1CT1D

Cholera toxin b-pentamer mutant g33r bound to receptor pentasaccharide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLARKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords CHOLERA TOXIN
publication title Structural studies of receptor binding by cholera toxin mutants.
pubmed rcsb
source organism Vibrio cholerae
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ct1D00
1V1PA 1PZJD 5FK9C 1LT6D 1LTAD 4RHSA 1JQYD 3DWPA 1D5ZC 1LT5D 1HQRD 5I4DA 2AQ1B 3R2TA 3CHBD 1D6EC 1QILA 1V1OA 1JWUD 3GP7A 4RFBA 1F77A 1PRTC 2NTSA 4ZYSA 1BCPB 1AW7A 1PRTD 1FNVA 1LTBD 1FNWA 1TS4A 4DXFA 1CT1D 2J4XA 1PTOF 2SEBD 1FNUA 3DWQA 1S5DD 1CHQD 3R2IA 2XNAC 4RGOS 1GOZA 4C56C 1SEBD 1L0YB 3URYA 1KLUD 1LT4D 1JCKB 1AN8A 4RCOA 1RF2D 3BVZA 3KLSX 2NTTA 1BCPC 4K6LA 3MFGA 3SEBA 3DWAA 1S5CD 1DYQA 2RDGA 2R61A 2TSSA 4BWGB 2QILA 1CQVA 1BCPD 1LTRD 1S5FD 2IPKD 1JWMD 4L6TB 5ELBA 3V05A 3OWEB 1EU4A 2IJ0A 1B44D 5ELEA 1G8ZD 1LTTD 5ELCA 1T5XD 1HTLD 1V1PB 3BZDB 1UNSA 2G9HD 3MC0B 1KTKA 1CK1A 1I4QA 3EA6A 3R8BA 1I4XA 3BYYB 1FGBD 4TSSA 2WV6D 1LT3D 1MD2D 2AQ3B 2QEJC 1TS2A 2ICIA 5D3DA 1CHPD 1PTOH 1JWSD 1S5ED 1XXGA 2O2LD 1TS3A 1SE2A 3BVMA 4L63B 1ET6A 1B1ZA 1EU3A 4RGTA 4RHRA 1TS5A 1RD9D 2XN9C 1I4HA 5ELFA 4RGNA 2XRSD 4UDUC 1KLGD 1LO5D 1EFID 1BCPF 1PTOD 1PZID 1EWCA 1D5MC 1ET9A 1LTID 1PZKD 2AQ2B 3BVGA 2CHBD 1M4VA 1PRTF 1PTOB 1BXTA 1HXYD 4DXGA 5ELDA 1LTGD 1FD7D 4RH6A 3TSSA 4OHJA 1D5XC 1LLRD 1EEFD 1S5BD 1HA5A 1SJHD 1JR0D 1I4RA 1STEA 1TY0A 1ENFA 1ESFA 1XTCD 4RGMA 1PTOC 1DJRD 1SE3A 1L0XB 1LTSD 4Z9CB 5TSSA 1SE4A 2RDHA 1I4PA 3W2DA 2Z8LA 1I4GA 2XRQD 1RDPD 1TY2A 4O1NA 1SJED 1SXTA 5D3IB 1PRTB 3EFXD 3O13A 1UUPA 1SBBB 5FKAC 3BYTB 1PYWD 1EEID 1RCVD
chains in the Genus database with same CATH superfamily
3I4MB 3HS0C 4GS3A 5IGCA 3Q22A 2RSOA 1FGUA 1F2MA 1G291 1D6EC 2LMCB 2IWHA 4DNIA 4BY1H 1W3SA 1CKNA 4PMBA 3GTJH 4DV5L 2NTSA 3JAME 3G71A 5NUCA 3T1HQ 1LTLA 3VYUA 4KHPQ 1GUSA 4ALPA 4JI5L 1FNWA 4V0BA 1PTOF 4JI7L 1FNUA 2ENBA 4P74A 3GTPH 4GNXC 2NVYB 3BDLA 2KHSA 4QIWE 5D14A 3V2TA 1T5EA 1HZAA 1Y8NB 1YJWA 4XYQA 1EUJA 1IBLQ 2F0OA 4DU9A 1PXUA 2A69C 2IX3A 5JJZA 1BCPD 1EQTA 4H13C 4K8JA 3S17B 5FO7B 3HFZB 1B44D 1LTTD 2SOBA 4GLAC 1OXVA 1GHJA 2KCNA 2VUMG 5IGDA 2GA4B 1N34Q 4TQUS 2UUAQ 5DLQE 1Q82C 1UEAB 4DR4Q 2Q8TA 5C3XA 2CQAA 1X56A 3S17H 1FYCA 4IFDI 4DFAA 4MTNA 4B3ML 4PZ8A 5BN5A 3TQYA 5C4ZA 4AIMA 2HDLA 1OXXK 2K14A 1HR0W 4WJ4A 1S5ED 4LF7L 1SE2A 5IE8A 3HKZG 4PZ7A 3PIO3 4I65A 3T13A 2R7DA 1KLGD 3M4PA 3PO3B 4JBWA 1PTOD 5IGEA 2JQOA 2X69A 1PZKD 3QG1A 1A2TA 4QY7A 3CKIB 3NEMA 3VDYA 1H9SB 4BBRG 5DM63 2PNRC 3WWVA 3CF5A 4LW1A 2UXCL 1ZKOA 4C1NI 1GUWA 4P75A 5E4XA 2BE5C 3KF8A 5BN3A 1EY6A 1PVOA 2N55A 1PDQA 1NY4A 3C3LA 5CORA 4ZCKA 4KJNA 1KDCA 4DKAC 5KIXA 3Q24A 5IYDH 3P7JA 4K2KA 3PO2G 3EVQA 1ASZA 4LF5L 5EKIA 2CH4A 4CJ1B 3GTQH 2JA8B 3GTOB 1PA6A 3J80i 3K8AA 4A3EG 1XNQL 5DAUA 4JI8L 2F03A 3W3AA 4J1MA 1PRTC 2JA8H 2K05A 3M3YB 4H44C 3GTKH 1FNVA 3C2PA 4QQBX 4DK0A 2J4XA 2MFIA 4JCVE 5CGKA 4R8NA 3KBGA 1L0YB 2WAQB 4QL5A 3M3YH 2CVRA 3MXNA 1A3VA 4DV7L 4RAUC 3MXPA 1NUCA 4K5XA 4NDXA 4LK1C 3DWAA 3U50C 3CRKC 2IPKD 5CYUA 2WKDA 2KEDA 1NMFA 3K0YA 1G8ZD 1VQBA 1A6XA 3SXHA 4PQXA 2E8GA 3SK6A 5M5WH 1LUZA 1CKMA 1A63A 1I6HB 3J80c 2PW5A 3BYYB 4JI6L 2NN6H 5KEEA 2WACA 4R4OA 3RUZA 5I2YA 4IOCA 2NBFA 3WOFA 1HFNA 2BCOA 3LGJA 4DR1L 1I6HH 4L5RC 4MIUA 3CCQA 3MTSA 2K1BA 4ZK9B 3I73A 4GKKQ 1TWHB 5EKKA 1XJVA 5J1ZA 4BBSG 2JA7B 3FP9A 4R1JA 2ES2A 3NHHA 4KD3A 4HIMA 1SE8A 4IUPA 1B70B 5I2XA 1ENCA 1FD7D 1TWHH 1EY8A 1SNDA 4K5WA 2V4DA 5E4WC 5LMUQ 4HTHA 1TWCB 4DK1A 5M3FG 2D2CC 4IPCA 4OWTB 4A3GB 2QA4A 5FJ8H 2GVAA 2IL8A 1TWCH 1XMQQ 3FMCA 3EN2A 3Q0AA 1I50H 4DR7L 5EJWA 2PQAB 1V43A 3UE1A 1KL9A 3CCVA 1PZJD 2A68D 4GN3B 1J5EL 2JEAI 5CV7A 1XMOL 3LWUA 2O5IC 3F2CA 2MNAA 1F2LA 4Q0FA 3M4YA 1HZCA 3KFUA 3OW7A 4LUZA 3J81E 2D0OA 2Z1CA 4LFBQ 3CMEA 2HCIA 4C3IH 3TREA 3HOUB 1K8GA 4DXFA 3K80C 4KJOA 3CP0A 3U9OA 1PH9A 1SDFA 3OW2A 1SFOH 1XNRQ 5C44H 1SNQA 2EYLA 4DV3L 4A3BB 1HNWQ 2EXDA 4DV1Q 4RCOA 1GUGA 4GKJL 2N78A 1ENAA 1KXLA 4YHHL 2OWOA 1YVCA 2LFNA 1EY7A 2OCEA 3TDQA 5ELCA 4KKSA 5IWAL 1XPOA 3M85A 3AQQA 2F0LA 1TWFB 4DAYB 4JK1C 4S3SA 3H0GB 4KK7A 1QNKA 1N32Q 2JK8A 2OTJA 3D31A 3A7LA 1HA6A 1O7IA 4HJ8A 1TWFH 2ZM6Q 2QDBA 3K59A 3BG3A 3PMFA 1SSOA 2MGSA 2I5LX 4PMWA 2UXBL 1ET9A 3AFPA 3NENA 5BR8Q 1Z9FA 2ZTEA 1QUQB 4DK3C 4WJWA 3ONAB 4PMCA 3J81j 5KYIA 4TKOB 5KRUA 4L5SA 3VA5A 2VY3A 2JA8G 1D5XC 1VCIA 2F3IA 1L1OC 1OTCA 1AZQA 1VQ6A 2EY5A 1KDAA 2OF1A 1I4RA 2K7VA 4TVAB 1N33L 1D7QA 1B3QA 4HCSA 5HGTA 1K3RA 4FF3A 3CCSA 1TKWB 1SE3A 1X3EA 4JBKA 3TS2A 1SE4A 1YHAA 4DUZQ 4QMGA 1RDPD 4O1NA 2JA6B 5M9OA 3AB9A 4G57A 1BOSA 1EEID 1Q46A 5C4JB 4BXXH 3OPOA 3S14B 1BO0A 1GJXA 3M9BA 1UE5A 2JA6H 3J7A5 2AHOB 3S16H 2VS1A 5IYBH 4HIKA 2FXQA 5C4JH 1S4ZA 2CWAA 2CCZA 1XPUA 1PH8A 3F2UA 3GTGB 3PIPA 1GXDC 4P71A 3JAMi 3VR3A 4PV1C 5C3EB 3GTGH 3RR5A 3SEBA 1RKNA 1DYQA 2RDGA 2F0SA 3S1NB 3GDEA 4N9PA 3H3VC 1CKOA 1JWMD 3BDCA 1EU4A 3DEOA 1VQJA 1I94Q 1IZ6A 1T5XD 3EJIA 3MWYW 1ICFB 3S1QH 1VQ9A 1WTWA 2E2JB 3TS0A 3S1NH 1JJCB 1I6VC 4KKTA 1SMXA 2VB2X 2A73B 4NMZA 2D5DA 1Q1BA 5FJ8G 1WD0A 1MSGA 2SNMA 1VQLA 3S24A 1ZXTA 4EQ5A 3NBHB 1CHPD 2DN8A 2WB1G 2K6AA 4IURA 1TS3A 4LAAA 1YBYA 4MZ9A 2DNCA 2OXPA 4Y7NB 1DONA 3PQIA 5EBCA 1J6QA 1C7YA 1EWCA 3JAMc 4AQYL 2L12A 4IUNA 1EIHA 1VQMA 3OOCA 1KAAA 3CRLC 1IKMA 2DGYA 3MAQA 4Y7NH 2FINB 1GUTA 1C48A 4C3IG 2L5TA 4LF8Q 1XYIA 4YY3Q 4C2MB 3CU7A 1H9JA 1STHA 3AMUA 5C44G 1JMCA 2VUMB 2Z8LA 1DGSA 3I4LA 2K5VA 1EY5A 1Y8OB 4BA1I 5C0XJ 1PFSA 1V1PA 2MO1A 4ILWA 1RTNA 4NB3A 5IT9L 4C3JB 4R4CA 4YWKA 5KYLA 1HZBA 1FL0A 2Q2IA 4DV4Q 4YWMA 2E2DC 3HKZB 1LV9A 1IL8A 4J6HA 4FDBA 1SNPA 2LXJA 1B9NA 4C3JH 1SMYC 1SAPA 3DLLA 2B3GA 3NWTA 2XIWA 1PMRA 4KY7A 4K6DA 2XNAC 4BBRB 1S72A 1X3FA 4B9WA 3HG9A 1A8VA 4LF4L 2R92H 4QF4A 1MI2A 1VQEA 3S1RB 2BA1A 2WFWA 2R61A 4UPAA 1PLFA 1LTRD 3TEHB 1JJGA 2B29A 1WTXA 5M5YB 1BBUA 3W5OA 3MEFA 4N9TA 2EJMA 3S1RH 1F9SA 2FMMA 4POGA 3PO2B 3K5LA 2Y0SE 4GN5A 4UHVA 2RCFA 2WV6D 3KLSA 1HUNA 1LT3D 4X62Q 4A3EB 2QEJC 5D3DA 1J9OA 3FHWA 4ABNA 4X64L 3D6WA 2NVQB 3NWSA 3PO2H 4UY8C 1O7ZA 4QUCA 4BXXG 4B3SL 1V9PA 1QJOA 3A0JA 3E6ZX 4A76A 4NXMQ 3H15A 1U0LA 4GNXA 5CV5A 4F7XA 3E0JA 2CHBD 2JA6G 4LFCL 1JOOA 2UUCQ 5IY0A 2IY5B 4FYDA 1K0RA 3W1BA 4DGZA 1CQFA 2JEBI 4LMQD 4LFAL 4EQNA 1JR0D 1E1TA 1KD1C 3M4QA 2F0HA 3RLFA 1IL2A 5EPJA 3M4OB 1VQPA 4F87A 1HFGA 1DOKA 1E24A 3RZDB 5FO8B 1G91A 1VQAA 2L0CA 2PZUA 1WOCA 1SYGA 4CJ0B 1EY4A 4A3MH 1SBBB 2A6EC 1K3BC 2IHFA 4DV6Q 4A3KH 3V96A 5GADC 3RZDH 3D4DA 1LT5D 5I4DA 5IODA 3R2TA 4RFBA 2E2IB 5IT9c 4Y52H 1LYLA 1TR5A 4IUUA 4BA2I 4BBSB 2SDFA 1CT1D 2SEBD 3UDFA 2C9OA 3S2HH 4JBJA 2MP1A 2V1CC 4HSPA 1GOZA 3TZDA 2I46A 1JCKB 2MO0A 1EQVA 2AUJD 4BBSH 1S5CD 3UE0A 5M3FB 1AZPA 1YNNC 3EROA 1PH7A 5A35A 3GTPB 1HNZL 2FHTA 3E9HA 2VQFL 2EDGA 3GV3A 2H5XA 3FKIH 1U4PA 1X65A 5M3FH 2K75A 3A8JE 3NTIA 1HZ9A 3BS1A 1DOLA 3AFQA 2I5MX 1Z6HA 3HOZB 2A6HC 2EE1A 3QR8A 4NW2A 2X6LA 3PUYA 3Q6SA 4G7ZC 4C3HH 1RD9D 4KY6A 2Z6KC 4DR5Q 1XPRA 2UU9Q 3HOZH 1E2VA 1LO5D 3J80L 4A3CH 2F1MA 4N8FA 1XNQQ 1RL2A 3MXGA 3ICEA 1HXYD 4XDXA 2E5LQ 4RH6A 5K5PA 1FVIA 2J0TD 2F3VA 4KHVA 5A2QE 4YWLA 4WJ3M 4HJ7A 4C3JG 1SJHD 2JYOA 2R3ZA 2WINB 4DR3Q 1ENFA 4LF6L 1DJRD 4DR2L 1N9WA 3J7YW 5I9PA 2R92G 3NELA 1I4GA 1H9MA 1X54A 2N88A 2KOLA 4JV5Q 3HOXH 3E9IA 3J7ZC 2EJGC 5HY6A 1IYVA 5J22A 2ZXOA 5FLXE 5IIFA 4JYAL 1A2UA 2YTVA 5C0XH 1HQRD 2H1EA 2MJ8A 4KV6A 4JW0A 5K36H 4JI2Q 3SR1A 5EGTA 1HJPA 1F77A 1STBA 3KLWA 1G51A 3FPPA 4ZYSA 1VQ4A 1WTOA 2EY1A 3EQLC 4KLKA 1BCPB 3NUCA 5HURA 3GTQB 2CH4W 3K5OA 5GAGC 4NPSA 1G6PA 2AKWB 3HEJA 3TRZA 4DR6Q 4BY7B 2PYKA 4RGOS 1KC8C 4C56C 4KHPL 3ITPA 1Z47A 1SNMA 1EWIA 3U58A 2A6HD 3GTKB 1CTMA 4IUTA 2HUGA 4BY7H 4IUQA 4NXNQ 4K0KL 1SROA 1WD1A 2A69D 2OTLA 1E2WA 5I6WA 1IBLL 5IGBA 5E7NA 1UNSA 2B8FA 4X65Q 3MC0B 1PYBA 2HT1A 1STGA 3R8BA 1N34L 4DR4L 4IZ8A 2O4XA 3SK8A 2K32A 1SRUA 2HHHQ 1MJCA 1PTOH 2O2LD 2MQHA 5BN4A 4L63B 4RHRA 4A3MG 4A3FH 5M5WB 2XRSD 3WDNA 5H1SE 2EYPA 4HN7A 4A3KG 1J5EQ 1LTID 2A1AA 5C4XB 3QOLA 1A62A 1K8AC 1Q86C 2PMZE 1PRTF 2WIIB 4IUVA 4DV2Q 3OTOL 1BXTA 3R3OA 1D1KA 4O2DA 3D4RA 2D0PA 1WTQA 1KABA 2L55A 3A5UA 5C4XH 1LM0A 4FF4A 3T16A 1HA5A 2BE5D 1XTCD 5JVH3 3HOWG 5EAYA 1YEZA 3HOYH 1CFMA 4CBVA 4GKJQ 4FF2A 1IYUA 4OIJA 3NSWA 4E6IA 4JI3Q 4HMIA 3T1YL 1QVCA 1QZGA 2F0IA 3GO5A 3OHXC 5GROA 1QNUA 1EIGA 3KOJA 2WB1B 3FKIG 4KI0A 4MN3A 2L4NA 4R4TA 4X3UA 1VQCA 1O78A 1I50B 2N49A 5LMNQ 1HCZA 2F0WA 1A3UA 1PRTD 2EYJA 4IALA 2K04A 1Q81C 2EYMA 3CPFA 1L1OA 3VYSA 4C3HG 1N36Q 4V190 3HOZG 3IRBA 3BVZA 4C3IB 4A3CG 4HIDA 3CW2C 4K6LA 4IPHA 1SYEA 4AYBG 3OYYA 4M1UB 4BWGB 1D2BA 2PPBC 3SHLA 1SFOB 4O42A 2F3WA 5KGUA 5C44B 3L9AX 2ZTCA 4P2CB 3K6OA 2ZJPA 3TP6A 1I4QA 3SDZA 4CGYB 4FXDA 3I4NH 1RHPA 3D8GA 3Q8DA 4TSSA 3GTMB 1CKNB 1FR3A 5M3MB 1TS2A 3QIAA 3HKSA 4H0LC 1FJGQ 1Y1WH 2R7FA 1KNAA 1TS5A 3HOXG 4K8IA 2RF4A 3TZUA 1HNXQ 4DAVA 2LY7A 2F0MA 3MFYA 3GTMH 5M3MH 3U9SA 5AJ3Q 5C0XG 1H9RA 2AQ2B 3CCUA 1BNZA 2Q8RE 5K36G 4GKKL 2A8VA 3TSSA 3RN5A 2DNEA 1I5FA 1VQIA 3CC2A 4ULLA 4HR7B 1IBKQ 4CJ2C 2F0QA 4DK6C 1AFPA 1B3AA 1EEFD 1BVSA 2PW7A 2K33A 3JAML 3I56A 1ESFA 3SK5A 1HR0L 5LMUL 1PFMA 1CA6A 5TSSA 3W2DA 3ER0A 4A93B 1STAA 1Y1VH 5JPMC 2PZWA 3PUXA 3BDOA 4OL7A 1PYWD 1SNCA 1RCVD 2M2LA 1IBMQ 4BY7G 1UE6A 1EQRA 4LJZC 2E2HB 1XMQL 3C46A 1ZEQX 1EIYB 3IFDA 5JEAJ 4A75A 2C5CA 4A93H 1C4QA 1B2TA 1EZ6A 3PSIA 4HJ9A 4B3RL 2UUBQ 1ESRA 1IKLA 4DUYQ 2E2HH 1QOHA 4B3TQ 1TS4A 1EY9A 2XWJB 4QIWB 4ZUJA 4LF9Q 2BA0A 2K03A 3S16B 3NK9A 1VQHA 3IAYA 2XSCA 4DNTB 1SN8A 3H94A 4A3FG 4CKCA 4A3LH 4JI0Q 2EOTA 1AN8A 4X6AH 4ZQ3A 1GKHA 4KKUA 3HZXA 1NTGA 1XNRL 1Y8PB 3G6JB 1GVPA 1HNWL 4BS9A 3LWEA 1EL0A 4DV1L 3K7AH 4FNFA 3KF6B 2KBNA 4LUVA 5ELNA 1YJ9A 2AWNA 4U673 5C4XG 2PI2E 1KIXA 1B50A 4MNOA 3I55A 4LUOA 5CR3A 1MKHA 2CFMA 2IW3A 5G3LF 4IOAA 3IFTA 2M9VA 3Q23A 4JI4Q 2R93B 3S1QB 3HOYG 4GLXA 3NTKA 1NBWA 1VF7A 1EY0A 2XVSA 2F4VQ 5KNCA 4RGTA 2KVMA 4X66L 1T9HA 1W2BA 2L9HA 3MHBA 1CSQA 1A15A 3HGBA 1VQ8A 4ODGA 1N32L 1AEXA 1D5MC 1LACA 4OELB 2R93H 2ZM6L 4I7ZC 2UXDQ 5IYCH 1M4VA 3RN2A 1U9RA 2F0UA 4DXGA 1JICA 1LTGD 3K7UC 4OX9L 2YTYA 4PZ6A 1AP0A 1LLRD 3ULLA 1KAWA 5JAVA 1SNOA 4DV0Q 2OQKA 1L0XB 1LABA 2EYHA 3MXUA 1OXTA 3D4WA 2RDHA 1YNJC 1QCBD 2Y0SG 3GV6A 1SXTA 4EX5A 2PI2A 3EFXD 1UE7A 2KCMA 3OMGA 5T1GA 3T53B 2R7ZB 4DUZL 1MSHA 4J8QA 5FK9C 4G7OC 1LTAD 2NVXB 2EYOA 3N6RA 4JBMA 2Q2UA 1WTVA 4G4KA 2G9DA 2R7ZH 2CW0C 3I4NG 5KNBA 2KUMA 2NVXH 1WTPA 2B2YC 1LTBD 2B2WC 2F0KA 4OONA 3QOJA 1Y1WG 3ND9A 1GO3E 2IX0A 4IQZA 4MTKA 1RF2D 3KLSX 4HAEA 1H9SA 4HEDA 5M3MG 1EZ8A 1E0BA 1WTHA 4XTCS 4IPDA 2WAQE 2ICEC 2PQEA 1CQVA 1SLJA 1EOVA 2EY6A 4L6TB 4B08A 1F9QA 1RODA 5T1IA 2R92B 1MHWC 3W1GA 3KJPA 2NZ1D 4N8X1 2EQSA 2JE6I 1GUOA 5CBAE 1VQNA 1DXMA 1TWAH 1I94L 2QW7A 4H02A 1BBWA 3KLRA 4CKBA 5FLXc 3KYHC 4U68A 5C0XI 3AYHB 1ZYRC 1Y1VG 3RLOA 3D3RA 1EIFA 4XQNA 2B8GA 5CV9A 5I9OA 4UDUC 2VQEQ 1EFID 3RMHA 4L5QA 1RIPA 1WCMG 2FFKB 4A93G 3GQBA 1QWYA 3TBIB 5I6YA 1NR4A 4NP5A 1R9TB 2F0EA 3PIOA 3J7AF 4R9WA 1HQMC 4CDDC 1H9KA 3J81L 3GD7A 4XQQA 1NE3A 1R9TH 1VF5C 1W6JA 1LTSD 3I3CA 4OGQC 1L0WA 2B2VC 2BDNA 3PF5A 1EYCA 4A3LG 4LF8L 4YY3L 1ILPA 2R6GA 4DPGA 1Q7YC 3G48A 2KENA 5FKAC 1BKBA 4JOIC 5M5XB 4DV5Q 2Z6KA 3RZOB 3DWPA 1D5ZC 2JA9A 5GAHC 1JT8A 3H3VH 1STNA 1QILA 2HDMA 5JEAH 4JI5Q 4A3MB 1S40A 1C9OA 3E3XA 1BDOA 2B2TC 1CZGA 5M5XH 4JI7Q 3RZOH 2NWGA 4KY5A 4A3KB 4DV4L 3P1HA 4QJFA 1VS0A 3I8ZA 2I5HA 2P5ZX 1PFNA 2QF7A 1SMYD 2F0PA 1XWEA 3UDIA 4L5TA 1OO9B 3TN2A 2N8NA 4CHTB 4POFA 3BJUA 1DM0B 2GN5A 1U5KA 2ZXRA 2ZJRA 2B63G 1BCPC 3MVVA 2R93G 2TSSA 4HMJA 3R93A 4F88A 4ZLTF 5IYCG 3M7NA 1YIJA 1MIUA 3S2HB 5ELBA 4JI1L 1KHIA 5JJLA 3QJYA 3F8TA 3HOWB 1PH1A 1K8OA 4WRDA 4B3MQ 3BZDB 1SYDA 2Z0SA 4KN7C 4JPBW 1HTPA 3J81i 2NVTH 2B2UA 5IP7H 4LF7Q 2A5HA 4ID6A 3HOWH 3OIQA 2MUYA 3PV0A 4XT3B 1KNEA 2PQAA 3CD6A 1O7YA 5FO9B 3FKIB 4K2LA 1C8CA 1B1ZA 1EU3A 2XN9C 4OWWB 1CI3M 4WFN3 3E0EA 1BCPF 3DM1A 1NMGA 1AH9A 4OO1G 2UXCQ 3EIVA 2I0QA 3G7LA 4UP9A 2KCCA 4TRDA 1E1OA 3U4VA 3RLNA 1JE4A 2Q2HA 4GLVB 4C3HB 1VMCA 2E75C 2I07B 5ELDA 1PFBA 3S9WA 1R4QB 4NXML 1UEBA 3NQTA 2R7ZG 2EYFA 4KD4A 3S2DH 1PH5A 4RA8A 4DN4M 1TU2B 3H6MA 2UUCL 2XGTA 1EFWA 2DUDA 1X3QA 4XXEA 4AYBB 1STEA 4RKLA 3I4MH 5ISRA 2DY7A 4YCWA 3B6YA 4LF5Q 4K5VA 1M8AA 1VMPA 2ZT9C 4R4QA 1X3GA 5EQ0A 4IFDJ 3J81c 1IHZA 1TY2A 4FO2A 5DNFA 4FP5D 1KQSA 3IL8A 2HIVA 4KN4C 4C1NK 5L37A 4CDCC 4JI8Q 2D9UA 1XX8A 4K0KQ 2KCTA 1Q8KA 2J7ZA 4RHSA 2A6ED 1X32A 2AQ1B 5F2DA 4DAYA 1F9RA 2PNHA 3F1ZA 4IJHA 3HOXB 4DV6L 2NVYH 2KA7A 3G6EA 1YNXA 2RDFA 1G6ZA 3LX0A 5C5LA 1G2SA 3FPUB 5LMNW 1TIID 3DEPA 4DV7Q 5C4HA 4A3DB 2N3SA 3G4SA 3OMCA 1QUQA 5CV4A 2DY8A 3VR2A 5JPNC 1NCVA 2EY2A 3QB3A 2JSOA 4GOPB 1P8LA 3MZ5A 2K5DA 2B2UC 1HH2P 1E7ZA 4A3DH 3OTOQ 1IW7C 2OT2A 1YNND 2QEXA 3RD4A 4A3JB 1B8AA 1V1PB 3CPWA 4JI6Q 4GZYC 4JG2A 1K0SA 1BF4A 4DF7A 1D1IA 3EA6A 3WOEA 2L11A 2F52A 4DR1Q 3T1HL 3PO3H 1RJTA 5KNDA 3NP8A 1AE2A 1X9NA 1MD2D 2PCFB 4A3JH 1C0AA 4R8IA 3K57A 1O7LA 1M90C 2K5WA 2Z6BA 2AMCB 1BBXC 4L8JA 3T1YQ 3K58A 2ASBA 4IJLA 2K28A 4OXPA 3SVMA 2EVBA 3KF6A 4X3KA 4PNYA 4DR5L 2UU9L 3I90A 1PTOB 1UE1A 3BZKA 5JEAG 4A3FB 1U4MA 1PH2A 2UUAL 3H09A 3NE5B 1AE3A 1E22A 4H7BA 5DEHA 2JN4A 2HQEA 1S3OA 2E5LL 3GTOH 3UI2A 4DR7Q 1NAPA 3K0XA 3AU7A 4Z9CB 1YZ6A 2KHIA 1VQOA 3VR4A 3HRZC 1QVGA 3A8IE 4DR3L 4A4IA 1SJED 1XMOQ 2A68C 3O13A 1N8RC 5JOBA 2QCPX 5GAEC 2DJGC 3UDGA 4ZRZA 1SYFA 1JQYD 1U4RA 4XT1B 4JV5L 1II3A 4CKEA 1UAPA 1L2FA 5HGQA 1VQKA 3HOYB 1F2YA 1IYJB 3OSOA 3L7ZC 3KBXA 2JP1A 1JWUD 1O80A 4GNXB 1GHKA 2ATWA 1TXYA 3NBHA 1CM9A 2CQOA 3QWNA 2CKZB 2VXWA 5E1FA 5IP7G 2IX1A 4FXKC 3HKZE 4JI2L 4DV3Q 1IW7D 2BDOA 1EYGA 3DWQA 4M8AA 2RHSB 3KJOA 4YHHQ 4QCLA 2XWBB 4GN4B 3URYA 1CUKA 3PUWA 4OEMB 3HP3A 3I2ZA 5AFWA 1ILQA 3DMUA 2LS01 4DR6L 1MBYA 2EXZA 3TP7A 5FLMH 5IT9E 5IWAQ 1JC7A 4NKLA 4EQOA 4ZUIA 1G2TA 1EOTA 1NSNS 4YIJA 2EIFA 3KDFB 2KEEA 1HRJA 1X3PA 1YITA 1BUVT 2O5JC 2Y0SB 1HUMA 4NXNL 1WVLA 2A74C 4BY1G 3U4ZA 4ME3A 3X3NA 3I4MG 1DCZA 1FGBD 1HR0Q 1SYBA 1B9MA 1SYCA 2JA7H 4X65L 4OO1I 2RSNA 2UXBQ 2ICIA 1M1KC 2RVLA 2BOSA 1Z7TA 4HJAA 1K28A 1ET6A 2LSSA 5ELFA 4XYOA 4WORA 3A5ZB 5J39A 3A55A 2HHHL 3I4NB 2HQLA 4XQJA 3I7FA 5D65A 2WP8J 1R4PB 4A3GH 2F0VA 4B3RQ 4X3SA 1Y1WB 2EPBA 1VQ7A 1N33Q 2VB3X 2YTXA 1E2ZA 1Q8IA 1A0IA 4OHJA 3I4OA 5IGGA 3E5SA 4DV2L 1S5BD 2L1BA 2ID0A 3TP5A 5EPKA 2ZTDA 2K5HA 3STBC 3VYRA 1EWHA 2DJFC 1I4PA 3OIPA 3GTLB 4R4IA 5CMDA 2JA5G 5IP9H 1PRTB 2F4IA 1WTRA 4YCUA 5C3WA 4IFDH 1S5FD 3K5MA 1BR9A 4AH6A 4A3DG 3PGZA 4PG3A 3VYTA 2F0NA 2LKVA 3J7AV 3HOUH 3EBEA 5E3FA 3GTLH 1W6KA 4JI3L 3SGIA 2WKCA 2QDLA 5EPLA 1Y1VB 2YU9B 2HIXA 1JOKA 2QKIC 4A3BH 1JJ2A 3S1MB 3L0OA 3PO3G 2OQ0A 1U4LA 4A3IB 1K8MA 1WCMB 4A3JG 3T56B 2YU9H 3MEHA 2K50A 5LMNL 1CHQD 2IT1A 3P75A 3A56A 3ERSX 3S1MH 3LNNA 4X66Q 2HCCA 1LT4D 4A3IH 4QUFA 3FDTA 1WCMH 4B9XA 4J15A 2NYZD 5IYDG 3F2BA 1N36L 3TP8A 2OEOA 4YCVA 3H0GH 3OWEB 5GQOA 1NJIC 1QG7A 3F2DA 3X3MA 4OX9Q 1HTLD 2VW9A 3T51B 3I91A 4JC0A 2G9HD 4JVZA 5DM73 4X3TA 3KF8B 3L2PA 5A2QL 1GUNA 4P72A 3N52A 4LFBL 5CC4A 2EZVA 3K7AB 1B4OA 3L3OC 3DHQA 4UAIA 1A3TA 4ZKCB 1JWSD 3ZYYX 2B2YA 3H3VI 2VL6A 2B2WA 3A7AB 4AQYQ 1I4HA 2NZHA 4AYBE 3RNUA 3FVQA 4RKBA 3IKJA 1PZID 1FJGL 3C1FA 3STBD 4IN3A 1PH4A 4HCEA 1HNXL 3BVGA 3D0FA 2M00A 1OXSC 4ZKBB 5FLXL 1ML0D 2K52A 1WI5A 3DM3A 2WAQG 2EJFC 5AJ3L 1ONLA 1STYA 2K01A 4QB4A 1YJNA 4QGUA 1J8IA 1JOQA 2B63B 1Q12A 4KMUC 3VA7A 2JXMB 2X6GA 1VQGA 1IXRA 1GD7A 1TY0A 1HHVA 1IBKL 3CC7A 2JJQA 3S14H 3NPPA 3FEWX 1P16A 2NN6G 2B63H 3CXCA 1GM5A 2D62A 3J80E 3CCLA 5FLMG 1TT2A 1UUPA 3BYTB 3MXNB 1H95A 1LT6D 3SE0A 5BR8L 2KHJA 1DZ1A 1IBML 2YYZA 1KRSA 1V1OA 4DA2A 3GP7A 2ALYB 3CCMA 3PF4A 3HOVB 5C3EH 2SNSA 3CC4A 1Y69U 1WFQA 2H4OA 1AW7A 1MJEA 2B39A 2F0DA 3NTHA 2UUBL 2JA7G 1Q1EA 4LF4Q 3CCJA 4DUYL 5G3LD 5CBEE 1S5DD 2JA5B 5FOBB 3R2IA 3HOVH 1Y14B 4LNQA 1QVFA 2FMCA 1K83B 1SEBD 3BU2A 4B3TL 1KLUD 3JC66 1OXUA 3NXWA 4HJ5A 1DOMA 4OO1H 2RBMA 4LF9L 3CCRA 2E2JH 2B2VA 3MFGA 2ZXPA 5C6AA 1YI2A 3S15B 2JA5H 4A3GG 2NUCA 3A8KE 4JI0L 5CV8A 1EYDA 2K5QA 1K83H 3V05A 1V8QA 2Q8IB 5ELEA 2Q2TA 1QZHA 4JOIA 5ELOA 1KRTA 3SK4A 4EGVA 2KJXA 3S15H 1KTKA 2K4KA 3VR5A 1CK1A 2AUKA 2A19A 4X64Q 1CSPA 3P20A 2B2TA 4B3SQ 3KK7A 1SR3A 4HIOA 1TQOA 1JE5A 1ICWA 5IP9G 3CMAA 3A54A 4DNRB 4IFDG 1TWAB 3DXJC 4GOPA 2XTIA 3M7GA 4FVMA 4JI4L 4G7HC 1K9MC 4LFCQ 2IHEA 1L1OB 3AEVA 2PMZB 1CZWA 4IO9A 3HOUG 2F4VL 3NQIA 5LL6S 4C2MH 1NR2A 2HD3A 2VZAA 4FF1A 2RKSA 4LFAQ 1VQ5A 2RQXA 2ZJQA 1DD2A 4A3BG 1WYDA 1K73C 2VUMH 1E3PA 2UXDL 3ND8A 5J3BA 2TMPA 2RHQB 2LXKA 3T4AC 1F9PA 1WJJA 5JJIA 1YHBA 2YV5A 4RWSC 5JVG3 2RCNA 3C1EA 3BZCA 4A3IG 4I7AA 2MHVA 4CDFC 1PHJA 4DV0L 1Q3LA 2L15A 1BQQT 2F0JA 4Q5VA 1RTOA 1YNJD 1EQQA 5LHY1 3H0GG 4JI1Q 2CWPA 4APVA 4IPGA 2C35B 3CHBD 1KDBA 4K14A 5IGFA 2NB0A 1QB5D 2KQ3A 1NNXA 3ERQA 3I70A 4BBRH 4HSVA 2E76C 2WB1E 2VNUD 5COYA 3TMEA 3I72A 2CW0D 1I3QB 3PUVA 2MPMA 4XIGS 3CQZB 1B53A 1JB7A 4CDEC 2Z9HA 5M5YH 3ZJYC 3PIP3 3VR6A 2NTTA 5JJKA 1I3QH 1TWGB 4RMFA 1HNZQ 1X6OA 2VQFQ 4LWCA 5CV6A 3CQZH 2F0FA 2AWOA 2QILA 2PZTA 3KUPA 3NBIA 5EKLA 2E74C 4ZAIA 2IJ0A 4DAPA 1V1QA 4A3EH 2QGQA 3QO2A 4OIKA 1TWGH 1F2ZA 5IOCA 2NVQH 4UP7A 2F0GA 4GOPC 5EBDA 4OWXB 4UP8A 5IYBG 2F0TA 1I4XA 1VDZA 4DAMA 3UDXA 4EVOA 3H91A 1JB3A 1D8LA 2Z4HA 2AQ3B 3PCOB 1PV4A 4MHEA 3K81C 1YHQA 1MGSA 1UWVA 3A74A 1XXGA 2G5DA 3BVMA 1PH3A 2BH8A 1VQDA 2FJ2A 2Z4IA 4F8MA 1CA5A 3ULJA 4RGNA 1ZYRD 4O0AA 2NVTB 4ME5A 1PYSB 4RG1A 1HPCA 1JORA 1PH6A 3OWFA 5C5MA 2NZOA 1Q90A 2RA4A 2GVBA 4RCNA 4FXGC 2VQEL 3KDFA 3M4OH 3MA2B 3CCEA 5LL6X 1VQFA 3D6CA 5C3EG 4LF6Q 1QE6A 2NN6I 4EQPA 4DR2Q 4P73A 4KTAA 2KECA 3ULPA 2PO4A 1XTDA 1EYAA 3FRPB 4RGMA 3CAMA 4KHZA 1PTOC 3HOVG 2BH2A 4X62L 1ASYA 3S2DB 2XRQD 1TVXA 3K5NA 4JYAQ 3DUZA 5D3IB 2K5NA 1B7YB 4BY1B 1X55A 2E2IH 3PUZA 3GTJB
chains in the Genus database with same CATH topology
3I4MB 3HS0C 5IGCA 3Q22A 2RSOA 2IWHA 1F2MA 1G291 1D6EC 2LMCB 4PMBA 2NTSA 3JAME 5NUCA 3VYUA 1GUSA 1FNWA 4V0BA 1PTOF 1FNUA 2ENBA 2NVYB 3BDLA 2KHSA 5D14A 3V2TA 1T5EA 1Y8NB 4XYQA 2F0OA 4DU9A 1PXUA 2A69C 2IX3A 5JJZA 1BCPD 1EQTA 4H13C 4K8JA 3S17B 5FO7B 1B44D 1LTTD 2SOBA 1OXVA 1GHJA 2KCNA 5IGDA 2GA4B 4TQUS 1UEAB 2Q8TA 5C3XA 2CQAA 1FYCA 4IFDI 4DFAA 5BN5A 5C4ZA 2HDLA 1OXXK 1S5ED 1SE2A 3PIO3 4I65A 3T13A 1KLGD 3PO3B 4JBWA 1PTOD 5IGEA 2X69A 1PZKD 3QG1A 1A2TA 3CKIB 1H9SB 5DM63 2PNRC 1ZKOA 4C1NI 1GUWA 5E4XA 2BE5C 3KF8A 5BN3A 1EY6A 2N55A 1PDQA 3C3LA 5CORA 4KJNA 1KDCA 3Q24A 5KIXA 3P7JA 4K2KA 3EVQA 5EKIA 4CJ1B 2JA8B 3GTOB 5DAUA 2F03A 3W3AA 4J1MA 1PRTC 2K05A 3M3YB 4H44C 1FNVA 3C2PA 4DK0A 2J4XA 5CGKA 4R8NA 3KBGA 1L0YB 2WAQB 2CVRA 1A3VA 3MXNA 4RAUC 3MXPA 1NUCA 4K5XA 4NDXA 4LK1C 3DWAA 3CRKC 2IPKD 5CYUA 2WKDA 2KEDA 3K0YA 1G8ZD 1A6XA 3SXHA 4PQXA 3SK6A 1I6HB 2PW5A 3BYYB 2NN6H 5KEEA 2WACA 3RUZA 5I2YA 2NBFA 3WOFA 1HFNA 2BCOA 4MIUA 3MTSA 2K1BA 4ZK9B 3I73A 1TWHB 5EKKA 5J1ZA 2JA7B 3NHHA 4KD3A 4IUPA 5I2XA 1ENCA 1FD7D 1EY8A 1SNDA 4K5WA 2V4DA 5E4WC 4HTHA 1TWCB 4DK1A 2D2CC 4A3GB 2IL8A 3FMCA 3Q0AA 5EJWA 1V43A 1PZJD 2A68D 2JEAI 5CV7A 3LWUA 2O5IC 1F2LA 4Q0FA 3M4YA 3OW7A 3J81E 2Z1CA 2HCIA 3HOUB 4DXFA 4KJOA 3U9OA 1SDFA 1SNQA 2EYLA 4A3BB 4RCOA 1GUGA 1ENAA 2LFNA 1EY7A 3TDQA 5ELCA 4KKSA 3M85A 2F0LA 1TWFB 4JK1C 4S3SA 3H0GB 4KK7A 1QNKA 3D31A 3A7LA 1HA6A 2QDBA 3K59A 3BG3A 3PMFA 1SSOA 2MGSA 4PMWA 1ET9A 4WJWA 3ONAB 4PMCA 5KYIA 4TKOB 5KRUA 3VA5A 1D5XC 1VCIA 1AZQA 2EY5A 1KDAA 2OF1A 1I4RA 2K7VA 4HCSA 5HGTA 4FF3A 1TKWB 1SE3A 1SE4A 4QMGA 1RDPD 4O1NA 2JA6B 5M9OA 3AB9A 4G57A 1BOSA 1EEID 5C4JB 3OPOA 3S14B 1BO0A 1GJXA 1S4ZA 3F2UA 3GTGB 1GXDC 3VR3A 4PV1C 5C3EB 3SEBA 1RKNA 1DYQA 2RDGA 2F0SA 3S1NB 4N9PA 3H3VC 1JWMD 3BDCA 1EU4A 3DEOA 1T5XD 3EJIA 3MWYW 1WTWA 2E2JB 1I6VC 4KKTA 2VB2X 2A73B 4NMZA 2D5DA 1Q1BA 1WD0A 1MSGA 2SNMA 1ZXTA 1CHPD 2DN8A 4IURA 2K6AA 1TS3A 4LAAA 2DNCA 2OXPA 4Y7NB 1DONA 5EBCA 1EWCA 2L12A 4IUNA 1EIHA 3OOCA 1KAAA 3CRLC 1IKMA 3MAQA 2FINB 1GUTA 1C48A 4C3IG 2L5TA 1XYIA 4C2MB 3CU7A 1H9JA 1STHA 3AMUA 2VUMB 2Z8LA 3I4LA 1EY5A 1Y8OB 4BA1I 5C0XJ 1V1PA 4ILWA 1RTNA 5IT9L 4C3JB 5KYLA 2E2DC 3HKZB 1LV9A 1IL8A 4J6HA 1SNPA 1B9NA 1SMYC 1SAPA 3NWTA 2XIWA 1PMRA 4KY7A 4K6DA 2XNAC 4BBRB 4B9WA 3HG9A 4QF4A 1MI2A 3S1RB 2BA1A 2R61A 1PLFA 1LTRD 1WTXA 5M5YB 4N9TA 2EJMA 1F9SA 2FMMA 3PO2B 3K5LA 2WV6D 3KLSA 1HUNA 1LT3D 4A3EB 2QEJC 5D3DA 1J9OA 4ABNA 3D6WA 2NVQB 3NWSA 1O7ZA 4QUCA 1QJOA 3E6ZX 5CV5A 4F7XA 3E0JA 2CHBD 1JOOA 4FYDA 4DGZA 1CQFA 2JEBI 4LMQD 4EQNA 1JR0D 2F0HA 3RLFA 5EPJA 3M4OB 4F87A 1HFGA 1DOKA 3RZDB 5FO8B 1G91A 2L0CA 2PZUA 1SYGA 4CJ0B 1EY4A 1SBBB 2A6EC 3V96A 3D4DA 1LT5D 5I4DA 5IODA 3R2TA 4RFBA 2E2IB 1TR5A 4IUUA 4BA2I 4BBSB 2SDFA 1CT1D 2SEBD 2C9OA 2MP1A 4HSPA 1GOZA 3TZDA 2I46A 1JCKB 1EQVA 2AUJD 1S5CD 5M3FB 1AZPA 1YNNC 3EROA 5A35A 3GTPB 2FHTA 2EDGA 3GV3A 1U4PA 3NTIA 3A8JE 3BS1A 1DOLA 3HOZB 1Z6HA 2A6HC 2EE1A 4NW2A 2X6LA 3PUYA 3Q6SA 4G7ZC 1RD9D 4KY6A 1E2VA 1LO5D 3J80L 2F1MA 3MXGA 1HXYD 4XDXA 4RH6A 5K5PA 2J0TD 2F3VA 4KHVA 5A2QE 4C3JG 1SJHD 2JYOA 2R3ZA 2WINB 1ENFA 1DJRD 3J7YW 5I9PA 1I4GA 1H9MA 2N88A 2KOLA 2EJGC 1IYVA 5J22A 2ZXOA 5FLXE 5IIFA 1A2UA 5C0XH 1HQRD 2H1EA 2MJ8A 4KV6A 5K36H 3SR1A 5EGTA 1F77A 1STBA 3FPPA 4ZYSA 1WTOA 2EY1A 3EQLC 5HURA 1BCPB 3NUCA 3GTQB 3K5OA 3HEJA 4BY7B 2PYKA 4RGOS 4C56C 3ITPA 1Z47A 1SNMA 2A6HD 3GTKB 1CTMA 4IUTA 2HUGA 4IUQA 1WD1A 2A69D 1E2WA 5I6WA 5IGBA 1UNSA 2B8FA 3MC0B 1STGA 3R8BA 4IZ8A 2O4XA 3SK8A 2K32A 1PTOH 2O2LD 5BN4A 4L63B 4RHRA 5M5WB 2XRSD 3WDNA 2EYPA 4HN7A 1LTID 5C4XB 3QOLA 1PRTF 2WIIB 4IUVA 1BXTA 3R3OA 1D1KA 3D4RA 1WTQA 1KABA 2L55A 4FF4A 3T16A 1HA5A 2BE5D 1XTCD 5JVH3 1CFMA 4CBVA 4FF2A 1IYUA 4OIJA 3NSWA 4E6IA 4HMIA 2F0IA 3GO5A 3OHXC 1QNUA 1EIGA 2WB1B 4KI0A 4MN3A 2L4NA 4X3UA 1O78A 1I50B 1HCZA 2F0WA 1A3UA 1PRTD 2EYJA 4IALA 2K04A 2EYMA 3VYSA 4C3HG 4V190 3BVZA 4C3IB 4K6LA 1SYEA 4BWGB 4M1UB 1D2BA 2PPBC 3SHLA 1SFOB 4O42A 2F3WA 5KGUA 5C44B 3L9AX 4P2CB 3K6OA 3TP6A 1I4QA 3SDZA 4CGYB 4FXDA 1RHPA 3D8GA 4TSSA 3GTMB 1FR3A 5M3MB 1TS2A 3QIAA 4H0LC 1KNAA 1TS5A 4K8IA 3TZUA 4DAVA 2LY7A 2F0MA 3MFYA 3U9SA 5C0XG 1H9RA 2AQ2B 1BNZA 2Q8RE 5K36G 3TSSA 2DNEA 4ULLA 4HR7B 4CJ2C 2F0QA 1AFPA 1B3AA 1EEFD 2PW7A 2K33A 3JAML 1ESFA 3SK5A 1PFMA 1CA6A 5TSSA 3W2DA 4A93B 1STAA 5JPMC 2PZWA 3PUXA 3BDOA 4OL7A 1PYWD 1SNCA 1RCVD 2M2LA 4LJZC 2E2HB 3C46A 1ZEQX 3IFDA 5JEAJ 2C5CA 1C4QA 1B2TA 1EZ6A 1ESRA 1IKLA 1QOHA 1TS4A 1EY9A 2XWJB 4QIWB 4ZUJA 2BA0A 2K03A 3S16B 3NK9A 3IAYA 2XSCA 4DNTB 3H94A 4CKCA 2EOTA 1AN8A 4ZQ3A 4KKUA 3HZXA 1Y8PB 3G6JB 4BS9A 3LWEA 1EL0A 4FNFA 2AWNA 4U673 1B50A 5CR3A 2IW3A 5G3LF 3IFTA 2M9VA 3Q23A 2R93B 3S1QB 3NTKA 1VF7A 1EY0A 2XVSA 5KNCA 4RGTA 2KVMA 2L9HA 3MHBA 1A15A 3HGBA 4ODGA 1AEXA 1D5MC 1LACA 4I7ZC 1M4VA 1U9RA 2F0UA 4DXGA 1JICA 1LTGD 1AP0A 1LLRD 5JAVA 1SNOA 1L0XB 1LABA 2EYHA 3MXUA 1OXTA 3D4WA 2RDHA 1YNJC 1QCBD 3GV6A 1SXTA 3EFXD 3OMGA 5T1GA 3T53B 2R7ZB 1MSHA 4J8QA 5FK9C 4G7OC 1LTAD 2NVXB 2EYOA 3N6RA 1WTVA 4G4KA 2G9DA 2CW0C 5KNBA 2KUMA 1WTPA 2B2YC 1LTBD 2B2WC 2F0KA 3QOJA 3ND9A 2IX0A 4IQZA 1RF2D 3KLSX 4HEDA 1H9SA 4HAEA 1EZ8A 1E0BA 4XTCS 2ICEC 2PQEA 1CQVA 2EY6A 4L6TB 4B08A 1F9QA 1RODA 5T1IA 2R92B 2NZ1D 2JE6I 1GUOA 5CBAE 1DXMA 3KLRA 4CKBA 4U68A 5C0XI 1ZYRC 3D3RA 4XQNA 2B8GA 5CV9A 5I9OA 4UDUC 1EFID 3RMHA 2FFKB 3GQBA 1QWYA 3TBIB 5I6YA 1NR4A 4NP5A 1R9TB 2F0EA 3J7AF 4R9WA 1HQMC 1H9KA 3J81L 3GD7A 4XQQA 1VF5C 1W6JA 1LTSD 3I3CA 4OGQC 2B2VC 2BDNA 1EYCA 1ILPA 2R6GA 5FKAC 5M5XB 3RZOB 3DWPA 1D5ZC 1STNA 1QILA 2HDMA 5JEAH 4A3MB 1BDOA 2B2TC 1CZGA 2NWGA 4KY5A 4A3KB 3P1HA 3I8ZA 1PFNA 2QF7A 1SMYD 2F0PA 1XWEA 1OO9B 3TN2A 4CHTB 1DM0B 2ZXRA 1BCPC 3MVVA 2TSSA 4HMJA 3R93A 4F88A 4ZLTF 3M7NA 3S2HB 5ELBA 3QJYA 3HOWB 1K8OA 4WRDA 3BZDB 1SYDA 4KN7C 1HTPA 2B2UA 2A5HA 4ID6A 3OIQA 2MUYA 3PV0A 4XT3B 1KNEA 1O7YA 5FO9B 3FKIB 4K2LA 1C8CA 1B1ZA 1EU3A 2XN9C 1CI3M 4WFN3 1BCPF 3DM1A 4OO1G 3G7LA 2KCCA 4TRDA 4C3HB 1JE4A 1VMCA 2E75C 2I07B 5ELDA 1PFBA 3S9WA 1R4QB 3NQTA 2EYFA 4KD4A 4RA8A 4DN4M 1TU2B 3H6MA 1X3QA 4XXEA 4AYBB 1STEA 4RKLA 5ISRA 2DY7A 4K5VA 1M8AA 1VMPA 2ZT9C 5EQ0A 4IFDJ 1IHZA 1TY2A 4FO2A 5DNFA 4FP5D 3IL8A 4KN4C 4C1NK 2D9UA 1XX8A 2J7ZA 4RHSA 2A6ED 1X32A 2AQ1B 5F2DA 4DAYA 1F9RA 3HOXB 2KA7A 2RDFA 1G6ZA 3LX0A 5C5LA 1G2SA 3FPUB 1TIID 3DEPA 5C4HA 4A3DB 3OMCA 5CV4A 2DY8A 3VR2A 5JPNC 1NCVA 2EY2A 3QB3A 2JSOA 3MZ5A 2K5DA 2B2UC 1IW7C 2OT2A 1YNND 3RD4A 4A3JB 1V1PB 4GZYC 1BF4A 4DF7A 1D1IA 3EA6A 3WOEA 2L11A 1RJTA 5KNDA 3NP8A 1MD2D 2PCFB 4R8IA 3K57A 1O7LA 2K5WA 1BBXC 4L8JA 3K58A 2K28A 3SVMA 2EVBA 4X3KA 4PNYA 3I90A 1PTOB 5JEAG 4A3FB 1U4MA 3H09A 3NE5B 4H7BA 5DEHA 2HQEA 3UI2A 1NAPA 4Z9CB 3AU7A 3VR4A 3HRZC 3A8IE 1SJED 2A68C 3O13A 5JOBA 2QCPX 4ZRZA 1SYFA 1JQYD 1U4RA 4XT1B 1II3A 4CKEA 1UAPA 3HOYB 1F2YA 3OSOA 3KBXA 3L7ZC 2JP1A 1JWUD 1O80A 1GHKA 3NBHA 1CM9A 3QWNA 5E1FA 2VXWA 2IX1A 4FXKC 1IW7D 2BDOA 3DWQA 4M8AA 4QCLA 2XWBB 3URYA 3PUWA 3HP3A 5AFWA 1ILQA 3DMUA 2LS01 1MBYA 2EXZA 3TP7A 5IT9E 1JC7A 4NKLA 4EQOA 4ZUIA 1G2TA 1EOTA 1NSNS 4YIJA 2KEEA 1HRJA 1X3PA 2O5JC 1BUVT 2Y0SB 1HUMA 1WVLA 2A74C 3X3NA 1DCZA 1FGBD 1SYBA 1B9MA 1SYCA 4OO1I 2RSNA 2ICIA 2RVLA 2BOSA 1Z7TA 1ET6A 5ELFA 4XYOA 4WORA 5J39A 3A55A 3I4NB 4XQJA 5D65A 2WP8J 1R4PB 2F0VA 4X3SA 1Y1WB 2EPBA 2VB3X 1E2ZA 1Q8IA 4OHJA 5IGGA 3E5SA 1S5BD 2L1BA 2ID0A 3TP5A 5EPKA 3VYRA 1EWHA 1I4PA 3OIPA 3GTLB 5CMDA 1PRTB 2F4IA 1WTRA 5C3WA 4IFDH 1S5FD 3K5MA 1BR9A 3VYTA 2F0NA 2LKVA 3J7AV 5E3FA 1W6KA 2WKCA 5EPLA 1Y1VB 2YU9B 1JOKA 2QKIC 3S1MB 4A3IB 1U4LA 1K8MA 1WCMB 3T56B 3MEHA 1CHQD 2IT1A 3P75A 3A56A 3LNNA 2HCCA 1LT4D 4QUFA 3FDTA 4B9XA 2NYZD 3TP8A 2OEOA 3OWEB 1QG7A 3X3MA 1HTLD 3T51B 3I91A 2G9HD 5DM73 4X3TA 5A2QL 1GUNA 3N52A 5CC4A 2EZVA 3K7AB 1B4OA 3L3OC 3DHQA 4UAIA 1A3TA 4ZKCB 1JWSD 3ZYYX 2B2YA 2B2WA 3A7AB 1I4HA 3FVQA 4RKBA 3IKJA 1PZID 3C1FA 4IN3A 4HCEA 3BVGA 2M00A 1OXSC 4ZKBB 5FLXL 1ML0D 2EJFC 1ONLA 1STYA 2K01A 4QB4A 1J8IA 1JOQA 2B63B 1Q12A 4KMUC 3VA7A 2JXMB 2X6GA 1TY0A 1HHVA 3NPPA 3FEWX 2NN6G 2D62A 3J80E 1TT2A 1UUPA 3BYTB 1LT6D 3SE0A 1DZ1A 2YYZA 1V1OA 4DA2A 3GP7A 3HOVB 2SNSA 1Y69U 2H4OA 1AW7A 2B39A 2F0DA 3NTHA 1Q1EA 5G3LD 5CBEE 1S5DD 2JA5B 5FOBB 3R2IA 2FMCA 1K83B 1SEBD 1KLUD 1OXUA 3NXWA 1DOMA 4OO1H 2RBMA 2B2VA 3MFGA 2ZXPA 5C6AA 3S15B 2NUCA 3A8KE 5CV8A 1EYDA 2K5QA 3V05A 1V8QA 2Q8IB 5ELEA 3SK4A 4EGVA 2KJXA 1KTKA 3VR5A 1CK1A 2AUKA 3P20A 2B2TA 3KK7A 1TQOA 1ICWA 3A54A 4DNRB 4IFDG 1TWAB 3DXJC 3M7GA 4FVMA 4G7HC 2PMZB 1CZWA 3NQIA 5LL6S 1NR2A 4FF1A 2RKSA 2RQXA 1DD2A 3ND8A 2TMPA 3T4AC 1F9PA 4RWSC 5JVG3 3C1EA 2MHVA 1Q3LA 1BQQT 2F0JA 4Q5VA 1RTOA 1YNJD 5LHY1 3CHBD 1KDBA 4K14A 5IGFA 2NB0A 1QB5D 2KQ3A 3ERQA 3I70A 4HSVA 2E76C 2VNUD 5COYA 3TMEA 3I72A 2CW0D 1I3QB 3PUVA 2MPMA 4XIGS 3CQZB 1B53A 3PIP3 3VR6A 2NTTA 1TWGB 5CV6A 2F0FA 2AWOA 2QILA 2PZTA 3KUPA 3NBIA 5EKLA 2E74C 4ZAIA 2IJ0A 4DAPA 3QO2A 4OIKA 1F2ZA 5IOCA 2F0GA 5EBDA 2F0TA 1I4XA 1VDZA 4EVOA 1JB3A 3H91A 2Z4HA 2AQ3B 4MHEA 1MGSA 1XXGA 3BVMA 2FJ2A 2Z4IA 4F8MA 1CA5A 4RGNA 1ZYRD 2NVTB 4ME5A 1HPCA 1JORA 3OWFA 5C5MA 1Q90A 2RA4A 4RCNA 4FXGC 3MA2B 5LL6X 3D6CA 1QE6A 2NN6I 4EQPA 4KTAA 2KECA 2PO4A 1EYAA 3FRPB 4RGMA 4KHZA 1PTOC 3S2DB 2XRQD 1TVXA 3K5NA 3DUZA 5D3IB 4BY1B 3PUZA 3GTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1P A;  1PZJ D;  5FK9 C;  1LT6 D;  1LTA D;  4RHS A;  1JQY D;  3DWP A;  1D5Z C;  1LT5 D;  1HQR D;  5I4D A;  2AQ1 B;  3R2T A;  3CHB D;  1D6E C;  1QIL A;  1V1O A;  1JWU D;  3GP7 A;  4RFB A;  1F77 A;  1PRT C;  2NTS A;  4ZYS A;  1BCP B;  1AW7 A;  1PRT D;  1FNV A;  1LTB D;  1FNW A;  1TS4 A;  4DXF A;  1CT1 D;  2J4X A;  1PTO F;  2SEB D;  1FNU A;  3DWQ A;  1S5D D;  1CHQ D;  3R2I A;  2XNA C;  4RGO S;  1GOZ A;  4C56 C;  1SEB D;  1L0Y B;  3URY A;  1KLU D;  1LT4 D;  1JCK B;  1AN8 A;  4RCO A;  1RF2 D;  3BVZ A;  3KLS X;  2NTT A;  1BCP C;  4K6L A;  3MFG A;  3SEB A;  3DWA A;  1S5C D;  1DYQ A;  2RDG A;  2R61 A;  2TSS A;  4BWG B;  2QIL A;  1CQV A;  1BCP D;  1LTR D;  1S5F D;  2IPK D;  1JWM D;  4L6T B;  5ELB A;  3V05 A;  3OWE B;  1EU4 A;  2IJ0 A;  1B44 D;  5ELE A;  1G8Z D;  1LTT D;  5ELC A;  1T5X D;  1HTL D;  1V1P B;  3BZD B;  1UNS A;  2G9H D;  3MC0 B;  1KTK A;  1CK1 A;  1I4Q A;  3EA6 A;  3R8B A;  1I4X A;  3BYY B;  1FGB D;  4TSS A;  2WV6 D;  1LT3 D;  1MD2 D;  2AQ3 B;  2QEJ C;  1TS2 A;  2ICI A;  5D3D A;  1CHP D;  1PTO H;  1JWS D;  1S5E D;  1XXG A;  2O2L D;  1TS3 A;  1SE2 A;  3BVM A;  4L63 B;  1ET6 A;  1B1Z A;  1EU3 A;  4RGT A;  4RHR A;  1TS5 A;  1RD9 D;  2XN9 C;  1I4H A;  5ELF A;  4RGN A;  2XRS D;  4UDU C;  1KLG D;  1LO5 D;  1EFI D;  1BCP F;  1PTO D;  1PZI D;  1EWC A;  1D5M C;  1ET9 A;  1LTI D;  1PZK D;  2AQ2 B;  3BVG A;  2CHB D;  1M4V A;  1PRT F;  1PTO B;  1BXT A;  1HXY D;  4DXG A;  5ELD A;  1LTG D;  1FD7 D;  4RH6 A;  3TSS A;  4OHJ A;  1D5X C;  1LLR D;  1EEF D;  1S5B D;  1HA5 A;  1SJH D;  1JR0 D;  1I4R A;  1STE A;  1TY0 A;  1ENF A;  1ESF A;  1XTC D;  4RGM A;  1PTO C;  1DJR D;  1SE3 A;  1L0X B;  1LTS D;  4Z9C B;  5TSS A;  1SE4 A;  2RDH A;  1I4P A;  3W2D A;  2Z8L A;  1I4G A;  2XRQ D;  1RDP D;  1TY2 A;  4O1N A;  1SJE D;  1SXT A;  5D3I B;  1PRT B;  3EFX D;  3O13 A;  1UUP A;  1SBB B;  5FKA C;  3BYT B;  1PYW D;  1EEI D;  1RCV D; 
#chains in the Genus database with same CATH topology
 3I4M B;  3HS0 C;  4GS3 A;  5IGC A;  3Q22 A;  2RSO A;  1FGU A;  1F2M A;  1G29 1;  1D6E C;  2LMC B;  2IWH A;  4DNI A;  4BY1 H;  1W3S A;  1CKN A;  4PMB A;  3GTJ H;  4DV5 L;  2NTS A;  3JAM E;  3G71 A;  5NUC A;  3T1H Q;  1LTL A;  3VYU A;  4KHP Q;  1GUS A;  4ALP A;  4JI5 L;  1FNW A;  4V0B A;  1PTO F;  4JI7 L;  1FNU A;  2ENB A;  4P74 A;  3GTP H;  4GNX C;  2NVY B;  3BDL A;  2KHS A;  4QIW E;  5D14 A;  3V2T A;  1T5E A;  1HZA A;  1Y8N B;  1YJW A;  4XYQ A;  1EUJ A;  1IBL Q;  2F0O A;  4DU9 A;  1PXU A;  2A69 C;  2IX3 A;  5JJZ A;  1BCP D;  1EQT A;  4H13 C;  4K8J A;  3S17 B;  5FO7 B;  3HFZ B;  1B44 D;  1LTT D;  2SOB A;  4GLA C;  1OXV A;  1GHJ A;  2KCN A;  2VUM G;  5IGD A;  2GA4 B;  1N34 Q;  4TQU S;  2UUA Q;  5DLQ E;  1Q82 C;  1UEA B;  4DR4 Q;  2Q8T A;  5C3X A;  2CQA A;  1X56 A;  3S17 H;  1FYC A;  4IFD I;  4DFA A;  4MTN A;  4B3M L;  4PZ8 A;  5BN5 A;  3TQY A;  5C4Z A;  4AIM A;  2HDL A;  1OXX K;  2K14 A;  1HR0 W;  4WJ4 A;  1S5E D;  4LF7 L;  1SE2 A;  5IE8 A;  3HKZ G;  4PZ7 A;  3PIO 3;  4I65 A;  3T13 A;  2R7D A;  1KLG D;  3M4P A;  3PO3 B;  4JBW A;  1PTO D;  5IGE A;  2JQO A;  2X69 A;  1PZK D;  3QG1 A;  1A2T A;  4QY7 A;  3CKI B;  3NEM A;  3VDY A;  1H9S B;  4BBR G;  5DM6 3;  2PNR C;  3WWV A;  3CF5 A;  4LW1 A;  2UXC L;  1ZKO A;  4C1N I;  1GUW A;  4P75 A;  5E4X A;  2BE5 C;  3KF8 A;  5BN3 A;  1EY6 A;  1PVO A;  2N55 A;  1PDQ A;  1NY4 A;  3C3L A;  5COR A;  4ZCK A;  4KJN A;  1KDC A;  4DKA C;  5KIX A;  3Q24 A;  5IYD H;  3P7J A;  4K2K A;  3PO2 G;  3EVQ A;  1ASZ A;  4LF5 L;  5EKI A;  2CH4 A;  4CJ1 B;  3GTQ H;  2JA8 B;  3GTO B;  1PA6 A;  3J80 i;  3K8A A;  4A3E G;  1XNQ L;  5DAU A;  4JI8 L;  2F03 A;  3W3A A;  4J1M A;  1PRT C;  2JA8 H;  2K05 A;  3M3Y B;  4H44 C;  3GTK H;  1FNV A;  3C2P A;  4QQB X;  4DK0 A;  2J4X A;  2MFI A;  4JCV E;  5CGK A;  4R8N A;  3KBG A;  1L0Y B;  2WAQ B;  4QL5 A;  3M3Y H;  2CVR A;  3MXN A;  1A3V A;  4DV7 L;  4RAU C;  3MXP A;  1NUC A;  4K5X A;  4NDX A;  4LK1 C;  3DWA A;  3U50 C;  3CRK C;  2IPK D;  5CYU A;  2WKD A;  2KED A;  1NMF A;  3K0Y A;  1G8Z D;  1VQB A;  1A6X A;  3SXH A;  4PQX A;  2E8G A;  3SK6 A;  5M5W H;  1LUZ A;  1CKM A;  1A63 A;  1I6H B;  3J80 c;  2PW5 A;  3BYY B;  4JI6 L;  2NN6 H;  5KEE A;  2WAC A;  4R4O A;  3RUZ A;  5I2Y A;  4IOC A;  2NBF A;  3WOF A;  1HFN A;  2BCO A;  3LGJ A;  4DR1 L;  1I6H H;  4L5R C;  4MIU A;  3CCQ A;  3MTS A;  2K1B A;  4ZK9 B;  3I73 A;  4GKK Q;  1TWH B;  5EKK A;  1XJV A;  5J1Z A;  4BBS G;  2JA7 B;  3FP9 A;  4R1J A;  2ES2 A;  3NHH A;  4KD3 A;  4HIM A;  1SE8 A;  4IUP A;  1B70 B;  5I2X A;  1ENC A;  1FD7 D;  1TWH H;  1EY8 A;  1SND A;  4K5W A;  2V4D A;  5E4W C;  5LMU Q;  4HTH A;  1TWC B;  4DK1 A;  5M3F G;  2D2C C;  4IPC A;  4OWT B;  4A3G B;  2QA4 A;  5FJ8 H;  2GVA A;  2IL8 A;  1TWC H;  1XMQ Q;  3FMC A;  3EN2 A;  3Q0A A;  1I50 H;  4DR7 L;  5EJW A;  2PQA B;  1V43 A;  3UE1 A;  1KL9 A;  3CCV A;  1PZJ D;  2A68 D;  4GN3 B;  1J5E L;  2JEA I;  5CV7 A;  1XMO L;  3LWU A;  2O5I C;  3F2C A;  2MNA A;  1F2L A;  4Q0F A;  3M4Y A;  1HZC A;  3KFU A;  3OW7 A;  4LUZ A;  3J81 E;  2D0O A;  2Z1C A;  4LFB Q;  3CME A;  2HCI A;  4C3I H;  3TRE A;  3HOU B;  1K8G A;  4DXF A;  3K80 C;  4KJO A;  3CP0 A;  3U9O A;  1PH9 A;  1SDF A;  3OW2 A;  1SFO H;  1XNR Q;  5C44 H;  1SNQ A;  2EYL A;  4DV3 L;  4A3B B;  1HNW Q;  2EXD A;  4DV1 Q;  4RCO A;  1GUG A;  4GKJ L;  2N78 A;  1ENA A;  1KXL A;  4YHH L;  2OWO A;  1YVC A;  2LFN A;  1EY7 A;  2OCE A;  3TDQ A;  5ELC A;  4KKS A;  5IWA L;  1XPO A;  3M85 A;  3AQQ A;  2F0L A;  1TWF B;  4DAY B;  4JK1 C;  4S3S A;  3H0G B;  4KK7 A;  1QNK A;  1N32 Q;  2JK8 A;  2OTJ A;  3D31 A;  3A7L A;  1HA6 A;  1O7I A;  4HJ8 A;  1TWF H;  2ZM6 Q;  2QDB A;  3K59 A;  3BG3 A;  3PMF A;  1SSO A;  2MGS A;  2I5L X;  4PMW A;  2UXB L;  1ET9 A;  3AFP A;  3NEN A;  5BR8 Q;  1Z9F A;  2ZTE A;  1QUQ B;  4DK3 C;  4WJW A;  3ONA B;  4PMC A;  3J81 j;  5KYI A;  4TKO B;  5KRU A;  4L5S A;  3VA5 A;  2VY3 A;  2JA8 G;  1D5X C;  1VCI A;  2F3I A;  1L1O C;  1OTC A;  1AZQ A;  1VQ6 A;  2EY5 A;  1KDA A;  2OF1 A;  1I4R A;  2K7V A;  4TVA B;  1N33 L;  1D7Q A;  1B3Q A;  4HCS A;  5HGT A;  1K3R A;  4FF3 A;  3CCS A;  1TKW B;  1SE3 A;  1X3E A;  4JBK A;  3TS2 A;  1SE4 A;  1YHA A;  4DUZ Q;  4QMG A;  1RDP D;  4O1N A;  2JA6 B;  5M9O A;  3AB9 A;  4G57 A;  1BOS A;  1EEI D;  1Q46 A;  5C4J B;  4BXX H;  3OPO A;  3S14 B;  1BO0 A;  1GJX A;  3M9B A;  1UE5 A;  2JA6 H;  3J7A 5;  2AHO B;  3S16 H;  2VS1 A;  5IYB H;  4HIK A;  2FXQ A;  5C4J H;  1S4Z A;  2CWA A;  2CCZ A;  1XPU A;  1PH8 A;  3F2U A;  3GTG B;  3PIP A;  1GXD C;  4P71 A;  3JAM i;  3VR3 A;  4PV1 C;  5C3E B;  3GTG H;  3RR5 A;  3SEB A;  1RKN A;  1DYQ A;  2RDG A;  2F0S A;  3S1N B;  3GDE A;  4N9P A;  3H3V C;  1CKO A;  1JWM D;  3BDC A;  1EU4 A;  3DEO A;  1VQJ A;  1I94 Q;  1IZ6 A;  1T5X D;  3EJI A;  3MWY W;  1ICF B;  3S1Q H;  1VQ9 A;  1WTW A;  2E2J B;  3TS0 A;  3S1N H;  1JJC B;  1I6V C;  4KKT A;  1SMX A;  2VB2 X;  2A73 B;  4NMZ A;  2D5D A;  1Q1B A;  5FJ8 G;  1WD0 A;  1MSG A;  2SNM A;  1VQL A;  3S24 A;  1ZXT A;  4EQ5 A;  3NBH B;  1CHP D;  2DN8 A;  2WB1 G;  2K6A A;  4IUR A;  1TS3 A;  4LAA A;  1YBY A;  4MZ9 A;  2DNC A;  2OXP A;  4Y7N B;  1DON A;  3PQI A;  5EBC A;  1J6Q A;  1C7Y A;  1EWC A;  3JAM c;  4AQY L;  2L12 A;  4IUN A;  1EIH A;  1VQM A;  3OOC A;  1KAA A;  3CRL C;  1IKM A;  2DGY A;  3MAQ A;  4Y7N H;  2FIN B;  1GUT A;  1C48 A;  4C3I G;  2L5T A;  4LF8 Q;  1XYI A;  4YY3 Q;  4C2M B;  3CU7 A;  1H9J A;  1STH A;  3AMU A;  5C44 G;  1JMC A;  2VUM B;  2Z8L A;  1DGS A;  3I4L A;  2K5V A;  1EY5 A;  1Y8O B;  4BA1 I;  5C0X J;  1PFS A;  1V1P A;  2MO1 A;  4ILW A;  1RTN A;  4NB3 A;  5IT9 L;  4C3J B;  4R4C A;  4YWK A;  5KYL A;  1HZB A;  1FL0 A;  2Q2I A;  4DV4 Q;  4YWM A;  2E2D C;  3HKZ B;  1LV9 A;  1IL8 A;  4J6H A;  4FDB A;  1SNP A;  2LXJ A;  1B9N A;  4C3J H;  1SMY C;  1SAP A;  3DLL A;  2B3G A;  3NWT A;  2XIW A;  1PMR A;  4KY7 A;  4K6D A;  2XNA C;  4BBR B;  1S72 A;  1X3F A;  4B9W A;  3HG9 A;  1A8V A;  4LF4 L;  2R92 H;  4QF4 A;  1MI2 A;  1VQE A;  3S1R B;  2BA1 A;  2WFW A;  2R61 A;  4UPA A;  1PLF A;  1LTR D;  3TEH B;  1JJG A;  2B29 A;  1WTX A;  5M5Y B;  1BBU A;  3W5O A;  3MEF A;  4N9T A;  2EJM A;  3S1R H;  1F9S A;  2FMM A;  4POG A;  3PO2 B;  3K5L A;  2Y0S E;  4GN5 A;  4UHV A;  2RCF A;  2WV6 D;  3KLS A;  1HUN A;  1LT3 D;  4X62 Q;  4A3E B;  2QEJ C;  5D3D A;  1J9O A;  3FHW A;  4ABN A;  4X64 L;  3D6W A;  2NVQ B;  3NWS A;  3PO2 H;  4UY8 C;  1O7Z A;  4QUC A;  4BXX G;  4B3S L;  1V9P A;  1QJO A;  3A0J A;  3E6Z X;  4A76 A;  4NXM Q;  3H15 A;  1U0L A;  4GNX A;  5CV5 A;  4F7X A;  3E0J A;  2CHB D;  2JA6 G;  4LFC L;  1JOO A;  2UUC Q;  5IY0 A;  2IY5 B;  4FYD A;  1K0R A;  3W1B A;  4DGZ A;  1CQF A;  2JEB I;  4LMQ D;  4LFA L;  4EQN A;  1JR0 D;  1E1T A;  1KD1 C;  3M4Q A;  2F0H A;  3RLF A;  1IL2 A;  5EPJ A;  3M4O B;  1VQP A;  4F87 A;  1HFG A;  1DOK A;  1E24 A;  3RZD B;  5FO8 B;  1G91 A;  1VQA A;  2L0C A;  2PZU A;  1WOC A;  1SYG A;  4CJ0 B;  1EY4 A;  4A3M H;  1SBB B;  2A6E C;  1K3B C;  2IHF A;  4DV6 Q;  4A3K H;  3V96 A;  5GAD C;  3RZD H;  3D4D A;  1LT5 D;  5I4D A;  5IOD A;  3R2T A;  4RFB A;  2E2I B;  5IT9 c;  4Y52 H;  1LYL A;  1TR5 A;  4IUU A;  4BA2 I;  4BBS B;  2SDF A;  1CT1 D;  2SEB D;  3UDF A;  2C9O A;  3S2H H;  4JBJ A;  2MP1 A;  2V1C C;  4HSP A;  1GOZ A;  3TZD A;  2I46 A;  1JCK B;  2MO0 A;  1EQV A;  2AUJ D;  4BBS H;  1S5C D;  3UE0 A;  5M3F B;  1AZP A;  1YNN C;  3ERO A;  1PH7 A;  5A35 A;  3GTP B;  1HNZ L;  2FHT A;  3E9H A;  2VQF L;  2EDG A;  3GV3 A;  2H5X A;  3FKI H;  1U4P A;  1X65 A;  5M3F H;  2K75 A;  3A8J E;  3NTI A;  1HZ9 A;  3BS1 A;  1DOL A;  3AFQ A;  2I5M X;  1Z6H A;  3HOZ B;  2A6H C;  2EE1 A;  3QR8 A;  4NW2 A;  2X6L A;  3PUY A;  3Q6S A;  4G7Z C;  4C3H H;  1RD9 D;  4KY6 A;  2Z6K C;  4DR5 Q;  1XPR A;  2UU9 Q;  3HOZ H;  1E2V A;  1LO5 D;  3J80 L;  4A3C H;  2F1M A;  4N8F A;  1XNQ Q;  1RL2 A;  3MXG A;  3ICE A;  1HXY D;  4XDX A;  2E5L Q;  4RH6 A;  5K5P A;  1FVI A;  2J0T D;  2F3V A;  4KHV A;  5A2Q E;  4YWL A;  4WJ3 M;  4HJ7 A;  4C3J G;  1SJH D;  2JYO A;  2R3Z A;  2WIN B;  4DR3 Q;  1ENF A;  4LF6 L;  1DJR D;  4DR2 L;  1N9W A;  3J7Y W;  5I9P A;  2R92 G;  3NEL A;  1I4G A;  1H9M A;  1X54 A;  2N88 A;  2KOL A;  4JV5 Q;  3HOX H;  3E9I A;  3J7Z C;  2EJG C;  5HY6 A;  1IYV A;  5J22 A;  2ZXO A;  5FLX E;  5IIF A;  4JYA L;  1A2U A;  2YTV A;  5C0X H;  1HQR D;  2H1E A;  2MJ8 A;  4KV6 A;  4JW0 A;  5K36 H;  4JI2 Q;  3SR1 A;  5EGT A;  1HJP A;  1F77 A;  1STB A;  3KLW A;  1G51 A;  3FPP A;  4ZYS A;  1VQ4 A;  1WTO A;  2EY1 A;  3EQL C;  4KLK A;  1BCP B;  3NUC A;  5HUR A;  3GTQ B;  2CH4 W;  3K5O A;  5GAG C;  4NPS A;  1G6P A;  2AKW B;  3HEJ A;  3TRZ A;  4DR6 Q;  4BY7 B;  2PYK A;  4RGO S;  1KC8 C;  4C56 C;  4KHP L;  3ITP A;  1Z47 A;  1SNM A;  1EWI A;  3U58 A;  2A6H D;  3GTK B;  1CTM A;  4IUT A;  2HUG A;  4BY7 H;  4IUQ A;  4NXN Q;  4K0K L;  1SRO A;  1WD1 A;  2A69 D;  2OTL A;  1E2W A;  5I6W A;  1IBL L;  5IGB A;  5E7N A;  1UNS A;  2B8F A;  4X65 Q;  3MC0 B;  1PYB A;  2HT1 A;  1STG A;  3R8B A;  1N34 L;  4DR4 L;  4IZ8 A;  2O4X A;  3SK8 A;  2K32 A;  1SRU A;  2HHH Q;  1MJC A;  1PTO H;  2O2L D;  2MQH A;  5BN4 A;  4L63 B;  4RHR A;  4A3M G;  4A3F H;  5M5W B;  2XRS D;  3WDN A;  5H1S E;  2EYP A;  4HN7 A;  4A3K G;  1J5E Q;  1LTI D;  2A1A A;  5C4X B;  3QOL A;  1A62 A;  1K8A C;  1Q86 C;  2PMZ E;  1PRT F;  2WII B;  4IUV A;  4DV2 Q;  3OTO L;  1BXT A;  3R3O A;  1D1K A;  4O2D A;  3D4R A;  2D0P A;  1WTQ A;  1KAB A;  2L55 A;  3A5U A;  5C4X H;  1LM0 A;  4FF4 A;  3T16 A;  1HA5 A;  2BE5 D;  1XTC D;  5JVH 3;  3HOW G;  5EAY A;  1YEZ A;  3HOY H;  1CFM A;  4CBV A;  4GKJ Q;  4FF2 A;  1IYU A;  4OIJ A;  3NSW A;  4E6I A;  4JI3 Q;  4HMI A;  3T1Y L;  1QVC A;  1QZG A;  2F0I A;  3GO5 A;  3OHX C;  5GRO A;  1QNU A;  1EIG A;  3KOJ A;  2WB1 B;  3FKI G;  4KI0 A;  4MN3 A;  2L4N A;  4R4T A;  4X3U A;  1VQC A;  1O78 A;  1I50 B;  2N49 A;  5LMN Q;  1HCZ A;  2F0W A;  1A3U A;  1PRT D;  2EYJ A;  4IAL A;  2K04 A;  1Q81 C;  2EYM A;  3CPF A;  1L1O A;  3VYS A;  4C3H G;  1N36 Q;  4V19 0;  3HOZ G;  3IRB A;  3BVZ A;  4C3I B;  4A3C G;  4HID A;  3CW2 C;  4K6L A;  4IPH A;  1SYE A;  4AYB G;  3OYY A;  4M1U B;  4BWG B;  1D2B A;  2PPB C;  3SHL A;  1SFO B;  4O42 A;  2F3W A;  5KGU A;  5C44 B;  3L9A X;  2ZTC A;  4P2C B;  3K6O A;  2ZJP A;  3TP6 A;  1I4Q A;  3SDZ A;  4CGY B;  4FXD A;  3I4N H;  1RHP A;  3D8G A;  3Q8D A;  4TSS A;  3GTM B;  1CKN B;  1FR3 A;  5M3M B;  1TS2 A;  3QIA A;  3HKS A;  4H0L C;  1FJG Q;  1Y1W H;  2R7F A;  1KNA A;  1TS5 A;  3HOX G;  4K8I A;  2RF4 A;  3TZU A;  1HNX Q;  4DAV A;  2LY7 A;  2F0M A;  3MFY A;  3GTM H;  5M3M H;  3U9S A;  5AJ3 Q;  5C0X G;  1H9R A;  2AQ2 B;  3CCU A;  1BNZ A;  2Q8R E;  5K36 G;  4GKK L;  2A8V A;  3TSS A;  3RN5 A;  2DNE A;  1I5F A;  1VQI A;  3CC2 A;  4ULL A;  4HR7 B;  1IBK Q;  4CJ2 C;  2F0Q A;  4DK6 C;  1AFP A;  1B3A A;  1EEF D;  1BVS A;  2PW7 A;  2K33 A;  3JAM L;  3I56 A;  1ESF A;  3SK5 A;  1HR0 L;  5LMU L;  1PFM A;  1CA6 A;  5TSS A;  3W2D A;  3ER0 A;  4A93 B;  1STA A;  1Y1V H;  5JPM C;  2PZW A;  3PUX A;  3BDO A;  4OL7 A;  1PYW D;  1SNC A;  1RCV D;  2M2L A;  1IBM Q;  4BY7 G;  1UE6 A;  1EQR A;  4LJZ C;  2E2H B;  1XMQ L;  3C46 A;  1ZEQ X;  1EIY B;  3IFD A;  5JEA J;  4A75 A;  2C5C A;  4A93 H;  1C4Q A;  1B2T A;  1EZ6 A;  3PSI A;  4HJ9 A;  4B3R L;  2UUB Q;  1ESR A;  1IKL A;  4DUY Q;  2E2H H;  1QOH A;  4B3T Q;  1TS4 A;  1EY9 A;  2XWJ B;  4QIW B;  4ZUJ A;  4LF9 Q;  2BA0 A;  2K03 A;  3S16 B;  3NK9 A;  1VQH A;  3IAY A;  2XSC A;  4DNT B;  1SN8 A;  3H94 A;  4A3F G;  4CKC A;  4A3L H;  4JI0 Q;  2EOT A;  1AN8 A;  4X6A H;  4ZQ3 A;  1GKH A;  4KKU A;  3HZX A;  1NTG A;  1XNR L;  1Y8P B;  3G6J B;  1GVP A;  1HNW L;  4BS9 A;  3LWE A;  1EL0 A;  4DV1 L;  3K7A H;  4FNF A;  3KF6 B;  2KBN A;  4LUV A;  5ELN A;  1YJ9 A;  2AWN A;  4U67 3;  5C4X G;  2PI2 E;  1KIX A;  1B50 A;  4MNO A;  3I55 A;  4LUO A;  5CR3 A;  1MKH A;  2CFM A;  2IW3 A;  5G3L F;  4IOA A;  3IFT A;  2M9V A;  3Q23 A;  4JI4 Q;  2R93 B;  3S1Q B;  3HOY G;  4GLX A;  3NTK A;  1NBW A;  1VF7 A;  1EY0 A;  2XVS A;  2F4V Q;  5KNC A;  4RGT A;  2KVM A;  4X66 L;  1T9H A;  1W2B A;  2L9H A;  3MHB A;  1CSQ A;  1A15 A;  3HGB A;  1VQ8 A;  4ODG A;  1N32 L;  1AEX A;  1D5M C;  1LAC A;  4OEL B;  2R93 H;  2ZM6 L;  4I7Z C;  2UXD Q;  5IYC H;  1M4V A;  3RN2 A;  1U9R A;  2F0U A;  4DXG A;  1JIC A;  1LTG D;  3K7U C;  4OX9 L;  2YTY A;  4PZ6 A;  1AP0 A;  1LLR D;  3ULL A;  1KAW A;  5JAV A;  1SNO A;  4DV0 Q;  2OQK A;  1L0X B;  1LAB A;  2EYH A;  3MXU A;  1OXT A;  3D4W A;  2RDH A;  1YNJ C;  1QCB D;  2Y0S G;  3GV6 A;  1SXT A;  4EX5 A;  2PI2 A;  3EFX D;  1UE7 A;  2KCM A;  3OMG A;  5T1G A;  3T53 B;  2R7Z B;  4DUZ L;  1MSH A;  4J8Q A;  5FK9 C;  4G7O C;  1LTA D;  2NVX B;  2EYO A;  3N6R A;  4JBM A;  2Q2U A;  1WTV A;  4G4K A;  2G9D A;  2R7Z H;  2CW0 C;  3I4N G;  5KNB A;  2KUM A;  2NVX H;  1WTP A;  2B2Y C;  1LTB D;  2B2W C;  2F0K A;  4OON A;  3QOJ A;  1Y1W G;  3ND9 A;  1GO3 E;  2IX0 A;  4IQZ A;  4MTK A;  1RF2 D;  3KLS X;  4HAE A;  1H9S A;  4HED A;  5M3M G;  1EZ8 A;  1E0B A;  1WTH A;  4XTC S;  4IPD A;  2WAQ E;  2ICE C;  2PQE A;  1CQV A;  1SLJ A;  1EOV A;  2EY6 A;  4L6T B;  4B08 A;  1F9Q A;  1ROD A;  5T1I A;  2R92 B;  1MHW C;  3W1G A;  3KJP A;  2NZ1 D;  4N8X 1;  2EQS A;  2JE6 I;  1GUO A;  5CBA E;  1VQN A;  1DXM A;  1TWA H;  1I94 L;  2QW7 A;  4H02 A;  1BBW A;  3KLR A;  4CKB A;  5FLX c;  3KYH C;  4U68 A;  5C0X I;  3AYH B;  1ZYR C;  1Y1V G;  3RLO A;  3D3R A;  1EIF A;  4XQN A;  2B8G A;  5CV9 A;  5I9O A;  4UDU C;  2VQE Q;  1EFI D;  3RMH A;  4L5Q A;  1RIP A;  1WCM G;  2FFK B;  4A93 G;  3GQB A;  1QWY A;  3TBI B;  5I6Y A;  1NR4 A;  4NP5 A;  1R9T B;  2F0E A;  3PIO A;  3J7A F;  4R9W A;  1HQM C;  4CDD C;  1H9K A;  3J81 L;  3GD7 A;  4XQQ A;  1NE3 A;  1R9T H;  1VF5 C;  1W6J A;  1LTS D;  3I3C A;  4OGQ C;  1L0W A;  2B2V C;  2BDN A;  3PF5 A;  1EYC A;  4A3L G;  4LF8 L;  4YY3 L;  1ILP A;  2R6G A;  4DPG A;  1Q7Y C;  3G48 A;  2KEN A;  5FKA C;  1BKB A;  4JOI C;  5M5X B;  4DV5 Q;  2Z6K A;  3RZO B;  3DWP A;  1D5Z C;  2JA9 A;  5GAH C;  1JT8 A;  3H3V H;  1STN A;  1QIL A;  2HDM A;  5JEA H;  4JI5 Q;  4A3M B;  1S40 A;  1C9O A;  3E3X A;  1BDO A;  2B2T C;  1CZG A;  5M5X H;  4JI7 Q;  3RZO H;  2NWG A;  4KY5 A;  4A3K B;  4DV4 L;  3P1H A;  4QJF A;  1VS0 A;  3I8Z A;  2I5H A;  2P5Z X;  1PFN A;  2QF7 A;  1SMY D;  2F0P A;  1XWE A;  3UDI A;  4L5T A;  1OO9 B;  3TN2 A;  2N8N A;  4CHT B;  4POF A;  3BJU A;  1DM0 B;  2GN5 A;  1U5K A;  2ZXR A;  2ZJR A;  2B63 G;  1BCP C;  3MVV A;  2R93 G;  2TSS A;  4HMJ A;  3R93 A;  4F88 A;  4ZLT F;  5IYC G;  3M7N A;  1YIJ A;  1MIU A;  3S2H B;  5ELB A;  4JI1 L;  1KHI A;  5JJL A;  3QJY A;  3F8T A;  3HOW B;  1PH1 A;  1K8O A;  4WRD A;  4B3M Q;  3BZD B;  1SYD A;  2Z0S A;  4KN7 C;  4JPB W;  1HTP A;  3J81 i;  2NVT H;  2B2U A;  5IP7 H;  4LF7 Q;  2A5H A;  4ID6 A;  3HOW H;  3OIQ A;  2MUY A;  3PV0 A;  4XT3 B;  1KNE A;  2PQA A;  3CD6 A;  1O7Y A;  5FO9 B;  3FKI B;  4K2L A;  1C8C A;  1B1Z A;  1EU3 A;  2XN9 C;  4OWW B;  1CI3 M;  4WFN 3;  3E0E A;  1BCP F;  3DM1 A;  1NMG A;  1AH9 A;  4OO1 G;  2UXC Q;  3EIV A;  2I0Q A;  3G7L A;  4UP9 A;  2KCC A;  4TRD A;  1E1O A;  3U4V A;  3RLN A;  1JE4 A;  2Q2H A;  4GLV B;  4C3H B;  1VMC A;  2E75 C;  2I07 B;  5ELD A;  1PFB A;  3S9W A;  1R4Q B;  4NXM L;  1UEB A;  3NQT A;  2R7Z G;  2EYF A;  4KD4 A;  3S2D H;  1PH5 A;  4RA8 A;  4DN4 M;  1TU2 B;  3H6M A;  2UUC L;  2XGT A;  1EFW A;  2DUD A;  1X3Q A;  4XXE A;  4AYB B;  1STE A;  4RKL A;  3I4M H;  5ISR A;  2DY7 A;  4YCW A;  3B6Y A;  4LF5 Q;  4K5V A;  1M8A A;  1VMP A;  2ZT9 C;  4R4Q A;  1X3G A;  5EQ0 A;  4IFD J;  3J81 c;  1IHZ A;  1TY2 A;  4FO2 A;  5DNF A;  4FP5 D;  1KQS A;  3IL8 A;  2HIV A;  4KN4 C;  4C1N K;  5L37 A;  4CDC C;  4JI8 Q;  2D9U A;  1XX8 A;  4K0K Q;  2KCT A;  1Q8K A;  2J7Z A;  4RHS A;  2A6E D;  1X32 A;  2AQ1 B;  5F2D A;  4DAY A;  1F9R A;  2PNH A;  3F1Z A;  4IJH A;  3HOX B;  4DV6 L;  2NVY H;  2KA7 A;  3G6E A;  1YNX A;  2RDF A;  1G6Z A;  3LX0 A;  5C5L A;  1G2S A;  3FPU B;  5LMN W;  1TII D;  3DEP A;  4DV7 Q;  5C4H A;  4A3D B;  2N3S A;  3G4S A;  3OMC A;  1QUQ A;  5CV4 A;  2DY8 A;  3VR2 A;  5JPN C;  1NCV A;  2EY2 A;  3QB3 A;  2JSO A;  4GOP B;  1P8L A;  3MZ5 A;  2K5D A;  2B2U C;  1HH2 P;  1E7Z A;  4A3D H;  3OTO Q;  1IW7 C;  2OT2 A;  1YNN D;  2QEX A;  3RD4 A;  4A3J B;  1B8A A;  1V1P B;  3CPW A;  4JI6 Q;  4GZY C;  4JG2 A;  1K0S A;  1BF4 A;  4DF7 A;  1D1I A;  3EA6 A;  3WOE A;  2L11 A;  2F52 A;  4DR1 Q;  3T1H L;  3PO3 H;  1RJT A;  5KND A;  3NP8 A;  1AE2 A;  1X9N A;  1MD2 D;  2PCF B;  4A3J H;  1C0A A;  4R8I A;  3K57 A;  1O7L A;  1M90 C;  2K5W A;  2Z6B A;  2AMC B;  1BBX C;  4L8J A;  3T1Y Q;  3K58 A;  2ASB A;  4IJL A;  2K28 A;  4OXP A;  3SVM A;  2EVB A;  3KF6 A;  4X3K A;  4PNY A;  4DR5 L;  2UU9 L;  3I90 A;  1PTO B;  1UE1 A;  3BZK A;  5JEA G;  4A3F B;  1U4M A;  1PH2 A;  2UUA L;  3H09 A;  3NE5 B;  1AE3 A;  1E22 A;  4H7B A;  5DEH A;  2JN4 A;  2HQE A;  1S3O A;  2E5L L;  3GTO H;  3UI2 A;  4DR7 Q;  1NAP A;  3K0X A;  3AU7 A;  4Z9C B;  1YZ6 A;  2KHI A;  1VQO A;  3VR4 A;  3HRZ C;  1QVG A;  3A8I E;  4DR3 L;  4A4I A;  1SJE D;  1XMO Q;  2A68 C;  3O13 A;  1N8R C;  5JOB A;  2QCP X;  5GAE C;  2DJG C;  3UDG A;  4ZRZ A;  1SYF A;  1JQY D;  1U4R A;  4XT1 B;  4JV5 L;  1II3 A;  4CKE A;  1UAP A;  1L2F A;  5HGQ A;  1VQK A;  3HOY B;  1F2Y A;  1IYJ B;  3OSO A;  3L7Z C;  3KBX A;  2JP1 A;  1JWU D;  1O80 A;  4GNX B;  1GHK A;  2ATW A;  1TXY A;  3NBH A;  1CM9 A;  2CQO A;  3QWN A;  2CKZ B;  2VXW A;  5E1F A;  5IP7 G;  2IX1 A;  4FXK C;  3HKZ E;  4JI2 L;  4DV3 Q;  1IW7 D;  2BDO A;  1EYG A;  3DWQ A;  4M8A A;  2RHS B;  3KJO A;  4YHH Q;  4QCL A;  2XWB B;  4GN4 B;  3URY A;  1CUK A;  3PUW A;  4OEM B;  3HP3 A;  3I2Z A;  5AFW A;  1ILQ A;  3DMU A;  2LS0 1;  4DR6 L;  1MBY A;  2EXZ A;  3TP7 A;  5FLM H;  5IT9 E;  5IWA Q;  1JC7 A;  4NKL A;  4EQO A;  4ZUI A;  1G2T A;  1EOT A;  1NSN S;  4YIJ A;  2EIF A;  3KDF B;  2KEE A;  1HRJ A;  1X3P A;  1YIT A;  1BUV T;  2O5J C;  2Y0S B;  1HUM A;  4NXN L;  1WVL A;  2A74 C;  4BY1 G;  3U4Z A;  4ME3 A;  3X3N A;  3I4M G;  1DCZ A;  1FGB D;  1HR0 Q;  1SYB A;  1B9M A;  1SYC A;  2JA7 H;  4X65 L;  4OO1 I;  2RSN A;  2UXB Q;  2ICI A;  1M1K C;  2RVL A;  2BOS A;  1Z7T A;  4HJA A;  1K28 A;  1ET6 A;  2LSS A;  5ELF A;  4XYO A;  4WOR A;  3A5Z B;  5J39 A;  3A55 A;  2HHH L;  3I4N B;  2HQL A;  4XQJ A;  3I7F A;  5D65 A;  2WP8 J;  1R4P B;  4A3G H;  2F0V A;  4B3R Q;  4X3S A;  1Y1W B;  2EPB A;  1VQ7 A;  1N33 Q;  2VB3 X;  2YTX A;  1E2Z A;  1Q8I A;  1A0I A;  4OHJ A;  3I4O A;  5IGG A;  3E5S A;  4DV2 L;  1S5B D;  2L1B A;  2ID0 A;  3TP5 A;  5EPK A;  2ZTD A;  2K5H A;  3STB C;  3VYR A;  1EWH A;  2DJF C;  1I4P A;  3OIP A;  3GTL B;  4R4I A;  5CMD A;  2JA5 G;  5IP9 H;  1PRT B;  2F4I A;  1WTR A;  4YCU A;  5C3W A;  4IFD H;  1S5F D;  3K5M A;  1BR9 A;  4AH6 A;  4A3D G;  3PGZ A;  4PG3 A;  3VYT A;  2F0N A;  2LKV A;  3J7A V;  3HOU H;  3EBE A;  5E3F A;  3GTL H;  1W6K A;  4JI3 L;  3SGI A;  2WKC A;  2QDL A;  5EPL A;  1Y1V B;  2YU9 B;  2HIX A;  1JOK A;  2QKI C;  4A3B H;  1JJ2 A;  3S1M B;  3L0O A;  3PO3 G;  2OQ0 A;  1U4L A;  4A3I B;  1K8M A;  1WCM B;  4A3J G;  3T56 B;  2YU9 H;  3MEH A;  2K50 A;  5LMN L;  1CHQ D;  2IT1 A;  3P75 A;  3A56 A;  3ERS X;  3S1M H;  3LNN A;  4X66 Q;  2HCC A;  1LT4 D;  4A3I H;  4QUF A;  3FDT A;  1WCM H;  4B9X A;  4J15 A;  2NYZ D;  5IYD G;  3F2B A;  1N36 L;  3TP8 A;  2OEO A;  4YCV A;  3H0G H;  3OWE B;  5GQO A;  1NJI C;  1QG7 A;  3F2D A;  3X3M A;  4OX9 Q;  1HTL D;  2VW9 A;  3T51 B;  3I91 A;  4JC0 A;  2G9H D;  4JVZ A;  5DM7 3;  4X3T A;  3KF8 B;  3L2P A;  5A2Q L;  1GUN A;  4P72 A;  3N52 A;  4LFB L;  5CC4 A;  2EZV A;  3K7A B;  1B4O A;  3L3O C;  3DHQ A;  4UAI A;  1A3T A;  4ZKC B;  1JWS D;  3ZYY X;  2B2Y A;  3H3V I;  2VL6 A;  2B2W A;  3A7A B;  4AQY Q;  1I4H A;  2NZH A;  4AYB E;  3RNU A;  3FVQ A;  4RKB A;  3IKJ A;  1PZI D;  1FJG L;  3C1F A;  3STB D;  4IN3 A;  1PH4 A;  4HCE A;  1HNX L;  3BVG A;  3D0F A;  2M00 A;  1OXS C;  4ZKB B;  5FLX L;  1ML0 D;  2K52 A;  1WI5 A;  3DM3 A;  2WAQ G;  2EJF C;  5AJ3 L;  1ONL A;  1STY A;  2K01 A;  4QB4 A;  1YJN A;  4QGU A;  1J8I A;  1JOQ A;  2B63 B;  1Q12 A;  4KMU C;  3VA7 A;  2JXM B;  2X6G A;  1VQG A;  1IXR A;  1GD7 A;  1TY0 A;  1HHV A;  1IBK L;  3CC7 A;  2JJQ A;  3S14 H;  3NPP A;  3FEW X;  1P16 A;  2NN6 G;  2B63 H;  3CXC A;  1GM5 A;  2D62 A;  3J80 E;  3CCL A;  5FLM G;  1TT2 A;  1UUP A;  3BYT B;  3MXN B;  1H95 A;  1LT6 D;  3SE0 A;  5BR8 L;  2KHJ A;  1DZ1 A;  1IBM L;  2YYZ A;  1KRS A;  1V1O A;  4DA2 A;  3GP7 A;  2ALY B;  3CCM A;  3PF4 A;  3HOV B;  5C3E H;  2SNS A;  3CC4 A;  1Y69 U;  1WFQ A;  2H4O A;  1AW7 A;  1MJE A;  2B39 A;  2F0D A;  3NTH A;  2UUB L;  2JA7 G;  1Q1E A;  4LF4 Q;  3CCJ A;  4DUY L;  5G3L D;  5CBE E;  1S5D D;  2JA5 B;  5FOB B;  3R2I A;  3HOV H;  1Y14 B;  4LNQ A;  1QVF A;  2FMC A;  1K83 B;  1SEB D;  3BU2 A;  4B3T L;  1KLU D;  3JC6 6;  1OXU A;  3NXW A;  4HJ5 A;  1DOM A;  4OO1 H;  2RBM A;  4LF9 L;  3CCR A;  2E2J H;  2B2V A;  3MFG A;  2ZXP A;  5C6A A;  1YI2 A;  3S15 B;  2JA5 H;  4A3G G;  2NUC A;  3A8K E;  4JI0 L;  5CV8 A;  1EYD A;  2K5Q A;  1K83 H;  3V05 A;  1V8Q A;  2Q8I B;  5ELE A;  2Q2T A;  1QZH A;  4JOI A;  5ELO A;  1KRT A;  3SK4 A;  4EGV A;  2KJX A;  3S15 H;  1KTK A;  2K4K A;  3VR5 A;  1CK1 A;  2AUK A;  2A19 A;  4X64 Q;  1CSP A;  3P20 A;  2B2T A;  4B3S Q;  3KK7 A;  1SR3 A;  4HIO A;  1TQO A;  1JE5 A;  1ICW A;  5IP9 G;  3CMA A;  3A54 A;  4DNR B;  4IFD G;  1TWA B;  3DXJ C;  4GOP A;  2XTI A;  3M7G A;  4FVM A;  4JI4 L;  4G7H C;  1K9M C;  4LFC Q;  2IHE A;  1L1O B;  3AEV A;  2PMZ B;  1CZW A;  4IO9 A;  3HOU G;  2F4V L;  3NQI A;  5LL6 S;  4C2M H;  1NR2 A;  2HD3 A;  2VZA A;  4FF1 A;  2RKS A;  4LFA Q;  1VQ5 A;  2RQX A;  2ZJQ A;  1DD2 A;  4A3B G;  1WYD A;  1K73 C;  2VUM H;  1E3P A;  2UXD L;  3ND8 A;  5J3B A;  2TMP A;  2RHQ B;  2LXK A;  3T4A C;  1F9P A;  1WJJ A;  5JJI A;  1YHB A;  2YV5 A;  4RWS C;  5JVG 3;  2RCN A;  3C1E A;  3BZC A;  4A3I G;  4I7A A;  2MHV A;  4CDF C;  1PHJ A;  4DV0 L;  1Q3L A;  2L15 A;  1BQQ T;  2F0J A;  4Q5V A;  1RTO A;  1YNJ D;  1EQQ A;  5LHY 1;  3H0G G;  4JI1 Q;  2CWP A;  4APV A;  4IPG A;  2C35 B;  3CHB D;  1KDB A;  4K14 A;  5IGF A;  2NB0 A;  1QB5 D;  2KQ3 A;  1NNX A;  3ERQ A;  3I70 A;  4BBR H;  4HSV A;  2E76 C;  2WB1 E;  2VNU D;  5COY A;  3TME A;  3I72 A;  2CW0 D;  1I3Q B;  3PUV A;  2MPM A;  4XIG S;  3CQZ B;  1B53 A;  1JB7 A;  4CDE C;  2Z9H A;  5M5Y H;  3ZJY C;  3PIP 3;  3VR6 A;  2NTT A;  5JJK A;  1I3Q H;  1TWG B;  4RMF A;  1HNZ Q;  1X6O A;  2VQF Q;  4LWC A;  5CV6 A;  3CQZ H;  2F0F A;  2AWO A;  2QIL A;  2PZT A;  3KUP A;  3NBI A;  5EKL A;  2E74 C;  4ZAI A;  2IJ0 A;  4DAP A;  1V1Q A;  4A3E H;  2QGQ A;  3QO2 A;  4OIK A;  1TWG H;  1F2Z A;  5IOC A;  2NVQ H;  4UP7 A;  2F0G A;  4GOP C;  5EBD A;  4OWX B;  4UP8 A;  5IYB G;  2F0T A;  1I4X A;  1VDZ A;  4DAM A;  3UDX A;  4EVO A;  3H91 A;  1JB3 A;  1D8L A;  2Z4H A;  2AQ3 B;  3PCO B;  1PV4 A;  4MHE A;  3K81 C;  1YHQ A;  1MGS A;  1UWV A;  3A74 A;  1XXG A;  2G5D A;  3BVM A;  1PH3 A;  2BH8 A;  1VQD A;  2FJ2 A;  2Z4I A;  4F8M A;  1CA5 A;  3ULJ A;  4RGN A;  1ZYR D;  4O0A A;  2NVT B;  4ME5 A;  1PYS B;  4RG1 A;  1HPC A;  1JOR A;  1PH6 A;  3OWF A;  5C5M A;  2NZO A;  1Q90 A;  2RA4 A;  2GVB A;  4RCN A;  4FXG C;  2VQE L;  3KDF A;  3M4O H;  3MA2 B;  3CCE A;  5LL6 X;  1VQF A;  3D6C A;  5C3E G;  4LF6 Q;  1QE6 A;  2NN6 I;  4EQP A;  4DR2 Q;  4P73 A;  4KTA A;  2KEC A;  3ULP A;  2PO4 A;  1XTD A;  1EYA A;  3FRP B;  4RGM A;  3CAM A;  4KHZ A;  1PTO C;  3HOV G;  2BH2 A;  4X62 L;  1ASY A;  3S2D B;  2XRQ D;  1TVX A;  3K5N A;  4JYA Q;  3DUZ A;  5D3I B;  2K5N A;  1B7Y B;  4BY1 B;  1X55 A;  2E2I H;  3PUZ A;  3GTJ B; 
#chains in the Genus database with same CATH homology
 3I4M B;  3HS0 C;  5IGC A;  3Q22 A;  2RSO A;  2IWH A;  1F2M A;  1G29 1;  1D6E C;  2LMC B;  4PMB A;  2NTS A;  3JAM E;  5NUC A;  3VYU A;  1GUS A;  1FNW A;  4V0B A;  1PTO F;  1FNU A;  2ENB A;  2NVY B;  3BDL A;  2KHS A;  5D14 A;  3V2T A;  1T5E A;  1Y8N B;  4XYQ A;  2F0O A;  4DU9 A;  1PXU A;  2A69 C;  2IX3 A;  5JJZ A;  1BCP D;  1EQT A;  4H13 C;  4K8J A;  3S17 B;  5FO7 B;  1B44 D;  1LTT D;  2SOB A;  1OXV A;  1GHJ A;  2KCN A;  5IGD A;  2GA4 B;  4TQU S;  1UEA B;  2Q8T A;  5C3X A;  2CQA A;  1FYC A;  4IFD I;  4DFA A;  5BN5 A;  5C4Z A;  2HDL A;  1OXX K;  1S5E D;  1SE2 A;  3PIO 3;  4I65 A;  3T13 A;  1KLG D;  3PO3 B;  4JBW A;  1PTO D;  5IGE A;  2X69 A;  1PZK D;  3QG1 A;  1A2T A;  3CKI B;  1H9S B;  5DM6 3;  2PNR C;  1ZKO A;  4C1N I;  1GUW A;  5E4X A;  2BE5 C;  3KF8 A;  5BN3 A;  1EY6 A;  2N55 A;  1PDQ A;  3C3L A;  5COR A;  4KJN A;  1KDC A;  3Q24 A;  5KIX A;  3P7J A;  4K2K A;  3EVQ A;  5EKI A;  4CJ1 B;  2JA8 B;  3GTO B;  5DAU A;  2F03 A;  3W3A A;  4J1M A;  1PRT C;  2K05 A;  3M3Y B;  4H44 C;  1FNV A;  3C2P A;  4DK0 A;  2J4X A;  5CGK A;  4R8N A;  3KBG A;  1L0Y B;  2WAQ B;  2CVR A;  1A3V A;  3MXN A;  4RAU C;  3MXP A;  1NUC A;  4K5X A;  4NDX A;  4LK1 C;  3DWA A;  3CRK C;  2IPK D;  5CYU A;  2WKD A;  2KED A;  3K0Y A;  1G8Z D;  1A6X A;  3SXH A;  4PQX A;  3SK6 A;  1I6H B;  2PW5 A;  3BYY B;  2NN6 H;  5KEE A;  2WAC A;  3RUZ A;  5I2Y A;  2NBF A;  3WOF A;  1HFN A;  2BCO A;  4MIU A;  3MTS A;  2K1B A;  4ZK9 B;  3I73 A;  1TWH B;  5EKK A;  5J1Z A;  2JA7 B;  3NHH A;  4KD3 A;  4IUP A;  5I2X A;  1ENC A;  1FD7 D;  1EY8 A;  1SND A;  4K5W A;  2V4D A;  5E4W C;  4HTH A;  1TWC B;  4DK1 A;  2D2C C;  4A3G B;  2IL8 A;  3FMC A;  3Q0A A;  5EJW A;  1V43 A;  1PZJ D;  2A68 D;  2JEA I;  5CV7 A;  3LWU A;  2O5I C;  1F2L A;  4Q0F A;  3M4Y A;  3OW7 A;  3J81 E;  2Z1C A;  2HCI A;  3HOU B;  4DXF A;  4KJO A;  3U9O A;  1SDF A;  1SNQ A;  2EYL A;  4A3B B;  4RCO A;  1GUG A;  1ENA A;  2LFN A;  1EY7 A;  3TDQ A;  5ELC A;  4KKS A;  3M85 A;  2F0L A;  1TWF B;  4JK1 C;  4S3S A;  3H0G B;  4KK7 A;  1QNK A;  3D31 A;  3A7L A;  1HA6 A;  2QDB A;  3K59 A;  3BG3 A;  3PMF A;  1SSO A;  2MGS A;  4PMW A;  1ET9 A;  4WJW A;  3ONA B;  4PMC A;  5KYI A;  4TKO B;  5KRU A;  3VA5 A;  1D5X C;  1VCI A;  1AZQ A;  2EY5 A;  1KDA A;  2OF1 A;  1I4R A;  2K7V A;  4HCS A;  5HGT A;  4FF3 A;  1TKW B;  1SE3 A;  1SE4 A;  4QMG A;  1RDP D;  4O1N A;  2JA6 B;  5M9O A;  3AB9 A;  4G57 A;  1BOS A;  1EEI D;  5C4J B;  3OPO A;  3S14 B;  1BO0 A;  1GJX A;  1S4Z A;  3F2U A;  3GTG B;  1GXD C;  3VR3 A;  4PV1 C;  5C3E B;  3SEB A;  1RKN A;  1DYQ A;  2RDG A;  2F0S A;  3S1N B;  4N9P A;  3H3V C;  1JWM D;  3BDC A;  1EU4 A;  3DEO A;  1T5X D;  3EJI A;  3MWY W;  1WTW A;  2E2J B;  1I6V C;  4KKT A;  2VB2 X;  2A73 B;  4NMZ A;  2D5D A;  1Q1B A;  1WD0 A;  1MSG A;  2SNM A;  1ZXT A;  1CHP D;  2DN8 A;  4IUR A;  2K6A A;  1TS3 A;  4LAA A;  2DNC A;  2OXP A;  4Y7N B;  1DON A;  5EBC A;  1EWC A;  2L12 A;  4IUN A;  1EIH A;  3OOC A;  1KAA A;  3CRL C;  1IKM A;  3MAQ A;  2FIN B;  1GUT A;  1C48 A;  4C3I G;  2L5T A;  1XYI A;  4C2M B;  3CU7 A;  1H9J A;  1STH A;  3AMU A;  2VUM B;  2Z8L A;  3I4L A;  1EY5 A;  1Y8O B;  4BA1 I;  5C0X J;  1V1P A;  4ILW A;  1RTN A;  5IT9 L;  4C3J B;  5KYL A;  2E2D C;  3HKZ B;  1LV9 A;  1IL8 A;  4J6H A;  1SNP A;  1B9N A;  1SMY C;  1SAP A;  3NWT A;  2XIW A;  1PMR A;  4KY7 A;  4K6D A;  2XNA C;  4BBR B;  4B9W A;  3HG9 A;  4QF4 A;  1MI2 A;  3S1R B;  2BA1 A;  2R61 A;  1PLF A;  1LTR D;  1WTX A;  5M5Y B;  4N9T A;  2EJM A;  1F9S A;  2FMM A;  3PO2 B;  3K5L A;  2WV6 D;  3KLS A;  1HUN A;  1LT3 D;  4A3E B;  2QEJ C;  5D3D A;  1J9O A;  4ABN A;  3D6W A;  2NVQ B;  3NWS A;  1O7Z A;  4QUC A;  1QJO A;  3E6Z X;  5CV5 A;  4F7X A;  3E0J A;  2CHB D;  1JOO A;  4FYD A;  4DGZ A;  1CQF A;  2JEB I;  4LMQ D;  4EQN A;  1JR0 D;  2F0H A;  3RLF A;  5EPJ A;  3M4O B;  4F87 A;  1HFG A;  1DOK A;  3RZD B;  5FO8 B;  1G91 A;  2L0C A;  2PZU A;  1SYG A;  4CJ0 B;  1EY4 A;  1SBB B;  2A6E C;  3V96 A;  3D4D A;  1LT5 D;  5I4D A;  5IOD A;  3R2T A;  4RFB A;  2E2I B;  1TR5 A;  4IUU A;  4BA2 I;  4BBS B;  2SDF A;  1CT1 D;  2SEB D;  2C9O A;  2MP1 A;  4HSP A;  1GOZ A;  3TZD A;  2I46 A;  1JCK B;  1EQV A;  2AUJ D;  1S5C D;  5M3F B;  1AZP A;  1YNN C;  3ERO A;  5A35 A;  3GTP B;  2FHT A;  2EDG A;  3GV3 A;  1U4P A;  3NTI A;  3A8J E;  3BS1 A;  1DOL A;  3HOZ B;  1Z6H A;  2A6H C;  2EE1 A;  4NW2 A;  2X6L A;  3PUY A;  3Q6S A;  4G7Z C;  1RD9 D;  4KY6 A;  1E2V A;  1LO5 D;  3J80 L;  2F1M A;  3MXG A;  1HXY D;  4XDX A;  4RH6 A;  5K5P A;  2J0T D;  2F3V A;  4KHV A;  5A2Q E;  4C3J G;  1SJH D;  2JYO A;  2R3Z A;  2WIN B;  1ENF A;  1DJR D;  3J7Y W;  5I9P A;  1I4G A;  1H9M A;  2N88 A;  2KOL A;  2EJG C;  1IYV A;  5J22 A;  2ZXO A;  5FLX E;  5IIF A;  1A2U A;  5C0X H;  1HQR D;  2H1E A;  2MJ8 A;  4KV6 A;  5K36 H;  3SR1 A;  5EGT A;  1F77 A;  1STB A;  3FPP A;  4ZYS A;  1WTO A;  2EY1 A;  3EQL C;  5HUR A;  1BCP B;  3NUC A;  3GTQ B;  3K5O A;  3HEJ A;  4BY7 B;  2PYK A;  4RGO S;  4C56 C;  3ITP A;  1Z47 A;  1SNM A;  2A6H D;  3GTK B;  1CTM A;  4IUT A;  2HUG A;  4IUQ A;  1WD1 A;  2A69 D;  1E2W A;  5I6W A;  5IGB A;  1UNS A;  2B8F A;  3MC0 B;  1STG A;  3R8B A;  4IZ8 A;  2O4X A;  3SK8 A;  2K32 A;  1PTO H;  2O2L D;  5BN4 A;  4L63 B;  4RHR A;  5M5W B;  2XRS D;  3WDN A;  2EYP A;  4HN7 A;  1LTI D;  5C4X B;  3QOL A;  1PRT F;  2WII B;  4IUV A;  1BXT A;  3R3O A;  1D1K A;  3D4R A;  1WTQ A;  1KAB A;  2L55 A;  4FF4 A;  3T16 A;  1HA5 A;  2BE5 D;  1XTC D;  5JVH 3;  1CFM A;  4CBV A;  4FF2 A;  1IYU A;  4OIJ A;  3NSW A;  4E6I A;  4HMI A;  2F0I A;  3GO5 A;  3OHX C;  1QNU A;  1EIG A;  2WB1 B;  4KI0 A;  4MN3 A;  2L4N A;  4X3U A;  1O78 A;  1I50 B;  1HCZ A;  2F0W A;  1A3U A;  1PRT D;  2EYJ A;  4IAL A;  2K04 A;  2EYM A;  3VYS A;  4C3H G;  4V19 0;  3BVZ A;  4C3I B;  4K6L A;  1SYE A;  4BWG B;  4M1U B;  1D2B A;  2PPB C;  3SHL A;  1SFO B;  4O42 A;  2F3W A;  5KGU A;  5C44 B;  3L9A X;  4P2C B;  3K6O A;  3TP6 A;  1I4Q A;  3SDZ A;  4CGY B;  4FXD A;  1RHP A;  3D8G A;  4TSS A;  3GTM B;  1FR3 A;  5M3M B;  1TS2 A;  3QIA A;  4H0L C;  1KNA A;  1TS5 A;  4K8I A;  3TZU A;  4DAV A;  2LY7 A;  2F0M A;  3MFY A;  3U9S A;  5C0X G;  1H9R A;  2AQ2 B;  1BNZ A;  2Q8R E;  5K36 G;  3TSS A;  2DNE A;  4ULL A;  4HR7 B;  4CJ2 C;  2F0Q A;  1AFP A;  1B3A A;  1EEF D;  2PW7 A;  2K33 A;  3JAM L;  1ESF A;  3SK5 A;  1PFM A;  1CA6 A;  5TSS A;  3W2D A;  4A93 B;  1STA A;  5JPM C;  2PZW A;  3PUX A;  3BDO A;  4OL7 A;  1PYW D;  1SNC A;  1RCV D;  2M2L A;  4LJZ C;  2E2H B;  3C46 A;  1ZEQ X;  3IFD A;  5JEA J;  2C5C A;  1C4Q A;  1B2T A;  1EZ6 A;  1ESR A;  1IKL A;  1QOH A;  1TS4 A;  1EY9 A;  2XWJ B;  4QIW B;  4ZUJ A;  2BA0 A;  2K03 A;  3S16 B;  3NK9 A;  3IAY A;  2XSC A;  4DNT B;  3H94 A;  4CKC A;  2EOT A;  1AN8 A;  4ZQ3 A;  4KKU A;  3HZX A;  1Y8P B;  3G6J B;  4BS9 A;  3LWE A;  1EL0 A;  4FNF A;  2AWN A;  4U67 3;  1B50 A;  5CR3 A;  2IW3 A;  5G3L F;  3IFT A;  2M9V A;  3Q23 A;  2R93 B;  3S1Q B;  3NTK A;  1VF7 A;  1EY0 A;  2XVS A;  5KNC A;  4RGT A;  2KVM A;  2L9H A;  3MHB A;  1A15 A;  3HGB A;  4ODG A;  1AEX A;  1D5M C;  1LAC A;  4I7Z C;  1M4V A;  1U9R A;  2F0U A;  4DXG A;  1JIC A;  1LTG D;  1AP0 A;  1LLR D;  5JAV A;  1SNO A;  1L0X B;  1LAB A;  2EYH A;  3MXU A;  1OXT A;  3D4W A;  2RDH A;  1YNJ C;  1QCB D;  3GV6 A;  1SXT A;  3EFX D;  3OMG A;  5T1G A;  3T53 B;  2R7Z B;  1MSH A;  4J8Q A;  5FK9 C;  4G7O C;  1LTA D;  2NVX B;  2EYO A;  3N6R A;  1WTV A;  4G4K A;  2G9D A;  2CW0 C;  5KNB A;  2KUM A;  1WTP A;  2B2Y C;  1LTB D;  2B2W C;  2F0K A;  3QOJ A;  3ND9 A;  2IX0 A;  4IQZ A;  1RF2 D;  3KLS X;  4HED A;  1H9S A;  4HAE A;  1EZ8 A;  1E0B A;  4XTC S;  2ICE C;  2PQE A;  1CQV A;  2EY6 A;  4L6T B;  4B08 A;  1F9Q A;  1ROD A;  5T1I A;  2R92 B;  2NZ1 D;  2JE6 I;  1GUO A;  5CBA E;  1DXM A;  3KLR A;  4CKB A;  4U68 A;  5C0X I;  1ZYR C;  3D3R A;  4XQN A;  2B8G A;  5CV9 A;  5I9O A;  4UDU C;  1EFI D;  3RMH A;  2FFK B;  3GQB A;  1QWY A;  3TBI B;  5I6Y A;  1NR4 A;  4NP5 A;  1R9T B;  2F0E A;  3J7A F;  4R9W A;  1HQM C;  1H9K A;  3J81 L;  3GD7 A;  4XQQ A;  1VF5 C;  1W6J A;  1LTS D;  3I3C A;  4OGQ C;  2B2V C;  2BDN A;  1EYC A;  1ILP A;  2R6G A;  5FKA C;  5M5X B;  3RZO B;  3DWP A;  1D5Z C;  1STN A;  1QIL A;  2HDM A;  5JEA H;  4A3M B;  1BDO A;  2B2T C;  1CZG A;  2NWG A;  4KY5 A;  4A3K B;  3P1H A;  3I8Z A;  1PFN A;  2QF7 A;  1SMY D;  2F0P A;  1XWE A;  1OO9 B;  3TN2 A;  4CHT B;  1DM0 B;  2ZXR A;  1BCP C;  3MVV A;  2TSS A;  4HMJ A;  3R93 A;  4F88 A;  4ZLT F;  3M7N A;  3S2H B;  5ELB A;  3QJY A;  3HOW B;  1K8O A;  4WRD A;  3BZD B;  1SYD A;  4KN7 C;  1HTP A;  2B2U A;  2A5H A;  4ID6 A;  3OIQ A;  2MUY A;  3PV0 A;  4XT3 B;  1KNE A;  1O7Y A;  5FO9 B;  3FKI B;  4K2L A;  1C8C A;  1B1Z A;  1EU3 A;  2XN9 C;  1CI3 M;  4WFN 3;  1BCP F;  3DM1 A;  4OO1 G;  3G7L A;  2KCC A;  4TRD A;  4C3H B;  1JE4 A;  1VMC A;  2E75 C;  2I07 B;  5ELD A;  1PFB A;  3S9W A;  1R4Q B;  3NQT A;  2EYF A;  4KD4 A;  4RA8 A;  4DN4 M;  1TU2 B;  3H6M A;  1X3Q A;  4XXE A;  4AYB B;  1STE A;  4RKL A;  5ISR A;  2DY7 A;  4K5V A;  1M8A A;  1VMP A;  2ZT9 C;  5EQ0 A;  4IFD J;  1IHZ A;  1TY2 A;  4FO2 A;  5DNF A;  4FP5 D;  3IL8 A;  4KN4 C;  4C1N K;  2D9U A;  1XX8 A;  2J7Z A;  4RHS A;  2A6E D;  1X32 A;  2AQ1 B;  5F2D A;  4DAY A;  1F9R A;  3HOX B;  2KA7 A;  2RDF A;  1G6Z A;  3LX0 A;  5C5L A;  1G2S A;  3FPU B;  1TII D;  3DEP A;  5C4H A;  4A3D B;  3OMC A;  5CV4 A;  2DY8 A;  3VR2 A;  5JPN C;  1NCV A;  2EY2 A;  3QB3 A;  2JSO A;  3MZ5 A;  2K5D A;  2B2U C;  1IW7 C;  2OT2 A;  1YNN D;  3RD4 A;  4A3J B;  1V1P B;  4GZY C;  1BF4 A;  4DF7 A;  1D1I A;  3EA6 A;  3WOE A;  2L11 A;  1RJT A;  5KND A;  3NP8 A;  1MD2 D;  2PCF B;  4R8I A;  3K57 A;  1O7L A;  2K5W A;  1BBX C;  4L8J A;  3K58 A;  2K28 A;  3SVM A;  2EVB A;  4X3K A;  4PNY A;  3I90 A;  1PTO B;  5JEA G;  4A3F B;  1U4M A;  3H09 A;  3NE5 B;  4H7B A;  5DEH A;  2HQE A;  3UI2 A;  1NAP A;  4Z9C B;  3AU7 A;  3VR4 A;  3HRZ C;  3A8I E;  1SJE D;  2A68 C;  3O13 A;  5JOB A;  2QCP X;  4ZRZ A;  1SYF A;  1JQY D;  1U4R A;  4XT1 B;  1II3 A;  4CKE A;  1UAP A;  3HOY B;  1F2Y A;  3OSO A;  3KBX A;  3L7Z C;  2JP1 A;  1JWU D;  1O80 A;  1GHK A;  3NBH A;  1CM9 A;  3QWN A;  5E1F A;  2VXW A;  2IX1 A;  4FXK C;  1IW7 D;  2BDO A;  3DWQ A;  4M8A A;  4QCL A;  2XWB B;  3URY A;  3PUW A;  3HP3 A;  5AFW A;  1ILQ A;  3DMU A;  2LS0 1;  1MBY A;  2EXZ A;  3TP7 A;  5IT9 E;  1JC7 A;  4NKL A;  4EQO A;  4ZUI A;  1G2T A;  1EOT A;  1NSN S;  4YIJ A;  2KEE A;  1HRJ A;  1X3P A;  2O5J C;  1BUV T;  2Y0S B;  1HUM A;  1WVL A;  2A74 C;  3X3N A;  1DCZ A;  1FGB D;  1SYB A;  1B9M A;  1SYC A;  4OO1 I;  2RSN A;  2ICI A;  2RVL A;  2BOS A;  1Z7T A;  1ET6 A;  5ELF A;  4XYO A;  4WOR A;  5J39 A;  3A55 A;  3I4N B;  4XQJ A;  5D65 A;  2WP8 J;  1R4P B;  2F0V A;  4X3S A;  1Y1W B;  2EPB A;  2VB3 X;  1E2Z A;  1Q8I A;  4OHJ A;  5IGG A;  3E5S A;  1S5B D;  2L1B A;  2ID0 A;  3TP5 A;  5EPK A;  3VYR A;  1EWH A;  1I4P A;  3OIP A;  3GTL B;  5CMD A;  1PRT B;  2F4I A;  1WTR A;  5C3W A;  4IFD H;  1S5F D;  3K5M A;  1BR9 A;  3VYT A;  2F0N A;  2LKV A;  3J7A V;  5E3F A;  1W6K A;  2WKC A;  5EPL A;  1Y1V B;  2YU9 B;  1JOK A;  2QKI C;  3S1M B;  4A3I B;  1U4L A;  1K8M A;  1WCM B;  3T56 B;  3MEH A;  1CHQ D;  2IT1 A;  3P75 A;  3A56 A;  3LNN A;  2HCC A;  1LT4 D;  4QUF A;  3FDT A;  4B9X A;  2NYZ D;  3TP8 A;  2OEO A;  3OWE B;  1QG7 A;  3X3M A;  1HTL D;  3T51 B;  3I91 A;  2G9H D;  5DM7 3;  4X3T A;  5A2Q L;  1GUN A;  3N52 A;  5CC4 A;  2EZV A;  3K7A B;  1B4O A;  3L3O C;  3DHQ A;  4UAI A;  1A3T A;  4ZKC B;  1JWS D;  3ZYY X;  2B2Y A;  2B2W A;  3A7A B;  1I4H A;  3FVQ A;  4RKB A;  3IKJ A;  1PZI D;  3C1F A;  4IN3 A;  4HCE A;  3BVG A;  2M00 A;  1OXS C;  4ZKB B;  5FLX L;  1ML0 D;  2EJF C;  1ONL A;  1STY A;  2K01 A;  4QB4 A;  1J8I A;  1JOQ A;  2B63 B;  1Q12 A;  4KMU C;  3VA7 A;  2JXM B;  2X6G A;  1TY0 A;  1HHV A;  3NPP A;  3FEW X;  2NN6 G;  2D62 A;  3J80 E;  1TT2 A;  1UUP A;  3BYT B;  1LT6 D;  3SE0 A;  1DZ1 A;  2YYZ A;  1V1O A;  4DA2 A;  3GP7 A;  3HOV B;  2SNS A;  1Y69 U;  2H4O A;  1AW7 A;  2B39 A;  2F0D A;  3NTH A;  1Q1E A;  5G3L D;  5CBE E;  1S5D D;  2JA5 B;  5FOB B;  3R2I A;  2FMC A;  1K83 B;  1SEB D;  1KLU D;  1OXU A;  3NXW A;  1DOM A;  4OO1 H;  2RBM A;  2B2V A;  3MFG A;  2ZXP A;  5C6A A;  3S15 B;  2NUC A;  3A8K E;  5CV8 A;  1EYD A;  2K5Q A;  3V05 A;  1V8Q A;  2Q8I B;  5ELE A;  3SK4 A;  4EGV A;  2KJX A;  1KTK A;  3VR5 A;  1CK1 A;  2AUK A;  3P20 A;  2B2T A;  3KK7 A;  1TQO A;  1ICW A;  3A54 A;  4DNR B;  4IFD G;  1TWA B;  3DXJ C;  3M7G A;  4FVM A;  4G7H C;  2PMZ B;  1CZW A;  3NQI A;  5LL6 S;  1NR2 A;  4FF1 A;  2RKS A;  2RQX A;  1DD2 A;  3ND8 A;  2TMP A;  3T4A C;  1F9P A;  4RWS C;  5JVG 3;  3C1E A;  2MHV A;  1Q3L A;  1BQQ T;  2F0J A;  4Q5V A;  1RTO A;  1YNJ D;  5LHY 1;  3CHB D;  1KDB A;  4K14 A;  5IGF A;  2NB0 A;  1QB5 D;  2KQ3 A;  3ERQ A;  3I70 A;  4HSV A;  2E76 C;  2VNU D;  5COY A;  3TME A;  3I72 A;  2CW0 D;  1I3Q B;  3PUV A;  2MPM A;  4XIG S;  3CQZ B;  1B53 A;  3PIP 3;  3VR6 A;  2NTT A;  1TWG B;  5CV6 A;  2F0F A;  2AWO A;  2QIL A;  2PZT A;  3KUP A;  3NBI A;  5EKL A;  2E74 C;  4ZAI A;  2IJ0 A;  4DAP A;  3QO2 A;  4OIK A;  1F2Z A;  5IOC A;  2F0G A;  5EBD A;  2F0T A;  1I4X A;  1VDZ A;  4EVO A;  1JB3 A;  3H91 A;  2Z4H A;  2AQ3 B;  4MHE A;  1MGS A;  1XXG A;  3BVM A;  2FJ2 A;  2Z4I A;  4F8M A;  1CA5 A;  4RGN A;  1ZYR D;  2NVT B;  4ME5 A;  1HPC A;  1JOR A;  3OWF A;  5C5M A;  1Q90 A;  2RA4 A;  4RCN A;  4FXG C;  3MA2 B;  5LL6 X;  3D6C A;  1QE6 A;  2NN6 I;  4EQP A;  4KTA A;  2KEC A;  2PO4 A;  1EYA A;  3FRP B;  4RGM A;  4KHZ A;  1PTO C;  3S2D B;  2XRQ D;  1TVX A;  3K5N A;  3DUZ A;  5D3I B;  4BY1 B;  3PUZ A;  3GTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...