4NMZA

Crystal structure of staphylococcal nuclease variant delta+phs v23q/v66a at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTQKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nmzA00
2EXZA 1IHZA 1KDBA 2F0SA 2F0NA 1ENAA 1ENCA 1F2MA 4ZUIA 1AEXA 1EYCA 4ZUJA 5IGDA 5J22A 5CV8A 4I65A 3D8GA 3U9OA 2QDBA 1STBA 5CV4A 4N9PA 5IOCA 5J39A 3SHLA 4KJOA 2PZWA 4KY7A 3HEJA 3TP5A 2SNMA 1SNDA 2KHSA 4KJNA 2EY5A 4DFAA 2RKSA 5C3WA 5I6WA 1EY8A 3RUZA 1EY0A 3MEHA 1KAAA 4K8IA 2EYHA 3P75A 5J1ZA 5JOBA 5CR3A 2O4XA 3D4DA 2F0KA 4F7XA 4S3SA 1SNOA 4KD4A 2EY1A 2F0OA 1F2YA 3R3OA 1A3TA 4HMJA 4IALA 5CV7A 3TP6A 2F0MA 4K5XA 1SYFA 2F0QA 1EZ6A 5E1FA 1STYA 2PZTA 5KGUA 4TRDA 4NKLA 4RKLA 4F8MA 3TP8A 3TMEA 4HTHA 1KABA 4QMGA 1NSNS 2PQEA 2M00A 3EVQA 4IZ8A 4KD3A 3C1EA 3OWFA 4WORA 4H7BA 2F0TA 5EKLA 5IIFA 5IGFA 1TT2A 5IGEA 5CV9A 4NMZA 3NUCA 1EYAA 3SK6A 1EQVA 3ERQA 2RBMA 1EY5A 3MZ5A 4ZQ3A 3C1FA 5CC4A 5KIXA 1SYBA 2F0HA 3QB3A 1NUCA 4DU9A 4J6HA 2EYJA 1A2TA 1SNCA 1EY9A 3MVVA 1EY4A 1KDAA 2PZUA 5CV5A 1RKNA 5C4ZA 1JORA 5KYLA 3T13A 2ENBA 1SNPA 5CGKA 5C5LA 5M9OA 4EQNA 3HZXA 2EYLA 4PMCA 1F2ZA 2NUCA 1U9RA 4N9TA 2PW7A 4OL7A 3DHQA 5CV6A 4KV6A 4KTAA 5KEEA 5DEHA 4EVOA 1SNQA 2KQ3A 4LAAA 4MIUA 5JAVA 5IGGA 5I9OA 1EYDA 2F0DA 5I6YA 4K14A 4B9XA 2F0GA 2F0WA 1STAA 5C4HA 1SYCA 1TR5A 3E5SA 1SYGA 3NQTA 4QB4A 3V2TA 4E6IA 4EQOA 2RDFA 1EZ8A 2LKVA 5KYIA 5C6AA 2F0JA 3PMFA 5ISRA 4K2KA 2OXPA 5C3XA 5HURA 1SNMA 5EKKA 3MXPA 1EY6A 4ODGA 4ME5A 1SYEA 3D6CA 5DAUA 2EYPA 4YIJA 1II3A 1A2UA 4K5WA 4DGZA 1SYDA 5KRUA 3H6MA 1A3UA 3SXHA 2SNSA 2EYFA 3VA5A 4DF7A 3SK4A 3EROA 1STNA 3NP8A 3D4WA 3P1HA 4G57A 5IGCA 2F0LA 4EQPA 2EY2A 2F0UA 5E3FA 1EY7A 4B9WA 2HQEA 2F0EA 3BDCA 3TP7A 4RKBA 2OF1A 2F0PA 4IUNA 4K2LA 5I9PA 2F0IA 2SOBA 5K5PA 4R8NA 2EYMA 1STGA 3EJIA 4J1MA 3LX0A 4WRDA 5HGTA 1JOQA 4KY5A 4K8JA 3SR1A 5IODA 3ITPA 5F2DA 3SK5A 3S9WA 3OMGA 1JOOA 3BDLA 3SK8A 1TQOA 2WACA 4NDXA 2F3VA 3QOLA 1KDCA 5C5MA 4NP5A 4QF4A 2F0FA 3NHHA 3MHBA 2OEOA 3NK9A 5EGTA 5NUCA 5IGBA 4KY6A 1JOKA 4K5VA 3OMCA 2PYKA 4K6DA 1STHA 2EY6A 3T16A 3NXWA 4HMIA 2PW5A 3OSOA 4KHVA 2F3WA 3QOJA 1A3VA 3DMUA 4ID6A 4PNYA 2F0VA 2EYOA 4PMBA
chains in the Genus database with same CATH superfamily
1WOCA 1BDOA 2VNUD 1SRUA 3S1RB 2MPMA 1E7ZA 4HR7B 4DV4Q 1AEXA 1CUKA 1VQOA 4GLAC 3UDFA 1TWCH 1DONA 2B39A 4YY3Q 1GHJA 1Q8IA 2HQLA 3G7LA 4UP8A 4K8IA 4KN4C 2IX1A 1HJPA 3K6OA 1WD0A 1TWHB 3RZOB 4MTKA 2LY7A 2F0OA 4B9XA 4C1NI 4K5XA 2CWAA 2JA6H 1YNND 1VQ8A 3BVMA 3CMAA 4C3IH 3H15A 2LFNA 4DAVA 1B70B 3TMEA 4JI5L 4BWGB 4A3MH 1G6PA 4DR5L 1CZGA 3RR5A 3L2PA 2F0TA 1PVOA 1BBWA 4A93G 4F88A 3ICEA 1GM5A 3JC66 1WTRA 2MO0A 1RJTA 3KK7A 5CC4A 1TWCB 2L11A 3K0YA 4OX9Q 5D14A 1P8LA 2J0TD 1G91A 3P20A 3R8BA 4YCVA 3K8AA 1SNPA 1N34Q 1F2ZA 2NUCA 1PH6A 1L0YB 3FEWX 2OQKA 1BF4A 2JA6B 3I4NG 1EYDA 3H3VC 3PGZA 4C3IB 2OTLA 3STBC 1BXTA 2EXDA 4A3MB 1FD7D 4K0KQ 1HPCA 4RCNA 4C3HG 4RAUC 2YYZA 1KLUD 3N52A 3TS0A 4M8AA 2R7ZG 3GTGH 2B2WC 4KHPL 5T1IA 1SE2A 2M9VA 1STNA 4BBSG 1D6EC 1LABA 3HOXB 3I91A 4X3KA 5ELFA 4JI2L 1O78A 2F0EA 1L1OB 1I94Q 4DNIA 1Y1WG 1PH4A 3UE0A 4BA2I 1AE3A 3QJYA 2K14A 2Z6KA 4PZ7A 5M5XH 3G71A 4DV5L 3DWQA 2N78A 4P73A 1SSOA 2JQOA 1NJIC 1C0AA 1EIGA 1FGUA 1TU2B 4JI3L 3NXWA 3GTGB 3TREA 4GKKL 1HCZA 1O80A 1HZCA 1CKOA 1KDBA 2F0NA 3PO2G 3PIO3 2CHBD 2RHQB 5DM73 3LNNA 1MKHA 1H9KA 3R2TA 5GAEC 3SHLA 1D2BA 1ILPA 2JA8H 2KEDA 3HEJA 1I5FA 1X3EA 2Q2HA 2RKSA 4EX5A 1XXGA 2ZXPA 3I8ZA 5M5XB 5IT9c 2HCCA 2MJ8A 1PFBA 3AU7A 1N33Q 1Y8PB 1EIYB 1CKMA 1HUMA 1HA6A 4RA8A 4JI1Q 4IUPA 1HNZQ 1JR0D 2AKWB 4C3JG 4UP7A 2BE5C 2GVAA 4B3SL 3E3XA 3E9IA 4O2DA 2I5HA 1I4PA 2AMCB 4LUVA 4A3BG 1WTOA 1HRJA 4FXDA 2JA8B 3MVVA 1CT1D 1L0WA 3U4VA 4B08A 5CGKA 2CKZB 2A1AA 2Z1CA 1U4PA 3HGBA 1U9RA 1R9TH 5CORA 5C4XB 2QILA 2FHTA 3EQLC 5KEEA 4NXNQ 3KFUA 5KNBA 1DYQA 1N32L 1QB5D 1VQIA 2R92H 3DUZA 4DR2Q 1AZQA 3QR8A 1F9PA 2OXPA 3CCVA 1G2TA 5D3IB 1KTKA 4HIKA 3PO3H 1SXTA 1J5EL 2EIFA 3KBGA 1YITA 5E3FA 1C4QA 2X69A 1R9TB 3J81E 4QIWE 1X3GA 2ZXOA 2PQAA 2K7VA 2A68C 1ZYRD 1YJNA 1KAWA 1VCIA 4DR1Q 2GA4B 2R92B 2NVYH 3W5OA 5BR8Q 5M3MH 1HXYD 2CCZA 2B63H 3MHBA 1X3PA 4PMWA 4LF7Q 4K5VA 3PUVA 3HKZB 3PO3B 2ZM6L 3GD7A 2CW0D 2VUMG 1IBKL 2O5IC 4DR3Q 4DR7Q 2JN4A 1SDFA 4DR5Q 2BOSA 2JE6I 3H3VH 3L9AX 2RDGA 2RSOA 3TP5A 1SNDA 2KHSA 4Y52H 1VQMA 3W2DA 3GTKH 4QL5A 4A3GG 3MXNA 1M8AA 4LF9Q 4CDFC 2NVYB 3D4DA 5M3MB 2NWGA 2VW9A 1CHQD 2A69D 4HMJA 2FMMA 1ICFB 5KGUA 4LF5L 4RKLA 1VQJA 1PTOC 4U673 5EAYA 2PO4A 3MEFA 3HFZB 2XRSD 1D1KA 4H7BA 3FKIH 1CTMA 3TZUA 1XMQQ 1VMCA 3CCEA 2KJXA 2C9OA 1C9OA 4A93H 2ZJRA 4JBMA 2R93G 4J6HA 4RGTA 3WOFA 1A2TA 4GOPA 4EQ5A 1RKNA 3GTKB 1JB7A 4CKBA 3X3NA 4EVOA 3HG9A 1PRTC 4V190 2QEJC 4OWTB 4LNQA 2KCTA 5C0XG 1X9NA 1G6ZA 1JQYD 5IYCG 3S17H 1VQPA 3DWAA 2NBFA 3DWPA 4RGMA 1Q3LA 3I4NH 3FDTA 2JK8A 3FKIB 1A15A 5C6AA 2UXBQ 4AIMA 3N6RA 5A2QE 1IBML 4DV5Q 4ODGA 2B2VC 4C3HH 3D6CA 1PH1A 4A93B 1D1IA 1H95A 3S2HH 4JYAQ 4DV3Q 2HCIA 1F9RA 2Q2UA 4I7AA 2R7ZH 5FJ8G 3AEVA 4GN3B 5BN5A 1YNJC 2XGTA 4GKKQ 3KDFA 4BBSH 2B29A 4YCUA 5A2QL 3SE0A 5C44G 2JA9A 5EPLA 1A63A 1XX8A 1FJGL 2UXCL 4WRDA 1EU3A 1Y1WH 3S17B 4K8JA 3I4NB 1LTRD 2KHJA 3BDLA 4CJ1B 3PIP3 1BNZA 1K83H 1IYJB 2R7FA 2CVRA 4C3HB 3S2HB 4X66L 1D5XC 1A3VA 1LTBD 4M1UB 3I7FA 4IFDG 1E1OA 5C0XI 3E0JA 5BN3A 3HOYB 3WDNA 1NNXA 5JVG3 1N36Q 4BBSB 1PH2A 4R4OA 5I4DA 1STBA 5IOCA 4XT1B 1M1KC 3PO2H 1R4PB 1L1OA 1Y69U 2WIIB 1ASZA 3KJOA 2SNMA 1QWYA 4LUOA 5C3WA 2AHOB 1O7YA 1Q81C 1OXSC 3J7ZC 1Y1WB 2RF4A 4B3RL 4HIMA 1RODA 1S5CD 2F0KA 1S3OA 4S3SA 5JJZA 4LW1A 1K83B 2LS01 3OW7A 3U50C 1CM9A 2QCPX 4XQQA 1Y1VH 5M3FG 3KF8B 2CQAA 4DAYB 3J80i 3H0GB 1NSNS 3SGIA 4DKAC 5JVH3 1S40A 4WORA 1IBLQ 1M90C 1WFQA 4QUFA 1EOVA 3FRPB 1SE8A 1FGBD 4C3JH 3A54A 2O5JC 1O7LA 3PO2B 2Q8RE 1LT3D 2CFMA 5G3LF 3G4SA 2RDHA 4DV0L 2I07B 1Y8OB 2EVBA 1PFMA 3M4OH 4JC0A 4A3BH 2MP1A 3OIQA 2OWOA 5BN4A 5FOBB 3DHQA 1QNUA 2TSSA 4KV6A 3W1GA 3T1HQ 1LTGD 4HIOA 4MIUA 4Q5VA 1Q46A 1S5FD 4DV4L 1JJCB 1HNXQ 1T9HA 1Y1VB 1K3RA 4CHTB 3AB9A 5M5WH 2VZAA 3NBHB 1WYDA 3KLSA 4YY3L 4LK1C 1H9MA 3OYYA 1Z7TA 4C3JB 3HOXG 3OW2A 1SE3A 3RMHA 1IKLA 1K8GA 4LF8Q 1CSPA 1TWGH 2PCFB 4R9WA 1XWEA 2JA5G 3M4OB 1NBWA 3PCOB 3D4WA 2NN6I 2DJFC 2ZTCA 2IY5B 2BE5D 3SDZA 1GHKA 4GLXA 3GDEA 4CJ2C 1PTOH 2XN9C 4YWMA 2SOBA 2MGSA 1CKNA 1LTAD 2D9UA 5M5WB 1V1PB 5F2DA 4OX9L 3KLRA 2WACA 5T1GA 1ICWA 1VMPA 4G4KA 4KY6A 1N34L 2Z8LA 1RHPA 2Q8TA 1TWGB 1KD1C 1EEFD 1B9MA 1GUNA 4LF5Q 1BBXC 1EYCA 2VUMH 1YBYA 2B8GA 1YIJA 4K0KL 1PTOB 3KBXA 1V9PA 1EQRA 2HT1A 2EOTA 2DUDA 4CKCA 3X3MA 4RCOA 1GUTA 2PMZE 2EQSA 2D2CC 2WAQG 2WB1E 1V43A 5JEAG 4ME3A 4HSPA 1H9RA 3Q6SA 2SDFA 4A3GH 1CA5A 1UEAB 1IZ6A 1VQAA 1SYFA 1Z6HA 3A5UA 4Z9CB 1I94L 1DOLA 1YEZA 2N49A 2TMPA 4FNFA 1JT8A 5IGFA 2JA8G 3QG1A 5IIFA 3NSWA 1XPOA 2VUMB 4IUUA 1MSHA 4KKTA 5KIXA 4DU9A 2DN8A 2EYJA 5C4XG 1EY9A 1EY4A 2A8VA 4N8FA 3FPPA 3T1YQ 2R93H 2YTYA 2WINB 1PYWD 2V4DA 3A7AB 3NPPA 1PH9A 1NY4A 2WFWA 4EQNA 3HZXA 3M7GA 4A3GB 1A8VA 4TVAB 2X6GA 4H02A 5JAVA 4JOIC 5HGQA 3JAMi 4A3CG 4WJ3M 1TS4A 1TVXA 2N3SA 3OWEB 2F0WA 4RG1A 1LT6D 4ZRZA 4ALPA 4E6IA 4QB4A 5C0XH 5IYCH 5ELNA 3H94A 3ULJA 4C2MH 3KLWA 4F87A 1ENFA 5EKKA 3MXPA 1EY6A 1N33L 1HZ9A 2K5HA 3E0EA 3ZJYC 4WJ4A 4L6TB 4A3LG 4JI1L 2R93B 1LTLA 1PH8A 4APVA 2DY8A 4JI8Q 2WV6D 3A55A 4Y7NH 3A8JE 2CW0C 1KC8C 5FJ8H 1I4RA 3BDOA 1Q82C 2B2WA 1VF7A 5C44H 1SROA 3D0FA 3E9HA 3S9WA 3PO3G 2DNCA 5JJIA 1EYGA 2IHEA 3SVMA 4C2MB 4HJ7A 1J6QA 1GOZA 4FP5D 3S24A 1NE3A 2N55A 1LO5D 4R4IA 4ABNA 1DM0B 4OXPA 2YTXA 1H9SB 1S5ED 2A69C 4NXNL 3BS1A 2K75A 1IL2A 1FL0A 1ENCA 1MBYA 4IFDH 4Y7NB 4I65A 3U9OA 3ERSX 4HEDA 1B4OA 5CV4A 2P5ZX 4DR2L 4V0BA 2Z4HA 4QGUA 2XTIA 1EY0A 1IXRA 5EJWA 4CGYB 1Z9FA 5C44B 3SEBA 5M5YH 2A19A 1WI5A 2AQ2B 1LT5D 4KD4A 2OCEA 3BYTB 4RGOS 2Z9HA 3FHWA 2Q2IA 1TS3A 5LL6S 4RFBA 2UXDQ 1EWIA 1TY2A 3J80L 5M3FH 4HIDA 4JI6Q 3OWFA 4POFA 4BBRG 3G48A 2L9HA 4DR1L 4ILWA 1HFGA 4NPSA 3M9BA 3MZ5A 3BZCA 5BR8L 3C3LA 1KDAA 1XYIA 1C7YA 1S5DD 4R4QA 5IP9G 4LF7L 4A3KG 1LLRD 1YNXA 2NZOA 3I4MG 3NEMA 1ESRA 4QCLA 2B3GA 5M5YB 3Q22A 4DR3L 1PZJD 4DR7L 3FKIG 5I6YA 3PUXA 1JB3A 1DZ1A 1PFSA 2ALYB 4L8JA 3KF8A 3E5SA 1OXTA 4JI7L 4DAYA 5M3FB 3A8KE 4ZYSA 1MJCA 1X56A 1K8OA 2JJQA 5DLQE 2L15A 1SAPA 5DAUA 1ASYA 3DLLA 4LF9L 2QDLA 3EFXD 1L2FA 1GO3E 3HOXH 3RD4A 4DV2Q 3BVZA 2YTVA 3LWEA 3TSSA 5HY6A 2JA5H 2EY2A 3F2BA 2K52A 2Z4IA 3VYTA 2C35B 4ULLA 3TP7A 4DXGA 3GQBA 3M7NA 1XMQL 1GKHA 2MNAA 3TEHB 1AFPA 4BXXG 1ZXTA 5FLMG 4IUVA 2MQHA 1ZEQX 5COYA 1XPRA 4OHJA 1KDCA 3K59A 4OIJA 3PUZA 2NZHA 1QJOA 4KHZA 5JJLA 4K6DA 3HOYG 4MZ9A 1XMOQ 3OSOA 4ID6A 2EYOA 1GUOA 4DK6C 1UUPA 1XNQQ 1ENAA 3K5LA 2JA5B 4JBKA 1AN8A 1V1OA 3FMCA 4DAPA 1QNKA 4J8QA 2UXBL 2F1MA 4U68A 4YCWA 5G3LD 1KAAA 2M2LA 5CBEE 2KEEA 1LTID 3VR5A 4JYAL 4O42A 4DV3L 1HTPA 3LGJA 3I56A 1E1TA 3NTIA 3H0GG 3VA7A 3D31A 4XQNA 2MUYA 5JEAH 4JI0Q 2F0QA 2ID0A 3TZDA 4GN4B 4DNRB 2KA7A 1KABA 4QMGA 5FLXL 1WD1A 2EDGA 5KNCA 2B2YA 1TXYA 1EQVA 3OHXC 1HTLD 4DXFA 2RBMA 1RTOA 3JAME 4K6LA 2AUKA 1SBBB 4PZ8A 1EWHA 3CPFA 3PF5A 1MD2D 3QIAA 5KYLA 1BKBA 2ENBA 3I3CA 1U5KA 2ICEC 1Y14B 4YHHQ 4GNXC 5C4XH 1Y1VG 4ZAIA 3RNUA 2WAQB 3M3YB 4YWLA 1SNQA 2UUAQ 3ZYYX 2QKIC 4LF4Q 2A6ED 1N36L 3M4PA 3JAML 1STAA 4RHSA 2K1BA 3RLOA 3CKIB 4A3CH 2RDFA 1HUNA 3E6ZX 2J4XA 2F0JA 2L5TA 5C3XA 1UE6A 1BO0A 2Y0SG 2K6AA 1I6HH 2KBNA 3MFGA 4DF7A 1HFNA 3BU2A 5IGCA 4EQPA 1K8MA 1EY7A 5CYUA 2XWBB 4A3LH 2VQEL 1LTTD 2MFIA 3K7AH 1IBLL 2OT2A 2B2VA 1N9WA 2NTSA 1STGA 4J1MA 3FPUB 2AQ3B 3SR1A 5TSSA 3ITPA 4YWKA 2ZJQA 3TN2A 1N8RC 3NWTA 4L5RC 1D7QA 2HHHQ 3EBEA 2F0FA 3TBIB 2JSOA 1OXVA 2LMCB 1PHJA 1I6HB 3VR6A 5E4WC 1EWCA 3T1HL 2JEAI 2F0VA 1PFNA 3F2DA 4WFN3 3M85A 3S15H 1HNXL 3OTOQ 1VDZA 5CV8A 1KXLA 3QO2A 3K7AB 4HJAA 2F4IA 3R2IA 1AE2A 4IQZA 1VQHA 3W3AA 2CQOA 1CHPD 3P75A 4LF8L 5J1ZA 1UE1A 3R93A 4IALA 2K33A 1Z47A 1XJVA 5IYDG 3PUYA 4G7OC 1FR3A 1AZPA 1FNVA 4ZLTF 2R61A 3I55A 3S15B 2QEXA 4NMZA 1MJEA 4JI7Q 1JJ2A 3TDQA 1X65A 1EOTA 4BBRH 2F0HA 2FINB 3CCLA 1SNCA 5EBCA 5IWAQ 2B2UA 4X3SA 3J81j 4PMCA 5IP9H 1QVFA 5FO9B 4A3KH 3I4MH 4KTAA 1HR0L 1LUZA 1HQMC 2F4VQ 4LMQD 5I9OA 1TWFH 2CH4W 1R4QB 3J7YW 5LMUQ 4AYBE 1HA5A 1SYCA 1GVPA 1EZ8A 4PZ6A 4DK0A 1SMYD 5HURA 3KJPA 4BBRB 1JWMD 2MO1A 4P71A 2K5WA 4IUQA 3ND9A 3NP8A 4UY8C 4G57A 3PQIA 2DNEA 4GKJQ 4A3KB 3I4MB 2OF1A 2F0IA 4XQJA 1TWFB 2PNHA 1ET6A 1G8ZD 4BXXH 5FLMH 3D4RA 1V8QA 3T1YL 1XNRQ 4B3TQ 1GJXA 5GAHC 2RQXA 2X6LA 2ZT9C 3T16A 5AJ3Q 4FYDA 2OTJA 1TWAH 3HOYH 3J7AV 1XPUA 3BVGA 4AH6A 4OIKA 1PH3A 2A6HC 4EGVA 2EJMA 3GTJH 2QDBA 2IPKD 4O0AA 2PZWA 1NCVA 4DFAA 3A5ZB 5H1SE 2XIWA 3CP0A 1B2TA 4BY1G 3KOJA 3PSIA 4HCEA 5I2YA 1OXXK 1IYVA 1C8CA 3WWVA 2L0CA 1FYCA 1UAPA 3ND8A 2NVXH 1KLGD 2EY1A 4RH6A 3PUWA 4JI8L 2F52A 3H0GH 3NWSA 1X32A 4NKLA 4TRDA 3AFQA 4OGQC 4PG3A 1VQNA 4GNXB 1TWAB 5JJKA 5L37A 1JC7A 1X3FA 4IN3A 1A6XA 3I90A 3GTJB 2C5CA 3IAYA 3QB3A 4AQYQ 4JG2A 5C4ZA 4DUYQ 3UDXA 1UWVA 3J80c 1F77A 1JE4A 4N9TA 4NXML 1GXDC 1RDPD 2NVXB 3VYUA 1WTPA 4LF6Q 2CH4A 2NN6G 2NVQH 2IX0A 3K80C 4K14A 2VQEQ 1TR5A 1K0SA 1JCKB 4R4TA 2AQ1B 3HOZG 3T53B 3A56A 2FJ2A 3MAQA 1A0IA 4L5QA 3K0XA 4JOIA 1II3A 2I0QA 3SXHA 4X64Q 4CDEC 3EROA 2RCNA 5IP7G 1KQSA 2AWOA 2HQEA 2UXDL 4A3FB 3BDCA 4L5TA 4RKBA 4JI6L 2WAQE 2PPBC 3TQYA 2NVQB 3NE5B 5IODA 2B2TC 1JICA 4ZKCB 4CJ0B 5EQ0A 3HP3A 1BCPF 5IE8A 1X3QA 2F3VA 4KLKA 1RD9D 2CWPA 2IL8A 3OMCA 2PYKA 3VYSA 3UDIA 1JJGA 3U9SA 5DM63 3CCRA 2F3WA 3DMUA 4GOPC 2Y0SB 4A3DG 4BY7B 2IT1A 2F0SA 1KNEA 2VQFQ 1BQQT 2H5XA 4KMUC 2RA4A 3D8GA 2HIXA 1SLJA 1NR4A 4KY7A 4FXKC 2E75C 4KJNA 2KUMA 1AH9A 3A7LA 3F2UA 4A4IA 1NMFA 2VXWA 1BCPC 4H13C 1SJHD 4DV2L 4A76A 1SNOA 4ZCKA 4X3UA 4OWXB 1F2YA 1H9JA 1JWUD 2XWJB 2K5VA 4HSVA 5D3DA 1PV4A 1DJRD 1G2SA 2KENA 1B53A 2E2IH 1STYA 2AWNA 1HR0Q 4QQBX 3UDGA 2QGQA 1CQFA 3HS0C 5IYDH 1Q1BA 3EVQA 1QUQB 3OIPA 3C1EA 4IZ8A 4FF4A 1SEBD 3NTHA 5GQOA 2A6EC 2K50A 3G6EA 2VY3A 1SE4A 3RN2A 4TQUS 2K28A 1OO9B 4DNTB 1NAPA 4RMFA 4OELB 1XMOL 4QY7A 5CV6A 3AFPA 1QE6A 3MC0B 2K03A 1JMCA 1IW7D 1PYBA 1CQVA 3V05A 1XNQL 4P74A 4LAAA 4DR6Q 1FNUA 3HKZE 2WKDA 2E2IB 3RZDB 4HJ9A 1ILQA 1EU4A 1RL2A 1S72A 2I5MX 3PF4A 3PV0A 3K5NA 4K2KA 2HD3A 3DXJC 3GTOH 2EYPA 1A2UA 3BG3A 3I70A 3JAMc 4JI0L 4LJZC 3HOWG 1EQTA 3DEPA 4O1NA 4DV1Q 3UE1A 4FDBA 3F8TA 3MWYW 3CCMA 4KK7A 3D3RA 1SFOH 1RCVD 3PIOA 1PDQA 2QW7A 3MTSA 2QA4A 3QOLA 2HDMA 4YHHL 4HMIA 4KHVA 3GTOB 1SJED 2L4NA 1J9OA 2UUAL 2OQ0A 4LF4L 1YHQA 2I46A 3O13A 1VF5C 4MTNA 4POGA 3NBIA 4N9PA 1K73C 3V96A 2HIVA 4X65Q 2ATWA 1D5MC 1SFOB 3LWUA 3MEHA 2EYHA 4UDUC 3KYHC 1L0XB 5CR3A 3ONAB 1NTGA 5LL6X 4DUZL 4BY1H 1A3TA 4FF2A 2FFKB 2WB1G 4C1NK 4NXMQ 2BH8A 2H1EA 4JBJA 5ELDA 4A3IG 2JP1A 2KHIA 2IX3A 4B3MQ 1ET9A 1HQRD 4FF3A 2ZTEA 2YU9H 5C0XJ 1YZ6A 1GUSA 2JEBI 1YHAA 2A5HA 4RGNA 2UU9Q 2GN5A 1K0RA 3HKSA 1B1ZA 3J80E 3VR2A 2HHHL 3GTPH 4LFBQ 3J7A5 1SMYC 4J15A 4DK3C 2PNRC 1W3SA 2H4OA 3L0OA 3J7AF 2NYZD 2K01A 1VQLA 4OL7A 1I4QA 4BY1B 2A6HD 1YI2A 2KQ3A 3BZKA 1TS2A 3FP9A 5EKIA 3OTOL 1LM0A 2F0DA 3K5OA 2WKCA 2E5LQ 2NN6H 4OEMB 1UE5A 3MXNB 1PA6A 2YU9B 3BJUA 3PMFA 1QZHA 5ISRA 3WOEA 1ONLA 1SNMA 3HOZH 3GTQH 3J81i 3HOUG 5C3EG 1I6VC 3K57A 4DGZA 3GTPB 3IFDA 1WTQA 4DV7Q 4GZYC 3CRLC 3VA5A 1NMGA 2L12A 4DK1A 4PQXA 4LWCA 4IJHA 4IFDJ 1W2BA 5IP7H 1MGSA 4GOPB 3DM1A 3GV6A 2HDLA 4KY5A 1MI2A 3K7UC 4ZK9B 4NDXA 2IWHA 3CCSA 5IWAL 1TS5A 5EGTA 5GADC 3HOZB 4XYQA 3GTQB 3HOVB 1DOMA 1QOHA 3AYHB 3H09A 3MFYA 1BOSA 2Q2TA 1BCPB 2F4VL 1BBUA 3A74A 1YHBA 1I4HA 4DV6L 5LMUL 4ZUIA 5IGDA 4A3DH 1DCZA 3GV3A 1QVCA 1K3BC 3T4AC 3G6JB 4H0LC 2E2JH 1TY0A 1I4GA 2YV5A 3EA6A 1SR3A 2NTTA 3NBHA 2E2HH 3F1ZA 1PZKD 4BA1I 3KDFB 2KECA 1LTSD 5CV7A 3TP6A 2R6GA 4XIGS 2VL6A 1EZ6A 3S2DH 5E1FA 3H3VI 3CMEA 1QG7A 4GKJL 2KCNA 4F8MA 2BA1A 2JYOA 1U4MA 2XVSA 4JV5L 1GUGA 2Y0SE 5EKLA 5IGEA 3BYYB 1RIPA 4X3TA 3NUCA 4A3DB 1VQEA 2BCOA 4N8X1 5A35A 2ES2A 3C1FA 3AMUA 1F9SA 1E0BA 5FLXE 5GAGC 5CMDA 4LFAQ 2R3ZA 2DGYA 2E2JB 4P72A 4B3TL 1XNRL 1CFMA 1JORA 3IRBA 2FMCA 2K04A 1V1PA 2A73B 5C5LA 4DAMA 5AJ3L 3M3YH 2E2HB 1RF2D 3BZDB 5DEHA 2K5DA 3S2DB 3NTKA 1CZWA 2XSCA 1VQKA 1GD7A 5ELCA 3NQTA 3V2TA 1VQDA 2J7ZA 4IUTA 4QJFA 3M4YA 1QUQA 1HR0W 1BCPD 2UUCL 1WCMG 4G7ZC 4IPGA 2O2LD 4JI4Q 5ELOA 4IO9A 3PIPA 4X6AH 2Z0SA 4JPBW 4A3EG 2ICIA 4JW0A 3H6MA 4A3FG 2EYFA 2DJGC 1O7IA 2F0UA 4HAEA 3D6WA 3HOWH 1O7ZA 5I9PA 1SMXA 2EYMA 1XTCD 1YVCA 1KNAA 1AW7A 4X62Q 1E3PA 3K58A 1CSQA 2EJFC 4AQYL 3CQZH 1FNWA 2E2DC 2F3IA 5C5MA 4DUYL 4QF4A 4UPAA 5NUCA 3GP7A 5IYBG 4BY7G 4MNOA 5I2XA 1I4XA 2AUJD 5JEAJ 4R4CA 4DUZQ 3QOJA 1IYUA 3CCQA 4XYOA 1HZAA 4LF6L 4PMBA 2EXZA 4GLVB 1IHZA 4JK1C 1F2MA 1CA6A 3HOWB 5C4JH 3CRKC 2EPBA 5J3BA 4KJOA 2EZVA 2D62A 2EY5A 5I6WA 1EY8A 2KVMA 4OONA 4QUCA 4XT3B 4I7ZC 4A75A 3CQZB 1LACA 4LFCQ 4X64L 3CC4A 4NB3A 1PH5A 1CKNB 4RWSC 2UUBQ 1BR9A 2G9HD 1EL0A 3CW2C 1IW7C 4HTHA 1TIID 3A8IE 1TT2A 4A3IH 1EYAA 3SK6A 3W1BA 2Q8IB 5C4JB 3C46A 1W6JA 3ERQA 1EY5A 4L5SA 5LMNQ 1CI3M 1IL8A 5CV5A 5LHY1 3C2PA 2RCFA 3ER0A 4TKOB 3QWNA 3GTLH 4CKEA 5M9OA 4DR4Q 3GTMH 1PYSB 2KCMA 3TRZA 2VB2X 5CBAE 5K36G 2R7DA 5GROA 2VQFL 4FVMA 4OWWB 3AQQA 5IGGA 3CPWA 1NR2A 3DEOA 5ELBA 5JPMC 2PMZB 2L1BA 1H9SA 2WB1B 1VQ5A 2LKVA 3KF6B 4A3IB 3VR3A 5D65A 2BA0A 1B7YB 4ME5A 2PI2E 2PI2A 1B3AA 3J81L 2VB3X 4YIJA 4K5WA 2L55A 2Z6KC 1A3UA 1EQQA 2D0OA 3HOUH 5C3EH 1K8AC 1PTOF 3P1HA 3GTLB 4MHEA 3GTMB 3CCUA 2E74C 1T5EA 1VQGA 3Q8DA 4DV6Q 4JI5Q 2MHVA 3MA2B 3Q23A 1E2ZA 2JA7G 1JOQA 1VQ6A 3UI2A 4OO1G 1JOOA 2RSNA 3SK8A 1KIXA 2B2YC 2IJ0A 1XTDA 4L63B 2G5DA 2B63B 4IPCA 1PRTF 1B50A 3HOUB 1QILA 4DR6L 2BH2A 5C3EB 2B2TA 1EFWA 3S14H 4KKSA 1Q1EA 3K81C 3ULLA 1X55A 1ML0D 2NZ1D 5J39A 4JV5Q 2V1CC 4XXEA 4G7HC 1WTWA 5JPNC 1S4ZA 4R8IA 1C48A 2KCCA 3GO5A 1E2WA 1B9NA 3P7JA 5E7NA 4KHPQ 4JBWA 1K9MC 4JI2Q 4DV1L 2LXJA 1PXUA 1YJ9A 1PZID 4PV1C 4A3JG 1VS0A 2M00A 1AP0A 5IY0A 3S14B 5CV9A 1QZGA 3S1NH 1S5BD 4OO1I 2WP8J 1ZKOA 5EPKA 1NUCA 2D5DA 2DY7A 2EJGC 2UUCQ 2PZUA 4IURA 3Q0AA 1I3QH 4LUZA 5KNDA 1VQ7A 4JI3Q 1EIHA 2HUGA 1U4LA 1Q86C 1DD2A 4JCVE 1X54A 1P16A 1UNSA 2F0GA 3VYRA 4HCSA 3IKJA 4X65L 3OOCA 2N8NA 3H91A 1TKWB 4GS3A 3T56B 3S1NB 4AYBG 2K5QA 4ZKBB 2ASBA 1T5XD 1WCMH 3FVQA 1UEBA 3CC7A 2NB0A 3I73A 3F2CA 2SNSA 1I3QB 1DOKA 2G9DA 2XRQD 4A3EH 2R7ZB 4A3FH 4CDCC 1YNNC 3STBD 2NVTH 4B3ML 4IUNA 4K2LA 2D0PA 4B3SQ 3I4OA 5K5PA 5IT9E 1I50H 4IJLA 3LX0A 2UU9L 4MN3A 5E4XA 3RLNA 1X6OA 2E8GA 3CXCA 3HOVG 4IPHA 1DXMA 4LFBL 1TQOA 3VR4A 2A74C 4GN5A 1Q7YC 2PW5A 5IYBH 4BY7H 1WCMB 5IT9L 2SEBD 2B2UC 1KL9A 4A3EB 2BDNA 3L3OC 5J22A 2E5LL 1N32Q 2NVTB 5ELEA 3CF5A 3DM3A 1VQCA 1HNWL 4H44C 1I50B 3RUZA 2RHSB 5FK9C 1E24A 5FO7B 5JOBA 2LSSA 2B8FA 2JA6G 4F7XA 4DV7L 2K4KA 4C3IG 4DA2A 3R3OA 4IFDI 4FXGC 3S1MH 4R1JA 1J5EQ 4A3MG 2ZTDA 3KUPA 4XTCS 4UP9A 4KD3A 1EIFA 3I72A 5DNFA 1G51A 1WJJA 1EEID 1G291 1WVLA 2LXKA 5FKAC 3S16H 1E2VA 1A62A 4IPDA 4P2CB 4ZQ3A 1V1QA 1HH2P 1VQFA 3CC2A 3EIVA 1K28A 5FO8B 4A3BB 2ZM6Q 1D5ZC 3IL8A 3RZDH 2IW3A 1IBKQ 1WTVA 3S1MB 3T51B 1PLFA 1SN8A 5K36H 1YJWA 3NELA 4C56C 4WJWA 5KYIA 1D8LA 3S16B 1SYEA 5AFWA 4JVZA 3S1QH 2I5LX 3SK4A 5FLXc 5LMNW 3EN2A 1M4VA 3I4LA 3A0JA 1F2LA 4IOAA 1J8IA 1Q8KA 2F0PA 2VS1A 4R8NA 4UAIA 5HGTA 1ESFA 1MHWC 3SK5A 1LV9A 3OMGA 3M4QA 2JA7H 2K5NA 4LFAL 1VQBA 4FF1A 3NK9A 3NHHA 4OO1H 3KF6A 4BS9A 1L1OC 1PMRA 1IKMA 2EY6A 3S1QB 1FVIA 2OEOA 4PNYA 1U4RA 1LT4D 3KLSX 4KN7C 4IOCA 2IHFA 2A68D 4ZUJA 4HN7A 1PRTB 3CAMA 3U58A 2RVLA 3K5MA 1PH7A 3NENA 2Z6BA 2K32A 1EUJA 1E22A 1IBMQ 4JI4L 1KHIA 2JXMB 1WTHA 2O4XA 2JA7B 2KOLA 2FXQA 2K05A 4DPGA 1JWSD 3OPOA 3ULPA 1RTNA 2F0MA 2EE1A 3URYA 2PZTA 1OTCA 1KRTA 2ZJPA 1MSGA 1MIUA 3TP8A 4KKUA 2PQEA 3CD6A 2BDOA 3NQIA 1JE5A 1VQ9A 4A3JH 1FJGQ 4CBVA 4X62L 2UXCQ 1B8AA 1ZYRC 1SYBA 3Q24A 1U0LA 1STEA 3T13A 1UE7A 1HNZL 2EYLA 4QIWB 4TSSA 4XDXA 2PW7A 1PTOD 3VDYA 4X66Q 2PQAB 3MXUA 3CU7A 4NW2A 1Y8NB 3I2ZA 2N88A 2R92G 5EPJA 1QVGA 5C4HA 1EFID 1GUWA 1SYGA 1B44D 4EQOA 3IFTA 4HJ8A 3HKZG 4HJ5A 1OXUA 2F03A 1HHVA 3U4ZA 3RN5A 4A3JB 1Q90A 1BUVT 1Q12A 2XNAC 4CDDC 4B3RQ 4LFCL 3HRZC 3RLFA 1SYDA 3CHBD 5KRUA 1KRSA 4FO2A 3B6YA 1PRTD 1W6KA 3S1RH 1F9QA 2F0LA 2UUBL 4B9WA 5EBDA 4DN4M 2E76C 4P75A 1BVSA 1QCBD 4RHRA 1CK1A 3TS2A 4KI0A 1WTXA 3EJIA 2QF7A 3J81c 5M3MG 3L7ZC 5LMNL 2B63G 4GNXA 1HNWQ 1HZBA 1B3QA 1TWHH 3CCJA 3RZOH 4DV0Q 4Q0FA 4NP5A 2ZXRA 3HOVH 5IGBA 1JOKA 1DGSA 2GVBA 4UHVA 1STHA 4DR4L 1YNJD 1VQ4A 3MXGA 4AYBB 1LYLA
chains in the Genus database with same CATH topology
1BDOA 2VNUD 3S1RB 2MPMA 4HR7B 1AEXA 1DONA 2B39A 1GHJA 1Q8IA 3G7LA 4K8IA 4KN4C 2IX1A 3K6OA 1WD0A 1TWHB 3RZOB 2LY7A 2F0OA 4B9XA 4C1NI 4K5XA 1YNND 3BVMA 2LFNA 4DAVA 3TMEA 4BWGB 1CZGA 2F0TA 4F88A 1WTRA 1RJTA 3KK7A 5CC4A 1TWCB 2L11A 3K0YA 5D14A 2J0TD 1G91A 3P20A 3R8BA 1SNPA 1F2ZA 2NUCA 1L0YB 3FEWX 1BF4A 2JA6B 1EYDA 3H3VC 4C3IB 1BXTA 4A3MB 1FD7D 1HPCA 4RCNA 4C3HG 4RAUC 2YYZA 1KLUD 3N52A 4M8AA 2B2WC 5T1IA 1SE2A 2M9VA 1STNA 1D6EC 1LABA 3HOXB 3I91A 4X3KA 5ELFA 1O78A 2F0EA 4BA2I 3QJYA 3DWQA 1SSOA 1EIGA 1TU2B 3NXWA 3GTGB 1HCZA 1O80A 1KDBA 2F0NA 3PIO3 2CHBD 5DM73 3LNNA 1H9KA 3R2TA 3SHLA 1D2BA 1ILPA 2KEDA 3HEJA 2RKSA 1XXGA 2ZXPA 3I8ZA 5M5XB 2HCCA 2MJ8A 1PFBA 3AU7A 1Y8PB 1HUMA 1HA6A 4RA8A 4IUPA 1JR0D 4C3JG 2BE5C 1I4PA 1WTOA 1HRJA 4FXDA 2JA8B 3MVVA 1CT1D 4B08A 5CGKA 2Z1CA 1U4PA 3HGBA 1U9RA 5CORA 5C4XB 2QILA 2FHTA 3EQLC 5KEEA 5KNBA 1DYQA 1QB5D 3DUZA 1AZQA 1F9PA 2OXPA 1G2TA 5D3IB 1KTKA 1SXTA 3KBGA 5E3FA 1C4QA 2X69A 1R9TB 3J81E 2ZXOA 2K7VA 2A68C 1ZYRD 1VCIA 2GA4B 2R92B 1HXYD 3MHBA 1X3PA 4PMWA 4K5VA 3PUVA 3HKZB 3PO3B 3GD7A 2CW0D 2O5IC 1SDFA 2BOSA 2JE6I 3L9AX 2RDGA 2RSOA 3TP5A 1SNDA 2KHSA 3W2DA 3MXNA 1M8AA 2NVYB 3D4DA 5M3MB 2NWGA 1CHQD 2A69D 4HMJA 2FMMA 5KGUA 4RKLA 1PTOC 4U673 2PO4A 2XRSD 1D1KA 4H7BA 1CTMA 3TZUA 1VMCA 2KJXA 2C9OA 4J6HA 4RGTA 3WOFA 1A2TA 1RKNA 3GTKB 4CKBA 3X3NA 4EVOA 3HG9A 1PRTC 4V190 2QEJC 5C0XG 1G6ZA 1JQYD 3DWAA 2NBFA 3DWPA 4RGMA 1Q3LA 3FDTA 3FKIB 1A15A 5C6AA 3N6RA 5A2QE 4ODGA 2B2VC 3D6CA 4A93B 1D1IA 2HCIA 1F9RA 5BN5A 1YNJC 5A2QL 3SE0A 5EPLA 1XX8A 4WRDA 1EU3A 3S17B 4K8JA 3I4NB 1LTRD 3PIP3 3BDLA 4CJ1B 1BNZA 2CVRA 4C3HB 3S2HB 1D5XC 1A3VA 1LTBD 4M1UB 4IFDG 5C0XI 3E0JA 5BN3A 3HOYB 3WDNA 5JVG3 4BBSB 5I4DA 1STBA 5IOCA 4XT1B 1R4PB 1Y69U 2WIIB 2SNMA 1QWYA 5C3WA 1O7YA 1OXSC 1Y1WB 1RODA 1S5CD 2F0KA 4S3SA 5JJZA 1K83B 2LS01 3OW7A 1CM9A 2QCPX 4XQQA 2CQAA 3H0GB 1NSNS 5JVH3 4WORA 4QUFA 3FRPB 1FGBD 3A54A 2O5JC 1O7LA 3PO2B 2Q8RE 1LT3D 5G3LF 2RDHA 2I07B 1Y8OB 2EVBA 1PFMA 2MP1A 3OIQA 5BN4A 5FOBB 3DHQA 1QNUA 2TSSA 4KV6A 1LTGD 4MIUA 4Q5VA 1S5FD 1Y1VB 4CHTB 3AB9A 3KLSA 4LK1C 1H9MA 1Z7TA 4C3JB 1SE3A 3RMHA 1IKLA 2PCFB 4R9WA 1XWEA 3M4OB 3D4WA 2NN6I 2BE5D 3SDZA 1GHKA 4CJ2C 1PTOH 2XN9C 2SOBA 2MGSA 1LTAD 2D9UA 5M5WB 1V1PB 5F2DA 3KLRA 2WACA 5T1GA 1ICWA 1VMPA 4G4KA 4KY6A 2Z8LA 1RHPA 2Q8TA 1TWGB 1EEFD 1B9MA 1GUNA 1BBXC 1EYCA 2B8GA 1PTOB 3KBXA 2EOTA 4CKCA 3X3MA 4RCOA 1GUTA 2D2CC 1V43A 5JEAG 4HSPA 1H9RA 3Q6SA 2SDFA 1CA5A 1UEAB 1SYFA 1Z6HA 4Z9CB 1DOLA 2TMPA 4FNFA 5IGFA 3QG1A 5IIFA 3NSWA 2VUMB 4IUUA 1MSHA 4KKTA 5KIXA 4DU9A 2DN8A 2EYJA 1EY9A 1EY4A 3FPPA 2WINB 1PYWD 2V4DA 3A7AB 3NPPA 4EQNA 3HZXA 3M7GA 4A3GB 2X6GA 5JAVA 1TS4A 1TVXA 3OWEB 2F0WA 1LT6D 4ZRZA 4E6IA 4QB4A 5C0XH 3H94A 4F87A 1ENFA 5EKKA 3MXPA 1EY6A 4L6TB 2R93B 2DY8A 2WV6D 3A55A 3A8JE 2CW0C 1I4RA 3BDOA 2B2WA 1VF7A 3S9WA 2DNCA 3SVMA 4C2MB 1GOZA 4FP5D 2N55A 1LO5D 4ABNA 1DM0B 1H9SB 1S5ED 2A69C 3BS1A 1ENCA 1MBYA 4IFDH 4Y7NB 4I65A 3U9OA 4HEDA 1B4OA 5CV4A 4V0BA 2Z4HA 1EY0A 5EJWA 4CGYB 5C44B 3SEBA 2AQ2B 1LT5D 4KD4A 3BYTB 4RGOS 1TS3A 5LL6S 4RFBA 1TY2A 3J80L 3OWFA 2L9HA 4ILWA 1HFGA 3MZ5A 3C3LA 1KDAA 1XYIA 1S5DD 1LLRD 1ESRA 4QCLA 5M5YB 3Q22A 1PZJD 5I6YA 3PUXA 1JB3A 1DZ1A 4L8JA 3KF8A 3E5SA 1OXTA 4DAYA 5M3FB 3A8KE 4ZYSA 1K8OA 1SAPA 5DAUA 3EFXD 3RD4A 3BVZA 3LWEA 3TSSA 2EY2A 2Z4IA 3VYTA 4ULLA 3TP7A 4DXGA 3GQBA 3M7NA 1AFPA 1ZXTA 4IUVA 1ZEQX 5COYA 4OHJA 1KDCA 3K59A 4OIJA 3PUZA 1QJOA 4KHZA 4K6DA 3OSOA 4ID6A 2EYOA 1GUOA 1UUPA 1ENAA 3K5LA 2JA5B 1AN8A 1V1OA 3FMCA 4DAPA 1QNKA 4J8QA 2F1MA 4U68A 5G3LD 1KAAA 2M2LA 5CBEE 2KEEA 1LTID 3VR5A 4O42A 1HTPA 3NTIA 3VA7A 3D31A 4XQNA 2MUYA 5JEAH 2F0QA 2ID0A 3TZDA 4DNRB 2KA7A 1KABA 4QMGA 5FLXL 1WD1A 2EDGA 5KNCA 2B2YA 1EQVA 3OHXC 1HTLD 4DXFA 2RBMA 1RTOA 3JAME 4K6LA 2AUKA 1SBBB 1EWHA 1MD2D 3QIAA 5KYLA 2ENBA 3I3CA 2ICEC 4ZAIA 2WAQB 3M3YB 1SNQA 3ZYYX 2QKIC 2A6ED 3JAML 1STAA 4RHSA 2K1BA 3CKIB 2RDFA 1HUNA 3E6ZX 2J4XA 2F0JA 2L5TA 5C3XA 1BO0A 2K6AA 3MFGA 4DF7A 1HFNA 5IGCA 4EQPA 1K8MA 1EY7A 5CYUA 2XWBB 1LTTD 2OT2A 2B2VA 2NTSA 1STGA 4J1MA 3FPUB 2AQ3B 3SR1A 5TSSA 3ITPA 3TN2A 3NWTA 2F0FA 3TBIB 2JSOA 1OXVA 2LMCB 1I6HB 3VR6A 5E4WC 1EWCA 2JEAI 2F0VA 1PFNA 4WFN3 3M85A 1VDZA 5CV8A 3QO2A 3K7AB 2F4IA 3R2IA 4IQZA 3W3AA 1CHPD 3P75A 5J1ZA 3R93A 4IALA 2K33A 1Z47A 3PUYA 4G7OC 1FR3A 1AZPA 1FNVA 4ZLTF 2R61A 3S15B 4NMZA 3TDQA 1EOTA 2F0HA 2FINB 1SNCA 5EBCA 2B2UA 4X3SA 4PMCA 5FO9B 4KTAA 1HQMC 4LMQD 5I9OA 1R4QB 3J7YW 1HA5A 1SYCA 1EZ8A 4DK0A 1SMYD 5HURA 4BBRB 1JWMD 2K5WA 4IUQA 3ND9A 3NP8A 4G57A 2DNEA 4A3KB 3I4MB 2OF1A 2F0IA 4XQJA 1TWFB 1ET6A 1G8ZD 3D4RA 1V8QA 1GJXA 2RQXA 2X6LA 2ZT9C 3T16A 4FYDA 3J7AV 3BVGA 4OIKA 2A6HC 4EGVA 2EJMA 2QDBA 2IPKD 2PZWA 1NCVA 4DFAA 2XIWA 1B2TA 4HCEA 5I2YA 1OXXK 1IYVA 1C8CA 2L0CA 1FYCA 1UAPA 3ND8A 1KLGD 2EY1A 4RH6A 3PUWA 3NWSA 1X32A 4NKLA 4TRDA 4OGQC 1TWAB 1JC7A 4IN3A 1A6XA 3I90A 3GTJB 2C5CA 3IAYA 3QB3A 5C4ZA 1F77A 1JE4A 4N9TA 1GXDC 1RDPD 2NVXB 3VYUA 1WTPA 2NN6G 2IX0A 4K14A 1TR5A 1JCKB 2AQ1B 3T53B 3A56A 2FJ2A 3MAQA 1II3A 3SXHA 3EROA 2AWOA 2HQEA 4A3FB 3BDCA 4RKBA 2PPBC 2NVQB 3NE5B 5IODA 2B2TC 1JICA 4ZKCB 4CJ0B 5EQ0A 3HP3A 1BCPF 1X3QA 2F3VA 1RD9D 2IL8A 3OMCA 2PYKA 3VYSA 3U9SA 5DM63 2F3WA 3DMUA 2Y0SB 4BY7B 2IT1A 2F0SA 1KNEA 1BQQT 4KMUC 2RA4A 3D8GA 1NR4A 4KY7A 4FXKC 2E75C 4KJNA 2KUMA 3A7LA 3F2UA 2VXWA 1BCPC 4H13C 1SJHD 1SNOA 4X3UA 1F2YA 1H9JA 1JWUD 2XWJB 4HSVA 5D3DA 1DJRD 1G2SA 1B53A 1STYA 2AWNA 1CQFA 3HS0C 1Q1BA 3EVQA 3OIPA 4IZ8A 3C1EA 4FF4A 1SEBD 3NTHA 2A6EC 1SE4A 4TQUS 2K28A 1OO9B 4DNTB 1NAPA 5CV6A 1QE6A 3MC0B 2K03A 1IW7D 1CQVA 3V05A 4LAAA 1FNUA 2WKDA 2E2IB 3RZDB 1ILQA 1EU4A 3PV0A 3K5NA 4K2KA 3DXJC 2EYPA 1A2UA 3BG3A 3I70A 4LJZC 1EQTA 3DEPA 4O1NA 3MWYW 4KK7A 3D3RA 1RCVD 1PDQA 3MTSA 3QOLA 2HDMA 4HMIA 4KHVA 3GTOB 1SJED 2L4NA 1J9OA 2I46A 3O13A 1VF5C 3NBIA 4N9PA 3V96A 1D5MC 1SFOB 3LWUA 3MEHA 2EYHA 4UDUC 1L0XB 5CR3A 3ONAB 5LL6X 1A3TA 4FF2A 2FFKB 4C1NK 2H1EA 5ELDA 2JP1A 2IX3A 1ET9A 1HQRD 4FF3A 5C0XJ 1GUSA 2JEBI 2A5HA 4RGNA 1B1ZA 3J80E 3VR2A 1SMYC 2PNRC 2H4OA 3J7AF 2NYZD 2K01A 4OL7A 1I4QA 4BY1B 2A6HD 2KQ3A 1TS2A 5EKIA 2F0DA 3K5OA 2WKCA 2NN6H 2YU9B 3PMFA 5ISRA 3WOEA 1ONLA 1SNMA 1I6VC 3K57A 4DGZA 3GTPB 3IFDA 1WTQA 4GZYC 3CRLC 3VA5A 2L12A 4DK1A 4PQXA 4IFDJ 1MGSA 3DM1A 3GV6A 2HDLA 4KY5A 1MI2A 4ZK9B 4NDXA 2IWHA 1TS5A 5EGTA 3HOZB 4XYQA 3GTQB 3HOVB 1DOMA 1QOHA 3H09A 3MFYA 1BOSA 1BCPB 1I4HA 4ZUIA 5IGDA 1DCZA 3GV3A 3T4AC 3G6JB 4H0LC 1TY0A 1I4GA 3EA6A 2NTTA 3NBHA 1PZKD 4BA1I 2KECA 1LTSD 5CV7A 3TP6A 2R6GA 4XIGS 1EZ6A 5E1FA 1QG7A 2KCNA 4F8MA 2BA1A 2JYOA 1U4MA 2XVSA 1GUGA 5EKLA 5IGEA 3BYYB 4X3TA 3NUCA 4A3DB 2BCOA 5A35A 3C1FA 3AMUA 1F9SA 1E0BA 5FLXE 5CMDA 2R3ZA 2E2JB 1CFMA 1JORA 2FMCA 2K04A 1V1PA 2A73B 5C5LA 2E2HB 1RF2D 3BZDB 5DEHA 2K5DA 3S2DB 3NTKA 1CZWA 2XSCA 5ELCA 3NQTA 3V2TA 2J7ZA 4IUTA 3M4YA 1BCPD 4G7ZC 2O2LD 2ICIA 3H6MA 2EYFA 2F0UA 4HAEA 3D6WA 1O7ZA 5I9PA 2EYMA 1XTCD 1KNAA 1AW7A 3K58A 2EJFC 1FNWA 2E2DC 5C5MA 4QF4A 5NUCA 3GP7A 5I2XA 1I4XA 2AUJD 5JEAJ 3QOJA 1IYUA 4XYOA 4PMBA 2EXZA 1IHZA 4JK1C 1F2MA 1CA6A 3HOWB 3CRKC 2EPBA 4KJOA 2EZVA 2D62A 2EY5A 5I6WA 1EY8A 2KVMA 4XT3B 4QUCA 4I7ZC 3CQZB 1LACA 4RWSC 1BR9A 2G9HD 1EL0A 1IW7C 4HTHA 1TIID 3A8IE 1TT2A 1EYAA 3SK6A 2Q8IB 5C4JB 3C46A 1W6JA 3ERQA 1EY5A 1CI3M 1IL8A 5CV5A 5LHY1 3C2PA 4TKOB 3QWNA 4CKEA 5M9OA 2VB2X 5CBAE 5K36G 4FVMA 5IGGA 1NR2A 3DEOA 5ELBA 5JPMC 2PMZB 2L1BA 1H9SA 2WB1B 2LKVA 4A3IB 3VR3A 5D65A 2BA0A 4ME5A 1B3AA 3J81L 2VB3X 4YIJA 4K5WA 2L55A 1A3UA 1PTOF 3P1HA 3GTLB 4MHEA 3GTMB 2E74C 1T5EA 2MHVA 3MA2B 3Q23A 1E2ZA 1JOQA 3UI2A 4OO1G 1JOOA 2RSNA 3SK8A 2B2YC 2IJ0A 4L63B 2B63B 1PRTF 1B50A 3HOUB 1QILA 5C3EB 2B2TA 4KKSA 1Q1EA 1ML0D 2NZ1D 5J39A 4XXEA 4G7HC 1WTWA 5JPNC 1S4ZA 4R8IA 1C48A 2KCCA 3GO5A 1E2WA 1B9NA 3P7JA 4JBWA 1PXUA 1PZID 4PV1C 2M00A 1AP0A 3S14B 5CV9A 1S5BD 4OO1I 2WP8J 1ZKOA 5EPKA 1NUCA 2D5DA 2DY7A 2EJGC 2PZUA 4IURA 3Q0AA 5KNDA 1EIHA 2HUGA 1U4LA 1DD2A 1UNSA 2F0GA 3VYRA 4HCSA 3IKJA 3OOCA 3H91A 1TKWB 3T56B 3S1NB 2K5QA 4ZKBB 1T5XD 3FVQA 2NB0A 3I73A 2SNSA 1I3QB 1DOKA 2G9DA 2XRQD 2R7ZB 1YNNC 4IUNA 4K2LA 5K5PA 5IT9E 3LX0A 4MN3A 5E4XA 1DXMA 1TQOA 3VR4A 2A74C 2PW5A 1WCMB 5IT9L 2SEBD 2B2UC 4A3EB 2BDNA 3L3OC 5J22A 2NVTB 5ELEA 4H44C 1I50B 3RUZA 5FK9C 5FO7B 5JOBA 2B8FA 4F7XA 4C3IG 4DA2A 3R3OA 4IFDI 4FXGC 3KUPA 4XTCS 4KD3A 3I72A 5DNFA 1EEID 1G291 1WVLA 5FKAC 1E2VA 4P2CB 4ZQ3A 5FO8B 4A3BB 1D5ZC 3IL8A 2IW3A 1WTVA 3S1MB 3T51B 1PLFA 5K36H 4C56C 4WJWA 5KYIA 3S16B 1SYEA 5AFWA 3SK4A 1M4VA 3I4LA 1F2LA 1J8IA 2F0PA 4R8NA 5HGTA 4UAIA 1ESFA 3SK5A 1LV9A 3OMGA 4FF1A 3NK9A 3NHHA 4OO1H 4BS9A 1PMRA 1IKMA 2EY6A 3S1QB 4PNYA 2OEOA 1U4RA 1LT4D 3KLSX 4KN7C 2A68D 4ZUJA 4HN7A 1PRTB 2RVLA 3K5MA 2K32A 2JXMB 2O4XA 2JA7B 2KOLA 2K05A 1JWSD 3OPOA 1RTNA 2F0MA 2EE1A 3URYA 2PZTA 1MSGA 3TP8A 4KKUA 2PQEA 2BDOA 3NQIA 4CBVA 1ZYRC 1SYBA 3Q24A 1STEA 3T13A 2EYLA 4QIWB 4TSSA 4XDXA 2PW7A 1PTOD 3MXUA 3CU7A 4NW2A 1Y8NB 2N88A 5EPJA 5C4HA 1EFID 1GUWA 1SYGA 1B44D 4EQOA 3IFTA 2F03A 1OXUA 1HHVA 4A3JB 1Q90A 1BUVT 1Q12A 2XNAC 3HRZC 3RLFA 5KRUA 1SYDA 3CHBD 4FO2A 1PRTD 1W6KA 1F9QA 2F0LA 4B9WA 5EBDA 4DN4M 2E76C 1QCBD 4RHRA 1CK1A 4KI0A 1WTXA 3EJIA 2QF7A 3L7ZC 4Q0FA 4NP5A 2ZXRA 5IGBA 1JOKA 1STHA 1YNJD 3MXGA 4AYBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXZ A;  1IHZ A;  1KDB A;  2F0S A;  2F0N A;  1ENA A;  1ENC A;  1F2M A;  4ZUI A;  1AEX A;  1EYC A;  4ZUJ A;  5IGD A;  5J22 A;  5CV8 A;  4I65 A;  3D8G A;  3U9O A;  2QDB A;  1STB A;  5CV4 A;  4N9P A;  5IOC A;  5J39 A;  3SHL A;  4KJO A;  2PZW A;  4KY7 A;  3HEJ A;  3TP5 A;  2SNM A;  1SND A;  2KHS A;  4KJN A;  2EY5 A;  4DFA A;  2RKS A;  5C3W A;  5I6W A;  1EY8 A;  3RUZ A;  1EY0 A;  3MEH A;  1KAA A;  4K8I A;  2EYH A;  3P75 A;  5J1Z A;  5JOB A;  5CR3 A;  2O4X A;  3D4D A;  2F0K A;  4F7X A;  4S3S A;  1SNO A;  4KD4 A;  2EY1 A;  2F0O A;  1F2Y A;  3R3O A;  1A3T A;  4HMJ A;  4IAL A;  5CV7 A;  3TP6 A;  2F0M A;  4K5X A;  1SYF A;  2F0Q A;  1EZ6 A;  5E1F A;  1STY A;  2PZT A;  5KGU A;  4TRD A;  4NKL A;  4RKL A;  4F8M A;  3TP8 A;  3TME A;  4HTH A;  1KAB A;  4QMG A;  1NSN S;  2PQE A;  2M00 A;  3EVQ A;  4IZ8 A;  4KD3 A;  3C1E A;  3OWF A;  4WOR A;  4H7B A;  2F0T A;  5EKL A;  5IIF A;  5IGF A;  1TT2 A;  5IGE A;  5CV9 A;  4NMZ A;  3NUC A;  1EYA A;  3SK6 A;  1EQV A;  3ERQ A;  2RBM A;  1EY5 A;  3MZ5 A;  4ZQ3 A;  3C1F A;  5CC4 A;  5KIX A;  1SYB A;  2F0H A;  3QB3 A;  1NUC A;  4DU9 A;  4J6H A;  2EYJ A;  1A2T A;  1SNC A;  1EY9 A;  3MVV A;  1EY4 A;  1KDA A;  2PZU A;  5CV5 A;  1RKN A;  5C4Z A;  1JOR A;  5KYL A;  3T13 A;  2ENB A;  1SNP A;  5CGK A;  5C5L A;  5M9O A;  4EQN A;  3HZX A;  2EYL A;  4PMC A;  1F2Z A;  2NUC A;  1U9R A;  4N9T A;  2PW7 A;  4OL7 A;  3DHQ A;  5CV6 A;  4KV6 A;  4KTA A;  5KEE A;  5DEH A;  4EVO A;  1SNQ A;  2KQ3 A;  4LAA A;  4MIU A;  5JAV A;  5IGG A;  5I9O A;  1EYD A;  2F0D A;  5I6Y A;  4K14 A;  4B9X A;  2F0G A;  2F0W A;  1STA A;  5C4H A;  1SYC A;  1TR5 A;  3E5S A;  1SYG A;  3NQT A;  4QB4 A;  3V2T A;  4E6I A;  4EQO A;  2RDF A;  1EZ8 A;  2LKV A;  5KYI A;  5C6A A;  2F0J A;  3PMF A;  5ISR A;  4K2K A;  2OXP A;  5C3X A;  5HUR A;  1SNM A;  5EKK A;  3MXP A;  1EY6 A;  4ODG A;  4ME5 A;  1SYE A;  3D6C A;  5DAU A;  2EYP A;  4YIJ A;  1II3 A;  1A2U A;  4K5W A;  4DGZ A;  1SYD A;  5KRU A;  3H6M A;  1A3U A;  3SXH A;  2SNS A;  2EYF A;  3VA5 A;  4DF7 A;  3SK4 A;  3ERO A;  1STN A;  3NP8 A;  3D4W A;  3P1H A;  4G57 A;  5IGC A;  2F0L A;  4EQP A;  2EY2 A;  2F0U A;  5E3F A;  1EY7 A;  4B9W A;  2HQE A;  2F0E A;  3BDC A;  3TP7 A;  4RKB A;  2OF1 A;  2F0P A;  4IUN A;  4K2L A;  5I9P A;  2F0I A;  2SOB A;  5K5P A;  4R8N A;  2EYM A;  1STG A;  3EJI A;  4J1M A;  3LX0 A;  4WRD A;  5HGT A;  1JOQ A;  4KY5 A;  4K8J A;  3SR1 A;  5IOD A;  3ITP A;  5F2D A;  3SK5 A;  3S9W A;  3OMG A;  1JOO A;  3BDL A;  3SK8 A;  1TQO A;  2WAC A;  4NDX A;  2F3V A;  3QOL A;  1KDC A;  5C5M A;  4NP5 A;  4QF4 A;  2F0F A;  3NHH A;  3MHB A;  2OEO A;  3NK9 A;  5EGT A;  5NUC A;  5IGB A;  4KY6 A;  1JOK A;  4K5V A;  3OMC A;  2PYK A;  4K6D A;  1STH A;  2EY6 A;  3T16 A;  3NXW A;  4HMI A;  2PW5 A;  3OSO A;  4KHV A;  2F3W A;  3QOJ A;  1A3V A;  3DMU A;  4ID6 A;  4PNY A;  2F0V A;  2EYO A;  4PMB A; 
#chains in the Genus database with same CATH topology
 1WOC A;  1BDO A;  2VNU D;  1SRU A;  3S1R B;  2MPM A;  1E7Z A;  4HR7 B;  4DV4 Q;  1AEX A;  1CUK A;  1VQO A;  4GLA C;  3UDF A;  1TWC H;  1DON A;  2B39 A;  4YY3 Q;  1GHJ A;  1Q8I A;  2HQL A;  3G7L A;  4UP8 A;  4K8I A;  4KN4 C;  2IX1 A;  1HJP A;  3K6O A;  1WD0 A;  1TWH B;  3RZO B;  4MTK A;  2LY7 A;  2F0O A;  4B9X A;  4C1N I;  4K5X A;  2CWA A;  2JA6 H;  1YNN D;  1VQ8 A;  3BVM A;  3CMA A;  4C3I H;  3H15 A;  2LFN A;  4DAV A;  1B70 B;  3TME A;  4JI5 L;  4BWG B;  4A3M H;  1G6P A;  4DR5 L;  1CZG A;  3RR5 A;  3L2P A;  2F0T A;  1PVO A;  1BBW A;  4A93 G;  4F88 A;  3ICE A;  1GM5 A;  3JC6 6;  1WTR A;  2MO0 A;  1RJT A;  3KK7 A;  5CC4 A;  1TWC B;  2L11 A;  3K0Y A;  4OX9 Q;  5D14 A;  1P8L A;  2J0T D;  1G91 A;  3P20 A;  3R8B A;  4YCV A;  3K8A A;  1SNP A;  1N34 Q;  1F2Z A;  2NUC A;  1PH6 A;  1L0Y B;  3FEW X;  2OQK A;  1BF4 A;  2JA6 B;  3I4N G;  1EYD A;  3H3V C;  3PGZ A;  4C3I B;  2OTL A;  3STB C;  1BXT A;  2EXD A;  4A3M B;  1FD7 D;  4K0K Q;  1HPC A;  4RCN A;  4C3H G;  4RAU C;  2YYZ A;  1KLU D;  3N52 A;  3TS0 A;  4M8A A;  2R7Z G;  3GTG H;  2B2W C;  4KHP L;  5T1I A;  1SE2 A;  2M9V A;  1STN A;  4BBS G;  1D6E C;  1LAB A;  3HOX B;  3I91 A;  4X3K A;  5ELF A;  4JI2 L;  1O78 A;  2F0E A;  1L1O B;  1I94 Q;  4DNI A;  1Y1W G;  1PH4 A;  3UE0 A;  4BA2 I;  1AE3 A;  3QJY A;  2K14 A;  2Z6K A;  4PZ7 A;  5M5X H;  3G71 A;  4DV5 L;  3DWQ A;  2N78 A;  4P73 A;  1SSO A;  2JQO A;  1NJI C;  1C0A A;  1EIG A;  1FGU A;  1TU2 B;  4JI3 L;  3NXW A;  3GTG B;  3TRE A;  4GKK L;  1HCZ A;  1O80 A;  1HZC A;  1CKO A;  1KDB A;  2F0N A;  3PO2 G;  3PIO 3;  2CHB D;  2RHQ B;  5DM7 3;  3LNN A;  1MKH A;  1H9K A;  3R2T A;  5GAE C;  3SHL A;  1D2B A;  1ILP A;  2JA8 H;  2KED A;  3HEJ A;  1I5F A;  1X3E A;  2Q2H A;  2RKS A;  4EX5 A;  1XXG A;  2ZXP A;  3I8Z A;  5M5X B;  5IT9 c;  2HCC A;  2MJ8 A;  1PFB A;  3AU7 A;  1N33 Q;  1Y8P B;  1EIY B;  1CKM A;  1HUM A;  1HA6 A;  4RA8 A;  4JI1 Q;  4IUP A;  1HNZ Q;  1JR0 D;  2AKW B;  4C3J G;  4UP7 A;  2BE5 C;  2GVA A;  4B3S L;  3E3X A;  3E9I A;  4O2D A;  2I5H A;  1I4P A;  2AMC B;  4LUV A;  4A3B G;  1WTO A;  1HRJ A;  4FXD A;  2JA8 B;  3MVV A;  1CT1 D;  1L0W A;  3U4V A;  4B08 A;  5CGK A;  2CKZ B;  2A1A A;  2Z1C A;  1U4P A;  3HGB A;  1U9R A;  1R9T H;  5COR A;  5C4X B;  2QIL A;  2FHT A;  3EQL C;  5KEE A;  4NXN Q;  3KFU A;  5KNB A;  1DYQ A;  1N32 L;  1QB5 D;  1VQI A;  2R92 H;  3DUZ A;  4DR2 Q;  1AZQ A;  3QR8 A;  1F9P A;  2OXP A;  3CCV A;  1G2T A;  5D3I B;  1KTK A;  4HIK A;  3PO3 H;  1SXT A;  1J5E L;  2EIF A;  3KBG A;  1YIT A;  5E3F A;  1C4Q A;  2X69 A;  1R9T B;  3J81 E;  4QIW E;  1X3G A;  2ZXO A;  2PQA A;  2K7V A;  2A68 C;  1ZYR D;  1YJN A;  1KAW A;  1VCI A;  4DR1 Q;  2GA4 B;  2R92 B;  2NVY H;  3W5O A;  5BR8 Q;  5M3M H;  1HXY D;  2CCZ A;  2B63 H;  3MHB A;  1X3P A;  4PMW A;  4LF7 Q;  4K5V A;  3PUV A;  3HKZ B;  3PO3 B;  2ZM6 L;  3GD7 A;  2CW0 D;  2VUM G;  1IBK L;  2O5I C;  4DR3 Q;  4DR7 Q;  2JN4 A;  1SDF A;  4DR5 Q;  2BOS A;  2JE6 I;  3H3V H;  3L9A X;  2RDG A;  2RSO A;  3TP5 A;  1SND A;  2KHS A;  4Y52 H;  1VQM A;  3W2D A;  3GTK H;  4QL5 A;  4A3G G;  3MXN A;  1M8A A;  4LF9 Q;  4CDF C;  2NVY B;  3D4D A;  5M3M B;  2NWG A;  2VW9 A;  1CHQ D;  2A69 D;  4HMJ A;  2FMM A;  1ICF B;  5KGU A;  4LF5 L;  4RKL A;  1VQJ A;  1PTO C;  4U67 3;  5EAY A;  2PO4 A;  3MEF A;  3HFZ B;  2XRS D;  1D1K A;  4H7B A;  3FKI H;  1CTM A;  3TZU A;  1XMQ Q;  1VMC A;  3CCE A;  2KJX A;  2C9O A;  1C9O A;  4A93 H;  2ZJR A;  4JBM A;  2R93 G;  4J6H A;  4RGT A;  3WOF A;  1A2T A;  4GOP A;  4EQ5 A;  1RKN A;  3GTK B;  1JB7 A;  4CKB A;  3X3N A;  4EVO A;  3HG9 A;  1PRT C;  4V19 0;  2QEJ C;  4OWT B;  4LNQ A;  2KCT A;  5C0X G;  1X9N A;  1G6Z A;  1JQY D;  5IYC G;  3S17 H;  1VQP A;  3DWA A;  2NBF A;  3DWP A;  4RGM A;  1Q3L A;  3I4N H;  3FDT A;  2JK8 A;  3FKI B;  1A15 A;  5C6A A;  2UXB Q;  4AIM A;  3N6R A;  5A2Q E;  1IBM L;  4DV5 Q;  4ODG A;  2B2V C;  4C3H H;  3D6C A;  1PH1 A;  4A93 B;  1D1I A;  1H95 A;  3S2H H;  4JYA Q;  4DV3 Q;  2HCI A;  1F9R A;  2Q2U A;  4I7A A;  2R7Z H;  5FJ8 G;  3AEV A;  4GN3 B;  5BN5 A;  1YNJ C;  2XGT A;  4GKK Q;  3KDF A;  4BBS H;  2B29 A;  4YCU A;  5A2Q L;  3SE0 A;  5C44 G;  2JA9 A;  5EPL A;  1A63 A;  1XX8 A;  1FJG L;  2UXC L;  4WRD A;  1EU3 A;  1Y1W H;  3S17 B;  4K8J A;  3I4N B;  1LTR D;  2KHJ A;  3BDL A;  4CJ1 B;  3PIP 3;  1BNZ A;  1K83 H;  1IYJ B;  2R7F A;  2CVR A;  4C3H B;  3S2H B;  4X66 L;  1D5X C;  1A3V A;  1LTB D;  4M1U B;  3I7F A;  4IFD G;  1E1O A;  5C0X I;  3E0J A;  5BN3 A;  3HOY B;  3WDN A;  1NNX A;  5JVG 3;  1N36 Q;  4BBS B;  1PH2 A;  4R4O A;  5I4D A;  1STB A;  5IOC A;  4XT1 B;  1M1K C;  3PO2 H;  1R4P B;  1L1O A;  1Y69 U;  2WII B;  1ASZ A;  3KJO A;  2SNM A;  1QWY A;  4LUO A;  5C3W A;  2AHO B;  1O7Y A;  1Q81 C;  1OXS C;  3J7Z C;  1Y1W B;  2RF4 A;  4B3R L;  4HIM A;  1ROD A;  1S5C D;  2F0K A;  1S3O A;  4S3S A;  5JJZ A;  4LW1 A;  1K83 B;  2LS0 1;  3OW7 A;  3U50 C;  1CM9 A;  2QCP X;  4XQQ A;  1Y1V H;  5M3F G;  3KF8 B;  2CQA A;  4DAY B;  3J80 i;  3H0G B;  1NSN S;  3SGI A;  4DKA C;  5JVH 3;  1S40 A;  4WOR A;  1IBL Q;  1M90 C;  1WFQ A;  4QUF A;  1EOV A;  3FRP B;  1SE8 A;  1FGB D;  4C3J H;  3A54 A;  2O5J C;  1O7L A;  3PO2 B;  2Q8R E;  1LT3 D;  2CFM A;  5G3L F;  3G4S A;  2RDH A;  4DV0 L;  2I07 B;  1Y8O B;  2EVB A;  1PFM A;  3M4O H;  4JC0 A;  4A3B H;  2MP1 A;  3OIQ A;  2OWO A;  5BN4 A;  5FOB B;  3DHQ A;  1QNU A;  2TSS A;  4KV6 A;  3W1G A;  3T1H Q;  1LTG D;  4HIO A;  4MIU A;  4Q5V A;  1Q46 A;  1S5F D;  4DV4 L;  1JJC B;  1HNX Q;  1T9H A;  1Y1V B;  1K3R A;  4CHT B;  3AB9 A;  5M5W H;  2VZA A;  3NBH B;  1WYD A;  3KLS A;  4YY3 L;  4LK1 C;  1H9M A;  3OYY A;  1Z7T A;  4C3J B;  3HOX G;  3OW2 A;  1SE3 A;  3RMH A;  1IKL A;  1K8G A;  4LF8 Q;  1CSP A;  1TWG H;  2PCF B;  4R9W A;  1XWE A;  2JA5 G;  3M4O B;  1NBW A;  3PCO B;  3D4W A;  2NN6 I;  2DJF C;  2ZTC A;  2IY5 B;  2BE5 D;  3SDZ A;  1GHK A;  4GLX A;  3GDE A;  4CJ2 C;  1PTO H;  2XN9 C;  4YWM A;  2SOB A;  2MGS A;  1CKN A;  1LTA D;  2D9U A;  5M5W B;  1V1P B;  5F2D A;  4OX9 L;  3KLR A;  2WAC A;  5T1G A;  1ICW A;  1VMP A;  4G4K A;  4KY6 A;  1N34 L;  2Z8L A;  1RHP A;  2Q8T A;  1TWG B;  1KD1 C;  1EEF D;  1B9M A;  1GUN A;  4LF5 Q;  1BBX C;  1EYC A;  2VUM H;  1YBY A;  2B8G A;  1YIJ A;  4K0K L;  1PTO B;  3KBX A;  1V9P A;  1EQR A;  2HT1 A;  2EOT A;  2DUD A;  4CKC A;  3X3M A;  4RCO A;  1GUT A;  2PMZ E;  2EQS A;  2D2C C;  2WAQ G;  2WB1 E;  1V43 A;  5JEA G;  4ME3 A;  4HSP A;  1H9R A;  3Q6S A;  2SDF A;  4A3G H;  1CA5 A;  1UEA B;  1IZ6 A;  1VQA A;  1SYF A;  1Z6H A;  3A5U A;  4Z9C B;  1I94 L;  1DOL A;  1YEZ A;  2N49 A;  2TMP A;  4FNF A;  1JT8 A;  5IGF A;  2JA8 G;  3QG1 A;  5IIF A;  3NSW A;  1XPO A;  2VUM B;  4IUU A;  1MSH A;  4KKT A;  5KIX A;  4DU9 A;  2DN8 A;  2EYJ A;  5C4X G;  1EY9 A;  1EY4 A;  2A8V A;  4N8F A;  3FPP A;  3T1Y Q;  2R93 H;  2YTY A;  2WIN B;  1PYW D;  2V4D A;  3A7A B;  3NPP A;  1PH9 A;  1NY4 A;  2WFW A;  4EQN A;  3HZX A;  3M7G A;  4A3G B;  1A8V A;  4TVA B;  2X6G A;  4H02 A;  5JAV A;  4JOI C;  5HGQ A;  3JAM i;  4A3C G;  4WJ3 M;  1TS4 A;  1TVX A;  2N3S A;  3OWE B;  2F0W A;  4RG1 A;  1LT6 D;  4ZRZ A;  4ALP A;  4E6I A;  4QB4 A;  5C0X H;  5IYC H;  5ELN A;  3H94 A;  3ULJ A;  4C2M H;  3KLW A;  4F87 A;  1ENF A;  5EKK A;  3MXP A;  1EY6 A;  1N33 L;  1HZ9 A;  2K5H A;  3E0E A;  3ZJY C;  4WJ4 A;  4L6T B;  4A3L G;  4JI1 L;  2R93 B;  1LTL A;  1PH8 A;  4APV A;  2DY8 A;  4JI8 Q;  2WV6 D;  3A55 A;  4Y7N H;  3A8J E;  2CW0 C;  1KC8 C;  5FJ8 H;  1I4R A;  3BDO A;  1Q82 C;  2B2W A;  1VF7 A;  5C44 H;  1SRO A;  3D0F A;  3E9H A;  3S9W A;  3PO3 G;  2DNC A;  5JJI A;  1EYG A;  2IHE A;  3SVM A;  4C2M B;  4HJ7 A;  1J6Q A;  1GOZ A;  4FP5 D;  3S24 A;  1NE3 A;  2N55 A;  1LO5 D;  4R4I A;  4ABN A;  1DM0 B;  4OXP A;  2YTX A;  1H9S B;  1S5E D;  2A69 C;  4NXN L;  3BS1 A;  2K75 A;  1IL2 A;  1FL0 A;  1ENC A;  1MBY A;  4IFD H;  4Y7N B;  4I65 A;  3U9O A;  3ERS X;  4HED A;  1B4O A;  5CV4 A;  2P5Z X;  4DR2 L;  4V0B A;  2Z4H A;  4QGU A;  2XTI A;  1EY0 A;  1IXR A;  5EJW A;  4CGY B;  1Z9F A;  5C44 B;  3SEB A;  5M5Y H;  2A19 A;  1WI5 A;  2AQ2 B;  1LT5 D;  4KD4 A;  2OCE A;  3BYT B;  4RGO S;  2Z9H A;  3FHW A;  2Q2I A;  1TS3 A;  5LL6 S;  4RFB A;  2UXD Q;  1EWI A;  1TY2 A;  3J80 L;  5M3F H;  4HID A;  4JI6 Q;  3OWF A;  4POF A;  4BBR G;  3G48 A;  2L9H A;  4DR1 L;  4ILW A;  1HFG A;  4NPS A;  3M9B A;  3MZ5 A;  3BZC A;  5BR8 L;  3C3L A;  1KDA A;  1XYI A;  1C7Y A;  1S5D D;  4R4Q A;  5IP9 G;  4LF7 L;  4A3K G;  1LLR D;  1YNX A;  2NZO A;  3I4M G;  3NEM A;  1ESR A;  4QCL A;  2B3G A;  5M5Y B;  3Q22 A;  4DR3 L;  1PZJ D;  4DR7 L;  3FKI G;  5I6Y A;  3PUX A;  1JB3 A;  1DZ1 A;  1PFS A;  2ALY B;  4L8J A;  3KF8 A;  3E5S A;  1OXT A;  4JI7 L;  4DAY A;  5M3F B;  3A8K E;  4ZYS A;  1MJC A;  1X56 A;  1K8O A;  2JJQ A;  5DLQ E;  2L15 A;  1SAP A;  5DAU A;  1ASY A;  3DLL A;  4LF9 L;  2QDL A;  3EFX D;  1L2F A;  1GO3 E;  3HOX H;  3RD4 A;  4DV2 Q;  3BVZ A;  2YTV A;  3LWE A;  3TSS A;  5HY6 A;  2JA5 H;  2EY2 A;  3F2B A;  2K52 A;  2Z4I A;  3VYT A;  2C35 B;  4ULL A;  3TP7 A;  4DXG A;  3GQB A;  3M7N A;  1XMQ L;  1GKH A;  2MNA A;  3TEH B;  1AFP A;  4BXX G;  1ZXT A;  5FLM G;  4IUV A;  2MQH A;  1ZEQ X;  5COY A;  1XPR A;  4OHJ A;  1KDC A;  3K59 A;  4OIJ A;  3PUZ A;  2NZH A;  1QJO A;  4KHZ A;  5JJL A;  4K6D A;  3HOY G;  4MZ9 A;  1XMO Q;  3OSO A;  4ID6 A;  2EYO A;  1GUO A;  4DK6 C;  1UUP A;  1XNQ Q;  1ENA A;  3K5L A;  2JA5 B;  4JBK A;  1AN8 A;  1V1O A;  3FMC A;  4DAP A;  1QNK A;  4J8Q A;  2UXB L;  2F1M A;  4U68 A;  4YCW A;  5G3L D;  1KAA A;  2M2L A;  5CBE E;  2KEE A;  1LTI D;  3VR5 A;  4JYA L;  4O42 A;  4DV3 L;  1HTP A;  3LGJ A;  3I56 A;  1E1T A;  3NTI A;  3H0G G;  3VA7 A;  3D31 A;  4XQN A;  2MUY A;  5JEA H;  4JI0 Q;  2F0Q A;  2ID0 A;  3TZD A;  4GN4 B;  4DNR B;  2KA7 A;  1KAB A;  4QMG A;  5FLX L;  1WD1 A;  2EDG A;  5KNC A;  2B2Y A;  1TXY A;  1EQV A;  3OHX C;  1HTL D;  4DXF A;  2RBM A;  1RTO A;  3JAM E;  4K6L A;  2AUK A;  1SBB B;  4PZ8 A;  1EWH A;  3CPF A;  3PF5 A;  1MD2 D;  3QIA A;  5KYL A;  1BKB A;  2ENB A;  3I3C A;  1U5K A;  2ICE C;  1Y14 B;  4YHH Q;  4GNX C;  5C4X H;  1Y1V G;  4ZAI A;  3RNU A;  2WAQ B;  3M3Y B;  4YWL A;  1SNQ A;  2UUA Q;  3ZYY X;  2QKI C;  4LF4 Q;  2A6E D;  1N36 L;  3M4P A;  3JAM L;  1STA A;  4RHS A;  2K1B A;  3RLO A;  3CKI B;  4A3C H;  2RDF A;  1HUN A;  3E6Z X;  2J4X A;  2F0J A;  2L5T A;  5C3X A;  1UE6 A;  1BO0 A;  2Y0S G;  2K6A A;  1I6H H;  2KBN A;  3MFG A;  4DF7 A;  1HFN A;  3BU2 A;  5IGC A;  4EQP A;  1K8M A;  1EY7 A;  5CYU A;  2XWB B;  4A3L H;  2VQE L;  1LTT D;  2MFI A;  3K7A H;  1IBL L;  2OT2 A;  2B2V A;  1N9W A;  2NTS A;  1STG A;  4J1M A;  3FPU B;  2AQ3 B;  3SR1 A;  5TSS A;  3ITP A;  4YWK A;  2ZJQ A;  3TN2 A;  1N8R C;  3NWT A;  4L5R C;  1D7Q A;  2HHH Q;  3EBE A;  2F0F A;  3TBI B;  2JSO A;  1OXV A;  2LMC B;  1PHJ A;  1I6H B;  3VR6 A;  5E4W C;  1EWC A;  3T1H L;  2JEA I;  2F0V A;  1PFN A;  3F2D A;  4WFN 3;  3M85 A;  3S15 H;  1HNX L;  3OTO Q;  1VDZ A;  5CV8 A;  1KXL A;  3QO2 A;  3K7A B;  4HJA A;  2F4I A;  3R2I A;  1AE2 A;  4IQZ A;  1VQH A;  3W3A A;  2CQO A;  1CHP D;  3P75 A;  4LF8 L;  5J1Z A;  1UE1 A;  3R93 A;  4IAL A;  2K33 A;  1Z47 A;  1XJV A;  5IYD G;  3PUY A;  4G7O C;  1FR3 A;  1AZP A;  1FNV A;  4ZLT F;  2R61 A;  3I55 A;  3S15 B;  2QEX A;  4NMZ A;  1MJE A;  4JI7 Q;  1JJ2 A;  3TDQ A;  1X65 A;  1EOT A;  4BBR H;  2F0H A;  2FIN B;  3CCL A;  1SNC A;  5EBC A;  5IWA Q;  2B2U A;  4X3S A;  3J81 j;  4PMC A;  5IP9 H;  1QVF A;  5FO9 B;  4A3K H;  3I4M H;  4KTA A;  1HR0 L;  1LUZ A;  1HQM C;  2F4V Q;  4LMQ D;  5I9O A;  1TWF H;  2CH4 W;  1R4Q B;  3J7Y W;  5LMU Q;  4AYB E;  1HA5 A;  1SYC A;  1GVP A;  1EZ8 A;  4PZ6 A;  4DK0 A;  1SMY D;  5HUR A;  3KJP A;  4BBR B;  1JWM D;  2MO1 A;  4P71 A;  2K5W A;  4IUQ A;  3ND9 A;  3NP8 A;  4UY8 C;  4G57 A;  3PQI A;  2DNE A;  4GKJ Q;  4A3K B;  3I4M B;  2OF1 A;  2F0I A;  4XQJ A;  1TWF B;  2PNH A;  1ET6 A;  1G8Z D;  4BXX H;  5FLM H;  3D4R A;  1V8Q A;  3T1Y L;  1XNR Q;  4B3T Q;  1GJX A;  5GAH C;  2RQX A;  2X6L A;  2ZT9 C;  3T16 A;  5AJ3 Q;  4FYD A;  2OTJ A;  1TWA H;  3HOY H;  3J7A V;  1XPU A;  3BVG A;  4AH6 A;  4OIK A;  1PH3 A;  2A6H C;  4EGV A;  2EJM A;  3GTJ H;  2QDB A;  2IPK D;  4O0A A;  2PZW A;  1NCV A;  4DFA A;  3A5Z B;  5H1S E;  2XIW A;  3CP0 A;  1B2T A;  4BY1 G;  3KOJ A;  3PSI A;  4HCE A;  5I2Y A;  1OXX K;  1IYV A;  1C8C A;  3WWV A;  2L0C A;  1FYC A;  1UAP A;  3ND8 A;  2NVX H;  1KLG D;  2EY1 A;  4RH6 A;  3PUW A;  4JI8 L;  2F52 A;  3H0G H;  3NWS A;  1X32 A;  4NKL A;  4TRD A;  3AFQ A;  4OGQ C;  4PG3 A;  1VQN A;  4GNX B;  1TWA B;  5JJK A;  5L37 A;  1JC7 A;  1X3F A;  4IN3 A;  1A6X A;  3I90 A;  3GTJ B;  2C5C A;  3IAY A;  3QB3 A;  4AQY Q;  4JG2 A;  5C4Z A;  4DUY Q;  3UDX A;  1UWV A;  3J80 c;  1F77 A;  1JE4 A;  4N9T A;  4NXM L;  1GXD C;  1RDP D;  2NVX B;  3VYU A;  1WTP A;  4LF6 Q;  2CH4 A;  2NN6 G;  2NVQ H;  2IX0 A;  3K80 C;  4K14 A;  2VQE Q;  1TR5 A;  1K0S A;  1JCK B;  4R4T A;  2AQ1 B;  3HOZ G;  3T53 B;  3A56 A;  2FJ2 A;  3MAQ A;  1A0I A;  4L5Q A;  3K0X A;  4JOI A;  1II3 A;  2I0Q A;  3SXH A;  4X64 Q;  4CDE C;  3ERO A;  2RCN A;  5IP7 G;  1KQS A;  2AWO A;  2HQE A;  2UXD L;  4A3F B;  3BDC A;  4L5T A;  4RKB A;  4JI6 L;  2WAQ E;  2PPB C;  3TQY A;  2NVQ B;  3NE5 B;  5IOD A;  2B2T C;  1JIC A;  4ZKC B;  4CJ0 B;  5EQ0 A;  3HP3 A;  1BCP F;  5IE8 A;  1X3Q A;  2F3V A;  4KLK A;  1RD9 D;  2CWP A;  2IL8 A;  3OMC A;  2PYK A;  3VYS A;  3UDI A;  1JJG A;  3U9S A;  5DM6 3;  3CCR A;  2F3W A;  3DMU A;  4GOP C;  2Y0S B;  4A3D G;  4BY7 B;  2IT1 A;  2F0S A;  1KNE A;  2VQF Q;  1BQQ T;  2H5X A;  4KMU C;  2RA4 A;  3D8G A;  2HIX A;  1SLJ A;  1NR4 A;  4KY7 A;  4FXK C;  2E75 C;  4KJN A;  2KUM A;  1AH9 A;  3A7L A;  3F2U A;  4A4I A;  1NMF A;  2VXW A;  1BCP C;  4H13 C;  1SJH D;  4DV2 L;  4A76 A;  1SNO A;  4ZCK A;  4X3U A;  4OWX B;  1F2Y A;  1H9J A;  1JWU D;  2XWJ B;  2K5V A;  4HSV A;  5D3D A;  1PV4 A;  1DJR D;  1G2S A;  2KEN A;  1B53 A;  2E2I H;  1STY A;  2AWN A;  1HR0 Q;  4QQB X;  3UDG A;  2QGQ A;  1CQF A;  3HS0 C;  5IYD H;  1Q1B A;  3EVQ A;  1QUQ B;  3OIP A;  3C1E A;  4IZ8 A;  4FF4 A;  1SEB D;  3NTH A;  5GQO A;  2A6E C;  2K50 A;  3G6E A;  2VY3 A;  1SE4 A;  3RN2 A;  4TQU S;  2K28 A;  1OO9 B;  4DNT B;  1NAP A;  4RMF A;  4OEL B;  1XMO L;  4QY7 A;  5CV6 A;  3AFP A;  1QE6 A;  3MC0 B;  2K03 A;  1JMC A;  1IW7 D;  1PYB A;  1CQV A;  3V05 A;  1XNQ L;  4P74 A;  4LAA A;  4DR6 Q;  1FNU A;  3HKZ E;  2WKD A;  2E2I B;  3RZD B;  4HJ9 A;  1ILQ A;  1EU4 A;  1RL2 A;  1S72 A;  2I5M X;  3PF4 A;  3PV0 A;  3K5N A;  4K2K A;  2HD3 A;  3DXJ C;  3GTO H;  2EYP A;  1A2U A;  3BG3 A;  3I70 A;  3JAM c;  4JI0 L;  4LJZ C;  3HOW G;  1EQT A;  3DEP A;  4O1N A;  4DV1 Q;  3UE1 A;  4FDB A;  3F8T A;  3MWY W;  3CCM A;  4KK7 A;  3D3R A;  1SFO H;  1RCV D;  3PIO A;  1PDQ A;  2QW7 A;  3MTS A;  2QA4 A;  3QOL A;  2HDM A;  4YHH L;  4HMI A;  4KHV A;  3GTO B;  1SJE D;  2L4N A;  1J9O A;  2UUA L;  2OQ0 A;  4LF4 L;  1YHQ A;  2I46 A;  3O13 A;  1VF5 C;  4MTN A;  4POG A;  3NBI A;  4N9P A;  1K73 C;  3V96 A;  2HIV A;  4X65 Q;  2ATW A;  1D5M C;  1SFO B;  3LWU A;  3MEH A;  2EYH A;  4UDU C;  3KYH C;  1L0X B;  5CR3 A;  3ONA B;  1NTG A;  5LL6 X;  4DUZ L;  4BY1 H;  1A3T A;  4FF2 A;  2FFK B;  2WB1 G;  4C1N K;  4NXM Q;  2BH8 A;  2H1E A;  4JBJ A;  5ELD A;  4A3I G;  2JP1 A;  2KHI A;  2IX3 A;  4B3M Q;  1ET9 A;  1HQR D;  4FF3 A;  2ZTE A;  2YU9 H;  5C0X J;  1YZ6 A;  1GUS A;  2JEB I;  1YHA A;  2A5H A;  4RGN A;  2UU9 Q;  2GN5 A;  1K0R A;  3HKS A;  1B1Z A;  3J80 E;  3VR2 A;  2HHH L;  3GTP H;  4LFB Q;  3J7A 5;  1SMY C;  4J15 A;  4DK3 C;  2PNR C;  1W3S A;  2H4O A;  3L0O A;  3J7A F;  2NYZ D;  2K01 A;  1VQL A;  4OL7 A;  1I4Q A;  4BY1 B;  2A6H D;  1YI2 A;  2KQ3 A;  3BZK A;  1TS2 A;  3FP9 A;  5EKI A;  3OTO L;  1LM0 A;  2F0D A;  3K5O A;  2WKC A;  2E5L Q;  2NN6 H;  4OEM B;  1UE5 A;  3MXN B;  1PA6 A;  2YU9 B;  3BJU A;  3PMF A;  1QZH A;  5ISR A;  3WOE A;  1ONL A;  1SNM A;  3HOZ H;  3GTQ H;  3J81 i;  3HOU G;  5C3E G;  1I6V C;  3K57 A;  4DGZ A;  3GTP B;  3IFD A;  1WTQ A;  4DV7 Q;  4GZY C;  3CRL C;  3VA5 A;  1NMG A;  2L12 A;  4DK1 A;  4PQX A;  4LWC A;  4IJH A;  4IFD J;  1W2B A;  5IP7 H;  1MGS A;  4GOP B;  3DM1 A;  3GV6 A;  2HDL A;  4KY5 A;  1MI2 A;  3K7U C;  4ZK9 B;  4NDX A;  2IWH A;  3CCS A;  5IWA L;  1TS5 A;  5EGT A;  5GAD C;  3HOZ B;  4XYQ A;  3GTQ B;  3HOV B;  1DOM A;  1QOH A;  3AYH B;  3H09 A;  3MFY A;  1BOS A;  2Q2T A;  1BCP B;  2F4V L;  1BBU A;  3A74 A;  1YHB A;  1I4H A;  4DV6 L;  5LMU L;  4ZUI A;  5IGD A;  4A3D H;  1DCZ A;  3GV3 A;  1QVC A;  1K3B C;  3T4A C;  3G6J B;  4H0L C;  2E2J H;  1TY0 A;  1I4G A;  2YV5 A;  3EA6 A;  1SR3 A;  2NTT A;  3NBH A;  2E2H H;  3F1Z A;  1PZK D;  4BA1 I;  3KDF B;  2KEC A;  1LTS D;  5CV7 A;  3TP6 A;  2R6G A;  4XIG S;  2VL6 A;  1EZ6 A;  3S2D H;  5E1F A;  3H3V I;  3CME A;  1QG7 A;  4GKJ L;  2KCN A;  4F8M A;  2BA1 A;  2JYO A;  1U4M A;  2XVS A;  4JV5 L;  1GUG A;  2Y0S E;  5EKL A;  5IGE A;  3BYY B;  1RIP A;  4X3T A;  3NUC A;  4A3D B;  1VQE A;  2BCO A;  4N8X 1;  5A35 A;  2ES2 A;  3C1F A;  3AMU A;  1F9S A;  1E0B A;  5FLX E;  5GAG C;  5CMD A;  4LFA Q;  2R3Z A;  2DGY A;  2E2J B;  4P72 A;  4B3T L;  1XNR L;  1CFM A;  1JOR A;  3IRB A;  2FMC A;  2K04 A;  1V1P A;  2A73 B;  5C5L A;  4DAM A;  5AJ3 L;  3M3Y H;  2E2H B;  1RF2 D;  3BZD B;  5DEH A;  2K5D A;  3S2D B;  3NTK A;  1CZW A;  2XSC A;  1VQK A;  1GD7 A;  5ELC A;  3NQT A;  3V2T A;  1VQD A;  2J7Z A;  4IUT A;  4QJF A;  3M4Y A;  1QUQ A;  1HR0 W;  1BCP D;  2UUC L;  1WCM G;  4G7Z C;  4IPG A;  2O2L D;  4JI4 Q;  5ELO A;  4IO9 A;  3PIP A;  4X6A H;  2Z0S A;  4JPB W;  4A3E G;  2ICI A;  4JW0 A;  3H6M A;  4A3F G;  2EYF A;  2DJG C;  1O7I A;  2F0U A;  4HAE A;  3D6W A;  3HOW H;  1O7Z A;  5I9P A;  1SMX A;  2EYM A;  1XTC D;  1YVC A;  1KNA A;  1AW7 A;  4X62 Q;  1E3P A;  3K58 A;  1CSQ A;  2EJF C;  4AQY L;  3CQZ H;  1FNW A;  2E2D C;  2F3I A;  5C5M A;  4DUY L;  4QF4 A;  4UPA A;  5NUC A;  3GP7 A;  5IYB G;  4BY7 G;  4MNO A;  5I2X A;  1I4X A;  2AUJ D;  5JEA J;  4R4C A;  4DUZ Q;  3QOJ A;  1IYU A;  3CCQ A;  4XYO A;  1HZA A;  4LF6 L;  4PMB A;  2EXZ A;  4GLV B;  1IHZ A;  4JK1 C;  1F2M A;  1CA6 A;  3HOW B;  5C4J H;  3CRK C;  2EPB A;  5J3B A;  4KJO A;  2EZV A;  2D62 A;  2EY5 A;  5I6W A;  1EY8 A;  2KVM A;  4OON A;  4QUC A;  4XT3 B;  4I7Z C;  4A75 A;  3CQZ B;  1LAC A;  4LFC Q;  4X64 L;  3CC4 A;  4NB3 A;  1PH5 A;  1CKN B;  4RWS C;  2UUB Q;  1BR9 A;  2G9H D;  1EL0 A;  3CW2 C;  1IW7 C;  4HTH A;  1TII D;  3A8I E;  1TT2 A;  4A3I H;  1EYA A;  3SK6 A;  3W1B A;  2Q8I B;  5C4J B;  3C46 A;  1W6J A;  3ERQ A;  1EY5 A;  4L5S A;  5LMN Q;  1CI3 M;  1IL8 A;  5CV5 A;  5LHY 1;  3C2P A;  2RCF A;  3ER0 A;  4TKO B;  3QWN A;  3GTL H;  4CKE A;  5M9O A;  4DR4 Q;  3GTM H;  1PYS B;  2KCM A;  3TRZ A;  2VB2 X;  5CBA E;  5K36 G;  2R7D A;  5GRO A;  2VQF L;  4FVM A;  4OWW B;  3AQQ A;  5IGG A;  3CPW A;  1NR2 A;  3DEO A;  5ELB A;  5JPM C;  2PMZ B;  2L1B A;  1H9S A;  2WB1 B;  1VQ5 A;  2LKV A;  3KF6 B;  4A3I B;  3VR3 A;  5D65 A;  2BA0 A;  1B7Y B;  4ME5 A;  2PI2 E;  2PI2 A;  1B3A A;  3J81 L;  2VB3 X;  4YIJ A;  4K5W A;  2L55 A;  2Z6K C;  1A3U A;  1EQQ A;  2D0O A;  3HOU H;  5C3E H;  1K8A C;  1PTO F;  3P1H A;  3GTL B;  4MHE A;  3GTM B;  3CCU A;  2E74 C;  1T5E A;  1VQG A;  3Q8D A;  4DV6 Q;  4JI5 Q;  2MHV A;  3MA2 B;  3Q23 A;  1E2Z A;  2JA7 G;  1JOQ A;  1VQ6 A;  3UI2 A;  4OO1 G;  1JOO A;  2RSN A;  3SK8 A;  1KIX A;  2B2Y C;  2IJ0 A;  1XTD A;  4L63 B;  2G5D A;  2B63 B;  4IPC A;  1PRT F;  1B50 A;  3HOU B;  1QIL A;  4DR6 L;  2BH2 A;  5C3E B;  2B2T A;  1EFW A;  3S14 H;  4KKS A;  1Q1E A;  3K81 C;  3ULL A;  1X55 A;  1ML0 D;  2NZ1 D;  5J39 A;  4JV5 Q;  2V1C C;  4XXE A;  4G7H C;  1WTW A;  5JPN C;  1S4Z A;  4R8I A;  1C48 A;  2KCC A;  3GO5 A;  1E2W A;  1B9N A;  3P7J A;  5E7N A;  4KHP Q;  4JBW A;  1K9M C;  4JI2 Q;  4DV1 L;  2LXJ A;  1PXU A;  1YJ9 A;  1PZI D;  4PV1 C;  4A3J G;  1VS0 A;  2M00 A;  1AP0 A;  5IY0 A;  3S14 B;  5CV9 A;  1QZG A;  3S1N H;  1S5B D;  4OO1 I;  2WP8 J;  1ZKO A;  5EPK A;  1NUC A;  2D5D A;  2DY7 A;  2EJG C;  2UUC Q;  2PZU A;  4IUR A;  3Q0A A;  1I3Q H;  4LUZ A;  5KND A;  1VQ7 A;  4JI3 Q;  1EIH A;  2HUG A;  1U4L A;  1Q86 C;  1DD2 A;  4JCV E;  1X54 A;  1P16 A;  1UNS A;  2F0G A;  3VYR A;  4HCS A;  3IKJ A;  4X65 L;  3OOC A;  2N8N A;  3H91 A;  1TKW B;  4GS3 A;  3T56 B;  3S1N B;  4AYB G;  2K5Q A;  4ZKB B;  2ASB A;  1T5X D;  1WCM H;  3FVQ A;  1UEB A;  3CC7 A;  2NB0 A;  3I73 A;  3F2C A;  2SNS A;  1I3Q B;  1DOK A;  2G9D A;  2XRQ D;  4A3E H;  2R7Z B;  4A3F H;  4CDC C;  1YNN C;  3STB D;  2NVT H;  4B3M L;  4IUN A;  4K2L A;  2D0P A;  4B3S Q;  3I4O A;  5K5P A;  5IT9 E;  1I50 H;  4IJL A;  3LX0 A;  2UU9 L;  4MN3 A;  5E4X A;  3RLN A;  1X6O A;  2E8G A;  3CXC A;  3HOV G;  4IPH A;  1DXM A;  4LFB L;  1TQO A;  3VR4 A;  2A74 C;  4GN5 A;  1Q7Y C;  2PW5 A;  5IYB H;  4BY7 H;  1WCM B;  5IT9 L;  2SEB D;  2B2U C;  1KL9 A;  4A3E B;  2BDN A;  3L3O C;  5J22 A;  2E5L L;  1N32 Q;  2NVT B;  5ELE A;  3CF5 A;  3DM3 A;  1VQC A;  1HNW L;  4H44 C;  1I50 B;  3RUZ A;  2RHS B;  5FK9 C;  1E24 A;  5FO7 B;  5JOB A;  2LSS A;  2B8F A;  2JA6 G;  4F7X A;  4DV7 L;  2K4K A;  4C3I G;  4DA2 A;  3R3O A;  4IFD I;  4FXG C;  3S1M H;  4R1J A;  1J5E Q;  4A3M G;  2ZTD A;  3KUP A;  4XTC S;  4UP9 A;  4KD3 A;  1EIF A;  3I72 A;  5DNF A;  1G51 A;  1WJJ A;  1EEI D;  1G29 1;  1WVL A;  2LXK A;  5FKA C;  3S16 H;  1E2V A;  1A62 A;  4IPD A;  4P2C B;  4ZQ3 A;  1V1Q A;  1HH2 P;  1VQF A;  3CC2 A;  3EIV A;  1K28 A;  5FO8 B;  4A3B B;  2ZM6 Q;  1D5Z C;  3IL8 A;  3RZD H;  2IW3 A;  1IBK Q;  1WTV A;  3S1M B;  3T51 B;  1PLF A;  1SN8 A;  5K36 H;  1YJW A;  3NEL A;  4C56 C;  4WJW A;  5KYI A;  1D8L A;  3S16 B;  1SYE A;  5AFW A;  4JVZ A;  3S1Q H;  2I5L X;  3SK4 A;  5FLX c;  5LMN W;  3EN2 A;  1M4V A;  3I4L A;  3A0J A;  1F2L A;  4IOA A;  1J8I A;  1Q8K A;  2F0P A;  2VS1 A;  4R8N A;  4UAI A;  5HGT A;  1ESF A;  1MHW C;  3SK5 A;  1LV9 A;  3OMG A;  3M4Q A;  2JA7 H;  2K5N A;  4LFA L;  1VQB A;  4FF1 A;  3NK9 A;  3NHH A;  4OO1 H;  3KF6 A;  4BS9 A;  1L1O C;  1PMR A;  1IKM A;  2EY6 A;  3S1Q B;  1FVI A;  2OEO A;  4PNY A;  1U4R A;  1LT4 D;  3KLS X;  4KN7 C;  4IOC A;  2IHF A;  2A68 D;  4ZUJ A;  4HN7 A;  1PRT B;  3CAM A;  3U58 A;  2RVL A;  3K5M A;  1PH7 A;  3NEN A;  2Z6B A;  2K32 A;  1EUJ A;  1E22 A;  1IBM Q;  4JI4 L;  1KHI A;  2JXM B;  1WTH A;  2O4X A;  2JA7 B;  2KOL A;  2FXQ A;  2K05 A;  4DPG A;  1JWS D;  3OPO A;  3ULP A;  1RTN A;  2F0M A;  2EE1 A;  3URY A;  2PZT A;  1OTC A;  1KRT A;  2ZJP A;  1MSG A;  1MIU A;  3TP8 A;  4KKU A;  2PQE A;  3CD6 A;  2BDO A;  3NQI A;  1JE5 A;  1VQ9 A;  4A3J H;  1FJG Q;  4CBV A;  4X62 L;  2UXC Q;  1B8A A;  1ZYR C;  1SYB A;  3Q24 A;  1U0L A;  1STE A;  3T13 A;  1UE7 A;  1HNZ L;  2EYL A;  4QIW B;  4TSS A;  4XDX A;  2PW7 A;  1PTO D;  3VDY A;  4X66 Q;  2PQA B;  3MXU A;  3CU7 A;  4NW2 A;  1Y8N B;  3I2Z A;  2N88 A;  2R92 G;  5EPJ A;  1QVG A;  5C4H A;  1EFI D;  1GUW A;  1SYG A;  1B44 D;  4EQO A;  3IFT A;  4HJ8 A;  3HKZ G;  4HJ5 A;  1OXU A;  2F03 A;  1HHV A;  3U4Z A;  3RN5 A;  4A3J B;  1Q90 A;  1BUV T;  1Q12 A;  2XNA C;  4CDD C;  4B3R Q;  4LFC L;  3HRZ C;  3RLF A;  1SYD A;  3CHB D;  5KRU A;  1KRS A;  4FO2 A;  3B6Y A;  1PRT D;  1W6K A;  3S1R H;  1F9Q A;  2F0L A;  2UUB L;  4B9W A;  5EBD A;  4DN4 M;  2E76 C;  4P75 A;  1BVS A;  1QCB D;  4RHR A;  1CK1 A;  3TS2 A;  4KI0 A;  1WTX A;  3EJI A;  2QF7 A;  3J81 c;  5M3M G;  3L7Z C;  5LMN L;  2B63 G;  4GNX A;  1HNW Q;  1HZB A;  1B3Q A;  1TWH H;  3CCJ A;  3RZO H;  4DV0 Q;  4Q0F A;  4NP5 A;  2ZXR A;  3HOV H;  5IGB A;  1JOK A;  1DGS A;  2GVB A;  4UHV A;  1STH A;  4DR4 L;  1YNJ D;  1VQ4 A;  3MXG A;  4AYB B;  1LYL A; 
#chains in the Genus database with same CATH homology
 1BDO A;  2VNU D;  3S1R B;  2MPM A;  4HR7 B;  1AEX A;  1DON A;  2B39 A;  1GHJ A;  1Q8I A;  3G7L A;  4K8I A;  4KN4 C;  2IX1 A;  3K6O A;  1WD0 A;  1TWH B;  3RZO B;  2LY7 A;  2F0O A;  4B9X A;  4C1N I;  4K5X A;  1YNN D;  3BVM A;  2LFN A;  4DAV A;  3TME A;  4BWG B;  1CZG A;  2F0T A;  4F88 A;  1WTR A;  1RJT A;  3KK7 A;  5CC4 A;  1TWC B;  2L11 A;  3K0Y A;  5D14 A;  2J0T D;  1G91 A;  3P20 A;  3R8B A;  1SNP A;  1F2Z A;  2NUC A;  1L0Y B;  3FEW X;  1BF4 A;  2JA6 B;  1EYD A;  3H3V C;  4C3I B;  1BXT A;  4A3M B;  1FD7 D;  1HPC A;  4RCN A;  4C3H G;  4RAU C;  2YYZ A;  1KLU D;  3N52 A;  4M8A A;  2B2W C;  5T1I A;  1SE2 A;  2M9V A;  1STN A;  1D6E C;  1LAB A;  3HOX B;  3I91 A;  4X3K A;  5ELF A;  1O78 A;  2F0E A;  4BA2 I;  3QJY A;  3DWQ A;  1SSO A;  1EIG A;  1TU2 B;  3NXW A;  3GTG B;  1HCZ A;  1O80 A;  1KDB A;  2F0N A;  3PIO 3;  2CHB D;  5DM7 3;  3LNN A;  1H9K A;  3R2T A;  3SHL A;  1D2B A;  1ILP A;  2KED A;  3HEJ A;  2RKS A;  1XXG A;  2ZXP A;  3I8Z A;  5M5X B;  2HCC A;  2MJ8 A;  1PFB A;  3AU7 A;  1Y8P B;  1HUM A;  1HA6 A;  4RA8 A;  4IUP A;  1JR0 D;  4C3J G;  2BE5 C;  1I4P A;  1WTO A;  1HRJ A;  4FXD A;  2JA8 B;  3MVV A;  1CT1 D;  4B08 A;  5CGK A;  2Z1C A;  1U4P A;  3HGB A;  1U9R A;  5COR A;  5C4X B;  2QIL A;  2FHT A;  3EQL C;  5KEE A;  5KNB A;  1DYQ A;  1QB5 D;  3DUZ A;  1AZQ A;  1F9P A;  2OXP A;  1G2T A;  5D3I B;  1KTK A;  1SXT A;  3KBG A;  5E3F A;  1C4Q A;  2X69 A;  1R9T B;  3J81 E;  2ZXO A;  2K7V A;  2A68 C;  1ZYR D;  1VCI A;  2GA4 B;  2R92 B;  1HXY D;  3MHB A;  1X3P A;  4PMW A;  4K5V A;  3PUV A;  3HKZ B;  3PO3 B;  3GD7 A;  2CW0 D;  2O5I C;  1SDF A;  2BOS A;  2JE6 I;  3L9A X;  2RDG A;  2RSO A;  3TP5 A;  1SND A;  2KHS A;  3W2D A;  3MXN A;  1M8A A;  2NVY B;  3D4D A;  5M3M B;  2NWG A;  1CHQ D;  2A69 D;  4HMJ A;  2FMM A;  5KGU A;  4RKL A;  1PTO C;  4U67 3;  2PO4 A;  2XRS D;  1D1K A;  4H7B A;  1CTM A;  3TZU A;  1VMC A;  2KJX A;  2C9O A;  4J6H A;  4RGT A;  3WOF A;  1A2T A;  1RKN A;  3GTK B;  4CKB A;  3X3N A;  4EVO A;  3HG9 A;  1PRT C;  4V19 0;  2QEJ C;  5C0X G;  1G6Z A;  1JQY D;  3DWA A;  2NBF A;  3DWP A;  4RGM A;  1Q3L A;  3FDT A;  3FKI B;  1A15 A;  5C6A A;  3N6R A;  5A2Q E;  4ODG A;  2B2V C;  3D6C A;  4A93 B;  1D1I A;  2HCI A;  1F9R A;  5BN5 A;  1YNJ C;  5A2Q L;  3SE0 A;  5EPL A;  1XX8 A;  4WRD A;  1EU3 A;  3S17 B;  4K8J A;  3I4N B;  1LTR D;  3PIP 3;  3BDL A;  4CJ1 B;  1BNZ A;  2CVR A;  4C3H B;  3S2H B;  1D5X C;  1A3V A;  1LTB D;  4M1U B;  4IFD G;  5C0X I;  3E0J A;  5BN3 A;  3HOY B;  3WDN A;  5JVG 3;  4BBS B;  5I4D A;  1STB A;  5IOC A;  4XT1 B;  1R4P B;  1Y69 U;  2WII B;  2SNM A;  1QWY A;  5C3W A;  1O7Y A;  1OXS C;  1Y1W B;  1ROD A;  1S5C D;  2F0K A;  4S3S A;  5JJZ A;  1K83 B;  2LS0 1;  3OW7 A;  1CM9 A;  2QCP X;  4XQQ A;  2CQA A;  3H0G B;  1NSN S;  5JVH 3;  4WOR A;  4QUF A;  3FRP B;  1FGB D;  3A54 A;  2O5J C;  1O7L A;  3PO2 B;  2Q8R E;  1LT3 D;  5G3L F;  2RDH A;  2I07 B;  1Y8O B;  2EVB A;  1PFM A;  2MP1 A;  3OIQ A;  5BN4 A;  5FOB B;  3DHQ A;  1QNU A;  2TSS A;  4KV6 A;  1LTG D;  4MIU A;  4Q5V A;  1S5F D;  1Y1V B;  4CHT B;  3AB9 A;  3KLS A;  4LK1 C;  1H9M A;  1Z7T A;  4C3J B;  1SE3 A;  3RMH A;  1IKL A;  2PCF B;  4R9W A;  1XWE A;  3M4O B;  3D4W A;  2NN6 I;  2BE5 D;  3SDZ A;  1GHK A;  4CJ2 C;  1PTO H;  2XN9 C;  2SOB A;  2MGS A;  1LTA D;  2D9U A;  5M5W B;  1V1P B;  5F2D A;  3KLR A;  2WAC A;  5T1G A;  1ICW A;  1VMP A;  4G4K A;  4KY6 A;  2Z8L A;  1RHP A;  2Q8T A;  1TWG B;  1EEF D;  1B9M A;  1GUN A;  1BBX C;  1EYC A;  2B8G A;  1PTO B;  3KBX A;  2EOT A;  4CKC A;  3X3M A;  4RCO A;  1GUT A;  2D2C C;  1V43 A;  5JEA G;  4HSP A;  1H9R A;  3Q6S A;  2SDF A;  1CA5 A;  1UEA B;  1SYF A;  1Z6H A;  4Z9C B;  1DOL A;  2TMP A;  4FNF A;  5IGF A;  3QG1 A;  5IIF A;  3NSW A;  2VUM B;  4IUU A;  1MSH A;  4KKT A;  5KIX A;  4DU9 A;  2DN8 A;  2EYJ A;  1EY9 A;  1EY4 A;  3FPP A;  2WIN B;  1PYW D;  2V4D A;  3A7A B;  3NPP A;  4EQN A;  3HZX A;  3M7G A;  4A3G B;  2X6G A;  5JAV A;  1TS4 A;  1TVX A;  3OWE B;  2F0W A;  1LT6 D;  4ZRZ A;  4E6I A;  4QB4 A;  5C0X H;  3H94 A;  4F87 A;  1ENF A;  5EKK A;  3MXP A;  1EY6 A;  4L6T B;  2R93 B;  2DY8 A;  2WV6 D;  3A55 A;  3A8J E;  2CW0 C;  1I4R A;  3BDO A;  2B2W A;  1VF7 A;  3S9W A;  2DNC A;  3SVM A;  4C2M B;  1GOZ A;  4FP5 D;  2N55 A;  1LO5 D;  4ABN A;  1DM0 B;  1H9S B;  1S5E D;  2A69 C;  3BS1 A;  1ENC A;  1MBY A;  4IFD H;  4Y7N B;  4I65 A;  3U9O A;  4HED A;  1B4O A;  5CV4 A;  4V0B A;  2Z4H A;  1EY0 A;  5EJW A;  4CGY B;  5C44 B;  3SEB A;  2AQ2 B;  1LT5 D;  4KD4 A;  3BYT B;  4RGO S;  1TS3 A;  5LL6 S;  4RFB A;  1TY2 A;  3J80 L;  3OWF A;  2L9H A;  4ILW A;  1HFG A;  3MZ5 A;  3C3L A;  1KDA A;  1XYI A;  1S5D D;  1LLR D;  1ESR A;  4QCL A;  5M5Y B;  3Q22 A;  1PZJ D;  5I6Y A;  3PUX A;  1JB3 A;  1DZ1 A;  4L8J A;  3KF8 A;  3E5S A;  1OXT A;  4DAY A;  5M3F B;  3A8K E;  4ZYS A;  1K8O A;  1SAP A;  5DAU A;  3EFX D;  3RD4 A;  3BVZ A;  3LWE A;  3TSS A;  2EY2 A;  2Z4I A;  3VYT A;  4ULL A;  3TP7 A;  4DXG A;  3GQB A;  3M7N A;  1AFP A;  1ZXT A;  4IUV A;  1ZEQ X;  5COY A;  4OHJ A;  1KDC A;  3K59 A;  4OIJ A;  3PUZ A;  1QJO A;  4KHZ A;  4K6D A;  3OSO A;  4ID6 A;  2EYO A;  1GUO A;  1UUP A;  1ENA A;  3K5L A;  2JA5 B;  1AN8 A;  1V1O A;  3FMC A;  4DAP A;  1QNK A;  4J8Q A;  2F1M A;  4U68 A;  5G3L D;  1KAA A;  2M2L A;  5CBE E;  2KEE A;  1LTI D;  3VR5 A;  4O42 A;  1HTP A;  3NTI A;  3VA7 A;  3D31 A;  4XQN A;  2MUY A;  5JEA H;  2F0Q A;  2ID0 A;  3TZD A;  4DNR B;  2KA7 A;  1KAB A;  4QMG A;  5FLX L;  1WD1 A;  2EDG A;  5KNC A;  2B2Y A;  1EQV A;  3OHX C;  1HTL D;  4DXF A;  2RBM A;  1RTO A;  3JAM E;  4K6L A;  2AUK A;  1SBB B;  1EWH A;  1MD2 D;  3QIA A;  5KYL A;  2ENB A;  3I3C A;  2ICE C;  4ZAI A;  2WAQ B;  3M3Y B;  1SNQ A;  3ZYY X;  2QKI C;  2A6E D;  3JAM L;  1STA A;  4RHS A;  2K1B A;  3CKI B;  2RDF A;  1HUN A;  3E6Z X;  2J4X A;  2F0J A;  2L5T A;  5C3X A;  1BO0 A;  2K6A A;  3MFG A;  4DF7 A;  1HFN A;  5IGC A;  4EQP A;  1K8M A;  1EY7 A;  5CYU A;  2XWB B;  1LTT D;  2OT2 A;  2B2V A;  2NTS A;  1STG A;  4J1M A;  3FPU B;  2AQ3 B;  3SR1 A;  5TSS A;  3ITP A;  3TN2 A;  3NWT A;  2F0F A;  3TBI B;  2JSO A;  1OXV A;  2LMC B;  1I6H B;  3VR6 A;  5E4W C;  1EWC A;  2JEA I;  2F0V A;  1PFN A;  4WFN 3;  3M85 A;  1VDZ A;  5CV8 A;  3QO2 A;  3K7A B;  2F4I A;  3R2I A;  4IQZ A;  3W3A A;  1CHP D;  3P75 A;  5J1Z A;  3R93 A;  4IAL A;  2K33 A;  1Z47 A;  3PUY A;  4G7O C;  1FR3 A;  1AZP A;  1FNV A;  4ZLT F;  2R61 A;  3S15 B;  4NMZ A;  3TDQ A;  1EOT A;  2F0H A;  2FIN B;  1SNC A;  5EBC A;  2B2U A;  4X3S A;  4PMC A;  5FO9 B;  4KTA A;  1HQM C;  4LMQ D;  5I9O A;  1R4Q B;  3J7Y W;  1HA5 A;  1SYC A;  1EZ8 A;  4DK0 A;  1SMY D;  5HUR A;  4BBR B;  1JWM D;  2K5W A;  4IUQ A;  3ND9 A;  3NP8 A;  4G57 A;  2DNE A;  4A3K B;  3I4M B;  2OF1 A;  2F0I A;  4XQJ A;  1TWF B;  1ET6 A;  1G8Z D;  3D4R A;  1V8Q A;  1GJX A;  2RQX A;  2X6L A;  2ZT9 C;  3T16 A;  4FYD A;  3J7A V;  3BVG A;  4OIK A;  2A6H C;  4EGV A;  2EJM A;  2QDB A;  2IPK D;  2PZW A;  1NCV A;  4DFA A;  2XIW A;  1B2T A;  4HCE A;  5I2Y A;  1OXX K;  1IYV A;  1C8C A;  2L0C A;  1FYC A;  1UAP A;  3ND8 A;  1KLG D;  2EY1 A;  4RH6 A;  3PUW A;  3NWS A;  1X32 A;  4NKL A;  4TRD A;  4OGQ C;  1TWA B;  1JC7 A;  4IN3 A;  1A6X A;  3I90 A;  3GTJ B;  2C5C A;  3IAY A;  3QB3 A;  5C4Z A;  1F77 A;  1JE4 A;  4N9T A;  1GXD C;  1RDP D;  2NVX B;  3VYU A;  1WTP A;  2NN6 G;  2IX0 A;  4K14 A;  1TR5 A;  1JCK B;  2AQ1 B;  3T53 B;  3A56 A;  2FJ2 A;  3MAQ A;  1II3 A;  3SXH A;  3ERO A;  2AWO A;  2HQE A;  4A3F B;  3BDC A;  4RKB A;  2PPB C;  2NVQ B;  3NE5 B;  5IOD A;  2B2T C;  1JIC A;  4ZKC B;  4CJ0 B;  5EQ0 A;  3HP3 A;  1BCP F;  1X3Q A;  2F3V A;  1RD9 D;  2IL8 A;  3OMC A;  2PYK A;  3VYS A;  3U9S A;  5DM6 3;  2F3W A;  3DMU A;  2Y0S B;  4BY7 B;  2IT1 A;  2F0S A;  1KNE A;  1BQQ T;  4KMU C;  2RA4 A;  3D8G A;  1NR4 A;  4KY7 A;  4FXK C;  2E75 C;  4KJN A;  2KUM A;  3A7L A;  3F2U A;  2VXW A;  1BCP C;  4H13 C;  1SJH D;  1SNO A;  4X3U A;  1F2Y A;  1H9J A;  1JWU D;  2XWJ B;  4HSV A;  5D3D A;  1DJR D;  1G2S A;  1B53 A;  1STY A;  2AWN A;  1CQF A;  3HS0 C;  1Q1B A;  3EVQ A;  3OIP A;  4IZ8 A;  3C1E A;  4FF4 A;  1SEB D;  3NTH A;  2A6E C;  1SE4 A;  4TQU S;  2K28 A;  1OO9 B;  4DNT B;  1NAP A;  5CV6 A;  1QE6 A;  3MC0 B;  2K03 A;  1IW7 D;  1CQV A;  3V05 A;  4LAA A;  1FNU A;  2WKD A;  2E2I B;  3RZD B;  1ILQ A;  1EU4 A;  3PV0 A;  3K5N A;  4K2K A;  3DXJ C;  2EYP A;  1A2U A;  3BG3 A;  3I70 A;  4LJZ C;  1EQT A;  3DEP A;  4O1N A;  3MWY W;  4KK7 A;  3D3R A;  1RCV D;  1PDQ A;  3MTS A;  3QOL A;  2HDM A;  4HMI A;  4KHV A;  3GTO B;  1SJE D;  2L4N A;  1J9O A;  2I46 A;  3O13 A;  1VF5 C;  3NBI A;  4N9P A;  3V96 A;  1D5M C;  1SFO B;  3LWU A;  3MEH A;  2EYH A;  4UDU C;  1L0X B;  5CR3 A;  3ONA B;  5LL6 X;  1A3T A;  4FF2 A;  2FFK B;  4C1N K;  2H1E A;  5ELD A;  2JP1 A;  2IX3 A;  1ET9 A;  1HQR D;  4FF3 A;  5C0X J;  1GUS A;  2JEB I;  2A5H A;  4RGN A;  1B1Z A;  3J80 E;  3VR2 A;  1SMY C;  2PNR C;  2H4O A;  3J7A F;  2NYZ D;  2K01 A;  4OL7 A;  1I4Q A;  4BY1 B;  2A6H D;  2KQ3 A;  1TS2 A;  5EKI A;  2F0D A;  3K5O A;  2WKC A;  2NN6 H;  2YU9 B;  3PMF A;  5ISR A;  3WOE A;  1ONL A;  1SNM A;  1I6V C;  3K57 A;  4DGZ A;  3GTP B;  3IFD A;  1WTQ A;  4GZY C;  3CRL C;  3VA5 A;  2L12 A;  4DK1 A;  4PQX A;  4IFD J;  1MGS A;  3DM1 A;  3GV6 A;  2HDL A;  4KY5 A;  1MI2 A;  4ZK9 B;  4NDX A;  2IWH A;  1TS5 A;  5EGT A;  3HOZ B;  4XYQ A;  3GTQ B;  3HOV B;  1DOM A;  1QOH A;  3H09 A;  3MFY A;  1BOS A;  1BCP B;  1I4H A;  4ZUI A;  5IGD A;  1DCZ A;  3GV3 A;  3T4A C;  3G6J B;  4H0L C;  1TY0 A;  1I4G A;  3EA6 A;  2NTT A;  3NBH A;  1PZK D;  4BA1 I;  2KEC A;  1LTS D;  5CV7 A;  3TP6 A;  2R6G A;  4XIG S;  1EZ6 A;  5E1F A;  1QG7 A;  2KCN A;  4F8M A;  2BA1 A;  2JYO A;  1U4M A;  2XVS A;  1GUG A;  5EKL A;  5IGE A;  3BYY B;  4X3T A;  3NUC A;  4A3D B;  2BCO A;  5A35 A;  3C1F A;  3AMU A;  1F9S A;  1E0B A;  5FLX E;  5CMD A;  2R3Z A;  2E2J B;  1CFM A;  1JOR A;  2FMC A;  2K04 A;  1V1P A;  2A73 B;  5C5L A;  2E2H B;  1RF2 D;  3BZD B;  5DEH A;  2K5D A;  3S2D B;  3NTK A;  1CZW A;  2XSC A;  5ELC A;  3NQT A;  3V2T A;  2J7Z A;  4IUT A;  3M4Y A;  1BCP D;  4G7Z C;  2O2L D;  2ICI A;  3H6M A;  2EYF A;  2F0U A;  4HAE A;  3D6W A;  1O7Z A;  5I9P A;  2EYM A;  1XTC D;  1KNA A;  1AW7 A;  3K58 A;  2EJF C;  1FNW A;  2E2D C;  5C5M A;  4QF4 A;  5NUC A;  3GP7 A;  5I2X A;  1I4X A;  2AUJ D;  5JEA J;  3QOJ A;  1IYU A;  4XYO A;  4PMB A;  2EXZ A;  1IHZ A;  4JK1 C;  1F2M A;  1CA6 A;  3HOW B;  3CRK C;  2EPB A;  4KJO A;  2EZV A;  2D62 A;  2EY5 A;  5I6W A;  1EY8 A;  2KVM A;  4XT3 B;  4QUC A;  4I7Z C;  3CQZ B;  1LAC A;  4RWS C;  1BR9 A;  2G9H D;  1EL0 A;  1IW7 C;  4HTH A;  1TII D;  3A8I E;  1TT2 A;  1EYA A;  3SK6 A;  2Q8I B;  5C4J B;  3C46 A;  1W6J A;  3ERQ A;  1EY5 A;  1CI3 M;  1IL8 A;  5CV5 A;  5LHY 1;  3C2P A;  4TKO B;  3QWN A;  4CKE A;  5M9O A;  2VB2 X;  5CBA E;  5K36 G;  4FVM A;  5IGG A;  1NR2 A;  3DEO A;  5ELB A;  5JPM C;  2PMZ B;  2L1B A;  1H9S A;  2WB1 B;  2LKV A;  4A3I B;  3VR3 A;  5D65 A;  2BA0 A;  4ME5 A;  1B3A A;  3J81 L;  2VB3 X;  4YIJ A;  4K5W A;  2L55 A;  1A3U A;  1PTO F;  3P1H A;  3GTL B;  4MHE A;  3GTM B;  2E74 C;  1T5E A;  2MHV A;  3MA2 B;  3Q23 A;  1E2Z A;  1JOQ A;  3UI2 A;  4OO1 G;  1JOO A;  2RSN A;  3SK8 A;  2B2Y C;  2IJ0 A;  4L63 B;  2B63 B;  1PRT F;  1B50 A;  3HOU B;  1QIL A;  5C3E B;  2B2T A;  4KKS A;  1Q1E A;  1ML0 D;  2NZ1 D;  5J39 A;  4XXE A;  4G7H C;  1WTW A;  5JPN C;  1S4Z A;  4R8I A;  1C48 A;  2KCC A;  3GO5 A;  1E2W A;  1B9N A;  3P7J A;  4JBW A;  1PXU A;  1PZI D;  4PV1 C;  2M00 A;  1AP0 A;  3S14 B;  5CV9 A;  1S5B D;  4OO1 I;  2WP8 J;  1ZKO A;  5EPK A;  1NUC A;  2D5D A;  2DY7 A;  2EJG C;  2PZU A;  4IUR A;  3Q0A A;  5KND A;  1EIH A;  2HUG A;  1U4L A;  1DD2 A;  1UNS A;  2F0G A;  3VYR A;  4HCS A;  3IKJ A;  3OOC A;  3H91 A;  1TKW B;  3T56 B;  3S1N B;  2K5Q A;  4ZKB B;  1T5X D;  3FVQ A;  2NB0 A;  3I73 A;  2SNS A;  1I3Q B;  1DOK A;  2G9D A;  2XRQ D;  2R7Z B;  1YNN C;  4IUN A;  4K2L A;  5K5P A;  5IT9 E;  3LX0 A;  4MN3 A;  5E4X A;  1DXM A;  1TQO A;  3VR4 A;  2A74 C;  2PW5 A;  1WCM B;  5IT9 L;  2SEB D;  2B2U C;  4A3E B;  2BDN A;  3L3O C;  5J22 A;  2NVT B;  5ELE A;  4H44 C;  1I50 B;  3RUZ A;  5FK9 C;  5FO7 B;  5JOB A;  2B8F A;  4F7X A;  4C3I G;  4DA2 A;  3R3O A;  4IFD I;  4FXG C;  3KUP A;  4XTC S;  4KD3 A;  3I72 A;  5DNF A;  1EEI D;  1G29 1;  1WVL A;  5FKA C;  1E2V A;  4P2C B;  4ZQ3 A;  5FO8 B;  4A3B B;  1D5Z C;  3IL8 A;  2IW3 A;  1WTV A;  3S1M B;  3T51 B;  1PLF A;  5K36 H;  4C56 C;  4WJW A;  5KYI A;  3S16 B;  1SYE A;  5AFW A;  3SK4 A;  1M4V A;  3I4L A;  1F2L A;  1J8I A;  2F0P A;  4R8N A;  5HGT A;  4UAI A;  1ESF A;  3SK5 A;  1LV9 A;  3OMG A;  4FF1 A;  3NK9 A;  3NHH A;  4OO1 H;  4BS9 A;  1PMR A;  1IKM A;  2EY6 A;  3S1Q B;  4PNY A;  2OEO A;  1U4R A;  1LT4 D;  3KLS X;  4KN7 C;  2A68 D;  4ZUJ A;  4HN7 A;  1PRT B;  2RVL A;  3K5M A;  2K32 A;  2JXM B;  2O4X A;  2JA7 B;  2KOL A;  2K05 A;  1JWS D;  3OPO A;  1RTN A;  2F0M A;  2EE1 A;  3URY A;  2PZT A;  1MSG A;  3TP8 A;  4KKU A;  2PQE A;  2BDO A;  3NQI A;  4CBV A;  1ZYR C;  1SYB A;  3Q24 A;  1STE A;  3T13 A;  2EYL A;  4QIW B;  4TSS A;  4XDX A;  2PW7 A;  1PTO D;  3MXU A;  3CU7 A;  4NW2 A;  1Y8N B;  2N88 A;  5EPJ A;  5C4H A;  1EFI D;  1GUW A;  1SYG A;  1B44 D;  4EQO A;  3IFT A;  2F03 A;  1OXU A;  1HHV A;  4A3J B;  1Q90 A;  1BUV T;  1Q12 A;  2XNA C;  3HRZ C;  3RLF A;  5KRU A;  1SYD A;  3CHB D;  4FO2 A;  1PRT D;  1W6K A;  1F9Q A;  2F0L A;  4B9W A;  5EBD A;  4DN4 M;  2E76 C;  1QCB D;  4RHR A;  1CK1 A;  4KI0 A;  1WTX A;  3EJI A;  2QF7 A;  3L7Z C;  4Q0F A;  4NP5 A;  2ZXR A;  5IGB A;  1JOK A;  1STH A;  1YNJ D;  3MXG A;  4AYB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...