2NYZD

Viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the c- chemokine xcl1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
DKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein GAMMAHV.M3
publication title Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor.
pubmed doi rcsb
source organism Murid herpesvirus 4
molecule tags Viral protein/cytokine
total genus 7
structure length 61
sequence length 61
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nyzD00
2HCIA 1X32A 1MI2A 3QO2A 1X3QA 1IKLA 2B2UA 4MN3A 1F9SA 1QG7A 2FMMA 1MSGA 1DOKA 4ZKBB 1O7ZA 3F2UA 3TN2A 3MWYW 2BDNA 3R93A 4R8IA 1B2TA 2M2LA 1G6ZA 3G7LA 2Q8RE 1S4ZA 3D6WA 4IUVA 5CORA 4R9WA 1PLFA 4RAUC 2KECA 3LWEA 1NR2A 2L11A 5E4WC 2XIWA 5EQ0A 1SAPA 4XDXA 1HRJA 4CJ0B 3P7JA 4HCSA 1F9RA 5EJWA 5E4XA 1A15A 4HSVA 5EPKA 1AZPA 2K04A 1PFBA 1RTOA 5D14A 1HFNA 1RTNA 1J8IA 2FFKB 2RSNA 4X3UA 1WTRA 4IUTA 2Q8TA 1AZQA 1EL0A 1HUNA 1QE6A 2B2TC 4DN4M 1MGSA 1G2SA 3IL8A 1XX8A 2J7ZA 1BF4A 2K1BA 3HP3A 1WTPA 4CJ2C 1O7YA 3IFDA 1SSOA 2EOTA 5COYA 1CA5A 2L1BA 3DEPA 2DY8A 5EPLA 1DZ1A 1VMPA 3DEOA 1O80A 2NYZD 3MTSA 1QNKA 2KVMA 5CMDA 1WTOA 1XYIA 2B2TA 1PFMA 3I3CA 4HAEA 2B2VC 4XT3B 4U68A 4ZLTF 1WTXA 4X3SA 1AP0A 1E0BA 3Q6SA 1ML0D 2HDMA 2MPMA 4RWSC 3I90A 4X3KA 1DOLA 1F9QA 2EE1A 2MGSA 2MJ8A 1F2LA 2K03A 1Q3LA 1JE4A 1BO0A 2K28A 1PDQA 2R3ZA 2IL8A 4NW2A 4MHEA 1HHVA 1PFNA 2N55A 2B2VA 3KBXA 2FJ2A 2KUMA 1BNZA 3H91A 1HFGA 3GV3A 2HDLA 1NCVA 1U4MA 5EKIA 1MSHA 1SDFA 2HCCA 2NZ1D 1LV9A 2SDFA 2X6GA 4ZKCB 2VXWA 5CBAE 3ONAB 1ILQA 5D65A 1M8AA 1B3AA 2DY7A 2JP1A 1KNAA 1ILPA 2L4NA 1HA6A 3DM1A 1RODA 1WTQA 4RA8A 4XT1B 4LMQD 2KEEA 4OIJA 2EPBA 5CBEE 2RSOA 1JICA 1B4OA 1EIHA 3I91A 5DNFA 1CA6A 1GUWA 1U4PA 3GV6A 4O42A 1B53A 2D9UA 1C8CA 1J9OA 4CJ1B 1WD0A 2HUGA 2L12A 1X3PA 1KNEA 4ZK9B 2NWGA 2JYOA 1WVLA 4IUPA 4IURA 1BBXC 4IUUA 5T1GA 3N52A 4UAIA 3UI2A 4ZAIA 2L9HA 1ICWA 2RA4A 1WTWA 1WTVA 3KUPA 1NR4A 1EOTA 1DOMA 2B2WC 2X6LA 3FDTA 2H1EA 3I8ZA 2KEDA 1RJTA 3FPUB 2FHTA 5EPJA 5T1IA 2B2YC 2RVLA 1ESRA 1U4LA 5AFWA 3SVMA 1U4RA 1RHPA 1VMCA 1ZXTA 2X69A 2CVRA 4QUFA 5JJZA 1DONA 1F9PA 4QUCA 2B2WA 1G2TA 1NAPA 1G91A 2B2UC 4X3TA 1TVXA 4IUQA 3TZDA 1HUMA 2K05A 1B50A 1IKMA 2KOLA 4OIKA 2FINB 2B2YA 1EIGA 2K01A 1EQTA 2MP1A 4HEDA 1CM9A 2N88A 1IL8A 1WD1A
chains in the Genus database with same CATH superfamily
4A3EG 2D0OA 1D7QA 1SNQA 4IPCA 2Z6KC 1W2BA 1F9SA 1O7LA 2ZTDA 3GTMH 2E2IB 1SJED 4QQBX 3NBIA 4A93G 4B3RL 3S1NB 4X6AH 1L1OA 3STBD 4UP8A 5J22A 3I4MH 1I94Q 5AJ3L 2UXBL 4KK7A 5EPKA 4EQPA 4TKOB 1XNRL 2K32A 1EFWA 2JA5H 2F3IA 3CP0A 1JOQA 1G6PA 1AZQA 5H1SE 1HUNA 3S16B 1CQVA 1XTDA 3A8IE 2VQEQ 3ULPA 3HFZB 1XX8A 3BU2A 4DV3Q 4A3KH 1K9MC 2F0FA 3M7GA 2B39A 2F0EA 4BBSB 5C4JB 4LK1C 1WOCA 1F2ZA 2EOTA 2JA7B 2A19A 1X9NA 1YIJA 2DY8A 1TWGB 4OWTB 3TS2A 3HOVB 1CZGA 5CMDA 4BY7G 2E75C 1PV4A 2EDGA 3M3YH 3I4NB 3CPFA 5IYDH 4LNQA 3K5LA 4JYAQ 1K3RA 2K03A 4K2KA 2E2HH 3BVZA 2CQOA 4JI5Q 3MHBA 3M7NA 2HDLA 3UDXA 2B29A 3ERSX 3NQTA 2AQ3B 5IYCG 4R4IA 1ASZA 2EY6A 5GROA 1XMOQ 1OTCA 5FO9B 4MNOA 3LNNA 1KDCA 4LMQD 5KIXA 4GLAC 2K5DA 3C1EA 1FYCA 4BBRG 4KI0A 3S1QB 2OCEA 3QIAA 1KAAA 3CMAA 2QGQA 2B8FA 3T1HL 4IFDI 4KJNA 2CHBD 2A6HC 4IUUA 2IJ0A 3CD6A 1WTHA 4BXXH 3BYTB 4ABNA 2JJQA 1STGA 3SXHA 4OO1H 2RBMA 4A3EH 2PNRC 4DV2L 1JT8A 3T56B 1L0YB 3D4WA 4A3GB 4JK1C 4A93H 2A6HD 2Y0SE 5JAVA 3PIO3 4QIWB 3KF8A 4K2LA 1FJGQ 1VQNA 1ICFB 3PUYA 1G2TA 3ND9A 4HR7B 4GNXA 2ES2A 3S2DH 3HKZB 1I94L 1HUMA 3J80L 1QCBD 2LY7A 2B2YA 4GZYC 1CM9A 1IL8A 1SROA 1X3QA 1S5CD 2Z4IA 4H02A 3TMEA 2FMMA 4EVOA 3M4PA 2N8NA 2VQEL 1FNWA 2K4KA 2WFWA 3I4LA 2M2LA 3G48A 3R93A 3D4RA 2ICIA 1V1QA 3D6WA 4R9WA 1PLFA 3S17B 4BY7H 3LWEA 5EQ0A 1CKNA 1HRJA 2F0HA 4A3IG 4LF5Q 4UPAA 3M4OH 4CKEA 1FD7D 2DJFC 1RTOA 4JYAL 5FK9C 4JI5L 1V9PA 3M4YA 2J7ZA 1PRTB 2KHSA 2WAQG 4F88A 4HJ5A 3SK6A 1EIYB 1CTMA 2EIFA 3DEOA 1O80A 4XYQA 1QNKA 1PFSA 1NJIC 4OEMB 5DLQE 3DWPA 2OXPA 3Q6SA 4AIMA 5J3BA 1XMOL 4X3KA 4A3MH 3SDZA 2EE1A 2EYFA 3TDQA 1X3EA 5LL6X 2F0DA 2FXQA 3HG9A 3K5OA 4BBRH 1PFNA 2A73B 5IY0A 2J0TD 3FPPA 5EKIA 1SNOA 1YHQA 1Z9FA 4DV4Q 1C4QA 4NDXA 4Q5VA 2UUBQ 1N9WA 2DY7A 2HQLA 2VY3A 5IYBG 1I4HA 1WTQA 4R4OA 1PH9A 1SYEA 2Q2UA 5CV9A 4LF7Q 4KY5A 3HKSA 1I3QH 2IX0A 1CT1D 4YHHQ 4G57A 1RD9D 4UP9A 2IHEA 1FJGL 3CC2A 4LFBQ 4GOPA 1X3FA 2Y0SB 5I9OA 3GDEA 2NVYB 3OIPA 2F4VL 1RIPA 3X3NA 4V0BA 1HR0W 2F0PA 3PO2H 3H3VH 2JEBI 3FDTA 1N36Q 2R93G 1QNUA 3EN2A 1KL9A 1EU3A 2UUCQ 2HQEA 3PO3B 5AFWA 2CVRA 1F9PA 1QVGA 3WOFA 1CUKA 4X3TA 1Y8NB 4IUQA 4NKLA 5JEAJ 3NELA 5M3MH 2PMZE 1YHAA 3G6JB 1HTLD 3C2PA 4ZKCB 1BQQT 3RZOB 2CQAA 1QZGA 5JVG3 5LMUQ 4DPGA 2F03A 2DGYA 1IBLQ 4J6HA 2R7DA 3PGZA 2HIVA 2BCOA 1I6HH 3E9HA 1EY5A 1EY9A 1T9HA 2E76C 4H44C 3T1YQ 2SEBD 4I7ZC 5IT9L 3S14H 3K6OA 1EYAA 1PFBA 4GKJQ 4CBVA 1EL0A 5ELFA 4KHVA 3J81i 4K5XA 1MBYA 1VQJA 3NSWA 4O2DA 2QILA 4CJ2C 1XXGA 5COYA 5ELNA 1HZBA 3S15B 2A68C 3I3CA 4NMZA 4AH6A 5IYBH 5FLMG 1QB5D 4HJAA 3CF5A 4FF3A 1G51A 1DOLA 1MD2D 2MJ8A 3CCSA 1HNWQ 2L5TA 1LLRD 1BCPF 1HCZA 4P75A 1PH4A 1IBMQ 2ZJQA 1KRTA 4LF7L 4OXPA 4DAPA 2A1AA 5EBDA 1LTID 5I4DA 1NCVA 4DNTB 2X6GA 2A68D 1LV9A 2OTJA 4YHHL 1Q8IA 2VXWA 4RH6A 1JJ2A 4F7XA 3QR8A 3D0FA 2DNCA 5JPMC 1A3TA 4BY1G 3F2BA 1S40A 2R93H 2NVXB 1N36L 1A8VA 1EFID 5JEAG 2LKVA 3MXNB 5KEEA 4WJ4A 3GTMB 1N34Q 1B3QA 1GD7A 1A62A 1WYDA 3GQBA 3S24A 4GN4B 1OXXK 1IBKL 3TS0A 4K6LA 3HEJA 3CQZB 1GOZA 5FLXc 1NMFA 2O4XA 4NXMQ 3QB3A 4L5QA 3PIOA 1IBLL 1S3OA 2N3SA 3SVMA 3U50C 4A3KB 2TSSA 3I72A 3J7YW 3F1ZA 2DNEA 1TS2A 3MAQA 3G6EA 2KOLA 5JPNC 1JOOA 2OQKA 4AYBB 4AQYQ 2EYMA 1X32A 1MI2A 4N9PA 2EVBA 3AFQA 3KJPA 4KTAA 3ITPA 3RD4A 4HSPA 1Q82C 3A74A 1STYA 4PG3A 1YEZA 4RG1A 2ZTEA 3QWNA 1YVCA 3CCMA 1NR2A 5E4WC 3ZYYX 2F0OA 4XDXA 5FLMH 2E2JH 3P7JA 1F9RA 1K8AC 4Y7NH 5D14A 3K7AB 3JAML 2K52A 1JC7A 2IX3A 5C3EG 1HNWL 2CWAA 4TQUS 1IBML 1TWHH 3NK9A 4YY3Q 1PH2A 1MGSA 3A54A 3CCVA 2K1BA 5JJIA 1AN8A 1O7YA 3P75A 5C4XG 3TP8A 1XJVA 3FKIH 2KVMA 2EJFC 5EGTA 1GXDC 4NPSA 5IE8A 1WTXA 1T5EA 4ID6A 2QF7A 3CMEA 2Z8LA 3J7A5 4BY1H 1B8AA 1CHPD 4ZQ3A 2ENBA 4RKLA 1VQ4A 1PTOF 1V43A 1GUGA 2PNHA 4HIMA 3AMUA 3I73A 4MHEA 2B2VA 4IPDA 1STEA 2E5LQ 5GAHC 2NZ1D 1N34L 4C2MB 2KHIA 4H13C 5CBAE 3U9SA 3S1RH 3T53B 3MXPA 5NUCA 3UDIA 1N8RC 1LM0A 1RODA 1JB3A 1P8LA 5IP7G 1EU4A 3NTHA 2EYOA 2RSOA 1N32Q 4G7OC 1JICA 4NXML 2F0KA 2OTLA 3TEHB 3PIP3 4JI8Q 2NVQB 1II3A 1JORA 3WOEA 2K14A 2RHSB 5DM63 1WVLA 2CH4W 4B9WA 3MFGA 2VW9A 3R8BA 1JJCB 2B63B 2NN6G 1EOTA 3WDNA 5C44B 1Y1WB 1D6EC 4RGOS 1D1KA 3W3AA 2F0IA 2G9HD 4CDFC 3NEMA 5CV4A 1ESRA 2LS01 1U4RA 1VMCA 1M1KC 1SNMA 4KN7C 1IKMA 3T4AC 4L8JA 2J4XA 1IYJB 4A3DG 1BDOA 4DR5L 4KHPL 4HJ7A 2D5DA 3R2TA 2MP1A 1YHBA 5C3EH 1D2BA 2WKDA 4GLVB 4A3MB 2Q2HA 4YY3L 5IWAQ 1VQLA 5C4XH 1DD2A 2CWPA 1X54A 2EYLA 4A3CG 1K8GA 3J7ZC 2EZVA 5CORA 3LX0A 2BOSA 2NZHA 4ME5A 3VYSA 2RCNA 3K59A 2RSNA 3BDCA 4F87A 4DR3Q 3U4ZA 1EWIA 2R92G 1SMXA 5KYLA 2KQ3A 1ET6A 3TP6A 2ZXRA 1I3QB 4A3BB 2E5LL 1SNDA 3ND8A 1EY8A 4CDDC 1Z6HA 3NHHA 5IIFA 3HOUB 1YI2A 3I90A 5IP7H 3U9OA 4K8JA 4OL7A 4DK6C 1BKBA 4DV7L 3PO2B 1N32L 4EGVA 2KUMA 1L0WA 4FVMA 5BN4A 1B7YB 3U58A 1HZCA 1T5XD 2I5HA 1SR3A 4B3SL 3DMUA 3MXNA 1M8AA 1VQDA 5I6WA 4PZ6A 2JP1A 3VYUA 3RZDH 4C3IG 1B70B 4U673 5M3MB 4ILWA 2NN6H 5AJ3Q 1JWUD 3EVQA 3MZ5A 2PCFB 2JE6I 2OQ0A 3ICEA 1XNRQ 5IP9G 4DUYQ 2ID0A 4GLXA 1VQHA 1J9OA 2KA7A 1WD0A 2R7ZG 4WORA 1I6HB 1E1OA 4PZ7A 4A3DH 3IFTA 4LFAQ 3BYYB 2LXKA 4HIOA 3D8GA 1KDAA 1H9MA 1ICWA 1TWAB 5ELCA 5EKKA 1WTVA 3E0EA 3K58A 3M4QA 4DU9A 4WFN3 2X6LA 4DFAA 1Z47A 1HNZQ 5G3LD 3Q23A 2VQFL 5T1IA 4A3CH 4K14A 3GTJH 3HOWB 4DR7Q 4FXKC 2B2WA 3J80i 2B2UC 2MHVA 1KLGD 1TVXA 1SBBB 4J1MA 5FLXE 1NMGA 4EQNA 1YBYA 2JA6G 1XNQQ 4KLKA 4IUVA 5CGKA 1UEAB 4QY7A 3PMFA 1EYDA 2I5MX 4DR3L 2R92H 4B9XA 3I70A 3TN2A 2QCPX 2GN5A 4Y52H 4ZCKA 3G7LA 1D5MC 2YTYA 1TQOA 1E2VA 3NWTA 5JVH3 3NTKA 1DJRD 2Z6KA 1F2MA 1JQYD 1LTGD 4CJ0B 4QGUA 4JG2A 5GAEC 1QVFA 2NBFA 3GO5A 2MO0A 2RKSA 2F3VA 2F4IA 5C5LA 4H0LC 1KRSA 3STBC 2LXJA 5A2QL 4OWWB 4RGTA 1X65A 4DV2Q 1TY2A 5CV7A 1Y69U 1OXUA 2Z4HA 4QIWE 2WINB 1E22A 3I7FA 2I0QA 1LYLA 2F0TA 1DZ1A 1SRUA 3HKZE 4ZUIA 1PFMA 3DM3A 4QF4A 1N33Q 1FGBD 2GVAA 3TREA 3PF4A 3NXWA 4O1NA 4IOAA 4X65Q 1Q3LA 1BO0A 2IL8A 3KBXA 2CW0C 1GO3E 2VUMG 1JCKB 5M5XH 3RN2A 4DUYL 5E1FA 4K8IA 4GKKQ 2HCCA 3B6YA 3G4SA 1EY6A 1STAA 2C35B 2JQOA 4LFAL 1JE5A 1PYWD 3H0GG 2CW0D 4DK3C 4OIJA 2BDOA 4KY6A 1CK1A 4DV6Q 2F0UA 3I91A 1CA6A 1HNZL 3PIPA 5C3XA 5ISRA 2MNAA 1Y8PB 3URYA 4HN7A 1LTAD 3HOXG 4DR7L 1MHWC 2VS1A 2VNUD 4IUPA 1L1OC 1JMCA 2JA6H 3S2HH 1EZ8A 2MQHA 2E2JB 1XNQL 2N49A 4OGQC 3CCLA 2IHFA 4NXNQ 2FHTA 2D62A 4DV0Q 2WV6D 2A8VA 3HOZB 3KF6B 1SN8A 3E0JA 3JC66 3TZDA 1SYCA 3FKIB 4EQOA 1EZ6A 1UE6A 5FO7B 2D2CC 3TSSA 4DK0A 2YTXA 2ZXOA 1GUNA 2HCIA 5M5WH 4PMWA 1BBWA 1U0LA 2XWBB 3GTQH 3L9AX 1I4PA 5GQOA 3QOJA 2FMCA 1CHQD 1KLUD 3BZCA 1S5DD 1SNCA 1NNXA 4XIGS 1E3PA 3S1RB 1N33L 2IX1A 4B3TQ 2PQAB 5IOCA 1S5FD 1M90C 1E1TA 1RTNA 5KNCA 4X65L 2TMPA 2YU9H 5I2YA 2F4VQ 1GHKA 3T13A 4S3SA 4G7HC 4YWLA 4KD3A 3IAYA 2VUMH 5IT9c 1QWYA 2A6EC 4M8AA 1HZ9A 4GKKL 2VZAA 1CA5A 4JBKA 1UAPA 1PYBA 1Q46A 2EYJA 5EAYA 3GTGH 3MEHA 3KLSX 5KGUA 4QB4A 4ZLTF 1YNNC 1EEID 4X3SA 1OXTA 1CSQA 3H0GH 3GTPH 2A6ED 1BCPC 4DV6L 3H3VC 2GVBA 1B9NA 3RUZA 2K50A 1MKHA 3HOXH 2AKWB 1YNND 2NVTH 1R4PB 3CHBD 5A35A 2XNAC 3HS0C 2EY2A 5IYCH 1BCPD 2OWOA 5CBEE 3E3XA 2JK8A 3TBIB 1PH8A 2KCCA 4NXNL 4CDCC 2E8GA 4DV0L 3Q8DA 1HNXQ 1FR3A 3PQIA 1KTKA 1VQEA 1IYVA 5ELDA 2L9HA 4DA2A 1SYGA 1K73C 4A3JG 3L2PA 1EQQA 5M3FB 2O5JC 4A3FG 4IO9A 1WCMB 5LMNL 2UXCQ 1TS4A 3PUVA 2YV5A 1NAPA 4POFA 4R4TA 1Y1VB 4DAVA 1AE3A 2FINB 4B3TL 3OWEB 3R3OA 2NTSA 1AZPA 2BH2A 3K0XA 1IKLA 3GTOB 5CYUA 4OO1I 4FF2A 4TSSA 2QDBA 3CW2C 4CDEC 4RCNA 1I6VC 4N8FA 3FP9A 4JI4Q 4FDBA 1SE8A 4C3HG 2KCNA 3I2ZA 5C0XJ 3Q22A 1EY4A 3E6ZX 4K5VA 3LWUA 4ZUJA 2PZWA 3MXGA 3J80E 4L5TA 4A3IH 3RZDB 5HGQA 4YCUA 1IBKQ 3ULLA 4DN4M 4DUZQ 4JW0A 4GS3A 4JOIC 2WB1B 2XTIA 3JAMc 1VMPA 1WTOA 1XYIA 5FJ8G 2MO1A 4APVA 4AYBE 1TWFH 4GOPC 3CCQA 1W6KA 2HHHQ 4R8NA 3HOYB 4JI2L 1EQVA 2R3ZA 4C3JB 1I50H 3FMCA 1R9TB 1ZKOA 1VQMA 1E2ZA 3DWQA 1UE5A 1K83B 1A2UA 4R1JA 4OELB 5IGBA 1CZWA 2KCMA 1HNXL 3GTJB 1B3AA 1FL0A 1H9SB 1LT5D 1ILPA 3UDGA 1SXTA 1RKNA 1NSNS 4FF4A 3V96A 1NE3A 2JA8G 4BBSG 2JA9A 2JA7G 4A3JH 4JPBW 3BZDB 3HOVG 1X3GA 2HD3A 4A3FH 4FYDA 2R92B 1G8ZD 1U4PA 4XQQA 1PMRA 3NE5B 4ODGA 3VR6A 3I4NG 2MUYA 4LUOA 2UXCL 2LMCB 1HQRD 4R4QA 2HUGA 2EQSA 1X3PA 1KNEA 4ZK9B 1SNPA 4IURA 3KF6A 4ZRZA 1B1ZA 3C46A 1PXUA 1Y14B 1A6XA 1ONLA 2R6GA 1FNUA 1PZJD 5EPJA 5C0XG 2RVLA 2B3GA 1YJNA 1STNA 4C3HH 1G91A 4JI4L 2E2DC 1SFOH 1UUPA 2N88A 2IWHA 4P73A 2EY5A 3UDFA 3I4MB 3PUZA 2PQAA 1KABA 1MSGA 1PTOH 4DUZL 3MWYW 3H3VI 1OXVA 4POGA 3SK8A 1SYFA 4DNIA 5M5XB 1BOSA 2JA5B 3NUCA 1PZKD 2KECA 2D0PA 2OEOA 5FJ8H 3AQQA 1EYCA 3TQYA 1YJWA 3M85A 1G291 3S1NH 1GJXA 2HHHL 3EBEA 2PZTA 1WTRA 3KLRA 1QE6A 3VA7A 3HKZG 3IL8A 1VQ6A 3NWSA 3M3YB 1GKHA 3L0OA 4FXGC 2UUAQ 1SJHD 3HRZC 3D31A 1SSOA 2EYHA 3SEBA 3I55A 1VQ8A 2E2HB 1QUQB 4JI6L 4DXFA 2R61A 4HAEA 2JA8H 2AQ2B 5CV8A 4BBSH 2MPMA 2JA7H 1K8OA 5IT9E 2QA4A 1TWGH 1VQCA 2KENA 4KY7A 3HOVH 3OOCA 4DR5Q 4KHPQ 5KRUA 2N55A 3GTKH 1U4MA 3I4NH 1SE3A 1CQFA 4YCWA 1KDBA 5IGCA 2F52A 3CPWA 2UU9L 2L4NA 2JEAI 1TY0A 2PQEA 2PW7A 1HPCA 4XT1B 2JN4A 3H09A 5CC4A 3M9BA 1KAWA 1LABA 5KNBA 1WI5A 5C0XH 3VR2A 5M5WB 2B8GA 3GV6A 4FP5D 1PHJA 3GTQB 2D9UA 4A3EB 4C1NI 2ZT9C 3KYHC 5JEAH 1PH1A 3K57A 2JYOA 5KYIA 3CC7A 1SE2A 2ZTCA 1PH7A 3BVGA 3A5UA 3I4OA 4A93B 1JR0D 4UAIA 4L63B 2DUDA 3SK5A 1VCIA 3IKJA 3OW2A 3RLNA 1I4GA 4HMIA 2BA1A 3S2DB 1JOKA 5BN5A 4L6TB 1AE2A 1MIUA 1Q90A 1GM5A 2ICEC 2M00A 4DV7Q 2X69A 1DONA 4QUCA 1ENFA 1LTBD 3NENA 1BVSA 4IFDJ 3GTGB 4HCEA 4B3SQ 4FO2A 2KCTA 1XWEA 1L1OB 3J81L 1B9MA 4BY7B 1YJ9A 1C0AA 4R4CA 3M4OB 1B2TA 2Y0SG 3BDLA 4IZ8A 2Q8RE 5DM73 4DV5Q 2UUAL 1WFQA 4MTKA 2OF1A 3ZJYC 2V1CC 2NVTB 1GVPA 3RR5A 1HR0Q 1HFNA 3PO3G 2ZM6L 3S17H 4X3UA 2XRSD 3PF5A 3KBGA 1TWCH 2OT2A 4DR2Q 1LTLA 1IHZA 2CCZA 4BBRB 2Z0SA 1NUCA 2VQFQ 1PA6A 2SNSA 1EY7A 4MTNA 2PI2A 4A76A 1WJJA 4RWSC 1UNSA 1TS3A 1H9SA 1F2LA 2V4DA 5CV5A 4CHTB 3JAME 4ULLA 4A4IA 2EYPA 1BNZA 3QJYA 4J15A 1UE1A 3CCEA 4WJWA 2SNMA 3A8KE 3ONAB 4LUZA 3EFXD 3I56A 1GUTA 1KNAA 1SLJA 3SHLA 4LF9Q 3J81j 3DM1A 2Q2TA 5TSSA 1S72A 2AMCB 3CAMA 2RF4A 3RN5A 4JV5Q 1VDZA 3PCOB 3CC4A 1H9JA 1Z7TA 2AQ1B 4IFDG 4UY8C 1VQGA 3DWAA 1VQAA 2JSOA 1NTGA 3W1BA 3V2TA 1BBXC 1U5KA 3TZUA 3EIVA 2HIXA 1KIXA 2AHOB 4ZAIA 2QW7A 3KUPA 3VYRA 1TR5A 4A3IB 3Q24A 4PQXA 3FPUB 2K5NA 4JI3L 1QOHA 2NVYH 2YTVA 1RHPA 4DV5L 1CKMA 1BXTA 1UWVA 1IW7C 1ZEQX 2WAQB 2C9OA 4DV1Q 2Z1CA 4X64Q 3PO3H 1HR0L 1PRTF 3KLWA 1XPOA 4WRDA 2H5XA 2K5WA 2I5LX 2CKZB 4K6DA 2EY1A 3K80C 4LW1A 1LTTD 2B2UA 1FGUA 3GTLH 3P20A 4KN4C 1O7ZA 4O0AA 1OXSC 1IW7D 4I65A 5F2DA 2O2LD 1G6ZA 3S14B 3OWFA 5JJLA 1K28A 4RCOA 1S4ZA 4DR2L 1HQMC 4I7AA 3RZOH 3S1MH 5ELEA 4K5WA 2L11A 2XIWA 2PYKA 2XSCA 3KK7A 2QDLA 1QUQA 1QVCA 2K04A 2ZJRA 2FFKB 2K5VA 4A3KG 2IT1A 1HTPA 2B2TC 3UE0A 3U4VA 4KD4A 4BA1I 2AUJD 3HP3A 2RCFA 4JI7L 1V1OA 3AFPA 5HGTA 4K0KL 1PYSB 2L1BA 3DEPA 4NB3A 4RHRA 1J5EL 1R4QB 1Q86C 1X55A 2K33A 2PPBC 4HTHA 4J8QA 2WACA 4LF9L 4Z9CB 5IGGA 4B3ML 1C9OA 2YYZA 3F8TA 4TRDA 3C3LA 4JBWA 1JE4A 3BG3A 1AFPA 4ALPA 4JV5L 4IPHA 4JI1Q 3A0JA 4H7BA 4IFDH 3H91A 1MSHA 1VS0A 3NPPA 1HH2P 3BJUA 2AWOA 5M5YH 2R93B 5D65A 4P71A 4L5SA 3ER0A 1SFOB 1VQBA 4C3IH 1MJEA 1JWMD 1VQKA 3OW7A 2KBNA 4MIUA 3N6RA 1RL2A 1IXRA 5IP9H 2NVXH 2NWGA 4OX9Q 4DK1A 2ALYB 2R7ZH 4IQZA 4PV1C 4DV1L 4X64L 2RA4A 3CCUA 3QG1A 1NR4A 4ME3A 1MJCA 1VQOA 1LTRD 1XPUA 2BA0A 2NN6I 1YZ6A 1EWCA 3BS1A 1VF5C 3ERQA 1B44D 1X56A 3CQZH 1ZXTA 1FVIA 1V8QA 3AYHB 1GHJA 2VB3X 4DF7A 3K0YA 5K5PA 4HEDA 2JA8B 3OSOA 3SK4A 3OMGA 1NBWA 2NTTA 1QG7A 1EOVA 2C5CA 2KHJA 4Y7NB 5I2XA 3GTKB 1O78A 4IOCA 1ET9A 3HZXA 2B63G 3KFUA 5C44G 1Y1WG 1TWHB 5IGDA 2F0WA 4HJ9A 1PVOA 1K0SA 4N9TA 3CCRA 4LWCA 1IL2A 2F0GA 1DM0B 1G2SA 1SEBD 1P16A 1F2YA 4JI1L 1Y8OB 1WTPA 4BY1B 1JJGA 5IGEA 3K7AH 2NYZD 4XXEA 3RNUA 4A3MG 2BE5C 2WP8J 5LMNQ 1RCVD 4G4KA 1EEFD 1KHIA 3TRZA 4JI0Q 5T1GA 1W6JA 5G3LF 1STBA 5FOBB 4NW2A 4OONA 2LSSA 2FJ2A 5A2QE 4HIKA 1O7IA 4IN3A 2BE5D 2SDFA 4YWMA 5K36G 1Q1BA 1BBUA 1AH9A 3PSIA 4PMBA 4OX9L 3SR1A 1E7ZA 2NUCA 2L55A 3BVMA 4KMUC 4RA8A 4C2MH 4A3BG 1H9KA 4P2CB 3E5SA 2EPBA 1VQ7A 2F3WA 1QZHA 3EQLC 2AWNA 1HZAA 5EKLA 3HOUG 5BR8Q 4O42A 2WB1E 1RF2D 2N78A 3PUWA 1V1PB 3FEWX 1TXYA 2IW3A 3DXJC 3PO2G 3DHQA 1C7YA 3A56A 2NVQH 4DV3L 4GNXC 2A74C 2KEDA 4XQNA 2EJGC 5BN3A 4C1NK 2EXDA 2B2YC 4JI2Q 1TKWB 1TWCB 3FVQA 4DR1Q 5C3EB 2B63H 2K5HA 5M3MG 5JJZA 2PI2E 5C44H 1VQIA 1Y1WH 3X3MA 1KQSA 5CR3A 4DR4Q 4YIJA 2K05A 4IJHA 5CV6A 4OIKA 1TU2B 3PV0A 5C4XB 2K01A 4P72A 3ULJA 3FRPB 3I8ZA 3CXCA 1SYDA 4X66Q 3VDYA 3MVVA 2E74C 3EROA 3GP7A 2ZJPA 1ZYRC 2F1MA 4RAUC 5D3DA 1VF7A 3TP5A 1EYGA 1K8MA 2A5HA 3UE1A 1VQPA 5E4XA 1A15A 3D6CA 2AUKA 5C6AA 4JI0L 3MA2B 3HOWG 4IUTA 3KDFB 1D5ZC 1ZYRD 2BH8A 3L7ZC 3OIQA 1BF4A 2F0VA 5K36H 4Q0FA 4KV6A 4JBMA 1HXYD 2L15A 1DXMA 1AP0A 2K6AA 4RGMA 4A3BH 2F0QA 4JOIA 1F9QA 4UHVA 2P5ZX 4L5RC 2VL6A 4RFBA 4CKBA 1I4RA 3JAMi 3W5OA 3HOUH 1KC8C 2F0JA 1A2TA 5BR8L 4NP5A 4XYOA 3NQIA 1A0IA 1K3BC 1ILQA 1YNJC 3OHXC 3CRKC 1SMYC 1W3SA 3CCJA 1D8LA 3GD7A 2Q8IB 4RHSA 1LT6D 3WWVA 4DR6Q 4A3DB 2IY5B 3CU7A 3GTLB 1QILA 1YNJD 4LF5L 2CFMA 3P1HA 3F2DA 1PTOC 5D3IB 4DGZA 4DR1L 3NTIA 1SMYD 1ENAA 1Q7YC 3S1MB 3V05A 1PH3A 4DR4L 2EXZA 4IPGA 3UI2A 1XMQQ 3DUZA 4JI6Q 4RGNA 2RDGA 1SE4A 4X66L 1K0RA 3LGJA 4TVAB 4EX5A 1RJTA 1PTOD 1S5BD 2DJGC 3K5NA 1TWAH 4LJZC 1TS5A 3F2CA 1VQ9A 2F0LA 4DXGA 3NBHB 1LT4D 4QCLA 3HOWH 4DAMA 1WD1A 2UU9Q 2RQXA 2UXDQ 4DV4L 2F0MA 3MC0B 1DOKA 1UEBA 1PH5A 1CSPA 3J81c 2UUBL 4DNRB 2Z9HA 3J7AV 2WKCA 1SAPA 1LO5D 2NZOA 3A8JE 4DKAC 5M5YB 2WIIB 3NP8A 4HSVA 3HOZG 5J39A 4C3IB 5FO8B 3VR5A 3FKIG 4LFBL 4PMCA 3OPOA 3D3RA 4JBJA 1EUJA 2RDHA 2I07B 2PO4A 5IODA 4QL5A 4QMGA 4XT3B 4LUVA 4U68A 1E0BA 1H95A 1LACA 4FF1A 3TP7A 1IZ6A 2E2IH 2R7ZB 3A7LA 2Q2IA 3H15A 2UUCL 4GN5A 4A3GG 1I5FA 4CKCA 4UP7A 1ENCA 1VQ5A 4IUNA 3SE0A 4DR6L 4X62Q 3GV3A 4YWKA 1X6OA 3T51B 3IRBA 4UDUC 2QEXA 2A69C 4HJ8A 1ASYA 2HT1A 1VQFA 3VR4A 1V1PA 1BUVT 1HA6A 5HY6A 1JWSD 4A75A 1H9RA 2PMZB 5LMUL 5C4HA 1U9RA 1XMQL 3A7AB 3S16H 3K5MA 4P74A 2L0CA 4V190 4KHZA 2DN8A 1TIID 5C4JH 2ZM6Q 1GUWA 2A69D 2JA6B 3S2HB 5M9OA 1B53A 2F0NA 3T1YL 4CJ1B 1LUZA 3BZKA 5E7NA 4GKJL 4BS9A 4LAAA 1KD1C 3CKIB 2UXDL 3MEFA 3RLFA 5HURA 3OTOQ 4B08A 2PZUA 4IALA 1YITA 2Z6BA 5GAGC 4QUFA 5EBCA 1OO9B 5I9PA 3AU7A 5JJKA 1EIGA 5IGFA 3E9IA 3HOZH 3DLLA 1EWHA 1GUOA 1PRTC 4KJOA 4XTCS 3S1QH 4FXDA 1KXLA 1J6QA 1SYBA 4MN3A 1TT2A 3A55A 1XTCD 3KDFA 4LFCQ 4QJFA 4DAYB 4LF6Q 1PZID 3EA6A 2YU9B 2VUMB 4JC0A 1PRTD 3KOJA 4HCSA 3VA5A 5M3FG 2R7FA 4OWXB 5LHY1 4HIDA 1WCMG 4A3GH 4LF8Q 1Y1VG 4X62L 1S5ED 3H0GB 3IFDA 3GTPB 4CGYB 4LF4Q 1L0XB 3R2IA 3OYYA 5C4ZA 2QKIC 3MTSA 4JI3Q 2GA4B 4EQ5A 4E6IA 2WAQE 2B2VC 5J1ZA 2ZXPA 1UE7A 3K8AA 3OMCA 2HDMA 3RMHA 4JCVE 3HOXB 1RDPD 4YCVA 1D5XC 2H4OA 1Q12A 1FNVA 1AW7A 2XWJB 3K7UC 1A63A 2NB0A 5I6YA 4AQYL 4BWGB 4BA2I 2XGTA 2VB2X 3HGBA 2KEEA 2WB1G 2RDFA 3MFYA 3AEVA 1EIHA 5DNFA 3OTOL 2PW5A 4ZYSA 1C8CA 5LMNW 4XQJA 4GN3B 2L12A 5FLXL 4JI7Q 3HOYG 4C3JG 3H94A 4K0KQ 2XN9C 1J5EQ 3AB9A 4PNYA 3NBHA 4B3MQ 4MZ9A 1STHA 2G9DA 2LFNA 3C1FA 4FNFA 1CKOA 4N8X1 1DGSA 1U4LA 3SGIA 5C0XI 1BR9A 4LFCL 2KJXA 3A5ZB 4WJ3M 4LF6L 1M4VA 2I46A 1CI3M 1I4QA 5M3FH 1B50A 1BCPB 3J7AF 5LL6S 3H6MA 5FKAC 1WCMH 1EQTA 4C56C 2ATWA 4A3LG 1C48A 1I4XA 3QO2A 4LF8L 3Q0AA 1HA5A 1A3UA 4ZKBB 1Y1VH 3KLSA 3F2UA 3KF8B 4OHJA 1F77A 2BDNA 4R8IA 4GNXB 3VYTA 3BDOA 1GUSA 3T16A 3VR3A 1EY0A 5DEHA 4LF4L 1L2FA 1Q8KA 3GTOH 1DYQA 4RMFA 2K7VA 4PZ8A 5EJWA 1CFMA 2EJMA 5E3FA 2K75A 1LTSD 3PUXA 4RKBA 1J8IA 4KKTA 2Q8TA 4JI8L 3J81E 4KKSA 1A3VA 3L3OC 1HJPA 1TWFB 4B3RQ 1CKNB 5DAUA 5EPLA 1JB7A 5ELOA 5KNDA 3W2DA 3I4MG 2B2TA 1I50B 2UXBQ 4G7ZC 5C3WA 3CRLC 1ML0D 1AEXA 2JXMB 2MGSA 1NY4A 2K28A 2JA5G 1PDQA 1HHVA 4HMJA 5L37A 1HFGA 3W1GA 3S9WA 1SDFA 4A3JB 1Q81C 3HOYH 1Q1EA 2ASBA 4C3JH 1R9TH 4A3FB 4AYBG 2M9VA 1K83H 5IYDG 5IWAL 2CH4A 2IPKD 2K5QA 1B4OA 3K81C 3D4DA 1YNXA 1EQRA 3S15H 2O5IC 1ESFA 1E2WA 4M1UB 3FHWA 3EJIA 4F8MA 2QEJC 5C5MA 3KJOA 4IJLA 5GADC 2XRQD 1PH6A 3N52A 4A3LH 5ELBA 2SOBA 4KKUA 3J80c 3G71A 1WTWA 1DOMA 2B2WC 4C3HB 3QOLA 1XPRA 2H1EA 1DCZA 1LT3D 1EIFA 1E24A 3MXUA 3O13A 1IYUA 2G5DA 2RHQB 1D1IA 4JVZA 3T1HQ 4GOPB 3RLOA 2XVSA 5JOBA 2F0SA 1QJOA 4DAYA 1PTOB 4BXXG 2MFIA 4OO1G
chains in the Genus database with same CATH topology
1SNQA 1F9SA 1O7LA 2E2IB 1SJED 3NBIA 3S1NB 5J22A 4KK7A 5EPKA 4EQPA 4TKOB 2K32A 1JOQA 1AZQA 1HUNA 3S16B 1CQVA 3A8IE 1XX8A 2F0FA 3M7GA 2B39A 2F0EA 4BBSB 5C4JB 4LK1C 2JA7B 1F2ZA 2EOTA 2DY8A 1TWGB 3HOVB 1CZGA 5CMDA 2E75C 2EDGA 3I4NB 3K5LA 2K03A 4K2KA 3BVZA 3MHBA 3M7NA 2HDLA 3NQTA 2AQ3B 2EY6A 5FO9B 3LNNA 1KDCA 4LMQD 5KIXA 2K5DA 3C1EA 1FYCA 4KI0A 3S1QB 3QIAA 1KAAA 2B8FA 4IFDI 4KJNA 2CHBD 2A6HC 4IUUA 2IJ0A 3BYTB 4ABNA 1STGA 3SXHA 4OO1H 2RBMA 2PNRC 3T56B 1L0YB 3D4WA 4A3GB 4JK1C 2A6HD 5JAVA 3PIO3 4QIWB 3KF8A 4K2LA 1G2TA 3PUYA 3ND9A 4HR7B 3HKZB 1HUMA 3J80L 1QCBD 2LY7A 2B2YA 4GZYC 1CM9A 1IL8A 1X3QA 1S5CD 2Z4IA 3TMEA 2FMMA 4EVOA 1FNWA 3R93A 3I4LA 2M2LA 3D4RA 2ICIA 3D6WA 4R9WA 1PLFA 3S17B 3LWEA 5EQ0A 1HRJA 2F0HA 4CKEA 1FD7D 1RTOA 5FK9C 3M4YA 2J7ZA 1PRTB 2KHSA 4F88A 3SK6A 1CTMA 3DEOA 1O80A 4XYQA 1QNKA 3DWPA 2OXPA 3Q6SA 4X3KA 3SDZA 2EE1A 2EYFA 3TDQA 5LL6X 2F0DA 3HG9A 3K5OA 1PFNA 2A73B 2J0TD 3FPPA 5EKIA 1SNOA 1C4QA 4NDXA 4Q5VA 2DY7A 1I4HA 1WTQA 1SYEA 5CV9A 4KY5A 2IX0A 1CT1D 4G57A 1RD9D 2Y0SB 5I9OA 2NVYB 3OIPA 3X3NA 4V0BA 2F0PA 2JEBI 3FDTA 1QNUA 1EU3A 3PO3B 2HQEA 5AFWA 2CVRA 1F9PA 3WOFA 4X3TA 1Y8NB 4IUQA 4NKLA 5JEAJ 3G6JB 1HTLD 3C2PA 4ZKCB 1BQQT 3RZOB 2CQAA 5JVG3 2F03A 4J6HA 2BCOA 1EY5A 1EY9A 4H44C 2E76C 2SEBD 4I7ZC 5IT9L 3K6OA 1EYAA 1PFBA 4CBVA 1EL0A 5ELFA 4KHVA 4K5XA 1MBYA 3NSWA 2QILA 4CJ2C 1XXGA 5COYA 3S15B 2A68C 3I3CA 4NMZA 1QB5D 4FF3A 1DOLA 1MD2D 2MJ8A 2L5TA 1LLRD 1BCPF 1HCZA 4DAPA 5EBDA 1LTID 5I4DA 1NCVA 4DNTB 2X6GA 2A68D 1LV9A 1Q8IA 2VXWA 4RH6A 4F7XA 2DNCA 5JPMC 1A3TA 2NVXB 1EFID 5JEAG 2LKVA 5KEEA 3GTMB 3GQBA 1OXXK 4K6LA 3HEJA 3CQZB 1GOZA 2O4XA 3QB3A 3SVMA 4A3KB 2TSSA 3I72A 3J7YW 2DNEA 1TS2A 3MAQA 2KOLA 5JPNC 1JOOA 4AYBB 2EYMA 1X32A 1MI2A 4N9PA 2EVBA 4KTAA 3ITPA 3RD4A 4HSPA 1STYA 3QWNA 1NR2A 5E4WC 3ZYYX 2F0OA 4XDXA 3P7JA 1F9RA 5D14A 3K7AB 3JAML 2IX3A 1JC7A 4TQUS 3NK9A 1MGSA 3A54A 2K1BA 1AN8A 1O7YA 3P75A 3TP8A 2KVMA 2EJFC 5EGTA 1GXDC 1WTXA 1T5EA 4ID6A 2QF7A 2Z8LA 1CHPD 4ZQ3A 2ENBA 4RKLA 1PTOF 1V43A 1GUGA 3AMUA 3I73A 4MHEA 2B2VA 1STEA 2NZ1D 4C2MB 4H13C 5CBAE 3U9SA 3T53B 3MXPA 5NUCA 1RODA 1JB3A 1EU4A 3NTHA 2EYOA 2RSOA 4G7OC 1JICA 2F0KA 3PIP3 2NVQB 1II3A 1JORA 3WOEA 5DM63 1WVLA 4B9WA 3MFGA 3R8BA 2B63B 2NN6G 1EOTA 3WDNA 5C44B 1Y1WB 1D6EC 4RGOS 1D1KA 2F0IA 3W3AA 2G9HD 5CV4A 1ESRA 2LS01 1U4RA 1VMCA 1SNMA 4KN7C 1IKMA 3T4AC 4L8JA 2J4XA 1BDOA 2D5DA 2MP1A 3R2TA 1D2BA 2WKDA 4A3MB 1DD2A 2EYLA 2EZVA 5CORA 3LX0A 2BOSA 4ME5A 3VYSA 3K59A 2RSNA 3BDCA 4F87A 5KYLA 2KQ3A 1ET6A 3TP6A 2ZXRA 1I3QB 4A3BB 1SNDA 3ND8A 1EY8A 1Z6HA 3NHHA 5IIFA 3HOUB 3I90A 3U9OA 4K8JA 4OL7A 3PO2B 4EGVA 2KUMA 4FVMA 5BN4A 1T5XD 3DMUA 3MXNA 1M8AA 5I6WA 2JP1A 3VYUA 4C3IG 4U673 5M3MB 4ILWA 2NN6H 1JWUD 3EVQA 3MZ5A 2PCFB 2JE6I 2ID0A 1J9OA 2KA7A 1WD0A 4WORA 1I6HB 3IFTA 3BYYB 3D8GA 1KDAA 5ELCA 1H9MA 1ICWA 1TWAB 5EKKA 1WTVA 3K58A 4DU9A 4WFN3 2X6LA 4DFAA 1Z47A 5G3LD 3Q23A 5T1IA 4K14A 3HOWB 4FXKC 2B2WA 2B2UC 2MHVA 1KLGD 1TVXA 1SBBB 4J1MA 5FLXE 4EQNA 5CGKA 4IUVA 1UEAB 3PMFA 1EYDA 4B9XA 3I70A 3TN2A 2QCPX 3G7LA 1D5MC 1TQOA 1E2VA 3NWTA 5JVH3 3NTKA 1DJRD 1F2MA 1JQYD 1LTGD 4CJ0B 2NBFA 3GO5A 2RKSA 2F3VA 2F4IA 5C5LA 4H0LC 5A2QL 4RGTA 1TY2A 5CV7A 1Y69U 1OXUA 2Z4HA 2WINB 2F0TA 1DZ1A 4ZUIA 1PFMA 4QF4A 1FGBD 3NXWA 4O1NA 1Q3LA 1BO0A 2IL8A 3KBXA 2CW0C 1JCKB 5E1FA 4K8IA 2HCCA 1EY6A 1STAA 1PYWD 2CW0D 4OIJA 2BDOA 4KY6A 1CK1A 2F0UA 3I91A 1CA6A 5C3XA 5ISRA 1Y8PB 3URYA 4HN7A 1LTAD 2VNUD 4IUPA 1EZ8A 2E2JB 4OGQC 2FHTA 2D62A 2WV6D 3HOZB 3E0JA 3TZDA 1SYCA 3FKIB 4EQOA 1EZ6A 5FO7B 2D2CC 3TSSA 4DK0A 2ZXOA 1GUNA 2HCIA 4PMWA 2XWBB 3L9AX 1I4PA 3QOJA 2FMCA 1CHQD 1KLUD 1S5DD 1SNCA 4XIGS 3S1RB 2IX1A 5IOCA 1S5FD 1RTNA 5KNCA 2TMPA 5I2YA 1GHKA 3T13A 4S3SA 4G7HC 4KD3A 3IAYA 1QWYA 2A6EC 4M8AA 1CA5A 1UAPA 2EYJA 3MEHA 3KLSX 5KGUA 4QB4A 4ZLTF 1YNNC 1EEID 4X3SA 1OXTA 2A6ED 1BCPC 3H3VC 1B9NA 3RUZA 1YNND 1R4PB 3CHBD 5A35A 2XNAC 3HS0C 2EY2A 1BCPD 5CBEE 3TBIB 2KCCA 1FR3A 1KTKA 1IYVA 5ELDA 2L9HA 4DA2A 1SYGA 5M3FB 2O5JC 1WCMB 1TS4A 3PUVA 1NAPA 1Y1VB 4DAVA 2FINB 3OWEB 3R3OA 2NTSA 1AZPA 1IKLA 3GTOB 5CYUA 4OO1I 4FF2A 4TSSA 2QDBA 4RCNA 1I6VC 4C3HG 2KCNA 5C0XJ 3Q22A 1EY4A 3E6ZX 4K5VA 3LWUA 4ZUJA 2PZWA 3MXGA 3J80E 3RZDB 4DN4M 2WB1B 1VMPA 1WTOA 1XYIA 1W6KA 4R8NA 3HOYB 1EQVA 2R3ZA 4C3JB 3FMCA 1R9TB 1ZKOA 1E2ZA 3DWQA 1K83B 1A2UA 5IGBA 1CZWA 3GTJB 1B3AA 1H9SB 1LT5D 1ILPA 1SXTA 1RKNA 1NSNS 4FF4A 3V96A 3BZDB 4FYDA 2R92B 1G8ZD 1U4PA 4XQQA 1PMRA 3NE5B 4ODGA 3VR6A 2MUYA 2LMCB 1HQRD 2HUGA 1X3PA 1KNEA 4ZK9B 1SNPA 4IURA 4ZRZA 1B1ZA 3C46A 1PXUA 1A6XA 1ONLA 2R6GA 1FNUA 1PZJD 5EPJA 5C0XG 2RVLA 1STNA 1G91A 2E2DC 1UUPA 2N88A 2IWHA 2EY5A 3I4MB 3PUZA 1KABA 1MSGA 1PTOH 3MWYW 1OXVA 3SK8A 1SYFA 5M5XB 1BOSA 2JA5B 3NUCA 1PZKD 2KECA 2OEOA 1EYCA 3M85A 1G291 1GJXA 2PZTA 1WTRA 3KLRA 1QE6A 3VA7A 3IL8A 3NWSA 3M3YB 4FXGC 1SJHD 3HRZC 3D31A 1SSOA 2EYHA 3SEBA 2E2HB 4DXFA 2R61A 4HAEA 2AQ2B 5CV8A 2MPMA 1K8OA 5IT9E 4KY7A 3OOCA 5KRUA 2N55A 1U4MA 1SE3A 1CQFA 1KDBA 5IGCA 2L4NA 2JEAI 1TY0A 2PQEA 2PW7A 1HPCA 4XT1B 3H09A 5CC4A 1LABA 5KNBA 5C0XH 3VR2A 5M5WB 2B8GA 3GV6A 4FP5D 3GTQB 2D9UA 4A3EB 4C1NI 2ZT9C 5JEAH 3K57A 2JYOA 5KYIA 1SE2A 3BVGA 4A93B 1JR0D 4UAIA 4L63B 3SK5A 1VCIA 3IKJA 1I4GA 4HMIA 2BA1A 3S2DB 1JOKA 5BN5A 4L6TB 1Q90A 2ICEC 2M00A 2X69A 1DONA 4QUCA 1ENFA 1LTBD 4IFDJ 3GTGB 4HCEA 4FO2A 1XWEA 3J81L 1B9MA 4BY7B 3M4OB 1B2TA 3BDLA 4IZ8A 2Q8RE 5DM73 2OF1A 2NVTB 1HFNA 4X3UA 2XRSD 3KBGA 2OT2A 1IHZA 4BBRB 1NUCA 2SNSA 1EY7A 4RWSC 1UNSA 1TS3A 1H9SA 1F2LA 2V4DA 5CV5A 4CHTB 3JAME 4ULLA 2EYPA 1BNZA 3QJYA 4WJWA 2SNMA 3A8KE 3ONAB 3EFXD 1GUTA 1KNAA 3SHLA 3DM1A 5TSSA 1VDZA 1H9JA 1Z7TA 2AQ1B 4IFDG 3DWAA 2JSOA 3V2TA 1BBXC 3TZUA 4ZAIA 3KUPA 3VYRA 1TR5A 4A3IB 3Q24A 4PQXA 3FPUB 1QOHA 1RHPA 1BXTA 1IW7C 1ZEQX 2WAQB 2C9OA 2Z1CA 1PRTF 4WRDA 2K5WA 4K6DA 2EY1A 1LTTD 2B2UA 3P20A 4KN4C 1O7ZA 1OXSC 1IW7D 4I65A 5F2DA 2O2LD 1G6ZA 3S14B 3OWFA 4RCOA 1S4ZA 1HQMC 5ELEA 4K5WA 2L11A 2XIWA 2PYKA 2XSCA 3KK7A 2K04A 2FFKB 2IT1A 1HTPA 2B2TC 4BA1I 4KD4A 2AUJD 3HP3A 1V1OA 5HGTA 2L1BA 3DEPA 4RHRA 1R4QB 2PPBC 2K33A 4HTHA 4J8QA 2WACA 4Z9CB 5IGGA 4TRDA 2YYZA 3C3LA 4JBWA 1JE4A 3BG3A 1AFPA 4H7BA 4IFDH 3H91A 1MSHA 3NPPA 2AWOA 2R93B 5D65A 1SFOB 1JWMD 3OW7A 4MIUA 3N6RA 2NWGA 4DK1A 4IQZA 4PV1C 2RA4A 3QG1A 1NR4A 1LTRD 2BA0A 2NN6I 1EWCA 3BS1A 1VF5C 3ERQA 1B44D 1ZXTA 1V8QA 1GHJA 2VB3X 4DF7A 3K0YA 5K5PA 4HEDA 2JA8B 3OSOA 3SK4A 3OMGA 2NTTA 1QG7A 2C5CA 4Y7NB 5I2XA 3GTKB 1O78A 1ET9A 3HZXA 1TWHB 5IGDA 2F0WA 4N9TA 2F0GA 1DM0B 1G2SA 1SEBD 1F2YA 1Y8OB 1WTPA 4BY1B 5IGEA 2NYZD 4XXEA 2BE5C 2WP8J 1RCVD 4G4KA 1EEFD 5T1GA 1W6JA 5G3LF 1STBA 5FOBB 4NW2A 2FJ2A 5A2QE 4IN3A 2BE5D 2SDFA 5K36G 1Q1BA 4PMBA 3SR1A 2NUCA 2L55A 3BVMA 4KMUC 4RA8A 1H9KA 4P2CB 3E5SA 2EPBA 2F3WA 3EQLC 2AWNA 5EKLA 4O42A 1RF2D 1V1PB 3FEWX 3PUWA 2IW3A 3DXJC 3DHQA 3A56A 2A74C 2KEDA 4XQNA 2EJGC 5BN3A 4C1NK 2B2YC 1TKWB 1TWCB 3FVQA 5C3EB 5JJZA 3X3MA 5CR3A 4YIJA 2K05A 5CV6A 4OIKA 1TU2B 3PV0A 5C4XB 2K01A 3FRPB 3I8ZA 1SYDA 3MVVA 2E74C 3EROA 3GP7A 1ZYRC 2F1MA 4RAUC 5D3DA 1VF7A 3TP5A 1K8MA 2A5HA 5E4XA 1A15A 3D6CA 2AUKA 5C6AA 3MA2B 4IUTA 1D5ZC 1ZYRD 3L7ZC 3OIQA 1BF4A 2F0VA 5K36H 4Q0FA 4KV6A 1HXYD 1DXMA 1AP0A 2K6AA 4RGMA 2F0QA 1F9QA 4RFBA 4CKBA 1I4RA 2F0JA 1A2TA 4NP5A 4XYOA 3NQIA 1ILQA 1YNJC 3OHXC 3CRKC 1SMYC 3GD7A 2Q8IB 4RHSA 1LT6D 4A3DB 3CU7A 3GTLB 1QILA 1YNJD 3P1HA 1PTOC 5D3IB 4DGZA 3NTIA 1SMYD 1ENAA 3S1MB 3V05A 2EXZA 3UI2A 3DUZA 4RGNA 2RDGA 1SE4A 1RJTA 1PTOD 1S5BD 3K5NA 4LJZC 1TS5A 2F0LA 4DXGA 1LT4D 4QCLA 1WD1A 2RQXA 2F0MA 3MC0B 1DOKA 4DNRB 3J7AV 2WKCA 1SAPA 1LO5D 3A8JE 5M5YB 2WIIB 3NP8A 4HSVA 5J39A 4C3IB 5FO8B 3VR5A 4PMCA 3OPOA 3D3RA 2RDHA 2I07B 2PO4A 5IODA 4QMGA 4XT3B 4U68A 1E0BA 1LACA 4FF1A 3TP7A 2R7ZB 3A7LA 4CKCA 1ENCA 4IUNA 3SE0A 3GV3A 3T51B 4UDUC 2A69C 3VR4A 1V1PA 1BUVT 1HA6A 1JWSD 1H9RA 2PMZB 5C4HA 1U9RA 3A7AB 3K5MA 2L0CA 4V190 4KHZA 2DN8A 1TIID 1GUWA 2A69D 2JA6B 3S2HB 5M9OA 1B53A 2F0NA 4CJ1B 4BS9A 4LAAA 3CKIB 3RLFA 5HURA 4B08A 2PZUA 4IALA 4QUFA 5EBCA 1OO9B 5I9PA 3AU7A 1EIGA 5IGFA 1EWHA 1GUOA 1PRTC 4KJOA 4XTCS 4FXDA 1SYBA 4MN3A 1TT2A 3A55A 1XTCD 1PZID 3EA6A 2YU9B 2VUMB 1PRTD 4HCSA 3VA5A 5LHY1 1S5ED 3H0GB 3IFDA 3GTPB 4CGYB 1L0XB 3R2IA 5C4ZA 2QKIC 3MTSA 2GA4B 4E6IA 2B2VC 5J1ZA 2ZXPA 3OMCA 2HDMA 3RMHA 3HOXB 1RDPD 1D5XC 2H4OA 1Q12A 1FNVA 1AW7A 2XWJB 2NB0A 5I6YA 4BWGB 4BA2I 2VB2X 3HGBA 2KEEA 2RDFA 3MFYA 1EIHA 5DNFA 2PW5A 4ZYSA 1C8CA 4XQJA 2L12A 5FLXL 4C3JG 3H94A 2XN9C 3AB9A 4PNYA 3NBHA 1STHA 2G9DA 2LFNA 3C1FA 4FNFA 1U4LA 5C0XI 1BR9A 2KJXA 1M4VA 2I46A 1CI3M 1I4QA 1B50A 1BCPB 3J7AF 5LL6S 3H6MA 5FKAC 1EQTA 4C56C 1C48A 1I4XA 3QO2A 3Q0AA 1HA5A 1A3UA 4ZKBB 3KLSA 3F2UA 4OHJA 1F77A 2BDNA 4R8IA 3VYTA 3BDOA 3VR3A 1GUSA 3T16A 1EY0A 5DEHA 1DYQA 2K7VA 5EJWA 1CFMA 2EJMA 5E3FA 1LTSD 3PUXA 4RKBA 1J8IA 4KKTA 2Q8TA 3J81E 4KKSA 1A3VA 3L3OC 1TWFB 5DAUA 5EPLA 5KNDA 3W2DA 2B2TA 1I50B 4G7ZC 5C3WA 3CRLC 1ML0D 1AEXA 2JXMB 2MGSA 2K28A 1PDQA 1HHVA 4HMJA 1HFGA 3S9WA 1SDFA 4A3JB 1Q1EA 4A3FB 2M9VA 2IPKD 2K5QA 1B4OA 3D4DA 2O5IC 1ESFA 1E2WA 4M1UB 3EJIA 4F8MA 2QEJC 5C5MA 2XRQD 3N52A 5ELBA 2SOBA 4KKUA 1WTWA 1DOMA 2B2WC 4C3HB 3QOLA 2H1EA 1DCZA 1LT3D 3MXUA 3O13A 1IYUA 1D1IA 2XVSA 5JOBA 2F0SA 1QJOA 4DAYA 1PTOB 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCI A;  1X32 A;  1MI2 A;  3QO2 A;  1X3Q A;  1IKL A;  2B2U A;  4MN3 A;  1F9S A;  1QG7 A;  2FMM A;  1MSG A;  1DOK A;  4ZKB B;  1O7Z A;  3F2U A;  3TN2 A;  3MWY W;  2BDN A;  3R93 A;  4R8I A;  1B2T A;  2M2L A;  1G6Z A;  3G7L A;  2Q8R E;  1S4Z A;  3D6W A;  4IUV A;  5COR A;  4R9W A;  1PLF A;  4RAU C;  2KEC A;  3LWE A;  1NR2 A;  2L11 A;  5E4W C;  2XIW A;  5EQ0 A;  1SAP A;  4XDX A;  1HRJ A;  4CJ0 B;  3P7J A;  4HCS A;  1F9R A;  5EJW A;  5E4X A;  1A15 A;  4HSV A;  5EPK A;  1AZP A;  2K04 A;  1PFB A;  1RTO A;  5D14 A;  1HFN A;  1RTN A;  1J8I A;  2FFK B;  2RSN A;  4X3U A;  1WTR A;  4IUT A;  2Q8T A;  1AZQ A;  1EL0 A;  1HUN A;  1QE6 A;  2B2T C;  4DN4 M;  1MGS A;  1G2S A;  3IL8 A;  1XX8 A;  2J7Z A;  1BF4 A;  2K1B A;  3HP3 A;  1WTP A;  4CJ2 C;  1O7Y A;  3IFD A;  1SSO A;  2EOT A;  5COY A;  1CA5 A;  2L1B A;  3DEP A;  2DY8 A;  5EPL A;  1DZ1 A;  1VMP A;  3DEO A;  1O80 A;  2NYZ D;  3MTS A;  1QNK A;  2KVM A;  5CMD A;  1WTO A;  1XYI A;  2B2T A;  1PFM A;  3I3C A;  4HAE A;  2B2V C;  4XT3 B;  4U68 A;  4ZLT F;  1WTX A;  4X3S A;  1AP0 A;  1E0B A;  3Q6S A;  1ML0 D;  2HDM A;  2MPM A;  4RWS C;  3I90 A;  4X3K A;  1DOL A;  1F9Q A;  2EE1 A;  2MGS A;  2MJ8 A;  1F2L A;  2K03 A;  1Q3L A;  1JE4 A;  1BO0 A;  2K28 A;  1PDQ A;  2R3Z A;  2IL8 A;  4NW2 A;  4MHE A;  1HHV A;  1PFN A;  2N55 A;  2B2V A;  3KBX A;  2FJ2 A;  2KUM A;  1BNZ A;  3H91 A;  1HFG A;  3GV3 A;  2HDL A;  1NCV A;  1U4M A;  5EKI A;  1MSH A;  1SDF A;  2HCC A;  2NZ1 D;  1LV9 A;  2SDF A;  2X6G A;  4ZKC B;  2VXW A;  5CBA E;  3ONA B;  1ILQ A;  5D65 A;  1M8A A;  1B3A A;  2DY7 A;  2JP1 A;  1KNA A;  1ILP A;  2L4N A;  1HA6 A;  3DM1 A;  1ROD A;  1WTQ A;  4RA8 A;  4XT1 B;  4LMQ D;  2KEE A;  4OIJ A;  2EPB A;  5CBE E;  2RSO A;  1JIC A;  1B4O A;  1EIH A;  3I91 A;  5DNF A;  1CA6 A;  1GUW A;  1U4P A;  3GV6 A;  4O42 A;  1B53 A;  2D9U A;  1C8C A;  1J9O A;  4CJ1 B;  1WD0 A;  2HUG A;  2L12 A;  1X3P A;  1KNE A;  4ZK9 B;  2NWG A;  2JYO A;  1WVL A;  4IUP A;  4IUR A;  1BBX C;  4IUU A;  5T1G A;  3N52 A;  4UAI A;  3UI2 A;  4ZAI A;  2L9H A;  1ICW A;  2RA4 A;  1WTW A;  1WTV A;  3KUP A;  1NR4 A;  1EOT A;  1DOM A;  2B2W C;  2X6L A;  3FDT A;  2H1E A;  3I8Z A;  2KED A;  1RJT A;  3FPU B;  2FHT A;  5EPJ A;  5T1I A;  2B2Y C;  2RVL A;  1ESR A;  1U4L A;  5AFW A;  3SVM A;  1U4R A;  1RHP A;  1VMC A;  1ZXT A;  2X69 A;  2CVR A;  4QUF A;  5JJZ A;  1DON A;  1F9P A;  4QUC A;  2B2W A;  1G2T A;  1NAP A;  1G91 A;  2B2U C;  4X3T A;  1TVX A;  4IUQ A;  3TZD A;  1HUM A;  2K05 A;  1B50 A;  1IKM A;  2KOL A;  4OIK A;  2FIN B;  2B2Y A;  1EIG A;  2K01 A;  1EQT A;  2MP1 A;  4HED A;  1CM9 A;  2N88 A;  1IL8 A;  1WD1 A; 
#chains in the Genus database with same CATH topology
 4A3E G;  2D0O A;  1D7Q A;  1SNQ A;  4IPC A;  2Z6K C;  1W2B A;  1F9S A;  1O7L A;  2ZTD A;  3GTM H;  2E2I B;  1SJE D;  4QQB X;  3NBI A;  4A93 G;  4B3R L;  3S1N B;  4X6A H;  1L1O A;  3STB D;  4UP8 A;  5J22 A;  3I4M H;  1I94 Q;  5AJ3 L;  2UXB L;  4KK7 A;  5EPK A;  4EQP A;  4TKO B;  1XNR L;  2K32 A;  1EFW A;  2JA5 H;  2F3I A;  3CP0 A;  1JOQ A;  1G6P A;  1AZQ A;  5H1S E;  1HUN A;  3S16 B;  1CQV A;  1XTD A;  3A8I E;  2VQE Q;  3ULP A;  3HFZ B;  1XX8 A;  3BU2 A;  4DV3 Q;  4A3K H;  1K9M C;  2F0F A;  3M7G A;  2B39 A;  2F0E A;  4BBS B;  5C4J B;  4LK1 C;  1WOC A;  1F2Z A;  2EOT A;  2JA7 B;  2A19 A;  1X9N A;  1YIJ A;  2DY8 A;  1TWG B;  4OWT B;  3TS2 A;  3HOV B;  1CZG A;  5CMD A;  4BY7 G;  2E75 C;  1PV4 A;  2EDG A;  3M3Y H;  3I4N B;  3CPF A;  5IYD H;  4LNQ A;  3K5L A;  4JYA Q;  1K3R A;  2K03 A;  4K2K A;  2E2H H;  3BVZ A;  2CQO A;  4JI5 Q;  3MHB A;  3M7N A;  2HDL A;  3UDX A;  2B29 A;  3ERS X;  3NQT A;  2AQ3 B;  5IYC G;  4R4I A;  1ASZ A;  2EY6 A;  5GRO A;  1XMO Q;  1OTC A;  5FO9 B;  4MNO A;  3LNN A;  1KDC A;  4LMQ D;  5KIX A;  4GLA C;  2K5D A;  3C1E A;  1FYC A;  4BBR G;  4KI0 A;  3S1Q B;  2OCE A;  3QIA A;  1KAA A;  3CMA A;  2QGQ A;  2B8F A;  3T1H L;  4IFD I;  4KJN A;  2CHB D;  2A6H C;  4IUU A;  2IJ0 A;  3CD6 A;  1WTH A;  4BXX H;  3BYT B;  4ABN A;  2JJQ A;  1STG A;  3SXH A;  4OO1 H;  2RBM A;  4A3E H;  2PNR C;  4DV2 L;  1JT8 A;  3T56 B;  1L0Y B;  3D4W A;  4A3G B;  4JK1 C;  4A93 H;  2A6H D;  2Y0S E;  5JAV A;  3PIO 3;  4QIW B;  3KF8 A;  4K2L A;  1FJG Q;  1VQN A;  1ICF B;  3PUY A;  1G2T A;  3ND9 A;  4HR7 B;  4GNX A;  2ES2 A;  3S2D H;  3HKZ B;  1I94 L;  1HUM A;  3J80 L;  1QCB D;  2LY7 A;  2B2Y A;  4GZY C;  1CM9 A;  1IL8 A;  1SRO A;  1X3Q A;  1S5C D;  2Z4I A;  4H02 A;  3TME A;  2FMM A;  4EVO A;  3M4P A;  2N8N A;  2VQE L;  1FNW A;  2K4K A;  2WFW A;  3I4L A;  2M2L A;  3G48 A;  3R93 A;  3D4R A;  2ICI A;  1V1Q A;  3D6W A;  4R9W A;  1PLF A;  3S17 B;  4BY7 H;  3LWE A;  5EQ0 A;  1CKN A;  1HRJ A;  2F0H A;  4A3I G;  4LF5 Q;  4UPA A;  3M4O H;  4CKE A;  1FD7 D;  2DJF C;  1RTO A;  4JYA L;  5FK9 C;  4JI5 L;  1V9P A;  3M4Y A;  2J7Z A;  1PRT B;  2KHS A;  2WAQ G;  4F88 A;  4HJ5 A;  3SK6 A;  1EIY B;  1CTM A;  2EIF A;  3DEO A;  1O80 A;  4XYQ A;  1QNK A;  1PFS A;  1NJI C;  4OEM B;  5DLQ E;  3DWP A;  2OXP A;  3Q6S A;  4AIM A;  5J3B A;  1XMO L;  4X3K A;  4A3M H;  3SDZ A;  2EE1 A;  2EYF A;  3TDQ A;  1X3E A;  5LL6 X;  2F0D A;  2FXQ A;  3HG9 A;  3K5O A;  4BBR H;  1PFN A;  2A73 B;  5IY0 A;  2J0T D;  3FPP A;  5EKI A;  1SNO A;  1YHQ A;  1Z9F A;  4DV4 Q;  1C4Q A;  4NDX A;  4Q5V A;  2UUB Q;  1N9W A;  2DY7 A;  2HQL A;  2VY3 A;  5IYB G;  1I4H A;  1WTQ A;  4R4O A;  1PH9 A;  1SYE A;  2Q2U A;  5CV9 A;  4LF7 Q;  4KY5 A;  3HKS A;  1I3Q H;  2IX0 A;  1CT1 D;  4YHH Q;  4G57 A;  1RD9 D;  4UP9 A;  2IHE A;  1FJG L;  3CC2 A;  4LFB Q;  4GOP A;  1X3F A;  2Y0S B;  5I9O A;  3GDE A;  2NVY B;  3OIP A;  2F4V L;  1RIP A;  3X3N A;  4V0B A;  1HR0 W;  2F0P A;  3PO2 H;  3H3V H;  2JEB I;  3FDT A;  1N36 Q;  2R93 G;  1QNU A;  3EN2 A;  1KL9 A;  1EU3 A;  2UUC Q;  2HQE A;  3PO3 B;  5AFW A;  2CVR A;  1F9P A;  1QVG A;  3WOF A;  1CUK A;  4X3T A;  1Y8N B;  4IUQ A;  4NKL A;  5JEA J;  3NEL A;  5M3M H;  2PMZ E;  1YHA A;  3G6J B;  1HTL D;  3C2P A;  4ZKC B;  1BQQ T;  3RZO B;  2CQA A;  1QZG A;  5JVG 3;  5LMU Q;  4DPG A;  2F03 A;  2DGY A;  1IBL Q;  4J6H A;  2R7D A;  3PGZ A;  2HIV A;  2BCO A;  1I6H H;  3E9H A;  1EY5 A;  1EY9 A;  1T9H A;  2E76 C;  4H44 C;  3T1Y Q;  2SEB D;  4I7Z C;  5IT9 L;  3S14 H;  3K6O A;  1EYA A;  1PFB A;  4GKJ Q;  4CBV A;  1EL0 A;  5ELF A;  4KHV A;  3J81 i;  4K5X A;  1MBY A;  1VQJ A;  3NSW A;  4O2D A;  2QIL A;  4CJ2 C;  1XXG A;  5COY A;  5ELN A;  1HZB A;  3S15 B;  2A68 C;  3I3C A;  4NMZ A;  4AH6 A;  5IYB H;  5FLM G;  1QB5 D;  4HJA A;  3CF5 A;  4FF3 A;  1G51 A;  1DOL A;  1MD2 D;  2MJ8 A;  3CCS A;  1HNW Q;  2L5T A;  1LLR D;  1BCP F;  1HCZ A;  4P75 A;  1PH4 A;  1IBM Q;  2ZJQ A;  1KRT A;  4LF7 L;  4OXP A;  4DAP A;  2A1A A;  5EBD A;  1LTI D;  5I4D A;  1NCV A;  4DNT B;  2X6G A;  2A68 D;  1LV9 A;  2OTJ A;  4YHH L;  1Q8I A;  2VXW A;  4RH6 A;  1JJ2 A;  4F7X A;  3QR8 A;  3D0F A;  2DNC A;  5JPM C;  1A3T A;  4BY1 G;  3F2B A;  1S40 A;  2R93 H;  2NVX B;  1N36 L;  1A8V A;  1EFI D;  5JEA G;  2LKV A;  3MXN B;  5KEE A;  4WJ4 A;  3GTM B;  1N34 Q;  1B3Q A;  1GD7 A;  1A62 A;  1WYD A;  3GQB A;  3S24 A;  4GN4 B;  1OXX K;  1IBK L;  3TS0 A;  4K6L A;  3HEJ A;  3CQZ B;  1GOZ A;  5FLX c;  1NMF A;  2O4X A;  4NXM Q;  3QB3 A;  4L5Q A;  3PIO A;  1IBL L;  1S3O A;  2N3S A;  3SVM A;  3U50 C;  4A3K B;  2TSS A;  3I72 A;  3J7Y W;  3F1Z A;  2DNE A;  1TS2 A;  3MAQ A;  3G6E A;  2KOL A;  5JPN C;  1JOO A;  2OQK A;  4AYB B;  4AQY Q;  2EYM A;  1X32 A;  1MI2 A;  4N9P A;  2EVB A;  3AFQ A;  3KJP A;  4KTA A;  3ITP A;  3RD4 A;  4HSP A;  1Q82 C;  3A74 A;  1STY A;  4PG3 A;  1YEZ A;  4RG1 A;  2ZTE A;  3QWN A;  1YVC A;  3CCM A;  1NR2 A;  5E4W C;  3ZYY X;  2F0O A;  4XDX A;  5FLM H;  2E2J H;  3P7J A;  1F9R A;  1K8A C;  4Y7N H;  5D14 A;  3K7A B;  3JAM L;  2K52 A;  1JC7 A;  2IX3 A;  5C3E G;  1HNW L;  2CWA A;  4TQU S;  1IBM L;  1TWH H;  3NK9 A;  4YY3 Q;  1PH2 A;  1MGS A;  3A54 A;  3CCV A;  2K1B A;  5JJI A;  1AN8 A;  1O7Y A;  3P75 A;  5C4X G;  3TP8 A;  1XJV A;  3FKI H;  2KVM A;  2EJF C;  5EGT A;  1GXD C;  4NPS A;  5IE8 A;  1WTX A;  1T5E A;  4ID6 A;  2QF7 A;  3CME A;  2Z8L A;  3J7A 5;  4BY1 H;  1B8A A;  1CHP D;  4ZQ3 A;  2ENB A;  4RKL A;  1VQ4 A;  1PTO F;  1V43 A;  1GUG A;  2PNH A;  4HIM A;  3AMU A;  3I73 A;  4MHE A;  2B2V A;  4IPD A;  1STE A;  2E5L Q;  5GAH C;  2NZ1 D;  1N34 L;  4C2M B;  2KHI A;  4H13 C;  5CBA E;  3U9S A;  3S1R H;  3T53 B;  3MXP A;  5NUC A;  3UDI A;  1N8R C;  1LM0 A;  1ROD A;  1JB3 A;  1P8L A;  5IP7 G;  1EU4 A;  3NTH A;  2EYO A;  2RSO A;  1N32 Q;  4G7O C;  1JIC A;  4NXM L;  2F0K A;  2OTL A;  3TEH B;  3PIP 3;  4JI8 Q;  2NVQ B;  1II3 A;  1JOR A;  3WOE A;  2K14 A;  2RHS B;  5DM6 3;  1WVL A;  2CH4 W;  4B9W A;  3MFG A;  2VW9 A;  3R8B A;  1JJC B;  2B63 B;  2NN6 G;  1EOT A;  3WDN A;  5C44 B;  1Y1W B;  1D6E C;  4RGO S;  1D1K A;  3W3A A;  2F0I A;  2G9H D;  4CDF C;  3NEM A;  5CV4 A;  1ESR A;  2LS0 1;  1U4R A;  1VMC A;  1M1K C;  1SNM A;  4KN7 C;  1IKM A;  3T4A C;  4L8J A;  2J4X A;  1IYJ B;  4A3D G;  1BDO A;  4DR5 L;  4KHP L;  4HJ7 A;  2D5D A;  3R2T A;  2MP1 A;  1YHB A;  5C3E H;  1D2B A;  2WKD A;  4GLV B;  4A3M B;  2Q2H A;  4YY3 L;  5IWA Q;  1VQL A;  5C4X H;  1DD2 A;  2CWP A;  1X54 A;  2EYL A;  4A3C G;  1K8G A;  3J7Z C;  2EZV A;  5COR A;  3LX0 A;  2BOS A;  2NZH A;  4ME5 A;  3VYS A;  2RCN A;  3K59 A;  2RSN A;  3BDC A;  4F87 A;  4DR3 Q;  3U4Z A;  1EWI A;  2R92 G;  1SMX A;  5KYL A;  2KQ3 A;  1ET6 A;  3TP6 A;  2ZXR A;  1I3Q B;  4A3B B;  2E5L L;  1SND A;  3ND8 A;  1EY8 A;  4CDD C;  1Z6H A;  3NHH A;  5IIF A;  3HOU B;  1YI2 A;  3I90 A;  5IP7 H;  3U9O A;  4K8J A;  4OL7 A;  4DK6 C;  1BKB A;  4DV7 L;  3PO2 B;  1N32 L;  4EGV A;  2KUM A;  1L0W A;  4FVM A;  5BN4 A;  1B7Y B;  3U58 A;  1HZC A;  1T5X D;  2I5H A;  1SR3 A;  4B3S L;  3DMU A;  3MXN A;  1M8A A;  1VQD A;  5I6W A;  4PZ6 A;  2JP1 A;  3VYU A;  3RZD H;  4C3I G;  1B70 B;  4U67 3;  5M3M B;  4ILW A;  2NN6 H;  5AJ3 Q;  1JWU D;  3EVQ A;  3MZ5 A;  2PCF B;  2JE6 I;  2OQ0 A;  3ICE A;  1XNR Q;  5IP9 G;  4DUY Q;  2ID0 A;  4GLX A;  1VQH A;  1J9O A;  2KA7 A;  1WD0 A;  2R7Z G;  4WOR A;  1I6H B;  1E1O A;  4PZ7 A;  4A3D H;  3IFT A;  4LFA Q;  3BYY B;  2LXK A;  4HIO A;  3D8G A;  1KDA A;  1H9M A;  1ICW A;  1TWA B;  5ELC A;  5EKK A;  1WTV A;  3E0E A;  3K58 A;  3M4Q A;  4DU9 A;  4WFN 3;  2X6L A;  4DFA A;  1Z47 A;  1HNZ Q;  5G3L D;  3Q23 A;  2VQF L;  5T1I A;  4A3C H;  4K14 A;  3GTJ H;  3HOW B;  4DR7 Q;  4FXK C;  2B2W A;  3J80 i;  2B2U C;  2MHV A;  1KLG D;  1TVX A;  1SBB B;  4J1M A;  5FLX E;  1NMG A;  4EQN A;  1YBY A;  2JA6 G;  1XNQ Q;  4KLK A;  4IUV A;  5CGK A;  1UEA B;  4QY7 A;  3PMF A;  1EYD A;  2I5M X;  4DR3 L;  2R92 H;  4B9X A;  3I70 A;  3TN2 A;  2QCP X;  2GN5 A;  4Y52 H;  4ZCK A;  3G7L A;  1D5M C;  2YTY A;  1TQO A;  1E2V A;  3NWT A;  5JVH 3;  3NTK A;  1DJR D;  2Z6K A;  1F2M A;  1JQY D;  1LTG D;  4CJ0 B;  4QGU A;  4JG2 A;  5GAE C;  1QVF A;  2NBF A;  3GO5 A;  2MO0 A;  2RKS A;  2F3V A;  2F4I A;  5C5L A;  4H0L C;  1KRS A;  3STB C;  2LXJ A;  5A2Q L;  4OWW B;  4RGT A;  1X65 A;  4DV2 Q;  1TY2 A;  5CV7 A;  1Y69 U;  1OXU A;  2Z4H A;  4QIW E;  2WIN B;  1E22 A;  3I7F A;  2I0Q A;  1LYL A;  2F0T A;  1DZ1 A;  1SRU A;  3HKZ E;  4ZUI A;  1PFM A;  3DM3 A;  4QF4 A;  1N33 Q;  1FGB D;  2GVA A;  3TRE A;  3PF4 A;  3NXW A;  4O1N A;  4IOA A;  4X65 Q;  1Q3L A;  1BO0 A;  2IL8 A;  3KBX A;  2CW0 C;  1GO3 E;  2VUM G;  1JCK B;  5M5X H;  3RN2 A;  4DUY L;  5E1F A;  4K8I A;  4GKK Q;  2HCC A;  3B6Y A;  3G4S A;  1EY6 A;  1STA A;  2C35 B;  2JQO A;  4LFA L;  1JE5 A;  1PYW D;  3H0G G;  2CW0 D;  4DK3 C;  4OIJ A;  2BDO A;  4KY6 A;  1CK1 A;  4DV6 Q;  2F0U A;  3I91 A;  1CA6 A;  1HNZ L;  3PIP A;  5C3X A;  5ISR A;  2MNA A;  1Y8P B;  3URY A;  4HN7 A;  1LTA D;  3HOX G;  4DR7 L;  1MHW C;  2VS1 A;  2VNU D;  4IUP A;  1L1O C;  1JMC A;  2JA6 H;  3S2H H;  1EZ8 A;  2MQH A;  2E2J B;  1XNQ L;  2N49 A;  4OGQ C;  3CCL A;  2IHF A;  4NXN Q;  2FHT A;  2D62 A;  4DV0 Q;  2WV6 D;  2A8V A;  3HOZ B;  3KF6 B;  1SN8 A;  3E0J A;  3JC6 6;  3TZD A;  1SYC A;  3FKI B;  4EQO A;  1EZ6 A;  1UE6 A;  5FO7 B;  2D2C C;  3TSS A;  4DK0 A;  2YTX A;  2ZXO A;  1GUN A;  2HCI A;  5M5W H;  4PMW A;  1BBW A;  1U0L A;  2XWB B;  3GTQ H;  3L9A X;  1I4P A;  5GQO A;  3QOJ A;  2FMC A;  1CHQ D;  1KLU D;  3BZC A;  1S5D D;  1SNC A;  1NNX A;  4XIG S;  1E3P A;  3S1R B;  1N33 L;  2IX1 A;  4B3T Q;  2PQA B;  5IOC A;  1S5F D;  1M90 C;  1E1T A;  1RTN A;  5KNC A;  4X65 L;  2TMP A;  2YU9 H;  5I2Y A;  2F4V Q;  1GHK A;  3T13 A;  4S3S A;  4G7H C;  4YWL A;  4KD3 A;  3IAY A;  2VUM H;  5IT9 c;  1QWY A;  2A6E C;  4M8A A;  1HZ9 A;  4GKK L;  2VZA A;  1CA5 A;  4JBK A;  1UAP A;  1PYB A;  1Q46 A;  2EYJ A;  5EAY A;  3GTG H;  3MEH A;  3KLS X;  5KGU A;  4QB4 A;  4ZLT F;  1YNN C;  1EEI D;  4X3S A;  1OXT A;  1CSQ A;  3H0G H;  3GTP H;  2A6E D;  1BCP C;  4DV6 L;  3H3V C;  2GVB A;  1B9N A;  3RUZ A;  2K50 A;  1MKH A;  3HOX H;  2AKW B;  1YNN D;  2NVT H;  1R4P B;  3CHB D;  5A35 A;  2XNA C;  3HS0 C;  2EY2 A;  5IYC H;  1BCP D;  2OWO A;  5CBE E;  3E3X A;  2JK8 A;  3TBI B;  1PH8 A;  2KCC A;  4NXN L;  4CDC C;  2E8G A;  4DV0 L;  3Q8D A;  1HNX Q;  1FR3 A;  3PQI A;  1KTK A;  1VQE A;  1IYV A;  5ELD A;  2L9H A;  4DA2 A;  1SYG A;  1K73 C;  4A3J G;  3L2P A;  1EQQ A;  5M3F B;  2O5J C;  4A3F G;  4IO9 A;  1WCM B;  5LMN L;  2UXC Q;  1TS4 A;  3PUV A;  2YV5 A;  1NAP A;  4POF A;  4R4T A;  1Y1V B;  4DAV A;  1AE3 A;  2FIN B;  4B3T L;  3OWE B;  3R3O A;  2NTS A;  1AZP A;  2BH2 A;  3K0X A;  1IKL A;  3GTO B;  5CYU A;  4OO1 I;  4FF2 A;  4TSS A;  2QDB A;  3CW2 C;  4CDE C;  4RCN A;  1I6V C;  4N8F A;  3FP9 A;  4JI4 Q;  4FDB A;  1SE8 A;  4C3H G;  2KCN A;  3I2Z A;  5C0X J;  3Q22 A;  1EY4 A;  3E6Z X;  4K5V A;  3LWU A;  4ZUJ A;  2PZW A;  3MXG A;  3J80 E;  4L5T A;  4A3I H;  3RZD B;  5HGQ A;  4YCU A;  1IBK Q;  3ULL A;  4DN4 M;  4DUZ Q;  4JW0 A;  4GS3 A;  4JOI C;  2WB1 B;  2XTI A;  3JAM c;  1VMP A;  1WTO A;  1XYI A;  5FJ8 G;  2MO1 A;  4APV A;  4AYB E;  1TWF H;  4GOP C;  3CCQ A;  1W6K A;  2HHH Q;  4R8N A;  3HOY B;  4JI2 L;  1EQV A;  2R3Z A;  4C3J B;  1I50 H;  3FMC A;  1R9T B;  1ZKO A;  1VQM A;  1E2Z A;  3DWQ A;  1UE5 A;  1K83 B;  1A2U A;  4R1J A;  4OEL B;  5IGB A;  1CZW A;  2KCM A;  1HNX L;  3GTJ B;  1B3A A;  1FL0 A;  1H9S B;  1LT5 D;  1ILP A;  3UDG A;  1SXT A;  1RKN A;  1NSN S;  4FF4 A;  3V96 A;  1NE3 A;  2JA8 G;  4BBS G;  2JA9 A;  2JA7 G;  4A3J H;  4JPB W;  3BZD B;  3HOV G;  1X3G A;  2HD3 A;  4A3F H;  4FYD A;  2R92 B;  1G8Z D;  1U4P A;  4XQQ A;  1PMR A;  3NE5 B;  4ODG A;  3VR6 A;  3I4N G;  2MUY A;  4LUO A;  2UXC L;  2LMC B;  1HQR D;  4R4Q A;  2HUG A;  2EQS A;  1X3P A;  1KNE A;  4ZK9 B;  1SNP A;  4IUR A;  3KF6 A;  4ZRZ A;  1B1Z A;  3C46 A;  1PXU A;  1Y14 B;  1A6X A;  1ONL A;  2R6G A;  1FNU A;  1PZJ D;  5EPJ A;  5C0X G;  2RVL A;  2B3G A;  1YJN A;  1STN A;  4C3H H;  1G91 A;  4JI4 L;  2E2D C;  1SFO H;  1UUP A;  2N88 A;  2IWH A;  4P73 A;  2EY5 A;  3UDF A;  3I4M B;  3PUZ A;  2PQA A;  1KAB A;  1MSG A;  1PTO H;  4DUZ L;  3MWY W;  3H3V I;  1OXV A;  4POG A;  3SK8 A;  1SYF A;  4DNI A;  5M5X B;  1BOS A;  2JA5 B;  3NUC A;  1PZK D;  2KEC A;  2D0P A;  2OEO A;  5FJ8 H;  3AQQ A;  1EYC A;  3TQY A;  1YJW A;  3M85 A;  1G29 1;  3S1N H;  1GJX A;  2HHH L;  3EBE A;  2PZT A;  1WTR A;  3KLR A;  1QE6 A;  3VA7 A;  3HKZ G;  3IL8 A;  1VQ6 A;  3NWS A;  3M3Y B;  1GKH A;  3L0O A;  4FXG C;  2UUA Q;  1SJH D;  3HRZ C;  3D31 A;  1SSO A;  2EYH A;  3SEB A;  3I55 A;  1VQ8 A;  2E2H B;  1QUQ B;  4JI6 L;  4DXF A;  2R61 A;  4HAE A;  2JA8 H;  2AQ2 B;  5CV8 A;  4BBS H;  2MPM A;  2JA7 H;  1K8O A;  5IT9 E;  2QA4 A;  1TWG H;  1VQC A;  2KEN A;  4KY7 A;  3HOV H;  3OOC A;  4DR5 Q;  4KHP Q;  5KRU A;  2N55 A;  3GTK H;  1U4M A;  3I4N H;  1SE3 A;  1CQF A;  4YCW A;  1KDB A;  5IGC A;  2F52 A;  3CPW A;  2UU9 L;  2L4N A;  2JEA I;  1TY0 A;  2PQE A;  2PW7 A;  1HPC A;  4XT1 B;  2JN4 A;  3H09 A;  5CC4 A;  3M9B A;  1KAW A;  1LAB A;  5KNB A;  1WI5 A;  5C0X H;  3VR2 A;  5M5W B;  2B8G A;  3GV6 A;  4FP5 D;  1PHJ A;  3GTQ B;  2D9U A;  4A3E B;  4C1N I;  2ZT9 C;  3KYH C;  5JEA H;  1PH1 A;  3K57 A;  2JYO A;  5KYI A;  3CC7 A;  1SE2 A;  2ZTC A;  1PH7 A;  3BVG A;  3A5U A;  3I4O A;  4A93 B;  1JR0 D;  4UAI A;  4L63 B;  2DUD A;  3SK5 A;  1VCI A;  3IKJ A;  3OW2 A;  3RLN A;  1I4G A;  4HMI A;  2BA1 A;  3S2D B;  1JOK A;  5BN5 A;  4L6T B;  1AE2 A;  1MIU A;  1Q90 A;  1GM5 A;  2ICE C;  2M00 A;  4DV7 Q;  2X69 A;  1DON A;  4QUC A;  1ENF A;  1LTB D;  3NEN A;  1BVS A;  4IFD J;  3GTG B;  4HCE A;  4B3S Q;  4FO2 A;  2KCT A;  1XWE A;  1L1O B;  3J81 L;  1B9M A;  4BY7 B;  1YJ9 A;  1C0A A;  4R4C A;  3M4O B;  1B2T A;  2Y0S G;  3BDL A;  4IZ8 A;  2Q8R E;  5DM7 3;  4DV5 Q;  2UUA L;  1WFQ A;  4MTK A;  2OF1 A;  3ZJY C;  2V1C C;  2NVT B;  1GVP A;  3RR5 A;  1HR0 Q;  1HFN A;  3PO3 G;  2ZM6 L;  3S17 H;  4X3U A;  2XRS D;  3PF5 A;  3KBG A;  1TWC H;  2OT2 A;  4DR2 Q;  1LTL A;  1IHZ A;  2CCZ A;  4BBR B;  2Z0S A;  1NUC A;  2VQF Q;  1PA6 A;  2SNS A;  1EY7 A;  4MTN A;  2PI2 A;  4A76 A;  1WJJ A;  4RWS C;  1UNS A;  1TS3 A;  1H9S A;  1F2L A;  2V4D A;  5CV5 A;  4CHT B;  3JAM E;  4ULL A;  4A4I A;  2EYP A;  1BNZ A;  3QJY A;  4J15 A;  1UE1 A;  3CCE A;  4WJW A;  2SNM A;  3A8K E;  3ONA B;  4LUZ A;  3EFX D;  3I56 A;  1GUT A;  1KNA A;  1SLJ A;  3SHL A;  4LF9 Q;  3J81 j;  3DM1 A;  2Q2T A;  5TSS A;  1S72 A;  2AMC B;  3CAM A;  2RF4 A;  3RN5 A;  4JV5 Q;  1VDZ A;  3PCO B;  3CC4 A;  1H9J A;  1Z7T A;  2AQ1 B;  4IFD G;  4UY8 C;  1VQG A;  3DWA A;  1VQA A;  2JSO A;  1NTG A;  3W1B A;  3V2T A;  1BBX C;  1U5K A;  3TZU A;  3EIV A;  2HIX A;  1KIX A;  2AHO B;  4ZAI A;  2QW7 A;  3KUP A;  3VYR A;  1TR5 A;  4A3I B;  3Q24 A;  4PQX A;  3FPU B;  2K5N A;  4JI3 L;  1QOH A;  2NVY H;  2YTV A;  1RHP A;  4DV5 L;  1CKM A;  1BXT A;  1UWV A;  1IW7 C;  1ZEQ X;  2WAQ B;  2C9O A;  4DV1 Q;  2Z1C A;  4X64 Q;  3PO3 H;  1HR0 L;  1PRT F;  3KLW A;  1XPO A;  4WRD A;  2H5X A;  2K5W A;  2I5L X;  2CKZ B;  4K6D A;  2EY1 A;  3K80 C;  4LW1 A;  1LTT D;  2B2U A;  1FGU A;  3GTL H;  3P20 A;  4KN4 C;  1O7Z A;  4O0A A;  1OXS C;  1IW7 D;  4I65 A;  5F2D A;  2O2L D;  1G6Z A;  3S14 B;  3OWF A;  5JJL A;  1K28 A;  4RCO A;  1S4Z A;  4DR2 L;  1HQM C;  4I7A A;  3RZO H;  3S1M H;  5ELE A;  4K5W A;  2L11 A;  2XIW A;  2PYK A;  2XSC A;  3KK7 A;  2QDL A;  1QUQ A;  1QVC A;  2K04 A;  2ZJR A;  2FFK B;  2K5V A;  4A3K G;  2IT1 A;  1HTP A;  2B2T C;  3UE0 A;  3U4V A;  4KD4 A;  4BA1 I;  2AUJ D;  3HP3 A;  2RCF A;  4JI7 L;  1V1O A;  3AFP A;  5HGT A;  4K0K L;  1PYS B;  2L1B A;  3DEP A;  4NB3 A;  4RHR A;  1J5E L;  1R4Q B;  1Q86 C;  1X55 A;  2K33 A;  2PPB C;  4HTH A;  4J8Q A;  2WAC A;  4LF9 L;  4Z9C B;  5IGG A;  4B3M L;  1C9O A;  2YYZ A;  3F8T A;  4TRD A;  3C3L A;  4JBW A;  1JE4 A;  3BG3 A;  1AFP A;  4ALP A;  4JV5 L;  4IPH A;  4JI1 Q;  3A0J A;  4H7B A;  4IFD H;  3H91 A;  1MSH A;  1VS0 A;  3NPP A;  1HH2 P;  3BJU A;  2AWO A;  5M5Y H;  2R93 B;  5D65 A;  4P71 A;  4L5S A;  3ER0 A;  1SFO B;  1VQB A;  4C3I H;  1MJE A;  1JWM D;  1VQK A;  3OW7 A;  2KBN A;  4MIU A;  3N6R A;  1RL2 A;  1IXR A;  5IP9 H;  2NVX H;  2NWG A;  4OX9 Q;  4DK1 A;  2ALY B;  2R7Z H;  4IQZ A;  4PV1 C;  4DV1 L;  4X64 L;  2RA4 A;  3CCU A;  3QG1 A;  1NR4 A;  4ME3 A;  1MJC A;  1VQO A;  1LTR D;  1XPU A;  2BA0 A;  2NN6 I;  1YZ6 A;  1EWC A;  3BS1 A;  1VF5 C;  3ERQ A;  1B44 D;  1X56 A;  3CQZ H;  1ZXT A;  1FVI A;  1V8Q A;  3AYH B;  1GHJ A;  2VB3 X;  4DF7 A;  3K0Y A;  5K5P A;  4HED A;  2JA8 B;  3OSO A;  3SK4 A;  3OMG A;  1NBW A;  2NTT A;  1QG7 A;  1EOV A;  2C5C A;  2KHJ A;  4Y7N B;  5I2X A;  3GTK B;  1O78 A;  4IOC A;  1ET9 A;  3HZX A;  2B63 G;  3KFU A;  5C44 G;  1Y1W G;  1TWH B;  5IGD A;  2F0W A;  4HJ9 A;  1PVO A;  1K0S A;  4N9T A;  3CCR A;  4LWC A;  1IL2 A;  2F0G A;  1DM0 B;  1G2S A;  1SEB D;  1P16 A;  1F2Y A;  4JI1 L;  1Y8O B;  1WTP A;  4BY1 B;  1JJG A;  5IGE A;  3K7A H;  2NYZ D;  4XXE A;  3RNU A;  4A3M G;  2BE5 C;  2WP8 J;  5LMN Q;  1RCV D;  4G4K A;  1EEF D;  1KHI A;  3TRZ A;  4JI0 Q;  5T1G A;  1W6J A;  5G3L F;  1STB A;  5FOB B;  4NW2 A;  4OON A;  2LSS A;  2FJ2 A;  5A2Q E;  4HIK A;  1O7I A;  4IN3 A;  2BE5 D;  2SDF A;  4YWM A;  5K36 G;  1Q1B A;  1BBU A;  1AH9 A;  3PSI A;  4PMB A;  4OX9 L;  3SR1 A;  1E7Z A;  2NUC A;  2L55 A;  3BVM A;  4KMU C;  4RA8 A;  4C2M H;  4A3B G;  1H9K A;  4P2C B;  3E5S A;  2EPB A;  1VQ7 A;  2F3W A;  1QZH A;  3EQL C;  2AWN A;  1HZA A;  5EKL A;  3HOU G;  5BR8 Q;  4O42 A;  2WB1 E;  1RF2 D;  2N78 A;  3PUW A;  1V1P B;  3FEW X;  1TXY A;  2IW3 A;  3DXJ C;  3PO2 G;  3DHQ A;  1C7Y A;  3A56 A;  2NVQ H;  4DV3 L;  4GNX C;  2A74 C;  2KED A;  4XQN A;  2EJG C;  5BN3 A;  4C1N K;  2EXD A;  2B2Y C;  4JI2 Q;  1TKW B;  1TWC B;  3FVQ A;  4DR1 Q;  5C3E B;  2B63 H;  2K5H A;  5M3M G;  5JJZ A;  2PI2 E;  5C44 H;  1VQI A;  1Y1W H;  3X3M A;  1KQS A;  5CR3 A;  4DR4 Q;  4YIJ A;  2K05 A;  4IJH A;  5CV6 A;  4OIK A;  1TU2 B;  3PV0 A;  5C4X B;  2K01 A;  4P72 A;  3ULJ A;  3FRP B;  3I8Z A;  3CXC A;  1SYD A;  4X66 Q;  3VDY A;  3MVV A;  2E74 C;  3ERO A;  3GP7 A;  2ZJP A;  1ZYR C;  2F1M A;  4RAU C;  5D3D A;  1VF7 A;  3TP5 A;  1EYG A;  1K8M A;  2A5H A;  3UE1 A;  1VQP A;  5E4X A;  1A15 A;  3D6C A;  2AUK A;  5C6A A;  4JI0 L;  3MA2 B;  3HOW G;  4IUT A;  3KDF B;  1D5Z C;  1ZYR D;  2BH8 A;  3L7Z C;  3OIQ A;  1BF4 A;  2F0V A;  5K36 H;  4Q0F A;  4KV6 A;  4JBM A;  1HXY D;  2L15 A;  1DXM A;  1AP0 A;  2K6A A;  4RGM A;  4A3B H;  2F0Q A;  4JOI A;  1F9Q A;  4UHV A;  2P5Z X;  4L5R C;  2VL6 A;  4RFB A;  4CKB A;  1I4R A;  3JAM i;  3W5O A;  3HOU H;  1KC8 C;  2F0J A;  1A2T A;  5BR8 L;  4NP5 A;  4XYO A;  3NQI A;  1A0I A;  1K3B C;  1ILQ A;  1YNJ C;  3OHX C;  3CRK C;  1SMY C;  1W3S A;  3CCJ A;  1D8L A;  3GD7 A;  2Q8I B;  4RHS A;  1LT6 D;  3WWV A;  4DR6 Q;  4A3D B;  2IY5 B;  3CU7 A;  3GTL B;  1QIL A;  1YNJ D;  4LF5 L;  2CFM A;  3P1H A;  3F2D A;  1PTO C;  5D3I B;  4DGZ A;  4DR1 L;  3NTI A;  1SMY D;  1ENA A;  1Q7Y C;  3S1M B;  3V05 A;  1PH3 A;  4DR4 L;  2EXZ A;  4IPG A;  3UI2 A;  1XMQ Q;  3DUZ A;  4JI6 Q;  4RGN A;  2RDG A;  1SE4 A;  4X66 L;  1K0R A;  3LGJ A;  4TVA B;  4EX5 A;  1RJT A;  1PTO D;  1S5B D;  2DJG C;  3K5N A;  1TWA H;  4LJZ C;  1TS5 A;  3F2C A;  1VQ9 A;  2F0L A;  4DXG A;  3NBH B;  1LT4 D;  4QCL A;  3HOW H;  4DAM A;  1WD1 A;  2UU9 Q;  2RQX A;  2UXD Q;  4DV4 L;  2F0M A;  3MC0 B;  1DOK A;  1UEB A;  1PH5 A;  1CSP A;  3J81 c;  2UUB L;  4DNR B;  2Z9H A;  3J7A V;  2WKC A;  1SAP A;  1LO5 D;  2NZO A;  3A8J E;  4DKA C;  5M5Y B;  2WII B;  3NP8 A;  4HSV A;  3HOZ G;  5J39 A;  4C3I B;  5FO8 B;  3VR5 A;  3FKI G;  4LFB L;  4PMC A;  3OPO A;  3D3R A;  4JBJ A;  1EUJ A;  2RDH A;  2I07 B;  2PO4 A;  5IOD A;  4QL5 A;  4QMG A;  4XT3 B;  4LUV A;  4U68 A;  1E0B A;  1H95 A;  1LAC A;  4FF1 A;  3TP7 A;  1IZ6 A;  2E2I H;  2R7Z B;  3A7L A;  2Q2I A;  3H15 A;  2UUC L;  4GN5 A;  4A3G G;  1I5F A;  4CKC A;  4UP7 A;  1ENC A;  1VQ5 A;  4IUN A;  3SE0 A;  4DR6 L;  4X62 Q;  3GV3 A;  4YWK A;  1X6O A;  3T51 B;  3IRB A;  4UDU C;  2QEX A;  2A69 C;  4HJ8 A;  1ASY A;  2HT1 A;  1VQF A;  3VR4 A;  1V1P A;  1BUV T;  1HA6 A;  5HY6 A;  1JWS D;  4A75 A;  1H9R A;  2PMZ B;  5LMU L;  5C4H A;  1U9R A;  1XMQ L;  3A7A B;  3S16 H;  3K5M A;  4P74 A;  2L0C A;  4V19 0;  4KHZ A;  2DN8 A;  1TII D;  5C4J H;  2ZM6 Q;  1GUW A;  2A69 D;  2JA6 B;  3S2H B;  5M9O A;  1B53 A;  2F0N A;  3T1Y L;  4CJ1 B;  1LUZ A;  3BZK A;  5E7N A;  4GKJ L;  4BS9 A;  4LAA A;  1KD1 C;  3CKI B;  2UXD L;  3MEF A;  3RLF A;  5HUR A;  3OTO Q;  4B08 A;  2PZU A;  4IAL A;  1YIT A;  2Z6B A;  5GAG C;  4QUF A;  5EBC A;  1OO9 B;  5I9P A;  3AU7 A;  5JJK A;  1EIG A;  5IGF A;  3E9I A;  3HOZ H;  3DLL A;  1EWH A;  1GUO A;  1PRT C;  4KJO A;  4XTC S;  3S1Q H;  4FXD A;  1KXL A;  1J6Q A;  1SYB A;  4MN3 A;  1TT2 A;  3A55 A;  1XTC D;  3KDF A;  4LFC Q;  4QJF A;  4DAY B;  4LF6 Q;  1PZI D;  3EA6 A;  2YU9 B;  2VUM B;  4JC0 A;  1PRT D;  3KOJ A;  4HCS A;  3VA5 A;  5M3F G;  2R7F A;  4OWX B;  5LHY 1;  4HID A;  1WCM G;  4A3G H;  4LF8 Q;  1Y1V G;  4X62 L;  1S5E D;  3H0G B;  3IFD A;  3GTP B;  4CGY B;  4LF4 Q;  1L0X B;  3R2I A;  3OYY A;  5C4Z A;  2QKI C;  3MTS A;  4JI3 Q;  2GA4 B;  4EQ5 A;  4E6I A;  2WAQ E;  2B2V C;  5J1Z A;  2ZXP A;  1UE7 A;  3K8A A;  3OMC A;  2HDM A;  3RMH A;  4JCV E;  3HOX B;  1RDP D;  4YCV A;  1D5X C;  2H4O A;  1Q12 A;  1FNV A;  1AW7 A;  2XWJ B;  3K7U C;  1A63 A;  2NB0 A;  5I6Y A;  4AQY L;  4BWG B;  4BA2 I;  2XGT A;  2VB2 X;  3HGB A;  2KEE A;  2WB1 G;  2RDF A;  3MFY A;  3AEV A;  1EIH A;  5DNF A;  3OTO L;  2PW5 A;  4ZYS A;  1C8C A;  5LMN W;  4XQJ A;  4GN3 B;  2L12 A;  5FLX L;  4JI7 Q;  3HOY G;  4C3J G;  3H94 A;  4K0K Q;  2XN9 C;  1J5E Q;  3AB9 A;  4PNY A;  3NBH A;  4B3M Q;  4MZ9 A;  1STH A;  2G9D A;  2LFN A;  3C1F A;  4FNF A;  1CKO A;  4N8X 1;  1DGS A;  1U4L A;  3SGI A;  5C0X I;  1BR9 A;  4LFC L;  2KJX A;  3A5Z B;  4WJ3 M;  4LF6 L;  1M4V A;  2I46 A;  1CI3 M;  1I4Q A;  5M3F H;  1B50 A;  1BCP B;  3J7A F;  5LL6 S;  3H6M A;  5FKA C;  1WCM H;  1EQT A;  4C56 C;  2ATW A;  4A3L G;  1C48 A;  1I4X A;  3QO2 A;  4LF8 L;  3Q0A A;  1HA5 A;  1A3U A;  4ZKB B;  1Y1V H;  3KLS A;  3F2U A;  3KF8 B;  4OHJ A;  1F77 A;  2BDN A;  4R8I A;  4GNX B;  3VYT A;  3BDO A;  1GUS A;  3T16 A;  3VR3 A;  1EY0 A;  5DEH A;  4LF4 L;  1L2F A;  1Q8K A;  3GTO H;  1DYQ A;  4RMF A;  2K7V A;  4PZ8 A;  5EJW A;  1CFM A;  2EJM A;  5E3F A;  2K75 A;  1LTS D;  3PUX A;  4RKB A;  1J8I A;  4KKT A;  2Q8T A;  4JI8 L;  3J81 E;  4KKS A;  1A3V A;  3L3O C;  1HJP A;  1TWF B;  4B3R Q;  1CKN B;  5DAU A;  5EPL A;  1JB7 A;  5ELO A;  5KND A;  3W2D A;  3I4M G;  2B2T A;  1I50 B;  2UXB Q;  4G7Z C;  5C3W A;  3CRL C;  1ML0 D;  1AEX A;  2JXM B;  2MGS A;  1NY4 A;  2K28 A;  2JA5 G;  1PDQ A;  1HHV A;  4HMJ A;  5L37 A;  1HFG A;  3W1G A;  3S9W A;  1SDF A;  4A3J B;  1Q81 C;  3HOY H;  1Q1E A;  2ASB A;  4C3J H;  1R9T H;  4A3F B;  4AYB G;  2M9V A;  1K83 H;  5IYD G;  5IWA L;  2CH4 A;  2IPK D;  2K5Q A;  1B4O A;  3K81 C;  3D4D A;  1YNX A;  1EQR A;  3S15 H;  2O5I C;  1ESF A;  1E2W A;  4M1U B;  3FHW A;  3EJI A;  4F8M A;  2QEJ C;  5C5M A;  3KJO A;  4IJL A;  5GAD C;  2XRQ D;  1PH6 A;  3N52 A;  4A3L H;  5ELB A;  2SOB A;  4KKU A;  3J80 c;  3G71 A;  1WTW A;  1DOM A;  2B2W C;  4C3H B;  3QOL A;  1XPR A;  2H1E A;  1DCZ A;  1LT3 D;  1EIF A;  1E24 A;  3MXU A;  3O13 A;  1IYU A;  2G5D A;  2RHQ B;  1D1I A;  4JVZ A;  3T1H Q;  4GOP B;  3RLO A;  2XVS A;  5JOB A;  2F0S A;  1QJO A;  4DAY A;  1PTO B;  4BXX G;  2MFI A;  4OO1 G; 
#chains in the Genus database with same CATH homology
 1SNQ A;  1F9S A;  1O7L A;  2E2I B;  1SJE D;  3NBI A;  3S1N B;  5J22 A;  4KK7 A;  5EPK A;  4EQP A;  4TKO B;  2K32 A;  1JOQ A;  1AZQ A;  1HUN A;  3S16 B;  1CQV A;  3A8I E;  1XX8 A;  2F0F A;  3M7G A;  2B39 A;  2F0E A;  4BBS B;  5C4J B;  4LK1 C;  2JA7 B;  1F2Z A;  2EOT A;  2DY8 A;  1TWG B;  3HOV B;  1CZG A;  5CMD A;  2E75 C;  2EDG A;  3I4N B;  3K5L A;  2K03 A;  4K2K A;  3BVZ A;  3MHB A;  3M7N A;  2HDL A;  3NQT A;  2AQ3 B;  2EY6 A;  5FO9 B;  3LNN A;  1KDC A;  4LMQ D;  5KIX A;  2K5D A;  3C1E A;  1FYC A;  4KI0 A;  3S1Q B;  3QIA A;  1KAA A;  2B8F A;  4IFD I;  4KJN A;  2CHB D;  2A6H C;  4IUU A;  2IJ0 A;  3BYT B;  4ABN A;  1STG A;  3SXH A;  4OO1 H;  2RBM A;  2PNR C;  3T56 B;  1L0Y B;  3D4W A;  4A3G B;  4JK1 C;  2A6H D;  5JAV A;  3PIO 3;  4QIW B;  3KF8 A;  4K2L A;  1G2T A;  3PUY A;  3ND9 A;  4HR7 B;  3HKZ B;  1HUM A;  3J80 L;  1QCB D;  2LY7 A;  2B2Y A;  4GZY C;  1CM9 A;  1IL8 A;  1X3Q A;  1S5C D;  2Z4I A;  3TME A;  2FMM A;  4EVO A;  1FNW A;  3R93 A;  3I4L A;  2M2L A;  3D4R A;  2ICI A;  3D6W A;  4R9W A;  1PLF A;  3S17 B;  3LWE A;  5EQ0 A;  1HRJ A;  2F0H A;  4CKE A;  1FD7 D;  1RTO A;  5FK9 C;  3M4Y A;  2J7Z A;  1PRT B;  2KHS A;  4F88 A;  3SK6 A;  1CTM A;  3DEO A;  1O80 A;  4XYQ A;  1QNK A;  3DWP A;  2OXP A;  3Q6S A;  4X3K A;  3SDZ A;  2EE1 A;  2EYF A;  3TDQ A;  5LL6 X;  2F0D A;  3HG9 A;  3K5O A;  1PFN A;  2A73 B;  2J0T D;  3FPP A;  5EKI A;  1SNO A;  1C4Q A;  4NDX A;  4Q5V A;  2DY7 A;  1I4H A;  1WTQ A;  1SYE A;  5CV9 A;  4KY5 A;  2IX0 A;  1CT1 D;  4G57 A;  1RD9 D;  2Y0S B;  5I9O A;  2NVY B;  3OIP A;  3X3N A;  4V0B A;  2F0P A;  2JEB I;  3FDT A;  1QNU A;  1EU3 A;  3PO3 B;  2HQE A;  5AFW A;  2CVR A;  1F9P A;  3WOF A;  4X3T A;  1Y8N B;  4IUQ A;  4NKL A;  5JEA J;  3G6J B;  1HTL D;  3C2P A;  4ZKC B;  1BQQ T;  3RZO B;  2CQA A;  5JVG 3;  2F03 A;  4J6H A;  2BCO A;  1EY5 A;  1EY9 A;  4H44 C;  2E76 C;  2SEB D;  4I7Z C;  5IT9 L;  3K6O A;  1EYA A;  1PFB A;  4CBV A;  1EL0 A;  5ELF A;  4KHV A;  4K5X A;  1MBY A;  3NSW A;  2QIL A;  4CJ2 C;  1XXG A;  5COY A;  3S15 B;  2A68 C;  3I3C A;  4NMZ A;  1QB5 D;  4FF3 A;  1DOL A;  1MD2 D;  2MJ8 A;  2L5T A;  1LLR D;  1BCP F;  1HCZ A;  4DAP A;  5EBD A;  1LTI D;  5I4D A;  1NCV A;  4DNT B;  2X6G A;  2A68 D;  1LV9 A;  1Q8I A;  2VXW A;  4RH6 A;  4F7X A;  2DNC A;  5JPM C;  1A3T A;  2NVX B;  1EFI D;  5JEA G;  2LKV A;  5KEE A;  3GTM B;  3GQB A;  1OXX K;  4K6L A;  3HEJ A;  3CQZ B;  1GOZ A;  2O4X A;  3QB3 A;  3SVM A;  4A3K B;  2TSS A;  3I72 A;  3J7Y W;  2DNE A;  1TS2 A;  3MAQ A;  2KOL A;  5JPN C;  1JOO A;  4AYB B;  2EYM A;  1X32 A;  1MI2 A;  4N9P A;  2EVB A;  4KTA A;  3ITP A;  3RD4 A;  4HSP A;  1STY A;  3QWN A;  1NR2 A;  5E4W C;  3ZYY X;  2F0O A;  4XDX A;  3P7J A;  1F9R A;  5D14 A;  3K7A B;  3JAM L;  2IX3 A;  1JC7 A;  4TQU S;  3NK9 A;  1MGS A;  3A54 A;  2K1B A;  1AN8 A;  1O7Y A;  3P75 A;  3TP8 A;  2KVM A;  2EJF C;  5EGT A;  1GXD C;  1WTX A;  1T5E A;  4ID6 A;  2QF7 A;  2Z8L A;  1CHP D;  4ZQ3 A;  2ENB A;  4RKL A;  1PTO F;  1V43 A;  1GUG A;  3AMU A;  3I73 A;  4MHE A;  2B2V A;  1STE A;  2NZ1 D;  4C2M B;  4H13 C;  5CBA E;  3U9S A;  3T53 B;  3MXP A;  5NUC A;  1ROD A;  1JB3 A;  1EU4 A;  3NTH A;  2EYO A;  2RSO A;  4G7O C;  1JIC A;  2F0K A;  3PIP 3;  2NVQ B;  1II3 A;  1JOR A;  3WOE A;  5DM6 3;  1WVL A;  4B9W A;  3MFG A;  3R8B A;  2B63 B;  2NN6 G;  1EOT A;  3WDN A;  5C44 B;  1Y1W B;  1D6E C;  4RGO S;  1D1K A;  2F0I A;  3W3A A;  2G9H D;  5CV4 A;  1ESR A;  2LS0 1;  1U4R A;  1VMC A;  1SNM A;  4KN7 C;  1IKM A;  3T4A C;  4L8J A;  2J4X A;  1BDO A;  2D5D A;  2MP1 A;  3R2T A;  1D2B A;  2WKD A;  4A3M B;  1DD2 A;  2EYL A;  2EZV A;  5COR A;  3LX0 A;  2BOS A;  4ME5 A;  3VYS A;  3K59 A;  2RSN A;  3BDC A;  4F87 A;  5KYL A;  2KQ3 A;  1ET6 A;  3TP6 A;  2ZXR A;  1I3Q B;  4A3B B;  1SND A;  3ND8 A;  1EY8 A;  1Z6H A;  3NHH A;  5IIF A;  3HOU B;  3I90 A;  3U9O A;  4K8J A;  4OL7 A;  3PO2 B;  4EGV A;  2KUM A;  4FVM A;  5BN4 A;  1T5X D;  3DMU A;  3MXN A;  1M8A A;  5I6W A;  2JP1 A;  3VYU A;  4C3I G;  4U67 3;  5M3M B;  4ILW A;  2NN6 H;  1JWU D;  3EVQ A;  3MZ5 A;  2PCF B;  2JE6 I;  2ID0 A;  1J9O A;  2KA7 A;  1WD0 A;  4WOR A;  1I6H B;  3IFT A;  3BYY B;  3D8G A;  1KDA A;  5ELC A;  1H9M A;  1ICW A;  1TWA B;  5EKK A;  1WTV A;  3K58 A;  4DU9 A;  4WFN 3;  2X6L A;  4DFA A;  1Z47 A;  5G3L D;  3Q23 A;  5T1I A;  4K14 A;  3HOW B;  4FXK C;  2B2W A;  2B2U C;  2MHV A;  1KLG D;  1TVX A;  1SBB B;  4J1M A;  5FLX E;  4EQN A;  5CGK A;  4IUV A;  1UEA B;  3PMF A;  1EYD A;  4B9X A;  3I70 A;  3TN2 A;  2QCP X;  3G7L A;  1D5M C;  1TQO A;  1E2V A;  3NWT A;  5JVH 3;  3NTK A;  1DJR D;  1F2M A;  1JQY D;  1LTG D;  4CJ0 B;  2NBF A;  3GO5 A;  2RKS A;  2F3V A;  2F4I A;  5C5L A;  4H0L C;  5A2Q L;  4RGT A;  1TY2 A;  5CV7 A;  1Y69 U;  1OXU A;  2Z4H A;  2WIN B;  2F0T A;  1DZ1 A;  4ZUI A;  1PFM A;  4QF4 A;  1FGB D;  3NXW A;  4O1N A;  1Q3L A;  1BO0 A;  2IL8 A;  3KBX A;  2CW0 C;  1JCK B;  5E1F A;  4K8I A;  2HCC A;  1EY6 A;  1STA A;  1PYW D;  2CW0 D;  4OIJ A;  2BDO A;  4KY6 A;  1CK1 A;  2F0U A;  3I91 A;  1CA6 A;  5C3X A;  5ISR A;  1Y8P B;  3URY A;  4HN7 A;  1LTA D;  2VNU D;  4IUP A;  1EZ8 A;  2E2J B;  4OGQ C;  2FHT A;  2D62 A;  2WV6 D;  3HOZ B;  3E0J A;  3TZD A;  1SYC A;  3FKI B;  4EQO A;  1EZ6 A;  5FO7 B;  2D2C C;  3TSS A;  4DK0 A;  2ZXO A;  1GUN A;  2HCI A;  4PMW A;  2XWB B;  3L9A X;  1I4P A;  3QOJ A;  2FMC A;  1CHQ D;  1KLU D;  1S5D D;  1SNC A;  4XIG S;  3S1R B;  2IX1 A;  5IOC A;  1S5F D;  1RTN A;  5KNC A;  2TMP A;  5I2Y A;  1GHK A;  3T13 A;  4S3S A;  4G7H C;  4KD3 A;  3IAY A;  1QWY A;  2A6E C;  4M8A A;  1CA5 A;  1UAP A;  2EYJ A;  3MEH A;  3KLS X;  5KGU A;  4QB4 A;  4ZLT F;  1YNN C;  1EEI D;  4X3S A;  1OXT A;  2A6E D;  1BCP C;  3H3V C;  1B9N A;  3RUZ A;  1YNN D;  1R4P B;  3CHB D;  5A35 A;  2XNA C;  3HS0 C;  2EY2 A;  1BCP D;  5CBE E;  3TBI B;  2KCC A;  1FR3 A;  1KTK A;  1IYV A;  5ELD A;  2L9H A;  4DA2 A;  1SYG A;  5M3F B;  2O5J C;  1WCM B;  1TS4 A;  3PUV A;  1NAP A;  1Y1V B;  4DAV A;  2FIN B;  3OWE B;  3R3O A;  2NTS A;  1AZP A;  1IKL A;  3GTO B;  5CYU A;  4OO1 I;  4FF2 A;  4TSS A;  2QDB A;  4RCN A;  1I6V C;  4C3H G;  2KCN A;  5C0X J;  3Q22 A;  1EY4 A;  3E6Z X;  4K5V A;  3LWU A;  4ZUJ A;  2PZW A;  3MXG A;  3J80 E;  3RZD B;  4DN4 M;  2WB1 B;  1VMP A;  1WTO A;  1XYI A;  1W6K A;  4R8N A;  3HOY B;  1EQV A;  2R3Z A;  4C3J B;  3FMC A;  1R9T B;  1ZKO A;  1E2Z A;  3DWQ A;  1K83 B;  1A2U A;  5IGB A;  1CZW A;  3GTJ B;  1B3A A;  1H9S B;  1LT5 D;  1ILP A;  1SXT A;  1RKN A;  1NSN S;  4FF4 A;  3V96 A;  3BZD B;  4FYD A;  2R92 B;  1G8Z D;  1U4P A;  4XQQ A;  1PMR A;  3NE5 B;  4ODG A;  3VR6 A;  2MUY A;  2LMC B;  1HQR D;  2HUG A;  1X3P A;  1KNE A;  4ZK9 B;  1SNP A;  4IUR A;  4ZRZ A;  1B1Z A;  3C46 A;  1PXU A;  1A6X A;  1ONL A;  2R6G A;  1FNU A;  1PZJ D;  5EPJ A;  5C0X G;  2RVL A;  1STN A;  1G91 A;  2E2D C;  1UUP A;  2N88 A;  2IWH A;  2EY5 A;  3I4M B;  3PUZ A;  1KAB A;  1MSG A;  1PTO H;  3MWY W;  1OXV A;  3SK8 A;  1SYF A;  5M5X B;  1BOS A;  2JA5 B;  3NUC A;  1PZK D;  2KEC A;  2OEO A;  1EYC A;  3M85 A;  1G29 1;  1GJX A;  2PZT A;  1WTR A;  3KLR A;  1QE6 A;  3VA7 A;  3IL8 A;  3NWS A;  3M3Y B;  4FXG C;  1SJH D;  3HRZ C;  3D31 A;  1SSO A;  2EYH A;  3SEB A;  2E2H B;  4DXF A;  2R61 A;  4HAE A;  2AQ2 B;  5CV8 A;  2MPM A;  1K8O A;  5IT9 E;  4KY7 A;  3OOC A;  5KRU A;  2N55 A;  1U4M A;  1SE3 A;  1CQF A;  1KDB A;  5IGC A;  2L4N A;  2JEA I;  1TY0 A;  2PQE A;  2PW7 A;  1HPC A;  4XT1 B;  3H09 A;  5CC4 A;  1LAB A;  5KNB A;  5C0X H;  3VR2 A;  5M5W B;  2B8G A;  3GV6 A;  4FP5 D;  3GTQ B;  2D9U A;  4A3E B;  4C1N I;  2ZT9 C;  5JEA H;  3K57 A;  2JYO A;  5KYI A;  1SE2 A;  3BVG A;  4A93 B;  1JR0 D;  4UAI A;  4L63 B;  3SK5 A;  1VCI A;  3IKJ A;  1I4G A;  4HMI A;  2BA1 A;  3S2D B;  1JOK A;  5BN5 A;  4L6T B;  1Q90 A;  2ICE C;  2M00 A;  2X69 A;  1DON A;  4QUC A;  1ENF A;  1LTB D;  4IFD J;  3GTG B;  4HCE A;  4FO2 A;  1XWE A;  3J81 L;  1B9M A;  4BY7 B;  3M4O B;  1B2T A;  3BDL A;  4IZ8 A;  2Q8R E;  5DM7 3;  2OF1 A;  2NVT B;  1HFN A;  4X3U A;  2XRS D;  3KBG A;  2OT2 A;  1IHZ A;  4BBR B;  1NUC A;  2SNS A;  1EY7 A;  4RWS C;  1UNS A;  1TS3 A;  1H9S A;  1F2L A;  2V4D A;  5CV5 A;  4CHT B;  3JAM E;  4ULL A;  2EYP A;  1BNZ A;  3QJY A;  4WJW A;  2SNM A;  3A8K E;  3ONA B;  3EFX D;  1GUT A;  1KNA A;  3SHL A;  3DM1 A;  5TSS A;  1VDZ A;  1H9J A;  1Z7T A;  2AQ1 B;  4IFD G;  3DWA A;  2JSO A;  3V2T A;  1BBX C;  3TZU A;  4ZAI A;  3KUP A;  3VYR A;  1TR5 A;  4A3I B;  3Q24 A;  4PQX A;  3FPU B;  1QOH A;  1RHP A;  1BXT A;  1IW7 C;  1ZEQ X;  2WAQ B;  2C9O A;  2Z1C A;  1PRT F;  4WRD A;  2K5W A;  4K6D A;  2EY1 A;  1LTT D;  2B2U A;  3P20 A;  4KN4 C;  1O7Z A;  1OXS C;  1IW7 D;  4I65 A;  5F2D A;  2O2L D;  1G6Z A;  3S14 B;  3OWF A;  4RCO A;  1S4Z A;  1HQM C;  5ELE A;  4K5W A;  2L11 A;  2XIW A;  2PYK A;  2XSC A;  3KK7 A;  2K04 A;  2FFK B;  2IT1 A;  1HTP A;  2B2T C;  4BA1 I;  4KD4 A;  2AUJ D;  3HP3 A;  1V1O A;  5HGT A;  2L1B A;  3DEP A;  4RHR A;  1R4Q B;  2PPB C;  2K33 A;  4HTH A;  4J8Q A;  2WAC A;  4Z9C B;  5IGG A;  4TRD A;  2YYZ A;  3C3L A;  4JBW A;  1JE4 A;  3BG3 A;  1AFP A;  4H7B A;  4IFD H;  3H91 A;  1MSH A;  3NPP A;  2AWO A;  2R93 B;  5D65 A;  1SFO B;  1JWM D;  3OW7 A;  4MIU A;  3N6R A;  2NWG A;  4DK1 A;  4IQZ A;  4PV1 C;  2RA4 A;  3QG1 A;  1NR4 A;  1LTR D;  2BA0 A;  2NN6 I;  1EWC A;  3BS1 A;  1VF5 C;  3ERQ A;  1B44 D;  1ZXT A;  1V8Q A;  1GHJ A;  2VB3 X;  4DF7 A;  3K0Y A;  5K5P A;  4HED A;  2JA8 B;  3OSO A;  3SK4 A;  3OMG A;  2NTT A;  1QG7 A;  2C5C A;  4Y7N B;  5I2X A;  3GTK B;  1O78 A;  1ET9 A;  3HZX A;  1TWH B;  5IGD A;  2F0W A;  4N9T A;  2F0G A;  1DM0 B;  1G2S A;  1SEB D;  1F2Y A;  1Y8O B;  1WTP A;  4BY1 B;  5IGE A;  2NYZ D;  4XXE A;  2BE5 C;  2WP8 J;  1RCV D;  4G4K A;  1EEF D;  5T1G A;  1W6J A;  5G3L F;  1STB A;  5FOB B;  4NW2 A;  2FJ2 A;  5A2Q E;  4IN3 A;  2BE5 D;  2SDF A;  5K36 G;  1Q1B A;  4PMB A;  3SR1 A;  2NUC A;  2L55 A;  3BVM A;  4KMU C;  4RA8 A;  1H9K A;  4P2C B;  3E5S A;  2EPB A;  2F3W A;  3EQL C;  2AWN A;  5EKL A;  4O42 A;  1RF2 D;  1V1P B;  3FEW X;  3PUW A;  2IW3 A;  3DXJ C;  3DHQ A;  3A56 A;  2A74 C;  2KED A;  4XQN A;  2EJG C;  5BN3 A;  4C1N K;  2B2Y C;  1TKW B;  1TWC B;  3FVQ A;  5C3E B;  5JJZ A;  3X3M A;  5CR3 A;  4YIJ A;  2K05 A;  5CV6 A;  4OIK A;  1TU2 B;  3PV0 A;  5C4X B;  2K01 A;  3FRP B;  3I8Z A;  1SYD A;  3MVV A;  2E74 C;  3ERO A;  3GP7 A;  1ZYR C;  2F1M A;  4RAU C;  5D3D A;  1VF7 A;  3TP5 A;  1K8M A;  2A5H A;  5E4X A;  1A15 A;  3D6C A;  2AUK A;  5C6A A;  3MA2 B;  4IUT A;  1D5Z C;  1ZYR D;  3L7Z C;  3OIQ A;  1BF4 A;  2F0V A;  5K36 H;  4Q0F A;  4KV6 A;  1HXY D;  1DXM A;  1AP0 A;  2K6A A;  4RGM A;  2F0Q A;  1F9Q A;  4RFB A;  4CKB A;  1I4R A;  2F0J A;  1A2T A;  4NP5 A;  4XYO A;  3NQI A;  1ILQ A;  1YNJ C;  3OHX C;  3CRK C;  1SMY C;  3GD7 A;  2Q8I B;  4RHS A;  1LT6 D;  4A3D B;  3CU7 A;  3GTL B;  1QIL A;  1YNJ D;  3P1H A;  1PTO C;  5D3I B;  4DGZ A;  3NTI A;  1SMY D;  1ENA A;  3S1M B;  3V05 A;  2EXZ A;  3UI2 A;  3DUZ A;  4RGN A;  2RDG A;  1SE4 A;  1RJT A;  1PTO D;  1S5B D;  3K5N A;  4LJZ C;  1TS5 A;  2F0L A;  4DXG A;  1LT4 D;  4QCL A;  1WD1 A;  2RQX A;  2F0M A;  3MC0 B;  1DOK A;  4DNR B;  3J7A V;  2WKC A;  1SAP A;  1LO5 D;  3A8J E;  5M5Y B;  2WII B;  3NP8 A;  4HSV A;  5J39 A;  4C3I B;  5FO8 B;  3VR5 A;  4PMC A;  3OPO A;  3D3R A;  2RDH A;  2I07 B;  2PO4 A;  5IOD A;  4QMG A;  4XT3 B;  4U68 A;  1E0B A;  1LAC A;  4FF1 A;  3TP7 A;  2R7Z B;  3A7L A;  4CKC A;  1ENC A;  4IUN A;  3SE0 A;  3GV3 A;  3T51 B;  4UDU C;  2A69 C;  3VR4 A;  1V1P A;  1BUV T;  1HA6 A;  1JWS D;  1H9R A;  2PMZ B;  5C4H A;  1U9R A;  3A7A B;  3K5M A;  2L0C A;  4V19 0;  4KHZ A;  2DN8 A;  1TII D;  1GUW A;  2A69 D;  2JA6 B;  3S2H B;  5M9O A;  1B53 A;  2F0N A;  4CJ1 B;  4BS9 A;  4LAA A;  3CKI B;  3RLF A;  5HUR A;  4B08 A;  2PZU A;  4IAL A;  4QUF A;  5EBC A;  1OO9 B;  5I9P A;  3AU7 A;  1EIG A;  5IGF A;  1EWH A;  1GUO A;  1PRT C;  4KJO A;  4XTC S;  4FXD A;  1SYB A;  4MN3 A;  1TT2 A;  3A55 A;  1XTC D;  1PZI D;  3EA6 A;  2YU9 B;  2VUM B;  1PRT D;  4HCS A;  3VA5 A;  5LHY 1;  1S5E D;  3H0G B;  3IFD A;  3GTP B;  4CGY B;  1L0X B;  3R2I A;  5C4Z A;  2QKI C;  3MTS A;  2GA4 B;  4E6I A;  2B2V C;  5J1Z A;  2ZXP A;  3OMC A;  2HDM A;  3RMH A;  3HOX B;  1RDP D;  1D5X C;  2H4O A;  1Q12 A;  1FNV A;  1AW7 A;  2XWJ B;  2NB0 A;  5I6Y A;  4BWG B;  4BA2 I;  2VB2 X;  3HGB A;  2KEE A;  2RDF A;  3MFY A;  1EIH A;  5DNF A;  2PW5 A;  4ZYS A;  1C8C A;  4XQJ A;  2L12 A;  5FLX L;  4C3J G;  3H94 A;  2XN9 C;  3AB9 A;  4PNY A;  3NBH A;  1STH A;  2G9D A;  2LFN A;  3C1F A;  4FNF A;  1U4L A;  5C0X I;  1BR9 A;  2KJX A;  1M4V A;  2I46 A;  1CI3 M;  1I4Q A;  1B50 A;  1BCP B;  3J7A F;  5LL6 S;  3H6M A;  5FKA C;  1EQT A;  4C56 C;  1C48 A;  1I4X A;  3QO2 A;  3Q0A A;  1HA5 A;  1A3U A;  4ZKB B;  3KLS A;  3F2U A;  4OHJ A;  1F77 A;  2BDN A;  4R8I A;  3VYT A;  3BDO A;  3VR3 A;  1GUS A;  3T16 A;  1EY0 A;  5DEH A;  1DYQ A;  2K7V A;  5EJW A;  1CFM A;  2EJM A;  5E3F A;  1LTS D;  3PUX A;  4RKB A;  1J8I A;  4KKT A;  2Q8T A;  3J81 E;  4KKS A;  1A3V A;  3L3O C;  1TWF B;  5DAU A;  5EPL A;  5KND A;  3W2D A;  2B2T A;  1I50 B;  4G7Z C;  5C3W A;  3CRL C;  1ML0 D;  1AEX A;  2JXM B;  2MGS A;  2K28 A;  1PDQ A;  1HHV A;  4HMJ A;  1HFG A;  3S9W A;  1SDF A;  4A3J B;  1Q1E A;  4A3F B;  2M9V A;  2IPK D;  2K5Q A;  1B4O A;  3D4D A;  2O5I C;  1ESF A;  1E2W A;  4M1U B;  3EJI A;  4F8M A;  2QEJ C;  5C5M A;  2XRQ D;  3N52 A;  5ELB A;  2SOB A;  4KKU A;  1WTW A;  1DOM A;  2B2W C;  4C3H B;  3QOL A;  2H1E A;  1DCZ A;  1LT3 D;  3MXU A;  3O13 A;  1IYU A;  1D1I A;  2XVS A;  5JOB A;  2F0S A;  1QJO A;  4DAY A;  1PTO B;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...