5H1SE

Structure of the large subunit of the chloro-ribosome
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
247
structure length
247
Chain Sequence
NPRNNLISGQRRCGKGRNARGIITARHRGGGHKRLYRKIDFRRNEKDIYGKIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEVPIKMGNALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKRLGRAGSKRWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKSPTTPWGYPALGRRSRKRNKYSDNFIIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S rRNA
publication title Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
pubmed doi rcsb
total genus 15
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2016-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain
E PF03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5h1sE01
3RR5A 3DLLA 2D62A 5LMUQ 2ALYB 3S1RH 3L0OA 3T1HQ 2JA8H 1A0IA 1FVIA 2OQKA 3T1YL 1X3FA 1L1OC 3PGZA 3NEMA 3J81i 3H3VH 4X6AH 4JI6Q 2K52A 1HZAA 3PUXA 1N34L 3ZJYC 2OTLA 4DR1Q 3Q8DA 2QA4A 1HH2P 1YHAA 4FDBA 4DR2L 2UXBL 2Y0SG 2UUBQ 1KIXA 1FJGQ 2GVAA 4MNOA 4B3ML 1Y1WG 1Q8KA 3PUWA 4BXXH 2R6GA 2Q2HA 4BBRG 3KF6A 1VQGA 2VL6A 4A93G 1Q46A 4JI2L 3FKIH 3I56A 2GN5A 1WFQA 4J15A 1E7ZA 1XMOL 2EXDA 3CCEA 4A3DG 2K14A 3HKSA 5FJ8H 4LUZA 1K3RA 2PI2E 3UDGA 4LUVA 2B63H 2UXCL 4PZ6A 4QL5A 1HJPA 3GTQH 4LF8L 2ID0A 1YNXA 4LF6L 1XNQQ 2AWOA 1SFOH 3DM3A 3KDFB 1Q12A 3PUZA 3JC66 5DLQE 5C4XH 1Q7YC 1ASYA 3S24A 1XNRL 2IX1A 1WOCA 2K75A 5IP9G 1TWFH 4A3FH 2LXKA 3UDIA 4DUYL 3A5UA 5LMNQ 2IT1A 4GKKQ 3U58A 4GKJQ 3ICEA 4JI5Q 1PYSB 1HZBA 1QVFA 3PO2H 1IBLL 5C44H 1OXXK 4LF7L 4GN3B 3TRZA 1JB7A 3EBEA 1VQMA 1EFWA 4YCVA 3SGIA 1TWGH 4JI4Q 3HOWH 1RL2A 2JA7G 4O2DA 4A3EG 4X66Q 4YWMA 4DR3L 1X56A 3I4NH 1Z9FA 2NVXH 1GM5A 4GOPC 1SMXA 3HKZE 3K80C 4NB3A 2ASBA 2VQEQ 4YHHL 1Q81C 2CQOA 4TVAB 4WJ4A 3CMAA 4A3LH 4UP8A 1L2FA 2JE6I 2Q2IA 1PH2A 3F2DA 2VQFL 1SE8A 3RN2A 1N34Q 2OTJA 2RF4A 4DNIA 4DR6L 3J81c 5M3MH 2ZJRA 2UXBQ 4DUZL 3EIVA 3UDFA 1PHJA 1X55A 2KBNA 3IRBA 5IT9c 5GAHC 2PQAB 3J81j 3CC7A 4DV2L 1IBML 4B3MQ 4X65L 2MQHA 1OXTA 2WFWA 4JI2Q 4DK6C 1CSPA 4HJAA 1A8VA 5M5YH 1Y1VH 3MEFA 2OCEA 1X54A 2DUDA 3TEHB 3UE1A 4DK3C 5C0XI 1XMOQ 2D0OA 5K36G 1D8LA 3CAMA 1VQOA 4X64L 4P72A 5M3FG 2UXCQ 3S17H 4LF8Q 2R7DA 5GROA 1AE3A 1Q1BA 5IYBH 1KD1C 2I0QA 2R92H 2YTYA 1QZGA 2YYZA 4LF6Q 4IFDI 4PZ8A 4A3GH 3HOVG 3HOZG 1N33Q 1V9PA 1X65A 2LSSA 1XNRQ 1XPRA 1CSQA 1VQPA 1P16A 2IHFA 1SR3A 1VQCA 2HQLA 1XNQL 3HKZG 3ULPA 4DUYQ 1PH7A 3CD6A 1CKNB 2L15A 1YIJA 4HIOA 4PG3A 3WWVA 4JCVE 5GAEC 3H15A 1V43A 1Q86C 3AEVA 4BBSH 1VQ4A 4HIMA 1Y14B 3GDEA 1Q82C 1IBLQ 1S72A 3A5ZB 1A63A 2D0PA 4LF7Q 2K5VA 1BKBA 2R7ZG 3CMEA 1TXYA 1EYGA 3M85A 2YV5A 3H0GG 3W5OA 4DR3Q 2VUMG 1QVGA 2VW9A 2JA6G 2AKWB 1UE1A 3PF5A 3E0EA 2DGYA 2K5HA 4YHHQ 2ZJQA 1CKMA 3F8TA 2EIFA 4EQ5A 2E2JH 1H95A 2F52A 4XIGS 1VQ7A 4B3RL 2MO1A 1Z47A 2WP8J 2NVTH 3GD7A 2VQEL 4DR6Q 1WCMH 5IP7H 4ALPA 2AMCB 1SN8A 5M5WH 1PH8A 4DUZQ 4A3CG 1IBMQ 4P74A 4DV2Q 1JJ2A 4IJLA 4OX9L 2YU9H 4A3MG 1YHBA 4X65Q 2ZTDA 2UXDL 4KLKA 3G71A 3GTPH 3BZCA 4C3JH 1AH9A 3MXNB 4JOIC 2WB1E 1EIYB 1QUQB 4HJ8A 1G6PA 4JV5L 3A0JA 1VQHA 4DV5Q 3ULJA 4GNXC 4GOPB 2KCMA 4JBJA 2EQSA 3M4QA 1GD7A 1I5FA 2N78A 1IZ6A 1UE5A 4JI8L 4X64Q 1Y1WH 2E5LL 4JI7L 1EQRA 2JA8G 5C0XJ 3TQYA 3CP0A 2BA0A 2FXQA 2JEBI 4DV6L 1XMQL 1N8RC 4WJ3M 2NN6G 3PCOB 5JEAJ 4AYBE 3CCLA 1M90C 1L1OA 2H5XA 1YJNA 4A3KG 4L5RC 4A3DH 2OQ0A 3ULLA 3OYYA 1LM0A 3CC4A 2VZAA 3M4PA 4JI0L 4GLVB 2KCTA 3M7NA 3G48A 4DV0L 2XGTA 1YEZA 4JBMA 1XPOA 1N33L 5FLMG 1PYBA 1Q1EA 4OWWB 3CCSA 3KJOA 1QZHA 1GKHA 5IYCG 2Q2TA 1XPUA 4OONA 4A76A 3S16H 4A4IA 3RZDH 3FHWA 2B63G 1O7IA 1VQ5A 4AH6A 5IP9H 2QEXA 4JBWA 2MFIA 5GADC 1KAWA 1OXVA 3KLWA 4GN4B 4HIKA 5C4XG 2WB1G 3K81C 4R1JA 2K4KA 1VQ6A 1IYJB 2N8NA 4ME3A 2VNUD 4LFCL 4A3JG 3F2CA 2PNHA 3F2BA 4BA1I 1EQQA 4A3FG 3CW2C 4B3RQ 2N49A 4A3EH 4IPCA 1AE2A 4Y52H 3UE0A 3GTMH 1E24A 2E8GA 4UPAA 1A62A 1BBWA 3U4VA 3RLFA 4DV1L 3PO2G 2UUAL 5C44G 3FP9A 2F3IA 4OX9Q 1NBWA 3G6EA 4IOCA 4AYBG 3F1ZA 1PA6A 3HOWG 2UXDQ 3CCRA 3S15H 3KJPA 3RLNA 4A75A 2QGQA 2JJQA 3M3YH 4IJHA 3GTGH 4JV5Q 2HIVA 1B70B 2ZJPA 1NMGA 4HIDA 3I4NG 2JK8A 4NPSA 1HNZL 3CQZH 3I4MG 1C7YA 3BU2A 3RN5A 1PVOA 1V1QA 4JI7Q 2C35B 4JI8Q 4OO1G 1MKHA 3J80i 4YY3Q 2E5LQ 2ATWA 4DV5L 4A3LG 2IY5B 5JJLA 1YHQA 4R4OA 3CCJA 4GOPA 1IXRA 1K83H 1X3EA 2B3GA 2BH2A 3HOYG 4DV6Q 1XMQQ 4POFA 3S2DH 1IBKL 1I3QH 1NTGA 1UE6A 1C0AA 4BY7H 3PO3H 3KOJA 1U0LA 3ER0A 3K8AA 3OW2A 5IYDG 2JA5H 1I50H 4JYAL 4HJ9A 3GO5A 2NZOA 1BVSA 1LTLA 4R4IA 3W1GA 3KYHC 3AFPA 5M3FH 1I94Q 2UU9L 1VQ9A 2HIXA 4KHZA 3L7ZC 4MZ9A 4DV0Q 1KRSA 4DV4L 4GNXB 1HZ9A 3D0FA 4LFAL 3KF6B 1Y1VG 4JC0A 3CCVA 4IPGA 4IPHA 2JEAI 4QJFA 4K0KL 3HOZH 1KXLA 3D31A 4X62L 1J6QA 4R4CA 4HJ5A 3STBD 3G4SA 4BA2I 5JJIA 3KDFA 2BA1A 1K73C 2UUCL 4JI0Q 1HNXL 4OWXB 3NBHB 2YTVA 5IY0A 3PUVA 3HOUG 5C3EH 3U50C 1KHIA 1CUKA 2RHSB 3E9IA 3M9BA 5ELOA 4A3IG 4LF9L 3KF8B 2R92G 3NENA 3K0XA 3I4OA 1NMFA 4LW1A 4UY8C 3K7UC 1PH1A 1XJVA 2R7ZH 1VQEA 2KHIA 4LFCQ 4GLXA 4LFBL 4HJ7A 4DV3L 2Z6KC 4A3BH 5H1SE 5J3BA 1HNWL 5E7NA 4JI3Q 4DV7L 2R93G 5IWAL 2VUMH 1VQLA 4DKAC 4POGA 2CFMA 3HOXH 4DV1Q 2UUAQ 2JA6H 1MIUA 4C3HH 5AJ3Q 3J7ZC 1VQKA 3NELA 3L2PA 2KHJA 2BH8A 3BJUA 4YCWA 4KHPL 1VQDA 1WYDA 4A3KH 4UP9A 4DR7L 1TWAH 3CCMA 1VQIA 2NN6I 2PI2A 3TS0A 1OXUA 4EX5A 1HNZQ 4YWKA 2NVQH 1W2BA 2LXJA 2PMZE 1HR0W 4DAYB 3CPFA 4L5QA 1KC8C 3BZKA 4BY1G 4A3MH 4LWCA 3S1MH 2PQAA 4NXML 4LF5Q 1K0RA 2NVYH 3EN2A 3J80c 3GTLH 2K50A 5C4JH 4IO9A 1IBKQ 5JJKA 1WCMG 1W3SA 1WJJA 1QVCA 2NZHA 4BBRH 1GO3E 4YY3L 2I5HA 1N36L 4A93H 3GTJH 2XTIA 4JYAQ 3S2HH 4C2MH 4JI1L 3M4OH 4RG1A 4PMWA 3I55A 2YTXA 1DGSA 4P75A 2UU9Q 2IX0A 3HFZB 4LFAQ 4DV4Q 3W1BA 3STBC 2OWOA 4P71A 4BXXG 3AFQA 2I5LX 4LNQA 4K0KQ 4IFDJ 1I94L 4X62Q 4JOIA 2R7FA 3FKIG 1S40A 2UUCQ 4GNXA 2Z0SA 1XTDA 3K7AH 1JJCB 2JA9A 1P8LA 1J5EL 1HNXQ 1IL2A 1GVPA 3PUYA 5FLMH 1EOVA 4LF9Q 3S14H 5FJ8G 1JT8A 3VDYA 4NXNL 3B6YA 1CKNA 3CCQA 1K8AC 5IYCH 3AYHB 4AQYL 2JQOA 1KL9A 4LUOA 2GVBA 1VQAA 4YCUA 1OTCA 3GTOH 4OXPA 3OTOQ 4LFBQ 4DV3Q 3PF4A 1B8AA 1PFSA 3I7FA 1HNWQ 4DV7Q 5IWAQ 4GS3A 1FL0A 1MJEA 3U4ZA 2KENA 1X9NA 4DPGA 1NY4A 4DR5L 5M5XH 1YJWA 1VQ8A 4LF4L 3CC2A 2JA7H 4OO1I 2A19A 4L5SA 1HR0L 4QQBX 4O0AA 3CXCA 4DR4L 4JI3L 1VQFA 4A3JH 2F4VL 4KHPQ 2ZTEA 1CKOA 4DR7Q 1JJGA 1YZ6A 4GN5A 5FLXc 4B3TL 5AJ3L 1YJ9A 1M1KC 4MTNA 3I2ZA 1YVCA 2CWAA 2VY3A 1R9TH 2CCZA 3KFUA 2I5MX 1E3PA 1KQSA 4IPDA 1N32L 1X3GA 4PZ7A 4XTCS 2ZM6Q 4C3IH 4OWTB 4B3SQ 4NXMQ 4RMFA 1S3OA 1NJIC 1SLJA 1U5KA 5HY6A 1YITA 3CCUA 5BR8L 1QUQA 2HHHL 3I4MH 3JAMi 4UP7A 5LMNW 1EUJA 1N36Q 2B29A 3ERSX 4LF5L 1UE7A 2ZTCA 4JI1Q 2K5NA 3TREA 2E2HH 3T1YQ 4JBKA 3S1NH 1E1OA 1EWIA 2WAQE 2MNAA 3J7A5 3LGJA 4APVA 4GLAC 5M3MG 1HZCA 3HOYH 3TS2A 4AIMA 1RIPA 1PV4A 5LMUL 1VS0A 2HT1A 3T1HL 1PH9A 4DR2Q 2E2IH 5IYDH 1T9HA 5GQOA 5IE8A 4Y7NH 1VCIA 1OXSC 1E1TA 4P73A 4JI6L 3GTKH 1J5EQ 3PIPA 4DR1L 1C9OA 3HOVH 1VQNA 2UUBL 1FJGL 4R4TA 4IOAA 1TWHH 4KI0A 1K9MC 1G291 2MO0A 4R4QA 4NXNQ 3PO3G 4BY7G 4DAMA 4AQYQ 2JA5G 1N9WA 5IYBG 1JE5A 1L1OB 4YWLA 3PIOA 4A3GG 3HOUH 1G51A 5HGQA 1FGUA 1MJCA 1WI5A 2RCNA 4QGUA 4A3IH 1L0WA 3RZOH 1PH3A 4H02A 5ELNA 1UEBA 3E9HA 5EAYA 1SROA 1TWCH 3H0GH 1VQJA 3PV0A 4DR5Q 2ES2A 4LF4Q 3OTOL 3S1QH 2Y0SE 1KRTA 1HR0Q 4DR4Q 1SRUA 2F4VQ 4BBSG 1B7YB 5C3EG 5C0XG 1PH5A 2A8VA 2AHOB 3CF5A 1K8GA 4B3TQ 2R93H 4JG2A 2WAQG 1LUZA 1NE3A 5JEAG 3CPWA 3H3VI 4L5TA 4GKJL 1BBUA 5LMNL 1PH4A 2CWPA 3AQQA 1JMCA 1UWVA 4JI5L 4GKKL 2RHQB 1I6HH 1N32Q 1X6OA 1EIFA 4IFDG 2AWNA 4QY7A 4A3BG 4A3CH 4QIWE 2IHEA 3PSIA 5GAGC 1YI2A 5BR8Q 2Q2UA 4TQUS 1ASZA 2HHHQ 2N3SA 3HOXG 3UDXA 2VS1A 4JI4L 2ZM6L 2Z6KA 4B3SL 3RLOA 1D7QA 3A74A 4BY1H 3JAMc 1E22A 1LYLA 2V1CC 4X66L 1YBYA 5IP7G 1PH6A 2A1AA 2VQFQ 3RNUA 1VQBA 2CKZB
chains in the Genus database with same CATH superfamily
2ALYB 3T1HQ 3T1YL 4C3JB 4R8NA 1X3FA 4JI6Q 1U4RA 4CJ0B 2OTLA 4IUTA 1FJGQ 5KIXA 2VL6A 1XXGA 3BVZA 4JI2L 1EYAA 5EKKA 1WFQA 4ZLTF 3FMCA 4RCNA 3NBHA 1MBYA 2K14A 3HKSA 1Q3LA 4L8JA 2B63H 4PZ6A 1HJPA 4DFAA 3QJYA 2ID0A 1YNXA 1AZQA 1CZWA 1SFOH 3KDFB 1ASYA 3PUZA 4QUCA 3RZDB 3TP6A 2IX1A 5EBCA 4DUYL 5IODA 2IT1A 5DM63 3ICEA 4JI5Q 1PYSB 1HZBA 2VB3X 4DF7A 1ZXTA 5J1ZA 1EY0A 3VR5A 1IBLL 1EEFD 4KK7A 5BN3A 2L12A 1HTPA 1QWYA 2Q8IB 1EEID 1VQMA 2F0MA 2B2TC 1JWUD 1TKWB 4L6TB 2F4IA 3HOWH 1SMYC 1X56A 2K5WA 1GM5A 4GOPC 1SMXA 3K80C 2VQEQ 3DWPA 3CMAA 4XDXA 2K33A 1I4XA 1KTKA 2JE6I 5DEHA 1BF4A 1LT4D 1F9SA 1IYUA 2QDLA 1SE8A 3C3LA 2OTJA 1SYDA 3UI2A 4DR6L 3J81c 1G8ZD 3EIVA 3UDFA 1X55A 1EY7A 1MHWC 2PQAB 2HUGA 4N9PA 2B8GA 2WFWA 3S2DB 1A8VA 5M5YH 2MJ8A 1X54A 4DK3C 3PMFA 2D0OA 5M3FB 5C3XA 4LF8Q 4CDEC 1D5ZC 2R92H 2YTYA 4PZ8A 1DYQA 1U4MA 4KY7A 1B53A 2EDGA 3V2TA 1RJTA 2L15A 1YIJA 1A3UA 3L3OC 3AEVA 1V43A 4HIMA 1Y14B 3NTIA 1H9JA 5CR3A 1EU3A 1EYGA 3SK8A 3H0GG 5JEAH 3W5OA 2NYZD 1XWEA 2EPBA 1H9KA 4HMJA 2VUMB 4HAEA 4OELB 4DR3Q 3OPOA 2IWHA 5IGCA 3E0JA 2DGYA 2K5HA 4YHHQ 1CKMA 4H7BA 2EIFA 2E2JH 4K6DA 2MO1A 4QMGA 1D1IA 2VQEL 3SXHA 1WCMH 5IP7H 1SN8A 3SEBA 3I72A 4KD4A 4DUZQ 4A3CG 2BE5C 3DEOA 1ILQA 1QNUA 1TY2A 4IJLA 2YU9H 4A3MG 3WOFA 3G71A 4C3JH 2SNMA 2C5CA 1EIYB 1QUQB 5C4HA 3ERQA 4JV5L 1VQHA 4EQOA 3GQBA 1F9RA 4N8FA 5LL6X 4GOPB 2KCMA 4OEMB 3GTJB 1GD7A 3I73A 3S2HB 1UE5A 2LMCB 5BN5A 2O2LD 4PMCA 3ND8A 1SE4A 2NBFA 1LTSD 2BA0A 2FXQA 3TP5A 1FD7D 4FF3A 1RTNA 4RKLA 2NN6G 3PCOB 5JEAJ 1FNVA 1SE2A 4L5RC 4RWSC 2F0TA 3MXPA 5G3LF 1LM0A 1Y8OB 3CC4A 2IPKD 2VZAA 4GLVB 4DV0L 2JYOA 5IGDA 5FLMG 1LT5D 4TKOB 3H6MA 5FLXE 5IYCG 1BO0A 2Q8RE 1KAAA 3RZDH 3CRLC 1EY5A 4ZQ3A 5GADC 1KAWA 1W6KA 4DNRB 4RGNA 4O42A 1O80A 2XNAC 3K5OA 2WB1G 2JA7B 4R1JA 5C4XG 4ZYSA 2AUKA 3RUZA 4A3JG 2O5IC 3NSWA 2XRSD 3HZXA 1DONA 1PRTF 2RDFA 3V05A 1BBWA 1RDPD 3RLFA 4PMBA 4KHVA 2UUAL 3PO2G 5C44G 1KDBA 4WJWA 1BDOA 1TVXA 2Z8LA 2K05A 3F1ZA 2UXDQ 3D4DA 3OWFA 1EIHA 3KJPA 4A75A 3I4MB 4NPSA 5IOCA 3BU2A 2BE5D 2F0WA 4OHJA 3RN5A 5DAUA 2C35B 4A3LG 3HOYB 1X3EA 2BH2A 3S2DH 1IBKL 1NTGA 4S3SA 1UE6A 4CHTB 4FNFA 5IYDG 1T5EA 4JYAL 4HJ9A 3W1GA 2BOSA 5M3FH 2KVMA 3HOVB 3L7ZC 4IUQA 4LFAL 1HZ9A 1Y1VG 4JC0A 2RDHA 3EA6A 3D31A 4X62L 4BA2I 2AQ1B 5JJIA 3JAML 1F2ZA 2X6GA 1HNXL 1DOMA 1I6VC 3HRZC 2L9HA 3HOUG 2QILA 2RHSB 3M9BA 3K0XA 3IFTA 1L0YB 3S1QB 4UY8C 3VYSA 1PH1A 4J1MA 3AB9A 2BCOA 2TSSA 2F0PA 4HJ7A 5JPNC 2Z6KC 5H1SE 4JI3Q 2VUMH 1VQLA 4POGA 2DNCA 4DV1Q 2PW5A 5AJ3Q 5KNCA 4CBVA 3NELA 3C2PA 1F9QA 3MXUA 2BDNA 2EZVA 1WTPA 4K5VA 4YWKA 4JPBW 1QNKA 2LXJA 2PMZE 4DAYB 4BY1B 3BYYB 1KC8C 2R3ZA 1EY9A 3J80c 2JA8B 4KN4C 3GTJH 2EYHA 3CRKC 1DXMA 3S2HH 1GOZA 3BZDB 3I55A 2DY7A 2UU9Q 2IX0A 4DK0A 3W1BA 4P71A 4BXXG 2EJMA 3FKIB 2HDLA 3PQIA 4GNXA 3IFDA 2PNRC 1P8LA 1RODA 1B3QA 3PUYA 1EOVA 4LF9Q 1LTTD 4ZRZA 5FJ8G 4NXNL 5CV8A 1S5FD 1LTBD 4AQYL 3LX0A 2KEDA 3KLSA 1KDCA 2L1BA 5EKIA 1B9NA 1IYVA 2WIIB 2RCFA 4OXPA 2K01A 1BBXC 5IT9L 4XQQA 1RCVD 1TWFB 1NY4A 1VQ8A 4OO1I 2JA7H 4O0AA 3CXCA 1ZKOA 4JI3L 2F4VL 5KNBA 1CKOA 1JJGA 1HQRD 4GN5A 5AJ3L 3J81E 1YJ9A 3FDTA 4AYBB 3NTHA 2Z4HA 5A2QL 2CWAA 2FJ2A 3DHQA 1E3PA 2NVXB 1E2ZA 4DXFA 1X3GA 3VYUA 1N32L 3A56A 4OWTB 4NXMQ 3R2IA 4RMFA 5D3IB 3MXNA 1B4OA 3I4MH 3JAMi 1BR9A 4RHRA 3QIAA 4OO1H 1PTOF 1E1OA 2WAQE 5ELDA 2MNAA 2A6EC 2F0JA 5M3MG 3LNNA 4Y7NB 3HOYH 5E4WC 1B1ZA 1PH9A 2Z9HA 5IE8A 2RQXA 1MI2A 1TWHB 1J5EQ 4CJ1B 4J8QA 3HOVH 1I4PA 2UUBL 1STEA 4IOAA 1G291 5FO8B 4DAMA 4MTKA 2A68C 2J0TD 1JE5A 4YWLA 3PIOA 4A3GG 1YNND 5HGQA 1WI5A 4RCOA 1BCPD 2EXZA 3E9HA 3MAQA 3S1QH 1VQJA 2F0KA 4DR5Q 4LF4Q 3NXWA 1GUWA 4BBSB 4XYQA 1M8AA 1BCPB 2WAQB 1EWCA 2WKDA 5EJWA 1F2LA 4GKJL 1BBUA 4C56C 3AQQA 1UWVA 5JVG3 2RHQB 1X6OA 2E74C 2R61A 4A3BG 4QIWE 3PSIA 2DY8A 3MHBA 2X6LA 5BR8Q 2G9HD 1ASZA 2J4XA 1HTLD 4KN7C 2VS1A 4JI4L 3RLOA 3A74A 4ZAIA 1DJRD 4BY1H 2M9VA 1TR5A 1ENAA 1PH6A 2A1AA 4A3KG 5ELEA 3RNUA 1VQBA 2ZXOA 3DLLA 5LMUQ 2D62A 1VDZA 3L0OA 2JA8H 1I4HA 1FVIA 2OQKA 1GUOA 2DJFC 1L1OC 5FKAC 2JSOA 3NEMA 4X6AH 1N34L 1HFNA 1EQTA 4DR1Q 1QE6A 3K0YA 1HH2P 1O78A 2UXBL 2Y0SG 2GVAA 4MNOA 1Y1WG 2Q2HA 1LTRD 4BBRG 3KF6A 4R9WA 1VQGA 4A93G 3FKIH 1BNZA 3I56A 3GV6A 5C3WA 1XMOL 3CCEA 2PI2E 4LUVA 1NNXA 4QIWB 3KF8A 4LF6L 2AWOA 3JC66 2FINB 2HCIA 4KY5A 1CA5A 3S24A 1Z6HA 5IP9G 1TWFH 2LXKA 4GKKQ 1QVFA 4KJNA 3P20A 2PQEA 5COYA 2EYLA 4GN3B 3TRZA 3EBEA 1EFWA 3SGIA 3Q24A 1K3BC 4A3EG 2CW0D 1LTAD 4QB4A 1KLGD 2NTSA 2ZXRA 2NVXH 2ASBA 1AN8A 1VF5C 4G4KA 4H0LC 4IUUA 4TVAB 2XN9C 3J7YW 2Q2IA 3GTGB 1Y8PB 2B2VA 4DNIA 5CORA 3U9OA 4KKUA 2B2UC 5GAHC 1G91A 4X3TA 1VMPA 2LKVA 4X65L 2MQHA 2B8FA 1OXTA 4JI2Q 4DK6C 3EJIA 2SDFA 3A7LA 3MEFA 2OCEA 4BY7B 2F03A 3TZDA 1I50B 2JA5B 4Z9CB 1ONLA 1VQOA 4X64L 1PZKD 5E3FA 2K5DA 3H91A 1SE3A 2R7DA 5IYBH 5E1FA 2F0HA 3E5SA 4IFDI 5F2DA 1X65A 1JORA 4PV1C 1CSQA 5J39A 1P16A 3O13A 1VQCA 1VQPA 1ILPA 4DUYQ 4N8X1 1JWSD 1PH7A 1CKNB 3MTSA 4CKCA 1KNEA 3WWVA 3LWUA 4BBSH 1SNMA 4NW2A 3TP7A 1VQ4A 1Q82C 1A6XA 1IBLQ 2WKCA 2D0PA 2OEOA 2R7ZG 1BKBA 2KCNA 5K5PA 2EJFC 5CMDA 3HOXB 3J80E 3X3NA 4IFDH 3G6JB 2JA6G 3E0EA 4C3HG 3SHLA 1RTOA 3KUPA 4XIGS 4B3RL 1TWAB 1NR4A 4RGOS 3GD7A 5C5LA 1E0BA 4DR6Q 2AMCB 3H94A 3KBXA 1IHZA 4A3MB 3BVGA 1JJ2A 4F87A 4OX9L 2HD3A 1YHBA 4RHSA 1TY0A 4LAAA 4KLKA 1AH9A 3BZCA 5C4JB 2PZWA 2WB1E 4HJ8A 3A54A 2EY5A 4JBJA 1PXUA 4IALA 3M4OB 4DU9A 2E5LL 5M9OA 5FLXL 1XMQL 1L0XB 2X69A 2QF7A 1M90C 1UAPA 3MZ5A 3OYYA 3K7AB 2QW7A 2KCTA 3M7NA 4V0BA 3G48A 4XXEA 3TMEA 4OWWB 3VR3A 3DWQA 1XPUA 4OONA 1RF2D 4A4IA 1DZ1A 5T1IA 4V190 2B63G 1O7IA 1VQ5A 3GTOB 3QG1A 1H9SB 3T56B 4JBWA 5KYLA 1SBBB 1Q90A 1H9MA 5M5XB 4UHVA 2K4KA 3QO2A 1IYJB 4A3JB 4ME3A 2VNUD 4LFCL 5HGTA 3F2CA 3CU7A 4BA1I 1CQFA 3OW7A 4IPCA 4UPAA 1A62A 1I4QA 4RGMA 3K57A 3FP9A 4EVOA 3IAYA 3G6EA 4C3IB 4CKEA 3HOWG 3MVVA 3CCRA 3RLNA 2CQAA 3VYTA 2QGQA 4IJHA 1Y69U 3GTGH 2Q8TA 4JV5Q 1B70B 1NMGA 1HNZL 2B2TA 3MEHA 2QCPX 1SNPA 2E2HB 2F0IA 4CDFC 2A6HD 2L55A 3I3CA 4GOPA 1EY8A 1C0AA 4ZK9B 4BY7H 2JA5H 1I50H 2NZOA 3E3XA 1SNQA 2XSCA 3MWYW 4DV0Q 3EVQA 3RD4A 4LMQD 3NPPA 5JOBA 4IPGA 1YNJD 4K0KL 1KLUD 3QWNA 4HJ5A 3STBD 3HOUB 3NBHB 2YTVA 1O7LA 1TS3A 3NHHA 3U50C 1ZYRD 3E9IA 2F0LA 5ELOA 2R92G 1E2WA 3C46A 1S5ED 3GV3A 1NMFA 5TSSA 3K7UC 2KHIA 4LFBL 3R8BA 2R93G 4DV7L 3HOXH 2UUAQ 1MIUA 2EYFA 3J7ZC 1I6HB 3L2PA 2KHJA 5EGTA 2BH8A 4KHPL 4YCWA 1VQDA 3D6WA 4DR7L 4UP9A 1TWAH 2NN6I 4RKBA 3BG3A 2H4OA 1UUPA 1Q8IA 4L5QA 2JXMB 2PZTA 3VR6A 4A3MH 1K0RA 3EN2A 3CHBD 2K50A 5C4JH 1CK1A 2D9UA 4IO9A 1IBKQ 5JJKA 1WCMG 1X3PA 2NZHA 2I5HA 2B2YC 4JYAQ 3C1EA 1E2VA 4B9WA 3M4OH 1SSOA 4CGYB 4I7AA 1DGSA 4K5WA 4P75A 4C3JG 3HG9A 3HFZB 4LFAQ 3KLSX 3NTKA 4IURA 3AFQA 2I5LX 1LT6D 1NR2A 3OIQA 1F9PA 4X62Q 3D4RA 2R7FA 4X3UA 2RDGA 1D5XC 4KD3A 1XTDA 3K7AH 1JJCB 2JA9A 4QF4A 1EIGA 4XQNA 1HNXQ 4B9XA 1IL2A 5FLMH 1S5DD 4KMUC 3B6YA 3CCQA 2FMMA 5IYCH 3AYHB 3QOLA 2JQOA 3K6OA 1ENCA 1LV9A 1QOHA 1JC7A 3DEPA 3J81L 2RSOA 3GTOH 2F0QA 4K2LA 1B8AA 1MJEA 4GS3A 1D1KA 3U4ZA 4A3FB 3MXGA 5M5XH 1LT3D 1YJWA 1A3TA 3CC2A 2A19A 4QQBX 4DR4L 1VQFA 4A3JH 1EQVA 1MSGA 4I65A 1K0SA 1YZ6A 2IX3A 1PZID 2VY3A 4IUPA 3HGBA 4MHEA 1MGSA 3I4NB 1KQSA 4IPDA 2ZM6Q 1IW7D 4C3IH 3M7GA 2D2CC 1F77A 3CCUA 4J6HA 1AFPA 4UP7A 5LMNW 4G7OC 2B29A 2BDOA 2L11A 2E2HH 1STBA 2K1BA 5M3MB 1EYDA 4GLAC 5NUCA 4DR2Q 3Q22A 2F0NA 5IYDH 1G6ZA 5ELFA 4P73A 2RBMA 5EPLA 2F0OA 2PPBC 2CH4W 3HEJA 2V4DA 1CHPD 1KDAA 1VQNA 2PW7A 1CHQD 4NXNQ 3S17B 2IJ0A 4RFBA 1HUNA 4AQYQ 1EYCA 5C4ZA 4A3GB 4GZYC 3HOUH 3BDLA 1FGUA 4RGTA 4QGUA 2RCNA 1L0WA 2B2WC 1PH3A 3MC0B 1SROA 3K59A 3DXJC 2Y0SE 2XIWA 1SRUA 2H1EA 2KCCA 2F4VQ 1B7YB 1K8OA 5C0XG 1PH5A 1EY4A 3CF5A 2TMPA 3K58A 2SEBD 1NE3A 3QOJA 4U68A 1JWMD 1ICFB 4L5TA 5LMNL 2K04A 2CWPA 2N88A 2K03A 2F0EA 1I6HH 1N32Q 3OHXC 4QY7A 1C4QA 2IHEA 2KUMA 5GAGC 1V1PA 2RSNA 2N3SA 2XWBB 3P7JA 3NWTA 2ZM6L 2Z6KA 2NVTB 1SJHD 3SE0A 1E22A 1LYLA 4X66L 1YBYA 1R4PB 5M5WB 2MHVA 1C48A 3D6CA 1JCKB 1HHVA 3PGZA 3J81i 1G2SA 3NE5B 2AQ3B 3J7AV 2QA4A 1YHAA 4FDBA 4DR2L 4UAIA 2UUBQ 4ABNA 3DWAA 4BXXH 4B3ML 1HA5A 3PUWA 3KLRA 2R6GA 4XT3B 1SNDA 1YNNC 2FMCA 3R93A 2J7ZA 1TIID 1JICA 2RA4A 3DMUA 1BCPC 3TBIB 1RKNA 2EXDA 3OMGA 4A3DG 5FJ8H 1S5CD 3J7AF 4ULLA 1K3RA 3UDGA 2UXCL 2PMZB 2ICEC 1STHA 4LJZC 1XNRL 1WOCA 2K75A 2PCFB 4A3FH 4GKJQ 3A5UA 3U58A 3U9SA 1PZJD 2F0DA 1JE4A 1OXXK 4LF7L 4EQNA 1JB7A 2K7VA 4YCVA 3SK4A 5AFWA 4UDUC 4JI4Q 4A3EB 2JA7G 4O2DA 4YWMA 3I4NH 1Z9FA 3BDOA 3OMCA 5JVH3 5EPJA 2DNEA 1PRTC 5DNFA 2SNSA 1PH2A 2CVRA 1KABA 2LFNA 1F2YA 1N34Q 2RF4A 5D14A 3A7AB 5M3MH 2ZJRA 2UXBQ 1JB3A 2LY7A 1PHJA 1IBML 4DV2L 4FXGC 5BN4A 2VXWA 2JN4A 1UEAB 1I3QB 3UE1A 2DUDA 3PO3B 4DGZA 3RMHA 2RVLA 1XMOQ 3FPUB 4WORA 5C5MA 5K36G 2MGSA 2C9OA 3QB3A 2EJGC 4FO2A 2EYOA 3S17H 1U4LA 5GROA 1Q1BA 1CQVA 4M8AA 1KD1C 2Z1CA 2I0QA 3ND9A 1HXYD 1QZGA 4LF6Q 4A3GH 3HOVG 3HOZG 1V9PA 3G7LA 1ET9A 2LSSA 2VB2X 1XPRA 5C3EB 3K5LA 3HKZG 5CGKA 3J80L 3ULPA 3CD6A 4HIOA 5A35A 5G3LD 2KOLA 3BVMA 5GAEC 1DOLA 1A63A 3GDEA 2R7ZB 2EE1A 2K5VA 1STAA 1TXYA 2CW0C 3M85A 2IL8A 4IZ8A 3H09A 1VF7A 4FF2A 2JA6B 3JAME 4CDCC 4C3HB 2VW9A 2AKWB 1WTRA 4P2CB 3VA5A 4EQ5A 1NSNS 1K28A 1VQ7A 1TS4A 3WOEA 2WP8J 2NVQB 5ELBA 1NCVA 3DUZA 4U673 2NVTH 3KK7A 1HRJA 1D6EC 5JJZA 5M5WH 1PH8A 2Z6BA 1CI3M 4P74A 3CKIB 3S1MB 5CV7A 4X65Q 1PRTD 2HDMA 2ZTDA 3GTLB 4O1NA 3MXNB 4JOIC 1G6PA 3A0JA 4DV5Q 3ULJA 3FRPB 3M4QA 1I5FA 1PRTB 1IZ6A 2G5DA 4JI8L 4X64Q 1Y1WH 4JI7L 2JA8G 1SXTA 4L63B 1ESFA 3CP0A 2JEBI 4DV6L 1N8RC 4WJ3M 2IW3A 3NWSA 4ZKCB 3CCLA 1L1OA 2H5XA 2WINB 5KRUA 1YJNA 2OQ0A 4JI0L 5T1GA 2QDBA 2O5JC 4JBMA 1XPOA 2KHSA 1PYBA 3CCSA 3KJOA 1QZHA 2MPMA 4MN3A 2Q2TA 1LTGD 3FHWA 4AH6A 5IP9H 1ML0D 2OXPA 2MFIA 5E4XA 1OXVA 4QCLA 2SOBA 2E76C 4HIKA 3K81C 1XX8A 2N8NA 1DCZA 5FOBB 3F2BA 1HQMC 1EQQA 1DOKA 3CW2C 4B3RQ 4NKLA 4A3EH 1E24A 2E8GA 1EL0A 1G2TA 4PNYA 1K8MA 5I9OA 3U4VA 1R9TB 2KQ3A 1V8QA 3A8KE 2G9DA 4OX9Q 3FPPA 1NBWA 4DK1A 4IOCA 2A73B 4ZCKA 4AYBG 2GA4B 1PA6A 1STGA 2ZJPA 4HIDA 2JK8A 1A2TA 1C7YA 3NQTA 1Z7TA 1MKHA 3J80i 4YY3Q 2E5LQ 2K28A 4DV5L 2ATWA 5JJLA 1YHQA 4TSSA 4R4OA 4HSVA 4TRDA 1XMQQ 4POFA 1I3QH 3PO3H 4HN7A 1U0LA 2KJXA 3K8AA 4FXDA 3EFXD 3GTKB 4IUNA 4R4IA 1BVSA 1LTLA 3KYHC 5I6WA 4MZ9A 1FGBD 4IN3A 2B2UA 4DV4L 3KF6B 1LO5D 1IKMA 1KXLA 1OO9B 1CTMA 2NZ1D 4R4CA 5ISRA 3G4SA 3BYTB 3KDFA 4ZUJA 2UUCL 1GUSA 4OWXB 5IY0A 3P75A 5C3EH 5CV5A 1KHIA 4A3IG 3RZOB 3KF8B 3I4OA 3H0GB 1AEXA 1GUGA 1LACA 2DJGC 2R7ZH 1DM0B 4LFCQ 3NQIA 1WTHA 4GLXA 2A69D 4DV3L 2R93B 1HNWL 1BOSA 5IWAL 1J9OA 2CFMA 2JA6H 2QKIC 4K6LA 4JK1C 4C3HH 1W6JA 3ITPA 5I2YA 1VQKA 3BJUA 1CFMA 3FVQA 1JR0D 4EGVA 4HEDA 3LWEA 2A6HC 1HNZQ 2NVQH 4HCEA 1W2BA 1HR0W 1PLFA 3CPFA 5EKLA 3HP3A 4LWCA 3TP8A 3S1MH 2PQAA 1TQOA 1UNSA 4LF5Q 3GTLH 3S1RB 5L37A 1W3SA 1QVCA 2K5QA 4YY3L 1GO3E 4K14A 1N36L 3N52A 2XTIA 4JI1L 1X3QA 4DXGA 4RG1A 4PMWA 2YTXA 1YNJC 3KBGA 5I9PA 3STBC 2OWOA 4FF1A 3HS0C 3SR1A 4LNQA 5I4DA 4K0KQ 4IFDJ 3I70A 2M00A 1EOTA 1PTOD 1SYGA 1ZYRC 2K32A 1JOKA 2Z0SA 5EQ0A 1PFNA 1A3VA 1EWHA 3Q0AA 1ICWA 1B3AA 1MSHA 2A5HA 3I8ZA 1JT8A 3VDYA 3GTQB 1PTOB 2OF1A 1WTOA 1KL9A 2EYPA 4LUOA 5LL6S 3V96A 1IL8A 1VQAA 3NUCA 1D2BA 5C4XB 4LFBQ 2WB1B 3D3RA 3IKJA 2XVSA 1PFSA 4DV7Q 1FL0A 2XRQD 2NB0A 2KENA 1QILA 1X9NA 3X3MA 1HR0L 1CA6A 3PO2B 4NDXA 4OL7A 2F0GA 4KHPQ 5C44B 2ZTEA 4DR7Q 2L4NA 2EVBA 4B3TL 1TWGB 4DA2A 5JAVA 1M1KC 4MTNA 5FO9B 3I2ZA 5FO7B 3TN2A 1R9TH 2OT2A 2CCZA 3KFUA 2I5MX 3TSSA 5CBEE 4XTCS 5LHY1 4B3SQ 1QCBD 2M2LA 1YITA 3EQLC 1QUQA 2HHHL 4KY6A 3VR2A 3ERSX 4LF5L 1UE7A 4C1NI 4CDDC 2K5NA 1C8CA 1EWIA 2L0CA 4APVA 2AQ2B 1JQYD 4AIMA 1SEBD 1RIPA 1PV4A 1SDFA 4H44C 2HT1A 1CM9A 4KTAA 3T1HL 2FHTA 1HA6A 5GQOA 1Y1VB 1OXSC 1E1TA 5EPKA 3K5NA 1WVLA 1TT2A 4JI6L 3GTKH 1PDQA 1ZEQX 3A8JE 3D4WA 5HURA 1B9MA 4R4TA 1FJGL 2MO0A 4BY7G 2JA5G 1G51A 4X3SA 1AW7A 1B50A 3RZOH 3OOCA 1HUMA 4H02A 1UEBA 2HCCA 3DM1A 4NMZA 5EAYA 3H0GH 3WDNA 2NTTA 1KRTA 4DR4Q 2JP1A 5JPMC 4DNTB 1EFID 4ID6A 2A8VA 2R93H 4JG2A 2XWJB 5JEAG 1SYEA 1IW7C 3H3VI 5CV4A 1PH4A 4JI5L 5D3DA 1HCZA 3FEWX 3ZYYX 4B08A 1J8IA 4OGQC 2AWNA 1FR3A 4A3CH 2EY1A 1AP0A 4TQUS 3HOXG 3UDXA 1D7QA 4B3SL 2PZUA 3JAMc 1GUNA 2I46A 5IP7G 4KV6A 2VQFQ 2CKZB 2NUCA 3RR5A 1DD2A 3T51B 1SMYD 3S1RH 3GTPB 1A0IA 1BQQT 4CJ2C 3OWEB 1QJOA 4PQXA 4WRDA 4QUFA 3H3VH 4FXKC 1PYWD 2K52A 1HZAA 3PUXA 3ZJYC 3NK9A 2NN6H 3Q8DA 4F88A 4ZKBB 1KIXA 2I07B 1NAPA 1Q8KA 5J22A 1BCPF 1Q46A 2AUJD 2GN5A 4J15A 1E7ZA 4A3DB 4XT1B 2B2YA 5CV9A 5CV6A 1S5BD 4LUZA 1EU4A 1GHJA 3SVMA 1QG7A 4QL5A 3GTQH 1PTOH 4LF8L 3VA7A 1XNQQ 3DM3A 3S16B 1Q12A 5DLQE 5C4XH 5D65A 1Q7YC 3S9WA 4HR7B 2HQEA 1JOQA 1GXDC 4C1NK 3PIO3 3UDIA 5LMNQ 1I4GA 1QB5D 3PO2H 2F0UA 5C44H 1TWGH 3MA2B 1RL2A 3VR4A 3GTMB 2FFKB 2D5DA 4OIJA 4X66Q 5FK9C 4DAYA 4DR3L 2LS01 3SDZA 3TZUA 1A2UA 3HKZE 1CT1D 4NB3A 4FYDA 4YHHL 1Q81C 2CQOA 4WJ4A 3F2UA 4A3LH 3S15B 4UP8A 1L2FA 3M3YB 3F2DA 2PYKA 2VQFL 3RN2A 3K5MA 2DN8A 3CQZB 1SNCA 3SK5A 4C3IG 1PFMA 4DUZL 3GP7A 2KBNA 5IT9c 3IRBA 5KEEA 3CC7A 3J81j 4B3MQ 3EROA 1K83B 2F0SA 4FVMA 1CSPA 4HJAA 1Y1VH 2MP1A 3TEHB 4IUVA 5C0XI 3I90A 4K2KA 1D8LA 3CAMA 2RKSA 4P72A 5M3FG 2UXCQ 1X32A 2F0FA 3QR8A 1JOOA 1AE3A 5DM73 3R3OA 3D8GA 3HOZB 2YYZA 1TU2B 1N33Q 1V1OA 4DN4M 4CKBA 1XNRQ 1O7YA 5IGEA 1GHKA 4YIJA 2KA7A 3HKZB 1SR3A 2IHFA 1XNQL 2HQLA 2N55A 3AU7A 1SAPA 4PG3A 4JCVE 3H15A 1Q86C 5C0XH 1F2MA 4DAPA 3VYRA 3A5ZB 1S72A 1U4PA 4LF7Q 3CMEA 4KKTA 2CHBD 2YV5A 1S4ZA 3W2DA 4A3BB 2B2WA 2VUMG 1QVGA 1UE1A 3PF5A 2ZXPA 3T16A 2ZJQA 3F8TA 1II3A 4FP5D 3A8IE 4A3KB 2F52A 1H95A 1SJED 1Z47A 2A74C 1XYIA 4ALPA 1T5XD 1IBMQ 4DV2Q 3AMUA 4ILWA 2ENBA 2Z4IA 2UXDL 2NVYB 3GTPH 4F8MA 2Y0SB 4H13C 1Y1WB 4GNXC 4BBRB 4ZUIA 4A93B 2EQSA 4C2MB 1B2TA 2N78A 1EQRA 3URYA 5C0XJ 3TQYA 2P5ZX 1EZ6A 2KECA 3SK6A 3NBIA 4AYBE 5C6AA 4A3DH 3PIP3 3ULLA 5IGFA 4XYOA 3M4PA 2XGTA 1YEZA 3S14B 1GUTA 1N33L 1ESRA 4EQPA 4I7ZC 1R4QB 1HFGA 1Q1EA 1I4RA 1SYBA 3BS1A 1GKHA 4E6IA 3R2TA 4A76A 3S16H 4MIUA 4JVZA 2QEXA 4KKSA 4ME5A 3IL8A 3KLWA 4GN4B 3L9AX 1Y8NB 1STNA 4K5XA 2MUYA 2PNHA 4A3FG 2N49A 1AE2A 4Y52H 3UE0A 4FF4A 1NUCA 3GTMH 1ENFA 2B39A 1RD9D 4DV1L 2F3IA 1WTQA 1IKLA 3S15H 1V1PB 2JJQA 3M3YH 2HIVA 1EY6A 1H9RA 3I4NG 3CQZH 3I4MG 4BWGB 1PVOA 3S1NB 1V1QA 3I91A 4JI8Q 4JI7Q 4OO1G 2IY5B 2EYJA 5KNDA 3CCJA 1IXRA 1K83H 2B3GA 3HOYG 4DV6Q 1LLRD 1SYCA 2E2IB 4N9TA 3KOJA 1BXTA 3ER0A 3MFYA 3OW2A 5K36H 3GO5A 2JEAI 4JI0Q 1VQ6A 3AFPA 1I94Q 2UU9L 1VQ9A 2HIXA 4KHZA 1KRSA 4GNXB 3D0FA 4F7XA 3CCVA 4IPHA 1A15A 4QJFA 3HOZH 1J6QA 2BA1A 1K73C 2WV6D 3W3AA 5I6YA 3PUVA 4A3IB 1KNAA 1CUKA 4RAUC 4LF9L 3NENA 1TWCB 4LW1A 1LTID 1XJVA 5KYIA 5I2XA 4M1UB 3M4YA 3OSOA 2KEEA 1VQEA 4A3BH 5J3BA 5E7NA 4RH6A 4DKAC 2CH4A 4HCSA 3TDQA 4LK1C 2O4XA 5EBDA 1MD2D 4HMIA 4HTHA 1WYDA 4A3KH 1D5MC 3CCMA 1VQIA 2PI2A 4RA8A 1OXUA 4EX5A 3TS0A 2ICIA 3T13A 5KGUA 3BZKA 4BY1G 2E75C 3BDCA 4NXML 2F3WA 2NVYH 1WJJA 4BBRH 1HPCA 3ONAB 4A93H 2EOTA 1SYFA 4Q0FA 4ODGA 4C2MH 1VMCA 4DV4Q 1AZPA 2A6ED 1XTCD 1I94L 4JOIA 3FKIG 1S40A 2UUCQ 1J5EL 1M4VA 2EY2A 1GVPA 1FNWA 1BUVT 3S14H 2K6AA 4K8IA 2B63B 1CKNA 1K8AC 2A69C 2GVBA 1GJXA 1SFOB 4YCUA 1LABA 1OTCA 1WD1A 2A68D 2L5TA 3OTOQ 4DV3Q 3PF4A 1FYCA 3I7FA 1HNWQ 2QEJC 5IWAQ 3N6RA 4DPGA 4DR5L 4LF4L 3I4LA 4HSPA 2PO4A 4L5SA 1WTWA 2WACA 1ET6A 1STYA 5FLXc 1WTVA 3H3VC 2B2VC 3HOWB 2ZT9C 4WFN3 3Q6SA 5IT9E 1YVCA 2F1MA 3T53B 1SNOA 4PZ7A 4Q5VA 1S3OA 1NJIC 1SLJA 1U5KA 1O7ZA 5HY6A 3Q23A 5BR8L 4JW0A 4NP5A 1EUJA 1N36Q 2NWGA 3NP8A 4DAVA 2ZTCA 5A2QE 4JI1Q 3TREA 4JBKA 3S1NH 4G7HC 3T1YQ 3J7A5 3LGJA 1HZCA 3C1FA 3TS2A 2EYMA 5CBAE 1PTOC 5LMUL 1VS0A 2EY6A 2E2IH 1T9HA 4Y7NH 5M5YB 1VCIA 5CC4A 4BS9A 3PIPA 4DR1L 1C9OA 4XQJA 1PFBA 1WTXA 1TWHH 4KI0A 1K9MC 4R4QA 1B44D 3PO3G 2F0VA 1N9WA 5IYBG 2E2DC 2R92B 1L1OB 1FNUA 2F3VA 1MJCA 4A3IH 1TS5A 3MFGA 1H9SA 5IGBA 5ELNA 3T4AC 2ES2A 1TWCH 3PV0A 5IGGA 3OTOL 5IIFA 1HR0Q 4BBSG 5C3EG 2AHOB 4B3TQ 1K8GA 1EZ8A 3P1HA 5CYUA 2WAQG 1LUZA 4X3KA 3A55A 3CPWA 1RHPA 5ELCA 1JMCA 4GKKL 4KJOA 1EIFA 1U9RA 4IFDG 1PMRA 1WD0A 1YI2A 1TS2A 2Q2UA 1CZGA 4G7ZC 2HHHQ 2E2JB 4R8IA 4IQZA 1WCMB 2V1CC 4OIKA 4K8JA 3OIPA 4G57A 3E6ZX 2YU9B
chains in the Genus database with same CATH topology
3RR5A 3DLLA 2D62A 5LMUQ 2ALYB 3S1RH 3L0OA 3T1HQ 2JA8H 1A0IA 1FVIA 2OQKA 3T1YL 1X3FA 1L1OC 3PGZA 3NEMA 3J81i 3H3VH 4X6AH 4JI6Q 2K52A 1HZAA 3PUXA 1N34L 3ZJYC 2OTLA 4DR1Q 3Q8DA 2QA4A 1HH2P 1YHAA 4FDBA 4DR2L 2UXBL 2Y0SG 2UUBQ 1KIXA 1FJGQ 2GVAA 4MNOA 4B3ML 1Y1WG 1Q8KA 3PUWA 4BXXH 2R6GA 2Q2HA 4BBRG 3KF6A 1VQGA 2VL6A 4A93G 1Q46A 4JI2L 3FKIH 3I56A 2GN5A 1WFQA 4J15A 1E7ZA 1XMOL 2EXDA 3CCEA 4A3DG 2K14A 3HKSA 5FJ8H 4LUZA 1K3RA 2PI2E 3UDGA 4LUVA 2B63H 2UXCL 4PZ6A 4QL5A 1HJPA 3GTQH 4LF8L 2ID0A 1YNXA 4LF6L 1XNQQ 2AWOA 1SFOH 3DM3A 3KDFB 1Q12A 3PUZA 3JC66 5DLQE 5C4XH 1Q7YC 1ASYA 3S24A 1XNRL 2IX1A 1WOCA 2K75A 5IP9G 1TWFH 4A3FH 2LXKA 3UDIA 4DUYL 3A5UA 5LMNQ 2IT1A 4GKKQ 3U58A 4GKJQ 3ICEA 4JI5Q 1PYSB 1HZBA 1QVFA 3PO2H 1IBLL 5C44H 1OXXK 4LF7L 4GN3B 3TRZA 1JB7A 3EBEA 1VQMA 1EFWA 4YCVA 3SGIA 1TWGH 4JI4Q 3HOWH 1RL2A 2JA7G 4O2DA 4A3EG 4X66Q 4YWMA 4DR3L 1X56A 3I4NH 1Z9FA 2NVXH 1GM5A 4GOPC 1SMXA 3HKZE 3K80C 4NB3A 2ASBA 2VQEQ 4YHHL 1Q81C 2CQOA 4TVAB 4WJ4A 3CMAA 4A3LH 4UP8A 1L2FA 2JE6I 2Q2IA 1PH2A 3F2DA 2VQFL 1SE8A 3RN2A 1N34Q 2OTJA 2RF4A 4DNIA 4DR6L 3J81c 5M3MH 2ZJRA 2UXBQ 4DUZL 3EIVA 3UDFA 1PHJA 1X55A 2KBNA 3IRBA 5IT9c 5GAHC 2PQAB 3J81j 3CC7A 4DV2L 1IBML 4B3MQ 4X65L 2MQHA 1OXTA 2WFWA 4JI2Q 4DK6C 1CSPA 4HJAA 1A8VA 5M5YH 1Y1VH 3MEFA 2OCEA 1X54A 2DUDA 3TEHB 3UE1A 4DK3C 5C0XI 1XMOQ 2D0OA 5K36G 1D8LA 3CAMA 1VQOA 4X64L 4P72A 5M3FG 2UXCQ 3S17H 4LF8Q 2R7DA 5GROA 1AE3A 1Q1BA 5IYBH 1KD1C 2I0QA 2R92H 2YTYA 1QZGA 2YYZA 4LF6Q 4IFDI 4PZ8A 4A3GH 3HOVG 3HOZG 1N33Q 1V9PA 1X65A 2LSSA 1XNRQ 1XPRA 1CSQA 1VQPA 1P16A 2IHFA 1SR3A 1VQCA 2HQLA 1XNQL 3HKZG 3ULPA 4DUYQ 1PH7A 3CD6A 1CKNB 2L15A 1YIJA 4HIOA 4PG3A 3WWVA 4JCVE 5GAEC 3H15A 1V43A 1Q86C 3AEVA 4BBSH 1VQ4A 4HIMA 1Y14B 3GDEA 1Q82C 1IBLQ 1S72A 3A5ZB 1A63A 2D0PA 4LF7Q 2K5VA 1BKBA 2R7ZG 3CMEA 1TXYA 1EYGA 3M85A 2YV5A 3H0GG 3W5OA 4DR3Q 2VUMG 1QVGA 2VW9A 2JA6G 2AKWB 1UE1A 3PF5A 3E0EA 2DGYA 2K5HA 4YHHQ 2ZJQA 1CKMA 3F8TA 2EIFA 4EQ5A 2E2JH 1H95A 2F52A 4XIGS 1VQ7A 4B3RL 2MO1A 1Z47A 2WP8J 2NVTH 3GD7A 2VQEL 4DR6Q 1WCMH 5IP7H 4ALPA 2AMCB 1SN8A 5M5WH 1PH8A 4DUZQ 4A3CG 1IBMQ 4P74A 4DV2Q 1JJ2A 4IJLA 4OX9L 2YU9H 4A3MG 1YHBA 4X65Q 2ZTDA 2UXDL 4KLKA 3G71A 3GTPH 3BZCA 4C3JH 1AH9A 3MXNB 4JOIC 2WB1E 1EIYB 1QUQB 4HJ8A 1G6PA 4JV5L 3A0JA 1VQHA 4DV5Q 3ULJA 4GNXC 4GOPB 2KCMA 4JBJA 2EQSA 3M4QA 1GD7A 1I5FA 2N78A 1IZ6A 1UE5A 4JI8L 4X64Q 1Y1WH 2E5LL 4JI7L 1EQRA 2JA8G 5C0XJ 3TQYA 3CP0A 2BA0A 2FXQA 2JEBI 4DV6L 1XMQL 1N8RC 4WJ3M 2NN6G 3PCOB 5JEAJ 4AYBE 3CCLA 1M90C 1L1OA 2H5XA 1YJNA 4A3KG 4L5RC 4A3DH 2OQ0A 3ULLA 3OYYA 1LM0A 3CC4A 2VZAA 3M4PA 4JI0L 4GLVB 2KCTA 3M7NA 3G48A 4DV0L 2XGTA 1YEZA 4JBMA 1XPOA 1N33L 5FLMG 1PYBA 1Q1EA 4OWWB 3CCSA 3KJOA 1QZHA 1GKHA 5IYCG 2Q2TA 1XPUA 4OONA 4A76A 3S16H 4A4IA 3RZDH 3FHWA 2B63G 1O7IA 1VQ5A 4AH6A 5IP9H 2QEXA 4JBWA 2MFIA 5GADC 1KAWA 1OXVA 3KLWA 4GN4B 4HIKA 5C4XG 2WB1G 3K81C 4R1JA 2K4KA 1VQ6A 1IYJB 2N8NA 4ME3A 2VNUD 4LFCL 4A3JG 3F2CA 2PNHA 3F2BA 4BA1I 1EQQA 4A3FG 3CW2C 4B3RQ 2N49A 4A3EH 4IPCA 1AE2A 4Y52H 3UE0A 3GTMH 1E24A 2E8GA 4UPAA 1A62A 1BBWA 3U4VA 3RLFA 4DV1L 3PO2G 2UUAL 5C44G 3FP9A 2F3IA 4OX9Q 1NBWA 3G6EA 4IOCA 4AYBG 3F1ZA 1PA6A 3HOWG 2UXDQ 3CCRA 3S15H 3KJPA 3RLNA 4A75A 2QGQA 2JJQA 3M3YH 4IJHA 3GTGH 4JV5Q 2HIVA 1B70B 2ZJPA 1NMGA 4HIDA 3I4NG 2JK8A 4NPSA 1HNZL 3CQZH 3I4MG 1C7YA 3BU2A 3RN5A 1PVOA 1V1QA 4JI7Q 2C35B 4JI8Q 4OO1G 1MKHA 3J80i 4YY3Q 2E5LQ 2ATWA 4DV5L 4A3LG 2IY5B 5JJLA 1YHQA 4R4OA 3CCJA 4GOPA 1IXRA 1K83H 1X3EA 2B3GA 2BH2A 3HOYG 4DV6Q 1XMQQ 4POFA 3S2DH 1IBKL 1I3QH 1NTGA 1UE6A 1C0AA 4BY7H 3PO3H 3KOJA 1U0LA 3ER0A 3K8AA 3OW2A 5IYDG 2JA5H 1I50H 4JYAL 4HJ9A 3GO5A 2NZOA 1BVSA 1LTLA 4R4IA 3W1GA 3KYHC 3AFPA 5M3FH 1I94Q 2UU9L 1VQ9A 2HIXA 4KHZA 3L7ZC 4MZ9A 4DV0Q 1KRSA 4DV4L 4GNXB 1HZ9A 3D0FA 4LFAL 3KF6B 1Y1VG 4JC0A 3CCVA 4IPGA 4IPHA 2JEAI 4QJFA 4K0KL 3HOZH 1KXLA 3D31A 4X62L 1J6QA 4R4CA 4HJ5A 3STBD 3G4SA 4BA2I 5JJIA 3KDFA 2BA1A 1K73C 2UUCL 4JI0Q 1HNXL 4OWXB 3NBHB 2YTVA 5IY0A 3PUVA 3HOUG 5C3EH 3U50C 1KHIA 1CUKA 2RHSB 3E9IA 3M9BA 5ELOA 4A3IG 4LF9L 3KF8B 2R92G 3NENA 3K0XA 3I4OA 1NMFA 4LW1A 4UY8C 3K7UC 1PH1A 1XJVA 2R7ZH 1VQEA 2KHIA 4LFCQ 4GLXA 4LFBL 4HJ7A 4DV3L 2Z6KC 4A3BH 5H1SE 5J3BA 1HNWL 5E7NA 4JI3Q 4DV7L 2R93G 5IWAL 2VUMH 1VQLA 4DKAC 4POGA 2CFMA 3HOXH 4DV1Q 2UUAQ 2JA6H 1MIUA 4C3HH 5AJ3Q 3J7ZC 1VQKA 3NELA 3L2PA 2KHJA 2BH8A 3BJUA 4YCWA 4KHPL 1VQDA 1WYDA 4A3KH 4UP9A 4DR7L 1TWAH 3CCMA 1VQIA 2NN6I 2PI2A 3TS0A 1OXUA 4EX5A 1HNZQ 4YWKA 2NVQH 1W2BA 2LXJA 2PMZE 1HR0W 4DAYB 3CPFA 4L5QA 1KC8C 3BZKA 4BY1G 4A3MH 4LWCA 3S1MH 2PQAA 4NXML 4LF5Q 1K0RA 2NVYH 3EN2A 3J80c 3GTLH 2K50A 5C4JH 4IO9A 1IBKQ 5JJKA 1WCMG 1W3SA 1WJJA 1QVCA 2NZHA 4BBRH 1GO3E 4YY3L 2I5HA 1N36L 4A93H 3GTJH 2XTIA 4JYAQ 3S2HH 4C2MH 4JI1L 3M4OH 4RG1A 4PMWA 3I55A 2YTXA 1DGSA 4P75A 2UU9Q 2IX0A 3HFZB 4LFAQ 4DV4Q 3W1BA 3STBC 2OWOA 4P71A 4BXXG 3AFQA 2I5LX 4LNQA 4K0KQ 4IFDJ 1I94L 4X62Q 4JOIA 2R7FA 3FKIG 1S40A 2UUCQ 4GNXA 2Z0SA 1XTDA 3K7AH 1JJCB 2JA9A 1P8LA 1J5EL 1HNXQ 1IL2A 1GVPA 3PUYA 5FLMH 1EOVA 4LF9Q 3S14H 5FJ8G 1JT8A 3VDYA 4NXNL 3B6YA 1CKNA 3CCQA 1K8AC 5IYCH 3AYHB 4AQYL 2JQOA 1KL9A 4LUOA 2GVBA 1VQAA 4YCUA 1OTCA 3GTOH 4OXPA 3OTOQ 4LFBQ 4DV3Q 3PF4A 1B8AA 1PFSA 3I7FA 1HNWQ 4DV7Q 5IWAQ 4GS3A 1FL0A 1MJEA 3U4ZA 2KENA 1X9NA 4DPGA 1NY4A 4DR5L 5M5XH 1YJWA 1VQ8A 4LF4L 3CC2A 2JA7H 4OO1I 2A19A 4L5SA 1HR0L 4QQBX 4O0AA 3CXCA 4DR4L 4JI3L 1VQFA 4A3JH 2F4VL 4KHPQ 2ZTEA 1CKOA 4DR7Q 1JJGA 1YZ6A 4GN5A 5FLXc 4B3TL 5AJ3L 1YJ9A 1M1KC 4MTNA 3I2ZA 1YVCA 2CWAA 2VY3A 1R9TH 2CCZA 3KFUA 2I5MX 1E3PA 1KQSA 4IPDA 1N32L 1X3GA 4PZ7A 4XTCS 2ZM6Q 4C3IH 4OWTB 4B3SQ 4NXMQ 4RMFA 1S3OA 1NJIC 1SLJA 1U5KA 5HY6A 1YITA 3CCUA 5BR8L 1QUQA 2HHHL 3I4MH 3JAMi 4UP7A 5LMNW 1EUJA 1N36Q 2B29A 3ERSX 4LF5L 1UE7A 2ZTCA 4JI1Q 2K5NA 3TREA 2E2HH 3T1YQ 4JBKA 3S1NH 1E1OA 1EWIA 2WAQE 2MNAA 3J7A5 3LGJA 4APVA 4GLAC 5M3MG 1HZCA 3HOYH 3TS2A 4AIMA 1RIPA 1PV4A 5LMUL 1VS0A 2HT1A 3T1HL 1PH9A 4DR2Q 2E2IH 5IYDH 1T9HA 5GQOA 5IE8A 4Y7NH 1VCIA 1OXSC 1E1TA 4P73A 4JI6L 3GTKH 1J5EQ 3PIPA 4DR1L 1C9OA 3HOVH 1VQNA 2UUBL 1FJGL 4R4TA 4IOAA 1TWHH 4KI0A 1K9MC 1G291 2MO0A 4R4QA 4NXNQ 3PO3G 4BY7G 4DAMA 4AQYQ 2JA5G 1N9WA 5IYBG 1JE5A 1L1OB 4YWLA 3PIOA 4A3GG 3HOUH 1G51A 5HGQA 1FGUA 1MJCA 1WI5A 2RCNA 4QGUA 4A3IH 1L0WA 3RZOH 1PH3A 4H02A 5ELNA 1UEBA 3E9HA 5EAYA 1SROA 1TWCH 3H0GH 1VQJA 3PV0A 4DR5Q 2ES2A 4LF4Q 3OTOL 3S1QH 2Y0SE 1KRTA 1HR0Q 4DR4Q 1SRUA 2F4VQ 4BBSG 1B7YB 5C3EG 5C0XG 1PH5A 2A8VA 2AHOB 3CF5A 1K8GA 4B3TQ 2R93H 4JG2A 2WAQG 1LUZA 1NE3A 5JEAG 3CPWA 3H3VI 4L5TA 4GKJL 1BBUA 5LMNL 1PH4A 2CWPA 3AQQA 1JMCA 1UWVA 4JI5L 4GKKL 2RHQB 1I6HH 1N32Q 1X6OA 1EIFA 4IFDG 2AWNA 4QY7A 4A3BG 4A3CH 4QIWE 2IHEA 3PSIA 5GAGC 1YI2A 5BR8Q 2Q2UA 4TQUS 1ASZA 2HHHQ 2N3SA 3HOXG 3UDXA 2VS1A 4JI4L 2ZM6L 2Z6KA 4B3SL 3RLOA 1D7QA 3A74A 4BY1H 3JAMc 1E22A 1LYLA 2V1CC 4X66L 1YBYA 5IP7G 1PH6A 2A1AA 2VQFQ 3RNUA 1VQBA 2CKZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RR5 A;  3DLL A;  2D62 A;  5LMU Q;  2ALY B;  3S1R H;  3L0O A;  3T1H Q;  2JA8 H;  1A0I A;  1FVI A;  2OQK A;  3T1Y L;  1X3F A;  1L1O C;  3PGZ A;  3NEM A;  3J81 i;  3H3V H;  4X6A H;  4JI6 Q;  2K52 A;  1HZA A;  3PUX A;  1N34 L;  3ZJY C;  2OTL A;  4DR1 Q;  3Q8D A;  2QA4 A;  1HH2 P;  1YHA A;  4FDB A;  4DR2 L;  2UXB L;  2Y0S G;  2UUB Q;  1KIX A;  1FJG Q;  2GVA A;  4MNO A;  4B3M L;  1Y1W G;  1Q8K A;  3PUW A;  4BXX H;  2R6G A;  2Q2H A;  4BBR G;  3KF6 A;  1VQG A;  2VL6 A;  4A93 G;  1Q46 A;  4JI2 L;  3FKI H;  3I56 A;  2GN5 A;  1WFQ A;  4J15 A;  1E7Z A;  1XMO L;  2EXD A;  3CCE A;  4A3D G;  2K14 A;  3HKS A;  5FJ8 H;  4LUZ A;  1K3R A;  2PI2 E;  3UDG A;  4LUV A;  2B63 H;  2UXC L;  4PZ6 A;  4QL5 A;  1HJP A;  3GTQ H;  4LF8 L;  2ID0 A;  1YNX A;  4LF6 L;  1XNQ Q;  2AWO A;  1SFO H;  3DM3 A;  3KDF B;  1Q12 A;  3PUZ A;  3JC6 6;  5DLQ E;  5C4X H;  1Q7Y C;  1ASY A;  3S24 A;  1XNR L;  2IX1 A;  1WOC A;  2K75 A;  5IP9 G;  1TWF H;  4A3F H;  2LXK A;  3UDI A;  4DUY L;  3A5U A;  5LMN Q;  2IT1 A;  4GKK Q;  3U58 A;  4GKJ Q;  3ICE A;  4JI5 Q;  1PYS B;  1HZB A;  1QVF A;  3PO2 H;  1IBL L;  5C44 H;  1OXX K;  4LF7 L;  4GN3 B;  3TRZ A;  1JB7 A;  3EBE A;  1VQM A;  1EFW A;  4YCV A;  3SGI A;  1TWG H;  4JI4 Q;  3HOW H;  1RL2 A;  2JA7 G;  4O2D A;  4A3E G;  4X66 Q;  4YWM A;  4DR3 L;  1X56 A;  3I4N H;  1Z9F A;  2NVX H;  1GM5 A;  4GOP C;  1SMX A;  3HKZ E;  3K80 C;  4NB3 A;  2ASB A;  2VQE Q;  4YHH L;  1Q81 C;  2CQO A;  4TVA B;  4WJ4 A;  3CMA A;  4A3L H;  4UP8 A;  1L2F A;  2JE6 I;  2Q2I A;  1PH2 A;  3F2D A;  2VQF L;  1SE8 A;  3RN2 A;  1N34 Q;  2OTJ A;  2RF4 A;  4DNI A;  4DR6 L;  3J81 c;  5M3M H;  2ZJR A;  2UXB Q;  4DUZ L;  3EIV A;  3UDF A;  1PHJ A;  1X55 A;  2KBN A;  3IRB A;  5IT9 c;  5GAH C;  2PQA B;  3J81 j;  3CC7 A;  4DV2 L;  1IBM L;  4B3M Q;  4X65 L;  2MQH A;  1OXT A;  2WFW A;  4JI2 Q;  4DK6 C;  1CSP A;  4HJA A;  1A8V A;  5M5Y H;  1Y1V H;  3MEF A;  2OCE A;  1X54 A;  2DUD A;  3TEH B;  3UE1 A;  4DK3 C;  5C0X I;  1XMO Q;  2D0O A;  5K36 G;  1D8L A;  3CAM A;  1VQO A;  4X64 L;  4P72 A;  5M3F G;  2UXC Q;  3S17 H;  4LF8 Q;  2R7D A;  5GRO A;  1AE3 A;  1Q1B A;  5IYB H;  1KD1 C;  2I0Q A;  2R92 H;  2YTY A;  1QZG A;  2YYZ A;  4LF6 Q;  4IFD I;  4PZ8 A;  4A3G H;  3HOV G;  3HOZ G;  1N33 Q;  1V9P A;  1X65 A;  2LSS A;  1XNR Q;  1XPR A;  1CSQ A;  1VQP A;  1P16 A;  2IHF A;  1SR3 A;  1VQC A;  2HQL A;  1XNQ L;  3HKZ G;  3ULP A;  4DUY Q;  1PH7 A;  3CD6 A;  1CKN B;  2L15 A;  1YIJ A;  4HIO A;  4PG3 A;  3WWV A;  4JCV E;  5GAE C;  3H15 A;  1V43 A;  1Q86 C;  3AEV A;  4BBS H;  1VQ4 A;  4HIM A;  1Y14 B;  3GDE A;  1Q82 C;  1IBL Q;  1S72 A;  3A5Z B;  1A63 A;  2D0P A;  4LF7 Q;  2K5V A;  1BKB A;  2R7Z G;  3CME A;  1TXY A;  1EYG A;  3M85 A;  2YV5 A;  3H0G G;  3W5O A;  4DR3 Q;  2VUM G;  1QVG A;  2VW9 A;  2JA6 G;  2AKW B;  1UE1 A;  3PF5 A;  3E0E A;  2DGY A;  2K5H A;  4YHH Q;  2ZJQ A;  1CKM A;  3F8T A;  2EIF A;  4EQ5 A;  2E2J H;  1H95 A;  2F52 A;  4XIG S;  1VQ7 A;  4B3R L;  2MO1 A;  1Z47 A;  2WP8 J;  2NVT H;  3GD7 A;  2VQE L;  4DR6 Q;  1WCM H;  5IP7 H;  4ALP A;  2AMC B;  1SN8 A;  5M5W H;  1PH8 A;  4DUZ Q;  4A3C G;  1IBM Q;  4P74 A;  4DV2 Q;  1JJ2 A;  4IJL A;  4OX9 L;  2YU9 H;  4A3M G;  1YHB A;  4X65 Q;  2ZTD A;  2UXD L;  4KLK A;  3G71 A;  3GTP H;  3BZC A;  4C3J H;  1AH9 A;  3MXN B;  4JOI C;  2WB1 E;  1EIY B;  1QUQ B;  4HJ8 A;  1G6P A;  4JV5 L;  3A0J A;  1VQH A;  4DV5 Q;  3ULJ A;  4GNX C;  4GOP B;  2KCM A;  4JBJ A;  2EQS A;  3M4Q A;  1GD7 A;  1I5F A;  2N78 A;  1IZ6 A;  1UE5 A;  4JI8 L;  4X64 Q;  1Y1W H;  2E5L L;  4JI7 L;  1EQR A;  2JA8 G;  5C0X J;  3TQY A;  3CP0 A;  2BA0 A;  2FXQ A;  2JEB I;  4DV6 L;  1XMQ L;  1N8R C;  4WJ3 M;  2NN6 G;  3PCO B;  5JEA J;  4AYB E;  3CCL A;  1M90 C;  1L1O A;  2H5X A;  1YJN A;  4A3K G;  4L5R C;  4A3D H;  2OQ0 A;  3ULL A;  3OYY A;  1LM0 A;  3CC4 A;  2VZA A;  3M4P A;  4JI0 L;  4GLV B;  2KCT A;  3M7N A;  3G48 A;  4DV0 L;  2XGT A;  1YEZ A;  4JBM A;  1XPO A;  1N33 L;  5FLM G;  1PYB A;  1Q1E A;  4OWW B;  3CCS A;  3KJO A;  1QZH A;  1GKH A;  5IYC G;  2Q2T A;  1XPU A;  4OON A;  4A76 A;  3S16 H;  4A4I A;  3RZD H;  3FHW A;  2B63 G;  1O7I A;  1VQ5 A;  4AH6 A;  5IP9 H;  2QEX A;  4JBW A;  2MFI A;  5GAD C;  1KAW A;  1OXV A;  3KLW A;  4GN4 B;  4HIK A;  5C4X G;  2WB1 G;  3K81 C;  4R1J A;  2K4K A;  1VQ6 A;  1IYJ B;  2N8N A;  4ME3 A;  2VNU D;  4LFC L;  4A3J G;  3F2C A;  2PNH A;  3F2B A;  4BA1 I;  1EQQ A;  4A3F G;  3CW2 C;  4B3R Q;  2N49 A;  4A3E H;  4IPC A;  1AE2 A;  4Y52 H;  3UE0 A;  3GTM H;  1E24 A;  2E8G A;  4UPA A;  1A62 A;  1BBW A;  3U4V A;  3RLF A;  4DV1 L;  3PO2 G;  2UUA L;  5C44 G;  3FP9 A;  2F3I A;  4OX9 Q;  1NBW A;  3G6E A;  4IOC A;  4AYB G;  3F1Z A;  1PA6 A;  3HOW G;  2UXD Q;  3CCR A;  3S15 H;  3KJP A;  3RLN A;  4A75 A;  2QGQ A;  2JJQ A;  3M3Y H;  4IJH A;  3GTG H;  4JV5 Q;  2HIV A;  1B70 B;  2ZJP A;  1NMG A;  4HID A;  3I4N G;  2JK8 A;  4NPS A;  1HNZ L;  3CQZ H;  3I4M G;  1C7Y A;  3BU2 A;  3RN5 A;  1PVO A;  1V1Q A;  4JI7 Q;  2C35 B;  4JI8 Q;  4OO1 G;  1MKH A;  3J80 i;  4YY3 Q;  2E5L Q;  2ATW A;  4DV5 L;  4A3L G;  2IY5 B;  5JJL A;  1YHQ A;  4R4O A;  3CCJ A;  4GOP A;  1IXR A;  1K83 H;  1X3E A;  2B3G A;  2BH2 A;  3HOY G;  4DV6 Q;  1XMQ Q;  4POF A;  3S2D H;  1IBK L;  1I3Q H;  1NTG A;  1UE6 A;  1C0A A;  4BY7 H;  3PO3 H;  3KOJ A;  1U0L A;  3ER0 A;  3K8A A;  3OW2 A;  5IYD G;  2JA5 H;  1I50 H;  4JYA L;  4HJ9 A;  3GO5 A;  2NZO A;  1BVS A;  1LTL A;  4R4I A;  3W1G A;  3KYH C;  3AFP A;  5M3F H;  1I94 Q;  2UU9 L;  1VQ9 A;  2HIX A;  4KHZ A;  3L7Z C;  4MZ9 A;  4DV0 Q;  1KRS A;  4DV4 L;  4GNX B;  1HZ9 A;  3D0F A;  4LFA L;  3KF6 B;  1Y1V G;  4JC0 A;  3CCV A;  4IPG A;  4IPH A;  2JEA I;  4QJF A;  4K0K L;  3HOZ H;  1KXL A;  3D31 A;  4X62 L;  1J6Q A;  4R4C A;  4HJ5 A;  3STB D;  3G4S A;  4BA2 I;  5JJI A;  3KDF A;  2BA1 A;  1K73 C;  2UUC L;  4JI0 Q;  1HNX L;  4OWX B;  3NBH B;  2YTV A;  5IY0 A;  3PUV A;  3HOU G;  5C3E H;  3U50 C;  1KHI A;  1CUK A;  2RHS B;  3E9I A;  3M9B A;  5ELO A;  4A3I G;  4LF9 L;  3KF8 B;  2R92 G;  3NEN A;  3K0X A;  3I4O A;  1NMF A;  4LW1 A;  4UY8 C;  3K7U C;  1PH1 A;  1XJV A;  2R7Z H;  1VQE A;  2KHI A;  4LFC Q;  4GLX A;  4LFB L;  4HJ7 A;  4DV3 L;  2Z6K C;  4A3B H;  5H1S E;  5J3B A;  1HNW L;  5E7N A;  4JI3 Q;  4DV7 L;  2R93 G;  5IWA L;  2VUM H;  1VQL A;  4DKA C;  4POG A;  2CFM A;  3HOX H;  4DV1 Q;  2UUA Q;  2JA6 H;  1MIU A;  4C3H H;  5AJ3 Q;  3J7Z C;  1VQK A;  3NEL A;  3L2P A;  2KHJ A;  2BH8 A;  3BJU A;  4YCW A;  4KHP L;  1VQD A;  1WYD A;  4A3K H;  4UP9 A;  4DR7 L;  1TWA H;  3CCM A;  1VQI A;  2NN6 I;  2PI2 A;  3TS0 A;  1OXU A;  4EX5 A;  1HNZ Q;  4YWK A;  2NVQ H;  1W2B A;  2LXJ A;  2PMZ E;  1HR0 W;  4DAY B;  3CPF A;  4L5Q A;  1KC8 C;  3BZK A;  4BY1 G;  4A3M H;  4LWC A;  3S1M H;  2PQA A;  4NXM L;  4LF5 Q;  1K0R A;  2NVY H;  3EN2 A;  3J80 c;  3GTL H;  2K50 A;  5C4J H;  4IO9 A;  1IBK Q;  5JJK A;  1WCM G;  1W3S A;  1WJJ A;  1QVC A;  2NZH A;  4BBR H;  1GO3 E;  4YY3 L;  2I5H A;  1N36 L;  4A93 H;  3GTJ H;  2XTI A;  4JYA Q;  3S2H H;  4C2M H;  4JI1 L;  3M4O H;  4RG1 A;  4PMW A;  3I55 A;  2YTX A;  1DGS A;  4P75 A;  2UU9 Q;  2IX0 A;  3HFZ B;  4LFA Q;  4DV4 Q;  3W1B A;  3STB C;  2OWO A;  4P71 A;  4BXX G;  3AFQ A;  2I5L X;  4LNQ A;  4K0K Q;  4IFD J;  1I94 L;  4X62 Q;  4JOI A;  2R7F A;  3FKI G;  1S40 A;  2UUC Q;  4GNX A;  2Z0S A;  1XTD A;  3K7A H;  1JJC B;  2JA9 A;  1P8L A;  1J5E L;  1HNX Q;  1IL2 A;  1GVP A;  3PUY A;  5FLM H;  1EOV A;  4LF9 Q;  3S14 H;  5FJ8 G;  1JT8 A;  3VDY A;  4NXN L;  3B6Y A;  1CKN A;  3CCQ A;  1K8A C;  5IYC H;  3AYH B;  4AQY L;  2JQO A;  1KL9 A;  4LUO A;  2GVB A;  1VQA A;  4YCU A;  1OTC A;  3GTO H;  4OXP A;  3OTO Q;  4LFB Q;  4DV3 Q;  3PF4 A;  1B8A A;  1PFS A;  3I7F A;  1HNW Q;  4DV7 Q;  5IWA Q;  4GS3 A;  1FL0 A;  1MJE A;  3U4Z A;  2KEN A;  1X9N A;  4DPG A;  1NY4 A;  4DR5 L;  5M5X H;  1YJW A;  1VQ8 A;  4LF4 L;  3CC2 A;  2JA7 H;  4OO1 I;  2A19 A;  4L5S A;  1HR0 L;  4QQB X;  4O0A A;  3CXC A;  4DR4 L;  4JI3 L;  1VQF A;  4A3J H;  2F4V L;  4KHP Q;  2ZTE A;  1CKO A;  4DR7 Q;  1JJG A;  1YZ6 A;  4GN5 A;  5FLX c;  4B3T L;  5AJ3 L;  1YJ9 A;  1M1K C;  4MTN A;  3I2Z A;  1YVC A;  2CWA A;  2VY3 A;  1R9T H;  2CCZ A;  3KFU A;  2I5M X;  1E3P A;  1KQS A;  4IPD A;  1N32 L;  1X3G A;  4PZ7 A;  4XTC S;  2ZM6 Q;  4C3I H;  4OWT B;  4B3S Q;  4NXM Q;  4RMF A;  1S3O A;  1NJI C;  1SLJ A;  1U5K A;  5HY6 A;  1YIT A;  3CCU A;  5BR8 L;  1QUQ A;  2HHH L;  3I4M H;  3JAM i;  4UP7 A;  5LMN W;  1EUJ A;  1N36 Q;  2B29 A;  3ERS X;  4LF5 L;  1UE7 A;  2ZTC A;  4JI1 Q;  2K5N A;  3TRE A;  2E2H H;  3T1Y Q;  4JBK A;  3S1N H;  1E1O A;  1EWI A;  2WAQ E;  2MNA A;  3J7A 5;  3LGJ A;  4APV A;  4GLA C;  5M3M G;  1HZC A;  3HOY H;  3TS2 A;  4AIM A;  1RIP A;  1PV4 A;  5LMU L;  1VS0 A;  2HT1 A;  3T1H L;  1PH9 A;  4DR2 Q;  2E2I H;  5IYD H;  1T9H A;  5GQO A;  5IE8 A;  4Y7N H;  1VCI A;  1OXS C;  1E1T A;  4P73 A;  4JI6 L;  3GTK H;  1J5E Q;  3PIP A;  4DR1 L;  1C9O A;  3HOV H;  1VQN A;  2UUB L;  1FJG L;  4R4T A;  4IOA A;  1TWH H;  4KI0 A;  1K9M C;  1G29 1;  2MO0 A;  4R4Q A;  4NXN Q;  3PO3 G;  4BY7 G;  4DAM A;  4AQY Q;  2JA5 G;  1N9W A;  5IYB G;  1JE5 A;  1L1O B;  4YWL A;  3PIO A;  4A3G G;  3HOU H;  1G51 A;  5HGQ A;  1FGU A;  1MJC A;  1WI5 A;  2RCN A;  4QGU A;  4A3I H;  1L0W A;  3RZO H;  1PH3 A;  4H02 A;  5ELN A;  1UEB A;  3E9H A;  5EAY A;  1SRO A;  1TWC H;  3H0G H;  1VQJ A;  3PV0 A;  4DR5 Q;  2ES2 A;  4LF4 Q;  3OTO L;  3S1Q H;  2Y0S E;  1KRT A;  1HR0 Q;  4DR4 Q;  1SRU A;  2F4V Q;  4BBS G;  1B7Y B;  5C3E G;  5C0X G;  1PH5 A;  2A8V A;  2AHO B;  3CF5 A;  1K8G A;  4B3T Q;  2R93 H;  4JG2 A;  2WAQ G;  1LUZ A;  1NE3 A;  5JEA G;  3CPW A;  3H3V I;  4L5T A;  4GKJ L;  1BBU A;  5LMN L;  1PH4 A;  2CWP A;  3AQQ A;  1JMC A;  1UWV A;  4JI5 L;  4GKK L;  2RHQ B;  1I6H H;  1N32 Q;  1X6O A;  1EIF A;  4IFD G;  2AWN A;  4QY7 A;  4A3B G;  4A3C H;  4QIW E;  2IHE A;  3PSI A;  5GAG C;  1YI2 A;  5BR8 Q;  2Q2U A;  4TQU S;  1ASZ A;  2HHH Q;  2N3S A;  3HOX G;  3UDX A;  2VS1 A;  4JI4 L;  2ZM6 L;  2Z6K A;  4B3S L;  3RLO A;  1D7Q A;  3A74 A;  4BY1 H;  3JAM c;  1E22 A;  1LYL A;  2V1C C;  4X66 L;  1YBY A;  5IP7 G;  1PH6 A;  2A1A A;  2VQF Q;  3RNU A;  1VQB A;  2CKZ B; 
#chains in the Genus database with same CATH topology
 2ALY B;  3T1H Q;  3T1Y L;  4C3J B;  4R8N A;  1X3F A;  4JI6 Q;  1U4R A;  4CJ0 B;  2OTL A;  4IUT A;  1FJG Q;  5KIX A;  2VL6 A;  1XXG A;  3BVZ A;  4JI2 L;  1EYA A;  5EKK A;  1WFQ A;  4ZLT F;  3FMC A;  4RCN A;  3NBH A;  1MBY A;  2K14 A;  3HKS A;  1Q3L A;  4L8J A;  2B63 H;  4PZ6 A;  1HJP A;  4DFA A;  3QJY A;  2ID0 A;  1YNX A;  1AZQ A;  1CZW A;  1SFO H;  3KDF B;  1ASY A;  3PUZ A;  4QUC A;  3RZD B;  3TP6 A;  2IX1 A;  5EBC A;  4DUY L;  5IOD A;  2IT1 A;  5DM6 3;  3ICE A;  4JI5 Q;  1PYS B;  1HZB A;  2VB3 X;  4DF7 A;  1ZXT A;  5J1Z A;  1EY0 A;  3VR5 A;  1IBL L;  1EEF D;  4KK7 A;  5BN3 A;  2L12 A;  1HTP A;  1QWY A;  2Q8I B;  1EEI D;  1VQM A;  2F0M A;  2B2T C;  1JWU D;  1TKW B;  4L6T B;  2F4I A;  3HOW H;  1SMY C;  1X56 A;  2K5W A;  1GM5 A;  4GOP C;  1SMX A;  3K80 C;  2VQE Q;  3DWP A;  3CMA A;  4XDX A;  2K33 A;  1I4X A;  1KTK A;  2JE6 I;  5DEH A;  1BF4 A;  1LT4 D;  1F9S A;  1IYU A;  2QDL A;  1SE8 A;  3C3L A;  2OTJ A;  1SYD A;  3UI2 A;  4DR6 L;  3J81 c;  1G8Z D;  3EIV A;  3UDF A;  1X55 A;  1EY7 A;  1MHW C;  2PQA B;  2HUG A;  4N9P A;  2B8G A;  2WFW A;  3S2D B;  1A8V A;  5M5Y H;  2MJ8 A;  1X54 A;  4DK3 C;  3PMF A;  2D0O A;  5M3F B;  5C3X A;  4LF8 Q;  4CDE C;  1D5Z C;  2R92 H;  2YTY A;  4PZ8 A;  1DYQ A;  1U4M A;  4KY7 A;  1B53 A;  2EDG A;  3V2T A;  1RJT A;  2L15 A;  1YIJ A;  1A3U A;  3L3O C;  3AEV A;  1V43 A;  4HIM A;  1Y14 B;  3NTI A;  1H9J A;  5CR3 A;  1EU3 A;  1EYG A;  3SK8 A;  3H0G G;  5JEA H;  3W5O A;  2NYZ D;  1XWE A;  2EPB A;  1H9K A;  4HMJ A;  2VUM B;  4HAE A;  4OEL B;  4DR3 Q;  3OPO A;  2IWH A;  5IGC A;  3E0J A;  2DGY A;  2K5H A;  4YHH Q;  1CKM A;  4H7B A;  2EIF A;  2E2J H;  4K6D A;  2MO1 A;  4QMG A;  1D1I A;  2VQE L;  3SXH A;  1WCM H;  5IP7 H;  1SN8 A;  3SEB A;  3I72 A;  4KD4 A;  4DUZ Q;  4A3C G;  2BE5 C;  3DEO A;  1ILQ A;  1QNU A;  1TY2 A;  4IJL A;  2YU9 H;  4A3M G;  3WOF A;  3G71 A;  4C3J H;  2SNM A;  2C5C A;  1EIY B;  1QUQ B;  5C4H A;  3ERQ A;  4JV5 L;  1VQH A;  4EQO A;  3GQB A;  1F9R A;  4N8F A;  5LL6 X;  4GOP B;  2KCM A;  4OEM B;  3GTJ B;  1GD7 A;  3I73 A;  3S2H B;  1UE5 A;  2LMC B;  5BN5 A;  2O2L D;  4PMC A;  3ND8 A;  1SE4 A;  2NBF A;  1LTS D;  2BA0 A;  2FXQ A;  3TP5 A;  1FD7 D;  4FF3 A;  1RTN A;  4RKL A;  2NN6 G;  3PCO B;  5JEA J;  1FNV A;  1SE2 A;  4L5R C;  4RWS C;  2F0T A;  3MXP A;  5G3L F;  1LM0 A;  1Y8O B;  3CC4 A;  2IPK D;  2VZA A;  4GLV B;  4DV0 L;  2JYO A;  5IGD A;  5FLM G;  1LT5 D;  4TKO B;  3H6M A;  5FLX E;  5IYC G;  1BO0 A;  2Q8R E;  1KAA A;  3RZD H;  3CRL C;  1EY5 A;  4ZQ3 A;  5GAD C;  1KAW A;  1W6K A;  4DNR B;  4RGN A;  4O42 A;  1O80 A;  2XNA C;  3K5O A;  2WB1 G;  2JA7 B;  4R1J A;  5C4X G;  4ZYS A;  2AUK A;  3RUZ A;  4A3J G;  2O5I C;  3NSW A;  2XRS D;  3HZX A;  1DON A;  1PRT F;  2RDF A;  3V05 A;  1BBW A;  1RDP D;  3RLF A;  4PMB A;  4KHV A;  2UUA L;  3PO2 G;  5C44 G;  1KDB A;  4WJW A;  1BDO A;  1TVX A;  2Z8L A;  2K05 A;  3F1Z A;  2UXD Q;  3D4D A;  3OWF A;  1EIH A;  3KJP A;  4A75 A;  3I4M B;  4NPS A;  5IOC A;  3BU2 A;  2BE5 D;  2F0W A;  4OHJ A;  3RN5 A;  5DAU A;  2C35 B;  4A3L G;  3HOY B;  1X3E A;  2BH2 A;  3S2D H;  1IBK L;  1NTG A;  4S3S A;  1UE6 A;  4CHT B;  4FNF A;  5IYD G;  1T5E A;  4JYA L;  4HJ9 A;  3W1G A;  2BOS A;  5M3F H;  2KVM A;  3HOV B;  3L7Z C;  4IUQ A;  4LFA L;  1HZ9 A;  1Y1V G;  4JC0 A;  2RDH A;  3EA6 A;  3D31 A;  4X62 L;  4BA2 I;  2AQ1 B;  5JJI A;  3JAM L;  1F2Z A;  2X6G A;  1HNX L;  1DOM A;  1I6V C;  3HRZ C;  2L9H A;  3HOU G;  2QIL A;  2RHS B;  3M9B A;  3K0X A;  3IFT A;  1L0Y B;  3S1Q B;  4UY8 C;  3VYS A;  1PH1 A;  4J1M A;  3AB9 A;  2BCO A;  2TSS A;  2F0P A;  4HJ7 A;  5JPN C;  2Z6K C;  5H1S E;  4JI3 Q;  2VUM H;  1VQL A;  4POG A;  2DNC A;  4DV1 Q;  2PW5 A;  5AJ3 Q;  5KNC A;  4CBV A;  3NEL A;  3C2P A;  1F9Q A;  3MXU A;  2BDN A;  2EZV A;  1WTP A;  4K5V A;  4YWK A;  4JPB W;  1QNK A;  2LXJ A;  2PMZ E;  4DAY B;  4BY1 B;  3BYY B;  1KC8 C;  2R3Z A;  1EY9 A;  3J80 c;  2JA8 B;  4KN4 C;  3GTJ H;  2EYH A;  3CRK C;  1DXM A;  3S2H H;  1GOZ A;  3BZD B;  3I55 A;  2DY7 A;  2UU9 Q;  2IX0 A;  4DK0 A;  3W1B A;  4P71 A;  4BXX G;  2EJM A;  3FKI B;  2HDL A;  3PQI A;  4GNX A;  3IFD A;  2PNR C;  1P8L A;  1ROD A;  1B3Q A;  3PUY A;  1EOV A;  4LF9 Q;  1LTT D;  4ZRZ A;  5FJ8 G;  4NXN L;  5CV8 A;  1S5F D;  1LTB D;  4AQY L;  3LX0 A;  2KED A;  3KLS A;  1KDC A;  2L1B A;  5EKI A;  1B9N A;  1IYV A;  2WII B;  2RCF A;  4OXP A;  2K01 A;  1BBX C;  5IT9 L;  4XQQ A;  1RCV D;  1TWF B;  1NY4 A;  1VQ8 A;  4OO1 I;  2JA7 H;  4O0A A;  3CXC A;  1ZKO A;  4JI3 L;  2F4V L;  5KNB A;  1CKO A;  1JJG A;  1HQR D;  4GN5 A;  5AJ3 L;  3J81 E;  1YJ9 A;  3FDT A;  4AYB B;  3NTH A;  2Z4H A;  5A2Q L;  2CWA A;  2FJ2 A;  3DHQ A;  1E3P A;  2NVX B;  1E2Z A;  4DXF A;  1X3G A;  3VYU A;  1N32 L;  3A56 A;  4OWT B;  4NXM Q;  3R2I A;  4RMF A;  5D3I B;  3MXN A;  1B4O A;  3I4M H;  3JAM i;  1BR9 A;  4RHR A;  3QIA A;  4OO1 H;  1PTO F;  1E1O A;  2WAQ E;  5ELD A;  2MNA A;  2A6E C;  2F0J A;  5M3M G;  3LNN A;  4Y7N B;  3HOY H;  5E4W C;  1B1Z A;  1PH9 A;  2Z9H A;  5IE8 A;  2RQX A;  1MI2 A;  1TWH B;  1J5E Q;  4CJ1 B;  4J8Q A;  3HOV H;  1I4P A;  2UUB L;  1STE A;  4IOA A;  1G29 1;  5FO8 B;  4DAM A;  4MTK A;  2A68 C;  2J0T D;  1JE5 A;  4YWL A;  3PIO A;  4A3G G;  1YNN D;  5HGQ A;  1WI5 A;  4RCO A;  1BCP D;  2EXZ A;  3E9H A;  3MAQ A;  3S1Q H;  1VQJ A;  2F0K A;  4DR5 Q;  4LF4 Q;  3NXW A;  1GUW A;  4BBS B;  4XYQ A;  1M8A A;  1BCP B;  2WAQ B;  1EWC A;  2WKD A;  5EJW A;  1F2L A;  4GKJ L;  1BBU A;  4C56 C;  3AQQ A;  1UWV A;  5JVG 3;  2RHQ B;  1X6O A;  2E74 C;  2R61 A;  4A3B G;  4QIW E;  3PSI A;  2DY8 A;  3MHB A;  2X6L A;  5BR8 Q;  2G9H D;  1ASZ A;  2J4X A;  1HTL D;  4KN7 C;  2VS1 A;  4JI4 L;  3RLO A;  3A74 A;  4ZAI A;  1DJR D;  4BY1 H;  2M9V A;  1TR5 A;  1ENA A;  1PH6 A;  2A1A A;  4A3K G;  5ELE A;  3RNU A;  1VQB A;  2ZXO A;  3DLL A;  5LMU Q;  2D62 A;  1VDZ A;  3L0O A;  2JA8 H;  1I4H A;  1FVI A;  2OQK A;  1GUO A;  2DJF C;  1L1O C;  5FKA C;  2JSO A;  3NEM A;  4X6A H;  1N34 L;  1HFN A;  1EQT A;  4DR1 Q;  1QE6 A;  3K0Y A;  1HH2 P;  1O78 A;  2UXB L;  2Y0S G;  2GVA A;  4MNO A;  1Y1W G;  2Q2H A;  1LTR D;  4BBR G;  3KF6 A;  4R9W A;  1VQG A;  4A93 G;  3FKI H;  1BNZ A;  3I56 A;  3GV6 A;  5C3W A;  1XMO L;  3CCE A;  2PI2 E;  4LUV A;  1NNX A;  4QIW B;  3KF8 A;  4LF6 L;  2AWO A;  3JC6 6;  2FIN B;  2HCI A;  4KY5 A;  1CA5 A;  3S24 A;  1Z6H A;  5IP9 G;  1TWF H;  2LXK A;  4GKK Q;  1QVF A;  4KJN A;  3P20 A;  2PQE A;  5COY A;  2EYL A;  4GN3 B;  3TRZ A;  3EBE A;  1EFW A;  3SGI A;  3Q24 A;  1K3B C;  4A3E G;  2CW0 D;  1LTA D;  4QB4 A;  1KLG D;  2NTS A;  2ZXR A;  2NVX H;  2ASB A;  1AN8 A;  1VF5 C;  4G4K A;  4H0L C;  4IUU A;  4TVA B;  2XN9 C;  3J7Y W;  2Q2I A;  3GTG B;  1Y8P B;  2B2V A;  4DNI A;  5COR A;  3U9O A;  4KKU A;  2B2U C;  5GAH C;  1G91 A;  4X3T A;  1VMP A;  2LKV A;  4X65 L;  2MQH A;  2B8F A;  1OXT A;  4JI2 Q;  4DK6 C;  3EJI A;  2SDF A;  3A7L A;  3MEF A;  2OCE A;  4BY7 B;  2F03 A;  3TZD A;  1I50 B;  2JA5 B;  4Z9C B;  1ONL A;  1VQO A;  4X64 L;  1PZK D;  5E3F A;  2K5D A;  3H91 A;  1SE3 A;  2R7D A;  5IYB H;  5E1F A;  2F0H A;  3E5S A;  4IFD I;  5F2D A;  1X65 A;  1JOR A;  4PV1 C;  1CSQ A;  5J39 A;  1P16 A;  3O13 A;  1VQC A;  1VQP A;  1ILP A;  4DUY Q;  4N8X 1;  1JWS D;  1PH7 A;  1CKN B;  3MTS A;  4CKC A;  1KNE A;  3WWV A;  3LWU A;  4BBS H;  1SNM A;  4NW2 A;  3TP7 A;  1VQ4 A;  1Q82 C;  1A6X A;  1IBL Q;  2WKC A;  2D0P A;  2OEO A;  2R7Z G;  1BKB A;  2KCN A;  5K5P A;  2EJF C;  5CMD A;  3HOX B;  3J80 E;  3X3N A;  4IFD H;  3G6J B;  2JA6 G;  3E0E A;  4C3H G;  3SHL A;  1RTO A;  3KUP A;  4XIG S;  4B3R L;  1TWA B;  1NR4 A;  4RGO S;  3GD7 A;  5C5L A;  1E0B A;  4DR6 Q;  2AMC B;  3H94 A;  3KBX A;  1IHZ A;  4A3M B;  3BVG A;  1JJ2 A;  4F87 A;  4OX9 L;  2HD3 A;  1YHB A;  4RHS A;  1TY0 A;  4LAA A;  4KLK A;  1AH9 A;  3BZC A;  5C4J B;  2PZW A;  2WB1 E;  4HJ8 A;  3A54 A;  2EY5 A;  4JBJ A;  1PXU A;  4IAL A;  3M4O B;  4DU9 A;  2E5L L;  5M9O A;  5FLX L;  1XMQ L;  1L0X B;  2X69 A;  2QF7 A;  1M90 C;  1UAP A;  3MZ5 A;  3OYY A;  3K7A B;  2QW7 A;  2KCT A;  3M7N A;  4V0B A;  3G48 A;  4XXE A;  3TME A;  4OWW B;  3VR3 A;  3DWQ A;  1XPU A;  4OON A;  1RF2 D;  4A4I A;  1DZ1 A;  5T1I A;  4V19 0;  2B63 G;  1O7I A;  1VQ5 A;  3GTO B;  3QG1 A;  1H9S B;  3T56 B;  4JBW A;  5KYL A;  1SBB B;  1Q90 A;  1H9M A;  5M5X B;  4UHV A;  2K4K A;  3QO2 A;  1IYJ B;  4A3J B;  4ME3 A;  2VNU D;  4LFC L;  5HGT A;  3F2C A;  3CU7 A;  4BA1 I;  1CQF A;  3OW7 A;  4IPC A;  4UPA A;  1A62 A;  1I4Q A;  4RGM A;  3K57 A;  3FP9 A;  4EVO A;  3IAY A;  3G6E A;  4C3I B;  4CKE A;  3HOW G;  3MVV A;  3CCR A;  3RLN A;  2CQA A;  3VYT A;  2QGQ A;  4IJH A;  1Y69 U;  3GTG H;  2Q8T A;  4JV5 Q;  1B70 B;  1NMG A;  1HNZ L;  2B2T A;  3MEH A;  2QCP X;  1SNP A;  2E2H B;  2F0I A;  4CDF C;  2A6H D;  2L55 A;  3I3C A;  4GOP A;  1EY8 A;  1C0A A;  4ZK9 B;  4BY7 H;  2JA5 H;  1I50 H;  2NZO A;  3E3X A;  1SNQ A;  2XSC A;  3MWY W;  4DV0 Q;  3EVQ A;  3RD4 A;  4LMQ D;  3NPP A;  5JOB A;  4IPG A;  1YNJ D;  4K0K L;  1KLU D;  3QWN A;  4HJ5 A;  3STB D;  3HOU B;  3NBH B;  2YTV A;  1O7L A;  1TS3 A;  3NHH A;  3U50 C;  1ZYR D;  3E9I A;  2F0L A;  5ELO A;  2R92 G;  1E2W A;  3C46 A;  1S5E D;  3GV3 A;  1NMF A;  5TSS A;  3K7U C;  2KHI A;  4LFB L;  3R8B A;  2R93 G;  4DV7 L;  3HOX H;  2UUA Q;  1MIU A;  2EYF A;  3J7Z C;  1I6H B;  3L2P A;  2KHJ A;  5EGT A;  2BH8 A;  4KHP L;  4YCW A;  1VQD A;  3D6W A;  4DR7 L;  4UP9 A;  1TWA H;  2NN6 I;  4RKB A;  3BG3 A;  2H4O A;  1UUP A;  1Q8I A;  4L5Q A;  2JXM B;  2PZT A;  3VR6 A;  4A3M H;  1K0R A;  3EN2 A;  3CHB D;  2K50 A;  5C4J H;  1CK1 A;  2D9U A;  4IO9 A;  1IBK Q;  5JJK A;  1WCM G;  1X3P A;  2NZH A;  2I5H A;  2B2Y C;  4JYA Q;  3C1E A;  1E2V A;  4B9W A;  3M4O H;  1SSO A;  4CGY B;  4I7A A;  1DGS A;  4K5W A;  4P75 A;  4C3J G;  3HG9 A;  3HFZ B;  4LFA Q;  3KLS X;  3NTK A;  4IUR A;  3AFQ A;  2I5L X;  1LT6 D;  1NR2 A;  3OIQ A;  1F9P A;  4X62 Q;  3D4R A;  2R7F A;  4X3U A;  2RDG A;  1D5X C;  4KD3 A;  1XTD A;  3K7A H;  1JJC B;  2JA9 A;  4QF4 A;  1EIG A;  4XQN A;  1HNX Q;  4B9X A;  1IL2 A;  5FLM H;  1S5D D;  4KMU C;  3B6Y A;  3CCQ A;  2FMM A;  5IYC H;  3AYH B;  3QOL A;  2JQO A;  3K6O A;  1ENC A;  1LV9 A;  1QOH A;  1JC7 A;  3DEP A;  3J81 L;  2RSO A;  3GTO H;  2F0Q A;  4K2L A;  1B8A A;  1MJE A;  4GS3 A;  1D1K A;  3U4Z A;  4A3F B;  3MXG A;  5M5X H;  1LT3 D;  1YJW A;  1A3T A;  3CC2 A;  2A19 A;  4QQB X;  4DR4 L;  1VQF A;  4A3J H;  1EQV A;  1MSG A;  4I65 A;  1K0S A;  1YZ6 A;  2IX3 A;  1PZI D;  2VY3 A;  4IUP A;  3HGB A;  4MHE A;  1MGS A;  3I4N B;  1KQS A;  4IPD A;  2ZM6 Q;  1IW7 D;  4C3I H;  3M7G A;  2D2C C;  1F77 A;  3CCU A;  4J6H A;  1AFP A;  4UP7 A;  5LMN W;  4G7O C;  2B29 A;  2BDO A;  2L11 A;  2E2H H;  1STB A;  2K1B A;  5M3M B;  1EYD A;  4GLA C;  5NUC A;  4DR2 Q;  3Q22 A;  2F0N A;  5IYD H;  1G6Z A;  5ELF A;  4P73 A;  2RBM A;  5EPL A;  2F0O A;  2PPB C;  2CH4 W;  3HEJ A;  2V4D A;  1CHP D;  1KDA A;  1VQN A;  2PW7 A;  1CHQ D;  4NXN Q;  3S17 B;  2IJ0 A;  4RFB A;  1HUN A;  4AQY Q;  1EYC A;  5C4Z A;  4A3G B;  4GZY C;  3HOU H;  3BDL A;  1FGU A;  4RGT A;  4QGU A;  2RCN A;  1L0W A;  2B2W C;  1PH3 A;  3MC0 B;  1SRO A;  3K59 A;  3DXJ C;  2Y0S E;  2XIW A;  1SRU A;  2H1E A;  2KCC A;  2F4V Q;  1B7Y B;  1K8O A;  5C0X G;  1PH5 A;  1EY4 A;  3CF5 A;  2TMP A;  3K58 A;  2SEB D;  1NE3 A;  3QOJ A;  4U68 A;  1JWM D;  1ICF B;  4L5T A;  5LMN L;  2K04 A;  2CWP A;  2N88 A;  2K03 A;  2F0E A;  1I6H H;  1N32 Q;  3OHX C;  4QY7 A;  1C4Q A;  2IHE A;  2KUM A;  5GAG C;  1V1P A;  2RSN A;  2N3S A;  2XWB B;  3P7J A;  3NWT A;  2ZM6 L;  2Z6K A;  2NVT B;  1SJH D;  3SE0 A;  1E22 A;  1LYL A;  4X66 L;  1YBY A;  1R4P B;  5M5W B;  2MHV A;  1C48 A;  3D6C A;  1JCK B;  1HHV A;  3PGZ A;  3J81 i;  1G2S A;  3NE5 B;  2AQ3 B;  3J7A V;  2QA4 A;  1YHA A;  4FDB A;  4DR2 L;  4UAI A;  2UUB Q;  4ABN A;  3DWA A;  4BXX H;  4B3M L;  1HA5 A;  3PUW A;  3KLR A;  2R6G A;  4XT3 B;  1SND A;  1YNN C;  2FMC A;  3R93 A;  2J7Z A;  1TII D;  1JIC A;  2RA4 A;  3DMU A;  1BCP C;  3TBI B;  1RKN A;  2EXD A;  3OMG A;  4A3D G;  5FJ8 H;  1S5C D;  3J7A F;  4ULL A;  1K3R A;  3UDG A;  2UXC L;  2PMZ B;  2ICE C;  1STH A;  4LJZ C;  1XNR L;  1WOC A;  2K75 A;  2PCF B;  4A3F H;  4GKJ Q;  3A5U A;  3U58 A;  3U9S A;  1PZJ D;  2F0D A;  1JE4 A;  1OXX K;  4LF7 L;  4EQN A;  1JB7 A;  2K7V A;  4YCV A;  3SK4 A;  5AFW A;  4UDU C;  4JI4 Q;  4A3E B;  2JA7 G;  4O2D A;  4YWM A;  3I4N H;  1Z9F A;  3BDO A;  3OMC A;  5JVH 3;  5EPJ A;  2DNE A;  1PRT C;  5DNF A;  2SNS A;  1PH2 A;  2CVR A;  1KAB A;  2LFN A;  1F2Y A;  1N34 Q;  2RF4 A;  5D14 A;  3A7A B;  5M3M H;  2ZJR A;  2UXB Q;  1JB3 A;  2LY7 A;  1PHJ A;  1IBM L;  4DV2 L;  4FXG C;  5BN4 A;  2VXW A;  2JN4 A;  1UEA B;  1I3Q B;  3UE1 A;  2DUD A;  3PO3 B;  4DGZ A;  3RMH A;  2RVL A;  1XMO Q;  3FPU B;  4WOR A;  5C5M A;  5K36 G;  2MGS A;  2C9O A;  3QB3 A;  2EJG C;  4FO2 A;  2EYO A;  3S17 H;  1U4L A;  5GRO A;  1Q1B A;  1CQV A;  4M8A A;  1KD1 C;  2Z1C A;  2I0Q A;  3ND9 A;  1HXY D;  1QZG A;  4LF6 Q;  4A3G H;  3HOV G;  3HOZ G;  1V9P A;  3G7L A;  1ET9 A;  2LSS A;  2VB2 X;  1XPR A;  5C3E B;  3K5L A;  3HKZ G;  5CGK A;  3J80 L;  3ULP A;  3CD6 A;  4HIO A;  5A35 A;  5G3L D;  2KOL A;  3BVM A;  5GAE C;  1DOL A;  1A63 A;  3GDE A;  2R7Z B;  2EE1 A;  2K5V A;  1STA A;  1TXY A;  2CW0 C;  3M85 A;  2IL8 A;  4IZ8 A;  3H09 A;  1VF7 A;  4FF2 A;  2JA6 B;  3JAM E;  4CDC C;  4C3H B;  2VW9 A;  2AKW B;  1WTR A;  4P2C B;  3VA5 A;  4EQ5 A;  1NSN S;  1K28 A;  1VQ7 A;  1TS4 A;  3WOE A;  2WP8 J;  2NVQ B;  5ELB A;  1NCV A;  3DUZ A;  4U67 3;  2NVT H;  3KK7 A;  1HRJ A;  1D6E C;  5JJZ A;  5M5W H;  1PH8 A;  2Z6B A;  1CI3 M;  4P74 A;  3CKI B;  3S1M B;  5CV7 A;  4X65 Q;  1PRT D;  2HDM A;  2ZTD A;  3GTL B;  4O1N A;  3MXN B;  4JOI C;  1G6P A;  3A0J A;  4DV5 Q;  3ULJ A;  3FRP B;  3M4Q A;  1I5F A;  1PRT B;  1IZ6 A;  2G5D A;  4JI8 L;  4X64 Q;  1Y1W H;  4JI7 L;  2JA8 G;  1SXT A;  4L63 B;  1ESF A;  3CP0 A;  2JEB I;  4DV6 L;  1N8R C;  4WJ3 M;  2IW3 A;  3NWS A;  4ZKC B;  3CCL A;  1L1O A;  2H5X A;  2WIN B;  5KRU A;  1YJN A;  2OQ0 A;  4JI0 L;  5T1G A;  2QDB A;  2O5J C;  4JBM A;  1XPO A;  2KHS A;  1PYB A;  3CCS A;  3KJO A;  1QZH A;  2MPM A;  4MN3 A;  2Q2T A;  1LTG D;  3FHW A;  4AH6 A;  5IP9 H;  1ML0 D;  2OXP A;  2MFI A;  5E4X A;  1OXV A;  4QCL A;  2SOB A;  2E76 C;  4HIK A;  3K81 C;  1XX8 A;  2N8N A;  1DCZ A;  5FOB B;  3F2B A;  1HQM C;  1EQQ A;  1DOK A;  3CW2 C;  4B3R Q;  4NKL A;  4A3E H;  1E24 A;  2E8G A;  1EL0 A;  1G2T A;  4PNY A;  1K8M A;  5I9O A;  3U4V A;  1R9T B;  2KQ3 A;  1V8Q A;  3A8K E;  2G9D A;  4OX9 Q;  3FPP A;  1NBW A;  4DK1 A;  4IOC A;  2A73 B;  4ZCK A;  4AYB G;  2GA4 B;  1PA6 A;  1STG A;  2ZJP A;  4HID A;  2JK8 A;  1A2T A;  1C7Y A;  3NQT A;  1Z7T A;  1MKH A;  3J80 i;  4YY3 Q;  2E5L Q;  2K28 A;  4DV5 L;  2ATW A;  5JJL A;  1YHQ A;  4TSS A;  4R4O A;  4HSV A;  4TRD A;  1XMQ Q;  4POF A;  1I3Q H;  3PO3 H;  4HN7 A;  1U0L A;  2KJX A;  3K8A A;  4FXD A;  3EFX D;  3GTK B;  4IUN A;  4R4I A;  1BVS A;  1LTL A;  3KYH C;  5I6W A;  4MZ9 A;  1FGB D;  4IN3 A;  2B2U A;  4DV4 L;  3KF6 B;  1LO5 D;  1IKM A;  1KXL A;  1OO9 B;  1CTM A;  2NZ1 D;  4R4C A;  5ISR A;  3G4S A;  3BYT B;  3KDF A;  4ZUJ A;  2UUC L;  1GUS A;  4OWX B;  5IY0 A;  3P75 A;  5C3E H;  5CV5 A;  1KHI A;  4A3I G;  3RZO B;  3KF8 B;  3I4O A;  3H0G B;  1AEX A;  1GUG A;  1LAC A;  2DJG C;  2R7Z H;  1DM0 B;  4LFC Q;  3NQI A;  1WTH A;  4GLX A;  2A69 D;  4DV3 L;  2R93 B;  1HNW L;  1BOS A;  5IWA L;  1J9O A;  2CFM A;  2JA6 H;  2QKI C;  4K6L A;  4JK1 C;  4C3H H;  1W6J A;  3ITP A;  5I2Y A;  1VQK A;  3BJU A;  1CFM A;  3FVQ A;  1JR0 D;  4EGV A;  4HED A;  3LWE A;  2A6H C;  1HNZ Q;  2NVQ H;  4HCE A;  1W2B A;  1HR0 W;  1PLF A;  3CPF A;  5EKL A;  3HP3 A;  4LWC A;  3TP8 A;  3S1M H;  2PQA A;  1TQO A;  1UNS A;  4LF5 Q;  3GTL H;  3S1R B;  5L37 A;  1W3S A;  1QVC A;  2K5Q A;  4YY3 L;  1GO3 E;  4K14 A;  1N36 L;  3N52 A;  2XTI A;  4JI1 L;  1X3Q A;  4DXG A;  4RG1 A;  4PMW A;  2YTX A;  1YNJ C;  3KBG A;  5I9P A;  3STB C;  2OWO A;  4FF1 A;  3HS0 C;  3SR1 A;  4LNQ A;  5I4D A;  4K0K Q;  4IFD J;  3I70 A;  2M00 A;  1EOT A;  1PTO D;  1SYG A;  1ZYR C;  2K32 A;  1JOK A;  2Z0S A;  5EQ0 A;  1PFN A;  1A3V A;  1EWH A;  3Q0A A;  1ICW A;  1B3A A;  1MSH A;  2A5H A;  3I8Z A;  1JT8 A;  3VDY A;  3GTQ B;  1PTO B;  2OF1 A;  1WTO A;  1KL9 A;  2EYP A;  4LUO A;  5LL6 S;  3V96 A;  1IL8 A;  1VQA A;  3NUC A;  1D2B A;  5C4X B;  4LFB Q;  2WB1 B;  3D3R A;  3IKJ A;  2XVS A;  1PFS A;  4DV7 Q;  1FL0 A;  2XRQ D;  2NB0 A;  2KEN A;  1QIL A;  1X9N A;  3X3M A;  1HR0 L;  1CA6 A;  3PO2 B;  4NDX A;  4OL7 A;  2F0G A;  4KHP Q;  5C44 B;  2ZTE A;  4DR7 Q;  2L4N A;  2EVB A;  4B3T L;  1TWG B;  4DA2 A;  5JAV A;  1M1K C;  4MTN A;  5FO9 B;  3I2Z A;  5FO7 B;  3TN2 A;  1R9T H;  2OT2 A;  2CCZ A;  3KFU A;  2I5M X;  3TSS A;  5CBE E;  4XTC S;  5LHY 1;  4B3S Q;  1QCB D;  2M2L A;  1YIT A;  3EQL C;  1QUQ A;  2HHH L;  4KY6 A;  3VR2 A;  3ERS X;  4LF5 L;  1UE7 A;  4C1N I;  4CDD C;  2K5N A;  1C8C A;  1EWI A;  2L0C A;  4APV A;  2AQ2 B;  1JQY D;  4AIM A;  1SEB D;  1RIP A;  1PV4 A;  1SDF A;  4H44 C;  2HT1 A;  1CM9 A;  4KTA A;  3T1H L;  2FHT A;  1HA6 A;  5GQO A;  1Y1V B;  1OXS C;  1E1T A;  5EPK A;  3K5N A;  1WVL A;  1TT2 A;  4JI6 L;  3GTK H;  1PDQ A;  1ZEQ X;  3A8J E;  3D4W A;  5HUR A;  1B9M A;  4R4T A;  1FJG L;  2MO0 A;  4BY7 G;  2JA5 G;  1G51 A;  4X3S A;  1AW7 A;  1B50 A;  3RZO H;  3OOC A;  1HUM A;  4H02 A;  1UEB A;  2HCC A;  3DM1 A;  4NMZ A;  5EAY A;  3H0G H;  3WDN A;  2NTT A;  1KRT A;  4DR4 Q;  2JP1 A;  5JPM C;  4DNT B;  1EFI D;  4ID6 A;  2A8V A;  2R93 H;  4JG2 A;  2XWJ B;  5JEA G;  1SYE A;  1IW7 C;  3H3V I;  5CV4 A;  1PH4 A;  4JI5 L;  5D3D A;  1HCZ A;  3FEW X;  3ZYY X;  4B08 A;  1J8I A;  4OGQ C;  2AWN A;  1FR3 A;  4A3C H;  2EY1 A;  1AP0 A;  4TQU S;  3HOX G;  3UDX A;  1D7Q A;  4B3S L;  2PZU A;  3JAM c;  1GUN A;  2I46 A;  5IP7 G;  4KV6 A;  2VQF Q;  2CKZ B;  2NUC A;  3RR5 A;  1DD2 A;  3T51 B;  1SMY D;  3S1R H;  3GTP B;  1A0I A;  1BQQ T;  4CJ2 C;  3OWE B;  1QJO A;  4PQX A;  4WRD A;  4QUF A;  3H3V H;  4FXK C;  1PYW D;  2K52 A;  1HZA A;  3PUX A;  3ZJY C;  3NK9 A;  2NN6 H;  3Q8D A;  4F88 A;  4ZKB B;  1KIX A;  2I07 B;  1NAP A;  1Q8K A;  5J22 A;  1BCP F;  1Q46 A;  2AUJ D;  2GN5 A;  4J15 A;  1E7Z A;  4A3D B;  4XT1 B;  2B2Y A;  5CV9 A;  5CV6 A;  1S5B D;  4LUZ A;  1EU4 A;  1GHJ A;  3SVM A;  1QG7 A;  4QL5 A;  3GTQ H;  1PTO H;  4LF8 L;  3VA7 A;  1XNQ Q;  3DM3 A;  3S16 B;  1Q12 A;  5DLQ E;  5C4X H;  5D65 A;  1Q7Y C;  3S9W A;  4HR7 B;  2HQE A;  1JOQ A;  1GXD C;  4C1N K;  3PIO 3;  3UDI A;  5LMN Q;  1I4G A;  1QB5 D;  3PO2 H;  2F0U A;  5C44 H;  1TWG H;  3MA2 B;  1RL2 A;  3VR4 A;  3GTM B;  2FFK B;  2D5D A;  4OIJ A;  4X66 Q;  5FK9 C;  4DAY A;  4DR3 L;  2LS0 1;  3SDZ A;  3TZU A;  1A2U A;  3HKZ E;  1CT1 D;  4NB3 A;  4FYD A;  4YHH L;  1Q81 C;  2CQO A;  4WJ4 A;  3F2U A;  4A3L H;  3S15 B;  4UP8 A;  1L2F A;  3M3Y B;  3F2D A;  2PYK A;  2VQF L;  3RN2 A;  3K5M A;  2DN8 A;  3CQZ B;  1SNC A;  3SK5 A;  4C3I G;  1PFM A;  4DUZ L;  3GP7 A;  2KBN A;  5IT9 c;  3IRB A;  5KEE A;  3CC7 A;  3J81 j;  4B3M Q;  3ERO A;  1K83 B;  2F0S A;  4FVM A;  1CSP A;  4HJA A;  1Y1V H;  2MP1 A;  3TEH B;  4IUV A;  5C0X I;  3I90 A;  4K2K A;  1D8L A;  3CAM A;  2RKS A;  4P72 A;  5M3F G;  2UXC Q;  1X32 A;  2F0F A;  3QR8 A;  1JOO A;  1AE3 A;  5DM7 3;  3R3O A;  3D8G A;  3HOZ B;  2YYZ A;  1TU2 B;  1N33 Q;  1V1O A;  4DN4 M;  4CKB A;  1XNR Q;  1O7Y A;  5IGE A;  1GHK A;  4YIJ A;  2KA7 A;  3HKZ B;  1SR3 A;  2IHF A;  1XNQ L;  2HQL A;  2N55 A;  3AU7 A;  1SAP A;  4PG3 A;  4JCV E;  3H15 A;  1Q86 C;  5C0X H;  1F2M A;  4DAP A;  3VYR A;  3A5Z B;  1S72 A;  1U4P A;  4LF7 Q;  3CME A;  4KKT A;  2CHB D;  2YV5 A;  1S4Z A;  3W2D A;  4A3B B;  2B2W A;  2VUM G;  1QVG A;  1UE1 A;  3PF5 A;  2ZXP A;  3T16 A;  2ZJQ A;  3F8T A;  1II3 A;  4FP5 D;  3A8I E;  4A3K B;  2F52 A;  1H95 A;  1SJE D;  1Z47 A;  2A74 C;  1XYI A;  4ALP A;  1T5X D;  1IBM Q;  4DV2 Q;  3AMU A;  4ILW A;  2ENB A;  2Z4I A;  2UXD L;  2NVY B;  3GTP H;  4F8M A;  2Y0S B;  4H13 C;  1Y1W B;  4GNX C;  4BBR B;  4ZUI A;  4A93 B;  2EQS A;  4C2M B;  1B2T A;  2N78 A;  1EQR A;  3URY A;  5C0X J;  3TQY A;  2P5Z X;  1EZ6 A;  2KEC A;  3SK6 A;  3NBI A;  4AYB E;  5C6A A;  4A3D H;  3PIP 3;  3ULL A;  5IGF A;  4XYO A;  3M4P A;  2XGT A;  1YEZ A;  3S14 B;  1GUT A;  1N33 L;  1ESR A;  4EQP A;  4I7Z C;  1R4Q B;  1HFG A;  1Q1E A;  1I4R A;  1SYB A;  3BS1 A;  1GKH A;  4E6I A;  3R2T A;  4A76 A;  3S16 H;  4MIU A;  4JVZ A;  2QEX A;  4KKS A;  4ME5 A;  3IL8 A;  3KLW A;  4GN4 B;  3L9A X;  1Y8N B;  1STN A;  4K5X A;  2MUY A;  2PNH A;  4A3F G;  2N49 A;  1AE2 A;  4Y52 H;  3UE0 A;  4FF4 A;  1NUC A;  3GTM H;  1ENF A;  2B39 A;  1RD9 D;  4DV1 L;  2F3I A;  1WTQ A;  1IKL A;  3S15 H;  1V1P B;  2JJQ A;  3M3Y H;  2HIV A;  1EY6 A;  1H9R A;  3I4N G;  3CQZ H;  3I4M G;  4BWG B;  1PVO A;  3S1N B;  1V1Q A;  3I91 A;  4JI8 Q;  4JI7 Q;  4OO1 G;  2IY5 B;  2EYJ A;  5KND A;  3CCJ A;  1IXR A;  1K83 H;  2B3G A;  3HOY G;  4DV6 Q;  1LLR D;  1SYC A;  2E2I B;  4N9T A;  3KOJ A;  1BXT A;  3ER0 A;  3MFY A;  3OW2 A;  5K36 H;  3GO5 A;  2JEA I;  4JI0 Q;  1VQ6 A;  3AFP A;  1I94 Q;  2UU9 L;  1VQ9 A;  2HIX A;  4KHZ A;  1KRS A;  4GNX B;  3D0F A;  4F7X A;  3CCV A;  4IPH A;  1A15 A;  4QJF A;  3HOZ H;  1J6Q A;  2BA1 A;  1K73 C;  2WV6 D;  3W3A A;  5I6Y A;  3PUV A;  4A3I B;  1KNA A;  1CUK A;  4RAU C;  4LF9 L;  3NEN A;  1TWC B;  4LW1 A;  1LTI D;  1XJV A;  5KYI A;  5I2X A;  4M1U B;  3M4Y A;  3OSO A;  2KEE A;  1VQE A;  4A3B H;  5J3B A;  5E7N A;  4RH6 A;  4DKA C;  2CH4 A;  4HCS A;  3TDQ A;  4LK1 C;  2O4X A;  5EBD A;  1MD2 D;  4HMI A;  4HTH A;  1WYD A;  4A3K H;  1D5M C;  3CCM A;  1VQI A;  2PI2 A;  4RA8 A;  1OXU A;  4EX5 A;  3TS0 A;  2ICI A;  3T13 A;  5KGU A;  3BZK A;  4BY1 G;  2E75 C;  3BDC A;  4NXM L;  2F3W A;  2NVY H;  1WJJ A;  4BBR H;  1HPC A;  3ONA B;  4A93 H;  2EOT A;  1SYF A;  4Q0F A;  4ODG A;  4C2M H;  1VMC A;  4DV4 Q;  1AZP A;  2A6E D;  1XTC D;  1I94 L;  4JOI A;  3FKI G;  1S40 A;  2UUC Q;  1J5E L;  1M4V A;  2EY2 A;  1GVP A;  1FNW A;  1BUV T;  3S14 H;  2K6A A;  4K8I A;  2B63 B;  1CKN A;  1K8A C;  2A69 C;  2GVB A;  1GJX A;  1SFO B;  4YCU A;  1LAB A;  1OTC A;  1WD1 A;  2A68 D;  2L5T A;  3OTO Q;  4DV3 Q;  3PF4 A;  1FYC A;  3I7F A;  1HNW Q;  2QEJ C;  5IWA Q;  3N6R A;  4DPG A;  4DR5 L;  4LF4 L;  3I4L A;  4HSP A;  2PO4 A;  4L5S A;  1WTW A;  2WAC A;  1ET6 A;  1STY A;  5FLX c;  1WTV A;  3H3V C;  2B2V C;  3HOW B;  2ZT9 C;  4WFN 3;  3Q6S A;  5IT9 E;  1YVC A;  2F1M A;  3T53 B;  1SNO A;  4PZ7 A;  4Q5V A;  1S3O A;  1NJI C;  1SLJ A;  1U5K A;  1O7Z A;  5HY6 A;  3Q23 A;  5BR8 L;  4JW0 A;  4NP5 A;  1EUJ A;  1N36 Q;  2NWG A;  3NP8 A;  4DAV A;  2ZTC A;  5A2Q E;  4JI1 Q;  3TRE A;  4JBK A;  3S1N H;  4G7H C;  3T1Y Q;  3J7A 5;  3LGJ A;  1HZC A;  3C1F A;  3TS2 A;  2EYM A;  5CBA E;  1PTO C;  5LMU L;  1VS0 A;  2EY6 A;  2E2I H;  1T9H A;  4Y7N H;  5M5Y B;  1VCI A;  5CC4 A;  4BS9 A;  3PIP A;  4DR1 L;  1C9O A;  4XQJ A;  1PFB A;  1WTX A;  1TWH H;  4KI0 A;  1K9M C;  4R4Q A;  1B44 D;  3PO3 G;  2F0V A;  1N9W A;  5IYB G;  2E2D C;  2R92 B;  1L1O B;  1FNU A;  2F3V A;  1MJC A;  4A3I H;  1TS5 A;  3MFG A;  1H9S A;  5IGB A;  5ELN A;  3T4A C;  2ES2 A;  1TWC H;  3PV0 A;  5IGG A;  3OTO L;  5IIF A;  1HR0 Q;  4BBS G;  5C3E G;  2AHO B;  4B3T Q;  1K8G A;  1EZ8 A;  3P1H A;  5CYU A;  2WAQ G;  1LUZ A;  4X3K A;  3A55 A;  3CPW A;  1RHP A;  5ELC A;  1JMC A;  4GKK L;  4KJO A;  1EIF A;  1U9R A;  4IFD G;  1PMR A;  1WD0 A;  1YI2 A;  1TS2 A;  2Q2U A;  1CZG A;  4G7Z C;  2HHH Q;  2E2J B;  4R8I A;  4IQZ A;  1WCM B;  2V1C C;  4OIK A;  4K8J A;  3OIP A;  4G57 A;  3E6Z X;  2YU9 B; 
#chains in the Genus database with same CATH homology
 3RR5 A;  3DLL A;  2D62 A;  5LMU Q;  2ALY B;  3S1R H;  3L0O A;  3T1H Q;  2JA8 H;  1A0I A;  1FVI A;  2OQK A;  3T1Y L;  1X3F A;  1L1O C;  3PGZ A;  3NEM A;  3J81 i;  3H3V H;  4X6A H;  4JI6 Q;  2K52 A;  1HZA A;  3PUX A;  1N34 L;  3ZJY C;  2OTL A;  4DR1 Q;  3Q8D A;  2QA4 A;  1HH2 P;  1YHA A;  4FDB A;  4DR2 L;  2UXB L;  2Y0S G;  2UUB Q;  1KIX A;  1FJG Q;  2GVA A;  4MNO A;  4B3M L;  1Y1W G;  1Q8K A;  3PUW A;  4BXX H;  2R6G A;  2Q2H A;  4BBR G;  3KF6 A;  1VQG A;  2VL6 A;  4A93 G;  1Q46 A;  4JI2 L;  3FKI H;  3I56 A;  2GN5 A;  1WFQ A;  4J15 A;  1E7Z A;  1XMO L;  2EXD A;  3CCE A;  4A3D G;  2K14 A;  3HKS A;  5FJ8 H;  4LUZ A;  1K3R A;  2PI2 E;  3UDG A;  4LUV A;  2B63 H;  2UXC L;  4PZ6 A;  4QL5 A;  1HJP A;  3GTQ H;  4LF8 L;  2ID0 A;  1YNX A;  4LF6 L;  1XNQ Q;  2AWO A;  1SFO H;  3DM3 A;  3KDF B;  1Q12 A;  3PUZ A;  3JC6 6;  5DLQ E;  5C4X H;  1Q7Y C;  1ASY A;  3S24 A;  1XNR L;  2IX1 A;  1WOC A;  2K75 A;  5IP9 G;  1TWF H;  4A3F H;  2LXK A;  3UDI A;  4DUY L;  3A5U A;  5LMN Q;  2IT1 A;  4GKK Q;  3U58 A;  4GKJ Q;  3ICE A;  4JI5 Q;  1PYS B;  1HZB A;  1QVF A;  3PO2 H;  1IBL L;  5C44 H;  1OXX K;  4LF7 L;  4GN3 B;  3TRZ A;  1JB7 A;  3EBE A;  1VQM A;  1EFW A;  4YCV A;  3SGI A;  1TWG H;  4JI4 Q;  3HOW H;  1RL2 A;  2JA7 G;  4O2D A;  4A3E G;  4X66 Q;  4YWM A;  4DR3 L;  1X56 A;  3I4N H;  1Z9F A;  2NVX H;  1GM5 A;  4GOP C;  1SMX A;  3HKZ E;  3K80 C;  4NB3 A;  2ASB A;  2VQE Q;  4YHH L;  1Q81 C;  2CQO A;  4TVA B;  4WJ4 A;  3CMA A;  4A3L H;  4UP8 A;  1L2F A;  2JE6 I;  2Q2I A;  1PH2 A;  3F2D A;  2VQF L;  1SE8 A;  3RN2 A;  1N34 Q;  2OTJ A;  2RF4 A;  4DNI A;  4DR6 L;  3J81 c;  5M3M H;  2ZJR A;  2UXB Q;  4DUZ L;  3EIV A;  3UDF A;  1PHJ A;  1X55 A;  2KBN A;  3IRB A;  5IT9 c;  5GAH C;  2PQA B;  3J81 j;  3CC7 A;  4DV2 L;  1IBM L;  4B3M Q;  4X65 L;  2MQH A;  1OXT A;  2WFW A;  4JI2 Q;  4DK6 C;  1CSP A;  4HJA A;  1A8V A;  5M5Y H;  1Y1V H;  3MEF A;  2OCE A;  1X54 A;  2DUD A;  3TEH B;  3UE1 A;  4DK3 C;  5C0X I;  1XMO Q;  2D0O A;  5K36 G;  1D8L A;  3CAM A;  1VQO A;  4X64 L;  4P72 A;  5M3F G;  2UXC Q;  3S17 H;  4LF8 Q;  2R7D A;  5GRO A;  1AE3 A;  1Q1B A;  5IYB H;  1KD1 C;  2I0Q A;  2R92 H;  2YTY A;  1QZG A;  2YYZ A;  4LF6 Q;  4IFD I;  4PZ8 A;  4A3G H;  3HOV G;  3HOZ G;  1N33 Q;  1V9P A;  1X65 A;  2LSS A;  1XNR Q;  1XPR A;  1CSQ A;  1VQP A;  1P16 A;  2IHF A;  1SR3 A;  1VQC A;  2HQL A;  1XNQ L;  3HKZ G;  3ULP A;  4DUY Q;  1PH7 A;  3CD6 A;  1CKN B;  2L15 A;  1YIJ A;  4HIO A;  4PG3 A;  3WWV A;  4JCV E;  5GAE C;  3H15 A;  1V43 A;  1Q86 C;  3AEV A;  4BBS H;  1VQ4 A;  4HIM A;  1Y14 B;  3GDE A;  1Q82 C;  1IBL Q;  1S72 A;  3A5Z B;  1A63 A;  2D0P A;  4LF7 Q;  2K5V A;  1BKB A;  2R7Z G;  3CME A;  1TXY A;  1EYG A;  3M85 A;  2YV5 A;  3H0G G;  3W5O A;  4DR3 Q;  2VUM G;  1QVG A;  2VW9 A;  2JA6 G;  2AKW B;  1UE1 A;  3PF5 A;  3E0E A;  2DGY A;  2K5H A;  4YHH Q;  2ZJQ A;  1CKM A;  3F8T A;  2EIF A;  4EQ5 A;  2E2J H;  1H95 A;  2F52 A;  4XIG S;  1VQ7 A;  4B3R L;  2MO1 A;  1Z47 A;  2WP8 J;  2NVT H;  3GD7 A;  2VQE L;  4DR6 Q;  1WCM H;  5IP7 H;  4ALP A;  2AMC B;  1SN8 A;  5M5W H;  1PH8 A;  4DUZ Q;  4A3C G;  1IBM Q;  4P74 A;  4DV2 Q;  1JJ2 A;  4IJL A;  4OX9 L;  2YU9 H;  4A3M G;  1YHB A;  4X65 Q;  2ZTD A;  2UXD L;  4KLK A;  3G71 A;  3GTP H;  3BZC A;  4C3J H;  1AH9 A;  3MXN B;  4JOI C;  2WB1 E;  1EIY B;  1QUQ B;  4HJ8 A;  1G6P A;  4JV5 L;  3A0J A;  1VQH A;  4DV5 Q;  3ULJ A;  4GNX C;  4GOP B;  2KCM A;  4JBJ A;  2EQS A;  3M4Q A;  1GD7 A;  1I5F A;  2N78 A;  1IZ6 A;  1UE5 A;  4JI8 L;  4X64 Q;  1Y1W H;  2E5L L;  4JI7 L;  1EQR A;  2JA8 G;  5C0X J;  3TQY A;  3CP0 A;  2BA0 A;  2FXQ A;  2JEB I;  4DV6 L;  1XMQ L;  1N8R C;  4WJ3 M;  2NN6 G;  3PCO B;  5JEA J;  4AYB E;  3CCL A;  1M90 C;  1L1O A;  2H5X A;  1YJN A;  4A3K G;  4L5R C;  4A3D H;  2OQ0 A;  3ULL A;  3OYY A;  1LM0 A;  3CC4 A;  2VZA A;  3M4P A;  4JI0 L;  4GLV B;  2KCT A;  3M7N A;  3G48 A;  4DV0 L;  2XGT A;  1YEZ A;  4JBM A;  1XPO A;  1N33 L;  5FLM G;  1PYB A;  1Q1E A;  4OWW B;  3CCS A;  3KJO A;  1QZH A;  1GKH A;  5IYC G;  2Q2T A;  1XPU A;  4OON A;  4A76 A;  3S16 H;  4A4I A;  3RZD H;  3FHW A;  2B63 G;  1O7I A;  1VQ5 A;  4AH6 A;  5IP9 H;  2QEX A;  4JBW A;  2MFI A;  5GAD C;  1KAW A;  1OXV A;  3KLW A;  4GN4 B;  4HIK A;  5C4X G;  2WB1 G;  3K81 C;  4R1J A;  2K4K A;  1VQ6 A;  1IYJ B;  2N8N A;  4ME3 A;  2VNU D;  4LFC L;  4A3J G;  3F2C A;  2PNH A;  3F2B A;  4BA1 I;  1EQQ A;  4A3F G;  3CW2 C;  4B3R Q;  2N49 A;  4A3E H;  4IPC A;  1AE2 A;  4Y52 H;  3UE0 A;  3GTM H;  1E24 A;  2E8G A;  4UPA A;  1A62 A;  1BBW A;  3U4V A;  3RLF A;  4DV1 L;  3PO2 G;  2UUA L;  5C44 G;  3FP9 A;  2F3I A;  4OX9 Q;  1NBW A;  3G6E A;  4IOC A;  4AYB G;  3F1Z A;  1PA6 A;  3HOW G;  2UXD Q;  3CCR A;  3S15 H;  3KJP A;  3RLN A;  4A75 A;  2QGQ A;  2JJQ A;  3M3Y H;  4IJH A;  3GTG H;  4JV5 Q;  2HIV A;  1B70 B;  2ZJP A;  1NMG A;  4HID A;  3I4N G;  2JK8 A;  4NPS A;  1HNZ L;  3CQZ H;  3I4M G;  1C7Y A;  3BU2 A;  3RN5 A;  1PVO A;  1V1Q A;  4JI7 Q;  2C35 B;  4JI8 Q;  4OO1 G;  1MKH A;  3J80 i;  4YY3 Q;  2E5L Q;  2ATW A;  4DV5 L;  4A3L G;  2IY5 B;  5JJL A;  1YHQ A;  4R4O A;  3CCJ A;  4GOP A;  1IXR A;  1K83 H;  1X3E A;  2B3G A;  2BH2 A;  3HOY G;  4DV6 Q;  1XMQ Q;  4POF A;  3S2D H;  1IBK L;  1I3Q H;  1NTG A;  1UE6 A;  1C0A A;  4BY7 H;  3PO3 H;  3KOJ A;  1U0L A;  3ER0 A;  3K8A A;  3OW2 A;  5IYD G;  2JA5 H;  1I50 H;  4JYA L;  4HJ9 A;  3GO5 A;  2NZO A;  1BVS A;  1LTL A;  4R4I A;  3W1G A;  3KYH C;  3AFP A;  5M3F H;  1I94 Q;  2UU9 L;  1VQ9 A;  2HIX A;  4KHZ A;  3L7Z C;  4MZ9 A;  4DV0 Q;  1KRS A;  4DV4 L;  4GNX B;  1HZ9 A;  3D0F A;  4LFA L;  3KF6 B;  1Y1V G;  4JC0 A;  3CCV A;  4IPG A;  4IPH A;  2JEA I;  4QJF A;  4K0K L;  3HOZ H;  1KXL A;  3D31 A;  4X62 L;  1J6Q A;  4R4C A;  4HJ5 A;  3STB D;  3G4S A;  4BA2 I;  5JJI A;  3KDF A;  2BA1 A;  1K73 C;  2UUC L;  4JI0 Q;  1HNX L;  4OWX B;  3NBH B;  2YTV A;  5IY0 A;  3PUV A;  3HOU G;  5C3E H;  3U50 C;  1KHI A;  1CUK A;  2RHS B;  3E9I A;  3M9B A;  5ELO A;  4A3I G;  4LF9 L;  3KF8 B;  2R92 G;  3NEN A;  3K0X A;  3I4O A;  1NMF A;  4LW1 A;  4UY8 C;  3K7U C;  1PH1 A;  1XJV A;  2R7Z H;  1VQE A;  2KHI A;  4LFC Q;  4GLX A;  4LFB L;  4HJ7 A;  4DV3 L;  2Z6K C;  4A3B H;  5H1S E;  5J3B A;  1HNW L;  5E7N A;  4JI3 Q;  4DV7 L;  2R93 G;  5IWA L;  2VUM H;  1VQL A;  4DKA C;  4POG A;  2CFM A;  3HOX H;  4DV1 Q;  2UUA Q;  2JA6 H;  1MIU A;  4C3H H;  5AJ3 Q;  3J7Z C;  1VQK A;  3NEL A;  3L2P A;  2KHJ A;  2BH8 A;  3BJU A;  4YCW A;  4KHP L;  1VQD A;  1WYD A;  4A3K H;  4UP9 A;  4DR7 L;  1TWA H;  3CCM A;  1VQI A;  2NN6 I;  2PI2 A;  3TS0 A;  1OXU A;  4EX5 A;  1HNZ Q;  4YWK A;  2NVQ H;  1W2B A;  2LXJ A;  2PMZ E;  1HR0 W;  4DAY B;  3CPF A;  4L5Q A;  1KC8 C;  3BZK A;  4BY1 G;  4A3M H;  4LWC A;  3S1M H;  2PQA A;  4NXM L;  4LF5 Q;  1K0R A;  2NVY H;  3EN2 A;  3J80 c;  3GTL H;  2K50 A;  5C4J H;  4IO9 A;  1IBK Q;  5JJK A;  1WCM G;  1W3S A;  1WJJ A;  1QVC A;  2NZH A;  4BBR H;  1GO3 E;  4YY3 L;  2I5H A;  1N36 L;  4A93 H;  3GTJ H;  2XTI A;  4JYA Q;  3S2H H;  4C2M H;  4JI1 L;  3M4O H;  4RG1 A;  4PMW A;  3I55 A;  2YTX A;  1DGS A;  4P75 A;  2UU9 Q;  2IX0 A;  3HFZ B;  4LFA Q;  4DV4 Q;  3W1B A;  3STB C;  2OWO A;  4P71 A;  4BXX G;  3AFQ A;  2I5L X;  4LNQ A;  4K0K Q;  4IFD J;  1I94 L;  4X62 Q;  4JOI A;  2R7F A;  3FKI G;  1S40 A;  2UUC Q;  4GNX A;  2Z0S A;  1XTD A;  3K7A H;  1JJC B;  2JA9 A;  1P8L A;  1J5E L;  1HNX Q;  1IL2 A;  1GVP A;  3PUY A;  5FLM H;  1EOV A;  4LF9 Q;  3S14 H;  5FJ8 G;  1JT8 A;  3VDY A;  4NXN L;  3B6Y A;  1CKN A;  3CCQ A;  1K8A C;  5IYC H;  3AYH B;  4AQY L;  2JQO A;  1KL9 A;  4LUO A;  2GVB A;  1VQA A;  4YCU A;  1OTC A;  3GTO H;  4OXP A;  3OTO Q;  4LFB Q;  4DV3 Q;  3PF4 A;  1B8A A;  1PFS A;  3I7F A;  1HNW Q;  4DV7 Q;  5IWA Q;  4GS3 A;  1FL0 A;  1MJE A;  3U4Z A;  2KEN A;  1X9N A;  4DPG A;  1NY4 A;  4DR5 L;  5M5X H;  1YJW A;  1VQ8 A;  4LF4 L;  3CC2 A;  2JA7 H;  4OO1 I;  2A19 A;  4L5S A;  1HR0 L;  4QQB X;  4O0A A;  3CXC A;  4DR4 L;  4JI3 L;  1VQF A;  4A3J H;  2F4V L;  4KHP Q;  2ZTE A;  1CKO A;  4DR7 Q;  1JJG A;  1YZ6 A;  4GN5 A;  5FLX c;  4B3T L;  5AJ3 L;  1YJ9 A;  1M1K C;  4MTN A;  3I2Z A;  1YVC A;  2CWA A;  2VY3 A;  1R9T H;  2CCZ A;  3KFU A;  2I5M X;  1E3P A;  1KQS A;  4IPD A;  1N32 L;  1X3G A;  4PZ7 A;  4XTC S;  2ZM6 Q;  4C3I H;  4OWT B;  4B3S Q;  4NXM Q;  4RMF A;  1S3O A;  1NJI C;  1SLJ A;  1U5K A;  5HY6 A;  1YIT A;  3CCU A;  5BR8 L;  1QUQ A;  2HHH L;  3I4M H;  3JAM i;  4UP7 A;  5LMN W;  1EUJ A;  1N36 Q;  2B29 A;  3ERS X;  4LF5 L;  1UE7 A;  2ZTC A;  4JI1 Q;  2K5N A;  3TRE A;  2E2H H;  3T1Y Q;  4JBK A;  3S1N H;  1E1O A;  1EWI A;  2WAQ E;  2MNA A;  3J7A 5;  3LGJ A;  4APV A;  4GLA C;  5M3M G;  1HZC A;  3HOY H;  3TS2 A;  4AIM A;  1RIP A;  1PV4 A;  5LMU L;  1VS0 A;  2HT1 A;  3T1H L;  1PH9 A;  4DR2 Q;  2E2I H;  5IYD H;  1T9H A;  5GQO A;  5IE8 A;  4Y7N H;  1VCI A;  1OXS C;  1E1T A;  4P73 A;  4JI6 L;  3GTK H;  1J5E Q;  3PIP A;  4DR1 L;  1C9O A;  3HOV H;  1VQN A;  2UUB L;  1FJG L;  4R4T A;  4IOA A;  1TWH H;  4KI0 A;  1K9M C;  1G29 1;  2MO0 A;  4R4Q A;  4NXN Q;  3PO3 G;  4BY7 G;  4DAM A;  4AQY Q;  2JA5 G;  1N9W A;  5IYB G;  1JE5 A;  1L1O B;  4YWL A;  3PIO A;  4A3G G;  3HOU H;  1G51 A;  5HGQ A;  1FGU A;  1MJC A;  1WI5 A;  2RCN A;  4QGU A;  4A3I H;  1L0W A;  3RZO H;  1PH3 A;  4H02 A;  5ELN A;  1UEB A;  3E9H A;  5EAY A;  1SRO A;  1TWC H;  3H0G H;  1VQJ A;  3PV0 A;  4DR5 Q;  2ES2 A;  4LF4 Q;  3OTO L;  3S1Q H;  2Y0S E;  1KRT A;  1HR0 Q;  4DR4 Q;  1SRU A;  2F4V Q;  4BBS G;  1B7Y B;  5C3E G;  5C0X G;  1PH5 A;  2A8V A;  2AHO B;  3CF5 A;  1K8G A;  4B3T Q;  2R93 H;  4JG2 A;  2WAQ G;  1LUZ A;  1NE3 A;  5JEA G;  3CPW A;  3H3V I;  4L5T A;  4GKJ L;  1BBU A;  5LMN L;  1PH4 A;  2CWP A;  3AQQ A;  1JMC A;  1UWV A;  4JI5 L;  4GKK L;  2RHQ B;  1I6H H;  1N32 Q;  1X6O A;  1EIF A;  4IFD G;  2AWN A;  4QY7 A;  4A3B G;  4A3C H;  4QIW E;  2IHE A;  3PSI A;  5GAG C;  1YI2 A;  5BR8 Q;  2Q2U A;  4TQU S;  1ASZ A;  2HHH Q;  2N3S A;  3HOX G;  3UDX A;  2VS1 A;  4JI4 L;  2ZM6 L;  2Z6K A;  4B3S L;  3RLO A;  1D7Q A;  3A74 A;  4BY1 H;  3JAM c;  1E22 A;  1LYL A;  2V1C C;  4X66 L;  1YBY A;  5IP7 G;  1PH6 A;  2A1A A;  2VQF Q;  3RNU A;  1VQB A;  2CKZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...