1QNUA

Shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Shiga toxin 1 variant B subunit
publication title Shiga-like toxins are neutralized by tailored multivalent carbohydrate ligands.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Toxin
total genus 17
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qnuA00
2BOSA 4M1UB 1D1IA 4ULLA 2XSCA 1QOHA 3MXGA 1BOSA 4P2CB 2GA4B 1QNUA 1R4PB 1CZWA 1C48A 1CQFA 1D1KA 1CZGA 1DM0B 1R4QB 2C5CA 1C4QA
chains in the Genus database with same CATH superfamily
1HZCA 1DZ1A 1BBWA 2NUCA 4DK6C 4JI5Q 1EUJA 1M90C 3GTGH 1PTOC 1OO9B 4DR7L 4A3MB 1C9OA 2F0FA 2TSSA 3DEOA 2BH8A 3M9BA 5EPLA 5BN4A 2E2HH 4XQQA 3KLRA 3K81C 3A8IE 3S1RH 1ASZA 1CSQA 2F0HA 4LF4L 1HA5A 1HTPA 4DXGA 2KVMA 5I6WA 5IYDH 1VQ9A 4ABNA 1GOZA 3PO3B 4Q5VA 1LLRD 2ZXPA 2L15A 3BDLA 3CCQA 2HQLA 3EQLC 1F77A 2K52A 4U673 4ZKBB 1SXTA 1NSNS 5M3MG 1TS4A 4ZYSA 3M4OH 2A8VA 1SE4A 2Q2HA 4LNQA 4ZK9B 1ASYA 5JEAG 3EVQA 5C4JH 1VDZA 1LTID 3RZDH 5I4DA 1VQ5A 3GV6A 4PMCA 3K59A 3PQIA 4DV6L 5M3FB 3I2ZA 3TS0A 1GM5A 2JA6G 2QGQA 2KA7A 3T1HQ 2L55A 4CDCC 4A3DB 4DPGA 4DR6L 5JOBA 3UDGA 2D5DA 3PUWA 3WWVA 1JR0D 1D5MC 5CBEE 4IURA 1EIFA 4HSPA 2V1CC 4QJFA 2JA8H 3BYTB 5J1ZA 3WDNA 3CCLA 1KHIA 3AYHB 2C35B 4K8JA 4DV4L 4LF8Q 3I70A 4BA1I 2KHSA 3NUCA 3HOUH 5G3LF 1X65A 1OTCA 1A62A 2I5HA 2HIVA 2WB1B 3K0YA 1K73C 3ER0A 3KFUA 3T51B 3M4PA 1QUQA 4ZUJA 4EX5A 1PFMA 3TDQA 1DGSA 3PO2G 4AYBG 4OL7A 3J81i 2F0KA 1QNKA 4KD4A 4RMFA 5C6AA 4KY6A 3I3CA 4K5XA 2K5WA 4K2LA 1AP0A 4JI3L 4HCEA 4DK0A 1EL0A 2A6HD 5CV7A 4P74A 3ND9A 3E0EA 4JC0A 1C7YA 1TQOA 5LMNW 3ZJYC 4A3IB 2K5QA 4N8FA 3HKZE 1QWYA 4IUQA 1WTRA 4X64Q 1E2ZA 1L0WA 4NP5A 4K2KA 1UWVA 5I2XA 4FF2A 1SYDA 3H94A 1IBLQ 1ENAA 1PRTB 3CMEA 2TMPA 4YCWA 3HOWB 3HOUG 1CQFA 1CZGA 4LFAQ 3CHBD 2QA4A 5GADC 2I07B 3BZDB 5D3DA 3LWUA 1OXTA 3L3OC 5M5WH 2VNUD 4IUPA 2K6AA 3SK8A 3KK7A 2OEOA 4K5WA 4DK1A 3HP3A 1N32Q 2IX1A 2NBFA 1YNJD 3U9SA 4AQYQ 1BCPD 3NQTA 2I5MX 4X6AH 1A3VA 2N88A 4HIMA 5ELCA 1G2SA 1PXUA 4JBJA 2UXDQ 4NXMQ 3I7FA 3HRZC 4ZAIA 4BBSB 2XSCA 1AZQA 1TWFH 4K0KQ 2B29A 1STNA 1QUQB 2F0OA 5IGBA 4B3MQ 3E9HA 3RN5A 2KCCA 2PO4A 2KCTA 1GUWA 1EIYB 1CUKA 2J4XA 1PFSA 2UUCL 4DUYQ 2B8FA 1I4GA 4ZCKA 1N36L 3GTLB 5DM63 4DNRB 3K58A 4A3JB 2BOSA 1WI5A 3Q6SA 1Z7TA 3NEMA 1K8OA 1EZ8A 2ZXRA 4UY8C 1CKOA 2B63H 2ES2A 1XNRL 1ESRA 1V8QA 2NN6H 1A63A 2AHOB 1SR3A 2O5IC 4TQUS 3GTKB 4KLKA 1VMCA 3SK5A 3CCSA 5FLXL 4UDUC 1M8AA 2CHBD 1ILPA 2E76C 3VYTA 3A74A 4L5SA 1KAWA 4GKJL 2EYLA 3LNNA 2XN9C 1XXGA 1F9RA 3QIAA 4X65Q 4Y7NB 4DK3C 4R4CA 1TWAB 3Q22A 5FO8B 2NVYB 2E5LL 5M3MB 2PMZB 4LUVA 3D31A 3H91A 1LTAD 4LUZA 1IYJB 4B3SL 4KKTA 1VQJA 1IHZA 3IRBA 4KMUC 3CCRA 5LMUL 4YWKA 4ZQ3A 3S9WA 2Y0SE 4KK7A 1O7ZA 4L5TA 3B6YA 2B2WC 3I4NG 2JA6B 4XYQA 4ZRZA 3OMCA 3GTPH 2QCPX 3S2DH 3MEFA 1UE7A 4IFDJ 2RQXA 1S4ZA 3EFXD 1B70B 1EWCA 2QDLA 3TBIB 1TWGB 1F2MA 3TMEA 2X6GA 1IW7D 2X6LA 1ICWA 4A3FG 1BO0A 2H5XA 1XNQL 3UDIA 1BBUA 2NTTA 1LTSD 4GKKQ 2BA1A 2K5NA 2WV6D 4S3SA 1X6OA 1HFGA 1JMCA 4OO1G 2JP1A 2QKIC 3CF5A 4C2MH 1EQQA 4EQOA 2UXBQ 2ZT9C 4F87A 1XMQL 5M5YH 3L7ZC 2KEEA 3M4OB 4TSSA 2E2IH 3PO2B 4AYBB 3OW2A 4FXDA 5C4JB 5E4WC 2AQ1B 2WINB 2E2JB 4B9XA 5HY6A 5JJIA 1TIID 4RGOS 1VQLA 2F4VQ 2OCEA 1SE2A 2HD3A 2VY3A 3PUVA 1U5KA 1GO3E 4HN7A 2O2LD 2IJ0A 5FLMG 2IY5B 2A68C 3KLWA 3T53B 3OPOA 1SYCA 2VB3X 5FOBB 4C56C 1X3FA 1H9KA 3W1BA 5IOCA 1B3AA 1HNZL 3A5UA 2UU9Q 4BXXH 1DONA 3NWTA 2JE6I 4J15A 4A3CG 4QL5A 2KUMA 1EWIA 2A6EC 5DNFA 1I5FA 4KY5A 4IJHA 1N9WA 4QF4A 4DV1Q 3HOUB 5IYBH 1UE5A 3E9IA 1W3SA 1XPRA 2Q2TA 1L1OA 3S2HH 2R7FA 3S1NB 3S1MH 5HGTA 1SE8A 1SFOB 4QUFA 4RGTA 3SK6A 4RKBA 1UNSA 4DU9A 2GA4B 1R9TH 3S15B 2UXCL 1BXTA 3CPFA 3HOXG 1I3QH 5EKKA 1G6PA 5JVH3 4I7ZC 4APVA 1QILA 2VQFL 4X62L 4DV2Q 4FNFA 2B2TA 3C2PA 1UUPA 4A76A 1VQ8A 2F52A 1TS3A 5C4XH 4B3RL 2Z1CA 4HIDA 2EDGA 2KHIA 3MXGA 3R8BA 2A74C 2VUMG 3NE5B 3OMGA 1SNPA 5J22A 2NB0A 5GAGC 2Q8TA 4JV5Q 4A3LG 3NBHA 1SNMA 1FL0A 1IBKQ 4K6LA 2I5LX 5IT9E 3HOYH 1I4PA 4JVZA 4KN4C 2IX3A 2WP8J 1Q7YC 1NR2A 1VF7A 2EJGC 3A55A 5M5WB 1GXDC 4A93H 1TWCH 3GV3A 1YHAA 5C0XI 3RR5A 1WFQA 1BDOA 1G8ZD 3GTOB 1BCPB 2DJFC 2PZWA 3VDYA 3A0JA 2BCOA 2YYZA 2FMMA 2L12A 1GVPA 1L1OB 3M3YH 3QOLA 4LAAA 3FHWA 3H0GH 2SNMA 1D6EC 2NTSA 1Y8NB 3GQBA 1MBYA 1WTOA 3CC2A 1F2ZA 1ILQA 1VQAA 5G3LD 3I8ZA 3PMFA 4A3KG 4K6DA 3PIP3 1IKLA 4DR5Q 4RG1A 1OXVA 4O0AA 3J7AV 5CV9A 1NNXA 4R4OA 1N33L 2R7ZH 1QVGA 3WOEA 4YY3L 2RBMA 3STBD 1YHBA 2VZAA 3GTMH 1CSPA 3H3VH 1TVXA 3CCJA 2BH2A 1B44D 2OQKA 1UAPA 1ET9A 1SMYD 3KDFB 1A2TA 3BYYB 4MTKA 3E6ZX 2K5DA 4RCOA 4QY7A 1S5ED 5GAEC 3DUZA 1ONLA 3TP7A 1Q1EA 1KIXA 4X3UA 3J81E 2WAQG 3FP9A 4DR4Q 4A3FB 1QZHA 4IO9A 5CBAE 4JW0A 1Q81C 4O42A 1BOSA 2DNCA 4KJNA 5FJ8G 1RIPA 5C0XJ 1AFPA 1ZYRD 3PUZA 2NVXB 4G7ZC 4JI2Q 1E2WA 4IPCA 4GLXA 4X3KA 4MIUA 2K04A 4H0LC 4DV0L 2B39A 5CC4A 2R7ZG 4UP7A 2Z4HA 1EIHA 4A3BG 3OTOL 4CGYB 1N34L 4PZ7A 3TQYA 3MZ5A 3M4YA 3T13A 2R92H 1Q3LA 4XT1B 2WKCA 3KUPA 2ZM6Q 1Z6HA 2F0JA 2MO1A 2Z8LA 1IL8A 4WJ3M 3KJOA 4J8QA 4X3TA 4CJ1B 3S2DB 2P5ZX 1PTOD 4UAIA 3PF4A 1KNEA 3PIO3 2CH4A 5IWAQ 1BVSA 3AFQA 2LKVA 4N9TA 5IGCA 2PNHA 1A0IA 4XTCS 4DKAC 1RTNA 3CCMA 3ERQA 4O2DA 3S1QH 5EPJA 1A8VA 3I73A 1QZGA 3P75A 5LMNQ 1O7YA 3BVMA 1FGBD 5I9OA 5FKAC 1QG7A 3IFTA 4C2MB 4GS3A 1ET6A 4RWSC 4H44C 4I65A 3V05A 5M5YB 2KEDA 1VQ7A 1KTKA 3BVGA 3WOFA 1B50A 4IPGA 3GTJB 2JA5H 1B9NA 3C1FA 3S14B 5JPMC 4DR2L 3NENA 4JI6Q 4QIWE 3D4WA 2VL6A 1X9NA 3RZOB 2K5VA 1GKHA 4BBRG 2ALYB 2EYPA 4UP8A 3V2TA 2KHJA 4P72A 1YNXA 1Q8KA 3AB9A 1PH4A 3HOVH 2PPBC 2HUGA 1TXYA 4ZLTF 2VUMB 4PG3A 1G291 3RNUA 1AZPA 5IT9c 1JORA 1IBML 3TRZA 4DV7Q 4KHZA 2RDGA 2UUBQ 1RF2D 3JC66 1X54A 2XNAC 3D8GA 4RAUC 4C3HG 1B9MA 3UDXA 1EEFD 4F88A 5JJLA 4NMZA 2DJGC 1CTMA 5M5XH 2MPMA 2PW7A 2PQAA 1WOCA 2R7DA 3LX0A 1ZEQX 1TWHB 2A5HA 2LMCB 3NP8A 2KENA 5HGQA 4JI8L 2H1EA 2CQAA 1R9TB 4H02A 1I3QB 3CAMA 1PFBA 3ERSX 1QE6A 2XWBB 3UE0A 5AJ3L 4QB4A 3S17B 2JA5G 5JEAJ 1LYLA 4NB3A 4JG2A 1EY0A 4WORA 1CKNA 1RCVD 5ELOA 3AQQA 2ZTCA 5C5MA 2UUAL 1FJGL 1YJWA 2R93G 1VQDA 3DLLA 5C3EH 3HOVG 4LF7L 5DAUA 3RLOA 2CKZB 2IPKD 5EGTA 4LFAL 3KOJA 3VYSA 1E2VA 1MD2D 3CMAA 4HAEA 1AEXA 1PH9A 2FMCA 1TKWB 5FO7B 2Q2UA 3KF6A 1LT4D 3K7AB 2M9VA 1HHVA 2K32A 1QOHA 4UPAA 4R8NA 4A3KB 2Q8RE 3E5SA 4OWXB 2MJ8A 4DV3Q 5IYDG 2RCNA 5C3XA 2GVBA 2NVTH 3OHXC 1UE1A 4NXNL 4DUZQ 3GO5A 4JI1Q 2VB2X 1KLGD 4UP9A 3PSIA 1DD2A 2YTXA 3J81c 5A2QL 2MO0A 1E0BA 2NZ1D 1DCZA 1RODA 1VQHA 1SROA 4L63B 4LFBQ 2RA4A 4GNXA 5K36H 4LF9Q 2Z9HA 1PRTF 1HRJA 3S16B 1X3QA 1DYQA 2WAQB 5BN3A 3R2IA 4GN3B 1HQRD 3GP7A 1VQBA 4DR7Q 1B8AA 2EOTA 2XRSD 1Y69U 1M1KC 3DWQA 2IHFA 2RDFA 3MVVA 2FINB 2PQAB 5ELEA 2VQEL 3VA5A 2MHVA 4IPDA 1B7YB 4PZ8A 2JA8G 1AE3A 3FPPA 3OWFA 5IGDA 1GHJA 4DR1Q 4JPBW 3CCVA 4ME5A 4LF4Q 1GUSA 2ICIA 3CCEA 4RCNA 1Y1VH 5ELFA 1Q12A 3D6WA 2OQ0A 4P73A 1VCIA 4KN7C 1GD7A 1CZWA 1CKNB 1IYVA 4BA2I 3GD7A 2R7ZB 4A3BB 2PZUA 3MXUA 1EU4A 3GTMB 1SNCA 2F0DA 3RLFA 4X66L 5COYA 4IN3A 4JI4L 1KDCA 1NR4A 1Q90A 2JA7H 4A4IA 4JYAL 1HNWL 1XPOA 2HIXA 1K8MA 1LTLA 2KJXA 3K5LA 4DV6Q 1T5XD 5IGEA 4KHPL 2WB1E 4DR6Q 3U4ZA 4FF1A 3PF5A 1H9SA 3M7NA 1E22A 3MXNA 3ULJA 4GN5A 5D65A 3NPPA 3F2UA 2E74C 2AQ3B 5LL6S 5I6YA 3I4MH 1SYEA 2OT2A 4DV4Q 2A69C 2JK8A 1HXYD 4KY7A 3FKIH 4OWTB 3J81j 2EY2A 1YHQA 3R2TA 1Q46A 4HJAA 1K0SA 1O7IA 5GAHC 1LT5D 1F9SA 2NN6I 4GNXB 4DR3L 4KTAA 1QVFA 1SSOA 5CV6A 4BY1H 2R92B 3I4OA 1PZJD 3UI2A 4CKBA 1EYGA 1U4RA 2J7ZA 2EXDA 1HH2P 4BBRB 1OXXK 4TVAB 1MJEA 2NWGA 2PI2A 4DA2A 1RDPD 1PTOB 3CPWA 1BKBA 1L0YB 3EROA 3T16A 4EQNA 2F0GA 4JI3Q 5DEHA 1NMFA 4OO1I 2Z6KC 3KBGA 4U68A 3DMUA 1D1KA 1SMXA 2CW0C 3CQZH 1E24A 2RF4A 1M4VA 4NKLA 3BZCA 1XMOL 3I4MG 5DLQE 5IYCH 3ONAB 4C3HB 1VQ6A 3PIPA 2F0PA 5NUCA 2HCCA 2F0QA 2IHEA 4CDFC 1LTTD 4KKUA 4IFDH 3G71A 3R93A 4WRDA 1NY4A 3T56B 2JA5B 2SEBD 3Q24A 4C3JH 1H9SB 4JCVE 1JJCB 1MSGA 4L5RC 1QCBD 4FO2A 2R93B 1S72A 4GZYC 2RVLA 2A68D 3L9AX 1I4RA 3HOVB 3DEPA 5H1SE 2KQ3A 1Q82C 1HPCA 4PV1C 2JQOA 1YBYA 2B63G 3QJYA 3GTGB 2NN6G 1Y1WH 1ENFA 1P8LA 1EOTA 2L9HA 4A3GH 2A6ED 3TZDA 5IE8A 1DXMA 4XQJA 3T1YL 1X55A 1GHKA 1QJOA 2E2HB 2SDFA 4BWGB 3S1RB 2G9DA 1GUOA 1VMPA 2B2YC 3F1ZA 5M5XB 1HR0L 3OW7A 2F0NA 4OX9L 2M2LA 2UUCQ 4IFDG 3Q23A 5KRUA 1N36Q 5TSSA 1CK1A 4PMBA 1SRUA 3VR3A 3FPUB 2Q2IA 2K33A 1PH1A 1PH5A 1VQKA 1F9QA 2MUYA 4LUOA 4XDXA 1D2BA 2E2DC 4C3JG 3NXWA 4MNOA 1STEA 1TR5A 2EYFA 4V0BA 3EBEA 1VQEA 1RHPA 3RZDB 3DM1A 4QMGA 3PIOA 1JE5A 1TS5A 2IL8A 1EY7A 1Z9FA 2MQHA 1XNRQ 5DM73 4KD3A 2PMZE 5E3FA 4POGA 5BR8L 1EQRA 5KNCA 1U4MA 5IP9H 1Y1WG 5IP7H 4FYDA 1PZKD 2E75C 2JA8B 4A3GG 4EQ5A 1U4PA 3GTQH 5IODA 2JA9A 4JBWA 2Z0SA 4IOAA 3CXCA 3JAML 4G4KA 4EQPA 4C1NI 4GKJQ 5EKIA 3NBIA 2I0QA 4CKEA 1UE6A 1CKMA 3MAQA 1Y8OB 2E5LQ 2XVSA 5JJKA 1G2TA 4B3SQ 1RJTA 3H6MA 4HJ9A 2OTLA 1GJXA 2EYMA 2AWOA 1XWEA 4P71A 5LMUQ 1N8RC 4IUVA 1KLUD 2IT1A 1HUMA 2NYZD 1HNXL 2B2WA 1VQ4A 2Z6BA 2EVBA 3CCUA 3EJIA 5IY0A 4OWWB 2IWHA 3X3NA 3D3RA 5I9PA 3OIQA 4YHHL 1YNNC 1B1ZA 3D4DA 2G9HD 4AYBE 2NZHA 4RA8A 5IP7G 1C48A 1PYSB 2QDBA 2B2UC 4O1NA 1V1QA 4BXXG 1XNQQ 2XWJB 2FHTA 1KXLA 1W6JA 1PH8A 1L2FA 1Y1VB 5FK9C 1MGSA 2PZTA 5EBCA 1ESFA 4GOPC 2F0LA 2K5HA 2KECA 2X69A 1BR9A 3BDOA 2FXQA 3S24A 1BCPF 4RHSA 3URYA 5IYBG 1D5ZC 2JEAI 4A3DH 5T1IA 4TRDA 2F0VA 1I4QA 4XIGS 1J5EL 2EPBA 2BE5D 3HOZH 1KC8C 2R61A 3SR1A 4LF5L 3F2BA 1WTWA 4OXPA 2MGSA 1NE3A 2A19A 4LJZC 3AMUA 5KNDA 4XXEA 2BDOA 4HTHA 1P16A 1EWHA 2K05A 4G57A 4YWMA 2D62A 5J3BA 4HJ8A 2B2VC 2F3WA 4ZKCB 3K57A 1HNZQ 2EJFC 5C4XG 5JAVA 1XTCD 3MFYA 3I4MB 2EXZA 1I94L 3H3VI 4OIJA 4DAYA 2A73B 1JWUD 1MSHA 3OSOA 3CKIB 1EFID 1WCMH 1TWFB 5CGKA 1DJRD 4HSVA 4LF6L 3VR2A 4B3TL 1YZ6A 1Z47A 4G7HC 2L5TA 2HCIA 3HKZG 3J7YW 2ZXOA 3TP6A 1TY2A 1WTHA 3FRPB 1A3TA 4PNYA 3A5ZB 4LFCL 1WD0A 2N78A 4ME3A 3PGZA 2DN8A 3HOYG 1U0LA 1XPUA 1ENCA 3EIVA 4BY1B 2F0WA 3HOZG 2UXCQ 1B53A 1HCZA 1LTBD 1R4PB 2CFMA 3HKSA 3DXJC 1V1PA 4GLAC 5C0XH 5IIFA 4A93G 1S5BD 2WKDA 1L0XB 4WFN3 2VQFQ 4JI0L 1WTXA 4X62Q 2B63B 3U50C 2LFNA 2ATWA 3HOWH 2MFIA 3P1HA 1X3GA 1PDQA 4IUTA 2OWOA 3SXHA 4B3RQ 3NBHB 5CV8A 4JOIC 1Q86C 3HFZB 1RTOA 2YTYA 4DV5L 4YCUA 2FJ2A 4ZUIA 1WD1A 4DXFA 1H9JA 3H0GG 1J6QA 2HT1A 1WCMG 2VW9A 3SDZA 1IKMA 4GOPA 5AFWA 1I6HH 1W2BA 2IW3A 4JI5L 4P75A 2CWAA 1EYAA 2N49A 3FMCA 4C3JB 2EY5A 1FR3A 1PHJA 3A8JE 4IUNA 1HFNA 1H9RA 2HDLA 1KAAA 4RFBA 4BBSH 1SNDA 4LWCA 4MN3A 2N8NA 5JVG3 3GTPB 1Y8PB 4DAYB 3ULPA 4MTNA 5A35A 1Y1WB 1PH3A 1BQQT 2JEBI 2LXJA 4A3GB 3P7JA 1LV9A 3TP5A 5JPNC 1FNUA 1PRTC 2K4KA 4A3JH 1HQMC 4IOCA 1HR0W 4JBKA 1X3PA 2CH4W 4H13C 1UEBA 1I50H 5C4ZA 3OIPA 3TZUA 3RN2A 4IALA 4ILWA 2ZTDA 2D0PA 1CHPD 3EN2A 1CFMA 2G5DA 2LSSA 4L6TB 4NW2A 2YV5A 2K01A 1V1PB 1JICA 1EU3A 3T1HL 1N33Q 4YY3Q 3DM3A 1AH9A 1SJHD 1DOKA 2HHHQ 3GTKH 4C3IH 3K6OA 3OOCA 3I56A 4DGZA 2E2IB 1VQOA 3O13A 2K7VA 1STYA 2QILA 3L0OA 2ZTEA 2R92G 4FF3A 1KDBA 1STGA 2MP1A 1HTLD 1K0RA 4JI7Q 4LF8L 1SE3A 2WIIB 3J80L 3CP0A 1YJNA 2Y0SG 4ID6A 4Y7NH 3PUYA 1JJ2A 5ELBA 1K28A 3J7AF 1ZYRC 3MC0B 3SVMA 1JOQA 2CQOA 5M3MH 2CWPA 2L0CA 4MHEA 1VF5C 3GTQB 1YVCA 3CRLC 2EY6A 2MNAA 1LABA 5D3IB 5JEAH 4TKOB 4RH6A 2LS01 4POFA 1PYBA 2ID0A 4LW1A 2JA6H 1STAA 3S2HB 3M7GA 3S1MB 4OHJA 3CU7A 1E1TA 3NELA 4IQZA 4DV0Q 2O4XA 1EOVA 3VR5A 1CM9A 5HURA 3OTOQ 1TWGH 1N34Q 4N9PA 3Q8DA 4C3IG 4B9WA 3MFGA 2OF1A 5KYLA 3J7ZC 1S5DD 3OWEB 2LXKA 5KGUA 3PV0A 1E7ZA 4OEMB 4DR1L 3QO2A 2YU9H 1FYCA 3RUZA 4X64L 1NJIC 1HZBA 5FLXE 1BBXC 1J9OA 1I4HA 1IBLL 4IPHA 1X3EA 2C9OA 3KLSX 1R4QB 2R6GA 1SNOA 1KNAA 3BG3A 1LO5D 5C4XB 3IFDA 2AUKA 1OXSC 3BVZA 3H09A 2EQSA 2K75A 1LM0A 1MI2A 3PO2H 1HZAA 2AMCB 3TREA 2E2JH 1ZXTA 3HKZB 2D0OA 3C1EA 3IKJA 3K5NA 4KHVA 4BY7H 1EEID 5E1FA 4YIJA 1N32L 1X56A 3QG1A 3I55A 4V190 3HOYB 1EQTA 1SLJA 3N52A 4AQYL 3X3MA 3QOJA 1IL2A 3HOZB 4CDDC 3RLNA 3HZXA 2OTJA 5L37A 1JWMD 1W6KA 2UXDL 4DR2Q 4NXML 1O80A 4A93B 1VQNA 1TWCB 1IYUA 3RMHA 1EYCA 4Q0FA 3SHLA 2RDHA 1CA5A 2EYHA 1KDAA 2B8GA 3K5OA 4K0KL 3J81L 4CJ2C 2DY8A 4K5VA 1U9RA 3SK4A 1DM0B 4B3ML 2F0EA 5C3EG 2GVAA 3S1NH 2YTVA 1SFOH 1K8AC 4DNIA 5F2DA 1T5EA 1F2YA 4DUYL 2A69D 1LT6D 3M3YB 1IBMQ 3H0GB 3S15H 2ENBA 5E4XA 1WCMB 3U58A 1AE2A 5D14A 1QB5D 2R3ZA 4A3EH 2XGTA 4BY7G 4CDEC 1SYGA 5J39A 1HA6A 3BU2A 3BZKA 2EJMA 3SEBA 2EZVA 4JI8Q 3TSSA 2JN4A 2NZOA 3VYUA 2HQEA 3D4RA 5GROA 5AJ3Q 3K80C 4C1NK 5E7NA 2FFKB 3VR6A 4XYOA 1PVOA 1PYWD 2CVRA 2UUAQ 1FJGQ 3W5OA 3JAME 3A8KE 4LF7Q 2CW0D 2RHSB 5K36G 1G51A 1EFWA 4X65L 3KF6B 5C3WA 2DNEA 1WTVA 1G91A 1GUNA 1A3UA 3IL8A 1WTQA 4LK1C 4R1JA 2V4DA 4DN4M 1NAPA 3ND8A 1SNQA 1YJ9A 2Q8IB 1LUZA 2VS1A 1PTOF 1Y1VG 1STHA 2WAQE 1KABA 5KYIA 4OONA 3RD4A 3F2DA 4A3EG 3GTOH 1A2UA 1CT1D 1I6HB 4IJLA 3NTKA 1NTGA 4L8JA 3G4SA 4NXNQ 5GQOA 1K9MC 4XT3B 2EYJA 2A6HC 3LGJA 1MHWC 4DFAA 1PH7A 3E0JA 1ICFB 2JA7G 4MZ9A 1B3QA 1UEAB 1C8CA 4GKKL 2Y0SB 4FP5D 5LL6X 4KV6A 1HZ9A 4HCSA 5EPKA 4FDBA 3Q0AA 4NPSA 1V43A 3ICEA 4IFDI 4HEDA 2PCFB 2UXBL 5I2YA 3NSWA 2VQEQ 1C4QA 4HIOA 1LACA 3K0XA 5ELDA 3S1QB 1I50B 1IXRA 4IZ8A 3I4NH 1Q8IA 1F2LA 4AH6A 4RHRA 1SN8A 2F4VL 3NTIA 2F0TA 3FKIG 4BS9A 1JB3A 2QF7A 1HUNA 3E3XA 1NMGA 3NHHA 1SAPA 2GN5A 5FLXc 4N8X1 5C44H 3BDCA 1RL2A 2K1BA 4C3IB 5EBDA 3MWYW 3G7LA 2WFWA 4X66Q 1S40A 4A3FH 4JI4Q 1I4XA 1DOMA 1SDFA 3KBXA 1YNJC 1EYDA 1H9MA 3SGIA 1BCPC 2UU9L 4G7OC 3HG9A 2N3SA 4BY1G 5C5LA 4WJ4A 4JYAQ 3CD6A 1HNWQ 4B08A 3AFPA 3MXNB 3J7A5 1HJPA 5C4HA 5ELNA 4KHPQ 3ULLA 1L1OC 4DV1L 2NVXH 1PH2A 4OO1H 1RKNA 4Z9CB 3CC4A 3AU7A 4FXKC 1KRSA 2I46A 4HMIA 1TU2B 3KJPA 3OYYA 4DNTB 3MHBA 4YCVA 1EZ6A 1ZKOA 1OXUA 4CHTB 5IYCG 1D1IA 3UDFA 2PNRC 4KKSA 1XJVA 3NTHA 1D8LA 2AUJD 3HS0C 1II3A 1ML0D 1AN8A 2B2TC 2F0UA 4OIKA 3D0FA 5FLMH 1WVLA 1Q1BA 2CCZA 1E3PA 1LTGD 4DV2L 4DR3Q 1YIJA 1C0AA 2D2CC 2KBNA 5C44G 3G6JB 3VA7A 1EY6A 2J0TD 1YITA 4R4TA 1CI3M 2AQ2B 2F0MA 2KCMA 4A3CH 1CA6A 1JCKB 4FF4A 2YU9B 1DOLA 3U4VA 3LWEA 1V1OA 3W3AA 4K8IA 2DGYA 1SEBD 2NVQH 1STBA 4JV5L 1U4LA 1D5XC 4CJ0B 5CORA 1YNND 5C3EB 1YEZA 3SE0A 2BA0A 4KJOA 5EQ0A 1IBKL 3QR8A 2E8GA 1K83H 1VQPA 1NCVA 3AEVA 2Z6KA 3TS2A 1GUTA 1XMOQ 3HOXH 2A1AA 3GTJH 4L5QA 1KRTA 1FGUA 3M4QA 3S14H 3RZOH 4BY7B 3P20A 2SNSA 2WACA 3MA2B 1FVIA 5KIXA 1RD9D 4XQNA 3KF8A 2OXPA 4R4IA 4DAPA 1LTRD 1YI2A 2NVTB 1TT2A 1VQIA 4HIKA 1EY8A 1JE4A 3JAMc 1PH6A 1S5FD 4K14A 5EKLA 2VUMH 3V96A 3JAMi 4A3MH 1J8IA 5KEEA 3ITPA 3G6EA 3M85A 2RHQB 4R9WA 1QVCA 3A7LA 4A3LH 4QCLA 4DAMA 1IW7C 1EY9A 1XTDA 2ZJQA 4PMWA 2PI2E 4EGVA 4ALPA 1FD7D 3F8TA 3CC7A 2LY7A 2QEXA 4DAVA 3NK9A 1TWHH 3PO3H 1JQYD 1A15A 1PFNA 4DR5L 2Z4IA 1PMRA 4HJ5A 1D7QA 2F3VA 3NWSA 5IP9G 2ZJPA 3T1YQ 2F4IA 1QNUA 1JWSD 3CRKC 1MKHA 3S17H 1SJED 4LMQD 4AIMA 1B4OA 3HEJA 4RKLA 3BS1A 2F03A 2QW7A 4M8AA 4UHVA 4A3EB 1HR0Q 4IUUA 2L1BA 4OX9Q 2PQEA 2B2YA 2JYOA 5M3FH 4EVOA 4A75A 5CR3A 1EQVA 2F0SA 2RSNA 1PA6A 1XMQQ 1K8GA 2XIWA 3J80E 1BF4A 5LHY1 3I90A 3KDFA 2IX0A 1K3BC 3ZYYX 4DR4L 4H7BA 4A3MG 4GLVB 2JA7B 2F0IA 2L11A 2C5CA 1TS2A 4YWLA 5BN5A 4OELB 3K7AH 3A56A 3GDEA 4A3KH 4JBMA 4JI2L 2D9UA 3FDTA 1EY5A 3TP8A 4J6HA 5BR8Q 1SBBB 1KL9A 2K50A 4Y52H 1Y14B 3PO3G 1PV4A 2ASBA 5CV5A 4QUCA 1EY4A 1EIGA 3KF8B 1G6ZA 4PQXA 3W2DA 4QGUA 2ZJRA 3I72A 4RGMA 1WJJA 1GUGA 4CBVA 3MEHA 1B2TA 2ZM6L 2K14A 3FKIB 3T4AC 4R8IA 2O5JC 4J1MA 3TN2A 3D6CA 2BDNA 4JK1C 3NQIA 5CMDA 1JC7A 3F2CA 1JJGA 5M3FG 3S16H 5IWAL 4A3DG 3FEWX 3L2PA 2KCNA 3FVQA 3I91A 5FJ8H 1JT8A 2RKSA 4A3IH 1CQVA 1O7LA 2H4OA 1HNXQ 1VS0A 1IZ6A 3C46A 2EIFA 2EE1A 5LMNL 1F9PA 4PZ6A 2JJQA 3DHQA 4FXGC 3H15A 1PRTD 1MIUA 5IGGA 3KYHC 3PCOB 4OGQC 4YHHQ 2N55A 5IGFA 2DY7A 4A3BH 3CQZB 1VQFA 2HHHL 2WB1G 3A54A 2KOLA 3CW2C 1I6VC 1PZID 3I4NB 2M00A 3U9OA 1JB7A 2B2UA 2BE5C 5CYUA 4HR7B 1V9PA 4JI6L 4WJWA 1VQCA 2XRQD 3VYRA 2PW5A 4HMJA 1WTPA 4JI7L 3K8AA 1VQGA 4E6IA 5A2QE 3HGBA 1SYBA 5C44B 3DWAA 2JSOA 1CHQD 1SYFA 3BJUA 1X32A 1J5EQ 4X3SA 2XTIA 3DWPA 4LF5Q 4QQBX 1PLFA 5ISRA 3VR4A 4DV7L 4HJ7A 1KD1C 3QWNA 4A3IG 1TY0A 2UUBL 1K3RA 3KLSA 3K5MA 4ODGA 4F8MA 1S5CD 5C0XG 4QIWB 5EAYA 1H95A 2DUDA 1JOKA 2AKWB 3MTSA 3HOWG 3MXPA 2B2VA 1XX8A 3EA6A 4KI0A 5FO9B 1I94Q 3GTLH 1NBWA 2HDMA 1VQMA 2F3IA 1BUVT 5CV4A 1AW7A 1XYIA 2K28A 4BBRH 4LF6Q 3STBC 4B3TQ 3H3VC 4R4QA 1PTOH 4GN4B 2ICEC 2RSOA 4FVMA 2RCFA 3K7UC 5K5PA 5EJWA 4LFCQ 1SMYC 2EY1A 3G48A 3W1GA 4ULLA 3IAYA 4NDXA 2B3GA 2QEJC 1MJCA 2F1MA 4F7XA 4C3HH 1S3OA 1A6XA 2NVQB 1T9HA 4P2CB 2L4NA 1BNZA 2AWNA 4JI0Q 4BBSG 3QB3A 3UE1A 2PYKA 1K83B 1FNWA 2K03A 5KNBA 4DV3L 1NUCA 3A7AB 4M1UB 1TWAH 1E1OA 5M9OA 4DV5Q 3HOXB 5JJZA 1O78A 2NVYH 2VXWA 4RGNA 1JOOA 3TEHB 4GOPB 3C3LA 4JOIA 1FNVA 3N6RA 4DUZL 3J80c 4JI1L 4A3JG 2EYOA 2JXMB 3R3OA 1WYDA 4DF7A 3I4LA 4GNXC 3J80i 1LT3D 4LFBL 2R93H 5T1GA 2SOBA 5IT9L 1KQSA 3PUXA 4CKCA 4I7AA 4LF9L
chains in the Genus database with same CATH topology
1DZ1A 2NUCA 1PTOC 1OO9B 4A3MB 2F0FA 2TSSA 3DEOA 5EPLA 5BN4A 4XQQA 3KLRA 3A8IE 2F0HA 1HA5A 1HTPA 4DXGA 2KVMA 5I6WA 4ABNA 1GOZA 3PO3B 4Q5VA 1LLRD 2ZXPA 3BDLA 3EQLC 1F77A 4U673 4ZKBB 1SXTA 1NSNS 1TS4A 4ZYSA 1SE4A 4ZK9B 5JEAG 3EVQA 1VDZA 1LTID 5I4DA 3GV6A 4PMCA 3K59A 5M3FB 2KA7A 2L55A 4A3DB 5JOBA 2D5DA 3PUWA 1JR0D 1D5MC 5CBEE 4IURA 4HSPA 3BYTB 5J1ZA 3WDNA 4K8JA 3I70A 4BA1I 2KHSA 3NUCA 5G3LF 2WB1B 3K0YA 3T51B 4ZUJA 1PFMA 3TDQA 4OL7A 2F0KA 1QNKA 4KD4A 5C6AA 4KY6A 3I3CA 4K5XA 2K5WA 4K2LA 1AP0A 1EL0A 4HCEA 4DK0A 2A6HD 5CV7A 3ND9A 1TQOA 4A3IB 2K5QA 4IUQA 1QWYA 1WTRA 1E2ZA 4NP5A 4K2KA 5I2XA 4FF2A 1SYDA 3H94A 1ENAA 1PRTB 2TMPA 3HOWB 1CQFA 1CZGA 3CHBD 2I07B 3BZDB 5D3DA 3LWUA 1OXTA 3L3OC 2VNUD 4IUPA 2K6AA 3SK8A 3KK7A 2OEOA 4K5WA 4DK1A 3HP3A 2IX1A 2NBFA 1YNJD 3U9SA 1BCPD 3NQTA 1A3VA 2N88A 5ELCA 1G2SA 1PXUA 3HRZC 4ZAIA 4BBSB 2XSCA 1AZQA 1STNA 2F0OA 5IGBA 2KCCA 2PO4A 1GUWA 2J4XA 2B8FA 1I4GA 3GTLB 5DM63 4DNRB 3K58A 4A3JB 2BOSA 3Q6SA 1Z7TA 1K8OA 1EZ8A 2ZXRA 1ESRA 1V8QA 2NN6H 2O5IC 4TQUS 3GTKB 1VMCA 3SK5A 5FLXL 4UDUC 1M8AA 2CHBD 1ILPA 2E76C 3VYTA 2EYLA 3LNNA 2XN9C 1XXGA 1F9RA 3QIAA 4Y7NB 1TWAB 3Q22A 5FO8B 2NVYB 5M3MB 2PMZB 3D31A 3H91A 1LTAD 4KKTA 1IHZA 4KMUC 4ZQ3A 3S9WA 4KK7A 1O7ZA 2B2WC 2JA6B 4XYQA 4ZRZA 3OMCA 2QCPX 4IFDJ 2RQXA 1S4ZA 3EFXD 1EWCA 3TBIB 1TWGB 1F2MA 3TMEA 2X6GA 1IW7D 2X6LA 1ICWA 1BO0A 2NTTA 1LTSD 2BA1A 2WV6D 4S3SA 1HFGA 4OO1G 2JP1A 2QKIC 4EQOA 2ZT9C 4F87A 3L7ZC 2KEEA 3M4OB 4TSSA 3PO2B 4AYBB 4FXDA 5C4JB 5E4WC 2AQ1B 2WINB 2E2JB 4B9XA 1TIID 4RGOS 1SE2A 3PUVA 4HN7A 2O2LD 2IJ0A 2A68C 3T53B 3OPOA 1SYCA 2VB3X 5FOBB 4C56C 1H9KA 5IOCA 1B3AA 1DONA 3NWTA 2JE6I 2KUMA 2A6EC 5DNFA 4KY5A 4QF4A 3HOUB 3S1NB 5HGTA 1SFOB 4QUFA 4RGTA 3SK6A 4RKBA 1UNSA 4DU9A 2GA4B 3S15B 1BXTA 5EKKA 5JVH3 4I7ZC 1QILA 3C2PA 4FNFA 2B2TA 1UUPA 1TS3A 2Z1CA 2EDGA 3MXGA 3R8BA 2A74C 3NE5B 3OMGA 1SNPA 5J22A 2NB0A 2Q8TA 3NBHA 1SNMA 4K6LA 5IT9E 1I4PA 4KN4C 2IX3A 2WP8J 1NR2A 1VF7A 2EJGC 3A55A 5M5WB 1GXDC 3GV3A 5C0XI 1BDOA 1G8ZD 3GTOB 1BCPB 2PZWA 2BCOA 2YYZA 2FMMA 2L12A 3QOLA 4LAAA 2SNMA 1D6EC 2NTSA 1Y8NB 3GQBA 1MBYA 1WTOA 1F2ZA 1ILQA 5G3LD 3I8ZA 3PMFA 4K6DA 3PIP3 1IKLA 1OXVA 3J7AV 5CV9A 3WOEA 2RBMA 1TVXA 1B44D 1UAPA 1ET9A 1SMYD 1A2TA 3BYYB 3E6ZX 2K5DA 4RCOA 1S5ED 3DUZA 1ONLA 3TP7A 1Q1EA 4X3UA 3J81E 4A3FB 5CBAE 4O42A 1BOSA 2DNCA 4KJNA 5C0XJ 1AFPA 1ZYRD 3PUZA 2NVXB 4G7ZC 1E2WA 4X3KA 4MIUA 2K04A 4H0LC 2B39A 5CC4A 1EIHA 2Z4HA 4CGYB 3MZ5A 3M4YA 3T13A 1Q3LA 4XT1B 2WKCA 3KUPA 1Z6HA 2F0JA 2Z8LA 1IL8A 4J8QA 4X3TA 4CJ1B 3S2DB 1PTOD 4UAIA 1KNEA 3PIO3 2LKVA 4N9TA 5IGCA 4XTCS 1RTNA 3ERQA 5EPJA 3I73A 3P75A 1O7YA 3BVMA 1FGBD 5I9OA 5FKAC 1QG7A 3IFTA 4C2MB 1ET6A 4RWSC 4H44C 4I65A 3V05A 5M5YB 2KEDA 1KTKA 3BVGA 3WOFA 1B50A 3GTJB 1B9NA 3C1FA 3S14B 5JPMC 3D4WA 3RZOB 2EYPA 3V2TA 3AB9A 2PPBC 2HUGA 4ZLTF 2VUMB 1G291 1AZPA 1JORA 4KHZA 2RDGA 1RF2D 2XNAC 3D8GA 4RAUC 4C3HG 1B9MA 1EEFD 4F88A 4NMZA 1CTMA 2MPMA 2PW7A 3LX0A 1ZEQX 1TWHB 2A5HA 2LMCB 3NP8A 2H1EA 2CQAA 1R9TB 1I3QB 1PFBA 1QE6A 2XWBB 4QB4A 3S17B 5JEAJ 1EY0A 4WORA 1RCVD 5C5MA 5DAUA 2IPKD 5EGTA 3VYSA 1E2VA 1MD2D 4HAEA 1AEXA 2FMCA 1TKWB 5FO7B 1LT4D 3K7AB 2M9VA 1HHVA 2K32A 1QOHA 4R8NA 4A3KB 2Q8RE 3E5SA 2MJ8A 5C3XA 3OHXC 3GO5A 2VB2X 1KLGD 1DD2A 5A2QL 1E0BA 2NZ1D 1DCZA 1RODA 4L63B 2RA4A 5K36H 1PRTF 1HRJA 3S16B 1X3QA 1DYQA 2WAQB 5BN3A 3R2IA 1HQRD 3GP7A 2EOTA 2XRSD 1Y69U 3DWQA 2RDFA 3MVVA 2FINB 5ELEA 3VA5A 2MHVA 3FPPA 3OWFA 5IGDA 1GHJA 4ME5A 1GUSA 2ICIA 4RCNA 5ELFA 1Q12A 3D6WA 1VCIA 4KN7C 1CZWA 1IYVA 4BA2I 3GD7A 2R7ZB 4A3BB 2PZUA 3MXUA 1EU4A 3GTMB 1SNCA 2F0DA 3RLFA 5COYA 4IN3A 1KDCA 1NR4A 1Q90A 1K8MA 3K5LA 2KJXA 1T5XD 5IGEA 4FF1A 3M7NA 1H9SA 3MXNA 5D65A 3NPPA 3F2UA 5I6YA 2E74C 2AQ3B 5LL6S 1SYEA 2OT2A 2A69C 1HXYD 4KY7A 2EY2A 3R2TA 1LT5D 1F9SA 2NN6I 4KTAA 1SSOA 5CV6A 2R92B 1PZJD 3UI2A 4CKBA 1U4RA 2J7ZA 4BBRB 1OXXK 2NWGA 4DA2A 1RDPD 1PTOB 1L0YB 3EROA 3T16A 4EQNA 2F0GA 5DEHA 4OO1I 3KBGA 4U68A 3DMUA 1D1KA 2CW0C 1M4VA 4NKLA 3ONAB 4C3HB 2F0PA 5NUCA 2HCCA 2F0QA 1LTTD 4KKUA 4IFDH 3R93A 4WRDA 3T56B 2JA5B 2SEBD 3Q24A 1H9SB 1MSGA 1QCBD 4FO2A 2R93B 4GZYC 2RVLA 2A68D 3L9AX 1I4RA 3HOVB 3DEPA 2KQ3A 1HPCA 4PV1C 3QJYA 3GTGB 2NN6G 1ENFA 1EOTA 2L9HA 2A6ED 3TZDA 1DXMA 4XQJA 1GHKA 1QJOA 2E2HB 2SDFA 4BWGB 3S1RB 2G9DA 1GUOA 1VMPA 2B2YC 5M5XB 3OW7A 2F0NA 2M2LA 4IFDG 3Q23A 5KRUA 5TSSA 1CK1A 4PMBA 3VR3A 3FPUB 2K33A 1F9QA 4XDXA 2MUYA 1D2BA 2E2DC 4C3JG 3NXWA 1STEA 1TR5A 2EYFA 4V0BA 1RHPA 3RZDB 3DM1A 4QMGA 1TS5A 2IL8A 1EY7A 5DM73 4KD3A 5E3FA 5KNCA 1U4MA 4FYDA 1PZKD 2E75C 2JA8B 1U4PA 5IODA 4JBWA 3JAML 4G4KA 4EQPA 4C1NI 5EKIA 3NBIA 4CKEA 3MAQA 1Y8OB 2XVSA 1G2TA 1RJTA 3H6MA 1GJXA 2EYMA 2AWOA 1XWEA 4IUVA 1KLUD 2IT1A 1HUMA 2NYZD 2B2WA 2EVBA 3EJIA 2IWHA 3X3NA 3D3RA 5I9PA 3OIQA 1YNNC 1B1ZA 3D4DA 2G9HD 4RA8A 1C48A 2QDBA 2B2UC 4O1NA 2XWJB 2FHTA 1W6JA 1Y1VB 5FK9C 1MGSA 2PZTA 5EBCA 1ESFA 2F0LA 2X69A 2KECA 1BR9A 3BDOA 1BCPF 4RHSA 3URYA 1D5ZC 2JEAI 5T1IA 4TRDA 2F0VA 1I4QA 4XIGS 2EPBA 2BE5D 2R61A 3SR1A 1WTWA 2MGSA 4LJZC 3AMUA 5KNDA 4XXEA 2BDOA 4HTHA 1EWHA 2K05A 4G57A 2D62A 2B2VC 2F3WA 4ZKCB 3K57A 2EJFC 5JAVA 1XTCD 3MFYA 3I4MB 2EXZA 4OIJA 4DAYA 2A73B 1JWUD 1MSHA 3OSOA 3CKIB 1EFID 1TWFB 5CGKA 1DJRD 4HSVA 3VR2A 1Z47A 4G7HC 2L5TA 2HCIA 3J7YW 2ZXOA 3TP6A 1TY2A 3FRPB 1A3TA 4PNYA 1WD0A 2DN8A 1ENCA 4BY1B 2F0WA 1B53A 1HCZA 1LTBD 1R4PB 3DXJC 1V1PA 5C0XH 5IIFA 1S5BD 2WKDA 1L0XB 4WFN3 1WTXA 2B63B 2LFNA 3P1HA 1PDQA 4IUTA 3SXHA 5CV8A 1RTOA 2FJ2A 4ZUIA 1WD1A 4DXFA 1H9JA 3SDZA 1IKMA 5AFWA 2IW3A 1EYAA 3FMCA 4C3JB 2EY5A 1FR3A 3A8JE 4IUNA 1HFNA 1H9RA 2HDLA 1KAAA 4RFBA 1SNDA 4MN3A 5JVG3 3GTPB 1Y8PB 5A35A 1Y1WB 1BQQT 2JEBI 4A3GB 3P7JA 1LV9A 3TP5A 5JPNC 1FNUA 1PRTC 1HQMC 1X3PA 4H13C 5C4ZA 3OIPA 3TZUA 4ILWA 4IALA 1CHPD 1CFMA 4L6TB 4NW2A 2K01A 1V1PB 1JICA 1EU3A 1SJHD 1DOKA 3K6OA 3OOCA 2E2IB 4DGZA 3O13A 2K7VA 1STYA 2QILA 4FF3A 1KDBA 1STGA 2MP1A 1HTLD 1SE3A 2WIIB 3J80L 4ID6A 3PUYA 5ELBA 3J7AF 1ZYRC 3MC0B 3SVMA 1JOQA 3GTQB 2L0CA 4MHEA 1VF5C 3CRLC 2EY6A 1LABA 5D3IB 5JEAH 4TKOB 4RH6A 2LS01 2ID0A 1STAA 3S2HB 3M7GA 3S1MB 4OHJA 3CU7A 4IQZA 2O4XA 3VR5A 1CM9A 5HURA 4N9PA 4C3IG 4B9WA 3MFGA 2OF1A 5KYLA 1S5DD 3OWEB 5KGUA 3PV0A 3QO2A 1FYCA 3RUZA 5FLXE 1BBXC 1J9OA 1I4HA 2C9OA 3KLSX 1R4QB 2R6GA 1SNOA 1KNAA 3BG3A 1LO5D 5C4XB 3IFDA 2AUKA 1OXSC 3BVZA 3H09A 1MI2A 1ZXTA 3HKZB 3C1EA 3IKJA 3K5NA 4KHVA 1EEID 5E1FA 4YIJA 3QG1A 4V190 3HOYB 1EQTA 3N52A 3X3MA 3QOJA 3HOZB 3HZXA 1JWMD 1W6KA 1O80A 4A93B 1TWCB 1IYUA 3RMHA 1EYCA 4Q0FA 3SHLA 2RDHA 1CA5A 2EYHA 1KDAA 2B8GA 3K5OA 3J81L 4CJ2C 2DY8A 4K5VA 1U9RA 3SK4A 1DM0B 2F0EA 5F2DA 1T5EA 1F2YA 2A69D 1LT6D 3M3YB 3H0GB 2ENBA 5E4XA 1WCMB 5D14A 1QB5D 2R3ZA 1SYGA 5J39A 1HA6A 2EJMA 3SEBA 2EZVA 3TSSA 3VYUA 2HQEA 3D4RA 4C1NK 2FFKB 3VR6A 4XYOA 1PYWD 2CVRA 3JAME 3A8KE 2CW0D 5K36G 5C3WA 2DNEA 1WTVA 1G91A 1GUNA 1A3UA 3IL8A 1WTQA 4LK1C 2V4DA 4DN4M 1NAPA 3ND8A 1SNQA 2Q8IB 1PTOF 1STHA 1KABA 5KYIA 3RD4A 1A2UA 1CT1D 1I6HB 3NTKA 4L8JA 4XT3B 2EYJA 2A6HC 4DFAA 3E0JA 1UEAB 1C8CA 2Y0SB 4FP5D 5LL6X 4KV6A 4HCSA 5EPKA 3Q0AA 1V43A 4IFDI 4HEDA 2PCFB 5I2YA 3NSWA 1C4QA 1LACA 5ELDA 3S1QB 1I50B 4IZ8A 1Q8IA 1F2LA 4RHRA 3NTIA 2F0TA 4BS9A 1JB3A 2QF7A 1HUNA 3NHHA 1SAPA 3BDCA 2K1BA 4C3IB 5EBDA 3MWYW 3G7LA 1I4XA 1DOMA 1SDFA 1YNJC 3KBXA 1EYDA 1H9MA 1BCPC 4G7OC 3HG9A 5C5LA 4B08A 5C4HA 4OO1H 1RKNA 4Z9CB 3AU7A 4FXKC 2I46A 4HMIA 1TU2B 4DNTB 3MHBA 1EZ6A 1ZKOA 1OXUA 4CHTB 1D1IA 2PNRC 4KKSA 3NTHA 2AUJD 3HS0C 1II3A 1ML0D 1AN8A 2B2TC 2F0UA 4OIKA 1WVLA 1Q1BA 1LTGD 2D2CC 3G6JB 3VA7A 1EY6A 2J0TD 1CI3M 2AQ2B 2F0MA 1CA6A 1JCKB 4FF4A 2YU9B 1DOLA 3LWEA 1V1OA 3W3AA 4K8IA 1SEBD 1STBA 1U4LA 1D5XC 4CJ0B 5CORA 1YNND 5C3EB 3SE0A 2BA0A 4KJOA 5EQ0A 1NCVA 1GUTA 4BY7B 3P20A 2SNSA 2WACA 3MA2B 5KIXA 1RD9D 4XQNA 3KF8A 2OXPA 4DAPA 1LTRD 2NVTB 1TT2A 1EY8A 1JE4A 1S5FD 4K14A 5EKLA 3V96A 1J8IA 5KEEA 3ITPA 3M85A 4R9WA 3A7LA 4QCLA 1IW7C 1EY9A 4PMWA 4EGVA 1FD7D 2LY7A 4DAVA 3NK9A 1JQYD 1A15A 1PFNA 2Z4IA 1PMRA 2F3VA 3NWSA 2F4IA 1QNUA 1JWSD 3CRKC 1SJED 4LMQD 1B4OA 3HEJA 4RKLA 3BS1A 2F03A 4M8AA 4A3EB 4IUUA 2L1BA 2PQEA 2B2YA 2JYOA 4EVOA 5CR3A 1EQVA 2F0SA 2RSNA 2XIWA 3J80E 1BF4A 5LHY1 3I90A 2IX0A 3ZYYX 4H7BA 2JA7B 2F0IA 2L11A 2C5CA 1TS2A 5BN5A 3A56A 2D9UA 3FDTA 1EY5A 3TP8A 4J6HA 1SBBB 5CV5A 4QUCA 1EY4A 1EIGA 1G6ZA 4PQXA 3W2DA 3I72A 4RGMA 1GUGA 4CBVA 3MEHA 1B2TA 3FKIB 3T4AC 4R8IA 2O5JC 4J1MA 3TN2A 3D6CA 2BDNA 4JK1C 3NQIA 5CMDA 1JC7A 3FEWX 2KCNA 3FVQA 3I91A 2RKSA 1CQVA 1O7LA 2H4OA 3C46A 2EE1A 1F9PA 3DHQA 4FXGC 1PRTD 5IGGA 4OGQC 2N55A 5IGFA 2DY7A 3CQZB 3A54A 2KOLA 1I6VC 1PZID 3I4NB 2M00A 3U9OA 2B2UA 2BE5C 5CYUA 4HR7B 4WJWA 3VYRA 2XRQD 1WTPA 2PW5A 4HMJA 4E6IA 5A2QE 3HGBA 1SYBA 5C44B 3DWAA 2JSOA 1CHQD 1SYFA 1X32A 4X3SA 3DWPA 1PLFA 5ISRA 3VR4A 3QWNA 1TY0A 3KLSA 3K5MA 4ODGA 4F8MA 1S5CD 5C0XG 4QIWB 1JOKA 3MTSA 3MXPA 2B2VA 1XX8A 3EA6A 4KI0A 5FO9B 2HDMA 1BUVT 5CV4A 1AW7A 1XYIA 2K28A 3H3VC 1PTOH 2ICEC 2RSOA 4FVMA 5K5PA 5EJWA 1SMYC 2EY1A 4ULLA 3IAYA 4NDXA 2QEJC 2F1MA 4F7XA 1A6XA 2NVQB 4P2CB 2L4NA 1BNZA 2AWNA 3QB3A 2PYKA 1K83B 1FNWA 2K03A 5KNBA 1NUCA 3A7AB 4M1UB 5M9OA 3HOXB 5JJZA 1O78A 2VXWA 4RGNA 1JOOA 3C3LA 1FNVA 3N6RA 2EYOA 2JXMB 3R3OA 4DF7A 3I4LA 1LT3D 5T1GA 2SOBA 5IT9L 3PUXA 4CKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOS A;  4M1U B;  1D1I A;  4ULL A;  2XSC A;  1QOH A;  3MXG A;  1BOS A;  4P2C B;  2GA4 B;  1QNU A;  1R4P B;  1CZW A;  1C48 A;  1CQF A;  1D1K A;  1CZG A;  1DM0 B;  1R4Q B;  2C5C A;  1C4Q A; 
#chains in the Genus database with same CATH topology
 1HZC A;  1DZ1 A;  1BBW A;  2NUC A;  4DK6 C;  4JI5 Q;  1EUJ A;  1M90 C;  3GTG H;  1PTO C;  1OO9 B;  4DR7 L;  4A3M B;  1C9O A;  2F0F A;  2TSS A;  3DEO A;  2BH8 A;  3M9B A;  5EPL A;  5BN4 A;  2E2H H;  4XQQ A;  3KLR A;  3K81 C;  3A8I E;  3S1R H;  1ASZ A;  1CSQ A;  2F0H A;  4LF4 L;  1HA5 A;  1HTP A;  4DXG A;  2KVM A;  5I6W A;  5IYD H;  1VQ9 A;  4ABN A;  1GOZ A;  3PO3 B;  4Q5V A;  1LLR D;  2ZXP A;  2L15 A;  3BDL A;  3CCQ A;  2HQL A;  3EQL C;  1F77 A;  2K52 A;  4U67 3;  4ZKB B;  1SXT A;  1NSN S;  5M3M G;  1TS4 A;  4ZYS A;  3M4O H;  2A8V A;  1SE4 A;  2Q2H A;  4LNQ A;  4ZK9 B;  1ASY A;  5JEA G;  3EVQ A;  5C4J H;  1VDZ A;  1LTI D;  3RZD H;  5I4D A;  1VQ5 A;  3GV6 A;  4PMC A;  3K59 A;  3PQI A;  4DV6 L;  5M3F B;  3I2Z A;  3TS0 A;  1GM5 A;  2JA6 G;  2QGQ A;  2KA7 A;  3T1H Q;  2L55 A;  4CDC C;  4A3D B;  4DPG A;  4DR6 L;  5JOB A;  3UDG A;  2D5D A;  3PUW A;  3WWV A;  1JR0 D;  1D5M C;  5CBE E;  4IUR A;  1EIF A;  4HSP A;  2V1C C;  4QJF A;  2JA8 H;  3BYT B;  5J1Z A;  3WDN A;  3CCL A;  1KHI A;  3AYH B;  2C35 B;  4K8J A;  4DV4 L;  4LF8 Q;  3I70 A;  4BA1 I;  2KHS A;  3NUC A;  3HOU H;  5G3L F;  1X65 A;  1OTC A;  1A62 A;  2I5H A;  2HIV A;  2WB1 B;  3K0Y A;  1K73 C;  3ER0 A;  3KFU A;  3T51 B;  3M4P A;  1QUQ A;  4ZUJ A;  4EX5 A;  1PFM A;  3TDQ A;  1DGS A;  3PO2 G;  4AYB G;  4OL7 A;  3J81 i;  2F0K A;  1QNK A;  4KD4 A;  4RMF A;  5C6A A;  4KY6 A;  3I3C A;  4K5X A;  2K5W A;  4K2L A;  1AP0 A;  4JI3 L;  4HCE A;  4DK0 A;  1EL0 A;  2A6H D;  5CV7 A;  4P74 A;  3ND9 A;  3E0E A;  4JC0 A;  1C7Y A;  1TQO A;  5LMN W;  3ZJY C;  4A3I B;  2K5Q A;  4N8F A;  3HKZ E;  1QWY A;  4IUQ A;  1WTR A;  4X64 Q;  1E2Z A;  1L0W A;  4NP5 A;  4K2K A;  1UWV A;  5I2X A;  4FF2 A;  1SYD A;  3H94 A;  1IBL Q;  1ENA A;  1PRT B;  3CME A;  2TMP A;  4YCW A;  3HOW B;  3HOU G;  1CQF A;  1CZG A;  4LFA Q;  3CHB D;  2QA4 A;  5GAD C;  2I07 B;  3BZD B;  5D3D A;  3LWU A;  1OXT A;  3L3O C;  5M5W H;  2VNU D;  4IUP A;  2K6A A;  3SK8 A;  3KK7 A;  2OEO A;  4K5W A;  4DK1 A;  3HP3 A;  1N32 Q;  2IX1 A;  2NBF A;  1YNJ D;  3U9S A;  4AQY Q;  1BCP D;  3NQT A;  2I5M X;  4X6A H;  1A3V A;  2N88 A;  4HIM A;  5ELC A;  1G2S A;  1PXU A;  4JBJ A;  2UXD Q;  4NXM Q;  3I7F A;  3HRZ C;  4ZAI A;  4BBS B;  2XSC A;  1AZQ A;  1TWF H;  4K0K Q;  2B29 A;  1STN A;  1QUQ B;  2F0O A;  5IGB A;  4B3M Q;  3E9H A;  3RN5 A;  2KCC A;  2PO4 A;  2KCT A;  1GUW A;  1EIY B;  1CUK A;  2J4X A;  1PFS A;  2UUC L;  4DUY Q;  2B8F A;  1I4G A;  4ZCK A;  1N36 L;  3GTL B;  5DM6 3;  4DNR B;  3K58 A;  4A3J B;  2BOS A;  1WI5 A;  3Q6S A;  1Z7T A;  3NEM A;  1K8O A;  1EZ8 A;  2ZXR A;  4UY8 C;  1CKO A;  2B63 H;  2ES2 A;  1XNR L;  1ESR A;  1V8Q A;  2NN6 H;  1A63 A;  2AHO B;  1SR3 A;  2O5I C;  4TQU S;  3GTK B;  4KLK A;  1VMC A;  3SK5 A;  3CCS A;  5FLX L;  4UDU C;  1M8A A;  2CHB D;  1ILP A;  2E76 C;  3VYT A;  3A74 A;  4L5S A;  1KAW A;  4GKJ L;  2EYL A;  3LNN A;  2XN9 C;  1XXG A;  1F9R A;  3QIA A;  4X65 Q;  4Y7N B;  4DK3 C;  4R4C A;  1TWA B;  3Q22 A;  5FO8 B;  2NVY B;  2E5L L;  5M3M B;  2PMZ B;  4LUV A;  3D31 A;  3H91 A;  1LTA D;  4LUZ A;  1IYJ B;  4B3S L;  4KKT A;  1VQJ A;  1IHZ A;  3IRB A;  4KMU C;  3CCR A;  5LMU L;  4YWK A;  4ZQ3 A;  3S9W A;  2Y0S E;  4KK7 A;  1O7Z A;  4L5T A;  3B6Y A;  2B2W C;  3I4N G;  2JA6 B;  4XYQ A;  4ZRZ A;  3OMC A;  3GTP H;  2QCP X;  3S2D H;  3MEF A;  1UE7 A;  4IFD J;  2RQX A;  1S4Z A;  3EFX D;  1B70 B;  1EWC A;  2QDL A;  3TBI B;  1TWG B;  1F2M A;  3TME A;  2X6G A;  1IW7 D;  2X6L A;  1ICW A;  4A3F G;  1BO0 A;  2H5X A;  1XNQ L;  3UDI A;  1BBU A;  2NTT A;  1LTS D;  4GKK Q;  2BA1 A;  2K5N A;  2WV6 D;  4S3S A;  1X6O A;  1HFG A;  1JMC A;  4OO1 G;  2JP1 A;  2QKI C;  3CF5 A;  4C2M H;  1EQQ A;  4EQO A;  2UXB Q;  2ZT9 C;  4F87 A;  1XMQ L;  5M5Y H;  3L7Z C;  2KEE A;  3M4O B;  4TSS A;  2E2I H;  3PO2 B;  4AYB B;  3OW2 A;  4FXD A;  5C4J B;  5E4W C;  2AQ1 B;  2WIN B;  2E2J B;  4B9X A;  5HY6 A;  5JJI A;  1TII D;  4RGO S;  1VQL A;  2F4V Q;  2OCE A;  1SE2 A;  2HD3 A;  2VY3 A;  3PUV A;  1U5K A;  1GO3 E;  4HN7 A;  2O2L D;  2IJ0 A;  5FLM G;  2IY5 B;  2A68 C;  3KLW A;  3T53 B;  3OPO A;  1SYC A;  2VB3 X;  5FOB B;  4C56 C;  1X3F A;  1H9K A;  3W1B A;  5IOC A;  1B3A A;  1HNZ L;  3A5U A;  2UU9 Q;  4BXX H;  1DON A;  3NWT A;  2JE6 I;  4J15 A;  4A3C G;  4QL5 A;  2KUM A;  1EWI A;  2A6E C;  5DNF A;  1I5F A;  4KY5 A;  4IJH A;  1N9W A;  4QF4 A;  4DV1 Q;  3HOU B;  5IYB H;  1UE5 A;  3E9I A;  1W3S A;  1XPR A;  2Q2T A;  1L1O A;  3S2H H;  2R7F A;  3S1N B;  3S1M H;  5HGT A;  1SE8 A;  1SFO B;  4QUF A;  4RGT A;  3SK6 A;  4RKB A;  1UNS A;  4DU9 A;  2GA4 B;  1R9T H;  3S15 B;  2UXC L;  1BXT A;  3CPF A;  3HOX G;  1I3Q H;  5EKK A;  1G6P A;  5JVH 3;  4I7Z C;  4APV A;  1QIL A;  2VQF L;  4X62 L;  4DV2 Q;  4FNF A;  2B2T A;  3C2P A;  1UUP A;  4A76 A;  1VQ8 A;  2F52 A;  1TS3 A;  5C4X H;  4B3R L;  2Z1C A;  4HID A;  2EDG A;  2KHI A;  3MXG A;  3R8B A;  2A74 C;  2VUM G;  3NE5 B;  3OMG A;  1SNP A;  5J22 A;  2NB0 A;  5GAG C;  2Q8T A;  4JV5 Q;  4A3L G;  3NBH A;  1SNM A;  1FL0 A;  1IBK Q;  4K6L A;  2I5L X;  5IT9 E;  3HOY H;  1I4P A;  4JVZ A;  4KN4 C;  2IX3 A;  2WP8 J;  1Q7Y C;  1NR2 A;  1VF7 A;  2EJG C;  3A55 A;  5M5W B;  1GXD C;  4A93 H;  1TWC H;  3GV3 A;  1YHA A;  5C0X I;  3RR5 A;  1WFQ A;  1BDO A;  1G8Z D;  3GTO B;  1BCP B;  2DJF C;  2PZW A;  3VDY A;  3A0J A;  2BCO A;  2YYZ A;  2FMM A;  2L12 A;  1GVP A;  1L1O B;  3M3Y H;  3QOL A;  4LAA A;  3FHW A;  3H0G H;  2SNM A;  1D6E C;  2NTS A;  1Y8N B;  3GQB A;  1MBY A;  1WTO A;  3CC2 A;  1F2Z A;  1ILQ A;  1VQA A;  5G3L D;  3I8Z A;  3PMF A;  4A3K G;  4K6D A;  3PIP 3;  1IKL A;  4DR5 Q;  4RG1 A;  1OXV A;  4O0A A;  3J7A V;  5CV9 A;  1NNX A;  4R4O A;  1N33 L;  2R7Z H;  1QVG A;  3WOE A;  4YY3 L;  2RBM A;  3STB D;  1YHB A;  2VZA A;  3GTM H;  1CSP A;  3H3V H;  1TVX A;  3CCJ A;  2BH2 A;  1B44 D;  2OQK A;  1UAP A;  1ET9 A;  1SMY D;  3KDF B;  1A2T A;  3BYY B;  4MTK A;  3E6Z X;  2K5D A;  4RCO A;  4QY7 A;  1S5E D;  5GAE C;  3DUZ A;  1ONL A;  3TP7 A;  1Q1E A;  1KIX A;  4X3U A;  3J81 E;  2WAQ G;  3FP9 A;  4DR4 Q;  4A3F B;  1QZH A;  4IO9 A;  5CBA E;  4JW0 A;  1Q81 C;  4O42 A;  1BOS A;  2DNC A;  4KJN A;  5FJ8 G;  1RIP A;  5C0X J;  1AFP A;  1ZYR D;  3PUZ A;  2NVX B;  4G7Z C;  4JI2 Q;  1E2W A;  4IPC A;  4GLX A;  4X3K A;  4MIU A;  2K04 A;  4H0L C;  4DV0 L;  2B39 A;  5CC4 A;  2R7Z G;  4UP7 A;  2Z4H A;  1EIH A;  4A3B G;  3OTO L;  4CGY B;  1N34 L;  4PZ7 A;  3TQY A;  3MZ5 A;  3M4Y A;  3T13 A;  2R92 H;  1Q3L A;  4XT1 B;  2WKC A;  3KUP A;  2ZM6 Q;  1Z6H A;  2F0J A;  2MO1 A;  2Z8L A;  1IL8 A;  4WJ3 M;  3KJO A;  4J8Q A;  4X3T A;  4CJ1 B;  3S2D B;  2P5Z X;  1PTO D;  4UAI A;  3PF4 A;  1KNE A;  3PIO 3;  2CH4 A;  5IWA Q;  1BVS A;  3AFQ A;  2LKV A;  4N9T A;  5IGC A;  2PNH A;  1A0I A;  4XTC S;  4DKA C;  1RTN A;  3CCM A;  3ERQ A;  4O2D A;  3S1Q H;  5EPJ A;  1A8V A;  3I73 A;  1QZG A;  3P75 A;  5LMN Q;  1O7Y A;  3BVM A;  1FGB D;  5I9O A;  5FKA C;  1QG7 A;  3IFT A;  4C2M B;  4GS3 A;  1ET6 A;  4RWS C;  4H44 C;  4I65 A;  3V05 A;  5M5Y B;  2KED A;  1VQ7 A;  1KTK A;  3BVG A;  3WOF A;  1B50 A;  4IPG A;  3GTJ B;  2JA5 H;  1B9N A;  3C1F A;  3S14 B;  5JPM C;  4DR2 L;  3NEN A;  4JI6 Q;  4QIW E;  3D4W A;  2VL6 A;  1X9N A;  3RZO B;  2K5V A;  1GKH A;  4BBR G;  2ALY B;  2EYP A;  4UP8 A;  3V2T A;  2KHJ A;  4P72 A;  1YNX A;  1Q8K A;  3AB9 A;  1PH4 A;  3HOV H;  2PPB C;  2HUG A;  1TXY A;  4ZLT F;  2VUM B;  4PG3 A;  1G29 1;  3RNU A;  1AZP A;  5IT9 c;  1JOR A;  1IBM L;  3TRZ A;  4DV7 Q;  4KHZ A;  2RDG A;  2UUB Q;  1RF2 D;  3JC6 6;  1X54 A;  2XNA C;  3D8G A;  4RAU C;  4C3H G;  1B9M A;  3UDX A;  1EEF D;  4F88 A;  5JJL A;  4NMZ A;  2DJG C;  1CTM A;  5M5X H;  2MPM A;  2PW7 A;  2PQA A;  1WOC A;  2R7D A;  3LX0 A;  1ZEQ X;  1TWH B;  2A5H A;  2LMC B;  3NP8 A;  2KEN A;  5HGQ A;  4JI8 L;  2H1E A;  2CQA A;  1R9T B;  4H02 A;  1I3Q B;  3CAM A;  1PFB A;  3ERS X;  1QE6 A;  2XWB B;  3UE0 A;  5AJ3 L;  4QB4 A;  3S17 B;  2JA5 G;  5JEA J;  1LYL A;  4NB3 A;  4JG2 A;  1EY0 A;  4WOR A;  1CKN A;  1RCV D;  5ELO A;  3AQQ A;  2ZTC A;  5C5M A;  2UUA L;  1FJG L;  1YJW A;  2R93 G;  1VQD A;  3DLL A;  5C3E H;  3HOV G;  4LF7 L;  5DAU A;  3RLO A;  2CKZ B;  2IPK D;  5EGT A;  4LFA L;  3KOJ A;  3VYS A;  1E2V A;  1MD2 D;  3CMA A;  4HAE A;  1AEX A;  1PH9 A;  2FMC A;  1TKW B;  5FO7 B;  2Q2U A;  3KF6 A;  1LT4 D;  3K7A B;  2M9V A;  1HHV A;  2K32 A;  1QOH A;  4UPA A;  4R8N A;  4A3K B;  2Q8R E;  3E5S A;  4OWX B;  2MJ8 A;  4DV3 Q;  5IYD G;  2RCN A;  5C3X A;  2GVB A;  2NVT H;  3OHX C;  1UE1 A;  4NXN L;  4DUZ Q;  3GO5 A;  4JI1 Q;  2VB2 X;  1KLG D;  4UP9 A;  3PSI A;  1DD2 A;  2YTX A;  3J81 c;  5A2Q L;  2MO0 A;  1E0B A;  2NZ1 D;  1DCZ A;  1ROD A;  1VQH A;  1SRO A;  4L63 B;  4LFB Q;  2RA4 A;  4GNX A;  5K36 H;  4LF9 Q;  2Z9H A;  1PRT F;  1HRJ A;  3S16 B;  1X3Q A;  1DYQ A;  2WAQ B;  5BN3 A;  3R2I A;  4GN3 B;  1HQR D;  3GP7 A;  1VQB A;  4DR7 Q;  1B8A A;  2EOT A;  2XRS D;  1Y69 U;  1M1K C;  3DWQ A;  2IHF A;  2RDF A;  3MVV A;  2FIN B;  2PQA B;  5ELE A;  2VQE L;  3VA5 A;  2MHV A;  4IPD A;  1B7Y B;  4PZ8 A;  2JA8 G;  1AE3 A;  3FPP A;  3OWF A;  5IGD A;  1GHJ A;  4DR1 Q;  4JPB W;  3CCV A;  4ME5 A;  4LF4 Q;  1GUS A;  2ICI A;  3CCE A;  4RCN A;  1Y1V H;  5ELF A;  1Q12 A;  3D6W A;  2OQ0 A;  4P73 A;  1VCI A;  4KN7 C;  1GD7 A;  1CZW A;  1CKN B;  1IYV A;  4BA2 I;  3GD7 A;  2R7Z B;  4A3B B;  2PZU A;  3MXU A;  1EU4 A;  3GTM B;  1SNC A;  2F0D A;  3RLF A;  4X66 L;  5COY A;  4IN3 A;  4JI4 L;  1KDC A;  1NR4 A;  1Q90 A;  2JA7 H;  4A4I A;  4JYA L;  1HNW L;  1XPO A;  2HIX A;  1K8M A;  1LTL A;  2KJX A;  3K5L A;  4DV6 Q;  1T5X D;  5IGE A;  4KHP L;  2WB1 E;  4DR6 Q;  3U4Z A;  4FF1 A;  3PF5 A;  1H9S A;  3M7N A;  1E22 A;  3MXN A;  3ULJ A;  4GN5 A;  5D65 A;  3NPP A;  3F2U A;  2E74 C;  2AQ3 B;  5LL6 S;  5I6Y A;  3I4M H;  1SYE A;  2OT2 A;  4DV4 Q;  2A69 C;  2JK8 A;  1HXY D;  4KY7 A;  3FKI H;  4OWT B;  3J81 j;  2EY2 A;  1YHQ A;  3R2T A;  1Q46 A;  4HJA A;  1K0S A;  1O7I A;  5GAH C;  1LT5 D;  1F9S A;  2NN6 I;  4GNX B;  4DR3 L;  4KTA A;  1QVF A;  1SSO A;  5CV6 A;  4BY1 H;  2R92 B;  3I4O A;  1PZJ D;  3UI2 A;  4CKB A;  1EYG A;  1U4R A;  2J7Z A;  2EXD A;  1HH2 P;  4BBR B;  1OXX K;  4TVA B;  1MJE A;  2NWG A;  2PI2 A;  4DA2 A;  1RDP D;  1PTO B;  3CPW A;  1BKB A;  1L0Y B;  3ERO A;  3T16 A;  4EQN A;  2F0G A;  4JI3 Q;  5DEH A;  1NMF A;  4OO1 I;  2Z6K C;  3KBG A;  4U68 A;  3DMU A;  1D1K A;  1SMX A;  2CW0 C;  3CQZ H;  1E24 A;  2RF4 A;  1M4V A;  4NKL A;  3BZC A;  1XMO L;  3I4M G;  5DLQ E;  5IYC H;  3ONA B;  4C3H B;  1VQ6 A;  3PIP A;  2F0P A;  5NUC A;  2HCC A;  2F0Q A;  2IHE A;  4CDF C;  1LTT D;  4KKU A;  4IFD H;  3G71 A;  3R93 A;  4WRD A;  1NY4 A;  3T56 B;  2JA5 B;  2SEB D;  3Q24 A;  4C3J H;  1H9S B;  4JCV E;  1JJC B;  1MSG A;  4L5R C;  1QCB D;  4FO2 A;  2R93 B;  1S72 A;  4GZY C;  2RVL A;  2A68 D;  3L9A X;  1I4R A;  3HOV B;  3DEP A;  5H1S E;  2KQ3 A;  1Q82 C;  1HPC A;  4PV1 C;  2JQO A;  1YBY A;  2B63 G;  3QJY A;  3GTG B;  2NN6 G;  1Y1W H;  1ENF A;  1P8L A;  1EOT A;  2L9H A;  4A3G H;  2A6E D;  3TZD A;  5IE8 A;  1DXM A;  4XQJ A;  3T1Y L;  1X55 A;  1GHK A;  1QJO A;  2E2H B;  2SDF A;  4BWG B;  3S1R B;  2G9D A;  1GUO A;  1VMP A;  2B2Y C;  3F1Z A;  5M5X B;  1HR0 L;  3OW7 A;  2F0N A;  4OX9 L;  2M2L A;  2UUC Q;  4IFD G;  3Q23 A;  5KRU A;  1N36 Q;  5TSS A;  1CK1 A;  4PMB A;  1SRU A;  3VR3 A;  3FPU B;  2Q2I A;  2K33 A;  1PH1 A;  1PH5 A;  1VQK A;  1F9Q A;  2MUY A;  4LUO A;  4XDX A;  1D2B A;  2E2D C;  4C3J G;  3NXW A;  4MNO A;  1STE A;  1TR5 A;  2EYF A;  4V0B A;  3EBE A;  1VQE A;  1RHP A;  3RZD B;  3DM1 A;  4QMG A;  3PIO A;  1JE5 A;  1TS5 A;  2IL8 A;  1EY7 A;  1Z9F A;  2MQH A;  1XNR Q;  5DM7 3;  4KD3 A;  2PMZ E;  5E3F A;  4POG A;  5BR8 L;  1EQR A;  5KNC A;  1U4M A;  5IP9 H;  1Y1W G;  5IP7 H;  4FYD A;  1PZK D;  2E75 C;  2JA8 B;  4A3G G;  4EQ5 A;  1U4P A;  3GTQ H;  5IOD A;  2JA9 A;  4JBW A;  2Z0S A;  4IOA A;  3CXC A;  3JAM L;  4G4K A;  4EQP A;  4C1N I;  4GKJ Q;  5EKI A;  3NBI A;  2I0Q A;  4CKE A;  1UE6 A;  1CKM A;  3MAQ A;  1Y8O B;  2E5L Q;  2XVS A;  5JJK A;  1G2T A;  4B3S Q;  1RJT A;  3H6M A;  4HJ9 A;  2OTL A;  1GJX A;  2EYM A;  2AWO A;  1XWE A;  4P71 A;  5LMU Q;  1N8R C;  4IUV A;  1KLU D;  2IT1 A;  1HUM A;  2NYZ D;  1HNX L;  2B2W A;  1VQ4 A;  2Z6B A;  2EVB A;  3CCU A;  3EJI A;  5IY0 A;  4OWW B;  2IWH A;  3X3N A;  3D3R A;  5I9P A;  3OIQ A;  4YHH L;  1YNN C;  1B1Z A;  3D4D A;  2G9H D;  4AYB E;  2NZH A;  4RA8 A;  5IP7 G;  1C48 A;  1PYS B;  2QDB A;  2B2U C;  4O1N A;  1V1Q A;  4BXX G;  1XNQ Q;  2XWJ B;  2FHT A;  1KXL A;  1W6J A;  1PH8 A;  1L2F A;  1Y1V B;  5FK9 C;  1MGS A;  2PZT A;  5EBC A;  1ESF A;  4GOP C;  2F0L A;  2K5H A;  2KEC A;  2X69 A;  1BR9 A;  3BDO A;  2FXQ A;  3S24 A;  1BCP F;  4RHS A;  3URY A;  5IYB G;  1D5Z C;  2JEA I;  4A3D H;  5T1I A;  4TRD A;  2F0V A;  1I4Q A;  4XIG S;  1J5E L;  2EPB A;  2BE5 D;  3HOZ H;  1KC8 C;  2R61 A;  3SR1 A;  4LF5 L;  3F2B A;  1WTW A;  4OXP A;  2MGS A;  1NE3 A;  2A19 A;  4LJZ C;  3AMU A;  5KND A;  4XXE A;  2BDO A;  4HTH A;  1P16 A;  1EWH A;  2K05 A;  4G57 A;  4YWM A;  2D62 A;  5J3B A;  4HJ8 A;  2B2V C;  2F3W A;  4ZKC B;  3K57 A;  1HNZ Q;  2EJF C;  5C4X G;  5JAV A;  1XTC D;  3MFY A;  3I4M B;  2EXZ A;  1I94 L;  3H3V I;  4OIJ A;  4DAY A;  2A73 B;  1JWU D;  1MSH A;  3OSO A;  3CKI B;  1EFI D;  1WCM H;  1TWF B;  5CGK A;  1DJR D;  4HSV A;  4LF6 L;  3VR2 A;  4B3T L;  1YZ6 A;  1Z47 A;  4G7H C;  2L5T A;  2HCI A;  3HKZ G;  3J7Y W;  2ZXO A;  3TP6 A;  1TY2 A;  1WTH A;  3FRP B;  1A3T A;  4PNY A;  3A5Z B;  4LFC L;  1WD0 A;  2N78 A;  4ME3 A;  3PGZ A;  2DN8 A;  3HOY G;  1U0L A;  1XPU A;  1ENC A;  3EIV A;  4BY1 B;  2F0W A;  3HOZ G;  2UXC Q;  1B53 A;  1HCZ A;  1LTB D;  1R4P B;  2CFM A;  3HKS A;  3DXJ C;  1V1P A;  4GLA C;  5C0X H;  5IIF A;  4A93 G;  1S5B D;  2WKD A;  1L0X B;  4WFN 3;  2VQF Q;  4JI0 L;  1WTX A;  4X62 Q;  2B63 B;  3U50 C;  2LFN A;  2ATW A;  3HOW H;  2MFI A;  3P1H A;  1X3G A;  1PDQ A;  4IUT A;  2OWO A;  3SXH A;  4B3R Q;  3NBH B;  5CV8 A;  4JOI C;  1Q86 C;  3HFZ B;  1RTO A;  2YTY A;  4DV5 L;  4YCU A;  2FJ2 A;  4ZUI A;  1WD1 A;  4DXF A;  1H9J A;  3H0G G;  1J6Q A;  2HT1 A;  1WCM G;  2VW9 A;  3SDZ A;  1IKM A;  4GOP A;  5AFW A;  1I6H H;  1W2B A;  2IW3 A;  4JI5 L;  4P75 A;  2CWA A;  1EYA A;  2N49 A;  3FMC A;  4C3J B;  2EY5 A;  1FR3 A;  1PHJ A;  3A8J E;  4IUN A;  1HFN A;  1H9R A;  2HDL A;  1KAA A;  4RFB A;  4BBS H;  1SND A;  4LWC A;  4MN3 A;  2N8N A;  5JVG 3;  3GTP B;  1Y8P B;  4DAY B;  3ULP A;  4MTN A;  5A35 A;  1Y1W B;  1PH3 A;  1BQQ T;  2JEB I;  2LXJ A;  4A3G B;  3P7J A;  1LV9 A;  3TP5 A;  5JPN C;  1FNU A;  1PRT C;  2K4K A;  4A3J H;  1HQM C;  4IOC A;  1HR0 W;  4JBK A;  1X3P A;  2CH4 W;  4H13 C;  1UEB A;  1I50 H;  5C4Z A;  3OIP A;  3TZU A;  3RN2 A;  4IAL A;  4ILW A;  2ZTD A;  2D0P A;  1CHP D;  3EN2 A;  1CFM A;  2G5D A;  2LSS A;  4L6T B;  4NW2 A;  2YV5 A;  2K01 A;  1V1P B;  1JIC A;  1EU3 A;  3T1H L;  1N33 Q;  4YY3 Q;  3DM3 A;  1AH9 A;  1SJH D;  1DOK A;  2HHH Q;  3GTK H;  4C3I H;  3K6O A;  3OOC A;  3I56 A;  4DGZ A;  2E2I B;  1VQO A;  3O13 A;  2K7V A;  1STY A;  2QIL A;  3L0O A;  2ZTE A;  2R92 G;  4FF3 A;  1KDB A;  1STG A;  2MP1 A;  1HTL D;  1K0R A;  4JI7 Q;  4LF8 L;  1SE3 A;  2WII B;  3J80 L;  3CP0 A;  1YJN A;  2Y0S G;  4ID6 A;  4Y7N H;  3PUY A;  1JJ2 A;  5ELB A;  1K28 A;  3J7A F;  1ZYR C;  3MC0 B;  3SVM A;  1JOQ A;  2CQO A;  5M3M H;  2CWP A;  2L0C A;  4MHE A;  1VF5 C;  3GTQ B;  1YVC A;  3CRL C;  2EY6 A;  2MNA A;  1LAB A;  5D3I B;  5JEA H;  4TKO B;  4RH6 A;  2LS0 1;  4POF A;  1PYB A;  2ID0 A;  4LW1 A;  2JA6 H;  1STA A;  3S2H B;  3M7G A;  3S1M B;  4OHJ A;  3CU7 A;  1E1T A;  3NEL A;  4IQZ A;  4DV0 Q;  2O4X A;  1EOV A;  3VR5 A;  1CM9 A;  5HUR A;  3OTO Q;  1TWG H;  1N34 Q;  4N9P A;  3Q8D A;  4C3I G;  4B9W A;  3MFG A;  2OF1 A;  5KYL A;  3J7Z C;  1S5D D;  3OWE B;  2LXK A;  5KGU A;  3PV0 A;  1E7Z A;  4OEM B;  4DR1 L;  3QO2 A;  2YU9 H;  1FYC A;  3RUZ A;  4X64 L;  1NJI C;  1HZB A;  5FLX E;  1BBX C;  1J9O A;  1I4H A;  1IBL L;  4IPH A;  1X3E A;  2C9O A;  3KLS X;  1R4Q B;  2R6G A;  1SNO A;  1KNA A;  3BG3 A;  1LO5 D;  5C4X B;  3IFD A;  2AUK A;  1OXS C;  3BVZ A;  3H09 A;  2EQS A;  2K75 A;  1LM0 A;  1MI2 A;  3PO2 H;  1HZA A;  2AMC B;  3TRE A;  2E2J H;  1ZXT A;  3HKZ B;  2D0O A;  3C1E A;  3IKJ A;  3K5N A;  4KHV A;  4BY7 H;  1EEI D;  5E1F A;  4YIJ A;  1N32 L;  1X56 A;  3QG1 A;  3I55 A;  4V19 0;  3HOY B;  1EQT A;  1SLJ A;  3N52 A;  4AQY L;  3X3M A;  3QOJ A;  1IL2 A;  3HOZ B;  4CDD C;  3RLN A;  3HZX A;  2OTJ A;  5L37 A;  1JWM D;  1W6K A;  2UXD L;  4DR2 Q;  4NXM L;  1O80 A;  4A93 B;  1VQN A;  1TWC B;  1IYU A;  3RMH A;  1EYC A;  4Q0F A;  3SHL A;  2RDH A;  1CA5 A;  2EYH A;  1KDA A;  2B8G A;  3K5O A;  4K0K L;  3J81 L;  4CJ2 C;  2DY8 A;  4K5V A;  1U9R A;  3SK4 A;  1DM0 B;  4B3M L;  2F0E A;  5C3E G;  2GVA A;  3S1N H;  2YTV A;  1SFO H;  1K8A C;  4DNI A;  5F2D A;  1T5E A;  1F2Y A;  4DUY L;  2A69 D;  1LT6 D;  3M3Y B;  1IBM Q;  3H0G B;  3S15 H;  2ENB A;  5E4X A;  1WCM B;  3U58 A;  1AE2 A;  5D14 A;  1QB5 D;  2R3Z A;  4A3E H;  2XGT A;  4BY7 G;  4CDE C;  1SYG A;  5J39 A;  1HA6 A;  3BU2 A;  3BZK A;  2EJM A;  3SEB A;  2EZV A;  4JI8 Q;  3TSS A;  2JN4 A;  2NZO A;  3VYU A;  2HQE A;  3D4R A;  5GRO A;  5AJ3 Q;  3K80 C;  4C1N K;  5E7N A;  2FFK B;  3VR6 A;  4XYO A;  1PVO A;  1PYW D;  2CVR A;  2UUA Q;  1FJG Q;  3W5O A;  3JAM E;  3A8K E;  4LF7 Q;  2CW0 D;  2RHS B;  5K36 G;  1G51 A;  1EFW A;  4X65 L;  3KF6 B;  5C3W A;  2DNE A;  1WTV A;  1G91 A;  1GUN A;  1A3U A;  3IL8 A;  1WTQ A;  4LK1 C;  4R1J A;  2V4D A;  4DN4 M;  1NAP A;  3ND8 A;  1SNQ A;  1YJ9 A;  2Q8I B;  1LUZ A;  2VS1 A;  1PTO F;  1Y1V G;  1STH A;  2WAQ E;  1KAB A;  5KYI A;  4OON A;  3RD4 A;  3F2D A;  4A3E G;  3GTO H;  1A2U A;  1CT1 D;  1I6H B;  4IJL A;  3NTK A;  1NTG A;  4L8J A;  3G4S A;  4NXN Q;  5GQO A;  1K9M C;  4XT3 B;  2EYJ A;  2A6H C;  3LGJ A;  1MHW C;  4DFA A;  1PH7 A;  3E0J A;  1ICF B;  2JA7 G;  4MZ9 A;  1B3Q A;  1UEA B;  1C8C A;  4GKK L;  2Y0S B;  4FP5 D;  5LL6 X;  4KV6 A;  1HZ9 A;  4HCS A;  5EPK A;  4FDB A;  3Q0A A;  4NPS A;  1V43 A;  3ICE A;  4IFD I;  4HED A;  2PCF B;  2UXB L;  5I2Y A;  3NSW A;  2VQE Q;  1C4Q A;  4HIO A;  1LAC A;  3K0X A;  5ELD A;  3S1Q B;  1I50 B;  1IXR A;  4IZ8 A;  3I4N H;  1Q8I A;  1F2L A;  4AH6 A;  4RHR A;  1SN8 A;  2F4V L;  3NTI A;  2F0T A;  3FKI G;  4BS9 A;  1JB3 A;  2QF7 A;  1HUN A;  3E3X A;  1NMG A;  3NHH A;  1SAP A;  2GN5 A;  5FLX c;  4N8X 1;  5C44 H;  3BDC A;  1RL2 A;  2K1B A;  4C3I B;  5EBD A;  3MWY W;  3G7L A;  2WFW A;  4X66 Q;  1S40 A;  4A3F H;  4JI4 Q;  1I4X A;  1DOM A;  1SDF A;  3KBX A;  1YNJ C;  1EYD A;  1H9M A;  3SGI A;  1BCP C;  2UU9 L;  4G7O C;  3HG9 A;  2N3S A;  4BY1 G;  5C5L A;  4WJ4 A;  4JYA Q;  3CD6 A;  1HNW Q;  4B08 A;  3AFP A;  3MXN B;  3J7A 5;  1HJP A;  5C4H A;  5ELN A;  4KHP Q;  3ULL A;  1L1O C;  4DV1 L;  2NVX H;  1PH2 A;  4OO1 H;  1RKN A;  4Z9C B;  3CC4 A;  3AU7 A;  4FXK C;  1KRS A;  2I46 A;  4HMI A;  1TU2 B;  3KJP A;  3OYY A;  4DNT B;  3MHB A;  4YCV A;  1EZ6 A;  1ZKO A;  1OXU A;  4CHT B;  5IYC G;  1D1I A;  3UDF A;  2PNR C;  4KKS A;  1XJV A;  3NTH A;  1D8L A;  2AUJ D;  3HS0 C;  1II3 A;  1ML0 D;  1AN8 A;  2B2T C;  2F0U A;  4OIK A;  3D0F A;  5FLM H;  1WVL A;  1Q1B A;  2CCZ A;  1E3P A;  1LTG D;  4DV2 L;  4DR3 Q;  1YIJ A;  1C0A A;  2D2C C;  2KBN A;  5C44 G;  3G6J B;  3VA7 A;  1EY6 A;  2J0T D;  1YIT A;  4R4T A;  1CI3 M;  2AQ2 B;  2F0M A;  2KCM A;  4A3C H;  1CA6 A;  1JCK B;  4FF4 A;  2YU9 B;  1DOL A;  3U4V A;  3LWE A;  1V1O A;  3W3A A;  4K8I A;  2DGY A;  1SEB D;  2NVQ H;  1STB A;  4JV5 L;  1U4L A;  1D5X C;  4CJ0 B;  5COR A;  1YNN D;  5C3E B;  1YEZ A;  3SE0 A;  2BA0 A;  4KJO A;  5EQ0 A;  1IBK L;  3QR8 A;  2E8G A;  1K83 H;  1VQP A;  1NCV A;  3AEV A;  2Z6K A;  3TS2 A;  1GUT A;  1XMO Q;  3HOX H;  2A1A A;  3GTJ H;  4L5Q A;  1KRT A;  1FGU A;  3M4Q A;  3S14 H;  3RZO H;  4BY7 B;  3P20 A;  2SNS A;  2WAC A;  3MA2 B;  1FVI A;  5KIX A;  1RD9 D;  4XQN A;  3KF8 A;  2OXP A;  4R4I A;  4DAP A;  1LTR D;  1YI2 A;  2NVT B;  1TT2 A;  1VQI A;  4HIK A;  1EY8 A;  1JE4 A;  3JAM c;  1PH6 A;  1S5F D;  4K14 A;  5EKL A;  2VUM H;  3V96 A;  3JAM i;  4A3M H;  1J8I A;  5KEE A;  3ITP A;  3G6E A;  3M85 A;  2RHQ B;  4R9W A;  1QVC A;  3A7L A;  4A3L H;  4QCL A;  4DAM A;  1IW7 C;  1EY9 A;  1XTD A;  2ZJQ A;  4PMW A;  2PI2 E;  4EGV A;  4ALP A;  1FD7 D;  3F8T A;  3CC7 A;  2LY7 A;  2QEX A;  4DAV A;  3NK9 A;  1TWH H;  3PO3 H;  1JQY D;  1A15 A;  1PFN A;  4DR5 L;  2Z4I A;  1PMR A;  4HJ5 A;  1D7Q A;  2F3V A;  3NWS A;  5IP9 G;  2ZJP A;  3T1Y Q;  2F4I A;  1QNU A;  1JWS D;  3CRK C;  1MKH A;  3S17 H;  1SJE D;  4LMQ D;  4AIM A;  1B4O A;  3HEJ A;  4RKL A;  3BS1 A;  2F03 A;  2QW7 A;  4M8A A;  4UHV A;  4A3E B;  1HR0 Q;  4IUU A;  2L1B A;  4OX9 Q;  2PQE A;  2B2Y A;  2JYO A;  5M3F H;  4EVO A;  4A75 A;  5CR3 A;  1EQV A;  2F0S A;  2RSN A;  1PA6 A;  1XMQ Q;  1K8G A;  2XIW A;  3J80 E;  1BF4 A;  5LHY 1;  3I90 A;  3KDF A;  2IX0 A;  1K3B C;  3ZYY X;  4DR4 L;  4H7B A;  4A3M G;  4GLV B;  2JA7 B;  2F0I A;  2L11 A;  2C5C A;  1TS2 A;  4YWL A;  5BN5 A;  4OEL B;  3K7A H;  3A56 A;  3GDE A;  4A3K H;  4JBM A;  4JI2 L;  2D9U A;  3FDT A;  1EY5 A;  3TP8 A;  4J6H A;  5BR8 Q;  1SBB B;  1KL9 A;  2K50 A;  4Y52 H;  1Y14 B;  3PO3 G;  1PV4 A;  2ASB A;  5CV5 A;  4QUC A;  1EY4 A;  1EIG A;  3KF8 B;  1G6Z A;  4PQX A;  3W2D A;  4QGU A;  2ZJR A;  3I72 A;  4RGM A;  1WJJ A;  1GUG A;  4CBV A;  3MEH A;  1B2T A;  2ZM6 L;  2K14 A;  3FKI B;  3T4A C;  4R8I A;  2O5J C;  4J1M A;  3TN2 A;  3D6C A;  2BDN A;  4JK1 C;  3NQI A;  5CMD A;  1JC7 A;  3F2C A;  1JJG A;  5M3F G;  3S16 H;  5IWA L;  4A3D G;  3FEW X;  3L2P A;  2KCN A;  3FVQ A;  3I91 A;  5FJ8 H;  1JT8 A;  2RKS A;  4A3I H;  1CQV A;  1O7L A;  2H4O A;  1HNX Q;  1VS0 A;  1IZ6 A;  3C46 A;  2EIF A;  2EE1 A;  5LMN L;  1F9P A;  4PZ6 A;  2JJQ A;  3DHQ A;  4FXG C;  3H15 A;  1PRT D;  1MIU A;  5IGG A;  3KYH C;  3PCO B;  4OGQ C;  4YHH Q;  2N55 A;  5IGF A;  2DY7 A;  4A3B H;  3CQZ B;  1VQF A;  2HHH L;  2WB1 G;  3A54 A;  2KOL A;  3CW2 C;  1I6V C;  1PZI D;  3I4N B;  2M00 A;  3U9O A;  1JB7 A;  2B2U A;  2BE5 C;  5CYU A;  4HR7 B;  1V9P A;  4JI6 L;  4WJW A;  1VQC A;  2XRQ D;  3VYR A;  2PW5 A;  4HMJ A;  1WTP A;  4JI7 L;  3K8A A;  1VQG A;  4E6I A;  5A2Q E;  3HGB A;  1SYB A;  5C44 B;  3DWA A;  2JSO A;  1CHQ D;  1SYF A;  3BJU A;  1X32 A;  1J5E Q;  4X3S A;  2XTI A;  3DWP A;  4LF5 Q;  4QQB X;  1PLF A;  5ISR A;  3VR4 A;  4DV7 L;  4HJ7 A;  1KD1 C;  3QWN A;  4A3I G;  1TY0 A;  2UUB L;  1K3R A;  3KLS A;  3K5M A;  4ODG A;  4F8M A;  1S5C D;  5C0X G;  4QIW B;  5EAY A;  1H95 A;  2DUD A;  1JOK A;  2AKW B;  3MTS A;  3HOW G;  3MXP A;  2B2V A;  1XX8 A;  3EA6 A;  4KI0 A;  5FO9 B;  1I94 Q;  3GTL H;  1NBW A;  2HDM A;  1VQM A;  2F3I A;  1BUV T;  5CV4 A;  1AW7 A;  1XYI A;  2K28 A;  4BBR H;  4LF6 Q;  3STB C;  4B3T Q;  3H3V C;  4R4Q A;  1PTO H;  4GN4 B;  2ICE C;  2RSO A;  4FVM A;  2RCF A;  3K7U C;  5K5P A;  5EJW A;  4LFC Q;  1SMY C;  2EY1 A;  3G48 A;  3W1G A;  4ULL A;  3IAY A;  4NDX A;  2B3G A;  2QEJ C;  1MJC A;  2F1M A;  4F7X A;  4C3H H;  1S3O A;  1A6X A;  2NVQ B;  1T9H A;  4P2C B;  2L4N A;  1BNZ A;  2AWN A;  4JI0 Q;  4BBS G;  3QB3 A;  3UE1 A;  2PYK A;  1K83 B;  1FNW A;  2K03 A;  5KNB A;  4DV3 L;  1NUC A;  3A7A B;  4M1U B;  1TWA H;  1E1O A;  5M9O A;  4DV5 Q;  3HOX B;  5JJZ A;  1O78 A;  2NVY H;  2VXW A;  4RGN A;  1JOO A;  3TEH B;  4GOP B;  3C3L A;  4JOI A;  1FNV A;  3N6R A;  4DUZ L;  3J80 c;  4JI1 L;  4A3J G;  2EYO A;  2JXM B;  3R3O A;  1WYD A;  4DF7 A;  3I4L A;  4GNX C;  3J80 i;  1LT3 D;  4LFB L;  2R93 H;  5T1G A;  2SOB A;  5IT9 L;  1KQS A;  3PUX A;  4CKC A;  4I7A A;  4LF9 L; 
#chains in the Genus database with same CATH homology
 1DZ1 A;  2NUC A;  1PTO C;  1OO9 B;  4A3M B;  2F0F A;  2TSS A;  3DEO A;  5EPL A;  5BN4 A;  4XQQ A;  3KLR A;  3A8I E;  2F0H A;  1HA5 A;  1HTP A;  4DXG A;  2KVM A;  5I6W A;  4ABN A;  1GOZ A;  3PO3 B;  4Q5V A;  1LLR D;  2ZXP A;  3BDL A;  3EQL C;  1F77 A;  4U67 3;  4ZKB B;  1SXT A;  1NSN S;  1TS4 A;  4ZYS A;  1SE4 A;  4ZK9 B;  5JEA G;  3EVQ A;  1VDZ A;  1LTI D;  5I4D A;  3GV6 A;  4PMC A;  3K59 A;  5M3F B;  2KA7 A;  2L55 A;  4A3D B;  5JOB A;  2D5D A;  3PUW A;  1JR0 D;  1D5M C;  5CBE E;  4IUR A;  4HSP A;  3BYT B;  5J1Z A;  3WDN A;  4K8J A;  3I70 A;  4BA1 I;  2KHS A;  3NUC A;  5G3L F;  2WB1 B;  3K0Y A;  3T51 B;  4ZUJ A;  1PFM A;  3TDQ A;  4OL7 A;  2F0K A;  1QNK A;  4KD4 A;  5C6A A;  4KY6 A;  3I3C A;  4K5X A;  2K5W A;  4K2L A;  1AP0 A;  1EL0 A;  4HCE A;  4DK0 A;  2A6H D;  5CV7 A;  3ND9 A;  1TQO A;  4A3I B;  2K5Q A;  4IUQ A;  1QWY A;  1WTR A;  1E2Z A;  4NP5 A;  4K2K A;  5I2X A;  4FF2 A;  1SYD A;  3H94 A;  1ENA A;  1PRT B;  2TMP A;  3HOW B;  1CQF A;  1CZG A;  3CHB D;  2I07 B;  3BZD B;  5D3D A;  3LWU A;  1OXT A;  3L3O C;  2VNU D;  4IUP A;  2K6A A;  3SK8 A;  3KK7 A;  2OEO A;  4K5W A;  4DK1 A;  3HP3 A;  2IX1 A;  2NBF A;  1YNJ D;  3U9S A;  1BCP D;  3NQT A;  1A3V A;  2N88 A;  5ELC A;  1G2S A;  1PXU A;  3HRZ C;  4ZAI A;  4BBS B;  2XSC A;  1AZQ A;  1STN A;  2F0O A;  5IGB A;  2KCC A;  2PO4 A;  1GUW A;  2J4X A;  2B8F A;  1I4G A;  3GTL B;  5DM6 3;  4DNR B;  3K58 A;  4A3J B;  2BOS A;  3Q6S A;  1Z7T A;  1K8O A;  1EZ8 A;  2ZXR A;  1ESR A;  1V8Q A;  2NN6 H;  2O5I C;  4TQU S;  3GTK B;  1VMC A;  3SK5 A;  5FLX L;  4UDU C;  1M8A A;  2CHB D;  1ILP A;  2E76 C;  3VYT A;  2EYL A;  3LNN A;  2XN9 C;  1XXG A;  1F9R A;  3QIA A;  4Y7N B;  1TWA B;  3Q22 A;  5FO8 B;  2NVY B;  5M3M B;  2PMZ B;  3D31 A;  3H91 A;  1LTA D;  4KKT A;  1IHZ A;  4KMU C;  4ZQ3 A;  3S9W A;  4KK7 A;  1O7Z A;  2B2W C;  2JA6 B;  4XYQ A;  4ZRZ A;  3OMC A;  2QCP X;  4IFD J;  2RQX A;  1S4Z A;  3EFX D;  1EWC A;  3TBI B;  1TWG B;  1F2M A;  3TME A;  2X6G A;  1IW7 D;  2X6L A;  1ICW A;  1BO0 A;  2NTT A;  1LTS D;  2BA1 A;  2WV6 D;  4S3S A;  1HFG A;  4OO1 G;  2JP1 A;  2QKI C;  4EQO A;  2ZT9 C;  4F87 A;  3L7Z C;  2KEE A;  3M4O B;  4TSS A;  3PO2 B;  4AYB B;  4FXD A;  5C4J B;  5E4W C;  2AQ1 B;  2WIN B;  2E2J B;  4B9X A;  1TII D;  4RGO S;  1SE2 A;  3PUV A;  4HN7 A;  2O2L D;  2IJ0 A;  2A68 C;  3T53 B;  3OPO A;  1SYC A;  2VB3 X;  5FOB B;  4C56 C;  1H9K A;  5IOC A;  1B3A A;  1DON A;  3NWT A;  2JE6 I;  2KUM A;  2A6E C;  5DNF A;  4KY5 A;  4QF4 A;  3HOU B;  3S1N B;  5HGT A;  1SFO B;  4QUF A;  4RGT A;  3SK6 A;  4RKB A;  1UNS A;  4DU9 A;  2GA4 B;  3S15 B;  1BXT A;  5EKK A;  5JVH 3;  4I7Z C;  1QIL A;  3C2P A;  4FNF A;  2B2T A;  1UUP A;  1TS3 A;  2Z1C A;  2EDG A;  3MXG A;  3R8B A;  2A74 C;  3NE5 B;  3OMG A;  1SNP A;  5J22 A;  2NB0 A;  2Q8T A;  3NBH A;  1SNM A;  4K6L A;  5IT9 E;  1I4P A;  4KN4 C;  2IX3 A;  2WP8 J;  1NR2 A;  1VF7 A;  2EJG C;  3A55 A;  5M5W B;  1GXD C;  3GV3 A;  5C0X I;  1BDO A;  1G8Z D;  3GTO B;  1BCP B;  2PZW A;  2BCO A;  2YYZ A;  2FMM A;  2L12 A;  3QOL A;  4LAA A;  2SNM A;  1D6E C;  2NTS A;  1Y8N B;  3GQB A;  1MBY A;  1WTO A;  1F2Z A;  1ILQ A;  5G3L D;  3I8Z A;  3PMF A;  4K6D A;  3PIP 3;  1IKL A;  1OXV A;  3J7A V;  5CV9 A;  3WOE A;  2RBM A;  1TVX A;  1B44 D;  1UAP A;  1ET9 A;  1SMY D;  1A2T A;  3BYY B;  3E6Z X;  2K5D A;  4RCO A;  1S5E D;  3DUZ A;  1ONL A;  3TP7 A;  1Q1E A;  4X3U A;  3J81 E;  4A3F B;  5CBA E;  4O42 A;  1BOS A;  2DNC A;  4KJN A;  5C0X J;  1AFP A;  1ZYR D;  3PUZ A;  2NVX B;  4G7Z C;  1E2W A;  4X3K A;  4MIU A;  2K04 A;  4H0L C;  2B39 A;  5CC4 A;  1EIH A;  2Z4H A;  4CGY B;  3MZ5 A;  3M4Y A;  3T13 A;  1Q3L A;  4XT1 B;  2WKC A;  3KUP A;  1Z6H A;  2F0J A;  2Z8L A;  1IL8 A;  4J8Q A;  4X3T A;  4CJ1 B;  3S2D B;  1PTO D;  4UAI A;  1KNE A;  3PIO 3;  2LKV A;  4N9T A;  5IGC A;  4XTC S;  1RTN A;  3ERQ A;  5EPJ A;  3I73 A;  3P75 A;  1O7Y A;  3BVM A;  1FGB D;  5I9O A;  5FKA C;  1QG7 A;  3IFT A;  4C2M B;  1ET6 A;  4RWS C;  4H44 C;  4I65 A;  3V05 A;  5M5Y B;  2KED A;  1KTK A;  3BVG A;  3WOF A;  1B50 A;  3GTJ B;  1B9N A;  3C1F A;  3S14 B;  5JPM C;  3D4W A;  3RZO B;  2EYP A;  3V2T A;  3AB9 A;  2PPB C;  2HUG A;  4ZLT F;  2VUM B;  1G29 1;  1AZP A;  1JOR A;  4KHZ A;  2RDG A;  1RF2 D;  2XNA C;  3D8G A;  4RAU C;  4C3H G;  1B9M A;  1EEF D;  4F88 A;  4NMZ A;  1CTM A;  2MPM A;  2PW7 A;  3LX0 A;  1ZEQ X;  1TWH B;  2A5H A;  2LMC B;  3NP8 A;  2H1E A;  2CQA A;  1R9T B;  1I3Q B;  1PFB A;  1QE6 A;  2XWB B;  4QB4 A;  3S17 B;  5JEA J;  1EY0 A;  4WOR A;  1RCV D;  5C5M A;  5DAU A;  2IPK D;  5EGT A;  3VYS A;  1E2V A;  1MD2 D;  4HAE A;  1AEX A;  2FMC A;  1TKW B;  5FO7 B;  1LT4 D;  3K7A B;  2M9V A;  1HHV A;  2K32 A;  1QOH A;  4R8N A;  4A3K B;  2Q8R E;  3E5S A;  2MJ8 A;  5C3X A;  3OHX C;  3GO5 A;  2VB2 X;  1KLG D;  1DD2 A;  5A2Q L;  1E0B A;  2NZ1 D;  1DCZ A;  1ROD A;  4L63 B;  2RA4 A;  5K36 H;  1PRT F;  1HRJ A;  3S16 B;  1X3Q A;  1DYQ A;  2WAQ B;  5BN3 A;  3R2I A;  1HQR D;  3GP7 A;  2EOT A;  2XRS D;  1Y69 U;  3DWQ A;  2RDF A;  3MVV A;  2FIN B;  5ELE A;  3VA5 A;  2MHV A;  3FPP A;  3OWF A;  5IGD A;  1GHJ A;  4ME5 A;  1GUS A;  2ICI A;  4RCN A;  5ELF A;  1Q12 A;  3D6W A;  1VCI A;  4KN7 C;  1CZW A;  1IYV A;  4BA2 I;  3GD7 A;  2R7Z B;  4A3B B;  2PZU A;  3MXU A;  1EU4 A;  3GTM B;  1SNC A;  2F0D A;  3RLF A;  5COY A;  4IN3 A;  1KDC A;  1NR4 A;  1Q90 A;  1K8M A;  3K5L A;  2KJX A;  1T5X D;  5IGE A;  4FF1 A;  3M7N A;  1H9S A;  3MXN A;  5D65 A;  3NPP A;  3F2U A;  5I6Y A;  2E74 C;  2AQ3 B;  5LL6 S;  1SYE A;  2OT2 A;  2A69 C;  1HXY D;  4KY7 A;  2EY2 A;  3R2T A;  1LT5 D;  1F9S A;  2NN6 I;  4KTA A;  1SSO A;  5CV6 A;  2R92 B;  1PZJ D;  3UI2 A;  4CKB A;  1U4R A;  2J7Z A;  4BBR B;  1OXX K;  2NWG A;  4DA2 A;  1RDP D;  1PTO B;  1L0Y B;  3ERO A;  3T16 A;  4EQN A;  2F0G A;  5DEH A;  4OO1 I;  3KBG A;  4U68 A;  3DMU A;  1D1K A;  2CW0 C;  1M4V A;  4NKL A;  3ONA B;  4C3H B;  2F0P A;  5NUC A;  2HCC A;  2F0Q A;  1LTT D;  4KKU A;  4IFD H;  3R93 A;  4WRD A;  3T56 B;  2JA5 B;  2SEB D;  3Q24 A;  1H9S B;  1MSG A;  1QCB D;  4FO2 A;  2R93 B;  4GZY C;  2RVL A;  2A68 D;  3L9A X;  1I4R A;  3HOV B;  3DEP A;  2KQ3 A;  1HPC A;  4PV1 C;  3QJY A;  3GTG B;  2NN6 G;  1ENF A;  1EOT A;  2L9H A;  2A6E D;  3TZD A;  1DXM A;  4XQJ A;  1GHK A;  1QJO A;  2E2H B;  2SDF A;  4BWG B;  3S1R B;  2G9D A;  1GUO A;  1VMP A;  2B2Y C;  5M5X B;  3OW7 A;  2F0N A;  2M2L A;  4IFD G;  3Q23 A;  5KRU A;  5TSS A;  1CK1 A;  4PMB A;  3VR3 A;  3FPU B;  2K33 A;  1F9Q A;  4XDX A;  2MUY A;  1D2B A;  2E2D C;  4C3J G;  3NXW A;  1STE A;  1TR5 A;  2EYF A;  4V0B A;  1RHP A;  3RZD B;  3DM1 A;  4QMG A;  1TS5 A;  2IL8 A;  1EY7 A;  5DM7 3;  4KD3 A;  5E3F A;  5KNC A;  1U4M A;  4FYD A;  1PZK D;  2E75 C;  2JA8 B;  1U4P A;  5IOD A;  4JBW A;  3JAM L;  4G4K A;  4EQP A;  4C1N I;  5EKI A;  3NBI A;  4CKE A;  3MAQ A;  1Y8O B;  2XVS A;  1G2T A;  1RJT A;  3H6M A;  1GJX A;  2EYM A;  2AWO A;  1XWE A;  4IUV A;  1KLU D;  2IT1 A;  1HUM A;  2NYZ D;  2B2W A;  2EVB A;  3EJI A;  2IWH A;  3X3N A;  3D3R A;  5I9P A;  3OIQ A;  1YNN C;  1B1Z A;  3D4D A;  2G9H D;  4RA8 A;  1C48 A;  2QDB A;  2B2U C;  4O1N A;  2XWJ B;  2FHT A;  1W6J A;  1Y1V B;  5FK9 C;  1MGS A;  2PZT A;  5EBC A;  1ESF A;  2F0L A;  2X69 A;  2KEC A;  1BR9 A;  3BDO A;  1BCP F;  4RHS A;  3URY A;  1D5Z C;  2JEA I;  5T1I A;  4TRD A;  2F0V A;  1I4Q A;  4XIG S;  2EPB A;  2BE5 D;  2R61 A;  3SR1 A;  1WTW A;  2MGS A;  4LJZ C;  3AMU A;  5KND A;  4XXE A;  2BDO A;  4HTH A;  1EWH A;  2K05 A;  4G57 A;  2D62 A;  2B2V C;  2F3W A;  4ZKC B;  3K57 A;  2EJF C;  5JAV A;  1XTC D;  3MFY A;  3I4M B;  2EXZ A;  4OIJ A;  4DAY A;  2A73 B;  1JWU D;  1MSH A;  3OSO A;  3CKI B;  1EFI D;  1TWF B;  5CGK A;  1DJR D;  4HSV A;  3VR2 A;  1Z47 A;  4G7H C;  2L5T A;  2HCI A;  3J7Y W;  2ZXO A;  3TP6 A;  1TY2 A;  3FRP B;  1A3T A;  4PNY A;  1WD0 A;  2DN8 A;  1ENC A;  4BY1 B;  2F0W A;  1B53 A;  1HCZ A;  1LTB D;  1R4P B;  3DXJ C;  1V1P A;  5C0X H;  5IIF A;  1S5B D;  2WKD A;  1L0X B;  4WFN 3;  1WTX A;  2B63 B;  2LFN A;  3P1H A;  1PDQ A;  4IUT A;  3SXH A;  5CV8 A;  1RTO A;  2FJ2 A;  4ZUI A;  1WD1 A;  4DXF A;  1H9J A;  3SDZ A;  1IKM A;  5AFW A;  2IW3 A;  1EYA A;  3FMC A;  4C3J B;  2EY5 A;  1FR3 A;  3A8J E;  4IUN A;  1HFN A;  1H9R A;  2HDL A;  1KAA A;  4RFB A;  1SND A;  4MN3 A;  5JVG 3;  3GTP B;  1Y8P B;  5A35 A;  1Y1W B;  1BQQ T;  2JEB I;  4A3G B;  3P7J A;  1LV9 A;  3TP5 A;  5JPN C;  1FNU A;  1PRT C;  1HQM C;  1X3P A;  4H13 C;  5C4Z A;  3OIP A;  3TZU A;  4ILW A;  4IAL A;  1CHP D;  1CFM A;  4L6T B;  4NW2 A;  2K01 A;  1V1P B;  1JIC A;  1EU3 A;  1SJH D;  1DOK A;  3K6O A;  3OOC A;  2E2I B;  4DGZ A;  3O13 A;  2K7V A;  1STY A;  2QIL A;  4FF3 A;  1KDB A;  1STG A;  2MP1 A;  1HTL D;  1SE3 A;  2WII B;  3J80 L;  4ID6 A;  3PUY A;  5ELB A;  3J7A F;  1ZYR C;  3MC0 B;  3SVM A;  1JOQ A;  3GTQ B;  2L0C A;  4MHE A;  1VF5 C;  3CRL C;  2EY6 A;  1LAB A;  5D3I B;  5JEA H;  4TKO B;  4RH6 A;  2LS0 1;  2ID0 A;  1STA A;  3S2H B;  3M7G A;  3S1M B;  4OHJ A;  3CU7 A;  4IQZ A;  2O4X A;  3VR5 A;  1CM9 A;  5HUR A;  4N9P A;  4C3I G;  4B9W A;  3MFG A;  2OF1 A;  5KYL A;  1S5D D;  3OWE B;  5KGU A;  3PV0 A;  3QO2 A;  1FYC A;  3RUZ A;  5FLX E;  1BBX C;  1J9O A;  1I4H A;  2C9O A;  3KLS X;  1R4Q B;  2R6G A;  1SNO A;  1KNA A;  3BG3 A;  1LO5 D;  5C4X B;  3IFD A;  2AUK A;  1OXS C;  3BVZ A;  3H09 A;  1MI2 A;  1ZXT A;  3HKZ B;  3C1E A;  3IKJ A;  3K5N A;  4KHV A;  1EEI D;  5E1F A;  4YIJ A;  3QG1 A;  4V19 0;  3HOY B;  1EQT A;  3N52 A;  3X3M A;  3QOJ A;  3HOZ B;  3HZX A;  1JWM D;  1W6K A;  1O80 A;  4A93 B;  1TWC B;  1IYU A;  3RMH A;  1EYC A;  4Q0F A;  3SHL A;  2RDH A;  1CA5 A;  2EYH A;  1KDA A;  2B8G A;  3K5O A;  3J81 L;  4CJ2 C;  2DY8 A;  4K5V A;  1U9R A;  3SK4 A;  1DM0 B;  2F0E A;  5F2D A;  1T5E A;  1F2Y A;  2A69 D;  1LT6 D;  3M3Y B;  3H0G B;  2ENB A;  5E4X A;  1WCM B;  5D14 A;  1QB5 D;  2R3Z A;  1SYG A;  5J39 A;  1HA6 A;  2EJM A;  3SEB A;  2EZV A;  3TSS A;  3VYU A;  2HQE A;  3D4R A;  4C1N K;  2FFK B;  3VR6 A;  4XYO A;  1PYW D;  2CVR A;  3JAM E;  3A8K E;  2CW0 D;  5K36 G;  5C3W A;  2DNE A;  1WTV A;  1G91 A;  1GUN A;  1A3U A;  3IL8 A;  1WTQ A;  4LK1 C;  2V4D A;  4DN4 M;  1NAP A;  3ND8 A;  1SNQ A;  2Q8I B;  1PTO F;  1STH A;  1KAB A;  5KYI A;  3RD4 A;  1A2U A;  1CT1 D;  1I6H B;  3NTK A;  4L8J A;  4XT3 B;  2EYJ A;  2A6H C;  4DFA A;  3E0J A;  1UEA B;  1C8C A;  2Y0S B;  4FP5 D;  5LL6 X;  4KV6 A;  4HCS A;  5EPK A;  3Q0A A;  1V43 A;  4IFD I;  4HED A;  2PCF B;  5I2Y A;  3NSW A;  1C4Q A;  1LAC A;  5ELD A;  3S1Q B;  1I50 B;  4IZ8 A;  1Q8I A;  1F2L A;  4RHR A;  3NTI A;  2F0T A;  4BS9 A;  1JB3 A;  2QF7 A;  1HUN A;  3NHH A;  1SAP A;  3BDC A;  2K1B A;  4C3I B;  5EBD A;  3MWY W;  3G7L A;  1I4X A;  1DOM A;  1SDF A;  1YNJ C;  3KBX A;  1EYD A;  1H9M A;  1BCP C;  4G7O C;  3HG9 A;  5C5L A;  4B08 A;  5C4H A;  4OO1 H;  1RKN A;  4Z9C B;  3AU7 A;  4FXK C;  2I46 A;  4HMI A;  1TU2 B;  4DNT B;  3MHB A;  1EZ6 A;  1ZKO A;  1OXU A;  4CHT B;  1D1I A;  2PNR C;  4KKS A;  3NTH A;  2AUJ D;  3HS0 C;  1II3 A;  1ML0 D;  1AN8 A;  2B2T C;  2F0U A;  4OIK A;  1WVL A;  1Q1B A;  1LTG D;  2D2C C;  3G6J B;  3VA7 A;  1EY6 A;  2J0T D;  1CI3 M;  2AQ2 B;  2F0M A;  1CA6 A;  1JCK B;  4FF4 A;  2YU9 B;  1DOL A;  3LWE A;  1V1O A;  3W3A A;  4K8I A;  1SEB D;  1STB A;  1U4L A;  1D5X C;  4CJ0 B;  5COR A;  1YNN D;  5C3E B;  3SE0 A;  2BA0 A;  4KJO A;  5EQ0 A;  1NCV A;  1GUT A;  4BY7 B;  3P20 A;  2SNS A;  2WAC A;  3MA2 B;  5KIX A;  1RD9 D;  4XQN A;  3KF8 A;  2OXP A;  4DAP A;  1LTR D;  2NVT B;  1TT2 A;  1EY8 A;  1JE4 A;  1S5F D;  4K14 A;  5EKL A;  3V96 A;  1J8I A;  5KEE A;  3ITP A;  3M85 A;  4R9W A;  3A7L A;  4QCL A;  1IW7 C;  1EY9 A;  4PMW A;  4EGV A;  1FD7 D;  2LY7 A;  4DAV A;  3NK9 A;  1JQY D;  1A15 A;  1PFN A;  2Z4I A;  1PMR A;  2F3V A;  3NWS A;  2F4I A;  1QNU A;  1JWS D;  3CRK C;  1SJE D;  4LMQ D;  1B4O A;  3HEJ A;  4RKL A;  3BS1 A;  2F03 A;  4M8A A;  4A3E B;  4IUU A;  2L1B A;  2PQE A;  2B2Y A;  2JYO A;  4EVO A;  5CR3 A;  1EQV A;  2F0S A;  2RSN A;  2XIW A;  3J80 E;  1BF4 A;  5LHY 1;  3I90 A;  2IX0 A;  3ZYY X;  4H7B A;  2JA7 B;  2F0I A;  2L11 A;  2C5C A;  1TS2 A;  5BN5 A;  3A56 A;  2D9U A;  3FDT A;  1EY5 A;  3TP8 A;  4J6H A;  1SBB B;  5CV5 A;  4QUC A;  1EY4 A;  1EIG A;  1G6Z A;  4PQX A;  3W2D A;  3I72 A;  4RGM A;  1GUG A;  4CBV A;  3MEH A;  1B2T A;  3FKI B;  3T4A C;  4R8I A;  2O5J C;  4J1M A;  3TN2 A;  3D6C A;  2BDN A;  4JK1 C;  3NQI A;  5CMD A;  1JC7 A;  3FEW X;  2KCN A;  3FVQ A;  3I91 A;  2RKS A;  1CQV A;  1O7L A;  2H4O A;  3C46 A;  2EE1 A;  1F9P A;  3DHQ A;  4FXG C;  1PRT D;  5IGG A;  4OGQ C;  2N55 A;  5IGF A;  2DY7 A;  3CQZ B;  3A54 A;  2KOL A;  1I6V C;  1PZI D;  3I4N B;  2M00 A;  3U9O A;  2B2U A;  2BE5 C;  5CYU A;  4HR7 B;  4WJW A;  3VYR A;  2XRQ D;  1WTP A;  2PW5 A;  4HMJ A;  4E6I A;  5A2Q E;  3HGB A;  1SYB A;  5C44 B;  3DWA A;  2JSO A;  1CHQ D;  1SYF A;  1X32 A;  4X3S A;  3DWP A;  1PLF A;  5ISR A;  3VR4 A;  3QWN A;  1TY0 A;  3KLS A;  3K5M A;  4ODG A;  4F8M A;  1S5C D;  5C0X G;  4QIW B;  1JOK A;  3MTS A;  3MXP A;  2B2V A;  1XX8 A;  3EA6 A;  4KI0 A;  5FO9 B;  2HDM A;  1BUV T;  5CV4 A;  1AW7 A;  1XYI A;  2K28 A;  3H3V C;  1PTO H;  2ICE C;  2RSO A;  4FVM A;  5K5P A;  5EJW A;  1SMY C;  2EY1 A;  4ULL A;  3IAY A;  4NDX A;  2QEJ C;  2F1M A;  4F7X A;  1A6X A;  2NVQ B;  4P2C B;  2L4N A;  1BNZ A;  2AWN A;  3QB3 A;  2PYK A;  1K83 B;  1FNW A;  2K03 A;  5KNB A;  1NUC A;  3A7A B;  4M1U B;  5M9O A;  3HOX B;  5JJZ A;  1O78 A;  2VXW A;  4RGN A;  1JOO A;  3C3L A;  1FNV A;  3N6R A;  2EYO A;  2JXM B;  3R3O A;  4DF7 A;  3I4L A;  1LT3 D;  5T1G A;  2SOB A;  5IT9 L;  3PUX A;  4CKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...