3MVVA

Crystal structure of staphylococcal nuclease variant delta+phs f34a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTARLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mvvA00
2EY6A 3TMEA 5KYLA 2RBMA 4YIJA 3EVQA 3QB3A 1KDAA 1AEXA 2F0TA 2PQEA 2PZUA 4K2KA 4K8JA 4K5XA 3VA5A 4DU9A 4B9XA 5KIXA 1JORA 5IGCA 2SNMA 1ENCA 3DMUA 1STNA 3C1FA 4KJOA 3BDCA 4KV6A 3TP7A 1JOKA 2M00A 3EJIA 4WRDA 3S9WA 3H6MA 2F0VA 3QOLA 4EQNA 4EQOA 1EY5A 1TT2A 1STHA 1NSNS 3SXHA 5J22A 3ITPA 2OEOA 4PMBA 1EYDA 5CGKA 4NKLA 3P1HA 2F0GA 1SYEA 2F3WA 1SYDA 5C5LA 4NDXA 3HZXA 2F0OA 2F0EA 2EXZA 5DEHA 3OSOA 5C3WA 2PW7A 4E6IA 2EY2A 3TP5A 4PMCA 1SYGA 1SNOA 3LX0A 3D8GA 4KY6A 2F0JA 1TR5A 2HQEA 4ID6A 3TP6A 5C4ZA 1KDBA 4I65A 5CR3A 3P75A 4IUNA 2F0LA 4HMJA 1KDCA 4ZUJA 3OMGA 3HEJA 4QB4A 1SNDA 3SR1A 4ZUIA 2F0NA 2EY5A 4H7BA 2F0PA 4NP5A 5CV7A 1SNMA 5JOBA 4N9PA 3MVVA 5I9OA 1SNPA 3EROA 4KD3A 4QMGA 5IGFA 4K5VA 1EYCA 5IGBA 1JOOA 1EY4A 3NQTA 1EY0A 3BDLA 2F0WA 1EQVA 2RKSA 3OWFA 4TRDA 5CV5A 5F2DA 3SHLA 4F7XA 2EYHA 4MIUA 3V2TA 2F0FA 1A3UA 2QDBA 4DF7A 4K2LA 1STAA 1SYFA 3MXPA 5C6AA 3OMCA 5HGTA 4B9WA 2EYMA 1SNCA 4DGZA 1NUCA 2SOBA 4K6DA 5KGUA 1STBA 4HTHA 5CV8A 1U9RA 2LKVA 1F2MA 3MEHA 2F0QA 3NXWA 2SNSA 3R3OA 2F0MA 2O4XA 4G57A 3T16A 5J39A 1II3A 4IZ8A 4K5WA 5CC4A 5IGGA 5ISRA 3D4WA 4KTAA 1STGA 2PW5A 1SYBA 3PMFA 4ME5A 1SNQA 2WACA 4QF4A 4R8NA 2EY1A 3ERQA 3NK9A 1EYAA 2EYPA 2NUCA 4KHVA 5J1ZA 3U9OA 4F8MA 5KYIA 1JOQA 5IGEA 4LAAA 5I6YA 4KY7A 5IIFA 3SK6A 1ENAA 1EY6A 2F0IA 5IODA 5IGDA 5KEEA 4ZQ3A 2EYJA 5I6WA 3D4DA 5EKLA 4K8IA 4N9TA 4PNYA 1EY9A 2EYLA 3MZ5A 1EZ8A 4RKBA 5I9PA 1TQOA 2F0DA 3NHHA 3QOJA 5E1FA 5EGTA 1STYA 1F2YA 2EYFA 3MHBA 5CV9A 5DAUA 3NUCA 3C1EA 3NP8A 5NUCA 4EQPA 5C4HA 4HMIA 5JAVA 1EY8A 4ODGA 1RKNA 4KY5A 2PYKA 4KD4A 3RUZA 5CV4A 5IOCA 4DFAA 1EZ6A 2F0HA 5C3XA 4J1MA 1KAAA 2F0KA 3D6CA 4K14A 4KJNA 4WORA 5K5PA 2OF1A 1A3TA 1EY7A 4RKLA 5EKKA 3SK8A 4J6HA 4S3SA 1A2TA 2PZWA 1F2ZA 5E3FA 5HURA 2F0UA 2PZTA 3SK5A 5KRUA 3TP8A 1A2UA 2EYOA 2KQ3A 1KABA 3T13A 2ENBA 1A3VA 5C5MA 2RDFA 2F3VA 2KHSA 2OXPA 4NMZA 4OL7A 4IALA 3SK4A 5CV6A 4EVOA 2F0SA 3DHQA 3E5SA 1SYCA 1IHZA 5M9OA
chains in the Genus database with same CATH superfamily
4BY7H 3K8AA 4JV5Q 3VYSA 1H9JA 1FYCA 3TSSA 3HKSA 4K5XA 4FVMA 2LSSA 3Q22A 1PYBA 4GNXB 1EOVA 1ENFA 2L4NA 3OYYA 5C4JB 3BDCA 3CMAA 4JOIA 2R92G 1K8OA 1E0BA 2ZXRA 3KK7A 3MXNB 2JA7G 1L2FA 2F0GA 3T53B 1BBWA 1FGUA 3U50C 4TSSA 1LUZA 2RF4A 3KF8A 1I3QH 1XMQQ 3RN2A 4IFDG 5G3LF 1R9TB 5AFWA 1R9TH 4JI5L 3FPUB 4KY6A 3RZOH 5C4ZA 2JQOA 4A3CH 2OT2A 3OTOL 3L2PA 2X69A 4XDXA 1ONLA 4H44C 4CGYB 1HNXL 2PQAB 5I9OA 1GHKA 5D3DA 4A3JB 4OEMB 2B2WA 3GTMH 3NQTA 2F0WA 4TRDA 3MFYA 2R93B 4BXXG 4DNRB 4BY1G 2EYMA 1S5BD 4MN3A 1KRTA 1S5ED 2ES2A 1X32A 3BZDB 5CV8A 2K7VA 3M7NA 5J39A 1STEA 4GS3A 3A8JE 2WAQE 1V8QA 3NTIA 1BVSA 3G6JB 2HD3A 3VYRA 1LT5D 1YZ6A 1AFPA 1GUGA 4RG1A 1G91A 2K05A 5IODA 2B2VC 1AZQA 4LF6Q 3S1NB 5JPNC 1B3QA 2F52A 1B9NA 5M5WB 2QEXA 1JWMD 1PFSA 2IJ0A 1KHIA 3QG1A 1I6VC 5FLMG 1Q3LA 2D5DA 4XYQA 3I7FA 4PZ8A 4WORA 3R2TA 4DV5L 4HIOA 1OXTA 4G4KA 2HUGA 1PA6A 3ONAB 4DR6L 3HOZH 2VW9A 1N36L 3HOVH 2NVTB 3UDFA 1LTBD 4DAMA 4LF7L 3CPWA 2JK8A 3H0GB 4DV4Q 1DOKA 2F0SA 1PH5A 2KA7A 1I4XA 3UDIA 1HPCA 1ZXTA 2D0OA 2HCCA 1PHJA 2F0TA 1ET6A 5IGDA 1D1IA 5KIXA 4CDDC 1ENCA 3E9HA 1KAWA 3NENA 4KJOA 3G71A 5CYUA 4LF9Q 1QUQB 2JA7B 1TT2A 4KLKA 2Z4IA 1K8AC 1NTGA 4K0KL 5JJLA 4U673 1E7ZA 3L0OA 3PO3H 3OSOA 3X3MA 2OTJA 4CDEC 1PMRA 1KQSA 1MIUA 1R4QB 4BS9A 2JE6I 1KDBA 1MGSA 1KDCA 3PCOB 4DV7L 2B2YA 4QGUA 1SROA 3VYUA 3CPFA 1G6ZA 1TWAB 1N32L 5IYCH 1LTSD 1EY0A 4X3TA 1E22A 1EQVA 1QCBD 5GROA 2NVQH 4A93B 5JVH3 4LFBQ 4A3JG 4BY1B 1RD9D 5JEAG 4A3EG 3GTPB 1E2ZA 4JI4L 1I4PA 2LKVA 4JG2A 1F2MA 1XXGA 1UE1A 4HJ8A 4JI0L 3NXWA 4DV0Q 3ER0A 4G7OC 2MUYA 1PRTB 3GDEA 4R8IA 1PH8A 1ZYRD 4JBJA 1NAPA 3J81j 1QNUA 2AUJD 1F9QA 2WAQB 3A8KE 4EGVA 2EY1A 3MEFA 2Q8RE 4L5QA 1WTHA 4OX9L 4HCEA 4HEDA 4YWLA 4C1NI 3RR5A 1F9SA 4CJ1B 1JT8A 3NEMA 4JBWA 2VQFQ 2HDMA 1SMYD 2BA1A 2WFWA 4XTCS 1EQQA 2N55A 3URYA 3WDNA 1ICWA 4JI8Q 4IFDI 3A5ZB 2A6EC 2KENA 1UWVA 1IBKQ 4ODGA 2EXDA 2WP8J 3KJOA 3HGBA 3GTQH 1EZ6A 3GTMB 2UXCL 1BBUA 4A3MH 4Q5VA 5E3FA 1A8VA 1CKOA 4A3EB 3CRKC 4LF8Q 1O78A 1IKMA 4FF2A 4NPSA 5CV6A 2P5ZX 1V1QA 2I07B 4DAPA 4O1NA 2J0TD 3PO2G 1HFNA 4DU9A 4BBSH 5ELDA 3J80E 1SE8A 1QG7A 3TP7A 3OOCA 5M3MG 3S9WA 4WRDA 3VA7A 4J15A 2NWGA 4PMWA 3BS1A 1X55A 5CGKA 1J5EL 4NKLA 3S1QH 2B63H 3HZXA 4AYBE 2F0EA 4EQ5A 5C44B 3NTHA 1JE4A 1JMCA 4UP8A 2D62A 2GVAA 4LNQA 3NQIA 4XQJA 1WTQA 4P71A 2ZJQA 4Q0FA 2MPMA 1X6OA 2DJFC 1SJED 2F0PA 5IT9L 3FDTA 3GV6A 2H4OA 5FJ8G 3EROA 1PH1A 5IGFA 2PNHA 1CM9A 2A68C 5IGBA 3BDLA 4KK7A 4DR1Q 5LL6X 4IQZA 1HA6A 3KF8B 3MC0B 1I94L 1PTOC 1VS0A 3K0XA 2B2UA 1BCPC 1TS2A 2DN8A 2R3ZA 3A0JA 2X6LA 4KKUA 3LNNA 4O2DA 2UU9Q 3CRLC 2YV5A 2K50A 2JJQA 1PRTF 1SE3A 2R6GA 1CQFA 3K59A 2Z6BA 1SN8A 2A1AA 2XWBB 1NJIC 2DGYA 3IFTA 2ICIA 3WOEA 1RTNA 1EY6A 2GA4B 2K5HA 2JA8G 1MSGA 2CWAA 4JK1C 3J7AF 1H95A 2D9UA 3I72A 4V190 1S5CD 1YIJA 2RSNA 5EGTA 4LF6L 2MO0A 4KD4A 1GUTA 1Q81C 3CU7A 2NZ1D 3KJPA 4A3DG 2A6HD 1SMXA 4J1MA 2PO4A 1A62A 4WJ4A 5A2QE 4AQYL 4A3BG 2XTIA 3D0FA 3SK5A 1G6PA 1DYQA 4QUCA 2CH4A 3RLOA 3BVMA 3ND8A 3S1MH 4POFA 1HNXQ 2B8FA 3HOXH 1RHPA 3I4NG 3EVQA 3A5UA 2EVBA 3MWYW 1D5XC 4LMQD 5LL6S 2M00A 1JJ2A 2AHOB 5J22A 1EYDA 1YJ9A 3HKZE 2JN4A 3M7GA 5C44H 5EQ0A 4C3JG 1JE5A 3TRZA 2JA7H 1DOMA 3F1ZA 2CQOA 1VQBA 1N34Q 4ZYSA 3LX0A 1GHJA 1Q1EA 4I7AA 3F2CA 2N8NA 2CHBD 3OHXC 4HJ7A 4GN3B 4H7BA 1U4MA 4DV6L 5C4XB 2YU9H 4R4OA 1J6QA 1TS4A 3K5LA 2F03A 3PIO3 1X3FA 4M8AA 4A3DH 1YVCA 4QJFA 3A56A 5KNDA 5EPJA 4OX9Q 1MJEA 1Y8OB 1V1PA 4LUOA 3J7A5 1JWUD 2K33A 2ZJPA 5FLXc 5C3EH 5KGUA 1N33Q 1FNWA 2KBNA 3MEHA 5AJ3L 1E24A 2WB1E 1EQRA 2A69D 1JICA 1SBBB 1H9SB 3I73A 4JI0Q 1UE6A 4OIKA 1G2SA 2JA8H 1DGSA 4RMFA 2XWJB 2K52A 1JOQA 1AZPA 1LT4D 1SXTA 1KL9A 4KY7A 2IPKD 3STBD 3BU2A 3KDFB 1WD0A 2NVXB 1KIXA 5FO9B 3HOYG 1GXDC 2N3SA 3NUCA 3Q8DA 1SDFA 3IFDA 1PYSB 2B2WC 1C4QA 3KLRA 1XWEA 1VQ5A 1VQIA 2RCNA 1EY7A 1VQ9A 1RF2D 1EU3A 4BY1H 3H0GG 2EOTA 2KQ3A 1I4HA 3ERSX 4DNTB 1ESFA 4NMZA 1L1OB 5IGCA 2E76C 5M9OA 2EJMA 3PUXA 1B8AA 3VA5A 3S1RB 4GKKL 1JC7A 3KF6A 1LACA 4HCSA 1STNA 2K5VA 3TZUA 5IY0A 2VY3A 1WJJA 2XNAC 3QOLA 3TBIB 1IXRA 3SXHA 4DAYB 4DR3L 2RA4A 1NNXA 1LTRD 3OIPA 2LMCB 4DXGA 4TQUS 1X65A 4GN5A 4HJAA 2Z6KA 1YNXA 3UDGA 1PVOA 1HQRD 2HQEA 2K1BA 2K75A 4ZUJA 1HJPA 2A68D 1X9NA 3R8BA 5E4XA 1JJCB 5D14A 4DK3C 4JVZA 3K6OA 5CV7A 2NVYH 1TWAH 3BJUA 1MSHA 3RNUA 2HIXA 3PQIA 5KEEA 4C1NK 2Y0SE 4LFCL 1EOTA 5IP7G 1GUNA 5C3EG 4MIUA 4F88A 2F0FA 3VR5A 1HZAA 5GQOA 3EIVA 3K7AB 4GOPC 4A93G 1PXUA 2BDNA 2MJ8A 1RIPA 3CCVA 2UXCQ 5K36G 1OO9B 2FFKB 5JEAH 4A3EH 1SE4A 1OXSC 1KRSA 3ZYYX 2E2IB 4DN4M 1EEID 3DWAA 4QF4A 2EPBA 2UXBL 3S1NH 1DM0B 5M3FG 3LWUA 2JA9A 1P16A 1Y1VG 2NZHA 1EIYB 1FD7D 3JAMc 5I9PA 1SRUA 1Q8KA 4DV2Q 1XMOQ 1F77A 4IUVA 3C46A 3NHHA 1XPUA 1Q7YC 2EYFA 1DD2A 2LY7A 5JPMC 1J5EQ 2EDGA 1RKNA 1YBYA 4XQNA 1MI2A 3H0GH 4CDCC 4C3IH 4RKLA 1AN8A 2ZM6L 3D3RA 2QGQA 1MKHA 5C5MA 2LS01 1ZKOA 2NN6G 3I70A 4ZKBB 3OTOQ 4IUQA 4A75A 1XMOL 4B3SQ 1W6JA 4DUZQ 2K5WA 1X3QA 4ZAIA 3TMEA 3GTKB 1TWGH 1SAPA 1CTMA 1G51A 2I5HA 3CW2C 3PUVA 2AQ2B 1JB7A 3S15H 1S40A 1KNAA 4GLXA 2R61A 2MHVA 2F0VA 3BZKA 4EQNA 2ZM6Q 3WWVA 3A54A 4O0AA 1X54A 4C3HB 5KNBA 2KECA 4ME3A 1QUQA 2FMCA 5LHY1 2B63G 3NBIA 4P72A 1HR0Q 1XTCD 2V1CC 4FF1A 1W2BA 1BCPF 3HOWG 4QB4A 3NBHB 2F0NA 1EQTA 2Q2IA 1VQPA 4A3MG 2E2JB 3VR6A 3KF6B 1CHPD 5COYA 3PIPA 3EA6A 2JYOA 4BBRB 2UXDQ 1EY4A 2R7ZG 3DM3A 3FP9A 5BR8L 1TWCH 4F7XA 5C4XH 2I5MX 4XQQA 4C56C 1CKMA 3GTOB 1Y1WH 1MHWC 4AQYQ 2NVTH 3HOVB 5FOBB 4LF5L 2ALYB 4K6DA 1VMCA 2AMCB 2UUAQ 1U9RA 1VQEA 1Q46A 4DK1A 1N32Q 2UXDL 1Y1VH 3NWSA 2K32A 4N8X1 4F87A 3DWQA 5DM63 2EYPA 1S5FD 1SE2A 4F8MA 3MTSA 3Q6SA 5IIFA 3SK6A 3JC66 3MXUA 2VB3X 3AQQA 5C4JH 3J80c 4LFAL 3P20A 4X64L 5I2YA 4PZ7A 3QOJA 4ZKCB 2Z0SA 5E1FA 3J81E 4FNFA 1VQLA 3TS0A 2RSOA 1HXYD 3NELA 2JSOA 1LT6D 2VB2X 4GOPB 3R93A 2JXMB 2XIWA 4KI0A 5K5PA 1O7ZA 4J6HA 1VQ4A 4X3SA 1K28A 2KCCA 2XN9C 4QQBX 2CWPA 5IT9E 3T13A 3E9IA 5IWAQ 2QDLA 1VQOA 4M1UB 2IHEA 1KD1C 1PZKD 4NXMQ 1YI2A 2MO1A 3CCMA 2N78A 4A3JH 1IBKL 1AEXA 4AYBB 4CHTB 1SJHD 3M4QA 3RD4A 3SVMA 3T4AC 2JA6B 3HS0C 4B3TQ 3UI2A 1WTXA 2ID0A 1NBWA 3F2BA 4ALPA 2FINB 2OEOA 2BE5D 1IBLQ 4OIJA 2OWOA 4A3KB 3AYHB 3K80C 3RLNA 1O7LA 3KOJA 1FVIA 1WTWA 1WTOA 2HHHL 3R2IA 2Z4HA 2G5DA 1X3PA 4U68A 1S3OA 1PH7A 2B2YC 2H1EA 1S72A 1G8ZD 4IO9A 2F0LA 3S17H 4XT3B 4JI1L 3UE1A 1BNZA 3RZDH 2FMMA 5ELNA 1B44D 5C0XH 3W3AA 1IYUA 1QILA 1C7YA 1IBLL 4KD3A 3HOWB 5D3IB 5IP9G 1JOOA 1PH3A 2J7ZA 1EEFD 4A3IG 3EN2A 1TWFH 2VUMG 1A3UA 4LFBL 3S2HH 3MXPA 3F2DA 3I3CA 1K83B 4Z9CB 1PTOH 1X3EA 2RDHA 5IT9c 3I56A 4R4CA 2IL8A 4DUYL 3PO2B 1I6HH 1GO3E 1QVFA 2EJFC 4P73A 2HCIA 1GJXA 3FHWA 1NE3A 3AU7A 1L1OA 3S14B 2EIFA 1Q90A 5E7NA 2F0IA 2O5IC 4IPCA 1LTID 1RJTA 4AH6A 4LWCA 4DR5L 2C35B 3N52A 1LTLA 1NY4A 3C1EA 1OXUA 5CV4A 4DFAA 2D0PA 2LFNA 4A3IB 4L8JA 3CCJA 1LTTD 1TIID 4BBRG 1PTOB 3D6CA 5FLXL 2VUMB 1QE6A 1A3TA 3SK8A 1BKBA 4XYOA 5M5YH 3BG3A 2HHHQ 4OWXB 1LO5D 1KABA 2IHFA 5IP9H 4RH6A 2OXPA 4C3IB 4A76A 4RGTA 4EVOA 1TKWB 2FXQA 2YU9B 1K8MA 3NK9A 3I55A 2EY6A 3I4OA 1WOCA 5KYLA 3I2ZA 3HP3A 1LLRD 2SNMA 3WOFA 4DXFA 3C1FA 4KV6A 1JCKB 4WFN3 1CI3M 1CKNB 1I4RA 4A3FG 1I4GA 1D2BA 4A3FB 3P1HA 3M9BA 4NDXA 4IFDJ 2EXZA 3FKIH 4A3LG 1BXTA 2UXBQ 1HRJA 5IYBG 3TP5A 1J9OA 4JI7Q 4JYAQ 2HQLA 3NTKA 3MXGA 2F0JA 2PMZB 1M1KC 3V96A 2DUDA 4HMJA 4RCNA 5C0XG 1Z6HA 1WVLA 1SNDA 3AFQA 1BDOA 3M85A 4G7ZC 4YCVA 1VF7A 2N88A 3BYTB 1S5DD 2CQAA 1SNPA 1X3GA 1K3RA 1BCPD 2VXWA 1L0WA 5F2DA 1P8LA 2B29A 5ELEA 2QKIC 3GQBA 1DOLA 2KEDA 3V2TA 1STAA 5C0XJ 3H3VC 5BR8Q 2M9VA 1SNCA 4LK1C 1EYGA 4BXXH 1T9HA 4ILWA 4HJ9A 2NBFA 4DUZL 3IAYA 2O4XA 1VQNA 1Q86C 2VS1A 2KCTA 1GUSA 4YHHL 1PLFA 2E5LQ 1VQKA 5HY6A 2PW5A 4RAUC 3S1QB 5EAYA 2VL6A 2PI2E 3VYTA 4KHVA 3G48A 5HGQA 5M5WH 1HTPA 4A3CG 2B39A 1VQ7A 1A0IA 2EYJA 4RWSC 3D4DA 4JCVE 2MNAA 1YJWA 1ZEQX 4IJHA 2A6HC 2NTSA 4C3JH 2Z9HA 2Z1CA 4V0BA 3JAML 4DAYA 1TWHB 4KKSA 3K57A 4HMIA 4OWWB 4IPGA 3KBXA 1HCZA 1FL0A 1PRTD 2F0HA 4P75A 1Y8PB 3DEOA 4DV6Q 4GKJL 4A3MB 1A2TA 4UPAA 1N36Q 1Q1BA 3CC2A 3U9SA 2EYOA 4C3IG 1SEBD 1OXXK 1JJGA 5GAHC 4KHZA 3HOXB 1BOSA 1Z9FA 1EFWA 5I2XA 2ZTCA 4K2KA 2PQEA 1JORA 1PYWD 4A3FH 4RGMA 5T1IA 3NE5B 5AJ3Q 4C2MH 5BN5A 1B2TA 5DNFA 4DV0L 3H6MA 3GTLH 4A3LH 2SEBD 1NSNS 1KLGD 1SYEA 4DV3Q 4IN3A 3S14H 1ICFB 1IL8A 2YYZA 4DR7L 3RLFA 5M5XH 4A3KH 4I65A 1CFMA 2GN5A 2IT1A 2Y0SB 4QIWB 4LFAQ 2VQFL 4HAEA 1WD1A 1HZ9A 1QJOA 2EZVA 4ZUIA 2TMPA 4LF4Q 4X65L 2C5CA 1B1ZA 1XNRQ 1SNMA 4JI8L 2HT1A 4DUYQ 1PFMA 4ZCKA 1EYCA 3HOUH 1LTGD 2LXKA 1W3SA 1UUPA 3GTJH 4A3DB 3CQZH 1ESRA 2XVSA 5IYCG 2A69C 3DLLA 1BBXC 4GOPA 5C6AA 4JW0A 2ZTEA 1UE7A 1Y1WG 1CA5A 2I5LX 3K58A 1IL2A 2JA5B 1KLUD 1HNWL 1PFBA 1GUWA 3STBC 4H0LC 4X3UA 3CMEA 2E75C 1TWGB 1T5XD 5KYIA 3HG9A 2F4VQ 3M4OB 1TS5A 1BO0A 1YHBA 2ASBA 1HTLD 3H91A 5EKLA 2KCNA 2MQHA 2NYZD 2B2TA 3TS2A 3H09A 4RKBA 2EYLA 2J4XA 4NB3A 4A3GH 4NXNL 5LMNL 3P7JA 2YTXA 2F4IA 4HSPA 4IPDA 1CQVA 1KAAA 4JI2L 5EKKA 4L6TB 1FR3A 3KFUA 1T5EA 1SLJA 2PZTA 3CC7A 1A2UA 1C0AA 1HHVA 4BBSB 3I4MB 3S2DB 3DHQA 1SYCA 1XNQL 2A74C 4X65Q 4YIJA 3C3LA 3OW7A 1EL0A 1DCZA 4FO2A 3E6ZX 1XPOA 1AE3A 1JOKA 5EBCA 5K36H 2NZOA 1K83H 3AB9A 1B4OA 3TN2A 2K03A 4X62L 4DR3Q 1CT1D 4DR4L 2OQ0A 4LUZA 5G3LD 3PF4A 1XNQQ 4E6IA 5M3FH 2E74C 3KLSA 3D8GA 1Y69U 3FKIB 3BZCA 5BN4A 3HKZB 2CVRA 3L7ZC 1NMFA 4JI7L 1EIFA 4JYAL 3BVGA 2XRSD 4PG3A 3HOUG 5EKIA 1PDQA 1CZWA 1FNUA 1MBYA 3VDYA 5FJ8H 3W2DA 3GTOH 3CCRA 4IURA 2QDBA 4NXNQ 4DF7A 4K2LA 3I4LA 3GTKH 3HOZG 4PV1C 4B9WA 4BBSG 3J81c 3LGJA 3H3VH 1NUCA 1VCIA 2SOBA 2NN6H 4YWMA 1IW7C 2NB0A 4RGNA 5EPLA 3OPOA 2F0MA 1HA5A 2RHSB 5CC4A 5IGGA 4FF3A 1K3BC 1HNZL 1Y1VB 4X3KA 1EUJA 5FO7B 3S1MB 1A6XA 1E3PA 1EYAA 2NUCA 3M4OH 4H02A 5LMUL 1YNJD 1BUVT 3J7YW 3C2PA 4EX5A 2K5DA 4ZQ3A 5CMDA 2AQ1B 4JI3Q 4BA1I 4XXEA 1L0XB 3PO3G 4QCLA 5GAEC 2L5TA 1QB5D 1HNZQ 2KVMA 4YHHQ 2PYKA 1VQJA 2KOLA 3E0JA 3RUZA 1Y8NB 4APVA 5IOCA 2E5LL 5H1SE 3T1HQ 3K0YA 4DV1Q 1AE2A 3N6RA 2F1MA 5C3EB 2VUMH 1MD2D 3CQZB 3J81i 1K9MC 2F0UA 4B08A 2QA4A 3KBGA 1V9PA 1V1OA 4DV3L 4LF7Q 2KHSA 1W6KA 2R7ZH 1A63A 4TVAB 1N9WA 4DR7Q 3VR4A 1SFOB 1QZGA 1PH2A 3B6YA 2KUMA 4UY8C 3NPPA 3I4NH 1CSPA 5GAGC 3PGZA 2L55A 2OQKA 1EY5A 2XSCA 3KYHC 3M3YH 2UUBL 2XGTA 2UUCQ 2JA6G 4C2MB 5DEHA 3S17B 1TU2B 2E2HH 3AMUA 1M4VA 1RL2A 4LW1A 1DONA 3FKIG 4ID6A 1EFID 4DK0A 5CR3A 5IYBH 2H5XA 3QO2A 1HH2P 1FGBD 2PQAA 3HEJA 3SR1A 2X6GA 4BBRH 4DPGA 4FF4A 4DV5Q 1V1PB 4A3BH 2WKDA 1H9MA 4CKBA 5C4XG 1CHQD 4YY3Q 4IPHA 3QR8A 3OWFA 3SHLA 5JJIA 4X66L 2N49A 3HOXG 2BCOA 1SYFA 3DUZA 5FLXE 3DWPA 1FJGL 1H9KA 5IWAL 1VQ6A 4JI4Q 1Y1WB 2DNCA 5D65A 5JEAJ 5M3MB 5LMNQ 4IUUA 4R4QA 4GKJQ 3MAQA 1F2LA 2A5HA 1M90C 4YWKA 3PO2H 1IYJB 4NW2A 1STGA 4ZRZA 1WTVA 2QILA 1YNND 3CAMA 1YHQA 2HIVA 4GNXA 1DJRD 1PZID 2ICEC 4OO1H 1B3AA 2XRQD 5I6WA 1U5KA 4ULLA 3MZ5A 1NMGA 1WI5A 2B2TC 1VMPA 1JQYD 1VQ8A 2CW0D 4C3HH 4HSVA 3FRPB 2CCZA 1F9PA 4A3GB 2VNUD 3Q0AA 2NN6I 4DA2A 3K5NA 2A73B 2UUCL 2Z6KC 4DV4L 3A55A 2MGSA 1VQCA 1M8AA 1TXYA 4KN7C 4H13C 4JV5L 1C8CA 1B9MA 4BY7B 1XYIA 2JA5H 1EIGA 4HIKA 1LV9A 2BE5C 2G9HD 2CH4W 3KLWA 4LUVA 4Y52H 1GOZA 3DMUA 4DR2L 2KEEA 2JA6H 3IL8A 4ABNA 3ITPA 3OIQA 1BF4A 4IOAA 2IY5B 3HOYH 4XIGS 4R4TA 1UAPA 5C3WA 2PW7A 3HKZG 1Z47A 4JI5Q 5DM73 4YCWA 3SE0A 3DEPA 2BDOA 1GUOA 1TR5A 5ELCA 2NVXH 3TP6A 3O13A 2CKZB 3P75A 4XT1B 2DY8A 1DXMA 4JI6L 2IX0A 4IUTA 3PIP3 1WTRA 1WCMB 2EY5A 5I4DA 3E3XA 3CP0A 3LWEA 3SGIA 1PH6A 3EQLC 1CK1A 3JAME 4QMGA 2QF7A 1HFGA 1KC8C 1UEAB 4JPBW 3CD6A 3GTPH 3D6WA 4X6AH 2D2CC 2E2JH 5LMUQ 2K14A 2AWNA 2QEJC 3T56B 3I8ZA 4DK6C 1LTAD 3UDXA 4GN4B 3OMCA 3K7AH 1LM0A 2RCFA 5ELOA 1H9RA 1VQFA 3GD7A 2SNSA 4G57A 4QUFA 3S16H 3CC4A 3IKJA 1CKNA 1YNJC 1BR9A 3S1RH 4UP7A 1D5ZC 4KTAA 1QWYA 4MHEA 4OO1G 3T1HL 4RGOS 1SYBA 1SNQA 2A19A 3FPPA 2WAQG 1HQMC 1WFQA 5L37A 4HIMA 2ZXPA 3J80L 3CCQA 4A3KG 3PUWA 4CJ2C 3K5MA 2IX3A 1B53A 4X62Q 3HOUB 4BA2I 1RTOA 1TWHH 1TWCB 3NP8A 4JI3L 1EY8A 2Y0SG 4B3RL 3OW2A 4UHVA 4DR4Q 2F0KA 1ILPA 1TWFB 3HRZC 1F2ZA 1PZJD 4CDFC 4HJ5A 4ZLTF 4UP9A 3H15A 1D7QA 1H9SA 4OL7A 5BN3A 1PH4A 5CBEE 3HOVG 1VQDA 2Q2HA 1B50A 2E8GA 5DLQE 1XX8A 3GTLB 3I90A 4POGA 4O42A 3I91A 2B2UC 2VQEQ 2ZT9C 1U4RA 3G7LA 3NBHA 4EQOA 4IOCA 5C44G 3E0EA 1PFNA 4YY3L 5C5LA 1E2VA 2MFIA 3PO3B 1RDPD 1VDZA 2UUAL 4X66Q 5KNCA 1WCMH 1WTPA 2Q8TA 2L0CA 4DR6Q 1FJGQ 5EBDA 1B7YB 1R4PB 1QZHA 1QNKA 3KLSX 2JEBI 5FLMH 1LABA 4FYDA 4FP5D 4I7ZC 1Z7TA 2CFMA 2L9HA 2JEAI 2GVBA 1TY0A 2AQ3B 5JVG3 5JJZA 2PMZE 4OONA 4L5TA 3J80i 2R7ZB 1E1TA 1U4LA 1SR3A 2FJ2A 2UU9L 3Q23A 4OHJA 1VQMA 2DY7A 5A2QL 3I4MG 2YTYA 1YNNC 4FXGC 2I46A 2F0QA 1CUKA 3S2HB 4DAVA 5J3BA 5ISRA 4P74A 1VQAA 4RHSA 3MFGA 1AP0A 3PMFA 4OWTB 2WACA 4R8NA 1JB3A 2KHIA 4PQXA 2LXJA 3CF5A 5J1ZA 4UAIA 2E2HB 1N34L 4LAAA 5I6YA 2CW0C 5JJKA 1HR0W 2B63B 1XTDA 1DZ1A 1IZ6A 4KMUC 2RQXA 1PRTC 1ASYA 3HOWH 3A8IE 1EWHA 1EZ8A 1JWSD 1TQOA 3D4RA 2VQEL 1V43A 1HNWQ 3M4YA 1WCMG 5NUCA 1VQGA 4JBKA 3NWTA 4DR2Q 1SSOA 1KTKA 1SMYC 1Q12A 3VR3A 2ATWA 2F3IA 2OF1A 3J7ZC 1EIHA 2PZWA 2A6ED 1AH9A 2ZTDA 1A3VA 4IUPA 3EFXD 5FO8B 4LF5Q 2NVQB 1O80A 1GKHA 1IHZA 1VF5C 1S4ZA 2BA0A 3D31A 1AW7A 4IJLA 3QB3A 1KDAA 3T1YL 4JI6Q 3TDQA 4B3TL 3EJIA 1GD7A 4L5RC 2K28A 4FDBA 1EU4A 2WB1B 5M5XB 3GV3A 1TY2A 1WYDA 2F3WA 3CKIB 2RVLA 5M3MH 2F0OA 2DJGC 2DNEA 4OO1I 2L15A 1CA6A 3F8TA 4GNXC 2EY2A 2JP1A 3HFZB 3RZDB 3G4SA 3TREA 2L1BA 4IUNA 2IWHA 4ZK9B 3CHBD 1O7YA 4FXKC 3Q24A 4A3GG 2WKCA 4JC0A 3X3NA 3GTJB 4TKOB 4NP5A 2RDGA 3SDZA 3MVVA 3J7AV 4JBMA 3GTQB 1RODA 4HN7A 1GM5A 5IE8A 2BH2A 1D1KA 1KNEA 4QIWE 2EYHA 2WV6D 3I4MH 3S2DH 4A93H 3I4NB 3H3VI 4NXML 2AKWB 2K5NA 3ICEA 3ULPA 4A3IH 1HUMA 5HGTA 1HZCA 1MJCA 4DKAC 3U58A 5CBAE 2B3GA 5ELFA 1C48A 3HOZB 1II3A 3U4VA 1PTOD 2ZXOA 4ME5A 3G6EA 2Z8LA 1IBML 2E2IH 3AEVA 3CXCA 1X56A 3CCLA 1CZGA 5IGEA 4A4IA 1J8IA 4L5SA 2M2LA 4K8IA 5E4WC 1LT3D 1QOHA 1CSQA 3KUPA 1E1OA 1STYA 4CKCA 1A15A 4EQPA 2C9OA 1G291 5C4HA 1ILQA 5JAVA 4GLVB 3BDOA 3L9AX 4B3MQ 3W1GA 2VZAA 1IKLA 1I5FA 2SDFA 4LJZC 5C3XA 1K8GA 2R93G 4FXDA 4MZ9A 4RA8A 5KRUA 3PIOA 1I94Q 2KHJA 2ENBA 2RDFA 4A3BB 2YTVA 1I6HB 3E5SA 1I4QA 3IRBA 5EJWA 1EWIA 2B8GA 2QW7A 2I0QA 3JAMi 1GVPA 2QCPX 4K8JA 4WJ3M 4GLAC 2RHQB 4RHRA 1U0LA 4AYBG 4CKEA 2B2VA 1L1OC 1D6EC 3BYYB 1YHAA 2PCFB 1BCPB 5A35A 1Y14B 4JOIC 2IX1A 4KHPL 2K5QA 3MXNA 2R92B 1I3QB 3U4ZA 3DM1A 4DR1L 4OXPA 2PI2A 1JR0D 2AWOA 4R4IA 1SNOA 4C3HG 3A7AB 1OXVA 3FVQA 1D5MC 3K5OA 4X64Q 2O2LD 3CCUA 3OMGA 4G7HC 1IYVA 1KXLA 5ELBA 1ASZA 1EWCA 1IBMQ 5T1GA 1LYLA 2K04A 2Q2UA 2UUBQ 2MP1A 3GO5A 4B3RQ 4K5VA 4LF4L 1IW7D 2AUKA 5CV5A 1XPRA 4WJWA 3T51B 2WINB 2R93H 1XMQL 1TS3A 2EQSA 1SFOH 1PV4A 2G9DA 4RFBA 2KCMA 4R9WA 1NCVA 1QVCA 4DV1L 4BWGB 1HZBA 3V05A 2K6AA 4K5WA 1TVXA 3D4WA 4YCUA 4P2CB 3CCEA 3M3YB 1D8LA 2JA8B 3TQYA 3ERQA 2FHTA 3U9OA 4DV2L 1UEBA 1FNVA 3S24A 3BVZA 3NSWA 1ENAA 1HR0L 2KJXA 3TZDA 5GADC 3RZOB 4N9TA 3TEHB 2NVYB 4PNYA 1XJVA 5DAUA 3PUZA 4CJ0B 3GTGB 2OTLA 3T1YQ 4OGQC 1F9RA 5M5YB 4UDUC 1N33L 2EE1A 5FKAC 4KHPQ 3H94A 3PSIA 3W5OA 4B3SL 3A74A 4S3SA 4HIDA 1ET9A 3RMHA 3W1BA 3DXJC 3QIAA 3TP8A 5CORA 4IALA 3UE0A 3PV0A 1E2WA 4CBVA 5LMNW 3ZJYC 5IYDH 3KDFA 2RBMA 3F2UA 4QY7A 2Q8IB 1Q82C 2PZUA 4MTKA 3AFPA 3ULJA 4DV7Q 1YITA 4B9XA 5C0XI 4QL5A 1K73C 4K0KQ 4BY7G 1OTCA 3RN5A 3PF5A 4L63B 4C3JB 2E2DC 1STHA 1G2TA 4PMBA 2TSSA 1SYDA 3HOYB 3ND9A 4HR7B 2R92H 4Y7NH 2WIIB 1U4PA 4Y7NB 2BOSA 4PMCA 3M4PA 1SYGA 5M3FB 2F4VL 4DNIA 1I50H 3GP7A 4K6LA 5FK9C 4IFDH 1ML0D 2Q2TA 3QJYA 4N8FA 4PZ6A 4LF9L 5JOBA 2PPBC 4N9PA 4GKKQ 3J81L 3L3OC 1K0SA 2L11A 1N8RC 4LFCQ 2RKSA 1NR4A 4JI2Q 3EBEA 4R1JA 3VR2A 2NTTA 4GZYC 1QVGA 3A7LA 1O7IA 3FMCA 5IP7H 4AIMA 4DGZA 1STBA 4HTHA 1PH9A 1BQQT 3S16B 2R7FA 3MA2B 3R3OA 3T16A 3SEBA 5IYDG 5EPKA 2WB1G 2JA5G 4IZ8A 1UNSA 1L0YB 4B3ML 1I50B 1VQHA 2IW3A 1B70B 2K01A 4MNOA 4RCOA 4OELB 1ZYRC 4KKTA 3GTGH 4LF8L 2R7DA 1PTOF 2OCEA 3CCSA 1YJNA 2EJGC 1RCVD 4JI1Q 1EY9A 2ZJRA 3OWEB 2F0DA 1UE5A 4DR5Q 4J8QA 1F2YA 3MHBA 5CV9A 3K81C 2BH8A 2K4KA 1XNRL 3ULLA 2V4DA 4KY5A 3FEWX 4MTNA 2L12A 1K0RA 2PNRC 1YEZA 2A8VA 1C9OA 4K14A 4KJNA 2O5JC 1Q8IA 2HDLA 3QWNA 5HURA 1NR2A 5TSSA 1HUNA 2F3VA 3SK4A 3PUYA 3K7UC 3S15B 4KN4C
chains in the Genus database with same CATH topology
3VYSA 1H9JA 1FYCA 3TSSA 4K5XA 4FVMA 3Q22A 1ENFA 2L4NA 5C4JB 3BDCA 1K8OA 1E0BA 2ZXRA 3KK7A 2F0GA 3T53B 4TSSA 3KF8A 4IFDG 5G3LF 1R9TB 5AFWA 3FPUB 4KY6A 5C4ZA 2OT2A 2X69A 4XDXA 1ONLA 4H44C 4CGYB 5I9OA 1GHKA 5D3DA 4A3JB 2B2WA 3NQTA 2F0WA 4TRDA 3MFYA 2R93B 4DNRB 2EYMA 1S5BD 4MN3A 1S5ED 1X32A 3BZDB 5CV8A 2K7VA 3M7NA 5J39A 1STEA 3A8JE 1V8QA 3NTIA 3G6JB 3VYRA 1LT5D 1AFPA 1GUGA 1G91A 2K05A 5IODA 2B2VC 1AZQA 3S1NB 5JPNC 1B9NA 5M5WB 1JWMD 2IJ0A 3QG1A 1I6VC 1Q3LA 2D5DA 4XYQA 4WORA 3R2TA 1OXTA 4G4KA 2HUGA 3ONAB 2NVTB 1LTBD 3H0GB 1DOKA 2F0SA 2KA7A 1I4XA 1HPCA 1ZXTA 2HCCA 2F0TA 1ET6A 5IGDA 1D1IA 5KIXA 1ENCA 4KJOA 5CYUA 2JA7B 1TT2A 2Z4IA 4U673 3OSOA 3X3MA 1PMRA 1R4QB 4BS9A 2JE6I 1KDBA 1MGSA 1KDCA 2B2YA 3VYUA 1G6ZA 1TWAB 1LTSD 1EY0A 4X3TA 1EQVA 1QCBD 4A93B 5JVH3 4BY1B 1RD9D 5JEAG 3GTPB 1E2ZA 1I4PA 2LKVA 1F2MA 1XXGA 3NXWA 4G7OC 2MUYA 1PRTB 4R8IA 1ZYRD 1NAPA 1QNUA 2AUJD 1F9QA 2WAQB 3A8KE 4EGVA 2EY1A 2Q8RE 4HCEA 4HEDA 4C1NI 1F9SA 4CJ1B 4JBWA 2HDMA 1SMYD 2BA1A 4XTCS 2N55A 3URYA 3WDNA 1ICWA 4IFDI 2A6EC 4ODGA 2WP8J 3HGBA 1EZ6A 3GTMB 4Q5VA 5E3FA 4A3EB 3CRKC 1IKMA 1O78A 4FF2A 5CV6A 2I07B 4DAPA 4O1NA 2J0TD 1HFNA 4DU9A 5ELDA 3J80E 1QG7A 3TP7A 3OOCA 3S9WA 3VA7A 4WRDA 2NWGA 4PMWA 3BS1A 5CGKA 4NKLA 3HZXA 2F0EA 5C44B 3NTHA 1JE4A 2D62A 3NQIA 4XQJA 1WTQA 4Q0FA 2MPMA 1SJED 2F0PA 5IT9L 3FDTA 3GV6A 2H4OA 3EROA 5IGFA 1CM9A 2A68C 5IGBA 3BDLA 4KK7A 5LL6X 4IQZA 1HA6A 3MC0B 1PTOC 2B2UA 1BCPC 1TS2A 2DN8A 2R3ZA 2X6LA 4KKUA 3LNNA 3CRLC 1PRTF 1SE3A 2R6GA 1CQFA 3K59A 2XWBB 3IFTA 2ICIA 3WOEA 1RTNA 1EY6A 2GA4B 1MSGA 4JK1C 3J7AF 2D9UA 3I72A 4V190 1S5CD 2RSNA 5EGTA 4KD4A 1GUTA 3CU7A 2NZ1D 2A6HD 4J1MA 2PO4A 5A2QE 3SK5A 1DYQA 4QUCA 3BVMA 3ND8A 2B8FA 1RHPA 3EVQA 2EVBA 3MWYW 1D5XC 4LMQD 5LL6S 2M00A 5J22A 1EYDA 3M7GA 5EQ0A 4C3JG 1DOMA 4ZYSA 3LX0A 1GHJA 1Q1EA 2CHBD 3OHXC 4H7BA 1U4MA 5C4XB 1TS4A 3K5LA 2F03A 3PIO3 4M8AA 3A56A 5KNDA 5EPJA 1Y8OB 1V1PA 1JWUD 2K33A 5KGUA 1FNWA 3MEHA 2A69D 1JICA 1SBBB 1H9SB 3I73A 4OIKA 1G2SA 2XWJB 1JOQA 1AZPA 1LT4D 1SXTA 4KY7A 2IPKD 1WD0A 2NVXB 5FO9B 1GXDC 3NUCA 1SDFA 3IFDA 2B2WC 1C4QA 3KLRA 1XWEA 1EY7A 1RF2D 1EU3A 2EOTA 2KQ3A 1I4HA 4DNTB 1ESFA 4NMZA 5IGCA 2E76C 5M9OA 2EJMA 3PUXA 3VA5A 3S1RB 1JC7A 1LACA 4HCSA 1STNA 3TZUA 2XNAC 3QOLA 3TBIB 3SXHA 2RA4A 1LTRD 3OIPA 2LMCB 4DXGA 4TQUS 1HQRD 2HQEA 2K1BA 4ZUJA 2A68D 3R8BA 5E4XA 5D14A 3K6OA 5CV7A 1MSHA 5KEEA 4C1NK 1EOTA 1GUNA 4MIUA 4F88A 2F0FA 3VR5A 3K7AB 1PXUA 2BDNA 2MJ8A 5K36G 1OO9B 2FFKB 5JEAH 1SE4A 1OXSC 3ZYYX 2E2IB 4DN4M 1EEID 3DWAA 4QF4A 2EPBA 1DM0B 3LWUA 1FD7D 5I9PA 1F77A 4IUVA 3C46A 3NHHA 2EYFA 1DD2A 2LY7A 5JPMC 2EDGA 1RKNA 4XQNA 1MI2A 4RKLA 1AN8A 3D3RA 5C5MA 2LS01 1ZKOA 2NN6G 3I70A 4ZKBB 4IUQA 1W6JA 2K5WA 1X3QA 4ZAIA 3TMEA 3GTKB 1SAPA 1CTMA 3PUVA 2AQ2B 1KNAA 2R61A 2MHVA 2F0VA 4EQNA 3A54A 4C3HB 5KNBA 2KECA 2FMCA 5LHY1 3NBIA 1XTCD 4FF1A 1BCPF 4QB4A 2F0NA 1EQTA 2E2JB 3VR6A 1CHPD 5COYA 3EA6A 2JYOA 4BBRB 1EY4A 4F7XA 4XQQA 4C56C 3GTOB 3HOVB 5FOBB 4K6DA 1VMCA 1U9RA 4DK1A 3NWSA 2K32A 4F87A 3DWQA 5DM63 2EYPA 1S5FD 1SE2A 4F8MA 3MTSA 3Q6SA 5IIFA 3SK6A 3MXUA 2VB3X 3P20A 5I2YA 3QOJA 4ZKCB 5E1FA 3J81E 4FNFA 2RSOA 1HXYD 2JSOA 1LT6D 2VB2X 3R93A 2JXMB 2XIWA 4KI0A 5K5PA 1O7ZA 4J6HA 4X3SA 2KCCA 2XN9C 5IT9E 3T13A 4M1UB 1PZKD 1AEXA 4AYBB 4CHTB 1SJHD 3RD4A 3SVMA 3T4AC 2JA6B 3HS0C 1WTXA 3UI2A 2ID0A 2FINB 2OEOA 2BE5D 4OIJA 4A3KB 1O7LA 1WTWA 1WTOA 3R2IA 2Z4HA 4U68A 1X3PA 2B2YC 2H1EA 1G8ZD 2F0LA 4XT3B 1BNZA 2FMMA 1B44D 5C0XH 3W3AA 1IYUA 1QILA 3HOWB 4KD3A 5D3IB 1JOOA 2J7ZA 1EEFD 1A3UA 3MXPA 3I3CA 1K83B 4Z9CB 1PTOH 2RDHA 2IL8A 3PO2B 2EJFC 2HCIA 1GJXA 3AU7A 3S14B 1Q90A 2F0IA 2O5IC 1LTID 1RJTA 3N52A 3C1EA 1OXUA 5CV4A 4DFAA 2LFNA 4A3IB 4L8JA 1LTTD 1TIID 1PTOB 3D6CA 5FLXL 2VUMB 1QE6A 1A3TA 3SK8A 4XYOA 3BG3A 1LO5D 1KABA 4RH6A 2OXPA 4C3IB 4RGTA 4EVOA 1TKWB 2YU9B 1K8MA 3NK9A 2EY6A 5KYLA 3HP3A 1LLRD 2SNMA 3WOFA 4DXFA 3C1FA 4KV6A 1JCKB 4WFN3 1CI3M 1I4RA 1I4GA 1D2BA 4A3FB 3P1HA 4NDXA 4IFDJ 2EXZA 1BXTA 1HRJA 3TP5A 1J9OA 3NTKA 3MXGA 2F0JA 2PMZB 3V96A 4HMJA 4RCNA 5C0XG 1Z6HA 1WVLA 1SNDA 1BDOA 3M85A 4G7ZC 1VF7A 2N88A 3BYTB 1S5DD 2CQAA 1SNPA 1BCPD 2VXWA 5F2DA 5ELEA 2QKIC 3GQBA 1DOLA 2KEDA 3V2TA 1STAA 5C0XJ 3H3VC 2M9VA 1SNCA 4LK1C 4ILWA 2NBFA 3IAYA 2O4XA 1GUSA 1PLFA 2PW5A 4RAUC 3S1QB 3VYTA 4KHVA 1HTPA 2B39A 4RWSC 2EYJA 3D4DA 1ZEQX 2A6HC 2NTSA 2Z1CA 4V0BA 3JAML 4DAYA 1TWHB 4KKSA 3K57A 4HMIA 3KBXA 1HCZA 1PRTD 2F0HA 1Y8PB 3DEOA 4A3MB 1A2TA 1Q1BA 3U9SA 2EYOA 4C3IG 1SEBD 1OXXK 4KHZA 3HOXB 1BOSA 5I2XA 4K2KA 2PQEA 1JORA 1PYWD 4RGMA 5T1IA 3NE5B 1B2TA 5BN5A 5DNFA 3H6MA 2SEBD 1NSNS 1KLGD 1SYEA 4IN3A 2YYZA 1IL8A 3RLFA 4I65A 1CFMA 4QIWB 2IT1A 2Y0SB 1WD1A 4HAEA 1QJOA 2EZVA 4ZUIA 2TMPA 2C5CA 1B1ZA 1SNMA 1PFMA 1EYCA 1LTGD 1UUPA 4A3DB 1ESRA 2XVSA 2A69C 1BBXC 5C6AA 1CA5A 3K58A 2JA5B 1KLUD 1PFBA 1GUWA 4H0LC 4X3UA 2E75C 1TWGB 1T5XD 5KYIA 3HG9A 3M4OB 1TS5A 1BO0A 1HTLD 3H91A 5EKLA 2KCNA 2NYZD 2B2TA 3H09A 4RKBA 2EYLA 2J4XA 3P7JA 2F4IA 4HSPA 1CQVA 1KAAA 5EKKA 4L6TB 1FR3A 1T5EA 2PZTA 1A2UA 1HHVA 4BBSB 3I4MB 3S2DB 3DHQA 1SYCA 2A74C 4YIJA 3C3LA 3OW7A 1EL0A 1DCZA 4FO2A 3E6ZX 1JOKA 5EBCA 5K36H 3AB9A 1B4OA 3TN2A 2K03A 1CT1D 5G3LD 4E6IA 2E74C 3KLSA 3D8GA 1Y69U 3FKIB 5BN4A 3HKZB 2CVRA 3L7ZC 3BVGA 2XRSD 5EKIA 1PDQA 1CZWA 1FNUA 1MBYA 3W2DA 4IURA 2QDBA 4DF7A 4K2LA 3I4LA 4PV1C 4B9WA 1NUCA 1VCIA 2SOBA 2NN6H 1IW7C 2NB0A 4RGNA 5EPLA 3OPOA 2F0MA 1HA5A 5CC4A 5IGGA 4FF3A 1Y1VB 4X3KA 3S1MB 5FO7B 1A6XA 1EYAA 2NUCA 1YNJD 1BUVT 3J7YW 3C2PA 2K5DA 4ZQ3A 5CMDA 2AQ1B 4BA1I 4XXEA 1L0XB 4QCLA 2L5TA 1QB5D 2KVMA 2PYKA 2KOLA 3E0JA 3RUZA 5IOCA 1Y8NB 3K0YA 3N6RA 2F1MA 5C3EB 1MD2D 3CQZB 2F0UA 4B08A 3KBGA 1V1OA 2KHSA 1W6KA 3VR4A 1SFOB 2KUMA 3NPPA 2L55A 1EY5A 2XSCA 4C2MB 5DEHA 3S17B 1TU2B 3AMUA 1M4VA 1DONA 4ID6A 1EFID 4DK0A 5CR3A 3QO2A 1FGBD 3HEJA 3SR1A 2X6GA 4FF4A 1V1PB 2WKDA 1H9MA 4CKBA 1CHQD 3OWFA 3SHLA 2BCOA 1SYFA 3DUZA 5FLXE 3DWPA 1H9KA 1Y1WB 2DNCA 5D65A 5JEAJ 5M3MB 4IUUA 3MAQA 1F2LA 2A5HA 4NW2A 1STGA 4ZRZA 1WTVA 2QILA 1YNND 1DJRD 1PZID 2ICEC 4OO1H 1B3AA 2XRQD 5I6WA 4ULLA 3MZ5A 2B2TC 1VMPA 1JQYD 2CW0D 4HSVA 3FRPB 1F9PA 4A3GB 2VNUD 3Q0AA 2NN6I 4DA2A 3K5NA 2A73B 3A55A 2MGSA 1M8AA 4KN7C 4H13C 1C8CA 1B9MA 4BY7B 1XYIA 1EIGA 1LV9A 2BE5C 2G9HD 1GOZA 3DMUA 2KEEA 3IL8A 4ABNA 3ITPA 3OIQA 1BF4A 4XIGS 1UAPA 5C3WA 2PW7A 1Z47A 5DM73 3SE0A 3DEPA 2BDOA 1GUOA 1TR5A 5ELCA 3TP6A 3O13A 3P75A 4XT1B 2DY8A 1DXMA 2IX0A 4IUTA 3PIP3 1WTRA 1WCMB 2EY5A 5I4DA 3LWEA 3EQLC 1CK1A 3JAME 4QMGA 2QF7A 1HFGA 1UEAB 3D6WA 2D2CC 2AWNA 2QEJC 3T56B 3I8ZA 1LTAD 3OMCA 1H9RA 3GD7A 2SNSA 4G57A 4QUFA 3IKJA 1YNJC 1BR9A 1D5ZC 4KTAA 1QWYA 4MHEA 4OO1G 4RGOS 1SYBA 1SNQA 3FPPA 1HQMC 2ZXPA 3J80L 3PUWA 4CJ2C 3K5MA 2IX3A 1B53A 3HOUB 4BA2I 1RTOA 1TWCB 3NP8A 1EY8A 2F0KA 1ILPA 1TWFB 3HRZC 1F2ZA 1PZJD 4ZLTF 1H9SA 4OL7A 5BN3A 5CBEE 1B50A 3GTLB 1XX8A 3I90A 4O42A 3I91A 2B2UC 2ZT9C 1U4RA 3G7LA 3NBHA 4EQOA 1PFNA 5C5LA 1E2VA 3PO3B 1RDPD 1VDZA 5KNCA 1WTPA 2Q8TA 2L0CA 5EBDA 1R4PB 1QNKA 2JEBI 3KLSX 1LABA 4FYDA 4FP5D 4I7ZC 1Z7TA 2L9HA 2JEAI 1TY0A 2AQ3B 5JVG3 5JJZA 2R7ZB 1U4LA 2FJ2A 3Q23A 4OHJA 2DY7A 5A2QL 1YNNC 4FXGC 2I46A 2F0QA 3S2HB 4DAVA 5ISRA 4RHSA 3MFGA 1AP0A 3PMFA 2WACA 4R8NA 1JB3A 4PQXA 5J1ZA 4UAIA 2E2HB 4LAAA 5I6YA 2CW0C 2B63B 1DZ1A 4KMUC 2RQXA 1PRTC 3A8IE 1EWHA 1EZ8A 1JWSD 1TQOA 3D4RA 1V43A 3M4YA 5NUCA 3NWTA 1SSOA 1KTKA 1SMYC 1Q12A 3VR3A 2OF1A 1EIHA 2PZWA 2A6ED 1A3VA 4IUPA 3EFXD 5FO8B 2NVQB 1O80A 1IHZA 1VF5C 1S4ZA 2BA0A 3D31A 1AW7A 3QB3A 1KDAA 3TDQA 3EJIA 2K28A 1EU4A 2WB1B 5M5XB 3GV3A 1TY2A 2F3WA 3CKIB 2RVLA 2F0OA 2DNEA 4OO1I 1CA6A 2EY2A 2JP1A 3RZDB 2L1BA 4IUNA 2IWHA 4ZK9B 3CHBD 1O7YA 4FXKC 3Q24A 2WKCA 3X3NA 3GTJB 4TKOB 4NP5A 2RDGA 3SDZA 3MVVA 3J7AV 3GTQB 1RODA 4HN7A 1D1KA 1KNEA 2EYHA 2WV6D 3I4NB 1HUMA 5HGTA 5CBAE 5ELFA 1C48A 3HOZB 1II3A 1PTOD 2ZXOA 4ME5A 2Z8LA 1CZGA 5IGEA 1J8IA 2M2LA 4K8IA 5E4WC 1LT3D 1QOHA 3KUPA 1STYA 4CKCA 1A15A 4EQPA 2C9OA 1G291 5C4HA 1ILQA 5JAVA 3BDOA 3L9AX 1IKLA 2SDFA 5C3XA 4LJZC 4FXDA 4RA8A 5KRUA 2ENBA 2RDFA 4A3BB 1I6HB 3E5SA 1I4QA 5EJWA 2B8GA 2QCPX 4K8JA 4RHRA 4CKEA 2B2VA 1D6EC 3BYYB 2PCFB 1BCPB 5A35A 2IX1A 2K5QA 3MXNA 2R92B 1I3QB 3DM1A 1JR0D 2AWOA 1SNOA 4C3HG 3A7AB 1OXVA 3FVQA 1D5MC 3K5OA 2O2LD 3OMGA 4G7HC 1IYVA 5ELBA 1EWCA 5T1GA 2K04A 2MP1A 3GO5A 4K5VA 1IW7D 2AUKA 5CV5A 4WJWA 3T51B 2WINB 1TS3A 2G9DA 4RFBA 4R9WA 1NCVA 4BWGB 3V05A 2K6AA 4K5WA 1TVXA 3D4WA 4P2CB 3M3YB 2JA8B 3ERQA 2FHTA 3U9OA 1FNVA 3BVZA 3NSWA 1ENAA 2KJXA 3TZDA 3RZOB 4N9TA 2NVYB 4PNYA 5DAUA 3PUZA 4CJ0B 3GTGB 4OGQC 1F9RA 5M5YB 4UDUC 2EE1A 5FKAC 3H94A 4S3SA 1ET9A 3RMHA 3DXJC 3QIAA 3TP8A 5CORA 4IALA 3PV0A 1E2WA 4CBVA 2RBMA 3F2UA 2Q8IB 2PZUA 4B9XA 5C0XI 4L63B 4C3JB 2E2DC 1STHA 1G2TA 4PMBA 2TSSA 1SYDA 3HOYB 3ND9A 4HR7B 2WIIB 1U4PA 4Y7NB 2BOSA 4PMCA 1SYGA 5M3FB 3GP7A 4K6LA 5FK9C 4IFDH 1ML0D 3QJYA 5JOBA 2PPBC 4N9PA 3J81L 3L3OC 2L11A 2RKSA 1NR4A 3VR2A 2NTTA 4GZYC 3A7LA 3FMCA 4DGZA 1STBA 4HTHA 1BQQT 3S16B 3MA2B 3R3OA 3T16A 3SEBA 5EPKA 4IZ8A 1UNSA 1L0YB 1I50B 2IW3A 2K01A 4RCOA 1ZYRC 4KKTA 1PTOF 2EJGC 1RCVD 1EY9A 3OWEB 2F0DA 4J8QA 1F2YA 3MHBA 5CV9A 2V4DA 4KY5A 3FEWX 2L12A 2PNRC 4K14A 4KJNA 2O5JC 1Q8IA 2HDLA 3QWNA 5HURA 1NR2A 5TSSA 1HUNA 2F3VA 3SK4A 3PUYA 3S15B 4KN4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY6 A;  3TME A;  5KYL A;  2RBM A;  4YIJ A;  3EVQ A;  3QB3 A;  1KDA A;  1AEX A;  2F0T A;  2PQE A;  2PZU A;  4K2K A;  4K8J A;  4K5X A;  3VA5 A;  4DU9 A;  4B9X A;  5KIX A;  1JOR A;  5IGC A;  2SNM A;  1ENC A;  3DMU A;  1STN A;  3C1F A;  4KJO A;  3BDC A;  4KV6 A;  3TP7 A;  1JOK A;  2M00 A;  3EJI A;  4WRD A;  3S9W A;  3H6M A;  2F0V A;  3QOL A;  4EQN A;  4EQO A;  1EY5 A;  1TT2 A;  1STH A;  1NSN S;  3SXH A;  5J22 A;  3ITP A;  2OEO A;  4PMB A;  1EYD A;  5CGK A;  4NKL A;  3P1H A;  2F0G A;  1SYE A;  2F3W A;  1SYD A;  5C5L A;  4NDX A;  3HZX A;  2F0O A;  2F0E A;  2EXZ A;  5DEH A;  3OSO A;  5C3W A;  2PW7 A;  4E6I A;  2EY2 A;  3TP5 A;  4PMC A;  1SYG A;  1SNO A;  3LX0 A;  3D8G A;  4KY6 A;  2F0J A;  1TR5 A;  2HQE A;  4ID6 A;  3TP6 A;  5C4Z A;  1KDB A;  4I65 A;  5CR3 A;  3P75 A;  4IUN A;  2F0L A;  4HMJ A;  1KDC A;  4ZUJ A;  3OMG A;  3HEJ A;  4QB4 A;  1SND A;  3SR1 A;  4ZUI A;  2F0N A;  2EY5 A;  4H7B A;  2F0P A;  4NP5 A;  5CV7 A;  1SNM A;  5JOB A;  4N9P A;  3MVV A;  5I9O A;  1SNP A;  3ERO A;  4KD3 A;  4QMG A;  5IGF A;  4K5V A;  1EYC A;  5IGB A;  1JOO A;  1EY4 A;  3NQT A;  1EY0 A;  3BDL A;  2F0W A;  1EQV A;  2RKS A;  3OWF A;  4TRD A;  5CV5 A;  5F2D A;  3SHL A;  4F7X A;  2EYH A;  4MIU A;  3V2T A;  2F0F A;  1A3U A;  2QDB A;  4DF7 A;  4K2L A;  1STA A;  1SYF A;  3MXP A;  5C6A A;  3OMC A;  5HGT A;  4B9W A;  2EYM A;  1SNC A;  4DGZ A;  1NUC A;  2SOB A;  4K6D A;  5KGU A;  1STB A;  4HTH A;  5CV8 A;  1U9R A;  2LKV A;  1F2M A;  3MEH A;  2F0Q A;  3NXW A;  2SNS A;  3R3O A;  2F0M A;  2O4X A;  4G57 A;  3T16 A;  5J39 A;  1II3 A;  4IZ8 A;  4K5W A;  5CC4 A;  5IGG A;  5ISR A;  3D4W A;  4KTA A;  1STG A;  2PW5 A;  1SYB A;  3PMF A;  4ME5 A;  1SNQ A;  2WAC A;  4QF4 A;  4R8N A;  2EY1 A;  3ERQ A;  3NK9 A;  1EYA A;  2EYP A;  2NUC A;  4KHV A;  5J1Z A;  3U9O A;  4F8M A;  5KYI A;  1JOQ A;  5IGE A;  4LAA A;  5I6Y A;  4KY7 A;  5IIF A;  3SK6 A;  1ENA A;  1EY6 A;  2F0I A;  5IOD A;  5IGD A;  5KEE A;  4ZQ3 A;  2EYJ A;  5I6W A;  3D4D A;  5EKL A;  4K8I A;  4N9T A;  4PNY A;  1EY9 A;  2EYL A;  3MZ5 A;  1EZ8 A;  4RKB A;  5I9P A;  1TQO A;  2F0D A;  3NHH A;  3QOJ A;  5E1F A;  5EGT A;  1STY A;  1F2Y A;  2EYF A;  3MHB A;  5CV9 A;  5DAU A;  3NUC A;  3C1E A;  3NP8 A;  5NUC A;  4EQP A;  5C4H A;  4HMI A;  5JAV A;  1EY8 A;  4ODG A;  1RKN A;  4KY5 A;  2PYK A;  4KD4 A;  3RUZ A;  5CV4 A;  5IOC A;  4DFA A;  1EZ6 A;  2F0H A;  5C3X A;  4J1M A;  1KAA A;  2F0K A;  3D6C A;  4K14 A;  4KJN A;  4WOR A;  5K5P A;  2OF1 A;  1A3T A;  1EY7 A;  4RKL A;  5EKK A;  3SK8 A;  4J6H A;  4S3S A;  1A2T A;  2PZW A;  1F2Z A;  5E3F A;  5HUR A;  2F0U A;  2PZT A;  3SK5 A;  5KRU A;  3TP8 A;  1A2U A;  2EYO A;  2KQ3 A;  1KAB A;  3T13 A;  2ENB A;  1A3V A;  5C5M A;  2RDF A;  2F3V A;  2KHS A;  2OXP A;  4NMZ A;  4OL7 A;  4IAL A;  3SK4 A;  5CV6 A;  4EVO A;  2F0S A;  3DHQ A;  3E5S A;  1SYC A;  1IHZ A;  5M9O A; 
#chains in the Genus database with same CATH topology
 4BY7 H;  3K8A A;  4JV5 Q;  3VYS A;  1H9J A;  1FYC A;  3TSS A;  3HKS A;  4K5X A;  4FVM A;  2LSS A;  3Q22 A;  1PYB A;  4GNX B;  1EOV A;  1ENF A;  2L4N A;  3OYY A;  5C4J B;  3BDC A;  3CMA A;  4JOI A;  2R92 G;  1K8O A;  1E0B A;  2ZXR A;  3KK7 A;  3MXN B;  2JA7 G;  1L2F A;  2F0G A;  3T53 B;  1BBW A;  1FGU A;  3U50 C;  4TSS A;  1LUZ A;  2RF4 A;  3KF8 A;  1I3Q H;  1XMQ Q;  3RN2 A;  4IFD G;  5G3L F;  1R9T B;  5AFW A;  1R9T H;  4JI5 L;  3FPU B;  4KY6 A;  3RZO H;  5C4Z A;  2JQO A;  4A3C H;  2OT2 A;  3OTO L;  3L2P A;  2X69 A;  4XDX A;  1ONL A;  4H44 C;  4CGY B;  1HNX L;  2PQA B;  5I9O A;  1GHK A;  5D3D A;  4A3J B;  4OEM B;  2B2W A;  3GTM H;  3NQT A;  2F0W A;  4TRD A;  3MFY A;  2R93 B;  4BXX G;  4DNR B;  4BY1 G;  2EYM A;  1S5B D;  4MN3 A;  1KRT A;  1S5E D;  2ES2 A;  1X32 A;  3BZD B;  5CV8 A;  2K7V A;  3M7N A;  5J39 A;  1STE A;  4GS3 A;  3A8J E;  2WAQ E;  1V8Q A;  3NTI A;  1BVS A;  3G6J B;  2HD3 A;  3VYR A;  1LT5 D;  1YZ6 A;  1AFP A;  1GUG A;  4RG1 A;  1G91 A;  2K05 A;  5IOD A;  2B2V C;  1AZQ A;  4LF6 Q;  3S1N B;  5JPN C;  1B3Q A;  2F52 A;  1B9N A;  5M5W B;  2QEX A;  1JWM D;  1PFS A;  2IJ0 A;  1KHI A;  3QG1 A;  1I6V C;  5FLM G;  1Q3L A;  2D5D A;  4XYQ A;  3I7F A;  4PZ8 A;  4WOR A;  3R2T A;  4DV5 L;  4HIO A;  1OXT A;  4G4K A;  2HUG A;  1PA6 A;  3ONA B;  4DR6 L;  3HOZ H;  2VW9 A;  1N36 L;  3HOV H;  2NVT B;  3UDF A;  1LTB D;  4DAM A;  4LF7 L;  3CPW A;  2JK8 A;  3H0G B;  4DV4 Q;  1DOK A;  2F0S A;  1PH5 A;  2KA7 A;  1I4X A;  3UDI A;  1HPC A;  1ZXT A;  2D0O A;  2HCC A;  1PHJ A;  2F0T A;  1ET6 A;  5IGD A;  1D1I A;  5KIX A;  4CDD C;  1ENC A;  3E9H A;  1KAW A;  3NEN A;  4KJO A;  3G71 A;  5CYU A;  4LF9 Q;  1QUQ B;  2JA7 B;  1TT2 A;  4KLK A;  2Z4I A;  1K8A C;  1NTG A;  4K0K L;  5JJL A;  4U67 3;  1E7Z A;  3L0O A;  3PO3 H;  3OSO A;  3X3M A;  2OTJ A;  4CDE C;  1PMR A;  1KQS A;  1MIU A;  1R4Q B;  4BS9 A;  2JE6 I;  1KDB A;  1MGS A;  1KDC A;  3PCO B;  4DV7 L;  2B2Y A;  4QGU A;  1SRO A;  3VYU A;  3CPF A;  1G6Z A;  1TWA B;  1N32 L;  5IYC H;  1LTS D;  1EY0 A;  4X3T A;  1E22 A;  1EQV A;  1QCB D;  5GRO A;  2NVQ H;  4A93 B;  5JVH 3;  4LFB Q;  4A3J G;  4BY1 B;  1RD9 D;  5JEA G;  4A3E G;  3GTP B;  1E2Z A;  4JI4 L;  1I4P A;  2LKV A;  4JG2 A;  1F2M A;  1XXG A;  1UE1 A;  4HJ8 A;  4JI0 L;  3NXW A;  4DV0 Q;  3ER0 A;  4G7O C;  2MUY A;  1PRT B;  3GDE A;  4R8I A;  1PH8 A;  1ZYR D;  4JBJ A;  1NAP A;  3J81 j;  1QNU A;  2AUJ D;  1F9Q A;  2WAQ B;  3A8K E;  4EGV A;  2EY1 A;  3MEF A;  2Q8R E;  4L5Q A;  1WTH A;  4OX9 L;  4HCE A;  4HED A;  4YWL A;  4C1N I;  3RR5 A;  1F9S A;  4CJ1 B;  1JT8 A;  3NEM A;  4JBW A;  2VQF Q;  2HDM A;  1SMY D;  2BA1 A;  2WFW A;  4XTC S;  1EQQ A;  2N55 A;  3URY A;  3WDN A;  1ICW A;  4JI8 Q;  4IFD I;  3A5Z B;  2A6E C;  2KEN A;  1UWV A;  1IBK Q;  4ODG A;  2EXD A;  2WP8 J;  3KJO A;  3HGB A;  3GTQ H;  1EZ6 A;  3GTM B;  2UXC L;  1BBU A;  4A3M H;  4Q5V A;  5E3F A;  1A8V A;  1CKO A;  4A3E B;  3CRK C;  4LF8 Q;  1O78 A;  1IKM A;  4FF2 A;  4NPS A;  5CV6 A;  2P5Z X;  1V1Q A;  2I07 B;  4DAP A;  4O1N A;  2J0T D;  3PO2 G;  1HFN A;  4DU9 A;  4BBS H;  5ELD A;  3J80 E;  1SE8 A;  1QG7 A;  3TP7 A;  3OOC A;  5M3M G;  3S9W A;  4WRD A;  3VA7 A;  4J15 A;  2NWG A;  4PMW A;  3BS1 A;  1X55 A;  5CGK A;  1J5E L;  4NKL A;  3S1Q H;  2B63 H;  3HZX A;  4AYB E;  2F0E A;  4EQ5 A;  5C44 B;  3NTH A;  1JE4 A;  1JMC A;  4UP8 A;  2D62 A;  2GVA A;  4LNQ A;  3NQI A;  4XQJ A;  1WTQ A;  4P71 A;  2ZJQ A;  4Q0F A;  2MPM A;  1X6O A;  2DJF C;  1SJE D;  2F0P A;  5IT9 L;  3FDT A;  3GV6 A;  2H4O A;  5FJ8 G;  3ERO A;  1PH1 A;  5IGF A;  2PNH A;  1CM9 A;  2A68 C;  5IGB A;  3BDL A;  4KK7 A;  4DR1 Q;  5LL6 X;  4IQZ A;  1HA6 A;  3KF8 B;  3MC0 B;  1I94 L;  1PTO C;  1VS0 A;  3K0X A;  2B2U A;  1BCP C;  1TS2 A;  2DN8 A;  2R3Z A;  3A0J A;  2X6L A;  4KKU A;  3LNN A;  4O2D A;  2UU9 Q;  3CRL C;  2YV5 A;  2K50 A;  2JJQ A;  1PRT F;  1SE3 A;  2R6G A;  1CQF A;  3K59 A;  2Z6B A;  1SN8 A;  2A1A A;  2XWB B;  1NJI C;  2DGY A;  3IFT A;  2ICI A;  3WOE A;  1RTN A;  1EY6 A;  2GA4 B;  2K5H A;  2JA8 G;  1MSG A;  2CWA A;  4JK1 C;  3J7A F;  1H95 A;  2D9U A;  3I72 A;  4V19 0;  1S5C D;  1YIJ A;  2RSN A;  5EGT A;  4LF6 L;  2MO0 A;  4KD4 A;  1GUT A;  1Q81 C;  3CU7 A;  2NZ1 D;  3KJP A;  4A3D G;  2A6H D;  1SMX A;  4J1M A;  2PO4 A;  1A62 A;  4WJ4 A;  5A2Q E;  4AQY L;  4A3B G;  2XTI A;  3D0F A;  3SK5 A;  1G6P A;  1DYQ A;  4QUC A;  2CH4 A;  3RLO A;  3BVM A;  3ND8 A;  3S1M H;  4POF A;  1HNX Q;  2B8F A;  3HOX H;  1RHP A;  3I4N G;  3EVQ A;  3A5U A;  2EVB A;  3MWY W;  1D5X C;  4LMQ D;  5LL6 S;  2M00 A;  1JJ2 A;  2AHO B;  5J22 A;  1EYD A;  1YJ9 A;  3HKZ E;  2JN4 A;  3M7G A;  5C44 H;  5EQ0 A;  4C3J G;  1JE5 A;  3TRZ A;  2JA7 H;  1DOM A;  3F1Z A;  2CQO A;  1VQB A;  1N34 Q;  4ZYS A;  3LX0 A;  1GHJ A;  1Q1E A;  4I7A A;  3F2C A;  2N8N A;  2CHB D;  3OHX C;  4HJ7 A;  4GN3 B;  4H7B A;  1U4M A;  4DV6 L;  5C4X B;  2YU9 H;  4R4O A;  1J6Q A;  1TS4 A;  3K5L A;  2F03 A;  3PIO 3;  1X3F A;  4M8A A;  4A3D H;  1YVC A;  4QJF A;  3A56 A;  5KND A;  5EPJ A;  4OX9 Q;  1MJE A;  1Y8O B;  1V1P A;  4LUO A;  3J7A 5;  1JWU D;  2K33 A;  2ZJP A;  5FLX c;  5C3E H;  5KGU A;  1N33 Q;  1FNW A;  2KBN A;  3MEH A;  5AJ3 L;  1E24 A;  2WB1 E;  1EQR A;  2A69 D;  1JIC A;  1SBB B;  1H9S B;  3I73 A;  4JI0 Q;  1UE6 A;  4OIK A;  1G2S A;  2JA8 H;  1DGS A;  4RMF A;  2XWJ B;  2K52 A;  1JOQ A;  1AZP A;  1LT4 D;  1SXT A;  1KL9 A;  4KY7 A;  2IPK D;  3STB D;  3BU2 A;  3KDF B;  1WD0 A;  2NVX B;  1KIX A;  5FO9 B;  3HOY G;  1GXD C;  2N3S A;  3NUC A;  3Q8D A;  1SDF A;  3IFD A;  1PYS B;  2B2W C;  1C4Q A;  3KLR A;  1XWE A;  1VQ5 A;  1VQI A;  2RCN A;  1EY7 A;  1VQ9 A;  1RF2 D;  1EU3 A;  4BY1 H;  3H0G G;  2EOT A;  2KQ3 A;  1I4H A;  3ERS X;  4DNT B;  1ESF A;  4NMZ A;  1L1O B;  5IGC A;  2E76 C;  5M9O A;  2EJM A;  3PUX A;  1B8A A;  3VA5 A;  3S1R B;  4GKK L;  1JC7 A;  3KF6 A;  1LAC A;  4HCS A;  1STN A;  2K5V A;  3TZU A;  5IY0 A;  2VY3 A;  1WJJ A;  2XNA C;  3QOL A;  3TBI B;  1IXR A;  3SXH A;  4DAY B;  4DR3 L;  2RA4 A;  1NNX A;  1LTR D;  3OIP A;  2LMC B;  4DXG A;  4TQU S;  1X65 A;  4GN5 A;  4HJA A;  2Z6K A;  1YNX A;  3UDG A;  1PVO A;  1HQR D;  2HQE A;  2K1B A;  2K75 A;  4ZUJ A;  1HJP A;  2A68 D;  1X9N A;  3R8B A;  5E4X A;  1JJC B;  5D14 A;  4DK3 C;  4JVZ A;  3K6O A;  5CV7 A;  2NVY H;  1TWA H;  3BJU A;  1MSH A;  3RNU A;  2HIX A;  3PQI A;  5KEE A;  4C1N K;  2Y0S E;  4LFC L;  1EOT A;  5IP7 G;  1GUN A;  5C3E G;  4MIU A;  4F88 A;  2F0F A;  3VR5 A;  1HZA A;  5GQO A;  3EIV A;  3K7A B;  4GOP C;  4A93 G;  1PXU A;  2BDN A;  2MJ8 A;  1RIP A;  3CCV A;  2UXC Q;  5K36 G;  1OO9 B;  2FFK B;  5JEA H;  4A3E H;  1SE4 A;  1OXS C;  1KRS A;  3ZYY X;  2E2I B;  4DN4 M;  1EEI D;  3DWA A;  4QF4 A;  2EPB A;  2UXB L;  3S1N H;  1DM0 B;  5M3F G;  3LWU A;  2JA9 A;  1P16 A;  1Y1V G;  2NZH A;  1EIY B;  1FD7 D;  3JAM c;  5I9P A;  1SRU A;  1Q8K A;  4DV2 Q;  1XMO Q;  1F77 A;  4IUV A;  3C46 A;  3NHH A;  1XPU A;  1Q7Y C;  2EYF A;  1DD2 A;  2LY7 A;  5JPM C;  1J5E Q;  2EDG A;  1RKN A;  1YBY A;  4XQN A;  1MI2 A;  3H0G H;  4CDC C;  4C3I H;  4RKL A;  1AN8 A;  2ZM6 L;  3D3R A;  2QGQ A;  1MKH A;  5C5M A;  2LS0 1;  1ZKO A;  2NN6 G;  3I70 A;  4ZKB B;  3OTO Q;  4IUQ A;  4A75 A;  1XMO L;  4B3S Q;  1W6J A;  4DUZ Q;  2K5W A;  1X3Q A;  4ZAI A;  3TME A;  3GTK B;  1TWG H;  1SAP A;  1CTM A;  1G51 A;  2I5H A;  3CW2 C;  3PUV A;  2AQ2 B;  1JB7 A;  3S15 H;  1S40 A;  1KNA A;  4GLX A;  2R61 A;  2MHV A;  2F0V A;  3BZK A;  4EQN A;  2ZM6 Q;  3WWV A;  3A54 A;  4O0A A;  1X54 A;  4C3H B;  5KNB A;  2KEC A;  4ME3 A;  1QUQ A;  2FMC A;  5LHY 1;  2B63 G;  3NBI A;  4P72 A;  1HR0 Q;  1XTC D;  2V1C C;  4FF1 A;  1W2B A;  1BCP F;  3HOW G;  4QB4 A;  3NBH B;  2F0N A;  1EQT A;  2Q2I A;  1VQP A;  4A3M G;  2E2J B;  3VR6 A;  3KF6 B;  1CHP D;  5COY A;  3PIP A;  3EA6 A;  2JYO A;  4BBR B;  2UXD Q;  1EY4 A;  2R7Z G;  3DM3 A;  3FP9 A;  5BR8 L;  1TWC H;  4F7X A;  5C4X H;  2I5M X;  4XQQ A;  4C56 C;  1CKM A;  3GTO B;  1Y1W H;  1MHW C;  4AQY Q;  2NVT H;  3HOV B;  5FOB B;  4LF5 L;  2ALY B;  4K6D A;  1VMC A;  2AMC B;  2UUA Q;  1U9R A;  1VQE A;  1Q46 A;  4DK1 A;  1N32 Q;  2UXD L;  1Y1V H;  3NWS A;  2K32 A;  4N8X 1;  4F87 A;  3DWQ A;  5DM6 3;  2EYP A;  1S5F D;  1SE2 A;  4F8M A;  3MTS A;  3Q6S A;  5IIF A;  3SK6 A;  3JC6 6;  3MXU A;  2VB3 X;  3AQQ A;  5C4J H;  3J80 c;  4LFA L;  3P20 A;  4X64 L;  5I2Y A;  4PZ7 A;  3QOJ A;  4ZKC B;  2Z0S A;  5E1F A;  3J81 E;  4FNF A;  1VQL A;  3TS0 A;  2RSO A;  1HXY D;  3NEL A;  2JSO A;  1LT6 D;  2VB2 X;  4GOP B;  3R93 A;  2JXM B;  2XIW A;  4KI0 A;  5K5P A;  1O7Z A;  4J6H A;  1VQ4 A;  4X3S A;  1K28 A;  2KCC A;  2XN9 C;  4QQB X;  2CWP A;  5IT9 E;  3T13 A;  3E9I A;  5IWA Q;  2QDL A;  1VQO A;  4M1U B;  2IHE A;  1KD1 C;  1PZK D;  4NXM Q;  1YI2 A;  2MO1 A;  3CCM A;  2N78 A;  4A3J H;  1IBK L;  1AEX A;  4AYB B;  4CHT B;  1SJH D;  3M4Q A;  3RD4 A;  3SVM A;  3T4A C;  2JA6 B;  3HS0 C;  4B3T Q;  3UI2 A;  1WTX A;  2ID0 A;  1NBW A;  3F2B A;  4ALP A;  2FIN B;  2OEO A;  2BE5 D;  1IBL Q;  4OIJ A;  2OWO A;  4A3K B;  3AYH B;  3K80 C;  3RLN A;  1O7L A;  3KOJ A;  1FVI A;  1WTW A;  1WTO A;  2HHH L;  3R2I A;  2Z4H A;  2G5D A;  1X3P A;  4U68 A;  1S3O A;  1PH7 A;  2B2Y C;  2H1E A;  1S72 A;  1G8Z D;  4IO9 A;  2F0L A;  3S17 H;  4XT3 B;  4JI1 L;  3UE1 A;  1BNZ A;  3RZD H;  2FMM A;  5ELN A;  1B44 D;  5C0X H;  3W3A A;  1IYU A;  1QIL A;  1C7Y A;  1IBL L;  4KD3 A;  3HOW B;  5D3I B;  5IP9 G;  1JOO A;  1PH3 A;  2J7Z A;  1EEF D;  4A3I G;  3EN2 A;  1TWF H;  2VUM G;  1A3U A;  4LFB L;  3S2H H;  3MXP A;  3F2D A;  3I3C A;  1K83 B;  4Z9C B;  1PTO H;  1X3E A;  2RDH A;  5IT9 c;  3I56 A;  4R4C A;  2IL8 A;  4DUY L;  3PO2 B;  1I6H H;  1GO3 E;  1QVF A;  2EJF C;  4P73 A;  2HCI A;  1GJX A;  3FHW A;  1NE3 A;  3AU7 A;  1L1O A;  3S14 B;  2EIF A;  1Q90 A;  5E7N A;  2F0I A;  2O5I C;  4IPC A;  1LTI D;  1RJT A;  4AH6 A;  4LWC A;  4DR5 L;  2C35 B;  3N52 A;  1LTL A;  1NY4 A;  3C1E A;  1OXU A;  5CV4 A;  4DFA A;  2D0P A;  2LFN A;  4A3I B;  4L8J A;  3CCJ A;  1LTT D;  1TII D;  4BBR G;  1PTO B;  3D6C A;  5FLX L;  2VUM B;  1QE6 A;  1A3T A;  3SK8 A;  1BKB A;  4XYO A;  5M5Y H;  3BG3 A;  2HHH Q;  4OWX B;  1LO5 D;  1KAB A;  2IHF A;  5IP9 H;  4RH6 A;  2OXP A;  4C3I B;  4A76 A;  4RGT A;  4EVO A;  1TKW B;  2FXQ A;  2YU9 B;  1K8M A;  3NK9 A;  3I55 A;  2EY6 A;  3I4O A;  1WOC A;  5KYL A;  3I2Z A;  3HP3 A;  1LLR D;  2SNM A;  3WOF A;  4DXF A;  3C1F A;  4KV6 A;  1JCK B;  4WFN 3;  1CI3 M;  1CKN B;  1I4R A;  4A3F G;  1I4G A;  1D2B A;  4A3F B;  3P1H A;  3M9B A;  4NDX A;  4IFD J;  2EXZ A;  3FKI H;  4A3L G;  1BXT A;  2UXB Q;  1HRJ A;  5IYB G;  3TP5 A;  1J9O A;  4JI7 Q;  4JYA Q;  2HQL A;  3NTK A;  3MXG A;  2F0J A;  2PMZ B;  1M1K C;  3V96 A;  2DUD A;  4HMJ A;  4RCN A;  5C0X G;  1Z6H A;  1WVL A;  1SND A;  3AFQ A;  1BDO A;  3M85 A;  4G7Z C;  4YCV A;  1VF7 A;  2N88 A;  3BYT B;  1S5D D;  2CQA A;  1SNP A;  1X3G A;  1K3R A;  1BCP D;  2VXW A;  1L0W A;  5F2D A;  1P8L A;  2B29 A;  5ELE A;  2QKI C;  3GQB A;  1DOL A;  2KED A;  3V2T A;  1STA A;  5C0X J;  3H3V C;  5BR8 Q;  2M9V A;  1SNC A;  4LK1 C;  1EYG A;  4BXX H;  1T9H A;  4ILW A;  4HJ9 A;  2NBF A;  4DUZ L;  3IAY A;  2O4X A;  1VQN A;  1Q86 C;  2VS1 A;  2KCT A;  1GUS A;  4YHH L;  1PLF A;  2E5L Q;  1VQK A;  5HY6 A;  2PW5 A;  4RAU C;  3S1Q B;  5EAY A;  2VL6 A;  2PI2 E;  3VYT A;  4KHV A;  3G48 A;  5HGQ A;  5M5W H;  1HTP A;  4A3C G;  2B39 A;  1VQ7 A;  1A0I A;  2EYJ A;  4RWS C;  3D4D A;  4JCV E;  2MNA A;  1YJW A;  1ZEQ X;  4IJH A;  2A6H C;  2NTS A;  4C3J H;  2Z9H A;  2Z1C A;  4V0B A;  3JAM L;  4DAY A;  1TWH B;  4KKS A;  3K57 A;  4HMI A;  4OWW B;  4IPG A;  3KBX A;  1HCZ A;  1FL0 A;  1PRT D;  2F0H A;  4P75 A;  1Y8P B;  3DEO A;  4DV6 Q;  4GKJ L;  4A3M B;  1A2T A;  4UPA A;  1N36 Q;  1Q1B A;  3CC2 A;  3U9S A;  2EYO A;  4C3I G;  1SEB D;  1OXX K;  1JJG A;  5GAH C;  4KHZ A;  3HOX B;  1BOS A;  1Z9F A;  1EFW A;  5I2X A;  2ZTC A;  4K2K A;  2PQE A;  1JOR A;  1PYW D;  4A3F H;  4RGM A;  5T1I A;  3NE5 B;  5AJ3 Q;  4C2M H;  5BN5 A;  1B2T A;  5DNF A;  4DV0 L;  3H6M A;  3GTL H;  4A3L H;  2SEB D;  1NSN S;  1KLG D;  1SYE A;  4DV3 Q;  4IN3 A;  3S14 H;  1ICF B;  1IL8 A;  2YYZ A;  4DR7 L;  3RLF A;  5M5X H;  4A3K H;  4I65 A;  1CFM A;  2GN5 A;  2IT1 A;  2Y0S B;  4QIW B;  4LFA Q;  2VQF L;  4HAE A;  1WD1 A;  1HZ9 A;  1QJO A;  2EZV A;  4ZUI A;  2TMP A;  4LF4 Q;  4X65 L;  2C5C A;  1B1Z A;  1XNR Q;  1SNM A;  4JI8 L;  2HT1 A;  4DUY Q;  1PFM A;  4ZCK A;  1EYC A;  3HOU H;  1LTG D;  2LXK A;  1W3S A;  1UUP A;  3GTJ H;  4A3D B;  3CQZ H;  1ESR A;  2XVS A;  5IYC G;  2A69 C;  3DLL A;  1BBX C;  4GOP A;  5C6A A;  4JW0 A;  2ZTE A;  1UE7 A;  1Y1W G;  1CA5 A;  2I5L X;  3K58 A;  1IL2 A;  2JA5 B;  1KLU D;  1HNW L;  1PFB A;  1GUW A;  3STB C;  4H0L C;  4X3U A;  3CME A;  2E75 C;  1TWG B;  1T5X D;  5KYI A;  3HG9 A;  2F4V Q;  3M4O B;  1TS5 A;  1BO0 A;  1YHB A;  2ASB A;  1HTL D;  3H91 A;  5EKL A;  2KCN A;  2MQH A;  2NYZ D;  2B2T A;  3TS2 A;  3H09 A;  4RKB A;  2EYL A;  2J4X A;  4NB3 A;  4A3G H;  4NXN L;  5LMN L;  3P7J A;  2YTX A;  2F4I A;  4HSP A;  4IPD A;  1CQV A;  1KAA A;  4JI2 L;  5EKK A;  4L6T B;  1FR3 A;  3KFU A;  1T5E A;  1SLJ A;  2PZT A;  3CC7 A;  1A2U A;  1C0A A;  1HHV A;  4BBS B;  3I4M B;  3S2D B;  3DHQ A;  1SYC A;  1XNQ L;  2A74 C;  4X65 Q;  4YIJ A;  3C3L A;  3OW7 A;  1EL0 A;  1DCZ A;  4FO2 A;  3E6Z X;  1XPO A;  1AE3 A;  1JOK A;  5EBC A;  5K36 H;  2NZO A;  1K83 H;  3AB9 A;  1B4O A;  3TN2 A;  2K03 A;  4X62 L;  4DR3 Q;  1CT1 D;  4DR4 L;  2OQ0 A;  4LUZ A;  5G3L D;  3PF4 A;  1XNQ Q;  4E6I A;  5M3F H;  2E74 C;  3KLS A;  3D8G A;  1Y69 U;  3FKI B;  3BZC A;  5BN4 A;  3HKZ B;  2CVR A;  3L7Z C;  1NMF A;  4JI7 L;  1EIF A;  4JYA L;  3BVG A;  2XRS D;  4PG3 A;  3HOU G;  5EKI A;  1PDQ A;  1CZW A;  1FNU A;  1MBY A;  3VDY A;  5FJ8 H;  3W2D A;  3GTO H;  3CCR A;  4IUR A;  2QDB A;  4NXN Q;  4DF7 A;  4K2L A;  3I4L A;  3GTK H;  3HOZ G;  4PV1 C;  4B9W A;  4BBS G;  3J81 c;  3LGJ A;  3H3V H;  1NUC A;  1VCI A;  2SOB A;  2NN6 H;  4YWM A;  1IW7 C;  2NB0 A;  4RGN A;  5EPL A;  3OPO A;  2F0M A;  1HA5 A;  2RHS B;  5CC4 A;  5IGG A;  4FF3 A;  1K3B C;  1HNZ L;  1Y1V B;  4X3K A;  1EUJ A;  5FO7 B;  3S1M B;  1A6X A;  1E3P A;  1EYA A;  2NUC A;  3M4O H;  4H02 A;  5LMU L;  1YNJ D;  1BUV T;  3J7Y W;  3C2P A;  4EX5 A;  2K5D A;  4ZQ3 A;  5CMD A;  2AQ1 B;  4JI3 Q;  4BA1 I;  4XXE A;  1L0X B;  3PO3 G;  4QCL A;  5GAE C;  2L5T A;  1QB5 D;  1HNZ Q;  2KVM A;  4YHH Q;  2PYK A;  1VQJ A;  2KOL A;  3E0J A;  3RUZ A;  1Y8N B;  4APV A;  5IOC A;  2E5L L;  5H1S E;  3T1H Q;  3K0Y A;  4DV1 Q;  1AE2 A;  3N6R A;  2F1M A;  5C3E B;  2VUM H;  1MD2 D;  3CQZ B;  3J81 i;  1K9M C;  2F0U A;  4B08 A;  2QA4 A;  3KBG A;  1V9P A;  1V1O A;  4DV3 L;  4LF7 Q;  2KHS A;  1W6K A;  2R7Z H;  1A63 A;  4TVA B;  1N9W A;  4DR7 Q;  3VR4 A;  1SFO B;  1QZG A;  1PH2 A;  3B6Y A;  2KUM A;  4UY8 C;  3NPP A;  3I4N H;  1CSP A;  5GAG C;  3PGZ A;  2L55 A;  2OQK A;  1EY5 A;  2XSC A;  3KYH C;  3M3Y H;  2UUB L;  2XGT A;  2UUC Q;  2JA6 G;  4C2M B;  5DEH A;  3S17 B;  1TU2 B;  2E2H H;  3AMU A;  1M4V A;  1RL2 A;  4LW1 A;  1DON A;  3FKI G;  4ID6 A;  1EFI D;  4DK0 A;  5CR3 A;  5IYB H;  2H5X A;  3QO2 A;  1HH2 P;  1FGB D;  2PQA A;  3HEJ A;  3SR1 A;  2X6G A;  4BBR H;  4DPG A;  4FF4 A;  4DV5 Q;  1V1P B;  4A3B H;  2WKD A;  1H9M A;  4CKB A;  5C4X G;  1CHQ D;  4YY3 Q;  4IPH A;  3QR8 A;  3OWF A;  3SHL A;  5JJI A;  4X66 L;  2N49 A;  3HOX G;  2BCO A;  1SYF A;  3DUZ A;  5FLX E;  3DWP A;  1FJG L;  1H9K A;  5IWA L;  1VQ6 A;  4JI4 Q;  1Y1W B;  2DNC A;  5D65 A;  5JEA J;  5M3M B;  5LMN Q;  4IUU A;  4R4Q A;  4GKJ Q;  3MAQ A;  1F2L A;  2A5H A;  1M90 C;  4YWK A;  3PO2 H;  1IYJ B;  4NW2 A;  1STG A;  4ZRZ A;  1WTV A;  2QIL A;  1YNN D;  3CAM A;  1YHQ A;  2HIV A;  4GNX A;  1DJR D;  1PZI D;  2ICE C;  4OO1 H;  1B3A A;  2XRQ D;  5I6W A;  1U5K A;  4ULL A;  3MZ5 A;  1NMG A;  1WI5 A;  2B2T C;  1VMP A;  1JQY D;  1VQ8 A;  2CW0 D;  4C3H H;  4HSV A;  3FRP B;  2CCZ A;  1F9P A;  4A3G B;  2VNU D;  3Q0A A;  2NN6 I;  4DA2 A;  3K5N A;  2A73 B;  2UUC L;  2Z6K C;  4DV4 L;  3A55 A;  2MGS A;  1VQC A;  1M8A A;  1TXY A;  4KN7 C;  4H13 C;  4JV5 L;  1C8C A;  1B9M A;  4BY7 B;  1XYI A;  2JA5 H;  1EIG A;  4HIK A;  1LV9 A;  2BE5 C;  2G9H D;  2CH4 W;  3KLW A;  4LUV A;  4Y52 H;  1GOZ A;  3DMU A;  4DR2 L;  2KEE A;  2JA6 H;  3IL8 A;  4ABN A;  3ITP A;  3OIQ A;  1BF4 A;  4IOA A;  2IY5 B;  3HOY H;  4XIG S;  4R4T A;  1UAP A;  5C3W A;  2PW7 A;  3HKZ G;  1Z47 A;  4JI5 Q;  5DM7 3;  4YCW A;  3SE0 A;  3DEP A;  2BDO A;  1GUO A;  1TR5 A;  5ELC A;  2NVX H;  3TP6 A;  3O13 A;  2CKZ B;  3P75 A;  4XT1 B;  2DY8 A;  1DXM A;  4JI6 L;  2IX0 A;  4IUT A;  3PIP 3;  1WTR A;  1WCM B;  2EY5 A;  5I4D A;  3E3X A;  3CP0 A;  3LWE A;  3SGI A;  1PH6 A;  3EQL C;  1CK1 A;  3JAM E;  4QMG A;  2QF7 A;  1HFG A;  1KC8 C;  1UEA B;  4JPB W;  3CD6 A;  3GTP H;  3D6W A;  4X6A H;  2D2C C;  2E2J H;  5LMU Q;  2K14 A;  2AWN A;  2QEJ C;  3T56 B;  3I8Z A;  4DK6 C;  1LTA D;  3UDX A;  4GN4 B;  3OMC A;  3K7A H;  1LM0 A;  2RCF A;  5ELO A;  1H9R A;  1VQF A;  3GD7 A;  2SNS A;  4G57 A;  4QUF A;  3S16 H;  3CC4 A;  3IKJ A;  1CKN A;  1YNJ C;  1BR9 A;  3S1R H;  4UP7 A;  1D5Z C;  4KTA A;  1QWY A;  4MHE A;  4OO1 G;  3T1H L;  4RGO S;  1SYB A;  1SNQ A;  2A19 A;  3FPP A;  2WAQ G;  1HQM C;  1WFQ A;  5L37 A;  4HIM A;  2ZXP A;  3J80 L;  3CCQ A;  4A3K G;  3PUW A;  4CJ2 C;  3K5M A;  2IX3 A;  1B53 A;  4X62 Q;  3HOU B;  4BA2 I;  1RTO A;  1TWH H;  1TWC B;  3NP8 A;  4JI3 L;  1EY8 A;  2Y0S G;  4B3R L;  3OW2 A;  4UHV A;  4DR4 Q;  2F0K A;  1ILP A;  1TWF B;  3HRZ C;  1F2Z A;  1PZJ D;  4CDF C;  4HJ5 A;  4ZLT F;  4UP9 A;  3H15 A;  1D7Q A;  1H9S A;  4OL7 A;  5BN3 A;  1PH4 A;  5CBE E;  3HOV G;  1VQD A;  2Q2H A;  1B50 A;  2E8G A;  5DLQ E;  1XX8 A;  3GTL B;  3I90 A;  4POG A;  4O42 A;  3I91 A;  2B2U C;  2VQE Q;  2ZT9 C;  1U4R A;  3G7L A;  3NBH A;  4EQO A;  4IOC A;  5C44 G;  3E0E A;  1PFN A;  4YY3 L;  5C5L A;  1E2V A;  2MFI A;  3PO3 B;  1RDP D;  1VDZ A;  2UUA L;  4X66 Q;  5KNC A;  1WCM H;  1WTP A;  2Q8T A;  2L0C A;  4DR6 Q;  1FJG Q;  5EBD A;  1B7Y B;  1R4P B;  1QZH A;  1QNK A;  3KLS X;  2JEB I;  5FLM H;  1LAB A;  4FYD A;  4FP5 D;  4I7Z C;  1Z7T A;  2CFM A;  2L9H A;  2JEA I;  2GVB A;  1TY0 A;  2AQ3 B;  5JVG 3;  5JJZ A;  2PMZ E;  4OON A;  4L5T A;  3J80 i;  2R7Z B;  1E1T A;  1U4L A;  1SR3 A;  2FJ2 A;  2UU9 L;  3Q23 A;  4OHJ A;  1VQM A;  2DY7 A;  5A2Q L;  3I4M G;  2YTY A;  1YNN C;  4FXG C;  2I46 A;  2F0Q A;  1CUK A;  3S2H B;  4DAV A;  5J3B A;  5ISR A;  4P74 A;  1VQA A;  4RHS A;  3MFG A;  1AP0 A;  3PMF A;  4OWT B;  2WAC A;  4R8N A;  1JB3 A;  2KHI A;  4PQX A;  2LXJ A;  3CF5 A;  5J1Z A;  4UAI A;  2E2H B;  1N34 L;  4LAA A;  5I6Y A;  2CW0 C;  5JJK A;  1HR0 W;  2B63 B;  1XTD A;  1DZ1 A;  1IZ6 A;  4KMU C;  2RQX A;  1PRT C;  1ASY A;  3HOW H;  3A8I E;  1EWH A;  1EZ8 A;  1JWS D;  1TQO A;  3D4R A;  2VQE L;  1V43 A;  1HNW Q;  3M4Y A;  1WCM G;  5NUC A;  1VQG A;  4JBK A;  3NWT A;  4DR2 Q;  1SSO A;  1KTK A;  1SMY C;  1Q12 A;  3VR3 A;  2ATW A;  2F3I A;  2OF1 A;  3J7Z C;  1EIH A;  2PZW A;  2A6E D;  1AH9 A;  2ZTD A;  1A3V A;  4IUP A;  3EFX D;  5FO8 B;  4LF5 Q;  2NVQ B;  1O80 A;  1GKH A;  1IHZ A;  1VF5 C;  1S4Z A;  2BA0 A;  3D31 A;  1AW7 A;  4IJL A;  3QB3 A;  1KDA A;  3T1Y L;  4JI6 Q;  3TDQ A;  4B3T L;  3EJI A;  1GD7 A;  4L5R C;  2K28 A;  4FDB A;  1EU4 A;  2WB1 B;  5M5X B;  3GV3 A;  1TY2 A;  1WYD A;  2F3W A;  3CKI B;  2RVL A;  5M3M H;  2F0O A;  2DJG C;  2DNE A;  4OO1 I;  2L15 A;  1CA6 A;  3F8T A;  4GNX C;  2EY2 A;  2JP1 A;  3HFZ B;  3RZD B;  3G4S A;  3TRE A;  2L1B A;  4IUN A;  2IWH A;  4ZK9 B;  3CHB D;  1O7Y A;  4FXK C;  3Q24 A;  4A3G G;  2WKC A;  4JC0 A;  3X3N A;  3GTJ B;  4TKO B;  4NP5 A;  2RDG A;  3SDZ A;  3MVV A;  3J7A V;  4JBM A;  3GTQ B;  1ROD A;  4HN7 A;  1GM5 A;  5IE8 A;  2BH2 A;  1D1K A;  1KNE A;  4QIW E;  2EYH A;  2WV6 D;  3I4M H;  3S2D H;  4A93 H;  3I4N B;  3H3V I;  4NXM L;  2AKW B;  2K5N A;  3ICE A;  3ULP A;  4A3I H;  1HUM A;  5HGT A;  1HZC A;  1MJC A;  4DKA C;  3U58 A;  5CBA E;  2B3G A;  5ELF A;  1C48 A;  3HOZ B;  1II3 A;  3U4V A;  1PTO D;  2ZXO A;  4ME5 A;  3G6E A;  2Z8L A;  1IBM L;  2E2I H;  3AEV A;  3CXC A;  1X56 A;  3CCL A;  1CZG A;  5IGE A;  4A4I A;  1J8I A;  4L5S A;  2M2L A;  4K8I A;  5E4W C;  1LT3 D;  1QOH A;  1CSQ A;  3KUP A;  1E1O A;  1STY A;  4CKC A;  1A15 A;  4EQP A;  2C9O A;  1G29 1;  5C4H A;  1ILQ A;  5JAV A;  4GLV B;  3BDO A;  3L9A X;  4B3M Q;  3W1G A;  2VZA A;  1IKL A;  1I5F A;  2SDF A;  4LJZ C;  5C3X A;  1K8G A;  2R93 G;  4FXD A;  4MZ9 A;  4RA8 A;  5KRU A;  3PIO A;  1I94 Q;  2KHJ A;  2ENB A;  2RDF A;  4A3B B;  2YTV A;  1I6H B;  3E5S A;  1I4Q A;  3IRB A;  5EJW A;  1EWI A;  2B8G A;  2QW7 A;  2I0Q A;  3JAM i;  1GVP A;  2QCP X;  4K8J A;  4WJ3 M;  4GLA C;  2RHQ B;  4RHR A;  1U0L A;  4AYB G;  4CKE A;  2B2V A;  1L1O C;  1D6E C;  3BYY B;  1YHA A;  2PCF B;  1BCP B;  5A35 A;  1Y14 B;  4JOI C;  2IX1 A;  4KHP L;  2K5Q A;  3MXN A;  2R92 B;  1I3Q B;  3U4Z A;  3DM1 A;  4DR1 L;  4OXP A;  2PI2 A;  1JR0 D;  2AWO A;  4R4I A;  1SNO A;  4C3H G;  3A7A B;  1OXV A;  3FVQ A;  1D5M C;  3K5O A;  4X64 Q;  2O2L D;  3CCU A;  3OMG A;  4G7H C;  1IYV A;  1KXL A;  5ELB A;  1ASZ A;  1EWC A;  1IBM Q;  5T1G A;  1LYL A;  2K04 A;  2Q2U A;  2UUB Q;  2MP1 A;  3GO5 A;  4B3R Q;  4K5V A;  4LF4 L;  1IW7 D;  2AUK A;  5CV5 A;  1XPR A;  4WJW A;  3T51 B;  2WIN B;  2R93 H;  1XMQ L;  1TS3 A;  2EQS A;  1SFO H;  1PV4 A;  2G9D A;  4RFB A;  2KCM A;  4R9W A;  1NCV A;  1QVC A;  4DV1 L;  4BWG B;  1HZB A;  3V05 A;  2K6A A;  4K5W A;  1TVX A;  3D4W A;  4YCU A;  4P2C B;  3CCE A;  3M3Y B;  1D8L A;  2JA8 B;  3TQY A;  3ERQ A;  2FHT A;  3U9O A;  4DV2 L;  1UEB A;  1FNV A;  3S24 A;  3BVZ A;  3NSW A;  1ENA A;  1HR0 L;  2KJX A;  3TZD A;  5GAD C;  3RZO B;  4N9T A;  3TEH B;  2NVY B;  4PNY A;  1XJV A;  5DAU A;  3PUZ A;  4CJ0 B;  3GTG B;  2OTL A;  3T1Y Q;  4OGQ C;  1F9R A;  5M5Y B;  4UDU C;  1N33 L;  2EE1 A;  5FKA C;  4KHP Q;  3H94 A;  3PSI A;  3W5O A;  4B3S L;  3A74 A;  4S3S A;  4HID A;  1ET9 A;  3RMH A;  3W1B A;  3DXJ C;  3QIA A;  3TP8 A;  5COR A;  4IAL A;  3UE0 A;  3PV0 A;  1E2W A;  4CBV A;  5LMN W;  3ZJY C;  5IYD H;  3KDF A;  2RBM A;  3F2U A;  4QY7 A;  2Q8I B;  1Q82 C;  2PZU A;  4MTK A;  3AFP A;  3ULJ A;  4DV7 Q;  1YIT A;  4B9X A;  5C0X I;  4QL5 A;  1K73 C;  4K0K Q;  4BY7 G;  1OTC A;  3RN5 A;  3PF5 A;  4L63 B;  4C3J B;  2E2D C;  1STH A;  1G2T A;  4PMB A;  2TSS A;  1SYD A;  3HOY B;  3ND9 A;  4HR7 B;  2R92 H;  4Y7N H;  2WII B;  1U4P A;  4Y7N B;  2BOS A;  4PMC A;  3M4P A;  1SYG A;  5M3F B;  2F4V L;  4DNI A;  1I50 H;  3GP7 A;  4K6L A;  5FK9 C;  4IFD H;  1ML0 D;  2Q2T A;  3QJY A;  4N8F A;  4PZ6 A;  4LF9 L;  5JOB A;  2PPB C;  4N9P A;  4GKK Q;  3J81 L;  3L3O C;  1K0S A;  2L11 A;  1N8R C;  4LFC Q;  2RKS A;  1NR4 A;  4JI2 Q;  3EBE A;  4R1J A;  3VR2 A;  2NTT A;  4GZY C;  1QVG A;  3A7L A;  1O7I A;  3FMC A;  5IP7 H;  4AIM A;  4DGZ A;  1STB A;  4HTH A;  1PH9 A;  1BQQ T;  3S16 B;  2R7F A;  3MA2 B;  3R3O A;  3T16 A;  3SEB A;  5IYD G;  5EPK A;  2WB1 G;  2JA5 G;  4IZ8 A;  1UNS A;  1L0Y B;  4B3M L;  1I50 B;  1VQH A;  2IW3 A;  1B70 B;  2K01 A;  4MNO A;  4RCO A;  4OEL B;  1ZYR C;  4KKT A;  3GTG H;  4LF8 L;  2R7D A;  1PTO F;  2OCE A;  3CCS A;  1YJN A;  2EJG C;  1RCV D;  4JI1 Q;  1EY9 A;  2ZJR A;  3OWE B;  2F0D A;  1UE5 A;  4DR5 Q;  4J8Q A;  1F2Y A;  3MHB A;  5CV9 A;  3K81 C;  2BH8 A;  2K4K A;  1XNR L;  3ULL A;  2V4D A;  4KY5 A;  3FEW X;  4MTN A;  2L12 A;  1K0R A;  2PNR C;  1YEZ A;  2A8V A;  1C9O A;  4K14 A;  4KJN A;  2O5J C;  1Q8I A;  2HDL A;  3QWN A;  5HUR A;  1NR2 A;  5TSS A;  1HUN A;  2F3V A;  3SK4 A;  3PUY A;  3K7U C;  3S15 B;  4KN4 C; 
#chains in the Genus database with same CATH homology
 3VYS A;  1H9J A;  1FYC A;  3TSS A;  4K5X A;  4FVM A;  3Q22 A;  1ENF A;  2L4N A;  5C4J B;  3BDC A;  1K8O A;  1E0B A;  2ZXR A;  3KK7 A;  2F0G A;  3T53 B;  4TSS A;  3KF8 A;  4IFD G;  5G3L F;  1R9T B;  5AFW A;  3FPU B;  4KY6 A;  5C4Z A;  2OT2 A;  2X69 A;  4XDX A;  1ONL A;  4H44 C;  4CGY B;  5I9O A;  1GHK A;  5D3D A;  4A3J B;  2B2W A;  3NQT A;  2F0W A;  4TRD A;  3MFY A;  2R93 B;  4DNR B;  2EYM A;  1S5B D;  4MN3 A;  1S5E D;  1X32 A;  3BZD B;  5CV8 A;  2K7V A;  3M7N A;  5J39 A;  1STE A;  3A8J E;  1V8Q A;  3NTI A;  3G6J B;  3VYR A;  1LT5 D;  1AFP A;  1GUG A;  1G91 A;  2K05 A;  5IOD A;  2B2V C;  1AZQ A;  3S1N B;  5JPN C;  1B9N A;  5M5W B;  1JWM D;  2IJ0 A;  3QG1 A;  1I6V C;  1Q3L A;  2D5D A;  4XYQ A;  4WOR A;  3R2T A;  1OXT A;  4G4K A;  2HUG A;  3ONA B;  2NVT B;  1LTB D;  3H0G B;  1DOK A;  2F0S A;  2KA7 A;  1I4X A;  1HPC A;  1ZXT A;  2HCC A;  2F0T A;  1ET6 A;  5IGD A;  1D1I A;  5KIX A;  1ENC A;  4KJO A;  5CYU A;  2JA7 B;  1TT2 A;  2Z4I A;  4U67 3;  3OSO A;  3X3M A;  1PMR A;  1R4Q B;  4BS9 A;  2JE6 I;  1KDB A;  1MGS A;  1KDC A;  2B2Y A;  3VYU A;  1G6Z A;  1TWA B;  1LTS D;  1EY0 A;  4X3T A;  1EQV A;  1QCB D;  4A93 B;  5JVH 3;  4BY1 B;  1RD9 D;  5JEA G;  3GTP B;  1E2Z A;  1I4P A;  2LKV A;  1F2M A;  1XXG A;  3NXW A;  4G7O C;  2MUY A;  1PRT B;  4R8I A;  1ZYR D;  1NAP A;  1QNU A;  2AUJ D;  1F9Q A;  2WAQ B;  3A8K E;  4EGV A;  2EY1 A;  2Q8R E;  4HCE A;  4HED A;  4C1N I;  1F9S A;  4CJ1 B;  4JBW A;  2HDM A;  1SMY D;  2BA1 A;  4XTC S;  2N55 A;  3URY A;  3WDN A;  1ICW A;  4IFD I;  2A6E C;  4ODG A;  2WP8 J;  3HGB A;  1EZ6 A;  3GTM B;  4Q5V A;  5E3F A;  4A3E B;  3CRK C;  1IKM A;  1O78 A;  4FF2 A;  5CV6 A;  2I07 B;  4DAP A;  4O1N A;  2J0T D;  1HFN A;  4DU9 A;  5ELD A;  3J80 E;  1QG7 A;  3TP7 A;  3OOC A;  3S9W A;  3VA7 A;  4WRD A;  2NWG A;  4PMW A;  3BS1 A;  5CGK A;  4NKL A;  3HZX A;  2F0E A;  5C44 B;  3NTH A;  1JE4 A;  2D62 A;  3NQI A;  4XQJ A;  1WTQ A;  4Q0F A;  2MPM A;  1SJE D;  2F0P A;  5IT9 L;  3FDT A;  3GV6 A;  2H4O A;  3ERO A;  5IGF A;  1CM9 A;  2A68 C;  5IGB A;  3BDL A;  4KK7 A;  5LL6 X;  4IQZ A;  1HA6 A;  3MC0 B;  1PTO C;  2B2U A;  1BCP C;  1TS2 A;  2DN8 A;  2R3Z A;  2X6L A;  4KKU A;  3LNN A;  3CRL C;  1PRT F;  1SE3 A;  2R6G A;  1CQF A;  3K59 A;  2XWB B;  3IFT A;  2ICI A;  3WOE A;  1RTN A;  1EY6 A;  2GA4 B;  1MSG A;  4JK1 C;  3J7A F;  2D9U A;  3I72 A;  4V19 0;  1S5C D;  2RSN A;  5EGT A;  4KD4 A;  1GUT A;  3CU7 A;  2NZ1 D;  2A6H D;  4J1M A;  2PO4 A;  5A2Q E;  3SK5 A;  1DYQ A;  4QUC A;  3BVM A;  3ND8 A;  2B8F A;  1RHP A;  3EVQ A;  2EVB A;  3MWY W;  1D5X C;  4LMQ D;  5LL6 S;  2M00 A;  5J22 A;  1EYD A;  3M7G A;  5EQ0 A;  4C3J G;  1DOM A;  4ZYS A;  3LX0 A;  1GHJ A;  1Q1E A;  2CHB D;  3OHX C;  4H7B A;  1U4M A;  5C4X B;  1TS4 A;  3K5L A;  2F03 A;  3PIO 3;  4M8A A;  3A56 A;  5KND A;  5EPJ A;  1Y8O B;  1V1P A;  1JWU D;  2K33 A;  5KGU A;  1FNW A;  3MEH A;  2A69 D;  1JIC A;  1SBB B;  1H9S B;  3I73 A;  4OIK A;  1G2S A;  2XWJ B;  1JOQ A;  1AZP A;  1LT4 D;  1SXT A;  4KY7 A;  2IPK D;  1WD0 A;  2NVX B;  5FO9 B;  1GXD C;  3NUC A;  1SDF A;  3IFD A;  2B2W C;  1C4Q A;  3KLR A;  1XWE A;  1EY7 A;  1RF2 D;  1EU3 A;  2EOT A;  2KQ3 A;  1I4H A;  4DNT B;  1ESF A;  4NMZ A;  5IGC A;  2E76 C;  5M9O A;  2EJM A;  3PUX A;  3VA5 A;  3S1R B;  1JC7 A;  1LAC A;  4HCS A;  1STN A;  3TZU A;  2XNA C;  3QOL A;  3TBI B;  3SXH A;  2RA4 A;  1LTR D;  3OIP A;  2LMC B;  4DXG A;  4TQU S;  1HQR D;  2HQE A;  2K1B A;  4ZUJ A;  2A68 D;  3R8B A;  5E4X A;  5D14 A;  3K6O A;  5CV7 A;  1MSH A;  5KEE A;  4C1N K;  1EOT A;  1GUN A;  4MIU A;  4F88 A;  2F0F A;  3VR5 A;  3K7A B;  1PXU A;  2BDN A;  2MJ8 A;  5K36 G;  1OO9 B;  2FFK B;  5JEA H;  1SE4 A;  1OXS C;  3ZYY X;  2E2I B;  4DN4 M;  1EEI D;  3DWA A;  4QF4 A;  2EPB A;  1DM0 B;  3LWU A;  1FD7 D;  5I9P A;  1F77 A;  4IUV A;  3C46 A;  3NHH A;  2EYF A;  1DD2 A;  2LY7 A;  5JPM C;  2EDG A;  1RKN A;  4XQN A;  1MI2 A;  4RKL A;  1AN8 A;  3D3R A;  5C5M A;  2LS0 1;  1ZKO A;  2NN6 G;  3I70 A;  4ZKB B;  4IUQ A;  1W6J A;  2K5W A;  1X3Q A;  4ZAI A;  3TME A;  3GTK B;  1SAP A;  1CTM A;  3PUV A;  2AQ2 B;  1KNA A;  2R61 A;  2MHV A;  2F0V A;  4EQN A;  3A54 A;  4C3H B;  5KNB A;  2KEC A;  2FMC A;  5LHY 1;  3NBI A;  1XTC D;  4FF1 A;  1BCP F;  4QB4 A;  2F0N A;  1EQT A;  2E2J B;  3VR6 A;  1CHP D;  5COY A;  3EA6 A;  2JYO A;  4BBR B;  1EY4 A;  4F7X A;  4XQQ A;  4C56 C;  3GTO B;  3HOV B;  5FOB B;  4K6D A;  1VMC A;  1U9R A;  4DK1 A;  3NWS A;  2K32 A;  4F87 A;  3DWQ A;  5DM6 3;  2EYP A;  1S5F D;  1SE2 A;  4F8M A;  3MTS A;  3Q6S A;  5IIF A;  3SK6 A;  3MXU A;  2VB3 X;  3P20 A;  5I2Y A;  3QOJ A;  4ZKC B;  5E1F A;  3J81 E;  4FNF A;  2RSO A;  1HXY D;  2JSO A;  1LT6 D;  2VB2 X;  3R93 A;  2JXM B;  2XIW A;  4KI0 A;  5K5P A;  1O7Z A;  4J6H A;  4X3S A;  2KCC A;  2XN9 C;  5IT9 E;  3T13 A;  4M1U B;  1PZK D;  1AEX A;  4AYB B;  4CHT B;  1SJH D;  3RD4 A;  3SVM A;  3T4A C;  2JA6 B;  3HS0 C;  1WTX A;  3UI2 A;  2ID0 A;  2FIN B;  2OEO A;  2BE5 D;  4OIJ A;  4A3K B;  1O7L A;  1WTW A;  1WTO A;  3R2I A;  2Z4H A;  4U68 A;  1X3P A;  2B2Y C;  2H1E A;  1G8Z D;  2F0L A;  4XT3 B;  1BNZ A;  2FMM A;  1B44 D;  5C0X H;  3W3A A;  1IYU A;  1QIL A;  3HOW B;  4KD3 A;  5D3I B;  1JOO A;  2J7Z A;  1EEF D;  1A3U A;  3MXP A;  3I3C A;  1K83 B;  4Z9C B;  1PTO H;  2RDH A;  2IL8 A;  3PO2 B;  2EJF C;  2HCI A;  1GJX A;  3AU7 A;  3S14 B;  1Q90 A;  2F0I A;  2O5I C;  1LTI D;  1RJT A;  3N52 A;  3C1E A;  1OXU A;  5CV4 A;  4DFA A;  2LFN A;  4A3I B;  4L8J A;  1LTT D;  1TII D;  1PTO B;  3D6C A;  5FLX L;  2VUM B;  1QE6 A;  1A3T A;  3SK8 A;  4XYO A;  3BG3 A;  1LO5 D;  1KAB A;  4RH6 A;  2OXP A;  4C3I B;  4RGT A;  4EVO A;  1TKW B;  2YU9 B;  1K8M A;  3NK9 A;  2EY6 A;  5KYL A;  3HP3 A;  1LLR D;  2SNM A;  3WOF A;  4DXF A;  3C1F A;  4KV6 A;  1JCK B;  4WFN 3;  1CI3 M;  1I4R A;  1I4G A;  1D2B A;  4A3F B;  3P1H A;  4NDX A;  4IFD J;  2EXZ A;  1BXT A;  1HRJ A;  3TP5 A;  1J9O A;  3NTK A;  3MXG A;  2F0J A;  2PMZ B;  3V96 A;  4HMJ A;  4RCN A;  5C0X G;  1Z6H A;  1WVL A;  1SND A;  1BDO A;  3M85 A;  4G7Z C;  1VF7 A;  2N88 A;  3BYT B;  1S5D D;  2CQA A;  1SNP A;  1BCP D;  2VXW A;  5F2D A;  5ELE A;  2QKI C;  3GQB A;  1DOL A;  2KED A;  3V2T A;  1STA A;  5C0X J;  3H3V C;  2M9V A;  1SNC A;  4LK1 C;  4ILW A;  2NBF A;  3IAY A;  2O4X A;  1GUS A;  1PLF A;  2PW5 A;  4RAU C;  3S1Q B;  3VYT A;  4KHV A;  1HTP A;  2B39 A;  4RWS C;  2EYJ A;  3D4D A;  1ZEQ X;  2A6H C;  2NTS A;  2Z1C A;  4V0B A;  3JAM L;  4DAY A;  1TWH B;  4KKS A;  3K57 A;  4HMI A;  3KBX A;  1HCZ A;  1PRT D;  2F0H A;  1Y8P B;  3DEO A;  4A3M B;  1A2T A;  1Q1B A;  3U9S A;  2EYO A;  4C3I G;  1SEB D;  1OXX K;  4KHZ A;  3HOX B;  1BOS A;  5I2X A;  4K2K A;  2PQE A;  1JOR A;  1PYW D;  4RGM A;  5T1I A;  3NE5 B;  1B2T A;  5BN5 A;  5DNF A;  3H6M A;  2SEB D;  1NSN S;  1KLG D;  1SYE A;  4IN3 A;  2YYZ A;  1IL8 A;  3RLF A;  4I65 A;  1CFM A;  4QIW B;  2IT1 A;  2Y0S B;  1WD1 A;  4HAE A;  1QJO A;  2EZV A;  4ZUI A;  2TMP A;  2C5C A;  1B1Z A;  1SNM A;  1PFM A;  1EYC A;  1LTG D;  1UUP A;  4A3D B;  1ESR A;  2XVS A;  2A69 C;  1BBX C;  5C6A A;  1CA5 A;  3K58 A;  2JA5 B;  1KLU D;  1PFB A;  1GUW A;  4H0L C;  4X3U A;  2E75 C;  1TWG B;  1T5X D;  5KYI A;  3HG9 A;  3M4O B;  1TS5 A;  1BO0 A;  1HTL D;  3H91 A;  5EKL A;  2KCN A;  2NYZ D;  2B2T A;  3H09 A;  4RKB A;  2EYL A;  2J4X A;  3P7J A;  2F4I A;  4HSP A;  1CQV A;  1KAA A;  5EKK A;  4L6T B;  1FR3 A;  1T5E A;  2PZT A;  1A2U A;  1HHV A;  4BBS B;  3I4M B;  3S2D B;  3DHQ A;  1SYC A;  2A74 C;  4YIJ A;  3C3L A;  3OW7 A;  1EL0 A;  1DCZ A;  4FO2 A;  3E6Z X;  1JOK A;  5EBC A;  5K36 H;  3AB9 A;  1B4O A;  3TN2 A;  2K03 A;  1CT1 D;  5G3L D;  4E6I A;  2E74 C;  3KLS A;  3D8G A;  1Y69 U;  3FKI B;  5BN4 A;  3HKZ B;  2CVR A;  3L7Z C;  3BVG A;  2XRS D;  5EKI A;  1PDQ A;  1CZW A;  1FNU A;  1MBY A;  3W2D A;  4IUR A;  2QDB A;  4DF7 A;  4K2L A;  3I4L A;  4PV1 C;  4B9W A;  1NUC A;  1VCI A;  2SOB A;  2NN6 H;  1IW7 C;  2NB0 A;  4RGN A;  5EPL A;  3OPO A;  2F0M A;  1HA5 A;  5CC4 A;  5IGG A;  4FF3 A;  1Y1V B;  4X3K A;  3S1M B;  5FO7 B;  1A6X A;  1EYA A;  2NUC A;  1YNJ D;  1BUV T;  3J7Y W;  3C2P A;  2K5D A;  4ZQ3 A;  5CMD A;  2AQ1 B;  4BA1 I;  4XXE A;  1L0X B;  4QCL A;  2L5T A;  1QB5 D;  2KVM A;  2PYK A;  2KOL A;  3E0J A;  3RUZ A;  5IOC A;  1Y8N B;  3K0Y A;  3N6R A;  2F1M A;  5C3E B;  1MD2 D;  3CQZ B;  2F0U A;  4B08 A;  3KBG A;  1V1O A;  2KHS A;  1W6K A;  3VR4 A;  1SFO B;  2KUM A;  3NPP A;  2L55 A;  1EY5 A;  2XSC A;  4C2M B;  5DEH A;  3S17 B;  1TU2 B;  3AMU A;  1M4V A;  1DON A;  4ID6 A;  1EFI D;  4DK0 A;  5CR3 A;  3QO2 A;  1FGB D;  3HEJ A;  3SR1 A;  2X6G A;  4FF4 A;  1V1P B;  2WKD A;  1H9M A;  4CKB A;  1CHQ D;  3OWF A;  3SHL A;  2BCO A;  1SYF A;  3DUZ A;  5FLX E;  3DWP A;  1H9K A;  1Y1W B;  2DNC A;  5D65 A;  5JEA J;  5M3M B;  4IUU A;  3MAQ A;  1F2L A;  2A5H A;  4NW2 A;  1STG A;  4ZRZ A;  1WTV A;  2QIL A;  1YNN D;  1DJR D;  1PZI D;  2ICE C;  4OO1 H;  1B3A A;  2XRQ D;  5I6W A;  4ULL A;  3MZ5 A;  2B2T C;  1VMP A;  1JQY D;  2CW0 D;  4HSV A;  3FRP B;  1F9P A;  4A3G B;  2VNU D;  3Q0A A;  2NN6 I;  4DA2 A;  3K5N A;  2A73 B;  3A55 A;  2MGS A;  1M8A A;  4KN7 C;  4H13 C;  1C8C A;  1B9M A;  4BY7 B;  1XYI A;  1EIG A;  1LV9 A;  2BE5 C;  2G9H D;  1GOZ A;  3DMU A;  2KEE A;  3IL8 A;  4ABN A;  3ITP A;  3OIQ A;  1BF4 A;  4XIG S;  1UAP A;  5C3W A;  2PW7 A;  1Z47 A;  5DM7 3;  3SE0 A;  3DEP A;  2BDO A;  1GUO A;  1TR5 A;  5ELC A;  3TP6 A;  3O13 A;  3P75 A;  4XT1 B;  2DY8 A;  1DXM A;  2IX0 A;  4IUT A;  3PIP 3;  1WTR A;  1WCM B;  2EY5 A;  5I4D A;  3LWE A;  3EQL C;  1CK1 A;  3JAM E;  4QMG A;  2QF7 A;  1HFG A;  1UEA B;  3D6W A;  2D2C C;  2AWN A;  2QEJ C;  3T56 B;  3I8Z A;  1LTA D;  3OMC A;  1H9R A;  3GD7 A;  2SNS A;  4G57 A;  4QUF A;  3IKJ A;  1YNJ C;  1BR9 A;  1D5Z C;  4KTA A;  1QWY A;  4MHE A;  4OO1 G;  4RGO S;  1SYB A;  1SNQ A;  3FPP A;  1HQM C;  2ZXP A;  3J80 L;  3PUW A;  4CJ2 C;  3K5M A;  2IX3 A;  1B53 A;  3HOU B;  4BA2 I;  1RTO A;  1TWC B;  3NP8 A;  1EY8 A;  2F0K A;  1ILP A;  1TWF B;  3HRZ C;  1F2Z A;  1PZJ D;  4ZLT F;  1H9S A;  4OL7 A;  5BN3 A;  5CBE E;  1B50 A;  3GTL B;  1XX8 A;  3I90 A;  4O42 A;  3I91 A;  2B2U C;  2ZT9 C;  1U4R A;  3G7L A;  3NBH A;  4EQO A;  1PFN A;  5C5L A;  1E2V A;  3PO3 B;  1RDP D;  1VDZ A;  5KNC A;  1WTP A;  2Q8T A;  2L0C A;  5EBD A;  1R4P B;  1QNK A;  2JEB I;  3KLS X;  1LAB A;  4FYD A;  4FP5 D;  4I7Z C;  1Z7T A;  2L9H A;  2JEA I;  1TY0 A;  2AQ3 B;  5JVG 3;  5JJZ A;  2R7Z B;  1U4L A;  2FJ2 A;  3Q23 A;  4OHJ A;  2DY7 A;  5A2Q L;  1YNN C;  4FXG C;  2I46 A;  2F0Q A;  3S2H B;  4DAV A;  5ISR A;  4RHS A;  3MFG A;  1AP0 A;  3PMF A;  2WAC A;  4R8N A;  1JB3 A;  4PQX A;  5J1Z A;  4UAI A;  2E2H B;  4LAA A;  5I6Y A;  2CW0 C;  2B63 B;  1DZ1 A;  4KMU C;  2RQX A;  1PRT C;  3A8I E;  1EWH A;  1EZ8 A;  1JWS D;  1TQO A;  3D4R A;  1V43 A;  3M4Y A;  5NUC A;  3NWT A;  1SSO A;  1KTK A;  1SMY C;  1Q12 A;  3VR3 A;  2OF1 A;  1EIH A;  2PZW A;  2A6E D;  1A3V A;  4IUP A;  3EFX D;  5FO8 B;  2NVQ B;  1O80 A;  1IHZ A;  1VF5 C;  1S4Z A;  2BA0 A;  3D31 A;  1AW7 A;  3QB3 A;  1KDA A;  3TDQ A;  3EJI A;  2K28 A;  1EU4 A;  2WB1 B;  5M5X B;  3GV3 A;  1TY2 A;  2F3W A;  3CKI B;  2RVL A;  2F0O A;  2DNE A;  4OO1 I;  1CA6 A;  2EY2 A;  2JP1 A;  3RZD B;  2L1B A;  4IUN A;  2IWH A;  4ZK9 B;  3CHB D;  1O7Y A;  4FXK C;  3Q24 A;  2WKC A;  3X3N A;  3GTJ B;  4TKO B;  4NP5 A;  2RDG A;  3SDZ A;  3MVV A;  3J7A V;  3GTQ B;  1ROD A;  4HN7 A;  1D1K A;  1KNE A;  2EYH A;  2WV6 D;  3I4N B;  1HUM A;  5HGT A;  5CBA E;  5ELF A;  1C48 A;  3HOZ B;  1II3 A;  1PTO D;  2ZXO A;  4ME5 A;  2Z8L A;  1CZG A;  5IGE A;  1J8I A;  2M2L A;  4K8I A;  5E4W C;  1LT3 D;  1QOH A;  3KUP A;  1STY A;  4CKC A;  1A15 A;  4EQP A;  2C9O A;  1G29 1;  5C4H A;  1ILQ A;  5JAV A;  3BDO A;  3L9A X;  1IKL A;  2SDF A;  5C3X A;  4LJZ C;  4FXD A;  4RA8 A;  5KRU A;  2ENB A;  2RDF A;  4A3B B;  1I6H B;  3E5S A;  1I4Q A;  5EJW A;  2B8G A;  2QCP X;  4K8J A;  4RHR A;  4CKE A;  2B2V A;  1D6E C;  3BYY B;  2PCF B;  1BCP B;  5A35 A;  2IX1 A;  2K5Q A;  3MXN A;  2R92 B;  1I3Q B;  3DM1 A;  1JR0 D;  2AWO A;  1SNO A;  4C3H G;  3A7A B;  1OXV A;  3FVQ A;  1D5M C;  3K5O A;  2O2L D;  3OMG A;  4G7H C;  1IYV A;  5ELB A;  1EWC A;  5T1G A;  2K04 A;  2MP1 A;  3GO5 A;  4K5V A;  1IW7 D;  2AUK A;  5CV5 A;  4WJW A;  3T51 B;  2WIN B;  1TS3 A;  2G9D A;  4RFB A;  4R9W A;  1NCV A;  4BWG B;  3V05 A;  2K6A A;  4K5W A;  1TVX A;  3D4W A;  4P2C B;  3M3Y B;  2JA8 B;  3ERQ A;  2FHT A;  3U9O A;  1FNV A;  3BVZ A;  3NSW A;  1ENA A;  2KJX A;  3TZD A;  3RZO B;  4N9T A;  2NVY B;  4PNY A;  5DAU A;  3PUZ A;  4CJ0 B;  3GTG B;  4OGQ C;  1F9R A;  5M5Y B;  4UDU C;  2EE1 A;  5FKA C;  3H94 A;  4S3S A;  1ET9 A;  3RMH A;  3DXJ C;  3QIA A;  3TP8 A;  5COR A;  4IAL A;  3PV0 A;  1E2W A;  4CBV A;  2RBM A;  3F2U A;  2Q8I B;  2PZU A;  4B9X A;  5C0X I;  4L63 B;  4C3J B;  2E2D C;  1STH A;  1G2T A;  4PMB A;  2TSS A;  1SYD A;  3HOY B;  3ND9 A;  4HR7 B;  2WII B;  1U4P A;  4Y7N B;  2BOS A;  4PMC A;  1SYG A;  5M3F B;  3GP7 A;  4K6L A;  5FK9 C;  4IFD H;  1ML0 D;  3QJY A;  5JOB A;  2PPB C;  4N9P A;  3J81 L;  3L3O C;  2L11 A;  2RKS A;  1NR4 A;  3VR2 A;  2NTT A;  4GZY C;  3A7L A;  3FMC A;  4DGZ A;  1STB A;  4HTH A;  1BQQ T;  3S16 B;  3MA2 B;  3R3O A;  3T16 A;  3SEB A;  5EPK A;  4IZ8 A;  1UNS A;  1L0Y B;  1I50 B;  2IW3 A;  2K01 A;  4RCO A;  1ZYR C;  4KKT A;  1PTO F;  2EJG C;  1RCV D;  1EY9 A;  3OWE B;  2F0D A;  4J8Q A;  1F2Y A;  3MHB A;  5CV9 A;  2V4D A;  4KY5 A;  3FEW X;  2L12 A;  2PNR C;  4K14 A;  4KJN A;  2O5J C;  1Q8I A;  2HDL A;  3QWN A;  5HUR A;  1NR2 A;  5TSS A;  1HUN A;  2F3V A;  3SK4 A;  3PUY A;  3S15 B;  4KN4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...