3MVVA

Crystal structure of staphylococcal nuclease variant delta+phs f34a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTARLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mvvA00
1EY8A 3QOJA 5CV5A 4ODGA 1STHA 3NP8A 4KY7A 4NKLA 1TT2A 4K6DA 5CR3A 1SNOA 2F0QA 5C4HA 5J39A 2PZUA 2RBMA 4KD4A 1JORA 4KHVA 1EY4A 1EY6A 5JAVA 1SYBA 4EVOA 1A3TA 4IALA 5C5MA 3SK8A 3SXHA 1II3A 1KABA 4IUNA 4KD3A 4WRDA 1STYA 3SR1A 2F0IA 3P1HA 2OXPA 3T13A 1JOOA 2F0PA 3OMGA 3DMUA 5ISRA 5CV4A 4KY5A 3SK4A 4DGZA 4E6IA 5IGGA 5KIXA 5DEHA 2PZTA 3SK6A 4K2LA 1KDAA 5IGFA 1F2ZA 1IHZA 3EVQA 4KJNA 3EROA 5E3FA 2WACA 4DU9A 5C3WA 4ZUJA 3P75A 2F0TA 4K5VA 4B9WA 3E5SA 2EYPA 3NUCA 3MXPA 1STBA 4ID6A 5KRUA 2NUCA 2EXZA 1SYCA 1EYDA 1TQOA 2RKSA 3TP7A 1SYGA 2F0EA 3OWFA 3MEHA 1EZ8A 1SYDA 1KDBA 4WORA 3BDLA 2F0HA 3D8GA 4TRDA 4NP5A 5I9PA 2F0NA 3OSOA 4K8JA 5EKKA 3D4WA 1EYAA 2PW5A 1KDCA 5JOBA 2EYOA 3QOLA 1A2TA 2F0WA 3NQTA 1SNPA 3S9WA 3R3OA 5C6AA 2F0OA 2SNSA 5I9OA 5M9OA 4KTAA 1SNDA 5F2DA 2PYKA 3PMFA 2F3VA 2KHSA 1EY5A 2F0FA 3NK9A 2OEOA 3C1EA 3NXWA 2HQEA 1STAA 5CV9A 3V2TA 3LX0A 4ZQ3A 2SOBA 5I6WA 1U9RA 3TMEA 5KEEA 5EKLA 4J1MA 4DF7A 1STNA 2F0UA 4EQOA 1TR5A 5EGTA 3TP6A 3SK5A 4N9PA 3TP5A 4I65A 4HMJA 3ITPA 1SYFA 4HTHA 4HMIA 5E1FA 1KAAA 3H6MA 5CC4A 4S3SA 5C3XA 4KV6A 4R8NA 2PW7A 3VA5A 1SYEA 2F0GA 2EYHA 1SNQA 3EJIA 1EYCA 3QB3A 4EQNA 1EY7A 2PQEA 1EZ6A 4DFAA 5IODA 2QDBA 4IZ8A 1A3UA 4J6HA 3SHLA 4MIUA 4QB4A 5KGUA 4H7BA 4PMCA 5KYLA 2PZWA 2F0JA 3MVVA 4K5XA 4RKLA 1JOQA 3HZXA 1JOKA 2RDFA 3ERQA 2SNMA 3C1FA 4K2KA 5C4ZA 5IOCA 2EY1A 2ENBA 2EYLA 2EYMA 4ZUIA 1A3VA 4QF4A 1A2UA 2F0VA 5HGTA 4PMBA 4OL7A 3MZ5A 1ENAA 3D4DA 4K14A 2EYJA 4PNYA 4N9TA 3RUZA 3DHQA 3NHHA 3D6CA 5DAUA 3TP8A 5NUCA 4NDXA 2EY2A 1AEXA 2F0DA 4KY6A 5IGBA 1F2MA 2F0SA 5CGKA 2EY5A 5IIFA 4EQPA 2EYFA 2F0MA 4LAAA 5C5LA 5CV7A 4F8MA 3U9OA 5K5PA 4QMGA 1NUCA 3HEJA 4B9XA 2KQ3A 5HURA 5I6YA 4YIJA 5IGEA 1EY9A 1NSNS 1SNCA 2EY6A 2F0LA 2M00A 5IGCA 5CV8A 1STGA 2OF1A 1EQVA 1SNMA 2F3WA 4K8IA 3BDCA 4RKBA 2F0KA 2O4XA 1ENCA 4F7XA 4KJOA 5J22A 4K5WA 3OMCA 2LKVA 1RKNA 4ME5A 4G57A 5CV6A 5KYIA 3MHBA 1F2YA 5J1ZA 3T16A 1EY0A 5IGDA 4NMZA
chains in the Genus database with same CATH superfamily
5CV5A 2Z4HA 3ZYYX 1P16A 5C4HA 2F4VQ 3HOVG 4V0BA 4HCEA 1KTKA 2IY5B 1BBUA 2B2TC 1STEA 3AU7A 1SE4A 5IT9E 1W6KA 3DMUA 1GVPA 3M4QA 1CZWA 4FXDA 1TKWB 4PZ8A 1ASYA 2WACA 3M3YB 3K58A 2EOTA 1DOKA 4RG1A 5I4DA 4ID6A 2BOSA 2JXMB 1PTOF 3A8JE 4A3GG 2F0EA 3OWFA 4G4KA 2EPBA 4IURA 3BDLA 4NXML 1G6PA 3D8GA 1QZHA 1BR9A 1O7LA 1D7QA 1YBYA 3KF8B 5IT9c 3I3CA 4JPBW 1TWFB 2JQOA 5M5YB 2EVBA 1YIJA 2DGYA 5C6AA 2M9VA 3LNNA 4BBSB 3HOWH 1EQRA 3EFXD 3LX0A 3CCRA 5LHY1 4JI6L 4DF7A 3J7YW 3SVMA 3CCUA 1VQ6A 1VQ4A 1QB5D 1AZPA 2H4OA 3CP0A 2NN6G 1SYEA 2QCPX 1EQQA 2WKDA 1Q46A 4J6HA 4YHHL 2Y0SE 2CWPA 1JOQA 4CDFC 4JVZA 2IHFA 4Y7NB 3ERQA 1QWYA 5C44B 2HDMA 3EQLC 4HAEA 4Q0FA 2ENBA 1N32L 2EYMA 4H13C 4L8JA 4DV4L 3PUYA 1HQMC 4PNYA 4J15A 2OCEA 1M8AA 5DAUA 4DV7Q 1PTOC 1TWCH 4WJWA 3FKIG 4IOCA 5IWAQ 2B63G 5FJ8G 4HEDA 2FMMA 3I4NG 1K9MC 4IFDH 2C9OA 1V9PA 3K5OA 4JI3Q 3I70A 3E0EA 3T56B 3NTKA 1ENCA 4LF4L 1B44D 1PDQA 3Q24A 1AW7A 4F88A 1I4XA 1XTCD 3TN2A 3CCJA 3PO3B 1K8MA 1FD7D 3JAML 3NTIA 3G6EA 4QIWE 4DXFA 3KDFB 1D6EC 4ODGA 1STHA 2B2YA 1FVIA 2TSSA 1KIXA 4R9WA 4GKJL 3NBIA 5JAVA 4A3IH 1X6OA 5H1SE 2Q8RE 1FNUA 4R4TA 1PYBA 5EAYA 3PF5A 3SR1A 4DNIA 5C3EB 2E5LQ 1I4PA 1VQAA 4MTKA 2L1BA 4BWGB 4U673 4E6IA 4KY5A 3SK4A 3IAYA 1AZQA 1XMQL 1BBXC 4JI5Q 3FVQA 4UPAA 1DCZA 2CHBD 4OWWB 5CMDA 1PH7A 4HIDA 2KCMA 1VQCA 2F0TA 2NUCA 4BBSG 3J81E 2A69D 1SN8A 1ONLA 4KKTA 3JAMi 2WFWA 1Z7TA 4TVAB 2F0NA 3VR5A 3V96A 4JK1C 1FNWA 3RLFA 1RF2D 2RF4A 1RD9D 1HH2P 1N34Q 1JJ2A 2TMPA 1Q81C 2OEOA 2RCFA 4JI8Q 4J1MA 5A35A 4O1NA 1HR0W 5C44G 1L0YB 3J81c 1HUMA 4N9PA 3HOUH 3ITPA 2OQKA 3TRZA 4DV5Q 4KV6A 4UDUC 3OTOL 4L5RC 1SFOH 1X3GA 2N8NA 1I4HA 1Y8OB 4M8AA 4MIUA 3MEFA 4DAVA 2CH4W 5IYBG 5KYLA 3OPOA 4UP7A 1SJED 3HOWB 5IOCA 4BXXG 4DR3Q 1W3SA 2K5DA 2UXBL 2XWJB 1ZKOA 1PH8A 4DR2L 1IW7D 5C0XG 2BE5D 4Q5VA 3CMEA 1GUNA 4JI4Q 4B3SL 4X66Q 3R93A 1TVXA 2I0QA 1W2BA 3PO3G 3OYYA 1J5EL 1GHKA 2FXQA 1DOLA 4IUUA 3VA7A 3BJUA 1SNCA 5FLMH 2FINB 3D3RA 5K36H 1B1ZA 4KHPQ 2QEXA 1SRUA 4RKBA 4XIGS 3GD7A 3H15A 1HNZL 4OX9L 5C3EG 3TZUA 4ME5A 5CV6A 5KYIA 2ID0A 2LXJA 3M4OH 1ZEQX 2EZVA 3NEMA 5ELOA 5JPNC 1TWCB 3VYSA 4XTCS 1TS5A 1KLUD 3A7AB 4KHVA 2EJFC 1B9NA 2YTXA 3KOJA 4WRDA 3P1HA 2OXPA 1Q8KA 1XNQQ 1GM5A 1JB3A 4LFBQ 3I56A 3UDIA 1OXSC 4AIMA 1IBLL 2V4DA 3KLSA 5LMUQ 1V1QA 1C7YA 1D2BA 3ULPA 1H9RA 1CHPD 1Y14B 1TIID 3NUCA 2NTTA 4RHSA 1HA6A 2YU9H 3HOXH 2JA8H 4A3IB 3CCSA 2UXCQ 4L5QA 2NZHA 3K80C 3I4OA 1BCPC 1KDBA 3WDNA 1A15A 1TS4A 4DNRB 2IJ0A 2QILA 4HIOA 3QOLA 1SJHD 3K57A 5IP7H 1F77A 2RCNA 3R3OA 1HNXQ 5F2DA 3K0XA 4LMQD 3NXWA 5LMNQ 2WV6D 5I6WA 3HOWG 4WJ3M 3URYA 2DNEA 4DUZQ 2UUBL 4EQOA 1TR5A 1TWAH 3TP6A 3TP5A 4GN5A 1S5ED 4C3IH 2UUAQ 3I72A 3OIQA 1SR3A 3FMCA 4YWMA 4CGYB 4JOIC 1Y1VH 4IJHA 3DM1A 3A5ZB 1VQNA 1U4LA 1HRJA 5GAHC 1IBKQ 2HHHQ 1YHAA 3EBEA 3KJPA 4FXGC 3A5UA 4RMFA 2AKWB 4IUQA 2F0VA 2XNAC 1JB7A 2K4KA 2KBNA 2MO1A 3HOUB 1UWVA 4PQXA 1SFOB 3CRLC 1G6ZA 4GLAC 4KLKA 1SAPA 4DK1A 1WD1A 1KL9A 2RVLA 3GTJH 1N33Q 2F0LA 2IWHA 1RL2A 4FDBA 4C3JH 1AH9A 2AWNA 4DV0L 1QZGA 4MN3A 4IFDG 2PO4A 3Q22A 1H9KA 1QCBD 1B70B 2NVYH 3AYHB 1D8LA 1YI2A 4OWXB 2Z6BA 5CBAE 3DUZA 1CUKA 1GO3E 1LLRD 4P71A 2MHVA 1E22A 4NKLA 3L7ZC 2PZUA 1CA5A 1LTTD 1IBMQ 1CKMA 1YZ6A 4NXNQ 4OGQC 1NR4A 2L11A 3R2TA 3MTSA 4O42A 4A3IG 2J7ZA 4IPCA 3VR6A 2NVXH 2R92H 4XT3B 3EVQA 3M4OB 2NTSA 4DR5L 1A63A 4YCVA 1FNVA 1C48A 4OO1H 3J80L 3RN2A 4X64L 4DAYA 1PZKD 1YVCA 4UY8C 3KF6A 2IHEA 2ZXRA 3PUWA 1EU4A 4A3MB 1WTOA 1SYDA 4IJLA 3HG9A 3DLLA 5LL6S 1WTXA 1I6HH 1RHPA 2B2VA 3G6JB 3VYUA 2B39A 5IY0A 3NQTA 1SNPA 3BVMA 4FXKC 1SNDA 1LYLA 4HCSA 3KK7A 3W1BA 1KRSA 4NW2A 2KVMA 1BCPD 3R8BA 4CBVA 2YU9B 1PHJA 4U68A 1BOSA 2VUMH 3HOXB 2JA8B 3NQIA 1S5FD 5FK9C 1JICA 3P20A 1MJCA 2WKCA 3GTPH 1X65A 1SNQA 4XXEA 3HOUG 5D14A 3J80i 1VQEA 2EE1A 4QL5A 5IODA 4IZ8A 2KA7A 3Q0AA 3C3LA 3FRPB 2VW9A 3X3MA 2NN6I 3M9BA 4Y52H 3U4VA 2JA6H 2PQAA 4AQYQ 4DR3L 1TWAB 5EQ0A 4K6LA 2EYJA 3FP9A 4C3IB 4LNQA 3DHQA 3RZOH 2MGSA 2K5HA 3MFYA 5NUCA 3TREA 2EY2A 3OWEB 3J7AF 2F0SA 2K52A 1I94Q 1Y1VB 1EU3A 3A8IE 5JEAJ 3O13A 4A3KB 5I6YA 5DM73 2PPBC 1Y1WH 3DEPA 2CQAA 4DV1L 2EY6A 5IGCA 4BA1I 4GNXB 3UE1A 2F0KA 1Z6HA 2KENA 5TSSA 4A3LH 4GN3B 4FF2A 5FLMG 4DXGA 5K36G 1FL0A 3CQZH 1S72A 1F2LA 3RMHA 1J8IA 1EY0A 2A68C 2RDGA 3SDZA 1SNOA 1SDFA 4FF3A 1TXYA 4RGOS 1OXXK 3JC66 3CRKC 3GTJB 2ZTDA 1WTHA 5CBEE 4C3JB 3DM3A 2QKIC 2XVSA 5AFWA 4A3MG 4DGZA 3I2ZA 4HSVA 3J81j 3NBHA 2H1EA 1MKHA 2K1BA 2NVYB 3OIPA 4KJNA 3T4AC 1UEAB 1PA6A 2JSOA 1LT6D 1Y8PB 2RDHA 3Q8DA 2EYPA 4B3TQ 1TQOA 2RKSA 1C9OA 1LT3D 3MEHA 5EBCA 4I7AA 4QQBX 4XT1B 3OSOA 1N36Q 4K8JA 3T1HL 1CI3M 3HOXG 2KEEA 2JA8G 4AYBB 1BDOA 4ZKCB 2R92B 4XQQA 5T1IA 4JV5Q 2I5LX 1X54A 5IYCH 1ESFA 1MI2A 1HNXL 5IP7G 1PTOB 2CH4A 2F52A 2VB3X 3AMUA 4I65A 1KNAA 3PIO3 2K5NA 1KAAA 4HIMA 1VQOA 1V8QA 2UUCQ 1I6HB 4PZ7A 4TKOB 4L5TA 2AQ1B 4C3IG 4DR1Q 3VR4A 4CKEA 1N9WA 2QDBA 3PV0A 1ESRA 3SHLA 4QB4A 2JA5H 2E2HB 1CQFA 2Y0SB 4OWTB 4KMUC 1LTRD 1CQVA 1Y1VG 3FHWA 1IBKL 1AE2A 3V05A 2R7ZH 5GQOA 2DNCA 1ET9A 4QY7A 3I55A 1T5XD 2K14A 1IKLA 3F2BA 1ENAA 2F1MA 2VUMB 4OELB 3MXNA 5JVH3 2HCCA 1PH1A 4DR6Q 1K83H 2XSCA 1LUZA 1ICFB 2F0DA 3GTPB 5COYA 3IFTA 1HQRD 5AJ3Q 3HKZB 3CC4A 1Q12A 4H44C 5BN3A 4X65Q 1C8CA 1NSNS 4X3UA 3DWAA 1BF4A 3JAME 2ES2A 4ZKBB 3RN5A 3GTLH 4A3CH 1LTID 1CSPA 1EQVA 4CJ2C 2A6ED 4K8IA 1A6XA 4HIKA 1QNKA 2JA6B 4GS3A 3CXCA 4FF4A 2K05A 4C3JG 4EX5A 1DZ1A 3T16A 5LMNW 5HY6A 1L0WA 4DV2L 4JI2Q 1JC7A 1SLJA 4QCLA 3I91A 2Q2UA 1EY4A 1HNWQ 2VNUD 3A54A 1Y1WB 3AQQA 4IUNA 3H09A 3H3VI 2XIWA 3S1NH 4FP5D 1FGUA 3C46A 2PZTA 3NELA 1GUWA 1K0SA 3SEBA 3CQZB 4YWLA 4AYBG 1X9NA 4XQJA 2R92G 1E3PA 2NBFA 4A3DH 2VQEL 3S17H 2PI2A 4IOAA 1JT8A 5JJKA 3K59A 1LM0A 3TP7A 1H9SA 1SYGA 4H02A 4OO1G 2YTYA 1M90C 2R6GA 3QG1A 1ENFA 3MWYW 2F0HA 4ALPA 4PZ6A 3BDOA 5JOBA 3S15H 2OQ0A 4LWCA 2EYOA 4CJ0B 5EPKA 1D5XC 2ICIA 1KD1C 3NENA 1G51A 2A69C 2SNSA 4IO9A 2PYKA 5GAEC 2XRSD 2OTJA 1HUNA 2A73B 3C1EA 2K04A 4XDXA 2Y0SG 3KLRA 1I3QH 1U9RA 1VQ7A 1HFNA 2CQOA 1VQJA 3KLSX 2X6GA 4HMIA 1K8AC 3VA5A 4FF1A 2VUMG 1EFID 1F9RA 3SGIA 4AYBE 3A8KE 4H7BA 1VQ8A 4ZRZA 1S5CD 2GVAA 4RKLA 1VMPA 3HKZG 2RHQB 3MA2B 2AMCB 5CORA 1SE2A 1DONA 3PF4A 4PMBA 1KAWA 2I5MX 4K14A 3VR2A 1LTAD 4X62L 2ZM6Q 3GTGH 1X3QA 2JA6G 4ULLA 4KY6A 4JYAQ 4RFBA 3CAMA 2R93H 4HSPA 4LAAA 5C5LA 3PGZA 2DY8A 3HS0C 5K5PA 3CU7A 2JA5B 1IW7C 2M2LA 1VQLA 1WVLA 2BE5C 4PV1C 5BR8Q 4JBWA 4LFAQ 2R7ZB 1VDZA 2WB1B 1Y1WG 2K5VA 3N52A 3H0GB 1FR3A 1HZ9A 4A3LG 1K83B 1ICWA 2N49A 4RH6A 4CDCC 2K5WA 4IFDI 4DN4M 1WJJA 1CHQD 4EVOA 4IALA 4FVMA 1MD2D 3HKZE 2K7VA 1GOZA 4JBKA 3GTLB 4KN7C 2QGQA 3BVGA 1PMRA 1D1IA 3CW2C 4Z9CB 4JBMA 2YTVA 3CCLA 1NMFA 4P75A 4DU9A 1NAPA 3S1MH 4ME3A 1EOTA 2G9DA 2GVBA 3QO2A 2K6AA 4JW0A 4LFCQ 1TY2A 1U5KA 2FMCA 2Q2TA 1HR0L 2NZ1D 2A6HC 1VF5C 2E2DC 3PUXA 4QJFA 3D4WA 1DM0B 3ERSX 3C2PA 3K7UC 1G291 3BVZA 1VQ9A 3S1NB 4MHEA 5I9OA 1E7ZA 3J7AV 2ZXPA 1BKBA 1HFGA 1H9MA 4CHTB 4A3DB 1A8VA 1RDPD 3S17B 5KEEA 2BA0A 1XX8A 3F1ZA 4JI7L 3NWTA 5IYCG 2CKZB 1PRTB 3ND9A 1XXGA 5IP9H 2NVQH 1F9QA 1LTBD 5CC4A 4S3SA 1PYSB 1EL0A 3B6YA 1MGSA 1U0LA 3S15B 1A0IA 1XPRA 1KNEA 3M7GA 2K33A 4F87A 1XJVA 3Q6SA 1T9HA 1K73C 2JA5G 2EIFA 2KHIA 5L37A 1I3QB 1NE3A 3VR3A 1O7YA 1AE3A 1PH6A 2R7ZG 4CJ1B 2WB1G 4IUVA 4DR4Q 4DUYQ 3WOFA 2JJQA 3EN2A 4A3JH 4R1JA 1NTGA 2UXDL 5JJIA 4F8MA 4JCVE 3NPPA 5AJ3L 4YIJA 1EEFD 1PFNA 2M00A 1EIFA 4X65L 2A8VA 1S5DD 1O7IA 3GV3A 5J22A 3T53B 4JOIA 1NMGA 4A3CG 2VXWA 3E0JA 1FYCA 3BYTB 1EY8A 3GTGB 1J9OA 5IYDH 1K28A 3WWVA 2ALYB 4LF9Q 1A62A 1TY0A 2R93B 1EYGA 2JYOA 2A1AA 4YY3L 3F2UA 1BCPF 1JWUD 5M5XB 1GUTA 1X56A 5DNFA 3J80E 1S4ZA 1B53A 2O5IC 3G48A 2WB1E 2O5JC 1JWMD 4IPDA 1SEBD 3KBXA 3RR5A 4DR7Q 1RTOA 3P75A 2BH2A 2IPKD 1YEZA 1U4RA 4IPHA 2EXZA 2ATWA 4A3DG 1F9SA 2PNHA 4K0KQ 2HIVA 1V1PA 2F4VL 4A3MH 1UNSA 2I07B 3FPPA 3D6WA 2JK8A 2K50A 1I50H 1A2TA 2F0WA 1SMYD 1B3AA 2A6HD 4BBRH 3S1MB 1O80A 4RAUC 3TMEA 2F0UA 3HRZC 3L9AX 1B50A 1PH4A 5E1FA 4LF7Q 2KJXA 2A19A 1UUPA 5C3XA 2KHJA 4EQNA 2UU9Q 4GZYC 1CKOA 2AQ2B 1OTCA 2H5XA 1HTLD 2VY3A 1KHIA 3MC0B 2F0JA 3EA6A 3A7LA 1JOKA 4ZAIA 3S1RH 4RGMA 4CKCA 3GTMH 2O2LD 2WP8J 1A3VA 5M3MB 3E9IA 3S24A 2KEDA 3I4MH 2K5QA 1RIPA 2ZTCA 3UDGA 2NVQB 4HJ7A 4DAMA 1I4QA 5CGKA 4P2CB 5IIFA 1B7YB 1CZGA 2VQFQ 1G2TA 1ZYRD 4DAYB 3PQIA 1O78A 3KF6B 4B9XA 3IKJA 3U58A 3M85A 3K5MA 3Q23A 1HZCA 4A3KH 2R93G 4BY7H 1ILPA 4LF6Q 2O4XA 5KNCA 1X3FA 3QR8A 1ASZA 1Q7YC 3PUZA 4LUVA 3R2IA 5KNDA 5FLXE 2LS01 4GKKQ 2Q2HA 4C1NI 4OXPA 1PH2A 4KY7A 2J0TD 1TT2A 4A3JB 2A74C 3BG3A 2Q2IA 1SYBA 4DV7L 1D5MC 1QVCA 2F0IA 2IL8A 4QUFA 1Q82C 3J81L 2F0PA 5IWAL 1EOVA 1HPCA 2WIIB 1XNRQ 2JN4A 1S5BD 3BZDB 3I90A 3GP7A 4JI3L 5FLXc 1ILQA 1O7ZA 1YNXA 1JE5A 3SE0A 3S1QH 4K5VA 3E5SA 3MXPA 1IKMA 4J8QA 2D2CC 2ZJRA 1EYDA 2JA7H 1LABA 2PQAB 4B3RQ 3LGJA 3U4ZA 2L4NA 1SROA 2PW5A 1K0RA 3KLWA 4OO1I 2E5LL 1EY5A 1XMOQ 4JI5L 4GN4B 5CV9A 1IYUA 3J81i 5ELFA 4A93H 2MFIA 1GJXA 1JE4A 1PTOH 5EGTA 3M4PA 1Y8NB 4HTHA 1SYFA 2E2IH 3KBGA 2B2UC 2IX0A 4NB3A 3HOYH 5IP9G 4LUOA 4L6TB 2Z6KA 1YHBA 1I50B 1Q1EA 3MVVA 2E2HH 2KCNA 2SDFA 4BBRB 5C4ZA 2EY1A 2Z0SA 4ZUIA 1A2UA 1GXDC 4P73A 1N34L 4POGA 3NBHB 3W2DA 4JI8L 4UHVA 2F0MA 3VYRA 3CCMA 3CC7A 4DV5L 3E3XA 5IGEA 5HURA 1C0AA 1EY9A 4A3JG 1L1OA 3RZDH 3S1RB 3GTMB 2P5ZX 3G71A 2KCCA 1WD0A 2MP1A 2PMZE 3OMCA 1EIGA 2QEJC 3I4MB 1CT1D 4DK6C 2F03A 4NXMQ 4ZCKA 2A6EC 1XPOA 5CR3A 4DV3Q 2SEBD 3NTHA 2K75A 4C3HH 2D5DA 5IYDG 3SXHA 2MUYA 1S40A 4JI4L 5A2QL 1PFMA 4BY7B 5DLQE 4X66L 1JOOA 1RODA 2HD3A 2R3ZA 3MXUA 4RGTA 1H9JA 1QNUA 2AHOB 5EPJA 4JI6Q 1VF7A 3D31A 3CKIB 3UE0A 5E3FA 4KHPL 3I8ZA 4R4OA 1MSGA 1Q3LA 3K7AB 4O0AA 3CCEA 2N88A 4FNFA 3K0YA 4N8X1 1LTGD 4YHHQ 4ZYSA 3MXNB 4A75A 3D0FA 5FO9B 2QDLA 5ELNA 1QE6A 5HGQA 5JEAH 3J7A5 5I2YA 1N32Q 2R7DA 4DV4Q 4KTAA 1PH5A 1XNQL 1KXLA 4L63B 3S1QB 1PRTD 2RQXA 4LFBL 3K6OA 2DUDA 4C2MH 2N3SA 2Z6KC 3I73A 1X32A 1STNA 4PMWA 5LMUL 2JA7B 4IN3A 4BBRG 4HMJA 2E2JH 3CF5A 1NJIC 4RCNA 2EYHA 3WOEA 5EKIA 1EQTA 2UXCL 2RHSB 4LF4Q 4G7OC 1HXYD 2UU9L 2PZWA 1VQHA 4CDEC 2CW0D 1JWSD 4A93B 2C5CA 2D0PA 4ZLTF 3CC2A 3UI2A 1WTRA 4GKJQ 3L0OA 2E2IB 3D6CA 1L1OC 5LMNL 1HA5A 1CK1A 3DWQA 3HOYB 4OIJA 3I4MG 1YNND 4DUZL 5M3FH 2UUAL 1DYQA 1H9SB 1NUCA 1XMQQ 2VQFL 4LJZC 3DXJC 4YCUA 5E7NA 1CM9A 4F7XA 3P7JA 2HHHL 4A3KG 2LKVA 5D3DA 4BY7G 1UE7A 3HKSA 2IW3A 2MPMA 1IXRA 3H0GH 4M1UB 2WINB 2BH8A 1JORA 2JEAI 4DV6Q 2JE6I 1E2ZA 2B2WC 2XTIA 1LTLA 2EJMA 5C5MA 2ASBA 1T5EA 4DNTB 3RZDB 4X3KA 2BDNA 3OMGA 3A74A 2KECA 1X3EA 1SE3A 2Z4IA 5C0XJ 2VL6A 4L5SA 4K2LA 1N33L 1IHZA 4A3BH 1BBWA 3EROA 4BY1H 3S2DH 1GUGA 1B2TA 1KC8C 5JJZA 3OTOQ 3GTQH 4C3HB 3PO2H 5JJLA 4UAIA 2CFMA 4GOPA 5EKKA 2JA7G 2OTLA 3JAMc 1DOMA 1IBML 1TU2B 2CVRA 3FDTA 4CDDC 1PFBA 4DPGA 3K5NA 2UXBQ 4NXNL 4O2DA 4DR2Q 3QIAA 4FYDA 2VS1A 2MO0A 3NE5B 2AQ3B 1GUOA 1CSQA 4IPGA 2L55A 1VQGA 4B3SQ 2V1CC 4YWKA 4IUTA 1YJWA 1J5EQ 4A93G 1VQFA 5G3LD 3ULJA 4APVA 3EJIA 1IL2A 1VQ5A 3GO5A 1G91A 3HOZH 1A3UA 2HQLA 4B08A 1HNZQ 4OX9Q 3HOYG 1L0XB 4X3SA 1HZAA 4K2KA 1WTWA 2RSOA 4C2MB 1EIHA 2IX3A 5HGTA 5DM63 2NVTB 1UE1A 3OOCA 3MAQA 3GTKH 3I4NB 2E2JB 1CFMA 4NPSA 2L9HA 3TZDA 4HJ9A 2J4XA 3QWNA 1QUQA 5C4JH 1BO0A 4QMGA 2KQ3A 1IBLQ 1QVFA 1STGA 1SNMA 4OIKA 1FJGQ 2K32A 3A0JA 4GNXC 2E75C 4ABNA 3RNUA 3ICEA 1CKNA 1JR0D 2XGTA 5EJWA 4AQYL 1AN8A 1K3BC 3S14H 5M3FB 1WTPA 2K03A 4AH6A 2PCFB 1A3TA 1SXTA 4DV3L 2EDGA 2LSSA 1KABA 2PI2E 1I94L 1MHWC 4P72A 1PYWD 3T13A 2AUKA 4C3HG 5M5XH 3S16H 1SE8A 4HN7A 3STBD 5CV4A 1CTMA 1PH3A 2QA4A 3G7LA 4I7ZC 2UUBQ 3AB9A 2A5HA 3W5OA 4MZ9A 1AFPA 5C3WA 4GOPC 3CMAA 1PV4A 1BNZA 1HCZA 3W1GA 1BCPB 1L2FA 3FEWX 1MJEA 1OXUA 1RCVD 2RA4A 4A3FH 1VQKA 3N6RA 3PIPA 4WORA 4DA2A 4IFDJ 3A55A 1NNXA 1JJCB 1EYAA 5D65A 4G7HC 1HJPA 3OHXC 1M4VA 2E76C 3K8AA 5D3IB 5JEAG 4A3BB 1GKHA 4BY1B 3S2DB 3K5LA 5EKLA 3GTQB 1SMYC 2OT2A 3ZJYC 3PO2B 2B29A 2MJ8A 4R8NA 1Q90A 1DJRD 4B3TL 3F2CA 4A4IA 2FHTA 4DK3C 4DV0Q 4KHZA 2I46A 2QW7A 3F8TA 3CD6A 1S3OA 4TSSA 2EJGC 4OONA 1VMCA 1N36L 1GHJA 1JJGA 2SNMA 3C1FA 4IQZA 2F3IA 4LF5Q 1R4QB 1NR2A 1DXMA 2EYLA 4JV5L 2L12A 4KKSA 3NHHA 5M3MH 3KF8A 4HJ5A 1GD7A 3HOZB 2ZTEA 4A3EH 1B4OA 1BXTA 4KKUA 2B3GA 2UUCL 1HZBA 1UE6A 4JI1Q 4X3TA 3PUVA 5M3FG 1V1PB 2OF1A 4DR1L 4DR5Q 2F3WA 4B3MQ 2NYZD 1M1KC 1ZYRC 1BUVT 4K5WA 4EQ5A 1OO9B 4X64Q 1XTDA 3CCQA 3TDQA 2DN8A 5J1ZA 3GTKB 1I6VC 5IGDA 3LWEA 1J6QA 5LL6X 1C4QA 4EGVA 3W3AA 1R4PB 3NP8A 4OEMB 5ELCA 1EY6A 1F9PA 4JI0Q 5C4JB 3H0GG 4DR6L 1LTSD 2VZAA 5KNBA 4R4IA 3SK8A 1YNJC 1IL8A 4QGUA 1EFWA 1STYA 4DV6L 4HJ8A 1I4RA 2Q8TA 1WOCA 2B8FA 4ILWA 1KQSA 2VB2X 1Y69U 3KYHC 5T1GA 5IT9L 4B9WA 1STBA 4A3BG 3M7NA 3I4LA 2R61A 4BY1G 2IX1A 3S14B 5BN4A 5E4WC 2L0CA 1Z47A 1JCKB 2JA9A 1EZ8A 4JI2L 5ELEA 1VQMA 4TRDA 5I9PA 1B8AA 1V1OA 1E0BA 3PO2G 1DD2A 3S16B 1HNWL 1TWGH 2F0OA 3F2DA 3PMFA 1AP0A 3KDFA 2JP1A 3ONAB 3J7ZC 1E1TA 1VCIA 4ZQ3A 2Q8IB 2QF7A 2MQHA 1B3QA 1K8OA 1HTPA 1MSHA 1UEBA 2DJFC 4A3FB 1ZXTA 1PVOA 4R8IA 2F0GA 1VQIA 4DV1Q 3QB3A 1CA6A 2PQEA 2LY7A 1IYJB 1KLGD 2G5DA 4CKBA 4PMCA 3J80c 2ZT9C 2B2YC 4K5XA 3PCOB 2EXDA 4WFN3 3HOZG 3HZXA 1PTOD 3T51B 5J3BA 1V43A 2D9UA 3MZ5A 4KI0A 1NY4A 1NCVA 3TP8A 1EIYB 2HCIA 1AEXA 2K01A 3IRBA 3M4YA 2EY5A 2EYFA 2EQSA 3U9OA 1JQYD 4DKAC 3T1YQ 1PZJD 2PNRC 1SSOA 1R9TH 5E4XA 1TWHH 1WCMH 4HJAA 1EWIA 2PMZB 2B2UA 1RKNA 3H91A 1FJGL 3G4SA 2AWOA 2LFNA 3BS1A 5A2QE 3A56A 1Q1BA 2D0OA 5J39A 4K6DA 3T1HQ 2F0QA 2KUMA 3KUPA 4KK7A 4A3EB 3BZKA 3CPFA 1H95A 1PRTF 2ZM6L 3RD4A 4TQUS 1KRTA 4KD3A 1XYIA 4JYAL 2C35B 2E74C 2R7FA 2FJ2A 4RCOA 1K3RA 3X3NA 2ZXOA 5IGGA 1PXUA 2HIXA 5BR8L 3CPWA 1YJ9A 2XWBB 1F2ZA 4RA8A 4LFAL 5C4XH 2X6LA 1YNJD 1GUSA 1QG7A 5KRUA 1YHQA 3CCVA 1SYCA 4R4QA 1RJTA 3K7AH 2OWOA 2DJGC 3E6ZX 3MXGA 1LT5D 3KJOA 4A3FG 3H94A 1QOHA 3IL8A 4LF8Q 4XYOA 3IFDA 2XN9C 2BCOA 4BA2I 2F3VA 2KHSA 1L1OB 3HGBA 4A76A 2ZJQA 1DGSA 2SOBA 2YV5A 3H3VC 5M5WH 3LWUA 3QJYA 2K28A 3ND8A 1PRTC 1UE5A 1EYCA 5JVG3 4LFCL 1TWGB 1N8RC 5JPMC 5ELDA 1MIUA 3CHBD 4DV2Q 4LF5L 3BZCA 3RUZA 3TS0A 3HFZB 3RLNA 1EWHA 1E1OA 4NDXA 2CW0C 5IGBA 1PH9A 1F2MA 4EQPA 2N78A 3HP3A 5M3MG 4MTNA 1QILA 2KCTA 2E8GA 1PLFA 5CV8A 4A3EG 1RTNA 4YCWA 1IZ6A 1YNNC 4ZK9B 4JI1L 2VQEQ 2YYZA 4PG3A 3HOVH 2HDLA 4B3ML 3D4RA 1VS0A 1MBYA 1VQBA 4BS9A 2RBMA 4KD4A 1PZID 1D1KA 1EWCA 4DR4L 4DUYL 1II3A 2GN5A 1D5ZC 2BA1A 4JI0L 1BVSA 1P8LA 1R9TB 1TWHB 1WCMB 3MFGA 4H0LC 2RSNA 2LXKA 2G9HD 3OW7A 5DEHA 5ELBA 5G3LF 1KDAA 4JG2A 1BQQT 4R4CA 3GTOH 4A3GH 2L15A 5FOBB 1TS2A 3GV6A 1EEID 1I4GA 3ULLA 1QJOA 4RGNA 2GA4B 1FGBD 1G2SA 4LF9L 1NBWA 3TBIB 2MNAA 2Z8LA 5M9OA 4XQNA 2HT1A 1E2VA 3VYTA 1TS3A 4DK0A 3OW2A 5C4XB 2B2WA 4X62Q 4RHRA 1YITA 2N55A 1STAA 5EBDA 2NN6H 4V190 3S2HH 3H6MA 1UAPA 4GLXA 1VQPA 4DR7L 3TSSA 3AFPA 1OXTA 2LMCB 3NWSA 4UP9A 1EY7A 1EZ6A 4DFAA 4JC0A 2AUJD 4K0KL 3AEVA 3U50C 1YJNA 1JMCA 1W6JA 4LK1C 1Q86C 5FKAC 2NB0A 3DEOA 2WAQB 1SBBB 2XRQD 1WTVA 4N8FA 1B9MA 4OL7A 5M5WB 1ML0D 3FKIH 4N9TA 4KN4C 2B63H 5FJ8H 2NVTH 1LT4D 3FPUB 3I4NH 1X55A 3U9SA 5FO7B 1Z9FA 5FLXL 5CV7A 2B8GA 4DAPA 4LF7L 5FO8B 4GOPB 1XWEA 3BDCA 3T1YL 4KJOA 4LW1A 4G57A 1WCMG 1LV9A 2B2VC 1HR0Q 3M3YH 3I7FA 3BYYB 3QOJA 1E24A 5BN5A 1X3PA 4HR7B 1I5FA 3TEHB 4OHJA 3GQBA 4MNOA 4GLVB 2I5HA 3TQYA 2X69A 2NVXB 3BU2A 1TWFH 5ISRA 4FO2A 4XYQA 5KIXA 1OXVA 1PFSA 4JBJA 5M5YH 2CCZA 1WI5A 2BDOA 3SK6A 1Q8IA 2CWAA 3L3OC 2HUGA 5IGFA 4JI7Q 3HOVB 4BBSH 4UP8A 4LF6L 5IE8A 2B2TA 4ZUJA 5CYUA 3PSIA 3STBC 2Z9HA 5C4XG 2Z1CA 1K8GA 4GKKL 1SMXA 2D62A 1G8ZD 2KOLA 4C1NK 4NP5A 4GNXA 1KDCA 1LACA 3UDFA 4C56C 3AFQA 3S9WA 5GADC 1QUQB 4LF8L 4X6AH 3NK9A 2F0FA 4Y7NH 5C44H 3GTOB 3DWPA 5EPLA 4A3GB 2HQEA 4P74A 3V2TA 2ICEC 1XNRL 2ZJPA 1XPUA 4POFA 1EUJA 3SK5A 1QVGA 2UXDQ 2WAQG 1IYVA 3TS2A 1WYDA 1VQDA 2PW7A 3RLOA 3E9HA 1CKNB 5IYBH 5C0XI 1HHVA 5I2XA 1WTQA 5GAGC 5KGUA 4BXXH 4B3RL 1WFQA 2FFKB 4G7ZC 1LO5D 3GDEA 2RDFA 4RWSC 5C0XH 5GROA 4QF4A 4QUCA 1ET6A 3K81C 3NSWA 4LUZA 4QIWB 2DY7A 3D4DA 3RZOB 3S2HB 3PO3H 1XMOL 2F4IA 1U4PA 2JEBI 4YY3Q 3UDXA 1E2WA 4IUPA 2NWGA 3KFUA 3HEJA 3ER0A 5C3EH 3PIP3 2A68D 2IT1A 3L2PA 2L5TA 3VDYA 4WJ4A 3PIOA 1U4MA 2WAQE 3H3VH 2NZOA 3MHBA 1F2YA 3FKIB 3EIVA 2B63B 4NMZA
chains in the Genus database with same CATH topology
5CV5A 2Z4HA 3ZYYX 5C4HA 4V0BA 4HCEA 1KTKA 2B2TC 1STEA 3AU7A 1SE4A 5IT9E 1W6KA 3DMUA 1CZWA 4FXDA 1TKWB 3M3YB 2WACA 3K58A 2EOTA 1DOKA 5I4DA 4ID6A 2BOSA 2JXMB 1PTOF 3A8JE 2F0EA 3OWFA 4G4KA 2EPBA 4IURA 3BDLA 3D8GA 1BR9A 1O7LA 3I3CA 1TWFB 5M5YB 2EVBA 5C6AA 2M9VA 3LNNA 4BBSB 3EFXD 3LX0A 5LHY1 4DF7A 3J7YW 3SVMA 1QB5D 1AZPA 2H4OA 2NN6G 1SYEA 2QCPX 2WKDA 4J6HA 1JOQA 4Y7NB 3ERQA 1QWYA 5C44B 2HDMA 3EQLC 4HAEA 4Q0FA 2ENBA 2EYMA 4H13C 4L8JA 3PUYA 1HQMC 4PNYA 1M8AA 5DAUA 1PTOC 4WJWA 4HEDA 2FMMA 4IFDH 2C9OA 3K5OA 3I70A 3T56B 3NTKA 1ENCA 1B44D 1PDQA 3Q24A 1AW7A 4F88A 1I4XA 1XTCD 3TN2A 3PO3B 1K8MA 1FD7D 3JAML 3NTIA 4DXFA 1D6EC 4ODGA 1STHA 2B2YA 2TSSA 4R9WA 3NBIA 5JAVA 2Q8RE 1FNUA 3SR1A 5C3EB 1I4PA 2L1BA 4BWGB 4U673 4E6IA 4KY5A 3SK4A 3IAYA 1AZQA 1BBXC 3FVQA 1DCZA 2CHBD 5CMDA 2F0TA 2NUCA 3J81E 2A69D 1ONLA 4KKTA 1Z7TA 3VR5A 2F0NA 3V96A 4JK1C 1FNWA 3RLFA 1RF2D 1RD9D 2TMPA 2OEOA 4J1MA 5A35A 4O1NA 1L0YB 1HUMA 4N9PA 3ITPA 4KV6A 4UDUC 1I4HA 1Y8OB 4M8AA 4MIUA 4DAVA 5KYLA 3OPOA 1SJED 3HOWB 5IOCA 2K5DA 2XWJB 1ZKOA 1IW7D 5C0XG 2BE5D 4Q5VA 1GUNA 3R93A 1TVXA 1GHKA 1DOLA 4IUUA 3VA7A 1SNCA 2FINB 3D3RA 5K36H 1B1ZA 4RKBA 4XIGS 3GD7A 3TZUA 4ME5A 5CV6A 5KYIA 2ID0A 1ZEQX 2EZVA 5JPNC 1TWCB 3VYSA 4XTCS 1TS5A 1KLUD 3A7AB 4KHVA 2EJFC 1B9NA 4WRDA 3P1HA 2OXPA 1JB3A 1OXSC 2V4DA 3KLSA 1D2BA 1H9RA 1CHPD 1TIID 3NUCA 2NTTA 4RHSA 1HA6A 4A3IB 1BCPC 1KDBA 3WDNA 1A15A 1TS4A 4DNRB 2IJ0A 2QILA 3QOLA 1SJHD 3K57A 1F77A 3R3OA 5F2DA 4LMQD 3NXWA 2WV6D 5I6WA 3URYA 2DNEA 4EQOA 1TR5A 3TP6A 3TP5A 1S5ED 3I72A 3OIQA 3FMCA 4CGYB 3DM1A 1HRJA 1U4LA 4FXGC 4IUQA 2F0VA 2XNAC 3HOUB 4PQXA 1SFOB 3CRLC 1G6ZA 1SAPA 4DK1A 1WD1A 2RVLA 2F0LA 2IWHA 2AWNA 4MN3A 4IFDG 2PO4A 3Q22A 1H9KA 1QCBD 5CBAE 3DUZA 1LLRD 2MHVA 4NKLA 3L7ZC 2PZUA 1CA5A 1LTTD 4OGQC 1NR4A 2L11A 3R2TA 3MTSA 4O42A 2J7ZA 3VR6A 4XT3B 3EVQA 3M4OB 2NTSA 1FNVA 1C48A 4OO1H 3J80L 4DAYA 1PZKD 2ZXRA 3PUWA 1EU4A 4A3MB 1WTOA 1SYDA 3HG9A 5LL6S 1WTXA 1RHPA 2B2VA 3G6JB 3VYUA 2B39A 3NQTA 1SNPA 3BVMA 4FXKC 1SNDA 4HCSA 3KK7A 4NW2A 2KVMA 1BCPD 3R8BA 4CBVA 2YU9B 4U68A 1BOSA 3HOXB 2JA8B 3NQIA 1S5FD 5FK9C 1JICA 3P20A 2WKCA 1SNQA 4XXEA 5D14A 2EE1A 5IODA 4IZ8A 2KA7A 3Q0AA 3C3LA 3FRPB 3X3MA 2NN6I 1TWAB 5EQ0A 4K6LA 2EYJA 4C3IB 3DHQA 2MGSA 3MFYA 5NUCA 2EY2A 3OWEB 3J7AF 2F0SA 1Y1VB 1EU3A 3A8IE 5JEAJ 3O13A 4A3KB 5I6YA 5DM73 2PPBC 3DEPA 2CQAA 2EY6A 5IGCA 4BA1I 2F0KA 1Z6HA 5TSSA 4FF2A 4DXGA 5K36G 1J8IA 1F2LA 3RMHA 1EY0A 2A68C 2RDGA 3SDZA 1SNOA 1SDFA 4FF3A 4RGOS 1OXXK 3GTJB 3CRKC 5CBEE 4C3JB 2QKIC 2XVSA 5AFWA 4DGZA 4HSVA 3NBHA 2H1EA 2K1BA 2NVYB 3OIPA 4KJNA 3T4AC 1UEAB 2JSOA 1LT6D 1Y8PB 2RDHA 2EYPA 1TQOA 2RKSA 1LT3D 3MEHA 5EBCA 4XT1B 3OSOA 4K8JA 1CI3M 2KEEA 4AYBB 1BDOA 4ZKCB 2R92B 4XQQA 5T1IA 1ESFA 1MI2A 1PTOB 3AMUA 2VB3X 4I65A 1KNAA 3PIO3 1KAAA 1V8QA 1I6HB 4TKOB 2AQ1B 4C3IG 3VR4A 4CKEA 2QDBA 3PV0A 1ESRA 3SHLA 4QB4A 2E2HB 1CQFA 2Y0SB 4KMUC 1LTRD 1CQVA 3V05A 2DNCA 1ET9A 1T5XD 1IKLA 1ENAA 2F1MA 2VUMB 3MXNA 5JVH3 2HCCA 2XSCA 2F0DA 3GTPB 5COYA 3IFTA 1HQRD 3HKZB 1Q12A 4H44C 5BN3A 1C8CA 1NSNS 4X3UA 3DWAA 1BF4A 3JAME 4ZKBB 1LTID 1EQVA 4CJ2C 2A6ED 4K8IA 1A6XA 1QNKA 2JA6B 4FF4A 2K05A 4C3JG 1DZ1A 3T16A 1JC7A 4QCLA 3I91A 1EY4A 2VNUD 3A54A 1Y1WB 4IUNA 3H09A 2XIWA 4FP5D 3C46A 1GUWA 2PZTA 3SEBA 3CQZB 4XQJA 2NBFA 3K59A 3TP7A 1H9SA 1SYGA 4OO1G 2R6GA 3QG1A 1ENFA 3MWYW 2F0HA 3BDOA 5JOBA 2EYOA 4CJ0B 5EPKA 1D5XC 2ICIA 2A69C 2SNSA 2PYKA 2XRSD 1HUNA 2A73B 3C1EA 2K04A 4XDXA 3KLRA 1U9RA 1HFNA 3KLSX 2X6GA 4HMIA 3VA5A 4FF1A 1EFID 1F9RA 3A8KE 4H7BA 4ZRZA 1S5CD 4RKLA 1VMPA 3MA2B 5CORA 1SE2A 1DONA 4PMBA 4K14A 3VR2A 1LTAD 1X3QA 4ULLA 4KY6A 4RFBA 4HSPA 4LAAA 5C5LA 2DY8A 3HS0C 5K5PA 3CU7A 2JA5B 1IW7C 2M2LA 1WVLA 2BE5C 4PV1C 4JBWA 2R7ZB 1VDZA 2WB1B 3N52A 3H0GB 1FR3A 1K83B 1ICWA 4RH6A 2K5WA 4IFDI 4DN4M 1CHQD 4EVOA 4IALA 4FVMA 1MD2D 2K7VA 1GOZA 3GTLB 4KN7C 3BVGA 1PMRA 1D1IA 4Z9CB 4DU9A 1NAPA 1EOTA 2G9DA 3QO2A 2K6AA 1TY2A 2FMCA 2NZ1D 2A6HC 1VF5C 2E2DC 3PUXA 3D4WA 1DM0B 3C2PA 1G291 3BVZA 3S1NB 4MHEA 5I9OA 3J7AV 2ZXPA 1HFGA 1H9MA 4CHTB 4A3DB 1RDPD 3S17B 5KEEA 2BA0A 1XX8A 3NWTA 1PRTB 3ND9A 1XXGA 1F9QA 1LTBD 5CC4A 4S3SA 1EL0A 1MGSA 3S15B 1KNEA 3M7GA 2K33A 4F87A 3Q6SA 1I3QB 3VR3A 1O7YA 4CJ1B 4IUVA 3WOFA 4F8MA 3NPPA 4YIJA 1EEFD 1PFNA 2M00A 1S5DD 3GV3A 5J22A 3T53B 2VXWA 3E0JA 1FYCA 3BYTB 1EY8A 3GTGB 1J9OA 1TY0A 2R93B 2JYOA 3F2UA 1BCPF 1JWUD 5M5XB 1GUTA 5DNFA 3J80E 1S4ZA 1B53A 2O5IC 2O5JC 1JWMD 1SEBD 3KBXA 1RTOA 3P75A 2IPKD 1U4RA 2EXZA 1F9SA 1V1PA 1UNSA 2I07B 3FPPA 3D6WA 1A2TA 2F0WA 1SMYD 1B3AA 2A6HD 3S1MB 1O80A 4RAUC 3TMEA 2F0UA 3HRZC 3L9AX 1B50A 5E1FA 2KJXA 1UUPA 5C3XA 4EQNA 4GZYC 2AQ2B 1HTLD 3MC0B 2F0JA 3EA6A 3A7LA 1JOKA 4ZAIA 4RGMA 4CKCA 2O2LD 2WP8J 1A3VA 5M3MB 2KEDA 2K5QA 2NVQB 1I4QA 5CGKA 4P2CB 5IIFA 1CZGA 1G2TA 1ZYRD 1O78A 4B9XA 3IKJA 3M85A 3K5MA 3Q23A 1ILPA 2O4XA 5KNCA 3PUZA 3R2IA 5KNDA 5FLXE 2LS01 4C1NI 4KY7A 2J0TD 1TT2A 4A3JB 2A74C 3BG3A 1SYBA 1D5MC 2F0IA 2IL8A 4QUFA 3J81L 2F0PA 1HPCA 2WIIB 1S5BD 3BZDB 3I90A 3GP7A 1ILQA 1O7ZA 3SE0A 4K5VA 3E5SA 3MXPA 1IKMA 4J8QA 2D2CC 1EYDA 1LABA 2L4NA 2PW5A 4OO1I 1EY5A 5CV9A 1IYUA 5ELFA 1GJXA 1JE4A 1PTOH 5EGTA 1Y8NB 4HTHA 1SYFA 3KBGA 2B2UC 2IX0A 4L6TB 1I50B 1Q1EA 3MVVA 2KCNA 2SDFA 4BBRB 5C4ZA 2EY1A 4ZUIA 1A2UA 1GXDC 3W2DA 2F0MA 3VYRA 5IGEA 5HURA 1EY9A 3S1RB 3GTMB 2KCCA 1WD0A 2MP1A 3OMCA 1EIGA 2QEJC 3I4MB 1CT1D 2F03A 2A6EC 5CR3A 2SEBD 3NTHA 2D5DA 3SXHA 2MUYA 5A2QL 1PFMA 4BY7B 1JOOA 1RODA 2R3ZA 3MXUA 4RGTA 1H9JA 1QNUA 5EPJA 1VF7A 3D31A 3CKIB 5E3FA 3I8ZA 1MSGA 1Q3LA 3K7AB 2N88A 4FNFA 3K0YA 1LTGD 4ZYSA 5FO9B 1QE6A 5JEAH 5I2YA 4KTAA 4L63B 3S1QB 1PRTD 2RQXA 3K6OA 3I73A 1X32A 1STNA 4PMWA 2JA7B 4IN3A 4HMJA 4RCNA 2EYHA 3WOEA 5EKIA 1EQTA 4G7OC 1HXYD 2PZWA 2CW0D 1JWSD 4A93B 2C5CA 4ZLTF 3UI2A 1WTRA 2E2IB 3D6CA 1HA5A 1CK1A 3DWQA 3HOYB 4OIJA 1YNND 1DYQA 1H9SB 1NUCA 4LJZC 3DXJC 1CM9A 4F7XA 3P7JA 2LKVA 5D3DA 2IW3A 2MPMA 4M1UB 2WINB 1JORA 2JEAI 2JE6I 1E2ZA 2B2WC 5C5MA 2EJMA 1T5EA 4DNTB 3RZDB 4X3KA 2BDNA 3OMGA 2KECA 1SE3A 2Z4IA 5C0XJ 4K2LA 1IHZA 3EROA 1GUGA 1B2TA 5JJZA 4C3HB 4UAIA 5EKKA 1DOMA 1TU2B 2CVRA 3FDTA 3K5NA 1PFBA 3QIAA 4FYDA 3NE5B 2AQ3B 1GUOA 2L55A 4IUTA 5G3LD 3EJIA 3GO5A 1G91A 1A3UA 4B08A 1L0XB 4X3SA 4K2KA 1WTWA 2RSOA 4C2MB 1EIHA 2IX3A 5HGTA 5DM63 2NVTB 3OOCA 3MAQA 3I4NB 2E2JB 1CFMA 2L9HA 3TZDA 2J4XA 3QWNA 1BO0A 4QMGA 2KQ3A 1STGA 1SNMA 4OIKA 2K32A 2E75C 4ABNA 1JR0D 5EJWA 1AN8A 5M3FB 1WTPA 2K03A 1A3TA 2PCFB 1SXTA 2EDGA 1KABA 1PYWD 3T13A 2AUKA 4C3HG 4HN7A 5CV4A 1CTMA 3G7LA 4I7ZC 3AB9A 2A5HA 1AFPA 5C3WA 1BNZA 1HCZA 1BCPB 3FEWX 1OXUA 1RCVD 2RA4A 3N6RA 4WORA 4DA2A 4IFDJ 3A55A 1EYAA 5D65A 4G7HC 3OHXC 1M4VA 2E76C 5D3IB 5JEAG 4A3BB 4BY1B 3S2DB 3K5LA 5EKLA 3GTQB 1SMYC 2OT2A 3PO2B 2MJ8A 4R8NA 1Q90A 1DJRD 2FHTA 4KHZA 2I46A 4TSSA 2EJGC 1VMCA 1GHJA 2SNMA 3C1FA 4IQZA 1R4QB 1NR2A 1DXMA 2EYLA 2L12A 4KKSA 3NHHA 3KF8A 3HOZB 1B4OA 1BXTA 4KKUA 4X3TA 3PUVA 1V1PB 2OF1A 2F3WA 2NYZD 1ZYRC 1BUVT 4K5WA 1OO9B 3TDQA 2DN8A 5J1ZA 3GTKB 5IGDA 1I6VC 3LWEA 5LL6X 1C4QA 4EGVA 3W3AA 1R4PB 3NP8A 5ELCA 1EY6A 1F9PA 5C4JB 1LTSD 5KNBA 3SK8A 1YNJC 1IL8A 1STYA 1I4RA 2Q8TA 2B8FA 4ILWA 2VB2X 1Y69U 5T1GA 5IT9L 4B9WA 1STBA 3M7NA 3I4LA 2R61A 2IX1A 3S14B 5BN4A 5E4WC 2L0CA 1Z47A 1JCKB 1EZ8A 5ELEA 4TRDA 5I9PA 1V1OA 1E0BA 1DD2A 3S16B 2F0OA 3PMFA 1AP0A 2JP1A 3ONAB 1VCIA 4ZQ3A 2Q8IB 2QF7A 1K8OA 1HTPA 1MSHA 4A3FB 1ZXTA 4R8IA 2F0GA 3QB3A 1CA6A 2PQEA 2LY7A 1KLGD 4CKBA 4PMCA 2ZT9C 2B2YC 4K5XA 4WFN3 3HZXA 1PTOD 3T51B 1V43A 2D9UA 3MZ5A 4KI0A 1NCVA 3TP8A 2HCIA 1AEXA 2K01A 3M4YA 2EY5A 2EYFA 3U9OA 1JQYD 1PZJD 2PNRC 1SSOA 5E4XA 2PMZB 2B2UA 1RKNA 3H91A 2AWOA 2LFNA 3BS1A 5A2QE 3A56A 1Q1BA 5J39A 4K6DA 2F0QA 2KUMA 3KUPA 4KK7A 4A3EB 1PRTF 3RD4A 4TQUS 1XYIA 4KD3A 2E74C 2FJ2A 4RCOA 3X3NA 2ZXOA 5IGGA 1PXUA 2XWBB 1F2ZA 4RA8A 2X6LA 1YNJD 1GUSA 1QG7A 5KRUA 1SYCA 1RJTA 3E6ZX 3MXGA 1LT5D 3H94A 1QOHA 3IL8A 4XYOA 3IFDA 2XN9C 2BCOA 4BA2I 2F3VA 2KHSA 3HGBA 2SOBA 3H3VC 3LWUA 3QJYA 2K28A 3ND8A 1PRTC 5JVG3 1EYCA 1TWGB 5JPMC 5ELDA 3CHBD 3RUZA 1EWHA 4NDXA 2CW0C 5IGBA 1F2MA 4EQPA 3HP3A 1QILA 1PLFA 5CV8A 1RTNA 1YNNC 4ZK9B 2YYZA 2HDLA 3D4RA 1MBYA 4BS9A 2RBMA 4KD4A 1PZID 1D1KA 1EWCA 1II3A 1D5ZC 2BA1A 1R9TB 1TWHB 1WCMB 3MFGA 4H0LC 2RSNA 2G9HD 3OW7A 5DEHA 5ELBA 5G3LF 1KDAA 1BQQT 5FOBB 1TS2A 3GV6A 1EEID 1I4GA 1QJOA 4RGNA 2GA4B 1FGBD 1G2SA 3TBIB 2Z8LA 5M9OA 4XQNA 1E2VA 3VYTA 1TS3A 4DK0A 5C4XB 2B2WA 4RHRA 2N55A 1STAA 5EBDA 2NN6H 4V190 3H6MA 1UAPA 3TSSA 1OXTA 2LMCB 3NWSA 1EY7A 1EZ6A 4DFAA 2AUJD 1W6JA 4LK1C 5FKAC 2NB0A 3DEOA 2WAQB 1SBBB 2XRQD 1WTVA 1B9MA 4OL7A 5M5WB 1ML0D 4N9TA 4KN4C 1LT4D 3FPUB 3U9SA 5FO7B 5FLXL 5CV7A 2B8GA 4DAPA 5FO8B 1XWEA 3BDCA 4KJOA 4G57A 1LV9A 2B2VC 3BYYB 3QOJA 5BN5A 1X3PA 4HR7B 4OHJA 3GQBA 2X69A 2NVXB 5ISRA 4FO2A 4XYQA 5KIXA 1OXVA 2BDOA 3SK6A 1Q8IA 3L3OC 2HUGA 5IGFA 3HOVB 2B2TA 4ZUJA 5CYUA 2Z1CA 2D62A 1G8ZD 2KOLA 4C1NK 4NP5A 1KDCA 1LACA 4C56C 3S9WA 3NK9A 2F0FA 3GTOB 3DWPA 5EPLA 4A3GB 2HQEA 3V2TA 2ICEC 3SK5A 1IYVA 2PW7A 5C0XI 1HHVA 5I2XA 1WTQA 5KGUA 2FFKB 4G7ZC 1LO5D 4RWSC 2RDFA 5C0XH 4QF4A 4QUCA 1ET6A 3RZOB 3NSWA 4QIWB 3S2HB 2DY7A 3D4DA 2F4IA 1U4PA 2JEBI 1E2WA 4IUPA 2NWGA 3HEJA 3PIP3 2A68D 2IT1A 2L5TA 1U4MA 3MHBA 1F2YA 3FKIB 2B63B 4NMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY8 A;  3QOJ A;  5CV5 A;  4ODG A;  1STH A;  3NP8 A;  4KY7 A;  4NKL A;  1TT2 A;  4K6D A;  5CR3 A;  1SNO A;  2F0Q A;  5C4H A;  5J39 A;  2PZU A;  2RBM A;  4KD4 A;  1JOR A;  4KHV A;  1EY4 A;  1EY6 A;  5JAV A;  1SYB A;  4EVO A;  1A3T A;  4IAL A;  5C5M A;  3SK8 A;  3SXH A;  1II3 A;  1KAB A;  4IUN A;  4KD3 A;  4WRD A;  1STY A;  3SR1 A;  2F0I A;  3P1H A;  2OXP A;  3T13 A;  1JOO A;  2F0P A;  3OMG A;  3DMU A;  5ISR A;  5CV4 A;  4KY5 A;  3SK4 A;  4DGZ A;  4E6I A;  5IGG A;  5KIX A;  5DEH A;  2PZT A;  3SK6 A;  4K2L A;  1KDA A;  5IGF A;  1F2Z A;  1IHZ A;  3EVQ A;  4KJN A;  3ERO A;  5E3F A;  2WAC A;  4DU9 A;  5C3W A;  4ZUJ A;  3P75 A;  2F0T A;  4K5V A;  4B9W A;  3E5S A;  2EYP A;  3NUC A;  3MXP A;  1STB A;  4ID6 A;  5KRU A;  2NUC A;  2EXZ A;  1SYC A;  1EYD A;  1TQO A;  2RKS A;  3TP7 A;  1SYG A;  2F0E A;  3OWF A;  3MEH A;  1EZ8 A;  1SYD A;  1KDB A;  4WOR A;  3BDL A;  2F0H A;  3D8G A;  4TRD A;  4NP5 A;  5I9P A;  2F0N A;  3OSO A;  4K8J A;  5EKK A;  3D4W A;  1EYA A;  2PW5 A;  1KDC A;  5JOB A;  2EYO A;  3QOL A;  1A2T A;  2F0W A;  3NQT A;  1SNP A;  3S9W A;  3R3O A;  5C6A A;  2F0O A;  2SNS A;  5I9O A;  5M9O A;  4KTA A;  1SND A;  5F2D A;  2PYK A;  3PMF A;  2F3V A;  2KHS A;  1EY5 A;  2F0F A;  3NK9 A;  2OEO A;  3C1E A;  3NXW A;  2HQE A;  1STA A;  5CV9 A;  3V2T A;  3LX0 A;  4ZQ3 A;  2SOB A;  5I6W A;  1U9R A;  3TME A;  5KEE A;  5EKL A;  4J1M A;  4DF7 A;  1STN A;  2F0U A;  4EQO A;  1TR5 A;  5EGT A;  3TP6 A;  3SK5 A;  4N9P A;  3TP5 A;  4I65 A;  4HMJ A;  3ITP A;  1SYF A;  4HTH A;  4HMI A;  5E1F A;  1KAA A;  3H6M A;  5CC4 A;  4S3S A;  5C3X A;  4KV6 A;  4R8N A;  2PW7 A;  3VA5 A;  1SYE A;  2F0G A;  2EYH A;  1SNQ A;  3EJI A;  1EYC A;  3QB3 A;  4EQN A;  1EY7 A;  2PQE A;  1EZ6 A;  4DFA A;  5IOD A;  2QDB A;  4IZ8 A;  1A3U A;  4J6H A;  3SHL A;  4MIU A;  4QB4 A;  5KGU A;  4H7B A;  4PMC A;  5KYL A;  2PZW A;  2F0J A;  3MVV A;  4K5X A;  4RKL A;  1JOQ A;  3HZX A;  1JOK A;  2RDF A;  3ERQ A;  2SNM A;  3C1F A;  4K2K A;  5C4Z A;  5IOC A;  2EY1 A;  2ENB A;  2EYL A;  2EYM A;  4ZUI A;  1A3V A;  4QF4 A;  1A2U A;  2F0V A;  5HGT A;  4PMB A;  4OL7 A;  3MZ5 A;  1ENA A;  3D4D A;  4K14 A;  2EYJ A;  4PNY A;  4N9T A;  3RUZ A;  3DHQ A;  3NHH A;  3D6C A;  5DAU A;  3TP8 A;  5NUC A;  4NDX A;  2EY2 A;  1AEX A;  2F0D A;  4KY6 A;  5IGB A;  1F2M A;  2F0S A;  5CGK A;  2EY5 A;  5IIF A;  4EQP A;  2EYF A;  2F0M A;  4LAA A;  5C5L A;  5CV7 A;  4F8M A;  3U9O A;  5K5P A;  4QMG A;  1NUC A;  3HEJ A;  4B9X A;  2KQ3 A;  5HUR A;  5I6Y A;  4YIJ A;  5IGE A;  1EY9 A;  1NSN S;  1SNC A;  2EY6 A;  2F0L A;  2M00 A;  5IGC A;  5CV8 A;  1STG A;  2OF1 A;  1EQV A;  1SNM A;  2F3W A;  4K8I A;  3BDC A;  4RKB A;  2F0K A;  2O4X A;  1ENC A;  4F7X A;  4KJO A;  5J22 A;  4K5W A;  3OMC A;  2LKV A;  1RKN A;  4ME5 A;  4G57 A;  5CV6 A;  5KYI A;  3MHB A;  1F2Y A;  5J1Z A;  3T16 A;  1EY0 A;  5IGD A;  4NMZ A; 
#chains in the Genus database with same CATH topology
 5CV5 A;  2Z4H A;  3ZYY X;  1P16 A;  5C4H A;  2F4V Q;  3HOV G;  4V0B A;  4HCE A;  1KTK A;  2IY5 B;  1BBU A;  2B2T C;  1STE A;  3AU7 A;  1SE4 A;  5IT9 E;  1W6K A;  3DMU A;  1GVP A;  3M4Q A;  1CZW A;  4FXD A;  1TKW B;  4PZ8 A;  1ASY A;  2WAC A;  3M3Y B;  3K58 A;  2EOT A;  1DOK A;  4RG1 A;  5I4D A;  4ID6 A;  2BOS A;  2JXM B;  1PTO F;  3A8J E;  4A3G G;  2F0E A;  3OWF A;  4G4K A;  2EPB A;  4IUR A;  3BDL A;  4NXM L;  1G6P A;  3D8G A;  1QZH A;  1BR9 A;  1O7L A;  1D7Q A;  1YBY A;  3KF8 B;  5IT9 c;  3I3C A;  4JPB W;  1TWF B;  2JQO A;  5M5Y B;  2EVB A;  1YIJ A;  2DGY A;  5C6A A;  2M9V A;  3LNN A;  4BBS B;  3HOW H;  1EQR A;  3EFX D;  3LX0 A;  3CCR A;  5LHY 1;  4JI6 L;  4DF7 A;  3J7Y W;  3SVM A;  3CCU A;  1VQ6 A;  1VQ4 A;  1QB5 D;  1AZP A;  2H4O A;  3CP0 A;  2NN6 G;  1SYE A;  2QCP X;  1EQQ A;  2WKD A;  1Q46 A;  4J6H A;  4YHH L;  2Y0S E;  2CWP A;  1JOQ A;  4CDF C;  4JVZ A;  2IHF A;  4Y7N B;  3ERQ A;  1QWY A;  5C44 B;  2HDM A;  3EQL C;  4HAE A;  4Q0F A;  2ENB A;  1N32 L;  2EYM A;  4H13 C;  4L8J A;  4DV4 L;  3PUY A;  1HQM C;  4PNY A;  4J15 A;  2OCE A;  1M8A A;  5DAU A;  4DV7 Q;  1PTO C;  1TWC H;  4WJW A;  3FKI G;  4IOC A;  5IWA Q;  2B63 G;  5FJ8 G;  4HED A;  2FMM A;  3I4N G;  1K9M C;  4IFD H;  2C9O A;  1V9P A;  3K5O A;  4JI3 Q;  3I70 A;  3E0E A;  3T56 B;  3NTK A;  1ENC A;  4LF4 L;  1B44 D;  1PDQ A;  3Q24 A;  1AW7 A;  4F88 A;  1I4X A;  1XTC D;  3TN2 A;  3CCJ A;  3PO3 B;  1K8M A;  1FD7 D;  3JAM L;  3NTI A;  3G6E A;  4QIW E;  4DXF A;  3KDF B;  1D6E C;  4ODG A;  1STH A;  2B2Y A;  1FVI A;  2TSS A;  1KIX A;  4R9W A;  4GKJ L;  3NBI A;  5JAV A;  4A3I H;  1X6O A;  5H1S E;  2Q8R E;  1FNU A;  4R4T A;  1PYB A;  5EAY A;  3PF5 A;  3SR1 A;  4DNI A;  5C3E B;  2E5L Q;  1I4P A;  1VQA A;  4MTK A;  2L1B A;  4BWG B;  4U67 3;  4E6I A;  4KY5 A;  3SK4 A;  3IAY A;  1AZQ A;  1XMQ L;  1BBX C;  4JI5 Q;  3FVQ A;  4UPA A;  1DCZ A;  2CHB D;  4OWW B;  5CMD A;  1PH7 A;  4HID A;  2KCM A;  1VQC A;  2F0T A;  2NUC A;  4BBS G;  3J81 E;  2A69 D;  1SN8 A;  1ONL A;  4KKT A;  3JAM i;  2WFW A;  1Z7T A;  4TVA B;  2F0N A;  3VR5 A;  3V96 A;  4JK1 C;  1FNW A;  3RLF A;  1RF2 D;  2RF4 A;  1RD9 D;  1HH2 P;  1N34 Q;  1JJ2 A;  2TMP A;  1Q81 C;  2OEO A;  2RCF A;  4JI8 Q;  4J1M A;  5A35 A;  4O1N A;  1HR0 W;  5C44 G;  1L0Y B;  3J81 c;  1HUM A;  4N9P A;  3HOU H;  3ITP A;  2OQK A;  3TRZ A;  4DV5 Q;  4KV6 A;  4UDU C;  3OTO L;  4L5R C;  1SFO H;  1X3G A;  2N8N A;  1I4H A;  1Y8O B;  4M8A A;  4MIU A;  3MEF A;  4DAV A;  2CH4 W;  5IYB G;  5KYL A;  3OPO A;  4UP7 A;  1SJE D;  3HOW B;  5IOC A;  4BXX G;  4DR3 Q;  1W3S A;  2K5D A;  2UXB L;  2XWJ B;  1ZKO A;  1PH8 A;  4DR2 L;  1IW7 D;  5C0X G;  2BE5 D;  4Q5V A;  3CME A;  1GUN A;  4JI4 Q;  4B3S L;  4X66 Q;  3R93 A;  1TVX A;  2I0Q A;  1W2B A;  3PO3 G;  3OYY A;  1J5E L;  1GHK A;  2FXQ A;  1DOL A;  4IUU A;  3VA7 A;  3BJU A;  1SNC A;  5FLM H;  2FIN B;  3D3R A;  5K36 H;  1B1Z A;  4KHP Q;  2QEX A;  1SRU A;  4RKB A;  4XIG S;  3GD7 A;  3H15 A;  1HNZ L;  4OX9 L;  5C3E G;  3TZU A;  4ME5 A;  5CV6 A;  5KYI A;  2ID0 A;  2LXJ A;  3M4O H;  1ZEQ X;  2EZV A;  3NEM A;  5ELO A;  5JPN C;  1TWC B;  3VYS A;  4XTC S;  1TS5 A;  1KLU D;  3A7A B;  4KHV A;  2EJF C;  1B9N A;  2YTX A;  3KOJ A;  4WRD A;  3P1H A;  2OXP A;  1Q8K A;  1XNQ Q;  1GM5 A;  1JB3 A;  4LFB Q;  3I56 A;  3UDI A;  1OXS C;  4AIM A;  1IBL L;  2V4D A;  3KLS A;  5LMU Q;  1V1Q A;  1C7Y A;  1D2B A;  3ULP A;  1H9R A;  1CHP D;  1Y14 B;  1TII D;  3NUC A;  2NTT A;  4RHS A;  1HA6 A;  2YU9 H;  3HOX H;  2JA8 H;  4A3I B;  3CCS A;  2UXC Q;  4L5Q A;  2NZH A;  3K80 C;  3I4O A;  1BCP C;  1KDB A;  3WDN A;  1A15 A;  1TS4 A;  4DNR B;  2IJ0 A;  2QIL A;  4HIO A;  3QOL A;  1SJH D;  3K57 A;  5IP7 H;  1F77 A;  2RCN A;  3R3O A;  1HNX Q;  5F2D A;  3K0X A;  4LMQ D;  3NXW A;  5LMN Q;  2WV6 D;  5I6W A;  3HOW G;  4WJ3 M;  3URY A;  2DNE A;  4DUZ Q;  2UUB L;  4EQO A;  1TR5 A;  1TWA H;  3TP6 A;  3TP5 A;  4GN5 A;  1S5E D;  4C3I H;  2UUA Q;  3I72 A;  3OIQ A;  1SR3 A;  3FMC A;  4YWM A;  4CGY B;  4JOI C;  1Y1V H;  4IJH A;  3DM1 A;  3A5Z B;  1VQN A;  1U4L A;  1HRJ A;  5GAH C;  1IBK Q;  2HHH Q;  1YHA A;  3EBE A;  3KJP A;  4FXG C;  3A5U A;  4RMF A;  2AKW B;  4IUQ A;  2F0V A;  2XNA C;  1JB7 A;  2K4K A;  2KBN A;  2MO1 A;  3HOU B;  1UWV A;  4PQX A;  1SFO B;  3CRL C;  1G6Z A;  4GLA C;  4KLK A;  1SAP A;  4DK1 A;  1WD1 A;  1KL9 A;  2RVL A;  3GTJ H;  1N33 Q;  2F0L A;  2IWH A;  1RL2 A;  4FDB A;  4C3J H;  1AH9 A;  2AWN A;  4DV0 L;  1QZG A;  4MN3 A;  4IFD G;  2PO4 A;  3Q22 A;  1H9K A;  1QCB D;  1B70 B;  2NVY H;  3AYH B;  1D8L A;  1YI2 A;  4OWX B;  2Z6B A;  5CBA E;  3DUZ A;  1CUK A;  1GO3 E;  1LLR D;  4P71 A;  2MHV A;  1E22 A;  4NKL A;  3L7Z C;  2PZU A;  1CA5 A;  1LTT D;  1IBM Q;  1CKM A;  1YZ6 A;  4NXN Q;  4OGQ C;  1NR4 A;  2L11 A;  3R2T A;  3MTS A;  4O42 A;  4A3I G;  2J7Z A;  4IPC A;  3VR6 A;  2NVX H;  2R92 H;  4XT3 B;  3EVQ A;  3M4O B;  2NTS A;  4DR5 L;  1A63 A;  4YCV A;  1FNV A;  1C48 A;  4OO1 H;  3J80 L;  3RN2 A;  4X64 L;  4DAY A;  1PZK D;  1YVC A;  4UY8 C;  3KF6 A;  2IHE A;  2ZXR A;  3PUW A;  1EU4 A;  4A3M B;  1WTO A;  1SYD A;  4IJL A;  3HG9 A;  3DLL A;  5LL6 S;  1WTX A;  1I6H H;  1RHP A;  2B2V A;  3G6J B;  3VYU A;  2B39 A;  5IY0 A;  3NQT A;  1SNP A;  3BVM A;  4FXK C;  1SND A;  1LYL A;  4HCS A;  3KK7 A;  3W1B A;  1KRS A;  4NW2 A;  2KVM A;  1BCP D;  3R8B A;  4CBV A;  2YU9 B;  1PHJ A;  4U68 A;  1BOS A;  2VUM H;  3HOX B;  2JA8 B;  3NQI A;  1S5F D;  5FK9 C;  1JIC A;  3P20 A;  1MJC A;  2WKC A;  3GTP H;  1X65 A;  1SNQ A;  4XXE A;  3HOU G;  5D14 A;  3J80 i;  1VQE A;  2EE1 A;  4QL5 A;  5IOD A;  4IZ8 A;  2KA7 A;  3Q0A A;  3C3L A;  3FRP B;  2VW9 A;  3X3M A;  2NN6 I;  3M9B A;  4Y52 H;  3U4V A;  2JA6 H;  2PQA A;  4AQY Q;  4DR3 L;  1TWA B;  5EQ0 A;  4K6L A;  2EYJ A;  3FP9 A;  4C3I B;  4LNQ A;  3DHQ A;  3RZO H;  2MGS A;  2K5H A;  3MFY A;  5NUC A;  3TRE A;  2EY2 A;  3OWE B;  3J7A F;  2F0S A;  2K52 A;  1I94 Q;  1Y1V B;  1EU3 A;  3A8I E;  5JEA J;  3O13 A;  4A3K B;  5I6Y A;  5DM7 3;  2PPB C;  1Y1W H;  3DEP A;  2CQA A;  4DV1 L;  2EY6 A;  5IGC A;  4BA1 I;  4GNX B;  3UE1 A;  2F0K A;  1Z6H A;  2KEN A;  5TSS A;  4A3L H;  4GN3 B;  4FF2 A;  5FLM G;  4DXG A;  5K36 G;  1FL0 A;  3CQZ H;  1S72 A;  1F2L A;  3RMH A;  1J8I A;  1EY0 A;  2A68 C;  2RDG A;  3SDZ A;  1SNO A;  1SDF A;  4FF3 A;  1TXY A;  4RGO S;  1OXX K;  3JC6 6;  3CRK C;  3GTJ B;  2ZTD A;  1WTH A;  5CBE E;  4C3J B;  3DM3 A;  2QKI C;  2XVS A;  5AFW A;  4A3M G;  4DGZ A;  3I2Z A;  4HSV A;  3J81 j;  3NBH A;  2H1E A;  1MKH A;  2K1B A;  2NVY B;  3OIP A;  4KJN A;  3T4A C;  1UEA B;  1PA6 A;  2JSO A;  1LT6 D;  1Y8P B;  2RDH A;  3Q8D A;  2EYP A;  4B3T Q;  1TQO A;  2RKS A;  1C9O A;  1LT3 D;  3MEH A;  5EBC A;  4I7A A;  4QQB X;  4XT1 B;  3OSO A;  1N36 Q;  4K8J A;  3T1H L;  1CI3 M;  3HOX G;  2KEE A;  2JA8 G;  4AYB B;  1BDO A;  4ZKC B;  2R92 B;  4XQQ A;  5T1I A;  4JV5 Q;  2I5L X;  1X54 A;  5IYC H;  1ESF A;  1MI2 A;  1HNX L;  5IP7 G;  1PTO B;  2CH4 A;  2F52 A;  2VB3 X;  3AMU A;  4I65 A;  1KNA A;  3PIO 3;  2K5N A;  1KAA A;  4HIM A;  1VQO A;  1V8Q A;  2UUC Q;  1I6H B;  4PZ7 A;  4TKO B;  4L5T A;  2AQ1 B;  4C3I G;  4DR1 Q;  3VR4 A;  4CKE A;  1N9W A;  2QDB A;  3PV0 A;  1ESR A;  3SHL A;  4QB4 A;  2JA5 H;  2E2H B;  1CQF A;  2Y0S B;  4OWT B;  4KMU C;  1LTR D;  1CQV A;  1Y1V G;  3FHW A;  1IBK L;  1AE2 A;  3V05 A;  2R7Z H;  5GQO A;  2DNC A;  1ET9 A;  4QY7 A;  3I55 A;  1T5X D;  2K14 A;  1IKL A;  3F2B A;  1ENA A;  2F1M A;  2VUM B;  4OEL B;  3MXN A;  5JVH 3;  2HCC A;  1PH1 A;  4DR6 Q;  1K83 H;  2XSC A;  1LUZ A;  1ICF B;  2F0D A;  3GTP B;  5COY A;  3IFT A;  1HQR D;  5AJ3 Q;  3HKZ B;  3CC4 A;  1Q12 A;  4H44 C;  5BN3 A;  4X65 Q;  1C8C A;  1NSN S;  4X3U A;  3DWA A;  1BF4 A;  3JAM E;  2ES2 A;  4ZKB B;  3RN5 A;  3GTL H;  4A3C H;  1LTI D;  1CSP A;  1EQV A;  4CJ2 C;  2A6E D;  4K8I A;  1A6X A;  4HIK A;  1QNK A;  2JA6 B;  4GS3 A;  3CXC A;  4FF4 A;  2K05 A;  4C3J G;  4EX5 A;  1DZ1 A;  3T16 A;  5LMN W;  5HY6 A;  1L0W A;  4DV2 L;  4JI2 Q;  1JC7 A;  1SLJ A;  4QCL A;  3I91 A;  2Q2U A;  1EY4 A;  1HNW Q;  2VNU D;  3A54 A;  1Y1W B;  3AQQ A;  4IUN A;  3H09 A;  3H3V I;  2XIW A;  3S1N H;  4FP5 D;  1FGU A;  3C46 A;  2PZT A;  3NEL A;  1GUW A;  1K0S A;  3SEB A;  3CQZ B;  4YWL A;  4AYB G;  1X9N A;  4XQJ A;  2R92 G;  1E3P A;  2NBF A;  4A3D H;  2VQE L;  3S17 H;  2PI2 A;  4IOA A;  1JT8 A;  5JJK A;  3K59 A;  1LM0 A;  3TP7 A;  1H9S A;  1SYG A;  4H02 A;  4OO1 G;  2YTY A;  1M90 C;  2R6G A;  3QG1 A;  1ENF A;  3MWY W;  2F0H A;  4ALP A;  4PZ6 A;  3BDO A;  5JOB A;  3S15 H;  2OQ0 A;  4LWC A;  2EYO A;  4CJ0 B;  5EPK A;  1D5X C;  2ICI A;  1KD1 C;  3NEN A;  1G51 A;  2A69 C;  2SNS A;  4IO9 A;  2PYK A;  5GAE C;  2XRS D;  2OTJ A;  1HUN A;  2A73 B;  3C1E A;  2K04 A;  4XDX A;  2Y0S G;  3KLR A;  1I3Q H;  1U9R A;  1VQ7 A;  1HFN A;  2CQO A;  1VQJ A;  3KLS X;  2X6G A;  4HMI A;  1K8A C;  3VA5 A;  4FF1 A;  2VUM G;  1EFI D;  1F9R A;  3SGI A;  4AYB E;  3A8K E;  4H7B A;  1VQ8 A;  4ZRZ A;  1S5C D;  2GVA A;  4RKL A;  1VMP A;  3HKZ G;  2RHQ B;  3MA2 B;  2AMC B;  5COR A;  1SE2 A;  1DON A;  3PF4 A;  4PMB A;  1KAW A;  2I5M X;  4K14 A;  3VR2 A;  1LTA D;  4X62 L;  2ZM6 Q;  3GTG H;  1X3Q A;  2JA6 G;  4ULL A;  4KY6 A;  4JYA Q;  4RFB A;  3CAM A;  2R93 H;  4HSP A;  4LAA A;  5C5L A;  3PGZ A;  2DY8 A;  3HS0 C;  5K5P A;  3CU7 A;  2JA5 B;  1IW7 C;  2M2L A;  1VQL A;  1WVL A;  2BE5 C;  4PV1 C;  5BR8 Q;  4JBW A;  4LFA Q;  2R7Z B;  1VDZ A;  2WB1 B;  1Y1W G;  2K5V A;  3N52 A;  3H0G B;  1FR3 A;  1HZ9 A;  4A3L G;  1K83 B;  1ICW A;  2N49 A;  4RH6 A;  4CDC C;  2K5W A;  4IFD I;  4DN4 M;  1WJJ A;  1CHQ D;  4EVO A;  4IAL A;  4FVM A;  1MD2 D;  3HKZ E;  2K7V A;  1GOZ A;  4JBK A;  3GTL B;  4KN7 C;  2QGQ A;  3BVG A;  1PMR A;  1D1I A;  3CW2 C;  4Z9C B;  4JBM A;  2YTV A;  3CCL A;  1NMF A;  4P75 A;  4DU9 A;  1NAP A;  3S1M H;  4ME3 A;  1EOT A;  2G9D A;  2GVB A;  3QO2 A;  2K6A A;  4JW0 A;  4LFC Q;  1TY2 A;  1U5K A;  2FMC A;  2Q2T A;  1HR0 L;  2NZ1 D;  2A6H C;  1VF5 C;  2E2D C;  3PUX A;  4QJF A;  3D4W A;  1DM0 B;  3ERS X;  3C2P A;  3K7U C;  1G29 1;  3BVZ A;  1VQ9 A;  3S1N B;  4MHE A;  5I9O A;  1E7Z A;  3J7A V;  2ZXP A;  1BKB A;  1HFG A;  1H9M A;  4CHT B;  4A3D B;  1A8V A;  1RDP D;  3S17 B;  5KEE A;  2BA0 A;  1XX8 A;  3F1Z A;  4JI7 L;  3NWT A;  5IYC G;  2CKZ B;  1PRT B;  3ND9 A;  1XXG A;  5IP9 H;  2NVQ H;  1F9Q A;  1LTB D;  5CC4 A;  4S3S A;  1PYS B;  1EL0 A;  3B6Y A;  1MGS A;  1U0L A;  3S15 B;  1A0I A;  1XPR A;  1KNE A;  3M7G A;  2K33 A;  4F87 A;  1XJV A;  3Q6S A;  1T9H A;  1K73 C;  2JA5 G;  2EIF A;  2KHI A;  5L37 A;  1I3Q B;  1NE3 A;  3VR3 A;  1O7Y A;  1AE3 A;  1PH6 A;  2R7Z G;  4CJ1 B;  2WB1 G;  4IUV A;  4DR4 Q;  4DUY Q;  3WOF A;  2JJQ A;  3EN2 A;  4A3J H;  4R1J A;  1NTG A;  2UXD L;  5JJI A;  4F8M A;  4JCV E;  3NPP A;  5AJ3 L;  4YIJ A;  1EEF D;  1PFN A;  2M00 A;  1EIF A;  4X65 L;  2A8V A;  1S5D D;  1O7I A;  3GV3 A;  5J22 A;  3T53 B;  4JOI A;  1NMG A;  4A3C G;  2VXW A;  3E0J A;  1FYC A;  3BYT B;  1EY8 A;  3GTG B;  1J9O A;  5IYD H;  1K28 A;  3WWV A;  2ALY B;  4LF9 Q;  1A62 A;  1TY0 A;  2R93 B;  1EYG A;  2JYO A;  2A1A A;  4YY3 L;  3F2U A;  1BCP F;  1JWU D;  5M5X B;  1GUT A;  1X56 A;  5DNF A;  3J80 E;  1S4Z A;  1B53 A;  2O5I C;  3G48 A;  2WB1 E;  2O5J C;  1JWM D;  4IPD A;  1SEB D;  3KBX A;  3RR5 A;  4DR7 Q;  1RTO A;  3P75 A;  2BH2 A;  2IPK D;  1YEZ A;  1U4R A;  4IPH A;  2EXZ A;  2ATW A;  4A3D G;  1F9S A;  2PNH A;  4K0K Q;  2HIV A;  1V1P A;  2F4V L;  4A3M H;  1UNS A;  2I07 B;  3FPP A;  3D6W A;  2JK8 A;  2K50 A;  1I50 H;  1A2T A;  2F0W A;  1SMY D;  1B3A A;  2A6H D;  4BBR H;  3S1M B;  1O80 A;  4RAU C;  3TME A;  2F0U A;  3HRZ C;  3L9A X;  1B50 A;  1PH4 A;  5E1F A;  4LF7 Q;  2KJX A;  2A19 A;  1UUP A;  5C3X A;  2KHJ A;  4EQN A;  2UU9 Q;  4GZY C;  1CKO A;  2AQ2 B;  1OTC A;  2H5X A;  1HTL D;  2VY3 A;  1KHI A;  3MC0 B;  2F0J A;  3EA6 A;  3A7L A;  1JOK A;  4ZAI A;  3S1R H;  4RGM A;  4CKC A;  3GTM H;  2O2L D;  2WP8 J;  1A3V A;  5M3M B;  3E9I A;  3S24 A;  2KED A;  3I4M H;  2K5Q A;  1RIP A;  2ZTC A;  3UDG A;  2NVQ B;  4HJ7 A;  4DAM A;  1I4Q A;  5CGK A;  4P2C B;  5IIF A;  1B7Y B;  1CZG A;  2VQF Q;  1G2T A;  1ZYR D;  4DAY B;  3PQI A;  1O78 A;  3KF6 B;  4B9X A;  3IKJ A;  3U58 A;  3M85 A;  3K5M A;  3Q23 A;  1HZC A;  4A3K H;  2R93 G;  4BY7 H;  1ILP A;  4LF6 Q;  2O4X A;  5KNC A;  1X3F A;  3QR8 A;  1ASZ A;  1Q7Y C;  3PUZ A;  4LUV A;  3R2I A;  5KND A;  5FLX E;  2LS0 1;  4GKK Q;  2Q2H A;  4C1N I;  4OXP A;  1PH2 A;  4KY7 A;  2J0T D;  1TT2 A;  4A3J B;  2A74 C;  3BG3 A;  2Q2I A;  1SYB A;  4DV7 L;  1D5M C;  1QVC A;  2F0I A;  2IL8 A;  4QUF A;  1Q82 C;  3J81 L;  2F0P A;  5IWA L;  1EOV A;  1HPC A;  2WII B;  1XNR Q;  2JN4 A;  1S5B D;  3BZD B;  3I90 A;  3GP7 A;  4JI3 L;  5FLX c;  1ILQ A;  1O7Z A;  1YNX A;  1JE5 A;  3SE0 A;  3S1Q H;  4K5V A;  3E5S A;  3MXP A;  1IKM A;  4J8Q A;  2D2C C;  2ZJR A;  1EYD A;  2JA7 H;  1LAB A;  2PQA B;  4B3R Q;  3LGJ A;  3U4Z A;  2L4N A;  1SRO A;  2PW5 A;  1K0R A;  3KLW A;  4OO1 I;  2E5L L;  1EY5 A;  1XMO Q;  4JI5 L;  4GN4 B;  5CV9 A;  1IYU A;  3J81 i;  5ELF A;  4A93 H;  2MFI A;  1GJX A;  1JE4 A;  1PTO H;  5EGT A;  3M4P A;  1Y8N B;  4HTH A;  1SYF A;  2E2I H;  3KBG A;  2B2U C;  2IX0 A;  4NB3 A;  3HOY H;  5IP9 G;  4LUO A;  4L6T B;  2Z6K A;  1YHB A;  1I50 B;  1Q1E A;  3MVV A;  2E2H H;  2KCN A;  2SDF A;  4BBR B;  5C4Z A;  2EY1 A;  2Z0S A;  4ZUI A;  1A2U A;  1GXD C;  4P73 A;  1N34 L;  4POG A;  3NBH B;  3W2D A;  4JI8 L;  4UHV A;  2F0M A;  3VYR A;  3CCM A;  3CC7 A;  4DV5 L;  3E3X A;  5IGE A;  5HUR A;  1C0A A;  1EY9 A;  4A3J G;  1L1O A;  3RZD H;  3S1R B;  3GTM B;  2P5Z X;  3G71 A;  2KCC A;  1WD0 A;  2MP1 A;  2PMZ E;  3OMC A;  1EIG A;  2QEJ C;  3I4M B;  1CT1 D;  4DK6 C;  2F03 A;  4NXM Q;  4ZCK A;  2A6E C;  1XPO A;  5CR3 A;  4DV3 Q;  2SEB D;  3NTH A;  2K75 A;  4C3H H;  2D5D A;  5IYD G;  3SXH A;  2MUY A;  1S40 A;  4JI4 L;  5A2Q L;  1PFM A;  4BY7 B;  5DLQ E;  4X66 L;  1JOO A;  1ROD A;  2HD3 A;  2R3Z A;  3MXU A;  4RGT A;  1H9J A;  1QNU A;  2AHO B;  5EPJ A;  4JI6 Q;  1VF7 A;  3D31 A;  3CKI B;  3UE0 A;  5E3F A;  4KHP L;  3I8Z A;  4R4O A;  1MSG A;  1Q3L A;  3K7A B;  4O0A A;  3CCE A;  2N88 A;  4FNF A;  3K0Y A;  4N8X 1;  1LTG D;  4YHH Q;  4ZYS A;  3MXN B;  4A75 A;  3D0F A;  5FO9 B;  2QDL A;  5ELN A;  1QE6 A;  5HGQ A;  5JEA H;  3J7A 5;  5I2Y A;  1N32 Q;  2R7D A;  4DV4 Q;  4KTA A;  1PH5 A;  1XNQ L;  1KXL A;  4L63 B;  3S1Q B;  1PRT D;  2RQX A;  4LFB L;  3K6O A;  2DUD A;  4C2M H;  2N3S A;  2Z6K C;  3I73 A;  1X32 A;  1STN A;  4PMW A;  5LMU L;  2JA7 B;  4IN3 A;  4BBR G;  4HMJ A;  2E2J H;  3CF5 A;  1NJI C;  4RCN A;  2EYH A;  3WOE A;  5EKI A;  1EQT A;  2UXC L;  2RHS B;  4LF4 Q;  4G7O C;  1HXY D;  2UU9 L;  2PZW A;  1VQH A;  4CDE C;  2CW0 D;  1JWS D;  4A93 B;  2C5C A;  2D0P A;  4ZLT F;  3CC2 A;  3UI2 A;  1WTR A;  4GKJ Q;  3L0O A;  2E2I B;  3D6C A;  1L1O C;  5LMN L;  1HA5 A;  1CK1 A;  3DWQ A;  3HOY B;  4OIJ A;  3I4M G;  1YNN D;  4DUZ L;  5M3F H;  2UUA L;  1DYQ A;  1H9S B;  1NUC A;  1XMQ Q;  2VQF L;  4LJZ C;  3DXJ C;  4YCU A;  5E7N A;  1CM9 A;  4F7X A;  3P7J A;  2HHH L;  4A3K G;  2LKV A;  5D3D A;  4BY7 G;  1UE7 A;  3HKS A;  2IW3 A;  2MPM A;  1IXR A;  3H0G H;  4M1U B;  2WIN B;  2BH8 A;  1JOR A;  2JEA I;  4DV6 Q;  2JE6 I;  1E2Z A;  2B2W C;  2XTI A;  1LTL A;  2EJM A;  5C5M A;  2ASB A;  1T5E A;  4DNT B;  3RZD B;  4X3K A;  2BDN A;  3OMG A;  3A74 A;  2KEC A;  1X3E A;  1SE3 A;  2Z4I A;  5C0X J;  2VL6 A;  4L5S A;  4K2L A;  1N33 L;  1IHZ A;  4A3B H;  1BBW A;  3ERO A;  4BY1 H;  3S2D H;  1GUG A;  1B2T A;  1KC8 C;  5JJZ A;  3OTO Q;  3GTQ H;  4C3H B;  3PO2 H;  5JJL A;  4UAI A;  2CFM A;  4GOP A;  5EKK A;  2JA7 G;  2OTL A;  3JAM c;  1DOM A;  1IBM L;  1TU2 B;  2CVR A;  3FDT A;  4CDD C;  1PFB A;  4DPG A;  3K5N A;  2UXB Q;  4NXN L;  4O2D A;  4DR2 Q;  3QIA A;  4FYD A;  2VS1 A;  2MO0 A;  3NE5 B;  2AQ3 B;  1GUO A;  1CSQ A;  4IPG A;  2L55 A;  1VQG A;  4B3S Q;  2V1C C;  4YWK A;  4IUT A;  1YJW A;  1J5E Q;  4A93 G;  1VQF A;  5G3L D;  3ULJ A;  4APV A;  3EJI A;  1IL2 A;  1VQ5 A;  3GO5 A;  1G91 A;  3HOZ H;  1A3U A;  2HQL A;  4B08 A;  1HNZ Q;  4OX9 Q;  3HOY G;  1L0X B;  4X3S A;  1HZA A;  4K2K A;  1WTW A;  2RSO A;  4C2M B;  1EIH A;  2IX3 A;  5HGT A;  5DM6 3;  2NVT B;  1UE1 A;  3OOC A;  3MAQ A;  3GTK H;  3I4N B;  2E2J B;  1CFM A;  4NPS A;  2L9H A;  3TZD A;  4HJ9 A;  2J4X A;  3QWN A;  1QUQ A;  5C4J H;  1BO0 A;  4QMG A;  2KQ3 A;  1IBL Q;  1QVF A;  1STG A;  1SNM A;  4OIK A;  1FJG Q;  2K32 A;  3A0J A;  4GNX C;  2E75 C;  4ABN A;  3RNU A;  3ICE A;  1CKN A;  1JR0 D;  2XGT A;  5EJW A;  4AQY L;  1AN8 A;  1K3B C;  3S14 H;  5M3F B;  1WTP A;  2K03 A;  4AH6 A;  2PCF B;  1A3T A;  1SXT A;  4DV3 L;  2EDG A;  2LSS A;  1KAB A;  2PI2 E;  1I94 L;  1MHW C;  4P72 A;  1PYW D;  3T13 A;  2AUK A;  4C3H G;  5M5X H;  3S16 H;  1SE8 A;  4HN7 A;  3STB D;  5CV4 A;  1CTM A;  1PH3 A;  2QA4 A;  3G7L A;  4I7Z C;  2UUB Q;  3AB9 A;  2A5H A;  3W5O A;  4MZ9 A;  1AFP A;  5C3W A;  4GOP C;  3CMA A;  1PV4 A;  1BNZ A;  1HCZ A;  3W1G A;  1BCP B;  1L2F A;  3FEW X;  1MJE A;  1OXU A;  1RCV D;  2RA4 A;  4A3F H;  1VQK A;  3N6R A;  3PIP A;  4WOR A;  4DA2 A;  4IFD J;  3A55 A;  1NNX A;  1JJC B;  1EYA A;  5D65 A;  4G7H C;  1HJP A;  3OHX C;  1M4V A;  2E76 C;  3K8A A;  5D3I B;  5JEA G;  4A3B B;  1GKH A;  4BY1 B;  3S2D B;  3K5L A;  5EKL A;  3GTQ B;  1SMY C;  2OT2 A;  3ZJY C;  3PO2 B;  2B29 A;  2MJ8 A;  4R8N A;  1Q90 A;  1DJR D;  4B3T L;  3F2C A;  4A4I A;  2FHT A;  4DK3 C;  4DV0 Q;  4KHZ A;  2I46 A;  2QW7 A;  3F8T A;  3CD6 A;  1S3O A;  4TSS A;  2EJG C;  4OON A;  1VMC A;  1N36 L;  1GHJ A;  1JJG A;  2SNM A;  3C1F A;  4IQZ A;  2F3I A;  4LF5 Q;  1R4Q B;  1NR2 A;  1DXM A;  2EYL A;  4JV5 L;  2L12 A;  4KKS A;  3NHH A;  5M3M H;  3KF8 A;  4HJ5 A;  1GD7 A;  3HOZ B;  2ZTE A;  4A3E H;  1B4O A;  1BXT A;  4KKU A;  2B3G A;  2UUC L;  1HZB A;  1UE6 A;  4JI1 Q;  4X3T A;  3PUV A;  5M3F G;  1V1P B;  2OF1 A;  4DR1 L;  4DR5 Q;  2F3W A;  4B3M Q;  2NYZ D;  1M1K C;  1ZYR C;  1BUV T;  4K5W A;  4EQ5 A;  1OO9 B;  4X64 Q;  1XTD A;  3CCQ A;  3TDQ A;  2DN8 A;  5J1Z A;  3GTK B;  1I6V C;  5IGD A;  3LWE A;  1J6Q A;  5LL6 X;  1C4Q A;  4EGV A;  3W3A A;  1R4P B;  3NP8 A;  4OEM B;  5ELC A;  1EY6 A;  1F9P A;  4JI0 Q;  5C4J B;  3H0G G;  4DR6 L;  1LTS D;  2VZA A;  5KNB A;  4R4I A;  3SK8 A;  1YNJ C;  1IL8 A;  4QGU A;  1EFW A;  1STY A;  4DV6 L;  4HJ8 A;  1I4R A;  2Q8T A;  1WOC A;  2B8F A;  4ILW A;  1KQS A;  2VB2 X;  1Y69 U;  3KYH C;  5T1G A;  5IT9 L;  4B9W A;  1STB A;  4A3B G;  3M7N A;  3I4L A;  2R61 A;  4BY1 G;  2IX1 A;  3S14 B;  5BN4 A;  5E4W C;  2L0C A;  1Z47 A;  1JCK B;  2JA9 A;  1EZ8 A;  4JI2 L;  5ELE A;  1VQM A;  4TRD A;  5I9P A;  1B8A A;  1V1O A;  1E0B A;  3PO2 G;  1DD2 A;  3S16 B;  1HNW L;  1TWG H;  2F0O A;  3F2D A;  3PMF A;  1AP0 A;  3KDF A;  2JP1 A;  3ONA B;  3J7Z C;  1E1T A;  1VCI A;  4ZQ3 A;  2Q8I B;  2QF7 A;  2MQH A;  1B3Q A;  1K8O A;  1HTP A;  1MSH A;  1UEB A;  2DJF C;  4A3F B;  1ZXT A;  1PVO A;  4R8I A;  2F0G A;  1VQI A;  4DV1 Q;  3QB3 A;  1CA6 A;  2PQE A;  2LY7 A;  1IYJ B;  1KLG D;  2G5D A;  4CKB A;  4PMC A;  3J80 c;  2ZT9 C;  2B2Y C;  4K5X A;  3PCO B;  2EXD A;  4WFN 3;  3HOZ G;  3HZX A;  1PTO D;  3T51 B;  5J3B A;  1V43 A;  2D9U A;  3MZ5 A;  4KI0 A;  1NY4 A;  1NCV A;  3TP8 A;  1EIY B;  2HCI A;  1AEX A;  2K01 A;  3IRB A;  3M4Y A;  2EY5 A;  2EYF A;  2EQS A;  3U9O A;  1JQY D;  4DKA C;  3T1Y Q;  1PZJ D;  2PNR C;  1SSO A;  1R9T H;  5E4X A;  1TWH H;  1WCM H;  4HJA A;  1EWI A;  2PMZ B;  2B2U A;  1RKN A;  3H91 A;  1FJG L;  3G4S A;  2AWO A;  2LFN A;  3BS1 A;  5A2Q E;  3A56 A;  1Q1B A;  2D0O A;  5J39 A;  4K6D A;  3T1H Q;  2F0Q A;  2KUM A;  3KUP A;  4KK7 A;  4A3E B;  3BZK A;  3CPF A;  1H95 A;  1PRT F;  2ZM6 L;  3RD4 A;  4TQU S;  1KRT A;  4KD3 A;  1XYI A;  4JYA L;  2C35 B;  2E74 C;  2R7F A;  2FJ2 A;  4RCO A;  1K3R A;  3X3N A;  2ZXO A;  5IGG A;  1PXU A;  2HIX A;  5BR8 L;  3CPW A;  1YJ9 A;  2XWB B;  1F2Z A;  4RA8 A;  4LFA L;  5C4X H;  2X6L A;  1YNJ D;  1GUS A;  1QG7 A;  5KRU A;  1YHQ A;  3CCV A;  1SYC A;  4R4Q A;  1RJT A;  3K7A H;  2OWO A;  2DJG C;  3E6Z X;  3MXG A;  1LT5 D;  3KJO A;  4A3F G;  3H94 A;  1QOH A;  3IL8 A;  4LF8 Q;  4XYO A;  3IFD A;  2XN9 C;  2BCO A;  4BA2 I;  2F3V A;  2KHS A;  1L1O B;  3HGB A;  4A76 A;  2ZJQ A;  1DGS A;  2SOB A;  2YV5 A;  3H3V C;  5M5W H;  3LWU A;  3QJY A;  2K28 A;  3ND8 A;  1PRT C;  1UE5 A;  1EYC A;  5JVG 3;  4LFC L;  1TWG B;  1N8R C;  5JPM C;  5ELD A;  1MIU A;  3CHB D;  4DV2 Q;  4LF5 L;  3BZC A;  3RUZ A;  3TS0 A;  3HFZ B;  3RLN A;  1EWH A;  1E1O A;  4NDX A;  2CW0 C;  5IGB A;  1PH9 A;  1F2M A;  4EQP A;  2N78 A;  3HP3 A;  5M3M G;  4MTN A;  1QIL A;  2KCT A;  2E8G A;  1PLF A;  5CV8 A;  4A3E G;  1RTN A;  4YCW A;  1IZ6 A;  1YNN C;  4ZK9 B;  4JI1 L;  2VQE Q;  2YYZ A;  4PG3 A;  3HOV H;  2HDL A;  4B3M L;  3D4R A;  1VS0 A;  1MBY A;  1VQB A;  4BS9 A;  2RBM A;  4KD4 A;  1PZI D;  1D1K A;  1EWC A;  4DR4 L;  4DUY L;  1II3 A;  2GN5 A;  1D5Z C;  2BA1 A;  4JI0 L;  1BVS A;  1P8L A;  1R9T B;  1TWH B;  1WCM B;  3MFG A;  4H0L C;  2RSN A;  2LXK A;  2G9H D;  3OW7 A;  5DEH A;  5ELB A;  5G3L F;  1KDA A;  4JG2 A;  1BQQ T;  4R4C A;  3GTO H;  4A3G H;  2L15 A;  5FOB B;  1TS2 A;  3GV6 A;  1EEI D;  1I4G A;  3ULL A;  1QJO A;  4RGN A;  2GA4 B;  1FGB D;  1G2S A;  4LF9 L;  1NBW A;  3TBI B;  2MNA A;  2Z8L A;  5M9O A;  4XQN A;  2HT1 A;  1E2V A;  3VYT A;  1TS3 A;  4DK0 A;  3OW2 A;  5C4X B;  2B2W A;  4X62 Q;  4RHR A;  1YIT A;  2N55 A;  1STA A;  5EBD A;  2NN6 H;  4V19 0;  3S2H H;  3H6M A;  1UAP A;  4GLX A;  1VQP A;  4DR7 L;  3TSS A;  3AFP A;  1OXT A;  2LMC B;  3NWS A;  4UP9 A;  1EY7 A;  1EZ6 A;  4DFA A;  4JC0 A;  2AUJ D;  4K0K L;  3AEV A;  3U50 C;  1YJN A;  1JMC A;  1W6J A;  4LK1 C;  1Q86 C;  5FKA C;  2NB0 A;  3DEO A;  2WAQ B;  1SBB B;  2XRQ D;  1WTV A;  4N8F A;  1B9M A;  4OL7 A;  5M5W B;  1ML0 D;  3FKI H;  4N9T A;  4KN4 C;  2B63 H;  5FJ8 H;  2NVT H;  1LT4 D;  3FPU B;  3I4N H;  1X55 A;  3U9S A;  5FO7 B;  1Z9F A;  5FLX L;  5CV7 A;  2B8G A;  4DAP A;  4LF7 L;  5FO8 B;  4GOP B;  1XWE A;  3BDC A;  3T1Y L;  4KJO A;  4LW1 A;  4G57 A;  1WCM G;  1LV9 A;  2B2V C;  1HR0 Q;  3M3Y H;  3I7F A;  3BYY B;  3QOJ A;  1E24 A;  5BN5 A;  1X3P A;  4HR7 B;  1I5F A;  3TEH B;  4OHJ A;  3GQB A;  4MNO A;  4GLV B;  2I5H A;  3TQY A;  2X69 A;  2NVX B;  3BU2 A;  1TWF H;  5ISR A;  4FO2 A;  4XYQ A;  5KIX A;  1OXV A;  1PFS A;  4JBJ A;  5M5Y H;  2CCZ A;  1WI5 A;  2BDO A;  3SK6 A;  1Q8I A;  2CWA A;  3L3O C;  2HUG A;  5IGF A;  4JI7 Q;  3HOV B;  4BBS H;  4UP8 A;  4LF6 L;  5IE8 A;  2B2T A;  4ZUJ A;  5CYU A;  3PSI A;  3STB C;  2Z9H A;  5C4X G;  2Z1C A;  1K8G A;  4GKK L;  1SMX A;  2D62 A;  1G8Z D;  2KOL A;  4C1N K;  4NP5 A;  4GNX A;  1KDC A;  1LAC A;  3UDF A;  4C56 C;  3AFQ A;  3S9W A;  5GAD C;  1QUQ B;  4LF8 L;  4X6A H;  3NK9 A;  2F0F A;  4Y7N H;  5C44 H;  3GTO B;  3DWP A;  5EPL A;  4A3G B;  2HQE A;  4P74 A;  3V2T A;  2ICE C;  1XNR L;  2ZJP A;  1XPU A;  4POF A;  1EUJ A;  3SK5 A;  1QVG A;  2UXD Q;  2WAQ G;  1IYV A;  3TS2 A;  1WYD A;  1VQD A;  2PW7 A;  3RLO A;  3E9H A;  1CKN B;  5IYB H;  5C0X I;  1HHV A;  5I2X A;  1WTQ A;  5GAG C;  5KGU A;  4BXX H;  4B3R L;  1WFQ A;  2FFK B;  4G7Z C;  1LO5 D;  3GDE A;  2RDF A;  4RWS C;  5C0X H;  5GRO A;  4QF4 A;  4QUC A;  1ET6 A;  3K81 C;  3NSW A;  4LUZ A;  4QIW B;  2DY7 A;  3D4D A;  3RZO B;  3S2H B;  3PO3 H;  1XMO L;  2F4I A;  1U4P A;  2JEB I;  4YY3 Q;  3UDX A;  1E2W A;  4IUP A;  2NWG A;  3KFU A;  3HEJ A;  3ER0 A;  5C3E H;  3PIP 3;  2A68 D;  2IT1 A;  3L2P A;  2L5T A;  3VDY A;  4WJ4 A;  3PIO A;  1U4M A;  2WAQ E;  3H3V H;  2NZO A;  3MHB A;  1F2Y A;  3FKI B;  3EIV A;  2B63 B;  4NMZ A; 
#chains in the Genus database with same CATH homology
 5CV5 A;  2Z4H A;  3ZYY X;  5C4H A;  4V0B A;  4HCE A;  1KTK A;  2B2T C;  1STE A;  3AU7 A;  1SE4 A;  5IT9 E;  1W6K A;  3DMU A;  1CZW A;  4FXD A;  1TKW B;  3M3Y B;  2WAC A;  3K58 A;  2EOT A;  1DOK A;  5I4D A;  4ID6 A;  2BOS A;  2JXM B;  1PTO F;  3A8J E;  2F0E A;  3OWF A;  4G4K A;  2EPB A;  4IUR A;  3BDL A;  3D8G A;  1BR9 A;  1O7L A;  3I3C A;  1TWF B;  5M5Y B;  2EVB A;  5C6A A;  2M9V A;  3LNN A;  4BBS B;  3EFX D;  3LX0 A;  5LHY 1;  4DF7 A;  3J7Y W;  3SVM A;  1QB5 D;  1AZP A;  2H4O A;  2NN6 G;  1SYE A;  2QCP X;  2WKD A;  4J6H A;  1JOQ A;  4Y7N B;  3ERQ A;  1QWY A;  5C44 B;  2HDM A;  3EQL C;  4HAE A;  4Q0F A;  2ENB A;  2EYM A;  4H13 C;  4L8J A;  3PUY A;  1HQM C;  4PNY A;  1M8A A;  5DAU A;  1PTO C;  4WJW A;  4HED A;  2FMM A;  4IFD H;  2C9O A;  3K5O A;  3I70 A;  3T56 B;  3NTK A;  1ENC A;  1B44 D;  1PDQ A;  3Q24 A;  1AW7 A;  4F88 A;  1I4X A;  1XTC D;  3TN2 A;  3PO3 B;  1K8M A;  1FD7 D;  3JAM L;  3NTI A;  4DXF A;  1D6E C;  4ODG A;  1STH A;  2B2Y A;  2TSS A;  4R9W A;  3NBI A;  5JAV A;  2Q8R E;  1FNU A;  3SR1 A;  5C3E B;  1I4P A;  2L1B A;  4BWG B;  4U67 3;  4E6I A;  4KY5 A;  3SK4 A;  3IAY A;  1AZQ A;  1BBX C;  3FVQ A;  1DCZ A;  2CHB D;  5CMD A;  2F0T A;  2NUC A;  3J81 E;  2A69 D;  1ONL A;  4KKT A;  1Z7T A;  3VR5 A;  2F0N A;  3V96 A;  4JK1 C;  1FNW A;  3RLF A;  1RF2 D;  1RD9 D;  2TMP A;  2OEO A;  4J1M A;  5A35 A;  4O1N A;  1L0Y B;  1HUM A;  4N9P A;  3ITP A;  4KV6 A;  4UDU C;  1I4H A;  1Y8O B;  4M8A A;  4MIU A;  4DAV A;  5KYL A;  3OPO A;  1SJE D;  3HOW B;  5IOC A;  2K5D A;  2XWJ B;  1ZKO A;  1IW7 D;  5C0X G;  2BE5 D;  4Q5V A;  1GUN A;  3R93 A;  1TVX A;  1GHK A;  1DOL A;  4IUU A;  3VA7 A;  1SNC A;  2FIN B;  3D3R A;  5K36 H;  1B1Z A;  4RKB A;  4XIG S;  3GD7 A;  3TZU A;  4ME5 A;  5CV6 A;  5KYI A;  2ID0 A;  1ZEQ X;  2EZV A;  5JPN C;  1TWC B;  3VYS A;  4XTC S;  1TS5 A;  1KLU D;  3A7A B;  4KHV A;  2EJF C;  1B9N A;  4WRD A;  3P1H A;  2OXP A;  1JB3 A;  1OXS C;  2V4D A;  3KLS A;  1D2B A;  1H9R A;  1CHP D;  1TII D;  3NUC A;  2NTT A;  4RHS A;  1HA6 A;  4A3I B;  1BCP C;  1KDB A;  3WDN A;  1A15 A;  1TS4 A;  4DNR B;  2IJ0 A;  2QIL A;  3QOL A;  1SJH D;  3K57 A;  1F77 A;  3R3O A;  5F2D A;  4LMQ D;  3NXW A;  2WV6 D;  5I6W A;  3URY A;  2DNE A;  4EQO A;  1TR5 A;  3TP6 A;  3TP5 A;  1S5E D;  3I72 A;  3OIQ A;  3FMC A;  4CGY B;  3DM1 A;  1HRJ A;  1U4L A;  4FXG C;  4IUQ A;  2F0V A;  2XNA C;  3HOU B;  4PQX A;  1SFO B;  3CRL C;  1G6Z A;  1SAP A;  4DK1 A;  1WD1 A;  2RVL A;  2F0L A;  2IWH A;  2AWN A;  4MN3 A;  4IFD G;  2PO4 A;  3Q22 A;  1H9K A;  1QCB D;  5CBA E;  3DUZ A;  1LLR D;  2MHV A;  4NKL A;  3L7Z C;  2PZU A;  1CA5 A;  1LTT D;  4OGQ C;  1NR4 A;  2L11 A;  3R2T A;  3MTS A;  4O42 A;  2J7Z A;  3VR6 A;  4XT3 B;  3EVQ A;  3M4O B;  2NTS A;  1FNV A;  1C48 A;  4OO1 H;  3J80 L;  4DAY A;  1PZK D;  2ZXR A;  3PUW A;  1EU4 A;  4A3M B;  1WTO A;  1SYD A;  3HG9 A;  5LL6 S;  1WTX A;  1RHP A;  2B2V A;  3G6J B;  3VYU A;  2B39 A;  3NQT A;  1SNP A;  3BVM A;  4FXK C;  1SND A;  4HCS A;  3KK7 A;  4NW2 A;  2KVM A;  1BCP D;  3R8B A;  4CBV A;  2YU9 B;  4U68 A;  1BOS A;  3HOX B;  2JA8 B;  3NQI A;  1S5F D;  5FK9 C;  1JIC A;  3P20 A;  2WKC A;  1SNQ A;  4XXE A;  5D14 A;  2EE1 A;  5IOD A;  4IZ8 A;  2KA7 A;  3Q0A A;  3C3L A;  3FRP B;  3X3M A;  2NN6 I;  1TWA B;  5EQ0 A;  4K6L A;  2EYJ A;  4C3I B;  3DHQ A;  2MGS A;  3MFY A;  5NUC A;  2EY2 A;  3OWE B;  3J7A F;  2F0S A;  1Y1V B;  1EU3 A;  3A8I E;  5JEA J;  3O13 A;  4A3K B;  5I6Y A;  5DM7 3;  2PPB C;  3DEP A;  2CQA A;  2EY6 A;  5IGC A;  4BA1 I;  2F0K A;  1Z6H A;  5TSS A;  4FF2 A;  4DXG A;  5K36 G;  1J8I A;  1F2L A;  3RMH A;  1EY0 A;  2A68 C;  2RDG A;  3SDZ A;  1SNO A;  1SDF A;  4FF3 A;  4RGO S;  1OXX K;  3GTJ B;  3CRK C;  5CBE E;  4C3J B;  2QKI C;  2XVS A;  5AFW A;  4DGZ A;  4HSV A;  3NBH A;  2H1E A;  2K1B A;  2NVY B;  3OIP A;  4KJN A;  3T4A C;  1UEA B;  2JSO A;  1LT6 D;  1Y8P B;  2RDH A;  2EYP A;  1TQO A;  2RKS A;  1LT3 D;  3MEH A;  5EBC A;  4XT1 B;  3OSO A;  4K8J A;  1CI3 M;  2KEE A;  4AYB B;  1BDO A;  4ZKC B;  2R92 B;  4XQQ A;  5T1I A;  1ESF A;  1MI2 A;  1PTO B;  3AMU A;  2VB3 X;  4I65 A;  1KNA A;  3PIO 3;  1KAA A;  1V8Q A;  1I6H B;  4TKO B;  2AQ1 B;  4C3I G;  3VR4 A;  4CKE A;  2QDB A;  3PV0 A;  1ESR A;  3SHL A;  4QB4 A;  2E2H B;  1CQF A;  2Y0S B;  4KMU C;  1LTR D;  1CQV A;  3V05 A;  2DNC A;  1ET9 A;  1T5X D;  1IKL A;  1ENA A;  2F1M A;  2VUM B;  3MXN A;  5JVH 3;  2HCC A;  2XSC A;  2F0D A;  3GTP B;  5COY A;  3IFT A;  1HQR D;  3HKZ B;  1Q12 A;  4H44 C;  5BN3 A;  1C8C A;  1NSN S;  4X3U A;  3DWA A;  1BF4 A;  3JAM E;  4ZKB B;  1LTI D;  1EQV A;  4CJ2 C;  2A6E D;  4K8I A;  1A6X A;  1QNK A;  2JA6 B;  4FF4 A;  2K05 A;  4C3J G;  1DZ1 A;  3T16 A;  1JC7 A;  4QCL A;  3I91 A;  1EY4 A;  2VNU D;  3A54 A;  1Y1W B;  4IUN A;  3H09 A;  2XIW A;  4FP5 D;  3C46 A;  1GUW A;  2PZT A;  3SEB A;  3CQZ B;  4XQJ A;  2NBF A;  3K59 A;  3TP7 A;  1H9S A;  1SYG A;  4OO1 G;  2R6G A;  3QG1 A;  1ENF A;  3MWY W;  2F0H A;  3BDO A;  5JOB A;  2EYO A;  4CJ0 B;  5EPK A;  1D5X C;  2ICI A;  2A69 C;  2SNS A;  2PYK A;  2XRS D;  1HUN A;  2A73 B;  3C1E A;  2K04 A;  4XDX A;  3KLR A;  1U9R A;  1HFN A;  3KLS X;  2X6G A;  4HMI A;  3VA5 A;  4FF1 A;  1EFI D;  1F9R A;  3A8K E;  4H7B A;  4ZRZ A;  1S5C D;  4RKL A;  1VMP A;  3MA2 B;  5COR A;  1SE2 A;  1DON A;  4PMB A;  4K14 A;  3VR2 A;  1LTA D;  1X3Q A;  4ULL A;  4KY6 A;  4RFB A;  4HSP A;  4LAA A;  5C5L A;  2DY8 A;  3HS0 C;  5K5P A;  3CU7 A;  2JA5 B;  1IW7 C;  2M2L A;  1WVL A;  2BE5 C;  4PV1 C;  4JBW A;  2R7Z B;  1VDZ A;  2WB1 B;  3N52 A;  3H0G B;  1FR3 A;  1K83 B;  1ICW A;  4RH6 A;  2K5W A;  4IFD I;  4DN4 M;  1CHQ D;  4EVO A;  4IAL A;  4FVM A;  1MD2 D;  2K7V A;  1GOZ A;  3GTL B;  4KN7 C;  3BVG A;  1PMR A;  1D1I A;  4Z9C B;  4DU9 A;  1NAP A;  1EOT A;  2G9D A;  3QO2 A;  2K6A A;  1TY2 A;  2FMC A;  2NZ1 D;  2A6H C;  1VF5 C;  2E2D C;  3PUX A;  3D4W A;  1DM0 B;  3C2P A;  1G29 1;  3BVZ A;  3S1N B;  4MHE A;  5I9O A;  3J7A V;  2ZXP A;  1HFG A;  1H9M A;  4CHT B;  4A3D B;  1RDP D;  3S17 B;  5KEE A;  2BA0 A;  1XX8 A;  3NWT A;  1PRT B;  3ND9 A;  1XXG A;  1F9Q A;  1LTB D;  5CC4 A;  4S3S A;  1EL0 A;  1MGS A;  3S15 B;  1KNE A;  3M7G A;  2K33 A;  4F87 A;  3Q6S A;  1I3Q B;  3VR3 A;  1O7Y A;  4CJ1 B;  4IUV A;  3WOF A;  4F8M A;  3NPP A;  4YIJ A;  1EEF D;  1PFN A;  2M00 A;  1S5D D;  3GV3 A;  5J22 A;  3T53 B;  2VXW A;  3E0J A;  1FYC A;  3BYT B;  1EY8 A;  3GTG B;  1J9O A;  1TY0 A;  2R93 B;  2JYO A;  3F2U A;  1BCP F;  1JWU D;  5M5X B;  1GUT A;  5DNF A;  3J80 E;  1S4Z A;  1B53 A;  2O5I C;  2O5J C;  1JWM D;  1SEB D;  3KBX A;  1RTO A;  3P75 A;  2IPK D;  1U4R A;  2EXZ A;  1F9S A;  1V1P A;  1UNS A;  2I07 B;  3FPP A;  3D6W A;  1A2T A;  2F0W A;  1SMY D;  1B3A A;  2A6H D;  3S1M B;  1O80 A;  4RAU C;  3TME A;  2F0U A;  3HRZ C;  3L9A X;  1B50 A;  5E1F A;  2KJX A;  1UUP A;  5C3X A;  4EQN A;  4GZY C;  2AQ2 B;  1HTL D;  3MC0 B;  2F0J A;  3EA6 A;  3A7L A;  1JOK A;  4ZAI A;  4RGM A;  4CKC A;  2O2L D;  2WP8 J;  1A3V A;  5M3M B;  2KED A;  2K5Q A;  2NVQ B;  1I4Q A;  5CGK A;  4P2C B;  5IIF A;  1CZG A;  1G2T A;  1ZYR D;  1O78 A;  4B9X A;  3IKJ A;  3M85 A;  3K5M A;  3Q23 A;  1ILP A;  2O4X A;  5KNC A;  3PUZ A;  3R2I A;  5KND A;  5FLX E;  2LS0 1;  4C1N I;  4KY7 A;  2J0T D;  1TT2 A;  4A3J B;  2A74 C;  3BG3 A;  1SYB A;  1D5M C;  2F0I A;  2IL8 A;  4QUF A;  3J81 L;  2F0P A;  1HPC A;  2WII B;  1S5B D;  3BZD B;  3I90 A;  3GP7 A;  1ILQ A;  1O7Z A;  3SE0 A;  4K5V A;  3E5S A;  3MXP A;  1IKM A;  4J8Q A;  2D2C C;  1EYD A;  1LAB A;  2L4N A;  2PW5 A;  4OO1 I;  1EY5 A;  5CV9 A;  1IYU A;  5ELF A;  1GJX A;  1JE4 A;  1PTO H;  5EGT A;  1Y8N B;  4HTH A;  1SYF A;  3KBG A;  2B2U C;  2IX0 A;  4L6T B;  1I50 B;  1Q1E A;  3MVV A;  2KCN A;  2SDF A;  4BBR B;  5C4Z A;  2EY1 A;  4ZUI A;  1A2U A;  1GXD C;  3W2D A;  2F0M A;  3VYR A;  5IGE A;  5HUR A;  1EY9 A;  3S1R B;  3GTM B;  2KCC A;  1WD0 A;  2MP1 A;  3OMC A;  1EIG A;  2QEJ C;  3I4M B;  1CT1 D;  2F03 A;  2A6E C;  5CR3 A;  2SEB D;  3NTH A;  2D5D A;  3SXH A;  2MUY A;  5A2Q L;  1PFM A;  4BY7 B;  1JOO A;  1ROD A;  2R3Z A;  3MXU A;  4RGT A;  1H9J A;  1QNU A;  5EPJ A;  1VF7 A;  3D31 A;  3CKI B;  5E3F A;  3I8Z A;  1MSG A;  1Q3L A;  3K7A B;  2N88 A;  4FNF A;  3K0Y A;  1LTG D;  4ZYS A;  5FO9 B;  1QE6 A;  5JEA H;  5I2Y A;  4KTA A;  4L63 B;  3S1Q B;  1PRT D;  2RQX A;  3K6O A;  3I73 A;  1X32 A;  1STN A;  4PMW A;  2JA7 B;  4IN3 A;  4HMJ A;  4RCN A;  2EYH A;  3WOE A;  5EKI A;  1EQT A;  4G7O C;  1HXY D;  2PZW A;  2CW0 D;  1JWS D;  4A93 B;  2C5C A;  4ZLT F;  3UI2 A;  1WTR A;  2E2I B;  3D6C A;  1HA5 A;  1CK1 A;  3DWQ A;  3HOY B;  4OIJ A;  1YNN D;  1DYQ A;  1H9S B;  1NUC A;  4LJZ C;  3DXJ C;  1CM9 A;  4F7X A;  3P7J A;  2LKV A;  5D3D A;  2IW3 A;  2MPM A;  4M1U B;  2WIN B;  1JOR A;  2JEA I;  2JE6 I;  1E2Z A;  2B2W C;  5C5M A;  2EJM A;  1T5E A;  4DNT B;  3RZD B;  4X3K A;  2BDN A;  3OMG A;  2KEC A;  1SE3 A;  2Z4I A;  5C0X J;  4K2L A;  1IHZ A;  3ERO A;  1GUG A;  1B2T A;  5JJZ A;  4C3H B;  4UAI A;  5EKK A;  1DOM A;  1TU2 B;  2CVR A;  3FDT A;  3K5N A;  1PFB A;  3QIA A;  4FYD A;  3NE5 B;  2AQ3 B;  1GUO A;  2L55 A;  4IUT A;  5G3L D;  3EJI A;  3GO5 A;  1G91 A;  1A3U A;  4B08 A;  1L0X B;  4X3S A;  4K2K A;  1WTW A;  2RSO A;  4C2M B;  1EIH A;  2IX3 A;  5HGT A;  5DM6 3;  2NVT B;  3OOC A;  3MAQ A;  3I4N B;  2E2J B;  1CFM A;  2L9H A;  3TZD A;  2J4X A;  3QWN A;  1BO0 A;  4QMG A;  2KQ3 A;  1STG A;  1SNM A;  4OIK A;  2K32 A;  2E75 C;  4ABN A;  1JR0 D;  5EJW A;  1AN8 A;  5M3F B;  1WTP A;  2K03 A;  1A3T A;  2PCF B;  1SXT A;  2EDG A;  1KAB A;  1PYW D;  3T13 A;  2AUK A;  4C3H G;  4HN7 A;  5CV4 A;  1CTM A;  3G7L A;  4I7Z C;  3AB9 A;  2A5H A;  1AFP A;  5C3W A;  1BNZ A;  1HCZ A;  1BCP B;  3FEW X;  1OXU A;  1RCV D;  2RA4 A;  3N6R A;  4WOR A;  4DA2 A;  4IFD J;  3A55 A;  1EYA A;  5D65 A;  4G7H C;  3OHX C;  1M4V A;  2E76 C;  5D3I B;  5JEA G;  4A3B B;  4BY1 B;  3S2D B;  3K5L A;  5EKL A;  3GTQ B;  1SMY C;  2OT2 A;  3PO2 B;  2MJ8 A;  4R8N A;  1Q90 A;  1DJR D;  2FHT A;  4KHZ A;  2I46 A;  4TSS A;  2EJG C;  1VMC A;  1GHJ A;  2SNM A;  3C1F A;  4IQZ A;  1R4Q B;  1NR2 A;  1DXM A;  2EYL A;  2L12 A;  4KKS A;  3NHH A;  3KF8 A;  3HOZ B;  1B4O A;  1BXT A;  4KKU A;  4X3T A;  3PUV A;  1V1P B;  2OF1 A;  2F3W A;  2NYZ D;  1ZYR C;  1BUV T;  4K5W A;  1OO9 B;  3TDQ A;  2DN8 A;  5J1Z A;  3GTK B;  5IGD A;  1I6V C;  3LWE A;  5LL6 X;  1C4Q A;  4EGV A;  3W3A A;  1R4P B;  3NP8 A;  5ELC A;  1EY6 A;  1F9P A;  5C4J B;  1LTS D;  5KNB A;  3SK8 A;  1YNJ C;  1IL8 A;  1STY A;  1I4R A;  2Q8T A;  2B8F A;  4ILW A;  2VB2 X;  1Y69 U;  5T1G A;  5IT9 L;  4B9W A;  1STB A;  3M7N A;  3I4L A;  2R61 A;  2IX1 A;  3S14 B;  5BN4 A;  5E4W C;  2L0C A;  1Z47 A;  1JCK B;  1EZ8 A;  5ELE A;  4TRD A;  5I9P A;  1V1O A;  1E0B A;  1DD2 A;  3S16 B;  2F0O A;  3PMF A;  1AP0 A;  2JP1 A;  3ONA B;  1VCI A;  4ZQ3 A;  2Q8I B;  2QF7 A;  1K8O A;  1HTP A;  1MSH A;  4A3F B;  1ZXT A;  4R8I A;  2F0G A;  3QB3 A;  1CA6 A;  2PQE A;  2LY7 A;  1KLG D;  4CKB A;  4PMC A;  2ZT9 C;  2B2Y C;  4K5X A;  4WFN 3;  3HZX A;  1PTO D;  3T51 B;  1V43 A;  2D9U A;  3MZ5 A;  4KI0 A;  1NCV A;  3TP8 A;  2HCI A;  1AEX A;  2K01 A;  3M4Y A;  2EY5 A;  2EYF A;  3U9O A;  1JQY D;  1PZJ D;  2PNR C;  1SSO A;  5E4X A;  2PMZ B;  2B2U A;  1RKN A;  3H91 A;  2AWO A;  2LFN A;  3BS1 A;  5A2Q E;  3A56 A;  1Q1B A;  5J39 A;  4K6D A;  2F0Q A;  2KUM A;  3KUP A;  4KK7 A;  4A3E B;  1PRT F;  3RD4 A;  4TQU S;  1XYI A;  4KD3 A;  2E74 C;  2FJ2 A;  4RCO A;  3X3N A;  2ZXO A;  5IGG A;  1PXU A;  2XWB B;  1F2Z A;  4RA8 A;  2X6L A;  1YNJ D;  1GUS A;  1QG7 A;  5KRU A;  1SYC A;  1RJT A;  3E6Z X;  3MXG A;  1LT5 D;  3H94 A;  1QOH A;  3IL8 A;  4XYO A;  3IFD A;  2XN9 C;  2BCO A;  4BA2 I;  2F3V A;  2KHS A;  3HGB A;  2SOB A;  3H3V C;  3LWU A;  3QJY A;  2K28 A;  3ND8 A;  1PRT C;  5JVG 3;  1EYC A;  1TWG B;  5JPM C;  5ELD A;  3CHB D;  3RUZ A;  1EWH A;  4NDX A;  2CW0 C;  5IGB A;  1F2M A;  4EQP A;  3HP3 A;  1QIL A;  1PLF A;  5CV8 A;  1RTN A;  1YNN C;  4ZK9 B;  2YYZ A;  2HDL A;  3D4R A;  1MBY A;  4BS9 A;  2RBM A;  4KD4 A;  1PZI D;  1D1K A;  1EWC A;  1II3 A;  1D5Z C;  2BA1 A;  1R9T B;  1TWH B;  1WCM B;  3MFG A;  4H0L C;  2RSN A;  2G9H D;  3OW7 A;  5DEH A;  5ELB A;  5G3L F;  1KDA A;  1BQQ T;  5FOB B;  1TS2 A;  3GV6 A;  1EEI D;  1I4G A;  1QJO A;  4RGN A;  2GA4 B;  1FGB D;  1G2S A;  3TBI B;  2Z8L A;  5M9O A;  4XQN A;  1E2V A;  3VYT A;  1TS3 A;  4DK0 A;  5C4X B;  2B2W A;  4RHR A;  2N55 A;  1STA A;  5EBD A;  2NN6 H;  4V19 0;  3H6M A;  1UAP A;  3TSS A;  1OXT A;  2LMC B;  3NWS A;  1EY7 A;  1EZ6 A;  4DFA A;  2AUJ D;  1W6J A;  4LK1 C;  5FKA C;  2NB0 A;  3DEO A;  2WAQ B;  1SBB B;  2XRQ D;  1WTV A;  1B9M A;  4OL7 A;  5M5W B;  1ML0 D;  4N9T A;  4KN4 C;  1LT4 D;  3FPU B;  3U9S A;  5FO7 B;  5FLX L;  5CV7 A;  2B8G A;  4DAP A;  5FO8 B;  1XWE A;  3BDC A;  4KJO A;  4G57 A;  1LV9 A;  2B2V C;  3BYY B;  3QOJ A;  5BN5 A;  1X3P A;  4HR7 B;  4OHJ A;  3GQB A;  2X69 A;  2NVX B;  5ISR A;  4FO2 A;  4XYQ A;  5KIX A;  1OXV A;  2BDO A;  3SK6 A;  1Q8I A;  3L3O C;  2HUG A;  5IGF A;  3HOV B;  2B2T A;  4ZUJ A;  5CYU A;  2Z1C A;  2D62 A;  1G8Z D;  2KOL A;  4C1N K;  4NP5 A;  1KDC A;  1LAC A;  4C56 C;  3S9W A;  3NK9 A;  2F0F A;  3GTO B;  3DWP A;  5EPL A;  4A3G B;  2HQE A;  3V2T A;  2ICE C;  3SK5 A;  1IYV A;  2PW7 A;  5C0X I;  1HHV A;  5I2X A;  1WTQ A;  5KGU A;  2FFK B;  4G7Z C;  1LO5 D;  4RWS C;  2RDF A;  5C0X H;  4QF4 A;  4QUC A;  1ET6 A;  3RZO B;  3NSW A;  4QIW B;  3S2H B;  2DY7 A;  3D4D A;  2F4I A;  1U4P A;  2JEB I;  1E2W A;  4IUP A;  2NWG A;  3HEJ A;  3PIP 3;  2A68 D;  2IT1 A;  2L5T A;  1U4M A;  3MHB A;  1F2Y A;  3FKI B;  2B63 B;  4NMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...