2VQFQ

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqfQ00
3HOZH 4UP8A 5IP7H 4A3CH 3NENA 4IFDI 3ERSX 1QZHA 4GLXA 1IBLQ 2UXBL 2WB1E 1VQHA 4QJFA 4A3MG 5GAEC 3PSIA 4A3DH 4YCUA 3STBC 3E9IA 3T1YL 4X66L 3RLFA 1S40A 2R93G 4BA1I 2I5LX 4XTCS 3J80c 3A74A 4ALPA 2R6GA 5BR8Q 1OXUA 4GLAC 3I56A 3E0EA 1KRTA 4A75A 2HQLA 3CP0A 1YHQA 4YHHQ 2K5NA 2ATWA 1TWAH 2BA1A 4BY1H 3PV0A 4IFDJ 3CCJA 2OCEA 1WJJA 3TREA 1XPOA 1TWGH 3RLNA 1VQFA 4YWMA 3CC7A 3PO3H 1VQ4A 1KC8C 1XPRA 4JBWA 4BY7H 3H0GH 1YNXA 4DPGA 2YTXA 4DV3Q 1VQOA 2I0QA 2Z6KC 4HIKA 1TWFH 1BBWA 4GN5A 2F4VL 1J5EQ 4A3BH 5IP9G 4A3LG 5LMNL 2WB1G 4BA2I 2IY5B 1PH7A 1VQMA 4P73A 4YY3Q 1PH3A 1QUQB 1T9HA 3M4OH 3TRZA 4KHPL 1DGSA 1YI2A 4WJ4A 1D8LA 1EYGA 4JI3L 1BBUA 2ZTEA 1NTGA 4OONA 3DLLA 4GNXC 1X3GA 5C0XG 1K9MC 4MTNA 4UPAA 4B3RL 3HOWH 2OWOA 1X56A 2ZM6L 1JB7A 2UUAQ 2F4VQ 1Q86C 1V43A 4DR2L 4JI0L 3J81i 3G48A 1FJGL 3S1NH 3PUZA 2YU9H 4A3JH 1PH4A 4QL5A 3HOYG 1IXRA 4KHPQ 1N33L 1PA6A 1I50H 5AJ3Q 1OXSC 3KF6B 4KLKA 1XPUA 2C35B 4IOAA 1ASZA 4BY7G 1IYJB 3H0GG 4B3RQ 4LWCA 1H95A 1NY4A 2RCNA 1IBML 1B8AA 1VQ9A 1L1OC 4QQBX 1U5KA 4HIOA 5C3EH 3CCUA 1KD1C 4JI5Q 2UUCL 3GTKH 2PI2A 4DAMA 4A3BG 3GDEA 3KJPA 2YTYA 2WFWA 4IPDA 1GM5A 5M5YH 3CCRA 1QVFA 3M3YH 5M3FH 5E7NA 4GNXB 4P72A 3I55A 2FXQA 5M5XH 4DUZL 3K8AA 3BU2A 4P74A 5IWAL 4AQYL 3AYHB 4LFCQ 3RR5A 4JCVE 5GQOA 1IBMQ 1VQBA 2ZTDA 3VDYA 2JA8H 2CQOA 2N78A 3UDXA 4C2MH 2NVYH 1KRSA 5GAGC 4LUZA 4B3MQ 4A3JG 3AQQA 4GOPB 1HH2P 1D7QA 3H3VH 1Y1WH 2VW9A 2JK8A 2AMCB 2K52A 4TQUS 3KDFA 1YJNA 3FP9A 3J7ZC 1FL0A 2V1CC 1OXXK 2VY3A 4A3IH 1HR0W 4BBRH 1KXLA 4JI1L 1K3RA 5M5WH 4R4CA 5C3EG 3CC4A 1Y14B 5EAYA 3M4QA 2WAQE 1YHBA 4NXNL 4R1JA 3I4OA 2ASBA 4A3MH 1OXTA 3CF5A 1HNZL 2JA9A 4PZ8A 1FVIA 4P75A 1PH5A 3RN5A 4C3HH 2R93H 4B3SL 2IHFA 3OW2A 1L0WA 1TWHH 4OX9L 3M9BA 4DAYB 2KENA 3K7AH 2Y0SE 5IYBG 1A62A 4K0KL 2MNAA 3J7A5 4NXMQ 3HOVH 2QGQA 2E2JH 1B70B 1KAWA 4JBKA 4IJLA 4TVAB 4DR3L 1VQEA 4X62Q 2AWOA 3CW2C 1Q1BA 4B3TQ 1LUZA 1O7IA 3PUVA 2VUMH 5H1SE 5JJKA 2PNHA 3G6EA 4JV5L 4B3SQ 2JQOA 4JOIA 3NBHB 1HZAA 1TWCH 2VL6A 2GVBA 4DV4L 1XMQQ 2JEAI 1UE1A 4K0KQ 4BBRG 2AKWB 1EOVA 2H5XA 2WAQG 3U50C 3G4SA 3AFQA 5IP9H 1VCIA 1S72A 3GTPH 4A3LH 3JAMc 3PUYA 2E2IH 1YIJA 1YITA 4DV6L 1X54A 3S2HH 2UXCL 4OWXB 2OTJA 3CXCA 4O0AA 4BBSG 3GD7A 1G291 1E3PA 4LW1A 4L5QA 1XNRQ 3GTGH 2Q2UA 2Y0SG 1HNWL 3GO5A 1CKMA 2F52A 4PG3A 3AFPA 3UE0A 1EQRA 2KBNA 1JJCB 1M1KC 4MNOA 3I4MH 3HOVG 2A19A 3GTQH 1SLJA 2IHEA 3KJOA 4A76A 1PH9A 2UXBQ 1Q46A 5DLQE 3HOYH 4JYAL 1VS0A 2VUMG 4HJ8A 3T1YQ 4X66Q 5ELNA 2Q2HA 3RN2A 5IYDH 1EWIA 4OO1G 1YHAA 1WOCA 4R4OA 1HZ9A 3W5OA 1WI5A 2D0PA 5LMUL 2OTLA 4JI6L 1VQGA 3A5UA 3KOJA 4X65L 4WJ3M 1CKNB 3CCEA 2IX1A 4GKKL 1E1TA 1VQ8A 5JJLA 1VQ6A 2PQAB 1VQIA 1I5FA 2DUDA 1RL2A 1VQNA 3I7FA 1QZGA 2Q2TA 2EIFA 4JI4L 3CQZH 4LF5L 3UDIA 2VQEL 4LF6L 3I2ZA 1C7YA 4DR7L 4IJHA 5FLXc 1XNQL 2RF4A 4A3KG 4IO9A 4A93H 5IYCG 3I4MG 2OQKA 2CKZB 5IY0A 5LMNQ 3F1ZA 3G71A 1VQPA 2XGTA 1YBYA 4DK6C 3KF8B 1PFSA 1E7ZA 3U4VA 1SN8A 1E22A 4DKAC 1N32L 4JI3Q 2A1AA 4GN4B 4HJ9A 1YJWA 1NMGA 4DV1L 5IYDG 4LF8L 2R92H 3H3VI 3F8TA 1G6PA 2LSSA 4DUYL 3CC2A 1I6HH 1C0AA 2VNUD 1GKHA 2ZM6Q 4KHZA 1Z47A 2CWPA 2D62A 5IT9c 3KYHC 2QA4A 1BKBA 4POFA 4DR2Q 1W3SA 4JI0Q 1FJGQ 1M90C 1N8RC 3PO2H 1JJGA 1KHIA 1GO3E 2K50A 4A3EG 3S14H 1KL9A 4EQ5A 4R4QA 4HJAA 1VQLA 1N33Q 3TS0A 2IT1A 4J15A 4P71A 5HY6A 2Z0SA 1CUKA 2E5LL 2I5HA 4LF4L 4DV1Q 1KIXA 2VQFL 3ICEA 3EBEA 3E9HA 3PF5A 4DUYQ 3W1BA 4LFBL 4DR5L 3A5ZB 4DNIA 5IYBH 1XTDA 3PF4A 3ZJYC 4YWLA 1XMOL 1UE7A 4A93G 1EUJA 2UUCQ 2EQSA 2HHHL 1V9PA 5GAHC 1CSQA 4OWTB 4JI8L 2QEXA 1WCMH 1IL2A 1G51A 3A0JA 1K0RA 1XJVA 2K5HA 2E5LQ 2JA7G 2OQ0A 3MEFA 2ALYB 3NEMA 2B29A 2ZJRA 3S24A 4DUZQ 1IBKL 3J80i 4C3IH 4GKJL 5IWAQ 4AQYQ 1AH9A 1CKOA 5FLMG 4RMFA 3CCVA 1QUQA 1L1OB 3HKZE 4APVA 4OO1I 4PZ7A 3U58A 5K36G 4HIMA 1AE3A 1UWVA 3B6YA 3BZCA 1BVSA 1X6OA 3PO2G 3CCQA 2HHHQ 4DV2L 2B3GA 1B7YB 4JG2A 4JI8Q 3U4ZA 4DR4L 3EIVA 4JI2L 1IZ6A 4BBSH 1IBKQ 3LGJA 3PIOA 3F2CA 2VS1A 3D0FA 2UU9L 2UXDL 4JI1Q 4JBMA 3KF6A 5C0XI 5GROA 1P16A 1X55A 1SR3A 1K73C 2VZAA 2DGYA 2Z6KA 2JJQA 3FHWA 3L0OA 1YJ9A 4NXNQ 4DR6L 1PVOA 4JI2Q 4JBJA 1WCMG 1HNZQ 4UY8C 1MKHA 3S2DH 3S1MH 4AH6A 1N36L 3J81c 3HKZG 4DV7L 4EX5A 3S16H 4IPCA 4OX9Q 3CMEA 3MXNB 4JI7L 4GNXA 1NMFA 1SMXA 5C0XJ 3GTOH 1QVGA 3S15H 4A3FH 1NBWA 1YZ6A 3CPFA 3L2PA 1OTCA 3TS2A 1HR0L 1P8LA 3W1GA 4DR3Q 4DR1L 3J81j 1W2BA 2KCMA 4JV5Q 3FKIH 5J3BA 2BA0A 1VQAA 3K7UC 2NVXH 4GOPA 1QVCA 3F2DA 3HKSA 3KFUA 3CD6A 1HJPA 4DV4Q 4JI7Q 4YCVA 4GN3B 4A3KH 1SROA 1Z9FA 5IYCH 3HOUH 2RHQB 1PV4A 4RG1A 4MZ9A 2CWAA 1HR0Q 5BR8L 4DV6Q 2UXCQ 3OTOL 3HOXH 4YHHL 1K8AC 4HIDA 2NVTH 2GVAA 1VQ5A 4LFAL 1JT8A 5GADC 1HNWQ 2YTVA 2JA5G 2MQHA 1X65A 3UDFA 5IE8A 1UE6A 2R7FA 3PCOB 4UP9A 2PMZE 3K80C 4Y7NH 5FJ8G 4LF9L 1UEBA 4A3EH 4A3FG 3HFZB 4DV3L 4JYAQ 2GN5A 1HZCA 3OTOQ 4AIMA 3Q8DA 4LF7L 1J5EL 3OYYA 2LXJA 3CPWA 4LFAQ 1C9OA 1A0IA 1Q12A 3FKIG 3F2BA 3BZKA 4YY3L 1UE5A 2MFIA 2HT1A 1LYLA 3GTJH 2RHSB 1YEZA 3PUWA 3CMAA 5LMUQ 4HJ5A 1LTLA 4JI6Q 4L5TA 2I5MX 4X65Q 2ID0A 3HOUG 1TXYA 4R4TA 1U0LA 4NB3A 2HIXA 4LF9Q 4GKKQ 2JA6H 2KHIA 4OWWB 2R92G 2UUAL 1JMCA 4LF7Q 2JA7H 1YVCA 4XIGS 3PGZA 3HOXG 3HOZG 3KDFB 5IP7G 4A3CG 5C4JH 4LNQA 5JEAG 4JI4Q 4YCWA 2CCZA 4LF5Q 1Q7YC 1LM0A 3PIPA 3M4PA 4LUOA 2VQEQ 5FLMH 4A3DG 4JOIC 4LF6Q 4DR7Q 1VQKA 2JEBI 3ULJA 2K75A 1JE5A 5AJ3L 1XNQQ 2D0OA 2ZJQA 2L15A 4QY7A 1Q81C 3S1QH 4BXXH 3D31A 1PH6A 1HZBA 1EFWA 1K83H 1J6QA 2K5VA 1L2FA 2N49A 1Q8KA 1E24A 1NE3A 4ME3A 4DV0L 1SFOH 1MJCA 4JI5L 1PHJA 1N32Q 2R7ZH 2E8GA 4O2DA 4BY1G 1MJEA 4LF8Q 3TQYA 4DV5L 2HIVA 3TEHB 5C4XH 1EIFA 1PYSB 2LXKA 4PZ6A 2MO0A 4GS3A 4GOPC 3UE1A 2NZOA 2UUBL 1SE8A 1SRUA 3PO3G 2AHOB 3K81C 3BJUA 2KCTA 3UDGA 3JAMi 4YWKA 1ASYA 4UP7A 4LFCL 3JC66 2NN6G 1VQDA 4DV0Q 4Y52H 1GD7A 1WYDA 4A4IA 2JA6G 3K0XA 4JC0A 4IPHA 4IFDG 3SGIA 4X6AH 3IRBA 1FGUA 4IOCA 3I4NH 2WP8J 4AYBE 1A8VA 1CKNA 2JE6I 2XTIA 2K4KA 3PUXA 4B3ML 4LF4Q 3ER0A 2VQFQ 4DV5Q 1EQQA 1JJ2A 1V1QA 2PQAA 4A3GH 1GVPA 2K14A 3T1HL 2A8VA 4LFBQ 2CFMA 2Q2IA 1AE2A 4DR5Q 1VQ7A 2UUBQ 2YYZA 1X3FA 5C44H 3CCLA 4BXXG 3ULPA 1XMOQ 3DM3A 1Y1VH 5M3MH 3H15A 2NVQH 4QGUA 4GLVB 3HOWG 5ELOA 4R4IA 5JJIA 2R7ZG 4GKJQ 2B63H 1MIUA 5HGQA 1I94L 4L5SA 3EN2A 1S3OA 3STBD 3T1HQ 1I3QH 1VQJA 5C4XG 1X9NA 2R7DA 4KI0A 2BH2A 4QIWE 2F3IA 4PMWA 3S17H 3ULLA 1N9WA 2BH8A 4L5RC 3L7ZC 4DV2Q 2N3SA 1CSPA 1WFQA 1N34L 3M7NA 4FDBA 4DR4Q 4AYBG 2NZHA 4NXML 2PI2E 2YV5A 4OXPA 1HNXL 3I4NG 1PH8A 2KHJA 1I94Q 1PH2A 1KQSA 1EIYB 1PH1A 1Q1EA 2ZTCA 4A3GG 2IX0A 2UU9Q 4X62L 2JA5H 1K8GA 4DK3C 5M3FG 4B3TL 3KLWA 2UXDQ 1NJIC 1X3EA 5C44G 2N8NA 4X64L 1Y1VG 5M3MG 3RZDH 4HJ7A 5FJ8H 3RNUA 3M85A 1OXVA 1N34Q 2E2HH 2MO1A 1XMQL 4DR6Q 4LUVA 3S1RH 2JA8G 1HNXQ 3RZOH 4IPGA 4C3JH 2AWNA 1R9TH 1N36Q 2B63G 4DV7Q 1IBLL 3CAMA 1PYBA 1Y1WG 1Q82C 3GTLH 3CCSA 5JEAJ 1A63A 3NELA 2ZJPA 1E1OA 4X64Q 3WWVA 1XNRL 3GTMH 4NPSA 1VQCA 5LMNW 1RIPA 2ES2A 4A3IG 3RLOA 1L1OA 3AEVA 4H02A 4POGA 3CCMA 2EXDA 4DR1Q 2NN6I
chains in the Genus database with same CATH superfamily
5EKLA 2LKVA 1BCPB 1R4QB 1PRTB 4QJFA 4A3DH 2A69D 3HKZB 1PFBA 2K04A 3E9IA 4X66L 2RBMA 4BA1I 1BXTA 4BBRB 2I5LX 2QDBA 4GLAC 2A73B 2HQLA 5L37A 2EYHA 3T53B 4HCSA 1UUPA 2EYPA 3CCJA 2OCEA 4PV1C 3MXUA 5ELBA 2A6EC 3PO3H 1TWHB 2SNMA 3SR1A 4R8IA 1XPRA 4BY7H 2YTXA 4R8NA 2I0QA 1EQTA 3BYTB 2MHVA 2XSCA 2JYOA 5IP9G 2F0DA 4FF4A 2F0FA 2WB1G 3S2DB 2DN8A 4P73A 4YY3Q 1RTNA 3L3OC 3NTIA 3S16B 4JI3L 3DLLA 1NTGA 3JAME 1TIID 5A35A 4GNXC 4B3RL 1X56A 4FXDA 2F0QA 2AQ1B 4JI0L 1HUMA 4DR2L 4OEMB 4KHPQ 1I50H 1OXSC 2C35B 3H6MA 4BY7G 1MI2A 1NCVA 3NK9A 3GTQB 2AQ2B 1VQ9A 1LTTD 4QQBX 1U5KA 4HIOA 4JI5Q 4JVZA 4C1NI 3CCRA 3M3YH 2LMCB 1NUCA 4P72A 1IW7C 4P74A 5E4XA 1TKWB 4LFCQ 3QWNA 3BVGA 1SYEA 3NHHA 4Y7NB 1HQMC 2H4OA 4C2MH 5KIXA 2NVYH 1KRSA 5GAGC 4B3MQ 4DNRB 2H1EA 1Y1WH 1BF4A 5FO7B 1ICWA 1CZWA 2Z6BA 4A93B 4U68A 1WTQA 1JOOA 4CDCC 1Y14B 5C4JB 1D1IA 2KVMA 2JA9A 2D9UA 4B3SL 2EYJA 3OW2A 3IAYA 1K83B 2A68D 1RD9D 4H7BA 3NQTA 3J7A5 3HOVH 4JPBW 1SFOB 4C1NK 3C3LA 1IL8A 1C4QA 2AWOA 3CW2C 1RTOA 2XNAC 2K1BA 4B3TQ 2VUMH 5C4XB 2F0PA 2O5IC 3G6EA 4JV5L 1QOHA 3I4LA 3Q6SA 1UE1A 2JXMB 4G4KA 5FKAC 1HHVA 2KUMA 3U50C 3ZYYX 3PUYA 4K2LA 1LABA 4DV6L 1X54A 3GD7A 3C46A 4LW1A 5KRUA 1XNRQ 4RAUC 1FNWA 3GTGH 3GP7A 2Y0SG 1HNWL 4EQPA 3D4RA 3UE0A 1EQRA 1BNZA 4LK1C 3HOVG 5LL6X 2F0JA 4A76A 2ZXPA 3P7JA 1PH9A 1Q46A 5DLQE 3SHLA 4CKEA 2VUMG 4X66Q 3VA5A 5IYDH 2EJMA 2HUGA 1CQFA 1HZ9A 3R93A 1WI5A 3W5OA 2OTLA 3A5UA 3KOJA 1CKNB 4GKKL 5JJLA 1VQ6A 1VQIA 5COYA 1SNDA 4E6IA 1IYUA 2RKSA 3EFXD 3KLSA 2EIFA 3CQZH 4HMJA 4ILWA 3UDIA 3LNNA 4IJHA 4ZRZA 1GJXA 4A3FB 4IUPA 5IYCG 5IGGA 4KN7C 1HXYD 5IY0A 3FPPA 1PZID 3KF8B 3N52A 1E7ZA 3GTLB 1F2YA 1X3QA 4B9WA 4JI3Q 4HJ9A 3H3VI 3HS0C 5IYDG 3TN2A 2PO4A 2EPBA 4DFAA 4M1UB 4DUYL 4X3SA 5C4HA 2CWPA 1U4RA 5JJZA 2KCNA 3KYHC 4DR2Q 4JI0Q 2VB3X 1M90C 1QILA 2K50A 1GO3E 4K8IA 3HOZB 4A3EG 3T4AC 4J15A 1D5MC 1O78A 4LF4L 1STYA 3PF5A 3OWEB 4DR5L 3A5ZB 5IYBH 3PF4A 5FOBB 2A6HC 4FF2A 3TZDA 1V9PA 2R3ZA 1M4VA 4ZAIA 4OWTB 4BY1B 4MIUA 3A0JA 1FR3A 1K0RA 2K5HA 2E5LQ 2ZJRA 3A8JE 1F2ZA 4X3UA 5I2XA 1X3PA 2OF1A 3CCVA 3MXGA 1H9JA 4APVA 2JA6B 1X6OA 1GHJA 3NQIA 4JI8Q 2K7VA 1A3VA 2VXWA 4JI2L 1IZ6A 1SYGA 1W6JA 1IBKQ 4K6LA 3PIOA 3F2CA 3TBIB 2WINB 2UXDL 4NKLA 5C3WA 5C0XI 3DHQA 2KEDA 5IT9L 5DEHA 4RA8A 2V4DA 3S2DH 4ABNA 3H3VC 2AUJD 3HKZG 3S16H 1PRTC 3CMEA 2E2DC 5CV5A 4OGQC 1QVGA 1O7ZA 2DJFC 3FDTA 3TS2A 1IKLA 1DOMA 1P8LA 4OIKA 5I2YA 3J81j 1V1PB 2KCMA 1W2BA 5M5YB 4JV5Q 1T5EA 2BA0A 1QVCA 2D5DA 3CD6A 3OWFA 1A3TA 5G3LD 1A6XA 1GHKA 1HR0Q 5BR8L 4ZCKA 2KA7A 4DV6Q 1K8OA 4DF7A 2DY7A 2DNEA 3HOXH 5JEAH 3NWTA 4FXKC 1VQ5A 4LFAL 3NTHA 1HNWQ 3TP7A 5E4WC 4KTAA 3MC0B 2A68C 3K80C 4Y7NH 5IOCA 1TU2B 3CRKC 2GN5A 5IGBA 3MWYW 4AIMA 1F9SA 4RGMA 1JWMD 4QUCA 1FNVA 1RF2D 2MFIA 1BO0A 2Z8LA 4FXGC 1JWUD 2KJXA 4L5TA 3K7AB 4R4TA 4GKKQ 4NB3A 2F0VA 3RZOB 2E2JB 4IFDH 3SVMA 4OWWB 1FD7D 1JMCA 1YVCA 4XIGS 3HOXG 2EZVA 5C4JH 5JEAG 1Q7YC 3PIPA 4JOIC 1IYVA 3ULJA 4BXXH 2D0OA 2ZJQA 2L15A 3OSOA 1Q81C 5K36H 2J4XA 1K83H 3LX0A 5EJWA 1KDCA 2EDGA 4KMUC 5BN3A 2WB1B 1SFOH 5IGFA 1PHJA 3S2HB 1PZJD 2E8GA 4O2DA 3AU7A 2HIVA 3TEHB 5C4XH 2LXKA 4K2KA 2MO0A 1UEAB 4F7XA 4KD3A 1WTXA 2EYOA 2B39A 4CJ0B 2F0HA 1VQDA 1SNPA 4Y52H 1GUWA 4IFDG 2Z9HA 3GV6A 4XQJA 1JE4A 3SGIA 2EY6A 4Z9CB 1FGUA 1CKNA 4LF4Q 5CBAE 2K4KA 3PUXA 5K5PA 2K14A 1S5CD 4DR5Q 1D6EC 4BY7B 1Z7TA 2YYZA 4BXXG 4J6HA 4K8JA 3EJIA 2NVQH 3A55A 1U9RA 4QGUA 1PTOD 1LV9A 1A3UA 3HOWG 3A8IE 3O13A 3U9OA 2EYFA 1VDZA 1Q3LA 2ICIA 1MIUA 1NR4A 1S3OA 4F88A 3T1HQ 1I3QH 5C4XG 1X9NA 1AP0A 4KI0A 3E6ZX 1EU4A 5CMDA 5D3IB 2Z4IA 4RCOA 4L5RC 3FMCA 1QWYA 4AYBG 2B2YA 1PTOF 4NXML 2YV5A 4OXPA 1CA6A 4J1MA 3DEPA 1PH1A 5ISRA 2A6ED 2X69A 2UXDQ 3KLWA 4XQQA 1I6HB 4X64L 2IWHA 3A7LA 2MO1A 4PMBA 4LUVA 2K05A 2F3VA 4C3JH 1Y69U 3CAMA 1SE4A 1PYBA 3GTLH 3A7AB 5JEAJ 3NELA 3MHBA 1F9RA 1VQCA 5LMNW 1RIPA 3E0JA 4C2MB 3AEVA 4H02A 1YNJC 4POGA 2EXDA 1KLGD 2NN6I 3HOZH 4A3CH 1B2TA 3NENA 4I65A 2B8GA 4GLXA 1IBLQ 2WB1E 5GAEC 3STBC 3Q23A 3QOJA 3T1YL 3RLFA 5CV7A 1A2UA 1GUTA 3E3XA 3SK8A 3J80c 5BR8Q 4A75A 2DNCA 3E0EA 1SNQA 5KNDA 2ATWA 1TWAH 4CDEC 4C3JG 4BY1H 3PV0A 1STBA 4IFDJ 2KECA 2G5DA 1WJJA 4DXGA 1NR2A 1VQFA 4YWMA 1LT6D 1KC8C 4JBWA 2NN6H 3HOVB 2Z6KC 4HIKA 1BBWA 2K33A 4J8QA 2B2YC 5EBCA 4A3BH 4Q0FA 2VUMB 4BA2I 1PH7A 1VQMA 3TRZA 1T9HA 4KHPL 3BDLA 4R9WA 1YI2A 1D8LA 1JWSD 1V1PA 4IUNA 1BBUA 3EA6A 2NUCA 3I3CA 3OHXC 2E75C 1JB7A 3C1EA 1WD1A 3DWQA 1Q86C 2F4VQ 1EQVA 4ZLTF 3PUZA 3A54A 5IGCA 1KABA 3HOYG 2E76C 1N33L 3GTGB 3KF6B 4KLKA 1PDQA 1ASZA 2MP1A 1HRJA 4LWCA 1LTAD 2RCNA 2FJ2A 3CCUA 4A3BG 2BE5C 1O80A 5CV9A 2YTYA 2WFWA 4IPDA 5M5YH 1ESRA 3I55A 1GUOA 1ET6A 1WVLA 2Q8IB 5IWAL 3AYHB 4N8FA 4XT1B 1IBMQ 3VR4A 1VQBA 3VDYA 4A3EB 1DJRD 5A2QE 5FLXE 3AQQA 1HH2P 3CQZB 2K52A 2O2LD 1EYCA 2FMMA 4CGYB 4WRDA 3FP9A 4IUUA 4HSVA 1ZYRC 1K3RA 3NE5B 4X3TA 2B2TC 4N8X1 1U4MA 3M4QA 1YHBA 3CRLC 3I4OA 3CF5A 1Y8PB 4BS9A 4P75A 3RN5A 4C3HH 2F0LA 2M00A 1L0WA 4OX9L 3M9BA 4DAYB 2KENA 3K7AH 2Y0SE 1A62A 4NXMQ 2QGQA 2E2JH 2BDNA 1EYAA 1KAWA 2R7ZB 4TVAB 2PPBC 1H9MA 5JJKA 1LUZA 1O7IA 5H1SE 3NBHB 1HZAA 4FYDA 1TWCH 2EJGC 1BQQT 3HRZC 1SMYC 1MSGA 5IP9H 1S72A 1VCIA 1OO9B 3JAMc 4ZKBB 3S2HH 4OWXB 3CXCA 4LJZC 4BBSG 3MVVA 3NP8A 5DM73 1G291 1E3PA 2NYZD 4L5QA 4C3HG 5LHY1 5C44B 2Q2UA 4CDFC 4KY5A 5C3XA 2EY1A 3X3MA 1LT3D 2K32A 1A15A 3ND9A 1VS0A 1EZ6A 5I4DA 1CK1A 4RGNA 3T1YQ 4V190 1E2VA 2CVRA 1EWIA 1O7YA 4XT3B 1YHAA 4R4OA 3L9AX 3VYRA 5LMUL 2A6HD 1IHZA 1WTHA 2L4NA 4X65L 1ET9A 5T1IA 3CCEA 2C9OA 2DUDA 1RL2A 2IPKD 1RDPD 1QJOA 5I6WA 1PXUA 4DR7L 3NTKA 1QE6A 1K28A 3S1RB 4QB4A 4LMQD 2CKZB 1VQPA 4RCNA 3W3AA 1PFSA 3EVQA 3U4VA 3F2UA 2Q8TA 1N32L 2SDFA 2A1AA 1NSNS 2LSSA 4I7AA 3GTMB 1I6HH 3QO2A 4KHZA 3K5MA 2D62A 3VA7A 2GA4B 2QA4A 5HURA 1BKBA 4POFA 1B44D 1KHIA 4G7ZC 5EPLA 4QMGA 5I9OA 3HOXB 1HA6A 2F0NA 1KL9A 4G7OC 4EQ5A 2PW7A 4R4QA 1N33Q 2BCOA 3URYA 4P71A 5M9OA 2E5LL 1BCPD 2AUKA 5CV6A 1PRTD 3ICEA 3E9HA 1QCBD 1SSOA 2RQXA 4DNIA 1CTMA 3ZJYC 4YWLA 2F0GA 1RODA 1F9PA 4JI8L 2QEXA 3DUZA 4XQNA 1IL2A 1GXDC 2JA7G 1VF7A 3NEMA 1KTKA 3KLSX 3UI2A 1D5ZC 1ZEQX 3S24A 1IBKL 4GKJL 1AH9A 5IWAQ 1BCPF 5FLMG 4KY6A 1L1OB 1SXTA 3HKZE 1PRTF 2IX3A 1AE3A 1UWVA 1BVSA 1BDOA 2HHHQ 5TSSA 1B7YB 4JG2A 1E0BA 1ILQA 3TZUA 2BDOA 2F0TA 3LGJA 1KNEA 4G57A 3D0FA 1XX8A 1STAA 3KF6A 4ME5A 4K14A 4BWGB 3HOWB 1J8IA 1FNUA 1SR3A 5KNCA 2VZAA 1YJ9A 1PVOA 2YU9B 1MKHA 4AH6A 1N36L 3N6RA 4CBVA 2XIWA 3J81c 1GUGA 4EX5A 4RH6A 4IPCA 4OX9Q 1DOLA 3MXNB 2XVSA 4Q5VA 2WIIB 4AYBB 3SE0A 2RDGA 3P1HA 1LTSD 1JB3A 1YZ6A 5C3EB 1STHA 2QKIC 1LTRD 2QDLA 1HR0L 1SAPA 4DR1L 4DU9A 3J7YW 1VQAA 5M5XB 3KFUA 4ZUJA 2J7ZA 3BVZA 2NVQB 4YCVA 2DJGC 4GN3B 5IYCH 1SYFA 2RHQB 2N88A 2CWAA 3BS1A 3KUPA 2JN4A 1K8AC 1I3QB 1F9QA 1JT8A 4IUQA 5JAVA 1XXGA 1LTGD 4WJWA 3UDFA 3DMUA 1UE6A 4CHTB 3J81E 1LT5D 4KJOA 5FJ8G 2B2WA 2MGSA 5D3DA 1UEBA 2WAQB 4A3EH 1EIHA 4DAYA 2HDMA 4ULLA 3OTOQ 1EOTA 1EL0A 4WORA 3BZKA 2HT1A 1UE5A 5EGTA 1YEZA 3PUWA 5LMUQ 4HJ5A 1JC7A 1LTLA 4X65Q 4JW0A 1EY4A 3NBHA 4LF9Q 3M7GA 2HIXA 4RHSA 4C3JB 5J22A 2R92G 3PGZA 3TP6A 1PFNA 3KDFB 5IP7G 1WTWA 4YCWA 2CCZA 3DXJC 4DR7Q 2JEBI 5AJ3L 4KKSA 3D31A 1EFWA 1J6QA 2B2VA 2K5VA 1L2FA 2KQ3A 2N49A 1E24A 3K6OA 2OT2A 5KNBA 4ME3A 1MJCA 2E2IB 1N32Q 1EWHA 2R7ZH 2RSNA 2FMCA 5JVG3 2LY7A 1J9OA 1EIFA 4H0LC 3DWAA 1MBYA 2AHOB 3BJUA 2KCTA 3R3OA 4ZK9B 2C5CA 1BUVT 1TWAB 1XYIA 2WV6D 1SJED 4FO2A 3HOYB 4IOCA 4RHRA 4AYBE 4DA2A 5JVH3 1V1QA 1GVPA 2A8VA 1GOZA 3I91A 3T1HL 2Q8RE 2CFMA 2KCCA 5CC4A 1S5BD 1X3FA 5C44H 4L8JA 3ULPA 3DM3A 3MA2B 1E2ZA 1AW7A 4DN4M 1QG7A 5CR3A 1YNJD 4GLVB 2B2WC 4A3BB 5ELOA 4R4IA 5JJIA 2NB0A 2FFKB 2B63H 2R7ZG 4GKJQ 4QCLA 5D65A 3EN2A 3STBD 2R7DA 4PMWA 4TKOB 2BH8A 3L7ZC 1SNOA 4FDBA 2PI2E 1PH8A 2SEBD 2KHJA 3SXHA 1KQSA 1BCPC 1EY5A 4DK3C 5M3FG 1NJIC 1X3EA 5C44G 1HFNA 3RZDH 3W2DA 2HQEA 1Z6HA 3M85A 3RNUA 2B2VC 1XMQL 3S1RH 2JA8G 4GZYC 1I4XA 4IPGA 1B1ZA 2RA4A 1N36Q 1DONA 2B63G 4CKBA 5FO9B 1IBLL 1II3A 1E1OA 3T13A 3WWVA 3GTMH 5C6AA 4IURA 4A3IG 1L1OA 4DR1Q 4P2CB 4IFDI 1PMRA 4A3MG 3PSIA 4YCUA 1R4PB 2R93G 1S40A 3OIPA 5KEEA 3V2TA 3A74A 4ALPA 2R61A 3CP0A 2BE5D 2K5NA 4IN3A 4NP5A 4BBSB 3TREA 2PW5A 3QB3A 1XPOA 1TWGH 4C3HB 3CC7A 1CM9A 1VQ4A 2K5DA 4HEDA 5IGEA 4IALA 1YNXA 4DPGA 1TWFH 1FYCA 1MHWC 3AB9A 3MXNA 2F4VL 4A3LG 5LMNL 2KHSA 2E74C 1TT2A 1PH3A 3SK4A 4DAVA 1LTBD 1TWCB 4OONA 2HD3A 1X3GA 5BN4A 5C0XG 1ZYRD 2F0SA 4MTNA 4ZQ3A 1K9MC 5C5LA 3GTOB 3HOWH 2OWOA 2ZM6L 3S15B 5F2DA 1BBXC 1V43A 1FJGL 3S1NH 5DNFA 3G48A 2YU9H 4A3JH 2KEEA 1PH4A 1CI3M 5EQ0A 1IXRA 2XN9C 3FKIB 1B50A 2NVXB 1B3QA 1PA6A 5AJ3Q 1H9RA 3AMUA 1IYJB 1H95A 1DM0B 1IBML 1L1OC 3J80L 1AZQA 5C3EH 1KD1C 5JOBA 2PI2A 3PIO3 4NW2A 1D2BA 3Q22A 4GNXB 2FXQA 5M5XH 3VR2A 4AQYL 4HSPA 3RR5A 4JCVE 2NBFA 5GQOA 1SMYD 3K57A 2ZTDA 3VR6A 3RMHA 2Z1CA 4LUZA 2F0EA 4A3JG 1D7QA 2WKDA 3KF8A 3OMGA 4TQUS 2F0WA 3KDFA 3GTJB 2QF7A 3BDCA 4ZYSA 2V1CC 1KXLA 2A5HA 3IFDA 5A2QL 2F4IA 4OIJA 4R4CA 5C3EG 2PZTA 5EPKA 5IODA 2JA7B 2ASBA 1PYWD 3BZDB 4R1JA 5CBEE 1HNZL 1WD0A 1B4OA 1FVIA 1B9NA 3S1QB 4C56C 2MNAA 4RGOS 1QB5D 4JBKA 1DCZA 4IJLA 4DR3L 3SDZA 4IUTA 1Q1BA 3PUVA 2XWJB 4OO1H 3T16A 2JQOA 4C3IG 2VL6A 3CU7A 2GVBA 1Y8OB 4DV4L 1XMQQ 4DK1A 2JEAI 4K0KQ 2NTSA 1EOVA 2H5XA 2O4XA 2WAQG 1AEXA 2E2IH 1YIJA 1YITA 2UXCL 2L0CA 3VR3A 3CKIB 5CV4A 4DXFA 2M9VA 1E2WA 5M3MB 1EEFD 2F52A 4KY7A 3AFPA 3GV3A 4RGTA 1M1KC 1JJCB 3KBXA 4MNOA 3NWSA 4ODGA 3I4MH 4RKLA 1STEA 1SLJA 2IHEA 3I8ZA 3KJOA 1RKNA 3HOYH 1PZKD 4ZUIA 4HJ8A 2ICEC 1EZ8A 3MTSA 3I73A 2Q2HA 3RN2A 4OO1G 3S17B 4K5XA 2D0PA 4JI6L 1VQGA 3HEJA 3MFGA 4EQOA 4WJ3M 1E1TA 4H44C 3D6CA 3I7FA 2Q2TA 4CJ1B 4JI4L 2D2CC 4OHJA 4LF6L 3I2ZA 1C7YA 5KGUA 5FLXc 3DEOA 4A3KG 4IO9A 2B2UA 3Q24A 3A56A 3I4MG 2OQKA 5LMNQ 3G71A 4K5WA 1YBYA 1C48A 3JAML 1E22A 3C1FA 2L5TA 4GN4B 1NMGA 3F8TA 4TRDA 1CA5A 3CC2A 1GKHA 2ZM6Q 3S9WA 3NXWA 4OELB 1FJGQ 3PO2H 1W3SA 1JJGA 2R92B 4KV6A 2SNSA 1UNSA 4HJAA 1VQLA 2J0TD 1TY0A 1H9KA 3NUCA 2Z0SA 2EYMA 4DV1Q 1FGBD 2VQFL 1KIXA 1YNNC 3X3NA 3TDQA 3P75A 1VF5C 3VYSA 3HP3A 1S4ZA 2PQEA 1UE7A 1EY6A 2EQSA 2HHHL 2Z4HA 1CSQA 1STNA 3CHBD 2B8FA 1XJVA 2OQ0A 4S3SA 2B29A 1XWEA 4DGZA 3J80i 4AQYQ 1XTCD 4K5VA 1TY2A 1G2TA 3PO2G 2IW3A 4LAAA 3CCQA 4DV2L 2B3GA 4KD4A 3U4ZA 4DR4L 2EYLA 4BBSH 3M4OB 1TR5A 2L9HA 2VS1A 2UU9L 2F03A 5E3FA 4JBMA 5GROA 3SK5A 1P16A 3RD4A 1G8ZD 1K73C 2JJQA 2DGYA 3FHWA 3KK7A 4DR6L 2O5JC 3TP8A 2QW7A 2NZ1D 3D4DA 3D8GA 1HNZQ 1STGA 4UY8C 2G9DA 1VMPA 2F0KA 2I46A 3KBGA 3FVQA 4XDXA 1C8CA 4GNXA 1NMFA 3GTOH 2PYKA 3S15H 1EFID 1NBWA 3GTKB 1B9MA 4JK1C 4DR3Q 1AZPA 1CFMA 5M3FB 3FKIH 2EOTA 1CT1D 5J3BA 3QIAA 2NVXH 3F2DA 1S5DD 1LLRD 5LL6S 3PMFA 4DV4Q 4KHVA 4CJ2C 4JI7Q 1Z9FA 1SBBB 2JA8B 1PV4A 4RG1A 3BG3A 1CHPD 2UXCQ 2B63B 3OTOL 4YHHL 5ELEA 4HIDA 3DWPA 2GVAA 1HA5A 2YTVA 2JA5G 2MQHA 1X65A 5IE8A 1QNUA 4UP9A 4A3IB 3A8KE 3QJYA 5M5WB 3QR8A 4LF9L 3HFZB 4DV3L 2EXZA 3I90A 3VYUA 1J5EL 3J7AF 3OYYA 4A3MB 2P5ZX 1A0IA 3FKIG 4RKBA 4U673 2R93B 1LYLA 3GTJH 2K28A 3J81L 3RZDB 4JI6Q 1ZKOA 1RHPA 1TVXA 2I5MX 1V8QA 1TXYA 2MUYA 1LTID 2KHIA 2UUAL 4KKUA 4LF7Q 2JA7H 1EU3A 4JI4Q 5EBDA 3K5OA 5FLMH 4F87A 4A3DG 1EY8A 4LF6Q 1RCVD 3TMEA 3S1QH 4PQXA 1PH6A 1HZBA 1H9SB 4B08A 1B53A 1BOSA 1Q8KA 3GTPB 1CQVA 1HUNA 1TS5A 3R2IA 3HG9A 2FHTA 3H94A 1PYSB 4QUFA 4GS3A 4PNYA 2X6GA 3UE1A 3PO3G 3K81C 3JAMi 2RSOA 4YWKA 4I7ZC 3JC66 4HTHA 3NBIA 3WOEA 1TS3A 1WYDA 4DV0Q 4JC0A 4IPHA 5T1GA 3IRBA 1S5FD 2PNRC 2IL8A 1SE2A 1TWGB 3FRPB 1JJ2A 2VQFQ 4DV5Q 1KDBA 4A3GH 1G2SA 2Q2IA 1AE2A 2OEOA 2WKCA 4HAEA 1VQ7A 3MFYA 2UUBQ 1F2LA 1Y1VH 5M3MH 1BR9A 1TWFB 4H13C 2EE1A 4FVMA 4K6DA 1DOKA 5HGQA 4L5SA 3OPOA 3S17H 3ULLA 2CW0C 4DV2Q 2RDHA 2N3SA 1CSPA 1WFQA 3S1NB 3M7NA 1F77A 4UDUC 5CYUA 4A3JB 4DR4Q 3K58A 2NZHA 1O7LA 3BDOA 3VR5A 1I94Q 4CDDC 1PH2A 1EIYB 4A3GG 2IX0A 2UU9Q 4X62L 1K8GA 2N55A 3G6JB 5J1ZA 1SEBD 4FP5D 1Y1VG 5M3MG 3I72A 4HJ7A 5FJ8H 5JPMC 1N34Q 4DR6Q 2QEJC 3S14B 3HZXA 1KAAA 1HNXQ 3K5NA 1Y1WG 4KK7A 1Q82C 4N9TA 2ZT9C 1A63A 3VYTA 4NPSA 5AFWA 4MN3A 1JORA 1MGSA 2R92H 3QOLA 5BN5A 1EEID 3H09A 1A2TA 4UP8A 4B9XA 1WCMB 5IP7H 1MSHA 3QG1A 3ERSX 4XYQA 1QZHA 2UXBL 3ONAB 1VQHA 4C3IB 5IGDA 5EKKA 5HGTA 2F3WA 1D5XC 1AFPA 1ZXTA 4XTCS 5CGKA 2R6GA 3I56A 1OXUA 1KRTA 3OMCA 1YHQA 3FEWX 1X32A 4YHHQ 2BA1A 4O1NA 4TSSA 1I4GA 1B3AA 3RLNA 1KNAA 5FK9C 3H0GH 5I9PA 4NDXA 4DV3Q 1VQOA 4GN5A 1J5EQ 1RJTA 3IFTA 2IY5B 3D6WA 3M4OH 4V0BA 3S1MB 1QUQB 2XRQD 3GQBA 2F0UA 1DGSA 3FPUB 1TQOA 4WJ4A 1EYGA 3K0YA 2ZTEA 1L0XB 4UPAA 2QCPX 5C4ZA 1K0SA 2UUAQ 5EPJA 3J81i 3SEBA 4QL5A 3WOFA 5DAUA 1HPCA 1XPUA 1UAPA 2A69C 4IOAA 4A3KB 1EY9A 3H0GG 4B3RQ 3HOUB 3I4MB 1NY4A 1B8AA 4N9PA 5CV8A 3GTKH 2UUCL 4DAMA 3GDEA 3KJPA 1LO5D 3SK6A 1GM5A 2NVTB 3T51B 1QVFA 5M3FH 5E7NA 5J39A 4DUZL 3K8AA 3BU2A 1HQRD 3BYYB 3OIQA 3EROA 2JA8H 2CQOA 2N78A 3D4WA 1TS4A 4OL7A 5ELDA 3UDXA 4GOPB 3H3VH 2VW9A 2JK8A 2AMCB 1YJNA 1EY7A 3J7ZC 2M2LA 1FL0A 1OXXK 2TSSA 2VY3A 4A3IH 4BBRH 1HR0W 4JI1L 5M5WH 1I4PA 2RDFA 3CC4A 1Q8IA 5EAYA 3TSSA 4FF3A 1H9SA 2WAQE 4NXNL 4A3MH 1OXTA 4PZ8A 2R93H 3E5SA 1PH5A 1S5ED 3KLRA 2L1BA 2IHFA 1TWHH 3P20A 2SOBA 1HCZA 2L55A 3PO2B 5IYBG 4M8AA 2K5WA 4K0KL 2HDLA 2XWBB 1B70B 1GUSA 2CH4W 1VQEA 4QF4A 4X62Q 2NTTA 5NUCA 2PNHA 2ZXRA 4B3SQ 4XXEA 4JOIA 1SNCA 3OW7A 4BBRG 2AKWB 5IIFA 3G4SA 1D1KA 3AFQA 1SYBA 3GTPH 4A3LH 3I4NB 4F8MA 2EVBA 2OTJA 4O0AA 1JOQA 2HCCA 1HTPA 5C0XH 3IL8A 1KDAA 1WTRA 3GO5A 1CKMA 3R2TA 4PG3A 2KBNA 2CHBD 2L12A 2A19A 3GTQH 2X6LA 1WTVA 2TMPA 2UXBQ 2HCIA 4KN4C 4JYAL 1F2MA 3BVMA 3MAQA 1YNND 5ELNA 2AQ3B 2EY5A 1PTOB 1WOCA 5G3LF 4FF1A 2IX1A 1VQ8A 2PQAB 1VQNA 1I5FA 2MPMA 4WFN3 1QZGA 3MZ5A 4CKCA 2JA5B 4KKTA 4LF5L 1JQYD 3D3RA 3MEHA 2VQEL 2K03A 2PZUA 5JPNC 3NPPA 1XNQL 1HTLD 2RF4A 4A93H 2E2HB 1JICA 1ONLA 3F1ZA 2XGTA 4DK6C 1DZ1A 1R9TB 1SN8A 1EWCA 4DKAC 2LS01 1YJWA 2CQAA 2WACA 4UHVA 4DV1L 4LF8L 1G6PA 3IKJA 1ILPA 2VNUD 1C0AA 4EGVA 4RFBA 4EVOA 1Z47A 1SJHD 5IT9c 1CZGA 1JR0D 2RCFA 3ITPA 1N8RC 3HGBA 3ND8A 3S14H 3TS0A 2IT1A 5HY6A 1CUKA 4A3DB 2I5HA 4MHEA 2DY8A 2PMZB 3EBEA 4DAPA 5CORA 4DUYQ 3W1BA 4LFBL 4DK0A 1I6VC 1XTDA 1XMOL 3T56B 4A93G 1EUJA 4L6TB 2UUCQ 2MJ8A 5GAHC 1WCMH 1G51A 5DM63 3MEFA 2ALYB 1GUNA 4DUZQ 4C3IH 1ENFA 3PQIA 3PO3B 1CKOA 5C5MA 4RMFA 5EKIA 1QUQA 1T5XD 4OO1I 1I4QA 1I4HA 4PZ7A 3U58A 5FLXL 4HIMA 5K36G 2F0IA 3B6YA 3BZCA 5KYLA 3TP5A 3EIVA 3RUZA 1SNMA 5IT9E 1U4LA 1SYDA 1V1OA 1PLFA 3R8BA 3LWUA 4JI1Q 3LWEA 1X55A 2JSOA 2CH4A 2OXPA 3Q0AA 1EY0A 2Z6KA 3L0OA 2F0MA 4NXNQ 2JP1A 4JI2Q 1TS2A 1WCMG 2KOLA 4JBJA 5KYIA 3S1MH 1I50B 1WTPA 1JCKB 4DV7L 3MXPA 2PCFB 4YIJA 4JI7L 1SMXA 1QNKA 2G9HD 4HR7B 5C0XJ 1DXMA 4IZ8A 4PMCA 4A3FH 3CPFA 3L2PA 1OTCA 3W1GA 4A3GB 3M3YB 1I4RA 3K7UC 2A74C 4GOPA 4X3KA 5ELFA 3HKSA 1Y1VB 1HJPA 3C2PA 4A3KH 1SROA 3HOUH 4RWSC 2ZXOA 4MZ9A 2NVYB 3PIP3 2K5QA 1AN8A 4QIWB 2ENBA 1Y1WB 2NVTH 1Y8NB 1NNXA 2EJFC 5GADC 2I07B 3ERQA 4ID6A 4MTKA 2R7FA 1IKMA 3PCOB 2K01A 2PMZE 1LACA 4A3FG 4JYAQ 1HZCA 1EIGA 3Q8DA 4LF7L 2LXJA 3CPWA 4LFAQ 1C9OA 1Q12A 3F2BA 1HFGA 5ELCA 3K59A 2XRSD 4UAIA 4YY3L 2RHSB 1IW7D 3U9SA 2Y0SB 3CMAA 3H91A 1PFMA 2K6AA 1SYCA 1G91A 2ID0A 3HOUG 1U0LA 2JA6H 2B2TA 3G7LA 3HOZG 4HN7A 4A3CG 1DD2A 4LNQA 1ENCA 4LF5Q 1LM0A 3M4PA 4LUOA 4NMZA 2VQEQ 1VQKA 4EQNA 2K75A 1JE5A 2CW0D 3V05A 1XNQQ 4QY7A 1ESFA 2F0OA 4HCEA 2LFNA 1NE3A 4DV0L 1ML0D 4G7HC 1SE3A 3I70A 4JI5L 3NSWA 1MJEA 4BY1G 3J80E 4LF8Q 3TQYA 1KLUD 2VB2X 1W6KA 4DV5L 2BOSA 3OOCA 4PZ6A 4GOPC 1K8MA 2NZOA 1SE8A 1SRUA 2UUBL 3UDGA 3M4YA 1MD2D 1ASYA 4UP7A 4LFCL 4XYOA 2NN6G 4KJNA 4L63B 4IQZA 1GD7A 4A4IA 2JA6G 3K0XA 1Q90A 4X6AH 3I4NH 2WP8J 1A8VA 2JE6I 2XTIA 4B3ML 3ER0A 1SDFA 1EQQA 2PQAA 4LFBQ 5FO8B 3EQLC 3H0GB 3CCLA 4FNFA 1XMOQ 3DM1A 3H15A 1NAPA 1G6ZA 1U4PA 4HMIA 1I94L 4DNTB 1VQJA 1WTOA 3K5LA 2BH2A 4QIWE 2F3IA 1ICFB 1M8AA 3J7AV 1N9WA 1PTOH 2RVLA 2IJ0A 2B2UC 3V96A 1N34L 2QILA 4ZKCB 2PZWA 1HNXL 3I4NG 5I6YA 4IUVA 1Q1EA 3WDNA 1EYDA 2ZTCA 4O42A 2JA5H 4B3TL 2L11A 2N8NA 1OXVA 2E2HH 1CHQD 2F1MA 1L0YB 5E1FA 3RZOH 2EY2A 2AWNA 1R9TH 1ENAA 4DV7Q 2NWGA 5D14A 2FINB 3CCSA 2ZJPA 1VMCA 4X64Q 1XNRL 1LT4D 2ES2A 3RLOA 1JOKA 1PTOC 1DYQA 3CCMA 1K3BC
chains in the Genus database with same CATH topology
3HOZH 4UP8A 5IP7H 4A3CH 3NENA 4IFDI 3ERSX 1QZHA 4GLXA 1IBLQ 2UXBL 2WB1E 1VQHA 4QJFA 4A3MG 5GAEC 3PSIA 4A3DH 4YCUA 3STBC 3E9IA 3T1YL 4X66L 3RLFA 1S40A 2R93G 4BA1I 2I5LX 4XTCS 3J80c 3A74A 4ALPA 2R6GA 5BR8Q 1OXUA 4GLAC 3I56A 3E0EA 1KRTA 4A75A 2HQLA 3CP0A 1YHQA 4YHHQ 2K5NA 2ATWA 1TWAH 2BA1A 4BY1H 3PV0A 4IFDJ 3CCJA 2OCEA 1WJJA 3TREA 1XPOA 1TWGH 3RLNA 1VQFA 4YWMA 3CC7A 3PO3H 1VQ4A 1KC8C 1XPRA 4JBWA 4BY7H 3H0GH 1YNXA 4DPGA 2YTXA 4DV3Q 1VQOA 2I0QA 2Z6KC 4HIKA 1TWFH 1BBWA 4GN5A 2F4VL 1J5EQ 4A3BH 5IP9G 4A3LG 5LMNL 2WB1G 4BA2I 2IY5B 1PH7A 1VQMA 4P73A 4YY3Q 1PH3A 1QUQB 1T9HA 3M4OH 3TRZA 4KHPL 1DGSA 1YI2A 4WJ4A 1D8LA 1EYGA 4JI3L 1BBUA 2ZTEA 1NTGA 4OONA 3DLLA 4GNXC 1X3GA 5C0XG 1K9MC 4MTNA 4UPAA 4B3RL 3HOWH 2OWOA 1X56A 2ZM6L 1JB7A 2UUAQ 2F4VQ 1Q86C 1V43A 4DR2L 4JI0L 3J81i 3G48A 1FJGL 3S1NH 3PUZA 2YU9H 4A3JH 1PH4A 4QL5A 3HOYG 1IXRA 4KHPQ 1N33L 1PA6A 1I50H 5AJ3Q 1OXSC 3KF6B 4KLKA 1XPUA 2C35B 4IOAA 1ASZA 4BY7G 1IYJB 3H0GG 4B3RQ 4LWCA 1H95A 1NY4A 2RCNA 1IBML 1B8AA 1VQ9A 1L1OC 4QQBX 1U5KA 4HIOA 5C3EH 3CCUA 1KD1C 4JI5Q 2UUCL 3GTKH 2PI2A 4DAMA 4A3BG 3GDEA 3KJPA 2YTYA 2WFWA 4IPDA 1GM5A 5M5YH 3CCRA 1QVFA 3M3YH 5M3FH 5E7NA 4GNXB 4P72A 3I55A 2FXQA 5M5XH 4DUZL 3K8AA 3BU2A 4P74A 5IWAL 4AQYL 3AYHB 4LFCQ 3RR5A 4JCVE 5GQOA 1IBMQ 1VQBA 2ZTDA 3VDYA 2JA8H 2CQOA 2N78A 3UDXA 4C2MH 2NVYH 1KRSA 5GAGC 4LUZA 4B3MQ 4A3JG 3AQQA 4GOPB 1HH2P 1D7QA 3H3VH 1Y1WH 2VW9A 2JK8A 2AMCB 2K52A 4TQUS 3KDFA 1YJNA 3FP9A 3J7ZC 1FL0A 2V1CC 1OXXK 2VY3A 4A3IH 1HR0W 4BBRH 1KXLA 4JI1L 1K3RA 5M5WH 4R4CA 5C3EG 3CC4A 1Y14B 5EAYA 3M4QA 2WAQE 1YHBA 4NXNL 4R1JA 3I4OA 2ASBA 4A3MH 1OXTA 3CF5A 1HNZL 2JA9A 4PZ8A 1FVIA 4P75A 1PH5A 3RN5A 4C3HH 2R93H 4B3SL 2IHFA 3OW2A 1L0WA 1TWHH 4OX9L 3M9BA 4DAYB 2KENA 3K7AH 2Y0SE 5IYBG 1A62A 4K0KL 2MNAA 3J7A5 4NXMQ 3HOVH 2QGQA 2E2JH 1B70B 1KAWA 4JBKA 4IJLA 4TVAB 4DR3L 1VQEA 4X62Q 2AWOA 3CW2C 1Q1BA 4B3TQ 1LUZA 1O7IA 3PUVA 2VUMH 5H1SE 5JJKA 2PNHA 3G6EA 4JV5L 4B3SQ 2JQOA 4JOIA 3NBHB 1HZAA 1TWCH 2VL6A 2GVBA 4DV4L 1XMQQ 2JEAI 1UE1A 4K0KQ 4BBRG 2AKWB 1EOVA 2H5XA 2WAQG 3U50C 3G4SA 3AFQA 5IP9H 1VCIA 1S72A 3GTPH 4A3LH 3JAMc 3PUYA 2E2IH 1YIJA 1YITA 4DV6L 1X54A 3S2HH 2UXCL 4OWXB 2OTJA 3CXCA 4O0AA 4BBSG 3GD7A 1G291 1E3PA 4LW1A 4L5QA 1XNRQ 3GTGH 2Q2UA 2Y0SG 1HNWL 3GO5A 1CKMA 2F52A 4PG3A 3AFPA 3UE0A 1EQRA 2KBNA 1JJCB 1M1KC 4MNOA 3I4MH 3HOVG 2A19A 3GTQH 1SLJA 2IHEA 3KJOA 4A76A 1PH9A 2UXBQ 1Q46A 5DLQE 3HOYH 4JYAL 1VS0A 2VUMG 4HJ8A 3T1YQ 4X66Q 5ELNA 2Q2HA 3RN2A 5IYDH 1EWIA 4OO1G 1YHAA 1WOCA 4R4OA 1HZ9A 3W5OA 1WI5A 2D0PA 5LMUL 2OTLA 4JI6L 1VQGA 3A5UA 3KOJA 4X65L 4WJ3M 1CKNB 3CCEA 2IX1A 4GKKL 1E1TA 1VQ8A 5JJLA 1VQ6A 2PQAB 1VQIA 1I5FA 2DUDA 1RL2A 1VQNA 3I7FA 1QZGA 2Q2TA 2EIFA 4JI4L 3CQZH 4LF5L 3UDIA 2VQEL 4LF6L 3I2ZA 1C7YA 4DR7L 4IJHA 5FLXc 1XNQL 2RF4A 4A3KG 4IO9A 4A93H 5IYCG 3I4MG 2OQKA 2CKZB 5IY0A 5LMNQ 3F1ZA 3G71A 1VQPA 2XGTA 1YBYA 4DK6C 3KF8B 1PFSA 1E7ZA 3U4VA 1SN8A 1E22A 4DKAC 1N32L 4JI3Q 2A1AA 4GN4B 4HJ9A 1YJWA 1NMGA 4DV1L 5IYDG 4LF8L 2R92H 3H3VI 3F8TA 1G6PA 2LSSA 4DUYL 3CC2A 1I6HH 1C0AA 2VNUD 1GKHA 2ZM6Q 4KHZA 1Z47A 2CWPA 2D62A 5IT9c 3KYHC 2QA4A 1BKBA 4POFA 4DR2Q 1W3SA 4JI0Q 1FJGQ 1M90C 1N8RC 3PO2H 1JJGA 1KHIA 1GO3E 2K50A 4A3EG 3S14H 1KL9A 4EQ5A 4R4QA 4HJAA 1VQLA 1N33Q 3TS0A 2IT1A 4J15A 4P71A 5HY6A 2Z0SA 1CUKA 2E5LL 2I5HA 4LF4L 4DV1Q 1KIXA 2VQFL 3ICEA 3EBEA 3E9HA 3PF5A 4DUYQ 3W1BA 4LFBL 4DR5L 3A5ZB 4DNIA 5IYBH 1XTDA 3PF4A 3ZJYC 4YWLA 1XMOL 1UE7A 4A93G 1EUJA 2UUCQ 2EQSA 2HHHL 1V9PA 5GAHC 1CSQA 4OWTB 4JI8L 2QEXA 1WCMH 1IL2A 1G51A 3A0JA 1K0RA 1XJVA 2K5HA 2E5LQ 2JA7G 2OQ0A 3MEFA 2ALYB 3NEMA 2B29A 2ZJRA 3S24A 4DUZQ 1IBKL 3J80i 4C3IH 4GKJL 5IWAQ 4AQYQ 1AH9A 1CKOA 5FLMG 4RMFA 3CCVA 1QUQA 1L1OB 3HKZE 4APVA 4OO1I 4PZ7A 3U58A 5K36G 4HIMA 1AE3A 1UWVA 3B6YA 3BZCA 1BVSA 1X6OA 3PO2G 3CCQA 2HHHQ 4DV2L 2B3GA 1B7YB 4JG2A 4JI8Q 3U4ZA 4DR4L 3EIVA 4JI2L 1IZ6A 4BBSH 1IBKQ 3LGJA 3PIOA 3F2CA 2VS1A 3D0FA 2UU9L 2UXDL 4JI1Q 4JBMA 3KF6A 5C0XI 5GROA 1P16A 1X55A 1SR3A 1K73C 2VZAA 2DGYA 2Z6KA 2JJQA 3FHWA 3L0OA 1YJ9A 4NXNQ 4DR6L 1PVOA 4JI2Q 4JBJA 1WCMG 1HNZQ 4UY8C 1MKHA 3S2DH 3S1MH 4AH6A 1N36L 3J81c 3HKZG 4DV7L 4EX5A 3S16H 4IPCA 4OX9Q 3CMEA 3MXNB 4JI7L 4GNXA 1NMFA 1SMXA 5C0XJ 3GTOH 1QVGA 3S15H 4A3FH 1NBWA 1YZ6A 3CPFA 3L2PA 1OTCA 3TS2A 1HR0L 1P8LA 3W1GA 4DR3Q 4DR1L 3J81j 1W2BA 2KCMA 4JV5Q 3FKIH 5J3BA 2BA0A 1VQAA 3K7UC 2NVXH 4GOPA 1QVCA 3F2DA 3HKSA 3KFUA 3CD6A 1HJPA 4DV4Q 4JI7Q 4YCVA 4GN3B 4A3KH 1SROA 1Z9FA 5IYCH 3HOUH 2RHQB 1PV4A 4RG1A 4MZ9A 2CWAA 1HR0Q 5BR8L 4DV6Q 2UXCQ 3OTOL 3HOXH 4YHHL 1K8AC 4HIDA 2NVTH 2GVAA 1VQ5A 4LFAL 1JT8A 5GADC 1HNWQ 2YTVA 2JA5G 2MQHA 1X65A 3UDFA 5IE8A 1UE6A 2R7FA 3PCOB 4UP9A 2PMZE 3K80C 4Y7NH 5FJ8G 4LF9L 1UEBA 4A3EH 4A3FG 3HFZB 4DV3L 4JYAQ 2GN5A 1HZCA 3OTOQ 4AIMA 3Q8DA 4LF7L 1J5EL 3OYYA 2LXJA 3CPWA 4LFAQ 1C9OA 1A0IA 1Q12A 3FKIG 3F2BA 3BZKA 4YY3L 1UE5A 2MFIA 2HT1A 1LYLA 3GTJH 2RHSB 1YEZA 3PUWA 3CMAA 5LMUQ 4HJ5A 1LTLA 4JI6Q 4L5TA 2I5MX 4X65Q 2ID0A 3HOUG 1TXYA 4R4TA 1U0LA 4NB3A 2HIXA 4LF9Q 4GKKQ 2JA6H 2KHIA 4OWWB 2R92G 2UUAL 1JMCA 4LF7Q 2JA7H 1YVCA 4XIGS 3PGZA 3HOXG 3HOZG 3KDFB 5IP7G 4A3CG 5C4JH 4LNQA 5JEAG 4JI4Q 4YCWA 2CCZA 4LF5Q 1Q7YC 1LM0A 3PIPA 3M4PA 4LUOA 2VQEQ 5FLMH 4A3DG 4JOIC 4LF6Q 4DR7Q 1VQKA 2JEBI 3ULJA 2K75A 1JE5A 5AJ3L 1XNQQ 2D0OA 2ZJQA 2L15A 4QY7A 1Q81C 3S1QH 4BXXH 3D31A 1PH6A 1HZBA 1EFWA 1K83H 1J6QA 2K5VA 1L2FA 2N49A 1Q8KA 1E24A 1NE3A 4ME3A 4DV0L 1SFOH 1MJCA 4JI5L 1PHJA 1N32Q 2R7ZH 2E8GA 4O2DA 4BY1G 1MJEA 4LF8Q 3TQYA 4DV5L 2HIVA 3TEHB 5C4XH 1EIFA 1PYSB 2LXKA 4PZ6A 2MO0A 4GS3A 4GOPC 3UE1A 2NZOA 2UUBL 1SE8A 1SRUA 3PO3G 2AHOB 3K81C 3BJUA 2KCTA 3UDGA 3JAMi 4YWKA 1ASYA 4UP7A 4LFCL 3JC66 2NN6G 1VQDA 4DV0Q 4Y52H 1GD7A 1WYDA 4A4IA 2JA6G 3K0XA 4JC0A 4IPHA 4IFDG 3SGIA 4X6AH 3IRBA 1FGUA 4IOCA 3I4NH 2WP8J 4AYBE 1A8VA 1CKNA 2JE6I 2XTIA 2K4KA 3PUXA 4B3ML 4LF4Q 3ER0A 2VQFQ 4DV5Q 1EQQA 1JJ2A 1V1QA 2PQAA 4A3GH 1GVPA 2K14A 3T1HL 2A8VA 4LFBQ 2CFMA 2Q2IA 1AE2A 4DR5Q 1VQ7A 2UUBQ 2YYZA 1X3FA 5C44H 3CCLA 4BXXG 3ULPA 1XMOQ 3DM3A 1Y1VH 5M3MH 3H15A 2NVQH 4QGUA 4GLVB 3HOWG 5ELOA 4R4IA 5JJIA 2R7ZG 4GKJQ 2B63H 1MIUA 5HGQA 1I94L 4L5SA 3EN2A 1S3OA 3STBD 3T1HQ 1I3QH 1VQJA 5C4XG 1X9NA 2R7DA 4KI0A 2BH2A 4QIWE 2F3IA 4PMWA 3S17H 3ULLA 1N9WA 2BH8A 4L5RC 3L7ZC 4DV2Q 2N3SA 1CSPA 1WFQA 1N34L 3M7NA 4FDBA 4DR4Q 4AYBG 2NZHA 4NXML 2PI2E 2YV5A 4OXPA 1HNXL 3I4NG 1PH8A 2KHJA 1I94Q 1PH2A 1KQSA 1EIYB 1PH1A 1Q1EA 2ZTCA 4A3GG 2IX0A 2UU9Q 4X62L 2JA5H 1K8GA 4DK3C 5M3FG 4B3TL 3KLWA 2UXDQ 1NJIC 1X3EA 5C44G 2N8NA 4X64L 1Y1VG 5M3MG 3RZDH 4HJ7A 5FJ8H 3RNUA 3M85A 1OXVA 1N34Q 2E2HH 2MO1A 1XMQL 4DR6Q 4LUVA 3S1RH 2JA8G 1HNXQ 3RZOH 4IPGA 4C3JH 2AWNA 1R9TH 1N36Q 2B63G 4DV7Q 1IBLL 3CAMA 1PYBA 1Y1WG 1Q82C 3GTLH 3CCSA 5JEAJ 1A63A 3NELA 2ZJPA 1E1OA 4X64Q 3WWVA 1XNRL 3GTMH 4NPSA 1VQCA 5LMNW 1RIPA 2ES2A 4A3IG 3RLOA 1L1OA 3AEVA 4H02A 4POGA 3CCMA 2EXDA 4DR1Q 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ H;  4UP8 A;  5IP7 H;  4A3C H;  3NEN A;  4IFD I;  3ERS X;  1QZH A;  4GLX A;  1IBL Q;  2UXB L;  2WB1 E;  1VQH A;  4QJF A;  4A3M G;  5GAE C;  3PSI A;  4A3D H;  4YCU A;  3STB C;  3E9I A;  3T1Y L;  4X66 L;  3RLF A;  1S40 A;  2R93 G;  4BA1 I;  2I5L X;  4XTC S;  3J80 c;  3A74 A;  4ALP A;  2R6G A;  5BR8 Q;  1OXU A;  4GLA C;  3I56 A;  3E0E A;  1KRT A;  4A75 A;  2HQL A;  3CP0 A;  1YHQ A;  4YHH Q;  2K5N A;  2ATW A;  1TWA H;  2BA1 A;  4BY1 H;  3PV0 A;  4IFD J;  3CCJ A;  2OCE A;  1WJJ A;  3TRE A;  1XPO A;  1TWG H;  3RLN A;  1VQF A;  4YWM A;  3CC7 A;  3PO3 H;  1VQ4 A;  1KC8 C;  1XPR A;  4JBW A;  4BY7 H;  3H0G H;  1YNX A;  4DPG A;  2YTX A;  4DV3 Q;  1VQO A;  2I0Q A;  2Z6K C;  4HIK A;  1TWF H;  1BBW A;  4GN5 A;  2F4V L;  1J5E Q;  4A3B H;  5IP9 G;  4A3L G;  5LMN L;  2WB1 G;  4BA2 I;  2IY5 B;  1PH7 A;  1VQM A;  4P73 A;  4YY3 Q;  1PH3 A;  1QUQ B;  1T9H A;  3M4O H;  3TRZ A;  4KHP L;  1DGS A;  1YI2 A;  4WJ4 A;  1D8L A;  1EYG A;  4JI3 L;  1BBU A;  2ZTE A;  1NTG A;  4OON A;  3DLL A;  4GNX C;  1X3G A;  5C0X G;  1K9M C;  4MTN A;  4UPA A;  4B3R L;  3HOW H;  2OWO A;  1X56 A;  2ZM6 L;  1JB7 A;  2UUA Q;  2F4V Q;  1Q86 C;  1V43 A;  4DR2 L;  4JI0 L;  3J81 i;  3G48 A;  1FJG L;  3S1N H;  3PUZ A;  2YU9 H;  4A3J H;  1PH4 A;  4QL5 A;  3HOY G;  1IXR A;  4KHP Q;  1N33 L;  1PA6 A;  1I50 H;  5AJ3 Q;  1OXS C;  3KF6 B;  4KLK A;  1XPU A;  2C35 B;  4IOA A;  1ASZ A;  4BY7 G;  1IYJ B;  3H0G G;  4B3R Q;  4LWC A;  1H95 A;  1NY4 A;  2RCN A;  1IBM L;  1B8A A;  1VQ9 A;  1L1O C;  4QQB X;  1U5K A;  4HIO A;  5C3E H;  3CCU A;  1KD1 C;  4JI5 Q;  2UUC L;  3GTK H;  2PI2 A;  4DAM A;  4A3B G;  3GDE A;  3KJP A;  2YTY A;  2WFW A;  4IPD A;  1GM5 A;  5M5Y H;  3CCR A;  1QVF A;  3M3Y H;  5M3F H;  5E7N A;  4GNX B;  4P72 A;  3I55 A;  2FXQ A;  5M5X H;  4DUZ L;  3K8A A;  3BU2 A;  4P74 A;  5IWA L;  4AQY L;  3AYH B;  4LFC Q;  3RR5 A;  4JCV E;  5GQO A;  1IBM Q;  1VQB A;  2ZTD A;  3VDY A;  2JA8 H;  2CQO A;  2N78 A;  3UDX A;  4C2M H;  2NVY H;  1KRS A;  5GAG C;  4LUZ A;  4B3M Q;  4A3J G;  3AQQ A;  4GOP B;  1HH2 P;  1D7Q A;  3H3V H;  1Y1W H;  2VW9 A;  2JK8 A;  2AMC B;  2K52 A;  4TQU S;  3KDF A;  1YJN A;  3FP9 A;  3J7Z C;  1FL0 A;  2V1C C;  1OXX K;  2VY3 A;  4A3I H;  1HR0 W;  4BBR H;  1KXL A;  4JI1 L;  1K3R A;  5M5W H;  4R4C A;  5C3E G;  3CC4 A;  1Y14 B;  5EAY A;  3M4Q A;  2WAQ E;  1YHB A;  4NXN L;  4R1J A;  3I4O A;  2ASB A;  4A3M H;  1OXT A;  3CF5 A;  1HNZ L;  2JA9 A;  4PZ8 A;  1FVI A;  4P75 A;  1PH5 A;  3RN5 A;  4C3H H;  2R93 H;  4B3S L;  2IHF A;  3OW2 A;  1L0W A;  1TWH H;  4OX9 L;  3M9B A;  4DAY B;  2KEN A;  3K7A H;  2Y0S E;  5IYB G;  1A62 A;  4K0K L;  2MNA A;  3J7A 5;  4NXM Q;  3HOV H;  2QGQ A;  2E2J H;  1B70 B;  1KAW A;  4JBK A;  4IJL A;  4TVA B;  4DR3 L;  1VQE A;  4X62 Q;  2AWO A;  3CW2 C;  1Q1B A;  4B3T Q;  1LUZ A;  1O7I A;  3PUV A;  2VUM H;  5H1S E;  5JJK A;  2PNH A;  3G6E A;  4JV5 L;  4B3S Q;  2JQO A;  4JOI A;  3NBH B;  1HZA A;  1TWC H;  2VL6 A;  2GVB A;  4DV4 L;  1XMQ Q;  2JEA I;  1UE1 A;  4K0K Q;  4BBR G;  2AKW B;  1EOV A;  2H5X A;  2WAQ G;  3U50 C;  3G4S A;  3AFQ A;  5IP9 H;  1VCI A;  1S72 A;  3GTP H;  4A3L H;  3JAM c;  3PUY A;  2E2I H;  1YIJ A;  1YIT A;  4DV6 L;  1X54 A;  3S2H H;  2UXC L;  4OWX B;  2OTJ A;  3CXC A;  4O0A A;  4BBS G;  3GD7 A;  1G29 1;  1E3P A;  4LW1 A;  4L5Q A;  1XNR Q;  3GTG H;  2Q2U A;  2Y0S G;  1HNW L;  3GO5 A;  1CKM A;  2F52 A;  4PG3 A;  3AFP A;  3UE0 A;  1EQR A;  2KBN A;  1JJC B;  1M1K C;  4MNO A;  3I4M H;  3HOV G;  2A19 A;  3GTQ H;  1SLJ A;  2IHE A;  3KJO A;  4A76 A;  1PH9 A;  2UXB Q;  1Q46 A;  5DLQ E;  3HOY H;  4JYA L;  1VS0 A;  2VUM G;  4HJ8 A;  3T1Y Q;  4X66 Q;  5ELN A;  2Q2H A;  3RN2 A;  5IYD H;  1EWI A;  4OO1 G;  1YHA A;  1WOC A;  4R4O A;  1HZ9 A;  3W5O A;  1WI5 A;  2D0P A;  5LMU L;  2OTL A;  4JI6 L;  1VQG A;  3A5U A;  3KOJ A;  4X65 L;  4WJ3 M;  1CKN B;  3CCE A;  2IX1 A;  4GKK L;  1E1T A;  1VQ8 A;  5JJL A;  1VQ6 A;  2PQA B;  1VQI A;  1I5F A;  2DUD A;  1RL2 A;  1VQN A;  3I7F A;  1QZG A;  2Q2T A;  2EIF A;  4JI4 L;  3CQZ H;  4LF5 L;  3UDI A;  2VQE L;  4LF6 L;  3I2Z A;  1C7Y A;  4DR7 L;  4IJH A;  5FLX c;  1XNQ L;  2RF4 A;  4A3K G;  4IO9 A;  4A93 H;  5IYC G;  3I4M G;  2OQK A;  2CKZ B;  5IY0 A;  5LMN Q;  3F1Z A;  3G71 A;  1VQP A;  2XGT A;  1YBY A;  4DK6 C;  3KF8 B;  1PFS A;  1E7Z A;  3U4V A;  1SN8 A;  1E22 A;  4DKA C;  1N32 L;  4JI3 Q;  2A1A A;  4GN4 B;  4HJ9 A;  1YJW A;  1NMG A;  4DV1 L;  5IYD G;  4LF8 L;  2R92 H;  3H3V I;  3F8T A;  1G6P A;  2LSS A;  4DUY L;  3CC2 A;  1I6H H;  1C0A A;  2VNU D;  1GKH A;  2ZM6 Q;  4KHZ A;  1Z47 A;  2CWP A;  2D62 A;  5IT9 c;  3KYH C;  2QA4 A;  1BKB A;  4POF A;  4DR2 Q;  1W3S A;  4JI0 Q;  1FJG Q;  1M90 C;  1N8R C;  3PO2 H;  1JJG A;  1KHI A;  1GO3 E;  2K50 A;  4A3E G;  3S14 H;  1KL9 A;  4EQ5 A;  4R4Q A;  4HJA A;  1VQL A;  1N33 Q;  3TS0 A;  2IT1 A;  4J15 A;  4P71 A;  5HY6 A;  2Z0S A;  1CUK A;  2E5L L;  2I5H A;  4LF4 L;  4DV1 Q;  1KIX A;  2VQF L;  3ICE A;  3EBE A;  3E9H A;  3PF5 A;  4DUY Q;  3W1B A;  4LFB L;  4DR5 L;  3A5Z B;  4DNI A;  5IYB H;  1XTD A;  3PF4 A;  3ZJY C;  4YWL A;  1XMO L;  1UE7 A;  4A93 G;  1EUJ A;  2UUC Q;  2EQS A;  2HHH L;  1V9P A;  5GAH C;  1CSQ A;  4OWT B;  4JI8 L;  2QEX A;  1WCM H;  1IL2 A;  1G51 A;  3A0J A;  1K0R A;  1XJV A;  2K5H A;  2E5L Q;  2JA7 G;  2OQ0 A;  3MEF A;  2ALY B;  3NEM A;  2B29 A;  2ZJR A;  3S24 A;  4DUZ Q;  1IBK L;  3J80 i;  4C3I H;  4GKJ L;  5IWA Q;  4AQY Q;  1AH9 A;  1CKO A;  5FLM G;  4RMF A;  3CCV A;  1QUQ A;  1L1O B;  3HKZ E;  4APV A;  4OO1 I;  4PZ7 A;  3U58 A;  5K36 G;  4HIM A;  1AE3 A;  1UWV A;  3B6Y A;  3BZC A;  1BVS A;  1X6O A;  3PO2 G;  3CCQ A;  2HHH Q;  4DV2 L;  2B3G A;  1B7Y B;  4JG2 A;  4JI8 Q;  3U4Z A;  4DR4 L;  3EIV A;  4JI2 L;  1IZ6 A;  4BBS H;  1IBK Q;  3LGJ A;  3PIO A;  3F2C A;  2VS1 A;  3D0F A;  2UU9 L;  2UXD L;  4JI1 Q;  4JBM A;  3KF6 A;  5C0X I;  5GRO A;  1P16 A;  1X55 A;  1SR3 A;  1K73 C;  2VZA A;  2DGY A;  2Z6K A;  2JJQ A;  3FHW A;  3L0O A;  1YJ9 A;  4NXN Q;  4DR6 L;  1PVO A;  4JI2 Q;  4JBJ A;  1WCM G;  1HNZ Q;  4UY8 C;  1MKH A;  3S2D H;  3S1M H;  4AH6 A;  1N36 L;  3J81 c;  3HKZ G;  4DV7 L;  4EX5 A;  3S16 H;  4IPC A;  4OX9 Q;  3CME A;  3MXN B;  4JI7 L;  4GNX A;  1NMF A;  1SMX A;  5C0X J;  3GTO H;  1QVG A;  3S15 H;  4A3F H;  1NBW A;  1YZ6 A;  3CPF A;  3L2P A;  1OTC A;  3TS2 A;  1HR0 L;  1P8L A;  3W1G A;  4DR3 Q;  4DR1 L;  3J81 j;  1W2B A;  2KCM A;  4JV5 Q;  3FKI H;  5J3B A;  2BA0 A;  1VQA A;  3K7U C;  2NVX H;  4GOP A;  1QVC A;  3F2D A;  3HKS A;  3KFU A;  3CD6 A;  1HJP A;  4DV4 Q;  4JI7 Q;  4YCV A;  4GN3 B;  4A3K H;  1SRO A;  1Z9F A;  5IYC H;  3HOU H;  2RHQ B;  1PV4 A;  4RG1 A;  4MZ9 A;  2CWA A;  1HR0 Q;  5BR8 L;  4DV6 Q;  2UXC Q;  3OTO L;  3HOX H;  4YHH L;  1K8A C;  4HID A;  2NVT H;  2GVA A;  1VQ5 A;  4LFA L;  1JT8 A;  5GAD C;  1HNW Q;  2YTV A;  2JA5 G;  2MQH A;  1X65 A;  3UDF A;  5IE8 A;  1UE6 A;  2R7F A;  3PCO B;  4UP9 A;  2PMZ E;  3K80 C;  4Y7N H;  5FJ8 G;  4LF9 L;  1UEB A;  4A3E H;  4A3F G;  3HFZ B;  4DV3 L;  4JYA Q;  2GN5 A;  1HZC A;  3OTO Q;  4AIM A;  3Q8D A;  4LF7 L;  1J5E L;  3OYY A;  2LXJ A;  3CPW A;  4LFA Q;  1C9O A;  1A0I A;  1Q12 A;  3FKI G;  3F2B A;  3BZK A;  4YY3 L;  1UE5 A;  2MFI A;  2HT1 A;  1LYL A;  3GTJ H;  2RHS B;  1YEZ A;  3PUW A;  3CMA A;  5LMU Q;  4HJ5 A;  1LTL A;  4JI6 Q;  4L5T A;  2I5M X;  4X65 Q;  2ID0 A;  3HOU G;  1TXY A;  4R4T A;  1U0L A;  4NB3 A;  2HIX A;  4LF9 Q;  4GKK Q;  2JA6 H;  2KHI A;  4OWW B;  2R92 G;  2UUA L;  1JMC A;  4LF7 Q;  2JA7 H;  1YVC A;  4XIG S;  3PGZ A;  3HOX G;  3HOZ G;  3KDF B;  5IP7 G;  4A3C G;  5C4J H;  4LNQ A;  5JEA G;  4JI4 Q;  4YCW A;  2CCZ A;  4LF5 Q;  1Q7Y C;  1LM0 A;  3PIP A;  3M4P A;  4LUO A;  2VQE Q;  5FLM H;  4A3D G;  4JOI C;  4LF6 Q;  4DR7 Q;  1VQK A;  2JEB I;  3ULJ A;  2K75 A;  1JE5 A;  5AJ3 L;  1XNQ Q;  2D0O A;  2ZJQ A;  2L15 A;  4QY7 A;  1Q81 C;  3S1Q H;  4BXX H;  3D31 A;  1PH6 A;  1HZB A;  1EFW A;  1K83 H;  1J6Q A;  2K5V A;  1L2F A;  2N49 A;  1Q8K A;  1E24 A;  1NE3 A;  4ME3 A;  4DV0 L;  1SFO H;  1MJC A;  4JI5 L;  1PHJ A;  1N32 Q;  2R7Z H;  2E8G A;  4O2D A;  4BY1 G;  1MJE A;  4LF8 Q;  3TQY A;  4DV5 L;  2HIV A;  3TEH B;  5C4X H;  1EIF A;  1PYS B;  2LXK A;  4PZ6 A;  2MO0 A;  4GS3 A;  4GOP C;  3UE1 A;  2NZO A;  2UUB L;  1SE8 A;  1SRU A;  3PO3 G;  2AHO B;  3K81 C;  3BJU A;  2KCT A;  3UDG A;  3JAM i;  4YWK A;  1ASY A;  4UP7 A;  4LFC L;  3JC6 6;  2NN6 G;  1VQD A;  4DV0 Q;  4Y52 H;  1GD7 A;  1WYD A;  4A4I A;  2JA6 G;  3K0X A;  4JC0 A;  4IPH A;  4IFD G;  3SGI A;  4X6A H;  3IRB A;  1FGU A;  4IOC A;  3I4N H;  2WP8 J;  4AYB E;  1A8V A;  1CKN A;  2JE6 I;  2XTI A;  2K4K A;  3PUX A;  4B3M L;  4LF4 Q;  3ER0 A;  2VQF Q;  4DV5 Q;  1EQQ A;  1JJ2 A;  1V1Q A;  2PQA A;  4A3G H;  1GVP A;  2K14 A;  3T1H L;  2A8V A;  4LFB Q;  2CFM A;  2Q2I A;  1AE2 A;  4DR5 Q;  1VQ7 A;  2UUB Q;  2YYZ A;  1X3F A;  5C44 H;  3CCL A;  4BXX G;  3ULP A;  1XMO Q;  3DM3 A;  1Y1V H;  5M3M H;  3H15 A;  2NVQ H;  4QGU A;  4GLV B;  3HOW G;  5ELO A;  4R4I A;  5JJI A;  2R7Z G;  4GKJ Q;  2B63 H;  1MIU A;  5HGQ A;  1I94 L;  4L5S A;  3EN2 A;  1S3O A;  3STB D;  3T1H Q;  1I3Q H;  1VQJ A;  5C4X G;  1X9N A;  2R7D A;  4KI0 A;  2BH2 A;  4QIW E;  2F3I A;  4PMW A;  3S17 H;  3ULL A;  1N9W A;  2BH8 A;  4L5R C;  3L7Z C;  4DV2 Q;  2N3S A;  1CSP A;  1WFQ A;  1N34 L;  3M7N A;  4FDB A;  4DR4 Q;  4AYB G;  2NZH A;  4NXM L;  2PI2 E;  2YV5 A;  4OXP A;  1HNX L;  3I4N G;  1PH8 A;  2KHJ A;  1I94 Q;  1PH2 A;  1KQS A;  1EIY B;  1PH1 A;  1Q1E A;  2ZTC A;  4A3G G;  2IX0 A;  2UU9 Q;  4X62 L;  2JA5 H;  1K8G A;  4DK3 C;  5M3F G;  4B3T L;  3KLW A;  2UXD Q;  1NJI C;  1X3E A;  5C44 G;  2N8N A;  4X64 L;  1Y1V G;  5M3M G;  3RZD H;  4HJ7 A;  5FJ8 H;  3RNU A;  3M85 A;  1OXV A;  1N34 Q;  2E2H H;  2MO1 A;  1XMQ L;  4DR6 Q;  4LUV A;  3S1R H;  2JA8 G;  1HNX Q;  3RZO H;  4IPG A;  4C3J H;  2AWN A;  1R9T H;  1N36 Q;  2B63 G;  4DV7 Q;  1IBL L;  3CAM A;  1PYB A;  1Y1W G;  1Q82 C;  3GTL H;  3CCS A;  5JEA J;  1A63 A;  3NEL A;  2ZJP A;  1E1O A;  4X64 Q;  3WWV A;  1XNR L;  3GTM H;  4NPS A;  1VQC A;  5LMN W;  1RIP A;  2ES2 A;  4A3I G;  3RLO A;  1L1O A;  3AEV A;  4H02 A;  4POG A;  3CCM A;  2EXD A;  4DR1 Q;  2NN6 I; 
#chains in the Genus database with same CATH topology
 5EKL A;  2LKV A;  1BCP B;  1R4Q B;  1PRT B;  4QJF A;  4A3D H;  2A69 D;  3HKZ B;  1PFB A;  2K04 A;  3E9I A;  4X66 L;  2RBM A;  4BA1 I;  1BXT A;  4BBR B;  2I5L X;  2QDB A;  4GLA C;  2A73 B;  2HQL A;  5L37 A;  2EYH A;  3T53 B;  4HCS A;  1UUP A;  2EYP A;  3CCJ A;  2OCE A;  4PV1 C;  3MXU A;  5ELB A;  2A6E C;  3PO3 H;  1TWH B;  2SNM A;  3SR1 A;  4R8I A;  1XPR A;  4BY7 H;  2YTX A;  4R8N A;  2I0Q A;  1EQT A;  3BYT B;  2MHV A;  2XSC A;  2JYO A;  5IP9 G;  2F0D A;  4FF4 A;  2F0F A;  2WB1 G;  3S2D B;  2DN8 A;  4P73 A;  4YY3 Q;  1RTN A;  3L3O C;  3NTI A;  3S16 B;  4JI3 L;  3DLL A;  1NTG A;  3JAM E;  1TII D;  5A35 A;  4GNX C;  4B3R L;  1X56 A;  4FXD A;  2F0Q A;  2AQ1 B;  4JI0 L;  1HUM A;  4DR2 L;  4OEM B;  4KHP Q;  1I50 H;  1OXS C;  2C35 B;  3H6M A;  4BY7 G;  1MI2 A;  1NCV A;  3NK9 A;  3GTQ B;  2AQ2 B;  1VQ9 A;  1LTT D;  4QQB X;  1U5K A;  4HIO A;  4JI5 Q;  4JVZ A;  4C1N I;  3CCR A;  3M3Y H;  2LMC B;  1NUC A;  4P72 A;  1IW7 C;  4P74 A;  5E4X A;  1TKW B;  4LFC Q;  3QWN A;  3BVG A;  1SYE A;  3NHH A;  4Y7N B;  1HQM C;  2H4O A;  4C2M H;  5KIX A;  2NVY H;  1KRS A;  5GAG C;  4B3M Q;  4DNR B;  2H1E A;  1Y1W H;  1BF4 A;  5FO7 B;  1ICW A;  1CZW A;  2Z6B A;  4A93 B;  4U68 A;  1WTQ A;  1JOO A;  4CDC C;  1Y14 B;  5C4J B;  1D1I A;  2KVM A;  2JA9 A;  2D9U A;  4B3S L;  2EYJ A;  3OW2 A;  3IAY A;  1K83 B;  2A68 D;  1RD9 D;  4H7B A;  3NQT A;  3J7A 5;  3HOV H;  4JPB W;  1SFO B;  4C1N K;  3C3L A;  1IL8 A;  1C4Q A;  2AWO A;  3CW2 C;  1RTO A;  2XNA C;  2K1B A;  4B3T Q;  2VUM H;  5C4X B;  2F0P A;  2O5I C;  3G6E A;  4JV5 L;  1QOH A;  3I4L A;  3Q6S A;  1UE1 A;  2JXM B;  4G4K A;  5FKA C;  1HHV A;  2KUM A;  3U50 C;  3ZYY X;  3PUY A;  4K2L A;  1LAB A;  4DV6 L;  1X54 A;  3GD7 A;  3C46 A;  4LW1 A;  5KRU A;  1XNR Q;  4RAU C;  1FNW A;  3GTG H;  3GP7 A;  2Y0S G;  1HNW L;  4EQP A;  3D4R A;  3UE0 A;  1EQR A;  1BNZ A;  4LK1 C;  3HOV G;  5LL6 X;  2F0J A;  4A76 A;  2ZXP A;  3P7J A;  1PH9 A;  1Q46 A;  5DLQ E;  3SHL A;  4CKE A;  2VUM G;  4X66 Q;  3VA5 A;  5IYD H;  2EJM A;  2HUG A;  1CQF A;  1HZ9 A;  3R93 A;  1WI5 A;  3W5O A;  2OTL A;  3A5U A;  3KOJ A;  1CKN B;  4GKK L;  5JJL A;  1VQ6 A;  1VQI A;  5COY A;  1SND A;  4E6I A;  1IYU A;  2RKS A;  3EFX D;  3KLS A;  2EIF A;  3CQZ H;  4HMJ A;  4ILW A;  3UDI A;  3LNN A;  4IJH A;  4ZRZ A;  1GJX A;  4A3F B;  4IUP A;  5IYC G;  5IGG A;  4KN7 C;  1HXY D;  5IY0 A;  3FPP A;  1PZI D;  3KF8 B;  3N52 A;  1E7Z A;  3GTL B;  1F2Y A;  1X3Q A;  4B9W A;  4JI3 Q;  4HJ9 A;  3H3V I;  3HS0 C;  5IYD G;  3TN2 A;  2PO4 A;  2EPB A;  4DFA A;  4M1U B;  4DUY L;  4X3S A;  5C4H A;  2CWP A;  1U4R A;  5JJZ A;  2KCN A;  3KYH C;  4DR2 Q;  4JI0 Q;  2VB3 X;  1M90 C;  1QIL A;  2K50 A;  1GO3 E;  4K8I A;  3HOZ B;  4A3E G;  3T4A C;  4J15 A;  1D5M C;  1O78 A;  4LF4 L;  1STY A;  3PF5 A;  3OWE B;  4DR5 L;  3A5Z B;  5IYB H;  3PF4 A;  5FOB B;  2A6H C;  4FF2 A;  3TZD A;  1V9P A;  2R3Z A;  1M4V A;  4ZAI A;  4OWT B;  4BY1 B;  4MIU A;  3A0J A;  1FR3 A;  1K0R A;  2K5H A;  2E5L Q;  2ZJR A;  3A8J E;  1F2Z A;  4X3U A;  5I2X A;  1X3P A;  2OF1 A;  3CCV A;  3MXG A;  1H9J A;  4APV A;  2JA6 B;  1X6O A;  1GHJ A;  3NQI A;  4JI8 Q;  2K7V A;  1A3V A;  2VXW A;  4JI2 L;  1IZ6 A;  1SYG A;  1W6J A;  1IBK Q;  4K6L A;  3PIO A;  3F2C A;  3TBI B;  2WIN B;  2UXD L;  4NKL A;  5C3W A;  5C0X I;  3DHQ A;  2KED A;  5IT9 L;  5DEH A;  4RA8 A;  2V4D A;  3S2D H;  4ABN A;  3H3V C;  2AUJ D;  3HKZ G;  3S16 H;  1PRT C;  3CME A;  2E2D C;  5CV5 A;  4OGQ C;  1QVG A;  1O7Z A;  2DJF C;  3FDT A;  3TS2 A;  1IKL A;  1DOM A;  1P8L A;  4OIK A;  5I2Y A;  3J81 j;  1V1P B;  2KCM A;  1W2B A;  5M5Y B;  4JV5 Q;  1T5E A;  2BA0 A;  1QVC A;  2D5D A;  3CD6 A;  3OWF A;  1A3T A;  5G3L D;  1A6X A;  1GHK A;  1HR0 Q;  5BR8 L;  4ZCK A;  2KA7 A;  4DV6 Q;  1K8O A;  4DF7 A;  2DY7 A;  2DNE A;  3HOX H;  5JEA H;  3NWT A;  4FXK C;  1VQ5 A;  4LFA L;  3NTH A;  1HNW Q;  3TP7 A;  5E4W C;  4KTA A;  3MC0 B;  2A68 C;  3K80 C;  4Y7N H;  5IOC A;  1TU2 B;  3CRK C;  2GN5 A;  5IGB A;  3MWY W;  4AIM A;  1F9S A;  4RGM A;  1JWM D;  4QUC A;  1FNV A;  1RF2 D;  2MFI A;  1BO0 A;  2Z8L A;  4FXG C;  1JWU D;  2KJX A;  4L5T A;  3K7A B;  4R4T A;  4GKK Q;  4NB3 A;  2F0V A;  3RZO B;  2E2J B;  4IFD H;  3SVM A;  4OWW B;  1FD7 D;  1JMC A;  1YVC A;  4XIG S;  3HOX G;  2EZV A;  5C4J H;  5JEA G;  1Q7Y C;  3PIP A;  4JOI C;  1IYV A;  3ULJ A;  4BXX H;  2D0O A;  2ZJQ A;  2L15 A;  3OSO A;  1Q81 C;  5K36 H;  2J4X A;  1K83 H;  3LX0 A;  5EJW A;  1KDC A;  2EDG A;  4KMU C;  5BN3 A;  2WB1 B;  1SFO H;  5IGF A;  1PHJ A;  3S2H B;  1PZJ D;  2E8G A;  4O2D A;  3AU7 A;  2HIV A;  3TEH B;  5C4X H;  2LXK A;  4K2K A;  2MO0 A;  1UEA B;  4F7X A;  4KD3 A;  1WTX A;  2EYO A;  2B39 A;  4CJ0 B;  2F0H A;  1VQD A;  1SNP A;  4Y52 H;  1GUW A;  4IFD G;  2Z9H A;  3GV6 A;  4XQJ A;  1JE4 A;  3SGI A;  2EY6 A;  4Z9C B;  1FGU A;  1CKN A;  4LF4 Q;  5CBA E;  2K4K A;  3PUX A;  5K5P A;  2K14 A;  1S5C D;  4DR5 Q;  1D6E C;  4BY7 B;  1Z7T A;  2YYZ A;  4BXX G;  4J6H A;  4K8J A;  3EJI A;  2NVQ H;  3A55 A;  1U9R A;  4QGU A;  1PTO D;  1LV9 A;  1A3U A;  3HOW G;  3A8I E;  3O13 A;  3U9O A;  2EYF A;  1VDZ A;  1Q3L A;  2ICI A;  1MIU A;  1NR4 A;  1S3O A;  4F88 A;  3T1H Q;  1I3Q H;  5C4X G;  1X9N A;  1AP0 A;  4KI0 A;  3E6Z X;  1EU4 A;  5CMD A;  5D3I B;  2Z4I A;  4RCO A;  4L5R C;  3FMC A;  1QWY A;  4AYB G;  2B2Y A;  1PTO F;  4NXM L;  2YV5 A;  4OXP A;  1CA6 A;  4J1M A;  3DEP A;  1PH1 A;  5ISR A;  2A6E D;  2X69 A;  2UXD Q;  3KLW A;  4XQQ A;  1I6H B;  4X64 L;  2IWH A;  3A7L A;  2MO1 A;  4PMB A;  4LUV A;  2K05 A;  2F3V A;  4C3J H;  1Y69 U;  3CAM A;  1SE4 A;  1PYB A;  3GTL H;  3A7A B;  5JEA J;  3NEL A;  3MHB A;  1F9R A;  1VQC A;  5LMN W;  1RIP A;  3E0J A;  4C2M B;  3AEV A;  4H02 A;  1YNJ C;  4POG A;  2EXD A;  1KLG D;  2NN6 I;  3HOZ H;  4A3C H;  1B2T A;  3NEN A;  4I65 A;  2B8G A;  4GLX A;  1IBL Q;  2WB1 E;  5GAE C;  3STB C;  3Q23 A;  3QOJ A;  3T1Y L;  3RLF A;  5CV7 A;  1A2U A;  1GUT A;  3E3X A;  3SK8 A;  3J80 c;  5BR8 Q;  4A75 A;  2DNC A;  3E0E A;  1SNQ A;  5KND A;  2ATW A;  1TWA H;  4CDE C;  4C3J G;  4BY1 H;  3PV0 A;  1STB A;  4IFD J;  2KEC A;  2G5D A;  1WJJ A;  4DXG A;  1NR2 A;  1VQF A;  4YWM A;  1LT6 D;  1KC8 C;  4JBW A;  2NN6 H;  3HOV B;  2Z6K C;  4HIK A;  1BBW A;  2K33 A;  4J8Q A;  2B2Y C;  5EBC A;  4A3B H;  4Q0F A;  2VUM B;  4BA2 I;  1PH7 A;  1VQM A;  3TRZ A;  1T9H A;  4KHP L;  3BDL A;  4R9W A;  1YI2 A;  1D8L A;  1JWS D;  1V1P A;  4IUN A;  1BBU A;  3EA6 A;  2NUC A;  3I3C A;  3OHX C;  2E75 C;  1JB7 A;  3C1E A;  1WD1 A;  3DWQ A;  1Q86 C;  2F4V Q;  1EQV A;  4ZLT F;  3PUZ A;  3A54 A;  5IGC A;  1KAB A;  3HOY G;  2E76 C;  1N33 L;  3GTG B;  3KF6 B;  4KLK A;  1PDQ A;  1ASZ A;  2MP1 A;  1HRJ A;  4LWC A;  1LTA D;  2RCN A;  2FJ2 A;  3CCU A;  4A3B G;  2BE5 C;  1O80 A;  5CV9 A;  2YTY A;  2WFW A;  4IPD A;  5M5Y H;  1ESR A;  3I55 A;  1GUO A;  1ET6 A;  1WVL A;  2Q8I B;  5IWA L;  3AYH B;  4N8F A;  4XT1 B;  1IBM Q;  3VR4 A;  1VQB A;  3VDY A;  4A3E B;  1DJR D;  5A2Q E;  5FLX E;  3AQQ A;  1HH2 P;  3CQZ B;  2K52 A;  2O2L D;  1EYC A;  2FMM A;  4CGY B;  4WRD A;  3FP9 A;  4IUU A;  4HSV A;  1ZYR C;  1K3R A;  3NE5 B;  4X3T A;  2B2T C;  4N8X 1;  1U4M A;  3M4Q A;  1YHB A;  3CRL C;  3I4O A;  3CF5 A;  1Y8P B;  4BS9 A;  4P75 A;  3RN5 A;  4C3H H;  2F0L A;  2M00 A;  1L0W A;  4OX9 L;  3M9B A;  4DAY B;  2KEN A;  3K7A H;  2Y0S E;  1A62 A;  4NXM Q;  2QGQ A;  2E2J H;  2BDN A;  1EYA A;  1KAW A;  2R7Z B;  4TVA B;  2PPB C;  1H9M A;  5JJK A;  1LUZ A;  1O7I A;  5H1S E;  3NBH B;  1HZA A;  4FYD A;  1TWC H;  2EJG C;  1BQQ T;  3HRZ C;  1SMY C;  1MSG A;  5IP9 H;  1S72 A;  1VCI A;  1OO9 B;  3JAM c;  4ZKB B;  3S2H H;  4OWX B;  3CXC A;  4LJZ C;  4BBS G;  3MVV A;  3NP8 A;  5DM7 3;  1G29 1;  1E3P A;  2NYZ D;  4L5Q A;  4C3H G;  5LHY 1;  5C44 B;  2Q2U A;  4CDF C;  4KY5 A;  5C3X A;  2EY1 A;  3X3M A;  1LT3 D;  2K32 A;  1A15 A;  3ND9 A;  1VS0 A;  1EZ6 A;  5I4D A;  1CK1 A;  4RGN A;  3T1Y Q;  4V19 0;  1E2V A;  2CVR A;  1EWI A;  1O7Y A;  4XT3 B;  1YHA A;  4R4O A;  3L9A X;  3VYR A;  5LMU L;  2A6H D;  1IHZ A;  1WTH A;  2L4N A;  4X65 L;  1ET9 A;  5T1I A;  3CCE A;  2C9O A;  2DUD A;  1RL2 A;  2IPK D;  1RDP D;  1QJO A;  5I6W A;  1PXU A;  4DR7 L;  3NTK A;  1QE6 A;  1K28 A;  3S1R B;  4QB4 A;  4LMQ D;  2CKZ B;  1VQP A;  4RCN A;  3W3A A;  1PFS A;  3EVQ A;  3U4V A;  3F2U A;  2Q8T A;  1N32 L;  2SDF A;  2A1A A;  1NSN S;  2LSS A;  4I7A A;  3GTM B;  1I6H H;  3QO2 A;  4KHZ A;  3K5M A;  2D62 A;  3VA7 A;  2GA4 B;  2QA4 A;  5HUR A;  1BKB A;  4POF A;  1B44 D;  1KHI A;  4G7Z C;  5EPL A;  4QMG A;  5I9O A;  3HOX B;  1HA6 A;  2F0N A;  1KL9 A;  4G7O C;  4EQ5 A;  2PW7 A;  4R4Q A;  1N33 Q;  2BCO A;  3URY A;  4P71 A;  5M9O A;  2E5L L;  1BCP D;  2AUK A;  5CV6 A;  1PRT D;  3ICE A;  3E9H A;  1QCB D;  1SSO A;  2RQX A;  4DNI A;  1CTM A;  3ZJY C;  4YWL A;  2F0G A;  1ROD A;  1F9P A;  4JI8 L;  2QEX A;  3DUZ A;  4XQN A;  1IL2 A;  1GXD C;  2JA7 G;  1VF7 A;  3NEM A;  1KTK A;  3KLS X;  3UI2 A;  1D5Z C;  1ZEQ X;  3S24 A;  1IBK L;  4GKJ L;  1AH9 A;  5IWA Q;  1BCP F;  5FLM G;  4KY6 A;  1L1O B;  1SXT A;  3HKZ E;  1PRT F;  2IX3 A;  1AE3 A;  1UWV A;  1BVS A;  1BDO A;  2HHH Q;  5TSS A;  1B7Y B;  4JG2 A;  1E0B A;  1ILQ A;  3TZU A;  2BDO A;  2F0T A;  3LGJ A;  1KNE A;  4G57 A;  3D0F A;  1XX8 A;  1STA A;  3KF6 A;  4ME5 A;  4K14 A;  4BWG B;  3HOW B;  1J8I A;  1FNU A;  1SR3 A;  5KNC A;  2VZA A;  1YJ9 A;  1PVO A;  2YU9 B;  1MKH A;  4AH6 A;  1N36 L;  3N6R A;  4CBV A;  2XIW A;  3J81 c;  1GUG A;  4EX5 A;  4RH6 A;  4IPC A;  4OX9 Q;  1DOL A;  3MXN B;  2XVS A;  4Q5V A;  2WII B;  4AYB B;  3SE0 A;  2RDG A;  3P1H A;  1LTS D;  1JB3 A;  1YZ6 A;  5C3E B;  1STH A;  2QKI C;  1LTR D;  2QDL A;  1HR0 L;  1SAP A;  4DR1 L;  4DU9 A;  3J7Y W;  1VQA A;  5M5X B;  3KFU A;  4ZUJ A;  2J7Z A;  3BVZ A;  2NVQ B;  4YCV A;  2DJG C;  4GN3 B;  5IYC H;  1SYF A;  2RHQ B;  2N88 A;  2CWA A;  3BS1 A;  3KUP A;  2JN4 A;  1K8A C;  1I3Q B;  1F9Q A;  1JT8 A;  4IUQ A;  5JAV A;  1XXG A;  1LTG D;  4WJW A;  3UDF A;  3DMU A;  1UE6 A;  4CHT B;  3J81 E;  1LT5 D;  4KJO A;  5FJ8 G;  2B2W A;  2MGS A;  5D3D A;  1UEB A;  2WAQ B;  4A3E H;  1EIH A;  4DAY A;  2HDM A;  4ULL A;  3OTO Q;  1EOT A;  1EL0 A;  4WOR A;  3BZK A;  2HT1 A;  1UE5 A;  5EGT A;  1YEZ A;  3PUW A;  5LMU Q;  4HJ5 A;  1JC7 A;  1LTL A;  4X65 Q;  4JW0 A;  1EY4 A;  3NBH A;  4LF9 Q;  3M7G A;  2HIX A;  4RHS A;  4C3J B;  5J22 A;  2R92 G;  3PGZ A;  3TP6 A;  1PFN A;  3KDF B;  5IP7 G;  1WTW A;  4YCW A;  2CCZ A;  3DXJ C;  4DR7 Q;  2JEB I;  5AJ3 L;  4KKS A;  3D31 A;  1EFW A;  1J6Q A;  2B2V A;  2K5V A;  1L2F A;  2KQ3 A;  2N49 A;  1E24 A;  3K6O A;  2OT2 A;  5KNB A;  4ME3 A;  1MJC A;  2E2I B;  1N32 Q;  1EWH A;  2R7Z H;  2RSN A;  2FMC A;  5JVG 3;  2LY7 A;  1J9O A;  1EIF A;  4H0L C;  3DWA A;  1MBY A;  2AHO B;  3BJU A;  2KCT A;  3R3O A;  4ZK9 B;  2C5C A;  1BUV T;  1TWA B;  1XYI A;  2WV6 D;  1SJE D;  4FO2 A;  3HOY B;  4IOC A;  4RHR A;  4AYB E;  4DA2 A;  5JVH 3;  1V1Q A;  1GVP A;  2A8V A;  1GOZ A;  3I91 A;  3T1H L;  2Q8R E;  2CFM A;  2KCC A;  5CC4 A;  1S5B D;  1X3F A;  5C44 H;  4L8J A;  3ULP A;  3DM3 A;  3MA2 B;  1E2Z A;  1AW7 A;  4DN4 M;  1QG7 A;  5CR3 A;  1YNJ D;  4GLV B;  2B2W C;  4A3B B;  5ELO A;  4R4I A;  5JJI A;  2NB0 A;  2FFK B;  2B63 H;  2R7Z G;  4GKJ Q;  4QCL A;  5D65 A;  3EN2 A;  3STB D;  2R7D A;  4PMW A;  4TKO B;  2BH8 A;  3L7Z C;  1SNO A;  4FDB A;  2PI2 E;  1PH8 A;  2SEB D;  2KHJ A;  3SXH A;  1KQS A;  1BCP C;  1EY5 A;  4DK3 C;  5M3F G;  1NJI C;  1X3E A;  5C44 G;  1HFN A;  3RZD H;  3W2D A;  2HQE A;  1Z6H A;  3M85 A;  3RNU A;  2B2V C;  1XMQ L;  3S1R H;  2JA8 G;  4GZY C;  1I4X A;  4IPG A;  1B1Z A;  2RA4 A;  1N36 Q;  1DON A;  2B63 G;  4CKB A;  5FO9 B;  1IBL L;  1II3 A;  1E1O A;  3T13 A;  3WWV A;  3GTM H;  5C6A A;  4IUR A;  4A3I G;  1L1O A;  4DR1 Q;  4P2C B;  4IFD I;  1PMR A;  4A3M G;  3PSI A;  4YCU A;  1R4P B;  2R93 G;  1S40 A;  3OIP A;  5KEE A;  3V2T A;  3A74 A;  4ALP A;  2R61 A;  3CP0 A;  2BE5 D;  2K5N A;  4IN3 A;  4NP5 A;  4BBS B;  3TRE A;  2PW5 A;  3QB3 A;  1XPO A;  1TWG H;  4C3H B;  3CC7 A;  1CM9 A;  1VQ4 A;  2K5D A;  4HED A;  5IGE A;  4IAL A;  1YNX A;  4DPG A;  1TWF H;  1FYC A;  1MHW C;  3AB9 A;  3MXN A;  2F4V L;  4A3L G;  5LMN L;  2KHS A;  2E74 C;  1TT2 A;  1PH3 A;  3SK4 A;  4DAV A;  1LTB D;  1TWC B;  4OON A;  2HD3 A;  1X3G A;  5BN4 A;  5C0X G;  1ZYR D;  2F0S A;  4MTN A;  4ZQ3 A;  1K9M C;  5C5L A;  3GTO B;  3HOW H;  2OWO A;  2ZM6 L;  3S15 B;  5F2D A;  1BBX C;  1V43 A;  1FJG L;  3S1N H;  5DNF A;  3G48 A;  2YU9 H;  4A3J H;  2KEE A;  1PH4 A;  1CI3 M;  5EQ0 A;  1IXR A;  2XN9 C;  3FKI B;  1B50 A;  2NVX B;  1B3Q A;  1PA6 A;  5AJ3 Q;  1H9R A;  3AMU A;  1IYJ B;  1H95 A;  1DM0 B;  1IBM L;  1L1O C;  3J80 L;  1AZQ A;  5C3E H;  1KD1 C;  5JOB A;  2PI2 A;  3PIO 3;  4NW2 A;  1D2B A;  3Q22 A;  4GNX B;  2FXQ A;  5M5X H;  3VR2 A;  4AQY L;  4HSP A;  3RR5 A;  4JCV E;  2NBF A;  5GQO A;  1SMY D;  3K57 A;  2ZTD A;  3VR6 A;  3RMH A;  2Z1C A;  4LUZ A;  2F0E A;  4A3J G;  1D7Q A;  2WKD A;  3KF8 A;  3OMG A;  4TQU S;  2F0W A;  3KDF A;  3GTJ B;  2QF7 A;  3BDC A;  4ZYS A;  2V1C C;  1KXL A;  2A5H A;  3IFD A;  5A2Q L;  2F4I A;  4OIJ A;  4R4C A;  5C3E G;  2PZT A;  5EPK A;  5IOD A;  2JA7 B;  2ASB A;  1PYW D;  3BZD B;  4R1J A;  5CBE E;  1HNZ L;  1WD0 A;  1B4O A;  1FVI A;  1B9N A;  3S1Q B;  4C56 C;  2MNA A;  4RGO S;  1QB5 D;  4JBK A;  1DCZ A;  4IJL A;  4DR3 L;  3SDZ A;  4IUT A;  1Q1B A;  3PUV A;  2XWJ B;  4OO1 H;  3T16 A;  2JQO A;  4C3I G;  2VL6 A;  3CU7 A;  2GVB A;  1Y8O B;  4DV4 L;  1XMQ Q;  4DK1 A;  2JEA I;  4K0K Q;  2NTS A;  1EOV A;  2H5X A;  2O4X A;  2WAQ G;  1AEX A;  2E2I H;  1YIJ A;  1YIT A;  2UXC L;  2L0C A;  3VR3 A;  3CKI B;  5CV4 A;  4DXF A;  2M9V A;  1E2W A;  5M3M B;  1EEF D;  2F52 A;  4KY7 A;  3AFP A;  3GV3 A;  4RGT A;  1M1K C;  1JJC B;  3KBX A;  4MNO A;  3NWS A;  4ODG A;  3I4M H;  4RKL A;  1STE A;  1SLJ A;  2IHE A;  3I8Z A;  3KJO A;  1RKN A;  3HOY H;  1PZK D;  4ZUI A;  4HJ8 A;  2ICE C;  1EZ8 A;  3MTS A;  3I73 A;  2Q2H A;  3RN2 A;  4OO1 G;  3S17 B;  4K5X A;  2D0P A;  4JI6 L;  1VQG A;  3HEJ A;  3MFG A;  4EQO A;  4WJ3 M;  1E1T A;  4H44 C;  3D6C A;  3I7F A;  2Q2T A;  4CJ1 B;  4JI4 L;  2D2C C;  4OHJ A;  4LF6 L;  3I2Z A;  1C7Y A;  5KGU A;  5FLX c;  3DEO A;  4A3K G;  4IO9 A;  2B2U A;  3Q24 A;  3A56 A;  3I4M G;  2OQK A;  5LMN Q;  3G71 A;  4K5W A;  1YBY A;  1C48 A;  3JAM L;  1E22 A;  3C1F A;  2L5T A;  4GN4 B;  1NMG A;  3F8T A;  4TRD A;  1CA5 A;  3CC2 A;  1GKH A;  2ZM6 Q;  3S9W A;  3NXW A;  4OEL B;  1FJG Q;  3PO2 H;  1W3S A;  1JJG A;  2R92 B;  4KV6 A;  2SNS A;  1UNS A;  4HJA A;  1VQL A;  2J0T D;  1TY0 A;  1H9K A;  3NUC A;  2Z0S A;  2EYM A;  4DV1 Q;  1FGB D;  2VQF L;  1KIX A;  1YNN C;  3X3N A;  3TDQ A;  3P75 A;  1VF5 C;  3VYS A;  3HP3 A;  1S4Z A;  2PQE A;  1UE7 A;  1EY6 A;  2EQS A;  2HHH L;  2Z4H A;  1CSQ A;  1STN A;  3CHB D;  2B8F A;  1XJV A;  2OQ0 A;  4S3S A;  2B29 A;  1XWE A;  4DGZ A;  3J80 i;  4AQY Q;  1XTC D;  4K5V A;  1TY2 A;  1G2T A;  3PO2 G;  2IW3 A;  4LAA A;  3CCQ A;  4DV2 L;  2B3G A;  4KD4 A;  3U4Z A;  4DR4 L;  2EYL A;  4BBS H;  3M4O B;  1TR5 A;  2L9H A;  2VS1 A;  2UU9 L;  2F03 A;  5E3F A;  4JBM A;  5GRO A;  3SK5 A;  1P16 A;  3RD4 A;  1G8Z D;  1K73 C;  2JJQ A;  2DGY A;  3FHW A;  3KK7 A;  4DR6 L;  2O5J C;  3TP8 A;  2QW7 A;  2NZ1 D;  3D4D A;  3D8G A;  1HNZ Q;  1STG A;  4UY8 C;  2G9D A;  1VMP A;  2F0K A;  2I46 A;  3KBG A;  3FVQ A;  4XDX A;  1C8C A;  4GNX A;  1NMF A;  3GTO H;  2PYK A;  3S15 H;  1EFI D;  1NBW A;  3GTK B;  1B9M A;  4JK1 C;  4DR3 Q;  1AZP A;  1CFM A;  5M3F B;  3FKI H;  2EOT A;  1CT1 D;  5J3B A;  3QIA A;  2NVX H;  3F2D A;  1S5D D;  1LLR D;  5LL6 S;  3PMF A;  4DV4 Q;  4KHV A;  4CJ2 C;  4JI7 Q;  1Z9F A;  1SBB B;  2JA8 B;  1PV4 A;  4RG1 A;  3BG3 A;  1CHP D;  2UXC Q;  2B63 B;  3OTO L;  4YHH L;  5ELE A;  4HID A;  3DWP A;  2GVA A;  1HA5 A;  2YTV A;  2JA5 G;  2MQH A;  1X65 A;  5IE8 A;  1QNU A;  4UP9 A;  4A3I B;  3A8K E;  3QJY A;  5M5W B;  3QR8 A;  4LF9 L;  3HFZ B;  4DV3 L;  2EXZ A;  3I90 A;  3VYU A;  1J5E L;  3J7A F;  3OYY A;  4A3M B;  2P5Z X;  1A0I A;  3FKI G;  4RKB A;  4U67 3;  2R93 B;  1LYL A;  3GTJ H;  2K28 A;  3J81 L;  3RZD B;  4JI6 Q;  1ZKO A;  1RHP A;  1TVX A;  2I5M X;  1V8Q A;  1TXY A;  2MUY A;  1LTI D;  2KHI A;  2UUA L;  4KKU A;  4LF7 Q;  2JA7 H;  1EU3 A;  4JI4 Q;  5EBD A;  3K5O A;  5FLM H;  4F87 A;  4A3D G;  1EY8 A;  4LF6 Q;  1RCV D;  3TME A;  3S1Q H;  4PQX A;  1PH6 A;  1HZB A;  1H9S B;  4B08 A;  1B53 A;  1BOS A;  1Q8K A;  3GTP B;  1CQV A;  1HUN A;  1TS5 A;  3R2I A;  3HG9 A;  2FHT A;  3H94 A;  1PYS B;  4QUF A;  4GS3 A;  4PNY A;  2X6G A;  3UE1 A;  3PO3 G;  3K81 C;  3JAM i;  2RSO A;  4YWK A;  4I7Z C;  3JC6 6;  4HTH A;  3NBI A;  3WOE A;  1TS3 A;  1WYD A;  4DV0 Q;  4JC0 A;  4IPH A;  5T1G A;  3IRB A;  1S5F D;  2PNR C;  2IL8 A;  1SE2 A;  1TWG B;  3FRP B;  1JJ2 A;  2VQF Q;  4DV5 Q;  1KDB A;  4A3G H;  1G2S A;  2Q2I A;  1AE2 A;  2OEO A;  2WKC A;  4HAE A;  1VQ7 A;  3MFY A;  2UUB Q;  1F2L A;  1Y1V H;  5M3M H;  1BR9 A;  1TWF B;  4H13 C;  2EE1 A;  4FVM A;  4K6D A;  1DOK A;  5HGQ A;  4L5S A;  3OPO A;  3S17 H;  3ULL A;  2CW0 C;  4DV2 Q;  2RDH A;  2N3S A;  1CSP A;  1WFQ A;  3S1N B;  3M7N A;  1F77 A;  4UDU C;  5CYU A;  4A3J B;  4DR4 Q;  3K58 A;  2NZH A;  1O7L A;  3BDO A;  3VR5 A;  1I94 Q;  4CDD C;  1PH2 A;  1EIY B;  4A3G G;  2IX0 A;  2UU9 Q;  4X62 L;  1K8G A;  2N55 A;  3G6J B;  5J1Z A;  1SEB D;  4FP5 D;  1Y1V G;  5M3M G;  3I72 A;  4HJ7 A;  5FJ8 H;  5JPM C;  1N34 Q;  4DR6 Q;  2QEJ C;  3S14 B;  3HZX A;  1KAA A;  1HNX Q;  3K5N A;  1Y1W G;  4KK7 A;  1Q82 C;  4N9T A;  2ZT9 C;  1A63 A;  3VYT A;  4NPS A;  5AFW A;  4MN3 A;  1JOR A;  1MGS A;  2R92 H;  3QOL A;  5BN5 A;  1EEI D;  3H09 A;  1A2T A;  4UP8 A;  4B9X A;  1WCM B;  5IP7 H;  1MSH A;  3QG1 A;  3ERS X;  4XYQ A;  1QZH A;  2UXB L;  3ONA B;  1VQH A;  4C3I B;  5IGD A;  5EKK A;  5HGT A;  2F3W A;  1D5X C;  1AFP A;  1ZXT A;  4XTC S;  5CGK A;  2R6G A;  3I56 A;  1OXU A;  1KRT A;  3OMC A;  1YHQ A;  3FEW X;  1X32 A;  4YHH Q;  2BA1 A;  4O1N A;  4TSS A;  1I4G A;  1B3A A;  3RLN A;  1KNA A;  5FK9 C;  3H0G H;  5I9P A;  4NDX A;  4DV3 Q;  1VQO A;  4GN5 A;  1J5E Q;  1RJT A;  3IFT A;  2IY5 B;  3D6W A;  3M4O H;  4V0B A;  3S1M B;  1QUQ B;  2XRQ D;  3GQB A;  2F0U A;  1DGS A;  3FPU B;  1TQO A;  4WJ4 A;  1EYG A;  3K0Y A;  2ZTE A;  1L0X B;  4UPA A;  2QCP X;  5C4Z A;  1K0S A;  2UUA Q;  5EPJ A;  3J81 i;  3SEB A;  4QL5 A;  3WOF A;  5DAU A;  1HPC A;  1XPU A;  1UAP A;  2A69 C;  4IOA A;  4A3K B;  1EY9 A;  3H0G G;  4B3R Q;  3HOU B;  3I4M B;  1NY4 A;  1B8A A;  4N9P A;  5CV8 A;  3GTK H;  2UUC L;  4DAM A;  3GDE A;  3KJP A;  1LO5 D;  3SK6 A;  1GM5 A;  2NVT B;  3T51 B;  1QVF A;  5M3F H;  5E7N A;  5J39 A;  4DUZ L;  3K8A A;  3BU2 A;  1HQR D;  3BYY B;  3OIQ A;  3ERO A;  2JA8 H;  2CQO A;  2N78 A;  3D4W A;  1TS4 A;  4OL7 A;  5ELD A;  3UDX A;  4GOP B;  3H3V H;  2VW9 A;  2JK8 A;  2AMC B;  1YJN A;  1EY7 A;  3J7Z C;  2M2L A;  1FL0 A;  1OXX K;  2TSS A;  2VY3 A;  4A3I H;  4BBR H;  1HR0 W;  4JI1 L;  5M5W H;  1I4P A;  2RDF A;  3CC4 A;  1Q8I A;  5EAY A;  3TSS A;  4FF3 A;  1H9S A;  2WAQ E;  4NXN L;  4A3M H;  1OXT A;  4PZ8 A;  2R93 H;  3E5S A;  1PH5 A;  1S5E D;  3KLR A;  2L1B A;  2IHF A;  1TWH H;  3P20 A;  2SOB A;  1HCZ A;  2L55 A;  3PO2 B;  5IYB G;  4M8A A;  2K5W A;  4K0K L;  2HDL A;  2XWB B;  1B70 B;  1GUS A;  2CH4 W;  1VQE A;  4QF4 A;  4X62 Q;  2NTT A;  5NUC A;  2PNH A;  2ZXR A;  4B3S Q;  4XXE A;  4JOI A;  1SNC A;  3OW7 A;  4BBR G;  2AKW B;  5IIF A;  3G4S A;  1D1K A;  3AFQ A;  1SYB A;  3GTP H;  4A3L H;  3I4N B;  4F8M A;  2EVB A;  2OTJ A;  4O0A A;  1JOQ A;  2HCC A;  1HTP A;  5C0X H;  3IL8 A;  1KDA A;  1WTR A;  3GO5 A;  1CKM A;  3R2T A;  4PG3 A;  2KBN A;  2CHB D;  2L12 A;  2A19 A;  3GTQ H;  2X6L A;  1WTV A;  2TMP A;  2UXB Q;  2HCI A;  4KN4 C;  4JYA L;  1F2M A;  3BVM A;  3MAQ A;  1YNN D;  5ELN A;  2AQ3 B;  2EY5 A;  1PTO B;  1WOC A;  5G3L F;  4FF1 A;  2IX1 A;  1VQ8 A;  2PQA B;  1VQN A;  1I5F A;  2MPM A;  4WFN 3;  1QZG A;  3MZ5 A;  4CKC A;  2JA5 B;  4KKT A;  4LF5 L;  1JQY D;  3D3R A;  3MEH A;  2VQE L;  2K03 A;  2PZU A;  5JPN C;  3NPP A;  1XNQ L;  1HTL D;  2RF4 A;  4A93 H;  2E2H B;  1JIC A;  1ONL A;  3F1Z A;  2XGT A;  4DK6 C;  1DZ1 A;  1R9T B;  1SN8 A;  1EWC A;  4DKA C;  2LS0 1;  1YJW A;  2CQA A;  2WAC A;  4UHV A;  4DV1 L;  4LF8 L;  1G6P A;  3IKJ A;  1ILP A;  2VNU D;  1C0A A;  4EGV A;  4RFB A;  4EVO A;  1Z47 A;  1SJH D;  5IT9 c;  1CZG A;  1JR0 D;  2RCF A;  3ITP A;  1N8R C;  3HGB A;  3ND8 A;  3S14 H;  3TS0 A;  2IT1 A;  5HY6 A;  1CUK A;  4A3D B;  2I5H A;  4MHE A;  2DY8 A;  2PMZ B;  3EBE A;  4DAP A;  5COR A;  4DUY Q;  3W1B A;  4LFB L;  4DK0 A;  1I6V C;  1XTD A;  1XMO L;  3T56 B;  4A93 G;  1EUJ A;  4L6T B;  2UUC Q;  2MJ8 A;  5GAH C;  1WCM H;  1G51 A;  5DM6 3;  3MEF A;  2ALY B;  1GUN A;  4DUZ Q;  4C3I H;  1ENF A;  3PQI A;  3PO3 B;  1CKO A;  5C5M A;  4RMF A;  5EKI A;  1QUQ A;  1T5X D;  4OO1 I;  1I4Q A;  1I4H A;  4PZ7 A;  3U58 A;  5FLX L;  4HIM A;  5K36 G;  2F0I A;  3B6Y A;  3BZC A;  5KYL A;  3TP5 A;  3EIV A;  3RUZ A;  1SNM A;  5IT9 E;  1U4L A;  1SYD A;  1V1O A;  1PLF A;  3R8B A;  3LWU A;  4JI1 Q;  3LWE A;  1X55 A;  2JSO A;  2CH4 A;  2OXP A;  3Q0A A;  1EY0 A;  2Z6K A;  3L0O A;  2F0M A;  4NXN Q;  2JP1 A;  4JI2 Q;  1TS2 A;  1WCM G;  2KOL A;  4JBJ A;  5KYI A;  3S1M H;  1I50 B;  1WTP A;  1JCK B;  4DV7 L;  3MXP A;  2PCF B;  4YIJ A;  4JI7 L;  1SMX A;  1QNK A;  2G9H D;  4HR7 B;  5C0X J;  1DXM A;  4IZ8 A;  4PMC A;  4A3F H;  3CPF A;  3L2P A;  1OTC A;  3W1G A;  4A3G B;  3M3Y B;  1I4R A;  3K7U C;  2A74 C;  4GOP A;  4X3K A;  5ELF A;  3HKS A;  1Y1V B;  1HJP A;  3C2P A;  4A3K H;  1SRO A;  3HOU H;  4RWS C;  2ZXO A;  4MZ9 A;  2NVY B;  3PIP 3;  2K5Q A;  1AN8 A;  4QIW B;  2ENB A;  1Y1W B;  2NVT H;  1Y8N B;  1NNX A;  2EJF C;  5GAD C;  2I07 B;  3ERQ A;  4ID6 A;  4MTK A;  2R7F A;  1IKM A;  3PCO B;  2K01 A;  2PMZ E;  1LAC A;  4A3F G;  4JYA Q;  1HZC A;  1EIG A;  3Q8D A;  4LF7 L;  2LXJ A;  3CPW A;  4LFA Q;  1C9O A;  1Q12 A;  3F2B A;  1HFG A;  5ELC A;  3K59 A;  2XRS D;  4UAI A;  4YY3 L;  2RHS B;  1IW7 D;  3U9S A;  2Y0S B;  3CMA A;  3H91 A;  1PFM A;  2K6A A;  1SYC A;  1G91 A;  2ID0 A;  3HOU G;  1U0L A;  2JA6 H;  2B2T A;  3G7L A;  3HOZ G;  4HN7 A;  4A3C G;  1DD2 A;  4LNQ A;  1ENC A;  4LF5 Q;  1LM0 A;  3M4P A;  4LUO A;  4NMZ A;  2VQE Q;  1VQK A;  4EQN A;  2K75 A;  1JE5 A;  2CW0 D;  3V05 A;  1XNQ Q;  4QY7 A;  1ESF A;  2F0O A;  4HCE A;  2LFN A;  1NE3 A;  4DV0 L;  1ML0 D;  4G7H C;  1SE3 A;  3I70 A;  4JI5 L;  3NSW A;  1MJE A;  4BY1 G;  3J80 E;  4LF8 Q;  3TQY A;  1KLU D;  2VB2 X;  1W6K A;  4DV5 L;  2BOS A;  3OOC A;  4PZ6 A;  4GOP C;  1K8M A;  2NZO A;  1SE8 A;  1SRU A;  2UUB L;  3UDG A;  3M4Y A;  1MD2 D;  1ASY A;  4UP7 A;  4LFC L;  4XYO A;  2NN6 G;  4KJN A;  4L63 B;  4IQZ A;  1GD7 A;  4A4I A;  2JA6 G;  3K0X A;  1Q90 A;  4X6A H;  3I4N H;  2WP8 J;  1A8V A;  2JE6 I;  2XTI A;  4B3M L;  3ER0 A;  1SDF A;  1EQQ A;  2PQA A;  4LFB Q;  5FO8 B;  3EQL C;  3H0G B;  3CCL A;  4FNF A;  1XMO Q;  3DM1 A;  3H15 A;  1NAP A;  1G6Z A;  1U4P A;  4HMI A;  1I94 L;  4DNT B;  1VQJ A;  1WTO A;  3K5L A;  2BH2 A;  4QIW E;  2F3I A;  1ICF B;  1M8A A;  3J7A V;  1N9W A;  1PTO H;  2RVL A;  2IJ0 A;  2B2U C;  3V96 A;  1N34 L;  2QIL A;  4ZKC B;  2PZW A;  1HNX L;  3I4N G;  5I6Y A;  4IUV A;  1Q1E A;  3WDN A;  1EYD A;  2ZTC A;  4O42 A;  2JA5 H;  4B3T L;  2L11 A;  2N8N A;  1OXV A;  2E2H H;  1CHQ D;  2F1M A;  1L0Y B;  5E1F A;  3RZO H;  2EY2 A;  2AWN A;  1R9T H;  1ENA A;  4DV7 Q;  2NWG A;  5D14 A;  2FIN B;  3CCS A;  2ZJP A;  1VMC A;  4X64 Q;  1XNR L;  1LT4 D;  2ES2 A;  3RLO A;  1JOK A;  1PTO C;  1DYQ A;  3CCM A;  1K3B C; 
#chains in the Genus database with same CATH homology
 3HOZ H;  4UP8 A;  5IP7 H;  4A3C H;  3NEN A;  4IFD I;  3ERS X;  1QZH A;  4GLX A;  1IBL Q;  2UXB L;  2WB1 E;  1VQH A;  4QJF A;  4A3M G;  5GAE C;  3PSI A;  4A3D H;  4YCU A;  3STB C;  3E9I A;  3T1Y L;  4X66 L;  3RLF A;  1S40 A;  2R93 G;  4BA1 I;  2I5L X;  4XTC S;  3J80 c;  3A74 A;  4ALP A;  2R6G A;  5BR8 Q;  1OXU A;  4GLA C;  3I56 A;  3E0E A;  1KRT A;  4A75 A;  2HQL A;  3CP0 A;  1YHQ A;  4YHH Q;  2K5N A;  2ATW A;  1TWA H;  2BA1 A;  4BY1 H;  3PV0 A;  4IFD J;  3CCJ A;  2OCE A;  1WJJ A;  3TRE A;  1XPO A;  1TWG H;  3RLN A;  1VQF A;  4YWM A;  3CC7 A;  3PO3 H;  1VQ4 A;  1KC8 C;  1XPR A;  4JBW A;  4BY7 H;  3H0G H;  1YNX A;  4DPG A;  2YTX A;  4DV3 Q;  1VQO A;  2I0Q A;  2Z6K C;  4HIK A;  1TWF H;  1BBW A;  4GN5 A;  2F4V L;  1J5E Q;  4A3B H;  5IP9 G;  4A3L G;  5LMN L;  2WB1 G;  4BA2 I;  2IY5 B;  1PH7 A;  1VQM A;  4P73 A;  4YY3 Q;  1PH3 A;  1QUQ B;  1T9H A;  3M4O H;  3TRZ A;  4KHP L;  1DGS A;  1YI2 A;  4WJ4 A;  1D8L A;  1EYG A;  4JI3 L;  1BBU A;  2ZTE A;  1NTG A;  4OON A;  3DLL A;  4GNX C;  1X3G A;  5C0X G;  1K9M C;  4MTN A;  4UPA A;  4B3R L;  3HOW H;  2OWO A;  1X56 A;  2ZM6 L;  1JB7 A;  2UUA Q;  2F4V Q;  1Q86 C;  1V43 A;  4DR2 L;  4JI0 L;  3J81 i;  3G48 A;  1FJG L;  3S1N H;  3PUZ A;  2YU9 H;  4A3J H;  1PH4 A;  4QL5 A;  3HOY G;  1IXR A;  4KHP Q;  1N33 L;  1PA6 A;  1I50 H;  5AJ3 Q;  1OXS C;  3KF6 B;  4KLK A;  1XPU A;  2C35 B;  4IOA A;  1ASZ A;  4BY7 G;  1IYJ B;  3H0G G;  4B3R Q;  4LWC A;  1H95 A;  1NY4 A;  2RCN A;  1IBM L;  1B8A A;  1VQ9 A;  1L1O C;  4QQB X;  1U5K A;  4HIO A;  5C3E H;  3CCU A;  1KD1 C;  4JI5 Q;  2UUC L;  3GTK H;  2PI2 A;  4DAM A;  4A3B G;  3GDE A;  3KJP A;  2YTY A;  2WFW A;  4IPD A;  1GM5 A;  5M5Y H;  3CCR A;  1QVF A;  3M3Y H;  5M3F H;  5E7N A;  4GNX B;  4P72 A;  3I55 A;  2FXQ A;  5M5X H;  4DUZ L;  3K8A A;  3BU2 A;  4P74 A;  5IWA L;  4AQY L;  3AYH B;  4LFC Q;  3RR5 A;  4JCV E;  5GQO A;  1IBM Q;  1VQB A;  2ZTD A;  3VDY A;  2JA8 H;  2CQO A;  2N78 A;  3UDX A;  4C2M H;  2NVY H;  1KRS A;  5GAG C;  4LUZ A;  4B3M Q;  4A3J G;  3AQQ A;  4GOP B;  1HH2 P;  1D7Q A;  3H3V H;  1Y1W H;  2VW9 A;  2JK8 A;  2AMC B;  2K52 A;  4TQU S;  3KDF A;  1YJN A;  3FP9 A;  3J7Z C;  1FL0 A;  2V1C C;  1OXX K;  2VY3 A;  4A3I H;  1HR0 W;  4BBR H;  1KXL A;  4JI1 L;  1K3R A;  5M5W H;  4R4C A;  5C3E G;  3CC4 A;  1Y14 B;  5EAY A;  3M4Q A;  2WAQ E;  1YHB A;  4NXN L;  4R1J A;  3I4O A;  2ASB A;  4A3M H;  1OXT A;  3CF5 A;  1HNZ L;  2JA9 A;  4PZ8 A;  1FVI A;  4P75 A;  1PH5 A;  3RN5 A;  4C3H H;  2R93 H;  4B3S L;  2IHF A;  3OW2 A;  1L0W A;  1TWH H;  4OX9 L;  3M9B A;  4DAY B;  2KEN A;  3K7A H;  2Y0S E;  5IYB G;  1A62 A;  4K0K L;  2MNA A;  3J7A 5;  4NXM Q;  3HOV H;  2QGQ A;  2E2J H;  1B70 B;  1KAW A;  4JBK A;  4IJL A;  4TVA B;  4DR3 L;  1VQE A;  4X62 Q;  2AWO A;  3CW2 C;  1Q1B A;  4B3T Q;  1LUZ A;  1O7I A;  3PUV A;  2VUM H;  5H1S E;  5JJK A;  2PNH A;  3G6E A;  4JV5 L;  4B3S Q;  2JQO A;  4JOI A;  3NBH B;  1HZA A;  1TWC H;  2VL6 A;  2GVB A;  4DV4 L;  1XMQ Q;  2JEA I;  1UE1 A;  4K0K Q;  4BBR G;  2AKW B;  1EOV A;  2H5X A;  2WAQ G;  3U50 C;  3G4S A;  3AFQ A;  5IP9 H;  1VCI A;  1S72 A;  3GTP H;  4A3L H;  3JAM c;  3PUY A;  2E2I H;  1YIJ A;  1YIT A;  4DV6 L;  1X54 A;  3S2H H;  2UXC L;  4OWX B;  2OTJ A;  3CXC A;  4O0A A;  4BBS G;  3GD7 A;  1G29 1;  1E3P A;  4LW1 A;  4L5Q A;  1XNR Q;  3GTG H;  2Q2U A;  2Y0S G;  1HNW L;  3GO5 A;  1CKM A;  2F52 A;  4PG3 A;  3AFP A;  3UE0 A;  1EQR A;  2KBN A;  1JJC B;  1M1K C;  4MNO A;  3I4M H;  3HOV G;  2A19 A;  3GTQ H;  1SLJ A;  2IHE A;  3KJO A;  4A76 A;  1PH9 A;  2UXB Q;  1Q46 A;  5DLQ E;  3HOY H;  4JYA L;  1VS0 A;  2VUM G;  4HJ8 A;  3T1Y Q;  4X66 Q;  5ELN A;  2Q2H A;  3RN2 A;  5IYD H;  1EWI A;  4OO1 G;  1YHA A;  1WOC A;  4R4O A;  1HZ9 A;  3W5O A;  1WI5 A;  2D0P A;  5LMU L;  2OTL A;  4JI6 L;  1VQG A;  3A5U A;  3KOJ A;  4X65 L;  4WJ3 M;  1CKN B;  3CCE A;  2IX1 A;  4GKK L;  1E1T A;  1VQ8 A;  5JJL A;  1VQ6 A;  2PQA B;  1VQI A;  1I5F A;  2DUD A;  1RL2 A;  1VQN A;  3I7F A;  1QZG A;  2Q2T A;  2EIF A;  4JI4 L;  3CQZ H;  4LF5 L;  3UDI A;  2VQE L;  4LF6 L;  3I2Z A;  1C7Y A;  4DR7 L;  4IJH A;  5FLX c;  1XNQ L;  2RF4 A;  4A3K G;  4IO9 A;  4A93 H;  5IYC G;  3I4M G;  2OQK A;  2CKZ B;  5IY0 A;  5LMN Q;  3F1Z A;  3G71 A;  1VQP A;  2XGT A;  1YBY A;  4DK6 C;  3KF8 B;  1PFS A;  1E7Z A;  3U4V A;  1SN8 A;  1E22 A;  4DKA C;  1N32 L;  4JI3 Q;  2A1A A;  4GN4 B;  4HJ9 A;  1YJW A;  1NMG A;  4DV1 L;  5IYD G;  4LF8 L;  2R92 H;  3H3V I;  3F8T A;  1G6P A;  2LSS A;  4DUY L;  3CC2 A;  1I6H H;  1C0A A;  2VNU D;  1GKH A;  2ZM6 Q;  4KHZ A;  1Z47 A;  2CWP A;  2D62 A;  5IT9 c;  3KYH C;  2QA4 A;  1BKB A;  4POF A;  4DR2 Q;  1W3S A;  4JI0 Q;  1FJG Q;  1M90 C;  1N8R C;  3PO2 H;  1JJG A;  1KHI A;  1GO3 E;  2K50 A;  4A3E G;  3S14 H;  1KL9 A;  4EQ5 A;  4R4Q A;  4HJA A;  1VQL A;  1N33 Q;  3TS0 A;  2IT1 A;  4J15 A;  4P71 A;  5HY6 A;  2Z0S A;  1CUK A;  2E5L L;  2I5H A;  4LF4 L;  4DV1 Q;  1KIX A;  2VQF L;  3ICE A;  3EBE A;  3E9H A;  3PF5 A;  4DUY Q;  3W1B A;  4LFB L;  4DR5 L;  3A5Z B;  4DNI A;  5IYB H;  1XTD A;  3PF4 A;  3ZJY C;  4YWL A;  1XMO L;  1UE7 A;  4A93 G;  1EUJ A;  2UUC Q;  2EQS A;  2HHH L;  1V9P A;  5GAH C;  1CSQ A;  4OWT B;  4JI8 L;  2QEX A;  1WCM H;  1IL2 A;  1G51 A;  3A0J A;  1K0R A;  1XJV A;  2K5H A;  2E5L Q;  2JA7 G;  2OQ0 A;  3MEF A;  2ALY B;  3NEM A;  2B29 A;  2ZJR A;  3S24 A;  4DUZ Q;  1IBK L;  3J80 i;  4C3I H;  4GKJ L;  5IWA Q;  4AQY Q;  1AH9 A;  1CKO A;  5FLM G;  4RMF A;  3CCV A;  1QUQ A;  1L1O B;  3HKZ E;  4APV A;  4OO1 I;  4PZ7 A;  3U58 A;  5K36 G;  4HIM A;  1AE3 A;  1UWV A;  3B6Y A;  3BZC A;  1BVS A;  1X6O A;  3PO2 G;  3CCQ A;  2HHH Q;  4DV2 L;  2B3G A;  1B7Y B;  4JG2 A;  4JI8 Q;  3U4Z A;  4DR4 L;  3EIV A;  4JI2 L;  1IZ6 A;  4BBS H;  1IBK Q;  3LGJ A;  3PIO A;  3F2C A;  2VS1 A;  3D0F A;  2UU9 L;  2UXD L;  4JI1 Q;  4JBM A;  3KF6 A;  5C0X I;  5GRO A;  1P16 A;  1X55 A;  1SR3 A;  1K73 C;  2VZA A;  2DGY A;  2Z6K A;  2JJQ A;  3FHW A;  3L0O A;  1YJ9 A;  4NXN Q;  4DR6 L;  1PVO A;  4JI2 Q;  4JBJ A;  1WCM G;  1HNZ Q;  4UY8 C;  1MKH A;  3S2D H;  3S1M H;  4AH6 A;  1N36 L;  3J81 c;  3HKZ G;  4DV7 L;  4EX5 A;  3S16 H;  4IPC A;  4OX9 Q;  3CME A;  3MXN B;  4JI7 L;  4GNX A;  1NMF A;  1SMX A;  5C0X J;  3GTO H;  1QVG A;  3S15 H;  4A3F H;  1NBW A;  1YZ6 A;  3CPF A;  3L2P A;  1OTC A;  3TS2 A;  1HR0 L;  1P8L A;  3W1G A;  4DR3 Q;  4DR1 L;  3J81 j;  1W2B A;  2KCM A;  4JV5 Q;  3FKI H;  5J3B A;  2BA0 A;  1VQA A;  3K7U C;  2NVX H;  4GOP A;  1QVC A;  3F2D A;  3HKS A;  3KFU A;  3CD6 A;  1HJP A;  4DV4 Q;  4JI7 Q;  4YCV A;  4GN3 B;  4A3K H;  1SRO A;  1Z9F A;  5IYC H;  3HOU H;  2RHQ B;  1PV4 A;  4RG1 A;  4MZ9 A;  2CWA A;  1HR0 Q;  5BR8 L;  4DV6 Q;  2UXC Q;  3OTO L;  3HOX H;  4YHH L;  1K8A C;  4HID A;  2NVT H;  2GVA A;  1VQ5 A;  4LFA L;  1JT8 A;  5GAD C;  1HNW Q;  2YTV A;  2JA5 G;  2MQH A;  1X65 A;  3UDF A;  5IE8 A;  1UE6 A;  2R7F A;  3PCO B;  4UP9 A;  2PMZ E;  3K80 C;  4Y7N H;  5FJ8 G;  4LF9 L;  1UEB A;  4A3E H;  4A3F G;  3HFZ B;  4DV3 L;  4JYA Q;  2GN5 A;  1HZC A;  3OTO Q;  4AIM A;  3Q8D A;  4LF7 L;  1J5E L;  3OYY A;  2LXJ A;  3CPW A;  4LFA Q;  1C9O A;  1A0I A;  1Q12 A;  3FKI G;  3F2B A;  3BZK A;  4YY3 L;  1UE5 A;  2MFI A;  2HT1 A;  1LYL A;  3GTJ H;  2RHS B;  1YEZ A;  3PUW A;  3CMA A;  5LMU Q;  4HJ5 A;  1LTL A;  4JI6 Q;  4L5T A;  2I5M X;  4X65 Q;  2ID0 A;  3HOU G;  1TXY A;  4R4T A;  1U0L A;  4NB3 A;  2HIX A;  4LF9 Q;  4GKK Q;  2JA6 H;  2KHI A;  4OWW B;  2R92 G;  2UUA L;  1JMC A;  4LF7 Q;  2JA7 H;  1YVC A;  4XIG S;  3PGZ A;  3HOX G;  3HOZ G;  3KDF B;  5IP7 G;  4A3C G;  5C4J H;  4LNQ A;  5JEA G;  4JI4 Q;  4YCW A;  2CCZ A;  4LF5 Q;  1Q7Y C;  1LM0 A;  3PIP A;  3M4P A;  4LUO A;  2VQE Q;  5FLM H;  4A3D G;  4JOI C;  4LF6 Q;  4DR7 Q;  1VQK A;  2JEB I;  3ULJ A;  2K75 A;  1JE5 A;  5AJ3 L;  1XNQ Q;  2D0O A;  2ZJQ A;  2L15 A;  4QY7 A;  1Q81 C;  3S1Q H;  4BXX H;  3D31 A;  1PH6 A;  1HZB A;  1EFW A;  1K83 H;  1J6Q A;  2K5V A;  1L2F A;  2N49 A;  1Q8K A;  1E24 A;  1NE3 A;  4ME3 A;  4DV0 L;  1SFO H;  1MJC A;  4JI5 L;  1PHJ A;  1N32 Q;  2R7Z H;  2E8G A;  4O2D A;  4BY1 G;  1MJE A;  4LF8 Q;  3TQY A;  4DV5 L;  2HIV A;  3TEH B;  5C4X H;  1EIF A;  1PYS B;  2LXK A;  4PZ6 A;  2MO0 A;  4GS3 A;  4GOP C;  3UE1 A;  2NZO A;  2UUB L;  1SE8 A;  1SRU A;  3PO3 G;  2AHO B;  3K81 C;  3BJU A;  2KCT A;  3UDG A;  3JAM i;  4YWK A;  1ASY A;  4UP7 A;  4LFC L;  3JC6 6;  2NN6 G;  1VQD A;  4DV0 Q;  4Y52 H;  1GD7 A;  1WYD A;  4A4I A;  2JA6 G;  3K0X A;  4JC0 A;  4IPH A;  4IFD G;  3SGI A;  4X6A H;  3IRB A;  1FGU A;  4IOC A;  3I4N H;  2WP8 J;  4AYB E;  1A8V A;  1CKN A;  2JE6 I;  2XTI A;  2K4K A;  3PUX A;  4B3M L;  4LF4 Q;  3ER0 A;  2VQF Q;  4DV5 Q;  1EQQ A;  1JJ2 A;  1V1Q A;  2PQA A;  4A3G H;  1GVP A;  2K14 A;  3T1H L;  2A8V A;  4LFB Q;  2CFM A;  2Q2I A;  1AE2 A;  4DR5 Q;  1VQ7 A;  2UUB Q;  2YYZ A;  1X3F A;  5C44 H;  3CCL A;  4BXX G;  3ULP A;  1XMO Q;  3DM3 A;  1Y1V H;  5M3M H;  3H15 A;  2NVQ H;  4QGU A;  4GLV B;  3HOW G;  5ELO A;  4R4I A;  5JJI A;  2R7Z G;  4GKJ Q;  2B63 H;  1MIU A;  5HGQ A;  1I94 L;  4L5S A;  3EN2 A;  1S3O A;  3STB D;  3T1H Q;  1I3Q H;  1VQJ A;  5C4X G;  1X9N A;  2R7D A;  4KI0 A;  2BH2 A;  4QIW E;  2F3I A;  4PMW A;  3S17 H;  3ULL A;  1N9W A;  2BH8 A;  4L5R C;  3L7Z C;  4DV2 Q;  2N3S A;  1CSP A;  1WFQ A;  1N34 L;  3M7N A;  4FDB A;  4DR4 Q;  4AYB G;  2NZH A;  4NXM L;  2PI2 E;  2YV5 A;  4OXP A;  1HNX L;  3I4N G;  1PH8 A;  2KHJ A;  1I94 Q;  1PH2 A;  1KQS A;  1EIY B;  1PH1 A;  1Q1E A;  2ZTC A;  4A3G G;  2IX0 A;  2UU9 Q;  4X62 L;  2JA5 H;  1K8G A;  4DK3 C;  5M3F G;  4B3T L;  3KLW A;  2UXD Q;  1NJI C;  1X3E A;  5C44 G;  2N8N A;  4X64 L;  1Y1V G;  5M3M G;  3RZD H;  4HJ7 A;  5FJ8 H;  3RNU A;  3M85 A;  1OXV A;  1N34 Q;  2E2H H;  2MO1 A;  1XMQ L;  4DR6 Q;  4LUV A;  3S1R H;  2JA8 G;  1HNX Q;  3RZO H;  4IPG A;  4C3J H;  2AWN A;  1R9T H;  1N36 Q;  2B63 G;  4DV7 Q;  1IBL L;  3CAM A;  1PYB A;  1Y1W G;  1Q82 C;  3GTL H;  3CCS A;  5JEA J;  1A63 A;  3NEL A;  2ZJP A;  1E1O A;  4X64 Q;  3WWV A;  1XNR L;  3GTM H;  4NPS A;  1VQC A;  5LMN W;  1RIP A;  2ES2 A;  4A3I G;  3RLO A;  1L1O A;  3AEV A;  4H02 A;  4POG A;  3CCM A;  2EXD A;  4DR1 Q;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...