2VQFQ

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqfQ00
1EQRA 1HZAA 5JEAG 1BBWA 2UXCL 4UP9A 3ULPA 3K7AH 4IJHA 4LFCL 2WB1G 4B3TL 4OWXB 2VQEL 2VY3A 4A76A 4A3MG 1WCMG 1D8LA 1VQ9A 3KJPA 4TVAB 5GADC 1B70B 4DR2L 1QUQB 4AQYQ 3M4PA 1PH4A 2F4VL 1VQMA 5LMNW 4IFDJ 4DV0L 2K14A 1PH1A 3L0OA 1NY4A 1HNZQ 1TWCH 3H0GG 2Q2HA 3I2ZA 1VQ8A 1N8RC 2OTLA 4LF6Q 5JJKA 1WYDA 4A3CG 4HJ8A 1VQ7A 4L5SA 4YWMA 3PF4A 3F1ZA 2I0QA 4IFDG 4LF4L 1N33L 1E7ZA 2RHQB 1VQ5A 1HH2P 2OTJA 3CCEA 1KXLA 1OXXK 2MNAA 1PH5A 3F2BA 3CC7A 3G71A 4LF8Q 5M3FH 4KHZA 2AWOA 3PV0A 1Q82C 4X65L 1PV4A 1C9OA 1YJWA 3F8TA 5FLXc 3G4SA 4ALPA 1JJ2A 4LFCQ 1V9PA 2R93G 4B3TQ 4BY1H 3GTGH 1HZ9A 2KCTA 1UE7A 1K83H 1NE3A 1Q8KA 1AE3A 1EIFA 2UXDL 2YTYA 4DR1L 4WJ4A 2R92H 5HGQA 1Q7YC 3JAMc 4LFAL 2UXBL 1IZ6A 2YU9H 2AWNA 2N3SA 4DV0Q 2CWAA 4PG3A 3ULJA 1IBML 3KDFB 3HOZG 4BY7G 4GKJL 1U5KA 4A3EG 1W3SA 2PQAB 1D7QA 1G51A 2ZTCA 4R4TA 3GTQH 3HOVG 4A3MH 5C4JH 3AEVA 1WCMH 2NN6I 5GROA 2I5HA 2PMZE 4LF4Q 1N33Q 4BA2I 4HIMA 3HOUG 2JQOA 4JOIC 1YIJA 5GAEC 4DAMA 4LF5L 3AFPA 2Z6KC 4NB3A 1E3PA 1IBLL 1Z47A 4X65Q 2OCEA 3NELA 1MKHA 3B6YA 3M85A 4L5RC 4LNQA 2OWOA 4LFBL 4A3CH 1GVPA 1TWFH 3L7ZC 2IX1A 4P71A 1E22A 1QVFA 2KHIA 5ELOA 2UXDQ 3CP0A 4DV3L 2Z0SA 4GN4B 1BBUA 1PYSB 3HOYG 3TS2A 4JBWA 2GN5A 4JI6Q 2A8VA 1OTCA 1XMOL 1IBMQ 4GKJQ 1WFQA 1K0RA 1QZGA 1I94Q 2IY5B 4ME3A 2WAQG 3CCQA 1GKHA 2WB1E 1JB7A 4MNOA 4RG1A 3M4QA 2R93H 2H5XA 2EIFA 1S40A 2BH8A 2JJQA 3J7ZC 4DV1L 4K0KL 4A3LG 1CKOA 3AFQA 1A62A 4JBMA 5C0XI 2CWPA 1S72A 5M3MH 2A19A 2C35B 1GD7A 4DV6L 1X3EA 2HHHL 4LF5Q 1PH8A 1IBLQ 1G291 2DUDA 4OX9Q 2AKWB 1Q86C 1EFWA 3HOZH 4C3HH 3PIOA 4A3EH 2ATWA 4R1JA 3KF8B 4DV5L 4DR5Q 1YHAA 3KYHC 4JI1Q 4XTCS 1VQOA 4LFBQ 3RLNA 4JG2A 3CW2C 1B8AA 1GM5A 2UXCQ 3CXCA 3NBHB 2LXJA 2KCMA 4DV3Q 4JI8Q 5FJ8H 3OYYA 3GTOH 5GAHC 3M3YH 3Q8DA 5BR8L 3FHWA 1K9MC 4DUYQ 2IX0A 4HJ5A 3F2CA 1XMOQ 4A3BH 3CPWA 4C2MH 3W5OA 5C3EG 3BU2A 5C4XG 3U4ZA 3I55A 2ZTDA 3E9IA 1HZBA 1UE5A 2NZOA 2ASBA 3T1HQ 3HKSA 1G6PA 1C0AA 4DR4L 3J7A5 3K0XA 1P16A 3WWVA 2RHSB 1KC8C 4A3KG 1JE5A 1Y14B 4X64Q 1CKNB 4DV6Q 2R7DA 3ULLA 3HOYH 2NZHA 4JI2Q 2UUBL 3OTOL 2VW9A 2HIXA 1HJPA 4A93G 1JT8A 4DK6C 4GKKL 1MJCA 4A3JG 3HFZB 2VL6A 4DV2L 4DV5Q 3A74A 3H3VH 1N36L 3EBEA 4HIKA 5E7NA 4HIDA 2E5LL 4A3LH 4BBRG 4P74A 5BR8Q 4JBJA 4MTNA 1XNQQ 3CAMA 2YTVA 4A3GG 1N32L 3K81C 2CKZB 2VNUD 5IP7G 1VQCA 1KQSA 1Q1BA 3S24A 3PO3G 4YCUA 4OWWB 2JA5G 2YV5A 3KF6B 3CCSA 2VZAA 2I5MX 2IHFA 2ZM6L 1Y1WH 4QQBX 1CSPA 5AJ3L 3PF5A 2RCNA 4POFA 3GTJH 4DR3L 2F52A 3BJUA 3U4VA 3CF5A 5IY0A 3MXNB 4GNXB 3PUVA 4P75A 4L5QA 2ZJPA 3S15H 2Q2UA 2WAQE 2UUBQ 3OTOQ 1AE2A 2VUMG 2B3GA 5C3EH 4O0AA 1SMXA 1U0LA 2ID0A 4JI5Q 1E1TA 3S1MH 3G48A 2JA8G 2OQKA 4IJLA 2V1CC 4IO9A 1N36Q 4HJ9A 4GOPB 2FXQA 1TWGH 3FP9A 4A3FG 1EIYB 2E5LQ 2AMCB 5C44G 3RLFA 2VQEQ 2VQFL 1L1OB 3A5ZB 2R7FA 2QEXA 4A75A 4A3KH 3CC2A 3CCRA 5M5YH 4DR2Q 1A8VA 1IXRA 1SROA 4LWCA 5IYDG 1Q81C 3NENA 3GTKH 1VQAA 4R4QA 4DPGA 3HOWG 4A3JH 1J5EL 2F4VQ 2RF4A 3HKZG 1AH9A 4BXXG 2MFIA 2ZM6Q 2GVBA 3FKIH 1SFOH 3S1RH 1WI5A 2NVYH 3D0FA 5AJ3Q 4DR3Q 3I4NG 1PH9A 4K0KQ 5LMNL 4BBRH 5GQOA 1PYBA 1CKMA 3RNUA 4J15A 1MJEA 4DV4L 2LSSA 1Q46A 1OXSC 4LUOA 2Q2IA 4PZ7A 2JA5H 1K73C 3E9HA 5LMUL 1BVSA 5M5WH 4YCVA 3FKIG 1RIPA 4C3JH 1S3OA 4QY7A 4QIWE 4JBKA 5C0XG 3H0GH 5DLQE 3PUXA 2E8GA 2MQHA 3UDFA 4GLXA 3A0JA 1KL9A 5FLMG 2VQFQ 1Y1VG 1VQDA 2XGTA 1XPOA 4JV5L 4IFDI 3LGJA 4PMWA 1PA6A 3VDYA 1TWHH 3CQZH 2K5HA 4BBSG 4DR1Q 3CCJA 1YJNA 1W2BA 4LFAQ 2UXBQ 4P72A 2E2HH 1K3RA 1VQHA 1UE6A 1Q12A 1QVGA 2QA4A 4NXML 3L2PA 3S2DH 2QGQA 1X65A 1FGUA 4YCWA 3CPFA 5C44H 4GNXC 3CC4A 4FDBA 4JI4L 3S1QH 1VQ4A 3PSIA 1PH6A 1X3GA 1VQIA 4DKAC 3TS0A 1VQGA 4DV4Q 1JJGA 2ZJRA 4P73A 1YITA 4O2DA 4R4OA 4DR7L 1KHIA 1JJCB 4YWLA 4GN5A 4PZ6A 4GOPC 1N34L 4BY7H 4A3DG 1HR0L 1VQ6A 3UE1A 3PUZA 1B7YB 2KENA 2E2JH 1JMCA 4DV7L 3I4NH 1I3QH 2UUCL 1UEBA 1M90C 1L1OC 2PNHA 2I5LX 4A3IG 3CD6A 3HOVH 4JV5Q 1H95A 4JOIA 1VQLA 3U50C 4B3RL 1LYLA 1YHBA 2CFMA 5IP9G 1SE8A 3HOUH 3AYHB 4JI7L 3S14H 4UPAA 3KFUA 4YY3L 2D0PA 4AYBG 4NXMQ 1I50H 2JEAI 4DUZL 2D0OA 4HIOA 5IYBG 2Y0SG 4YWKA 1YI2A 1XJVA 3PUYA 1VQEA 3OW2A 4JI4Q 4QJFA 1QUQA 3T1YL 3H15A 4IOCA 1K8AC 1XNRL 2LXKA 3W1GA 3UDXA 4AIMA 1OXUA 4X62L 2JEBI 4DV1Q 4JYAL 2HIVA 3K7UC 3CCMA 2UU9L 4BBSH 3UDGA 2K5VA 2HT1A 3HKZE 3S1NH 1IBKL 1IYJB 4DR7Q 1Q1EA 3M9BA 2HHHQ 4OO1I 3I4OA 1NMGA 1N34Q 1NMFA 3UE0A 1HR0Q 2NVXH 5GAGC 1X9NA 2BA1A 3IRBA 3H3VI 4DV7Q 2UUCQ 2ZJQA 1V1QA 3PCOB 1OXTA 4AQYL 2B29A 1OXVA 1LM0A 3ZJYC 1LTLA 1A63A 1VS0A 2E2IH 4B3ML 1HNZL 1P8LA 4UP7A 4YY3Q 3MEFA 2AHOB 2DGYA 2KHJA 4LF6L 3GD7A 4BY1G 2N8NA 4B3SL 2IT1A 1MIUA 1PH3A 4X6AH 1X3FA 4C3IH 3ERSX 3T1YQ 4EQ5A 4LF7L 1XNRQ 4LF9L 2R92G 1Z9FA 5EAYA 1NTGA 3UDIA 4DR4Q 4JYAQ 2N78A 5IP9H 4JCVE 1XMQL 3KDFA 3KOJA 4MZ9A 4NPSA 1IBKQ 1WJJA 1ASYA 1QVCA 2JK8A 2PQAA 5ELNA 3NEMA 1KRSA 1DGSA 1E1OA 4IOAA 1XPUA 1YZ6A 4IPHA 1L0WA 4GKKQ 5IYBH 5C4XH 4L5TA 4DV2Q 1EQQA 3CMEA 5IWAL 1E24A 2NN6G 3STBD 1C7YA 2ZTEA 4R4IA 4Y52H 2PI2A 4OXPA 1VQFA 1VCIA 3A5UA 1KIXA 1HZCA 2K52A 3J81i 3RZDH 1YJ9A 4B3MQ 1N32Q 2CCZA 2XTIA 4JC0A 4NXNL 5K36G 1TXYA 3K8AA 3S17H 4A93H 3G6EA 1RL2A 4B3SQ 3TRZA 4GLVB 4YHHL 3JAMi 5H1SE 1TWAH 3HOXG 4LF7Q 2NVQH 4LF9Q 1HNXL 3E0EA 1I5FA 1XMQQ 1KD1C 1T9HA 4H02A 1KAWA 1X6OA 4A3GH 4AYBE 4RMFA 1CSQA 1XPRA 1EWIA 3J81c 5C0XJ 2K75A 1UE1A 2Y0SE 5IP7H 3PO3H 5JJLA 3SGIA 2YTXA 4LUVA 2MO0A 5IWAQ 4HJAA 4KI0A 4LW1A 5M3MG 2ES2A 1K8GA 3KLWA 3PO2G 4IPDA 3EN2A 4GN3B 1SR3A 1VQPA 4JI6L 4QL5A 2B63G 4JI0L 2R7ZG 2BA0A 3DM3A 1I94L 4NXNQ 4UP8A 1EUJA 1EOVA 1O7IA 3PIPA 1I6HH 4WJ3M 3CCVA 1VQNA 2JA6G 1VQBA 1J6QA 2VUMH 3TEHB 3S16H 2ALYB 4LUZA 5IT9c 1SLJA 4YHHQ 1J5EQ 3CCLA 3PUWA 2JA8H 2R6GA 1BKBA 5FJ8G 1A0IA 4XIGS 4JI3L 4Y7NH 2K5NA 3AQQA 2HQLA 1PHJA 1HNXQ 1HR0W 3ICEA 3D31A 2MO1A 4A3FH 3BZKA 1FVIA 4KLKA 4A4IA 3RLOA 5LMNQ 3S2HH 4A3BG 4OX9L 5IYCG 3GTLH 2F3IA 2N49A 5HY6A 4DAYB 1FL0A 4KHPL 5JJIA 4DR5L 1CUKA 4JI1L 1UWVA 1R9TH 5IYDH 4POGA 2A1AA 1X56A 2YYZA 1XTDA 4APVA 3GTMH 5LMUQ 3HOWH 2K50A 3I4MG 1X54A 1KRTA 4BXXH 3HOXH 3TREA 3GDEA 4JI8L 1CKNA 3TQYA 1PH2A 2JA9A 4DUYL 4DK3C 4DR6L 1IL2A 3J80i 3W1BA 4DNIA 4OO1G 1PH7A 4JI0Q 3ER0A 1PVOA 4OONA 1FJGL 1SN8A 3CCUA 1X55A 2K4KA 2Z6KA 4HJ7A 1EYGA 4UY8C 2JA7G 3DLLA 4GLAC 3STBC 1YHQA 3CMAA 2BH2A 3T1HL 3EIVA 2EQSA 1HNWL 1WOCA 3M7NA 1GO3E 3RR5A 2Q2TA 4JI3Q 2L15A 2WFWA 4X64L 2OQ0A 4R4CA 5J3BA 3PO2H 4AH6A 1YNXA 1QZHA 3J81j 3K80C 4X66L 1Y1VH 5FLMH 4JI2L 2B63H 3KF6A 2R7ZH 3J80c 5IE8A 4KHPQ 2UUAL 1M1KC 2WP8J 1Y1WG 2JA6H 3I56A 1N9WA 3BZCA 1V43A 2EXDA 2PI2E 1PFSA 4GNXA 1NJIC 1XNQL 3RZOH 4DR6Q 1ASZA 1YBYA 2VS1A 3GO5A 1YEZA 1YVCA 1SRUA 4EX5A 4BA1I 1FJGQ 5IYCH 4B3RQ 3I7FA 2GVAA 4TQUS 3PGZA 4GOPA 5M3FG 4IPCA 3RN2A 4JI7Q 3JC66 1NBWA 4GS3A 3KJOA 1HNWQ 2CQOA 1VQJA 4IPGA 4OWTB 3I4MH 1L1OA 3RN5A 2D62A 3F2DA 4DUZQ 4A3DH 2IHEA 3GTPH 2KBNA 5JEAJ 3M4OH 4X66Q 4A3IH 2NVTH 4QGUA 4PZ8A 2JE6I 4X62Q 2UUAQ 2UU9Q 4JI5L 1VQKA 4LF8L 2JA7H 5M5XH 1LUZA 3U58A 1L2FA
chains in the Genus database with same CATH superfamily
1SSOA 4KD3A 1TWCB 2VY3A 1DXMA 5C4ZA 1VF7A 1WCMG 3KJPA 1B70B 3I4LA 4AQYQ 3M4PA 1F9RA 2ZT9C 1WTVA 2F4VL 1VQMA 3OOCA 2KEEA 3J80E 2K14A 4C3JG 3L0OA 1WYDA 4A3CG 1KABA 4HJ8A 3GV3A 3SK4A 1G8ZD 4G57A 1K83B 4LF4L 3CCEA 1KXLA 2MNAA 1PH5A 2R92B 3VA5A 1D1KA 1EYAA 4KHZA 3LX0A 2AWOA 2FHTA 3BYTB 4K14A 1YJWA 1G2SA 3G4SA 2R93G 1HZ9A 2KCTA 2MP1A 4R8NA 1EIFA 1GHJA 1V1PA 4KTAA 2P5ZX 1SNPA 2VB2X 3D8GA 4PG3A 3KDFB 4GKJL 3J80L 5JEAH 5IOCA 1CFMA 4ZLTF 3AEVA 4JVZA 1SE2A 1HQRD 2NN6I 4FF4A 4MTKA 4LF4Q 4JOIC 5GAEC 1FD7D 3PIP3 4NB3A 1TU2B 2OCEA 3NELA 5NUCA 5K36H 1IYVA 4V190 1LTGD 1TWFH 2IX1A 1QVFA 2KHIA 4RHRA 3IL8A 3R2TA 3CHBD 4DV3L 1LTID 4H13C 1WD0A 3MTSA 4GN4B 2BE5D 1F77A 4K6LA 5DM63 1OTCA 1STYA 4GKJQ 1QZGA 4XT3B 3CCQA 4JK1C 4MNOA 5E1FA 4RGOS 2H5XA 1S40A 5FLXL 2BH8A 4R9WA 1Q3LA 5C0XI 1S72A 2A19A 1GD7A 1H9JA 2ICIA 4EVOA 1B3QA 4R1JA 5ELEA 2H4OA 4DR5Q 4XTCS 1CHQD 4R8IA 4KV6A 3NBHB 1PXUA 4DV3Q 3EROA 5FJ8H 3OYYA 3M3YH 5GAHC 4CKEA 4DUYQ 2IX0A 2EVBA 2ZXPA 3HOYB 2K28A 3CPWA 1UUPA 5JPNC 5C3EG 4G7OC 4CJ0B 2NBFA 3BU2A 1QNKA 2WAQB 2ZTDA 4RH6A 3A55A 2KJXA 1CQFA 1C0AA 4DK1A 5ISRA 1Y14B 1ML0D 2UUBL 3OTOL 2HIXA 1JT8A 1LT3D 4A3JG 1HFNA 3URYA 4HMIA 4HIKA 4A3LH 1ESRA 4J1MA 4IN3A 2YTVA 4NKLA 2CKZB 2PYKA 3NTKA 1KQSA 3S24A 4YCUA 4OWWB 4KHVA 4RA8A 3ZYYX 1LTAD 1PLFA 1F2LA 4IUTA 3S1MB 4QQBX 5AJ3L 1CA6A 5IY0A 4GNXB 4L5QA 1EY4A 4DXGA 2Q2UA 2UUBQ 3OTOQ 1M8AA 1DJRD 2B2YC 4O0AA 1A2UA 1SJHD 1R4QB 4IJLA 2V1CC 3HZXA 1JICA 1B3AA 4BS9A 1IKLA 3FVQA 3S1RB 2VQEQ 2R61A 2R7FA 4A3KH 3GTQB 2L12A 3K57A 5IYDG 3NENA 1VQAA 5IODA 5EBDA 1EY7A 1NAPA 3HKZG 3MC0B 2MFIA 2JA5B 3H3VC 2IW3A 1SFOH 1WVLA 1WI5A 2NVYH 4C3JB 5AJ3Q 1O80A 2Z1CA 4BBRH 1PYBA 3RNUA 4QCLA 1EQTA 1MJEA 2LSSA 3OW7A 3QJYA 3KBGA 2F0MA 2QILA 3FDTA 3HRZC 1BVSA 5D65A 1B1ZA 1MSGA 2HD3A 1JOKA 4CDDC 5M5WH 1S3OA 5DLQE 3PUXA 3UDFA 4KJOA 1AP0A 4GLXA 3A0JA 1KL9A 1SEBD 1XPOA 2XGTA 4IFDI 2PZUA 1ONLA 3VDYA 3CQZH 1W2BA 4LFAQ 2UXBQ 5CV8A 3FEWX 1QVGA 2JP1A 5EBCA 1UNSA 2A68D 1CM9A 4EQPA 2BDNA 3P1HA 1B44D 3CPFA 2PCFB 3S1QH 3PSIA 1X3GA 1C48A 1VQIA 1JJGA 3T56B 1BBXC 1STEA 2FFKB 4IUQA 1SJED 3S14B 3W3AA 3ITPA 4A3DG 1HR0L 2E75C 1I50B 1B7YB 2KENA 1I3QH 1UEBA 1M90C 1L1OC 4B3RL 2IWHA 1LYLA 2CFMA 1O7YA 2IL8A 2HUGA 3HOUH 4Z9CB 3IFDA 4JI7L 4UPAA 4BBSB 3ONAB 3KFUA 4YY3L 4KY7A 1I4HA 3OWEB 4AYBG 2JEAI 4DUZL 4HIOA 1DOKA 3PUYA 3DWPA 2O4XA 4DV1Q 3UDXA 1E2WA 4X3UA 1CA5A 4GZYC 1IBKL 5FO8B 1Q1EA 3OMCA 3F2UA 1NMFA 1I6VC 3I8ZA 1HR0Q 4HN7A 2NVXH 1JCKB 3M4YA 3VYSA 3IRBA 1GUTA 1LACA 3L3OC 5ELBA 4ZAIA 1V1QA 5G3LF 2B29A 3N6RA 4DAVA 3N52A 1A63A 3PQIA 4YY3Q 3MEFA 2AHOB 4BY1G 2IT1A 4C3IH 1DYQA 1HHVA 2F0GA 2N78A 5IP9H 3K6OA 2F0LA 3KDFA 4NPSA 1IBKQ 2A68C 4QIWB 1YNND 2JK8A 2DNCA 5ELNA 3NEMA 1YZ6A 3V05A 4CDFC 4QUFA 2B39A 4L5TA 2J7ZA 2WKCA 2DNEA 2NN6G 4R4IA 4Y52H 1TY2A 2X6GA 3KK7A 3KLSX 1ZEQX 1HPCA 1VCIA 1VQFA 1HTPA 2LFNA 1KIXA 1HZCA 1STNA 1EZ8A 5KNDA 2XTIA 1QJOA 1S5ED 2F3VA 4GLVB 3JAMi 3HOXG 1NNXA 5JPMC 2NVQH 1S5CD 3R93A 2XNAC 4KY5A 1SXTA 4FF3A 2K75A 3Q23A 2Y0SE 3NXWA 5IP7H 5KRUA 3D4WA 1WTRA 2MO0A 2NTSA 4HJAA 3PO2G 3EN2A 1L0XB 2R7ZG 3DM3A 1Y8PB 3GTLB 5EKIA 1I6HH 2E74C 2KHSA 1WTWA 1J6QA 2D9UA 2JA6G 3NBHA 3S16H 4LUZA 3SEBA 1SLJA 2JA8H 1PHJA 1A0IA 2FJ2A 3AQQA 1LABA 1HR0W 3MAQA 4A4IA 3S2HH 5LMNQ 3RLOA 2G9DA 2PO4A 2EYOA 5IYCG 5JJIA 3QIAA 5C6AA 3K5NA 4DA2A 2EYLA 4JI1L 1UWVA 1R9TH 4C1NI 3WOFA 3I4MG 3TREA 3GDEA 1STHA 1YNNC 2JA9A 5CYUA 1TQOA 5EJWA 5BN3A 3J7AF 4OO1G 1PVOA 1K0SA 4OONA 1FJGL 1SN8A 2B63B 3CCUA 2K4KA 2SNMA 2JA7G 3CKIB 4GLAC 3VR4A 1YHQA 1F2YA 2OF1A 1HNWL 5EKKA 1XXGA 1GO3E 4H7BA 4DF7A 1EQVA 3I3CA 2OQ0A 4R4CA 3E3XA 1QZHA 1E0BA 3JAME 4XQJA 1Y1VH 5IE8A 5I6WA 1GUOA 1Y1WG 1B2TA 4F8MA 4KMUC 2F0NA 5COYA 4J8QA 4GNXA 4HSVA 4JPBW 1OO9B 5BN5A 1XNQL 4A3DB 1ASZA 1GJXA 1TR5A 5E3FA 1K8MA 1FJGQ 4IZ8A 1FNUA 2GA4B 5M3FG 1HNWQ 2EJGC 1VQJA 4OWTB 2VB3X 1Y8OB 2IHEA 2F0SA 1B53A 1BDOA 1FNWA 4AYBB 2FINB 2XSCA 4FP5D 4HR7B 1MSHA 2L4NA 1RTNA 4LF8L 3NP8A 3SR1A 3MXUA 3T4AC 3ULPA 3IKJA 2QW7A 4LFCL 5LL6X 2WB1G 2L11A 4A3MG 1D8LA 3U9SA 4DR2L 4H44C 4RKBA 1PH4A 1HFGA 3A7LA 1GHKA 2D5DA 4ABNA 5LMNW 1PH1A 1NY4A 1NSNS 3H0GG 1VQ8A 4LF6Q 3D4RA 2E76C 3TP7A 1VQ7A 4BY1B 4YWMA 4IFDG 2G9HD 3M7GA 1SYEA 1VQ5A 3V2TA 1OXXK 3F2BA 1R4PB 1X3QA 3G71A 4LF8Q 1PV4A 3F8TA 1JJ2A 1VMPA 4LFCQ 3DEPA 3P20A 1Q8KA 5C4JB 4DR1L 2Q8RE 3JAMc 1Y8NB 4Y7NB 1IZ6A 2YU9H 2AWNA 2N3SA 3MFGA 3SHLA 4RGTA 1U4PA 3HOZG 4BY7G 1O7LA 2NB0A 1S5FD 4L6TB 2PQAB 1D7QA 1G51A 2ZTCA 4CBVA 3GTQH 1WCMH 1JOOA 1Q8IA 2Z4HA 4BA2I 3HOXB 1YIJA 3BDOA 4LF5L 1IBLL 3LWEA 1U4LA 4LK1C 2PZWA 1EIHA 1EEFD 4A3CH 2L0CA 3OIQA 5ELOA 3CP0A 1C4QA 3E0JA 5HGTA 1KDBA 1F2ZA 1PZJD 3HOYG 4JBWA 2GN5A 1SE3A 4JI6Q 3PO2B 1WFQA 2FMCA 2A6EC 2WAQG 1GKHA 4RG1A 2R7ZB 4C3HB 2R93H 4NMZA 1BR9A 1TT2A 4ID6A 4UDUC 1LTBD 3J7ZC 4K0KL 2JA6B 2XRSD 1PRTB 4Q0FA 5KEEA 1E2VA 5M3MH 2ENBA 2C35B 4DV6L 4LF5Q 4RCNA 1IBLQ 1G291 2V4DA 2AKWB 1Q86C 3DWAA 3GQBA 2CH4W 4C2MB 3KF8B 1CI3M 1VQOA 1FNVA 1H9SB 1YHAA 3KYHC 4I7ZC 4JG2A 3CW2C 2UXCQ 2XWBB 1KDCA 2LXJA 2PW7A 4JI8Q 5BR8L 1K9MC 2CQAA 4H0LC 3F2CA 4A3BH 1QOHA 1SNQA 1ZYRC 2NVTB 1HZBA 2ASBA 2H1EA 3T1HQ 3EFXD 3K0XA 3J7A5 5JVG3 1WTQA 1E2ZA 1GXDC 3RD4A 1KC8C 4X64Q 5ELDA 4DV6Q 1LTRD 2F03A 1W6JA 4JI2Q 1H9MA 1HJPA 1MJCA 4B9WA 3HFZB 2VL6A 5LHY1 3ND8A 3H3VH 2A69C 4P2CB 1N36L 2K7VA 5DM73 1Y1WB 4HIDA 1PZKD 2TSSA 2EYHA 2ZXRA 4JBJA 2MUYA 4MTNA 5BR8Q 3GTJB 4A3GG 4QUCA 2VNUD 3PO3G 3K5OA 2JA5G 2YV5A 3KF6B 5I9OA 4V0BA 2PW5A 2PMZB 2XWJB 3TDQA 5M3FB 3PF5A 1I4RA 5I6YA 1AZQA 3MXNB 4P75A 4DNRB 3S15H 2VUMG 2B3GA 5C3EH 1U0LA 4XYOA 4JI5Q 3SDZA 3GTKB 3G48A 2OQKA 1J9OA 1N36Q 4HJ9A 3A54A 3A8JE 2F0TA 4FXDA 2A74C 1SYDA 1EIYB 3BVGA 2QEXA 2WB1B 3CCRA 4G4KA 4FO2A 1JE4A 1I4QA 5M5YH 2AQ3B 4A3MB 1SROA 4R4QA 4DPGA 3HOWG 4A3JH 2F4VQ 1AH9A 4BXXG 3FKIH 3Q6SA 3D0FA 3NUCA 3H0GB 4ILWA 3A8IE 4J15A 3U9OA 4IURA 4HCEA 5FO7B 1TWHB 4LUOA 2Q2IA 3H94A 2NWGA 1K73C 1HA5A 2E2HB 2XIWA 4QY7A 4QIWE 3NTHA 1IW7C 2MQHA 3S2DB 2F0FA 1JC7A 1FGBD 3LGJA 1PA6A 1WTXA 1TVXA 4BBSG 3T16A 1VQHA 2QA4A 3HOZB 4BY7B 2QGQA 3CC4A 1JR0D 4GNXC 4JI4L 2E2JB 1V1OA 2M2LA 4QMGA 3I4NB 1PTOB 3TS0A 1VQGA 4ZYSA 2PPBC 1HRJA 2ZJRA 2CW0C 1LO5D 4P73A 5J22A 4O2DA 3GTOB 2JN4A 2VXWA 1AEXA 1O7ZA 4WRDA 4PZ6A 4ZRZA 1G2TA 3BG3A 4DV7L 4A3IG 2B8FA 3HOVH 1VQLA 3U50C 1TIID 3VR2A 3MWYW 1SE8A 3AYHB 5EKLA 1SNOA 4CHTB 1QILA 3DHQA 2D0PA 4WJWA 4YWKA 3T51B 1BCPB 1Z6HA 4JI4Q 4QJFA 3QR8A 2LXKA 4FXGC 1PRTF 2F0UA 1W6KA 2HIVA 2UU9L 3QB3A 3X3NA 2K5VA 3MXGA 3SE0A 3HKZE 3UDGA 2HT1A 3S1NH 1ILPA 4OO1I 3MA2B 2SOBA 5JVH3 1CT1D 3UE0A 5IT9E 4ZK9B 2BA1A 5I9PA 4DV7Q 2ZJQA 3NK9A 1XYIA 1OXTA 4IUNA 4B3ML 1HNZL 2PQEA 1P8LA 3OSOA 4UP7A 2KHJA 2KOLA 3HEJA 2RBMA 4X6AH 1PH3A 1II3A 4LF7L 1EYDA 1HXYD 5EAYA 5C5LA 1NTGA 2DJGC 2LMCB 4JCVE 3EA6A 1EZ6A 3AU7A 4WORA 1IHZA 1WJJA 1ASYA 2PQAA 3VR5A 3X3MA 1E1OA 3S17B 4IPHA 5C4XH 1EU3A 3CMEA 1E24A 1TWAB 4B3MQ 3I70A 3RZDH 1YJ9A 5K36G 4A3GB 2K01A 4A93H 2OT2A 1RL2A 1DOLA 3PO3B 4LF7Q 3HG9A 4XYQA 2OXPA 3EQLC 1I5FA 5TSSA 1KAWA 4AYBE 2C5CA 3GV6A 4RMFA 1XPRA 3TZDA 1EWIA 3SK6A 5C0XJ 2WACA 1C8CA 3MFYA 5C3WA 5KGUA 2VUMB 1YNJC 1B9MA 2ES2A 3GTGB 4RGMA 2EZVA 3EVQA 1IKMA 1SR3A 2L9HA 4QL5A 2B63G 4JI0L 1I94L 2RKSA 3NBIA 2SDFA 1EOVA 1O7IA 3CCVA 2F3WA 1VQNA 5IT9c 4PMCA 3CCLA 3PUWA 2R6GA 5FJ8G 4Y7NH 3HOWB 1SNMA 2NN6H 2MO1A 4A3FH 1H9RA 2Z4IA 4OX9L 2F3IA 2N49A 3Q22A 4KY6A 1ET6A 2YYZA 5J1ZA 3GTMH 2Q8IB 1KRTA 3HOXH 4IQZA 4RGNA 3TQYA 5C4HA 4DR6L 4ULLA 1IL2A 4DK0A 4JI0Q 2AQ1B 3C1EA 1EYGA 3DUZA 4K6DA 5FK9C 3CMAA 3EIVA 5JOBA 2L55A 3I90A 5C0XH 3PO2H 1ZKOA 4AH6A 1G91A 3RZOB 5FLMH 1SYGA 1PTOF 3KF6A 2R7ZH 2UUAL 1M1KC 2B8GA 2BDOA 2JA6H 1QCBD 3I56A 1N9WA 2E2IB 2F0IA 3UI2A 3MXNA 1HUNA 2RCFA 4DR6Q 3GTPB 3GO5A 4EX5A 1SRUA 4BA1I 1SMYD 5IYCH 3M4OB 4B3RQ 4A3IB 4U68A 3RN2A 4JI7Q 3JC66 1NBWA 2K32A 3I4MH 3RN5A 3F2DA 2DJFC 4DUZQ 1L0YB 4CDCC 1BCPF 5AFWA 4PNYA 4PQXA 2JXMB 2NVTH 4QGUA 4CGYB 2JE6I 1U9RA 3NHHA 1LT6D 2UUAQ 3AB9A 2JA7H 5M5XH 1F9PA 1J8IA 3U58A 1L2FA 3MVVA 1BBWA 3K7AH 4OWXB 4A76A 3AMUA 1DD2A 5E4WC 1EU4A 4J6HA 4TVAB 2EYMA 4OIKA 4KJNA 1RD9D 3EJIA 4IFDJ 1TS2A 4DV0L 4K5VA 4L8JA 1JB3A 1TWCH 2Q2HA 3I2ZA 2SNSA 2OTLA 5JJKA 4F87A 5EPJA 4L5SA 1WTPA 3PF4A 3F1ZA 2CVRA 1UEAB 3TSSA 2QF7A 2RHQB 1LT5D 1HH2P 3WDNA 5M3FH 2Z8LA 3VR6A 4BWGB 1V9PA 5FKAC 4DU9A 2DY8A 3I91A 1UE7A 1K83H 1NR4A 1AE3A 3V96A 2UXDL 2YTYA 2R92H 3Q0AA 1DOMA 4FVMA 4FXKC 4DV0Q 2CWAA 4N9TA 4C3HG 4A3EG 2EE1A 1W3SA 4IUVA 2F0PA 5FOBB 4M8AA 4R4TA 1SMYC 4DXFA 4A3MH 1BOSA 2PMZE 5CV5A 4O42A 3HOUG 2JQOA 1JORA 3OHXC 3AFPA 1CHPD 3SK5A 2KECA 5HURA 1MKHA 1QE6A 4L5RC 2OWOA 2EJFC 4LFBL 1GVPA 3L7ZC 4LMQD 4IFDH 2UXDQ 2KUMA 1I4GA 1BBUA 3BYYB 3G7LA 2A8VA 1XMOL 1HA6A 4HTHA 2F0HA 4ME3A 2WB1E 2NYZD 5CBEE 3M4QA 4HEDA 2JJQA 2F0EA 1BXTA 3AFQA 3QOJA 1MGSA 1SAPA 4G7HC 1DONA 5T1IA 3M3YB 5DEHA 3K5LA 2HHHL 1DM0B 1V1PB 1ICWA 2LY7A 2DUDA 3HOZH 1EFWA 3VA7A 3A8KE 4JI1Q 4LFBQ 2WKDA 1GM5A 3CXCA 3J7AV 2KCMA 4CJ1B 3GTOH 1D1IA 5IGCA 1QWYA 3KBXA 3BVZA 3PIO3 1MD2D 2L1BA 1KLGD 4X3SA 1XMOQ 1K8OA 1JWSD 2NUCA 4KKSA 2PZTA 2EYFA 3U4ZA 1RCVD 1UE5A 2NZOA 4CKCA 1A3VA 4DR4L 3VYUA 1P16A 2RHSB 1HQMC 1CKNB 1ENFA 2R7DA 3ULLA 3HOYH 2B2TA 2VW9A 1VF5C 4DK6C 3JAML 4GKKL 5A2QE 4DV2L 3A74A 3GP7A 2KEDA 3EBEA 4DN4M 2E5LL 3FRPB 4P74A 1TKWB 2A6ED 1XNQQ 1AN8A 1N32L 3MZ5A 3K81C 1TS5A 5L37A 4YIJA 5IP7G 1VQCA 1Q1BA 2VZAA 3W2DA 2I5MX 2IHFA 3C3LA 3K58A 2K04A 1V8QA 1CSPA 4DGZA 1PRTC 1K3BC 4DR3L 1PFNA 3U4VA 4A3KB 2WAQE 2IJ0A 1MI2A 2NZ1D 5IGEA 2ID0A 1E1TA 3S1MH 2PNRC 2JA8G 4S3SA 5A2QL 2G5DA 4GOPB 2JSOA 3C46A 2FXQA 1XTCD 2E5LQ 2AMCB 5C44G 1SFOB 3RLFA 2O5IC 2NVYB 1ZYRD 2N88A 4BBRB 1T5XD 1IL8A 4X3KA 4DR2Q 1A8VA 1IXRA 4LWCA 5CGKA 2O5JC 1STBA 4IUPA 1J5EL 2B2VA 4F88A 2GVBA 5M5WB 3S1RH 2E2DC 2X6LA 4DR3Q 3I4NG 1PH9A 5I4DA 1KAAA 2RQXA 4N9PA 2RDHA 4DV4L 1FYCA 3MXPA 4K8IA 3CQZB 2A69D 1EFID 2JA5H 5LMUL 3CRLC 4C3JH 5A35A 1F9SA 2E8GA 1Y1VG 1VQDA 3WOEA 1HCZA 5EPKA 1PDQA 2EPBA 3CCJA 4DR1Q 4O1NA 4IUUA 4P72A 3PMFA 2BOSA 2RDGA 1STAA 3D4DA 4HAEA 4NXML 2EYJA 2QEJC 3KLRA 1X65A 1FGUA 4YCWA 4C56C 4A3EB 4K2KA 1NCVA 4FDBA 4PMBA 3NWTA 1I3QB 3NQIA 4LAAA 3CU7A 4TRDA 4DV4Q 5D3DA 4OEMB 5G3LD 1YITA 4R4OA 2K5DA 3HOUB 1RJTA 4DR7L 4OIJA 4N8FA 3K59A 3PUZA 4K8JA 1JQYD 2UUCL 1F2MA 1B50A 2PNHA 2I5LX 5IGFA 5KYLA 3A56A 4G7ZC 3S14H 3VYRA 1SYCA 2MGSA 4NXMQ 1I50H 5F2DA 5IYBG 1XJVA 2NVXB 1VQEA 3IFTA 4IOCA 1XNRL 3W1GA 4K0KQ 1OXUA 4X62L 3DMUA 4JYAL 3CCMA 4BBSH 1IYJB 1JWMD 3BVMA 4DR7Q 1IW7D 4RAUC 1TS3A 1NMGA 1PZID 1X9NA 2UUCQ 2F4IA 2EY5A 3PCOB 4C3IB 3TBIB 4AQYL 1LM0A 5T1GA 4RWSC 1VS0A 2E2IH 3P75A 3DWQA 5E4XA 2DGYA 1CK1A 2N8NA 1MHWC 1LV9A 4B3SL 4UAIA 1MIUA 1X3FA 2DN8A 3BZDB 2CW0D 1XNRQ 4LF9L 1Z9FA 3OIPA 3UDIA 4JYAQ 2F0KA 1TWGB 1XMQL 3KOJA 1VMCA 1BF4A 3QO2A 4MZ9A 5I2XA 1QVCA 2A6HC 1QG7A 4U673 1KRSA 1DGSA 5CV9A 1XWEA 3C1FA 2RSOA 3D6CA 1EQQA 5IWAL 3STBD 2ZTEA 4QB4A 2NVQB 2PI2A 4OXPA 2ZXOA 2MHVA 2K52A 2CCZA 1TS4A 4JC0A 1TXYA 2F0QA 3C2PA 2RSNA 4JW0A 3G6EA 3OMGA 4B3SQ 1Q90A 2HDLA 3NWSA 1BCPC 3FMCA 4YHHL 5H1SE 4LF9Q 2D2CC 1D5MC 3E0EA 1XMQQ 1B9NA 1KD1C 3J81c 1X3PA 1SNDA 5JJLA 1S5DD 1I6HB 2K05A 4LUVA 5IWAQ 3S16B 1XX8A 2IPKD 4KI0A 4LW1A 2EDGA 2JA8B 5M3MG 1K8GA 1SBBB 3KLWA 3TMEA 4GN3B 1VQPA 3S9WA 2J0TD 2I46A 3S2HB 5C44B 3O13A 3FPPA 2F1MA 1EUJA 5FLXE 1WTOA 1NUCA 3E5SA 1VQBA 4ZQ3A 5KYIA 2ALYB 3SK8A 1R9TB 4YHHQ 1BKBA 4JI3L 1SE4A 2HQLA 3ICEA 3D31A 4A3BG 3GTLH 5HY6A 4DAYB 1FL0A 2BCOA 4KHPL 1A3UA 1EWHA 4DR5L 4HMJA 5IYDH 4POGA 1EL0A 3D3RA 1X56A 1XTDA 2K50A 1SDFA 2KA7A 2KVMA 1CKNA 1UAPA 1PH2A 4DUYL 2I07B 3LWUA 3W1BA 4DNIA 3BDCA 1PH7A 5CC4A 3HP3A 1Y1VB 2C9OA 1X55A 4K5XA 3DLLA 1SYBA 2B2TC 3STBC 4ZUJA 4K2LA 5D3IB 4Q5VA 2EQSA 1RDPD 3M7NA 1A3TA 2Q2TA 4JI3Q 4XDXA 3RMHA 4KK7A 1YNXA 1M4VA 2LKVA 3J81j 4X66L 2B63H 3J80c 4KHPQ 1RODA 2B2WA 1YNJD 3DXJC 3QG1A 3H6MA 2F0OA 5ELFA 5CR3A 3TP5A 1V43A 5LL6S 2EXDA 2PI2E 1PFSA 2OEOA 1NJIC 4N8X1 4ZUIA 1QB5D 3NSWA 2VS1A 2X69A 1YVCA 5ELCA 4RHSA 3I7FA 1EYCA 3R2IA 3G6JB 2GVAA 3PGZA 4GOPA 3KJOA 4GS3A 1PMRA 2CQOA 4IPGA 2D62A 3MEHA 3VYTA 4A3DH 1EY6A 3CRKC 4X66Q 4RCOA 3BDLA 3L9AX 2UU9Q 3SXHA 2EJMA 3NQTA 5CV4A 5FLXc 3FKIG 5IGDA 5EPLA 1EQRA 1HZAA 5JEAG 1Z7TA 2K03A 4UP9A 1GUSA 4IJHA 3ND9A 2B2VC 4B3TL 3KUPA 3TP6A 2VQEL 5IT9L 2F0VA 1VQ9A 5DNFA 5GADC 2KCNA 1QUQB 4L63B 5JAVA 1MBYA 4F7XA 5CV6A 4KN4C 1HNZQ 1EWCA 2BE5C 1GUWA 1D2BA 1N8RC 4OELB 2EXZA 4K5WA 4EGVA 2I0QA 4CKBA 1JOQA 1N33L 1E7ZA 2OTJA 3CC7A 3NPPA 2YU9B 1BO0A 3PV0A 1Q82C 4X65L 2QCPX 1C9OA 1WD1A 4ALPA 4NP5A 4LJZC 4B3TQ 4BY1H 1NE3A 1WCMB 1G6ZA 4WJ4A 5HGQA 1Q7YC 4LFAL 2UXBL 4ZKCB 5CBAE 1HUMA 1IBML 3ULJA 1U5KA 3KF8A 1H9SA 2R3ZA 3HOVG 5C4JH 5GROA 2I5HA 4RFBA 1N33Q 4FYDA 4HIMA 5KNCA 4DAMA 1RHPA 2Z6KC 4QF4A 1E3PA 1BQQT 1Z47A 4X65Q 1STGA 3B6YA 1SYFA 3M85A 1S4ZA 4LNQA 3H09A 4P71A 1E22A 2R93B 2XVSA 3A7AB 3R3OA 3T53B 5K5PA 1K28A 2Z0SA 3TS2A 1PYSB 1U4MA 3TZUA 1LT4D 5M3MB 3D6WA 1IBMQ 1I94Q 1K0RA 2IY5B 3ERQA 1JB7A 4PV1C 2EIFA 1H9KA 2HCIA 2B2UC 4ME5A 1SNCA 4I7AA 4DV1L 4MHEA 1PFBA 4A3LG 1CKOA 1A62A 1D5XC 4JBMA 1KNAA 5I2YA 2CWPA 5KIXA 1X3EA 1PH8A 2M9VA 4OX9Q 2Q8TA 1GOZA 4C3HH 3PIOA 4A3EH 4A3BB 2ATWA 4DV5L 5IGGA 2WIIB 2RDFA 3RLNA 2ICEC 1EOTA 1B8AA 1IYUA 2EYPA 3Q8DA 3FHWA 1RKNA 2RVLA 4HJ5A 4C2MH 3W5OA 5FO9B 5C4XG 3I55A 3E9IA 3NTIA 3HKSA 1G6PA 2K6AA 3WWVA 1O78A 4A3KG 1JE5A 2O2LD 2RA4A 2NZHA 3RUZA 4OO1H 4DFAA 4A93G 2HQEA 5D14A 4KN7C 4DV5Q 1RF2D 4UHVA 5J39A 1PYWD 5E7NA 4BBRG 3CAMA 1CQVA 1FR3A 2CH4A 3S15B 3Q24A 3CCSA 5C3EB 4TKOB 2DY7A 2MJ8A 2AUKA 2ZM6L 1Y1WH 2RCNA 4POFA 3GTJH 2F52A 3BJUA 2F0JA 3CF5A 3PUVA 4RKLA 2ZJPA 4I65A 1BUVT 1AE2A 2K5WA 2EOTA 1ESFA 1SMXA 5IGBA 5M5YB 1T5EA 4X3TA 1QNUA 4IO9A 4A3JB 1EY8A 1KDAA 1TWGH 3FP9A 4A3FG 3FKIB 2LS01 5CORA 4DAYA 1VDZA 2VQFL 1L1OB 3A5ZB 2A5HA 4NW2A 4A75A 3CC2A 3KLSA 2L5TA 1LLRD 1Q81C 3GTKH 4FF2A 2K33A 2RF4A 2ZM6Q 1EEID 4B08A 4XT1B 5LMNL 3QWNA 5GQOA 1CKMA 4XQNA 1TWFB 1Q46A 1OXSC 1U4RA 3SVMA 4PZ7A 3E9HA 4YCVA 3DEOA 1RIPA 1I4PA 4JBKA 5C0XG 3H0GH 5EGTA 5FLMG 2VQFQ 2JYOA 2KQ3A 4JV5L 4PMWA 1TWHH 2K5HA 1GUGA 1YJNA 3LNNA 2E2HH 1K3RA 1PRTD 1UE6A 2IX3A 1Q12A 2B2WC 1X32A 3L2PA 3HKZB 4OHJA 3S2DH 4FNFA 5C44H 4HCSA 3HGBA 4E6IA 1VQ4A 4KKUA 1PH6A 4DKAC 3HOVB 5EQ0A 5C3XA 1KHIA 1JJCB 4YWLA 4GN5A 4GOPC 1N34L 4BY7H 1VQ6A 3UE1A 4NDXA 2E2JH 1JMCA 3I4NH 4C3IG 1PTOH 2AUJD 4JV5Q 3CD6A 1H95A 4JOIA 1YHBA 5IP9G 2K5QA 3BS1A 4B9XA 5M9OA 4KKTA 3S1NB 2QDLA 1EY0A 2D0OA 2Y0SG 2Z9HA 1YI2A 4EQOA 3OW2A 1QUQA 2XRQD 3I73A 3H15A 3T1YL 1K8AC 4AIMA 4EQNA 2JEBI 3K7UC 4ZCKA 1A2TA 1ENCA 2EY1A 1KTKA 1ENAA 3M9BA 2HHHQ 2TMPA 4WFN3 3I4OA 3J7YW 1N34Q 1B4OA 3HS0C 5GAGC 1DZ1A 1LTSD 3H3VI 5CV7A 2J4XA 3QOLA 1AFPA 1ICFB 4HSPA 4XQQA 1OXVA 2HDMA 1D5ZC 1LTLA 2EY2A 3ZJYC 1EY5A 1KLUD 1KNEA 4LF6L 3GD7A 3FPUB 3ERSX 1F9QA 1JWUD 3TN2A 4EQ5A 4OL7A 3T1YQ 2R92G 5C4XB 4OGQC 4DR4Q 2M00A 4IALA 3RZDB 3IAYA 5DAUA 4IOAA 1XPUA 1L0WA 2K1BA 4GKKQ 3R8BA 5IYBH 4DV2Q 2HCCA 2N55A 4A93B 3I72A 2SEBD 1C7YA 1GUNA 1I4XA 3A5UA 3J81i 2WV6D 1N32Q 4NXNL 1ET9A 3K8AA 3S17H 5JJZA 3TRZA 1AZPA 4DAPA 1TWAH 4DNTB 1EIGA 1HNXL 2CHBD 4ZKBB 3OPOA 1T9HA 4H02A 1X6OA 2Z6BA 4A3GH 1Y69U 1CSQA 2NTTA 1UE1A 3E6ZX 3PO3H 3SGIA 2YTXA 4ODGA 3T13A 2A73B 4IPDA 1S5BD 4JI6L 2B2YA 4A3FB 2BA0A 2QDBA 4NXNQ 4UP8A 3S1QB 3PIPA 4WJ3M 2AQ2B 3NE5B 2VUMH 1PTOD 4MIUA 3TEHB 1J5EQ 2MPMA 4C1NK 3GTGH 3GTMB 4XIGS 2K5NA 2F0WA 3OWFA 1HNXQ 4M1UB 2A6HD 3BZKA 1FVIA 4KLKA 1NR2A 3K0YA 3VR3A 1D6EC 2WINB 1CZGA 4CJ2C 1A15A 3DM1A 1CUKA 5KNBA 2A1AA 4APVA 3HOWH 2UXCL 5BN4A 5LMUQ 2QKIC 1X54A 4BXXH 4JI8L 5CMDA 4FF1A 4DK3C 3J80i 5C5MA 1ZXTA 1ILQA 3ER0A 1BCPD 2Z6KA 4XXEA 4HJ7A 3MHBA 4UY8C 1HTLD 3J81E 2BH2A 3T1HL 1WOCA 3RR5A 4CDEC 1AW7A 2L15A 2WFWA 1LTTD 1BNZA 4X64L 5J3BA 2F0DA 3K80C 4JI2L 1CZWA 1PFMA 2KCCA 4TSSA 1CTMA 2WP8J 1A6XA 2XN9C 3BZCA 1WTHA 1TY0A 2B2UA 3I4MB 3H91A 3RZOH 1RTOA 1YBYA 3P7JA 1YEZA 3K5MA 4MN3A 4TQUS 4IPCA 2JA7B 5M5XB 2EY6A 3J81L 2FMMA 1L1OA 3GTPH 1EY9A 3K7AB 1DCZA 3TP8A 2KBNA 5JEAJ 3M4OH 2Y0SB 4A3IH 1PTOC 5IIFA 4PZ8A 4X62Q 4JI5L 1VQKA 1LUZA 4KD4A
chains in the Genus database with same CATH topology
1EQRA 1HZAA 5JEAG 1BBWA 2UXCL 4UP9A 3ULPA 3K7AH 4IJHA 4LFCL 2WB1G 4B3TL 4OWXB 2VQEL 2VY3A 4A76A 4A3MG 1WCMG 1D8LA 1VQ9A 3KJPA 4TVAB 5GADC 1B70B 4DR2L 1QUQB 4AQYQ 3M4PA 1PH4A 2F4VL 1VQMA 5LMNW 4IFDJ 4DV0L 2K14A 1PH1A 3L0OA 1NY4A 1HNZQ 1TWCH 3H0GG 2Q2HA 3I2ZA 1VQ8A 1N8RC 2OTLA 4LF6Q 5JJKA 1WYDA 4A3CG 4HJ8A 1VQ7A 4L5SA 4YWMA 3PF4A 3F1ZA 2I0QA 4IFDG 4LF4L 1N33L 1E7ZA 2RHQB 1VQ5A 1HH2P 2OTJA 3CCEA 1KXLA 1OXXK 2MNAA 1PH5A 3F2BA 3CC7A 3G71A 4LF8Q 5M3FH 4KHZA 2AWOA 3PV0A 1Q82C 4X65L 1PV4A 1C9OA 1YJWA 3F8TA 5FLXc 3G4SA 4ALPA 1JJ2A 4LFCQ 1V9PA 2R93G 4B3TQ 4BY1H 3GTGH 1HZ9A 2KCTA 1UE7A 1K83H 1NE3A 1Q8KA 1AE3A 1EIFA 2UXDL 2YTYA 4DR1L 4WJ4A 2R92H 5HGQA 1Q7YC 3JAMc 4LFAL 2UXBL 1IZ6A 2YU9H 2AWNA 2N3SA 4DV0Q 2CWAA 4PG3A 3ULJA 1IBML 3KDFB 3HOZG 4BY7G 4GKJL 1U5KA 4A3EG 1W3SA 2PQAB 1D7QA 1G51A 2ZTCA 4R4TA 3GTQH 3HOVG 4A3MH 5C4JH 3AEVA 1WCMH 2NN6I 5GROA 2I5HA 2PMZE 4LF4Q 1N33Q 4BA2I 4HIMA 3HOUG 2JQOA 4JOIC 1YIJA 5GAEC 4DAMA 4LF5L 3AFPA 2Z6KC 4NB3A 1E3PA 1IBLL 1Z47A 4X65Q 2OCEA 3NELA 1MKHA 3B6YA 3M85A 4L5RC 4LNQA 2OWOA 4LFBL 4A3CH 1GVPA 1TWFH 3L7ZC 2IX1A 4P71A 1E22A 1QVFA 2KHIA 5ELOA 2UXDQ 3CP0A 4DV3L 2Z0SA 4GN4B 1BBUA 1PYSB 3HOYG 3TS2A 4JBWA 2GN5A 4JI6Q 2A8VA 1OTCA 1XMOL 1IBMQ 4GKJQ 1WFQA 1K0RA 1QZGA 1I94Q 2IY5B 4ME3A 2WAQG 3CCQA 1GKHA 2WB1E 1JB7A 4MNOA 4RG1A 3M4QA 2R93H 2H5XA 2EIFA 1S40A 2BH8A 2JJQA 3J7ZC 4DV1L 4K0KL 4A3LG 1CKOA 3AFQA 1A62A 4JBMA 5C0XI 2CWPA 1S72A 5M3MH 2A19A 2C35B 1GD7A 4DV6L 1X3EA 2HHHL 4LF5Q 1PH8A 1IBLQ 1G291 2DUDA 4OX9Q 2AKWB 1Q86C 1EFWA 3HOZH 4C3HH 3PIOA 4A3EH 2ATWA 4R1JA 3KF8B 4DV5L 4DR5Q 1YHAA 3KYHC 4JI1Q 4XTCS 1VQOA 4LFBQ 3RLNA 4JG2A 3CW2C 1B8AA 1GM5A 2UXCQ 3CXCA 3NBHB 2LXJA 2KCMA 4DV3Q 4JI8Q 5FJ8H 3OYYA 3GTOH 5GAHC 3M3YH 3Q8DA 5BR8L 3FHWA 1K9MC 4DUYQ 2IX0A 4HJ5A 3F2CA 1XMOQ 4A3BH 3CPWA 4C2MH 3W5OA 5C3EG 3BU2A 5C4XG 3U4ZA 3I55A 2ZTDA 3E9IA 1HZBA 1UE5A 2NZOA 2ASBA 3T1HQ 3HKSA 1G6PA 1C0AA 4DR4L 3J7A5 3K0XA 1P16A 3WWVA 2RHSB 1KC8C 4A3KG 1JE5A 1Y14B 4X64Q 1CKNB 4DV6Q 2R7DA 3ULLA 3HOYH 2NZHA 4JI2Q 2UUBL 3OTOL 2VW9A 2HIXA 1HJPA 4A93G 1JT8A 4DK6C 4GKKL 1MJCA 4A3JG 3HFZB 2VL6A 4DV2L 4DV5Q 3A74A 3H3VH 1N36L 3EBEA 4HIKA 5E7NA 4HIDA 2E5LL 4A3LH 4BBRG 4P74A 5BR8Q 4JBJA 4MTNA 1XNQQ 3CAMA 2YTVA 4A3GG 1N32L 3K81C 2CKZB 2VNUD 5IP7G 1VQCA 1KQSA 1Q1BA 3S24A 3PO3G 4YCUA 4OWWB 2JA5G 2YV5A 3KF6B 3CCSA 2VZAA 2I5MX 2IHFA 2ZM6L 1Y1WH 4QQBX 1CSPA 5AJ3L 3PF5A 2RCNA 4POFA 3GTJH 4DR3L 2F52A 3BJUA 3U4VA 3CF5A 5IY0A 3MXNB 4GNXB 3PUVA 4P75A 4L5QA 2ZJPA 3S15H 2Q2UA 2WAQE 2UUBQ 3OTOQ 1AE2A 2VUMG 2B3GA 5C3EH 4O0AA 1SMXA 1U0LA 2ID0A 4JI5Q 1E1TA 3S1MH 3G48A 2JA8G 2OQKA 4IJLA 2V1CC 4IO9A 1N36Q 4HJ9A 4GOPB 2FXQA 1TWGH 3FP9A 4A3FG 1EIYB 2E5LQ 2AMCB 5C44G 3RLFA 2VQEQ 2VQFL 1L1OB 3A5ZB 2R7FA 2QEXA 4A75A 4A3KH 3CC2A 3CCRA 5M5YH 4DR2Q 1A8VA 1IXRA 1SROA 4LWCA 5IYDG 1Q81C 3NENA 3GTKH 1VQAA 4R4QA 4DPGA 3HOWG 4A3JH 1J5EL 2F4VQ 2RF4A 3HKZG 1AH9A 4BXXG 2MFIA 2ZM6Q 2GVBA 3FKIH 1SFOH 3S1RH 1WI5A 2NVYH 3D0FA 5AJ3Q 4DR3Q 3I4NG 1PH9A 4K0KQ 5LMNL 4BBRH 5GQOA 1PYBA 1CKMA 3RNUA 4J15A 1MJEA 4DV4L 2LSSA 1Q46A 1OXSC 4LUOA 2Q2IA 4PZ7A 2JA5H 1K73C 3E9HA 5LMUL 1BVSA 5M5WH 4YCVA 3FKIG 1RIPA 4C3JH 1S3OA 4QY7A 4QIWE 4JBKA 5C0XG 3H0GH 5DLQE 3PUXA 2E8GA 2MQHA 3UDFA 4GLXA 3A0JA 1KL9A 5FLMG 2VQFQ 1Y1VG 1VQDA 2XGTA 1XPOA 4JV5L 4IFDI 3LGJA 4PMWA 1PA6A 3VDYA 1TWHH 3CQZH 2K5HA 4BBSG 4DR1Q 3CCJA 1YJNA 1W2BA 4LFAQ 2UXBQ 4P72A 2E2HH 1K3RA 1VQHA 1UE6A 1Q12A 1QVGA 2QA4A 4NXML 3L2PA 3S2DH 2QGQA 1X65A 1FGUA 4YCWA 3CPFA 5C44H 4GNXC 3CC4A 4FDBA 4JI4L 3S1QH 1VQ4A 3PSIA 1PH6A 1X3GA 1VQIA 4DKAC 3TS0A 1VQGA 4DV4Q 1JJGA 2ZJRA 4P73A 1YITA 4O2DA 4R4OA 4DR7L 1KHIA 1JJCB 4YWLA 4GN5A 4PZ6A 4GOPC 1N34L 4BY7H 4A3DG 1HR0L 1VQ6A 3UE1A 3PUZA 1B7YB 2KENA 2E2JH 1JMCA 4DV7L 3I4NH 1I3QH 2UUCL 1UEBA 1M90C 1L1OC 2PNHA 2I5LX 4A3IG 3CD6A 3HOVH 4JV5Q 1H95A 4JOIA 1VQLA 3U50C 4B3RL 1LYLA 1YHBA 2CFMA 5IP9G 1SE8A 3HOUH 3AYHB 4JI7L 3S14H 4UPAA 3KFUA 4YY3L 2D0PA 4AYBG 4NXMQ 1I50H 2JEAI 4DUZL 2D0OA 4HIOA 5IYBG 2Y0SG 4YWKA 1YI2A 1XJVA 3PUYA 1VQEA 3OW2A 4JI4Q 4QJFA 1QUQA 3T1YL 3H15A 4IOCA 1K8AC 1XNRL 2LXKA 3W1GA 3UDXA 4AIMA 1OXUA 4X62L 2JEBI 4DV1Q 4JYAL 2HIVA 3K7UC 3CCMA 2UU9L 4BBSH 3UDGA 2K5VA 2HT1A 3HKZE 3S1NH 1IBKL 1IYJB 4DR7Q 1Q1EA 3M9BA 2HHHQ 4OO1I 3I4OA 1NMGA 1N34Q 1NMFA 3UE0A 1HR0Q 2NVXH 5GAGC 1X9NA 2BA1A 3IRBA 3H3VI 4DV7Q 2UUCQ 2ZJQA 1V1QA 3PCOB 1OXTA 4AQYL 2B29A 1OXVA 1LM0A 3ZJYC 1LTLA 1A63A 1VS0A 2E2IH 4B3ML 1HNZL 1P8LA 4UP7A 4YY3Q 3MEFA 2AHOB 2DGYA 2KHJA 4LF6L 3GD7A 4BY1G 2N8NA 4B3SL 2IT1A 1MIUA 1PH3A 4X6AH 1X3FA 4C3IH 3ERSX 3T1YQ 4EQ5A 4LF7L 1XNRQ 4LF9L 2R92G 1Z9FA 5EAYA 1NTGA 3UDIA 4DR4Q 4JYAQ 2N78A 5IP9H 4JCVE 1XMQL 3KDFA 3KOJA 4MZ9A 4NPSA 1IBKQ 1WJJA 1ASYA 1QVCA 2JK8A 2PQAA 5ELNA 3NEMA 1KRSA 1DGSA 1E1OA 4IOAA 1XPUA 1YZ6A 4IPHA 1L0WA 4GKKQ 5IYBH 5C4XH 4L5TA 4DV2Q 1EQQA 3CMEA 5IWAL 1E24A 2NN6G 3STBD 1C7YA 2ZTEA 4R4IA 4Y52H 2PI2A 4OXPA 1VQFA 1VCIA 3A5UA 1KIXA 1HZCA 2K52A 3J81i 3RZDH 1YJ9A 4B3MQ 1N32Q 2CCZA 2XTIA 4JC0A 4NXNL 5K36G 1TXYA 3K8AA 3S17H 4A93H 3G6EA 1RL2A 4B3SQ 3TRZA 4GLVB 4YHHL 3JAMi 5H1SE 1TWAH 3HOXG 4LF7Q 2NVQH 4LF9Q 1HNXL 3E0EA 1I5FA 1XMQQ 1KD1C 1T9HA 4H02A 1KAWA 1X6OA 4A3GH 4AYBE 4RMFA 1CSQA 1XPRA 1EWIA 3J81c 5C0XJ 2K75A 1UE1A 2Y0SE 5IP7H 3PO3H 5JJLA 3SGIA 2YTXA 4LUVA 2MO0A 5IWAQ 4HJAA 4KI0A 4LW1A 5M3MG 2ES2A 1K8GA 3KLWA 3PO2G 4IPDA 3EN2A 4GN3B 1SR3A 1VQPA 4JI6L 4QL5A 2B63G 4JI0L 2R7ZG 2BA0A 3DM3A 1I94L 4NXNQ 4UP8A 1EUJA 1EOVA 1O7IA 3PIPA 1I6HH 4WJ3M 3CCVA 1VQNA 2JA6G 1VQBA 1J6QA 2VUMH 3TEHB 3S16H 2ALYB 4LUZA 5IT9c 1SLJA 4YHHQ 1J5EQ 3CCLA 3PUWA 2JA8H 2R6GA 1BKBA 5FJ8G 1A0IA 4XIGS 4JI3L 4Y7NH 2K5NA 3AQQA 2HQLA 1PHJA 1HNXQ 1HR0W 3ICEA 3D31A 2MO1A 4A3FH 3BZKA 1FVIA 4KLKA 4A4IA 3RLOA 5LMNQ 3S2HH 4A3BG 4OX9L 5IYCG 3GTLH 2F3IA 2N49A 5HY6A 4DAYB 1FL0A 4KHPL 5JJIA 4DR5L 1CUKA 4JI1L 1UWVA 1R9TH 5IYDH 4POGA 2A1AA 1X56A 2YYZA 1XTDA 4APVA 3GTMH 5LMUQ 3HOWH 2K50A 3I4MG 1X54A 1KRTA 4BXXH 3HOXH 3TREA 3GDEA 4JI8L 1CKNA 3TQYA 1PH2A 2JA9A 4DUYL 4DK3C 4DR6L 1IL2A 3J80i 3W1BA 4DNIA 4OO1G 1PH7A 4JI0Q 3ER0A 1PVOA 4OONA 1FJGL 1SN8A 3CCUA 1X55A 2K4KA 2Z6KA 4HJ7A 1EYGA 4UY8C 2JA7G 3DLLA 4GLAC 3STBC 1YHQA 3CMAA 2BH2A 3T1HL 3EIVA 2EQSA 1HNWL 1WOCA 3M7NA 1GO3E 3RR5A 2Q2TA 4JI3Q 2L15A 2WFWA 4X64L 2OQ0A 4R4CA 5J3BA 3PO2H 4AH6A 1YNXA 1QZHA 3J81j 3K80C 4X66L 1Y1VH 5FLMH 4JI2L 2B63H 3KF6A 2R7ZH 3J80c 5IE8A 4KHPQ 2UUAL 1M1KC 2WP8J 1Y1WG 2JA6H 3I56A 1N9WA 3BZCA 1V43A 2EXDA 2PI2E 1PFSA 4GNXA 1NJIC 1XNQL 3RZOH 4DR6Q 1ASZA 1YBYA 2VS1A 3GO5A 1YEZA 1YVCA 1SRUA 4EX5A 4BA1I 1FJGQ 5IYCH 4B3RQ 3I7FA 2GVAA 4TQUS 3PGZA 4GOPA 5M3FG 4IPCA 3RN2A 4JI7Q 3JC66 1NBWA 4GS3A 3KJOA 1HNWQ 2CQOA 1VQJA 4IPGA 4OWTB 3I4MH 1L1OA 3RN5A 2D62A 3F2DA 4DUZQ 4A3DH 2IHEA 3GTPH 2KBNA 5JEAJ 3M4OH 4X66Q 4A3IH 2NVTH 4QGUA 4PZ8A 2JE6I 4X62Q 2UUAQ 2UU9Q 4JI5L 1VQKA 4LF8L 2JA7H 5M5XH 1LUZA 3U58A 1L2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQR A;  1HZA A;  5JEA G;  1BBW A;  2UXC L;  4UP9 A;  3ULP A;  3K7A H;  4IJH A;  4LFC L;  2WB1 G;  4B3T L;  4OWX B;  2VQE L;  2VY3 A;  4A76 A;  4A3M G;  1WCM G;  1D8L A;  1VQ9 A;  3KJP A;  4TVA B;  5GAD C;  1B70 B;  4DR2 L;  1QUQ B;  4AQY Q;  3M4P A;  1PH4 A;  2F4V L;  1VQM A;  5LMN W;  4IFD J;  4DV0 L;  2K14 A;  1PH1 A;  3L0O A;  1NY4 A;  1HNZ Q;  1TWC H;  3H0G G;  2Q2H A;  3I2Z A;  1VQ8 A;  1N8R C;  2OTL A;  4LF6 Q;  5JJK A;  1WYD A;  4A3C G;  4HJ8 A;  1VQ7 A;  4L5S A;  4YWM A;  3PF4 A;  3F1Z A;  2I0Q A;  4IFD G;  4LF4 L;  1N33 L;  1E7Z A;  2RHQ B;  1VQ5 A;  1HH2 P;  2OTJ A;  3CCE A;  1KXL A;  1OXX K;  2MNA A;  1PH5 A;  3F2B A;  3CC7 A;  3G71 A;  4LF8 Q;  5M3F H;  4KHZ A;  2AWO A;  3PV0 A;  1Q82 C;  4X65 L;  1PV4 A;  1C9O A;  1YJW A;  3F8T A;  5FLX c;  3G4S A;  4ALP A;  1JJ2 A;  4LFC Q;  1V9P A;  2R93 G;  4B3T Q;  4BY1 H;  3GTG H;  1HZ9 A;  2KCT A;  1UE7 A;  1K83 H;  1NE3 A;  1Q8K A;  1AE3 A;  1EIF A;  2UXD L;  2YTY A;  4DR1 L;  4WJ4 A;  2R92 H;  5HGQ A;  1Q7Y C;  3JAM c;  4LFA L;  2UXB L;  1IZ6 A;  2YU9 H;  2AWN A;  2N3S A;  4DV0 Q;  2CWA A;  4PG3 A;  3ULJ A;  1IBM L;  3KDF B;  3HOZ G;  4BY7 G;  4GKJ L;  1U5K A;  4A3E G;  1W3S A;  2PQA B;  1D7Q A;  1G51 A;  2ZTC A;  4R4T A;  3GTQ H;  3HOV G;  4A3M H;  5C4J H;  3AEV A;  1WCM H;  2NN6 I;  5GRO A;  2I5H A;  2PMZ E;  4LF4 Q;  1N33 Q;  4BA2 I;  4HIM A;  3HOU G;  2JQO A;  4JOI C;  1YIJ A;  5GAE C;  4DAM A;  4LF5 L;  3AFP A;  2Z6K C;  4NB3 A;  1E3P A;  1IBL L;  1Z47 A;  4X65 Q;  2OCE A;  3NEL A;  1MKH A;  3B6Y A;  3M85 A;  4L5R C;  4LNQ A;  2OWO A;  4LFB L;  4A3C H;  1GVP A;  1TWF H;  3L7Z C;  2IX1 A;  4P71 A;  1E22 A;  1QVF A;  2KHI A;  5ELO A;  2UXD Q;  3CP0 A;  4DV3 L;  2Z0S A;  4GN4 B;  1BBU A;  1PYS B;  3HOY G;  3TS2 A;  4JBW A;  2GN5 A;  4JI6 Q;  2A8V A;  1OTC A;  1XMO L;  1IBM Q;  4GKJ Q;  1WFQ A;  1K0R A;  1QZG A;  1I94 Q;  2IY5 B;  4ME3 A;  2WAQ G;  3CCQ A;  1GKH A;  2WB1 E;  1JB7 A;  4MNO A;  4RG1 A;  3M4Q A;  2R93 H;  2H5X A;  2EIF A;  1S40 A;  2BH8 A;  2JJQ A;  3J7Z C;  4DV1 L;  4K0K L;  4A3L G;  1CKO A;  3AFQ A;  1A62 A;  4JBM A;  5C0X I;  2CWP A;  1S72 A;  5M3M H;  2A19 A;  2C35 B;  1GD7 A;  4DV6 L;  1X3E A;  2HHH L;  4LF5 Q;  1PH8 A;  1IBL Q;  1G29 1;  2DUD A;  4OX9 Q;  2AKW B;  1Q86 C;  1EFW A;  3HOZ H;  4C3H H;  3PIO A;  4A3E H;  2ATW A;  4R1J A;  3KF8 B;  4DV5 L;  4DR5 Q;  1YHA A;  3KYH C;  4JI1 Q;  4XTC S;  1VQO A;  4LFB Q;  3RLN A;  4JG2 A;  3CW2 C;  1B8A A;  1GM5 A;  2UXC Q;  3CXC A;  3NBH B;  2LXJ A;  2KCM A;  4DV3 Q;  4JI8 Q;  5FJ8 H;  3OYY A;  3GTO H;  5GAH C;  3M3Y H;  3Q8D A;  5BR8 L;  3FHW A;  1K9M C;  4DUY Q;  2IX0 A;  4HJ5 A;  3F2C A;  1XMO Q;  4A3B H;  3CPW A;  4C2M H;  3W5O A;  5C3E G;  3BU2 A;  5C4X G;  3U4Z A;  3I55 A;  2ZTD A;  3E9I A;  1HZB A;  1UE5 A;  2NZO A;  2ASB A;  3T1H Q;  3HKS A;  1G6P A;  1C0A A;  4DR4 L;  3J7A 5;  3K0X A;  1P16 A;  3WWV A;  2RHS B;  1KC8 C;  4A3K G;  1JE5 A;  1Y14 B;  4X64 Q;  1CKN B;  4DV6 Q;  2R7D A;  3ULL A;  3HOY H;  2NZH A;  4JI2 Q;  2UUB L;  3OTO L;  2VW9 A;  2HIX A;  1HJP A;  4A93 G;  1JT8 A;  4DK6 C;  4GKK L;  1MJC A;  4A3J G;  3HFZ B;  2VL6 A;  4DV2 L;  4DV5 Q;  3A74 A;  3H3V H;  1N36 L;  3EBE A;  4HIK A;  5E7N A;  4HID A;  2E5L L;  4A3L H;  4BBR G;  4P74 A;  5BR8 Q;  4JBJ A;  4MTN A;  1XNQ Q;  3CAM A;  2YTV A;  4A3G G;  1N32 L;  3K81 C;  2CKZ B;  2VNU D;  5IP7 G;  1VQC A;  1KQS A;  1Q1B A;  3S24 A;  3PO3 G;  4YCU A;  4OWW B;  2JA5 G;  2YV5 A;  3KF6 B;  3CCS A;  2VZA A;  2I5M X;  2IHF A;  2ZM6 L;  1Y1W H;  4QQB X;  1CSP A;  5AJ3 L;  3PF5 A;  2RCN A;  4POF A;  3GTJ H;  4DR3 L;  2F52 A;  3BJU A;  3U4V A;  3CF5 A;  5IY0 A;  3MXN B;  4GNX B;  3PUV A;  4P75 A;  4L5Q A;  2ZJP A;  3S15 H;  2Q2U A;  2WAQ E;  2UUB Q;  3OTO Q;  1AE2 A;  2VUM G;  2B3G A;  5C3E H;  4O0A A;  1SMX A;  1U0L A;  2ID0 A;  4JI5 Q;  1E1T A;  3S1M H;  3G48 A;  2JA8 G;  2OQK A;  4IJL A;  2V1C C;  4IO9 A;  1N36 Q;  4HJ9 A;  4GOP B;  2FXQ A;  1TWG H;  3FP9 A;  4A3F G;  1EIY B;  2E5L Q;  2AMC B;  5C44 G;  3RLF A;  2VQE Q;  2VQF L;  1L1O B;  3A5Z B;  2R7F A;  2QEX A;  4A75 A;  4A3K H;  3CC2 A;  3CCR A;  5M5Y H;  4DR2 Q;  1A8V A;  1IXR A;  1SRO A;  4LWC A;  5IYD G;  1Q81 C;  3NEN A;  3GTK H;  1VQA A;  4R4Q A;  4DPG A;  3HOW G;  4A3J H;  1J5E L;  2F4V Q;  2RF4 A;  3HKZ G;  1AH9 A;  4BXX G;  2MFI A;  2ZM6 Q;  2GVB A;  3FKI H;  1SFO H;  3S1R H;  1WI5 A;  2NVY H;  3D0F A;  5AJ3 Q;  4DR3 Q;  3I4N G;  1PH9 A;  4K0K Q;  5LMN L;  4BBR H;  5GQO A;  1PYB A;  1CKM A;  3RNU A;  4J15 A;  1MJE A;  4DV4 L;  2LSS A;  1Q46 A;  1OXS C;  4LUO A;  2Q2I A;  4PZ7 A;  2JA5 H;  1K73 C;  3E9H A;  5LMU L;  1BVS A;  5M5W H;  4YCV A;  3FKI G;  1RIP A;  4C3J H;  1S3O A;  4QY7 A;  4QIW E;  4JBK A;  5C0X G;  3H0G H;  5DLQ E;  3PUX A;  2E8G A;  2MQH A;  3UDF A;  4GLX A;  3A0J A;  1KL9 A;  5FLM G;  2VQF Q;  1Y1V G;  1VQD A;  2XGT A;  1XPO A;  4JV5 L;  4IFD I;  3LGJ A;  4PMW A;  1PA6 A;  3VDY A;  1TWH H;  3CQZ H;  2K5H A;  4BBS G;  4DR1 Q;  3CCJ A;  1YJN A;  1W2B A;  4LFA Q;  2UXB Q;  4P72 A;  2E2H H;  1K3R A;  1VQH A;  1UE6 A;  1Q12 A;  1QVG A;  2QA4 A;  4NXM L;  3L2P A;  3S2D H;  2QGQ A;  1X65 A;  1FGU A;  4YCW A;  3CPF A;  5C44 H;  4GNX C;  3CC4 A;  4FDB A;  4JI4 L;  3S1Q H;  1VQ4 A;  3PSI A;  1PH6 A;  1X3G A;  1VQI A;  4DKA C;  3TS0 A;  1VQG A;  4DV4 Q;  1JJG A;  2ZJR A;  4P73 A;  1YIT A;  4O2D A;  4R4O A;  4DR7 L;  1KHI A;  1JJC B;  4YWL A;  4GN5 A;  4PZ6 A;  4GOP C;  1N34 L;  4BY7 H;  4A3D G;  1HR0 L;  1VQ6 A;  3UE1 A;  3PUZ A;  1B7Y B;  2KEN A;  2E2J H;  1JMC A;  4DV7 L;  3I4N H;  1I3Q H;  2UUC L;  1UEB A;  1M90 C;  1L1O C;  2PNH A;  2I5L X;  4A3I G;  3CD6 A;  3HOV H;  4JV5 Q;  1H95 A;  4JOI A;  1VQL A;  3U50 C;  4B3R L;  1LYL A;  1YHB A;  2CFM A;  5IP9 G;  1SE8 A;  3HOU H;  3AYH B;  4JI7 L;  3S14 H;  4UPA A;  3KFU A;  4YY3 L;  2D0P A;  4AYB G;  4NXM Q;  1I50 H;  2JEA I;  4DUZ L;  2D0O A;  4HIO A;  5IYB G;  2Y0S G;  4YWK A;  1YI2 A;  1XJV A;  3PUY A;  1VQE A;  3OW2 A;  4JI4 Q;  4QJF A;  1QUQ A;  3T1Y L;  3H15 A;  4IOC A;  1K8A C;  1XNR L;  2LXK A;  3W1G A;  3UDX A;  4AIM A;  1OXU A;  4X62 L;  2JEB I;  4DV1 Q;  4JYA L;  2HIV A;  3K7U C;  3CCM A;  2UU9 L;  4BBS H;  3UDG A;  2K5V A;  2HT1 A;  3HKZ E;  3S1N H;  1IBK L;  1IYJ B;  4DR7 Q;  1Q1E A;  3M9B A;  2HHH Q;  4OO1 I;  3I4O A;  1NMG A;  1N34 Q;  1NMF A;  3UE0 A;  1HR0 Q;  2NVX H;  5GAG C;  1X9N A;  2BA1 A;  3IRB A;  3H3V I;  4DV7 Q;  2UUC Q;  2ZJQ A;  1V1Q A;  3PCO B;  1OXT A;  4AQY L;  2B29 A;  1OXV A;  1LM0 A;  3ZJY C;  1LTL A;  1A63 A;  1VS0 A;  2E2I H;  4B3M L;  1HNZ L;  1P8L A;  4UP7 A;  4YY3 Q;  3MEF A;  2AHO B;  2DGY A;  2KHJ A;  4LF6 L;  3GD7 A;  4BY1 G;  2N8N A;  4B3S L;  2IT1 A;  1MIU A;  1PH3 A;  4X6A H;  1X3F A;  4C3I H;  3ERS X;  3T1Y Q;  4EQ5 A;  4LF7 L;  1XNR Q;  4LF9 L;  2R92 G;  1Z9F A;  5EAY A;  1NTG A;  3UDI A;  4DR4 Q;  4JYA Q;  2N78 A;  5IP9 H;  4JCV E;  1XMQ L;  3KDF A;  3KOJ A;  4MZ9 A;  4NPS A;  1IBK Q;  1WJJ A;  1ASY A;  1QVC A;  2JK8 A;  2PQA A;  5ELN A;  3NEM A;  1KRS A;  1DGS A;  1E1O A;  4IOA A;  1XPU A;  1YZ6 A;  4IPH A;  1L0W A;  4GKK Q;  5IYB H;  5C4X H;  4L5T A;  4DV2 Q;  1EQQ A;  3CME A;  5IWA L;  1E24 A;  2NN6 G;  3STB D;  1C7Y A;  2ZTE A;  4R4I A;  4Y52 H;  2PI2 A;  4OXP A;  1VQF A;  1VCI A;  3A5U A;  1KIX A;  1HZC A;  2K52 A;  3J81 i;  3RZD H;  1YJ9 A;  4B3M Q;  1N32 Q;  2CCZ A;  2XTI A;  4JC0 A;  4NXN L;  5K36 G;  1TXY A;  3K8A A;  3S17 H;  4A93 H;  3G6E A;  1RL2 A;  4B3S Q;  3TRZ A;  4GLV B;  4YHH L;  3JAM i;  5H1S E;  1TWA H;  3HOX G;  4LF7 Q;  2NVQ H;  4LF9 Q;  1HNX L;  3E0E A;  1I5F A;  1XMQ Q;  1KD1 C;  1T9H A;  4H02 A;  1KAW A;  1X6O A;  4A3G H;  4AYB E;  4RMF A;  1CSQ A;  1XPR A;  1EWI A;  3J81 c;  5C0X J;  2K75 A;  1UE1 A;  2Y0S E;  5IP7 H;  3PO3 H;  5JJL A;  3SGI A;  2YTX A;  4LUV A;  2MO0 A;  5IWA Q;  4HJA A;  4KI0 A;  4LW1 A;  5M3M G;  2ES2 A;  1K8G A;  3KLW A;  3PO2 G;  4IPD A;  3EN2 A;  4GN3 B;  1SR3 A;  1VQP A;  4JI6 L;  4QL5 A;  2B63 G;  4JI0 L;  2R7Z G;  2BA0 A;  3DM3 A;  1I94 L;  4NXN Q;  4UP8 A;  1EUJ A;  1EOV A;  1O7I A;  3PIP A;  1I6H H;  4WJ3 M;  3CCV A;  1VQN A;  2JA6 G;  1VQB A;  1J6Q A;  2VUM H;  3TEH B;  3S16 H;  2ALY B;  4LUZ A;  5IT9 c;  1SLJ A;  4YHH Q;  1J5E Q;  3CCL A;  3PUW A;  2JA8 H;  2R6G A;  1BKB A;  5FJ8 G;  1A0I A;  4XIG S;  4JI3 L;  4Y7N H;  2K5N A;  3AQQ A;  2HQL A;  1PHJ A;  1HNX Q;  1HR0 W;  3ICE A;  3D31 A;  2MO1 A;  4A3F H;  3BZK A;  1FVI A;  4KLK A;  4A4I A;  3RLO A;  5LMN Q;  3S2H H;  4A3B G;  4OX9 L;  5IYC G;  3GTL H;  2F3I A;  2N49 A;  5HY6 A;  4DAY B;  1FL0 A;  4KHP L;  5JJI A;  4DR5 L;  1CUK A;  4JI1 L;  1UWV A;  1R9T H;  5IYD H;  4POG A;  2A1A A;  1X56 A;  2YYZ A;  1XTD A;  4APV A;  3GTM H;  5LMU Q;  3HOW H;  2K50 A;  3I4M G;  1X54 A;  1KRT A;  4BXX H;  3HOX H;  3TRE A;  3GDE A;  4JI8 L;  1CKN A;  3TQY A;  1PH2 A;  2JA9 A;  4DUY L;  4DK3 C;  4DR6 L;  1IL2 A;  3J80 i;  3W1B A;  4DNI A;  4OO1 G;  1PH7 A;  4JI0 Q;  3ER0 A;  1PVO A;  4OON A;  1FJG L;  1SN8 A;  3CCU A;  1X55 A;  2K4K A;  2Z6K A;  4HJ7 A;  1EYG A;  4UY8 C;  2JA7 G;  3DLL A;  4GLA C;  3STB C;  1YHQ A;  3CMA A;  2BH2 A;  3T1H L;  3EIV A;  2EQS A;  1HNW L;  1WOC A;  3M7N A;  1GO3 E;  3RR5 A;  2Q2T A;  4JI3 Q;  2L15 A;  2WFW A;  4X64 L;  2OQ0 A;  4R4C A;  5J3B A;  3PO2 H;  4AH6 A;  1YNX A;  1QZH A;  3J81 j;  3K80 C;  4X66 L;  1Y1V H;  5FLM H;  4JI2 L;  2B63 H;  3KF6 A;  2R7Z H;  3J80 c;  5IE8 A;  4KHP Q;  2UUA L;  1M1K C;  2WP8 J;  1Y1W G;  2JA6 H;  3I56 A;  1N9W A;  3BZC A;  1V43 A;  2EXD A;  2PI2 E;  1PFS A;  4GNX A;  1NJI C;  1XNQ L;  3RZO H;  4DR6 Q;  1ASZ A;  1YBY A;  2VS1 A;  3GO5 A;  1YEZ A;  1YVC A;  1SRU A;  4EX5 A;  4BA1 I;  1FJG Q;  5IYC H;  4B3R Q;  3I7F A;  2GVA A;  4TQU S;  3PGZ A;  4GOP A;  5M3F G;  4IPC A;  3RN2 A;  4JI7 Q;  3JC6 6;  1NBW A;  4GS3 A;  3KJO A;  1HNW Q;  2CQO A;  1VQJ A;  4IPG A;  4OWT B;  3I4M H;  1L1O A;  3RN5 A;  2D62 A;  3F2D A;  4DUZ Q;  4A3D H;  2IHE A;  3GTP H;  2KBN A;  5JEA J;  3M4O H;  4X66 Q;  4A3I H;  2NVT H;  4QGU A;  4PZ8 A;  2JE6 I;  4X62 Q;  2UUA Q;  2UU9 Q;  4JI5 L;  1VQK A;  4LF8 L;  2JA7 H;  5M5X H;  1LUZ A;  3U58 A;  1L2F A; 
#chains in the Genus database with same CATH topology
 1SSO A;  4KD3 A;  1TWC B;  2VY3 A;  1DXM A;  5C4Z A;  1VF7 A;  1WCM G;  3KJP A;  1B70 B;  3I4L A;  4AQY Q;  3M4P A;  1F9R A;  2ZT9 C;  1WTV A;  2F4V L;  1VQM A;  3OOC A;  2KEE A;  3J80 E;  2K14 A;  4C3J G;  3L0O A;  1WYD A;  4A3C G;  1KAB A;  4HJ8 A;  3GV3 A;  3SK4 A;  1G8Z D;  4G57 A;  1K83 B;  4LF4 L;  3CCE A;  1KXL A;  2MNA A;  1PH5 A;  2R92 B;  3VA5 A;  1D1K A;  1EYA A;  4KHZ A;  3LX0 A;  2AWO A;  2FHT A;  3BYT B;  4K14 A;  1YJW A;  1G2S A;  3G4S A;  2R93 G;  1HZ9 A;  2KCT A;  2MP1 A;  4R8N A;  1EIF A;  1GHJ A;  1V1P A;  4KTA A;  2P5Z X;  1SNP A;  2VB2 X;  3D8G A;  4PG3 A;  3KDF B;  4GKJ L;  3J80 L;  5JEA H;  5IOC A;  1CFM A;  4ZLT F;  3AEV A;  4JVZ A;  1SE2 A;  1HQR D;  2NN6 I;  4FF4 A;  4MTK A;  4LF4 Q;  4JOI C;  5GAE C;  1FD7 D;  3PIP 3;  4NB3 A;  1TU2 B;  2OCE A;  3NEL A;  5NUC A;  5K36 H;  1IYV A;  4V19 0;  1LTG D;  1TWF H;  2IX1 A;  1QVF A;  2KHI A;  4RHR A;  3IL8 A;  3R2T A;  3CHB D;  4DV3 L;  1LTI D;  4H13 C;  1WD0 A;  3MTS A;  4GN4 B;  2BE5 D;  1F77 A;  4K6L A;  5DM6 3;  1OTC A;  1STY A;  4GKJ Q;  1QZG A;  4XT3 B;  3CCQ A;  4JK1 C;  4MNO A;  5E1F A;  4RGO S;  2H5X A;  1S40 A;  5FLX L;  2BH8 A;  4R9W A;  1Q3L A;  5C0X I;  1S72 A;  2A19 A;  1GD7 A;  1H9J A;  2ICI A;  4EVO A;  1B3Q A;  4R1J A;  5ELE A;  2H4O A;  4DR5 Q;  4XTC S;  1CHQ D;  4R8I A;  4KV6 A;  3NBH B;  1PXU A;  4DV3 Q;  3ERO A;  5FJ8 H;  3OYY A;  3M3Y H;  5GAH C;  4CKE A;  4DUY Q;  2IX0 A;  2EVB A;  2ZXP A;  3HOY B;  2K28 A;  3CPW A;  1UUP A;  5JPN C;  5C3E G;  4G7O C;  4CJ0 B;  2NBF A;  3BU2 A;  1QNK A;  2WAQ B;  2ZTD A;  4RH6 A;  3A55 A;  2KJX A;  1CQF A;  1C0A A;  4DK1 A;  5ISR A;  1Y14 B;  1ML0 D;  2UUB L;  3OTO L;  2HIX A;  1JT8 A;  1LT3 D;  4A3J G;  1HFN A;  3URY A;  4HMI A;  4HIK A;  4A3L H;  1ESR A;  4J1M A;  4IN3 A;  2YTV A;  4NKL A;  2CKZ B;  2PYK A;  3NTK A;  1KQS A;  3S24 A;  4YCU A;  4OWW B;  4KHV A;  4RA8 A;  3ZYY X;  1LTA D;  1PLF A;  1F2L A;  4IUT A;  3S1M B;  4QQB X;  5AJ3 L;  1CA6 A;  5IY0 A;  4GNX B;  4L5Q A;  1EY4 A;  4DXG A;  2Q2U A;  2UUB Q;  3OTO Q;  1M8A A;  1DJR D;  2B2Y C;  4O0A A;  1A2U A;  1SJH D;  1R4Q B;  4IJL A;  2V1C C;  3HZX A;  1JIC A;  1B3A A;  4BS9 A;  1IKL A;  3FVQ A;  3S1R B;  2VQE Q;  2R61 A;  2R7F A;  4A3K H;  3GTQ B;  2L12 A;  3K57 A;  5IYD G;  3NEN A;  1VQA A;  5IOD A;  5EBD A;  1EY7 A;  1NAP A;  3HKZ G;  3MC0 B;  2MFI A;  2JA5 B;  3H3V C;  2IW3 A;  1SFO H;  1WVL A;  1WI5 A;  2NVY H;  4C3J B;  5AJ3 Q;  1O80 A;  2Z1C A;  4BBR H;  1PYB A;  3RNU A;  4QCL A;  1EQT A;  1MJE A;  2LSS A;  3OW7 A;  3QJY A;  3KBG A;  2F0M A;  2QIL A;  3FDT A;  3HRZ C;  1BVS A;  5D65 A;  1B1Z A;  1MSG A;  2HD3 A;  1JOK A;  4CDD C;  5M5W H;  1S3O A;  5DLQ E;  3PUX A;  3UDF A;  4KJO A;  1AP0 A;  4GLX A;  3A0J A;  1KL9 A;  1SEB D;  1XPO A;  2XGT A;  4IFD I;  2PZU A;  1ONL A;  3VDY A;  3CQZ H;  1W2B A;  4LFA Q;  2UXB Q;  5CV8 A;  3FEW X;  1QVG A;  2JP1 A;  5EBC A;  1UNS A;  2A68 D;  1CM9 A;  4EQP A;  2BDN A;  3P1H A;  1B44 D;  3CPF A;  2PCF B;  3S1Q H;  3PSI A;  1X3G A;  1C48 A;  1VQI A;  1JJG A;  3T56 B;  1BBX C;  1STE A;  2FFK B;  4IUQ A;  1SJE D;  3S14 B;  3W3A A;  3ITP A;  4A3D G;  1HR0 L;  2E75 C;  1I50 B;  1B7Y B;  2KEN A;  1I3Q H;  1UEB A;  1M90 C;  1L1O C;  4B3R L;  2IWH A;  1LYL A;  2CFM A;  1O7Y A;  2IL8 A;  2HUG A;  3HOU H;  4Z9C B;  3IFD A;  4JI7 L;  4UPA A;  4BBS B;  3ONA B;  3KFU A;  4YY3 L;  4KY7 A;  1I4H A;  3OWE B;  4AYB G;  2JEA I;  4DUZ L;  4HIO A;  1DOK A;  3PUY A;  3DWP A;  2O4X A;  4DV1 Q;  3UDX A;  1E2W A;  4X3U A;  1CA5 A;  4GZY C;  1IBK L;  5FO8 B;  1Q1E A;  3OMC A;  3F2U A;  1NMF A;  1I6V C;  3I8Z A;  1HR0 Q;  4HN7 A;  2NVX H;  1JCK B;  3M4Y A;  3VYS A;  3IRB A;  1GUT A;  1LAC A;  3L3O C;  5ELB A;  4ZAI A;  1V1Q A;  5G3L F;  2B29 A;  3N6R A;  4DAV A;  3N52 A;  1A63 A;  3PQI A;  4YY3 Q;  3MEF A;  2AHO B;  4BY1 G;  2IT1 A;  4C3I H;  1DYQ A;  1HHV A;  2F0G A;  2N78 A;  5IP9 H;  3K6O A;  2F0L A;  3KDF A;  4NPS A;  1IBK Q;  2A68 C;  4QIW B;  1YNN D;  2JK8 A;  2DNC A;  5ELN A;  3NEM A;  1YZ6 A;  3V05 A;  4CDF C;  4QUF A;  2B39 A;  4L5T A;  2J7Z A;  2WKC A;  2DNE A;  2NN6 G;  4R4I A;  4Y52 H;  1TY2 A;  2X6G A;  3KK7 A;  3KLS X;  1ZEQ X;  1HPC A;  1VCI A;  1VQF A;  1HTP A;  2LFN A;  1KIX A;  1HZC A;  1STN A;  1EZ8 A;  5KND A;  2XTI A;  1QJO A;  1S5E D;  2F3V A;  4GLV B;  3JAM i;  3HOX G;  1NNX A;  5JPM C;  2NVQ H;  1S5C D;  3R93 A;  2XNA C;  4KY5 A;  1SXT A;  4FF3 A;  2K75 A;  3Q23 A;  2Y0S E;  3NXW A;  5IP7 H;  5KRU A;  3D4W A;  1WTR A;  2MO0 A;  2NTS A;  4HJA A;  3PO2 G;  3EN2 A;  1L0X B;  2R7Z G;  3DM3 A;  1Y8P B;  3GTL B;  5EKI A;  1I6H H;  2E74 C;  2KHS A;  1WTW A;  1J6Q A;  2D9U A;  2JA6 G;  3NBH A;  3S16 H;  4LUZ A;  3SEB A;  1SLJ A;  2JA8 H;  1PHJ A;  1A0I A;  2FJ2 A;  3AQQ A;  1LAB A;  1HR0 W;  3MAQ A;  4A4I A;  3S2H H;  5LMN Q;  3RLO A;  2G9D A;  2PO4 A;  2EYO A;  5IYC G;  5JJI A;  3QIA A;  5C6A A;  3K5N A;  4DA2 A;  2EYL A;  4JI1 L;  1UWV A;  1R9T H;  4C1N I;  3WOF A;  3I4M G;  3TRE A;  3GDE A;  1STH A;  1YNN C;  2JA9 A;  5CYU A;  1TQO A;  5EJW A;  5BN3 A;  3J7A F;  4OO1 G;  1PVO A;  1K0S A;  4OON A;  1FJG L;  1SN8 A;  2B63 B;  3CCU A;  2K4K A;  2SNM A;  2JA7 G;  3CKI B;  4GLA C;  3VR4 A;  1YHQ A;  1F2Y A;  2OF1 A;  1HNW L;  5EKK A;  1XXG A;  1GO3 E;  4H7B A;  4DF7 A;  1EQV A;  3I3C A;  2OQ0 A;  4R4C A;  3E3X A;  1QZH A;  1E0B A;  3JAM E;  4XQJ A;  1Y1V H;  5IE8 A;  5I6W A;  1GUO A;  1Y1W G;  1B2T A;  4F8M A;  4KMU C;  2F0N A;  5COY A;  4J8Q A;  4GNX A;  4HSV A;  4JPB W;  1OO9 B;  5BN5 A;  1XNQ L;  4A3D B;  1ASZ A;  1GJX A;  1TR5 A;  5E3F A;  1K8M A;  1FJG Q;  4IZ8 A;  1FNU A;  2GA4 B;  5M3F G;  1HNW Q;  2EJG C;  1VQJ A;  4OWT B;  2VB3 X;  1Y8O B;  2IHE A;  2F0S A;  1B53 A;  1BDO A;  1FNW A;  4AYB B;  2FIN B;  2XSC A;  4FP5 D;  4HR7 B;  1MSH A;  2L4N A;  1RTN A;  4LF8 L;  3NP8 A;  3SR1 A;  3MXU A;  3T4A C;  3ULP A;  3IKJ A;  2QW7 A;  4LFC L;  5LL6 X;  2WB1 G;  2L11 A;  4A3M G;  1D8L A;  3U9S A;  4DR2 L;  4H44 C;  4RKB A;  1PH4 A;  1HFG A;  3A7L A;  1GHK A;  2D5D A;  4ABN A;  5LMN W;  1PH1 A;  1NY4 A;  1NSN S;  3H0G G;  1VQ8 A;  4LF6 Q;  3D4R A;  2E76 C;  3TP7 A;  1VQ7 A;  4BY1 B;  4YWM A;  4IFD G;  2G9H D;  3M7G A;  1SYE A;  1VQ5 A;  3V2T A;  1OXX K;  3F2B A;  1R4P B;  1X3Q A;  3G71 A;  4LF8 Q;  1PV4 A;  3F8T A;  1JJ2 A;  1VMP A;  4LFC Q;  3DEP A;  3P20 A;  1Q8K A;  5C4J B;  4DR1 L;  2Q8R E;  3JAM c;  1Y8N B;  4Y7N B;  1IZ6 A;  2YU9 H;  2AWN A;  2N3S A;  3MFG A;  3SHL A;  4RGT A;  1U4P A;  3HOZ G;  4BY7 G;  1O7L A;  2NB0 A;  1S5F D;  4L6T B;  2PQA B;  1D7Q A;  1G51 A;  2ZTC A;  4CBV A;  3GTQ H;  1WCM H;  1JOO A;  1Q8I A;  2Z4H A;  4BA2 I;  3HOX B;  1YIJ A;  3BDO A;  4LF5 L;  1IBL L;  3LWE A;  1U4L A;  4LK1 C;  2PZW A;  1EIH A;  1EEF D;  4A3C H;  2L0C A;  3OIQ A;  5ELO A;  3CP0 A;  1C4Q A;  3E0J A;  5HGT A;  1KDB A;  1F2Z A;  1PZJ D;  3HOY G;  4JBW A;  2GN5 A;  1SE3 A;  4JI6 Q;  3PO2 B;  1WFQ A;  2FMC A;  2A6E C;  2WAQ G;  1GKH A;  4RG1 A;  2R7Z B;  4C3H B;  2R93 H;  4NMZ A;  1BR9 A;  1TT2 A;  4ID6 A;  4UDU C;  1LTB D;  3J7Z C;  4K0K L;  2JA6 B;  2XRS D;  1PRT B;  4Q0F A;  5KEE A;  1E2V A;  5M3M H;  2ENB A;  2C35 B;  4DV6 L;  4LF5 Q;  4RCN A;  1IBL Q;  1G29 1;  2V4D A;  2AKW B;  1Q86 C;  3DWA A;  3GQB A;  2CH4 W;  4C2M B;  3KF8 B;  1CI3 M;  1VQO A;  1FNV A;  1H9S B;  1YHA A;  3KYH C;  4I7Z C;  4JG2 A;  3CW2 C;  2UXC Q;  2XWB B;  1KDC A;  2LXJ A;  2PW7 A;  4JI8 Q;  5BR8 L;  1K9M C;  2CQA A;  4H0L C;  3F2C A;  4A3B H;  1QOH A;  1SNQ A;  1ZYR C;  2NVT B;  1HZB A;  2ASB A;  2H1E A;  3T1H Q;  3EFX D;  3K0X A;  3J7A 5;  5JVG 3;  1WTQ A;  1E2Z A;  1GXD C;  3RD4 A;  1KC8 C;  4X64 Q;  5ELD A;  4DV6 Q;  1LTR D;  2F03 A;  1W6J A;  4JI2 Q;  1H9M A;  1HJP A;  1MJC A;  4B9W A;  3HFZ B;  2VL6 A;  5LHY 1;  3ND8 A;  3H3V H;  2A69 C;  4P2C B;  1N36 L;  2K7V A;  5DM7 3;  1Y1W B;  4HID A;  1PZK D;  2TSS A;  2EYH A;  2ZXR A;  4JBJ A;  2MUY A;  4MTN A;  5BR8 Q;  3GTJ B;  4A3G G;  4QUC A;  2VNU D;  3PO3 G;  3K5O A;  2JA5 G;  2YV5 A;  3KF6 B;  5I9O A;  4V0B A;  2PW5 A;  2PMZ B;  2XWJ B;  3TDQ A;  5M3F B;  3PF5 A;  1I4R A;  5I6Y A;  1AZQ A;  3MXN B;  4P75 A;  4DNR B;  3S15 H;  2VUM G;  2B3G A;  5C3E H;  1U0L A;  4XYO A;  4JI5 Q;  3SDZ A;  3GTK B;  3G48 A;  2OQK A;  1J9O A;  1N36 Q;  4HJ9 A;  3A54 A;  3A8J E;  2F0T A;  4FXD A;  2A74 C;  1SYD A;  1EIY B;  3BVG A;  2QEX A;  2WB1 B;  3CCR A;  4G4K A;  4FO2 A;  1JE4 A;  1I4Q A;  5M5Y H;  2AQ3 B;  4A3M B;  1SRO A;  4R4Q A;  4DPG A;  3HOW G;  4A3J H;  2F4V Q;  1AH9 A;  4BXX G;  3FKI H;  3Q6S A;  3D0F A;  3NUC A;  3H0G B;  4ILW A;  3A8I E;  4J15 A;  3U9O A;  4IUR A;  4HCE A;  5FO7 B;  1TWH B;  4LUO A;  2Q2I A;  3H94 A;  2NWG A;  1K73 C;  1HA5 A;  2E2H B;  2XIW A;  4QY7 A;  4QIW E;  3NTH A;  1IW7 C;  2MQH A;  3S2D B;  2F0F A;  1JC7 A;  1FGB D;  3LGJ A;  1PA6 A;  1WTX A;  1TVX A;  4BBS G;  3T16 A;  1VQH A;  2QA4 A;  3HOZ B;  4BY7 B;  2QGQ A;  3CC4 A;  1JR0 D;  4GNX C;  4JI4 L;  2E2J B;  1V1O A;  2M2L A;  4QMG A;  3I4N B;  1PTO B;  3TS0 A;  1VQG A;  4ZYS A;  2PPB C;  1HRJ A;  2ZJR A;  2CW0 C;  1LO5 D;  4P73 A;  5J22 A;  4O2D A;  3GTO B;  2JN4 A;  2VXW A;  1AEX A;  1O7Z A;  4WRD A;  4PZ6 A;  4ZRZ A;  1G2T A;  3BG3 A;  4DV7 L;  4A3I G;  2B8F A;  3HOV H;  1VQL A;  3U50 C;  1TII D;  3VR2 A;  3MWY W;  1SE8 A;  3AYH B;  5EKL A;  1SNO A;  4CHT B;  1QIL A;  3DHQ A;  2D0P A;  4WJW A;  4YWK A;  3T51 B;  1BCP B;  1Z6H A;  4JI4 Q;  4QJF A;  3QR8 A;  2LXK A;  4FXG C;  1PRT F;  2F0U A;  1W6K A;  2HIV A;  2UU9 L;  3QB3 A;  3X3N A;  2K5V A;  3MXG A;  3SE0 A;  3HKZ E;  3UDG A;  2HT1 A;  3S1N H;  1ILP A;  4OO1 I;  3MA2 B;  2SOB A;  5JVH 3;  1CT1 D;  3UE0 A;  5IT9 E;  4ZK9 B;  2BA1 A;  5I9P A;  4DV7 Q;  2ZJQ A;  3NK9 A;  1XYI A;  1OXT A;  4IUN A;  4B3M L;  1HNZ L;  2PQE A;  1P8L A;  3OSO A;  4UP7 A;  2KHJ A;  2KOL A;  3HEJ A;  2RBM A;  4X6A H;  1PH3 A;  1II3 A;  4LF7 L;  1EYD A;  1HXY D;  5EAY A;  5C5L A;  1NTG A;  2DJG C;  2LMC B;  4JCV E;  3EA6 A;  1EZ6 A;  3AU7 A;  4WOR A;  1IHZ A;  1WJJ A;  1ASY A;  2PQA A;  3VR5 A;  3X3M A;  1E1O A;  3S17 B;  4IPH A;  5C4X H;  1EU3 A;  3CME A;  1E24 A;  1TWA B;  4B3M Q;  3I70 A;  3RZD H;  1YJ9 A;  5K36 G;  4A3G B;  2K01 A;  4A93 H;  2OT2 A;  1RL2 A;  1DOL A;  3PO3 B;  4LF7 Q;  3HG9 A;  4XYQ A;  2OXP A;  3EQL C;  1I5F A;  5TSS A;  1KAW A;  4AYB E;  2C5C A;  3GV6 A;  4RMF A;  1XPR A;  3TZD A;  1EWI A;  3SK6 A;  5C0X J;  2WAC A;  1C8C A;  3MFY A;  5C3W A;  5KGU A;  2VUM B;  1YNJ C;  1B9M A;  2ES2 A;  3GTG B;  4RGM A;  2EZV A;  3EVQ A;  1IKM A;  1SR3 A;  2L9H A;  4QL5 A;  2B63 G;  4JI0 L;  1I94 L;  2RKS A;  3NBI A;  2SDF A;  1EOV A;  1O7I A;  3CCV A;  2F3W A;  1VQN A;  5IT9 c;  4PMC A;  3CCL A;  3PUW A;  2R6G A;  5FJ8 G;  4Y7N H;  3HOW B;  1SNM A;  2NN6 H;  2MO1 A;  4A3F H;  1H9R A;  2Z4I A;  4OX9 L;  2F3I A;  2N49 A;  3Q22 A;  4KY6 A;  1ET6 A;  2YYZ A;  5J1Z A;  3GTM H;  2Q8I B;  1KRT A;  3HOX H;  4IQZ A;  4RGN A;  3TQY A;  5C4H A;  4DR6 L;  4ULL A;  1IL2 A;  4DK0 A;  4JI0 Q;  2AQ1 B;  3C1E A;  1EYG A;  3DUZ A;  4K6D A;  5FK9 C;  3CMA A;  3EIV A;  5JOB A;  2L55 A;  3I90 A;  5C0X H;  3PO2 H;  1ZKO A;  4AH6 A;  1G91 A;  3RZO B;  5FLM H;  1SYG A;  1PTO F;  3KF6 A;  2R7Z H;  2UUA L;  1M1K C;  2B8G A;  2BDO A;  2JA6 H;  1QCB D;  3I56 A;  1N9W A;  2E2I B;  2F0I A;  3UI2 A;  3MXN A;  1HUN A;  2RCF A;  4DR6 Q;  3GTP B;  3GO5 A;  4EX5 A;  1SRU A;  4BA1 I;  1SMY D;  5IYC H;  3M4O B;  4B3R Q;  4A3I B;  4U68 A;  3RN2 A;  4JI7 Q;  3JC6 6;  1NBW A;  2K32 A;  3I4M H;  3RN5 A;  3F2D A;  2DJF C;  4DUZ Q;  1L0Y B;  4CDC C;  1BCP F;  5AFW A;  4PNY A;  4PQX A;  2JXM B;  2NVT H;  4QGU A;  4CGY B;  2JE6 I;  1U9R A;  3NHH A;  1LT6 D;  2UUA Q;  3AB9 A;  2JA7 H;  5M5X H;  1F9P A;  1J8I A;  3U58 A;  1L2F A;  3MVV A;  1BBW A;  3K7A H;  4OWX B;  4A76 A;  3AMU A;  1DD2 A;  5E4W C;  1EU4 A;  4J6H A;  4TVA B;  2EYM A;  4OIK A;  4KJN A;  1RD9 D;  3EJI A;  4IFD J;  1TS2 A;  4DV0 L;  4K5V A;  4L8J A;  1JB3 A;  1TWC H;  2Q2H A;  3I2Z A;  2SNS A;  2OTL A;  5JJK A;  4F87 A;  5EPJ A;  4L5S A;  1WTP A;  3PF4 A;  3F1Z A;  2CVR A;  1UEA B;  3TSS A;  2QF7 A;  2RHQ B;  1LT5 D;  1HH2 P;  3WDN A;  5M3F H;  2Z8L A;  3VR6 A;  4BWG B;  1V9P A;  5FKA C;  4DU9 A;  2DY8 A;  3I91 A;  1UE7 A;  1K83 H;  1NR4 A;  1AE3 A;  3V96 A;  2UXD L;  2YTY A;  2R92 H;  3Q0A A;  1DOM A;  4FVM A;  4FXK C;  4DV0 Q;  2CWA A;  4N9T A;  4C3H G;  4A3E G;  2EE1 A;  1W3S A;  4IUV A;  2F0P A;  5FOB B;  4M8A A;  4R4T A;  1SMY C;  4DXF A;  4A3M H;  1BOS A;  2PMZ E;  5CV5 A;  4O42 A;  3HOU G;  2JQO A;  1JOR A;  3OHX C;  3AFP A;  1CHP D;  3SK5 A;  2KEC A;  5HUR A;  1MKH A;  1QE6 A;  4L5R C;  2OWO A;  2EJF C;  4LFB L;  1GVP A;  3L7Z C;  4LMQ D;  4IFD H;  2UXD Q;  2KUM A;  1I4G A;  1BBU A;  3BYY B;  3G7L A;  2A8V A;  1XMO L;  1HA6 A;  4HTH A;  2F0H A;  4ME3 A;  2WB1 E;  2NYZ D;  5CBE E;  3M4Q A;  4HED A;  2JJQ A;  2F0E A;  1BXT A;  3AFQ A;  3QOJ A;  1MGS A;  1SAP A;  4G7H C;  1DON A;  5T1I A;  3M3Y B;  5DEH A;  3K5L A;  2HHH L;  1DM0 B;  1V1P B;  1ICW A;  2LY7 A;  2DUD A;  3HOZ H;  1EFW A;  3VA7 A;  3A8K E;  4JI1 Q;  4LFB Q;  2WKD A;  1GM5 A;  3CXC A;  3J7A V;  2KCM A;  4CJ1 B;  3GTO H;  1D1I A;  5IGC A;  1QWY A;  3KBX A;  3BVZ A;  3PIO 3;  1MD2 D;  2L1B A;  1KLG D;  4X3S A;  1XMO Q;  1K8O A;  1JWS D;  2NUC A;  4KKS A;  2PZT A;  2EYF A;  3U4Z A;  1RCV D;  1UE5 A;  2NZO A;  4CKC A;  1A3V A;  4DR4 L;  3VYU A;  1P16 A;  2RHS B;  1HQM C;  1CKN B;  1ENF A;  2R7D A;  3ULL A;  3HOY H;  2B2T A;  2VW9 A;  1VF5 C;  4DK6 C;  3JAM L;  4GKK L;  5A2Q E;  4DV2 L;  3A74 A;  3GP7 A;  2KED A;  3EBE A;  4DN4 M;  2E5L L;  3FRP B;  4P74 A;  1TKW B;  2A6E D;  1XNQ Q;  1AN8 A;  1N32 L;  3MZ5 A;  3K81 C;  1TS5 A;  5L37 A;  4YIJ A;  5IP7 G;  1VQC A;  1Q1B A;  2VZA A;  3W2D A;  2I5M X;  2IHF A;  3C3L A;  3K58 A;  2K04 A;  1V8Q A;  1CSP A;  4DGZ A;  1PRT C;  1K3B C;  4DR3 L;  1PFN A;  3U4V A;  4A3K B;  2WAQ E;  2IJ0 A;  1MI2 A;  2NZ1 D;  5IGE A;  2ID0 A;  1E1T A;  3S1M H;  2PNR C;  2JA8 G;  4S3S A;  5A2Q L;  2G5D A;  4GOP B;  2JSO A;  3C46 A;  2FXQ A;  1XTC D;  2E5L Q;  2AMC B;  5C44 G;  1SFO B;  3RLF A;  2O5I C;  2NVY B;  1ZYR D;  2N88 A;  4BBR B;  1T5X D;  1IL8 A;  4X3K A;  4DR2 Q;  1A8V A;  1IXR A;  4LWC A;  5CGK A;  2O5J C;  1STB A;  4IUP A;  1J5E L;  2B2V A;  4F88 A;  2GVB A;  5M5W B;  3S1R H;  2E2D C;  2X6L A;  4DR3 Q;  3I4N G;  1PH9 A;  5I4D A;  1KAA A;  2RQX A;  4N9P A;  2RDH A;  4DV4 L;  1FYC A;  3MXP A;  4K8I A;  3CQZ B;  2A69 D;  1EFI D;  2JA5 H;  5LMU L;  3CRL C;  4C3J H;  5A35 A;  1F9S A;  2E8G A;  1Y1V G;  1VQD A;  3WOE A;  1HCZ A;  5EPK A;  1PDQ A;  2EPB A;  3CCJ A;  4DR1 Q;  4O1N A;  4IUU A;  4P72 A;  3PMF A;  2BOS A;  2RDG A;  1STA A;  3D4D A;  4HAE A;  4NXM L;  2EYJ A;  2QEJ C;  3KLR A;  1X65 A;  1FGU A;  4YCW A;  4C56 C;  4A3E B;  4K2K A;  1NCV A;  4FDB A;  4PMB A;  3NWT A;  1I3Q B;  3NQI A;  4LAA A;  3CU7 A;  4TRD A;  4DV4 Q;  5D3D A;  4OEM B;  5G3L D;  1YIT A;  4R4O A;  2K5D A;  3HOU B;  1RJT A;  4DR7 L;  4OIJ A;  4N8F A;  3K59 A;  3PUZ A;  4K8J A;  1JQY D;  2UUC L;  1F2M A;  1B50 A;  2PNH A;  2I5L X;  5IGF A;  5KYL A;  3A56 A;  4G7Z C;  3S14 H;  3VYR A;  1SYC A;  2MGS A;  4NXM Q;  1I50 H;  5F2D A;  5IYB G;  1XJV A;  2NVX B;  1VQE A;  3IFT A;  4IOC A;  1XNR L;  3W1G A;  4K0K Q;  1OXU A;  4X62 L;  3DMU A;  4JYA L;  3CCM A;  4BBS H;  1IYJ B;  1JWM D;  3BVM A;  4DR7 Q;  1IW7 D;  4RAU C;  1TS3 A;  1NMG A;  1PZI D;  1X9N A;  2UUC Q;  2F4I A;  2EY5 A;  3PCO B;  4C3I B;  3TBI B;  4AQY L;  1LM0 A;  5T1G A;  4RWS C;  1VS0 A;  2E2I H;  3P75 A;  3DWQ A;  5E4X A;  2DGY A;  1CK1 A;  2N8N A;  1MHW C;  1LV9 A;  4B3S L;  4UAI A;  1MIU A;  1X3F A;  2DN8 A;  3BZD B;  2CW0 D;  1XNR Q;  4LF9 L;  1Z9F A;  3OIP A;  3UDI A;  4JYA Q;  2F0K A;  1TWG B;  1XMQ L;  3KOJ A;  1VMC A;  1BF4 A;  3QO2 A;  4MZ9 A;  5I2X A;  1QVC A;  2A6H C;  1QG7 A;  4U67 3;  1KRS A;  1DGS A;  5CV9 A;  1XWE A;  3C1F A;  2RSO A;  3D6C A;  1EQQ A;  5IWA L;  3STB D;  2ZTE A;  4QB4 A;  2NVQ B;  2PI2 A;  4OXP A;  2ZXO A;  2MHV A;  2K52 A;  2CCZ A;  1TS4 A;  4JC0 A;  1TXY A;  2F0Q A;  3C2P A;  2RSN A;  4JW0 A;  3G6E A;  3OMG A;  4B3S Q;  1Q90 A;  2HDL A;  3NWS A;  1BCP C;  3FMC A;  4YHH L;  5H1S E;  4LF9 Q;  2D2C C;  1D5M C;  3E0E A;  1XMQ Q;  1B9N A;  1KD1 C;  3J81 c;  1X3P A;  1SND A;  5JJL A;  1S5D D;  1I6H B;  2K05 A;  4LUV A;  5IWA Q;  3S16 B;  1XX8 A;  2IPK D;  4KI0 A;  4LW1 A;  2EDG A;  2JA8 B;  5M3M G;  1K8G A;  1SBB B;  3KLW A;  3TME A;  4GN3 B;  1VQP A;  3S9W A;  2J0T D;  2I46 A;  3S2H B;  5C44 B;  3O13 A;  3FPP A;  2F1M A;  1EUJ A;  5FLX E;  1WTO A;  1NUC A;  3E5S A;  1VQB A;  4ZQ3 A;  5KYI A;  2ALY B;  3SK8 A;  1R9T B;  4YHH Q;  1BKB A;  4JI3 L;  1SE4 A;  2HQL A;  3ICE A;  3D31 A;  4A3B G;  3GTL H;  5HY6 A;  4DAY B;  1FL0 A;  2BCO A;  4KHP L;  1A3U A;  1EWH A;  4DR5 L;  4HMJ A;  5IYD H;  4POG A;  1EL0 A;  3D3R A;  1X56 A;  1XTD A;  2K50 A;  1SDF A;  2KA7 A;  2KVM A;  1CKN A;  1UAP A;  1PH2 A;  4DUY L;  2I07 B;  3LWU A;  3W1B A;  4DNI A;  3BDC A;  1PH7 A;  5CC4 A;  3HP3 A;  1Y1V B;  2C9O A;  1X55 A;  4K5X A;  3DLL A;  1SYB A;  2B2T C;  3STB C;  4ZUJ A;  4K2L A;  5D3I B;  4Q5V A;  2EQS A;  1RDP D;  3M7N A;  1A3T A;  2Q2T A;  4JI3 Q;  4XDX A;  3RMH A;  4KK7 A;  1YNX A;  1M4V A;  2LKV A;  3J81 j;  4X66 L;  2B63 H;  3J80 c;  4KHP Q;  1ROD A;  2B2W A;  1YNJ D;  3DXJ C;  3QG1 A;  3H6M A;  2F0O A;  5ELF A;  5CR3 A;  3TP5 A;  1V43 A;  5LL6 S;  2EXD A;  2PI2 E;  1PFS A;  2OEO A;  1NJI C;  4N8X 1;  4ZUI A;  1QB5 D;  3NSW A;  2VS1 A;  2X69 A;  1YVC A;  5ELC A;  4RHS A;  3I7F A;  1EYC A;  3R2I A;  3G6J B;  2GVA A;  3PGZ A;  4GOP A;  3KJO A;  4GS3 A;  1PMR A;  2CQO A;  4IPG A;  2D62 A;  3MEH A;  3VYT A;  4A3D H;  1EY6 A;  3CRK C;  4X66 Q;  4RCO A;  3BDL A;  3L9A X;  2UU9 Q;  3SXH A;  2EJM A;  3NQT A;  5CV4 A;  5FLX c;  3FKI G;  5IGD A;  5EPL A;  1EQR A;  1HZA A;  5JEA G;  1Z7T A;  2K03 A;  4UP9 A;  1GUS A;  4IJH A;  3ND9 A;  2B2V C;  4B3T L;  3KUP A;  3TP6 A;  2VQE L;  5IT9 L;  2F0V A;  1VQ9 A;  5DNF A;  5GAD C;  2KCN A;  1QUQ B;  4L63 B;  5JAV A;  1MBY A;  4F7X A;  5CV6 A;  4KN4 C;  1HNZ Q;  1EWC A;  2BE5 C;  1GUW A;  1D2B A;  1N8R C;  4OEL B;  2EXZ A;  4K5W A;  4EGV A;  2I0Q A;  4CKB A;  1JOQ A;  1N33 L;  1E7Z A;  2OTJ A;  3CC7 A;  3NPP A;  2YU9 B;  1BO0 A;  3PV0 A;  1Q82 C;  4X65 L;  2QCP X;  1C9O A;  1WD1 A;  4ALP A;  4NP5 A;  4LJZ C;  4B3T Q;  4BY1 H;  1NE3 A;  1WCM B;  1G6Z A;  4WJ4 A;  5HGQ A;  1Q7Y C;  4LFA L;  2UXB L;  4ZKC B;  5CBA E;  1HUM A;  1IBM L;  3ULJ A;  1U5K A;  3KF8 A;  1H9S A;  2R3Z A;  3HOV G;  5C4J H;  5GRO A;  2I5H A;  4RFB A;  1N33 Q;  4FYD A;  4HIM A;  5KNC A;  4DAM A;  1RHP A;  2Z6K C;  4QF4 A;  1E3P A;  1BQQ T;  1Z47 A;  4X65 Q;  1STG A;  3B6Y A;  1SYF A;  3M85 A;  1S4Z A;  4LNQ A;  3H09 A;  4P71 A;  1E22 A;  2R93 B;  2XVS A;  3A7A B;  3R3O A;  3T53 B;  5K5P A;  1K28 A;  2Z0S A;  3TS2 A;  1PYS B;  1U4M A;  3TZU A;  1LT4 D;  5M3M B;  3D6W A;  1IBM Q;  1I94 Q;  1K0R A;  2IY5 B;  3ERQ A;  1JB7 A;  4PV1 C;  2EIF A;  1H9K A;  2HCI A;  2B2U C;  4ME5 A;  1SNC A;  4I7A A;  4DV1 L;  4MHE A;  1PFB A;  4A3L G;  1CKO A;  1A62 A;  1D5X C;  4JBM A;  1KNA A;  5I2Y A;  2CWP A;  5KIX A;  1X3E A;  1PH8 A;  2M9V A;  4OX9 Q;  2Q8T A;  1GOZ A;  4C3H H;  3PIO A;  4A3E H;  4A3B B;  2ATW A;  4DV5 L;  5IGG A;  2WII B;  2RDF A;  3RLN A;  2ICE C;  1EOT A;  1B8A A;  1IYU A;  2EYP A;  3Q8D A;  3FHW A;  1RKN A;  2RVL A;  4HJ5 A;  4C2M H;  3W5O A;  5FO9 B;  5C4X G;  3I55 A;  3E9I A;  3NTI A;  3HKS A;  1G6P A;  2K6A A;  3WWV A;  1O78 A;  4A3K G;  1JE5 A;  2O2L D;  2RA4 A;  2NZH A;  3RUZ A;  4OO1 H;  4DFA A;  4A93 G;  2HQE A;  5D14 A;  4KN7 C;  4DV5 Q;  1RF2 D;  4UHV A;  5J39 A;  1PYW D;  5E7N A;  4BBR G;  3CAM A;  1CQV A;  1FR3 A;  2CH4 A;  3S15 B;  3Q24 A;  3CCS A;  5C3E B;  4TKO B;  2DY7 A;  2MJ8 A;  2AUK A;  2ZM6 L;  1Y1W H;  2RCN A;  4POF A;  3GTJ H;  2F52 A;  3BJU A;  2F0J A;  3CF5 A;  3PUV A;  4RKL A;  2ZJP A;  4I65 A;  1BUV T;  1AE2 A;  2K5W A;  2EOT A;  1ESF A;  1SMX A;  5IGB A;  5M5Y B;  1T5E A;  4X3T A;  1QNU A;  4IO9 A;  4A3J B;  1EY8 A;  1KDA A;  1TWG H;  3FP9 A;  4A3F G;  3FKI B;  2LS0 1;  5COR A;  4DAY A;  1VDZ A;  2VQF L;  1L1O B;  3A5Z B;  2A5H A;  4NW2 A;  4A75 A;  3CC2 A;  3KLS A;  2L5T A;  1LLR D;  1Q81 C;  3GTK H;  4FF2 A;  2K33 A;  2RF4 A;  2ZM6 Q;  1EEI D;  4B08 A;  4XT1 B;  5LMN L;  3QWN A;  5GQO A;  1CKM A;  4XQN A;  1TWF B;  1Q46 A;  1OXS C;  1U4R A;  3SVM A;  4PZ7 A;  3E9H A;  4YCV A;  3DEO A;  1RIP A;  1I4P A;  4JBK A;  5C0X G;  3H0G H;  5EGT A;  5FLM G;  2VQF Q;  2JYO A;  2KQ3 A;  4JV5 L;  4PMW A;  1TWH H;  2K5H A;  1GUG A;  1YJN A;  3LNN A;  2E2H H;  1K3R A;  1PRT D;  1UE6 A;  2IX3 A;  1Q12 A;  2B2W C;  1X32 A;  3L2P A;  3HKZ B;  4OHJ A;  3S2D H;  4FNF A;  5C44 H;  4HCS A;  3HGB A;  4E6I A;  1VQ4 A;  4KKU A;  1PH6 A;  4DKA C;  3HOV B;  5EQ0 A;  5C3X A;  1KHI A;  1JJC B;  4YWL A;  4GN5 A;  4GOP C;  1N34 L;  4BY7 H;  1VQ6 A;  3UE1 A;  4NDX A;  2E2J H;  1JMC A;  3I4N H;  4C3I G;  1PTO H;  2AUJ D;  4JV5 Q;  3CD6 A;  1H95 A;  4JOI A;  1YHB A;  5IP9 G;  2K5Q A;  3BS1 A;  4B9X A;  5M9O A;  4KKT A;  3S1N B;  2QDL A;  1EY0 A;  2D0O A;  2Y0S G;  2Z9H A;  1YI2 A;  4EQO A;  3OW2 A;  1QUQ A;  2XRQ D;  3I73 A;  3H15 A;  3T1Y L;  1K8A C;  4AIM A;  4EQN A;  2JEB I;  3K7U C;  4ZCK A;  1A2T A;  1ENC A;  2EY1 A;  1KTK A;  1ENA A;  3M9B A;  2HHH Q;  2TMP A;  4WFN 3;  3I4O A;  3J7Y W;  1N34 Q;  1B4O A;  3HS0 C;  5GAG C;  1DZ1 A;  1LTS D;  3H3V I;  5CV7 A;  2J4X A;  3QOL A;  1AFP A;  1ICF B;  4HSP A;  4XQQ A;  1OXV A;  2HDM A;  1D5Z C;  1LTL A;  2EY2 A;  3ZJY C;  1EY5 A;  1KLU D;  1KNE A;  4LF6 L;  3GD7 A;  3FPU B;  3ERS X;  1F9Q A;  1JWU D;  3TN2 A;  4EQ5 A;  4OL7 A;  3T1Y Q;  2R92 G;  5C4X B;  4OGQ C;  4DR4 Q;  2M00 A;  4IAL A;  3RZD B;  3IAY A;  5DAU A;  4IOA A;  1XPU A;  1L0W A;  2K1B A;  4GKK Q;  3R8B A;  5IYB H;  4DV2 Q;  2HCC A;  2N55 A;  4A93 B;  3I72 A;  2SEB D;  1C7Y A;  1GUN A;  1I4X A;  3A5U A;  3J81 i;  2WV6 D;  1N32 Q;  4NXN L;  1ET9 A;  3K8A A;  3S17 H;  5JJZ A;  3TRZ A;  1AZP A;  4DAP A;  1TWA H;  4DNT B;  1EIG A;  1HNX L;  2CHB D;  4ZKB B;  3OPO A;  1T9H A;  4H02 A;  1X6O A;  2Z6B A;  4A3G H;  1Y69 U;  1CSQ A;  2NTT A;  1UE1 A;  3E6Z X;  3PO3 H;  3SGI A;  2YTX A;  4ODG A;  3T13 A;  2A73 B;  4IPD A;  1S5B D;  4JI6 L;  2B2Y A;  4A3F B;  2BA0 A;  2QDB A;  4NXN Q;  4UP8 A;  3S1Q B;  3PIP A;  4WJ3 M;  2AQ2 B;  3NE5 B;  2VUM H;  1PTO D;  4MIU A;  3TEH B;  1J5E Q;  2MPM A;  4C1N K;  3GTG H;  3GTM B;  4XIG S;  2K5N A;  2F0W A;  3OWF A;  1HNX Q;  4M1U B;  2A6H D;  3BZK A;  1FVI A;  4KLK A;  1NR2 A;  3K0Y A;  3VR3 A;  1D6E C;  2WIN B;  1CZG A;  4CJ2 C;  1A15 A;  3DM1 A;  1CUK A;  5KNB A;  2A1A A;  4APV A;  3HOW H;  2UXC L;  5BN4 A;  5LMU Q;  2QKI C;  1X54 A;  4BXX H;  4JI8 L;  5CMD A;  4FF1 A;  4DK3 C;  3J80 i;  5C5M A;  1ZXT A;  1ILQ A;  3ER0 A;  1BCP D;  2Z6K A;  4XXE A;  4HJ7 A;  3MHB A;  4UY8 C;  1HTL D;  3J81 E;  2BH2 A;  3T1H L;  1WOC A;  3RR5 A;  4CDE C;  1AW7 A;  2L15 A;  2WFW A;  1LTT D;  1BNZ A;  4X64 L;  5J3B A;  2F0D A;  3K80 C;  4JI2 L;  1CZW A;  1PFM A;  2KCC A;  4TSS A;  1CTM A;  2WP8 J;  1A6X A;  2XN9 C;  3BZC A;  1WTH A;  1TY0 A;  2B2U A;  3I4M B;  3H91 A;  3RZO H;  1RTO A;  1YBY A;  3P7J A;  1YEZ A;  3K5M A;  4MN3 A;  4TQU S;  4IPC A;  2JA7 B;  5M5X B;  2EY6 A;  3J81 L;  2FMM A;  1L1O A;  3GTP H;  1EY9 A;  3K7A B;  1DCZ A;  3TP8 A;  2KBN A;  5JEA J;  3M4O H;  2Y0S B;  4A3I H;  1PTO C;  5IIF A;  4PZ8 A;  4X62 Q;  4JI5 L;  1VQK A;  1LUZ A;  4KD4 A; 
#chains in the Genus database with same CATH homology
 1EQR A;  1HZA A;  5JEA G;  1BBW A;  2UXC L;  4UP9 A;  3ULP A;  3K7A H;  4IJH A;  4LFC L;  2WB1 G;  4B3T L;  4OWX B;  2VQE L;  2VY3 A;  4A76 A;  4A3M G;  1WCM G;  1D8L A;  1VQ9 A;  3KJP A;  4TVA B;  5GAD C;  1B70 B;  4DR2 L;  1QUQ B;  4AQY Q;  3M4P A;  1PH4 A;  2F4V L;  1VQM A;  5LMN W;  4IFD J;  4DV0 L;  2K14 A;  1PH1 A;  3L0O A;  1NY4 A;  1HNZ Q;  1TWC H;  3H0G G;  2Q2H A;  3I2Z A;  1VQ8 A;  1N8R C;  2OTL A;  4LF6 Q;  5JJK A;  1WYD A;  4A3C G;  4HJ8 A;  1VQ7 A;  4L5S A;  4YWM A;  3PF4 A;  3F1Z A;  2I0Q A;  4IFD G;  4LF4 L;  1N33 L;  1E7Z A;  2RHQ B;  1VQ5 A;  1HH2 P;  2OTJ A;  3CCE A;  1KXL A;  1OXX K;  2MNA A;  1PH5 A;  3F2B A;  3CC7 A;  3G71 A;  4LF8 Q;  5M3F H;  4KHZ A;  2AWO A;  3PV0 A;  1Q82 C;  4X65 L;  1PV4 A;  1C9O A;  1YJW A;  3F8T A;  5FLX c;  3G4S A;  4ALP A;  1JJ2 A;  4LFC Q;  1V9P A;  2R93 G;  4B3T Q;  4BY1 H;  3GTG H;  1HZ9 A;  2KCT A;  1UE7 A;  1K83 H;  1NE3 A;  1Q8K A;  1AE3 A;  1EIF A;  2UXD L;  2YTY A;  4DR1 L;  4WJ4 A;  2R92 H;  5HGQ A;  1Q7Y C;  3JAM c;  4LFA L;  2UXB L;  1IZ6 A;  2YU9 H;  2AWN A;  2N3S A;  4DV0 Q;  2CWA A;  4PG3 A;  3ULJ A;  1IBM L;  3KDF B;  3HOZ G;  4BY7 G;  4GKJ L;  1U5K A;  4A3E G;  1W3S A;  2PQA B;  1D7Q A;  1G51 A;  2ZTC A;  4R4T A;  3GTQ H;  3HOV G;  4A3M H;  5C4J H;  3AEV A;  1WCM H;  2NN6 I;  5GRO A;  2I5H A;  2PMZ E;  4LF4 Q;  1N33 Q;  4BA2 I;  4HIM A;  3HOU G;  2JQO A;  4JOI C;  1YIJ A;  5GAE C;  4DAM A;  4LF5 L;  3AFP A;  2Z6K C;  4NB3 A;  1E3P A;  1IBL L;  1Z47 A;  4X65 Q;  2OCE A;  3NEL A;  1MKH A;  3B6Y A;  3M85 A;  4L5R C;  4LNQ A;  2OWO A;  4LFB L;  4A3C H;  1GVP A;  1TWF H;  3L7Z C;  2IX1 A;  4P71 A;  1E22 A;  1QVF A;  2KHI A;  5ELO A;  2UXD Q;  3CP0 A;  4DV3 L;  2Z0S A;  4GN4 B;  1BBU A;  1PYS B;  3HOY G;  3TS2 A;  4JBW A;  2GN5 A;  4JI6 Q;  2A8V A;  1OTC A;  1XMO L;  1IBM Q;  4GKJ Q;  1WFQ A;  1K0R A;  1QZG A;  1I94 Q;  2IY5 B;  4ME3 A;  2WAQ G;  3CCQ A;  1GKH A;  2WB1 E;  1JB7 A;  4MNO A;  4RG1 A;  3M4Q A;  2R93 H;  2H5X A;  2EIF A;  1S40 A;  2BH8 A;  2JJQ A;  3J7Z C;  4DV1 L;  4K0K L;  4A3L G;  1CKO A;  3AFQ A;  1A62 A;  4JBM A;  5C0X I;  2CWP A;  1S72 A;  5M3M H;  2A19 A;  2C35 B;  1GD7 A;  4DV6 L;  1X3E A;  2HHH L;  4LF5 Q;  1PH8 A;  1IBL Q;  1G29 1;  2DUD A;  4OX9 Q;  2AKW B;  1Q86 C;  1EFW A;  3HOZ H;  4C3H H;  3PIO A;  4A3E H;  2ATW A;  4R1J A;  3KF8 B;  4DV5 L;  4DR5 Q;  1YHA A;  3KYH C;  4JI1 Q;  4XTC S;  1VQO A;  4LFB Q;  3RLN A;  4JG2 A;  3CW2 C;  1B8A A;  1GM5 A;  2UXC Q;  3CXC A;  3NBH B;  2LXJ A;  2KCM A;  4DV3 Q;  4JI8 Q;  5FJ8 H;  3OYY A;  3GTO H;  5GAH C;  3M3Y H;  3Q8D A;  5BR8 L;  3FHW A;  1K9M C;  4DUY Q;  2IX0 A;  4HJ5 A;  3F2C A;  1XMO Q;  4A3B H;  3CPW A;  4C2M H;  3W5O A;  5C3E G;  3BU2 A;  5C4X G;  3U4Z A;  3I55 A;  2ZTD A;  3E9I A;  1HZB A;  1UE5 A;  2NZO A;  2ASB A;  3T1H Q;  3HKS A;  1G6P A;  1C0A A;  4DR4 L;  3J7A 5;  3K0X A;  1P16 A;  3WWV A;  2RHS B;  1KC8 C;  4A3K G;  1JE5 A;  1Y14 B;  4X64 Q;  1CKN B;  4DV6 Q;  2R7D A;  3ULL A;  3HOY H;  2NZH A;  4JI2 Q;  2UUB L;  3OTO L;  2VW9 A;  2HIX A;  1HJP A;  4A93 G;  1JT8 A;  4DK6 C;  4GKK L;  1MJC A;  4A3J G;  3HFZ B;  2VL6 A;  4DV2 L;  4DV5 Q;  3A74 A;  3H3V H;  1N36 L;  3EBE A;  4HIK A;  5E7N A;  4HID A;  2E5L L;  4A3L H;  4BBR G;  4P74 A;  5BR8 Q;  4JBJ A;  4MTN A;  1XNQ Q;  3CAM A;  2YTV A;  4A3G G;  1N32 L;  3K81 C;  2CKZ B;  2VNU D;  5IP7 G;  1VQC A;  1KQS A;  1Q1B A;  3S24 A;  3PO3 G;  4YCU A;  4OWW B;  2JA5 G;  2YV5 A;  3KF6 B;  3CCS A;  2VZA A;  2I5M X;  2IHF A;  2ZM6 L;  1Y1W H;  4QQB X;  1CSP A;  5AJ3 L;  3PF5 A;  2RCN A;  4POF A;  3GTJ H;  4DR3 L;  2F52 A;  3BJU A;  3U4V A;  3CF5 A;  5IY0 A;  3MXN B;  4GNX B;  3PUV A;  4P75 A;  4L5Q A;  2ZJP A;  3S15 H;  2Q2U A;  2WAQ E;  2UUB Q;  3OTO Q;  1AE2 A;  2VUM G;  2B3G A;  5C3E H;  4O0A A;  1SMX A;  1U0L A;  2ID0 A;  4JI5 Q;  1E1T A;  3S1M H;  3G48 A;  2JA8 G;  2OQK A;  4IJL A;  2V1C C;  4IO9 A;  1N36 Q;  4HJ9 A;  4GOP B;  2FXQ A;  1TWG H;  3FP9 A;  4A3F G;  1EIY B;  2E5L Q;  2AMC B;  5C44 G;  3RLF A;  2VQE Q;  2VQF L;  1L1O B;  3A5Z B;  2R7F A;  2QEX A;  4A75 A;  4A3K H;  3CC2 A;  3CCR A;  5M5Y H;  4DR2 Q;  1A8V A;  1IXR A;  1SRO A;  4LWC A;  5IYD G;  1Q81 C;  3NEN A;  3GTK H;  1VQA A;  4R4Q A;  4DPG A;  3HOW G;  4A3J H;  1J5E L;  2F4V Q;  2RF4 A;  3HKZ G;  1AH9 A;  4BXX G;  2MFI A;  2ZM6 Q;  2GVB A;  3FKI H;  1SFO H;  3S1R H;  1WI5 A;  2NVY H;  3D0F A;  5AJ3 Q;  4DR3 Q;  3I4N G;  1PH9 A;  4K0K Q;  5LMN L;  4BBR H;  5GQO A;  1PYB A;  1CKM A;  3RNU A;  4J15 A;  1MJE A;  4DV4 L;  2LSS A;  1Q46 A;  1OXS C;  4LUO A;  2Q2I A;  4PZ7 A;  2JA5 H;  1K73 C;  3E9H A;  5LMU L;  1BVS A;  5M5W H;  4YCV A;  3FKI G;  1RIP A;  4C3J H;  1S3O A;  4QY7 A;  4QIW E;  4JBK A;  5C0X G;  3H0G H;  5DLQ E;  3PUX A;  2E8G A;  2MQH A;  3UDF A;  4GLX A;  3A0J A;  1KL9 A;  5FLM G;  2VQF Q;  1Y1V G;  1VQD A;  2XGT A;  1XPO A;  4JV5 L;  4IFD I;  3LGJ A;  4PMW A;  1PA6 A;  3VDY A;  1TWH H;  3CQZ H;  2K5H A;  4BBS G;  4DR1 Q;  3CCJ A;  1YJN A;  1W2B A;  4LFA Q;  2UXB Q;  4P72 A;  2E2H H;  1K3R A;  1VQH A;  1UE6 A;  1Q12 A;  1QVG A;  2QA4 A;  4NXM L;  3L2P A;  3S2D H;  2QGQ A;  1X65 A;  1FGU A;  4YCW A;  3CPF A;  5C44 H;  4GNX C;  3CC4 A;  4FDB A;  4JI4 L;  3S1Q H;  1VQ4 A;  3PSI A;  1PH6 A;  1X3G A;  1VQI A;  4DKA C;  3TS0 A;  1VQG A;  4DV4 Q;  1JJG A;  2ZJR A;  4P73 A;  1YIT A;  4O2D A;  4R4O A;  4DR7 L;  1KHI A;  1JJC B;  4YWL A;  4GN5 A;  4PZ6 A;  4GOP C;  1N34 L;  4BY7 H;  4A3D G;  1HR0 L;  1VQ6 A;  3UE1 A;  3PUZ A;  1B7Y B;  2KEN A;  2E2J H;  1JMC A;  4DV7 L;  3I4N H;  1I3Q H;  2UUC L;  1UEB A;  1M90 C;  1L1O C;  2PNH A;  2I5L X;  4A3I G;  3CD6 A;  3HOV H;  4JV5 Q;  1H95 A;  4JOI A;  1VQL A;  3U50 C;  4B3R L;  1LYL A;  1YHB A;  2CFM A;  5IP9 G;  1SE8 A;  3HOU H;  3AYH B;  4JI7 L;  3S14 H;  4UPA A;  3KFU A;  4YY3 L;  2D0P A;  4AYB G;  4NXM Q;  1I50 H;  2JEA I;  4DUZ L;  2D0O A;  4HIO A;  5IYB G;  2Y0S G;  4YWK A;  1YI2 A;  1XJV A;  3PUY A;  1VQE A;  3OW2 A;  4JI4 Q;  4QJF A;  1QUQ A;  3T1Y L;  3H15 A;  4IOC A;  1K8A C;  1XNR L;  2LXK A;  3W1G A;  3UDX A;  4AIM A;  1OXU A;  4X62 L;  2JEB I;  4DV1 Q;  4JYA L;  2HIV A;  3K7U C;  3CCM A;  2UU9 L;  4BBS H;  3UDG A;  2K5V A;  2HT1 A;  3HKZ E;  3S1N H;  1IBK L;  1IYJ B;  4DR7 Q;  1Q1E A;  3M9B A;  2HHH Q;  4OO1 I;  3I4O A;  1NMG A;  1N34 Q;  1NMF A;  3UE0 A;  1HR0 Q;  2NVX H;  5GAG C;  1X9N A;  2BA1 A;  3IRB A;  3H3V I;  4DV7 Q;  2UUC Q;  2ZJQ A;  1V1Q A;  3PCO B;  1OXT A;  4AQY L;  2B29 A;  1OXV A;  1LM0 A;  3ZJY C;  1LTL A;  1A63 A;  1VS0 A;  2E2I H;  4B3M L;  1HNZ L;  1P8L A;  4UP7 A;  4YY3 Q;  3MEF A;  2AHO B;  2DGY A;  2KHJ A;  4LF6 L;  3GD7 A;  4BY1 G;  2N8N A;  4B3S L;  2IT1 A;  1MIU A;  1PH3 A;  4X6A H;  1X3F A;  4C3I H;  3ERS X;  3T1Y Q;  4EQ5 A;  4LF7 L;  1XNR Q;  4LF9 L;  2R92 G;  1Z9F A;  5EAY A;  1NTG A;  3UDI A;  4DR4 Q;  4JYA Q;  2N78 A;  5IP9 H;  4JCV E;  1XMQ L;  3KDF A;  3KOJ A;  4MZ9 A;  4NPS A;  1IBK Q;  1WJJ A;  1ASY A;  1QVC A;  2JK8 A;  2PQA A;  5ELN A;  3NEM A;  1KRS A;  1DGS A;  1E1O A;  4IOA A;  1XPU A;  1YZ6 A;  4IPH A;  1L0W A;  4GKK Q;  5IYB H;  5C4X H;  4L5T A;  4DV2 Q;  1EQQ A;  3CME A;  5IWA L;  1E24 A;  2NN6 G;  3STB D;  1C7Y A;  2ZTE A;  4R4I A;  4Y52 H;  2PI2 A;  4OXP A;  1VQF A;  1VCI A;  3A5U A;  1KIX A;  1HZC A;  2K52 A;  3J81 i;  3RZD H;  1YJ9 A;  4B3M Q;  1N32 Q;  2CCZ A;  2XTI A;  4JC0 A;  4NXN L;  5K36 G;  1TXY A;  3K8A A;  3S17 H;  4A93 H;  3G6E A;  1RL2 A;  4B3S Q;  3TRZ A;  4GLV B;  4YHH L;  3JAM i;  5H1S E;  1TWA H;  3HOX G;  4LF7 Q;  2NVQ H;  4LF9 Q;  1HNX L;  3E0E A;  1I5F A;  1XMQ Q;  1KD1 C;  1T9H A;  4H02 A;  1KAW A;  1X6O A;  4A3G H;  4AYB E;  4RMF A;  1CSQ A;  1XPR A;  1EWI A;  3J81 c;  5C0X J;  2K75 A;  1UE1 A;  2Y0S E;  5IP7 H;  3PO3 H;  5JJL A;  3SGI A;  2YTX A;  4LUV A;  2MO0 A;  5IWA Q;  4HJA A;  4KI0 A;  4LW1 A;  5M3M G;  2ES2 A;  1K8G A;  3KLW A;  3PO2 G;  4IPD A;  3EN2 A;  4GN3 B;  1SR3 A;  1VQP A;  4JI6 L;  4QL5 A;  2B63 G;  4JI0 L;  2R7Z G;  2BA0 A;  3DM3 A;  1I94 L;  4NXN Q;  4UP8 A;  1EUJ A;  1EOV A;  1O7I A;  3PIP A;  1I6H H;  4WJ3 M;  3CCV A;  1VQN A;  2JA6 G;  1VQB A;  1J6Q A;  2VUM H;  3TEH B;  3S16 H;  2ALY B;  4LUZ A;  5IT9 c;  1SLJ A;  4YHH Q;  1J5E Q;  3CCL A;  3PUW A;  2JA8 H;  2R6G A;  1BKB A;  5FJ8 G;  1A0I A;  4XIG S;  4JI3 L;  4Y7N H;  2K5N A;  3AQQ A;  2HQL A;  1PHJ A;  1HNX Q;  1HR0 W;  3ICE A;  3D31 A;  2MO1 A;  4A3F H;  3BZK A;  1FVI A;  4KLK A;  4A4I A;  3RLO A;  5LMN Q;  3S2H H;  4A3B G;  4OX9 L;  5IYC G;  3GTL H;  2F3I A;  2N49 A;  5HY6 A;  4DAY B;  1FL0 A;  4KHP L;  5JJI A;  4DR5 L;  1CUK A;  4JI1 L;  1UWV A;  1R9T H;  5IYD H;  4POG A;  2A1A A;  1X56 A;  2YYZ A;  1XTD A;  4APV A;  3GTM H;  5LMU Q;  3HOW H;  2K50 A;  3I4M G;  1X54 A;  1KRT A;  4BXX H;  3HOX H;  3TRE A;  3GDE A;  4JI8 L;  1CKN A;  3TQY A;  1PH2 A;  2JA9 A;  4DUY L;  4DK3 C;  4DR6 L;  1IL2 A;  3J80 i;  3W1B A;  4DNI A;  4OO1 G;  1PH7 A;  4JI0 Q;  3ER0 A;  1PVO A;  4OON A;  1FJG L;  1SN8 A;  3CCU A;  1X55 A;  2K4K A;  2Z6K A;  4HJ7 A;  1EYG A;  4UY8 C;  2JA7 G;  3DLL A;  4GLA C;  3STB C;  1YHQ A;  3CMA A;  2BH2 A;  3T1H L;  3EIV A;  2EQS A;  1HNW L;  1WOC A;  3M7N A;  1GO3 E;  3RR5 A;  2Q2T A;  4JI3 Q;  2L15 A;  2WFW A;  4X64 L;  2OQ0 A;  4R4C A;  5J3B A;  3PO2 H;  4AH6 A;  1YNX A;  1QZH A;  3J81 j;  3K80 C;  4X66 L;  1Y1V H;  5FLM H;  4JI2 L;  2B63 H;  3KF6 A;  2R7Z H;  3J80 c;  5IE8 A;  4KHP Q;  2UUA L;  1M1K C;  2WP8 J;  1Y1W G;  2JA6 H;  3I56 A;  1N9W A;  3BZC A;  1V43 A;  2EXD A;  2PI2 E;  1PFS A;  4GNX A;  1NJI C;  1XNQ L;  3RZO H;  4DR6 Q;  1ASZ A;  1YBY A;  2VS1 A;  3GO5 A;  1YEZ A;  1YVC A;  1SRU A;  4EX5 A;  4BA1 I;  1FJG Q;  5IYC H;  4B3R Q;  3I7F A;  2GVA A;  4TQU S;  3PGZ A;  4GOP A;  5M3F G;  4IPC A;  3RN2 A;  4JI7 Q;  3JC6 6;  1NBW A;  4GS3 A;  3KJO A;  1HNW Q;  2CQO A;  1VQJ A;  4IPG A;  4OWT B;  3I4M H;  1L1O A;  3RN5 A;  2D62 A;  3F2D A;  4DUZ Q;  4A3D H;  2IHE A;  3GTP H;  2KBN A;  5JEA J;  3M4O H;  4X66 Q;  4A3I H;  2NVT H;  4QGU A;  4PZ8 A;  2JE6 I;  4X62 Q;  2UUA Q;  2UU9 Q;  4JI5 L;  1VQK A;  4LF8 L;  2JA7 H;  5M5X H;  1LUZ A;  3U58 A;  1L2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...