4NMZA

Crystal structure of staphylococcal nuclease variant delta+phs v23q/v66a at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTQKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nmzA00
3D6CA 3H6MA 1ENAA 3RUZA 4B9WA 5C3XA 3DHQA 5CV5A 5IGCA 4WRDA 3NHHA 3U9OA 4EQNA 3R3OA 4WORA 1SYDA 2EYHA 5HURA 4G57A 5CV8A 1F2YA 1EY9A 1A2TA 4ID6A 3VA5A 4F7XA 4ODGA 5IOCA 1EY0A 1JOQA 1KDCA 1JORA 2OEOA 5JOBA 5KYIA 4IUNA 2RDFA 4H7BA 4K8IA 3NP8A 2SNSA 4QF4A 3T16A 4KY5A 3SK4A 3TP8A 1KABA 3T13A 5HGTA 1JOKA 1TT2A 2EXZA 2RBMA 2PQEA 3NK9A 2OF1A 4KY7A 4PMCA 4RKLA 4ZUJA 3SR1A 3E5SA 4NKLA 3TP5A 4RKBA 1A3UA 5IGBA 2F3VA 2PZUA 5IIFA 4KJOA 4K5XA 2F0QA 4KTAA 2NUCA 3PMFA 4QMGA 5E1FA 5K5PA 2F0PA 1EQVA 3MZ5A 4QB4A 1STAA 5CV9A 5I9PA 5J22A 1SYFA 1SNMA 3ERQA 4K5WA 4HMJA 4NMZA 5CGKA 5KRUA 1STBA 3TP7A 2EY5A 4J1MA 4OL7A 4F8MA 1TQOA 3S9WA 4KD4A 5KIXA 1ENCA 5C4ZA 1A3TA 2F0KA 1EY8A 4K6DA 4KJNA 5C6AA 1EY5A 3NUCA 3C1EA 2F0HA 2SNMA 5NUCA 5DEHA 5I6YA 5ISRA 3TP6A 3OSOA 4LAAA 2EYJA 1SNOA 2EY1A 5CV7A 5DAUA 4PMBA 4NP5A 1JOOA 1SNDA 1EY7A 4ME5A 1SYCA 5I9OA 2F0LA 3NQTA 4S3SA 1EZ6A 1NSNS 3QB3A 4EQPA 2EYPA 1IHZA 3D8GA 1II3A 3BDCA 3EROA 1F2ZA 4HMIA 4YIJA 3TMEA 5C3WA 2PZWA 2QDBA 5C4HA 1KDAA 1SYGA 2PYKA 2PW7A 1SYEA 4K2KA 2O4XA 1SNQA 1STNA 3SHLA 2EYLA 5IGEA 3SXHA 1EYDA 2EYMA 2M00A 4K5VA 3SK5A 4DU9A 1EY6A 4HTHA 5EKKA 3V2TA 2EYFA 2F0OA 3SK8A 4KHVA 1A3VA 2F0WA 3MXPA 5EKLA 4DF7A 1EY4A 1SNPA 4IZ8A 3OMCA 3D4DA 4K2LA 2F0MA 4K14A 5IGGA 4KV6A 2F0UA 2PW5A 5EGTA 1STHA 4E6IA 3QOJA 2HQEA 2KHSA 3MVVA 3SK6A 4TRDA 1AEXA 4PNYA 4R8NA 1SYBA 4EVOA 2WACA 2F0EA 5F2DA 4K8JA 4MIUA 5J1ZA 4DGZA 5IGFA 4KY6A 3P1HA 2OXPA 1EZ8A 3D4WA 5CR3A 5KGUA 1F2MA 2F0SA 5C5LA 5KEEA 1KDBA 2EYOA 3HZXA 5J39A 4B9XA 2F0NA 2F0GA 2F0DA 5I6WA 4EQOA 3DMUA 1KAAA 3EVQA 5E3FA 5CC4A 3LX0A 2EY6A 3QOLA 4N9TA 1NUCA 1EYCA 5IODA 1SNCA 1U9RA 3OMGA 3ITPA 5IGDA 5CV4A 3MEHA 3MHBA 4ZQ3A 2RKSA 4DFAA 5KYLA 2KQ3A 3HEJA 4ZUIA 1A2UA 2PZTA 3C1FA 3OWFA 4N9PA 2F0JA 5CV6A 1STYA 4I65A 2LKVA 2EY2A 1EYAA 2ENBA 2F0IA 2F3WA 2F0TA 3P75A 5JAVA 1RKNA 1TR5A 4J6HA 3BDLA 2F0VA 2SOBA 4KD3A 4IALA 4NDXA 3NXWA 5M9OA 5C5MA 3EJIA 2F0FA 1STGA
chains in the Genus database with same CATH superfamily
4RG1A 3I55A 2ZM6L 3SDZA 4X3KA 1X32A 3NHHA 3R3OA 1NE3A 4B3MQ 1XTDA 1EY9A 1WCMH 4BY7H 4POFA 1RJTA 1M90C 3KF6A 2DY8A 1QG7A 2SNSA 4Q5VA 3AEVA 2R93G 2K52A 3CC7A 4PZ7A 2J7ZA 4ULLA 2KHIA 1CT1D 3PGZA 4XYQA 1SR3A 4RKBA 3V96A 1JQYD 2JA8B 3GP7A 2B2TC 1I4RA 1C48A 4YHHQ 2V4DA 2B2VA 3CCLA 3S9WA 3GO5A 1UWVA 2PPBC 4FF2A 3J81E 4BBSB 1XX8A 1K73C 1I4QA 2XN9C 3CCRA 1Y8PB 1CFMA 5IT9c 1NMFA 4DR1L 3PUXA 4HSPA 4DV0Q 3PF4A 2JSOA 4DR7Q 2R7ZB 1TWGB 2VUMH 4X6AH 1WOCA 3HOVH 1VQAA 3S1RH 3HOWB 1D5ZC 4LF8L 1D5XC 1KDAA 2L5TA 2RF4A 3BZDB 4A3DB 3JC66 2EYLA 2K01A 1SN8A 1EYDA 4BY1G 3SK8A 2RSOA 4HJAA 2EXDA 3AYHB 3GDEA 4C2MB 4JYAL 4H0LC 4WJ3M 1MGSA 3EBEA 3HG9A 1PYSB 4K2LA 4K14A 1M4VA 3E0EA 1G51A 1XPOA 1BCPB 1DOKA 2IHEA 3FP9A 4AYBB 1ET9A 3HOXB 3D4WA 3T56B 5CR3A 4A3MH 1SJED 2F0SA 3CMAA 1HH2P 4L5TA 1I6VC 5C4XG 4FO2A 3T1HL 2O5IC 3PO3G 1Z7TA 1QZGA 1M1KC 1K83B 2Z0SA 5IODA 3CHBD 2JE6I 3ITPA 3HEJA 4CJ2C 2AQ1B 3S15B 1S4ZA 5CV6A 1NTGA 5FK9C 2Y0SG 1Y1WH 3MC0B 1WTXA 1D5MC 1GUSA 3OW7A 3E9HA 4R8IA 3GTOH 3D6CA 2HIVA 2XNAC 5JJIA 3NEMA 2ATWA 2JN4A 2Z8LA 4C3HH 3UDFA 4RHRA 4EX5A 1Q1BA 2EJGC 3A8IE 4F7XA 3HKZB 2KUMA 3PV0A 1PH9A 1MSGA 5EAYA 1WVLA 3OOCA 5C0XI 4UPAA 2K32A 1TT2A 1T5XD 4RGNA 1HFNA 1E1OA 4P73A 4XXEA 3CC2A 3HKSA 1PH3A 2N49A 3HFZB 4R4CA 1CQFA 1TWAB 5K36H 4KTAA 2B2UA 3KDFB 5E1FA 2QEXA 2UXCQ 5C3EB 3FKIB 4A3KH 1D7QA 4DUZQ 2Z1CA 2VQEL 4CDCC 5CGKA 1HZ9A 4B3TQ 4V0BA 1EWCA 3BVZA 4KD4A 2OWOA 2DJFC 2AHOB 4IJHA 2K6AA 3NUCA 4A3BG 2F0HA 3CU7A 4KN4C 3O13A 5ELDA 2PI2A 2L55A 4JI8Q 2AUKA 4GN4B 1RL2A 1F2ZA 2A19A 2IHFA 2VQFL 2HIXA 2CFMA 2OCEA 4B3SQ 5FLMH 2FXQA 1L0YB 4OO1I 3SK5A 4JBKA 4OX9Q 1SXTA 1HQMC 1NCVA 2RSNA 3D3RA 3FVQA 1WD0A 2K5WA 3U50C 2IY5B 2CHBD 3D31A 3GTQH 1CSPA 1N33Q 2QW7A 1D1IA 4DKAC 4GN3B 3TRZA 4LF5Q 1SYBA 4NXMQ 1VMCA 2D62A 4DV5Q 5EBCA 4A93B 4H44C 3X3NA 3M85A 2L0CA 5J39A 4JI6Q 1MBYA 2K14A 2ZTCA 2B63B 4DNTB 3M4OH 3OMGA 2UUCQ 1GUGA 4IFDI 3VDYA 4JI5Q 3KDFA 4PG3A 2KQ3A 4R4IA 1I6HH 2PZTA 1EOVA 1FNWA 1MHWC 2ENBA 2NN6H 1IBKQ 5C44G 2K75A 2XSCA 1TR5A 4LF7Q 1FJGL 1EUJA 5HGQA 1NJIC 2LFNA 3F2CA 1CZGA 3T1YL 1CA6A 1F9QA 4B9WA 4POGA 4R4QA 5IGCA 1KTKA 1QWYA 2VZAA 1LTTD 2MHVA 1QZHA 3F2DA 4GOPC 1VQDA 1DZ1A 3NSWA 3CC4A 3T16A 1EOTA 1U5KA 1QNKA 3T13A 1IBMQ 2RCNA 2MJ8A 3DLLA 2LS01 5M3MB 3A5ZB 4A3JG 5LL6X 1XMQQ 1PH6A 3CD6A 5I9PA 2Q2UA 1STAA 3H91A 4LMQD 3S16H 3J7A5 1PYBA 1L1OA 5GQOA 1PTOB 4OO1H 2ZXPA 1S3OA 4M1UB 1VQ5A 1LTGD 4KJNA 3AFPA 1CHPD 3L7ZC 3E6ZX 3AQQA 2EY1A 2EVBA 1J5EQ 2E5LL 2F0LA 4P72A 1UE1A 1WTVA 3S1MH 1GO3E 4OWTB 3M7GA 3QWNA 1KC8C 1EEFD 1XMOL 1PFNA 3CCEA 2PYKA 3NTHA 2CQAA 1E1TA 2I5LX 2Z4IA 1X3QA 3I4MH 4QIWE 5LMUQ 2JA6B 1JC7A 2DUDA 4IZ8A 3RR5A 2A68D 1N36Q 3R93A 2B2WA 5AJ3Q 1YI2A 3U9SA 5IYBG 1SMYD 3DEOA 4PMWA 2HQEA 5I2XA 1ENFA 5C4JH 1WCMB 3A0JA 3OYYA 4HAEA 4PNYA 4LFAQ 3T4AC 2CW0D 1VMPA 2AQ2B 3IKJA 2LSSA 3J80i 3PF5A 3IRBA 4C1NI 1EZ8A 1BDOA 2JJQA 4OIKA 3K5NA 1LT3D 5I6WA 4A3EH 1CZWA 2Q8RE 2XGTA 2UUAQ 1J6QA 4IOCA 1O80A 4O1NA 4K0KL 4LK1C 1A2UA 1PFSA 4HCSA 2LKVA 5JAVA 2F0TA 1WTOA 4DV2Q 4G7HC 3BDLA 2F0VA 2A74C 3ULLA 4B3RQ 5FO8B 2VUMB 3HOVB 3S1RB 5I4DA 1JMCA 4QL5A 2C5CA 3GTMH 4G57A 2A69C 1VQ8A 4ID6A 4IUUA 2AKWB 2V1CC 4DNIA 3I4NH 4H7BA 1BF4A 1K28A 4ZYSA 1GXDC 1VQ4A 2YTYA 5IIFA 4KJOA 4YY3L 1DOLA 1LYLA 2PO4A 1YJ9A 1Z9FA 3STBD 1EL0A 4IURA 4X62L 2JA8G 1HZAA 1TXYA 4A3MB 3KFUA 2KCTA 1YHBA 1WJJA 1QVFA 3LWEA 3IL8A 3GTJH 2MGSA 3C1EA 2SNMA 3W3AA 4HJ7A 4JI4L 2TMPA 3F8TA 3BZKA 2A6HD 1UE5A 5DAUA 1XNRL 3A54A 4NP5A 3I7FA 2Z9HA 1VF5C 4ZKCB 4BBSG 3G6EA 1IL2A 2K5DA 4DA2A 3FRPB 2R7ZG 4JOIC 4DV6Q 1CK1A 5C0XJ 1STNA 1Y1WB 1VQMA 1E3PA 3HOWG 3CRLC 3CRKC 2N78A 4YWKA 4A3DG 5JJZA 2KCCA 1PHJA 4NXNQ 1EIFA 4LW1A 3J80E 3NBHB 3VR2A 3RZOH 4YCUA 4C3HB 1EWHA 3AU7A 3HOUH 3SK6A 1XNQQ 4DK1A 4JK1C 4L5RC 4C56C 5J1ZA 1BBXC 4HIDA 3GD7A 4KK7A 5KEEA 1NNXA 4WFN3 2E8GA 4AYBG 1HHVA 2CQOA 2F0DA 3HOXG 1VS0A 2EPBA 4A3KB 2BE5C 3PO2H 2QILA 5E4XA 1BNZA 1WI5A 1BQQT 3KJOA 3BVGA 2F3WA 1SE2A 3MXUA 4CGYB 4KD3A 3K0YA 3F2BA 1GUNA 1YBYA 1IBLL 1OTCA 1OXSC 3RUZA 4JVZA 1SYDA 2KVMA 2HQLA 1VQJA 4ALPA 2KJXA 4RCNA 5IP7G 1HR0L 4Q0FA 3RN5A 3KLSA 5JOBA 2D0OA 3T53B 4XQJA 4L5SA 4QF4A 3RLNA 2EXZA 3FPUB 1TWFH 4RKLA 1ML0D 1EU4A 4PV1C 4L5QA 2XRQD 3N6RA 5BN5A 1NBWA 3NBHA 4Z9CB 4LUVA 1X54A 1KNEA 2R7FA 3OPOA 4R1JA 2MNAA 2WFWA 1E7ZA 4OL7A 2B2YC 5C3EG 3FKIG 3H0GG 3CF5A 3NWTA 1MIUA 2E75C 1YVCA 2B2TA 1EY7A 3M4OB 1NSNS 2E76C 2B3GA 3PIOA 1I6HB 4A76A 4IN3A 4A3IH 4K2KA 2NZHA 2O4XA 5DM63 2M00A 4I7AA 1TU2B 4FF4A 1A8VA 1Q86C 1I50B 2OTLA 2JQOA 1VQ6A 3H3VC 3HS0C 1YHQA 2NVYH 2AMCB 2KCMA 4DR5L 4KV6A 2F0UA 5EGTA 3IAYA 1UNSA 2DJGC 4CKEA 4E6IA 1CUKA 2EZVA 4FF3A 1YNND 2LXJA 4LFCQ 5F2DA 3H15A 4MIUA 3I73A 4DUYQ 2K50A 2OXPA 1QUQA 4UY8C 3PCOB 5ELCA 2BOSA 2PMZB 3K7AH 3KF6B 3SGIA 4P75A 3DMUA 5E3FA 4N9TA 4A93G 2I07B 1CKNB 1SNCA 2NYZD 5L37A 3ONAB 1K8AC 3S16B 3VYRA 4HIKA 4H02A 1CA5A 3DWQA 1C4QA 5KYLA 1KNAA 1GKHA 2B63G 4I65A 1WYDA 1ICFB 2E2HH 2UU9Q 4G4KA 1YNXA 2B39A 5IT9E 1RKNA 1LO5D 2L15A 4GKJL 3EQLC 3FDTA 1A63A 2B8FA 5C3XA 2BA1A 4J8QA 2WAQB 3S2DH 3TQYA 3E3XA 4P74A 2L12A 4A3GG 1B3AA 4AQYQ 1WTRA 3I4MB 3UDGA 4K8IA 4RCOA 3FMCA 1E22A 4KY5A 4ME3A 3UE1A 3R8BA 4JI7Q 4GN5A 2ZJRA 3S1NH 1RF2D 2VQFQ 1Q82C 1I94L 2R93H 4R4OA 3URYA 1IZ6A 1KHIA 3MXNA 1SYFA 5M3MG 1OXXK 1V9PA 2KHJA 2EE1A 4JV5Q 2KECA 2A6ED 3HOZG 3W2DA 4HR7B 1TIID 4LF6L 4DAVA 1E2ZA 3SE0A 3HGBA 1W6JA 4A3EB 1PH8A 1K9MC 1SYCA 4QJFA 3NQTA 3VR5A 1O7IA 1CTMA 3RD4A 2UXDL 4JG2A 1CKNA 1BKBA 3I70A 4JI2Q 2EJMA 1PTOD 4X64L 1OO9B 5EPLA 1LTLA 5I2YA 5G3LD 1CM9A 1F9RA 4IPGA 3A7AB 2D2CC 4BBRH 2X6LA 2FFKB 1GHJA 2BCOA 3GQBA 2QKIC 1D8LA 4BS9A 4RAUC 5JVG3 4IPDA 1X6OA 3S14H 1WTQA 1KD1C 3GTMB 4YCWA 4BY1H 4EGVA 3TN2A 2WAQE 2B8GA 1Y8OB 1ZKOA 5JPNC 4DR4L 4TRDA 3TS0A 4EVOA 4JI3L 5CBEE 3I4NB 3MA2B 4HJ9A 4DGZA 4C3IG 1HPCA 1PRTD 2IT1A 1PZID 1RCVD 1FNVA 1QB5D 3DWAA 3KOJA 3M9BA 1YJNA 3GTLH 5CC4A 3MFYA 2VY3A 4O2DA 2Q2HA 4RGTA 5DNFA 1LACA 1U4MA 3BVMA 3GTJB 3L3OC 5LMNL 1UEBA 4GZYC 2K5QA 1O7YA 1GVPA 3KF8B 2NB0A 1M8AA 3WOEA 4LFBQ 4DAYB 1EYGA 3NELA 3LNNA 2EYHA 1VQ7A 2WB1B 4QY7A 5M5WH 1S5BD 4OIJA 2VNUD 2OEOA 5KYIA 2RDFA 1X3EA 2MO1A 2PQEA 1CQVA 3N52A 4NB3A 3RZOB 5T1GA 1A3UA 2KENA 1EQTA 1O78A 3HOUB 1HNXQ 1XMOQ 2R92G 2AWOA 4GOPA 1H9KA 1K8MA 4IUVA 3NTKA 4HMJA 4DV7Q 3OIPA 5M3FG 2JP1A 2UXBQ 3H94A 2M2LA 1B4OA 1LTSD 4ZK9B 1N9WA 4LF4L 1Y14B 3J7AF 2KEEA 4DV4Q 2JA5B 4A3MG 3PUVA 4GKKL 2NN6I 4G7OC 1G91A 1QVCA 1W6KA 4UP8A 3QB3A 3PO2B 3M4YA 1JJ2A 3BDCA 1BCPF 3GTKB 4DPGA 1T9HA 3UDXA 3A74A 2HDLA 2E2DC 1DXMA 2EYMA 1MI2A 4X66Q 5DLQE 4AYBE 2D0PA 3S1QB 4DNRB 5A2QE 1KLGD 1Y1WG 5IWAQ 2JEBI 5EBDA 2A68C 2N55A 4R9WA 3KF8A 1ESRA 1HXYD 3KK7A 1SMYC 3OTOL 2NTSA 4DAYA 5IP9G 3NBIA 2ASBA 2F0EA 4OGQC 2CW0C 1N34L 3C46A 4C3HG 4GNXB 3MFGA 2WKDA 2R6GA 1X3FA 1JE4A 1TWFB 3UDIA 2RHSB 3ND9A 2HHHL 4KKSA 1D2BA 5E4WC 1KAAA 3EVQA 1NUCA 2LMCB 4KKTA 2B2VC 3LGJA 4DV3Q 5IGDA 4X65Q 1GUOA 1Q8IA 3I2ZA 2F0JA 5M5YB 1B9MA 1AE3A 3K57A 3P75A 1L1OB 3L0OA 3HKZE 1E0BA 4DAPA 4YY3Q 1NR2A 1VQ9A 2RDGA 3RLFA 5C44H 4J15A 1F9PA 1PH5A 3DHQA 4B3ML 3X3MA 2RDHA 1TY2A 3I4OA 3Q23A 2Q2TA 2ZTEA 2OQ0A 4LF9Q 1TWHH 1SMXA 2K1BA 3SR1A 5KNDA 4CJ0B 2NVYB 2CWPA 1D6EC 2VS1A 3W1GA 1G6ZA 4YHHL 1H95A 2PZUA 2PNRC 2CH4A 2K04A 3F1ZA 1G8ZD 1HQRD 3STBC 4LJZC 3M7NA 2IX1A 4L6TB 1TQOA 4A3JH 1ENCA 1MKHA 3DXJC 1A3TA 4GNXA 1VQPA 5C6AA 3K7AB 3J81L 1HUNA 4DV0L 3B6YA 1ZYRC 3HOYG 4DR7L 5CV7A 2O5JC 4DR6Q 2A6HC 3I72A 4A3FG 4JCVE 4FF1A 3BJUA 1ILPA 1RTOA 2DN8A 2ALYB 1QE6A 4FNFA 2E2HB 2K33A 4F87A 1HUMA 4M8AA 1FYCA 3SXHA 1FR3A 4JBWA 1J9OA 5JEAH 1B1ZA 5C0XG 1K3RA 4KN7C 5GAGC 2E2IH 2C9OA 1LT4D 1I3QH 3M3YH 1LT5D 4N8X1 4JOIA 4AIMA 5COYA 2N3SA 2CVRA 4DR3Q 3P1HA 3TBIB 5BR8L 2PQAB 3WDNA 2MQHA 4YCVA 4C3JG 3TSSA 3S1NB 1S5CD 4EQOA 1QNUA 1TVXA 1TWCH 1H9RA 3CW2C 2R93B 2HUGA 1PRTB 1BCPC 3FEWX 1JWMD 3EN2A 4XTCS 1XWEA 1B53A 1I4PA 1TY0A 3EA6A 1SROA 1HTLD 4BY7B 1AE2A 3TS2A 1ILQA 2PCFB 4OO1G 5EPJA 2JK8A 1RHPA 4JW0A 4A3CG 3C2PA 3RZDH 1VDZA 4ABNA 2JA7H 3VYSA 4CDDC 2CCZA 3WOFA 1HNZQ 3G6JB 2H4OA 5IOCA 2EQSA 4BBRB 1ICWA 1KDCA 1BO0A 1EEID 4DN4M 5G3LF 4BXXH 2WAQG 2BA0A 1X3GA 1UAPA 2EDGA 5HGTA 1JOKA 3MXGA 3J7YW 4Y7NH 3Q0AA 5IYCG 3S14B 3TZUA 1EQQA 5IYDG 3BDOA 4OWWB 2UXCL 4DUZL 1PLFA 3CCVA 4UP9A 2NUCA 2ICIA 3MZ5A 4DR2L 4B3TL 2FMMA 2MO0A 4IFDG 2QF7A 3TP7A 3KBGA 1YHAA 5FKAC 1C0AA 2K5HA 5A35A 2PQAA 2JA8H 3TP6A 1I4GA 3OSOA 2RHQB 4JI8L 1QCBD 1ESFA 5IE8A 1Q12A 3U4VA 2I5HA 1PA6A 4JBJA 2AQ3B 1UUPA 1IL8A 2SDFA 4KHZA 1F2LA 1STEA 3TMEA 4B3SL 1N32Q 2PZWA 1HA6A 2YYZA 2UUBQ 4OX9L 3HP3A 2EYFA 3I4LA 3AMUA 1EIHA 3MAQA 2IPKD 4JI1Q 1HNWQ 2F0MA 4DV1Q 3A56A 1SJHD 1N33L 1A0IA 1JJCB 4LF5L 3CP0A 4NXML 1X55A 2KHSA 5M5WB 1YZ6A 4DV5L 5DM73 1XTCD 4X3TA 5IGFA 5FJ8G 5KGUA 4TVAB 4JI6L 3I90A 1KDBA 2EYOA 1AFPA 1R4QB 2TSSA 2QEJC 2DNCA 3VR6A 1W3SA 1B7YB 4APVA 4KHPQ 2UUCL 1I4HA 1IW7D 4JI5L 5FO7B 1SRUA 3NE5B 3GTOB 1LLRD 1DCZA 1PH2A 3UE0A 4CHTB 1IBKL 1NMGA 1STYA 1LTAD 3G4SA 1AP0A 2F0IA 1K3BC 3J81j 1MD2D 3BG3A 3ULPA 2ZM6Q 3U9OA 4JPBW 1V8QA 4WJ4A 1X56A 1WTWA 1Z47A 4MZ9A 1EY0A 3S17H 5FLXc 1Y69U 2VB3X 1AZQA 1IBML 2ZTDA 2HD3A 3FHWA 2F4VL 4QQBX 3E5SA 3ERSX 2RVLA 3MEFA 4GLAC 1XMQL 5T1IA 4K5XA 4RMFA 4O42A 4JBMA 1KRSA 1ET6A 1EQVA 5CV9A 5EJWA 1W2BA 2KBNA 5KNCA 1BR9A 2OTJA 3NTIA 1DONA 5EPKA 1ZEQX 5JPMC 1IKLA 3VYTA 3K80C 2FJ2A 2K03A 3HOUG 5KIXA 1BOSA 2KA7A 1EY8A 4K6DA 2A6EC 1C8CA 2ZT9C 3K6OA 5BN4A 4CDEC 3CKIB 5ELOA 1J5EL 1QUQB 2HCCA 4DR1Q 4L63B 3H0GH 2EYPA 3HKZG 1HFGA 3DEPA 2NBFA 2JA5G 3M4PA 4ZAIA 2F4IA 3KUPA 5LL6S 3V05A 3GTQB 2Z6BA 4IFDJ 1SYGA 1PDQA 1QILA 2X6GA 4A3LG 5JJKA 4LF8Q 2XRSD 4YWMA 1AH9A 5LMUL 2AWNA 2G9DA 2JXMB 3E9IA 1KRTA 1N36L 3JAMc 5AJ3L 1LT6D 5C44B 4A4IA 1Y1VH 1OXTA 3R2IA 3OMCA 4JYAQ 2VW9A 4HIOA 1STHA 5E7NA 4LFAL 1WTPA 3TDQA 1TS3A 1JWUD 4JC0A 3ZJYC 1TWHB 3TZDA 4YWLA 4K6LA 4G7ZC 1OXUA 5KNBA 4RA8A 3KYHC 4QCLA 2YU9H 2UUAL 1O7ZA 3K59A 2EY6A 3QOLA 2A69D 1VQHA 4IOAA 3T1HQ 1SE4A 1ONLA 3MHBA 1C7YA 5D3IB 4A3JB 3OWFA 2WKCA 3MXNB 1EQRA 4TKOB 4DV2L 1TS5A 1A62A 4B3RL 1VQCA 2SOBA 1FVIA 3GTPH 2B63H 3OWEB 4OONA 1STGA 4DXGA 4RGOS 4WRDA 3H3VI 3CQZH 1IYJB 5HURA 2R3ZA 2GA4B 4JI0L 4KLKA 1DD2A 1EWIA 1PMRA 2D9UA 4OWXB 4A3GH 3A7LA 4EQ5A 1I3QB 2Q8IB 3M3YB 2F0QA 3W1BA 1K8GA 2E2JH 2F0PA 5J22A 3P20A 3S1MB 1U4LA 1B3QA 2FINB 2H1EA 5D3DA 1H9SA 4IUTA 2VQEQ 2EY5A 2J0TD 4J1MA 4F8MA 2JEAI 5C4ZA 3LWUA 5I6YA 3NENA 1TWCB 1AN8A 3D0FA 1B44D 1IXRA 2YTVA 1VQOA 1EZ6A 3VYUA 4EQPA 3HOZH 1V1QA 3EROA 4UHVA 2XVSA 4DV6L 3K58A 2QDBA 3I8ZA 4FXDA 1JT8A 1S5FD 5C4JB 5IGEA 2N8NA 4K5VA 1BXTA 1EFWA 2KEDA 3K0XA 4KHVA 4NXNL 2F0WA 1G6PA 3K5OA 3MXPA 1J8IA 1BBWA 3RZDB 2JA7B 2N88A 3A8KE 3WWVA 5IGGA 3J80L 2H5XA 2PMZE 2CH4W 4CJ1B 1XNQL 3S2HH 4ILWA 1LM0A 1JCKB 3QR8A 5C5LA 1ZXTA 4Y7NB 4DK3C 3ER0A 2I46A 3KBXA 2F0GA 2C35B 2F1MA 4C3IH 3G48A 2XWBB 4PZ6A 2KOLA 4GS3A 2JA9A 1YEZA 3H3VH 1YITA 3NPPA 3QIAA 4DK0A 1VQEA 5BN3A 1VQKA 1P16A 1B8AA 2LXKA 2Q2IA 2LY7A 1SBBB 2JA6G 4GOPB 1EYAA 2WV6D 4DXFA 3DM3A 1S5ED 1JJGA 1FJGQ 5M9OA 3K5LA 5C5MA 3EJIA 2F0FA 3AB9A 3KLWA 4N8FA 1WCMG 3H6MA 4BY7G 1E2WA 1SSOA 1EFID 3T1YQ 1DOMA 3BYTB 1TS2A 2A5HA 1A2TA 2F52A 4ODGA 4KMUC 1U0LA 1PVOA 1B50A 1JOQA 4P2CB 5C4XH 1JORA 2AUJD 1YNJD 3NP8A 3PO3H 1D1KA 3VR3A 5JVH3 3TP8A 4PMCA 2L1BA 2K5NA 1VF7A 1Y8NB 1CKMA 4BBRG 1PH4A 4L8JA 2FHTA 2WP8J 5IGBA 2NVXH 2FMCA 1HR0W 4OXPA 2K5VA 5H1SE 1SNMA 4UP7A 3ERQA 4HJ5A 1AZPA 5KRUA 3I3CA 3NQIA 1Q7YC 4DK6C 3PIO3 3GTGH 2L9HA 2R92H 2VUMG 3L2PA 3MWYW 3HOVG 2ZXRA 5DEHA 3RMHA 5EKIA 2IX3A 5M3FH 5GAHC 1JR0D 2Z6KC 2KCNA 2RCFA 3A55A 3K7UC 2E5LQ 1IHZA 1RTNA 4HMIA 1GD7A 5C3WA 3CMEA 3Q22A 2L4NA 5BR8Q 2PW7A 2D5DA 2QCPX 2SEBD 5EKKA 3V2TA 1CSQA 1X3PA 1OXVA 3CCQA 1EY4A 3KLSX 1L0XB 1JB3A 1ASYA 1HA5A 3PUWA 1FL0A 3EFXD 3EIVA 1KLUD 4LFCL 4BA1I 4X3UA 4DUYL 3S17B 1AW7A 4A3BH 4UAIA 1E2VA 5IP9H 1JICA 1Q3LA 2BH8A 4ZCKA 3J81c 1Z6HA 2QA4A 4HIMA 1EYCA 1VQNA 1KQSA 1LTBD 5CV4A 2NVTH 2HT1A 4ZQ3A 2RKSA 2UU9L 1FGUA 1HZCA 2PI2E 3CPFA 4K0KQ 1HRJA 3ULJA 5ELFA 4MNOA 2M9VA 5GADC 2WB1E 3BS1A 4J6HA 5IT9L 2GVBA 5M5XH 1X9NA 4IALA 3CCJA 3H0GB 3UI2A 4QUFA 1PYWD 1G2TA 4DR2Q 3MTSA 4WORA 3VA7A 4AQYL 1X65A 4RWSC 1RIPA 1K0SA 3PUYA 5K36G 1KIXA 1SEBD 2L11A 3GV3A 4JI7L 4ZUJA 4KY7A 4A3KG 1Y1VB 2OF1A 1G2SA 1B9NA 2YTXA 3S24A 3U4ZA 3H09A 2K05A 3D4RA 3PIPA 4RFBA 1S5DD 4QMGA 4IQZA 4JV5L 1NAPA 4NMZA 5J3BA 4X62Q 3C3LA 1A6XA 1QJOA 4A3IB 1PH1A 1U4RA 1EY5A 1XPUA 2ZJPA 1TKWB 2YU9B 4XQQA 4CBVA 1P8LA 4JI4Q 4PMBA 1JOOA 1SNDA 4ME5A 5FLMG 2I5MX 1XNRQ 2R7DA 4JI2L 1FD7D 3P7JA 2OT2A 2OQKA 4YIJA 3HOYH 4FP5D 4Y52H 5C4HA 4A3FH 3DWPA 3OHXC 1WTHA 3SHLA 4FXGC 4GLVB 3CCSA 3GTPB 4IJLA 3I56A 4DF7A 2EJFC 2VXWA 1PFBA 1N8RC 4FYDA 3D4DA 5GROA 4U68A 2O2LD 3CQZB 1BBUA 5C0XH 1NY4A 4R8NA 4QIWB 4K8JA 1V1PB 2NVQH 4KY6A 1I50H 4A3GB 3SVMA 4IO9A 2YV5A 4PZ8A 1U4PA 2E2JB 4C1NK 1IW7C 4C3JH 2NN6G 1F77A 1MJCA 1S40A 4ZUIA 2WIIB 3K8AA 1EU3A 4N9PA 3S2DB 4UDUC 1HZBA 2EY2A 2F4VQ 4KKUA 1YJWA 5IYBH 4IPHA 2G5DA 3HOZB 4LFBL 1IBLQ 1ENAA 2B29A 5CV5A 4MTNA 4TQUS 2B2UC 2DNEA 2I0QA 1DM0B 1F2YA 5CV8A 5LMNW 4A3CH 4IUQA 5CBAE 2IWHA 3CPWA 1HR0Q 3RNUA 3SK4A 3NK9A 1SFOH 4HCEA 4OHJA 1HNXL 2CKZB 1Q46A 5JEAG 3JAMi 3S2HB 4MN3A 5K5PA 1LABA 4DV7L 3ICEA 2UXBL 1R9TH 5IYCH 5CMDA 1QOHA 2BDOA 5IYDH 4TSSA 1STBA 3Q8DA 1V1PA 4U673 2DY7A 1NR4A 2K7VA 2HCIA 4DV4L 1IKMA 5NUCA 1PTOF 1EIGA 4IFDH 4C3IB 1LV9A 1C9OA 4HN7A 5I9OA 4OELB 1PH7A 1B2TA 1Q1EA 1H9MA 1I5FA 1VQFA 4A75A 3I4MG 1Q90A 4BY1B 1UE7A 1DYQA 5D65A 4X66L 1SNQA 4QUCA 4XDXA 4DU9A 2HDMA 4MHEA 4CDFC 2GN5A 2RA4A 5IWAL 1YIJA 5A2QL 3FPPA 1SNPA 5FO9B 1SE8A 4XIGS 1PV4A 1V43A 4BA2I 3GTLB 1PRTF 4HSVA 3QOJA 4DR5Q 1CI3M 3TREA 1AEXA 5FLXE 1SAPA 2JA7G 5C4XB 3I91A 3PO3B 5EQ0A 2ID0A 2A1AA 4A3EG 2EIFA 2PNHA 3ND8A 3OW2A 2B2YA 3HZXA 3BZCA 4BXXG 4BBSH 1HTPA 2IW3A 2R61A 1L0WA 4FDBA 2NVXB 1FNUA 4IPCA 4DV3L 3LX0A 5FJ8H 2MP1A 4X65L 1U9RA 2K4KA 2R7ZH 3HRZC 3RLOA 1TWGH 1VQIA 1L2FA 2Y0SB 3PIP3 4JI0Q 3HOWH 4GNXC 3RN2A 3C1FA 3F2UA 3GTGB 5D14A 2R92B 3L9AX 4A3DH 2P5ZX 2XWJB 4B08A 3J7ZC 2IX0A 2GVAA 5ELNA 1YNNC 5M3FB 1LTRD 1RODA 3NXWA 4GKJQ 4I7ZC 4C2MH 3I4NG 1KAWA 5ELEA 4EQNA 4IUPA 4O0AA 5FOBB 4XQNA 4LF9L 5GAEC 1ZYRD 1L1OC 2WINB 4IUNA 1TS4A 3JAME 3G7LA 3HOXH 1CHQD 2RBMA 4LF7L 1GUTA 3E0JA 5CYUA 4HEDA 1PZKD 2IJ0A 2VB2X 4BWGB 1K83H 3PMFA 4XT1B 1GJXA 4QB4A 2RQXA 4A3BB 1H9JA 2XTIA 1I94Q 3OIQA 4K5WA 2ES2A 3K5MA 3T51B 3S15H 4RH6A 1QVGA 1SE3A 2F0KA 2CWAA 4DR6L 2NTTA 2J4XA 2EYJA 1SNOA 1RD9D 1SDFA 4LWCA 4R4TA 4LF6Q 1PXUA 4HJ8A 4S3SA 5JEAJ 2WB1G 3A5UA 3R2TA 5IY0A 2B2WC 4FVMA 2NVTB 5HY6A 3CCUA 1DGSA 1JE5A 3PQIA 4XT3B 5IP7H 1G291 3J7AV 2Y0SE 2UXDQ 1VQGA 4CKBA 1VQBA 1DJRD 4X64Q 5M5XB 1EY6A 4HTHA 2JA5H 2F0OA 4WJWA 1A3VA 1BCPD 4RHSA 1HJPA 4A3LH 1WFQA 1RDPD 3GTKH 3A8JE 2PW5A 1T5EA 3CAMA 1TWAH 3MVVA 5C3EH 3FKIH 4DR3L 4DR4Q 1MSHA 3Q24A 4ZRZA 1BVSA 3KJPA 1WD1A 2VL6A 2ZXOA 3CCMA 3BU2A 4JI3Q 3S1QH 4NW2A 2QDLA 1PTOC 2EOTA 2X69A 4AH6A 3IFTA 3PO2G 2F0NA 3AFQA 4LUZA 1FGBD 3MEHA 1GOZA 2MFIA 4LUOA 4KI0A 4DFAA 5TSSA 3W5OA 2IL8A 1GHKA 1H9SB 3VR4A 2G9HD 4ZKBB 4MTKA 4QGUA 1CKOA 1IYUA 1JB7A 5LMNQ 3IFDA 3BYYB 1EIYB 1PRTC 2MPMA 2A8VA 3HOYB 4NPSA 1HNZL 3J80c 4A3FB 5M5YH 1E24A 3M4QA 3VA5A 4P71A 3DM1A 4LNQA 1YNJC 3CXCA 1KABA 4PQXA 4A93H 2JYOA 4B9XA 1F9SA 2K28A 3Q6SA 4FXKC 1K0RA 4NKLA 3TP5A 3PUZA 1IYVA 2F3VA 1PZJD 2BH2A 1Y1VG 1LUZA 1PFMA 3D6WA 2NVQB 4GLXA 3K81C 1UEAB 3GV6A 5ELBA 5ISRA 3KLRA 4XYOA 2BDNA 4LAAA 1B70B 4LF4Q 1GUWA 1R4PB 3QG1A 2ICEC 3ZYYX 1SLJA 4A3IG 4C3JB 4GKKQ 5FLXL 1XJVA 1Q81C 1ASZA 3J81i 1N32L 1I4XA 2Z4HA 3D8GA 2E2IB 1II3A 4OEMB 2UUBL 4V190 5LHY1 3PSIA 1UE6A 1KL9A 1SYEA 1BUVT 3DUZA 1GM5A 5JJLA 4JI1L 2DGYA 1HNWL 1O7LA 1HCZA 5EKLA 2Z6KA 2F3IA 1S72A 4DV1L 1KXLA 3NWSA 1K8OA 5M3MH 1XXGA 2Q8TA 1LTID 1XYIA 2ZJQA 2A73B 1VCIA 2MUYA 5AFWA 2F03A 3OTOQ 2E74C 3SEBA 2WACA 2XIWA 5CORA 2NZ1D 1N34Q 1PTOH 1A15A 1F2MA 4X3SA 1SFOB 2QGQA 4CKCA 4F88A 4KHPL 2NZOA 4RGMA 1XPRA 4DAMA 2HHHQ 3QO2A 2BE5D 1JWSD 1R9TB 4H13C 3G71A 1MJEA 4ZLTF 1V1OA 3JAML 1VQLA 1Q8KA 3U58A 3QJYA 4NDXA 2NWGA 3TEHB 2JA6H
chains in the Genus database with same CATH topology
3SDZA 4X3KA 1X32A 3NHHA 3R3OA 1EY9A 1RJTA 2DY8A 1QG7A 2SNSA 4Q5VA 2J7ZA 4ULLA 1CT1D 4XYQA 3V96A 2JA8B 4RKBA 1JQYD 3GP7A 2B2TC 1I4RA 1C48A 2V4DA 2B2VA 3S9WA 3GO5A 2PPBC 4FF2A 3J81E 4BBSB 1XX8A 1I4QA 2XN9C 1Y8PB 1CFMA 3PUXA 4HSPA 2JSOA 2R7ZB 1TWGB 3HOWB 1D5ZC 1D5XC 1KDAA 2L5TA 3BZDB 4A3DB 2EYLA 2K01A 1EYDA 3SK8A 2RSOA 4C2MB 4H0LC 1MGSA 3HG9A 4K2LA 4K14A 1M4VA 1BCPB 1DOKA 4AYBB 1ET9A 3HOXB 3D4WA 3T56B 5CR3A 1SJED 2F0SA 1I6VC 4FO2A 2O5IC 1Z7TA 1K83B 5IODA 3CHBD 2JE6I 3ITPA 3HEJA 4CJ2C 2AQ1B 3S15B 1S4ZA 5CV6A 5FK9C 3MC0B 1WTXA 1D5MC 1GUSA 3OW7A 4R8IA 3D6CA 2XNAC 2Z8LA 4RHRA 1Q1BA 2EJGC 3A8IE 4F7XA 3HKZB 2KUMA 3PV0A 1MSGA 1WVLA 3OOCA 5C0XI 2K32A 1TT2A 1T5XD 4RGNA 1HFNA 4XXEA 1CQFA 1TWAB 5K36H 4KTAA 2B2UA 5E1FA 5C3EB 3FKIB 2Z1CA 5CGKA 4V0BA 1EWCA 3BVZA 4KD4A 2K6AA 3NUCA 2F0HA 3CU7A 4KN4C 3O13A 5ELDA 2L55A 2AUKA 1F2ZA 1L0YB 4OO1I 3SK5A 1SXTA 1HQMC 1NCVA 2RSNA 3D3RA 3FVQA 1WD0A 2K5WA 2CHBD 3D31A 1D1IA 1SYBA 1VMCA 2D62A 5EBCA 4A93B 4H44C 3X3NA 3M85A 2L0CA 5J39A 1MBYA 2B63B 4DNTB 3OMGA 1GUGA 4IFDI 2KQ3A 2PZTA 1FNWA 2ENBA 2NN6H 2XSCA 1TR5A 2LFNA 1CZGA 1CA6A 1F9QA 4B9WA 5IGCA 1KTKA 1QWYA 1LTTD 2MHVA 1DZ1A 3NSWA 3T16A 1EOTA 1QNKA 3T13A 2MJ8A 2LS01 5M3MB 5LL6X 5I9PA 1STAA 3H91A 4LMQD 1PTOB 4OO1H 2ZXPA 4M1UB 1LTGD 4KJNA 1CHPD 3L7ZC 3E6ZX 2EY1A 2EVBA 2F0LA 1WTVA 3M7GA 3QWNA 1EEFD 1PFNA 2PYKA 3NTHA 2CQAA 2Z4IA 1X3QA 2JA6B 1JC7A 4IZ8A 2A68D 3R93A 2B2WA 3U9SA 1SMYD 3DEOA 4PMWA 2HQEA 5I2XA 1ENFA 1WCMB 4HAEA 4PNYA 3T4AC 2CW0D 1VMPA 2AQ2B 3IKJA 4C1NI 1EZ8A 1BDOA 4OIKA 3K5NA 1LT3D 5I6WA 1CZWA 2Q8RE 1O80A 4O1NA 4LK1C 1A2UA 4HCSA 2LKVA 5JAVA 2F0TA 1WTOA 4G7HC 3BDLA 2F0VA 2A74C 5FO8B 2VUMB 3HOVB 3S1RB 5I4DA 2C5CA 4G57A 2A69C 4ID6A 4IUUA 4H7BA 1BF4A 4ZYSA 1GXDC 5IIFA 4KJOA 1DOLA 2PO4A 1EL0A 4IURA 4A3MB 3LWEA 3IL8A 2MGSA 3C1EA 2SNMA 3W3AA 2TMPA 2A6HD 5DAUA 3A54A 4NP5A 1VF5C 4ZKCB 2K5DA 4DA2A 3FRPB 1CK1A 5C0XJ 1STNA 1Y1WB 3CRLC 3CRKC 5JJZA 2KCCA 3J80E 3VR2A 4C3HB 1EWHA 3AU7A 3SK6A 4DK1A 4JK1C 4C56C 5J1ZA 1BBXC 3GD7A 4KK7A 5KEEA 4WFN3 1HHVA 2F0DA 2EPBA 4A3KB 2BE5C 2QILA 5E4XA 1BNZA 1BQQT 3BVGA 2F3WA 1SE2A 3MXUA 4CGYB 4KD3A 3K0YA 1GUNA 1OXSC 3RUZA 1SYDA 2KVMA 2KJXA 4RCNA 4Q0FA 3KLSA 5JOBA 3T53B 4XQJA 4QF4A 2EXZA 3FPUB 4RKLA 1ML0D 1EU4A 4PV1C 2XRQD 3N6RA 5BN5A 3NBHA 4Z9CB 3OPOA 1KNEA 4OL7A 2B2YC 3NWTA 2E75C 2B2TA 1EY7A 3M4OB 1NSNS 2E76C 1I6HB 4IN3A 4K2KA 2O4XA 5DM63 2M00A 1TU2B 4FF4A 1I50B 3H3VC 3HS0C 4KV6A 2F0UA 5EGTA 3IAYA 1UNSA 4CKEA 4E6IA 2EZVA 4FF3A 1YNND 5F2DA 4MIUA 3I73A 2OXPA 5ELCA 2BOSA 2PMZB 3DMUA 5E3FA 4N9TA 2I07B 1SNCA 2NYZD 3ONAB 3S16B 3VYRA 1CA5A 3DWQA 1C4QA 5KYLA 1KNAA 4I65A 4G4KA 2B39A 5IT9E 1RKNA 1LO5D 3EQLC 3FDTA 2B8FA 5C3XA 2BA1A 4J8QA 2WAQB 2L12A 1B3AA 1WTRA 3I4MB 4K8IA 4RCOA 3FMCA 4KY5A 3R8BA 1RF2D 3URYA 3MXNA 1SYFA 1OXXK 2EE1A 2KECA 2A6ED 3W2DA 4HR7B 1TIID 4DAVA 1E2ZA 3SE0A 3HGBA 1W6JA 4A3EB 1SYCA 3NQTA 3VR5A 1CTMA 3RD4A 3I70A 2EJMA 1PTOD 1OO9B 5EPLA 5I2YA 5G3LD 1CM9A 1F9RA 3A7AB 2D2CC 2X6LA 2FFKB 1GHJA 2BCOA 3GQBA 2QKIC 4BS9A 4RAUC 5JVG3 1WTQA 3GTMB 4EGVA 3TN2A 2B8GA 1Y8OB 1ZKOA 5JPNC 4TRDA 4EVOA 5CBEE 3I4NB 3MA2B 4DGZA 4C3IG 1HPCA 1PRTD 2IT1A 1PZID 1RCVD 1FNVA 1QB5D 3DWAA 5CC4A 3MFYA 4RGTA 5DNFA 1LACA 1U4MA 3BVMA 3GTJB 3L3OC 4GZYC 2K5QA 1O7YA 2NB0A 1M8AA 3WOEA 3LNNA 2EYHA 2WB1B 1S5BD 4OIJA 2VNUD 2OEOA 5KYIA 2RDFA 2PQEA 1CQVA 3N52A 3RZOB 5T1GA 1A3UA 1EQTA 1O78A 3HOUB 2AWOA 1H9KA 1K8MA 4IUVA 3NTKA 4HMJA 3OIPA 2JP1A 3H94A 2M2LA 1B4OA 1LTSD 4ZK9B 3J7AF 2KEEA 2JA5B 3PUVA 2NN6I 4G7OC 1G91A 1W6KA 3QB3A 3PO2B 3M4YA 3BDCA 1BCPF 3GTKB 2HDLA 2E2DC 1DXMA 2EYMA 1MI2A 3S1QB 4DNRB 5A2QE 1KLGD 2JEBI 5EBDA 2A68C 2N55A 4R9WA 3KF8A 1ESRA 1HXYD 3KK7A 1SMYC 2NTSA 4DAYA 3NBIA 2F0EA 4OGQC 2CW0C 3C46A 4C3HG 3MFGA 2WKDA 2R6GA 1JE4A 1TWFB 3ND9A 4KKSA 1D2BA 5E4WC 1KAAA 3EVQA 1NUCA 2LMCB 4KKTA 2B2VC 5IGDA 1GUOA 1Q8IA 2F0JA 5M5YB 1B9MA 3K57A 3P75A 1E0BA 4DAPA 1NR2A 2RDGA 3RLFA 1F9PA 3DHQA 3X3MA 2RDHA 1TY2A 3Q23A 2K1BA 3SR1A 5KNDA 4CJ0B 2NVYB 1D6EC 1G6ZA 2PZUA 2PNRC 2K04A 1G8ZD 1HQRD 4LJZC 3M7NA 2IX1A 4L6TB 1TQOA 1ENCA 3DXJC 1A3TA 5C6AA 3K7AB 3J81L 1HUNA 1ZYRC 5CV7A 2O5JC 2A6HC 3I72A 4FF1A 1ILPA 1RTOA 2DN8A 1QE6A 4FNFA 2E2HB 2K33A 4F87A 1HUMA 4M8AA 1FYCA 3SXHA 1FR3A 4JBWA 1J9OA 5JEAH 1B1ZA 5C0XG 4KN7C 2C9OA 1LT4D 1LT5D 5COYA 2CVRA 3P1HA 3TBIB 3WDNA 4C3JG 3TSSA 3S1NB 1S5CD 4EQOA 1QNUA 1TVXA 1H9RA 2R93B 2HUGA 1PRTB 1BCPC 3FEWX 1JWMD 4XTCS 1XWEA 1B53A 1I4PA 1TY0A 3EA6A 4BY7B 1HTLD 1ILQA 2PCFB 4OO1G 5EPJA 1RHPA 3C2PA 1VDZA 4ABNA 3VYSA 3WOFA 3G6JB 2H4OA 5IOCA 4BBRB 1ICWA 1KDCA 1BO0A 1EEID 4DN4M 5G3LF 2BA0A 1UAPA 2EDGA 5HGTA 1JOKA 3MXGA 3J7YW 3Q0AA 3S14B 3TZUA 3BDOA 1PLFA 2NUCA 2ICIA 3MZ5A 2FMMA 4IFDG 2QF7A 3TP7A 3KBGA 5FKAC 5A35A 3TP6A 1I4GA 3OSOA 1QCBD 1ESFA 1Q12A 2AQ3B 1UUPA 1IL8A 2SDFA 4KHZA 1F2LA 1STEA 3TMEA 2PZWA 1HA6A 2YYZA 3HP3A 2EYFA 3I4LA 3AMUA 1EIHA 3MAQA 2IPKD 2F0MA 3A56A 1SJHD 2KHSA 5M5WB 5DM73 1XTCD 4X3TA 5IGFA 5KGUA 3I90A 1KDBA 2EYOA 1AFPA 1R4QB 2TSSA 2QEJC 2DNCA 3VR6A 1I4HA 1IW7D 5FO7B 3NE5B 3GTOB 1LLRD 1DCZA 4CHTB 1STYA 1LTAD 1AP0A 2F0IA 1MD2D 3BG3A 3U9OA 1V8QA 1WTWA 1Z47A 1EY0A 1Y69U 2VB3X 1AZQA 3E5SA 2RVLA 5T1IA 4K5XA 4O42A 1ET6A 1EQVA 5CV9A 5EJWA 5KNCA 1BR9A 3NTIA 1DONA 5EPKA 1ZEQX 5JPMC 1IKLA 3VYTA 2FJ2A 2K03A 5KIXA 1BOSA 2KA7A 1EY8A 4K6DA 2A6EC 1C8CA 2ZT9C 3K6OA 5BN4A 3CKIB 2HCCA 4L63B 2EYPA 1HFGA 3DEPA 2NBFA 4ZAIA 2F4IA 3KUPA 5LL6S 3V05A 3GTQB 4IFDJ 1SYGA 1PDQA 1QILA 2X6GA 2XRSD 2AWNA 2G9DA 2JXMB 1LT6D 5C44B 1OXTA 3R2IA 3OMCA 1STHA 1WTPA 3TDQA 1TS3A 1JWUD 1TWHB 3TZDA 4K6LA 4G7ZC 1OXUA 5KNBA 4RA8A 4QCLA 1O7ZA 3K59A 2EY6A 3QOLA 2A69D 1SE4A 1ONLA 3MHBA 5D3IB 4A3JB 3OWFA 2WKCA 4TKOB 1TS5A 2SOBA 3OWEB 1STGA 4DXGA 4RGOS 4WRDA 5HURA 2R3ZA 2GA4B 1DD2A 1PMRA 2D9UA 3A7LA 1I3QB 2Q8IB 3M3YB 2F0QA 2F0PA 5J22A 3P20A 3S1MB 1U4LA 2FINB 2H1EA 5D3DA 1H9SA 4IUTA 2EY5A 2J0TD 4J1MA 4F8MA 2JEAI 5C4ZA 3LWUA 5I6YA 1TWCB 1AN8A 1B44D 1EZ6A 3VYUA 4EQPA 3EROA 2XVSA 3K58A 2QDBA 3I8ZA 4FXDA 1S5FD 5C4JB 5IGEA 4K5VA 1BXTA 2KEDA 4KHVA 2F0WA 3K5OA 3MXPA 1J8IA 3RZDB 2JA7B 2N88A 3A8KE 5IGGA 3J80L 4CJ1B 4ILWA 1JCKB 5C5LA 1ZXTA 4Y7NB 2I46A 3KBXA 2F0GA 2F1MA 2XWBB 2KOLA 3NPPA 3QIAA 4DK0A 5BN3A 2LY7A 1SBBB 1EYAA 2WV6D 4DXFA 1S5ED 5M9OA 3K5LA 5C5MA 3EJIA 2F0FA 3AB9A 3H6MA 1E2WA 1SSOA 1EFID 1DOMA 3BYTB 1TS2A 2A5HA 1A2TA 4ODGA 4KMUC 1B50A 1JOQA 4P2CB 1JORA 2AUJD 1YNJD 3NP8A 1D1KA 3VR3A 5JVH3 3TP8A 4PMCA 2L1BA 1VF7A 1Y8NB 4L8JA 2FHTA 2WP8J 5IGBA 2FMCA 1SNMA 3ERQA 1AZPA 5KRUA 3I3CA 3NQIA 3PIO3 2L9HA 3MWYW 2ZXRA 5DEHA 3RMHA 5EKIA 2IX3A 1JR0D 2KCNA 3A55A 1IHZA 1RTNA 4HMIA 5C3WA 3Q22A 2L4NA 2PW7A 2D5DA 2QCPX 2SEBD 5EKKA 3V2TA 1X3PA 1OXVA 1EY4A 3KLSX 1L0XB 1JB3A 1HA5A 3PUWA 3EFXD 4BA1I 1KLUD 4X3UA 3S17B 1AW7A 4UAIA 1E2VA 1JICA 1Q3LA 1Z6HA 1EYCA 1LTBD 5CV4A 4ZQ3A 2RKSA 1HRJA 5ELFA 2M9VA 3BS1A 4J6HA 5IT9L 4IALA 3H0GB 3UI2A 4QUFA 1PYWD 1G2TA 3MTSA 4WORA 3VA7A 4RWSC 3PUYA 5K36G 1SEBD 2L11A 3GV3A 4ZUJA 4KY7A 1Y1VB 2OF1A 1G2SA 1B9NA 3H09A 2K05A 3D4RA 4RFBA 1S5DD 4QMGA 4IQZA 1NAPA 4NMZA 3C3LA 1A6XA 1QJOA 4A3IB 1U4RA 1EY5A 1TKWB 2YU9B 4XQQA 4CBVA 4PMBA 1JOOA 1SNDA 4ME5A 1FD7D 3P7JA 2OT2A 4YIJA 4FP5D 5C4HA 3DWPA 3OHXC 3SHLA 4FXGC 3GTPB 4DF7A 2EJFC 2VXWA 1PFBA 4FYDA 3D4DA 4U68A 2O2LD 3CQZB 5C0XH 4R8NA 4QIWB 4K8JA 1V1PB 4KY6A 4A3GB 3SVMA 1U4PA 2E2JB 4C1NK 1IW7C 2NN6G 1F77A 4ZUIA 2WIIB 1EU3A 4N9PA 3S2DB 4UDUC 2EY2A 4KKUA 3HOZB 1ENAA 5CV5A 4TQUS 2B2UC 2DNEA 1DM0B 1F2YA 5CV8A 4IUQA 5CBAE 2IWHA 3SK4A 3NK9A 4HCEA 4OHJA 5JEAG 3S2HB 4MN3A 5K5PA 1LABA 5CMDA 1QOHA 2BDOA 4TSSA 1STBA 1V1PA 4U673 2DY7A 1NR4A 2K7VA 2HCIA 1IKMA 5NUCA 1PTOF 1EIGA 4IFDH 4C3IB 1LV9A 4HN7A 5I9OA 1B2TA 1Q1EA 1H9MA 1Q90A 4BY1B 1DYQA 5D65A 1SNQA 4QUCA 4XDXA 4DU9A 2HDMA 4MHEA 2RA4A 5A2QL 3FPPA 1SNPA 5FO9B 4XIGS 1V43A 4BA2I 3GTLB 1PRTF 4HSVA 3QOJA 1CI3M 1AEXA 5FLXE 1SAPA 5C4XB 3I91A 3PO3B 5EQ0A 2ID0A 3ND8A 2B2YA 3HZXA 1HTPA 2IW3A 2R61A 2NVXB 1FNUA 3LX0A 2MP1A 1U9RA 3HRZC 2Y0SB 3PIP3 3C1FA 3F2UA 3GTGB 5D14A 2R92B 3L9AX 2XWJB 4B08A 2IX0A 1YNNC 5M3FB 1LTRD 1RODA 3NXWA 4I7ZC 5ELEA 4EQNA 4IUPA 5FOBB 4XQNA 1ZYRD 2WINB 4IUNA 1TS4A 3JAME 3G7LA 1CHQD 2RBMA 1GUTA 3E0JA 5CYUA 4HEDA 1PZKD 2IJ0A 2VB2X 4BWGB 4XT1B 3PMFA 1GJXA 4QB4A 2RQXA 4A3BB 1H9JA 3OIQA 4K5WA 3K5MA 3T51B 4RH6A 1SE3A 2F0KA 2NTTA 2J4XA 2EYJA 1SNOA 1RD9D 1SDFA 1PXUA 4S3SA 5JEAJ 3R2TA 2B2WC 4FVMA 2NVTB 4XT3B 1G291 3J7AV 4CKBA 1DJRD 5M5XB 1EY6A 4HTHA 2F0OA 4WJWA 1A3VA 1BCPD 4RHSA 1RDPD 3A8JE 2PW5A 1T5EA 3MVVA 1MSHA 3Q24A 4ZRZA 1WD1A 2ZXOA 4NW2A 1PTOC 2EOTA 2X69A 3IFTA 2F0NA 1FGBD 3MEHA 1GOZA 4KI0A 4DFAA 5TSSA 2IL8A 1GHKA 1H9SB 3VR4A 2G9HD 4ZKBB 1IYUA 3IFDA 3BYYB 1PRTC 2MPMA 3HOYB 4A3FB 3VA5A 3DM1A 1YNJC 1KABA 4PQXA 2JYOA 4B9XA 1F9SA 2K28A 3Q6SA 4FXKC 4NKLA 3TP5A 3PUZA 1IYVA 2F3VA 1PZJD 1PFMA 3D6WA 2NVQB 1UEAB 3GV6A 5ELBA 5ISRA 3KLRA 4XYOA 2BDNA 4LAAA 1GUWA 1R4PB 3QG1A 2ICEC 3ZYYX 4C3JB 5FLXL 1I4XA 2Z4HA 3D8GA 2E2IB 1II3A 4V190 5LHY1 1SYEA 1BUVT 3DUZA 1O7LA 1HCZA 5EKLA 3NWSA 1K8OA 1XXGA 2Q8TA 1LTID 1XYIA 2A73B 1VCIA 2MUYA 5AFWA 2F03A 2E74C 3SEBA 2WACA 2XIWA 5CORA 2NZ1D 1PTOH 1A15A 1F2MA 4X3SA 1SFOB 4CKCA 4F88A 4RGMA 3QO2A 2BE5D 1JWSD 1R9TB 4H13C 4ZLTF 1V1OA 3JAML 3QJYA 4NDXA 2NWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6C A;  3H6M A;  1ENA A;  3RUZ A;  4B9W A;  5C3X A;  3DHQ A;  5CV5 A;  5IGC A;  4WRD A;  3NHH A;  3U9O A;  4EQN A;  3R3O A;  4WOR A;  1SYD A;  2EYH A;  5HUR A;  4G57 A;  5CV8 A;  1F2Y A;  1EY9 A;  1A2T A;  4ID6 A;  3VA5 A;  4F7X A;  4ODG A;  5IOC A;  1EY0 A;  1JOQ A;  1KDC A;  1JOR A;  2OEO A;  5JOB A;  5KYI A;  4IUN A;  2RDF A;  4H7B A;  4K8I A;  3NP8 A;  2SNS A;  4QF4 A;  3T16 A;  4KY5 A;  3SK4 A;  3TP8 A;  1KAB A;  3T13 A;  5HGT A;  1JOK A;  1TT2 A;  2EXZ A;  2RBM A;  2PQE A;  3NK9 A;  2OF1 A;  4KY7 A;  4PMC A;  4RKL A;  4ZUJ A;  3SR1 A;  3E5S A;  4NKL A;  3TP5 A;  4RKB A;  1A3U A;  5IGB A;  2F3V A;  2PZU A;  5IIF A;  4KJO A;  4K5X A;  2F0Q A;  4KTA A;  2NUC A;  3PMF A;  4QMG A;  5E1F A;  5K5P A;  2F0P A;  1EQV A;  3MZ5 A;  4QB4 A;  1STA A;  5CV9 A;  5I9P A;  5J22 A;  1SYF A;  1SNM A;  3ERQ A;  4K5W A;  4HMJ A;  4NMZ A;  5CGK A;  5KRU A;  1STB A;  3TP7 A;  2EY5 A;  4J1M A;  4OL7 A;  4F8M A;  1TQO A;  3S9W A;  4KD4 A;  5KIX A;  1ENC A;  5C4Z A;  1A3T A;  2F0K A;  1EY8 A;  4K6D A;  4KJN A;  5C6A A;  1EY5 A;  3NUC A;  3C1E A;  2F0H A;  2SNM A;  5NUC A;  5DEH A;  5I6Y A;  5ISR A;  3TP6 A;  3OSO A;  4LAA A;  2EYJ A;  1SNO A;  2EY1 A;  5CV7 A;  5DAU A;  4PMB A;  4NP5 A;  1JOO A;  1SND A;  1EY7 A;  4ME5 A;  1SYC A;  5I9O A;  2F0L A;  3NQT A;  4S3S A;  1EZ6 A;  1NSN S;  3QB3 A;  4EQP A;  2EYP A;  1IHZ A;  3D8G A;  1II3 A;  3BDC A;  3ERO A;  1F2Z A;  4HMI A;  4YIJ A;  3TME A;  5C3W A;  2PZW A;  2QDB A;  5C4H A;  1KDA A;  1SYG A;  2PYK A;  2PW7 A;  1SYE A;  4K2K A;  2O4X A;  1SNQ A;  1STN A;  3SHL A;  2EYL A;  5IGE A;  3SXH A;  1EYD A;  2EYM A;  2M00 A;  4K5V A;  3SK5 A;  4DU9 A;  1EY6 A;  4HTH A;  5EKK A;  3V2T A;  2EYF A;  2F0O A;  3SK8 A;  4KHV A;  1A3V A;  2F0W A;  3MXP A;  5EKL A;  4DF7 A;  1EY4 A;  1SNP A;  4IZ8 A;  3OMC A;  3D4D A;  4K2L A;  2F0M A;  4K14 A;  5IGG A;  4KV6 A;  2F0U A;  2PW5 A;  5EGT A;  1STH A;  4E6I A;  3QOJ A;  2HQE A;  2KHS A;  3MVV A;  3SK6 A;  4TRD A;  1AEX A;  4PNY A;  4R8N A;  1SYB A;  4EVO A;  2WAC A;  2F0E A;  5F2D A;  4K8J A;  4MIU A;  5J1Z A;  4DGZ A;  5IGF A;  4KY6 A;  3P1H A;  2OXP A;  1EZ8 A;  3D4W A;  5CR3 A;  5KGU A;  1F2M A;  2F0S A;  5C5L A;  5KEE A;  1KDB A;  2EYO A;  3HZX A;  5J39 A;  4B9X A;  2F0N A;  2F0G A;  2F0D A;  5I6W A;  4EQO A;  3DMU A;  1KAA A;  3EVQ A;  5E3F A;  5CC4 A;  3LX0 A;  2EY6 A;  3QOL A;  4N9T A;  1NUC A;  1EYC A;  5IOD A;  1SNC A;  1U9R A;  3OMG A;  3ITP A;  5IGD A;  5CV4 A;  3MEH A;  3MHB A;  4ZQ3 A;  2RKS A;  4DFA A;  5KYL A;  2KQ3 A;  3HEJ A;  4ZUI A;  1A2U A;  2PZT A;  3C1F A;  3OWF A;  4N9P A;  2F0J A;  5CV6 A;  1STY A;  4I65 A;  2LKV A;  2EY2 A;  1EYA A;  2ENB A;  2F0I A;  2F3W A;  2F0T A;  3P75 A;  5JAV A;  1RKN A;  1TR5 A;  4J6H A;  3BDL A;  2F0V A;  2SOB A;  4KD3 A;  4IAL A;  4NDX A;  3NXW A;  5M9O A;  5C5M A;  3EJI A;  2F0F A;  1STG A; 
#chains in the Genus database with same CATH topology
 4RG1 A;  3I55 A;  2ZM6 L;  3SDZ A;  4X3K A;  1X32 A;  3NHH A;  3R3O A;  1NE3 A;  4B3M Q;  1XTD A;  1EY9 A;  1WCM H;  4BY7 H;  4POF A;  1RJT A;  1M90 C;  3KF6 A;  2DY8 A;  1QG7 A;  2SNS A;  4Q5V A;  3AEV A;  2R93 G;  2K52 A;  3CC7 A;  4PZ7 A;  2J7Z A;  4ULL A;  2KHI A;  1CT1 D;  3PGZ A;  4XYQ A;  1SR3 A;  4RKB A;  3V96 A;  1JQY D;  2JA8 B;  3GP7 A;  2B2T C;  1I4R A;  1C48 A;  4YHH Q;  2V4D A;  2B2V A;  3CCL A;  3S9W A;  3GO5 A;  1UWV A;  2PPB C;  4FF2 A;  3J81 E;  4BBS B;  1XX8 A;  1K73 C;  1I4Q A;  2XN9 C;  3CCR A;  1Y8P B;  1CFM A;  5IT9 c;  1NMF A;  4DR1 L;  3PUX A;  4HSP A;  4DV0 Q;  3PF4 A;  2JSO A;  4DR7 Q;  2R7Z B;  1TWG B;  2VUM H;  4X6A H;  1WOC A;  3HOV H;  1VQA A;  3S1R H;  3HOW B;  1D5Z C;  4LF8 L;  1D5X C;  1KDA A;  2L5T A;  2RF4 A;  3BZD B;  4A3D B;  3JC6 6;  2EYL A;  2K01 A;  1SN8 A;  1EYD A;  4BY1 G;  3SK8 A;  2RSO A;  4HJA A;  2EXD A;  3AYH B;  3GDE A;  4C2M B;  4JYA L;  4H0L C;  4WJ3 M;  1MGS A;  3EBE A;  3HG9 A;  1PYS B;  4K2L A;  4K14 A;  1M4V A;  3E0E A;  1G51 A;  1XPO A;  1BCP B;  1DOK A;  2IHE A;  3FP9 A;  4AYB B;  1ET9 A;  3HOX B;  3D4W A;  3T56 B;  5CR3 A;  4A3M H;  1SJE D;  2F0S A;  3CMA A;  1HH2 P;  4L5T A;  1I6V C;  5C4X G;  4FO2 A;  3T1H L;  2O5I C;  3PO3 G;  1Z7T A;  1QZG A;  1M1K C;  1K83 B;  2Z0S A;  5IOD A;  3CHB D;  2JE6 I;  3ITP A;  3HEJ A;  4CJ2 C;  2AQ1 B;  3S15 B;  1S4Z A;  5CV6 A;  1NTG A;  5FK9 C;  2Y0S G;  1Y1W H;  3MC0 B;  1WTX A;  1D5M C;  1GUS A;  3OW7 A;  3E9H A;  4R8I A;  3GTO H;  3D6C A;  2HIV A;  2XNA C;  5JJI A;  3NEM A;  2ATW A;  2JN4 A;  2Z8L A;  4C3H H;  3UDF A;  4RHR A;  4EX5 A;  1Q1B A;  2EJG C;  3A8I E;  4F7X A;  3HKZ B;  2KUM A;  3PV0 A;  1PH9 A;  1MSG A;  5EAY A;  1WVL A;  3OOC A;  5C0X I;  4UPA A;  2K32 A;  1TT2 A;  1T5X D;  4RGN A;  1HFN A;  1E1O A;  4P73 A;  4XXE A;  3CC2 A;  3HKS A;  1PH3 A;  2N49 A;  3HFZ B;  4R4C A;  1CQF A;  1TWA B;  5K36 H;  4KTA A;  2B2U A;  3KDF B;  5E1F A;  2QEX A;  2UXC Q;  5C3E B;  3FKI B;  4A3K H;  1D7Q A;  4DUZ Q;  2Z1C A;  2VQE L;  4CDC C;  5CGK A;  1HZ9 A;  4B3T Q;  4V0B A;  1EWC A;  3BVZ A;  4KD4 A;  2OWO A;  2DJF C;  2AHO B;  4IJH A;  2K6A A;  3NUC A;  4A3B G;  2F0H A;  3CU7 A;  4KN4 C;  3O13 A;  5ELD A;  2PI2 A;  2L55 A;  4JI8 Q;  2AUK A;  4GN4 B;  1RL2 A;  1F2Z A;  2A19 A;  2IHF A;  2VQF L;  2HIX A;  2CFM A;  2OCE A;  4B3S Q;  5FLM H;  2FXQ A;  1L0Y B;  4OO1 I;  3SK5 A;  4JBK A;  4OX9 Q;  1SXT A;  1HQM C;  1NCV A;  2RSN A;  3D3R A;  3FVQ A;  1WD0 A;  2K5W A;  3U50 C;  2IY5 B;  2CHB D;  3D31 A;  3GTQ H;  1CSP A;  1N33 Q;  2QW7 A;  1D1I A;  4DKA C;  4GN3 B;  3TRZ A;  4LF5 Q;  1SYB A;  4NXM Q;  1VMC A;  2D62 A;  4DV5 Q;  5EBC A;  4A93 B;  4H44 C;  3X3N A;  3M85 A;  2L0C A;  5J39 A;  4JI6 Q;  1MBY A;  2K14 A;  2ZTC A;  2B63 B;  4DNT B;  3M4O H;  3OMG A;  2UUC Q;  1GUG A;  4IFD I;  3VDY A;  4JI5 Q;  3KDF A;  4PG3 A;  2KQ3 A;  4R4I A;  1I6H H;  2PZT A;  1EOV A;  1FNW A;  1MHW C;  2ENB A;  2NN6 H;  1IBK Q;  5C44 G;  2K75 A;  2XSC A;  1TR5 A;  4LF7 Q;  1FJG L;  1EUJ A;  5HGQ A;  1NJI C;  2LFN A;  3F2C A;  1CZG A;  3T1Y L;  1CA6 A;  1F9Q A;  4B9W A;  4POG A;  4R4Q A;  5IGC A;  1KTK A;  1QWY A;  2VZA A;  1LTT D;  2MHV A;  1QZH A;  3F2D A;  4GOP C;  1VQD A;  1DZ1 A;  3NSW A;  3CC4 A;  3T16 A;  1EOT A;  1U5K A;  1QNK A;  3T13 A;  1IBM Q;  2RCN A;  2MJ8 A;  3DLL A;  2LS0 1;  5M3M B;  3A5Z B;  4A3J G;  5LL6 X;  1XMQ Q;  1PH6 A;  3CD6 A;  5I9P A;  2Q2U A;  1STA A;  3H91 A;  4LMQ D;  3S16 H;  3J7A 5;  1PYB A;  1L1O A;  5GQO A;  1PTO B;  4OO1 H;  2ZXP A;  1S3O A;  4M1U B;  1VQ5 A;  1LTG D;  4KJN A;  3AFP A;  1CHP D;  3L7Z C;  3E6Z X;  3AQQ A;  2EY1 A;  2EVB A;  1J5E Q;  2E5L L;  2F0L A;  4P72 A;  1UE1 A;  1WTV A;  3S1M H;  1GO3 E;  4OWT B;  3M7G A;  3QWN A;  1KC8 C;  1EEF D;  1XMO L;  1PFN A;  3CCE A;  2PYK A;  3NTH A;  2CQA A;  1E1T A;  2I5L X;  2Z4I A;  1X3Q A;  3I4M H;  4QIW E;  5LMU Q;  2JA6 B;  1JC7 A;  2DUD A;  4IZ8 A;  3RR5 A;  2A68 D;  1N36 Q;  3R93 A;  2B2W A;  5AJ3 Q;  1YI2 A;  3U9S A;  5IYB G;  1SMY D;  3DEO A;  4PMW A;  2HQE A;  5I2X A;  1ENF A;  5C4J H;  1WCM B;  3A0J A;  3OYY A;  4HAE A;  4PNY A;  4LFA Q;  3T4A C;  2CW0 D;  1VMP A;  2AQ2 B;  3IKJ A;  2LSS A;  3J80 i;  3PF5 A;  3IRB A;  4C1N I;  1EZ8 A;  1BDO A;  2JJQ A;  4OIK A;  3K5N A;  1LT3 D;  5I6W A;  4A3E H;  1CZW A;  2Q8R E;  2XGT A;  2UUA Q;  1J6Q A;  4IOC A;  1O80 A;  4O1N A;  4K0K L;  4LK1 C;  1A2U A;  1PFS A;  4HCS A;  2LKV A;  5JAV A;  2F0T A;  1WTO A;  4DV2 Q;  4G7H C;  3BDL A;  2F0V A;  2A74 C;  3ULL A;  4B3R Q;  5FO8 B;  2VUM B;  3HOV B;  3S1R B;  5I4D A;  1JMC A;  4QL5 A;  2C5C A;  3GTM H;  4G57 A;  2A69 C;  1VQ8 A;  4ID6 A;  4IUU A;  2AKW B;  2V1C C;  4DNI A;  3I4N H;  4H7B A;  1BF4 A;  1K28 A;  4ZYS A;  1GXD C;  1VQ4 A;  2YTY A;  5IIF A;  4KJO A;  4YY3 L;  1DOL A;  1LYL A;  2PO4 A;  1YJ9 A;  1Z9F A;  3STB D;  1EL0 A;  4IUR A;  4X62 L;  2JA8 G;  1HZA A;  1TXY A;  4A3M B;  3KFU A;  2KCT A;  1YHB A;  1WJJ A;  1QVF A;  3LWE A;  3IL8 A;  3GTJ H;  2MGS A;  3C1E A;  2SNM A;  3W3A A;  4HJ7 A;  4JI4 L;  2TMP A;  3F8T A;  3BZK A;  2A6H D;  1UE5 A;  5DAU A;  1XNR L;  3A54 A;  4NP5 A;  3I7F A;  2Z9H A;  1VF5 C;  4ZKC B;  4BBS G;  3G6E A;  1IL2 A;  2K5D A;  4DA2 A;  3FRP B;  2R7Z G;  4JOI C;  4DV6 Q;  1CK1 A;  5C0X J;  1STN A;  1Y1W B;  1VQM A;  1E3P A;  3HOW G;  3CRL C;  3CRK C;  2N78 A;  4YWK A;  4A3D G;  5JJZ A;  2KCC A;  1PHJ A;  4NXN Q;  1EIF A;  4LW1 A;  3J80 E;  3NBH B;  3VR2 A;  3RZO H;  4YCU A;  4C3H B;  1EWH A;  3AU7 A;  3HOU H;  3SK6 A;  1XNQ Q;  4DK1 A;  4JK1 C;  4L5R C;  4C56 C;  5J1Z A;  1BBX C;  4HID A;  3GD7 A;  4KK7 A;  5KEE A;  1NNX A;  4WFN 3;  2E8G A;  4AYB G;  1HHV A;  2CQO A;  2F0D A;  3HOX G;  1VS0 A;  2EPB A;  4A3K B;  2BE5 C;  3PO2 H;  2QIL A;  5E4X A;  1BNZ A;  1WI5 A;  1BQQ T;  3KJO A;  3BVG A;  2F3W A;  1SE2 A;  3MXU A;  4CGY B;  4KD3 A;  3K0Y A;  3F2B A;  1GUN A;  1YBY A;  1IBL L;  1OTC A;  1OXS C;  3RUZ A;  4JVZ A;  1SYD A;  2KVM A;  2HQL A;  1VQJ A;  4ALP A;  2KJX A;  4RCN A;  5IP7 G;  1HR0 L;  4Q0F A;  3RN5 A;  3KLS A;  5JOB A;  2D0O A;  3T53 B;  4XQJ A;  4L5S A;  4QF4 A;  3RLN A;  2EXZ A;  3FPU B;  1TWF H;  4RKL A;  1ML0 D;  1EU4 A;  4PV1 C;  4L5Q A;  2XRQ D;  3N6R A;  5BN5 A;  1NBW A;  3NBH A;  4Z9C B;  4LUV A;  1X54 A;  1KNE A;  2R7F A;  3OPO A;  4R1J A;  2MNA A;  2WFW A;  1E7Z A;  4OL7 A;  2B2Y C;  5C3E G;  3FKI G;  3H0G G;  3CF5 A;  3NWT A;  1MIU A;  2E75 C;  1YVC A;  2B2T A;  1EY7 A;  3M4O B;  1NSN S;  2E76 C;  2B3G A;  3PIO A;  1I6H B;  4A76 A;  4IN3 A;  4A3I H;  4K2K A;  2NZH A;  2O4X A;  5DM6 3;  2M00 A;  4I7A A;  1TU2 B;  4FF4 A;  1A8V A;  1Q86 C;  1I50 B;  2OTL A;  2JQO A;  1VQ6 A;  3H3V C;  3HS0 C;  1YHQ A;  2NVY H;  2AMC B;  2KCM A;  4DR5 L;  4KV6 A;  2F0U A;  5EGT A;  3IAY A;  1UNS A;  2DJG C;  4CKE A;  4E6I A;  1CUK A;  2EZV A;  4FF3 A;  1YNN D;  2LXJ A;  4LFC Q;  5F2D A;  3H15 A;  4MIU A;  3I73 A;  4DUY Q;  2K50 A;  2OXP A;  1QUQ A;  4UY8 C;  3PCO B;  5ELC A;  2BOS A;  2PMZ B;  3K7A H;  3KF6 B;  3SGI A;  4P75 A;  3DMU A;  5E3F A;  4N9T A;  4A93 G;  2I07 B;  1CKN B;  1SNC A;  2NYZ D;  5L37 A;  3ONA B;  1K8A C;  3S16 B;  3VYR A;  4HIK A;  4H02 A;  1CA5 A;  3DWQ A;  1C4Q A;  5KYL A;  1KNA A;  1GKH A;  2B63 G;  4I65 A;  1WYD A;  1ICF B;  2E2H H;  2UU9 Q;  4G4K A;  1YNX A;  2B39 A;  5IT9 E;  1RKN A;  1LO5 D;  2L15 A;  4GKJ L;  3EQL C;  3FDT A;  1A63 A;  2B8F A;  5C3X A;  2BA1 A;  4J8Q A;  2WAQ B;  3S2D H;  3TQY A;  3E3X A;  4P74 A;  2L12 A;  4A3G G;  1B3A A;  4AQY Q;  1WTR A;  3I4M B;  3UDG A;  4K8I A;  4RCO A;  3FMC A;  1E22 A;  4KY5 A;  4ME3 A;  3UE1 A;  3R8B A;  4JI7 Q;  4GN5 A;  2ZJR A;  3S1N H;  1RF2 D;  2VQF Q;  1Q82 C;  1I94 L;  2R93 H;  4R4O A;  3URY A;  1IZ6 A;  1KHI A;  3MXN A;  1SYF A;  5M3M G;  1OXX K;  1V9P A;  2KHJ A;  2EE1 A;  4JV5 Q;  2KEC A;  2A6E D;  3HOZ G;  3W2D A;  4HR7 B;  1TII D;  4LF6 L;  4DAV A;  1E2Z A;  3SE0 A;  3HGB A;  1W6J A;  4A3E B;  1PH8 A;  1K9M C;  1SYC A;  4QJF A;  3NQT A;  3VR5 A;  1O7I A;  1CTM A;  3RD4 A;  2UXD L;  4JG2 A;  1CKN A;  1BKB A;  3I70 A;  4JI2 Q;  2EJM A;  1PTO D;  4X64 L;  1OO9 B;  5EPL A;  1LTL A;  5I2Y A;  5G3L D;  1CM9 A;  1F9R A;  4IPG A;  3A7A B;  2D2C C;  4BBR H;  2X6L A;  2FFK B;  1GHJ A;  2BCO A;  3GQB A;  2QKI C;  1D8L A;  4BS9 A;  4RAU C;  5JVG 3;  4IPD A;  1X6O A;  3S14 H;  1WTQ A;  1KD1 C;  3GTM B;  4YCW A;  4BY1 H;  4EGV A;  3TN2 A;  2WAQ E;  2B8G A;  1Y8O B;  1ZKO A;  5JPN C;  4DR4 L;  4TRD A;  3TS0 A;  4EVO A;  4JI3 L;  5CBE E;  3I4N B;  3MA2 B;  4HJ9 A;  4DGZ A;  4C3I G;  1HPC A;  1PRT D;  2IT1 A;  1PZI D;  1RCV D;  1FNV A;  1QB5 D;  3DWA A;  3KOJ A;  3M9B A;  1YJN A;  3GTL H;  5CC4 A;  3MFY A;  2VY3 A;  4O2D A;  2Q2H A;  4RGT A;  5DNF A;  1LAC A;  1U4M A;  3BVM A;  3GTJ B;  3L3O C;  5LMN L;  1UEB A;  4GZY C;  2K5Q A;  1O7Y A;  1GVP A;  3KF8 B;  2NB0 A;  1M8A A;  3WOE A;  4LFB Q;  4DAY B;  1EYG A;  3NEL A;  3LNN A;  2EYH A;  1VQ7 A;  2WB1 B;  4QY7 A;  5M5W H;  1S5B D;  4OIJ A;  2VNU D;  2OEO A;  5KYI A;  2RDF A;  1X3E A;  2MO1 A;  2PQE A;  1CQV A;  3N52 A;  4NB3 A;  3RZO B;  5T1G A;  1A3U A;  2KEN A;  1EQT A;  1O78 A;  3HOU B;  1HNX Q;  1XMO Q;  2R92 G;  2AWO A;  4GOP A;  1H9K A;  1K8M A;  4IUV A;  3NTK A;  4HMJ A;  4DV7 Q;  3OIP A;  5M3F G;  2JP1 A;  2UXB Q;  3H94 A;  2M2L A;  1B4O A;  1LTS D;  4ZK9 B;  1N9W A;  4LF4 L;  1Y14 B;  3J7A F;  2KEE A;  4DV4 Q;  2JA5 B;  4A3M G;  3PUV A;  4GKK L;  2NN6 I;  4G7O C;  1G91 A;  1QVC A;  1W6K A;  4UP8 A;  3QB3 A;  3PO2 B;  3M4Y A;  1JJ2 A;  3BDC A;  1BCP F;  3GTK B;  4DPG A;  1T9H A;  3UDX A;  3A74 A;  2HDL A;  2E2D C;  1DXM A;  2EYM A;  1MI2 A;  4X66 Q;  5DLQ E;  4AYB E;  2D0P A;  3S1Q B;  4DNR B;  5A2Q E;  1KLG D;  1Y1W G;  5IWA Q;  2JEB I;  5EBD A;  2A68 C;  2N55 A;  4R9W A;  3KF8 A;  1ESR A;  1HXY D;  3KK7 A;  1SMY C;  3OTO L;  2NTS A;  4DAY A;  5IP9 G;  3NBI A;  2ASB A;  2F0E A;  4OGQ C;  2CW0 C;  1N34 L;  3C46 A;  4C3H G;  4GNX B;  3MFG A;  2WKD A;  2R6G A;  1X3F A;  1JE4 A;  1TWF B;  3UDI A;  2RHS B;  3ND9 A;  2HHH L;  4KKS A;  1D2B A;  5E4W C;  1KAA A;  3EVQ A;  1NUC A;  2LMC B;  4KKT A;  2B2V C;  3LGJ A;  4DV3 Q;  5IGD A;  4X65 Q;  1GUO A;  1Q8I A;  3I2Z A;  2F0J A;  5M5Y B;  1B9M A;  1AE3 A;  3K57 A;  3P75 A;  1L1O B;  3L0O A;  3HKZ E;  1E0B A;  4DAP A;  4YY3 Q;  1NR2 A;  1VQ9 A;  2RDG A;  3RLF A;  5C44 H;  4J15 A;  1F9P A;  1PH5 A;  3DHQ A;  4B3M L;  3X3M A;  2RDH A;  1TY2 A;  3I4O A;  3Q23 A;  2Q2T A;  2ZTE A;  2OQ0 A;  4LF9 Q;  1TWH H;  1SMX A;  2K1B A;  3SR1 A;  5KND A;  4CJ0 B;  2NVY B;  2CWP A;  1D6E C;  2VS1 A;  3W1G A;  1G6Z A;  4YHH L;  1H95 A;  2PZU A;  2PNR C;  2CH4 A;  2K04 A;  3F1Z A;  1G8Z D;  1HQR D;  3STB C;  4LJZ C;  3M7N A;  2IX1 A;  4L6T B;  1TQO A;  4A3J H;  1ENC A;  1MKH A;  3DXJ C;  1A3T A;  4GNX A;  1VQP A;  5C6A A;  3K7A B;  3J81 L;  1HUN A;  4DV0 L;  3B6Y A;  1ZYR C;  3HOY G;  4DR7 L;  5CV7 A;  2O5J C;  4DR6 Q;  2A6H C;  3I72 A;  4A3F G;  4JCV E;  4FF1 A;  3BJU A;  1ILP A;  1RTO A;  2DN8 A;  2ALY B;  1QE6 A;  4FNF A;  2E2H B;  2K33 A;  4F87 A;  1HUM A;  4M8A A;  1FYC A;  3SXH A;  1FR3 A;  4JBW A;  1J9O A;  5JEA H;  1B1Z A;  5C0X G;  1K3R A;  4KN7 C;  5GAG C;  2E2I H;  2C9O A;  1LT4 D;  1I3Q H;  3M3Y H;  1LT5 D;  4N8X 1;  4JOI A;  4AIM A;  5COY A;  2N3S A;  2CVR A;  4DR3 Q;  3P1H A;  3TBI B;  5BR8 L;  2PQA B;  3WDN A;  2MQH A;  4YCV A;  4C3J G;  3TSS A;  3S1N B;  1S5C D;  4EQO A;  1QNU A;  1TVX A;  1TWC H;  1H9R A;  3CW2 C;  2R93 B;  2HUG A;  1PRT B;  1BCP C;  3FEW X;  1JWM D;  3EN2 A;  4XTC S;  1XWE A;  1B53 A;  1I4P A;  1TY0 A;  3EA6 A;  1SRO A;  1HTL D;  4BY7 B;  1AE2 A;  3TS2 A;  1ILQ A;  2PCF B;  4OO1 G;  5EPJ A;  2JK8 A;  1RHP A;  4JW0 A;  4A3C G;  3C2P A;  3RZD H;  1VDZ A;  4ABN A;  2JA7 H;  3VYS A;  4CDD C;  2CCZ A;  3WOF A;  1HNZ Q;  3G6J B;  2H4O A;  5IOC A;  2EQS A;  4BBR B;  1ICW A;  1KDC A;  1BO0 A;  1EEI D;  4DN4 M;  5G3L F;  4BXX H;  2WAQ G;  2BA0 A;  1X3G A;  1UAP A;  2EDG A;  5HGT A;  1JOK A;  3MXG A;  3J7Y W;  4Y7N H;  3Q0A A;  5IYC G;  3S14 B;  3TZU A;  1EQQ A;  5IYD G;  3BDO A;  4OWW B;  2UXC L;  4DUZ L;  1PLF A;  3CCV A;  4UP9 A;  2NUC A;  2ICI A;  3MZ5 A;  4DR2 L;  4B3T L;  2FMM A;  2MO0 A;  4IFD G;  2QF7 A;  3TP7 A;  3KBG A;  1YHA A;  5FKA C;  1C0A A;  2K5H A;  5A35 A;  2PQA A;  2JA8 H;  3TP6 A;  1I4G A;  3OSO A;  2RHQ B;  4JI8 L;  1QCB D;  1ESF A;  5IE8 A;  1Q12 A;  3U4V A;  2I5H A;  1PA6 A;  4JBJ A;  2AQ3 B;  1UUP A;  1IL8 A;  2SDF A;  4KHZ A;  1F2L A;  1STE A;  3TME A;  4B3S L;  1N32 Q;  2PZW A;  1HA6 A;  2YYZ A;  2UUB Q;  4OX9 L;  3HP3 A;  2EYF A;  3I4L A;  3AMU A;  1EIH A;  3MAQ A;  2IPK D;  4JI1 Q;  1HNW Q;  2F0M A;  4DV1 Q;  3A56 A;  1SJH D;  1N33 L;  1A0I A;  1JJC B;  4LF5 L;  3CP0 A;  4NXM L;  1X55 A;  2KHS A;  5M5W B;  1YZ6 A;  4DV5 L;  5DM7 3;  1XTC D;  4X3T A;  5IGF A;  5FJ8 G;  5KGU A;  4TVA B;  4JI6 L;  3I90 A;  1KDB A;  2EYO A;  1AFP A;  1R4Q B;  2TSS A;  2QEJ C;  2DNC A;  3VR6 A;  1W3S A;  1B7Y B;  4APV A;  4KHP Q;  2UUC L;  1I4H A;  1IW7 D;  4JI5 L;  5FO7 B;  1SRU A;  3NE5 B;  3GTO B;  1LLR D;  1DCZ A;  1PH2 A;  3UE0 A;  4CHT B;  1IBK L;  1NMG A;  1STY A;  1LTA D;  3G4S A;  1AP0 A;  2F0I A;  1K3B C;  3J81 j;  1MD2 D;  3BG3 A;  3ULP A;  2ZM6 Q;  3U9O A;  4JPB W;  1V8Q A;  4WJ4 A;  1X56 A;  1WTW A;  1Z47 A;  4MZ9 A;  1EY0 A;  3S17 H;  5FLX c;  1Y69 U;  2VB3 X;  1AZQ A;  1IBM L;  2ZTD A;  2HD3 A;  3FHW A;  2F4V L;  4QQB X;  3E5S A;  3ERS X;  2RVL A;  3MEF A;  4GLA C;  1XMQ L;  5T1I A;  4K5X A;  4RMF A;  4O42 A;  4JBM A;  1KRS A;  1ET6 A;  1EQV A;  5CV9 A;  5EJW A;  1W2B A;  2KBN A;  5KNC A;  1BR9 A;  2OTJ A;  3NTI A;  1DON A;  5EPK A;  1ZEQ X;  5JPM C;  1IKL A;  3VYT A;  3K80 C;  2FJ2 A;  2K03 A;  3HOU G;  5KIX A;  1BOS A;  2KA7 A;  1EY8 A;  4K6D A;  2A6E C;  1C8C A;  2ZT9 C;  3K6O A;  5BN4 A;  4CDE C;  3CKI B;  5ELO A;  1J5E L;  1QUQ B;  2HCC A;  4DR1 Q;  4L63 B;  3H0G H;  2EYP A;  3HKZ G;  1HFG A;  3DEP A;  2NBF A;  2JA5 G;  3M4P A;  4ZAI A;  2F4I A;  3KUP A;  5LL6 S;  3V05 A;  3GTQ B;  2Z6B A;  4IFD J;  1SYG A;  1PDQ A;  1QIL A;  2X6G A;  4A3L G;  5JJK A;  4LF8 Q;  2XRS D;  4YWM A;  1AH9 A;  5LMU L;  2AWN A;  2G9D A;  2JXM B;  3E9I A;  1KRT A;  1N36 L;  3JAM c;  5AJ3 L;  1LT6 D;  5C44 B;  4A4I A;  1Y1V H;  1OXT A;  3R2I A;  3OMC A;  4JYA Q;  2VW9 A;  4HIO A;  1STH A;  5E7N A;  4LFA L;  1WTP A;  3TDQ A;  1TS3 A;  1JWU D;  4JC0 A;  3ZJY C;  1TWH B;  3TZD A;  4YWL A;  4K6L A;  4G7Z C;  1OXU A;  5KNB A;  4RA8 A;  3KYH C;  4QCL A;  2YU9 H;  2UUA L;  1O7Z A;  3K59 A;  2EY6 A;  3QOL A;  2A69 D;  1VQH A;  4IOA A;  3T1H Q;  1SE4 A;  1ONL A;  3MHB A;  1C7Y A;  5D3I B;  4A3J B;  3OWF A;  2WKC A;  3MXN B;  1EQR A;  4TKO B;  4DV2 L;  1TS5 A;  1A62 A;  4B3R L;  1VQC A;  2SOB A;  1FVI A;  3GTP H;  2B63 H;  3OWE B;  4OON A;  1STG A;  4DXG A;  4RGO S;  4WRD A;  3H3V I;  3CQZ H;  1IYJ B;  5HUR A;  2R3Z A;  2GA4 B;  4JI0 L;  4KLK A;  1DD2 A;  1EWI A;  1PMR A;  2D9U A;  4OWX B;  4A3G H;  3A7L A;  4EQ5 A;  1I3Q B;  2Q8I B;  3M3Y B;  2F0Q A;  3W1B A;  1K8G A;  2E2J H;  2F0P A;  5J22 A;  3P20 A;  3S1M B;  1U4L A;  1B3Q A;  2FIN B;  2H1E A;  5D3D A;  1H9S A;  4IUT A;  2VQE Q;  2EY5 A;  2J0T D;  4J1M A;  4F8M A;  2JEA I;  5C4Z A;  3LWU A;  5I6Y A;  3NEN A;  1TWC B;  1AN8 A;  3D0F A;  1B44 D;  1IXR A;  2YTV A;  1VQO A;  1EZ6 A;  3VYU A;  4EQP A;  3HOZ H;  1V1Q A;  3ERO A;  4UHV A;  2XVS A;  4DV6 L;  3K58 A;  2QDB A;  3I8Z A;  4FXD A;  1JT8 A;  1S5F D;  5C4J B;  5IGE A;  2N8N A;  4K5V A;  1BXT A;  1EFW A;  2KED A;  3K0X A;  4KHV A;  4NXN L;  2F0W A;  1G6P A;  3K5O A;  3MXP A;  1J8I A;  1BBW A;  3RZD B;  2JA7 B;  2N88 A;  3A8K E;  3WWV A;  5IGG A;  3J80 L;  2H5X A;  2PMZ E;  2CH4 W;  4CJ1 B;  1XNQ L;  3S2H H;  4ILW A;  1LM0 A;  1JCK B;  3QR8 A;  5C5L A;  1ZXT A;  4Y7N B;  4DK3 C;  3ER0 A;  2I46 A;  3KBX A;  2F0G A;  2C35 B;  2F1M A;  4C3I H;  3G48 A;  2XWB B;  4PZ6 A;  2KOL A;  4GS3 A;  2JA9 A;  1YEZ A;  3H3V H;  1YIT A;  3NPP A;  3QIA A;  4DK0 A;  1VQE A;  5BN3 A;  1VQK A;  1P16 A;  1B8A A;  2LXK A;  2Q2I A;  2LY7 A;  1SBB B;  2JA6 G;  4GOP B;  1EYA A;  2WV6 D;  4DXF A;  3DM3 A;  1S5E D;  1JJG A;  1FJG Q;  5M9O A;  3K5L A;  5C5M A;  3EJI A;  2F0F A;  3AB9 A;  3KLW A;  4N8F A;  1WCM G;  3H6M A;  4BY7 G;  1E2W A;  1SSO A;  1EFI D;  3T1Y Q;  1DOM A;  3BYT B;  1TS2 A;  2A5H A;  1A2T A;  2F52 A;  4ODG A;  4KMU C;  1U0L A;  1PVO A;  1B50 A;  1JOQ A;  4P2C B;  5C4X H;  1JOR A;  2AUJ D;  1YNJ D;  3NP8 A;  3PO3 H;  1D1K A;  3VR3 A;  5JVH 3;  3TP8 A;  4PMC A;  2L1B A;  2K5N A;  1VF7 A;  1Y8N B;  1CKM A;  4BBR G;  1PH4 A;  4L8J A;  2FHT A;  2WP8 J;  5IGB A;  2NVX H;  2FMC A;  1HR0 W;  4OXP A;  2K5V A;  5H1S E;  1SNM A;  4UP7 A;  3ERQ A;  4HJ5 A;  1AZP A;  5KRU A;  3I3C A;  3NQI A;  1Q7Y C;  4DK6 C;  3PIO 3;  3GTG H;  2L9H A;  2R92 H;  2VUM G;  3L2P A;  3MWY W;  3HOV G;  2ZXR A;  5DEH A;  3RMH A;  5EKI A;  2IX3 A;  5M3F H;  5GAH C;  1JR0 D;  2Z6K C;  2KCN A;  2RCF A;  3A55 A;  3K7U C;  2E5L Q;  1IHZ A;  1RTN A;  4HMI A;  1GD7 A;  5C3W A;  3CME A;  3Q22 A;  2L4N A;  5BR8 Q;  2PW7 A;  2D5D A;  2QCP X;  2SEB D;  5EKK A;  3V2T A;  1CSQ A;  1X3P A;  1OXV A;  3CCQ A;  1EY4 A;  3KLS X;  1L0X B;  1JB3 A;  1ASY A;  1HA5 A;  3PUW A;  1FL0 A;  3EFX D;  3EIV A;  1KLU D;  4LFC L;  4BA1 I;  4X3U A;  4DUY L;  3S17 B;  1AW7 A;  4A3B H;  4UAI A;  1E2V A;  5IP9 H;  1JIC A;  1Q3L A;  2BH8 A;  4ZCK A;  3J81 c;  1Z6H A;  2QA4 A;  4HIM A;  1EYC A;  1VQN A;  1KQS A;  1LTB D;  5CV4 A;  2NVT H;  2HT1 A;  4ZQ3 A;  2RKS A;  2UU9 L;  1FGU A;  1HZC A;  2PI2 E;  3CPF A;  4K0K Q;  1HRJ A;  3ULJ A;  5ELF A;  4MNO A;  2M9V A;  5GAD C;  2WB1 E;  3BS1 A;  4J6H A;  5IT9 L;  2GVB A;  5M5X H;  1X9N A;  4IAL A;  3CCJ A;  3H0G B;  3UI2 A;  4QUF A;  1PYW D;  1G2T A;  4DR2 Q;  3MTS A;  4WOR A;  3VA7 A;  4AQY L;  1X65 A;  4RWS C;  1RIP A;  1K0S A;  3PUY A;  5K36 G;  1KIX A;  1SEB D;  2L11 A;  3GV3 A;  4JI7 L;  4ZUJ A;  4KY7 A;  4A3K G;  1Y1V B;  2OF1 A;  1G2S A;  1B9N A;  2YTX A;  3S24 A;  3U4Z A;  3H09 A;  2K05 A;  3D4R A;  3PIP A;  4RFB A;  1S5D D;  4QMG A;  4IQZ A;  4JV5 L;  1NAP A;  4NMZ A;  5J3B A;  4X62 Q;  3C3L A;  1A6X A;  1QJO A;  4A3I B;  1PH1 A;  1U4R A;  1EY5 A;  1XPU A;  2ZJP A;  1TKW B;  2YU9 B;  4XQQ A;  4CBV A;  1P8L A;  4JI4 Q;  4PMB A;  1JOO A;  1SND A;  4ME5 A;  5FLM G;  2I5M X;  1XNR Q;  2R7D A;  4JI2 L;  1FD7 D;  3P7J A;  2OT2 A;  2OQK A;  4YIJ A;  3HOY H;  4FP5 D;  4Y52 H;  5C4H A;  4A3F H;  3DWP A;  3OHX C;  1WTH A;  3SHL A;  4FXG C;  4GLV B;  3CCS A;  3GTP B;  4IJL A;  3I56 A;  4DF7 A;  2EJF C;  2VXW A;  1PFB A;  1N8R C;  4FYD A;  3D4D A;  5GRO A;  4U68 A;  2O2L D;  3CQZ B;  1BBU A;  5C0X H;  1NY4 A;  4R8N A;  4QIW B;  4K8J A;  1V1P B;  2NVQ H;  4KY6 A;  1I50 H;  4A3G B;  3SVM A;  4IO9 A;  2YV5 A;  4PZ8 A;  1U4P A;  2E2J B;  4C1N K;  1IW7 C;  4C3J H;  2NN6 G;  1F77 A;  1MJC A;  1S40 A;  4ZUI A;  2WII B;  3K8A A;  1EU3 A;  4N9P A;  3S2D B;  4UDU C;  1HZB A;  2EY2 A;  2F4V Q;  4KKU A;  1YJW A;  5IYB H;  4IPH A;  2G5D A;  3HOZ B;  4LFB L;  1IBL Q;  1ENA A;  2B29 A;  5CV5 A;  4MTN A;  4TQU S;  2B2U C;  2DNE A;  2I0Q A;  1DM0 B;  1F2Y A;  5CV8 A;  5LMN W;  4A3C H;  4IUQ A;  5CBA E;  2IWH A;  3CPW A;  1HR0 Q;  3RNU A;  3SK4 A;  3NK9 A;  1SFO H;  4HCE A;  4OHJ A;  1HNX L;  2CKZ B;  1Q46 A;  5JEA G;  3JAM i;  3S2H B;  4MN3 A;  5K5P A;  1LAB A;  4DV7 L;  3ICE A;  2UXB L;  1R9T H;  5IYC H;  5CMD A;  1QOH A;  2BDO A;  5IYD H;  4TSS A;  1STB A;  3Q8D A;  1V1P A;  4U67 3;  2DY7 A;  1NR4 A;  2K7V A;  2HCI A;  4DV4 L;  1IKM A;  5NUC A;  1PTO F;  1EIG A;  4IFD H;  4C3I B;  1LV9 A;  1C9O A;  4HN7 A;  5I9O A;  4OEL B;  1PH7 A;  1B2T A;  1Q1E A;  1H9M A;  1I5F A;  1VQF A;  4A75 A;  3I4M G;  1Q90 A;  4BY1 B;  1UE7 A;  1DYQ A;  5D65 A;  4X66 L;  1SNQ A;  4QUC A;  4XDX A;  4DU9 A;  2HDM A;  4MHE A;  4CDF C;  2GN5 A;  2RA4 A;  5IWA L;  1YIJ A;  5A2Q L;  3FPP A;  1SNP A;  5FO9 B;  1SE8 A;  4XIG S;  1PV4 A;  1V43 A;  4BA2 I;  3GTL B;  1PRT F;  4HSV A;  3QOJ A;  4DR5 Q;  1CI3 M;  3TRE A;  1AEX A;  5FLX E;  1SAP A;  2JA7 G;  5C4X B;  3I91 A;  3PO3 B;  5EQ0 A;  2ID0 A;  2A1A A;  4A3E G;  2EIF A;  2PNH A;  3ND8 A;  3OW2 A;  2B2Y A;  3HZX A;  3BZC A;  4BXX G;  4BBS H;  1HTP A;  2IW3 A;  2R61 A;  1L0W A;  4FDB A;  2NVX B;  1FNU A;  4IPC A;  4DV3 L;  3LX0 A;  5FJ8 H;  2MP1 A;  4X65 L;  1U9R A;  2K4K A;  2R7Z H;  3HRZ C;  3RLO A;  1TWG H;  1VQI A;  1L2F A;  2Y0S B;  3PIP 3;  4JI0 Q;  3HOW H;  4GNX C;  3RN2 A;  3C1F A;  3F2U A;  3GTG B;  5D14 A;  2R92 B;  3L9A X;  4A3D H;  2P5Z X;  2XWJ B;  4B08 A;  3J7Z C;  2IX0 A;  2GVA A;  5ELN A;  1YNN C;  5M3F B;  1LTR D;  1ROD A;  3NXW A;  4GKJ Q;  4I7Z C;  4C2M H;  3I4N G;  1KAW A;  5ELE A;  4EQN A;  4IUP A;  4O0A A;  5FOB B;  4XQN A;  4LF9 L;  5GAE C;  1ZYR D;  1L1O C;  2WIN B;  4IUN A;  1TS4 A;  3JAM E;  3G7L A;  3HOX H;  1CHQ D;  2RBM A;  4LF7 L;  1GUT A;  3E0J A;  5CYU A;  4HED A;  1PZK D;  2IJ0 A;  2VB2 X;  4BWG B;  1K83 H;  3PMF A;  4XT1 B;  1GJX A;  4QB4 A;  2RQX A;  4A3B B;  1H9J A;  2XTI A;  1I94 Q;  3OIQ A;  4K5W A;  2ES2 A;  3K5M A;  3T51 B;  3S15 H;  4RH6 A;  1QVG A;  1SE3 A;  2F0K A;  2CWA A;  4DR6 L;  2NTT A;  2J4X A;  2EYJ A;  1SNO A;  1RD9 D;  1SDF A;  4LWC A;  4R4T A;  4LF6 Q;  1PXU A;  4HJ8 A;  4S3S A;  5JEA J;  2WB1 G;  3A5U A;  3R2T A;  5IY0 A;  2B2W C;  4FVM A;  2NVT B;  5HY6 A;  3CCU A;  1DGS A;  1JE5 A;  3PQI A;  4XT3 B;  5IP7 H;  1G29 1;  3J7A V;  2Y0S E;  2UXD Q;  1VQG A;  4CKB A;  1VQB A;  1DJR D;  4X64 Q;  5M5X B;  1EY6 A;  4HTH A;  2JA5 H;  2F0O A;  4WJW A;  1A3V A;  1BCP D;  4RHS A;  1HJP A;  4A3L H;  1WFQ A;  1RDP D;  3GTK H;  3A8J E;  2PW5 A;  1T5E A;  3CAM A;  1TWA H;  3MVV A;  5C3E H;  3FKI H;  4DR3 L;  4DR4 Q;  1MSH A;  3Q24 A;  4ZRZ A;  1BVS A;  3KJP A;  1WD1 A;  2VL6 A;  2ZXO A;  3CCM A;  3BU2 A;  4JI3 Q;  3S1Q H;  4NW2 A;  2QDL A;  1PTO C;  2EOT A;  2X69 A;  4AH6 A;  3IFT A;  3PO2 G;  2F0N A;  3AFQ A;  4LUZ A;  1FGB D;  3MEH A;  1GOZ A;  2MFI A;  4LUO A;  4KI0 A;  4DFA A;  5TSS A;  3W5O A;  2IL8 A;  1GHK A;  1H9S B;  3VR4 A;  2G9H D;  4ZKB B;  4MTK A;  4QGU A;  1CKO A;  1IYU A;  1JB7 A;  5LMN Q;  3IFD A;  3BYY B;  1EIY B;  1PRT C;  2MPM A;  2A8V A;  3HOY B;  4NPS A;  1HNZ L;  3J80 c;  4A3F B;  5M5Y H;  1E24 A;  3M4Q A;  3VA5 A;  4P71 A;  3DM1 A;  4LNQ A;  1YNJ C;  3CXC A;  1KAB A;  4PQX A;  4A93 H;  2JYO A;  4B9X A;  1F9S A;  2K28 A;  3Q6S A;  4FXK C;  1K0R A;  4NKL A;  3TP5 A;  3PUZ A;  1IYV A;  2F3V A;  1PZJ D;  2BH2 A;  1Y1V G;  1LUZ A;  1PFM A;  3D6W A;  2NVQ B;  4GLX A;  3K81 C;  1UEA B;  3GV6 A;  5ELB A;  5ISR A;  3KLR A;  4XYO A;  2BDN A;  4LAA A;  1B70 B;  4LF4 Q;  1GUW A;  1R4P B;  3QG1 A;  2ICE C;  3ZYY X;  1SLJ A;  4A3I G;  4C3J B;  4GKK Q;  5FLX L;  1XJV A;  1Q81 C;  1ASZ A;  3J81 i;  1N32 L;  1I4X A;  2Z4H A;  3D8G A;  2E2I B;  1II3 A;  4OEM B;  2UUB L;  4V19 0;  5LHY 1;  3PSI A;  1UE6 A;  1KL9 A;  1SYE A;  1BUV T;  3DUZ A;  1GM5 A;  5JJL A;  4JI1 L;  2DGY A;  1HNW L;  1O7L A;  1HCZ A;  5EKL A;  2Z6K A;  2F3I A;  1S72 A;  4DV1 L;  1KXL A;  3NWS A;  1K8O A;  5M3M H;  1XXG A;  2Q8T A;  1LTI D;  1XYI A;  2ZJQ A;  2A73 B;  1VCI A;  2MUY A;  5AFW A;  2F03 A;  3OTO Q;  2E74 C;  3SEB A;  2WAC A;  2XIW A;  5COR A;  2NZ1 D;  1N34 Q;  1PTO H;  1A15 A;  1F2M A;  4X3S A;  1SFO B;  2QGQ A;  4CKC A;  4F88 A;  4KHP L;  2NZO A;  4RGM A;  1XPR A;  4DAM A;  2HHH Q;  3QO2 A;  2BE5 D;  1JWS D;  1R9T B;  4H13 C;  3G71 A;  1MJE A;  4ZLT F;  1V1O A;  3JAM L;  1VQL A;  1Q8K A;  3U58 A;  3QJY A;  4NDX A;  2NWG A;  3TEH B;  2JA6 H; 
#chains in the Genus database with same CATH homology
 3SDZ A;  4X3K A;  1X32 A;  3NHH A;  3R3O A;  1EY9 A;  1RJT A;  2DY8 A;  1QG7 A;  2SNS A;  4Q5V A;  2J7Z A;  4ULL A;  1CT1 D;  4XYQ A;  3V96 A;  2JA8 B;  4RKB A;  1JQY D;  3GP7 A;  2B2T C;  1I4R A;  1C48 A;  2V4D A;  2B2V A;  3S9W A;  3GO5 A;  2PPB C;  4FF2 A;  3J81 E;  4BBS B;  1XX8 A;  1I4Q A;  2XN9 C;  1Y8P B;  1CFM A;  3PUX A;  4HSP A;  2JSO A;  2R7Z B;  1TWG B;  3HOW B;  1D5Z C;  1D5X C;  1KDA A;  2L5T A;  3BZD B;  4A3D B;  2EYL A;  2K01 A;  1EYD A;  3SK8 A;  2RSO A;  4C2M B;  4H0L C;  1MGS A;  3HG9 A;  4K2L A;  4K14 A;  1M4V A;  1BCP B;  1DOK A;  4AYB B;  1ET9 A;  3HOX B;  3D4W A;  3T56 B;  5CR3 A;  1SJE D;  2F0S A;  1I6V C;  4FO2 A;  2O5I C;  1Z7T A;  1K83 B;  5IOD A;  3CHB D;  2JE6 I;  3ITP A;  3HEJ A;  4CJ2 C;  2AQ1 B;  3S15 B;  1S4Z A;  5CV6 A;  5FK9 C;  3MC0 B;  1WTX A;  1D5M C;  1GUS A;  3OW7 A;  4R8I A;  3D6C A;  2XNA C;  2Z8L A;  4RHR A;  1Q1B A;  2EJG C;  3A8I E;  4F7X A;  3HKZ B;  2KUM A;  3PV0 A;  1MSG A;  1WVL A;  3OOC A;  5C0X I;  2K32 A;  1TT2 A;  1T5X D;  4RGN A;  1HFN A;  4XXE A;  1CQF A;  1TWA B;  5K36 H;  4KTA A;  2B2U A;  5E1F A;  5C3E B;  3FKI B;  2Z1C A;  5CGK A;  4V0B A;  1EWC A;  3BVZ A;  4KD4 A;  2K6A A;  3NUC A;  2F0H A;  3CU7 A;  4KN4 C;  3O13 A;  5ELD A;  2L55 A;  2AUK A;  1F2Z A;  1L0Y B;  4OO1 I;  3SK5 A;  1SXT A;  1HQM C;  1NCV A;  2RSN A;  3D3R A;  3FVQ A;  1WD0 A;  2K5W A;  2CHB D;  3D31 A;  1D1I A;  1SYB A;  1VMC A;  2D62 A;  5EBC A;  4A93 B;  4H44 C;  3X3N A;  3M85 A;  2L0C A;  5J39 A;  1MBY A;  2B63 B;  4DNT B;  3OMG A;  1GUG A;  4IFD I;  2KQ3 A;  2PZT A;  1FNW A;  2ENB A;  2NN6 H;  2XSC A;  1TR5 A;  2LFN A;  1CZG A;  1CA6 A;  1F9Q A;  4B9W A;  5IGC A;  1KTK A;  1QWY A;  1LTT D;  2MHV A;  1DZ1 A;  3NSW A;  3T16 A;  1EOT A;  1QNK A;  3T13 A;  2MJ8 A;  2LS0 1;  5M3M B;  5LL6 X;  5I9P A;  1STA A;  3H91 A;  4LMQ D;  1PTO B;  4OO1 H;  2ZXP A;  4M1U B;  1LTG D;  4KJN A;  1CHP D;  3L7Z C;  3E6Z X;  2EY1 A;  2EVB A;  2F0L A;  1WTV A;  3M7G A;  3QWN A;  1EEF D;  1PFN A;  2PYK A;  3NTH A;  2CQA A;  2Z4I A;  1X3Q A;  2JA6 B;  1JC7 A;  4IZ8 A;  2A68 D;  3R93 A;  2B2W A;  3U9S A;  1SMY D;  3DEO A;  4PMW A;  2HQE A;  5I2X A;  1ENF A;  1WCM B;  4HAE A;  4PNY A;  3T4A C;  2CW0 D;  1VMP A;  2AQ2 B;  3IKJ A;  4C1N I;  1EZ8 A;  1BDO A;  4OIK A;  3K5N A;  1LT3 D;  5I6W A;  1CZW A;  2Q8R E;  1O80 A;  4O1N A;  4LK1 C;  1A2U A;  4HCS A;  2LKV A;  5JAV A;  2F0T A;  1WTO A;  4G7H C;  3BDL A;  2F0V A;  2A74 C;  5FO8 B;  2VUM B;  3HOV B;  3S1R B;  5I4D A;  2C5C A;  4G57 A;  2A69 C;  4ID6 A;  4IUU A;  4H7B A;  1BF4 A;  4ZYS A;  1GXD C;  5IIF A;  4KJO A;  1DOL A;  2PO4 A;  1EL0 A;  4IUR A;  4A3M B;  3LWE A;  3IL8 A;  2MGS A;  3C1E A;  2SNM A;  3W3A A;  2TMP A;  2A6H D;  5DAU A;  3A54 A;  4NP5 A;  1VF5 C;  4ZKC B;  2K5D A;  4DA2 A;  3FRP B;  1CK1 A;  5C0X J;  1STN A;  1Y1W B;  3CRL C;  3CRK C;  5JJZ A;  2KCC A;  3J80 E;  3VR2 A;  4C3H B;  1EWH A;  3AU7 A;  3SK6 A;  4DK1 A;  4JK1 C;  4C56 C;  5J1Z A;  1BBX C;  3GD7 A;  4KK7 A;  5KEE A;  4WFN 3;  1HHV A;  2F0D A;  2EPB A;  4A3K B;  2BE5 C;  2QIL A;  5E4X A;  1BNZ A;  1BQQ T;  3BVG A;  2F3W A;  1SE2 A;  3MXU A;  4CGY B;  4KD3 A;  3K0Y A;  1GUN A;  1OXS C;  3RUZ A;  1SYD A;  2KVM A;  2KJX A;  4RCN A;  4Q0F A;  3KLS A;  5JOB A;  3T53 B;  4XQJ A;  4QF4 A;  2EXZ A;  3FPU B;  4RKL A;  1ML0 D;  1EU4 A;  4PV1 C;  2XRQ D;  3N6R A;  5BN5 A;  3NBH A;  4Z9C B;  3OPO A;  1KNE A;  4OL7 A;  2B2Y C;  3NWT A;  2E75 C;  2B2T A;  1EY7 A;  3M4O B;  1NSN S;  2E76 C;  1I6H B;  4IN3 A;  4K2K A;  2O4X A;  5DM6 3;  2M00 A;  1TU2 B;  4FF4 A;  1I50 B;  3H3V C;  3HS0 C;  4KV6 A;  2F0U A;  5EGT A;  3IAY A;  1UNS A;  4CKE A;  4E6I A;  2EZV A;  4FF3 A;  1YNN D;  5F2D A;  4MIU A;  3I73 A;  2OXP A;  5ELC A;  2BOS A;  2PMZ B;  3DMU A;  5E3F A;  4N9T A;  2I07 B;  1SNC A;  2NYZ D;  3ONA B;  3S16 B;  3VYR A;  1CA5 A;  3DWQ A;  1C4Q A;  5KYL A;  1KNA A;  4I65 A;  4G4K A;  2B39 A;  5IT9 E;  1RKN A;  1LO5 D;  3EQL C;  3FDT A;  2B8F A;  5C3X A;  2BA1 A;  4J8Q A;  2WAQ B;  2L12 A;  1B3A A;  1WTR A;  3I4M B;  4K8I A;  4RCO A;  3FMC A;  4KY5 A;  3R8B A;  1RF2 D;  3URY A;  3MXN A;  1SYF A;  1OXX K;  2EE1 A;  2KEC A;  2A6E D;  3W2D A;  4HR7 B;  1TII D;  4DAV A;  1E2Z A;  3SE0 A;  3HGB A;  1W6J A;  4A3E B;  1SYC A;  3NQT A;  3VR5 A;  1CTM A;  3RD4 A;  3I70 A;  2EJM A;  1PTO D;  1OO9 B;  5EPL A;  5I2Y A;  5G3L D;  1CM9 A;  1F9R A;  3A7A B;  2D2C C;  2X6L A;  2FFK B;  1GHJ A;  2BCO A;  3GQB A;  2QKI C;  4BS9 A;  4RAU C;  5JVG 3;  1WTQ A;  3GTM B;  4EGV A;  3TN2 A;  2B8G A;  1Y8O B;  1ZKO A;  5JPN C;  4TRD A;  4EVO A;  5CBE E;  3I4N B;  3MA2 B;  4DGZ A;  4C3I G;  1HPC A;  1PRT D;  2IT1 A;  1PZI D;  1RCV D;  1FNV A;  1QB5 D;  3DWA A;  5CC4 A;  3MFY A;  4RGT A;  5DNF A;  1LAC A;  1U4M A;  3BVM A;  3GTJ B;  3L3O C;  4GZY C;  2K5Q A;  1O7Y A;  2NB0 A;  1M8A A;  3WOE A;  3LNN A;  2EYH A;  2WB1 B;  1S5B D;  4OIJ A;  2VNU D;  2OEO A;  5KYI A;  2RDF A;  2PQE A;  1CQV A;  3N52 A;  3RZO B;  5T1G A;  1A3U A;  1EQT A;  1O78 A;  3HOU B;  2AWO A;  1H9K A;  1K8M A;  4IUV A;  3NTK A;  4HMJ A;  3OIP A;  2JP1 A;  3H94 A;  2M2L A;  1B4O A;  1LTS D;  4ZK9 B;  3J7A F;  2KEE A;  2JA5 B;  3PUV A;  2NN6 I;  4G7O C;  1G91 A;  1W6K A;  3QB3 A;  3PO2 B;  3M4Y A;  3BDC A;  1BCP F;  3GTK B;  2HDL A;  2E2D C;  1DXM A;  2EYM A;  1MI2 A;  3S1Q B;  4DNR B;  5A2Q E;  1KLG D;  2JEB I;  5EBD A;  2A68 C;  2N55 A;  4R9W A;  3KF8 A;  1ESR A;  1HXY D;  3KK7 A;  1SMY C;  2NTS A;  4DAY A;  3NBI A;  2F0E A;  4OGQ C;  2CW0 C;  3C46 A;  4C3H G;  3MFG A;  2WKD A;  2R6G A;  1JE4 A;  1TWF B;  3ND9 A;  4KKS A;  1D2B A;  5E4W C;  1KAA A;  3EVQ A;  1NUC A;  2LMC B;  4KKT A;  2B2V C;  5IGD A;  1GUO A;  1Q8I A;  2F0J A;  5M5Y B;  1B9M A;  3K57 A;  3P75 A;  1E0B A;  4DAP A;  1NR2 A;  2RDG A;  3RLF A;  1F9P A;  3DHQ A;  3X3M A;  2RDH A;  1TY2 A;  3Q23 A;  2K1B A;  3SR1 A;  5KND A;  4CJ0 B;  2NVY B;  1D6E C;  1G6Z A;  2PZU A;  2PNR C;  2K04 A;  1G8Z D;  1HQR D;  4LJZ C;  3M7N A;  2IX1 A;  4L6T B;  1TQO A;  1ENC A;  3DXJ C;  1A3T A;  5C6A A;  3K7A B;  3J81 L;  1HUN A;  1ZYR C;  5CV7 A;  2O5J C;  2A6H C;  3I72 A;  4FF1 A;  1ILP A;  1RTO A;  2DN8 A;  1QE6 A;  4FNF A;  2E2H B;  2K33 A;  4F87 A;  1HUM A;  4M8A A;  1FYC A;  3SXH A;  1FR3 A;  4JBW A;  1J9O A;  5JEA H;  1B1Z A;  5C0X G;  4KN7 C;  2C9O A;  1LT4 D;  1LT5 D;  5COY A;  2CVR A;  3P1H A;  3TBI B;  3WDN A;  4C3J G;  3TSS A;  3S1N B;  1S5C D;  4EQO A;  1QNU A;  1TVX A;  1H9R A;  2R93 B;  2HUG A;  1PRT B;  1BCP C;  3FEW X;  1JWM D;  4XTC S;  1XWE A;  1B53 A;  1I4P A;  1TY0 A;  3EA6 A;  4BY7 B;  1HTL D;  1ILQ A;  2PCF B;  4OO1 G;  5EPJ A;  1RHP A;  3C2P A;  1VDZ A;  4ABN A;  3VYS A;  3WOF A;  3G6J B;  2H4O A;  5IOC A;  4BBR B;  1ICW A;  1KDC A;  1BO0 A;  1EEI D;  4DN4 M;  5G3L F;  2BA0 A;  1UAP A;  2EDG A;  5HGT A;  1JOK A;  3MXG A;  3J7Y W;  3Q0A A;  3S14 B;  3TZU A;  3BDO A;  1PLF A;  2NUC A;  2ICI A;  3MZ5 A;  2FMM A;  4IFD G;  2QF7 A;  3TP7 A;  3KBG A;  5FKA C;  5A35 A;  3TP6 A;  1I4G A;  3OSO A;  1QCB D;  1ESF A;  1Q12 A;  2AQ3 B;  1UUP A;  1IL8 A;  2SDF A;  4KHZ A;  1F2L A;  1STE A;  3TME A;  2PZW A;  1HA6 A;  2YYZ A;  3HP3 A;  2EYF A;  3I4L A;  3AMU A;  1EIH A;  3MAQ A;  2IPK D;  2F0M A;  3A56 A;  1SJH D;  2KHS A;  5M5W B;  5DM7 3;  1XTC D;  4X3T A;  5IGF A;  5KGU A;  3I90 A;  1KDB A;  2EYO A;  1AFP A;  1R4Q B;  2TSS A;  2QEJ C;  2DNC A;  3VR6 A;  1I4H A;  1IW7 D;  5FO7 B;  3NE5 B;  3GTO B;  1LLR D;  1DCZ A;  4CHT B;  1STY A;  1LTA D;  1AP0 A;  2F0I A;  1MD2 D;  3BG3 A;  3U9O A;  1V8Q A;  1WTW A;  1Z47 A;  1EY0 A;  1Y69 U;  2VB3 X;  1AZQ A;  3E5S A;  2RVL A;  5T1I A;  4K5X A;  4O42 A;  1ET6 A;  1EQV A;  5CV9 A;  5EJW A;  5KNC A;  1BR9 A;  3NTI A;  1DON A;  5EPK A;  1ZEQ X;  5JPM C;  1IKL A;  3VYT A;  2FJ2 A;  2K03 A;  5KIX A;  1BOS A;  2KA7 A;  1EY8 A;  4K6D A;  2A6E C;  1C8C A;  2ZT9 C;  3K6O A;  5BN4 A;  3CKI B;  2HCC A;  4L63 B;  2EYP A;  1HFG A;  3DEP A;  2NBF A;  4ZAI A;  2F4I A;  3KUP A;  5LL6 S;  3V05 A;  3GTQ B;  4IFD J;  1SYG A;  1PDQ A;  1QIL A;  2X6G A;  2XRS D;  2AWN A;  2G9D A;  2JXM B;  1LT6 D;  5C44 B;  1OXT A;  3R2I A;  3OMC A;  1STH A;  1WTP A;  3TDQ A;  1TS3 A;  1JWU D;  1TWH B;  3TZD A;  4K6L A;  4G7Z C;  1OXU A;  5KNB A;  4RA8 A;  4QCL A;  1O7Z A;  3K59 A;  2EY6 A;  3QOL A;  2A69 D;  1SE4 A;  1ONL A;  3MHB A;  5D3I B;  4A3J B;  3OWF A;  2WKC A;  4TKO B;  1TS5 A;  2SOB A;  3OWE B;  1STG A;  4DXG A;  4RGO S;  4WRD A;  5HUR A;  2R3Z A;  2GA4 B;  1DD2 A;  1PMR A;  2D9U A;  3A7L A;  1I3Q B;  2Q8I B;  3M3Y B;  2F0Q A;  2F0P A;  5J22 A;  3P20 A;  3S1M B;  1U4L A;  2FIN B;  2H1E A;  5D3D A;  1H9S A;  4IUT A;  2EY5 A;  2J0T D;  4J1M A;  4F8M A;  2JEA I;  5C4Z A;  3LWU A;  5I6Y A;  1TWC B;  1AN8 A;  1B44 D;  1EZ6 A;  3VYU A;  4EQP A;  3ERO A;  2XVS A;  3K58 A;  2QDB A;  3I8Z A;  4FXD A;  1S5F D;  5C4J B;  5IGE A;  4K5V A;  1BXT A;  2KED A;  4KHV A;  2F0W A;  3K5O A;  3MXP A;  1J8I A;  3RZD B;  2JA7 B;  2N88 A;  3A8K E;  5IGG A;  3J80 L;  4CJ1 B;  4ILW A;  1JCK B;  5C5L A;  1ZXT A;  4Y7N B;  2I46 A;  3KBX A;  2F0G A;  2F1M A;  2XWB B;  2KOL A;  3NPP A;  3QIA A;  4DK0 A;  5BN3 A;  2LY7 A;  1SBB B;  1EYA A;  2WV6 D;  4DXF A;  1S5E D;  5M9O A;  3K5L A;  5C5M A;  3EJI A;  2F0F A;  3AB9 A;  3H6M A;  1E2W A;  1SSO A;  1EFI D;  1DOM A;  3BYT B;  1TS2 A;  2A5H A;  1A2T A;  4ODG A;  4KMU C;  1B50 A;  1JOQ A;  4P2C B;  1JOR A;  2AUJ D;  1YNJ D;  3NP8 A;  1D1K A;  3VR3 A;  5JVH 3;  3TP8 A;  4PMC A;  2L1B A;  1VF7 A;  1Y8N B;  4L8J A;  2FHT A;  2WP8 J;  5IGB A;  2FMC A;  1SNM A;  3ERQ A;  1AZP A;  5KRU A;  3I3C A;  3NQI A;  3PIO 3;  2L9H A;  3MWY W;  2ZXR A;  5DEH A;  3RMH A;  5EKI A;  2IX3 A;  1JR0 D;  2KCN A;  3A55 A;  1IHZ A;  1RTN A;  4HMI A;  5C3W A;  3Q22 A;  2L4N A;  2PW7 A;  2D5D A;  2QCP X;  2SEB D;  5EKK A;  3V2T A;  1X3P A;  1OXV A;  1EY4 A;  3KLS X;  1L0X B;  1JB3 A;  1HA5 A;  3PUW A;  3EFX D;  4BA1 I;  1KLU D;  4X3U A;  3S17 B;  1AW7 A;  4UAI A;  1E2V A;  1JIC A;  1Q3L A;  1Z6H A;  1EYC A;  1LTB D;  5CV4 A;  4ZQ3 A;  2RKS A;  1HRJ A;  5ELF A;  2M9V A;  3BS1 A;  4J6H A;  5IT9 L;  4IAL A;  3H0G B;  3UI2 A;  4QUF A;  1PYW D;  1G2T A;  3MTS A;  4WOR A;  3VA7 A;  4RWS C;  3PUY A;  5K36 G;  1SEB D;  2L11 A;  3GV3 A;  4ZUJ A;  4KY7 A;  1Y1V B;  2OF1 A;  1G2S A;  1B9N A;  3H09 A;  2K05 A;  3D4R A;  4RFB A;  1S5D D;  4QMG A;  4IQZ A;  1NAP A;  4NMZ A;  3C3L A;  1A6X A;  1QJO A;  4A3I B;  1U4R A;  1EY5 A;  1TKW B;  2YU9 B;  4XQQ A;  4CBV A;  4PMB A;  1JOO A;  1SND A;  4ME5 A;  1FD7 D;  3P7J A;  2OT2 A;  4YIJ A;  4FP5 D;  5C4H A;  3DWP A;  3OHX C;  3SHL A;  4FXG C;  3GTP B;  4DF7 A;  2EJF C;  2VXW A;  1PFB A;  4FYD A;  3D4D A;  4U68 A;  2O2L D;  3CQZ B;  5C0X H;  4R8N A;  4QIW B;  4K8J A;  1V1P B;  4KY6 A;  4A3G B;  3SVM A;  1U4P A;  2E2J B;  4C1N K;  1IW7 C;  2NN6 G;  1F77 A;  4ZUI A;  2WII B;  1EU3 A;  4N9P A;  3S2D B;  4UDU C;  2EY2 A;  4KKU A;  3HOZ B;  1ENA A;  5CV5 A;  4TQU S;  2B2U C;  2DNE A;  1DM0 B;  1F2Y A;  5CV8 A;  4IUQ A;  5CBA E;  2IWH A;  3SK4 A;  3NK9 A;  4HCE A;  4OHJ A;  5JEA G;  3S2H B;  4MN3 A;  5K5P A;  1LAB A;  5CMD A;  1QOH A;  2BDO A;  4TSS A;  1STB A;  1V1P A;  4U67 3;  2DY7 A;  1NR4 A;  2K7V A;  2HCI A;  1IKM A;  5NUC A;  1PTO F;  1EIG A;  4IFD H;  4C3I B;  1LV9 A;  4HN7 A;  5I9O A;  1B2T A;  1Q1E A;  1H9M A;  1Q90 A;  4BY1 B;  1DYQ A;  5D65 A;  1SNQ A;  4QUC A;  4XDX A;  4DU9 A;  2HDM A;  4MHE A;  2RA4 A;  5A2Q L;  3FPP A;  1SNP A;  5FO9 B;  4XIG S;  1V43 A;  4BA2 I;  3GTL B;  1PRT F;  4HSV A;  3QOJ A;  1CI3 M;  1AEX A;  5FLX E;  1SAP A;  5C4X B;  3I91 A;  3PO3 B;  5EQ0 A;  2ID0 A;  3ND8 A;  2B2Y A;  3HZX A;  1HTP A;  2IW3 A;  2R61 A;  2NVX B;  1FNU A;  3LX0 A;  2MP1 A;  1U9R A;  3HRZ C;  2Y0S B;  3PIP 3;  3C1F A;  3F2U A;  3GTG B;  5D14 A;  2R92 B;  3L9A X;  2XWJ B;  4B08 A;  2IX0 A;  1YNN C;  5M3F B;  1LTR D;  1ROD A;  3NXW A;  4I7Z C;  5ELE A;  4EQN A;  4IUP A;  5FOB B;  4XQN A;  1ZYR D;  2WIN B;  4IUN A;  1TS4 A;  3JAM E;  3G7L A;  1CHQ D;  2RBM A;  1GUT A;  3E0J A;  5CYU A;  4HED A;  1PZK D;  2IJ0 A;  2VB2 X;  4BWG B;  4XT1 B;  3PMF A;  1GJX A;  4QB4 A;  2RQX A;  4A3B B;  1H9J A;  3OIQ A;  4K5W A;  3K5M A;  3T51 B;  4RH6 A;  1SE3 A;  2F0K A;  2NTT A;  2J4X A;  2EYJ A;  1SNO A;  1RD9 D;  1SDF A;  1PXU A;  4S3S A;  5JEA J;  3R2T A;  2B2W C;  4FVM A;  2NVT B;  4XT3 B;  1G29 1;  3J7A V;  4CKB A;  1DJR D;  5M5X B;  1EY6 A;  4HTH A;  2F0O A;  4WJW A;  1A3V A;  1BCP D;  4RHS A;  1RDP D;  3A8J E;  2PW5 A;  1T5E A;  3MVV A;  1MSH A;  3Q24 A;  4ZRZ A;  1WD1 A;  2ZXO A;  4NW2 A;  1PTO C;  2EOT A;  2X69 A;  3IFT A;  2F0N A;  1FGB D;  3MEH A;  1GOZ A;  4KI0 A;  4DFA A;  5TSS A;  2IL8 A;  1GHK A;  1H9S B;  3VR4 A;  2G9H D;  4ZKB B;  1IYU A;  3IFD A;  3BYY B;  1PRT C;  2MPM A;  3HOY B;  4A3F B;  3VA5 A;  3DM1 A;  1YNJ C;  1KAB A;  4PQX A;  2JYO A;  4B9X A;  1F9S A;  2K28 A;  3Q6S A;  4FXK C;  4NKL A;  3TP5 A;  3PUZ A;  1IYV A;  2F3V A;  1PZJ D;  1PFM A;  3D6W A;  2NVQ B;  1UEA B;  3GV6 A;  5ELB A;  5ISR A;  3KLR A;  4XYO A;  2BDN A;  4LAA A;  1GUW A;  1R4P B;  3QG1 A;  2ICE C;  3ZYY X;  4C3J B;  5FLX L;  1I4X A;  2Z4H A;  3D8G A;  2E2I B;  1II3 A;  4V19 0;  5LHY 1;  1SYE A;  1BUV T;  3DUZ A;  1O7L A;  1HCZ A;  5EKL A;  3NWS A;  1K8O A;  1XXG A;  2Q8T A;  1LTI D;  1XYI A;  2A73 B;  1VCI A;  2MUY A;  5AFW A;  2F03 A;  2E74 C;  3SEB A;  2WAC A;  2XIW A;  5COR A;  2NZ1 D;  1PTO H;  1A15 A;  1F2M A;  4X3S A;  1SFO B;  4CKC A;  4F88 A;  4RGM A;  3QO2 A;  2BE5 D;  1JWS D;  1R9T B;  4H13 C;  4ZLT F;  1V1O A;  3JAM L;  3QJY A;  4NDX A;  2NWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...