2NYZD

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the c- chemokine xcl1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
DKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
molecule tags Viral protein/cytokine
molecule keywords Hypothetical protein GAMMAHV.M3
total genus 7
structure length 61
sequence length 61
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nyzD00
4IUUA 2N88A 1X32A 2MGSA 1PFMA 2B2TA 2VXWA 4OIKA 3TN2A 2FINB 2L9HA 1QE6A 1RHPA 4O42A 1U4PA 1NR4A 1DOLA 1S4ZA 5CMDA 4CJ0B 5EPJA 4IUVA 3D6WA 4IUPA 1WTRA 3I90A 2B2WC 3N52A 4NW2A 4U68A 1G6ZA 3GV6A 2K03A 1PDQA 1WVLA 5EJWA 4XDXA 4XT3B 2J7ZA 1WTXA 4X3UA 1SDFA 4IUQA 1QNKA 3DEOA 4ZAIA 4ZKCB 1HA6A 3IL8A 2JYOA 2NYZD 4X3SA 1JICA 4R8IA 4MHEA 1AP0A 1ZXTA 2HCIA 2KECA 2FMMA 2DY8A 3IFDA 2HDMA 1WTVA 5D65A 5CBAE 1F9QA 3LWEA 2Q8TA 4RA8A 2HDLA 5T1GA 2X6GA 3DM1A 4IURA 1MI2A 3UI2A 5AFWA 1MGSA 1BO0A 3MTSA 2KEEA 4ZLTF 5CBEE 2L1BA 5DNFA 1XYIA 1JE4A 3DEPA 1DONA 1B2TA 3Q6SA 1HUNA 3I3CA 1RTOA 2K05A 2XIWA 2RSOA 2DY7A 1DOKA 4LMQD 1WTWA 1U4LA 2K04A 3G7LA 4HEDA 4RAUC 2EPBA 2HCCA 2L12A 2MP1A 1EOTA 2RVLA 4QUCA 2EE1A 3KBXA 4X3TA 1WD0A 1AZQA 1J8IA 1IKMA 1X3QA 1SAPA 2B2VA 1PFBA 1G2SA 3MWYW 4CJ1B 1DZ1A 2KOLA 2K01A 1RJTA 1EIHA 1LV9A 2B2YC 3SVMA 1CM9A 5EQ0A 3F2UA 5T1IA 4CJ2C 3GV3A 4DN4M 4MN3A 5EPLA 1EL0A 4HCSA 3I91A 2X6LA 4RWSC 1O80A 2IL8A 1AZPA 2MJ8A 1ICWA 2X69A 1BF4A 1CA5A 5COYA 2B2VC 1KNEA 2MPMA 5E4WC 4ZK9B 5JJZA 2KUMA 3FDTA 1PLFA 1VMPA 2R3ZA 1O7ZA 2FHTA 2M2LA 1WD1A 2CVRA 1XX8A 1MSHA 2D9UA 3HP3A 3FPUB 1F9RA 1HRJA 2H1EA 1TVXA 2NWGA 4IUTA 2B2TC 1O7YA 2BDNA 3P7JA 4X3KA 1WTOA 5CORA 1VMCA 2K28A 4QUFA 2EOTA 4ZKBB 1X3PA 1GUWA 1B53A 1EIGA 1U4RA 2B2WA 2FJ2A 2KVMA 1HUMA 2Q8RE 1F9SA 2KEDA 1BNZA 1A15A 1B3AA 5E4XA 1WTPA 1E0BA 4OIJA 1F2LA 2SDFA 5D14A 1ML0D 4HAEA 1G91A 5EKIA 1BBXC 1RODA 4R9WA 4XT1B 2K1BA 1SSOA 1HFNA 1HHVA 1NR2A 2L4NA 2FFKB 1PFNA 3R93A 1B4OA 3I8ZA 1G2TA 3ONAB 1MSGA 1NAPA 1F9PA 1ESRA 1ILPA 2B2YA 1CA6A 1QG7A 1EQTA 4HSVA 2B2UC 3H91A 2JP1A 3KUPA 2L11A 4UAIA 1IL8A 2RSNA 1RTNA 1M8AA 1B50A 2NZ1D 1J9OA 2HUGA 5EPKA 3TZDA 1ILQA 2RA4A 1IKLA 1NCVA 1C8CA 1U4MA 3QO2A 1Q3LA 1DOMA 1HFGA 1WTQA 2N55A 1KNAA 2B2UA
chains in the Genus database with same CATH superfamily
1E1TA 4KD4A 2L9HA 1QE6A 2ZJQA 1A3UA 3HOZG 1NR4A 1E2ZA 2XRSD 3K0XA 2WB1E 2DUDA 4R4OA 1VQ6A 3RLNA 2F0EA 4U68A 4DF7A 4XYOA 2LFNA 1QNUA 4OONA 3S1NB 1Y14B 1LO5D 4I7ZC 1CSPA 2ALYB 3S1RH 3I4OA 2PYKA 1AFPA 2WAQE 2SOBA 2VQEL 3HKZG 5IT9E 4L63B 4QIWB 1TY2A 4RA8A 1ENFA 3HOVH 3S15B 4OX9Q 1XYIA 1IBLQ 2R92H 1SE4A 1W3SA 4K0KL 1P16A 3G7LA 2K04A 3J81j 1S5CD 3PIPA 1TWGB 3FRPB 1VQEA 1NMFA 2CHBD 4CJ1B 2I0QA 3BDCA 4NXMQ 3K6OA 2LY7A 2MNAA 1NUCA 5EQ0A 3PO3H 1VQIA 5IWAQ 5IY0A 1PYBA 2MO1A 4JI2L 1ICWA 4B08A 3T1YL 1PH2A 4FF2A 1J5EQ 1Q1BA 4RGNA 1SFOB 1I4RA 1BXTA 3CW2C 1PMRA 4GN5A 3W5OA 3FKIG 5K36H 3CQZH 1IXRA 1UNSA 3BZDB 2UUAQ 1JWUD 3SXHA 5FO9B 1A15A 3NBHA 5CYUA 4NPSA 4DR1Q 1EY0A 5EBDA 1XMQL 5IE8A 4QCLA 4QF4A 2DGYA 1KDBA 5ELBA 4JI5L 1HHVA 4GNXC 3D0FA 3H3VH 1TS2A 1O7IA 3KUPA 4UAIA 2QW7A 4IO9A 2ICIA 5C5MA 4ZUJA 1EYGA 3NTHA 3TZDA 1UE6A 1BUVT 1CKNB 1SMXA 1X54A 3ND9A 1WTQA 1Q3LA 1T9HA 2JQOA 3QIAA 1A3TA 3S2DB 1YNJD 1SNCA 2A6HC 5KYIA 5CC4A 4JBWA 1DOLA 3L2PA 2ZTCA 2L55A 3D6WA 5IGGA 3KK7A 3N6RA 4NW2A 3FKIB 1BKBA 1JR0D 3CCJA 3HKSA 3HOWG 4UPAA 3U50C 4X3UA 3RZDH 1HA6A 3GTMB 1DYQA 2EY6A 4JG2A 1YJ9A 4FO2A 4WJWA 2FMMA 1HPCA 2C5CA 1RDPD 3CMEA 3S16B 2CW0D 4A3MH 1PH1A 5NUCA 4JI4Q 4IJHA 3DM1A 3CD6A 5HGTA 2F0GA 5JJLA 1NMGA 3SK5A 1GUGA 4MIUA 2CQOA 1V1OA 1S5BD 2OCEA 3IFTA 1T5EA 1SYDA 1TWAB 2B2VA 4ZQ3A 4B3SL 1TWGH 4JI3L 4GZYC 1CM9A 1K8OA 2A74C 3F2UA 3NBIA 2OTLA 3GV3A 2O5IC 4QQBX 3K5NA 3OMCA 3CRKC 1BDOA 5GROA 1CI3M 4IN3A 1YNND 2MO0A 1R9TH 1ESFA 1CTMA 2IT1A 1FL0A 1O7ZA 2FHTA 2QGQA 1K83H 1XX8A 4AYBB 2WKDA 2BA1A 3MEFA 1GVPA 2QA4A 2F52A 3I2ZA 4RCOA 4BBRH 5CR3A 4A3KB 3A56A 5DM63 1UUPA 1QWYA 2WIIB 3AFQA 2EYJA 1RKNA 1H9KA 2YTVA 3KF8A 3LGJA 1RCVD 5I9PA 3FEWX 3M3YB 4Y52H 4R9WA 2K4KA 4PMBA 1V8QA 1PRTC 1PFNA 3K81C 1E7ZA 1G2TA 1MSGA 3SR1A 1RIPA 2B2YA 1ZKOA 4CDCC 5KNCA 1QG7A 3H91A 3BYYB 2JA8B 3ICEA 3R2TA 3Q8DA 1M90C 2ZM6L 4GN3B 1UEAB 1FGBD 3NUCA 2OXPA 4R1JA 1PYWD 4YCUA 3VA5A 5FOBB 4GKKL 2CFMA 1S5ED 4H02A 3U9OA 1S40A 1CZGA 1U4PA 2K5DA 2O5JC 2F0LA 1V43A 2F03A 1HNZQ 1MJEA 4C3HG 1EU3A 1U9RA 4TKOB 2B2WC 3N52A 1EYCA 2JA5H 3Q0AA 1JWMD 5EJWA 3S15H 2K6AA 1CHPD 2JYOA 4L5RC 1SNOA 1AP0A 4FXGC 3A54A 2KECA 5FK9C 4A3BB 3K8AA 3CCEA 2WKCA 2JSOA 3FP9A 2O4XA 1KAAA 4POGA 2VS1A 2YU9H 1PVOA 1U5KA 1E2VA 2SEBD 1SNDA 3SK8A 2QCPX 2A6HD 5M3FB 1C48A 1WJJA 1CZWA 4KY6A 5IT9L 4LFAQ 2F4IA 1H9RA 1EOTA 1J8IA 3X3NA 1X3QA 1K8AC 4CKBA 4A93B 4P71A 1II3A 1M1KC 5JJIA 5GAEC 2BDOA 3TREA 1TY0A 4N9TA 4JYAQ 4DN4M 2QKIC 2WFWA 3AQQA 2RCNA 1HA5A 1FJGQ 1EEFD 4JV5L 1I6VC 4LF5L 4JOIA 4A3EG 1KNEA 5E4WC 1I4HA 2UXCQ 4DV6L 3QB3A 4OO1G 4CDDC 4A75A 4ODGA 2BDNA 2I07B 4JCVE 3BYTB 3TBIB 3K7AH 1VMCA 1UWVA 3H3VI 3GTPB 4ID6A 1PHJA 2XRQD 1DCZA 2EYHA 2KQ3A 1H9SB 2Q2HA 2NN6H 2ZXPA 4DKAC 3T1YQ 4XTCS 4P73A 1OTCA 4GN4B 3M4QA 1GD7A 4LUVA 1PZJD 2EZVA 1A2UA 3SGIA 2D5DA 3PF4A 4FYDA 2OTJA 2XTIA 3ULPA 2YTYA 5M5WB 4GOPA 5KRUA 3BS1A 1CA6A 1STYA 1CKMA 1Z9FA 2F3WA 1KTKA 1HR0L 1YHQA 2K5VA 3J7ZC 3NQTA 1JB3A 3CCUA 4I65A 1U4MA 3DXJC 1L1OB 1Y8OB 4BBSH 3I4MG 4DUZL 1VS0A 2BE5C 2YYZA 4PNYA 2Y0SB 4KJNA 2F0UA 4MTNA 4DR4L 4RMFA 4JI7Q 4X6AH 3I90A 1SMYD 2QDLA 1XNQQ 3HG9A 1LTAD 4G7OC 4XDXA 3PIO3 1VQJA 4R4TA 1SDFA 4HN7A 1MBYA 3DEOA 4N8FA 3UE1A 4M1UB 1G8ZD 3OIPA 4K6DA 1SE2A 5C6AA 3SDZA 4IPDA 1XMOQ 1EWHA 4MHEA 3K5LA 2AUJD 2UUCL 5IOCA 1FVIA 5LL6S 2AHOB 1KRSA 1BCPB 2R7ZH 4YY3L 1E24A 4A3FG 1HUNA 2XIWA 2P5ZX 4BXXH 1DOKA 3S2DH 5IP9H 4A3GH 2EPBA 2R61A 1IL2A 1WCMG 4LFCL 4DA2A 1AZQA 4GKKQ 5FJ8G 3CPWA 1W2BA 1PH3A 5C4HA 3S24A 1I94L 2Y0SG 1D5XC 4DR1L 2OEOA 1S72A 1KL9A 3I91A 4RWSC 3UDXA 1N34L 2YU9B 2E2HH 3E6ZX 2SNSA 2JA6G 4HSPA 2MPMA 1N33Q 4MZ9A 4IPCA 4LAAA 3OWEB 3EFXD 4HMIA 4A3LH 5JPNC 3CQZB 3J81c 2G9HD 5M5XH 2F0QA 2KEDA 4UY8C 2MFIA 2JE6I 4IUNA 1SN8A 2HIXA 4A3FB 4P72A 1A2TA 1KD1C 3GTLH 4OELB 4JBJA 3TP8A 1B9NA 2Z8LA 2OQ0A 2F0HA 1YZ6A 1EY5A 1NAPA 3MFYA 2A6EC 4B3RQ 3E0JA 3KFUA 1YHBA 1IL8A 3DHQA 4HCEA 2WAQB 5JVG3 2I5LX 2HHHQ 1FNUA 5AJ3L 1HJPA 2XNAC 1GUOA 1Q1EA 3RR5A 3EA6A 5BR8L 2FINB 1L2FA 5KEEA 4EQ5A 1OXUA 1B8AA 1SBBB 4QMGA 4BWGB 1WI5A 4NP5A 4B3RL 4A3CH 1DGSA 2QEXA 5CV9A 4JI7L 4DR2L 4IOAA 4KN4C 2BH2A 2QILA 5IP7H 3P75A 2IX3A 4ZUIA 3I4NG 3KF6B 4TRDA 3T53B 3OYYA 3H6MA 3KJPA 2ZTDA 3S14B 1GKHA 2GVBA 1RL2A 2ZTEA 5DLQE 1B3QA 3GQBA 2EIFA 1MI2A 4EVOA 3PQIA 2A5HA 1R4QB 2K05A 1N34Q 1U4LA 4HEDA 5IGCA 1C7YA 1C4QA 1F2ZA 2F0WA 1VQDA 3J80L 2B63H 3J81E 1XPOA 1IYVA 1YJNA 4BY1H 4N8X1 1VQNA 3PUVA 4R4CA 4IFDG 2F0SA 4L5QA 4CJ2C 1S5FD 4KKSA 3QJYA 4RHRA 4WFN3 4APVA 2NN6I 1X56A 1O80A 1A6XA 1STAA 1X65A 1L0XB 3CC7A 1EY6A 4DU9A 2L15A 5M5WH 4DAYA 5M3MB 4PG3A 3G6JB 4DUYL 3L0OA 4LNQA 1B70B 2QF7A 3AU7A 2NWGA 5EAYA 4X3KA 3V2TA 4DAYB 1PZKD 3MFGA 2KHSA 4G7ZC 2VUMG 3HOZH 3G4SA 1Y1WH 3M4OB 5EKIA 2K5QA 1KQSA 1CSQA 5C4JH 4R8NA 3H94A 2K1BA 3SK4A 2E2HB 1HFNA 3AMUA 1B7YB 1K83B 1ESRA 5A2QL 5BN4A 3TZUA 1NNXA 2VNUD 5JJKA 4IQZA 3LNNA 4UP8A 2PQEA 3HFZB 1LTRD 2PO4A 4JOIC 1PRTB 4X66Q 2Z4IA 1VQ5A 4NXML 3R3OA 3MXNA 3HOVG 3HOYB 2RHSB 1KIXA 2JA7G 1NE3A 1XTCD 3HOWB 3I72A 2JEAI 1K3BC 1TWAH 1L0YB 2KCTA 1U0LA 2L0CA 3TDQA 3RLOA 1PDQA 4FNFA 2R93G 5C3EH 4TVAB 4DXFA 1HH2P 1XNRQ 4IUQA 3PO3G 4X3SA 2NVXH 2DN8A 4R8IA 1BCPD 2NZOA 5M3MH 5CBAE 3J7YW 4DR7L 2K52A 4K5VA 3GTMH 1SLJA 1ICFB 3HS0C 3FPPA 4B9WA 4C56C 1OXSC 2RDGA 1H9JA 1QVGA 3FKIH 5K36G 1JOQA 2XWJB 3LX0A 2MP1A 2L12A 2WV6D 4GLXA 3RZOB 1YNXA 3JAMi 4K5XA 1GXDC 5A2QE 1SNMA 4WJ4A 4V0BA 1EIFA 3ZJYC 3PUXA 1IBKL 2UUBQ 1A3VA 2IL8A 3KDFB 2JN4A 1AZPA 2PI2A 2KCCA 4RCNA 1SMYC 2Q8IB 1HTLD 1JJ2A 3CPFA 2A1AA 2EY2A 4LJZC 4C3JG 5IGEA 1CHQD 3F2CA 1TIID 2EDGA 3EIVA 2PQAB 1B53A 1GUWA 5EBCA 2FXQA 5ELDA 3S1NH 2K5HA 3U58A 5D14A 3I7FA 4IZ8A 4KKUA 1TWCH 3MXNB 5ELNA 5I4DA 2XN9C 4RGMA 3VDYA 1ENCA 2FFKB 3K0YA 4A93G 1D7QA 1ZYRC 1IBML 1Z47A 4FXKC 5I9OA 3V96A 1QILA 4HSVA 1CKOA 3AEVA 3SHLA 1X3FA 4IOCA 3H3VC 1C9OA 1FNVA 1BQQT 2UXDL 4A3MG 3QO2A 2E8GA 3VYUA 5M3FH 2F0TA 2IHEA 5JEAG 1XNRL 4A3IH 2CQAA 1SNPA 1KXLA 1LLRD 3HOXH 2PMZE 4CJ0B 5EPJA 1SE3A 4LF6L 1M4VA 4R4IA 4C1NK 4AYBG 1WOCA 2B8FA 2NVTH 4OL7A 2A69D 2EYFA 1JORA 4X64L 1QNKA 2F0VA 3QWNA 4I7AA 2JJQA 1Q8IA 1XPUA 3G48A 5JEAJ 3IL8A 3RN5A 2IW3A 3S1MH 1PH5A 1KLUD 1MHWC 3LWUA 4JI8Q 2PNRC 1X6OA 2LMCB 3DUZA 4LF4Q 2K50A 3MTSA 3H09A 4CKCA 1DONA 3Q6SA 1O7LA 2GN5A 3W3AA 2VY3A 1SJHD 4BY1B 4BA1I 4QGUA 4DV7L 4DR2Q 3BDOA 4HIOA 5F2DA 1HR0Q 1PYSB 4QUCA 4GNXB 2D0PA 1JQYD 4X62L 1HNXL 1I5FA 1PTOD 4GNXA 2ZJRA 4LWCA 1KLGD 3C1FA 5GADC 2HD3A 3KF8B 1HZ9A 5JJZA 4A3KH 1VMPA 2DJGC 4M8AA 2E2JB 1K9MC 1H9MA 3IKJA 1TVXA 2B2TC 4J8QA 1WTOA 1I4XA 3CCMA 2EJMA 2RBMA 2UXBL 4A3BH 3ER0A 3T56B 1JOOA 2FJ2A 1TQOA 5IYBH 1NBWA 5E4XA 5M5XB 4XIGS 4L8JA 4C3HH 4LK1C 4JI1Q 3H0GG 2DNEA 2PZWA 2EYLA 2QDBA 3Q22A 1JT8A 2BH8A 2V4DA 2E2IB 4DR5L 4PZ7A 2RSNA 2QEJC 3NQIA 3RLFA 1QOHA 1N36L 1LTLA 3W2DA 1LACA 1SE8A 1O78A 1LT4D 3CCLA 1GM5A 4QIWE 2JA8H 3QOLA 1LT6D 1D6EC 4O42A 3K5MA 4C2MB 1QJOA 1S4ZA 4P2CB 2EVBA 3F8TA 3MXPA 4IUPA 4DV1L 2HIVA 3E9HA 4HR7B 4YWMA 3TS0A 1G6ZA 1SROA 3SEBA 2VW9A 3KLRA 2NVXB 1R4PB 3UDFA 5I2XA 3HZXA 4XT3B 5E1FA 4A76A 5FO7B 1VF5C 4X64Q 3KYHC 2E5LQ 1BCPF 1CKNA 1Y1VH 4GLAC 5FLXE 2ZJPA 5HY6A 1IW7D 1SYBA 2E2JH 2BCOA 4F8MA 1Y1VB 3FMCA 4UDUC 2N49A 1F9QA 1F2MA 2JEBI 2RQXA 3A0JA 3D8GA 3I4LA 3I73A 5AFWA 3KBGA 1XTDA 1VQHA 5KIXA 3PO2H 2CKZB 3L3OC 3U4VA 1NY4A 5BN3A 1HNZL 4K8JA 3I3CA 3E5SA 3NHHA 1PH8A 3S17B 1PH4A 1QUQB 4RGOS 4KY7A 2WINB 3GP7A 1EYDA 1T5XD 1Y8PB 5J22A 1EOVA 1PTOB 1G2SA 2Q2IA 3J7AF 2HT1A 2V1CC 5FLMH 4DNIA 3SE0A 1BBUA 4G57A 4Y7NB 2F0OA 4KHPQ 4J1MA 2CH4W 1ET6A 4YWKA 2F4VQ 2Q2UA 3J7A5 4ILWA 4JBKA 5ISRA 5CV7A 1VQ8A 1N33L 1B1ZA 4KN7C 4ZK9B 4FP5D 1SXTA 3GTLB 2UXBQ 3PGZA 2IHFA 1GJXA 1KDAA 3NWTA 1O7YA 3FVQA 5LMNL 1I4QA 4DR6Q 2EOTA 5IIFA 4IFDJ 1HNWL 3AB9A 1BNZA 1XXGA 1ASZA 5CV5A 1I6HB 3ERQA 4A4IA 2K7VA 1PRTF 1YI2A 4JYAL 2Z9HA 3OOCA 3MEHA 4A3DB 1NR2A 1B4OA 2EQSA 2DNCA 3CMAA 4X62Q 5C0XI 4DV6Q 4KKTA 1LYLA 2B2UC 2JP1A 2RDFA 3A8JE 1M8AA 4DR5Q 3GTOH 2NZ1D 2CWAA 4B3TQ 2E2IH 2RA4A 1IKLA 4DK0A 4F88A 1EY9A 2UUCQ 3C3LA 1E3PA 1Q46A 1HFGA 2LXJA 2CWPA 2B2UA 1HNWQ 3HOYH 3DLLA 1AN8A 1CFMA 3OIQA 4K2LA 2A8VA 2R92G 3CU7A 3CCQA 3HOUH 2KJXA 3HKZE 3M7GA 3R8BA 5IP9G 4A3GG 1JMCA 4DR7Q 1TWHB 3KLSA 3K7UC 1IW7C 3I70A 3TP7A 3S1RB 5JOBA 2K03A 1GOZA 3CCVA 1K8MA 2PW7A 1WTXA 4KHZA 5C44G 1YITA 1JWSD 3OW2A 3FHWA 4B9XA 4ZKCB 3OPOA 1RD9D 2NYZD 4HMJA 1VQOA 2D62A 2K5WA 1LUZA 3AYHB 2RCFA 3CP0A 2JA6H 1FJGL 1QVCA 5LL6X 4IURA 4NB3A 3S9WA 3Q24A 1G51A 1Z7TA 3H0GB 2L1BA 3D6CA 4NDXA 1JE4A 4RHSA 4YIJA 3F2DA 1WYDA 1STBA 2K75A 2M9VA 2NUCA 4RH6A 2PPBC 4A3LG 2DY7A 2KCNA 2VB2X 2TSSA 1VQ9A 2EE1A 3KBXA 4ABNA 3HOXB 1DZ1A 4DPGA 1YJWA 1RJTA 1LV9A 1ZYRD 4A3DH 4JPBW 4Z9CB 2ENBA 1ONLA 4HCSA 3S1QB 1TT2A 4RG1A 1BF4A 1N32Q 2B2VC 4P75A 3MVVA 4GOPB 3WDNA 1PLFA 1STHA 4OXPA 3CXCA 4HTHA 4S3SA 1EWIA 2ASBA 3W1BA 4B3ML 1J6QA 1HRJA 3KLWA 4RFBA 3K80C 3P1HA 4GKJL 5G3LD 3PUYA 1U4RA 3I56A 3BVZA 1FD7D 1F9SA 5EKKA 3J7AV 4C3IB 4JI2Q 5KGUA 4P74A 2N78A 2K32A 5ELFA 5IWAL 1IZ6A 4Y7NH 3NBHB 4F7XA 5IP7G 2L4NA 1CQFA 4Q0FA 4OEMB 1TXYA 3I8ZA 2F0FA 1Q82C 3T1HL 4NXNL 4B3TL 2PNHA 4O2DA 2AKWB 4A3JH 4YHHL 1LTSD 4EQPA 1X55A 2Z6KC 3DWAA 3TRZA 3A8IE 2N55A 4X65L 3PO2B 2B2TA 3S17H 3TN2A 3RMHA 4DV0Q 3HKZB 4IPGA 3RZOH 4JV5Q 3T1HQ 4C3JB 4YCWA 2NTTA 3VR6A 2A73B 2HQLA 4ME5A 2B63G 2AWNA 3TP5A 4BY1G 2F0JA 1EFWA 1V1PB 2OWOA 4RKBA 3NEMA 2F3VA 2UXCL 3STBD 3CHBD 3S16H 3CAMA 2AWOA 2HCIA 3K58A 2KHIA 1WTVA 2NVQB 4DK1A 2RHQB 2X6GA 3UI2A 3E0EA 4HJ9A 4K0KQ 4ZLTF 1JC7A 5CBEE 5EGTA 3JAML 3RD4A 3JC66 4LMQD 1GO3E 1XWEA 3VA7A 4AIMA 1WTWA 1LTBD 4BBRG 5IYDG 2C9OA 1GHJA 2R7FA 4HJ8A 4X3TA 1LT5D 1WD0A 1AE3A 1IKMA 1Y1WG 2K01A 3HOWH 1N9WA 2Q2TA 4N9PA 3G6EA 5ELCA 2CCZA 3PUZA 5C4XG 1XPRA 3GTQB 3NTKA 1QB5D 1UAPA 5IODA 5M5YH 4JI1L 4JI6Q 1LTID 2E76C 1J5EL 2G5DA 3PIOA 5TSSA 1SNQA 4PQXA 2BA0A 5M9OA 4HJAA 2F0IA 1MJCA 5J1ZA 5C3WA 2JA9A 2XGTA 4K2KA 5C0XH 3K7AB 4H13C 5CORA 1TR5A 5GAHC 1X3PA 4R4QA 4DV4L 1EYAA 4K14A 1SYCA 4OIJA 2Y0SE 2EJGC 3TMEA 1IBMQ 5G3LF 4AQYQ 2YTXA 2R93H 1KABA 1ILPA 1BVSA 3BG3A 2NB0A 1D2BA 5E7NA 3WOFA 1I94Q 4LFCQ 1KDCA 1STGA 1A63A 1IYUA 4IJLA 4DV3L 5M3MG 3EQLC 2LXKA 3JAME 1Q12A 3HRZC 4JBMA 4CDFC 1PFMA 5CV8A 4DFAA 1RHPA 1VQCA 1DXMA 1C0AA 3EBEA 1X3GA 3H15A 4H0LC 1I6HH 4ULLA 2R92B 2HQEA 1WVLA 5KYLA 2BOSA 1FR3A 2Z0SA 2JA6B 2NVTB 3A74A 3ZYYX 5DM73 1ZXTA 3S14H 2DY8A 4A3EH 5T1GA 1PFSA 4OO1H 3M85A 4KLKA 1B2TA 4K8IA 4C3JH 3BJUA 3NK9A 1D1KA 3Q23A 1PZID 5L37A 1ENAA 4DV5Q 3MWYW 1AEXA 3KF6A 4YHHQ 2AQ2B 1I4GA 4CDEC 3D4RA 4LF9L 3VYTA 5T1IA 3U4ZA 1UE7A 4PMCA 1HXYD 2K5NA 2PQAA 4A93H 4DGZA 2Z6KA 4RKLA 3V05A 2R7ZB 2R6GA 1CA5A 2OQKA 4J6HA 4JW0A 4LF7L 1Z6HA 2KUMA 4JI0Q 1DD2A 4UP9A 3KOJA 3I4NB 1UE1A 3HP3A 4CBVA 2H1EA 4IUTA 5M3FG 4BY7G 2MQHA 3TSSA 3I4MB 4POFA 1PXUA 1D5ZC 4C3IH 4QUFA 1I3QH 2D2CC 3GD7A 1B44D 2Q8RE 2ZXRA 1V1QA 3HOXG 2NBFA 1B3AA 4KY5A 2KA7A 1LTGD 2Z6BA 1R9TB 1OXXK 5M5YB 1IHZA 2MUYA 5IGFA 2EY1A 3ONAB 2JA5B 3CC2A 2IX0A 3GTJH 1V9PA 2UUAL 3DWPA 1GUSA 4G4KA 4A3IB 3NPPA 2VQFQ 2HUGA 5EPKA 4YWLA 1NJIC 2E2DC 1NCVA 5IGDA 1GHKA 2F0KA 5C44B 1DOMA 1N36Q 4JI5Q 4EQNA 4BA2I 2R7ZG 2I46A 1BR9A 2OT2A 4PMWA 1WTHA 2VXWA 4DK6C 1EQVA 1JOKA 2NN6G 2WACA 3EROA 4AH6A 2B8GA 4QJFA 1YBYA 2ZXOA 3J81L 1EY8A 2VB3X 4H7BA 1TU2B 3RUZA 1G291 5FJ8H 3R2IA 1EU4A 1EQQA 1FYCA 1YNNC 1SR3A 4V190 1I3QB 3CCRA 1TWCB 2PCFB 1P8LA 1S5DD 3OTOL 5IYCH 1TWFH 4KK7A 1H95A 1Q86C 4DR3L 1YEZA 3LWEA 4FXDA 1TKWB 2G9DA 2A68D 3CKIB 3G71A 3TQYA 1Y8NB 1VQGA 3UDIA 1K73C 1CK1A 3CCSA 3M9BA 4GLVB 4KI0A 5C0XJ 2ZM6Q 4DV5L 2L5TA 4MNOA 4K5WA 2RVLA 3J81i 5K5PA 1LTTD 5IYBG 1PFBA 1YVCA 4A3GB 2KOLA 1XJVA 1JCKB 1EQRA 1PTOC 4CHTB 1EIHA 2B2YC 4HIDA 1Q8KA 4MN3A 1EL0A 1Q7YC 3I55A 4FF1A 4NMZA 2MJ8A 1AE2A 5C4JB 3W1GA 4OX9L 1D8LA 3HOZB 3A5ZB 3EVQA 3M4OH 4DV7Q 1F2YA 1I50B 2D9UA 5LMNQ 3L7ZC 2JA7B 4A3FH 1DJRD 2A19A 5JAVA 5J3BA 1KAWA 4KHVA 1VDZA 1VQMA 2HHHL 1EIGA 3U9SA 2B2WA 1WCMB 1WCMH 2EYMA 4JI3Q 1UE5A 4HIKA 2EYOA 1E0BA 1WTPA 4KV6A 1F2LA 4DV0L 1A0IA 1G91A 2A68C 4A3CG 5I6YA 4G7HC 3RZDB 2R7DA 4QL5A 5AJ3Q 3PCOB 3M4PA 2M00A 2N8NA 3I4NH 3J80i 3A7LA 1Y1VG 1Q90A 3BVGA 1K28A 4MTKA 2VUMB 3T16A 1Y69U 3GTJB 2RDHA 4DV4Q 1OXVA 5GQOA 4DNTB 4H44C 3IAYA 4DAPA 1GUNA 3GTKB 1FGUA 5CV6A 2MGSA 1VQLA 4A3JB 1X9NA 4IUVA 2WB1B 2LSSA 1EY7A 2VZAA 3CF5A 4OO1I 3UDGA 3VYRA 3WOEA 5C3XA 3ND8A 2YV5A 5H1SE 2J7ZA 4BBRB 2IY5B 3F2BA 1JJGA 1QVFA 4K6LA 1F77A 4NKLA 1YIJA 1Y1WB 4O1NA 4QY7A 1EWCA 2Q8TA 4DV1Q 2DJFC 1LT3D 3BVMA 2MHVA 1EUJA 2PZUA 1BOSA 1VCIA 2EYPA 2A6ED 2PI2E 1RTOA 1S3OA 1SFOH 1K0SA 1KC8C 2ATWA 3D4DA 1HZBA 4L5TA 5HURA 2KBNA 1HZAA 1JJCB 3KLSX 2VQFL 5JVH3 3MXUA 3T51B 5CV4A 1MKHA 5I2YA 3NP8A 5ELEA 2KCMA 1OO9B 4LF9Q 5EPLA 2B63B 3GO5A 4XXEA 3PUWA 4ALPA 2AQ3B 2X69A 5BN5A 5LMUL 1KRTA 4A3MB 4DAMA 2GA4B 2R3ZA 3NWSA 4DAVA 4IALA 1W6JA 3K57A 1F9RA 5FLXc 4DR3Q 3E3XA 3HOYG 2LS01 1I50H 2K28A 3NENA 1VQ4A 1XNQL 3M3YH 2PZTA 3OTOQ 1HUMA 3RN2A 3KDFA 4GKJQ 4JVZA 4ZYSA 3OW7A 3A8KE 4JI0L 2IWHA 1ML0D 4KHPL 1HQMC 2LKVA 2I5MX 5JPMC 5KNDA 3TP6A 4ME3A 5C3EG 4FF4A 2JXMB 5LMUQ 2AUKA 3RNUA 2J4XA 1HZCA 1PA6A 1HNXQ 1CQVA 3HOUB 3A7AB 5CGKA 2CW0C 2VQEQ 1HTPA 3PMFA 5BR8Q 3VYSA 4BY7B 4U673 3QR8A 2ICEC 2N88A 4PV1C 2F0NA 5DAUA 2K33A 1VQFA 2EJFC 2VUMH 1IBLL 3GTOB 1WFQA 3K5OA 4XQNA 2J0TD 3QOJA 1HR0W 1ZEQX 1KHIA 2I5HA 3ULJA 3GV6A 1JE5A 1G6PA 4A3DG 1NTGA 4DV2L 2A69C 4GOPC 1TS5A 3CRLC 4JI8L 4DR4Q 3BZCA 1CUKA 2SNMA 5D65A 1YHAA 1QZGA 2HDLA 2B29A 1PH7A 1YNJC 2WAQG 2JA7H 4CGYB 3E9IA 4B3MQ 2RSOA 3SK6A 2VL6A 3S2HH 5D3IB 2ID0A 1PH6A 3S2HB 1SAPA 4DV3Q 2JA5G 3C46A 3IRBA 4JI6L 1JB7A 4E6IA 4WJ3M 4X65Q 1PRTD 1TS3A 4Q5VA 3KJOA 2CH4A 5DEHA 3M7NA 2NVQH 1K3RA 4HIMA 5COYA 4A3JG 4KTAA 2E75C 2CVRA 2EXDA 2B3GA 2TMPA 1EEID 3EJIA 3DMUA 4A3IG 2KVMA 3URYA 3MC0B 1BCPC 4TQUS 3BU2A 2ZT9C 5EKLA 1A8VA 1TWFB 3OSOA 3C2PA 2O2LD 4OHJA 2E5LL 3D4WA 1RODA 3J80E 4DUZQ 2F0PA 2IX1A 1AH9A 3A55A 3GTGB 3GTKH 3TS2A 2NTSA 4AYBE 1EFID 2IPKD 2NZHA 5IT9c 1J9OA 5ELOA 2F3IA 3M4YA 3K59A 1XMOL 4B3SQ 3DEPA 2JK8A 4IFDI 4YCVA 4UP7A 3TEHB 2RF4A 1W6KA 2KHJA 3D31A 5HGQA 4OIKA 1HQRD 3MA2B 5LHY1 1X3EA 3ITPA 3PSIA 1VQAA 5FO8B 2XSCA 4ZRZA 5A35A 5GAGC 1WTRA 5IYDH 5C4ZA 4FDBA 2H5XA 3NE5B 3X3MA 4NXNQ 4OWTB 5C4XB 3WWVA 5C4XH 4ZAIA 1PH9A 2D0OA 1N8RC 4C3HB 1MD2D 4PZ8A 3T4AC 4OWWB 5FKAC 4XQJA 3BZKA 4UHVA 3GTPH 3IFDA 3STBC 2F1MA 1LM0A 4CKEA 4EGVA 3S1QH 1NSNS 5JEAH 3DWQA 3I4MH 2EXZA 4A3KG 4BBSG 1MGSA 1BO0A 2KEEA 3J80c 5DNFA 3VR5A 2AMCB 1D5MC 2E74C 5C0XG 4A3BG 2H4OA 5KNBA 4TSSA 4LFAL 1PTOH 2F0DA 1GUTA 3DM3A 2XVSA 2XWBB 4OGQC 3SVMA 1AW7A 1EIYB 1UEBA 2R93B 3HOVB 5D3DA 4X66L 2C35B 1QUQA 1MIUA 4PZ6A 2UUBL 2IJ0A 5C5LA 4KD3A 4KJOA 3FDTA 4YY3Q 1XMQQ 3O13A 4XYQA 1TS4A 3P7JA 4BXXG 1E22A 4L6TB 2WB1G 1LABA 4A3EB 3S1MB 1ASYA 3ERSX 2B39A 4EX5A 4DV2Q 5IGBA 1H9SA 4FF3A 1SSOA 1STNA 4LFBL 4C1NI 4KMUC 3NTIA 1F9PA 3GTQH 4DUYQ 3OWFA 3T13A 1VF7A 4BS9A 1V1PA 1E2WA 5E3FA 2BE5D 3VR3A 3MAQA 4LF6Q 1IYJB 1B50A 1SYGA 1IBKQ 1C8CA 1SYEA 1VQKA 3CC4A 1CT1D 4LUOA 4OWXB 1E1OA 2AQ1B 2F0MA 4IUUA 1X32A 3P20A 3A5UA 5CMDA 4WORA 2NVYB 4IPHA 3NELA 2K14A 3H0GH 5FLXL 5LMNW 4LF7Q 1HCZA 4LFBQ 4LF4L 3GTGH 4O0AA 5FLMG 5C3EB 4GS3A 3PIP3 4J15A 1K8GA 1EZ6A 2GVAA 4RGTA 1JICA 5I6WA 1VQPA 1OXTA 4WRDA 3EN2A 1QZHA 2HDMA 3B6YA 4LW1A 1DM0B 4L5SA 4QB4A 4LF5Q 3PV0A 2PMZB 1Q81C 2JA8G 4DK3C 1TWHH 3MHBA 4BY7H 2N3SA 3OMGA 2ES2A 3HEJA 3VR2A 4C3IG 4RAUC 2HCCA 2KENA 2RKSA 3F1ZA 1FNWA 1SYFA 3PF5A 4DXGA 3C1EA 1D1IA 1RF2D 4HJ5A 4DR6L 1PTOF 1BBWA 4JC0A 1N32L 2UXDQ 2FMCA 3D3RA 2X6LA 3MZ5A 4XQQA 4HJ7A 1QCBD 3HGBA 3ULLA 3MXGA 1WD1A 2M2LA 3PO2G 1MSHA 2Z4HA 3JAMc 3FPUB 3AFPA 3BDLA 4JK1C 3GDEA 4ZKBB 1VQ7A 1ET9A 4LF8Q 4JI4L 3VR4A 1SRUA 2NVYH 1EY4A 3HOUG 1L0WA 2UU9Q 4LUZA 4C2MH 1SJED 2SDFA 4HAEA 4ZCKA 4AQYL 2Z1CA 2WP8J 1BBXC 4IFDH 1STEA 4F87A 4XT1B 1L1OA 1B9MA 3QG1A 3NXWA 1SEBD 2F4VL 3PO3B 4BBSB 2EY5A 3R93A 1I4PA 5C44H 1EZ8A 1PV4A 2PW5A 3OHXC 1EQTA 4EQOA 2L11A 5IYCG 1K0RA 1RTNA 1L1OC 3L9AX 3UE0A 1A62A 2UU9L 1ILQA 4FVMA 4DNRB 2OF1A 5J39A 1VQBA 3NSWA 1KNAA 4LF8L
chains in the Genus database with same CATH topology
4KD4A 2L9HA 1QE6A 1A3UA 1NR4A 1E2ZA 2XRSD 2F0EA 4U68A 4DF7A 4XYOA 2LFNA 1QNUA 3S1NB 1LO5D 4I7ZC 2PYKA 1AFPA 2SOBA 5IT9E 4L63B 4QIWB 1TY2A 4RA8A 1ENFA 3S15B 1XYIA 1SE4A 3G7LA 2K04A 1S5CD 1TWGB 3FRPB 2CHBD 4CJ1B 3BDCA 3K6OA 2LY7A 1NUCA 5EQ0A 1ICWA 4B08A 4FF2A 1Q1BA 4RGNA 1SFOB 1I4RA 1BXTA 1PMRA 5K36H 1UNSA 3BZDB 1JWUD 3SXHA 5FO9B 1A15A 3NBHA 5CYUA 1EY0A 5EBDA 4QCLA 4QF4A 5ELBA 1KDBA 1HHVA 1TS2A 3KUPA 4UAIA 2ICIA 5C5MA 4ZUJA 3NTHA 3TZDA 1BUVT 3ND9A 1WTQA 1Q3LA 3QIAA 1A3TA 3S2DB 1YNJD 1SNCA 2A6HC 5KYIA 5CC4A 4JBWA 1DOLA 2L55A 3D6WA 5IGGA 3KK7A 3N6RA 4NW2A 3FKIB 1JR0D 4X3UA 1HA6A 3GTMB 1DYQA 2EY6A 4FO2A 4WJWA 2FMMA 1HPCA 2C5CA 1RDPD 3S16B 2CW0D 5NUCA 3DM1A 5HGTA 2F0GA 3SK5A 1GUGA 4MIUA 1V1OA 1S5BD 3IFTA 1T5EA 1SYDA 1TWAB 2B2VA 4ZQ3A 4GZYC 1CM9A 1K8OA 2A74C 3F2UA 3NBIA 3GV3A 2O5IC 3K5NA 3OMCA 3CRKC 1BDOA 1CI3M 4IN3A 1YNND 1ESFA 1CTMA 2IT1A 1O7ZA 2FHTA 1XX8A 4AYBB 2WKDA 2BA1A 4RCOA 5CR3A 4A3KB 5DM63 3A56A 1UUPA 1QWYA 2WIIB 2EYJA 1RKNA 1H9KA 3KF8A 1RCVD 5I9PA 3FEWX 3M3YB 4R9WA 4PMBA 1V8QA 1PRTC 1PFNA 1G2TA 1MSGA 3SR1A 2B2YA 1ZKOA 5KNCA 1QG7A 3H91A 3BYYB 2JA8B 3R2TA 1UEAB 1FGBD 3NUCA 2OXPA 1PYWD 3VA5A 5FOBB 1S5ED 3U9OA 1CZGA 1U4PA 2K5DA 2O5JC 2F0LA 1V43A 2F03A 4C3HG 1EU3A 1U9RA 4TKOB 2B2WC 3N52A 1EYCA 3Q0AA 1JWMD 5EJWA 2K6AA 1CHPD 2JYOA 1SNOA 1AP0A 4FXGC 3A54A 2KECA 5FK9C 4A3BB 2WKCA 2JSOA 2O4XA 1KAAA 1E2VA 2SEBD 1SNDA 3SK8A 2QCPX 2A6HD 5M3FB 1C48A 1CZWA 4KY6A 5IT9L 2F4IA 1H9RA 1EOTA 1J8IA 3X3NA 1X3QA 4CKBA 4A93B 1II3A 2BDOA 1TY0A 4N9TA 4DN4M 2QKIC 1HA5A 1EEFD 1I6VC 1KNEA 5E4WC 1I4HA 3QB3A 4OO1G 4ODGA 2BDNA 2I07B 3BYTB 3GTPB 3TBIB 1VMCA 4ID6A 2XRQD 1DCZA 2EYHA 2KQ3A 1H9SB 2NN6H 2ZXPA 4XTCS 1PZJD 2EZVA 1A2UA 2D5DA 4FYDA 5M5WB 5KRUA 3BS1A 1CA6A 1STYA 2F3WA 1KTKA 3NQTA 1JB3A 4I65A 1U4MA 3DXJC 1Y8OB 2BE5C 2YYZA 4PNYA 2Y0SB 4KJNA 2F0UA 3I90A 1SMYD 3HG9A 1LTAD 4G7OC 4XDXA 3PIO3 1SDFA 4HN7A 1MBYA 3DEOA 1G8ZD 4M1UB 3OIPA 4K6DA 1SE2A 5C6AA 3SDZA 1EWHA 4MHEA 3K5LA 2AUJD 5IOCA 5LL6S 1BCPB 1HUNA 2XIWA 1DOKA 2EPBA 2R61A 4DA2A 1AZQA 5C4HA 1D5XC 2OEOA 3I91A 4RWSC 2YU9B 3E6ZX 2SNSA 4HSPA 2MPMA 4LAAA 3OWEB 3EFXD 4HMIA 5JPNC 3CQZB 2G9HD 2F0QA 2KEDA 2JE6I 4IUNA 4A3FB 1A2TA 3TP8A 1B9NA 2F0HA 2Z8LA 1EY5A 1NAPA 3MFYA 2A6EC 3E0JA 1IL8A 3DHQA 4HCEA 2WAQB 5JVG3 1FNUA 2XNAC 1GUOA 1Q1EA 3EA6A 2FINB 5KEEA 1OXUA 1SBBB 4QMGA 4BWGB 4NP5A 5CV9A 4KN4C 2QILA 2IX3A 3P75A 4ZUIA 3T53B 4TRDA 3H6MA 3S14B 3GQBA 1MI2A 4EVOA 2A5HA 1R4QB 2K05A 1U4LA 4HEDA 5IGCA 1C4QA 1F2ZA 2F0WA 3J80L 3J81E 1IYVA 3PUVA 4IFDG 2F0SA 4CJ2C 1S5FD 4KKSA 3QJYA 4RHRA 4WFN3 2NN6I 1O80A 1A6XA 1STAA 1L0XB 1EY6A 4DU9A 4DAYA 5M3MB 3G6JB 2QF7A 3AU7A 2NWGA 4X3KA 3V2TA 1PZKD 3MFGA 2KHSA 4G7ZC 3M4OB 5EKIA 2K5QA 4R8NA 3H94A 2K1BA 3SK4A 2E2HB 1HFNA 3AMUA 1K83B 1ESRA 5A2QL 5BN4A 3TZUA 2VNUD 4IQZA 3LNNA 2PQEA 1LTRD 2PO4A 1PRTB 2Z4IA 3R3OA 3MXNA 3HOYB 1XTCD 3HOWB 3I72A 2JEAI 1L0YB 2L0CA 3TDQA 1PDQA 4FNFA 4DXFA 4IUQA 4X3SA 2DN8A 4R8IA 1BCPD 5CBAE 3J7YW 4K5VA 3HS0C 3FPPA 4B9WA 4C56C 1OXSC 2RDGA 1H9JA 5K36G 1JOQA 2XWJB 3LX0A 2MP1A 2L12A 2WV6D 3RZOB 4K5XA 1GXDC 5A2QE 1SNMA 4V0BA 3PUXA 1A3VA 2IL8A 1AZPA 2KCCA 4RCNA 1SMYC 2Q8IB 1HTLD 2EY2A 4LJZC 4C3JG 5IGEA 1CHQD 1TIID 2EDGA 1GUWA 1B53A 5EBCA 5ELDA 5D14A 4IZ8A 4KKUA 5I4DA 2XN9C 4RGMA 1ENCA 2FFKB 3K0YA 1ZYRC 1Z47A 4FXKC 5I9OA 3V96A 1QILA 4HSVA 3SHLA 3H3VC 1FNVA 1BQQT 3QO2A 3VYUA 2F0TA 5JEAG 2CQAA 1SNPA 1LLRD 4CJ0B 5EPJA 1SE3A 1M4VA 4C1NK 2B8FA 4OL7A 2A69D 2EYFA 1JORA 1QNKA 2F0VA 3QWNA 1Q8IA 5JEAJ 3IL8A 2IW3A 1KLUD 3LWUA 2PNRC 2LMCB 3DUZA 3MTSA 3H09A 4CKCA 1DONA 3Q6SA 1O7LA 3W3AA 1SJHD 4BY1B 4BA1I 3BDOA 5F2DA 4QUCA 1JQYD 1PTOD 1KLGD 3C1FA 5JJZA 1VMPA 4M8AA 2E2JB 1H9MA 3IKJA 1TVXA 2B2TC 4J8QA 1WTOA 1I4XA 2EJMA 2RBMA 3T56B 1JOOA 2FJ2A 1TQOA 5E4XA 5M5XB 4XIGS 4L8JA 4LK1C 2DNEA 2PZWA 2EYLA 2QDBA 3Q22A 2V4DA 2E2IB 2RSNA 2QEJC 3NQIA 3RLFA 1QOHA 3W2DA 1LACA 1O78A 1LT4D 3QOLA 1LT6D 1D6EC 4O42A 3K5MA 4C2MB 1QJOA 1S4ZA 4P2CB 2EVBA 3MXPA 4IUPA 4HR7B 1G6ZA 3SEBA 3KLRA 2NVXB 1R4PB 5I2XA 3HZXA 4XT3B 5E1FA 5FO7B 1VF5C 1BCPF 5FLXE 1IW7D 1SYBA 2BCOA 4F8MA 1Y1VB 3FMCA 4UDUC 1F9QA 1F2MA 2JEBI 2RQXA 3D8GA 3I4LA 3I73A 5AFWA 3KBGA 5KIXA 3L3OC 3S17B 5BN3A 3I3CA 3E5SA 3NHHA 4K8JA 4RGOS 4KY7A 2WINB 3GP7A 1EYDA 1T5XD 1Y8PB 5J22A 1PTOB 1G2SA 3J7AF 3SE0A 4Y7NB 4G57A 2F0OA 4J1MA 1ET6A 4ILWA 5ISRA 5CV7A 1B1ZA 4KN7C 4ZK9B 4FP5D 1SXTA 3GTLB 1GJXA 1KDAA 3NWTA 1O7YA 3FVQA 1I4QA 2EOTA 5IIFA 4IFDJ 3AB9A 1BNZA 1XXGA 5CV5A 1I6HB 3ERQA 2K7VA 1PRTF 3OOCA 3MEHA 4A3DB 1NR2A 1B4OA 2DNCA 5C0XI 4KKTA 2B2UC 2JP1A 2RDFA 3A8JE 1M8AA 2NZ1D 3C3LA 2RA4A 1IKLA 4DK0A 1EY9A 4F88A 1HFGA 2B2UA 1AN8A 1CFMA 3OIQA 4K2LA 3CU7A 2KJXA 3M7GA 3R8BA 1TWHB 3KLSA 1IW7C 3I70A 3TP7A 3S1RB 5JOBA 2K03A 1GOZA 1K8MA 2PW7A 1WTXA 4KHZA 1JWSD 4B9XA 4ZKCB 3OPOA 1RD9D 2NYZD 4HMJA 2D62A 2K5WA 5LL6X 4IURA 3S9WA 3Q24A 1Z7TA 3D6CA 3H0GB 2L1BA 4YIJA 4RHSA 1JE4A 4NDXA 1STBA 2NUCA 2M9VA 2PPBC 4RH6A 2DY7A 2KCNA 2VB2X 2TSSA 2EE1A 3KBXA 4ABNA 3HOXB 1DZ1A 1RJTA 1LV9A 1ZYRD 4Z9CB 2ENBA 1ONLA 4HCSA 3S1QB 1TT2A 1BF4A 2B2VC 3MVVA 3WDNA 1PLFA 1STHA 4HTHA 4S3SA 1HRJA 4RFBA 3P1HA 5G3LD 3PUYA 1U4RA 3BVZA 1FD7D 1F9SA 5EKKA 3J7AV 4C3IB 5KGUA 2K32A 5ELFA 4F7XA 2L4NA 1CQFA 4Q0FA 3I8ZA 2F0FA 1LTSD 4EQPA 3DWAA 3A8IE 2N55A 3PO2B 2B2TA 3TN2A 3RMHA 3HKZB 4C3JB 2NTTA 3VR6A 2A73B 4ME5A 2AWNA 3TP5A 2F0JA 1V1PB 4RKBA 2F3VA 3CHBD 2AWOA 2HCIA 3K58A 1WTVA 2NVQB 4DK1A 2X6GA 3UI2A 4ZLTF 1JC7A 5CBEE 5EGTA 3JAML 3RD4A 4LMQD 1XWEA 3VA7A 1WTWA 1LTBD 2C9OA 1GHJA 1WD0A 4X3TA 1LT5D 1IKMA 2K01A 4N9PA 5ELCA 3PUZA 3GTQB 3NTKA 1QB5D 1UAPA 5IODA 1LTID 2E76C 5TSSA 1SNQA 4PQXA 2BA0A 5M9OA 2F0IA 5J1ZA 5C3WA 5C0XH 4K2KA 3K7AB 4H13C 5CORA 1TR5A 1X3PA 1EYAA 4K14A 1SYCA 4OIJA 2EJGC 3TMEA 5G3LF 1KABA 1ILPA 3BG3A 2NB0A 1D2BA 3WOFA 1KDCA 1STGA 1IYUA 3EQLC 3JAME 1Q12A 3HRZC 1PFMA 5CV8A 4DFAA 1RHPA 1DXMA 4H0LC 4ULLA 2R92B 2HQEA 1WVLA 5KYLA 2BOSA 1FR3A 2NVTB 2JA6B 3ZYYX 5DM73 1ZXTA 2DY8A 5T1GA 4OO1H 3M85A 1B2TA 4K8IA 3NK9A 1D1KA 3Q23A 1PZID 1ENAA 3MWYW 1AEXA 2AQ2B 1I4GA 3D4RA 3VYTA 5T1IA 4PMCA 1HXYD 4DGZA 4RKLA 3V05A 2R7ZB 2R6GA 1CA5A 4J6HA 1Z6HA 2KUMA 1DD2A 3I4NB 3HP3A 4CBVA 2H1EA 4IUTA 3TSSA 3I4MB 1PXUA 1D5ZC 4QUFA 2D2CC 3GD7A 1B44D 2Q8RE 2ZXRA 2NBFA 1B3AA 4KY5A 2KA7A 1LTGD 1R9TB 1OXXK 5M5YB 1IHZA 2MUYA 5IGFA 2EY1A 3ONAB 2JA5B 2IX0A 3DWPA 1GUSA 4G4KA 4A3IB 3NPPA 2HUGA 5EPKA 2E2DC 1NCVA 5IGDA 1GHKA 2F0KA 5C44B 1DOMA 4EQNA 4BA2I 2I46A 1BR9A 2OT2A 4PMWA 2VXWA 1EQVA 1JOKA 2NN6G 2WACA 3EROA 2B8GA 2ZXOA 3J81L 1EY8A 2VB3X 4H7BA 1TU2B 3RUZA 1G291 3R2IA 1EU4A 1FYCA 1YNNC 4V190 1I3QB 1TWCB 2PCFB 1S5DD 4KK7A 3LWEA 4FXDA 1TKWB 2G9DA 2A68D 3CKIB 1Y8NB 1CK1A 4KI0A 5C0XJ 2L5TA 4K5WA 2RVLA 5K5PA 1LTTD 1PFBA 4A3GB 2KOLA 1JCKB 1PTOC 1EIHA 4CHTB 2B2YC 4MN3A 1EL0A 4FF1A 4NMZA 2MJ8A 5C4JB 3HOZB 3EVQA 1F2YA 1I50B 2D9UA 3L7ZC 2JA7B 1DJRD 5JAVA 4KHVA 1VDZA 1EIGA 3U9SA 2B2WA 1WCMB 2EYMA 2EYOA 1E0BA 1WTPA 4KV6A 1F2LA 1G91A 2A68C 5I6YA 4G7HC 3RZDB 2M00A 3A7LA 1Q90A 3BVGA 2VUMB 1Y69U 3T16A 3GTJB 2RDHA 4DNTB 1OXVA 4H44C 3IAYA 4DAPA 1GUNA 3GTKB 5CV6A 2MGSA 4A3JB 4IUVA 2WB1B 1EY7A 4OO1I 3VYRA 3WOEA 5C3XA 3ND8A 2J7ZA 4BBRB 4K6LA 1F77A 4NKLA 1Y1WB 4O1NA 1EWCA 2Q8TA 1LT3D 3BVMA 2MHVA 2PZUA 1BOSA 1VCIA 2EYPA 2A6ED 1RTOA 3D4DA 5HURA 3KLSX 5JVH3 3MXUA 3T51B 5CV4A 5I2YA 3NP8A 5ELEA 1OO9B 5EPLA 2B63B 3GO5A 4XXEA 3PUWA 2AQ3B 2X69A 5BN5A 4A3MB 2GA4B 2R3ZA 3NWSA 4DAVA 4IALA 1W6JA 3K57A 1F9RA 2LS01 2K28A 2PZTA 1HUMA 4ZYSA 3OW7A 3A8KE 2IWHA 1ML0D 1HQMC 2LKVA 5JPMC 5KNDA 3TP6A 4FF4A 2JXMB 2AUKA 2J4XA 1CQVA 3HOUB 3A7AB 5CGKA 2CW0C 1HTPA 3PMFA 4BY7B 3VYSA 4U673 2ICEC 2N88A 4PV1C 2F0NA 5DAUA 2K33A 2EJFC 3GTOB 3K5OA 4XQNA 2J0TD 3QOJA 1ZEQX 3GV6A 2A69C 1TS5A 3CRLC 2SNMA 5D65A 2HDLA 1YNJC 4CGYB 2RSOA 3SK6A 5D3IB 2ID0A 3S2HB 1SAPA 3C46A 4E6IA 1PRTD 1TS3A 4Q5VA 5DEHA 3M7NA 5COYA 4KTAA 2E75C 2CVRA 2TMPA 1EEID 3EJIA 3DMUA 2KVMA 3URYA 3MC0B 1BCPC 4TQUS 2ZT9C 5EKLA 1TWFB 3OSOA 3C2PA 2O2LD 4OHJA 3D4WA 1RODA 3J80E 2F0PA 2IX1A 3A55A 3GTGB 2NTSA 1EFID 2IPKD 1J9OA 3M4YA 3K59A 3DEPA 4IFDI 1W6KA 3D31A 4OIKA 1HQRD 3MA2B 5LHY1 3ITPA 5FO8B 2XSCA 4ZRZA 5A35A 1WTRA 5C4ZA 3NE5B 3X3MA 5C4XB 4ZAIA 4C3HB 1MD2D 3T4AC 5FKAC 4XQJA 3IFDA 2F1MA 4CKEA 4EGVA 1NSNS 5JEAH 3DWQA 2EXZA 1MGSA 1BO0A 2KEEA 5DNFA 3VR5A 1D5MC 2E74C 5C0XG 2H4OA 5KNBA 4TSSA 1PTOH 2F0DA 1GUTA 2XVSA 2XWBB 4OGQC 3SVMA 1AW7A 2R93B 3HOVB 5D3DA 2IJ0A 5C5LA 4KD3A 4KJOA 3FDTA 3O13A 4XYQA 1TS4A 3P7JA 4L6TB 1LABA 4A3EB 3S1MB 2B39A 5IGBA 1H9SA 4FF3A 1SSOA 1STNA 4C1NI 4KMUC 3NTIA 1F9PA 3OWFA 3T13A 1VF7A 4BS9A 1V1PA 1E2WA 5E3FA 2BE5D 3VR3A 3MAQA 1B50A 1SYGA 1C8CA 1SYEA 1CT1D 2AQ1B 2F0MA 4IUUA 1X32A 3P20A 5CMDA 4WORA 2NVYB 5FLXL 1HCZA 5C3EB 3PIP3 1EZ6A 4RGTA 1JICA 5I6WA 1OXTA 4WRDA 2HDMA 1DM0B 4QB4A 3PV0A 2PMZB 3MHBA 3OMGA 3HEJA 3VR2A 4C3IG 4RAUC 2HCCA 2RKSA 1FNWA 1SYFA 4DXGA 3C1EA 1D1IA 1RF2D 1PTOF 2FMCA 3D3RA 2X6LA 3MZ5A 4XQQA 1QCBD 3HGBA 3MXGA 1WD1A 2M2LA 1MSHA 2Z4HA 3FPUB 3BDLA 4JK1C 4ZKBB 1ET9A 3VR4A 1EY4A 1SJED 2SDFA 4HAEA 2Z1CA 2WP8J 1BBXC 4IFDH 1STEA 4F87A 4XT1B 1B9MA 3QG1A 3NXWA 1SEBD 3PO3B 4BBSB 2EY5A 3R93A 1I4PA 1EZ8A 2PW5A 3OHXC 1EQTA 4EQOA 2L11A 1RTNA 3L9AX 1ILQA 4FVMA 4DNRB 2OF1A 5J39A 3NSWA 1KNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUU A;  2N88 A;  1X32 A;  2MGS A;  1PFM A;  2B2T A;  2VXW A;  4OIK A;  3TN2 A;  2FIN B;  2L9H A;  1QE6 A;  1RHP A;  4O42 A;  1U4P A;  1NR4 A;  1DOL A;  1S4Z A;  5CMD A;  4CJ0 B;  5EPJ A;  4IUV A;  3D6W A;  4IUP A;  1WTR A;  3I90 A;  2B2W C;  3N52 A;  4NW2 A;  4U68 A;  1G6Z A;  3GV6 A;  2K03 A;  1PDQ A;  1WVL A;  5EJW A;  4XDX A;  4XT3 B;  2J7Z A;  1WTX A;  4X3U A;  1SDF A;  4IUQ A;  1QNK A;  3DEO A;  4ZAI A;  4ZKC B;  1HA6 A;  3IL8 A;  2JYO A;  2NYZ D;  4X3S A;  1JIC A;  4R8I A;  4MHE A;  1AP0 A;  1ZXT A;  2HCI A;  2KEC A;  2FMM A;  2DY8 A;  3IFD A;  2HDM A;  1WTV A;  5D65 A;  5CBA E;  1F9Q A;  3LWE A;  2Q8T A;  4RA8 A;  2HDL A;  5T1G A;  2X6G A;  3DM1 A;  4IUR A;  1MI2 A;  3UI2 A;  5AFW A;  1MGS A;  1BO0 A;  3MTS A;  2KEE A;  4ZLT F;  5CBE E;  2L1B A;  5DNF A;  1XYI A;  1JE4 A;  3DEP A;  1DON A;  1B2T A;  3Q6S A;  1HUN A;  3I3C A;  1RTO A;  2K05 A;  2XIW A;  2RSO A;  2DY7 A;  1DOK A;  4LMQ D;  1WTW A;  1U4L A;  2K04 A;  3G7L A;  4HED A;  4RAU C;  2EPB A;  2HCC A;  2L12 A;  2MP1 A;  1EOT A;  2RVL A;  4QUC A;  2EE1 A;  3KBX A;  4X3T A;  1WD0 A;  1AZQ A;  1J8I A;  1IKM A;  1X3Q A;  1SAP A;  2B2V A;  1PFB A;  1G2S A;  3MWY W;  4CJ1 B;  1DZ1 A;  2KOL A;  2K01 A;  1RJT A;  1EIH A;  1LV9 A;  2B2Y C;  3SVM A;  1CM9 A;  5EQ0 A;  3F2U A;  5T1I A;  4CJ2 C;  3GV3 A;  4DN4 M;  4MN3 A;  5EPL A;  1EL0 A;  4HCS A;  3I91 A;  2X6L A;  4RWS C;  1O80 A;  2IL8 A;  1AZP A;  2MJ8 A;  1ICW A;  2X69 A;  1BF4 A;  1CA5 A;  5COY A;  2B2V C;  1KNE A;  2MPM A;  5E4W C;  4ZK9 B;  5JJZ A;  2KUM A;  3FDT A;  1PLF A;  1VMP A;  2R3Z A;  1O7Z A;  2FHT A;  2M2L A;  1WD1 A;  2CVR A;  1XX8 A;  1MSH A;  2D9U A;  3HP3 A;  3FPU B;  1F9R A;  1HRJ A;  2H1E A;  1TVX A;  2NWG A;  4IUT A;  2B2T C;  1O7Y A;  2BDN A;  3P7J A;  4X3K A;  1WTO A;  5COR A;  1VMC A;  2K28 A;  4QUF A;  2EOT A;  4ZKB B;  1X3P A;  1GUW A;  1B53 A;  1EIG A;  1U4R A;  2B2W A;  2FJ2 A;  2KVM A;  1HUM A;  2Q8R E;  1F9S A;  2KED A;  1BNZ A;  1A15 A;  1B3A A;  5E4X A;  1WTP A;  1E0B A;  4OIJ A;  1F2L A;  2SDF A;  5D14 A;  1ML0 D;  4HAE A;  1G91 A;  5EKI A;  1BBX C;  1ROD A;  4R9W A;  4XT1 B;  2K1B A;  1SSO A;  1HFN A;  1HHV A;  1NR2 A;  2L4N A;  2FFK B;  1PFN A;  3R93 A;  1B4O A;  3I8Z A;  1G2T A;  3ONA B;  1MSG A;  1NAP A;  1F9P A;  1ESR A;  1ILP A;  2B2Y A;  1CA6 A;  1QG7 A;  1EQT A;  4HSV A;  2B2U C;  3H91 A;  2JP1 A;  3KUP A;  2L11 A;  4UAI A;  1IL8 A;  2RSN A;  1RTN A;  1M8A A;  1B50 A;  2NZ1 D;  1J9O A;  2HUG A;  5EPK A;  3TZD A;  1ILQ A;  2RA4 A;  1IKL A;  1NCV A;  1C8C A;  1U4M A;  3QO2 A;  1Q3L A;  1DOM A;  1HFG A;  1WTQ A;  2N55 A;  1KNA A;  2B2U A; 
#chains in the Genus database with same CATH topology
 1E1T A;  4KD4 A;  2L9H A;  1QE6 A;  2ZJQ A;  1A3U A;  3HOZ G;  1NR4 A;  1E2Z A;  2XRS D;  3K0X A;  2WB1 E;  2DUD A;  4R4O A;  1VQ6 A;  3RLN A;  2F0E A;  4U68 A;  4DF7 A;  4XYO A;  2LFN A;  1QNU A;  4OON A;  3S1N B;  1Y14 B;  1LO5 D;  4I7Z C;  1CSP A;  2ALY B;  3S1R H;  3I4O A;  2PYK A;  1AFP A;  2WAQ E;  2SOB A;  2VQE L;  3HKZ G;  5IT9 E;  4L63 B;  4QIW B;  1TY2 A;  4RA8 A;  1ENF A;  3HOV H;  3S15 B;  4OX9 Q;  1XYI A;  1IBL Q;  2R92 H;  1SE4 A;  1W3S A;  4K0K L;  1P16 A;  3G7L A;  2K04 A;  3J81 j;  1S5C D;  3PIP A;  1TWG B;  3FRP B;  1VQE A;  1NMF A;  2CHB D;  4CJ1 B;  2I0Q A;  3BDC A;  4NXM Q;  3K6O A;  2LY7 A;  2MNA A;  1NUC A;  5EQ0 A;  3PO3 H;  1VQI A;  5IWA Q;  5IY0 A;  1PYB A;  2MO1 A;  4JI2 L;  1ICW A;  4B08 A;  3T1Y L;  1PH2 A;  4FF2 A;  1J5E Q;  1Q1B A;  4RGN A;  1SFO B;  1I4R A;  1BXT A;  3CW2 C;  1PMR A;  4GN5 A;  3W5O A;  3FKI G;  5K36 H;  3CQZ H;  1IXR A;  1UNS A;  3BZD B;  2UUA Q;  1JWU D;  3SXH A;  5FO9 B;  1A15 A;  3NBH A;  5CYU A;  4NPS A;  4DR1 Q;  1EY0 A;  5EBD A;  1XMQ L;  5IE8 A;  4QCL A;  4QF4 A;  2DGY A;  1KDB A;  5ELB A;  4JI5 L;  1HHV A;  4GNX C;  3D0F A;  3H3V H;  1TS2 A;  1O7I A;  3KUP A;  4UAI A;  2QW7 A;  4IO9 A;  2ICI A;  5C5M A;  4ZUJ A;  1EYG A;  3NTH A;  3TZD A;  1UE6 A;  1BUV T;  1CKN B;  1SMX A;  1X54 A;  3ND9 A;  1WTQ A;  1Q3L A;  1T9H A;  2JQO A;  3QIA A;  1A3T A;  3S2D B;  1YNJ D;  1SNC A;  2A6H C;  5KYI A;  5CC4 A;  4JBW A;  1DOL A;  3L2P A;  2ZTC A;  2L55 A;  3D6W A;  5IGG A;  3KK7 A;  3N6R A;  4NW2 A;  3FKI B;  1BKB A;  1JR0 D;  3CCJ A;  3HKS A;  3HOW G;  4UPA A;  3U50 C;  4X3U A;  3RZD H;  1HA6 A;  3GTM B;  1DYQ A;  2EY6 A;  4JG2 A;  1YJ9 A;  4FO2 A;  4WJW A;  2FMM A;  1HPC A;  2C5C A;  1RDP D;  3CME A;  3S16 B;  2CW0 D;  4A3M H;  1PH1 A;  5NUC A;  4JI4 Q;  4IJH A;  3DM1 A;  3CD6 A;  5HGT A;  2F0G A;  5JJL A;  1NMG A;  3SK5 A;  1GUG A;  4MIU A;  2CQO A;  1V1O A;  1S5B D;  2OCE A;  3IFT A;  1T5E A;  1SYD A;  1TWA B;  2B2V A;  4ZQ3 A;  4B3S L;  1TWG H;  4JI3 L;  4GZY C;  1CM9 A;  1K8O A;  2A74 C;  3F2U A;  3NBI A;  2OTL A;  3GV3 A;  2O5I C;  4QQB X;  3K5N A;  3OMC A;  3CRK C;  1BDO A;  5GRO A;  1CI3 M;  4IN3 A;  1YNN D;  2MO0 A;  1R9T H;  1ESF A;  1CTM A;  2IT1 A;  1FL0 A;  1O7Z A;  2FHT A;  2QGQ A;  1K83 H;  1XX8 A;  4AYB B;  2WKD A;  2BA1 A;  3MEF A;  1GVP A;  2QA4 A;  2F52 A;  3I2Z A;  4RCO A;  4BBR H;  5CR3 A;  4A3K B;  3A56 A;  5DM6 3;  1UUP A;  1QWY A;  2WII B;  3AFQ A;  2EYJ A;  1RKN A;  1H9K A;  2YTV A;  3KF8 A;  3LGJ A;  1RCV D;  5I9P A;  3FEW X;  3M3Y B;  4Y52 H;  4R9W A;  2K4K A;  4PMB A;  1V8Q A;  1PRT C;  1PFN A;  3K81 C;  1E7Z A;  1G2T A;  1MSG A;  3SR1 A;  1RIP A;  2B2Y A;  1ZKO A;  4CDC C;  5KNC A;  1QG7 A;  3H91 A;  3BYY B;  2JA8 B;  3ICE A;  3R2T A;  3Q8D A;  1M90 C;  2ZM6 L;  4GN3 B;  1UEA B;  1FGB D;  3NUC A;  2OXP A;  4R1J A;  1PYW D;  4YCU A;  3VA5 A;  5FOB B;  4GKK L;  2CFM A;  1S5E D;  4H02 A;  3U9O A;  1S40 A;  1CZG A;  1U4P A;  2K5D A;  2O5J C;  2F0L A;  1V43 A;  2F03 A;  1HNZ Q;  1MJE A;  4C3H G;  1EU3 A;  1U9R A;  4TKO B;  2B2W C;  3N52 A;  1EYC A;  2JA5 H;  3Q0A A;  1JWM D;  5EJW A;  3S15 H;  2K6A A;  1CHP D;  2JYO A;  4L5R C;  1SNO A;  1AP0 A;  4FXG C;  3A54 A;  2KEC A;  5FK9 C;  4A3B B;  3K8A A;  3CCE A;  2WKC A;  2JSO A;  3FP9 A;  2O4X A;  1KAA A;  4POG A;  2VS1 A;  2YU9 H;  1PVO A;  1U5K A;  1E2V A;  2SEB D;  1SND A;  3SK8 A;  2QCP X;  2A6H D;  5M3F B;  1C48 A;  1WJJ A;  1CZW A;  4KY6 A;  5IT9 L;  4LFA Q;  2F4I A;  1H9R A;  1EOT A;  1J8I A;  3X3N A;  1X3Q A;  1K8A C;  4CKB A;  4A93 B;  4P71 A;  1II3 A;  1M1K C;  5JJI A;  5GAE C;  2BDO A;  3TRE A;  1TY0 A;  4N9T A;  4JYA Q;  4DN4 M;  2QKI C;  2WFW A;  3AQQ A;  2RCN A;  1HA5 A;  1FJG Q;  1EEF D;  4JV5 L;  1I6V C;  4LF5 L;  4JOI A;  4A3E G;  1KNE A;  5E4W C;  1I4H A;  2UXC Q;  4DV6 L;  3QB3 A;  4OO1 G;  4CDD C;  4A75 A;  4ODG A;  2BDN A;  2I07 B;  4JCV E;  3BYT B;  3TBI B;  3K7A H;  1VMC A;  1UWV A;  3H3V I;  3GTP B;  4ID6 A;  1PHJ A;  2XRQ D;  1DCZ A;  2EYH A;  2KQ3 A;  1H9S B;  2Q2H A;  2NN6 H;  2ZXP A;  4DKA C;  3T1Y Q;  4XTC S;  4P73 A;  1OTC A;  4GN4 B;  3M4Q A;  1GD7 A;  4LUV A;  1PZJ D;  2EZV A;  1A2U A;  3SGI A;  2D5D A;  3PF4 A;  4FYD A;  2OTJ A;  2XTI A;  3ULP A;  2YTY A;  5M5W B;  4GOP A;  5KRU A;  3BS1 A;  1CA6 A;  1STY A;  1CKM A;  1Z9F A;  2F3W A;  1KTK A;  1HR0 L;  1YHQ A;  2K5V A;  3J7Z C;  3NQT A;  1JB3 A;  3CCU A;  4I65 A;  1U4M A;  3DXJ C;  1L1O B;  1Y8O B;  4BBS H;  3I4M G;  4DUZ L;  1VS0 A;  2BE5 C;  2YYZ A;  4PNY A;  2Y0S B;  4KJN A;  2F0U A;  4MTN A;  4DR4 L;  4RMF A;  4JI7 Q;  4X6A H;  3I90 A;  1SMY D;  2QDL A;  1XNQ Q;  3HG9 A;  1LTA D;  4G7O C;  4XDX A;  3PIO 3;  1VQJ A;  4R4T A;  1SDF A;  4HN7 A;  1MBY A;  3DEO A;  4N8F A;  3UE1 A;  4M1U B;  1G8Z D;  3OIP A;  4K6D A;  1SE2 A;  5C6A A;  3SDZ A;  4IPD A;  1XMO Q;  1EWH A;  4MHE A;  3K5L A;  2AUJ D;  2UUC L;  5IOC A;  1FVI A;  5LL6 S;  2AHO B;  1KRS A;  1BCP B;  2R7Z H;  4YY3 L;  1E24 A;  4A3F G;  1HUN A;  2XIW A;  2P5Z X;  4BXX H;  1DOK A;  3S2D H;  5IP9 H;  4A3G H;  2EPB A;  2R61 A;  1IL2 A;  1WCM G;  4LFC L;  4DA2 A;  1AZQ A;  4GKK Q;  5FJ8 G;  3CPW A;  1W2B A;  1PH3 A;  5C4H A;  3S24 A;  1I94 L;  2Y0S G;  1D5X C;  4DR1 L;  2OEO A;  1S72 A;  1KL9 A;  3I91 A;  4RWS C;  3UDX A;  1N34 L;  2YU9 B;  2E2H H;  3E6Z X;  2SNS A;  2JA6 G;  4HSP A;  2MPM A;  1N33 Q;  4MZ9 A;  4IPC A;  4LAA A;  3OWE B;  3EFX D;  4HMI A;  4A3L H;  5JPN C;  3CQZ B;  3J81 c;  2G9H D;  5M5X H;  2F0Q A;  2KED A;  4UY8 C;  2MFI A;  2JE6 I;  4IUN A;  1SN8 A;  2HIX A;  4A3F B;  4P72 A;  1A2T A;  1KD1 C;  3GTL H;  4OEL B;  4JBJ A;  3TP8 A;  1B9N A;  2Z8L A;  2OQ0 A;  2F0H A;  1YZ6 A;  1EY5 A;  1NAP A;  3MFY A;  2A6E C;  4B3R Q;  3E0J A;  3KFU A;  1YHB A;  1IL8 A;  3DHQ A;  4HCE A;  2WAQ B;  5JVG 3;  2I5L X;  2HHH Q;  1FNU A;  5AJ3 L;  1HJP A;  2XNA C;  1GUO A;  1Q1E A;  3RR5 A;  3EA6 A;  5BR8 L;  2FIN B;  1L2F A;  5KEE A;  4EQ5 A;  1OXU A;  1B8A A;  1SBB B;  4QMG A;  4BWG B;  1WI5 A;  4NP5 A;  4B3R L;  4A3C H;  1DGS A;  2QEX A;  5CV9 A;  4JI7 L;  4DR2 L;  4IOA A;  4KN4 C;  2BH2 A;  2QIL A;  5IP7 H;  3P75 A;  2IX3 A;  4ZUI A;  3I4N G;  3KF6 B;  4TRD A;  3T53 B;  3OYY A;  3H6M A;  3KJP A;  2ZTD A;  3S14 B;  1GKH A;  2GVB A;  1RL2 A;  2ZTE A;  5DLQ E;  1B3Q A;  3GQB A;  2EIF A;  1MI2 A;  4EVO A;  3PQI A;  2A5H A;  1R4Q B;  2K05 A;  1N34 Q;  1U4L A;  4HED A;  5IGC A;  1C7Y A;  1C4Q A;  1F2Z A;  2F0W A;  1VQD A;  3J80 L;  2B63 H;  3J81 E;  1XPO A;  1IYV A;  1YJN A;  4BY1 H;  4N8X 1;  1VQN A;  3PUV A;  4R4C A;  4IFD G;  2F0S A;  4L5Q A;  4CJ2 C;  1S5F D;  4KKS A;  3QJY A;  4RHR A;  4WFN 3;  4APV A;  2NN6 I;  1X56 A;  1O80 A;  1A6X A;  1STA A;  1X65 A;  1L0X B;  3CC7 A;  1EY6 A;  4DU9 A;  2L15 A;  5M5W H;  4DAY A;  5M3M B;  4PG3 A;  3G6J B;  4DUY L;  3L0O A;  4LNQ A;  1B70 B;  2QF7 A;  3AU7 A;  2NWG A;  5EAY A;  4X3K A;  3V2T A;  4DAY B;  1PZK D;  3MFG A;  2KHS A;  4G7Z C;  2VUM G;  3HOZ H;  3G4S A;  1Y1W H;  3M4O B;  5EKI A;  2K5Q A;  1KQS A;  1CSQ A;  5C4J H;  4R8N A;  3H94 A;  2K1B A;  3SK4 A;  2E2H B;  1HFN A;  3AMU A;  1B7Y B;  1K83 B;  1ESR A;  5A2Q L;  5BN4 A;  3TZU A;  1NNX A;  2VNU D;  5JJK A;  4IQZ A;  3LNN A;  4UP8 A;  2PQE A;  3HFZ B;  1LTR D;  2PO4 A;  4JOI C;  1PRT B;  4X66 Q;  2Z4I A;  1VQ5 A;  4NXM L;  3R3O A;  3MXN A;  3HOV G;  3HOY B;  2RHS B;  1KIX A;  2JA7 G;  1NE3 A;  1XTC D;  3HOW B;  3I72 A;  2JEA I;  1K3B C;  1TWA H;  1L0Y B;  2KCT A;  1U0L A;  2L0C A;  3TDQ A;  3RLO A;  1PDQ A;  4FNF A;  2R93 G;  5C3E H;  4TVA B;  4DXF A;  1HH2 P;  1XNR Q;  4IUQ A;  3PO3 G;  4X3S A;  2NVX H;  2DN8 A;  4R8I A;  1BCP D;  2NZO A;  5M3M H;  5CBA E;  3J7Y W;  4DR7 L;  2K52 A;  4K5V A;  3GTM H;  1SLJ A;  1ICF B;  3HS0 C;  3FPP A;  4B9W A;  4C56 C;  1OXS C;  2RDG A;  1H9J A;  1QVG A;  3FKI H;  5K36 G;  1JOQ A;  2XWJ B;  3LX0 A;  2MP1 A;  2L12 A;  2WV6 D;  4GLX A;  3RZO B;  1YNX A;  3JAM i;  4K5X A;  1GXD C;  5A2Q E;  1SNM A;  4WJ4 A;  4V0B A;  1EIF A;  3ZJY C;  3PUX A;  1IBK L;  2UUB Q;  1A3V A;  2IL8 A;  3KDF B;  2JN4 A;  1AZP A;  2PI2 A;  2KCC A;  4RCN A;  1SMY C;  2Q8I B;  1HTL D;  1JJ2 A;  3CPF A;  2A1A A;  2EY2 A;  4LJZ C;  4C3J G;  5IGE A;  1CHQ D;  3F2C A;  1TII D;  2EDG A;  3EIV A;  2PQA B;  1B53 A;  1GUW A;  5EBC A;  2FXQ A;  5ELD A;  3S1N H;  2K5H A;  3U58 A;  5D14 A;  3I7F A;  4IZ8 A;  4KKU A;  1TWC H;  3MXN B;  5ELN A;  5I4D A;  2XN9 C;  4RGM A;  3VDY A;  1ENC A;  2FFK B;  3K0Y A;  4A93 G;  1D7Q A;  1ZYR C;  1IBM L;  1Z47 A;  4FXK C;  5I9O A;  3V96 A;  1QIL A;  4HSV A;  1CKO A;  3AEV A;  3SHL A;  1X3F A;  4IOC A;  3H3V C;  1C9O A;  1FNV A;  1BQQ T;  2UXD L;  4A3M G;  3QO2 A;  2E8G A;  3VYU A;  5M3F H;  2F0T A;  2IHE A;  5JEA G;  1XNR L;  4A3I H;  2CQA A;  1SNP A;  1KXL A;  1LLR D;  3HOX H;  2PMZ E;  4CJ0 B;  5EPJ A;  1SE3 A;  4LF6 L;  1M4V A;  4R4I A;  4C1N K;  4AYB G;  1WOC A;  2B8F A;  2NVT H;  4OL7 A;  2A69 D;  2EYF A;  1JOR A;  4X64 L;  1QNK A;  2F0V A;  3QWN A;  4I7A A;  2JJQ A;  1Q8I A;  1XPU A;  3G48 A;  5JEA J;  3IL8 A;  3RN5 A;  2IW3 A;  3S1M H;  1PH5 A;  1KLU D;  1MHW C;  3LWU A;  4JI8 Q;  2PNR C;  1X6O A;  2LMC B;  3DUZ A;  4LF4 Q;  2K50 A;  3MTS A;  3H09 A;  4CKC A;  1DON A;  3Q6S A;  1O7L A;  2GN5 A;  3W3A A;  2VY3 A;  1SJH D;  4BY1 B;  4BA1 I;  4QGU A;  4DV7 L;  4DR2 Q;  3BDO A;  4HIO A;  5F2D A;  1HR0 Q;  1PYS B;  4QUC A;  4GNX B;  2D0P A;  1JQY D;  4X62 L;  1HNX L;  1I5F A;  1PTO D;  4GNX A;  2ZJR A;  4LWC A;  1KLG D;  3C1F A;  5GAD C;  2HD3 A;  3KF8 B;  1HZ9 A;  5JJZ A;  4A3K H;  1VMP A;  2DJG C;  4M8A A;  2E2J B;  1K9M C;  1H9M A;  3IKJ A;  1TVX A;  2B2T C;  4J8Q A;  1WTO A;  1I4X A;  3CCM A;  2EJM A;  2RBM A;  2UXB L;  4A3B H;  3ER0 A;  3T56 B;  1JOO A;  2FJ2 A;  1TQO A;  5IYB H;  1NBW A;  5E4X A;  5M5X B;  4XIG S;  4L8J A;  4C3H H;  4LK1 C;  4JI1 Q;  3H0G G;  2DNE A;  2PZW A;  2EYL A;  2QDB A;  3Q22 A;  1JT8 A;  2BH8 A;  2V4D A;  2E2I B;  4DR5 L;  4PZ7 A;  2RSN A;  2QEJ C;  3NQI A;  3RLF A;  1QOH A;  1N36 L;  1LTL A;  3W2D A;  1LAC A;  1SE8 A;  1O78 A;  1LT4 D;  3CCL A;  1GM5 A;  4QIW E;  2JA8 H;  3QOL A;  1LT6 D;  1D6E C;  4O42 A;  3K5M A;  4C2M B;  1QJO A;  1S4Z A;  4P2C B;  2EVB A;  3F8T A;  3MXP A;  4IUP A;  4DV1 L;  2HIV A;  3E9H A;  4HR7 B;  4YWM A;  3TS0 A;  1G6Z A;  1SRO A;  3SEB A;  2VW9 A;  3KLR A;  2NVX B;  1R4P B;  3UDF A;  5I2X A;  3HZX A;  4XT3 B;  5E1F A;  4A76 A;  5FO7 B;  1VF5 C;  4X64 Q;  3KYH C;  2E5L Q;  1BCP F;  1CKN A;  1Y1V H;  4GLA C;  5FLX E;  2ZJP A;  5HY6 A;  1IW7 D;  1SYB A;  2E2J H;  2BCO A;  4F8M A;  1Y1V B;  3FMC A;  4UDU C;  2N49 A;  1F9Q A;  1F2M A;  2JEB I;  2RQX A;  3A0J A;  3D8G A;  3I4L A;  3I73 A;  5AFW A;  3KBG A;  1XTD A;  1VQH A;  5KIX A;  3PO2 H;  2CKZ B;  3L3O C;  3U4V A;  1NY4 A;  5BN3 A;  1HNZ L;  4K8J A;  3I3C A;  3E5S A;  3NHH A;  1PH8 A;  3S17 B;  1PH4 A;  1QUQ B;  4RGO S;  4KY7 A;  2WIN B;  3GP7 A;  1EYD A;  1T5X D;  1Y8P B;  5J22 A;  1EOV A;  1PTO B;  1G2S A;  2Q2I A;  3J7A F;  2HT1 A;  2V1C C;  5FLM H;  4DNI A;  3SE0 A;  1BBU A;  4G57 A;  4Y7N B;  2F0O A;  4KHP Q;  4J1M A;  2CH4 W;  1ET6 A;  4YWK A;  2F4V Q;  2Q2U A;  3J7A 5;  4ILW A;  4JBK A;  5ISR A;  5CV7 A;  1VQ8 A;  1N33 L;  1B1Z A;  4KN7 C;  4ZK9 B;  4FP5 D;  1SXT A;  3GTL B;  2UXB Q;  3PGZ A;  2IHF A;  1GJX A;  1KDA A;  3NWT A;  1O7Y A;  3FVQ A;  5LMN L;  1I4Q A;  4DR6 Q;  2EOT A;  5IIF A;  4IFD J;  1HNW L;  3AB9 A;  1BNZ A;  1XXG A;  1ASZ A;  5CV5 A;  1I6H B;  3ERQ A;  4A4I A;  2K7V A;  1PRT F;  1YI2 A;  4JYA L;  2Z9H A;  3OOC A;  3MEH A;  4A3D B;  1NR2 A;  1B4O A;  2EQS A;  2DNC A;  3CMA A;  4X62 Q;  5C0X I;  4DV6 Q;  4KKT A;  1LYL A;  2B2U C;  2JP1 A;  2RDF A;  3A8J E;  1M8A A;  4DR5 Q;  3GTO H;  2NZ1 D;  2CWA A;  4B3T Q;  2E2I H;  2RA4 A;  1IKL A;  4DK0 A;  4F88 A;  1EY9 A;  2UUC Q;  3C3L A;  1E3P A;  1Q46 A;  1HFG A;  2LXJ A;  2CWP A;  2B2U A;  1HNW Q;  3HOY H;  3DLL A;  1AN8 A;  1CFM A;  3OIQ A;  4K2L A;  2A8V A;  2R92 G;  3CU7 A;  3CCQ A;  3HOU H;  2KJX A;  3HKZ E;  3M7G A;  3R8B A;  5IP9 G;  4A3G G;  1JMC A;  4DR7 Q;  1TWH B;  3KLS A;  3K7U C;  1IW7 C;  3I70 A;  3TP7 A;  3S1R B;  5JOB A;  2K03 A;  1GOZ A;  3CCV A;  1K8M A;  2PW7 A;  1WTX A;  4KHZ A;  5C44 G;  1YIT A;  1JWS D;  3OW2 A;  3FHW A;  4B9X A;  4ZKC B;  3OPO A;  1RD9 D;  2NYZ D;  4HMJ A;  1VQO A;  2D62 A;  2K5W A;  1LUZ A;  3AYH B;  2RCF A;  3CP0 A;  2JA6 H;  1FJG L;  1QVC A;  5LL6 X;  4IUR A;  4NB3 A;  3S9W A;  3Q24 A;  1G51 A;  1Z7T A;  3H0G B;  2L1B A;  3D6C A;  4NDX A;  1JE4 A;  4RHS A;  4YIJ A;  3F2D A;  1WYD A;  1STB A;  2K75 A;  2M9V A;  2NUC A;  4RH6 A;  2PPB C;  4A3L G;  2DY7 A;  2KCN A;  2VB2 X;  2TSS A;  1VQ9 A;  2EE1 A;  3KBX A;  4ABN A;  3HOX B;  1DZ1 A;  4DPG A;  1YJW A;  1RJT A;  1LV9 A;  1ZYR D;  4A3D H;  4JPB W;  4Z9C B;  2ENB A;  1ONL A;  4HCS A;  3S1Q B;  1TT2 A;  4RG1 A;  1BF4 A;  1N32 Q;  2B2V C;  4P75 A;  3MVV A;  4GOP B;  3WDN A;  1PLF A;  1STH A;  4OXP A;  3CXC A;  4HTH A;  4S3S A;  1EWI A;  2ASB A;  3W1B A;  4B3M L;  1J6Q A;  1HRJ A;  3KLW A;  4RFB A;  3K80 C;  3P1H A;  4GKJ L;  5G3L D;  3PUY A;  1U4R A;  3I56 A;  3BVZ A;  1FD7 D;  1F9S A;  5EKK A;  3J7A V;  4C3I B;  4JI2 Q;  5KGU A;  4P74 A;  2N78 A;  2K32 A;  5ELF A;  5IWA L;  1IZ6 A;  4Y7N H;  3NBH B;  4F7X A;  5IP7 G;  2L4N A;  1CQF A;  4Q0F A;  4OEM B;  1TXY A;  3I8Z A;  2F0F A;  1Q82 C;  3T1H L;  4NXN L;  4B3T L;  2PNH A;  4O2D A;  2AKW B;  4A3J H;  4YHH L;  1LTS D;  4EQP A;  1X55 A;  2Z6K C;  3DWA A;  3TRZ A;  3A8I E;  2N55 A;  4X65 L;  3PO2 B;  2B2T A;  3S17 H;  3TN2 A;  3RMH A;  4DV0 Q;  3HKZ B;  4IPG A;  3RZO H;  4JV5 Q;  3T1H Q;  4C3J B;  4YCW A;  2NTT A;  3VR6 A;  2A73 B;  2HQL A;  4ME5 A;  2B63 G;  2AWN A;  3TP5 A;  4BY1 G;  2F0J A;  1EFW A;  1V1P B;  2OWO A;  4RKB A;  3NEM A;  2F3V A;  2UXC L;  3STB D;  3CHB D;  3S16 H;  3CAM A;  2AWO A;  2HCI A;  3K58 A;  2KHI A;  1WTV A;  2NVQ B;  4DK1 A;  2RHQ B;  2X6G A;  3UI2 A;  3E0E A;  4HJ9 A;  4K0K Q;  4ZLT F;  1JC7 A;  5CBE E;  5EGT A;  3JAM L;  3RD4 A;  3JC6 6;  4LMQ D;  1GO3 E;  1XWE A;  3VA7 A;  4AIM A;  1WTW A;  1LTB D;  4BBR G;  5IYD G;  2C9O A;  1GHJ A;  2R7F A;  4HJ8 A;  4X3T A;  1LT5 D;  1WD0 A;  1AE3 A;  1IKM A;  1Y1W G;  2K01 A;  3HOW H;  1N9W A;  2Q2T A;  4N9P A;  3G6E A;  5ELC A;  2CCZ A;  3PUZ A;  5C4X G;  1XPR A;  3GTQ B;  3NTK A;  1QB5 D;  1UAP A;  5IOD A;  5M5Y H;  4JI1 L;  4JI6 Q;  1LTI D;  2E76 C;  1J5E L;  2G5D A;  3PIO A;  5TSS A;  1SNQ A;  4PQX A;  2BA0 A;  5M9O A;  4HJA A;  2F0I A;  1MJC A;  5J1Z A;  5C3W A;  2JA9 A;  2XGT A;  4K2K A;  5C0X H;  3K7A B;  4H13 C;  5COR A;  1TR5 A;  5GAH C;  1X3P A;  4R4Q A;  4DV4 L;  1EYA A;  4K14 A;  1SYC A;  4OIJ A;  2Y0S E;  2EJG C;  3TME A;  1IBM Q;  5G3L F;  4AQY Q;  2YTX A;  2R93 H;  1KAB A;  1ILP A;  1BVS A;  3BG3 A;  2NB0 A;  1D2B A;  5E7N A;  3WOF A;  1I94 Q;  4LFC Q;  1KDC A;  1STG A;  1A63 A;  1IYU A;  4IJL A;  4DV3 L;  5M3M G;  3EQL C;  2LXK A;  3JAM E;  1Q12 A;  3HRZ C;  4JBM A;  4CDF C;  1PFM A;  5CV8 A;  4DFA A;  1RHP A;  1VQC A;  1DXM A;  1C0A A;  3EBE A;  1X3G A;  3H15 A;  4H0L C;  1I6H H;  4ULL A;  2R92 B;  2HQE A;  1WVL A;  5KYL A;  2BOS A;  1FR3 A;  2Z0S A;  2JA6 B;  2NVT B;  3A74 A;  3ZYY X;  5DM7 3;  1ZXT A;  3S14 H;  2DY8 A;  4A3E H;  5T1G A;  1PFS A;  4OO1 H;  3M85 A;  4KLK A;  1B2T A;  4K8I A;  4C3J H;  3BJU A;  3NK9 A;  1D1K A;  3Q23 A;  1PZI D;  5L37 A;  1ENA A;  4DV5 Q;  3MWY W;  1AEX A;  3KF6 A;  4YHH Q;  2AQ2 B;  1I4G A;  4CDE C;  3D4R A;  4LF9 L;  3VYT A;  5T1I A;  3U4Z A;  1UE7 A;  4PMC A;  1HXY D;  2K5N A;  2PQA A;  4A93 H;  4DGZ A;  2Z6K A;  4RKL A;  3V05 A;  2R7Z B;  2R6G A;  1CA5 A;  2OQK A;  4J6H A;  4JW0 A;  4LF7 L;  1Z6H A;  2KUM A;  4JI0 Q;  1DD2 A;  4UP9 A;  3KOJ A;  3I4N B;  1UE1 A;  3HP3 A;  4CBV A;  2H1E A;  4IUT A;  5M3F G;  4BY7 G;  2MQH A;  3TSS A;  3I4M B;  4POF A;  1PXU A;  1D5Z C;  4C3I H;  4QUF A;  1I3Q H;  2D2C C;  3GD7 A;  1B44 D;  2Q8R E;  2ZXR A;  1V1Q A;  3HOX G;  2NBF A;  1B3A A;  4KY5 A;  2KA7 A;  1LTG D;  2Z6B A;  1R9T B;  1OXX K;  5M5Y B;  1IHZ A;  2MUY A;  5IGF A;  2EY1 A;  3ONA B;  2JA5 B;  3CC2 A;  2IX0 A;  3GTJ H;  1V9P A;  2UUA L;  3DWP A;  1GUS A;  4G4K A;  4A3I B;  3NPP A;  2VQF Q;  2HUG A;  5EPK A;  4YWL A;  1NJI C;  2E2D C;  1NCV A;  5IGD A;  1GHK A;  2F0K A;  5C44 B;  1DOM A;  1N36 Q;  4JI5 Q;  4EQN A;  4BA2 I;  2R7Z G;  2I46 A;  1BR9 A;  2OT2 A;  4PMW A;  1WTH A;  2VXW A;  4DK6 C;  1EQV A;  1JOK A;  2NN6 G;  2WAC A;  3ERO A;  4AH6 A;  2B8G A;  4QJF A;  1YBY A;  2ZXO A;  3J81 L;  1EY8 A;  2VB3 X;  4H7B A;  1TU2 B;  3RUZ A;  1G29 1;  5FJ8 H;  3R2I A;  1EU4 A;  1EQQ A;  1FYC A;  1YNN C;  1SR3 A;  4V19 0;  1I3Q B;  3CCR A;  1TWC B;  2PCF B;  1P8L A;  1S5D D;  3OTO L;  5IYC H;  1TWF H;  4KK7 A;  1H95 A;  1Q86 C;  4DR3 L;  1YEZ A;  3LWE A;  4FXD A;  1TKW B;  2G9D A;  2A68 D;  3CKI B;  3G71 A;  3TQY A;  1Y8N B;  1VQG A;  3UDI A;  1K73 C;  1CK1 A;  3CCS A;  3M9B A;  4GLV B;  4KI0 A;  5C0X J;  2ZM6 Q;  4DV5 L;  2L5T A;  4MNO A;  4K5W A;  2RVL A;  3J81 i;  5K5P A;  1LTT D;  5IYB G;  1PFB A;  1YVC A;  4A3G B;  2KOL A;  1XJV A;  1JCK B;  1EQR A;  1PTO C;  4CHT B;  1EIH A;  2B2Y C;  4HID A;  1Q8K A;  4MN3 A;  1EL0 A;  1Q7Y C;  3I55 A;  4FF1 A;  4NMZ A;  2MJ8 A;  1AE2 A;  5C4J B;  3W1G A;  4OX9 L;  1D8L A;  3HOZ B;  3A5Z B;  3EVQ A;  3M4O H;  4DV7 Q;  1F2Y A;  1I50 B;  2D9U A;  5LMN Q;  3L7Z C;  2JA7 B;  4A3F H;  1DJR D;  2A19 A;  5JAV A;  5J3B A;  1KAW A;  4KHV A;  1VDZ A;  1VQM A;  2HHH L;  1EIG A;  3U9S A;  2B2W A;  1WCM B;  1WCM H;  2EYM A;  4JI3 Q;  1UE5 A;  4HIK A;  2EYO A;  1E0B A;  1WTP A;  4KV6 A;  1F2L A;  4DV0 L;  1A0I A;  1G91 A;  2A68 C;  4A3C G;  5I6Y A;  4G7H C;  3RZD B;  2R7D A;  4QL5 A;  5AJ3 Q;  3PCO B;  3M4P A;  2M00 A;  2N8N A;  3I4N H;  3J80 i;  3A7L A;  1Y1V G;  1Q90 A;  3BVG A;  1K28 A;  4MTK A;  2VUM B;  3T16 A;  1Y69 U;  3GTJ B;  2RDH A;  4DV4 Q;  1OXV A;  5GQO A;  4DNT B;  4H44 C;  3IAY A;  4DAP A;  1GUN A;  3GTK B;  1FGU A;  5CV6 A;  2MGS A;  1VQL A;  4A3J B;  1X9N A;  4IUV A;  2WB1 B;  2LSS A;  1EY7 A;  2VZA A;  3CF5 A;  4OO1 I;  3UDG A;  3VYR A;  3WOE A;  5C3X A;  3ND8 A;  2YV5 A;  5H1S E;  2J7Z A;  4BBR B;  2IY5 B;  3F2B A;  1JJG A;  1QVF A;  4K6L A;  1F77 A;  4NKL A;  1YIJ A;  1Y1W B;  4O1N A;  4QY7 A;  1EWC A;  2Q8T A;  4DV1 Q;  2DJF C;  1LT3 D;  3BVM A;  2MHV A;  1EUJ A;  2PZU A;  1BOS A;  1VCI A;  2EYP A;  2A6E D;  2PI2 E;  1RTO A;  1S3O A;  1SFO H;  1K0S A;  1KC8 C;  2ATW A;  3D4D A;  1HZB A;  4L5T A;  5HUR A;  2KBN A;  1HZA A;  1JJC B;  3KLS X;  2VQF L;  5JVH 3;  3MXU A;  3T51 B;  5CV4 A;  1MKH A;  5I2Y A;  3NP8 A;  5ELE A;  2KCM A;  1OO9 B;  4LF9 Q;  5EPL A;  2B63 B;  3GO5 A;  4XXE A;  3PUW A;  4ALP A;  2AQ3 B;  2X69 A;  5BN5 A;  5LMU L;  1KRT A;  4A3M B;  4DAM A;  2GA4 B;  2R3Z A;  3NWS A;  4DAV A;  4IAL A;  1W6J A;  3K57 A;  1F9R A;  5FLX c;  4DR3 Q;  3E3X A;  3HOY G;  2LS0 1;  1I50 H;  2K28 A;  3NEN A;  1VQ4 A;  1XNQ L;  3M3Y H;  2PZT A;  3OTO Q;  1HUM A;  3RN2 A;  3KDF A;  4GKJ Q;  4JVZ A;  4ZYS A;  3OW7 A;  3A8K E;  4JI0 L;  2IWH A;  1ML0 D;  4KHP L;  1HQM C;  2LKV A;  2I5M X;  5JPM C;  5KND A;  3TP6 A;  4ME3 A;  5C3E G;  4FF4 A;  2JXM B;  5LMU Q;  2AUK A;  3RNU A;  2J4X A;  1HZC A;  1PA6 A;  1HNX Q;  1CQV A;  3HOU B;  3A7A B;  5CGK A;  2CW0 C;  2VQE Q;  1HTP A;  3PMF A;  5BR8 Q;  3VYS A;  4BY7 B;  4U67 3;  3QR8 A;  2ICE C;  2N88 A;  4PV1 C;  2F0N A;  5DAU A;  2K33 A;  1VQF A;  2EJF C;  2VUM H;  1IBL L;  3GTO B;  1WFQ A;  3K5O A;  4XQN A;  2J0T D;  3QOJ A;  1HR0 W;  1ZEQ X;  1KHI A;  2I5H A;  3ULJ A;  3GV6 A;  1JE5 A;  1G6P A;  4A3D G;  1NTG A;  4DV2 L;  2A69 C;  4GOP C;  1TS5 A;  3CRL C;  4JI8 L;  4DR4 Q;  3BZC A;  1CUK A;  2SNM A;  5D65 A;  1YHA A;  1QZG A;  2HDL A;  2B29 A;  1PH7 A;  1YNJ C;  2WAQ G;  2JA7 H;  4CGY B;  3E9I A;  4B3M Q;  2RSO A;  3SK6 A;  2VL6 A;  3S2H H;  5D3I B;  2ID0 A;  1PH6 A;  3S2H B;  1SAP A;  4DV3 Q;  2JA5 G;  3C46 A;  3IRB A;  4JI6 L;  1JB7 A;  4E6I A;  4WJ3 M;  4X65 Q;  1PRT D;  1TS3 A;  4Q5V A;  3KJO A;  2CH4 A;  5DEH A;  3M7N A;  2NVQ H;  1K3R A;  4HIM A;  5COY A;  4A3J G;  4KTA A;  2E75 C;  2CVR A;  2EXD A;  2B3G A;  2TMP A;  1EEI D;  3EJI A;  3DMU A;  4A3I G;  2KVM A;  3URY A;  3MC0 B;  1BCP C;  4TQU S;  3BU2 A;  2ZT9 C;  5EKL A;  1A8V A;  1TWF B;  3OSO A;  3C2P A;  2O2L D;  4OHJ A;  2E5L L;  3D4W A;  1ROD A;  3J80 E;  4DUZ Q;  2F0P A;  2IX1 A;  1AH9 A;  3A55 A;  3GTG B;  3GTK H;  3TS2 A;  2NTS A;  4AYB E;  1EFI D;  2IPK D;  2NZH A;  5IT9 c;  1J9O A;  5ELO A;  2F3I A;  3M4Y A;  3K59 A;  1XMO L;  4B3S Q;  3DEP A;  2JK8 A;  4IFD I;  4YCV A;  4UP7 A;  3TEH B;  2RF4 A;  1W6K A;  2KHJ A;  3D31 A;  5HGQ A;  4OIK A;  1HQR D;  3MA2 B;  5LHY 1;  1X3E A;  3ITP A;  3PSI A;  1VQA A;  5FO8 B;  2XSC A;  4ZRZ A;  5A35 A;  5GAG C;  1WTR A;  5IYD H;  5C4Z A;  4FDB A;  2H5X A;  3NE5 B;  3X3M A;  4NXN Q;  4OWT B;  5C4X B;  3WWV A;  5C4X H;  4ZAI A;  1PH9 A;  2D0O A;  1N8R C;  4C3H B;  1MD2 D;  4PZ8 A;  3T4A C;  4OWW B;  5FKA C;  4XQJ A;  3BZK A;  4UHV A;  3GTP H;  3IFD A;  3STB C;  2F1M A;  1LM0 A;  4CKE A;  4EGV A;  3S1Q H;  1NSN S;  5JEA H;  3DWQ A;  3I4M H;  2EXZ A;  4A3K G;  4BBS G;  1MGS A;  1BO0 A;  2KEE A;  3J80 c;  5DNF A;  3VR5 A;  2AMC B;  1D5M C;  2E74 C;  5C0X G;  4A3B G;  2H4O A;  5KNB A;  4TSS A;  4LFA L;  1PTO H;  2F0D A;  1GUT A;  3DM3 A;  2XVS A;  2XWB B;  4OGQ C;  3SVM A;  1AW7 A;  1EIY B;  1UEB A;  2R93 B;  3HOV B;  5D3D A;  4X66 L;  2C35 B;  1QUQ A;  1MIU A;  4PZ6 A;  2UUB L;  2IJ0 A;  5C5L A;  4KD3 A;  4KJO A;  3FDT A;  4YY3 Q;  1XMQ Q;  3O13 A;  4XYQ A;  1TS4 A;  3P7J A;  4BXX G;  1E22 A;  4L6T B;  2WB1 G;  1LAB A;  4A3E B;  3S1M B;  1ASY A;  3ERS X;  2B39 A;  4EX5 A;  4DV2 Q;  5IGB A;  1H9S A;  4FF3 A;  1SSO A;  1STN A;  4LFB L;  4C1N I;  4KMU C;  3NTI A;  1F9P A;  3GTQ H;  4DUY Q;  3OWF A;  3T13 A;  1VF7 A;  4BS9 A;  1V1P A;  1E2W A;  5E3F A;  2BE5 D;  3VR3 A;  3MAQ A;  4LF6 Q;  1IYJ B;  1B50 A;  1SYG A;  1IBK Q;  1C8C A;  1SYE A;  1VQK A;  3CC4 A;  1CT1 D;  4LUO A;  4OWX B;  1E1O A;  2AQ1 B;  2F0M A;  4IUU A;  1X32 A;  3P20 A;  3A5U A;  5CMD A;  4WOR A;  2NVY B;  4IPH A;  3NEL A;  2K14 A;  3H0G H;  5FLX L;  5LMN W;  4LF7 Q;  1HCZ A;  4LFB Q;  4LF4 L;  3GTG H;  4O0A A;  5FLM G;  5C3E B;  4GS3 A;  3PIP 3;  4J15 A;  1K8G A;  1EZ6 A;  2GVA A;  4RGT A;  1JIC A;  5I6W A;  1VQP A;  1OXT A;  4WRD A;  3EN2 A;  1QZH A;  2HDM A;  3B6Y A;  4LW1 A;  1DM0 B;  4L5S A;  4QB4 A;  4LF5 Q;  3PV0 A;  2PMZ B;  1Q81 C;  2JA8 G;  4DK3 C;  1TWH H;  3MHB A;  4BY7 H;  2N3S A;  3OMG A;  2ES2 A;  3HEJ A;  3VR2 A;  4C3I G;  4RAU C;  2HCC A;  2KEN A;  2RKS A;  3F1Z A;  1FNW A;  1SYF A;  3PF5 A;  4DXG A;  3C1E A;  1D1I A;  1RF2 D;  4HJ5 A;  4DR6 L;  1PTO F;  1BBW A;  4JC0 A;  1N32 L;  2UXD Q;  2FMC A;  3D3R A;  2X6L A;  3MZ5 A;  4XQQ A;  4HJ7 A;  1QCB D;  3HGB A;  3ULL A;  3MXG A;  1WD1 A;  2M2L A;  3PO2 G;  1MSH A;  2Z4H A;  3JAM c;  3FPU B;  3AFP A;  3BDL A;  4JK1 C;  3GDE A;  4ZKB B;  1VQ7 A;  1ET9 A;  4LF8 Q;  4JI4 L;  3VR4 A;  1SRU A;  2NVY H;  1EY4 A;  3HOU G;  1L0W A;  2UU9 Q;  4LUZ A;  4C2M H;  1SJE D;  2SDF A;  4HAE A;  4ZCK A;  4AQY L;  2Z1C A;  2WP8 J;  1BBX C;  4IFD H;  1STE A;  4F87 A;  4XT1 B;  1L1O A;  1B9M A;  3QG1 A;  3NXW A;  1SEB D;  2F4V L;  3PO3 B;  4BBS B;  2EY5 A;  3R93 A;  1I4P A;  5C44 H;  1EZ8 A;  1PV4 A;  2PW5 A;  3OHX C;  1EQT A;  4EQO A;  2L11 A;  5IYC G;  1K0R A;  1RTN A;  1L1O C;  3L9A X;  3UE0 A;  1A62 A;  2UU9 L;  1ILQ A;  4FVM A;  4DNR B;  2OF1 A;  5J39 A;  1VQB A;  3NSW A;  1KNA A;  4LF8 L; 
#chains in the Genus database with same CATH homology
 4KD4 A;  2L9H A;  1QE6 A;  1A3U A;  1NR4 A;  1E2Z A;  2XRS D;  2F0E A;  4U68 A;  4DF7 A;  4XYO A;  2LFN A;  1QNU A;  3S1N B;  1LO5 D;  4I7Z C;  2PYK A;  1AFP A;  2SOB A;  5IT9 E;  4L63 B;  4QIW B;  1TY2 A;  4RA8 A;  1ENF A;  3S15 B;  1XYI A;  1SE4 A;  3G7L A;  2K04 A;  1S5C D;  1TWG B;  3FRP B;  2CHB D;  4CJ1 B;  3BDC A;  3K6O A;  2LY7 A;  1NUC A;  5EQ0 A;  1ICW A;  4B08 A;  4FF2 A;  1Q1B A;  4RGN A;  1SFO B;  1I4R A;  1BXT A;  1PMR A;  5K36 H;  1UNS A;  3BZD B;  1JWU D;  3SXH A;  5FO9 B;  1A15 A;  3NBH A;  5CYU A;  1EY0 A;  5EBD A;  4QCL A;  4QF4 A;  5ELB A;  1KDB A;  1HHV A;  1TS2 A;  3KUP A;  4UAI A;  2ICI A;  5C5M A;  4ZUJ A;  3NTH A;  3TZD A;  1BUV T;  3ND9 A;  1WTQ A;  1Q3L A;  3QIA A;  1A3T A;  3S2D B;  1YNJ D;  1SNC A;  2A6H C;  5KYI A;  5CC4 A;  4JBW A;  1DOL A;  2L55 A;  3D6W A;  5IGG A;  3KK7 A;  3N6R A;  4NW2 A;  3FKI B;  1JR0 D;  4X3U A;  1HA6 A;  3GTM B;  1DYQ A;  2EY6 A;  4FO2 A;  4WJW A;  2FMM A;  1HPC A;  2C5C A;  1RDP D;  3S16 B;  2CW0 D;  5NUC A;  3DM1 A;  5HGT A;  2F0G A;  3SK5 A;  1GUG A;  4MIU A;  1V1O A;  1S5B D;  3IFT A;  1T5E A;  1SYD A;  1TWA B;  2B2V A;  4ZQ3 A;  4GZY C;  1CM9 A;  1K8O A;  2A74 C;  3F2U A;  3NBI A;  3GV3 A;  2O5I C;  3K5N A;  3OMC A;  3CRK C;  1BDO A;  1CI3 M;  4IN3 A;  1YNN D;  1ESF A;  1CTM A;  2IT1 A;  1O7Z A;  2FHT A;  1XX8 A;  4AYB B;  2WKD A;  2BA1 A;  4RCO A;  5CR3 A;  4A3K B;  5DM6 3;  3A56 A;  1UUP A;  1QWY A;  2WII B;  2EYJ A;  1RKN A;  1H9K A;  3KF8 A;  1RCV D;  5I9P A;  3FEW X;  3M3Y B;  4R9W A;  4PMB A;  1V8Q A;  1PRT C;  1PFN A;  1G2T A;  1MSG A;  3SR1 A;  2B2Y A;  1ZKO A;  5KNC A;  1QG7 A;  3H91 A;  3BYY B;  2JA8 B;  3R2T A;  1UEA B;  1FGB D;  3NUC A;  2OXP A;  1PYW D;  3VA5 A;  5FOB B;  1S5E D;  3U9O A;  1CZG A;  1U4P A;  2K5D A;  2O5J C;  2F0L A;  1V43 A;  2F03 A;  4C3H G;  1EU3 A;  1U9R A;  4TKO B;  2B2W C;  3N52 A;  1EYC A;  3Q0A A;  1JWM D;  5EJW A;  2K6A A;  1CHP D;  2JYO A;  1SNO A;  1AP0 A;  4FXG C;  3A54 A;  2KEC A;  5FK9 C;  4A3B B;  2WKC A;  2JSO A;  2O4X A;  1KAA A;  1E2V A;  2SEB D;  1SND A;  3SK8 A;  2QCP X;  2A6H D;  5M3F B;  1C48 A;  1CZW A;  4KY6 A;  5IT9 L;  2F4I A;  1H9R A;  1EOT A;  1J8I A;  3X3N A;  1X3Q A;  4CKB A;  4A93 B;  1II3 A;  2BDO A;  1TY0 A;  4N9T A;  4DN4 M;  2QKI C;  1HA5 A;  1EEF D;  1I6V C;  1KNE A;  5E4W C;  1I4H A;  3QB3 A;  4OO1 G;  4ODG A;  2BDN A;  2I07 B;  3BYT B;  3GTP B;  3TBI B;  1VMC A;  4ID6 A;  2XRQ D;  1DCZ A;  2EYH A;  2KQ3 A;  1H9S B;  2NN6 H;  2ZXP A;  4XTC S;  1PZJ D;  2EZV A;  1A2U A;  2D5D A;  4FYD A;  5M5W B;  5KRU A;  3BS1 A;  1CA6 A;  1STY A;  2F3W A;  1KTK A;  3NQT A;  1JB3 A;  4I65 A;  1U4M A;  3DXJ C;  1Y8O B;  2BE5 C;  2YYZ A;  4PNY A;  2Y0S B;  4KJN A;  2F0U A;  3I90 A;  1SMY D;  3HG9 A;  1LTA D;  4G7O C;  4XDX A;  3PIO 3;  1SDF A;  4HN7 A;  1MBY A;  3DEO A;  1G8Z D;  4M1U B;  3OIP A;  4K6D A;  1SE2 A;  5C6A A;  3SDZ A;  1EWH A;  4MHE A;  3K5L A;  2AUJ D;  5IOC A;  5LL6 S;  1BCP B;  1HUN A;  2XIW A;  1DOK A;  2EPB A;  2R61 A;  4DA2 A;  1AZQ A;  5C4H A;  1D5X C;  2OEO A;  3I91 A;  4RWS C;  2YU9 B;  3E6Z X;  2SNS A;  4HSP A;  2MPM A;  4LAA A;  3OWE B;  3EFX D;  4HMI A;  5JPN C;  3CQZ B;  2G9H D;  2F0Q A;  2KED A;  2JE6 I;  4IUN A;  4A3F B;  1A2T A;  3TP8 A;  1B9N A;  2F0H A;  2Z8L A;  1EY5 A;  1NAP A;  3MFY A;  2A6E C;  3E0J A;  1IL8 A;  3DHQ A;  4HCE A;  2WAQ B;  5JVG 3;  1FNU A;  2XNA C;  1GUO A;  1Q1E A;  3EA6 A;  2FIN B;  5KEE A;  1OXU A;  1SBB B;  4QMG A;  4BWG B;  4NP5 A;  5CV9 A;  4KN4 C;  2QIL A;  2IX3 A;  3P75 A;  4ZUI A;  3T53 B;  4TRD A;  3H6M A;  3S14 B;  3GQB A;  1MI2 A;  4EVO A;  2A5H A;  1R4Q B;  2K05 A;  1U4L A;  4HED A;  5IGC A;  1C4Q A;  1F2Z A;  2F0W A;  3J80 L;  3J81 E;  1IYV A;  3PUV A;  4IFD G;  2F0S A;  4CJ2 C;  1S5F D;  4KKS A;  3QJY A;  4RHR A;  4WFN 3;  2NN6 I;  1O80 A;  1A6X A;  1STA A;  1L0X B;  1EY6 A;  4DU9 A;  4DAY A;  5M3M B;  3G6J B;  2QF7 A;  3AU7 A;  2NWG A;  4X3K A;  3V2T A;  1PZK D;  3MFG A;  2KHS A;  4G7Z C;  3M4O B;  5EKI A;  2K5Q A;  4R8N A;  3H94 A;  2K1B A;  3SK4 A;  2E2H B;  1HFN A;  3AMU A;  1K83 B;  1ESR A;  5A2Q L;  5BN4 A;  3TZU A;  2VNU D;  4IQZ A;  3LNN A;  2PQE A;  1LTR D;  2PO4 A;  1PRT B;  2Z4I A;  3R3O A;  3MXN A;  3HOY B;  1XTC D;  3HOW B;  3I72 A;  2JEA I;  1L0Y B;  2L0C A;  3TDQ A;  1PDQ A;  4FNF A;  4DXF A;  4IUQ A;  4X3S A;  2DN8 A;  4R8I A;  1BCP D;  5CBA E;  3J7Y W;  4K5V A;  3HS0 C;  3FPP A;  4B9W A;  4C56 C;  1OXS C;  2RDG A;  1H9J A;  5K36 G;  1JOQ A;  2XWJ B;  3LX0 A;  2MP1 A;  2L12 A;  2WV6 D;  3RZO B;  4K5X A;  1GXD C;  5A2Q E;  1SNM A;  4V0B A;  3PUX A;  1A3V A;  2IL8 A;  1AZP A;  2KCC A;  4RCN A;  1SMY C;  2Q8I B;  1HTL D;  2EY2 A;  4LJZ C;  4C3J G;  5IGE A;  1CHQ D;  1TII D;  2EDG A;  1GUW A;  1B53 A;  5EBC A;  5ELD A;  5D14 A;  4IZ8 A;  4KKU A;  5I4D A;  2XN9 C;  4RGM A;  1ENC A;  2FFK B;  3K0Y A;  1ZYR C;  1Z47 A;  4FXK C;  5I9O A;  3V96 A;  1QIL A;  4HSV A;  3SHL A;  3H3V C;  1FNV A;  1BQQ T;  3QO2 A;  3VYU A;  2F0T A;  5JEA G;  2CQA A;  1SNP A;  1LLR D;  4CJ0 B;  5EPJ A;  1SE3 A;  1M4V A;  4C1N K;  2B8F A;  4OL7 A;  2A69 D;  2EYF A;  1JOR A;  1QNK A;  2F0V A;  3QWN A;  1Q8I A;  5JEA J;  3IL8 A;  2IW3 A;  1KLU D;  3LWU A;  2PNR C;  2LMC B;  3DUZ A;  3MTS A;  3H09 A;  4CKC A;  1DON A;  3Q6S A;  1O7L A;  3W3A A;  1SJH D;  4BY1 B;  4BA1 I;  3BDO A;  5F2D A;  4QUC A;  1JQY D;  1PTO D;  1KLG D;  3C1F A;  5JJZ A;  1VMP A;  4M8A A;  2E2J B;  1H9M A;  3IKJ A;  1TVX A;  2B2T C;  4J8Q A;  1WTO A;  1I4X A;  2EJM A;  2RBM A;  3T56 B;  1JOO A;  2FJ2 A;  1TQO A;  5E4X A;  5M5X B;  4XIG S;  4L8J A;  4LK1 C;  2DNE A;  2PZW A;  2EYL A;  2QDB A;  3Q22 A;  2V4D A;  2E2I B;  2RSN A;  2QEJ C;  3NQI A;  3RLF A;  1QOH A;  3W2D A;  1LAC A;  1O78 A;  1LT4 D;  3QOL A;  1LT6 D;  1D6E C;  4O42 A;  3K5M A;  4C2M B;  1QJO A;  1S4Z A;  4P2C B;  2EVB A;  3MXP A;  4IUP A;  4HR7 B;  1G6Z A;  3SEB A;  3KLR A;  2NVX B;  1R4P B;  5I2X A;  3HZX A;  4XT3 B;  5E1F A;  5FO7 B;  1VF5 C;  1BCP F;  5FLX E;  1IW7 D;  1SYB A;  2BCO A;  4F8M A;  1Y1V B;  3FMC A;  4UDU C;  1F9Q A;  1F2M A;  2JEB I;  2RQX A;  3D8G A;  3I4L A;  3I73 A;  5AFW A;  3KBG A;  5KIX A;  3L3O C;  3S17 B;  5BN3 A;  3I3C A;  3E5S A;  3NHH A;  4K8J A;  4RGO S;  4KY7 A;  2WIN B;  3GP7 A;  1EYD A;  1T5X D;  1Y8P B;  5J22 A;  1PTO B;  1G2S A;  3J7A F;  3SE0 A;  4Y7N B;  4G57 A;  2F0O A;  4J1M A;  1ET6 A;  4ILW A;  5ISR A;  5CV7 A;  1B1Z A;  4KN7 C;  4ZK9 B;  4FP5 D;  1SXT A;  3GTL B;  1GJX A;  1KDA A;  3NWT A;  1O7Y A;  3FVQ A;  1I4Q A;  2EOT A;  5IIF A;  4IFD J;  3AB9 A;  1BNZ A;  1XXG A;  5CV5 A;  1I6H B;  3ERQ A;  2K7V A;  1PRT F;  3OOC A;  3MEH A;  4A3D B;  1NR2 A;  1B4O A;  2DNC A;  5C0X I;  4KKT A;  2B2U C;  2JP1 A;  2RDF A;  3A8J E;  1M8A A;  2NZ1 D;  3C3L A;  2RA4 A;  1IKL A;  4DK0 A;  1EY9 A;  4F88 A;  1HFG A;  2B2U A;  1AN8 A;  1CFM A;  3OIQ A;  4K2L A;  3CU7 A;  2KJX A;  3M7G A;  3R8B A;  1TWH B;  3KLS A;  1IW7 C;  3I70 A;  3TP7 A;  3S1R B;  5JOB A;  2K03 A;  1GOZ A;  1K8M A;  2PW7 A;  1WTX A;  4KHZ A;  1JWS D;  4B9X A;  4ZKC B;  3OPO A;  1RD9 D;  2NYZ D;  4HMJ A;  2D62 A;  2K5W A;  5LL6 X;  4IUR A;  3S9W A;  3Q24 A;  1Z7T A;  3D6C A;  3H0G B;  2L1B A;  4YIJ A;  4RHS A;  1JE4 A;  4NDX A;  1STB A;  2NUC A;  2M9V A;  2PPB C;  4RH6 A;  2DY7 A;  2KCN A;  2VB2 X;  2TSS A;  2EE1 A;  3KBX A;  4ABN A;  3HOX B;  1DZ1 A;  1RJT A;  1LV9 A;  1ZYR D;  4Z9C B;  2ENB A;  1ONL A;  4HCS A;  3S1Q B;  1TT2 A;  1BF4 A;  2B2V C;  3MVV A;  3WDN A;  1PLF A;  1STH A;  4HTH A;  4S3S A;  1HRJ A;  4RFB A;  3P1H A;  5G3L D;  3PUY A;  1U4R A;  3BVZ A;  1FD7 D;  1F9S A;  5EKK A;  3J7A V;  4C3I B;  5KGU A;  2K32 A;  5ELF A;  4F7X A;  2L4N A;  1CQF A;  4Q0F A;  3I8Z A;  2F0F A;  1LTS D;  4EQP A;  3DWA A;  3A8I E;  2N55 A;  3PO2 B;  2B2T A;  3TN2 A;  3RMH A;  3HKZ B;  4C3J B;  2NTT A;  3VR6 A;  2A73 B;  4ME5 A;  2AWN A;  3TP5 A;  2F0J A;  1V1P B;  4RKB A;  2F3V A;  3CHB D;  2AWO A;  2HCI A;  3K58 A;  1WTV A;  2NVQ B;  4DK1 A;  2X6G A;  3UI2 A;  4ZLT F;  1JC7 A;  5CBE E;  5EGT A;  3JAM L;  3RD4 A;  4LMQ D;  1XWE A;  3VA7 A;  1WTW A;  1LTB D;  2C9O A;  1GHJ A;  1WD0 A;  4X3T A;  1LT5 D;  1IKM A;  2K01 A;  4N9P A;  5ELC A;  3PUZ A;  3GTQ B;  3NTK A;  1QB5 D;  1UAP A;  5IOD A;  1LTI D;  2E76 C;  5TSS A;  1SNQ A;  4PQX A;  2BA0 A;  5M9O A;  2F0I A;  5J1Z A;  5C3W A;  5C0X H;  4K2K A;  3K7A B;  4H13 C;  5COR A;  1TR5 A;  1X3P A;  1EYA A;  4K14 A;  1SYC A;  4OIJ A;  2EJG C;  3TME A;  5G3L F;  1KAB A;  1ILP A;  3BG3 A;  2NB0 A;  1D2B A;  3WOF A;  1KDC A;  1STG A;  1IYU A;  3EQL C;  3JAM E;  1Q12 A;  3HRZ C;  1PFM A;  5CV8 A;  4DFA A;  1RHP A;  1DXM A;  4H0L C;  4ULL A;  2R92 B;  2HQE A;  1WVL A;  5KYL A;  2BOS A;  1FR3 A;  2NVT B;  2JA6 B;  3ZYY X;  5DM7 3;  1ZXT A;  2DY8 A;  5T1G A;  4OO1 H;  3M85 A;  1B2T A;  4K8I A;  3NK9 A;  1D1K A;  3Q23 A;  1PZI D;  1ENA A;  3MWY W;  1AEX A;  2AQ2 B;  1I4G A;  3D4R A;  3VYT A;  5T1I A;  4PMC A;  1HXY D;  4DGZ A;  4RKL A;  3V05 A;  2R7Z B;  2R6G A;  1CA5 A;  4J6H A;  1Z6H A;  2KUM A;  1DD2 A;  3I4N B;  3HP3 A;  4CBV A;  2H1E A;  4IUT A;  3TSS A;  3I4M B;  1PXU A;  1D5Z C;  4QUF A;  2D2C C;  3GD7 A;  1B44 D;  2Q8R E;  2ZXR A;  2NBF A;  1B3A A;  4KY5 A;  2KA7 A;  1LTG D;  1R9T B;  1OXX K;  5M5Y B;  1IHZ A;  2MUY A;  5IGF A;  2EY1 A;  3ONA B;  2JA5 B;  2IX0 A;  3DWP A;  1GUS A;  4G4K A;  4A3I B;  3NPP A;  2HUG A;  5EPK A;  2E2D C;  1NCV A;  5IGD A;  1GHK A;  2F0K A;  5C44 B;  1DOM A;  4EQN A;  4BA2 I;  2I46 A;  1BR9 A;  2OT2 A;  4PMW A;  2VXW A;  1EQV A;  1JOK A;  2NN6 G;  2WAC A;  3ERO A;  2B8G A;  2ZXO A;  3J81 L;  1EY8 A;  2VB3 X;  4H7B A;  1TU2 B;  3RUZ A;  1G29 1;  3R2I A;  1EU4 A;  1FYC A;  1YNN C;  4V19 0;  1I3Q B;  1TWC B;  2PCF B;  1S5D D;  4KK7 A;  3LWE A;  4FXD A;  1TKW B;  2G9D A;  2A68 D;  3CKI B;  1Y8N B;  1CK1 A;  4KI0 A;  5C0X J;  2L5T A;  4K5W A;  2RVL A;  5K5P A;  1LTT D;  1PFB A;  4A3G B;  2KOL A;  1JCK B;  1PTO C;  1EIH A;  4CHT B;  2B2Y C;  4MN3 A;  1EL0 A;  4FF1 A;  4NMZ A;  2MJ8 A;  5C4J B;  3HOZ B;  3EVQ A;  1F2Y A;  1I50 B;  2D9U A;  3L7Z C;  2JA7 B;  1DJR D;  5JAV A;  4KHV A;  1VDZ A;  1EIG A;  3U9S A;  2B2W A;  1WCM B;  2EYM A;  2EYO A;  1E0B A;  1WTP A;  4KV6 A;  1F2L A;  1G91 A;  2A68 C;  5I6Y A;  4G7H C;  3RZD B;  2M00 A;  3A7L A;  1Q90 A;  3BVG A;  2VUM B;  1Y69 U;  3T16 A;  3GTJ B;  2RDH A;  4DNT B;  1OXV A;  4H44 C;  3IAY A;  4DAP A;  1GUN A;  3GTK B;  5CV6 A;  2MGS A;  4A3J B;  4IUV A;  2WB1 B;  1EY7 A;  4OO1 I;  3VYR A;  3WOE A;  5C3X A;  3ND8 A;  2J7Z A;  4BBR B;  4K6L A;  1F77 A;  4NKL A;  1Y1W B;  4O1N A;  1EWC A;  2Q8T A;  1LT3 D;  3BVM A;  2MHV A;  2PZU A;  1BOS A;  1VCI A;  2EYP A;  2A6E D;  1RTO A;  3D4D A;  5HUR A;  3KLS X;  5JVH 3;  3MXU A;  3T51 B;  5CV4 A;  5I2Y A;  3NP8 A;  5ELE A;  1OO9 B;  5EPL A;  2B63 B;  3GO5 A;  4XXE A;  3PUW A;  2AQ3 B;  2X69 A;  5BN5 A;  4A3M B;  2GA4 B;  2R3Z A;  3NWS A;  4DAV A;  4IAL A;  1W6J A;  3K57 A;  1F9R A;  2LS0 1;  2K28 A;  2PZT A;  1HUM A;  4ZYS A;  3OW7 A;  3A8K E;  2IWH A;  1ML0 D;  1HQM C;  2LKV A;  5JPM C;  5KND A;  3TP6 A;  4FF4 A;  2JXM B;  2AUK A;  2J4X A;  1CQV A;  3HOU B;  3A7A B;  5CGK A;  2CW0 C;  1HTP A;  3PMF A;  4BY7 B;  3VYS A;  4U67 3;  2ICE C;  2N88 A;  4PV1 C;  2F0N A;  5DAU A;  2K33 A;  2EJF C;  3GTO B;  3K5O A;  4XQN A;  2J0T D;  3QOJ A;  1ZEQ X;  3GV6 A;  2A69 C;  1TS5 A;  3CRL C;  2SNM A;  5D65 A;  2HDL A;  1YNJ C;  4CGY B;  2RSO A;  3SK6 A;  5D3I B;  2ID0 A;  3S2H B;  1SAP A;  3C46 A;  4E6I A;  1PRT D;  1TS3 A;  4Q5V A;  5DEH A;  3M7N A;  5COY A;  4KTA A;  2E75 C;  2CVR A;  2TMP A;  1EEI D;  3EJI A;  3DMU A;  2KVM A;  3URY A;  3MC0 B;  1BCP C;  4TQU S;  2ZT9 C;  5EKL A;  1TWF B;  3OSO A;  3C2P A;  2O2L D;  4OHJ A;  3D4W A;  1ROD A;  3J80 E;  2F0P A;  2IX1 A;  3A55 A;  3GTG B;  2NTS A;  1EFI D;  2IPK D;  1J9O A;  3M4Y A;  3K59 A;  3DEP A;  4IFD I;  1W6K A;  3D31 A;  4OIK A;  1HQR D;  3MA2 B;  5LHY 1;  3ITP A;  5FO8 B;  2XSC A;  4ZRZ A;  5A35 A;  1WTR A;  5C4Z A;  3NE5 B;  3X3M A;  5C4X B;  4ZAI A;  4C3H B;  1MD2 D;  3T4A C;  5FKA C;  4XQJ A;  3IFD A;  2F1M A;  4CKE A;  4EGV A;  1NSN S;  5JEA H;  3DWQ A;  2EXZ A;  1MGS A;  1BO0 A;  2KEE A;  5DNF A;  3VR5 A;  1D5M C;  2E74 C;  5C0X G;  2H4O A;  5KNB A;  4TSS A;  1PTO H;  2F0D A;  1GUT A;  2XVS A;  2XWB B;  4OGQ C;  3SVM A;  1AW7 A;  2R93 B;  3HOV B;  5D3D A;  2IJ0 A;  5C5L A;  4KD3 A;  4KJO A;  3FDT A;  3O13 A;  4XYQ A;  1TS4 A;  3P7J A;  4L6T B;  1LAB A;  4A3E B;  3S1M B;  2B39 A;  5IGB A;  1H9S A;  4FF3 A;  1SSO A;  1STN A;  4C1N I;  4KMU C;  3NTI A;  1F9P A;  3OWF A;  3T13 A;  1VF7 A;  4BS9 A;  1V1P A;  1E2W A;  5E3F A;  2BE5 D;  3VR3 A;  3MAQ A;  1B50 A;  1SYG A;  1C8C A;  1SYE A;  1CT1 D;  2AQ1 B;  2F0M A;  4IUU A;  1X32 A;  3P20 A;  5CMD A;  4WOR A;  2NVY B;  5FLX L;  1HCZ A;  5C3E B;  3PIP 3;  1EZ6 A;  4RGT A;  1JIC A;  5I6W A;  1OXT A;  4WRD A;  2HDM A;  1DM0 B;  4QB4 A;  3PV0 A;  2PMZ B;  3MHB A;  3OMG A;  3HEJ A;  3VR2 A;  4C3I G;  4RAU C;  2HCC A;  2RKS A;  1FNW A;  1SYF A;  4DXG A;  3C1E A;  1D1I A;  1RF2 D;  1PTO F;  2FMC A;  3D3R A;  2X6L A;  3MZ5 A;  4XQQ A;  1QCB D;  3HGB A;  3MXG A;  1WD1 A;  2M2L A;  1MSH A;  2Z4H A;  3FPU B;  3BDL A;  4JK1 C;  4ZKB B;  1ET9 A;  3VR4 A;  1EY4 A;  1SJE D;  2SDF A;  4HAE A;  2Z1C A;  2WP8 J;  1BBX C;  4IFD H;  1STE A;  4F87 A;  4XT1 B;  1B9M A;  3QG1 A;  3NXW A;  1SEB D;  3PO3 B;  4BBS B;  2EY5 A;  3R93 A;  1I4P A;  1EZ8 A;  2PW5 A;  3OHX C;  1EQT A;  4EQO A;  2L11 A;  1RTN A;  3L9A X;  1ILQ A;  4FVM A;  4DNR B;  2OF1 A;  5J39 A;  3NSW A;  1KNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...