4RWSC

Crystal structure of cxcr4 and viral chemokine antagonist vmip-ii complex (psi community target)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
LGASCHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-X-C chemokine receptor type 4/Endolysin chimeric protein
publication title Structural biology. Crystal structure of the chemokine receptor CXCR4 in complex with a viral chemokine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, hydrolase
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rwsC00
2K1BA 2B2UC 1LV9A 1PFMA 5EPKA 1JE4A 2VXWA 1XYIA 3I91A 2FFKB 1TVXA 1MSHA 2MJ8A 2MP1A 1SSOA 1CM9A 3I3CA 1BNZA 1A15A 1E0BA 2B2TA 2L9HA 4IUTA 4LMQD 1WTWA 1ILQA 3I8ZA 4ZK9B 1ML0D 4XT1B 4XDXA 2IL8A 1G2TA 1M8AA 4QUFA 3QO2A 1JICA 1MGSA 4R9WA 3KUPA 2RSNA 2N55A 5T1IA 1WTOA 4QUCA 2B2TC 5COYA 1WTRA 1J9OA 2MPMA 1SAPA 4RAUC 4CJ0B 5EQ0A 1GUWA 3G7LA 1F9SA 4X3KA 1WD0A 1HUMA 2NYZD 1EQTA 2HUGA 3P7JA 5EJWA 2X6GA 1WD1A 3IL8A 1RTOA 1G6ZA 1X3QA 2M2LA 4NW2A 2FHTA 1DOMA 1BF4A 2MGSA 2HCIA 2J7ZA 4ZLTF 1U4RA 1RODA 1B4OA 1NCVA 1HRJA 4IUPA 2RSOA 2N88A 1O80A 2B2YA 3DEPA 3IFDA 1B50A 3MWYW 1IL8A 1B53A 1DOKA 1Q3LA 3GV6A 3TN2A 1ICWA 1MI2A 1CA6A 1HHVA 1F9QA 1U4MA 4DN4M 3MTSA 2KUMA 5EKIA 1IKLA 2K28A 1O7ZA 3R93A 2B2YC 2NWGA 1WTVA 5E4XA 2EPBA 2X69A 4X3SA 4X3UA 2SDFA 5T1GA 1HA6A 1G2SA 4IUUA 1KNEA 3FDTA 5EPLA 1DOLA 4HEDA 2FMMA 2JP1A 1F9PA 3H91A 4ZKBB 1HFGA 2DY7A 1B3AA 2FJ2A 2JYOA 2B2WA 1DONA 1EL0A 1MSGA 2K05A 5AFWA 1SDFA 1X3PA 1QG7A 4XT3B 5E4WC 3DEOA 1EIHA 3HP3A 1EOTA 4X3TA 2XIWA 2EOTA 2D9UA 3I90A 2RVLA 2DY8A 2R3ZA 2HDLA 4IURA 3F2UA 1HFNA 2L11A 3KBXA 5D14A 2B2WC 5JJZA 2CVRA 1AP0A 2RA4A 1PDQA 3TZDA 1NR2A 4OIJA 1PLFA 1J8IA 1ESRA 1KNAA 2KEEA 4CJ1B 1G91A 1IKMA 4MN3A 3DM1A 2B2VA 2KEDA 4HCSA 1C8CA 1BO0A 4IUQA 5D65A 2HCCA 1RJTA 2HDMA 2KECA 1WTPA 3GV3A 5EPJA 1HUNA 1X32A 5CBAE 2L12A 2BDNA 1S4ZA 2K01A 4ZKCB 1WVLA 1B2TA 2L4NA 1U4PA 2K04A 2Q8RE 3ONAB 2NZ1D 2H1EA 2X6LA 1QE6A 1O7YA 4ZAIA 2K03A 1U4LA 2B2VC 2KVMA 1CA5A 1BBXC 1NAPA 1DZ1A 2L1BA 3LWEA 1XX8A 3SVMA 1F2LA 1WTQA 1QNKA 2KOLA 2EE1A 5CORA 4CJ2C 2Q8TA 1NR4A 4IUVA 4RWSC 1VMPA 4U68A 4HSVA 3UI2A 2B2UA 3FPUB 3D6WA 4R8IA 1RTNA 1VMCA 1AZPA 4HAEA 4RA8A 5DNFA 1EIGA 5CBEE 1ILPA 4OIKA 3N52A 1PFBA 1ZXTA 3Q6SA 5CMDA 1AZQA 4O42A 1F9RA 4UAIA 1WTXA 4MHEA 2FINB 1PFNA 1RHPA
chains in the Genus database with same CATH superfamily
2LFNA 2ZT9C 1BKBA 1I4PA 1K8MA 2Q2UA 5IT9c 3RZOH 2F0MA 4ZK9B 3KF8A 3JAMc 2NVQB 1VQBA 5M5XH 2WV6D 5JVG3 4DR7Q 1PYSB 2Y0SG 3TRZA 3DXJC 3URYA 4EVOA 2JSOA 5J22A 2RSNA 3H0GG 2A8VA 1EQTA 3P7JA 1MHWC 4RFBA 3PMFA 1G6ZA 2H5XA 4BXXG 2HCIA 5GADC 4FXGC 3HOYG 2K5QA 4LF9L 4P75A 3I56A 3S2HB 3K5OA 5J1ZA 3GV6A 3NWTA 2Y0SB 1F9QA 2PQEA 4N8X1 2F0WA 1V43A 3HOUG 1X3EA 2JA8H 4JI2Q 1O7ZA 3SHLA 2K5VA 3I4NH 3NWSA 4NDXA 2SDFA 2K7VA 5C4XG 4DUYQ 1KNEA 2ATWA 2AUJD 3NTHA 1EL0A 3HOYB 1BOSA 1QG7A 3FVQA 4F88A 1RIPA 3RNUA 3NPPA 1QNUA 5GQOA 1S5ED 2RHQB 1I50B 4DV5Q 1Q86C 1A62A 1MJEA 3KJPA 3HOUB 1NMFA 3SDZA 2JA9A 2YV5A 3VR2A 1KD1C 2NVXB 3ULJA 2KCMA 1KDBA 3L2PA 3NENA 2EJMA 2DGYA 1O7IA 2F0JA 3HOXG 3SK6A 3TZUA 2R92H 3DHQA 4IPDA 5EPJA 1N8RC 1CHPD 3SR1A 1AH9A 2CCZA 2H1EA 4HMJA 1CA5A 4JVZA 1HQRD 1K8GA 1SMXA 5JJIA 2BH8A 1SFOB 2EE1A 4KD4A 4QIWE 4JI2L 4RGMA 4POFA 1LTAD 2OCEA 4RH6A 4RCNA 3VR5A 3UDFA 5J39A 3I4MH 2JJQA 1NY4A 3T56B 1L0XB 3HOXB 4JK1C 4IUNA 4HAEA 4BY7H 2F0EA 4DA2A 5C5MA 4BA2I 2O5JC 1B3AA 1RHPA 4ZUJA 4Y52H 2FFKB 4DV5L 1QZHA 3M4OB 1K73C 3K6OA 1DD2A 3I8ZA 4XXEA 3OW2A 4DR3Q 4GN3B 1CKOA 3OWFA 2Z4IA 1JICA 3CW2C 2AKWB 2SNSA 1PRTF 4UHVA 4RAUC 2GVBA 2F0SA 1EFWA 3KLSA 3G7LA 4X3KA 1WD0A 3J81L 2DJFC 1VQCA 4GN5A 4DUZQ 1JOOA 2BE5D 4N9TA 1D8LA 1SLJA 1EY5A 4YHHQ 2A5HA 3AFQA 2RHSB 3DM3A 1RDPD 1PH2A 3UE1A 1VQ4A 1IL8A 1DOKA 1YNJC 3CQZB 4QY7A 3I72A 1TWFB 1FR3A 4C3HH 2IT1A 5I4DA 2SOBA 4EGVA 3GTJB 4JI4L 1IKLA 3KF8B 4A3JH 1GUTA 2EYHA 2E8GA 4JI8Q 4MNOA 4UP7A 4IFDJ 2KHJA 3PQIA 2VQFL 4A3IH 3CC7A 4DR4L 1DOLA 4BY1G 4GNXB 2YU9H 3DWPA 4HIMA 1X3PA 3A7LA 3DEOA 4DR3L 2BH2A 3VR3A 1LO5D 4TQUS 2K6AA 3KBGA 1M1KC 3PUVA 4A3KH 5HGQA 3A5UA 3F2BA 2CHBD 1PDQA 1NR2A 2D0OA 4FYDA 4TSSA 1QILA 1IW7D 1E2ZA 4Q0FA 3NBHA 4JV5Q 2B29A 1FL0A 1STYA 4OXPA 3Q0AA 4HCEA 3AFPA 1E7ZA 3GTPB 2KECA 2QGQA 1A8VA 2XNAC 4L5TA 1H9SB 4BY1B 4YHHL 3HOWG 1VQDA 3NSWA 2BDOA 1NMGA 5IYBG 1S5BD 3UE0A 5ISRA 4B3SL 3PO3H 1K28A 3LWEA 1OO9B 3L7ZC 1VQ6A 5LMUQ 4J6HA 5C4JB 1TT2A 3W1BA 3I2ZA 3C1EA 4JI8L 2CH4W 1LUZA 4IOAA 1YZ6A 4KTAA 3TP8A 5C3XA 1N34Q 2K5DA 3I70A 5ELCA 4XIGS 5CMDA 3HOWB 4IZ8A 4DNIA 3WWVA 3IRBA 3K8AA 4H7BA 4WFN3 1SNCA 2O2LD 3CMAA 4IJHA 4A3MH 4DK3C 1YJ9A 5JOBA 5FLXc 3QWNA 1BQQT 2G9HD 1IBML 4WORA 3S15B 5EJWA 4FNFA 2E2JH 5FLMH 1D5ZC 2J7ZA 3RLFA 1U4RA 3MWYW 5IYDG 2N8NA 5C44H 4I7ZC 1MI2A 1B44D 2N78A 4OX9L 4DAYB 1EEFD 1WCMH 3MVVA 3K7AB 2E2IB 1WTVA 4IPGA 2NWGA 2QDLA 5M5YH 3Q23A 2X69A 4DV4Q 3NBIA 5ELDA 3CC2A 4A3GG 2AQ3B 3W1GA 4RMFA 3RLNA 1TWCH 1KL9A 2C35B 4P2CB 1ET6A 4DR2L 4BBRG 4PMCA 4OO1I 2Z0SA 2EOTA 4DV6Q 1E1TA 3P75A 2JEAI 1ESFA 5JJZA 1I94Q 2F0UA 3TZDA 1D7QA 1J8IA 1SJED 2EY5A 3J80i 2K5WA 4CJ1B 1X3GA 3J7YW 3I55A 3OOCA 2PI2E 1XTDA 1BO0A 3PF4A 3J7ZC 4CKEA 4DK6C 4A3GB 1PTOF 3S14B 4RCOA 1Q82C 1U4PA 4DR1L 3R93A 3GTMH 4LF7Q 4BBRB 2JA7H 2NVXH 4L6TB 2L1BA 3E0JA 4BA1I 1BCPD 4DNRB 4A3BH 2D5DA 3CU7A 1ONLA 3RUZA 5FJ8H 3UI2A 1RTNA 3TSSA 2G9DA 4DV4L 2I46A 3KJOA 5BN4A 5M3FG 1VQOA 3Q6SA 3GDEA 3PO2G 4JI3Q 4FDBA 4X65L 1TS4A 1XNQQ 2QEXA 3A0JA 1VQNA 4PZ8A 4DV6L 1HR0Q 3BG3A 4DV2Q 1H9RA 4KKTA 4XDXA 1VQAA 2IHFA 3A5ZB 5BN3A 5K36G 4R9WA 3U9OA 4X64Q 1ASYA 1WTRA 5LL6S 2UUBL 2NTTA 2QW7A 5M3FB 4FF1A 4KHPQ 3PO2B 3TS0A 4R4TA 3GTGB 2ZXRA 1LT4D 1K0RA 2IPKD 4B9WA 3BU2A 4YCWA 1AE3A 1ET9A 2MO1A 1T5XD 3I73A 3IFDA 1EWIA 2LY7A 4F7XA 1DYQA 2EYMA 2KHSA 3NP8A 2BA0A 3T16A 5C0XH 4KHVA 3RLOA 1X9NA 3T13A 4DK0A 5C0XJ 3NXWA 4DU9A 4JI3L 3LGJA 1R9TB 1HA5A 3CP0A 2WACA 1PZKD 1H9MA 4DV2L 3M4QA 4IPHA 3C3LA 4LNQA 1B8AA 2FJ2A 1PH5A 4J1MA 4GKJQ 4XTCS 1AFPA 1B70B 1J6QA 1M90C 2F0LA 1RD9D 4C56C 1PRTB 1I6HB 1V8QA 1VQJA 2F0KA 2R3ZA 3HKSA 1KAWA 3J81E 2EJGC 2L11A 3J7AF 2VUMB 3OWEB 3S1NB 3AYHB 3E9HA 4JBKA 3D4WA 4R1JA 2B2VA 5DM73 2BE5C 2R6GA 4JI7Q 1Z6HA 1WTPA 5CC4A 1JWUD 1EWCA 4PMWA 4MZ9A 4HSPA 2B2VC 4DXFA 4LFBL 4KHZA 2JK8A 1CKNA 1QCBD 1QNKA 4PZ6A 3NELA 2VY3A 3BDCA 3GTPH 2PQAA 4Z9CB 4F8MA 5AJ3L 2E2DC 4HJ5A 2A6HD 2B2UA 1VF5C 4R8IA 2Z6KA 5KIXA 1M4VA 1Y8PB 2BCOA 4H0LC 2RBMA 4JI1Q 3IFTA 1AE2A 2F4VQ 3JAMi 1SNDA 1I4HA 1IBLQ 5C4ZA 2XVSA 4A3FH 4HIOA 2HHHL 2B2UC 2F0DA 2Z6KC 4A93H 1JR0D 1JOKA 3S1RH 4HIDA 2MJ8A 4G7HC 1BNZA 2L9HA 1A3TA 4NPSA 3TREA 3A7AB 3CCVA 2F3WA 1D6EC 1IW7C 2M9VA 3SE0A 4P73A 3WOFA 1XMQQ 4QCLA 5G3LD 4LW1A 1MGSA 4O1NA 3TEHB 3KUPA 1P16A 3A54A 4I65A 3SGIA 4KY7A 4POGA 5IYBH 3UDXA 1SAPA 3U9SA 1HCZA 2Y0SE 4JG2A 3M4YA 1UE6A 5EQ0A 3J80L 1SNOA 2NN6G 3A56A 1S40A 1SE2A 2Q2HA 3NK9A 1KTKA 2A6ED 1NCVA 4NMZA 1LTBD 1B53A 2ZTCA 4HJ9A 4DV3Q 1F77A 4WJWA 3M9BA 1PV4A 1N33Q 1VQFA 3SK4A 3RN5A 3PGZA 4R4CA 1PZJD 1SXTA 3H91A 2JYOA 2N3SA 4X66Q 5E4WC 4RGTA 3GTLB 1JORA 2F0GA 1LLRD 1CQFA 4OEMB 2JA5G 3K7AH 2PPBC 4C3JG 2E2IH 1JJGA 4DV7Q 1ICFB 2RVLA 2ID0A 1CSPA 2F0NA 4PZ7A 1Y1WH 3Q24A 1N32L 2KEEA 3GD7A 5DM63 4HR7B 1QOHA 1T9HA 1B9NA 3E5SA 3ULLA 4ZCKA 3ITPA 1V1QA 1KQSA 1TQOA 2JA5B 4FXDA 4C3JB 3BDOA 3PF5A 3C46A 1D5MC 3ERSX 1JC7A 3T1HL 3HEJA 4A3GH 1XJVA 4LWCA 3RZDH 1A2UA 1LTGD 5I6WA 2ASBA 5EKLA 1UAPA 4A3EH 3PIPA 3S2DB 3C2PA 4OIKA 4X66L 3S9WA 2WKCA 5ELNA 1EIYB 1PFMA 1QUQA 2VXWA 4RHRA 3K57A 1TVXA 4PNYA 4G7OC 2AUKA 2WB1G 3QJYA 2D0PA 1KRTA 1ENAA 1NBWA 1ILQA 1FNUA 2NVTH 2F0HA 2VB3X 4LF9Q 3HKZG 1PTOB 2CH4A 3BS1A 3HOZG 1CKNB 1WJJA 3V05A 4ZYSA 5COYA 2PQAB 4WJ3M 3HRZC 1VQEA 3VDYA 2WKDA 1ZYRD 3K59A 1AEXA 1IZ6A 2OWOA 1BCPC 2WB1B 5CGKA 3DLLA 2A19A 4KI0A 1GD7A 1VQHA 1RF2D 1ICWA 3M7NA 2C9OA 3HKZB 3I4OA 4FF4A 2VNUD 1O7LA 2F52A 3IKJA 3PUZA 3PO2H 2VS1A 3HOZB 1HXYD 4U673 1Z7TA 2K5NA 3D3RA 4NP5A 2A1AA 1PH3A 2H4OA 4HN7A 1WOCA 4Y7NH 2ALYB 5IE8A 1SRUA 1L1OA 1G8ZD 5T1GA 4AYBB 1G2SA 2UXDL 1Q90A 2R93H 1XMOL 4ZKBB 2WIIB 3G71A 1UEBA 5K36H 1Q12A 1L1OC 3QG1A 2XWJB 4EQPA 3RR5A 1IL2A 1SNQA 4XQQA 1G91A 4IPCA 3L9AX 4S3SA 3DM1A 3H0GB 4GN4B 1FJGL 4YWMA 1YITA 1D1IA 1X32A 1PVOA 2RCFA 3D4RA 5ELFA 2VUMH 2HIXA 5ELEA 1DJRD 1K83B 2SEBD 2YYZA 1DZ1A 3STBD 4LF8L 3E9IA 3PSIA 1A3VA 4U68A 1FNWA 5HGTA 1TWHB 3O13A 3OPOA 5C4XB 1TKWB 2J0TD 1GVPA 1WTXA 3F8TA 1IKMA 1A6XA 2F0TA 4P72A 5IP9G 4JYAL 5EBDA 2MUYA 1PYBA 1MIUA 2MP1A 4IO9A 1CM9A 3CXCA 5GAGC 1ML0D 1LABA 3L3OC 3EIVA 4A3DH 3G48A 1K9MC 2F0VA 2IWHA 3EA6A 3HG9A 2MPMA 2N49A 5C6AA 4IN3A 1KAAA 4ZRZA 4UP9A 1F9SA 1W2BA 5JEAG 4JI4Q 2PMZB 1EY0A 4CKCA 2E2HB 2VZAA 1PH7A 3W2DA 2ZJPA 1FD7D 2VQFQ 2CKZB 2QF7A 4KY5A 4DR4Q 3GTOB 5IP7G 1EU3A 1HJPA 1O80A 3ZYYX 1QUQB 2A6HC 2WAQG 4L63B 5NUCA 3G6JB 2V4DA 5CV8A 1GM5A 3PIO3 2XSCA 2O5IC 2F03A 3K58A 4QMGA 3KK7A 3MHBA 5DLQE 2K33A 3FDTA 1B1ZA 3DWQA 1SDFA 3F2CA 3J81c 3MXUA 1LT3D 4A3LG 2MFIA 2RDGA 4M1UB 3S17H 2WAQB 1HFNA 4K2LA 3G6EA 1X55A 3J80E 3ND9A 5KYIA 4B3SQ 3S16B 2NN6H 4LF4L 1AP0A 1U9RA 3AQQA 4YCVA 1TU2B 1C7YA 1ESRA 5IYCG 2IW3A 2B3GA 2KEDA 4YY3L 2UUAL 2B63G 3HOVG 1EU4A 4IUQA 3U4ZA 4DXGA 1QVFA 3OMCA 4K0KL 1CTMA 4X6AH 1K0SA 4ZKCB 1VQ5A 2A6EC 2E74C 3PIOA 3LX0A 1O7YA 1L1OB 1UEAB 1TWAH 1G51A 2EYJA 1F2LA 1JCKB 2A74C 3SK5A 5IGGA 3TP6A 4FXKC 1L0YB 1HTLD 1VMCA 1D5XC 1AZPA 3BYYB 2B63B 5CV4A 3HOVB 1J5EL 3MC0B 2F3IA 3FKIG 2K5HA 2JA5H 1GO3E 2K50A 1F9RA 1PFNA 1TS5A 4YWLA 4CDFC 5M5WH 5EPKA 4OELB 1IBMQ 2JXMB 1VQMA 1TS3A 2EYLA 3TQYA 2I0QA 3WDNA 4LMQD 2YTVA 4XT1B 4DV1L 2DJGC 3S1MH 3S2DH 2LXJA 2ZXPA 1EOVA 2WP8J 3R2TA 1HQMC 1BDOA 1WTOA 4QUCA 5C3EG 1J9OA 5GROA 2PNHA 4OX9Q 2PZWA 3FKIB 4L5SA 1NUCA 2MNAA 1WD1A 3P20A 1X3QA 4NW2A 2KHIA 2EYPA 4IFDI 2MGSA 1UWVA 1YEZA 3H3VH 1PTOH 4ZLTF 3CKIB 4PV1C 4JI6L 1WTHA 2D62A 4LJZC 1TWGH 2FXQA 3R2IA 5IWAL 1TIID 4R8NA 1B50A 2C5CA 4A3CG 1SR3A 4DR2Q 5JAVA 3CCQA 4BBSH 1S3OA 1SE3A 3VA5A 3E6ZX 5C3EB 2K28A 2KJXA 3T1YQ 2IJ0A 2EPBA 3CC4A 1QVGA 3M85A 2D2CC 4QL5A 3T51B 1EQQA 2Q2TA 4M8AA 1MSGA 4DK1A 2NVQH 1YHQA 3HOZH 4IALA 4DR1Q 4Q5VA 4IURA 3MXNA 2HDLA 3PV0A 4K8IA 4HMIA 4C3IG 4CDDC 5KNDA 2Z6BA 5D3IB 3M3YB 1JWMD 1EZ6A 1OXXK 3GO5A 4WJ4A 2NB0A 1HH2P 5D65A 2OTLA 4H44C 1LTRD 1ZYRC 4GOPA 2UXCL 2L12A 4KN4C 3S2HH 1WVLA 1B2TA 2F4IA 2IHEA 4ZAIA 1N36L 2LSSA 4AQYL 4X65Q 3ER0A 1YNND 4DR5L 1XX8A 4GOPC 2XN9C 3H0GH 4C3IB 1MKHA 1V1PA 4CJ2C 3T1YL 1NR4A 4PMBA 4RWSC 3JAME 3FPUB 4BXXH 1EY7A 3BDLA 1LACA 5CBEE 3HOYH 2CWAA 1XWEA 5FOBB 2UUBQ 1LV9A 1I50H 2OT2A 1KLGD 4DNTB 1CI3M 1E2WA 3HOUH 1CQVA 2XRSD 3BVGA 4OONA 1FGUA 2NVYB 2F1MA 2JN4A 1TWHH 1G2TA 2A69D 3A74A 5C4XH 4ODGA 4B3RL 3QO2A 4JI5L 2OEOA 2TMPA 4CKBA 3CCLA 4B08A 1H9JA 1PHJA 1PH8A 5GAHC 1NTGA 1E1OA 2BA1A 5KNCA 1HR0W 4DKAC 3NBHB 1YHAA 4GKKQ 2PYKA 3STBC 4IOCA 1SFOH 3OIPA 5I2YA 1B9MA 2TSSA 2AQ2B 5D3DA 1CZGA 2B2YA 3HOXH 5A35A 1HNWL 5IY0A 1SBBB 4LUOA 2G5DA 3MTSA 2QKIC 1FVIA 5EKIA 2B2YC 3HS0C 3CPWA 2A73B 4C2MB 2I07B 2OQKA 2SNMA 2VQEL 3M4OH 3K0YA 4C1NK 2IX3A 4NXML 2K05A 4JOIA 3K0XA 4OWWB 1BBUA 4JBJA 1SYDA 5KNBA 4LFCL 3V2TA 2R7FA 1GKHA 4LFBQ 3RN2A 1CT1D 5D14A 2CVRA 1KIXA 4JOIC 1Q8KA 5IOCA 2DN8A 2Z9HA 1Q1BA 5M5XB 5AJ3Q 3Q8DA 1TS2A 1RJTA 1EY4A 4GKKL 1N9WA 2JA8G 5LMNW 3OIQA 3CQZH 3I4NG 1CKMA 4QQBX 3S16H 1TWFH 2KVMA 1X56A 4X62L 1IYVA 2HHHQ 3MFGA 4JPBW 4B3TL 3GTJH 3SVMA 4UY8C 5DEHA 3EJIA 3M4PA 3S1QB 2Q8TA 1UNSA 5HY6A 1A0IA 3PIP3 1EZ8A 3CAMA 3MXNB 3N52A 1IYUA 5BN5A 3L0OA 1H9KA 4MHEA 1BVSA 1E22A 1JE4A 5IGBA 3HGBA 3EROA 1I4QA 3QOLA 1OXUA 5CV9A 4LAAA 1WTWA 1HNXQ 1Y69U 3K7UC 2IL8A 1JQYD 2AQ1B 2F3VA 2WB1E 2XWBB 4UP8A 3GTKB 1SE8A 4GZYC 3FEWX 2L0CA 4BY1H 1EQRA 1II3A 1E24A 3HKZE 1T5EA 5C0XI 1IYJB 3DMUA 3OHXC 1I5FA 3EQLC 2E5LL 3I4MG 1GXDC 2PO4A 2M2LA 1DOMA 4JBMA 1K3RA 3K80C 5C4JH 4BY7G 4QB4A 3HFZB 1D2BA 5M3MG 2NUCA 4AYBE 3PUYA 1JB7A 1XTCD 5C5LA 2QA4A 3FKIH 3GTQB 1F2MA 4ABNA 2QILA 1BCPF 3HOWH 1QZGA 4K5XA 2JA6G 5CYUA 4R4OA 2GVAA 3NTIA 1N32Q 2EYOA 2JP1A 3KFUA 1F9PA 1FGBD 4BY7B 2ZXOA 1IBKL 1DXMA 1BBWA 3TDQA 1HNXL 5M3MB 3J80c 4X3TA 3N6RA 2ZJQA 3D0FA 1F2ZA 4J15A 4CBVA 1STHA 1U5KA 3S15H 2JA6B 3PCOB 3E3XA 5IGFA 3ZJYC 3W3AA 3T1HQ 2AMCB 4C3HG 2LXKA 1EY9A 2XGTA 2PCFB 4TKOB 4IFDG 2OTJA 4A3JG 3S24A 1MD2D 2NZ1D 3CCJA 3QR8A 4DAVA 1O78A 2ZJRA 1XPOA 1NAPA 4A3IG 5KRUA 4KD3A 1UE1A 1X6OA 3GQBA 3H15A 3FRPB 3I7FA 3R3OA 4YCUA 3D6WA 1Q7YC 4K6DA 4XYOA 2F0OA 4DAMA 4A3KG 1STGA 4C3HB 5FO8B 1S72A 1X54A 2UUCQ 1ZXTA 4JI0L 2FINB 5IYDH 3BVMA 2WFWA 4A3IB 3H6MA 1A15A 2B2TA 2PMZE 3NEMA 2EZVA 2YU9B 3OSOA 4KV6A 4YWKA 4PG3A 1RKNA 3SEBA 4G7ZC 3DWAA 3CF5A 2HT1A 3PO3G 3OYYA 3S14H 5KEEA 2AHOB 3MAQA 2B2TC 5EAYA 4A3KB 1HNZL 1HUMA 3X3NA 1E2VA 4BBRH 4IQZA 1X65A 1GHKA 2IY5B 1YNNC 2YTXA 4K14A 5ELBA 1EWHA 1LT5D 1XPRA 3CD6A 2UXDQ 3ERQA 5F2DA 3CCRA 1XMOQ 4DV0Q 4OO1G 1EY6A 3D6CA 2DNCA 1HHVA 4B9XA 3PO3B 4LF6L 1D1KA 1V1OA 1TY0A 1C4QA 2UUCL 2WAQE 2EVBA 2EDGA 1C0AA 2KBNA 5EPLA 2UXBL 3KLWA 1FJGQ 1H95A 1HFGA 1PYWD 2DY7A 4BWGB 1DONA 4XT3B 4V0BA 1Y14B 4UPAA 2A69C 1UE5A 2D9UA 5FLMG 5M3FH 5L37A 2KA7A 4LF8Q 1PRTD 1GJXA 1QB5D 4OIJA 2EJFC 3GTGH 5G3LF 1JMCA 5C44G 1VQKA 1C8CA 1KLUD 1ASZA 4XYQA 1HUNA 4KN7C 1WCMG 2F0PA 2EY1A 5IT9L 4QF4A 4DV0L 3JAML 4OWXB 4NXNQ 1SYGA 2E2JB 2L5TA 2KOLA 4R4QA 4JYAQ 4L8JA 3UDIA 1R9TH 2ICIA 4GLXA 2GN5A 3DUZA 1HTPA 1SE4A 4GNXA 2L15A 3MEHA 5C44B 1CZWA 4RA8A 1EIGA 4N8FA 3A8IE 1Y8NB 1WCMB 2O4XA 4LF5L 3H94A 1I6HH 1SYCA 4GNXC 4XQNA 5A2QL 3S1QH 5M5YB 4RGNA 3U4VA 2ZM6Q 3G4SA 2VW9A 1RCVD 3K5MA 3F2DA 3S1NH 1E0BA 1MBYA 4CHTB 1TWCB 1I3QB 4N9PA 3J7A5 5E7NA 4QUFA 1H9SA 2JA7G 1CK1A 4FO2A 2N55A 3NQIA 5T1IA 3AMUA 2PZUA 1K3BC 4A3BG 3PUWA 2NBFA 5FJ8G 2HIVA 5LL6X 4NXNL 2FHTA 1I4GA 4DFAA 1PA6A 3GTKH 4DR7L 3CHBD 3BVZA 1JJ2A 3GTMB 3FP9A 1QWYA 2A68D 1U4MA 1KC8C 3JC66 3KLSX 4DN4M 2JA7B 1PH6A 3A8KE 4ME3A 2F0IA 2R7ZG 1EYAA 2CQAA 1EUJA 5E4XA 4CDEC 4A3BB 4LF4Q 4CDCC 2ENBA 3CRLC 1HA6A 3QIAA 3MXPA 2GA4B 4HEDA 2ZM6L 4YY3Q 2UUAQ 4K0KQ 4NB3A 3GTQH 1BXTA 1JT8A 4DPGA 4EQOA 1EOTA 1I4RA 2XIWA 1QVCA 3MEFA 4H02A 4KLKA 1AN8A 1IHZA 2J4XA 1CFMA 2RA4A 3D8GA 2R7ZB 1SYFA 1L2FA 1EFID 1KNAA 1YJNA 4DUYL 2K32A 2OF1A 4JCVE 2RF4A 5FKAC 2ZTDA 5C0XG 5M3MH 3RD4A 2HDMA 1KHIA 3U50C 3ULPA 2Q8IB 2AWOA 2BDNA 2K01A 1A3UA 1J5EQ 3VR6A 1PFSA 2L4NA 3NHHA 2X6LA 3CRKC 1U4LA 1BCPB 4DAYA 1GUOA 4A76A 4O0AA 5CV6A 2JA6H 5FO9B 1R4QB 4JBWA 2BOSA 1CHQD 4B3MQ 3TS2A 1EIFA 5IGDA 1JWSD 4DV1Q 2KCNA 1Y8OB 3OMGA 3BZDB 1YI2A 4RGOS 1VCIA 1PFBA 3GTLH 1EYGA 3U58A 1A63A 5I9OA 3TN2A 1JB3A 2K1BA 4OL7A 1I6VC 1XYIA 2YTYA 1V9PA 4CGYB 5KYLA 3FMCA 3MXGA 2EYFA 4JI6Q 5IWAQ 4ME5A 4IFDH 4FP5D 5EBCA 1PTOD 4FVMA 1STBA 1HZCA 4CJ0B 2NYZD 2PZTA 4C3JH 2X6GA 4RHSA 3MFYA 2HQEA 5CR3A 2F0QA 4IJLA 4K5VA 1BF4A 2V1CC 2KENA 1RODA 1HRJA 4B3ML 4IUPA 2I5HA 2LKVA 1LTID 4A3FG 3WOEA 1LT6D 1ENFA 1Q3LA 4A93G 4KMUC 3QOJA 3A55A 3NE5B 4LUVA 4KK7A 3H09A 1NJIC 4DUZL 1K8OA 1DM0B 3VYUA 1OXTA 4UDUC 1LYLA 4X3UA 3X3MA 3SK8A 1UE7A 2QDBA 2NN6I 4RKBA 4I7AA 2R61A 3KOJA 5AFWA 1BUVT 3ICEA 2UXCQ 1OXVA 1YBYA 4R4IA 4A3FB 5CV7A 1N36Q 3I90A 4A93B 2EY6A 3EBEA 4G57A 4AQYQ 3VR4A 3S1RB 4JW0A 1F2YA 4YIJA 4DR5Q 5JJKA 5IODA 1DGSA 3V96A 1KXLA 1W6JA 2HCCA 5LHY1 2L55A 4OO1H 2CW0D 1TR5A 4HJAA 1SMYD 2OXPA 2K4KA 1VQ7A 3P1HA 3KLRA 4OGQC 1SNMA 1LTLA 2B8GA 4JV5L 4MTNA 5FLXL 2PW7A 5IIFA 3TMEA 3UDGA 4IUVA 1GOZA 1VS0A 2IX1A 2NZHA 2DNEA 5DNFA 2M00A 5FK9C 3KYHC 4B3RQ 3CCMA 4AH6A 4JI5Q 3CCEA 1Y1WG 4UAIA 5M9OA 3NUCA 2LMCB 2MHVA 3T53B 2VB2X 2QCPX 3W5OA 4QIWB 2HQLA 5LMUL 1VQ9A 1BR9A 2NTSA 4XQJA 1VQPA 3I3CA 3BZKA 5IGEA 1AW7A 1VQIA 1PRTC 1C48A 1WFQA 3D31A 4HJ7A 1PZID 2XRQD 2K52A 5IT9E 1N34L 3H3VI 2UU9Q 3CCSA 1XNRQ 1YVCA 4DF7A 1VQ8A 1HPCA 2E75C 1HNWQ 3J81j 1KRSA 2OQ0A 1Y1WB 2RCNA 1K83H 4KKUA 1EEID 1TY2A 1PMRA 3R8BA 2IX0A 3IL8A 3ND8A 1L0WA 1I3QH 2RQXA 5JJLA 5KGUA 4A3EG 1S5FD 2ZTEA 4FF3A 3OTOQ 2VQEQ 4KJNA 1GHJA 1B4OA 2I5LX 3NQTA 2RSOA 3TBIB 4NXMQ 2MO0A 4LFAQ 4EQNA 1Y1VG 1CA6A 5TSSA 5A2QE 4LFCQ 1JOQA 2JE6I 4A4IA 5IGCA 2R7DA 1VQLA 3RZDB 1S5DD 2B2WA 4A3EB 4DR6Q 2PI2A 3EFXD 1I4XA 4QJFA 4ID6A 2RDHA 2UU9L 1Y1VB 1XNRL 1XXGA 4FF2A 1Z9FA 4X62Q 3KBXA 1STNA 2B2WC 4MTKA 2K14A 3F1ZA 4B3TQ 2NVTB 2E2HH 4MN3A 5IP9H 3KF6A 4HCSA 3BYTB 1HZ9A 4ZQ3A 1ENCA 3OW7A 4RKLA 3GV3A 3VYRA 1WI5A 3GTOH 5GAEC 3OTOL 1STEA 4KY6A 2Q8RE 1WYDA 3ONAB 4DGZA 1FNVA 4LFAL 2A68C 3PUXA 2R7ZH 2R93G 1I94L 2B39A 1CUKA 1WTQA 5CORA 1RL2A 2KCTA 4BS9A 4ULLA 1VDZA 5JEAH 2RDFA 1VMPA 4K5WA 1EYDA 3RZOB 2JQOA 5JEAJ 2Q2IA 5JVH3 4LF7L 1PH9A 4HIKA 4DR6L 5IP7H 3VYTA 2EXZA 4Y7NB 3I91A 3MZ5A 1MSHA 1GUGA 1B3QA 5E3FA 3AB9A 3M7GA 3FPPA 3NTKA 4K2KA 2E5LQ 2R93B 1CSQA 1SSOA 1NSNS 1NE3A 2EIFA 4IUTA 4L5QA 2VUMG 1M8AA 3LWUA 2F0FA 4MIUA 3HZXA 2PNRC 4KKSA 3KDFA 1MJCA 1XNQL 4APVA 3CPFA 1PH1A 1HR0L 2CQOA 1C9OA 4A3LH 1ZKOA 1Q81C 1ZEQX 3D4DA 5BR8Q 4O2DA 1RTOA 2JA8B 3I4NB 2Z8LA 5LMNQ 4HJ8A 3SXHA 5IYCH 4GOPB 2R92G 3FHWA 2FMCA 2QEJC 4KJOA 4X64L 1IBKQ 1Q8IA 2B63H 3HOVH 4P74A 4KHPL 5H1SE 1Z47A 4GLAC 1E3PA 4C1NI 1V1PB 1SROA 1KDAA 4X3SA 3K5LA 2DUDA 4ALPA 4A3DG 1U0LA 1JJCB 1YHBA 4IUUA 4K8JA 1X3FA 3B6YA 4RG1A 4PQXA 5I9PA 1EIHA 3HP3A 2R92B 2KQ3A 1EY8A 1QJOA 1GUNA 2JEBI 2PW5A 2DY8A 1OTCA 1JE5A 3H3VC 1PTOC 5JPNC 4HTHA 5C3WA 2RKSA 1VF7A 5BR8L 1GUSA 4A3DB 5CV5A 4GKJL 5CBAE 5LMNL 3I4MB 1EYCA 1S5CD 2K04A 2EXDA 2K03A 4JI0Q 1EQVA 2I5MX 3RMHA 2KCCA 1YIJA 5C3EH 4V190 2CWPA 4K6LA 5I2XA 1YNJD 2HD3A 4JI7L 1UUPA 2MQHA 4TVAB 4JC0A 1FYCA 1LTSD 1R4PB 1HZAA 3E0EA 4A3CH 3KF6B 1HNZQ 4DAPA 3EVQA 1Q1EA 4GS3A 3I4LA 1STAA 3M3YH 2B8FA 4H13C 5K5PA 3QB3A 4L5RC 3VYSA 4GLVB 3K5NA 4JI1L 5DAUA 2F4VL 1KABA 3VA7A 1IBLL 1PH4A 3S17B 4NKLA 1G291 2VL6A 3CMEA 2CW0C 2P5ZX 5HURA 4LF6Q 1DCZA 1GUWA 1SYBA 1SMYC 2HUGA 5FLXE 2CFMA 1VQGA 5J3BA 1SYEA 4A3JB 4C3IH 1HZBA 2AWNA 4OWTB 1W3SA 2UXBQ 1XMQL 1XPUA 1LTTD 3DEPA 2N88A 1SJHD 2WINB 1A2TA 4WRDA 1Q46A 5JPMC 3C1FA 4ZUIA 1TWAB 2Z1CA 3Q22A 2KUMA 3CCUA 4G4KA 4EX5A 4LK1C 1G6PA 5EKKA 1SN8A 3K81C 4LUZA 5FO7B 1LM0A 2FMMA 3KDFB 2ES2A 4P71A 3AEVA 2NVYH 4DV3L 2LS01 5I6YA 4E6IA 4OHJA 5M5WB 3TP7A 4J8QA 1OXSC 3F2UA 2ICEC 1K8AC 1TXYA 1PXUA 4TRDA 2K75A 5EGTA 1YJWA 1N33L 3MA2B 4ILWA 1PLFA 3J81i 1KDCA 3A8JE 3T4AC 2XTIA 3S1MB 4BBSG 1NNXA 1YNXA 4A3MG 3BZCA 1S4ZA 3AU7A 1Y1VH 1P8LA 1BBXC 3EN2A 1QE6A 4DV7L 3IAYA 3J7AV 4AIMA 4LF5Q 1IXRA 2Z4HA 1B7YB 5ELOA 3TP5A 4EQ5A 2EQSA 4QGUA 5C4HA 2EY2A 4C2MH 1TWGB 2E76C 3GP7A 4HSVA 1W6KA 4F87A 4BBSB 5E1FA 1ILPA 4A75A 3LNNA 4A3MB 4AYBG 1AZQA 2NZOA 4O42A 1SEBD 3BJUA 1SNPA
chains in the Genus database with same CATH topology
2LFNA 2ZT9C 1I4PA 1K8MA 2F0MA 4ZK9B 3KF8A 2NVQB 2WV6D 5JVG3 3DXJC 3URYA 4EVOA 2JSOA 5J22A 2RSNA 1EQTA 3P7JA 4RFBA 3PMFA 1G6ZA 2HCIA 4FXGC 2K5QA 3S2HB 3K5OA 5J1ZA 3GV6A 3NWTA 2Y0SB 1F9QA 2PQEA 2F0WA 1V43A 1O7ZA 3SHLA 3NWSA 4NDXA 2SDFA 2K7VA 1KNEA 2AUJD 3NTHA 1EL0A 3HOYB 1BOSA 1QG7A 3FVQA 4F88A 3NPPA 1QNUA 1S5ED 1I50B 3HOUB 3SDZA 2NVXB 3VR2A 1KDBA 2EJMA 2F0JA 3SK6A 3TZUA 3DHQA 5EPJA 1CHPD 3SR1A 2H1EA 4HMJA 1CA5A 1HQRD 1SFOB 2EE1A 4KD4A 4RGMA 1LTAD 4RH6A 4RCNA 3VR5A 5J39A 3T56B 1L0XB 3HOXB 4JK1C 4IUNA 4HAEA 2F0EA 4DA2A 5C5MA 4BA2I 2O5JC 1RHPA 1B3AA 4ZUJA 2FFKB 3M4OB 3K6OA 1DD2A 3I8ZA 4XXEA 3OWFA 2Z4IA 1JICA 2SNSA 1PRTF 4RAUC 2F0SA 3KLSA 3G7LA 4X3KA 1WD0A 3J81L 1JOOA 2BE5D 4N9TA 1EY5A 2A5HA 1RDPD 1IL8A 1DOKA 1YNJC 3CQZB 3I72A 1TWFB 1FR3A 2IT1A 5I4DA 2SOBA 4EGVA 3GTJB 1IKLA 1GUTA 4IFDJ 1DOLA 3DWPA 1X3PA 3A7LA 3DEOA 3VR3A 1LO5D 4TQUS 2K6AA 3KBGA 3PUVA 2CHBD 1PDQA 1NR2A 4FYDA 4TSSA 1QILA 1IW7D 1E2ZA 4Q0FA 3NBHA 1STYA 3Q0AA 4HCEA 3GTPB 2KECA 2XNAC 1H9SB 4BY1B 3NSWA 2BDOA 1S5BD 5ISRA 3LWEA 1OO9B 3L7ZC 4J6HA 5C4JB 1TT2A 3C1EA 3TP8A 4KTAA 5C3XA 2K5DA 3I70A 5ELCA 4XIGS 5CMDA 3HOWB 4IZ8A 4H7BA 4WFN3 1SNCA 2O2LD 5JOBA 3QWNA 1BQQT 2G9HD 4WORA 3S15B 5EJWA 4FNFA 1D5ZC 2J7ZA 3RLFA 1U4RA 3MWYW 4I7ZC 1MI2A 1B44D 1EEFD 3MVVA 3K7AB 2E2IB 1WTVA 2NWGA 3Q23A 2X69A 3NBIA 5ELDA 2AQ3B 4P2CB 1ET6A 4PMCA 4OO1I 2EOTA 3P75A 2JEAI 1ESFA 5JJZA 2F0UA 3TZDA 1J8IA 1SJED 2EY5A 4CJ1B 2K5WA 3J7YW 3OOCA 1BO0A 4CKEA 4A3GB 1PTOF 3S14B 4RCOA 1U4PA 3R93A 4BBRB 4L6TB 2L1BA 3E0JA 4BA1I 1BCPD 4DNRB 2D5DA 3CU7A 1ONLA 3RUZA 3UI2A 1RTNA 3TSSA 2G9DA 2I46A 5BN4A 3Q6SA 1TS4A 3BG3A 1H9RA 4KKTA 4XDXA 5BN3A 5K36G 4R9WA 3U9OA 1WTRA 5LL6S 2NTTA 5M3FB 4FF1A 3PO2B 3GTGB 2ZXRA 1LT4D 2IPKD 4B9WA 1ET9A 1T5XD 3I73A 3IFDA 4F7XA 2LY7A 1DYQA 2EYMA 2KHSA 3NP8A 2BA0A 3T16A 5C0XH 4KHVA 3T13A 4DK0A 5C0XJ 3NXWA 4DU9A 1R9TB 1HA5A 2WACA 1PZKD 1H9MA 3C3LA 2FJ2A 4J1MA 4XTCS 1AFPA 2F0LA 1RD9D 4C56C 1PRTB 1I6HB 1V8QA 2F0KA 2R3ZA 3J81E 3J7AF 2EJGC 2L11A 2VUMB 3OWEB 3S1NB 3D4WA 2B2VA 5DM73 2BE5C 2R6GA 1Z6HA 1WTPA 5CC4A 1JWUD 1EWCA 4PMWA 4HSPA 2B2VC 4DXFA 4KHZA 1QCBD 1QNKA 3BDCA 4Z9CB 4F8MA 2E2DC 2A6HD 2B2UA 1VF5C 4R8IA 5KIXA 1M4VA 1Y8PB 2BCOA 4H0LC 2RBMA 3IFTA 1SNDA 1I4HA 5C4ZA 2XVSA 2B2UC 2F0DA 1JR0D 1JOKA 2MJ8A 4G7HC 1BNZA 2L9HA 1A3TA 3A7AB 2F3WA 1D6EC 1IW7C 2M9VA 3SE0A 3WOFA 4QCLA 5G3LD 1MGSA 4O1NA 3KUPA 4I65A 3A54A 4KY7A 1SAPA 3U9SA 1HCZA 3M4YA 5EQ0A 3J80L 1SNOA 2NN6G 3A56A 1SE2A 3NK9A 1KTKA 2A6ED 1NCVA 4NMZA 1LTBD 1B53A 1F77A 4WJWA 3SK4A 1PZJD 1SXTA 3H91A 2JYOA 5E4WC 4RGTA 3GTLB 1JORA 2F0GA 1LLRD 1CQFA 2PPBC 4C3JG 2RVLA 2ID0A 2F0NA 3Q24A 2KEEA 3GD7A 5DM63 4HR7B 1QOHA 1B9NA 3E5SA 3ITPA 1TQOA 2JA5B 4FXDA 4C3JB 3BDOA 3C46A 1D5MC 1JC7A 3HEJA 1A2UA 1LTGD 5I6WA 5EKLA 1UAPA 3S2DB 3C2PA 4OIKA 3S9WA 2WKCA 1PFMA 2VXWA 4RHRA 3K57A 1TVXA 4PNYA 4G7OC 2AUKA 3QJYA 1ENAA 1ILQA 1FNUA 2F0HA 2VB3X 1PTOB 3BS1A 3V05A 4ZYSA 5COYA 3HRZC 2WKDA 1ZYRD 3K59A 1AEXA 1BCPC 2WB1B 5CGKA 4KI0A 1RF2D 1ICWA 3M7NA 2C9OA 3HKZB 4FF4A 2VNUD 1O7LA 3IKJA 3PUZA 3HOZB 1HXYD 4U673 1Z7TA 3D3RA 4NP5A 2H4OA 4HN7A 1G8ZD 5T1GA 4AYBB 1G2SA 1Q90A 4ZKBB 2WIIB 5K36H 1Q12A 3QG1A 2XWJB 4EQPA 1SNQA 4XQQA 1G91A 3L9AX 4S3SA 3DM1A 3H0GB 1D1IA 1X32A 3D4RA 5ELFA 5ELEA 1DJRD 1K83B 2SEBD 2YYZA 1DZ1A 1A3VA 4U68A 1FNWA 5HGTA 1TWHB 3O13A 3OPOA 5C4XB 1TKWB 2J0TD 1WTXA 1IKMA 1A6XA 2F0TA 5EBDA 2MUYA 2MP1A 1CM9A 1ML0D 1LABA 3L3OC 2F0VA 2IWHA 3EA6A 3HG9A 2MPMA 5C6AA 4IN3A 1KAAA 4ZRZA 1F9SA 5JEAG 2PMZB 1EY0A 4CKCA 2E2HB 3W2DA 1FD7D 2QF7A 4KY5A 3GTOB 1EU3A 1O80A 3ZYYX 2A6HC 4L63B 5NUCA 3G6JB 2V4DA 5CV8A 3PIO3 2XSCA 2O5IC 2F03A 3K58A 4QMGA 3KK7A 3MHBA 2K33A 3FDTA 1B1ZA 3DWQA 1SDFA 3MXUA 1LT3D 2RDGA 4M1UB 2WAQB 1HFNA 4K2LA 3J80E 3ND9A 5KYIA 3S16B 2NN6H 1AP0A 1U9RA 1TU2B 1ESRA 2IW3A 2KEDA 1EU4A 4IUQA 4DXGA 3OMCA 1CTMA 4ZKCB 2A6EC 2E74C 3LX0A 1O7YA 1UEAB 2EYJA 1F2LA 1JCKB 2A74C 3SK5A 5IGGA 3TP6A 4FXKC 1L0YB 1HTLD 1VMCA 1D5XC 1AZPA 3BYYB 2B63B 5CV4A 3HOVB 3MC0B 1F9RA 1PFNA 1TS5A 5EPKA 2JXMB 1TS3A 2EYLA 3WDNA 4LMQD 4XT1B 2ZXPA 2WP8J 3R2TA 1HQMC 1BDOA 1WTOA 4QUCA 1J9OA 2PZWA 3FKIB 1NUCA 1WD1A 3P20A 1X3QA 4NW2A 4IFDI 2EYPA 2MGSA 4ZLTF 1PTOH 3CKIB 4PV1C 2D62A 4LJZC 3R2IA 1TIID 4R8NA 1B50A 2C5CA 5JAVA 1SE3A 3VA5A 3E6ZX 5C3EB 2K28A 2KJXA 2IJ0A 2EPBA 3M85A 2D2CC 3T51B 4M8AA 1MSGA 4DK1A 4IALA 4Q5VA 4IURA 3MXNA 2HDLA 3PV0A 4K8IA 4HMIA 4C3IG 5KNDA 5D3IB 3M3YB 1JWMD 1EZ6A 1OXXK 3GO5A 2NB0A 5D65A 4H44C 1LTRD 1ZYRC 2L12A 4KN4C 1WVLA 1B2TA 2F4IA 4ZAIA 1YNND 1XX8A 2XN9C 4C3IB 1V1PA 4CJ2C 1NR4A 4PMBA 4RWSC 3JAME 3FPUB 1EY7A 3BDLA 1LACA 5CBEE 1XWEA 5FOBB 1LV9A 2OT2A 1KLGD 4DNTB 1CI3M 1E2WA 1CQVA 2XRSD 3BVGA 2NVYB 2F1MA 1G2TA 2A69D 4ODGA 3QO2A 2OEOA 2TMPA 4CKBA 4B08A 1H9JA 2BA1A 5KNCA 2PYKA 3OIPA 5I2YA 1B9MA 2TSSA 2AQ2B 5D3DA 1CZGA 2B2YA 5A35A 1SBBB 3MTSA 2QKIC 5EKIA 2B2YC 3HS0C 2A73B 4C2MB 2I07B 2SNMA 3K0YA 4C1NK 2IX3A 2K05A 1SYDA 5KNBA 3V2TA 1CT1D 5D14A 2CVRA 5IOCA 2DN8A 1Q1BA 5M5XB 1TS2A 1RJTA 1EY4A 3OIQA 2KVMA 1IYVA 3MFGA 3SVMA 5DEHA 3EJIA 3S1QB 2Q8TA 1UNSA 3PIP3 1EZ8A 3N52A 1IYUA 5BN5A 1H9KA 4MHEA 1JE4A 5IGBA 3HGBA 3EROA 1I4QA 3QOLA 1OXUA 5CV9A 4LAAA 1WTWA 1Y69U 2IL8A 1JQYD 2AQ1B 2F3VA 2XWBB 3GTKB 4GZYC 3FEWX 2L0CA 1II3A 1T5EA 5C0XI 3DMUA 3EQLC 3OHXC 1GXDC 2PO4A 2M2LA 1DOMA 4QB4A 1D2BA 2NUCA 3PUYA 1XTCD 5C5LA 3GTQB 1F2MA 4ABNA 2QILA 1BCPF 4K5XA 5CYUA 3NTIA 2EYOA 2JP1A 1F9PA 1FGBD 4BY7B 2ZXOA 1DXMA 3TDQA 5M3MB 4X3TA 3N6RA 1F2ZA 4CBVA 1STHA 2JA6B 5IGFA 3W3AA 4C3HG 1EY9A 2PCFB 4TKOB 4IFDG 1MD2D 2NZ1D 4DAVA 1O78A 1NAPA 5KRUA 4KD3A 3GQBA 3FRPB 3R3OA 3D6WA 4K6DA 4XYOA 2F0OA 1STGA 4C3HB 5FO8B 1ZXTA 2FINB 3BVMA 4A3IB 3H6MA 1A15A 2B2TA 2EZVA 2YU9B 3OSOA 4KV6A 1RKNA 3SEBA 4G7ZC 3DWAA 5KEEA 3MAQA 2B2TC 4A3KB 1HUMA 3X3NA 1E2VA 4IQZA 1GHKA 1YNNC 4K14A 5ELBA 1EWHA 1LT5D 3ERQA 5F2DA 4OO1G 1EY6A 3D6CA 2DNCA 1HHVA 4B9XA 3PO3B 1D1KA 1V1OA 1TY0A 1C4QA 2EVBA 2EDGA 5EPLA 1HFGA 1PYWD 2DY7A 4BWGB 1DONA 4XT3B 4V0BA 2A69C 2D9UA 2KA7A 1PRTD 1GJXA 1QB5D 4OIJA 2EJFC 5G3LF 1C8CA 1KLUD 4XYQA 1HUNA 4KN7C 2EY1A 2F0PA 5IT9L 4QF4A 3JAML 1SYGA 2E2JB 2L5TA 2KOLA 4L8JA 2ICIA 3DUZA 1SE4A 1HTPA 3MEHA 5C44B 1CZWA 4RA8A 1EIGA 3A8IE 1Y8NB 1WCMB 2O4XA 3H94A 1SYCA 4XQNA 5A2QL 5M5YB 4RGNA 1RCVD 3K5MA 1E0BA 1MBYA 4CHTB 1TWCB 1I3QB 4N9PA 4QUFA 1H9SA 1CK1A 4FO2A 2N55A 3NQIA 5T1IA 3AMUA 2PZUA 3PUWA 2NBFA 5LL6X 2FHTA 1I4GA 4DFAA 3CHBD 3BVZA 3GTMB 1QWYA 2A68D 1U4MA 4DN4M 3KLSX 2JA7B 3A8KE 2F0IA 1EYAA 2CQAA 5E4XA 4A3BB 2ENBA 3CRLC 1HA6A 3QIAA 3MXPA 2GA4B 4HEDA 1BXTA 4EQOA 1EOTA 1I4RA 2XIWA 1AN8A 1IHZA 2J4XA 1CFMA 2RA4A 3D8GA 2R7ZB 1SYFA 1EFID 1KNAA 2K32A 2OF1A 5FKAC 5C0XG 3RD4A 2HDMA 2Q8IB 2AWOA 2BDNA 2K01A 1A3UA 3VR6A 2L4NA 3NHHA 2X6LA 3CRKC 1U4LA 1BCPB 4DAYA 1GUOA 5CV6A 5FO9B 1R4QB 4JBWA 2BOSA 1CHQD 5IGDA 1JWSD 2KCNA 1Y8OB 3OMGA 3BZDB 4RGOS 1VCIA 1PFBA 5I9OA 3TN2A 1JB3A 2K1BA 4OL7A 1I6VC 1XYIA 4CGYB 5KYLA 3FMCA 3MXGA 2EYFA 4ME5A 4IFDH 4FP5D 5EBCA 1PTOD 4FVMA 1STBA 4CJ0B 2NYZD 2PZTA 2X6GA 4RHSA 3MFYA 2HQEA 5CR3A 2F0QA 4K5VA 1BF4A 1RODA 1HRJA 4IUPA 2LKVA 1LTID 3WOEA 1LT6D 1ENFA 1Q3LA 4KMUC 3QOJA 3A55A 3NE5B 4KK7A 3H09A 1K8OA 1DM0B 3VYUA 1OXTA 4UDUC 4X3UA 3X3MA 3SK8A 2QDBA 2NN6I 4RKBA 2R61A 5AFWA 1BUVT 1OXVA 4A3FB 5CV7A 4A93B 3I90A 2EY6A 4G57A 3VR4A 3S1RB 1F2YA 4YIJA 5IODA 3V96A 1W6JA 2HCCA 5LHY1 2L55A 4OO1H 2CW0D 1TR5A 1SMYD 2OXPA 3P1HA 3KLRA 4OGQC 1SNMA 2B8GA 5FLXL 2PW7A 5IIFA 3TMEA 4IUVA 1GOZA 2IX1A 2DNEA 5DNFA 2M00A 5FK9C 4UAIA 5M9OA 3NUCA 2LMCB 2MHVA 3T53B 2VB2X 2QCPX 4QIWB 1BR9A 2NTSA 4XQJA 3I3CA 5IGEA 1AW7A 1PRTC 1C48A 3D31A 1PZID 2XRQD 5IT9E 4DF7A 1HPCA 2E75C 1Y1WB 4KKUA 1EEID 3R8BA 1PMRA 1TY2A 2IX0A 3IL8A 3ND8A 2RQXA 5KGUA 1S5FD 4FF3A 4KJNA 1GHJA 1B4OA 3NQTA 2RSOA 3TBIB 4EQNA 1CA6A 5TSSA 5A2QE 1JOQA 2JE6I 5IGCA 3RZDB 1S5DD 2B2WA 4A3EB 3EFXD 1I4XA 4ID6A 2RDHA 1Y1VB 1XXGA 4FF2A 3KBXA 1STNA 2B2WC 2NVTB 4MN3A 4HCSA 3BYTB 4ZQ3A 1ENCA 3OW7A 4RKLA 3GV3A 3VYRA 1STEA 4KY6A 2Q8RE 3ONAB 4DGZA 1FNVA 2A68C 3PUXA 2B39A 1WTQA 5CORA 4BS9A 4ULLA 1VDZA 5JEAH 2RDFA 1VMPA 4K5WA 1EYDA 3RZOB 5JEAJ 5JVH3 3VYTA 2EXZA 4Y7NB 3I91A 3MZ5A 1MSHA 1GUGA 5E3FA 3AB9A 3M7GA 3FPPA 3NTKA 4K2KA 2R93B 1SSOA 1NSNS 4IUTA 1M8AA 3LWUA 2F0FA 4MIUA 3HZXA 2PNRC 4KKSA 1ZKOA 1ZEQX 3D4DA 1RTOA 2JA8B 3I4NB 2Z8LA 3SXHA 2FMCA 2QEJC 4KJOA 1Q8IA 1Z47A 4C1NI 1V1PB 1KDAA 4X3SA 3K5LA 4IUUA 4K8JA 4PQXA 5I9PA 1EIHA 3HP3A 2R92B 2KQ3A 1EY8A 1QJOA 1GUNA 2JEBI 2PW5A 2DY8A 3H3VC 1PTOC 5JPNC 4HTHA 5C3WA 2RKSA 1VF7A 1GUSA 4A3DB 5CV5A 5CBAE 3I4MB 1EYCA 1S5CD 2K04A 2K03A 1EQVA 3RMHA 2KCCA 4V190 4K6LA 5I2XA 1YNJD 1UUPA 1FYCA 1LTSD 1R4PB 4DAPA 3EVQA 1Q1EA 3I4LA 1STAA 2B8FA 4H13C 5K5PA 3QB3A 3VYSA 3K5NA 5DAUA 1KABA 3VA7A 3S17B 4NKLA 1G291 2CW0C 5HURA 1DCZA 1GUWA 1SYBA 1SMYC 2HUGA 5FLXE 1SYEA 4A3JB 2AWNA 1LTTD 3DEPA 2N88A 1SJHD 2WINB 1A2TA 4WRDA 5JPMC 3C1FA 4ZUIA 1TWAB 2Z1CA 3Q22A 2KUMA 4G4KA 4LK1C 5EKKA 5FO7B 2FMMA 2LS01 5I6YA 4E6IA 4OHJA 5M5WB 3TP7A 4J8QA 1OXSC 2ICEC 3F2UA 4TRDA 1PXUA 5EGTA 3MA2B 4ILWA 1PLFA 1KDCA 3A8JE 3T4AC 3S1MB 1S4ZA 3AU7A 1BBXC 1QE6A 3IAYA 3J7AV 2Z4HA 3TP5A 5C4HA 2EY2A 1TWGB 2E76C 3GP7A 4HSVA 1W6KA 4F87A 4BBSB 5E1FA 1ILPA 3LNNA 4A3MB 1AZQA 4O42A 1SEBD 2EYHA 1SNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1B A;  2B2U C;  1LV9 A;  1PFM A;  5EPK A;  1JE4 A;  2VXW A;  1XYI A;  3I91 A;  2FFK B;  1TVX A;  1MSH A;  2MJ8 A;  2MP1 A;  1SSO A;  1CM9 A;  3I3C A;  1BNZ A;  1A15 A;  1E0B A;  2B2T A;  2L9H A;  4IUT A;  4LMQ D;  1WTW A;  1ILQ A;  3I8Z A;  4ZK9 B;  1ML0 D;  4XT1 B;  4XDX A;  2IL8 A;  1G2T A;  1M8A A;  4QUF A;  3QO2 A;  1JIC A;  1MGS A;  4R9W A;  3KUP A;  2RSN A;  2N55 A;  5T1I A;  1WTO A;  4QUC A;  2B2T C;  5COY A;  1WTR A;  1J9O A;  2MPM A;  1SAP A;  4RAU C;  4CJ0 B;  5EQ0 A;  1GUW A;  3G7L A;  1F9S A;  4X3K A;  1WD0 A;  1HUM A;  2NYZ D;  1EQT A;  2HUG A;  3P7J A;  5EJW A;  2X6G A;  1WD1 A;  3IL8 A;  1RTO A;  1G6Z A;  1X3Q A;  2M2L A;  4NW2 A;  2FHT A;  1DOM A;  1BF4 A;  2MGS A;  2HCI A;  2J7Z A;  4ZLT F;  1U4R A;  1ROD A;  1B4O A;  1NCV A;  1HRJ A;  4IUP A;  2RSO A;  2N88 A;  1O80 A;  2B2Y A;  3DEP A;  3IFD A;  1B50 A;  3MWY W;  1IL8 A;  1B53 A;  1DOK A;  1Q3L A;  3GV6 A;  3TN2 A;  1ICW A;  1MI2 A;  1CA6 A;  1HHV A;  1F9Q A;  1U4M A;  4DN4 M;  3MTS A;  2KUM A;  5EKI A;  1IKL A;  2K28 A;  1O7Z A;  3R93 A;  2B2Y C;  2NWG A;  1WTV A;  5E4X A;  2EPB A;  2X69 A;  4X3S A;  4X3U A;  2SDF A;  5T1G A;  1HA6 A;  1G2S A;  4IUU A;  1KNE A;  3FDT A;  5EPL A;  1DOL A;  4HED A;  2FMM A;  2JP1 A;  1F9P A;  3H91 A;  4ZKB B;  1HFG A;  2DY7 A;  1B3A A;  2FJ2 A;  2JYO A;  2B2W A;  1DON A;  1EL0 A;  1MSG A;  2K05 A;  5AFW A;  1SDF A;  1X3P A;  1QG7 A;  4XT3 B;  5E4W C;  3DEO A;  1EIH A;  3HP3 A;  1EOT A;  4X3T A;  2XIW A;  2EOT A;  2D9U A;  3I90 A;  2RVL A;  2DY8 A;  2R3Z A;  2HDL A;  4IUR A;  3F2U A;  1HFN A;  2L11 A;  3KBX A;  5D14 A;  2B2W C;  5JJZ A;  2CVR A;  1AP0 A;  2RA4 A;  1PDQ A;  3TZD A;  1NR2 A;  4OIJ A;  1PLF A;  1J8I A;  1ESR A;  1KNA A;  2KEE A;  4CJ1 B;  1G91 A;  1IKM A;  4MN3 A;  3DM1 A;  2B2V A;  2KED A;  4HCS A;  1C8C A;  1BO0 A;  4IUQ A;  5D65 A;  2HCC A;  1RJT A;  2HDM A;  2KEC A;  1WTP A;  3GV3 A;  5EPJ A;  1HUN A;  1X32 A;  5CBA E;  2L12 A;  2BDN A;  1S4Z A;  2K01 A;  4ZKC B;  1WVL A;  1B2T A;  2L4N A;  1U4P A;  2K04 A;  2Q8R E;  3ONA B;  2NZ1 D;  2H1E A;  2X6L A;  1QE6 A;  1O7Y A;  4ZAI A;  2K03 A;  1U4L A;  2B2V C;  2KVM A;  1CA5 A;  1BBX C;  1NAP A;  1DZ1 A;  2L1B A;  3LWE A;  1XX8 A;  3SVM A;  1F2L A;  1WTQ A;  1QNK A;  2KOL A;  2EE1 A;  5COR A;  4CJ2 C;  2Q8T A;  1NR4 A;  4IUV A;  4RWS C;  1VMP A;  4U68 A;  4HSV A;  3UI2 A;  2B2U A;  3FPU B;  3D6W A;  4R8I A;  1RTN A;  1VMC A;  1AZP A;  4HAE A;  4RA8 A;  5DNF A;  1EIG A;  5CBE E;  1ILP A;  4OIK A;  3N52 A;  1PFB A;  1ZXT A;  3Q6S A;  5CMD A;  1AZQ A;  4O42 A;  1F9R A;  4UAI A;  1WTX A;  4MHE A;  2FIN B;  1PFN A;  1RHP A; 
#chains in the Genus database with same CATH topology
 2LFN A;  2ZT9 C;  1BKB A;  1I4P A;  1K8M A;  2Q2U A;  5IT9 c;  3RZO H;  2F0M A;  4ZK9 B;  3KF8 A;  3JAM c;  2NVQ B;  1VQB A;  5M5X H;  2WV6 D;  5JVG 3;  4DR7 Q;  1PYS B;  2Y0S G;  3TRZ A;  3DXJ C;  3URY A;  4EVO A;  2JSO A;  5J22 A;  2RSN A;  3H0G G;  2A8V A;  1EQT A;  3P7J A;  1MHW C;  4RFB A;  3PMF A;  1G6Z A;  2H5X A;  4BXX G;  2HCI A;  5GAD C;  4FXG C;  3HOY G;  2K5Q A;  4LF9 L;  4P75 A;  3I56 A;  3S2H B;  3K5O A;  5J1Z A;  3GV6 A;  3NWT A;  2Y0S B;  1F9Q A;  2PQE A;  4N8X 1;  2F0W A;  1V43 A;  3HOU G;  1X3E A;  2JA8 H;  4JI2 Q;  1O7Z A;  3SHL A;  2K5V A;  3I4N H;  3NWS A;  4NDX A;  2SDF A;  2K7V A;  5C4X G;  4DUY Q;  1KNE A;  2ATW A;  2AUJ D;  3NTH A;  1EL0 A;  3HOY B;  1BOS A;  1QG7 A;  3FVQ A;  4F88 A;  1RIP A;  3RNU A;  3NPP A;  1QNU A;  5GQO A;  1S5E D;  2RHQ B;  1I50 B;  4DV5 Q;  1Q86 C;  1A62 A;  1MJE A;  3KJP A;  3HOU B;  1NMF A;  3SDZ A;  2JA9 A;  2YV5 A;  3VR2 A;  1KD1 C;  2NVX B;  3ULJ A;  2KCM A;  1KDB A;  3L2P A;  3NEN A;  2EJM A;  2DGY A;  1O7I A;  2F0J A;  3HOX G;  3SK6 A;  3TZU A;  2R92 H;  3DHQ A;  4IPD A;  5EPJ A;  1N8R C;  1CHP D;  3SR1 A;  1AH9 A;  2CCZ A;  2H1E A;  4HMJ A;  1CA5 A;  4JVZ A;  1HQR D;  1K8G A;  1SMX A;  5JJI A;  2BH8 A;  1SFO B;  2EE1 A;  4KD4 A;  4QIW E;  4JI2 L;  4RGM A;  4POF A;  1LTA D;  2OCE A;  4RH6 A;  4RCN A;  3VR5 A;  3UDF A;  5J39 A;  3I4M H;  2JJQ A;  1NY4 A;  3T56 B;  1L0X B;  3HOX B;  4JK1 C;  4IUN A;  4HAE A;  4BY7 H;  2F0E A;  4DA2 A;  5C5M A;  4BA2 I;  2O5J C;  1B3A A;  1RHP A;  4ZUJ A;  4Y52 H;  2FFK B;  4DV5 L;  1QZH A;  3M4O B;  1K73 C;  3K6O A;  1DD2 A;  3I8Z A;  4XXE A;  3OW2 A;  4DR3 Q;  4GN3 B;  1CKO A;  3OWF A;  2Z4I A;  1JIC A;  3CW2 C;  2AKW B;  2SNS A;  1PRT F;  4UHV A;  4RAU C;  2GVB A;  2F0S A;  1EFW A;  3KLS A;  3G7L A;  4X3K A;  1WD0 A;  3J81 L;  2DJF C;  1VQC A;  4GN5 A;  4DUZ Q;  1JOO A;  2BE5 D;  4N9T A;  1D8L A;  1SLJ A;  1EY5 A;  4YHH Q;  2A5H A;  3AFQ A;  2RHS B;  3DM3 A;  1RDP D;  1PH2 A;  3UE1 A;  1VQ4 A;  1IL8 A;  1DOK A;  1YNJ C;  3CQZ B;  4QY7 A;  3I72 A;  1TWF B;  1FR3 A;  4C3H H;  2IT1 A;  5I4D A;  2SOB A;  4EGV A;  3GTJ B;  4JI4 L;  1IKL A;  3KF8 B;  4A3J H;  1GUT A;  2EYH A;  2E8G A;  4JI8 Q;  4MNO A;  4UP7 A;  4IFD J;  2KHJ A;  3PQI A;  2VQF L;  4A3I H;  3CC7 A;  4DR4 L;  1DOL A;  4BY1 G;  4GNX B;  2YU9 H;  3DWP A;  4HIM A;  1X3P A;  3A7L A;  3DEO A;  4DR3 L;  2BH2 A;  3VR3 A;  1LO5 D;  4TQU S;  2K6A A;  3KBG A;  1M1K C;  3PUV A;  4A3K H;  5HGQ A;  3A5U A;  3F2B A;  2CHB D;  1PDQ A;  1NR2 A;  2D0O A;  4FYD A;  4TSS A;  1QIL A;  1IW7 D;  1E2Z A;  4Q0F A;  3NBH A;  4JV5 Q;  2B29 A;  1FL0 A;  1STY A;  4OXP A;  3Q0A A;  4HCE A;  3AFP A;  1E7Z A;  3GTP B;  2KEC A;  2QGQ A;  1A8V A;  2XNA C;  4L5T A;  1H9S B;  4BY1 B;  4YHH L;  3HOW G;  1VQD A;  3NSW A;  2BDO A;  1NMG A;  5IYB G;  1S5B D;  3UE0 A;  5ISR A;  4B3S L;  3PO3 H;  1K28 A;  3LWE A;  1OO9 B;  3L7Z C;  1VQ6 A;  5LMU Q;  4J6H A;  5C4J B;  1TT2 A;  3W1B A;  3I2Z A;  3C1E A;  4JI8 L;  2CH4 W;  1LUZ A;  4IOA A;  1YZ6 A;  4KTA A;  3TP8 A;  5C3X A;  1N34 Q;  2K5D A;  3I70 A;  5ELC A;  4XIG S;  5CMD A;  3HOW B;  4IZ8 A;  4DNI A;  3WWV A;  3IRB A;  3K8A A;  4H7B A;  4WFN 3;  1SNC A;  2O2L D;  3CMA A;  4IJH A;  4A3M H;  4DK3 C;  1YJ9 A;  5JOB A;  5FLX c;  3QWN A;  1BQQ T;  2G9H D;  1IBM L;  4WOR A;  3S15 B;  5EJW A;  4FNF A;  2E2J H;  5FLM H;  1D5Z C;  2J7Z A;  3RLF A;  1U4R A;  3MWY W;  5IYD G;  2N8N A;  5C44 H;  4I7Z C;  1MI2 A;  1B44 D;  2N78 A;  4OX9 L;  4DAY B;  1EEF D;  1WCM H;  3MVV A;  3K7A B;  2E2I B;  1WTV A;  4IPG A;  2NWG A;  2QDL A;  5M5Y H;  3Q23 A;  2X69 A;  4DV4 Q;  3NBI A;  5ELD A;  3CC2 A;  4A3G G;  2AQ3 B;  3W1G A;  4RMF A;  3RLN A;  1TWC H;  1KL9 A;  2C35 B;  4P2C B;  1ET6 A;  4DR2 L;  4BBR G;  4PMC A;  4OO1 I;  2Z0S A;  2EOT A;  4DV6 Q;  1E1T A;  3P75 A;  2JEA I;  1ESF A;  5JJZ A;  1I94 Q;  2F0U A;  3TZD A;  1D7Q A;  1J8I A;  1SJE D;  2EY5 A;  3J80 i;  2K5W A;  4CJ1 B;  1X3G A;  3J7Y W;  3I55 A;  3OOC A;  2PI2 E;  1XTD A;  1BO0 A;  3PF4 A;  3J7Z C;  4CKE A;  4DK6 C;  4A3G B;  1PTO F;  3S14 B;  4RCO A;  1Q82 C;  1U4P A;  4DR1 L;  3R93 A;  3GTM H;  4LF7 Q;  4BBR B;  2JA7 H;  2NVX H;  4L6T B;  2L1B A;  3E0J A;  4BA1 I;  1BCP D;  4DNR B;  4A3B H;  2D5D A;  3CU7 A;  1ONL A;  3RUZ A;  5FJ8 H;  3UI2 A;  1RTN A;  3TSS A;  2G9D A;  4DV4 L;  2I46 A;  3KJO A;  5BN4 A;  5M3F G;  1VQO A;  3Q6S A;  3GDE A;  3PO2 G;  4JI3 Q;  4FDB A;  4X65 L;  1TS4 A;  1XNQ Q;  2QEX A;  3A0J A;  1VQN A;  4PZ8 A;  4DV6 L;  1HR0 Q;  3BG3 A;  4DV2 Q;  1H9R A;  4KKT A;  4XDX A;  1VQA A;  2IHF A;  3A5Z B;  5BN3 A;  5K36 G;  4R9W A;  3U9O A;  4X64 Q;  1ASY A;  1WTR A;  5LL6 S;  2UUB L;  2NTT A;  2QW7 A;  5M3F B;  4FF1 A;  4KHP Q;  3PO2 B;  3TS0 A;  4R4T A;  3GTG B;  2ZXR A;  1LT4 D;  1K0R A;  2IPK D;  4B9W A;  3BU2 A;  4YCW A;  1AE3 A;  1ET9 A;  2MO1 A;  1T5X D;  3I73 A;  3IFD A;  1EWI A;  2LY7 A;  4F7X A;  1DYQ A;  2EYM A;  2KHS A;  3NP8 A;  2BA0 A;  3T16 A;  5C0X H;  4KHV A;  3RLO A;  1X9N A;  3T13 A;  4DK0 A;  5C0X J;  3NXW A;  4DU9 A;  4JI3 L;  3LGJ A;  1R9T B;  1HA5 A;  3CP0 A;  2WAC A;  1PZK D;  1H9M A;  4DV2 L;  3M4Q A;  4IPH A;  3C3L A;  4LNQ A;  1B8A A;  2FJ2 A;  1PH5 A;  4J1M A;  4GKJ Q;  4XTC S;  1AFP A;  1B70 B;  1J6Q A;  1M90 C;  2F0L A;  1RD9 D;  4C56 C;  1PRT B;  1I6H B;  1V8Q A;  1VQJ A;  2F0K A;  2R3Z A;  3HKS A;  1KAW A;  3J81 E;  2EJG C;  2L11 A;  3J7A F;  2VUM B;  3OWE B;  3S1N B;  3AYH B;  3E9H A;  4JBK A;  3D4W A;  4R1J A;  2B2V A;  5DM7 3;  2BE5 C;  2R6G A;  4JI7 Q;  1Z6H A;  1WTP A;  5CC4 A;  1JWU D;  1EWC A;  4PMW A;  4MZ9 A;  4HSP A;  2B2V C;  4DXF A;  4LFB L;  4KHZ A;  2JK8 A;  1CKN A;  1QCB D;  1QNK A;  4PZ6 A;  3NEL A;  2VY3 A;  3BDC A;  3GTP H;  2PQA A;  4Z9C B;  4F8M A;  5AJ3 L;  2E2D C;  4HJ5 A;  2A6H D;  2B2U A;  1VF5 C;  4R8I A;  2Z6K A;  5KIX A;  1M4V A;  1Y8P B;  2BCO A;  4H0L C;  2RBM A;  4JI1 Q;  3IFT A;  1AE2 A;  2F4V Q;  3JAM i;  1SND A;  1I4H A;  1IBL Q;  5C4Z A;  2XVS A;  4A3F H;  4HIO A;  2HHH L;  2B2U C;  2F0D A;  2Z6K C;  4A93 H;  1JR0 D;  1JOK A;  3S1R H;  4HID A;  2MJ8 A;  4G7H C;  1BNZ A;  2L9H A;  1A3T A;  4NPS A;  3TRE A;  3A7A B;  3CCV A;  2F3W A;  1D6E C;  1IW7 C;  2M9V A;  3SE0 A;  4P73 A;  3WOF A;  1XMQ Q;  4QCL A;  5G3L D;  4LW1 A;  1MGS A;  4O1N A;  3TEH B;  3KUP A;  1P16 A;  3A54 A;  4I65 A;  3SGI A;  4KY7 A;  4POG A;  5IYB H;  3UDX A;  1SAP A;  3U9S A;  1HCZ A;  2Y0S E;  4JG2 A;  3M4Y A;  1UE6 A;  5EQ0 A;  3J80 L;  1SNO A;  2NN6 G;  3A56 A;  1S40 A;  1SE2 A;  2Q2H A;  3NK9 A;  1KTK A;  2A6E D;  1NCV A;  4NMZ A;  1LTB D;  1B53 A;  2ZTC A;  4HJ9 A;  4DV3 Q;  1F77 A;  4WJW A;  3M9B A;  1PV4 A;  1N33 Q;  1VQF A;  3SK4 A;  3RN5 A;  3PGZ A;  4R4C A;  1PZJ D;  1SXT A;  3H91 A;  2JYO A;  2N3S A;  4X66 Q;  5E4W C;  4RGT A;  3GTL B;  1JOR A;  2F0G A;  1LLR D;  1CQF A;  4OEM B;  2JA5 G;  3K7A H;  2PPB C;  4C3J G;  2E2I H;  1JJG A;  4DV7 Q;  1ICF B;  2RVL A;  2ID0 A;  1CSP A;  2F0N A;  4PZ7 A;  1Y1W H;  3Q24 A;  1N32 L;  2KEE A;  3GD7 A;  5DM6 3;  4HR7 B;  1QOH A;  1T9H A;  1B9N A;  3E5S A;  3ULL A;  4ZCK A;  3ITP A;  1V1Q A;  1KQS A;  1TQO A;  2JA5 B;  4FXD A;  4C3J B;  3BDO A;  3PF5 A;  3C46 A;  1D5M C;  3ERS X;  1JC7 A;  3T1H L;  3HEJ A;  4A3G H;  1XJV A;  4LWC A;  3RZD H;  1A2U A;  1LTG D;  5I6W A;  2ASB A;  5EKL A;  1UAP A;  4A3E H;  3PIP A;  3S2D B;  3C2P A;  4OIK A;  4X66 L;  3S9W A;  2WKC A;  5ELN A;  1EIY B;  1PFM A;  1QUQ A;  2VXW A;  4RHR A;  3K57 A;  1TVX A;  4PNY A;  4G7O C;  2AUK A;  2WB1 G;  3QJY A;  2D0P A;  1KRT A;  1ENA A;  1NBW A;  1ILQ A;  1FNU A;  2NVT H;  2F0H A;  2VB3 X;  4LF9 Q;  3HKZ G;  1PTO B;  2CH4 A;  3BS1 A;  3HOZ G;  1CKN B;  1WJJ A;  3V05 A;  4ZYS A;  5COY A;  2PQA B;  4WJ3 M;  3HRZ C;  1VQE A;  3VDY A;  2WKD A;  1ZYR D;  3K59 A;  1AEX A;  1IZ6 A;  2OWO A;  1BCP C;  2WB1 B;  5CGK A;  3DLL A;  2A19 A;  4KI0 A;  1GD7 A;  1VQH A;  1RF2 D;  1ICW A;  3M7N A;  2C9O A;  3HKZ B;  3I4O A;  4FF4 A;  2VNU D;  1O7L A;  2F52 A;  3IKJ A;  3PUZ A;  3PO2 H;  2VS1 A;  3HOZ B;  1HXY D;  4U67 3;  1Z7T A;  2K5N A;  3D3R A;  4NP5 A;  2A1A A;  1PH3 A;  2H4O A;  4HN7 A;  1WOC A;  4Y7N H;  2ALY B;  5IE8 A;  1SRU A;  1L1O A;  1G8Z D;  5T1G A;  4AYB B;  1G2S A;  2UXD L;  1Q90 A;  2R93 H;  1XMO L;  4ZKB B;  2WII B;  3G71 A;  1UEB A;  5K36 H;  1Q12 A;  1L1O C;  3QG1 A;  2XWJ B;  4EQP A;  3RR5 A;  1IL2 A;  1SNQ A;  4XQQ A;  1G91 A;  4IPC A;  3L9A X;  4S3S A;  3DM1 A;  3H0G B;  4GN4 B;  1FJG L;  4YWM A;  1YIT A;  1D1I A;  1X32 A;  1PVO A;  2RCF A;  3D4R A;  5ELF A;  2VUM H;  2HIX A;  5ELE A;  1DJR D;  1K83 B;  2SEB D;  2YYZ A;  1DZ1 A;  3STB D;  4LF8 L;  3E9I A;  3PSI A;  1A3V A;  4U68 A;  1FNW A;  5HGT A;  1TWH B;  3O13 A;  3OPO A;  5C4X B;  1TKW B;  2J0T D;  1GVP A;  1WTX A;  3F8T A;  1IKM A;  1A6X A;  2F0T A;  4P72 A;  5IP9 G;  4JYA L;  5EBD A;  2MUY A;  1PYB A;  1MIU A;  2MP1 A;  4IO9 A;  1CM9 A;  3CXC A;  5GAG C;  1ML0 D;  1LAB A;  3L3O C;  3EIV A;  4A3D H;  3G48 A;  1K9M C;  2F0V A;  2IWH A;  3EA6 A;  3HG9 A;  2MPM A;  2N49 A;  5C6A A;  4IN3 A;  1KAA A;  4ZRZ A;  4UP9 A;  1F9S A;  1W2B A;  5JEA G;  4JI4 Q;  2PMZ B;  1EY0 A;  4CKC A;  2E2H B;  2VZA A;  1PH7 A;  3W2D A;  2ZJP A;  1FD7 D;  2VQF Q;  2CKZ B;  2QF7 A;  4KY5 A;  4DR4 Q;  3GTO B;  5IP7 G;  1EU3 A;  1HJP A;  1O80 A;  3ZYY X;  1QUQ B;  2A6H C;  2WAQ G;  4L63 B;  5NUC A;  3G6J B;  2V4D A;  5CV8 A;  1GM5 A;  3PIO 3;  2XSC A;  2O5I C;  2F03 A;  3K58 A;  4QMG A;  3KK7 A;  3MHB A;  5DLQ E;  2K33 A;  3FDT A;  1B1Z A;  3DWQ A;  1SDF A;  3F2C A;  3J81 c;  3MXU A;  1LT3 D;  4A3L G;  2MFI A;  2RDG A;  4M1U B;  3S17 H;  2WAQ B;  1HFN A;  4K2L A;  3G6E A;  1X55 A;  3J80 E;  3ND9 A;  5KYI A;  4B3S Q;  3S16 B;  2NN6 H;  4LF4 L;  1AP0 A;  1U9R A;  3AQQ A;  4YCV A;  1TU2 B;  1C7Y A;  1ESR A;  5IYC G;  2IW3 A;  2B3G A;  2KED A;  4YY3 L;  2UUA L;  2B63 G;  3HOV G;  1EU4 A;  4IUQ A;  3U4Z A;  4DXG A;  1QVF A;  3OMC A;  4K0K L;  1CTM A;  4X6A H;  1K0S A;  4ZKC B;  1VQ5 A;  2A6E C;  2E74 C;  3PIO A;  3LX0 A;  1O7Y A;  1L1O B;  1UEA B;  1TWA H;  1G51 A;  2EYJ A;  1F2L A;  1JCK B;  2A74 C;  3SK5 A;  5IGG A;  3TP6 A;  4FXK C;  1L0Y B;  1HTL D;  1VMC A;  1D5X C;  1AZP A;  3BYY B;  2B63 B;  5CV4 A;  3HOV B;  1J5E L;  3MC0 B;  2F3I A;  3FKI G;  2K5H A;  2JA5 H;  1GO3 E;  2K50 A;  1F9R A;  1PFN A;  1TS5 A;  4YWL A;  4CDF C;  5M5W H;  5EPK A;  4OEL B;  1IBM Q;  2JXM B;  1VQM A;  1TS3 A;  2EYL A;  3TQY A;  2I0Q A;  3WDN A;  4LMQ D;  2YTV A;  4XT1 B;  4DV1 L;  2DJG C;  3S1M H;  3S2D H;  2LXJ A;  2ZXP A;  1EOV A;  2WP8 J;  3R2T A;  1HQM C;  1BDO A;  1WTO A;  4QUC A;  5C3E G;  1J9O A;  5GRO A;  2PNH A;  4OX9 Q;  2PZW A;  3FKI B;  4L5S A;  1NUC A;  2MNA A;  1WD1 A;  3P20 A;  1X3Q A;  4NW2 A;  2KHI A;  2EYP A;  4IFD I;  2MGS A;  1UWV A;  1YEZ A;  3H3V H;  1PTO H;  4ZLT F;  3CKI B;  4PV1 C;  4JI6 L;  1WTH A;  2D62 A;  4LJZ C;  1TWG H;  2FXQ A;  3R2I A;  5IWA L;  1TII D;  4R8N A;  1B50 A;  2C5C A;  4A3C G;  1SR3 A;  4DR2 Q;  5JAV A;  3CCQ A;  4BBS H;  1S3O A;  1SE3 A;  3VA5 A;  3E6Z X;  5C3E B;  2K28 A;  2KJX A;  3T1Y Q;  2IJ0 A;  2EPB A;  3CC4 A;  1QVG A;  3M85 A;  2D2C C;  4QL5 A;  3T51 B;  1EQQ A;  2Q2T A;  4M8A A;  1MSG A;  4DK1 A;  2NVQ H;  1YHQ A;  3HOZ H;  4IAL A;  4DR1 Q;  4Q5V A;  4IUR A;  3MXN A;  2HDL A;  3PV0 A;  4K8I A;  4HMI A;  4C3I G;  4CDD C;  5KND A;  2Z6B A;  5D3I B;  3M3Y B;  1JWM D;  1EZ6 A;  1OXX K;  3GO5 A;  4WJ4 A;  2NB0 A;  1HH2 P;  5D65 A;  2OTL A;  4H44 C;  1LTR D;  1ZYR C;  4GOP A;  2UXC L;  2L12 A;  4KN4 C;  3S2H H;  1WVL A;  1B2T A;  2F4I A;  2IHE A;  4ZAI A;  1N36 L;  2LSS A;  4AQY L;  4X65 Q;  3ER0 A;  1YNN D;  4DR5 L;  1XX8 A;  4GOP C;  2XN9 C;  3H0G H;  4C3I B;  1MKH A;  1V1P A;  4CJ2 C;  3T1Y L;  1NR4 A;  4PMB A;  4RWS C;  3JAM E;  3FPU B;  4BXX H;  1EY7 A;  3BDL A;  1LAC A;  5CBE E;  3HOY H;  2CWA A;  1XWE A;  5FOB B;  2UUB Q;  1LV9 A;  1I50 H;  2OT2 A;  1KLG D;  4DNT B;  1CI3 M;  1E2W A;  3HOU H;  1CQV A;  2XRS D;  3BVG A;  4OON A;  1FGU A;  2NVY B;  2F1M A;  2JN4 A;  1TWH H;  1G2T A;  2A69 D;  3A74 A;  5C4X H;  4ODG A;  4B3R L;  3QO2 A;  4JI5 L;  2OEO A;  2TMP A;  4CKB A;  3CCL A;  4B08 A;  1H9J A;  1PHJ A;  1PH8 A;  5GAH C;  1NTG A;  1E1O A;  2BA1 A;  5KNC A;  1HR0 W;  4DKA C;  3NBH B;  1YHA A;  4GKK Q;  2PYK A;  3STB C;  4IOC A;  1SFO H;  3OIP A;  5I2Y A;  1B9M A;  2TSS A;  2AQ2 B;  5D3D A;  1CZG A;  2B2Y A;  3HOX H;  5A35 A;  1HNW L;  5IY0 A;  1SBB B;  4LUO A;  2G5D A;  3MTS A;  2QKI C;  1FVI A;  5EKI A;  2B2Y C;  3HS0 C;  3CPW A;  2A73 B;  4C2M B;  2I07 B;  2OQK A;  2SNM A;  2VQE L;  3M4O H;  3K0Y A;  4C1N K;  2IX3 A;  4NXM L;  2K05 A;  4JOI A;  3K0X A;  4OWW B;  1BBU A;  4JBJ A;  1SYD A;  5KNB A;  4LFC L;  3V2T A;  2R7F A;  1GKH A;  4LFB Q;  3RN2 A;  1CT1 D;  5D14 A;  2CVR A;  1KIX A;  4JOI C;  1Q8K A;  5IOC A;  2DN8 A;  2Z9H A;  1Q1B A;  5M5X B;  5AJ3 Q;  3Q8D A;  1TS2 A;  1RJT A;  1EY4 A;  4GKK L;  1N9W A;  2JA8 G;  5LMN W;  3OIQ A;  3CQZ H;  3I4N G;  1CKM A;  4QQB X;  3S16 H;  1TWF H;  2KVM A;  1X56 A;  4X62 L;  1IYV A;  2HHH Q;  3MFG A;  4JPB W;  4B3T L;  3GTJ H;  3SVM A;  4UY8 C;  5DEH A;  3EJI A;  3M4P A;  3S1Q B;  2Q8T A;  1UNS A;  5HY6 A;  1A0I A;  3PIP 3;  1EZ8 A;  3CAM A;  3MXN B;  3N52 A;  1IYU A;  5BN5 A;  3L0O A;  1H9K A;  4MHE A;  1BVS A;  1E22 A;  1JE4 A;  5IGB A;  3HGB A;  3ERO A;  1I4Q A;  3QOL A;  1OXU A;  5CV9 A;  4LAA A;  1WTW A;  1HNX Q;  1Y69 U;  3K7U C;  2IL8 A;  1JQY D;  2AQ1 B;  2F3V A;  2WB1 E;  2XWB B;  4UP8 A;  3GTK B;  1SE8 A;  4GZY C;  3FEW X;  2L0C A;  4BY1 H;  1EQR A;  1II3 A;  1E24 A;  3HKZ E;  1T5E A;  5C0X I;  1IYJ B;  3DMU A;  3OHX C;  1I5F A;  3EQL C;  2E5L L;  3I4M G;  1GXD C;  2PO4 A;  2M2L A;  1DOM A;  4JBM A;  1K3R A;  3K80 C;  5C4J H;  4BY7 G;  4QB4 A;  3HFZ B;  1D2B A;  5M3M G;  2NUC A;  4AYB E;  3PUY A;  1JB7 A;  1XTC D;  5C5L A;  2QA4 A;  3FKI H;  3GTQ B;  1F2M A;  4ABN A;  2QIL A;  1BCP F;  3HOW H;  1QZG A;  4K5X A;  2JA6 G;  5CYU A;  4R4O A;  2GVA A;  3NTI A;  1N32 Q;  2EYO A;  2JP1 A;  3KFU A;  1F9P A;  1FGB D;  4BY7 B;  2ZXO A;  1IBK L;  1DXM A;  1BBW A;  3TDQ A;  1HNX L;  5M3M B;  3J80 c;  4X3T A;  3N6R A;  2ZJQ A;  3D0F A;  1F2Z A;  4J15 A;  4CBV A;  1STH A;  1U5K A;  3S15 H;  2JA6 B;  3PCO B;  3E3X A;  5IGF A;  3ZJY C;  3W3A A;  3T1H Q;  2AMC B;  4C3H G;  2LXK A;  1EY9 A;  2XGT A;  2PCF B;  4TKO B;  4IFD G;  2OTJ A;  4A3J G;  3S24 A;  1MD2 D;  2NZ1 D;  3CCJ A;  3QR8 A;  4DAV A;  1O78 A;  2ZJR A;  1XPO A;  1NAP A;  4A3I G;  5KRU A;  4KD3 A;  1UE1 A;  1X6O A;  3GQB A;  3H15 A;  3FRP B;  3I7F A;  3R3O A;  4YCU A;  3D6W A;  1Q7Y C;  4K6D A;  4XYO A;  2F0O A;  4DAM A;  4A3K G;  1STG A;  4C3H B;  5FO8 B;  1S72 A;  1X54 A;  2UUC Q;  1ZXT A;  4JI0 L;  2FIN B;  5IYD H;  3BVM A;  2WFW A;  4A3I B;  3H6M A;  1A15 A;  2B2T A;  2PMZ E;  3NEM A;  2EZV A;  2YU9 B;  3OSO A;  4KV6 A;  4YWK A;  4PG3 A;  1RKN A;  3SEB A;  4G7Z C;  3DWA A;  3CF5 A;  2HT1 A;  3PO3 G;  3OYY A;  3S14 H;  5KEE A;  2AHO B;  3MAQ A;  2B2T C;  5EAY A;  4A3K B;  1HNZ L;  1HUM A;  3X3N A;  1E2V A;  4BBR H;  4IQZ A;  1X65 A;  1GHK A;  2IY5 B;  1YNN C;  2YTX A;  4K14 A;  5ELB A;  1EWH A;  1LT5 D;  1XPR A;  3CD6 A;  2UXD Q;  3ERQ A;  5F2D A;  3CCR A;  1XMO Q;  4DV0 Q;  4OO1 G;  1EY6 A;  3D6C A;  2DNC A;  1HHV A;  4B9X A;  3PO3 B;  4LF6 L;  1D1K A;  1V1O A;  1TY0 A;  1C4Q A;  2UUC L;  2WAQ E;  2EVB A;  2EDG A;  1C0A A;  2KBN A;  5EPL A;  2UXB L;  3KLW A;  1FJG Q;  1H95 A;  1HFG A;  1PYW D;  2DY7 A;  4BWG B;  1DON A;  4XT3 B;  4V0B A;  1Y14 B;  4UPA A;  2A69 C;  1UE5 A;  2D9U A;  5FLM G;  5M3F H;  5L37 A;  2KA7 A;  4LF8 Q;  1PRT D;  1GJX A;  1QB5 D;  4OIJ A;  2EJF C;  3GTG H;  5G3L F;  1JMC A;  5C44 G;  1VQK A;  1C8C A;  1KLU D;  1ASZ A;  4XYQ A;  1HUN A;  4KN7 C;  1WCM G;  2F0P A;  2EY1 A;  5IT9 L;  4QF4 A;  4DV0 L;  3JAM L;  4OWX B;  4NXN Q;  1SYG A;  2E2J B;  2L5T A;  2KOL A;  4R4Q A;  4JYA Q;  4L8J A;  3UDI A;  1R9T H;  2ICI A;  4GLX A;  2GN5 A;  3DUZ A;  1HTP A;  1SE4 A;  4GNX A;  2L15 A;  3MEH A;  5C44 B;  1CZW A;  4RA8 A;  1EIG A;  4N8F A;  3A8I E;  1Y8N B;  1WCM B;  2O4X A;  4LF5 L;  3H94 A;  1I6H H;  1SYC A;  4GNX C;  4XQN A;  5A2Q L;  3S1Q H;  5M5Y B;  4RGN A;  3U4V A;  2ZM6 Q;  3G4S A;  2VW9 A;  1RCV D;  3K5M A;  3F2D A;  3S1N H;  1E0B A;  1MBY A;  4CHT B;  1TWC B;  1I3Q B;  4N9P A;  3J7A 5;  5E7N A;  4QUF A;  1H9S A;  2JA7 G;  1CK1 A;  4FO2 A;  2N55 A;  3NQI A;  5T1I A;  3AMU A;  2PZU A;  1K3B C;  4A3B G;  3PUW A;  2NBF A;  5FJ8 G;  2HIV A;  5LL6 X;  4NXN L;  2FHT A;  1I4G A;  4DFA A;  1PA6 A;  3GTK H;  4DR7 L;  3CHB D;  3BVZ A;  1JJ2 A;  3GTM B;  3FP9 A;  1QWY A;  2A68 D;  1U4M A;  1KC8 C;  3JC6 6;  3KLS X;  4DN4 M;  2JA7 B;  1PH6 A;  3A8K E;  4ME3 A;  2F0I A;  2R7Z G;  1EYA A;  2CQA A;  1EUJ A;  5E4X A;  4CDE C;  4A3B B;  4LF4 Q;  4CDC C;  2ENB A;  3CRL C;  1HA6 A;  3QIA A;  3MXP A;  2GA4 B;  4HED A;  2ZM6 L;  4YY3 Q;  2UUA Q;  4K0K Q;  4NB3 A;  3GTQ H;  1BXT A;  1JT8 A;  4DPG A;  4EQO A;  1EOT A;  1I4R A;  2XIW A;  1QVC A;  3MEF A;  4H02 A;  4KLK A;  1AN8 A;  1IHZ A;  2J4X A;  1CFM A;  2RA4 A;  3D8G A;  2R7Z B;  1SYF A;  1L2F A;  1EFI D;  1KNA A;  1YJN A;  4DUY L;  2K32 A;  2OF1 A;  4JCV E;  2RF4 A;  5FKA C;  2ZTD A;  5C0X G;  5M3M H;  3RD4 A;  2HDM A;  1KHI A;  3U50 C;  3ULP A;  2Q8I B;  2AWO A;  2BDN A;  2K01 A;  1A3U A;  1J5E Q;  3VR6 A;  1PFS A;  2L4N A;  3NHH A;  2X6L A;  3CRK C;  1U4L A;  1BCP B;  4DAY A;  1GUO A;  4A76 A;  4O0A A;  5CV6 A;  2JA6 H;  5FO9 B;  1R4Q B;  4JBW A;  2BOS A;  1CHQ D;  4B3M Q;  3TS2 A;  1EIF A;  5IGD A;  1JWS D;  4DV1 Q;  2KCN A;  1Y8O B;  3OMG A;  3BZD B;  1YI2 A;  4RGO S;  1VCI A;  1PFB A;  3GTL H;  1EYG A;  3U58 A;  1A63 A;  5I9O A;  3TN2 A;  1JB3 A;  2K1B A;  4OL7 A;  1I6V C;  1XYI A;  2YTY A;  1V9P A;  4CGY B;  5KYL A;  3FMC A;  3MXG A;  2EYF A;  4JI6 Q;  5IWA Q;  4ME5 A;  4IFD H;  4FP5 D;  5EBC A;  1PTO D;  4FVM A;  1STB A;  1HZC A;  4CJ0 B;  2NYZ D;  2PZT A;  4C3J H;  2X6G A;  4RHS A;  3MFY A;  2HQE A;  5CR3 A;  2F0Q A;  4IJL A;  4K5V A;  1BF4 A;  2V1C C;  2KEN A;  1ROD A;  1HRJ A;  4B3M L;  4IUP A;  2I5H A;  2LKV A;  1LTI D;  4A3F G;  3WOE A;  1LT6 D;  1ENF A;  1Q3L A;  4A93 G;  4KMU C;  3QOJ A;  3A55 A;  3NE5 B;  4LUV A;  4KK7 A;  3H09 A;  1NJI C;  4DUZ L;  1K8O A;  1DM0 B;  3VYU A;  1OXT A;  4UDU C;  1LYL A;  4X3U A;  3X3M A;  3SK8 A;  1UE7 A;  2QDB A;  2NN6 I;  4RKB A;  4I7A A;  2R61 A;  3KOJ A;  5AFW A;  1BUV T;  3ICE A;  2UXC Q;  1OXV A;  1YBY A;  4R4I A;  4A3F B;  5CV7 A;  1N36 Q;  3I90 A;  4A93 B;  2EY6 A;  3EBE A;  4G57 A;  4AQY Q;  3VR4 A;  3S1R B;  4JW0 A;  1F2Y A;  4YIJ A;  4DR5 Q;  5JJK A;  5IOD A;  1DGS A;  3V96 A;  1KXL A;  1W6J A;  2HCC A;  5LHY 1;  2L55 A;  4OO1 H;  2CW0 D;  1TR5 A;  4HJA A;  1SMY D;  2OXP A;  2K4K A;  1VQ7 A;  3P1H A;  3KLR A;  4OGQ C;  1SNM A;  1LTL A;  2B8G A;  4JV5 L;  4MTN A;  5FLX L;  2PW7 A;  5IIF A;  3TME A;  3UDG A;  4IUV A;  1GOZ A;  1VS0 A;  2IX1 A;  2NZH A;  2DNE A;  5DNF A;  2M00 A;  5FK9 C;  3KYH C;  4B3R Q;  3CCM A;  4AH6 A;  4JI5 Q;  3CCE A;  1Y1W G;  4UAI A;  5M9O A;  3NUC A;  2LMC B;  2MHV A;  3T53 B;  2VB2 X;  2QCP X;  3W5O A;  4QIW B;  2HQL A;  5LMU L;  1VQ9 A;  1BR9 A;  2NTS A;  4XQJ A;  1VQP A;  3I3C A;  3BZK A;  5IGE A;  1AW7 A;  1VQI A;  1PRT C;  1C48 A;  1WFQ A;  3D31 A;  4HJ7 A;  1PZI D;  2XRQ D;  2K52 A;  5IT9 E;  1N34 L;  3H3V I;  2UU9 Q;  3CCS A;  1XNR Q;  1YVC A;  4DF7 A;  1VQ8 A;  1HPC A;  2E75 C;  1HNW Q;  3J81 j;  1KRS A;  2OQ0 A;  1Y1W B;  2RCN A;  1K83 H;  4KKU A;  1EEI D;  1TY2 A;  1PMR A;  3R8B A;  2IX0 A;  3IL8 A;  3ND8 A;  1L0W A;  1I3Q H;  2RQX A;  5JJL A;  5KGU A;  4A3E G;  1S5F D;  2ZTE A;  4FF3 A;  3OTO Q;  2VQE Q;  4KJN A;  1GHJ A;  1B4O A;  2I5L X;  3NQT A;  2RSO A;  3TBI B;  4NXM Q;  2MO0 A;  4LFA Q;  4EQN A;  1Y1V G;  1CA6 A;  5TSS A;  5A2Q E;  4LFC Q;  1JOQ A;  2JE6 I;  4A4I A;  5IGC A;  2R7D A;  1VQL A;  3RZD B;  1S5D D;  2B2W A;  4A3E B;  4DR6 Q;  2PI2 A;  3EFX D;  1I4X A;  4QJF A;  4ID6 A;  2RDH A;  2UU9 L;  1Y1V B;  1XNR L;  1XXG A;  4FF2 A;  1Z9F A;  4X62 Q;  3KBX A;  1STN A;  2B2W C;  4MTK A;  2K14 A;  3F1Z A;  4B3T Q;  2NVT B;  2E2H H;  4MN3 A;  5IP9 H;  3KF6 A;  4HCS A;  3BYT B;  1HZ9 A;  4ZQ3 A;  1ENC A;  3OW7 A;  4RKL A;  3GV3 A;  3VYR A;  1WI5 A;  3GTO H;  5GAE C;  3OTO L;  1STE A;  4KY6 A;  2Q8R E;  1WYD A;  3ONA B;  4DGZ A;  1FNV A;  4LFA L;  2A68 C;  3PUX A;  2R7Z H;  2R93 G;  1I94 L;  2B39 A;  1CUK A;  1WTQ A;  5COR A;  1RL2 A;  2KCT A;  4BS9 A;  4ULL A;  1VDZ A;  5JEA H;  2RDF A;  1VMP A;  4K5W A;  1EYD A;  3RZO B;  2JQO A;  5JEA J;  2Q2I A;  5JVH 3;  4LF7 L;  1PH9 A;  4HIK A;  4DR6 L;  5IP7 H;  3VYT A;  2EXZ A;  4Y7N B;  3I91 A;  3MZ5 A;  1MSH A;  1GUG A;  1B3Q A;  5E3F A;  3AB9 A;  3M7G A;  3FPP A;  3NTK A;  4K2K A;  2E5L Q;  2R93 B;  1CSQ A;  1SSO A;  1NSN S;  1NE3 A;  2EIF A;  4IUT A;  4L5Q A;  2VUM G;  1M8A A;  3LWU A;  2F0F A;  4MIU A;  3HZX A;  2PNR C;  4KKS A;  3KDF A;  1MJC A;  1XNQ L;  4APV A;  3CPF A;  1PH1 A;  1HR0 L;  2CQO A;  1C9O A;  4A3L H;  1ZKO A;  1Q81 C;  1ZEQ X;  3D4D A;  5BR8 Q;  4O2D A;  1RTO A;  2JA8 B;  3I4N B;  2Z8L A;  5LMN Q;  4HJ8 A;  3SXH A;  5IYC H;  4GOP B;  2R92 G;  3FHW A;  2FMC A;  2QEJ C;  4KJO A;  4X64 L;  1IBK Q;  1Q8I A;  2B63 H;  3HOV H;  4P74 A;  4KHP L;  5H1S E;  1Z47 A;  4GLA C;  1E3P A;  4C1N I;  1V1P B;  1SRO A;  1KDA A;  4X3S A;  3K5L A;  2DUD A;  4ALP A;  4A3D G;  1U0L A;  1JJC B;  1YHB A;  4IUU A;  4K8J A;  1X3F A;  3B6Y A;  4RG1 A;  4PQX A;  5I9P A;  1EIH A;  3HP3 A;  2R92 B;  2KQ3 A;  1EY8 A;  1QJO A;  1GUN A;  2JEB I;  2PW5 A;  2DY8 A;  1OTC A;  1JE5 A;  3H3V C;  1PTO C;  5JPN C;  4HTH A;  5C3W A;  2RKS A;  1VF7 A;  5BR8 L;  1GUS A;  4A3D B;  5CV5 A;  4GKJ L;  5CBA E;  5LMN L;  3I4M B;  1EYC A;  1S5C D;  2K04 A;  2EXD A;  2K03 A;  4JI0 Q;  1EQV A;  2I5M X;  3RMH A;  2KCC A;  1YIJ A;  5C3E H;  4V19 0;  2CWP A;  4K6L A;  5I2X A;  1YNJ D;  2HD3 A;  4JI7 L;  1UUP A;  2MQH A;  4TVA B;  4JC0 A;  1FYC A;  1LTS D;  1R4P B;  1HZA A;  3E0E A;  4A3C H;  3KF6 B;  1HNZ Q;  4DAP A;  3EVQ A;  1Q1E A;  4GS3 A;  3I4L A;  1STA A;  3M3Y H;  2B8F A;  4H13 C;  5K5P A;  3QB3 A;  4L5R C;  3VYS A;  4GLV B;  3K5N A;  4JI1 L;  5DAU A;  2F4V L;  1KAB A;  3VA7 A;  1IBL L;  1PH4 A;  3S17 B;  4NKL A;  1G29 1;  2VL6 A;  3CME A;  2CW0 C;  2P5Z X;  5HUR A;  4LF6 Q;  1DCZ A;  1GUW A;  1SYB A;  1SMY C;  2HUG A;  5FLX E;  2CFM A;  1VQG A;  5J3B A;  1SYE A;  4A3J B;  4C3I H;  1HZB A;  2AWN A;  4OWT B;  1W3S A;  2UXB Q;  1XMQ L;  1XPU A;  1LTT D;  3DEP A;  2N88 A;  1SJH D;  2WIN B;  1A2T A;  4WRD A;  1Q46 A;  5JPM C;  3C1F A;  4ZUI A;  1TWA B;  2Z1C A;  3Q22 A;  2KUM A;  3CCU A;  4G4K A;  4EX5 A;  4LK1 C;  1G6P A;  5EKK A;  1SN8 A;  3K81 C;  4LUZ A;  5FO7 B;  1LM0 A;  2FMM A;  3KDF B;  2ES2 A;  4P71 A;  3AEV A;  2NVY H;  4DV3 L;  2LS0 1;  5I6Y A;  4E6I A;  4OHJ A;  5M5W B;  3TP7 A;  4J8Q A;  1OXS C;  3F2U A;  2ICE C;  1K8A C;  1TXY A;  1PXU A;  4TRD A;  2K75 A;  5EGT A;  1YJW A;  1N33 L;  3MA2 B;  4ILW A;  1PLF A;  3J81 i;  1KDC A;  3A8J E;  3T4A C;  2XTI A;  3S1M B;  4BBS G;  1NNX A;  1YNX A;  4A3M G;  3BZC A;  1S4Z A;  3AU7 A;  1Y1V H;  1P8L A;  1BBX C;  3EN2 A;  1QE6 A;  4DV7 L;  3IAY A;  3J7A V;  4AIM A;  4LF5 Q;  1IXR A;  2Z4H A;  1B7Y B;  5ELO A;  3TP5 A;  4EQ5 A;  2EQS A;  4QGU A;  5C4H A;  2EY2 A;  4C2M H;  1TWG B;  2E76 C;  3GP7 A;  4HSV A;  1W6K A;  4F87 A;  4BBS B;  5E1F A;  1ILP A;  4A75 A;  3LNN A;  4A3M B;  4AYB G;  1AZQ A;  2NZO A;  4O42 A;  1SEB D;  3BJU A;  1SNP A; 
#chains in the Genus database with same CATH homology
 2LFN A;  2ZT9 C;  1I4P A;  1K8M A;  2F0M A;  4ZK9 B;  3KF8 A;  2NVQ B;  2WV6 D;  5JVG 3;  3DXJ C;  3URY A;  4EVO A;  2JSO A;  5J22 A;  2RSN A;  1EQT A;  3P7J A;  4RFB A;  3PMF A;  1G6Z A;  2HCI A;  4FXG C;  2K5Q A;  3S2H B;  3K5O A;  5J1Z A;  3GV6 A;  3NWT A;  2Y0S B;  1F9Q A;  2PQE A;  2F0W A;  1V43 A;  1O7Z A;  3SHL A;  3NWS A;  4NDX A;  2SDF A;  2K7V A;  1KNE A;  2AUJ D;  3NTH A;  1EL0 A;  3HOY B;  1BOS A;  1QG7 A;  3FVQ A;  4F88 A;  3NPP A;  1QNU A;  1S5E D;  1I50 B;  3HOU B;  3SDZ A;  2NVX B;  3VR2 A;  1KDB A;  2EJM A;  2F0J A;  3SK6 A;  3TZU A;  3DHQ A;  5EPJ A;  1CHP D;  3SR1 A;  2H1E A;  4HMJ A;  1CA5 A;  1HQR D;  1SFO B;  2EE1 A;  4KD4 A;  4RGM A;  1LTA D;  4RH6 A;  4RCN A;  3VR5 A;  5J39 A;  3T56 B;  1L0X B;  3HOX B;  4JK1 C;  4IUN A;  4HAE A;  2F0E A;  4DA2 A;  5C5M A;  4BA2 I;  2O5J C;  1RHP A;  1B3A A;  4ZUJ A;  2FFK B;  3M4O B;  3K6O A;  1DD2 A;  3I8Z A;  4XXE A;  3OWF A;  2Z4I A;  1JIC A;  2SNS A;  1PRT F;  4RAU C;  2F0S A;  3KLS A;  3G7L A;  4X3K A;  1WD0 A;  3J81 L;  1JOO A;  2BE5 D;  4N9T A;  1EY5 A;  2A5H A;  1RDP D;  1IL8 A;  1DOK A;  1YNJ C;  3CQZ B;  3I72 A;  1TWF B;  1FR3 A;  2IT1 A;  5I4D A;  2SOB A;  4EGV A;  3GTJ B;  1IKL A;  1GUT A;  4IFD J;  1DOL A;  3DWP A;  1X3P A;  3A7L A;  3DEO A;  3VR3 A;  1LO5 D;  4TQU S;  2K6A A;  3KBG A;  3PUV A;  2CHB D;  1PDQ A;  1NR2 A;  4FYD A;  4TSS A;  1QIL A;  1IW7 D;  1E2Z A;  4Q0F A;  3NBH A;  1STY A;  3Q0A A;  4HCE A;  3GTP B;  2KEC A;  2XNA C;  1H9S B;  4BY1 B;  3NSW A;  2BDO A;  1S5B D;  5ISR A;  3LWE A;  1OO9 B;  3L7Z C;  4J6H A;  5C4J B;  1TT2 A;  3C1E A;  3TP8 A;  4KTA A;  5C3X A;  2K5D A;  3I70 A;  5ELC A;  4XIG S;  5CMD A;  3HOW B;  4IZ8 A;  4H7B A;  4WFN 3;  1SNC A;  2O2L D;  5JOB A;  3QWN A;  1BQQ T;  2G9H D;  4WOR A;  3S15 B;  5EJW A;  4FNF A;  1D5Z C;  2J7Z A;  3RLF A;  1U4R A;  3MWY W;  4I7Z C;  1MI2 A;  1B44 D;  1EEF D;  3MVV A;  3K7A B;  2E2I B;  1WTV A;  2NWG A;  3Q23 A;  2X69 A;  3NBI A;  5ELD A;  2AQ3 B;  4P2C B;  1ET6 A;  4PMC A;  4OO1 I;  2EOT A;  3P75 A;  2JEA I;  1ESF A;  5JJZ A;  2F0U A;  3TZD A;  1J8I A;  1SJE D;  2EY5 A;  4CJ1 B;  2K5W A;  3J7Y W;  3OOC A;  1BO0 A;  4CKE A;  4A3G B;  1PTO F;  3S14 B;  4RCO A;  1U4P A;  3R93 A;  4BBR B;  4L6T B;  2L1B A;  3E0J A;  4BA1 I;  1BCP D;  4DNR B;  2D5D A;  3CU7 A;  1ONL A;  3RUZ A;  3UI2 A;  1RTN A;  3TSS A;  2G9D A;  2I46 A;  5BN4 A;  3Q6S A;  1TS4 A;  3BG3 A;  1H9R A;  4KKT A;  4XDX A;  5BN3 A;  5K36 G;  4R9W A;  3U9O A;  1WTR A;  5LL6 S;  2NTT A;  5M3F B;  4FF1 A;  3PO2 B;  3GTG B;  2ZXR A;  1LT4 D;  2IPK D;  4B9W A;  1ET9 A;  1T5X D;  3I73 A;  3IFD A;  4F7X A;  2LY7 A;  1DYQ A;  2EYM A;  2KHS A;  3NP8 A;  2BA0 A;  3T16 A;  5C0X H;  4KHV A;  3T13 A;  4DK0 A;  5C0X J;  3NXW A;  4DU9 A;  1R9T B;  1HA5 A;  2WAC A;  1PZK D;  1H9M A;  3C3L A;  2FJ2 A;  4J1M A;  4XTC S;  1AFP A;  2F0L A;  1RD9 D;  4C56 C;  1PRT B;  1I6H B;  1V8Q A;  2F0K A;  2R3Z A;  3J81 E;  3J7A F;  2EJG C;  2L11 A;  2VUM B;  3OWE B;  3S1N B;  3D4W A;  2B2V A;  5DM7 3;  2BE5 C;  2R6G A;  1Z6H A;  1WTP A;  5CC4 A;  1JWU D;  1EWC A;  4PMW A;  4HSP A;  2B2V C;  4DXF A;  4KHZ A;  1QCB D;  1QNK A;  3BDC A;  4Z9C B;  4F8M A;  2E2D C;  2A6H D;  2B2U A;  1VF5 C;  4R8I A;  5KIX A;  1M4V A;  1Y8P B;  2BCO A;  4H0L C;  2RBM A;  3IFT A;  1SND A;  1I4H A;  5C4Z A;  2XVS A;  2B2U C;  2F0D A;  1JR0 D;  1JOK A;  2MJ8 A;  4G7H C;  1BNZ A;  2L9H A;  1A3T A;  3A7A B;  2F3W A;  1D6E C;  1IW7 C;  2M9V A;  3SE0 A;  3WOF A;  4QCL A;  5G3L D;  1MGS A;  4O1N A;  3KUP A;  4I65 A;  3A54 A;  4KY7 A;  1SAP A;  3U9S A;  1HCZ A;  3M4Y A;  5EQ0 A;  3J80 L;  1SNO A;  2NN6 G;  3A56 A;  1SE2 A;  3NK9 A;  1KTK A;  2A6E D;  1NCV A;  4NMZ A;  1LTB D;  1B53 A;  1F77 A;  4WJW A;  3SK4 A;  1PZJ D;  1SXT A;  3H91 A;  2JYO A;  5E4W C;  4RGT A;  3GTL B;  1JOR A;  2F0G A;  1LLR D;  1CQF A;  2PPB C;  4C3J G;  2RVL A;  2ID0 A;  2F0N A;  3Q24 A;  2KEE A;  3GD7 A;  5DM6 3;  4HR7 B;  1QOH A;  1B9N A;  3E5S A;  3ITP A;  1TQO A;  2JA5 B;  4FXD A;  4C3J B;  3BDO A;  3C46 A;  1D5M C;  1JC7 A;  3HEJ A;  1A2U A;  1LTG D;  5I6W A;  5EKL A;  1UAP A;  3S2D B;  3C2P A;  4OIK A;  3S9W A;  2WKC A;  1PFM A;  2VXW A;  4RHR A;  3K57 A;  1TVX A;  4PNY A;  4G7O C;  2AUK A;  3QJY A;  1ENA A;  1ILQ A;  1FNU A;  2F0H A;  2VB3 X;  1PTO B;  3BS1 A;  3V05 A;  4ZYS A;  5COY A;  3HRZ C;  2WKD A;  1ZYR D;  3K59 A;  1AEX A;  1BCP C;  2WB1 B;  5CGK A;  4KI0 A;  1RF2 D;  1ICW A;  3M7N A;  2C9O A;  3HKZ B;  4FF4 A;  2VNU D;  1O7L A;  3IKJ A;  3PUZ A;  3HOZ B;  1HXY D;  4U67 3;  1Z7T A;  3D3R A;  4NP5 A;  2H4O A;  4HN7 A;  1G8Z D;  5T1G A;  4AYB B;  1G2S A;  1Q90 A;  4ZKB B;  2WII B;  5K36 H;  1Q12 A;  3QG1 A;  2XWJ B;  4EQP A;  1SNQ A;  4XQQ A;  1G91 A;  3L9A X;  4S3S A;  3DM1 A;  3H0G B;  1D1I A;  1X32 A;  3D4R A;  5ELF A;  5ELE A;  1DJR D;  1K83 B;  2SEB D;  2YYZ A;  1DZ1 A;  1A3V A;  4U68 A;  1FNW A;  5HGT A;  1TWH B;  3O13 A;  3OPO A;  5C4X B;  1TKW B;  2J0T D;  1WTX A;  1IKM A;  1A6X A;  2F0T A;  5EBD A;  2MUY A;  2MP1 A;  1CM9 A;  1ML0 D;  1LAB A;  3L3O C;  2F0V A;  2IWH A;  3EA6 A;  3HG9 A;  2MPM A;  5C6A A;  4IN3 A;  1KAA A;  4ZRZ A;  1F9S A;  5JEA G;  2PMZ B;  1EY0 A;  4CKC A;  2E2H B;  3W2D A;  1FD7 D;  2QF7 A;  4KY5 A;  3GTO B;  1EU3 A;  1O80 A;  3ZYY X;  2A6H C;  4L63 B;  5NUC A;  3G6J B;  2V4D A;  5CV8 A;  3PIO 3;  2XSC A;  2O5I C;  2F03 A;  3K58 A;  4QMG A;  3KK7 A;  3MHB A;  2K33 A;  3FDT A;  1B1Z A;  3DWQ A;  1SDF A;  3MXU A;  1LT3 D;  2RDG A;  4M1U B;  2WAQ B;  1HFN A;  4K2L A;  3J80 E;  3ND9 A;  5KYI A;  3S16 B;  2NN6 H;  1AP0 A;  1U9R A;  1TU2 B;  1ESR A;  2IW3 A;  2KED A;  1EU4 A;  4IUQ A;  4DXG A;  3OMC A;  1CTM A;  4ZKC B;  2A6E C;  2E74 C;  3LX0 A;  1O7Y A;  1UEA B;  2EYJ A;  1F2L A;  1JCK B;  2A74 C;  3SK5 A;  5IGG A;  3TP6 A;  4FXK C;  1L0Y B;  1HTL D;  1VMC A;  1D5X C;  1AZP A;  3BYY B;  2B63 B;  5CV4 A;  3HOV B;  3MC0 B;  1F9R A;  1PFN A;  1TS5 A;  5EPK A;  2JXM B;  1TS3 A;  2EYL A;  3WDN A;  4LMQ D;  4XT1 B;  2ZXP A;  2WP8 J;  3R2T A;  1HQM C;  1BDO A;  1WTO A;  4QUC A;  1J9O A;  2PZW A;  3FKI B;  1NUC A;  1WD1 A;  3P20 A;  1X3Q A;  4NW2 A;  4IFD I;  2EYP A;  2MGS A;  4ZLT F;  1PTO H;  3CKI B;  4PV1 C;  2D62 A;  4LJZ C;  3R2I A;  1TII D;  4R8N A;  1B50 A;  2C5C A;  5JAV A;  1SE3 A;  3VA5 A;  3E6Z X;  5C3E B;  2K28 A;  2KJX A;  2IJ0 A;  2EPB A;  3M85 A;  2D2C C;  3T51 B;  4M8A A;  1MSG A;  4DK1 A;  4IAL A;  4Q5V A;  4IUR A;  3MXN A;  2HDL A;  3PV0 A;  4K8I A;  4HMI A;  4C3I G;  5KND A;  5D3I B;  3M3Y B;  1JWM D;  1EZ6 A;  1OXX K;  3GO5 A;  2NB0 A;  5D65 A;  4H44 C;  1LTR D;  1ZYR C;  2L12 A;  4KN4 C;  1WVL A;  1B2T A;  2F4I A;  4ZAI A;  1YNN D;  1XX8 A;  2XN9 C;  4C3I B;  1V1P A;  4CJ2 C;  1NR4 A;  4PMB A;  4RWS C;  3JAM E;  3FPU B;  1EY7 A;  3BDL A;  1LAC A;  5CBE E;  1XWE A;  5FOB B;  1LV9 A;  2OT2 A;  1KLG D;  4DNT B;  1CI3 M;  1E2W A;  1CQV A;  2XRS D;  3BVG A;  2NVY B;  2F1M A;  1G2T A;  2A69 D;  4ODG A;  3QO2 A;  2OEO A;  2TMP A;  4CKB A;  4B08 A;  1H9J A;  2BA1 A;  5KNC A;  2PYK A;  3OIP A;  5I2Y A;  1B9M A;  2TSS A;  2AQ2 B;  5D3D A;  1CZG A;  2B2Y A;  5A35 A;  1SBB B;  3MTS A;  2QKI C;  5EKI A;  2B2Y C;  3HS0 C;  2A73 B;  4C2M B;  2I07 B;  2SNM A;  3K0Y A;  4C1N K;  2IX3 A;  2K05 A;  1SYD A;  5KNB A;  3V2T A;  1CT1 D;  5D14 A;  2CVR A;  5IOC A;  2DN8 A;  1Q1B A;  5M5X B;  1TS2 A;  1RJT A;  1EY4 A;  3OIQ A;  2KVM A;  1IYV A;  3MFG A;  3SVM A;  5DEH A;  3EJI A;  3S1Q B;  2Q8T A;  1UNS A;  3PIP 3;  1EZ8 A;  3N52 A;  1IYU A;  5BN5 A;  1H9K A;  4MHE A;  1JE4 A;  5IGB A;  3HGB A;  3ERO A;  1I4Q A;  3QOL A;  1OXU A;  5CV9 A;  4LAA A;  1WTW A;  1Y69 U;  2IL8 A;  1JQY D;  2AQ1 B;  2F3V A;  2XWB B;  3GTK B;  4GZY C;  3FEW X;  2L0C A;  1II3 A;  1T5E A;  5C0X I;  3DMU A;  3EQL C;  3OHX C;  1GXD C;  2PO4 A;  2M2L A;  1DOM A;  4QB4 A;  1D2B A;  2NUC A;  3PUY A;  1XTC D;  5C5L A;  3GTQ B;  1F2M A;  4ABN A;  2QIL A;  1BCP F;  4K5X A;  5CYU A;  3NTI A;  2EYO A;  2JP1 A;  1F9P A;  1FGB D;  4BY7 B;  2ZXO A;  1DXM A;  3TDQ A;  5M3M B;  4X3T A;  3N6R A;  1F2Z A;  4CBV A;  1STH A;  2JA6 B;  5IGF A;  3W3A A;  4C3H G;  1EY9 A;  2PCF B;  4TKO B;  4IFD G;  1MD2 D;  2NZ1 D;  4DAV A;  1O78 A;  1NAP A;  5KRU A;  4KD3 A;  3GQB A;  3FRP B;  3R3O A;  3D6W A;  4K6D A;  4XYO A;  2F0O A;  1STG A;  4C3H B;  5FO8 B;  1ZXT A;  2FIN B;  3BVM A;  4A3I B;  3H6M A;  1A15 A;  2B2T A;  2EZV A;  2YU9 B;  3OSO A;  4KV6 A;  1RKN A;  3SEB A;  4G7Z C;  3DWA A;  5KEE A;  3MAQ A;  2B2T C;  4A3K B;  1HUM A;  3X3N A;  1E2V A;  4IQZ A;  1GHK A;  1YNN C;  4K14 A;  5ELB A;  1EWH A;  1LT5 D;  3ERQ A;  5F2D A;  4OO1 G;  1EY6 A;  3D6C A;  2DNC A;  1HHV A;  4B9X A;  3PO3 B;  1D1K A;  1V1O A;  1TY0 A;  1C4Q A;  2EVB A;  2EDG A;  5EPL A;  1HFG A;  1PYW D;  2DY7 A;  4BWG B;  1DON A;  4XT3 B;  4V0B A;  2A69 C;  2D9U A;  2KA7 A;  1PRT D;  1GJX A;  1QB5 D;  4OIJ A;  2EJF C;  5G3L F;  1C8C A;  1KLU D;  4XYQ A;  1HUN A;  4KN7 C;  2EY1 A;  2F0P A;  5IT9 L;  4QF4 A;  3JAM L;  1SYG A;  2E2J B;  2L5T A;  2KOL A;  4L8J A;  2ICI A;  3DUZ A;  1SE4 A;  1HTP A;  3MEH A;  5C44 B;  1CZW A;  4RA8 A;  1EIG A;  3A8I E;  1Y8N B;  1WCM B;  2O4X A;  3H94 A;  1SYC A;  4XQN A;  5A2Q L;  5M5Y B;  4RGN A;  1RCV D;  3K5M A;  1E0B A;  1MBY A;  4CHT B;  1TWC B;  1I3Q B;  4N9P A;  4QUF A;  1H9S A;  1CK1 A;  4FO2 A;  2N55 A;  3NQI A;  5T1I A;  3AMU A;  2PZU A;  3PUW A;  2NBF A;  5LL6 X;  2FHT A;  1I4G A;  4DFA A;  3CHB D;  3BVZ A;  3GTM B;  1QWY A;  2A68 D;  1U4M A;  4DN4 M;  3KLS X;  2JA7 B;  3A8K E;  2F0I A;  1EYA A;  2CQA A;  5E4X A;  4A3B B;  2ENB A;  3CRL C;  1HA6 A;  3QIA A;  3MXP A;  2GA4 B;  4HED A;  1BXT A;  4EQO A;  1EOT A;  1I4R A;  2XIW A;  1AN8 A;  1IHZ A;  2J4X A;  1CFM A;  2RA4 A;  3D8G A;  2R7Z B;  1SYF A;  1EFI D;  1KNA A;  2K32 A;  2OF1 A;  5FKA C;  5C0X G;  3RD4 A;  2HDM A;  2Q8I B;  2AWO A;  2BDN A;  2K01 A;  1A3U A;  3VR6 A;  2L4N A;  3NHH A;  2X6L A;  3CRK C;  1U4L A;  1BCP B;  4DAY A;  1GUO A;  5CV6 A;  5FO9 B;  1R4Q B;  4JBW A;  2BOS A;  1CHQ D;  5IGD A;  1JWS D;  2KCN A;  1Y8O B;  3OMG A;  3BZD B;  4RGO S;  1VCI A;  1PFB A;  5I9O A;  3TN2 A;  1JB3 A;  2K1B A;  4OL7 A;  1I6V C;  1XYI A;  4CGY B;  5KYL A;  3FMC A;  3MXG A;  2EYF A;  4ME5 A;  4IFD H;  4FP5 D;  5EBC A;  1PTO D;  4FVM A;  1STB A;  4CJ0 B;  2NYZ D;  2PZT A;  2X6G A;  4RHS A;  3MFY A;  2HQE A;  5CR3 A;  2F0Q A;  4K5V A;  1BF4 A;  1ROD A;  1HRJ A;  4IUP A;  2LKV A;  1LTI D;  3WOE A;  1LT6 D;  1ENF A;  1Q3L A;  4KMU C;  3QOJ A;  3A55 A;  3NE5 B;  4KK7 A;  3H09 A;  1K8O A;  1DM0 B;  3VYU A;  1OXT A;  4UDU C;  4X3U A;  3X3M A;  3SK8 A;  2QDB A;  2NN6 I;  4RKB A;  2R61 A;  5AFW A;  1BUV T;  1OXV A;  4A3F B;  5CV7 A;  4A93 B;  3I90 A;  2EY6 A;  4G57 A;  3VR4 A;  3S1R B;  1F2Y A;  4YIJ A;  5IOD A;  3V96 A;  1W6J A;  2HCC A;  5LHY 1;  2L55 A;  4OO1 H;  2CW0 D;  1TR5 A;  1SMY D;  2OXP A;  3P1H A;  3KLR A;  4OGQ C;  1SNM A;  2B8G A;  5FLX L;  2PW7 A;  5IIF A;  3TME A;  4IUV A;  1GOZ A;  2IX1 A;  2DNE A;  5DNF A;  2M00 A;  5FK9 C;  4UAI A;  5M9O A;  3NUC A;  2LMC B;  2MHV A;  3T53 B;  2VB2 X;  2QCP X;  4QIW B;  1BR9 A;  2NTS A;  4XQJ A;  3I3C A;  5IGE A;  1AW7 A;  1PRT C;  1C48 A;  3D31 A;  1PZI D;  2XRQ D;  5IT9 E;  4DF7 A;  1HPC A;  2E75 C;  1Y1W B;  4KKU A;  1EEI D;  3R8B A;  1PMR A;  1TY2 A;  2IX0 A;  3IL8 A;  3ND8 A;  2RQX A;  5KGU A;  1S5F D;  4FF3 A;  4KJN A;  1GHJ A;  1B4O A;  3NQT A;  2RSO A;  3TBI B;  4EQN A;  1CA6 A;  5TSS A;  5A2Q E;  1JOQ A;  2JE6 I;  5IGC A;  3RZD B;  1S5D D;  2B2W A;  4A3E B;  3EFX D;  1I4X A;  4ID6 A;  2RDH A;  1Y1V B;  1XXG A;  4FF2 A;  3KBX A;  1STN A;  2B2W C;  2NVT B;  4MN3 A;  4HCS A;  3BYT B;  4ZQ3 A;  1ENC A;  3OW7 A;  4RKL A;  3GV3 A;  3VYR A;  1STE A;  4KY6 A;  2Q8R E;  3ONA B;  4DGZ A;  1FNV A;  2A68 C;  3PUX A;  2B39 A;  1WTQ A;  5COR A;  4BS9 A;  4ULL A;  1VDZ A;  5JEA H;  2RDF A;  1VMP A;  4K5W A;  1EYD A;  3RZO B;  5JEA J;  5JVH 3;  3VYT A;  2EXZ A;  4Y7N B;  3I91 A;  3MZ5 A;  1MSH A;  1GUG A;  5E3F A;  3AB9 A;  3M7G A;  3FPP A;  3NTK A;  4K2K A;  2R93 B;  1SSO A;  1NSN S;  4IUT A;  1M8A A;  3LWU A;  2F0F A;  4MIU A;  3HZX A;  2PNR C;  4KKS A;  1ZKO A;  1ZEQ X;  3D4D A;  1RTO A;  2JA8 B;  3I4N B;  2Z8L A;  3SXH A;  2FMC A;  2QEJ C;  4KJO A;  1Q8I A;  1Z47 A;  4C1N I;  1V1P B;  1KDA A;  4X3S A;  3K5L A;  4IUU A;  4K8J A;  4PQX A;  5I9P A;  1EIH A;  3HP3 A;  2R92 B;  2KQ3 A;  1EY8 A;  1QJO A;  1GUN A;  2JEB I;  2PW5 A;  2DY8 A;  3H3V C;  1PTO C;  5JPN C;  4HTH A;  5C3W A;  2RKS A;  1VF7 A;  1GUS A;  4A3D B;  5CV5 A;  5CBA E;  3I4M B;  1EYC A;  1S5C D;  2K04 A;  2K03 A;  1EQV A;  3RMH A;  2KCC A;  4V19 0;  4K6L A;  5I2X A;  1YNJ D;  1UUP A;  1FYC A;  1LTS D;  1R4P B;  4DAP A;  3EVQ A;  1Q1E A;  3I4L A;  1STA A;  2B8F A;  4H13 C;  5K5P A;  3QB3 A;  3VYS A;  3K5N A;  5DAU A;  1KAB A;  3VA7 A;  3S17 B;  4NKL A;  1G29 1;  2CW0 C;  5HUR A;  1DCZ A;  1GUW A;  1SYB A;  1SMY C;  2HUG A;  5FLX E;  1SYE A;  4A3J B;  2AWN A;  1LTT D;  3DEP A;  2N88 A;  1SJH D;  2WIN B;  1A2T A;  4WRD A;  5JPM C;  3C1F A;  4ZUI A;  1TWA B;  2Z1C A;  3Q22 A;  2KUM A;  4G4K A;  4LK1 C;  5EKK A;  5FO7 B;  2FMM A;  2LS0 1;  5I6Y A;  4E6I A;  4OHJ A;  5M5W B;  3TP7 A;  4J8Q A;  1OXS C;  2ICE C;  3F2U A;  4TRD A;  1PXU A;  5EGT A;  3MA2 B;  4ILW A;  1PLF A;  1KDC A;  3A8J E;  3T4A C;  3S1M B;  1S4Z A;  3AU7 A;  1BBX C;  1QE6 A;  3IAY A;  3J7A V;  2Z4H A;  3TP5 A;  5C4H A;  2EY2 A;  1TWG B;  2E76 C;  3GP7 A;  4HSV A;  1W6K A;  4F87 A;  4BBS B;  5E1F A;  1ILP A;  3LNN A;  4A3M B;  1AZQ A;  4O42 A;  1SEB D;  2EYH A;  1SNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...