3MVVA

Crystal structure of staphylococcal nuclease variant delta+phs f34a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTARLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mvvA00
3LX0A 5KEEA 3D6CA 5IGFA 5KYLA 3NUCA 4WRDA 4OL7A 4EQNA 4NP5A 2F0FA 4K8IA 1KDBA 2EY1A 2WACA 1EY4A 2F0NA 4K6DA 4S3SA 5IOCA 4QMGA 5IODA 4PMCA 1A3UA 1STNA 2EYLA 5I6YA 2KQ3A 2EY5A 5IGCA 3ITPA 3S9WA 4WORA 5CR3A 3TP6A 1SNMA 3SR1A 1NSNS 1NUCA 4B9XA 4N9PA 4R8NA 2EYFA 4PMBA 4F7XA 4DU9A 1EZ6A 3OSOA 4ZUIA 3TP5A 3ERQA 3SXHA 4E6IA 3BDCA 3NP8A 3OMGA 5IGDA 3QOJA 4LAAA 5I9PA 4KTAA 5IIFA 3HEJA 3D8GA 4H7BA 3NXWA 2PW5A 5I6WA 1EYAA 5EKLA 5J1ZA 3T13A 1F2YA 5CV8A 3MEHA 4K5VA 1U9RA 4F8MA 5E3FA 3OMCA 1EY8A 4K5XA 4ODGA 2F0MA 1STYA 4HMIA 4K2KA 2ENBA 3T16A 1ENAA 4MIUA 5HURA 4K14A 2EY6A 2EYJA 1EY9A 1SYDA 1EY0A 5C3XA 2F0OA 4IALA 4KD3A 2F3VA 2SNMA 2EYOA 1AEXA 1SYGA 3SK6A 4DGZA 4RKLA 2F0DA 3TMEA 1F2MA 1SNQA 3SK8A 2OEOA 4N9TA 3RUZA 5DEHA 4G57A 3DHQA 1ENCA 5KRUA 1EYCA 3BDLA 1STGA 3U9OA 3P75A 3D4WA 4ID6A 1EY5A 4K5WA 1F2ZA 1JORA 1EY6A 4K2LA 1STAA 1TT2A 1A2TA 5F2DA 5CC4A 2SOBA 1SNDA 3PMFA 2QDBA 4KV6A 1RKNA 5NUCA 5C4HA 5C5MA 1A2UA 5EKKA 4QB4A 3E5SA 2F0LA 1KDCA 3D4DA 5JOBA 3H6MA 1JOQA 4IUNA 1SYEA 2F0VA 4IZ8A 4KD4A 5CV7A 1KDAA 5IGEA 5CV6A 3P1HA 1SNCA 3DMUA 4KY6A 3QB3A 2PZUA 5CV5A 3MVVA 4J6HA 1IHZA 4I65A 4DFAA 3OWFA 3R3OA 1EZ8A 4J1MA 5C3WA 3QOLA 4NDXA 2PZTA 5CGKA 5JAVA 2OXPA 4RKBA 2HQEA 2F0UA 2PYKA 3NHHA 3C1EA 1EQVA 2M00A 5EGTA 2F0EA 2EXZA 4ME5A 5C5LA 2LKVA 4KJNA 3TP7A 5C6AA 5KIXA 1A3TA 4KHVA 4NKLA 2RBMA 3HZXA 1SYFA 2EY2A 2EYPA 3VA5A 4DF7A 2F0TA 5I9OA 3EJIA 3SK5A 1KABA 5M9OA 4EVOA 4ZQ3A 2F0QA 3NK9A 5IGGA 1STHA 4TRDA 5HGTA 5ISRA 4EQPA 1JOKA 4B9WA 2PQEA 1TR5A 3NQTA 3MZ5A 4HTHA 4KY5A 2RDFA 2F0PA 4KY7A 5CV4A 2F0HA 5DAUA 5J39A 3EVQA 2PW7A 2PZWA 4PNYA 3MHBA 5E1FA 4HMJA 4K8JA 1II3A 4ZUJA 2RKSA 5IGBA 5KYIA 2F0JA 2SNSA 3EROA 3TP8A 1EY7A 2F0GA 1JOOA 1SYCA 3C1FA 1A3VA 3MXPA 3SHLA 2NUCA 1SNPA 4YIJA 4NMZA 5CV9A 3V2TA 1STBA 5J22A 4KJOA 1EYDA 1SNOA 2F0WA 2F0SA 2F3WA 2OF1A 2EYMA 5KGUA 5K5PA 2EYHA 2F0IA 4QF4A 1SYBA 2KHSA 1TQOA 3SK4A 5C4ZA 4EQOA 2O4XA 2F0KA 1KAAA
chains in the Genus database with same CATH superfamily
3LX0A 4X66Q 5AJ3Q 4NP5A 1RODA 4K8IA 1MJEA 2B3GA 4JI0Q 1AZPA 1A3UA 1WTPA 1X3FA 1WCMH 2E2IH 4LK1C 1ILQA 5LMNQ 4HIOA 4RHRA 1GHJA 1NSNS 1LTBD 4OXPA 4JW0A 3CCEA 2B2VC 5DLQE 1E2VA 1PZJD 1B70B 3A55A 1LLRD 1SSOA 4CKCA 1XJVA 3ND8A 2JP1A 1LTSD 4IQZA 2E76C 2ZTEA 4JVZA 4ODGA 2F0MA 1TWGB 3GV3A 1EIYB 1GUTA 4A3IB 1Y1VB 4C1NI 1JJCB 1E3PA 2WB1G 3MXNA 3UI2A 2F4IA 3S15B 1J9OA 5IYDH 1NCVA 5M3MG 3CD6A 4DR3L 1TS4A 2RQXA 3RUZA 3TREA 5BN3A 2B2VA 3GTJH 1WD0A 4QY7A 1WCMB 2UUCL 1PTOD 2BOSA 1XTDA 1C7YA 3O13A 2QF7A 2A68C 2Z9HA 4JV5L 2PZUA 1GUOA 2X6GA 3H0GG 1DYQA 1ML0D 4I65A 5CGKA 3IFTA 3HKZG 3F2CA 1HFGA 2AKWB 3NHHA 2J0TD 2L1BA 4AIMA 4X64L 3VDYA 1S40A 5C5LA 1R9TB 3D4RA 1FVIA 3CQZH 3HKSA 3VA5A 4JYAL 4OONA 4XIGS 2MO1A 5C3EH 4ZQ3A 4DV4L 4DV1L 2KVMA 3TS2A 1EOVA 3AMUA 5E7NA 4LFAQ 3PV0A 4YHHQ 1MSGA 3K7UC 3GTJB 2BH8A 1G6PA 2HHHL 2Z6BA 3K59A 1JJ2A 4QIWB 1VQ7A 3URYA 1EY7A 2F0GA 5CC4A 1LTLA 2C9OA 1G2SA 4PV1C 4KJOA 2OF1A 3NBIA 1H9JA 1A63A 1E2ZA 1LT4D 3L9AX 1TQOA 3WDNA 5K36H 5EKKA 3J7ZC 1XMQL 3P7JA 3D6CA 5IGFA 1VQLA 1UEBA 1QZGA 1D5MC 1N34Q 5IODA 3CC7A 4H44C 2EZVA 5EJWA 1TXYA 2JA6G 3D3RA 5C3EB 2NVTH 5IE8A 1UE5A 2PNRC 1AE3A 1RHPA 3AYHB 5FKAC 4F7XA 4DU9A 1LABA 1TKWB 2K01A 4MZ9A 1CT1D 3TP5A 4JI5Q 3ERQA 1JWUD 4PZ8A 1I4PA 2JA7H 3STBC 2EPBA 2PMZE 3GTGH 3PCOB 1CZWA 1NY4A 2ICEC 1WTRA 4K2KA 2F52A 4X65L 2HIVA 5C4XH 3TRZA 2JSOA 5C0XI 1PDQA 2EY6A 1BKBA 2I0QA 4XYOA 1C0AA 4AYBE 2R3ZA 4MNOA 1UE7A 2OEOA 1RDPD 2UXDL 1CSQA 5KRUA 2K5DA 4C3JH 4UP7A 3SEBA 1F9PA 2TMPA 1S72A 3FKIG 5D65A 4J8QA 3S17B 4K0KQ 1WTXA 2GN5A 3CPWA 3D4DA 3NENA 3BZDB 4NW2A 5CORA 3GTGB 1PXUA 2PYKA 2MGSA 1GUSA 1CKNB 1EQVA 1Y14B 2MO0A 4LNQA 1HPCA 5CYUA 2QKIC 1VQ5A 2B63B 5C4XB 5C6AA 3T1HL 1IXRA 2K5WA 3CCJA 2K7VA 3CCRA 1KNEA 3QO2A 4EX5A 2L55A 1QOHA 1FL0A 1HA5A 1BBXC 1B53A 5M3MH 4DR5Q 2D0OA 5IYCG 2AQ1B 2I5LX 3MHBA 4C3JB 1QCBD 2DNEA 1H9RA 1GO3E 4GN4B 2ZT9C 4HSPA 3T1YL 1K0RA 2NUCA 4ZAIA 2KECA 1MSHA 5IT9c 1PFNA 4DUYL 3VR3A 1LO5D 1SYBA 5JEAH 1RTNA 2L9HA 3ZYYX 1K3RA 3PUVA 5KEEA 3H0GH 4WRDA 1B9MA 4FO2A 2VQEQ 3ONAB 1MHWC 1Q86C 1JB3A 4FF3A 4JI8L 2RSNA 1EYGA 1PV4A 4GKKQ 1HFNA 5M3FH 1TIID 1ZKOA 3CRKC 3E9IA 1V8QA 5M3MB 3BDCA 3NP8A 4LF7L 5IGDA 3K0YA 2E2DC 5I9PA 1Y8OB 3BZKA 4PZ7A 3CCLA 4DK0A 2XTIA 1YIJA 4HMIA 2ENBA 4CKBA 3H3VI 4B3SQ 2F0OA 3A56A 1ZYRD 4FDBA 1KLGD 3VA7A 1IW7C 3H0GB 1SNQA 3SK8A 5JJKA 1C48A 1KD1C 3DHQA 1U4LA 4K5WA 4F88A 3MA2B 1SMXA 4IUVA 3QIAA 1B4OA 1A2TA 3DWPA 3M4OH 3PMFA 4HCEA 4LMQD 4U673 4R4QA 3VR6A 2JA6H 3GDEA 1SMYD 4DAMA 1VQIA 5FJ8H 1ET9A 1FD7D 1KHIA 4A3DH 3TZDA 1RTOA 2JN4A 1GOZA 3V96A 4DV3Q 5GAGC 3R3OA 1LACA 2NN6G 1YHQA 2R93G 1SFOH 4IUUA 4IOCA 3P20A 2JA5G 4KN7C 2A8VA 2M00A 5ELBA 2A73B 1IYJB 1PFSA 2CFMA 4OWWB 2RHQB 5KIXA 4B3TQ 4KHVA 4OIJA 1V9PA 5C4JH 3EJIA 2HQLA 4R4OA 4RGNA 3RN5A 1CI3M 4EQPA 3D31A 4X3KA 2FHTA 2JA9A 2K52A 4DK1A 3CHBD 2F0PA 3MWYW 3H09A 1BR9A 3E3XA 1TWCH 2NVYH 3GTKB 4DV2Q 1YNND 3G4SA 2VNUD 3IKJA 3M4OB 5FLMH 1R4PB 4GKJL 3L2PA 1BCPF 5FOBB 2FJ2A 2JA6B 5C4HA 1B9NA 3FKIH 1MI2A 4L8JA 3HOWH 4A3DB 3H91A 1EQQA 3GO5A 1M4VA 4L63B 3KF8B 1IBKL 4Z9CB 3ULLA 1U4MA 1PLFA 5IOCA 2WACA 1X56A 2ES2A 1QZHA 4DV7L 2HDLA 5C4JB 3EIVA 1HUMA 2KCTA 3ERSX 2YTVA 2DN8A 1HNZL 5CR3A 4KLKA 4B9XA 4KI0A 1PH8A 2MFIA 2F1MA 1HRJA 4LJZC 4IFDI 3OHXC 1EEFD 1TWCB 2NVYB 1K8AC 4UHVA 1X9NA 4NXNQ 3NBHB 2O2LD 2L0CA 3U50C 4JI2Q 2XWJB 1RIPA 4DNRB 1VQAA 5LMUQ 3OMCA 3FKIB 4DV0L 2O5IC 1DD2A 1Q1BA 3S16H 2EYJA 3M9BA 3T4AC 4OIKA 1WOCA 2JJQA 1DOKA 1E24A 1I5FA 2QILA 2CH4A 3NELA 2LXKA 4DV5L 1HCZA 4UPAA 1H9MA 3C3LA 3KJPA 1JWSD 3PUYA 3ICEA 1SDFA 1W6JA 4DXGA 5M5YH 3I8ZA 4QB4A 1Z47A 2DJGC 3F2UA 5LL6S 1Y1WH 5JOBA 2UXCQ 3ULPA 3DM1A 4DR1Q 1IHZA 3F2BA 3OWFA 1I6HH 3VR2A 1IBLQ 1ZEQX 1HNXL 2F0UA 3C1EA 2WAQG 1IBML 4NPSA 3S16B 4UAIA 3CCVA 3N6RA 2ASBA 4AYBG 1G2TA 4TRDA 4IJLA 3S24A 3CC4A 2NZ1D 1N32L 5CV4A 1CHPD 2G9HD 2VB3X 4KHZA 1Q46A 5G3LF 1XTCD 2BE5D 1K8OA 4K8JA 3MTSA 5ELEA 2IWHA 1G51A 5JEAJ 1E0BA 2SNSA 5M5YB 1JOQA 3MXPA 3RNUA 2K04A 2EJFC 1DGSA 2V4DA 4ZLTF 5CBAE 1SNOA 5FO7B 2F3WA 3AB9A 4M8AA 3K5NA 4A3LG 4QF4A 4LFCQ 1I6HB 1Q8IA 1Q82C 1MIUA 2R6GA 3CKIB 3RLOA 1YJWA 1R4QB 2F4VQ 1PMRA 1O7LA 2QGQA 1XNRQ 4BBSG 2FXQA 1QVFA 4DR4Q 2EIFA 1LT6D 1DOLA 3LNNA 4MTKA 4AQYL 4POGA 3KLSA 1FR3A 5GAEC 1EZ6A 4L5SA 1GUNA 4BY7G 4ME3A 4YCUA 1PH2A 1BBUA 5IIFA 4H7BA 5I6WA 1T9HA 1EIGA 2A6EC 2G9DA 4LFBL 1L1OC 1V1OA 2I5MX 5HURA 1SYDA 5FK9C 4DK6C 3E6ZX 3SVMA 1HR0L 5HGQA 1C8CA 4JI6Q 1W2BA 5E4WC 2X6LA 1XPUA 3I91A 2BDOA 1ONLA 2CW0C 3J80L 5EQ0A 3U9OA 1E7ZA 2B2TC 3RLNA 1M90C 4CJ1B 5HY6A 2QDBA 1M8AA 3PIO3 4NB3A 4H13C 3A74A 5C44G 3S2DH 1G6ZA 1I3QH 1A62A 2E75C 1YJNA 2K28A 2F0VA 1L1OA 1SE2A 1QVCA 5CV6A 1SNCA 4KY6A 2NWGA 1NBWA 4QUCA 1JWMD 4DFAA 1EZ8A 5JAVA 2UUAL 1VQDA 4OO1I 1RCVD 2AQ2B 4X62L 4A76A 4GOPB 1TWFH 4JCVE 5IP9H 4HAEA 1BO0A 4JBKA 1S5DD 4DR6Q 2EY2A 3GTPH 4BA2I 2P5ZX 2Y0SB 1J5EQ 3J7AV 1NTGA 4UP8A 4DN4M 2JA8G 3R2IA 2E5LQ 1I4GA 5JJIA 1EIHA 3K6OA 5DAUA 2B29A 3BU2A 1CSPA 1FNUA 4GOPC 4HMJA 1CQVA 1E22A 2QCPX 3OW2A 1QJOA 5IWAQ 1Z7TA 4OHJA 4RWSC 3TP8A 1K83H 2V1CC 2K75A 2OT2A 1I3QB 5CV9A 1STBA 2EJGC 2EYMA 4BWGB 2R7DA 3OW7A 3PQIA 1CKMA 1NR2A 1RJTA 4DR2Q 2AUJD 1K8GA 3FMCA 3EFXD 1OXUA 1TWFB 4QMGA 1KLUD 3GTPB 4XQNA 4CHTB 4ZKBB 5IGCA 3GTMH 3CAMA 3J80E 3R8BA 2WIIB 2IHFA 4P72A 4CGYB 3MXNB 3X3NA 1NJIC 2YV5A 3DXJC 4UY8C 3S1MH 1XPOA 2UXBL 3A54A 5EKLA 4Y52H 1K83B 1HH2P 1EY8A 4K5XA 3HOVG 1STYA 1SXTA 3T16A 1Y8NB 4GN3B 1YJ9A 4LF9L 2KHIA 1VQ6A 1VQBA 2SNMA 1UAPA 2EVBA 4G7HC 3HFZB 4L5TA 1PH1A 1BNZA 1G91A 4BXXG 3BYTB 5DEHA 4ILWA 4G57A 1VQJA 3PUXA 1T5EA 1F77A 1F2ZA 5D14A 1MBYA 1XXGA 3GTMB 4O0AA 1SE3A 2CCZA 4KV6A 1K28A 4BBRG 1V1PB 2D62A 2NZOA 4O1NA 4KD4A 4R4TA 1NAPA 4DR3Q 1R9TH 1ASZA 3S1MB 3AQQA 3MVVA 4J1MA 1SN8A 3K81C 1EIFA 1O7ZA 2UUCQ 1VQOA 4ME5A 2PQAA 1FYCA 2B39A 1IL8A 3LWEA 2F0TA 4C3IH 3GP7A 4JV5Q 5AFWA 3CC2A 1JOKA 1TR5A 2VS1A 1O78A 4CJ2C 2WV6D 1T5XD 1BCPD 4LF6L 1XX8A 3GD7A 1GUWA 1VQHA 3M7GA 3PUWA 5EBDA 4C1NK 4X64Q 2UUBL 1U5KA 4KHPL 4BBSB 3ER0A 2R92G 4JYAQ 3W3AA 3QG1A 2Z4IA 2PNHA 3C1FA 1A3VA 2CQOA 3UDIA 4DV4Q 1C9OA 4DV1Q 4RAUC 5C44H 2R61A 1AE2A 2JYOA 1SROA 5C4ZA 4EQOA 2KCCA 1M1KC 1PH5A 2JE6I 2NVQH 2HHHQ 3CF5A 1FNVA 5BN5A 3HOXG 2IX3A 1F2LA 2D5DA 1OXVA 4BY1G 2VXWA 4C3IB 2LFNA 1Q7YC 4IFDJ 3D6WA 4YY3L 4A93H 1B2TA 2EYFA 3LGJA 3OSOA 1E2WA 4Y7NH 3W2DA 2L4NA 2JA8H 1XMQQ 2AUKA 4A3GG 3NPPA 4IOAA 1SJHD 4KTAA 1X54A 4YWKA 3HGBA 2VQFL 3A7AB 1TU2B 4RFBA 1PH4A 3HOZH 2MNAA 5C44B 1YNXA 4K14A 5C3XA 3TS0A 4GLXA 1FNWA 1I6VC 3M4QA 3ULJA 3S17H 1JB7A 5C0XG 2YTYA 4CJ0B 2NVQB 3S1NH 1S5ED 2ICIA 1CZGA 2K5NA 1JCKB 4H0LC 4FNFA 4R8IA 4HIDA 2NVXH 3BG3A 4K6LA 1CFMA 2RDHA 3D4WA 3U4ZA 4C3HG 4X65Q 1JORA 2RCFA 1QILA 1Z6HA 3TDQA 3M4PA 4A93B 2E8GA 3HP3A 1I4HA 4Y7NB 2JA8B 1QB5D 2B63H 2Q8RE 3S14H 4IPDA 5LMNW 2UXDQ 1F9RA 2NYZD 1IYVA 1RF2D 4A3EG 1Y69U 3GV6A 3K58A 4Q0FA 1LUZA 2F0EA 3NTHA 3HOZB 2HCCA 4FVMA 2AMCB 3PF5A 5I9OA 5ELFA 5G3LD 5IP7G 2CWAA 3ND9A 1LV9A 2F0QA 3PUZA 4JI5L 1BXTA 2EXDA 3S1NB 2NVXB 3BJUA 2IX0A 4IUTA 1PH9A 5E1FA 4I7AA 4A3MG 3T1HQ 1VMPA 3MFGA 4XYQA 4R4CA 4OX9L 1TS3A 1DJRD 2NTSA 3IFDA 4ULLA 4YIJA 4LF8L 1BF4A 2Z0SA 1MGSA 3S14B 4A3JG 3A8JE 2B2WC 4ALPA 3A5ZB 3M3YH 2XRQD 2F0KA 1Q12A 4EGVA 2GVAA 3D0FA 1IL2A 2AQ3B 2F0FA 2HIXA 3STBD 3T1YQ 1LTAD 1MKHA 3HOUG 4ABNA 5ELDA 2B2YC 1RL2A 1VQFA 2KEEA 4DUYQ 2VW9A 5JVG3 4HN7A 1XYIA 1O80A 3I4MG 5JJZA 4DXFA 1KRSA 2MJ8A 5CBEE 3SXHA 4E6IA 3QWNA 3BVZA 5CV8A 2B2WA 1KAWA 4JI8Q 2AWOA 4P73A 4JOIA 4A3FG 3M3YB 4LF7Q 4DGZA 3I4NG 2KHJA 4L6TB 1A6XA 2B2YA 4CDCC 2RSOA 1EUJA 2WB1B 2ATWA 3OYYA 1ILPA 1Q81C 3RMHA 1D6EC 1STEA 2QW7A 4QIWE 2Q2TA 2K6AA 1AZQA 4DV6L 1RKNA 2LS01 3FP9A 4BY1H 3J7YW 1D7QA 1YITA 4DKAC 1SYEA 3K5MA 1KDAA 3OPOA 1DOMA 3VYSA 4O2DA 1CKNA 2JXMB 1QWYA 1D5XC 2DUDA 4TQUS 3PF4A 2DY8A 4RMFA 5C3WA 2PZTA 1K3BC 5L37A 4GS3A 5EGTA 3NWSA 4XDXA 3HKZB 3RN2A 4QGUA 3GTKH 1SYFA 2OQKA 1BOSA 1D5ZC 3NQIA 3DLLA 3SK5A 1GD7A 5ELOA 2MQHA 1VQ4A 2KENA 1GM5A 1PZKD 4B9WA 1DZ1A 3KUPA 4KY7A 2VUMG 3FHWA 1VF7A 3EVQA 4YWMA 2PW7A 4DAVA 5C0XH 3KBGA 1UNSA 4RGMA 5E4XA 4FXKC 4JC0A 3UE0A 3V05A 2RVLA 2KOLA 3CPFA 4BY1B 1UEAB 4RH6A 3F2DA 1BVSA 3GTQH 1CA6A 1JOOA 2A69D 4DF7A 1C4QA 1WFQA 4NMZA 1K73C 1OO9B 2L11A 3I73A 2EYHA 2F0IA 2FINB 1LYLA 3VYRA 2IW3A 4A3GB 4L5QA 1V1QA 2CKZB 3J81L 4GKJQ 1XMOL 3K80C 4K6DA 4A3EH 1EQRA 3F8TA 1EL0A 3KLSX 1A8VA 5I6YA 2N55A 1NMFA 4P2CB 4PZ6A 1RD9D 4DR7L 1PRTB 1S5BD 2N3SA 3G6EA 4PMBA 2D0PA 2CVRA 1IBKQ 2ALYB 4FF1A 1BUVT 2FMCA 5T1IA 4DV7Q 4C3HB 2A6HD 3KLWA 3I4LA 4IFDG 3GTQB 1HNZQ 4P71A 1KIXA 4CDDC 1HA6A 1PRTC 3KDFA 3SGIA 2ZXOA 4QUFA 4KD3A 1SYGA 2AHOB 3HS0C 1B3QA 4HJ9A 2RCNA 4A3JH 1HZ9A 1EEID 3I7FA 4L5RC 4A3EB 4B3RL 2F3IA 1QE6A 1STGA 4GN5A 4DV0Q 3BVMA 1TY2A 3SE0A 1SBBB 3F1ZA 3WOFA 5IYCH 1P8LA 1A2UA 4XTCS 1J8IA 3HG9A 2F0LA 5IGEA 2IJ0A 5EPLA 2A1AA 3I2ZA 2NTTA 4UDUC 4DV5Q 5EKIA 4IPGA 4NDXA 2IT1A 4HJ7A 2YYZA 4OWTB 4JPBW 2DY7A 1HJPA 1WTHA 1BBWA 3GTLH 4KJNA 1A3TA 3J81E 3HZXA 1XWEA 1DONA 2KEDA 2WB1E 2N49A 4XXEA 2N8NA 5HGTA 1H9SA 3CCUA 4A3JB 2ZM6L 3NQTA 3BDOA 2RDFA 1HNXQ 4R4IA 1I50H 1JR0D 3J7A5 3AFQA 1IBMQ 1II3A 5IGBA 1TWAH 4N8X1 3G71A 3EROA 1WTOA 1J6QA 1HZBA 3MEFA 4RHSA 1TS2A 2K03A 2E2HH 3I4MB 1U0LA 4KN4C 1QUQA 1N32Q 1QNUA 4DNIA 2EOTA 2K33A 2DNCA 1QVGA 3HKZE 4GNXA 1K8MA 1L0XB 3GTLB 1WJJA 1YBYA 4S3SA 4NXML 2Z4HA 1LTTD 3FPUB 5GROA 1LTRD 3TP6A 4LF5Q 4N9PA 2EQSA 2BDNA 1I50B 3Q8DA 4A4IA 1VQ9A 1PFMA 2Q2IA 3A8KE 4A3CG 1SR3A 3QR8A 2K1BA 1XNQL 5J1ZA 1TWAB 1AW7A 1F9SA 2Q2HA 2PPBC 4FYDA 3A5UA 1SLJA 1CKOA 2E2HB 2NN6H 1EWHA 2R93H 1QG7A 3CRLC 4AQYQ 2JA5H 2OQ0A 3OWEB 5GADC 3H3VC 4WJWA 1L1OB 2KUMA 3SK6A 3JC66 3C46A 4DUZL 4MTNA 1GKHA 1N36L 4QCLA 1DM0B 2JEBI 3OTOL 4LFBQ 4ID6A 2NBFA 1YNJD 3NTIA 4AH6A 5JVH3 4HJAA 2CWPA 1KDCA 1HR0Q 3PO3G 4JI1Q 2VUMB 4LUVA 4B3ML 4RA8A 3MC0B 2HCIA 2QEJC 2HQEA 4MHEA 1I94Q 1X3QA 4DNTB 2EXZA 2UU9L 3TQYA 2R93B 2RDGA 3B6YA 1L0YB 2C35B 3LWUA 2Q2UA 3E0JA 2JA5B 3FPPA 2EYPA 4OO1G 2YU9H 2ID0A 2N88A 4IUPA 4Q5VA 2ZJRA 3A0JA 1VS0A 4F87A 2UUAQ 3KK7A 2JEAI 3J81c 1KL9A 2XNAC 5BR8L 4JI3L 4X62Q 3J81j 1FJGL 3R2TA 1W6KA 2F0JA 3G48A 1S4ZA 4RGOS 5DM73 1SNPA 4BA1I 1X3PA 4XQJA 2F0SA 1X6OA 3BZCA 1N9WA 1VQEA 4ZK9B 5KYLA 1DCZA 2PCFB 2LXJA 3AFPA 2QA4A 2AWNA 2H5XA 3QJYA 1MJCA 1NNXA 1VF5C 1KDBA 2XWBB 3VR4A 1PTOH 2A6ED 2YU9B 3CXCA 3SR1A 3OMGA 4I7ZC 1GVPA 1U4RA 1F9QA 4LF4L 5IY0A 1HNWQ 2DJFC 2CW0D 4JI4L 1HTPA 1ENAA 1TWHH 5K36G 1D1IA 2KCMA 3A7LA 5IYBG 2JK8A 4PMWA 3OOCA 2X69A 2A5HA 1OXSC 2PI2E 3DUZA 3I3CA 4CKEA 1KNAA 1PHJA 1WVLA 1PTOB 2QEXA 3I55A 3KLRA 4LF9Q 4TSSA 2PQAB 4V190 3Q6SA 4JI7L 2JA7G 3E5SA 2CHBD 1PYBA 5A35A 2RA4A 2VL6A 4N8FA 1A0IA 1Q90A 3W1BA 3P1HA 2L15A 3EN2A 2Z6KA 3MXUA 4TKOB 1CTMA 2R7FA 1O7IA 4A3CH 4PQXA 1K9MC 3C2PA 4A3LH 3M85A 1N33L 5C4XG 1PTOC 2PMZB 1CUKA 4G4KA 3T53B 3I56A 1PZID 1H95A 1JJGA 1WTWA 5JPNC 1TWHB 2KBNA 1GXDC 1EU3A 2WAQB 2B8GA 3JAML 3RZOH 1PYWD 1W3SA 3KF6A 4BBSH 3CMAA 4R1JA 1GHKA 2I07B 3AU7A 4C3JG 5EPKA 4AYBB 5TSSA 1VQKA 3MXGA 3K7AH 5AJ3L 4X66L 3H15A 4BY7H 2SDFA 3FVQA 5EBCA 2MUYA 2L5TA 1LM0A 5IT9L 4JI0L 2ZXRA 4DAYA 2K4KA 3V2TA 5J22A 1EYDA 4TVAB 4LF6Q 3T56B 5LMNL 1MD2D 3PO3H 4IPCA 3PIPA 3CW2C 3Q0AA 4A75A 2UUBQ 2XGTA 5A2QL 1KC8C 4KHPQ 1IYUA 1LTGD 3J81i 4EQNA 3S2HH 1CHQD 1STNA 3RD4A 2WINB 3RZOB 3UDFA 1X3EA 1NMGA 1ASYA 4OO1H 4R8NA 2O5JC 2GVBA 2I5HA 1WTVA 5EPJA 3K7AB 4LAAA 5I4DA 2E2IB 3D8GA 4IJHA 5M5WH 3NXWA 2PW5A 4BY7B 3T51B 1F2YA 1PRTF 2PO4A 2WKDA 2CQAA 4F8MA 5JEAG 1PVOA 1G291 4YY3Q 4CDFC 1HXYD 1JE5A 2Y0SE 2EDGA 1EY0A 5LL6X 3PO3B 3DEOA 5DNFA 1ESRA 3DEPA 4UP9A 1S5FD 2WFWA 3JAME 3U4VA 2RF4A 4RG1A 3S2HB 1V1PA 1EYCA 2VQFQ 2K5HA 3J80c 5M3FG 1AH9A 2SOBA 1B1ZA 1HQRD 2KJXA 3EBEA 5C5MA 4XT3B 4RGTA 3H6MA 4IUNA 4QL5A 5IT9E 1ICWA 1VQPA 1BDOA 5M5WB 1X3GA 3QOLA 4J15A 4YHHL 1EU4A 1YVCA 4LFAL 2BA0A 2A68D 1ENFA 2LKVA 3TP7A 5A2QE 2M2LA 3BVGA 2D2CC 4EVOA 5IGGA 1AFPA 1OTCA 5IYBH 2YTXA 1U4PA 2VY3A 4KY5A 1EWIA 2F0HA 1YHAA 2IL8A 2XRSD 4C2MH 3IAYA 3CQZB 5FLXL 1O7YA 1PH7A 4V0BA 1VQNA 2BA1A 4LUZA 1HUNA 5FJ8G 4A3DG 4DA2A 5M5XH 1N34L 1SYCA 4XQQA 1SE8A 1H9KA 1OXXK 4JBWA 1Q1EA 2I46A 1Q3LA 4DK3C 3HOVH 1YI2A 1V43A 2WAQE 4OX9Q 4OL7A 3I70A 5I2XA 4BXXH 1DXMA 2KQ3A 4LF8Q 4YWLA 1E1OA 2FFKB 4PG3A 2HUGA 4KKTA 1B50A 4HIMA 3M7NA 4ZUIA 4C2MB 5FLMG 4BBRH 3L3OC 3QOJA 4LWCA 4IUQA 2NVTB 4IN3A 3OIQA 3RZDH 3HOWG 5M5XB 3MEHA 1S5CD 1U9RA 2DGYA 5ELNA 1SE4A 3CP0A 4JOIC 2JA7B 4WJ4A 4HEDA 3HOVB 4K0KL 2BCOA 4A3BG 2F3VA 1GJXA 2ZXPA 5GQOA 1P16A 4XT1B 2D9UA 1EQTA 3DWAA 3DWQA 3PO2G 4N9TA 3L0OA 2NZHA 3G6JB 3KYHC 4FP5D 5I2YA 3P75A 1X65A 3FRPB 4K2LA 4POFA 1K0SA 3PIP3 5FLXE 3UDGA 3JAMc 1ZYRC 5NUCA 4OGQC 3TEHB 4FF4A 2R7ZG 3Q22A 1TS5A 4IZ8A 4BBRB 1BQQT 3KBXA 2R92H 3NE5B 4DAPA 1VMCA 3KJOA 3RZDB 4A3KG 2K14A 4DR5L 5KNDA 4DV6Q 4P74A 1SMYC 5CMDA 3I90A 1N8RC 2RBMA 3X3MA 3J80i 2Q8TA 3HOXH 2HDMA 1IKLA 4HCSA 2EJMA 4FXGC 2QDLA 2A69C 1A15A 2FMMA 3ZJYC 1YHBA 3KOJA 3L7ZC 1EOTA 1UWVA 4ZUJA 2Z8LA 1Y1WG 2RKSA 3R93A 3RR5A 5KNCA 4A3GH 1PYSB 3EA6A 2VQEL 4HIKA 2H4OA 3K5OA 5FO8B 1TY0A 2R92B 3Q23A 5KGUA 1B3AA 3NTKA 1I4RA 3MFYA 4GKKL 5D3IB 1YNNC 5D3DA 3KFUA 2SEBD 3NUCA 3I72A 2KCNA 3G7LA 1JC7A 3HOYG 4H02A 4X6AH 2EY5A 3HOXB 4ZKCB 1KTKA 3KDFB 2A6HC 4C3HH 1HHVA 2LMCB 4B3SL 4U68A 3M4YA 1ICFB 1XMOQ 3HEJA 2IPKD 1NR4A 1YEZA 4K5VA 5M3FB 1EFID 1PFBA 1KQSA 4DR7Q 2GA4B 1EFWA 5FO9B 1AEXA 4RKLA 1IZ6A 3TMEA 1B44D 1PH3A 3DM3A 5IP7H 3W1GA 3K0XA 4DV3L 1ENCA 1B8AA 1EY6A 1STAA 1SRUA 2K32A 1IW7D 3CMEA 3Q24A 2HD3A 4B3TL 4A3MH 2Q8IB 2NN6I 4OEMB 4G7OC 1H9SB 1SJED 1WI5A 1PTOF 3PGZA 1HQMC 3EQLC 5FLXc 2KA7A 4GLAC 4B3RQ 4O42A 3IRBA 1XPRA 2OXPA 4KKSA 4RKBA 1FGUA 1HTLD 1ZXTA 1SAPA 2IHEA 4DV2L 1I4XA 1JQYD 2K05A 2Y0SG 3W5OA 1JICA 2B2UC 1KABA 1SFOB 3NK9A 3JAMi 3PIOA 1QUQB 1WD1A 2PQEA 3HOUH 4A3BH 1OXTA 5J39A 4YCVA 2RHSB 3PO2H 4GNXB 3I4MH 2J4XA 4WFN3 3U9SA 2MHVA 2BH2A 3BS1A 2ZJPA 5BN4A 2OCEA 4A3MB 2ZTCA 1WTQA 1L0WA 5ELCA 2TSSA 2ZM6Q 2R7ZH 1UUPA 4C56C 1D8LA 2BE5C 5IP9G 2B2UA 4GNXC 1VQGA 4A3FH 1D1KA 4A3KH 3HOWB 4NXNL 3HRZC 4APVA 2EY1A 3I4NH 1EY4A 4JI2L 3H3VH 1VDZA 4PMCA 2EYLA 5LMUL 3WOEA 2OTJA 1SNMA 2ZJQA 1NUCA 3HOUB 1LTID 4A3BB 3CCMA 1PRTD 2H1EA 2EE1A 2VZAA 3PO2B 4HJ5A 1JE4A 1VQCA 4ZRZA 3KF8A 1QNKA 4FXDA 4NXMQ 1EYAA 3T13A 4RCOA 3WWVA 2M9VA 4GZYC 4MIUA 1CM9A 3S1RH 2R7ZB 4IO9A 1UE6A 2MP1A 2LSSA 1EY9A 4G7ZC 4LUOA 1HZAA 1YNJC 2EYOA 4HJ8A 3VR5A 2F0DA 4A3FB 1XNQQ 1F2MA 2UXCL 1HZCA 4A3KB 3NBHA 4RCNA 4DR1L 3I4NB 1IBLL 1CA5A 3BYYB 2Z1CA 1E1TA 4P75A 2VUMH 5F2DA 3HOYH 1SNDA 2WP8J 4A3IG 3TN2A 1Y1VG 4LW1A 3CCQA 2NB0A 4DUZQ 1JT8A 4X3TA 2C5CA 3DMUA 1N36Q 3QB3A 2ZTDA 1G8ZD 1X32A 3NEMA 5EAYA 4OWXB 1PH6A 3OTOQ 2JQOA 5GAHC 1Y1WB 4EQ5A 3K8AA 2N78A 1WCMG 4BS9A 3S1RB 5H1SE 1GUGA 3CU7A 1KXLA 4LF5L 1FGBD 4FF2A 3FEWX 4B3MQ 3MZ5A 4HTHA 4ZCKA 4LFCL 2PZWA 3E9HA 3SDZA 2UU9Q 1Z9FA 2OTLA 3HOYB 4JK1C 3GQBA 4JG2A 2F4VL 3S1QH 4WJ3M 4KMUC 1XNRL 1LT5D 4GLVB 2F0WA 4IURA 3K57A 4HR7B 1CK1A 1UE1A 5IYDG 4MN3A 4DR4L 4IFDH 3CCSA 3AEVA 1WYDA 5BR8Q 4M1UB 4ZYSA 4JI3Q 3SK4A 3PSIA 2LY7A 5C0XJ 2OWOA 2PI2A 4QQBX 1KAAA 1FJGQ 5T1GA 3E0EA 2IX1A 4C3IG 1X55A 5DM63 2HT1A 2A19A 2CH4W 4KKUA 2F0NA 4JBJA 1AP0A 3J7AF 4X3UA 3ITPA 4X3SA 1CQFA 3S9WA 1ET6A 4WORA 2XVSA 4JI1L 1Q8KA 3NWTA 4QJFA 2E2JH 3NSWA 1L2FA 1YZ6A 2L12A 4YCWA 2A74C 3UE1A 4JI6L 1I94L 1VQ8A 1NE3A 3VYTA 1PA6A 3U58A 3FDTA 3GTOH 5JJLA 5E3FA 3S1QB 3UDXA 5C3EG 4DPGA 4IALA 4OELB 1AN8A 1B7YB 4LF4Q 2G5DA 3A8IE 1I4QA 3K5LA 3BDLA 1EY5A 4A93G 3TBIB 4JI4Q 3TSSA 5COYA 4IPHA 2B2TA 2IY5B 1TT2A 3OIPA 3N52A 2XN9C 4DR6L 2E2JB 5LHY1 2B8FA 2XSCA 3H94A 5CV7A 1VQMA 3I4OA 1J5EL 3KF6B 1Y8PB 2Z6KC 1KRTA 3TZUA 3MAQA 1ESFA 5CV5A 2K5VA 4J6HA 2E5LL 3GTOB 2K5QA 2J7ZA 3HOZG 3VYUA 3IL8A 3RLFA 3S2DB 4B08A 2UXBQ 1SEBD 1VCIA 1EWCA 4HSVA 4JI7Q 5IWAL 1S3OA 2K50A 4NKLA 5M9OA 2MPMA 4DAYB 1IKMA 4JBMA 1LT3D 1STHA 5ISRA 5J3BA 1BCPB 1N33Q 4PNYA 1HNWL 5JPMC 4DR2L 2F03A 4GOPA 2VB2X 5KYIA 4CDEC 1D2BA 2B63G 4R9WA 2XIWA 2WKCA 4CBVA 5KNBA 3SHLA 4KK7A 1TWGH 1TVXA 1BCPC 2E74C 5K5PA 4A3IH 1JMCA 1Y1VH 2KHSA 3S15H 2O4XA 1HR0W
chains in the Genus database with same CATH topology
3LX0A 4NP5A 1RODA 4K8IA 1AZPA 1A3UA 1WTPA 4LK1C 1ILQA 4RHRA 1GHJA 1NSNS 1LTBD 2B2VC 1E2VA 1PZJD 3A55A 1LLRD 1SSOA 4CKCA 3ND8A 2JP1A 1LTSD 4IQZA 2E76C 4ODGA 2F0MA 1TWGB 3GV3A 1GUTA 4A3IB 1Y1VB 4C1NI 3MXNA 3UI2A 2F4IA 3S15B 1J9OA 1NCVA 1TS4A 2RQXA 3RUZA 5BN3A 2B2VA 1WD0A 1WCMB 1PTOD 2BOSA 3O13A 2QF7A 2A68C 2PZUA 1GUOA 2X6GA 4I65A 1DYQA 1ML0D 5CGKA 3IFTA 1HFGA 3NHHA 2J0TD 2L1BA 5C5LA 1R9TB 3D4RA 3VA5A 4XIGS 4ZQ3A 2KVMA 3AMUA 3PV0A 1MSGA 3GTJB 3K59A 4QIWB 3URYA 1EY7A 2F0GA 5CC4A 2C9OA 1G2SA 4PV1C 4KJOA 2OF1A 3NBIA 1H9JA 1E2ZA 1LT4D 3L9AX 1TQOA 3WDNA 5K36H 5EKKA 3P7JA 3D6CA 5IGFA 1D5MC 5IODA 2EZVA 4H44C 5EJWA 3D3RA 5C3EB 2PNRC 1RHPA 5FKAC 4F7XA 4DU9A 1LABA 1TKWB 2K01A 1CT1D 3TP5A 3ERQA 1JWUD 1I4PA 2EPBA 1CZWA 2ICEC 1WTRA 4K2KA 2JSOA 5C0XI 1PDQA 2EY6A 4XYOA 2R3ZA 2OEOA 1RDPD 5KRUA 2K5DA 3SEBA 1F9PA 2TMPA 5D65A 4J8QA 3S17B 1WTXA 3D4DA 3BZDB 4NW2A 5CORA 3GTGB 1PXUA 2PYKA 2MGSA 1GUSA 1EQVA 1HPCA 5CYUA 2QKIC 2B63B 5C4XB 5C6AA 2K5WA 2K7VA 1KNEA 3QO2A 2L55A 1QOHA 1HA5A 1BBXC 1B53A 2AQ1B 3MHBA 4C3JB 1QCBD 2DNEA 1H9RA 2ZT9C 4HSPA 2NUCA 4ZAIA 2KECA 1MSHA 1PFNA 3VR3A 1LO5D 1SYBA 5JEAH 1RTNA 2L9HA 3ZYYX 3PUVA 5KEEA 4WRDA 1B9MA 4FO2A 3ONAB 1JB3A 4FF3A 2RSNA 1HFNA 1TIID 1ZKOA 3CRKC 1V8QA 5M3MB 3BDCA 3NP8A 5IGDA 3K0YA 2E2DC 5I9PA 1Y8OB 4DK0A 4HMIA 2ENBA 4CKBA 2F0OA 3A56A 1ZYRD 1KLGD 3VA7A 1IW7C 3H0GB 1SNQA 3SK8A 1C48A 3DHQA 1U4LA 4K5WA 4F88A 3MA2B 4IUVA 3QIAA 1B4OA 1A2TA 3DWPA 3PMFA 4HCEA 4LMQD 4U673 3VR6A 1SMYD 1ET9A 1FD7D 3TZDA 1RTOA 1GOZA 3V96A 3R3OA 1LACA 2NN6G 4IUUA 3P20A 4KN7C 2M00A 5ELBA 2A73B 5KIXA 4KHVA 4OIJA 3EJIA 4RGNA 1CI3M 4EQPA 3D31A 4X3KA 2FHTA 4DK1A 3CHBD 2F0PA 3MWYW 3H09A 1BR9A 3GTKB 1YNND 2VNUD 3IKJA 3M4OB 1R4PB 1BCPF 5FOBB 2FJ2A 2JA6B 5C4HA 1B9NA 1MI2A 4L8JA 4A3DB 3H91A 3GO5A 1M4VA 4L63B 4Z9CB 1U4MA 1PLFA 5IOCA 2WACA 2HDLA 5C4JB 1HUMA 2DN8A 5CR3A 4B9XA 4KI0A 2F1MA 1HRJA 4LJZC 4IFDI 3OHXC 1EEFD 1TWCB 2NVYB 2O2LD 2L0CA 2XWJB 4DNRB 3OMCA 3FKIB 2O5IC 1DD2A 1Q1BA 2EYJA 3T4AC 4OIKA 1DOKA 2QILA 1HCZA 1H9MA 3C3LA 1JWSD 3PUYA 1SDFA 1W6JA 4DXGA 3I8ZA 4QB4A 1Z47A 3F2UA 5LL6S 5JOBA 3DM1A 1IHZA 3OWFA 3VR2A 1ZEQX 2F0UA 3C1EA 3S16B 4UAIA 3N6RA 1G2TA 4TRDA 2NZ1D 5CV4A 1CHPD 2G9HD 2VB3X 4KHZA 5G3LF 1XTCD 2BE5D 1K8OA 4K8JA 3MTSA 5ELEA 2IWHA 5JEAJ 1E0BA 2SNSA 5M5YB 1JOQA 3MXPA 2K04A 2EJFC 4ZLTF 5CBAE 2V4DA 1SNOA 5FO7B 2F3WA 3AB9A 4M8AA 3K5NA 4QF4A 1I6HB 1Q8IA 2R6GA 3CKIB 1R4QB 1PMRA 1O7LA 1LT6D 1DOLA 3LNNA 3KLSA 1FR3A 1EZ6A 1GUNA 5IIFA 4H7BA 5I6WA 1EIGA 2A6EC 2G9DA 1V1OA 5HURA 1SYDA 5FK9C 3E6ZX 3SVMA 1C8CA 5E4WC 2X6LA 3I91A 2BDOA 1ONLA 2CW0C 3J80L 5EQ0A 3U9OA 2B2TC 4CJ1B 2QDBA 1M8AA 3PIO3 4H13C 1G6ZA 2E75C 2K28A 2F0VA 1SE2A 5CV6A 1SNCA 4KY6A 2NWGA 4QUCA 1JWMD 4DFAA 1EZ8A 5JAVA 4OO1I 1RCVD 2AQ2B 4HAEA 1BO0A 1S5DD 2EY2A 4BA2I 3J7AV 2Y0SB 4DN4M 3R2IA 1I4GA 1EIHA 3K6OA 5DAUA 1FNUA 4HMJA 1CQVA 2QCPX 1QJOA 1Z7TA 4OHJA 4RWSC 3TP8A 2OT2A 1I3QB 5CV9A 1STBA 2EJGC 2EYMA 4BWGB 3OW7A 1NR2A 1RJTA 2AUJD 3FMCA 3EFXD 1OXUA 1TWFB 4QMGA 1KLUD 3GTPB 4XQNA 4CHTB 4ZKBB 5IGCA 3J80E 3R8BA 2WIIB 4CGYB 3X3NA 3DXJC 3A54A 5EKLA 1K83B 1EY8A 4K5XA 1STYA 1SXTA 3T16A 1Y8NB 2SNMA 1UAPA 2EVBA 4G7HC 1BNZA 1G91A 3BYTB 5DEHA 4ILWA 4G57A 3PUXA 1T5EA 1F77A 1F2ZA 5D14A 1MBYA 1XXGA 3GTMB 1SE3A 4KV6A 1V1PB 2D62A 4O1NA 4KD4A 1NAPA 3S1MB 3MVVA 4J1MA 1O7ZA 4ME5A 1FYCA 2B39A 1IL8A 3LWEA 2F0TA 3GP7A 5AFWA 1JOKA 1TR5A 4CJ2C 1O78A 2WV6D 1T5XD 1BCPD 1XX8A 3GD7A 1GUWA 3PUWA 3M7GA 4C1NK 5EBDA 4BBSB 3W3AA 3QG1A 2Z4IA 3C1FA 1A3VA 4RAUC 2R61A 2JYOA 5C4ZA 4EQOA 2KCCA 2JE6I 1FNVA 5BN5A 2IX3A 1F2LA 2D5DA 1OXVA 2VXWA 4C3IB 2LFNA 4IFDJ 3D6WA 1B2TA 2EYFA 3OSOA 1E2WA 3W2DA 2L4NA 2AUKA 3NPPA 1SJHD 4KTAA 3HGBA 3A7AB 1TU2B 4RFBA 5C44B 4K14A 5C3XA 1FNWA 1I6VC 5C0XG 4CJ0B 2NVQB 1S5ED 2ICIA 1CZGA 1JCKB 4H0LC 4FNFA 4R8IA 3BG3A 4K6LA 1CFMA 2RDHA 3D4WA 4C3HG 1JORA 1QILA 1Z6HA 3TDQA 4A93B 3HP3A 1I4HA 4Y7NB 2JA8B 1QB5D 2Q8RE 1F9RA 2NYZD 1IYVA 1RF2D 1Y69U 3GV6A 3K58A 4Q0FA 2F0EA 3NTHA 3HOZB 2HCCA 4FVMA 5I9OA 5ELFA 5G3LD 3ND9A 1LV9A 2F0QA 3PUZA 1BXTA 3S1NB 2NVXB 2IX0A 4IUTA 5E1FA 1VMPA 3MFGA 4XYQA 1TS3A 1DJRD 2NTSA 3IFDA 4ULLA 4YIJA 1BF4A 1MGSA 3S14B 3A8JE 2B2WC 2XRQD 2F0KA 1Q12A 4EGVA 2AQ3B 2F0FA 1LTAD 4ABNA 5ELDA 2B2YC 2KEEA 1XYIA 5JVG3 4HN7A 1O80A 5JJZA 4DXFA 2MJ8A 5CBEE 3SXHA 4E6IA 3QWNA 3BVZA 5CV8A 2B2WA 2AWOA 3M3YB 4DGZA 4L6TB 1A6XA 2B2YA 2RSOA 2WB1B 1ILPA 3RMHA 1D6EC 1STEA 2K6AA 1AZQA 1RKNA 2LS01 3J7YW 1SYEA 3K5MA 1KDAA 3OPOA 1DOMA 3VYSA 2JXMB 1QWYA 1D5XC 4TQUS 2DY8A 5C3WA 2PZTA 5EGTA 3NWSA 4XDXA 3HKZB 1SYFA 1BOSA 1D5ZC 3NQIA 3SK5A 1PZKD 4B9WA 1DZ1A 3KUPA 4KY7A 1VF7A 3EVQA 2PW7A 4DAVA 5C0XH 3KBGA 1UNSA 4RGMA 5E4XA 4FXKC 3V05A 2RVLA 2KOLA 4BY1B 1UEAB 4RH6A 1CA6A 1JOOA 4DF7A 2A69D 1C4QA 4NMZA 1OO9B 2L11A 3I73A 2EYHA 2F0IA 2FINB 3VYRA 2IW3A 4A3GB 3J81L 4K6DA 1EL0A 3KLSX 5I6YA 2N55A 4P2CB 1RD9D 1PRTB 1S5BD 4PMBA 2CVRA 4FF1A 1BUVT 2FMCA 5T1IA 4C3HB 2A6HD 3I4LA 4IFDG 3GTQB 1HA6A 1PRTC 2ZXOA 4QUFA 4KD3A 1SYGA 3HS0C 1EEID 4A3EB 1QE6A 1STGA 3BVMA 1TY2A 3SE0A 1SBBB 3WOFA 1A2UA 4XTCS 1J8IA 3HG9A 2F0LA 5IGEA 2IJ0A 5EPLA 2NTTA 4UDUC 5EKIA 4NDXA 2IT1A 2YYZA 2DY7A 4KJNA 1A3TA 3J81E 3HZXA 1XWEA 1DONA 2KEDA 4XXEA 5HGTA 1H9SA 4A3JB 3NQTA 3BDOA 2RDFA 1JR0D 1II3A 5IGBA 3EROA 1WTOA 4RHSA 1TS2A 2K03A 3I4MB 4KN4C 1QNUA 2EOTA 2K33A 2DNCA 1K8MA 1L0XB 3GTLB 4S3SA 2Z4HA 1LTTD 3FPUB 1LTRD 3TP6A 4N9PA 2BDNA 1I50B 1PFMA 3A8KE 2K1BA 5J1ZA 1TWAB 1AW7A 1F9SA 2PPBC 4FYDA 2E2HB 2NN6H 1EWHA 1QG7A 3CRLC 3OWEB 3H3VC 4WJWA 2KUMA 3SK6A 3C46A 4QCLA 1DM0B 2JEBI 4ID6A 2NBFA 1YNJD 3NTIA 5JVH3 1KDCA 2VUMB 4RA8A 3MC0B 2HCIA 2QEJC 2HQEA 4MHEA 1X3QA 4DNTB 2EXZA 2R93B 2RDGA 1L0YB 3LWUA 2JA5B 3E0JA 3FPPA 2EYPA 4OO1G 2ID0A 2N88A 4IUPA 4Q5VA 4F87A 3KK7A 2JEAI 2XNAC 3R2TA 1W6KA 2F0JA 1S4ZA 4RGOS 5DM73 1SNPA 4BA1I 1X3PA 4XQJA 2F0SA 4ZK9B 5KYLA 1DCZA 2PCFB 2AWNA 3QJYA 1VF5C 1KDBA 2XWBB 3VR4A 1PTOH 2A6ED 2YU9B 3SR1A 4I7ZC 3OMGA 1U4RA 1F9QA 2CW0D 1HTPA 1ENAA 5K36G 1D1IA 3A7LA 4PMWA 3OOCA 2X69A 2A5HA 1OXSC 3DUZA 3I3CA 4CKEA 1KNAA 1WVLA 1PTOB 3KLRA 4TSSA 4V190 3Q6SA 3E5SA 2CHBD 5A35A 2RA4A 1Q90A 3P1HA 3MXUA 4TKOB 1CTMA 4PQXA 3C2PA 3M85A 1PTOC 2PMZB 4G4KA 3T53B 1PZID 1WTWA 5JPNC 1TWHB 1GXDC 1EU3A 2WAQB 2B8GA 3JAML 1PYWD 1GHKA 2I07B 3AU7A 4C3JG 5EPKA 4AYBB 5TSSA 3MXGA 2SDFA 3FVQA 5EBCA 2MUYA 2L5TA 5IT9L 2ZXRA 4DAYA 3V2TA 5J22A 1EYDA 3T56B 1MD2D 3Q0AA 5A2QL 1IYUA 1LTGD 4EQNA 1CHQD 1STNA 3RD4A 2WINB 3RZOB 4OO1H 4R8NA 2O5JC 1WTVA 5EPJA 3K7AB 4LAAA 5I4DA 2E2IB 3D8GA 3NXWA 2PW5A 4BY7B 3T51B 1F2YA 1PRTF 2PO4A 2WKDA 2CQAA 4F8MA 5JEAG 1G291 1HXYD 2EDGA 1EY0A 5LL6X 3PO3B 3DEOA 5DNFA 1ESRA 3DEPA 1S5FD 3JAME 3S2HB 1V1PA 1EYCA 2SOBA 1B1ZA 1HQRD 2KJXA 5C5MA 4XT3B 4RGTA 3H6MA 4IUNA 5IT9E 1ICWA 1BDOA 5M5WB 3QOLA 1EU4A 2BA0A 2A68D 1ENFA 2LKVA 3TP7A 5A2QE 2M2LA 3BVGA 2D2CC 4EVOA 5IGGA 1AFPA 1U4PA 4KY5A 2F0HA 3IAYA 2IL8A 2XRSD 3CQZB 5FLXL 1O7YA 4V0BA 2BA1A 1HUNA 4DA2A 1SYCA 4XQQA 1H9KA 1OXXK 4JBWA 1Q1EA 2I46A 1Q3LA 1V43A 4OL7A 3I70A 5I2XA 1DXMA 2KQ3A 2FFKB 2HUGA 4KKTA 1B50A 3M7NA 4ZUIA 4C2MB 3L3OC 3QOJA 4IUQA 2NVTB 4IN3A 3OIQA 5M5XB 3MEHA 1S5CD 1U9RA 1SE4A 2JA7B 4HEDA 3HOVB 2BCOA 1GJXA 2F3VA 2ZXPA 4XT1B 2D9UA 1EQTA 3DWAA 3DWQA 4N9TA 3G6JB 4FP5D 5I2YA 3P75A 3FRPB 4K2LA 3PIP3 5FLXE 1ZYRC 5NUCA 4OGQC 4FF4A 3Q22A 1TS5A 4IZ8A 4BBRB 1BQQT 3KBXA 3NE5B 4DAPA 1VMCA 3RZDB 5KNDA 1SMYC 5CMDA 3I90A 2RBMA 3X3MA 2Q8TA 2HDMA 1IKLA 4HCSA 2EJMA 4FXGC 2A69C 1A15A 2FMMA 3L7ZC 1EOTA 4ZUJA 2Z8LA 2RKSA 3R93A 5KNCA 3EA6A 2H4OA 3K5OA 5FO8B 1TY0A 2R92B 3Q23A 5KGUA 1B3AA 3NTKA 1I4RA 3MFYA 5D3IB 1YNNC 5D3DA 2SEBD 3NUCA 3I72A 2KCNA 3G7LA 1JC7A 2EY5A 3HOXB 4ZKCB 1KTKA 2A6HC 1HHVA 2LMCB 4U68A 3M4YA 3HEJA 2IPKD 1NR4A 4K5VA 5M3FB 1EFID 1PFBA 2GA4B 5FO9B 1AEXA 4RKLA 3TMEA 1B44D 1ENCA 1EY6A 1STAA 2K32A 1IW7D 3Q24A 2Q8IB 2NN6I 4G7OC 1H9SB 1SJED 1PTOF 1HQMC 3EQLC 2KA7A 4O42A 2OXPA 4KKSA 4RKBA 1HTLD 1ZXTA 1SAPA 1I4XA 1JQYD 2K05A 1JICA 2B2UC 1KABA 1SFOB 3NK9A 1WD1A 2PQEA 1OXTA 5J39A 2J4XA 4WFN3 3U9SA 2MHVA 3BS1A 5BN4A 4A3MB 1WTQA 5ELCA 2TSSA 1UUPA 4C56C 2BE5C 2B2UA 1D1KA 3HOWB 3HRZC 2EY1A 1EY4A 1VDZA 4PMCA 2EYLA 3WOEA 1SNMA 3HOUB 1NUCA 1LTID 4A3BB 1PRTD 2H1EA 2EE1A 3PO2B 1JE4A 4ZRZA 3KF8A 1QNKA 4FXDA 1EYAA 3T13A 4RCOA 2M9VA 4GZYC 4MIUA 1CM9A 2R7ZB 2MP1A 4G7ZC 1EY9A 1YNJC 2EYOA 3VR5A 2F0DA 4A3FB 1F2MA 4A3KB 3NBHA 4RCNA 3I4NB 1CA5A 3BYYB 2Z1CA 5F2DA 1SNDA 2WP8J 3TN2A 2NB0A 4X3TA 2C5CA 3DMUA 3QB3A 1G8ZD 1X32A 1Y1WB 4BS9A 3S1RB 1GUGA 3CU7A 1FGBD 4FF2A 3FEWX 3MZ5A 4HTHA 2PZWA 3SDZA 3HOYB 4JK1C 3GQBA 4KMUC 1LT5D 2F0WA 4IURA 3K57A 4HR7B 1CK1A 4IFDH 4MN3A 4ZYSA 4M1UB 3SK4A 5C0XJ 2LY7A 1KAAA 5T1GA 2IX1A 4C3IG 5DM63 4KKUA 2F0NA 1AP0A 3J7AF 4X3UA 3ITPA 4X3SA 1CQFA 3S9WA 1ET6A 4WORA 2XVSA 3NWTA 3NSWA 2L12A 2A74C 3VYTA 3FDTA 5E3FA 3S1QB 4IALA 1AN8A 3A8IE 1I4QA 3K5LA 3BDLA 1EY5A 3TBIB 3TSSA 5COYA 2B2TA 1TT2A 3OIPA 3N52A 2XN9C 2E2JB 5LHY1 2B8FA 2XSCA 3H94A 5CV7A 1Y8PB 3TZUA 3MAQA 1ESFA 5CV5A 4J6HA 3GTOB 2K5QA 2J7ZA 3VYUA 3IL8A 3RLFA 3S2DB 4B08A 1SEBD 1VCIA 1EWCA 4HSVA 4NKLA 5M9OA 2MPMA 1IKMA 1LT3D 1STHA 5ISRA 1BCPB 4PNYA 5JPMC 2F03A 2VB2X 5KYIA 1D2BA 4R9WA 4CBVA 5KNBA 2WKCA 2XIWA 3SHLA 4KK7A 1TVXA 1BCPC 2E74C 5K5PA 2KHSA 2O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LX0 A;  5KEE A;  3D6C A;  5IGF A;  5KYL A;  3NUC A;  4WRD A;  4OL7 A;  4EQN A;  4NP5 A;  2F0F A;  4K8I A;  1KDB A;  2EY1 A;  2WAC A;  1EY4 A;  2F0N A;  4K6D A;  4S3S A;  5IOC A;  4QMG A;  5IOD A;  4PMC A;  1A3U A;  1STN A;  2EYL A;  5I6Y A;  2KQ3 A;  2EY5 A;  5IGC A;  3ITP A;  3S9W A;  4WOR A;  5CR3 A;  3TP6 A;  1SNM A;  3SR1 A;  1NSN S;  1NUC A;  4B9X A;  4N9P A;  4R8N A;  2EYF A;  4PMB A;  4F7X A;  4DU9 A;  1EZ6 A;  3OSO A;  4ZUI A;  3TP5 A;  3ERQ A;  3SXH A;  4E6I A;  3BDC A;  3NP8 A;  3OMG A;  5IGD A;  3QOJ A;  4LAA A;  5I9P A;  4KTA A;  5IIF A;  3HEJ A;  3D8G A;  4H7B A;  3NXW A;  2PW5 A;  5I6W A;  1EYA A;  5EKL A;  5J1Z A;  3T13 A;  1F2Y A;  5CV8 A;  3MEH A;  4K5V A;  1U9R A;  4F8M A;  5E3F A;  3OMC A;  1EY8 A;  4K5X A;  4ODG A;  2F0M A;  1STY A;  4HMI A;  4K2K A;  2ENB A;  3T16 A;  1ENA A;  4MIU A;  5HUR A;  4K14 A;  2EY6 A;  2EYJ A;  1EY9 A;  1SYD A;  1EY0 A;  5C3X A;  2F0O A;  4IAL A;  4KD3 A;  2F3V A;  2SNM A;  2EYO A;  1AEX A;  1SYG A;  3SK6 A;  4DGZ A;  4RKL A;  2F0D A;  3TME A;  1F2M A;  1SNQ A;  3SK8 A;  2OEO A;  4N9T A;  3RUZ A;  5DEH A;  4G57 A;  3DHQ A;  1ENC A;  5KRU A;  1EYC A;  3BDL A;  1STG A;  3U9O A;  3P75 A;  3D4W A;  4ID6 A;  1EY5 A;  4K5W A;  1F2Z A;  1JOR A;  1EY6 A;  4K2L A;  1STA A;  1TT2 A;  1A2T A;  5F2D A;  5CC4 A;  2SOB A;  1SND A;  3PMF A;  2QDB A;  4KV6 A;  1RKN A;  5NUC A;  5C4H A;  5C5M A;  1A2U A;  5EKK A;  4QB4 A;  3E5S A;  2F0L A;  1KDC A;  3D4D A;  5JOB A;  3H6M A;  1JOQ A;  4IUN A;  1SYE A;  2F0V A;  4IZ8 A;  4KD4 A;  5CV7 A;  1KDA A;  5IGE A;  5CV6 A;  3P1H A;  1SNC A;  3DMU A;  4KY6 A;  3QB3 A;  2PZU A;  5CV5 A;  3MVV A;  4J6H A;  1IHZ A;  4I65 A;  4DFA A;  3OWF A;  3R3O A;  1EZ8 A;  4J1M A;  5C3W A;  3QOL A;  4NDX A;  2PZT A;  5CGK A;  5JAV A;  2OXP A;  4RKB A;  2HQE A;  2F0U A;  2PYK A;  3NHH A;  3C1E A;  1EQV A;  2M00 A;  5EGT A;  2F0E A;  2EXZ A;  4ME5 A;  5C5L A;  2LKV A;  4KJN A;  3TP7 A;  5C6A A;  5KIX A;  1A3T A;  4KHV A;  4NKL A;  2RBM A;  3HZX A;  1SYF A;  2EY2 A;  2EYP A;  3VA5 A;  4DF7 A;  2F0T A;  5I9O A;  3EJI A;  3SK5 A;  1KAB A;  5M9O A;  4EVO A;  4ZQ3 A;  2F0Q A;  3NK9 A;  5IGG A;  1STH A;  4TRD A;  5HGT A;  5ISR A;  4EQP A;  1JOK A;  4B9W A;  2PQE A;  1TR5 A;  3NQT A;  3MZ5 A;  4HTH A;  4KY5 A;  2RDF A;  2F0P A;  4KY7 A;  5CV4 A;  2F0H A;  5DAU A;  5J39 A;  3EVQ A;  2PW7 A;  2PZW A;  4PNY A;  3MHB A;  5E1F A;  4HMJ A;  4K8J A;  1II3 A;  4ZUJ A;  2RKS A;  5IGB A;  5KYI A;  2F0J A;  2SNS A;  3ERO A;  3TP8 A;  1EY7 A;  2F0G A;  1JOO A;  1SYC A;  3C1F A;  1A3V A;  3MXP A;  3SHL A;  2NUC A;  1SNP A;  4YIJ A;  4NMZ A;  5CV9 A;  3V2T A;  1STB A;  5J22 A;  4KJO A;  1EYD A;  1SNO A;  2F0W A;  2F0S A;  2F3W A;  2OF1 A;  2EYM A;  5KGU A;  5K5P A;  2EYH A;  2F0I A;  4QF4 A;  1SYB A;  2KHS A;  1TQO A;  3SK4 A;  5C4Z A;  4EQO A;  2O4X A;  2F0K A;  1KAA A; 
#chains in the Genus database with same CATH topology
 3LX0 A;  4X66 Q;  5AJ3 Q;  4NP5 A;  1ROD A;  4K8I A;  1MJE A;  2B3G A;  4JI0 Q;  1AZP A;  1A3U A;  1WTP A;  1X3F A;  1WCM H;  2E2I H;  4LK1 C;  1ILQ A;  5LMN Q;  4HIO A;  4RHR A;  1GHJ A;  1NSN S;  1LTB D;  4OXP A;  4JW0 A;  3CCE A;  2B2V C;  5DLQ E;  1E2V A;  1PZJ D;  1B70 B;  3A55 A;  1LLR D;  1SSO A;  4CKC A;  1XJV A;  3ND8 A;  2JP1 A;  1LTS D;  4IQZ A;  2E76 C;  2ZTE A;  4JVZ A;  4ODG A;  2F0M A;  1TWG B;  3GV3 A;  1EIY B;  1GUT A;  4A3I B;  1Y1V B;  4C1N I;  1JJC B;  1E3P A;  2WB1 G;  3MXN A;  3UI2 A;  2F4I A;  3S15 B;  1J9O A;  5IYD H;  1NCV A;  5M3M G;  3CD6 A;  4DR3 L;  1TS4 A;  2RQX A;  3RUZ A;  3TRE A;  5BN3 A;  2B2V A;  3GTJ H;  1WD0 A;  4QY7 A;  1WCM B;  2UUC L;  1PTO D;  2BOS A;  1XTD A;  1C7Y A;  3O13 A;  2QF7 A;  2A68 C;  2Z9H A;  4JV5 L;  2PZU A;  1GUO A;  2X6G A;  3H0G G;  1DYQ A;  1ML0 D;  4I65 A;  5CGK A;  3IFT A;  3HKZ G;  3F2C A;  1HFG A;  2AKW B;  3NHH A;  2J0T D;  2L1B A;  4AIM A;  4X64 L;  3VDY A;  1S40 A;  5C5L A;  1R9T B;  3D4R A;  1FVI A;  3CQZ H;  3HKS A;  3VA5 A;  4JYA L;  4OON A;  4XIG S;  2MO1 A;  5C3E H;  4ZQ3 A;  4DV4 L;  4DV1 L;  2KVM A;  3TS2 A;  1EOV A;  3AMU A;  5E7N A;  4LFA Q;  3PV0 A;  4YHH Q;  1MSG A;  3K7U C;  3GTJ B;  2BH8 A;  1G6P A;  2HHH L;  2Z6B A;  3K59 A;  1JJ2 A;  4QIW B;  1VQ7 A;  3URY A;  1EY7 A;  2F0G A;  5CC4 A;  1LTL A;  2C9O A;  1G2S A;  4PV1 C;  4KJO A;  2OF1 A;  3NBI A;  1H9J A;  1A63 A;  1E2Z A;  1LT4 D;  3L9A X;  1TQO A;  3WDN A;  5K36 H;  5EKK A;  3J7Z C;  1XMQ L;  3P7J A;  3D6C A;  5IGF A;  1VQL A;  1UEB A;  1QZG A;  1D5M C;  1N34 Q;  5IOD A;  3CC7 A;  4H44 C;  2EZV A;  5EJW A;  1TXY A;  2JA6 G;  3D3R A;  5C3E B;  2NVT H;  5IE8 A;  1UE5 A;  2PNR C;  1AE3 A;  1RHP A;  3AYH B;  5FKA C;  4F7X A;  4DU9 A;  1LAB A;  1TKW B;  2K01 A;  4MZ9 A;  1CT1 D;  3TP5 A;  4JI5 Q;  3ERQ A;  1JWU D;  4PZ8 A;  1I4P A;  2JA7 H;  3STB C;  2EPB A;  2PMZ E;  3GTG H;  3PCO B;  1CZW A;  1NY4 A;  2ICE C;  1WTR A;  4K2K A;  2F52 A;  4X65 L;  2HIV A;  5C4X H;  3TRZ A;  2JSO A;  5C0X I;  1PDQ A;  2EY6 A;  1BKB A;  2I0Q A;  4XYO A;  1C0A A;  4AYB E;  2R3Z A;  4MNO A;  1UE7 A;  2OEO A;  1RDP D;  2UXD L;  1CSQ A;  5KRU A;  2K5D A;  4C3J H;  4UP7 A;  3SEB A;  1F9P A;  2TMP A;  1S72 A;  3FKI G;  5D65 A;  4J8Q A;  3S17 B;  4K0K Q;  1WTX A;  2GN5 A;  3CPW A;  3D4D A;  3NEN A;  3BZD B;  4NW2 A;  5COR A;  3GTG B;  1PXU A;  2PYK A;  2MGS A;  1GUS A;  1CKN B;  1EQV A;  1Y14 B;  2MO0 A;  4LNQ A;  1HPC A;  5CYU A;  2QKI C;  1VQ5 A;  2B63 B;  5C4X B;  5C6A A;  3T1H L;  1IXR A;  2K5W A;  3CCJ A;  2K7V A;  3CCR A;  1KNE A;  3QO2 A;  4EX5 A;  2L55 A;  1QOH A;  1FL0 A;  1HA5 A;  1BBX C;  1B53 A;  5M3M H;  4DR5 Q;  2D0O A;  5IYC G;  2AQ1 B;  2I5L X;  3MHB A;  4C3J B;  1QCB D;  2DNE A;  1H9R A;  1GO3 E;  4GN4 B;  2ZT9 C;  4HSP A;  3T1Y L;  1K0R A;  2NUC A;  4ZAI A;  2KEC A;  1MSH A;  5IT9 c;  1PFN A;  4DUY L;  3VR3 A;  1LO5 D;  1SYB A;  5JEA H;  1RTN A;  2L9H A;  3ZYY X;  1K3R A;  3PUV A;  5KEE A;  3H0G H;  4WRD A;  1B9M A;  4FO2 A;  2VQE Q;  3ONA B;  1MHW C;  1Q86 C;  1JB3 A;  4FF3 A;  4JI8 L;  2RSN A;  1EYG A;  1PV4 A;  4GKK Q;  1HFN A;  5M3F H;  1TII D;  1ZKO A;  3CRK C;  3E9I A;  1V8Q A;  5M3M B;  3BDC A;  3NP8 A;  4LF7 L;  5IGD A;  3K0Y A;  2E2D C;  5I9P A;  1Y8O B;  3BZK A;  4PZ7 A;  3CCL A;  4DK0 A;  2XTI A;  1YIJ A;  4HMI A;  2ENB A;  4CKB A;  3H3V I;  4B3S Q;  2F0O A;  3A56 A;  1ZYR D;  4FDB A;  1KLG D;  3VA7 A;  1IW7 C;  3H0G B;  1SNQ A;  3SK8 A;  5JJK A;  1C48 A;  1KD1 C;  3DHQ A;  1U4L A;  4K5W A;  4F88 A;  3MA2 B;  1SMX A;  4IUV A;  3QIA A;  1B4O A;  1A2T A;  3DWP A;  3M4O H;  3PMF A;  4HCE A;  4LMQ D;  4U67 3;  4R4Q A;  3VR6 A;  2JA6 H;  3GDE A;  1SMY D;  4DAM A;  1VQI A;  5FJ8 H;  1ET9 A;  1FD7 D;  1KHI A;  4A3D H;  3TZD A;  1RTO A;  2JN4 A;  1GOZ A;  3V96 A;  4DV3 Q;  5GAG C;  3R3O A;  1LAC A;  2NN6 G;  1YHQ A;  2R93 G;  1SFO H;  4IUU A;  4IOC A;  3P20 A;  2JA5 G;  4KN7 C;  2A8V A;  2M00 A;  5ELB A;  2A73 B;  1IYJ B;  1PFS A;  2CFM A;  4OWW B;  2RHQ B;  5KIX A;  4B3T Q;  4KHV A;  4OIJ A;  1V9P A;  5C4J H;  3EJI A;  2HQL A;  4R4O A;  4RGN A;  3RN5 A;  1CI3 M;  4EQP A;  3D31 A;  4X3K A;  2FHT A;  2JA9 A;  2K52 A;  4DK1 A;  3CHB D;  2F0P A;  3MWY W;  3H09 A;  1BR9 A;  3E3X A;  1TWC H;  2NVY H;  3GTK B;  4DV2 Q;  1YNN D;  3G4S A;  2VNU D;  3IKJ A;  3M4O B;  5FLM H;  1R4P B;  4GKJ L;  3L2P A;  1BCP F;  5FOB B;  2FJ2 A;  2JA6 B;  5C4H A;  1B9N A;  3FKI H;  1MI2 A;  4L8J A;  3HOW H;  4A3D B;  3H91 A;  1EQQ A;  3GO5 A;  1M4V A;  4L63 B;  3KF8 B;  1IBK L;  4Z9C B;  3ULL A;  1U4M A;  1PLF A;  5IOC A;  2WAC A;  1X56 A;  2ES2 A;  1QZH A;  4DV7 L;  2HDL A;  5C4J B;  3EIV A;  1HUM A;  2KCT A;  3ERS X;  2YTV A;  2DN8 A;  1HNZ L;  5CR3 A;  4KLK A;  4B9X A;  4KI0 A;  1PH8 A;  2MFI A;  2F1M A;  1HRJ A;  4LJZ C;  4IFD I;  3OHX C;  1EEF D;  1TWC B;  2NVY B;  1K8A C;  4UHV A;  1X9N A;  4NXN Q;  3NBH B;  2O2L D;  2L0C A;  3U50 C;  4JI2 Q;  2XWJ B;  1RIP A;  4DNR B;  1VQA A;  5LMU Q;  3OMC A;  3FKI B;  4DV0 L;  2O5I C;  1DD2 A;  1Q1B A;  3S16 H;  2EYJ A;  3M9B A;  3T4A C;  4OIK A;  1WOC A;  2JJQ A;  1DOK A;  1E24 A;  1I5F A;  2QIL A;  2CH4 A;  3NEL A;  2LXK A;  4DV5 L;  1HCZ A;  4UPA A;  1H9M A;  3C3L A;  3KJP A;  1JWS D;  3PUY A;  3ICE A;  1SDF A;  1W6J A;  4DXG A;  5M5Y H;  3I8Z A;  4QB4 A;  1Z47 A;  2DJG C;  3F2U A;  5LL6 S;  1Y1W H;  5JOB A;  2UXC Q;  3ULP A;  3DM1 A;  4DR1 Q;  1IHZ A;  3F2B A;  3OWF A;  1I6H H;  3VR2 A;  1IBL Q;  1ZEQ X;  1HNX L;  2F0U A;  3C1E A;  2WAQ G;  1IBM L;  4NPS A;  3S16 B;  4UAI A;  3CCV A;  3N6R A;  2ASB A;  4AYB G;  1G2T A;  4TRD A;  4IJL A;  3S24 A;  3CC4 A;  2NZ1 D;  1N32 L;  5CV4 A;  1CHP D;  2G9H D;  2VB3 X;  4KHZ A;  1Q46 A;  5G3L F;  1XTC D;  2BE5 D;  1K8O A;  4K8J A;  3MTS A;  5ELE A;  2IWH A;  1G51 A;  5JEA J;  1E0B A;  2SNS A;  5M5Y B;  1JOQ A;  3MXP A;  3RNU A;  2K04 A;  2EJF C;  1DGS A;  2V4D A;  4ZLT F;  5CBA E;  1SNO A;  5FO7 B;  2F3W A;  3AB9 A;  4M8A A;  3K5N A;  4A3L G;  4QF4 A;  4LFC Q;  1I6H B;  1Q8I A;  1Q82 C;  1MIU A;  2R6G A;  3CKI B;  3RLO A;  1YJW A;  1R4Q B;  2F4V Q;  1PMR A;  1O7L A;  2QGQ A;  1XNR Q;  4BBS G;  2FXQ A;  1QVF A;  4DR4 Q;  2EIF A;  1LT6 D;  1DOL A;  3LNN A;  4MTK A;  4AQY L;  4POG A;  3KLS A;  1FR3 A;  5GAE C;  1EZ6 A;  4L5S A;  1GUN A;  4BY7 G;  4ME3 A;  4YCU A;  1PH2 A;  1BBU A;  5IIF A;  4H7B A;  5I6W A;  1T9H A;  1EIG A;  2A6E C;  2G9D A;  4LFB L;  1L1O C;  1V1O A;  2I5M X;  5HUR A;  1SYD A;  5FK9 C;  4DK6 C;  3E6Z X;  3SVM A;  1HR0 L;  5HGQ A;  1C8C A;  4JI6 Q;  1W2B A;  5E4W C;  2X6L A;  1XPU A;  3I91 A;  2BDO A;  1ONL A;  2CW0 C;  3J80 L;  5EQ0 A;  3U9O A;  1E7Z A;  2B2T C;  3RLN A;  1M90 C;  4CJ1 B;  5HY6 A;  2QDB A;  1M8A A;  3PIO 3;  4NB3 A;  4H13 C;  3A74 A;  5C44 G;  3S2D H;  1G6Z A;  1I3Q H;  1A62 A;  2E75 C;  1YJN A;  2K28 A;  2F0V A;  1L1O A;  1SE2 A;  1QVC A;  5CV6 A;  1SNC A;  4KY6 A;  2NWG A;  1NBW A;  4QUC A;  1JWM D;  4DFA A;  1EZ8 A;  5JAV A;  2UUA L;  1VQD A;  4OO1 I;  1RCV D;  2AQ2 B;  4X62 L;  4A76 A;  4GOP B;  1TWF H;  4JCV E;  5IP9 H;  4HAE A;  1BO0 A;  4JBK A;  1S5D D;  4DR6 Q;  2EY2 A;  3GTP H;  4BA2 I;  2P5Z X;  2Y0S B;  1J5E Q;  3J7A V;  1NTG A;  4UP8 A;  4DN4 M;  2JA8 G;  3R2I A;  2E5L Q;  1I4G A;  5JJI A;  1EIH A;  3K6O A;  5DAU A;  2B29 A;  3BU2 A;  1CSP A;  1FNU A;  4GOP C;  4HMJ A;  1CQV A;  1E22 A;  2QCP X;  3OW2 A;  1QJO A;  5IWA Q;  1Z7T A;  4OHJ A;  4RWS C;  3TP8 A;  1K83 H;  2V1C C;  2K75 A;  2OT2 A;  1I3Q B;  5CV9 A;  1STB A;  2EJG C;  2EYM A;  4BWG B;  2R7D A;  3OW7 A;  3PQI A;  1CKM A;  1NR2 A;  1RJT A;  4DR2 Q;  2AUJ D;  1K8G A;  3FMC A;  3EFX D;  1OXU A;  1TWF B;  4QMG A;  1KLU D;  3GTP B;  4XQN A;  4CHT B;  4ZKB B;  5IGC A;  3GTM H;  3CAM A;  3J80 E;  3R8B A;  2WII B;  2IHF A;  4P72 A;  4CGY B;  3MXN B;  3X3N A;  1NJI C;  2YV5 A;  3DXJ C;  4UY8 C;  3S1M H;  1XPO A;  2UXB L;  3A54 A;  5EKL A;  4Y52 H;  1K83 B;  1HH2 P;  1EY8 A;  4K5X A;  3HOV G;  1STY A;  1SXT A;  3T16 A;  1Y8N B;  4GN3 B;  1YJ9 A;  4LF9 L;  2KHI A;  1VQ6 A;  1VQB A;  2SNM A;  1UAP A;  2EVB A;  4G7H C;  3HFZ B;  4L5T A;  1PH1 A;  1BNZ A;  1G91 A;  4BXX G;  3BYT B;  5DEH A;  4ILW A;  4G57 A;  1VQJ A;  3PUX A;  1T5E A;  1F77 A;  1F2Z A;  5D14 A;  1MBY A;  1XXG A;  3GTM B;  4O0A A;  1SE3 A;  2CCZ A;  4KV6 A;  1K28 A;  4BBR G;  1V1P B;  2D62 A;  2NZO A;  4O1N A;  4KD4 A;  4R4T A;  1NAP A;  4DR3 Q;  1R9T H;  1ASZ A;  3S1M B;  3AQQ A;  3MVV A;  4J1M A;  1SN8 A;  3K81 C;  1EIF A;  1O7Z A;  2UUC Q;  1VQO A;  4ME5 A;  2PQA A;  1FYC A;  2B39 A;  1IL8 A;  3LWE A;  2F0T A;  4C3I H;  3GP7 A;  4JV5 Q;  5AFW A;  3CC2 A;  1JOK A;  1TR5 A;  2VS1 A;  1O78 A;  4CJ2 C;  2WV6 D;  1T5X D;  1BCP D;  4LF6 L;  1XX8 A;  3GD7 A;  1GUW A;  1VQH A;  3M7G A;  3PUW A;  5EBD A;  4C1N K;  4X64 Q;  2UUB L;  1U5K A;  4KHP L;  4BBS B;  3ER0 A;  2R92 G;  4JYA Q;  3W3A A;  3QG1 A;  2Z4I A;  2PNH A;  3C1F A;  1A3V A;  2CQO A;  3UDI A;  4DV4 Q;  1C9O A;  4DV1 Q;  4RAU C;  5C44 H;  2R61 A;  1AE2 A;  2JYO A;  1SRO A;  5C4Z A;  4EQO A;  2KCC A;  1M1K C;  1PH5 A;  2JE6 I;  2NVQ H;  2HHH Q;  3CF5 A;  1FNV A;  5BN5 A;  3HOX G;  2IX3 A;  1F2L A;  2D5D A;  1OXV A;  4BY1 G;  2VXW A;  4C3I B;  2LFN A;  1Q7Y C;  4IFD J;  3D6W A;  4YY3 L;  4A93 H;  1B2T A;  2EYF A;  3LGJ A;  3OSO A;  1E2W A;  4Y7N H;  3W2D A;  2L4N A;  2JA8 H;  1XMQ Q;  2AUK A;  4A3G G;  3NPP A;  4IOA A;  1SJH D;  4KTA A;  1X54 A;  4YWK A;  3HGB A;  2VQF L;  3A7A B;  1TU2 B;  4RFB A;  1PH4 A;  3HOZ H;  2MNA A;  5C44 B;  1YNX A;  4K14 A;  5C3X A;  3TS0 A;  4GLX A;  1FNW A;  1I6V C;  3M4Q A;  3ULJ A;  3S17 H;  1JB7 A;  5C0X G;  2YTY A;  4CJ0 B;  2NVQ B;  3S1N H;  1S5E D;  2ICI A;  1CZG A;  2K5N A;  1JCK B;  4H0L C;  4FNF A;  4R8I A;  4HID A;  2NVX H;  3BG3 A;  4K6L A;  1CFM A;  2RDH A;  3D4W A;  3U4Z A;  4C3H G;  4X65 Q;  1JOR A;  2RCF A;  1QIL A;  1Z6H A;  3TDQ A;  3M4P A;  4A93 B;  2E8G A;  3HP3 A;  1I4H A;  4Y7N B;  2JA8 B;  1QB5 D;  2B63 H;  2Q8R E;  3S14 H;  4IPD A;  5LMN W;  2UXD Q;  1F9R A;  2NYZ D;  1IYV A;  1RF2 D;  4A3E G;  1Y69 U;  3GV6 A;  3K58 A;  4Q0F A;  1LUZ A;  2F0E A;  3NTH A;  3HOZ B;  2HCC A;  4FVM A;  2AMC B;  3PF5 A;  5I9O A;  5ELF A;  5G3L D;  5IP7 G;  2CWA A;  3ND9 A;  1LV9 A;  2F0Q A;  3PUZ A;  4JI5 L;  1BXT A;  2EXD A;  3S1N B;  2NVX B;  3BJU A;  2IX0 A;  4IUT A;  1PH9 A;  5E1F A;  4I7A A;  4A3M G;  3T1H Q;  1VMP A;  3MFG A;  4XYQ A;  4R4C A;  4OX9 L;  1TS3 A;  1DJR D;  2NTS A;  3IFD A;  4ULL A;  4YIJ A;  4LF8 L;  1BF4 A;  2Z0S A;  1MGS A;  3S14 B;  4A3J G;  3A8J E;  2B2W C;  4ALP A;  3A5Z B;  3M3Y H;  2XRQ D;  2F0K A;  1Q12 A;  4EGV A;  2GVA A;  3D0F A;  1IL2 A;  2AQ3 B;  2F0F A;  2HIX A;  3STB D;  3T1Y Q;  1LTA D;  1MKH A;  3HOU G;  4ABN A;  5ELD A;  2B2Y C;  1RL2 A;  1VQF A;  2KEE A;  4DUY Q;  2VW9 A;  5JVG 3;  4HN7 A;  1XYI A;  1O80 A;  3I4M G;  5JJZ A;  4DXF A;  1KRS A;  2MJ8 A;  5CBE E;  3SXH A;  4E6I A;  3QWN A;  3BVZ A;  5CV8 A;  2B2W A;  1KAW A;  4JI8 Q;  2AWO A;  4P73 A;  4JOI A;  4A3F G;  3M3Y B;  4LF7 Q;  4DGZ A;  3I4N G;  2KHJ A;  4L6T B;  1A6X A;  2B2Y A;  4CDC C;  2RSO A;  1EUJ A;  2WB1 B;  2ATW A;  3OYY A;  1ILP A;  1Q81 C;  3RMH A;  1D6E C;  1STE A;  2QW7 A;  4QIW E;  2Q2T A;  2K6A A;  1AZQ A;  4DV6 L;  1RKN A;  2LS0 1;  3FP9 A;  4BY1 H;  3J7Y W;  1D7Q A;  1YIT A;  4DKA C;  1SYE A;  3K5M A;  1KDA A;  3OPO A;  1DOM A;  3VYS A;  4O2D A;  1CKN A;  2JXM B;  1QWY A;  1D5X C;  2DUD A;  4TQU S;  3PF4 A;  2DY8 A;  4RMF A;  5C3W A;  2PZT A;  1K3B C;  5L37 A;  4GS3 A;  5EGT A;  3NWS A;  4XDX A;  3HKZ B;  3RN2 A;  4QGU A;  3GTK H;  1SYF A;  2OQK A;  1BOS A;  1D5Z C;  3NQI A;  3DLL A;  3SK5 A;  1GD7 A;  5ELO A;  2MQH A;  1VQ4 A;  2KEN A;  1GM5 A;  1PZK D;  4B9W A;  1DZ1 A;  3KUP A;  4KY7 A;  2VUM G;  3FHW A;  1VF7 A;  3EVQ A;  4YWM A;  2PW7 A;  4DAV A;  5C0X H;  3KBG A;  1UNS A;  4RGM A;  5E4X A;  4FXK C;  4JC0 A;  3UE0 A;  3V05 A;  2RVL A;  2KOL A;  3CPF A;  4BY1 B;  1UEA B;  4RH6 A;  3F2D A;  1BVS A;  3GTQ H;  1CA6 A;  1JOO A;  2A69 D;  4DF7 A;  1C4Q A;  1WFQ A;  4NMZ A;  1K73 C;  1OO9 B;  2L11 A;  3I73 A;  2EYH A;  2F0I A;  2FIN B;  1LYL A;  3VYR A;  2IW3 A;  4A3G B;  4L5Q A;  1V1Q A;  2CKZ B;  3J81 L;  4GKJ Q;  1XMO L;  3K80 C;  4K6D A;  4A3E H;  1EQR A;  3F8T A;  1EL0 A;  3KLS X;  1A8V A;  5I6Y A;  2N55 A;  1NMF A;  4P2C B;  4PZ6 A;  1RD9 D;  4DR7 L;  1PRT B;  1S5B D;  2N3S A;  3G6E A;  4PMB A;  2D0P A;  2CVR A;  1IBK Q;  2ALY B;  4FF1 A;  1BUV T;  2FMC A;  5T1I A;  4DV7 Q;  4C3H B;  2A6H D;  3KLW A;  3I4L A;  4IFD G;  3GTQ B;  1HNZ Q;  4P71 A;  1KIX A;  4CDD C;  1HA6 A;  1PRT C;  3KDF A;  3SGI A;  2ZXO A;  4QUF A;  4KD3 A;  1SYG A;  2AHO B;  3HS0 C;  1B3Q A;  4HJ9 A;  2RCN A;  4A3J H;  1HZ9 A;  1EEI D;  3I7F A;  4L5R C;  4A3E B;  4B3R L;  2F3I A;  1QE6 A;  1STG A;  4GN5 A;  4DV0 Q;  3BVM A;  1TY2 A;  3SE0 A;  1SBB B;  3F1Z A;  3WOF A;  5IYC H;  1P8L A;  1A2U A;  4XTC S;  1J8I A;  3HG9 A;  2F0L A;  5IGE A;  2IJ0 A;  5EPL A;  2A1A A;  3I2Z A;  2NTT A;  4UDU C;  4DV5 Q;  5EKI A;  4IPG A;  4NDX A;  2IT1 A;  4HJ7 A;  2YYZ A;  4OWT B;  4JPB W;  2DY7 A;  1HJP A;  1WTH A;  1BBW A;  3GTL H;  4KJN A;  1A3T A;  3J81 E;  3HZX A;  1XWE A;  1DON A;  2KED A;  2WB1 E;  2N49 A;  4XXE A;  2N8N A;  5HGT A;  1H9S A;  3CCU A;  4A3J B;  2ZM6 L;  3NQT A;  3BDO A;  2RDF A;  1HNX Q;  4R4I A;  1I50 H;  1JR0 D;  3J7A 5;  3AFQ A;  1IBM Q;  1II3 A;  5IGB A;  1TWA H;  4N8X 1;  3G71 A;  3ERO A;  1WTO A;  1J6Q A;  1HZB A;  3MEF A;  4RHS A;  1TS2 A;  2K03 A;  2E2H H;  3I4M B;  1U0L A;  4KN4 C;  1QUQ A;  1N32 Q;  1QNU A;  4DNI A;  2EOT A;  2K33 A;  2DNC A;  1QVG A;  3HKZ E;  4GNX A;  1K8M A;  1L0X B;  3GTL B;  1WJJ A;  1YBY A;  4S3S A;  4NXM L;  2Z4H A;  1LTT D;  3FPU B;  5GRO A;  1LTR D;  3TP6 A;  4LF5 Q;  4N9P A;  2EQS A;  2BDN A;  1I50 B;  3Q8D A;  4A4I A;  1VQ9 A;  1PFM A;  2Q2I A;  3A8K E;  4A3C G;  1SR3 A;  3QR8 A;  2K1B A;  1XNQ L;  5J1Z A;  1TWA B;  1AW7 A;  1F9S A;  2Q2H A;  2PPB C;  4FYD A;  3A5U A;  1SLJ A;  1CKO A;  2E2H B;  2NN6 H;  1EWH A;  2R93 H;  1QG7 A;  3CRL C;  4AQY Q;  2JA5 H;  2OQ0 A;  3OWE B;  5GAD C;  3H3V C;  4WJW A;  1L1O B;  2KUM A;  3SK6 A;  3JC6 6;  3C46 A;  4DUZ L;  4MTN A;  1GKH A;  1N36 L;  4QCL A;  1DM0 B;  2JEB I;  3OTO L;  4LFB Q;  4ID6 A;  2NBF A;  1YNJ D;  3NTI A;  4AH6 A;  5JVH 3;  4HJA A;  2CWP A;  1KDC A;  1HR0 Q;  3PO3 G;  4JI1 Q;  2VUM B;  4LUV A;  4B3M L;  4RA8 A;  3MC0 B;  2HCI A;  2QEJ C;  2HQE A;  4MHE A;  1I94 Q;  1X3Q A;  4DNT B;  2EXZ A;  2UU9 L;  3TQY A;  2R93 B;  2RDG A;  3B6Y A;  1L0Y B;  2C35 B;  3LWU A;  2Q2U A;  3E0J A;  2JA5 B;  3FPP A;  2EYP A;  4OO1 G;  2YU9 H;  2ID0 A;  2N88 A;  4IUP A;  4Q5V A;  2ZJR A;  3A0J A;  1VS0 A;  4F87 A;  2UUA Q;  3KK7 A;  2JEA I;  3J81 c;  1KL9 A;  2XNA C;  5BR8 L;  4JI3 L;  4X62 Q;  3J81 j;  1FJG L;  3R2T A;  1W6K A;  2F0J A;  3G48 A;  1S4Z A;  4RGO S;  5DM7 3;  1SNP A;  4BA1 I;  1X3P A;  4XQJ A;  2F0S A;  1X6O A;  3BZC A;  1N9W A;  1VQE A;  4ZK9 B;  5KYL A;  1DCZ A;  2PCF B;  2LXJ A;  3AFP A;  2QA4 A;  2AWN A;  2H5X A;  3QJY A;  1MJC A;  1NNX A;  1VF5 C;  1KDB A;  2XWB B;  3VR4 A;  1PTO H;  2A6E D;  2YU9 B;  3CXC A;  3SR1 A;  3OMG A;  4I7Z C;  1GVP A;  1U4R A;  1F9Q A;  4LF4 L;  5IY0 A;  1HNW Q;  2DJF C;  2CW0 D;  4JI4 L;  1HTP A;  1ENA A;  1TWH H;  5K36 G;  1D1I A;  2KCM A;  3A7L A;  5IYB G;  2JK8 A;  4PMW A;  3OOC A;  2X69 A;  2A5H A;  1OXS C;  2PI2 E;  3DUZ A;  3I3C A;  4CKE A;  1KNA A;  1PHJ A;  1WVL A;  1PTO B;  2QEX A;  3I55 A;  3KLR A;  4LF9 Q;  4TSS A;  2PQA B;  4V19 0;  3Q6S A;  4JI7 L;  2JA7 G;  3E5S A;  2CHB D;  1PYB A;  5A35 A;  2RA4 A;  2VL6 A;  4N8F A;  1A0I A;  1Q90 A;  3W1B A;  3P1H A;  2L15 A;  3EN2 A;  2Z6K A;  3MXU A;  4TKO B;  1CTM A;  2R7F A;  1O7I A;  4A3C H;  4PQX A;  1K9M C;  3C2P A;  4A3L H;  3M85 A;  1N33 L;  5C4X G;  1PTO C;  2PMZ B;  1CUK A;  4G4K A;  3T53 B;  3I56 A;  1PZI D;  1H95 A;  1JJG A;  1WTW A;  5JPN C;  1TWH B;  2KBN A;  1GXD C;  1EU3 A;  2WAQ B;  2B8G A;  3JAM L;  3RZO H;  1PYW D;  1W3S A;  3KF6 A;  4BBS H;  3CMA A;  4R1J A;  1GHK A;  2I07 B;  3AU7 A;  4C3J G;  5EPK A;  4AYB B;  5TSS A;  1VQK A;  3MXG A;  3K7A H;  5AJ3 L;  4X66 L;  3H15 A;  4BY7 H;  2SDF A;  3FVQ A;  5EBC A;  2MUY A;  2L5T A;  1LM0 A;  5IT9 L;  4JI0 L;  2ZXR A;  4DAY A;  2K4K A;  3V2T A;  5J22 A;  1EYD A;  4TVA B;  4LF6 Q;  3T56 B;  5LMN L;  1MD2 D;  3PO3 H;  4IPC A;  3PIP A;  3CW2 C;  3Q0A A;  4A75 A;  2UUB Q;  2XGT A;  5A2Q L;  1KC8 C;  4KHP Q;  1IYU A;  1LTG D;  3J81 i;  4EQN A;  3S2H H;  1CHQ D;  1STN A;  3RD4 A;  2WIN B;  3RZO B;  3UDF A;  1X3E A;  1NMG A;  1ASY A;  4OO1 H;  4R8N A;  2O5J C;  2GVB A;  2I5H A;  1WTV A;  5EPJ A;  3K7A B;  4LAA A;  5I4D A;  2E2I B;  3D8G A;  4IJH A;  5M5W H;  3NXW A;  2PW5 A;  4BY7 B;  3T51 B;  1F2Y A;  1PRT F;  2PO4 A;  2WKD A;  2CQA A;  4F8M A;  5JEA G;  1PVO A;  1G29 1;  4YY3 Q;  4CDF C;  1HXY D;  1JE5 A;  2Y0S E;  2EDG A;  1EY0 A;  5LL6 X;  3PO3 B;  3DEO A;  5DNF A;  1ESR A;  3DEP A;  4UP9 A;  1S5F D;  2WFW A;  3JAM E;  3U4V A;  2RF4 A;  4RG1 A;  3S2H B;  1V1P A;  1EYC A;  2VQF Q;  2K5H A;  3J80 c;  5M3F G;  1AH9 A;  2SOB A;  1B1Z A;  1HQR D;  2KJX A;  3EBE A;  5C5M A;  4XT3 B;  4RGT A;  3H6M A;  4IUN A;  4QL5 A;  5IT9 E;  1ICW A;  1VQP A;  1BDO A;  5M5W B;  1X3G A;  3QOL A;  4J15 A;  4YHH L;  1EU4 A;  1YVC A;  4LFA L;  2BA0 A;  2A68 D;  1ENF A;  2LKV A;  3TP7 A;  5A2Q E;  2M2L A;  3BVG A;  2D2C C;  4EVO A;  5IGG A;  1AFP A;  1OTC A;  5IYB H;  2YTX A;  1U4P A;  2VY3 A;  4KY5 A;  1EWI A;  2F0H A;  1YHA A;  2IL8 A;  2XRS D;  4C2M H;  3IAY A;  3CQZ B;  5FLX L;  1O7Y A;  1PH7 A;  4V0B A;  1VQN A;  2BA1 A;  4LUZ A;  1HUN A;  5FJ8 G;  4A3D G;  4DA2 A;  5M5X H;  1N34 L;  1SYC A;  4XQQ A;  1SE8 A;  1H9K A;  1OXX K;  4JBW A;  1Q1E A;  2I46 A;  1Q3L A;  4DK3 C;  3HOV H;  1YI2 A;  1V43 A;  2WAQ E;  4OX9 Q;  4OL7 A;  3I70 A;  5I2X A;  4BXX H;  1DXM A;  2KQ3 A;  4LF8 Q;  4YWL A;  1E1O A;  2FFK B;  4PG3 A;  2HUG A;  4KKT A;  1B50 A;  4HIM A;  3M7N A;  4ZUI A;  4C2M B;  5FLM G;  4BBR H;  3L3O C;  3QOJ A;  4LWC A;  4IUQ A;  2NVT B;  4IN3 A;  3OIQ A;  3RZD H;  3HOW G;  5M5X B;  3MEH A;  1S5C D;  1U9R A;  2DGY A;  5ELN A;  1SE4 A;  3CP0 A;  4JOI C;  2JA7 B;  4WJ4 A;  4HED A;  3HOV B;  4K0K L;  2BCO A;  4A3B G;  2F3V A;  1GJX A;  2ZXP A;  5GQO A;  1P16 A;  4XT1 B;  2D9U A;  1EQT A;  3DWA A;  3DWQ A;  3PO2 G;  4N9T A;  3L0O A;  2NZH A;  3G6J B;  3KYH C;  4FP5 D;  5I2Y A;  3P75 A;  1X65 A;  3FRP B;  4K2L A;  4POF A;  1K0S A;  3PIP 3;  5FLX E;  3UDG A;  3JAM c;  1ZYR C;  5NUC A;  4OGQ C;  3TEH B;  4FF4 A;  2R7Z G;  3Q22 A;  1TS5 A;  4IZ8 A;  4BBR B;  1BQQ T;  3KBX A;  2R92 H;  3NE5 B;  4DAP A;  1VMC A;  3KJO A;  3RZD B;  4A3K G;  2K14 A;  4DR5 L;  5KND A;  4DV6 Q;  4P74 A;  1SMY C;  5CMD A;  3I90 A;  1N8R C;  2RBM A;  3X3M A;  3J80 i;  2Q8T A;  3HOX H;  2HDM A;  1IKL A;  4HCS A;  2EJM A;  4FXG C;  2QDL A;  2A69 C;  1A15 A;  2FMM A;  3ZJY C;  1YHB A;  3KOJ A;  3L7Z C;  1EOT A;  1UWV A;  4ZUJ A;  2Z8L A;  1Y1W G;  2RKS A;  3R93 A;  3RR5 A;  5KNC A;  4A3G H;  1PYS B;  3EA6 A;  2VQE L;  4HIK A;  2H4O A;  3K5O A;  5FO8 B;  1TY0 A;  2R92 B;  3Q23 A;  5KGU A;  1B3A A;  3NTK A;  1I4R A;  3MFY A;  4GKK L;  5D3I B;  1YNN C;  5D3D A;  3KFU A;  2SEB D;  3NUC A;  3I72 A;  2KCN A;  3G7L A;  1JC7 A;  3HOY G;  4H02 A;  4X6A H;  2EY5 A;  3HOX B;  4ZKC B;  1KTK A;  3KDF B;  2A6H C;  4C3H H;  1HHV A;  2LMC B;  4B3S L;  4U68 A;  3M4Y A;  1ICF B;  1XMO Q;  3HEJ A;  2IPK D;  1NR4 A;  1YEZ A;  4K5V A;  5M3F B;  1EFI D;  1PFB A;  1KQS A;  4DR7 Q;  2GA4 B;  1EFW A;  5FO9 B;  1AEX A;  4RKL A;  1IZ6 A;  3TME A;  1B44 D;  1PH3 A;  3DM3 A;  5IP7 H;  3W1G A;  3K0X A;  4DV3 L;  1ENC A;  1B8A A;  1EY6 A;  1STA A;  1SRU A;  2K32 A;  1IW7 D;  3CME A;  3Q24 A;  2HD3 A;  4B3T L;  4A3M H;  2Q8I B;  2NN6 I;  4OEM B;  4G7O C;  1H9S B;  1SJE D;  1WI5 A;  1PTO F;  3PGZ A;  1HQM C;  3EQL C;  5FLX c;  2KA7 A;  4GLA C;  4B3R Q;  4O42 A;  3IRB A;  1XPR A;  2OXP A;  4KKS A;  4RKB A;  1FGU A;  1HTL D;  1ZXT A;  1SAP A;  2IHE A;  4DV2 L;  1I4X A;  1JQY D;  2K05 A;  2Y0S G;  3W5O A;  1JIC A;  2B2U C;  1KAB A;  1SFO B;  3NK9 A;  3JAM i;  3PIO A;  1QUQ B;  1WD1 A;  2PQE A;  3HOU H;  4A3B H;  1OXT A;  5J39 A;  4YCV A;  2RHS B;  3PO2 H;  4GNX B;  3I4M H;  2J4X A;  4WFN 3;  3U9S A;  2MHV A;  2BH2 A;  3BS1 A;  2ZJP A;  5BN4 A;  2OCE A;  4A3M B;  2ZTC A;  1WTQ A;  1L0W A;  5ELC A;  2TSS A;  2ZM6 Q;  2R7Z H;  1UUP A;  4C56 C;  1D8L A;  2BE5 C;  5IP9 G;  2B2U A;  4GNX C;  1VQG A;  4A3F H;  1D1K A;  4A3K H;  3HOW B;  4NXN L;  3HRZ C;  4APV A;  2EY1 A;  3I4N H;  1EY4 A;  4JI2 L;  3H3V H;  1VDZ A;  4PMC A;  2EYL A;  5LMU L;  3WOE A;  2OTJ A;  1SNM A;  2ZJQ A;  1NUC A;  3HOU B;  1LTI D;  4A3B B;  3CCM A;  1PRT D;  2H1E A;  2EE1 A;  2VZA A;  3PO2 B;  4HJ5 A;  1JE4 A;  1VQC A;  4ZRZ A;  3KF8 A;  1QNK A;  4FXD A;  4NXM Q;  1EYA A;  3T13 A;  4RCO A;  3WWV A;  2M9V A;  4GZY C;  4MIU A;  1CM9 A;  3S1R H;  2R7Z B;  4IO9 A;  1UE6 A;  2MP1 A;  2LSS A;  1EY9 A;  4G7Z C;  4LUO A;  1HZA A;  1YNJ C;  2EYO A;  4HJ8 A;  3VR5 A;  2F0D A;  4A3F B;  1XNQ Q;  1F2M A;  2UXC L;  1HZC A;  4A3K B;  3NBH A;  4RCN A;  4DR1 L;  3I4N B;  1IBL L;  1CA5 A;  3BYY B;  2Z1C A;  1E1T A;  4P75 A;  2VUM H;  5F2D A;  3HOY H;  1SND A;  2WP8 J;  4A3I G;  3TN2 A;  1Y1V G;  4LW1 A;  3CCQ A;  2NB0 A;  4DUZ Q;  1JT8 A;  4X3T A;  2C5C A;  3DMU A;  1N36 Q;  3QB3 A;  2ZTD A;  1G8Z D;  1X32 A;  3NEM A;  5EAY A;  4OWX B;  1PH6 A;  3OTO Q;  2JQO A;  5GAH C;  1Y1W B;  4EQ5 A;  3K8A A;  2N78 A;  1WCM G;  4BS9 A;  3S1R B;  5H1S E;  1GUG A;  3CU7 A;  1KXL A;  4LF5 L;  1FGB D;  4FF2 A;  3FEW X;  4B3M Q;  3MZ5 A;  4HTH A;  4ZCK A;  4LFC L;  2PZW A;  3E9H A;  3SDZ A;  2UU9 Q;  1Z9F A;  2OTL A;  3HOY B;  4JK1 C;  3GQB A;  4JG2 A;  2F4V L;  3S1Q H;  4WJ3 M;  4KMU C;  1XNR L;  1LT5 D;  4GLV B;  2F0W A;  4IUR A;  3K57 A;  4HR7 B;  1CK1 A;  1UE1 A;  5IYD G;  4MN3 A;  4DR4 L;  4IFD H;  3CCS A;  3AEV A;  1WYD A;  5BR8 Q;  4M1U B;  4ZYS A;  4JI3 Q;  3SK4 A;  3PSI A;  2LY7 A;  5C0X J;  2OWO A;  2PI2 A;  4QQB X;  1KAA A;  1FJG Q;  5T1G A;  3E0E A;  2IX1 A;  4C3I G;  1X55 A;  5DM6 3;  2HT1 A;  2A19 A;  2CH4 W;  4KKU A;  2F0N A;  4JBJ A;  1AP0 A;  3J7A F;  4X3U A;  3ITP A;  4X3S A;  1CQF A;  3S9W A;  1ET6 A;  4WOR A;  2XVS A;  4JI1 L;  1Q8K A;  3NWT A;  4QJF A;  2E2J H;  3NSW A;  1L2F A;  1YZ6 A;  2L12 A;  4YCW A;  2A74 C;  3UE1 A;  4JI6 L;  1I94 L;  1VQ8 A;  1NE3 A;  3VYT A;  1PA6 A;  3U58 A;  3FDT A;  3GTO H;  5JJL A;  5E3F A;  3S1Q B;  3UDX A;  5C3E G;  4DPG A;  4IAL A;  4OEL B;  1AN8 A;  1B7Y B;  4LF4 Q;  2G5D A;  3A8I E;  1I4Q A;  3K5L A;  3BDL A;  1EY5 A;  4A93 G;  3TBI B;  4JI4 Q;  3TSS A;  5COY A;  4IPH A;  2B2T A;  2IY5 B;  1TT2 A;  3OIP A;  3N52 A;  2XN9 C;  4DR6 L;  2E2J B;  5LHY 1;  2B8F A;  2XSC A;  3H94 A;  5CV7 A;  1VQM A;  3I4O A;  1J5E L;  3KF6 B;  1Y8P B;  2Z6K C;  1KRT A;  3TZU A;  3MAQ A;  1ESF A;  5CV5 A;  2K5V A;  4J6H A;  2E5L L;  3GTO B;  2K5Q A;  2J7Z A;  3HOZ G;  3VYU A;  3IL8 A;  3RLF A;  3S2D B;  4B08 A;  2UXB Q;  1SEB D;  1VCI A;  1EWC A;  4HSV A;  4JI7 Q;  5IWA L;  1S3O A;  2K50 A;  4NKL A;  5M9O A;  2MPM A;  4DAY B;  1IKM A;  4JBM A;  1LT3 D;  1STH A;  5ISR A;  5J3B A;  1BCP B;  1N33 Q;  4PNY A;  1HNW L;  5JPM C;  4DR2 L;  2F03 A;  4GOP A;  2VB2 X;  5KYI A;  4CDE C;  1D2B A;  2B63 G;  4R9W A;  2XIW A;  2WKC A;  4CBV A;  5KNB A;  3SHL A;  4KK7 A;  1TWG H;  1TVX A;  1BCP C;  2E74 C;  5K5P A;  4A3I H;  1JMC A;  1Y1V H;  2KHS A;  3S15 H;  2O4X A;  1HR0 W; 
#chains in the Genus database with same CATH homology
 3LX0 A;  4NP5 A;  1ROD A;  4K8I A;  1AZP A;  1A3U A;  1WTP A;  4LK1 C;  1ILQ A;  4RHR A;  1GHJ A;  1NSN S;  1LTB D;  2B2V C;  1E2V A;  1PZJ D;  3A55 A;  1LLR D;  1SSO A;  4CKC A;  3ND8 A;  2JP1 A;  1LTS D;  4IQZ A;  2E76 C;  4ODG A;  2F0M A;  1TWG B;  3GV3 A;  1GUT A;  4A3I B;  1Y1V B;  4C1N I;  3MXN A;  3UI2 A;  2F4I A;  3S15 B;  1J9O A;  1NCV A;  1TS4 A;  2RQX A;  3RUZ A;  5BN3 A;  2B2V A;  1WD0 A;  1WCM B;  1PTO D;  2BOS A;  3O13 A;  2QF7 A;  2A68 C;  2PZU A;  1GUO A;  2X6G A;  4I65 A;  1DYQ A;  1ML0 D;  5CGK A;  3IFT A;  1HFG A;  3NHH A;  2J0T D;  2L1B A;  5C5L A;  1R9T B;  3D4R A;  3VA5 A;  4XIG S;  4ZQ3 A;  2KVM A;  3AMU A;  3PV0 A;  1MSG A;  3GTJ B;  3K59 A;  4QIW B;  3URY A;  1EY7 A;  2F0G A;  5CC4 A;  2C9O A;  1G2S A;  4PV1 C;  4KJO A;  2OF1 A;  3NBI A;  1H9J A;  1E2Z A;  1LT4 D;  3L9A X;  1TQO A;  3WDN A;  5K36 H;  5EKK A;  3P7J A;  3D6C A;  5IGF A;  1D5M C;  5IOD A;  2EZV A;  4H44 C;  5EJW A;  3D3R A;  5C3E B;  2PNR C;  1RHP A;  5FKA C;  4F7X A;  4DU9 A;  1LAB A;  1TKW B;  2K01 A;  1CT1 D;  3TP5 A;  3ERQ A;  1JWU D;  1I4P A;  2EPB A;  1CZW A;  2ICE C;  1WTR A;  4K2K A;  2JSO A;  5C0X I;  1PDQ A;  2EY6 A;  4XYO A;  2R3Z A;  2OEO A;  1RDP D;  5KRU A;  2K5D A;  3SEB A;  1F9P A;  2TMP A;  5D65 A;  4J8Q A;  3S17 B;  1WTX A;  3D4D A;  3BZD B;  4NW2 A;  5COR A;  3GTG B;  1PXU A;  2PYK A;  2MGS A;  1GUS A;  1EQV A;  1HPC A;  5CYU A;  2QKI C;  2B63 B;  5C4X B;  5C6A A;  2K5W A;  2K7V A;  1KNE A;  3QO2 A;  2L55 A;  1QOH A;  1HA5 A;  1BBX C;  1B53 A;  2AQ1 B;  3MHB A;  4C3J B;  1QCB D;  2DNE A;  1H9R A;  2ZT9 C;  4HSP A;  2NUC A;  4ZAI A;  2KEC A;  1MSH A;  1PFN A;  3VR3 A;  1LO5 D;  1SYB A;  5JEA H;  1RTN A;  2L9H A;  3ZYY X;  3PUV A;  5KEE A;  4WRD A;  1B9M A;  4FO2 A;  3ONA B;  1JB3 A;  4FF3 A;  2RSN A;  1HFN A;  1TII D;  1ZKO A;  3CRK C;  1V8Q A;  5M3M B;  3BDC A;  3NP8 A;  5IGD A;  3K0Y A;  2E2D C;  5I9P A;  1Y8O B;  4DK0 A;  4HMI A;  2ENB A;  4CKB A;  2F0O A;  3A56 A;  1ZYR D;  1KLG D;  3VA7 A;  1IW7 C;  3H0G B;  1SNQ A;  3SK8 A;  1C48 A;  3DHQ A;  1U4L A;  4K5W A;  4F88 A;  3MA2 B;  4IUV A;  3QIA A;  1B4O A;  1A2T A;  3DWP A;  3PMF A;  4HCE A;  4LMQ D;  4U67 3;  3VR6 A;  1SMY D;  1ET9 A;  1FD7 D;  3TZD A;  1RTO A;  1GOZ A;  3V96 A;  3R3O A;  1LAC A;  2NN6 G;  4IUU A;  3P20 A;  4KN7 C;  2M00 A;  5ELB A;  2A73 B;  5KIX A;  4KHV A;  4OIJ A;  3EJI A;  4RGN A;  1CI3 M;  4EQP A;  3D31 A;  4X3K A;  2FHT A;  4DK1 A;  3CHB D;  2F0P A;  3MWY W;  3H09 A;  1BR9 A;  3GTK B;  1YNN D;  2VNU D;  3IKJ A;  3M4O B;  1R4P B;  1BCP F;  5FOB B;  2FJ2 A;  2JA6 B;  5C4H A;  1B9N A;  1MI2 A;  4L8J A;  4A3D B;  3H91 A;  3GO5 A;  1M4V A;  4L63 B;  4Z9C B;  1U4M A;  1PLF A;  5IOC A;  2WAC A;  2HDL A;  5C4J B;  1HUM A;  2DN8 A;  5CR3 A;  4B9X A;  4KI0 A;  2F1M A;  1HRJ A;  4LJZ C;  4IFD I;  3OHX C;  1EEF D;  1TWC B;  2NVY B;  2O2L D;  2L0C A;  2XWJ B;  4DNR B;  3OMC A;  3FKI B;  2O5I C;  1DD2 A;  1Q1B A;  2EYJ A;  3T4A C;  4OIK A;  1DOK A;  2QIL A;  1HCZ A;  1H9M A;  3C3L A;  1JWS D;  3PUY A;  1SDF A;  1W6J A;  4DXG A;  3I8Z A;  4QB4 A;  1Z47 A;  3F2U A;  5LL6 S;  5JOB A;  3DM1 A;  1IHZ A;  3OWF A;  3VR2 A;  1ZEQ X;  2F0U A;  3C1E A;  3S16 B;  4UAI A;  3N6R A;  1G2T A;  4TRD A;  2NZ1 D;  5CV4 A;  1CHP D;  2G9H D;  2VB3 X;  4KHZ A;  5G3L F;  1XTC D;  2BE5 D;  1K8O A;  4K8J A;  3MTS A;  5ELE A;  2IWH A;  5JEA J;  1E0B A;  2SNS A;  5M5Y B;  1JOQ A;  3MXP A;  2K04 A;  2EJF C;  4ZLT F;  5CBA E;  2V4D A;  1SNO A;  5FO7 B;  2F3W A;  3AB9 A;  4M8A A;  3K5N A;  4QF4 A;  1I6H B;  1Q8I A;  2R6G A;  3CKI B;  1R4Q B;  1PMR A;  1O7L A;  1LT6 D;  1DOL A;  3LNN A;  3KLS A;  1FR3 A;  1EZ6 A;  1GUN A;  5IIF A;  4H7B A;  5I6W A;  1EIG A;  2A6E C;  2G9D A;  1V1O A;  5HUR A;  1SYD A;  5FK9 C;  3E6Z X;  3SVM A;  1C8C A;  5E4W C;  2X6L A;  3I91 A;  2BDO A;  1ONL A;  2CW0 C;  3J80 L;  5EQ0 A;  3U9O A;  2B2T C;  4CJ1 B;  2QDB A;  1M8A A;  3PIO 3;  4H13 C;  1G6Z A;  2E75 C;  2K28 A;  2F0V A;  1SE2 A;  5CV6 A;  1SNC A;  4KY6 A;  2NWG A;  4QUC A;  1JWM D;  4DFA A;  1EZ8 A;  5JAV A;  4OO1 I;  1RCV D;  2AQ2 B;  4HAE A;  1BO0 A;  1S5D D;  2EY2 A;  4BA2 I;  3J7A V;  2Y0S B;  4DN4 M;  3R2I A;  1I4G A;  1EIH A;  3K6O A;  5DAU A;  1FNU A;  4HMJ A;  1CQV A;  2QCP X;  1QJO A;  1Z7T A;  4OHJ A;  4RWS C;  3TP8 A;  2OT2 A;  1I3Q B;  5CV9 A;  1STB A;  2EJG C;  2EYM A;  4BWG B;  3OW7 A;  1NR2 A;  1RJT A;  2AUJ D;  3FMC A;  3EFX D;  1OXU A;  1TWF B;  4QMG A;  1KLU D;  3GTP B;  4XQN A;  4CHT B;  4ZKB B;  5IGC A;  3J80 E;  3R8B A;  2WII B;  4CGY B;  3X3N A;  3DXJ C;  3A54 A;  5EKL A;  1K83 B;  1EY8 A;  4K5X A;  1STY A;  1SXT A;  3T16 A;  1Y8N B;  2SNM A;  1UAP A;  2EVB A;  4G7H C;  1BNZ A;  1G91 A;  3BYT B;  5DEH A;  4ILW A;  4G57 A;  3PUX A;  1T5E A;  1F77 A;  1F2Z A;  5D14 A;  1MBY A;  1XXG A;  3GTM B;  1SE3 A;  4KV6 A;  1V1P B;  2D62 A;  4O1N A;  4KD4 A;  1NAP A;  3S1M B;  3MVV A;  4J1M A;  1O7Z A;  4ME5 A;  1FYC A;  2B39 A;  1IL8 A;  3LWE A;  2F0T A;  3GP7 A;  5AFW A;  1JOK A;  1TR5 A;  4CJ2 C;  1O78 A;  2WV6 D;  1T5X D;  1BCP D;  1XX8 A;  3GD7 A;  1GUW A;  3PUW A;  3M7G A;  4C1N K;  5EBD A;  4BBS B;  3W3A A;  3QG1 A;  2Z4I A;  3C1F A;  1A3V A;  4RAU C;  2R61 A;  2JYO A;  5C4Z A;  4EQO A;  2KCC A;  2JE6 I;  1FNV A;  5BN5 A;  2IX3 A;  1F2L A;  2D5D A;  1OXV A;  2VXW A;  4C3I B;  2LFN A;  4IFD J;  3D6W A;  1B2T A;  2EYF A;  3OSO A;  1E2W A;  3W2D A;  2L4N A;  2AUK A;  3NPP A;  1SJH D;  4KTA A;  3HGB A;  3A7A B;  1TU2 B;  4RFB A;  5C44 B;  4K14 A;  5C3X A;  1FNW A;  1I6V C;  5C0X G;  4CJ0 B;  2NVQ B;  1S5E D;  2ICI A;  1CZG A;  1JCK B;  4H0L C;  4FNF A;  4R8I A;  3BG3 A;  4K6L A;  1CFM A;  2RDH A;  3D4W A;  4C3H G;  1JOR A;  1QIL A;  1Z6H A;  3TDQ A;  4A93 B;  3HP3 A;  1I4H A;  4Y7N B;  2JA8 B;  1QB5 D;  2Q8R E;  1F9R A;  2NYZ D;  1IYV A;  1RF2 D;  1Y69 U;  3GV6 A;  3K58 A;  4Q0F A;  2F0E A;  3NTH A;  3HOZ B;  2HCC A;  4FVM A;  5I9O A;  5ELF A;  5G3L D;  3ND9 A;  1LV9 A;  2F0Q A;  3PUZ A;  1BXT A;  3S1N B;  2NVX B;  2IX0 A;  4IUT A;  5E1F A;  1VMP A;  3MFG A;  4XYQ A;  1TS3 A;  1DJR D;  2NTS A;  3IFD A;  4ULL A;  4YIJ A;  1BF4 A;  1MGS A;  3S14 B;  3A8J E;  2B2W C;  2XRQ D;  2F0K A;  1Q12 A;  4EGV A;  2AQ3 B;  2F0F A;  1LTA D;  4ABN A;  5ELD A;  2B2Y C;  2KEE A;  1XYI A;  5JVG 3;  4HN7 A;  1O80 A;  5JJZ A;  4DXF A;  2MJ8 A;  5CBE E;  3SXH A;  4E6I A;  3QWN A;  3BVZ A;  5CV8 A;  2B2W A;  2AWO A;  3M3Y B;  4DGZ A;  4L6T B;  1A6X A;  2B2Y A;  2RSO A;  2WB1 B;  1ILP A;  3RMH A;  1D6E C;  1STE A;  2K6A A;  1AZQ A;  1RKN A;  2LS0 1;  3J7Y W;  1SYE A;  3K5M A;  1KDA A;  3OPO A;  1DOM A;  3VYS A;  2JXM B;  1QWY A;  1D5X C;  4TQU S;  2DY8 A;  5C3W A;  2PZT A;  5EGT A;  3NWS A;  4XDX A;  3HKZ B;  1SYF A;  1BOS A;  1D5Z C;  3NQI A;  3SK5 A;  1PZK D;  4B9W A;  1DZ1 A;  3KUP A;  4KY7 A;  1VF7 A;  3EVQ A;  2PW7 A;  4DAV A;  5C0X H;  3KBG A;  1UNS A;  4RGM A;  5E4X A;  4FXK C;  3V05 A;  2RVL A;  2KOL A;  4BY1 B;  1UEA B;  4RH6 A;  1CA6 A;  1JOO A;  4DF7 A;  2A69 D;  1C4Q A;  4NMZ A;  1OO9 B;  2L11 A;  3I73 A;  2EYH A;  2F0I A;  2FIN B;  3VYR A;  2IW3 A;  4A3G B;  3J81 L;  4K6D A;  1EL0 A;  3KLS X;  5I6Y A;  2N55 A;  4P2C B;  1RD9 D;  1PRT B;  1S5B D;  4PMB A;  2CVR A;  4FF1 A;  1BUV T;  2FMC A;  5T1I A;  4C3H B;  2A6H D;  3I4L A;  4IFD G;  3GTQ B;  1HA6 A;  1PRT C;  2ZXO A;  4QUF A;  4KD3 A;  1SYG A;  3HS0 C;  1EEI D;  4A3E B;  1QE6 A;  1STG A;  3BVM A;  1TY2 A;  3SE0 A;  1SBB B;  3WOF A;  1A2U A;  4XTC S;  1J8I A;  3HG9 A;  2F0L A;  5IGE A;  2IJ0 A;  5EPL A;  2NTT A;  4UDU C;  5EKI A;  4NDX A;  2IT1 A;  2YYZ A;  2DY7 A;  4KJN A;  1A3T A;  3J81 E;  3HZX A;  1XWE A;  1DON A;  2KED A;  4XXE A;  5HGT A;  1H9S A;  4A3J B;  3NQT A;  3BDO A;  2RDF A;  1JR0 D;  1II3 A;  5IGB A;  3ERO A;  1WTO A;  4RHS A;  1TS2 A;  2K03 A;  3I4M B;  4KN4 C;  1QNU A;  2EOT A;  2K33 A;  2DNC A;  1K8M A;  1L0X B;  3GTL B;  4S3S A;  2Z4H A;  1LTT D;  3FPU B;  1LTR D;  3TP6 A;  4N9P A;  2BDN A;  1I50 B;  1PFM A;  3A8K E;  2K1B A;  5J1Z A;  1TWA B;  1AW7 A;  1F9S A;  2PPB C;  4FYD A;  2E2H B;  2NN6 H;  1EWH A;  1QG7 A;  3CRL C;  3OWE B;  3H3V C;  4WJW A;  2KUM A;  3SK6 A;  3C46 A;  4QCL A;  1DM0 B;  2JEB I;  4ID6 A;  2NBF A;  1YNJ D;  3NTI A;  5JVH 3;  1KDC A;  2VUM B;  4RA8 A;  3MC0 B;  2HCI A;  2QEJ C;  2HQE A;  4MHE A;  1X3Q A;  4DNT B;  2EXZ A;  2R93 B;  2RDG A;  1L0Y B;  3LWU A;  2JA5 B;  3E0J A;  3FPP A;  2EYP A;  4OO1 G;  2ID0 A;  2N88 A;  4IUP A;  4Q5V A;  4F87 A;  3KK7 A;  2JEA I;  2XNA C;  3R2T A;  1W6K A;  2F0J A;  1S4Z A;  4RGO S;  5DM7 3;  1SNP A;  4BA1 I;  1X3P A;  4XQJ A;  2F0S A;  4ZK9 B;  5KYL A;  1DCZ A;  2PCF B;  2AWN A;  3QJY A;  1VF5 C;  1KDB A;  2XWB B;  3VR4 A;  1PTO H;  2A6E D;  2YU9 B;  3SR1 A;  4I7Z C;  3OMG A;  1U4R A;  1F9Q A;  2CW0 D;  1HTP A;  1ENA A;  5K36 G;  1D1I A;  3A7L A;  4PMW A;  3OOC A;  2X69 A;  2A5H A;  1OXS C;  3DUZ A;  3I3C A;  4CKE A;  1KNA A;  1WVL A;  1PTO B;  3KLR A;  4TSS A;  4V19 0;  3Q6S A;  3E5S A;  2CHB D;  5A35 A;  2RA4 A;  1Q90 A;  3P1H A;  3MXU A;  4TKO B;  1CTM A;  4PQX A;  3C2P A;  3M85 A;  1PTO C;  2PMZ B;  4G4K A;  3T53 B;  1PZI D;  1WTW A;  5JPN C;  1TWH B;  1GXD C;  1EU3 A;  2WAQ B;  2B8G A;  3JAM L;  1PYW D;  1GHK A;  2I07 B;  3AU7 A;  4C3J G;  5EPK A;  4AYB B;  5TSS A;  3MXG A;  2SDF A;  3FVQ A;  5EBC A;  2MUY A;  2L5T A;  5IT9 L;  2ZXR A;  4DAY A;  3V2T A;  5J22 A;  1EYD A;  3T56 B;  1MD2 D;  3Q0A A;  5A2Q L;  1IYU A;  1LTG D;  4EQN A;  1CHQ D;  1STN A;  3RD4 A;  2WIN B;  3RZO B;  4OO1 H;  4R8N A;  2O5J C;  1WTV A;  5EPJ A;  3K7A B;  4LAA A;  5I4D A;  2E2I B;  3D8G A;  3NXW A;  2PW5 A;  4BY7 B;  3T51 B;  1F2Y A;  1PRT F;  2PO4 A;  2WKD A;  2CQA A;  4F8M A;  5JEA G;  1G29 1;  1HXY D;  2EDG A;  1EY0 A;  5LL6 X;  3PO3 B;  3DEO A;  5DNF A;  1ESR A;  3DEP A;  1S5F D;  3JAM E;  3S2H B;  1V1P A;  1EYC A;  2SOB A;  1B1Z A;  1HQR D;  2KJX A;  5C5M A;  4XT3 B;  4RGT A;  3H6M A;  4IUN A;  5IT9 E;  1ICW A;  1BDO A;  5M5W B;  3QOL A;  1EU4 A;  2BA0 A;  2A68 D;  1ENF A;  2LKV A;  3TP7 A;  5A2Q E;  2M2L A;  3BVG A;  2D2C C;  4EVO A;  5IGG A;  1AFP A;  1U4P A;  4KY5 A;  2F0H A;  3IAY A;  2IL8 A;  2XRS D;  3CQZ B;  5FLX L;  1O7Y A;  4V0B A;  2BA1 A;  1HUN A;  4DA2 A;  1SYC A;  4XQQ A;  1H9K A;  1OXX K;  4JBW A;  1Q1E A;  2I46 A;  1Q3L A;  1V43 A;  4OL7 A;  3I70 A;  5I2X A;  1DXM A;  2KQ3 A;  2FFK B;  2HUG A;  4KKT A;  1B50 A;  3M7N A;  4ZUI A;  4C2M B;  3L3O C;  3QOJ A;  4IUQ A;  2NVT B;  4IN3 A;  3OIQ A;  5M5X B;  3MEH A;  1S5C D;  1U9R A;  1SE4 A;  2JA7 B;  4HED A;  3HOV B;  2BCO A;  1GJX A;  2F3V A;  2ZXP A;  4XT1 B;  2D9U A;  1EQT A;  3DWA A;  3DWQ A;  4N9T A;  3G6J B;  4FP5 D;  5I2Y A;  3P75 A;  3FRP B;  4K2L A;  3PIP 3;  5FLX E;  1ZYR C;  5NUC A;  4OGQ C;  4FF4 A;  3Q22 A;  1TS5 A;  4IZ8 A;  4BBR B;  1BQQ T;  3KBX A;  3NE5 B;  4DAP A;  1VMC A;  3RZD B;  5KND A;  1SMY C;  5CMD A;  3I90 A;  2RBM A;  3X3M A;  2Q8T A;  2HDM A;  1IKL A;  4HCS A;  2EJM A;  4FXG C;  2A69 C;  1A15 A;  2FMM A;  3L7Z C;  1EOT A;  4ZUJ A;  2Z8L A;  2RKS A;  3R93 A;  5KNC A;  3EA6 A;  2H4O A;  3K5O A;  5FO8 B;  1TY0 A;  2R92 B;  3Q23 A;  5KGU A;  1B3A A;  3NTK A;  1I4R A;  3MFY A;  5D3I B;  1YNN C;  5D3D A;  2SEB D;  3NUC A;  3I72 A;  2KCN A;  3G7L A;  1JC7 A;  2EY5 A;  3HOX B;  4ZKC B;  1KTK A;  2A6H C;  1HHV A;  2LMC B;  4U68 A;  3M4Y A;  3HEJ A;  2IPK D;  1NR4 A;  4K5V A;  5M3F B;  1EFI D;  1PFB A;  2GA4 B;  5FO9 B;  1AEX A;  4RKL A;  3TME A;  1B44 D;  1ENC A;  1EY6 A;  1STA A;  2K32 A;  1IW7 D;  3Q24 A;  2Q8I B;  2NN6 I;  4G7O C;  1H9S B;  1SJE D;  1PTO F;  1HQM C;  3EQL C;  2KA7 A;  4O42 A;  2OXP A;  4KKS A;  4RKB A;  1HTL D;  1ZXT A;  1SAP A;  1I4X A;  1JQY D;  2K05 A;  1JIC A;  2B2U C;  1KAB A;  1SFO B;  3NK9 A;  1WD1 A;  2PQE A;  1OXT A;  5J39 A;  2J4X A;  4WFN 3;  3U9S A;  2MHV A;  3BS1 A;  5BN4 A;  4A3M B;  1WTQ A;  5ELC A;  2TSS A;  1UUP A;  4C56 C;  2BE5 C;  2B2U A;  1D1K A;  3HOW B;  3HRZ C;  2EY1 A;  1EY4 A;  1VDZ A;  4PMC A;  2EYL A;  3WOE A;  1SNM A;  3HOU B;  1NUC A;  1LTI D;  4A3B B;  1PRT D;  2H1E A;  2EE1 A;  3PO2 B;  1JE4 A;  4ZRZ A;  3KF8 A;  1QNK A;  4FXD A;  1EYA A;  3T13 A;  4RCO A;  2M9V A;  4GZY C;  4MIU A;  1CM9 A;  2R7Z B;  2MP1 A;  4G7Z C;  1EY9 A;  1YNJ C;  2EYO A;  3VR5 A;  2F0D A;  4A3F B;  1F2M A;  4A3K B;  3NBH A;  4RCN A;  3I4N B;  1CA5 A;  3BYY B;  2Z1C A;  5F2D A;  1SND A;  2WP8 J;  3TN2 A;  2NB0 A;  4X3T A;  2C5C A;  3DMU A;  3QB3 A;  1G8Z D;  1X32 A;  1Y1W B;  4BS9 A;  3S1R B;  1GUG A;  3CU7 A;  1FGB D;  4FF2 A;  3FEW X;  3MZ5 A;  4HTH A;  2PZW A;  3SDZ A;  3HOY B;  4JK1 C;  3GQB A;  4KMU C;  1LT5 D;  2F0W A;  4IUR A;  3K57 A;  4HR7 B;  1CK1 A;  4IFD H;  4MN3 A;  4ZYS A;  4M1U B;  3SK4 A;  5C0X J;  2LY7 A;  1KAA A;  5T1G A;  2IX1 A;  4C3I G;  5DM6 3;  4KKU A;  2F0N A;  1AP0 A;  3J7A F;  4X3U A;  3ITP A;  4X3S A;  1CQF A;  3S9W A;  1ET6 A;  4WOR A;  2XVS A;  3NWT A;  3NSW A;  2L12 A;  2A74 C;  3VYT A;  3FDT A;  5E3F A;  3S1Q B;  4IAL A;  1AN8 A;  3A8I E;  1I4Q A;  3K5L A;  3BDL A;  1EY5 A;  3TBI B;  3TSS A;  5COY A;  2B2T A;  1TT2 A;  3OIP A;  3N52 A;  2XN9 C;  2E2J B;  5LHY 1;  2B8F A;  2XSC A;  3H94 A;  5CV7 A;  1Y8P B;  3TZU A;  3MAQ A;  1ESF A;  5CV5 A;  4J6H A;  3GTO B;  2K5Q A;  2J7Z A;  3VYU A;  3IL8 A;  3RLF A;  3S2D B;  4B08 A;  1SEB D;  1VCI A;  1EWC A;  4HSV A;  4NKL A;  5M9O A;  2MPM A;  1IKM A;  1LT3 D;  1STH A;  5ISR A;  1BCP B;  4PNY A;  5JPM C;  2F03 A;  2VB2 X;  5KYI A;  1D2B A;  4R9W A;  4CBV A;  5KNB A;  2WKC A;  2XIW A;  3SHL A;  4KK7 A;  1TVX A;  1BCP C;  2E74 C;  5K5P A;  2KHS A;  2O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...