5H1SE

Structure of the large subunit of the chloro-ribosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
247
structure length
247
Chain Sequence
NPRNNLISGQRRCGKGRNARGIITARHRGGGHKRLYRKIDFRRNEKDIYGKIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEVPIKMGNALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKRLGRAGSKRWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKSPTTPWGYPALGRRSRKRNKYSDNFIIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
total genus 15
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain
E PF03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5h1sE01
4DV0L 5IT9c 1QZHA 1X55A 3HOZG 2I5MX 4JI8Q 2ZJQA 3EBEA 4UP9A 3S2DH 5M3FG 4DR1Q 4A3MG 4P75A 1J5EL 5JEAJ 1A8VA 4KI0A 1YBYA 2EXDA 5C0XG 3GTPH 1TWCH 2HQLA 4A3LH 1SFOH 4GOPB 5IYCG 4LF7L 4A3EH 3A5ZB 1HNXQ 1I94L 3UE1A 4JI0Q 3L7ZC 2OCEA 4BBSG 1L0WA 1PH3A 4B3TL 1CUKA 2MO0A 1MJCA 5GROA 5C3EH 4LF8L 1V43A 2VUMH 4A3BH 4DR4L 1HH2P 1YI2A 2K5VA 4BXXH 3UDXA 1A63A 2Q2TA 5AJ3L 3TRZA 2ATWA 4GLAC 4LNQA 5JEAG 2KBNA 4UP8A 1EIYB 3HOWG 4X62L 1LYLA 2K14A 3EN2A 4JI5L 1HZBA 4DK3C 4QQBX 2JQOA 2Z6KC 2I5HA 1VQOA 2MNAA 4LUOA 3E0EA 4FDBA 4XTCS 1LUZA 1P8LA 4C3HH 4NXML 1ASZA 4YCWA 1L1OC 1X3GA 4POFA 1BVSA 1WJJA 1YHQA 3T1YQ 3NELA 4JI2Q 3PV0A 3S16H 3ULLA 4JBJA 2R7ZH 3AQQA 3STBC 4PZ7A 5M3FH 2XGTA 1M1KC 1X3EA 3KDFB 1AE3A 1J5EQ 4B3SQ 3STBD 1QVFA 2WAQE 2R92H 2QGQA 3UDFA 4GN5A 1Z47A 3RN5A 3CCUA 2JJQA 5FLXc 3CP0A 4HJ8A 1VCIA 3T1YL 1PA6A 4LF9L 1WFQA 4JC0A 4A3IG 3GTLH 1XNQQ 3PF4A 5JJKA 4IFDI 3F8TA 3I4NH 4L5QA 1Y1VH 4LFCQ 2B3GA 1W3SA 4A3BG 4DV0Q 1KRSA 4MZ9A 1HJPA 2JEAI 2IHEA 2YYZA 2Q2IA 3HKZE 3I2ZA 3CCSA 2VNUD 1G6PA 2MO1A 2HIVA 4IOAA 3U4ZA 5H1SE 1YHAA 3J7A5 3TS2A 4LFBL 4X66L 5FJ8H 3HOXH 4OWWB 2RCNA 3L2PA 2A1AA 3IRBA 4GKJQ 1E22A 1XTDA 2ZJPA 1Z9FA 4Y7NH 3J7ZC 4JI4L 4X65L 1I6HH 1VQPA 1QUQA 4DR2Q 1FJGQ 3S1RH 2VQEQ 4BBRH 3GDEA 4QY7A 4DUZL 2UU9L 5BR8L 4HIDA 1XPUA 4A3GH 3FHWA 5JJLA 1JB7A 1IBMQ 2Y0SG 2QEXA 3K7UC 1N33L 3AFQA 2KCTA 2JA8G 3CC2A 4P71A 3ICEA 4DR3L 2AMCB 4LFAL 1V9PA 1EFWA 1VQLA 4DR6L 2IX1A 1N32Q 3AEVA 2BA1A 4OWTB 1L1OA 2CCZA 2UXDQ 4BA2I 4LF6Q 4BBSH 1KL9A 4IPHA 1K83H 3UE0A 1I94Q 4B3RL 4HJ9A 1JJCB 1XMQL 1NTGA 4DV6Q 3RLOA 1VQFA 2PI2E 4BA1I 5DLQE 1CSQA 1PH2A 2B63H 3F1ZA 4DV2Q 3CAMA 5M3MG 4B3RQ 4DV5Q 1PH9A 3PIPA 4YHHQ 1NE3A 4L5SA 3HOUH 4WJ4A 3ER0A 1E24A 2R6GA 3GTOH 3T1HL 1TWHH 1I50H 4R4CA 4H02A 2E2IH 3RLFA 5BR8Q 3M4PA 5J3BA 1PH8A 2H5XA 3EIVA 3G4SA 3CCVA 4A3JG 1KD1C 1IBKL 4GN4B 4IOCA 3I7FA 4LF5L 5GAHC 1E3PA 2R93H 1VQCA 4HJ5A 2AKWB 4XIGS 1S40A 4GOPA 1D7QA 2VS1A 5AJ3Q 1NMFA 2N78A 4KHZA 2AWNA 1OXXK 1TXYA 2BH8A 2NN6I 4LUVA 4MNOA 4ME3A 4RMFA 4A3KH 3I4NG 1X65A 2JA5H 2A19A 3M85A 4GKJL 1SR3A 1OTCA 1VQ6A 1PYSB 4L5TA 2OTJA 3J81i 4BY1G 3PGZA 1X56A 4J15A 2C35B 2ES2A 2OWOA 3HFZB 3BJUA 1SE8A 2PNHA 4DUYQ 1YNXA 1N9WA 3SGIA 5IY0A 1G51A 2D62A 5FJ8G 4YHHL 1Y1WG 2B29A 3PUXA 1KC8C 2N49A 2JA6G 1EUJA 1R9TH 5K36G 1N36L 1IXRA 3M4OH 4PZ8A 4DNIA 2A8VA 3HOVG 5ELNA 5C3EG 5C0XJ 4DR5L 3G48A 3PIOA 3H15A 4AYBG 2NVXH 5FLMG 1VQBA 1I3QH 2OQKA 3E9IA 2Y0SE 3J80c 1A0IA 3ULPA 1QVCA 1Q1EA 4JCVE 1YHBA 4JI1Q 5GQOA 3A0JA 4YY3L 4JBKA 1BKBA 3CQZH 4A76A 5IP7G 1Y14B 2VW9A 4GKKL 1NY4A 1H95A 2CKZB 3M3YH 1Q12A 3DM3A 4JOIA 3S14H 2F52A 2UXBL 1CSPA 3CC7A 4R1JA 4R4TA 4DK6C 3A5UA 1FGUA 4DR2L 2Z0SA 1B7YB 3PUYA 2RHSB 4P73A 2ALYB 5IYBG 4A93G 3GTGH 4DV2L 3CMEA 2Z6KA 4AYBE 3F2BA 1DGSA 4TQUS 4LF9Q 3S15H 5ELOA 2I5LX 3K80C 1N33Q 4OO1I 2OQ0A 4AH6A 4LF7Q 1XNRQ 1XPRA 4QIWE 1PH5A 1UE5A 1X6OA 3S24A 1VQGA 5LMUQ 2UXCQ 3S1QH 4LF6L 1GKHA 1J6QA 4DV1L 2UUCQ 1WI5A 4YCVA 4DV7Q 1MJEA 4LF5Q 2EQSA 1YEZA 2NN6G 2K75A 3ZJYC 3CW2C 1YITA 3VDYA 3PO3G 5M5YH 1K8AC 1T9HA 5GADC 4A75A 5LMNL 3CD6A 4LUZA 2VZAA 4DV7L 3J80i 1UE6A 2UU9Q 4BY1H 5GAGC 1X9NA 4C3JH 4A3GG 2NZOA 3CCMA 4JYAQ 1X54A 1IL2A 1D8LA 5C4XG 2E5LL 3BZCA 1VQ9A 1C7YA 1RL2A 2KENA 1U0LA 2BH2A 1CKNA 4GNXA 3FKIH 4WJ3M 4KHPL 5IYBH 2LXJA 2VQFL 1FVIA 2CWPA 3ERSX 1TWFH 1X3FA 1VQMA 4HJAA 2NVQH 4DR1L 3OTOQ 4A3LG 1GO3E 1XNRL 4A3FG 1N36Q 3S17H 5IYDG 3KDFA 2MFIA 4IO9A 2YV5A 3HOYG 1KAWA 2D0PA 4APVA 4OXPA 3PUWA 4LW1A 1CKMA 1PH6A 1ASYA 1VQKA 2B63G 5HGQA 2HHHL 2JA7G 3GO5A 2ZTDA 1N8RC 4OX9L 3CPFA 1IYJB 3H3VI 4YCUA 4YWKA 4MTNA 4LF4L 2ID0A 4JI1L 1Q46A 1IBML 2UUAL 4DV4Q 4JI3L 4X6AH 4PZ6A 5IP7H 4YY3Q 2UUBQ 1U5KA 2JE6I 2OTLA 4DKAC 2GVAA 1BBWA 3A74A 2PQAA 4JI4Q 2KHJA 2WFWA 1XJVA 2VL6A 2K52A 3HOZH 4IPGA 1AH9A 4C3IH 4X64Q 4AQYQ 2ZTCA 4JI7L 2EIFA 5GAEC 3I4MH 2R7ZG 3D0FA 4DR5Q 1SLJA 1PH1A 1YJ9A 2HT1A 2R93G 2HIXA 1W2BA 3FKIG 3OW2A 3I4OA 3OTOL 1JJGA 3RLNA 3CCRA 1YZ6A 1K8GA 4K0KL 3T1HQ 2WB1E 3RNUA 1IBLL 1Q82C 4A3DG 1C0AA 5IE8A 3K8AA 1VQIA 3JC66 4UP7A 4B3TQ 4LF8Q 4QL5A 2L15A 2UXDL 1SROA 3G6EA 5IYDH 1XNQL 4TVAB 2NVTH 4DR7L 3WWVA 1EWIA 1KIXA 1MIUA 2IT1A 1NJIC 2UXCL 1SRUA 4A4IA 2Q2UA 2CWAA 2PQAB 1L2FA 5LMNW 3CCLA 4LF4Q 4DR7Q 4IFDG 1HNWL 5JJIA 1VQNA 2JA6H 3S1NH 1PVOA 4Y52H 1JMCA 1LM0A 3U58A 3TQYA 1HNWQ 1B8AA 1M90C 1O7IA 1VQ7A 3KYHC 2NZHA 2F4VQ 1KXLA 4JBWA 3U4VA 2WB1G 3KJPA 3M7NA 1IBKQ 4HIMA 3LGJA 1SMXA 2ZTEA 4B3SL 2KHIA 3I4MG 1OXVA 3L0OA 4PMWA 2VQEL 4JV5Q 1FL0A 3GD7A 3CPWA 2F4VL 4EX5A 1EYGA 3GTKH 3RZDH 1VQ4A 2IHFA 3RR5A 3CMAA 1Y1VG 1RIPA 1XMOQ 1P16A 2E8GA 4JOIC 2UUBL 2E2HH 3HOYH 4JV5L 3TEHB 1E1TA 4O0AA 4AIMA 1Q7YC 3CCEA 1HNZL 4YWMA 4IJLA 3HKZG 3U50C 4LWCA 4IPDA 5LMNQ 1EQRA 1PH4A 4JI6L 1PH7A 2JA7H 4R4IA 2HHHQ 3M4QA 5IP9G 4HJ7A 2AHOB 1B70B 2D0OA 2IX0A 2RF4A 3CCJA 4OX9Q 5C0XI 1WCMH 1GD7A 2MQHA 4DV5L 3KF8B 2UXBQ 5LMUL 4DV4L 2YTYA 1HNXL 3I56A 2I0QA 2K5HA 3W1BA 2JA9A 2F3IA 3ULJA 1PV4A 3FP9A 4R4QA 4GS3A 4OONA 3NENA 2BA0A 3JAMc 4A3JH 1SN8A 3D31A 3M9BA 3OYYA 1HR0W 1Q8KA 4QGUA 4AQYL 4ALPA 4EQ5A 2GVBA 1QVGA 3PO3H 1N32L 3MEFA 1NBWA 4C2MH 1E1OA 4RG1A 1PHJA 3GTMH 1BBUA 1HZ9A 5IYCH 5IWAQ 4A3KG 2E2JH 4GKKQ 4JYAL 1IBLQ 3KF6B 2R7FA 2AWOA 3NBHB 3KLWA 5C4XH 2E5LQ 2N8NA 2YTXA 4JI6Q 1VQ5A 4UPAA 4IFDJ 3BZKA 4BXXG 3K7AH 1EOVA 4NPSA 1QUQB 3JAMi 3DLLA 3F2DA 5C4JH 4UY8C 3PO2H 3I55A 2QA4A 3HOWH 5IP9H 4GOPC 1Y1WH 1VQDA 3KJOA 1PFSA 3W1GA 4DUYL 4X64L 1VS0A 1KHIA 3E9HA 4JG2A 1LTLA 4X65Q 1QZGA 1KQSA 3HOUG 4O2DA 1K0RA 3H0GG 3MXNB 2RHQB 3HKSA 3PCOB 2PMZE 1HZAA 2N3SA 2DGYA 1YIJA 5C44H 4GLXA 1N34Q 1VQ8A 2JEBI 4L5RC 2ASBA 4POGA 4DV1Q 2UUCL 4DR3Q 1OXSC 1CKOA 4OO1G 2WAQG 4NXNL 4B3MQ 4GLVB 3PUVA 2R92G 3AYHB 1C9OA 5E7NA 1WYDA 3KOJA 2VY3A 4LFAQ 4BY7H 1PYBA 4DR6Q 2JA5G 1XPOA 4A3CG 1E7ZA 4A3IH 2ZM6L 4JI7Q 4R4OA 3KFUA 2JA8H 3RZOH 2CFMA 3S1MH 4JI5Q 4GN3B 3RN2A 2YTVA 1XMQQ 1NMGA 1K73C 1HNZQ 3TS0A 3K0XA 1FJGL 3GTQH 4DV3L 1V1QA 4KHPQ 2Q2HA 4A3MH 4HIKA 1EQQA 4JI3Q 4A93H 4JI0L 4NXMQ 4A3DH 1WCMG 4X66Q 1Q81C 4A3EG 3HOVH 1YJWA 1CKNB 4GNXB 2JK8A 5IWAL 3PF5A 3F2CA 5FLMH 1K9MC 1HR0L 1JE5A 1Q86C 3H3VH 1Q1BA 1UWVA 4JBMA 2VUMG 3B6YA 4BBRG 3CCQA 4GNXC 1AE2A 1HZCA 2YU9H 2R7DA 4KLKA 3Q8DA 2WP8J 4P74A 1UEBA 5C44G 2LXKA 4QJFA 3UDIA 1XMOL 3CC4A 2IY5B 1JT8A 4DAYB 4IPCA 5M5WH 3J81j 2ZJRA 4B3ML 4NXNQ 1VQEA 3S2HH 1VQJA 2DUDA 1KRTA 1VQAA 3PUZA 4BY7G 2UUAQ 4A3CH 1GVPA 1S72A 4PG3A 1UE1A 2GN5A 1K3RA 4JI2L 1EIFA 1YJNA 2KCMA 4DAMA 4DV3Q 3W5OA 2FXQA 2K50A 3PO2G 4P72A 4JI8L 1IZ6A 2NVYH 1A62A 5HY6A 5M3MH 5M5XH 4DUZQ 1TWGH 2K5NA 3TREA 2VQFQ 4IJHA 1GM5A 1OXTA 4K0KQ 3H0GH 1TWAH 2K4KA 4A3FH 1HR0Q 3KF6A 1VQHA 3AFPA 4DPGA 3G71A 3PSIA 3J81c 4HIOA 3NEMA 1MKHA 1G291 1JJ2A 2LSSA 4NB3A 4LFBQ 4DR4Q 3GTJH 1N34L 2V1CC 3BU2A 3CXCA 5EAYA 1YVCA 4OWXB 2PI2A 4YWLA 3HOXG 3CF5A 4DV6L 1UE7A 2CQOA 1L1OB 1I5FA 4X62Q 3UDGA 1S3OA 1OXUA 4LFCL 3K81C 1WOCA 2XTIA 2ZM6Q
chains in the Genus database with same CATH superfamily
1FNVA 2F0JA 3CRLC 1X55A 2XIWA 3HOZG 3F2UA 1TQOA 2ZJQA 1EU3A 4XDXA 4K5XA 3EBEA 4RGTA 1TVXA 5M3FG 4IUPA 1OO9B 4P75A 5JEAJ 3HEJA 1TWCH 1D6EC 1KABA 3DMUA 3A5ZB 3FPPA 2NYZD 4JI0Q 1KDBA 3L7ZC 4RCNA 2OCEA 3MVVA 1L0WA 1CUKA 1MJCA 5GROA 2K04A 2D9UA 1YI2A 1QILA 4A3GB 3TRZA 4LNQA 2B2TA 2F0EA 2A69D 4UP8A 1EIYB 4CJ0B 3HOWG 1LTAD 1HZBA 4DK3C 2F0FA 2Z9HA 2JQOA 4QQBX 4K8JA 2MNAA 4LUOA 1P8LA 4A3FB 1HA5A 1X3GA 4POFA 2RBMA 2FHTA 1YHQA 3NELA 3TMEA 2R7ZH 1F2MA 1J5EQ 5IGBA 5ISRA 1A2TA 3SK5A 5CYUA 4CDCC 2QGQA 1Z47A 3RN5A 3CCUA 4LF9L 4JC0A 2A5HA 4ZKBB 3PF4A 1F9PA 1K3BC 1S5FD 2B3GA 2XRSD 4KKSA 1HJPA 2JEAI 1JCKB 3I2ZA 3ONAB 2MO1A 1SNCA 3U4ZA 4J1MA 5H1SE 3VYSA 1TY0A 2DNCA 4X66L 5FJ8H 5A2QL 4OWWB 1XTDA 2ZJPA 1Z9FA 4Y7NH 2NVXB 3EA6A 1QUQA 1VQPA 3DWPA 1WTRA 1IKLA 4WRDA 5D3DA 1BF4A 4H0LC 3GDEA 4DUZL 1WTVA 5BR8L 1S5BD 3K7UC 1JICA 3AFQA 2KCTA 3MXNA 4P71A 3OSOA 4FP5D 4DR3L 2RVLA 3S17B 4LFAL 2B2UC 5EPLA 4F8MA 4HCSA 1EFWA 3MFYA 5M3FB 4F87A 2NZ1D 3BDCA 4OWTB 2CCZA 2B8GA 4LF6Q 1KL9A 4IPHA 3UE0A 3TZDA 1X32A 4DV6Q 5EKIA 3I70A 4BA1I 5DLQE 2B63H 5E3FA 5KRUA 4DV2Q 1BO0A 4OHJA 1IW7D 3K5MA 4WJ4A 1E24A 2EJGC 1LTGD 4PQXA 2O2LD 3C1FA 3RLFA 5BR8Q 5J3BA 2B2WA 2RDHA 3C1EA 2H5XA 3EIVA 1IBKL 4ME5A 3I7FA 5GAHC 2WINB 2R93H 2Y0SB 4HJ5A 2AKWB 3DUZA 3RUZA 4MNOA 4LUVA 5CV4A 4ME3A 2L55A 1B53A 2B2WC 4XYOA 1VQ6A 1PYSB 3T16A 1X56A 2ENBA 3HFZB 1SYGA 3N6RA 3QOLA 5IT9L 1QNUA 5IY0A 1G51A 5FJ8G 2B2UA 1EQTA 4BY7B 1N36L 5JJZA 4PZ8A 1FGBD 4HMIA 4DNIA 1LTSD 2EJFC 3E9IA 1JWMD 3PO2B 1H9RA 1SNOA 4WJWA 1TWGB 1JC7A 1QVCA 5I6YA 4JCVE 3HKZB 4JVZA 5FKAC 1LT4D 1F9RA 4K2KA 4YY3L 3MC0B 3CQZH 4A76A 3E6ZX 2F0KA 3R3OA 3M3YH 4N9PA 1Q12A 3DM3A 3S1NB 1H9JA 1BUVT 1CSPA 1G2TA 1FGUA 1C48A 3PUYA 1EY4A 2RHSB 2ALYB 4P73A 2R61A 4AYBE 1DGSA 3NWTA 1JE4A 4FXKC 2OQ0A 3HOZB 3A8IE 5F2DA 3DEOA 4V0BA 5CV7A 5C4JB 5ELDA 1F9SA 2UXCQ 1J6QA 1WI5A 1MJEA 4KKTA 3ZJYC 1T9HA 2EDGA 1CZGA 4LUZA 1Q3LA 2VZAA 3V2TA 2UU9Q 5GAGC 3FVQA 1X9NA 3K7AB 4A3GG 1D8LA 2X6LA 1SYCA 5CORA 5IYBH 4A3DB 2CWPA 1TWFH 1H9SA 4A93B 1E0BA 1IL8A 3S17H 2D0PA 4OXPA 4LW1A 1YNNC 1VQKA 1AZQA 2HHHL 2QW7A 4AYBB 3BDLA 1WD0A 3ERQA 4KKUA 1STBA 5DM63 4DV4Q 4X6AH 5E4WC 1DYQA 2RDGA 4DKAC 1BBWA 1XJVA 2K52A 4C3IH 2B2YC 1CK1A 4JI7L 2EIFA 3D6CA 2C5CA 4OIJA 3T1HQ 3RNUA 1Q82C 4A3DG 1ESRA 1XWEA 1CM9A 1F2ZA 2J0TD 3GV6A 2B2YA 3G6EA 5IYDH 1EU4A 3W3AA 4TVAB 1JOOA 1B4OA 2EYFA 5FLXE 3CRKC 3CCLA 2JA6H 1LM0A 2RCFA 2XRQD 3MXUA 5FOBB 4HAEA 4C3JG 2NZHA 2CVRA 1MHWC 3M4OB 3U4VA 1KXLA 3KJPA 1B3AA 4HIMA 1SMXA 4ZAIA 2D2CC 2A6EC 2VQEL 4CHTB 4JV5Q 1B3QA 2F4VL 2NBFA 2PPBC 4OGQC 2KQ3A 1TWCB 3RZDH 2KHSA 1O7YA 1VQ4A 2K33A 1P16A 5T1GA 2E2HH 3TEHB 5K5PA 1HNZL 4YWMA 4IJLA 2JA7H 1L0XB 1TY2A 2KA7A 2F0QA 4UHVA 1LTRD 1A3TA 2QEJC 4RHRA 5LMUL 3OMGA 3P1HA 1HFNA 2OF1A 3L3OC 2F3IA 1PV4A 5BN5A 4GS3A 5LHY1 5CV9A 3MA2B 1WTOA 1SBBB 3OYYA 4B08A 5KEEA 1Q8KA 2R92B 2GVBA 3PO3H 1N32L 1QNKA 1NBWA 2NVQB 1AW7A 5I4DA 4TKOB 4RG1A 4A3KG 2EPBA 4FF1A 2AUKA 1HUMA 3DWQA 2N8NA 3A56A 1F77A 5KGUA 3K7AH 3A7AB 5JAVA 1EY7A 4KV6A 3DLLA 4UY8C 1Y1WH 1O7ZA 1VQDA 5C4XB 3E9HA 4JG2A 3OPOA 3SE0A 1KQSA 3HOUG 1K0RA 5CBEE 3GTGB 2DGYA 5C3XA 4HMJA 1KNAA 1PZKD 4HTHA 5CR3A 5C44H 4GLXA 1VQ8A 1QB5D 1SFOB 2G5DA 3HOXB 4U68A 1UNSA 4DV1Q 3EVQA 2X6GA 2BCOA 2R92G 5E4XA 5E7NA 2IJ0A 3KOJA 4I7ZC 1GUGA 1PYBA 4C1NK 2JA5G 1D1KA 1PFNA 4JI5Q 4DAYA 1HRJA 1RTNA 2YTVA 2A69C 1ZXTA 4A3MH 2PQEA 4UDUC 4NXMQ 4K6LA 1ILPA 4X66Q 1Q81C 3S1RB 3HOVH 1ICFB 2R93B 1KNEA 1Q86C 3HOWB 4HCEA 1Q1BA 3BZDB 4BBRG 1AE2A 4BY1B 2PNRC 2R7DA 1NUCA 2FMMA 1BDOA 2LXKA 4QJFA 1JT8A 5EJWA 4EQNA 3MEHA 5ELBA 5CBAE 3Q0AA 2F3VA 1VQEA 1EFID 2LY7A 1EQVA 2DUDA 1H9MA 1PZJD 4A3CH 1S72A 3QO2A 3H94A 1YJNA 2FXQA 2K50A 3G7LA 4XT3B 1NNXA 2PZUA 5M3MH 5M5XH 2F0SA 3H09A 5AFWA 1TWGH 2K5NA 1QJOA 4KJNA 2EYMA 3TP8A 3G71A 3J81c 3NEMA 1MKHA 1G291 4RGOS 2K03A 4BBRB 1PRTB 3GTJH 1DXMA 4MN3A 1SNQA 1EYDA 4L8JA 3EQLC 4OWXB 1UE7A 2CQOA 3LNNA 4X62Q 1S3OA 3K81C 1B44D 2Z4IA 5IT9c 2ZM6Q 4U673 2JA5B 4CBVA 1TT2A 4A3MG 1EWCA 1A8VA 2EXDA 1LV9A 2HQLA 4A3LH 1SFOH 4Y7NB 4A3EH 1ZYRD 1I94L 4BBSG 1TS4A 1XX8A 4DR4L 2BE5D 4BXXH 1TWHB 2K5VA 3UDXA 5T1IA 4GLAC 4X3UA 4X62L 1LYLA 3E5SA 3GTMB 4FVMA 3S1QB 1VQOA 4XTCS 3HP3A 1LUZA 1B1ZA 4C3HH 4ZYSA 4R8NA 3EJIA 2EY1A 1WJJA 5HGTA 4JI2Q 3PV0A 3J7AF 3OHXC 4JBJA 3S16H 3W2DA 1IBML 2PZTA 3KDFB 2K7VA 4B3SQ 3J81E 1X3PA 4A3MB 1QVFA 2QCPX 2DN8A 5FLXc 3T1YL 3CP0A 4FNFA 1WFQA 2KJXA 3GQBA 3NBIA 3VR3A 3X3MA 1H95A 3F8TA 1KDCA 4L5QA 4LFCQ 2IW3A 2XVSA 4A3BG 3I72A 4DV0Q 4MZ9A 2YYZA 1BCPC 3RD4A 3IAYA 2PW5A 5KNBA 1SMYD 1G6PA 4S3SA 4KN7C 2Q8IB 1XXGA 1TR5A 1Z6HA 1U9RA 2RCNA 3L2PA 3NTKA 1K0SA 3J7ZC 4X65L 5EGTA 1VMCA 3GV3A 2UU9L 4F88A 1HCZA 2QEXA 3KBGA 1N33L 2J7ZA 3CC2A 3I73A 4X3TA 1BNZA 2ZXPA 1QWYA 1V9PA 3AEVA 4P2CB 1LT5D 1D5ZC 1I94Q 3QIAA 2E2DC 3NSWA 3RLOA 2JXMB 4KN4C 2QDLA 3CAMA 1NAPA 4DV5Q 4B3RQ 2JN4A 1U4PA 2R6GA 3GTOH 3T1HL 1TWHH 3GTJB 5CMDA 1G2SA 1Y1VB 2E2IH 4C2MB 2EYJA 1QE6A 2MJ8A 1VQCA 2RA4A 4K5VA 1EIGA 1S40A 1SXTA 5FO9B 5IGEA 1BBXC 2NN6I 2ZXOA 2JA5H 3I91A 1SR3A 2KVMA 1GXDC 1OTCA 1RJTA 3J81i 4BY1G 2F0NA 3PGZA 1I4XA 1DD2A 2C35B 2B2TC 4E6IA 3RZOB 2B2VA 1Y1WG 1YNXA 1AN8A 3SK8A 1FR3A 1EUJA 1G6ZA 3QB3A 1IXRA 5C3EG 5C0XJ 3H15A 3PIOA 4AYBG 1I3QH 2WKCA 2Y0SE 1PXUA 2F0UA 1A0IA 1I4PA 1VF5C 1WVLA 1YHBA 4CDEC 3A0JA 1ICWA 3FDTA 4IURA 1BKBA 1RTOA 5IP7G 4GKKL 1NY4A 1STYA 2CKZB 2JSOA 2UXBL 3NUCA 1IYUA 3A5UA 1B7YB 4QIWB 3S15H 5ELOA 2I5LX 5FO8B 1B50A 3K80C 3TP7A 5BN4A 5IOCA 1XPRA 2J4XA 2NWGA 1VQGA 5LMUQ 5G3LF 1PFBA 3S1QH 4LF6L 4HSVA 1RDPD 4OL7A 1V1OA 2Z4HA 2NN6G 1BCPF 1J9OA 1MSGA 2K75A 3CW2C 3VR6A 3D6WA 4DAPA 1YITA 1K8AC 4BBSB 1STEA 5GADC 5E1FA 4F7XA 4DV7L 2N55A 3J80i 4BY1H 4JYAQ 4C3JH 2IWHA 1IL2A 4KJOA 2MHVA 3BZCA 3A54A 1RL2A 2KENA 3K5NA 2BH2A 1CKNA 4GNXA 1S5DD 1EIHA 4KHPL 3Q6SA 4DR6L 2K28A 2LXJA 2VQFL 3ERSX 1VQMA 2NVQH 2O5JC 3CHBD 2RQXA 4A3FG 3KF8A 4ID6A 3KDFA 1MBYA 3KLSX 5C4HA 1KAWA 3HOYG 1LTID 4G7HC 1PH6A 4QUCA 2ZTDA 4YCUA 4L63B 1ESFA 2AQ1B 5IIFA 2JE6I 2OTLA 3A74A 3T4AC 3HOZH 1MSHA 4IPGA 3WDNA 1FYCA 3BG3A 3I4MH 3D0FA 3GP7A 2HIXA 1W2BA 3EFXD 4NKLA 3OW2A 3OTOL 3RLNA 1YZ6A 5JPNC 1C8CA 3QR8A 1G8ZD 3K8AA 4UP7A 5C5LA 4B3TQ 4QL5A 4LF8Q 2UXDL 4IZ8A 1SROA 2IL8A 4FF4A 3WWVA 1PTOC 2Q2UA 2CWAA 1L2FA 5LMNW 4LF4Q 3D4WA 2L4NA 2NN6H 1KDAA 5IGGA 1I3QB 3R8BA 2K05A 1O7IA 2M2LA 4JBWA 1QOHA 2B8FA 1PDQA 3VYRA 2BDNA 2LMCB 1LLRD 4PMWA 3CPWA 1EYGA 3GTKH 5C6AA 1EZ6A 3CMAA 1Y1VG 1RIPA 1XYIA 4R9WA 2E8GA 2UUBL 3HOYH 1BQQT 4O0AA 3ND8A 4LWCA 4IPDA 4NP5A 3U50C 4JI6L 1TU2B 1PH7A 4R4IA 2F0PA 3M4QA 4QMGA 1LO5D 4HJ7A 1B70B 5JOBA 2IX0A 2RF4A 3CCJA 2A74C 1WCMH 3H0GB 2MQHA 4DV5L 3DXJC 3SK4A 2UXBQ 4QUFA 3NTHA 4OONA 3NENA 1Y1WB 3JAMc 1EY5A 3D31A 3M9BA 4EQ5A 1QVGA 4DNTB 2O4XA 4XQNA 2R7ZB 3M7GA 3GTOB 4JYAL 5M5YB 1IBLQ 3KF6B 3G6JB 5FK9C 3BYTB 3NBHB 3DHQA 2L1BA 2CW0D 4DU9A 2XN9C 2EY6A 3PMFA 1A2UA 3W1GA 3PIP3 2L12A 2VXWA 3KBXA 4O2DA 3J80L 2F0HA 4G4KA 3DEPA 2PMZE 1HQRD 1FNWA 2N3SA 1QG7A 3H3VC 4POGA 2MUYA 4DR3Q 2JA8B 2WAQG 4IALA 1WYDA 2ZT9C 2VY3A 1R9TB 1S5CD 1XPOA 1E7ZA 2F0MA 2ZM6L 4NW2A 4R4OA 1A15A 3IL8A 2JA8H 1SMYC 3QG1A 4DK0A 1FJGL 1NMGA 2PZWA 3K0XA 3TS0A 1DONA 1ENCA 3GTQH 1V1QA 2Q2HA 4HIKA 3BVGA 1EQQA 2SNSA 4A93H 3TSSA 2DJGC 4A3DH 1GUNA 1WCMG 4ZUJA 4CKCA 1JOKA 4A3EG 4KTAA 1JWSD 1WTPA 3GTKB 1JE5A 2KOLA 1UWVA 4G7ZC 4JBMA 3B6YA 4GNXC 4ZCKA 1HZCA 1FD7D 2WP8J 5LL6S 4DXFA 2IY5B 4DAYB 4WFN3 3FPUB 1LTTD 3R2TA 2WACA 3PUZA 2X69A 1JORA 2UUAQ 1GVPA 2KEEA 4DFAA 1TKWB 5I9PA 4PG3A 4ZK9B 2GN5A 3VR2A 1JB3A 4JI2L 1CZWA 2KCMA 3LWUA 4P72A 2WIIB 4JI8L 2EYPA 1QCBD 3JAML 1LACA 4A3BB 1F2YA 4K0KQ 4IJHA 4KD4A 1WCMB 3H0GH 3OWFA 3H6MA 4A3EB 1CQVA 3NXWA 3QOJA 4HIOA 4ABNA 4HN7A 1DJRD 1N34L 4JW0A 1KTKA 4OO1H 1F2LA 4RCOA 3D3RA 1YVCA 2F3WA 3Q23A 1K8OA 1I5FA 4CDDC 4LFCL 1OXUA 2QDBA 2XTIA 2JA8G 2I5MX 4JI8Q 2BOSA 4C3IG 4DR1Q 2HCCA 1CHPD 5C0XG 3GTPH 3BVZA 1HNXQ 1Q8IA 3UE1A 4RH6A 4C3JB 2KUMA 1HXYD 1PH3A 4A3BH 1V43A 1VDZA 4KY5A 2K5WA 1IW7C 1HH2P 5M3MB 1DOMA 5AJ3L 4DK1A 5JEAG 3L9AX 3EN2A 4JI5L 3VR4A 2EVBA 2I5HA 3V96A 3E0EA 4FDBA 1CT1D 3CU7A 1ASZA 1L1OC 4JK1C 3T1YQ 2A6ED 2L9HA 3ULLA 4HR7B 5ELEA 2F0WA 2NB0A 3AQQA 4PZ7A 3STBC 5M3FH 1AE3A 1BXTA 3P75A 1I4QA 4CKEA 2WAQE 2R92H 3Q24A 2NTTA 4GN5A 4HJ8A 1VCIA 3GTLH 2H4OA 1PFMA 1XNQQ 1Y1VH 3WOFA 2IHEA 3HKZE 2Q2IA 2KCNA 4RWSC 4IQZA 3CCSA 3IFDA 2HIVA 3HRZC 3TS2A 1YHAA 5C3EB 4LFBL 4J8QA 4IUUA 3MHBA 3HOXH 3K0YA 2A1AA 3LX0A 1E22A 3C46A 4JI4L 1FJGQ 1WTHA 3X3NA 4ZLTF 4A3GH 4QY7A 3CKIB 3VA7A 1E2VA 2A68C 4HIDA 1TIID 4RAUC 1LT3D 1JB7A 1IBMQ 2A68D 3ICEA 2AMCB 1VQLA 1O7LA 4ZQ3A 2IX1A 1N32Q 2BA1A 1L1OA 1T5XD 4BA2I 4IUNA 4BBSH 1SJHD 2M00A 2SNMA 4B3RL 1JJCB 1XMQL 1SYBA 1NTGA 1HHVA 1VQFA 3NK9A 2N88A 1CSQA 2WAQB 3F1ZA 3PIO3 1PYWD 5M3MG 5K36H 2RKSA 3MZ5A 4CKBA 4RFBA 4YHHQ 3HOVB 4L5SA 1SEBD 1I50H 3PO3B 1PH8A 4XT1B 3CCVA 3J7AV 4A3JG 1KD1C 1NR2A 4IOCA 3TP6A 3C3LA 4LAAA 4GOPA 3E3XA 1D7QA 2VS1A 1NMFA 5D65A 1OXXK 2BH8A 4FF2A 5L37A 4RMFA 4GKJL 5ELCA 4L5TA 1VF7A 5IT9E 2HCIA 2CW0C 3RZDB 2Z8LA 3BJUA 3KLRA 3SVMA 1SE8A 2RSOA 1ENAA 1N9WA 3SGIA 2PMZB 4YHHL 1STHA 1GUWA 1KC8C 1YNND 2CHBD 3PUXA 1R9TH 2E74C 2M9VA 4EQOA 3HOYB 2HD3A 1WTXA 3M4OH 2TMPA 5ELNA 3AMUA 4DR5L 1STAA 3IFTA 3KK7A 2NVXH 3EROA 2O5IC 2BDOA 4MHEA 5JEAH 3J80c 1RD9D 1I4GA 3OIQA 2E2HB 3Q22A 4JBKA 1ET6A 3BVMA 2VW9A 4H13C 4HSPA 4JOIA 3OWEB 2F52A 1YNJD 4R4TA 2Z0SA 3TDQA 2G9DA 5IYBG 1K28A 2Z6KA 3F2BA 4TQUS 5I2XA 1S4ZA 2L5TA 3NE5B 4LF7Q 4AH6A 2YU9B 3D4DA 1PH5A 3S24A 3TBIB 1TWAB 3K58A 3ITPA 2JA7B 1GKHA 1U4MA 1H9SB 2SEBD 4I65A 5C4ZA 2UUCQ 4DV7Q 4LF5Q 5M9OA 1YEZA 1Y69U 1HQMC 3PO3G 1HFGA 3VDYA 1B9MA 1U4RA 4A75A 5LMNL 2K5DA 3BS1A 1U4LA 2DJFC 2NZOA 5KYIA 5C4XG 4EGVA 1VQ9A 3CQZB 4IUTA 2RSNA 4LMQD 4XXEA 1U0LA 1K83B 1FVIA 4DR1L 3OTOQ 1GO3E 3D8GA 2MFIA 4IO9A 2XWJB 1TWFB 1DOLA 1SJED 3K5OA 2GA4B 4G7OC 3H3VI 3CPFA 1IYJB 4LF4L 3PQIA 4JI1L 1Q46A 3RMHA 1FNUA 4PZ6A 5IP7H 2CQAA 4YY3Q 2PQAA 2KHJA 2WFWA 2VL6A 4X64Q 3SK6A 1I50B 3I4MB 1LT6D 5GAEC 2R7ZG 2R93G 2HT1A 2EE1A 3QWNA 3FKIG 3AU7A 1JJGA 3CCRA 4Q5VA 2WB1E 1IBLL 3FRPB 5C44B 5IE8A 3JC66 2QKIC 2L15A 2EY2A 4K14A 1SNMA 1NCVA 1MD2D 2NVTH 5M5XB 1KIXA 1MIUA 2UXCL 1SRUA 2CH4W 4A4IA 4EQPA 1MGSA 2XSCA 1PTOD 4DR7Q 5JJIA 3I3CA 4GZYC 3S1NH 1J8IA 3U58A 2F0LA 3TQYA 2F0TA 4PNYA 3T56B 1VQ7A 1F9QA 3KYHC 1ZKOA 2F4VQ 5I6WA 2WB1G 1IBKQ 3LGJA 2ZTEA 4MIUA 4RKLA 3M4YA 1I6HB 3I4MG 2NUCA 1OXVA 2EYHA 3L0OA 4HEDA 4KY7A 2IX3A 1FL0A 3GD7A 4EX5A 2F03A 1LABA 2IHFA 1SE4A 3RR5A 1XMOQ 4Z9CB 1E1TA 1Q7YC 3CCEA 2HUGA 4DR7L 3HKZG 4FF3A 1EQRA 5JVG3 2HHHQ 4QF4A 2AHOB 1R4PB 2K5QA 2WV6D 5EBCA 2D0OA 2LKVA 4OX9Q 1L0YB 5C0XI 1GD7A 1PRTF 1GHJA 4BWGB 1HNXL 2I0QA 4CGYB 3J7YW 2JA9A 3ULJA 1EY0A 1DM0B 5CV6A 3TN2A 4A3JH 1SN8A 2AUJD 4JI7Q 5DAUA 4QGUA 1GUOA 3HZXA 4O42A 3P20A 4M1UB 4C2MH 1PHJA 1BBUA 5IYCH 2E2JH 3FKIB 2R7FA 2AWOA 2E5LQ 3KLWA 4JI6Q 1B9NA 4WORA 3BZKA 4K2LA 1I4HA 4LK1C 4BXXG 1EOVA 4NPSA 2A73B 1QUQB 2Z1CA 3T51B 5EPJA 3JAMi 3I55A 2DY7A 2K32A 2XWBB 5IP9H 4CJ1B 4GOPC 4ULLA 3KJOA 4X64L 1VS0A 1KHIA 4X65Q 2F0GA 1LTLA 1QZGA 3H0GG 2Z6BA 2RHQB 3S2DB 5EQ0A 2VUMB 1E2WA 2F0OA 1R4QB 1N34Q 2JEBI 1STGA 1BR9A 2ASBA 1A3VA 4FYDA 1OXSC 4NXNL 4B3MQ 4GLVB 1C9OA 4LFAQ 4DR6Q 1EY9A 3K6OA 5DNFA 2VB3X 4C3IB 1CTMA 3RZOH 2CFMA 1AEXA 3S1MH 4GN3B 3SEBA 3OMCA 3U9SA 1HNZQ 4ZRZA 4DXGA 4DV3L 3OOCA 1W6JA 4I7AA 1SNDA 3J80E 1UEAB 2KCCA 1CKNB 4GNXB 3PF5A 3KLSA 5IWAL 3F2CA 5FLMH 1K9MC 1HR0L 3CCQA 3KUPA 2YU9H 1PRTD 5COYA 4KLKA 3Q8DA 1HPCA 2B2VC 4P74A 1UEBA 3CC4A 3UDIA 2I46A 3H91A 3J81j 4MTKA 5CC4A 4RA8A 4LJZC 4K6DA 2ICIA 1VQJA 1KRTA 2SDFA 4C3HB 1STNA 1NR4A 5EBDA 1V1PB 4XYQA 1AFPA 1GUTA 1Y8PB 5LL6X 1RKNA 1EIFA 3W5OA 3PO2G 2QILA 3E0JA 1EY6A 2E2JB 3S16B 4FXDA 1WTWA 4TSSA 4DUZQ 2QF7A 3TREA 2VQFQ 1SYEA 4A3FH 2L11A 2F1MA 1VQHA 4O1NA 4DPGA 3PSIA 1AZPA 4NB3A 4LFBQ 3A8KE 3OIPA 2V1CC 4M8AA 3CXCA 1PTOF 1X3QA 5EAYA 3HG9A 4YWLA 4DV6L 1Z7TA 1L1OB 3UDGA 1WOCA 4A3CG 2P5ZX 1KLGD 4C3HG 5J22A 4DV0L 1QZHA 3M3YB 3IKJA 2NTSA 3C2PA 3I4LA 2FINB 4UP9A 3S2DH 2EY5A 1J5EL 3JAME 3MFGA 3QJYA 4IN3A 2JP1A 1D1IA 2PW7A 1YBYA 3DM1A 4KI0A 5CGKA 1EEID 2MGSA 4GOPB 1B2TA 5IYCG 4LF7L 5KIXA 4Q0FA 4ZKCB 3BYYB 4B3TL 2MO0A 2OXPA 4G57A 5EKKA 1ILQA 5C3EH 4LF8L 3NP8A 2VUMH 3ND9A 4V190 1A63A 2Q2TA 2EJMA 3UI2A 2KBNA 1GOZA 4A3KB 3T53B 2RDFA 2K14A 2OEOA 4KY6A 3V05A 2A6HD 2Z6KC 4DGZA 4A3JB 3R93A 2BE5C 4OELB 1PLFA 4YCWA 5EPKA 4NXML 1BVSA 1D5XC 3NQTA 1M1KC 2F4IA 3HOUB 1D5MC 2XGTA 1X3EA 4R8IA 3STBD 3MAQA 3UDFA 5IGFA 1JOQA 2JJQA 1PA6A 5ELFA 3R2IA 4A3IG 5JJKA 3J81L 3I4NH 4DAVA 4IFDI 1RODA 2A6HC 3S15B 1W3SA 1KRSA 5TSSA 1CI3M 2VNUD 5J1ZA 5M5WB 4IOAA 4XQQA 3HS0C 3URYA 3J7A5 2EZVA 1EOTA 4B9XA 3IRBA 4GKJQ 3T13A 1I6HH 1PTOB 4DR2Q 1G91A 1BCPB 3S1RH 2VQEQ 4BBRH 1XPUA 5JJLA 1EYCA 3FHWA 1A6XA 4J6HA 2Y0SG 1PTOH 1DZ1A 4N9TA 4CDFC 3HGBA 2IPKD 2WKDA 2ZXRA 2UXDQ 2F0VA 3VA5A 2LFNA 1K83H 4A3IB 4RGNA 4YIJA 5C3WA 4HJ9A 2FFKB 3NPPA 1VMPA 1HTLD 2TSSA 2F0DA 2PI2E 1PH2A 4KMUC 2C9OA 4OIKA 1S5ED 1KAAA 4K8IA 1PH9A 3PIPA 1NE3A 3HOUH 3ER0A 3TZUA 3OW7A 4R4CA 4H02A 3M4PA 2PCFB 1JR0D 3G4SA 4GN4B 4LF5L 1E3PA 4XIGS 3FEWX 5AJ3Q 2N78A 1SAPA 1DOKA 4KHZA 2AWNA 1TXYA 4A3KH 4FO2A 3I4NG 1X65A 2A19A 3M85A 2OTJA 3LWEA 3GTQB 4J15A 4RKBA 2ES2A 5J39A 2OWOA 1SNPA 2PNHA 3BDOA 4DUYQ 2ATWA 2D62A 4PMCA 4K5WA 2B29A 3D4RA 2JA6G 2N49A 5K36G 5IODA 4BS9A 2KEDA 2A8VA 5FLXL 3HOVG 1SYFA 2Q8TA 1EZ8A 3G48A 3VR5A 4IUQA 4KD3A 5FLMG 1VQBA 2OQKA 4B9WA 3ULPA 3SR1A 1LTBD 1EL0A 1Q1EA 4JI1Q 5GQOA 3S9WA 4EVOA 2OT2A 1Y14B 3A7LA 4NMZA 3I4NB 2JYOA 4UAIA 3S14H 1ET9A 1Y8NB 2D5DA 3CC7A 4R1JA 2E76C 3S1MB 1IHZA 4DK6C 4DR2L 1UUPA 1EYAA 4A93G 3GTGH 4DV2L 3CMEA 4LF9Q 1W6KA 2EYLA 1N33Q 4OO1I 1XNRQ 2V4DA 1RF2D 4QIWE 5A2QE 1JQYD 1UE5A 1X6OA 2MPMA 2E2IB 4DV1L 3A8JE 4YCVA 2K1BA 2EQSA 1M4VA 5JPMC 4DNRB 2DY8A 1PZID 1RCVD 5M5YH 1RHPA 4L6TB 3CD6A 1UE6A 1EWHA 1CHQD 3CCMA 1X54A 1JWUD 2E5LL 1C7YA 2HDLA 3K57A 3FKIH 2AQ2B 4WJ3M 5EKLA 1X3FA 5NUCA 2PO4A 4HJAA 4ILWA 4A3LG 1XNRL 1N36Q 5KNCA 5IYDG 2FJ2A 4IUVA 1C4QA 2B39A 3NHHA 2JA6B 2YV5A 4APVA 2H1EA 3PUWA 1CKMA 1ASYA 2B63G 2EOTA 2LS01 5HGQA 4IFDH 2JA7G 1KLUD 5D14A 3GO5A 4OX9L 1N8RC 1PMRA 4YWKA 4MTNA 2ID0A 1EEFD 3O13A 2UUAL 1BCPD 4JI3L 1HA6A 3A55A 1UAPA 2UUBQ 1U5KA 3NBHA 2GVAA 4JI4Q 1AH9A 4DN4M 4AQYQ 2ZTCA 1T5EA 4DR5Q 1EY8A 1GUSA 1SLJA 1YJ9A 1PH1A 3I4OA 3GTLB 4K0KL 1K8GA 1HUNA 1C0AA 1VQIA 2K6AA 3SDZA 3K5LA 4PMBA 1XNQL 4TRDA 1EWIA 2IT1A 4KHVA 1NJIC 4X3SA 1GHKA 2HQEA 2PQAB 4IFDG 1H9KA 1HNWL 2EXZA 1VQNA 1PVOA 4Y52H 1JMCA 2EYOA 1B8AA 1I4RA 1M90C 3SXHA 4DA2A 1ZYRC 3N52A 3M7NA 2NVTB 4B3SL 2KHIA 5KNDA 4NDXA 2MP1A 1SE2A 4C1NI 4QB4A 1DCZA 3S14B 1ZEQX 1CFMA 2AQ3B 2VB2X 3I90A 4JOIC 3U9OA 5I9OA 1CA6A 4JV5L 1V1PA 2XNAC 4AIMA 1YNJC 1HNWQ 1PH4A 3MTSA 5LMNQ 3NQIA 1HTPA 1SE3A 5IP9G 2K01A 3WOEA 2CH4A 3KF8B 4DV4L 2YTYA 3I56A 2K5HA 2NVYB 1ML0D 3W1BA 1MI2A 3FP9A 4R4QA 2BA0A 3MWYW 1ENFA 3NWSA 4X3KA 4AQYL 1HR0W 1NSNS 4ALPA 1M8AA 3MEFA 1E1OA 1Q90A 3I8ZA 5C5MA 3GTMH 1HZ9A 5IWAQ 4GKKQ 2G9HD 1SYDA 3SHLA 3S2HB 5C4XH 2YTXA 1VQ5A 3MXGA 4UPAA 4IFDJ 4XQJA 3PO2H 3F2DA 5C4JH 2ICEC 2QA4A 3HOWH 1O80A 1PFSA 5IGDA 4DUYL 1IYVA 1PRTC 4ZUIA 5JVH3 3MXNB 2R3ZA 3TP5A 3HKSA 3PCOB 5D3IB 1D2BA 1HZAA 1AP0A 2PYKA 1YIJA 4N8X1 4DF7A 5BN3A 4L5RC 2UUCL 4CJ2C 4OO1G 1CKOA 1WD1A 3K59A 3PUVA 3AYHB 4ODGA 4BY7H 2SOBA 4A3IH 3P7JA 2F0IA 4KK7A 3KFUA 1SDFA 1Y8OB 4H7BA 5A35A 3RN2A 1TS3A 1XMQQ 1SSOA 4FXGC 1K73C 4RGMA 4KHPQ 1CA5A 1TS5A 4JI3Q 4JI0L 1WTQA 5DM73 4OEMB 4RHSA 1YJWA 1K8MA 2FMCA 5G3LD 2JK8A 1E2ZA 4H44C 4PV1C 3H3VH 1II3A 2VUMG 1TS2A 5HURA 1O78A 5DEHA 1CQFA 5C44G 1XMOL 2E75C 1XTCD 5M5WH 4IPCA 2ZJRA 1A3UA 1GJXA 4B3ML 4NXNQ 3S2HH 1I6VC 3DWAA 5CV8A 5KYLA 1VQAA 4BY7G 3AB9A 1UE1A 2L0CA 2B63B 2KECA 1K3RA 3MXPA 3GTPB 4DAMA 3FMCA 4DV3Q 1IKMA 1IZ6A 2NVYH 4N8FA 5C0XH 1A62A 5HY6A 5FO7B 1GM5A 1OXTA 2WB1B 1TWAH 3ZYYX 2K4KA 1HR0Q 3KF6A 4C56C 3AFPA 1V8QA 3VYUA 5I2YA 2I07B 5IGCA 1JJ2A 2DNEA 2LSSA 3NTIA 4QCLA 4DR4Q 2HDMA 5CV5A 3BU2A 1ONLA 2Q8RE 2PI2A 3HOXG 3CF5A 1BOSA 3VYTA 4JPBW
chains in the Genus database with same CATH topology
4DV0L 5IT9c 1QZHA 1X55A 3HOZG 2I5MX 4JI8Q 2ZJQA 3EBEA 4UP9A 3S2DH 5M3FG 4DR1Q 4A3MG 4P75A 1J5EL 5JEAJ 1A8VA 4KI0A 1YBYA 2EXDA 5C0XG 3GTPH 1TWCH 2HQLA 4A3LH 1SFOH 4GOPB 5IYCG 4LF7L 4A3EH 3A5ZB 1HNXQ 1I94L 3UE1A 4JI0Q 3L7ZC 2OCEA 4BBSG 1L0WA 1PH3A 4B3TL 1CUKA 2MO0A 1MJCA 5GROA 5C3EH 4LF8L 1V43A 2VUMH 4A3BH 4DR4L 1HH2P 1YI2A 2K5VA 4BXXH 3UDXA 1A63A 2Q2TA 5AJ3L 3TRZA 2ATWA 4GLAC 4LNQA 5JEAG 2KBNA 4UP8A 1EIYB 3HOWG 4X62L 1LYLA 2K14A 3EN2A 4JI5L 1HZBA 4DK3C 4QQBX 2JQOA 2Z6KC 2I5HA 1VQOA 2MNAA 4LUOA 3E0EA 4FDBA 4XTCS 1LUZA 1P8LA 4C3HH 4NXML 1ASZA 4YCWA 1L1OC 1X3GA 4POFA 1BVSA 1WJJA 1YHQA 3T1YQ 3NELA 4JI2Q 3PV0A 3S16H 3ULLA 4JBJA 2R7ZH 3AQQA 3STBC 4PZ7A 5M3FH 2XGTA 1M1KC 1X3EA 3KDFB 1AE3A 1J5EQ 4B3SQ 3STBD 1QVFA 2WAQE 2R92H 2QGQA 3UDFA 4GN5A 1Z47A 3RN5A 3CCUA 2JJQA 5FLXc 3CP0A 4HJ8A 1VCIA 3T1YL 1PA6A 4LF9L 1WFQA 4JC0A 4A3IG 3GTLH 1XNQQ 3PF4A 5JJKA 4IFDI 3F8TA 3I4NH 4L5QA 1Y1VH 4LFCQ 2B3GA 1W3SA 4A3BG 4DV0Q 1KRSA 4MZ9A 1HJPA 2JEAI 2IHEA 2YYZA 2Q2IA 3HKZE 3I2ZA 3CCSA 2VNUD 1G6PA 2MO1A 2HIVA 4IOAA 3U4ZA 5H1SE 1YHAA 3J7A5 3TS2A 4LFBL 4X66L 5FJ8H 3HOXH 4OWWB 2RCNA 3L2PA 2A1AA 3IRBA 4GKJQ 1E22A 1XTDA 2ZJPA 1Z9FA 4Y7NH 3J7ZC 4JI4L 4X65L 1I6HH 1VQPA 1QUQA 4DR2Q 1FJGQ 3S1RH 2VQEQ 4BBRH 3GDEA 4QY7A 4DUZL 2UU9L 5BR8L 4HIDA 1XPUA 4A3GH 3FHWA 5JJLA 1JB7A 1IBMQ 2Y0SG 2QEXA 3K7UC 1N33L 3AFQA 2KCTA 2JA8G 3CC2A 4P71A 3ICEA 4DR3L 2AMCB 4LFAL 1V9PA 1EFWA 1VQLA 4DR6L 2IX1A 1N32Q 3AEVA 2BA1A 4OWTB 1L1OA 2CCZA 2UXDQ 4BA2I 4LF6Q 4BBSH 1KL9A 4IPHA 1K83H 3UE0A 1I94Q 4B3RL 4HJ9A 1JJCB 1XMQL 1NTGA 4DV6Q 3RLOA 1VQFA 2PI2E 4BA1I 5DLQE 1CSQA 1PH2A 2B63H 3F1ZA 4DV2Q 3CAMA 5M3MG 4B3RQ 4DV5Q 1PH9A 3PIPA 4YHHQ 1NE3A 4L5SA 3HOUH 4WJ4A 3ER0A 1E24A 2R6GA 3GTOH 3T1HL 1TWHH 1I50H 4R4CA 4H02A 2E2IH 3RLFA 5BR8Q 3M4PA 5J3BA 1PH8A 2H5XA 3EIVA 3G4SA 3CCVA 4A3JG 1KD1C 1IBKL 4GN4B 4IOCA 3I7FA 4LF5L 5GAHC 1E3PA 2R93H 1VQCA 4HJ5A 2AKWB 4XIGS 1S40A 4GOPA 1D7QA 2VS1A 5AJ3Q 1NMFA 2N78A 4KHZA 2AWNA 1OXXK 1TXYA 2BH8A 2NN6I 4LUVA 4MNOA 4ME3A 4RMFA 4A3KH 3I4NG 1X65A 2JA5H 2A19A 3M85A 4GKJL 1SR3A 1OTCA 1VQ6A 1PYSB 4L5TA 2OTJA 3J81i 4BY1G 3PGZA 1X56A 4J15A 2C35B 2ES2A 2OWOA 3HFZB 3BJUA 1SE8A 2PNHA 4DUYQ 1YNXA 1N9WA 3SGIA 5IY0A 1G51A 2D62A 5FJ8G 4YHHL 1Y1WG 2B29A 3PUXA 1KC8C 2N49A 2JA6G 1EUJA 1R9TH 5K36G 1N36L 1IXRA 3M4OH 4PZ8A 4DNIA 2A8VA 3HOVG 5ELNA 5C3EG 5C0XJ 4DR5L 3G48A 3PIOA 3H15A 4AYBG 2NVXH 5FLMG 1VQBA 1I3QH 2OQKA 3E9IA 2Y0SE 3J80c 1A0IA 3ULPA 1QVCA 1Q1EA 4JCVE 1YHBA 4JI1Q 5GQOA 3A0JA 4YY3L 4JBKA 1BKBA 3CQZH 4A76A 5IP7G 1Y14B 2VW9A 4GKKL 1NY4A 1H95A 2CKZB 3M3YH 1Q12A 3DM3A 4JOIA 3S14H 2F52A 2UXBL 1CSPA 3CC7A 4R1JA 4R4TA 4DK6C 3A5UA 1FGUA 4DR2L 2Z0SA 1B7YB 3PUYA 2RHSB 4P73A 2ALYB 5IYBG 4A93G 3GTGH 4DV2L 3CMEA 2Z6KA 4AYBE 3F2BA 1DGSA 4TQUS 4LF9Q 3S15H 5ELOA 2I5LX 3K80C 1N33Q 4OO1I 2OQ0A 4AH6A 4LF7Q 1XNRQ 1XPRA 4QIWE 1PH5A 1UE5A 1X6OA 3S24A 1VQGA 5LMUQ 2UXCQ 3S1QH 4LF6L 1GKHA 1J6QA 4DV1L 2UUCQ 1WI5A 4YCVA 4DV7Q 1MJEA 4LF5Q 2EQSA 1YEZA 2NN6G 2K75A 3ZJYC 3CW2C 1YITA 3VDYA 3PO3G 5M5YH 1K8AC 1T9HA 5GADC 4A75A 5LMNL 3CD6A 4LUZA 2VZAA 4DV7L 3J80i 1UE6A 2UU9Q 4BY1H 5GAGC 1X9NA 4C3JH 4A3GG 2NZOA 3CCMA 4JYAQ 1X54A 1IL2A 1D8LA 5C4XG 2E5LL 3BZCA 1VQ9A 1C7YA 1RL2A 2KENA 1U0LA 2BH2A 1CKNA 4GNXA 3FKIH 4WJ3M 4KHPL 5IYBH 2LXJA 2VQFL 1FVIA 2CWPA 3ERSX 1TWFH 1X3FA 1VQMA 4HJAA 2NVQH 4DR1L 3OTOQ 4A3LG 1GO3E 1XNRL 4A3FG 1N36Q 3S17H 5IYDG 3KDFA 2MFIA 4IO9A 2YV5A 3HOYG 1KAWA 2D0PA 4APVA 4OXPA 3PUWA 4LW1A 1CKMA 1PH6A 1ASYA 1VQKA 2B63G 5HGQA 2HHHL 2JA7G 3GO5A 2ZTDA 1N8RC 4OX9L 3CPFA 1IYJB 3H3VI 4YCUA 4YWKA 4MTNA 4LF4L 2ID0A 4JI1L 1Q46A 1IBML 2UUAL 4DV4Q 4JI3L 4X6AH 4PZ6A 5IP7H 4YY3Q 2UUBQ 1U5KA 2JE6I 2OTLA 4DKAC 2GVAA 1BBWA 3A74A 2PQAA 4JI4Q 2KHJA 2WFWA 1XJVA 2VL6A 2K52A 3HOZH 4IPGA 1AH9A 4C3IH 4X64Q 4AQYQ 2ZTCA 4JI7L 2EIFA 5GAEC 3I4MH 2R7ZG 3D0FA 4DR5Q 1SLJA 1PH1A 1YJ9A 2HT1A 2R93G 2HIXA 1W2BA 3FKIG 3OW2A 3I4OA 3OTOL 1JJGA 3RLNA 3CCRA 1YZ6A 1K8GA 4K0KL 3T1HQ 2WB1E 3RNUA 1IBLL 1Q82C 4A3DG 1C0AA 5IE8A 3K8AA 1VQIA 3JC66 4UP7A 4B3TQ 4LF8Q 4QL5A 2L15A 2UXDL 1SROA 3G6EA 5IYDH 1XNQL 4TVAB 2NVTH 4DR7L 3WWVA 1EWIA 1KIXA 1MIUA 2IT1A 1NJIC 2UXCL 1SRUA 4A4IA 2Q2UA 2CWAA 2PQAB 1L2FA 5LMNW 3CCLA 4LF4Q 4DR7Q 4IFDG 1HNWL 5JJIA 1VQNA 2JA6H 3S1NH 1PVOA 4Y52H 1JMCA 1LM0A 3U58A 3TQYA 1HNWQ 1B8AA 1M90C 1O7IA 1VQ7A 3KYHC 2NZHA 2F4VQ 1KXLA 4JBWA 3U4VA 2WB1G 3KJPA 3M7NA 1IBKQ 4HIMA 3LGJA 1SMXA 2ZTEA 4B3SL 2KHIA 3I4MG 1OXVA 3L0OA 4PMWA 2VQEL 4JV5Q 1FL0A 3GD7A 3CPWA 2F4VL 4EX5A 1EYGA 3GTKH 3RZDH 1VQ4A 2IHFA 3RR5A 3CMAA 1Y1VG 1RIPA 1XMOQ 1P16A 2E8GA 4JOIC 2UUBL 2E2HH 3HOYH 4JV5L 3TEHB 1E1TA 4O0AA 4AIMA 1Q7YC 3CCEA 1HNZL 4YWMA 4IJLA 3HKZG 3U50C 4LWCA 4IPDA 5LMNQ 1EQRA 1PH4A 4JI6L 1PH7A 2JA7H 4R4IA 2HHHQ 3M4QA 5IP9G 4HJ7A 2AHOB 1B70B 2D0OA 2IX0A 2RF4A 3CCJA 4OX9Q 5C0XI 1WCMH 1GD7A 2MQHA 4DV5L 3KF8B 2UXBQ 5LMUL 4DV4L 2YTYA 1HNXL 3I56A 2I0QA 2K5HA 3W1BA 2JA9A 2F3IA 3ULJA 1PV4A 3FP9A 4R4QA 4GS3A 4OONA 3NENA 2BA0A 3JAMc 4A3JH 1SN8A 3D31A 3M9BA 3OYYA 1HR0W 1Q8KA 4QGUA 4AQYL 4ALPA 4EQ5A 2GVBA 1QVGA 3PO3H 1N32L 3MEFA 1NBWA 4C2MH 1E1OA 4RG1A 1PHJA 3GTMH 1BBUA 1HZ9A 5IYCH 5IWAQ 4A3KG 2E2JH 4GKKQ 4JYAL 1IBLQ 3KF6B 2R7FA 2AWOA 3NBHB 3KLWA 5C4XH 2E5LQ 2N8NA 2YTXA 4JI6Q 1VQ5A 4UPAA 4IFDJ 3BZKA 4BXXG 3K7AH 1EOVA 4NPSA 1QUQB 3JAMi 3DLLA 3F2DA 5C4JH 4UY8C 3PO2H 3I55A 2QA4A 3HOWH 5IP9H 4GOPC 1Y1WH 1VQDA 3KJOA 1PFSA 3W1GA 4DUYL 4X64L 1VS0A 1KHIA 3E9HA 4JG2A 1LTLA 4X65Q 1QZGA 1KQSA 3HOUG 4O2DA 1K0RA 3H0GG 3MXNB 2RHQB 3HKSA 3PCOB 2PMZE 1HZAA 2N3SA 2DGYA 1YIJA 5C44H 4GLXA 1N34Q 1VQ8A 2JEBI 4L5RC 2ASBA 4POGA 4DV1Q 2UUCL 4DR3Q 1OXSC 1CKOA 4OO1G 2WAQG 4NXNL 4B3MQ 4GLVB 3PUVA 2R92G 3AYHB 1C9OA 5E7NA 1WYDA 3KOJA 2VY3A 4LFAQ 4BY7H 1PYBA 4DR6Q 2JA5G 1XPOA 4A3CG 1E7ZA 4A3IH 2ZM6L 4JI7Q 4R4OA 3KFUA 2JA8H 3RZOH 2CFMA 3S1MH 4JI5Q 4GN3B 3RN2A 2YTVA 1XMQQ 1NMGA 1K73C 1HNZQ 3TS0A 3K0XA 1FJGL 3GTQH 4DV3L 1V1QA 4KHPQ 2Q2HA 4A3MH 4HIKA 1EQQA 4JI3Q 4A93H 4JI0L 4NXMQ 4A3DH 1WCMG 4X66Q 1Q81C 4A3EG 3HOVH 1YJWA 1CKNB 4GNXB 2JK8A 5IWAL 3PF5A 3F2CA 5FLMH 1K9MC 1HR0L 1JE5A 1Q86C 3H3VH 1Q1BA 1UWVA 4JBMA 2VUMG 3B6YA 4BBRG 3CCQA 4GNXC 1AE2A 1HZCA 2YU9H 2R7DA 4KLKA 3Q8DA 2WP8J 4P74A 1UEBA 5C44G 2LXKA 4QJFA 3UDIA 1XMOL 3CC4A 2IY5B 1JT8A 4DAYB 4IPCA 5M5WH 3J81j 2ZJRA 4B3ML 4NXNQ 1VQEA 3S2HH 1VQJA 2DUDA 1KRTA 1VQAA 3PUZA 4BY7G 2UUAQ 4A3CH 1GVPA 1S72A 4PG3A 1UE1A 2GN5A 1K3RA 4JI2L 1EIFA 1YJNA 2KCMA 4DAMA 4DV3Q 3W5OA 2FXQA 2K50A 3PO2G 4P72A 4JI8L 1IZ6A 2NVYH 1A62A 5HY6A 5M3MH 5M5XH 4DUZQ 1TWGH 2K5NA 3TREA 2VQFQ 4IJHA 1GM5A 1OXTA 4K0KQ 3H0GH 1TWAH 2K4KA 4A3FH 1HR0Q 3KF6A 1VQHA 3AFPA 4DPGA 3G71A 3PSIA 3J81c 4HIOA 3NEMA 1MKHA 1G291 1JJ2A 2LSSA 4NB3A 4LFBQ 4DR4Q 3GTJH 1N34L 2V1CC 3BU2A 3CXCA 5EAYA 1YVCA 4OWXB 2PI2A 4YWLA 3HOXG 3CF5A 4DV6L 1UE7A 2CQOA 1L1OB 1I5FA 4X62Q 3UDGA 1S3OA 1OXUA 4LFCL 3K81C 1WOCA 2XTIA 2ZM6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 L;  5IT9 c;  1QZH A;  1X55 A;  3HOZ G;  2I5M X;  4JI8 Q;  2ZJQ A;  3EBE A;  4UP9 A;  3S2D H;  5M3F G;  4DR1 Q;  4A3M G;  4P75 A;  1J5E L;  5JEA J;  1A8V A;  4KI0 A;  1YBY A;  2EXD A;  5C0X G;  3GTP H;  1TWC H;  2HQL A;  4A3L H;  1SFO H;  4GOP B;  5IYC G;  4LF7 L;  4A3E H;  3A5Z B;  1HNX Q;  1I94 L;  3UE1 A;  4JI0 Q;  3L7Z C;  2OCE A;  4BBS G;  1L0W A;  1PH3 A;  4B3T L;  1CUK A;  2MO0 A;  1MJC A;  5GRO A;  5C3E H;  4LF8 L;  1V43 A;  2VUM H;  4A3B H;  4DR4 L;  1HH2 P;  1YI2 A;  2K5V A;  4BXX H;  3UDX A;  1A63 A;  2Q2T A;  5AJ3 L;  3TRZ A;  2ATW A;  4GLA C;  4LNQ A;  5JEA G;  2KBN A;  4UP8 A;  1EIY B;  3HOW G;  4X62 L;  1LYL A;  2K14 A;  3EN2 A;  4JI5 L;  1HZB A;  4DK3 C;  4QQB X;  2JQO A;  2Z6K C;  2I5H A;  1VQO A;  2MNA A;  4LUO A;  3E0E A;  4FDB A;  4XTC S;  1LUZ A;  1P8L A;  4C3H H;  4NXM L;  1ASZ A;  4YCW A;  1L1O C;  1X3G A;  4POF A;  1BVS A;  1WJJ A;  1YHQ A;  3T1Y Q;  3NEL A;  4JI2 Q;  3PV0 A;  3S16 H;  3ULL A;  4JBJ A;  2R7Z H;  3AQQ A;  3STB C;  4PZ7 A;  5M3F H;  2XGT A;  1M1K C;  1X3E A;  3KDF B;  1AE3 A;  1J5E Q;  4B3S Q;  3STB D;  1QVF A;  2WAQ E;  2R92 H;  2QGQ A;  3UDF A;  4GN5 A;  1Z47 A;  3RN5 A;  3CCU A;  2JJQ A;  5FLX c;  3CP0 A;  4HJ8 A;  1VCI A;  3T1Y L;  1PA6 A;  4LF9 L;  1WFQ A;  4JC0 A;  4A3I G;  3GTL H;  1XNQ Q;  3PF4 A;  5JJK A;  4IFD I;  3F8T A;  3I4N H;  4L5Q A;  1Y1V H;  4LFC Q;  2B3G A;  1W3S A;  4A3B G;  4DV0 Q;  1KRS A;  4MZ9 A;  1HJP A;  2JEA I;  2IHE A;  2YYZ A;  2Q2I A;  3HKZ E;  3I2Z A;  3CCS A;  2VNU D;  1G6P A;  2MO1 A;  2HIV A;  4IOA A;  3U4Z A;  5H1S E;  1YHA A;  3J7A 5;  3TS2 A;  4LFB L;  4X66 L;  5FJ8 H;  3HOX H;  4OWW B;  2RCN A;  3L2P A;  2A1A A;  3IRB A;  4GKJ Q;  1E22 A;  1XTD A;  2ZJP A;  1Z9F A;  4Y7N H;  3J7Z C;  4JI4 L;  4X65 L;  1I6H H;  1VQP A;  1QUQ A;  4DR2 Q;  1FJG Q;  3S1R H;  2VQE Q;  4BBR H;  3GDE A;  4QY7 A;  4DUZ L;  2UU9 L;  5BR8 L;  4HID A;  1XPU A;  4A3G H;  3FHW A;  5JJL A;  1JB7 A;  1IBM Q;  2Y0S G;  2QEX A;  3K7U C;  1N33 L;  3AFQ A;  2KCT A;  2JA8 G;  3CC2 A;  4P71 A;  3ICE A;  4DR3 L;  2AMC B;  4LFA L;  1V9P A;  1EFW A;  1VQL A;  4DR6 L;  2IX1 A;  1N32 Q;  3AEV A;  2BA1 A;  4OWT B;  1L1O A;  2CCZ A;  2UXD Q;  4BA2 I;  4LF6 Q;  4BBS H;  1KL9 A;  4IPH A;  1K83 H;  3UE0 A;  1I94 Q;  4B3R L;  4HJ9 A;  1JJC B;  1XMQ L;  1NTG A;  4DV6 Q;  3RLO A;  1VQF A;  2PI2 E;  4BA1 I;  5DLQ E;  1CSQ A;  1PH2 A;  2B63 H;  3F1Z A;  4DV2 Q;  3CAM A;  5M3M G;  4B3R Q;  4DV5 Q;  1PH9 A;  3PIP A;  4YHH Q;  1NE3 A;  4L5S A;  3HOU H;  4WJ4 A;  3ER0 A;  1E24 A;  2R6G A;  3GTO H;  3T1H L;  1TWH H;  1I50 H;  4R4C A;  4H02 A;  2E2I H;  3RLF A;  5BR8 Q;  3M4P A;  5J3B A;  1PH8 A;  2H5X A;  3EIV A;  3G4S A;  3CCV A;  4A3J G;  1KD1 C;  1IBK L;  4GN4 B;  4IOC A;  3I7F A;  4LF5 L;  5GAH C;  1E3P A;  2R93 H;  1VQC A;  4HJ5 A;  2AKW B;  4XIG S;  1S40 A;  4GOP A;  1D7Q A;  2VS1 A;  5AJ3 Q;  1NMF A;  2N78 A;  4KHZ A;  2AWN A;  1OXX K;  1TXY A;  2BH8 A;  2NN6 I;  4LUV A;  4MNO A;  4ME3 A;  4RMF A;  4A3K H;  3I4N G;  1X65 A;  2JA5 H;  2A19 A;  3M85 A;  4GKJ L;  1SR3 A;  1OTC A;  1VQ6 A;  1PYS B;  4L5T A;  2OTJ A;  3J81 i;  4BY1 G;  3PGZ A;  1X56 A;  4J15 A;  2C35 B;  2ES2 A;  2OWO A;  3HFZ B;  3BJU A;  1SE8 A;  2PNH A;  4DUY Q;  1YNX A;  1N9W A;  3SGI A;  5IY0 A;  1G51 A;  2D62 A;  5FJ8 G;  4YHH L;  1Y1W G;  2B29 A;  3PUX A;  1KC8 C;  2N49 A;  2JA6 G;  1EUJ A;  1R9T H;  5K36 G;  1N36 L;  1IXR A;  3M4O H;  4PZ8 A;  4DNI A;  2A8V A;  3HOV G;  5ELN A;  5C3E G;  5C0X J;  4DR5 L;  3G48 A;  3PIO A;  3H15 A;  4AYB G;  2NVX H;  5FLM G;  1VQB A;  1I3Q H;  2OQK A;  3E9I A;  2Y0S E;  3J80 c;  1A0I A;  3ULP A;  1QVC A;  1Q1E A;  4JCV E;  1YHB A;  4JI1 Q;  5GQO A;  3A0J A;  4YY3 L;  4JBK A;  1BKB A;  3CQZ H;  4A76 A;  5IP7 G;  1Y14 B;  2VW9 A;  4GKK L;  1NY4 A;  1H95 A;  2CKZ B;  3M3Y H;  1Q12 A;  3DM3 A;  4JOI A;  3S14 H;  2F52 A;  2UXB L;  1CSP A;  3CC7 A;  4R1J A;  4R4T A;  4DK6 C;  3A5U A;  1FGU A;  4DR2 L;  2Z0S A;  1B7Y B;  3PUY A;  2RHS B;  4P73 A;  2ALY B;  5IYB G;  4A93 G;  3GTG H;  4DV2 L;  3CME A;  2Z6K A;  4AYB E;  3F2B A;  1DGS A;  4TQU S;  4LF9 Q;  3S15 H;  5ELO A;  2I5L X;  3K80 C;  1N33 Q;  4OO1 I;  2OQ0 A;  4AH6 A;  4LF7 Q;  1XNR Q;  1XPR A;  4QIW E;  1PH5 A;  1UE5 A;  1X6O A;  3S24 A;  1VQG A;  5LMU Q;  2UXC Q;  3S1Q H;  4LF6 L;  1GKH A;  1J6Q A;  4DV1 L;  2UUC Q;  1WI5 A;  4YCV A;  4DV7 Q;  1MJE A;  4LF5 Q;  2EQS A;  1YEZ A;  2NN6 G;  2K75 A;  3ZJY C;  3CW2 C;  1YIT A;  3VDY A;  3PO3 G;  5M5Y H;  1K8A C;  1T9H A;  5GAD C;  4A75 A;  5LMN L;  3CD6 A;  4LUZ A;  2VZA A;  4DV7 L;  3J80 i;  1UE6 A;  2UU9 Q;  4BY1 H;  5GAG C;  1X9N A;  4C3J H;  4A3G G;  2NZO A;  3CCM A;  4JYA Q;  1X54 A;  1IL2 A;  1D8L A;  5C4X G;  2E5L L;  3BZC A;  1VQ9 A;  1C7Y A;  1RL2 A;  2KEN A;  1U0L A;  2BH2 A;  1CKN A;  4GNX A;  3FKI H;  4WJ3 M;  4KHP L;  5IYB H;  2LXJ A;  2VQF L;  1FVI A;  2CWP A;  3ERS X;  1TWF H;  1X3F A;  1VQM A;  4HJA A;  2NVQ H;  4DR1 L;  3OTO Q;  4A3L G;  1GO3 E;  1XNR L;  4A3F G;  1N36 Q;  3S17 H;  5IYD G;  3KDF A;  2MFI A;  4IO9 A;  2YV5 A;  3HOY G;  1KAW A;  2D0P A;  4APV A;  4OXP A;  3PUW A;  4LW1 A;  1CKM A;  1PH6 A;  1ASY A;  1VQK A;  2B63 G;  5HGQ A;  2HHH L;  2JA7 G;  3GO5 A;  2ZTD A;  1N8R C;  4OX9 L;  3CPF A;  1IYJ B;  3H3V I;  4YCU A;  4YWK A;  4MTN A;  4LF4 L;  2ID0 A;  4JI1 L;  1Q46 A;  1IBM L;  2UUA L;  4DV4 Q;  4JI3 L;  4X6A H;  4PZ6 A;  5IP7 H;  4YY3 Q;  2UUB Q;  1U5K A;  2JE6 I;  2OTL A;  4DKA C;  2GVA A;  1BBW A;  3A74 A;  2PQA A;  4JI4 Q;  2KHJ A;  2WFW A;  1XJV A;  2VL6 A;  2K52 A;  3HOZ H;  4IPG A;  1AH9 A;  4C3I H;  4X64 Q;  4AQY Q;  2ZTC A;  4JI7 L;  2EIF A;  5GAE C;  3I4M H;  2R7Z G;  3D0F A;  4DR5 Q;  1SLJ A;  1PH1 A;  1YJ9 A;  2HT1 A;  2R93 G;  2HIX A;  1W2B A;  3FKI G;  3OW2 A;  3I4O A;  3OTO L;  1JJG A;  3RLN A;  3CCR A;  1YZ6 A;  1K8G A;  4K0K L;  3T1H Q;  2WB1 E;  3RNU A;  1IBL L;  1Q82 C;  4A3D G;  1C0A A;  5IE8 A;  3K8A A;  1VQI A;  3JC6 6;  4UP7 A;  4B3T Q;  4LF8 Q;  4QL5 A;  2L15 A;  2UXD L;  1SRO A;  3G6E A;  5IYD H;  1XNQ L;  4TVA B;  2NVT H;  4DR7 L;  3WWV A;  1EWI A;  1KIX A;  1MIU A;  2IT1 A;  1NJI C;  2UXC L;  1SRU A;  4A4I A;  2Q2U A;  2CWA A;  2PQA B;  1L2F A;  5LMN W;  3CCL A;  4LF4 Q;  4DR7 Q;  4IFD G;  1HNW L;  5JJI A;  1VQN A;  2JA6 H;  3S1N H;  1PVO A;  4Y52 H;  1JMC A;  1LM0 A;  3U58 A;  3TQY A;  1HNW Q;  1B8A A;  1M90 C;  1O7I A;  1VQ7 A;  3KYH C;  2NZH A;  2F4V Q;  1KXL A;  4JBW A;  3U4V A;  2WB1 G;  3KJP A;  3M7N A;  1IBK Q;  4HIM A;  3LGJ A;  1SMX A;  2ZTE A;  4B3S L;  2KHI A;  3I4M G;  1OXV A;  3L0O A;  4PMW A;  2VQE L;  4JV5 Q;  1FL0 A;  3GD7 A;  3CPW A;  2F4V L;  4EX5 A;  1EYG A;  3GTK H;  3RZD H;  1VQ4 A;  2IHF A;  3RR5 A;  3CMA A;  1Y1V G;  1RIP A;  1XMO Q;  1P16 A;  2E8G A;  4JOI C;  2UUB L;  2E2H H;  3HOY H;  4JV5 L;  3TEH B;  1E1T A;  4O0A A;  4AIM A;  1Q7Y C;  3CCE A;  1HNZ L;  4YWM A;  4IJL A;  3HKZ G;  3U50 C;  4LWC A;  4IPD A;  5LMN Q;  1EQR A;  1PH4 A;  4JI6 L;  1PH7 A;  2JA7 H;  4R4I A;  2HHH Q;  3M4Q A;  5IP9 G;  4HJ7 A;  2AHO B;  1B70 B;  2D0O A;  2IX0 A;  2RF4 A;  3CCJ A;  4OX9 Q;  5C0X I;  1WCM H;  1GD7 A;  2MQH A;  4DV5 L;  3KF8 B;  2UXB Q;  5LMU L;  4DV4 L;  2YTY A;  1HNX L;  3I56 A;  2I0Q A;  2K5H A;  3W1B A;  2JA9 A;  2F3I A;  3ULJ A;  1PV4 A;  3FP9 A;  4R4Q A;  4GS3 A;  4OON A;  3NEN A;  2BA0 A;  3JAM c;  4A3J H;  1SN8 A;  3D31 A;  3M9B A;  3OYY A;  1HR0 W;  1Q8K A;  4QGU A;  4AQY L;  4ALP A;  4EQ5 A;  2GVB A;  1QVG A;  3PO3 H;  1N32 L;  3MEF A;  1NBW A;  4C2M H;  1E1O A;  4RG1 A;  1PHJ A;  3GTM H;  1BBU A;  1HZ9 A;  5IYC H;  5IWA Q;  4A3K G;  2E2J H;  4GKK Q;  4JYA L;  1IBL Q;  3KF6 B;  2R7F A;  2AWO A;  3NBH B;  3KLW A;  5C4X H;  2E5L Q;  2N8N A;  2YTX A;  4JI6 Q;  1VQ5 A;  4UPA A;  4IFD J;  3BZK A;  4BXX G;  3K7A H;  1EOV A;  4NPS A;  1QUQ B;  3JAM i;  3DLL A;  3F2D A;  5C4J H;  4UY8 C;  3PO2 H;  3I55 A;  2QA4 A;  3HOW H;  5IP9 H;  4GOP C;  1Y1W H;  1VQD A;  3KJO A;  1PFS A;  3W1G A;  4DUY L;  4X64 L;  1VS0 A;  1KHI A;  3E9H A;  4JG2 A;  1LTL A;  4X65 Q;  1QZG A;  1KQS A;  3HOU G;  4O2D A;  1K0R A;  3H0G G;  3MXN B;  2RHQ B;  3HKS A;  3PCO B;  2PMZ E;  1HZA A;  2N3S A;  2DGY A;  1YIJ A;  5C44 H;  4GLX A;  1N34 Q;  1VQ8 A;  2JEB I;  4L5R C;  2ASB A;  4POG A;  4DV1 Q;  2UUC L;  4DR3 Q;  1OXS C;  1CKO A;  4OO1 G;  2WAQ G;  4NXN L;  4B3M Q;  4GLV B;  3PUV A;  2R92 G;  3AYH B;  1C9O A;  5E7N A;  1WYD A;  3KOJ A;  2VY3 A;  4LFA Q;  4BY7 H;  1PYB A;  4DR6 Q;  2JA5 G;  1XPO A;  4A3C G;  1E7Z A;  4A3I H;  2ZM6 L;  4JI7 Q;  4R4O A;  3KFU A;  2JA8 H;  3RZO H;  2CFM A;  3S1M H;  4JI5 Q;  4GN3 B;  3RN2 A;  2YTV A;  1XMQ Q;  1NMG A;  1K73 C;  1HNZ Q;  3TS0 A;  3K0X A;  1FJG L;  3GTQ H;  4DV3 L;  1V1Q A;  4KHP Q;  2Q2H A;  4A3M H;  4HIK A;  1EQQ A;  4JI3 Q;  4A93 H;  4JI0 L;  4NXM Q;  4A3D H;  1WCM G;  4X66 Q;  1Q81 C;  4A3E G;  3HOV H;  1YJW A;  1CKN B;  4GNX B;  2JK8 A;  5IWA L;  3PF5 A;  3F2C A;  5FLM H;  1K9M C;  1HR0 L;  1JE5 A;  1Q86 C;  3H3V H;  1Q1B A;  1UWV A;  4JBM A;  2VUM G;  3B6Y A;  4BBR G;  3CCQ A;  4GNX C;  1AE2 A;  1HZC A;  2YU9 H;  2R7D A;  4KLK A;  3Q8D A;  2WP8 J;  4P74 A;  1UEB A;  5C44 G;  2LXK A;  4QJF A;  3UDI A;  1XMO L;  3CC4 A;  2IY5 B;  1JT8 A;  4DAY B;  4IPC A;  5M5W H;  3J81 j;  2ZJR A;  4B3M L;  4NXN Q;  1VQE A;  3S2H H;  1VQJ A;  2DUD A;  1KRT A;  1VQA A;  3PUZ A;  4BY7 G;  2UUA Q;  4A3C H;  1GVP A;  1S72 A;  4PG3 A;  1UE1 A;  2GN5 A;  1K3R A;  4JI2 L;  1EIF A;  1YJN A;  2KCM A;  4DAM A;  4DV3 Q;  3W5O A;  2FXQ A;  2K50 A;  3PO2 G;  4P72 A;  4JI8 L;  1IZ6 A;  2NVY H;  1A62 A;  5HY6 A;  5M3M H;  5M5X H;  4DUZ Q;  1TWG H;  2K5N A;  3TRE A;  2VQF Q;  4IJH A;  1GM5 A;  1OXT A;  4K0K Q;  3H0G H;  1TWA H;  2K4K A;  4A3F H;  1HR0 Q;  3KF6 A;  1VQH A;  3AFP A;  4DPG A;  3G71 A;  3PSI A;  3J81 c;  4HIO A;  3NEM A;  1MKH A;  1G29 1;  1JJ2 A;  2LSS A;  4NB3 A;  4LFB Q;  4DR4 Q;  3GTJ H;  1N34 L;  2V1C C;  3BU2 A;  3CXC A;  5EAY A;  1YVC A;  4OWX B;  2PI2 A;  4YWL A;  3HOX G;  3CF5 A;  4DV6 L;  1UE7 A;  2CQO A;  1L1O B;  1I5F A;  4X62 Q;  3UDG A;  1S3O A;  1OXU A;  4LFC L;  3K81 C;  1WOC A;  2XTI A;  2ZM6 Q; 
#chains in the Genus database with same CATH topology
 1FNV A;  2F0J A;  3CRL C;  1X55 A;  2XIW A;  3HOZ G;  3F2U A;  1TQO A;  2ZJQ A;  1EU3 A;  4XDX A;  4K5X A;  3EBE A;  4RGT A;  1TVX A;  5M3F G;  4IUP A;  1OO9 B;  4P75 A;  5JEA J;  3HEJ A;  1TWC H;  1D6E C;  1KAB A;  3DMU A;  3A5Z B;  3FPP A;  2NYZ D;  4JI0 Q;  1KDB A;  3L7Z C;  4RCN A;  2OCE A;  3MVV A;  1L0W A;  1CUK A;  1MJC A;  5GRO A;  2K04 A;  2D9U A;  1YI2 A;  1QIL A;  4A3G B;  3TRZ A;  4LNQ A;  2B2T A;  2F0E A;  2A69 D;  4UP8 A;  1EIY B;  4CJ0 B;  3HOW G;  1LTA D;  1HZB A;  4DK3 C;  2F0F A;  2Z9H A;  2JQO A;  4QQB X;  4K8J A;  2MNA A;  4LUO A;  1P8L A;  4A3F B;  1HA5 A;  1X3G A;  4POF A;  2RBM A;  2FHT A;  1YHQ A;  3NEL A;  3TME A;  2R7Z H;  1F2M A;  1J5E Q;  5IGB A;  5ISR A;  1A2T A;  3SK5 A;  5CYU A;  4CDC C;  2QGQ A;  1Z47 A;  3RN5 A;  3CCU A;  4LF9 L;  4JC0 A;  2A5H A;  4ZKB B;  3PF4 A;  1F9P A;  1K3B C;  1S5F D;  2B3G A;  2XRS D;  4KKS A;  1HJP A;  2JEA I;  1JCK B;  3I2Z A;  3ONA B;  2MO1 A;  1SNC A;  3U4Z A;  4J1M A;  5H1S E;  3VYS A;  1TY0 A;  2DNC A;  4X66 L;  5FJ8 H;  5A2Q L;  4OWW B;  1XTD A;  2ZJP A;  1Z9F A;  4Y7N H;  2NVX B;  3EA6 A;  1QUQ A;  1VQP A;  3DWP A;  1WTR A;  1IKL A;  4WRD A;  5D3D A;  1BF4 A;  4H0L C;  3GDE A;  4DUZ L;  1WTV A;  5BR8 L;  1S5B D;  3K7U C;  1JIC A;  3AFQ A;  2KCT A;  3MXN A;  4P71 A;  3OSO A;  4FP5 D;  4DR3 L;  2RVL A;  3S17 B;  4LFA L;  2B2U C;  5EPL A;  4F8M A;  4HCS A;  1EFW A;  3MFY A;  5M3F B;  4F87 A;  2NZ1 D;  3BDC A;  4OWT B;  2CCZ A;  2B8G A;  4LF6 Q;  1KL9 A;  4IPH A;  3UE0 A;  3TZD A;  1X32 A;  4DV6 Q;  5EKI A;  3I70 A;  4BA1 I;  5DLQ E;  2B63 H;  5E3F A;  5KRU A;  4DV2 Q;  1BO0 A;  4OHJ A;  1IW7 D;  3K5M A;  4WJ4 A;  1E24 A;  2EJG C;  1LTG D;  4PQX A;  2O2L D;  3C1F A;  3RLF A;  5BR8 Q;  5J3B A;  2B2W A;  2RDH A;  3C1E A;  2H5X A;  3EIV A;  1IBK L;  4ME5 A;  3I7F A;  5GAH C;  2WIN B;  2R93 H;  2Y0S B;  4HJ5 A;  2AKW B;  3DUZ A;  3RUZ A;  4MNO A;  4LUV A;  5CV4 A;  4ME3 A;  2L55 A;  1B53 A;  2B2W C;  4XYO A;  1VQ6 A;  1PYS B;  3T16 A;  1X56 A;  2ENB A;  3HFZ B;  1SYG A;  3N6R A;  3QOL A;  5IT9 L;  1QNU A;  5IY0 A;  1G51 A;  5FJ8 G;  2B2U A;  1EQT A;  4BY7 B;  1N36 L;  5JJZ A;  4PZ8 A;  1FGB D;  4HMI A;  4DNI A;  1LTS D;  2EJF C;  3E9I A;  1JWM D;  3PO2 B;  1H9R A;  1SNO A;  4WJW A;  1TWG B;  1JC7 A;  1QVC A;  5I6Y A;  4JCV E;  3HKZ B;  4JVZ A;  5FKA C;  1LT4 D;  1F9R A;  4K2K A;  4YY3 L;  3MC0 B;  3CQZ H;  4A76 A;  3E6Z X;  2F0K A;  3R3O A;  3M3Y H;  4N9P A;  1Q12 A;  3DM3 A;  3S1N B;  1H9J A;  1BUV T;  1CSP A;  1G2T A;  1FGU A;  1C48 A;  3PUY A;  1EY4 A;  2RHS B;  2ALY B;  4P73 A;  2R61 A;  4AYB E;  1DGS A;  3NWT A;  1JE4 A;  4FXK C;  2OQ0 A;  3HOZ B;  3A8I E;  5F2D A;  3DEO A;  4V0B A;  5CV7 A;  5C4J B;  5ELD A;  1F9S A;  2UXC Q;  1J6Q A;  1WI5 A;  1MJE A;  4KKT A;  3ZJY C;  1T9H A;  2EDG A;  1CZG A;  4LUZ A;  1Q3L A;  2VZA A;  3V2T A;  2UU9 Q;  5GAG C;  3FVQ A;  1X9N A;  3K7A B;  4A3G G;  1D8L A;  2X6L A;  1SYC A;  5COR A;  5IYB H;  4A3D B;  2CWP A;  1TWF H;  1H9S A;  4A93 B;  1E0B A;  1IL8 A;  3S17 H;  2D0P A;  4OXP A;  4LW1 A;  1YNN C;  1VQK A;  1AZQ A;  2HHH L;  2QW7 A;  4AYB B;  3BDL A;  1WD0 A;  3ERQ A;  4KKU A;  1STB A;  5DM6 3;  4DV4 Q;  4X6A H;  5E4W C;  1DYQ A;  2RDG A;  4DKA C;  1BBW A;  1XJV A;  2K52 A;  4C3I H;  2B2Y C;  1CK1 A;  4JI7 L;  2EIF A;  3D6C A;  2C5C A;  4OIJ A;  3T1H Q;  3RNU A;  1Q82 C;  4A3D G;  1ESR A;  1XWE A;  1CM9 A;  1F2Z A;  2J0T D;  3GV6 A;  2B2Y A;  3G6E A;  5IYD H;  1EU4 A;  3W3A A;  4TVA B;  1JOO A;  1B4O A;  2EYF A;  5FLX E;  3CRK C;  3CCL A;  2JA6 H;  1LM0 A;  2RCF A;  2XRQ D;  3MXU A;  5FOB B;  4HAE A;  4C3J G;  2NZH A;  2CVR A;  1MHW C;  3M4O B;  3U4V A;  1KXL A;  3KJP A;  1B3A A;  4HIM A;  1SMX A;  4ZAI A;  2D2C C;  2A6E C;  2VQE L;  4CHT B;  4JV5 Q;  1B3Q A;  2F4V L;  2NBF A;  2PPB C;  4OGQ C;  2KQ3 A;  1TWC B;  3RZD H;  2KHS A;  1O7Y A;  1VQ4 A;  2K33 A;  1P16 A;  5T1G A;  2E2H H;  3TEH B;  5K5P A;  1HNZ L;  4YWM A;  4IJL A;  2JA7 H;  1L0X B;  1TY2 A;  2KA7 A;  2F0Q A;  4UHV A;  1LTR D;  1A3T A;  2QEJ C;  4RHR A;  5LMU L;  3OMG A;  3P1H A;  1HFN A;  2OF1 A;  3L3O C;  2F3I A;  1PV4 A;  5BN5 A;  4GS3 A;  5LHY 1;  5CV9 A;  3MA2 B;  1WTO A;  1SBB B;  3OYY A;  4B08 A;  5KEE A;  1Q8K A;  2R92 B;  2GVB A;  3PO3 H;  1N32 L;  1QNK A;  1NBW A;  2NVQ B;  1AW7 A;  5I4D A;  4TKO B;  4RG1 A;  4A3K G;  2EPB A;  4FF1 A;  2AUK A;  1HUM A;  3DWQ A;  2N8N A;  3A56 A;  1F77 A;  5KGU A;  3K7A H;  3A7A B;  5JAV A;  1EY7 A;  4KV6 A;  3DLL A;  4UY8 C;  1Y1W H;  1O7Z A;  1VQD A;  5C4X B;  3E9H A;  4JG2 A;  3OPO A;  3SE0 A;  1KQS A;  3HOU G;  1K0R A;  5CBE E;  3GTG B;  2DGY A;  5C3X A;  4HMJ A;  1KNA A;  1PZK D;  4HTH A;  5CR3 A;  5C44 H;  4GLX A;  1VQ8 A;  1QB5 D;  1SFO B;  2G5D A;  3HOX B;  4U68 A;  1UNS A;  4DV1 Q;  3EVQ A;  2X6G A;  2BCO A;  2R92 G;  5E4X A;  5E7N A;  2IJ0 A;  3KOJ A;  4I7Z C;  1GUG A;  1PYB A;  4C1N K;  2JA5 G;  1D1K A;  1PFN A;  4JI5 Q;  4DAY A;  1HRJ A;  1RTN A;  2YTV A;  2A69 C;  1ZXT A;  4A3M H;  2PQE A;  4UDU C;  4NXM Q;  4K6L A;  1ILP A;  4X66 Q;  1Q81 C;  3S1R B;  3HOV H;  1ICF B;  2R93 B;  1KNE A;  1Q86 C;  3HOW B;  4HCE A;  1Q1B A;  3BZD B;  4BBR G;  1AE2 A;  4BY1 B;  2PNR C;  2R7D A;  1NUC A;  2FMM A;  1BDO A;  2LXK A;  4QJF A;  1JT8 A;  5EJW A;  4EQN A;  3MEH A;  5ELB A;  5CBA E;  3Q0A A;  2F3V A;  1VQE A;  1EFI D;  2LY7 A;  1EQV A;  2DUD A;  1H9M A;  1PZJ D;  4A3C H;  1S72 A;  3QO2 A;  3H94 A;  1YJN A;  2FXQ A;  2K50 A;  3G7L A;  4XT3 B;  1NNX A;  2PZU A;  5M3M H;  5M5X H;  2F0S A;  3H09 A;  5AFW A;  1TWG H;  2K5N A;  1QJO A;  4KJN A;  2EYM A;  3TP8 A;  3G71 A;  3J81 c;  3NEM A;  1MKH A;  1G29 1;  4RGO S;  2K03 A;  4BBR B;  1PRT B;  3GTJ H;  1DXM A;  4MN3 A;  1SNQ A;  1EYD A;  4L8J A;  3EQL C;  4OWX B;  1UE7 A;  2CQO A;  3LNN A;  4X62 Q;  1S3O A;  3K81 C;  1B44 D;  2Z4I A;  5IT9 c;  2ZM6 Q;  4U67 3;  2JA5 B;  4CBV A;  1TT2 A;  4A3M G;  1EWC A;  1A8V A;  2EXD A;  1LV9 A;  2HQL A;  4A3L H;  1SFO H;  4Y7N B;  4A3E H;  1ZYR D;  1I94 L;  4BBS G;  1TS4 A;  1XX8 A;  4DR4 L;  2BE5 D;  4BXX H;  1TWH B;  2K5V A;  3UDX A;  5T1I A;  4GLA C;  4X3U A;  4X62 L;  1LYL A;  3E5S A;  3GTM B;  4FVM A;  3S1Q B;  1VQO A;  4XTC S;  3HP3 A;  1LUZ A;  1B1Z A;  4C3H H;  4ZYS A;  4R8N A;  3EJI A;  2EY1 A;  1WJJ A;  5HGT A;  4JI2 Q;  3PV0 A;  3J7A F;  3OHX C;  4JBJ A;  3S16 H;  3W2D A;  1IBM L;  2PZT A;  3KDF B;  2K7V A;  4B3S Q;  3J81 E;  1X3P A;  4A3M B;  1QVF A;  2QCP X;  2DN8 A;  5FLX c;  3T1Y L;  3CP0 A;  4FNF A;  1WFQ A;  2KJX A;  3GQB A;  3NBI A;  3VR3 A;  3X3M A;  1H95 A;  3F8T A;  1KDC A;  4L5Q A;  4LFC Q;  2IW3 A;  2XVS A;  4A3B G;  3I72 A;  4DV0 Q;  4MZ9 A;  2YYZ A;  1BCP C;  3RD4 A;  3IAY A;  2PW5 A;  5KNB A;  1SMY D;  1G6P A;  4S3S A;  4KN7 C;  2Q8I B;  1XXG A;  1TR5 A;  1Z6H A;  1U9R A;  2RCN A;  3L2P A;  3NTK A;  1K0S A;  3J7Z C;  4X65 L;  5EGT A;  1VMC A;  3GV3 A;  2UU9 L;  4F88 A;  1HCZ A;  2QEX A;  3KBG A;  1N33 L;  2J7Z A;  3CC2 A;  3I73 A;  4X3T A;  1BNZ A;  2ZXP A;  1QWY A;  1V9P A;  3AEV A;  4P2C B;  1LT5 D;  1D5Z C;  1I94 Q;  3QIA A;  2E2D C;  3NSW A;  3RLO A;  2JXM B;  4KN4 C;  2QDL A;  3CAM A;  1NAP A;  4DV5 Q;  4B3R Q;  2JN4 A;  1U4P A;  2R6G A;  3GTO H;  3T1H L;  1TWH H;  3GTJ B;  5CMD A;  1G2S A;  1Y1V B;  2E2I H;  4C2M B;  2EYJ A;  1QE6 A;  2MJ8 A;  1VQC A;  2RA4 A;  4K5V A;  1EIG A;  1S40 A;  1SXT A;  5FO9 B;  5IGE A;  1BBX C;  2NN6 I;  2ZXO A;  2JA5 H;  3I91 A;  1SR3 A;  2KVM A;  1GXD C;  1OTC A;  1RJT A;  3J81 i;  4BY1 G;  2F0N A;  3PGZ A;  1I4X A;  1DD2 A;  2C35 B;  2B2T C;  4E6I A;  3RZO B;  2B2V A;  1Y1W G;  1YNX A;  1AN8 A;  3SK8 A;  1FR3 A;  1EUJ A;  1G6Z A;  3QB3 A;  1IXR A;  5C3E G;  5C0X J;  3H15 A;  3PIO A;  4AYB G;  1I3Q H;  2WKC A;  2Y0S E;  1PXU A;  2F0U A;  1A0I A;  1I4P A;  1VF5 C;  1WVL A;  1YHB A;  4CDE C;  3A0J A;  1ICW A;  3FDT A;  4IUR A;  1BKB A;  1RTO A;  5IP7 G;  4GKK L;  1NY4 A;  1STY A;  2CKZ B;  2JSO A;  2UXB L;  3NUC A;  1IYU A;  3A5U A;  1B7Y B;  4QIW B;  3S15 H;  5ELO A;  2I5L X;  5FO8 B;  1B50 A;  3K80 C;  3TP7 A;  5BN4 A;  5IOC A;  1XPR A;  2J4X A;  2NWG A;  1VQG A;  5LMU Q;  5G3L F;  1PFB A;  3S1Q H;  4LF6 L;  4HSV A;  1RDP D;  4OL7 A;  1V1O A;  2Z4H A;  2NN6 G;  1BCP F;  1J9O A;  1MSG A;  2K75 A;  3CW2 C;  3VR6 A;  3D6W A;  4DAP A;  1YIT A;  1K8A C;  4BBS B;  1STE A;  5GAD C;  5E1F A;  4F7X A;  4DV7 L;  2N55 A;  3J80 i;  4BY1 H;  4JYA Q;  4C3J H;  2IWH A;  1IL2 A;  4KJO A;  2MHV A;  3BZC A;  3A54 A;  1RL2 A;  2KEN A;  3K5N A;  2BH2 A;  1CKN A;  4GNX A;  1S5D D;  1EIH A;  4KHP L;  3Q6S A;  4DR6 L;  2K28 A;  2LXJ A;  2VQF L;  3ERS X;  1VQM A;  2NVQ H;  2O5J C;  3CHB D;  2RQX A;  4A3F G;  3KF8 A;  4ID6 A;  3KDF A;  1MBY A;  3KLS X;  5C4H A;  1KAW A;  3HOY G;  1LTI D;  4G7H C;  1PH6 A;  4QUC A;  2ZTD A;  4YCU A;  4L63 B;  1ESF A;  2AQ1 B;  5IIF A;  2JE6 I;  2OTL A;  3A74 A;  3T4A C;  3HOZ H;  1MSH A;  4IPG A;  3WDN A;  1FYC A;  3BG3 A;  3I4M H;  3D0F A;  3GP7 A;  2HIX A;  1W2B A;  3EFX D;  4NKL A;  3OW2 A;  3OTO L;  3RLN A;  1YZ6 A;  5JPN C;  1C8C A;  3QR8 A;  1G8Z D;  3K8A A;  4UP7 A;  5C5L A;  4B3T Q;  4QL5 A;  4LF8 Q;  2UXD L;  4IZ8 A;  1SRO A;  2IL8 A;  4FF4 A;  3WWV A;  1PTO C;  2Q2U A;  2CWA A;  1L2F A;  5LMN W;  4LF4 Q;  3D4W A;  2L4N A;  2NN6 H;  1KDA A;  5IGG A;  1I3Q B;  3R8B A;  2K05 A;  1O7I A;  2M2L A;  4JBW A;  1QOH A;  2B8F A;  1PDQ A;  3VYR A;  2BDN A;  2LMC B;  1LLR D;  4PMW A;  3CPW A;  1EYG A;  3GTK H;  5C6A A;  1EZ6 A;  3CMA A;  1Y1V G;  1RIP A;  1XYI A;  4R9W A;  2E8G A;  2UUB L;  3HOY H;  1BQQ T;  4O0A A;  3ND8 A;  4LWC A;  4IPD A;  4NP5 A;  3U50 C;  4JI6 L;  1TU2 B;  1PH7 A;  4R4I A;  2F0P A;  3M4Q A;  4QMG A;  1LO5 D;  4HJ7 A;  1B70 B;  5JOB A;  2IX0 A;  2RF4 A;  3CCJ A;  2A74 C;  1WCM H;  3H0G B;  2MQH A;  4DV5 L;  3DXJ C;  3SK4 A;  2UXB Q;  4QUF A;  3NTH A;  4OON A;  3NEN A;  1Y1W B;  3JAM c;  1EY5 A;  3D31 A;  3M9B A;  4EQ5 A;  1QVG A;  4DNT B;  2O4X A;  4XQN A;  2R7Z B;  3M7G A;  3GTO B;  4JYA L;  5M5Y B;  1IBL Q;  3KF6 B;  3G6J B;  5FK9 C;  3BYT B;  3NBH B;  3DHQ A;  2L1B A;  2CW0 D;  4DU9 A;  2XN9 C;  2EY6 A;  3PMF A;  1A2U A;  3W1G A;  3PIP 3;  2L12 A;  2VXW A;  3KBX A;  4O2D A;  3J80 L;  2F0H A;  4G4K A;  3DEP A;  2PMZ E;  1HQR D;  1FNW A;  2N3S A;  1QG7 A;  3H3V C;  4POG A;  2MUY A;  4DR3 Q;  2JA8 B;  2WAQ G;  4IAL A;  1WYD A;  2ZT9 C;  2VY3 A;  1R9T B;  1S5C D;  1XPO A;  1E7Z A;  2F0M A;  2ZM6 L;  4NW2 A;  4R4O A;  1A15 A;  3IL8 A;  2JA8 H;  1SMY C;  3QG1 A;  4DK0 A;  1FJG L;  1NMG A;  2PZW A;  3K0X A;  3TS0 A;  1DON A;  1ENC A;  3GTQ H;  1V1Q A;  2Q2H A;  4HIK A;  3BVG A;  1EQQ A;  2SNS A;  4A93 H;  3TSS A;  2DJG C;  4A3D H;  1GUN A;  1WCM G;  4ZUJ A;  4CKC A;  1JOK A;  4A3E G;  4KTA A;  1JWS D;  1WTP A;  3GTK B;  1JE5 A;  2KOL A;  1UWV A;  4G7Z C;  4JBM A;  3B6Y A;  4GNX C;  4ZCK A;  1HZC A;  1FD7 D;  2WP8 J;  5LL6 S;  4DXF A;  2IY5 B;  4DAY B;  4WFN 3;  3FPU B;  1LTT D;  3R2T A;  2WAC A;  3PUZ A;  2X69 A;  1JOR A;  2UUA Q;  1GVP A;  2KEE A;  4DFA A;  1TKW B;  5I9P A;  4PG3 A;  4ZK9 B;  2GN5 A;  3VR2 A;  1JB3 A;  4JI2 L;  1CZW A;  2KCM A;  3LWU A;  4P72 A;  2WII B;  4JI8 L;  2EYP A;  1QCB D;  3JAM L;  1LAC A;  4A3B B;  1F2Y A;  4K0K Q;  4IJH A;  4KD4 A;  1WCM B;  3H0G H;  3OWF A;  3H6M A;  4A3E B;  1CQV A;  3NXW A;  3QOJ A;  4HIO A;  4ABN A;  4HN7 A;  1DJR D;  1N34 L;  4JW0 A;  1KTK A;  4OO1 H;  1F2L A;  4RCO A;  3D3R A;  1YVC A;  2F3W A;  3Q23 A;  1K8O A;  1I5F A;  4CDD C;  4LFC L;  1OXU A;  2QDB A;  2XTI A;  2JA8 G;  2I5M X;  4JI8 Q;  2BOS A;  4C3I G;  4DR1 Q;  2HCC A;  1CHP D;  5C0X G;  3GTP H;  3BVZ A;  1HNX Q;  1Q8I A;  3UE1 A;  4RH6 A;  4C3J B;  2KUM A;  1HXY D;  1PH3 A;  4A3B H;  1V43 A;  1VDZ A;  4KY5 A;  2K5W A;  1IW7 C;  1HH2 P;  5M3M B;  1DOM A;  5AJ3 L;  4DK1 A;  5JEA G;  3L9A X;  3EN2 A;  4JI5 L;  3VR4 A;  2EVB A;  2I5H A;  3V96 A;  3E0E A;  4FDB A;  1CT1 D;  3CU7 A;  1ASZ A;  1L1O C;  4JK1 C;  3T1Y Q;  2A6E D;  2L9H A;  3ULL A;  4HR7 B;  5ELE A;  2F0W A;  2NB0 A;  3AQQ A;  4PZ7 A;  3STB C;  5M3F H;  1AE3 A;  1BXT A;  3P75 A;  1I4Q A;  4CKE A;  2WAQ E;  2R92 H;  3Q24 A;  2NTT A;  4GN5 A;  4HJ8 A;  1VCI A;  3GTL H;  2H4O A;  1PFM A;  1XNQ Q;  1Y1V H;  3WOF A;  2IHE A;  3HKZ E;  2Q2I A;  2KCN A;  4RWS C;  4IQZ A;  3CCS A;  3IFD A;  2HIV A;  3HRZ C;  3TS2 A;  1YHA A;  5C3E B;  4LFB L;  4J8Q A;  4IUU A;  3MHB A;  3HOX H;  3K0Y A;  2A1A A;  3LX0 A;  1E22 A;  3C46 A;  4JI4 L;  1FJG Q;  1WTH A;  3X3N A;  4ZLT F;  4A3G H;  4QY7 A;  3CKI B;  3VA7 A;  1E2V A;  2A68 C;  4HID A;  1TII D;  4RAU C;  1LT3 D;  1JB7 A;  1IBM Q;  2A68 D;  3ICE A;  2AMC B;  1VQL A;  1O7L A;  4ZQ3 A;  2IX1 A;  1N32 Q;  2BA1 A;  1L1O A;  1T5X D;  4BA2 I;  4IUN A;  4BBS H;  1SJH D;  2M00 A;  2SNM A;  4B3R L;  1JJC B;  1XMQ L;  1SYB A;  1NTG A;  1HHV A;  1VQF A;  3NK9 A;  2N88 A;  1CSQ A;  2WAQ B;  3F1Z A;  3PIO 3;  1PYW D;  5M3M G;  5K36 H;  2RKS A;  3MZ5 A;  4CKB A;  4RFB A;  4YHH Q;  3HOV B;  4L5S A;  1SEB D;  1I50 H;  3PO3 B;  1PH8 A;  4XT1 B;  3CCV A;  3J7A V;  4A3J G;  1KD1 C;  1NR2 A;  4IOC A;  3TP6 A;  3C3L A;  4LAA A;  4GOP A;  3E3X A;  1D7Q A;  2VS1 A;  1NMF A;  5D65 A;  1OXX K;  2BH8 A;  4FF2 A;  5L37 A;  4RMF A;  4GKJ L;  5ELC A;  4L5T A;  1VF7 A;  5IT9 E;  2HCI A;  2CW0 C;  3RZD B;  2Z8L A;  3BJU A;  3KLR A;  3SVM A;  1SE8 A;  2RSO A;  1ENA A;  1N9W A;  3SGI A;  2PMZ B;  4YHH L;  1STH A;  1GUW A;  1KC8 C;  1YNN D;  2CHB D;  3PUX A;  1R9T H;  2E74 C;  2M9V A;  4EQO A;  3HOY B;  2HD3 A;  1WTX A;  3M4O H;  2TMP A;  5ELN A;  3AMU A;  4DR5 L;  1STA A;  3IFT A;  3KK7 A;  2NVX H;  3ERO A;  2O5I C;  2BDO A;  4MHE A;  5JEA H;  3J80 c;  1RD9 D;  1I4G A;  3OIQ A;  2E2H B;  3Q22 A;  4JBK A;  1ET6 A;  3BVM A;  2VW9 A;  4H13 C;  4HSP A;  4JOI A;  3OWE B;  2F52 A;  1YNJ D;  4R4T A;  2Z0S A;  3TDQ A;  2G9D A;  5IYB G;  1K28 A;  2Z6K A;  3F2B A;  4TQU S;  5I2X A;  1S4Z A;  2L5T A;  3NE5 B;  4LF7 Q;  4AH6 A;  2YU9 B;  3D4D A;  1PH5 A;  3S24 A;  3TBI B;  1TWA B;  3K58 A;  3ITP A;  2JA7 B;  1GKH A;  1U4M A;  1H9S B;  2SEB D;  4I65 A;  5C4Z A;  2UUC Q;  4DV7 Q;  4LF5 Q;  5M9O A;  1YEZ A;  1Y69 U;  1HQM C;  3PO3 G;  1HFG A;  3VDY A;  1B9M A;  1U4R A;  4A75 A;  5LMN L;  2K5D A;  3BS1 A;  1U4L A;  2DJF C;  2NZO A;  5KYI A;  5C4X G;  4EGV A;  1VQ9 A;  3CQZ B;  4IUT A;  2RSN A;  4LMQ D;  4XXE A;  1U0L A;  1K83 B;  1FVI A;  4DR1 L;  3OTO Q;  1GO3 E;  3D8G A;  2MFI A;  4IO9 A;  2XWJ B;  1TWF B;  1DOL A;  1SJE D;  3K5O A;  2GA4 B;  4G7O C;  3H3V I;  3CPF A;  1IYJ B;  4LF4 L;  3PQI A;  4JI1 L;  1Q46 A;  3RMH A;  1FNU A;  4PZ6 A;  5IP7 H;  2CQA A;  4YY3 Q;  2PQA A;  2KHJ A;  2WFW A;  2VL6 A;  4X64 Q;  3SK6 A;  1I50 B;  3I4M B;  1LT6 D;  5GAE C;  2R7Z G;  2R93 G;  2HT1 A;  2EE1 A;  3QWN A;  3FKI G;  3AU7 A;  1JJG A;  3CCR A;  4Q5V A;  2WB1 E;  1IBL L;  3FRP B;  5C44 B;  5IE8 A;  3JC6 6;  2QKI C;  2L15 A;  2EY2 A;  4K14 A;  1SNM A;  1NCV A;  1MD2 D;  2NVT H;  5M5X B;  1KIX A;  1MIU A;  2UXC L;  1SRU A;  2CH4 W;  4A4I A;  4EQP A;  1MGS A;  2XSC A;  1PTO D;  4DR7 Q;  5JJI A;  3I3C A;  4GZY C;  3S1N H;  1J8I A;  3U58 A;  2F0L A;  3TQY A;  2F0T A;  4PNY A;  3T56 B;  1VQ7 A;  1F9Q A;  3KYH C;  1ZKO A;  2F4V Q;  5I6W A;  2WB1 G;  1IBK Q;  3LGJ A;  2ZTE A;  4MIU A;  4RKL A;  3M4Y A;  1I6H B;  3I4M G;  2NUC A;  1OXV A;  2EYH A;  3L0O A;  4HED A;  4KY7 A;  2IX3 A;  1FL0 A;  3GD7 A;  4EX5 A;  2F03 A;  1LAB A;  2IHF A;  1SE4 A;  3RR5 A;  1XMO Q;  4Z9C B;  1E1T A;  1Q7Y C;  3CCE A;  2HUG A;  4DR7 L;  3HKZ G;  4FF3 A;  1EQR A;  5JVG 3;  2HHH Q;  4QF4 A;  2AHO B;  1R4P B;  2K5Q A;  2WV6 D;  5EBC A;  2D0O A;  2LKV A;  4OX9 Q;  1L0Y B;  5C0X I;  1GD7 A;  1PRT F;  1GHJ A;  4BWG B;  1HNX L;  2I0Q A;  4CGY B;  3J7Y W;  2JA9 A;  3ULJ A;  1EY0 A;  1DM0 B;  5CV6 A;  3TN2 A;  4A3J H;  1SN8 A;  2AUJ D;  4JI7 Q;  5DAU A;  4QGU A;  1GUO A;  3HZX A;  4O42 A;  3P20 A;  4M1U B;  4C2M H;  1PHJ A;  1BBU A;  5IYC H;  2E2J H;  3FKI B;  2R7F A;  2AWO A;  2E5L Q;  3KLW A;  4JI6 Q;  1B9N A;  4WOR A;  3BZK A;  4K2L A;  1I4H A;  4LK1 C;  4BXX G;  1EOV A;  4NPS A;  2A73 B;  1QUQ B;  2Z1C A;  3T51 B;  5EPJ A;  3JAM i;  3I55 A;  2DY7 A;  2K32 A;  2XWB B;  5IP9 H;  4CJ1 B;  4GOP C;  4ULL A;  3KJO A;  4X64 L;  1VS0 A;  1KHI A;  4X65 Q;  2F0G A;  1LTL A;  1QZG A;  3H0G G;  2Z6B A;  2RHQ B;  3S2D B;  5EQ0 A;  2VUM B;  1E2W A;  2F0O A;  1R4Q B;  1N34 Q;  2JEB I;  1STG A;  1BR9 A;  2ASB A;  1A3V A;  4FYD A;  1OXS C;  4NXN L;  4B3M Q;  4GLV B;  1C9O A;  4LFA Q;  4DR6 Q;  1EY9 A;  3K6O A;  5DNF A;  2VB3 X;  4C3I B;  1CTM A;  3RZO H;  2CFM A;  1AEX A;  3S1M H;  4GN3 B;  3SEB A;  3OMC A;  3U9S A;  1HNZ Q;  4ZRZ A;  4DXG A;  4DV3 L;  3OOC A;  1W6J A;  4I7A A;  1SND A;  3J80 E;  1UEA B;  2KCC A;  1CKN B;  4GNX B;  3PF5 A;  3KLS A;  5IWA L;  3F2C A;  5FLM H;  1K9M C;  1HR0 L;  3CCQ A;  3KUP A;  2YU9 H;  1PRT D;  5COY A;  4KLK A;  3Q8D A;  1HPC A;  2B2V C;  4P74 A;  1UEB A;  3CC4 A;  3UDI A;  2I46 A;  3H91 A;  3J81 j;  4MTK A;  5CC4 A;  4RA8 A;  4LJZ C;  4K6D A;  2ICI A;  1VQJ A;  1KRT A;  2SDF A;  4C3H B;  1STN A;  1NR4 A;  5EBD A;  1V1P B;  4XYQ A;  1AFP A;  1GUT A;  1Y8P B;  5LL6 X;  1RKN A;  1EIF A;  3W5O A;  3PO2 G;  2QIL A;  3E0J A;  1EY6 A;  2E2J B;  3S16 B;  4FXD A;  1WTW A;  4TSS A;  4DUZ Q;  2QF7 A;  3TRE A;  2VQF Q;  1SYE A;  4A3F H;  2L11 A;  2F1M A;  1VQH A;  4O1N A;  4DPG A;  3PSI A;  1AZP A;  4NB3 A;  4LFB Q;  3A8K E;  3OIP A;  2V1C C;  4M8A A;  3CXC A;  1PTO F;  1X3Q A;  5EAY A;  3HG9 A;  4YWL A;  4DV6 L;  1Z7T A;  1L1O B;  3UDG A;  1WOC A;  4A3C G;  2P5Z X;  1KLG D;  4C3H G;  5J22 A;  4DV0 L;  1QZH A;  3M3Y B;  3IKJ A;  2NTS A;  3C2P A;  3I4L A;  2FIN B;  4UP9 A;  3S2D H;  2EY5 A;  1J5E L;  3JAM E;  3MFG A;  3QJY A;  4IN3 A;  2JP1 A;  1D1I A;  2PW7 A;  1YBY A;  3DM1 A;  4KI0 A;  5CGK A;  1EEI D;  2MGS A;  4GOP B;  1B2T A;  5IYC G;  4LF7 L;  5KIX A;  4Q0F A;  4ZKC B;  3BYY B;  4B3T L;  2MO0 A;  2OXP A;  4G57 A;  5EKK A;  1ILQ A;  5C3E H;  4LF8 L;  3NP8 A;  2VUM H;  3ND9 A;  4V19 0;  1A63 A;  2Q2T A;  2EJM A;  3UI2 A;  2KBN A;  1GOZ A;  4A3K B;  3T53 B;  2RDF A;  2K14 A;  2OEO A;  4KY6 A;  3V05 A;  2A6H D;  2Z6K C;  4DGZ A;  4A3J B;  3R93 A;  2BE5 C;  4OEL B;  1PLF A;  4YCW A;  5EPK A;  4NXM L;  1BVS A;  1D5X C;  3NQT A;  1M1K C;  2F4I A;  3HOU B;  1D5M C;  2XGT A;  1X3E A;  4R8I A;  3STB D;  3MAQ A;  3UDF A;  5IGF A;  1JOQ A;  2JJQ A;  1PA6 A;  5ELF A;  3R2I A;  4A3I G;  5JJK A;  3J81 L;  3I4N H;  4DAV A;  4IFD I;  1ROD A;  2A6H C;  3S15 B;  1W3S A;  1KRS A;  5TSS A;  1CI3 M;  2VNU D;  5J1Z A;  5M5W B;  4IOA A;  4XQQ A;  3HS0 C;  3URY A;  3J7A 5;  2EZV A;  1EOT A;  4B9X A;  3IRB A;  4GKJ Q;  3T13 A;  1I6H H;  1PTO B;  4DR2 Q;  1G91 A;  1BCP B;  3S1R H;  2VQE Q;  4BBR H;  1XPU A;  5JJL A;  1EYC A;  3FHW A;  1A6X A;  4J6H A;  2Y0S G;  1PTO H;  1DZ1 A;  4N9T A;  4CDF C;  3HGB A;  2IPK D;  2WKD A;  2ZXR A;  2UXD Q;  2F0V A;  3VA5 A;  2LFN A;  1K83 H;  4A3I B;  4RGN A;  4YIJ A;  5C3W A;  4HJ9 A;  2FFK B;  3NPP A;  1VMP A;  1HTL D;  2TSS A;  2F0D A;  2PI2 E;  1PH2 A;  4KMU C;  2C9O A;  4OIK A;  1S5E D;  1KAA A;  4K8I A;  1PH9 A;  3PIP A;  1NE3 A;  3HOU H;  3ER0 A;  3TZU A;  3OW7 A;  4R4C A;  4H02 A;  3M4P A;  2PCF B;  1JR0 D;  3G4S A;  4GN4 B;  4LF5 L;  1E3P A;  4XIG S;  3FEW X;  5AJ3 Q;  2N78 A;  1SAP A;  1DOK A;  4KHZ A;  2AWN A;  1TXY A;  4A3K H;  4FO2 A;  3I4N G;  1X65 A;  2A19 A;  3M85 A;  2OTJ A;  3LWE A;  3GTQ B;  4J15 A;  4RKB A;  2ES2 A;  5J39 A;  2OWO A;  1SNP A;  2PNH A;  3BDO A;  4DUY Q;  2ATW A;  2D62 A;  4PMC A;  4K5W A;  2B29 A;  3D4R A;  2JA6 G;  2N49 A;  5K36 G;  5IOD A;  4BS9 A;  2KED A;  2A8V A;  5FLX L;  3HOV G;  1SYF A;  2Q8T A;  1EZ8 A;  3G48 A;  3VR5 A;  4IUQ A;  4KD3 A;  5FLM G;  1VQB A;  2OQK A;  4B9W A;  3ULP A;  3SR1 A;  1LTB D;  1EL0 A;  1Q1E A;  4JI1 Q;  5GQO A;  3S9W A;  4EVO A;  2OT2 A;  1Y14 B;  3A7L A;  4NMZ A;  3I4N B;  2JYO A;  4UAI A;  3S14 H;  1ET9 A;  1Y8N B;  2D5D A;  3CC7 A;  4R1J A;  2E76 C;  3S1M B;  1IHZ A;  4DK6 C;  4DR2 L;  1UUP A;  1EYA A;  4A93 G;  3GTG H;  4DV2 L;  3CME A;  4LF9 Q;  1W6K A;  2EYL A;  1N33 Q;  4OO1 I;  1XNR Q;  2V4D A;  1RF2 D;  4QIW E;  5A2Q E;  1JQY D;  1UE5 A;  1X6O A;  2MPM A;  2E2I B;  4DV1 L;  3A8J E;  4YCV A;  2K1B A;  2EQS A;  1M4V A;  5JPM C;  4DNR B;  2DY8 A;  1PZI D;  1RCV D;  5M5Y H;  1RHP A;  4L6T B;  3CD6 A;  1UE6 A;  1EWH A;  1CHQ D;  3CCM A;  1X54 A;  1JWU D;  2E5L L;  1C7Y A;  2HDL A;  3K57 A;  3FKI H;  2AQ2 B;  4WJ3 M;  5EKL A;  1X3F A;  5NUC A;  2PO4 A;  4HJA A;  4ILW A;  4A3L G;  1XNR L;  1N36 Q;  5KNC A;  5IYD G;  2FJ2 A;  4IUV A;  1C4Q A;  2B39 A;  3NHH A;  2JA6 B;  2YV5 A;  4APV A;  2H1E A;  3PUW A;  1CKM A;  1ASY A;  2B63 G;  2EOT A;  2LS0 1;  5HGQ A;  4IFD H;  2JA7 G;  1KLU D;  5D14 A;  3GO5 A;  4OX9 L;  1N8R C;  1PMR A;  4YWK A;  4MTN A;  2ID0 A;  1EEF D;  3O13 A;  2UUA L;  1BCP D;  4JI3 L;  1HA6 A;  3A55 A;  1UAP A;  2UUB Q;  1U5K A;  3NBH A;  2GVA A;  4JI4 Q;  1AH9 A;  4DN4 M;  4AQY Q;  2ZTC A;  1T5E A;  4DR5 Q;  1EY8 A;  1GUS A;  1SLJ A;  1YJ9 A;  1PH1 A;  3I4O A;  3GTL B;  4K0K L;  1K8G A;  1HUN A;  1C0A A;  1VQI A;  2K6A A;  3SDZ A;  3K5L A;  4PMB A;  1XNQ L;  4TRD A;  1EWI A;  2IT1 A;  4KHV A;  1NJI C;  4X3S A;  1GHK A;  2HQE A;  2PQA B;  4IFD G;  1H9K A;  1HNW L;  2EXZ A;  1VQN A;  1PVO A;  4Y52 H;  1JMC A;  2EYO A;  1B8A A;  1I4R A;  1M90 C;  3SXH A;  4DA2 A;  1ZYR C;  3N52 A;  3M7N A;  2NVT B;  4B3S L;  2KHI A;  5KND A;  4NDX A;  2MP1 A;  1SE2 A;  4C1N I;  4QB4 A;  1DCZ A;  3S14 B;  1ZEQ X;  1CFM A;  2AQ3 B;  2VB2 X;  3I90 A;  4JOI C;  3U9O A;  5I9O A;  1CA6 A;  4JV5 L;  1V1P A;  2XNA C;  4AIM A;  1YNJ C;  1HNW Q;  1PH4 A;  3MTS A;  5LMN Q;  3NQI A;  1HTP A;  1SE3 A;  5IP9 G;  2K01 A;  3WOE A;  2CH4 A;  3KF8 B;  4DV4 L;  2YTY A;  3I56 A;  2K5H A;  2NVY B;  1ML0 D;  3W1B A;  1MI2 A;  3FP9 A;  4R4Q A;  2BA0 A;  3MWY W;  1ENF A;  3NWS A;  4X3K A;  4AQY L;  1HR0 W;  1NSN S;  4ALP A;  1M8A A;  3MEF A;  1E1O A;  1Q90 A;  3I8Z A;  5C5M A;  3GTM H;  1HZ9 A;  5IWA Q;  4GKK Q;  2G9H D;  1SYD A;  3SHL A;  3S2H B;  5C4X H;  2YTX A;  1VQ5 A;  3MXG A;  4UPA A;  4IFD J;  4XQJ A;  3PO2 H;  3F2D A;  5C4J H;  2ICE C;  2QA4 A;  3HOW H;  1O80 A;  1PFS A;  5IGD A;  4DUY L;  1IYV A;  1PRT C;  4ZUI A;  5JVH 3;  3MXN B;  2R3Z A;  3TP5 A;  3HKS A;  3PCO B;  5D3I B;  1D2B A;  1HZA A;  1AP0 A;  2PYK A;  1YIJ A;  4N8X 1;  4DF7 A;  5BN3 A;  4L5R C;  2UUC L;  4CJ2 C;  4OO1 G;  1CKO A;  1WD1 A;  3K59 A;  3PUV A;  3AYH B;  4ODG A;  4BY7 H;  2SOB A;  4A3I H;  3P7J A;  2F0I A;  4KK7 A;  3KFU A;  1SDF A;  1Y8O B;  4H7B A;  5A35 A;  3RN2 A;  1TS3 A;  1XMQ Q;  1SSO A;  4FXG C;  1K73 C;  4RGM A;  4KHP Q;  1CA5 A;  1TS5 A;  4JI3 Q;  4JI0 L;  1WTQ A;  5DM7 3;  4OEM B;  4RHS A;  1YJW A;  1K8M A;  2FMC A;  5G3L D;  2JK8 A;  1E2Z A;  4H44 C;  4PV1 C;  3H3V H;  1II3 A;  2VUM G;  1TS2 A;  5HUR A;  1O78 A;  5DEH A;  1CQF A;  5C44 G;  1XMO L;  2E75 C;  1XTC D;  5M5W H;  4IPC A;  2ZJR A;  1A3U A;  1GJX A;  4B3M L;  4NXN Q;  3S2H H;  1I6V C;  3DWA A;  5CV8 A;  5KYL A;  1VQA A;  4BY7 G;  3AB9 A;  1UE1 A;  2L0C A;  2B63 B;  2KEC A;  1K3R A;  3MXP A;  3GTP B;  4DAM A;  3FMC A;  4DV3 Q;  1IKM A;  1IZ6 A;  2NVY H;  4N8F A;  5C0X H;  1A62 A;  5HY6 A;  5FO7 B;  1GM5 A;  1OXT A;  2WB1 B;  1TWA H;  3ZYY X;  2K4K A;  1HR0 Q;  3KF6 A;  4C56 C;  3AFP A;  1V8Q A;  3VYU A;  5I2Y A;  2I07 B;  5IGC A;  1JJ2 A;  2DNE A;  2LSS A;  3NTI A;  4QCL A;  4DR4 Q;  2HDM A;  5CV5 A;  3BU2 A;  1ONL A;  2Q8R E;  2PI2 A;  3HOX G;  3CF5 A;  1BOS A;  3VYT A;  4JPB W; 
#chains in the Genus database with same CATH homology
 4DV0 L;  5IT9 c;  1QZH A;  1X55 A;  3HOZ G;  2I5M X;  4JI8 Q;  2ZJQ A;  3EBE A;  4UP9 A;  3S2D H;  5M3F G;  4DR1 Q;  4A3M G;  4P75 A;  1J5E L;  5JEA J;  1A8V A;  4KI0 A;  1YBY A;  2EXD A;  5C0X G;  3GTP H;  1TWC H;  2HQL A;  4A3L H;  1SFO H;  4GOP B;  5IYC G;  4LF7 L;  4A3E H;  3A5Z B;  1HNX Q;  1I94 L;  3UE1 A;  4JI0 Q;  3L7Z C;  2OCE A;  4BBS G;  1L0W A;  1PH3 A;  4B3T L;  1CUK A;  2MO0 A;  1MJC A;  5GRO A;  5C3E H;  4LF8 L;  1V43 A;  2VUM H;  4A3B H;  4DR4 L;  1HH2 P;  1YI2 A;  2K5V A;  4BXX H;  3UDX A;  1A63 A;  2Q2T A;  5AJ3 L;  3TRZ A;  2ATW A;  4GLA C;  4LNQ A;  5JEA G;  2KBN A;  4UP8 A;  1EIY B;  3HOW G;  4X62 L;  1LYL A;  2K14 A;  3EN2 A;  4JI5 L;  1HZB A;  4DK3 C;  4QQB X;  2JQO A;  2Z6K C;  2I5H A;  1VQO A;  2MNA A;  4LUO A;  3E0E A;  4FDB A;  4XTC S;  1LUZ A;  1P8L A;  4C3H H;  4NXM L;  1ASZ A;  4YCW A;  1L1O C;  1X3G A;  4POF A;  1BVS A;  1WJJ A;  1YHQ A;  3T1Y Q;  3NEL A;  4JI2 Q;  3PV0 A;  3S16 H;  3ULL A;  4JBJ A;  2R7Z H;  3AQQ A;  3STB C;  4PZ7 A;  5M3F H;  2XGT A;  1M1K C;  1X3E A;  3KDF B;  1AE3 A;  1J5E Q;  4B3S Q;  3STB D;  1QVF A;  2WAQ E;  2R92 H;  2QGQ A;  3UDF A;  4GN5 A;  1Z47 A;  3RN5 A;  3CCU A;  2JJQ A;  5FLX c;  3CP0 A;  4HJ8 A;  1VCI A;  3T1Y L;  1PA6 A;  4LF9 L;  1WFQ A;  4JC0 A;  4A3I G;  3GTL H;  1XNQ Q;  3PF4 A;  5JJK A;  4IFD I;  3F8T A;  3I4N H;  4L5Q A;  1Y1V H;  4LFC Q;  2B3G A;  1W3S A;  4A3B G;  4DV0 Q;  1KRS A;  4MZ9 A;  1HJP A;  2JEA I;  2IHE A;  2YYZ A;  2Q2I A;  3HKZ E;  3I2Z A;  3CCS A;  2VNU D;  1G6P A;  2MO1 A;  2HIV A;  4IOA A;  3U4Z A;  5H1S E;  1YHA A;  3J7A 5;  3TS2 A;  4LFB L;  4X66 L;  5FJ8 H;  3HOX H;  4OWW B;  2RCN A;  3L2P A;  2A1A A;  3IRB A;  4GKJ Q;  1E22 A;  1XTD A;  2ZJP A;  1Z9F A;  4Y7N H;  3J7Z C;  4JI4 L;  4X65 L;  1I6H H;  1VQP A;  1QUQ A;  4DR2 Q;  1FJG Q;  3S1R H;  2VQE Q;  4BBR H;  3GDE A;  4QY7 A;  4DUZ L;  2UU9 L;  5BR8 L;  4HID A;  1XPU A;  4A3G H;  3FHW A;  5JJL A;  1JB7 A;  1IBM Q;  2Y0S G;  2QEX A;  3K7U C;  1N33 L;  3AFQ A;  2KCT A;  2JA8 G;  3CC2 A;  4P71 A;  3ICE A;  4DR3 L;  2AMC B;  4LFA L;  1V9P A;  1EFW A;  1VQL A;  4DR6 L;  2IX1 A;  1N32 Q;  3AEV A;  2BA1 A;  4OWT B;  1L1O A;  2CCZ A;  2UXD Q;  4BA2 I;  4LF6 Q;  4BBS H;  1KL9 A;  4IPH A;  1K83 H;  3UE0 A;  1I94 Q;  4B3R L;  4HJ9 A;  1JJC B;  1XMQ L;  1NTG A;  4DV6 Q;  3RLO A;  1VQF A;  2PI2 E;  4BA1 I;  5DLQ E;  1CSQ A;  1PH2 A;  2B63 H;  3F1Z A;  4DV2 Q;  3CAM A;  5M3M G;  4B3R Q;  4DV5 Q;  1PH9 A;  3PIP A;  4YHH Q;  1NE3 A;  4L5S A;  3HOU H;  4WJ4 A;  3ER0 A;  1E24 A;  2R6G A;  3GTO H;  3T1H L;  1TWH H;  1I50 H;  4R4C A;  4H02 A;  2E2I H;  3RLF A;  5BR8 Q;  3M4P A;  5J3B A;  1PH8 A;  2H5X A;  3EIV A;  3G4S A;  3CCV A;  4A3J G;  1KD1 C;  1IBK L;  4GN4 B;  4IOC A;  3I7F A;  4LF5 L;  5GAH C;  1E3P A;  2R93 H;  1VQC A;  4HJ5 A;  2AKW B;  4XIG S;  1S40 A;  4GOP A;  1D7Q A;  2VS1 A;  5AJ3 Q;  1NMF A;  2N78 A;  4KHZ A;  2AWN A;  1OXX K;  1TXY A;  2BH8 A;  2NN6 I;  4LUV A;  4MNO A;  4ME3 A;  4RMF A;  4A3K H;  3I4N G;  1X65 A;  2JA5 H;  2A19 A;  3M85 A;  4GKJ L;  1SR3 A;  1OTC A;  1VQ6 A;  1PYS B;  4L5T A;  2OTJ A;  3J81 i;  4BY1 G;  3PGZ A;  1X56 A;  4J15 A;  2C35 B;  2ES2 A;  2OWO A;  3HFZ B;  3BJU A;  1SE8 A;  2PNH A;  4DUY Q;  1YNX A;  1N9W A;  3SGI A;  5IY0 A;  1G51 A;  2D62 A;  5FJ8 G;  4YHH L;  1Y1W G;  2B29 A;  3PUX A;  1KC8 C;  2N49 A;  2JA6 G;  1EUJ A;  1R9T H;  5K36 G;  1N36 L;  1IXR A;  3M4O H;  4PZ8 A;  4DNI A;  2A8V A;  3HOV G;  5ELN A;  5C3E G;  5C0X J;  4DR5 L;  3G48 A;  3PIO A;  3H15 A;  4AYB G;  2NVX H;  5FLM G;  1VQB A;  1I3Q H;  2OQK A;  3E9I A;  2Y0S E;  3J80 c;  1A0I A;  3ULP A;  1QVC A;  1Q1E A;  4JCV E;  1YHB A;  4JI1 Q;  5GQO A;  3A0J A;  4YY3 L;  4JBK A;  1BKB A;  3CQZ H;  4A76 A;  5IP7 G;  1Y14 B;  2VW9 A;  4GKK L;  1NY4 A;  1H95 A;  2CKZ B;  3M3Y H;  1Q12 A;  3DM3 A;  4JOI A;  3S14 H;  2F52 A;  2UXB L;  1CSP A;  3CC7 A;  4R1J A;  4R4T A;  4DK6 C;  3A5U A;  1FGU A;  4DR2 L;  2Z0S A;  1B7Y B;  3PUY A;  2RHS B;  4P73 A;  2ALY B;  5IYB G;  4A93 G;  3GTG H;  4DV2 L;  3CME A;  2Z6K A;  4AYB E;  3F2B A;  1DGS A;  4TQU S;  4LF9 Q;  3S15 H;  5ELO A;  2I5L X;  3K80 C;  1N33 Q;  4OO1 I;  2OQ0 A;  4AH6 A;  4LF7 Q;  1XNR Q;  1XPR A;  4QIW E;  1PH5 A;  1UE5 A;  1X6O A;  3S24 A;  1VQG A;  5LMU Q;  2UXC Q;  3S1Q H;  4LF6 L;  1GKH A;  1J6Q A;  4DV1 L;  2UUC Q;  1WI5 A;  4YCV A;  4DV7 Q;  1MJE A;  4LF5 Q;  2EQS A;  1YEZ A;  2NN6 G;  2K75 A;  3ZJY C;  3CW2 C;  1YIT A;  3VDY A;  3PO3 G;  5M5Y H;  1K8A C;  1T9H A;  5GAD C;  4A75 A;  5LMN L;  3CD6 A;  4LUZ A;  2VZA A;  4DV7 L;  3J80 i;  1UE6 A;  2UU9 Q;  4BY1 H;  5GAG C;  1X9N A;  4C3J H;  4A3G G;  2NZO A;  3CCM A;  4JYA Q;  1X54 A;  1IL2 A;  1D8L A;  5C4X G;  2E5L L;  3BZC A;  1VQ9 A;  1C7Y A;  1RL2 A;  2KEN A;  1U0L A;  2BH2 A;  1CKN A;  4GNX A;  3FKI H;  4WJ3 M;  4KHP L;  5IYB H;  2LXJ A;  2VQF L;  1FVI A;  2CWP A;  3ERS X;  1TWF H;  1X3F A;  1VQM A;  4HJA A;  2NVQ H;  4DR1 L;  3OTO Q;  4A3L G;  1GO3 E;  1XNR L;  4A3F G;  1N36 Q;  3S17 H;  5IYD G;  3KDF A;  2MFI A;  4IO9 A;  2YV5 A;  3HOY G;  1KAW A;  2D0P A;  4APV A;  4OXP A;  3PUW A;  4LW1 A;  1CKM A;  1PH6 A;  1ASY A;  1VQK A;  2B63 G;  5HGQ A;  2HHH L;  2JA7 G;  3GO5 A;  2ZTD A;  1N8R C;  4OX9 L;  3CPF A;  1IYJ B;  3H3V I;  4YCU A;  4YWK A;  4MTN A;  4LF4 L;  2ID0 A;  4JI1 L;  1Q46 A;  1IBM L;  2UUA L;  4DV4 Q;  4JI3 L;  4X6A H;  4PZ6 A;  5IP7 H;  4YY3 Q;  2UUB Q;  1U5K A;  2JE6 I;  2OTL A;  4DKA C;  2GVA A;  1BBW A;  3A74 A;  2PQA A;  4JI4 Q;  2KHJ A;  2WFW A;  1XJV A;  2VL6 A;  2K52 A;  3HOZ H;  4IPG A;  1AH9 A;  4C3I H;  4X64 Q;  4AQY Q;  2ZTC A;  4JI7 L;  2EIF A;  5GAE C;  3I4M H;  2R7Z G;  3D0F A;  4DR5 Q;  1SLJ A;  1PH1 A;  1YJ9 A;  2HT1 A;  2R93 G;  2HIX A;  1W2B A;  3FKI G;  3OW2 A;  3I4O A;  3OTO L;  1JJG A;  3RLN A;  3CCR A;  1YZ6 A;  1K8G A;  4K0K L;  3T1H Q;  2WB1 E;  3RNU A;  1IBL L;  1Q82 C;  4A3D G;  1C0A A;  5IE8 A;  3K8A A;  1VQI A;  3JC6 6;  4UP7 A;  4B3T Q;  4LF8 Q;  4QL5 A;  2L15 A;  2UXD L;  1SRO A;  3G6E A;  5IYD H;  1XNQ L;  4TVA B;  2NVT H;  4DR7 L;  3WWV A;  1EWI A;  1KIX A;  1MIU A;  2IT1 A;  1NJI C;  2UXC L;  1SRU A;  4A4I A;  2Q2U A;  2CWA A;  2PQA B;  1L2F A;  5LMN W;  3CCL A;  4LF4 Q;  4DR7 Q;  4IFD G;  1HNW L;  5JJI A;  1VQN A;  2JA6 H;  3S1N H;  1PVO A;  4Y52 H;  1JMC A;  1LM0 A;  3U58 A;  3TQY A;  1HNW Q;  1B8A A;  1M90 C;  1O7I A;  1VQ7 A;  3KYH C;  2NZH A;  2F4V Q;  1KXL A;  4JBW A;  3U4V A;  2WB1 G;  3KJP A;  3M7N A;  1IBK Q;  4HIM A;  3LGJ A;  1SMX A;  2ZTE A;  4B3S L;  2KHI A;  3I4M G;  1OXV A;  3L0O A;  4PMW A;  2VQE L;  4JV5 Q;  1FL0 A;  3GD7 A;  3CPW A;  2F4V L;  4EX5 A;  1EYG A;  3GTK H;  3RZD H;  1VQ4 A;  2IHF A;  3RR5 A;  3CMA A;  1Y1V G;  1RIP A;  1XMO Q;  1P16 A;  2E8G A;  4JOI C;  2UUB L;  2E2H H;  3HOY H;  4JV5 L;  3TEH B;  1E1T A;  4O0A A;  4AIM A;  1Q7Y C;  3CCE A;  1HNZ L;  4YWM A;  4IJL A;  3HKZ G;  3U50 C;  4LWC A;  4IPD A;  5LMN Q;  1EQR A;  1PH4 A;  4JI6 L;  1PH7 A;  2JA7 H;  4R4I A;  2HHH Q;  3M4Q A;  5IP9 G;  4HJ7 A;  2AHO B;  1B70 B;  2D0O A;  2IX0 A;  2RF4 A;  3CCJ A;  4OX9 Q;  5C0X I;  1WCM H;  1GD7 A;  2MQH A;  4DV5 L;  3KF8 B;  2UXB Q;  5LMU L;  4DV4 L;  2YTY A;  1HNX L;  3I56 A;  2I0Q A;  2K5H A;  3W1B A;  2JA9 A;  2F3I A;  3ULJ A;  1PV4 A;  3FP9 A;  4R4Q A;  4GS3 A;  4OON A;  3NEN A;  2BA0 A;  3JAM c;  4A3J H;  1SN8 A;  3D31 A;  3M9B A;  3OYY A;  1HR0 W;  1Q8K A;  4QGU A;  4AQY L;  4ALP A;  4EQ5 A;  2GVB A;  1QVG A;  3PO3 H;  1N32 L;  3MEF A;  1NBW A;  4C2M H;  1E1O A;  4RG1 A;  1PHJ A;  3GTM H;  1BBU A;  1HZ9 A;  5IYC H;  5IWA Q;  4A3K G;  2E2J H;  4GKK Q;  4JYA L;  1IBL Q;  3KF6 B;  2R7F A;  2AWO A;  3NBH B;  3KLW A;  5C4X H;  2E5L Q;  2N8N A;  2YTX A;  4JI6 Q;  1VQ5 A;  4UPA A;  4IFD J;  3BZK A;  4BXX G;  3K7A H;  1EOV A;  4NPS A;  1QUQ B;  3JAM i;  3DLL A;  3F2D A;  5C4J H;  4UY8 C;  3PO2 H;  3I55 A;  2QA4 A;  3HOW H;  5IP9 H;  4GOP C;  1Y1W H;  1VQD A;  3KJO A;  1PFS A;  3W1G A;  4DUY L;  4X64 L;  1VS0 A;  1KHI A;  3E9H A;  4JG2 A;  1LTL A;  4X65 Q;  1QZG A;  1KQS A;  3HOU G;  4O2D A;  1K0R A;  3H0G G;  3MXN B;  2RHQ B;  3HKS A;  3PCO B;  2PMZ E;  1HZA A;  2N3S A;  2DGY A;  1YIJ A;  5C44 H;  4GLX A;  1N34 Q;  1VQ8 A;  2JEB I;  4L5R C;  2ASB A;  4POG A;  4DV1 Q;  2UUC L;  4DR3 Q;  1OXS C;  1CKO A;  4OO1 G;  2WAQ G;  4NXN L;  4B3M Q;  4GLV B;  3PUV A;  2R92 G;  3AYH B;  1C9O A;  5E7N A;  1WYD A;  3KOJ A;  2VY3 A;  4LFA Q;  4BY7 H;  1PYB A;  4DR6 Q;  2JA5 G;  1XPO A;  4A3C G;  1E7Z A;  4A3I H;  2ZM6 L;  4JI7 Q;  4R4O A;  3KFU A;  2JA8 H;  3RZO H;  2CFM A;  3S1M H;  4JI5 Q;  4GN3 B;  3RN2 A;  2YTV A;  1XMQ Q;  1NMG A;  1K73 C;  1HNZ Q;  3TS0 A;  3K0X A;  1FJG L;  3GTQ H;  4DV3 L;  1V1Q A;  4KHP Q;  2Q2H A;  4A3M H;  4HIK A;  1EQQ A;  4JI3 Q;  4A93 H;  4JI0 L;  4NXM Q;  4A3D H;  1WCM G;  4X66 Q;  1Q81 C;  4A3E G;  3HOV H;  1YJW A;  1CKN B;  4GNX B;  2JK8 A;  5IWA L;  3PF5 A;  3F2C A;  5FLM H;  1K9M C;  1HR0 L;  1JE5 A;  1Q86 C;  3H3V H;  1Q1B A;  1UWV A;  4JBM A;  2VUM G;  3B6Y A;  4BBR G;  3CCQ A;  4GNX C;  1AE2 A;  1HZC A;  2YU9 H;  2R7D A;  4KLK A;  3Q8D A;  2WP8 J;  4P74 A;  1UEB A;  5C44 G;  2LXK A;  4QJF A;  3UDI A;  1XMO L;  3CC4 A;  2IY5 B;  1JT8 A;  4DAY B;  4IPC A;  5M5W H;  3J81 j;  2ZJR A;  4B3M L;  4NXN Q;  1VQE A;  3S2H H;  1VQJ A;  2DUD A;  1KRT A;  1VQA A;  3PUZ A;  4BY7 G;  2UUA Q;  4A3C H;  1GVP A;  1S72 A;  4PG3 A;  1UE1 A;  2GN5 A;  1K3R A;  4JI2 L;  1EIF A;  1YJN A;  2KCM A;  4DAM A;  4DV3 Q;  3W5O A;  2FXQ A;  2K50 A;  3PO2 G;  4P72 A;  4JI8 L;  1IZ6 A;  2NVY H;  1A62 A;  5HY6 A;  5M3M H;  5M5X H;  4DUZ Q;  1TWG H;  2K5N A;  3TRE A;  2VQF Q;  4IJH A;  1GM5 A;  1OXT A;  4K0K Q;  3H0G H;  1TWA H;  2K4K A;  4A3F H;  1HR0 Q;  3KF6 A;  1VQH A;  3AFP A;  4DPG A;  3G71 A;  3PSI A;  3J81 c;  4HIO A;  3NEM A;  1MKH A;  1G29 1;  1JJ2 A;  2LSS A;  4NB3 A;  4LFB Q;  4DR4 Q;  3GTJ H;  1N34 L;  2V1C C;  3BU2 A;  3CXC A;  5EAY A;  1YVC A;  4OWX B;  2PI2 A;  4YWL A;  3HOX G;  3CF5 A;  4DV6 L;  1UE7 A;  2CQO A;  1L1O B;  1I5F A;  4X62 Q;  3UDG A;  1S3O A;  1OXU A;  4LFC L;  3K81 C;  1WOC A;  2XTI A;  2ZM6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...