2VQFQ

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqfQ00
4DUYQ 4DR2L 4LF4L 2N49A 4JI7Q 3KDFB 1Z9FA 1PH3A 1I94L 4LF9L 1GKHA 3PIOA 3IRBA 4EX5A 4A3BH 1HH2P 3HOYG 1UEBA 2R93H 1IZ6A 1CKMA 3KF8B 1E22A 1XMOL 1XPOA 3ZJYC 4B3TQ 3BZCA 2ZM6Q 1Q8KA 2MFIA 4OX9Q 4GKKL 2YYZA 3DLLA 3GTQH 1UE5A 3A74A 3F2BA 1SE8A 2DGYA 1TWAH 4DV3L 1Y1VG 2CFMA 2DUDA 2HIXA 4MNOA 4YY3L 4Y7NH 5C0XJ 1WYDA 3DM3A 2R7ZH 5GAGC 5C44G 3G4SA 1XNQL 4JV5L 2ID0A 4JI1L 4GNXA 3I56A 2A1AA 1QZGA 1LYLA 1LM0A 4PZ8A 3HOYH 3RZOH 4YWKA 2FXQA 5FLMG 2VQFQ 1M1KC 3CC4A 1XNRL 3CD6A 1T9HA 4P71A 1K83H 3CW2C 3W5OA 2GVAA 2NN6I 4YWLA 1R9TH 4DR4Q 4C3IH 4A3DG 4GKKQ 4PZ6A 3BZKA 4POFA 1HNXL 1K0RA 3OTOQ 3GO5A 2BA0A 1DGSA 4DV6L 1VCIA 4OWXB 2E5LQ 1V43A 4A75A 1X9NA 1WCMH 1KIXA 2NVQH 1NBWA 4O2DA 1PV4A 3CCUA 1KAWA 1YEZA 4DAYB 2OTLA 3MEFA 4Y52H 4JI5L 3U4ZA 3CCEA 4IPDA 1PH1A 4JOIC 1X6OA 2KCMA 3ICEA 4L5TA 1HNZQ 1BBWA 4HIMA 2QA4A 2OQ0A 3TQYA 4A3KH 1A63A 1PH9A 2UUAL 4X62L 4QL5A 1AE2A 3VDYA 1S40A 3J80i 4C2MH 4RMFA 3KJOA 2ASBA 3M4OH 2PI2A 4LF7Q 3HOVH 2Z0SA 4B3TL 2K5NA 1VQEA 1FJGL 3GTOH 1HR0Q 3S2HH 2Y0SG 4DV0Q 3L7ZC 4NXMQ 3HOZG 3J7A5 1J5EQ 1NMFA 2PI2E 1XPRA 4DR6L 1XNQQ 1Q1BA 3J7ZC 2K75A 1N32Q 2R7FA 4J15A 3I4OA 3H0GH 2K5HA 4DV2L 4YY3Q 3CAMA 2A19A 3K81C 3CCVA 5M3FG 5JJLA 3D0FA 1W3SA 3J81i 4JI0Q 1UE6A 4JOIA 2C35B 3AYHB 2B63H 5IT9c 1PH4A 1Y1VH 1VQFA 3JAMc 3G48A 1VQMA 3K7AH 4BY1H 3PF4A 3PUWA 4DV1Q 4A93H 1YHAA 3SGIA 2R7ZG 2L15A 3W1GA 2A8VA 3M4PA 4YCUA 4AQYQ 5JJKA 4X66Q 4JI6Q 3S15H 1U5KA 2OQKA 4BBSG 1WCMG 5M5WH 2GN5A 5C0XI 2UXBQ 4NB3A 1L2FA 2YTYA 4LW1A 2JE6I 3CXCA 1X3GA 2K14A 2VNUD 2NZOA 3H0GG 2V1CC 4P75A 1Q1EA 5IWAQ 1HR0W 3S1QH 1VQBA 2CCZA 1N8RC 3PSIA 4OXPA 2HHHL 1IYJB 4JI3Q 4LF6Q 4H02A 5GAEC 1KD1C 2I5MX 2EIFA 3E9HA 3I7FA 3PUYA 4R4TA 2ALYB 1X55A 1UE7A 3M9BA 4APVA 3HOXH 1K8GA 2RCNA 4HIDA 1YZ6A 3S1NH 1A0IA 5J3BA 2PMZE 4BA1I 3RZDH 3HKZE 3S17H 3J80c 2YV5A 2KHJA 2RHSB 4DAMA 3S1RH 2F52A 5C44H 4P74A 1G51A 1NMGA 1E1TA 1FL0A 2WB1E 3E0EA 1Y1WG 2E5LL 3CMAA 4HJ7A 1PH8A 4WJ4A 4PZ7A 1EOVA 2JA5G 4X65Q 4NXNQ 4A3GH 3PIPA 1PHJA 3CCLA 1PFSA 1KXLA 4RG1A 4X64Q 1I50H 1AE3A 3GTKH 1HZAA 2N3SA 2XTIA 4JBWA 5AJ3L 3H15A 2CQOA 4B3SL 4LUZA 5M3MG 2PNHA 1TWCH 1PH6A 4JI4Q 2NVXH 3PUVA 1HZ9A 3EIVA 4QJFA 1VQPA 2BH2A 1KC8C 1AH9A 3JC66 2OCEA 4PG3A 4DUZL 3CCRA 4JI5Q 2R93G 3D31A 3I4MG 3GTPH 2VW9A 3PV0A 3CCSA 1FJGQ 4JCVE 2HQLA 3S14H 2VS1A 4IJLA 3CMEA 4A3KG 4DR4L 4K0KQ 4GN4B 1XNRQ 4QGUA 1TWGH 4P73A 4HJ9A 1CKNA 4JI8Q 3FP9A 5IP7G 1HNXQ 1CUKA 1EQQA 3PO2H 1EYGA 1BKBA 4DUZQ 4JBMA 5K36G 4MTNA 3HKSA 1ASZA 2JEAI 3CCJA 4A3IH 4DR2Q 4HIOA 3PO3G 4A3MG 1N32L 5IP9H 5LMNL 2PQAA 2PQAB 4TVAB 3L2PA 1OXTA 4OX9L 4DNIA 3Q8DA 3S2DH 4IJHA 3T1YL 4AYBE 4LFCQ 2IY5B 1D8LA 4LF8L 2CWAA 3S24A 1O7IA 1SLJA 2IT1A 5IP7H 2XGTA 4DK3C 4LF5Q 2R92G 4GKJL 2MO1A 3CQZH 1KRTA 3U50C 2ZM6L 1YITA 2R6GA 3A0JA 4NXNL 4DR7Q 2UXCL 3J81j 3RR5A 3I4NG 3OYYA 2JA7H 1XMQQ 1SROA 4B3MQ 4A3IG 4HJ5A 2JA9A 2LSSA 4DUYL 4DV7Q 4JI6L 4LF4Q 5GADC 4LFBQ 1JJGA 1P16A 1QUQB 3GDEA 2IHEA 3TEHB 3K0XA 5LMUQ 4BBRH 1PA6A 1IBML 1N33Q 4AYBG 4IFDJ 3PCOB 2AHOB 4PMWA 1N34L 1WJJA 2LXKA 3HKZG 4POGA 3NBHB 1YHQA 4LWCA 1Q81C 4DV2Q 1UWVA 1VQLA 3F1ZA 1YJWA 5HY6A 3A5UA 5LMUL 5IY0A 5E7NA 3UE0A 4L5RC 1XPUA 4DR5L 3HOUG 3I4NH 1C7YA 3HOWG 1EIFA 3S16H 4R4IA 4DR3L 1RL2A 1S3OA 2AMCB 5FLXc 1YVCA 1JJCB 4EQ5A 2K4KA 2R7DA 2UU9Q 1TXYA 1YBYA 1ASYA 1CSPA 3FKIH 1XJVA 4O0AA 4R4OA 2VQEQ 1B70B 1QVGA 1JMCA 3TS2A 4BXXG 3HFZB 2ES2A 1VQNA 3K7UC 3I2ZA 1N34Q 2JA8G 4A3LH 1X3EA 1QUQA 4LFCL 3M85A 1QZHA 3CC2A 1VQ4A 4IOCA 1BBUA 2D0OA 2OTJA 1FVIA 4IFDI 3HOUH 2JQOA 4JI2L 1K3RA 3UDGA 1G291 4MZ9A 3G6EA 4OO1I 3KLWA 3GTLH 3HOVG 3NEMA 3RNUA 2RHQB 1JE5A 5FJ8G 2AWNA 4JBKA 1GVPA 3NENA 2KHIA 2GVBA 4DV7L 1YIJA 3NELA 3TRZA 1J6QA 2BA1A 4DR7L 4A3CH 1PYSB 3B6YA 2MNAA 2HT1A 1XMQL 4B3ML 4DR1L 1HZBA 3PGZA 5BR8L 1IBLQ 1EIYB 2YU9H 3W1BA 4QY7A 1VQJA 2F4VL 3J81c 4LNQA 5M3FH 1IXRA 3UE1A 4JBJA 3KYHC 3F8TA 3CC7A 2ZTEA 1NTGA 4A3FH 1YHBA 2BH8A 4ME3A 3GTMH 1NJIC 4UPAA 3KDFA 1IBMQ 1OXUA 2UXDL 4JI1Q 1C9OA 1HNZL 1VQ7A 3STBD 3T1HQ 1A62A 1KHIA 3U4VA 1B8AA 4IPHA 5IYCG 1IBKQ 3HOWH 1E7ZA 4JG2A 1X56A 4C3JH 2I5LX 4NXML 1HR0L 5AJ3Q 2UUBQ 2H5XA 3OTOL 4B3RQ 3EN2A 2KBNA 4DK6C 3F2CA 1HNWQ 1Q12A 3AEVA 2YTXA 3M3YH 1MJCA 5H1SE 3GTJH 4DV4L 5C4XG 4JYAL 4YWMA 2MO0A 1VQDA 1I5FA 4BY7G 1Q86C 1N36L 4K0KL 4A3EH 1I3QH 3ERSX 3H3VI 3ULLA 4GLXA 1N9WA 4XIGS 2JA7G 3I55A 2VY3A 3OW2A 1EFWA 1C0AA 2D62A 2CKZB 3TS0A 3FKIG 4UP7A 2JJQA 5IYBG 4BXXH 2E2HH 3ULJA 1I6HH 4A3DH 5DLQE 4HJAA 4KI0A 4IFDG 4KHZA 2VZAA 3K8AA 2UUCQ 5BR8Q 4AH6A 4IO9A 1VS0A 4B3SQ 4JYAQ 4DV4Q 4DR1Q 4X64L 5IYDH 5IE8A 2UU9L 3GD7A 3RLOA 4LUVA 4ALPA 4GOPB 2VQFL 1PH2A 1VQGA 2Y0SE 4GN5A 3CP0A 1X54A 4FDBA 2K5VA 4A4IA 2D0PA 2QEXA 4DR3Q 1GM5A 2Q2TA 3PO3H 4BBSH 3MXNB 1I94Q 2Q2UA 4LF9Q 5IP9G 5M5XH 3T1HL 4WJ3M 1YJNA 4UP9A 4JI7L 1S72A 4QQBX 4YHHQ 4GLAC 4JI0L 4OWTB 1E24A 4DKAC 4JI2Q 3M7NA 4IPGA 1A8VA 4GNXB 2N78A 1L1OC 1P8LA 3BJUA 3LGJA 4P72A 1PVOA 3UDXA 5C3EG 1IL2A 4X65L 2YTVA 2EQSA 1K9MC 2ZTDA 1K73C 4JC0A 3RLNA 2NVYH 3TREA 5IWAL 1MIUA 1KRSA 1GD7A 4LUOA 4X66L 3A5ZB 3BU2A 2E2JH 4UP8A 2VUMG 3I4MH 3CCMA 1TWHH 3PUZA 1OXXK 1SN8A 2ATWA 4LF7L 3AFQA 4A3CG 4A3MH 2ZJRA 2WB1G 1PH7A 5IYBH 1L1OB 1TWFH 1EWIA 4YCWA 5GQOA 4GOPA 4R1JA 2JA5H 3CPWA 1KQSA 2UUCL 1EUJA 3T1YQ 3UDFA 4BY7H 4DV5Q 4A93G 3RN5A 4GNXC 4JI3L 4LF6L 3M4QA 1SRUA 1SR3A 4LFAL 2IHFA 1MJEA 3S1MH 4BA2I 1JJ2A 3WWVA 1N33L 3AQQA 4UY8C 1V9PA 4A76A 4KLKA 5JEAG 3H3VH 2UXCQ 2WFWA 4DPGA 4TQUS 2NN6G 1H95A 1XTDA 4OWWB 2ZTCA 1N36Q 2N8NA 3PUXA 1NY4A 2F3IA 1JB7A 4L5SA 4X62Q 1L0WA 1YI2A 2ZJQA 4A3JG 1HZCA 1V1QA 2UUAQ 4A3LG 4YCVA 4KHPQ 1Q46A 3HOXG 1RIPA 2VL6A 1QVCA 4L5QA 3PF5A 1HNWL 5M5YH 3CF5A 3KF6A 2JA6G 2WAQG 2WP8J 5C4XH 4LF8Q 4YHHL 3L0OA 1CSQA 1X65A 5C3EH 3RLFA 4A3EG 1BVSA 4GN3B 1YJ9A 4XTCS 1CKOA 4R4QA 4DR6Q 1GO3E 2QGQA 4OONA 4GOPC 2UXDQ 2Q2IA 2OWOA 1EQRA 4GS3A 4BBRG 1J5EL 1VQ8A 2HIVA 2K50A 2AKWB 4DV6Q 1U0LA 5C4JH 1VQCA 1VQIA 1VQAA 1VQ9A 3CPFA 4X6AH 1G6PA 3F2DA 1VQOA 1SMXA 4B3RL 4JI8L 2UUBL 2JA8H 1W2BA 4A3FG 1D7QA 2R92H 2NZHA 4OO1G 4QIWE 5IYDG 1UE1A 2ZJPA 3G71A 4IOAA 5ELOA 2RF4A 2I0QA 1VQHA 5LMNQ 2E8GA 3KOJA 2VUMH 1KL9A 2KENA 3KF6B 5GROA 3K80C 3ULPA 3FHWA 5C0XG 1MKHA 2IX0A 2Z6KC 4JV5Q 1VQ6A 1QVFA 1HJPA 2F4VQ 4JI4L 3STBC 1LTLA 1X3FA 2AWOA 5HGQA 3JAMi 1PH5A 1IBLL 5JEAJ 4KHPL 2LXJA 2HHHQ 4A3GG 3UDIA 1Q82C 2VQEL 2B63G 5GAHC 5JJIA 1VQKA 1OTCA 2JK8A 4BY1G 1SFOH 3KJPA 4HIKA 1XMOQ 2JA6H 2NVTH 1E3PA 4AIMA 1Y14B 1Z47A 1Q7YC 1Y1WH 2IX1A 4A3BG 1B7YB 1IBKL 3AFPA 5IYCH 4AQYL 4LFAQ 4IPCA 4A3JH 3RN2A 5LMNW 3CCQA 1K8AC 2WAQE 4DV3Q 2CWPA 2KCTA 2I5HA 1VQ5A 5M3MH 3U58A 3ER0A 4DV5L 5EAYA 1WI5A 1PYBA 2Z6KA 3KFUA 2B3GA 1NE3A 3HOZH 2JEBI 1E1OA 2UXBL 1YNXA 3EBEA 3GTGH 2EXDA 1M90C 4DV0L 1JT8A 2K52A 4NPSA 1L1OA 5FLMH 5FJ8H 4DR5Q 1CKNB 1WFQA 1WOCA 4R4CA 4LF5L 1FGUA 2Q2HA 4GKJQ 2MQHA 2B29A 2E2IH 4DV1L 3PO2G 1OXSC 4GLVB 5ELNA 4HJ8A 4C3HH 3E9IA 1OXVA 4LFBL 1LUZA
chains in the Genus database with same CATH superfamily
4DUYQ 2K5QA 2N49A 1KLGD 4XYQA 1QNKA 1Z9FA 2PQEA 2VUMB 3IRBA 4ZRZA 1H9SA 3Q6SA 1HH2P 3HOYG 1XMOL 2AQ3B 4R9WA 1WTQA 3BZCA 2ZM6Q 4HR7B 2N55A 4OX9Q 2YYZA 4GKKL 5FO9B 5BN3A 3A74A 2DGYA 5J22A 1TWAH 3KBGA 2XNAC 2HIXA 2ZT9C 1WYDA 1BCPF 1I6VC 5C44G 3G4SA 1I4GA 2C5CA 2HUGA 1TU2B 5C5MA 4A3EB 1F9QA 2A1AA 4PZ8A 4DNRB 3PIP3 5FK9C 5FLMG 3CC4A 2AUJD 1FGBD 1CHPD 2B2WA 2E2DC 3BZDB 1K83H 4A3DG 4U68A 2BA0A 1FR3A 2Q8TA 1WCMH 4V190 1NBWA 4O2DA 3CCUA 1STBA 3MEFA 4CDCC 5M9OA 4RHRA 1X6OA 5ELBA 3E3XA 2QA4A 1B1ZA 5IT9E 2OQ0A 1Y8NB 2K01A 3KLRA 1S40A 4RMFA 2B2YA 2ASBA 2EJGC 5BN4A 3M4OH 1A6XA 3HOVH 4FF2A 2K5NA 4NKLA 1HR0Q 2Y0SG 3L7ZC 2I07B 5A2QE 2D5DA 2L12A 5CV9A 4QF4A 2ICEC 3H0GH 2K5HA 3NTIA 5DNFA 5M3FG 1W3SA 3URYA 5IT9c 1PH4A 3JAMc 1G8ZD 3G48A 5JPNC 3NSWA 1K0SA 1YHAA 1EEID 4YCUA 1O7LA 4X3KA 4X66Q 3OPOA 5K36H 1G2TA 2SNSA 4NB3A 2YTYA 4LW1A 3NK9A 3DWPA 1SNMA 1VQBA 4RGNA 2HHHL 1IYJB 4LF6Q 4H02A 3PUYA 3I7FA 4R4TA 2ALYB 1X55A 1K8GA 2RCNA 1HRJA 4B9XA 3S1NH 1A0IA 5J3BA 1UAPA 1MSGA 1HXYD 3HKZE 4KY5A 3J80c 2FJ2A 2KHJA 2E74C 1RF2D 4KKTA 5C3EB 1G51A 3HGBA 1Y1WG 3CMAA 4HJ7A 2JA5G 2R61A 1KAAA 4X65Q 4NXNQ 3PIPA 5CYUA 4X64Q 3PMFA 4JBWA 1WTHA 2N3SA 2XTIA 2WIIB 2CQOA 2JA6B 2PNHA 1TWCH 4F87A 4JI4Q 1XXGA 3EIVA 2F1MA 3H6MA 3OIQA 1KDCA 1KC8C 3EA6A 4U673 4FF4A 1PRTD 2K05A 3MHBA 3NWTA 4IUUA 3R8BA 1H9SB 3PV0A 3CKIB 3S14H 2HDMA 2VS1A 4IJLA 4PMCA 3K6OA 3CMEA 1A3UA 4QGUA 4P73A 1AEXA 1CKNA 3S17B 1CUKA 3HOZB 1H9MA 2EVBA 3TDQA 2A6HC 4HIOA 4A3MG 2D9UA 1CZWA 2EY6A 3OHXC 4NDXA 1N32L 2IWHA 2PQAB 3L2PA 4K8IA 4OX9L 3Q8DA 1U9RA 4UAIA 1D8LA 3I3CA 1TS4A 1KNAA 2XGTA 4JPBW 1ILQA 2MO1A 1YITA 2M00A 3J81j 3I4NG 2WACA 1RTNA 2RSNA 4LF4Q 4DV7Q 4WORA 4JI6L 2O5JC 5GADC 1PYWD 3VR2A 4M1UB 1P16A 1SFOB 5LMUQ 4FF3A 4AYBG 2E75C 3HEJA 1Q81C 4DV2Q 1UWVA 3P75A 1KLUD 1KTKA 3F1ZA 1XPUA 2KVMA 1EIGA 5LMUL 1C48A 1VMCA 4DR5L 2L11A 3DMUA 4X3SA 1NSNS 4HSVA 2A69C 4KMUC 2L9HA 2UU9Q 1YBYA 1OO9B 2LKVA 3X3NA 2E2HB 3FKIH 1XJVA 4O0AA 4R4OA 1QVGA 3GTGB 2QDLA 5FKAC 2JA8G 5IIFA 1QZHA 1BBUA 5A2QL 3NBIA 1FVIA 3PO2B 4IFDI 2MUYA 1CK1A 3HOUH 4IURA 1NUCA 1G291 3SE0A 2RHQB 4DR7L 4DV7L 5JVG3 1KABA 2BA1A 3WOEA 2MNAA 4C3JG 2Z1CA 4A3KB 1HZBA 5BR8L 2EXZA 1VQJA 5TSSA 2V4DA 2OEOA 2RDHA 4LNQA 1IXRA 4JBJA 3KYHC 2ZTEA 4A3FH 2QW7A 3GTMH 5KYLA 1VQ7A 3HOWH 1AFPA 1KHIA 1B8AA 4ZUJA 2E2JB 4JG2A 4KN4C 4DFAA 3KK7A 2UUBQ 4ZAIA 2G5DA 2KBNA 2F0QA 1Q12A 3M3YH 1WTRA 2PCFB 1SMYC 1IKMA 4IUPA 3EJIA 1I4PA 1I3QH 2JSOA 2X69A 4NW2A 3ULLA 3D6WA 4C2MB 1HQMC 2CH4A 4BXXH 1QJOA 1SEBD 4IUQA 3IAYA 1IW7D 5G3LF 1X3PA 4OELB 5DLQE 3I4LA 3BDLA 5BR8Q 5D3IB 4IO9A 5IGGA 4KV6A 1SJED 2KCCA 2UU9L 4LUVA 5KNBA 1PH2A 2HCIA 3CP0A 2D0PA 3TN2A 4RCNA 1I94Q 2Q2UA 4LF9Q 2EOTA 1I4RA 4UP9A 4JI7L 4QQBX 4YHHQ 2SEBD 2H1EA 2K33A 2EY5A 1Y1WB 1H9RA 1L1OC 1P8LA 5CBAE 1PVOA 1Q3LA 1IL2A 4X65L 1EIHA 2YTVA 1YNJD 2EQSA 2ZTDA 1K73C 4ABNA 3A7AB 1CT1D 1G2SA 1MIUA 1KRSA 4LUOA 4YIJA 3HOUB 3A5ZB 4H44C 3HOXB 1OXXK 1SN8A 3LWEA 3AFQA 4A3CG 5I2XA 2ZJRA 1Q8IA 3PIO3 5DAUA 2MHVA 2EY2A 4BY7H 3UDFA 4A93G 4FNFA 4LF6L 3M4QA 1SR3A 5AFWA 2IHFA 3S1QB 1JJ2A 1WTWA 1I50B 1XYIA 1V9PA 4A76A 3H3VH 4DPGA 4EGVA 1JOOA 2N8NA 1JB7A 2F3IA 1MSHA 4L5SA 4G7ZC 4A3LG 2ZJQA 1HZCA 4R8IA 4YCVA 1YNND 3J7AV 3PF5A 1RIPA 1HNWL 2B2TA 3EROA 5M5YH 3S1RB 2WAQG 4LF8Q 4XQQA 2BOSA 3L0OA 1C4QA 4A3EG 3OSOA 1HTLD 3K5LA 4XTCS 1SYCA 4XQJA 4L63B 1KNEA 4RFBA 2QGQA 4GOPC 1EY6A 1I3QB 4GS3A 2OWOA 1S4ZA 2RQXA 1J5EL 1VQ8A 1TWGB 4BBRB 2HIVA 2AKWB 5C4JH 4X6AH 1BXTA 3LNNA 1SYFA 5IGEA 4OO1G 5IGFA 1JB3A 1GOZA 2E8GA 1KL9A 3K80C 3FHWA 1SNCA 1MKHA 2IX0A 3EQLC 3W2DA 1F2YA 4C1NI 3DXJC 2F4VQ 3HZXA 1LTLA 1R4QB 3JAMi 1RTOA 5JEAJ 1SYBA 2XRQD 2F0SA 2IL8A 1Q82C 2VQEL 1HUNA 3WOFA 3KJPA 1E3PA 3TP8A 1Y14B 3DEPA 4FF1A 2A74C 2AQ2B 1B53A 1D5XC 2K5DA 4N8X1 2DNEA 2NB0A 1ET6A 5ELDA 4PQXA 4F88A 2TSSA 4RKBA 3K5OA 3U58A 1VQ5A 5EAYA 1LTTD 1NE3A 1F2MA 5JJZA 4K14A 1E1OA 1YNXA 3R2TA 2EXDA 4DXGA 1LTGD 1NAPA 1YNJC 1L0XB 3C46A 2O2LD 4GKJQ 2Q2HA 1WD1A 1EY4A 3A8KE 4JW0A 3I91A 3I4NB 2QEJC 1SBBB 3D4RA 4HJ8A 1SAPA 4DR2L 3KDFB 2ZXRA 4HMJA 1ENCA 2QF7A 4FVMA 1DOKA 1GKHA 1QNUA 2K03A 5CR3A 3BS1A 4A3BH 3BYTB 1ICWA 1IZ6A 1CKMA 1XPOA 1B2TA 4B3TQ 1RODA 4DV3L 4MNOA 4YY3L 4UHVA 4Y7NH 3AMUA 2JYOA 5I6YA 4JV5L 2Z8LA 2Z4IA 4K8JA 3I56A 3MXUA 1CA6A 1LYLA 1ET9A 5C3XA 2VQFQ 3CD6A 2I46A 2KQ3A 1T9HA 2O4XA 2G9HD 3G6JB 1XNRL 2GVAA 3KUPA 1R9TH 4DR4Q 4C3IH 4POFA 1HNXL 1K0RA 3C1FA 1DCZA 4CJ1B 1DGSA 2XIWA 4CDEC 2E5LQ 1X9NA 1KIXA 2NVQH 1KAWA 1YEZA 4V0BA 2JP1A 3CCEA 2B2WC 1PH1A 3S15B 5A35A 4L5TA 1HNZQ 1BBWA 3TQYA 5I9PA 5FOBB 1AN8A 4X62L 2XVSA 3VDYA 3J80i 3PO3B 4C2MH 2CW0D 4C3HB 1B9MA 1LTID 4LF7Q 2Z0SA 2D2CC 4B3TL 3R93A 2PZUA 1FJGL 5EBCA 3HOZG 5C0XH 3SVMA 2J7ZA 2PI2E 5I6WA 1XPRA 2F0TA 4HCEA 4XDXA 1XNQQ 1Q1BA 5L37A 1BNZA 3I4OA 4DV2L 3K81C 3CCVA 5JJLA 4KKUA 4OHJA 4Z9CB 4JI0Q 4JOIA 5D14A 2C35B 1HA5A 1Y1VH 1VQFA 2IPKD 3MVVA 4A93H 3K7AH 4BY1H 1DZ1A 4AQYQ 4JI6Q 1TWFB 2OQKA 3NPPA 3VYRA 2GN5A 4L8JA 3MFGA 5JAVA 2NYZD 2JE6I 5CV6A 2NZOA 1QILA 4C3IG 3HRZC 2MP1A 3D4DA 3SDZA 1GHJA 4HSPA 1R9TB 2TMPA 1GXDC 1UE7A 1B44D 3D4WA 4A3MB 5CV4A 4HIDA 1G91A 2PMZE 3J80L 4H0LC 4BA1I 3S17H 2KOLA 1HFNA 5C44H 3A8JE 2B8FA 1A3TA 1FL0A 5EGTA 2E5LL 1PH8A 4WJ4A 4A3GH 1EYAA 1PHJA 1SJHD 4XXEA 1HZAA 4ZKCB 3GTKH 2BE5D 4KHVA 3ND8A 1PH6A 3TSSA 2BDNA 2NVXH 1LT4D 2X6LA 2CVRA 3VR3A 4DUZL 1EZ6A 2OCEA 4PG3A 4JI5Q 2A6HD 3Q0AA 3GTPH 1FJGQ 4JCVE 2A6EC 5CGKA 4A3KG 4K0KQ 1EU4A 4GN4B 1XNRQ 2F4IA 4HJ9A 3UI2A 1PMRA 5EKLA 1BKBA 4JBMA 1TKWB 3HKSA 4I65A 3H09A 2JEAI 3CCJA 3A54A 2PMZB 4DR2Q 3PO3G 5IP9H 2PQAA 2QDBA 3TBIB 4DNIA 3KLSA 4IJHA 2E2IB 5EKKA 4LFCQ 2NZ1D 4LF8L 1VMPA 5IP7H 4GKJL 2L1BA 3CQZH 3U50C 4DR7Q 3RR5A 1BCPB 1XMQQ 1SROA 4PV1C 4C3JB 1IL8A 2IHEA 4ZK9B 3K0XA 1IBML 3PCOB 4PMWA 3J7AF 1LABA 1N34L 4BBSB 3ERQA 5EQ0A 1YHQA 1VQLA 1E2WA 1YJWA 5HY6A 5IY0A 1HQRD 2F0KA 1C7YA 1EIFA 2O5IC 4R4IA 1QCBD 3SK4A 1RL2A 1SE3A 4DR3L 2Y0SB 1X3QA 2Z6BA 1LACA 2K4KA 2R7DA 4KY7A 2DY7A 4F8MA 4DK0A 2FHTA 1VQNA 1ZEQX 3I2ZA 4LFCL 2NUCA 1VQ4A 4IOCA 3CC2A 3ITPA 4KTAA 4RCOA 1IYUA 4A3GB 4OO1I 3K5NA 3NBHA 3RNUA 2LFNA 2CH4W 1JWUD 2AWNA 3NENA 3VYUA 3E6ZX 3K0YA 4DNTB 3B6YA 1XMQL 1W6JA 4H7BA 1IBLQ 2YU9H 1STNA 1PFMA 5M3FH 2RA4A 3I72A 3UE1A 3M4OB 2CQAA 3CC7A 3I90A 4ME3A 4UPAA 4OO1H 2UXDL 3J7YW 1C9OA 1HNZL 1A2UA 3STBD 5IYCG 2JN4A 3CU7A 1HR0L 2IW3A 5AJ3Q 1K8OA 2H5XA 4B3RQ 1HNWQ 3F2UA 1GUGA 1E2VA 1GUOA 3AEVA 2AUKA 1Y1VB 2MO0A 5J1ZA 4A3EH 2A69D 3H3VI 2KJXA 4IZ8A 4LJZC 4XIGS 5C4JB 2CKZB 4C3IB 4UP7A 2JJQA 3T53B 5IYBG 3EFXD 2ZXPA 2VZAA 3K8AA 1WCMB 4OGQC 1VS0A 3OWFA 5JPMC 1T5XD 3GD7A 3RLOA 2F03A 4O1NA 2HD3A 1HFGA 5IP9G 5ISRA 1YJNA 1Q90A 1JCKB 4GLAC 4OWTB 4DKAC 4JI2Q 4FXDA 4P72A 3LGJA 1WTOA 2BCOA 3MAQA 3E5SA 1K9MC 3RLNA 5IWAL 4K2LA 4CBVA 1GD7A 1WTPA 1TWHH 1BQQT 3RZDB 2NN6H 1LV9A 1PH7A 2AQ1B 2VB2X 3DM1A 4DF7A 2K6AA 2JA5H 3T1YQ 3RN5A 3QJYA 1R4PB 4LFAL 4BA2I 1JWSD 1MJEA 1FNWA 3TZDA 1F9RA 3VYTA 3AQQA 2CW0C 5EPJA 5JEAG 3KBXA 5FO8B 2WFWA 3HS0C 3K58A 1WVLA 1NY4A 5DM63 3BDOA 1D5MC 1STGA 1YI2A 4KHPQ 2UUAQ 3HOXG 1QVCA 4XT3B 4C3HG 2C9OA 4WJWA 2X6GA 2JA6G 1CSQA 1F9SA 1X65A 5C3EH 4FYDA 3OMCA 4XQNA 1YJ9A 3PQIA 3S14B 3MEHA 5M5WB 4Q0FA 2Q2IA 1AP0A 2K50A 4C56C 3IFDA 1VQCA 1VQAA 2XWBB 1RJTA 1BBXC 1BCPC 5IGCA 1VQOA 1SMXA 2EZVA 4FXKC 2PZWA 1Z7TA 1D7QA 1SXTA 2R92H 2NZHA 4GZYC 4QIWE 4IOAA 3NUCA 1PTOD 4A3DB 1O7YA 5LMNQ 3KOJA 1CQVA 5GROA 1ML0D 1S5DD 2OF1A 4QMGA 1TS3A 4JV5Q 1QVFA 1HJPA 4JI4L 3HP3A 1X3FA 4O42A 3V96A 4QCLA 3E0JA 2EYJA 3AU7A 5JJIA 1JICA 5ELFA 2B63G 3G7LA 1OTCA 2JK8A 4UDUC 5KYIA 1SFOH 3MC0B 4HIKA 2NVTH 3NP8A 3T13A 3AFPA 3VYSA 5IYCH 4AQYL 4RHSA 1EOTA 4A3JH 3RN2A 1O7ZA 4QB4A 4DV3Q 3FVQA 2EYFA 1IYVA 4K5WA 2KCTA 3Q23A 5M3MH 5IOCA 3ER0A 3VR6A 3QOJA 1RD9D 2Z6KA 3QB3A 1H9KA 5C4ZA 2B3GA 1KDBA 2A6ED 1TY0A 2UXBL 4ILWA 3GTGH 1K28A 2SDFA 1DXMA 1GUWA 4DR5Q 3K7AB 4MN3A 1L1OA 4BY1B 1CTMA 1JORA 4R4CA 1MHWC 3QWNA 1FGUA 4LF5L 2MQHA 2BE5C 4IQZA 1K83B 4S3SA 3P20A 3VA5A 2A73B 3E9IA 4PMBA 4LF4L 4JI7Q 4ZLTF 1DOLA 4OIJA 4TSSA 1PH3A 1I94L 4LF9L 4EX5A 2F0JA 5C4XB 2R93H 2B8GA 5I2YA 3KF8B 1E22A 3ZJYC 3D3RA 1Q8KA 4G57A 1JOQA 2ENBA 2K04A 1V8QA 3GTQH 2PW5A 1HA6A 5EPKA 5I9OA 3F2BA 1SE8A 2L4NA 1Y1VG 2CFMA 1U4LA 2DUDA 2RDGA 1RCVD 5GAGC 2ID0A 4JI1L 4GNXA 1EWHA 1HHVA 2FFKB 3JAME 4R8NA 2OT2A 1V1OA 4CDFC 4CKEA 3RZOH 4YWKA 5M3FB 1M1KC 3DWQA 3W5OA 5FLXL 2NN6I 4A3JB 4PZ6A 3BZKA 3QIAA 1MBYA 1VCIA 1V43A 3RUZA 4A75A 4I7ZC 3C2PA 1STAA 2OTLA 4Y52H 4JI5L 3U4ZA 3I73A 2K7VA 1XX8A 4JOIC 3K57A 2KCMA 1Y8PB 3ICEA 5D65A 3A56A 1AW7A 3KLSX 1B3AA 5IGDA 2JA5B 1PH9A 2UUAL 4WFN3 3SEBA 3MFYA 1TWAB 2Q8RE 3KJOA 2PI2A 1B50A 3S2HH 4DV0Q 3OMGA 4NXMQ 3J7A5 1J5EQ 2LS01 3DHQA 3NHHA 1CHQD 2NVYB 3J7ZC 2K75A 4HTHA 1IHZA 1VF5C 2R7FA 4J15A 5CV5A 1JE4A 3CAMA 2A19A 3QOLA 2EYOA 3D0FA 1QOHA 3H94A 3GTJB 1BF4A 3PUWA 4DV1Q 2R7ZG 3M4PA 1B9NA 5JJKA 2DJGC 2F0EA 1U5KA 1WCMG 3VA7A 4N8FA 1L2FA 4NP5A 2K14A 2V1CC 3H0GG 1Q1EA 1HR0W 2PYKA 3S1QH 4J8QA 1N8RC 3PSIA 3RZOB 2K28A 3BDCA 3S2DB 4JI3Q 1WD0A 1KD1C 2EIFA 3E9HA 3HOXH 3M9BA 4APVA 3A7LA 2JXMB 2NTTA 2F0FA 1YZ6A 4LK1C 4DU9A 4MTKA 2YV5A 3GTQB 3SHLA 4DAMA 4KJNA 4P74A 5C5LA 1DONA 2WB1E 4OIKA 3NQTA 2L5TA 1CQFA 5G3LD 2NBFA 2RBMA 1EOVA 1IKLA 3MXNA 5CV8A 4ZUIA 2R7ZB 1ESRA 1ONLA 1PFSA 4RG1A 1KXLA 3D8GA 1I50H 3QR8A 4IUTA 4B3SL 4LUZA 5M3MG 4P2CB 2LY7A 4OL7A 1HZ9A 1VQPA 2BH2A 1UUPA 1I4QA 3JC66 5ELEA 2VW9A 1TT2A 3BVGA 1XWEA 3GV3A 2K32A 3OOCA 1PTOB 1TWGH 4ODGA 4JI8Q 3FP9A 1HNXQ 3U9OA 1EQQA 3PO2H 1PRTC 4EVOA 1EYGA 2IJ0A 2KECA 4IN3A 4A93B 1BDOA 1EY9A 4FXGC 3RD4A 5LMNL 4TVAB 5E3FA 3GTOB 1OXTA 5JOBA 5C6AA 3S24A 1PFBA 1O7IA 4LF5Q 2R92G 4K5VA 1KRTA 4LMQD 4DXFA 4RAUC 1SYEA 3A0JA 5EJWA 4NXNL 2BDOA 3J81E 2UXCL 2JA7H 3TZUA 4HJ5A 3HOWB 4DUYL 4MHEA 3GDEA 4RKLA 1MGSA 1N33Q 4DAVA 2AHOB 1WJJA 1A2TA 3HKZG 3M3YB 3O13A 4POGA 4L5RC 1PFNA 3UE0A 2F0MA 2EYPA 1JQYD 4ULLA 4RWSC 3HOWG 4A3IB 2WB1B 1S3OA 5FLXc 1I4XA 4ZQ3A 4EQ5A 1I6HB 2XRSD 1CSPA 4BXXG 4JVZA 3HFZB 1DYQA 4K5XA 1N34Q 5LHY1 1X3EA 1QUQA 2RSOA 2OTJA 4G7OC 3CHBD 3SK6A 2KEEA 5ELCA 2JQOA 4JI2L 1K3RA 1PTOH 3GTLH 2B2TC 4JBKA 3TRZA 1HTPA 1SYGA 2GVBA 4A3CH 1AZQA 1TWCB 4KK7A 1F9PA 4ME5A 4QY7A 4Q5VA 3Q24A 2H4OA 3U4VA 4IPHA 1NR4A 4C3JH 2I5LX 2A68D 4DK6C 1PRTF 2DN8A 2YTXA 4CHTB 1MJCA 3GTJH 4DV4L 2KUMA 4YWMA 4RGTA 1I5FA 4BY7G 1Q86C 1N36L 2LMCB 3ERSX 1TS5A 1PDQA 1EWCA 2SNMA 3FEWX 3OW2A 1EFWA 2EJMA 1EYDA 2F3WA 4FO2A 2D62A 4MIUA 3CRLC 1X32A 2E2HH 2PZTA 3LX0A 1L0YB 2VB3X 1Z6HA 1I6HH 4HEDA 4HJAA 1JOKA 4KHZA 2UUCQ 2NVQB 1GUNA 1HCZA 2NWGA 2F0WA 4AH6A 4B3SQ 2L55A 4JYAQ 1FD7D 4X64L 5IYDH 5IE8A 1ICFB 4ALPA 3QO2A 4GOPB 2VQFL 1VQGA 5J39A 2Y0SE 1YNNC 4GN5A 3GQBA 4FDBA 4A4IA 2QEXA 2KA7A 3HG9A 1GM5A 3PO3H 3MXNB 5M5XH 3T1HL 2QCPX 4WJ3M 2EDGA 2FMCA 2WV6D 2JA8B 2EYMA 1JWMD 4IPGA 1EY0A 1A8VA 2WAQB 3S2HB 3GTKB 4ZCKA 2J0TD 3UDXA 2WKDA 1FYCA 4KJOA 5KNDA 3TREA 3N6RA 2E2JH 4UP8A 2VUMG 4CJ2C 3CCMA 4B9WA 3PUZA 2J4XA 2ATWA 1FNVA 3SR1A 2GA4B 2WB1G 1DOMA 4YCWA 1TWFH 3X3MA 4ZKBB 5GQOA 4GOPA 3M4YA 4R1JA 3DWAA 4HAEA 1KQSA 1EUJA 4DV5Q 1EFID 3GV6A 4JI3L 4QUFA 3S1MH 1SRUA 1Y8OB 2M2LA 2E76C 3WWVA 1B4OA 1EQVA 4UY8C 2F3VA 2UXCQ 3S1NB 4X62Q 1L0WA 4A3JG 1V1QA 1EZ8A 2DNCA 3NXWA 1PXUA 1Q46A 3MTSA 2VL6A 4L5QA 5EPLA 1WTXA 3CF5A 3KF6A 1N32Q 2F0UA 2WP8J 1U4PA 3RLFA 2JA7B 1BVSA 1SE2A 1GO3E 2UXDQ 1EQRA 1PTOC 2K5WA 4RGOS 1PZID 4DV6Q 1SDFA 1VQ9A 3CPFA 1G6PA 4J6HA 3J80E 1LTRD 4B3RL 1W2BA 4A3FG 5LL6X 3K5MA 1BCPD 5IYDG 2EE1A 4KD4A 5ELOA 2I0QA 1ILPA 4HCSA 4OEMB 3GTPB 1O80A 3ULPA 2A68C 1RKNA 3ONAB 1STYA 2Z6KC 1VQ6A 4G4KA 1JR0D 3STBC 1IBLL 5HGQA 1VDZA 4KHPL 2LXJA 2HHHQ 1U4RA 4E6IA 2EYHA 5GAHC 4BY1G 1XMOQ 1S5CD 1LTBD 3HOYB 1Z47A 4FP5D 4IUNA 1Y1WH 4I7AA 2IX1A 1IBKL 4G7HC 4LFAQ 1CFMA 5KNCA 1M4VA 2WAQE 3I4MB 1II3A 2MPMA 2R93B 2CWPA 2F0NA 1QE6A 1K8MA 2I5HA 4RGMA 5M5YB 2XWJB 2JEBI 3EBEA 3H91A 3JAML 1BUVT 3A8IE 4DV0L 1JT8A 5FLMH 4NPSA 3I8ZA 5FJ8H 5JEAH 1WFQA 1O78A 2F0GA 2F0DA 3NTKA 3C1EA 2DY8A 4TRDA 2B29A 3NQIA 4C3HH 3FKIB 3HOVB 1LUZA 4LFBL 1ZKOA 1BOSA 3K59A 4CJ0B 3QG1A 2F0OA 2F0LA 1S5FD 3PIOA 3DEOA 2MGSA 3R2IA 5T1IA 4HN7A 1UEBA 4XT1B 3BVZA 2MFIA 1LLRD 3DLLA 1J9OA 1T5EA 1UE5A 4X3TA 1PTOF 5C0XJ 1B3QA 3S16B 3DM3A 2R7ZH 1XNQL 5M5XB 1QZGA 1H9JA 3OIPA 1LM0A 4CKBA 3HOYH 2FXQA 2B2VA 4P71A 3CW2C 4YWLA 4GKKQ 4JK1C 5COYA 3OTOQ 3GO5A 4DK1A 1Y69U 4DV6L 3LWUA 4OWXB 2EPBA 1PV4A 3C3LA 4WRDA 4DAYB 4DAYA 1SNQA 4IPDA 2PNRC 4DN4M 1LTAD 2EYLA 1I4HA 1GHKA 4HIMA 3VR5A 3T56B 4A3KH 1A63A 4QL5A 1AE2A 1EYCA 4DGZA 3H3VC 2IX3A 2PW7A 1VQEA 3GTOH 1EY5A 1STEA 1D1KA 4RA8A 1NMFA 2B2YC 1LTSD 4DR6L 1PLFA 3SK8A 1VF7A 4KY6A 5NUCA 1EQTA 2XSCA 4ID6A 4BS9A 4YY3Q 1BR9A 4HMIA 1SNPA 3J81i 1UE6A 2B63H 3AYHB 1VQMA 3PF4A 1TWHB 3SGIA 2L15A 2WINB 3W1GA 2A8VA 1F2LA 2Z9HA 2QKIC 4QUCA 3S15H 4EQNA 4BBSG 1G6ZA 5M5WH 1SYDA 4N9TA 5C0XI 2UXBQ 3CXCA 3MXGA 1X3GA 2VNUD 4P75A 5IWAQ 4DAPA 1MI2A 4PNYA 2CCZA 5E4XA 4OXPA 5EKIA 5GAEC 2XN9C 4IFDH 2I5MX 3DUZA 3RZDH 1V1PB 2KEDA 2RHSB 1QWYA 3S1RH 2F52A 1NMGA 3T16A 1E1TA 3E0EA 3OWEB 3BG3A 3T4AC 4PZ7A 2CHBD 3W3AA 1ENFA 3CCLA 3OW7A 3GTLB 1AE3A 3VR4A 4CDDC 3H15A 5AJ3L 2B2UC 1CZGA 4M8AA 3CQZB 3PUVA 4QJFA 1PRTB 4F7XA 2WKCA 1AH9A 1MD2D 1KDAA 2SOBA 3CCRA 2R93G 1LT3D 3D31A 3I4MG 3CCSA 1ZYRC 2HQLA 3M7GA 4DR4L 1K3BC 2PPBC 5IP7G 1AZPA 5LL6S 3NTHA 1ZYRD 4DUZQ 5K36G 4MTNA 1ASZA 5CC4A 1D1IA 1ENAA 2F0VA 4A3IH 5KEEA 2ZXOA 5E4WC 5C4HA 3S2DH 3T1YL 4QIWB 4AYBE 1EY7A 1TY2A 2IY5B 2CWAA 2P5ZX 1SLJA 2IT1A 1STHA 4DK3C 3FMCA 3TP7A 1S5ED 2ZM6L 2R6GA 1J8IA 1SNDA 3OYYA 4NMZA 4B3MQ 4A3IG 2JA9A 2LSSA 1JJGA 4LFBQ 4X3UA 1QUQB 1WTVA 3TEHB 4BBRH 1PA6A 1CM9A 4IFDJ 1NR2A 5IGBA 1PZKD 1LT5D 3T51B 4BWGB 2LXKA 2NVTB 1QG7A 3NBHB 4LWCA 2F0PA 3A5UA 5E7NA 3I4NH 3HOUG 3S16H 5T1GA 2F0IA 4KD3A 1XTCD 2AMCB 2FMMA 1DJRD 1YVCA 1JJCB 1UEAB 4ZYSA 3Q22A 1TXYA 3L9AX 1ASYA 1JMCA 2VQEQ 1B70B 3TS2A 4IALA 2ES2A 3K7UC 3WDNA 1DM0B 2Q8IB 4A3LH 3A55A 3M85A 2D0OA 1EL0A 4A3BB 3UDGA 1PZJD 4MZ9A 3G6EA 3KLWA 3HOVG 3NEMA 1JE5A 5FJ8G 3R3OA 1GUSA 1GVPA 2KHIA 1YIJA 3NELA 1J6QA 1GUTA 1PYSB 3ZYYX 2HT1A 4B3ML 1A15A 4DR1L 5HURA 3PGZA 2EJFC 3L3OC 1EIYB 3W1BA 1HUMA 2NVXB 2F4VL 3J81c 5KRUA 3F8TA 5E1FA 1NTGA 1YHBA 4K6DA 2BH8A 2HQEA 4DA2A 1NJIC 3KDFA 1IBMQ 1FNUA 1OXUA 4JI1Q 3T1HQ 1A62A 1IBKQ 1JC7A 4IUVA 1E7ZA 2PO4A 1X56A 4NXML 5C3WA 4CGYB 1EEFD 5CMDA 3RMHA 1F77A 3OTOL 3EN2A 1ESFA 3F2CA 4KKSA 5H1SE 4BY7B 1M8AA 5C4XG 4JYAL 3GP7A 4C1NK 1VQDA 4K0KL 2HCCA 2A5HA 1UNSA 5CBEE 4CKCA 4GLXA 1N9WA 1TR5A 2JA7G 3I55A 2DJFC 2VY3A 1C0AA 1TQOA 3TS0A 3FKIG 2KCNA 3ULJA 4A3DH 4IFDG 4KI0A 4N9PA 2RVLA 4DV4Q 4DR1Q 3H0GB 4EQPA 1LT6D 5HGTA 3I70A 3P7JA 4EQOA 2FINB 4Y7NB 4J1MA 1X54A 4BBSH 2K5VA 4DR3Q 2Q2TA 1EU3A 3AB9A 1S72A 5KIXA 3MXPA 1TIID 4JI0L 1E24A 3M7NA 4KN7C 1BO0A 4GNXB 2N78A 3BJUA 3S9WA 5C3EG 2R92B 2NTSA 4JC0A 2EY1A 2NVYH 3TMEA 5JVH3 4X66L 3BU2A 3MA2B 4TKOB 3I4MH 1SSOA 2VXWA 3BYYB 3MZ5A 3KF8A 2B39A 1EY8A 4LF7L 5FLXE 1CI3M 4A3MH 5IYBH 1L1OB 1RDPD 1EWIA 5FO7B 4AYBB 2B2UA 3CPWA 2UUCL 4GNXC 5F2DA 2M9VA 3CRKC 1N33L 2RKSA 2YU9B 3IL8A 4KLKA 4TQUS 2NN6G 1H95A 1TVXA 5CV7A 1XTDA 3J81L 4OWWB 2ZTCA 1N36Q 4A3FB 3PUXA 3GTMB 2KHSA 5C44B 3BVMA 3NWSA 1LO5D 1ZXTA 5M3MB 4L6TB 1QB5D 5C4XH 4YHHL 2OXPA 1V1PA 3N52A 4GN3B 1CKOA 1D6EC 4R4QA 2G9DA 3IKJA 4DR6Q 4OONA 1D2BA 1IW7C 4K2KA 4BBRG 2Z4HA 2R3ZA 1NNXA 1U0LA 1NCVA 1VQIA 1SE4A 5D3DA 3TP6A 3F2DA 5DEHA 5DM73 4JI8L 2UUBL 2JA8H 1D5ZC 3EVQA 1DD2A 1W6KA 1E2ZA 1UE1A 2ZJPA 3G71A 1SMYD 2B2VC 3SK5A 2RF4A 1VQHA 2VUMH 5IODA 2KENA 3KF6B 3FRPB 5C0XG 2K1BA 3FPUB 1HPCA 4RH6A 4B08A 3TP5A 1TS2A 3NE5B 2AWOA 5CORA 1PH5A 1GJXA 1A3VA 1CA5A 2HDLA 3MWYW 4A3GG 3UDIA 5BN5A 1VQKA 3IFTA 3FDTA 1RHPA 2JA6H 2QILA 3S1MB 4AIMA 1S5BD 4A3BG 1Q7YC 1SNOA 1B7YB 1F2ZA 2RCFA 3V05A 4IPCA 5LMNW 3CCQA 1K8AC 4K6LA 1C8CA 3V2TA 5KGUA 4DV5L 1WI5A 1PYBA 3ND9A 3KFUA 2F0HA 1E0BA 3HOZH 5K5PA 3U9SA 5IT9L 4XYOA 1U4MA 1M90C 2RDFA 2K52A 2MJ8A 1CKNB 1WOCA 2B63B 3P1HA 3HKZB 3SXHA 4H13C 2N88A 2E2IH 4DV1L 3D6CA 4LAAA 3FPPA 5I4DA 3PO2G 1OXSC 5EBDA 4GLVB 5ELNA 2ICIA 2L0CA 1OXVA
chains in the Genus database with same CATH topology
4DUYQ 4DR2L 4LF4L 2N49A 4JI7Q 3KDFB 1Z9FA 1PH3A 1I94L 4LF9L 1GKHA 3PIOA 3IRBA 4EX5A 4A3BH 1HH2P 3HOYG 1UEBA 2R93H 1IZ6A 1CKMA 3KF8B 1E22A 1XMOL 1XPOA 3ZJYC 4B3TQ 3BZCA 2ZM6Q 1Q8KA 2MFIA 4OX9Q 4GKKL 2YYZA 3DLLA 3GTQH 1UE5A 3A74A 3F2BA 1SE8A 2DGYA 1TWAH 4DV3L 1Y1VG 2CFMA 2DUDA 2HIXA 4MNOA 4YY3L 4Y7NH 5C0XJ 1WYDA 3DM3A 2R7ZH 5GAGC 5C44G 3G4SA 1XNQL 4JV5L 2ID0A 4JI1L 4GNXA 3I56A 2A1AA 1QZGA 1LYLA 1LM0A 4PZ8A 3HOYH 3RZOH 4YWKA 2FXQA 5FLMG 2VQFQ 1M1KC 3CC4A 1XNRL 3CD6A 1T9HA 4P71A 1K83H 3CW2C 3W5OA 2GVAA 2NN6I 4YWLA 1R9TH 4DR4Q 4C3IH 4A3DG 4GKKQ 4PZ6A 3BZKA 4POFA 1HNXL 1K0RA 3OTOQ 3GO5A 2BA0A 1DGSA 4DV6L 1VCIA 4OWXB 2E5LQ 1V43A 4A75A 1X9NA 1WCMH 1KIXA 2NVQH 1NBWA 4O2DA 1PV4A 3CCUA 1KAWA 1YEZA 4DAYB 2OTLA 3MEFA 4Y52H 4JI5L 3U4ZA 3CCEA 4IPDA 1PH1A 4JOIC 1X6OA 2KCMA 3ICEA 4L5TA 1HNZQ 1BBWA 4HIMA 2QA4A 2OQ0A 3TQYA 4A3KH 1A63A 1PH9A 2UUAL 4X62L 4QL5A 1AE2A 3VDYA 1S40A 3J80i 4C2MH 4RMFA 3KJOA 2ASBA 3M4OH 2PI2A 4LF7Q 3HOVH 2Z0SA 4B3TL 2K5NA 1VQEA 1FJGL 3GTOH 1HR0Q 3S2HH 2Y0SG 4DV0Q 3L7ZC 4NXMQ 3HOZG 3J7A5 1J5EQ 1NMFA 2PI2E 1XPRA 4DR6L 1XNQQ 1Q1BA 3J7ZC 2K75A 1N32Q 2R7FA 4J15A 3I4OA 3H0GH 2K5HA 4DV2L 4YY3Q 3CAMA 2A19A 3K81C 3CCVA 5M3FG 5JJLA 3D0FA 1W3SA 3J81i 4JI0Q 1UE6A 4JOIA 2C35B 3AYHB 2B63H 5IT9c 1PH4A 1Y1VH 1VQFA 3JAMc 3G48A 1VQMA 3K7AH 4BY1H 3PF4A 3PUWA 4DV1Q 4A93H 1YHAA 3SGIA 2R7ZG 2L15A 3W1GA 2A8VA 3M4PA 4YCUA 4AQYQ 5JJKA 4X66Q 4JI6Q 3S15H 1U5KA 2OQKA 4BBSG 1WCMG 5M5WH 2GN5A 5C0XI 2UXBQ 4NB3A 1L2FA 2YTYA 4LW1A 2JE6I 3CXCA 1X3GA 2K14A 2VNUD 2NZOA 3H0GG 2V1CC 4P75A 1Q1EA 5IWAQ 1HR0W 3S1QH 1VQBA 2CCZA 1N8RC 3PSIA 4OXPA 2HHHL 1IYJB 4JI3Q 4LF6Q 4H02A 5GAEC 1KD1C 2I5MX 2EIFA 3E9HA 3I7FA 3PUYA 4R4TA 2ALYB 1X55A 1UE7A 3M9BA 4APVA 3HOXH 1K8GA 2RCNA 4HIDA 1YZ6A 3S1NH 1A0IA 5J3BA 2PMZE 4BA1I 3RZDH 3HKZE 3S17H 3J80c 2YV5A 2KHJA 2RHSB 4DAMA 3S1RH 2F52A 5C44H 4P74A 1G51A 1NMGA 1E1TA 1FL0A 2WB1E 3E0EA 1Y1WG 2E5LL 3CMAA 4HJ7A 1PH8A 4WJ4A 4PZ7A 1EOVA 2JA5G 4X65Q 4NXNQ 4A3GH 3PIPA 1PHJA 3CCLA 1PFSA 1KXLA 4RG1A 4X64Q 1I50H 1AE3A 3GTKH 1HZAA 2N3SA 2XTIA 4JBWA 5AJ3L 3H15A 2CQOA 4B3SL 4LUZA 5M3MG 2PNHA 1TWCH 1PH6A 4JI4Q 2NVXH 3PUVA 1HZ9A 3EIVA 4QJFA 1VQPA 2BH2A 1KC8C 1AH9A 3JC66 2OCEA 4PG3A 4DUZL 3CCRA 4JI5Q 2R93G 3D31A 3I4MG 3GTPH 2VW9A 3PV0A 3CCSA 1FJGQ 4JCVE 2HQLA 3S14H 2VS1A 4IJLA 3CMEA 4A3KG 4DR4L 4K0KQ 4GN4B 1XNRQ 4QGUA 1TWGH 4P73A 4HJ9A 1CKNA 4JI8Q 3FP9A 5IP7G 1HNXQ 1CUKA 1EQQA 3PO2H 1EYGA 1BKBA 4DUZQ 4JBMA 5K36G 4MTNA 3HKSA 1ASZA 2JEAI 3CCJA 4A3IH 4DR2Q 4HIOA 3PO3G 4A3MG 1N32L 5IP9H 5LMNL 2PQAA 2PQAB 4TVAB 3L2PA 1OXTA 4OX9L 4DNIA 3Q8DA 3S2DH 4IJHA 3T1YL 4AYBE 4LFCQ 2IY5B 1D8LA 4LF8L 2CWAA 3S24A 1O7IA 1SLJA 2IT1A 5IP7H 2XGTA 4DK3C 4LF5Q 2R92G 4GKJL 2MO1A 3CQZH 1KRTA 3U50C 2ZM6L 1YITA 2R6GA 3A0JA 4NXNL 4DR7Q 2UXCL 3J81j 3RR5A 3I4NG 3OYYA 2JA7H 1XMQQ 1SROA 4B3MQ 4A3IG 4HJ5A 2JA9A 2LSSA 4DUYL 4DV7Q 4JI6L 4LF4Q 5GADC 4LFBQ 1JJGA 1P16A 1QUQB 3GDEA 2IHEA 3TEHB 3K0XA 5LMUQ 4BBRH 1PA6A 1IBML 1N33Q 4AYBG 4IFDJ 3PCOB 2AHOB 4PMWA 1N34L 1WJJA 2LXKA 3HKZG 4POGA 3NBHB 1YHQA 4LWCA 1Q81C 4DV2Q 1UWVA 1VQLA 3F1ZA 1YJWA 5HY6A 3A5UA 5LMUL 5IY0A 5E7NA 3UE0A 4L5RC 1XPUA 4DR5L 3HOUG 3I4NH 1C7YA 3HOWG 1EIFA 3S16H 4R4IA 4DR3L 1RL2A 1S3OA 2AMCB 5FLXc 1YVCA 1JJCB 4EQ5A 2K4KA 2R7DA 2UU9Q 1TXYA 1YBYA 1ASYA 1CSPA 3FKIH 1XJVA 4O0AA 4R4OA 2VQEQ 1B70B 1QVGA 1JMCA 3TS2A 4BXXG 3HFZB 2ES2A 1VQNA 3K7UC 3I2ZA 1N34Q 2JA8G 4A3LH 1X3EA 1QUQA 4LFCL 3M85A 1QZHA 3CC2A 1VQ4A 4IOCA 1BBUA 2D0OA 2OTJA 1FVIA 4IFDI 3HOUH 2JQOA 4JI2L 1K3RA 3UDGA 1G291 4MZ9A 3G6EA 4OO1I 3KLWA 3GTLH 3HOVG 3NEMA 3RNUA 2RHQB 1JE5A 5FJ8G 2AWNA 4JBKA 1GVPA 3NENA 2KHIA 2GVBA 4DV7L 1YIJA 3NELA 3TRZA 1J6QA 2BA1A 4DR7L 4A3CH 1PYSB 3B6YA 2MNAA 2HT1A 1XMQL 4B3ML 4DR1L 1HZBA 3PGZA 5BR8L 1IBLQ 1EIYB 2YU9H 3W1BA 4QY7A 1VQJA 2F4VL 3J81c 4LNQA 5M3FH 1IXRA 3UE1A 4JBJA 3KYHC 3F8TA 3CC7A 2ZTEA 1NTGA 4A3FH 1YHBA 2BH8A 4ME3A 3GTMH 1NJIC 4UPAA 3KDFA 1IBMQ 1OXUA 2UXDL 4JI1Q 1C9OA 1HNZL 1VQ7A 3STBD 3T1HQ 1A62A 1KHIA 3U4VA 1B8AA 4IPHA 5IYCG 1IBKQ 3HOWH 1E7ZA 4JG2A 1X56A 4C3JH 2I5LX 4NXML 1HR0L 5AJ3Q 2UUBQ 2H5XA 3OTOL 4B3RQ 3EN2A 2KBNA 4DK6C 3F2CA 1HNWQ 1Q12A 3AEVA 2YTXA 3M3YH 1MJCA 5H1SE 3GTJH 4DV4L 5C4XG 4JYAL 4YWMA 2MO0A 1VQDA 1I5FA 4BY7G 1Q86C 1N36L 4K0KL 4A3EH 1I3QH 3ERSX 3H3VI 3ULLA 4GLXA 1N9WA 4XIGS 2JA7G 3I55A 2VY3A 3OW2A 1EFWA 1C0AA 2D62A 2CKZB 3TS0A 3FKIG 4UP7A 2JJQA 5IYBG 4BXXH 2E2HH 3ULJA 1I6HH 4A3DH 5DLQE 4HJAA 4KI0A 4IFDG 4KHZA 2VZAA 3K8AA 2UUCQ 5BR8Q 4AH6A 4IO9A 1VS0A 4B3SQ 4JYAQ 4DV4Q 4DR1Q 4X64L 5IYDH 5IE8A 2UU9L 3GD7A 3RLOA 4LUVA 4ALPA 4GOPB 2VQFL 1PH2A 1VQGA 2Y0SE 4GN5A 3CP0A 1X54A 4FDBA 2K5VA 4A4IA 2D0PA 2QEXA 4DR3Q 1GM5A 2Q2TA 3PO3H 4BBSH 3MXNB 1I94Q 2Q2UA 4LF9Q 5IP9G 5M5XH 3T1HL 4WJ3M 1YJNA 4UP9A 4JI7L 1S72A 4QQBX 4YHHQ 4GLAC 4JI0L 4OWTB 1E24A 4DKAC 4JI2Q 3M7NA 4IPGA 1A8VA 4GNXB 2N78A 1L1OC 1P8LA 3BJUA 3LGJA 4P72A 1PVOA 3UDXA 5C3EG 1IL2A 4X65L 2YTVA 2EQSA 1K9MC 2ZTDA 1K73C 4JC0A 3RLNA 2NVYH 3TREA 5IWAL 1MIUA 1KRSA 1GD7A 4LUOA 4X66L 3A5ZB 3BU2A 2E2JH 4UP8A 2VUMG 3I4MH 3CCMA 1TWHH 3PUZA 1OXXK 1SN8A 2ATWA 4LF7L 3AFQA 4A3CG 4A3MH 2ZJRA 2WB1G 1PH7A 5IYBH 1L1OB 1TWFH 1EWIA 4YCWA 5GQOA 4GOPA 4R1JA 2JA5H 3CPWA 1KQSA 2UUCL 1EUJA 3T1YQ 3UDFA 4BY7H 4DV5Q 4A93G 3RN5A 4GNXC 4JI3L 4LF6L 3M4QA 1SRUA 1SR3A 4LFAL 2IHFA 1MJEA 3S1MH 4BA2I 1JJ2A 3WWVA 1N33L 3AQQA 4UY8C 1V9PA 4A76A 4KLKA 5JEAG 3H3VH 2UXCQ 2WFWA 4DPGA 4TQUS 2NN6G 1H95A 1XTDA 4OWWB 2ZTCA 1N36Q 2N8NA 3PUXA 1NY4A 2F3IA 1JB7A 4L5SA 4X62Q 1L0WA 1YI2A 2ZJQA 4A3JG 1HZCA 1V1QA 2UUAQ 4A3LG 4YCVA 4KHPQ 1Q46A 3HOXG 1RIPA 2VL6A 1QVCA 4L5QA 3PF5A 1HNWL 5M5YH 3CF5A 3KF6A 2JA6G 2WAQG 2WP8J 5C4XH 4LF8Q 4YHHL 3L0OA 1CSQA 1X65A 5C3EH 3RLFA 4A3EG 1BVSA 4GN3B 1YJ9A 4XTCS 1CKOA 4R4QA 4DR6Q 1GO3E 2QGQA 4OONA 4GOPC 2UXDQ 2Q2IA 2OWOA 1EQRA 4GS3A 4BBRG 1J5EL 1VQ8A 2HIVA 2K50A 2AKWB 4DV6Q 1U0LA 5C4JH 1VQCA 1VQIA 1VQAA 1VQ9A 3CPFA 4X6AH 1G6PA 3F2DA 1VQOA 1SMXA 4B3RL 4JI8L 2UUBL 2JA8H 1W2BA 4A3FG 1D7QA 2R92H 2NZHA 4OO1G 4QIWE 5IYDG 1UE1A 2ZJPA 3G71A 4IOAA 5ELOA 2RF4A 2I0QA 1VQHA 5LMNQ 2E8GA 3KOJA 2VUMH 1KL9A 2KENA 3KF6B 5GROA 3K80C 3ULPA 3FHWA 5C0XG 1MKHA 2IX0A 2Z6KC 4JV5Q 1VQ6A 1QVFA 1HJPA 2F4VQ 4JI4L 3STBC 1LTLA 1X3FA 2AWOA 5HGQA 3JAMi 1PH5A 1IBLL 5JEAJ 4KHPL 2LXJA 2HHHQ 4A3GG 3UDIA 1Q82C 2VQEL 2B63G 5GAHC 5JJIA 1VQKA 1OTCA 2JK8A 4BY1G 1SFOH 3KJPA 4HIKA 1XMOQ 2JA6H 2NVTH 1E3PA 4AIMA 1Y14B 1Z47A 1Q7YC 1Y1WH 2IX1A 4A3BG 1B7YB 1IBKL 3AFPA 5IYCH 4AQYL 4LFAQ 4IPCA 4A3JH 3RN2A 5LMNW 3CCQA 1K8AC 2WAQE 4DV3Q 2CWPA 2KCTA 2I5HA 1VQ5A 5M3MH 3U58A 3ER0A 4DV5L 5EAYA 1WI5A 1PYBA 2Z6KA 3KFUA 2B3GA 1NE3A 3HOZH 2JEBI 1E1OA 2UXBL 1YNXA 3EBEA 3GTGH 2EXDA 1M90C 4DV0L 1JT8A 2K52A 4NPSA 1L1OA 5FLMH 5FJ8H 4DR5Q 1CKNB 1WFQA 1WOCA 4R4CA 4LF5L 1FGUA 2Q2HA 4GKJQ 2MQHA 2B29A 2E2IH 4DV1L 3PO2G 1OXSC 4GLVB 5ELNA 4HJ8A 4C3HH 3E9IA 1OXVA 4LFBL 1LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY Q;  4DR2 L;  4LF4 L;  2N49 A;  4JI7 Q;  3KDF B;  1Z9F A;  1PH3 A;  1I94 L;  4LF9 L;  1GKH A;  3PIO A;  3IRB A;  4EX5 A;  4A3B H;  1HH2 P;  3HOY G;  1UEB A;  2R93 H;  1IZ6 A;  1CKM A;  3KF8 B;  1E22 A;  1XMO L;  1XPO A;  3ZJY C;  4B3T Q;  3BZC A;  2ZM6 Q;  1Q8K A;  2MFI A;  4OX9 Q;  4GKK L;  2YYZ A;  3DLL A;  3GTQ H;  1UE5 A;  3A74 A;  3F2B A;  1SE8 A;  2DGY A;  1TWA H;  4DV3 L;  1Y1V G;  2CFM A;  2DUD A;  2HIX A;  4MNO A;  4YY3 L;  4Y7N H;  5C0X J;  1WYD A;  3DM3 A;  2R7Z H;  5GAG C;  5C44 G;  3G4S A;  1XNQ L;  4JV5 L;  2ID0 A;  4JI1 L;  4GNX A;  3I56 A;  2A1A A;  1QZG A;  1LYL A;  1LM0 A;  4PZ8 A;  3HOY H;  3RZO H;  4YWK A;  2FXQ A;  5FLM G;  2VQF Q;  1M1K C;  3CC4 A;  1XNR L;  3CD6 A;  1T9H A;  4P71 A;  1K83 H;  3CW2 C;  3W5O A;  2GVA A;  2NN6 I;  4YWL A;  1R9T H;  4DR4 Q;  4C3I H;  4A3D G;  4GKK Q;  4PZ6 A;  3BZK A;  4POF A;  1HNX L;  1K0R A;  3OTO Q;  3GO5 A;  2BA0 A;  1DGS A;  4DV6 L;  1VCI A;  4OWX B;  2E5L Q;  1V43 A;  4A75 A;  1X9N A;  1WCM H;  1KIX A;  2NVQ H;  1NBW A;  4O2D A;  1PV4 A;  3CCU A;  1KAW A;  1YEZ A;  4DAY B;  2OTL A;  3MEF A;  4Y52 H;  4JI5 L;  3U4Z A;  3CCE A;  4IPD A;  1PH1 A;  4JOI C;  1X6O A;  2KCM A;  3ICE A;  4L5T A;  1HNZ Q;  1BBW A;  4HIM A;  2QA4 A;  2OQ0 A;  3TQY A;  4A3K H;  1A63 A;  1PH9 A;  2UUA L;  4X62 L;  4QL5 A;  1AE2 A;  3VDY A;  1S40 A;  3J80 i;  4C2M H;  4RMF A;  3KJO A;  2ASB A;  3M4O H;  2PI2 A;  4LF7 Q;  3HOV H;  2Z0S A;  4B3T L;  2K5N A;  1VQE A;  1FJG L;  3GTO H;  1HR0 Q;  3S2H H;  2Y0S G;  4DV0 Q;  3L7Z C;  4NXM Q;  3HOZ G;  3J7A 5;  1J5E Q;  1NMF A;  2PI2 E;  1XPR A;  4DR6 L;  1XNQ Q;  1Q1B A;  3J7Z C;  2K75 A;  1N32 Q;  2R7F A;  4J15 A;  3I4O A;  3H0G H;  2K5H A;  4DV2 L;  4YY3 Q;  3CAM A;  2A19 A;  3K81 C;  3CCV A;  5M3F G;  5JJL A;  3D0F A;  1W3S A;  3J81 i;  4JI0 Q;  1UE6 A;  4JOI A;  2C35 B;  3AYH B;  2B63 H;  5IT9 c;  1PH4 A;  1Y1V H;  1VQF A;  3JAM c;  3G48 A;  1VQM A;  3K7A H;  4BY1 H;  3PF4 A;  3PUW A;  4DV1 Q;  4A93 H;  1YHA A;  3SGI A;  2R7Z G;  2L15 A;  3W1G A;  2A8V A;  3M4P A;  4YCU A;  4AQY Q;  5JJK A;  4X66 Q;  4JI6 Q;  3S15 H;  1U5K A;  2OQK A;  4BBS G;  1WCM G;  5M5W H;  2GN5 A;  5C0X I;  2UXB Q;  4NB3 A;  1L2F A;  2YTY A;  4LW1 A;  2JE6 I;  3CXC A;  1X3G A;  2K14 A;  2VNU D;  2NZO A;  3H0G G;  2V1C C;  4P75 A;  1Q1E A;  5IWA Q;  1HR0 W;  3S1Q H;  1VQB A;  2CCZ A;  1N8R C;  3PSI A;  4OXP A;  2HHH L;  1IYJ B;  4JI3 Q;  4LF6 Q;  4H02 A;  5GAE C;  1KD1 C;  2I5M X;  2EIF A;  3E9H A;  3I7F A;  3PUY A;  4R4T A;  2ALY B;  1X55 A;  1UE7 A;  3M9B A;  4APV A;  3HOX H;  1K8G A;  2RCN A;  4HID A;  1YZ6 A;  3S1N H;  1A0I A;  5J3B A;  2PMZ E;  4BA1 I;  3RZD H;  3HKZ E;  3S17 H;  3J80 c;  2YV5 A;  2KHJ A;  2RHS B;  4DAM A;  3S1R H;  2F52 A;  5C44 H;  4P74 A;  1G51 A;  1NMG A;  1E1T A;  1FL0 A;  2WB1 E;  3E0E A;  1Y1W G;  2E5L L;  3CMA A;  4HJ7 A;  1PH8 A;  4WJ4 A;  4PZ7 A;  1EOV A;  2JA5 G;  4X65 Q;  4NXN Q;  4A3G H;  3PIP A;  1PHJ A;  3CCL A;  1PFS A;  1KXL A;  4RG1 A;  4X64 Q;  1I50 H;  1AE3 A;  3GTK H;  1HZA A;  2N3S A;  2XTI A;  4JBW A;  5AJ3 L;  3H15 A;  2CQO A;  4B3S L;  4LUZ A;  5M3M G;  2PNH A;  1TWC H;  1PH6 A;  4JI4 Q;  2NVX H;  3PUV A;  1HZ9 A;  3EIV A;  4QJF A;  1VQP A;  2BH2 A;  1KC8 C;  1AH9 A;  3JC6 6;  2OCE A;  4PG3 A;  4DUZ L;  3CCR A;  4JI5 Q;  2R93 G;  3D31 A;  3I4M G;  3GTP H;  2VW9 A;  3PV0 A;  3CCS A;  1FJG Q;  4JCV E;  2HQL A;  3S14 H;  2VS1 A;  4IJL A;  3CME A;  4A3K G;  4DR4 L;  4K0K Q;  4GN4 B;  1XNR Q;  4QGU A;  1TWG H;  4P73 A;  4HJ9 A;  1CKN A;  4JI8 Q;  3FP9 A;  5IP7 G;  1HNX Q;  1CUK A;  1EQQ A;  3PO2 H;  1EYG A;  1BKB A;  4DUZ Q;  4JBM A;  5K36 G;  4MTN A;  3HKS A;  1ASZ A;  2JEA I;  3CCJ A;  4A3I H;  4DR2 Q;  4HIO A;  3PO3 G;  4A3M G;  1N32 L;  5IP9 H;  5LMN L;  2PQA A;  2PQA B;  4TVA B;  3L2P A;  1OXT A;  4OX9 L;  4DNI A;  3Q8D A;  3S2D H;  4IJH A;  3T1Y L;  4AYB E;  4LFC Q;  2IY5 B;  1D8L A;  4LF8 L;  2CWA A;  3S24 A;  1O7I A;  1SLJ A;  2IT1 A;  5IP7 H;  2XGT A;  4DK3 C;  4LF5 Q;  2R92 G;  4GKJ L;  2MO1 A;  3CQZ H;  1KRT A;  3U50 C;  2ZM6 L;  1YIT A;  2R6G A;  3A0J A;  4NXN L;  4DR7 Q;  2UXC L;  3J81 j;  3RR5 A;  3I4N G;  3OYY A;  2JA7 H;  1XMQ Q;  1SRO A;  4B3M Q;  4A3I G;  4HJ5 A;  2JA9 A;  2LSS A;  4DUY L;  4DV7 Q;  4JI6 L;  4LF4 Q;  5GAD C;  4LFB Q;  1JJG A;  1P16 A;  1QUQ B;  3GDE A;  2IHE A;  3TEH B;  3K0X A;  5LMU Q;  4BBR H;  1PA6 A;  1IBM L;  1N33 Q;  4AYB G;  4IFD J;  3PCO B;  2AHO B;  4PMW A;  1N34 L;  1WJJ A;  2LXK A;  3HKZ G;  4POG A;  3NBH B;  1YHQ A;  4LWC A;  1Q81 C;  4DV2 Q;  1UWV A;  1VQL A;  3F1Z A;  1YJW A;  5HY6 A;  3A5U A;  5LMU L;  5IY0 A;  5E7N A;  3UE0 A;  4L5R C;  1XPU A;  4DR5 L;  3HOU G;  3I4N H;  1C7Y A;  3HOW G;  1EIF A;  3S16 H;  4R4I A;  4DR3 L;  1RL2 A;  1S3O A;  2AMC B;  5FLX c;  1YVC A;  1JJC B;  4EQ5 A;  2K4K A;  2R7D A;  2UU9 Q;  1TXY A;  1YBY A;  1ASY A;  1CSP A;  3FKI H;  1XJV A;  4O0A A;  4R4O A;  2VQE Q;  1B70 B;  1QVG A;  1JMC A;  3TS2 A;  4BXX G;  3HFZ B;  2ES2 A;  1VQN A;  3K7U C;  3I2Z A;  1N34 Q;  2JA8 G;  4A3L H;  1X3E A;  1QUQ A;  4LFC L;  3M85 A;  1QZH A;  3CC2 A;  1VQ4 A;  4IOC A;  1BBU A;  2D0O A;  2OTJ A;  1FVI A;  4IFD I;  3HOU H;  2JQO A;  4JI2 L;  1K3R A;  3UDG A;  1G29 1;  4MZ9 A;  3G6E A;  4OO1 I;  3KLW A;  3GTL H;  3HOV G;  3NEM A;  3RNU A;  2RHQ B;  1JE5 A;  5FJ8 G;  2AWN A;  4JBK A;  1GVP A;  3NEN A;  2KHI A;  2GVB A;  4DV7 L;  1YIJ A;  3NEL A;  3TRZ A;  1J6Q A;  2BA1 A;  4DR7 L;  4A3C H;  1PYS B;  3B6Y A;  2MNA A;  2HT1 A;  1XMQ L;  4B3M L;  4DR1 L;  1HZB A;  3PGZ A;  5BR8 L;  1IBL Q;  1EIY B;  2YU9 H;  3W1B A;  4QY7 A;  1VQJ A;  2F4V L;  3J81 c;  4LNQ A;  5M3F H;  1IXR A;  3UE1 A;  4JBJ A;  3KYH C;  3F8T A;  3CC7 A;  2ZTE A;  1NTG A;  4A3F H;  1YHB A;  2BH8 A;  4ME3 A;  3GTM H;  1NJI C;  4UPA A;  3KDF A;  1IBM Q;  1OXU A;  2UXD L;  4JI1 Q;  1C9O A;  1HNZ L;  1VQ7 A;  3STB D;  3T1H Q;  1A62 A;  1KHI A;  3U4V A;  1B8A A;  4IPH A;  5IYC G;  1IBK Q;  3HOW H;  1E7Z A;  4JG2 A;  1X56 A;  4C3J H;  2I5L X;  4NXM L;  1HR0 L;  5AJ3 Q;  2UUB Q;  2H5X A;  3OTO L;  4B3R Q;  3EN2 A;  2KBN A;  4DK6 C;  3F2C A;  1HNW Q;  1Q12 A;  3AEV A;  2YTX A;  3M3Y H;  1MJC A;  5H1S E;  3GTJ H;  4DV4 L;  5C4X G;  4JYA L;  4YWM A;  2MO0 A;  1VQD A;  1I5F A;  4BY7 G;  1Q86 C;  1N36 L;  4K0K L;  4A3E H;  1I3Q H;  3ERS X;  3H3V I;  3ULL A;  4GLX A;  1N9W A;  4XIG S;  2JA7 G;  3I55 A;  2VY3 A;  3OW2 A;  1EFW A;  1C0A A;  2D62 A;  2CKZ B;  3TS0 A;  3FKI G;  4UP7 A;  2JJQ A;  5IYB G;  4BXX H;  2E2H H;  3ULJ A;  1I6H H;  4A3D H;  5DLQ E;  4HJA A;  4KI0 A;  4IFD G;  4KHZ A;  2VZA A;  3K8A A;  2UUC Q;  5BR8 Q;  4AH6 A;  4IO9 A;  1VS0 A;  4B3S Q;  4JYA Q;  4DV4 Q;  4DR1 Q;  4X64 L;  5IYD H;  5IE8 A;  2UU9 L;  3GD7 A;  3RLO A;  4LUV A;  4ALP A;  4GOP B;  2VQF L;  1PH2 A;  1VQG A;  2Y0S E;  4GN5 A;  3CP0 A;  1X54 A;  4FDB A;  2K5V A;  4A4I A;  2D0P A;  2QEX A;  4DR3 Q;  1GM5 A;  2Q2T A;  3PO3 H;  4BBS H;  3MXN B;  1I94 Q;  2Q2U A;  4LF9 Q;  5IP9 G;  5M5X H;  3T1H L;  4WJ3 M;  1YJN A;  4UP9 A;  4JI7 L;  1S72 A;  4QQB X;  4YHH Q;  4GLA C;  4JI0 L;  4OWT B;  1E24 A;  4DKA C;  4JI2 Q;  3M7N A;  4IPG A;  1A8V A;  4GNX B;  2N78 A;  1L1O C;  1P8L A;  3BJU A;  3LGJ A;  4P72 A;  1PVO A;  3UDX A;  5C3E G;  1IL2 A;  4X65 L;  2YTV A;  2EQS A;  1K9M C;  2ZTD A;  1K73 C;  4JC0 A;  3RLN A;  2NVY H;  3TRE A;  5IWA L;  1MIU A;  1KRS A;  1GD7 A;  4LUO A;  4X66 L;  3A5Z B;  3BU2 A;  2E2J H;  4UP8 A;  2VUM G;  3I4M H;  3CCM A;  1TWH H;  3PUZ A;  1OXX K;  1SN8 A;  2ATW A;  4LF7 L;  3AFQ A;  4A3C G;  4A3M H;  2ZJR A;  2WB1 G;  1PH7 A;  5IYB H;  1L1O B;  1TWF H;  1EWI A;  4YCW A;  5GQO A;  4GOP A;  4R1J A;  2JA5 H;  3CPW A;  1KQS A;  2UUC L;  1EUJ A;  3T1Y Q;  3UDF A;  4BY7 H;  4DV5 Q;  4A93 G;  3RN5 A;  4GNX C;  4JI3 L;  4LF6 L;  3M4Q A;  1SRU A;  1SR3 A;  4LFA L;  2IHF A;  1MJE A;  3S1M H;  4BA2 I;  1JJ2 A;  3WWV A;  1N33 L;  3AQQ A;  4UY8 C;  1V9P A;  4A76 A;  4KLK A;  5JEA G;  3H3V H;  2UXC Q;  2WFW A;  4DPG A;  4TQU S;  2NN6 G;  1H95 A;  1XTD A;  4OWW B;  2ZTC A;  1N36 Q;  2N8N A;  3PUX A;  1NY4 A;  2F3I A;  1JB7 A;  4L5S A;  4X62 Q;  1L0W A;  1YI2 A;  2ZJQ A;  4A3J G;  1HZC A;  1V1Q A;  2UUA Q;  4A3L G;  4YCV A;  4KHP Q;  1Q46 A;  3HOX G;  1RIP A;  2VL6 A;  1QVC A;  4L5Q A;  3PF5 A;  1HNW L;  5M5Y H;  3CF5 A;  3KF6 A;  2JA6 G;  2WAQ G;  2WP8 J;  5C4X H;  4LF8 Q;  4YHH L;  3L0O A;  1CSQ A;  1X65 A;  5C3E H;  3RLF A;  4A3E G;  1BVS A;  4GN3 B;  1YJ9 A;  4XTC S;  1CKO A;  4R4Q A;  4DR6 Q;  1GO3 E;  2QGQ A;  4OON A;  4GOP C;  2UXD Q;  2Q2I A;  2OWO A;  1EQR A;  4GS3 A;  4BBR G;  1J5E L;  1VQ8 A;  2HIV A;  2K50 A;  2AKW B;  4DV6 Q;  1U0L A;  5C4J H;  1VQC A;  1VQI A;  1VQA A;  1VQ9 A;  3CPF A;  4X6A H;  1G6P A;  3F2D A;  1VQO A;  1SMX A;  4B3R L;  4JI8 L;  2UUB L;  2JA8 H;  1W2B A;  4A3F G;  1D7Q A;  2R92 H;  2NZH A;  4OO1 G;  4QIW E;  5IYD G;  1UE1 A;  2ZJP A;  3G71 A;  4IOA A;  5ELO A;  2RF4 A;  2I0Q A;  1VQH A;  5LMN Q;  2E8G A;  3KOJ A;  2VUM H;  1KL9 A;  2KEN A;  3KF6 B;  5GRO A;  3K80 C;  3ULP A;  3FHW A;  5C0X G;  1MKH A;  2IX0 A;  2Z6K C;  4JV5 Q;  1VQ6 A;  1QVF A;  1HJP A;  2F4V Q;  4JI4 L;  3STB C;  1LTL A;  1X3F A;  2AWO A;  5HGQ A;  3JAM i;  1PH5 A;  1IBL L;  5JEA J;  4KHP L;  2LXJ A;  2HHH Q;  4A3G G;  3UDI A;  1Q82 C;  2VQE L;  2B63 G;  5GAH C;  5JJI A;  1VQK A;  1OTC A;  2JK8 A;  4BY1 G;  1SFO H;  3KJP A;  4HIK A;  1XMO Q;  2JA6 H;  2NVT H;  1E3P A;  4AIM A;  1Y14 B;  1Z47 A;  1Q7Y C;  1Y1W H;  2IX1 A;  4A3B G;  1B7Y B;  1IBK L;  3AFP A;  5IYC H;  4AQY L;  4LFA Q;  4IPC A;  4A3J H;  3RN2 A;  5LMN W;  3CCQ A;  1K8A C;  2WAQ E;  4DV3 Q;  2CWP A;  2KCT A;  2I5H A;  1VQ5 A;  5M3M H;  3U58 A;  3ER0 A;  4DV5 L;  5EAY A;  1WI5 A;  1PYB A;  2Z6K A;  3KFU A;  2B3G A;  1NE3 A;  3HOZ H;  2JEB I;  1E1O A;  2UXB L;  1YNX A;  3EBE A;  3GTG H;  2EXD A;  1M90 C;  4DV0 L;  1JT8 A;  2K52 A;  4NPS A;  1L1O A;  5FLM H;  5FJ8 H;  4DR5 Q;  1CKN B;  1WFQ A;  1WOC A;  4R4C A;  4LF5 L;  1FGU A;  2Q2H A;  4GKJ Q;  2MQH A;  2B29 A;  2E2I H;  4DV1 L;  3PO2 G;  1OXS C;  4GLV B;  5ELN A;  4HJ8 A;  4C3H H;  3E9I A;  1OXV A;  4LFB L;  1LUZ A; 
#chains in the Genus database with same CATH topology
 4DUY Q;  2K5Q A;  2N49 A;  1KLG D;  4XYQ A;  1QNK A;  1Z9F A;  2PQE A;  2VUM B;  3IRB A;  4ZRZ A;  1H9S A;  3Q6S A;  1HH2 P;  3HOY G;  1XMO L;  2AQ3 B;  4R9W A;  1WTQ A;  3BZC A;  2ZM6 Q;  4HR7 B;  2N55 A;  4OX9 Q;  2YYZ A;  4GKK L;  5FO9 B;  5BN3 A;  3A74 A;  2DGY A;  5J22 A;  1TWA H;  3KBG A;  2XNA C;  2HIX A;  2ZT9 C;  1WYD A;  1BCP F;  1I6V C;  5C44 G;  3G4S A;  1I4G A;  2C5C A;  2HUG A;  1TU2 B;  5C5M A;  4A3E B;  1F9Q A;  2A1A A;  4PZ8 A;  4DNR B;  3PIP 3;  5FK9 C;  5FLM G;  3CC4 A;  2AUJ D;  1FGB D;  1CHP D;  2B2W A;  2E2D C;  3BZD B;  1K83 H;  4A3D G;  4U68 A;  2BA0 A;  1FR3 A;  2Q8T A;  1WCM H;  4V19 0;  1NBW A;  4O2D A;  3CCU A;  1STB A;  3MEF A;  4CDC C;  5M9O A;  4RHR A;  1X6O A;  5ELB A;  3E3X A;  2QA4 A;  1B1Z A;  5IT9 E;  2OQ0 A;  1Y8N B;  2K01 A;  3KLR A;  1S40 A;  4RMF A;  2B2Y A;  2ASB A;  2EJG C;  5BN4 A;  3M4O H;  1A6X A;  3HOV H;  4FF2 A;  2K5N A;  4NKL A;  1HR0 Q;  2Y0S G;  3L7Z C;  2I07 B;  5A2Q E;  2D5D A;  2L12 A;  5CV9 A;  4QF4 A;  2ICE C;  3H0G H;  2K5H A;  3NTI A;  5DNF A;  5M3F G;  1W3S A;  3URY A;  5IT9 c;  1PH4 A;  3JAM c;  1G8Z D;  3G48 A;  5JPN C;  3NSW A;  1K0S A;  1YHA A;  1EEI D;  4YCU A;  1O7L A;  4X3K A;  4X66 Q;  3OPO A;  5K36 H;  1G2T A;  2SNS A;  4NB3 A;  2YTY A;  4LW1 A;  3NK9 A;  3DWP A;  1SNM A;  1VQB A;  4RGN A;  2HHH L;  1IYJ B;  4LF6 Q;  4H02 A;  3PUY A;  3I7F A;  4R4T A;  2ALY B;  1X55 A;  1K8G A;  2RCN A;  1HRJ A;  4B9X A;  3S1N H;  1A0I A;  5J3B A;  1UAP A;  1MSG A;  1HXY D;  3HKZ E;  4KY5 A;  3J80 c;  2FJ2 A;  2KHJ A;  2E74 C;  1RF2 D;  4KKT A;  5C3E B;  1G51 A;  3HGB A;  1Y1W G;  3CMA A;  4HJ7 A;  2JA5 G;  2R61 A;  1KAA A;  4X65 Q;  4NXN Q;  3PIP A;  5CYU A;  4X64 Q;  3PMF A;  4JBW A;  1WTH A;  2N3S A;  2XTI A;  2WII B;  2CQO A;  2JA6 B;  2PNH A;  1TWC H;  4F87 A;  4JI4 Q;  1XXG A;  3EIV A;  2F1M A;  3H6M A;  3OIQ A;  1KDC A;  1KC8 C;  3EA6 A;  4U67 3;  4FF4 A;  1PRT D;  2K05 A;  3MHB A;  3NWT A;  4IUU A;  3R8B A;  1H9S B;  3PV0 A;  3CKI B;  3S14 H;  2HDM A;  2VS1 A;  4IJL A;  4PMC A;  3K6O A;  3CME A;  1A3U A;  4QGU A;  4P73 A;  1AEX A;  1CKN A;  3S17 B;  1CUK A;  3HOZ B;  1H9M A;  2EVB A;  3TDQ A;  2A6H C;  4HIO A;  4A3M G;  2D9U A;  1CZW A;  2EY6 A;  3OHX C;  4NDX A;  1N32 L;  2IWH A;  2PQA B;  3L2P A;  4K8I A;  4OX9 L;  3Q8D A;  1U9R A;  4UAI A;  1D8L A;  3I3C A;  1TS4 A;  1KNA A;  2XGT A;  4JPB W;  1ILQ A;  2MO1 A;  1YIT A;  2M00 A;  3J81 j;  3I4N G;  2WAC A;  1RTN A;  2RSN A;  4LF4 Q;  4DV7 Q;  4WOR A;  4JI6 L;  2O5J C;  5GAD C;  1PYW D;  3VR2 A;  4M1U B;  1P16 A;  1SFO B;  5LMU Q;  4FF3 A;  4AYB G;  2E75 C;  3HEJ A;  1Q81 C;  4DV2 Q;  1UWV A;  3P75 A;  1KLU D;  1KTK A;  3F1Z A;  1XPU A;  2KVM A;  1EIG A;  5LMU L;  1C48 A;  1VMC A;  4DR5 L;  2L11 A;  3DMU A;  4X3S A;  1NSN S;  4HSV A;  2A69 C;  4KMU C;  2L9H A;  2UU9 Q;  1YBY A;  1OO9 B;  2LKV A;  3X3N A;  2E2H B;  3FKI H;  1XJV A;  4O0A A;  4R4O A;  1QVG A;  3GTG B;  2QDL A;  5FKA C;  2JA8 G;  5IIF A;  1QZH A;  1BBU A;  5A2Q L;  3NBI A;  1FVI A;  3PO2 B;  4IFD I;  2MUY A;  1CK1 A;  3HOU H;  4IUR A;  1NUC A;  1G29 1;  3SE0 A;  2RHQ B;  4DR7 L;  4DV7 L;  5JVG 3;  1KAB A;  2BA1 A;  3WOE A;  2MNA A;  4C3J G;  2Z1C A;  4A3K B;  1HZB A;  5BR8 L;  2EXZ A;  1VQJ A;  5TSS A;  2V4D A;  2OEO A;  2RDH A;  4LNQ A;  1IXR A;  4JBJ A;  3KYH C;  2ZTE A;  4A3F H;  2QW7 A;  3GTM H;  5KYL A;  1VQ7 A;  3HOW H;  1AFP A;  1KHI A;  1B8A A;  4ZUJ A;  2E2J B;  4JG2 A;  4KN4 C;  4DFA A;  3KK7 A;  2UUB Q;  4ZAI A;  2G5D A;  2KBN A;  2F0Q A;  1Q12 A;  3M3Y H;  1WTR A;  2PCF B;  1SMY C;  1IKM A;  4IUP A;  3EJI A;  1I4P A;  1I3Q H;  2JSO A;  2X69 A;  4NW2 A;  3ULL A;  3D6W A;  4C2M B;  1HQM C;  2CH4 A;  4BXX H;  1QJO A;  1SEB D;  4IUQ A;  3IAY A;  1IW7 D;  5G3L F;  1X3P A;  4OEL B;  5DLQ E;  3I4L A;  3BDL A;  5BR8 Q;  5D3I B;  4IO9 A;  5IGG A;  4KV6 A;  1SJE D;  2KCC A;  2UU9 L;  4LUV A;  5KNB A;  1PH2 A;  2HCI A;  3CP0 A;  2D0P A;  3TN2 A;  4RCN A;  1I94 Q;  2Q2U A;  4LF9 Q;  2EOT A;  1I4R A;  4UP9 A;  4JI7 L;  4QQB X;  4YHH Q;  2SEB D;  2H1E A;  2K33 A;  2EY5 A;  1Y1W B;  1H9R A;  1L1O C;  1P8L A;  5CBA E;  1PVO A;  1Q3L A;  1IL2 A;  4X65 L;  1EIH A;  2YTV A;  1YNJ D;  2EQS A;  2ZTD A;  1K73 C;  4ABN A;  3A7A B;  1CT1 D;  1G2S A;  1MIU A;  1KRS A;  4LUO A;  4YIJ A;  3HOU B;  3A5Z B;  4H44 C;  3HOX B;  1OXX K;  1SN8 A;  3LWE A;  3AFQ A;  4A3C G;  5I2X A;  2ZJR A;  1Q8I A;  3PIO 3;  5DAU A;  2MHV A;  2EY2 A;  4BY7 H;  3UDF A;  4A93 G;  4FNF A;  4LF6 L;  3M4Q A;  1SR3 A;  5AFW A;  2IHF A;  3S1Q B;  1JJ2 A;  1WTW A;  1I50 B;  1XYI A;  1V9P A;  4A76 A;  3H3V H;  4DPG A;  4EGV A;  1JOO A;  2N8N A;  1JB7 A;  2F3I A;  1MSH A;  4L5S A;  4G7Z C;  4A3L G;  2ZJQ A;  1HZC A;  4R8I A;  4YCV A;  1YNN D;  3J7A V;  3PF5 A;  1RIP A;  1HNW L;  2B2T A;  3ERO A;  5M5Y H;  3S1R B;  2WAQ G;  4LF8 Q;  4XQQ A;  2BOS A;  3L0O A;  1C4Q A;  4A3E G;  3OSO A;  1HTL D;  3K5L A;  4XTC S;  1SYC A;  4XQJ A;  4L63 B;  1KNE A;  4RFB A;  2QGQ A;  4GOP C;  1EY6 A;  1I3Q B;  4GS3 A;  2OWO A;  1S4Z A;  2RQX A;  1J5E L;  1VQ8 A;  1TWG B;  4BBR B;  2HIV A;  2AKW B;  5C4J H;  4X6A H;  1BXT A;  3LNN A;  1SYF A;  5IGE A;  4OO1 G;  5IGF A;  1JB3 A;  1GOZ A;  2E8G A;  1KL9 A;  3K80 C;  3FHW A;  1SNC A;  1MKH A;  2IX0 A;  3EQL C;  3W2D A;  1F2Y A;  4C1N I;  3DXJ C;  2F4V Q;  3HZX A;  1LTL A;  1R4Q B;  3JAM i;  1RTO A;  5JEA J;  1SYB A;  2XRQ D;  2F0S A;  2IL8 A;  1Q82 C;  2VQE L;  1HUN A;  3WOF A;  3KJP A;  1E3P A;  3TP8 A;  1Y14 B;  3DEP A;  4FF1 A;  2A74 C;  2AQ2 B;  1B53 A;  1D5X C;  2K5D A;  4N8X 1;  2DNE A;  2NB0 A;  1ET6 A;  5ELD A;  4PQX A;  4F88 A;  2TSS A;  4RKB A;  3K5O A;  3U58 A;  1VQ5 A;  5EAY A;  1LTT D;  1NE3 A;  1F2M A;  5JJZ A;  4K14 A;  1E1O A;  1YNX A;  3R2T A;  2EXD A;  4DXG A;  1LTG D;  1NAP A;  1YNJ C;  1L0X B;  3C46 A;  2O2L D;  4GKJ Q;  2Q2H A;  1WD1 A;  1EY4 A;  3A8K E;  4JW0 A;  3I91 A;  3I4N B;  2QEJ C;  1SBB B;  3D4R A;  4HJ8 A;  1SAP A;  4DR2 L;  3KDF B;  2ZXR A;  4HMJ A;  1ENC A;  2QF7 A;  4FVM A;  1DOK A;  1GKH A;  1QNU A;  2K03 A;  5CR3 A;  3BS1 A;  4A3B H;  3BYT B;  1ICW A;  1IZ6 A;  1CKM A;  1XPO A;  1B2T A;  4B3T Q;  1ROD A;  4DV3 L;  4MNO A;  4YY3 L;  4UHV A;  4Y7N H;  3AMU A;  2JYO A;  5I6Y A;  4JV5 L;  2Z8L A;  2Z4I A;  4K8J A;  3I56 A;  3MXU A;  1CA6 A;  1LYL A;  1ET9 A;  5C3X A;  2VQF Q;  3CD6 A;  2I46 A;  2KQ3 A;  1T9H A;  2O4X A;  2G9H D;  3G6J B;  1XNR L;  2GVA A;  3KUP A;  1R9T H;  4DR4 Q;  4C3I H;  4POF A;  1HNX L;  1K0R A;  3C1F A;  1DCZ A;  4CJ1 B;  1DGS A;  2XIW A;  4CDE C;  2E5L Q;  1X9N A;  1KIX A;  2NVQ H;  1KAW A;  1YEZ A;  4V0B A;  2JP1 A;  3CCE A;  2B2W C;  1PH1 A;  3S15 B;  5A35 A;  4L5T A;  1HNZ Q;  1BBW A;  3TQY A;  5I9P A;  5FOB B;  1AN8 A;  4X62 L;  2XVS A;  3VDY A;  3J80 i;  3PO3 B;  4C2M H;  2CW0 D;  4C3H B;  1B9M A;  1LTI D;  4LF7 Q;  2Z0S A;  2D2C C;  4B3T L;  3R93 A;  2PZU A;  1FJG L;  5EBC A;  3HOZ G;  5C0X H;  3SVM A;  2J7Z A;  2PI2 E;  5I6W A;  1XPR A;  2F0T A;  4HCE A;  4XDX A;  1XNQ Q;  1Q1B A;  5L37 A;  1BNZ A;  3I4O A;  4DV2 L;  3K81 C;  3CCV A;  5JJL A;  4KKU A;  4OHJ A;  4Z9C B;  4JI0 Q;  4JOI A;  5D14 A;  2C35 B;  1HA5 A;  1Y1V H;  1VQF A;  2IPK D;  3MVV A;  4A93 H;  3K7A H;  4BY1 H;  1DZ1 A;  4AQY Q;  4JI6 Q;  1TWF B;  2OQK A;  3NPP A;  3VYR A;  2GN5 A;  4L8J A;  3MFG A;  5JAV A;  2NYZ D;  2JE6 I;  5CV6 A;  2NZO A;  1QIL A;  4C3I G;  3HRZ C;  2MP1 A;  3D4D A;  3SDZ A;  1GHJ A;  4HSP A;  1R9T B;  2TMP A;  1GXD C;  1UE7 A;  1B44 D;  3D4W A;  4A3M B;  5CV4 A;  4HID A;  1G91 A;  2PMZ E;  3J80 L;  4H0L C;  4BA1 I;  3S17 H;  2KOL A;  1HFN A;  5C44 H;  3A8J E;  2B8F A;  1A3T A;  1FL0 A;  5EGT A;  2E5L L;  1PH8 A;  4WJ4 A;  4A3G H;  1EYA A;  1PHJ A;  1SJH D;  4XXE A;  1HZA A;  4ZKC B;  3GTK H;  2BE5 D;  4KHV A;  3ND8 A;  1PH6 A;  3TSS A;  2BDN A;  2NVX H;  1LT4 D;  2X6L A;  2CVR A;  3VR3 A;  4DUZ L;  1EZ6 A;  2OCE A;  4PG3 A;  4JI5 Q;  2A6H D;  3Q0A A;  3GTP H;  1FJG Q;  4JCV E;  2A6E C;  5CGK A;  4A3K G;  4K0K Q;  1EU4 A;  4GN4 B;  1XNR Q;  2F4I A;  4HJ9 A;  3UI2 A;  1PMR A;  5EKL A;  1BKB A;  4JBM A;  1TKW B;  3HKS A;  4I65 A;  3H09 A;  2JEA I;  3CCJ A;  3A54 A;  2PMZ B;  4DR2 Q;  3PO3 G;  5IP9 H;  2PQA A;  2QDB A;  3TBI B;  4DNI A;  3KLS A;  4IJH A;  2E2I B;  5EKK A;  4LFC Q;  2NZ1 D;  4LF8 L;  1VMP A;  5IP7 H;  4GKJ L;  2L1B A;  3CQZ H;  3U50 C;  4DR7 Q;  3RR5 A;  1BCP B;  1XMQ Q;  1SRO A;  4PV1 C;  4C3J B;  1IL8 A;  2IHE A;  4ZK9 B;  3K0X A;  1IBM L;  3PCO B;  4PMW A;  3J7A F;  1LAB A;  1N34 L;  4BBS B;  3ERQ A;  5EQ0 A;  1YHQ A;  1VQL A;  1E2W A;  1YJW A;  5HY6 A;  5IY0 A;  1HQR D;  2F0K A;  1C7Y A;  1EIF A;  2O5I C;  4R4I A;  1QCB D;  3SK4 A;  1RL2 A;  1SE3 A;  4DR3 L;  2Y0S B;  1X3Q A;  2Z6B A;  1LAC A;  2K4K A;  2R7D A;  4KY7 A;  2DY7 A;  4F8M A;  4DK0 A;  2FHT A;  1VQN A;  1ZEQ X;  3I2Z A;  4LFC L;  2NUC A;  1VQ4 A;  4IOC A;  3CC2 A;  3ITP A;  4KTA A;  4RCO A;  1IYU A;  4A3G B;  4OO1 I;  3K5N A;  3NBH A;  3RNU A;  2LFN A;  2CH4 W;  1JWU D;  2AWN A;  3NEN A;  3VYU A;  3E6Z X;  3K0Y A;  4DNT B;  3B6Y A;  1XMQ L;  1W6J A;  4H7B A;  1IBL Q;  2YU9 H;  1STN A;  1PFM A;  5M3F H;  2RA4 A;  3I72 A;  3UE1 A;  3M4O B;  2CQA A;  3CC7 A;  3I90 A;  4ME3 A;  4UPA A;  4OO1 H;  2UXD L;  3J7Y W;  1C9O A;  1HNZ L;  1A2U A;  3STB D;  5IYC G;  2JN4 A;  3CU7 A;  1HR0 L;  2IW3 A;  5AJ3 Q;  1K8O A;  2H5X A;  4B3R Q;  1HNW Q;  3F2U A;  1GUG A;  1E2V A;  1GUO A;  3AEV A;  2AUK A;  1Y1V B;  2MO0 A;  5J1Z A;  4A3E H;  2A69 D;  3H3V I;  2KJX A;  4IZ8 A;  4LJZ C;  4XIG S;  5C4J B;  2CKZ B;  4C3I B;  4UP7 A;  2JJQ A;  3T53 B;  5IYB G;  3EFX D;  2ZXP A;  2VZA A;  3K8A A;  1WCM B;  4OGQ C;  1VS0 A;  3OWF A;  5JPM C;  1T5X D;  3GD7 A;  3RLO A;  2F03 A;  4O1N A;  2HD3 A;  1HFG A;  5IP9 G;  5ISR A;  1YJN A;  1Q90 A;  1JCK B;  4GLA C;  4OWT B;  4DKA C;  4JI2 Q;  4FXD A;  4P72 A;  3LGJ A;  1WTO A;  2BCO A;  3MAQ A;  3E5S A;  1K9M C;  3RLN A;  5IWA L;  4K2L A;  4CBV A;  1GD7 A;  1WTP A;  1TWH H;  1BQQ T;  3RZD B;  2NN6 H;  1LV9 A;  1PH7 A;  2AQ1 B;  2VB2 X;  3DM1 A;  4DF7 A;  2K6A A;  2JA5 H;  3T1Y Q;  3RN5 A;  3QJY A;  1R4P B;  4LFA L;  4BA2 I;  1JWS D;  1MJE A;  1FNW A;  3TZD A;  1F9R A;  3VYT A;  3AQQ A;  2CW0 C;  5EPJ A;  5JEA G;  3KBX A;  5FO8 B;  2WFW A;  3HS0 C;  3K58 A;  1WVL A;  1NY4 A;  5DM6 3;  3BDO A;  1D5M C;  1STG A;  1YI2 A;  4KHP Q;  2UUA Q;  3HOX G;  1QVC A;  4XT3 B;  4C3H G;  2C9O A;  4WJW A;  2X6G A;  2JA6 G;  1CSQ A;  1F9S A;  1X65 A;  5C3E H;  4FYD A;  3OMC A;  4XQN A;  1YJ9 A;  3PQI A;  3S14 B;  3MEH A;  5M5W B;  4Q0F A;  2Q2I A;  1AP0 A;  2K50 A;  4C56 C;  3IFD A;  1VQC A;  1VQA A;  2XWB B;  1RJT A;  1BBX C;  1BCP C;  5IGC A;  1VQO A;  1SMX A;  2EZV A;  4FXK C;  2PZW A;  1Z7T A;  1D7Q A;  1SXT A;  2R92 H;  2NZH A;  4GZY C;  4QIW E;  4IOA A;  3NUC A;  1PTO D;  4A3D B;  1O7Y A;  5LMN Q;  3KOJ A;  1CQV A;  5GRO A;  1ML0 D;  1S5D D;  2OF1 A;  4QMG A;  1TS3 A;  4JV5 Q;  1QVF A;  1HJP A;  4JI4 L;  3HP3 A;  1X3F A;  4O42 A;  3V96 A;  4QCL A;  3E0J A;  2EYJ A;  3AU7 A;  5JJI A;  1JIC A;  5ELF A;  2B63 G;  3G7L A;  1OTC A;  2JK8 A;  4UDU C;  5KYI A;  1SFO H;  3MC0 B;  4HIK A;  2NVT H;  3NP8 A;  3T13 A;  3AFP A;  3VYS A;  5IYC H;  4AQY L;  4RHS A;  1EOT A;  4A3J H;  3RN2 A;  1O7Z A;  4QB4 A;  4DV3 Q;  3FVQ A;  2EYF A;  1IYV A;  4K5W A;  2KCT A;  3Q23 A;  5M3M H;  5IOC A;  3ER0 A;  3VR6 A;  3QOJ A;  1RD9 D;  2Z6K A;  3QB3 A;  1H9K A;  5C4Z A;  2B3G A;  1KDB A;  2A6E D;  1TY0 A;  2UXB L;  4ILW A;  3GTG H;  1K28 A;  2SDF A;  1DXM A;  1GUW A;  4DR5 Q;  3K7A B;  4MN3 A;  1L1O A;  4BY1 B;  1CTM A;  1JOR A;  4R4C A;  1MHW C;  3QWN A;  1FGU A;  4LF5 L;  2MQH A;  2BE5 C;  4IQZ A;  1K83 B;  4S3S A;  3P20 A;  3VA5 A;  2A73 B;  3E9I A;  4PMB A;  4LF4 L;  4JI7 Q;  4ZLT F;  1DOL A;  4OIJ A;  4TSS A;  1PH3 A;  1I94 L;  4LF9 L;  4EX5 A;  2F0J A;  5C4X B;  2R93 H;  2B8G A;  5I2Y A;  3KF8 B;  1E22 A;  3ZJY C;  3D3R A;  1Q8K A;  4G57 A;  1JOQ A;  2ENB A;  2K04 A;  1V8Q A;  3GTQ H;  2PW5 A;  1HA6 A;  5EPK A;  5I9O A;  3F2B A;  1SE8 A;  2L4N A;  1Y1V G;  2CFM A;  1U4L A;  2DUD A;  2RDG A;  1RCV D;  5GAG C;  2ID0 A;  4JI1 L;  4GNX A;  1EWH A;  1HHV A;  2FFK B;  3JAM E;  4R8N A;  2OT2 A;  1V1O A;  4CDF C;  4CKE A;  3RZO H;  4YWK A;  5M3F B;  1M1K C;  3DWQ A;  3W5O A;  5FLX L;  2NN6 I;  4A3J B;  4PZ6 A;  3BZK A;  3QIA A;  1MBY A;  1VCI A;  1V43 A;  3RUZ A;  4A75 A;  4I7Z C;  3C2P A;  1STA A;  2OTL A;  4Y52 H;  4JI5 L;  3U4Z A;  3I73 A;  2K7V A;  1XX8 A;  4JOI C;  3K57 A;  2KCM A;  1Y8P B;  3ICE A;  5D65 A;  3A56 A;  1AW7 A;  3KLS X;  1B3A A;  5IGD A;  2JA5 B;  1PH9 A;  2UUA L;  4WFN 3;  3SEB A;  3MFY A;  1TWA B;  2Q8R E;  3KJO A;  2PI2 A;  1B50 A;  3S2H H;  4DV0 Q;  3OMG A;  4NXM Q;  3J7A 5;  1J5E Q;  2LS0 1;  3DHQ A;  3NHH A;  1CHQ D;  2NVY B;  3J7Z C;  2K75 A;  4HTH A;  1IHZ A;  1VF5 C;  2R7F A;  4J15 A;  5CV5 A;  1JE4 A;  3CAM A;  2A19 A;  3QOL A;  2EYO A;  3D0F A;  1QOH A;  3H94 A;  3GTJ B;  1BF4 A;  3PUW A;  4DV1 Q;  2R7Z G;  3M4P A;  1B9N A;  5JJK A;  2DJG C;  2F0E A;  1U5K A;  1WCM G;  3VA7 A;  4N8F A;  1L2F A;  4NP5 A;  2K14 A;  2V1C C;  3H0G G;  1Q1E A;  1HR0 W;  2PYK A;  3S1Q H;  4J8Q A;  1N8R C;  3PSI A;  3RZO B;  2K28 A;  3BDC A;  3S2D B;  4JI3 Q;  1WD0 A;  1KD1 C;  2EIF A;  3E9H A;  3HOX H;  3M9B A;  4APV A;  3A7L A;  2JXM B;  2NTT A;  2F0F A;  1YZ6 A;  4LK1 C;  4DU9 A;  4MTK A;  2YV5 A;  3GTQ B;  3SHL A;  4DAM A;  4KJN A;  4P74 A;  5C5L A;  1DON A;  2WB1 E;  4OIK A;  3NQT A;  2L5T A;  1CQF A;  5G3L D;  2NBF A;  2RBM A;  1EOV A;  1IKL A;  3MXN A;  5CV8 A;  4ZUI A;  2R7Z B;  1ESR A;  1ONL A;  1PFS A;  4RG1 A;  1KXL A;  3D8G A;  1I50 H;  3QR8 A;  4IUT A;  4B3S L;  4LUZ A;  5M3M G;  4P2C B;  2LY7 A;  4OL7 A;  1HZ9 A;  1VQP A;  2BH2 A;  1UUP A;  1I4Q A;  3JC6 6;  5ELE A;  2VW9 A;  1TT2 A;  3BVG A;  1XWE A;  3GV3 A;  2K32 A;  3OOC A;  1PTO B;  1TWG H;  4ODG A;  4JI8 Q;  3FP9 A;  1HNX Q;  3U9O A;  1EQQ A;  3PO2 H;  1PRT C;  4EVO A;  1EYG A;  2IJ0 A;  2KEC A;  4IN3 A;  4A93 B;  1BDO A;  1EY9 A;  4FXG C;  3RD4 A;  5LMN L;  4TVA B;  5E3F A;  3GTO B;  1OXT A;  5JOB A;  5C6A A;  3S24 A;  1PFB A;  1O7I A;  4LF5 Q;  2R92 G;  4K5V A;  1KRT A;  4LMQ D;  4DXF A;  4RAU C;  1SYE A;  3A0J A;  5EJW A;  4NXN L;  2BDO A;  3J81 E;  2UXC L;  2JA7 H;  3TZU A;  4HJ5 A;  3HOW B;  4DUY L;  4MHE A;  3GDE A;  4RKL A;  1MGS A;  1N33 Q;  4DAV A;  2AHO B;  1WJJ A;  1A2T A;  3HKZ G;  3M3Y B;  3O13 A;  4POG A;  4L5R C;  1PFN A;  3UE0 A;  2F0M A;  2EYP A;  1JQY D;  4ULL A;  4RWS C;  3HOW G;  4A3I B;  2WB1 B;  1S3O A;  5FLX c;  1I4X A;  4ZQ3 A;  4EQ5 A;  1I6H B;  2XRS D;  1CSP A;  4BXX G;  4JVZ A;  3HFZ B;  1DYQ A;  4K5X A;  1N34 Q;  5LHY 1;  1X3E A;  1QUQ A;  2RSO A;  2OTJ A;  4G7O C;  3CHB D;  3SK6 A;  2KEE A;  5ELC A;  2JQO A;  4JI2 L;  1K3R A;  1PTO H;  3GTL H;  2B2T C;  4JBK A;  3TRZ A;  1HTP A;  1SYG A;  2GVB A;  4A3C H;  1AZQ A;  1TWC B;  4KK7 A;  1F9P A;  4ME5 A;  4QY7 A;  4Q5V A;  3Q24 A;  2H4O A;  3U4V A;  4IPH A;  1NR4 A;  4C3J H;  2I5L X;  2A68 D;  4DK6 C;  1PRT F;  2DN8 A;  2YTX A;  4CHT B;  1MJC A;  3GTJ H;  4DV4 L;  2KUM A;  4YWM A;  4RGT A;  1I5F A;  4BY7 G;  1Q86 C;  1N36 L;  2LMC B;  3ERS X;  1TS5 A;  1PDQ A;  1EWC A;  2SNM A;  3FEW X;  3OW2 A;  1EFW A;  2EJM A;  1EYD A;  2F3W A;  4FO2 A;  2D62 A;  4MIU A;  3CRL C;  1X32 A;  2E2H H;  2PZT A;  3LX0 A;  1L0Y B;  2VB3 X;  1Z6H A;  1I6H H;  4HED A;  4HJA A;  1JOK A;  4KHZ A;  2UUC Q;  2NVQ B;  1GUN A;  1HCZ A;  2NWG A;  2F0W A;  4AH6 A;  4B3S Q;  2L55 A;  4JYA Q;  1FD7 D;  4X64 L;  5IYD H;  5IE8 A;  1ICF B;  4ALP A;  3QO2 A;  4GOP B;  2VQF L;  1VQG A;  5J39 A;  2Y0S E;  1YNN C;  4GN5 A;  3GQB A;  4FDB A;  4A4I A;  2QEX A;  2KA7 A;  3HG9 A;  1GM5 A;  3PO3 H;  3MXN B;  5M5X H;  3T1H L;  2QCP X;  4WJ3 M;  2EDG A;  2FMC A;  2WV6 D;  2JA8 B;  2EYM A;  1JWM D;  4IPG A;  1EY0 A;  1A8V A;  2WAQ B;  3S2H B;  3GTK B;  4ZCK A;  2J0T D;  3UDX A;  2WKD A;  1FYC A;  4KJO A;  5KND A;  3TRE A;  3N6R A;  2E2J H;  4UP8 A;  2VUM G;  4CJ2 C;  3CCM A;  4B9W A;  3PUZ A;  2J4X A;  2ATW A;  1FNV A;  3SR1 A;  2GA4 B;  2WB1 G;  1DOM A;  4YCW A;  1TWF H;  3X3M A;  4ZKB B;  5GQO A;  4GOP A;  3M4Y A;  4R1J A;  3DWA A;  4HAE A;  1KQS A;  1EUJ A;  4DV5 Q;  1EFI D;  3GV6 A;  4JI3 L;  4QUF A;  3S1M H;  1SRU A;  1Y8O B;  2M2L A;  2E76 C;  3WWV A;  1B4O A;  1EQV A;  4UY8 C;  2F3V A;  2UXC Q;  3S1N B;  4X62 Q;  1L0W A;  4A3J G;  1V1Q A;  1EZ8 A;  2DNC A;  3NXW A;  1PXU A;  1Q46 A;  3MTS A;  2VL6 A;  4L5Q A;  5EPL A;  1WTX A;  3CF5 A;  3KF6 A;  1N32 Q;  2F0U A;  2WP8 J;  1U4P A;  3RLF A;  2JA7 B;  1BVS A;  1SE2 A;  1GO3 E;  2UXD Q;  1EQR A;  1PTO C;  2K5W A;  4RGO S;  1PZI D;  4DV6 Q;  1SDF A;  1VQ9 A;  3CPF A;  1G6P A;  4J6H A;  3J80 E;  1LTR D;  4B3R L;  1W2B A;  4A3F G;  5LL6 X;  3K5M A;  1BCP D;  5IYD G;  2EE1 A;  4KD4 A;  5ELO A;  2I0Q A;  1ILP A;  4HCS A;  4OEM B;  3GTP B;  1O80 A;  3ULP A;  2A68 C;  1RKN A;  3ONA B;  1STY A;  2Z6K C;  1VQ6 A;  4G4K A;  1JR0 D;  3STB C;  1IBL L;  5HGQ A;  1VDZ A;  4KHP L;  2LXJ A;  2HHH Q;  1U4R A;  4E6I A;  2EYH A;  5GAH C;  4BY1 G;  1XMO Q;  1S5C D;  1LTB D;  3HOY B;  1Z47 A;  4FP5 D;  4IUN A;  1Y1W H;  4I7A A;  2IX1 A;  1IBK L;  4G7H C;  4LFA Q;  1CFM A;  5KNC A;  1M4V A;  2WAQ E;  3I4M B;  1II3 A;  2MPM A;  2R93 B;  2CWP A;  2F0N A;  1QE6 A;  1K8M A;  2I5H A;  4RGM A;  5M5Y B;  2XWJ B;  2JEB I;  3EBE A;  3H91 A;  3JAM L;  1BUV T;  3A8I E;  4DV0 L;  1JT8 A;  5FLM H;  4NPS A;  3I8Z A;  5FJ8 H;  5JEA H;  1WFQ A;  1O78 A;  2F0G A;  2F0D A;  3NTK A;  3C1E A;  2DY8 A;  4TRD A;  2B29 A;  3NQI A;  4C3H H;  3FKI B;  3HOV B;  1LUZ A;  4LFB L;  1ZKO A;  1BOS A;  3K59 A;  4CJ0 B;  3QG1 A;  2F0O A;  2F0L A;  1S5F D;  3PIO A;  3DEO A;  2MGS A;  3R2I A;  5T1I A;  4HN7 A;  1UEB A;  4XT1 B;  3BVZ A;  2MFI A;  1LLR D;  3DLL A;  1J9O A;  1T5E A;  1UE5 A;  4X3T A;  1PTO F;  5C0X J;  1B3Q A;  3S16 B;  3DM3 A;  2R7Z H;  1XNQ L;  5M5X B;  1QZG A;  1H9J A;  3OIP A;  1LM0 A;  4CKB A;  3HOY H;  2FXQ A;  2B2V A;  4P71 A;  3CW2 C;  4YWL A;  4GKK Q;  4JK1 C;  5COY A;  3OTO Q;  3GO5 A;  4DK1 A;  1Y69 U;  4DV6 L;  3LWU A;  4OWX B;  2EPB A;  1PV4 A;  3C3L A;  4WRD A;  4DAY B;  4DAY A;  1SNQ A;  4IPD A;  2PNR C;  4DN4 M;  1LTA D;  2EYL A;  1I4H A;  1GHK A;  4HIM A;  3VR5 A;  3T56 B;  4A3K H;  1A63 A;  4QL5 A;  1AE2 A;  1EYC A;  4DGZ A;  3H3V C;  2IX3 A;  2PW7 A;  1VQE A;  3GTO H;  1EY5 A;  1STE A;  1D1K A;  4RA8 A;  1NMF A;  2B2Y C;  1LTS D;  4DR6 L;  1PLF A;  3SK8 A;  1VF7 A;  4KY6 A;  5NUC A;  1EQT A;  2XSC A;  4ID6 A;  4BS9 A;  4YY3 Q;  1BR9 A;  4HMI A;  1SNP A;  3J81 i;  1UE6 A;  2B63 H;  3AYH B;  1VQM A;  3PF4 A;  1TWH B;  3SGI A;  2L15 A;  2WIN B;  3W1G A;  2A8V A;  1F2L A;  2Z9H A;  2QKI C;  4QUC A;  3S15 H;  4EQN A;  4BBS G;  1G6Z A;  5M5W H;  1SYD A;  4N9T A;  5C0X I;  2UXB Q;  3CXC A;  3MXG A;  1X3G A;  2VNU D;  4P75 A;  5IWA Q;  4DAP A;  1MI2 A;  4PNY A;  2CCZ A;  5E4X A;  4OXP A;  5EKI A;  5GAE C;  2XN9 C;  4IFD H;  2I5M X;  3DUZ A;  3RZD H;  1V1P B;  2KED A;  2RHS B;  1QWY A;  3S1R H;  2F52 A;  1NMG A;  3T16 A;  1E1T A;  3E0E A;  3OWE B;  3BG3 A;  3T4A C;  4PZ7 A;  2CHB D;  3W3A A;  1ENF A;  3CCL A;  3OW7 A;  3GTL B;  1AE3 A;  3VR4 A;  4CDD C;  3H15 A;  5AJ3 L;  2B2U C;  1CZG A;  4M8A A;  3CQZ B;  3PUV A;  4QJF A;  1PRT B;  4F7X A;  2WKC A;  1AH9 A;  1MD2 D;  1KDA A;  2SOB A;  3CCR A;  2R93 G;  1LT3 D;  3D31 A;  3I4M G;  3CCS A;  1ZYR C;  2HQL A;  3M7G A;  4DR4 L;  1K3B C;  2PPB C;  5IP7 G;  1AZP A;  5LL6 S;  3NTH A;  1ZYR D;  4DUZ Q;  5K36 G;  4MTN A;  1ASZ A;  5CC4 A;  1D1I A;  1ENA A;  2F0V A;  4A3I H;  5KEE A;  2ZXO A;  5E4W C;  5C4H A;  3S2D H;  3T1Y L;  4QIW B;  4AYB E;  1EY7 A;  1TY2 A;  2IY5 B;  2CWA A;  2P5Z X;  1SLJ A;  2IT1 A;  1STH A;  4DK3 C;  3FMC A;  3TP7 A;  1S5E D;  2ZM6 L;  2R6G A;  1J8I A;  1SND A;  3OYY A;  4NMZ A;  4B3M Q;  4A3I G;  2JA9 A;  2LSS A;  1JJG A;  4LFB Q;  4X3U A;  1QUQ B;  1WTV A;  3TEH B;  4BBR H;  1PA6 A;  1CM9 A;  4IFD J;  1NR2 A;  5IGB A;  1PZK D;  1LT5 D;  3T51 B;  4BWG B;  2LXK A;  2NVT B;  1QG7 A;  3NBH B;  4LWC A;  2F0P A;  3A5U A;  5E7N A;  3I4N H;  3HOU G;  3S16 H;  5T1G A;  2F0I A;  4KD3 A;  1XTC D;  2AMC B;  2FMM A;  1DJR D;  1YVC A;  1JJC B;  1UEA B;  4ZYS A;  3Q22 A;  1TXY A;  3L9A X;  1ASY A;  1JMC A;  2VQE Q;  1B70 B;  3TS2 A;  4IAL A;  2ES2 A;  3K7U C;  3WDN A;  1DM0 B;  2Q8I B;  4A3L H;  3A55 A;  3M85 A;  2D0O A;  1EL0 A;  4A3B B;  3UDG A;  1PZJ D;  4MZ9 A;  3G6E A;  3KLW A;  3HOV G;  3NEM A;  1JE5 A;  5FJ8 G;  3R3O A;  1GUS A;  1GVP A;  2KHI A;  1YIJ A;  3NEL A;  1J6Q A;  1GUT A;  1PYS B;  3ZYY X;  2HT1 A;  4B3M L;  1A15 A;  4DR1 L;  5HUR A;  3PGZ A;  2EJF C;  3L3O C;  1EIY B;  3W1B A;  1HUM A;  2NVX B;  2F4V L;  3J81 c;  5KRU A;  3F8T A;  5E1F A;  1NTG A;  1YHB A;  4K6D A;  2BH8 A;  2HQE A;  4DA2 A;  1NJI C;  3KDF A;  1IBM Q;  1FNU A;  1OXU A;  4JI1 Q;  3T1H Q;  1A62 A;  1IBK Q;  1JC7 A;  4IUV A;  1E7Z A;  2PO4 A;  1X56 A;  4NXM L;  5C3W A;  4CGY B;  1EEF D;  5CMD A;  3RMH A;  1F77 A;  3OTO L;  3EN2 A;  1ESF A;  3F2C A;  4KKS A;  5H1S E;  4BY7 B;  1M8A A;  5C4X G;  4JYA L;  3GP7 A;  4C1N K;  1VQD A;  4K0K L;  2HCC A;  2A5H A;  1UNS A;  5CBE E;  4CKC A;  4GLX A;  1N9W A;  1TR5 A;  2JA7 G;  3I55 A;  2DJF C;  2VY3 A;  1C0A A;  1TQO A;  3TS0 A;  3FKI G;  2KCN A;  3ULJ A;  4A3D H;  4IFD G;  4KI0 A;  4N9P A;  2RVL A;  4DV4 Q;  4DR1 Q;  3H0G B;  4EQP A;  1LT6 D;  5HGT A;  3I70 A;  3P7J A;  4EQO A;  2FIN B;  4Y7N B;  4J1M A;  1X54 A;  4BBS H;  2K5V A;  4DR3 Q;  2Q2T A;  1EU3 A;  3AB9 A;  1S72 A;  5KIX A;  3MXP A;  1TII D;  4JI0 L;  1E24 A;  3M7N A;  4KN7 C;  1BO0 A;  4GNX B;  2N78 A;  3BJU A;  3S9W A;  5C3E G;  2R92 B;  2NTS A;  4JC0 A;  2EY1 A;  2NVY H;  3TME A;  5JVH 3;  4X66 L;  3BU2 A;  3MA2 B;  4TKO B;  3I4M H;  1SSO A;  2VXW A;  3BYY B;  3MZ5 A;  3KF8 A;  2B39 A;  1EY8 A;  4LF7 L;  5FLX E;  1CI3 M;  4A3M H;  5IYB H;  1L1O B;  1RDP D;  1EWI A;  5FO7 B;  4AYB B;  2B2U A;  3CPW A;  2UUC L;  4GNX C;  5F2D A;  2M9V A;  3CRK C;  1N33 L;  2RKS A;  2YU9 B;  3IL8 A;  4KLK A;  4TQU S;  2NN6 G;  1H95 A;  1TVX A;  5CV7 A;  1XTD A;  3J81 L;  4OWW B;  2ZTC A;  1N36 Q;  4A3F B;  3PUX A;  3GTM B;  2KHS A;  5C44 B;  3BVM A;  3NWS A;  1LO5 D;  1ZXT A;  5M3M B;  4L6T B;  1QB5 D;  5C4X H;  4YHH L;  2OXP A;  1V1P A;  3N52 A;  4GN3 B;  1CKO A;  1D6E C;  4R4Q A;  2G9D A;  3IKJ A;  4DR6 Q;  4OON A;  1D2B A;  1IW7 C;  4K2K A;  4BBR G;  2Z4H A;  2R3Z A;  1NNX A;  1U0L A;  1NCV A;  1VQI A;  1SE4 A;  5D3D A;  3TP6 A;  3F2D A;  5DEH A;  5DM7 3;  4JI8 L;  2UUB L;  2JA8 H;  1D5Z C;  3EVQ A;  1DD2 A;  1W6K A;  1E2Z A;  1UE1 A;  2ZJP A;  3G71 A;  1SMY D;  2B2V C;  3SK5 A;  2RF4 A;  1VQH A;  2VUM H;  5IOD A;  2KEN A;  3KF6 B;  3FRP B;  5C0X G;  2K1B A;  3FPU B;  1HPC A;  4RH6 A;  4B08 A;  3TP5 A;  1TS2 A;  3NE5 B;  2AWO A;  5COR A;  1PH5 A;  1GJX A;  1A3V A;  1CA5 A;  2HDL A;  3MWY W;  4A3G G;  3UDI A;  5BN5 A;  1VQK A;  3IFT A;  3FDT A;  1RHP A;  2JA6 H;  2QIL A;  3S1M B;  4AIM A;  1S5B D;  4A3B G;  1Q7Y C;  1SNO A;  1B7Y B;  1F2Z A;  2RCF A;  3V05 A;  4IPC A;  5LMN W;  3CCQ A;  1K8A C;  4K6L A;  1C8C A;  3V2T A;  5KGU A;  4DV5 L;  1WI5 A;  1PYB A;  3ND9 A;  3KFU A;  2F0H A;  1E0B A;  3HOZ H;  5K5P A;  3U9S A;  5IT9 L;  4XYO A;  1U4M A;  1M90 C;  2RDF A;  2K52 A;  2MJ8 A;  1CKN B;  1WOC A;  2B63 B;  3P1H A;  3HKZ B;  3SXH A;  4H13 C;  2N88 A;  2E2I H;  4DV1 L;  3D6C A;  4LAA A;  3FPP A;  5I4D A;  3PO2 G;  1OXS C;  5EBD A;  4GLV B;  5ELN A;  2ICI A;  2L0C A;  1OXV A; 
#chains in the Genus database with same CATH homology
 4DUY Q;  4DR2 L;  4LF4 L;  2N49 A;  4JI7 Q;  3KDF B;  1Z9F A;  1PH3 A;  1I94 L;  4LF9 L;  1GKH A;  3PIO A;  3IRB A;  4EX5 A;  4A3B H;  1HH2 P;  3HOY G;  1UEB A;  2R93 H;  1IZ6 A;  1CKM A;  3KF8 B;  1E22 A;  1XMO L;  1XPO A;  3ZJY C;  4B3T Q;  3BZC A;  2ZM6 Q;  1Q8K A;  2MFI A;  4OX9 Q;  4GKK L;  2YYZ A;  3DLL A;  3GTQ H;  1UE5 A;  3A74 A;  3F2B A;  1SE8 A;  2DGY A;  1TWA H;  4DV3 L;  1Y1V G;  2CFM A;  2DUD A;  2HIX A;  4MNO A;  4YY3 L;  4Y7N H;  5C0X J;  1WYD A;  3DM3 A;  2R7Z H;  5GAG C;  5C44 G;  3G4S A;  1XNQ L;  4JV5 L;  2ID0 A;  4JI1 L;  4GNX A;  3I56 A;  2A1A A;  1QZG A;  1LYL A;  1LM0 A;  4PZ8 A;  3HOY H;  3RZO H;  4YWK A;  2FXQ A;  5FLM G;  2VQF Q;  1M1K C;  3CC4 A;  1XNR L;  3CD6 A;  1T9H A;  4P71 A;  1K83 H;  3CW2 C;  3W5O A;  2GVA A;  2NN6 I;  4YWL A;  1R9T H;  4DR4 Q;  4C3I H;  4A3D G;  4GKK Q;  4PZ6 A;  3BZK A;  4POF A;  1HNX L;  1K0R A;  3OTO Q;  3GO5 A;  2BA0 A;  1DGS A;  4DV6 L;  1VCI A;  4OWX B;  2E5L Q;  1V43 A;  4A75 A;  1X9N A;  1WCM H;  1KIX A;  2NVQ H;  1NBW A;  4O2D A;  1PV4 A;  3CCU A;  1KAW A;  1YEZ A;  4DAY B;  2OTL A;  3MEF A;  4Y52 H;  4JI5 L;  3U4Z A;  3CCE A;  4IPD A;  1PH1 A;  4JOI C;  1X6O A;  2KCM A;  3ICE A;  4L5T A;  1HNZ Q;  1BBW A;  4HIM A;  2QA4 A;  2OQ0 A;  3TQY A;  4A3K H;  1A63 A;  1PH9 A;  2UUA L;  4X62 L;  4QL5 A;  1AE2 A;  3VDY A;  1S40 A;  3J80 i;  4C2M H;  4RMF A;  3KJO A;  2ASB A;  3M4O H;  2PI2 A;  4LF7 Q;  3HOV H;  2Z0S A;  4B3T L;  2K5N A;  1VQE A;  1FJG L;  3GTO H;  1HR0 Q;  3S2H H;  2Y0S G;  4DV0 Q;  3L7Z C;  4NXM Q;  3HOZ G;  3J7A 5;  1J5E Q;  1NMF A;  2PI2 E;  1XPR A;  4DR6 L;  1XNQ Q;  1Q1B A;  3J7Z C;  2K75 A;  1N32 Q;  2R7F A;  4J15 A;  3I4O A;  3H0G H;  2K5H A;  4DV2 L;  4YY3 Q;  3CAM A;  2A19 A;  3K81 C;  3CCV A;  5M3F G;  5JJL A;  3D0F A;  1W3S A;  3J81 i;  4JI0 Q;  1UE6 A;  4JOI A;  2C35 B;  3AYH B;  2B63 H;  5IT9 c;  1PH4 A;  1Y1V H;  1VQF A;  3JAM c;  3G48 A;  1VQM A;  3K7A H;  4BY1 H;  3PF4 A;  3PUW A;  4DV1 Q;  4A93 H;  1YHA A;  3SGI A;  2R7Z G;  2L15 A;  3W1G A;  2A8V A;  3M4P A;  4YCU A;  4AQY Q;  5JJK A;  4X66 Q;  4JI6 Q;  3S15 H;  1U5K A;  2OQK A;  4BBS G;  1WCM G;  5M5W H;  2GN5 A;  5C0X I;  2UXB Q;  4NB3 A;  1L2F A;  2YTY A;  4LW1 A;  2JE6 I;  3CXC A;  1X3G A;  2K14 A;  2VNU D;  2NZO A;  3H0G G;  2V1C C;  4P75 A;  1Q1E A;  5IWA Q;  1HR0 W;  3S1Q H;  1VQB A;  2CCZ A;  1N8R C;  3PSI A;  4OXP A;  2HHH L;  1IYJ B;  4JI3 Q;  4LF6 Q;  4H02 A;  5GAE C;  1KD1 C;  2I5M X;  2EIF A;  3E9H A;  3I7F A;  3PUY A;  4R4T A;  2ALY B;  1X55 A;  1UE7 A;  3M9B A;  4APV A;  3HOX H;  1K8G A;  2RCN A;  4HID A;  1YZ6 A;  3S1N H;  1A0I A;  5J3B A;  2PMZ E;  4BA1 I;  3RZD H;  3HKZ E;  3S17 H;  3J80 c;  2YV5 A;  2KHJ A;  2RHS B;  4DAM A;  3S1R H;  2F52 A;  5C44 H;  4P74 A;  1G51 A;  1NMG A;  1E1T A;  1FL0 A;  2WB1 E;  3E0E A;  1Y1W G;  2E5L L;  3CMA A;  4HJ7 A;  1PH8 A;  4WJ4 A;  4PZ7 A;  1EOV A;  2JA5 G;  4X65 Q;  4NXN Q;  4A3G H;  3PIP A;  1PHJ A;  3CCL A;  1PFS A;  1KXL A;  4RG1 A;  4X64 Q;  1I50 H;  1AE3 A;  3GTK H;  1HZA A;  2N3S A;  2XTI A;  4JBW A;  5AJ3 L;  3H15 A;  2CQO A;  4B3S L;  4LUZ A;  5M3M G;  2PNH A;  1TWC H;  1PH6 A;  4JI4 Q;  2NVX H;  3PUV A;  1HZ9 A;  3EIV A;  4QJF A;  1VQP A;  2BH2 A;  1KC8 C;  1AH9 A;  3JC6 6;  2OCE A;  4PG3 A;  4DUZ L;  3CCR A;  4JI5 Q;  2R93 G;  3D31 A;  3I4M G;  3GTP H;  2VW9 A;  3PV0 A;  3CCS A;  1FJG Q;  4JCV E;  2HQL A;  3S14 H;  2VS1 A;  4IJL A;  3CME A;  4A3K G;  4DR4 L;  4K0K Q;  4GN4 B;  1XNR Q;  4QGU A;  1TWG H;  4P73 A;  4HJ9 A;  1CKN A;  4JI8 Q;  3FP9 A;  5IP7 G;  1HNX Q;  1CUK A;  1EQQ A;  3PO2 H;  1EYG A;  1BKB A;  4DUZ Q;  4JBM A;  5K36 G;  4MTN A;  3HKS A;  1ASZ A;  2JEA I;  3CCJ A;  4A3I H;  4DR2 Q;  4HIO A;  3PO3 G;  4A3M G;  1N32 L;  5IP9 H;  5LMN L;  2PQA A;  2PQA B;  4TVA B;  3L2P A;  1OXT A;  4OX9 L;  4DNI A;  3Q8D A;  3S2D H;  4IJH A;  3T1Y L;  4AYB E;  4LFC Q;  2IY5 B;  1D8L A;  4LF8 L;  2CWA A;  3S24 A;  1O7I A;  1SLJ A;  2IT1 A;  5IP7 H;  2XGT A;  4DK3 C;  4LF5 Q;  2R92 G;  4GKJ L;  2MO1 A;  3CQZ H;  1KRT A;  3U50 C;  2ZM6 L;  1YIT A;  2R6G A;  3A0J A;  4NXN L;  4DR7 Q;  2UXC L;  3J81 j;  3RR5 A;  3I4N G;  3OYY A;  2JA7 H;  1XMQ Q;  1SRO A;  4B3M Q;  4A3I G;  4HJ5 A;  2JA9 A;  2LSS A;  4DUY L;  4DV7 Q;  4JI6 L;  4LF4 Q;  5GAD C;  4LFB Q;  1JJG A;  1P16 A;  1QUQ B;  3GDE A;  2IHE A;  3TEH B;  3K0X A;  5LMU Q;  4BBR H;  1PA6 A;  1IBM L;  1N33 Q;  4AYB G;  4IFD J;  3PCO B;  2AHO B;  4PMW A;  1N34 L;  1WJJ A;  2LXK A;  3HKZ G;  4POG A;  3NBH B;  1YHQ A;  4LWC A;  1Q81 C;  4DV2 Q;  1UWV A;  1VQL A;  3F1Z A;  1YJW A;  5HY6 A;  3A5U A;  5LMU L;  5IY0 A;  5E7N A;  3UE0 A;  4L5R C;  1XPU A;  4DR5 L;  3HOU G;  3I4N H;  1C7Y A;  3HOW G;  1EIF A;  3S16 H;  4R4I A;  4DR3 L;  1RL2 A;  1S3O A;  2AMC B;  5FLX c;  1YVC A;  1JJC B;  4EQ5 A;  2K4K A;  2R7D A;  2UU9 Q;  1TXY A;  1YBY A;  1ASY A;  1CSP A;  3FKI H;  1XJV A;  4O0A A;  4R4O A;  2VQE Q;  1B70 B;  1QVG A;  1JMC A;  3TS2 A;  4BXX G;  3HFZ B;  2ES2 A;  1VQN A;  3K7U C;  3I2Z A;  1N34 Q;  2JA8 G;  4A3L H;  1X3E A;  1QUQ A;  4LFC L;  3M85 A;  1QZH A;  3CC2 A;  1VQ4 A;  4IOC A;  1BBU A;  2D0O A;  2OTJ A;  1FVI A;  4IFD I;  3HOU H;  2JQO A;  4JI2 L;  1K3R A;  3UDG A;  1G29 1;  4MZ9 A;  3G6E A;  4OO1 I;  3KLW A;  3GTL H;  3HOV G;  3NEM A;  3RNU A;  2RHQ B;  1JE5 A;  5FJ8 G;  2AWN A;  4JBK A;  1GVP A;  3NEN A;  2KHI A;  2GVB A;  4DV7 L;  1YIJ A;  3NEL A;  3TRZ A;  1J6Q A;  2BA1 A;  4DR7 L;  4A3C H;  1PYS B;  3B6Y A;  2MNA A;  2HT1 A;  1XMQ L;  4B3M L;  4DR1 L;  1HZB A;  3PGZ A;  5BR8 L;  1IBL Q;  1EIY B;  2YU9 H;  3W1B A;  4QY7 A;  1VQJ A;  2F4V L;  3J81 c;  4LNQ A;  5M3F H;  1IXR A;  3UE1 A;  4JBJ A;  3KYH C;  3F8T A;  3CC7 A;  2ZTE A;  1NTG A;  4A3F H;  1YHB A;  2BH8 A;  4ME3 A;  3GTM H;  1NJI C;  4UPA A;  3KDF A;  1IBM Q;  1OXU A;  2UXD L;  4JI1 Q;  1C9O A;  1HNZ L;  1VQ7 A;  3STB D;  3T1H Q;  1A62 A;  1KHI A;  3U4V A;  1B8A A;  4IPH A;  5IYC G;  1IBK Q;  3HOW H;  1E7Z A;  4JG2 A;  1X56 A;  4C3J H;  2I5L X;  4NXM L;  1HR0 L;  5AJ3 Q;  2UUB Q;  2H5X A;  3OTO L;  4B3R Q;  3EN2 A;  2KBN A;  4DK6 C;  3F2C A;  1HNW Q;  1Q12 A;  3AEV A;  2YTX A;  3M3Y H;  1MJC A;  5H1S E;  3GTJ H;  4DV4 L;  5C4X G;  4JYA L;  4YWM A;  2MO0 A;  1VQD A;  1I5F A;  4BY7 G;  1Q86 C;  1N36 L;  4K0K L;  4A3E H;  1I3Q H;  3ERS X;  3H3V I;  3ULL A;  4GLX A;  1N9W A;  4XIG S;  2JA7 G;  3I55 A;  2VY3 A;  3OW2 A;  1EFW A;  1C0A A;  2D62 A;  2CKZ B;  3TS0 A;  3FKI G;  4UP7 A;  2JJQ A;  5IYB G;  4BXX H;  2E2H H;  3ULJ A;  1I6H H;  4A3D H;  5DLQ E;  4HJA A;  4KI0 A;  4IFD G;  4KHZ A;  2VZA A;  3K8A A;  2UUC Q;  5BR8 Q;  4AH6 A;  4IO9 A;  1VS0 A;  4B3S Q;  4JYA Q;  4DV4 Q;  4DR1 Q;  4X64 L;  5IYD H;  5IE8 A;  2UU9 L;  3GD7 A;  3RLO A;  4LUV A;  4ALP A;  4GOP B;  2VQF L;  1PH2 A;  1VQG A;  2Y0S E;  4GN5 A;  3CP0 A;  1X54 A;  4FDB A;  2K5V A;  4A4I A;  2D0P A;  2QEX A;  4DR3 Q;  1GM5 A;  2Q2T A;  3PO3 H;  4BBS H;  3MXN B;  1I94 Q;  2Q2U A;  4LF9 Q;  5IP9 G;  5M5X H;  3T1H L;  4WJ3 M;  1YJN A;  4UP9 A;  4JI7 L;  1S72 A;  4QQB X;  4YHH Q;  4GLA C;  4JI0 L;  4OWT B;  1E24 A;  4DKA C;  4JI2 Q;  3M7N A;  4IPG A;  1A8V A;  4GNX B;  2N78 A;  1L1O C;  1P8L A;  3BJU A;  3LGJ A;  4P72 A;  1PVO A;  3UDX A;  5C3E G;  1IL2 A;  4X65 L;  2YTV A;  2EQS A;  1K9M C;  2ZTD A;  1K73 C;  4JC0 A;  3RLN A;  2NVY H;  3TRE A;  5IWA L;  1MIU A;  1KRS A;  1GD7 A;  4LUO A;  4X66 L;  3A5Z B;  3BU2 A;  2E2J H;  4UP8 A;  2VUM G;  3I4M H;  3CCM A;  1TWH H;  3PUZ A;  1OXX K;  1SN8 A;  2ATW A;  4LF7 L;  3AFQ A;  4A3C G;  4A3M H;  2ZJR A;  2WB1 G;  1PH7 A;  5IYB H;  1L1O B;  1TWF H;  1EWI A;  4YCW A;  5GQO A;  4GOP A;  4R1J A;  2JA5 H;  3CPW A;  1KQS A;  2UUC L;  1EUJ A;  3T1Y Q;  3UDF A;  4BY7 H;  4DV5 Q;  4A93 G;  3RN5 A;  4GNX C;  4JI3 L;  4LF6 L;  3M4Q A;  1SRU A;  1SR3 A;  4LFA L;  2IHF A;  1MJE A;  3S1M H;  4BA2 I;  1JJ2 A;  3WWV A;  1N33 L;  3AQQ A;  4UY8 C;  1V9P A;  4A76 A;  4KLK A;  5JEA G;  3H3V H;  2UXC Q;  2WFW A;  4DPG A;  4TQU S;  2NN6 G;  1H95 A;  1XTD A;  4OWW B;  2ZTC A;  1N36 Q;  2N8N A;  3PUX A;  1NY4 A;  2F3I A;  1JB7 A;  4L5S A;  4X62 Q;  1L0W A;  1YI2 A;  2ZJQ A;  4A3J G;  1HZC A;  1V1Q A;  2UUA Q;  4A3L G;  4YCV A;  4KHP Q;  1Q46 A;  3HOX G;  1RIP A;  2VL6 A;  1QVC A;  4L5Q A;  3PF5 A;  1HNW L;  5M5Y H;  3CF5 A;  3KF6 A;  2JA6 G;  2WAQ G;  2WP8 J;  5C4X H;  4LF8 Q;  4YHH L;  3L0O A;  1CSQ A;  1X65 A;  5C3E H;  3RLF A;  4A3E G;  1BVS A;  4GN3 B;  1YJ9 A;  4XTC S;  1CKO A;  4R4Q A;  4DR6 Q;  1GO3 E;  2QGQ A;  4OON A;  4GOP C;  2UXD Q;  2Q2I A;  2OWO A;  1EQR A;  4GS3 A;  4BBR G;  1J5E L;  1VQ8 A;  2HIV A;  2K50 A;  2AKW B;  4DV6 Q;  1U0L A;  5C4J H;  1VQC A;  1VQI A;  1VQA A;  1VQ9 A;  3CPF A;  4X6A H;  1G6P A;  3F2D A;  1VQO A;  1SMX A;  4B3R L;  4JI8 L;  2UUB L;  2JA8 H;  1W2B A;  4A3F G;  1D7Q A;  2R92 H;  2NZH A;  4OO1 G;  4QIW E;  5IYD G;  1UE1 A;  2ZJP A;  3G71 A;  4IOA A;  5ELO A;  2RF4 A;  2I0Q A;  1VQH A;  5LMN Q;  2E8G A;  3KOJ A;  2VUM H;  1KL9 A;  2KEN A;  3KF6 B;  5GRO A;  3K80 C;  3ULP A;  3FHW A;  5C0X G;  1MKH A;  2IX0 A;  2Z6K C;  4JV5 Q;  1VQ6 A;  1QVF A;  1HJP A;  2F4V Q;  4JI4 L;  3STB C;  1LTL A;  1X3F A;  2AWO A;  5HGQ A;  3JAM i;  1PH5 A;  1IBL L;  5JEA J;  4KHP L;  2LXJ A;  2HHH Q;  4A3G G;  3UDI A;  1Q82 C;  2VQE L;  2B63 G;  5GAH C;  5JJI A;  1VQK A;  1OTC A;  2JK8 A;  4BY1 G;  1SFO H;  3KJP A;  4HIK A;  1XMO Q;  2JA6 H;  2NVT H;  1E3P A;  4AIM A;  1Y14 B;  1Z47 A;  1Q7Y C;  1Y1W H;  2IX1 A;  4A3B G;  1B7Y B;  1IBK L;  3AFP A;  5IYC H;  4AQY L;  4LFA Q;  4IPC A;  4A3J H;  3RN2 A;  5LMN W;  3CCQ A;  1K8A C;  2WAQ E;  4DV3 Q;  2CWP A;  2KCT A;  2I5H A;  1VQ5 A;  5M3M H;  3U58 A;  3ER0 A;  4DV5 L;  5EAY A;  1WI5 A;  1PYB A;  2Z6K A;  3KFU A;  2B3G A;  1NE3 A;  3HOZ H;  2JEB I;  1E1O A;  2UXB L;  1YNX A;  3EBE A;  3GTG H;  2EXD A;  1M90 C;  4DV0 L;  1JT8 A;  2K52 A;  4NPS A;  1L1O A;  5FLM H;  5FJ8 H;  4DR5 Q;  1CKN B;  1WFQ A;  1WOC A;  4R4C A;  4LF5 L;  1FGU A;  2Q2H A;  4GKJ Q;  2MQH A;  2B29 A;  2E2I H;  4DV1 L;  3PO2 G;  1OXS C;  4GLV B;  5ELN A;  4HJ8 A;  4C3H H;  3E9I A;  1OXV A;  4LFB L;  1LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...