1QNUA

Shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords Shiga toxin 1 variant B subunit
publication title Shiga-like toxins are neutralized by tailored multivalent carbohydrate ligands.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 17
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qnuA00
4P2CB 2BOSA 1CZWA 1CQFA 2C5CA 4ULLA 2XSCA 2GA4B 1BOSA 1QNUA 1R4QB 1QOHA 4M1UB 1D1KA 1D1IA 1C4QA 1DM0B 3MXGA 1R4PB 1CZGA 1C48A
chains in the Genus database with same CATH superfamily
3M7GA 2C5CA 4K2LA 1CTMA 3H91A 1BF4A 2UUCQ 2PCFB 5NUCA 2FMMA 4JI3L 3K7AB 1KC8C 4JI4L 3SK6A 2F0JA 4DK0A 2L0CA 3CQZB 3AMUA 1FNUA 4GOPB 3IKJA 2XN9C 1WCMB 2AUJD 3NTIA 3GTPB 3G6EA 2R61A 4X64L 3F1ZA 2RDFA 4QQBX 3S9WA 2FFKB 3W1GA 2CKZB 2P5ZX 1BXTA 4DR2L 2O4XA 4DR5Q 1QNUA 4X65L 3MEHA 2MGSA 1STNA 3L0OA 4O2DA 2LKVA 2G9DA 2GN5A 4ZCKA 5KYLA 4JI6L 2SEBD 1SNCA 4DKAC 4DXGA 1JICA 2JA5G 4A3DH 2KEDA 2IHEA 1C4QA 2XIWA 5JEAG 3CC2A 5M3FG 4A3EH 1F2MA 5ELBA 3NPPA 1EFWA 1ZXTA 1FR3A 1E0BA 1HNXQ 4NP5A 2QW7A 5EGTA 3U9SA 4IFDH 1TWCB 1BCPB 5E4XA 4IFDI 5CC4A 1OXTA 2E76C 1G2SA 4JCVE 3UDGA 4LMQD 3Q6SA 4LFAL 4GZYC 4QGUA 3ULLA 3KLSA 1NNXA 1ET9A 4M1UB 4J15A 4CBVA 3ND9A 5EKKA 1WCMG 1D2BA 3OTOQ 5CYUA 2B2VC 2CWPA 3H94A 3SDZA 3OW7A 4EQNA 5M3MH 1B3AA 1NAPA 3E9IA 5K36H 3NUCA 4OELB 2A19A 4JI0Q 2B2VA 4GNXC 5C4XH 4LFBL 1S5DD 1Y8PB 3UDXA 1XMOQ 1DCZA 1MSGA 3K57A 3L9AX 4NW2A 5IT9c 5J1ZA 1EYCA 3F2BA 4GNXA 4IUQA 3E5SA 3I4NG 1N34L 4DV2Q 1VQBA 3I72A 5M5WH 4A3MH 3MXUA 1L1OC 4N8X1 4FYDA 1DGSA 4FO2A 2CWAA 1B1ZA 1FGBD 3S1RB 4RHSA 3M3YH 2R93B 1AW7A 3FKIB 3PIO3 3CXCA 3H3VC 1L1OA 1T5XD 2NTTA 3AQQA 1NSNS 2V4DA 1MI2A 3PUYA 4DV1L 1V1OA 1CA5A 1NMFA 5C5MA 2A68C 5D65A 4K2KA 1HNWL 3SK5A 2ZM6Q 1PLFA 1Y1WG 1PZKD 5IOCA 5EAYA 5L37A 4AQYQ 3KLSX 5C0XJ 2B29A 3J80i 3W5OA 1GKHA 1S5FD 2EPBA 5KYIA 1A15A 1SE4A 1PH6A 1VQ6A 4Y7NB 2RDGA 3S14H 4RCOA 3OYYA 4WJWA 4A3KH 2L55A 1WTRA 2CFMA 2NN6H 2IY5B 2NN6I 4A93B 4CJ2C 4DF7A 2F0IA 2HHHQ 1ZYRC 4X3KA 4CDDC 1PTOC 2FJ2A 4BBRH 4MN3A 4QF4A 1X55A 2PI2A 3SGIA 2RSOA 3E3XA 2R93G 1B3QA 3J81c 2BE5D 3DXJC 3MXGA 1ESRA 1F2LA 3MAQA 3R2TA 1LT5D 4RAUC 3ICEA 1RDPD 3EN2A 4TQUS 1LV9A 2A69D 1XWEA 3M4QA 4EQPA 2R92B 2A8VA 3MXPA 4BBSB 1G6ZA 2CQOA 1UEBA 2Q8RE 1SE2A 3T4AC 4P75A 3TMEA 2OTJA 2XNAC 4BY7H 3S2DH 1OXVA 5EBCA 3N52A 4J1MA 1YNNC 4HEDA 3QO2A 1KDAA 5LMNW 4DV5Q 2N88A 1NR4A 5C4JB 4LFCL 2UU9Q 2R3ZA 4I65A 1EZ8A 1Q1EA 1K83H 2R7ZH 3KFUA 1I6VC 1JOKA 4PQXA 1DJRD 2ZTEA 2XTIA 1M4VA 2CCZA 3K7UC 2L5TA 1AE3A 4K8IA 4LF5L 2BH2A 1J6QA 4X66Q 1N36L 1ENFA 1N8RC 1EY9A 1VF5C 4BWGB 1T9HA 3NP8A 1EQTA 4A3FH 1LUZA 2WKCA 5KIXA 2H5XA 3BZDB 4BA1I 5IYBH 5CV8A 3CCSA 1GJXA 1Y1VH 4O1NA 5A35A 3T1HQ 2DN8A 4A3LG 4XQJA 2K03A 1QE6A 1T5EA 4DR3L 2E5LQ 1S4ZA 4UP7A 2R92G 4BBSG 1EY5A 1KABA 5FJ8H 5CV7A 5I4DA 4A3CH 4OXPA 1Q8KA 4PZ8A 2MNAA 3GTKB 1PYWD 1VF7A 5G3LD 3TS0A 4RCNA 4GNXB 2H4OA 3LGJA 5HURA 5H1SE 1ML0D 2QILA 1V1PA 2F0HA 4ZUJA 2DUDA 2EJGC 1RODA 1U9RA 4IJLA 3PIPA 3HOVG 1O7IA 3T13A 4X3TA 5AJ3L 4DV2L 3W2DA 1SEBD 3K81C 3GP7A 1TY2A 3BZKA 1L1OB 1VQIA 3RN2A 1PFBA 1RD9D 4C3JG 3GTOH 4KHZA 5C3EG 3HOUG 4JOIC 1RCVD 3M9BA 4R4IA 5M5XH 2E2JH 1I6HB 3PO2H 2F0LA 1CZGA 1OO9B 1PRTF 4LWCA 3RLFA 4EX5A 4CJ1B 1GD7A 1MSHA 4JOIA 3RZDH 3AEVA 1C7YA 1TR5A 3PMFA 4PMBA 4LJZC 3DMUA 2JYOA 3HOXB 1JJCB 1Z47A 5CMDA 1K73C 4NXMQ 3KDFA 2FINB 2IWHA 4PMCA 3CF5A 2Q2IA 1XPOA 3DUZA 5JAVA 3VR4A 4JBMA 4K5WA 1CZWA 3QG1A 2NZOA 5E1FA 1YNXA 2ZXOA 1S5ED 1K9MC 4JI2L 4MTNA 3J7A5 2Q8TA 1CA6A 4JI8Q 2IPKD 4PZ6A 2WB1E 5C44H 3A8KE 3J81i 2HHHL 2UXBL 1RL2A 3ER0A 5IWAQ 3FHWA 4DUYQ 1E2ZA 1TWHH 1F9SA 3KF8A 3F2DA 3AFQA 1W2BA 3KYHC 2WB1G 4TRDA 1K8GA 2Z6BA 4LF8L 3AYHB 3MA2B 1HTLD 4S3SA 3HGBA 2OWOA 1SYCA 3VYSA 1E1OA 2PZWA 3H0GH 4B9WA 3BYYB 4ZYSA 4DPGA 2OTLA 3S15H 1PHJA 1HPCA 1H95A 3A7LA 3F2CA 3M85A 1B53A 2IT1A 4JBKA 4QMGA 2VQFQ 3A74A 3U58A 1A2UA 2RDHA 1OXUA 3C2PA 3GTGB 3HOXG 4B3SQ 2KHSA 4G57A 3Q22A 1LTSD 3S15B 1R9TB 3U4VA 2QA4A 4IUUA 2YV5A 3VR5A 3RZOB 4YWLA 3S1QB 3NQIA 5I2XA 2PZTA 1LTTD 4IN3A 3M7NA 4GS3A 3QB3A 3TBIB 5IE8A 4LNQA 3J80L 2KQ3A 3GTQH 3M4OH 1WTHA 3WOEA 1LTGD 2F0OA 2PMZB 3DHQA 1UE5A 3CKIB 1G2TA 2K4KA 1R4QB 4KKSA 3BDCA 3GD7A 1SFOH 2BDOA 3T53B 4A4IA 5JJIA 2F4VQ 3PGZA 2JA9A 1GUSA 4M8AA 4CDEC 5GQOA 2Q8IB 4EQ5A 3OPOA 2JA6B 1JORA 1D5ZC 1SYDA 1YHQA 3PO3H 4Q5VA 1SFOB 2O5JC 1S40A 4JYAQ 3BVGA 1UE1A 3CPFA 1TU2B 4DAYA 2BE5C 4BY1G 1VQFA 4XT1B 4NXNL 4C3IG 1EY6A 4IPHA 1CKMA 4OX9L 2A69C 3HKZB 3F2UA 2N55A 4H44C 1STYA 2WAQE 5DNFA 1IBLL 1PMRA 3EQLC 1EOVA 1CHPD 5E4WC 1I4QA 4PMWA 2JA8H 5IGFA 1XTCD 2AUKA 3OIPA 3SVMA 1QCBD 2WAQG 2ZJRA 5C5LA 3SEBA 4U673 4YCVA 1L0YB 2YYZA 3BS1A 2NYZD 4A3JG 3CP0A 3NENA 2E2IH 2ENBA 1C8CA 3RUZA 1XNRL 3VA5A 3CCRA 1SYFA 3DEPA 4R4CA 2ATWA 4KY6A 1XPRA 2F0TA 2MPMA 3I4MG 2VUMH 2I5HA 1CHQD 4DNIA 3D31A 2NVTH 1DOLA 1QNKA 5DM63 4HJAA 4LF7Q 5LMNL 1X3FA 3VYUA 3HKZE 4HIKA 1SBBB 4A3GB 2LFNA 3BZCA 3I4LA 5IODA 1I4PA 1UE6A 2E8GA 1LT4D 3CC7A 2DJGC 1CSPA 1STBA 3KDFB 1FNVA 2AQ3B 3QWNA 5GROA 1SRUA 3HKZG 2O5IC 4L8JA 2ES2A 2NUCA 4Z9CB 1S5CD 1KL9A 3NK9A 1PFMA 4G7OC 3A8IE 3LX0A 3R93A 1E3PA 1QB5D 1V9PA 1A3VA 1UE7A 1ENAA 1HQRD 2K14A 3ERQA 4DA2A 4HR7B 1Y14B 1XMQL 3EIVA 3KF8B 1JR0D 2Z0SA 5IP7H 1JC7A 2RBMA 4Y52H 1FL0A 3S16B 3HOZG 1QJOA 5M9OA 1F77A 3GTMH 1CKOA 1WTWA 3M4YA 1HH2P 1NR2A 2NVYH 3D8GA 2GVAA 3S17B 5BN5A 3FPPA 3K0XA 4N9TA 2RA4A 1GVPA 2K1BA 1HFNA 2YU9H 4DXFA 5K5PA 4HIMA 4PZ7A 3UDIA 1TWGH 2DNEA 1I4GA 2L1BA 1XNQL 3PUXA 1IL8A 3D4DA 5EPJA 4C1NI 4A3IG 3BYTB 5COYA 4RKLA 1EU3A 1STGA 1R4PB 3G71A 4CHTB 2K5VA 4ME5A 4K5XA 3UI2A 5JPMC 1VQPA 4QCLA 3FPUB 3D3RA 2JA5H 4XQQA 4DUZL 1TXYA 1VQAA 5M3FH 1PH2A 4KK7A 5DLQE 4DV0L 1KRSA 1VQKA 4ID6A 4IPGA 3GTLB 2X6LA 4MNOA 3FVQA 2F4VL 1RKNA 2K05A 4GKJQ 4LW1A 4C3HG 1I3QB 3MXNA 1A3TA 4JI7Q 3CRLC 2Z9HA 4DAYB 1EFID 3K7AH 3SK8A 1HA6A 2MFIA 1G91A 4FF1A 1WYDA 3CQZH 1CQVA 4K0KQ 1WCMH 1I4XA 4WJ3M 3GTPH 2B63B 3P7JA 4CDFC 1KIXA 5CR3A 5C0XH 1AEXA 3GQBA 5C0XI 1V43A 3OSOA 4LUOA 5J3BA 4DV6L 1FJGL 2K5HA 1E22A 1H9JA 2PQAA 1XPUA 3QIAA 2K5DA 3SXHA 3I7FA 2UXDL 2SNMA 5FO7B 1JWUD 1GHKA 3BDLA 1VQ9A 3OWEB 3I55A 4XYQA 3CRKC 3HZXA 4X3SA 1CK1A 4RGTA 2ZJPA 1EY8A 1I94L 3QOJA 3G6JB 1M1KC 2PQEA 4DV3L 2CHBD 2ZTCA 2Z6KC 2Z8LA 3JAMc 5CV5A 3VA7A 3LWEA 3TQYA 1TWCH 5IGEA 1DM0B 1FGUA 4K14A 4JI1L 1TWAB 2K5QA 3J7AV 3I4NB 2WV6D 3OOCA 1NE3A 4LF7L 5JPNC 2EQSA 2GA4B 2Z6KA 1JWMD 1HQMC 3RNUA 2QEXA 1WI5A 1KXLA 3ULPA 1CI3M 5CV6A 1KHIA 5JVG3 2JA7G 3EVQA 2B63G 3TP6A 1SNQA 1GM5A 2F0EA 1IBMQ 3PUVA 1Y1WH 1K0SA 4HN7A 2DJFC 1LYLA 4B3TQ 3IAYA 3J7AF 4HJ9A 2F0VA 1TQOA 3C1FA 1H9RA 4R1JA 2CH4A 1BVSA 5C6AA 1Y1WB 3CCEA 4OWXB 1SYBA 1EQVA 2KEEA 1SROA 2PYKA 4DU9A 1K3BC 3K0YA 3V05A 5CBAE 1VQNA 4LF9Q 1I4HA 4LAAA 4JV5L 4JI5Q 2MP1A 3GO5A 1CT1D 4HJ5A 2B39A 5LL6X 1IBKL 4NMZA 2ZTDA 4NB3A 3A5UA 2EY1A 4OEMB 4DAPA 2KCNA 1MD2D 1JB3A 3IL8A 3Q23A 3S1RH 4KKTA 5JEAJ 2R93H 2A5HA 3FKIH 4WFN3 4HCSA 3E0JA 4LK1C 2AQ2B 3LWUA 1E2WA 1XYIA 1NTGA 4DR1L 1V1QA 1YJ9A 1KNAA 2I0QA 5IP9H 5HGTA 3TREA 4FXKC 3JC66 1BCPF 4R4OA 3SHLA 1A62A 5JJZA 1N33Q 3K5LA 5BR8Q 1XJVA 4YWMA 3T56B 4XXEA 4DV4Q 3SR1A 2SOBA 4XQNA 4Y7NH 1X3GA 3ZYYX 2ZXRA 1J8IA 3I3CA 4JVZA 4IFDG 3MXNB 1WD0A 1AE2A 3X3NA 3U4ZA 5M5YB 2F0PA 5BN4A 1IZ6A 1PH3A 3CD6A 1Y8NB 1HZCA 1O7ZA 5I6WA 4HSVA 3I70A 4LF4L 4A93H 5IYDH 4DGZA 3GTJB 1NBWA 3IRBA 4CDCC 2FHTA 2HCCA 2ICIA 5I2YA 1QG7A 2WIIB 4QY7A 2B2WC 2KHIA 2NB0A 4P73A 4HTHA 3TEHB 2UUCL 1MJEA 4H02A 5IGDA 4JBJA 1N9WA 2YTXA 1Z7TA 2PQAB 1A2TA 2R92H 2JSOA 1FNWA 4BBSH 1PVOA 4A76A 2B2WA 1VQ4A 3I56A 2KHJA 4YIJA 4YHHQ 3S24A 3Q24A 1W3SA 2GVBA 3D0FA 4FVMA 4X3UA 4WORA 1EWIA 4FF2A 2E2HB 1VQDA 3JAMi 4HJ7A 3V96A 4DR5L 5IYCG 5C4JH 3R2IA 3B6YA 1B44D 1IYUA 3G48A 5FO8B 3KBGA 1HTPA 1B8AA 1CFMA 3K8AA 1I5FA 2NBFA 1DOMA 3A55A 1TS4A 1U4MA 4C2MB 2A1AA 2O2LD 1CKNA 3HOVB 2LS01 3ZJYC 4DK6C 4C3JH 1KAAA 1EQRA 1HNXL 1D6EC 3CCVA 3TP5A 1LT6D 1EEFD 2KOLA 3BU2A 5KGUA 1PYSB 5CORA 3ERSX 2PNHA 3HOUB 1VQ7A 4C3JB 5C3EB 1J9OA 4ZAIA 3T51B 3TP7A 5IT9E 3RR5A 5FLXE 3ITPA 3C3LA 3HFZB 3OTOL 1IKLA 4NDXA 2TMPA 1YHAA 4P2CB 1N32Q 3K80C 1B9NA 2UUBQ 3GTKH 3KLRA 3BDOA 4KY5A 5ISRA 2KJXA 3FMCA 3KOJA 3K5MA 4IOAA 4A3KG 1HR0Q 2NN6G 5ELEA 4JI0L 1ASZA 1BR9A 1SJED 2OCEA 3IFTA 4IALA 3L3OC 3NBHA 2RQXA 4QJFA 2L9HA 1XMOL 2F4IA 1SNMA 4EGVA 1VQCA 1ICFB 1IKMA 2B2TC 4DFAA 4X62Q 5A2QE 1LTAD 1YJWA 1MIUA 4IUNA 5FLMH 1I6HH 1JE5A 2EYMA 4QUCA 4GN4B 1PH8A 1P16A 3TS2A 4DR7Q 3L2PA 1QVGA 2VNUD 2WB1B 3I8ZA 2B2TA 3H3VH 1RF2D 1YHBA 2RHQB 4DN4M 1BQQT 1AZPA 3H3VI 2UXCQ 4QL5A 4KHPQ 2XRQD 3WOFA 4CKEA 1JWSD 3HOXH 1HNZQ 5J22A 1EY0A 1SR3A 1HRJA 3DWQA 2R7ZG 1IYVA 2LXKA 2ZM6L 3KJOA 1VQMA 4EQOA 4JK1C 3D4WA 3J81E 3K59A 4AQYL 3H15A 2A6HD 2JEBI 1K8OA 2CH4W 1XX8A 1RTNA 2BA1A 1A6XA 3AU7A 4DR6Q 4IOCA 5KRUA 2F0KA 4A3FG 5KNCA 1TS2A 5T1IA 1YNJD 4OIKA 2HUGA 1X6OA 2MO1A 5JJKA 2EYHA 1G8ZD 5FK9C 1PTOH 5CV4A 2K32A 4P71A 1E7ZA 4B3MQ 3QJYA 1GUWA 1FVIA 1YI2A 1LABA 2VL6A 2L4NA 1HFGA 4IUVA 1PTOB 5FJ8G 2F0FA 4B9XA 3PF5A 2C9OA 4YHHL 1X9NA 2VY3A 4B3RQ 4BY1B 1CM9A 4DNRB 4HIOA 3GTGH 1M90C 4K6LA 1BBWA 4C3IB 1R9TH 2IL8A 1AZQA 3STBD 3VR3A 3RZOH 1II3A 3S1QH 5E7NA 1FYCA 2NVQB 4RWSC 4I7AA 1CKNB 4DV5L 2B2YC 3Q0AA 3A0JA 4L6TB 1YEZA 2WAQB 2AQ1B 1EWHA 1HHVA 4A3JB 4X6AH 2UU9L 1KDCA 4AH6A 4ZUIA 5GAEC 3P75A 5I9PA 3J7ZC 3NTKA 4JPBW 1TT2A 5EBDA 2V1CC 2JA6H 1D8LA 2RVLA 2UUAQ 1ONLA 4CKCA 2B2YA 4L5QA 4PV1C 1SN8A 1PV4A 4X66L 3I4MB 4YY3Q 1ESFA 4L63B 3S2HH 1JE4A 3NE5B 2LXJA 1VQ5A 4ZKBB 1ZKOA 3VDYA 4ZQ3A 4DK3C 2J4XA 2XWJB 1B9MA 3UE1A 3A8JE 2HT1A 3T1HL 1K28A 2AMCB 1AH9A 4GN5A 2RCNA 3S2HB 4E6IA 1N32L 2HQLA 2UUBL 3HOWB 2E5LL 5BN3A 3PV0A 1E1TA 1TWFB 2YTVA 1BNZA 1GUOA 1Q81C 4C1NK 1PRTD 3NBHB 5I6YA 2G9HD 3RN5A 2FMCA 4GKKQ 1V1PB 1TS3A 3HP3A 1KRTA 4CKBA 3JAML 2M9VA 1Q3LA 3EJIA 1SAPA 4BXXG 1NUCA 1Z6HA 4KV6A 3TZUA 3V2TA 3CMAA 1RIPA 4F7XA 4JI3Q 4JI4Q 4RH6A 2OT2A 1QILA 2Y0SE 5F2DA 3CW2C 5IGCA 3H0GG 2PW7A 1LTLA 3HOZB 4KN4C 3PIP3 1QZGA 4X64Q 4LF6Q 1Q8IA 2Y0SG 4KY7A 1PH7A 4A3GH 1EZ6A 3S1NB 4H7BA 4EVOA 3OMCA 2K50A 3OW2A 2F03A 4DR2Q 4X65Q 1L0XB 3KK7A 3K58A 2OXPA 2NVXB 3G4SA 1VQEA 1EL0A 1D5XC 3HOWG 2BA0A 4JI6Q 2KBNA 2LMCB 1I50B 1TVXA 4A3IB 1E24A 3MFYA 2HIXA 1NCVA 4NXML 4HIDA 3HOYB 3VYRA 2IX1A 3S16H 1PH1A 2LY7A 1CSQA 4ODGA 1BOSA 2D0PA 3OIQA 3PO3G 1GUGA 4LFAQ 5C3WA 2MHVA 3KLWA 3NWTA 4JI8L 3R3OA 4YCUA 1YBYA 4R4QA 1C9OA 5KNDA 4B3ML 4OHJA 3S17H 1SE3A 5IWAL 4DUYL 3CHBD 4C3HB 4RGOS 5JVH3 2N49A 1LTBD 4A3BB 2X69A 2QDBA 3EBEA 2WACA 2RF4A 4XT3B 3PQIA 5EPKA 4K8JA 4MTKA 1L2FA 1HCZA 1Q46A 2CVRA 2WINB 4B3RL 2KECA 2JA8G 5EKLA 1VS0A 1QOHA 3NHHA 3C1EA 4POFA 4AIMA 2VQFL 4NPSA 3MWYW 4HMJA 4KHVA 1SYEA 4B3SL 1LO5D 5ELOA 1ICWA 4MIUA 1N34Q 2A6HC 3HOYG 2L11A 2DY7A 2E74C 1ILPA 1PFNA 1MHWC 3GTLH 4TSSA 5C4ZA 3PIOA 3TZDA 2MO0A 3RLOA 1YNJC 3EA6A 1I3QH 1ZEQX 3DWPA 5JEAH 1ENCA 2K04A 1OTCA 2M2LA 3S1MB 3CCMA 2K75A 2EYOA 5LL6S 1D1KA 1KTKA 2E75C 1Q82C 3PUZA 1PXUA 1WTVA 2CQAA 2AWNA 1JT8A 1YIJA 4F8MA 4A3BG 3BVMA 2F0WA 1HNWQ 4IQZA 1LLRD 2B63H 1U0LA 1AN8A 2B8GA 4JYAL 3LNNA 5TSSA 2EY6A 4XTCS 5AFWA 2OQ0A 5GAGC 1EU4A 4FF4A 4UDUC 2JA7B 3TSSA 1F9PA 1QUQA 3A5ZB 4R8IA 2EYPA 2EYFA 1BKBA 2K52A 3TDQA 1DYQA 1EIYB 3SE0A 1H9MA 4MHEA 1PA6A 1C0AA 3NEMA 4K5VA 3STBC 2K33A 1Q90A 1SMYD 4WRDA 4LUVA 1SYGA 1DONA 2EE1A 3MC0B 4QUFA 2K28A 5ELNA 2Z4IA 2MJ8A 1JJGA 2BCOA 3D4RA 1KDBA 4IPDA 2ZJQA 1TWAH 1EYDA 3D6WA 2C35B 3I4NH 1FD7D 1UAPA 2D0OA 4KLKA 4ZRZA 1MKHA 4LF6L 1EYAA 4FDBA 1Q7YC 4H0LC 3UE0A 4R9WA 4OO1G 3UDFA 4UP9A 1TS5A 1U4LA 1D7QA 1HUNA 2N3SA 1WFQA 1EWCA 5FOBB 4FF3A 2R6GA 1W6JA 3X3MA 3I91A 1KLGD 1MGSA 1B4OA 1L0WA 4AYBE 1JMCA 2A6ED 1JB7A 4LFCQ 1O80A 4N9PA 4H13C 4IZ8A 3AB9A 1ET6A 1PRTC 2EYLA 2QGQA 2JQOA 4AYBG 4NKLA 2SDFA 1X3QA 2D9UA 4V190 4LF5Q 4A3DB 1N36Q 1IXRA 1H9KA 1VQJA 1J5EQ 1VQ8A 4DR4Q 1D5MC 2EXDA 4HMIA 4A3EB 2JXMB 1GHJA 2ZT9C 1VQGA 1HUMA 3PUWA 3RMHA 3VR6A 4R8NA 4PG3A 3MZ5A 4FP5D 5DM73 2G5DA 3U50C 4ME3A 5ELCA 2VB3X 4IUTA 3O13A 4YCWA 4DR3Q 4FXGC 1LTID 5C3XA 1SDFA 2EVBA 5C0XG 2N8NA 4RG1A 2HDLA 2K6AA 2Q2TA 3T1YQ 2JJQA 4N8FA 1KD1C 3PCOB 2IX0A 4MZ9A 2QCPX 3I4OA 2VZAA 5M3MB 5E3FA 4JBWA 4TKOB 5IGGA 1Y69U 4JC0A 3J80E 3A56A 3A7AB 4DNTB 5FLXc 4IJHA 4C56C 2J7ZA 2VB2X 4RKBA 5IYCH 5C4XB 5AJ3Q 2F0NA 2KENA 1IW7D 3W3AA 2XSCA 4F87A 2F0GA 3RLNA 5M5YH 1KAWA 2KCMA 1K3RA 3VYTA 4A3DG 4A3EG 5EJWA 2Z4HA 3MHBA 2B8FA 3GTJH 5M5WB 4A3MB 3CC4A 4L5SA 1AP0A 2EJFC 1LM0A 5LMUQ 2M00A 3CAMA 1TIID 4B08A 5GADC 3P20A 1PH9A 4OL7A 5ELFA 4GKJL 3HG9A 1Y8OB 4V0BA 3M3YB 4JI7L 4ALPA 5G3LF 5IY0A 1U4RA 3EFXD 1A8VA 2B2UC 1IL2A 3GDEA 2YTYA 1QUQB 2D5DA 3FRPB 1HR0W 1SNOA 3MTSA 3JAME 4K0KL 4A3LH 2F0MA 3L7ZC 2KCCA 5M3MG 2QEJC 1KQSA 4FXDA 2B2UA 2KCTA 3DM1A 3M4PA 5K36G 4ZLTF 2E2HH 3IFDA 4JI2Q 4RHRA 1JOQA 2PZUA 2NTSA 2PO4A 2VQEQ 5C4XG 1IYJB 2DY8A 2JP1A 3S14B 2CW0D 5J39A 2PW5A 5GAHC 2UXBQ 2RKSA 2HDMA 1EIFA 4RMFA 4A3KB 5FKAC 3PF4A 2D62A 1QVFA 2JN4A 1SNDA 5DAUA 1PFSA 1UNSA 4C2MH 2OQKA 4A3MG 1K8AC 4LF8Q 1O7LA 3DEOA 3HOVH 1BUVT 3FKIG 1EQQA 3PSIA 5HGQA 4UHVA 4BBRB 1S5BD 1PYBA 4IFDJ 4HSPA 2MUYA 3HOUH 2Q2HA 4UPAA 2R7FA 5IP9G 3OMGA 5C3EH 2L15A 3K6OA 4QIWB 4DAMA 3WWVA 4FNFA 1B50A 3NTHA 1VQOA 3S2DB 5D3DA 3DLLA 5JOBA 2B3GA 1IBML 2EY5A 3URYA 2F52A 4B3TL 1BO0A 4XDXA 1BBXC 1Q1BA 3HEJA 1YITA 4A93G 3K5OA 1PRTB 5IYDG 2I5MX 2VS1A 3CCLA 4ILWA 1SMYC 2VW9A 1J5EL 2QDLA 1K83B 4DR4L 2R7ZB 2BH8A 1BCPD 1HZAA 4PNYA 2F3VA 2XWBB 4OIJA 2VXWA 1YVCA 1KLUD 2NWGA 3J7YW 1GXDC 1DOKA 4G7HC 1X65A 4LF9L 3NWSA 4JG2A 1G291 1X54A 4A3FB 4JI5L 4BBRG 1C48A 2KA7A 4UY8C 1Y1VB 4GLVB 4QIWE 4O42A 1CQFA 1SSOA 3NXWA 4NXNQ 1V8QA 4OX9Q 3ND8A 2BDNA 4KI0A 3RD4A 4RA8A 3T1YL 1OXXK 1LACA 2K5WA 1F9RA 3KUPA 1IBLQ 2J0TD 3BG3A 2X6GA 1GUNA 2F0SA 1XTDA 3CCUA 3J81j 2IX3A 1U5KA 2A74C 2R7DA 2JK8A 2A6EC 1EYGA 3SK4A 5IGBA 4ULLA 1SXTA 1VCIA 3CCJA 1E2VA 1XNRQ 2F3WA 1O7YA 3F8TA 1N33L 5BR8L 4YWKA 4L5TA 4OONA 2IW3A 4KMUC 1IHZA 2EY2A 4RGNA 1TKWB 1QVCA 4DV4L 4KKUA 5C4HA 3D6CA 1OXSC 3C46A 5LMUL 1EOTA 2AKWB 5LMNQ 4XYOA 2LSSA 3I73A 1GO3E 3KJPA 3GTOB 4A75A 4BY7B 5IYBG 1BBUA 1RJTA 4GLAC 2RSNA 1Y1VG 5M5XB 2E2JB 3PO2B 3HS0C 1UWVA 3HKSA 4RGMA 1PZJD 4IO9A 2ID0A 3P1HA 2Q2UA 3R8BA 2EYJA 5ELDA 1SJHD 1DD2A 1I4RA 1K8MA 2MQHA 3RZDB 3MFGA 1EEID 5KNBA 2PPBC 4BY1H 3TRZA 4RFBA 2ALYB 4C3IH 4A3CG 1JOOA 1NJIC 2Z1CA 3TP8A 1PH4A 1XMQQ 2VQEL 1MBYA 2NVQH 1UEAB 1TY0A 1RHPA 4I7ZC 2D2CC 4BXXH 1IW7C 3EROA 2F0QA 3W1BA 2F3IA 5EQ0A 4KD3A 1WTQA 1X56A 4HJ8A 3NBIA 4A3JH 3NQTA 2EDGA 3KF6A 5FLMG 5C44B 1B7YB 3U9OA 1PZID 5DEHA 2F0UA 1TWHB 1WVLA 4OGQC 1X3PA 5JJLA 4G4KA 4BY7G 1SNPA 4KJOA 2HCIA 2ASBA 2ZXPA 1WJJA 1STHA 3I4MH 3PO2G 4P72A 1H9SA 4P74A 1B2TA 4G7ZC 3H0GB 4DV7Q 5CGKA 1XNQQ 3VR2A 1A63A 2Y0SB 2A73B 1D1IA 3KBXA 2TSSA 2EJMA 3HOWH 4TVAB 1TWFH 2IHFA 2PI2E 4J6HA 3T16A 4F88A 2WP8J 4DUZQ 1VQLA 2I46A 2E2DC 1GUTA 3QR8A 4DK1A 4DV0Q 1SMXA 1ILQA 4BA2I 1PTOF 3OWFA 3FDTA 3FP9A 2CW0C 5EKIA 3GTQB 2RCFA 3M4OB 4L5RC 1HR0L 1WOCA 2WFWA 4QB4A 1HA5A 2HIVA 2OEOA 2EOTA 3G7LA 1VMPA 2HD3A 2XVSA 1K0RA 3ULJA 3A54A 5C44G 1HXYD 1U4PA 1F9QA 1HZ9A 4ABNA 5CBEE 3HOZH 1EIGA 2EZVA 3PO3B 3E6ZX 4IURA 4GOPC 3CPWA 2N78A 2RHSB 3H6MA 1EY4A 5I9OA 1YJNA 4CJ0B 4X62L 3S1NH 1SLJA 1YZ6A 3MVVA 4DV6Q 1FJGQ 1QZHA 4IUPA 5CV9A 1ASYA 1PH5A 2JEAI 4ZKCB 4DR7L 1S3OA 3WDNA 2NVXH 5EPLA 4GOPA 5HY6A 1DZ1A 1JQYD 2UXDQ 2PMZE 5D3IB 4LUZA 1X3EA 2UXCL 1STAA 1VQHA 2BOSA 1EIHA 3AFPA 2H1EA 4KHPL 3QOLA 4APVA 3H09A 1WTOA 2JA8B 4Q0FA 1I50H 1I94Q 4ZK9B 4A3IH 1HNZL 1F2YA 1HJPA 4DV3Q 2EIFA 4KD4A 3HOYH 3K5NA 2E2IB 4UAIA 4WJ4A 1X32A 3ONAB 2PNRC 3BJUA 4JI1Q 2JA6G 1W6KA 1BCPC 3DWAA 1GOZA 1A0IA 1BDOA 4HAEA 4DR6L 1NY4A 4R4TA 4OWTB 2VUMB 2K5NA 2NVTB 1Q12A 2KUMA 5FO9B 4C3HH 4CGYB 1EUJA 1UUPA 1G51A 2XRSD 4A3BH 1PDQA 3NELA 2AWOA 1Z9FA 1JCKB 2A68D 2F0DA 2QKIC 2JE6I 3DM3A 2K7VA 1VDZA 5IT9L 3CU7A 3I90A 5FLXL 1CUKA 3N6RA 5IIFA 1LTRD 2SNSA 4KTAA 2NZHA 2WKDA 4J8QA 4GN3B 2AHOB 1STEA 4IPCA 1M8AA 4POGA 4JV5Q 2K01A 4LFBQ 3KF6B 1AFPA 2DNCA 2F1MA 2IJ0A 3E9HA 3MEFA 4HCEA 5D14A 1IBKQ 2FXQA 1WTPA 1WTXA 1F2ZA 2I07B 3HRZC 4K6DA 4OWWB 4GLXA 1WD1A 1ZYRD 3GTMB 1PTOD 2DGYA 2L12A 5T1GA 2XGTA 1H9SB 3BVZA 3S1MH 3TN2A 2VUMG 4O0AA 2I5LX 1Q86C 4A3GG 4KN7C 2NZ1D 2NVYB 1RTOA 4KJNA 2OF1A 2KVMA 4UP8A 3NSWA 4DR1Q 4DV7L 3Q8DA 5KEEA 2UUAL 3GV6A 2YU9B 4OO1H 5A2QL 4OO1I 1B70B 1TWGB 1LT3D 1MJCA 1VMCA 1QWYA 1XXGA 4YY3L 3CCQA 5LHY1 4DV1Q 3CMEA 1JJ2A 2JA7H 1HZBA 1G6PA 1YNND 4XIGS 1DXMA 4BS9A 2HQEA 1S72A 1NMGA 1A3UA 4DAVA 1EY7A 1KNEA 4LF4Q 4JW0A 3I2ZA 3E0EA 3OHXC 2JA5B 2ICEC 3FEWX 5M3FB 1SE8A 3GV3A 4U68A 2QF7A 4GKKL 1O78A 1P8LA 4AYBB 3J80c 5IP7G 3J81L 2EXZA
chains in the Genus database with same CATH topology
3M7GA 2C5CA 4K2LA 1CTMA 3H91A 1BF4A 2PCFB 5NUCA 2FMMA 3K7AB 3SK6A 2F0JA 4DK0A 2L0CA 3CQZB 3AMUA 1FNUA 3IKJA 2XN9C 1WCMB 2AUJD 3NTIA 3GTPB 2R61A 2RDFA 3S9WA 2FFKB 1BXTA 2O4XA 1QNUA 3MEHA 2MGSA 1STNA 2LKVA 2G9DA 5KYLA 2SEBD 1SNCA 4DXGA 1JICA 2KEDA 2XIWA 1C4QA 5JEAG 1F2MA 5ELBA 3NPPA 1ZXTA 1FR3A 1E0BA 4NP5A 3U9SA 5EGTA 4IFDH 1TWCB 1BCPB 5E4XA 4IFDI 5CC4A 1OXTA 2E76C 1G2SA 4LMQD 3Q6SA 4GZYC 3KLSA 1ET9A 4M1UB 4CBVA 3ND9A 5EKKA 1D2BA 5CYUA 2B2VC 3H94A 3SDZA 3OW7A 4EQNA 1B3AA 1NAPA 5K36H 3NUCA 2B2VA 1S5DD 1Y8PB 1DCZA 1MSGA 3K57A 3L9AX 4NW2A 5J1ZA 1EYCA 4IUQA 3E5SA 3I72A 3MXUA 4FYDA 4FO2A 1B1ZA 1FGBD 3S1RB 4RHSA 2R93B 1AW7A 3FKIB 3PIO3 3H3VC 1T5XD 2NTTA 1NSNS 2V4DA 1MI2A 3PUYA 1V1OA 1CA5A 5C5MA 2A68C 5D65A 4K2KA 3SK5A 1PLFA 1PZKD 5IOCA 3KLSX 5C0XJ 1S5FD 2EPBA 5KYIA 1A15A 1SE4A 4Y7NB 2RDGA 4RCOA 4WJWA 2L55A 1WTRA 2NN6H 2NN6I 4A93B 4CJ2C 4DF7A 2F0IA 1ZYRC 4X3KA 1PTOC 2FJ2A 4MN3A 4QF4A 2RSOA 2BE5D 3DXJC 3MXGA 1ESRA 1F2LA 3MAQA 3R2TA 1LT5D 4RAUC 1RDPD 4TQUS 1LV9A 2A69D 1XWEA 4EQPA 2R92B 3MXPA 4BBSB 1G6ZA 2Q8RE 3T4AC 1SE2A 3TMEA 2XNAC 1OXVA 5EBCA 3N52A 4J1MA 1YNNC 4HEDA 3QO2A 1KDAA 2N88A 1NR4A 5C4JB 2R3ZA 4I65A 1EZ8A 1Q1EA 1I6VC 1JOKA 4PQXA 1DJRD 1M4VA 2L5TA 4K8IA 1ENFA 1EY9A 1VF5C 4BWGB 3NP8A 1EQTA 2WKCA 5KIXA 4BA1I 3BZDB 5CV8A 1GJXA 4O1NA 5A35A 2DN8A 4XQJA 2K03A 1QE6A 1T5EA 1S4ZA 1EY5A 1KABA 5CV7A 5I4DA 3GTKB 1PYWD 1VF7A 5G3LD 4RCNA 2H4OA 5HURA 1ML0D 2QILA 1V1PA 2F0HA 4ZUJA 2EJGC 1RODA 1U9RA 3T13A 4X3TA 3W2DA 1SEBD 3GP7A 1TY2A 1PFBA 1RD9D 4C3JG 4KHZA 1RCVD 1I6HB 2F0LA 1CZGA 1OO9B 1PRTF 3RLFA 4CJ1B 1MSHA 1TR5A 3PMFA 4PMBA 4LJZC 3DMUA 2JYOA 3HOXB 1Z47A 5CMDA 2FINB 2IWHA 4PMCA 3DUZA 5JAVA 3VR4A 4K5WA 1CZWA 3QG1A 5E1FA 2ZXOA 1S5ED 2Q8TA 1CA6A 2IPKD 3A8KE 1E2ZA 1F9SA 3KF8A 4TRDA 3MA2B 1HTLD 4S3SA 3HGBA 1SYCA 3VYSA 2PZWA 4B9WA 3BYYB 4ZYSA 1HPCA 3A7LA 3M85A 1B53A 2IT1A 4QMGA 1A2UA 2RDHA 1OXUA 3C2PA 3GTGB 2KHSA 4G57A 3Q22A 1LTSD 3S15B 1R9TB 4IUUA 3VR5A 3RZOB 3S1QB 3NQIA 5I2XA 2PZTA 1LTTD 4IN3A 3M7NA 3QB3A 3TBIB 3J80L 2KQ3A 3WOEA 1LTGD 2F0OA 2PMZB 3DHQA 3CKIB 1G2TA 1R4QB 4KKSA 3BDCA 3GD7A 2BDOA 3T53B 1GUSA 4M8AA 2Q8IB 3OPOA 2JA6B 1JORA 1D5ZC 1SYDA 4Q5VA 1SFOB 2O5JC 3BVGA 1TU2B 4DAYA 2BE5C 4XT1B 4C3IG 1EY6A 2A69C 3HKZB 3F2UA 2N55A 4H44C 1STYA 5DNFA 1PMRA 3EQLC 5E4WC 1CHPD 1I4QA 4PMWA 5IGFA 1XTCD 2AUKA 3OIPA 3SVMA 1QCBD 5C5LA 3SEBA 4U673 1L0YB 2YYZA 3BS1A 2NYZD 2ENBA 1C8CA 3RUZA 3VA5A 1SYFA 3DEPA 4KY6A 2F0TA 2MPMA 1CHQD 3D31A 1DOLA 1QNKA 5DM63 3VYUA 1SBBB 4A3GB 2LFNA 3I4LA 5IODA 1I4PA 1LT4D 1STBA 3QWNA 1FNVA 2AQ3B 2O5IC 4L8JA 2NUCA 4Z9CB 1S5CD 3NK9A 1PFMA 4G7OC 3A8IE 3LX0A 3R93A 1QB5D 1A3VA 1ENAA 1HQRD 3ERQA 4DA2A 4HR7B 1JR0D 1JC7A 2RBMA 3S16B 1QJOA 5M9OA 1F77A 1WTWA 3M4YA 1NR2A 3D8GA 3S17B 5BN5A 3FPPA 4N9TA 2RA4A 2K1BA 1HFNA 4DXFA 5K5PA 2DNEA 1I4GA 2L1BA 3PUXA 1IL8A 3D4DA 5EPJA 4C1NI 3BYTB 5COYA 4RKLA 1EU3A 1STGA 1R4PB 4CHTB 4ME5A 4K5XA 3UI2A 5JPMC 4QCLA 3FPUB 3D3RA 4XQQA 4KK7A 4ID6A 3GTLB 2X6LA 3FVQA 1RKNA 2K05A 4C3HG 1I3QB 3MXNA 1A3TA 3CRLC 1EFID 3SK8A 1HA6A 1G91A 4FF1A 1CQVA 1I4XA 2B63B 3P7JA 5CR3A 5C0XH 1AEXA 3GQBA 5C0XI 1V43A 3OSOA 1H9JA 3QIAA 2K5DA 3SXHA 2SNMA 5FO7B 1JWUD 1GHKA 3BDLA 3OWEB 4XYQA 3CRKC 3HZXA 4X3SA 1CK1A 4RGTA 1EY8A 3QOJA 3G6JB 2PQEA 2CHBD 2Z8LA 5CV5A 3VA7A 3LWEA 5IGEA 1DM0B 4K14A 1TWAB 2K5QA 3J7AV 3I4NB 2WV6D 3OOCA 5JPNC 2GA4B 1JWMD 1HQMC 1CI3M 5CV6A 5JVG3 3EVQA 3TP6A 1SNQA 2F0EA 3PUVA 4HN7A 3IAYA 3J7AF 2F0VA 1TQOA 3C1FA 1H9RA 5C6AA 1Y1WB 1SYBA 1EQVA 2KEEA 2PYKA 4DU9A 3K0YA 3V05A 5CBAE 1I4HA 4LAAA 2MP1A 3GO5A 1CT1D 2B39A 5LL6X 4NMZA 2EY1A 4DAPA 2KCNA 1MD2D 1JB3A 3IL8A 3Q23A 4KKTA 5JEAJ 2A5HA 4WFN3 4HCSA 3E0JA 4LK1C 2AQ2B 3LWUA 1E2WA 1XYIA 1KNAA 5HGTA 4FXKC 1BCPF 3SHLA 5JJZA 3K5LA 3T56B 4XXEA 3SR1A 2SOBA 4XQNA 3ZYYX 2ZXRA 1J8IA 3I3CA 4IFDG 1WD0A 5M5YB 3X3NA 2F0PA 5BN4A 1Y8NB 1O7ZA 5I6WA 4HSVA 3I70A 4DGZA 3GTJB 2FHTA 2HCCA 2ICIA 5I2YA 1QG7A 2WIIB 2B2WC 2NB0A 4HTHA 5IGDA 1Z7TA 1A2TA 2JSOA 1FNWA 2B2WA 4YIJA 3Q24A 4FVMA 4X3UA 4WORA 4FF2A 2E2HB 3V96A 3R2IA 1B44D 1IYUA 5FO8B 3KBGA 1HTPA 1CFMA 2NBFA 1DOMA 1TS4A 1U4MA 3A55A 4C2MB 2O2LD 3HOVB 2LS01 1KAAA 1D6EC 3TP5A 1LT6D 1EEFD 2KOLA 5KGUA 5CORA 3HOUB 4C3JB 5C3EB 1J9OA 4ZAIA 3T51B 3TP7A 5IT9E 5FLXE 3ITPA 3C3LA 1IKLA 4NDXA 2TMPA 4P2CB 1B9NA 3KLRA 3BDOA 4KY5A 5ISRA 2KJXA 3FMCA 3K5MA 2NN6G 5ELEA 1BR9A 1SJED 3IFTA 4IALA 3L3OC 3NBHA 2RQXA 2L9HA 2F4IA 1SNMA 4EGVA 1IKMA 2B2TC 4DFAA 5A2QE 1LTAD 4IUNA 2EYMA 4QUCA 2VNUD 2WB1B 3I8ZA 2B2TA 1RF2D 4DN4M 1BQQT 1AZPA 2XRQD 3WOFA 4CKEA 1JWSD 5J22A 1EY0A 1HRJA 3DWQA 1IYVA 4EQOA 4JK1C 3D4WA 3J81E 3K59A 2A6HD 2JEBI 1K8OA 1XX8A 1RTNA 2BA1A 1A6XA 3AU7A 5KRUA 2F0KA 5KNCA 1TS2A 5T1IA 1YNJD 4OIKA 2HUGA 2EYHA 1G8ZD 5FK9C 1PTOH 5CV4A 2K32A 3QJYA 1GUWA 1LABA 2L4NA 1HFGA 4IUVA 1PTOB 2F0FA 4B9XA 2C9OA 4BY1B 1CM9A 4DNRB 4K6LA 4C3IB 2IL8A 1AZQA 3VR3A 1II3A 1FYCA 2NVQB 4RWSC 2B2YC 3Q0AA 4L6TB 2WAQB 2AQ1B 1EWHA 1HHVA 4A3JB 1KDCA 4ZUIA 3P75A 5I9PA 3NTKA 5EBDA 1TT2A 2RVLA 1ONLA 4CKCA 2B2YA 4PV1C 3I4MB 1ESFA 4L63B 1JE4A 3NE5B 4ZKBB 1ZKOA 4ZQ3A 2J4XA 2XWJB 1B9MA 3A8JE 3S2HB 4E6IA 3HOWB 5BN3A 3PV0A 1TWFB 1BNZA 1GUOA 4C1NK 1PRTD 5I6YA 2G9HD 2FMCA 1V1PB 1TS3A 3HP3A 4CKBA 3JAML 2M9VA 1Q3LA 3EJIA 1SAPA 1NUCA 1Z6HA 4KV6A 3TZUA 3V2TA 4F7XA 4RH6A 2OT2A 1QILA 5F2DA 5IGCA 2PW7A 3HOZB 4KN4C 3PIP3 1Q8IA 4KY7A 1EZ6A 3S1NB 4H7BA 4EVOA 3OMCA 2F03A 1L0XB 3KK7A 3K58A 2OXPA 2NVXB 1EL0A 1D5XC 2BA0A 2LMCB 1I50B 1TVXA 4A3IB 3MFYA 1NCVA 3HOYB 3VYRA 2IX1A 2LY7A 4ODGA 1BOSA 3OIQA 1GUGA 5C3WA 2MHVA 3NWTA 3R3OA 5KNDA 4OHJA 1SE3A 3CHBD 4C3HB 4RGOS 5JVH3 1LTBD 4A3BB 2X69A 2QDBA 2WACA 4XT3B 5EPKA 4K8JA 1HCZA 2CVRA 2WINB 2KECA 5EKLA 1QOHA 3NHHA 3C1EA 3MWYW 4HMJA 4KHVA 1SYEA 1LO5D 1ICWA 4MIUA 2A6HC 2L11A 2DY7A 2E74C 1ILPA 1PFNA 4TSSA 5C4ZA 3TZDA 1YNJC 3EA6A 3DWPA 1ZEQX 5JEAH 1ENCA 2K04A 2M2LA 3S1MB 2EYOA 5LL6S 1D1KA 1KTKA 2E75C 3PUZA 1PXUA 1WTVA 2CQAA 2AWNA 4F8MA 3BVMA 2F0WA 4IQZA 1LLRD 1AN8A 2B8GA 3LNNA 5TSSA 2EY6A 4XTCS 5AFWA 1EU4A 4FF4A 4UDUC 2JA7B 3TSSA 1F9PA 4R8IA 2EYPA 2EYFA 3TDQA 1DYQA 3SE0A 1H9MA 4MHEA 4K5VA 2K33A 1Q90A 1SMYD 4WRDA 1SYGA 1DONA 2EE1A 3MC0B 4QUFA 2K28A 2Z4IA 2MJ8A 2BCOA 3D4RA 1KDBA 1EYDA 3D6WA 1FD7D 1UAPA 4ZRZA 1EYAA 4H0LC 4R9WA 4OO1G 1TS5A 1U4LA 1HUNA 1EWCA 5FOBB 4FF3A 2R6GA 1W6JA 3X3MA 3I91A 1KLGD 1MGSA 1B4OA 2A6ED 1O80A 4N9PA 4H13C 4IZ8A 3AB9A 1ET6A 1PRTC 2EYLA 4NKLA 2SDFA 1X3QA 2D9UA 4V190 4A3DB 1H9KA 1D5MC 4A3EB 4HMIA 2JXMB 1GHJA 2ZT9C 1HUMA 3PUWA 3RMHA 3VR6A 4R8NA 3MZ5A 4FP5D 5DM73 5ELCA 2VB3X 4IUTA 3O13A 4FXGC 1LTID 5C3XA 1SDFA 2EVBA 5C0XG 2HDLA 2K6AA 2IX0A 2QCPX 5M3MB 5E3FA 4JBWA 4TKOB 5IGGA 1Y69U 3J80E 3A56A 3A7AB 4DNTB 4C56C 2J7ZA 2VB2X 4RKBA 5C4XB 2F0NA 1IW7D 3W3AA 2XSCA 4F87A 2F0GA 3VYTA 5EJWA 2Z4HA 3MHBA 2B8FA 5M5WB 4A3MB 1AP0A 2EJFC 2M00A 1TIID 4B08A 3P20A 4OL7A 5ELFA 3HG9A 1Y8OB 4V0BA 3M3YB 5G3LF 1U4RA 3EFXD 2B2UC 2D5DA 3FRPB 1SNOA 3MTSA 3JAME 2F0MA 3L7ZC 2KCCA 2QEJC 4FXDA 2B2UA 3DM1A 5K36G 4ZLTF 3IFDA 4RHRA 1JOQA 2PZUA 2NTSA 2PO4A 2DY8A 2JP1A 3S14B 2CW0D 5J39A 2PW5A 2RKSA 2HDMA 4A3KB 5FKAC 2D62A 1SNDA 5DAUA 1UNSA 1O7LA 3DEOA 1BUVT 4BBRB 1S5BD 4IFDJ 4HSPA 2MUYA 3OMGA 3K6OA 4QIWB 4FNFA 1B50A 3NTHA 3S2DB 5D3DA 5JOBA 2EY5A 3URYA 1BO0A 4XDXA 1BBXC 1Q1BA 3HEJA 3K5OA 1PRTB 4ILWA 1SMYC 2R7ZB 1K83B 1BCPD 4PNYA 2F3VA 2XWBB 4OIJA 2VXWA 2NWGA 1KLUD 3J7YW 1GXDC 1DOKA 4G7HC 3NWSA 1G291 4A3FB 1C48A 2KA7A 1Y1VB 4O42A 1CQFA 1SSOA 3NXWA 1V8QA 3ND8A 2BDNA 4KI0A 3RD4A 4RA8A 1OXXK 1LACA 2K5WA 1F9RA 3KUPA 2J0TD 3BG3A 2X6GA 1GUNA 2F0SA 2IX3A 2A74C 2A6EC 3SK4A 5IGBA 4ULLA 1SXTA 1VCIA 1E2VA 2F3WA 1O7YA 2IW3A 4KMUC 1IHZA 2EY2A 4RGNA 1TKWB 4KKUA 5C4HA 3D6CA 1OXSC 3C46A 1EOTA 4XYOA 3I73A 3GTOB 4BY7B 1RJTA 2RSNA 5M5XB 2E2JB 3PO2B 3HS0C 4RGMA 1PZJD 2ID0A 3P1HA 3R8BA 2EYJA 5ELDA 1SJHD 1DD2A 1I4RA 1K8MA 3RZDB 3MFGA 1EEID 5KNBA 2PPBC 4RFBA 1JOOA 2Z1CA 3TP8A 1MBYA 1UEAB 1TY0A 1RHPA 4I7ZC 2D2CC 1IW7C 3EROA 2F0QA 5EQ0A 4KD3A 1WTQA 3NBIA 3NQTA 2EDGA 5C44B 3U9OA 1PZID 5DEHA 2F0UA 1TWHB 1WVLA 4OGQC 1X3PA 4G4KA 1SNPA 4KJOA 2HCIA 2ZXPA 1STHA 1H9SA 1B2TA 4G7ZC 3H0GB 5CGKA 3VR2A 2Y0SB 2A73B 1D1IA 3KBXA 2TSSA 2EJMA 4F88A 3T16A 4J6HA 2WP8J 2I46A 2E2DC 1GUTA 4DK1A 1ILQA 4BA2I 1PTOF 3OWFA 3FDTA 2CW0C 5EKIA 3GTQB 3M4OB 4QB4A 1HA5A 2OEOA 2EOTA 3G7LA 1VMPA 2XVSA 3A54A 1HXYD 1U4PA 1F9QA 4ABNA 5CBEE 1EIGA 2EZVA 3PO3B 3E6ZX 4IURA 3H6MA 1EY4A 5I9OA 4CJ0B 3MVVA 4IUPA 5CV9A 2JEAI 4ZKCB 3WDNA 5EPLA 1DZ1A 1JQYD 5D3IB 1STAA 2BOSA 1EIHA 2H1EA 3QOLA 3H09A 1WTOA 2JA8B 4Q0FA 4ZK9B 1F2YA 4KD4A 2E2IB 3K5NA 4UAIA 1X32A 3ONAB 2PNRC 1W6KA 1BCPC 3DWAA 1GOZA 1BDOA 4HAEA 2VUMB 2NVTB 1Q12A 2KUMA 5FO9B 4CGYB 1UUPA 2XRSD 1PDQA 2AWOA 1JCKB 2A68D 2F0DA 2QKIC 2JE6I 2K7VA 1VDZA 5IT9L 3CU7A 3I90A 5FLXL 3N6RA 5IIFA 1LTRD 2SNSA 4KTAA 4J8QA 2WKDA 1STEA 1M8AA 2K01A 1AFPA 2DNCA 2F1MA 2IJ0A 4HCEA 5D14A 1WTPA 1WTXA 1F2ZA 2I07B 3HRZC 4K6DA 1WD1A 1ZYRD 3GTMB 1PTOD 2L12A 5T1GA 1H9SB 3BVZA 3TN2A 4KN7C 2NZ1D 2NVYB 1RTOA 4KJNA 2OF1A 2KVMA 3NSWA 5KEEA 2YU9B 3GV6A 4OO1H 5A2QL 4OO1I 1TWGB 1LT3D 1VMCA 1QWYA 1XXGA 5LHY1 1YNND 4XIGS 1DXMA 4BS9A 2HQEA 1A3UA 4DAVA 1EY7A 1KNEA 3OHXC 2JA5B 2ICEC 3FEWX 5M3FB 3GV3A 4U68A 2QF7A 1O78A 4AYBB 3J81L 2EXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2C B;  2BOS A;  1CZW A;  1CQF A;  2C5C A;  4ULL A;  2XSC A;  2GA4 B;  1BOS A;  1QNU A;  1R4Q B;  1QOH A;  4M1U B;  1D1K A;  1D1I A;  1C4Q A;  1DM0 B;  3MXG A;  1R4P B;  1CZG A;  1C48 A; 
#chains in the Genus database with same CATH topology
 3M7G A;  2C5C A;  4K2L A;  1CTM A;  3H91 A;  1BF4 A;  2UUC Q;  2PCF B;  5NUC A;  2FMM A;  4JI3 L;  3K7A B;  1KC8 C;  4JI4 L;  3SK6 A;  2F0J A;  4DK0 A;  2L0C A;  3CQZ B;  3AMU A;  1FNU A;  4GOP B;  3IKJ A;  2XN9 C;  1WCM B;  2AUJ D;  3NTI A;  3GTP B;  3G6E A;  2R61 A;  4X64 L;  3F1Z A;  2RDF A;  4QQB X;  3S9W A;  2FFK B;  3W1G A;  2CKZ B;  2P5Z X;  1BXT A;  4DR2 L;  2O4X A;  4DR5 Q;  1QNU A;  4X65 L;  3MEH A;  2MGS A;  1STN A;  3L0O A;  4O2D A;  2LKV A;  2G9D A;  2GN5 A;  4ZCK A;  5KYL A;  4JI6 L;  2SEB D;  1SNC A;  4DKA C;  4DXG A;  1JIC A;  2JA5 G;  4A3D H;  2KED A;  2IHE A;  1C4Q A;  2XIW A;  5JEA G;  3CC2 A;  5M3F G;  4A3E H;  1F2M A;  5ELB A;  3NPP A;  1EFW A;  1ZXT A;  1FR3 A;  1E0B A;  1HNX Q;  4NP5 A;  2QW7 A;  5EGT A;  3U9S A;  4IFD H;  1TWC B;  1BCP B;  5E4X A;  4IFD I;  5CC4 A;  1OXT A;  2E76 C;  1G2S A;  4JCV E;  3UDG A;  4LMQ D;  3Q6S A;  4LFA L;  4GZY C;  4QGU A;  3ULL A;  3KLS A;  1NNX A;  1ET9 A;  4M1U B;  4J15 A;  4CBV A;  3ND9 A;  5EKK A;  1WCM G;  1D2B A;  3OTO Q;  5CYU A;  2B2V C;  2CWP A;  3H94 A;  3SDZ A;  3OW7 A;  4EQN A;  5M3M H;  1B3A A;  1NAP A;  3E9I A;  5K36 H;  3NUC A;  4OEL B;  2A19 A;  4JI0 Q;  2B2V A;  4GNX C;  5C4X H;  4LFB L;  1S5D D;  1Y8P B;  3UDX A;  1XMO Q;  1DCZ A;  1MSG A;  3K57 A;  3L9A X;  4NW2 A;  5IT9 c;  5J1Z A;  1EYC A;  3F2B A;  4GNX A;  4IUQ A;  3E5S A;  3I4N G;  1N34 L;  4DV2 Q;  1VQB A;  3I72 A;  5M5W H;  4A3M H;  3MXU A;  1L1O C;  4N8X 1;  4FYD A;  1DGS A;  4FO2 A;  2CWA A;  1B1Z A;  1FGB D;  3S1R B;  4RHS A;  3M3Y H;  2R93 B;  1AW7 A;  3FKI B;  3PIO 3;  3CXC A;  3H3V C;  1L1O A;  1T5X D;  2NTT A;  3AQQ A;  1NSN S;  2V4D A;  1MI2 A;  3PUY A;  4DV1 L;  1V1O A;  1CA5 A;  1NMF A;  5C5M A;  2A68 C;  5D65 A;  4K2K A;  1HNW L;  3SK5 A;  2ZM6 Q;  1PLF A;  1Y1W G;  1PZK D;  5IOC A;  5EAY A;  5L37 A;  4AQY Q;  3KLS X;  5C0X J;  2B29 A;  3J80 i;  3W5O A;  1GKH A;  1S5F D;  2EPB A;  5KYI A;  1A15 A;  1SE4 A;  1PH6 A;  1VQ6 A;  4Y7N B;  2RDG A;  3S14 H;  4RCO A;  3OYY A;  4WJW A;  4A3K H;  2L55 A;  1WTR A;  2CFM A;  2NN6 H;  2IY5 B;  2NN6 I;  4A93 B;  4CJ2 C;  4DF7 A;  2F0I A;  2HHH Q;  1ZYR C;  4X3K A;  4CDD C;  1PTO C;  2FJ2 A;  4BBR H;  4MN3 A;  4QF4 A;  1X55 A;  2PI2 A;  3SGI A;  2RSO A;  3E3X A;  2R93 G;  1B3Q A;  3J81 c;  2BE5 D;  3DXJ C;  3MXG A;  1ESR A;  1F2L A;  3MAQ A;  3R2T A;  1LT5 D;  4RAU C;  3ICE A;  1RDP D;  3EN2 A;  4TQU S;  1LV9 A;  2A69 D;  1XWE A;  3M4Q A;  4EQP A;  2R92 B;  2A8V A;  3MXP A;  4BBS B;  1G6Z A;  2CQO A;  1UEB A;  2Q8R E;  1SE2 A;  3T4A C;  4P75 A;  3TME A;  2OTJ A;  2XNA C;  4BY7 H;  3S2D H;  1OXV A;  5EBC A;  3N52 A;  4J1M A;  1YNN C;  4HED A;  3QO2 A;  1KDA A;  5LMN W;  4DV5 Q;  2N88 A;  1NR4 A;  5C4J B;  4LFC L;  2UU9 Q;  2R3Z A;  4I65 A;  1EZ8 A;  1Q1E A;  1K83 H;  2R7Z H;  3KFU A;  1I6V C;  1JOK A;  4PQX A;  1DJR D;  2ZTE A;  2XTI A;  1M4V A;  2CCZ A;  3K7U C;  2L5T A;  1AE3 A;  4K8I A;  4LF5 L;  2BH2 A;  1J6Q A;  4X66 Q;  1N36 L;  1ENF A;  1N8R C;  1EY9 A;  1VF5 C;  4BWG B;  1T9H A;  3NP8 A;  1EQT A;  4A3F H;  1LUZ A;  2WKC A;  5KIX A;  2H5X A;  3BZD B;  4BA1 I;  5IYB H;  5CV8 A;  3CCS A;  1GJX A;  1Y1V H;  4O1N A;  5A35 A;  3T1H Q;  2DN8 A;  4A3L G;  4XQJ A;  2K03 A;  1QE6 A;  1T5E A;  4DR3 L;  2E5L Q;  1S4Z A;  4UP7 A;  2R92 G;  4BBS G;  1EY5 A;  1KAB A;  5FJ8 H;  5CV7 A;  5I4D A;  4A3C H;  4OXP A;  1Q8K A;  4PZ8 A;  2MNA A;  3GTK B;  1PYW D;  1VF7 A;  5G3L D;  3TS0 A;  4RCN A;  4GNX B;  2H4O A;  3LGJ A;  5HUR A;  5H1S E;  1ML0 D;  2QIL A;  1V1P A;  2F0H A;  4ZUJ A;  2DUD A;  2EJG C;  1ROD A;  1U9R A;  4IJL A;  3PIP A;  3HOV G;  1O7I A;  3T13 A;  4X3T A;  5AJ3 L;  4DV2 L;  3W2D A;  1SEB D;  3K81 C;  3GP7 A;  1TY2 A;  3BZK A;  1L1O B;  1VQI A;  3RN2 A;  1PFB A;  1RD9 D;  4C3J G;  3GTO H;  4KHZ A;  5C3E G;  3HOU G;  4JOI C;  1RCV D;  3M9B A;  4R4I A;  5M5X H;  2E2J H;  1I6H B;  3PO2 H;  2F0L A;  1CZG A;  1OO9 B;  1PRT F;  4LWC A;  3RLF A;  4EX5 A;  4CJ1 B;  1GD7 A;  1MSH A;  4JOI A;  3RZD H;  3AEV A;  1C7Y A;  1TR5 A;  3PMF A;  4PMB A;  4LJZ C;  3DMU A;  2JYO A;  3HOX B;  1JJC B;  1Z47 A;  5CMD A;  1K73 C;  4NXM Q;  3KDF A;  2FIN B;  2IWH A;  4PMC A;  3CF5 A;  2Q2I A;  1XPO A;  3DUZ A;  5JAV A;  3VR4 A;  4JBM A;  4K5W A;  1CZW A;  3QG1 A;  2NZO A;  5E1F A;  1YNX A;  2ZXO A;  1S5E D;  1K9M C;  4JI2 L;  4MTN A;  3J7A 5;  2Q8T A;  1CA6 A;  4JI8 Q;  2IPK D;  4PZ6 A;  2WB1 E;  5C44 H;  3A8K E;  3J81 i;  2HHH L;  2UXB L;  1RL2 A;  3ER0 A;  5IWA Q;  3FHW A;  4DUY Q;  1E2Z A;  1TWH H;  1F9S A;  3KF8 A;  3F2D A;  3AFQ A;  1W2B A;  3KYH C;  2WB1 G;  4TRD A;  1K8G A;  2Z6B A;  4LF8 L;  3AYH B;  3MA2 B;  1HTL D;  4S3S A;  3HGB A;  2OWO A;  1SYC A;  3VYS A;  1E1O A;  2PZW A;  3H0G H;  4B9W A;  3BYY B;  4ZYS A;  4DPG A;  2OTL A;  3S15 H;  1PHJ A;  1HPC A;  1H95 A;  3A7L A;  3F2C A;  3M85 A;  1B53 A;  2IT1 A;  4JBK A;  4QMG A;  2VQF Q;  3A74 A;  3U58 A;  1A2U A;  2RDH A;  1OXU A;  3C2P A;  3GTG B;  3HOX G;  4B3S Q;  2KHS A;  4G57 A;  3Q22 A;  1LTS D;  3S15 B;  1R9T B;  3U4V A;  2QA4 A;  4IUU A;  2YV5 A;  3VR5 A;  3RZO B;  4YWL A;  3S1Q B;  3NQI A;  5I2X A;  2PZT A;  1LTT D;  4IN3 A;  3M7N A;  4GS3 A;  3QB3 A;  3TBI B;  5IE8 A;  4LNQ A;  3J80 L;  2KQ3 A;  3GTQ H;  3M4O H;  1WTH A;  3WOE A;  1LTG D;  2F0O A;  2PMZ B;  3DHQ A;  1UE5 A;  3CKI B;  1G2T A;  2K4K A;  1R4Q B;  4KKS A;  3BDC A;  3GD7 A;  1SFO H;  2BDO A;  3T53 B;  4A4I A;  5JJI A;  2F4V Q;  3PGZ A;  2JA9 A;  1GUS A;  4M8A A;  4CDE C;  5GQO A;  2Q8I B;  4EQ5 A;  3OPO A;  2JA6 B;  1JOR A;  1D5Z C;  1SYD A;  1YHQ A;  3PO3 H;  4Q5V A;  1SFO B;  2O5J C;  1S40 A;  4JYA Q;  3BVG A;  1UE1 A;  3CPF A;  1TU2 B;  4DAY A;  2BE5 C;  4BY1 G;  1VQF A;  4XT1 B;  4NXN L;  4C3I G;  1EY6 A;  4IPH A;  1CKM A;  4OX9 L;  2A69 C;  3HKZ B;  3F2U A;  2N55 A;  4H44 C;  1STY A;  2WAQ E;  5DNF A;  1IBL L;  1PMR A;  3EQL C;  1EOV A;  1CHP D;  5E4W C;  1I4Q A;  4PMW A;  2JA8 H;  5IGF A;  1XTC D;  2AUK A;  3OIP A;  3SVM A;  1QCB D;  2WAQ G;  2ZJR A;  5C5L A;  3SEB A;  4U67 3;  4YCV A;  1L0Y B;  2YYZ A;  3BS1 A;  2NYZ D;  4A3J G;  3CP0 A;  3NEN A;  2E2I H;  2ENB A;  1C8C A;  3RUZ A;  1XNR L;  3VA5 A;  3CCR A;  1SYF A;  3DEP A;  4R4C A;  2ATW A;  4KY6 A;  1XPR A;  2F0T A;  2MPM A;  3I4M G;  2VUM H;  2I5H A;  1CHQ D;  4DNI A;  3D31 A;  2NVT H;  1DOL A;  1QNK A;  5DM6 3;  4HJA A;  4LF7 Q;  5LMN L;  1X3F A;  3VYU A;  3HKZ E;  4HIK A;  1SBB B;  4A3G B;  2LFN A;  3BZC A;  3I4L A;  5IOD A;  1I4P A;  1UE6 A;  2E8G A;  1LT4 D;  3CC7 A;  2DJG C;  1CSP A;  1STB A;  3KDF B;  1FNV A;  2AQ3 B;  3QWN A;  5GRO A;  1SRU A;  3HKZ G;  2O5I C;  4L8J A;  2ES2 A;  2NUC A;  4Z9C B;  1S5C D;  1KL9 A;  3NK9 A;  1PFM A;  4G7O C;  3A8I E;  3LX0 A;  3R93 A;  1E3P A;  1QB5 D;  1V9P A;  1A3V A;  1UE7 A;  1ENA A;  1HQR D;  2K14 A;  3ERQ A;  4DA2 A;  4HR7 B;  1Y14 B;  1XMQ L;  3EIV A;  3KF8 B;  1JR0 D;  2Z0S A;  5IP7 H;  1JC7 A;  2RBM A;  4Y52 H;  1FL0 A;  3S16 B;  3HOZ G;  1QJO A;  5M9O A;  1F77 A;  3GTM H;  1CKO A;  1WTW A;  3M4Y A;  1HH2 P;  1NR2 A;  2NVY H;  3D8G A;  2GVA A;  3S17 B;  5BN5 A;  3FPP A;  3K0X A;  4N9T A;  2RA4 A;  1GVP A;  2K1B A;  1HFN A;  2YU9 H;  4DXF A;  5K5P A;  4HIM A;  4PZ7 A;  3UDI A;  1TWG H;  2DNE A;  1I4G A;  2L1B A;  1XNQ L;  3PUX A;  1IL8 A;  3D4D A;  5EPJ A;  4C1N I;  4A3I G;  3BYT B;  5COY A;  4RKL A;  1EU3 A;  1STG A;  1R4P B;  3G71 A;  4CHT B;  2K5V A;  4ME5 A;  4K5X A;  3UI2 A;  5JPM C;  1VQP A;  4QCL A;  3FPU B;  3D3R A;  2JA5 H;  4XQQ A;  4DUZ L;  1TXY A;  1VQA A;  5M3F H;  1PH2 A;  4KK7 A;  5DLQ E;  4DV0 L;  1KRS A;  1VQK A;  4ID6 A;  4IPG A;  3GTL B;  2X6L A;  4MNO A;  3FVQ A;  2F4V L;  1RKN A;  2K05 A;  4GKJ Q;  4LW1 A;  4C3H G;  1I3Q B;  3MXN A;  1A3T A;  4JI7 Q;  3CRL C;  2Z9H A;  4DAY B;  1EFI D;  3K7A H;  3SK8 A;  1HA6 A;  2MFI A;  1G91 A;  4FF1 A;  1WYD A;  3CQZ H;  1CQV A;  4K0K Q;  1WCM H;  1I4X A;  4WJ3 M;  3GTP H;  2B63 B;  3P7J A;  4CDF C;  1KIX A;  5CR3 A;  5C0X H;  1AEX A;  3GQB A;  5C0X I;  1V43 A;  3OSO A;  4LUO A;  5J3B A;  4DV6 L;  1FJG L;  2K5H A;  1E22 A;  1H9J A;  2PQA A;  1XPU A;  3QIA A;  2K5D A;  3SXH A;  3I7F A;  2UXD L;  2SNM A;  5FO7 B;  1JWU D;  1GHK A;  3BDL A;  1VQ9 A;  3OWE B;  3I55 A;  4XYQ A;  3CRK C;  3HZX A;  4X3S A;  1CK1 A;  4RGT A;  2ZJP A;  1EY8 A;  1I94 L;  3QOJ A;  3G6J B;  1M1K C;  2PQE A;  4DV3 L;  2CHB D;  2ZTC A;  2Z6K C;  2Z8L A;  3JAM c;  5CV5 A;  3VA7 A;  3LWE A;  3TQY A;  1TWC H;  5IGE A;  1DM0 B;  1FGU A;  4K14 A;  4JI1 L;  1TWA B;  2K5Q A;  3J7A V;  3I4N B;  2WV6 D;  3OOC A;  1NE3 A;  4LF7 L;  5JPN C;  2EQS A;  2GA4 B;  2Z6K A;  1JWM D;  1HQM C;  3RNU A;  2QEX A;  1WI5 A;  1KXL A;  3ULP A;  1CI3 M;  5CV6 A;  1KHI A;  5JVG 3;  2JA7 G;  3EVQ A;  2B63 G;  3TP6 A;  1SNQ A;  1GM5 A;  2F0E A;  1IBM Q;  3PUV A;  1Y1W H;  1K0S A;  4HN7 A;  2DJF C;  1LYL A;  4B3T Q;  3IAY A;  3J7A F;  4HJ9 A;  2F0V A;  1TQO A;  3C1F A;  1H9R A;  4R1J A;  2CH4 A;  1BVS A;  5C6A A;  1Y1W B;  3CCE A;  4OWX B;  1SYB A;  1EQV A;  2KEE A;  1SRO A;  2PYK A;  4DU9 A;  1K3B C;  3K0Y A;  3V05 A;  5CBA E;  1VQN A;  4LF9 Q;  1I4H A;  4LAA A;  4JV5 L;  4JI5 Q;  2MP1 A;  3GO5 A;  1CT1 D;  4HJ5 A;  2B39 A;  5LL6 X;  1IBK L;  4NMZ A;  2ZTD A;  4NB3 A;  3A5U A;  2EY1 A;  4OEM B;  4DAP A;  2KCN A;  1MD2 D;  1JB3 A;  3IL8 A;  3Q23 A;  3S1R H;  4KKT A;  5JEA J;  2R93 H;  2A5H A;  3FKI H;  4WFN 3;  4HCS A;  3E0J A;  4LK1 C;  2AQ2 B;  3LWU A;  1E2W A;  1XYI A;  1NTG A;  4DR1 L;  1V1Q A;  1YJ9 A;  1KNA A;  2I0Q A;  5IP9 H;  5HGT A;  3TRE A;  4FXK C;  3JC6 6;  1BCP F;  4R4O A;  3SHL A;  1A62 A;  5JJZ A;  1N33 Q;  3K5L A;  5BR8 Q;  1XJV A;  4YWM A;  3T56 B;  4XXE A;  4DV4 Q;  3SR1 A;  2SOB A;  4XQN A;  4Y7N H;  1X3G A;  3ZYY X;  2ZXR A;  1J8I A;  3I3C A;  4JVZ A;  4IFD G;  3MXN B;  1WD0 A;  1AE2 A;  3X3N A;  3U4Z A;  5M5Y B;  2F0P A;  5BN4 A;  1IZ6 A;  1PH3 A;  3CD6 A;  1Y8N B;  1HZC A;  1O7Z A;  5I6W A;  4HSV A;  3I70 A;  4LF4 L;  4A93 H;  5IYD H;  4DGZ A;  3GTJ B;  1NBW A;  3IRB A;  4CDC C;  2FHT A;  2HCC A;  2ICI A;  5I2Y A;  1QG7 A;  2WII B;  4QY7 A;  2B2W C;  2KHI A;  2NB0 A;  4P73 A;  4HTH A;  3TEH B;  2UUC L;  1MJE A;  4H02 A;  5IGD A;  4JBJ A;  1N9W A;  2YTX A;  1Z7T A;  2PQA B;  1A2T A;  2R92 H;  2JSO A;  1FNW A;  4BBS H;  1PVO A;  4A76 A;  2B2W A;  1VQ4 A;  3I56 A;  2KHJ A;  4YIJ A;  4YHH Q;  3S24 A;  3Q24 A;  1W3S A;  2GVB A;  3D0F A;  4FVM A;  4X3U A;  4WOR A;  1EWI A;  4FF2 A;  2E2H B;  1VQD A;  3JAM i;  4HJ7 A;  3V96 A;  4DR5 L;  5IYC G;  5C4J H;  3R2I A;  3B6Y A;  1B44 D;  1IYU A;  3G48 A;  5FO8 B;  3KBG A;  1HTP A;  1B8A A;  1CFM A;  3K8A A;  1I5F A;  2NBF A;  1DOM A;  3A55 A;  1TS4 A;  1U4M A;  4C2M B;  2A1A A;  2O2L D;  1CKN A;  3HOV B;  2LS0 1;  3ZJY C;  4DK6 C;  4C3J H;  1KAA A;  1EQR A;  1HNX L;  1D6E C;  3CCV A;  3TP5 A;  1LT6 D;  1EEF D;  2KOL A;  3BU2 A;  5KGU A;  1PYS B;  5COR A;  3ERS X;  2PNH A;  3HOU B;  1VQ7 A;  4C3J B;  5C3E B;  1J9O A;  4ZAI A;  3T51 B;  3TP7 A;  5IT9 E;  3RR5 A;  5FLX E;  3ITP A;  3C3L A;  3HFZ B;  3OTO L;  1IKL A;  4NDX A;  2TMP A;  1YHA A;  4P2C B;  1N32 Q;  3K80 C;  1B9N A;  2UUB Q;  3GTK H;  3KLR A;  3BDO A;  4KY5 A;  5ISR A;  2KJX A;  3FMC A;  3KOJ A;  3K5M A;  4IOA A;  4A3K G;  1HR0 Q;  2NN6 G;  5ELE A;  4JI0 L;  1ASZ A;  1BR9 A;  1SJE D;  2OCE A;  3IFT A;  4IAL A;  3L3O C;  3NBH A;  2RQX A;  4QJF A;  2L9H A;  1XMO L;  2F4I A;  1SNM A;  4EGV A;  1VQC A;  1ICF B;  1IKM A;  2B2T C;  4DFA A;  4X62 Q;  5A2Q E;  1LTA D;  1YJW A;  1MIU A;  4IUN A;  5FLM H;  1I6H H;  1JE5 A;  2EYM A;  4QUC A;  4GN4 B;  1PH8 A;  1P16 A;  3TS2 A;  4DR7 Q;  3L2P A;  1QVG A;  2VNU D;  2WB1 B;  3I8Z A;  2B2T A;  3H3V H;  1RF2 D;  1YHB A;  2RHQ B;  4DN4 M;  1BQQ T;  1AZP A;  3H3V I;  2UXC Q;  4QL5 A;  4KHP Q;  2XRQ D;  3WOF A;  4CKE A;  1JWS D;  3HOX H;  1HNZ Q;  5J22 A;  1EY0 A;  1SR3 A;  1HRJ A;  3DWQ A;  2R7Z G;  1IYV A;  2LXK A;  2ZM6 L;  3KJO A;  1VQM A;  4EQO A;  4JK1 C;  3D4W A;  3J81 E;  3K59 A;  4AQY L;  3H15 A;  2A6H D;  2JEB I;  1K8O A;  2CH4 W;  1XX8 A;  1RTN A;  2BA1 A;  1A6X A;  3AU7 A;  4DR6 Q;  4IOC A;  5KRU A;  2F0K A;  4A3F G;  5KNC A;  1TS2 A;  5T1I A;  1YNJ D;  4OIK A;  2HUG A;  1X6O A;  2MO1 A;  5JJK A;  2EYH A;  1G8Z D;  5FK9 C;  1PTO H;  5CV4 A;  2K32 A;  4P71 A;  1E7Z A;  4B3M Q;  3QJY A;  1GUW A;  1FVI A;  1YI2 A;  1LAB A;  2VL6 A;  2L4N A;  1HFG A;  4IUV A;  1PTO B;  5FJ8 G;  2F0F A;  4B9X A;  3PF5 A;  2C9O A;  4YHH L;  1X9N A;  2VY3 A;  4B3R Q;  4BY1 B;  1CM9 A;  4DNR B;  4HIO A;  3GTG H;  1M90 C;  4K6L A;  1BBW A;  4C3I B;  1R9T H;  2IL8 A;  1AZQ A;  3STB D;  3VR3 A;  3RZO H;  1II3 A;  3S1Q H;  5E7N A;  1FYC A;  2NVQ B;  4RWS C;  4I7A A;  1CKN B;  4DV5 L;  2B2Y C;  3Q0A A;  3A0J A;  4L6T B;  1YEZ A;  2WAQ B;  2AQ1 B;  1EWH A;  1HHV A;  4A3J B;  4X6A H;  2UU9 L;  1KDC A;  4AH6 A;  4ZUI A;  5GAE C;  3P75 A;  5I9P A;  3J7Z C;  3NTK A;  4JPB W;  1TT2 A;  5EBD A;  2V1C C;  2JA6 H;  1D8L A;  2RVL A;  2UUA Q;  1ONL A;  4CKC A;  2B2Y A;  4L5Q A;  4PV1 C;  1SN8 A;  1PV4 A;  4X66 L;  3I4M B;  4YY3 Q;  1ESF A;  4L63 B;  3S2H H;  1JE4 A;  3NE5 B;  2LXJ A;  1VQ5 A;  4ZKB B;  1ZKO A;  3VDY A;  4ZQ3 A;  4DK3 C;  2J4X A;  2XWJ B;  1B9M A;  3UE1 A;  3A8J E;  2HT1 A;  3T1H L;  1K28 A;  2AMC B;  1AH9 A;  4GN5 A;  2RCN A;  3S2H B;  4E6I A;  1N32 L;  2HQL A;  2UUB L;  3HOW B;  2E5L L;  5BN3 A;  3PV0 A;  1E1T A;  1TWF B;  2YTV A;  1BNZ A;  1GUO A;  1Q81 C;  4C1N K;  1PRT D;  3NBH B;  5I6Y A;  2G9H D;  3RN5 A;  2FMC A;  4GKK Q;  1V1P B;  1TS3 A;  3HP3 A;  1KRT A;  4CKB A;  3JAM L;  2M9V A;  1Q3L A;  3EJI A;  1SAP A;  4BXX G;  1NUC A;  1Z6H A;  4KV6 A;  3TZU A;  3V2T A;  3CMA A;  1RIP A;  4F7X A;  4JI3 Q;  4JI4 Q;  4RH6 A;  2OT2 A;  1QIL A;  2Y0S E;  5F2D A;  3CW2 C;  5IGC A;  3H0G G;  2PW7 A;  1LTL A;  3HOZ B;  4KN4 C;  3PIP 3;  1QZG A;  4X64 Q;  4LF6 Q;  1Q8I A;  2Y0S G;  4KY7 A;  1PH7 A;  4A3G H;  1EZ6 A;  3S1N B;  4H7B A;  4EVO A;  3OMC A;  2K50 A;  3OW2 A;  2F03 A;  4DR2 Q;  4X65 Q;  1L0X B;  3KK7 A;  3K58 A;  2OXP A;  2NVX B;  3G4S A;  1VQE A;  1EL0 A;  1D5X C;  3HOW G;  2BA0 A;  4JI6 Q;  2KBN A;  2LMC B;  1I50 B;  1TVX A;  4A3I B;  1E24 A;  3MFY A;  2HIX A;  1NCV A;  4NXM L;  4HID A;  3HOY B;  3VYR A;  2IX1 A;  3S16 H;  1PH1 A;  2LY7 A;  1CSQ A;  4ODG A;  1BOS A;  2D0P A;  3OIQ A;  3PO3 G;  1GUG A;  4LFA Q;  5C3W A;  2MHV A;  3KLW A;  3NWT A;  4JI8 L;  3R3O A;  4YCU A;  1YBY A;  4R4Q A;  1C9O A;  5KND A;  4B3M L;  4OHJ A;  3S17 H;  1SE3 A;  5IWA L;  4DUY L;  3CHB D;  4C3H B;  4RGO S;  5JVH 3;  2N49 A;  1LTB D;  4A3B B;  2X69 A;  2QDB A;  3EBE A;  2WAC A;  2RF4 A;  4XT3 B;  3PQI A;  5EPK A;  4K8J A;  4MTK A;  1L2F A;  1HCZ A;  1Q46 A;  2CVR A;  2WIN B;  4B3R L;  2KEC A;  2JA8 G;  5EKL A;  1VS0 A;  1QOH A;  3NHH A;  3C1E A;  4POF A;  4AIM A;  2VQF L;  4NPS A;  3MWY W;  4HMJ A;  4KHV A;  1SYE A;  4B3S L;  1LO5 D;  5ELO A;  1ICW A;  4MIU A;  1N34 Q;  2A6H C;  3HOY G;  2L11 A;  2DY7 A;  2E74 C;  1ILP A;  1PFN A;  1MHW C;  3GTL H;  4TSS A;  5C4Z A;  3PIO A;  3TZD A;  2MO0 A;  3RLO A;  1YNJ C;  3EA6 A;  1I3Q H;  1ZEQ X;  3DWP A;  5JEA H;  1ENC A;  2K04 A;  1OTC A;  2M2L A;  3S1M B;  3CCM A;  2K75 A;  2EYO A;  5LL6 S;  1D1K A;  1KTK A;  2E75 C;  1Q82 C;  3PUZ A;  1PXU A;  1WTV A;  2CQA A;  2AWN A;  1JT8 A;  1YIJ A;  4F8M A;  4A3B G;  3BVM A;  2F0W A;  1HNW Q;  4IQZ A;  1LLR D;  2B63 H;  1U0L A;  1AN8 A;  2B8G A;  4JYA L;  3LNN A;  5TSS A;  2EY6 A;  4XTC S;  5AFW A;  2OQ0 A;  5GAG C;  1EU4 A;  4FF4 A;  4UDU C;  2JA7 B;  3TSS A;  1F9P A;  1QUQ A;  3A5Z B;  4R8I A;  2EYP A;  2EYF A;  1BKB A;  2K52 A;  3TDQ A;  1DYQ A;  1EIY B;  3SE0 A;  1H9M A;  4MHE A;  1PA6 A;  1C0A A;  3NEM A;  4K5V A;  3STB C;  2K33 A;  1Q90 A;  1SMY D;  4WRD A;  4LUV A;  1SYG A;  1DON A;  2EE1 A;  3MC0 B;  4QUF A;  2K28 A;  5ELN A;  2Z4I A;  2MJ8 A;  1JJG A;  2BCO A;  3D4R A;  1KDB A;  4IPD A;  2ZJQ A;  1TWA H;  1EYD A;  3D6W A;  2C35 B;  3I4N H;  1FD7 D;  1UAP A;  2D0O A;  4KLK A;  4ZRZ A;  1MKH A;  4LF6 L;  1EYA A;  4FDB A;  1Q7Y C;  4H0L C;  3UE0 A;  4R9W A;  4OO1 G;  3UDF A;  4UP9 A;  1TS5 A;  1U4L A;  1D7Q A;  1HUN A;  2N3S A;  1WFQ A;  1EWC A;  5FOB B;  4FF3 A;  2R6G A;  1W6J A;  3X3M A;  3I91 A;  1KLG D;  1MGS A;  1B4O A;  1L0W A;  4AYB E;  1JMC A;  2A6E D;  1JB7 A;  4LFC Q;  1O80 A;  4N9P A;  4H13 C;  4IZ8 A;  3AB9 A;  1ET6 A;  1PRT C;  2EYL A;  2QGQ A;  2JQO A;  4AYB G;  4NKL A;  2SDF A;  1X3Q A;  2D9U A;  4V19 0;  4LF5 Q;  4A3D B;  1N36 Q;  1IXR A;  1H9K A;  1VQJ A;  1J5E Q;  1VQ8 A;  4DR4 Q;  1D5M C;  2EXD A;  4HMI A;  4A3E B;  2JXM B;  1GHJ A;  2ZT9 C;  1VQG A;  1HUM A;  3PUW A;  3RMH A;  3VR6 A;  4R8N A;  4PG3 A;  3MZ5 A;  4FP5 D;  5DM7 3;  2G5D A;  3U50 C;  4ME3 A;  5ELC A;  2VB3 X;  4IUT A;  3O13 A;  4YCW A;  4DR3 Q;  4FXG C;  1LTI D;  5C3X A;  1SDF A;  2EVB A;  5C0X G;  2N8N A;  4RG1 A;  2HDL A;  2K6A A;  2Q2T A;  3T1Y Q;  2JJQ A;  4N8F A;  1KD1 C;  3PCO B;  2IX0 A;  4MZ9 A;  2QCP X;  3I4O A;  2VZA A;  5M3M B;  5E3F A;  4JBW A;  4TKO B;  5IGG A;  1Y69 U;  4JC0 A;  3J80 E;  3A56 A;  3A7A B;  4DNT B;  5FLX c;  4IJH A;  4C56 C;  2J7Z A;  2VB2 X;  4RKB A;  5IYC H;  5C4X B;  5AJ3 Q;  2F0N A;  2KEN A;  1IW7 D;  3W3A A;  2XSC A;  4F87 A;  2F0G A;  3RLN A;  5M5Y H;  1KAW A;  2KCM A;  1K3R A;  3VYT A;  4A3D G;  4A3E G;  5EJW A;  2Z4H A;  3MHB A;  2B8F A;  3GTJ H;  5M5W B;  4A3M B;  3CC4 A;  4L5S A;  1AP0 A;  2EJF C;  1LM0 A;  5LMU Q;  2M00 A;  3CAM A;  1TII D;  4B08 A;  5GAD C;  3P20 A;  1PH9 A;  4OL7 A;  5ELF A;  4GKJ L;  3HG9 A;  1Y8O B;  4V0B A;  3M3Y B;  4JI7 L;  4ALP A;  5G3L F;  5IY0 A;  1U4R A;  3EFX D;  1A8V A;  2B2U C;  1IL2 A;  3GDE A;  2YTY A;  1QUQ B;  2D5D A;  3FRP B;  1HR0 W;  1SNO A;  3MTS A;  3JAM E;  4K0K L;  4A3L H;  2F0M A;  3L7Z C;  2KCC A;  5M3M G;  2QEJ C;  1KQS A;  4FXD A;  2B2U A;  2KCT A;  3DM1 A;  3M4P A;  5K36 G;  4ZLT F;  2E2H H;  3IFD A;  4JI2 Q;  4RHR A;  1JOQ A;  2PZU A;  2NTS A;  2PO4 A;  2VQE Q;  5C4X G;  1IYJ B;  2DY8 A;  2JP1 A;  3S14 B;  2CW0 D;  5J39 A;  2PW5 A;  5GAH C;  2UXB Q;  2RKS A;  2HDM A;  1EIF A;  4RMF A;  4A3K B;  5FKA C;  3PF4 A;  2D62 A;  1QVF A;  2JN4 A;  1SND A;  5DAU A;  1PFS A;  1UNS A;  4C2M H;  2OQK A;  4A3M G;  1K8A C;  4LF8 Q;  1O7L A;  3DEO A;  3HOV H;  1BUV T;  3FKI G;  1EQQ A;  3PSI A;  5HGQ A;  4UHV A;  4BBR B;  1S5B D;  1PYB A;  4IFD J;  4HSP A;  2MUY A;  3HOU H;  2Q2H A;  4UPA A;  2R7F A;  5IP9 G;  3OMG A;  5C3E H;  2L15 A;  3K6O A;  4QIW B;  4DAM A;  3WWV A;  4FNF A;  1B50 A;  3NTH A;  1VQO A;  3S2D B;  5D3D A;  3DLL A;  5JOB A;  2B3G A;  1IBM L;  2EY5 A;  3URY A;  2F52 A;  4B3T L;  1BO0 A;  4XDX A;  1BBX C;  1Q1B A;  3HEJ A;  1YIT A;  4A93 G;  3K5O A;  1PRT B;  5IYD G;  2I5M X;  2VS1 A;  3CCL A;  4ILW A;  1SMY C;  2VW9 A;  1J5E L;  2QDL A;  1K83 B;  4DR4 L;  2R7Z B;  2BH8 A;  1BCP D;  1HZA A;  4PNY A;  2F3V A;  2XWB B;  4OIJ A;  2VXW A;  1YVC A;  1KLU D;  2NWG A;  3J7Y W;  1GXD C;  1DOK A;  4G7H C;  1X65 A;  4LF9 L;  3NWS A;  4JG2 A;  1G29 1;  1X54 A;  4A3F B;  4JI5 L;  4BBR G;  1C48 A;  2KA7 A;  4UY8 C;  1Y1V B;  4GLV B;  4QIW E;  4O42 A;  1CQF A;  1SSO A;  3NXW A;  4NXN Q;  1V8Q A;  4OX9 Q;  3ND8 A;  2BDN A;  4KI0 A;  3RD4 A;  4RA8 A;  3T1Y L;  1OXX K;  1LAC A;  2K5W A;  1F9R A;  3KUP A;  1IBL Q;  2J0T D;  3BG3 A;  2X6G A;  1GUN A;  2F0S A;  1XTD A;  3CCU A;  3J81 j;  2IX3 A;  1U5K A;  2A74 C;  2R7D A;  2JK8 A;  2A6E C;  1EYG A;  3SK4 A;  5IGB A;  4ULL A;  1SXT A;  1VCI A;  3CCJ A;  1E2V A;  1XNR Q;  2F3W A;  1O7Y A;  3F8T A;  1N33 L;  5BR8 L;  4YWK A;  4L5T A;  4OON A;  2IW3 A;  4KMU C;  1IHZ A;  2EY2 A;  4RGN A;  1TKW B;  1QVC A;  4DV4 L;  4KKU A;  5C4H A;  3D6C A;  1OXS C;  3C46 A;  5LMU L;  1EOT A;  2AKW B;  5LMN Q;  4XYO A;  2LSS A;  3I73 A;  1GO3 E;  3KJP A;  3GTO B;  4A75 A;  4BY7 B;  5IYB G;  1BBU A;  1RJT A;  4GLA C;  2RSN A;  1Y1V G;  5M5X B;  2E2J B;  3PO2 B;  3HS0 C;  1UWV A;  3HKS A;  4RGM A;  1PZJ D;  4IO9 A;  2ID0 A;  3P1H A;  2Q2U A;  3R8B A;  2EYJ A;  5ELD A;  1SJH D;  1DD2 A;  1I4R A;  1K8M A;  2MQH A;  3RZD B;  3MFG A;  1EEI D;  5KNB A;  2PPB C;  4BY1 H;  3TRZ A;  4RFB A;  2ALY B;  4C3I H;  4A3C G;  1JOO A;  1NJI C;  2Z1C A;  3TP8 A;  1PH4 A;  1XMQ Q;  2VQE L;  1MBY A;  2NVQ H;  1UEA B;  1TY0 A;  1RHP A;  4I7Z C;  2D2C C;  4BXX H;  1IW7 C;  3ERO A;  2F0Q A;  3W1B A;  2F3I A;  5EQ0 A;  4KD3 A;  1WTQ A;  1X56 A;  4HJ8 A;  3NBI A;  4A3J H;  3NQT A;  2EDG A;  3KF6 A;  5FLM G;  5C44 B;  1B7Y B;  3U9O A;  1PZI D;  5DEH A;  2F0U A;  1TWH B;  1WVL A;  4OGQ C;  1X3P A;  5JJL A;  4G4K A;  4BY7 G;  1SNP A;  4KJO A;  2HCI A;  2ASB A;  2ZXP A;  1WJJ A;  1STH A;  3I4M H;  3PO2 G;  4P72 A;  1H9S A;  4P74 A;  1B2T A;  4G7Z C;  3H0G B;  4DV7 Q;  5CGK A;  1XNQ Q;  3VR2 A;  1A63 A;  2Y0S B;  2A73 B;  1D1I A;  3KBX A;  2TSS A;  2EJM A;  3HOW H;  4TVA B;  1TWF H;  2IHF A;  2PI2 E;  4J6H A;  3T16 A;  4F88 A;  2WP8 J;  4DUZ Q;  1VQL A;  2I46 A;  2E2D C;  1GUT A;  3QR8 A;  4DK1 A;  4DV0 Q;  1SMX A;  1ILQ A;  4BA2 I;  1PTO F;  3OWF A;  3FDT A;  3FP9 A;  2CW0 C;  5EKI A;  3GTQ B;  2RCF A;  3M4O B;  4L5R C;  1HR0 L;  1WOC A;  2WFW A;  4QB4 A;  1HA5 A;  2HIV A;  2OEO A;  2EOT A;  3G7L A;  1VMP A;  2HD3 A;  2XVS A;  1K0R A;  3ULJ A;  3A54 A;  5C44 G;  1HXY D;  1U4P A;  1F9Q A;  1HZ9 A;  4ABN A;  5CBE E;  3HOZ H;  1EIG A;  2EZV A;  3PO3 B;  3E6Z X;  4IUR A;  4GOP C;  3CPW A;  2N78 A;  2RHS B;  3H6M A;  1EY4 A;  5I9O A;  1YJN A;  4CJ0 B;  4X62 L;  3S1N H;  1SLJ A;  1YZ6 A;  3MVV A;  4DV6 Q;  1FJG Q;  1QZH A;  4IUP A;  5CV9 A;  1ASY A;  1PH5 A;  2JEA I;  4ZKC B;  4DR7 L;  1S3O A;  3WDN A;  2NVX H;  5EPL A;  4GOP A;  5HY6 A;  1DZ1 A;  1JQY D;  2UXD Q;  2PMZ E;  5D3I B;  4LUZ A;  1X3E A;  2UXC L;  1STA A;  1VQH A;  2BOS A;  1EIH A;  3AFP A;  2H1E A;  4KHP L;  3QOL A;  4APV A;  3H09 A;  1WTO A;  2JA8 B;  4Q0F A;  1I50 H;  1I94 Q;  4ZK9 B;  4A3I H;  1HNZ L;  1F2Y A;  1HJP A;  4DV3 Q;  2EIF A;  4KD4 A;  3HOY H;  3K5N A;  2E2I B;  4UAI A;  4WJ4 A;  1X32 A;  3ONA B;  2PNR C;  3BJU A;  4JI1 Q;  2JA6 G;  1W6K A;  1BCP C;  3DWA A;  1GOZ A;  1A0I A;  1BDO A;  4HAE A;  4DR6 L;  1NY4 A;  4R4T A;  4OWT B;  2VUM B;  2K5N A;  2NVT B;  1Q12 A;  2KUM A;  5FO9 B;  4C3H H;  4CGY B;  1EUJ A;  1UUP A;  1G51 A;  2XRS D;  4A3B H;  1PDQ A;  3NEL A;  2AWO A;  1Z9F A;  1JCK B;  2A68 D;  2F0D A;  2QKI C;  2JE6 I;  3DM3 A;  2K7V A;  1VDZ A;  5IT9 L;  3CU7 A;  3I90 A;  5FLX L;  1CUK A;  3N6R A;  5IIF A;  1LTR D;  2SNS A;  4KTA A;  2NZH A;  2WKD A;  4J8Q A;  4GN3 B;  2AHO B;  1STE A;  4IPC A;  1M8A A;  4POG A;  4JV5 Q;  2K01 A;  4LFB Q;  3KF6 B;  1AFP A;  2DNC A;  2F1M A;  2IJ0 A;  3E9H A;  3MEF A;  4HCE A;  5D14 A;  1IBK Q;  2FXQ A;  1WTP A;  1WTX A;  1F2Z A;  2I07 B;  3HRZ C;  4K6D A;  4OWW B;  4GLX A;  1WD1 A;  1ZYR D;  3GTM B;  1PTO D;  2DGY A;  2L12 A;  5T1G A;  2XGT A;  1H9S B;  3BVZ A;  3S1M H;  3TN2 A;  2VUM G;  4O0A A;  2I5L X;  1Q86 C;  4A3G G;  4KN7 C;  2NZ1 D;  2NVY B;  1RTO A;  4KJN A;  2OF1 A;  2KVM A;  4UP8 A;  3NSW A;  4DR1 Q;  4DV7 L;  3Q8D A;  5KEE A;  2UUA L;  3GV6 A;  2YU9 B;  4OO1 H;  5A2Q L;  4OO1 I;  1B70 B;  1TWG B;  1LT3 D;  1MJC A;  1VMC A;  1QWY A;  1XXG A;  4YY3 L;  3CCQ A;  5LHY 1;  4DV1 Q;  3CME A;  1JJ2 A;  2JA7 H;  1HZB A;  1G6P A;  1YNN D;  4XIG S;  1DXM A;  4BS9 A;  2HQE A;  1S72 A;  1NMG A;  1A3U A;  4DAV A;  1EY7 A;  1KNE A;  4LF4 Q;  4JW0 A;  3I2Z A;  3E0E A;  3OHX C;  2JA5 B;  2ICE C;  3FEW X;  5M3F B;  1SE8 A;  3GV3 A;  4U68 A;  2QF7 A;  4GKK L;  1O78 A;  1P8L A;  4AYB B;  3J80 c;  5IP7 G;  3J81 L;  2EXZ A; 
#chains in the Genus database with same CATH homology
 3M7G A;  2C5C A;  4K2L A;  1CTM A;  3H91 A;  1BF4 A;  2PCF B;  5NUC A;  2FMM A;  3K7A B;  3SK6 A;  2F0J A;  4DK0 A;  2L0C A;  3CQZ B;  3AMU A;  1FNU A;  3IKJ A;  2XN9 C;  1WCM B;  2AUJ D;  3NTI A;  3GTP B;  2R61 A;  2RDF A;  3S9W A;  2FFK B;  1BXT A;  2O4X A;  1QNU A;  3MEH A;  2MGS A;  1STN A;  2LKV A;  2G9D A;  5KYL A;  2SEB D;  1SNC A;  4DXG A;  1JIC A;  2KED A;  2XIW A;  1C4Q A;  5JEA G;  1F2M A;  5ELB A;  3NPP A;  1ZXT A;  1FR3 A;  1E0B A;  4NP5 A;  3U9S A;  5EGT A;  4IFD H;  1TWC B;  1BCP B;  5E4X A;  4IFD I;  5CC4 A;  1OXT A;  2E76 C;  1G2S A;  4LMQ D;  3Q6S A;  4GZY C;  3KLS A;  1ET9 A;  4M1U B;  4CBV A;  3ND9 A;  5EKK A;  1D2B A;  5CYU A;  2B2V C;  3H94 A;  3SDZ A;  3OW7 A;  4EQN A;  1B3A A;  1NAP A;  5K36 H;  3NUC A;  2B2V A;  1S5D D;  1Y8P B;  1DCZ A;  1MSG A;  3K57 A;  3L9A X;  4NW2 A;  5J1Z A;  1EYC A;  4IUQ A;  3E5S A;  3I72 A;  3MXU A;  4FYD A;  4FO2 A;  1B1Z A;  1FGB D;  3S1R B;  4RHS A;  2R93 B;  1AW7 A;  3FKI B;  3PIO 3;  3H3V C;  1T5X D;  2NTT A;  1NSN S;  2V4D A;  1MI2 A;  3PUY A;  1V1O A;  1CA5 A;  5C5M A;  2A68 C;  5D65 A;  4K2K A;  3SK5 A;  1PLF A;  1PZK D;  5IOC A;  3KLS X;  5C0X J;  1S5F D;  2EPB A;  5KYI A;  1A15 A;  1SE4 A;  4Y7N B;  2RDG A;  4RCO A;  4WJW A;  2L55 A;  1WTR A;  2NN6 H;  2NN6 I;  4A93 B;  4CJ2 C;  4DF7 A;  2F0I A;  1ZYR C;  4X3K A;  1PTO C;  2FJ2 A;  4MN3 A;  4QF4 A;  2RSO A;  2BE5 D;  3DXJ C;  3MXG A;  1ESR A;  1F2L A;  3MAQ A;  3R2T A;  1LT5 D;  4RAU C;  1RDP D;  4TQU S;  1LV9 A;  2A69 D;  1XWE A;  4EQP A;  2R92 B;  3MXP A;  4BBS B;  1G6Z A;  2Q8R E;  3T4A C;  1SE2 A;  3TME A;  2XNA C;  1OXV A;  5EBC A;  3N52 A;  4J1M A;  1YNN C;  4HED A;  3QO2 A;  1KDA A;  2N88 A;  1NR4 A;  5C4J B;  2R3Z A;  4I65 A;  1EZ8 A;  1Q1E A;  1I6V C;  1JOK A;  4PQX A;  1DJR D;  1M4V A;  2L5T A;  4K8I A;  1ENF A;  1EY9 A;  1VF5 C;  4BWG B;  3NP8 A;  1EQT A;  2WKC A;  5KIX A;  4BA1 I;  3BZD B;  5CV8 A;  1GJX A;  4O1N A;  5A35 A;  2DN8 A;  4XQJ A;  2K03 A;  1QE6 A;  1T5E A;  1S4Z A;  1EY5 A;  1KAB A;  5CV7 A;  5I4D A;  3GTK B;  1PYW D;  1VF7 A;  5G3L D;  4RCN A;  2H4O A;  5HUR A;  1ML0 D;  2QIL A;  1V1P A;  2F0H A;  4ZUJ A;  2EJG C;  1ROD A;  1U9R A;  3T13 A;  4X3T A;  3W2D A;  1SEB D;  3GP7 A;  1TY2 A;  1PFB A;  1RD9 D;  4C3J G;  4KHZ A;  1RCV D;  1I6H B;  2F0L A;  1CZG A;  1OO9 B;  1PRT F;  3RLF A;  4CJ1 B;  1MSH A;  1TR5 A;  3PMF A;  4PMB A;  4LJZ C;  3DMU A;  2JYO A;  3HOX B;  1Z47 A;  5CMD A;  2FIN B;  2IWH A;  4PMC A;  3DUZ A;  5JAV A;  3VR4 A;  4K5W A;  1CZW A;  3QG1 A;  5E1F A;  2ZXO A;  1S5E D;  2Q8T A;  1CA6 A;  2IPK D;  3A8K E;  1E2Z A;  1F9S A;  3KF8 A;  4TRD A;  3MA2 B;  1HTL D;  4S3S A;  3HGB A;  1SYC A;  3VYS A;  2PZW A;  4B9W A;  3BYY B;  4ZYS A;  1HPC A;  3A7L A;  3M85 A;  1B53 A;  2IT1 A;  4QMG A;  1A2U A;  2RDH A;  1OXU A;  3C2P A;  3GTG B;  2KHS A;  4G57 A;  3Q22 A;  1LTS D;  3S15 B;  1R9T B;  4IUU A;  3VR5 A;  3RZO B;  3S1Q B;  3NQI A;  5I2X A;  2PZT A;  1LTT D;  4IN3 A;  3M7N A;  3QB3 A;  3TBI B;  3J80 L;  2KQ3 A;  3WOE A;  1LTG D;  2F0O A;  2PMZ B;  3DHQ A;  3CKI B;  1G2T A;  1R4Q B;  4KKS A;  3BDC A;  3GD7 A;  2BDO A;  3T53 B;  1GUS A;  4M8A A;  2Q8I B;  3OPO A;  2JA6 B;  1JOR A;  1D5Z C;  1SYD A;  4Q5V A;  1SFO B;  2O5J C;  3BVG A;  1TU2 B;  4DAY A;  2BE5 C;  4XT1 B;  4C3I G;  1EY6 A;  2A69 C;  3HKZ B;  3F2U A;  2N55 A;  4H44 C;  1STY A;  5DNF A;  1PMR A;  3EQL C;  5E4W C;  1CHP D;  1I4Q A;  4PMW A;  5IGF A;  1XTC D;  2AUK A;  3OIP A;  3SVM A;  1QCB D;  5C5L A;  3SEB A;  4U67 3;  1L0Y B;  2YYZ A;  3BS1 A;  2NYZ D;  2ENB A;  1C8C A;  3RUZ A;  3VA5 A;  1SYF A;  3DEP A;  4KY6 A;  2F0T A;  2MPM A;  1CHQ D;  3D31 A;  1DOL A;  1QNK A;  5DM6 3;  3VYU A;  1SBB B;  4A3G B;  2LFN A;  3I4L A;  5IOD A;  1I4P A;  1LT4 D;  1STB A;  3QWN A;  1FNV A;  2AQ3 B;  2O5I C;  4L8J A;  2NUC A;  4Z9C B;  1S5C D;  3NK9 A;  1PFM A;  4G7O C;  3A8I E;  3LX0 A;  3R93 A;  1QB5 D;  1A3V A;  1ENA A;  1HQR D;  3ERQ A;  4DA2 A;  4HR7 B;  1JR0 D;  1JC7 A;  2RBM A;  3S16 B;  1QJO A;  5M9O A;  1F77 A;  1WTW A;  3M4Y A;  1NR2 A;  3D8G A;  3S17 B;  5BN5 A;  3FPP A;  4N9T A;  2RA4 A;  2K1B A;  1HFN A;  4DXF A;  5K5P A;  2DNE A;  1I4G A;  2L1B A;  3PUX A;  1IL8 A;  3D4D A;  5EPJ A;  4C1N I;  3BYT B;  5COY A;  4RKL A;  1EU3 A;  1STG A;  1R4P B;  4CHT B;  4ME5 A;  4K5X A;  3UI2 A;  5JPM C;  4QCL A;  3FPU B;  3D3R A;  4XQQ A;  4KK7 A;  4ID6 A;  3GTL B;  2X6L A;  3FVQ A;  1RKN A;  2K05 A;  4C3H G;  1I3Q B;  3MXN A;  1A3T A;  3CRL C;  1EFI D;  3SK8 A;  1HA6 A;  1G91 A;  4FF1 A;  1CQV A;  1I4X A;  2B63 B;  3P7J A;  5CR3 A;  5C0X H;  1AEX A;  3GQB A;  5C0X I;  1V43 A;  3OSO A;  1H9J A;  3QIA A;  2K5D A;  3SXH A;  2SNM A;  5FO7 B;  1JWU D;  1GHK A;  3BDL A;  3OWE B;  4XYQ A;  3CRK C;  3HZX A;  4X3S A;  1CK1 A;  4RGT A;  1EY8 A;  3QOJ A;  3G6J B;  2PQE A;  2CHB D;  2Z8L A;  5CV5 A;  3VA7 A;  3LWE A;  5IGE A;  1DM0 B;  4K14 A;  1TWA B;  2K5Q A;  3J7A V;  3I4N B;  2WV6 D;  3OOC A;  5JPN C;  2GA4 B;  1JWM D;  1HQM C;  1CI3 M;  5CV6 A;  5JVG 3;  3EVQ A;  3TP6 A;  1SNQ A;  2F0E A;  3PUV A;  4HN7 A;  3IAY A;  3J7A F;  2F0V A;  1TQO A;  3C1F A;  1H9R A;  5C6A A;  1Y1W B;  1SYB A;  1EQV A;  2KEE A;  2PYK A;  4DU9 A;  3K0Y A;  3V05 A;  5CBA E;  1I4H A;  4LAA A;  2MP1 A;  3GO5 A;  1CT1 D;  2B39 A;  5LL6 X;  4NMZ A;  2EY1 A;  4DAP A;  2KCN A;  1MD2 D;  1JB3 A;  3IL8 A;  3Q23 A;  4KKT A;  5JEA J;  2A5H A;  4WFN 3;  4HCS A;  3E0J A;  4LK1 C;  2AQ2 B;  3LWU A;  1E2W A;  1XYI A;  1KNA A;  5HGT A;  4FXK C;  1BCP F;  3SHL A;  5JJZ A;  3K5L A;  3T56 B;  4XXE A;  3SR1 A;  2SOB A;  4XQN A;  3ZYY X;  2ZXR A;  1J8I A;  3I3C A;  4IFD G;  1WD0 A;  5M5Y B;  3X3N A;  2F0P A;  5BN4 A;  1Y8N B;  1O7Z A;  5I6W A;  4HSV A;  3I70 A;  4DGZ A;  3GTJ B;  2FHT A;  2HCC A;  2ICI A;  5I2Y A;  1QG7 A;  2WII B;  2B2W C;  2NB0 A;  4HTH A;  5IGD A;  1Z7T A;  1A2T A;  2JSO A;  1FNW A;  2B2W A;  4YIJ A;  3Q24 A;  4FVM A;  4X3U A;  4WOR A;  4FF2 A;  2E2H B;  3V96 A;  3R2I A;  1B44 D;  1IYU A;  5FO8 B;  3KBG A;  1HTP A;  1CFM A;  2NBF A;  1DOM A;  1TS4 A;  1U4M A;  3A55 A;  4C2M B;  2O2L D;  3HOV B;  2LS0 1;  1KAA A;  1D6E C;  3TP5 A;  1LT6 D;  1EEF D;  2KOL A;  5KGU A;  5COR A;  3HOU B;  4C3J B;  5C3E B;  1J9O A;  4ZAI A;  3T51 B;  3TP7 A;  5IT9 E;  5FLX E;  3ITP A;  3C3L A;  1IKL A;  4NDX A;  2TMP A;  4P2C B;  1B9N A;  3KLR A;  3BDO A;  4KY5 A;  5ISR A;  2KJX A;  3FMC A;  3K5M A;  2NN6 G;  5ELE A;  1BR9 A;  1SJE D;  3IFT A;  4IAL A;  3L3O C;  3NBH A;  2RQX A;  2L9H A;  2F4I A;  1SNM A;  4EGV A;  1IKM A;  2B2T C;  4DFA A;  5A2Q E;  1LTA D;  4IUN A;  2EYM A;  4QUC A;  2VNU D;  2WB1 B;  3I8Z A;  2B2T A;  1RF2 D;  4DN4 M;  1BQQ T;  1AZP A;  2XRQ D;  3WOF A;  4CKE A;  1JWS D;  5J22 A;  1EY0 A;  1HRJ A;  3DWQ A;  1IYV A;  4EQO A;  4JK1 C;  3D4W A;  3J81 E;  3K59 A;  2A6H D;  2JEB I;  1K8O A;  1XX8 A;  1RTN A;  2BA1 A;  1A6X A;  3AU7 A;  5KRU A;  2F0K A;  5KNC A;  1TS2 A;  5T1I A;  1YNJ D;  4OIK A;  2HUG A;  2EYH A;  1G8Z D;  5FK9 C;  1PTO H;  5CV4 A;  2K32 A;  3QJY A;  1GUW A;  1LAB A;  2L4N A;  1HFG A;  4IUV A;  1PTO B;  2F0F A;  4B9X A;  2C9O A;  4BY1 B;  1CM9 A;  4DNR B;  4K6L A;  4C3I B;  2IL8 A;  1AZQ A;  3VR3 A;  1II3 A;  1FYC A;  2NVQ B;  4RWS C;  2B2Y C;  3Q0A A;  4L6T B;  2WAQ B;  2AQ1 B;  1EWH A;  1HHV A;  4A3J B;  1KDC A;  4ZUI A;  3P75 A;  5I9P A;  3NTK A;  5EBD A;  1TT2 A;  2RVL A;  1ONL A;  4CKC A;  2B2Y A;  4PV1 C;  3I4M B;  1ESF A;  4L63 B;  1JE4 A;  3NE5 B;  4ZKB B;  1ZKO A;  4ZQ3 A;  2J4X A;  2XWJ B;  1B9M A;  3A8J E;  3S2H B;  4E6I A;  3HOW B;  5BN3 A;  3PV0 A;  1TWF B;  1BNZ A;  1GUO A;  4C1N K;  1PRT D;  5I6Y A;  2G9H D;  2FMC A;  1V1P B;  1TS3 A;  3HP3 A;  4CKB A;  3JAM L;  2M9V A;  1Q3L A;  3EJI A;  1SAP A;  1NUC A;  1Z6H A;  4KV6 A;  3TZU A;  3V2T A;  4F7X A;  4RH6 A;  2OT2 A;  1QIL A;  5F2D A;  5IGC A;  2PW7 A;  3HOZ B;  4KN4 C;  3PIP 3;  1Q8I A;  4KY7 A;  1EZ6 A;  3S1N B;  4H7B A;  4EVO A;  3OMC A;  2F03 A;  1L0X B;  3KK7 A;  3K58 A;  2OXP A;  2NVX B;  1EL0 A;  1D5X C;  2BA0 A;  2LMC B;  1I50 B;  1TVX A;  4A3I B;  3MFY A;  1NCV A;  3HOY B;  3VYR A;  2IX1 A;  2LY7 A;  4ODG A;  1BOS A;  3OIQ A;  1GUG A;  5C3W A;  2MHV A;  3NWT A;  3R3O A;  5KND A;  4OHJ A;  1SE3 A;  3CHB D;  4C3H B;  4RGO S;  5JVH 3;  1LTB D;  4A3B B;  2X69 A;  2QDB A;  2WAC A;  4XT3 B;  5EPK A;  4K8J A;  1HCZ A;  2CVR A;  2WIN B;  2KEC A;  5EKL A;  1QOH A;  3NHH A;  3C1E A;  3MWY W;  4HMJ A;  4KHV A;  1SYE A;  1LO5 D;  1ICW A;  4MIU A;  2A6H C;  2L11 A;  2DY7 A;  2E74 C;  1ILP A;  1PFN A;  4TSS A;  5C4Z A;  3TZD A;  1YNJ C;  3EA6 A;  3DWP A;  1ZEQ X;  5JEA H;  1ENC A;  2K04 A;  2M2L A;  3S1M B;  2EYO A;  5LL6 S;  1D1K A;  1KTK A;  2E75 C;  3PUZ A;  1PXU A;  1WTV A;  2CQA A;  2AWN A;  4F8M A;  3BVM A;  2F0W A;  4IQZ A;  1LLR D;  1AN8 A;  2B8G A;  3LNN A;  5TSS A;  2EY6 A;  4XTC S;  5AFW A;  1EU4 A;  4FF4 A;  4UDU C;  2JA7 B;  3TSS A;  1F9P A;  4R8I A;  2EYP A;  2EYF A;  3TDQ A;  1DYQ A;  3SE0 A;  1H9M A;  4MHE A;  4K5V A;  2K33 A;  1Q90 A;  1SMY D;  4WRD A;  1SYG A;  1DON A;  2EE1 A;  3MC0 B;  4QUF A;  2K28 A;  2Z4I A;  2MJ8 A;  2BCO A;  3D4R A;  1KDB A;  1EYD A;  3D6W A;  1FD7 D;  1UAP A;  4ZRZ A;  1EYA A;  4H0L C;  4R9W A;  4OO1 G;  1TS5 A;  1U4L A;  1HUN A;  1EWC A;  5FOB B;  4FF3 A;  2R6G A;  1W6J A;  3X3M A;  3I91 A;  1KLG D;  1MGS A;  1B4O A;  2A6E D;  1O80 A;  4N9P A;  4H13 C;  4IZ8 A;  3AB9 A;  1ET6 A;  1PRT C;  2EYL A;  4NKL A;  2SDF A;  1X3Q A;  2D9U A;  4V19 0;  4A3D B;  1H9K A;  1D5M C;  4A3E B;  4HMI A;  2JXM B;  1GHJ A;  2ZT9 C;  1HUM A;  3PUW A;  3RMH A;  3VR6 A;  4R8N A;  3MZ5 A;  4FP5 D;  5DM7 3;  5ELC A;  2VB3 X;  4IUT A;  3O13 A;  4FXG C;  1LTI D;  5C3X A;  1SDF A;  2EVB A;  5C0X G;  2HDL A;  2K6A A;  2IX0 A;  2QCP X;  5M3M B;  5E3F A;  4JBW A;  4TKO B;  5IGG A;  1Y69 U;  3J80 E;  3A56 A;  3A7A B;  4DNT B;  4C56 C;  2J7Z A;  2VB2 X;  4RKB A;  5C4X B;  2F0N A;  1IW7 D;  3W3A A;  2XSC A;  4F87 A;  2F0G A;  3VYT A;  5EJW A;  2Z4H A;  3MHB A;  2B8F A;  5M5W B;  4A3M B;  1AP0 A;  2EJF C;  2M00 A;  1TII D;  4B08 A;  3P20 A;  4OL7 A;  5ELF A;  3HG9 A;  1Y8O B;  4V0B A;  3M3Y B;  5G3L F;  1U4R A;  3EFX D;  2B2U C;  2D5D A;  3FRP B;  1SNO A;  3MTS A;  3JAM E;  2F0M A;  3L7Z C;  2KCC A;  2QEJ C;  4FXD A;  2B2U A;  3DM1 A;  5K36 G;  4ZLT F;  3IFD A;  4RHR A;  1JOQ A;  2PZU A;  2NTS A;  2PO4 A;  2DY8 A;  2JP1 A;  3S14 B;  2CW0 D;  5J39 A;  2PW5 A;  2RKS A;  2HDM A;  4A3K B;  5FKA C;  2D62 A;  1SND A;  5DAU A;  1UNS A;  1O7L A;  3DEO A;  1BUV T;  4BBR B;  1S5B D;  4IFD J;  4HSP A;  2MUY A;  3OMG A;  3K6O A;  4QIW B;  4FNF A;  1B50 A;  3NTH A;  3S2D B;  5D3D A;  5JOB A;  2EY5 A;  3URY A;  1BO0 A;  4XDX A;  1BBX C;  1Q1B A;  3HEJ A;  3K5O A;  1PRT B;  4ILW A;  1SMY C;  2R7Z B;  1K83 B;  1BCP D;  4PNY A;  2F3V A;  2XWB B;  4OIJ A;  2VXW A;  2NWG A;  1KLU D;  3J7Y W;  1GXD C;  1DOK A;  4G7H C;  3NWS A;  1G29 1;  4A3F B;  1C48 A;  2KA7 A;  1Y1V B;  4O42 A;  1CQF A;  1SSO A;  3NXW A;  1V8Q A;  3ND8 A;  2BDN A;  4KI0 A;  3RD4 A;  4RA8 A;  1OXX K;  1LAC A;  2K5W A;  1F9R A;  3KUP A;  2J0T D;  3BG3 A;  2X6G A;  1GUN A;  2F0S A;  2IX3 A;  2A74 C;  2A6E C;  3SK4 A;  5IGB A;  4ULL A;  1SXT A;  1VCI A;  1E2V A;  2F3W A;  1O7Y A;  2IW3 A;  4KMU C;  1IHZ A;  2EY2 A;  4RGN A;  1TKW B;  4KKU A;  5C4H A;  3D6C A;  1OXS C;  3C46 A;  1EOT A;  4XYO A;  3I73 A;  3GTO B;  4BY7 B;  1RJT A;  2RSN A;  5M5X B;  2E2J B;  3PO2 B;  3HS0 C;  4RGM A;  1PZJ D;  2ID0 A;  3P1H A;  3R8B A;  2EYJ A;  5ELD A;  1SJH D;  1DD2 A;  1I4R A;  1K8M A;  3RZD B;  3MFG A;  1EEI D;  5KNB A;  2PPB C;  4RFB A;  1JOO A;  2Z1C A;  3TP8 A;  1MBY A;  1UEA B;  1TY0 A;  1RHP A;  4I7Z C;  2D2C C;  1IW7 C;  3ERO A;  2F0Q A;  5EQ0 A;  4KD3 A;  1WTQ A;  3NBI A;  3NQT A;  2EDG A;  5C44 B;  3U9O A;  1PZI D;  5DEH A;  2F0U A;  1TWH B;  1WVL A;  4OGQ C;  1X3P A;  4G4K A;  1SNP A;  4KJO A;  2HCI A;  2ZXP A;  1STH A;  1H9S A;  1B2T A;  4G7Z C;  3H0G B;  5CGK A;  3VR2 A;  2Y0S B;  2A73 B;  1D1I A;  3KBX A;  2TSS A;  2EJM A;  4F88 A;  3T16 A;  4J6H A;  2WP8 J;  2I46 A;  2E2D C;  1GUT A;  4DK1 A;  1ILQ A;  4BA2 I;  1PTO F;  3OWF A;  3FDT A;  2CW0 C;  5EKI A;  3GTQ B;  3M4O B;  4QB4 A;  1HA5 A;  2OEO A;  2EOT A;  3G7L A;  1VMP A;  2XVS A;  3A54 A;  1HXY D;  1U4P A;  1F9Q A;  4ABN A;  5CBE E;  1EIG A;  2EZV A;  3PO3 B;  3E6Z X;  4IUR A;  3H6M A;  1EY4 A;  5I9O A;  4CJ0 B;  3MVV A;  4IUP A;  5CV9 A;  2JEA I;  4ZKC B;  3WDN A;  5EPL A;  1DZ1 A;  1JQY D;  5D3I B;  1STA A;  2BOS A;  1EIH A;  2H1E A;  3QOL A;  3H09 A;  1WTO A;  2JA8 B;  4Q0F A;  4ZK9 B;  1F2Y A;  4KD4 A;  2E2I B;  3K5N A;  4UAI A;  1X32 A;  3ONA B;  2PNR C;  1W6K A;  1BCP C;  3DWA A;  1GOZ A;  1BDO A;  4HAE A;  2VUM B;  2NVT B;  1Q12 A;  2KUM A;  5FO9 B;  4CGY B;  1UUP A;  2XRS D;  1PDQ A;  2AWO A;  1JCK B;  2A68 D;  2F0D A;  2QKI C;  2JE6 I;  2K7V A;  1VDZ A;  5IT9 L;  3CU7 A;  3I90 A;  5FLX L;  3N6R A;  5IIF A;  1LTR D;  2SNS A;  4KTA A;  4J8Q A;  2WKD A;  1STE A;  1M8A A;  2K01 A;  1AFP A;  2DNC A;  2F1M A;  2IJ0 A;  4HCE A;  5D14 A;  1WTP A;  1WTX A;  1F2Z A;  2I07 B;  3HRZ C;  4K6D A;  1WD1 A;  1ZYR D;  3GTM B;  1PTO D;  2L12 A;  5T1G A;  1H9S B;  3BVZ A;  3TN2 A;  4KN7 C;  2NZ1 D;  2NVY B;  1RTO A;  4KJN A;  2OF1 A;  2KVM A;  3NSW A;  5KEE A;  2YU9 B;  3GV6 A;  4OO1 H;  5A2Q L;  4OO1 I;  1TWG B;  1LT3 D;  1VMC A;  1QWY A;  1XXG A;  5LHY 1;  1YNN D;  4XIG S;  1DXM A;  4BS9 A;  2HQE A;  1A3U A;  4DAV A;  1EY7 A;  1KNE A;  3OHX C;  2JA5 B;  2ICE C;  3FEW X;  5M3F B;  3GV3 A;  4U68 A;  2QF7 A;  1O78 A;  4AYB B;  3J81 L;  2EXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...