2NYZD

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the c- chemokine xcl1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
DKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
molecule tags Viral protein/cytokine
molecule keywords Hypothetical protein GAMMAHV.M3
total genus 7
structure length 61
sequence length 61
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nyzD00
3IFDA 2FJ2A 1EQTA 3R93A 2HDMA 1RTNA 1CA6A 2K03A 4RAUC 2KECA 1HHVA 2RVLA 3H91A 1A15A 4MHEA 1J9OA 1F9SA 1QNKA 2K01A 1B2TA 2NZ1D 3GV3A 1F9RA 2KUMA 3KUPA 1G6ZA 4XT3B 1KNEA 4RA8A 3MWYW 5EKIA 2KEDA 2B2VA 1HRJA 4NW2A 3FDTA 2KVMA 3DM1A 4IUUA 1M8AA 1ICWA 2L11A 5E4WC 1XYIA 1EIGA 2DY8A 1B4OA 1BNZA 1AZPA 1F9PA 2N55A 2X6LA 3I90A 1CA5A 1G2SA 2VXWA 1WTOA 3I8ZA 4CJ1B 2L9HA 1IKLA 2CVRA 4IUTA 2FMMA 2Q8TA 3TZDA 4CJ0B 1PFMA 1AZQA 2B2UC 1O80A 1ILPA 4O42A 2H1EA 2NYZD 4CJ2C 2B2UA 4XDXA 2BDNA 4X3SA 1X3QA 4LMQD 2MJ8A 1HFNA 5EQ0A 1PLFA 1RJTA 4IUPA 5CORA 4ZKCB 5CMDA 1WTXA 1EL0A 4UAIA 1MSHA 1KNAA 1RODA 2D9UA 1B53A 3I3CA 2KOLA 1WD0A 2K04A 4R8IA 4U68A 1WVLA 3TN2A 1B3AA 4ZK9B 1JE4A 4IUQA 4ZKBB 1LV9A 5EJWA 2B2WC 2N88A 1NAPA 2JP1A 1NR2A 4OIJA 1IKMA 4DN4M 1O7ZA 1ML0D 1QG7A 2FINB 2MGSA 3ONAB 2B2WA 1HUNA 2NWGA 3P7JA 1HA6A 3IL8A 4QUFA 1EIHA 2DY7A 2K05A 4MN3A 1O7YA 1DOMA 1NCVA 2B2YA 2HCIA 1DZ1A 1QE6A 5CBEE 5DNFA 1RHPA 2FHTA 2L4NA 3QO2A 1DOLA 5T1IA 2K1BA 4X3UA 2X6GA 5AFWA 5EPJA 5D14A 2EE1A 1G2TA 1JICA 3HP3A 1BO0A 1F2LA 1ESRA 3FPUB 2Q8RE 1SDFA 3LWEA 1U4RA 2HUGA 1MSGA 1U4PA 2X69A 4IUVA 4QUCA 3SVMA 2MPMA 4X3TA 5COYA 4ZLTF 3F2UA 5E4XA 3GV6A 1Q3LA 2IL8A 2L12A 2RA4A 3N52A 1WTVA 1IL8A 3Q6SA 3KBXA 1RTOA 1PFBA 3DEPA 4HCSA 5EPLA 2B2TA 1MGSA 2B2VC 1X3PA 2J7ZA 2EOTA 1WTWA 1WTPA 2HCCA 1BBXC 1CM9A 4HAEA 3G7LA 2B2TC 4RWSC 1B50A 1DONA 4ZAIA 2EPBA 1WTQA 1GUWA 1MI2A 1VMCA 1XX8A 4HSVA 4X3KA 2MP1A 2JYOA 2HDLA 2RSNA 1HFGA 1TVXA 1U4MA 1ILQA 3DEOA 5D65A 1F9QA 1NR4A 3D6WA 1S4ZA 1ZXTA 2XIWA 2L1BA 4IURA 4XT1B 3UI2A 2M2LA 3MTSA 1U4LA 2RSOA 1J8IA 1DOKA 1SSOA 1X32A 1AP0A 1SAPA 5JJZA 1WTRA 1BF4A 1E0BA 1EOTA 3I91A 4R9WA 4OIKA 1VMPA 2K28A 4HEDA 5EPKA 5T1GA 5CBAE 1G91A 1HUMA 2B2YC 2R3ZA 2SDFA 1C8CA 1PDQA 2KEEA 2FFKB 1WD1A 1PFNA
chains in the Genus database with same CATH superfamily
1PHJA 1R4PB 2Z8LA 5BR8L 1UNSA 4R1JA 1A15A 2K01A 3T1YQ 2IHFA 5I2XA 1QVCA 2NZ1D 4KY6A 3QJYA 4FP5D 1F9RA 2D0OA 2F0JA 3EA6A 2JXMB 3H09A 2HD3A 5JVG3 1XMOL 3TREA 1IBMQ 4DUYQ 1SLJA 1A62A 2E2IH 1IL2A 3RD4A 4IPGA 1B4OA 3GP7A 1F9PA 3S2DB 2A6EC 2X6LA 4C1NK 3RN5A 1RDPD 1VQGA 1F2YA 4BA2I 5IYBG 1FVIA 4CJ0B 3NXWA 5G3LD 3HZXA 5C0XG 5TSSA 4GLXA 2MQHA 4GLAC 2PQAB 4XDXA 1O78A 3NBHB 4X3SA 3GTOH 4YHHQ 1TWGB 1LLRD 4IOAA 1V8QA 3EFXD 3OWEB 1B53A 1X6OA 3I55A 1BBWA 1EYDA 1HPCA 1SNMA 2UXCQ 4C3JB 1L0YB 4YY3Q 4JI5Q 1XPRA 3JAMi 4OIJA 1CUKA 4A3MH 3M7NA 1I3QB 4O1NA 1HUNA 4CKCA 1IYUA 4C3HB 2B39A 1YNNC 5LL6X 4X62L 2QEJC 2DY7A 4NKLA 3NTHA 3U9OA 5C4HA 3QO2A 4X3UA 2A5HA 3KK7A 1I4PA 3I4MB 5M3FB 3FVQA 1W6JA 4OXPA 2SNMA 2HUGA 2UUCQ 4RKBA 4IUVA 2PNRC 2Y0SE 4KKTA 3VDYA 3HOYG 3IKJA 3TMEA 5COYA 4IJHA 5BR8Q 4BBRG 3P1HA 1HNWL 3M3YB 4BBRB 4JI4Q 4G7OC 4X64Q 5DM63 4FDBA 2R7FA 1H9KA 3ZJYC 4C1NI 3TS0A 4X3KA 4ZQ3A 5FLMG 4A3EG 1O7IA 2O2LD 1K83H 1OXTA 2WIIB 1I4RA 3J7AF 2OEOA 2WAQG 3ND9A 1GJXA 4DXGA 3P20A 4DAPA 4PMBA 5IGDA 3QG1A 1IBKQ 4XYOA 1BF4A 3HOUG 3I91A 5ISRA 1I6HB 1F2MA 4DUYL 2SDFA 3K5OA 3OMGA 4HIOA 1QILA 1Q86C 2RKSA 2FJ2A 2NB0A 3LX0A 4PQXA 3H91A 1B2TA 2NVYH 1TU2B 5I9OA 1AE2A 1VDZA 4RGMA 2BA1A 1X3GA 4BY7B 1EY0A 1D1IA 2B8FA 4A75A 1PTOD 2VXWA 4GNXC 1PFMA 5K36G 2TMPA 5FLMH 2GA4B 5I2YA 1DM0B 3BYTB 1EL0A 1G51A 1PRTB 2R7ZH 2KOLA 2VUMG 2CFMA 3FP9A 3RZOH 2K4KA 2UUAL 1XTDA 1WVLA 3BVZA 5C44B 3SGIA 1NAPA 3P7JA 3N6RA 1BKBA 1PMRA 3I73A 1LTGD 1STNA 1DXMA 1O7LA 4IALA 3PO3H 2OXPA 1RHPA 2L4NA 3D4DA 3K0YA 5EAYA 2BE5C 3PIPA 3CCLA 2JK8A 3K5NA 2AWNA 2HT1A 2Q8RE 3KJPA 3LWEA 1BQQT 2QA4A 4DV5Q 1J5EQ 3H3VI 4A3GH 4A3MG 4I7ZC 1U9RA 5L37A 3RLNA 1CSPA 2MO1A 2ZTCA 4QB4A 2VQFL 3CC4A 5FOBB 1SMXA 2F0PA 1QCBD 2NBFA 1Y1WB 1VQLA 2JYOA 2PO4A 1Y1WG 3AU7A 3K59A 1IW7D 1NR4A 3OW7A 1HNZL 5EBCA 3PO3G 2K5WA 1Z7TA 5BN5A 2PQAA 4ALPA 1II3A 2CW0D 5C0XJ 1DJRD 5ELFA 1EFWA 4MTNA 5M3MG 1ONLA 1YNND 3NSWA 2EDGA 1AH9A 1HTPA 5GQOA 4UP7A 3U50C 1MBYA 4JVZA 3K7AH 3OYYA 1J9OA 5GAHC 4KHZA 2VNUD 3KUPA 2F03A 4XT3B 4DR5L 3L3OC 4IUUA 1NNXA 2UXDL 3DLLA 3EIVA 1A2TA 2OCEA 4KI0A 1TS5A 2XNAC 1WFQA 3KYHC 5JVH3 2HHHQ 3S17B 4KY7A 4B08A 4B3ML 1JJGA 2F0KA 4RHRA 4CJ1B 1IKLA 3S16H 2Q8TA 1VQ5A 1O80A 3E6ZX 5D3IB 1X3QA 2RDFA 3MXNA 4GNXA 1VQPA 2VQEL 1HJPA 3CD6A 3LWUA 1TT2A 5F2DA 1YIJA 3MXNB 2KCCA 4A4IA 1IZ6A 2LXKA 2RCNA 1RL2A 2R92B 1N8RC 4DV7Q 5FO9B 5C4ZA 1VQ8A 3C46A 5C4XG 3HKZB 3V96A 2K05A 1LT5D 4GKJQ 4EVOA 3S1MH 2K52A 3S15B 5CBEE 3S17H 1U5KA 1IW7C 2AQ2B 1E2WA 2E75C 4DV1Q 4GOPB 1GVPA 1A3UA 2B3GA 1NJIC 3FHWA 2MPMA 5CGKA 2ZM6L 4C3HH 3PIP3 1XMQL 2QEXA 3BS1A 5K5PA 4DV7L 4TVAB 3W2DA 3EROA 5FLXc 4DAYA 3CCQA 4A76A 1I6HH 5C3EB 3A0JA 3G6EA 4P74A 4DR3Q 1MI2A 1PRTD 1H95A 4H0LC 4CKBA 2AMCB 1F9QA 1X65A 3UDIA 1LT6D 2L0CA 2F0MA 1D5XC 1AP0A 4R4TA 1STYA 3MFYA 2PPBC 4JYAL 3KF8B 2WB1E 1E0BA 2UUCL 5IGEA 4R9WA 1ET6A 3AB9A 3I70A 4RGOS 2AUKA 4DR6Q 3CCRA 4FF2A 1JOKA 4M8AA 3I7FA 3PMFA 4JW0A 4EQOA 1S5CD 3NENA 4RAUC 1PH1A 1F9SA 1QNKA 5C5LA 3RN2A 1PZID 1QVFA 2WKCA 4HTHA 1M8AA 3H6MA 1J6QA 2QF7A 3IFTA 4YY3L 4XQQA 3Q24A 2EQSA 1GXDC 5JEAG 3T56B 1EIYB 1SN8A 3UE0A 1QUQA 2R92G 2RF4A 3KDFA 2JEAI 1C7YA 2XSCA 1ILPA 4O42A 2B2UA 1I3QH 4YHHL 1EY8A 5IWAL 4A3JG 1HFNA 1EUJA 1PLFA 3PO2B 1K3RA 1HZCA 4A3JH 3RZDB 2D9UA 4BXXH 3STBD 2K04A 4JI7Q 3K8AA 1SYDA 1KL9A 2B8GA 1I94L 4BBSG 4BXXG 3FMCA 3KF6A 3GQBA 1QB5D 4KY5A 2EY1A 3I4MH 4LF9Q 4HCEA 3S2HH 4R8NA 3NHHA 5J22A 2DN8A 1L1OC 5EBDA 3S1RH 1XNRQ 3VR6A 1NCVA 4B3MQ 2IPKD 2Y0SB 3CW2C 2KHIA 4DGZA 4F7XA 3J81L 1Q7YC 3CC2A 5GAEC 1PH7A 4MNOA 2VW9A 5CV5A 1TXYA 1JJCB 4DR6L 2E2HB 2MFIA 1EQVA 2EYHA 1KC8C 3CCUA 1MSGA 1VF5C 2MHVA 5K36H 1DGSA 1B44D 4R4IA 3PSIA 4A3CH 4LJZC 3HOXG 2QKIC 1HCZA 3DEPA 1EZ6A 1PYBA 3S1RB 3RLOA 5IP7H 1WTPA 1Z6HA 1CM9A 3GTLH 2CW0C 1PZJD 1WCMG 2D5DA 3AMUA 3D6CA 2VL6A 1HFGA 1ILQA 1D6EC 1S4ZA 1XPUA 1YHQA 3I2ZA 2JSOA 2L1BA 4KMUC 1CHPD 4QIWE 3R2TA 3PUXA 3W1GA 4RGTA 2CQAA 3KF8A 2ASBA 1LUZA 5FKAC 2HIXA 3JAMc 3DM3A 4I65A 2KEEA 1V1PA 4CHTB 4O0AA 2E8GA 1KLGD 4DR3L 1CA6A 1TWHH 1TWAH 3S1NH 4LF7Q 2K33A 3A7LA 4RKLA 4N8FA 2KUMA 3BU2A 1UAPA 2VY3A 2CWAA 3K7UC 5E4WC 5E3FA 1EIGA 1JC7A 4WORA 1WTOA 4P75A 3I8ZA 1YITA 1XTCD 3NWTA 3BZDB 1KAWA 2JE6I 4FXGC 1E2VA 1B9NA 1PFSA 4DR4Q 1D2BA 4DR7Q 5AJ3L 1N32L 5KNCA 1XNQQ 4QL5A 1JOOA 1PVOA 3K5MA 1Q8IA 3V2TA 4A3FG 2OF1A 4PV1C 4K8JA 3Q8DA 1SROA 1PH3A 1JR0D 3A5ZB 1JB3A 2N3SA 3G6JB 4S3SA 1B3AA 1STHA 1L1OA 2VB3X 3OMCA 2F0HA 2K5VA 1Y8OB 4PMCA 3CCEA 3PUYA 4JOIC 3M4OH 1YNJC 3E3XA 3J81E 4A3MB 4LFCQ 3KLWA 4IFDG 4DNRB 3H3VH 4A3KG 1L0XB 4K5WA 4NXMQ 1HNWQ 1E1TA 3CU7A 1DOMA 1SR3A 1TS4A 4YWKA 1LTSD 1K0RA 1LTBD 4RHSA 3UDFA 4BWGB 1Q82C 2YU9B 2FXQA 4JI6Q 3BJUA 5IYCH 4DV5L 5G3LF 1EYAA 2UUBQ 1VQDA 3N52A 3HEJA 3M3YH 4QQBX 2BH8A 1Y8NB 2MO0A 4DXFA 2QDBA 4A3BB 4C3JH 1AW7A 2L55A 2XGTA 5C44H 3K57A 4HAEA 5LMUQ 1VF7A 1TQOA 3AYHB 1AE3A 5LMNW 3T13A 2UUAQ 1D5MC 1I4QA 5C3EG 1IBKL 1H9SB 1RF2D 3CHBD 3CRLC 4L5QA 4P72A 4IPHA 4K14A 4LF6Q 4B9XA 2OWOA 1X3EA 2N49A 4YIJA 2SNSA 2LSSA 1XNQL 2Q2HA 2LXJA 4DV6Q 3F2DA 4UY8C 2JA8B 1JCKB 4KHVA 4JI4L 4JV5L 1EEFD 2I0QA 1STAA 4TQUS 5LMUL 4YCVA 1UUPA 1J5EL 1IBML 2A68D 4JG2A 3HKZG 4DR5Q 3OTOQ 1GHKA 1K83B 1L0WA 4NW2A 5CC4A 1ICWA 1K28A 2OQKA 1F77A 2MUYA 1XYIA 1Q1EA 3HOWH 3LNNA 1RCVD 2N55A 2OT2A 4UPAA 1CA5A 1M4VA 1F2ZA 3HOWG 4DK1A 2QDLA 1EYCA 2F4VQ 1Q12A 4K2LA 3OIPA 4CBVA 3QWNA 1PZKD 1VQ7A 1VQAA 2PW5A 1SXTA 4H7BA 4A3GG 3PIO3 1FR3A 3I4NB 2UXCL 3M4YA 3S15H 2YTXA 3RZOB 1WTHA 5M5XH 5ELCA 5NUCA 3CAMA 3J81j 3NBHA 2DJFC 2N78A 2Z6KC 4UHVA 1EWIA 2KENA 4DV3L 3KJOA 2JA6H 4DV0Q 3VR4A 5JJIA 4AH6A 2DNEA 3KBGA 5EKLA 3F8TA 3FRPB 5GROA 4CDCC 2KHJA 2F52A 2A6HC 2K7VA 1DOLA 2RDHA 1PH9A 2JA7G 1GO3E 4GOPA 2F0GA 4DR4L 5D14A 1D7QA 4F87A 1SJED 5M5XB 1H9JA 1SDFA 2NTTA 1RKNA 2A74C 2EXZA 1WCMB 4JBWA 1PTOC 5ELBA 2ZT9C 1K8MA 3UDXA 1KD1C 2CH4W 1KTKA 2M00A 3PV0A 1JMCA 4NXML 5JJLA 3S2DH 1SNCA 1VS0A 2HIVA 3BVGA 4GN5A 3QR8A 5IP9H 2HCCA 1VQHA 5C3XA 4PZ8A 1IYVA 4L8JA 4DR2L 1VMCA 4L6TB 4B3SQ 1GHJA 5M3FG 5ELEA 4Y7NH 4QF4A 1Q81C 2XN9C 5IGGA 5LHY1 1EQQA 1M90C 2NN6I 3SK4A 3HOZB 4DR1L 4DAVA 4HR7B 1YNJD 5H1SE 4OWTB 4GOPC 1FJGL 3CCSA 4DR7L 1JORA 2EYFA 5EPKA 4U673 3ULPA 1IBLQ 1HUMA 2B2YC 2Q8IB 1ESRA 2L11A 1EQTA 3R8BA 4A3DB 3A8JE 3HOXH 1N34L 4PZ7A 3DMUA 2EYOA 1XMQQ 2YTVA 5A2QL 1STBA 2Z6KA 3S24A 5DEHA 5ELNA 5C4XH 3CPFA 2WAQB 4JI1L 4DV3Q 4QJFA 2KVMA 4DV2Q 4NXNL 1VQCA 1BNZA 3OHXC 1Y1WH 1X56A 3R3OA 2Z1CA 4UDUC 1N34Q 4G57A 3HOZH 4L63B 1A0IA 1PTOH 4BBRH 4X65Q 1Y1VB 1L1OB 1C48A 1SE8A 2KJXA 2B63B 4JI5L 3GTKB 1NTGA 3J7YW 3KOJA 3RR5A 2EXDA 2VS1A 3MHBA 1D5ZC 2GN5A 3HOVH 2LMCB 4LAAA 4LF9L 4DV2L 3A8KE 1KRSA 1NR2A 1TS2A 4DN4M 1CKNB 1MJEA 2LKVA 5IT9c 1DZ1A 3BYYB 1QE6A 2FHTA 2E2DC 3M4PA 5KGUA 3ULLA 2CHBD 1A2UA 2N8NA 5KRUA 4LNQA 2E2IB 1G2TA 4KD3A 4GZYC 1ESFA 1U4PA 1T5EA 1S3OA 3HOZG 2F4IA 2F3VA 1SYFA 1Q90A 2IL8A 2EY6A 3A56A 3GTJH 1PFBA 3GTOB 4OEMB 4L5RC 3NUCA 3S14B 5C3WA 3PUWA 1GUSA 2XTIA 3WOFA 4ZAIA 4YCWA 1WTQA 3X3NA 3KLSX 1TIID 1XX8A 2A8VA 3KDFB 3ITPA 3VYUA 2WKDA 2EYLA 1YJWA 3Q0AA 3KLSA 5BN4A 1U4LA 2I5LX 2F0TA 2EIFA 3NQIA 1SAPA 2XRSD 3PGZA 1Y1VH 1GUTA 1B3QA 2YYZA 2EVBA 2NVTB 3NBIA 2FFKB 1WD1A 3IFDA 3HOVB 5AJ3Q 3K0XA 4GNXB 1LTTD 3WOEA 5IYCG 2Z4HA 1AN8A 3O13A 3OW2A 1CFMA 2VQFQ 1SNOA 4CDEC 2B63G 2ICEC 1TWGH 3MWYW 3NELA 1SMYD 2JJQA 3I4NH 3I4LA 3SDZA 2BH2A 1FL0A 4JI2Q 2JQOA 3E0EA 4DV4Q 2BDOA 3HG9A 3HKZE 4QIWB 4CKEA 2C35B 2UU9L 2R7DA 2L9HA 4BBSB 2EYPA 2A1AA 4RCOA 2NYZD 1CHQD 1ASYA 2BOSA 4HIMA 2K5DA 3KF6B 3M7GA 2EJGC 5CMDA 3HFZB 1RODA 3CKIB 4B3TL 5IOCA 4R8IA 1TWCH 4LFAQ 4LF4Q 4RGNA 4QCLA 5M5YB 5IP9G 1PV4A 3H15A 2JA6G 1QG7A 5FJ8H 1LACA 1SMYC 4EQPA 4EQ5A 1X3FA 4DAYB 4QUFA 3D4WA 3L2PA 1K9MC 2UXDQ 1S40A 2B2YA 1LTRD 4QGUA 3J80E 4IFDJ 1CK1A 2AHOB 2H4OA 3ULJA 3CXCA 2JA8G 1YBYA 2ZJPA 3K7AB 4JCVE 3STBC 1TWCB 3J81c 3W5OA 2PZTA 2EY2A 4KHPQ 2BE5D 3VYRA 3F2UA 5E4XA 5J1ZA 1WTVA 1Q3LA 3ERQA 3MAQA 1RIPA 1YEZA 1HXYD 1Y69U 3G48A 4FYDA 2A68C 1Z47A 2F1MA 2JA5B 2EYMA 3G7LA 2B2TC 4DKAC 3RLFA 2JA5G 3RNUA 3EBEA 4DPGA 4IUNA 4L5SA 3DEOA 1S5ED 3L0OA 1WCMH 3HOXB 1LT4D 4IURA 3HOYB 2OTJA 1K8GA 4B3RL 5C4XB 4IPDA 2PI2E 3SK5A 1C0AA 2K50A 1EY7A 5M9OA 4JI8Q 4KKUA 4MZ9A 3CCMA 3HOWB 4Q0FA 2ZJRA 1RTNA 4HJ7A 1A3VA 1KDAA 2J0TD 3C1EA 3H3VC 3GV3A 4LF8L 4L5TA 4A3GB 2K32A 3FKIG 2JA5H 3HS0C 4LF5L 3QOJA 4GS3A 1PYWD 1G2SA 4NP5A 1I50B 1R9TB 4IUTA 3TZDA 4LFCL 3NK9A 4DA2A 2B2UC 4HN7A 4LF4L 4CJ2C 4X6AH 2BDNA 3I72A 4AYBB 5IT9L 5C4JH 4HJ9A 1L2FA 4UAIA 2HQEA 1KNAA 5J3BA 2F0DA 4J15A 4BY7G 4GN4B 4NMZA 5IGFA 3U4ZA 2NVQB 1VQMA 3TP7A 4HIKA 5JAVA 4KKSA 3EJIA 4I7AA 3L7ZC 3MZ5A 5FLXL 3GTGB 2ZJQA 1HQRD 2FINB 3E9IA 3DUZA 1PTOB 5JPMC 1PH6A 1EIHA 3CF5A 3L9AX 2ES2A 1N36Q 4TRDA 3NTKA 3EQLC 2ZTEA 3DXJC 3NTIA 4ZUIA 4G7HC 2ZM6Q 3U58A 3MC0B 4X62Q 2E76C 4WJ4A 3S16B 3HGBA 1NY4A 3GV6A 3MVVA 3T1HQ 1XMOQ 1QJOA 4BY1B 5I6WA 4X66L 1N36L 1MGSA 2RHSB 4C3IH 2Y0SG 2NN6H 1B8AA 3Q22A 1FJGQ 4MIUA 1IHZA 5JEAJ 5IWAQ 1U4MA 1CSQA 1FNWA 2XIWA 4XT1B 3OOCA 2M2LA 2O5IC 3AFPA 4N9TA 2F0NA 2EZVA 1ASZA 1YVCA 3GTMH 3E0JA 4X66Q 1K8OA 1BBUA 2O4XA 4FF3A 2TSSA 1EQRA 2RHQB 4IPCA 5JPNC 3H94A 3VA5A 2L5TA 2K03A 2QW7A 2KECA 5FJ8G 2RVLA 1XNRL 1B9MA 4AYBG 2K75A 2KCMA 1HZ9A 4HJAA 5EKIA 3D8GA 5EGTA 4R4CA 3EN2A 3C3LA 5IIFA 4KV6A 4C2MH 4JI3Q 2M9VA 4XQNA 4EX5A 1DD2A 1BUVT 1LYLA 1A63A 2CVRA 5M5YH 1U0LA 2PMZE 2EY5A 5IY0A 3PCOB 1G6PA 4PG3A 2R92H 4JV5Q 1ZEQX 2ID0A 1S72A 1NUCA 4JBMA 2CCZA 5FLXE 4GN3B 5FO8B 1NE3A 1SE4A 2A73B 2O5JC 1CKMA 1FGUA 4JI0L 2PCFB 1XXGA 4P73A 4HSPA 1HNXQ 2B2WC 4BBSH 5C6AA 3D3RA 4RCNA 1GKHA 1O7ZA 1ML0D 4AQYQ 1T9HA 2Z4IA 1EY6A 3VYSA 1WJJA 3NQTA 1HZAA 4OONA 2JA7H 3A8IE 2CWPA 5M5WH 2B29A 2LFNA 4K6DA 5CV6A 1CQFA 3AFQA 2DNCA 3CMEA 5ELOA 1BVSA 2ZXPA 4O2DA 4IO9A 5C3EH 2R6GA 2WB1G 1QNUA 1ZYRC 4DAMA 1HR0W 2CQOA 1PH8A 4LUZA 4DUZQ 2L15A 4WJWA 3K81C 1JT8A 2J7ZA 2EOTA 3C1FA 4LFAL 4DV6L 1OXVA 4E6IA 1G8ZD 1PA6A 4DU9A 3AEVA 3S1NB 1VQEA 2PW7A 4KLKA 3MTSA 4A3KB 3U4VA 4FVMA 1CTMA 1KABA 1VQJA 2D62A 5JJZA 1V9PA 1YHBA 2E5LL 4RMFA 1Q46A 4ME5A 4JI2L 3FKIB 4KN4C 5IE8A 1E3PA 4ABNA 3VYTA 1Y14B 2ZXRA 3B6YA 4DK0A 2HDMA 4LF8Q 4A3IB 1JE5A 1GUGA 1DYQA 3TQYA 3Q23A 2KCNA 2HHHL 3H0GB 3J81i 1UEBA 1KNEA 1Q8KA 3CQZH 2E2JH 1HRJA 2JA7B 3SHLA 3QB3A 3K5LA 3EVQA 1W2BA 3SK6A 3GTLB 1AZQA 2QGQA 4J8QA 4JI8L 4OX9Q 4A3FB 2MJ8A 4ZKCB 5IGBA 4IUPA 1HH2P 3AQQA 1I4HA 3SR1A 5GADC 1B1ZA 1BCPF 3GTKH 4FXDA 1JB7A 1EU4A 3I3CA 4K0KL 3TN2A 4ZKBB 1LV9A 5J39A 1N33Q 2NZOA 3M9BA 4XYQA 4KD4A 2JEBI 2MGSA 4DFAA 2PYKA 3IL8A 2IJ0A 4J1MA 3TP8A 4IN3A 3J80c 4XTCS 4BS9A 4A3KH 4K5XA 2NZHA 2HCIA 1MJCA 1LTAD 1QWYA 2F0FA 5E7NA 2X6GA 5EPJA 2YV5A 1JICA 1OXXK 3FPUB 1F2LA 4ZCKA 3T53B 2A19A 5BN3A 2IT1A 4QMGA 4ZLTF 2B63H 2ZTDA 2PNHA 1RTOA 3OIQA 4WRDA 4XXEA 3VR5A 3GTMB 2NTSA 1CZWA 4G4KA 5KYIA 3VR2A 1EY9A 3TBIB 3HOUB 1GM5A 1I94Q 2NN6G 4JYAQ 1YI2A 2F0SA 3FPPA 2RSNA 2WACA 3JAML 5D65A 1NBWA 2A69D 3PQIA 3W1BA 2JA9A 1Y1VG 3SE0A 2AQ1B 1OXUA 2F0VA 4DUZL 4KTAA 2ENBA 3DWQA 3PUZA 4HEDA 1LTID 3CPWA 2IX3A 4N8X1 1P16A 3BZCA 4LFBL 2OQ0A 4K6LA 4ULLA 3BG3A 4HJ8A 2F3IA 3NWSA 3TEHB 1BCPB 4V0BA 3IAYA 4RH6A 1E22A 1KDBA 5LMNQ 3OWFA 4G7ZC 1G6ZA 4NXNQ 3TZUA 2KEDA 1V1OA 3DM1A 3GTQB 4FF4A 4GLVB 3ERSX 5KYLA 4KK7A 4C3JG 4DV1L 1AZPA 3ICEA 4AYBE 3T1YL 3MXPA 2R93B 4APVA 1HTLD 5DAUA 2ATWA 1B70B 1PRTF 1I4XA 5DLQE 5CYUA 1VQOA 4H44C 5CORA 4A3JB 2R61A 3RZDH 3PIOA 3G71A 4ID6A 4OL7A 1SBBB 2UXBL 2JN4A 3I4MG 1SFOB 1PTOF 3BDOA 5I9PA 3PF5A 5IYBH 3VA7A 1UEAB 3MXGA 4JOIA 4CDFC 3CC7A 2IX0A 5C5MA 1VQBA 2IW3A 4BY1G 3MXUA 5LL6S 1CKOA 1TY0A 1X54A 1I4GA 1V1PB 3GTQH 1O7YA 2VZAA 1PRTC 5DNFA 3CP0A 4OWXB 3A5UA 3F2CA 4XIGS 3GTPH 3KLRA 2K14A 4KN7C 3HP3A 1YHAA 1FD7D 1BOSA 2V4DA 2Z9HA 1SFOH 3SXHA 3K6OA 2A6HD 1FYCA 1MKHA 4QUCA 5CV9A 2DGYA 4Z9CB 3PO3B 3Q6SA 4HCSA 1WOCA 3UDGA 1QZHA 2B2TA 4TKOB 2RBMA 2B2VC 4OO1H 1B50A 4C56C 1GUWA 4HJ5A 3TP5A 1TWFH 3CCVA 1UE6A 4JI7L 4A3IH 1KIXA 1C4QA 3RMHA 1S5FD 1SJHD 1X32A 1OO9B 3H0GH 1BDOA 2F0IA 3BDLA 1SEBD 5CBAE 2K6AA 2R3ZA 1TS3A 2EJMA 1PDQA 1CQVA 2QCPX 4IZ8A 4CDDC 1HHVA 1K73C 1UE7A 4OWWB 2UU9Q 3D31A 3NEMA 2V1CC 3J80L 5HGTA 3OTOL 5CV7A 1T5XD 2B2VA 1TKWB 4C3IB 3FDTA 2F0QA 4LF7L 4UP9A 5IP7G 3J7A5 1EY5A 3URYA 1EIFA 4H02A 2K5NA 3D4RA 1D8LA 4AQYL 4B3TQ 4HIDA 4RG1A 1P8LA 1SE2A 3K80C 3HOYH 3SK8A 2XWBB 4GKKQ 4ME3A 5C0XH 4OELB 2LS01 4LMQD 4A93G 5EQ0A 1FGBD 5HURA 3WDNA 2Z0SA 1HNZQ 1GOZA 2CKZB 5JOBA 1WD0A 4U68A 3BVMA 5HY6A 3OPOA 1NMGA 2WP8J 5EJWA 2N88A 1E1OA 2F3WA 2JP1A 2LY7A 1HA5A 1SYCA 1FNVA 3FEWX 2EYJA 4JI6L 1STGA 3U9SA 4DF7A 1K0SA 1K3BC 1KDCA 4OX9L 3IRBA 2F0OA 3ZYYX 1PH5A 2WAQE 2RCFA 1PYSB 1SRUA 3ER0A 1N9WA 2A6ED 3SVMA 5CR3A 1CKNA 4JPBW 4LFBQ 2RA4A 3GTGH 3C2PA 1V1QA 2Q2TA 3KBXA 3MA2B 4NB3A 2NVQH 3QIAA 1HNXL 3G4SA 4RWSC 2NVTH 2D2CC 1ICFB 3BZKA 2I5MX 2XVSA 3T51B 2OTLA 4ILWA 2E5LQ 1SNQA 4GKKL 1E7ZA 2BCOA 2KBNA 3A7AB 4YCUA 4OIKA 1VMPA 3S1MB 5T1GA 1A8VA 5GAGC 1ENFA 1C8CA 4IFDI 4KHPL 2VB2X 1PFNA 1S5BD 3R93A 3GO5A 2R93H 4OGQC 4PNYA 1E2ZA 1ZKOA 2G9HD 4MHEA 2R93G 2I46A 4R4QA 4ODGA 4JI1Q 4CGYB 4LF5Q 4A3LG 3TP6A 4A3FH 1VQ6A 1VQIA 1VQFA 1B7YB 1X55A 2J4XA 4RA8A 4BY7H 5M3MH 2UUBL 3PO2G 2C9OA 3HOVG 1ZYRD 1OTCA 1KRTA 1TWAB 2XWJB 1NMFA 3TSSA 1XPOA 1W3SA 4FO2A 2F0LA 2K5QA 1KAAA 1W6KA 2F0WA 3S1QH 1WTXA 2VUMH 2R7ZG 1EY4A 1H9SA 1KLUD 1E24A 1MSHA 4LF6L 1S5DD 3OSOA 3E5SA 1JE4A 1STEA 3D0FA 3RUZA 4P2CB 2F0EA 1XJVA 1QUQB 1SYGA 2KHSA 2NWGA 3DWAA 2Q2IA 1VQNA 1QZGA 4A93H 4MN3A 1H9RA 2IHEA 2K1BA 4ZYSA 1AEXA 3F1ZA 5AFWA 2EE1A 1U4RA 4EQNA 2PI2A 2X69A 1K8AC 4LW1A 4IFDH 1YJNA 2NVYB 2L12A 2E74C 3VR3A 4OO1G 1PH4A 1JJ2A 3HKSA 5M3MB 1N33L 1DONA 5M3FH 1TY2A 2CH4A 1GD7A 1I5FA 3GDEA 1SNDA 1TVXA 4JI0Q 3J7ZC 1IBLL 4KJOA 4H13C 1LT3D 4C3HG 1J8IA 2HQLA 1DOKA 1SSOA 2AKWB 1VQ9A 1WTRA 3JC66 3T16A 3DWPA 4K2KA 3NP8A 3X3MA 2VUMB 4FXKC 3A74A 2WV6D 4C3IG 1PH2A 1G91A 5ELDA 3HRZC 3M4OB 1QVGA 4A3DG 5I4DA 1Q1BA 2RQXA 1D1KA 3PF4A 1KHIA 3S9WA 2D0PA 1WYDA 3T1HL 2RDGA 1R9TH 2E2HH 4Y52H 2H5XA 4YWLA 5LMNL 5KNBA 1SNPA 4A93B 1NSNS 1CT1D 3HOUH 1WI5A 2AUJD 3K58A 1UWVA 1VCIA 2DY8A 2KQ3A 4IJLA 2P5ZX 1JQYD 1HQMC 1VQKA 4V190 1JOQA 2UXBQ 1MHWC 1SE3A 1EZ8A 2FMMA 5JJKA 4ZRZA 3H0GG 5EKKA 2H1EA 2QILA 3A55A 3E9HA 5CV8A 4P71A 3J80i 4B3RQ 4EGVA 2WFWA 1LTLA 3I4OA 2EJFC 2PMZB 3ND8A 4YWMA 4NPSA 1EWCA 1LABA 3CQZB 4DR1Q 2E2JB 2GVAA 4B3SL 4ZK9B 4IUQA 2VQEQ 1BCPC 1LM0A 4JK1C 4N9PA 1IKMA 3MEFA 1LO5D 4IOCA 2ALYB 2B2WA 5E1FA 4F88A 1TWHB 5C0XI 1HA6A 3I56A 1CI3M 5KIXA 3J7AV 1YJ9A 4K5VA 4WFN3 2K5HA 3M4QA 5KEEA 1BXTA 3NPPA 4A3BG 2KA7A 2MNAA 1BO0A 3WWVA 1CZGA 4HMJA 2JA6B 4X3TA 3MEHA 2YTYA 1PXUA 3TRZA 3KFUA 4PMWA 5I6YA 3GTJB 5IODA 2Z6BA 5EPLA 1A3TA 4R4OA 1I6VC 1ENAA 1WTWA 3S14H 4LWCA 2BA0A 1ENCA 4RFBA 1JWSD 4XQJA 1H9MA 4K8IA 2EPBA 5KNDA 5C44G 3BDCA 2FMCA 4HSVA 2GVBA 2HDLA 2DUDA 4JBJA 5A35A 3D6WA 1GUOA 1HZBA 1JWMD 1ZXTA 5JEAH 2WB1B 2SOBA 4FNFA 3UI2A 2IWHA 1HR0L 2ZXOA 4A3BH 5DM73 3CRKC 4F8MA 1EOTA 1KQSA 1G291 3V05A 3GTPB 1SYBA 4POFA 5CV4A 5FO7B 4OO1I 3F2BA 4C2MB 4LUVA 3MFGA 2G5DA 4A3EB 1I50H 3NE5B 4Y7NB 2YU9H 3CCJA 3S2HB 1OXSC 5D3DA 2SEBD 4DV4L 4PZ6A 4DV0L 4DNTB 5M5WB 3DHQA 3A54A 3S1QB 4J6HA 1TR5A 5C4JB 3M85A 2DJGC 1BCPD 2R7ZB 4GKJL 2JA8H 1JWUD 4DK3C 1IXRA 3I4NG 2NVXH 5IYDH 3I90A 1Y8PB 1VQ4A 4A3DH 1SYEA 3P75A 4QY7A 1EYGA 2ICIA 3CMAA 1GUNA 2KCTA 2PZUA 1R4QB 4TSSA 1EU3A 2I5HA 3UE1A 1YNXA 2PQEA 2IY5B 1RJTA 1UE1A 4OHJA 1N32Q 4K0KQ 3LGJA 2F4VL 2A69C 1YZ6A 3QOLA 1V43A 1ET9A 1EWHA 2PZWA 4DR2Q 1KXLA 4A3LH 2WINB 4X64L 5HGQA 1M1KC 4A3IG 1X9NA 3TDQA 4BA1I 1A6XA 4WJ3M 4DNIA 2C5CA 4NDXA 4Q5VA 4LK1C 5IYDG 4BY1H 2G9DA 1FNUA 3PUVA 2NUCA 2NVXB 4UP8A 5T1IA 2I07B 4JI3L 5IGCA 4POGA 1UE5A 3JAME 1XWEA 3SEBA 4A3EH 2IX1A 4MTKA 4DK6C 4ZUJA 5A2QE 3W3AA 1IL8A 4A3CG 4FF1A 1Z9FA 1QOHA 1IYJB 5FK9C 1EFID 1X3PA 2AQ3B 1BBXC 1HR0Q 1MIUA 4JBKA 3FKIH 4KJNA 1TWFB 2MP1A 1C9OA 4M1UB 1EOVA 2F0UA 3R2IA 4X65L 2RSOA 2AWOA 4B9WA 5IT9E 1AFPA 1EEID 2Q2UA 3GD7A 4AIMA 1MD2D 4IQZA 3T4AC 3PO2H 1RD9D 4LUOA 2K28A 2XRQD 4HMIA 1BR9A 4JC0A 3TS2A 1DCZA 3ONAB
chains in the Genus database with same CATH topology
1R4PB 2Z8LA 1UNSA 1A15A 2K01A 5I2XA 2NZ1D 4KY6A 3QJYA 4FP5D 1F9RA 3EA6A 2F0JA 3H09A 2JXMB 5JVG3 3RD4A 1B4OA 3GP7A 1F9PA 3S2DB 2A6EC 2X6LA 4C1NK 1RDPD 1F2YA 4BA2I 4CJ0B 3NXWA 5G3LD 3HZXA 5C0XG 5TSSA 4XDXA 1O78A 4X3SA 1TWGB 1LLRD 1V8QA 3EFXD 3OWEB 1B53A 1EYDA 1HPCA 1SNMA 4C3JB 1L0YB 4OIJA 3M7NA 1I3QB 4O1NA 1HUNA 4CKCA 1IYUA 4C3HB 2B39A 1YNNC 5LL6X 2QEJC 2DY7A 4NKLA 3NTHA 3U9OA 5C4HA 3QO2A 4X3UA 2A5HA 3KK7A 1I4PA 3I4MB 5M3FB 3FVQA 1W6JA 2SNMA 2HUGA 4RKBA 4IUVA 2PNRC 4KKTA 3IKJA 3TMEA 5COYA 3P1HA 3M3YB 4BBRB 4G7OC 5DM63 1H9KA 4C1NI 4X3KA 4ZQ3A 2O2LD 1OXTA 2WIIB 3J7AF 1I4RA 2OEOA 3ND9A 1GJXA 4DXGA 3P20A 4DAPA 4PMBA 5IGDA 3QG1A 4XYOA 1BF4A 3I91A 5ISRA 1I6HB 1F2MA 2SDFA 3K5OA 3OMGA 1QILA 2RKSA 2FJ2A 2NB0A 3LX0A 4PQXA 3H91A 1B2TA 1TU2B 5I9OA 1VDZA 4RGMA 2BA1A 4BY7B 1EY0A 1D1IA 2B8FA 1PTOD 2VXWA 1PFMA 5K36G 2TMPA 2GA4B 5I2YA 1DM0B 3BYTB 1EL0A 1PRTB 2KOLA 1WVLA 3BVZA 5C44B 1NAPA 3P7JA 3N6RA 1PMRA 3I73A 1LTGD 1STNA 1DXMA 1O7LA 4IALA 2OXPA 1RHPA 2L4NA 3D4DA 3K0YA 2BE5C 3K5NA 2AWNA 2Q8RE 3LWEA 1BQQT 4I7ZC 1U9RA 4QB4A 5FOBB 2F0PA 1QCBD 2NBFA 1Y1WB 2JYOA 2PO4A 3AU7A 3K59A 1IW7D 1NR4A 3OW7A 5EBCA 2K5WA 1Z7TA 5BN5A 1II3A 5C0XJ 2CW0D 1DJRD 5ELFA 1ONLA 1YNND 3NSWA 2EDGA 1HTPA 1MBYA 1J9OA 4KHZA 2VNUD 3KUPA 2F03A 4XT3B 3L3OC 4IUUA 4KI0A 1A2TA 1TS5A 2XNAC 5JVH3 3S17B 4KY7A 4B08A 2F0KA 4RHRA 4CJ1B 1IKLA 2Q8TA 1O80A 3E6ZX 5D3IB 1X3QA 2RDFA 3MXNA 3LWUA 1TT2A 5F2DA 2KCCA 2R92B 5FO9B 5C4ZA 3C46A 3HKZB 3V96A 2K05A 1LT5D 4EVOA 3S15B 5CBEE 2AQ2B 1IW7C 2E75C 1E2WA 1A3UA 5CGKA 2MPMA 3PIP3 3BS1A 5K5PA 3W2DA 3EROA 4DAYA 5C3EB 1MI2A 1PRTD 4H0LC 4CKBA 1F9QA 1LT6D 2L0CA 2F0MA 1D5XC 1AP0A 2PPBC 1STYA 3MFYA 1E0BA 5IGEA 4R9WA 1ET6A 3AB9A 3I70A 4RGOS 2AUKA 4FF2A 1JOKA 4M8AA 3PMFA 4EQOA 1S5CD 4RAUC 1F9SA 1QNKA 5C5LA 1PZID 2WKCA 4HTHA 1M8AA 3H6MA 2QF7A 3IFTA 4XQQA 3Q24A 1GXDC 5JEAG 3T56B 2JEAI 2XSCA 1ILPA 4O42A 2B2UA 1EY8A 1HFNA 1PLFA 3PO2B 3RZDB 2D9UA 2K04A 1SYDA 2B8GA 3FMCA 3GQBA 1QB5D 4KY5A 2EY1A 4HCEA 4R8NA 3NHHA 5J22A 2DN8A 5EBDA 3VR6A 1NCVA 2IPKD 2Y0SB 4F7XA 4DGZA 3J81L 5CV5A 2E2HB 1EQVA 2EYHA 1MSGA 1VF5C 2MHVA 5K36H 1B44D 4LJZC 2QKIC 1HCZA 3DEPA 1EZ6A 3S1RB 1WTPA 1Z6HA 1CM9A 2CW0C 1PZJD 2D5DA 3AMUA 3D6CA 1HFGA 1ILQA 1D6EC 1S4ZA 2JSOA 2L1BA 4KMUC 1CHPD 3R2TA 3PUXA 4RGTA 2CQAA 3KF8A 5FKAC 4I65A 2KEEA 4CHTB 1V1PA 1KLGD 1CA6A 2K33A 3A7LA 4RKLA 2KUMA 1UAPA 5E4WC 5E3FA 1EIGA 1JC7A 4WORA 1WTOA 3I8ZA 1XTCD 3NWTA 3BZDB 2JE6I 4FXGC 1E2VA 1B9NA 1D2BA 5KNCA 1JOOA 3K5MA 1Q8IA 3V2TA 2OF1A 4PV1C 4K8JA 1JR0D 1JB3A 3G6JB 4S3SA 1B3AA 1STHA 2VB3X 3OMCA 2F0HA 1Y8OB 4PMCA 3PUYA 1YNJC 3J81E 4A3MB 4IFDG 4DNRB 1L0XB 4K5WA 3CU7A 1DOMA 1TS4A 1LTSD 1LTBD 4RHSA 4BWGB 2YU9B 5G3LF 1EYAA 3N52A 3HEJA 1Y8NB 4DXFA 2QDBA 4A3BB 1AW7A 2L55A 3K57A 4HAEA 1VF7A 1TQOA 3T13A 1D5MC 1I4QA 1H9SB 1RF2D 3CHBD 3CRLC 4K14A 4B9XA 4YIJA 2SNSA 2JA8B 1JCKB 4KHVA 1EEFD 1STAA 4TQUS 1UUPA 2A68D 1GHKA 1K83B 4NW2A 5CC4A 1ICWA 1F77A 2MUYA 1XYIA 1Q1EA 3LNNA 1RCVD 2N55A 2OT2A 1CA5A 1M4VA 1F2ZA 4DK1A 1EYCA 1Q12A 4K2LA 3OIPA 4CBVA 3QWNA 1PZKD 2PW5A 1SXTA 4H7BA 3PIO3 1FR3A 3I4NB 3M4YA 3RZOB 5ELCA 5NUCA 3NBHA 3VR4A 2DNEA 3KBGA 5EKLA 3FRPB 2K7VA 2A6HC 1DOLA 2RDHA 2F0GA 5D14A 4F87A 1SJED 5M5XB 1H9JA 1SDFA 2NTTA 1RKNA 2A74C 2EXZA 1WCMB 4JBWA 1PTOC 5ELBA 2ZT9C 1K8MA 1KTKA 2M00A 3PV0A 1SNCA 3BVGA 2HCCA 5C3XA 1IYVA 4L8JA 1VMCA 4L6TB 1GHJA 5ELEA 4QF4A 2XN9C 5IGGA 5LHY1 3HOZB 2NN6I 3SK4A 4DAVA 4HR7B 1YNJD 1JORA 2EYFA 5EPKA 4U673 1HUMA 2B2YC 2Q8IB 1ESRA 2L11A 1EQTA 3R8BA 4A3DB 3A8JE 3DMUA 2EYOA 5A2QL 1STBA 5DEHA 2WAQB 2KVMA 1BNZA 3OHXC 3R3OA 2Z1CA 4UDUC 4G57A 4L63B 1PTOH 1Y1VB 1C48A 2KJXA 2B63B 3GTKB 3J7YW 3MHBA 1D5ZC 2LMCB 4LAAA 3A8KE 1NR2A 1TS2A 4DN4M 2LKVA 1DZ1A 3BYYB 1QE6A 2FHTA 2E2DC 5KGUA 2E2IB 2CHBD 1A2UA 5KRUA 1G2TA 4KD3A 4GZYC 1ESFA 1U4PA 1T5EA 2F4IA 2F3VA 1SYFA 1Q90A 2IL8A 2EY6A 3A56A 1PFBA 3GTOB 3NUCA 3S14B 5C3WA 3PUWA 1GUSA 3WOFA 4ZAIA 1WTQA 3X3NA 3KLSX 1TIID 1XX8A 3ITPA 3VYUA 2WKDA 2EYLA 3Q0AA 3KLSA 5BN4A 1U4LA 2F0TA 3NQIA 1SAPA 2XRSD 1GUTA 2YYZA 2EVBA 2NVTB 3NBIA 2FFKB 1WD1A 3IFDA 3HOVB 1LTTD 3WOEA 2Z4HA 1AN8A 3O13A 1CFMA 1SNOA 2ICEC 3MWYW 1SMYD 3I4LA 3SDZA 2BDOA 3HG9A 4QIWB 4CKEA 2L9HA 4BBSB 2EYPA 4RCOA 2NYZD 1CHQD 2BOSA 2K5DA 3M7GA 2EJGC 5CMDA 1RODA 3CKIB 5IOCA 4R8IA 4RGNA 4QCLA 5M5YB 1QG7A 1LACA 1SMYC 4EQPA 4QUFA 3D4WA 2B2YA 1LTRD 3J80E 4IFDJ 1CK1A 2H4OA 3K7AB 1TWCB 2PZTA 2EY2A 2BE5D 3VYRA 3F2UA 5E4XA 5J1ZA 1WTVA 1Q3LA 3ERQA 3MAQA 1HXYD 1Y69U 4FYDA 2A68C 1Z47A 2F1MA 2JA5B 2EYMA 3G7LA 2B2TC 3RLFA 4IUNA 3DEOA 1S5ED 3HOXB 1LT4D 4IURA 3HOYB 5C4XB 3SK5A 1EY7A 5M9OA 4KKUA 3HOWB 4Q0FA 1RTNA 1A3VA 1KDAA 2J0TD 3C1EA 3H3VC 3GV3A 4A3GB 2K32A 3HS0C 3QOJA 1PYWD 1G2SA 4NP5A 1I50B 1R9TB 4IUTA 3TZDA 3NK9A 4DA2A 2B2UC 4HN7A 4CJ2C 2BDNA 3I72A 4AYBB 5IT9L 4UAIA 2HQEA 1KNAA 2F0DA 4NMZA 5IGFA 2NVQB 3TP7A 5JAVA 4KKSA 3EJIA 3L7ZC 3MZ5A 5FLXL 3GTGB 1HQRD 2FINB 3DUZA 1PTOB 5JPMC 1EIHA 3L9AX 4TRDA 3NTKA 3EQLC 3DXJC 3NTIA 4ZUIA 4G7HC 3MC0B 2E76C 3S16B 3HGBA 3GV6A 3MVVA 1QJOA 4BY1B 5I6WA 1MGSA 2NN6H 3Q22A 4MIUA 1IHZA 5JEAJ 1U4MA 1FNWA 2XIWA 4XT1B 3OOCA 2M2LA 2O5IC 4N9TA 2F0NA 2EZVA 3E0JA 1K8OA 2O4XA 4FF3A 2TSSA 5JPNC 3H94A 3VA5A 2L5TA 2K03A 2KECA 2RVLA 1B9MA 5EKIA 3D8GA 5EGTA 3C3LA 5IIFA 4KV6A 2M9VA 4XQNA 1DD2A 1BUVT 2CVRA 2EY5A 1ZEQX 2ID0A 1NUCA 5FLXE 5FO8B 1SE4A 2A73B 2O5JC 2PCFB 1XXGA 4HSPA 2B2WC 5C6AA 3D3RA 4RCNA 1O7ZA 1ML0D 2Z4IA 1EY6A 3VYSA 3NQTA 3A8IE 4K6DA 2LFNA 5CV6A 1CQFA 2DNCA 2ZXPA 2R6GA 1QNUA 1ZYRC 4WJWA 2J7ZA 2EOTA 3C1FA 1OXVA 4E6IA 1G8ZD 4DU9A 3S1NB 2PW7A 3MTSA 4A3KB 4FVMA 1CTMA 1KABA 2D62A 5JJZA 4ME5A 3FKIB 4KN4C 4ABNA 3VYTA 2ZXRA 4DK0A 2HDMA 4A3IB 1GUGA 1DYQA 3Q23A 2KCNA 3H0GB 1KNEA 1HRJA 2JA7B 3SHLA 3QB3A 3K5LA 3EVQA 3SK6A 3GTLB 1AZQA 4J8QA 4A3FB 2MJ8A 4ZKCB 5IGBA 4IUPA 1I4HA 3SR1A 4FXDA 1B1ZA 1BCPF 1EU4A 3I3CA 3TN2A 4ZKBB 1LV9A 5J39A 4XYQA 4KD4A 2JEBI 2MGSA 4DFAA 2PYKA 3IL8A 2IJ0A 4J1MA 3TP8A 4IN3A 4XTCS 4BS9A 4K5XA 2HCIA 1LTAD 1QWYA 2F0FA 2X6GA 5EPJA 1JICA 1OXXK 3FPUB 1F2LA 3T53B 5BN3A 2IT1A 4QMGA 4ZLTF 4XXEA 1RTOA 3OIQA 4WRDA 3VR5A 3GTMB 2NTSA 1CZWA 4G4KA 5KYIA 3VR2A 1EY9A 3TBIB 3HOUB 2NN6G 2F0SA 3FPPA 2RSNA 2WACA 3JAML 5D65A 2A69D 3SE0A 2AQ1B 1OXUA 2F0VA 4KTAA 2ENBA 3DWQA 3PUZA 4HEDA 1LTID 2IX3A 4K6LA 4ULLA 3BG3A 3NWSA 1BCPB 4V0BA 3IAYA 4RH6A 1KDBA 3OWFA 4G7ZC 1G6ZA 3TZUA 2KEDA 1V1OA 3DM1A 3GTQB 4FF4A 5KYLA 4KK7A 4C3JG 1AZPA 3MXPA 2R93B 1HTLD 5DAUA 1PRTF 1I4XA 5CYUA 4H44C 5CORA 4A3JB 2R61A 4ID6A 4OL7A 1SBBB 1SFOB 1PTOF 3BDOA 5I9PA 3VA7A 1UEAB 3MXGA 2IX0A 5C5MA 2IW3A 3MXUA 5LL6S 1TY0A 1I4GA 1V1PB 1O7YA 1PRTC 5DNFA 4XIGS 3KLRA 4KN7C 3HP3A 1FD7D 1BOSA 2V4DA 3SXHA 3K6OA 2A6HD 1FYCA 5CV9A 4QUCA 4Z9CB 3PO3B 3Q6SA 4HCSA 2B2TA 4TKOB 2RBMA 2B2VC 4OO1H 1B50A 4C56C 1GUWA 3TP5A 1C4QA 3RMHA 1S5FD 1SJHD 1X32A 1OO9B 1BDOA 2F0IA 3BDLA 1SEBD 5CBAE 2K6AA 2R3ZA 1TS3A 2EJMA 1PDQA 1CQVA 2QCPX 4IZ8A 1HHVA 3D31A 3J80L 5HGTA 5CV7A 1T5XD 2B2VA 1TKWB 4C3IB 3FDTA 2F0QA 1EY5A 3URYA 3D4RA 1SE2A 3SK8A 2XWBB 5C0XH 2LS01 4LMQD 5EQ0A 1FGBD 5HURA 3WDNA 1GOZA 5JOBA 1WD0A 4U68A 3BVMA 3OPOA 2WP8J 5EJWA 2N88A 2F3WA 2JP1A 2LY7A 1HA5A 1SYCA 1FNVA 3FEWX 2EYJA 1STGA 3U9SA 4DF7A 1KDCA 2F0OA 3ZYYX 2A6ED 3SVMA 5CR3A 2RA4A 3C2PA 3KBXA 3MA2B 3QIAA 4RWSC 2D2CC 2XVSA 3T51B 4ILWA 1SNQA 2BCOA 3A7AB 4OIKA 1VMPA 3S1MB 5T1GA 1ENFA 1C8CA 4IFDI 2VB2X 1S5BD 1PFNA 3R93A 3GO5A 4OGQC 4PNYA 1E2ZA 1ZKOA 2G9HD 4MHEA 2I46A 4ODGA 4CGYB 3TP6A 4RA8A 2J4XA 2C9OA 1ZYRD 1TWAB 2XWJB 3TSSA 4FO2A 2F0LA 2K5QA 1KAAA 1W6KA 2F0WA 1WTXA 1EY4A 1H9SA 1KLUD 1MSHA 1S5DD 3OSOA 3E5SA 1JE4A 1STEA 3RUZA 4P2CB 2F0EA 1SYGA 2KHSA 2NWGA 3DWAA 4MN3A 1H9RA 2K1BA 4ZYSA 1AEXA 5AFWA 2EE1A 1U4RA 4EQNA 2X69A 4IFDH 2NVYB 2L12A 2E74C 3VR3A 4OO1G 5M3MB 1DONA 1TY2A 1SNDA 1TVXA 4KJOA 4H13C 1LT3D 4C3HG 1J8IA 1DOKA 1SSOA 1WTRA 3T16A 3DWPA 4K2KA 3NP8A 3X3MA 2VUMB 4FXKC 2WV6D 4C3IG 1G91A 5ELDA 3HRZC 3M4OB 5I4DA 1Q1BA 2RQXA 1D1KA 3S9WA 2RDGA 5KNBA 1SNPA 4A93B 1NSNS 1CT1D 2AUJD 3K58A 1VCIA 2DY8A 2KQ3A 1JQYD 1HQMC 4V190 1JOQA 1SE3A 1EZ8A 2FMMA 4ZRZA 5EKKA 2H1EA 2QILA 3A55A 5CV8A 4EGVA 2EJFC 2PMZB 3ND8A 1EWCA 1LABA 3CQZB 2E2JB 4ZK9B 4IUQA 1BCPC 4JK1C 4N9PA 1IKMA 1LO5D 5C0XI 2B2WA 5E1FA 4F88A 1TWHB 1HA6A 1CI3M 5KIXA 3J7AV 4K5VA 4WFN3 5KEEA 1BXTA 3NPPA 2KA7A 1BO0A 1CZGA 4HMJA 2JA6B 4X3TA 3MEHA 1PXUA 4PMWA 5I6YA 3GTJB 5IODA 5EPLA 1A3TA 1I6VC 1ENAA 1WTWA 2BA0A 1ENCA 4RFBA 1JWSD 4XQJA 1H9MA 4K8IA 2EPBA 5KNDA 3BDCA 2FMCA 4HSVA 2HDLA 5A35A 3D6WA 1GUOA 1ZXTA 1JWMD 5JEAH 2WB1B 2SOBA 4FNFA 3UI2A 2IWHA 2ZXOA 5DM73 3CRKC 4F8MA 1EOTA 3V05A 3GTPB 1G291 1SYBA 5CV4A 5FO7B 4OO1I 4C2MB 3MFGA 4A3EB 3NE5B 4Y7NB 3S2HB 1OXSC 5D3DA 2SEBD 4DNTB 5M5WB 3DHQA 3A54A 3S1QB 4J6HA 1TR5A 5C4JB 3M85A 1BCPD 2R7ZB 1JWUD 3I90A 1Y8PB 1SYEA 3P75A 2ICIA 1GUNA 2PZUA 1R4QB 4TSSA 1EU3A 2PQEA 1RJTA 4OHJA 2A69C 3QOLA 1V43A 1ET9A 1EWHA 2PZWA 2WINB 3TDQA 4BA1I 1A6XA 2C5CA 4NDXA 4Q5VA 4LK1C 2G9DA 1FNUA 3PUVA 2NUCA 2NVXB 5T1IA 2I07B 5IGCA 3JAME 1XWEA 3SEBA 2IX1A 4ZUJA 5A2QE 3W3AA 1IL8A 4FF1A 1QOHA 5FK9C 1EFID 1X3PA 2AQ3B 1BBXC 4KJNA 1TWFB 2MP1A 4M1UB 2F0UA 3R2IA 2RSOA 2AWOA 4B9WA 5IT9E 1AFPA 1EEID 3GD7A 1MD2D 4IQZA 3T4AC 1RD9D 2K28A 2XRQD 4HMIA 1BR9A 1DCZA 3ONAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFD A;  2FJ2 A;  1EQT A;  3R93 A;  2HDM A;  1RTN A;  1CA6 A;  2K03 A;  4RAU C;  2KEC A;  1HHV A;  2RVL A;  3H91 A;  1A15 A;  4MHE A;  1J9O A;  1F9S A;  1QNK A;  2K01 A;  1B2T A;  2NZ1 D;  3GV3 A;  1F9R A;  2KUM A;  3KUP A;  1G6Z A;  4XT3 B;  1KNE A;  4RA8 A;  3MWY W;  5EKI A;  2KED A;  2B2V A;  1HRJ A;  4NW2 A;  3FDT A;  2KVM A;  3DM1 A;  4IUU A;  1M8A A;  1ICW A;  2L11 A;  5E4W C;  1XYI A;  1EIG A;  2DY8 A;  1B4O A;  1BNZ A;  1AZP A;  1F9P A;  2N55 A;  2X6L A;  3I90 A;  1CA5 A;  1G2S A;  2VXW A;  1WTO A;  3I8Z A;  4CJ1 B;  2L9H A;  1IKL A;  2CVR A;  4IUT A;  2FMM A;  2Q8T A;  3TZD A;  4CJ0 B;  1PFM A;  1AZQ A;  2B2U C;  1O80 A;  1ILP A;  4O42 A;  2H1E A;  2NYZ D;  4CJ2 C;  2B2U A;  4XDX A;  2BDN A;  4X3S A;  1X3Q A;  4LMQ D;  2MJ8 A;  1HFN A;  5EQ0 A;  1PLF A;  1RJT A;  4IUP A;  5COR A;  4ZKC B;  5CMD A;  1WTX A;  1EL0 A;  4UAI A;  1MSH A;  1KNA A;  1ROD A;  2D9U A;  1B53 A;  3I3C A;  2KOL A;  1WD0 A;  2K04 A;  4R8I A;  4U68 A;  1WVL A;  3TN2 A;  1B3A A;  4ZK9 B;  1JE4 A;  4IUQ A;  4ZKB B;  1LV9 A;  5EJW A;  2B2W C;  2N88 A;  1NAP A;  2JP1 A;  1NR2 A;  4OIJ A;  1IKM A;  4DN4 M;  1O7Z A;  1ML0 D;  1QG7 A;  2FIN B;  2MGS A;  3ONA B;  2B2W A;  1HUN A;  2NWG A;  3P7J A;  1HA6 A;  3IL8 A;  4QUF A;  1EIH A;  2DY7 A;  2K05 A;  4MN3 A;  1O7Y A;  1DOM A;  1NCV A;  2B2Y A;  2HCI A;  1DZ1 A;  1QE6 A;  5CBE E;  5DNF A;  1RHP A;  2FHT A;  2L4N A;  3QO2 A;  1DOL A;  5T1I A;  2K1B A;  4X3U A;  2X6G A;  5AFW A;  5EPJ A;  5D14 A;  2EE1 A;  1G2T A;  1JIC A;  3HP3 A;  1BO0 A;  1F2L A;  1ESR A;  3FPU B;  2Q8R E;  1SDF A;  3LWE A;  1U4R A;  2HUG A;  1MSG A;  1U4P A;  2X69 A;  4IUV A;  4QUC A;  3SVM A;  2MPM A;  4X3T A;  5COY A;  4ZLT F;  3F2U A;  5E4X A;  3GV6 A;  1Q3L A;  2IL8 A;  2L12 A;  2RA4 A;  3N52 A;  1WTV A;  1IL8 A;  3Q6S A;  3KBX A;  1RTO A;  1PFB A;  3DEP A;  4HCS A;  5EPL A;  2B2T A;  1MGS A;  2B2V C;  1X3P A;  2J7Z A;  2EOT A;  1WTW A;  1WTP A;  2HCC A;  1BBX C;  1CM9 A;  4HAE A;  3G7L A;  2B2T C;  4RWS C;  1B50 A;  1DON A;  4ZAI A;  2EPB A;  1WTQ A;  1GUW A;  1MI2 A;  1VMC A;  1XX8 A;  4HSV A;  4X3K A;  2MP1 A;  2JYO A;  2HDL A;  2RSN A;  1HFG A;  1TVX A;  1U4M A;  1ILQ A;  3DEO A;  5D65 A;  1F9Q A;  1NR4 A;  3D6W A;  1S4Z A;  1ZXT A;  2XIW A;  2L1B A;  4IUR A;  4XT1 B;  3UI2 A;  2M2L A;  3MTS A;  1U4L A;  2RSO A;  1J8I A;  1DOK A;  1SSO A;  1X32 A;  1AP0 A;  1SAP A;  5JJZ A;  1WTR A;  1BF4 A;  1E0B A;  1EOT A;  3I91 A;  4R9W A;  4OIK A;  1VMP A;  2K28 A;  4HED A;  5EPK A;  5T1G A;  5CBA E;  1G91 A;  1HUM A;  2B2Y C;  2R3Z A;  2SDF A;  1C8C A;  1PDQ A;  2KEE A;  2FFK B;  1WD1 A;  1PFN A; 
#chains in the Genus database with same CATH topology
 1PHJ A;  1R4P B;  2Z8L A;  5BR8 L;  1UNS A;  4R1J A;  1A15 A;  2K01 A;  3T1Y Q;  2IHF A;  5I2X A;  1QVC A;  2NZ1 D;  4KY6 A;  3QJY A;  4FP5 D;  1F9R A;  2D0O A;  2F0J A;  3EA6 A;  2JXM B;  3H09 A;  2HD3 A;  5JVG 3;  1XMO L;  3TRE A;  1IBM Q;  4DUY Q;  1SLJ A;  1A62 A;  2E2I H;  1IL2 A;  3RD4 A;  4IPG A;  1B4O A;  3GP7 A;  1F9P A;  3S2D B;  2A6E C;  2X6L A;  4C1N K;  3RN5 A;  1RDP D;  1VQG A;  1F2Y A;  4BA2 I;  5IYB G;  1FVI A;  4CJ0 B;  3NXW A;  5G3L D;  3HZX A;  5C0X G;  5TSS A;  4GLX A;  2MQH A;  4GLA C;  2PQA B;  4XDX A;  1O78 A;  3NBH B;  4X3S A;  3GTO H;  4YHH Q;  1TWG B;  1LLR D;  4IOA A;  1V8Q A;  3EFX D;  3OWE B;  1B53 A;  1X6O A;  3I55 A;  1BBW A;  1EYD A;  1HPC A;  1SNM A;  2UXC Q;  4C3J B;  1L0Y B;  4YY3 Q;  4JI5 Q;  1XPR A;  3JAM i;  4OIJ A;  1CUK A;  4A3M H;  3M7N A;  1I3Q B;  4O1N A;  1HUN A;  4CKC A;  1IYU A;  4C3H B;  2B39 A;  1YNN C;  5LL6 X;  4X62 L;  2QEJ C;  2DY7 A;  4NKL A;  3NTH A;  3U9O A;  5C4H A;  3QO2 A;  4X3U A;  2A5H A;  3KK7 A;  1I4P A;  3I4M B;  5M3F B;  3FVQ A;  1W6J A;  4OXP A;  2SNM A;  2HUG A;  2UUC Q;  4RKB A;  4IUV A;  2PNR C;  2Y0S E;  4KKT A;  3VDY A;  3HOY G;  3IKJ A;  3TME A;  5COY A;  4IJH A;  5BR8 Q;  4BBR G;  3P1H A;  1HNW L;  3M3Y B;  4BBR B;  4JI4 Q;  4G7O C;  4X64 Q;  5DM6 3;  4FDB A;  2R7F A;  1H9K A;  3ZJY C;  4C1N I;  3TS0 A;  4X3K A;  4ZQ3 A;  5FLM G;  4A3E G;  1O7I A;  2O2L D;  1K83 H;  1OXT A;  2WII B;  1I4R A;  3J7A F;  2OEO A;  2WAQ G;  3ND9 A;  1GJX A;  4DXG A;  3P20 A;  4DAP A;  4PMB A;  5IGD A;  3QG1 A;  1IBK Q;  4XYO A;  1BF4 A;  3HOU G;  3I91 A;  5ISR A;  1I6H B;  1F2M A;  4DUY L;  2SDF A;  3K5O A;  3OMG A;  4HIO A;  1QIL A;  1Q86 C;  2RKS A;  2FJ2 A;  2NB0 A;  3LX0 A;  4PQX A;  3H91 A;  1B2T A;  2NVY H;  1TU2 B;  5I9O A;  1AE2 A;  1VDZ A;  4RGM A;  2BA1 A;  1X3G A;  4BY7 B;  1EY0 A;  1D1I A;  2B8F A;  4A75 A;  1PTO D;  2VXW A;  4GNX C;  1PFM A;  5K36 G;  2TMP A;  5FLM H;  2GA4 B;  5I2Y A;  1DM0 B;  3BYT B;  1EL0 A;  1G51 A;  1PRT B;  2R7Z H;  2KOL A;  2VUM G;  2CFM A;  3FP9 A;  3RZO H;  2K4K A;  2UUA L;  1XTD A;  1WVL A;  3BVZ A;  5C44 B;  3SGI A;  1NAP A;  3P7J A;  3N6R A;  1BKB A;  1PMR A;  3I73 A;  1LTG D;  1STN A;  1DXM A;  1O7L A;  4IAL A;  3PO3 H;  2OXP A;  1RHP A;  2L4N A;  3D4D A;  3K0Y A;  5EAY A;  2BE5 C;  3PIP A;  3CCL A;  2JK8 A;  3K5N A;  2AWN A;  2HT1 A;  2Q8R E;  3KJP A;  3LWE A;  1BQQ T;  2QA4 A;  4DV5 Q;  1J5E Q;  3H3V I;  4A3G H;  4A3M G;  4I7Z C;  1U9R A;  5L37 A;  3RLN A;  1CSP A;  2MO1 A;  2ZTC A;  4QB4 A;  2VQF L;  3CC4 A;  5FOB B;  1SMX A;  2F0P A;  1QCB D;  2NBF A;  1Y1W B;  1VQL A;  2JYO A;  2PO4 A;  1Y1W G;  3AU7 A;  3K59 A;  1IW7 D;  1NR4 A;  3OW7 A;  1HNZ L;  5EBC A;  3PO3 G;  2K5W A;  1Z7T A;  5BN5 A;  2PQA A;  4ALP A;  1II3 A;  2CW0 D;  5C0X J;  1DJR D;  5ELF A;  1EFW A;  4MTN A;  5M3M G;  1ONL A;  1YNN D;  3NSW A;  2EDG A;  1AH9 A;  1HTP A;  5GQO A;  4UP7 A;  3U50 C;  1MBY A;  4JVZ A;  3K7A H;  3OYY A;  1J9O A;  5GAH C;  4KHZ A;  2VNU D;  3KUP A;  2F03 A;  4XT3 B;  4DR5 L;  3L3O C;  4IUU A;  1NNX A;  2UXD L;  3DLL A;  3EIV A;  1A2T A;  2OCE A;  4KI0 A;  1TS5 A;  2XNA C;  1WFQ A;  3KYH C;  5JVH 3;  2HHH Q;  3S17 B;  4KY7 A;  4B08 A;  4B3M L;  1JJG A;  2F0K A;  4RHR A;  4CJ1 B;  1IKL A;  3S16 H;  2Q8T A;  1VQ5 A;  1O80 A;  3E6Z X;  5D3I B;  1X3Q A;  2RDF A;  3MXN A;  4GNX A;  1VQP A;  2VQE L;  1HJP A;  3CD6 A;  3LWU A;  1TT2 A;  5F2D A;  1YIJ A;  3MXN B;  2KCC A;  4A4I A;  1IZ6 A;  2LXK A;  2RCN A;  1RL2 A;  2R92 B;  1N8R C;  4DV7 Q;  5FO9 B;  5C4Z A;  1VQ8 A;  3C46 A;  5C4X G;  3HKZ B;  3V96 A;  2K05 A;  1LT5 D;  4GKJ Q;  4EVO A;  3S1M H;  2K52 A;  3S15 B;  5CBE E;  3S17 H;  1U5K A;  1IW7 C;  2AQ2 B;  1E2W A;  2E75 C;  4DV1 Q;  4GOP B;  1GVP A;  1A3U A;  2B3G A;  1NJI C;  3FHW A;  2MPM A;  5CGK A;  2ZM6 L;  4C3H H;  3PIP 3;  1XMQ L;  2QEX A;  3BS1 A;  5K5P A;  4DV7 L;  4TVA B;  3W2D A;  3ERO A;  5FLX c;  4DAY A;  3CCQ A;  4A76 A;  1I6H H;  5C3E B;  3A0J A;  3G6E A;  4P74 A;  4DR3 Q;  1MI2 A;  1PRT D;  1H95 A;  4H0L C;  4CKB A;  2AMC B;  1F9Q A;  1X65 A;  3UDI A;  1LT6 D;  2L0C A;  2F0M A;  1D5X C;  1AP0 A;  4R4T A;  1STY A;  3MFY A;  2PPB C;  4JYA L;  3KF8 B;  2WB1 E;  1E0B A;  2UUC L;  5IGE A;  4R9W A;  1ET6 A;  3AB9 A;  3I70 A;  4RGO S;  2AUK A;  4DR6 Q;  3CCR A;  4FF2 A;  1JOK A;  4M8A A;  3I7F A;  3PMF A;  4JW0 A;  4EQO A;  1S5C D;  3NEN A;  4RAU C;  1PH1 A;  1F9S A;  1QNK A;  5C5L A;  3RN2 A;  1PZI D;  1QVF A;  2WKC A;  4HTH A;  1M8A A;  3H6M A;  1J6Q A;  2QF7 A;  3IFT A;  4YY3 L;  4XQQ A;  3Q24 A;  2EQS A;  1GXD C;  5JEA G;  3T56 B;  1EIY B;  1SN8 A;  3UE0 A;  1QUQ A;  2R92 G;  2RF4 A;  3KDF A;  2JEA I;  1C7Y A;  2XSC A;  1ILP A;  4O42 A;  2B2U A;  1I3Q H;  4YHH L;  1EY8 A;  5IWA L;  4A3J G;  1HFN A;  1EUJ A;  1PLF A;  3PO2 B;  1K3R A;  1HZC A;  4A3J H;  3RZD B;  2D9U A;  4BXX H;  3STB D;  2K04 A;  4JI7 Q;  3K8A A;  1SYD A;  1KL9 A;  2B8G A;  1I94 L;  4BBS G;  4BXX G;  3FMC A;  3KF6 A;  3GQB A;  1QB5 D;  4KY5 A;  2EY1 A;  3I4M H;  4LF9 Q;  4HCE A;  3S2H H;  4R8N A;  3NHH A;  5J22 A;  2DN8 A;  1L1O C;  5EBD A;  3S1R H;  1XNR Q;  3VR6 A;  1NCV A;  4B3M Q;  2IPK D;  2Y0S B;  3CW2 C;  2KHI A;  4DGZ A;  4F7X A;  3J81 L;  1Q7Y C;  3CC2 A;  5GAE C;  1PH7 A;  4MNO A;  2VW9 A;  5CV5 A;  1TXY A;  1JJC B;  4DR6 L;  2E2H B;  2MFI A;  1EQV A;  2EYH A;  1KC8 C;  3CCU A;  1MSG A;  1VF5 C;  2MHV A;  5K36 H;  1DGS A;  1B44 D;  4R4I A;  3PSI A;  4A3C H;  4LJZ C;  3HOX G;  2QKI C;  1HCZ A;  3DEP A;  1EZ6 A;  1PYB A;  3S1R B;  3RLO A;  5IP7 H;  1WTP A;  1Z6H A;  1CM9 A;  3GTL H;  2CW0 C;  1PZJ D;  1WCM G;  2D5D A;  3AMU A;  3D6C A;  2VL6 A;  1HFG A;  1ILQ A;  1D6E C;  1S4Z A;  1XPU A;  1YHQ A;  3I2Z A;  2JSO A;  2L1B A;  4KMU C;  1CHP D;  4QIW E;  3R2T A;  3PUX A;  3W1G A;  4RGT A;  2CQA A;  3KF8 A;  2ASB A;  1LUZ A;  5FKA C;  2HIX A;  3JAM c;  3DM3 A;  4I65 A;  2KEE A;  1V1P A;  4CHT B;  4O0A A;  2E8G A;  1KLG D;  4DR3 L;  1CA6 A;  1TWH H;  1TWA H;  3S1N H;  4LF7 Q;  2K33 A;  3A7L A;  4RKL A;  4N8F A;  2KUM A;  3BU2 A;  1UAP A;  2VY3 A;  2CWA A;  3K7U C;  5E4W C;  5E3F A;  1EIG A;  1JC7 A;  4WOR A;  1WTO A;  4P75 A;  3I8Z A;  1YIT A;  1XTC D;  3NWT A;  3BZD B;  1KAW A;  2JE6 I;  4FXG C;  1E2V A;  1B9N A;  1PFS A;  4DR4 Q;  1D2B A;  4DR7 Q;  5AJ3 L;  1N32 L;  5KNC A;  1XNQ Q;  4QL5 A;  1JOO A;  1PVO A;  3K5M A;  1Q8I A;  3V2T A;  4A3F G;  2OF1 A;  4PV1 C;  4K8J A;  3Q8D A;  1SRO A;  1PH3 A;  1JR0 D;  3A5Z B;  1JB3 A;  2N3S A;  3G6J B;  4S3S A;  1B3A A;  1STH A;  1L1O A;  2VB3 X;  3OMC A;  2F0H A;  2K5V A;  1Y8O B;  4PMC A;  3CCE A;  3PUY A;  4JOI C;  3M4O H;  1YNJ C;  3E3X A;  3J81 E;  4A3M B;  4LFC Q;  3KLW A;  4IFD G;  4DNR B;  3H3V H;  4A3K G;  1L0X B;  4K5W A;  4NXM Q;  1HNW Q;  1E1T A;  3CU7 A;  1DOM A;  1SR3 A;  1TS4 A;  4YWK A;  1LTS D;  1K0R A;  1LTB D;  4RHS A;  3UDF A;  4BWG B;  1Q82 C;  2YU9 B;  2FXQ A;  4JI6 Q;  3BJU A;  5IYC H;  4DV5 L;  5G3L F;  1EYA A;  2UUB Q;  1VQD A;  3N52 A;  3HEJ A;  3M3Y H;  4QQB X;  2BH8 A;  1Y8N B;  2MO0 A;  4DXF A;  2QDB A;  4A3B B;  4C3J H;  1AW7 A;  2L55 A;  2XGT A;  5C44 H;  3K57 A;  4HAE A;  5LMU Q;  1VF7 A;  1TQO A;  3AYH B;  1AE3 A;  5LMN W;  3T13 A;  2UUA Q;  1D5M C;  1I4Q A;  5C3E G;  1IBK L;  1H9S B;  1RF2 D;  3CHB D;  3CRL C;  4L5Q A;  4P72 A;  4IPH A;  4K14 A;  4LF6 Q;  4B9X A;  2OWO A;  1X3E A;  2N49 A;  4YIJ A;  2SNS A;  2LSS A;  1XNQ L;  2Q2H A;  2LXJ A;  4DV6 Q;  3F2D A;  4UY8 C;  2JA8 B;  1JCK B;  4KHV A;  4JI4 L;  4JV5 L;  1EEF D;  2I0Q A;  1STA A;  4TQU S;  5LMU L;  4YCV A;  1UUP A;  1J5E L;  1IBM L;  2A68 D;  4JG2 A;  3HKZ G;  4DR5 Q;  3OTO Q;  1GHK A;  1K83 B;  1L0W A;  4NW2 A;  5CC4 A;  1ICW A;  1K28 A;  2OQK A;  1F77 A;  2MUY A;  1XYI A;  1Q1E A;  3HOW H;  3LNN A;  1RCV D;  2N55 A;  2OT2 A;  4UPA A;  1CA5 A;  1M4V A;  1F2Z A;  3HOW G;  4DK1 A;  2QDL A;  1EYC A;  2F4V Q;  1Q12 A;  4K2L A;  3OIP A;  4CBV A;  3QWN A;  1PZK D;  1VQ7 A;  1VQA A;  2PW5 A;  1SXT A;  4H7B A;  4A3G G;  3PIO 3;  1FR3 A;  3I4N B;  2UXC L;  3M4Y A;  3S15 H;  2YTX A;  3RZO B;  1WTH A;  5M5X H;  5ELC A;  5NUC A;  3CAM A;  3J81 j;  3NBH A;  2DJF C;  2N78 A;  2Z6K C;  4UHV A;  1EWI A;  2KEN A;  4DV3 L;  3KJO A;  2JA6 H;  4DV0 Q;  3VR4 A;  5JJI A;  4AH6 A;  2DNE A;  3KBG A;  5EKL A;  3F8T A;  3FRP B;  5GRO A;  4CDC C;  2KHJ A;  2F52 A;  2A6H C;  2K7V A;  1DOL A;  2RDH A;  1PH9 A;  2JA7 G;  1GO3 E;  4GOP A;  2F0G A;  4DR4 L;  5D14 A;  1D7Q A;  4F87 A;  1SJE D;  5M5X B;  1H9J A;  1SDF A;  2NTT A;  1RKN A;  2A74 C;  2EXZ A;  1WCM B;  4JBW A;  1PTO C;  5ELB A;  2ZT9 C;  1K8M A;  3UDX A;  1KD1 C;  2CH4 W;  1KTK A;  2M00 A;  3PV0 A;  1JMC A;  4NXM L;  5JJL A;  3S2D H;  1SNC A;  1VS0 A;  2HIV A;  3BVG A;  4GN5 A;  3QR8 A;  5IP9 H;  2HCC A;  1VQH A;  5C3X A;  4PZ8 A;  1IYV A;  4L8J A;  4DR2 L;  1VMC A;  4L6T B;  4B3S Q;  1GHJ A;  5M3F G;  5ELE A;  4Y7N H;  4QF4 A;  1Q81 C;  2XN9 C;  5IGG A;  5LHY 1;  1EQQ A;  1M90 C;  2NN6 I;  3SK4 A;  3HOZ B;  4DR1 L;  4DAV A;  4HR7 B;  1YNJ D;  5H1S E;  4OWT B;  4GOP C;  1FJG L;  3CCS A;  4DR7 L;  1JOR A;  2EYF A;  5EPK A;  4U67 3;  3ULP A;  1IBL Q;  1HUM A;  2B2Y C;  2Q8I B;  1ESR A;  2L11 A;  1EQT A;  3R8B A;  4A3D B;  3A8J E;  3HOX H;  1N34 L;  4PZ7 A;  3DMU A;  2EYO A;  1XMQ Q;  2YTV A;  5A2Q L;  1STB A;  2Z6K A;  3S24 A;  5DEH A;  5ELN A;  5C4X H;  3CPF A;  2WAQ B;  4JI1 L;  4DV3 Q;  4QJF A;  2KVM A;  4DV2 Q;  4NXN L;  1VQC A;  1BNZ A;  3OHX C;  1Y1W H;  1X56 A;  3R3O A;  2Z1C A;  4UDU C;  1N34 Q;  4G57 A;  3HOZ H;  4L63 B;  1A0I A;  1PTO H;  4BBR H;  4X65 Q;  1Y1V B;  1L1O B;  1C48 A;  1SE8 A;  2KJX A;  2B63 B;  4JI5 L;  3GTK B;  1NTG A;  3J7Y W;  3KOJ A;  3RR5 A;  2EXD A;  2VS1 A;  3MHB A;  1D5Z C;  2GN5 A;  3HOV H;  2LMC B;  4LAA A;  4LF9 L;  4DV2 L;  3A8K E;  1KRS A;  1NR2 A;  1TS2 A;  4DN4 M;  1CKN B;  1MJE A;  2LKV A;  5IT9 c;  1DZ1 A;  3BYY B;  1QE6 A;  2FHT A;  2E2D C;  3M4P A;  5KGU A;  3ULL A;  2CHB D;  1A2U A;  2N8N A;  5KRU A;  4LNQ A;  2E2I B;  1G2T A;  4KD3 A;  4GZY C;  1ESF A;  1U4P A;  1T5E A;  1S3O A;  3HOZ G;  2F4I A;  2F3V A;  1SYF A;  1Q90 A;  2IL8 A;  2EY6 A;  3A56 A;  3GTJ H;  1PFB A;  3GTO B;  4OEM B;  4L5R C;  3NUC A;  3S14 B;  5C3W A;  3PUW A;  1GUS A;  2XTI A;  3WOF A;  4ZAI A;  4YCW A;  1WTQ A;  3X3N A;  3KLS X;  1TII D;  1XX8 A;  2A8V A;  3KDF B;  3ITP A;  3VYU A;  2WKD A;  2EYL A;  1YJW A;  3Q0A A;  3KLS A;  5BN4 A;  1U4L A;  2I5L X;  2F0T A;  2EIF A;  3NQI A;  1SAP A;  2XRS D;  3PGZ A;  1Y1V H;  1GUT A;  1B3Q A;  2YYZ A;  2EVB A;  2NVT B;  3NBI A;  2FFK B;  1WD1 A;  3IFD A;  3HOV B;  5AJ3 Q;  3K0X A;  4GNX B;  1LTT D;  3WOE A;  5IYC G;  2Z4H A;  1AN8 A;  3O13 A;  3OW2 A;  1CFM A;  2VQF Q;  1SNO A;  4CDE C;  2B63 G;  2ICE C;  1TWG H;  3MWY W;  3NEL A;  1SMY D;  2JJQ A;  3I4N H;  3I4L A;  3SDZ A;  2BH2 A;  1FL0 A;  4JI2 Q;  2JQO A;  3E0E A;  4DV4 Q;  2BDO A;  3HG9 A;  3HKZ E;  4QIW B;  4CKE A;  2C35 B;  2UU9 L;  2R7D A;  2L9H A;  4BBS B;  2EYP A;  2A1A A;  4RCO A;  2NYZ D;  1CHQ D;  1ASY A;  2BOS A;  4HIM A;  2K5D A;  3KF6 B;  3M7G A;  2EJG C;  5CMD A;  3HFZ B;  1ROD A;  3CKI B;  4B3T L;  5IOC A;  4R8I A;  1TWC H;  4LFA Q;  4LF4 Q;  4RGN A;  4QCL A;  5M5Y B;  5IP9 G;  1PV4 A;  3H15 A;  2JA6 G;  1QG7 A;  5FJ8 H;  1LAC A;  1SMY C;  4EQP A;  4EQ5 A;  1X3F A;  4DAY B;  4QUF A;  3D4W A;  3L2P A;  1K9M C;  2UXD Q;  1S40 A;  2B2Y A;  1LTR D;  4QGU A;  3J80 E;  4IFD J;  1CK1 A;  2AHO B;  2H4O A;  3ULJ A;  3CXC A;  2JA8 G;  1YBY A;  2ZJP A;  3K7A B;  4JCV E;  3STB C;  1TWC B;  3J81 c;  3W5O A;  2PZT A;  2EY2 A;  4KHP Q;  2BE5 D;  3VYR A;  3F2U A;  5E4X A;  5J1Z A;  1WTV A;  1Q3L A;  3ERQ A;  3MAQ A;  1RIP A;  1YEZ A;  1HXY D;  1Y69 U;  3G48 A;  4FYD A;  2A68 C;  1Z47 A;  2F1M A;  2JA5 B;  2EYM A;  3G7L A;  2B2T C;  4DKA C;  3RLF A;  2JA5 G;  3RNU A;  3EBE A;  4DPG A;  4IUN A;  4L5S A;  3DEO A;  1S5E D;  3L0O A;  1WCM H;  3HOX B;  1LT4 D;  4IUR A;  3HOY B;  2OTJ A;  1K8G A;  4B3R L;  5C4X B;  4IPD A;  2PI2 E;  3SK5 A;  1C0A A;  2K50 A;  1EY7 A;  5M9O A;  4JI8 Q;  4KKU A;  4MZ9 A;  3CCM A;  3HOW B;  4Q0F A;  2ZJR A;  1RTN A;  4HJ7 A;  1A3V A;  1KDA A;  2J0T D;  3C1E A;  3H3V C;  3GV3 A;  4LF8 L;  4L5T A;  4A3G B;  2K32 A;  3FKI G;  2JA5 H;  3HS0 C;  4LF5 L;  3QOJ A;  4GS3 A;  1PYW D;  1G2S A;  4NP5 A;  1I50 B;  1R9T B;  4IUT A;  3TZD A;  4LFC L;  3NK9 A;  4DA2 A;  2B2U C;  4HN7 A;  4LF4 L;  4CJ2 C;  4X6A H;  2BDN A;  3I72 A;  4AYB B;  5IT9 L;  5C4J H;  4HJ9 A;  1L2F A;  4UAI A;  2HQE A;  1KNA A;  5J3B A;  2F0D A;  4J15 A;  4BY7 G;  4GN4 B;  4NMZ A;  5IGF A;  3U4Z A;  2NVQ B;  1VQM A;  3TP7 A;  4HIK A;  5JAV A;  4KKS A;  3EJI A;  4I7A A;  3L7Z C;  3MZ5 A;  5FLX L;  3GTG B;  2ZJQ A;  1HQR D;  2FIN B;  3E9I A;  3DUZ A;  1PTO B;  5JPM C;  1PH6 A;  1EIH A;  3CF5 A;  3L9A X;  2ES2 A;  1N36 Q;  4TRD A;  3NTK A;  3EQL C;  2ZTE A;  3DXJ C;  3NTI A;  4ZUI A;  4G7H C;  2ZM6 Q;  3U58 A;  3MC0 B;  4X62 Q;  2E76 C;  4WJ4 A;  3S16 B;  3HGB A;  1NY4 A;  3GV6 A;  3MVV A;  3T1H Q;  1XMO Q;  1QJO A;  4BY1 B;  5I6W A;  4X66 L;  1N36 L;  1MGS A;  2RHS B;  4C3I H;  2Y0S G;  2NN6 H;  1B8A A;  3Q22 A;  1FJG Q;  4MIU A;  1IHZ A;  5JEA J;  5IWA Q;  1U4M A;  1CSQ A;  1FNW A;  2XIW A;  4XT1 B;  3OOC A;  2M2L A;  2O5I C;  3AFP A;  4N9T A;  2F0N A;  2EZV A;  1ASZ A;  1YVC A;  3GTM H;  3E0J A;  4X66 Q;  1K8O A;  1BBU A;  2O4X A;  4FF3 A;  2TSS A;  1EQR A;  2RHQ B;  4IPC A;  5JPN C;  3H94 A;  3VA5 A;  2L5T A;  2K03 A;  2QW7 A;  2KEC A;  5FJ8 G;  2RVL A;  1XNR L;  1B9M A;  4AYB G;  2K75 A;  2KCM A;  1HZ9 A;  4HJA A;  5EKI A;  3D8G A;  5EGT A;  4R4C A;  3EN2 A;  3C3L A;  5IIF A;  4KV6 A;  4C2M H;  4JI3 Q;  2M9V A;  4XQN A;  4EX5 A;  1DD2 A;  1BUV T;  1LYL A;  1A63 A;  2CVR A;  5M5Y H;  1U0L A;  2PMZ E;  2EY5 A;  5IY0 A;  3PCO B;  1G6P A;  4PG3 A;  2R92 H;  4JV5 Q;  1ZEQ X;  2ID0 A;  1S72 A;  1NUC A;  4JBM A;  2CCZ A;  5FLX E;  4GN3 B;  5FO8 B;  1NE3 A;  1SE4 A;  2A73 B;  2O5J C;  1CKM A;  1FGU A;  4JI0 L;  2PCF B;  1XXG A;  4P73 A;  4HSP A;  1HNX Q;  2B2W C;  4BBS H;  5C6A A;  3D3R A;  4RCN A;  1GKH A;  1O7Z A;  1ML0 D;  4AQY Q;  1T9H A;  2Z4I A;  1EY6 A;  3VYS A;  1WJJ A;  3NQT A;  1HZA A;  4OON A;  2JA7 H;  3A8I E;  2CWP A;  5M5W H;  2B29 A;  2LFN A;  4K6D A;  5CV6 A;  1CQF A;  3AFQ A;  2DNC A;  3CME A;  5ELO A;  1BVS A;  2ZXP A;  4O2D A;  4IO9 A;  5C3E H;  2R6G A;  2WB1 G;  1QNU A;  1ZYR C;  4DAM A;  1HR0 W;  2CQO A;  1PH8 A;  4LUZ A;  4DUZ Q;  2L15 A;  4WJW A;  3K81 C;  1JT8 A;  2J7Z A;  2EOT A;  3C1F A;  4LFA L;  4DV6 L;  1OXV A;  4E6I A;  1G8Z D;  1PA6 A;  4DU9 A;  3AEV A;  3S1N B;  1VQE A;  2PW7 A;  4KLK A;  3MTS A;  4A3K B;  3U4V A;  4FVM A;  1CTM A;  1KAB A;  1VQJ A;  2D62 A;  5JJZ A;  1V9P A;  1YHB A;  2E5L L;  4RMF A;  1Q46 A;  4ME5 A;  4JI2 L;  3FKI B;  4KN4 C;  5IE8 A;  1E3P A;  4ABN A;  3VYT A;  1Y14 B;  2ZXR A;  3B6Y A;  4DK0 A;  2HDM A;  4LF8 Q;  4A3I B;  1JE5 A;  1GUG A;  1DYQ A;  3TQY A;  3Q23 A;  2KCN A;  2HHH L;  3H0G B;  3J81 i;  1UEB A;  1KNE A;  1Q8K A;  3CQZ H;  2E2J H;  1HRJ A;  2JA7 B;  3SHL A;  3QB3 A;  3K5L A;  3EVQ A;  1W2B A;  3SK6 A;  3GTL B;  1AZQ A;  2QGQ A;  4J8Q A;  4JI8 L;  4OX9 Q;  4A3F B;  2MJ8 A;  4ZKC B;  5IGB A;  4IUP A;  1HH2 P;  3AQQ A;  1I4H A;  3SR1 A;  5GAD C;  1B1Z A;  1BCP F;  3GTK H;  4FXD A;  1JB7 A;  1EU4 A;  3I3C A;  4K0K L;  3TN2 A;  4ZKB B;  1LV9 A;  5J39 A;  1N33 Q;  2NZO A;  3M9B A;  4XYQ A;  4KD4 A;  2JEB I;  2MGS A;  4DFA A;  2PYK A;  3IL8 A;  2IJ0 A;  4J1M A;  3TP8 A;  4IN3 A;  3J80 c;  4XTC S;  4BS9 A;  4A3K H;  4K5X A;  2NZH A;  2HCI A;  1MJC A;  1LTA D;  1QWY A;  2F0F A;  5E7N A;  2X6G A;  5EPJ A;  2YV5 A;  1JIC A;  1OXX K;  3FPU B;  1F2L A;  4ZCK A;  3T53 B;  2A19 A;  5BN3 A;  2IT1 A;  4QMG A;  4ZLT F;  2B63 H;  2ZTD A;  2PNH A;  1RTO A;  3OIQ A;  4WRD A;  4XXE A;  3VR5 A;  3GTM B;  2NTS A;  1CZW A;  4G4K A;  5KYI A;  3VR2 A;  1EY9 A;  3TBI B;  3HOU B;  1GM5 A;  1I94 Q;  2NN6 G;  4JYA Q;  1YI2 A;  2F0S A;  3FPP A;  2RSN A;  2WAC A;  3JAM L;  5D65 A;  1NBW A;  2A69 D;  3PQI A;  3W1B A;  2JA9 A;  1Y1V G;  3SE0 A;  2AQ1 B;  1OXU A;  2F0V A;  4DUZ L;  4KTA A;  2ENB A;  3DWQ A;  3PUZ A;  4HED A;  1LTI D;  3CPW A;  2IX3 A;  4N8X 1;  1P16 A;  3BZC A;  4LFB L;  2OQ0 A;  4K6L A;  4ULL A;  3BG3 A;  4HJ8 A;  2F3I A;  3NWS A;  3TEH B;  1BCP B;  4V0B A;  3IAY A;  4RH6 A;  1E22 A;  1KDB A;  5LMN Q;  3OWF A;  4G7Z C;  1G6Z A;  4NXN Q;  3TZU A;  2KED A;  1V1O A;  3DM1 A;  3GTQ B;  4FF4 A;  4GLV B;  3ERS X;  5KYL A;  4KK7 A;  4C3J G;  4DV1 L;  1AZP A;  3ICE A;  4AYB E;  3T1Y L;  3MXP A;  2R93 B;  4APV A;  1HTL D;  5DAU A;  2ATW A;  1B70 B;  1PRT F;  1I4X A;  5DLQ E;  5CYU A;  1VQO A;  4H44 C;  5COR A;  4A3J B;  2R61 A;  3RZD H;  3PIO A;  3G71 A;  4ID6 A;  4OL7 A;  1SBB B;  2UXB L;  2JN4 A;  3I4M G;  1SFO B;  1PTO F;  3BDO A;  5I9P A;  3PF5 A;  5IYB H;  3VA7 A;  1UEA B;  3MXG A;  4JOI A;  4CDF C;  3CC7 A;  2IX0 A;  5C5M A;  1VQB A;  2IW3 A;  4BY1 G;  3MXU A;  5LL6 S;  1CKO A;  1TY0 A;  1X54 A;  1I4G A;  1V1P B;  3GTQ H;  1O7Y A;  2VZA A;  1PRT C;  5DNF A;  3CP0 A;  4OWX B;  3A5U A;  3F2C A;  4XIG S;  3GTP H;  3KLR A;  2K14 A;  4KN7 C;  3HP3 A;  1YHA A;  1FD7 D;  1BOS A;  2V4D A;  2Z9H A;  1SFO H;  3SXH A;  3K6O A;  2A6H D;  1FYC A;  1MKH A;  4QUC A;  5CV9 A;  2DGY A;  4Z9C B;  3PO3 B;  3Q6S A;  4HCS A;  1WOC A;  3UDG A;  1QZH A;  2B2T A;  4TKO B;  2RBM A;  2B2V C;  4OO1 H;  1B50 A;  4C56 C;  1GUW A;  4HJ5 A;  3TP5 A;  1TWF H;  3CCV A;  1UE6 A;  4JI7 L;  4A3I H;  1KIX A;  1C4Q A;  3RMH A;  1S5F D;  1SJH D;  1X32 A;  1OO9 B;  3H0G H;  1BDO A;  2F0I A;  3BDL A;  1SEB D;  5CBA E;  2K6A A;  2R3Z A;  1TS3 A;  2EJM A;  1PDQ A;  1CQV A;  2QCP X;  4IZ8 A;  4CDD C;  1HHV A;  1K73 C;  1UE7 A;  4OWW B;  2UU9 Q;  3D31 A;  3NEM A;  2V1C C;  3J80 L;  5HGT A;  3OTO L;  5CV7 A;  1T5X D;  2B2V A;  1TKW B;  4C3I B;  3FDT A;  2F0Q A;  4LF7 L;  4UP9 A;  5IP7 G;  3J7A 5;  1EY5 A;  3URY A;  1EIF A;  4H02 A;  2K5N A;  3D4R A;  1D8L A;  4AQY L;  4B3T Q;  4HID A;  4RG1 A;  1P8L A;  1SE2 A;  3K80 C;  3HOY H;  3SK8 A;  2XWB B;  4GKK Q;  4ME3 A;  5C0X H;  4OEL B;  2LS0 1;  4LMQ D;  4A93 G;  5EQ0 A;  1FGB D;  5HUR A;  3WDN A;  2Z0S A;  1HNZ Q;  1GOZ A;  2CKZ B;  5JOB A;  1WD0 A;  4U68 A;  3BVM A;  5HY6 A;  3OPO A;  1NMG A;  2WP8 J;  5EJW A;  2N88 A;  1E1O A;  2F3W A;  2JP1 A;  2LY7 A;  1HA5 A;  1SYC A;  1FNV A;  3FEW X;  2EYJ A;  4JI6 L;  1STG A;  3U9S A;  4DF7 A;  1K0S A;  1K3B C;  1KDC A;  4OX9 L;  3IRB A;  2F0O A;  3ZYY X;  1PH5 A;  2WAQ E;  2RCF A;  1PYS B;  1SRU A;  3ER0 A;  1N9W A;  2A6E D;  3SVM A;  5CR3 A;  1CKN A;  4JPB W;  4LFB Q;  2RA4 A;  3GTG H;  3C2P A;  1V1Q A;  2Q2T A;  3KBX A;  3MA2 B;  4NB3 A;  2NVQ H;  3QIA A;  1HNX L;  3G4S A;  4RWS C;  2NVT H;  2D2C C;  1ICF B;  3BZK A;  2I5M X;  2XVS A;  3T51 B;  2OTL A;  4ILW A;  2E5L Q;  1SNQ A;  4GKK L;  1E7Z A;  2BCO A;  2KBN A;  3A7A B;  4YCU A;  4OIK A;  1VMP A;  3S1M B;  5T1G A;  1A8V A;  5GAG C;  1ENF A;  1C8C A;  4IFD I;  4KHP L;  2VB2 X;  1PFN A;  1S5B D;  3R93 A;  3GO5 A;  2R93 H;  4OGQ C;  4PNY A;  1E2Z A;  1ZKO A;  2G9H D;  4MHE A;  2R93 G;  2I46 A;  4R4Q A;  4ODG A;  4JI1 Q;  4CGY B;  4LF5 Q;  4A3L G;  3TP6 A;  4A3F H;  1VQ6 A;  1VQI A;  1VQF A;  1B7Y B;  1X55 A;  2J4X A;  4RA8 A;  4BY7 H;  5M3M H;  2UUB L;  3PO2 G;  2C9O A;  3HOV G;  1ZYR D;  1OTC A;  1KRT A;  1TWA B;  2XWJ B;  1NMF A;  3TSS A;  1XPO A;  1W3S A;  4FO2 A;  2F0L A;  2K5Q A;  1KAA A;  1W6K A;  2F0W A;  3S1Q H;  1WTX A;  2VUM H;  2R7Z G;  1EY4 A;  1H9S A;  1KLU D;  1E24 A;  1MSH A;  4LF6 L;  1S5D D;  3OSO A;  3E5S A;  1JE4 A;  1STE A;  3D0F A;  3RUZ A;  4P2C B;  2F0E A;  1XJV A;  1QUQ B;  1SYG A;  2KHS A;  2NWG A;  3DWA A;  2Q2I A;  1VQN A;  1QZG A;  4A93 H;  4MN3 A;  1H9R A;  2IHE A;  2K1B A;  4ZYS A;  1AEX A;  3F1Z A;  5AFW A;  2EE1 A;  1U4R A;  4EQN A;  2PI2 A;  2X69 A;  1K8A C;  4LW1 A;  4IFD H;  1YJN A;  2NVY B;  2L12 A;  2E74 C;  3VR3 A;  4OO1 G;  1PH4 A;  1JJ2 A;  3HKS A;  5M3M B;  1N33 L;  1DON A;  5M3F H;  1TY2 A;  2CH4 A;  1GD7 A;  1I5F A;  3GDE A;  1SND A;  1TVX A;  4JI0 Q;  3J7Z C;  1IBL L;  4KJO A;  4H13 C;  1LT3 D;  4C3H G;  1J8I A;  2HQL A;  1DOK A;  1SSO A;  2AKW B;  1VQ9 A;  1WTR A;  3JC6 6;  3T16 A;  3DWP A;  4K2K A;  3NP8 A;  3X3M A;  2VUM B;  4FXK C;  3A74 A;  2WV6 D;  4C3I G;  1PH2 A;  1G91 A;  5ELD A;  3HRZ C;  3M4O B;  1QVG A;  4A3D G;  5I4D A;  1Q1B A;  2RQX A;  1D1K A;  3PF4 A;  1KHI A;  3S9W A;  2D0P A;  1WYD A;  3T1H L;  2RDG A;  1R9T H;  2E2H H;  4Y52 H;  2H5X A;  4YWL A;  5LMN L;  5KNB A;  1SNP A;  4A93 B;  1NSN S;  1CT1 D;  3HOU H;  1WI5 A;  2AUJ D;  3K58 A;  1UWV A;  1VCI A;  2DY8 A;  2KQ3 A;  4IJL A;  2P5Z X;  1JQY D;  1HQM C;  1VQK A;  4V19 0;  1JOQ A;  2UXB Q;  1MHW C;  1SE3 A;  1EZ8 A;  2FMM A;  5JJK A;  4ZRZ A;  3H0G G;  5EKK A;  2H1E A;  2QIL A;  3A55 A;  3E9H A;  5CV8 A;  4P71 A;  3J80 i;  4B3R Q;  4EGV A;  2WFW A;  1LTL A;  3I4O A;  2EJF C;  2PMZ B;  3ND8 A;  4YWM A;  4NPS A;  1EWC A;  1LAB A;  3CQZ B;  4DR1 Q;  2E2J B;  2GVA A;  4B3S L;  4ZK9 B;  4IUQ A;  2VQE Q;  1BCP C;  1LM0 A;  4JK1 C;  4N9P A;  1IKM A;  3MEF A;  1LO5 D;  4IOC A;  2ALY B;  2B2W A;  5E1F A;  4F88 A;  1TWH B;  5C0X I;  1HA6 A;  3I56 A;  1CI3 M;  5KIX A;  3J7A V;  1YJ9 A;  4K5V A;  4WFN 3;  2K5H A;  3M4Q A;  5KEE A;  1BXT A;  3NPP A;  4A3B G;  2KA7 A;  2MNA A;  1BO0 A;  3WWV A;  1CZG A;  4HMJ A;  2JA6 B;  4X3T A;  3MEH A;  2YTY A;  1PXU A;  3TRZ A;  3KFU A;  4PMW A;  5I6Y A;  3GTJ B;  5IOD A;  2Z6B A;  5EPL A;  1A3T A;  4R4O A;  1I6V C;  1ENA A;  1WTW A;  3S14 H;  4LWC A;  2BA0 A;  1ENC A;  4RFB A;  1JWS D;  4XQJ A;  1H9M A;  4K8I A;  2EPB A;  5KND A;  5C44 G;  3BDC A;  2FMC A;  4HSV A;  2GVB A;  2HDL A;  2DUD A;  4JBJ A;  5A35 A;  3D6W A;  1GUO A;  1HZB A;  1JWM D;  1ZXT A;  5JEA H;  2WB1 B;  2SOB A;  4FNF A;  3UI2 A;  2IWH A;  1HR0 L;  2ZXO A;  4A3B H;  5DM7 3;  3CRK C;  4F8M A;  1EOT A;  1KQS A;  1G29 1;  3V05 A;  3GTP B;  1SYB A;  4POF A;  5CV4 A;  5FO7 B;  4OO1 I;  3F2B A;  4C2M B;  4LUV A;  3MFG A;  2G5D A;  4A3E B;  1I50 H;  3NE5 B;  4Y7N B;  2YU9 H;  3CCJ A;  3S2H B;  1OXS C;  5D3D A;  2SEB D;  4DV4 L;  4PZ6 A;  4DV0 L;  4DNT B;  5M5W B;  3DHQ A;  3A54 A;  3S1Q B;  4J6H A;  1TR5 A;  5C4J B;  3M85 A;  2DJG C;  1BCP D;  2R7Z B;  4GKJ L;  2JA8 H;  1JWU D;  4DK3 C;  1IXR A;  3I4N G;  2NVX H;  5IYD H;  3I90 A;  1Y8P B;  1VQ4 A;  4A3D H;  1SYE A;  3P75 A;  4QY7 A;  1EYG A;  2ICI A;  3CMA A;  1GUN A;  2KCT A;  2PZU A;  1R4Q B;  4TSS A;  1EU3 A;  2I5H A;  3UE1 A;  1YNX A;  2PQE A;  2IY5 B;  1RJT A;  1UE1 A;  4OHJ A;  1N32 Q;  4K0K Q;  3LGJ A;  2F4V L;  2A69 C;  1YZ6 A;  3QOL A;  1V43 A;  1ET9 A;  1EWH A;  2PZW A;  4DR2 Q;  1KXL A;  4A3L H;  2WIN B;  4X64 L;  5HGQ A;  1M1K C;  4A3I G;  1X9N A;  3TDQ A;  4BA1 I;  1A6X A;  4WJ3 M;  4DNI A;  2C5C A;  4NDX A;  4Q5V A;  4LK1 C;  5IYD G;  4BY1 H;  2G9D A;  1FNU A;  3PUV A;  2NUC A;  2NVX B;  4UP8 A;  5T1I A;  2I07 B;  4JI3 L;  5IGC A;  4POG A;  1UE5 A;  3JAM E;  1XWE A;  3SEB A;  4A3E H;  2IX1 A;  4MTK A;  4DK6 C;  4ZUJ A;  5A2Q E;  3W3A A;  1IL8 A;  4A3C G;  4FF1 A;  1Z9F A;  1QOH A;  1IYJ B;  5FK9 C;  1EFI D;  1X3P A;  2AQ3 B;  1BBX C;  1HR0 Q;  1MIU A;  4JBK A;  3FKI H;  4KJN A;  1TWF B;  2MP1 A;  1C9O A;  4M1U B;  1EOV A;  2F0U A;  3R2I A;  4X65 L;  2RSO A;  2AWO A;  4B9W A;  5IT9 E;  1AFP A;  1EEI D;  2Q2U A;  3GD7 A;  4AIM A;  1MD2 D;  4IQZ A;  3T4A C;  3PO2 H;  1RD9 D;  4LUO A;  2K28 A;  2XRQ D;  4HMI A;  1BR9 A;  4JC0 A;  3TS2 A;  1DCZ A;  3ONA B; 
#chains in the Genus database with same CATH homology
 1R4P B;  2Z8L A;  1UNS A;  1A15 A;  2K01 A;  5I2X A;  2NZ1 D;  4KY6 A;  3QJY A;  4FP5 D;  1F9R A;  3EA6 A;  2F0J A;  3H09 A;  2JXM B;  5JVG 3;  3RD4 A;  1B4O A;  3GP7 A;  1F9P A;  3S2D B;  2A6E C;  2X6L A;  4C1N K;  1RDP D;  1F2Y A;  4BA2 I;  4CJ0 B;  3NXW A;  5G3L D;  3HZX A;  5C0X G;  5TSS A;  4XDX A;  1O78 A;  4X3S A;  1TWG B;  1LLR D;  1V8Q A;  3EFX D;  3OWE B;  1B53 A;  1EYD A;  1HPC A;  1SNM A;  4C3J B;  1L0Y B;  4OIJ A;  3M7N A;  1I3Q B;  4O1N A;  1HUN A;  4CKC A;  1IYU A;  4C3H B;  2B39 A;  1YNN C;  5LL6 X;  2QEJ C;  2DY7 A;  4NKL A;  3NTH A;  3U9O A;  5C4H A;  3QO2 A;  4X3U A;  2A5H A;  3KK7 A;  1I4P A;  3I4M B;  5M3F B;  3FVQ A;  1W6J A;  2SNM A;  2HUG A;  4RKB A;  4IUV A;  2PNR C;  4KKT A;  3IKJ A;  3TME A;  5COY A;  3P1H A;  3M3Y B;  4BBR B;  4G7O C;  5DM6 3;  1H9K A;  4C1N I;  4X3K A;  4ZQ3 A;  2O2L D;  1OXT A;  2WII B;  3J7A F;  1I4R A;  2OEO A;  3ND9 A;  1GJX A;  4DXG A;  3P20 A;  4DAP A;  4PMB A;  5IGD A;  3QG1 A;  4XYO A;  1BF4 A;  3I91 A;  5ISR A;  1I6H B;  1F2M A;  2SDF A;  3K5O A;  3OMG A;  1QIL A;  2RKS A;  2FJ2 A;  2NB0 A;  3LX0 A;  4PQX A;  3H91 A;  1B2T A;  1TU2 B;  5I9O A;  1VDZ A;  4RGM A;  2BA1 A;  4BY7 B;  1EY0 A;  1D1I A;  2B8F A;  1PTO D;  2VXW A;  1PFM A;  5K36 G;  2TMP A;  2GA4 B;  5I2Y A;  1DM0 B;  3BYT B;  1EL0 A;  1PRT B;  2KOL A;  1WVL A;  3BVZ A;  5C44 B;  1NAP A;  3P7J A;  3N6R A;  1PMR A;  3I73 A;  1LTG D;  1STN A;  1DXM A;  1O7L A;  4IAL A;  2OXP A;  1RHP A;  2L4N A;  3D4D A;  3K0Y A;  2BE5 C;  3K5N A;  2AWN A;  2Q8R E;  3LWE A;  1BQQ T;  4I7Z C;  1U9R A;  4QB4 A;  5FOB B;  2F0P A;  1QCB D;  2NBF A;  1Y1W B;  2JYO A;  2PO4 A;  3AU7 A;  3K59 A;  1IW7 D;  1NR4 A;  3OW7 A;  5EBC A;  2K5W A;  1Z7T A;  5BN5 A;  1II3 A;  5C0X J;  2CW0 D;  1DJR D;  5ELF A;  1ONL A;  1YNN D;  3NSW A;  2EDG A;  1HTP A;  1MBY A;  1J9O A;  4KHZ A;  2VNU D;  3KUP A;  2F03 A;  4XT3 B;  3L3O C;  4IUU A;  4KI0 A;  1A2T A;  1TS5 A;  2XNA C;  5JVH 3;  3S17 B;  4KY7 A;  4B08 A;  2F0K A;  4RHR A;  4CJ1 B;  1IKL A;  2Q8T A;  1O80 A;  3E6Z X;  5D3I B;  1X3Q A;  2RDF A;  3MXN A;  3LWU A;  1TT2 A;  5F2D A;  2KCC A;  2R92 B;  5FO9 B;  5C4Z A;  3C46 A;  3HKZ B;  3V96 A;  2K05 A;  1LT5 D;  4EVO A;  3S15 B;  5CBE E;  2AQ2 B;  1IW7 C;  2E75 C;  1E2W A;  1A3U A;  5CGK A;  2MPM A;  3PIP 3;  3BS1 A;  5K5P A;  3W2D A;  3ERO A;  4DAY A;  5C3E B;  1MI2 A;  1PRT D;  4H0L C;  4CKB A;  1F9Q A;  1LT6 D;  2L0C A;  2F0M A;  1D5X C;  1AP0 A;  2PPB C;  1STY A;  3MFY A;  1E0B A;  5IGE A;  4R9W A;  1ET6 A;  3AB9 A;  3I70 A;  4RGO S;  2AUK A;  4FF2 A;  1JOK A;  4M8A A;  3PMF A;  4EQO A;  1S5C D;  4RAU C;  1F9S A;  1QNK A;  5C5L A;  1PZI D;  2WKC A;  4HTH A;  1M8A A;  3H6M A;  2QF7 A;  3IFT A;  4XQQ A;  3Q24 A;  1GXD C;  5JEA G;  3T56 B;  2JEA I;  2XSC A;  1ILP A;  4O42 A;  2B2U A;  1EY8 A;  1HFN A;  1PLF A;  3PO2 B;  3RZD B;  2D9U A;  2K04 A;  1SYD A;  2B8G A;  3FMC A;  3GQB A;  1QB5 D;  4KY5 A;  2EY1 A;  4HCE A;  4R8N A;  3NHH A;  5J22 A;  2DN8 A;  5EBD A;  3VR6 A;  1NCV A;  2IPK D;  2Y0S B;  4F7X A;  4DGZ A;  3J81 L;  5CV5 A;  2E2H B;  1EQV A;  2EYH A;  1MSG A;  1VF5 C;  2MHV A;  5K36 H;  1B44 D;  4LJZ C;  2QKI C;  1HCZ A;  3DEP A;  1EZ6 A;  3S1R B;  1WTP A;  1Z6H A;  1CM9 A;  2CW0 C;  1PZJ D;  2D5D A;  3AMU A;  3D6C A;  1HFG A;  1ILQ A;  1D6E C;  1S4Z A;  2JSO A;  2L1B A;  4KMU C;  1CHP D;  3R2T A;  3PUX A;  4RGT A;  2CQA A;  3KF8 A;  5FKA C;  4I65 A;  2KEE A;  4CHT B;  1V1P A;  1KLG D;  1CA6 A;  2K33 A;  3A7L A;  4RKL A;  2KUM A;  1UAP A;  5E4W C;  5E3F A;  1EIG A;  1JC7 A;  4WOR A;  1WTO A;  3I8Z A;  1XTC D;  3NWT A;  3BZD B;  2JE6 I;  4FXG C;  1E2V A;  1B9N A;  1D2B A;  5KNC A;  1JOO A;  3K5M A;  1Q8I A;  3V2T A;  2OF1 A;  4PV1 C;  4K8J A;  1JR0 D;  1JB3 A;  3G6J B;  4S3S A;  1B3A A;  1STH A;  2VB3 X;  3OMC A;  2F0H A;  1Y8O B;  4PMC A;  3PUY A;  1YNJ C;  3J81 E;  4A3M B;  4IFD G;  4DNR B;  1L0X B;  4K5W A;  3CU7 A;  1DOM A;  1TS4 A;  1LTS D;  1LTB D;  4RHS A;  4BWG B;  2YU9 B;  5G3L F;  1EYA A;  3N52 A;  3HEJ A;  1Y8N B;  4DXF A;  2QDB A;  4A3B B;  1AW7 A;  2L55 A;  3K57 A;  4HAE A;  1VF7 A;  1TQO A;  3T13 A;  1D5M C;  1I4Q A;  1H9S B;  1RF2 D;  3CHB D;  3CRL C;  4K14 A;  4B9X A;  4YIJ A;  2SNS A;  2JA8 B;  1JCK B;  4KHV A;  1EEF D;  1STA A;  4TQU S;  1UUP A;  2A68 D;  1GHK A;  1K83 B;  4NW2 A;  5CC4 A;  1ICW A;  1F77 A;  2MUY A;  1XYI A;  1Q1E A;  3LNN A;  1RCV D;  2N55 A;  2OT2 A;  1CA5 A;  1M4V A;  1F2Z A;  4DK1 A;  1EYC A;  1Q12 A;  4K2L A;  3OIP A;  4CBV A;  3QWN A;  1PZK D;  2PW5 A;  1SXT A;  4H7B A;  3PIO 3;  1FR3 A;  3I4N B;  3M4Y A;  3RZO B;  5ELC A;  5NUC A;  3NBH A;  3VR4 A;  2DNE A;  3KBG A;  5EKL A;  3FRP B;  2K7V A;  2A6H C;  1DOL A;  2RDH A;  2F0G A;  5D14 A;  4F87 A;  1SJE D;  5M5X B;  1H9J A;  1SDF A;  2NTT A;  1RKN A;  2A74 C;  2EXZ A;  1WCM B;  4JBW A;  1PTO C;  5ELB A;  2ZT9 C;  1K8M A;  1KTK A;  2M00 A;  3PV0 A;  1SNC A;  3BVG A;  2HCC A;  5C3X A;  1IYV A;  4L8J A;  1VMC A;  4L6T B;  1GHJ A;  5ELE A;  4QF4 A;  2XN9 C;  5IGG A;  5LHY 1;  3HOZ B;  2NN6 I;  3SK4 A;  4DAV A;  4HR7 B;  1YNJ D;  1JOR A;  2EYF A;  5EPK A;  4U67 3;  1HUM A;  2B2Y C;  2Q8I B;  1ESR A;  2L11 A;  1EQT A;  3R8B A;  4A3D B;  3A8J E;  3DMU A;  2EYO A;  5A2Q L;  1STB A;  5DEH A;  2WAQ B;  2KVM A;  1BNZ A;  3OHX C;  3R3O A;  2Z1C A;  4UDU C;  4G57 A;  4L63 B;  1PTO H;  1Y1V B;  1C48 A;  2KJX A;  2B63 B;  3GTK B;  3J7Y W;  3MHB A;  1D5Z C;  2LMC B;  4LAA A;  3A8K E;  1NR2 A;  1TS2 A;  4DN4 M;  2LKV A;  1DZ1 A;  3BYY B;  1QE6 A;  2FHT A;  2E2D C;  5KGU A;  2E2I B;  2CHB D;  1A2U A;  5KRU A;  1G2T A;  4KD3 A;  4GZY C;  1ESF A;  1U4P A;  1T5E A;  2F4I A;  2F3V A;  1SYF A;  1Q90 A;  2IL8 A;  2EY6 A;  3A56 A;  1PFB A;  3GTO B;  3NUC A;  3S14 B;  5C3W A;  3PUW A;  1GUS A;  3WOF A;  4ZAI A;  1WTQ A;  3X3N A;  3KLS X;  1TII D;  1XX8 A;  3ITP A;  3VYU A;  2WKD A;  2EYL A;  3Q0A A;  3KLS A;  5BN4 A;  1U4L A;  2F0T A;  3NQI A;  1SAP A;  2XRS D;  1GUT A;  2YYZ A;  2EVB A;  2NVT B;  3NBI A;  2FFK B;  1WD1 A;  3IFD A;  3HOV B;  1LTT D;  3WOE A;  2Z4H A;  1AN8 A;  3O13 A;  1CFM A;  1SNO A;  2ICE C;  3MWY W;  1SMY D;  3I4L A;  3SDZ A;  2BDO A;  3HG9 A;  4QIW B;  4CKE A;  2L9H A;  4BBS B;  2EYP A;  4RCO A;  2NYZ D;  1CHQ D;  2BOS A;  2K5D A;  3M7G A;  2EJG C;  5CMD A;  1ROD A;  3CKI B;  5IOC A;  4R8I A;  4RGN A;  4QCL A;  5M5Y B;  1QG7 A;  1LAC A;  1SMY C;  4EQP A;  4QUF A;  3D4W A;  2B2Y A;  1LTR D;  3J80 E;  4IFD J;  1CK1 A;  2H4O A;  3K7A B;  1TWC B;  2PZT A;  2EY2 A;  2BE5 D;  3VYR A;  3F2U A;  5E4X A;  5J1Z A;  1WTV A;  1Q3L A;  3ERQ A;  3MAQ A;  1HXY D;  1Y69 U;  4FYD A;  2A68 C;  1Z47 A;  2F1M A;  2JA5 B;  2EYM A;  3G7L A;  2B2T C;  3RLF A;  4IUN A;  3DEO A;  1S5E D;  3HOX B;  1LT4 D;  4IUR A;  3HOY B;  5C4X B;  3SK5 A;  1EY7 A;  5M9O A;  4KKU A;  3HOW B;  4Q0F A;  1RTN A;  1A3V A;  1KDA A;  2J0T D;  3C1E A;  3H3V C;  3GV3 A;  4A3G B;  2K32 A;  3HS0 C;  3QOJ A;  1PYW D;  1G2S A;  4NP5 A;  1I50 B;  1R9T B;  4IUT A;  3TZD A;  3NK9 A;  4DA2 A;  2B2U C;  4HN7 A;  4CJ2 C;  2BDN A;  3I72 A;  4AYB B;  5IT9 L;  4UAI A;  2HQE A;  1KNA A;  2F0D A;  4NMZ A;  5IGF A;  2NVQ B;  3TP7 A;  5JAV A;  4KKS A;  3EJI A;  3L7Z C;  3MZ5 A;  5FLX L;  3GTG B;  1HQR D;  2FIN B;  3DUZ A;  1PTO B;  5JPM C;  1EIH A;  3L9A X;  4TRD A;  3NTK A;  3EQL C;  3DXJ C;  3NTI A;  4ZUI A;  4G7H C;  3MC0 B;  2E76 C;  3S16 B;  3HGB A;  3GV6 A;  3MVV A;  1QJO A;  4BY1 B;  5I6W A;  1MGS A;  2NN6 H;  3Q22 A;  4MIU A;  1IHZ A;  5JEA J;  1U4M A;  1FNW A;  2XIW A;  4XT1 B;  3OOC A;  2M2L A;  2O5I C;  4N9T A;  2F0N A;  2EZV A;  3E0J A;  1K8O A;  2O4X A;  4FF3 A;  2TSS A;  5JPN C;  3H94 A;  3VA5 A;  2L5T A;  2K03 A;  2KEC A;  2RVL A;  1B9M A;  5EKI A;  3D8G A;  5EGT A;  3C3L A;  5IIF A;  4KV6 A;  2M9V A;  4XQN A;  1DD2 A;  1BUV T;  2CVR A;  2EY5 A;  1ZEQ X;  2ID0 A;  1NUC A;  5FLX E;  5FO8 B;  1SE4 A;  2A73 B;  2O5J C;  2PCF B;  1XXG A;  4HSP A;  2B2W C;  5C6A A;  3D3R A;  4RCN A;  1O7Z A;  1ML0 D;  2Z4I A;  1EY6 A;  3VYS A;  3NQT A;  3A8I E;  4K6D A;  2LFN A;  5CV6 A;  1CQF A;  2DNC A;  2ZXP A;  2R6G A;  1QNU A;  1ZYR C;  4WJW A;  2J7Z A;  2EOT A;  3C1F A;  1OXV A;  4E6I A;  1G8Z D;  4DU9 A;  3S1N B;  2PW7 A;  3MTS A;  4A3K B;  4FVM A;  1CTM A;  1KAB A;  2D62 A;  5JJZ A;  4ME5 A;  3FKI B;  4KN4 C;  4ABN A;  3VYT A;  2ZXR A;  4DK0 A;  2HDM A;  4A3I B;  1GUG A;  1DYQ A;  3Q23 A;  2KCN A;  3H0G B;  1KNE A;  1HRJ A;  2JA7 B;  3SHL A;  3QB3 A;  3K5L A;  3EVQ A;  3SK6 A;  3GTL B;  1AZQ A;  4J8Q A;  4A3F B;  2MJ8 A;  4ZKC B;  5IGB A;  4IUP A;  1I4H A;  3SR1 A;  4FXD A;  1B1Z A;  1BCP F;  1EU4 A;  3I3C A;  3TN2 A;  4ZKB B;  1LV9 A;  5J39 A;  4XYQ A;  4KD4 A;  2JEB I;  2MGS A;  4DFA A;  2PYK A;  3IL8 A;  2IJ0 A;  4J1M A;  3TP8 A;  4IN3 A;  4XTC S;  4BS9 A;  4K5X A;  2HCI A;  1LTA D;  1QWY A;  2F0F A;  2X6G A;  5EPJ A;  1JIC A;  1OXX K;  3FPU B;  1F2L A;  3T53 B;  5BN3 A;  2IT1 A;  4QMG A;  4ZLT F;  4XXE A;  1RTO A;  3OIQ A;  4WRD A;  3VR5 A;  3GTM B;  2NTS A;  1CZW A;  4G4K A;  5KYI A;  3VR2 A;  1EY9 A;  3TBI B;  3HOU B;  2NN6 G;  2F0S A;  3FPP A;  2RSN A;  2WAC A;  3JAM L;  5D65 A;  2A69 D;  3SE0 A;  2AQ1 B;  1OXU A;  2F0V A;  4KTA A;  2ENB A;  3DWQ A;  3PUZ A;  4HED A;  1LTI D;  2IX3 A;  4K6L A;  4ULL A;  3BG3 A;  3NWS A;  1BCP B;  4V0B A;  3IAY A;  4RH6 A;  1KDB A;  3OWF A;  4G7Z C;  1G6Z A;  3TZU A;  2KED A;  1V1O A;  3DM1 A;  3GTQ B;  4FF4 A;  5KYL A;  4KK7 A;  4C3J G;  1AZP A;  3MXP A;  2R93 B;  1HTL D;  5DAU A;  1PRT F;  1I4X A;  5CYU A;  4H44 C;  5COR A;  4A3J B;  2R61 A;  4ID6 A;  4OL7 A;  1SBB B;  1SFO B;  1PTO F;  3BDO A;  5I9P A;  3VA7 A;  1UEA B;  3MXG A;  2IX0 A;  5C5M A;  2IW3 A;  3MXU A;  5LL6 S;  1TY0 A;  1I4G A;  1V1P B;  1O7Y A;  1PRT C;  5DNF A;  4XIG S;  3KLR A;  4KN7 C;  3HP3 A;  1FD7 D;  1BOS A;  2V4D A;  3SXH A;  3K6O A;  2A6H D;  1FYC A;  5CV9 A;  4QUC A;  4Z9C B;  3PO3 B;  3Q6S A;  4HCS A;  2B2T A;  4TKO B;  2RBM A;  2B2V C;  4OO1 H;  1B50 A;  4C56 C;  1GUW A;  3TP5 A;  1C4Q A;  3RMH A;  1S5F D;  1SJH D;  1X32 A;  1OO9 B;  1BDO A;  2F0I A;  3BDL A;  1SEB D;  5CBA E;  2K6A A;  2R3Z A;  1TS3 A;  2EJM A;  1PDQ A;  1CQV A;  2QCP X;  4IZ8 A;  1HHV A;  3D31 A;  3J80 L;  5HGT A;  5CV7 A;  1T5X D;  2B2V A;  1TKW B;  4C3I B;  3FDT A;  2F0Q A;  1EY5 A;  3URY A;  3D4R A;  1SE2 A;  3SK8 A;  2XWB B;  5C0X H;  2LS0 1;  4LMQ D;  5EQ0 A;  1FGB D;  5HUR A;  3WDN A;  1GOZ A;  5JOB A;  1WD0 A;  4U68 A;  3BVM A;  3OPO A;  2WP8 J;  5EJW A;  2N88 A;  2F3W A;  2JP1 A;  2LY7 A;  1HA5 A;  1SYC A;  1FNV A;  3FEW X;  2EYJ A;  1STG A;  3U9S A;  4DF7 A;  1KDC A;  2F0O A;  3ZYY X;  2A6E D;  3SVM A;  5CR3 A;  2RA4 A;  3C2P A;  3KBX A;  3MA2 B;  3QIA A;  4RWS C;  2D2C C;  2XVS A;  3T51 B;  4ILW A;  1SNQ A;  2BCO A;  3A7A B;  4OIK A;  1VMP A;  3S1M B;  5T1G A;  1ENF A;  1C8C A;  4IFD I;  2VB2 X;  1S5B D;  1PFN A;  3R93 A;  3GO5 A;  4OGQ C;  4PNY A;  1E2Z A;  1ZKO A;  2G9H D;  4MHE A;  2I46 A;  4ODG A;  4CGY B;  3TP6 A;  4RA8 A;  2J4X A;  2C9O A;  1ZYR D;  1TWA B;  2XWJ B;  3TSS A;  4FO2 A;  2F0L A;  2K5Q A;  1KAA A;  1W6K A;  2F0W A;  1WTX A;  1EY4 A;  1H9S A;  1KLU D;  1MSH A;  1S5D D;  3OSO A;  3E5S A;  1JE4 A;  1STE A;  3RUZ A;  4P2C B;  2F0E A;  1SYG A;  2KHS A;  2NWG A;  3DWA A;  4MN3 A;  1H9R A;  2K1B A;  4ZYS A;  1AEX A;  5AFW A;  2EE1 A;  1U4R A;  4EQN A;  2X69 A;  4IFD H;  2NVY B;  2L12 A;  2E74 C;  3VR3 A;  4OO1 G;  5M3M B;  1DON A;  1TY2 A;  1SND A;  1TVX A;  4KJO A;  4H13 C;  1LT3 D;  4C3H G;  1J8I A;  1DOK A;  1SSO A;  1WTR A;  3T16 A;  3DWP A;  4K2K A;  3NP8 A;  3X3M A;  2VUM B;  4FXK C;  2WV6 D;  4C3I G;  1G91 A;  5ELD A;  3HRZ C;  3M4O B;  5I4D A;  1Q1B A;  2RQX A;  1D1K A;  3S9W A;  2RDG A;  5KNB A;  1SNP A;  4A93 B;  1NSN S;  1CT1 D;  2AUJ D;  3K58 A;  1VCI A;  2DY8 A;  2KQ3 A;  1JQY D;  1HQM C;  4V19 0;  1JOQ A;  1SE3 A;  1EZ8 A;  2FMM A;  4ZRZ A;  5EKK A;  2H1E A;  2QIL A;  3A55 A;  5CV8 A;  4EGV A;  2EJF C;  2PMZ B;  3ND8 A;  1EWC A;  1LAB A;  3CQZ B;  2E2J B;  4ZK9 B;  4IUQ A;  1BCP C;  4JK1 C;  4N9P A;  1IKM A;  1LO5 D;  5C0X I;  2B2W A;  5E1F A;  4F88 A;  1TWH B;  1HA6 A;  1CI3 M;  5KIX A;  3J7A V;  4K5V A;  4WFN 3;  5KEE A;  1BXT A;  3NPP A;  2KA7 A;  1BO0 A;  1CZG A;  4HMJ A;  2JA6 B;  4X3T A;  3MEH A;  1PXU A;  4PMW A;  5I6Y A;  3GTJ B;  5IOD A;  5EPL A;  1A3T A;  1I6V C;  1ENA A;  1WTW A;  2BA0 A;  1ENC A;  4RFB A;  1JWS D;  4XQJ A;  1H9M A;  4K8I A;  2EPB A;  5KND A;  3BDC A;  2FMC A;  4HSV A;  2HDL A;  5A35 A;  3D6W A;  1GUO A;  1ZXT A;  1JWM D;  5JEA H;  2WB1 B;  2SOB A;  4FNF A;  3UI2 A;  2IWH A;  2ZXO A;  5DM7 3;  3CRK C;  4F8M A;  1EOT A;  3V05 A;  3GTP B;  1G29 1;  1SYB A;  5CV4 A;  5FO7 B;  4OO1 I;  4C2M B;  3MFG A;  4A3E B;  3NE5 B;  4Y7N B;  3S2H B;  1OXS C;  5D3D A;  2SEB D;  4DNT B;  5M5W B;  3DHQ A;  3A54 A;  3S1Q B;  4J6H A;  1TR5 A;  5C4J B;  3M85 A;  1BCP D;  2R7Z B;  1JWU D;  3I90 A;  1Y8P B;  1SYE A;  3P75 A;  2ICI A;  1GUN A;  2PZU A;  1R4Q B;  4TSS A;  1EU3 A;  2PQE A;  1RJT A;  4OHJ A;  2A69 C;  3QOL A;  1V43 A;  1ET9 A;  1EWH A;  2PZW A;  2WIN B;  3TDQ A;  4BA1 I;  1A6X A;  2C5C A;  4NDX A;  4Q5V A;  4LK1 C;  2G9D A;  1FNU A;  3PUV A;  2NUC A;  2NVX B;  5T1I A;  2I07 B;  5IGC A;  3JAM E;  1XWE A;  3SEB A;  2IX1 A;  4ZUJ A;  5A2Q E;  3W3A A;  1IL8 A;  4FF1 A;  1QOH A;  5FK9 C;  1EFI D;  1X3P A;  2AQ3 B;  1BBX C;  4KJN A;  1TWF B;  2MP1 A;  4M1U B;  2F0U A;  3R2I A;  2RSO A;  2AWO A;  4B9W A;  5IT9 E;  1AFP A;  1EEI D;  3GD7 A;  1MD2 D;  4IQZ A;  3T4A C;  1RD9 D;  2K28 A;  2XRQ D;  4HMI A;  1BR9 A;  1DCZ A;  3ONA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...