2NYZD

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the c- chemokine xcl1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
DKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/cytokine
molecule keywords Hypothetical protein GAMMAHV.M3
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
total genus 7
structure length 61
sequence length 61
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nyzD00
1E0BA 1U4PA 1ML0D 1PLFA 5JJZA 2FMMA 1MI2A 1NCVA 2KEEA 1EIHA 3GV6A 1F9PA 2FINB 1Q3LA 4ZAIA 2B2TA 3G7LA 3HP3A 3N52A 1SSOA 1CM9A 3I3CA 4XT1B 2K05A 1GUWA 1WTWA 4IUVA 1WTQA 4HAEA 2M2LA 1SDFA 4UAIA 2DY7A 5D65A 3SVMA 1HFGA 2IL8A 1IKLA 1B53A 1KNEA 1ZXTA 2L9HA 4IUQA 3TN2A 1BF4A 2B2YA 4RWSC 1DZ1A 2EOTA 2X69A 4QUCA 1J8IA 3DEOA 1BBXC 1PFBA 1WD0A 1EIGA 4LMQD 3F2UA 2DY8A 2B2VA 5COYA 1NR2A 4CJ1B 4X3TA 1G2TA 1HA6A 1O7YA 5E4XA 1AZQA 1HUNA 2BDNA 1O80A 2L12A 2RVLA 1DONA 4XT3B 1X3PA 1KNAA 2NZ1D 1NAPA 2NWGA 1XYIA 4HCSA 2KEDA 1X3QA 1ILPA 2D9UA 3FDTA 3MTSA 5T1IA 3R93A 3LWEA 2KOLA 2KECA 1IKMA 3QO2A 1NR4A 2NYZD 4XDXA 1DOMA 2FFKB 2XIWA 5T1GA 3DM1A 1HFNA 3FPUB 5AFWA 4U68A 3TZDA 1C8CA 1AZPA 2K28A 4X3KA 5DNFA 2B2WC 1B2TA 1O7ZA 1QG7A 2H1EA 5CMDA 1B50A 1HHVA 3I90A 1TVXA 1MSHA 2HDMA 2VXWA 4X3UA 2MPMA 4RAUC 2JP1A 4CJ2C 2R3ZA 1HRJA 4OIKA 2J7ZA 1ESRA 2K03A 2FJ2A 1SAPA 2Q8TA 4QUFA 4ZKBB 1MSGA 1RHPA 1CA5A 4DN4M 1X32A 2EPBA 5EPKA 1DOLA 1WTPA 3I8ZA 3P7JA 1F9RA 1PFNA 1A15A 1MGSA 1QE6A 1S4ZA 5EJWA 1M8AA 1RODA 2JYOA 3KUPA 4OIJA 1RTOA 2KVMA 4ZLTF 1U4RA 1WD1A 3UI2A 1JICA 2B2WA 4R8IA 1LV9A 1U4LA 3GV3A 3D6WA 4IUTA 4O42A 1AP0A 1BO0A 1VMPA 2L4NA 5EPJA 5CBAE 1EL0A 2B2UC 5EKIA 1HUMA 3KBXA 2N55A 2X6LA 5EPLA 1CA6A 5EQ0A 1G91A 1EQTA 1PDQA 5E4WC 1U4MA 1F9SA 2MJ8A 2HUGA 3H91A 1G6ZA 2K1BA 2CVRA 2MP1A 1VMCA 2EE1A 2RSNA 5CORA 4ZKCB 1WTVA 4ZK9B 2K01A 4MN3A 4R9WA 4RA8A 4IURA 4IUPA 1WTOA 1WTRA 1WVLA 1B4OA 1DOKA 2FHTA 3I91A 1J9OA 2RSOA 2N88A 4CJ0B 5D14A 1ICWA 3IFDA 2RA4A 1EOTA 1G2SA 1QNKA 1JE4A 2B2UA 2B2TC 2K04A 3IL8A 3ONAB 3Q6SA 4X3SA 2X6GA 4HEDA 1WTXA 1B3AA 2KUMA 2HCIA 1RJTA 4IUUA 1XX8A 4HSVA 2MGSA 2B2YC 2HCCA 2HDLA 1BNZA 2L11A 1IL8A 1ILQA 2L1BA 3MWYW 2Q8RE 1RTNA 1F9QA 2B2VC 4MHEA 5CBEE 3DEPA 4NW2A 1PFMA 1F2LA 2SDFA
chains in the Genus database with same CATH superfamily
3C2PA 2ENBA 3HOZH 1NCVA 1H9JA 1S5ED 2Z0SA 5I2XA 3N52A 2O2LD 3DM3A 3IKJA 1FL0A 4JW0A 4NPSA 3SGIA 2R92B 5K36H 2F0UA 3TRZA 5COYA 5FK9C 2A74C 5C0XJ 4CJ1B 1AZQA 1T5EA 1RCVD 1DONA 3PO2B 1BCPF 4QMGA 2NWGA 1XYIA 1KAWA 4X66Q 4H7BA 1WJJA 3R93A 1JJ2A 4DV3L 1CQFA 1QUQA 1K8OA 4JI5L 4K5XA 4Y7NH 4ZCKA 1AEXA 4I7ZC 5DNFA 4QGUA 1HHVA 3R3OA 4Z9CB 1KDCA 4RAUC 3W2DA 2JA8G 1FYCA 4DR3Q 1HNXQ 2VUMH 3CRLC 1X55A 1WTPA 1TWFH 1SNPA 1JJCB 2EYLA 2OEOA 4C2MH 4BY1H 4M8AA 5IY0A 4A3GG 4JYAL 1XTDA 4Q5VA 4DAVA 3PIP3 2R61A 3K58A 1A0IA 1TS5A 1RD9D 3NE5B 5EPJA 3NQIA 5JVH3 5M5XB 3HGBA 3T16A 4B3ML 5JJIA 3VR5A 4NXNL 3T1YQ 2M9VA 4BBSB 4IOCA 4JC0A 4YIJA 1SEBD 3I4NG 4ZK9B 4AQYQ 4POFA 5KIXA 1PH7A 3BZDB 4EGVA 1UWVA 5GAEC 3HOWB 4TQUS 4GLAC 1PA6A 2A19A 2R6GA 1PVOA 3HEJA 4YWKA 4DR5L 4J8QA 1DXMA 5AJ3Q 4K2KA 1SMXA 1STGA 1J5EQ 3MZ5A 1I4RA 3HKSA 4A3FG 1IKMA 2KHIA 4FVMA 3DEPA 5CC4A 3NBHB 5KYIA 1E0BA 4BBRG 1STYA 1I3QH 1D5MC 4DKAC 1EY7A 3S16H 1KC8C 4XYOA 4FXDA 3FKIH 2PZWA 4DV1Q 1LABA 3ZJYC 5M3MH 5C4JH 1YHBA 2LXJA 1PH4A 2BA1A 4GLXA 1GJXA 4Q0FA 1XPOA 1UE5A 1KABA 1EY9A 2PO4A 4MNOA 1S5DD 4A76A 1BCPD 5M3FG 3H3VH 3CCJA 4GKJL 4J6HA 3AEVA 3K81C 1QOHA 1JOQA 2FFKB 3AB9A 4B3RL 1C8CA 1Y1WG 4K8JA 1VF7A 1GHJA 1QG7A 4PMWA 5FO8B 4B08A 4GOPA 2PW5A 1N33L 2K5QA 4JI2L 5JEAJ 3K5LA 2J7ZA 4A3MB 2XWBB 4C3JG 3K5OA 2RDGA 1MJEA 2F0GA 4BA2I 2N3SA 2NBFA 3BU2A 4DV3Q 3KJOA 4IPCA 4JI5Q 3HOVH 4IN3A 4HIKA 1WD1A 4ZYSA 2HHHL 1IW7C 1X3FA 2L4NA 4OXPA 2VQEL 4C3HB 1CK1A 2ZJRA 3PF5A 5K36G 1GVPA 1HTLD 4HMIA 3ERQA 4DK6C 2Q2UA 2MP1A 2R7ZG 3M3YH 1LYLA 1WCMB 2YU9H 4QL5A 4UP9A 3STBC 1VQ4A 2EJMA 5KEEA 4JYAQ 1DOKA 1JB3A 3HG9A 2IY5B 3BDLA 4B3MQ 2B2UA 2RCNA 4QB4A 5C5MA 2X6GA 4NXNQ 4UDUC 2PQAA 1MKHA 4NKLA 4HIMA 1E24A 1OXUA 3MWYW 3BS1A 4XXEA 2WB1E 3MHBA 1E22A 1Y8OB 3QOJA 1Y8PB 4IFDH 1KL9A 2EYFA 2VUMG 4WORA 3I4OA 3S2DH 2FINB 1IHZA 2K5VA 3HP3A 4DR5Q 2JA6H 2YYZA 4ABNA 1HFGA 1B53A 1BBWA 1PTOC 1YHQA 1MD2D 3KK7A 2JA7H 4JI6L 3HOUB 3HS0C 2TMPA 2E5LL 1SNDA 2R93B 4L5SA 1ICFB 3KJPA 1UUPA 2CH4W 1TWHH 3K6OA 5M5WB 3FPUB 5EKKA 2SEBD 4MTNA 5G3LF 2B2WC 4YWLA 1W6KA 3F2DA 1A6XA 1B50A 4GS3A 3SR1A 3K5NA 3GTJH 1AFPA 1HH2P 3ULJA 5JPMC 2ALYB 3S1NH 1I4XA 4GKJQ 3L7ZC 1Q82C 2ASBA 1W2BA 3D31A 5KYLA 1E2ZA 1A3UA 4JBWA 3LGJA 4LJZC 3U9SA 2R7FA 1RTOA 4B3RQ 4KTAA 3S14B 3EQLC 3OMCA 2CQOA 4IUTA 3Q22A 2CW0C 1N33Q 3ERSX 4JI2Q 1HQRD 4R8NA 3W1GA 2OWOA 1I6HB 1TWCB 2OCEA 3T53B 4RKLA 1VMCA 3L3OC 3OWEB 4A3EH 5LHY1 3CCUA 3MXPA 2I5LX 3GTOH 1SN8A 4DV6L 3PF4A 4L5QA 3EFXD 4CDCC 2E8GA 3E3XA 2HHHQ 3DWAA 2MO1A 2FXQA 2RBMA 4AYBE 2UUCL 1JWUD 1JORA 3C3LA 2VQEQ 4RFBA 1S5BD 1LT4D 3IL8A 4L6TB 1WTXA 2CCZA 3CF5A 3GTMB 1B3AA 4K6LA 1FNWA 1Q81C 1KLUD 4HR7B 4C3IB 2B2VC 4A3DB 1N32L 3SK4A 4FO2A 2A6EC 3K7AB 1F9PA 3UDXA 1V1PB 2QCPX 3CCEA 3I3CA 3ZYYX 1S3OA 1SLJA 3RLFA 2CQAA 1CKNB 2IL8A 1IKLA 1D1KA 4HIDA 5E3FA 2L5TA 1E7ZA 2XRQD 2JXMB 2LS01 3C1FA 3C46A 3I4MB 2BDNA 5C44H 1M1KC 2D2CC 1KNAA 3PO3B 2VB3X 4Y52H 2XGTA 3PUWA 2KBNA 1LTSD 3HZXA 3LWEA 4RHRA 3KOJA 3M4QA 3QO2A 5FO9B 1SJHD 2H5XA 4BY7H 2M00A 5C3XA 1EQRA 1BXTA 1D5XC 4JBJA 1B2TA 1I50B 3EN2A 5JAVA 3D4WA 3EVQA 1UE6A 4DV0L 3BVMA 2JP1A 2F4IA 1WTHA 4JI7L 1TY2A 4RH6A 1VQ8A 4JI6Q 2JA5B 5IIFA 4DV4L 2BA0A 1QVCA 1ZYRC 3F8TA 3E5SA 2E5LQ 3HOUG 5DEHA 4H44C 4IFDG 2F0FA 1PFSA 2CWAA 4DNIA 5LL6X 4ZLTF 4B3TL 2XSCA 4R8IA 4C56C 1AP0A 2EY1A 2A69C 5E7NA 3G6EA 5HURA 1KDAA 1Q1BA 5JVG3 2RF4A 4R4TA 4JI8L 1G91A 2ZJQA 3D6CA 1CA6A 1F9SA 4A3LH 2K1BA 1YNJD 2HIXA 3KF6B 5CORA 1JOKA 1HR0L 1AH9A 1SJED 3V05A 2JA7G 4P71A 3CQZH 1SR3A 4DK0A 4YCWA 4LWCA 1N36L 1VQGA 5GAHC 2ATWA 3BJUA 3HOXB 5D14A 1IW7D 3PUVA 4LF4L 2JSOA 4LFAL 5FLMG 2VS1A 4OX9L 5IT9L 2EYMA 4JI1L 3BYYB 1K0RA 1BUVT 4YHHL 1ESFA 4KY6A 1Q8KA 3OW7A 5LMUL 2OT2A 2L11A 4IFDJ 1VF5C 4DV6Q 3CC4A 3STBD 3BVZA 1STNA 3T4AC 4PZ6A 2SNMA 2UUCQ 2F1MA 2UXBL 3A8IE 1EIFA 1G8ZD 3I70A 4IPGA 5K5PA 3MFGA 4UAIA 1Z9FA 3CMAA 1SFOH 3TN2A 5LL6S 4OHJA 2E2IH 1DZ1A 5CV6A 2XNAC 3GTKB 3J80c 4DXGA 4KJOA 1N32Q 2JA8H 1HA6A 4L63B 3MC0B 4A3DG 2KQ3A 2RVLA 2LKVA 5IYDG 3VR2A 4DF7A 1OXTA 4TRDA 4G4KA 4LFCL 3MTSA 2GVBA 2F3VA 3GTGB 5EBDA 4LUZA 2B63H 2BH2A 3RR5A 2K28A 4JBKA 3CAMA 4A93G 1M90C 1PTOD 1ZKOA 4FF3A 1YZ6A 4CJ2C 4TVAB 3M7GA 3A7LA 1GO3E 1XMOL 1GD7A 1SAPA 2CFMA 3I4NH 4LUVA 5EPKA 3A5ZB 1YHAA 2AKWB 3D8GA 1L1OB 1PXUA 1S40A 1F9RA 4P72A 3RD4A 1M8AA 2Q2HA 3E0JA 4DUZL 1TWGB 3GV3A 3QOLA 3D6WA 4HJ5A 4DV0Q 1VQ6A 5IGEA 2O5JC 1NY4A 3D0FA 2OQKA 4JI7Q 2NVXB 1EQQA 4DV4Q 2Y0SG 2MJ8A 3FPPA 4A3FH 4P73A 2IJ0A 3S15H 1E2WA 4HJ7A 4KY5A 5IGDA 3A5UA 4PQXA 1UE1A 1I4PA 4PV1C 1UNSA 3AQQA 1G6PA 4WJ3M 3S1QB 4B3TQ 4RCOA 1VQDA 1ICWA 1YVCA 2GVAA 3ER0A 2CW0D 2F0DA 5GADC 1G2SA 2UUBL 1S5FD 1LT3D 4ODGA 4JI8Q 1QVGA 1LT6D 4K5WA 4PZ8A 3FHWA 2HCIA 2JEBI 1RJTA 4K8IA 3M4OB 1Q12A 3G71A 2OTJA 1HR0Q 4J1MA 2WFWA 2Q8RE 4DR4L 5JOBA 1AW7A 4DK3C 4DPGA 1N36Q 1I4QA 4LFAQ 4LF4Q 3E0EA 4RGOS 4OX9Q 1ET6A 1L1OC 4JI1Q 1H9SA 2KJXA 4KN7C 1KNEA 4YHHQ 1STEA 3D4DA 4RWSC 2EOTA 5LMUQ 1Y69U 4BXXG 4LMQD 2WP8J 4KKSA 3PO2H 4G7HC 4A75A 2A6ED 5BN3A 2UXBQ 1NAPA 3CHBD 1HPCA 4I65A 3M7NA 3NXWA 4IUNA 2K5WA 4O2DA 1IZ6A 1EY5A 4POGA 1B8AA 3GD7A 4BWGB 5CMDA 5FLXc 4R1JA 2HDMA 4IPDA 3S17B 1VQ7A 2I0QA 4DFAA 1PH1A 5IE8A 3TBIB 1HR0W 2R7ZH 1HRJA 1EY0A 1W6JA 3X3NA 1VQFA 4QUFA 4ZKBB 1H95A 1ASZA 3Q24A 1ET9A 1JWMD 4LFCQ 2E2HB 1MGSA 1EY6A 4A3IB 1KXLA 1TWAB 4HJAA 1K9MC 3JAMi 4JV5L 3TP8A 1QZHA 5JJLA 1ASYA 2EZVA 1VMPA 4E6IA 3SK6A 5M5XH 1JJGA 4KY7A 2Z9HA 2C9OA 1RIPA 5A35A 3H3VI 1XMOQ 1STBA 3GQBA 1ZYRD 3V2TA 2RSNA 1L0YB 2KCTA 4MTKA 2MNAA 4RGTA 3HOZB 4IUPA 4O0AA 4QY7A 5FO7B 4DUZQ 3HOWH 4AYBB 2I5HA 2XRSD 1KAAA 2I46A 2AWNA 2UXCL 3DMUA 1V43A 1S5CD 3PIPA 4RCNA 5HGQA 2A69D 1AN8A 3R2TA 4OWWB 2EJGC 2B63G 1CSQA 1L0XB 2NVYH 2ICIA 3F1ZA 3ITPA 3RZOH 3LX0A 4OO1H 1VCIA 5J39A 3T1HL 4AH6A 3PIO3 5C3EB 2HD3A 4K14A 2F0EA 1PLFA 3PV0A 3CXCA 4KJNA 3J7ZC 3PUYA 4H02A 4O1NA 2UUBQ 1HCZA 2B2TA 3G6JB 1SSOA 2BE5C 4F7XA 2K05A 3EROA 4IUVA 3E9HA 1XPRA 3QIAA 4RKBA 1LTAD 4R4QA 3H0GG 1I6VC 2AUJD 1J8IA 1BBXC 2WB1G 2A6HC 3F2UA 4DR4Q 3J81j 1O7YA 4GKKL 2L12A 3OPOA 2PW7A 1TWFB 2YTYA 1STAA 2QILA 5CV7A 4C1NI 4C2MB 1TKWB 2Z6BA 5GAGC 2MUYA 3JAMc 2NYZD 1EYAA 1LACA 3H15A 1YNND 3CW2C 4UHVA 2CKZB 1PZKD 2H1EA 3B6YA 2ZTCA 4YCVA 3RNUA 4PNYA 1TVXA 2VXWA 1BOSA 3J7AV 2IX0A 4YY3L 2D62A 1K83B 1NMGA 1C0AA 5KNBA 1L0WA 2Q8TA 1RKNA 3JC66 4EQOA 1S72A 1X54A 5L37A 1Q7YC 3BG3A 3I8ZA 5IYBH 1QE6A 3CCMA 1JT8A 1SBBB 1U4LA 5NUCA 3L2PA 1BO0A 1EY8A 4C3HH 2R92G 1HUMA 2Z1CA 4FXGC 2N49A 5CR3A 5IWAL 2CVRA 1WCMH 2ZJPA 1IYVA 1GUNA 3PO2G 1LLRD 1WTRA 2PPBC 5IT9E 4A3IG 3S16B 4A3KB 5TSSA 4CJ0B 3FKIB 1R9TB 4LF8L 1YNXA 1WYDA 2F0PA 3MXUA 1PTOB 2Z6KA 5M3MB 2WV6D 5C4JB 5CGKA 2F4VL 3TSSA 2KUMA 1EYGA 3K7UC 5IGGA 1PRTC 2JE6I 2B2YC 1EEFD 2RQXA 2HCCA 2F0KA 2E74C 1IL8A 3CU7A 3VA5A 1PDQA 1G2TA 4OWTB 4DAYA 2UXCQ 5JJZA 4A3CG 4OL7A 2J0TD 4A3JB 4JI3L 2B3GA 3S2HB 3GV6A 3S1RH 3SDZA 2HQLA 4KK7A 3RLOA 1I4GA 1KTKA 4GLVB 2K5HA 2BDOA 4R4IA 4DR7L 2H4OA 4JI0L 4QUCA 2Q8IB 5M9OA 2L55A 4L8JA 3U58A 3C1EA 1EIGA 2I5MX 4XQNA 2RCFA 3T1HQ 3HKZE 2ICEC 4BBSG 2E2JH 5C3EG 3HOUH 5CV5A 2PMZE 3I7FA 1A2TA 1TIID 2KEDA 1D6EC 2BCOA 3HOWG 4DR2L 3HOVB 2KECA 4KKUA 5M5WH 3CCLA 5T1GA 5FOBB 3CD6A 2AWOA 1AZPA 1V1OA 1MBYA 1NNXA 3T13A 4GKKQ 1SNQA 1EIYB 3KF8A 3M3YB 3VR6A 4OO1G 1MSGA 3KDFA 2KHJA 1I94L 1H9KA 1PFNA 2OQ0A 4MIUA 4XTCS 1WFQA 1SNCA 5EJWA 2JYOA 4DU9A 4FF4A 3TS0A 3H3VC 3FMCA 4GNXB 5FLMH 4LAAA 2ZT9C 4YY3Q 4CDFC 5I6WA 1JE5A 3VDYA 3NHHA 4L5RC 3TP5A 1KD1C 5EQ0A 3A74A 3OWFA 1HA5A 5IYCH 4KD3A 3S9WA 1O7IA 1V9PA 3VYSA 1FD7D 4JBMA 4IURA 2C5CA 3S2DB 1YJNA 1LTTD 1II3A 4XQQA 3SXHA 4N8X1 1FGBD 3NTKA 1DYQA 2NVQH 5ELCA 4HEDA 2DNCA 5C0XI 5IWAQ 1OXVA 3GTQH 1A3TA 2F0NA 3TS2A 2QF7A 2MQHA 4A3DH 1R4PB 4EX5A 4A3MG 3A8KE 4LFBL 5IYDH 4C1NK 3K7AH 2FMMA 1MI2A 4LF8Q 5IYBG 1H9MA 1EWHA 1YJ9A 1TWHB 1HZCA 1Q3LA 5GQOA 2F4VQ 2EYJA 3IRBA 3GTLH 4A93H 5GROA 4C3HG 5IOCA 1JWSD 3GTJB 2UXDL 4GNXC 1QVFA 3T51B 1A8VA 4DA2A 4K5VA 2F0SA 1WCMG 3PO3H 1X3PA 4CKCA 4JI3Q 1FVIA 2NN6H 4M1UB 2V4DA 4A3JG 4IPHA 4J15A 5EBCA 2VW9A 3GTPB 2VY3A 2E2DC 3RZDH 1D8LA 1A2UA 2BE5D 1DOMA 1GXDC 2A8VA 4RGMA 4DR7Q 5C4XB 5AFWA 1EYCA 1PH6A 4JI0Q 1JR0D 3PGZA 3LNNA 3J80E 2A6HD 4DNRB 1Q90A 2EQSA 3CPFA 4TSSA 2VQFL 4EVOA 2JEAI 4DN4M 1DOLA 1EOVA 1E1TA 3DXJC 3U9OA 4DR2Q 1QUQB 4DR1L 1VQNA 1LTLA 1FGUA 1U0LA 4O42A 4R4CA 2YTVA 2MHVA 2A5HA 4HN7A 1PTOF 1Q1EA 3J80i 5KRUA 3NELA 1BDOA 3ND8A 1JMCA 2Z8LA 3EIVA 1I94Q 2DJGC 4DNTB 3KLSA 1QZGA 4K0KL 1YITA 1WVLA 1KIXA 2R93G 1GUGA 3NBHA 3MA2B 1EEID 3HOXH 4JK1C 3IFDA 5C4HA 2DUDA 3TEHB 1PH5A 1QNKA 4YWMA 2K04A 3ICEA 5BR8L 1SE3A 5CV9A 4NDXA 5I4DA 1VQCA 3J81c 5ISRA 4BXXH 2JQOA 4G7OC 2MGSA 1LUZA 1K28A 2HDLA 5C44B 2CH4A 1X65A 2K14A 5KGUA 1DM0B 1ZEQX 2I07B 4F87A 5IODA 1Y1VB 4A3BB 1XMQL 1VQIA 1GUSA 1GUWA 1KRSA 4LF6L 4X65L 3R8BA 1H9RA 3NEMA 2L9HA 1GM5A 4IO9A 3SK5A 1SYCA 3GTKH 1KQSA 1KHIA 4LF9L 1PZID 4LFBQ 1NTGA 1CKOA 5IYCG 4FNFA 1O80A 4H13C 2EY2A 2EY6A 1F2YA 2JJQA 5IGBA 2KOLA 4CDDC 1T9HA 2KENA 4AIMA 1G291 3X3MA 2G5DA 2UXDQ 3RN2A 3BDCA 4LNQA 3I90A 2RKSA 2WKDA 4GN3B 1JC7A 3ULPA 1WI5A 3M4PA 1K8MA 4IZ8A 1J6QA 2F03A 3SE0A 4C3IG 3MAQA 2LXKA 1EFID 2PYKA 3ULLA 1A15A 3RN5A 4EQPA 3BDOA 3SEBA 1TWGH 2WAQE 4DUYL 2B2WA 2N78A 5C4XG 4ALPA 1CZWA 1BKBA 4OONA 5FLXE 3K8AA 1DD2A 2VQFQ 2N55A 1YIJA 1EQTA 3D3RA 3TP6A 2NZHA 2HUGA 3H91A 4ZRZA 2EE1A 1TY0A 3I73A 2KCNA 4ZKCB 3I4MG 3CCRA 2MO0A 1ENAA 4MN3A 3RUZA 1GUOA 3E6ZX 4DR1Q 1BVSA 3PO3G 3S1QH 1EU3A 3KLWA 4DAMA 2NN6G 3S1MH 4P75A 4DXFA 3HOYB 3NBIA 2K7VA 1SNMA 3Q6SA 3ONAB 1X56A 1Z47A 3K0XA 1E3PA 1U9RA 3H0GH 4F88A 2E2IB 1BBUA 4XIGS 1TS3A 3ND9A 1IYUA 2JA8B 3F2BA 4K0KQ 2JA5G 2NB0A 2KHSA 4ZUIA 3TDQA 2O5IC 3A54A 4XYQA 2IPKD 4A3GB 1PZJD 1IBML 3CP0A 4QIWE 4WRDA 1Y14B 3G7LA 5BR8Q 2PI2E 4NP5A 1SE2A 3H94A 3HRZC 2NVTH 4I7AA 2A68C 2K32A 3TREA 3HKZB 1G51A 3IFTA 4GN5A 3DEOA 5DLQE 1QNUA 3W3AA 2B2VA 2DY8A 3NP8A 3MEFA 4NB3A 4KHZA 1I5FA 3OYYA 3CPWA 4GOPC 1CT1D 2PMZB 3I55A 3I4NB 1HUNA 4K2LA 3NQTA 2ZTDA 2VZAA 3NTHA 4HMJA 4LUOA 4FP5D 1XMQQ 1Y1VG 2VB2X 1X9NA 4QCLA 5FJ8G 4LF6Q 3HOXG 5KNDA 4X65Q 1SE4A 1I4HA 1PMRA 3K59A 2R92H 2KCMA 4H0LC 4LF9Q 1LM0A 2OTLA 1P8LA 3W5OA 4KD4A 4JOIA 2RHQB 2J4XA 2D5DA 1D5ZC 1X3GA 4QF4A 4A3FB 4OIKA 3S15B 4BA1I 5BN5A 4KKTA 1SYFA 1RDPD 4BBRB 1MIUA 2E2HH 3MVVA 3P7JA 5M5YB 4A3IH 1TWAH 1VQMA 1VQKA 2UU9L 3DWPA 3JAME 3DWQA 1PYWD 3M4YA 3UI2A 1M4VA 1SYBA 2AQ3B 3I4LA 1AE2A 2JA9A 3VR4A 1EL0A 4P74A 5F2DA 2B2UC 2F0TA 1BR9A 1SRUA 1SMYC 2LFNA 3CCQA 1X3EA 2DJFC 2K5NA 5M3FB 1JQYD 5DM73 1V1QA 4R9WA 3K5MA 2EDGA 4LK1C 4A3CH 3J80L 4DUYQ 5FKAC 3K80C 2F0MA 5IP7G 1B7YB 1Y8NB 1Y1WB 1V1PA 1JE4A 1UEBA 2ID0A 4X62L 2WKCA 4DV2L 4HJ9A 1XX8A 1E2VA 2SNSA 1CKNA 2EXDA 2QEXA 4BBSH 3QG1A 4C3JB 5C3EH 3UDFA 1F2LA 1DJRD 1NUCA 1U4PA 4N9TA 4FF2A 4OWXB 1SROA 3HOYG 1CM9A 1EU4A 2YV5A 3OTOL 3SVMA 5D65A 3FVQA 2DGYA 4IUQA 3MXNB 1TU2B 2F0JA 5J3BA 2IWHA 2O4XA 1EFWA 3KFUA 2R7ZB 4FDBA 5E4XA 1N34L 2Y0SE 3PIOA 1B3QA 2NZOA 3J7AF 5BN4A 2NTSA 1IBMQ 1L2FA 2A1AA 2G9DA 3WOFA 3KLRA 2D9UA 1KDBA 2GN5A 4KMUC 5I9PA 3RMHA 3I2ZA 3PUXA 1HTPA 1NR4A 4F8MA 3GP7A 1XNRL 1HFNA 1PH3A 4Y7NB 4KI0A 4X3KA 3QJYA 3HKZG 5HY6A 5JPNC 4QJFA 1K83H 3DUZA 5C6AA 4DV5L 1RF2D 1IXRA 5ELOA 1VQ5A 1EZ8A 3CCVA 3VYRA 2JN4A 2VUMB 3KF6A 5HGTA 3NWTA 5ELDA 3CKIB 1KRTA 4BY1B 5E1FA 2XVSA 2F0HA 3NENA 5C5LA 3BZCA 1PRTB 5CBAE 4LF7L 2NVYB 4HJ8A 4IFDI 3TQYA 2TSSA 2CHBD 3RZOB 1E1OA 5IGFA 3M9BA 4TKOB 2QW7A 1A3VA 2YTXA 4A3MH 1WTVA 4P2CB 2L15A 5JEAG 4ME5A 1CUKA 3K0YA 2UU9Q 2KCCA 4B9XA 1B4OA 2FHTA 4A3KH 4NXML 2RSOA 3OHXC 1R9TH 1R4QB 2ZM6L 3NK9A 2OXPA 1PTOH 3VA7A 3EA6A 1LTGD 1LTBD 2QEJC 1GHKA 3G4SA 4WJ4A 2WACA 4MHEA 4KHPL 2R7DA 1EZ6A 2G9HD 4ZUJA 5FLXL 1T5XD 1HNWL 1NE3A 2F0IA 1K8AC 4A3JH 1I3QB 3S2HH 2E76C 2KEEA 1CTMA 4N8FA 2LY7A 5ELFA 1YI2A 4JV5Q 1ENCA 2PCFB 1LTRD 2K50A 2SOBA 4X62Q 1PYBA 4DV2Q 1B44D 3CC2A 3TZUA 1ZXTA 2B8FA 4JG2A 1HNZL 2X69A 5DM63 1PFBA 4OELB 1EWCA 1YNJC 4XT3B 4APVA 3P20A 1XJVA 2NZ1D 1Z7TA 1Z6HA 3HOZG 3URYA 1EQVA 4AYBG 2WINB 4GZYC 1L1OA 3OTOQ 3EJIA 5CYUA 1FJGL 3TZDA 5IP9H 1O7ZA 2A68D 3TP7A 2F52A 4X3UA 3VYUA 2MPMA 2IHEA 1SXTA 4K6DA 1K3BC 4CKBA 1N34Q 2XTIA 3UDGA 1QWYA 3G48A 1DCZA 4MZ9A 5ELBA 5DAUA 2XN9C 3OIQA 3LWUA 2B39A 1CHQD 2AQ1B 4EQNA 1IL2A 2AMCB 2WAQB 2R93H 2VL6A 1XNRQ 1U4RA 1XWEA 2NTTA 3P1HA 1EUJA 3IAYA 2QA4A 1EYDA 3K57A 3NPPA 5ELEA 1GOZA 4DV5Q 3UE1A 2NN6I 2B29A 4PZ7A 2X6LA 4LW1A 5A2QL 4N9PA 3M85A 5E4WC 4B3SL 4B9WA 1BQQT 4RHSA 3QR8A 1OXXK 4PMCA 4CBVA 1TT2A 1UEAB 2YU9B 5D3IB 4CKEA 2IHFA 4IQZA 3U4VA 1NMFA 3L0OA 3I91A 3SK8A 1J9OA 3CCSA 1EY4A 1F77A 2BOSA 3T56B 4BY1G 3S1RB 3OOCA 2KA7A 4R4OA 4GN4B 3S14H 1C9OA 2RA4A 4LF7Q 3MFYA 4DAPA 5LMNL 2LSSA 3DLLA 2K5DA 1SMYD 1YEZA 3JAML 4BS9A 1IBKL 3J7A5 1TWCH 1I6HH 3QB3A 2E2JB 3DHQA 1RTNA 5EGTA 4NXMQ 2BH8A 1XTCD 3UDIA 3OMGA 4X64L 2ZM6Q 1CSPA 4QIWB 4RMFA 1OTCA 1N9WA 2JA6B 2ZXRA 1SDFA 1PV4A 1BF4A 3GTMH 4WJWA 1PYSB 3J81E 1Q8IA 4HIOA 3AMUA 1WD0A 1HZAA 4KHPQ 5C3WA 1VQBA 1HNWQ 4X3TA 4C3IH 1VQEA 2JK8A 2XWJB 3H09A 1QCBD 2JA7B 1MHWC 1U5KA 4IOAA 1IBLL 4ULLA 1GUTA 5IT9c 1O7LA 1TXYA 4NMZA 3FDTA 3GTPH 4A3KG 2DN8A 4S3SA 3FKIG 3RLNA 1H9SB 5C4XH 4IJLA 1D2BA 4XDXA 3WDNA 2Z4IA 1HNZQ 1YJWA 2EIFA 5M3MG 1Q86C 2PZTA 1MSHA 3D4RA 1CQVA 4UY8C 3J81i 4FYDA 1PRTF 2R3ZA 3A55A 3I4MH 3S1NB 2EPBA 1CFMA 1ONLA 3R2IA 1ENFA 3WWVA 1LT5D 1NSNS 1SYDA 2F3IA 4L5TA 2QKIC 1FJGQ 3Q23A 2IX3A 2VNUD 3SHLA 1STHA 1UE7A 1LV9A 1VQJA 2OF1A 3FEWX 3TMEA 2NVQB 1I50H 2ZXOA 3N6RA 2NUCA 5EPLA 1D7QA 3PCOB 5H1SE 3GTQB 4HSPA 3MXNA 2EY5A 2JA5H 1TQOA 1K73C 1FR3A 1DGSA 4A3EB 4ZQ3A 3UE0A 3A0JA 4FF1A 3GTOB 1LTID 1WTOA 1QILA 2WAQG 2D0OA 1NJIC 2N88A 3CMEA 3H6MA 3HOVG 2AQ2B 3L9AX 3Q0AA 4X6AH 2QDBA 3GTLB 4X3SA 4A93B 1CZGA 5IP9G 1TS4A 4B3SQ 3PMFA 2QGQA 1B70B 2K6AA 4JOIC 4PMBA 1BNZA 4QQBX 1N8RC 5CBEE 4V0BA 1PFMA 3E9IA 1VQAA 4ID6A 2F0OA 2RHSB 1NBWA 2K4KA 1D1IA 1EIHA 1B9MA 1Y1VH 3RZDB 1SNOA 4KV6A 1HQMC 4ZAIA 5FJ8H 3BZKA 5LMNQ 4A3BH 1SYEA 5G3LD 1WTWA 3AFPA 1X6OA 4HAEA 1WTQA 2QDLA 4DR6L 2DY7A 1IBKQ 2B2YA 2V1CC 1XPUA 4DV7L 1TS2A 2EYHA 2Y0SB 3OSOA 3KYHC 1NR2A 3CC7A 2PQEA 4LF5L 1FNVA 3AYHB 3A56A 4X64Q 5C0XH 2CWPA 1VQLA 3NUCA 3PSIA 1X3QA 2EYPA 1QJOA 5T1IA 5I6YA 1PHJA 1O78A 4FXKC 1F2ZA 2WIIB 2ZTEA 2Z4HA 2Q2IA 3DM1A 2JA6G 4UP7A 4BY7B 4OGQC 2EXZA 1KLGD 2PNHA 1A63A 2D0PA 2B8GA 1GKHA 1TR5A 1BCPB 1PRTD 1RHPA 1IBLQ 1CA5A 1X32A 4KLKA 2MFIA 2EYOA 3KUPA 1PH8A 2KVMA 5IP7H 3GTGH 5LMNW 2UUAL 1HJPA 2EVBA 2ES2A 4JI4L 4PG3A 3W1BA 5EKIA 3KBXA 2F3WA 1QB5D 3Q8DA 3J7YW 1U4MA 3O13A 5C4ZA 2HT1A 1K3RA 3WOEA 2PZUA 1HXYD 4JVZA 5CV4A 3CQZB 1XNQL 5CV8A 1PH2A 3S24A 3HOYH 3PUZA 3AU7A 1YNNC 4CGYB 2B2TC 2RDFA 3KBGA 4GOPB 1JCKB 2L0CA 1OXSC 3OW2A 1JB7A 1VDZA 4IUUA 3A7AB 5ELNA 2F0QA 2NVXH 4HSVA 1PH9A 3U4ZA 1B1ZA 3QWNA 1B9NA 1C48A 1ILQA 3NSWA 3A8JE 1IYJB 4A3EG 4EQ5A 2SDFA 1BCPC 1UAPA 4XQJA 1ML0D 1Q46A 1P16A 2P5ZX 3I72A 3BVGA 4A3GH 1OO9B 3I56A 2DNEA 1C4QA 1SE8A 3FP9A 4X66L 1VQPA 3CRKC 1C7YA 2F0VA 1V8QA 3VYTA 3FRPB 4XT1B 2M2LA 1SFOB 3M4OH 2K52A 3KLSX 1XXGA 3NWSA 3HFZB 5J22A 1K8GA 4DAYB 2ZXPA 1CHPD 1W3SA 2GA4B 1VS0A 4KHVA 4HCSA 4DR3L 3MXGA 1HNXL 1FNUA 2HQEA 2EJFC 1ILPA 4IJHA 3U50C 4RGNA 1VQHA 4G7ZC 4WFN3 4DR6Q 2XIWA 5IGCA 5J1ZA 2IW3A 4U68A 2B63B 2N8NA 4CDEC 1A62A 2A73B 4DV7Q 4GNXA 2E75C 4KN4C 2PQAB 4ME3A 2LMCB 4LF5Q 1RL2A 1HZ9A 2K03A 3T1YL 2FJ2A 5EAYA 4CHTB 5C44G 2F0LA 4OEMB 4BBRH 4JCVE 5JEAH 4RG1A 1SYGA 5M5YH 1WOCA 3J81L 3VR3A 4ILWA 3PQIA 4AQYL 3S1MB 1S4ZA 1K0SA 2F0WA 1RODA 4OIJA 4DK1A 5I2YA 5I9OA 4A4IA 4DGZA 5A2QE 4V190 1JICA 3MEHA 1MJCA 2PI2A 3GDEA 4OO1I 4BY7G 2IT1A 2RDHA 4A3BG 2C35B 3EBEA 4G57A 4YCUA 3NTIA 3H0GB 2IX1A 2Z6KC 3KF8B 2K33A 4JPBW 3S17H 5D3DA 3GO5A 2WB1B 5AJ3L 3KDFB 2HIVA 2AUKA 3AFQA 2Q2TA 1G6ZA 2FMCA 1J5EL 5M3FH 2K01A 3OIPA 5C0XG 3P75A 4RA8A 1HZBA 1AE3A 2PNRC 1F2MA 4HTHA 2UUAQ 5EKLA 1CI3M 4JI4Q 3BYTB 1Y1WH 1EOTA 1LO5D 5KNCA 4DV1L 2NVTB 3F2CA 4UP8A 1JOOA 1VQOA 1VQ9A 5JJKA 4IALA 1CKMA 1EWIA 4HCEA 2AHOB 4UPAA 4A3LG 3V96A 4C3JH 2L1BA 2K75A 1F9QA 1YBYA 4U673 1XNQQ 4NW2A 1ESRA
chains in the Genus database with same CATH topology
3C2PA 2ENBA 1NCVA 1H9JA 1S5ED 5I2XA 3N52A 2O2LD 3IKJA 5K36H 2R92B 2F0UA 5COYA 5FK9C 2A74C 5C0XJ 4CJ1B 1AZQA 1T5EA 1RCVD 1DONA 3PO2B 1BCPF 4QMGA 2NWGA 1XYIA 4H7BA 3R93A 1CQFA 1K8OA 4K5XA 1AEXA 4I7ZC 5DNFA 1HHVA 3R3OA 4Z9CB 1KDCA 4RAUC 3W2DA 1FYCA 3CRLC 1WTPA 1SNPA 2EYLA 2OEOA 4M8AA 4Q5VA 4DAVA 3PIP3 2R61A 3K58A 1TS5A 1RD9D 3NE5B 5EPJA 3NQIA 5JVH3 5M5XB 3HGBA 3T16A 3VR5A 2M9VA 4BBSB 4YIJA 1SEBD 4ZK9B 5KIXA 3BZDB 4EGVA 3HOWB 4TQUS 2R6GA 3HEJA 4J8QA 1DXMA 4K2KA 1STGA 3MZ5A 1I4RA 1IKMA 4FVMA 3DEPA 5CC4A 5KYIA 1E0BA 1STYA 1D5MC 1EY7A 4XYOA 4FXDA 2PZWA 1LABA 2BA1A 1GJXA 4Q0FA 1KABA 1EY9A 2PO4A 1S5DD 1BCPD 4J6HA 1QOHA 1JOQA 2FFKB 3AB9A 1C8CA 4K8JA 1VF7A 1GHJA 1QG7A 4PMWA 5FO8B 4B08A 2PW5A 2K5QA 5JEAJ 3K5LA 2J7ZA 4A3MB 2XWBB 4C3JG 3K5OA 2RDGA 2F0GA 4BA2I 2NBFA 4IN3A 1WD1A 4ZYSA 1IW7C 2L4NA 4C3HB 1CK1A 5K36G 1HTLD 4HMIA 3ERQA 2MP1A 1WCMB 2EJMA 5KEEA 1DOKA 1JB3A 3HG9A 3BDLA 2B2UA 4QB4A 5C5MA 2X6GA 4UDUC 4NKLA 1OXUA 3MWYW 3BS1A 4XXEA 3MHBA 1Y8OB 3QOJA 1Y8PB 4IFDH 2EYFA 4WORA 2FINB 1IHZA 3HP3A 2YYZA 4ABNA 1HFGA 1B53A 1PTOC 1MD2D 3KK7A 3HOUB 3HS0C 2TMPA 1SNDA 2R93B 1UUPA 3K6OA 5M5WB 3FPUB 5EKKA 2SEBD 5G3LF 2B2WC 1W6KA 1A6XA 1B50A 3SR1A 3K5NA 1AFPA 5JPMC 1I4XA 3L7ZC 3D31A 5KYLA 1E2ZA 1A3UA 4JBWA 4LJZC 3U9SA 1RTOA 4KTAA 3S14B 3EQLC 3OMCA 4IUTA 3Q22A 2CW0C 1HQRD 4R8NA 1I6HB 1TWCB 3T53B 4RKLA 1VMCA 3L3OC 3OWEB 5LHY1 3MXPA 3EFXD 3DWAA 1JORA 2RBMA 1JWUD 3C3LA 4RFBA 1S5BD 1LT4D 3IL8A 4L6TB 1WTXA 3GTMB 1B3AA 4K6LA 1FNWA 1KLUD 4HR7B 4C3IB 2B2VC 4A3DB 3SK4A 4FO2A 2A6EC 3K7AB 1F9PA 1V1PB 2QCPX 3I3CA 3ZYYX 3RLFA 2CQAA 2IL8A 1IKLA 1D1KA 5E3FA 2L5TA 2XRQD 2JXMB 2LS01 3C1FA 3C46A 3I4MB 2BDNA 2D2CC 1KNAA 3PO3B 2VB3X 3PUWA 1LTSD 3HZXA 3LWEA 4RHRA 3QO2A 5FO9B 1SJHD 5C3XA 2M00A 1BXTA 1D5XC 1B2TA 1I50B 5JAVA 3D4WA 3EVQA 3BVMA 2JP1A 2F4IA 2JA5B 1TY2A 4RH6A 5IIFA 2BA0A 1ZYRC 3E5SA 5DEHA 4H44C 4IFDG 2F0FA 5LL6X 4ZLTF 2XSCA 4R8IA 4C56C 1AP0A 2EY1A 2A69C 5HURA 1KDAA 1Q1BA 5JVG3 1G91A 3D6CA 1CA6A 1F9SA 2K1BA 1YNJD 5CORA 1JOKA 1SJED 3V05A 4DK0A 3HOXB 5D14A 1IW7D 3PUVA 2JSOA 5IT9L 2EYMA 3BYYB 1BUVT 1ESFA 4KY6A 3OW7A 2OT2A 2L11A 4IFDJ 1VF5C 3BVZA 1STNA 3T4AC 2SNMA 2F1MA 3A8IE 1G8ZD 3I70A 5K5PA 3MFGA 4UAIA 3TN2A 5LL6S 4OHJA 1DZ1A 5CV6A 2XNAC 3GTKB 4DXGA 4KJOA 1HA6A 4L63B 3MC0B 2KQ3A 2RVLA 2LKVA 3VR2A 4DF7A 1OXTA 4TRDA 4G4KA 3MTSA 2F3VA 3GTGB 5EBDA 2K28A 1PTOD 1ZKOA 4FF3A 4CJ2C 3M7GA 3A7LA 1SAPA 5EPKA 3D8GA 1PXUA 1F9RA 3RD4A 1M8AA 3E0JA 1TWGB 3GV3A 3QOLA 3D6WA 5IGEA 2O5JC 2NVXB 2MJ8A 3FPPA 2IJ0A 1E2WA 4KY5A 5IGDA 4PQXA 1I4PA 4PV1C 1UNSA 3S1QB 4RCOA 1ICWA 2CW0D 2F0DA 1G2SA 1S5FD 1LT3D 4ODGA 1LT6D 4K5WA 2HCIA 2JEBI 1RJTA 4K8IA 3M4OB 1Q12A 4J1MA 2Q8RE 5JOBA 1AW7A 1I4QA 4RGOS 1ET6A 1H9SA 2KJXA 4KN7C 1KNEA 1STEA 3D4DA 4RWSC 2EOTA 1Y69U 4LMQD 2WP8J 4KKSA 4G7HC 2A6ED 5BN3A 1NAPA 3CHBD 1HPCA 4I65A 3M7NA 3NXWA 4IUNA 2K5WA 1EY5A 3GD7A 4BWGB 5CMDA 2HDMA 3S17B 4DFAA 1HRJA 3TBIB 1EY0A 1W6JA 3X3NA 4QUFA 4ZKBB 3Q24A 1ET9A 1JWMD 2E2HB 1MGSA 1EY6A 4A3IB 1TWAB 3TP8A 2EZVA 1VMPA 4E6IA 3SK6A 4KY7A 2C9OA 5A35A 1STBA 3GQBA 1ZYRD 3V2TA 2RSNA 1L0YB 4RGTA 3HOZB 4IUPA 5FO7B 4AYBB 2XRSD 1KAAA 2I46A 2AWNA 3DMUA 1V43A 1S5CD 4RCNA 2A69D 1AN8A 3R2TA 2EJGC 1L0XB 2ICIA 3ITPA 3LX0A 4OO1H 1VCIA 5J39A 3PIO3 5C3EB 4K14A 2F0EA 1PLFA 3PV0A 4KJNA 3PUYA 4O1NA 1HCZA 2B2TA 3G6JB 1SSOA 2BE5C 4F7XA 2K05A 3EROA 4IUVA 3QIAA 4RKBA 1LTAD 1I6VC 2AUJD 1J8IA 1BBXC 3F2UA 2A6HC 1O7YA 2L12A 3OPOA 2PW7A 1TWFB 1STAA 2QILA 5CV7A 4C1NI 4C2MB 1TKWB 2MUYA 2NYZD 1EYAA 1LACA 1YNND 1PZKD 2H1EA 4PNYA 1TVXA 2VXWA 1BOSA 3J7AV 2IX0A 2D62A 1K83B 5KNBA 2Q8TA 1RKNA 4EQOA 3BG3A 3I8ZA 1QE6A 1SBBB 1U4LA 5NUCA 1BO0A 1EY8A 1HUMA 2Z1CA 4FXGC 5CR3A 2CVRA 1IYVA 1GUNA 1LLRD 1WTRA 2PPBC 5IT9E 3S16B 4A3KB 5TSSA 4CJ0B 3FKIB 1R9TB 2F0PA 3MXUA 1PTOB 5M3MB 2WV6D 5C4JB 5CGKA 3TSSA 2KUMA 5IGGA 1PRTC 2JE6I 2B2YC 1EEFD 2RQXA 2HCCA 2F0KA 2E74C 1IL8A 3CU7A 3VA5A 1PDQA 1G2TA 4DAYA 5JJZA 4OL7A 2J0TD 4A3JB 3S2HB 3GV6A 3SDZA 4KK7A 1I4GA 1KTKA 2BDOA 2H4OA 4QUCA 2Q8IB 5M9OA 2L55A 4L8JA 3C1EA 1EIGA 4XQNA 2ICEC 5CV5A 1A2TA 1TIID 2KEDA 1D6EC 2BCOA 3HOVB 2KECA 4KKUA 5T1GA 5FOBB 2AWOA 1AZPA 1V1OA 1MBYA 3T13A 1SNQA 3KF8A 3M3YB 3VR6A 4OO1G 1MSGA 1H9KA 1PFNA 4MIUA 4XTCS 5EJWA 1SNCA 2JYOA 4DU9A 4FF4A 3H3VC 3FMCA 4LAAA 2ZT9C 5I6WA 3NHHA 3TP5A 5EQ0A 3OWFA 1HA5A 4KD3A 3S9WA 3VYSA 1FD7D 4IURA 2C5CA 3S2DB 1LTTD 1II3A 4XQQA 3SXHA 1FGBD 3NTKA 1DYQA 5ELCA 4HEDA 2DNCA 5C0XI 1OXVA 1A3TA 2F0NA 2QF7A 1R4PB 3A8KE 4C1NK 2FMMA 1MI2A 1H9MA 1EWHA 1TWHB 1Q3LA 2EYJA 4C3HG 5IOCA 1JWSD 3GTJB 3T51B 4DA2A 4K5VA 2F0SA 1X3PA 4CKCA 2NN6H 4M1UB 2V4DA 5EBCA 3GTPB 2E2DC 1A2UA 2BE5D 1DOMA 1GXDC 5C4XB 4RGMA 5AFWA 1EYCA 1JR0D 3LNNA 3J80E 2A6HD 4DNRB 1Q90A 4TSSA 4EVOA 2JEAI 4DN4M 1DOLA 3DXJC 3U9OA 4O42A 2MHVA 2A5HA 4HN7A 1PTOF 1Q1EA 5KRUA 1BDOA 3ND8A 2Z8LA 4DNTB 3KLSA 1WVLA 1GUGA 3NBHA 3MA2B 1EEID 4JK1C 3IFDA 5C4HA 1QNKA 2K04A 1SE3A 5CV9A 4NDXA 5I4DA 5ISRA 4G7OC 2MGSA 2HDLA 5C44B 5KGUA 1DM0B 1ZEQX 2I07B 4F87A 5IODA 1Y1VB 4A3BB 1GUSA 1GUWA 3R8BA 1H9RA 2L9HA 3SK5A 1SYCA 1PZID 1O80A 4FNFA 4H13C 2EY2A 2EY6A 1F2YA 5IGBA 2KOLA 1G291 3X3MA 3BDCA 3I90A 2RKSA 2WKDA 1JC7A 1K8MA 4IZ8A 2F03A 3SE0A 4C3IG 3MAQA 1EFID 2PYKA 1A15A 4EQPA 3BDOA 3SEBA 2B2WA 1CZWA 5FLXE 1DD2A 2N55A 1EQTA 3D3RA 3TP6A 2HUGA 3H91A 4ZRZA 2EE1A 1TY0A 3I73A 2KCNA 4ZKCB 1ENAA 4MN3A 3RUZA 1GUOA 3E6ZX 1EU3A 2NN6G 4DXFA 3HOYB 3NBIA 2K7VA 1SNMA 3Q6SA 3ONAB 1Z47A 1U9RA 4F88A 2E2IB 4XIGS 1TS3A 3ND9A 1IYUA 2JA8B 2NB0A 2KHSA 4ZUIA 3TDQA 2O5IC 3A54A 4XYQA 2IPKD 4A3GB 1PZJD 4WRDA 3G7LA 4NP5A 1SE2A 3H94A 3HRZC 2A68C 2K32A 3HKZB 3IFTA 3DEOA 1QNUA 2DY8A 2B2VA 3W3AA 3NP8A 4KHZA 1CT1D 2PMZB 3I4NB 1HUNA 4K2LA 3NQTA 3NTHA 4HMJA 4FP5D 2VB2X 4QCLA 5KNDA 1SE4A 1I4HA 1PMRA 3K59A 4H0LC 4KD4A 2J4XA 2D5DA 1D5ZC 4QF4A 4A3FB 4OIKA 3S15B 4BA1I 5BN5A 4KKTA 1SYFA 1RDPD 4BBRB 3MVVA 3P7JA 5M5YB 3DWPA 3JAME 3DWQA 1PYWD 3M4YA 3UI2A 1M4VA 1SYBA 2AQ3B 3I4LA 3VR4A 1EL0A 5F2DA 2B2UC 2F0TA 1BR9A 1SMYC 2LFNA 5M3FB 1JQYD 5DM73 4R9WA 3K5MA 2EDGA 4LK1C 3J80L 5FKAC 2F0MA 1Y8NB 1Y1WB 1V1PA 1JE4A 2ID0A 2WKCA 1XX8A 1E2VA 2SNSA 3QG1A 4C3JB 1F2LA 1DJRD 1NUCA 1U4PA 4N9TA 4FF2A 1CM9A 1EU4A 3SVMA 5D65A 3FVQA 4IUQA 1TU2B 2F0JA 2IWHA 2O4XA 2R7ZB 5E4XA 3J7AF 5BN4A 2NTSA 2G9DA 3WOFA 3KLRA 2D9UA 1KDBA 4KMUC 5I9PA 3RMHA 3PUXA 1HTPA 1NR4A 4F8MA 3GP7A 1HFNA 4Y7NB 4KI0A 4X3KA 3QJYA 5JPNC 5C6AA 3DUZA 1RF2D 1EZ8A 3VYRA 2VUMB 5HGTA 3NWTA 5ELDA 3CKIB 4BY1B 5E1FA 2XVSA 2F0HA 5C5LA 1PRTB 5CBAE 2NVYB 4IFDI 2TSSA 2CHBD 3RZOB 5IGFA 4TKOB 1A3VA 1WTVA 4P2CB 5JEAG 4ME5A 3K0YA 2KCCA 4B9XA 1B4OA 2FHTA 2RSOA 3OHXC 1R4QB 3NK9A 2OXPA 1PTOH 3VA7A 3EA6A 1LTGD 1LTBD 2QEJC 1GHKA 2WACA 4MHEA 1EZ6A 2G9HD 4ZUJA 5FLXL 1T5XD 2F0IA 1I3QB 2E76C 2KEEA 1CTMA 2LY7A 5ELFA 1ENCA 2PCFB 1LTRD 2SOBA 1B44D 3TZUA 1ZXTA 2B8FA 2X69A 5DM63 1PFBA 1EWCA 1YNJC 4XT3B 3P20A 2NZ1D 1Z7TA 1Z6HA 3URYA 1EQVA 2WINB 4GZYC 3EJIA 5CYUA 3TZDA 1O7ZA 2A68D 3TP7A 4X3UA 3VYUA 2MPMA 1SXTA 4K6DA 4CKBA 1QWYA 1DCZA 5ELBA 5DAUA 2XN9C 3OIQA 3LWUA 2B39A 1CHQD 2AQ1B 4EQNA 2WAQB 1U4RA 1XWEA 2NTTA 3P1HA 3IAYA 1EYDA 3K57A 3NPPA 5ELEA 1GOZA 2NN6I 2X6LA 5A2QL 4N9PA 3M85A 5E4WC 4B9WA 1BQQT 4RHSA 1OXXK 4PMCA 4CBVA 1TT2A 1UEAB 2YU9B 5D3IB 4CKEA 4IQZA 3I91A 3SK8A 1J9OA 1EY4A 1F77A 2BOSA 3T56B 3S1RB 3OOCA 2KA7A 2RA4A 3MFYA 4DAPA 2K5DA 1SMYD 3JAML 4BS9A 3QB3A 2E2JB 3DHQA 1RTNA 5EGTA 1XTCD 3OMGA 4QIWB 2JA6B 2ZXRA 1SDFA 1BF4A 4WJWA 3J81E 1Q8IA 3AMUA 1WD0A 5C3WA 4X3TA 2XWJB 3H09A 1QCBD 2JA7B 4ULLA 1GUTA 1O7LA 4NMZA 3FDTA 2DN8A 4S3SA 1H9SB 1D2BA 4XDXA 3WDNA 2Z4IA 2PZTA 1MSHA 3D4RA 1CQVA 4FYDA 1PRTF 2R3ZA 3A55A 3S1NB 2EPBA 1CFMA 1ONLA 3R2IA 1ENFA 1LT5D 1NSNS 1SYDA 2QKIC 3Q23A 2IX3A 2VNUD 3SHLA 1STHA 1LV9A 2OF1A 3FEWX 3TMEA 2NVQB 2ZXOA 3N6RA 2NUCA 5EPLA 3GTQB 4HSPA 3MXNA 2EY5A 1TQOA 1FR3A 4A3EB 4ZQ3A 4FF1A 3GTOB 1LTID 1WTOA 1QILA 2N88A 3H6MA 2AQ2B 3L9AX 3Q0AA 2QDBA 3GTLB 4X3SA 4A93B 1CZGA 1TS4A 3PMFA 2K6AA 4PMBA 1BNZA 5CBEE 4V0BA 1PFMA 4ID6A 2F0OA 1D1IA 1EIHA 1B9MA 3RZDB 1SNOA 4KV6A 1HQMC 4ZAIA 1SYEA 5G3LD 1WTWA 1WTQA 4HAEA 2DY7A 2B2YA 1TS2A 2EYHA 2Y0SB 3OSOA 1NR2A 2PQEA 1FNVA 3A56A 5C0XH 3NUCA 1X3QA 2EYPA 1QJOA 5T1IA 5I6YA 1O78A 4FXKC 1F2ZA 2WIIB 2Z4HA 3DM1A 4BY7B 4OGQC 2EXZA 1KLGD 2B8GA 1TR5A 1BCPB 1PRTD 1RHPA 1CA5A 1X32A 2EYOA 3KUPA 2KVMA 2EVBA 5EKIA 3KBXA 2F3WA 1QB5D 3J7YW 1U4MA 3O13A 5C4ZA 3WOEA 2PZUA 1HXYD 5CV4A 3CQZB 5CV8A 3PUZA 1YNNC 3AU7A 4CGYB 2B2TC 2RDFA 3KBGA 1JCKB 2L0CA 1OXSC 1VDZA 4IUUA 3A7AB 2F0QA 4HSVA 1B1ZA 3QWNA 1B9NA 1C48A 1ILQA 3NSWA 3A8JE 2SDFA 1BCPC 1UAPA 4XQJA 1ML0D 3I72A 3BVGA 1OO9B 2DNEA 1C4QA 3CRKC 2F0VA 1V8QA 3VYTA 3FRPB 4XT1B 2M2LA 1SFOB 3KLSX 1XXGA 3NWSA 5J22A 2ZXPA 1CHPD 2GA4B 4KHVA 4HCSA 3MXGA 1FNUA 2HQEA 2EJFC 1ILPA 4RGNA 4G7ZC 4WFN3 2XIWA 5IGCA 5J1ZA 2IW3A 4U68A 2B63B 2A73B 2E75C 4KN4C 2LMCB 2K03A 2FJ2A 4CHTB 2F0LA 5JEAH 1SYGA 3J81L 3VR3A 4ILWA 3S1MB 1S4ZA 2F0WA 1RODA 4OIJA 4DK1A 5I2YA 5I9OA 4DGZA 5A2QE 4V190 1JICA 3MEHA 4OO1I 2IT1A 2RDHA 4G57A 3NTIA 3H0GB 2IX1A 2K33A 5D3DA 3GO5A 2WB1B 2AUKA 1G6ZA 2FMCA 2K01A 3OIPA 5C0XG 3P75A 4RA8A 2PNRC 1F2MA 4HTHA 5EKLA 1CI3M 3BYTB 1EOTA 1LO5D 5KNCA 2NVTB 1JOOA 4IALA 4HCEA 3V96A 2L1BA 1F9QA 4U673 4NW2A 1ESRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0B A;  1U4P A;  1ML0 D;  1PLF A;  5JJZ A;  2FMM A;  1MI2 A;  1NCV A;  2KEE A;  1EIH A;  3GV6 A;  1F9P A;  2FIN B;  1Q3L A;  4ZAI A;  2B2T A;  3G7L A;  3HP3 A;  3N52 A;  1SSO A;  1CM9 A;  3I3C A;  4XT1 B;  2K05 A;  1GUW A;  1WTW A;  4IUV A;  1WTQ A;  4HAE A;  2M2L A;  1SDF A;  4UAI A;  2DY7 A;  5D65 A;  3SVM A;  1HFG A;  2IL8 A;  1IKL A;  1B53 A;  1KNE A;  1ZXT A;  2L9H A;  4IUQ A;  3TN2 A;  1BF4 A;  2B2Y A;  4RWS C;  1DZ1 A;  2EOT A;  2X69 A;  4QUC A;  1J8I A;  3DEO A;  1BBX C;  1PFB A;  1WD0 A;  1EIG A;  4LMQ D;  3F2U A;  2DY8 A;  2B2V A;  5COY A;  1NR2 A;  4CJ1 B;  4X3T A;  1G2T A;  1HA6 A;  1O7Y A;  5E4X A;  1AZQ A;  1HUN A;  2BDN A;  1O80 A;  2L12 A;  2RVL A;  1DON A;  4XT3 B;  1X3P A;  1KNA A;  2NZ1 D;  1NAP A;  2NWG A;  1XYI A;  4HCS A;  2KED A;  1X3Q A;  1ILP A;  2D9U A;  3FDT A;  3MTS A;  5T1I A;  3R93 A;  3LWE A;  2KOL A;  2KEC A;  1IKM A;  3QO2 A;  1NR4 A;  2NYZ D;  4XDX A;  1DOM A;  2FFK B;  2XIW A;  5T1G A;  3DM1 A;  1HFN A;  3FPU B;  5AFW A;  4U68 A;  3TZD A;  1C8C A;  1AZP A;  2K28 A;  4X3K A;  5DNF A;  2B2W C;  1B2T A;  1O7Z A;  1QG7 A;  2H1E A;  5CMD A;  1B50 A;  1HHV A;  3I90 A;  1TVX A;  1MSH A;  2HDM A;  2VXW A;  4X3U A;  2MPM A;  4RAU C;  2JP1 A;  4CJ2 C;  2R3Z A;  1HRJ A;  4OIK A;  2J7Z A;  1ESR A;  2K03 A;  2FJ2 A;  1SAP A;  2Q8T A;  4QUF A;  4ZKB B;  1MSG A;  1RHP A;  1CA5 A;  4DN4 M;  1X32 A;  2EPB A;  5EPK A;  1DOL A;  1WTP A;  3I8Z A;  3P7J A;  1F9R A;  1PFN A;  1A15 A;  1MGS A;  1QE6 A;  1S4Z A;  5EJW A;  1M8A A;  1ROD A;  2JYO A;  3KUP A;  4OIJ A;  1RTO A;  2KVM A;  4ZLT F;  1U4R A;  1WD1 A;  3UI2 A;  1JIC A;  2B2W A;  4R8I A;  1LV9 A;  1U4L A;  3GV3 A;  3D6W A;  4IUT A;  4O42 A;  1AP0 A;  1BO0 A;  1VMP A;  2L4N A;  5EPJ A;  5CBA E;  1EL0 A;  2B2U C;  5EKI A;  1HUM A;  3KBX A;  2N55 A;  2X6L A;  5EPL A;  1CA6 A;  5EQ0 A;  1G91 A;  1EQT A;  1PDQ A;  5E4W C;  1U4M A;  1F9S A;  2MJ8 A;  2HUG A;  3H91 A;  1G6Z A;  2K1B A;  2CVR A;  2MP1 A;  1VMC A;  2EE1 A;  2RSN A;  5COR A;  4ZKC B;  1WTV A;  4ZK9 B;  2K01 A;  4MN3 A;  4R9W A;  4RA8 A;  4IUR A;  4IUP A;  1WTO A;  1WTR A;  1WVL A;  1B4O A;  1DOK A;  2FHT A;  3I91 A;  1J9O A;  2RSO A;  2N88 A;  4CJ0 B;  5D14 A;  1ICW A;  3IFD A;  2RA4 A;  1EOT A;  1G2S A;  1QNK A;  1JE4 A;  2B2U A;  2B2T C;  2K04 A;  3IL8 A;  3ONA B;  3Q6S A;  4X3S A;  2X6G A;  4HED A;  1WTX A;  1B3A A;  2KUM A;  2HCI A;  1RJT A;  4IUU A;  1XX8 A;  4HSV A;  2MGS A;  2B2Y C;  2HCC A;  2HDL A;  1BNZ A;  2L11 A;  1IL8 A;  1ILQ A;  2L1B A;  3MWY W;  2Q8R E;  1RTN A;  1F9Q A;  2B2V C;  4MHE A;  5CBE E;  3DEP A;  4NW2 A;  1PFM A;  1F2L A;  2SDF A; 
#chains in the Genus database with same CATH topology
 3C2P A;  2ENB A;  3HOZ H;  1NCV A;  1H9J A;  1S5E D;  2Z0S A;  5I2X A;  3N52 A;  2O2L D;  3DM3 A;  3IKJ A;  1FL0 A;  4JW0 A;  4NPS A;  3SGI A;  2R92 B;  5K36 H;  2F0U A;  3TRZ A;  5COY A;  5FK9 C;  2A74 C;  5C0X J;  4CJ1 B;  1AZQ A;  1T5E A;  1RCV D;  1DON A;  3PO2 B;  1BCP F;  4QMG A;  2NWG A;  1XYI A;  1KAW A;  4X66 Q;  4H7B A;  1WJJ A;  3R93 A;  1JJ2 A;  4DV3 L;  1CQF A;  1QUQ A;  1K8O A;  4JI5 L;  4K5X A;  4Y7N H;  4ZCK A;  1AEX A;  4I7Z C;  5DNF A;  4QGU A;  1HHV A;  3R3O A;  4Z9C B;  1KDC A;  4RAU C;  3W2D A;  2JA8 G;  1FYC A;  4DR3 Q;  1HNX Q;  2VUM H;  3CRL C;  1X55 A;  1WTP A;  1TWF H;  1SNP A;  1JJC B;  2EYL A;  2OEO A;  4C2M H;  4BY1 H;  4M8A A;  5IY0 A;  4A3G G;  4JYA L;  1XTD A;  4Q5V A;  4DAV A;  3PIP 3;  2R61 A;  3K58 A;  1A0I A;  1TS5 A;  1RD9 D;  3NE5 B;  5EPJ A;  3NQI A;  5JVH 3;  5M5X B;  3HGB A;  3T16 A;  4B3M L;  5JJI A;  3VR5 A;  4NXN L;  3T1Y Q;  2M9V A;  4BBS B;  4IOC A;  4JC0 A;  4YIJ A;  1SEB D;  3I4N G;  4ZK9 B;  4AQY Q;  4POF A;  5KIX A;  1PH7 A;  3BZD B;  4EGV A;  1UWV A;  5GAE C;  3HOW B;  4TQU S;  4GLA C;  1PA6 A;  2A19 A;  2R6G A;  1PVO A;  3HEJ A;  4YWK A;  4DR5 L;  4J8Q A;  1DXM A;  5AJ3 Q;  4K2K A;  1SMX A;  1STG A;  1J5E Q;  3MZ5 A;  1I4R A;  3HKS A;  4A3F G;  1IKM A;  2KHI A;  4FVM A;  3DEP A;  5CC4 A;  3NBH B;  5KYI A;  1E0B A;  4BBR G;  1STY A;  1I3Q H;  1D5M C;  4DKA C;  1EY7 A;  3S16 H;  1KC8 C;  4XYO A;  4FXD A;  3FKI H;  2PZW A;  4DV1 Q;  1LAB A;  3ZJY C;  5M3M H;  5C4J H;  1YHB A;  2LXJ A;  1PH4 A;  2BA1 A;  4GLX A;  1GJX A;  4Q0F A;  1XPO A;  1UE5 A;  1KAB A;  1EY9 A;  2PO4 A;  4MNO A;  1S5D D;  4A76 A;  1BCP D;  5M3F G;  3H3V H;  3CCJ A;  4GKJ L;  4J6H A;  3AEV A;  3K81 C;  1QOH A;  1JOQ A;  2FFK B;  3AB9 A;  4B3R L;  1C8C A;  1Y1W G;  4K8J A;  1VF7 A;  1GHJ A;  1QG7 A;  4PMW A;  5FO8 B;  4B08 A;  4GOP A;  2PW5 A;  1N33 L;  2K5Q A;  4JI2 L;  5JEA J;  3K5L A;  2J7Z A;  4A3M B;  2XWB B;  4C3J G;  3K5O A;  2RDG A;  1MJE A;  2F0G A;  4BA2 I;  2N3S A;  2NBF A;  3BU2 A;  4DV3 Q;  3KJO A;  4IPC A;  4JI5 Q;  3HOV H;  4IN3 A;  4HIK A;  1WD1 A;  4ZYS A;  2HHH L;  1IW7 C;  1X3F A;  2L4N A;  4OXP A;  2VQE L;  4C3H B;  1CK1 A;  2ZJR A;  3PF5 A;  5K36 G;  1GVP A;  1HTL D;  4HMI A;  3ERQ A;  4DK6 C;  2Q2U A;  2MP1 A;  2R7Z G;  3M3Y H;  1LYL A;  1WCM B;  2YU9 H;  4QL5 A;  4UP9 A;  3STB C;  1VQ4 A;  2EJM A;  5KEE A;  4JYA Q;  1DOK A;  1JB3 A;  3HG9 A;  2IY5 B;  3BDL A;  4B3M Q;  2B2U A;  2RCN A;  4QB4 A;  5C5M A;  2X6G A;  4NXN Q;  4UDU C;  2PQA A;  1MKH A;  4NKL A;  4HIM A;  1E24 A;  1OXU A;  3MWY W;  3BS1 A;  4XXE A;  2WB1 E;  3MHB A;  1E22 A;  1Y8O B;  3QOJ A;  1Y8P B;  4IFD H;  1KL9 A;  2EYF A;  2VUM G;  4WOR A;  3I4O A;  3S2D H;  2FIN B;  1IHZ A;  2K5V A;  3HP3 A;  4DR5 Q;  2JA6 H;  2YYZ A;  4ABN A;  1HFG A;  1B53 A;  1BBW A;  1PTO C;  1YHQ A;  1MD2 D;  3KK7 A;  2JA7 H;  4JI6 L;  3HOU B;  3HS0 C;  2TMP A;  2E5L L;  1SND A;  2R93 B;  4L5S A;  1ICF B;  3KJP A;  1UUP A;  2CH4 W;  1TWH H;  3K6O A;  5M5W B;  3FPU B;  5EKK A;  2SEB D;  4MTN A;  5G3L F;  2B2W C;  4YWL A;  1W6K A;  3F2D A;  1A6X A;  1B50 A;  4GS3 A;  3SR1 A;  3K5N A;  3GTJ H;  1AFP A;  1HH2 P;  3ULJ A;  5JPM C;  2ALY B;  3S1N H;  1I4X A;  4GKJ Q;  3L7Z C;  1Q82 C;  2ASB A;  1W2B A;  3D31 A;  5KYL A;  1E2Z A;  1A3U A;  4JBW A;  3LGJ A;  4LJZ C;  3U9S A;  2R7F A;  1RTO A;  4B3R Q;  4KTA A;  3S14 B;  3EQL C;  3OMC A;  2CQO A;  4IUT A;  3Q22 A;  2CW0 C;  1N33 Q;  3ERS X;  4JI2 Q;  1HQR D;  4R8N A;  3W1G A;  2OWO A;  1I6H B;  1TWC B;  2OCE A;  3T53 B;  4RKL A;  1VMC A;  3L3O C;  3OWE B;  4A3E H;  5LHY 1;  3CCU A;  3MXP A;  2I5L X;  3GTO H;  1SN8 A;  4DV6 L;  3PF4 A;  4L5Q A;  3EFX D;  4CDC C;  2E8G A;  3E3X A;  2HHH Q;  3DWA A;  2MO1 A;  2FXQ A;  2RBM A;  4AYB E;  2UUC L;  1JWU D;  1JOR A;  3C3L A;  2VQE Q;  4RFB A;  1S5B D;  1LT4 D;  3IL8 A;  4L6T B;  1WTX A;  2CCZ A;  3CF5 A;  3GTM B;  1B3A A;  4K6L A;  1FNW A;  1Q81 C;  1KLU D;  4HR7 B;  4C3I B;  2B2V C;  4A3D B;  1N32 L;  3SK4 A;  4FO2 A;  2A6E C;  3K7A B;  1F9P A;  3UDX A;  1V1P B;  2QCP X;  3CCE A;  3I3C A;  3ZYY X;  1S3O A;  1SLJ A;  3RLF A;  2CQA A;  1CKN B;  2IL8 A;  1IKL A;  1D1K A;  4HID A;  5E3F A;  2L5T A;  1E7Z A;  2XRQ D;  2JXM B;  2LS0 1;  3C1F A;  3C46 A;  3I4M B;  2BDN A;  5C44 H;  1M1K C;  2D2C C;  1KNA A;  3PO3 B;  2VB3 X;  4Y52 H;  2XGT A;  3PUW A;  2KBN A;  1LTS D;  3HZX A;  3LWE A;  4RHR A;  3KOJ A;  3M4Q A;  3QO2 A;  5FO9 B;  1SJH D;  2H5X A;  4BY7 H;  2M00 A;  5C3X A;  1EQR A;  1BXT A;  1D5X C;  4JBJ A;  1B2T A;  1I50 B;  3EN2 A;  5JAV A;  3D4W A;  3EVQ A;  1UE6 A;  4DV0 L;  3BVM A;  2JP1 A;  2F4I A;  1WTH A;  4JI7 L;  1TY2 A;  4RH6 A;  1VQ8 A;  4JI6 Q;  2JA5 B;  5IIF A;  4DV4 L;  2BA0 A;  1QVC A;  1ZYR C;  3F8T A;  3E5S A;  2E5L Q;  3HOU G;  5DEH A;  4H44 C;  4IFD G;  2F0F A;  1PFS A;  2CWA A;  4DNI A;  5LL6 X;  4ZLT F;  4B3T L;  2XSC A;  4R8I A;  4C56 C;  1AP0 A;  2EY1 A;  2A69 C;  5E7N A;  3G6E A;  5HUR A;  1KDA A;  1Q1B A;  5JVG 3;  2RF4 A;  4R4T A;  4JI8 L;  1G91 A;  2ZJQ A;  3D6C A;  1CA6 A;  1F9S A;  4A3L H;  2K1B A;  1YNJ D;  2HIX A;  3KF6 B;  5COR A;  1JOK A;  1HR0 L;  1AH9 A;  1SJE D;  3V05 A;  2JA7 G;  4P71 A;  3CQZ H;  1SR3 A;  4DK0 A;  4YCW A;  4LWC A;  1N36 L;  1VQG A;  5GAH C;  2ATW A;  3BJU A;  3HOX B;  5D14 A;  1IW7 D;  3PUV A;  4LF4 L;  2JSO A;  4LFA L;  5FLM G;  2VS1 A;  4OX9 L;  5IT9 L;  2EYM A;  4JI1 L;  3BYY B;  1K0R A;  1BUV T;  4YHH L;  1ESF A;  4KY6 A;  1Q8K A;  3OW7 A;  5LMU L;  2OT2 A;  2L11 A;  4IFD J;  1VF5 C;  4DV6 Q;  3CC4 A;  3STB D;  3BVZ A;  1STN A;  3T4A C;  4PZ6 A;  2SNM A;  2UUC Q;  2F1M A;  2UXB L;  3A8I E;  1EIF A;  1G8Z D;  3I70 A;  4IPG A;  5K5P A;  3MFG A;  4UAI A;  1Z9F A;  3CMA A;  1SFO H;  3TN2 A;  5LL6 S;  4OHJ A;  2E2I H;  1DZ1 A;  5CV6 A;  2XNA C;  3GTK B;  3J80 c;  4DXG A;  4KJO A;  1N32 Q;  2JA8 H;  1HA6 A;  4L63 B;  3MC0 B;  4A3D G;  2KQ3 A;  2RVL A;  2LKV A;  5IYD G;  3VR2 A;  4DF7 A;  1OXT A;  4TRD A;  4G4K A;  4LFC L;  3MTS A;  2GVB A;  2F3V A;  3GTG B;  5EBD A;  4LUZ A;  2B63 H;  2BH2 A;  3RR5 A;  2K28 A;  4JBK A;  3CAM A;  4A93 G;  1M90 C;  1PTO D;  1ZKO A;  4FF3 A;  1YZ6 A;  4CJ2 C;  4TVA B;  3M7G A;  3A7L A;  1GO3 E;  1XMO L;  1GD7 A;  1SAP A;  2CFM A;  3I4N H;  4LUV A;  5EPK A;  3A5Z B;  1YHA A;  2AKW B;  3D8G A;  1L1O B;  1PXU A;  1S40 A;  1F9R A;  4P72 A;  3RD4 A;  1M8A A;  2Q2H A;  3E0J A;  4DUZ L;  1TWG B;  3GV3 A;  3QOL A;  3D6W A;  4HJ5 A;  4DV0 Q;  1VQ6 A;  5IGE A;  2O5J C;  1NY4 A;  3D0F A;  2OQK A;  4JI7 Q;  2NVX B;  1EQQ A;  4DV4 Q;  2Y0S G;  2MJ8 A;  3FPP A;  4A3F H;  4P73 A;  2IJ0 A;  3S15 H;  1E2W A;  4HJ7 A;  4KY5 A;  5IGD A;  3A5U A;  4PQX A;  1UE1 A;  1I4P A;  4PV1 C;  1UNS A;  3AQQ A;  1G6P A;  4WJ3 M;  3S1Q B;  4B3T Q;  4RCO A;  1VQD A;  1ICW A;  1YVC A;  2GVA A;  3ER0 A;  2CW0 D;  2F0D A;  5GAD C;  1G2S A;  2UUB L;  1S5F D;  1LT3 D;  4ODG A;  4JI8 Q;  1QVG A;  1LT6 D;  4K5W A;  4PZ8 A;  3FHW A;  2HCI A;  2JEB I;  1RJT A;  4K8I A;  3M4O B;  1Q12 A;  3G71 A;  2OTJ A;  1HR0 Q;  4J1M A;  2WFW A;  2Q8R E;  4DR4 L;  5JOB A;  1AW7 A;  4DK3 C;  4DPG A;  1N36 Q;  1I4Q A;  4LFA Q;  4LF4 Q;  3E0E A;  4RGO S;  4OX9 Q;  1ET6 A;  1L1O C;  4JI1 Q;  1H9S A;  2KJX A;  4KN7 C;  1KNE A;  4YHH Q;  1STE A;  3D4D A;  4RWS C;  2EOT A;  5LMU Q;  1Y69 U;  4BXX G;  4LMQ D;  2WP8 J;  4KKS A;  3PO2 H;  4G7H C;  4A75 A;  2A6E D;  5BN3 A;  2UXB Q;  1NAP A;  3CHB D;  1HPC A;  4I65 A;  3M7N A;  3NXW A;  4IUN A;  2K5W A;  4O2D A;  1IZ6 A;  1EY5 A;  4POG A;  1B8A A;  3GD7 A;  4BWG B;  5CMD A;  5FLX c;  4R1J A;  2HDM A;  4IPD A;  3S17 B;  1VQ7 A;  2I0Q A;  4DFA A;  1PH1 A;  5IE8 A;  3TBI B;  1HR0 W;  2R7Z H;  1HRJ A;  1EY0 A;  1W6J A;  3X3N A;  1VQF A;  4QUF A;  4ZKB B;  1H95 A;  1ASZ A;  3Q24 A;  1ET9 A;  1JWM D;  4LFC Q;  2E2H B;  1MGS A;  1EY6 A;  4A3I B;  1KXL A;  1TWA B;  4HJA A;  1K9M C;  3JAM i;  4JV5 L;  3TP8 A;  1QZH A;  5JJL A;  1ASY A;  2EZV A;  1VMP A;  4E6I A;  3SK6 A;  5M5X H;  1JJG A;  4KY7 A;  2Z9H A;  2C9O A;  1RIP A;  5A35 A;  3H3V I;  1XMO Q;  1STB A;  3GQB A;  1ZYR D;  3V2T A;  2RSN A;  1L0Y B;  2KCT A;  4MTK A;  2MNA A;  4RGT A;  3HOZ B;  4IUP A;  4O0A A;  4QY7 A;  5FO7 B;  4DUZ Q;  3HOW H;  4AYB B;  2I5H A;  2XRS D;  1KAA A;  2I46 A;  2AWN A;  2UXC L;  3DMU A;  1V43 A;  1S5C D;  3PIP A;  4RCN A;  5HGQ A;  2A69 D;  1AN8 A;  3R2T A;  4OWW B;  2EJG C;  2B63 G;  1CSQ A;  1L0X B;  2NVY H;  2ICI A;  3F1Z A;  3ITP A;  3RZO H;  3LX0 A;  4OO1 H;  1VCI A;  5J39 A;  3T1H L;  4AH6 A;  3PIO 3;  5C3E B;  2HD3 A;  4K14 A;  2F0E A;  1PLF A;  3PV0 A;  3CXC A;  4KJN A;  3J7Z C;  3PUY A;  4H02 A;  4O1N A;  2UUB Q;  1HCZ A;  2B2T A;  3G6J B;  1SSO A;  2BE5 C;  4F7X A;  2K05 A;  3ERO A;  4IUV A;  3E9H A;  1XPR A;  3QIA A;  4RKB A;  1LTA D;  4R4Q A;  3H0G G;  1I6V C;  2AUJ D;  1J8I A;  1BBX C;  2WB1 G;  2A6H C;  3F2U A;  4DR4 Q;  3J81 j;  1O7Y A;  4GKK L;  2L12 A;  3OPO A;  2PW7 A;  1TWF B;  2YTY A;  1STA A;  2QIL A;  5CV7 A;  4C1N I;  4C2M B;  1TKW B;  2Z6B A;  5GAG C;  2MUY A;  3JAM c;  2NYZ D;  1EYA A;  1LAC A;  3H15 A;  1YNN D;  3CW2 C;  4UHV A;  2CKZ B;  1PZK D;  2H1E A;  3B6Y A;  2ZTC A;  4YCV A;  3RNU A;  4PNY A;  1TVX A;  2VXW A;  1BOS A;  3J7A V;  2IX0 A;  4YY3 L;  2D62 A;  1K83 B;  1NMG A;  1C0A A;  5KNB A;  1L0W A;  2Q8T A;  1RKN A;  3JC6 6;  4EQO A;  1S72 A;  1X54 A;  5L37 A;  1Q7Y C;  3BG3 A;  3I8Z A;  5IYB H;  1QE6 A;  3CCM A;  1JT8 A;  1SBB B;  1U4L A;  5NUC A;  3L2P A;  1BO0 A;  1EY8 A;  4C3H H;  2R92 G;  1HUM A;  2Z1C A;  4FXG C;  2N49 A;  5CR3 A;  5IWA L;  2CVR A;  1WCM H;  2ZJP A;  1IYV A;  1GUN A;  3PO2 G;  1LLR D;  1WTR A;  2PPB C;  5IT9 E;  4A3I G;  3S16 B;  4A3K B;  5TSS A;  4CJ0 B;  3FKI B;  1R9T B;  4LF8 L;  1YNX A;  1WYD A;  2F0P A;  3MXU A;  1PTO B;  2Z6K A;  5M3M B;  2WV6 D;  5C4J B;  5CGK A;  2F4V L;  3TSS A;  2KUM A;  1EYG A;  3K7U C;  5IGG A;  1PRT C;  2JE6 I;  2B2Y C;  1EEF D;  2RQX A;  2HCC A;  2F0K A;  2E74 C;  1IL8 A;  3CU7 A;  3VA5 A;  1PDQ A;  1G2T A;  4OWT B;  4DAY A;  2UXC Q;  5JJZ A;  4A3C G;  4OL7 A;  2J0T D;  4A3J B;  4JI3 L;  2B3G A;  3S2H B;  3GV6 A;  3S1R H;  3SDZ A;  2HQL A;  4KK7 A;  3RLO A;  1I4G A;  1KTK A;  4GLV B;  2K5H A;  2BDO A;  4R4I A;  4DR7 L;  2H4O A;  4JI0 L;  4QUC A;  2Q8I B;  5M9O A;  2L55 A;  4L8J A;  3U58 A;  3C1E A;  1EIG A;  2I5M X;  4XQN A;  2RCF A;  3T1H Q;  3HKZ E;  2ICE C;  4BBS G;  2E2J H;  5C3E G;  3HOU H;  5CV5 A;  2PMZ E;  3I7F A;  1A2T A;  1TII D;  2KED A;  1D6E C;  2BCO A;  3HOW G;  4DR2 L;  3HOV B;  2KEC A;  4KKU A;  5M5W H;  3CCL A;  5T1G A;  5FOB B;  3CD6 A;  2AWO A;  1AZP A;  1V1O A;  1MBY A;  1NNX A;  3T13 A;  4GKK Q;  1SNQ A;  1EIY B;  3KF8 A;  3M3Y B;  3VR6 A;  4OO1 G;  1MSG A;  3KDF A;  2KHJ A;  1I94 L;  1H9K A;  1PFN A;  2OQ0 A;  4MIU A;  4XTC S;  1WFQ A;  1SNC A;  5EJW A;  2JYO A;  4DU9 A;  4FF4 A;  3TS0 A;  3H3V C;  3FMC A;  4GNX B;  5FLM H;  4LAA A;  2ZT9 C;  4YY3 Q;  4CDF C;  5I6W A;  1JE5 A;  3VDY A;  3NHH A;  4L5R C;  3TP5 A;  1KD1 C;  5EQ0 A;  3A74 A;  3OWF A;  1HA5 A;  5IYC H;  4KD3 A;  3S9W A;  1O7I A;  1V9P A;  3VYS A;  1FD7 D;  4JBM A;  4IUR A;  2C5C A;  3S2D B;  1YJN A;  1LTT D;  1II3 A;  4XQQ A;  3SXH A;  4N8X 1;  1FGB D;  3NTK A;  1DYQ A;  2NVQ H;  5ELC A;  4HED A;  2DNC A;  5C0X I;  5IWA Q;  1OXV A;  3GTQ H;  1A3T A;  2F0N A;  3TS2 A;  2QF7 A;  2MQH A;  4A3D H;  1R4P B;  4EX5 A;  4A3M G;  3A8K E;  4LFB L;  5IYD H;  4C1N K;  3K7A H;  2FMM A;  1MI2 A;  4LF8 Q;  5IYB G;  1H9M A;  1EWH A;  1YJ9 A;  1TWH B;  1HZC A;  1Q3L A;  5GQO A;  2F4V Q;  2EYJ A;  3IRB A;  3GTL H;  4A93 H;  5GRO A;  4C3H G;  5IOC A;  1JWS D;  3GTJ B;  2UXD L;  4GNX C;  1QVF A;  3T51 B;  1A8V A;  4DA2 A;  4K5V A;  2F0S A;  1WCM G;  3PO3 H;  1X3P A;  4CKC A;  4JI3 Q;  1FVI A;  2NN6 H;  4M1U B;  2V4D A;  4A3J G;  4IPH A;  4J15 A;  5EBC A;  2VW9 A;  3GTP B;  2VY3 A;  2E2D C;  3RZD H;  1D8L A;  1A2U A;  2BE5 D;  1DOM A;  1GXD C;  2A8V A;  4RGM A;  4DR7 Q;  5C4X B;  5AFW A;  1EYC A;  1PH6 A;  4JI0 Q;  1JR0 D;  3PGZ A;  3LNN A;  3J80 E;  2A6H D;  4DNR B;  1Q90 A;  2EQS A;  3CPF A;  4TSS A;  2VQF L;  4EVO A;  2JEA I;  4DN4 M;  1DOL A;  1EOV A;  1E1T A;  3DXJ C;  3U9O A;  4DR2 Q;  1QUQ B;  4DR1 L;  1VQN A;  1LTL A;  1FGU A;  1U0L A;  4O42 A;  4R4C A;  2YTV A;  2MHV A;  2A5H A;  4HN7 A;  1PTO F;  1Q1E A;  3J80 i;  5KRU A;  3NEL A;  1BDO A;  3ND8 A;  1JMC A;  2Z8L A;  3EIV A;  1I94 Q;  2DJG C;  4DNT B;  3KLS A;  1QZG A;  4K0K L;  1YIT A;  1WVL A;  1KIX A;  2R93 G;  1GUG A;  3NBH A;  3MA2 B;  1EEI D;  3HOX H;  4JK1 C;  3IFD A;  5C4H A;  2DUD A;  3TEH B;  1PH5 A;  1QNK A;  4YWM A;  2K04 A;  3ICE A;  5BR8 L;  1SE3 A;  5CV9 A;  4NDX A;  5I4D A;  1VQC A;  3J81 c;  5ISR A;  4BXX H;  2JQO A;  4G7O C;  2MGS A;  1LUZ A;  1K28 A;  2HDL A;  5C44 B;  2CH4 A;  1X65 A;  2K14 A;  5KGU A;  1DM0 B;  1ZEQ X;  2I07 B;  4F87 A;  5IOD A;  1Y1V B;  4A3B B;  1XMQ L;  1VQI A;  1GUS A;  1GUW A;  1KRS A;  4LF6 L;  4X65 L;  3R8B A;  1H9R A;  3NEM A;  2L9H A;  1GM5 A;  4IO9 A;  3SK5 A;  1SYC A;  3GTK H;  1KQS A;  1KHI A;  4LF9 L;  1PZI D;  4LFB Q;  1NTG A;  1CKO A;  5IYC G;  4FNF A;  1O80 A;  4H13 C;  2EY2 A;  2EY6 A;  1F2Y A;  2JJQ A;  5IGB A;  2KOL A;  4CDD C;  1T9H A;  2KEN A;  4AIM A;  1G29 1;  3X3M A;  2G5D A;  2UXD Q;  3RN2 A;  3BDC A;  4LNQ A;  3I90 A;  2RKS A;  2WKD A;  4GN3 B;  1JC7 A;  3ULP A;  1WI5 A;  3M4P A;  1K8M A;  4IZ8 A;  1J6Q A;  2F03 A;  3SE0 A;  4C3I G;  3MAQ A;  2LXK A;  1EFI D;  2PYK A;  3ULL A;  1A15 A;  3RN5 A;  4EQP A;  3BDO A;  3SEB A;  1TWG H;  2WAQ E;  4DUY L;  2B2W A;  2N78 A;  5C4X G;  4ALP A;  1CZW A;  1BKB A;  4OON A;  5FLX E;  3K8A A;  1DD2 A;  2VQF Q;  2N55 A;  1YIJ A;  1EQT A;  3D3R A;  3TP6 A;  2NZH A;  2HUG A;  3H91 A;  4ZRZ A;  2EE1 A;  1TY0 A;  3I73 A;  2KCN A;  4ZKC B;  3I4M G;  3CCR A;  2MO0 A;  1ENA A;  4MN3 A;  3RUZ A;  1GUO A;  3E6Z X;  4DR1 Q;  1BVS A;  3PO3 G;  3S1Q H;  1EU3 A;  3KLW A;  4DAM A;  2NN6 G;  3S1M H;  4P75 A;  4DXF A;  3HOY B;  3NBI A;  2K7V A;  1SNM A;  3Q6S A;  3ONA B;  1X56 A;  1Z47 A;  3K0X A;  1E3P A;  1U9R A;  3H0G H;  4F88 A;  2E2I B;  1BBU A;  4XIG S;  1TS3 A;  3ND9 A;  1IYU A;  2JA8 B;  3F2B A;  4K0K Q;  2JA5 G;  2NB0 A;  2KHS A;  4ZUI A;  3TDQ A;  2O5I C;  3A54 A;  4XYQ A;  2IPK D;  4A3G B;  1PZJ D;  1IBM L;  3CP0 A;  4QIW E;  4WRD A;  1Y14 B;  3G7L A;  5BR8 Q;  2PI2 E;  4NP5 A;  1SE2 A;  3H94 A;  3HRZ C;  2NVT H;  4I7A A;  2A68 C;  2K32 A;  3TRE A;  3HKZ B;  1G51 A;  3IFT A;  4GN5 A;  3DEO A;  5DLQ E;  1QNU A;  3W3A A;  2B2V A;  2DY8 A;  3NP8 A;  3MEF A;  4NB3 A;  4KHZ A;  1I5F A;  3OYY A;  3CPW A;  4GOP C;  1CT1 D;  2PMZ B;  3I55 A;  3I4N B;  1HUN A;  4K2L A;  3NQT A;  2ZTD A;  2VZA A;  3NTH A;  4HMJ A;  4LUO A;  4FP5 D;  1XMQ Q;  1Y1V G;  2VB2 X;  1X9N A;  4QCL A;  5FJ8 G;  4LF6 Q;  3HOX G;  5KND A;  4X65 Q;  1SE4 A;  1I4H A;  1PMR A;  3K59 A;  2R92 H;  2KCM A;  4H0L C;  4LF9 Q;  1LM0 A;  2OTL A;  1P8L A;  3W5O A;  4KD4 A;  4JOI A;  2RHQ B;  2J4X A;  2D5D A;  1D5Z C;  1X3G A;  4QF4 A;  4A3F B;  4OIK A;  3S15 B;  4BA1 I;  5BN5 A;  4KKT A;  1SYF A;  1RDP D;  4BBR B;  1MIU A;  2E2H H;  3MVV A;  3P7J A;  5M5Y B;  4A3I H;  1TWA H;  1VQM A;  1VQK A;  2UU9 L;  3DWP A;  3JAM E;  3DWQ A;  1PYW D;  3M4Y A;  3UI2 A;  1M4V A;  1SYB A;  2AQ3 B;  3I4L A;  1AE2 A;  2JA9 A;  3VR4 A;  1EL0 A;  4P74 A;  5F2D A;  2B2U C;  2F0T A;  1BR9 A;  1SRU A;  1SMY C;  2LFN A;  3CCQ A;  1X3E A;  2DJF C;  2K5N A;  5M3F B;  1JQY D;  5DM7 3;  1V1Q A;  4R9W A;  3K5M A;  2EDG A;  4LK1 C;  4A3C H;  3J80 L;  4DUY Q;  5FKA C;  3K80 C;  2F0M A;  5IP7 G;  1B7Y B;  1Y8N B;  1Y1W B;  1V1P A;  1JE4 A;  1UEB A;  2ID0 A;  4X62 L;  2WKC A;  4DV2 L;  4HJ9 A;  1XX8 A;  1E2V A;  2SNS A;  1CKN A;  2EXD A;  2QEX A;  4BBS H;  3QG1 A;  4C3J B;  5C3E H;  3UDF A;  1F2L A;  1DJR D;  1NUC A;  1U4P A;  4N9T A;  4FF2 A;  4OWX B;  1SRO A;  3HOY G;  1CM9 A;  1EU4 A;  2YV5 A;  3OTO L;  3SVM A;  5D65 A;  3FVQ A;  2DGY A;  4IUQ A;  3MXN B;  1TU2 B;  2F0J A;  5J3B A;  2IWH A;  2O4X A;  1EFW A;  3KFU A;  2R7Z B;  4FDB A;  5E4X A;  1N34 L;  2Y0S E;  3PIO A;  1B3Q A;  2NZO A;  3J7A F;  5BN4 A;  2NTS A;  1IBM Q;  1L2F A;  2A1A A;  2G9D A;  3WOF A;  3KLR A;  2D9U A;  1KDB A;  2GN5 A;  4KMU C;  5I9P A;  3RMH A;  3I2Z A;  3PUX A;  1HTP A;  1NR4 A;  4F8M A;  3GP7 A;  1XNR L;  1HFN A;  1PH3 A;  4Y7N B;  4KI0 A;  4X3K A;  3QJY A;  3HKZ G;  5HY6 A;  5JPN C;  4QJF A;  1K83 H;  3DUZ A;  5C6A A;  4DV5 L;  1RF2 D;  1IXR A;  5ELO A;  1VQ5 A;  1EZ8 A;  3CCV A;  3VYR A;  2JN4 A;  2VUM B;  3KF6 A;  5HGT A;  3NWT A;  5ELD A;  3CKI B;  1KRT A;  4BY1 B;  5E1F A;  2XVS A;  2F0H A;  3NEN A;  5C5L A;  3BZC A;  1PRT B;  5CBA E;  4LF7 L;  2NVY B;  4HJ8 A;  4IFD I;  3TQY A;  2TSS A;  2CHB D;  3RZO B;  1E1O A;  5IGF A;  3M9B A;  4TKO B;  2QW7 A;  1A3V A;  2YTX A;  4A3M H;  1WTV A;  4P2C B;  2L15 A;  5JEA G;  4ME5 A;  1CUK A;  3K0Y A;  2UU9 Q;  2KCC A;  4B9X A;  1B4O A;  2FHT A;  4A3K H;  4NXM L;  2RSO A;  3OHX C;  1R9T H;  1R4Q B;  2ZM6 L;  3NK9 A;  2OXP A;  1PTO H;  3VA7 A;  3EA6 A;  1LTG D;  1LTB D;  2QEJ C;  1GHK A;  3G4S A;  4WJ4 A;  2WAC A;  4MHE A;  4KHP L;  2R7D A;  1EZ6 A;  2G9H D;  4ZUJ A;  5FLX L;  1T5X D;  1HNW L;  1NE3 A;  2F0I A;  1K8A C;  4A3J H;  1I3Q B;  3S2H H;  2E76 C;  2KEE A;  1CTM A;  4N8F A;  2LY7 A;  5ELF A;  1YI2 A;  4JV5 Q;  1ENC A;  2PCF B;  1LTR D;  2K50 A;  2SOB A;  4X62 Q;  1PYB A;  4DV2 Q;  1B44 D;  3CC2 A;  3TZU A;  1ZXT A;  2B8F A;  4JG2 A;  1HNZ L;  2X69 A;  5DM6 3;  1PFB A;  4OEL B;  1EWC A;  1YNJ C;  4XT3 B;  4APV A;  3P20 A;  1XJV A;  2NZ1 D;  1Z7T A;  1Z6H A;  3HOZ G;  3URY A;  1EQV A;  4AYB G;  2WIN B;  4GZY C;  1L1O A;  3OTO Q;  3EJI A;  5CYU A;  1FJG L;  3TZD A;  5IP9 H;  1O7Z A;  2A68 D;  3TP7 A;  2F52 A;  4X3U A;  3VYU A;  2MPM A;  2IHE A;  1SXT A;  4K6D A;  1K3B C;  4CKB A;  1N34 Q;  2XTI A;  3UDG A;  1QWY A;  3G48 A;  1DCZ A;  4MZ9 A;  5ELB A;  5DAU A;  2XN9 C;  3OIQ A;  3LWU A;  2B39 A;  1CHQ D;  2AQ1 B;  4EQN A;  1IL2 A;  2AMC B;  2WAQ B;  2R93 H;  2VL6 A;  1XNR Q;  1U4R A;  1XWE A;  2NTT A;  3P1H A;  1EUJ A;  3IAY A;  2QA4 A;  1EYD A;  3K57 A;  3NPP A;  5ELE A;  1GOZ A;  4DV5 Q;  3UE1 A;  2NN6 I;  2B29 A;  4PZ7 A;  2X6L A;  4LW1 A;  5A2Q L;  4N9P A;  3M85 A;  5E4W C;  4B3S L;  4B9W A;  1BQQ T;  4RHS A;  3QR8 A;  1OXX K;  4PMC A;  4CBV A;  1TT2 A;  1UEA B;  2YU9 B;  5D3I B;  4CKE A;  2IHF A;  4IQZ A;  3U4V A;  1NMF A;  3L0O A;  3I91 A;  3SK8 A;  1J9O A;  3CCS A;  1EY4 A;  1F77 A;  2BOS A;  3T56 B;  4BY1 G;  3S1R B;  3OOC A;  2KA7 A;  4R4O A;  4GN4 B;  3S14 H;  1C9O A;  2RA4 A;  4LF7 Q;  3MFY A;  4DAP A;  5LMN L;  2LSS A;  3DLL A;  2K5D A;  1SMY D;  1YEZ A;  3JAM L;  4BS9 A;  1IBK L;  3J7A 5;  1TWC H;  1I6H H;  3QB3 A;  2E2J B;  3DHQ A;  1RTN A;  5EGT A;  4NXM Q;  2BH8 A;  1XTC D;  3UDI A;  3OMG A;  4X64 L;  2ZM6 Q;  1CSP A;  4QIW B;  4RMF A;  1OTC A;  1N9W A;  2JA6 B;  2ZXR A;  1SDF A;  1PV4 A;  1BF4 A;  3GTM H;  4WJW A;  1PYS B;  3J81 E;  1Q8I A;  4HIO A;  3AMU A;  1WD0 A;  1HZA A;  4KHP Q;  5C3W A;  1VQB A;  1HNW Q;  4X3T A;  4C3I H;  1VQE A;  2JK8 A;  2XWJ B;  3H09 A;  1QCB D;  2JA7 B;  1MHW C;  1U5K A;  4IOA A;  1IBL L;  4ULL A;  1GUT A;  5IT9 c;  1O7L A;  1TXY A;  4NMZ A;  3FDT A;  3GTP H;  4A3K G;  2DN8 A;  4S3S A;  3FKI G;  3RLN A;  1H9S B;  5C4X H;  4IJL A;  1D2B A;  4XDX A;  3WDN A;  2Z4I A;  1HNZ Q;  1YJW A;  2EIF A;  5M3M G;  1Q86 C;  2PZT A;  1MSH A;  3D4R A;  1CQV A;  4UY8 C;  3J81 i;  4FYD A;  1PRT F;  2R3Z A;  3A55 A;  3I4M H;  3S1N B;  2EPB A;  1CFM A;  1ONL A;  3R2I A;  1ENF A;  3WWV A;  1LT5 D;  1NSN S;  1SYD A;  2F3I A;  4L5T A;  2QKI C;  1FJG Q;  3Q23 A;  2IX3 A;  2VNU D;  3SHL A;  1STH A;  1UE7 A;  1LV9 A;  1VQJ A;  2OF1 A;  3FEW X;  3TME A;  2NVQ B;  1I50 H;  2ZXO A;  3N6R A;  2NUC A;  5EPL A;  1D7Q A;  3PCO B;  5H1S E;  3GTQ B;  4HSP A;  3MXN A;  2EY5 A;  2JA5 H;  1TQO A;  1K73 C;  1FR3 A;  1DGS A;  4A3E B;  4ZQ3 A;  3UE0 A;  3A0J A;  4FF1 A;  3GTO B;  1LTI D;  1WTO A;  1QIL A;  2WAQ G;  2D0O A;  1NJI C;  2N88 A;  3CME A;  3H6M A;  3HOV G;  2AQ2 B;  3L9A X;  3Q0A A;  4X6A H;  2QDB A;  3GTL B;  4X3S A;  4A93 B;  1CZG A;  5IP9 G;  1TS4 A;  4B3S Q;  3PMF A;  2QGQ A;  1B70 B;  2K6A A;  4JOI C;  4PMB A;  1BNZ A;  4QQB X;  1N8R C;  5CBE E;  4V0B A;  1PFM A;  3E9I A;  1VQA A;  4ID6 A;  2F0O A;  2RHS B;  1NBW A;  2K4K A;  1D1I A;  1EIH A;  1B9M A;  1Y1V H;  3RZD B;  1SNO A;  4KV6 A;  1HQM C;  4ZAI A;  5FJ8 H;  3BZK A;  5LMN Q;  4A3B H;  1SYE A;  5G3L D;  1WTW A;  3AFP A;  1X6O A;  4HAE A;  1WTQ A;  2QDL A;  4DR6 L;  2DY7 A;  1IBK Q;  2B2Y A;  2V1C C;  1XPU A;  4DV7 L;  1TS2 A;  2EYH A;  2Y0S B;  3OSO A;  3KYH C;  1NR2 A;  3CC7 A;  2PQE A;  4LF5 L;  1FNV A;  3AYH B;  3A56 A;  4X64 Q;  5C0X H;  2CWP A;  1VQL A;  3NUC A;  3PSI A;  1X3Q A;  2EYP A;  1QJO A;  5T1I A;  5I6Y A;  1PHJ A;  1O78 A;  4FXK C;  1F2Z A;  2WII B;  2ZTE A;  2Z4H A;  2Q2I A;  3DM1 A;  2JA6 G;  4UP7 A;  4BY7 B;  4OGQ C;  2EXZ A;  1KLG D;  2PNH A;  1A63 A;  2D0P A;  2B8G A;  1GKH A;  1TR5 A;  1BCP B;  1PRT D;  1RHP A;  1IBL Q;  1CA5 A;  1X32 A;  4KLK A;  2MFI A;  2EYO A;  3KUP A;  1PH8 A;  2KVM A;  5IP7 H;  3GTG H;  5LMN W;  2UUA L;  1HJP A;  2EVB A;  2ES2 A;  4JI4 L;  4PG3 A;  3W1B A;  5EKI A;  3KBX A;  2F3W A;  1QB5 D;  3Q8D A;  3J7Y W;  1U4M A;  3O13 A;  5C4Z A;  2HT1 A;  1K3R A;  3WOE A;  2PZU A;  1HXY D;  4JVZ A;  5CV4 A;  3CQZ B;  1XNQ L;  5CV8 A;  1PH2 A;  3S24 A;  3HOY H;  3PUZ A;  3AU7 A;  1YNN C;  4CGY B;  2B2T C;  2RDF A;  3KBG A;  4GOP B;  1JCK B;  2L0C A;  1OXS C;  3OW2 A;  1JB7 A;  1VDZ A;  4IUU A;  3A7A B;  5ELN A;  2F0Q A;  2NVX H;  4HSV A;  1PH9 A;  3U4Z A;  1B1Z A;  3QWN A;  1B9N A;  1C48 A;  1ILQ A;  3NSW A;  3A8J E;  1IYJ B;  4A3E G;  4EQ5 A;  2SDF A;  1BCP C;  1UAP A;  4XQJ A;  1ML0 D;  1Q46 A;  1P16 A;  2P5Z X;  3I72 A;  3BVG A;  4A3G H;  1OO9 B;  3I56 A;  2DNE A;  1C4Q A;  1SE8 A;  3FP9 A;  4X66 L;  1VQP A;  3CRK C;  1C7Y A;  2F0V A;  1V8Q A;  3VYT A;  3FRP B;  4XT1 B;  2M2L A;  1SFO B;  3M4O H;  2K52 A;  3KLS X;  1XXG A;  3NWS A;  3HFZ B;  5J22 A;  1K8G A;  4DAY B;  2ZXP A;  1CHP D;  1W3S A;  2GA4 B;  1VS0 A;  4KHV A;  4HCS A;  4DR3 L;  3MXG A;  1HNX L;  1FNU A;  2HQE A;  2EJF C;  1ILP A;  4IJH A;  3U50 C;  4RGN A;  1VQH A;  4G7Z C;  4WFN 3;  4DR6 Q;  2XIW A;  5IGC A;  5J1Z A;  2IW3 A;  4U68 A;  2B63 B;  2N8N A;  4CDE C;  1A62 A;  2A73 B;  4DV7 Q;  4GNX A;  2E75 C;  4KN4 C;  2PQA B;  4ME3 A;  2LMC B;  4LF5 Q;  1RL2 A;  1HZ9 A;  2K03 A;  3T1Y L;  2FJ2 A;  5EAY A;  4CHT B;  5C44 G;  2F0L A;  4OEM B;  4BBR H;  4JCV E;  5JEA H;  4RG1 A;  1SYG A;  5M5Y H;  1WOC A;  3J81 L;  3VR3 A;  4ILW A;  3PQI A;  4AQY L;  3S1M B;  1S4Z A;  1K0S A;  2F0W A;  1ROD A;  4OIJ A;  4DK1 A;  5I2Y A;  5I9O A;  4A4I A;  4DGZ A;  5A2Q E;  4V19 0;  1JIC A;  3MEH A;  1MJC A;  2PI2 A;  3GDE A;  4OO1 I;  4BY7 G;  2IT1 A;  2RDH A;  4A3B G;  2C35 B;  3EBE A;  4G57 A;  4YCU A;  3NTI A;  3H0G B;  2IX1 A;  2Z6K C;  3KF8 B;  2K33 A;  4JPB W;  3S17 H;  5D3D A;  3GO5 A;  2WB1 B;  5AJ3 L;  3KDF B;  2HIV A;  2AUK A;  3AFQ A;  2Q2T A;  1G6Z A;  2FMC A;  1J5E L;  5M3F H;  2K01 A;  3OIP A;  5C0X G;  3P75 A;  4RA8 A;  1HZB A;  1AE3 A;  2PNR C;  1F2M A;  4HTH A;  2UUA Q;  5EKL A;  1CI3 M;  4JI4 Q;  3BYT B;  1Y1W H;  1EOT A;  1LO5 D;  5KNC A;  4DV1 L;  2NVT B;  3F2C A;  4UP8 A;  1JOO A;  1VQO A;  1VQ9 A;  5JJK A;  4IAL A;  1CKM A;  1EWI A;  4HCE A;  2AHO B;  4UPA A;  4A3L G;  3V96 A;  4C3J H;  2L1B A;  2K75 A;  1F9Q A;  1YBY A;  4U67 3;  1XNQ Q;  4NW2 A;  1ESR A; 
#chains in the Genus database with same CATH homology
 3C2P A;  2ENB A;  1NCV A;  1H9J A;  1S5E D;  5I2X A;  3N52 A;  2O2L D;  3IKJ A;  5K36 H;  2R92 B;  2F0U A;  5COY A;  5FK9 C;  2A74 C;  5C0X J;  4CJ1 B;  1AZQ A;  1T5E A;  1RCV D;  1DON A;  3PO2 B;  1BCP F;  4QMG A;  2NWG A;  1XYI A;  4H7B A;  3R93 A;  1CQF A;  1K8O A;  4K5X A;  1AEX A;  4I7Z C;  5DNF A;  1HHV A;  3R3O A;  4Z9C B;  1KDC A;  4RAU C;  3W2D A;  1FYC A;  3CRL C;  1WTP A;  1SNP A;  2EYL A;  2OEO A;  4M8A A;  4Q5V A;  4DAV A;  3PIP 3;  2R61 A;  3K58 A;  1TS5 A;  1RD9 D;  3NE5 B;  5EPJ A;  3NQI A;  5JVH 3;  5M5X B;  3HGB A;  3T16 A;  3VR5 A;  2M9V A;  4BBS B;  4YIJ A;  1SEB D;  4ZK9 B;  5KIX A;  3BZD B;  4EGV A;  3HOW B;  4TQU S;  2R6G A;  3HEJ A;  4J8Q A;  1DXM A;  4K2K A;  1STG A;  3MZ5 A;  1I4R A;  1IKM A;  4FVM A;  3DEP A;  5CC4 A;  5KYI A;  1E0B A;  1STY A;  1D5M C;  1EY7 A;  4XYO A;  4FXD A;  2PZW A;  1LAB A;  2BA1 A;  1GJX A;  4Q0F A;  1KAB A;  1EY9 A;  2PO4 A;  1S5D D;  1BCP D;  4J6H A;  1QOH A;  1JOQ A;  2FFK B;  3AB9 A;  1C8C A;  4K8J A;  1VF7 A;  1GHJ A;  1QG7 A;  4PMW A;  5FO8 B;  4B08 A;  2PW5 A;  2K5Q A;  5JEA J;  3K5L A;  2J7Z A;  4A3M B;  2XWB B;  4C3J G;  3K5O A;  2RDG A;  2F0G A;  4BA2 I;  2NBF A;  4IN3 A;  1WD1 A;  4ZYS A;  1IW7 C;  2L4N A;  4C3H B;  1CK1 A;  5K36 G;  1HTL D;  4HMI A;  3ERQ A;  2MP1 A;  1WCM B;  2EJM A;  5KEE A;  1DOK A;  1JB3 A;  3HG9 A;  3BDL A;  2B2U A;  4QB4 A;  5C5M A;  2X6G A;  4UDU C;  4NKL A;  1OXU A;  3MWY W;  3BS1 A;  4XXE A;  3MHB A;  1Y8O B;  3QOJ A;  1Y8P B;  4IFD H;  2EYF A;  4WOR A;  2FIN B;  1IHZ A;  3HP3 A;  2YYZ A;  4ABN A;  1HFG A;  1B53 A;  1PTO C;  1MD2 D;  3KK7 A;  3HOU B;  3HS0 C;  2TMP A;  1SND A;  2R93 B;  1UUP A;  3K6O A;  5M5W B;  3FPU B;  5EKK A;  2SEB D;  5G3L F;  2B2W C;  1W6K A;  1A6X A;  1B50 A;  3SR1 A;  3K5N A;  1AFP A;  5JPM C;  1I4X A;  3L7Z C;  3D31 A;  5KYL A;  1E2Z A;  1A3U A;  4JBW A;  4LJZ C;  3U9S A;  1RTO A;  4KTA A;  3S14 B;  3EQL C;  3OMC A;  4IUT A;  3Q22 A;  2CW0 C;  1HQR D;  4R8N A;  1I6H B;  1TWC B;  3T53 B;  4RKL A;  1VMC A;  3L3O C;  3OWE B;  5LHY 1;  3MXP A;  3EFX D;  3DWA A;  1JOR A;  2RBM A;  1JWU D;  3C3L A;  4RFB A;  1S5B D;  1LT4 D;  3IL8 A;  4L6T B;  1WTX A;  3GTM B;  1B3A A;  4K6L A;  1FNW A;  1KLU D;  4HR7 B;  4C3I B;  2B2V C;  4A3D B;  3SK4 A;  4FO2 A;  2A6E C;  3K7A B;  1F9P A;  1V1P B;  2QCP X;  3I3C A;  3ZYY X;  3RLF A;  2CQA A;  2IL8 A;  1IKL A;  1D1K A;  5E3F A;  2L5T A;  2XRQ D;  2JXM B;  2LS0 1;  3C1F A;  3C46 A;  3I4M B;  2BDN A;  2D2C C;  1KNA A;  3PO3 B;  2VB3 X;  3PUW A;  1LTS D;  3HZX A;  3LWE A;  4RHR A;  3QO2 A;  5FO9 B;  1SJH D;  5C3X A;  2M00 A;  1BXT A;  1D5X C;  1B2T A;  1I50 B;  5JAV A;  3D4W A;  3EVQ A;  3BVM A;  2JP1 A;  2F4I A;  2JA5 B;  1TY2 A;  4RH6 A;  5IIF A;  2BA0 A;  1ZYR C;  3E5S A;  5DEH A;  4H44 C;  4IFD G;  2F0F A;  5LL6 X;  4ZLT F;  2XSC A;  4R8I A;  4C56 C;  1AP0 A;  2EY1 A;  2A69 C;  5HUR A;  1KDA A;  1Q1B A;  5JVG 3;  1G91 A;  3D6C A;  1CA6 A;  1F9S A;  2K1B A;  1YNJ D;  5COR A;  1JOK A;  1SJE D;  3V05 A;  4DK0 A;  3HOX B;  5D14 A;  1IW7 D;  3PUV A;  2JSO A;  5IT9 L;  2EYM A;  3BYY B;  1BUV T;  1ESF A;  4KY6 A;  3OW7 A;  2OT2 A;  2L11 A;  4IFD J;  1VF5 C;  3BVZ A;  1STN A;  3T4A C;  2SNM A;  2F1M A;  3A8I E;  1G8Z D;  3I70 A;  5K5P A;  3MFG A;  4UAI A;  3TN2 A;  5LL6 S;  4OHJ A;  1DZ1 A;  5CV6 A;  2XNA C;  3GTK B;  4DXG A;  4KJO A;  1HA6 A;  4L63 B;  3MC0 B;  2KQ3 A;  2RVL A;  2LKV A;  3VR2 A;  4DF7 A;  1OXT A;  4TRD A;  4G4K A;  3MTS A;  2F3V A;  3GTG B;  5EBD A;  2K28 A;  1PTO D;  1ZKO A;  4FF3 A;  4CJ2 C;  3M7G A;  3A7L A;  1SAP A;  5EPK A;  3D8G A;  1PXU A;  1F9R A;  3RD4 A;  1M8A A;  3E0J A;  1TWG B;  3GV3 A;  3QOL A;  3D6W A;  5IGE A;  2O5J C;  2NVX B;  2MJ8 A;  3FPP A;  2IJ0 A;  1E2W A;  4KY5 A;  5IGD A;  4PQX A;  1I4P A;  4PV1 C;  1UNS A;  3S1Q B;  4RCO A;  1ICW A;  2CW0 D;  2F0D A;  1G2S A;  1S5F D;  1LT3 D;  4ODG A;  1LT6 D;  4K5W A;  2HCI A;  2JEB I;  1RJT A;  4K8I A;  3M4O B;  1Q12 A;  4J1M A;  2Q8R E;  5JOB A;  1AW7 A;  1I4Q A;  4RGO S;  1ET6 A;  1H9S A;  2KJX A;  4KN7 C;  1KNE A;  1STE A;  3D4D A;  4RWS C;  2EOT A;  1Y69 U;  4LMQ D;  2WP8 J;  4KKS A;  4G7H C;  2A6E D;  5BN3 A;  1NAP A;  3CHB D;  1HPC A;  4I65 A;  3M7N A;  3NXW A;  4IUN A;  2K5W A;  1EY5 A;  3GD7 A;  4BWG B;  5CMD A;  2HDM A;  3S17 B;  4DFA A;  1HRJ A;  3TBI B;  1EY0 A;  1W6J A;  3X3N A;  4QUF A;  4ZKB B;  3Q24 A;  1ET9 A;  1JWM D;  2E2H B;  1MGS A;  1EY6 A;  4A3I B;  1TWA B;  3TP8 A;  2EZV A;  1VMP A;  4E6I A;  3SK6 A;  4KY7 A;  2C9O A;  5A35 A;  1STB A;  3GQB A;  1ZYR D;  3V2T A;  2RSN A;  1L0Y B;  4RGT A;  3HOZ B;  4IUP A;  5FO7 B;  4AYB B;  2XRS D;  1KAA A;  2I46 A;  2AWN A;  3DMU A;  1V43 A;  1S5C D;  4RCN A;  2A69 D;  1AN8 A;  3R2T A;  2EJG C;  1L0X B;  2ICI A;  3ITP A;  3LX0 A;  4OO1 H;  1VCI A;  5J39 A;  3PIO 3;  5C3E B;  4K14 A;  2F0E A;  1PLF A;  3PV0 A;  4KJN A;  3PUY A;  4O1N A;  1HCZ A;  2B2T A;  3G6J B;  1SSO A;  2BE5 C;  4F7X A;  2K05 A;  3ERO A;  4IUV A;  3QIA A;  4RKB A;  1LTA D;  1I6V C;  2AUJ D;  1J8I A;  1BBX C;  3F2U A;  2A6H C;  1O7Y A;  2L12 A;  3OPO A;  2PW7 A;  1TWF B;  1STA A;  2QIL A;  5CV7 A;  4C1N I;  4C2M B;  1TKW B;  2MUY A;  2NYZ D;  1EYA A;  1LAC A;  1YNN D;  1PZK D;  2H1E A;  4PNY A;  1TVX A;  2VXW A;  1BOS A;  3J7A V;  2IX0 A;  2D62 A;  1K83 B;  5KNB A;  2Q8T A;  1RKN A;  4EQO A;  3BG3 A;  3I8Z A;  1QE6 A;  1SBB B;  1U4L A;  5NUC A;  1BO0 A;  1EY8 A;  1HUM A;  2Z1C A;  4FXG C;  5CR3 A;  2CVR A;  1IYV A;  1GUN A;  1LLR D;  1WTR A;  2PPB C;  5IT9 E;  3S16 B;  4A3K B;  5TSS A;  4CJ0 B;  3FKI B;  1R9T B;  2F0P A;  3MXU A;  1PTO B;  5M3M B;  2WV6 D;  5C4J B;  5CGK A;  3TSS A;  2KUM A;  5IGG A;  1PRT C;  2JE6 I;  2B2Y C;  1EEF D;  2RQX A;  2HCC A;  2F0K A;  2E74 C;  1IL8 A;  3CU7 A;  3VA5 A;  1PDQ A;  1G2T A;  4DAY A;  5JJZ A;  4OL7 A;  2J0T D;  4A3J B;  3S2H B;  3GV6 A;  3SDZ A;  4KK7 A;  1I4G A;  1KTK A;  2BDO A;  2H4O A;  4QUC A;  2Q8I B;  5M9O A;  2L55 A;  4L8J A;  3C1E A;  1EIG A;  4XQN A;  2ICE C;  5CV5 A;  1A2T A;  1TII D;  2KED A;  1D6E C;  2BCO A;  3HOV B;  2KEC A;  4KKU A;  5T1G A;  5FOB B;  2AWO A;  1AZP A;  1V1O A;  1MBY A;  3T13 A;  1SNQ A;  3KF8 A;  3M3Y B;  3VR6 A;  4OO1 G;  1MSG A;  1H9K A;  1PFN A;  4MIU A;  4XTC S;  5EJW A;  1SNC A;  2JYO A;  4DU9 A;  4FF4 A;  3H3V C;  3FMC A;  4LAA A;  2ZT9 C;  5I6W A;  3NHH A;  3TP5 A;  5EQ0 A;  3OWF A;  1HA5 A;  4KD3 A;  3S9W A;  3VYS A;  1FD7 D;  4IUR A;  2C5C A;  3S2D B;  1LTT D;  1II3 A;  4XQQ A;  3SXH A;  1FGB D;  3NTK A;  1DYQ A;  5ELC A;  4HED A;  2DNC A;  5C0X I;  1OXV A;  1A3T A;  2F0N A;  2QF7 A;  1R4P B;  3A8K E;  4C1N K;  2FMM A;  1MI2 A;  1H9M A;  1EWH A;  1TWH B;  1Q3L A;  2EYJ A;  4C3H G;  5IOC A;  1JWS D;  3GTJ B;  3T51 B;  4DA2 A;  4K5V A;  2F0S A;  1X3P A;  4CKC A;  2NN6 H;  4M1U B;  2V4D A;  5EBC A;  3GTP B;  2E2D C;  1A2U A;  2BE5 D;  1DOM A;  1GXD C;  5C4X B;  4RGM A;  5AFW A;  1EYC A;  1JR0 D;  3LNN A;  3J80 E;  2A6H D;  4DNR B;  1Q90 A;  4TSS A;  4EVO A;  2JEA I;  4DN4 M;  1DOL A;  3DXJ C;  3U9O A;  4O42 A;  2MHV A;  2A5H A;  4HN7 A;  1PTO F;  1Q1E A;  5KRU A;  1BDO A;  3ND8 A;  2Z8L A;  4DNT B;  3KLS A;  1WVL A;  1GUG A;  3NBH A;  3MA2 B;  1EEI D;  4JK1 C;  3IFD A;  5C4H A;  1QNK A;  2K04 A;  1SE3 A;  5CV9 A;  4NDX A;  5I4D A;  5ISR A;  4G7O C;  2MGS A;  2HDL A;  5C44 B;  5KGU A;  1DM0 B;  1ZEQ X;  2I07 B;  4F87 A;  5IOD A;  1Y1V B;  4A3B B;  1GUS A;  1GUW A;  3R8B A;  1H9R A;  2L9H A;  3SK5 A;  1SYC A;  1PZI D;  1O80 A;  4FNF A;  4H13 C;  2EY2 A;  2EY6 A;  1F2Y A;  5IGB A;  2KOL A;  1G29 1;  3X3M A;  3BDC A;  3I90 A;  2RKS A;  2WKD A;  1JC7 A;  1K8M A;  4IZ8 A;  2F03 A;  3SE0 A;  4C3I G;  3MAQ A;  1EFI D;  2PYK A;  1A15 A;  4EQP A;  3BDO A;  3SEB A;  2B2W A;  1CZW A;  5FLX E;  1DD2 A;  2N55 A;  1EQT A;  3D3R A;  3TP6 A;  2HUG A;  3H91 A;  4ZRZ A;  2EE1 A;  1TY0 A;  3I73 A;  2KCN A;  4ZKC B;  1ENA A;  4MN3 A;  3RUZ A;  1GUO A;  3E6Z X;  1EU3 A;  2NN6 G;  4DXF A;  3HOY B;  3NBI A;  2K7V A;  1SNM A;  3Q6S A;  3ONA B;  1Z47 A;  1U9R A;  4F88 A;  2E2I B;  4XIG S;  1TS3 A;  3ND9 A;  1IYU A;  2JA8 B;  2NB0 A;  2KHS A;  4ZUI A;  3TDQ A;  2O5I C;  3A54 A;  4XYQ A;  2IPK D;  4A3G B;  1PZJ D;  4WRD A;  3G7L A;  4NP5 A;  1SE2 A;  3H94 A;  3HRZ C;  2A68 C;  2K32 A;  3HKZ B;  3IFT A;  3DEO A;  1QNU A;  2DY8 A;  2B2V A;  3W3A A;  3NP8 A;  4KHZ A;  1CT1 D;  2PMZ B;  3I4N B;  1HUN A;  4K2L A;  3NQT A;  3NTH A;  4HMJ A;  4FP5 D;  2VB2 X;  4QCL A;  5KND A;  1SE4 A;  1I4H A;  1PMR A;  3K59 A;  4H0L C;  4KD4 A;  2J4X A;  2D5D A;  1D5Z C;  4QF4 A;  4A3F B;  4OIK A;  3S15 B;  4BA1 I;  5BN5 A;  4KKT A;  1SYF A;  1RDP D;  4BBR B;  3MVV A;  3P7J A;  5M5Y B;  3DWP A;  3JAM E;  3DWQ A;  1PYW D;  3M4Y A;  3UI2 A;  1M4V A;  1SYB A;  2AQ3 B;  3I4L A;  3VR4 A;  1EL0 A;  5F2D A;  2B2U C;  2F0T A;  1BR9 A;  1SMY C;  2LFN A;  5M3F B;  1JQY D;  5DM7 3;  4R9W A;  3K5M A;  2EDG A;  4LK1 C;  3J80 L;  5FKA C;  2F0M A;  1Y8N B;  1Y1W B;  1V1P A;  1JE4 A;  2ID0 A;  2WKC A;  1XX8 A;  1E2V A;  2SNS A;  3QG1 A;  4C3J B;  1F2L A;  1DJR D;  1NUC A;  1U4P A;  4N9T A;  4FF2 A;  1CM9 A;  1EU4 A;  3SVM A;  5D65 A;  3FVQ A;  4IUQ A;  1TU2 B;  2F0J A;  2IWH A;  2O4X A;  2R7Z B;  5E4X A;  3J7A F;  5BN4 A;  2NTS A;  2G9D A;  3WOF A;  3KLR A;  2D9U A;  1KDB A;  4KMU C;  5I9P A;  3RMH A;  3PUX A;  1HTP A;  1NR4 A;  4F8M A;  3GP7 A;  1HFN A;  4Y7N B;  4KI0 A;  4X3K A;  3QJY A;  5JPN C;  5C6A A;  3DUZ A;  1RF2 D;  1EZ8 A;  3VYR A;  2VUM B;  5HGT A;  3NWT A;  5ELD A;  3CKI B;  4BY1 B;  5E1F A;  2XVS A;  2F0H A;  5C5L A;  1PRT B;  5CBA E;  2NVY B;  4IFD I;  2TSS A;  2CHB D;  3RZO B;  5IGF A;  4TKO B;  1A3V A;  1WTV A;  4P2C B;  5JEA G;  4ME5 A;  3K0Y A;  2KCC A;  4B9X A;  1B4O A;  2FHT A;  2RSO A;  3OHX C;  1R4Q B;  3NK9 A;  2OXP A;  1PTO H;  3VA7 A;  3EA6 A;  1LTG D;  1LTB D;  2QEJ C;  1GHK A;  2WAC A;  4MHE A;  1EZ6 A;  2G9H D;  4ZUJ A;  5FLX L;  1T5X D;  2F0I A;  1I3Q B;  2E76 C;  2KEE A;  1CTM A;  2LY7 A;  5ELF A;  1ENC A;  2PCF B;  1LTR D;  2SOB A;  1B44 D;  3TZU A;  1ZXT A;  2B8F A;  2X69 A;  5DM6 3;  1PFB A;  1EWC A;  1YNJ C;  4XT3 B;  3P20 A;  2NZ1 D;  1Z7T A;  1Z6H A;  3URY A;  1EQV A;  2WIN B;  4GZY C;  3EJI A;  5CYU A;  3TZD A;  1O7Z A;  2A68 D;  3TP7 A;  4X3U A;  3VYU A;  2MPM A;  1SXT A;  4K6D A;  4CKB A;  1QWY A;  1DCZ A;  5ELB A;  5DAU A;  2XN9 C;  3OIQ A;  3LWU A;  2B39 A;  1CHQ D;  2AQ1 B;  4EQN A;  2WAQ B;  1U4R A;  1XWE A;  2NTT A;  3P1H A;  3IAY A;  1EYD A;  3K57 A;  3NPP A;  5ELE A;  1GOZ A;  2NN6 I;  2X6L A;  5A2Q L;  4N9P A;  3M85 A;  5E4W C;  4B9W A;  1BQQ T;  4RHS A;  1OXX K;  4PMC A;  4CBV A;  1TT2 A;  1UEA B;  2YU9 B;  5D3I B;  4CKE A;  4IQZ A;  3I91 A;  3SK8 A;  1J9O A;  1EY4 A;  1F77 A;  2BOS A;  3T56 B;  3S1R B;  3OOC A;  2KA7 A;  2RA4 A;  3MFY A;  4DAP A;  2K5D A;  1SMY D;  3JAM L;  4BS9 A;  3QB3 A;  2E2J B;  3DHQ A;  1RTN A;  5EGT A;  1XTC D;  3OMG A;  4QIW B;  2JA6 B;  2ZXR A;  1SDF A;  1BF4 A;  4WJW A;  3J81 E;  1Q8I A;  3AMU A;  1WD0 A;  5C3W A;  4X3T A;  2XWJ B;  3H09 A;  1QCB D;  2JA7 B;  4ULL A;  1GUT A;  1O7L A;  4NMZ A;  3FDT A;  2DN8 A;  4S3S A;  1H9S B;  1D2B A;  4XDX A;  3WDN A;  2Z4I A;  2PZT A;  1MSH A;  3D4R A;  1CQV A;  4FYD A;  1PRT F;  2R3Z A;  3A55 A;  3S1N B;  2EPB A;  1CFM A;  1ONL A;  3R2I A;  1ENF A;  1LT5 D;  1NSN S;  1SYD A;  2QKI C;  3Q23 A;  2IX3 A;  2VNU D;  3SHL A;  1STH A;  1LV9 A;  2OF1 A;  3FEW X;  3TME A;  2NVQ B;  2ZXO A;  3N6R A;  2NUC A;  5EPL A;  3GTQ B;  4HSP A;  3MXN A;  2EY5 A;  1TQO A;  1FR3 A;  4A3E B;  4ZQ3 A;  4FF1 A;  3GTO B;  1LTI D;  1WTO A;  1QIL A;  2N88 A;  3H6M A;  2AQ2 B;  3L9A X;  3Q0A A;  2QDB A;  3GTL B;  4X3S A;  4A93 B;  1CZG A;  1TS4 A;  3PMF A;  2K6A A;  4PMB A;  1BNZ A;  5CBE E;  4V0B A;  1PFM A;  4ID6 A;  2F0O A;  1D1I A;  1EIH A;  1B9M A;  3RZD B;  1SNO A;  4KV6 A;  1HQM C;  4ZAI A;  1SYE A;  5G3L D;  1WTW A;  1WTQ A;  4HAE A;  2DY7 A;  2B2Y A;  1TS2 A;  2EYH A;  2Y0S B;  3OSO A;  1NR2 A;  2PQE A;  1FNV A;  3A56 A;  5C0X H;  3NUC A;  1X3Q A;  2EYP A;  1QJO A;  5T1I A;  5I6Y A;  1O78 A;  4FXK C;  1F2Z A;  2WII B;  2Z4H A;  3DM1 A;  4BY7 B;  4OGQ C;  2EXZ A;  1KLG D;  2B8G A;  1TR5 A;  1BCP B;  1PRT D;  1RHP A;  1CA5 A;  1X32 A;  2EYO A;  3KUP A;  2KVM A;  2EVB A;  5EKI A;  3KBX A;  2F3W A;  1QB5 D;  3J7Y W;  1U4M A;  3O13 A;  5C4Z A;  3WOE A;  2PZU A;  1HXY D;  5CV4 A;  3CQZ B;  5CV8 A;  3PUZ A;  1YNN C;  3AU7 A;  4CGY B;  2B2T C;  2RDF A;  3KBG A;  1JCK B;  2L0C A;  1OXS C;  1VDZ A;  4IUU A;  3A7A B;  2F0Q A;  4HSV A;  1B1Z A;  3QWN A;  1B9N A;  1C48 A;  1ILQ A;  3NSW A;  3A8J E;  2SDF A;  1BCP C;  1UAP A;  4XQJ A;  1ML0 D;  3I72 A;  3BVG A;  1OO9 B;  2DNE A;  1C4Q A;  3CRK C;  2F0V A;  1V8Q A;  3VYT A;  3FRP B;  4XT1 B;  2M2L A;  1SFO B;  3KLS X;  1XXG A;  3NWS A;  5J22 A;  2ZXP A;  1CHP D;  2GA4 B;  4KHV A;  4HCS A;  3MXG A;  1FNU A;  2HQE A;  2EJF C;  1ILP A;  4RGN A;  4G7Z C;  4WFN 3;  2XIW A;  5IGC A;  5J1Z A;  2IW3 A;  4U68 A;  2B63 B;  2A73 B;  2E75 C;  4KN4 C;  2LMC B;  2K03 A;  2FJ2 A;  4CHT B;  2F0L A;  5JEA H;  1SYG A;  3J81 L;  3VR3 A;  4ILW A;  3S1M B;  1S4Z A;  2F0W A;  1ROD A;  4OIJ A;  4DK1 A;  5I2Y A;  5I9O A;  4DGZ A;  5A2Q E;  4V19 0;  1JIC A;  3MEH A;  4OO1 I;  2IT1 A;  2RDH A;  4G57 A;  3NTI A;  3H0G B;  2IX1 A;  2K33 A;  5D3D A;  3GO5 A;  2WB1 B;  2AUK A;  1G6Z A;  2FMC A;  2K01 A;  3OIP A;  5C0X G;  3P75 A;  4RA8 A;  2PNR C;  1F2M A;  4HTH A;  5EKL A;  1CI3 M;  3BYT B;  1EOT A;  1LO5 D;  5KNC A;  2NVT B;  1JOO A;  4IAL A;  4HCE A;  3V96 A;  2L1B A;  1F9Q A;  4U67 3;  4NW2 A;  1ESR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...