4RWSC

Crystal structure of cxcr4 and viral chemokine antagonist vmip-ii complex (psi community target)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
LGASCHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, hydrolase
molecule keywords C-X-C chemokine receptor type 4/Endolysin chimeric protein
publication title Structural biology. Crystal structure of the chemokine receptor CXCR4 in complex with a viral chemokine.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rwsC00
4IUTA 5D14A 1G91A 1SDFA 1B53A 1F9RA 1EL0A 3DEOA 4HSVA 1EOTA 3TZDA 2B2YC 2IL8A 1X32A 1HA6A 2B2VC 2H1EA 4RAUC 1E0BA 5CMDA 1ESRA 5EQ0A 1BBXC 2L9HA 2KOLA 1IL8A 1RODA 1O7ZA 1NCVA 5AFWA 1PFBA 1ML0D 1VMPA 2B2YA 2RA4A 3I8ZA 2B2VA 2EOTA 3HP3A 3ONAB 1HHVA 2N55A 1AZQA 1AZPA 2JP1A 1KNAA 1O7YA 5EKIA 1CM9A 1RTOA 4MN3A 2RSNA 2XIWA 1F9PA 2BDNA 4X3UA 1SAPA 1WTPA 4RA8A 3LWEA 3DM1A 3N52A 2Q8TA 2HDMA 1GUWA 1U4RA 1B4OA 2FMMA 2MP1A 2K1BA 2NWGA 3G7LA 4XT1B 3UI2A 1HRJA 5CBEE 4XT3B 1F9QA 3H91A 1NAPA 1SSOA 2J7ZA 3IL8A 4ZKCB 5JJZA 4IURA 1XYIA 4ZK9B 2KUMA 4UAIA 2B2WC 2K05A 3KUPA 1A15A 1BF4A 2R3ZA 1HFNA 1QG7A 1RJTA 2N88A 2X6GA 3I90A 1NR2A 1J8IA 4X3TA 1J9OA 1WTOA 1MI2A 4CJ2C 4MHEA 4ZLTF 2B2WA 2L11A 3KBXA 1TVXA 1JICA 1LV9A 3F2UA 2MGSA 4ZKBB 1IKMA 1DZ1A 2K03A 2EE1A 4IUVA 4HAEA 4LMQD 5CORA 3QO2A 1PDQA 1WD1A 3TN2A 4RWSC 5DNFA 1WTRA 2NZ1D 2FFKB 2L12A 4NW2A 1PFNA 2FJ2A 1XX8A 4U68A 1WTVA 1ICWA 1QE6A 1PFMA 1F2LA 2K04A 3GV3A 2X6LA 1Q3LA 1O80A 2KVMA 2B2UC 1U4MA 3MWYW 3I3CA 4ZAIA 2VXWA 3MTSA 1RHPA 4X3KA 4X3SA 2DY8A 1AP0A 1QNKA 1X3QA 2K28A 2Q8RE 1B50A 4OIKA 5EPLA 1PLFA 2RSOA 1EQTA 1ZXTA 3FPUB 5EPKA 2D9UA 1ILQA 2B2UA 2X69A 1BO0A 2CVRA 5EPJA 1MSGA 1DOKA 2M2LA 1RTNA 1KNEA 4R9WA 1JE4A 4R8IA 1EIGA 1DOMA 2FINB 2KEDA 3FDTA 5E4XA 5EJWA 2MJ8A 3GV6A 4HCSA 2FHTA 1EIHA 1VMCA 1U4PA 2L1BA 3R93A 1WTWA 1F9SA 1ILPA 1MSHA 3DEPA 1CA5A 1G6ZA 5T1GA 1WD0A 2KECA 2NYZD 1HUMA 2HCIA 2K01A 3IFDA 4CJ1B 4QUFA 2HCCA 3P7JA 5COYA 1WVLA 2JYOA 4CJ0B 3Q6SA 2MPMA 3I91A 4IUPA 4QUCA 1MGSA 5E4WC 2B2TC 1WTQA 1HUNA 4DN4M 2RVLA 1B3AA 4IUUA 1S4ZA 1C8CA 1U4LA 2HDLA 2SDFA 1G2TA 2EPBA 2KEEA 4IUQA 1HFGA 2DY7A 1DOLA 4HEDA 2B2TA 1M8AA 5D65A 1CA6A 1DONA 1WTXA 3SVMA 5CBAE 4O42A 4XDXA 1NR4A 5T1IA 1BNZA 1B2TA 1IKLA 3D6WA 2L4NA 4OIJA 1G2SA 2HUGA 1X3PA
chains in the Genus database with same CATH superfamily
3Q8DA 1S40A 1GJXA 4P71A 5E7NA 1EY8A 1PXUA 1IYJB 3I72A 1KDBA 4A3MB 1I3QH 2DJGC 3JAML 1ESRA 4LF6L 4MNOA 4QCLA 1J6QA 4CDDC 3TP8A 3BZKA 1CTMA 1UUPA 1ENCA 4K5VA 1VCIA 5EKIA 4DV4Q 1Z7TA 4IPDA 3PO3B 4K5WA 4JK1C 3LWEA 4G4KA 1WCMB 1N34L 4P72A 1JJ2A 3G7LA 3UDXA 4WJ3M 3WWVA 1ZKOA 4FP5D 1KLGD 1SE8A 3A7AB 2WP8J 4KHPL 1K3RA 3J81i 1HFNA 2X6GA 4H0LC 5C44H 2RDFA 3D31A 1JORA 4HMJA 1AEXA 1GUOA 1TVXA 5G3LD 5J1ZA 2EE1A 3BVMA 4HJ5A 4DV6Q 3PV0A 4EGVA 5DNFA 2F52A 5M3FG 3TP6A 4HTHA 1BBUA 3C1FA 1AP0A 1XPRA 2JE6I 1X3QA 1OXUA 1PH4A 3RLNA 5IIFA 2F0SA 1YI2A 5C0XJ 1B8AA 5E4XA 1KD1C 2E76C 5I6YA 3PF4A 4KI0A 1HQMC 3OIPA 4OEMB 1EIYB 1FGUA 1I50H 2RDHA 3W1BA 5C5LA 4OGQC 5D3DA 1TWFB 2EIFA 3HOYH 3R8BA 1ZYRC 3P7JA 1L0YB 4JI0L 4MIUA 2JYOA 2WINB 4H02A 1X6OA 3J80i 1J5EQ 4C1NI 1S5ED 5KNDA 4LUZA 2F4IA 2EYOA 3BS1A 3DWPA 5LL6X 2ZJQA 1WTXA 3NUCA 1XPUA 1QOHA 1Q46A 4E6IA 2O5JC 4A3CG 4TRDA 4IUNA 3UE0A 4C3HG 5FLMH 3GTQB 4GKKQ 3S17B 5CYUA 2RQXA 1RODA 2R93B 1VQ4A 5IP9H 4DV0L 4JOIC 4YCWA 4X62Q 3HP3A 1PZID 2LKVA 1IYUA 4NDXA 4FO2A 3CCQA 4KTAA 1TXYA 1M4VA 2XIWA 1I4QA 4HSPA 3ND8A 5I2XA 1PH9A 4JBWA 2FMMA 2I5LX 5GAEC 1I3QB 4A93G 3HOUH 4PG3A 1SNDA 1F77A 3D6CA 3UDIA 3M4QA 2WB1B 3CPWA 4DV4L 4QJFA 2LXJA 5CGKA 3F2BA 1XPOA 3FHWA 3AMUA 1BCPD 4IJHA 3F2DA 2K03A 2F0KA 3EVQA 3QIAA 4LMQD 2QA4A 3QJYA 4DAYB 2HHHL 1U5KA 4LFCQ 3MXUA 1X3FA 1N32Q 1GKHA 3MFGA 2IWHA 2NN6H 2R7FA 2PPBC 1LTRD 4DV6L 3H3VI 2QDBA 3K6OA 5JOBA 2UXCL 1ESFA 3OIQA 1EY0A 4ZYSA 3PF5A 5C0XH 4HN7A 1EWIA 3H0GH 3HKSA 2EY6A 1MHWC 1MSGA 1RTNA 3OWEB 1VQ8A 1BCPC 3EROA 4JI6L 4ZUIA 4JVZA 4A3BG 2PCFB 2L1BA 1K83H 4H7BA 4KV6A 1KTKA 1S5CD 4A3LG 1S3OA 2DUDA 1EOVA 2WAQG 4QUCA 4DK0A 2B2TC 3FMCA 1TY2A 4KJNA 3CRKC 4DV1Q 2A5HA 4FVMA 4YY3L 4OO1H 4BWGB 1C9OA 1V43A 5D65A 1EZ6A 1I50B 4ZQ3A 2IT1A 4R1JA 1LO5D 2FFKB 1STAA 3G48A 1HQRD 1E24A 5D14A 3HOYB 1EWCA 5NUCA 2B29A 1CI3M 3FKIG 1YJNA 2B63G 2B2VC 2OXPA 4IFDG 2CKZB 4LJZC 3VYRA 1HNZQ 2F0DA 3OTOQ 4HR7B 5ELBA 3M3YH 1ZEQX 1AZQA 1Q1BA 1Z9FA 2QW7A 5CC4A 1K73C 3JAME 1Q90A 1EY5A 4GKKL 4GOPC 2Q8TA 3NWTA 4XT1B 2K1BA 4LWCA 4B3RL 4DPGA 2K50A 1D5ZC 4X62L 3DMUA 1BKBA 2RHQB 1ONLA 1PTOD 2E2IH 4BXXG 2PZWA 2AQ2B 4CKCA 4DV7L 1LT4D 4R4QA 3HZXA 2XVSA 3I90A 1NR2A 4K2KA 4MHEA 5CV5A 1TWCH 3L7ZC 2R92H 3NWSA 3NENA 3PUZA 1VDZA 4K6LA 2L15A 1QVGA 4A3MG 5C4JH 4JBJA 4K8JA 2OCEA 4L5RC 4JI5Q 3R2IA 2K04A 3GV3A 5DM63 1PZKD 3EFXD 4YWKA 2D62A 1JCKB 2E2JH 1Y1WH 1CZWA 2Q2TA 2NTSA 4LFCL 4TVAB 1LM0A 5I6WA 1VS0A 5KIXA 2V4DA 1VMCA 3AFQA 1KIXA 1GVPA 3R93A 5IY0A 1SFOH 4RMFA 2B3GA 4KMUC 1Q86C 4EQNA 1I6HH 1E2ZA 1SJED 4OXPA 4L8JA 4A3EH 2RCNA 4C3JG 3QR8A 5LMNQ 1PRTF 1D7QA 4DUYQ 2F0VA 4C56C 3U9OA 1TWGH 4DNTB 4OIJA 2DNEA 4NP5A 4DK3C 2WV6D 2DNCA 1EL0A 3QG1A 4IJLA 5FLXL 4RAUC 4OWWB 3U50C 2PQEA 2MUYA 1HR0W 3PO2H 1PH8A 1B70B 3CQZH 1E3PA 1YNND 3BZCA 2PMZB 1VF7A 2IX0A 4DGZA 1SJHD 1SYDA 2JP1A 1AZPA 3I4MG 3FRPB 3DHQA 5C0XI 2E5LQ 3G71A 5K5PA 1LTBD 1AE2A 1GUNA 3E5SA 2HDMA 1VQ9A 4L5TA 2NWGA 3GTMB 3EN2A 1XMQQ 2GVAA 2PW7A 4XT3B 1HNZL 2K5DA 3OTOL 2WB1E 4N9PA 2CWPA 2QKIC 5M3FB 3OW7A 3KUPA 3SEBA 1R4PB 3M3YB 5JJKA 1H9RA 3HKZG 4FYDA 4DV5Q 1VQOA 3KK7A 1WTOA 1EWHA 1LV9A 1RCVD 4K5XA 3SK4A 3RZDH 2IY5B 1EFID 3HFZB 1Q12A 2CW0D 1R4QB 1SNOA 2IHFA 5M9OA 1PFMA 1F2LA 5FKAC 1UE5A 1Q7YC 3MWYW 3X3NA 2R61A 4LF7Q 1YJ9A 1JJGA 3K8AA 4P75A 3JAMc 1EYDA 3F2CA 1HTPA 2LY7A 1HA5A 2R92B 2CVRA 5GQOA 2A8VA 4JI5L 5C4JB 5J22A 3NBHA 2KCTA 3J7AF 1GM5A 3A55A 3VR3A 4ZUJA 3NTHA 1MSHA 3DEPA 3KF8A 4J8QA 4B08A 4YIJA 2EYJA 4RGTA 2K01A 1SNCA 3HEJA 3IAYA 2B8FA 1Y8NB 2MQHA 2EYHA 4JW0A 1Y1WB 2LFNA 2BDOA 4X64Q 1B3AA 3K0YA 4XYOA 4N9TA 1G2TA 2O5IC 1CFMA 1H9MA 1M8AA 4BXXH 4HIMA 2A68D 4PMCA 2EYFA 1BNZA 3I4OA 1IKLA 4DXFA 1CK1A 2OQKA 5FOBB 3K7AH 1VQIA 3MC0B 5C44G 1NSNS 1FNWA 3ICEA 3J81L 2K32A 5LMNL 3HOXH 1I6HB 3AFPA 4UP9A 2JA6H 2XNAC 3X3MA 5KNBA 2KOLA 4O0AA 1PVOA 3K5LA 3S2HH 1NCVA 1V9PA 4A93B 1EY7A 3RD4A 3BDLA 1TKWB 1AW7A 3HOWH 1HNXQ 1KNAA 1O7YA 2IW3A 2F3WA 3STBD 3VR5A 5JPNC 1WFQA 3L2PA 1PH5A 1M1KC 3NSWA 2UUCQ 3KF6A 1C0AA 1JB7A 4GNXA 1TWHH 1NAPA 1SSOA 1X54A 3MXGA 4HMIA 5JJZA 5IGBA 2E2HB 1MIUA 1Z47A 4PQXA 2E5LL 4FF2A 4DAPA 3CQZB 5CR3A 2Q8IB 1QWYA 3BZDB 4CKBA 5C4HA 3S14H 2Y0SB 4LF5L 3PGZA 1XMQL 2EXDA 2EJFC 2B2WA 3HOYG 1U9RA 5HGTA 2GVBA 3RLFA 1WTRA 4DNRB 1CKOA 1N9WA 1WTVA 4CHTB 4DV5L 3A8IE 2ZM6L 1HNWQ 5EKLA 3TDQA 4DF7A 5EPLA 4Y52H 1ILQA 1O7LA 2WAQB 3VYUA 1JOOA 3MVVA 1EIGA 5M5WH 4QY7A 5FLMG 5JJLA 1GUGA 1WTWA 1G6ZA 2Z4IA 1CQFA 5IP9G 1UEBA 4DV2Q 1WOCA 1YVCA 5C6AA 5C3EH 1IBMQ 2CHBD 5ELDA 1QB5D 2UUAQ 3FKIB 3SDZA 1S4ZA 2JQOA 2B63B 3T51B 2EPBA 3GD7A 4K0KQ 1HFGA 3HOUG 1CA6A 4G7HC 2EYLA 4OX9Q 1NR4A 3P1HA 1G2SA 3OWFA 4WJWA 3BJUA 4X64L 2NVQB 2D5DA 2TSSA 2QEXA 1FVIA 2IL8A 3BVZA 3TP7A 1SBBB 5JEAH 2EY1A 3MXNA 3SR1A 1X65A 2E74C 4NXNQ 3CU7A 4R8NA 4MZ9A 2RA4A 2PMZE 4OELB 3K0XA 3M9BA 1XTDA 4IQZA 1NTGA 5FLXE 2NN6G 2NVXB 2C5CA 3K7AB 2F0JA 1B4OA 2PI2E 3HOXB 4LFBQ 5CBEE 2K14A 3M4PA 1LUZA 5C0XG 3GTJH 1D1IA 4QF4A 1TWAH 3H0GG 1HNXL 2Z6KC 3KLWA 1JWSD 4YHHQ 3S2HB 3H3VH 1TS2A 2KA7A 4KLKA 2K7VA 1CUKA 4IZ8A 4X65Q 3NEMA 4A3JH 4X3TA 1Y1VH 2UUCL 3I4LA 2O4XA 1J9OA 3MEHA 2IX1A 5LMUQ 3AQQA 2L11A 3EBEA 5H1SE 1EQQA 3I4NH 4K14A 3CCSA 4Y7NH 4A3KH 2RKSA 4OO1G 2JA8H 2H5XA 2F0WA 5HURA 4PNYA 3S14B 2HQEA 4X3SA 4KN4C 3KJPA 2K33A 3OW2A 2K28A 3U4ZA 1I94Q 1EQTA 4POGA 3T4AC 3NPPA 4DR7Q 1STNA 1IBKL 4A4IA 5EPJA 2XTIA 2I07B 2M2LA 4GLXA 3FDTA 3NTKA 2HD3A 3CF5A 1HNWL 1AH9A 4C3JB 2KQ3A 1L0XB 1F9SA 4JV5Q 5M5YH 1SMXA 5T1GA 2UXDL 2ASBA 3JC66 2C35B 1ZYRD 2JEAI 4I65A 1P8LA 5IT9L 1SR3A 1JT8A 3OPOA 1A3UA 4J1MA 3F8TA 5M5XB 1K8MA 1PHJA 2XWBB 1ENFA 2VW9A 1OO9B 1Q8IA 3MHBA 1I4RA 3E6ZX 3TRZA 3I55A 4WRDA 3KDFA 4DV2L 2ZJPA 3D6WA 1E1TA 1ICFB 3NE5B 4DUZQ 1IBML 3CRLC 4CDEC 3I4MB 4JI3L 1IW7C 1NBWA 2UUAL 2F0HA 1VQHA 5G3LF 3RZOH 2JK8A 1LTID 1MBYA 1DM0B 3V96A 4K0KL 4R4IA 3C1EA 3K58A 1C7YA 1LT5D 4DU9A 1HZAA 2R92G 4OX9L 3HGBA 5C3XA 2CQAA 1O7ZA 1Y69U 4MTNA 2L0CA 1EYCA 3KF8B 1UAPA 4BA2I 2N55A 1UE1A 5KEEA 2YU9B 3J81E 1W2BA 1CM9A 1NUCA 1A6XA 1QUQA 3HKZB 1F9PA 5M3MH 3H09A 3OSOA 4RGMA 2F0GA 2TMPA 4NXNL 4N8FA 4AQYQ 1Y1WG 4ZKCB 3L0OA 4UAIA 3M85A 2AQ3B 1R9TH 2Y0SE 4BBSH 1NNXA 2A6HC 1D6EC 1TS3A 2B39A 1I6VC 4LFBL 4QIWB 2MGSA 2OT2A 1IBLQ 1CKNA 3GTOH 5CORA 1PDQA 1CT1D 3URYA 3A54A 4EQ5A 1YEZA 4DR2Q 4X65L 4A3EG 3GTLH 1X3GA 4QQBX 2K75A 2PZUA 5LMUL 2EQSA 3A8JE 4DR4Q 2UXBQ 2Q8RE 3OMGA 5FLXc 5GAHC 2NBFA 1PTOH 1O78A 4K6DA 5EPKA 3S16H 2WAQE 2B2UA 1B3QA 4GNXB 4RCNA 3PSIA 5AJ3Q 4A3KB 1PYWD 2EYMA 1X9NA 2F1MA 2BE5D 3PO2G 1I94L 1WD0A 1EFWA 4LK1C 3IFDA 4DR7L 2Y0SG 1LTGD 3FPPA 4BS9A 3S1NH 1UNSA 1WTHA 5FO7B 4QL5A 2GA4B 3M4OH 5C44B 3RN5A 3J81j 1IL2A 2PQAA 5CV7A 1GHKA 2Z9HA 1K8GA 4FF4A 1U4LA 1KABA 1V8QA 3S9WA 1DOLA 1DONA 1SYFA 2AWOA 4O42A 3UDFA 4UPAA 1OTCA 1DOKA 1X3PA 2Z8LA 4GN3B 4XQQA 1T5EA 1G91A 3ULPA 1WI5A 1F9RA 3ERSX 1SNMA 1LTTD 2F0IA 3P20A 1DYQA 2BE5C 4DXGA 2B2YC 3TS0A 3V05A 1SNPA 2JEBI 4AYBB 1LACA 1X3EA 1AE3A 4DUZL 3CCVA 1BQQT 4BA1I 2K5HA 2EZVA 1VQEA 2AUJD 3RZOB 1HRJA 3G6EA 1J5EL 3PCOB 4DK6C 5KGUA 2NVYH 5L37A 1L1OA 4PZ8A 4RKBA 1KRTA 1C4QA 3RMHA 2F03A 4IURA 5IYBH 4ZK9B 4OWTB 4IPCA 5FO9B 4LAAA 1BF4A 4GLVB 3CXCA 2R3ZA 1IXRA 1QG7A 1FNVA 3CC7A 3S1RH 4DKAC 4IN3A 5EGTA 3I2ZA 4AQYL 4K2LA 1JMCA 4JI1Q 1EU4A 4FDBA 2RHSB 5FK9C 3J7A5 2VQFQ 4LF8Q 1P16A 3MAQA 1ET9A 2M9VA 4L6TB 5IYDH 3LX0A 1SE3A 3S1QH 5BN4A 4L5QA 3J81c 1ENAA 1IBLL 3WOFA 1B50A 1JJCB 1PV4A 1ZXTA 4JYAQ 4DR2L 2NZHA 3KOJA 4ULLA 3HOXG 1A8VA 2JA6G 1W6JA 4DR4L 1Y8OB 1RDPD 1NY4A 3NELA 4ID6A 5IODA 3HOUB 2G9DA 4X66Q 1H9SA 4KKUA 5DM73 4BY1H 3K57A 1CHQD 3HOWG 2VNUD 3FVQA 3DWQA 2FXQA 5C4XH 5FO8B 1FNUA 5JAVA 2JXMB 4NB3A 1PTOF 5IT9E 1N32L 5JVG3 2R6GA 5C5MA 2VS1A 3NP8A 1HR0Q 2HUGA 4CBVA 5GAGC 4GLAC 1JR0D 2SEBD 1TT2A 3NXWA 2ALYB 2XN9C 2F0LA 1II3A 5BN5A 1X32A 2ZT9C 3L9AX 1HA6A 1PRTB 5CMDA 3M4OB 4AIMA 2VQEQ 4ME3A 2XWJB 3MXPA 3H0GB 3I8ZA 3VA7A 2R7ZH 2I0QA 1KDAA 1PH2A 3HKZE 1QZGA 5F2DA 1EEID 2SNMA 1K83B 4IFDJ 1N36Q 4POFA 1D1KA 5FJ8H 3S15H 3E3XA 4B3TQ 1TIID 4DV1L 2N8NA 2YTXA 3KDFB 1PRTC 4BY7H 4RG1A 3L3OC 2OTJA 2JA7H 2HIVA 1YBYA 1YNXA 2RCFA 4LUVA 4ME5A 4G7OC 5ELFA 5KYLA 4QIWE 1STYA 5C4ZA 4NPSA 1YIJA 4C2MH 4HIOA 1JICA 3ULLA 2WKCA 1DGSA 1JC7A 4IUVA 1LABA 4JBKA 5C3EG 2N78A 3K80C 1JWUD 5BN3A 4RHSA 2IX3A 4FF3A 2EDGA 2N49A 1QUQB 1RHPA 4C3IH 1AFPA 4JI1L 2L5TA 4PMWA 5EBDA 3ITPA 4TQUS 1XWEA 2VQFL 3RR5A 1KQSA 4LF8L 4B9WA 4A3IH 2FINB 2ZXRA 2KEDA 4GKJQ 5LL6S 1QILA 4Z9CB 5JEAG 2I5MX 3PUYA 3DUZA 3AU7A 2BH2A 2D2CC 5I9OA 4M1UB 2NVTH 1D5XC 2IPKD 2KECA 3Q24A 2E2IB 3MZ5A 4KD3A 3NK9A 4KKTA 4CJ0B 4HJ7A 1W3SA 5E4WC 1IKMA 5I4DA 1HZBA 3T1YQ 4DR6Q 2A1AA 2VUMH 3H15A 1MJEA 3W5OA 1KHIA 1TWCB 4X66L 3U9SA 2DY7A 2K5NA 3G6JB 3S1MH 3PMFA 3CPFA 3GTPH 2L4NA 1KC8C 4A3FH 3GV6A 3K7UC 2G5DA 2A69C 4YCVA 1G8ZD 1SMYC 4KY5A 4A3JG 1Y1VG 4F8MA 2E8GA 1VF5C 4AYBE 1D5MC 4H13C 5EQ0A 1VQJA 1PMRA 4DR5Q 2L9HA 4OWXB 1HR0L 2E2JB 3I4NG 4A3KG 3ONAB 2JA5H 2F3IA 1RTOA 4MN3A 1TS4A 2JA8G 2QDLA 3CAMA 3D4DA 4A3GH 1Q81C 5C3WA 4IOAA 4JOIA 2CH4W 3DM1A 3PQIA 1PH6A 1SFOB 4NMZA 2EVBA 4PZ7A 2BA1A 2VQEL 3CCMA 3CMEA 3OYYA 1E22A 4UHVA 1XJVA 4DV3Q 3KYHC 3H91A 1KAWA 2J7ZA 1H9KA 1KAAA 2KUMA 4DUYL 4Q0FA 1HXYD 4Q5VA 3HOZH 5IT9c 4A3EB 1A15A 1QZHA 1YHBA 3GO5A 1N36L 3CC4A 3D4WA 2F0UA 3EIVA 2KENA 1B1ZA 4PZ6A 3C46A 1FL0A 1MI2A 4CJ2C 4V190 1LTLA 1TWGB 2Q2HA 3F2UA 2J0TD 2VB3X 3I56A 4LW1A 4DAMA 2NZ1D 1LTAD 1VQMA 4AYBG 2KHJA 3RN2A 3A56A 4U68A 1ICWA 4IPGA 2EJGC 1YNJC 2JA7B 2QF7A 3VR6A 4NXMQ 3MTSA 1CKMA 3PO2B 4JBMA 3R2TA 2MFIA 4FF1A 1BO0A 3IRBA 3CKIB 1U0LA 4IO9A 3E9HA 1C48A 3MA2B 1KDCA 2I46A 1RL2A 3BVGA 4XQNA 2CFMA 3PO3H 3EA6A 2NUCA 1WCMH 2KCMA 3M7NA 2KHSA 3J80L 3KJOA 2F0TA 1EZ8A 3C3LA 1Q8KA 1HUNA 4GKJL 1GUTA 3IKJA 4DN4M 1NJIC 5M3MG 3T53B 2YTYA 1FGBD 5KYIA 2SDFA 1HJPA 4KHPQ 3RZDB 1TS5A 2CWAA 2B2TA 3A7LA 2C9OA 3MEFA 3VDYA 2Z6BA 3T1YL 4G7ZC 4DR6L 1L0WA 1IHZA 4LF7L 4BBSG 4IUTA 3CD6A 1B53A 3PUVA 3W2DA 2ZTCA 1K3BC 3B6YA 1STHA 4H44C 4JI8Q 3PIP3 1KLUD 4JI2Q 1IL8A 1XTCD 1VMPA 2AWNA 4P73A 1YHQA 2F0FA 2B2VA 2PNRC 3S1MB 4HIKA 1T5XD 3K59A 3GTPB 1GXDC 2PYKA 5K36H 4A76A 4DR5L 1HZ9A 1Q82C 2AKWB 1RKNA 1VQDA 4RH6A 4J6HA 3HOVH 1K0RA 1TWFH 1B44D 4GOPA 3VA5A 1KRSA 4BBRH 1VQ7A 2D0PA 4P2CB 2JA5B 4GZYC 1SRUA 4WFN3 2LXKA 4YWMA 4LUOA 4DV3L 3D3RA 3ERQA 1FD7D 1WD1A 4EVOA 3A5UA 1LTSD 3NTIA 1BVSA 3CCJA 2F0EA 1SYBA 4I7ZC 4EQPA 3CHBD 1VQPA 3SK5A 5ELOA 2X6LA 2JA6B 3BU2A 3IFTA 1PZJD 2ZTDA 3K5MA 1JWMD 3GTQH 1UWVA 1TR5A 4OIKA 1RD9D 3Q23A 1YZ6A 3HOWB 2R93H 1VQNA 1EYGA 1HH2P 2XSCA 3BYYB 1L2FA 1XXGA 5CV8A 2EXZA 1EQVA 1STGA 4HCSA 3T16A 3LWUA 4IFDI 3SE0A 2IHEA 4NXML 2EJMA 2A74C 1EIFA 1TWHB 4FXDA 1ILPA 1IYVA 1W6KA 2JN4A 2NYZD 3M7GA 1PYSB 2VY3A 1WVLA 3Q0AA 5CV9A 1C8CA 3K5OA 1HTLD 2P5ZX 4HEDA 2PW5A 2K5VA 2KJXA 5IYBG 5T1IA 5GADC 1K28A 1HZCA 1IW7D 3A5ZB 3OHXC 1EY4A 4QB4A 3HS0C 2OF1A 5IOCA 1VQKA 4HSVA 1EOTA 1GUSA 1DD2A 2NB0A 3ER0A 2HHHQ 1CHPD 3F1ZA 1BBXC 1AN8A 1VQAA 3LNNA 1G291 3BYTB 4KD4A 3CC2A 2EOTA 1HHVA 2AHOB 2Q2UA 5M5WB 1TY0A 4RCOA 1PH3A 5IYDG 2UXCQ 4JI8L 5DEHA 5A2QL 3U58A 5IYCH 1GUWA 2ATWA 3CW2C 4JI2L 1ET6A 2MP1A 4UDUC 1EY9A 3KFUA 4JI6Q 2B8GA 5C3EB 1XYIA 4DA2A 2A6HD 2JSOA 2K05A 2K52A 3NBHB 5E3FA 1T9HA 4A3DH 3O13A 4ZLTF 3J7ZC 4BY1G 1SYEA 1YHAA 4HAEA 1RF2D 1BDOA 1A0IA 4RWSC 4KK7A 3TN2A 4YY3Q 2YTVA 3J7YW 4P74A 3HOVB 5C4XG 2F4VQ 4UP8A 3RNUA 1S5FD 4BBRB 2NTTA 1IZ6A 1Q3LA 3TBIB 3N6RA 1EYAA 2DY8A 4L63B 2UUBQ 1MKHA 1DXMA 4JCVE 4LF4Q 3C2PA 2PI2A 4UY8C 5J39A 4R9WA 3AB9A 1KNEA 1SE4A 3P75A 3E0EA 3MFYA 1EIHA 1VQCA 1FR3A 4YHHL 3GTJB 1NMFA 1CA5A 1TWAB 2IJ0A 1MD2D 2NZOA 3VYSA 2R7ZG 4CJ1B 4XQJA 2CCZA 2I5HA 2PNHA 1S5BD 1VQ5A 4HJ9A 2UU9Q 3GTGH 4B3RQ 4A3JB 1Y1VB 1EY6A 4NKLA 2BH8A 4DR3Q 1M90C 2J4XA 2Z1CA 5FJ8G 3KF6B 5ELNA 2KEEA 4EQOA 4I7AA 4XYQA 3J80E 4DV7Q 4LFAQ 4ILWA 3I4NB 4XXEA 4Y7NB 1ASYA 4BY7G 1SROA 1F2MA 2MO1A 4X6AH 2JA7G 2A73B 2HT1A 2JA8B 1SDFA 2F0PA 4O1NA 3AEVA 2SNSA 3H3VC 2SOBA 1WYDA 2OQ0A 1MJCA 2Q2IA 4YWLA 4APVA 2F0MA 2K5QA 1LT6D 3H94A 4RFBA 2WIIB 5ELCA 2EY2A 4JV5L 3ND9A 1JE5A 1STBA 5JVH3 1BCPB 4GNXC 2RSNA 3W3AA 2PO4A 5E1FA 4X3UA 3A74A 1STEA 1SAPA 2ZTEA 5IP7H 4R4OA 3PIOA 5M5YB 1GD7A 3N52A 1GO3E 4C3IG 1A2TA 3D4RA 4K8IA 3SK8A 5IE8A 1BOSA 4HIDA 1BCPF 3G4SA 5HGQA 4TKOB 4A3IG 2N3SA 2B2WC 2ZJRA 2KBNA 3PUXA 4R4TA 5EKKA 1F2ZA 3JAMi 2DN8A 2KCNA 1V1PA 3QOJA 5IGEA 3CCRA 2BCOA 3I7FA 3SGIA 5KRUA 3CCUA 3FP9A 2FJ2A 4PV1C 3W1GA 2VUMG 1QVFA 2MNAA 3A8KE 1QE6A 3CP0A 1SYGA 3PIPA 5HY6A 3I3CA 2VXWA 3HRZC 1SLJA 1HCZA 4OHJA 1N8RC 1I4HA 3UE1A 1EU3A 3FPUB 4A3FG 4A3DB 3K5NA 1TQOA 2F4VL 1JE4A 5M3MB 3T13A 4GOPB 2H4OA 2UUBL 3MXNB 1LT3D 1VQBA 2R7DA 4LF4L 2A19A 1EUJA 3CMAA 3NQIA 3KLSX 3GTMH 4WJ4A 1GHJA 1HUMA 2HCIA 2ICEC 3M4YA 2JA5G 1WJJA 2QGQA 5D3IB 3QWNA 2HCCA 1R9TB 5JJIA 1JQYD 1JOKA 3I91A 4IUPA 4BBSB 4A3GG 1RIPA 1PH7A 5M3FH 2K6AA 2WACA 4JPBW 4EX5A 1YJWA 1EEFD 2RDGA 5JPMC 3QOLA 3GTOB 3PUWA 1KL9A 2QILA 5I9PA 3BDOA 4WORA 5GROA 3VR4A 3HOZG 1PYBA 2UU9L 2CH4A 2UXBL 3GTLB 1A3TA 4DR3L 3GQBA 4GS3A 3BG3A 3GTGB 1E0BA 2DJFC 1G51A 2WKDA 1PTOB 4LFAL 3GTKH 5AJ3L 5I2YA 1A2UA 1E2VA 3S16B 5AFWA 1DJRD 2F0NA 3Q22A 3V2TA 3S2DH 2BDNA 1WTPA 4RA8A 2XRSD 4JI7Q 1A62A 2EY5A 3QB3A 2D0OA 2K4KA 1PRTD 2AMCB 3S1NB 2EYPA 1I4GA 3SXHA 4LNQA 4GN5A 1CSPA 1NE3A 4N8X1 1PTOC 5BR8Q 3J80c 5A2QE 4DR1Q 3PO3G 4A3CH 2N88A 1J8IA 3KLRA 2F0OA 2Z6KA 5IGGA 1WCMG 1I5FA 3BDCA 4C3HH 4ZKBB 4AH6A 3DWAA 1N33Q 1A3VA 4U673 2L12A 1OXTA 3TZUA 5DAUA 4B9XA 4CDCC 1JB3A 4JG2A 1H95A 1SEBD 1V1QA 1U4MA 2HIXA 4KHVA 2Z4HA 1XMOQ 1PH1A 2Z0SA 1BBWA 5CV6A 4LF9Q 4A93H 2CQOA 3I70A 1S5DD 4R8IA 2MJ8A 2FHTA 4B3SQ 4JC0A 3SHLA 1E2WA 2NVYB 4FXKC 5IGFA 3I73A 2FMCA 3TS2A 4QUFA 3TREA 4JI4Q 1LYLA 2NN6I 2E2HH 3EJIA 4B3MQ 4KY6A 5EBCA 5K36G 2RVLA 2F0QA 4DFAA 3S1RB 4IUUA 4R4CA 4IPHA 1Y8PB 3KLSA 5KNCA 2ZXOA 4F88A 3HOVG 4RKLA 1VQLA 3SVMA 1Y14B 2ES2A 4BBRG 4LF5Q 2A69D 1SMYD 3NBIA 3WOEA 2DGYA 3U4VA 3DEOA 4CKEA 5LMNW 3S1QB 3EQLC 4JYAL 4J15A 1OXVA 2H1EA 1VQFA 1SNQA 4QGUA 1K8OA 2JJQA 4A3BH 2BOSA 1CKNB 2XGTA 2ID0A 4RGOS 1PFBA 4A3LH 1B7YB 2ZM6Q 1HPCA 4QMGA 1OXSC 1YNNC 3DXJC 4OO1I 1X56A 2MO0A 4L5SA 1UEAB 4OL7A 3SK6A 5EAYA 4DK1A 4M8AA 1U4RA 1D8LA 2XRQD 1FJGQ 4BY1B 1XNQQ 1SN8A 1ASZA 1F9QA 2R93G 3IL8A 1I4XA 2ZXPA 3J7AV 3GTKB 4GN4B 3TSSA 1E1OA 3WDNA 5C4XB 1XNRQ 1TU2B 1SE2A 1RJTA 4DAVA 4FXGC 3ULJA 4JI7L 1S72A 3FKIH 4CDFC 2B63H 3K81C 4KN7C 4F7XA 3S2DB 5A35A 1B9NA 1DZ1A 1UE7A 4IFDH 3QO2A 3T1HQ 2WB1G 5BR8L 4NW2A 1PFNA 4HJ8A 2M00A 4KJOA 1BXTA 3GDEA 3DLLA 3A0JA 2CW0C 4DR1L 1YNJD 2PQAB 4KHZA 2YYZA 2NVQH 2KVMA 2B2UC 3OMCA 4ZAIA 4X3KA 1QCBD 4XTCS 2R7ZB 2OTLA 2RSOA 1N33L 4C3HB 1OXXK 5IWAQ 1B9MA 2KCCA 4S3SA 2AQ1B 1O7IA 2VB2X 3GP7A 1DOMA 4YCUA 3NQTA 4B3TL 2HQLA 2OWOA 2E75C 2NVXH 3S15B 1U4PA 1XMOL 4ODGA 4OONA 1VQ6A 4LF9L 3CCLA 2YV5A 4BY7B 1V1PB 5COYA 4KKSA 1V1OA 3D0FA 4A3MH 5JEAJ 4F87A 1BUVT 1QNUA 1A63A 5IYCG 4B3SL 1I4PA 4TSSA 4C2MB 4RHRA 3D8GA 2VL6A 2RBMA 3TMEA 1PFSA 4LF6Q 2PZTA 1L1OB 4IALA 5CBAE 4XDXA 4A75A 4IOCA 4JI4L 3LGJA 2A68C 2BA0A 3PIO3 4B3ML 3KBGA 3E0JA 3TZDA 4KY7A 1PA6A 4A3DG 3RLOA 4C3IB 4DAYA 1N34Q 2LMCB 2RF4A 1VQGA 3H6MA 1Z6HA 1ML0D 1DCZA 2B2YA 3E9IA 4A3IB 2L55A 2A6ED 2VZAA 1E7ZA 4FNFA 4DNIA 4V0BA 1L1OC 4HJAA 4UP7A 1QVCA 3STBC 3TEHB 3NHHA 3T56B 2NVTB 1IBKQ 4HCEA 4C3JH 3UI2A 3R3OA 4PMBA 4A3BB 1UE6A 2AUKA 3FEWX 5M5XH 2VUMB 2UXDQ 3OOCA 1K0SA 4XIGS 1CZGA 2V1CC 1SXTA 1QJOA 3TP5A 2K5WA 1FJGL 1XNQL 1YITA 1H9SB 3KBXA 3VYTA 1SYCA 3UDGA 5IGDA 2A6EC 1Q1EA 2QEJC 4A3FB 2LSSA 4CGYB 1EQRA 1XNRL 4ABNA 1XX8A 3VR2A 3AYHB 3I4MH 2WFWA 3S24A 1H9JA 4ZCKA 2LS01 5J3BA 1F2YA 3HG9A 1O80A 4RGNA 4O2DA 4ZRZA 1D2BA 1CSQA 4JI3Q 1QNKA 5TSSA 2MHVA 1PLFA 2QCPX 2E2DC 2F3VA 3T1HL 2D9UA 2X69A 1BR9A 2ICIA 4JI0Q 4A3GB 3ZYYX 2ENBA 1GOZA 1CQVA 2KHIA 5EJWA 2YU9H 5ELEA 3CCEA 1K8AC 1K9MC 4MTKA 3ZJYC 2O2LD 4C1NK 1NMGA 1X55A 5IWAL 3RUZA 4G57A 5LHY1 3HOZB 5ISRA 5IGCA 3Q6SA 2MPMA 4ALPA 1WTQA 1MGSA 5IP7G 3S17H 2GN5A 1G6PA 2JA9A 3TQYA 1LLRD 2G9HD 2HDLA 4IUQA 3DM3A 5CV4A 1KXLA 5DLQE 1JOQA 1FYCA 2OEOA 4DV0Q 1B2TA
chains in the Genus database with same CATH topology
1GJXA 1EY8A 1PXUA 3I72A 1KDBA 4A3MB 3JAML 1ESRA 4QCLA 3TP8A 1CTMA 1UUPA 1ENCA 4K5VA 1VCIA 5EKIA 1Z7TA 3PO3B 4K5WA 4JK1C 3LWEA 4G4KA 1WCMB 3G7LA 1ZKOA 4FP5D 1KLGD 3A7AB 2WP8J 1HFNA 2X6GA 4H0LC 2RDFA 3D31A 1JORA 4HMJA 1AEXA 1GUOA 1TVXA 5G3LD 5J1ZA 2EE1A 3BVMA 3PV0A 4EGVA 5DNFA 3TP6A 4HTHA 3C1FA 1AP0A 2JE6I 1X3QA 1OXUA 5IIFA 2F0SA 5C0XJ 5E4XA 2E76C 5I6YA 4KI0A 1HQMC 3OIPA 2RDHA 5C5LA 4OGQC 5D3DA 1TWFB 3R8BA 1ZYRC 3P7JA 1L0YB 4MIUA 2JYOA 2WINB 4C1NI 1S5ED 5KNDA 2F4IA 2EYOA 3BS1A 3DWPA 5LL6X 1WTXA 3NUCA 1QOHA 4E6IA 2O5JC 4TRDA 4IUNA 4C3HG 3GTQB 3S17B 5CYUA 2RQXA 1RODA 2R93B 3HP3A 1PZID 2LKVA 1IYUA 4NDXA 4FO2A 4KTAA 1M4VA 2XIWA 1I4QA 4HSPA 3ND8A 5I2XA 4JBWA 2FMMA 1I3QB 1SNDA 1F77A 3D6CA 2WB1B 5CGKA 3AMUA 1BCPD 2K03A 2F0KA 3EVQA 3QIAA 4LMQD 3QJYA 3MXUA 3MFGA 2IWHA 2NN6H 2PPBC 1LTRD 2QDBA 3K6OA 5JOBA 1ESFA 3OIQA 1EY0A 4ZYSA 5C0XH 4HN7A 2EY6A 1MSGA 1RTNA 3OWEB 1BCPC 3EROA 4ZUIA 2PCFB 2L1BA 4H7BA 4KV6A 1KTKA 1S5CD 4QUCA 4DK0A 2B2TC 3FMCA 1TY2A 4KJNA 3CRKC 2A5HA 4FVMA 4OO1H 4BWGB 1V43A 5D65A 1EZ6A 1I50B 4ZQ3A 2IT1A 1LO5D 2FFKB 1STAA 1HQRD 5D14A 3HOYB 1EWCA 5NUCA 1CI3M 2B2VC 2OXPA 4IFDG 4LJZC 3VYRA 2F0DA 4HR7B 5ELBA 1ZEQX 1AZQA 1Q1BA 5CC4A 3JAME 1Q90A 1EY5A 2Q8TA 3NWTA 4XT1B 2K1BA 1D5ZC 3DMUA 1ONLA 1PTOD 2PZWA 2AQ2B 4CKCA 1LT4D 3HZXA 2XVSA 3I90A 1NR2A 4K2KA 4MHEA 5CV5A 3L7ZC 3NWSA 3PUZA 1VDZA 4K6LA 4K8JA 3R2IA 2K04A 3GV3A 5DM63 1PZKD 3EFXD 2D62A 1JCKB 1CZWA 2NTSA 5I6WA 5KIXA 2V4DA 1VMCA 3R93A 4KMUC 4EQNA 1E2ZA 1SJED 4L8JA 4C3JG 1PRTF 2F0VA 4C56C 3U9OA 4DNTB 4OIJA 2DNEA 4NP5A 2WV6D 2DNCA 1EL0A 3QG1A 5FLXL 4RAUC 2PQEA 2MUYA 1YNND 2PMZB 1VF7A 2IX0A 4DGZA 1SJHD 1SYDA 2JP1A 1AZPA 3FRPB 3DHQA 5C0XI 5K5PA 1LTBD 1GUNA 3E5SA 2HDMA 2NWGA 3GTMB 2PW7A 4XT3B 2K5DA 4N9PA 2QKIC 5M3FB 3OW7A 3KUPA 3SEBA 1R4PB 3M3YB 1H9RA 4FYDA 3KK7A 1WTOA 1EWHA 1LV9A 1RCVD 4K5XA 3SK4A 1EFID 1Q12A 2CW0D 1R4QB 1SNOA 5M9OA 5FKAC 1PFMA 1F2LA 3MWYW 3X3NA 2R61A 1EYDA 1HTPA 2LY7A 1HA5A 2R92B 2CVRA 5C4JB 5J22A 3NBHA 3J7AF 3A55A 3VR3A 4ZUJA 3NTHA 1MSHA 3DEPA 3KF8A 4B08A 4J8QA 4YIJA 2EYJA 4RGTA 2K01A 1SNCA 3HEJA 3IAYA 2B8FA 1Y8NB 2EYHA 1Y1WB 2LFNA 2BDOA 1B3AA 3K0YA 4XYOA 4N9TA 1G2TA 2O5IC 1CFMA 1H9MA 1M8AA 2A68D 4PMCA 2EYFA 1BNZA 1IKLA 4DXFA 1CK1A 5FOBB 3MC0B 1NSNS 1FNWA 3J81L 2K32A 1I6HB 2XNAC 3X3MA 5KNBA 2KOLA 3K5LA 4A93B 1NCVA 1EY7A 3RD4A 3BDLA 1TKWB 1AW7A 1KNAA 1O7YA 2IW3A 2F3WA 3VR5A 5JPNC 3NSWA 1NAPA 1SSOA 3MXGA 4HMIA 5JJZA 5IGBA 2E2HB 1Z47A 4PQXA 4FF2A 4DAPA 3CQZB 5CR3A 2Q8IB 1QWYA 3BZDB 4CKBA 5C4HA 2Y0SB 2EJFC 2B2WA 1U9RA 5HGTA 3RLFA 1WTRA 4DNRB 1WTVA 4CHTB 3A8IE 5EKLA 3TDQA 4DF7A 5EPLA 1ILQA 1O7LA 2WAQB 3VYUA 1JOOA 3MVVA 1EIGA 1GUGA 1WTWA 1G6ZA 2Z4IA 1CQFA 5C6AA 2CHBD 5ELDA 1QB5D 3FKIB 3SDZA 1S4ZA 2B63B 3T51B 2EPBA 3GD7A 1HFGA 1CA6A 4G7HC 2EYLA 1NR4A 3P1HA 1G2SA 3OWFA 4WJWA 2NVQB 2D5DA 2TSSA 2IL8A 3BVZA 3TP7A 1SBBB 5JEAH 2EY1A 3MXNA 3SR1A 2E74C 3CU7A 4R8NA 2RA4A 4IQZA 5FLXE 2NN6G 2NVXB 2C5CA 3K7AB 2F0JA 1B4OA 3HOXB 5CBEE 5C0XG 1D1IA 4QF4A 3S2HB 1JWSD 1TS2A 2KA7A 2K7VA 4IZ8A 4X3TA 3I4LA 2O4XA 1J9OA 3MEHA 2IX1A 2L11A 4K14A 2RKSA 4OO1G 2F0WA 5HURA 4PNYA 3S14B 2HQEA 4X3SA 4KN4C 2K33A 2K28A 1EQTA 3T4AC 3NPPA 1STNA 5EPJA 2I07B 2M2LA 3FDTA 3NTKA 4C3JB 2KQ3A 1L0XB 1F9SA 5T1GA 1ZYRD 2JEAI 4I65A 5IT9L 3OPOA 1A3UA 4J1MA 5M5XB 1K8MA 2XWBB 1ENFA 1OO9B 1Q8IA 3MHBA 1I4RA 3E6ZX 4WRDA 3D6WA 3NE5B 3CRLC 3I4MB 1IW7C 2F0HA 5G3LF 1LTID 1MBYA 1DM0B 3V96A 3C1EA 3K58A 1LT5D 4DU9A 3HGBA 5C3XA 2CQAA 1O7ZA 1Y69U 2L0CA 1EYCA 1UAPA 4BA2I 2N55A 5KEEA 2YU9B 3J81E 1CM9A 1NUCA 1A6XA 3HKZB 1F9PA 3H09A 3OSOA 4RGMA 2F0GA 2TMPA 4ZKCB 4UAIA 3M85A 2AQ3B 2A6HC 1D6EC 1TS3A 2B39A 1I6VC 4QIWB 2MGSA 2OT2A 5CORA 1PDQA 1CT1D 3URYA 3A54A 2PZUA 3A8JE 2Q8RE 3OMGA 2NBFA 1PTOH 1O78A 4K6DA 5EPKA 2B2UA 4RCNA 4A3KB 1PYWD 2EYMA 2F1MA 2BE5D 1WD0A 4LK1C 3IFDA 1LTGD 3FPPA 4BS9A 1UNSA 5FO7B 2GA4B 5C44B 5CV7A 1GHKA 4FF4A 1U4LA 1KABA 1V8QA 3S9WA 1DOLA 1DONA 1SYFA 2AWOA 4O42A 1DOKA 1X3PA 2Z8LA 4XQQA 1T5EA 1G91A 1F9RA 1SNMA 1LTTD 2F0IA 3P20A 4DXGA 1DYQA 2BE5C 2B2YC 3V05A 1SNPA 2JEBI 4AYBB 1LACA 1BQQT 4BA1I 2EZVA 2AUJD 3RZOB 1HRJA 5KGUA 4RKBA 3RMHA 1C4QA 2F03A 4IURA 4ZK9B 5FO9B 4LAAA 1BF4A 2R3ZA 1QG7A 1FNVA 4IN3A 5EGTA 4K2LA 1EU4A 5FK9C 3MAQA 1ET9A 2M9VA 4L6TB 3LX0A 1SE3A 5BN4A 1ENAA 3WOFA 1B50A 1ZXTA 4ULLA 1W6JA 1Y8OB 1RDPD 5IODA 4ID6A 3HOUB 2G9DA 1H9SA 4KKUA 5DM73 3K57A 1CHQD 2VNUD 3FVQA 3DWQA 5FO8B 1FNUA 5JAVA 2JXMB 1PTOF 5IT9E 5JVG3 2R6GA 5C5MA 3NP8A 2HUGA 4CBVA 1JR0D 2SEBD 1TT2A 3NXWA 2XN9C 2F0LA 1II3A 5BN5A 1X32A 2ZT9C 3L9AX 1HA6A 1PRTB 5CMDA 3M4OB 2XWJB 3MXPA 3H0GB 3I8ZA 3VA7A 1KDAA 5F2DA 1EEID 2SNMA 1K83B 4IFDJ 1D1KA 1TIID 1PRTC 3L3OC 4ME5A 4G7OC 5ELFA 5KYLA 1STYA 5C4ZA 1JICA 2WKCA 1JC7A 4IUVA 1LABA 1JWUD 5BN3A 4RHSA 2IX3A 4FF3A 2EDGA 1RHPA 1AFPA 2L5TA 4PMWA 5EBDA 3ITPA 4TQUS 1XWEA 4B9WA 2FINB 2ZXRA 2KEDA 5LL6S 1QILA 4Z9CB 5JEAG 3PUYA 3DUZA 3AU7A 2D2CC 5I9OA 4M1UB 1D5XC 2IPKD 2KECA 3Q24A 2E2IB 3MZ5A 4KD3A 3NK9A 4KKTA 4CJ0B 1IKMA 5E4WC 5I4DA 1TWCB 3U9SA 2DY7A 3G6JB 3PMFA 2L4NA 3GV6A 2A69C 1G8ZD 1SMYC 4KY5A 4F8MA 1VF5C 1D5MC 4H13C 5EQ0A 1PMRA 2L9HA 2E2JB 3ONAB 1RTOA 4MN3A 1TS4A 3D4DA 5C3WA 3DM1A 1SFOB 4NMZA 2EVBA 2BA1A 3H91A 2J7ZA 1H9KA 1KAAA 2KUMA 4Q0FA 1HXYD 4Q5VA 4A3EB 1A15A 3GO5A 3D4WA 2F0UA 1B1ZA 3C46A 1MI2A 4CJ2C 4V190 1TWGB 3F2UA 2J0TD 2VB3X 2NZ1D 1LTAD 3A56A 4U68A 1ICWA 2EJGC 1YNJC 2JA7B 2QF7A 3VR6A 3MTSA 3PO2B 3R2TA 4FF1A 1BO0A 3CKIB 1C48A 3MA2B 1KDCA 2I46A 3BVGA 4XQNA 3EA6A 2NUCA 3M7NA 2KHSA 3J80L 2F0TA 1EZ8A 3C3LA 1HUNA 1GUTA 3IKJA 4DN4M 3T53B 1FGBD 5KYIA 2SDFA 3RZDB 1TS5A 2B2TA 3A7LA 2C9OA 4G7ZC 1IHZA 4IUTA 1B53A 3PUVA 3W2DA 1STHA 4H44C 3PIP3 1KLUD 1IL8A 1XTCD 1VMPA 2AWNA 2F0FA 2B2VA 2PNRC 3S1MB 1T5XD 3K59A 3GTPB 1GXDC 2PYKA 5K36H 1RKNA 4RH6A 4J6HA 1B44D 3VA5A 4P2CB 2JA5B 4GZYC 4WFN3 3D3RA 3ERQA 1FD7D 1WD1A 4EVOA 1LTSD 3NTIA 2F0EA 1SYBA 4I7ZC 4EQPA 3CHBD 3SK5A 2JA6B 2X6LA 3IFTA 1PZJD 3K5MA 1JWMD 1TR5A 4OIKA 1RD9D 3Q23A 3HOWB 2XSCA 3BYYB 5CV8A 1XXGA 2EXZA 1EQVA 1STGA 4HCSA 3T16A 3LWUA 4IFDI 3SE0A 2EJMA 2A74C 1TWHB 4FXDA 1ILPA 1IYVA 1W6KA 2NYZD 3M7GA 1WVLA 3Q0AA 5CV9A 1C8CA 3K5OA 1HTLD 4HEDA 2PW5A 2KJXA 5T1IA 3OHXC 1IW7D 1EY4A 4QB4A 3HS0C 2OF1A 5IOCA 4HSVA 1EOTA 1GUSA 1DD2A 2NB0A 1CHPD 1BBXC 1AN8A 3LNNA 1G291 3BYTB 4KD4A 2EOTA 1HHVA 5M5WB 1TY0A 4RCOA 5DEHA 5A2QL 1GUWA 1ET6A 2MP1A 4UDUC 1EY9A 2B8GA 5C3EB 1XYIA 4DA2A 2A6HD 2JSOA 2K05A 5E3FA 3O13A 4ZLTF 1SYEA 4HAEA 1RF2D 1BDOA 4RWSC 3TN2A 4KK7A 3J7YW 3HOVB 1S5FD 4BBRB 2NTTA 3TBIB 1Q3LA 3N6RA 1EYAA 2DY8A 4L63B 1DXMA 3C2PA 5J39A 4R9WA 3AB9A 1KNEA 1SE4A 3P75A 3MFYA 1EIHA 1FR3A 3GTJB 1CA5A 1TWAB 2IJ0A 1MD2D 3VYSA 4CJ1B 4XQJA 1S5BD 4A3JB 1Y1VB 1EY6A 4NKLA 2J4XA 2Z1CA 2KEEA 4EQOA 4XYQA 3J80E 4ILWA 3I4NB 4XXEA 4Y7NB 1F2MA 2A73B 2JA8B 1SDFA 2F0PA 4O1NA 2SNSA 3H3VC 2SOBA 2F0MA 2K5QA 1LT6D 3H94A 4RFBA 2WIIB 5ELCA 2EY2A 3ND9A 1STBA 5JVH3 1BCPB 2RSNA 3W3AA 2PO4A 5E1FA 4X3UA 1STEA 1SAPA 5M5YB 3N52A 4C3IG 1A2TA 3D4RA 4K8IA 3SK8A 1BOSA 1BCPF 4TKOB 2B2WC 3PUXA 5EKKA 1F2ZA 2DN8A 2KCNA 1V1PA 3QOJA 5IGEA 2BCOA 5KRUA 2FJ2A 4PV1C 3A8KE 1QE6A 1SYGA 3I3CA 2VXWA 3HRZC 4OHJA 1HCZA 1I4HA 1EU3A 3FPUB 4A3DB 3K5NA 1TQOA 1JE4A 5M3MB 3T13A 2H4OA 1LT3D 3NQIA 3KLSX 1GHJA 1HUMA 2HCIA 2ICEC 3M4YA 5D3IB 3QWNA 2HCCA 1R9TB 1JQYD 1JOKA 3I91A 4IUPA 4BBSB 2K6AA 2WACA 1EEFD 2RDGA 5JPMC 3QOLA 3GTOB 3PUWA 2QILA 5I9PA 3BDOA 4WORA 3VR4A 3GTLB 1A3TA 3GQBA 3BG3A 3GTGB 1E0BA 2WKDA 1PTOB 5I2YA 1A2UA 1E2VA 3S16B 5AFWA 1DJRD 2F0NA 3Q22A 3V2TA 2BDNA 1WTPA 4RA8A 2XRSD 2EY5A 3QB3A 1PRTD 3S1NB 2EYPA 1I4GA 3SXHA 1PTOC 5A2QE 2N88A 1J8IA 3KLRA 2F0OA 5IGGA 3BDCA 4ZKBB 3DWAA 1A3VA 4U673 2L12A 1OXTA 3TZUA 5DAUA 4B9XA 1JB3A 1SEBD 4KHVA 1U4MA 2Z4HA 5CV6A 3I70A 1S5DD 4R8IA 2MJ8A 2FHTA 3SHLA 1E2WA 2NVYB 4FXKC 5IGFA 3I73A 2FMCA 4QUFA 2NN6I 3EJIA 5K36G 4KY6A 5EBCA 2RVLA 2F0QA 4DFAA 3S1RB 4IUUA 1Y8PB 3KLSA 5KNCA 2ZXOA 4F88A 4RKLA 3SVMA 2A69D 1SMYD 3NBIA 3WOEA 3DEOA 4CKEA 3S1QB 3EQLC 1OXVA 2H1EA 1SNQA 1K8OA 2BOSA 2ID0A 4RGOS 1PFBA 1HPCA 4QMGA 1OXSC 1YNNC 3DXJC 4OO1I 1UEAB 4OL7A 3SK6A 4DK1A 4M8AA 1U4RA 2XRQD 4BY1B 1F9QA 3IL8A 1I4XA 2ZXPA 3J7AV 3GTKB 3TSSA 3WDNA 5C4XB 1TU2B 1SE2A 1RJTA 4DAVA 4FXGC 3S2DB 4KN7C 4F7XA 5A35A 1B9NA 1DZ1A 4IFDH 3QO2A 4NW2A 1PFNA 2M00A 4KJOA 1BXTA 2CW0C 1YNJD 4KHZA 2YYZA 2KVMA 2B2UC 3OMCA 4ZAIA 4X3KA 1QCBD 4XTCS 2R7ZB 2RSOA 4C3HB 1OXXK 1B9MA 2KCCA 4S3SA 2AQ1B 2VB2X 3GP7A 1DOMA 3NQTA 2E75C 3S15B 1U4PA 4ODGA 4BY7B 1V1PB 5COYA 4KKSA 1V1OA 5JEAJ 4F87A 1BUVT 1QNUA 1I4PA 4TSSA 4C2MB 4RHRA 3D8GA 2RBMA 3TMEA 2PZTA 4IALA 5CBAE 4XDXA 2A68C 2BA0A 3PIO3 3KBGA 3E0JA 3TZDA 4KY7A 4C3IB 4DAYA 2LMCB 3H6MA 1Z6HA 1ML0D 1DCZA 2B2YA 4A3IB 2L55A 2A6ED 4FNFA 4V0BA 3NHHA 3T56B 2NVTB 4HCEA 3UI2A 3R3OA 4PMBA 4A3BB 2AUKA 3FEWX 2VUMB 3OOCA 4XIGS 1CZGA 1SXTA 1QJOA 3TP5A 2K5WA 1H9SB 3KBXA 3VYTA 1SYCA 5IGDA 2A6EC 1Q1EA 2QEJC 4A3FB 4CGYB 4ABNA 1XX8A 3VR2A 1H9JA 2LS01 1F2YA 3HG9A 1O80A 4RGNA 4ZRZA 1D2BA 1QNKA 5TSSA 2MHVA 1PLFA 2QCPX 2E2DC 2F3VA 2D9UA 2X69A 1BR9A 2ICIA 4A3GB 3ZYYX 2ENBA 1GOZA 1CQVA 5EJWA 5ELEA 2O2LD 4C1NK 3RUZA 4G57A 5LHY1 3HOZB 5ISRA 5IGCA 3Q6SA 2MPMA 1WTQA 1MGSA 1LLRD 2G9HD 2HDLA 4IUQA 5CV4A 1JOQA 1FYCA 2OEOA 1B2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUT A;  5D14 A;  1G91 A;  1SDF A;  1B53 A;  1F9R A;  1EL0 A;  3DEO A;  4HSV A;  1EOT A;  3TZD A;  2B2Y C;  2IL8 A;  1X32 A;  1HA6 A;  2B2V C;  2H1E A;  4RAU C;  1E0B A;  5CMD A;  1ESR A;  5EQ0 A;  1BBX C;  2L9H A;  2KOL A;  1IL8 A;  1ROD A;  1O7Z A;  1NCV A;  5AFW A;  1PFB A;  1ML0 D;  1VMP A;  2B2Y A;  2RA4 A;  3I8Z A;  2B2V A;  2EOT A;  3HP3 A;  3ONA B;  1HHV A;  2N55 A;  1AZQ A;  1AZP A;  2JP1 A;  1KNA A;  1O7Y A;  5EKI A;  1CM9 A;  1RTO A;  4MN3 A;  2RSN A;  2XIW A;  1F9P A;  2BDN A;  4X3U A;  1SAP A;  1WTP A;  4RA8 A;  3LWE A;  3DM1 A;  3N52 A;  2Q8T A;  2HDM A;  1GUW A;  1U4R A;  1B4O A;  2FMM A;  2MP1 A;  2K1B A;  2NWG A;  3G7L A;  4XT1 B;  3UI2 A;  1HRJ A;  5CBE E;  4XT3 B;  1F9Q A;  3H91 A;  1NAP A;  1SSO A;  2J7Z A;  3IL8 A;  4ZKC B;  5JJZ A;  4IUR A;  1XYI A;  4ZK9 B;  2KUM A;  4UAI A;  2B2W C;  2K05 A;  3KUP A;  1A15 A;  1BF4 A;  2R3Z A;  1HFN A;  1QG7 A;  1RJT A;  2N88 A;  2X6G A;  3I90 A;  1NR2 A;  1J8I A;  4X3T A;  1J9O A;  1WTO A;  1MI2 A;  4CJ2 C;  4MHE A;  4ZLT F;  2B2W A;  2L11 A;  3KBX A;  1TVX A;  1JIC A;  1LV9 A;  3F2U A;  2MGS A;  4ZKB B;  1IKM A;  1DZ1 A;  2K03 A;  2EE1 A;  4IUV A;  4HAE A;  4LMQ D;  5COR A;  3QO2 A;  1PDQ A;  1WD1 A;  3TN2 A;  4RWS C;  5DNF A;  1WTR A;  2NZ1 D;  2FFK B;  2L12 A;  4NW2 A;  1PFN A;  2FJ2 A;  1XX8 A;  4U68 A;  1WTV A;  1ICW A;  1QE6 A;  1PFM A;  1F2L A;  2K04 A;  3GV3 A;  2X6L A;  1Q3L A;  1O80 A;  2KVM A;  2B2U C;  1U4M A;  3MWY W;  3I3C A;  4ZAI A;  2VXW A;  3MTS A;  1RHP A;  4X3K A;  4X3S A;  2DY8 A;  1AP0 A;  1QNK A;  1X3Q A;  2K28 A;  2Q8R E;  1B50 A;  4OIK A;  5EPL A;  1PLF A;  2RSO A;  1EQT A;  1ZXT A;  3FPU B;  5EPK A;  2D9U A;  1ILQ A;  2B2U A;  2X69 A;  1BO0 A;  2CVR A;  5EPJ A;  1MSG A;  1DOK A;  2M2L A;  1RTN A;  1KNE A;  4R9W A;  1JE4 A;  4R8I A;  1EIG A;  1DOM A;  2FIN B;  2KED A;  3FDT A;  5E4X A;  5EJW A;  2MJ8 A;  3GV6 A;  4HCS A;  2FHT A;  1EIH A;  1VMC A;  1U4P A;  2L1B A;  3R93 A;  1WTW A;  1F9S A;  1ILP A;  1MSH A;  3DEP A;  1CA5 A;  1G6Z A;  5T1G A;  1WD0 A;  2KEC A;  2NYZ D;  1HUM A;  2HCI A;  2K01 A;  3IFD A;  4CJ1 B;  4QUF A;  2HCC A;  3P7J A;  5COY A;  1WVL A;  2JYO A;  4CJ0 B;  3Q6S A;  2MPM A;  3I91 A;  4IUP A;  4QUC A;  1MGS A;  5E4W C;  2B2T C;  1WTQ A;  1HUN A;  4DN4 M;  2RVL A;  1B3A A;  4IUU A;  1S4Z A;  1C8C A;  1U4L A;  2HDL A;  2SDF A;  1G2T A;  2EPB A;  2KEE A;  4IUQ A;  1HFG A;  2DY7 A;  1DOL A;  4HED A;  2B2T A;  1M8A A;  5D65 A;  1CA6 A;  1DON A;  1WTX A;  3SVM A;  5CBA E;  4O42 A;  4XDX A;  1NR4 A;  5T1I A;  1BNZ A;  1B2T A;  1IKL A;  3D6W A;  2L4N A;  4OIJ A;  1G2S A;  2HUG A;  1X3P A; 
#chains in the Genus database with same CATH topology
 3Q8D A;  1S40 A;  1GJX A;  4P71 A;  5E7N A;  1EY8 A;  1PXU A;  1IYJ B;  3I72 A;  1KDB A;  4A3M B;  1I3Q H;  2DJG C;  3JAM L;  1ESR A;  4LF6 L;  4MNO A;  4QCL A;  1J6Q A;  4CDD C;  3TP8 A;  3BZK A;  1CTM A;  1UUP A;  1ENC A;  4K5V A;  1VCI A;  5EKI A;  4DV4 Q;  1Z7T A;  4IPD A;  3PO3 B;  4K5W A;  4JK1 C;  3LWE A;  4G4K A;  1WCM B;  1N34 L;  4P72 A;  1JJ2 A;  3G7L A;  3UDX A;  4WJ3 M;  3WWV A;  1ZKO A;  4FP5 D;  1KLG D;  1SE8 A;  3A7A B;  2WP8 J;  4KHP L;  1K3R A;  3J81 i;  1HFN A;  2X6G A;  4H0L C;  5C44 H;  2RDF A;  3D31 A;  1JOR A;  4HMJ A;  1AEX A;  1GUO A;  1TVX A;  5G3L D;  5J1Z A;  2EE1 A;  3BVM A;  4HJ5 A;  4DV6 Q;  3PV0 A;  4EGV A;  5DNF A;  2F52 A;  5M3F G;  3TP6 A;  4HTH A;  1BBU A;  3C1F A;  1AP0 A;  1XPR A;  2JE6 I;  1X3Q A;  1OXU A;  1PH4 A;  3RLN A;  5IIF A;  2F0S A;  1YI2 A;  5C0X J;  1B8A A;  5E4X A;  1KD1 C;  2E76 C;  5I6Y A;  3PF4 A;  4KI0 A;  1HQM C;  3OIP A;  4OEM B;  1EIY B;  1FGU A;  1I50 H;  2RDH A;  3W1B A;  5C5L A;  4OGQ C;  5D3D A;  1TWF B;  2EIF A;  3HOY H;  3R8B A;  1ZYR C;  3P7J A;  1L0Y B;  4JI0 L;  4MIU A;  2JYO A;  2WIN B;  4H02 A;  1X6O A;  3J80 i;  1J5E Q;  4C1N I;  1S5E D;  5KND A;  4LUZ A;  2F4I A;  2EYO A;  3BS1 A;  3DWP A;  5LL6 X;  2ZJQ A;  1WTX A;  3NUC A;  1XPU A;  1QOH A;  1Q46 A;  4E6I A;  2O5J C;  4A3C G;  4TRD A;  4IUN A;  3UE0 A;  4C3H G;  5FLM H;  3GTQ B;  4GKK Q;  3S17 B;  5CYU A;  2RQX A;  1ROD A;  2R93 B;  1VQ4 A;  5IP9 H;  4DV0 L;  4JOI C;  4YCW A;  4X62 Q;  3HP3 A;  1PZI D;  2LKV A;  1IYU A;  4NDX A;  4FO2 A;  3CCQ A;  4KTA A;  1TXY A;  1M4V A;  2XIW A;  1I4Q A;  4HSP A;  3ND8 A;  5I2X A;  1PH9 A;  4JBW A;  2FMM A;  2I5L X;  5GAE C;  1I3Q B;  4A93 G;  3HOU H;  4PG3 A;  1SND A;  1F77 A;  3D6C A;  3UDI A;  3M4Q A;  2WB1 B;  3CPW A;  4DV4 L;  4QJF A;  2LXJ A;  5CGK A;  3F2B A;  1XPO A;  3FHW A;  3AMU A;  1BCP D;  4IJH A;  3F2D A;  2K03 A;  2F0K A;  3EVQ A;  3QIA A;  4LMQ D;  2QA4 A;  3QJY A;  4DAY B;  2HHH L;  1U5K A;  4LFC Q;  3MXU A;  1X3F A;  1N32 Q;  1GKH A;  3MFG A;  2IWH A;  2NN6 H;  2R7F A;  2PPB C;  1LTR D;  4DV6 L;  3H3V I;  2QDB A;  3K6O A;  5JOB A;  2UXC L;  1ESF A;  3OIQ A;  1EY0 A;  4ZYS A;  3PF5 A;  5C0X H;  4HN7 A;  1EWI A;  3H0G H;  3HKS A;  2EY6 A;  1MHW C;  1MSG A;  1RTN A;  3OWE B;  1VQ8 A;  1BCP C;  3ERO A;  4JI6 L;  4ZUI A;  4JVZ A;  4A3B G;  2PCF B;  2L1B A;  1K83 H;  4H7B A;  4KV6 A;  1KTK A;  1S5C D;  4A3L G;  1S3O A;  2DUD A;  1EOV A;  2WAQ G;  4QUC A;  4DK0 A;  2B2T C;  3FMC A;  1TY2 A;  4KJN A;  3CRK C;  4DV1 Q;  2A5H A;  4FVM A;  4YY3 L;  4OO1 H;  4BWG B;  1C9O A;  1V43 A;  5D65 A;  1EZ6 A;  1I50 B;  4ZQ3 A;  2IT1 A;  4R1J A;  1LO5 D;  2FFK B;  1STA A;  3G48 A;  1HQR D;  1E24 A;  5D14 A;  3HOY B;  1EWC A;  5NUC A;  2B29 A;  1CI3 M;  3FKI G;  1YJN A;  2B63 G;  2B2V C;  2OXP A;  4IFD G;  2CKZ B;  4LJZ C;  3VYR A;  1HNZ Q;  2F0D A;  3OTO Q;  4HR7 B;  5ELB A;  3M3Y H;  1ZEQ X;  1AZQ A;  1Q1B A;  1Z9F A;  2QW7 A;  5CC4 A;  1K73 C;  3JAM E;  1Q90 A;  1EY5 A;  4GKK L;  4GOP C;  2Q8T A;  3NWT A;  4XT1 B;  2K1B A;  4LWC A;  4B3R L;  4DPG A;  2K50 A;  1D5Z C;  4X62 L;  3DMU A;  1BKB A;  2RHQ B;  1ONL A;  1PTO D;  2E2I H;  4BXX G;  2PZW A;  2AQ2 B;  4CKC A;  4DV7 L;  1LT4 D;  4R4Q A;  3HZX A;  2XVS A;  3I90 A;  1NR2 A;  4K2K A;  4MHE A;  5CV5 A;  1TWC H;  3L7Z C;  2R92 H;  3NWS A;  3NEN A;  3PUZ A;  1VDZ A;  4K6L A;  2L15 A;  1QVG A;  4A3M G;  5C4J H;  4JBJ A;  4K8J A;  2OCE A;  4L5R C;  4JI5 Q;  3R2I A;  2K04 A;  3GV3 A;  5DM6 3;  1PZK D;  3EFX D;  4YWK A;  2D62 A;  1JCK B;  2E2J H;  1Y1W H;  1CZW A;  2Q2T A;  2NTS A;  4LFC L;  4TVA B;  1LM0 A;  5I6W A;  1VS0 A;  5KIX A;  2V4D A;  1VMC A;  3AFQ A;  1KIX A;  1GVP A;  3R93 A;  5IY0 A;  1SFO H;  4RMF A;  2B3G A;  4KMU C;  1Q86 C;  4EQN A;  1I6H H;  1E2Z A;  1SJE D;  4OXP A;  4L8J A;  4A3E H;  2RCN A;  4C3J G;  3QR8 A;  5LMN Q;  1PRT F;  1D7Q A;  4DUY Q;  2F0V A;  4C56 C;  3U9O A;  1TWG H;  4DNT B;  4OIJ A;  2DNE A;  4NP5 A;  4DK3 C;  2WV6 D;  2DNC A;  1EL0 A;  3QG1 A;  4IJL A;  5FLX L;  4RAU C;  4OWW B;  3U50 C;  2PQE A;  2MUY A;  1HR0 W;  3PO2 H;  1PH8 A;  1B70 B;  3CQZ H;  1E3P A;  1YNN D;  3BZC A;  2PMZ B;  1VF7 A;  2IX0 A;  4DGZ A;  1SJH D;  1SYD A;  2JP1 A;  1AZP A;  3I4M G;  3FRP B;  3DHQ A;  5C0X I;  2E5L Q;  3G71 A;  5K5P A;  1LTB D;  1AE2 A;  1GUN A;  3E5S A;  2HDM A;  1VQ9 A;  4L5T A;  2NWG A;  3GTM B;  3EN2 A;  1XMQ Q;  2GVA A;  2PW7 A;  4XT3 B;  1HNZ L;  2K5D A;  3OTO L;  2WB1 E;  4N9P A;  2CWP A;  2QKI C;  5M3F B;  3OW7 A;  3KUP A;  3SEB A;  1R4P B;  3M3Y B;  5JJK A;  1H9R A;  3HKZ G;  4FYD A;  4DV5 Q;  1VQO A;  3KK7 A;  1WTO A;  1EWH A;  1LV9 A;  1RCV D;  4K5X A;  3SK4 A;  3RZD H;  2IY5 B;  1EFI D;  3HFZ B;  1Q12 A;  2CW0 D;  1R4Q B;  1SNO A;  2IHF A;  5M9O A;  1PFM A;  1F2L A;  5FKA C;  1UE5 A;  1Q7Y C;  3MWY W;  3X3N A;  2R61 A;  4LF7 Q;  1YJ9 A;  1JJG A;  3K8A A;  4P75 A;  3JAM c;  1EYD A;  3F2C A;  1HTP A;  2LY7 A;  1HA5 A;  2R92 B;  2CVR A;  5GQO A;  2A8V A;  4JI5 L;  5C4J B;  5J22 A;  3NBH A;  2KCT A;  3J7A F;  1GM5 A;  3A55 A;  3VR3 A;  4ZUJ A;  3NTH A;  1MSH A;  3DEP A;  3KF8 A;  4J8Q A;  4B08 A;  4YIJ A;  2EYJ A;  4RGT A;  2K01 A;  1SNC A;  3HEJ A;  3IAY A;  2B8F A;  1Y8N B;  2MQH A;  2EYH A;  4JW0 A;  1Y1W B;  2LFN A;  2BDO A;  4X64 Q;  1B3A A;  3K0Y A;  4XYO A;  4N9T A;  1G2T A;  2O5I C;  1CFM A;  1H9M A;  1M8A A;  4BXX H;  4HIM A;  2A68 D;  4PMC A;  2EYF A;  1BNZ A;  3I4O A;  1IKL A;  4DXF A;  1CK1 A;  2OQK A;  5FOB B;  3K7A H;  1VQI A;  3MC0 B;  5C44 G;  1NSN S;  1FNW A;  3ICE A;  3J81 L;  2K32 A;  5LMN L;  3HOX H;  1I6H B;  3AFP A;  4UP9 A;  2JA6 H;  2XNA C;  3X3M A;  5KNB A;  2KOL A;  4O0A A;  1PVO A;  3K5L A;  3S2H H;  1NCV A;  1V9P A;  4A93 B;  1EY7 A;  3RD4 A;  3BDL A;  1TKW B;  1AW7 A;  3HOW H;  1HNX Q;  1KNA A;  1O7Y A;  2IW3 A;  2F3W A;  3STB D;  3VR5 A;  5JPN C;  1WFQ A;  3L2P A;  1PH5 A;  1M1K C;  3NSW A;  2UUC Q;  3KF6 A;  1C0A A;  1JB7 A;  4GNX A;  1TWH H;  1NAP A;  1SSO A;  1X54 A;  3MXG A;  4HMI A;  5JJZ A;  5IGB A;  2E2H B;  1MIU A;  1Z47 A;  4PQX A;  2E5L L;  4FF2 A;  4DAP A;  3CQZ B;  5CR3 A;  2Q8I B;  1QWY A;  3BZD B;  4CKB A;  5C4H A;  3S14 H;  2Y0S B;  4LF5 L;  3PGZ A;  1XMQ L;  2EXD A;  2EJF C;  2B2W A;  3HOY G;  1U9R A;  5HGT A;  2GVB A;  3RLF A;  1WTR A;  4DNR B;  1CKO A;  1N9W A;  1WTV A;  4CHT B;  4DV5 L;  3A8I E;  2ZM6 L;  1HNW Q;  5EKL A;  3TDQ A;  4DF7 A;  5EPL A;  4Y52 H;  1ILQ A;  1O7L A;  2WAQ B;  3VYU A;  1JOO A;  3MVV A;  1EIG A;  5M5W H;  4QY7 A;  5FLM G;  5JJL A;  1GUG A;  1WTW A;  1G6Z A;  2Z4I A;  1CQF A;  5IP9 G;  1UEB A;  4DV2 Q;  1WOC A;  1YVC A;  5C6A A;  5C3E H;  1IBM Q;  2CHB D;  5ELD A;  1QB5 D;  2UUA Q;  3FKI B;  3SDZ A;  1S4Z A;  2JQO A;  2B63 B;  3T51 B;  2EPB A;  3GD7 A;  4K0K Q;  1HFG A;  3HOU G;  1CA6 A;  4G7H C;  2EYL A;  4OX9 Q;  1NR4 A;  3P1H A;  1G2S A;  3OWF A;  4WJW A;  3BJU A;  4X64 L;  2NVQ B;  2D5D A;  2TSS A;  2QEX A;  1FVI A;  2IL8 A;  3BVZ A;  3TP7 A;  1SBB B;  5JEA H;  2EY1 A;  3MXN A;  3SR1 A;  1X65 A;  2E74 C;  4NXN Q;  3CU7 A;  4R8N A;  4MZ9 A;  2RA4 A;  2PMZ E;  4OEL B;  3K0X A;  3M9B A;  1XTD A;  4IQZ A;  1NTG A;  5FLX E;  2NN6 G;  2NVX B;  2C5C A;  3K7A B;  2F0J A;  1B4O A;  2PI2 E;  3HOX B;  4LFB Q;  5CBE E;  2K14 A;  3M4P A;  1LUZ A;  5C0X G;  3GTJ H;  1D1I A;  4QF4 A;  1TWA H;  3H0G G;  1HNX L;  2Z6K C;  3KLW A;  1JWS D;  4YHH Q;  3S2H B;  3H3V H;  1TS2 A;  2KA7 A;  4KLK A;  2K7V A;  1CUK A;  4IZ8 A;  4X65 Q;  3NEM A;  4A3J H;  4X3T A;  1Y1V H;  2UUC L;  3I4L A;  2O4X A;  1J9O A;  3MEH A;  2IX1 A;  5LMU Q;  3AQQ A;  2L11 A;  3EBE A;  5H1S E;  1EQQ A;  3I4N H;  4K14 A;  3CCS A;  4Y7N H;  4A3K H;  2RKS A;  4OO1 G;  2JA8 H;  2H5X A;  2F0W A;  5HUR A;  4PNY A;  3S14 B;  2HQE A;  4X3S A;  4KN4 C;  3KJP A;  2K33 A;  3OW2 A;  2K28 A;  3U4Z A;  1I94 Q;  1EQT A;  4POG A;  3T4A C;  3NPP A;  4DR7 Q;  1STN A;  1IBK L;  4A4I A;  5EPJ A;  2XTI A;  2I07 B;  2M2L A;  4GLX A;  3FDT A;  3NTK A;  2HD3 A;  3CF5 A;  1HNW L;  1AH9 A;  4C3J B;  2KQ3 A;  1L0X B;  1F9S A;  4JV5 Q;  5M5Y H;  1SMX A;  5T1G A;  2UXD L;  2ASB A;  3JC6 6;  2C35 B;  1ZYR D;  2JEA I;  4I65 A;  1P8L A;  5IT9 L;  1SR3 A;  1JT8 A;  3OPO A;  1A3U A;  4J1M A;  3F8T A;  5M5X B;  1K8M A;  1PHJ A;  2XWB B;  1ENF A;  2VW9 A;  1OO9 B;  1Q8I A;  3MHB A;  1I4R A;  3E6Z X;  3TRZ A;  3I55 A;  4WRD A;  3KDF A;  4DV2 L;  2ZJP A;  3D6W A;  1E1T A;  1ICF B;  3NE5 B;  4DUZ Q;  1IBM L;  3CRL C;  4CDE C;  3I4M B;  4JI3 L;  1IW7 C;  1NBW A;  2UUA L;  2F0H A;  1VQH A;  5G3L F;  3RZO H;  2JK8 A;  1LTI D;  1MBY A;  1DM0 B;  3V96 A;  4K0K L;  4R4I A;  3C1E A;  3K58 A;  1C7Y A;  1LT5 D;  4DU9 A;  1HZA A;  2R92 G;  4OX9 L;  3HGB A;  5C3X A;  2CQA A;  1O7Z A;  1Y69 U;  4MTN A;  2L0C A;  1EYC A;  3KF8 B;  1UAP A;  4BA2 I;  2N55 A;  1UE1 A;  5KEE A;  2YU9 B;  3J81 E;  1W2B A;  1CM9 A;  1NUC A;  1A6X A;  1QUQ A;  3HKZ B;  1F9P A;  5M3M H;  3H09 A;  3OSO A;  4RGM A;  2F0G A;  2TMP A;  4NXN L;  4N8F A;  4AQY Q;  1Y1W G;  4ZKC B;  3L0O A;  4UAI A;  3M85 A;  2AQ3 B;  1R9T H;  2Y0S E;  4BBS H;  1NNX A;  2A6H C;  1D6E C;  1TS3 A;  2B39 A;  1I6V C;  4LFB L;  4QIW B;  2MGS A;  2OT2 A;  1IBL Q;  1CKN A;  3GTO H;  5COR A;  1PDQ A;  1CT1 D;  3URY A;  3A54 A;  4EQ5 A;  1YEZ A;  4DR2 Q;  4X65 L;  4A3E G;  3GTL H;  1X3G A;  4QQB X;  2K75 A;  2PZU A;  5LMU L;  2EQS A;  3A8J E;  4DR4 Q;  2UXB Q;  2Q8R E;  3OMG A;  5FLX c;  5GAH C;  2NBF A;  1PTO H;  1O78 A;  4K6D A;  5EPK A;  3S16 H;  2WAQ E;  2B2U A;  1B3Q A;  4GNX B;  4RCN A;  3PSI A;  5AJ3 Q;  4A3K B;  1PYW D;  2EYM A;  1X9N A;  2F1M A;  2BE5 D;  3PO2 G;  1I94 L;  1WD0 A;  1EFW A;  4LK1 C;  3IFD A;  4DR7 L;  2Y0S G;  1LTG D;  3FPP A;  4BS9 A;  3S1N H;  1UNS A;  1WTH A;  5FO7 B;  4QL5 A;  2GA4 B;  3M4O H;  5C44 B;  3RN5 A;  3J81 j;  1IL2 A;  2PQA A;  5CV7 A;  1GHK A;  2Z9H A;  1K8G A;  4FF4 A;  1U4L A;  1KAB A;  1V8Q A;  3S9W A;  1DOL A;  1DON A;  1SYF A;  2AWO A;  4O42 A;  3UDF A;  4UPA A;  1OTC A;  1DOK A;  1X3P A;  2Z8L A;  4GN3 B;  4XQQ A;  1T5E A;  1G91 A;  3ULP A;  1WI5 A;  1F9R A;  3ERS X;  1SNM A;  1LTT D;  2F0I A;  3P20 A;  1DYQ A;  2BE5 C;  4DXG A;  2B2Y C;  3TS0 A;  3V05 A;  1SNP A;  2JEB I;  4AYB B;  1LAC A;  1X3E A;  1AE3 A;  4DUZ L;  3CCV A;  1BQQ T;  4BA1 I;  2K5H A;  2EZV A;  1VQE A;  2AUJ D;  3RZO B;  1HRJ A;  3G6E A;  1J5E L;  3PCO B;  4DK6 C;  5KGU A;  2NVY H;  5L37 A;  1L1O A;  4PZ8 A;  4RKB A;  1KRT A;  1C4Q A;  3RMH A;  2F03 A;  4IUR A;  5IYB H;  4ZK9 B;  4OWT B;  4IPC A;  5FO9 B;  4LAA A;  1BF4 A;  4GLV B;  3CXC A;  2R3Z A;  1IXR A;  1QG7 A;  1FNV A;  3CC7 A;  3S1R H;  4DKA C;  4IN3 A;  5EGT A;  3I2Z A;  4AQY L;  4K2L A;  1JMC A;  4JI1 Q;  1EU4 A;  4FDB A;  2RHS B;  5FK9 C;  3J7A 5;  2VQF Q;  4LF8 Q;  1P16 A;  3MAQ A;  1ET9 A;  2M9V A;  4L6T B;  5IYD H;  3LX0 A;  1SE3 A;  3S1Q H;  5BN4 A;  4L5Q A;  3J81 c;  1ENA A;  1IBL L;  3WOF A;  1B50 A;  1JJC B;  1PV4 A;  1ZXT A;  4JYA Q;  4DR2 L;  2NZH A;  3KOJ A;  4ULL A;  3HOX G;  1A8V A;  2JA6 G;  1W6J A;  4DR4 L;  1Y8O B;  1RDP D;  1NY4 A;  3NEL A;  4ID6 A;  5IOD A;  3HOU B;  2G9D A;  4X66 Q;  1H9S A;  4KKU A;  5DM7 3;  4BY1 H;  3K57 A;  1CHQ D;  3HOW G;  2VNU D;  3FVQ A;  3DWQ A;  2FXQ A;  5C4X H;  5FO8 B;  1FNU A;  5JAV A;  2JXM B;  4NB3 A;  1PTO F;  5IT9 E;  1N32 L;  5JVG 3;  2R6G A;  5C5M A;  2VS1 A;  3NP8 A;  1HR0 Q;  2HUG A;  4CBV A;  5GAG C;  4GLA C;  1JR0 D;  2SEB D;  1TT2 A;  3NXW A;  2ALY B;  2XN9 C;  2F0L A;  1II3 A;  5BN5 A;  1X32 A;  2ZT9 C;  3L9A X;  1HA6 A;  1PRT B;  5CMD A;  3M4O B;  4AIM A;  2VQE Q;  4ME3 A;  2XWJ B;  3MXP A;  3H0G B;  3I8Z A;  3VA7 A;  2R7Z H;  2I0Q A;  1KDA A;  1PH2 A;  3HKZ E;  1QZG A;  5F2D A;  1EEI D;  2SNM A;  1K83 B;  4IFD J;  1N36 Q;  4POF A;  1D1K A;  5FJ8 H;  3S15 H;  3E3X A;  4B3T Q;  1TII D;  4DV1 L;  2N8N A;  2YTX A;  3KDF B;  1PRT C;  4BY7 H;  4RG1 A;  3L3O C;  2OTJ A;  2JA7 H;  2HIV A;  1YBY A;  1YNX A;  2RCF A;  4LUV A;  4ME5 A;  4G7O C;  5ELF A;  5KYL A;  4QIW E;  1STY A;  5C4Z A;  4NPS A;  1YIJ A;  4C2M H;  4HIO A;  1JIC A;  3ULL A;  2WKC A;  1DGS A;  1JC7 A;  4IUV A;  1LAB A;  4JBK A;  5C3E G;  2N78 A;  3K80 C;  1JWU D;  5BN3 A;  4RHS A;  2IX3 A;  4FF3 A;  2EDG A;  2N49 A;  1QUQ B;  1RHP A;  4C3I H;  1AFP A;  4JI1 L;  2L5T A;  4PMW A;  5EBD A;  3ITP A;  4TQU S;  1XWE A;  2VQF L;  3RR5 A;  1KQS A;  4LF8 L;  4B9W A;  4A3I H;  2FIN B;  2ZXR A;  2KED A;  4GKJ Q;  5LL6 S;  1QIL A;  4Z9C B;  5JEA G;  2I5M X;  3PUY A;  3DUZ A;  3AU7 A;  2BH2 A;  2D2C C;  5I9O A;  4M1U B;  2NVT H;  1D5X C;  2IPK D;  2KEC A;  3Q24 A;  2E2I B;  3MZ5 A;  4KD3 A;  3NK9 A;  4KKT A;  4CJ0 B;  4HJ7 A;  1W3S A;  5E4W C;  1IKM A;  5I4D A;  1HZB A;  3T1Y Q;  4DR6 Q;  2A1A A;  2VUM H;  3H15 A;  1MJE A;  3W5O A;  1KHI A;  1TWC B;  4X66 L;  3U9S A;  2DY7 A;  2K5N A;  3G6J B;  3S1M H;  3PMF A;  3CPF A;  3GTP H;  2L4N A;  1KC8 C;  4A3F H;  3GV6 A;  3K7U C;  2G5D A;  2A69 C;  4YCV A;  1G8Z D;  1SMY C;  4KY5 A;  4A3J G;  1Y1V G;  4F8M A;  2E8G A;  1VF5 C;  4AYB E;  1D5M C;  4H13 C;  5EQ0 A;  1VQJ A;  1PMR A;  4DR5 Q;  2L9H A;  4OWX B;  1HR0 L;  2E2J B;  3I4N G;  4A3K G;  3ONA B;  2JA5 H;  2F3I A;  1RTO A;  4MN3 A;  1TS4 A;  2JA8 G;  2QDL A;  3CAM A;  3D4D A;  4A3G H;  1Q81 C;  5C3W A;  4IOA A;  4JOI A;  2CH4 W;  3DM1 A;  3PQI A;  1PH6 A;  1SFO B;  4NMZ A;  2EVB A;  4PZ7 A;  2BA1 A;  2VQE L;  3CCM A;  3CME A;  3OYY A;  1E22 A;  4UHV A;  1XJV A;  4DV3 Q;  3KYH C;  3H91 A;  1KAW A;  2J7Z A;  1H9K A;  1KAA A;  2KUM A;  4DUY L;  4Q0F A;  1HXY D;  4Q5V A;  3HOZ H;  5IT9 c;  4A3E B;  1A15 A;  1QZH A;  1YHB A;  3GO5 A;  1N36 L;  3CC4 A;  3D4W A;  2F0U A;  3EIV A;  2KEN A;  1B1Z A;  4PZ6 A;  3C46 A;  1FL0 A;  1MI2 A;  4CJ2 C;  4V19 0;  1LTL A;  1TWG B;  2Q2H A;  3F2U A;  2J0T D;  2VB3 X;  3I56 A;  4LW1 A;  4DAM A;  2NZ1 D;  1LTA D;  1VQM A;  4AYB G;  2KHJ A;  3RN2 A;  3A56 A;  4U68 A;  1ICW A;  4IPG A;  2EJG C;  1YNJ C;  2JA7 B;  2QF7 A;  3VR6 A;  4NXM Q;  3MTS A;  1CKM A;  3PO2 B;  4JBM A;  3R2T A;  2MFI A;  4FF1 A;  1BO0 A;  3IRB A;  3CKI B;  1U0L A;  4IO9 A;  3E9H A;  1C48 A;  3MA2 B;  1KDC A;  2I46 A;  1RL2 A;  3BVG A;  4XQN A;  2CFM A;  3PO3 H;  3EA6 A;  2NUC A;  1WCM H;  2KCM A;  3M7N A;  2KHS A;  3J80 L;  3KJO A;  2F0T A;  1EZ8 A;  3C3L A;  1Q8K A;  1HUN A;  4GKJ L;  1GUT A;  3IKJ A;  4DN4 M;  1NJI C;  5M3M G;  3T53 B;  2YTY A;  1FGB D;  5KYI A;  2SDF A;  1HJP A;  4KHP Q;  3RZD B;  1TS5 A;  2CWA A;  2B2T A;  3A7L A;  2C9O A;  3MEF A;  3VDY A;  2Z6B A;  3T1Y L;  4G7Z C;  4DR6 L;  1L0W A;  1IHZ A;  4LF7 L;  4BBS G;  4IUT A;  3CD6 A;  1B53 A;  3PUV A;  3W2D A;  2ZTC A;  1K3B C;  3B6Y A;  1STH A;  4H44 C;  4JI8 Q;  3PIP 3;  1KLU D;  4JI2 Q;  1IL8 A;  1XTC D;  1VMP A;  2AWN A;  4P73 A;  1YHQ A;  2F0F A;  2B2V A;  2PNR C;  3S1M B;  4HIK A;  1T5X D;  3K59 A;  3GTP B;  1GXD C;  2PYK A;  5K36 H;  4A76 A;  4DR5 L;  1HZ9 A;  1Q82 C;  2AKW B;  1RKN A;  1VQD A;  4RH6 A;  4J6H A;  3HOV H;  1K0R A;  1TWF H;  1B44 D;  4GOP A;  3VA5 A;  1KRS A;  4BBR H;  1VQ7 A;  2D0P A;  4P2C B;  2JA5 B;  4GZY C;  1SRU A;  4WFN 3;  2LXK A;  4YWM A;  4LUO A;  4DV3 L;  3D3R A;  3ERQ A;  1FD7 D;  1WD1 A;  4EVO A;  3A5U A;  1LTS D;  3NTI A;  1BVS A;  3CCJ A;  2F0E A;  1SYB A;  4I7Z C;  4EQP A;  3CHB D;  1VQP A;  3SK5 A;  5ELO A;  2X6L A;  2JA6 B;  3BU2 A;  3IFT A;  1PZJ D;  2ZTD A;  3K5M A;  1JWM D;  3GTQ H;  1UWV A;  1TR5 A;  4OIK A;  1RD9 D;  3Q23 A;  1YZ6 A;  3HOW B;  2R93 H;  1VQN A;  1EYG A;  1HH2 P;  2XSC A;  3BYY B;  1L2F A;  1XXG A;  5CV8 A;  2EXZ A;  1EQV A;  1STG A;  4HCS A;  3T16 A;  3LWU A;  4IFD I;  3SE0 A;  2IHE A;  4NXM L;  2EJM A;  2A74 C;  1EIF A;  1TWH B;  4FXD A;  1ILP A;  1IYV A;  1W6K A;  2JN4 A;  2NYZ D;  3M7G A;  1PYS B;  2VY3 A;  1WVL A;  3Q0A A;  5CV9 A;  1C8C A;  3K5O A;  1HTL D;  2P5Z X;  4HED A;  2PW5 A;  2K5V A;  2KJX A;  5IYB G;  5T1I A;  5GAD C;  1K28 A;  1HZC A;  1IW7 D;  3A5Z B;  3OHX C;  1EY4 A;  4QB4 A;  3HS0 C;  2OF1 A;  5IOC A;  1VQK A;  4HSV A;  1EOT A;  1GUS A;  1DD2 A;  2NB0 A;  3ER0 A;  2HHH Q;  1CHP D;  3F1Z A;  1BBX C;  1AN8 A;  1VQA A;  3LNN A;  1G29 1;  3BYT B;  4KD4 A;  3CC2 A;  2EOT A;  1HHV A;  2AHO B;  2Q2U A;  5M5W B;  1TY0 A;  4RCO A;  1PH3 A;  5IYD G;  2UXC Q;  4JI8 L;  5DEH A;  5A2Q L;  3U58 A;  5IYC H;  1GUW A;  2ATW A;  3CW2 C;  4JI2 L;  1ET6 A;  2MP1 A;  4UDU C;  1EY9 A;  3KFU A;  4JI6 Q;  2B8G A;  5C3E B;  1XYI A;  4DA2 A;  2A6H D;  2JSO A;  2K05 A;  2K52 A;  3NBH B;  5E3F A;  1T9H A;  4A3D H;  3O13 A;  4ZLT F;  3J7Z C;  4BY1 G;  1SYE A;  1YHA A;  4HAE A;  1RF2 D;  1BDO A;  1A0I A;  4RWS C;  4KK7 A;  3TN2 A;  4YY3 Q;  2YTV A;  3J7Y W;  4P74 A;  3HOV B;  5C4X G;  2F4V Q;  4UP8 A;  3RNU A;  1S5F D;  4BBR B;  2NTT A;  1IZ6 A;  1Q3L A;  3TBI B;  3N6R A;  1EYA A;  2DY8 A;  4L63 B;  2UUB Q;  1MKH A;  1DXM A;  4JCV E;  4LF4 Q;  3C2P A;  2PI2 A;  4UY8 C;  5J39 A;  4R9W A;  3AB9 A;  1KNE A;  1SE4 A;  3P75 A;  3E0E A;  3MFY A;  1EIH A;  1VQC A;  1FR3 A;  4YHH L;  3GTJ B;  1NMF A;  1CA5 A;  1TWA B;  2IJ0 A;  1MD2 D;  2NZO A;  3VYS A;  2R7Z G;  4CJ1 B;  4XQJ A;  2CCZ A;  2I5H A;  2PNH A;  1S5B D;  1VQ5 A;  4HJ9 A;  2UU9 Q;  3GTG H;  4B3R Q;  4A3J B;  1Y1V B;  1EY6 A;  4NKL A;  2BH8 A;  4DR3 Q;  1M90 C;  2J4X A;  2Z1C A;  5FJ8 G;  3KF6 B;  5ELN A;  2KEE A;  4EQO A;  4I7A A;  4XYQ A;  3J80 E;  4DV7 Q;  4LFA Q;  4ILW A;  3I4N B;  4XXE A;  4Y7N B;  1ASY A;  4BY7 G;  1SRO A;  1F2M A;  2MO1 A;  4X6A H;  2JA7 G;  2A73 B;  2HT1 A;  2JA8 B;  1SDF A;  2F0P A;  4O1N A;  3AEV A;  2SNS A;  3H3V C;  2SOB A;  1WYD A;  2OQ0 A;  1MJC A;  2Q2I A;  4YWL A;  4APV A;  2F0M A;  2K5Q A;  1LT6 D;  3H94 A;  4RFB A;  2WII B;  5ELC A;  2EY2 A;  4JV5 L;  3ND9 A;  1JE5 A;  1STB A;  5JVH 3;  1BCP B;  4GNX C;  2RSN A;  3W3A A;  2PO4 A;  5E1F A;  4X3U A;  3A74 A;  1STE A;  1SAP A;  2ZTE A;  5IP7 H;  4R4O A;  3PIO A;  5M5Y B;  1GD7 A;  3N52 A;  1GO3 E;  4C3I G;  1A2T A;  3D4R A;  4K8I A;  3SK8 A;  5IE8 A;  1BOS A;  4HID A;  1BCP F;  3G4S A;  5HGQ A;  4TKO B;  4A3I G;  2N3S A;  2B2W C;  2ZJR A;  2KBN A;  3PUX A;  4R4T A;  5EKK A;  1F2Z A;  3JAM i;  2DN8 A;  2KCN A;  1V1P A;  3QOJ A;  5IGE A;  3CCR A;  2BCO A;  3I7F A;  3SGI A;  5KRU A;  3CCU A;  3FP9 A;  2FJ2 A;  4PV1 C;  3W1G A;  2VUM G;  1QVF A;  2MNA A;  3A8K E;  1QE6 A;  3CP0 A;  1SYG A;  3PIP A;  5HY6 A;  3I3C A;  2VXW A;  3HRZ C;  1SLJ A;  1HCZ A;  4OHJ A;  1N8R C;  1I4H A;  3UE1 A;  1EU3 A;  3FPU B;  4A3F G;  4A3D B;  3K5N A;  1TQO A;  2F4V L;  1JE4 A;  5M3M B;  3T13 A;  4GOP B;  2H4O A;  2UUB L;  3MXN B;  1LT3 D;  1VQB A;  2R7D A;  4LF4 L;  2A19 A;  1EUJ A;  3CMA A;  3NQI A;  3KLS X;  3GTM H;  4WJ4 A;  1GHJ A;  1HUM A;  2HCI A;  2ICE C;  3M4Y A;  2JA5 G;  1WJJ A;  2QGQ A;  5D3I B;  3QWN A;  2HCC A;  1R9T B;  5JJI A;  1JQY D;  1JOK A;  3I91 A;  4IUP A;  4BBS B;  4A3G G;  1RIP A;  1PH7 A;  5M3F H;  2K6A A;  2WAC A;  4JPB W;  4EX5 A;  1YJW A;  1EEF D;  2RDG A;  5JPM C;  3QOL A;  3GTO B;  3PUW A;  1KL9 A;  2QIL A;  5I9P A;  3BDO A;  4WOR A;  5GRO A;  3VR4 A;  3HOZ G;  1PYB A;  2UU9 L;  2CH4 A;  2UXB L;  3GTL B;  1A3T A;  4DR3 L;  3GQB A;  4GS3 A;  3BG3 A;  3GTG B;  1E0B A;  2DJF C;  1G51 A;  2WKD A;  1PTO B;  4LFA L;  3GTK H;  5AJ3 L;  5I2Y A;  1A2U A;  1E2V A;  3S16 B;  5AFW A;  1DJR D;  2F0N A;  3Q22 A;  3V2T A;  3S2D H;  2BDN A;  1WTP A;  4RA8 A;  2XRS D;  4JI7 Q;  1A62 A;  2EY5 A;  3QB3 A;  2D0O A;  2K4K A;  1PRT D;  2AMC B;  3S1N B;  2EYP A;  1I4G A;  3SXH A;  4LNQ A;  4GN5 A;  1CSP A;  1NE3 A;  4N8X 1;  1PTO C;  5BR8 Q;  3J80 c;  5A2Q E;  4DR1 Q;  3PO3 G;  4A3C H;  2N88 A;  1J8I A;  3KLR A;  2F0O A;  2Z6K A;  5IGG A;  1WCM G;  1I5F A;  3BDC A;  4C3H H;  4ZKB B;  4AH6 A;  3DWA A;  1N33 Q;  1A3V A;  4U67 3;  2L12 A;  1OXT A;  3TZU A;  5DAU A;  4B9X A;  4CDC C;  1JB3 A;  4JG2 A;  1H95 A;  1SEB D;  1V1Q A;  1U4M A;  2HIX A;  4KHV A;  2Z4H A;  1XMO Q;  1PH1 A;  2Z0S A;  1BBW A;  5CV6 A;  4LF9 Q;  4A93 H;  2CQO A;  3I70 A;  1S5D D;  4R8I A;  2MJ8 A;  2FHT A;  4B3S Q;  4JC0 A;  3SHL A;  1E2W A;  2NVY B;  4FXK C;  5IGF A;  3I73 A;  2FMC A;  3TS2 A;  4QUF A;  3TRE A;  4JI4 Q;  1LYL A;  2NN6 I;  2E2H H;  3EJI A;  4B3M Q;  4KY6 A;  5EBC A;  5K36 G;  2RVL A;  2F0Q A;  4DFA A;  3S1R B;  4IUU A;  4R4C A;  4IPH A;  1Y8P B;  3KLS A;  5KNC A;  2ZXO A;  4F88 A;  3HOV G;  4RKL A;  1VQL A;  3SVM A;  1Y14 B;  2ES2 A;  4BBR G;  4LF5 Q;  2A69 D;  1SMY D;  3NBI A;  3WOE A;  2DGY A;  3U4V A;  3DEO A;  4CKE A;  5LMN W;  3S1Q B;  3EQL C;  4JYA L;  4J15 A;  1OXV A;  2H1E A;  1VQF A;  1SNQ A;  4QGU A;  1K8O A;  2JJQ A;  4A3B H;  2BOS A;  1CKN B;  2XGT A;  2ID0 A;  4RGO S;  1PFB A;  4A3L H;  1B7Y B;  2ZM6 Q;  1HPC A;  4QMG A;  1OXS C;  1YNN C;  3DXJ C;  4OO1 I;  1X56 A;  2MO0 A;  4L5S A;  1UEA B;  4OL7 A;  3SK6 A;  5EAY A;  4DK1 A;  4M8A A;  1U4R A;  1D8L A;  2XRQ D;  1FJG Q;  4BY1 B;  1XNQ Q;  1SN8 A;  1ASZ A;  1F9Q A;  2R93 G;  3IL8 A;  1I4X A;  2ZXP A;  3J7A V;  3GTK B;  4GN4 B;  3TSS A;  1E1O A;  3WDN A;  5C4X B;  1XNR Q;  1TU2 B;  1SE2 A;  1RJT A;  4DAV A;  4FXG C;  3ULJ A;  4JI7 L;  1S72 A;  3FKI H;  4CDF C;  2B63 H;  3K81 C;  4KN7 C;  4F7X A;  3S2D B;  5A35 A;  1B9N A;  1DZ1 A;  1UE7 A;  4IFD H;  3QO2 A;  3T1H Q;  2WB1 G;  5BR8 L;  4NW2 A;  1PFN A;  4HJ8 A;  2M00 A;  4KJO A;  1BXT A;  3GDE A;  3DLL A;  3A0J A;  2CW0 C;  4DR1 L;  1YNJ D;  2PQA B;  4KHZ A;  2YYZ A;  2NVQ H;  2KVM A;  2B2U C;  3OMC A;  4ZAI A;  4X3K A;  1QCB D;  4XTC S;  2R7Z B;  2OTL A;  2RSO A;  1N33 L;  4C3H B;  1OXX K;  5IWA Q;  1B9M A;  2KCC A;  4S3S A;  2AQ1 B;  1O7I A;  2VB2 X;  3GP7 A;  1DOM A;  4YCU A;  3NQT A;  4B3T L;  2HQL A;  2OWO A;  2E75 C;  2NVX H;  3S15 B;  1U4P A;  1XMO L;  4ODG A;  4OON A;  1VQ6 A;  4LF9 L;  3CCL A;  2YV5 A;  4BY7 B;  1V1P B;  5COY A;  4KKS A;  1V1O A;  3D0F A;  4A3M H;  5JEA J;  4F87 A;  1BUV T;  1QNU A;  1A63 A;  5IYC G;  4B3S L;  1I4P A;  4TSS A;  4C2M B;  4RHR A;  3D8G A;  2VL6 A;  2RBM A;  3TME A;  1PFS A;  4LF6 Q;  2PZT A;  1L1O B;  4IAL A;  5CBA E;  4XDX A;  4A75 A;  4IOC A;  4JI4 L;  3LGJ A;  2A68 C;  2BA0 A;  3PIO 3;  4B3M L;  3KBG A;  3E0J A;  3TZD A;  4KY7 A;  1PA6 A;  4A3D G;  3RLO A;  4C3I B;  4DAY A;  1N34 Q;  2LMC B;  2RF4 A;  1VQG A;  3H6M A;  1Z6H A;  1ML0 D;  1DCZ A;  2B2Y A;  3E9I A;  4A3I B;  2L55 A;  2A6E D;  2VZA A;  1E7Z A;  4FNF A;  4DNI A;  4V0B A;  1L1O C;  4HJA A;  4UP7 A;  1QVC A;  3STB C;  3TEH B;  3NHH A;  3T56 B;  2NVT B;  1IBK Q;  4HCE A;  4C3J H;  3UI2 A;  3R3O A;  4PMB A;  4A3B B;  1UE6 A;  2AUK A;  3FEW X;  5M5X H;  2VUM B;  2UXD Q;  3OOC A;  1K0S A;  4XIG S;  1CZG A;  2V1C C;  1SXT A;  1QJO A;  3TP5 A;  2K5W A;  1FJG L;  1XNQ L;  1YIT A;  1H9S B;  3KBX A;  3VYT A;  1SYC A;  3UDG A;  5IGD A;  2A6E C;  1Q1E A;  2QEJ C;  4A3F B;  2LSS A;  4CGY B;  1EQR A;  1XNR L;  4ABN A;  1XX8 A;  3VR2 A;  3AYH B;  3I4M H;  2WFW A;  3S24 A;  1H9J A;  4ZCK A;  2LS0 1;  5J3B A;  1F2Y A;  3HG9 A;  1O80 A;  4RGN A;  4O2D A;  4ZRZ A;  1D2B A;  1CSQ A;  4JI3 Q;  1QNK A;  5TSS A;  2MHV A;  1PLF A;  2QCP X;  2E2D C;  2F3V A;  3T1H L;  2D9U A;  2X69 A;  1BR9 A;  2ICI A;  4JI0 Q;  4A3G B;  3ZYY X;  2ENB A;  1GOZ A;  1CQV A;  2KHI A;  5EJW A;  2YU9 H;  5ELE A;  3CCE A;  1K8A C;  1K9M C;  4MTK A;  3ZJY C;  2O2L D;  4C1N K;  1NMG A;  1X55 A;  5IWA L;  3RUZ A;  4G57 A;  5LHY 1;  3HOZ B;  5ISR A;  5IGC A;  3Q6S A;  2MPM A;  4ALP A;  1WTQ A;  1MGS A;  5IP7 G;  3S17 H;  2GN5 A;  1G6P A;  2JA9 A;  3TQY A;  1LLR D;  2G9H D;  2HDL A;  4IUQ A;  3DM3 A;  5CV4 A;  1KXL A;  5DLQ E;  1JOQ A;  1FYC A;  2OEO A;  4DV0 Q;  1B2T A; 
#chains in the Genus database with same CATH homology
 1GJX A;  1EY8 A;  1PXU A;  3I72 A;  1KDB A;  4A3M B;  3JAM L;  1ESR A;  4QCL A;  3TP8 A;  1CTM A;  1UUP A;  1ENC A;  4K5V A;  1VCI A;  5EKI A;  1Z7T A;  3PO3 B;  4K5W A;  4JK1 C;  3LWE A;  4G4K A;  1WCM B;  3G7L A;  1ZKO A;  4FP5 D;  1KLG D;  3A7A B;  2WP8 J;  1HFN A;  2X6G A;  4H0L C;  2RDF A;  3D31 A;  1JOR A;  4HMJ A;  1AEX A;  1GUO A;  1TVX A;  5G3L D;  5J1Z A;  2EE1 A;  3BVM A;  3PV0 A;  4EGV A;  5DNF A;  3TP6 A;  4HTH A;  3C1F A;  1AP0 A;  2JE6 I;  1X3Q A;  1OXU A;  5IIF A;  2F0S A;  5C0X J;  5E4X A;  2E76 C;  5I6Y A;  4KI0 A;  1HQM C;  3OIP A;  2RDH A;  5C5L A;  4OGQ C;  5D3D A;  1TWF B;  3R8B A;  1ZYR C;  3P7J A;  1L0Y B;  4MIU A;  2JYO A;  2WIN B;  4C1N I;  1S5E D;  5KND A;  2F4I A;  2EYO A;  3BS1 A;  3DWP A;  5LL6 X;  1WTX A;  3NUC A;  1QOH A;  4E6I A;  2O5J C;  4TRD A;  4IUN A;  4C3H G;  3GTQ B;  3S17 B;  5CYU A;  2RQX A;  1ROD A;  2R93 B;  3HP3 A;  1PZI D;  2LKV A;  1IYU A;  4NDX A;  4FO2 A;  4KTA A;  1M4V A;  2XIW A;  1I4Q A;  4HSP A;  3ND8 A;  5I2X A;  4JBW A;  2FMM A;  1I3Q B;  1SND A;  1F77 A;  3D6C A;  2WB1 B;  5CGK A;  3AMU A;  1BCP D;  2K03 A;  2F0K A;  3EVQ A;  3QIA A;  4LMQ D;  3QJY A;  3MXU A;  3MFG A;  2IWH A;  2NN6 H;  2PPB C;  1LTR D;  2QDB A;  3K6O A;  5JOB A;  1ESF A;  3OIQ A;  1EY0 A;  4ZYS A;  5C0X H;  4HN7 A;  2EY6 A;  1MSG A;  1RTN A;  3OWE B;  1BCP C;  3ERO A;  4ZUI A;  2PCF B;  2L1B A;  4H7B A;  4KV6 A;  1KTK A;  1S5C D;  4QUC A;  4DK0 A;  2B2T C;  3FMC A;  1TY2 A;  4KJN A;  3CRK C;  2A5H A;  4FVM A;  4OO1 H;  4BWG B;  1V43 A;  5D65 A;  1EZ6 A;  1I50 B;  4ZQ3 A;  2IT1 A;  1LO5 D;  2FFK B;  1STA A;  1HQR D;  5D14 A;  3HOY B;  1EWC A;  5NUC A;  1CI3 M;  2B2V C;  2OXP A;  4IFD G;  4LJZ C;  3VYR A;  2F0D A;  4HR7 B;  5ELB A;  1ZEQ X;  1AZQ A;  1Q1B A;  5CC4 A;  3JAM E;  1Q90 A;  1EY5 A;  2Q8T A;  3NWT A;  4XT1 B;  2K1B A;  1D5Z C;  3DMU A;  1ONL A;  1PTO D;  2PZW A;  2AQ2 B;  4CKC A;  1LT4 D;  3HZX A;  2XVS A;  3I90 A;  1NR2 A;  4K2K A;  4MHE A;  5CV5 A;  3L7Z C;  3NWS A;  3PUZ A;  1VDZ A;  4K6L A;  4K8J A;  3R2I A;  2K04 A;  3GV3 A;  5DM6 3;  1PZK D;  3EFX D;  2D62 A;  1JCK B;  1CZW A;  2NTS A;  5I6W A;  5KIX A;  2V4D A;  1VMC A;  3R93 A;  4KMU C;  4EQN A;  1E2Z A;  1SJE D;  4L8J A;  4C3J G;  1PRT F;  2F0V A;  4C56 C;  3U9O A;  4DNT B;  4OIJ A;  2DNE A;  4NP5 A;  2WV6 D;  2DNC A;  1EL0 A;  3QG1 A;  5FLX L;  4RAU C;  2PQE A;  2MUY A;  1YNN D;  2PMZ B;  1VF7 A;  2IX0 A;  4DGZ A;  1SJH D;  1SYD A;  2JP1 A;  1AZP A;  3FRP B;  3DHQ A;  5C0X I;  5K5P A;  1LTB D;  1GUN A;  3E5S A;  2HDM A;  2NWG A;  3GTM B;  2PW7 A;  4XT3 B;  2K5D A;  4N9P A;  2QKI C;  5M3F B;  3OW7 A;  3KUP A;  3SEB A;  1R4P B;  3M3Y B;  1H9R A;  4FYD A;  3KK7 A;  1WTO A;  1EWH A;  1LV9 A;  1RCV D;  4K5X A;  3SK4 A;  1EFI D;  1Q12 A;  2CW0 D;  1R4Q B;  1SNO A;  5M9O A;  5FKA C;  1PFM A;  1F2L A;  3MWY W;  3X3N A;  2R61 A;  1EYD A;  1HTP A;  2LY7 A;  1HA5 A;  2R92 B;  2CVR A;  5C4J B;  5J22 A;  3NBH A;  3J7A F;  3A55 A;  3VR3 A;  4ZUJ A;  3NTH A;  1MSH A;  3DEP A;  3KF8 A;  4B08 A;  4J8Q A;  4YIJ A;  2EYJ A;  4RGT A;  2K01 A;  1SNC A;  3HEJ A;  3IAY A;  2B8F A;  1Y8N B;  2EYH A;  1Y1W B;  2LFN A;  2BDO A;  1B3A A;  3K0Y A;  4XYO A;  4N9T A;  1G2T A;  2O5I C;  1CFM A;  1H9M A;  1M8A A;  2A68 D;  4PMC A;  2EYF A;  1BNZ A;  1IKL A;  4DXF A;  1CK1 A;  5FOB B;  3MC0 B;  1NSN S;  1FNW A;  3J81 L;  2K32 A;  1I6H B;  2XNA C;  3X3M A;  5KNB A;  2KOL A;  3K5L A;  4A93 B;  1NCV A;  1EY7 A;  3RD4 A;  3BDL A;  1TKW B;  1AW7 A;  1KNA A;  1O7Y A;  2IW3 A;  2F3W A;  3VR5 A;  5JPN C;  3NSW A;  1NAP A;  1SSO A;  3MXG A;  4HMI A;  5JJZ A;  5IGB A;  2E2H B;  1Z47 A;  4PQX A;  4FF2 A;  4DAP A;  3CQZ B;  5CR3 A;  2Q8I B;  1QWY A;  3BZD B;  4CKB A;  5C4H A;  2Y0S B;  2EJF C;  2B2W A;  1U9R A;  5HGT A;  3RLF A;  1WTR A;  4DNR B;  1WTV A;  4CHT B;  3A8I E;  5EKL A;  3TDQ A;  4DF7 A;  5EPL A;  1ILQ A;  1O7L A;  2WAQ B;  3VYU A;  1JOO A;  3MVV A;  1EIG A;  1GUG A;  1WTW A;  1G6Z A;  2Z4I A;  1CQF A;  5C6A A;  2CHB D;  5ELD A;  1QB5 D;  3FKI B;  3SDZ A;  1S4Z A;  2B63 B;  3T51 B;  2EPB A;  3GD7 A;  1HFG A;  1CA6 A;  4G7H C;  2EYL A;  1NR4 A;  3P1H A;  1G2S A;  3OWF A;  4WJW A;  2NVQ B;  2D5D A;  2TSS A;  2IL8 A;  3BVZ A;  3TP7 A;  1SBB B;  5JEA H;  2EY1 A;  3MXN A;  3SR1 A;  2E74 C;  3CU7 A;  4R8N A;  2RA4 A;  4IQZ A;  5FLX E;  2NN6 G;  2NVX B;  2C5C A;  3K7A B;  2F0J A;  1B4O A;  3HOX B;  5CBE E;  5C0X G;  1D1I A;  4QF4 A;  3S2H B;  1JWS D;  1TS2 A;  2KA7 A;  2K7V A;  4IZ8 A;  4X3T A;  3I4L A;  2O4X A;  1J9O A;  3MEH A;  2IX1 A;  2L11 A;  4K14 A;  2RKS A;  4OO1 G;  2F0W A;  5HUR A;  4PNY A;  3S14 B;  2HQE A;  4X3S A;  4KN4 C;  2K33 A;  2K28 A;  1EQT A;  3T4A C;  3NPP A;  1STN A;  5EPJ A;  2I07 B;  2M2L A;  3FDT A;  3NTK A;  4C3J B;  2KQ3 A;  1L0X B;  1F9S A;  5T1G A;  1ZYR D;  2JEA I;  4I65 A;  5IT9 L;  3OPO A;  1A3U A;  4J1M A;  5M5X B;  1K8M A;  2XWB B;  1ENF A;  1OO9 B;  1Q8I A;  3MHB A;  1I4R A;  3E6Z X;  4WRD A;  3D6W A;  3NE5 B;  3CRL C;  3I4M B;  1IW7 C;  2F0H A;  5G3L F;  1LTI D;  1MBY A;  1DM0 B;  3V96 A;  3C1E A;  3K58 A;  1LT5 D;  4DU9 A;  3HGB A;  5C3X A;  2CQA A;  1O7Z A;  1Y69 U;  2L0C A;  1EYC A;  1UAP A;  4BA2 I;  2N55 A;  5KEE A;  2YU9 B;  3J81 E;  1CM9 A;  1NUC A;  1A6X A;  3HKZ B;  1F9P A;  3H09 A;  3OSO A;  4RGM A;  2F0G A;  2TMP A;  4ZKC B;  4UAI A;  3M85 A;  2AQ3 B;  2A6H C;  1D6E C;  1TS3 A;  2B39 A;  1I6V C;  4QIW B;  2MGS A;  2OT2 A;  5COR A;  1PDQ A;  1CT1 D;  3URY A;  3A54 A;  2PZU A;  3A8J E;  2Q8R E;  3OMG A;  2NBF A;  1PTO H;  1O78 A;  4K6D A;  5EPK A;  2B2U A;  4RCN A;  4A3K B;  1PYW D;  2EYM A;  2F1M A;  2BE5 D;  1WD0 A;  4LK1 C;  3IFD A;  1LTG D;  3FPP A;  4BS9 A;  1UNS A;  5FO7 B;  2GA4 B;  5C44 B;  5CV7 A;  1GHK A;  4FF4 A;  1U4L A;  1KAB A;  1V8Q A;  3S9W A;  1DOL A;  1DON A;  1SYF A;  2AWO A;  4O42 A;  1DOK A;  1X3P A;  2Z8L A;  4XQQ A;  1T5E A;  1G91 A;  1F9R A;  1SNM A;  1LTT D;  2F0I A;  3P20 A;  4DXG A;  1DYQ A;  2BE5 C;  2B2Y C;  3V05 A;  1SNP A;  2JEB I;  4AYB B;  1LAC A;  1BQQ T;  4BA1 I;  2EZV A;  2AUJ D;  3RZO B;  1HRJ A;  5KGU A;  4RKB A;  3RMH A;  1C4Q A;  2F03 A;  4IUR A;  4ZK9 B;  5FO9 B;  4LAA A;  1BF4 A;  2R3Z A;  1QG7 A;  1FNV A;  4IN3 A;  5EGT A;  4K2L A;  1EU4 A;  5FK9 C;  3MAQ A;  1ET9 A;  2M9V A;  4L6T B;  3LX0 A;  1SE3 A;  5BN4 A;  1ENA A;  3WOF A;  1B50 A;  1ZXT A;  4ULL A;  1W6J A;  1Y8O B;  1RDP D;  5IOD A;  4ID6 A;  3HOU B;  2G9D A;  1H9S A;  4KKU A;  5DM7 3;  3K57 A;  1CHQ D;  2VNU D;  3FVQ A;  3DWQ A;  5FO8 B;  1FNU A;  5JAV A;  2JXM B;  1PTO F;  5IT9 E;  5JVG 3;  2R6G A;  5C5M A;  3NP8 A;  2HUG A;  4CBV A;  1JR0 D;  2SEB D;  1TT2 A;  3NXW A;  2XN9 C;  2F0L A;  1II3 A;  5BN5 A;  1X32 A;  2ZT9 C;  3L9A X;  1HA6 A;  1PRT B;  5CMD A;  3M4O B;  2XWJ B;  3MXP A;  3H0G B;  3I8Z A;  3VA7 A;  1KDA A;  5F2D A;  1EEI D;  2SNM A;  1K83 B;  4IFD J;  1D1K A;  1TII D;  1PRT C;  3L3O C;  4ME5 A;  4G7O C;  5ELF A;  5KYL A;  1STY A;  5C4Z A;  1JIC A;  2WKC A;  1JC7 A;  4IUV A;  1LAB A;  1JWU D;  5BN3 A;  4RHS A;  2IX3 A;  4FF3 A;  2EDG A;  1RHP A;  1AFP A;  2L5T A;  4PMW A;  5EBD A;  3ITP A;  4TQU S;  1XWE A;  4B9W A;  2FIN B;  2ZXR A;  2KED A;  5LL6 S;  1QIL A;  4Z9C B;  5JEA G;  3PUY A;  3DUZ A;  3AU7 A;  2D2C C;  5I9O A;  4M1U B;  1D5X C;  2IPK D;  2KEC A;  3Q24 A;  2E2I B;  3MZ5 A;  4KD3 A;  3NK9 A;  4KKT A;  4CJ0 B;  1IKM A;  5E4W C;  5I4D A;  1TWC B;  3U9S A;  2DY7 A;  3G6J B;  3PMF A;  2L4N A;  3GV6 A;  2A69 C;  1G8Z D;  1SMY C;  4KY5 A;  4F8M A;  1VF5 C;  1D5M C;  4H13 C;  5EQ0 A;  1PMR A;  2L9H A;  2E2J B;  3ONA B;  1RTO A;  4MN3 A;  1TS4 A;  3D4D A;  5C3W A;  3DM1 A;  1SFO B;  4NMZ A;  2EVB A;  2BA1 A;  3H91 A;  2J7Z A;  1H9K A;  1KAA A;  2KUM A;  4Q0F A;  1HXY D;  4Q5V A;  4A3E B;  1A15 A;  3GO5 A;  3D4W A;  2F0U A;  1B1Z A;  3C46 A;  1MI2 A;  4CJ2 C;  4V19 0;  1TWG B;  3F2U A;  2J0T D;  2VB3 X;  2NZ1 D;  1LTA D;  3A56 A;  4U68 A;  1ICW A;  2EJG C;  1YNJ C;  2JA7 B;  2QF7 A;  3VR6 A;  3MTS A;  3PO2 B;  3R2T A;  4FF1 A;  1BO0 A;  3CKI B;  1C48 A;  3MA2 B;  1KDC A;  2I46 A;  3BVG A;  4XQN A;  3EA6 A;  2NUC A;  3M7N A;  2KHS A;  3J80 L;  2F0T A;  1EZ8 A;  3C3L A;  1HUN A;  1GUT A;  3IKJ A;  4DN4 M;  3T53 B;  1FGB D;  5KYI A;  2SDF A;  3RZD B;  1TS5 A;  2B2T A;  3A7L A;  2C9O A;  4G7Z C;  1IHZ A;  4IUT A;  1B53 A;  3PUV A;  3W2D A;  1STH A;  4H44 C;  3PIP 3;  1KLU D;  1IL8 A;  1XTC D;  1VMP A;  2AWN A;  2F0F A;  2B2V A;  2PNR C;  3S1M B;  1T5X D;  3K59 A;  3GTP B;  1GXD C;  2PYK A;  5K36 H;  1RKN A;  4RH6 A;  4J6H A;  1B44 D;  3VA5 A;  4P2C B;  2JA5 B;  4GZY C;  4WFN 3;  3D3R A;  3ERQ A;  1FD7 D;  1WD1 A;  4EVO A;  1LTS D;  3NTI A;  2F0E A;  1SYB A;  4I7Z C;  4EQP A;  3CHB D;  3SK5 A;  2JA6 B;  2X6L A;  3IFT A;  1PZJ D;  3K5M A;  1JWM D;  1TR5 A;  4OIK A;  1RD9 D;  3Q23 A;  3HOW B;  2XSC A;  3BYY B;  5CV8 A;  1XXG A;  2EXZ A;  1EQV A;  1STG A;  4HCS A;  3T16 A;  3LWU A;  4IFD I;  3SE0 A;  2EJM A;  2A74 C;  1TWH B;  4FXD A;  1ILP A;  1IYV A;  1W6K A;  2NYZ D;  3M7G A;  1WVL A;  3Q0A A;  5CV9 A;  1C8C A;  3K5O A;  1HTL D;  4HED A;  2PW5 A;  2KJX A;  5T1I A;  3OHX C;  1IW7 D;  1EY4 A;  4QB4 A;  3HS0 C;  2OF1 A;  5IOC A;  4HSV A;  1EOT A;  1GUS A;  1DD2 A;  2NB0 A;  1CHP D;  1BBX C;  1AN8 A;  3LNN A;  1G29 1;  3BYT B;  4KD4 A;  2EOT A;  1HHV A;  5M5W B;  1TY0 A;  4RCO A;  5DEH A;  5A2Q L;  1GUW A;  1ET6 A;  2MP1 A;  4UDU C;  1EY9 A;  2B8G A;  5C3E B;  1XYI A;  4DA2 A;  2A6H D;  2JSO A;  2K05 A;  5E3F A;  3O13 A;  4ZLT F;  1SYE A;  4HAE A;  1RF2 D;  1BDO A;  4RWS C;  3TN2 A;  4KK7 A;  3J7Y W;  3HOV B;  1S5F D;  4BBR B;  2NTT A;  3TBI B;  1Q3L A;  3N6R A;  1EYA A;  2DY8 A;  4L63 B;  1DXM A;  3C2P A;  5J39 A;  4R9W A;  3AB9 A;  1KNE A;  1SE4 A;  3P75 A;  3MFY A;  1EIH A;  1FR3 A;  3GTJ B;  1CA5 A;  1TWA B;  2IJ0 A;  1MD2 D;  3VYS A;  4CJ1 B;  4XQJ A;  1S5B D;  4A3J B;  1Y1V B;  1EY6 A;  4NKL A;  2J4X A;  2Z1C A;  2KEE A;  4EQO A;  4XYQ A;  3J80 E;  4ILW A;  3I4N B;  4XXE A;  4Y7N B;  1F2M A;  2A73 B;  2JA8 B;  1SDF A;  2F0P A;  4O1N A;  2SNS A;  3H3V C;  2SOB A;  2F0M A;  2K5Q A;  1LT6 D;  3H94 A;  4RFB A;  2WII B;  5ELC A;  2EY2 A;  3ND9 A;  1STB A;  5JVH 3;  1BCP B;  2RSN A;  3W3A A;  2PO4 A;  5E1F A;  4X3U A;  1STE A;  1SAP A;  5M5Y B;  3N52 A;  4C3I G;  1A2T A;  3D4R A;  4K8I A;  3SK8 A;  1BOS A;  1BCP F;  4TKO B;  2B2W C;  3PUX A;  5EKK A;  1F2Z A;  2DN8 A;  2KCN A;  1V1P A;  3QOJ A;  5IGE A;  2BCO A;  5KRU A;  2FJ2 A;  4PV1 C;  3A8K E;  1QE6 A;  1SYG A;  3I3C A;  2VXW A;  3HRZ C;  4OHJ A;  1HCZ A;  1I4H A;  1EU3 A;  3FPU B;  4A3D B;  3K5N A;  1TQO A;  1JE4 A;  5M3M B;  3T13 A;  2H4O A;  1LT3 D;  3NQI A;  3KLS X;  1GHJ A;  1HUM A;  2HCI A;  2ICE C;  3M4Y A;  5D3I B;  3QWN A;  2HCC A;  1R9T B;  1JQY D;  1JOK A;  3I91 A;  4IUP A;  4BBS B;  2K6A A;  2WAC A;  1EEF D;  2RDG A;  5JPM C;  3QOL A;  3GTO B;  3PUW A;  2QIL A;  5I9P A;  3BDO A;  4WOR A;  3VR4 A;  3GTL B;  1A3T A;  3GQB A;  3BG3 A;  3GTG B;  1E0B A;  2WKD A;  1PTO B;  5I2Y A;  1A2U A;  1E2V A;  3S16 B;  5AFW A;  1DJR D;  2F0N A;  3Q22 A;  3V2T A;  2BDN A;  1WTP A;  4RA8 A;  2XRS D;  2EY5 A;  3QB3 A;  1PRT D;  3S1N B;  2EYP A;  1I4G A;  3SXH A;  1PTO C;  5A2Q E;  2N88 A;  1J8I A;  3KLR A;  2F0O A;  5IGG A;  3BDC A;  4ZKB B;  3DWA A;  1A3V A;  4U67 3;  2L12 A;  1OXT A;  3TZU A;  5DAU A;  4B9X A;  1JB3 A;  1SEB D;  4KHV A;  1U4M A;  2Z4H A;  5CV6 A;  3I70 A;  1S5D D;  4R8I A;  2MJ8 A;  2FHT A;  3SHL A;  1E2W A;  2NVY B;  4FXK C;  5IGF A;  3I73 A;  2FMC A;  4QUF A;  2NN6 I;  3EJI A;  5K36 G;  4KY6 A;  5EBC A;  2RVL A;  2F0Q A;  4DFA A;  3S1R B;  4IUU A;  1Y8P B;  3KLS A;  5KNC A;  2ZXO A;  4F88 A;  4RKL A;  3SVM A;  2A69 D;  1SMY D;  3NBI A;  3WOE A;  3DEO A;  4CKE A;  3S1Q B;  3EQL C;  1OXV A;  2H1E A;  1SNQ A;  1K8O A;  2BOS A;  2ID0 A;  4RGO S;  1PFB A;  1HPC A;  4QMG A;  1OXS C;  1YNN C;  3DXJ C;  4OO1 I;  1UEA B;  4OL7 A;  3SK6 A;  4DK1 A;  4M8A A;  1U4R A;  2XRQ D;  4BY1 B;  1F9Q A;  3IL8 A;  1I4X A;  2ZXP A;  3J7A V;  3GTK B;  3TSS A;  3WDN A;  5C4X B;  1TU2 B;  1SE2 A;  1RJT A;  4DAV A;  4FXG C;  3S2D B;  4KN7 C;  4F7X A;  5A35 A;  1B9N A;  1DZ1 A;  4IFD H;  3QO2 A;  4NW2 A;  1PFN A;  2M00 A;  4KJO A;  1BXT A;  2CW0 C;  1YNJ D;  4KHZ A;  2YYZ A;  2KVM A;  2B2U C;  3OMC A;  4ZAI A;  4X3K A;  1QCB D;  4XTC S;  2R7Z B;  2RSO A;  4C3H B;  1OXX K;  1B9M A;  2KCC A;  4S3S A;  2AQ1 B;  2VB2 X;  3GP7 A;  1DOM A;  3NQT A;  2E75 C;  3S15 B;  1U4P A;  4ODG A;  4BY7 B;  1V1P B;  5COY A;  4KKS A;  1V1O A;  5JEA J;  4F87 A;  1BUV T;  1QNU A;  1I4P A;  4TSS A;  4C2M B;  4RHR A;  3D8G A;  2RBM A;  3TME A;  2PZT A;  4IAL A;  5CBA E;  4XDX A;  2A68 C;  2BA0 A;  3PIO 3;  3KBG A;  3E0J A;  3TZD A;  4KY7 A;  4C3I B;  4DAY A;  2LMC B;  3H6M A;  1Z6H A;  1ML0 D;  1DCZ A;  2B2Y A;  4A3I B;  2L55 A;  2A6E D;  4FNF A;  4V0B A;  3NHH A;  3T56 B;  2NVT B;  4HCE A;  3UI2 A;  3R3O A;  4PMB A;  4A3B B;  2AUK A;  3FEW X;  2VUM B;  3OOC A;  4XIG S;  1CZG A;  1SXT A;  1QJO A;  3TP5 A;  2K5W A;  1H9S B;  3KBX A;  3VYT A;  1SYC A;  5IGD A;  2A6E C;  1Q1E A;  2QEJ C;  4A3F B;  4CGY B;  4ABN A;  1XX8 A;  3VR2 A;  1H9J A;  2LS0 1;  1F2Y A;  3HG9 A;  1O80 A;  4RGN A;  4ZRZ A;  1D2B A;  1QNK A;  5TSS A;  2MHV A;  1PLF A;  2QCP X;  2E2D C;  2F3V A;  2D9U A;  2X69 A;  1BR9 A;  2ICI A;  4A3G B;  3ZYY X;  2ENB A;  1GOZ A;  1CQV A;  5EJW A;  5ELE A;  2O2L D;  4C1N K;  3RUZ A;  4G57 A;  5LHY 1;  3HOZ B;  5ISR A;  5IGC A;  3Q6S A;  2MPM A;  1WTQ A;  1MGS A;  1LLR D;  2G9H D;  2HDL A;  4IUQ A;  5CV4 A;  1JOQ A;  1FYC A;  2OEO A;  1B2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...