2NYZD

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the c- chemokine xcl1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
DKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein GAMMAHV.M3
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
molecule tags Viral protein/cytokine
total genus 7
structure length 61
sequence length 61
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nyzD00
5EKIA 1QE6A 4HCSA 1DZ1A 3KBXA 1HUMA 2KVMA 4MN3A 4U68A 2B2VC 2K05A 4CJ1B 1CA5A 1HHVA 4MHEA 3F2UA 1RTNA 5EQ0A 1HFNA 1NCVA 1BBXC 2M2LA 1WTPA 2RSNA 1GUWA 1J9OA 2KUMA 4X3UA 1U4PA 2NWGA 4OIKA 1KNAA 2K01A 2SDFA 3I90A 1ILQA 2BDNA 2MPMA 4IUTA 1G2SA 5EPLA 4QUCA 1XYIA 1BF4A 1WTOA 1NR2A 4LMQD 2B2UC 1MI2A 1IKMA 2X69A 1G2TA 2XIWA 1DOLA 4X3KA 1BNZA 4RA8A 1G6ZA 1HRJA 1PFNA 1TVXA 1EIHA 1F9PA 1U4LA 1B3AA 1DOKA 1U4RA 1X3QA 3DM1A 5COYA 2RVLA 1CA6A 1ICWA 2R3ZA 2HDMA 4R9WA 1QNKA 4UAIA 1AP0A 2J7ZA 3UI2A 1MGSA 4ZLTF 2FJ2A 1BO0A 2DY8A 1EL0A 1B53A 1PFBA 2HDLA 1SDFA 2L11A 2B2YA 3I8ZA 5EJWA 1SAPA 1HUNA 4ZKBB 1U4MA 2B2YC 2FINB 2RSOA 5CBAE 2L4NA 2EOTA 4XT1B 4ZKCB 1WTQA 1XX8A 2HCIA 2JP1A 4IUPA 4O42A 3TN2A 1F9QA 2D9UA 5JJZA 1NR4A 1MSGA 4IUUA 1PLFA 1CM9A 3TZDA 1AZQA 1AZPA 1IL8A 4IUVA 1WTWA 4X3SA 1DOMA 4ZAIA 4QUFA 2FHTA 5CMDA 3I91A 4IUQA 2MJ8A 1IKLA 3LWEA 1F9RA 1RTOA 2MP1A 4RWSC 2Q8TA 2NZ1D 1C8CA 2X6LA 1RODA 1PDQA 1F2LA 2L12A 3GV3A 3R93A 5CBEE 2KEEA 3I3CA 2L1BA 1RJTA 5E4WC 4R8IA 1WD1A 3SVMA 1B2TA 3ONAB 3HP3A 4HEDA 1S4ZA 1B4OA 2K03A 2H1EA 1JICA 1B50A 1NAPA 1VMCA 3FDTA 1PFMA 1WTRA 5T1IA 5EPJA 2B2WA 1M8AA 1F9SA 2EPBA 2MGSA 2K28A 2HCCA 3DEPA 4XT3B 2B2WC 2FMMA 4HAEA 4RAUC 1G91A 5D65A 1EIGA 3Q6SA 4ZK9B 2KEDA 3DEOA 4XDXA 3N52A 2VXWA 1HFGA 2IL8A 3P7JA 4IURA 1X3PA 2B2VA 3D6WA 1DONA 2EE1A 1O80A 2Q8RE 2RA4A 1QG7A 1MSHA 4DN4M 1HA6A 1EOTA 2KECA 5CORA 1X32A 2K1BA 3QO2A 1ZXTA 1LV9A 3MWYW 4NW2A 1WTVA 4OIJA 3H91A 2FFKB 2K04A 2JYOA 3IL8A 3KUPA 3MTSA 5EPKA 1EQTA 2HUGA 3G7LA 2X6GA 1O7YA 5T1GA 4CJ2C 3IFDA 3FPUB 4HSVA 1RHPA 1ESRA 1O7ZA 2B2UA 5AFWA 5E4XA 4CJ0B 1WD0A 1ILPA 1J8IA 3GV6A 1WTXA 5D14A 2NYZD 1A15A 2N55A 1E0BA 1VMPA 1SSOA 2N88A 5DNFA 1WVLA 2B2TA 1KNEA 2KOLA 2L9HA 2B2TC 1ML0D 2CVRA 1JE4A 2DY7A 1Q3LA 4X3TA
chains in the Genus database with same CATH superfamily
1X55A 1AEXA 2L0CA 1HQMC 4RGMA 2NB0A 5M3MH 1SMYC 4XQNA 1BBXC 4J8QA 3VR6A 2NWGA 4DF7A 1YHQA 3SK6A 4N8X1 4BS9A 5LMUL 4AYBG 1N8RC 3MEFA 2B63H 1PTOC 2EY6A 2HHHL 5IGEA 1PH3A 4BA2I 2AKWB 3W3AA 1CKOA 3VYSA 2ZM6Q 2WP8J 4KMUC 1VQIA 4TSSA 1EYGA 5IGBA 3STBC 2F3IA 2JA6G 3HOUB 4O0AA 2F4VL 3S14B 1IL2A 1SXTA 5E7NA 1PFSA 4QGUA 2KCTA 4UP7A 3GTOH 1VQCA 2Q2HA 3RZDH 1L0XB 3H94A 5BN5A 2LSSA 3T1HL 2F0PA 4A3FH 4DNTB 3W1GA 3I4MH 2D9UA 5M5WB 4DUYQ 2VQFQ 3AFQA 2FHTA 1A6XA 4GLXA 5G3LF 3OWEB 3ULLA 1IKLA 4A3KG 3SGIA 4K0KQ 4R4QA 1RODA 5CR3A 1V1PB 1UE1A 2AQ3B 2QEJC 5IYDG 4FP5D 1LLRD 2EJFC 3FHWA 4B08A 3FDTA 5JVG3 1HZBA 1STYA 4ZQ3A 2B2WC 4DR4Q 2HIXA 4JW0A 4K6DA 1AE2A 1K28A 1A0IA 1Q1EA 1QZHA 3KOJA 4EQPA 3PIOA 4LUZA 3HOXG 3CHBD 2LY7A 1IYJB 1QG7A 3I56A 1K3BC 1NMFA 1TWAB 2KHJA 2K1BA 3MWYW 2BA1A 2B8GA 4IO9A 3H91A 4F88A 4OELB 1GHJA 1RL2A 3KUPA 3IL8A 1U0LA 4NXNL 4LF4L 3CD6A 4WRDA 1HNWQ 1LT4D 1EY8A 2ZXRA 4JVZA 4DGZA 2A5HA 4JOIA 5C4ZA 4KY5A 1P16A 2N55A 1Y8OB 3NWTA 3A74A 4IJHA 1XMQQ 1YNND 1TWHB 2O2LD 4C2MH 2Y0SG 1U9RA 3RLOA 4OWTB 2MQHA 3PO2G 4QY7A 5FJ8H 1L2FA 4DV5L 1I4QA 2I5MX 1OXVA 1VQPA 1OXXK 1WTPA 2OEOA 1GUWA 4P71A 5ISRA 1DCZA 2RF4A 2WAQG 4OX9Q 1VQHA 3T53B 1D5XC 2A68C 2K01A 1XMOQ 4C3HB 4IUTA 3MA2B 1G2SA 5EPLA 4QUCA 4OL7A 3OPOA 5FLXc 4A3CG 1CHQD 2R7DA 1M90C 2SNSA 4AQYL 3J81c 3K81C 5FO8B 1BCPC 3R2IA 1F9PA 4DNRB 5KNCA 4JI0Q 4BXXH 3R2TA 1H95A 1ICWA 1V1PA 3BYTB 4DR6Q 1SMXA 4XTCS 3VR2A 5FO9B 5FLMG 2DUDA 2AHOB 4NXML 4KV6A 2E74C 3GTGB 1SDFA 3CPWA 3OIPA 4TVAB 1UEAB 2UUBL 5EBCA 2B29A 2ATWA 3A5UA 1NE3A 4B3TL 4LF8L 1SJED 3NUCA 4PMWA 1H9RA 1J5EL 3OOCA 2JA7G 1AE3A 4LF5L 3KJOA 1HPCA 1MSGA 4OEMB 2PZTA 3J81j 1WTWA 4JI4Q 5FO7B 3HOUH 2OT2A 4K8IA 2F0QA 3MC0B 3S14H 1JWUD 1MD2D 1HTPA 1PRTD 4ZYSA 3LX0A 1OXTA 3I3CA 2R7FA 1EZ6A 2E2HB 2WB1B 4GN4B 5M5WH 1VQEA 2VB2X 2QILA 4A3BB 1Y8NB 3DWQA 5DLQE 1EIYB 3TZUA 5C3EG 2C9OA 3NTKA 4HAEA 3TRZA 1BQQT 5CV7A 2VXWA 1UE7A 3D6WA 1UWVA 4WFN3 1AN8A 1B1ZA 5JEAJ 4X66L 5M5XB 1PVOA 2KBNA 2YU9B 3AU7A 2NTTA 2F0SA 3CC2A 2UXDQ 2LS01 2FFKB 2SEBD 2D5DA 5LMNL 3P1HA 3LGJA 4GKKQ 1F77A 4DAYB 2JA8G 4G4KA 1V8QA 2VS1A 5C0XH 4WJWA 1SMYD 2N88A 3VA7A 1H9MA 4JI7L 1Y1VG 4J15A 4F87A 2DY7A 1Q3LA 1TWAH 2A1AA 1KRTA 5IYBH 3CCJA 1EFWA 4KD3A 1VF7A 4GN3B 2B2VC 2A69C 3CP0A 3K8AA 3BVGA 1NCVA 1PTOD 3TS0A 1VQLA 1EFID 3CCSA 3PIO3 4JI3L 1ILQA 3STBD 1TWHH 1A8VA 3CAMA 3R3OA 4H7BA 1XYIA 4PQXA 4QIWB 4H02A 5ELOA 3VYTA 1IKMA 3VR5A 1R9TB 2XIWA 2HD3A 4DK6C 1FL0A 1YI2A 1DOKA 1X3QA 4FVMA 4L5TA 1STNA 2HDMA 1PV4A 3HOWG 5C4XG 3J80c 4C3HH 1I3QB 5JJLA 3TP6A 4GLAC 1Q82C 4B3RQ 2EJGC 2FINB 2NUCA 3K5OA 5KYLA 1FNVA 2I5HA 4IUPA 1G51A 1G291 4R4TA 1ONLA 4DV4L 4LFCL 5C44G 4ODGA 3A54A 1HH2P 4RWSC 3GTGH 1YNXA 4K5XA 3CMEA 3GTPB 4IQZA 1W6JA 2L12A 5IWAQ 5FK9C 4R8IA 2L1BA 5FLXL 3SVMA 1WCMB 5IYCH 2UXCQ 5IP9H 1B4OA 4DAYA 2KCMA 4DR5L 5K5PA 4K5WA 3J81L 2E76C 3MAQA 3F2BA 5T1IA 1WTRA 2EPBA 1F9SA 2OCEA 1H9SB 1EY7A 4V0BA 2LXJA 1JOQA 1VQFA 4O2DA 2KHSA 3P7JA 1GO3E 3CW2C 2Q8RE 2E2HH 3RR5A 3S1RB 4XYOA 3SDZA 1LV9A 1GM5A 4A3BH 1K0RA 4A3JG 2JYOA 3GTJB 5T1GA 2RQXA 4C56C 1MJCA 3FPPA 4N8FA 4A93B 1CFMA 2EYPA 4DR1Q 2IY5B 4ZUIA 1OO9B 1XPRA 3BYYB 3NEMA 4NPSA 4DV1L 2ICEC 4KHPL 2YU9H 2A68D 1AH9A 3G6EA 4BWGB 2JA5B 3H3VI 2PW7A 1N36Q 1YHAA 3FKIG 3PUYA 1Q8IA 2PQEA 2VW9A 3HOZB 1H9KA 4I7AA 1BCPD 2L15A 3CCEA 1A3TA 4GLVB 1MHWC 2VB3X 3PUXA 5J39A 1G2TA 2IX3A 4P75A 1VQ9A 1BNZA 2QDLA 2DGYA 1PH4A 3GTMB 3PUZA 2E75C 2TMPA 3S1MB 3HS0C 3S1NH 2QCPX 1SNPA 1CQFA 2L11A 3NP8A 4K0KL 1BBWA 1R9TH 1H9SA 4KHZA 2IX0A 3QR8A 2WB1E 1CTMA 1AZPA 4DR7Q 2C35B 2CH4A 2N3SA 4FO2A 1I3QH 2R92H 1RTOA 4DR4L 2E5LL 1PDQA 1V1OA 4XQQA 2UU9L 1UEBA 3I4OA 1LABA 3IFTA 3HP3A 4OHJA 2O5IC 2RDFA 2TSSA 3BG3A 3H15A 2MGSA 2MO1A 3B6YA 2E2DC 2EY2A 2OTJA 5J1ZA 3GTPH 1PH5A 1TWFH 3QJYA 3J80L 1SNDA 3K80C 1HFGA 5M9OA 2AUJD 3PCOB 1WCMH 1O80A 1SNCA 4OO1G 1VQ7A 5CV5A 1JOKA 1BCPF 1X32A 2Z0SA 1QCBD 3QO2A 1ZXTA 1SFOB 2R93G 3UE0A 3NHHA 2X6GA 3DHQA 2D0OA 2A69D 1HNXL 5HGQA 1I94Q 2EVBA 4JG2A 1WTXA 1EZ8A 2HT1A 1VQ5A 1SYGA 1EY9A 5C5MA 2MHVA 3WWVA 3HOVB 1XNQQ 3DMUA 4DV3Q 4X65Q 1QVGA 3NTHA 4KY6A 3S1RH 4CKCA 3S9WA 4GNXB 2BCOA 4QIWE 4DXFA 5IP7H 3DWAA 3GTJH 4FXDA 2WACA 1Z47A 4EQ5A 2XRQD 4RH6A 3S16B 4A93H 4C3JH 3FMCA 3NXWA 4ALPA 4BBRB 5M3MB 3CMAA 3K5MA 3I90A 3K57A 4N9PA 4PZ8A 5LL6S 4P72A 1FR3A 4GOPC 1BF4A 3I7FA 1IBML 1SRUA 2HQLA 4H13C 4HJ5A 2NN6G 3OMCA 2BH8A 4OO1I 2DNCA 1EY4A 1TVXA 2WINB 2ALYB 5AJ3Q 3DM1A 1FD7D 3SEBA 3HOZH 3OW2A 3SK5A 4Y52H 4JI4L 1MGSA 1HNZQ 1BR9A 3DXJC 4MNOA 1YNNC 2PNHA 2K6AA 5ELDA 1R4PB 2K5WA 1IZ6A 4A3EG 5CV8A 3GTOB 2ZTDA 2QKIC 5LMNW 1D1IA 2WIIB 3S1MH 5CMDA 2QGQA 3TP5A 4IUQA 1B8AA 1WOCA 4LNQA 4NMZA 1P8LA 3M4YA 5FKAC 3VYUA 1XNRQ 3ERQA 4A75A 5KNDA 4KKUA 4YCUA 3CU7A 4NKLA 3GQBA 1EY6A 4Z9CB 2CWAA 2NN6I 2JA6B 4JI1Q 1S5ED 1SBBB 3S2HB 1IBKL 2ID0A 2UXBQ 4GNXA 1FJGL 4DK1A 2IL8A 3M4OH 5HY6A 4HMJA 2RBMA 3I4NG 4A3DG 4B3ML 4KN7C 1EQRA 1T5XD 4X62Q 3F2DA 1LT5D 5CORA 2K50A 5H1SE 2KQ3A 3EFXD 2GN5A 1T5EA 4ZUJA 3TBIB 1K8OA 3OSOA 4A3KB 5EGTA 4EVOA 3TDQA 3OIQA 1ESRA 1VCIA 2AWNA 3GD7A 1EYCA 4JOIC 1Q12A 2NYZD 1E0BA 5DNFA 1SSOA 1JWMD 5ELCA 2KOLA 1ML0D 4JI5L 1HFNA 1BDOA 5E3FA 1QE6A 1EYDA 3K7UC 4H0LC 4MN3A 2VQEL 2F0DA 2EYJA 2IX1A 1VF5C 1GXDC 5EBDA 1VQAA 5IT9E 3NENA 2YYZA 3UE1A 3HOXB 3L2PA 3MXPA 3HG9A 3J7ZC 4LWCA 1MI2A 4JI6L 5GAGC 5M3FH 2A6EC 4IPCA 4DR3Q 2K14A 5BN3A 3S16H 1SEBD 3HRZC 2PPBC 4BBRH 2EDGA 1QNKA 2F0UA 3UI2A 1B44D 2YTYA 1K8MA 1YJWA 1N33Q 4M8AA 2ASBA 1B9MA 4GKJQ 3JC66 1SLJA 3KLRA 4POFA 4ZKBB 2KCCA 1EEID 5IWAL 3J81i 3PO2B 5KNBA 4DUZQ 3O13A 4X6AH 2HCIA 2JP1A 1CUKA 2YTVA 2CW0C 4WJ3M 2UXCL 2XN9C 2BA0A 1AZQA 1IL8A 1KAAA 5EAYA 3NE5B 4K2KA 2WAQB 2MJ8A 3RUZA 1SYDA 2F0LA 3DUZA 4DV0L 3P75A 2K5VA 3ZYYX 2JEAI 2ZTCA 4YHHL 4FF1A 1KTKA 2KEEA 3BS1A 2F0NA 3J7YW 4LF9Q 4HEDA 5I2XA 3VA5A 1JICA 3AQQA 1K8AC 2C5CA 4IFDJ 1CT1D 2ICIA 2JSOA 1VQ4A 1OXUA 3S24A 1G91A 3DEOA 1X56A 2G9HD 3A7AB 5C4JB 1QJOA 1DONA 4FNFA 4ID6A 3TEHB 1HZAA 1SE8A 1EOTA 1SYFA 2JA7B 1TS2A 4BBSG 2F52A 4CBVA 2JA6H 1I4PA 1LT6D 3S2HH 1O7YA 4A4IA 5BR8Q 1ILPA 3RD4A 2F3VA 1N36L 3T4AC 4YY3Q 1A15A 3RN5A 1X6OA 2EIFA 2Q2UA 2EYFA 2XNAC 1B50A 4HCSA 2R6GA 3AFPA 2A73B 4K6LA 4B3SL 3HKZG 2K05A 2K75A 5C3EB 4A3KH 2G9DA 1L1OB 1VQMA 4IOAA 2MUYA 2VUMG 1U5KA 1KLUD 5IYDH 4YCVA 3QOLA 3OW7A 3HOYG 2B2UC 1KIXA 1G6ZA 4OONA 5JEAG 1LT3D 4FXKC 1U4LA 3A5ZB 1U4RA 2IHFA 2JA9A 2JA8B 4R9WA 2RKSA 2I07B 4DR7L 3HOXH 1ZYRC 2DY8A 1Y1VB 4RCOA 1EU3A 4AYBE 3RNUA 1TR5A 4A3GG 2K5NA 1XTCD 4UHVA 3NWSA 3MXNB 1Z6HA 3J80i 4RMFA 1IYVA 1PYBA 3BZCA 4DAMA 2MFIA 4C3IG 3R93A 3JAME 1GUGA 4IPHA 3PO2H 1WD1A 1B2TA 1X9NA 3K5NA 2LXKA 4DR2Q 3GDEA 4JK1C 3KK7A 4NDXA 1FNWA 2HCCA 3HOWB 3GP7A 5HGTA 3BZDB 5C4XB 1TQOA 3L7ZC 2L55A 1TWCB 5DM73 3CPFA 4A3CH 3K6OA 4LF6Q 3ZJYC 3QB3A 3EVQA 1RCVD 1L1OA 4C1NI 4DN4M 1XNQL 1M4VA 2KECA 3T1YQ 3PF4A 1S5DD 2BDOA 5FLMH 3LNNA 3Q22A 5C44B 4HCEA 4G7HC 2IWHA 1O7ZA 1ENAA 2N49A 1GHKA 5C4JH 1JC7A 1EOVA 1KDCA 1LUZA 4IPGA 1E24A 3RMHA 3KJPA 4ME5A 3PIPA 4LF7L 2L9HA 4ULLA 1XTDA 2RCFA 3A7LA 3BDLA 3H0GG 2JA7H 1D1KA 2ZJRA 1S3OA 4LUOA 1PH6A 3TS2A 4HIDA 1VS0A 2CH4W 2EYMA 3HGBA 1C7YA 4GZYC 5K36G 4A76A 4ME3A 3DLLA 3L9AX 1J9OA 5AJ3L 4G57A 2DJGC 3W1BA 2A6ED 1BBUA 1OXSC 2JN4A 3PGZA 2UUAL 1Z7TA 5A35A 3D4WA 4JCVE 4I65A 4POGA 3MXNA 2Y0SE 3PV0A 4LFBQ 1LTID 4J6HA 2VNUD 3MXUA 3PF5A 2PZUA 5I6WA 5C3EH 4A3JB 1BCPB 2K32A 2HQEA 1CA6A 3ICEA 2R3ZA 4A3LG 2WAQE 2CW0D 4DV7L 4BA1I 1NUCA 1CQVA 3BVMA 2B2YA 3PUVA 1PTOH 1W2BA 3GTLH 5ELNA 2EXDA 3X3NA 3S1NB 1QZGA 3T16A 5GADC 4KJNA 3A8JE 3V05A 3OHXC 3VDYA 4G7ZC 4DA2A 5JJZA 2R7ZG 1NR4A 3NTIA 4A3MG 1JJGA 2JA8H 3FKIB 1PRTF 4K2LA 3TSSA 5LHY1 3M7NA 1X65A 4DV2L 5IGFA 3TREA 1Y1VH 1C8CA 4J1MA 1H9JA 2V1CC 1HR0Q 2UXBL 2I46A 2UUCQ 4JPBW 1JB3A 2R92B 2K7VA 4IOCA 4MTNA 5A2QE 2O5JC 1X3GA 2G5DA 2K03A 4JI2Q 2QDBA 4X62L 4L5SA 1PFMA 2KHIA 1ENFA 3C1FA 3Q8DA 4XT3B 4ZRZA 3EROA 4DV6Q 4XDXA 1KC8C 4L8JA 3G4SA 1PH7A 2L5TA 1GVPA 2RA4A 5C5LA 2PYKA 3X3MA 1F2YA 2LKVA 4JYAQ 3RN2A 1TWFB 4PV1C 1HTLD 1EEFD 3OTOL 3HOWH 1IBLL 1SROA 3AB9A 5C4XH 3HKSA 4P73A 1IXRA 1SE2A 1TWCH 3IKJA 4HJAA 1J8IA 1G6PA 5CGKA 3S2DB 3CXCA 4LFAQ 3MFGA 4PZ7A 2B2TA 1D5MC 2J0TD 3LWUA 2NZOA 2N78A 5EKIA 4QB4A 1LTBD 2VY3A 1PTOF 1ZEQX 3U9SA 4RGTA 2F0OA 1WYDA 1HHVA 1CA5A 5LMUQ 5C44H 3E3XA 1YBYA 4HTHA 5JOBA 1Y1WG 3K0YA 4RHRA 1SYCA 2KUMA 1MKHA 1NSNS 4LUVA 2NVYB 2FMCA 3A0JA 1B70B 3MHBA 2BDNA 1D5ZC 4B9WA 5JPMC 3H3VH 1Q1BA 1C9OA 5CV9A 5M5YH 4C3JB 3VR3A 2F4VQ 4IALA 1PZID 2HIVA 1ZYRD 1E7ZA 1QWYA 4QF4A 2R93B 2K5DA 2GVAA 1PFNA 5I9OA 1RIPA 5COYA 5JAVA 3Q0AA 3J7AF 1A2TA 2SOBA 1VQKA 2AQ1B 2JE6I 4CDCC 2KCNA 2ZM6L 3F2CA 3K5LA 2LMCB 1EYAA 5EJWA 5IODA 1HUNA 3T51B 1M1KC 2EYOA 1Q46A 4A3JH 1VQDA 1K83B 3T13A 3UDGA 4O1NA 4LF9L 4DK0A 1EWIA 1I4GA 4X3SA 4ZAIA 1NNXA 3LWEA 1K0SA 3NELA 2EZVA 3J7A5 3M7GA 2D0PA 4DUYL 2VQFL 2A6HC 1K3RA 5GAEC 1CZGA 2LFNA 4TQUS 1YNJC 1E1OA 1NAPA 4JI8Q 3FKIH 3KDFB 4JBJA 3PO3G 3VR4A 3OWFA 4ZK9B 2PMZB 4DAPA 4GNXC 5BR8L 4NXNQ 2B2VA 4LF4Q 2Z6BA 4A3EB 4AIMA 2QW7A 1K9MC 2K5QA 4CGYB 3C3LA 3M4OB 4C1NK 1WTVA 1PH2A 1CKMA 3I4LA 1X54A 5NUCA 5IT9c 1S5FD 1B9NA 4GS3A 1ZKOA 5E4XA 3SK4A 4CJ0B 3FEWX 3GV6A 1VMPA 4DV5Q 4IN3A 3KLSA 1HNWL 1KABA 1KDAA 1Q8KA 1AW7A 1XXGA 2KVMA 4U68A 3CC4A 4KKSA 1ENCA 1XMQL 3QIAA 3IRBA 3S2DH 3S17H 5ELFA 1KNAA 4AQYQ 5TSSA 3I4NB 4A3DB 3AMUA 4DPGA 1MIUA 5JVH3 1NR2A 4QJFA 4JBMA 1YJNA 1LO5D 4OX9L 4X3KA 4NXMQ 1Y14B 4S3SA 1ET9A 4KD4A 1XMOL 4FF3A 1B3AA 2UUBQ 4TRDA 4B3TQ 2NVYH 1J5EQ 5M3FB 4LF5Q 2JJQA 5DAUA 4IZ8A 1CSQA 4OO1H 1UE6A 5I2YA 4JI0L 5CBAE 3KDFA 1DJRD 4DR6L 2JA5G 2R93H 2EOTA 2QA4A 3TN2A 2VZAA 1BOSA 3ND9A 2EYLA 1D8LA 1QILA 2CHBD 3Q24A 2IHEA 1PHJA 3I91A 1FGBD 1B3QA 2Q8TA 2E2JB 1CZWA 4OWXB 1F2LA 1I4RA 4RHSA 2F0IA 1RJTA 1AFPA 4UP8A 1K83H 2BE5C 1SNOA 3D31A 5CYUA 1YJ9A 4DFAA 4JV5Q 1N34Q 3D6CA 4KTAA 3IAYA 3CF5A 3ER0A 3M4PA 4A3IG 2MO0A 4L5QA 2FMMA 4CKEA 3MVVA 1NBWA 3HFZB 2KEDA 2A8VA 1WI5A 4YWKA 1X3PA 4RGOS 5DM63 5LMNQ 4HN7A 2NN6H 2XTIA 4AYBB 2M9VA 3U4ZA 4NW2A 2DNEA 4JI7Q 5EPKA 5L37A 2RHSB 1S5CD 1QOHA 2E8GA 3E9IA 2PI2A 3N6RA 3CCUA 2UXDL 1EWHA 4YWMA 4A3EH 4DKAC 2WKDA 1KRSA 2I0QA 4GKKL 5D3DA 1DZ1A 3KBXA 1KQSA 2CQAA 3F8TA 4BY1G 4JI3Q 4FYDA 5EKLA 4FXGC 4KHVA 1E3PA 1YVCA 3K58A 4HJ7A 5LL6X 4IFDG 4X3UA 4QL5A 3TQYA 1FVIA 4GN5A 2F0KA 3VYRA 4HJ8A 2M00A 3EQLC 4HSPA 5ELBA 3SK8A 4GOPB 4WORA 1Y69U 4Q0FA 4BY7G 3M9BA 2V4DA 4BBSB 1DOLA 1VQ6A 2ENBA 4RCNA 5GAHC 4EQNA 3J7AV 1STBA 5CC4A 3AYHB 3HOVG 4RGNA 2J7ZA 5IT9L 3I4NH 1A3VA 4A3DH 3KLWA 3EA6A 1RDPD 3JAMc 2EY5A 5C3WA 4DV4Q 1K8GA 3ULJA 1PA6A 3U50C 2L4NA 1PH9A 1VQOA 1HR0L 3HKZB 1HZCA 1HJPA 1XX8A 1JMCA 1A2UA 5IE8A 3CCVA 2DN8A 2A6HD 2XGTA 3UDFA 1VQBA 4B9XA 5M3MG 2ZXPA 1RD9D 4JI2L 3AEVA 4B3RL 2VUMB 1JT8A 5D3IB 1YNJD 2ZTEA 1PZKD 2PMZE 5GQOA 1SJHD 4IFDI 1C48A 5G3LD 1GUOA 5CBEE 3HOYB 4UDUC 1GJXA 3K7AB 2A74C 1SNMA 1HQRD 2XRSD 2B63G 2Y0SB 1VMCA 1L0WA 4UY8C 1TKWB 1UUPA 5EPJA 1M8AA 2KA7A 2WFWA 2E2JH 3Q6SA 4KK7A 1CI3M 5KEEA 4XYQA 4YIJA 1NMGA 1QVFA 4LFAL 2F1MA 4A3GB 1L1OC 2ZJQA 2Z9HA 2OF1A 5J22A 1JJCB 4A3FG 4DV1Q 2I5LX 3MTSA 3I4MG 1S5BD 1WFQA 4KHPQ 4GOPA 4CDDC 3WDNA 1PRTB 1TY0A 4C3IB 2Z6KA 5C6AA 4R4CA 4HIKA 5C3XA 1UNSA 2RCNA 2F0WA 4HJ9A 4P74A 1NTGA 1SYEA 4DR1L 2PI2E 1YZ6A 4P2CB 1CKNB 4R1JA 4CKBA 3FP9A 1RTNA 4KLKA 3F1ZA 2EQSA 2JK8A 2IT1A 1PXUA 1JORA 2SDFA 1DD2A 3TP7A 2F03A 2N8NA 4Y7NB 3NQTA 1UE5A 1T9HA 1A62A 5BN4A 2AQ2B 4EX5A 2OQ0A 3G71A 5CV6A 3CCRA 1D2BA 2OQKA 4Q5VA 3K0XA 2RVLA 3D8GA 4DU9A 2K5HA 5EKKA 1YIJA 2FJ2A 1J6QA 1PFBA 1JB7A 1CSPA 3GTKB 3I8ZA 3H0GB 1SAPA 2B2YC 4BBSH 3GTQB 5FOBB 2E5LQ 3E0EA 1ESFA 1F9QA 1I4HA 3A55A 1PTOB 2UU9Q 3GTLB 4QUFA 2GVBA 4LK1C 2BE5D 1EQVA 5CV4A 4JI8L 2F3WA 5FJ8G 1I6HH 1TS5A 1VQGA 1OTCA 4EQOA 4HIOA 4OXPA 1EIFA 4QMGA 1S4ZA 3OMGA 2E2IB 4HIMA 1S72A 1JCKB 1YITA 3MZ5A 1ASYA 2NVTH 2VUMH 5ELEA 1BVSA 3OYYA 4BXXG 1HCZA 2XVSA 2ZJPA 4X64Q 3H3VC 1D6EC 3HEJA 2BOSA 3JAML 3I55A 3HOYH 4MIUA 1CKNA 3K7AH 2F0MA 1V43A 2ES2A 1PYSB 5JEAH 3U58A 1NJIC 1HNXQ 2R7ZB 2EXZA 4A3MB 2PW5A 5DEHA 3I72A 4OIJA 5F2DA 2K04A 3NSWA 4L5RC 4H44C 3G7LA 3FPUB 1QB5D 3HOUG 1RHPA 2JQOA 4DAVA 1WD0A 4DNIA 1YEZA 5D14A 3SXHA 2OXPA 4A3GH 5I4DA 2XWJB 3NBHB 2B2TC 2NVXB 1K73C 1IW7C 3U4VA 2KJXA 2H4OA 2DJFC 1I94L 1JJ2A 5EQ0A 1I5FA 3DM3A 1IBMQ 4DV3L 4X65L 2VL6A 1IYUA 2CCZA 4IUNA 3M3YB 4C3IH 1TXYA 3S1QB 1IHZA 3KF8B 2MPMA 1I4XA 3RLFA 3L3OC 4YWLA 2K33A 4DK3C 1VDZA 3HKZE 4N9TA 4NP5A 1KL9A 5M5YB 2QEXA 2RDHA 4UAIA 2JXMB 3PUWA 4OGQC 1GOZA 4Y7NH 2HDLA 5C0XG 3H6MA 4XXEA 3URYA 1PH1A 4UP9A 1LTLA 3KYHC 1TU2B 1HNZL 5KIXA 2Z1CA 1HXYD 4JBWA 4O42A 1CK1A 1SE4A 5IYBG 3H09A 1MJEA 1LTRD 2IPKD 3EJIA 3UDIA 2R61A 4R4IA 3L0OA 1Y1WB 4JV5L 2ZT9C 1N34L 3BU2A 3PMFA 3BDOA 1F9RA 1JQYD 3V96A 3GTKH 3H0GH 2EJMA 2B8FA 3GV3A 1FNUA 1TS3A 1VQ8A 2D62A 1F2MA 3TMEA 4LAAA 5IOCA 3GTQH 3V2TA 4U673 2EY1A 1IBKQ 1FJGQ 2H1EA 1I6VC 4RG1A 5K36H 2QF7A 4B3MQ 2B2WA 1XPUA 1N32Q 1STGA 3FRPB 4ZCKA 2PZWA 1XNRL 1BUVT 5D65A 3NBHA 1KAWA 3NBIA 1N9WA 2F0VA 1UAPA 2F0FA 5IIFA 2SNMA 2F0EA 4CDFC 4C3HG 5I6YA 2EE1A 1C4QA 4JI1L 5A2QL 1HA6A 2E2IH 5C0XI 1QVCA 2F0TA 2XWBB 4A3LH 2WV6D 3I2ZA 3KF8A 4JI5Q 3U9OA 2IJ0A 4QCLA 4PG3A 2CQOA 2B2UA 2VQEQ 3CCQA 3D3RA 1KNEA 2NBFA 1VQNA 5JJKA 1HR0W 1STAA 2RDGA 4F7XA 2B39A 4X3TA 3ND8A 2R7ZH 4A3MH 1E2ZA 4OWWB 1HUMA 3E9HA 5IYCG 3PO3B 4MHEA 1PH8A 1DYQA 3F2UA 5IP9G 1GUNA 1BKBA 1PYWD 2IW3A 2M2LA 3CCLA 4JI6Q 2PQAB 2NVXH 5C0XJ 5KRUA 1TT2A 1WTOA 3CC7A 1YHBA 3S17B 1ET6A 1TWGB 1V1QA 4QQBX 2Q2IA 2OWOA 2WB1G 1EIHA 4A3BG 1SE3A 3NK9A 3M3YH 3S1QH 4CHTB 2YV5A 1B7YB 2K52A 1ICFB 1DGSA 1EL0A 3G6JB 4HMIA 4DR3L 2HHHQ 1X3EA 2D2CC 2Q2TA 2PNRC 1KDBA 2NVQB 3CQZB 5FLXE 4ZKCB 1S40A 3UDXA 1MBYA 4DV0Q 3BDCA 4IUUA 1PLFA 3SHLA 1N33L 1GUSA 4YHHQ 3J81E 4GKJL 1DOMA 3ERSX 2PCFB 4HR7B 5IGGA 2Z4IA 2MNAA 2PO4A 3PQIA 4DUZL 1DM0B 3EIVA 2CWPA 3T1HQ 3W2DA 3KBGA 3PIP3 1I50B 1Y1WH 3WOEA 4RAUC 4M1UB 2J4XA 1KXLA 3QG1A 3A8IE 5M5XH 1W3SA 1VQJA 1STHA 3N52A 4IURA 4PZ6A 2OTLA 1G8ZD 1O7IA 3T56B 2A19A 1O78A 3D4DA 4LW1A 4K5VA 1RKNA 3BVZA 4KY7A 4L6TB 2PQAA 3ULPA 3HZXA 4PNYA 1WTHA 1IW7D 1GD7A 5AFWA 4B3SQ 4I7ZC 4NB3A 1WVLA 2R92G 1SN8A 4IJLA 1KD1C 4L63B 2H5XA 1QUQB 3NPPA 1LTAD 3R8BA 1E2WA 2FXQA 4EGVA 4YY3L 4A3IB 1EQQA 3MXGA 2JEBI 1FYCA 1GUTA 2AWOA 2BH2A 4OIKA 4IPDA 3KFUA 1JR0D 3S15B 4PMBA 2P5ZX 5JPNC 4LMQD 3QOJA 3RZOB 3D4RA 2X69A 1TY2A 1WCMG 1Y8PB 3PO3H 3EN2A 3E5SA 4RA8A 1SYBA 1Q7YC 1HRJA 1PMRA 1QNUA 4PMCA 1KHIA 3P20A 3A56A 1BO0A 1B53A 1SNQA 5KYIA 2F0HA 1E1TA 1U4MA 1TWGH 2ZXOA 4XT1B 1WTQA 1R4QB 4BY1B 1GKHA 4MTKA 5HURA 1CM9A 3TZDA 1EU4A 3SE0A 1SR3A 5IP7G 3JAMi 4ABNA 4KKTA 2O4XA 4FF4A 4A93G 3C1EA 4RKBA 4C3JG 3J80E 4LF8Q 4X64L 2NVQH 5IGDA 3CQZH 5E4WC 4BY7B 4K14A 3QWNA 3ONAB 3RLNA 3KF6B 1LTGD 1FGUA 2GA4B 1X3FA 3DEPA 2K28A 1STEA 3CKIB 1XJVA 4JC0A 1NY4A 5IY0A 2XSCA 1QUQA 2B3GA 3HOZG 4UPAA 1EY0A 1Q81C 3C2PA 1D7QA 4DR2L 1JWSD 4G7OC 1I50H 3G48A 2CKZB 3I70A 4LF7Q 4LF6L 1EQTA 3WOFA 5KGUA 4K8JA 1EWCA 3IFDA 4HSVA 1JOOA 3T1YL 2Z6KC 4X66Q 2JA5H 5E1FA 1EUJA 4WJ4A 2HUGA 2CVRA 1JE4A 2B63B 2UUAQ 2F0JA 5IGCA 4CJ1B 1ASZA 3BZKA 1TS4A 3DWPA 4YCWA 2RSNA 3E6ZX 1XWEA 4JBKA 4R8NA 1U4PA 1EY5A 1A3UA 4MZ9A 2YTXA 1LTTD 3W5OA 1C0AA 3A8KE 3GO5A 2F4IA 3GTMH 2F0GA 1E2VA 3RZDB 1Z9FA 2Z4HA 1TIID 4A3FB 1HA5A 3M85A 3K59A 4XQJA 4A3IH 4DV7Q 3I4MB 2CFMA 5J3BA 4V190 2NZHA 4KJOA 4KN4C 4CDEC 4KI0A 4LFBL 4FF2A 3S15H 2NTSA 4ZLTF 1E22A 4R4OA 3KF6A 4LJZC 1XPOA 3RZOH 2Q8IB 2RSOA 2WKCA 1LTSD 4DV2Q 3MEHA 3PSIA 1HZ9A 2Z8LA 3EBEA 4AH6A 4APVA 3ITPA 1N32L 2RHQB 2MP1A 3KLSX 2EYHA 5C4HA 4TKOB 3C46A 2NZ1D 2X6LA 3FVQA 1Q86C 2K4KA 3M4QA 5JJIA 1PZJD 3CRKC 1I6HB 4BY1H 4E6IA 4LFCQ 1DXMA 1WJJA 4IFDH 1AP0A 1A63A 1PRTC 3BJUA 1L0YB 5M3FG 4XIGS 2UUCL 5GROA 4FDBA 1EIGA 3SR1A 1O7LA 3NQIA 4DXGA 3Q23A 4BBRG 3D0FA 3OTOQ 1LM0A 1IBLQ 1SFOH 5I9PA 2NVTB 1LACA 1RF2D 4BY7H 4ILWA 1V9PA 2AMCB 4DR5Q 1II3A 1MSHA 4C2MB 3CRLC 4F8MA 4DV6L 3CCMA 3HOVH 1CHPD 2KENA 4RKLA 1LYLA 4CJ2C 1W6KA 4JYAL 1Q90A 3I73A 1JE5A 4RFBA 1KLGD 3E0JA 1F2ZA 2AUKA 3TP8A 3MFYA 1BXTA 4IUVA
chains in the Genus database with same CATH topology
1AEXA 2L0CA 1HQMC 4RGMA 2NB0A 1SMYC 4XQNA 1BBXC 4J8QA 3VR6A 2NWGA 4DF7A 3SK6A 4BS9A 1PTOC 2EY6A 5IGEA 4BA2I 3W3AA 3VYSA 2WP8J 4KMUC 4TSSA 5IGBA 3HOUB 3S14B 1SXTA 1L0XB 3H94A 5BN5A 2F0PA 4DNTB 2D9UA 5M5WB 2FHTA 1A6XA 5G3LF 3OWEB 1IKLA 1RODA 5CR3A 1V1PB 2AQ3B 2QEJC 4FP5D 1LLRD 2EJFC 4B08A 3FDTA 5JVG3 1STYA 4ZQ3A 2B2WC 4K6DA 1Q1EA 4EQPA 3CHBD 2LY7A 1QG7A 1TWAB 2K1BA 3MWYW 2BA1A 2B8GA 3H91A 4F88A 1GHJA 3KUPA 3IL8A 4WRDA 1LT4D 1EY8A 2ZXRA 4DGZA 2A5HA 5C4ZA 4KY5A 2N55A 1Y8OB 3NWTA 1YNND 1TWHB 2O2LD 1U9RA 1I4QA 1OXVA 1OXXK 1WTPA 2OEOA 1GUWA 5ISRA 1DCZA 3T53B 1D5XC 2A68C 2K01A 4C3HB 4IUTA 3MA2B 1G2SA 5EPLA 4QUCA 4OL7A 3OPOA 1CHQD 2SNSA 5FO8B 1BCPC 3R2IA 1F9PA 4DNRB 5KNCA 3R2TA 1ICWA 1V1PA 3BYTB 4XTCS 3VR2A 5FO9B 4KV6A 2E74C 3GTGB 1SDFA 3OIPA 1UEAB 5EBCA 1SJED 3NUCA 4PMWA 1H9RA 3OOCA 1HPCA 1MSGA 2PZTA 1WTWA 5FO7B 2OT2A 4K8IA 2F0QA 3MC0B 1JWUD 1MD2D 1HTPA 1PRTD 4ZYSA 3LX0A 1OXTA 3I3CA 1EZ6A 2E2HB 2WB1B 2VB2X 2QILA 4A3BB 1Y8NB 3DWQA 3TZUA 2C9OA 3NTKA 4HAEA 1BQQT 5CV7A 2VXWA 3D6WA 4WFN3 1AN8A 1B1ZA 5JEAJ 5M5XB 2YU9B 3AU7A 2NTTA 2F0SA 2LS01 2FFKB 2SEBD 2D5DA 3P1HA 1F77A 4G4KA 1V8QA 5C0XH 4WJWA 1SMYD 2N88A 3VA7A 1H9MA 4F87A 2DY7A 1Q3LA 4KD3A 1VF7A 2B2VC 2A69C 3BVGA 1NCVA 1PTOD 1EFID 3PIO3 1ILQA 3R3OA 4H7BA 1XYIA 4PQXA 4QIWB 3VYTA 1IKMA 3VR5A 1R9TB 2XIWA 1DOKA 1X3QA 4FVMA 1STNA 2HDMA 1I3QB 3TP6A 2EJGC 2FINB 2NUCA 3K5OA 5KYLA 1FNVA 4IUPA 1G291 1ONLA 4ODGA 3A54A 4RWSC 4K5XA 3GTPB 4IQZA 1W6JA 2L12A 5FK9C 4R8IA 2L1BA 5FLXL 3SVMA 1WCMB 1B4OA 4DAYA 5K5PA 4K5WA 3J81L 2E76C 3MAQA 1WTRA 5T1IA 2EPBA 1F9SA 1H9SB 1EY7A 4V0BA 1JOQA 2KHSA 3P7JA 2Q8RE 3S1RB 4XYOA 3SDZA 1LV9A 2JYOA 3GTJB 5T1GA 2RQXA 4C56C 3FPPA 4A93B 1CFMA 2EYPA 4ZUIA 1OO9B 3BYYB 2ICEC 2A68D 4BWGB 2JA5B 2PW7A 3PUYA 1Q8IA 2PQEA 3HOZB 1H9KA 1BCPD 1A3TA 2VB3X 3PUXA 5J39A 1G2TA 2IX3A 1BNZA 3GTMB 3PUZA 2E75C 2TMPA 3S1MB 3HS0C 2QCPX 1SNPA 1CQFA 2L11A 3NP8A 1H9SA 4KHZA 2IX0A 1CTMA 1AZPA 4FO2A 1RTOA 1PDQA 1V1OA 4XQQA 1LABA 3IFTA 3HP3A 4OHJA 2O5IC 2RDFA 2TSSA 3BG3A 2MGSA 2E2DC 2EY2A 5J1ZA 3J80L 3QJYA 1SNDA 1HFGA 5M9OA 2AUJD 1O80A 1SNCA 4OO1G 5CV5A 1JOKA 1BCPF 1X32A 1QCBD 3QO2A 1ZXTA 1SFOB 3NHHA 2X6GA 3DHQA 2A69D 2EVBA 1WTXA 1EZ8A 1SYGA 1EY9A 5C5MA 2MHVA 3HOVB 3DMUA 4KY6A 3NTHA 4CKCA 3S9WA 2BCOA 4DXFA 3DWAA 4FXDA 2WACA 1Z47A 2XRQD 4RH6A 3S16B 3FMCA 3NXWA 4BBRB 5M3MB 3K5MA 3I90A 3K57A 4N9PA 5LL6S 1FR3A 1BF4A 4H13C 2NN6G 3OMCA 4OO1I 2DNCA 1EY4A 1TVXA 2WINB 3DM1A 1FD7D 3SEBA 3SK5A 1MGSA 1BR9A 3DXJC 1YNNC 2K6AA 5ELDA 1R4PB 2K5WA 5CV8A 3GTOB 2QKIC 1D1IA 2WIIB 5CMDA 3TP5A 4IUQA 4NMZA 3M4YA 5FKAC 3VYUA 3ERQA 5KNDA 4KKUA 3CU7A 4NKLA 3GQBA 1EY6A 4Z9CB 2NN6I 2JA6B 1S5ED 1SBBB 3S2HB 2ID0A 4DK1A 2IL8A 4HMJA 2RBMA 4KN7C 1T5XD 1LT5D 5CORA 2KQ3A 3EFXD 4ZUJA 1T5EA 3TBIB 1K8OA 3OSOA 4A3KB 5EGTA 4EVOA 3TDQA 3OIQA 1ESRA 1VCIA 2AWNA 3GD7A 1EYCA 1Q12A 2NYZD 1E0BA 5DNFA 1SSOA 1JWMD 5ELCA 2KOLA 1ML0D 1HFNA 1BDOA 5E3FA 1QE6A 1EYDA 4H0LC 4MN3A 2F0DA 2EYJA 2IX1A 1VF5C 1GXDC 5EBDA 5IT9E 2YYZA 3HOXB 3MXPA 3HG9A 1MI2A 2A6EC 5BN3A 1SEBD 3HRZC 2PPBC 2EDGA 1QNKA 2F0UA 3UI2A 1B44D 1K8MA 4M8AA 1B9MA 3KLRA 4ZKBB 2KCCA 1EEID 3PO2B 5KNBA 3O13A 2HCIA 2JP1A 2CW0C 2XN9C 2BA0A 1AZQA 1IL8A 1KAAA 3NE5B 4K2KA 2WAQB 2MJ8A 3RUZA 1SYDA 2F0LA 3DUZA 3P75A 3ZYYX 2JEAI 4FF1A 1KTKA 2KEEA 3BS1A 2F0NA 3J7YW 4HEDA 5I2XA 3VA5A 1JICA 2C5CA 4IFDJ 1CT1D 2ICIA 2JSOA 1OXUA 1G91A 3DEOA 2G9HD 3A7AB 5C4JB 1QJOA 1DONA 4FNFA 4ID6A 1EOTA 1SYFA 2JA7B 1TS2A 4CBVA 1I4PA 1LT6D 1O7YA 1ILPA 3RD4A 2F3VA 3T4AC 1A15A 2EYFA 2XNAC 1B50A 4HCSA 2R6GA 2A73B 4K6LA 2K05A 5C3EB 2G9DA 2MUYA 1KLUD 3QOLA 3OW7A 2B2UC 1G6ZA 5JEAG 1LT3D 4FXKC 1U4LA 1U4RA 2JA8B 4R9WA 2RKSA 2I07B 1ZYRC 2DY8A 1Y1VB 4RCOA 1EU3A 1TR5A 1XTCD 3NWSA 1Z6HA 1IYVA 4C3IG 3R93A 3JAME 1GUGA 1WD1A 1B2TA 3K5NA 4JK1C 3KK7A 4NDXA 1FNWA 2HCCA 3HOWB 3GP7A 5HGTA 3BZDB 5C4XB 1TQOA 3L7ZC 2L55A 1TWCB 5DM73 3K6OA 3QB3A 3EVQA 1RCVD 4C1NI 4DN4M 1M4VA 2KECA 1S5DD 2BDOA 3LNNA 3Q22A 5C44B 4HCEA 4G7HC 2IWHA 1O7ZA 1ENAA 1GHKA 1JC7A 1KDCA 3RMHA 4ME5A 2L9HA 4ULLA 3A7LA 3BDLA 1D1KA 2EYMA 3HGBA 4GZYC 5K36G 1J9OA 3L9AX 4G57A 2A6ED 1OXSC 1Z7TA 5A35A 3D4WA 4I65A 3MXNA 3PV0A 1LTID 4J6HA 2VNUD 3MXUA 2PZUA 5I6WA 4A3JB 1BCPB 2K32A 2HQEA 1CA6A 2R3ZA 2CW0D 4BA1I 1NUCA 1CQVA 3BVMA 2B2YA 3PUVA 1PTOH 3X3NA 3S1NB 3T16A 4KJNA 3A8JE 3V05A 3OHXC 4G7ZC 4DA2A 5JJZA 1NR4A 3NTIA 3FKIB 1PRTF 4K2LA 3TSSA 5LHY1 3M7NA 5IGFA 1C8CA 4J1MA 1H9JA 2I46A 1JB3A 2R92B 2K7VA 2O5JC 5A2QE 2K03A 2QDBA 1PFMA 1ENFA 3C1FA 4XT3B 4ZRZA 3EROA 4XDXA 4L8JA 2L5TA 2RA4A 5C5LA 2PYKA 3X3MA 1F2YA 2LKVA 1TWFB 4PV1C 1HTLD 1EEFD 3AB9A 1SE2A 3IKJA 1J8IA 5CGKA 3S2DB 3MFGA 2B2TA 1D5MC 2J0TD 3LWUA 5EKIA 4QB4A 1LTBD 1PTOF 1ZEQX 3U9SA 4RGTA 2F0OA 1HHVA 1CA5A 4HTHA 5JOBA 3K0YA 4RHRA 1SYCA 2KUMA 1NSNS 2NVYB 2FMCA 3MHBA 2BDNA 1D5ZC 4B9WA 5JPMC 1Q1BA 5CV9A 4C3JB 3VR3A 4IALA 1PZID 1ZYRD 1QWYA 4QF4A 2R93B 2K5DA 1PFNA 5I9OA 5COYA 5JAVA 3Q0AA 3J7AF 1A2TA 2SOBA 2AQ1B 2JE6I 2KCNA 3K5LA 2LMCB 1EYAA 5EJWA 5IODA 1HUNA 3T51B 2EYOA 1K83B 3T13A 4O1NA 4DK0A 1I4GA 4X3SA 4ZAIA 3LWEA 2EZVA 3M7GA 2A6HC 1CZGA 2LFNA 4TQUS 1YNJC 1NAPA 3VR4A 3OWFA 4ZK9B 2PMZB 4DAPA 2B2VA 4A3EB 2K5QA 4CGYB 3C3LA 3M4OB 4C1NK 1WTVA 3I4LA 5NUCA 1S5FD 1B9NA 1ZKOA 5E4XA 3SK4A 4CJ0B 3FEWX 3GV6A 1VMPA 4IN3A 3KLSA 1KABA 1KDAA 1AW7A 1XXGA 2KVMA 4U68A 4KKSA 1ENCA 3QIAA 5ELFA 1KNAA 5TSSA 3I4NB 4A3DB 3AMUA 5JVH3 1NR2A 1LO5D 4X3KA 4S3SA 1ET9A 4KD4A 4FF3A 1B3AA 4TRDA 5M3FB 5DAUA 4IZ8A 4OO1H 5I2YA 5CBAE 1DJRD 2EOTA 3TN2A 1BOSA 3ND9A 2EYLA 1QILA 2CHBD 3Q24A 3I91A 1FGBD 2Q8TA 2E2JB 1CZWA 1F2LA 1I4RA 4RHSA 2F0IA 1RJTA 1AFPA 2BE5C 1SNOA 3D31A 5CYUA 4DFAA 3D6CA 4KTAA 3IAYA 2FMMA 4CKEA 3MVVA 2KEDA 1X3PA 4RGOS 5DM63 4HN7A 2NN6H 4AYBB 2M9VA 4NW2A 2DNEA 5EPKA 1S5CD 1QOHA 3N6RA 1EWHA 2WKDA 5D3DA 1DZ1A 3KBXA 2CQAA 4FYDA 5EKLA 4FXGC 4KHVA 3K58A 5LL6X 4IFDG 4X3UA 2F0KA 3VYRA 2M00A 3EQLC 4HSPA 5ELBA 3SK8A 4WORA 1Y69U 4Q0FA 2V4DA 4BBSB 1DOLA 2ENBA 4RCNA 4EQNA 3J7AV 1STBA 5CC4A 4RGNA 2J7ZA 5IT9L 1A3VA 3EA6A 1RDPD 2EY5A 5C3WA 2L4NA 3HKZB 1XX8A 1A2UA 2DN8A 2A6HD 4B9XA 2ZXPA 1RD9D 2VUMB 5D3IB 1YNJD 1PZKD 1SJHD 4IFDI 1C48A 5G3LD 1GUOA 5CBEE 3HOYB 4UDUC 1GJXA 3K7AB 2A74C 1SNMA 1HQRD 2XRSD 2Y0SB 1VMCA 1TKWB 1UUPA 5EPJA 1M8AA 2KA7A 3Q6SA 4KK7A 1CI3M 5KEEA 4XYQA 4YIJA 2F1MA 4A3GB 2OF1A 5J22A 3MTSA 1S5BD 3WDNA 1PRTB 1TY0A 4C3IB 5C6AA 5C3XA 1UNSA 2F0WA 1SYEA 4P2CB 4CKBA 1RTNA 2IT1A 1PXUA 1JORA 2SDFA 1DD2A 3TP7A 2F03A 4Y7NB 3NQTA 5BN4A 2AQ2B 5CV6A 1D2BA 4Q5VA 2RVLA 3D8GA 4DU9A 5EKKA 2FJ2A 1PFBA 3GTKB 3I8ZA 3H0GB 1SAPA 2B2YC 3GTQB 5FOBB 1ESFA 1F9QA 1I4HA 3A55A 1PTOB 3GTLB 4QUFA 4LK1C 2BE5D 1EQVA 5CV4A 2F3WA 1TS5A 4EQOA 4QMGA 1S4ZA 3OMGA 2E2IB 1JCKB 3MZ5A 5ELEA 1HCZA 2XVSA 3H3VC 1D6EC 3HEJA 2BOSA 3JAML 4MIUA 2F0MA 1V43A 5JEAH 2R7ZB 2EXZA 4A3MB 2PW5A 5DEHA 3I72A 4OIJA 5F2DA 2K04A 3NSWA 4H44C 3G7LA 3FPUB 1QB5D 1RHPA 4DAVA 1WD0A 5D14A 3SXHA 2OXPA 5I4DA 2XWJB 2B2TC 2NVXB 1IW7C 2KJXA 2H4OA 5EQ0A 1IYUA 4IUNA 3M3YB 3S1QB 1IHZA 2MPMA 1I4XA 3RLFA 3L3OC 2K33A 1VDZA 4N9TA 4NP5A 5M5YB 2RDHA 4UAIA 2JXMB 3PUWA 4OGQC 1GOZA 2HDLA 5C0XG 3H6MA 4XXEA 3URYA 1TU2B 5KIXA 2Z1CA 1HXYD 4JBWA 4O42A 1SE4A 1CK1A 3H09A 1LTRD 2IPKD 3EJIA 1Y1WB 2R61A 2ZT9C 3PMFA 3BDOA 1F9RA 1JQYD 3V96A 2EJMA 2B8FA 3GV3A 1FNUA 1TS3A 2D62A 1F2MA 3TMEA 4LAAA 5IOCA 3V2TA 4U673 2EY1A 2H1EA 1I6VC 5K36H 2QF7A 2B2WA 1STGA 3FRPB 2PZWA 1BUVT 5D65A 3NBHA 3NBIA 2F0VA 1UAPA 2F0FA 5IIFA 2SNMA 2F0EA 4C3HG 5I6YA 2EE1A 1C4QA 5A2QL 1HA6A 5C0XI 2F0TA 2XWBB 2WV6D 3KF8A 3U9OA 2IJ0A 4QCLA 2B2UA 3D3RA 1KNEA 2NBFA 1STAA 2RDGA 4F7XA 2B39A 4X3TA 3ND8A 1E2ZA 1HUMA 3PO3B 4MHEA 1DYQA 3F2UA 1GUNA 1PYWD 2IW3A 2M2LA 5C0XJ 5KRUA 1TT2A 1WTOA 3S17B 1ET6A 1TWGB 1EIHA 1SE3A 3NK9A 4CHTB 1EL0A 3G6JB 4HMIA 2D2CC 2PNRC 1KDBA 2NVQB 3CQZB 5FLXE 4ZKCB 1MBYA 3BDCA 3SHLA 1PLFA 4IUUA 1GUSA 3J81E 1DOMA 2PCFB 4HR7B 5IGGA 2Z4IA 2PO4A 1DM0B 3W2DA 3KBGA 3PIP3 1I50B 3WOEA 4RAUC 4M1UB 2J4XA 3QG1A 3A8IE 1STHA 3N52A 4IURA 1G8ZD 3T56B 1O78A 3D4DA 4K5VA 1RKNA 3BVZA 4KY7A 4L6TB 3HZXA 4PNYA 1IW7D 5AFWA 4I7ZC 1WVLA 4L63B 3NPPA 1LTAD 3R8BA 1E2WA 4EGVA 4A3IB 3MXGA 2JEBI 1FYCA 1GUTA 2AWOA 4OIKA 1JR0D 3S15B 4PMBA 5JPNC 4LMQD 3QOJA 3RZOB 3D4RA 2X69A 1TY2A 1Y8PB 4RA8A 3E5SA 1HRJA 1SYBA 1PMRA 1QNUA 4PMCA 3P20A 3A56A 1BO0A 1B53A 1SNQA 5KYIA 2F0HA 1U4MA 2ZXOA 4XT1B 1WTQA 1R4QB 4BY1B 5HURA 1CM9A 3TZDA 1EU4A 3SE0A 4ABNA 4KKTA 2O4XA 4FF4A 3C1EA 4RKBA 4C3JG 3J80E 5IGDA 5E4WC 4BY7B 4K14A 3QWNA 3ONAB 1LTGD 2GA4B 3DEPA 2K28A 1STEA 3CKIB 2XSCA 1EY0A 3C2PA 1JWSD 4G7OC 3I70A 1EQTA 3WOFA 5KGUA 4K8JA 1EWCA 3IFDA 4HSVA 1JOOA 5E1FA 2HUGA 2CVRA 1JE4A 2B63B 2F0JA 5IGCA 4CJ1B 1TS4A 3DWPA 2RSNA 3E6ZX 1XWEA 4R8NA 1U4PA 1EY5A 1A3UA 1LTTD 3A8KE 3GO5A 2F4IA 2F0GA 1E2VA 3RZDB 2Z4HA 1TIID 4A3FB 1HA5A 3M85A 3K59A 4XQJA 3I4MB 4V190 4KJOA 4KN4C 4KI0A 4FF2A 2NTSA 4ZLTF 4LJZC 2Q8IB 2RSOA 2WKCA 1LTSD 3MEHA 2Z8LA 3ITPA 2MP1A 3KLSX 2EYHA 5C4HA 4TKOB 3C46A 2NZ1D 2X6LA 3FVQA 1PZJD 3CRKC 1I6HB 4E6IA 1DXMA 4IFDH 1AP0A 1PRTC 1L0YB 4XIGS 1EIGA 3SR1A 1O7LA 3NQIA 4DXGA 3Q23A 5I9PA 2NVTB 1LACA 1RF2D 4ILWA 1II3A 1MSHA 4C2MB 3CRLC 4F8MA 1CHPD 4RKLA 4CJ2C 1W6KA 1Q90A 3I73A 4RFBA 1KLGD 3E0JA 1F2ZA 2AUKA 3TP8A 3MFYA 1BXTA 4IUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKI A;  1QE6 A;  4HCS A;  1DZ1 A;  3KBX A;  1HUM A;  2KVM A;  4MN3 A;  4U68 A;  2B2V C;  2K05 A;  4CJ1 B;  1CA5 A;  1HHV A;  4MHE A;  3F2U A;  1RTN A;  5EQ0 A;  1HFN A;  1NCV A;  1BBX C;  2M2L A;  1WTP A;  2RSN A;  1GUW A;  1J9O A;  2KUM A;  4X3U A;  1U4P A;  2NWG A;  4OIK A;  1KNA A;  2K01 A;  2SDF A;  3I90 A;  1ILQ A;  2BDN A;  2MPM A;  4IUT A;  1G2S A;  5EPL A;  4QUC A;  1XYI A;  1BF4 A;  1WTO A;  1NR2 A;  4LMQ D;  2B2U C;  1MI2 A;  1IKM A;  2X69 A;  1G2T A;  2XIW A;  1DOL A;  4X3K A;  1BNZ A;  4RA8 A;  1G6Z A;  1HRJ A;  1PFN A;  1TVX A;  1EIH A;  1F9P A;  1U4L A;  1B3A A;  1DOK A;  1U4R A;  1X3Q A;  3DM1 A;  5COY A;  2RVL A;  1CA6 A;  1ICW A;  2R3Z A;  2HDM A;  4R9W A;  1QNK A;  4UAI A;  1AP0 A;  2J7Z A;  3UI2 A;  1MGS A;  4ZLT F;  2FJ2 A;  1BO0 A;  2DY8 A;  1EL0 A;  1B53 A;  1PFB A;  2HDL A;  1SDF A;  2L11 A;  2B2Y A;  3I8Z A;  5EJW A;  1SAP A;  1HUN A;  4ZKB B;  1U4M A;  2B2Y C;  2FIN B;  2RSO A;  5CBA E;  2L4N A;  2EOT A;  4XT1 B;  4ZKC B;  1WTQ A;  1XX8 A;  2HCI A;  2JP1 A;  4IUP A;  4O42 A;  3TN2 A;  1F9Q A;  2D9U A;  5JJZ A;  1NR4 A;  1MSG A;  4IUU A;  1PLF A;  1CM9 A;  3TZD A;  1AZQ A;  1AZP A;  1IL8 A;  4IUV A;  1WTW A;  4X3S A;  1DOM A;  4ZAI A;  4QUF A;  2FHT A;  5CMD A;  3I91 A;  4IUQ A;  2MJ8 A;  1IKL A;  3LWE A;  1F9R A;  1RTO A;  2MP1 A;  4RWS C;  2Q8T A;  2NZ1 D;  1C8C A;  2X6L A;  1ROD A;  1PDQ A;  1F2L A;  2L12 A;  3GV3 A;  3R93 A;  5CBE E;  2KEE A;  3I3C A;  2L1B A;  1RJT A;  5E4W C;  4R8I A;  1WD1 A;  3SVM A;  1B2T A;  3ONA B;  3HP3 A;  4HED A;  1S4Z A;  1B4O A;  2K03 A;  2H1E A;  1JIC A;  1B50 A;  1NAP A;  1VMC A;  3FDT A;  1PFM A;  1WTR A;  5T1I A;  5EPJ A;  2B2W A;  1M8A A;  1F9S A;  2EPB A;  2MGS A;  2K28 A;  2HCC A;  3DEP A;  4XT3 B;  2B2W C;  2FMM A;  4HAE A;  4RAU C;  1G91 A;  5D65 A;  1EIG A;  3Q6S A;  4ZK9 B;  2KED A;  3DEO A;  4XDX A;  3N52 A;  2VXW A;  1HFG A;  2IL8 A;  3P7J A;  4IUR A;  1X3P A;  2B2V A;  3D6W A;  1DON A;  2EE1 A;  1O80 A;  2Q8R E;  2RA4 A;  1QG7 A;  1MSH A;  4DN4 M;  1HA6 A;  1EOT A;  2KEC A;  5COR A;  1X32 A;  2K1B A;  3QO2 A;  1ZXT A;  1LV9 A;  3MWY W;  4NW2 A;  1WTV A;  4OIJ A;  3H91 A;  2FFK B;  2K04 A;  2JYO A;  3IL8 A;  3KUP A;  3MTS A;  5EPK A;  1EQT A;  2HUG A;  3G7L A;  2X6G A;  1O7Y A;  5T1G A;  4CJ2 C;  3IFD A;  3FPU B;  4HSV A;  1RHP A;  1ESR A;  1O7Z A;  2B2U A;  5AFW A;  5E4X A;  4CJ0 B;  1WD0 A;  1ILP A;  1J8I A;  3GV6 A;  1WTX A;  5D14 A;  2NYZ D;  1A15 A;  2N55 A;  1E0B A;  1VMP A;  1SSO A;  2N88 A;  5DNF A;  1WVL A;  2B2T A;  1KNE A;  2KOL A;  2L9H A;  2B2T C;  1ML0 D;  2CVR A;  1JE4 A;  2DY7 A;  1Q3L A;  4X3T A; 
#chains in the Genus database with same CATH topology
 1X55 A;  1AEX A;  2L0C A;  1HQM C;  4RGM A;  2NB0 A;  5M3M H;  1SMY C;  4XQN A;  1BBX C;  4J8Q A;  3VR6 A;  2NWG A;  4DF7 A;  1YHQ A;  3SK6 A;  4N8X 1;  4BS9 A;  5LMU L;  4AYB G;  1N8R C;  3MEF A;  2B63 H;  1PTO C;  2EY6 A;  2HHH L;  5IGE A;  1PH3 A;  4BA2 I;  2AKW B;  3W3A A;  1CKO A;  3VYS A;  2ZM6 Q;  2WP8 J;  4KMU C;  1VQI A;  4TSS A;  1EYG A;  5IGB A;  3STB C;  2F3I A;  2JA6 G;  3HOU B;  4O0A A;  2F4V L;  3S14 B;  1IL2 A;  1SXT A;  5E7N A;  1PFS A;  4QGU A;  2KCT A;  4UP7 A;  3GTO H;  1VQC A;  2Q2H A;  3RZD H;  1L0X B;  3H94 A;  5BN5 A;  2LSS A;  3T1H L;  2F0P A;  4A3F H;  4DNT B;  3W1G A;  3I4M H;  2D9U A;  5M5W B;  4DUY Q;  2VQF Q;  3AFQ A;  2FHT A;  1A6X A;  4GLX A;  5G3L F;  3OWE B;  3ULL A;  1IKL A;  4A3K G;  3SGI A;  4K0K Q;  4R4Q A;  1ROD A;  5CR3 A;  1V1P B;  1UE1 A;  2AQ3 B;  2QEJ C;  5IYD G;  4FP5 D;  1LLR D;  2EJF C;  3FHW A;  4B08 A;  3FDT A;  5JVG 3;  1HZB A;  1STY A;  4ZQ3 A;  2B2W C;  4DR4 Q;  2HIX A;  4JW0 A;  4K6D A;  1AE2 A;  1K28 A;  1A0I A;  1Q1E A;  1QZH A;  3KOJ A;  4EQP A;  3PIO A;  4LUZ A;  3HOX G;  3CHB D;  2LY7 A;  1IYJ B;  1QG7 A;  3I56 A;  1K3B C;  1NMF A;  1TWA B;  2KHJ A;  2K1B A;  3MWY W;  2BA1 A;  2B8G A;  4IO9 A;  3H91 A;  4F88 A;  4OEL B;  1GHJ A;  1RL2 A;  3KUP A;  3IL8 A;  1U0L A;  4NXN L;  4LF4 L;  3CD6 A;  4WRD A;  1HNW Q;  1LT4 D;  1EY8 A;  2ZXR A;  4JVZ A;  4DGZ A;  2A5H A;  4JOI A;  5C4Z A;  4KY5 A;  1P16 A;  2N55 A;  1Y8O B;  3NWT A;  3A74 A;  4IJH A;  1XMQ Q;  1YNN D;  1TWH B;  2O2L D;  4C2M H;  2Y0S G;  1U9R A;  3RLO A;  4OWT B;  2MQH A;  3PO2 G;  4QY7 A;  5FJ8 H;  1L2F A;  4DV5 L;  1I4Q A;  2I5M X;  1OXV A;  1VQP A;  1OXX K;  1WTP A;  2OEO A;  1GUW A;  4P71 A;  5ISR A;  1DCZ A;  2RF4 A;  2WAQ G;  4OX9 Q;  1VQH A;  3T53 B;  1D5X C;  2A68 C;  2K01 A;  1XMO Q;  4C3H B;  4IUT A;  3MA2 B;  1G2S A;  5EPL A;  4QUC A;  4OL7 A;  3OPO A;  5FLX c;  4A3C G;  1CHQ D;  2R7D A;  1M90 C;  2SNS A;  4AQY L;  3J81 c;  3K81 C;  5FO8 B;  1BCP C;  3R2I A;  1F9P A;  4DNR B;  5KNC A;  4JI0 Q;  4BXX H;  3R2T A;  1H95 A;  1ICW A;  1V1P A;  3BYT B;  4DR6 Q;  1SMX A;  4XTC S;  3VR2 A;  5FO9 B;  5FLM G;  2DUD A;  2AHO B;  4NXM L;  4KV6 A;  2E74 C;  3GTG B;  1SDF A;  3CPW A;  3OIP A;  4TVA B;  1UEA B;  2UUB L;  5EBC A;  2B29 A;  2ATW A;  3A5U A;  1NE3 A;  4B3T L;  4LF8 L;  1SJE D;  3NUC A;  4PMW A;  1H9R A;  1J5E L;  3OOC A;  2JA7 G;  1AE3 A;  4LF5 L;  3KJO A;  1HPC A;  1MSG A;  4OEM B;  2PZT A;  3J81 j;  1WTW A;  4JI4 Q;  5FO7 B;  3HOU H;  2OT2 A;  4K8I A;  2F0Q A;  3MC0 B;  3S14 H;  1JWU D;  1MD2 D;  1HTP A;  1PRT D;  4ZYS A;  3LX0 A;  1OXT A;  3I3C A;  2R7F A;  1EZ6 A;  2E2H B;  2WB1 B;  4GN4 B;  5M5W H;  1VQE A;  2VB2 X;  2QIL A;  4A3B B;  1Y8N B;  3DWQ A;  5DLQ E;  1EIY B;  3TZU A;  5C3E G;  2C9O A;  3NTK A;  4HAE A;  3TRZ A;  1BQQ T;  5CV7 A;  2VXW A;  1UE7 A;  3D6W A;  1UWV A;  4WFN 3;  1AN8 A;  1B1Z A;  5JEA J;  4X66 L;  5M5X B;  1PVO A;  2KBN A;  2YU9 B;  3AU7 A;  2NTT A;  2F0S A;  3CC2 A;  2UXD Q;  2LS0 1;  2FFK B;  2SEB D;  2D5D A;  5LMN L;  3P1H A;  3LGJ A;  4GKK Q;  1F77 A;  4DAY B;  2JA8 G;  4G4K A;  1V8Q A;  2VS1 A;  5C0X H;  4WJW A;  1SMY D;  2N88 A;  3VA7 A;  1H9M A;  4JI7 L;  1Y1V G;  4J15 A;  4F87 A;  2DY7 A;  1Q3L A;  1TWA H;  2A1A A;  1KRT A;  5IYB H;  3CCJ A;  1EFW A;  4KD3 A;  1VF7 A;  4GN3 B;  2B2V C;  2A69 C;  3CP0 A;  3K8A A;  3BVG A;  1NCV A;  1PTO D;  3TS0 A;  1VQL A;  1EFI D;  3CCS A;  3PIO 3;  4JI3 L;  1ILQ A;  3STB D;  1TWH H;  1A8V A;  3CAM A;  3R3O A;  4H7B A;  1XYI A;  4PQX A;  4QIW B;  4H02 A;  5ELO A;  3VYT A;  1IKM A;  3VR5 A;  1R9T B;  2XIW A;  2HD3 A;  4DK6 C;  1FL0 A;  1YI2 A;  1DOK A;  1X3Q A;  4FVM A;  4L5T A;  1STN A;  2HDM A;  1PV4 A;  3HOW G;  5C4X G;  3J80 c;  4C3H H;  1I3Q B;  5JJL A;  3TP6 A;  4GLA C;  1Q82 C;  4B3R Q;  2EJG C;  2FIN B;  2NUC A;  3K5O A;  5KYL A;  1FNV A;  2I5H A;  4IUP A;  1G51 A;  1G29 1;  4R4T A;  1ONL A;  4DV4 L;  4LFC L;  5C44 G;  4ODG A;  3A54 A;  1HH2 P;  4RWS C;  3GTG H;  1YNX A;  4K5X A;  3CME A;  3GTP B;  4IQZ A;  1W6J A;  2L12 A;  5IWA Q;  5FK9 C;  4R8I A;  2L1B A;  5FLX L;  3SVM A;  1WCM B;  5IYC H;  2UXC Q;  5IP9 H;  1B4O A;  4DAY A;  2KCM A;  4DR5 L;  5K5P A;  4K5W A;  3J81 L;  2E76 C;  3MAQ A;  3F2B A;  5T1I A;  1WTR A;  2EPB A;  1F9S A;  2OCE A;  1H9S B;  1EY7 A;  4V0B A;  2LXJ A;  1JOQ A;  1VQF A;  4O2D A;  2KHS A;  3P7J A;  1GO3 E;  3CW2 C;  2Q8R E;  2E2H H;  3RR5 A;  3S1R B;  4XYO A;  3SDZ A;  1LV9 A;  1GM5 A;  4A3B H;  1K0R A;  4A3J G;  2JYO A;  3GTJ B;  5T1G A;  2RQX A;  4C56 C;  1MJC A;  3FPP A;  4N8F A;  4A93 B;  1CFM A;  2EYP A;  4DR1 Q;  2IY5 B;  4ZUI A;  1OO9 B;  1XPR A;  3BYY B;  3NEM A;  4NPS A;  4DV1 L;  2ICE C;  4KHP L;  2YU9 H;  2A68 D;  1AH9 A;  3G6E A;  4BWG B;  2JA5 B;  3H3V I;  2PW7 A;  1N36 Q;  1YHA A;  3FKI G;  3PUY A;  1Q8I A;  2PQE A;  2VW9 A;  3HOZ B;  1H9K A;  4I7A A;  1BCP D;  2L15 A;  3CCE A;  1A3T A;  4GLV B;  1MHW C;  2VB3 X;  3PUX A;  5J39 A;  1G2T A;  2IX3 A;  4P75 A;  1VQ9 A;  1BNZ A;  2QDL A;  2DGY A;  1PH4 A;  3GTM B;  3PUZ A;  2E75 C;  2TMP A;  3S1M B;  3HS0 C;  3S1N H;  2QCP X;  1SNP A;  1CQF A;  2L11 A;  3NP8 A;  4K0K L;  1BBW A;  1R9T H;  1H9S A;  4KHZ A;  2IX0 A;  3QR8 A;  2WB1 E;  1CTM A;  1AZP A;  4DR7 Q;  2C35 B;  2CH4 A;  2N3S A;  4FO2 A;  1I3Q H;  2R92 H;  1RTO A;  4DR4 L;  2E5L L;  1PDQ A;  1V1O A;  4XQQ A;  2UU9 L;  1UEB A;  3I4O A;  1LAB A;  3IFT A;  3HP3 A;  4OHJ A;  2O5I C;  2RDF A;  2TSS A;  3BG3 A;  3H15 A;  2MGS A;  2MO1 A;  3B6Y A;  2E2D C;  2EY2 A;  2OTJ A;  5J1Z A;  3GTP H;  1PH5 A;  1TWF H;  3QJY A;  3J80 L;  1SND A;  3K80 C;  1HFG A;  5M9O A;  2AUJ D;  3PCO B;  1WCM H;  1O80 A;  1SNC A;  4OO1 G;  1VQ7 A;  5CV5 A;  1JOK A;  1BCP F;  1X32 A;  2Z0S A;  1QCB D;  3QO2 A;  1ZXT A;  1SFO B;  2R93 G;  3UE0 A;  3NHH A;  2X6G A;  3DHQ A;  2D0O A;  2A69 D;  1HNX L;  5HGQ A;  1I94 Q;  2EVB A;  4JG2 A;  1WTX A;  1EZ8 A;  2HT1 A;  1VQ5 A;  1SYG A;  1EY9 A;  5C5M A;  2MHV A;  3WWV A;  3HOV B;  1XNQ Q;  3DMU A;  4DV3 Q;  4X65 Q;  1QVG A;  3NTH A;  4KY6 A;  3S1R H;  4CKC A;  3S9W A;  4GNX B;  2BCO A;  4QIW E;  4DXF A;  5IP7 H;  3DWA A;  3GTJ H;  4FXD A;  2WAC A;  1Z47 A;  4EQ5 A;  2XRQ D;  4RH6 A;  3S16 B;  4A93 H;  4C3J H;  3FMC A;  3NXW A;  4ALP A;  4BBR B;  5M3M B;  3CMA A;  3K5M A;  3I90 A;  3K57 A;  4N9P A;  4PZ8 A;  5LL6 S;  4P72 A;  1FR3 A;  4GOP C;  1BF4 A;  3I7F A;  1IBM L;  1SRU A;  2HQL A;  4H13 C;  4HJ5 A;  2NN6 G;  3OMC A;  2BH8 A;  4OO1 I;  2DNC A;  1EY4 A;  1TVX A;  2WIN B;  2ALY B;  5AJ3 Q;  3DM1 A;  1FD7 D;  3SEB A;  3HOZ H;  3OW2 A;  3SK5 A;  4Y52 H;  4JI4 L;  1MGS A;  1HNZ Q;  1BR9 A;  3DXJ C;  4MNO A;  1YNN C;  2PNH A;  2K6A A;  5ELD A;  1R4P B;  2K5W A;  1IZ6 A;  4A3E G;  5CV8 A;  3GTO B;  2ZTD A;  2QKI C;  5LMN W;  1D1I A;  2WII B;  3S1M H;  5CMD A;  2QGQ A;  3TP5 A;  4IUQ A;  1B8A A;  1WOC A;  4LNQ A;  4NMZ A;  1P8L A;  3M4Y A;  5FKA C;  3VYU A;  1XNR Q;  3ERQ A;  4A75 A;  5KND A;  4KKU A;  4YCU A;  3CU7 A;  4NKL A;  3GQB A;  1EY6 A;  4Z9C B;  2CWA A;  2NN6 I;  2JA6 B;  4JI1 Q;  1S5E D;  1SBB B;  3S2H B;  1IBK L;  2ID0 A;  2UXB Q;  4GNX A;  1FJG L;  4DK1 A;  2IL8 A;  3M4O H;  5HY6 A;  4HMJ A;  2RBM A;  3I4N G;  4A3D G;  4B3M L;  4KN7 C;  1EQR A;  1T5X D;  4X62 Q;  3F2D A;  1LT5 D;  5COR A;  2K50 A;  5H1S E;  2KQ3 A;  3EFX D;  2GN5 A;  1T5E A;  4ZUJ A;  3TBI B;  1K8O A;  3OSO A;  4A3K B;  5EGT A;  4EVO A;  3TDQ A;  3OIQ A;  1ESR A;  1VCI A;  2AWN A;  3GD7 A;  1EYC A;  4JOI C;  1Q12 A;  2NYZ D;  1E0B A;  5DNF A;  1SSO A;  1JWM D;  5ELC A;  2KOL A;  1ML0 D;  4JI5 L;  1HFN A;  1BDO A;  5E3F A;  1QE6 A;  1EYD A;  3K7U C;  4H0L C;  4MN3 A;  2VQE L;  2F0D A;  2EYJ A;  2IX1 A;  1VF5 C;  1GXD C;  5EBD A;  1VQA A;  5IT9 E;  3NEN A;  2YYZ A;  3UE1 A;  3HOX B;  3L2P A;  3MXP A;  3HG9 A;  3J7Z C;  4LWC A;  1MI2 A;  4JI6 L;  5GAG C;  5M3F H;  2A6E C;  4IPC A;  4DR3 Q;  2K14 A;  5BN3 A;  3S16 H;  1SEB D;  3HRZ C;  2PPB C;  4BBR H;  2EDG A;  1QNK A;  2F0U A;  3UI2 A;  1B44 D;  2YTY A;  1K8M A;  1YJW A;  1N33 Q;  4M8A A;  2ASB A;  1B9M A;  4GKJ Q;  3JC6 6;  1SLJ A;  3KLR A;  4POF A;  4ZKB B;  2KCC A;  1EEI D;  5IWA L;  3J81 i;  3PO2 B;  5KNB A;  4DUZ Q;  3O13 A;  4X6A H;  2HCI A;  2JP1 A;  1CUK A;  2YTV A;  2CW0 C;  4WJ3 M;  2UXC L;  2XN9 C;  2BA0 A;  1AZQ A;  1IL8 A;  1KAA A;  5EAY A;  3NE5 B;  4K2K A;  2WAQ B;  2MJ8 A;  3RUZ A;  1SYD A;  2F0L A;  3DUZ A;  4DV0 L;  3P75 A;  2K5V A;  3ZYY X;  2JEA I;  2ZTC A;  4YHH L;  4FF1 A;  1KTK A;  2KEE A;  3BS1 A;  2F0N A;  3J7Y W;  4LF9 Q;  4HED A;  5I2X A;  3VA5 A;  1JIC A;  3AQQ A;  1K8A C;  2C5C A;  4IFD J;  1CT1 D;  2ICI A;  2JSO A;  1VQ4 A;  1OXU A;  3S24 A;  1G91 A;  3DEO A;  1X56 A;  2G9H D;  3A7A B;  5C4J B;  1QJO A;  1DON A;  4FNF A;  4ID6 A;  3TEH B;  1HZA A;  1SE8 A;  1EOT A;  1SYF A;  2JA7 B;  1TS2 A;  4BBS G;  2F52 A;  4CBV A;  2JA6 H;  1I4P A;  1LT6 D;  3S2H H;  1O7Y A;  4A4I A;  5BR8 Q;  1ILP A;  3RD4 A;  2F3V A;  1N36 L;  3T4A C;  4YY3 Q;  1A15 A;  3RN5 A;  1X6O A;  2EIF A;  2Q2U A;  2EYF A;  2XNA C;  1B50 A;  4HCS A;  2R6G A;  3AFP A;  2A73 B;  4K6L A;  4B3S L;  3HKZ G;  2K05 A;  2K75 A;  5C3E B;  4A3K H;  2G9D A;  1L1O B;  1VQM A;  4IOA A;  2MUY A;  2VUM G;  1U5K A;  1KLU D;  5IYD H;  4YCV A;  3QOL A;  3OW7 A;  3HOY G;  2B2U C;  1KIX A;  1G6Z A;  4OON A;  5JEA G;  1LT3 D;  4FXK C;  1U4L A;  3A5Z B;  1U4R A;  2IHF A;  2JA9 A;  2JA8 B;  4R9W A;  2RKS A;  2I07 B;  4DR7 L;  3HOX H;  1ZYR C;  2DY8 A;  1Y1V B;  4RCO A;  1EU3 A;  4AYB E;  3RNU A;  1TR5 A;  4A3G G;  2K5N A;  1XTC D;  4UHV A;  3NWS A;  3MXN B;  1Z6H A;  3J80 i;  4RMF A;  1IYV A;  1PYB A;  3BZC A;  4DAM A;  2MFI A;  4C3I G;  3R93 A;  3JAM E;  1GUG A;  4IPH A;  3PO2 H;  1WD1 A;  1B2T A;  1X9N A;  3K5N A;  2LXK A;  4DR2 Q;  3GDE A;  4JK1 C;  3KK7 A;  4NDX A;  1FNW A;  2HCC A;  3HOW B;  3GP7 A;  5HGT A;  3BZD B;  5C4X B;  1TQO A;  3L7Z C;  2L55 A;  1TWC B;  5DM7 3;  3CPF A;  4A3C H;  3K6O A;  4LF6 Q;  3ZJY C;  3QB3 A;  3EVQ A;  1RCV D;  1L1O A;  4C1N I;  4DN4 M;  1XNQ L;  1M4V A;  2KEC A;  3T1Y Q;  3PF4 A;  1S5D D;  2BDO A;  5FLM H;  3LNN A;  3Q22 A;  5C44 B;  4HCE A;  4G7H C;  2IWH A;  1O7Z A;  1ENA A;  2N49 A;  1GHK A;  5C4J H;  1JC7 A;  1EOV A;  1KDC A;  1LUZ A;  4IPG A;  1E24 A;  3RMH A;  3KJP A;  4ME5 A;  3PIP A;  4LF7 L;  2L9H A;  4ULL A;  1XTD A;  2RCF A;  3A7L A;  3BDL A;  3H0G G;  2JA7 H;  1D1K A;  2ZJR A;  1S3O A;  4LUO A;  1PH6 A;  3TS2 A;  4HID A;  1VS0 A;  2CH4 W;  2EYM A;  3HGB A;  1C7Y A;  4GZY C;  5K36 G;  4A76 A;  4ME3 A;  3DLL A;  3L9A X;  1J9O A;  5AJ3 L;  4G57 A;  2DJG C;  3W1B A;  2A6E D;  1BBU A;  1OXS C;  2JN4 A;  3PGZ A;  2UUA L;  1Z7T A;  5A35 A;  3D4W A;  4JCV E;  4I65 A;  4POG A;  3MXN A;  2Y0S E;  3PV0 A;  4LFB Q;  1LTI D;  4J6H A;  2VNU D;  3MXU A;  3PF5 A;  2PZU A;  5I6W A;  5C3E H;  4A3J B;  1BCP B;  2K32 A;  2HQE A;  1CA6 A;  3ICE A;  2R3Z A;  4A3L G;  2WAQ E;  2CW0 D;  4DV7 L;  4BA1 I;  1NUC A;  1CQV A;  3BVM A;  2B2Y A;  3PUV A;  1PTO H;  1W2B A;  3GTL H;  5ELN A;  2EXD A;  3X3N A;  3S1N B;  1QZG A;  3T16 A;  5GAD C;  4KJN A;  3A8J E;  3V05 A;  3OHX C;  3VDY A;  4G7Z C;  4DA2 A;  5JJZ A;  2R7Z G;  1NR4 A;  3NTI A;  4A3M G;  1JJG A;  2JA8 H;  3FKI B;  1PRT F;  4K2L A;  3TSS A;  5LHY 1;  3M7N A;  1X65 A;  4DV2 L;  5IGF A;  3TRE A;  1Y1V H;  1C8C A;  4J1M A;  1H9J A;  2V1C C;  1HR0 Q;  2UXB L;  2I46 A;  2UUC Q;  4JPB W;  1JB3 A;  2R92 B;  2K7V A;  4IOC A;  4MTN A;  5A2Q E;  2O5J C;  1X3G A;  2G5D A;  2K03 A;  4JI2 Q;  2QDB A;  4X62 L;  4L5S A;  1PFM A;  2KHI A;  1ENF A;  3C1F A;  3Q8D A;  4XT3 B;  4ZRZ A;  3ERO A;  4DV6 Q;  4XDX A;  1KC8 C;  4L8J A;  3G4S A;  1PH7 A;  2L5T A;  1GVP A;  2RA4 A;  5C5L A;  2PYK A;  3X3M A;  1F2Y A;  2LKV A;  4JYA Q;  3RN2 A;  1TWF B;  4PV1 C;  1HTL D;  1EEF D;  3OTO L;  3HOW H;  1IBL L;  1SRO A;  3AB9 A;  5C4X H;  3HKS A;  4P73 A;  1IXR A;  1SE2 A;  1TWC H;  3IKJ A;  4HJA A;  1J8I A;  1G6P A;  5CGK A;  3S2D B;  3CXC A;  4LFA Q;  3MFG A;  4PZ7 A;  2B2T A;  1D5M C;  2J0T D;  3LWU A;  2NZO A;  2N78 A;  5EKI A;  4QB4 A;  1LTB D;  2VY3 A;  1PTO F;  1ZEQ X;  3U9S A;  4RGT A;  2F0O A;  1WYD A;  1HHV A;  1CA5 A;  5LMU Q;  5C44 H;  3E3X A;  1YBY A;  4HTH A;  5JOB A;  1Y1W G;  3K0Y A;  4RHR A;  1SYC A;  2KUM A;  1MKH A;  1NSN S;  4LUV A;  2NVY B;  2FMC A;  3A0J A;  1B70 B;  3MHB A;  2BDN A;  1D5Z C;  4B9W A;  5JPM C;  3H3V H;  1Q1B A;  1C9O A;  5CV9 A;  5M5Y H;  4C3J B;  3VR3 A;  2F4V Q;  4IAL A;  1PZI D;  2HIV A;  1ZYR D;  1E7Z A;  1QWY A;  4QF4 A;  2R93 B;  2K5D A;  2GVA A;  1PFN A;  5I9O A;  1RIP A;  5COY A;  5JAV A;  3Q0A A;  3J7A F;  1A2T A;  2SOB A;  1VQK A;  2AQ1 B;  2JE6 I;  4CDC C;  2KCN A;  2ZM6 L;  3F2C A;  3K5L A;  2LMC B;  1EYA A;  5EJW A;  5IOD A;  1HUN A;  3T51 B;  1M1K C;  2EYO A;  1Q46 A;  4A3J H;  1VQD A;  1K83 B;  3T13 A;  3UDG A;  4O1N A;  4LF9 L;  4DK0 A;  1EWI A;  1I4G A;  4X3S A;  4ZAI A;  1NNX A;  3LWE A;  1K0S A;  3NEL A;  2EZV A;  3J7A 5;  3M7G A;  2D0P A;  4DUY L;  2VQF L;  2A6H C;  1K3R A;  5GAE C;  1CZG A;  2LFN A;  4TQU S;  1YNJ C;  1E1O A;  1NAP A;  4JI8 Q;  3FKI H;  3KDF B;  4JBJ A;  3PO3 G;  3VR4 A;  3OWF A;  4ZK9 B;  2PMZ B;  4DAP A;  4GNX C;  5BR8 L;  4NXN Q;  2B2V A;  4LF4 Q;  2Z6B A;  4A3E B;  4AIM A;  2QW7 A;  1K9M C;  2K5Q A;  4CGY B;  3C3L A;  3M4O B;  4C1N K;  1WTV A;  1PH2 A;  1CKM A;  3I4L A;  1X54 A;  5NUC A;  5IT9 c;  1S5F D;  1B9N A;  4GS3 A;  1ZKO A;  5E4X A;  3SK4 A;  4CJ0 B;  3FEW X;  3GV6 A;  1VMP A;  4DV5 Q;  4IN3 A;  3KLS A;  1HNW L;  1KAB A;  1KDA A;  1Q8K A;  1AW7 A;  1XXG A;  2KVM A;  4U68 A;  3CC4 A;  4KKS A;  1ENC A;  1XMQ L;  3QIA A;  3IRB A;  3S2D H;  3S17 H;  5ELF A;  1KNA A;  4AQY Q;  5TSS A;  3I4N B;  4A3D B;  3AMU A;  4DPG A;  1MIU A;  5JVH 3;  1NR2 A;  4QJF A;  4JBM A;  1YJN A;  1LO5 D;  4OX9 L;  4X3K A;  4NXM Q;  1Y14 B;  4S3S A;  1ET9 A;  4KD4 A;  1XMO L;  4FF3 A;  1B3A A;  2UUB Q;  4TRD A;  4B3T Q;  2NVY H;  1J5E Q;  5M3F B;  4LF5 Q;  2JJQ A;  5DAU A;  4IZ8 A;  1CSQ A;  4OO1 H;  1UE6 A;  5I2Y A;  4JI0 L;  5CBA E;  3KDF A;  1DJR D;  4DR6 L;  2JA5 G;  2R93 H;  2EOT A;  2QA4 A;  3TN2 A;  2VZA A;  1BOS A;  3ND9 A;  2EYL A;  1D8L A;  1QIL A;  2CHB D;  3Q24 A;  2IHE A;  1PHJ A;  3I91 A;  1FGB D;  1B3Q A;  2Q8T A;  2E2J B;  1CZW A;  4OWX B;  1F2L A;  1I4R A;  4RHS A;  2F0I A;  1RJT A;  1AFP A;  4UP8 A;  1K83 H;  2BE5 C;  1SNO A;  3D31 A;  5CYU A;  1YJ9 A;  4DFA A;  4JV5 Q;  1N34 Q;  3D6C A;  4KTA A;  3IAY A;  3CF5 A;  3ER0 A;  3M4P A;  4A3I G;  2MO0 A;  4L5Q A;  2FMM A;  4CKE A;  3MVV A;  1NBW A;  3HFZ B;  2KED A;  2A8V A;  1WI5 A;  4YWK A;  1X3P A;  4RGO S;  5DM6 3;  5LMN Q;  4HN7 A;  2NN6 H;  2XTI A;  4AYB B;  2M9V A;  3U4Z A;  4NW2 A;  2DNE A;  4JI7 Q;  5EPK A;  5L37 A;  2RHS B;  1S5C D;  1QOH A;  2E8G A;  3E9I A;  2PI2 A;  3N6R A;  3CCU A;  2UXD L;  1EWH A;  4YWM A;  4A3E H;  4DKA C;  2WKD A;  1KRS A;  2I0Q A;  4GKK L;  5D3D A;  1DZ1 A;  3KBX A;  1KQS A;  2CQA A;  3F8T A;  4BY1 G;  4JI3 Q;  4FYD A;  5EKL A;  4FXG C;  4KHV A;  1E3P A;  1YVC A;  3K58 A;  4HJ7 A;  5LL6 X;  4IFD G;  4X3U A;  4QL5 A;  3TQY A;  1FVI A;  4GN5 A;  2F0K A;  3VYR A;  4HJ8 A;  2M00 A;  3EQL C;  4HSP A;  5ELB A;  3SK8 A;  4GOP B;  4WOR A;  1Y69 U;  4Q0F A;  4BY7 G;  3M9B A;  2V4D A;  4BBS B;  1DOL A;  1VQ6 A;  2ENB A;  4RCN A;  5GAH C;  4EQN A;  3J7A V;  1STB A;  5CC4 A;  3AYH B;  3HOV G;  4RGN A;  2J7Z A;  5IT9 L;  3I4N H;  1A3V A;  4A3D H;  3KLW A;  3EA6 A;  1RDP D;  3JAM c;  2EY5 A;  5C3W A;  4DV4 Q;  1K8G A;  3ULJ A;  1PA6 A;  3U50 C;  2L4N A;  1PH9 A;  1VQO A;  1HR0 L;  3HKZ B;  1HZC A;  1HJP A;  1XX8 A;  1JMC A;  1A2U A;  5IE8 A;  3CCV A;  2DN8 A;  2A6H D;  2XGT A;  3UDF A;  1VQB A;  4B9X A;  5M3M G;  2ZXP A;  1RD9 D;  4JI2 L;  3AEV A;  4B3R L;  2VUM B;  1JT8 A;  5D3I B;  1YNJ D;  2ZTE A;  1PZK D;  2PMZ E;  5GQO A;  1SJH D;  4IFD I;  1C48 A;  5G3L D;  1GUO A;  5CBE E;  3HOY B;  4UDU C;  1GJX A;  3K7A B;  2A74 C;  1SNM A;  1HQR D;  2XRS D;  2B63 G;  2Y0S B;  1VMC A;  1L0W A;  4UY8 C;  1TKW B;  1UUP A;  5EPJ A;  1M8A A;  2KA7 A;  2WFW A;  2E2J H;  3Q6S A;  4KK7 A;  1CI3 M;  5KEE A;  4XYQ A;  4YIJ A;  1NMG A;  1QVF A;  4LFA L;  2F1M A;  4A3G B;  1L1O C;  2ZJQ A;  2Z9H A;  2OF1 A;  5J22 A;  1JJC B;  4A3F G;  4DV1 Q;  2I5L X;  3MTS A;  3I4M G;  1S5B D;  1WFQ A;  4KHP Q;  4GOP A;  4CDD C;  3WDN A;  1PRT B;  1TY0 A;  4C3I B;  2Z6K A;  5C6A A;  4R4C A;  4HIK A;  5C3X A;  1UNS A;  2RCN A;  2F0W A;  4HJ9 A;  4P74 A;  1NTG A;  1SYE A;  4DR1 L;  2PI2 E;  1YZ6 A;  4P2C B;  1CKN B;  4R1J A;  4CKB A;  3FP9 A;  1RTN A;  4KLK A;  3F1Z A;  2EQS A;  2JK8 A;  2IT1 A;  1PXU A;  1JOR A;  2SDF A;  1DD2 A;  3TP7 A;  2F03 A;  2N8N A;  4Y7N B;  3NQT A;  1UE5 A;  1T9H A;  1A62 A;  5BN4 A;  2AQ2 B;  4EX5 A;  2OQ0 A;  3G71 A;  5CV6 A;  3CCR A;  1D2B A;  2OQK A;  4Q5V A;  3K0X A;  2RVL A;  3D8G A;  4DU9 A;  2K5H A;  5EKK A;  1YIJ A;  2FJ2 A;  1J6Q A;  1PFB A;  1JB7 A;  1CSP A;  3GTK B;  3I8Z A;  3H0G B;  1SAP A;  2B2Y C;  4BBS H;  3GTQ B;  5FOB B;  2E5L Q;  3E0E A;  1ESF A;  1F9Q A;  1I4H A;  3A55 A;  1PTO B;  2UU9 Q;  3GTL B;  4QUF A;  2GVB A;  4LK1 C;  2BE5 D;  1EQV A;  5CV4 A;  4JI8 L;  2F3W A;  5FJ8 G;  1I6H H;  1TS5 A;  1VQG A;  1OTC A;  4EQO A;  4HIO A;  4OXP A;  1EIF A;  4QMG A;  1S4Z A;  3OMG A;  2E2I B;  4HIM A;  1S72 A;  1JCK B;  1YIT A;  3MZ5 A;  1ASY A;  2NVT H;  2VUM H;  5ELE A;  1BVS A;  3OYY A;  4BXX G;  1HCZ A;  2XVS A;  2ZJP A;  4X64 Q;  3H3V C;  1D6E C;  3HEJ A;  2BOS A;  3JAM L;  3I55 A;  3HOY H;  4MIU A;  1CKN A;  3K7A H;  2F0M A;  1V43 A;  2ES2 A;  1PYS B;  5JEA H;  3U58 A;  1NJI C;  1HNX Q;  2R7Z B;  2EXZ A;  4A3M B;  2PW5 A;  5DEH A;  3I72 A;  4OIJ A;  5F2D A;  2K04 A;  3NSW A;  4L5R C;  4H44 C;  3G7L A;  3FPU B;  1QB5 D;  3HOU G;  1RHP A;  2JQO A;  4DAV A;  1WD0 A;  4DNI A;  1YEZ A;  5D14 A;  3SXH A;  2OXP A;  4A3G H;  5I4D A;  2XWJ B;  3NBH B;  2B2T C;  2NVX B;  1K73 C;  1IW7 C;  3U4V A;  2KJX A;  2H4O A;  2DJF C;  1I94 L;  1JJ2 A;  5EQ0 A;  1I5F A;  3DM3 A;  1IBM Q;  4DV3 L;  4X65 L;  2VL6 A;  1IYU A;  2CCZ A;  4IUN A;  3M3Y B;  4C3I H;  1TXY A;  3S1Q B;  1IHZ A;  3KF8 B;  2MPM A;  1I4X A;  3RLF A;  3L3O C;  4YWL A;  2K33 A;  4DK3 C;  1VDZ A;  3HKZ E;  4N9T A;  4NP5 A;  1KL9 A;  5M5Y B;  2QEX A;  2RDH A;  4UAI A;  2JXM B;  3PUW A;  4OGQ C;  1GOZ A;  4Y7N H;  2HDL A;  5C0X G;  3H6M A;  4XXE A;  3URY A;  1PH1 A;  4UP9 A;  1LTL A;  3KYH C;  1TU2 B;  1HNZ L;  5KIX A;  2Z1C A;  1HXY D;  4JBW A;  4O42 A;  1CK1 A;  1SE4 A;  5IYB G;  3H09 A;  1MJE A;  1LTR D;  2IPK D;  3EJI A;  3UDI A;  2R61 A;  4R4I A;  3L0O A;  1Y1W B;  4JV5 L;  2ZT9 C;  1N34 L;  3BU2 A;  3PMF A;  3BDO A;  1F9R A;  1JQY D;  3V96 A;  3GTK H;  3H0G H;  2EJM A;  2B8F A;  3GV3 A;  1FNU A;  1TS3 A;  1VQ8 A;  2D62 A;  1F2M A;  3TME A;  4LAA A;  5IOC A;  3GTQ H;  3V2T A;  4U67 3;  2EY1 A;  1IBK Q;  1FJG Q;  2H1E A;  1I6V C;  4RG1 A;  5K36 H;  2QF7 A;  4B3M Q;  2B2W A;  1XPU A;  1N32 Q;  1STG A;  3FRP B;  4ZCK A;  2PZW A;  1XNR L;  1BUV T;  5D65 A;  3NBH A;  1KAW A;  3NBI A;  1N9W A;  2F0V A;  1UAP A;  2F0F A;  5IIF A;  2SNM A;  2F0E A;  4CDF C;  4C3H G;  5I6Y A;  2EE1 A;  1C4Q A;  4JI1 L;  5A2Q L;  1HA6 A;  2E2I H;  5C0X I;  1QVC A;  2F0T A;  2XWB B;  4A3L H;  2WV6 D;  3I2Z A;  3KF8 A;  4JI5 Q;  3U9O A;  2IJ0 A;  4QCL A;  4PG3 A;  2CQO A;  2B2U A;  2VQE Q;  3CCQ A;  3D3R A;  1KNE A;  2NBF A;  1VQN A;  5JJK A;  1HR0 W;  1STA A;  2RDG A;  4F7X A;  2B39 A;  4X3T A;  3ND8 A;  2R7Z H;  4A3M H;  1E2Z A;  4OWW B;  1HUM A;  3E9H A;  5IYC G;  3PO3 B;  4MHE A;  1PH8 A;  1DYQ A;  3F2U A;  5IP9 G;  1GUN A;  1BKB A;  1PYW D;  2IW3 A;  2M2L A;  3CCL A;  4JI6 Q;  2PQA B;  2NVX H;  5C0X J;  5KRU A;  1TT2 A;  1WTO A;  3CC7 A;  1YHB A;  3S17 B;  1ET6 A;  1TWG B;  1V1Q A;  4QQB X;  2Q2I A;  2OWO A;  2WB1 G;  1EIH A;  4A3B G;  1SE3 A;  3NK9 A;  3M3Y H;  3S1Q H;  4CHT B;  2YV5 A;  1B7Y B;  2K52 A;  1ICF B;  1DGS A;  1EL0 A;  3G6J B;  4HMI A;  4DR3 L;  2HHH Q;  1X3E A;  2D2C C;  2Q2T A;  2PNR C;  1KDB A;  2NVQ B;  3CQZ B;  5FLX E;  4ZKC B;  1S40 A;  3UDX A;  1MBY A;  4DV0 Q;  3BDC A;  4IUU A;  1PLF A;  3SHL A;  1N33 L;  1GUS A;  4YHH Q;  3J81 E;  4GKJ L;  1DOM A;  3ERS X;  2PCF B;  4HR7 B;  5IGG A;  2Z4I A;  2MNA A;  2PO4 A;  3PQI A;  4DUZ L;  1DM0 B;  3EIV A;  2CWP A;  3T1H Q;  3W2D A;  3KBG A;  3PIP 3;  1I50 B;  1Y1W H;  3WOE A;  4RAU C;  4M1U B;  2J4X A;  1KXL A;  3QG1 A;  3A8I E;  5M5X H;  1W3S A;  1VQJ A;  1STH A;  3N52 A;  4IUR A;  4PZ6 A;  2OTL A;  1G8Z D;  1O7I A;  3T56 B;  2A19 A;  1O78 A;  3D4D A;  4LW1 A;  4K5V A;  1RKN A;  3BVZ A;  4KY7 A;  4L6T B;  2PQA A;  3ULP A;  3HZX A;  4PNY A;  1WTH A;  1IW7 D;  1GD7 A;  5AFW A;  4B3S Q;  4I7Z C;  4NB3 A;  1WVL A;  2R92 G;  1SN8 A;  4IJL A;  1KD1 C;  4L63 B;  2H5X A;  1QUQ B;  3NPP A;  1LTA D;  3R8B A;  1E2W A;  2FXQ A;  4EGV A;  4YY3 L;  4A3I B;  1EQQ A;  3MXG A;  2JEB I;  1FYC A;  1GUT A;  2AWO A;  2BH2 A;  4OIK A;  4IPD A;  3KFU A;  1JR0 D;  3S15 B;  4PMB A;  2P5Z X;  5JPN C;  4LMQ D;  3QOJ A;  3RZO B;  3D4R A;  2X69 A;  1TY2 A;  1WCM G;  1Y8P B;  3PO3 H;  3EN2 A;  3E5S A;  4RA8 A;  1SYB A;  1Q7Y C;  1HRJ A;  1PMR A;  1QNU A;  4PMC A;  1KHI A;  3P20 A;  3A56 A;  1BO0 A;  1B53 A;  1SNQ A;  5KYI A;  2F0H A;  1E1T A;  1U4M A;  1TWG H;  2ZXO A;  4XT1 B;  1WTQ A;  1R4Q B;  4BY1 B;  1GKH A;  4MTK A;  5HUR A;  1CM9 A;  3TZD A;  1EU4 A;  3SE0 A;  1SR3 A;  5IP7 G;  3JAM i;  4ABN A;  4KKT A;  2O4X A;  4FF4 A;  4A93 G;  3C1E A;  4RKB A;  4C3J G;  3J80 E;  4LF8 Q;  4X64 L;  2NVQ H;  5IGD A;  3CQZ H;  5E4W C;  4BY7 B;  4K14 A;  3QWN A;  3ONA B;  3RLN A;  3KF6 B;  1LTG D;  1FGU A;  2GA4 B;  1X3F A;  3DEP A;  2K28 A;  1STE A;  3CKI B;  1XJV A;  4JC0 A;  1NY4 A;  5IY0 A;  2XSC A;  1QUQ A;  2B3G A;  3HOZ G;  4UPA A;  1EY0 A;  1Q81 C;  3C2P A;  1D7Q A;  4DR2 L;  1JWS D;  4G7O C;  1I50 H;  3G48 A;  2CKZ B;  3I70 A;  4LF7 Q;  4LF6 L;  1EQT A;  3WOF A;  5KGU A;  4K8J A;  1EWC A;  3IFD A;  4HSV A;  1JOO A;  3T1Y L;  2Z6K C;  4X66 Q;  2JA5 H;  5E1F A;  1EUJ A;  4WJ4 A;  2HUG A;  2CVR A;  1JE4 A;  2B63 B;  2UUA Q;  2F0J A;  5IGC A;  4CJ1 B;  1ASZ A;  3BZK A;  1TS4 A;  3DWP A;  4YCW A;  2RSN A;  3E6Z X;  1XWE A;  4JBK A;  4R8N A;  1U4P A;  1EY5 A;  1A3U A;  4MZ9 A;  2YTX A;  1LTT D;  3W5O A;  1C0A A;  3A8K E;  3GO5 A;  2F4I A;  3GTM H;  2F0G A;  1E2V A;  3RZD B;  1Z9F A;  2Z4H A;  1TII D;  4A3F B;  1HA5 A;  3M85 A;  3K59 A;  4XQJ A;  4A3I H;  4DV7 Q;  3I4M B;  2CFM A;  5J3B A;  4V19 0;  2NZH A;  4KJO A;  4KN4 C;  4CDE C;  4KI0 A;  4LFB L;  4FF2 A;  3S15 H;  2NTS A;  4ZLT F;  1E22 A;  4R4O A;  3KF6 A;  4LJZ C;  1XPO A;  3RZO H;  2Q8I B;  2RSO A;  2WKC A;  1LTS D;  4DV2 Q;  3MEH A;  3PSI A;  1HZ9 A;  2Z8L A;  3EBE A;  4AH6 A;  4APV A;  3ITP A;  1N32 L;  2RHQ B;  2MP1 A;  3KLS X;  2EYH A;  5C4H A;  4TKO B;  3C46 A;  2NZ1 D;  2X6L A;  3FVQ A;  1Q86 C;  2K4K A;  3M4Q A;  5JJI A;  1PZJ D;  3CRK C;  1I6H B;  4BY1 H;  4E6I A;  4LFC Q;  1DXM A;  1WJJ A;  4IFD H;  1AP0 A;  1A63 A;  1PRT C;  3BJU A;  1L0Y B;  5M3F G;  4XIG S;  2UUC L;  5GRO A;  4FDB A;  1EIG A;  3SR1 A;  1O7L A;  3NQI A;  4DXG A;  3Q23 A;  4BBR G;  3D0F A;  3OTO Q;  1LM0 A;  1IBL Q;  1SFO H;  5I9P A;  2NVT B;  1LAC A;  1RF2 D;  4BY7 H;  4ILW A;  1V9P A;  2AMC B;  4DR5 Q;  1II3 A;  1MSH A;  4C2M B;  3CRL C;  4F8M A;  4DV6 L;  3CCM A;  3HOV H;  1CHP D;  2KEN A;  4RKL A;  1LYL A;  4CJ2 C;  1W6K A;  4JYA L;  1Q90 A;  3I73 A;  1JE5 A;  4RFB A;  1KLG D;  3E0J A;  1F2Z A;  2AUK A;  3TP8 A;  3MFY A;  1BXT A;  4IUV A; 
#chains in the Genus database with same CATH homology
 1AEX A;  2L0C A;  1HQM C;  4RGM A;  2NB0 A;  1SMY C;  4XQN A;  1BBX C;  4J8Q A;  3VR6 A;  2NWG A;  4DF7 A;  3SK6 A;  4BS9 A;  1PTO C;  2EY6 A;  5IGE A;  4BA2 I;  3W3A A;  3VYS A;  2WP8 J;  4KMU C;  4TSS A;  5IGB A;  3HOU B;  3S14 B;  1SXT A;  1L0X B;  3H94 A;  5BN5 A;  2F0P A;  4DNT B;  2D9U A;  5M5W B;  2FHT A;  1A6X A;  5G3L F;  3OWE B;  1IKL A;  1ROD A;  5CR3 A;  1V1P B;  2AQ3 B;  2QEJ C;  4FP5 D;  1LLR D;  2EJF C;  4B08 A;  3FDT A;  5JVG 3;  1STY A;  4ZQ3 A;  2B2W C;  4K6D A;  1Q1E A;  4EQP A;  3CHB D;  2LY7 A;  1QG7 A;  1TWA B;  2K1B A;  3MWY W;  2BA1 A;  2B8G A;  3H91 A;  4F88 A;  1GHJ A;  3KUP A;  3IL8 A;  4WRD A;  1LT4 D;  1EY8 A;  2ZXR A;  4DGZ A;  2A5H A;  5C4Z A;  4KY5 A;  2N55 A;  1Y8O B;  3NWT A;  1YNN D;  1TWH B;  2O2L D;  1U9R A;  1I4Q A;  1OXV A;  1OXX K;  1WTP A;  2OEO A;  1GUW A;  5ISR A;  1DCZ A;  3T53 B;  1D5X C;  2A68 C;  2K01 A;  4C3H B;  4IUT A;  3MA2 B;  1G2S A;  5EPL A;  4QUC A;  4OL7 A;  3OPO A;  1CHQ D;  2SNS A;  5FO8 B;  1BCP C;  3R2I A;  1F9P A;  4DNR B;  5KNC A;  3R2T A;  1ICW A;  1V1P A;  3BYT B;  4XTC S;  3VR2 A;  5FO9 B;  4KV6 A;  2E74 C;  3GTG B;  1SDF A;  3OIP A;  1UEA B;  5EBC A;  1SJE D;  3NUC A;  4PMW A;  1H9R A;  3OOC A;  1HPC A;  1MSG A;  2PZT A;  1WTW A;  5FO7 B;  2OT2 A;  4K8I A;  2F0Q A;  3MC0 B;  1JWU D;  1MD2 D;  1HTP A;  1PRT D;  4ZYS A;  3LX0 A;  1OXT A;  3I3C A;  1EZ6 A;  2E2H B;  2WB1 B;  2VB2 X;  2QIL A;  4A3B B;  1Y8N B;  3DWQ A;  3TZU A;  2C9O A;  3NTK A;  4HAE A;  1BQQ T;  5CV7 A;  2VXW A;  3D6W A;  4WFN 3;  1AN8 A;  1B1Z A;  5JEA J;  5M5X B;  2YU9 B;  3AU7 A;  2NTT A;  2F0S A;  2LS0 1;  2FFK B;  2SEB D;  2D5D A;  3P1H A;  1F77 A;  4G4K A;  1V8Q A;  5C0X H;  4WJW A;  1SMY D;  2N88 A;  3VA7 A;  1H9M A;  4F87 A;  2DY7 A;  1Q3L A;  4KD3 A;  1VF7 A;  2B2V C;  2A69 C;  3BVG A;  1NCV A;  1PTO D;  1EFI D;  3PIO 3;  1ILQ A;  3R3O A;  4H7B A;  1XYI A;  4PQX A;  4QIW B;  3VYT A;  1IKM A;  3VR5 A;  1R9T B;  2XIW A;  1DOK A;  1X3Q A;  4FVM A;  1STN A;  2HDM A;  1I3Q B;  3TP6 A;  2EJG C;  2FIN B;  2NUC A;  3K5O A;  5KYL A;  1FNV A;  4IUP A;  1G29 1;  1ONL A;  4ODG A;  3A54 A;  4RWS C;  4K5X A;  3GTP B;  4IQZ A;  1W6J A;  2L12 A;  5FK9 C;  4R8I A;  2L1B A;  5FLX L;  3SVM A;  1WCM B;  1B4O A;  4DAY A;  5K5P A;  4K5W A;  3J81 L;  2E76 C;  3MAQ A;  1WTR A;  5T1I A;  2EPB A;  1F9S A;  1H9S B;  1EY7 A;  4V0B A;  1JOQ A;  2KHS A;  3P7J A;  2Q8R E;  3S1R B;  4XYO A;  3SDZ A;  1LV9 A;  2JYO A;  3GTJ B;  5T1G A;  2RQX A;  4C56 C;  3FPP A;  4A93 B;  1CFM A;  2EYP A;  4ZUI A;  1OO9 B;  3BYY B;  2ICE C;  2A68 D;  4BWG B;  2JA5 B;  2PW7 A;  3PUY A;  1Q8I A;  2PQE A;  3HOZ B;  1H9K A;  1BCP D;  1A3T A;  2VB3 X;  3PUX A;  5J39 A;  1G2T A;  2IX3 A;  1BNZ A;  3GTM B;  3PUZ A;  2E75 C;  2TMP A;  3S1M B;  3HS0 C;  2QCP X;  1SNP A;  1CQF A;  2L11 A;  3NP8 A;  1H9S A;  4KHZ A;  2IX0 A;  1CTM A;  1AZP A;  4FO2 A;  1RTO A;  1PDQ A;  1V1O A;  4XQQ A;  1LAB A;  3IFT A;  3HP3 A;  4OHJ A;  2O5I C;  2RDF A;  2TSS A;  3BG3 A;  2MGS A;  2E2D C;  2EY2 A;  5J1Z A;  3J80 L;  3QJY A;  1SND A;  1HFG A;  5M9O A;  2AUJ D;  1O80 A;  1SNC A;  4OO1 G;  5CV5 A;  1JOK A;  1BCP F;  1X32 A;  1QCB D;  3QO2 A;  1ZXT A;  1SFO B;  3NHH A;  2X6G A;  3DHQ A;  2A69 D;  2EVB A;  1WTX A;  1EZ8 A;  1SYG A;  1EY9 A;  5C5M A;  2MHV A;  3HOV B;  3DMU A;  4KY6 A;  3NTH A;  4CKC A;  3S9W A;  2BCO A;  4DXF A;  3DWA A;  4FXD A;  2WAC A;  1Z47 A;  2XRQ D;  4RH6 A;  3S16 B;  3FMC A;  3NXW A;  4BBR B;  5M3M B;  3K5M A;  3I90 A;  3K57 A;  4N9P A;  5LL6 S;  1FR3 A;  1BF4 A;  4H13 C;  2NN6 G;  3OMC A;  4OO1 I;  2DNC A;  1EY4 A;  1TVX A;  2WIN B;  3DM1 A;  1FD7 D;  3SEB A;  3SK5 A;  1MGS A;  1BR9 A;  3DXJ C;  1YNN C;  2K6A A;  5ELD A;  1R4P B;  2K5W A;  5CV8 A;  3GTO B;  2QKI C;  1D1I A;  2WII B;  5CMD A;  3TP5 A;  4IUQ A;  4NMZ A;  3M4Y A;  5FKA C;  3VYU A;  3ERQ A;  5KND A;  4KKU A;  3CU7 A;  4NKL A;  3GQB A;  1EY6 A;  4Z9C B;  2NN6 I;  2JA6 B;  1S5E D;  1SBB B;  3S2H B;  2ID0 A;  4DK1 A;  2IL8 A;  4HMJ A;  2RBM A;  4KN7 C;  1T5X D;  1LT5 D;  5COR A;  2KQ3 A;  3EFX D;  4ZUJ A;  1T5E A;  3TBI B;  1K8O A;  3OSO A;  4A3K B;  5EGT A;  4EVO A;  3TDQ A;  3OIQ A;  1ESR A;  1VCI A;  2AWN A;  3GD7 A;  1EYC A;  1Q12 A;  2NYZ D;  1E0B A;  5DNF A;  1SSO A;  1JWM D;  5ELC A;  2KOL A;  1ML0 D;  1HFN A;  1BDO A;  5E3F A;  1QE6 A;  1EYD A;  4H0L C;  4MN3 A;  2F0D A;  2EYJ A;  2IX1 A;  1VF5 C;  1GXD C;  5EBD A;  5IT9 E;  2YYZ A;  3HOX B;  3MXP A;  3HG9 A;  1MI2 A;  2A6E C;  5BN3 A;  1SEB D;  3HRZ C;  2PPB C;  2EDG A;  1QNK A;  2F0U A;  3UI2 A;  1B44 D;  1K8M A;  4M8A A;  1B9M A;  3KLR A;  4ZKB B;  2KCC A;  1EEI D;  3PO2 B;  5KNB A;  3O13 A;  2HCI A;  2JP1 A;  2CW0 C;  2XN9 C;  2BA0 A;  1AZQ A;  1IL8 A;  1KAA A;  3NE5 B;  4K2K A;  2WAQ B;  2MJ8 A;  3RUZ A;  1SYD A;  2F0L A;  3DUZ A;  3P75 A;  3ZYY X;  2JEA I;  4FF1 A;  1KTK A;  2KEE A;  3BS1 A;  2F0N A;  3J7Y W;  4HED A;  5I2X A;  3VA5 A;  1JIC A;  2C5C A;  4IFD J;  1CT1 D;  2ICI A;  2JSO A;  1OXU A;  1G91 A;  3DEO A;  2G9H D;  3A7A B;  5C4J B;  1QJO A;  1DON A;  4FNF A;  4ID6 A;  1EOT A;  1SYF A;  2JA7 B;  1TS2 A;  4CBV A;  1I4P A;  1LT6 D;  1O7Y A;  1ILP A;  3RD4 A;  2F3V A;  3T4A C;  1A15 A;  2EYF A;  2XNA C;  1B50 A;  4HCS A;  2R6G A;  2A73 B;  4K6L A;  2K05 A;  5C3E B;  2G9D A;  2MUY A;  1KLU D;  3QOL A;  3OW7 A;  2B2U C;  1G6Z A;  5JEA G;  1LT3 D;  4FXK C;  1U4L A;  1U4R A;  2JA8 B;  4R9W A;  2RKS A;  2I07 B;  1ZYR C;  2DY8 A;  1Y1V B;  4RCO A;  1EU3 A;  1TR5 A;  1XTC D;  3NWS A;  1Z6H A;  1IYV A;  4C3I G;  3R93 A;  3JAM E;  1GUG A;  1WD1 A;  1B2T A;  3K5N A;  4JK1 C;  3KK7 A;  4NDX A;  1FNW A;  2HCC A;  3HOW B;  3GP7 A;  5HGT A;  3BZD B;  5C4X B;  1TQO A;  3L7Z C;  2L55 A;  1TWC B;  5DM7 3;  3K6O A;  3QB3 A;  3EVQ A;  1RCV D;  4C1N I;  4DN4 M;  1M4V A;  2KEC A;  1S5D D;  2BDO A;  3LNN A;  3Q22 A;  5C44 B;  4HCE A;  4G7H C;  2IWH A;  1O7Z A;  1ENA A;  1GHK A;  1JC7 A;  1KDC A;  3RMH A;  4ME5 A;  2L9H A;  4ULL A;  3A7L A;  3BDL A;  1D1K A;  2EYM A;  3HGB A;  4GZY C;  5K36 G;  1J9O A;  3L9A X;  4G57 A;  2A6E D;  1OXS C;  1Z7T A;  5A35 A;  3D4W A;  4I65 A;  3MXN A;  3PV0 A;  1LTI D;  4J6H A;  2VNU D;  3MXU A;  2PZU A;  5I6W A;  4A3J B;  1BCP B;  2K32 A;  2HQE A;  1CA6 A;  2R3Z A;  2CW0 D;  4BA1 I;  1NUC A;  1CQV A;  3BVM A;  2B2Y A;  3PUV A;  1PTO H;  3X3N A;  3S1N B;  3T16 A;  4KJN A;  3A8J E;  3V05 A;  3OHX C;  4G7Z C;  4DA2 A;  5JJZ A;  1NR4 A;  3NTI A;  3FKI B;  1PRT F;  4K2L A;  3TSS A;  5LHY 1;  3M7N A;  5IGF A;  1C8C A;  4J1M A;  1H9J A;  2I46 A;  1JB3 A;  2R92 B;  2K7V A;  2O5J C;  5A2Q E;  2K03 A;  2QDB A;  1PFM A;  1ENF A;  3C1F A;  4XT3 B;  4ZRZ A;  3ERO A;  4XDX A;  4L8J A;  2L5T A;  2RA4 A;  5C5L A;  2PYK A;  3X3M A;  1F2Y A;  2LKV A;  1TWF B;  4PV1 C;  1HTL D;  1EEF D;  3AB9 A;  1SE2 A;  3IKJ A;  1J8I A;  5CGK A;  3S2D B;  3MFG A;  2B2T A;  1D5M C;  2J0T D;  3LWU A;  5EKI A;  4QB4 A;  1LTB D;  1PTO F;  1ZEQ X;  3U9S A;  4RGT A;  2F0O A;  1HHV A;  1CA5 A;  4HTH A;  5JOB A;  3K0Y A;  4RHR A;  1SYC A;  2KUM A;  1NSN S;  2NVY B;  2FMC A;  3MHB A;  2BDN A;  1D5Z C;  4B9W A;  5JPM C;  1Q1B A;  5CV9 A;  4C3J B;  3VR3 A;  4IAL A;  1PZI D;  1ZYR D;  1QWY A;  4QF4 A;  2R93 B;  2K5D A;  1PFN A;  5I9O A;  5COY A;  5JAV A;  3Q0A A;  3J7A F;  1A2T A;  2SOB A;  2AQ1 B;  2JE6 I;  2KCN A;  3K5L A;  2LMC B;  1EYA A;  5EJW A;  5IOD A;  1HUN A;  3T51 B;  2EYO A;  1K83 B;  3T13 A;  4O1N A;  4DK0 A;  1I4G A;  4X3S A;  4ZAI A;  3LWE A;  2EZV A;  3M7G A;  2A6H C;  1CZG A;  2LFN A;  4TQU S;  1YNJ C;  1NAP A;  3VR4 A;  3OWF A;  4ZK9 B;  2PMZ B;  4DAP A;  2B2V A;  4A3E B;  2K5Q A;  4CGY B;  3C3L A;  3M4O B;  4C1N K;  1WTV A;  3I4L A;  5NUC A;  1S5F D;  1B9N A;  1ZKO A;  5E4X A;  3SK4 A;  4CJ0 B;  3FEW X;  3GV6 A;  1VMP A;  4IN3 A;  3KLS A;  1KAB A;  1KDA A;  1AW7 A;  1XXG A;  2KVM A;  4U68 A;  4KKS A;  1ENC A;  3QIA A;  5ELF A;  1KNA A;  5TSS A;  3I4N B;  4A3D B;  3AMU A;  5JVH 3;  1NR2 A;  1LO5 D;  4X3K A;  4S3S A;  1ET9 A;  4KD4 A;  4FF3 A;  1B3A A;  4TRD A;  5M3F B;  5DAU A;  4IZ8 A;  4OO1 H;  5I2Y A;  5CBA E;  1DJR D;  2EOT A;  3TN2 A;  1BOS A;  3ND9 A;  2EYL A;  1QIL A;  2CHB D;  3Q24 A;  3I91 A;  1FGB D;  2Q8T A;  2E2J B;  1CZW A;  1F2L A;  1I4R A;  4RHS A;  2F0I A;  1RJT A;  1AFP A;  2BE5 C;  1SNO A;  3D31 A;  5CYU A;  4DFA A;  3D6C A;  4KTA A;  3IAY A;  2FMM A;  4CKE A;  3MVV A;  2KED A;  1X3P A;  4RGO S;  5DM6 3;  4HN7 A;  2NN6 H;  4AYB B;  2M9V A;  4NW2 A;  2DNE A;  5EPK A;  1S5C D;  1QOH A;  3N6R A;  1EWH A;  2WKD A;  5D3D A;  1DZ1 A;  3KBX A;  2CQA A;  4FYD A;  5EKL A;  4FXG C;  4KHV A;  3K58 A;  5LL6 X;  4IFD G;  4X3U A;  2F0K A;  3VYR A;  2M00 A;  3EQL C;  4HSP A;  5ELB A;  3SK8 A;  4WOR A;  1Y69 U;  4Q0F A;  2V4D A;  4BBS B;  1DOL A;  2ENB A;  4RCN A;  4EQN A;  3J7A V;  1STB A;  5CC4 A;  4RGN A;  2J7Z A;  5IT9 L;  1A3V A;  3EA6 A;  1RDP D;  2EY5 A;  5C3W A;  2L4N A;  3HKZ B;  1XX8 A;  1A2U A;  2DN8 A;  2A6H D;  4B9X A;  2ZXP A;  1RD9 D;  2VUM B;  5D3I B;  1YNJ D;  1PZK D;  1SJH D;  4IFD I;  1C48 A;  5G3L D;  1GUO A;  5CBE E;  3HOY B;  4UDU C;  1GJX A;  3K7A B;  2A74 C;  1SNM A;  1HQR D;  2XRS D;  2Y0S B;  1VMC A;  1TKW B;  1UUP A;  5EPJ A;  1M8A A;  2KA7 A;  3Q6S A;  4KK7 A;  1CI3 M;  5KEE A;  4XYQ A;  4YIJ A;  2F1M A;  4A3G B;  2OF1 A;  5J22 A;  3MTS A;  1S5B D;  3WDN A;  1PRT B;  1TY0 A;  4C3I B;  5C6A A;  5C3X A;  1UNS A;  2F0W A;  1SYE A;  4P2C B;  4CKB A;  1RTN A;  2IT1 A;  1PXU A;  1JOR A;  2SDF A;  1DD2 A;  3TP7 A;  2F03 A;  4Y7N B;  3NQT A;  5BN4 A;  2AQ2 B;  5CV6 A;  1D2B A;  4Q5V A;  2RVL A;  3D8G A;  4DU9 A;  5EKK A;  2FJ2 A;  1PFB A;  3GTK B;  3I8Z A;  3H0G B;  1SAP A;  2B2Y C;  3GTQ B;  5FOB B;  1ESF A;  1F9Q A;  1I4H A;  3A55 A;  1PTO B;  3GTL B;  4QUF A;  4LK1 C;  2BE5 D;  1EQV A;  5CV4 A;  2F3W A;  1TS5 A;  4EQO A;  4QMG A;  1S4Z A;  3OMG A;  2E2I B;  1JCK B;  3MZ5 A;  5ELE A;  1HCZ A;  2XVS A;  3H3V C;  1D6E C;  3HEJ A;  2BOS A;  3JAM L;  4MIU A;  2F0M A;  1V43 A;  5JEA H;  2R7Z B;  2EXZ A;  4A3M B;  2PW5 A;  5DEH A;  3I72 A;  4OIJ A;  5F2D A;  2K04 A;  3NSW A;  4H44 C;  3G7L A;  3FPU B;  1QB5 D;  1RHP A;  4DAV A;  1WD0 A;  5D14 A;  3SXH A;  2OXP A;  5I4D A;  2XWJ B;  2B2T C;  2NVX B;  1IW7 C;  2KJX A;  2H4O A;  5EQ0 A;  1IYU A;  4IUN A;  3M3Y B;  3S1Q B;  1IHZ A;  2MPM A;  1I4X A;  3RLF A;  3L3O C;  2K33 A;  1VDZ A;  4N9T A;  4NP5 A;  5M5Y B;  2RDH A;  4UAI A;  2JXM B;  3PUW A;  4OGQ C;  1GOZ A;  2HDL A;  5C0X G;  3H6M A;  4XXE A;  3URY A;  1TU2 B;  5KIX A;  2Z1C A;  1HXY D;  4JBW A;  4O42 A;  1SE4 A;  1CK1 A;  3H09 A;  1LTR D;  2IPK D;  3EJI A;  1Y1W B;  2R61 A;  2ZT9 C;  3PMF A;  3BDO A;  1F9R A;  1JQY D;  3V96 A;  2EJM A;  2B8F A;  3GV3 A;  1FNU A;  1TS3 A;  2D62 A;  1F2M A;  3TME A;  4LAA A;  5IOC A;  3V2T A;  4U67 3;  2EY1 A;  2H1E A;  1I6V C;  5K36 H;  2QF7 A;  2B2W A;  1STG A;  3FRP B;  2PZW A;  1BUV T;  5D65 A;  3NBH A;  3NBI A;  2F0V A;  1UAP A;  2F0F A;  5IIF A;  2SNM A;  2F0E A;  4C3H G;  5I6Y A;  2EE1 A;  1C4Q A;  5A2Q L;  1HA6 A;  5C0X I;  2F0T A;  2XWB B;  2WV6 D;  3KF8 A;  3U9O A;  2IJ0 A;  4QCL A;  2B2U A;  3D3R A;  1KNE A;  2NBF A;  1STA A;  2RDG A;  4F7X A;  2B39 A;  4X3T A;  3ND8 A;  1E2Z A;  1HUM A;  3PO3 B;  4MHE A;  1DYQ A;  3F2U A;  1GUN A;  1PYW D;  2IW3 A;  2M2L A;  5C0X J;  5KRU A;  1TT2 A;  1WTO A;  3S17 B;  1ET6 A;  1TWG B;  1EIH A;  1SE3 A;  3NK9 A;  4CHT B;  1EL0 A;  3G6J B;  4HMI A;  2D2C C;  2PNR C;  1KDB A;  2NVQ B;  3CQZ B;  5FLX E;  4ZKC B;  1MBY A;  3BDC A;  3SHL A;  1PLF A;  4IUU A;  1GUS A;  3J81 E;  1DOM A;  2PCF B;  4HR7 B;  5IGG A;  2Z4I A;  2PO4 A;  1DM0 B;  3W2D A;  3KBG A;  3PIP 3;  1I50 B;  3WOE A;  4RAU C;  4M1U B;  2J4X A;  3QG1 A;  3A8I E;  1STH A;  3N52 A;  4IUR A;  1G8Z D;  3T56 B;  1O78 A;  3D4D A;  4K5V A;  1RKN A;  3BVZ A;  4KY7 A;  4L6T B;  3HZX A;  4PNY A;  1IW7 D;  5AFW A;  4I7Z C;  1WVL A;  4L63 B;  3NPP A;  1LTA D;  3R8B A;  1E2W A;  4EGV A;  4A3I B;  3MXG A;  2JEB I;  1FYC A;  1GUT A;  2AWO A;  4OIK A;  1JR0 D;  3S15 B;  4PMB A;  5JPN C;  4LMQ D;  3QOJ A;  3RZO B;  3D4R A;  2X69 A;  1TY2 A;  1Y8P B;  4RA8 A;  3E5S A;  1HRJ A;  1SYB A;  1PMR A;  1QNU A;  4PMC A;  3P20 A;  3A56 A;  1BO0 A;  1B53 A;  1SNQ A;  5KYI A;  2F0H A;  1U4M A;  2ZXO A;  4XT1 B;  1WTQ A;  1R4Q B;  4BY1 B;  5HUR A;  1CM9 A;  3TZD A;  1EU4 A;  3SE0 A;  4ABN A;  4KKT A;  2O4X A;  4FF4 A;  3C1E A;  4RKB A;  4C3J G;  3J80 E;  5IGD A;  5E4W C;  4BY7 B;  4K14 A;  3QWN A;  3ONA B;  1LTG D;  2GA4 B;  3DEP A;  2K28 A;  1STE A;  3CKI B;  2XSC A;  1EY0 A;  3C2P A;  1JWS D;  4G7O C;  3I70 A;  1EQT A;  3WOF A;  5KGU A;  4K8J A;  1EWC A;  3IFD A;  4HSV A;  1JOO A;  5E1F A;  2HUG A;  2CVR A;  1JE4 A;  2B63 B;  2F0J A;  5IGC A;  4CJ1 B;  1TS4 A;  3DWP A;  2RSN A;  3E6Z X;  1XWE A;  4R8N A;  1U4P A;  1EY5 A;  1A3U A;  1LTT D;  3A8K E;  3GO5 A;  2F4I A;  2F0G A;  1E2V A;  3RZD B;  2Z4H A;  1TII D;  4A3F B;  1HA5 A;  3M85 A;  3K59 A;  4XQJ A;  3I4M B;  4V19 0;  4KJO A;  4KN4 C;  4KI0 A;  4FF2 A;  2NTS A;  4ZLT F;  4LJZ C;  2Q8I B;  2RSO A;  2WKC A;  1LTS D;  3MEH A;  2Z8L A;  3ITP A;  2MP1 A;  3KLS X;  2EYH A;  5C4H A;  4TKO B;  3C46 A;  2NZ1 D;  2X6L A;  3FVQ A;  1PZJ D;  3CRK C;  1I6H B;  4E6I A;  1DXM A;  4IFD H;  1AP0 A;  1PRT C;  1L0Y B;  4XIG S;  1EIG A;  3SR1 A;  1O7L A;  3NQI A;  4DXG A;  3Q23 A;  5I9P A;  2NVT B;  1LAC A;  1RF2 D;  4ILW A;  1II3 A;  1MSH A;  4C2M B;  3CRL C;  4F8M A;  1CHP D;  4RKL A;  4CJ2 C;  1W6K A;  1Q90 A;  3I73 A;  4RFB A;  1KLG D;  3E0J A;  1F2Z A;  2AUK A;  3TP8 A;  3MFY A;  1BXT A;  4IUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...