4RWSC

Crystal structure of cxcr4 and viral chemokine antagonist vmip-ii complex (psi community target)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
LGASCHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-X-C chemokine receptor type 4/Endolysin chimeric protein
publication title Structural biology. Crystal structure of the chemokine receptor CXCR4 in complex with a viral chemokine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, hydrolase
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rwsC00
1U4MA 3R93A 1B53A 2NZ1D 2RSOA 1DOKA 2JP1A 1WTPA 4HSVA 1ILPA 1RTNA 1F9QA 4HAEA 1VMCA 2K05A 3P7JA 2K28A 3DM1A 1MGSA 4X3SA 2Q8TA 3TN2A 5EJWA 1CA5A 1KNAA 1NCVA 1U4PA 4MN3A 2CVRA 1KNEA 2K1BA 1DOLA 5DNFA 1Q3LA 1SSOA 3GV6A 2L12A 2HCIA 5JJZA 1PDQA 1ESRA 1HHVA 2B2YC 2MGSA 2RSNA 4U68A 3UI2A 1RJTA 2X6LA 1EOTA 1AZQA 5CBEE 1NR2A 1O7ZA 5D65A 1B3AA 1PFMA 1PLFA 4XDXA 1WTOA 4X3KA 1G6ZA 4RWSC 1XYIA 2B2TA 2NYZD 3DEOA 1ZXTA 5EPJA 4HEDA 1B4OA 1PFBA 4QUCA 1AZPA 3MTSA 3I91A 4R9WA 2FINB 2HDLA 1BNZA 2L11A 1GUWA 4ZKCB 1HA6A 1HFGA 1EQTA 1X3QA 4CJ2C 2DY8A 4HCSA 1AP0A 2B2TC 1IKLA 3FPUB 1RODA 2B2WC 1NR4A 1F2LA 1A15A 1RHPA 4XT3B 1G91A 2L9HA 5E4XA 2L1BA 3N52A 1DOMA 2K04A 3I90A 4ZAIA 3TZDA 1QE6A 2FHTA 1QG7A 1SDFA 1JE4A 2DY7A 4IUVA 2RA4A 5AFWA 3H91A 2KUMA 1HUNA 2B2UA 3MWYW 1O7YA 1B50A 2N55A 1MSHA 1NAPA 5CBAE 1ILQA 1BO0A 2R3ZA 4XT1B 1M8AA 3ONAB 2JYOA 2KEDA 2MPMA 4RAUC 4X3UA 3D6WA 1PFNA 3GV3A 2MJ8A 5T1GA 4IUPA 1BBXC 1IKMA 1J9OA 3KUPA 1DONA 2D9UA 1B2TA 5T1IA 1J8IA 1IL8A 4ZKBB 1EIHA 4IUTA 5EKIA 4DN4M 1F9PA 1CM9A 2KEEA 2FMMA 5E4WC 1X3PA 4OIKA 5CORA 2HCCA 2X6GA 3DEPA 4O42A 1WTXA 2X69A 1HFNA 1G2SA 2J7ZA 2IL8A 2NWGA 1F9SA 2SDFA 1S4ZA 1F9RA 4ZLTF 1WVLA 1X32A 4MHEA 4CJ1B 4IUUA 1O80A 2B2VA 2L4NA 3IFDA 1BF4A 1WD1A 2XIWA 4IURA 4UAIA 1ML0D 1WTQA 1C8CA 5EQ0A 4ZK9B 1MI2A 1XX8A 3F2UA 2N88A 1U4LA 1E0BA 2EPBA 3FDTA 2HDMA 5EPKA 2H1EA 3I3CA 2HUGA 4CJ0B 5EPLA 2B2VC 2EOTA 1WTWA 2K03A 2Q8RE 2B2UC 1WD0A 1G2TA 1WTRA 3G7LA 3Q6SA 2B2YA 1JICA 1HUMA 5CMDA 1RTOA 2KECA 4NW2A 2MP1A 2VXWA 1EIGA 5COYA 5D14A 3HP3A 2BDNA 3QO2A 4OIJA 1CA6A 1MSGA 1QNKA 3LWEA 4X3TA 1SAPA 2RVLA 3I8ZA 1WTVA 4IUQA 2M2LA 1ICWA 2KOLA 1VMPA 3KBXA 3IL8A 2KVMA 2EE1A 4R8IA 2FJ2A 1DZ1A 1EL0A 1LV9A 2K01A 1TVXA 1U4RA 4RA8A 3SVMA 4LMQD 2B2WA 1HRJA 4QUFA 2FFKB
chains in the Genus database with same CATH superfamily
3T56B 3AU7A 3S2DB 3FHWA 1WJJA 1K8OA 2UUAL 1N8RC 1KNAA 1PZID 2I0QA 3GTOH 3W3AA 1HQMC 1OTCA 3GV6A 2F3IA 2HCIA 3NPPA 2UXBQ 2E2HB 4JPBW 1QOHA 1SNOA 2KQ3A 1I3QH 4LUVA 4CKBA 5C0XH 2OTJA 2NYZD 3J7AV 4BXXG 4ZKCB 1HFGA 2K5NA 4QF4A 3OTOQ 1QUQA 2B8FA 5CC4A 2F0DA 2WB1B 2VQFQ 4X6AH 4NXNL 5DM63 4A3KH 5I6YA 4DKAC 5JVG3 1LT6D 1A3UA 3N52A 3L7ZC 1K9MC 3MWYW 2L5TA 4A3FH 4K5VA 4JI3Q 1L0YB 1B7YB 3CHBD 3TREA 1SE4A 4A3GH 1G8ZD 5D3DA 4JI7Q 4YCUA 5CV4A 3DHQA 4OWXB 3RMHA 1A63A 1TY0A 2KBNA 2ASBA 4HN7A 1VQGA 4C3IH 3NWSA 4LF9L 2WKCA 1SNCA 4MHEA 2F0UA 1BF4A 3E0EA 4JI2Q 5EQ0A 4DR1L 3Q24A 2I5MX 1FVIA 4A93H 1EYDA 3I3CA 2HUGA 2KENA 1KRTA 4NXML 1VQAA 4JCVE 5IGFA 3RN2A 2VUMB 3Q6SA 3K5NA 5M3MB 2E2JB 5CMDA 1DGSA 3HOWB 4OWTB 1S5ED 2BDNA 1QNKA 4WJWA 3MFYA 2EXDA 1HPCA 2OQ0A 1J5EL 1XNQQ 3HOXB 1LTBD 3S16B 1I50H 4DV7Q 5IIFA 4IALA 5LL6X 2AUKA 3SVMA 2KHSA 1CKMA 1IW7C 1WFQA 5IYBH 1PTOB 1VQ6A 3OMCA 3K58A 1RL2A 4U673 1YJ9A 4Q0FA 4I65A 4ODGA 4DV6L 4A3EB 4B3ML 4IPDA 1G291 5D3IB 1EYAA 1I6HH 3OW2A 2B63G 4JBWA 3HZXA 4IFDH 1ESRA 5BN4A 2MGSA 5ELCA 1Y1WH 2HQEA 4U68A 1PH8A 2BA0A 2XN9C 3QB3A 4L5SA 5LMNW 1VQ9A 2IX1A 4A3DB 4L63B 1R4PB 2FINB 2K75A 3GTPB 2EDGA 2QGQA 1I94Q 3HFZB 2OCEA 4PV1C 3OOCA 4O1NA 1IBML 1Q46A 3TP6A 4IJLA 2L9HA 1SYEA 4FVMA 1QE6A 1KLGD 1U5KA 1QG7A 1MD2D 1P16A 4JVZA 4B3TL 1B50A 1B8AA 1LT3D 4PMCA 3FKIH 4XT1B 3GTMH 1FYCA 4RAUC 2SNMA 1J9OA 3KUPA 2LXJA 1KDCA 2BE5D 4M1UB 1GUSA 3PIO3 3HOZB 1Y8NB 3J7YW 2UU9L 1SXTA 3OHXC 5ELOA 4GN4B 4ZKBB 1GJXA 3VR4A 1Y14B 1LTID 1W3SA 3J81E 2QCPX 4OIKA 2X6GA 3DEPA 1Q90A 3J7ZC 3ZJYC 4XYOA 1HQRD 4JC0A 4YWMA 3J7AF 2SEBD 5FO9B 2G9DA 2P5ZX 4NDXA 4LNQA 1WCMG 3I4MH 1VQ8A 3BDOA 1PRTD 2N88A 2VB2X 3NBHA 1VDZA 4KHZA 3NTKA 3D31A 4GOPA 1VQMA 1X6OA 1WD0A 2R92H 2ICIA 1UE5A 1V1OA 2DUDA 1H95A 4BBSG 4ME5A 3PIPA 2N3SA 4OGQC 1SJED 3STBC 3HOVH 4G7HC 3TQYA 1EU3A 2LXKA 2B8GA 4X62L 3KBXA 1EZ6A 4GNXC 3I4MB 1DZ1A 4POFA 1HTLD 1TVXA 4HJ8A 1T9HA 4LF8Q 1TWAB 5IWAQ 3H3VI 4X65L 2EZVA 2BH2A 1R9TB 3GQBA 1WTPA 1X55A 2F3VA 4HSVA 2F0OA 1QCBD 1S5FD 3CCVA 2KCMA 2NVQH 2K28A 2PPBC 1JR0D 4Z9CB 5EJWA 4N8X1 2MO0A 1KD1C 2L12A 1NMFA 1EEID 5JJZA 2Z1CA 5J22A 5FJ8G 2X6LA 1LT5D 2RF4A 5CBEE 4DU9A 2PQEA 1B3AA 2UXBL 1JOQA 1X3EA 3HEJA 5J1ZA 5CGKA 4H02A 5E1FA 2QA4A 4HIKA 2ICEC 3NP8A 2CH4A 2A6EC 4JI0Q 3D4RA 1QZHA 1MIUA 3OTOL 5IYCG 2OWOA 3VA5A 2O2LD 1NR4A 1X56A 4A3JG 3NQTA 2VQFL 4HMJA 1Z47A 3TZDA 1QB5D 4RGOS 1D1IA 2V1CC 4BA1I 4ULLA 1SFOH 2VB3X 2C5CA 4CKCA 1JMCA 4OO1H 1S5DD 1EU4A 3PUYA 1S5BD 1IYUA 4X3UA 3GV3A 4EQNA 1IKMA 1KC8C 3Q22A 4JI3L 4WRDA 4DR3L 1V9PA 3PUZA 1D2BA 1KXLA 2F0JA 1QJOA 3FP9A 3A74A 2HQLA 3CCSA 1N32Q 1F2YA 4DPGA 1KRSA 1WVLA 1PFSA 4KY5A 3KYHC 2CH4W 1Y8OB 2K7VA 2E2DC 2F4IA 1U4LA 3RLFA 5IP9H 4AQYQ 1NJIC 2HDMA 3DLLA 2WP8J 4JI2L 1N36Q 5IT9E 2YYZA 2NVTB 1G2TA 1GOZA 1A62A 2B2YA 1JWSD 3BVZA 3G6JB 4ME3A 2VXWA 5ISRA 4RGNA 3TS2A 1V43A 3CKIB 3QO2A 4GOPC 4XTCS 4QJFA 4UY8C 4XQNA 4H44C 4ID6A 4P72A 1YNJD 1CQFA 1LYLA 3PQIA 5C3WA 2M2LA 3VDYA 4TKOB 2BA1A 2LKVA 3BYTB 3A5ZB 1PHJA 1EL0A 1D1KA 1LV9A 2YTXA 5K5PA 4DR5Q 1YHAA 5C0XI 4LF5Q 4BBRH 4LMQD 3Q23A 4FO2A 2CQAA 2TSSA 4IPGA 4N8FA 3CXCA 4DV7L 1PZKD 3TDQA 1XTCD 1YITA 2RSOA 1TWCH 3PSIA 5M5XH 5CV5A 4P73A 1K8MA 4K8IA 3TN2A 5A2QL 3I2ZA 2KHJA 1YIJA 5M3FB 5C6AA 5FO7B 5C4HA 5K36H 1XNRQ 2JJQA 5GQOA 2OQKA 2EYJA 3TSSA 3EVQA 1PH5A 4LW1A 1KAAA 3U4ZA 1XYIA 3S1MH 1B4OA 1PFBA 1TWCB 1Q1BA 4GS3A 2HDLA 3E6ZX 1ET6A 3IRBA 1IBKQ 5HGTA 1OXTA 3UDIA 4DA2A 1PVOA 1VQDA 2FMCA 4A3IH 3BYYB 3QG1A 3S24A 3RUZA 1HNZQ 1DOMA 1STHA 4CHTB 2MNAA 3J80L 2NTTA 3BS1A 3J81i 1H9MA 3M4YA 2PZWA 1TWFB 1TKWB 2O4XA 4L6TB 3U4VA 1YNND 2OF1A 3R3OA 2GN5A 2OT2A 4EVOA 3D6WA 5HURA 5CV6A 3ZYYX 1XPRA 5FLMG 1SNMA 1B2TA 4A3MG 4OX9L 3DWAA 2I5HA 3E0JA 3U50C 1GM5A 2YTVA 1JE5A 5JVH3 3N6RA 4K6LA 1D8LA 1FGUA 3MXNA 2A6HC 1NUCA 1HZ9A 2EY5A 1MI2A 3K5OA 3C2PA 3I7FA 3FDTA 4KK7A 1X9NA 4A3BG 5EPLA 1OO9B 2JA7G 3NENA 1CSQA 4MTNA 5C3EG 2QEXA 2JA5H 1JOKA 1LT4D 1LTGD 2J0TD 4BY7B 1MSGA 1K83B 1XPOA 2R93G 1AE3A 1IBLQ 2YU9H 2Z4HA 5IOCA 2KCTA 3H0GB 5LMUQ 2B2WA 3GTJH 2KCNA 2XRQD 4HCEA 2UXCQ 3EA6A 4MIUA 1Q12A 4LF8L 1N33Q 2JA8G 3GD7A 2EY6A 4HAEA 4L8JA 5C4XB 3AFPA 2Q8IB 4LFAL 3CQZH 4X66Q 3HOUG 2NBFA 2ZTEA 2XSCA 3BDLA 4JI4L 4IOCA 2UXDQ 4KLKA 1PRTB 4FF4A 4K6DA 2EVBA 4B3SQ 2WIIB 1VQ5A 3A5UA 3NTHA 4OELB 3SK5A 1O78A 1O7ZA 4GLVB 1PFMA 1C48A 4A3CH 5BR8Q 4DV0Q 2I5LX 3O13A 2H5XA 3HOYH 1GUTA 3RZOB 3H15A 1FL0A 4AH6A 1OXSC 1G91A 2EYOA 2WAQB 3KOJA 4JI0L 1T5XD 2F0TA 4IOAA 2RDHA 1CTMA 2IY5B 1BDOA 3D0FA 1TS4A 3H09A 2DY7A 3K59A 4CDEC 3SK4A 5C44H 2Z9HA 1ZKOA 2E2IH 2R3ZA 3VR6A 2ZT9C 3PO2G 2AHOB 3K7AB 4LAAA 5T1GA 3DUZA 4YWKA 3GTGH 4J8QA 4KKUA 3GTKB 4DV2Q 3WOFA 5CV7A 1CM9A 3QOJA 1K28A 2KEEA 3OIPA 2EYMA 1EWIA 1A3VA 1X3GA 2OXPA 2XTIA 3A8KE 3CCRA 5M5WB 1HNXQ 4LFBL 1I6VC 1HFNA 1VQJA 4ABNA 3ER0A 5IE8A 1HZAA 1P8LA 4KJOA 1N32L 4IUUA 1QVFA 1CUKA 4LWCA 2A74C 2XNAC 3C3LA 1YJNA 1U0LA 2I07B 4C3JG 3PO3B 2JE6I 1TS5A 1NSNS 1JORA 4BY1B 3X3MA 3K7UC 4X64L 1W2BA 1V1PA 3J81c 2F4VQ 1IHZA 1BCPF 4C1NK 3KF8B 3S1QB 1EIGA 2Z6KC 1E24A 4Q5VA 1GUGA 1IYVA 4QY7A 5J39A 2QDBA 1GUOA 1WTVA 1EWCA 2KOLA 1O7IA 1LTTD 4KD3A 1MJEA 2R6GA 5C3XA 4QIWE 4DR4Q 2A1AA 4DR5L 4DV3Q 4LF5L 2CW0D 3MXGA 2NZ1D 4LF6Q 2A8VA 2R7ZB 1VMCA 4DV4Q 4K0KQ 4X3SA 3S2DH 3EROA 4UP9A 2CVRA 1KNEA 2NN6H 5C0XG 2F0EA 2E75C 4RHSA 2RSNA 4JG2A 3F2BA 2MHVA 2D62A 4QQBX 2GVAA 3GO5A 1XNRL 2E2HH 3WOEA 5KRUA 5C4JB 3ULLA 4A3KG 1GHJA 5M9OA 3MAQA 3I91A 3KJOA 2L11A 1X3QA 2VS1A 3AMUA 4CJ2C 4C3HB 5E3FA 4MZ9A 3W1BA 4FF3A 4XT3B 5H1SE 4A3FG 1A3TA 3S14B 5M5YB 1Y1VB 4E6IA 3RLOA 1GXDC 1JJGA 4MNOA 1VS0A 4JV5Q 1YVCA 1B1ZA 2K50A 4A3GG 1YI2A 4R1JA 4P2CB 2JA6G 2K14A 3NSWA 2NVYB 4ZYSA 4RG1A 1LTAD 2EJFC 3VYTA 1DONA 4RKBA 1FNVA 1VQPA 1OXXK 2ZTCA 3SR1A 2SOBA 2ZM6Q 4C3IG 1NY4A 3DMUA 4KMUC 4JI1Q 4R4CA 1EQRA 1ESFA 1UAPA 2X69A 2IW3A 4P75A 4CDFC 4JBKA 1SYFA 4LF4Q 3BZDB 4A93G 1SNDA 4KN4C 1F9RA 1X32A 4GZYC 1CQVA 3TP7A 1Q7YC 1EFWA 3GP7A 3M85A 3P1HA 2VZAA 5JPNC 4CJ0B 3LWUA 5G3LD 4FDBA 3RD4A 3JAME 3KLSX 2B2UC 5JEAJ 1Q81C 3G7LA 3I72A 1X65A 4KTAA 2VUMH 1RIPA 5M3MH 2E2JH 2JEAI 1UWVA 3HOWH 4UHVA 1ASYA 4QIWB 5IYBG 4DV5L 3M4PA 4R4IA 1ENFA 2EE1A 5EKLA 3GTLB 2D2CC 3HOXH 2G9HD 3S16H 1PH3A 5IT9c 4B3RL 3R93A 1B53A 5LMUL 2UUCL 1PTOH 5F2DA 4XQJA 2IHFA 4IFDG 1PTOF 2GA4B 1N33L 4EQPA 1Y1WG 3RR5A 3BDCA 1NCVA 4K14A 4A3EH 2JK8A 5DNFA 4X66L 3NUCA 1IW7D 2EYLA 1KDAA 2DGYA 2RCFA 3BJUA 3U9SA 2UXDL 4DAVA 1Z6HA 4QCLA 5D65A 4DK1A 5LMNL 1PLFA 2AQ1B 1KLUD 3U9OA 1Q82C 5EPJA 2F52A 2RDGA 4DUYQ 4B9WA 1BQQT 4CDDC 5BR8L 2BCOA 2ZXPA 4R8NA 4A3DH 1B70B 1VQ4A 3GTPH 1WI5A 3WDNA 1CKNA 1L1OB 1U9RA 3BVGA 2PI2E 3FKIG 4EQOA 3FPPA 5DAUA 1VQKA 1EY0A 1RF2D 2M00A 2N78A 2F0NA 3GDEA 1E2ZA 4RH6A 5EKKA 4KHPQ 1IXRA 2L0CA 3UDGA 5KYIA 2E8GA 1PXUA 1FD7D 1AW7A 5EBDA 1J8IA 1IL8A 5I9OA 3S2HB 1TIID 3ND9A 2JQOA 3HOZH 2XVSA 2Q2UA 1H9SB 4DV2L 3TBIB 1SYCA 4WJ4A 1PZJD 2EJMA 3HS0C 1DJRD 1HNXL 4L5TA 1NTGA 4CJ1B 1O80A 1BXTA 2R92G 1C8CA 2K5DA 4LFCL 2AWNA 4FF1A 5EPKA 1M1KC 1HNWQ 3S17B 1WTWA 3FMCA 1SR3A 2DJFC 4DAYB 3HOVG 1LTSD 4IJHA 1BR9A 4XXEA 1II3A 2EXZA 1EYGA 5D14A 2F4VL 2SNSA 2MQHA 3D4WA 1DYQA 1NMGA 2F1MA 1I4HA 4QL5A 2LY7A 2WKDA 1N34L 4R8IA 3G6EA 1XXGA 2FJ2A 3KF8A 2BH8A 1U4RA 1MHWC 1I4PA 2ZXOA 4HJ7A 3CW2C 1YNXA 1U4MA 3STBD 1CZWA 1TWAH 2C9OA 1XMOL 2JP1A 4DR4L 1QVGA 4YWLA 3CMEA 3Q0AA 4KJNA 4DV3L 2Q2HA 1R9TH 4DNRB 2N49A 3DWQA 4LF6L 4HIOA 5KNBA 1SMYC 4DV4L 4K0KL 4ZRZA 3S9WA 3CMAA 4EQ5A 5GAEC 4DR6Q 1ZEQX 2B63B 5BN5A 1EOTA 1NNXA 2NZHA 1EY7A 4QB4A 4FXDA 3OSOA 2A69C 2JN4A 4HEDA 4RHRA 4KKTA 4FXKC 1EQTA 3URYA 1TQOA 4GKJQ 3SEBA 2DY8A 3C1EA 1B44D 1J6QA 1RODA 1A15A 3MZ5A 4HMIA 5E4XA 2K04A 2OTLA 1UNSA 4OO1G 2ZJRA 1JT8A 1EWHA 1O7LA 4AYBG 3HKSA 2A6ED 1K3BC 3JC66 3AB9A 3AFQA 3TS0A 3MHBA 5JEAH 3G71A 5I9PA 1M8AA 1QWYA 1TWGB 2MJ8A 4IUPA 2HT1A 3S15B 4RCOA 2F0FA 1XTDA 4KHVA 1F2ZA 4YHHQ 4FF2A 3Q8DA 1PYSB 2NTSA 5LL6S 2ZM6L 2CCZA 3P20A 4CGYB 5IP9G 3SGIA 3ICEA 2ATWA 4HJ5A 1MJCA 1KABA 1RKNA 2PQAB 4J15A 2TMPA 2NB0A 1XX8A 4DUZQ 1WCMB 3T13A 1G6PA 1ET9A 4B08A 2K03A 1XWEA 2B29A 1Q8IA 2JA9A 4K8JA 4NW2A 4KY7A 2NVTH 4PZ8A 4BBRG 2EY1A 3NTIA 1Y69U 5IP7H 4JI7L 4P71A 4BBSB 1ICWA 2MUYA 4N9PA 4EGVA 2NVXB 2NUCA 1LTLA 2L15A 1S3OA 1STGA 4JI5Q 2RHQB 3K8AA 2BOSA 4O2DA 5KYLA 1DOKA 4YY3Q 3AQQA 5K36G 3DM1A 1KAWA 1HJPA 5GROA 3PUWA 5BN3A 4L5QA 2PO4A 4IZ8A 1SSOA 5KEEA 2KJXA 5IYCH 3KLWA 5M3FH 4A3JH 1SNQA 1SE2A 1GKHA 4F8MA 1G6ZA 4NP5A 1BCPC 4GN5A 1XNQL 4QMGA 1BNZA 4A3IG 3HKZG 3A8JE 3I55A 3SK6A 3PF4A 4DUYL 3DWPA 4HCSA 5I2XA 1ICFB 5HY6A 1VQBA 3FPUB 1NBWA 3MXPA 4DR2Q 3I90A 4EX5A 4A3JB 3T1YQ 1LO5D 4P74A 3K5LA 1K3RA 1L1OA 2V4DA 2WACA 4IO9A 1MSHA 1NAPA 1ILQA 3KF6B 1PH9A 3CPFA 3PUVA 2JYOA 1WYDA 1TWFH 2MFIA 4KHPL 1EZ8A 1KIXA 4RGMA 4IUTA 1BOSA 4F7XA 1EY6A 3CCEA 1I94L 1TY2A 3A56A 4O42A 4Y7NH 1E2VA 1I5FA 3DM3A 3SDZA 3SE0A 3EBEA 1FGBD 2WAQE 3PIP3 2UUBQ 1NE3A 1H9SA 4UAIA 4FYDA 3M7GA 1RDPD 3K57A 4A76A 4DGZA 4DV1Q 2JA5G 2H1EA 5DEHA 2UUAQ 3EQLC 2PYKA 1HNWL 3D4DA 4HJ9A 1HUMA 2F0SA 2A6HD 4ZCKA 4A3LG 4Y7NB 1VQFA 1CK1A 1STYA 1EFID 2IT1A 1S40A 4DAYA 4BY7H 2VW9A 1K83H 2F0VA 2GVBA 2K01A 1W6JA 2PNRC 4HSPA 2R7DA 3VR5A 3MC0B 3CC2A 4IUNA 3JAMc 3H0GH 2JEBI 4XYQA 4LK1C 3IKJA 3LNNA 1V8QA 5C4XH 3K5MA 2PMZE 2EYFA 3CRKC 4A3CG 4JYAQ 2E74C 5EGTA 1SNPA 1D5XC 2B2YC 4IFDI 3HOYG 4JI8Q 1QVCA 4X3KA 3MEHA 3CF5A 1A8VA 2QEJC 1SRUA 1YHBA 1HA5A 4DXFA 1VQIA 4IPCA 1PH1A 1AEXA 5IWAL 2RHSB 3DXJC 3RZOH 1PTOD 5FO8B 5KIXA 5IGGA 5C44G 3NE5B 1VQHA 1TR5A 1XPUA 2PI2A 5JPMC 3M4OB 4IUVA 5AFWA 2WINB 3H91A 4K5WA 5IGDA 1EIYB 1O7YA 1EQVA 3RLNA 4NXMQ 1PTOC 2IPKD 4V0BA 4GNXB 5C5LA 2E5LQ 3D6CA 4PZ6A 4GKKQ 1FNUA 1GHKA 2XWBB 1Q8KA 3K7AH 3GTQB 2RDFA 3PV0A 4FP5D 1F9PA 5DM73 4DF7A 5CV9A 1HR0W 4RCNA 3GTKH 3VYRA 4A3MB 3F8TA 5FLXE 1F9SA 5M5WH 3ND8A 4J1MA 1S4ZA 1B9NA 2EJGC 2L4NA 2XIWA 1ML0D 2Z0SA 4ZQ3A 3D8GA 3G4SA 3KFUA 3KLRA 4YCWA 3RZDB 1H9KA 4DV6Q 2Z8LA 4B3MQ 4XQQA 4KY6A 3PO3H 4TSSA 4DUZL 1UUPA 3M7NA 4ZUIA 4S3SA 3CCLA 3R2TA 3VYUA 2PQAA 4BY1H 4A3BB 2PNHA 2KECA 3EJIA 5AJ3Q 1STBA 2IX0A 3K0XA 1ENCA 3L9AX 3T16A 3IFTA 2JA7B 3HP3A 3LWEA 5C3EB 3S1QH 4IN3A 2N8NA 3I8ZA 1X54A 3M3YB 2Y0SG 1M90C 4C2MB 1VMPA 3CCMA 3I4NG 2R93B 2QILA 3H3VH 4Y52H 2A73B 5DLQE 4QUFA 1FJGQ 2AMCB 1VF7A 2NN6G 3BZCA 1ILPA 1SJHD 1F9QA 2PMZB 4AQYL 3J81L 1SYBA 4R4QA 2Q8TA 3I73A 2JA8B 1N36L 2R7ZH 2NZOA 2LS01 3PUXA 4F88A 2A5HA 3PGZA 2VL6A 4OWWB 3HOUB 1Q3LA 5FOBB 1PMRA 4OONA 4WORA 1HH2P 2D0OA 1RJTA 2ES2A 1NR2A 4R4TA 3CAMA 4RWSC 3FEWX 2K5QA 1ZXTA 3ITPA 3C46A 2WB1G 1H9JA 5C4JH 3S1NB 3NK9A 3T4AC 5IODA 2C35B 5CV8A 1VQOA 3S1RB 2B2WC 4C3HH 3PO2H 1D6EC 1JWMD 2CWAA 4DR2L 4GLXA 1YZ6A 4ALPA 5JJIA 4GOPB 4M8AA 4UP7A 5ELBA 3SHLA 2Q2TA 3T1YL 1SN8A 2KUMA 2ID0A 3T51B 5M5YH 3S14H 1Y1VH 4CDCC 5IYDH 1JQYD 1SROA 1UE1A 1VQEA 3ONAB 2MPMA 4UP8A 3J7A5 4OO1I 1SYGA 2CKZB 1K73C 3A55A 2NVYH 1ENAA 4C3JH 3PO2B 3NEMA 1QZGA 1ZYRC 5EKIA 3KF6A 3CCQA 3OPOA 1IBKL 2FMMA 5E4WC 2DNCA 4X62Q 5A2QE 2HCCA 2R7FA 3KJPA 1VQ7A 4HTHA 1BBUA 1HNZL 3QWNA 4YIJA 5JJKA 3K6OA 3E9HA 2UUBL 4N9TA 3PIOA 2VUMG 1VQLA 2O5JC 3I4OA 2CQOA 1E22A 4RKLA 4C3JB 5M3MG 1OXVA 3H94A 2EOTA 3HOWG 1MBYA 2AQ3B 4DNIA 4DV1L 2H4OA 4H7BA 1B9MA 1D5MC 1AN8A 2Q2IA 4A4IA 1JCKB 4OIJA 4F87A 1L0WA 3HOXG 4JK1C 1Q1EA 5NUCA 3J80E 3TP8A 2PW5A 3TP5A 1JOOA 4HJAA 3GTLH 4A3EG 3MA2B 1EOVA 1HZBA 1RTNA 3K81C 1LABA 3ERQA 2K05A 3GTOB 4LUZA 2RCNA 4H0LC 3IAYA 1EY4A 5I6WA 1BKBA 4PZ7A 3SK8A 4KI0A 1PV4A 1BBWA 1HHVA 3CC4A 1EY8A 1I3QB 4JYAL 4A3DG 4JBMA 1N9WA 1IBLL 1STEA 3DEOA 4JI8L 1EYCA 5IT9L 4DR3Q 4GLAC 1HA6A 1I4XA 5JOBA 4PQXA 5CR3A 3VR2A 4A3KB 4DR7Q 3T1HQ 2JA6H 5IGCA 2UXCL 1AP0A 4R4OA 1JJCB 3I56A 1IKLA 4TVAB 1E1TA 4BXXH 2PZUA 1K0RA 2I46A 1SDFA 1PH7A 4A3FB 2PZTA 5C5MA 2DN8A 1E3PA 1HUNA 4J6HA 2N55A 4KD4A 5CBAE 1BO0A 4B3SL 2M9VA 4BWGB 4A3GB 3HOZG 2B39A 2JA6B 4DV0L 2E5LL 4GKKL 2WV6D 1SYDA 1TWHH 4GNXA 1MKHA 1GD7A 2JXMB 3S2HH 1X3PA 1RD9D 2ZTDA 4C3IB 5GAGC 1HXYD 3NWTA 2HHHQ 4ZLTF 1TXYA 5KNDA 2B2VA 4A93B 2HIVA 4PMBA 1D5ZC 1STAA 3AYHB 1EEFD 2K4KA 2Q8RE 1TWHB 1WTRA 1SE8A 1WTHA 5E7NA 3S17H 1DD2A 3X3NA 3RNUA 3T53B 3NBIA 5COYA 2D5DA 3CRLC 4O0AA 4CBVA 5AJ3L 4X3TA 1EQQA 3I4MG 5ELNA 1I50B 2FXQA 4DK0A 4G7OC 1JB3A 3BVMA 3IL8A 4FNFA 5KGUA 4QGUA 2G5DA 3AEVA 3HG9A 1HCZA 5TSSA 1QNUA 2AUJD 1IYJB 1I4GA 1FJGL 5HGQA 5IY0A 2IJ0A 1I6HB 1TS2A 4RMFA 1FR3A 4C1NI 1BUVT 4L5RC 2EIFA 2ENBA 3A54A 2K5WA 1Y1WB 2EY2A 2F0QA 3V2TA 4XDXA 3VR3A 2B63H 3CP0A 1KHIA 1SMYD 3W1GA 1UE7A 2EYPA 4QUCA 3MTSA 4MTKA 3KBGA 4DFAA 4OX9Q 5ELFA 3LX0A 2F0LA 1CZGA 3ERSX 3MXNB 1ASZA 2LSSA 3KLSA 2Z6BA 3U58A 3A7LA 1CT1D 2A69D 5JEAG 3M4QA 1XMQQ 1IZ6A 2BE5C 1JE4A 3I4LA 3FKIB 3GTMB 4AIMA 3R2IA 2F3WA 2LFNA 1A6XA 2DNEA 4AYBE 1YEZA 2F0KA 3UDXA 1HR0Q 1AE2A 4PG3A 2QW7A 1TWGH 4H13C 3S15H 1PRTC 3P75A 2OEOA 3V96A 2NWGA 4LJZC 3KDFB 2PW7A 1WD1A 2A19A 4IURA 5J3BA 3F2DA 4OXPA 2EPBA 4JV5L 2R92B 4LFAQ 3J80i 2B2VC 3LGJA 4NMZA 3TEHB 3CCUA 1C9OA 5EAYA 1TS3A 1WCMH 1JB7A 4JI4Q 5IP7G 2CWPA 1EIFA 5FLXL 3NHHA 5FLXc 1RTOA 3L3OC 3NQIA 3HOVB 4DXGA 3OWEB 1YJWA 5L37A 1SMXA 1CA6A 3OW7A 4JI1L 1SE3A 3JAMi 1SAPA 3G48A 3R8BA 3CU7A 2F0IA 2QF7A 3E9IA 2KVMA 4BBSH 4LF4L 4RA8A 3OIQA 2NVXH 2FFKB 2L1BA 1CSPA 2A68D 1JJ2A 2NVQB 1E1OA 4JOIA 4K5XA 2QKIC 4IQZA 2K6AA 4HIDA 1D7QA 3A7AB 5M3FG 1YHQA 1TT2A 1IL2A 1JC7A 1U4PA 2A68C 2NN6I 2B3GA 4NKLA 1PH6A 4KV6A 1SBBB 1R4QB 3CD6A 2VNUD 1WTOA 1ONLA 2B2TA 3M9BA 5G3LF 1AZPA 2MO1A 3E3XA 2VQEQ 5FJ8H 5A35A 1C4QA 3VYSA 3EFXD 1Z9FA 3F1ZA 4LFBQ 3PMFA 4K2LA 2F0MA 2RKSA 4JW0A 3UDFA 1F2LA 2HD3A 3QR8A 3T1HL 5C4ZA 4DR7L 5EBCA 3HKZE 1BCPD 2RQXA 1LTRD 5CYUA 3MFGA 3H3VC 1UEAB 1HTPA 2FHTA 1SFOB 4KKSA 1V1PB 5ELDA 1BVSA 4AYBB 1CKOA 4X64Q 2KEDA 3QOLA 1F77A 1BBXC 1H9RA 2AKWB 4UPAA 1I4RA 4DAMA 2XRSD 2E76C 1PH4A 5CORA 4WFN3 3OYYA 2IL8A 4G57A 1C7YA 3VA7A 3FRPB 2HHHL 1I4QA 1AFPA 4DNTB 3F2UA 3QJYA 1E0BA 1EUJA 1YNJC 4TQUS 3TMEA 1KDBA 4LF7Q 4BY7G 5FKAC 3A0JA 3NXWA 1KQSA 2VY3A 2ZXRA 1G51A 2PCFB 3KK7A 3FVQA 1GUNA 2RVLA 3H0GG 4JI6Q 4DK6C 3HGBA 4BBRB 2J4XA 1UEBA 1VCIA 3MVVA 1B3QA 1EY9A 2K5HA 3PF5A 1Q86C 2HIXA 5C4XG 3L2PA 5M5XB 4HR7B 1PA6A 1XJVA 2JSOA 4OEMB 3TRZA 2YV5A 3BZKA 4B9XA 4RGTA 1F2MA 1DM0B 1MGSA 1OXUA 3BU2A 1K8GA 4WJ3M 3SXHA 2K1BA 1DOLA 1CHQD 2KHIA 2Z4IA 4JOIC 3L0OA 1M4VA 2EQSA 3J80c 4CKEA 1PDQA 5GADC 1VQCA 3S1MB 3UI2A 1S72A 1AZQA 1QUQB 4OL7A 5JJLA 1LLRD 3BG3A 4R9WA 3JAML 4NXNQ 2WAQG 4A3IB 4V190 3HKZB 2B2TC 1Y8PB 2F03A 2BDOA 1RHPA 1W6KA 1YNNC 4ZUJA 1LM0A 4NB3A 4ILWA 3CC7A 3HRZC 5I4DA 4G4KA 3NELA 5JAVA 1GVPA 1QILA 2YTYA 4PMWA 1XMQL 2K52A 3V05A 1PRTF 3CPWA 3M4OH 1T5EA 4DR6L 3ULJA 4K2KA 2Z6KA 2LMCB 5C0XJ 2ZJQA 1HR0L 1PYBA 4GKJL 4YCVA 1A2TA 3GTQH 4DV5Q 1WTXA 4LF9Q 1V1QA 1G2SA 2XWJB 1CI3M 5FLMH 1A0IA 2SDFA 4A3MH 4PNYA 4A3LH 4DR1Q 4RFBA 3PO3G 4B3RQ 3IFDA 2IX3A 2UUCQ 4ZK9B 5IGEA 4BY1G 2RBMA 4DAPA 2IWHA 4UDUC 3CCJA 1S5CD 3KDFA 2K32A 4BA2I 1L1OC 2EYHA 3RZDH 3UE1A 2JA5B 1JICA 2MP1A 3B6YA 4A3BH 5GAHC 1J5EQ 1VF5C 1SLJA 2JA7H 5LMNQ 4YHHL 2YU9B 3WWVA 5C3EH 3GTJB 2XGTA 3M3YH 1JWUD 4OHJA 1CKNB 4C2MH 3W2DA 2R93H 4I7ZC 1Z7TA 1HRJA 4DK3C 2R7ZG 2KCCA 2D0PA 3PCOB 4TRDA 2Y0SE 3CQZB 1EY5A 2L55A 3C1FA 3P7JA 1DCZA 2QDLA 3EN2A 1A2UA 1CA5A 1WOCA 1CFMA 4MN3A 3MXUA 2JA8H 2AQ2B 1SEBD 1FNWA 1KL9A 3OMGA 1PH2A 3HOUH 4KN7C 2CFMA 1HZCA 4FXGC 2KA7A 3F2CA 1K0SA 4C56C 2AWOA 3HOYB 4C3HG 2K5VA 2ZJPA 4POGA 2F0GA 4IPHA 1GUWA 3K0YA 1IBMQ 2F0PA 3H6MA 1RCVD 3S1NH 2VQEL 4JI5L 4APVA 1PYWD 4YY3L 1VQNA 2WB1E 3S1RH 1Y1VG 4ZAIA 5IYDG 1L2FA 4B3TQ 2WFWA 3J81j 5C44B 4LFCQ 1KTKA 2E2IB 2RA4A 3K80C 2B2UA 1DXMA 4GN3B 4IFDJ 3GTGB 1E7ZA 1PFNA 2UU9Q 3EIVA 2D9UA 5T1IA 1EIHA 1GO3E 3A8IE 3E5SA 3QIAA 4DN4M 4JBJA 5KNCA 2F0HA 4LUOA 1N34Q 5I2YA 3NBHB 2J7ZA 1LUZA 2ALYB 3MEFA 4HIMA 1L0XB 1ZYRD 1YBYA 1WTQA 5LHY1 1XMOQ 3TZUA 1AH9A 5FK9C 1UE6A 4I7AA 4NPSA 3I4NH 1BCPB 2R61A 4BS9A 2F0WA 1C0AA 4XIGS 5IGBA 4A75A 3RN5A 2CHBD 2IHEA 1LACA 5ELEA 4G7ZC 1STNA 4LF7L 2CW0C 3D3RA 3OWFA 2O5IC 4IUQA 1CHPD 2DJGC 2K33A 1K8AC 1X3FA 3I70A 3UE0A 4X65Q 1TU2B 2Y0SB 3W5OA 4JI6L 3I4NB 1E2WA 3ULPA
chains in the Genus database with same CATH topology
3T56B 3AU7A 3S2DB 1K8OA 1KNAA 1PZID 3W3AA 1HQMC 3GV6A 2HCIA 3NPPA 2E2HB 1QOHA 1SNOA 2KQ3A 4CKBA 5C0XH 2NYZD 3J7AV 4ZKCB 1HFGA 4QF4A 2B8FA 5CC4A 2F0DA 2WB1B 5DM63 5I6YA 5JVG3 1LT6D 1A3UA 3N52A 3L7ZC 3MWYW 2L5TA 4K5VA 1L0YB 3CHBD 1SE4A 1G8ZD 5D3DA 5CV4A 3RMHA 3DHQA 1TY0A 4HN7A 3NWSA 2WKCA 1SNCA 4MHEA 2F0UA 1BF4A 5EQ0A 3Q24A 1EYDA 3I3CA 2HUGA 5IGFA 2VUMB 3Q6SA 3K5NA 5M3MB 2E2JB 5CMDA 3HOWB 1S5ED 2BDNA 1QNKA 4WJWA 3MFYA 1HPCA 3HOXB 1LTBD 3S16B 5IIFA 4IALA 5LL6X 2AUKA 3SVMA 2KHSA 1IW7C 1PTOB 3OMCA 3K58A 4U673 4Q0FA 4I65A 4ODGA 4A3EB 1G291 5D3IB 1EYAA 4JBWA 3HZXA 4IFDH 1ESRA 5BN4A 2MGSA 5ELCA 2HQEA 4U68A 2BA0A 2XN9C 3QB3A 2IX1A 4A3DB 4L63B 1R4PB 2FINB 3GTPB 2EDGA 4PV1C 3OOCA 4O1NA 3TP6A 2L9HA 1SYEA 4FVMA 1QE6A 1KLGD 1QG7A 1MD2D 1B50A 1LT3D 4PMCA 4XT1B 1FYCA 4RAUC 2SNMA 1J9OA 3KUPA 1KDCA 2BE5D 4M1UB 1GUSA 3PIO3 3HOZB 1Y8NB 3J7YW 1GJXA 1SXTA 3OHXC 4ZKBB 3VR4A 1LTID 3J81E 2QCPX 4OIKA 2X6GA 3DEPA 1Q90A 4XYOA 1HQRD 3J7AF 2SEBD 5FO9B 2G9DA 4NDXA 3BDOA 1PRTD 2N88A 2VB2X 3NBHA 1VDZA 4KHZA 3NTKA 3D31A 1WD0A 2ICIA 1V1OA 4ME5A 4OGQC 1SJED 4G7HC 1EU3A 2B8GA 3KBXA 1EZ6A 3I4MB 1DZ1A 1HTLD 1TVXA 1TWAB 2EZVA 1R9TB 3GQBA 1WTPA 2F3VA 4HSVA 2F0OA 1QCBD 1S5FD 2K28A 2PPBC 1JR0D 4Z9CB 5EJWA 2L12A 5J22A 1EEID 5JJZA 2Z1CA 2X6LA 1LT5D 5CBEE 4DU9A 2PQEA 1B3AA 1JOQA 3HEJA 5J1ZA 5CGKA 5E1FA 2ICEC 3NP8A 2A6EC 3D4RA 3VA5A 2O2LD 1NR4A 3NQTA 4HMJA 1Z47A 3TZDA 1QB5D 4RGOS 1D1IA 4BA1I 4ULLA 2VB3X 2C5CA 4CKCA 4OO1H 1S5DD 1EU4A 3PUYA 1S5BD 1IYUA 4X3UA 3GV3A 4EQNA 1IKMA 3Q22A 4WRDA 3PUZA 1D2BA 2F0JA 1QJOA 1F2YA 1WVLA 4KY5A 1Y8OB 2K7VA 2E2DC 2F4IA 1U4LA 3RLFA 2HDMA 2WP8J 5IT9E 2YYZA 2NVTB 1G2TA 1GOZA 2B2YA 1JWSD 3BVZA 3G6JB 2VXWA 5ISRA 4RGNA 1V43A 3CKIB 3QO2A 4XTCS 4XQNA 4H44C 4ID6A 1YNJD 1CQFA 5C3WA 2M2LA 4TKOB 2BA1A 2LKVA 3BYTB 1EL0A 1D1KA 1LV9A 5K5PA 5C0XI 4LMQD 3Q23A 4FO2A 2CQAA 2TSSA 1PZKD 3TDQA 1XTCD 2RSOA 5CV5A 1K8MA 4K8IA 3TN2A 5A2QL 5M3FB 5C6AA 5FO7B 5C4HA 5K36H 2EYJA 3TSSA 3EVQA 1KAAA 1XYIA 1B4OA 1PFBA 1TWCB 1Q1BA 2HDLA 3E6ZX 1ET6A 5HGTA 1OXTA 4DA2A 2FMCA 3BYYB 3QG1A 3RUZA 1DOMA 1STHA 4CHTB 3J80L 2NTTA 3BS1A 1H9MA 3M4YA 2PZWA 1TWFB 1TKWB 2O4XA 4L6TB 1YNND 2OF1A 3R3OA 4EVOA 2OT2A 3D6WA 5HURA 5CV6A 3ZYYX 1B2TA 1SNMA 3DWAA 3E0JA 5JVH3 3N6RA 4K6LA 3MXNA 2A6HC 1NUCA 2EY5A 1MI2A 3K5OA 3C2PA 3FDTA 4KK7A 5EPLA 1OO9B 1JOKA 1LT4D 1LTGD 2J0TD 4BY7B 1MSGA 1K83B 2Z4HA 5IOCA 3H0GB 2B2WA 2KCNA 2XRQD 4HCEA 4MIUA 3EA6A 1Q12A 3GD7A 2EY6A 4HAEA 4L8JA 5C4XB 2Q8IB 2NBFA 2XSCA 3BDLA 1PRTB 4FF4A 4K6DA 2EVBA 2WIIB 3NTHA 3SK5A 1O78A 1O7ZA 1PFMA 1C48A 3O13A 1GUTA 3RZOB 1OXSC 1G91A 2EYOA 2WAQB 1T5XD 2F0TA 2RDHA 1CTMA 1BDOA 1TS4A 3H09A 2DY7A 3K59A 3SK4A 1ZKOA 2R3ZA 3VR6A 2ZT9C 3K7AB 4LAAA 5T1GA 3DUZA 4J8QA 4KKUA 3GTKB 3WOFA 5CV7A 1CM9A 3QOJA 2KEEA 2EYMA 3OIPA 3A8KE 1A3VA 2OXPA 5M5WB 1I6VC 1HFNA 4ABNA 4KJOA 4IUUA 2A74C 2XNAC 3C3LA 2I07B 4C3JG 3PO3B 2JE6I 1TS5A 1NSNS 1JORA 4BY1B 3X3MA 1V1PA 1IHZA 1BCPF 4C1NK 3S1QB 1EIGA 4Q5VA 1GUGA 1IYVA 5J39A 2QDBA 1GUOA 1WTVA 1EWCA 2KOLA 1LTTD 4KD3A 2R6GA 5C3XA 2CW0D 3MXGA 2NZ1D 2R7ZB 1VMCA 4X3SA 3EROA 2CVRA 1KNEA 2NN6H 5C0XG 2F0EA 2E75C 4RHSA 2RSNA 2MHVA 2D62A 3GO5A 3WOEA 5KRUA 5C4JB 1GHJA 5M9OA 3MAQA 3I91A 2L11A 1X3QA 3AMUA 4CJ2C 4C3HB 5E3FA 4FF3A 4XT3B 1A3TA 3S14B 5M5YB 1Y1VB 4E6IA 1GXDC 1B1ZA 4P2CB 3NSWA 2NVYB 4ZYSA 1LTAD 2EJFC 3VYTA 1DONA 4RKBA 1FNVA 1OXXK 3SR1A 2SOBA 4C3IG 3DMUA 4KMUC 1ESFA 1UAPA 2X69A 2IW3A 1SYFA 3BZDB 1SNDA 4KN4C 1F9RA 1X32A 4GZYC 1CQVA 3TP7A 3GP7A 3M85A 3P1HA 5JPNC 4CJ0B 3LWUA 5G3LD 3RD4A 3JAME 3KLSX 2B2UC 5JEAJ 3G7LA 3I72A 4KTAA 2JEAI 4QIWB 1ENFA 2EE1A 5EKLA 3GTLB 2D2CC 2G9HD 3R93A 1B53A 1PTOH 5F2DA 4XQJA 4IFDG 1PTOF 2GA4B 4EQPA 3BDCA 1NCVA 4K14A 5DNFA 3NUCA 1IW7D 2EYLA 1KDAA 3U9SA 4DAVA 1Z6HA 4QCLA 5D65A 4DK1A 1PLFA 2AQ1B 1KLUD 3U9OA 5EPJA 2RDGA 4B9WA 1BQQT 2BCOA 2ZXPA 4R8NA 3WDNA 1U9RA 3BVGA 4EQOA 3FPPA 5DAUA 1EY0A 1RF2D 2M00A 2F0NA 1E2ZA 4RH6A 5EKKA 2L0CA 5KYIA 1PXUA 1FD7D 1AW7A 5EBDA 1J8IA 1IL8A 5I9OA 3S2HB 1TIID 3ND9A 2XVSA 1H9SB 3TBIB 1SYCA 1PZJD 2EJMA 3HS0C 1DJRD 4CJ1B 1O80A 1BXTA 1C8CA 2K5DA 2AWNA 4FF1A 5EPKA 3S17B 1WTWA 3FMCA 1LTSD 1BR9A 4XXEA 1II3A 2EXZA 5D14A 2SNSA 3D4WA 1DYQA 2F1MA 1I4HA 2LY7A 2WKDA 4R8IA 1XXGA 2FJ2A 3KF8A 1U4RA 2ZXOA 1I4PA 1U4MA 1CZWA 2C9OA 2JP1A 3Q0AA 4KJNA 4DNRB 3DWQA 5KNBA 1SMYC 4ZRZA 3S9WA 1ZEQX 2B63B 5BN5A 1EOTA 4QB4A 1EY7A 4FXDA 3OSOA 2A69C 4HEDA 4RHRA 4KKTA 4FXKC 1EQTA 3URYA 1TQOA 3SEBA 2DY8A 3C1EA 1B44D 1RODA 1A15A 3MZ5A 4HMIA 5E4XA 2K04A 1UNSA 4OO1G 1EWHA 1O7LA 2A6ED 3AB9A 3MHBA 5JEAH 5I9PA 1M8AA 1QWYA 1TWGB 2MJ8A 4IUPA 3S15B 4RCOA 2F0FA 4KHVA 1F2ZA 4FF2A 2NTSA 5LL6S 3P20A 4CGYB 1KABA 1RKNA 2TMPA 2NB0A 1XX8A 1WCMB 3T13A 1ET9A 4B08A 2K03A 1XWEA 1Q8IA 4K8JA 4NW2A 4KY7A 2EY1A 3NTIA 1Y69U 4BBSB 1ICWA 2MUYA 4N9PA 4EGVA 2NVXB 2NUCA 1STGA 2BOSA 5KYLA 1DOKA 5K36G 3DM1A 3PUWA 5BN3A 2PO4A 4IZ8A 1SSOA 5KEEA 2KJXA 1SNQA 1SE2A 4F8MA 1G6ZA 4NP5A 1BCPC 4QMGA 1BNZA 3A8JE 3SK6A 3DWPA 4HCSA 5I2XA 3FPUB 3MXPA 3I90A 4A3JB 1LO5D 3K5LA 2V4DA 2WACA 1MSHA 1NAPA 1ILQA 3PUVA 2JYOA 1EZ8A 4RGMA 4IUTA 1BOSA 4F7XA 1EY6A 1TY2A 3A56A 4O42A 1E2VA 3SDZA 3SE0A 1FGBD 3PIP3 1H9SA 4UAIA 4FYDA 3M7GA 1RDPD 3K57A 4DGZA 2H1EA 5DEHA 3EQLC 2PYKA 3D4DA 1HUMA 2F0SA 2A6HD 4Y7NB 1CK1A 1STYA 1EFID 2IT1A 4DAYA 2F0VA 2K01A 1W6JA 2PNRC 4HSPA 3VR5A 3MC0B 4IUNA 2JEBI 4XYQA 4LK1C 3IKJA 3LNNA 1V8QA 3K5MA 2EYFA 3CRKC 2E74C 5EGTA 1SNPA 1D5XC 2B2YC 4IFDI 4X3KA 3MEHA 2QEJC 1HA5A 4DXFA 1AEXA 3DXJC 1PTOD 5FO8B 5KIXA 5IGGA 3NE5B 1TR5A 5JPMC 3M4OB 4IUVA 5AFWA 2WINB 3H91A 4K5WA 5IGDA 1O7YA 1EQVA 1PTOC 2IPKD 4V0BA 5C5LA 3D6CA 1FNUA 1GHKA 2XWBB 3GTQB 2RDFA 3PV0A 4FP5D 1F9PA 5DM73 4DF7A 5CV9A 4RCNA 3VYRA 4A3MB 5FLXE 1F9SA 3ND8A 4J1MA 1S4ZA 1B9NA 2EJGC 2L4NA 2XIWA 1ML0D 4ZQ3A 3D8GA 3KLRA 3RZDB 1H9KA 2Z8LA 4XQQA 4KY6A 4TSSA 3M7NA 1UUPA 4ZUIA 4S3SA 3R2TA 3VYUA 4A3BB 2KECA 3EJIA 1STBA 2IX0A 2JA7B 1ENCA 3L9AX 3T16A 3IFTA 3HP3A 3LWEA 5C3EB 4IN3A 3I8ZA 3M3YB 4C2MB 1VMPA 2R93B 2QILA 2A73B 4QUFA 1VF7A 2NN6G 1ILPA 1SJHD 1F9QA 2PMZB 3J81L 1SYBA 2Q8TA 3I73A 2JA8B 2LS01 3PUXA 4F88A 2A5HA 3HOUB 1Q3LA 5FOBB 1PMRA 4WORA 1RJTA 1NR2A 4RWSC 3FEWX 2K5QA 1ZXTA 3ITPA 3C46A 1H9JA 3S1NB 3NK9A 3T4AC 5IODA 5CV8A 3S1RB 2B2WC 1D6EC 1JWMD 4M8AA 5ELBA 3SHLA 2KUMA 2ID0A 3T51B 1JQYD 3ONAB 2MPMA 4OO1I 1SYGA 3A55A 1ENAA 3PO2B 1ZYRC 5EKIA 3OPOA 2FMMA 5E4WC 2DNCA 5A2QE 2HCCA 4HTHA 3QWNA 4YIJA 3K6OA 4N9TA 2O5JC 4RKLA 4C3JB 1OXVA 3H94A 2EOTA 1MBYA 2AQ3B 2H4OA 4H7BA 1B9MA 1D5MC 1AN8A 1JCKB 4OIJA 4F87A 4JK1C 1Q1EA 5NUCA 3J80E 3TP8A 2PW5A 3TP5A 1JOOA 3MA2B 1RTNA 1LABA 3ERQA 2K05A 3GTOB 4H0LC 3IAYA 1EY4A 5I6WA 3SK8A 4KI0A 1HHVA 1EY8A 1I3QB 1STEA 3DEOA 1EYCA 5IT9L 1HA6A 1I4XA 5JOBA 4PQXA 5CR3A 3VR2A 4A3KB 1AP0A 5IGCA 1IKLA 2PZUA 2I46A 1SDFA 4A3FB 2PZTA 5C5MA 2DN8A 1HUNA 4J6HA 2N55A 4KD4A 5CBAE 1BO0A 2M9VA 4BWGB 4A3GB 2B39A 2JA6B 2WV6D 1SYDA 2JXMB 1X3PA 1RD9D 4C3IB 1HXYD 3NWTA 4ZLTF 5KNDA 2B2VA 4A93B 4PMBA 1D5ZC 1STAA 1EEFD 2Q8RE 1TWHB 1WTRA 1DD2A 3X3NA 3T53B 3NBIA 5COYA 2D5DA 3CRLC 4CBVA 4X3TA 1I50B 4DK0A 4G7OC 1JB3A 3BVMA 3IL8A 4FNFA 5KGUA 3HG9A 1HCZA 5TSSA 1QNUA 2AUJD 1I4GA 2IJ0A 1I6HB 1TS2A 4C1NI 1FR3A 1BUVT 2ENBA 3A54A 2K5WA 1Y1WB 2EY2A 2F0QA 3V2TA 4XDXA 3VR3A 1SMYD 2EYPA 4QUCA 3MTSA 3KBGA 4DFAA 5ELFA 3LX0A 2F0LA 1CZGA 3KLSA 3A7LA 1CT1D 2A69D 5JEAG 2BE5C 1JE4A 3I4LA 3FKIB 3GTMB 3R2IA 2F3WA 2LFNA 1A6XA 2DNEA 2F0KA 4H13C 1PRTC 3P75A 2OEOA 3V96A 2NWGA 4LJZC 2PW7A 1WD1A 4IURA 2EPBA 2R92B 2B2VC 4NMZA 1TS3A 5FLXL 3NHHA 1RTOA 3L3OC 3NQIA 3HOVB 4DXGA 3OWEB 1CA6A 3OW7A 1SE3A 1SAPA 3R8BA 3CU7A 2F0IA 2QF7A 2KVMA 4RA8A 3OIQA 2FFKB 2L1BA 2A68D 2NVQB 4K5XA 2QKIC 4IQZA 2K6AA 3A7AB 1TT2A 1JC7A 1U4PA 2A68C 2NN6I 4NKLA 4KV6A 1SBBB 1R4QB 2VNUD 1WTOA 1ONLA 2B2TA 5G3LF 1AZPA 5A35A 1C4QA 3VYSA 3EFXD 3PMFA 4K2LA 2F0MA 2RKSA 1F2LA 5C4ZA 5EBCA 1BCPD 2RQXA 1LTRD 5CYUA 3MFGA 3H3VC 1UEAB 1HTPA 2FHTA 1SFOB 4KKSA 1V1PB 5ELDA 4AYBB 2KEDA 3QOLA 1F77A 1BBXC 1H9RA 1I4RA 2XRSD 2E76C 5CORA 4WFN3 2IL8A 4G57A 3VA7A 3FRPB 1I4QA 1AFPA 4DNTB 3F2UA 3QJYA 1E0BA 4TQUS 1YNJC 3TMEA 1KDBA 5FKAC 3NXWA 2ZXRA 2PCFB 3KK7A 3FVQA 1GUNA 2RVLA 3HGBA 4BBRB 2J4XA 1VCIA 3MVVA 1EY9A 5M5XB 4HR7B 2JSOA 4B9XA 4RGTA 1F2MA 1DM0B 1MGSA 1OXUA 3SXHA 2K1BA 1DOLA 1CHQD 2Z4IA 1M4VA 4CKEA 1PDQA 3S1MB 3UI2A 1AZQA 4OL7A 1LLRD 3BG3A 4R9WA 3JAML 4A3IB 4V190 3HKZB 2B2TC 1Y8PB 2F03A 2BDOA 1RHPA 1W6KA 1YNNC 4ZUJA 4ILWA 3HRZC 5I4DA 4G4KA 5JAVA 1QILA 4PMWA 3V05A 1PRTF 1T5EA 4K2KA 2LMCB 5C0XJ 1A2TA 1WTXA 1G2SA 2XWJB 1CI3M 2SDFA 4PNYA 4RFBA 3IFDA 2IX3A 4ZK9B 5IGEA 2RBMA 4DAPA 2IWHA 4UDUC 1S5CD 4BA2I 2K32A 2EYHA 2JA5B 1JICA 2MP1A 1VF5C 2YU9B 3GTJB 1JWUD 4OHJA 3W2DA 4I7ZC 1Z7TA 1HRJA 2KCCA 4TRDA 3CQZB 1EY5A 2L55A 3C1FA 3P7JA 1DCZA 1A2UA 1CA5A 1CFMA 4MN3A 3MXUA 2AQ2B 1SEBD 1FNWA 3OMGA 4KN7C 4FXGC 2KA7A 4C56C 2AWOA 3HOYB 4C3HG 2F0GA 1GUWA 3K0YA 2F0PA 3H6MA 1RCVD 1PYWD 4ZAIA 5C44B 1KTKA 2E2IB 2RA4A 2B2UA 1DXMA 4IFDJ 3GTGB 1PFNA 2D9UA 5T1IA 1EIHA 3A8IE 3E5SA 3QIAA 4DN4M 5KNCA 2F0HA 5I2YA 2J7ZA 1L0XB 1ZYRD 1WTQA 5LHY1 3TZUA 5FK9C 1BCPB 2R61A 4BS9A 2F0WA 4XIGS 5IGBA 2CHBD 1LACA 5ELEA 4G7ZC 1STNA 2CW0C 3D3RA 3OWFA 2O5IC 4IUQA 1CHPD 2K33A 3I70A 1TU2B 2Y0SB 3I4NB 1E2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4M A;  3R93 A;  1B53 A;  2NZ1 D;  2RSO A;  1DOK A;  2JP1 A;  1WTP A;  4HSV A;  1ILP A;  1RTN A;  1F9Q A;  4HAE A;  1VMC A;  2K05 A;  3P7J A;  2K28 A;  3DM1 A;  1MGS A;  4X3S A;  2Q8T A;  3TN2 A;  5EJW A;  1CA5 A;  1KNA A;  1NCV A;  1U4P A;  4MN3 A;  2CVR A;  1KNE A;  2K1B A;  1DOL A;  5DNF A;  1Q3L A;  1SSO A;  3GV6 A;  2L12 A;  2HCI A;  5JJZ A;  1PDQ A;  1ESR A;  1HHV A;  2B2Y C;  2MGS A;  2RSN A;  4U68 A;  3UI2 A;  1RJT A;  2X6L A;  1EOT A;  1AZQ A;  5CBE E;  1NR2 A;  1O7Z A;  5D65 A;  1B3A A;  1PFM A;  1PLF A;  4XDX A;  1WTO A;  4X3K A;  1G6Z A;  4RWS C;  1XYI A;  2B2T A;  2NYZ D;  3DEO A;  1ZXT A;  5EPJ A;  4HED A;  1B4O A;  1PFB A;  4QUC A;  1AZP A;  3MTS A;  3I91 A;  4R9W A;  2FIN B;  2HDL A;  1BNZ A;  2L11 A;  1GUW A;  4ZKC B;  1HA6 A;  1HFG A;  1EQT A;  1X3Q A;  4CJ2 C;  2DY8 A;  4HCS A;  1AP0 A;  2B2T C;  1IKL A;  3FPU B;  1ROD A;  2B2W C;  1NR4 A;  1F2L A;  1A15 A;  1RHP A;  4XT3 B;  1G91 A;  2L9H A;  5E4X A;  2L1B A;  3N52 A;  1DOM A;  2K04 A;  3I90 A;  4ZAI A;  3TZD A;  1QE6 A;  2FHT A;  1QG7 A;  1SDF A;  1JE4 A;  2DY7 A;  4IUV A;  2RA4 A;  5AFW A;  3H91 A;  2KUM A;  1HUN A;  2B2U A;  3MWY W;  1O7Y A;  1B50 A;  2N55 A;  1MSH A;  1NAP A;  5CBA E;  1ILQ A;  1BO0 A;  2R3Z A;  4XT1 B;  1M8A A;  3ONA B;  2JYO A;  2KED A;  2MPM A;  4RAU C;  4X3U A;  3D6W A;  1PFN A;  3GV3 A;  2MJ8 A;  5T1G A;  4IUP A;  1BBX C;  1IKM A;  1J9O A;  3KUP A;  1DON A;  2D9U A;  1B2T A;  5T1I A;  1J8I A;  1IL8 A;  4ZKB B;  1EIH A;  4IUT A;  5EKI A;  4DN4 M;  1F9P A;  1CM9 A;  2KEE A;  2FMM A;  5E4W C;  1X3P A;  4OIK A;  5COR A;  2HCC A;  2X6G A;  3DEP A;  4O42 A;  1WTX A;  2X69 A;  1HFN A;  1G2S A;  2J7Z A;  2IL8 A;  2NWG A;  1F9S A;  2SDF A;  1S4Z A;  1F9R A;  4ZLT F;  1WVL A;  1X32 A;  4MHE A;  4CJ1 B;  4IUU A;  1O80 A;  2B2V A;  2L4N A;  3IFD A;  1BF4 A;  1WD1 A;  2XIW A;  4IUR A;  4UAI A;  1ML0 D;  1WTQ A;  1C8C A;  5EQ0 A;  4ZK9 B;  1MI2 A;  1XX8 A;  3F2U A;  2N88 A;  1U4L A;  1E0B A;  2EPB A;  3FDT A;  2HDM A;  5EPK A;  2H1E A;  3I3C A;  2HUG A;  4CJ0 B;  5EPL A;  2B2V C;  2EOT A;  1WTW A;  2K03 A;  2Q8R E;  2B2U C;  1WD0 A;  1G2T A;  1WTR A;  3G7L A;  3Q6S A;  2B2Y A;  1JIC A;  1HUM A;  5CMD A;  1RTO A;  2KEC A;  4NW2 A;  2MP1 A;  2VXW A;  1EIG A;  5COY A;  5D14 A;  3HP3 A;  2BDN A;  3QO2 A;  4OIJ A;  1CA6 A;  1MSG A;  1QNK A;  3LWE A;  4X3T A;  1SAP A;  2RVL A;  3I8Z A;  1WTV A;  4IUQ A;  2M2L A;  1ICW A;  2KOL A;  1VMP A;  3KBX A;  3IL8 A;  2KVM A;  2EE1 A;  4R8I A;  2FJ2 A;  1DZ1 A;  1EL0 A;  1LV9 A;  2K01 A;  1TVX A;  1U4R A;  4RA8 A;  3SVM A;  4LMQ D;  2B2W A;  1HRJ A;  4QUF A;  2FFK B; 
#chains in the Genus database with same CATH topology
 3T56 B;  3AU7 A;  3S2D B;  3FHW A;  1WJJ A;  1K8O A;  2UUA L;  1N8R C;  1KNA A;  1PZI D;  2I0Q A;  3GTO H;  3W3A A;  1HQM C;  1OTC A;  3GV6 A;  2F3I A;  2HCI A;  3NPP A;  2UXB Q;  2E2H B;  4JPB W;  1QOH A;  1SNO A;  2KQ3 A;  1I3Q H;  4LUV A;  4CKB A;  5C0X H;  2OTJ A;  2NYZ D;  3J7A V;  4BXX G;  4ZKC B;  1HFG A;  2K5N A;  4QF4 A;  3OTO Q;  1QUQ A;  2B8F A;  5CC4 A;  2F0D A;  2WB1 B;  2VQF Q;  4X6A H;  4NXN L;  5DM6 3;  4A3K H;  5I6Y A;  4DKA C;  5JVG 3;  1LT6 D;  1A3U A;  3N52 A;  3L7Z C;  1K9M C;  3MWY W;  2L5T A;  4A3F H;  4K5V A;  4JI3 Q;  1L0Y B;  1B7Y B;  3CHB D;  3TRE A;  1SE4 A;  4A3G H;  1G8Z D;  5D3D A;  4JI7 Q;  4YCU A;  5CV4 A;  3DHQ A;  4OWX B;  3RMH A;  1A63 A;  1TY0 A;  2KBN A;  2ASB A;  4HN7 A;  1VQG A;  4C3I H;  3NWS A;  4LF9 L;  2WKC A;  1SNC A;  4MHE A;  2F0U A;  1BF4 A;  3E0E A;  4JI2 Q;  5EQ0 A;  4DR1 L;  3Q24 A;  2I5M X;  1FVI A;  4A93 H;  1EYD A;  3I3C A;  2HUG A;  2KEN A;  1KRT A;  4NXM L;  1VQA A;  4JCV E;  5IGF A;  3RN2 A;  2VUM B;  3Q6S A;  3K5N A;  5M3M B;  2E2J B;  5CMD A;  1DGS A;  3HOW B;  4OWT B;  1S5E D;  2BDN A;  1QNK A;  4WJW A;  3MFY A;  2EXD A;  1HPC A;  2OQ0 A;  1J5E L;  1XNQ Q;  3HOX B;  1LTB D;  3S16 B;  1I50 H;  4DV7 Q;  5IIF A;  4IAL A;  5LL6 X;  2AUK A;  3SVM A;  2KHS A;  1CKM A;  1IW7 C;  1WFQ A;  5IYB H;  1PTO B;  1VQ6 A;  3OMC A;  3K58 A;  1RL2 A;  4U67 3;  1YJ9 A;  4Q0F A;  4I65 A;  4ODG A;  4DV6 L;  4A3E B;  4B3M L;  4IPD A;  1G29 1;  5D3I B;  1EYA A;  1I6H H;  3OW2 A;  2B63 G;  4JBW A;  3HZX A;  4IFD H;  1ESR A;  5BN4 A;  2MGS A;  5ELC A;  1Y1W H;  2HQE A;  4U68 A;  1PH8 A;  2BA0 A;  2XN9 C;  3QB3 A;  4L5S A;  5LMN W;  1VQ9 A;  2IX1 A;  4A3D B;  4L63 B;  1R4P B;  2FIN B;  2K75 A;  3GTP B;  2EDG A;  2QGQ A;  1I94 Q;  3HFZ B;  2OCE A;  4PV1 C;  3OOC A;  4O1N A;  1IBM L;  1Q46 A;  3TP6 A;  4IJL A;  2L9H A;  1SYE A;  4FVM A;  1QE6 A;  1KLG D;  1U5K A;  1QG7 A;  1MD2 D;  1P16 A;  4JVZ A;  4B3T L;  1B50 A;  1B8A A;  1LT3 D;  4PMC A;  3FKI H;  4XT1 B;  3GTM H;  1FYC A;  4RAU C;  2SNM A;  1J9O A;  3KUP A;  2LXJ A;  1KDC A;  2BE5 D;  4M1U B;  1GUS A;  3PIO 3;  3HOZ B;  1Y8N B;  3J7Y W;  2UU9 L;  1SXT A;  3OHX C;  5ELO A;  4GN4 B;  4ZKB B;  1GJX A;  3VR4 A;  1Y14 B;  1LTI D;  1W3S A;  3J81 E;  2QCP X;  4OIK A;  2X6G A;  3DEP A;  1Q90 A;  3J7Z C;  3ZJY C;  4XYO A;  1HQR D;  4JC0 A;  4YWM A;  3J7A F;  2SEB D;  5FO9 B;  2G9D A;  2P5Z X;  4NDX A;  4LNQ A;  1WCM G;  3I4M H;  1VQ8 A;  3BDO A;  1PRT D;  2N88 A;  2VB2 X;  3NBH A;  1VDZ A;  4KHZ A;  3NTK A;  3D31 A;  4GOP A;  1VQM A;  1X6O A;  1WD0 A;  2R92 H;  2ICI A;  1UE5 A;  1V1O A;  2DUD A;  1H95 A;  4BBS G;  4ME5 A;  3PIP A;  2N3S A;  4OGQ C;  1SJE D;  3STB C;  3HOV H;  4G7H C;  3TQY A;  1EU3 A;  2LXK A;  2B8G A;  4X62 L;  3KBX A;  1EZ6 A;  4GNX C;  3I4M B;  1DZ1 A;  4POF A;  1HTL D;  1TVX A;  4HJ8 A;  1T9H A;  4LF8 Q;  1TWA B;  5IWA Q;  3H3V I;  4X65 L;  2EZV A;  2BH2 A;  1R9T B;  3GQB A;  1WTP A;  1X55 A;  2F3V A;  4HSV A;  2F0O A;  1QCB D;  1S5F D;  3CCV A;  2KCM A;  2NVQ H;  2K28 A;  2PPB C;  1JR0 D;  4Z9C B;  5EJW A;  4N8X 1;  2MO0 A;  1KD1 C;  2L12 A;  1NMF A;  1EEI D;  5JJZ A;  2Z1C A;  5J22 A;  5FJ8 G;  2X6L A;  1LT5 D;  2RF4 A;  5CBE E;  4DU9 A;  2PQE A;  1B3A A;  2UXB L;  1JOQ A;  1X3E A;  3HEJ A;  5J1Z A;  5CGK A;  4H02 A;  5E1F A;  2QA4 A;  4HIK A;  2ICE C;  3NP8 A;  2CH4 A;  2A6E C;  4JI0 Q;  3D4R A;  1QZH A;  1MIU A;  3OTO L;  5IYC G;  2OWO A;  3VA5 A;  2O2L D;  1NR4 A;  1X56 A;  4A3J G;  3NQT A;  2VQF L;  4HMJ A;  1Z47 A;  3TZD A;  1QB5 D;  4RGO S;  1D1I A;  2V1C C;  4BA1 I;  4ULL A;  1SFO H;  2VB3 X;  2C5C A;  4CKC A;  1JMC A;  4OO1 H;  1S5D D;  1EU4 A;  3PUY A;  1S5B D;  1IYU A;  4X3U A;  3GV3 A;  4EQN A;  1IKM A;  1KC8 C;  3Q22 A;  4JI3 L;  4WRD A;  4DR3 L;  1V9P A;  3PUZ A;  1D2B A;  1KXL A;  2F0J A;  1QJO A;  3FP9 A;  3A74 A;  2HQL A;  3CCS A;  1N32 Q;  1F2Y A;  4DPG A;  1KRS A;  1WVL A;  1PFS A;  4KY5 A;  3KYH C;  2CH4 W;  1Y8O B;  2K7V A;  2E2D C;  2F4I A;  1U4L A;  3RLF A;  5IP9 H;  4AQY Q;  1NJI C;  2HDM A;  3DLL A;  2WP8 J;  4JI2 L;  1N36 Q;  5IT9 E;  2YYZ A;  2NVT B;  1G2T A;  1GOZ A;  1A62 A;  2B2Y A;  1JWS D;  3BVZ A;  3G6J B;  4ME3 A;  2VXW A;  5ISR A;  4RGN A;  3TS2 A;  1V43 A;  3CKI B;  3QO2 A;  4GOP C;  4XTC S;  4QJF A;  4UY8 C;  4XQN A;  4H44 C;  4ID6 A;  4P72 A;  1YNJ D;  1CQF A;  1LYL A;  3PQI A;  5C3W A;  2M2L A;  3VDY A;  4TKO B;  2BA1 A;  2LKV A;  3BYT B;  3A5Z B;  1PHJ A;  1EL0 A;  1D1K A;  1LV9 A;  2YTX A;  5K5P A;  4DR5 Q;  1YHA A;  5C0X I;  4LF5 Q;  4BBR H;  4LMQ D;  3Q23 A;  4FO2 A;  2CQA A;  2TSS A;  4IPG A;  4N8F A;  3CXC A;  4DV7 L;  1PZK D;  3TDQ A;  1XTC D;  1YIT A;  2RSO A;  1TWC H;  3PSI A;  5M5X H;  5CV5 A;  4P73 A;  1K8M A;  4K8I A;  3TN2 A;  5A2Q L;  3I2Z A;  2KHJ A;  1YIJ A;  5M3F B;  5C6A A;  5FO7 B;  5C4H A;  5K36 H;  1XNR Q;  2JJQ A;  5GQO A;  2OQK A;  2EYJ A;  3TSS A;  3EVQ A;  1PH5 A;  4LW1 A;  1KAA A;  3U4Z A;  1XYI A;  3S1M H;  1B4O A;  1PFB A;  1TWC B;  1Q1B A;  4GS3 A;  2HDL A;  3E6Z X;  1ET6 A;  3IRB A;  1IBK Q;  5HGT A;  1OXT A;  3UDI A;  4DA2 A;  1PVO A;  1VQD A;  2FMC A;  4A3I H;  3BYY B;  3QG1 A;  3S24 A;  3RUZ A;  1HNZ Q;  1DOM A;  1STH A;  4CHT B;  2MNA A;  3J80 L;  2NTT A;  3BS1 A;  3J81 i;  1H9M A;  3M4Y A;  2PZW A;  1TWF B;  1TKW B;  2O4X A;  4L6T B;  3U4V A;  1YNN D;  2OF1 A;  3R3O A;  2GN5 A;  2OT2 A;  4EVO A;  3D6W A;  5HUR A;  5CV6 A;  3ZYY X;  1XPR A;  5FLM G;  1SNM A;  1B2T A;  4A3M G;  4OX9 L;  3DWA A;  2I5H A;  3E0J A;  3U50 C;  1GM5 A;  2YTV A;  1JE5 A;  5JVH 3;  3N6R A;  4K6L A;  1D8L A;  1FGU A;  3MXN A;  2A6H C;  1NUC A;  1HZ9 A;  2EY5 A;  1MI2 A;  3K5O A;  3C2P A;  3I7F A;  3FDT A;  4KK7 A;  1X9N A;  4A3B G;  5EPL A;  1OO9 B;  2JA7 G;  3NEN A;  1CSQ A;  4MTN A;  5C3E G;  2QEX A;  2JA5 H;  1JOK A;  1LT4 D;  1LTG D;  2J0T D;  4BY7 B;  1MSG A;  1K83 B;  1XPO A;  2R93 G;  1AE3 A;  1IBL Q;  2YU9 H;  2Z4H A;  5IOC A;  2KCT A;  3H0G B;  5LMU Q;  2B2W A;  3GTJ H;  2KCN A;  2XRQ D;  4HCE A;  2UXC Q;  3EA6 A;  4MIU A;  1Q12 A;  4LF8 L;  1N33 Q;  2JA8 G;  3GD7 A;  2EY6 A;  4HAE A;  4L8J A;  5C4X B;  3AFP A;  2Q8I B;  4LFA L;  3CQZ H;  4X66 Q;  3HOU G;  2NBF A;  2ZTE A;  2XSC A;  3BDL A;  4JI4 L;  4IOC A;  2UXD Q;  4KLK A;  1PRT B;  4FF4 A;  4K6D A;  2EVB A;  4B3S Q;  2WII B;  1VQ5 A;  3A5U A;  3NTH A;  4OEL B;  3SK5 A;  1O78 A;  1O7Z A;  4GLV B;  1PFM A;  1C48 A;  4A3C H;  5BR8 Q;  4DV0 Q;  2I5L X;  3O13 A;  2H5X A;  3HOY H;  1GUT A;  3RZO B;  3H15 A;  1FL0 A;  4AH6 A;  1OXS C;  1G91 A;  2EYO A;  2WAQ B;  3KOJ A;  4JI0 L;  1T5X D;  2F0T A;  4IOA A;  2RDH A;  1CTM A;  2IY5 B;  1BDO A;  3D0F A;  1TS4 A;  3H09 A;  2DY7 A;  3K59 A;  4CDE C;  3SK4 A;  5C44 H;  2Z9H A;  1ZKO A;  2E2I H;  2R3Z A;  3VR6 A;  2ZT9 C;  3PO2 G;  2AHO B;  3K7A B;  4LAA A;  5T1G A;  3DUZ A;  4YWK A;  3GTG H;  4J8Q A;  4KKU A;  3GTK B;  4DV2 Q;  3WOF A;  5CV7 A;  1CM9 A;  3QOJ A;  1K28 A;  2KEE A;  3OIP A;  2EYM A;  1EWI A;  1A3V A;  1X3G A;  2OXP A;  2XTI A;  3A8K E;  3CCR A;  5M5W B;  1HNX Q;  4LFB L;  1I6V C;  1HFN A;  1VQJ A;  4ABN A;  3ER0 A;  5IE8 A;  1HZA A;  1P8L A;  4KJO A;  1N32 L;  4IUU A;  1QVF A;  1CUK A;  4LWC A;  2A74 C;  2XNA C;  3C3L A;  1YJN A;  1U0L A;  2I07 B;  4C3J G;  3PO3 B;  2JE6 I;  1TS5 A;  1NSN S;  1JOR A;  4BY1 B;  3X3M A;  3K7U C;  4X64 L;  1W2B A;  1V1P A;  3J81 c;  2F4V Q;  1IHZ A;  1BCP F;  4C1N K;  3KF8 B;  3S1Q B;  1EIG A;  2Z6K C;  1E24 A;  4Q5V A;  1GUG A;  1IYV A;  4QY7 A;  5J39 A;  2QDB A;  1GUO A;  1WTV A;  1EWC A;  2KOL A;  1O7I A;  1LTT D;  4KD3 A;  1MJE A;  2R6G A;  5C3X A;  4QIW E;  4DR4 Q;  2A1A A;  4DR5 L;  4DV3 Q;  4LF5 L;  2CW0 D;  3MXG A;  2NZ1 D;  4LF6 Q;  2A8V A;  2R7Z B;  1VMC A;  4DV4 Q;  4K0K Q;  4X3S A;  3S2D H;  3ERO A;  4UP9 A;  2CVR A;  1KNE A;  2NN6 H;  5C0X G;  2F0E A;  2E75 C;  4RHS A;  2RSN A;  4JG2 A;  3F2B A;  2MHV A;  2D62 A;  4QQB X;  2GVA A;  3GO5 A;  1XNR L;  2E2H H;  3WOE A;  5KRU A;  5C4J B;  3ULL A;  4A3K G;  1GHJ A;  5M9O A;  3MAQ A;  3I91 A;  3KJO A;  2L11 A;  1X3Q A;  2VS1 A;  3AMU A;  4CJ2 C;  4C3H B;  5E3F A;  4MZ9 A;  3W1B A;  4FF3 A;  4XT3 B;  5H1S E;  4A3F G;  1A3T A;  3S14 B;  5M5Y B;  1Y1V B;  4E6I A;  3RLO A;  1GXD C;  1JJG A;  4MNO A;  1VS0 A;  4JV5 Q;  1YVC A;  1B1Z A;  2K50 A;  4A3G G;  1YI2 A;  4R1J A;  4P2C B;  2JA6 G;  2K14 A;  3NSW A;  2NVY B;  4ZYS A;  4RG1 A;  1LTA D;  2EJF C;  3VYT A;  1DON A;  4RKB A;  1FNV A;  1VQP A;  1OXX K;  2ZTC A;  3SR1 A;  2SOB A;  2ZM6 Q;  4C3I G;  1NY4 A;  3DMU A;  4KMU C;  4JI1 Q;  4R4C A;  1EQR A;  1ESF A;  1UAP A;  2X69 A;  2IW3 A;  4P75 A;  4CDF C;  4JBK A;  1SYF A;  4LF4 Q;  3BZD B;  4A93 G;  1SND A;  4KN4 C;  1F9R A;  1X32 A;  4GZY C;  1CQV A;  3TP7 A;  1Q7Y C;  1EFW A;  3GP7 A;  3M85 A;  3P1H A;  2VZA A;  5JPN C;  4CJ0 B;  3LWU A;  5G3L D;  4FDB A;  3RD4 A;  3JAM E;  3KLS X;  2B2U C;  5JEA J;  1Q81 C;  3G7L A;  3I72 A;  1X65 A;  4KTA A;  2VUM H;  1RIP A;  5M3M H;  2E2J H;  2JEA I;  1UWV A;  3HOW H;  4UHV A;  1ASY A;  4QIW B;  5IYB G;  4DV5 L;  3M4P A;  4R4I A;  1ENF A;  2EE1 A;  5EKL A;  3GTL B;  2D2C C;  3HOX H;  2G9H D;  3S16 H;  1PH3 A;  5IT9 c;  4B3R L;  3R93 A;  1B53 A;  5LMU L;  2UUC L;  1PTO H;  5F2D A;  4XQJ A;  2IHF A;  4IFD G;  1PTO F;  2GA4 B;  1N33 L;  4EQP A;  1Y1W G;  3RR5 A;  3BDC A;  1NCV A;  4K14 A;  4A3E H;  2JK8 A;  5DNF A;  4X66 L;  3NUC A;  1IW7 D;  2EYL A;  1KDA A;  2DGY A;  2RCF A;  3BJU A;  3U9S A;  2UXD L;  4DAV A;  1Z6H A;  4QCL A;  5D65 A;  4DK1 A;  5LMN L;  1PLF A;  2AQ1 B;  1KLU D;  3U9O A;  1Q82 C;  5EPJ A;  2F52 A;  2RDG A;  4DUY Q;  4B9W A;  1BQQ T;  4CDD C;  5BR8 L;  2BCO A;  2ZXP A;  4R8N A;  4A3D H;  1B70 B;  1VQ4 A;  3GTP H;  1WI5 A;  3WDN A;  1CKN A;  1L1O B;  1U9R A;  3BVG A;  2PI2 E;  3FKI G;  4EQO A;  3FPP A;  5DAU A;  1VQK A;  1EY0 A;  1RF2 D;  2M00 A;  2N78 A;  2F0N A;  3GDE A;  1E2Z A;  4RH6 A;  5EKK A;  4KHP Q;  1IXR A;  2L0C A;  3UDG A;  5KYI A;  2E8G A;  1PXU A;  1FD7 D;  1AW7 A;  5EBD A;  1J8I A;  1IL8 A;  5I9O A;  3S2H B;  1TII D;  3ND9 A;  2JQO A;  3HOZ H;  2XVS A;  2Q2U A;  1H9S B;  4DV2 L;  3TBI B;  1SYC A;  4WJ4 A;  1PZJ D;  2EJM A;  3HS0 C;  1DJR D;  1HNX L;  4L5T A;  1NTG A;  4CJ1 B;  1O80 A;  1BXT A;  2R92 G;  1C8C A;  2K5D A;  4LFC L;  2AWN A;  4FF1 A;  5EPK A;  1M1K C;  1HNW Q;  3S17 B;  1WTW A;  3FMC A;  1SR3 A;  2DJF C;  4DAY B;  3HOV G;  1LTS D;  4IJH A;  1BR9 A;  4XXE A;  1II3 A;  2EXZ A;  1EYG A;  5D14 A;  2F4V L;  2SNS A;  2MQH A;  3D4W A;  1DYQ A;  1NMG A;  2F1M A;  1I4H A;  4QL5 A;  2LY7 A;  2WKD A;  1N34 L;  4R8I A;  3G6E A;  1XXG A;  2FJ2 A;  3KF8 A;  2BH8 A;  1U4R A;  1MHW C;  1I4P A;  2ZXO A;  4HJ7 A;  3CW2 C;  1YNX A;  1U4M A;  3STB D;  1CZW A;  1TWA H;  2C9O A;  1XMO L;  2JP1 A;  4DR4 L;  1QVG A;  4YWL A;  3CME A;  3Q0A A;  4KJN A;  4DV3 L;  2Q2H A;  1R9T H;  4DNR B;  2N49 A;  3DWQ A;  4LF6 L;  4HIO A;  5KNB A;  1SMY C;  4DV4 L;  4K0K L;  4ZRZ A;  3S9W A;  3CMA A;  4EQ5 A;  5GAE C;  4DR6 Q;  1ZEQ X;  2B63 B;  5BN5 A;  1EOT A;  1NNX A;  2NZH A;  1EY7 A;  4QB4 A;  4FXD A;  3OSO A;  2A69 C;  2JN4 A;  4HED A;  4RHR A;  4KKT A;  4FXK C;  1EQT A;  3URY A;  1TQO A;  4GKJ Q;  3SEB A;  2DY8 A;  3C1E A;  1B44 D;  1J6Q A;  1ROD A;  1A15 A;  3MZ5 A;  4HMI A;  5E4X A;  2K04 A;  2OTL A;  1UNS A;  4OO1 G;  2ZJR A;  1JT8 A;  1EWH A;  1O7L A;  4AYB G;  3HKS A;  2A6E D;  1K3B C;  3JC6 6;  3AB9 A;  3AFQ A;  3TS0 A;  3MHB A;  5JEA H;  3G71 A;  5I9P A;  1M8A A;  1QWY A;  1TWG B;  2MJ8 A;  4IUP A;  2HT1 A;  3S15 B;  4RCO A;  2F0F A;  1XTD A;  4KHV A;  1F2Z A;  4YHH Q;  4FF2 A;  3Q8D A;  1PYS B;  2NTS A;  5LL6 S;  2ZM6 L;  2CCZ A;  3P20 A;  4CGY B;  5IP9 G;  3SGI A;  3ICE A;  2ATW A;  4HJ5 A;  1MJC A;  1KAB A;  1RKN A;  2PQA B;  4J15 A;  2TMP A;  2NB0 A;  1XX8 A;  4DUZ Q;  1WCM B;  3T13 A;  1G6P A;  1ET9 A;  4B08 A;  2K03 A;  1XWE A;  2B29 A;  1Q8I A;  2JA9 A;  4K8J A;  4NW2 A;  4KY7 A;  2NVT H;  4PZ8 A;  4BBR G;  2EY1 A;  3NTI A;  1Y69 U;  5IP7 H;  4JI7 L;  4P71 A;  4BBS B;  1ICW A;  2MUY A;  4N9P A;  4EGV A;  2NVX B;  2NUC A;  1LTL A;  2L15 A;  1S3O A;  1STG A;  4JI5 Q;  2RHQ B;  3K8A A;  2BOS A;  4O2D A;  5KYL A;  1DOK A;  4YY3 Q;  3AQQ A;  5K36 G;  3DM1 A;  1KAW A;  1HJP A;  5GRO A;  3PUW A;  5BN3 A;  4L5Q A;  2PO4 A;  4IZ8 A;  1SSO A;  5KEE A;  2KJX A;  5IYC H;  3KLW A;  5M3F H;  4A3J H;  1SNQ A;  1SE2 A;  1GKH A;  4F8M A;  1G6Z A;  4NP5 A;  1BCP C;  4GN5 A;  1XNQ L;  4QMG A;  1BNZ A;  4A3I G;  3HKZ G;  3A8J E;  3I55 A;  3SK6 A;  3PF4 A;  4DUY L;  3DWP A;  4HCS A;  5I2X A;  1ICF B;  5HY6 A;  1VQB A;  3FPU B;  1NBW A;  3MXP A;  4DR2 Q;  3I90 A;  4EX5 A;  4A3J B;  3T1Y Q;  1LO5 D;  4P74 A;  3K5L A;  1K3R A;  1L1O A;  2V4D A;  2WAC A;  4IO9 A;  1MSH A;  1NAP A;  1ILQ A;  3KF6 B;  1PH9 A;  3CPF A;  3PUV A;  2JYO A;  1WYD A;  1TWF H;  2MFI A;  4KHP L;  1EZ8 A;  1KIX A;  4RGM A;  4IUT A;  1BOS A;  4F7X A;  1EY6 A;  3CCE A;  1I94 L;  1TY2 A;  3A56 A;  4O42 A;  4Y7N H;  1E2V A;  1I5F A;  3DM3 A;  3SDZ A;  3SE0 A;  3EBE A;  1FGB D;  2WAQ E;  3PIP 3;  2UUB Q;  1NE3 A;  1H9S A;  4UAI A;  4FYD A;  3M7G A;  1RDP D;  3K57 A;  4A76 A;  4DGZ A;  4DV1 Q;  2JA5 G;  2H1E A;  5DEH A;  2UUA Q;  3EQL C;  2PYK A;  1HNW L;  3D4D A;  4HJ9 A;  1HUM A;  2F0S A;  2A6H D;  4ZCK A;  4A3L G;  4Y7N B;  1VQF A;  1CK1 A;  1STY A;  1EFI D;  2IT1 A;  1S40 A;  4DAY A;  4BY7 H;  2VW9 A;  1K83 H;  2F0V A;  2GVB A;  2K01 A;  1W6J A;  2PNR C;  4HSP A;  2R7D A;  3VR5 A;  3MC0 B;  3CC2 A;  4IUN A;  3JAM c;  3H0G H;  2JEB I;  4XYQ A;  4LK1 C;  3IKJ A;  3LNN A;  1V8Q A;  5C4X H;  3K5M A;  2PMZ E;  2EYF A;  3CRK C;  4A3C G;  4JYA Q;  2E74 C;  5EGT A;  1SNP A;  1D5X C;  2B2Y C;  4IFD I;  3HOY G;  4JI8 Q;  1QVC A;  4X3K A;  3MEH A;  3CF5 A;  1A8V A;  2QEJ C;  1SRU A;  1YHB A;  1HA5 A;  4DXF A;  1VQI A;  4IPC A;  1PH1 A;  1AEX A;  5IWA L;  2RHS B;  3DXJ C;  3RZO H;  1PTO D;  5FO8 B;  5KIX A;  5IGG A;  5C44 G;  3NE5 B;  1VQH A;  1TR5 A;  1XPU A;  2PI2 A;  5JPM C;  3M4O B;  4IUV A;  5AFW A;  2WIN B;  3H91 A;  4K5W A;  5IGD A;  1EIY B;  1O7Y A;  1EQV A;  3RLN A;  4NXM Q;  1PTO C;  2IPK D;  4V0B A;  4GNX B;  5C5L A;  2E5L Q;  3D6C A;  4PZ6 A;  4GKK Q;  1FNU A;  1GHK A;  2XWB B;  1Q8K A;  3K7A H;  3GTQ B;  2RDF A;  3PV0 A;  4FP5 D;  1F9P A;  5DM7 3;  4DF7 A;  5CV9 A;  1HR0 W;  4RCN A;  3GTK H;  3VYR A;  4A3M B;  3F8T A;  5FLX E;  1F9S A;  5M5W H;  3ND8 A;  4J1M A;  1S4Z A;  1B9N A;  2EJG C;  2L4N A;  2XIW A;  1ML0 D;  2Z0S A;  4ZQ3 A;  3D8G A;  3G4S A;  3KFU A;  3KLR A;  4YCW A;  3RZD B;  1H9K A;  4DV6 Q;  2Z8L A;  4B3M Q;  4XQQ A;  4KY6 A;  3PO3 H;  4TSS A;  4DUZ L;  1UUP A;  3M7N A;  4ZUI A;  4S3S A;  3CCL A;  3R2T A;  3VYU A;  2PQA A;  4BY1 H;  4A3B B;  2PNH A;  2KEC A;  3EJI A;  5AJ3 Q;  1STB A;  2IX0 A;  3K0X A;  1ENC A;  3L9A X;  3T16 A;  3IFT A;  2JA7 B;  3HP3 A;  3LWE A;  5C3E B;  3S1Q H;  4IN3 A;  2N8N A;  3I8Z A;  1X54 A;  3M3Y B;  2Y0S G;  1M90 C;  4C2M B;  1VMP A;  3CCM A;  3I4N G;  2R93 B;  2QIL A;  3H3V H;  4Y52 H;  2A73 B;  5DLQ E;  4QUF A;  1FJG Q;  2AMC B;  1VF7 A;  2NN6 G;  3BZC A;  1ILP A;  1SJH D;  1F9Q A;  2PMZ B;  4AQY L;  3J81 L;  1SYB A;  4R4Q A;  2Q8T A;  3I73 A;  2JA8 B;  1N36 L;  2R7Z H;  2NZO A;  2LS0 1;  3PUX A;  4F88 A;  2A5H A;  3PGZ A;  2VL6 A;  4OWW B;  3HOU B;  1Q3L A;  5FOB B;  1PMR A;  4OON A;  4WOR A;  1HH2 P;  2D0O A;  1RJT A;  2ES2 A;  1NR2 A;  4R4T A;  3CAM A;  4RWS C;  3FEW X;  2K5Q A;  1ZXT A;  3ITP A;  3C46 A;  2WB1 G;  1H9J A;  5C4J H;  3S1N B;  3NK9 A;  3T4A C;  5IOD A;  2C35 B;  5CV8 A;  1VQO A;  3S1R B;  2B2W C;  4C3H H;  3PO2 H;  1D6E C;  1JWM D;  2CWA A;  4DR2 L;  4GLX A;  1YZ6 A;  4ALP A;  5JJI A;  4GOP B;  4M8A A;  4UP7 A;  5ELB A;  3SHL A;  2Q2T A;  3T1Y L;  1SN8 A;  2KUM A;  2ID0 A;  3T51 B;  5M5Y H;  3S14 H;  1Y1V H;  4CDC C;  5IYD H;  1JQY D;  1SRO A;  1UE1 A;  1VQE A;  3ONA B;  2MPM A;  4UP8 A;  3J7A 5;  4OO1 I;  1SYG A;  2CKZ B;  1K73 C;  3A55 A;  2NVY H;  1ENA A;  4C3J H;  3PO2 B;  3NEM A;  1QZG A;  1ZYR C;  5EKI A;  3KF6 A;  3CCQ A;  3OPO A;  1IBK L;  2FMM A;  5E4W C;  2DNC A;  4X62 Q;  5A2Q E;  2HCC A;  2R7F A;  3KJP A;  1VQ7 A;  4HTH A;  1BBU A;  1HNZ L;  3QWN A;  4YIJ A;  5JJK A;  3K6O A;  3E9H A;  2UUB L;  4N9T A;  3PIO A;  2VUM G;  1VQL A;  2O5J C;  3I4O A;  2CQO A;  1E22 A;  4RKL A;  4C3J B;  5M3M G;  1OXV A;  3H94 A;  2EOT A;  3HOW G;  1MBY A;  2AQ3 B;  4DNI A;  4DV1 L;  2H4O A;  4H7B A;  1B9M A;  1D5M C;  1AN8 A;  2Q2I A;  4A4I A;  1JCK B;  4OIJ A;  4F87 A;  1L0W A;  3HOX G;  4JK1 C;  1Q1E A;  5NUC A;  3J80 E;  3TP8 A;  2PW5 A;  3TP5 A;  1JOO A;  4HJA A;  3GTL H;  4A3E G;  3MA2 B;  1EOV A;  1HZB A;  1RTN A;  3K81 C;  1LAB A;  3ERQ A;  2K05 A;  3GTO B;  4LUZ A;  2RCN A;  4H0L C;  3IAY A;  1EY4 A;  5I6W A;  1BKB A;  4PZ7 A;  3SK8 A;  4KI0 A;  1PV4 A;  1BBW A;  1HHV A;  3CC4 A;  1EY8 A;  1I3Q B;  4JYA L;  4A3D G;  4JBM A;  1N9W A;  1IBL L;  1STE A;  3DEO A;  4JI8 L;  1EYC A;  5IT9 L;  4DR3 Q;  4GLA C;  1HA6 A;  1I4X A;  5JOB A;  4PQX A;  5CR3 A;  3VR2 A;  4A3K B;  4DR7 Q;  3T1H Q;  2JA6 H;  5IGC A;  2UXC L;  1AP0 A;  4R4O A;  1JJC B;  3I56 A;  1IKL A;  4TVA B;  1E1T A;  4BXX H;  2PZU A;  1K0R A;  2I46 A;  1SDF A;  1PH7 A;  4A3F B;  2PZT A;  5C5M A;  2DN8 A;  1E3P A;  1HUN A;  4J6H A;  2N55 A;  4KD4 A;  5CBA E;  1BO0 A;  4B3S L;  2M9V A;  4BWG B;  4A3G B;  3HOZ G;  2B39 A;  2JA6 B;  4DV0 L;  2E5L L;  4GKK L;  2WV6 D;  1SYD A;  1TWH H;  4GNX A;  1MKH A;  1GD7 A;  2JXM B;  3S2H H;  1X3P A;  1RD9 D;  2ZTD A;  4C3I B;  5GAG C;  1HXY D;  3NWT A;  2HHH Q;  4ZLT F;  1TXY A;  5KND A;  2B2V A;  4A93 B;  2HIV A;  4PMB A;  1D5Z C;  1STA A;  3AYH B;  1EEF D;  2K4K A;  2Q8R E;  1TWH B;  1WTR A;  1SE8 A;  1WTH A;  5E7N A;  3S17 H;  1DD2 A;  3X3N A;  3RNU A;  3T53 B;  3NBI A;  5COY A;  2D5D A;  3CRL C;  4O0A A;  4CBV A;  5AJ3 L;  4X3T A;  1EQQ A;  3I4M G;  5ELN A;  1I50 B;  2FXQ A;  4DK0 A;  4G7O C;  1JB3 A;  3BVM A;  3IL8 A;  4FNF A;  5KGU A;  4QGU A;  2G5D A;  3AEV A;  3HG9 A;  1HCZ A;  5TSS A;  1QNU A;  2AUJ D;  1IYJ B;  1I4G A;  1FJG L;  5HGQ A;  5IY0 A;  2IJ0 A;  1I6H B;  1TS2 A;  4RMF A;  1FR3 A;  4C1N I;  1BUV T;  4L5R C;  2EIF A;  2ENB A;  3A54 A;  2K5W A;  1Y1W B;  2EY2 A;  2F0Q A;  3V2T A;  4XDX A;  3VR3 A;  2B63 H;  3CP0 A;  1KHI A;  1SMY D;  3W1G A;  1UE7 A;  2EYP A;  4QUC A;  3MTS A;  4MTK A;  3KBG A;  4DFA A;  4OX9 Q;  5ELF A;  3LX0 A;  2F0L A;  1CZG A;  3ERS X;  3MXN B;  1ASZ A;  2LSS A;  3KLS A;  2Z6B A;  3U58 A;  3A7L A;  1CT1 D;  2A69 D;  5JEA G;  3M4Q A;  1XMQ Q;  1IZ6 A;  2BE5 C;  1JE4 A;  3I4L A;  3FKI B;  3GTM B;  4AIM A;  3R2I A;  2F3W A;  2LFN A;  1A6X A;  2DNE A;  4AYB E;  1YEZ A;  2F0K A;  3UDX A;  1HR0 Q;  1AE2 A;  4PG3 A;  2QW7 A;  1TWG H;  4H13 C;  3S15 H;  1PRT C;  3P75 A;  2OEO A;  3V96 A;  2NWG A;  4LJZ C;  3KDF B;  2PW7 A;  1WD1 A;  2A19 A;  4IUR A;  5J3B A;  3F2D A;  4OXP A;  2EPB A;  4JV5 L;  2R92 B;  4LFA Q;  3J80 i;  2B2V C;  3LGJ A;  4NMZ A;  3TEH B;  3CCU A;  1C9O A;  5EAY A;  1TS3 A;  1WCM H;  1JB7 A;  4JI4 Q;  5IP7 G;  2CWP A;  1EIF A;  5FLX L;  3NHH A;  5FLX c;  1RTO A;  3L3O C;  3NQI A;  3HOV B;  4DXG A;  3OWE B;  1YJW A;  5L37 A;  1SMX A;  1CA6 A;  3OW7 A;  4JI1 L;  1SE3 A;  3JAM i;  1SAP A;  3G48 A;  3R8B A;  3CU7 A;  2F0I A;  2QF7 A;  3E9I A;  2KVM A;  4BBS H;  4LF4 L;  4RA8 A;  3OIQ A;  2NVX H;  2FFK B;  2L1B A;  1CSP A;  2A68 D;  1JJ2 A;  2NVQ B;  1E1O A;  4JOI A;  4K5X A;  2QKI C;  4IQZ A;  2K6A A;  4HID A;  1D7Q A;  3A7A B;  5M3F G;  1YHQ A;  1TT2 A;  1IL2 A;  1JC7 A;  1U4P A;  2A68 C;  2NN6 I;  2B3G A;  4NKL A;  1PH6 A;  4KV6 A;  1SBB B;  1R4Q B;  3CD6 A;  2VNU D;  1WTO A;  1ONL A;  2B2T A;  3M9B A;  5G3L F;  1AZP A;  2MO1 A;  3E3X A;  2VQE Q;  5FJ8 H;  5A35 A;  1C4Q A;  3VYS A;  3EFX D;  1Z9F A;  3F1Z A;  4LFB Q;  3PMF A;  4K2L A;  2F0M A;  2RKS A;  4JW0 A;  3UDF A;  1F2L A;  2HD3 A;  3QR8 A;  3T1H L;  5C4Z A;  4DR7 L;  5EBC A;  3HKZ E;  1BCP D;  2RQX A;  1LTR D;  5CYU A;  3MFG A;  3H3V C;  1UEA B;  1HTP A;  2FHT A;  1SFO B;  4KKS A;  1V1P B;  5ELD A;  1BVS A;  4AYB B;  1CKO A;  4X64 Q;  2KED A;  3QOL A;  1F77 A;  1BBX C;  1H9R A;  2AKW B;  4UPA A;  1I4R A;  4DAM A;  2XRS D;  2E76 C;  1PH4 A;  5COR A;  4WFN 3;  3OYY A;  2IL8 A;  4G57 A;  1C7Y A;  3VA7 A;  3FRP B;  2HHH L;  1I4Q A;  1AFP A;  4DNT B;  3F2U A;  3QJY A;  1E0B A;  1EUJ A;  1YNJ C;  4TQU S;  3TME A;  1KDB A;  4LF7 Q;  4BY7 G;  5FKA C;  3A0J A;  3NXW A;  1KQS A;  2VY3 A;  2ZXR A;  1G51 A;  2PCF B;  3KK7 A;  3FVQ A;  1GUN A;  2RVL A;  3H0G G;  4JI6 Q;  4DK6 C;  3HGB A;  4BBR B;  2J4X A;  1UEB A;  1VCI A;  3MVV A;  1B3Q A;  1EY9 A;  2K5H A;  3PF5 A;  1Q86 C;  2HIX A;  5C4X G;  3L2P A;  5M5X B;  4HR7 B;  1PA6 A;  1XJV A;  2JSO A;  4OEM B;  3TRZ A;  2YV5 A;  3BZK A;  4B9X A;  4RGT A;  1F2M A;  1DM0 B;  1MGS A;  1OXU A;  3BU2 A;  1K8G A;  4WJ3 M;  3SXH A;  2K1B A;  1DOL A;  1CHQ D;  2KHI A;  2Z4I A;  4JOI C;  3L0O A;  1M4V A;  2EQS A;  3J80 c;  4CKE A;  1PDQ A;  5GAD C;  1VQC A;  3S1M B;  3UI2 A;  1S72 A;  1AZQ A;  1QUQ B;  4OL7 A;  5JJL A;  1LLR D;  3BG3 A;  4R9W A;  3JAM L;  4NXN Q;  2WAQ G;  4A3I B;  4V19 0;  3HKZ B;  2B2T C;  1Y8P B;  2F03 A;  2BDO A;  1RHP A;  1W6K A;  1YNN C;  4ZUJ A;  1LM0 A;  4NB3 A;  4ILW A;  3CC7 A;  3HRZ C;  5I4D A;  4G4K A;  3NEL A;  5JAV A;  1GVP A;  1QIL A;  2YTY A;  4PMW A;  1XMQ L;  2K52 A;  3V05 A;  1PRT F;  3CPW A;  3M4O H;  1T5E A;  4DR6 L;  3ULJ A;  4K2K A;  2Z6K A;  2LMC B;  5C0X J;  2ZJQ A;  1HR0 L;  1PYB A;  4GKJ L;  4YCV A;  1A2T A;  3GTQ H;  4DV5 Q;  1WTX A;  4LF9 Q;  1V1Q A;  1G2S A;  2XWJ B;  1CI3 M;  5FLM H;  1A0I A;  2SDF A;  4A3M H;  4PNY A;  4A3L H;  4DR1 Q;  4RFB A;  3PO3 G;  4B3R Q;  3IFD A;  2IX3 A;  2UUC Q;  4ZK9 B;  5IGE A;  4BY1 G;  2RBM A;  4DAP A;  2IWH A;  4UDU C;  3CCJ A;  1S5C D;  3KDF A;  2K32 A;  4BA2 I;  1L1O C;  2EYH A;  3RZD H;  3UE1 A;  2JA5 B;  1JIC A;  2MP1 A;  3B6Y A;  4A3B H;  5GAH C;  1J5E Q;  1VF5 C;  1SLJ A;  2JA7 H;  5LMN Q;  4YHH L;  2YU9 B;  3WWV A;  5C3E H;  3GTJ B;  2XGT A;  3M3Y H;  1JWU D;  4OHJ A;  1CKN B;  4C2M H;  3W2D A;  2R93 H;  4I7Z C;  1Z7T A;  1HRJ A;  4DK3 C;  2R7Z G;  2KCC A;  2D0P A;  3PCO B;  4TRD A;  2Y0S E;  3CQZ B;  1EY5 A;  2L55 A;  3C1F A;  3P7J A;  1DCZ A;  2QDL A;  3EN2 A;  1A2U A;  1CA5 A;  1WOC A;  1CFM A;  4MN3 A;  3MXU A;  2JA8 H;  2AQ2 B;  1SEB D;  1FNW A;  1KL9 A;  3OMG A;  1PH2 A;  3HOU H;  4KN7 C;  2CFM A;  1HZC A;  4FXG C;  2KA7 A;  3F2C A;  1K0S A;  4C56 C;  2AWO A;  3HOY B;  4C3H G;  2K5V A;  2ZJP A;  4POG A;  2F0G A;  4IPH A;  1GUW A;  3K0Y A;  1IBM Q;  2F0P A;  3H6M A;  1RCV D;  3S1N H;  2VQE L;  4JI5 L;  4APV A;  1PYW D;  4YY3 L;  1VQN A;  2WB1 E;  3S1R H;  1Y1V G;  4ZAI A;  5IYD G;  1L2F A;  4B3T Q;  2WFW A;  3J81 j;  5C44 B;  4LFC Q;  1KTK A;  2E2I B;  2RA4 A;  3K80 C;  2B2U A;  1DXM A;  4GN3 B;  4IFD J;  3GTG B;  1E7Z A;  1PFN A;  2UU9 Q;  3EIV A;  2D9U A;  5T1I A;  1EIH A;  1GO3 E;  3A8I E;  3E5S A;  3QIA A;  4DN4 M;  4JBJ A;  5KNC A;  2F0H A;  4LUO A;  1N34 Q;  5I2Y A;  3NBH B;  2J7Z A;  1LUZ A;  2ALY B;  3MEF A;  4HIM A;  1L0X B;  1ZYR D;  1YBY A;  1WTQ A;  5LHY 1;  1XMO Q;  3TZU A;  1AH9 A;  5FK9 C;  1UE6 A;  4I7A A;  4NPS A;  3I4N H;  1BCP B;  2R61 A;  4BS9 A;  2F0W A;  1C0A A;  4XIG S;  5IGB A;  4A75 A;  3RN5 A;  2CHB D;  2IHE A;  1LAC A;  5ELE A;  4G7Z C;  1STN A;  4LF7 L;  2CW0 C;  3D3R A;  3OWF A;  2O5I C;  4IUQ A;  1CHP D;  2DJG C;  2K33 A;  1K8A C;  1X3F A;  3I70 A;  3UE0 A;  4X65 Q;  1TU2 B;  2Y0S B;  3W5O A;  4JI6 L;  3I4N B;  1E2W A;  3ULP A; 
#chains in the Genus database with same CATH homology
 3T56 B;  3AU7 A;  3S2D B;  1K8O A;  1KNA A;  1PZI D;  3W3A A;  1HQM C;  3GV6 A;  2HCI A;  3NPP A;  2E2H B;  1QOH A;  1SNO A;  2KQ3 A;  4CKB A;  5C0X H;  2NYZ D;  3J7A V;  4ZKC B;  1HFG A;  4QF4 A;  2B8F A;  5CC4 A;  2F0D A;  2WB1 B;  5DM6 3;  5I6Y A;  5JVG 3;  1LT6 D;  1A3U A;  3N52 A;  3L7Z C;  3MWY W;  2L5T A;  4K5V A;  1L0Y B;  3CHB D;  1SE4 A;  1G8Z D;  5D3D A;  5CV4 A;  3RMH A;  3DHQ A;  1TY0 A;  4HN7 A;  3NWS A;  2WKC A;  1SNC A;  4MHE A;  2F0U A;  1BF4 A;  5EQ0 A;  3Q24 A;  1EYD A;  3I3C A;  2HUG A;  5IGF A;  2VUM B;  3Q6S A;  3K5N A;  5M3M B;  2E2J B;  5CMD A;  3HOW B;  1S5E D;  2BDN A;  1QNK A;  4WJW A;  3MFY A;  1HPC A;  3HOX B;  1LTB D;  3S16 B;  5IIF A;  4IAL A;  5LL6 X;  2AUK A;  3SVM A;  2KHS A;  1IW7 C;  1PTO B;  3OMC A;  3K58 A;  4U67 3;  4Q0F A;  4I65 A;  4ODG A;  4A3E B;  1G29 1;  5D3I B;  1EYA A;  4JBW A;  3HZX A;  4IFD H;  1ESR A;  5BN4 A;  2MGS A;  5ELC A;  2HQE A;  4U68 A;  2BA0 A;  2XN9 C;  3QB3 A;  2IX1 A;  4A3D B;  4L63 B;  1R4P B;  2FIN B;  3GTP B;  2EDG A;  4PV1 C;  3OOC A;  4O1N A;  3TP6 A;  2L9H A;  1SYE A;  4FVM A;  1QE6 A;  1KLG D;  1QG7 A;  1MD2 D;  1B50 A;  1LT3 D;  4PMC A;  4XT1 B;  1FYC A;  4RAU C;  2SNM A;  1J9O A;  3KUP A;  1KDC A;  2BE5 D;  4M1U B;  1GUS A;  3PIO 3;  3HOZ B;  1Y8N B;  3J7Y W;  1GJX A;  1SXT A;  3OHX C;  4ZKB B;  3VR4 A;  1LTI D;  3J81 E;  2QCP X;  4OIK A;  2X6G A;  3DEP A;  1Q90 A;  4XYO A;  1HQR D;  3J7A F;  2SEB D;  5FO9 B;  2G9D A;  4NDX A;  3BDO A;  1PRT D;  2N88 A;  2VB2 X;  3NBH A;  1VDZ A;  4KHZ A;  3NTK A;  3D31 A;  1WD0 A;  2ICI A;  1V1O A;  4ME5 A;  4OGQ C;  1SJE D;  4G7H C;  1EU3 A;  2B8G A;  3KBX A;  1EZ6 A;  3I4M B;  1DZ1 A;  1HTL D;  1TVX A;  1TWA B;  2EZV A;  1R9T B;  3GQB A;  1WTP A;  2F3V A;  4HSV A;  2F0O A;  1QCB D;  1S5F D;  2K28 A;  2PPB C;  1JR0 D;  4Z9C B;  5EJW A;  2L12 A;  5J22 A;  1EEI D;  5JJZ A;  2Z1C A;  2X6L A;  1LT5 D;  5CBE E;  4DU9 A;  2PQE A;  1B3A A;  1JOQ A;  3HEJ A;  5J1Z A;  5CGK A;  5E1F A;  2ICE C;  3NP8 A;  2A6E C;  3D4R A;  3VA5 A;  2O2L D;  1NR4 A;  3NQT A;  4HMJ A;  1Z47 A;  3TZD A;  1QB5 D;  4RGO S;  1D1I A;  4BA1 I;  4ULL A;  2VB3 X;  2C5C A;  4CKC A;  4OO1 H;  1S5D D;  1EU4 A;  3PUY A;  1S5B D;  1IYU A;  4X3U A;  3GV3 A;  4EQN A;  1IKM A;  3Q22 A;  4WRD A;  3PUZ A;  1D2B A;  2F0J A;  1QJO A;  1F2Y A;  1WVL A;  4KY5 A;  1Y8O B;  2K7V A;  2E2D C;  2F4I A;  1U4L A;  3RLF A;  2HDM A;  2WP8 J;  5IT9 E;  2YYZ A;  2NVT B;  1G2T A;  1GOZ A;  2B2Y A;  1JWS D;  3BVZ A;  3G6J B;  2VXW A;  5ISR A;  4RGN A;  1V43 A;  3CKI B;  3QO2 A;  4XTC S;  4XQN A;  4H44 C;  4ID6 A;  1YNJ D;  1CQF A;  5C3W A;  2M2L A;  4TKO B;  2BA1 A;  2LKV A;  3BYT B;  1EL0 A;  1D1K A;  1LV9 A;  5K5P A;  5C0X I;  4LMQ D;  3Q23 A;  4FO2 A;  2CQA A;  2TSS A;  1PZK D;  3TDQ A;  1XTC D;  2RSO A;  5CV5 A;  1K8M A;  4K8I A;  3TN2 A;  5A2Q L;  5M3F B;  5C6A A;  5FO7 B;  5C4H A;  5K36 H;  2EYJ A;  3TSS A;  3EVQ A;  1KAA A;  1XYI A;  1B4O A;  1PFB A;  1TWC B;  1Q1B A;  2HDL A;  3E6Z X;  1ET6 A;  5HGT A;  1OXT A;  4DA2 A;  2FMC A;  3BYY B;  3QG1 A;  3RUZ A;  1DOM A;  1STH A;  4CHT B;  3J80 L;  2NTT A;  3BS1 A;  1H9M A;  3M4Y A;  2PZW A;  1TWF B;  1TKW B;  2O4X A;  4L6T B;  1YNN D;  2OF1 A;  3R3O A;  4EVO A;  2OT2 A;  3D6W A;  5HUR A;  5CV6 A;  3ZYY X;  1B2T A;  1SNM A;  3DWA A;  3E0J A;  5JVH 3;  3N6R A;  4K6L A;  3MXN A;  2A6H C;  1NUC A;  2EY5 A;  1MI2 A;  3K5O A;  3C2P A;  3FDT A;  4KK7 A;  5EPL A;  1OO9 B;  1JOK A;  1LT4 D;  1LTG D;  2J0T D;  4BY7 B;  1MSG A;  1K83 B;  2Z4H A;  5IOC A;  3H0G B;  2B2W A;  2KCN A;  2XRQ D;  4HCE A;  4MIU A;  3EA6 A;  1Q12 A;  3GD7 A;  2EY6 A;  4HAE A;  4L8J A;  5C4X B;  2Q8I B;  2NBF A;  2XSC A;  3BDL A;  1PRT B;  4FF4 A;  4K6D A;  2EVB A;  2WII B;  3NTH A;  3SK5 A;  1O78 A;  1O7Z A;  1PFM A;  1C48 A;  3O13 A;  1GUT A;  3RZO B;  1OXS C;  1G91 A;  2EYO A;  2WAQ B;  1T5X D;  2F0T A;  2RDH A;  1CTM A;  1BDO A;  1TS4 A;  3H09 A;  2DY7 A;  3K59 A;  3SK4 A;  1ZKO A;  2R3Z A;  3VR6 A;  2ZT9 C;  3K7A B;  4LAA A;  5T1G A;  3DUZ A;  4J8Q A;  4KKU A;  3GTK B;  3WOF A;  5CV7 A;  1CM9 A;  3QOJ A;  2KEE A;  2EYM A;  3OIP A;  3A8K E;  1A3V A;  2OXP A;  5M5W B;  1I6V C;  1HFN A;  4ABN A;  4KJO A;  4IUU A;  2A74 C;  2XNA C;  3C3L A;  2I07 B;  4C3J G;  3PO3 B;  2JE6 I;  1TS5 A;  1NSN S;  1JOR A;  4BY1 B;  3X3M A;  1V1P A;  1IHZ A;  1BCP F;  4C1N K;  3S1Q B;  1EIG A;  4Q5V A;  1GUG A;  1IYV A;  5J39 A;  2QDB A;  1GUO A;  1WTV A;  1EWC A;  2KOL A;  1LTT D;  4KD3 A;  2R6G A;  5C3X A;  2CW0 D;  3MXG A;  2NZ1 D;  2R7Z B;  1VMC A;  4X3S A;  3ERO A;  2CVR A;  1KNE A;  2NN6 H;  5C0X G;  2F0E A;  2E75 C;  4RHS A;  2RSN A;  2MHV A;  2D62 A;  3GO5 A;  3WOE A;  5KRU A;  5C4J B;  1GHJ A;  5M9O A;  3MAQ A;  3I91 A;  2L11 A;  1X3Q A;  3AMU A;  4CJ2 C;  4C3H B;  5E3F A;  4FF3 A;  4XT3 B;  1A3T A;  3S14 B;  5M5Y B;  1Y1V B;  4E6I A;  1GXD C;  1B1Z A;  4P2C B;  3NSW A;  2NVY B;  4ZYS A;  1LTA D;  2EJF C;  3VYT A;  1DON A;  4RKB A;  1FNV A;  1OXX K;  3SR1 A;  2SOB A;  4C3I G;  3DMU A;  4KMU C;  1ESF A;  1UAP A;  2X69 A;  2IW3 A;  1SYF A;  3BZD B;  1SND A;  4KN4 C;  1F9R A;  1X32 A;  4GZY C;  1CQV A;  3TP7 A;  3GP7 A;  3M85 A;  3P1H A;  5JPN C;  4CJ0 B;  3LWU A;  5G3L D;  3RD4 A;  3JAM E;  3KLS X;  2B2U C;  5JEA J;  3G7L A;  3I72 A;  4KTA A;  2JEA I;  4QIW B;  1ENF A;  2EE1 A;  5EKL A;  3GTL B;  2D2C C;  2G9H D;  3R93 A;  1B53 A;  1PTO H;  5F2D A;  4XQJ A;  4IFD G;  1PTO F;  2GA4 B;  4EQP A;  3BDC A;  1NCV A;  4K14 A;  5DNF A;  3NUC A;  1IW7 D;  2EYL A;  1KDA A;  3U9S A;  4DAV A;  1Z6H A;  4QCL A;  5D65 A;  4DK1 A;  1PLF A;  2AQ1 B;  1KLU D;  3U9O A;  5EPJ A;  2RDG A;  4B9W A;  1BQQ T;  2BCO A;  2ZXP A;  4R8N A;  3WDN A;  1U9R A;  3BVG A;  4EQO A;  3FPP A;  5DAU A;  1EY0 A;  1RF2 D;  2M00 A;  2F0N A;  1E2Z A;  4RH6 A;  5EKK A;  2L0C A;  5KYI A;  1PXU A;  1FD7 D;  1AW7 A;  5EBD A;  1J8I A;  1IL8 A;  5I9O A;  3S2H B;  1TII D;  3ND9 A;  2XVS A;  1H9S B;  3TBI B;  1SYC A;  1PZJ D;  2EJM A;  3HS0 C;  1DJR D;  4CJ1 B;  1O80 A;  1BXT A;  1C8C A;  2K5D A;  2AWN A;  4FF1 A;  5EPK A;  3S17 B;  1WTW A;  3FMC A;  1LTS D;  1BR9 A;  4XXE A;  1II3 A;  2EXZ A;  5D14 A;  2SNS A;  3D4W A;  1DYQ A;  2F1M A;  1I4H A;  2LY7 A;  2WKD A;  4R8I A;  1XXG A;  2FJ2 A;  3KF8 A;  1U4R A;  2ZXO A;  1I4P A;  1U4M A;  1CZW A;  2C9O A;  2JP1 A;  3Q0A A;  4KJN A;  4DNR B;  3DWQ A;  5KNB A;  1SMY C;  4ZRZ A;  3S9W A;  1ZEQ X;  2B63 B;  5BN5 A;  1EOT A;  4QB4 A;  1EY7 A;  4FXD A;  3OSO A;  2A69 C;  4HED A;  4RHR A;  4KKT A;  4FXK C;  1EQT A;  3URY A;  1TQO A;  3SEB A;  2DY8 A;  3C1E A;  1B44 D;  1ROD A;  1A15 A;  3MZ5 A;  4HMI A;  5E4X A;  2K04 A;  1UNS A;  4OO1 G;  1EWH A;  1O7L A;  2A6E D;  3AB9 A;  3MHB A;  5JEA H;  5I9P A;  1M8A A;  1QWY A;  1TWG B;  2MJ8 A;  4IUP A;  3S15 B;  4RCO A;  2F0F A;  4KHV A;  1F2Z A;  4FF2 A;  2NTS A;  5LL6 S;  3P20 A;  4CGY B;  1KAB A;  1RKN A;  2TMP A;  2NB0 A;  1XX8 A;  1WCM B;  3T13 A;  1ET9 A;  4B08 A;  2K03 A;  1XWE A;  1Q8I A;  4K8J A;  4NW2 A;  4KY7 A;  2EY1 A;  3NTI A;  1Y69 U;  4BBS B;  1ICW A;  2MUY A;  4N9P A;  4EGV A;  2NVX B;  2NUC A;  1STG A;  2BOS A;  5KYL A;  1DOK A;  5K36 G;  3DM1 A;  3PUW A;  5BN3 A;  2PO4 A;  4IZ8 A;  1SSO A;  5KEE A;  2KJX A;  1SNQ A;  1SE2 A;  4F8M A;  1G6Z A;  4NP5 A;  1BCP C;  4QMG A;  1BNZ A;  3A8J E;  3SK6 A;  3DWP A;  4HCS A;  5I2X A;  3FPU B;  3MXP A;  3I90 A;  4A3J B;  1LO5 D;  3K5L A;  2V4D A;  2WAC A;  1MSH A;  1NAP A;  1ILQ A;  3PUV A;  2JYO A;  1EZ8 A;  4RGM A;  4IUT A;  1BOS A;  4F7X A;  1EY6 A;  1TY2 A;  3A56 A;  4O42 A;  1E2V A;  3SDZ A;  3SE0 A;  1FGB D;  3PIP 3;  1H9S A;  4UAI A;  4FYD A;  3M7G A;  1RDP D;  3K57 A;  4DGZ A;  2H1E A;  5DEH A;  3EQL C;  2PYK A;  3D4D A;  1HUM A;  2F0S A;  2A6H D;  4Y7N B;  1CK1 A;  1STY A;  1EFI D;  2IT1 A;  4DAY A;  2F0V A;  2K01 A;  1W6J A;  2PNR C;  4HSP A;  3VR5 A;  3MC0 B;  4IUN A;  2JEB I;  4XYQ A;  4LK1 C;  3IKJ A;  3LNN A;  1V8Q A;  3K5M A;  2EYF A;  3CRK C;  2E74 C;  5EGT A;  1SNP A;  1D5X C;  2B2Y C;  4IFD I;  4X3K A;  3MEH A;  2QEJ C;  1HA5 A;  4DXF A;  1AEX A;  3DXJ C;  1PTO D;  5FO8 B;  5KIX A;  5IGG A;  3NE5 B;  1TR5 A;  5JPM C;  3M4O B;  4IUV A;  5AFW A;  2WIN B;  3H91 A;  4K5W A;  5IGD A;  1O7Y A;  1EQV A;  1PTO C;  2IPK D;  4V0B A;  5C5L A;  3D6C A;  1FNU A;  1GHK A;  2XWB B;  3GTQ B;  2RDF A;  3PV0 A;  4FP5 D;  1F9P A;  5DM7 3;  4DF7 A;  5CV9 A;  4RCN A;  3VYR A;  4A3M B;  5FLX E;  1F9S A;  3ND8 A;  4J1M A;  1S4Z A;  1B9N A;  2EJG C;  2L4N A;  2XIW A;  1ML0 D;  4ZQ3 A;  3D8G A;  3KLR A;  3RZD B;  1H9K A;  2Z8L A;  4XQQ A;  4KY6 A;  4TSS A;  3M7N A;  1UUP A;  4ZUI A;  4S3S A;  3R2T A;  3VYU A;  4A3B B;  2KEC A;  3EJI A;  1STB A;  2IX0 A;  2JA7 B;  1ENC A;  3L9A X;  3T16 A;  3IFT A;  3HP3 A;  3LWE A;  5C3E B;  4IN3 A;  3I8Z A;  3M3Y B;  4C2M B;  1VMP A;  2R93 B;  2QIL A;  2A73 B;  4QUF A;  1VF7 A;  2NN6 G;  1ILP A;  1SJH D;  1F9Q A;  2PMZ B;  3J81 L;  1SYB A;  2Q8T A;  3I73 A;  2JA8 B;  2LS0 1;  3PUX A;  4F88 A;  2A5H A;  3HOU B;  1Q3L A;  5FOB B;  1PMR A;  4WOR A;  1RJT A;  1NR2 A;  4RWS C;  3FEW X;  2K5Q A;  1ZXT A;  3ITP A;  3C46 A;  1H9J A;  3S1N B;  3NK9 A;  3T4A C;  5IOD A;  5CV8 A;  3S1R B;  2B2W C;  1D6E C;  1JWM D;  4M8A A;  5ELB A;  3SHL A;  2KUM A;  2ID0 A;  3T51 B;  1JQY D;  3ONA B;  2MPM A;  4OO1 I;  1SYG A;  3A55 A;  1ENA A;  3PO2 B;  1ZYR C;  5EKI A;  3OPO A;  2FMM A;  5E4W C;  2DNC A;  5A2Q E;  2HCC A;  4HTH A;  3QWN A;  4YIJ A;  3K6O A;  4N9T A;  2O5J C;  4RKL A;  4C3J B;  1OXV A;  3H94 A;  2EOT A;  1MBY A;  2AQ3 B;  2H4O A;  4H7B A;  1B9M A;  1D5M C;  1AN8 A;  1JCK B;  4OIJ A;  4F87 A;  4JK1 C;  1Q1E A;  5NUC A;  3J80 E;  3TP8 A;  2PW5 A;  3TP5 A;  1JOO A;  3MA2 B;  1RTN A;  1LAB A;  3ERQ A;  2K05 A;  3GTO B;  4H0L C;  3IAY A;  1EY4 A;  5I6W A;  3SK8 A;  4KI0 A;  1HHV A;  1EY8 A;  1I3Q B;  1STE A;  3DEO A;  1EYC A;  5IT9 L;  1HA6 A;  1I4X A;  5JOB A;  4PQX A;  5CR3 A;  3VR2 A;  4A3K B;  1AP0 A;  5IGC A;  1IKL A;  2PZU A;  2I46 A;  1SDF A;  4A3F B;  2PZT A;  5C5M A;  2DN8 A;  1HUN A;  4J6H A;  2N55 A;  4KD4 A;  5CBA E;  1BO0 A;  2M9V A;  4BWG B;  4A3G B;  2B39 A;  2JA6 B;  2WV6 D;  1SYD A;  2JXM B;  1X3P A;  1RD9 D;  4C3I B;  1HXY D;  3NWT A;  4ZLT F;  5KND A;  2B2V A;  4A93 B;  4PMB A;  1D5Z C;  1STA A;  1EEF D;  2Q8R E;  1TWH B;  1WTR A;  1DD2 A;  3X3N A;  3T53 B;  3NBI A;  5COY A;  2D5D A;  3CRL C;  4CBV A;  4X3T A;  1I50 B;  4DK0 A;  4G7O C;  1JB3 A;  3BVM A;  3IL8 A;  4FNF A;  5KGU A;  3HG9 A;  1HCZ A;  5TSS A;  1QNU A;  2AUJ D;  1I4G A;  2IJ0 A;  1I6H B;  1TS2 A;  4C1N I;  1FR3 A;  1BUV T;  2ENB A;  3A54 A;  2K5W A;  1Y1W B;  2EY2 A;  2F0Q A;  3V2T A;  4XDX A;  3VR3 A;  1SMY D;  2EYP A;  4QUC A;  3MTS A;  3KBG A;  4DFA A;  5ELF A;  3LX0 A;  2F0L A;  1CZG A;  3KLS A;  3A7L A;  1CT1 D;  2A69 D;  5JEA G;  2BE5 C;  1JE4 A;  3I4L A;  3FKI B;  3GTM B;  3R2I A;  2F3W A;  2LFN A;  1A6X A;  2DNE A;  2F0K A;  4H13 C;  1PRT C;  3P75 A;  2OEO A;  3V96 A;  2NWG A;  4LJZ C;  2PW7 A;  1WD1 A;  4IUR A;  2EPB A;  2R92 B;  2B2V C;  4NMZ A;  1TS3 A;  5FLX L;  3NHH A;  1RTO A;  3L3O C;  3NQI A;  3HOV B;  4DXG A;  3OWE B;  1CA6 A;  3OW7 A;  1SE3 A;  1SAP A;  3R8B A;  3CU7 A;  2F0I A;  2QF7 A;  2KVM A;  4RA8 A;  3OIQ A;  2FFK B;  2L1B A;  2A68 D;  2NVQ B;  4K5X A;  2QKI C;  4IQZ A;  2K6A A;  3A7A B;  1TT2 A;  1JC7 A;  1U4P A;  2A68 C;  2NN6 I;  4NKL A;  4KV6 A;  1SBB B;  1R4Q B;  2VNU D;  1WTO A;  1ONL A;  2B2T A;  5G3L F;  1AZP A;  5A35 A;  1C4Q A;  3VYS A;  3EFX D;  3PMF A;  4K2L A;  2F0M A;  2RKS A;  1F2L A;  5C4Z A;  5EBC A;  1BCP D;  2RQX A;  1LTR D;  5CYU A;  3MFG A;  3H3V C;  1UEA B;  1HTP A;  2FHT A;  1SFO B;  4KKS A;  1V1P B;  5ELD A;  4AYB B;  2KED A;  3QOL A;  1F77 A;  1BBX C;  1H9R A;  1I4R A;  2XRS D;  2E76 C;  5COR A;  4WFN 3;  2IL8 A;  4G57 A;  3VA7 A;  3FRP B;  1I4Q A;  1AFP A;  4DNT B;  3F2U A;  3QJY A;  1E0B A;  4TQU S;  1YNJ C;  3TME A;  1KDB A;  5FKA C;  3NXW A;  2ZXR A;  2PCF B;  3KK7 A;  3FVQ A;  1GUN A;  2RVL A;  3HGB A;  4BBR B;  2J4X A;  1VCI A;  3MVV A;  1EY9 A;  5M5X B;  4HR7 B;  2JSO A;  4B9X A;  4RGT A;  1F2M A;  1DM0 B;  1MGS A;  1OXU A;  3SXH A;  2K1B A;  1DOL A;  1CHQ D;  2Z4I A;  1M4V A;  4CKE A;  1PDQ A;  3S1M B;  3UI2 A;  1AZQ A;  4OL7 A;  1LLR D;  3BG3 A;  4R9W A;  3JAM L;  4A3I B;  4V19 0;  3HKZ B;  2B2T C;  1Y8P B;  2F03 A;  2BDO A;  1RHP A;  1W6K A;  1YNN C;  4ZUJ A;  4ILW A;  3HRZ C;  5I4D A;  4G4K A;  5JAV A;  1QIL A;  4PMW A;  3V05 A;  1PRT F;  1T5E A;  4K2K A;  2LMC B;  5C0X J;  1A2T A;  1WTX A;  1G2S A;  2XWJ B;  1CI3 M;  2SDF A;  4PNY A;  4RFB A;  3IFD A;  2IX3 A;  4ZK9 B;  5IGE A;  2RBM A;  4DAP A;  2IWH A;  4UDU C;  1S5C D;  4BA2 I;  2K32 A;  2EYH A;  2JA5 B;  1JIC A;  2MP1 A;  1VF5 C;  2YU9 B;  3GTJ B;  1JWU D;  4OHJ A;  3W2D A;  4I7Z C;  1Z7T A;  1HRJ A;  2KCC A;  4TRD A;  3CQZ B;  1EY5 A;  2L55 A;  3C1F A;  3P7J A;  1DCZ A;  1A2U A;  1CA5 A;  1CFM A;  4MN3 A;  3MXU A;  2AQ2 B;  1SEB D;  1FNW A;  3OMG A;  4KN7 C;  4FXG C;  2KA7 A;  4C56 C;  2AWO A;  3HOY B;  4C3H G;  2F0G A;  1GUW A;  3K0Y A;  2F0P A;  3H6M A;  1RCV D;  1PYW D;  4ZAI A;  5C44 B;  1KTK A;  2E2I B;  2RA4 A;  2B2U A;  1DXM A;  4IFD J;  3GTG B;  1PFN A;  2D9U A;  5T1I A;  1EIH A;  3A8I E;  3E5S A;  3QIA A;  4DN4 M;  5KNC A;  2F0H A;  5I2Y A;  2J7Z A;  1L0X B;  1ZYR D;  1WTQ A;  5LHY 1;  3TZU A;  5FK9 C;  1BCP B;  2R61 A;  4BS9 A;  2F0W A;  4XIG S;  5IGB A;  2CHB D;  1LAC A;  5ELE A;  4G7Z C;  1STN A;  2CW0 C;  3D3R A;  3OWF A;  2O5I C;  4IUQ A;  1CHP D;  2K33 A;  3I70 A;  1TU2 B;  2Y0S B;  3I4N B;  1E2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...