2VQFQ

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqfQ00
1FL0A 2A19A 4A3GH 4A3BH 5C4XH 2E5LL 3W1GA 3CPFA 4O0AA 4AYBE 4IFDI 1KXLA 2JQOA 1JJGA 2Y0SE 3ULPA 5JEAG 4A75A 1EQQA 1N32Q 5GAHC 2NZHA 3OW2A 1I94L 3NELA 4LFCL 3HOWH 3HOVG 2JA7H 1HR0W 4UP9A 1Q7YC 3M4OH 4UY8C 3RR5A 3DM3A 3ULJA 5H1SE 3G4SA 3M3YH 2MO0A 2E8GA 4JV5Q 3S1NH 1JJCB 3FP9A 4DV4L 4LNQA 1YZ6A 1N36L 5HY6A 1UEBA 3J81c 2AWOA 3PUZA 3GTQH 4GNXB 5IP9G 1X65A 5K36G 4A3LH 1K83H 4B3TL 3UDGA 1X3FA 2CQOA 3K8AA 4A3KH 5C3EH 2ZTEA 4HJAA 1YHBA 1GO3E 1GKHA 4DV7Q 1E1OA 3LGJA 1PH5A 4RMFA 3NENA 1VQHA 4DR6Q 3K7UC 2D62A 3I2ZA 4A3FG 3CP0A 2UXCQ 2K4KA 4DR4L 1SFOH 5IYDG 4LFBL 1NE3A 3HOVH 4PZ8A 2ZTDA 1HZAA 1Q1EA 2R7ZG 1SLJA 3PO2G 2A8VA 4LF5L 2PQAB 3GD7A 1CUKA 1N9WA 4YCVA 3EN2A 4Y7NH 2E2IH 3IRBA 4OWTB 4DR7L 1Q46A 1K3RA 4QL5A 1HNXL 4DR3L 1TWGH 4IPDA 4POFA 2UUCQ 5IP9H 2HHHQ 2CWAA 1VQPA 4PMWA 1SMXA 3OTOQ 4NXMQ 4IJLA 3H0GG 2I5MX 5HGQA 2WAQE 3L2PA 3J7A5 1A63A 2OQKA 3CCSA 3MXNB 4GKJL 1B70B 2UUBL 1J6QA 3CD6A 2K5NA 1VQJA 4LWCA 1W2BA 4JI4L 1Q81C 4A3FH 3MEFA 4OX9L 2K52A 4A3JG 1Y14B 3GTOH 4DUZL 2UUAL 5IYDH 2ALYB 4LUOA 1IBKL 1JB7A 1YBYA 2WFWA 1A62A 1R9TH 1QZHA 4JI5Q 1XNRQ 4JBKA 4L5TA 3FHWA 4A3DG 3PO2H 3Q8DA 3CCRA 1VQCA 2F4VL 4IJHA 2H5XA 3CXCA 2ZTCA 4B3SQ 1SE8A 1PH8A 2UXDQ 2MQHA 3RLNA 2L15A 4JI8L 2LSSA 4IFDJ 4X62L 5AJ3Q 2YTVA 4IPGA 3G71A 3GO5A 3S2DH 1YI2A 1N33L 1CKNB 1KC8C 3M9BA 3U50C 2RF4A 2QGQA 1NMFA 1QVFA 2CKZB 1X55A 5IE8A 2EQSA 3H0GH 4LW1A 3RLFA 1V9PA 1A0IA 4UP7A 1B8AA 3RN2A 3S1RH 4MZ9A 4LFAL 4WJ3M 1JT8A 1A8VA 4A3EG 5JJLA 4H02A 2I0QA 1Q82C 4JI3Q 3TREA 1YIJA 2NVQH 4UP8A 1H95A 2ZJQA 3A5UA 5IYCG 4A3JH 2LXJA 3NEMA 5LMNQ 4DV3Q 1J5EL 4LF7Q 5BR8Q 4R4QA 4DR1Q 4DR5Q 3PF5A 3PV0A 3J80c 2KCTA 3AFPA 4A3DH 3RLOA 3S16H 4YCUA 2C35B 4DV6L 1PH9A 2VUMG 4BY7G 2E2HH 2OTJA 1JJ2A 1AH9A 3UDXA 3TEHB 5IYBH 3KDFB 3HOXG 1D8LA 1VQIA 5C0XG 4GOPA 1PH1A 3HOYG 2IY5B 4LFBQ 4PG3A 4MNOA 1S72A 1L0WA 4NXNL 4P71A 3M4PA 1XMQQ 2VQFQ 1V43A 2IX1A 3K7AH 3KFUA 1VQ4A 4LF8L 3BZKA 4X64Q 1QUQB 4R4CA 1K73C 4B3RL 2RCNA 4A3EH 2OQ0A 3TRZA 4A3CH 1IL2A 1EOVA 4AIMA 3CCUA 4HJ5A 1KQSA 4JI1L 4JI7Q 2Z6KC 2Q2UA 2JA8G 1M90C 1HZBA 3CF5A 3BZCA 4UPAA 3UDIA 5IYCH 4DUYL 1X9NA 4GLXA 5JJKA 4JBWA 2Q2TA 1QVCA 1OXUA 3D31A 3STBD 5IY0A 4OXPA 5LMUQ 3S15H 2D0OA 1D7QA 4GKJQ 1VQ9A 2UUBQ 4JOIC 3I4MG 1AE2A 2YU9H 2VUMH 4EX5A 4BY7H 1TWHH 3GTJH 4KLKA 4GNXA 1PH4A 2B63G 3HOXH 1VQAA 2AWNA 1C9OA 3ER0A 3CC7A 3HOYH 1PVOA 3UE0A 3J81j 1LM0A 4NPSA 4QIWE 2GVAA 4JI0L 2HT1A 1P8LA 4DV0Q 3I56A 1E3PA 3PIOA 4HJ9A 2YV5A 1PH7A 2N3SA 2PI2E 3S24A 1HNZL 4GN4B 1QZGA 4DR2L 1VQEA 1V1QA 4LF6L 1XMOQ 3ERSX 4HJ7A 1K8GA 4LF9L 4JG2A 1IYJB 1X56A 3E9HA 2VQEQ 3J7ZC 3F2CA 1PH2A 2JA8H 4YY3L 1X6OA 2OTLA 4JBMA 2VNUD 2ATWA 3L0OA 1IXRA 4JC0A 1HZCA 4PZ6A 3BJUA 4BA2I 2PNHA 2JA6G 4OO1I 1IBMQ 3RN5A 3PUYA 1I50H 3CPWA 3JAMc 1VQBA 4AQYL 4B3ML 2JEAI 4R4IA 3I4MH 2UU9Q 3FKIG 2DUDA 3ZJYC 1MJCA 1BBWA 2EXDA 1GD7A 1L2FA 5GADC 1ASYA 3CC4A 2B63H 4JYAL 5GQOA 2ZM6L 3CMEA 3GTMH 3L7ZC 4X66L 3F1ZA 4JI2Q 3CCJA 1YJ9A 4QQBX 4P73A 2BA0A 1L1OC 2HIXA 3E0EA 2WB1G 3U4VA 1JE5A 3PF4A 4DNIA 4YWMA 3M4QA 4L5SA 1OXSC 4DV6Q 1N34Q 5M5YH 3K81C 1UE6A 3T1YQ 3KJOA 4LF4L 4GKKQ 1VQOA 4DV2Q 1IBLL 3AQQA 2Q2HA 4QGUA 5IWAL 3WWVA 5JEAJ 1TWCH 3GDEA 4DV5L 4DV2L 3S17H 1HNWL 2K50A 2UXBQ 3CC2A 4OO1G 3T1HQ 5M5XH 4X65L 1TXYA 3EIVA 4K0KL 1XPOA 2E2JH 2JA6H 2GVBA 3F2DA 2D0PA 1AE3A 3HKZG 3PUXA 2OWOA 1EUJA 4C3IH 5JJIA 3FKIH 1KHIA 1NY4A 1XTDA 4R1JA 1CKNA 4NB3A 1E7ZA 1L1OB 3H3VI 1HR0Q 2AKWB 2R7FA 4P75A 4YHHQ 2MNAA 4O2DA 3I55A 1DGSA 3CCMA 2E5LQ 2NVYH 4KHPL 3PUWA 4DV1L 1PV4A 3S2HH 3HFZB 2IHFA 5IYBG 1BKBA 2YTXA 4GNXC 1VQ7A 1RIPA 3GTPH 2JJQA 4OWWB 4L5QA 2R93G 1I94Q 5C0XI 4LFCQ 1WCMG 2VZAA 1CKMA 1N32L 1KAWA 2JEBI 1PA6A 1VQMA 3CCVA 4A3IG 3B6YA 2NN6I 4GLVB 3S1MH 1WI5A 4DAMA 1X54A 4A3CG 4DV4Q 4JV5L 4OWXB 4IPHA 4IPCA 4A76A 1N36Q 3I4OA 5E7NA 1HJPA 3W5OA 4B3TQ 1Y1VG 3TQYA 4LF9Q 4BA1I 5FLXc 1VQLA 1YJNA 1WFQA 4JCVE 2K5HA 2VW9A 1E1TA 4XTCS 1G291 2NVXH 4P74A 1QUQA 1UWVA 1YITA 4YWLA 2VS1A 1MKHA 1FJGL 1LUZA 4DV7L 4KHZA 1EQRA 2I5HA 3KLWA 2QA4A 4DR4Q 2BA1A 3CAMA 2F3IA 4DR6L 4TQUS 2R93H 1WCMH 4X6AH 2UXCL 2NN6G 3U4ZA 5FJ8G 3KF8B 4PZ7A 4A3IH 1HR0L 1LTLA 4LF5Q 3STBC 3ICEA 4BBSG 4DR7Q 2K5VA 1LYLA 1Q12A 3KOJA 1HNXQ 1XNQL 1BVSA 3PIPA 3UDFA 4DR3Q 2NZOA 1OTCA 1S40A 1EFWA 1EIYB 1IBLQ 4ME3A 3H3VH 1W3SA 1VQGA 1PFSA 1KRTA 3S14H 1Y1VH 5IT9c 1VQDA 4DAYB 1CKOA 1SROA 2IX0A 2MO1A 3OYYA 1OXTA 2GN5A 2K14A 4EQ5A 4IOCA 2RHSB 2HHHL 1XPRA 1VQ6A 3OTOL 4NXML 4ALPA 1UE7A 4IOAA 2Z0SA 3RZDH 2Z6KA 2IHEA 5EAYA 2AMCB 1X3EA 1UE1A 1HH2P 1I3QH 1SN8A 1TWAH 1K8AC 4JI4Q 3K80C 1HZ9A 4P72A 4DK6C 3H15A 4OX9Q 4DUZQ 2UUAQ 3KF6B 4BBRG 2B29A 3RZOH 4AYBG 1IBKQ 4DK3C 1VQFA 1Q1BA 3GTGH 1Z47A 5FJ8H 1SR3A 2XTIA 4GN5A 1C0AA 1OXXK 2F4VQ 1XNRL 1CSPA 4GS3A 4HJ8A 3RNUA 4R4OA 4BBSH 4JBJA 4J15A 3E9IA 4JI8Q 1FVIA 3CCLA 1NMGA 2I5LX 4QY7A 4X62Q 4IO9A 2KCMA 2ID0A 4B3SL 4POGA 2KHJA 2UXDL 4RG1A 1N33Q 2N78A 2BH8A 5AJ3L 2DGYA 3NBHB 1P16A 3I4NG 2PQAA 5C0XJ 2R92G 1EIFA 4BY1G 2MFIA 4A4IA 4LFAQ 1YHAA 1UE5A 3GTKH 1BBUA 2CFMA 2N49A 4KI0A 1M1KC 1GM5A 3U58A 4JI3L 5IP7G 4JI6L 1KD1C 4BBRH 1J5EQ 1EYGA 1WYDA 1T9HA 5LMNL 4DV3L 3K0XA 4LF7L 4APVA 5BR8L 4DR1L 4DR5L 2FXQA 2RHQB 2VL6A 2ZJRA 4IFDG 2V1CC 2AHOB 4A3MG 3GTLH 1FJGQ 2UUCL 2BH2A 1YJWA 1NBWA 1GVPA 3VDYA 1B7YB 3UE1A 1L1OA 2WB1E 4R4TA 4YWKA 1PYBA 2B3GA 2JA9A 2EIFA 4NXNQ 1O7IA 4L5RC 5LMNW 3I4NH 2R92H 1Z9FA 4BY1H 2HIVA 2YTYA 3KJPA 3HOZG 4LF8Q 1XMQL 3J81i 5GAEC 2VQFL 1K9MC 1WOCA 3ULLA 1PYSB 4DPGA 4B3RQ 4A93G 1MJEA 2LXKA 3M85A 4JI1Q 4C2MH 2WP8J 4X64L 2JA5G 1XNQQ 1XJVA 2KHIA 2WAQG 3PUVA 3A5ZB 3CCEA 2ASBA 1IZ6A 5IP7H 1KL9A 2VY3A 1I5FA 1Q8KA 4DUYQ 4JI7L 2QEXA 1YHQA 1Y1WG 3HKZE 2HQLA 2JE6I 3JAMi 3G48A 3JC66 1U0LA 1OXVA 4LUVA 2PMZE 1S3OA 1Q86C 3PO3G 5C44G 4XIGS 5LMUL 4A3MH 4LUZA 1C7YA 3TS2A 5FLMG 1CSQA 1JMCA 1G51A 3DLLA 3HOUG 1VS0A 3EBEA 4YCWA 4JI0Q 3CW2C 5GROA 1FGUA 1TWFH 3D0FA 1RL2A 5ELNA 4GN3B 3HOZH 5DLQE 3A74A 3AFQA 3KDFA 2A1AA 2R7ZH 3I7FA 3G6EA 1HNZQ 4A93H 3AYHB 3CCQA 2Q2IA 4DV0L 2OCEA 4DR2Q 4Y52H 2JA5H 4QJFA 4LF6Q 2NVTH 3F2BA 1G6PA 2JK8A 4YY3Q 4HIMA 1XMOL 2CCZA 2VQEL 3M7NA 1Y1WH 2PI2A 2ES2A 1NTGA 1PHJA 1VQ5A 3A0JA 5M3MG 1KRSA 1VQKA 5M3FG 1YNXA 1N8RC 4AQYQ 4B3MQ 1IBML 3PO3H 5C44H 4WJ4A 5C4JH 2KENA 3HKSA 5FLMH 4JYAQ 4C3HH 2ZM6Q 2UU9L 3TS0A 4MTNA 4JI6Q 1XPUA 2K75A 4X66Q 3HOUH 3BU2A 1E22A 1VCIA 3SGIA 5M5WH 5GAGC 1E24A 2YYZA 3KYHC 4GOPC 1PH3A 4BXXG 4A3GG 4JI2L 4A3BG 3PGZA 4C3JH 5C4XG 4DKAC 1I6HH 2CWPA 2R6GA 1YVCA 4LF4Q 3CMAA 3KF6A 1SRUA 1N34L 2XGTA 2F52A 3T1YL 3W1BA 4GLAC 5IWAQ 2ZJPA 1X3GA 4DV5Q 1PH6A 3HOWG 1KIXA 4GKKL 1VQ8A 1HNWQ 2JA7G 2R7DA 4X65Q 3F8TA 3CQZH 5ELOA 4K0KQ 2UXBL 1QVGA 1VQNA 3T1HL 1NJIC 2N8NA 1ASZA 5M3MH 3S1QH 4HIOA 5M3FH 4AH6A 1K0RA 5J3BA 3PSIA 3J80i 1EWIA 1MIUA 1U5KA 4OONA 4GOPB 4A3LG 4BXXH 3PCOB 2IT1A 2Y0SG 4FDBA 4JOIA 1YEZA 2KBNA 4TVAB 3AEVA 1WJJA 4A3KG 4JI5L 5C3EG 4HIDA 4DV1Q 4KHPQ 4HIKA 4YHHL
chains in the Genus database with same CATH superfamily
4F7XA 5C4XH 3W1GA 3BYTB 1PFMA 3L9AX 2Y0SE 1ET9A 4A75A 3BVGA 4OIJA 3OW2A 1SNOA 1LTAD 1I94L 2F0MA 3HOWH 3P7JA 3D8GA 1SYGA 1EY6A 4B9WA 2MO0A 3A7LA 5M9OA 1LT4D 1JJCB 4DAVA 2FMCA 3FP9A 5ISRA 4LNQA 1N36L 3J81c 4IUPA 1BCPC 5LL6S 4GNXB 3EQLC 4A3LH 4QB4A 1K83H 1X3FA 2PMZB 1D5MC 4OIKA 1XTCD 3FPUB 2NYZD 3J80L 4DV7Q 1K8OA 1B4OA 3LGJA 2JN4A 4A3FG 2UXCQ 4DR4L 2QCPX 1SFOH 2OF1A 4LAAA 1NE3A 2M2LA 1JWSD 2ZTDA 4KJOA 1SSOA 2R7ZG 1SLJA 3PO2G 4RAUC 2A8VA 3CKIB 3R93A 1KTKA 2PQAB 3GD7A 1NR4A 4DR3L 1TWGH 4IPDA 1LO5D 3QR8A 4TRDA 5A35A 3DEOA 4RGOS 4NXMQ 2PPBC 2I5MX 2PO4A 2WAQE 2A73B 2VB3X 3CD6A 1K3BC 1TWAB 4A3FH 4K6LA 2XIWA 1U4RA 1Y14B 4DUZL 2UUAL 3RZOB 2ALYB 1R9TH 3GTGB 3FHWA 4A3DG 3PO2H 4IJHA 2ZTCA 1BNZA 2MQHA 2L15A 4JI8L 2ZXPA 2F3VA 4DU9A 2EYMA 4RKBA 2XRQD 5CGKA 3M9BA 3OWFA 1QVFA 4NMZA 2CKZB 1X55A 2EQSA 3S1RH 2IW3A 1V9PA 5A2QL 4WJ3M 4A3EG 2MGSA 1YIJA 4FXDA 4LJZC 3GP7A 1I4RA 4J8QA 2LXJA 4DV3Q 3T4AC 4LF7Q 5BR8Q 1A15A 3MHBA 3PF5A 1F2LA 4ME5A 4A3DH 2DY8A 1PH9A 1FGBD 1GUSA 3UDXA 5IYBH 1PH1A 3KDFB 4FYDA 1KABA 5C0XG 5I6YA 4LFBQ 3VR4A 1L0WA 3HGBA 1FNVA 3M4PA 1V43A 2R92B 4BY1B 4H13C 2EYLA 4X64Q 4R4CA 2RCNA 4A3EH 1TVXA 3CCUA 3IAYA 1M90C 4JW0A 1HZBA 5EKIA 3CF5A 1EOTA 1WTHA 2WV6D 1QVCA 2F0JA 2F0WA 5LMUQ 3S15H 5DM63 4GKJQ 1O80A 1RODA 3P20A 5E4XA 2JP1A 4A3MB 1PH4A 1T5XD 5C0XH 3K6OA 1SJED 4NPSA 3J81j 4QIWE 1E3PA 3PIOA 3HOZB 1STBA 3S24A 4CJ0B 1QZGA 4LF9L 1K8GA 2JA5B 4CDFC 5EKKA 5CMDA 5E4WC 3J7ZC 3HRZC 4ZLTF 4YY3L 3MVVA 2O5JC 2PNRC 2NVXB 4PZ6A 1WD1A 4KY6A 1IBMQ 1I50H 3CPWA 2MP1A 3JAMc 1ENAA 3M4YA 4AQYL 4B3ML 3EJIA 4C3IG 1B3QA 3FKIG 2KVMA 5C44B 1BBWA 1EY5A 3CC4A 1BXTA 1L2FA 3BDLA 4JYAL 4C3HB 3SEBA 2F0HA 5M5WB 5KYLA 1BCPB 3QOJA 1QILA 1VF5C 1N34Q 1RTNA 1I6HB 1LTSD 3K81C 1G2SA 3T1YQ 3K0YA 2IY5B 5IWAL 1TWCH 1I6VC 1JWUD 4E6IA 5EPJA 5IT9L 4OO1G 1TT2A 3QOLA 5M5XH 4X65L 3CQZB 1XPOA 1MSGA 4RCOA 4DK1A 2D0PA 1AE3A 1Q3LA 3HKZG 3PUXA 4C3IH 1QB5D 2B2YA 3FKIH 4WORA 3K59A 1CKNA 1E7ZA 2D9UA 1YNNC 1ILPA 3FRPB 3I55A 3CCMA 4DV1L 1PV4A 2FINB 1CZGA 1GHKA 1O78A 2WACA 1VQ7A 4X3KA 4L5QA 2F0KA 2F4IA 5EKLA 2JEBI 2E76C 5EPKA 1STYA 1VQMA 1V1OA 4OO1H 1WI5A 4DAMA 1CQVA 1LTRD 4OWXB 3S1NB 3I4OA 4R8NA 1EY0A 1YNJD 3SK6A 5E7NA 5KRUA 2RBMA 3TQYA 3OIPA 4BA1I 1WFQA 4HR7B 1E1TA 1ESRA 4P74A 1GUTA 1QUQA 2A74C 3C1EA 2VS1A 1LUZA 4DV7L 1B2TA 2XNAC 2QA4A 5KYIA 3GQBA 4KD3A 4TQUS 1M4VA 2E2DC 2UXCL 4DK0A 4PZ7A 1LTLA 4LF5Q 3STBC 3A8JE 2K5VA 1LYLA 3KOJA 1OTCA 1D5XC 2E2IB 1IBLQ 2SNMA 4ME3A 1U4LA 4RFBA 3VYTA 1KRTA 3H3VH 1C4QA 4DV2Q 1SROA 2IX0A 5EGTA 4IOCA 2LFNA 1ICFB 4FNFA 2CW0C 2PW7A 1Z7TA 1EIHA 4NXML 1FNWA 2AMCB 1R4QB 1E2ZA 1HH2P 1TWAH 4JI4Q 4OX9Q 4DK6C 3H15A 3RZOH 3TP5A 4K5WA 4G7ZC 2AQ1B 4DK3C 1VQFA 1Q1BA 3GTGH 4F88A 4EQPA 4K5VA 3OOCA 4ILWA 3A7AB 2G9DA 4S3SA 3CCLA 1SEBD 4X62Q 4POGA 4IO9A 1EEID 2CH4W 2N78A 2G9HD 4DXGA 4X3UA 2R92G 4K14A 4BY1G 2MFIA 1WTOA 4EQOA 2KEDA 1UE5A 1LABA 1BBUA 3H0GB 1C8CA 1F2MA 5D65A 4DV1Q 5IP7G 3U9OA 3GV3A 1J5EQ 1WYDA 1GUNA 4A3JB 4DV3L 1SYDA 4LF7L 5BR8L 4UAIA 2ZJRA 4IFDG 4A3MG 2M9VA 2RKSA 3AB9A 3UE1A 1UEAB 1PLFA 1PYBA 1SE2A 4G7OC 2R92H 4BY1H 1NR2A 3KJPA 3HOZG 4CKEA 3J81i 5ELCA 4ZUJA 1MJEA 3M85A 4JI1Q 4C2MH 4X64L 2JA5G 1XNQQ 2KHIA 2LS01 2ASBA 1IZ6A 5IP7H 2VY3A 3FMCA 5I4DA 4KV6A 3DWPA 3G48A 2F0EA 2A6HC 2AUKA 3DWAA 1S3OA 1EEFD 3K58A 5C44G 4XIGS 5LMUL 4Q0FA 4A3MH 4IFDH 1WTRA 3D4DA 4C3HG 1JMCA 1G51A 2VUMB 1TWHB 4KN4C 3TZUA 3HOXB 3P1HA 3HOYB 4C1NI 4C56C 2L12A 4KJNA 5IGFA 2Q8TA 3HOZH 4ZYSA 3AFQA 2MHVA 3I7FA 1HNZQ 3AYHB 1PFNA 4Y52H 3A8IE 2JA5H 2DNCA 4OL7A 5EQ0A 1G6PA 1SYBA 2CHBD 2JA8B 2ES2A 4XT3B 2J7ZA 3D4WA 1KRSA 1MD2D 1VQKA 4QCLA 1CQFA 5D14A 1IBML 5C44H 1DM0B 1VDZA 2K33A 2KENA 3CRLC 4C3HH 2ZM6Q 1XPUA 3N6RA 1SFOB 1H9JA 4IALA 4MHEA 1VCIA 5CBEE 2B63B 5M5WH 2B2TC 1HRJA 3KYHC 4GOPC 2RDFA 2L9HA 1HUNA 2ZXOA 4NKLA 1I6HH 2R6GA 4LF4Q 3KF6A 1KLGD 1N34L 2XGTA 3T1YL 4ID6A 4GLAC 4JK1C 1X3GA 2VB2X 5LHY1 2EJMA 2R7DA 2L55A 3F8TA 3CQZH 4K0KQ 1QVGA 4ABNA 1NJIC 3MZ5A 1AN8A 4DXFA 1ASZA 2H1EA 4OELB 1BBXC 3DMUA 3NUCA 3CU7A 3NSWA 1K0RA 1UNSA 5J3BA 3PSIA 1EWIA 1MIUA 1O7ZA 2F0FA 3NBHA 2HQEA 4FDBA 4N9PA 3KBXA 3AEVA 4JI5L 4HIDA 4GNXC 4HIKA 2RCFA 1R9TB 1FL0A 2A19A 1EQVA 2VXWA 2NVYB 2OXPA 1HHVA 5IGBA 3S2HB 4V190 2WB1B 4CKBA 5JEAG 1TR5A 2ZXRA 5CV6A 1EQQA 2NZHA 2CVRA 2XRSD 4KY5A 3GTPB 1A2UA 4UP9A 4X3TA 2XN9C 3G4SA 1IKLA 1GHJA 5T1GA 3S1RB 3S1MB 4JV5Q 3S1NH 2ZT9C 3OIQA 2RDHA 2K32A 1UEBA 4K2LA 5IP9G 5JVG3 2BE5D 5JJZA 3G7LA 2EOTA 1TY0A 4RH6A 5CV4A 1F2ZA 1GKHA 1PH5A 2SDFA 4RMFA 4IURA 3K7UC 1PTOB 2K6AA 1ET6A 1PRTB 2R93B 4PZ8A 1HZAA 4A3IB 2F1MA 4LF5L 1F2YA 2PW5A 3O13A 5JVH3 1CUKA 3EN2A 2E2IH 4N8FA 4QL5A 1LV9A 1TU2B 3LNNA 5IP9H 4CDDC 2EPBA 3S14B 4I7AA 1SMXA 1S5CD 1Y1VB 4IJLA 4YIJA 3H0GG 3L2PA 3J7A5 3QWNA 1A63A 4FF3A 1EY4A 2FHTA 2OQKA 3CCSA 3MXNB 2UUBL 2RDGA 4JI4L 1W2BA 1Q81C 3QG1A 4OX9L 2K52A 4A3JG 1TS2A 3FEWX 1HCZA 4LUOA 4XDXA 1QZHA 2Z9HA 4L5TA 1DXMA 5CV9A 2A69D 4CGYB 4HSPA 2V4DA 3CXCA 2A6EC 3PMFA 2F0OA 3RLNA 3TBIB 2Z8LA 4X62L 1QWYA 3G71A 3TZDA 2F0TA 4RGNA 2O2LD 1TS4A 2QGQA 1NMFA 2OT2A 3H0GH 4UP7A 2KCCA 3RN2A 5DM73 2F0NA 5C4ZA 4FF4A 1JT8A 4H02A 2I0QA 4JI3Q 3OMGA 4UP8A 2R61A 4KY7A 4A3JH 2EZVA 1J5EL 4PQXA 4BBRB 4R4QA 4DR5Q 3J80c 3OMCA 5FKAC 2EYPA 1SNPA 2C35B 2VUMG 1Y8OB 2B2TA 4GOPA 5EBDA 1D8LA 1VQIA 2IX3A 3HOXG 3HOYG 1I4HA 2GA4B 4PG3A 4MNOA 3K57A 1TWCB 3QJYA 1F9SA 1XMQQ 4CJ1B 1RHPA 2IX1A 3K7AH 1JORA 1VQ4A 1PFBA 4A3CH 1EOVA 4HJ5A 2K04A 2RSOA 4JI1L 3C1FA 2JA8G 1D1IA 3BZCA 4UPAA 4JBWA 1OXUA 3D31A 2EXZA 5IY0A 2MJ8A 4OXPA 2D0OA 4IUNA 1H9MA 1D7QA 3KK7A 2VUMH 1TWHH 4GNXA 3N52A 2B63G 3HOXH 2AWNA 3HOYH 1C9OA 4FXKC 5CYUA 3CC7A 1AZPA 4H0LC 2B8GA 4JVZA 1BUVT 1LM0A 2B2UC 5G3LD 1IHZA 1A6XA 5FOBB 2YV5A 2N3SA 1HNZL 4GN4B 3HKZB 1GJXA 1V1QA 4HTHA 1UAPA 4JG2A 1IYJB 1PH2A 2JA8H 3JAME 2OTLA 4JBMA 1IXRA 4OO1I 3RN5A 4GZYC 3VR6A 1VQBA 4M8AA 3E3XA 3PO3B 3ZJYC 4XQJA 3C3LA 5C4JB 2B63H 2ZM6L 1TS5A 3F1ZA 3EVQA 4XT1B 3V05A 3CRKC 2WB1G 3PF4A 1D5ZC 3SHLA 4L5SA 3VR3A 4DV6Q 1HPCA 4HSVA 3EA6A 4LF4L 2K01A 4CBVA 5KGUA 1RTOA 1B9NA 2LMCB 2UXBQ 1Q90A 5AFWA 4H44C 4K0KL 4R1JA 1KHIA 1NY4A 1Q8IA 4NB3A 1L1OB 1Y69U 3H3VI 5C5LA 1R4PB 5HURA 4YHHQ 1LTGD 2E5LQ 2NVYH 3S2HH 5CBAE 2IHFA 5IYBG 1BKBA 4A3GB 4A3BB 3GTPH 2JJQA 2R93G 4LFCQ 3I91A 5T1IA 1B53A 1CKMA 4XQQA 1KAWA 1PA6A 4A3IG 3AMUA 3S1MH 2QDLA 1CM9A 4TSSA 4JV5L 3D3RA 4IPHA 1EWHA 1ENFA 1E0BA 4JPBW 1EY8A 1Y1VG 3EROA 1KAAA 1STNA 1DD2A 5FLXc 3BG3A 4JCVE 2VW9A 1UUPA 3HG9A 4A3KB 5C3EB 1YITA 1FJGL 1PTOH 3BDCA 2F3IA 1HXYD 2R93H 1CHQD 1CA6A 4PMCA 4QIWB 2F0SA 2NN6G 3NWSA 3U4ZA 3KF8B 3E6ZX 1G6ZA 4A3IH 2F0UA 1K28A 3OHXC 1JOKA 1PXUA 2FJ2A 2QILA 2EYOA 1ZKOA 2K7VA 3ICEA 4DR7Q 2BCOA 5CORA 1HNXQ 3UDFA 4C2MB 4QMGA 3SVMA 4H7BA 1EFID 3S14H 1Y1VH 5IT9c 3NQIA 4DAYB 1HA6A 3OYYA 4FXGC 2RHSB 1XPRA 4HMIA 5IIFA 4ALPA 1UE7A 2B2VA 4I65A 2Z0SA 5K5PA 2IHEA 1X3EA 1UE1A 3T53B 3I72A 5D3IB 1LTBD 4P72A 4BBRG 2B29A 2NN6H 3I73A 3GTOB 4XXEA 1OXXK 2F4VQ 1CSPA 3RNUA 4R4OA 4J15A 2HCCA 1MGSA 3BVZA 2I5LX 4QY7A 2ID0A 2DN8A 1DOLA 4NP5A 4RG1A 1QG7A 2PCFB 3NK9A 3Q23A 1I4GA 2BDNA 3GV6A 1LT6D 5C0XJ 4LFAQ 4ZKCB 3GTKH 1LLRD 1CFMA 3KLSA 4CDCC 3PIP3 4FO2A 4KI0A 1GM5A 3U58A 1GUWA 4JI3L 5E1FA 1K0SA 1KD1C 2NVQB 1DZ1A 1QNKA 4BBRH 1SNDA 1T9HA 3ND9A 1ICWA 4NDXA 3E5SA 4DR5L 1GUOA 3Q0AA 2FXQA 4CHTB 1SE3A 1EYCA 2VL6A 2V1CC 1J9OA 2X6LA 1YJWA 1NBWA 1IW7D 3S16B 1H9SB 3MXPA 5J1ZA 2E2HB 4R4TA 4YWKA 1FYCA 2B3GA 2EIFA 2PZWA 4G4KA 2KJXA 1AP0A 4L5RC 2J4XA 3IKJA 4LF8Q 1XMQL 1HFNA 1WOCA 4B3RQ 4R9WA 4XYOA 3X3NA 2LXKA 2WP8J 3PUVA 2WAQG 1WTPA 1I5FA 4DUYQ 2QEXA 1YHQA 1E2VA 1DCZA 4ZKBB 1OXVA 4LUVA 1Q86C 3PO3G 2QEJC 4LUZA 3TS2A 2F0LA 5FLMG 4RA8A 2L11A 1YNJC 3DLLA 2YU9B 4BY7B 1VS0A 3GTJB 1S5DD 1STAA 4IUQA 3EBEA 3CW2C 1F77A 3D0FA 1RL2A 4GN3B 2A1AA 4L8JA 4DR2Q 2IPKD 3MXGA 3F2BA 1KLUD 2JXMB 1H9KA 3M7NA 1STEA 2QF7A 2PI2A 4XQNA 3RD4A 3PO3H 4WJ4A 5C4JH 3R2IA 5FLMH 4JI6Q 5GAGC 2YYZA 1RDPD 4A3GG 4A3BG 3PGZA 1YVCA 3NHHA 2F52A 3OW7A 1HNWQ 1PH6A 1SYEA 3A54A 4KD4A 1BOSA 1VQ8A 2J0TD 3W3AA 1A3UA 1RJTA 4DN4M 1BCPF 1QOHA 2UXBL 1VF7A 4K6DA 4RKLA 2N8NA 2E2JB 5BN5A 3J80i 3LWEA 3BS1A 2A68D 4TVAB 1ZXTA 4A3KG 5C3EG 3HP3A 1ZYRC 2LKVA 3NE5B 4YHHL 5C5MA 4A3GH 4A3BH 2E5LL 3IL8A 3CPFA 4O0AA 4AYBE 1KXLA 1HUMA 2JQOA 1JJGA 3ULPA 3URYA 4QUFA 3A55A 1N32Q 3NELA 4LFCL 3VR2A 1PTOC 3A56A 1Q7YC 3FDTA 1PRTC 4UY8C 3ULJA 2I46A 1I4XA 2XSCA 1HFGA 1X65A 3W2DA 5K36G 3UDGA 2CQOA 5C3WA 4A3KH 4DNTB 5C3EH 1QNUA 4OEMB 1YHBA 1GO3E 3NQTA 3NTIA 1E1OA 4IQZA 3NENA 4CDEC 3CP0A 4G57A 4PNYA 4LFBL 5IYDG 2EE1A 2C9OA 2EJFC 3K5MA 1JOQA 3FPPA 3K7AB 4CKCA 1N9WA 3IRBA 4OWTB 4DR7L 1K3RA 1HNXL 3MWYW 2UUCQ 2HHHQ 1VQPA 5K36H 4PMWA 5I2YA 2SOBA 3IFTA 3J7AV 4GKJL 1B70B 5F2DA 2EYFA 4ZK9B 4LWCA 4UDUC 1I3QB 3GTOH 1HTLD 5IYDH 3NXWA 1JB7A 1YBYA 1XNRQ 5DEHA 1J8IA 4JBKA 1GUGA 1VQCA 2F4VL 2H5XA 4KK7A 4IUUA 1A3VA 2UXDQ 4IFDJ 4IPGA 3S2DH 2WINB 4ODGA 2F0VA 3U50C 5I9PA 5IE8A 3RLFA 1M8AA 5ELDA 1B8AA 1CTMA 4LFAL 2NUCA 3ERQA 2A6HD 1A8VA 1Q82C 2NVQH 1FD7D 5IYCG 3A5UA 3NEMA 3PV0A 5FO7B 2KCTA 3AFPA 2QDBA 1U4MA 3S16H 4BY7G 2OTJA 1AH9A 2E2HH 3TEHB 5IGGA 3QIAA 2F3WA 1S72A 4J6HA 1V1PB 4HCEA 5TSSA 3KFUA 3TDQA 1JCKB 4LF8L 3BZKA 4B3RL 3TRZA 1IL2A 4AIMA 5C6AA 4OGQC 4JI7Q 3RMHA 2Q2UA 5IYCH 4DUYL 1X9NA 4MIUA 5JJKA 3HEJA 2D5DA 1JR0D 4HN7A 4ZQ3A 1VQ9A 2OEOA 4JOIC 2KOLA 2YU9H 4BY7H 2F0PA 3GTJH 4KLKA 1VQAA 1CHPD 3ER0A 1WTQA 4WRDA 2K5DA 1RCVD 2GVAA 1SAPA 2I07B 2N88A 3J81E 1I4PA 1P8LA 4DV0Q 3I56A 4HJ9A 1LT5D 1HA5A 4A93B 4DR2L 1VQEA 5A2QE 3NTHA 2DNEA 3ERSX 4HJ7A 1X56A 2EYJA 1TS3A 4X3SA 1X6OA 1KNEA 2EY5A 4JC0A 1HZCA 3TMEA 4BA2I 1Y1WB 2PNHA 4Z9CB 1EZ6A 2EDGA 5FO9B 2SEBD 2JEAI 2PYKA 2UU9Q 2DUDA 3SK5A 3VA7A 1ZEQX 5IOCA 1ASYA 2PZTA 1U9RA 1AW7A 4R8IA 3CMEA 1MI2A 4QQBX 4JI2Q 1JOOA 3SXHA 3CCJA 3HOUB 1QCBD 1L1OC 1E2WA 5FK9C 3E0EA 3MXNA 1JE5A 3H91A 1S4ZA 1EL0A 1OXSC 3C46A 3BYYB 1EU4A 3KJOA 4GKKQ 2O4XA 5DAUA 1IBLL 2DY7A 2Q2HA 3WWVA 5JEAJ 1HNWL 4DV2L 1TXYA 1SMYD 2F0QA 3EIVA 2X6GA 4LK1C 2E2JH 1FR3A 2GVBA 5M3MB 3S1QB 1KDCA 5M3FB 1XYIA 5JJIA 1XTDA 3HS0C 3BZDB 1JQYD 4NW2A 2AKWB 2R7FA 4P75A 1JB3A 4O2DA 1DGSA 4FVMA 1LACA 1W6KA 3PUWA 1EZ8A 1A2TA 1RIPA 4OWWB 3VR5A 5C0XI 2R3ZA 2VZAA 1N32L 5IGDA 4N8X1 3B6YA 2L1BA 2NN6I 2DJGC 2JA7B 3M4OB 1TY2A 1X54A 3GTKB 3M3YB 4A3CG 4DV4Q 4A76A 5FLXE 4J1MA 2WIIB 1XWEA 4HCSA 4LF9Q 4B3TQ 1DYQA 1VQLA 2L0CA 1KDAA 1L0YB 2K5HA 2L5TA 2Y0SB 4IN3A 4XTCS 1L0XB 1UWVA 4YWLA 4KHZA 2CQAA 2A6ED 1SE4A 2BA1A 1O7YA 4X6AH 1SXTA 3DHQA 5FJ8G 3HOVB 1DOMA 5HGTA 3NP8A 1PTOF 1Q12A 3DXJC 1SJHD 5C4HA 1XNQL 1BVSA 3ITPA 1PRTF 2NZOA 4Y7NB 2ICIA 4RCNA 1W3SA 1VQGA 3KLRA 4QF4A 1VQDA 2UUCL 2ATWA 2HHHL 1OXTA 1VQ6A 2K14A 3WOEA 2O5IC 4Q5VA 1ESFA 1WTXA 3K5LA 1I3QH 4PMBA 4UHVA 4ZAIA 1K8AC 3K80C 2IWHA 1CK1A 3WOFA 1IBKQ 1KDBA 4ZUIA 1U4PA 5FJ8H 1SR3A 3X3MA 2XTIA 2KA7A 1DJRD 1XNRL 4GS3A 3T51B 1S5FD 5J39A 5J22A 1F9PA 3Q24A 5EBCA 1FVIA 1NMGA 2UXDL 1N33Q 2WAQB 2BH8A 1P16A 2NTSA 2PQAA 1EIFA 1NAPA 4A4IA 4DGZA 3SK4A 3PQIA 2N49A 1EY9A 2RQXA 1VMCA 2F0DA 2X69A 2BOSA 3T56B 4IUTA 3D4RA 1EYGA 3OWEB 3A8KE 4U673 4APVA 2AHOB 1AEXA 1GVPA 1PZID 1PZJD 2EJGC 1L1OA 2NTTA 1BCPD 2EYHA 3R3OA 5ELEA 4NXNQ 1O7IA 2Z1CA 5LMNW 2HIVA 2YTYA 1A3TA 2ENBA 5GAEC 3ULLA 4DPGA 4A93G 3DM1A 1STHA 4JI7L 2HUGA 1Y1WG 2RVLA 3HKZE 3IFDA 2HQLA 2JE6I 1ML0D 1W6JA 2B2YC 2PMZE 1B3AA 1SNMA 2FMMA 3F2UA 1V8QA 3HOUG 1LTTD 4YCWA 4JI0Q 4EGVA 1LTID 5GROA 1G91A 5ELNA 4C3JG 5ELFA 2BDOA 2TSSA 3A74A 2Z6BA 3KDFA 4L63B 3OSOA 2R7ZH 4A93H 4DV0L 3LWUA 2OCEA 4KKUA 5BN3A 1B50A 4LF6Q 2B2WC 3FVQA 3KF8A 2JK8A 3J81L 4MTKA 4HIMA 4DNRB 1S5BD 2CCZA 1Y1WH 1VQ5A 1NUCA 1X32A 2NBFA 1EYDA 5M3MG 3MAQA 5M3FG 1YNXA 2H4OA 2Q8IB 1N8RC 1O7LA 4KMUC 3EFXD 4F87A 3HKSA 5JPNC 2UU9L 3I4MB 4DAYA 4MTNA 3TS0A 2Q8RE 5IGEA 4X66Q 3HOUH 1E24A 1PH3A 1C48A 4JI2L 3GTMB 4C3JH 2WKCA 4DKAC 4F8MA 4DAPA 1XXGA 2CWPA 1NSNS 3MC0B 3CMAA 1SRUA 5M5YB 3W1BA 4GKKL 4DV5Q 2JA7G 3KBGA 4HEDA 5I6WA 3S17B 5ELOA 2L4NA 2PZUA 3E0JA 4IZ8A 5E3FA 5M3MH 3S1QH 1NNXA 4O42A 2K03A 5M3FH 2JA6B 4N9TA 4AH6A 1T5EA 2XVSA 1U5KA 4OONA 4QUCA 3TSSA 2HD3A 2IT1A 2Y0SG 5LL6X 1RF2D 4G7HC 1WJJA 4KHPQ 3KLSX 1CA5A 2K28A 4PV1C 4IFDI 5JOBA 2B2UA 2EY2A 1CI3M 5GAHC 2KCNA 3NPPA 1AFPA 3DWQA 2JSOA 3S2DB 3HOVG 1WD0A 2JA7H 4B08A 1HR0W 2B8FA 3M4OH 2XWBB 3RR5A 3DM3A 5H1SE 3M3YH 2E8GA 2NB0A 1AZQA 1H9SA 3C2PA 4DV4L 1IYVA 1IW7C 2FFKB 1YZ6A 5HY6A 2B39A 2AWOA 3PUZA 3GTQH 5FO8B 4B3TL 3K8AA 5ELBA 2ZTEA 3U9SA 4HJAA 5FLXL 3R2TA 1JE4A 2HDLA 1MHWC 3HZXA 1VQHA 4DR6Q 5KIXA 1SNQA 5CV8A 2D62A 3I2ZA 2K5QA 5IGCA 2K4KA 1CT1D 1EWCA 1WCMB 1XX8A 5I9OA 1B1ZA 3HOVH 1ONLA 1GOZA 1Q1EA 3I8ZA 4ULLA 4TKOB 1TIID 3VYSA 2C5CA 2KECA 4K5XA 2DJFC 4YCVA 4Y7NH 1F9RA 1II3A 1Q46A 4DFAA 1RKNA 2F0GA 1TQOA 4POFA 1H9RA 2CWAA 3QB3A 3OTOQ 5HGQA 1G8ZD 3RZDB 1J6QA 1JC7A 4B9XA 2K5NA 4BS9A 1VQJA 4M1UB 5CC4A 3MEFA 4K8IA 2JYOA 1IBKL 2WFWA 4JI5Q 1A62A 2D2CC 2AQ2B 2IJ0A 3Q8DA 3CCRA 4B3SQ 1SE8A 4U68A 2G5DA 1PH8A 4BBSB 1B9MA 3D6CA 2LSSA 3K5NA 5AJ3Q 2YTVA 3J7AF 1YNND 3GO5A 1YI2A 1N33L 1CKNB 2SNSA 5EJWA 1KC8C 1ILQA 2RF4A 1MSHA 2KHSA 4LW1A 1A0IA 2B2WA 4MZ9A 1SDFA 5JJLA 3TREA 3JAML 5G3LF 1H95A 1EY7A 3M7GA 2ZJQA 4HAEA 5LMNQ 1SYFA 2E74C 4AYBB 2K05A 4DR1Q 1EYAA 1HQRD 3RLOA 1WTWA 4YCUA 4DV6L 2ICEC 1JJ2A 3GTLB 3V2TA 1IYUA 2A68C 4NXNL 4P71A 3T16A 1PYWD 2VQFQ 3I4NB 3VYRA 4CJ2C 1K73C 1QUQB 4FP5D 1HQMC 2OQ0A 1KQSA 1IKMA 2Z6KC 4DA2A 5EPLA 5BN4A 3T13A 3UDIA 4GLXA 2Q2TA 3ZYYX 1EQTA 3H09A 3STBD 3I90A 1X3QA 5JAVA 3Q6SA 2N55A 2NWGA 3Q22A 2UUBQ 3I4MG 1AE2A 4EX5A 1Y8NB 1PVOA 3UE0A 1SYCA 2HCIA 3K5OA 4JI0L 2CW0D 1K8MA 3I4LA 1TWFB 2HT1A 3BDOA 4MN3A 1PH7A 2PI2E 1SNCA 3ND8A 4LF6L 1XMOQ 2NVTB 3E9HA 2VQEQ 3F2CA 2VNUD 3L0OA 1ZYRD 3BJUA 2JA6G 2F0IA 3PUYA 3TN2A 5IODA 1GXDC 5KNDA 3I4MH 4R4IA 1FNUA 1MJCA 2EXDA 1GD7A 5GADC 1BR9A 5GQOA 3MFYA 3L7ZC 4X66L 3GTMH 1YJ9A 2F03A 1PTOD 4P73A 2BA0A 2HIXA 1BDOA 1PRTD 3KUPA 3U4VA 5D3DA 3MA2B 4DNIA 4YWMA 3M4QA 1EU3A 5L37A 5M5YH 3UI2A 1UE6A 4K2KA 1VQOA 5I2XA 3AQQA 4OHJA 4QGUA 3GDEA 4DV5L 3S17H 1HTPA 1DONA 2K50A 3CC2A 3DUZA 4EVOA 3T1HQ 4FF2A 1F9QA 2TMPA 2M00A 2JA6H 2KEEA 3F2DA 3I70A 2HDMA 2OWOA 5C3XA 1EUJA 1B44D 3LX0A 1HR0Q 2MNAA 4KHPL 3HFZB 3I3CA 3CHBD 2YTXA 5NUCA 5C4XB 3J7YW 1I94Q 1WCMG 4EQNA 4RGMA 3VYUA 3CCVA 1QJOA 3HOWB 4GLVB 2WKDA 1G2TA 4IPCA 1N36Q 4IUVA 3J80E 3MXUA 4I7ZC 3H94A 3L3OC 1HJPA 1PMRA 3W5OA 5KEEA 1V1PA 1YJNA 1K83B 1G291 2NVXH 1D6EC 2RSNA 2QW7A 1MKHA 1EQRA 2I5HA 2MUYA 1BO0A 3KLWA 3CAMA 3VA5A 4DR4Q 1S5ED 1CZWA 4DR6L 1WCMH 2KQ3A 2K1BA 5CV7A 4KTAA 3DEPA 1NCVA 1SBBB 4RHSA 4BBSG 4DR3Q 1LT3D 3PIPA 4ZRZA 1S40A 4XYQA 1EFWA 1EIYB 1PFSA 1TWGB 1CKOA 2MO1A 4EQ5A 2GN5A 2EY1A 1JICA 3OTOL 4IOAA 1STGA 3RZDH 2Z6KA 5EAYA 2KUMA 1SN8A 4WJWA 3AU7A 1HZ9A 4L6TB 2CH4A 4DUZQ 2UUAQ 3KF6B 2BE5C 4AYBG 5CR3A 2A5HA 4RWSC 4A3FB 4P2CB 1Z47A 4GN5A 1C0AA 4HJ8A 4BBSH 4JBJA 2R7ZB 3PO2B 1BQQT 3E9IA 4JI8Q 2K5WA 4B3SL 2KCMA 1PDQA 2AUJD 2KHJA 2QKIC 5AJ3L 2AQ3B 2DGYA 3MTSA 3NBHB 3I4NG 2LY7A 4KKSA 3WDNA 1ENCA 1YHAA 2EY6A 2CFMA 4BWGB 3TP8A 1M1KC 1WTVA 1WVLA 3SDZA 4JI6L 3OPOA 1PZKD 5LMNL 1QE6A 1D1KA 3K0XA 1SMYC 4C3JB 4DR1L 2RHQB 3H3VC 3GTLH 1FJGQ 4A3DB 2XWJB 2BH2A 5DNFA 3VDYA 3ONAB 4KHVA 1B7YB 2RA4A 5KNCA 2WB1E 4K8JA 4KKTA 5JEAH 1KNAA 2JA9A 2IL8A 2EVBA 3I4NH 3MFGA 1Y8PB 1TKWB 1Z9FA 2A69C 2NZ1D 3PIO3 2VQFL 1K9MC 1PYSB 3G6JB 3QO2A 2PQEA 1XJVA 3NTKA 4A3EB 3A5ZB 3CCEA 1KL9A 1Q8KA 1Z6HA 1JWMD 4O1NA 3P75A 3JAMi 3JC66 3SK8A 1U0LA 2E75C 3R8BA 4C1NK 3S15B 4DF7A 2MPMA 3SR1A 3NBIA 1IL8A 1C7YA 4WFN3 1CSQA 1RD9D 5KNBA 1FGUA 1TWFH 5DLQE 5JPMC 4LMQD 3G6EA 4KN7C 3CCQA 1EIGA 2Q2IA 2Z4IA 4QJFA 4V0BA 1X3PA 2NVTH 3GTQB 4FF1A 4YY3Q 1XMOL 5CV5A 4RHRA 2VQEL 1NTGA 1PHJA 3A0JA 3H6MA 4AQYQ 4B3MQ 3S9WA 3BVMA 5COYA 1I50B 1VMPA 1I4QA 4JYAQ 2K75A 3NWTA 3TP7A 3BU2A 1E22A 3SGIA 1DOKA 4BXXG 3MEHA 5C4XG 3RUZA 5IT9E 2Z4HA 4RGTA 1D2BA 3SE0A 5IWAQ 2ZJPA 3HOWG 1KIXA 3V96A 4X65Q 1VQNA 3T1HL 5M5XB 1BF4A 4HIOA 2P5ZX 4ZCKA 4HMJA 3TP6A 4GOPB 4C3IB 2B2VC 4A3LG 3PCOB 3FKIB 4JOIA 1MBYA 1YEZA 2KBNA 3D6WA 1HR0L 1OO9B 4BXXH
chains in the Genus database with same CATH topology
1FL0A 2A19A 4A3GH 4A3BH 5C4XH 2E5LL 3W1GA 3CPFA 4O0AA 4AYBE 4IFDI 1KXLA 2JQOA 1JJGA 2Y0SE 3ULPA 5JEAG 4A75A 1EQQA 1N32Q 5GAHC 2NZHA 3OW2A 1I94L 3NELA 4LFCL 3HOWH 3HOVG 2JA7H 1HR0W 4UP9A 1Q7YC 3M4OH 4UY8C 3RR5A 3DM3A 3ULJA 5H1SE 3G4SA 3M3YH 2MO0A 2E8GA 4JV5Q 3S1NH 1JJCB 3FP9A 4DV4L 4LNQA 1YZ6A 1N36L 5HY6A 1UEBA 3J81c 2AWOA 3PUZA 3GTQH 4GNXB 5IP9G 1X65A 5K36G 4A3LH 1K83H 4B3TL 3UDGA 1X3FA 2CQOA 3K8AA 4A3KH 5C3EH 2ZTEA 4HJAA 1YHBA 1GO3E 1GKHA 4DV7Q 1E1OA 3LGJA 1PH5A 4RMFA 3NENA 1VQHA 4DR6Q 3K7UC 2D62A 3I2ZA 4A3FG 3CP0A 2UXCQ 2K4KA 4DR4L 1SFOH 5IYDG 4LFBL 1NE3A 3HOVH 4PZ8A 2ZTDA 1HZAA 1Q1EA 2R7ZG 1SLJA 3PO2G 2A8VA 4LF5L 2PQAB 3GD7A 1CUKA 1N9WA 4YCVA 3EN2A 4Y7NH 2E2IH 3IRBA 4OWTB 4DR7L 1Q46A 1K3RA 4QL5A 1HNXL 4DR3L 1TWGH 4IPDA 4POFA 2UUCQ 5IP9H 2HHHQ 2CWAA 1VQPA 4PMWA 1SMXA 3OTOQ 4NXMQ 4IJLA 3H0GG 2I5MX 5HGQA 2WAQE 3L2PA 3J7A5 1A63A 2OQKA 3CCSA 3MXNB 4GKJL 1B70B 2UUBL 1J6QA 3CD6A 2K5NA 1VQJA 4LWCA 1W2BA 4JI4L 1Q81C 4A3FH 3MEFA 4OX9L 2K52A 4A3JG 1Y14B 3GTOH 4DUZL 2UUAL 5IYDH 2ALYB 4LUOA 1IBKL 1JB7A 1YBYA 2WFWA 1A62A 1R9TH 1QZHA 4JI5Q 1XNRQ 4JBKA 4L5TA 3FHWA 4A3DG 3PO2H 3Q8DA 3CCRA 1VQCA 2F4VL 4IJHA 2H5XA 3CXCA 2ZTCA 4B3SQ 1SE8A 1PH8A 2UXDQ 2MQHA 3RLNA 2L15A 4JI8L 2LSSA 4IFDJ 4X62L 5AJ3Q 2YTVA 4IPGA 3G71A 3GO5A 3S2DH 1YI2A 1N33L 1CKNB 1KC8C 3M9BA 3U50C 2RF4A 2QGQA 1NMFA 1QVFA 2CKZB 1X55A 5IE8A 2EQSA 3H0GH 4LW1A 3RLFA 1V9PA 1A0IA 4UP7A 1B8AA 3RN2A 3S1RH 4MZ9A 4LFAL 4WJ3M 1JT8A 1A8VA 4A3EG 5JJLA 4H02A 2I0QA 1Q82C 4JI3Q 3TREA 1YIJA 2NVQH 4UP8A 1H95A 2ZJQA 3A5UA 5IYCG 4A3JH 2LXJA 3NEMA 5LMNQ 4DV3Q 1J5EL 4LF7Q 5BR8Q 4R4QA 4DR1Q 4DR5Q 3PF5A 3PV0A 3J80c 2KCTA 3AFPA 4A3DH 3RLOA 3S16H 4YCUA 2C35B 4DV6L 1PH9A 2VUMG 4BY7G 2E2HH 2OTJA 1JJ2A 1AH9A 3UDXA 3TEHB 5IYBH 3KDFB 3HOXG 1D8LA 1VQIA 5C0XG 4GOPA 1PH1A 3HOYG 2IY5B 4LFBQ 4PG3A 4MNOA 1S72A 1L0WA 4NXNL 4P71A 3M4PA 1XMQQ 2VQFQ 1V43A 2IX1A 3K7AH 3KFUA 1VQ4A 4LF8L 3BZKA 4X64Q 1QUQB 4R4CA 1K73C 4B3RL 2RCNA 4A3EH 2OQ0A 3TRZA 4A3CH 1IL2A 1EOVA 4AIMA 3CCUA 4HJ5A 1KQSA 4JI1L 4JI7Q 2Z6KC 2Q2UA 2JA8G 1M90C 1HZBA 3CF5A 3BZCA 4UPAA 3UDIA 5IYCH 4DUYL 1X9NA 4GLXA 5JJKA 4JBWA 2Q2TA 1QVCA 1OXUA 3D31A 3STBD 5IY0A 4OXPA 5LMUQ 3S15H 2D0OA 1D7QA 4GKJQ 1VQ9A 2UUBQ 4JOIC 3I4MG 1AE2A 2YU9H 2VUMH 4EX5A 4BY7H 1TWHH 3GTJH 4KLKA 4GNXA 1PH4A 2B63G 3HOXH 1VQAA 2AWNA 1C9OA 3ER0A 3CC7A 3HOYH 1PVOA 3UE0A 3J81j 1LM0A 4NPSA 4QIWE 2GVAA 4JI0L 2HT1A 1P8LA 4DV0Q 3I56A 1E3PA 3PIOA 4HJ9A 2YV5A 1PH7A 2N3SA 2PI2E 3S24A 1HNZL 4GN4B 1QZGA 4DR2L 1VQEA 1V1QA 4LF6L 1XMOQ 3ERSX 4HJ7A 1K8GA 4LF9L 4JG2A 1IYJB 1X56A 3E9HA 2VQEQ 3J7ZC 3F2CA 1PH2A 2JA8H 4YY3L 1X6OA 2OTLA 4JBMA 2VNUD 2ATWA 3L0OA 1IXRA 4JC0A 1HZCA 4PZ6A 3BJUA 4BA2I 2PNHA 2JA6G 4OO1I 1IBMQ 3RN5A 3PUYA 1I50H 3CPWA 3JAMc 1VQBA 4AQYL 4B3ML 2JEAI 4R4IA 3I4MH 2UU9Q 3FKIG 2DUDA 3ZJYC 1MJCA 1BBWA 2EXDA 1GD7A 1L2FA 5GADC 1ASYA 3CC4A 2B63H 4JYAL 5GQOA 2ZM6L 3CMEA 3GTMH 3L7ZC 4X66L 3F1ZA 4JI2Q 3CCJA 1YJ9A 4QQBX 4P73A 2BA0A 1L1OC 2HIXA 3E0EA 2WB1G 3U4VA 1JE5A 3PF4A 4DNIA 4YWMA 3M4QA 4L5SA 1OXSC 4DV6Q 1N34Q 5M5YH 3K81C 1UE6A 3T1YQ 3KJOA 4LF4L 4GKKQ 1VQOA 4DV2Q 1IBLL 3AQQA 2Q2HA 4QGUA 5IWAL 3WWVA 5JEAJ 1TWCH 3GDEA 4DV5L 4DV2L 3S17H 1HNWL 2K50A 2UXBQ 3CC2A 4OO1G 3T1HQ 5M5XH 4X65L 1TXYA 3EIVA 4K0KL 1XPOA 2E2JH 2JA6H 2GVBA 3F2DA 2D0PA 1AE3A 3HKZG 3PUXA 2OWOA 1EUJA 4C3IH 5JJIA 3FKIH 1KHIA 1NY4A 1XTDA 4R1JA 1CKNA 4NB3A 1E7ZA 1L1OB 3H3VI 1HR0Q 2AKWB 2R7FA 4P75A 4YHHQ 2MNAA 4O2DA 3I55A 1DGSA 3CCMA 2E5LQ 2NVYH 4KHPL 3PUWA 4DV1L 1PV4A 3S2HH 3HFZB 2IHFA 5IYBG 1BKBA 2YTXA 4GNXC 1VQ7A 1RIPA 3GTPH 2JJQA 4OWWB 4L5QA 2R93G 1I94Q 5C0XI 4LFCQ 1WCMG 2VZAA 1CKMA 1N32L 1KAWA 2JEBI 1PA6A 1VQMA 3CCVA 4A3IG 3B6YA 2NN6I 4GLVB 3S1MH 1WI5A 4DAMA 1X54A 4A3CG 4DV4Q 4JV5L 4OWXB 4IPHA 4IPCA 4A76A 1N36Q 3I4OA 5E7NA 1HJPA 3W5OA 4B3TQ 1Y1VG 3TQYA 4LF9Q 4BA1I 5FLXc 1VQLA 1YJNA 1WFQA 4JCVE 2K5HA 2VW9A 1E1TA 4XTCS 1G291 2NVXH 4P74A 1QUQA 1UWVA 1YITA 4YWLA 2VS1A 1MKHA 1FJGL 1LUZA 4DV7L 4KHZA 1EQRA 2I5HA 3KLWA 2QA4A 4DR4Q 2BA1A 3CAMA 2F3IA 4DR6L 4TQUS 2R93H 1WCMH 4X6AH 2UXCL 2NN6G 3U4ZA 5FJ8G 3KF8B 4PZ7A 4A3IH 1HR0L 1LTLA 4LF5Q 3STBC 3ICEA 4BBSG 4DR7Q 2K5VA 1LYLA 1Q12A 3KOJA 1HNXQ 1XNQL 1BVSA 3PIPA 3UDFA 4DR3Q 2NZOA 1OTCA 1S40A 1EFWA 1EIYB 1IBLQ 4ME3A 3H3VH 1W3SA 1VQGA 1PFSA 1KRTA 3S14H 1Y1VH 5IT9c 1VQDA 4DAYB 1CKOA 1SROA 2IX0A 2MO1A 3OYYA 1OXTA 2GN5A 2K14A 4EQ5A 4IOCA 2RHSB 2HHHL 1XPRA 1VQ6A 3OTOL 4NXML 4ALPA 1UE7A 4IOAA 2Z0SA 3RZDH 2Z6KA 2IHEA 5EAYA 2AMCB 1X3EA 1UE1A 1HH2P 1I3QH 1SN8A 1TWAH 1K8AC 4JI4Q 3K80C 1HZ9A 4P72A 4DK6C 3H15A 4OX9Q 4DUZQ 2UUAQ 3KF6B 4BBRG 2B29A 3RZOH 4AYBG 1IBKQ 4DK3C 1VQFA 1Q1BA 3GTGH 1Z47A 5FJ8H 1SR3A 2XTIA 4GN5A 1C0AA 1OXXK 2F4VQ 1XNRL 1CSPA 4GS3A 4HJ8A 3RNUA 4R4OA 4BBSH 4JBJA 4J15A 3E9IA 4JI8Q 1FVIA 3CCLA 1NMGA 2I5LX 4QY7A 4X62Q 4IO9A 2KCMA 2ID0A 4B3SL 4POGA 2KHJA 2UXDL 4RG1A 1N33Q 2N78A 2BH8A 5AJ3L 2DGYA 3NBHB 1P16A 3I4NG 2PQAA 5C0XJ 2R92G 1EIFA 4BY1G 2MFIA 4A4IA 4LFAQ 1YHAA 1UE5A 3GTKH 1BBUA 2CFMA 2N49A 4KI0A 1M1KC 1GM5A 3U58A 4JI3L 5IP7G 4JI6L 1KD1C 4BBRH 1J5EQ 1EYGA 1WYDA 1T9HA 5LMNL 4DV3L 3K0XA 4LF7L 4APVA 5BR8L 4DR1L 4DR5L 2FXQA 2RHQB 2VL6A 2ZJRA 4IFDG 2V1CC 2AHOB 4A3MG 3GTLH 1FJGQ 2UUCL 2BH2A 1YJWA 1NBWA 1GVPA 3VDYA 1B7YB 3UE1A 1L1OA 2WB1E 4R4TA 4YWKA 1PYBA 2B3GA 2JA9A 2EIFA 4NXNQ 1O7IA 4L5RC 5LMNW 3I4NH 2R92H 1Z9FA 4BY1H 2HIVA 2YTYA 3KJPA 3HOZG 4LF8Q 1XMQL 3J81i 5GAEC 2VQFL 1K9MC 1WOCA 3ULLA 1PYSB 4DPGA 4B3RQ 4A93G 1MJEA 2LXKA 3M85A 4JI1Q 4C2MH 2WP8J 4X64L 2JA5G 1XNQQ 1XJVA 2KHIA 2WAQG 3PUVA 3A5ZB 3CCEA 2ASBA 1IZ6A 5IP7H 1KL9A 2VY3A 1I5FA 1Q8KA 4DUYQ 4JI7L 2QEXA 1YHQA 1Y1WG 3HKZE 2HQLA 2JE6I 3JAMi 3G48A 3JC66 1U0LA 1OXVA 4LUVA 2PMZE 1S3OA 1Q86C 3PO3G 5C44G 4XIGS 5LMUL 4A3MH 4LUZA 1C7YA 3TS2A 5FLMG 1CSQA 1JMCA 1G51A 3DLLA 3HOUG 1VS0A 3EBEA 4YCWA 4JI0Q 3CW2C 5GROA 1FGUA 1TWFH 3D0FA 1RL2A 5ELNA 4GN3B 3HOZH 5DLQE 3A74A 3AFQA 3KDFA 2A1AA 2R7ZH 3I7FA 3G6EA 1HNZQ 4A93H 3AYHB 3CCQA 2Q2IA 4DV0L 2OCEA 4DR2Q 4Y52H 2JA5H 4QJFA 4LF6Q 2NVTH 3F2BA 1G6PA 2JK8A 4YY3Q 4HIMA 1XMOL 2CCZA 2VQEL 3M7NA 1Y1WH 2PI2A 2ES2A 1NTGA 1PHJA 1VQ5A 3A0JA 5M3MG 1KRSA 1VQKA 5M3FG 1YNXA 1N8RC 4AQYQ 4B3MQ 1IBML 3PO3H 5C44H 4WJ4A 5C4JH 2KENA 3HKSA 5FLMH 4JYAQ 4C3HH 2ZM6Q 2UU9L 3TS0A 4MTNA 4JI6Q 1XPUA 2K75A 4X66Q 3HOUH 3BU2A 1E22A 1VCIA 3SGIA 5M5WH 5GAGC 1E24A 2YYZA 3KYHC 4GOPC 1PH3A 4BXXG 4A3GG 4JI2L 4A3BG 3PGZA 4C3JH 5C4XG 4DKAC 1I6HH 2CWPA 2R6GA 1YVCA 4LF4Q 3CMAA 3KF6A 1SRUA 1N34L 2XGTA 2F52A 3T1YL 3W1BA 4GLAC 5IWAQ 2ZJPA 1X3GA 4DV5Q 1PH6A 3HOWG 1KIXA 4GKKL 1VQ8A 1HNWQ 2JA7G 2R7DA 4X65Q 3F8TA 3CQZH 5ELOA 4K0KQ 2UXBL 1QVGA 1VQNA 3T1HL 1NJIC 2N8NA 1ASZA 5M3MH 3S1QH 4HIOA 5M3FH 4AH6A 1K0RA 5J3BA 3PSIA 3J80i 1EWIA 1MIUA 1U5KA 4OONA 4GOPB 4A3LG 4BXXH 3PCOB 2IT1A 2Y0SG 4FDBA 4JOIA 1YEZA 2KBNA 4TVAB 3AEVA 1WJJA 4A3KG 4JI5L 5C3EG 4HIDA 4DV1Q 4KHPQ 4HIKA 4YHHL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FL0 A;  2A19 A;  4A3G H;  4A3B H;  5C4X H;  2E5L L;  3W1G A;  3CPF A;  4O0A A;  4AYB E;  4IFD I;  1KXL A;  2JQO A;  1JJG A;  2Y0S E;  3ULP A;  5JEA G;  4A75 A;  1EQQ A;  1N32 Q;  5GAH C;  2NZH A;  3OW2 A;  1I94 L;  3NEL A;  4LFC L;  3HOW H;  3HOV G;  2JA7 H;  1HR0 W;  4UP9 A;  1Q7Y C;  3M4O H;  4UY8 C;  3RR5 A;  3DM3 A;  3ULJ A;  5H1S E;  3G4S A;  3M3Y H;  2MO0 A;  2E8G A;  4JV5 Q;  3S1N H;  1JJC B;  3FP9 A;  4DV4 L;  4LNQ A;  1YZ6 A;  1N36 L;  5HY6 A;  1UEB A;  3J81 c;  2AWO A;  3PUZ A;  3GTQ H;  4GNX B;  5IP9 G;  1X65 A;  5K36 G;  4A3L H;  1K83 H;  4B3T L;  3UDG A;  1X3F A;  2CQO A;  3K8A A;  4A3K H;  5C3E H;  2ZTE A;  4HJA A;  1YHB A;  1GO3 E;  1GKH A;  4DV7 Q;  1E1O A;  3LGJ A;  1PH5 A;  4RMF A;  3NEN A;  1VQH A;  4DR6 Q;  3K7U C;  2D62 A;  3I2Z A;  4A3F G;  3CP0 A;  2UXC Q;  2K4K A;  4DR4 L;  1SFO H;  5IYD G;  4LFB L;  1NE3 A;  3HOV H;  4PZ8 A;  2ZTD A;  1HZA A;  1Q1E A;  2R7Z G;  1SLJ A;  3PO2 G;  2A8V A;  4LF5 L;  2PQA B;  3GD7 A;  1CUK A;  1N9W A;  4YCV A;  3EN2 A;  4Y7N H;  2E2I H;  3IRB A;  4OWT B;  4DR7 L;  1Q46 A;  1K3R A;  4QL5 A;  1HNX L;  4DR3 L;  1TWG H;  4IPD A;  4POF A;  2UUC Q;  5IP9 H;  2HHH Q;  2CWA A;  1VQP A;  4PMW A;  1SMX A;  3OTO Q;  4NXM Q;  4IJL A;  3H0G G;  2I5M X;  5HGQ A;  2WAQ E;  3L2P A;  3J7A 5;  1A63 A;  2OQK A;  3CCS A;  3MXN B;  4GKJ L;  1B70 B;  2UUB L;  1J6Q A;  3CD6 A;  2K5N A;  1VQJ A;  4LWC A;  1W2B A;  4JI4 L;  1Q81 C;  4A3F H;  3MEF A;  4OX9 L;  2K52 A;  4A3J G;  1Y14 B;  3GTO H;  4DUZ L;  2UUA L;  5IYD H;  2ALY B;  4LUO A;  1IBK L;  1JB7 A;  1YBY A;  2WFW A;  1A62 A;  1R9T H;  1QZH A;  4JI5 Q;  1XNR Q;  4JBK A;  4L5T A;  3FHW A;  4A3D G;  3PO2 H;  3Q8D A;  3CCR A;  1VQC A;  2F4V L;  4IJH A;  2H5X A;  3CXC A;  2ZTC A;  4B3S Q;  1SE8 A;  1PH8 A;  2UXD Q;  2MQH A;  3RLN A;  2L15 A;  4JI8 L;  2LSS A;  4IFD J;  4X62 L;  5AJ3 Q;  2YTV A;  4IPG A;  3G71 A;  3GO5 A;  3S2D H;  1YI2 A;  1N33 L;  1CKN B;  1KC8 C;  3M9B A;  3U50 C;  2RF4 A;  2QGQ A;  1NMF A;  1QVF A;  2CKZ B;  1X55 A;  5IE8 A;  2EQS A;  3H0G H;  4LW1 A;  3RLF A;  1V9P A;  1A0I A;  4UP7 A;  1B8A A;  3RN2 A;  3S1R H;  4MZ9 A;  4LFA L;  4WJ3 M;  1JT8 A;  1A8V A;  4A3E G;  5JJL A;  4H02 A;  2I0Q A;  1Q82 C;  4JI3 Q;  3TRE A;  1YIJ A;  2NVQ H;  4UP8 A;  1H95 A;  2ZJQ A;  3A5U A;  5IYC G;  4A3J H;  2LXJ A;  3NEM A;  5LMN Q;  4DV3 Q;  1J5E L;  4LF7 Q;  5BR8 Q;  4R4Q A;  4DR1 Q;  4DR5 Q;  3PF5 A;  3PV0 A;  3J80 c;  2KCT A;  3AFP A;  4A3D H;  3RLO A;  3S16 H;  4YCU A;  2C35 B;  4DV6 L;  1PH9 A;  2VUM G;  4BY7 G;  2E2H H;  2OTJ A;  1JJ2 A;  1AH9 A;  3UDX A;  3TEH B;  5IYB H;  3KDF B;  3HOX G;  1D8L A;  1VQI A;  5C0X G;  4GOP A;  1PH1 A;  3HOY G;  2IY5 B;  4LFB Q;  4PG3 A;  4MNO A;  1S72 A;  1L0W A;  4NXN L;  4P71 A;  3M4P A;  1XMQ Q;  2VQF Q;  1V43 A;  2IX1 A;  3K7A H;  3KFU A;  1VQ4 A;  4LF8 L;  3BZK A;  4X64 Q;  1QUQ B;  4R4C A;  1K73 C;  4B3R L;  2RCN A;  4A3E H;  2OQ0 A;  3TRZ A;  4A3C H;  1IL2 A;  1EOV A;  4AIM A;  3CCU A;  4HJ5 A;  1KQS A;  4JI1 L;  4JI7 Q;  2Z6K C;  2Q2U A;  2JA8 G;  1M90 C;  1HZB A;  3CF5 A;  3BZC A;  4UPA A;  3UDI A;  5IYC H;  4DUY L;  1X9N A;  4GLX A;  5JJK A;  4JBW A;  2Q2T A;  1QVC A;  1OXU A;  3D31 A;  3STB D;  5IY0 A;  4OXP A;  5LMU Q;  3S15 H;  2D0O A;  1D7Q A;  4GKJ Q;  1VQ9 A;  2UUB Q;  4JOI C;  3I4M G;  1AE2 A;  2YU9 H;  2VUM H;  4EX5 A;  4BY7 H;  1TWH H;  3GTJ H;  4KLK A;  4GNX A;  1PH4 A;  2B63 G;  3HOX H;  1VQA A;  2AWN A;  1C9O A;  3ER0 A;  3CC7 A;  3HOY H;  1PVO A;  3UE0 A;  3J81 j;  1LM0 A;  4NPS A;  4QIW E;  2GVA A;  4JI0 L;  2HT1 A;  1P8L A;  4DV0 Q;  3I56 A;  1E3P A;  3PIO A;  4HJ9 A;  2YV5 A;  1PH7 A;  2N3S A;  2PI2 E;  3S24 A;  1HNZ L;  4GN4 B;  1QZG A;  4DR2 L;  1VQE A;  1V1Q A;  4LF6 L;  1XMO Q;  3ERS X;  4HJ7 A;  1K8G A;  4LF9 L;  4JG2 A;  1IYJ B;  1X56 A;  3E9H A;  2VQE Q;  3J7Z C;  3F2C A;  1PH2 A;  2JA8 H;  4YY3 L;  1X6O A;  2OTL A;  4JBM A;  2VNU D;  2ATW A;  3L0O A;  1IXR A;  4JC0 A;  1HZC A;  4PZ6 A;  3BJU A;  4BA2 I;  2PNH A;  2JA6 G;  4OO1 I;  1IBM Q;  3RN5 A;  3PUY A;  1I50 H;  3CPW A;  3JAM c;  1VQB A;  4AQY L;  4B3M L;  2JEA I;  4R4I A;  3I4M H;  2UU9 Q;  3FKI G;  2DUD A;  3ZJY C;  1MJC A;  1BBW A;  2EXD A;  1GD7 A;  1L2F A;  5GAD C;  1ASY A;  3CC4 A;  2B63 H;  4JYA L;  5GQO A;  2ZM6 L;  3CME A;  3GTM H;  3L7Z C;  4X66 L;  3F1Z A;  4JI2 Q;  3CCJ A;  1YJ9 A;  4QQB X;  4P73 A;  2BA0 A;  1L1O C;  2HIX A;  3E0E A;  2WB1 G;  3U4V A;  1JE5 A;  3PF4 A;  4DNI A;  4YWM A;  3M4Q A;  4L5S A;  1OXS C;  4DV6 Q;  1N34 Q;  5M5Y H;  3K81 C;  1UE6 A;  3T1Y Q;  3KJO A;  4LF4 L;  4GKK Q;  1VQO A;  4DV2 Q;  1IBL L;  3AQQ A;  2Q2H A;  4QGU A;  5IWA L;  3WWV A;  5JEA J;  1TWC H;  3GDE A;  4DV5 L;  4DV2 L;  3S17 H;  1HNW L;  2K50 A;  2UXB Q;  3CC2 A;  4OO1 G;  3T1H Q;  5M5X H;  4X65 L;  1TXY A;  3EIV A;  4K0K L;  1XPO A;  2E2J H;  2JA6 H;  2GVB A;  3F2D A;  2D0P A;  1AE3 A;  3HKZ G;  3PUX A;  2OWO A;  1EUJ A;  4C3I H;  5JJI A;  3FKI H;  1KHI A;  1NY4 A;  1XTD A;  4R1J A;  1CKN A;  4NB3 A;  1E7Z A;  1L1O B;  3H3V I;  1HR0 Q;  2AKW B;  2R7F A;  4P75 A;  4YHH Q;  2MNA A;  4O2D A;  3I55 A;  1DGS A;  3CCM A;  2E5L Q;  2NVY H;  4KHP L;  3PUW A;  4DV1 L;  1PV4 A;  3S2H H;  3HFZ B;  2IHF A;  5IYB G;  1BKB A;  2YTX A;  4GNX C;  1VQ7 A;  1RIP A;  3GTP H;  2JJQ A;  4OWW B;  4L5Q A;  2R93 G;  1I94 Q;  5C0X I;  4LFC Q;  1WCM G;  2VZA A;  1CKM A;  1N32 L;  1KAW A;  2JEB I;  1PA6 A;  1VQM A;  3CCV A;  4A3I G;  3B6Y A;  2NN6 I;  4GLV B;  3S1M H;  1WI5 A;  4DAM A;  1X54 A;  4A3C G;  4DV4 Q;  4JV5 L;  4OWX B;  4IPH A;  4IPC A;  4A76 A;  1N36 Q;  3I4O A;  5E7N A;  1HJP A;  3W5O A;  4B3T Q;  1Y1V G;  3TQY A;  4LF9 Q;  4BA1 I;  5FLX c;  1VQL A;  1YJN A;  1WFQ A;  4JCV E;  2K5H A;  2VW9 A;  1E1T A;  4XTC S;  1G29 1;  2NVX H;  4P74 A;  1QUQ A;  1UWV A;  1YIT A;  4YWL A;  2VS1 A;  1MKH A;  1FJG L;  1LUZ A;  4DV7 L;  4KHZ A;  1EQR A;  2I5H A;  3KLW A;  2QA4 A;  4DR4 Q;  2BA1 A;  3CAM A;  2F3I A;  4DR6 L;  4TQU S;  2R93 H;  1WCM H;  4X6A H;  2UXC L;  2NN6 G;  3U4Z A;  5FJ8 G;  3KF8 B;  4PZ7 A;  4A3I H;  1HR0 L;  1LTL A;  4LF5 Q;  3STB C;  3ICE A;  4BBS G;  4DR7 Q;  2K5V A;  1LYL A;  1Q12 A;  3KOJ A;  1HNX Q;  1XNQ L;  1BVS A;  3PIP A;  3UDF A;  4DR3 Q;  2NZO A;  1OTC A;  1S40 A;  1EFW A;  1EIY B;  1IBL Q;  4ME3 A;  3H3V H;  1W3S A;  1VQG A;  1PFS A;  1KRT A;  3S14 H;  1Y1V H;  5IT9 c;  1VQD A;  4DAY B;  1CKO A;  1SRO A;  2IX0 A;  2MO1 A;  3OYY A;  1OXT A;  2GN5 A;  2K14 A;  4EQ5 A;  4IOC A;  2RHS B;  2HHH L;  1XPR A;  1VQ6 A;  3OTO L;  4NXM L;  4ALP A;  1UE7 A;  4IOA A;  2Z0S A;  3RZD H;  2Z6K A;  2IHE A;  5EAY A;  2AMC B;  1X3E A;  1UE1 A;  1HH2 P;  1I3Q H;  1SN8 A;  1TWA H;  1K8A C;  4JI4 Q;  3K80 C;  1HZ9 A;  4P72 A;  4DK6 C;  3H15 A;  4OX9 Q;  4DUZ Q;  2UUA Q;  3KF6 B;  4BBR G;  2B29 A;  3RZO H;  4AYB G;  1IBK Q;  4DK3 C;  1VQF A;  1Q1B A;  3GTG H;  1Z47 A;  5FJ8 H;  1SR3 A;  2XTI A;  4GN5 A;  1C0A A;  1OXX K;  2F4V Q;  1XNR L;  1CSP A;  4GS3 A;  4HJ8 A;  3RNU A;  4R4O A;  4BBS H;  4JBJ A;  4J15 A;  3E9I A;  4JI8 Q;  1FVI A;  3CCL A;  1NMG A;  2I5L X;  4QY7 A;  4X62 Q;  4IO9 A;  2KCM A;  2ID0 A;  4B3S L;  4POG A;  2KHJ A;  2UXD L;  4RG1 A;  1N33 Q;  2N78 A;  2BH8 A;  5AJ3 L;  2DGY A;  3NBH B;  1P16 A;  3I4N G;  2PQA A;  5C0X J;  2R92 G;  1EIF A;  4BY1 G;  2MFI A;  4A4I A;  4LFA Q;  1YHA A;  1UE5 A;  3GTK H;  1BBU A;  2CFM A;  2N49 A;  4KI0 A;  1M1K C;  1GM5 A;  3U58 A;  4JI3 L;  5IP7 G;  4JI6 L;  1KD1 C;  4BBR H;  1J5E Q;  1EYG A;  1WYD A;  1T9H A;  5LMN L;  4DV3 L;  3K0X A;  4LF7 L;  4APV A;  5BR8 L;  4DR1 L;  4DR5 L;  2FXQ A;  2RHQ B;  2VL6 A;  2ZJR A;  4IFD G;  2V1C C;  2AHO B;  4A3M G;  3GTL H;  1FJG Q;  2UUC L;  2BH2 A;  1YJW A;  1NBW A;  1GVP A;  3VDY A;  1B7Y B;  3UE1 A;  1L1O A;  2WB1 E;  4R4T A;  4YWK A;  1PYB A;  2B3G A;  2JA9 A;  2EIF A;  4NXN Q;  1O7I A;  4L5R C;  5LMN W;  3I4N H;  2R92 H;  1Z9F A;  4BY1 H;  2HIV A;  2YTY A;  3KJP A;  3HOZ G;  4LF8 Q;  1XMQ L;  3J81 i;  5GAE C;  2VQF L;  1K9M C;  1WOC A;  3ULL A;  1PYS B;  4DPG A;  4B3R Q;  4A93 G;  1MJE A;  2LXK A;  3M85 A;  4JI1 Q;  4C2M H;  2WP8 J;  4X64 L;  2JA5 G;  1XNQ Q;  1XJV A;  2KHI A;  2WAQ G;  3PUV A;  3A5Z B;  3CCE A;  2ASB A;  1IZ6 A;  5IP7 H;  1KL9 A;  2VY3 A;  1I5F A;  1Q8K A;  4DUY Q;  4JI7 L;  2QEX A;  1YHQ A;  1Y1W G;  3HKZ E;  2HQL A;  2JE6 I;  3JAM i;  3G48 A;  3JC6 6;  1U0L A;  1OXV A;  4LUV A;  2PMZ E;  1S3O A;  1Q86 C;  3PO3 G;  5C44 G;  4XIG S;  5LMU L;  4A3M H;  4LUZ A;  1C7Y A;  3TS2 A;  5FLM G;  1CSQ A;  1JMC A;  1G51 A;  3DLL A;  3HOU G;  1VS0 A;  3EBE A;  4YCW A;  4JI0 Q;  3CW2 C;  5GRO A;  1FGU A;  1TWF H;  3D0F A;  1RL2 A;  5ELN A;  4GN3 B;  3HOZ H;  5DLQ E;  3A74 A;  3AFQ A;  3KDF A;  2A1A A;  2R7Z H;  3I7F A;  3G6E A;  1HNZ Q;  4A93 H;  3AYH B;  3CCQ A;  2Q2I A;  4DV0 L;  2OCE A;  4DR2 Q;  4Y52 H;  2JA5 H;  4QJF A;  4LF6 Q;  2NVT H;  3F2B A;  1G6P A;  2JK8 A;  4YY3 Q;  4HIM A;  1XMO L;  2CCZ A;  2VQE L;  3M7N A;  1Y1W H;  2PI2 A;  2ES2 A;  1NTG A;  1PHJ A;  1VQ5 A;  3A0J A;  5M3M G;  1KRS A;  1VQK A;  5M3F G;  1YNX A;  1N8R C;  4AQY Q;  4B3M Q;  1IBM L;  3PO3 H;  5C44 H;  4WJ4 A;  5C4J H;  2KEN A;  3HKS A;  5FLM H;  4JYA Q;  4C3H H;  2ZM6 Q;  2UU9 L;  3TS0 A;  4MTN A;  4JI6 Q;  1XPU A;  2K75 A;  4X66 Q;  3HOU H;  3BU2 A;  1E22 A;  1VCI A;  3SGI A;  5M5W H;  5GAG C;  1E24 A;  2YYZ A;  3KYH C;  4GOP C;  1PH3 A;  4BXX G;  4A3G G;  4JI2 L;  4A3B G;  3PGZ A;  4C3J H;  5C4X G;  4DKA C;  1I6H H;  2CWP A;  2R6G A;  1YVC A;  4LF4 Q;  3CMA A;  3KF6 A;  1SRU A;  1N34 L;  2XGT A;  2F52 A;  3T1Y L;  3W1B A;  4GLA C;  5IWA Q;  2ZJP A;  1X3G A;  4DV5 Q;  1PH6 A;  3HOW G;  1KIX A;  4GKK L;  1VQ8 A;  1HNW Q;  2JA7 G;  2R7D A;  4X65 Q;  3F8T A;  3CQZ H;  5ELO A;  4K0K Q;  2UXB L;  1QVG A;  1VQN A;  3T1H L;  1NJI C;  2N8N A;  1ASZ A;  5M3M H;  3S1Q H;  4HIO A;  5M3F H;  4AH6 A;  1K0R A;  5J3B A;  3PSI A;  3J80 i;  1EWI A;  1MIU A;  1U5K A;  4OON A;  4GOP B;  4A3L G;  4BXX H;  3PCO B;  2IT1 A;  2Y0S G;  4FDB A;  4JOI A;  1YEZ A;  2KBN A;  4TVA B;  3AEV A;  1WJJ A;  4A3K G;  4JI5 L;  5C3E G;  4HID A;  4DV1 Q;  4KHP Q;  4HIK A;  4YHH L; 
#chains in the Genus database with same CATH topology
 4F7X A;  5C4X H;  3W1G A;  3BYT B;  1PFM A;  3L9A X;  2Y0S E;  1ET9 A;  4A75 A;  3BVG A;  4OIJ A;  3OW2 A;  1SNO A;  1LTA D;  1I94 L;  2F0M A;  3HOW H;  3P7J A;  3D8G A;  1SYG A;  1EY6 A;  4B9W A;  2MO0 A;  3A7L A;  5M9O A;  1LT4 D;  1JJC B;  4DAV A;  2FMC A;  3FP9 A;  5ISR A;  4LNQ A;  1N36 L;  3J81 c;  4IUP A;  1BCP C;  5LL6 S;  4GNX B;  3EQL C;  4A3L H;  4QB4 A;  1K83 H;  1X3F A;  2PMZ B;  1D5M C;  4OIK A;  1XTC D;  3FPU B;  2NYZ D;  3J80 L;  4DV7 Q;  1K8O A;  1B4O A;  3LGJ A;  2JN4 A;  4A3F G;  2UXC Q;  4DR4 L;  2QCP X;  1SFO H;  2OF1 A;  4LAA A;  1NE3 A;  2M2L A;  1JWS D;  2ZTD A;  4KJO A;  1SSO A;  2R7Z G;  1SLJ A;  3PO2 G;  4RAU C;  2A8V A;  3CKI B;  3R93 A;  1KTK A;  2PQA B;  3GD7 A;  1NR4 A;  4DR3 L;  1TWG H;  4IPD A;  1LO5 D;  3QR8 A;  4TRD A;  5A35 A;  3DEO A;  4RGO S;  4NXM Q;  2PPB C;  2I5M X;  2PO4 A;  2WAQ E;  2A73 B;  2VB3 X;  3CD6 A;  1K3B C;  1TWA B;  4A3F H;  4K6L A;  2XIW A;  1U4R A;  1Y14 B;  4DUZ L;  2UUA L;  3RZO B;  2ALY B;  1R9T H;  3GTG B;  3FHW A;  4A3D G;  3PO2 H;  4IJH A;  2ZTC A;  1BNZ A;  2MQH A;  2L15 A;  4JI8 L;  2ZXP A;  2F3V A;  4DU9 A;  2EYM A;  4RKB A;  2XRQ D;  5CGK A;  3M9B A;  3OWF A;  1QVF A;  4NMZ A;  2CKZ B;  1X55 A;  2EQS A;  3S1R H;  2IW3 A;  1V9P A;  5A2Q L;  4WJ3 M;  4A3E G;  2MGS A;  1YIJ A;  4FXD A;  4LJZ C;  3GP7 A;  1I4R A;  4J8Q A;  2LXJ A;  4DV3 Q;  3T4A C;  4LF7 Q;  5BR8 Q;  1A15 A;  3MHB A;  3PF5 A;  1F2L A;  4ME5 A;  4A3D H;  2DY8 A;  1PH9 A;  1FGB D;  1GUS A;  3UDX A;  5IYB H;  1PH1 A;  3KDF B;  4FYD A;  1KAB A;  5C0X G;  5I6Y A;  4LFB Q;  3VR4 A;  1L0W A;  3HGB A;  1FNV A;  3M4P A;  1V43 A;  2R92 B;  4BY1 B;  4H13 C;  2EYL A;  4X64 Q;  4R4C A;  2RCN A;  4A3E H;  1TVX A;  3CCU A;  3IAY A;  1M90 C;  4JW0 A;  1HZB A;  5EKI A;  3CF5 A;  1EOT A;  1WTH A;  2WV6 D;  1QVC A;  2F0J A;  2F0W A;  5LMU Q;  3S15 H;  5DM6 3;  4GKJ Q;  1O80 A;  1ROD A;  3P20 A;  5E4X A;  2JP1 A;  4A3M B;  1PH4 A;  1T5X D;  5C0X H;  3K6O A;  1SJE D;  4NPS A;  3J81 j;  4QIW E;  1E3P A;  3PIO A;  3HOZ B;  1STB A;  3S24 A;  4CJ0 B;  1QZG A;  4LF9 L;  1K8G A;  2JA5 B;  4CDF C;  5EKK A;  5CMD A;  5E4W C;  3J7Z C;  3HRZ C;  4ZLT F;  4YY3 L;  3MVV A;  2O5J C;  2PNR C;  2NVX B;  4PZ6 A;  1WD1 A;  4KY6 A;  1IBM Q;  1I50 H;  3CPW A;  2MP1 A;  3JAM c;  1ENA A;  3M4Y A;  4AQY L;  4B3M L;  3EJI A;  4C3I G;  1B3Q A;  3FKI G;  2KVM A;  5C44 B;  1BBW A;  1EY5 A;  3CC4 A;  1BXT A;  1L2F A;  3BDL A;  4JYA L;  4C3H B;  3SEB A;  2F0H A;  5M5W B;  5KYL A;  1BCP B;  3QOJ A;  1QIL A;  1VF5 C;  1N34 Q;  1RTN A;  1I6H B;  1LTS D;  3K81 C;  1G2S A;  3T1Y Q;  3K0Y A;  2IY5 B;  5IWA L;  1TWC H;  1I6V C;  1JWU D;  4E6I A;  5EPJ A;  5IT9 L;  4OO1 G;  1TT2 A;  3QOL A;  5M5X H;  4X65 L;  3CQZ B;  1XPO A;  1MSG A;  4RCO A;  4DK1 A;  2D0P A;  1AE3 A;  1Q3L A;  3HKZ G;  3PUX A;  4C3I H;  1QB5 D;  2B2Y A;  3FKI H;  4WOR A;  3K59 A;  1CKN A;  1E7Z A;  2D9U A;  1YNN C;  1ILP A;  3FRP B;  3I55 A;  3CCM A;  4DV1 L;  1PV4 A;  2FIN B;  1CZG A;  1GHK A;  1O78 A;  2WAC A;  1VQ7 A;  4X3K A;  4L5Q A;  2F0K A;  2F4I A;  5EKL A;  2JEB I;  2E76 C;  5EPK A;  1STY A;  1VQM A;  1V1O A;  4OO1 H;  1WI5 A;  4DAM A;  1CQV A;  1LTR D;  4OWX B;  3S1N B;  3I4O A;  4R8N A;  1EY0 A;  1YNJ D;  3SK6 A;  5E7N A;  5KRU A;  2RBM A;  3TQY A;  3OIP A;  4BA1 I;  1WFQ A;  4HR7 B;  1E1T A;  1ESR A;  4P74 A;  1GUT A;  1QUQ A;  2A74 C;  3C1E A;  2VS1 A;  1LUZ A;  4DV7 L;  1B2T A;  2XNA C;  2QA4 A;  5KYI A;  3GQB A;  4KD3 A;  4TQU S;  1M4V A;  2E2D C;  2UXC L;  4DK0 A;  4PZ7 A;  1LTL A;  4LF5 Q;  3STB C;  3A8J E;  2K5V A;  1LYL A;  3KOJ A;  1OTC A;  1D5X C;  2E2I B;  1IBL Q;  2SNM A;  4ME3 A;  1U4L A;  4RFB A;  3VYT A;  1KRT A;  3H3V H;  1C4Q A;  4DV2 Q;  1SRO A;  2IX0 A;  5EGT A;  4IOC A;  2LFN A;  1ICF B;  4FNF A;  2CW0 C;  2PW7 A;  1Z7T A;  1EIH A;  4NXM L;  1FNW A;  2AMC B;  1R4Q B;  1E2Z A;  1HH2 P;  1TWA H;  4JI4 Q;  4OX9 Q;  4DK6 C;  3H15 A;  3RZO H;  3TP5 A;  4K5W A;  4G7Z C;  2AQ1 B;  4DK3 C;  1VQF A;  1Q1B A;  3GTG H;  4F88 A;  4EQP A;  4K5V A;  3OOC A;  4ILW A;  3A7A B;  2G9D A;  4S3S A;  3CCL A;  1SEB D;  4X62 Q;  4POG A;  4IO9 A;  1EEI D;  2CH4 W;  2N78 A;  2G9H D;  4DXG A;  4X3U A;  2R92 G;  4K14 A;  4BY1 G;  2MFI A;  1WTO A;  4EQO A;  2KED A;  1UE5 A;  1LAB A;  1BBU A;  3H0G B;  1C8C A;  1F2M A;  5D65 A;  4DV1 Q;  5IP7 G;  3U9O A;  3GV3 A;  1J5E Q;  1WYD A;  1GUN A;  4A3J B;  4DV3 L;  1SYD A;  4LF7 L;  5BR8 L;  4UAI A;  2ZJR A;  4IFD G;  4A3M G;  2M9V A;  2RKS A;  3AB9 A;  3UE1 A;  1UEA B;  1PLF A;  1PYB A;  1SE2 A;  4G7O C;  2R92 H;  4BY1 H;  1NR2 A;  3KJP A;  3HOZ G;  4CKE A;  3J81 i;  5ELC A;  4ZUJ A;  1MJE A;  3M85 A;  4JI1 Q;  4C2M H;  4X64 L;  2JA5 G;  1XNQ Q;  2KHI A;  2LS0 1;  2ASB A;  1IZ6 A;  5IP7 H;  2VY3 A;  3FMC A;  5I4D A;  4KV6 A;  3DWP A;  3G48 A;  2F0E A;  2A6H C;  2AUK A;  3DWA A;  1S3O A;  1EEF D;  3K58 A;  5C44 G;  4XIG S;  5LMU L;  4Q0F A;  4A3M H;  4IFD H;  1WTR A;  3D4D A;  4C3H G;  1JMC A;  1G51 A;  2VUM B;  1TWH B;  4KN4 C;  3TZU A;  3HOX B;  3P1H A;  3HOY B;  4C1N I;  4C56 C;  2L12 A;  4KJN A;  5IGF A;  2Q8T A;  3HOZ H;  4ZYS A;  3AFQ A;  2MHV A;  3I7F A;  1HNZ Q;  3AYH B;  1PFN A;  4Y52 H;  3A8I E;  2JA5 H;  2DNC A;  4OL7 A;  5EQ0 A;  1G6P A;  1SYB A;  2CHB D;  2JA8 B;  2ES2 A;  4XT3 B;  2J7Z A;  3D4W A;  1KRS A;  1MD2 D;  1VQK A;  4QCL A;  1CQF A;  5D14 A;  1IBM L;  5C44 H;  1DM0 B;  1VDZ A;  2K33 A;  2KEN A;  3CRL C;  4C3H H;  2ZM6 Q;  1XPU A;  3N6R A;  1SFO B;  1H9J A;  4IAL A;  4MHE A;  1VCI A;  5CBE E;  2B63 B;  5M5W H;  2B2T C;  1HRJ A;  3KYH C;  4GOP C;  2RDF A;  2L9H A;  1HUN A;  2ZXO A;  4NKL A;  1I6H H;  2R6G A;  4LF4 Q;  3KF6 A;  1KLG D;  1N34 L;  2XGT A;  3T1Y L;  4ID6 A;  4GLA C;  4JK1 C;  1X3G A;  2VB2 X;  5LHY 1;  2EJM A;  2R7D A;  2L55 A;  3F8T A;  3CQZ H;  4K0K Q;  1QVG A;  4ABN A;  1NJI C;  3MZ5 A;  1AN8 A;  4DXF A;  1ASZ A;  2H1E A;  4OEL B;  1BBX C;  3DMU A;  3NUC A;  3CU7 A;  3NSW A;  1K0R A;  1UNS A;  5J3B A;  3PSI A;  1EWI A;  1MIU A;  1O7Z A;  2F0F A;  3NBH A;  2HQE A;  4FDB A;  4N9P A;  3KBX A;  3AEV A;  4JI5 L;  4HID A;  4GNX C;  4HIK A;  2RCF A;  1R9T B;  1FL0 A;  2A19 A;  1EQV A;  2VXW A;  2NVY B;  2OXP A;  1HHV A;  5IGB A;  3S2H B;  4V19 0;  2WB1 B;  4CKB A;  5JEA G;  1TR5 A;  2ZXR A;  5CV6 A;  1EQQ A;  2NZH A;  2CVR A;  2XRS D;  4KY5 A;  3GTP B;  1A2U A;  4UP9 A;  4X3T A;  2XN9 C;  3G4S A;  1IKL A;  1GHJ A;  5T1G A;  3S1R B;  3S1M B;  4JV5 Q;  3S1N H;  2ZT9 C;  3OIQ A;  2RDH A;  2K32 A;  1UEB A;  4K2L A;  5IP9 G;  5JVG 3;  2BE5 D;  5JJZ A;  3G7L A;  2EOT A;  1TY0 A;  4RH6 A;  5CV4 A;  1F2Z A;  1GKH A;  1PH5 A;  2SDF A;  4RMF A;  4IUR A;  3K7U C;  1PTO B;  2K6A A;  1ET6 A;  1PRT B;  2R93 B;  4PZ8 A;  1HZA A;  4A3I B;  2F1M A;  4LF5 L;  1F2Y A;  2PW5 A;  3O13 A;  5JVH 3;  1CUK A;  3EN2 A;  2E2I H;  4N8F A;  4QL5 A;  1LV9 A;  1TU2 B;  3LNN A;  5IP9 H;  4CDD C;  2EPB A;  3S14 B;  4I7A A;  1SMX A;  1S5C D;  1Y1V B;  4IJL A;  4YIJ A;  3H0G G;  3L2P A;  3J7A 5;  3QWN A;  1A63 A;  4FF3 A;  1EY4 A;  2FHT A;  2OQK A;  3CCS A;  3MXN B;  2UUB L;  2RDG A;  4JI4 L;  1W2B A;  1Q81 C;  3QG1 A;  4OX9 L;  2K52 A;  4A3J G;  1TS2 A;  3FEW X;  1HCZ A;  4LUO A;  4XDX A;  1QZH A;  2Z9H A;  4L5T A;  1DXM A;  5CV9 A;  2A69 D;  4CGY B;  4HSP A;  2V4D A;  3CXC A;  2A6E C;  3PMF A;  2F0O A;  3RLN A;  3TBI B;  2Z8L A;  4X62 L;  1QWY A;  3G71 A;  3TZD A;  2F0T A;  4RGN A;  2O2L D;  1TS4 A;  2QGQ A;  1NMF A;  2OT2 A;  3H0G H;  4UP7 A;  2KCC A;  3RN2 A;  5DM7 3;  2F0N A;  5C4Z A;  4FF4 A;  1JT8 A;  4H02 A;  2I0Q A;  4JI3 Q;  3OMG A;  4UP8 A;  2R61 A;  4KY7 A;  4A3J H;  2EZV A;  1J5E L;  4PQX A;  4BBR B;  4R4Q A;  4DR5 Q;  3J80 c;  3OMC A;  5FKA C;  2EYP A;  1SNP A;  2C35 B;  2VUM G;  1Y8O B;  2B2T A;  4GOP A;  5EBD A;  1D8L A;  1VQI A;  2IX3 A;  3HOX G;  3HOY G;  1I4H A;  2GA4 B;  4PG3 A;  4MNO A;  3K57 A;  1TWC B;  3QJY A;  1F9S A;  1XMQ Q;  4CJ1 B;  1RHP A;  2IX1 A;  3K7A H;  1JOR A;  1VQ4 A;  1PFB A;  4A3C H;  1EOV A;  4HJ5 A;  2K04 A;  2RSO A;  4JI1 L;  3C1F A;  2JA8 G;  1D1I A;  3BZC A;  4UPA A;  4JBW A;  1OXU A;  3D31 A;  2EXZ A;  5IY0 A;  2MJ8 A;  4OXP A;  2D0O A;  4IUN A;  1H9M A;  1D7Q A;  3KK7 A;  2VUM H;  1TWH H;  4GNX A;  3N52 A;  2B63 G;  3HOX H;  2AWN A;  3HOY H;  1C9O A;  4FXK C;  5CYU A;  3CC7 A;  1AZP A;  4H0L C;  2B8G A;  4JVZ A;  1BUV T;  1LM0 A;  2B2U C;  5G3L D;  1IHZ A;  1A6X A;  5FOB B;  2YV5 A;  2N3S A;  1HNZ L;  4GN4 B;  3HKZ B;  1GJX A;  1V1Q A;  4HTH A;  1UAP A;  4JG2 A;  1IYJ B;  1PH2 A;  2JA8 H;  3JAM E;  2OTL A;  4JBM A;  1IXR A;  4OO1 I;  3RN5 A;  4GZY C;  3VR6 A;  1VQB A;  4M8A A;  3E3X A;  3PO3 B;  3ZJY C;  4XQJ A;  3C3L A;  5C4J B;  2B63 H;  2ZM6 L;  1TS5 A;  3F1Z A;  3EVQ A;  4XT1 B;  3V05 A;  3CRK C;  2WB1 G;  3PF4 A;  1D5Z C;  3SHL A;  4L5S A;  3VR3 A;  4DV6 Q;  1HPC A;  4HSV A;  3EA6 A;  4LF4 L;  2K01 A;  4CBV A;  5KGU A;  1RTO A;  1B9N A;  2LMC B;  2UXB Q;  1Q90 A;  5AFW A;  4H44 C;  4K0K L;  4R1J A;  1KHI A;  1NY4 A;  1Q8I A;  4NB3 A;  1L1O B;  1Y69 U;  3H3V I;  5C5L A;  1R4P B;  5HUR A;  4YHH Q;  1LTG D;  2E5L Q;  2NVY H;  3S2H H;  5CBA E;  2IHF A;  5IYB G;  1BKB A;  4A3G B;  4A3B B;  3GTP H;  2JJQ A;  2R93 G;  4LFC Q;  3I91 A;  5T1I A;  1B53 A;  1CKM A;  4XQQ A;  1KAW A;  1PA6 A;  4A3I G;  3AMU A;  3S1M H;  2QDL A;  1CM9 A;  4TSS A;  4JV5 L;  3D3R A;  4IPH A;  1EWH A;  1ENF A;  1E0B A;  4JPB W;  1EY8 A;  1Y1V G;  3ERO A;  1KAA A;  1STN A;  1DD2 A;  5FLX c;  3BG3 A;  4JCV E;  2VW9 A;  1UUP A;  3HG9 A;  4A3K B;  5C3E B;  1YIT A;  1FJG L;  1PTO H;  3BDC A;  2F3I A;  1HXY D;  2R93 H;  1CHQ D;  1CA6 A;  4PMC A;  4QIW B;  2F0S A;  2NN6 G;  3NWS A;  3U4Z A;  3KF8 B;  3E6Z X;  1G6Z A;  4A3I H;  2F0U A;  1K28 A;  3OHX C;  1JOK A;  1PXU A;  2FJ2 A;  2QIL A;  2EYO A;  1ZKO A;  2K7V A;  3ICE A;  4DR7 Q;  2BCO A;  5COR A;  1HNX Q;  3UDF A;  4C2M B;  4QMG A;  3SVM A;  4H7B A;  1EFI D;  3S14 H;  1Y1V H;  5IT9 c;  3NQI A;  4DAY B;  1HA6 A;  3OYY A;  4FXG C;  2RHS B;  1XPR A;  4HMI A;  5IIF A;  4ALP A;  1UE7 A;  2B2V A;  4I65 A;  2Z0S A;  5K5P A;  2IHE A;  1X3E A;  1UE1 A;  3T53 B;  3I72 A;  5D3I B;  1LTB D;  4P72 A;  4BBR G;  2B29 A;  2NN6 H;  3I73 A;  3GTO B;  4XXE A;  1OXX K;  2F4V Q;  1CSP A;  3RNU A;  4R4O A;  4J15 A;  2HCC A;  1MGS A;  3BVZ A;  2I5L X;  4QY7 A;  2ID0 A;  2DN8 A;  1DOL A;  4NP5 A;  4RG1 A;  1QG7 A;  2PCF B;  3NK9 A;  3Q23 A;  1I4G A;  2BDN A;  3GV6 A;  1LT6 D;  5C0X J;  4LFA Q;  4ZKC B;  3GTK H;  1LLR D;  1CFM A;  3KLS A;  4CDC C;  3PIP 3;  4FO2 A;  4KI0 A;  1GM5 A;  3U58 A;  1GUW A;  4JI3 L;  5E1F A;  1K0S A;  1KD1 C;  2NVQ B;  1DZ1 A;  1QNK A;  4BBR H;  1SND A;  1T9H A;  3ND9 A;  1ICW A;  4NDX A;  3E5S A;  4DR5 L;  1GUO A;  3Q0A A;  2FXQ A;  4CHT B;  1SE3 A;  1EYC A;  2VL6 A;  2V1C C;  1J9O A;  2X6L A;  1YJW A;  1NBW A;  1IW7 D;  3S16 B;  1H9S B;  3MXP A;  5J1Z A;  2E2H B;  4R4T A;  4YWK A;  1FYC A;  2B3G A;  2EIF A;  2PZW A;  4G4K A;  2KJX A;  1AP0 A;  4L5R C;  2J4X A;  3IKJ A;  4LF8 Q;  1XMQ L;  1HFN A;  1WOC A;  4B3R Q;  4R9W A;  4XYO A;  3X3N A;  2LXK A;  2WP8 J;  3PUV A;  2WAQ G;  1WTP A;  1I5F A;  4DUY Q;  2QEX A;  1YHQ A;  1E2V A;  1DCZ A;  4ZKB B;  1OXV A;  4LUV A;  1Q86 C;  3PO3 G;  2QEJ C;  4LUZ A;  3TS2 A;  2F0L A;  5FLM G;  4RA8 A;  2L11 A;  1YNJ C;  3DLL A;  2YU9 B;  4BY7 B;  1VS0 A;  3GTJ B;  1S5D D;  1STA A;  4IUQ A;  3EBE A;  3CW2 C;  1F77 A;  3D0F A;  1RL2 A;  4GN3 B;  2A1A A;  4L8J A;  4DR2 Q;  2IPK D;  3MXG A;  3F2B A;  1KLU D;  2JXM B;  1H9K A;  3M7N A;  1STE A;  2QF7 A;  2PI2 A;  4XQN A;  3RD4 A;  3PO3 H;  4WJ4 A;  5C4J H;  3R2I A;  5FLM H;  4JI6 Q;  5GAG C;  2YYZ A;  1RDP D;  4A3G G;  4A3B G;  3PGZ A;  1YVC A;  3NHH A;  2F52 A;  3OW7 A;  1HNW Q;  1PH6 A;  1SYE A;  3A54 A;  4KD4 A;  1BOS A;  1VQ8 A;  2J0T D;  3W3A A;  1A3U A;  1RJT A;  4DN4 M;  1BCP F;  1QOH A;  2UXB L;  1VF7 A;  4K6D A;  4RKL A;  2N8N A;  2E2J B;  5BN5 A;  3J80 i;  3LWE A;  3BS1 A;  2A68 D;  4TVA B;  1ZXT A;  4A3K G;  5C3E G;  3HP3 A;  1ZYR C;  2LKV A;  3NE5 B;  4YHH L;  5C5M A;  4A3G H;  4A3B H;  2E5L L;  3IL8 A;  3CPF A;  4O0A A;  4AYB E;  1KXL A;  1HUM A;  2JQO A;  1JJG A;  3ULP A;  3URY A;  4QUF A;  3A55 A;  1N32 Q;  3NEL A;  4LFC L;  3VR2 A;  1PTO C;  3A56 A;  1Q7Y C;  3FDT A;  1PRT C;  4UY8 C;  3ULJ A;  2I46 A;  1I4X A;  2XSC A;  1HFG A;  1X65 A;  3W2D A;  5K36 G;  3UDG A;  2CQO A;  5C3W A;  4A3K H;  4DNT B;  5C3E H;  1QNU A;  4OEM B;  1YHB A;  1GO3 E;  3NQT A;  3NTI A;  1E1O A;  4IQZ A;  3NEN A;  4CDE C;  3CP0 A;  4G57 A;  4PNY A;  4LFB L;  5IYD G;  2EE1 A;  2C9O A;  2EJF C;  3K5M A;  1JOQ A;  3FPP A;  3K7A B;  4CKC A;  1N9W A;  3IRB A;  4OWT B;  4DR7 L;  1K3R A;  1HNX L;  3MWY W;  2UUC Q;  2HHH Q;  1VQP A;  5K36 H;  4PMW A;  5I2Y A;  2SOB A;  3IFT A;  3J7A V;  4GKJ L;  1B70 B;  5F2D A;  2EYF A;  4ZK9 B;  4LWC A;  4UDU C;  1I3Q B;  3GTO H;  1HTL D;  5IYD H;  3NXW A;  1JB7 A;  1YBY A;  1XNR Q;  5DEH A;  1J8I A;  4JBK A;  1GUG A;  1VQC A;  2F4V L;  2H5X A;  4KK7 A;  4IUU A;  1A3V A;  2UXD Q;  4IFD J;  4IPG A;  3S2D H;  2WIN B;  4ODG A;  2F0V A;  3U50 C;  5I9P A;  5IE8 A;  3RLF A;  1M8A A;  5ELD A;  1B8A A;  1CTM A;  4LFA L;  2NUC A;  3ERQ A;  2A6H D;  1A8V A;  1Q82 C;  2NVQ H;  1FD7 D;  5IYC G;  3A5U A;  3NEM A;  3PV0 A;  5FO7 B;  2KCT A;  3AFP A;  2QDB A;  1U4M A;  3S16 H;  4BY7 G;  2OTJ A;  1AH9 A;  2E2H H;  3TEH B;  5IGG A;  3QIA A;  2F3W A;  1S72 A;  4J6H A;  1V1P B;  4HCE A;  5TSS A;  3KFU A;  3TDQ A;  1JCK B;  4LF8 L;  3BZK A;  4B3R L;  3TRZ A;  1IL2 A;  4AIM A;  5C6A A;  4OGQ C;  4JI7 Q;  3RMH A;  2Q2U A;  5IYC H;  4DUY L;  1X9N A;  4MIU A;  5JJK A;  3HEJ A;  2D5D A;  1JR0 D;  4HN7 A;  4ZQ3 A;  1VQ9 A;  2OEO A;  4JOI C;  2KOL A;  2YU9 H;  4BY7 H;  2F0P A;  3GTJ H;  4KLK A;  1VQA A;  1CHP D;  3ER0 A;  1WTQ A;  4WRD A;  2K5D A;  1RCV D;  2GVA A;  1SAP A;  2I07 B;  2N88 A;  3J81 E;  1I4P A;  1P8L A;  4DV0 Q;  3I56 A;  4HJ9 A;  1LT5 D;  1HA5 A;  4A93 B;  4DR2 L;  1VQE A;  5A2Q E;  3NTH A;  2DNE A;  3ERS X;  4HJ7 A;  1X56 A;  2EYJ A;  1TS3 A;  4X3S A;  1X6O A;  1KNE A;  2EY5 A;  4JC0 A;  1HZC A;  3TME A;  4BA2 I;  1Y1W B;  2PNH A;  4Z9C B;  1EZ6 A;  2EDG A;  5FO9 B;  2SEB D;  2JEA I;  2PYK A;  2UU9 Q;  2DUD A;  3SK5 A;  3VA7 A;  1ZEQ X;  5IOC A;  1ASY A;  2PZT A;  1U9R A;  1AW7 A;  4R8I A;  3CME A;  1MI2 A;  4QQB X;  4JI2 Q;  1JOO A;  3SXH A;  3CCJ A;  3HOU B;  1QCB D;  1L1O C;  1E2W A;  5FK9 C;  3E0E A;  3MXN A;  1JE5 A;  3H91 A;  1S4Z A;  1EL0 A;  1OXS C;  3C46 A;  3BYY B;  1EU4 A;  3KJO A;  4GKK Q;  2O4X A;  5DAU A;  1IBL L;  2DY7 A;  2Q2H A;  3WWV A;  5JEA J;  1HNW L;  4DV2 L;  1TXY A;  1SMY D;  2F0Q A;  3EIV A;  2X6G A;  4LK1 C;  2E2J H;  1FR3 A;  2GVB A;  5M3M B;  3S1Q B;  1KDC A;  5M3F B;  1XYI A;  5JJI A;  1XTD A;  3HS0 C;  3BZD B;  1JQY D;  4NW2 A;  2AKW B;  2R7F A;  4P75 A;  1JB3 A;  4O2D A;  1DGS A;  4FVM A;  1LAC A;  1W6K A;  3PUW A;  1EZ8 A;  1A2T A;  1RIP A;  4OWW B;  3VR5 A;  5C0X I;  2R3Z A;  2VZA A;  1N32 L;  5IGD A;  4N8X 1;  3B6Y A;  2L1B A;  2NN6 I;  2DJG C;  2JA7 B;  3M4O B;  1TY2 A;  1X54 A;  3GTK B;  3M3Y B;  4A3C G;  4DV4 Q;  4A76 A;  5FLX E;  4J1M A;  2WII B;  1XWE A;  4HCS A;  4LF9 Q;  4B3T Q;  1DYQ A;  1VQL A;  2L0C A;  1KDA A;  1L0Y B;  2K5H A;  2L5T A;  2Y0S B;  4IN3 A;  4XTC S;  1L0X B;  1UWV A;  4YWL A;  4KHZ A;  2CQA A;  2A6E D;  1SE4 A;  2BA1 A;  1O7Y A;  4X6A H;  1SXT A;  3DHQ A;  5FJ8 G;  3HOV B;  1DOM A;  5HGT A;  3NP8 A;  1PTO F;  1Q12 A;  3DXJ C;  1SJH D;  5C4H A;  1XNQ L;  1BVS A;  3ITP A;  1PRT F;  2NZO A;  4Y7N B;  2ICI A;  4RCN A;  1W3S A;  1VQG A;  3KLR A;  4QF4 A;  1VQD A;  2UUC L;  2ATW A;  2HHH L;  1OXT A;  1VQ6 A;  2K14 A;  3WOE A;  2O5I C;  4Q5V A;  1ESF A;  1WTX A;  3K5L A;  1I3Q H;  4PMB A;  4UHV A;  4ZAI A;  1K8A C;  3K80 C;  2IWH A;  1CK1 A;  3WOF A;  1IBK Q;  1KDB A;  4ZUI A;  1U4P A;  5FJ8 H;  1SR3 A;  3X3M A;  2XTI A;  2KA7 A;  1DJR D;  1XNR L;  4GS3 A;  3T51 B;  1S5F D;  5J39 A;  5J22 A;  1F9P A;  3Q24 A;  5EBC A;  1FVI A;  1NMG A;  2UXD L;  1N33 Q;  2WAQ B;  2BH8 A;  1P16 A;  2NTS A;  2PQA A;  1EIF A;  1NAP A;  4A4I A;  4DGZ A;  3SK4 A;  3PQI A;  2N49 A;  1EY9 A;  2RQX A;  1VMC A;  2F0D A;  2X69 A;  2BOS A;  3T56 B;  4IUT A;  3D4R A;  1EYG A;  3OWE B;  3A8K E;  4U67 3;  4APV A;  2AHO B;  1AEX A;  1GVP A;  1PZI D;  1PZJ D;  2EJG C;  1L1O A;  2NTT A;  1BCP D;  2EYH A;  3R3O A;  5ELE A;  4NXN Q;  1O7I A;  2Z1C A;  5LMN W;  2HIV A;  2YTY A;  1A3T A;  2ENB A;  5GAE C;  3ULL A;  4DPG A;  4A93 G;  3DM1 A;  1STH A;  4JI7 L;  2HUG A;  1Y1W G;  2RVL A;  3HKZ E;  3IFD A;  2HQL A;  2JE6 I;  1ML0 D;  1W6J A;  2B2Y C;  2PMZ E;  1B3A A;  1SNM A;  2FMM A;  3F2U A;  1V8Q A;  3HOU G;  1LTT D;  4YCW A;  4JI0 Q;  4EGV A;  1LTI D;  5GRO A;  1G91 A;  5ELN A;  4C3J G;  5ELF A;  2BDO A;  2TSS A;  3A74 A;  2Z6B A;  3KDF A;  4L63 B;  3OSO A;  2R7Z H;  4A93 H;  4DV0 L;  3LWU A;  2OCE A;  4KKU A;  5BN3 A;  1B50 A;  4LF6 Q;  2B2W C;  3FVQ A;  3KF8 A;  2JK8 A;  3J81 L;  4MTK A;  4HIM A;  4DNR B;  1S5B D;  2CCZ A;  1Y1W H;  1VQ5 A;  1NUC A;  1X32 A;  2NBF A;  1EYD A;  5M3M G;  3MAQ A;  5M3F G;  1YNX A;  2H4O A;  2Q8I B;  1N8R C;  1O7L A;  4KMU C;  3EFX D;  4F87 A;  3HKS A;  5JPN C;  2UU9 L;  3I4M B;  4DAY A;  4MTN A;  3TS0 A;  2Q8R E;  5IGE A;  4X66 Q;  3HOU H;  1E24 A;  1PH3 A;  1C48 A;  4JI2 L;  3GTM B;  4C3J H;  2WKC A;  4DKA C;  4F8M A;  4DAP A;  1XXG A;  2CWP A;  1NSN S;  3MC0 B;  3CMA A;  1SRU A;  5M5Y B;  3W1B A;  4GKK L;  4DV5 Q;  2JA7 G;  3KBG A;  4HED A;  5I6W A;  3S17 B;  5ELO A;  2L4N A;  2PZU A;  3E0J A;  4IZ8 A;  5E3F A;  5M3M H;  3S1Q H;  1NNX A;  4O42 A;  2K03 A;  5M3F H;  2JA6 B;  4N9T A;  4AH6 A;  1T5E A;  2XVS A;  1U5K A;  4OON A;  4QUC A;  3TSS A;  2HD3 A;  2IT1 A;  2Y0S G;  5LL6 X;  1RF2 D;  4G7H C;  1WJJ A;  4KHP Q;  3KLS X;  1CA5 A;  2K28 A;  4PV1 C;  4IFD I;  5JOB A;  2B2U A;  2EY2 A;  1CI3 M;  5GAH C;  2KCN A;  3NPP A;  1AFP A;  3DWQ A;  2JSO A;  3S2D B;  3HOV G;  1WD0 A;  2JA7 H;  4B08 A;  1HR0 W;  2B8F A;  3M4O H;  2XWB B;  3RR5 A;  3DM3 A;  5H1S E;  3M3Y H;  2E8G A;  2NB0 A;  1AZQ A;  1H9S A;  3C2P A;  4DV4 L;  1IYV A;  1IW7 C;  2FFK B;  1YZ6 A;  5HY6 A;  2B39 A;  2AWO A;  3PUZ A;  3GTQ H;  5FO8 B;  4B3T L;  3K8A A;  5ELB A;  2ZTE A;  3U9S A;  4HJA A;  5FLX L;  3R2T A;  1JE4 A;  2HDL A;  1MHW C;  3HZX A;  1VQH A;  4DR6 Q;  5KIX A;  1SNQ A;  5CV8 A;  2D62 A;  3I2Z A;  2K5Q A;  5IGC A;  2K4K A;  1CT1 D;  1EWC A;  1WCM B;  1XX8 A;  5I9O A;  1B1Z A;  3HOV H;  1ONL A;  1GOZ A;  1Q1E A;  3I8Z A;  4ULL A;  4TKO B;  1TII D;  3VYS A;  2C5C A;  2KEC A;  4K5X A;  2DJF C;  4YCV A;  4Y7N H;  1F9R A;  1II3 A;  1Q46 A;  4DFA A;  1RKN A;  2F0G A;  1TQO A;  4POF A;  1H9R A;  2CWA A;  3QB3 A;  3OTO Q;  5HGQ A;  1G8Z D;  3RZD B;  1J6Q A;  1JC7 A;  4B9X A;  2K5N A;  4BS9 A;  1VQJ A;  4M1U B;  5CC4 A;  3MEF A;  4K8I A;  2JYO A;  1IBK L;  2WFW A;  4JI5 Q;  1A62 A;  2D2C C;  2AQ2 B;  2IJ0 A;  3Q8D A;  3CCR A;  4B3S Q;  1SE8 A;  4U68 A;  2G5D A;  1PH8 A;  4BBS B;  1B9M A;  3D6C A;  2LSS A;  3K5N A;  5AJ3 Q;  2YTV A;  3J7A F;  1YNN D;  3GO5 A;  1YI2 A;  1N33 L;  1CKN B;  2SNS A;  5EJW A;  1KC8 C;  1ILQ A;  2RF4 A;  1MSH A;  2KHS A;  4LW1 A;  1A0I A;  2B2W A;  4MZ9 A;  1SDF A;  5JJL A;  3TRE A;  3JAM L;  5G3L F;  1H95 A;  1EY7 A;  3M7G A;  2ZJQ A;  4HAE A;  5LMN Q;  1SYF A;  2E74 C;  4AYB B;  2K05 A;  4DR1 Q;  1EYA A;  1HQR D;  3RLO A;  1WTW A;  4YCU A;  4DV6 L;  2ICE C;  1JJ2 A;  3GTL B;  3V2T A;  1IYU A;  2A68 C;  4NXN L;  4P71 A;  3T16 A;  1PYW D;  2VQF Q;  3I4N B;  3VYR A;  4CJ2 C;  1K73 C;  1QUQ B;  4FP5 D;  1HQM C;  2OQ0 A;  1KQS A;  1IKM A;  2Z6K C;  4DA2 A;  5EPL A;  5BN4 A;  3T13 A;  3UDI A;  4GLX A;  2Q2T A;  3ZYY X;  1EQT A;  3H09 A;  3STB D;  3I90 A;  1X3Q A;  5JAV A;  3Q6S A;  2N55 A;  2NWG A;  3Q22 A;  2UUB Q;  3I4M G;  1AE2 A;  4EX5 A;  1Y8N B;  1PVO A;  3UE0 A;  1SYC A;  2HCI A;  3K5O A;  4JI0 L;  2CW0 D;  1K8M A;  3I4L A;  1TWF B;  2HT1 A;  3BDO A;  4MN3 A;  1PH7 A;  2PI2 E;  1SNC A;  3ND8 A;  4LF6 L;  1XMO Q;  2NVT B;  3E9H A;  2VQE Q;  3F2C A;  2VNU D;  3L0O A;  1ZYR D;  3BJU A;  2JA6 G;  2F0I A;  3PUY A;  3TN2 A;  5IOD A;  1GXD C;  5KND A;  3I4M H;  4R4I A;  1FNU A;  1MJC A;  2EXD A;  1GD7 A;  5GAD C;  1BR9 A;  5GQO A;  3MFY A;  3L7Z C;  4X66 L;  3GTM H;  1YJ9 A;  2F03 A;  1PTO D;  4P73 A;  2BA0 A;  2HIX A;  1BDO A;  1PRT D;  3KUP A;  3U4V A;  5D3D A;  3MA2 B;  4DNI A;  4YWM A;  3M4Q A;  1EU3 A;  5L37 A;  5M5Y H;  3UI2 A;  1UE6 A;  4K2K A;  1VQO A;  5I2X A;  3AQQ A;  4OHJ A;  4QGU A;  3GDE A;  4DV5 L;  3S17 H;  1HTP A;  1DON A;  2K50 A;  3CC2 A;  3DUZ A;  4EVO A;  3T1H Q;  4FF2 A;  1F9Q A;  2TMP A;  2M00 A;  2JA6 H;  2KEE A;  3F2D A;  3I70 A;  2HDM A;  2OWO A;  5C3X A;  1EUJ A;  1B44 D;  3LX0 A;  1HR0 Q;  2MNA A;  4KHP L;  3HFZ B;  3I3C A;  3CHB D;  2YTX A;  5NUC A;  5C4X B;  3J7Y W;  1I94 Q;  1WCM G;  4EQN A;  4RGM A;  3VYU A;  3CCV A;  1QJO A;  3HOW B;  4GLV B;  2WKD A;  1G2T A;  4IPC A;  1N36 Q;  4IUV A;  3J80 E;  3MXU A;  4I7Z C;  3H94 A;  3L3O C;  1HJP A;  1PMR A;  3W5O A;  5KEE A;  1V1P A;  1YJN A;  1K83 B;  1G29 1;  2NVX H;  1D6E C;  2RSN A;  2QW7 A;  1MKH A;  1EQR A;  2I5H A;  2MUY A;  1BO0 A;  3KLW A;  3CAM A;  3VA5 A;  4DR4 Q;  1S5E D;  1CZW A;  4DR6 L;  1WCM H;  2KQ3 A;  2K1B A;  5CV7 A;  4KTA A;  3DEP A;  1NCV A;  1SBB B;  4RHS A;  4BBS G;  4DR3 Q;  1LT3 D;  3PIP A;  4ZRZ A;  1S40 A;  4XYQ A;  1EFW A;  1EIY B;  1PFS A;  1TWG B;  1CKO A;  2MO1 A;  4EQ5 A;  2GN5 A;  2EY1 A;  1JIC A;  3OTO L;  4IOA A;  1STG A;  3RZD H;  2Z6K A;  5EAY A;  2KUM A;  1SN8 A;  4WJW A;  3AU7 A;  1HZ9 A;  4L6T B;  2CH4 A;  4DUZ Q;  2UUA Q;  3KF6 B;  2BE5 C;  4AYB G;  5CR3 A;  2A5H A;  4RWS C;  4A3F B;  4P2C B;  1Z47 A;  4GN5 A;  1C0A A;  4HJ8 A;  4BBS H;  4JBJ A;  2R7Z B;  3PO2 B;  1BQQ T;  3E9I A;  4JI8 Q;  2K5W A;  4B3S L;  2KCM A;  1PDQ A;  2AUJ D;  2KHJ A;  2QKI C;  5AJ3 L;  2AQ3 B;  2DGY A;  3MTS A;  3NBH B;  3I4N G;  2LY7 A;  4KKS A;  3WDN A;  1ENC A;  1YHA A;  2EY6 A;  2CFM A;  4BWG B;  3TP8 A;  1M1K C;  1WTV A;  1WVL A;  3SDZ A;  4JI6 L;  3OPO A;  1PZK D;  5LMN L;  1QE6 A;  1D1K A;  3K0X A;  1SMY C;  4C3J B;  4DR1 L;  2RHQ B;  3H3V C;  3GTL H;  1FJG Q;  4A3D B;  2XWJ B;  2BH2 A;  5DNF A;  3VDY A;  3ONA B;  4KHV A;  1B7Y B;  2RA4 A;  5KNC A;  2WB1 E;  4K8J A;  4KKT A;  5JEA H;  1KNA A;  2JA9 A;  2IL8 A;  2EVB A;  3I4N H;  3MFG A;  1Y8P B;  1TKW B;  1Z9F A;  2A69 C;  2NZ1 D;  3PIO 3;  2VQF L;  1K9M C;  1PYS B;  3G6J B;  3QO2 A;  2PQE A;  1XJV A;  3NTK A;  4A3E B;  3A5Z B;  3CCE A;  1KL9 A;  1Q8K A;  1Z6H A;  1JWM D;  4O1N A;  3P75 A;  3JAM i;  3JC6 6;  3SK8 A;  1U0L A;  2E75 C;  3R8B A;  4C1N K;  3S15 B;  4DF7 A;  2MPM A;  3SR1 A;  3NBI A;  1IL8 A;  1C7Y A;  4WFN 3;  1CSQ A;  1RD9 D;  5KNB A;  1FGU A;  1TWF H;  5DLQ E;  5JPM C;  4LMQ D;  3G6E A;  4KN7 C;  3CCQ A;  1EIG A;  2Q2I A;  2Z4I A;  4QJF A;  4V0B A;  1X3P A;  2NVT H;  3GTQ B;  4FF1 A;  4YY3 Q;  1XMO L;  5CV5 A;  4RHR A;  2VQE L;  1NTG A;  1PHJ A;  3A0J A;  3H6M A;  4AQY Q;  4B3M Q;  3S9W A;  3BVM A;  5COY A;  1I50 B;  1VMP A;  1I4Q A;  4JYA Q;  2K75 A;  3NWT A;  3TP7 A;  3BU2 A;  1E22 A;  3SGI A;  1DOK A;  4BXX G;  3MEH A;  5C4X G;  3RUZ A;  5IT9 E;  2Z4H A;  4RGT A;  1D2B A;  3SE0 A;  5IWA Q;  2ZJP A;  3HOW G;  1KIX A;  3V96 A;  4X65 Q;  1VQN A;  3T1H L;  5M5X B;  1BF4 A;  4HIO A;  2P5Z X;  4ZCK A;  4HMJ A;  3TP6 A;  4GOP B;  4C3I B;  2B2V C;  4A3L G;  3PCO B;  3FKI B;  4JOI A;  1MBY A;  1YEZ A;  2KBN A;  3D6W A;  1HR0 L;  1OO9 B;  4BXX H; 
#chains in the Genus database with same CATH homology
 1FL0 A;  2A19 A;  4A3G H;  4A3B H;  5C4X H;  2E5L L;  3W1G A;  3CPF A;  4O0A A;  4AYB E;  4IFD I;  1KXL A;  2JQO A;  1JJG A;  2Y0S E;  3ULP A;  5JEA G;  4A75 A;  1EQQ A;  1N32 Q;  5GAH C;  2NZH A;  3OW2 A;  1I94 L;  3NEL A;  4LFC L;  3HOW H;  3HOV G;  2JA7 H;  1HR0 W;  4UP9 A;  1Q7Y C;  3M4O H;  4UY8 C;  3RR5 A;  3DM3 A;  3ULJ A;  5H1S E;  3G4S A;  3M3Y H;  2MO0 A;  2E8G A;  4JV5 Q;  3S1N H;  1JJC B;  3FP9 A;  4DV4 L;  4LNQ A;  1YZ6 A;  1N36 L;  5HY6 A;  1UEB A;  3J81 c;  2AWO A;  3PUZ A;  3GTQ H;  4GNX B;  5IP9 G;  1X65 A;  5K36 G;  4A3L H;  1K83 H;  4B3T L;  3UDG A;  1X3F A;  2CQO A;  3K8A A;  4A3K H;  5C3E H;  2ZTE A;  4HJA A;  1YHB A;  1GO3 E;  1GKH A;  4DV7 Q;  1E1O A;  3LGJ A;  1PH5 A;  4RMF A;  3NEN A;  1VQH A;  4DR6 Q;  3K7U C;  2D62 A;  3I2Z A;  4A3F G;  3CP0 A;  2UXC Q;  2K4K A;  4DR4 L;  1SFO H;  5IYD G;  4LFB L;  1NE3 A;  3HOV H;  4PZ8 A;  2ZTD A;  1HZA A;  1Q1E A;  2R7Z G;  1SLJ A;  3PO2 G;  2A8V A;  4LF5 L;  2PQA B;  3GD7 A;  1CUK A;  1N9W A;  4YCV A;  3EN2 A;  4Y7N H;  2E2I H;  3IRB A;  4OWT B;  4DR7 L;  1Q46 A;  1K3R A;  4QL5 A;  1HNX L;  4DR3 L;  1TWG H;  4IPD A;  4POF A;  2UUC Q;  5IP9 H;  2HHH Q;  2CWA A;  1VQP A;  4PMW A;  1SMX A;  3OTO Q;  4NXM Q;  4IJL A;  3H0G G;  2I5M X;  5HGQ A;  2WAQ E;  3L2P A;  3J7A 5;  1A63 A;  2OQK A;  3CCS A;  3MXN B;  4GKJ L;  1B70 B;  2UUB L;  1J6Q A;  3CD6 A;  2K5N A;  1VQJ A;  4LWC A;  1W2B A;  4JI4 L;  1Q81 C;  4A3F H;  3MEF A;  4OX9 L;  2K52 A;  4A3J G;  1Y14 B;  3GTO H;  4DUZ L;  2UUA L;  5IYD H;  2ALY B;  4LUO A;  1IBK L;  1JB7 A;  1YBY A;  2WFW A;  1A62 A;  1R9T H;  1QZH A;  4JI5 Q;  1XNR Q;  4JBK A;  4L5T A;  3FHW A;  4A3D G;  3PO2 H;  3Q8D A;  3CCR A;  1VQC A;  2F4V L;  4IJH A;  2H5X A;  3CXC A;  2ZTC A;  4B3S Q;  1SE8 A;  1PH8 A;  2UXD Q;  2MQH A;  3RLN A;  2L15 A;  4JI8 L;  2LSS A;  4IFD J;  4X62 L;  5AJ3 Q;  2YTV A;  4IPG A;  3G71 A;  3GO5 A;  3S2D H;  1YI2 A;  1N33 L;  1CKN B;  1KC8 C;  3M9B A;  3U50 C;  2RF4 A;  2QGQ A;  1NMF A;  1QVF A;  2CKZ B;  1X55 A;  5IE8 A;  2EQS A;  3H0G H;  4LW1 A;  3RLF A;  1V9P A;  1A0I A;  4UP7 A;  1B8A A;  3RN2 A;  3S1R H;  4MZ9 A;  4LFA L;  4WJ3 M;  1JT8 A;  1A8V A;  4A3E G;  5JJL A;  4H02 A;  2I0Q A;  1Q82 C;  4JI3 Q;  3TRE A;  1YIJ A;  2NVQ H;  4UP8 A;  1H95 A;  2ZJQ A;  3A5U A;  5IYC G;  4A3J H;  2LXJ A;  3NEM A;  5LMN Q;  4DV3 Q;  1J5E L;  4LF7 Q;  5BR8 Q;  4R4Q A;  4DR1 Q;  4DR5 Q;  3PF5 A;  3PV0 A;  3J80 c;  2KCT A;  3AFP A;  4A3D H;  3RLO A;  3S16 H;  4YCU A;  2C35 B;  4DV6 L;  1PH9 A;  2VUM G;  4BY7 G;  2E2H H;  2OTJ A;  1JJ2 A;  1AH9 A;  3UDX A;  3TEH B;  5IYB H;  3KDF B;  3HOX G;  1D8L A;  1VQI A;  5C0X G;  4GOP A;  1PH1 A;  3HOY G;  2IY5 B;  4LFB Q;  4PG3 A;  4MNO A;  1S72 A;  1L0W A;  4NXN L;  4P71 A;  3M4P A;  1XMQ Q;  2VQF Q;  1V43 A;  2IX1 A;  3K7A H;  3KFU A;  1VQ4 A;  4LF8 L;  3BZK A;  4X64 Q;  1QUQ B;  4R4C A;  1K73 C;  4B3R L;  2RCN A;  4A3E H;  2OQ0 A;  3TRZ A;  4A3C H;  1IL2 A;  1EOV A;  4AIM A;  3CCU A;  4HJ5 A;  1KQS A;  4JI1 L;  4JI7 Q;  2Z6K C;  2Q2U A;  2JA8 G;  1M90 C;  1HZB A;  3CF5 A;  3BZC A;  4UPA A;  3UDI A;  5IYC H;  4DUY L;  1X9N A;  4GLX A;  5JJK A;  4JBW A;  2Q2T A;  1QVC A;  1OXU A;  3D31 A;  3STB D;  5IY0 A;  4OXP A;  5LMU Q;  3S15 H;  2D0O A;  1D7Q A;  4GKJ Q;  1VQ9 A;  2UUB Q;  4JOI C;  3I4M G;  1AE2 A;  2YU9 H;  2VUM H;  4EX5 A;  4BY7 H;  1TWH H;  3GTJ H;  4KLK A;  4GNX A;  1PH4 A;  2B63 G;  3HOX H;  1VQA A;  2AWN A;  1C9O A;  3ER0 A;  3CC7 A;  3HOY H;  1PVO A;  3UE0 A;  3J81 j;  1LM0 A;  4NPS A;  4QIW E;  2GVA A;  4JI0 L;  2HT1 A;  1P8L A;  4DV0 Q;  3I56 A;  1E3P A;  3PIO A;  4HJ9 A;  2YV5 A;  1PH7 A;  2N3S A;  2PI2 E;  3S24 A;  1HNZ L;  4GN4 B;  1QZG A;  4DR2 L;  1VQE A;  1V1Q A;  4LF6 L;  1XMO Q;  3ERS X;  4HJ7 A;  1K8G A;  4LF9 L;  4JG2 A;  1IYJ B;  1X56 A;  3E9H A;  2VQE Q;  3J7Z C;  3F2C A;  1PH2 A;  2JA8 H;  4YY3 L;  1X6O A;  2OTL A;  4JBM A;  2VNU D;  2ATW A;  3L0O A;  1IXR A;  4JC0 A;  1HZC A;  4PZ6 A;  3BJU A;  4BA2 I;  2PNH A;  2JA6 G;  4OO1 I;  1IBM Q;  3RN5 A;  3PUY A;  1I50 H;  3CPW A;  3JAM c;  1VQB A;  4AQY L;  4B3M L;  2JEA I;  4R4I A;  3I4M H;  2UU9 Q;  3FKI G;  2DUD A;  3ZJY C;  1MJC A;  1BBW A;  2EXD A;  1GD7 A;  1L2F A;  5GAD C;  1ASY A;  3CC4 A;  2B63 H;  4JYA L;  5GQO A;  2ZM6 L;  3CME A;  3GTM H;  3L7Z C;  4X66 L;  3F1Z A;  4JI2 Q;  3CCJ A;  1YJ9 A;  4QQB X;  4P73 A;  2BA0 A;  1L1O C;  2HIX A;  3E0E A;  2WB1 G;  3U4V A;  1JE5 A;  3PF4 A;  4DNI A;  4YWM A;  3M4Q A;  4L5S A;  1OXS C;  4DV6 Q;  1N34 Q;  5M5Y H;  3K81 C;  1UE6 A;  3T1Y Q;  3KJO A;  4LF4 L;  4GKK Q;  1VQO A;  4DV2 Q;  1IBL L;  3AQQ A;  2Q2H A;  4QGU A;  5IWA L;  3WWV A;  5JEA J;  1TWC H;  3GDE A;  4DV5 L;  4DV2 L;  3S17 H;  1HNW L;  2K50 A;  2UXB Q;  3CC2 A;  4OO1 G;  3T1H Q;  5M5X H;  4X65 L;  1TXY A;  3EIV A;  4K0K L;  1XPO A;  2E2J H;  2JA6 H;  2GVB A;  3F2D A;  2D0P A;  1AE3 A;  3HKZ G;  3PUX A;  2OWO A;  1EUJ A;  4C3I H;  5JJI A;  3FKI H;  1KHI A;  1NY4 A;  1XTD A;  4R1J A;  1CKN A;  4NB3 A;  1E7Z A;  1L1O B;  3H3V I;  1HR0 Q;  2AKW B;  2R7F A;  4P75 A;  4YHH Q;  2MNA A;  4O2D A;  3I55 A;  1DGS A;  3CCM A;  2E5L Q;  2NVY H;  4KHP L;  3PUW A;  4DV1 L;  1PV4 A;  3S2H H;  3HFZ B;  2IHF A;  5IYB G;  1BKB A;  2YTX A;  4GNX C;  1VQ7 A;  1RIP A;  3GTP H;  2JJQ A;  4OWW B;  4L5Q A;  2R93 G;  1I94 Q;  5C0X I;  4LFC Q;  1WCM G;  2VZA A;  1CKM A;  1N32 L;  1KAW A;  2JEB I;  1PA6 A;  1VQM A;  3CCV A;  4A3I G;  3B6Y A;  2NN6 I;  4GLV B;  3S1M H;  1WI5 A;  4DAM A;  1X54 A;  4A3C G;  4DV4 Q;  4JV5 L;  4OWX B;  4IPH A;  4IPC A;  4A76 A;  1N36 Q;  3I4O A;  5E7N A;  1HJP A;  3W5O A;  4B3T Q;  1Y1V G;  3TQY A;  4LF9 Q;  4BA1 I;  5FLX c;  1VQL A;  1YJN A;  1WFQ A;  4JCV E;  2K5H A;  2VW9 A;  1E1T A;  4XTC S;  1G29 1;  2NVX H;  4P74 A;  1QUQ A;  1UWV A;  1YIT A;  4YWL A;  2VS1 A;  1MKH A;  1FJG L;  1LUZ A;  4DV7 L;  4KHZ A;  1EQR A;  2I5H A;  3KLW A;  2QA4 A;  4DR4 Q;  2BA1 A;  3CAM A;  2F3I A;  4DR6 L;  4TQU S;  2R93 H;  1WCM H;  4X6A H;  2UXC L;  2NN6 G;  3U4Z A;  5FJ8 G;  3KF8 B;  4PZ7 A;  4A3I H;  1HR0 L;  1LTL A;  4LF5 Q;  3STB C;  3ICE A;  4BBS G;  4DR7 Q;  2K5V A;  1LYL A;  1Q12 A;  3KOJ A;  1HNX Q;  1XNQ L;  1BVS A;  3PIP A;  3UDF A;  4DR3 Q;  2NZO A;  1OTC A;  1S40 A;  1EFW A;  1EIY B;  1IBL Q;  4ME3 A;  3H3V H;  1W3S A;  1VQG A;  1PFS A;  1KRT A;  3S14 H;  1Y1V H;  5IT9 c;  1VQD A;  4DAY B;  1CKO A;  1SRO A;  2IX0 A;  2MO1 A;  3OYY A;  1OXT A;  2GN5 A;  2K14 A;  4EQ5 A;  4IOC A;  2RHS B;  2HHH L;  1XPR A;  1VQ6 A;  3OTO L;  4NXM L;  4ALP A;  1UE7 A;  4IOA A;  2Z0S A;  3RZD H;  2Z6K A;  2IHE A;  5EAY A;  2AMC B;  1X3E A;  1UE1 A;  1HH2 P;  1I3Q H;  1SN8 A;  1TWA H;  1K8A C;  4JI4 Q;  3K80 C;  1HZ9 A;  4P72 A;  4DK6 C;  3H15 A;  4OX9 Q;  4DUZ Q;  2UUA Q;  3KF6 B;  4BBR G;  2B29 A;  3RZO H;  4AYB G;  1IBK Q;  4DK3 C;  1VQF A;  1Q1B A;  3GTG H;  1Z47 A;  5FJ8 H;  1SR3 A;  2XTI A;  4GN5 A;  1C0A A;  1OXX K;  2F4V Q;  1XNR L;  1CSP A;  4GS3 A;  4HJ8 A;  3RNU A;  4R4O A;  4BBS H;  4JBJ A;  4J15 A;  3E9I A;  4JI8 Q;  1FVI A;  3CCL A;  1NMG A;  2I5L X;  4QY7 A;  4X62 Q;  4IO9 A;  2KCM A;  2ID0 A;  4B3S L;  4POG A;  2KHJ A;  2UXD L;  4RG1 A;  1N33 Q;  2N78 A;  2BH8 A;  5AJ3 L;  2DGY A;  3NBH B;  1P16 A;  3I4N G;  2PQA A;  5C0X J;  2R92 G;  1EIF A;  4BY1 G;  2MFI A;  4A4I A;  4LFA Q;  1YHA A;  1UE5 A;  3GTK H;  1BBU A;  2CFM A;  2N49 A;  4KI0 A;  1M1K C;  1GM5 A;  3U58 A;  4JI3 L;  5IP7 G;  4JI6 L;  1KD1 C;  4BBR H;  1J5E Q;  1EYG A;  1WYD A;  1T9H A;  5LMN L;  4DV3 L;  3K0X A;  4LF7 L;  4APV A;  5BR8 L;  4DR1 L;  4DR5 L;  2FXQ A;  2RHQ B;  2VL6 A;  2ZJR A;  4IFD G;  2V1C C;  2AHO B;  4A3M G;  3GTL H;  1FJG Q;  2UUC L;  2BH2 A;  1YJW A;  1NBW A;  1GVP A;  3VDY A;  1B7Y B;  3UE1 A;  1L1O A;  2WB1 E;  4R4T A;  4YWK A;  1PYB A;  2B3G A;  2JA9 A;  2EIF A;  4NXN Q;  1O7I A;  4L5R C;  5LMN W;  3I4N H;  2R92 H;  1Z9F A;  4BY1 H;  2HIV A;  2YTY A;  3KJP A;  3HOZ G;  4LF8 Q;  1XMQ L;  3J81 i;  5GAE C;  2VQF L;  1K9M C;  1WOC A;  3ULL A;  1PYS B;  4DPG A;  4B3R Q;  4A93 G;  1MJE A;  2LXK A;  3M85 A;  4JI1 Q;  4C2M H;  2WP8 J;  4X64 L;  2JA5 G;  1XNQ Q;  1XJV A;  2KHI A;  2WAQ G;  3PUV A;  3A5Z B;  3CCE A;  2ASB A;  1IZ6 A;  5IP7 H;  1KL9 A;  2VY3 A;  1I5F A;  1Q8K A;  4DUY Q;  4JI7 L;  2QEX A;  1YHQ A;  1Y1W G;  3HKZ E;  2HQL A;  2JE6 I;  3JAM i;  3G48 A;  3JC6 6;  1U0L A;  1OXV A;  4LUV A;  2PMZ E;  1S3O A;  1Q86 C;  3PO3 G;  5C44 G;  4XIG S;  5LMU L;  4A3M H;  4LUZ A;  1C7Y A;  3TS2 A;  5FLM G;  1CSQ A;  1JMC A;  1G51 A;  3DLL A;  3HOU G;  1VS0 A;  3EBE A;  4YCW A;  4JI0 Q;  3CW2 C;  5GRO A;  1FGU A;  1TWF H;  3D0F A;  1RL2 A;  5ELN A;  4GN3 B;  3HOZ H;  5DLQ E;  3A74 A;  3AFQ A;  3KDF A;  2A1A A;  2R7Z H;  3I7F A;  3G6E A;  1HNZ Q;  4A93 H;  3AYH B;  3CCQ A;  2Q2I A;  4DV0 L;  2OCE A;  4DR2 Q;  4Y52 H;  2JA5 H;  4QJF A;  4LF6 Q;  2NVT H;  3F2B A;  1G6P A;  2JK8 A;  4YY3 Q;  4HIM A;  1XMO L;  2CCZ A;  2VQE L;  3M7N A;  1Y1W H;  2PI2 A;  2ES2 A;  1NTG A;  1PHJ A;  1VQ5 A;  3A0J A;  5M3M G;  1KRS A;  1VQK A;  5M3F G;  1YNX A;  1N8R C;  4AQY Q;  4B3M Q;  1IBM L;  3PO3 H;  5C44 H;  4WJ4 A;  5C4J H;  2KEN A;  3HKS A;  5FLM H;  4JYA Q;  4C3H H;  2ZM6 Q;  2UU9 L;  3TS0 A;  4MTN A;  4JI6 Q;  1XPU A;  2K75 A;  4X66 Q;  3HOU H;  3BU2 A;  1E22 A;  1VCI A;  3SGI A;  5M5W H;  5GAG C;  1E24 A;  2YYZ A;  3KYH C;  4GOP C;  1PH3 A;  4BXX G;  4A3G G;  4JI2 L;  4A3B G;  3PGZ A;  4C3J H;  5C4X G;  4DKA C;  1I6H H;  2CWP A;  2R6G A;  1YVC A;  4LF4 Q;  3CMA A;  3KF6 A;  1SRU A;  1N34 L;  2XGT A;  2F52 A;  3T1Y L;  3W1B A;  4GLA C;  5IWA Q;  2ZJP A;  1X3G A;  4DV5 Q;  1PH6 A;  3HOW G;  1KIX A;  4GKK L;  1VQ8 A;  1HNW Q;  2JA7 G;  2R7D A;  4X65 Q;  3F8T A;  3CQZ H;  5ELO A;  4K0K Q;  2UXB L;  1QVG A;  1VQN A;  3T1H L;  1NJI C;  2N8N A;  1ASZ A;  5M3M H;  3S1Q H;  4HIO A;  5M3F H;  4AH6 A;  1K0R A;  5J3B A;  3PSI A;  3J80 i;  1EWI A;  1MIU A;  1U5K A;  4OON A;  4GOP B;  4A3L G;  4BXX H;  3PCO B;  2IT1 A;  2Y0S G;  4FDB A;  4JOI A;  1YEZ A;  2KBN A;  4TVA B;  3AEV A;  1WJJ A;  4A3K G;  4JI5 L;  5C3E G;  4HID A;  4DV1 Q;  4KHP Q;  4HIK A;  4YHH L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...