4L6TB

Gm1 bound form of the ecx ab5 holotoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
MTPQNITDLCNEYQNTMIYSLNKEIATYTESLAGKREMVIISFSNGATFQVEVPGSQHLESQKRPLERMKDTLRAAYFTGIKISKLCAWTNKSPNSIAAIELSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECXA
publication title EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 105
sequence length 105
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4l6tB00
2XN9C 1UUPA 1PZKD 4BWGB 4RGNA 1JWUD 1AN8A 3BZDB 3W2DA 4K6LA 3BVMA 2RDHA 5TSSA 4DXFA 2QEJC 2AQ3B 1TS3A 3GP7A 1D6EC 2AQ2B 1SJED 1FGBD 1LT3D 4RH6A 1PTOH 1I4HA 1SXTA 1S5DD 2XRSD 1TY0A 2SEBD 1LTAD 1M4VA 1JR0D 1I4RA 2R61A 1D5ZC 1SE4A 1L0XB 1CK1A 5D3DA 1CQVA 1BCPB 5ELCA 1BCPC 5ELDA 1GOZA 1SEBD 1RD9D 1SJHD 1EU3A 1SE2A 4C56C 5FKAC 1BXTA 1T5XD 3R2TA 2G9HD 3DWAA 4RHRA 1TY2A 3DWPA 1ENFA 1BCPF 4RHSA 5ELFA 1LO5D 3EFXD 1FNVA 4OHJA 1LTSD 2TSSA 1EWCA 5ELBA 2ICIA 1V1OA 1FD7D 3DWQA 1KLGD 2QILA 1LTTD 4ZYSA 1JCKB 5I4DA 1S5CD 1RDPD 1SE3A 4RCOA 4TSSA 1XTCD 2XRQD 1L0YB 1SBBB 3URYA 1JWMD 1S5FD 2O2LD 2RDGA 4L6TB 1HXYD 1HQRD 3V05A 2IJ0A 1JWSD 3R8BA 1G8ZD 1PTOD 1RF2D 4L63B 4RGTA 1PRTD 1I4XA 1V1PB 1V1PA 1I4GA 1PZID 1PZJD 2IPKD 1LTBD 1MD2D 3BYYB 4RFBA 1FNWA 1S5ED 3SEBA 1ET6A 1I4QA 1PTOB 4DXGA 1TS4A 1PRTB 3MFGA 1EU4A 3TSSA 2AQ1B 1ESFA 1KLUD 2NTSA 1HA5A 3KLSX 4Z9CB 1CHPD 1DYQA 1PTOF 1PYWD 1EEFD 1S5BD 5D3IB 3BVZA 1LT6D 1LLRD 2J4XA 1CHQD 1QILA 4UDUC 3MC0B 1LT4D 3O13A 1TS2A 3OWEB 1ET9A 1B1ZA 1F77A 1TS5A 1XXGA 1D5MC 1I4PA 1LTID 3BYTB 1B44D 3EA6A 1AW7A 1DJRD 1CT1D 1LTGD 1RCVD 4RGOS 1KTKA 1PTOC 5FK9C 1JQYD 1PRTC 1BCPD 4O1NA 3BVGA 1FNUA 3CHBD 2Z8LA 1EEID 1EFID 1UNSA 1HTLD 1LTRD 1LT5D 1STEA 2WV6D 1PRTF 2NTTA 2CHBD 1D5XC 5ELEA 2XNAC 4RGMA 3R2IA
chains in the Genus database with same CATH superfamily
4JI4L 4OXPA 1IBKQ 1UUPA 4TVAB 1PV4A 3AMUA 3IFDA 3K5OA 3BVMA 2LXKA 2Q8TA 2VUMH 3P7JA 3GTOH 1CKMA 1NBWA 3GTKH 4M1UB 1IBMQ 4LFCL 3H0GH 3NPPA 4RG1A 1S4ZA 2QGQA 2N78A 3PIO3 1W6JA 1SMYC 2AUJD 2F0NA 2YYZA 5DAUA 4GOPA 3HKZG 2K5VA 2WKDA 3GV6A 1EYCA 4KHPL 4FDBA 1SNPA 3KJOA 1BCPB 4LF6L 4DV5Q 3J81E 5JOBA 1NUCA 2EYPA 1EY9A 1FNVA 3F2UA 2R6GA 1KLGD 2Z4HA 3UDXA 4LF9Q 4RA8A 1RDPD 1YNJD 4TSSA 1FL0A 4EQ5A 4CHTB 4GOPB 3A54A 2F52A 3KUPA 3M3YH 4O0AA 1S5FD 2F3IA 2N49A 2RDGA 4L6TB 1AZQA 1IBLQ 2F0TA 1OXXK 1HZAA 1JWSD 4AIMA 1EY6A 1P16A 5FLMH 1D7QA 1XPUA 1XJVA 4YHHL 1N32Q 1I3QB 2F0MA 2HQEA 2CCZA 3CRLC 4KD4A 1PFNA 2I46A 5JEAH 1DCZA 4LK1C 3MHBA 1E24A 4QMGA 1I94L 3GTJB 4X3UA 3F1ZA 2K04A 1BBUA 1K9MC 1XNRL 5KEEA 2RF4A 3O13A 1EQTA 1BF4A 4JV5L 2Q2IA 1TXYA 5JJKA 1UEBA 1L1OA 3VYUA 1C0AA 3C3LA 2HT1A 3J7AF 2F0DA 2PW5A 4F8MA 1WOCA 1I4PA 2JK8A 5AJ3Q 3I4MB 2XGTA 3S15B 1PTOC 4KJNA 1BOSA 1SYCA 1J5EQ 4BY1H 1TWHH 2WAQE 3AU7A 4KD3A 5M5XH 5IYCG 4FF4A 3TS2A 4UP9A 4R8NA 3Q22A 3NBIA 2B2YA 1K0SA 2KEDA 5GAEC 2AHOB 3F2BA 4PMCA 3I4MG 1N34Q 1L1OB 2JA6H 1AN8A 3M85A 3TREA 1CKNB 3HOWB 5M3MB 2PW7A 3F8TA 3R3OA 1B4OA 3GP7A 2RDFA 4TRDA 1HUNA 1DZ1A 1B9MA 2DY7A 1BDOA 2B39A 1CA5A 1X3EA 2L0CA 1SYEA 4BBSH 2Z6KC 2R61A 1F2YA 2K1BA 4APVA 3JAMc 1NR4A 3CCJA 1HNXQ 5D65A 3HOWG 2RCFA 5M3MG 1TY2A 4DUYL 1XYIA 1KL9A 5C3EG 3PIP3 1VS0A 3NENA 2E2JH 1FD7D 4LF8L 2ZXPA 5JJLA 3U4ZA 1L0YB 1OXVA 5C3EH 3X3NA 5JJIA 1HRJA 2N8NA 1NMFA 4NXMQ 3TRZA 3K7AB 1K3RA 2L4NA 1WJJA 3PV0A 2AWNA 1PA6A 2IX1A 4DR5L 1FYCA 4K8IA 4HIKA 2EJGC 3TDQA 1V1PA 4CDDC 1HQMC 3AQQA 1ZKOA 3I7FA 1MD2D 5I9PA 4OIJA 2OEOA 1HUMA 4LFBL 2F4VQ 1PRTB 5T1IA 1PDQA 3PF4A 3DEOA 5GADC 3D6CA 3KLSX 5DEHA 2HHHQ 1CHPD 3STBD 5LMNQ 2J4XA 4CJ0B 1QILA 2PNRC 4C2MB 2CW0C 4NXNL 4EQPA 4XDXA 4DR3Q 3BDLA 2VY3A 4B3SL 3RN5A 3FHWA 4YCUA 5AFWA 2VS1A 1QG7A 1ENCA 2CH4W 1YI2A 1KDAA 4K0KL 1SAPA 2EYJA 4CJ1B 4IFDH 2K28A 2M00A 4O1NA 1JB3A 1WTQA 3MXNA 2WINB 4JBWA 3MEHA 3OW7A 4QGUA 1H9RA 3A8JE 3MWYW 2IY5B 5JPNC 4DNIA 5ELEA 4K5XA 2XNAC 3IRBA 4MNOA 5DM63 1OTCA 5EBCA 5E4WC 3R93A 2BA0A 3FKIH 1XMQQ 5IOCA 4IOCA 1EOVA 2JA8H 2B3GA 4P74A 1TY0A 1AP0A 2A6EC 1TKWB 1Q1EA 4A3FH 3H6MA 3HRZC 3MFYA 4K5WA 4RWSC 4P2CB 2WP8J 1R4PB 2UUAQ 4DR1L 3U4VA 3NTIA 2B2UA 1VQNA 3QJYA 4OO1I 1BCPF 1HA6A 3J80E 5FLXc 5M3FB 2NVXB 3HOUB 1A3UA 1ZYRD 2L15A 3H94A 4WJ4A 4C3IB 2XRQD 3FRPB 4YWMA 5I2YA 1IBKL 1STYA 4JBMA 4A3MB 4IPGA 2NVQH 4K8JA 3MEFA 3VR2A 3PO2H 1PRTD 3U9OA 1PFMA 1QUQB 3PGZA 3G71A 3KOJA 5M3FG 2B63H 5FJ8G 4JCVE 1I4QA 4QIWE 4DR4Q 3HOUG 2XWBB 4IPDA 3MVVA 1GM5A 1X3GA 2F0EA 3U9SA 3CPFA 3HZXA 4DV5L 5FJ8H 3A7AB 4ZUIA 5IGGA 4A3MG 3GTMB 2N3SA 2ALYB 4ZAIA 4UDUC 3TN2A 2K01A 5BR8Q 4DV1Q 4UP7A 2OTLA 4J1MA 3HKZE 2OQKA 2LMCB 1FR3A 2D5DA 4H7BA 5DM73 5M5YB 1TS5A 4LF9L 1DONA 1G6PA 3I4NB 3QG1A 5KIXA 4A3LG 4DV6Q 3OMCA 3E0EA 5IGEA 3ULJA 2ASBA 4DAMA 1EWHA 4IUNA 1IBLL 2V1CC 1PH4A 1K83B 3H15A 4N8FA 1EQQA 5C44B 2PYKA 1HNWQ 3TP5A 2I0QA 4DV7L 2KCCA 3UDGA 4RGMA 2PQAA 5C4JB 2NWGA 2UUCL 3I4NG 4XQJA 4AYBB 2GA4B 2F0HA 3G48A 4YWLA 3D4DA 2UXBQ 2N55A 2F0JA 4GLVB 3OW2A 3J7AV 2PO4A 1VQLA 2WB1B 5C44G 1FGBD 4N8X1 4ZLTF 2PZTA 3K80C 2Q8IB 4A3DH 5C5MA 5FO7B 1CSQA 5AJ3L 3L2PA 1ASYA 1SEBD 1GHJA 2PQAB 1OXUA 3TP8A 1VQMA 1E1TA 1FJGL 5HGTA 1N33Q 5ELOA 4IN3A 4HJ7A 2A6HD 5BN4A 4V190 2WB1G 3CMEA 2E8GA 2IT1A 2OCEA 4IJLA 2UU9L 4GKJL 2O4XA 2CKZB 1U4LA 2EIFA 3S1NH 1ESRA 5KNDA 1GUSA 2B2WA 4EGVA 3NE5B 1N34L 5K5PA 1GJXA 3PUXA 4S3SA 3V05A 5KNCA 1YNND 2K7VA 1CQFA 4TKOB 1IW7D 4OWTB 2LS01 2EXZA 3K59A 1N36Q 3J81i 5FO9B 1ZEQX 3NWSA 1HFNA 2OQ0A 4OL7A 3EQLC 1PTOB 4G7HC 5IWAL 2IX0A 3M4OH 1KHIA 3ONAB 1A0IA 1GVPA 1HR0Q 1A62A 5IP9G 3DM1A 1PXUA 1IYJB 4A3IB 5EPKA 1VCIA 1LLRD 4HIDA 1V8QA 1TWGB 3T56B 1A2TA 4K2KA 1VDZA 4A93H 1EFWA 3RLOA 2NVTB 5DNFA 1SMYD 5FO8B 5BN5A 4B9XA 3JAME 2B2TA 2QKIC 1ILPA 1VQ6A 4LAAA 3HOYH 1SLJA 2BH8A 3WDNA 3ULPA 2FMMA 4B3MQ 1VQ7A 2VQFL 4NXML 4A3EG 2K5QA 3BVGA 4A3IG 1EEID 1EFID 1HTLD 1STBA 3QO2A 2HCIA 3V2TA 4A3EH 1PVOA 4DNRB 2KUMA 2F0IA 5GAHC 1CTMA 1EY4A 3HOXB 1JOKA 2Z4IA 1JWUD 1PH8A 2DY8A 4Y7NH 3CKIB 3RR5A 4R4IA 1GXDC 3I55A 2JA5B 3KF8A 4DXFA 2AQ3B 1HH2P 4EQNA 3NEMA 1B8AA 2AQ2B 2BDNA 1BKBA 5IYDH 2JN4A 3CP0A 3T1HQ 5LHY1 3GTGH 5EGTA 1KIXA 1SE4A 1L0XB 5CV8A 3HOXG 4ALPA 1XPRA 2M9VA 5LMUQ 2L9HA 1JOQA 5FKAC 4HJ5A 4DUZQ 2JA5G 2JSOA 3A74A 4DN4M 4LFAQ 5L37A 1H9KA 5ELBA 4X3KA 2K03A 4EQOA 3LX0A 4N9PA 3PUZA 1G2SA 5C0XJ 1F9RA 1XTCD 1W6KA 4R1JA 1YHBA 3D6WA 5A2QE 5EQ0A 1HQRD 1YJ9A 4IO9A 1C8CA 1PMRA 1VQIA 1JT8A 5EKKA 1AE3A 1PTOD 2R93H 1I4XA 3MTSA 3S9WA 2F4IA 1I4GA 1PZID 2IPKD 2F1MA 4HCEA 1FNWA 1KAAA 1X3PA 3OIPA 5IY0A 1MHWC 1BO0A 1NTGA 2ENBA 4EVOA 4A3KH 1Z6HA 4DFAA 3S14H 2AQ1B 2NTSA 3RZOH 1TWAB 3K58A 4XYOA 3I90A 2UUAL 1YNXA 4DAPA 3FVQA 3S16H 1VF7A 3OWEB 4JI1L 3S2HB 5M5WB 4BBRH 3HEJA 1VF5C 3NHHA 2HDLA 3S2DH 4GN5A 1QZHA 5FLXE 4BXXH 2F0FA 4A3JH 3HOVB 1IYVA 3LWUA 4XQNA 4IUVA 1VQPA 4KY5A 1YEZA 4OO1H 2L1BA 1ML0D 2ZTCA 4DR4L 1QWYA 4X3SA 3I70A 4JI8Q 1IKMA 3KBXA 2CWPA 4FF1A 5G3LF 3RNUA 1X3QA 5K36G 1PFSA 2KEEA 5BR8L 2YV5A 4KKTA 5IODA 4DAVA 4R9WA 1U4MA 4PMWA 1TWFH 2XWJB 1WCMB 5ELCA 3DEPA 2CQOA 5K36H 1EYAA 5CV5A 3UI2A 1RD9D 3GQBA 1EU3A 4DV6L 4HR7B 2HUGA 4BY7B 1VQDA 1QB5D 1KDCA 1VQKA 4X65Q 5IT9L 4DV3Q 1VQEA 3DWQA 4ZQ3A 4XQQA 1VQBA 3GTLH 1WFQA 2E2HB 2CW0D 5I4DA 3K8AA 1WCMG 1LUZA 1PH6A 1HXYD 2QCPX 5C3WA 3H3VH 1QVFA 2EYOA 4QB4A 4BY7G 1TWCH 2IJ0A 4L63B 3I91A 5CC4A 3KK7A 4RFBA 4DR6Q 1B7YB 3FPPA 4XIGS 3J80i 1JE5A 2I5LX 4X3TA 2HQLA 2R7FA 2LSSA 1RODA 1PH1A 3NK9A 4A3BB 1DYQA 1PTOF 2P5ZX 3IFTA 2JEBI 1N33L 2OF1A 3J81L 1SMXA 1STNA 1SYDA 3MZ5A 1A15A 3K5MA 3D0FA 1R4QB 4ZUJA 1HNZQ 1X65A 1NR2A 2E76C 3HGBA 3OYYA 4J6HA 2A6ED 4GNXC 1QCBD 5HY6A 4X64L 4A3BG 4AH6A 1G6ZA 4YWKA 2WB1E 2VZAA 4GKKQ 2UUBQ 2NUCA 1UE1A 1CFMA 4IUQA 1N36L 4N9TA 5CYUA 4CGYB 2NTTA 1EZ6A 1I6HB 1D5XC 3GD7A 2RQXA 2EYMA 1K8AC 1ENAA 3S1MB 3VDYA 1E0BA 1CKNA 1V43A 4X66L 2YTYA 3ND8A 4RAUC 2B2VC 1CZGA 1V1QA 1N9WA 2EY1A 1V9PA 3LWEA 4QY7A 3KF6A 3TZDA 1I3QH 5C0XG 5F2DA 3A0JA 3V96A 3NBHA 2EZVA 4K6DA 2F3WA 3P75A 3GTJH 4JI2Q 3GTQB 5ELDA 4DV2Q 1N8RC 3CCUA 3DWAA 4GLXA 3K7UC 4B3ML 1TT2A 2PZWA 2K5WA 2VNUD 5IYCH 3DWPA 5C4ZA 4OX9Q 4XYQA 4MN3A 2UXDQ 1EUJA 2KCMA 3I4MH 1ONLA 1JCKB 2K33A 3KF6B 3S15H 1QNUA 3U58A 2JA7B 1MBYA 2SNMA 4LF5Q 1XNQQ 2IHFA 4DV4Q 3M4YA 2BDOA 3NBHB 4F7XA 1PYSB 1SSOA 2DGYA 3C1EA 5IGDA 3PO3B 3D4WA 3CCRA 2C5CA 4L5SA 4DR2Q 3OTOL 4CKCA 1EY8A 1SR3A 4POFA 1WI5A 4DR7Q 3PUVA 3SEBA 3CW2C 2A69C 4L5TA 1DOLA 2JA7G 2M2LA 4LF4Q 3HOWH 1SRUA 5M3MH 3RD4A 4HSPA 1K8MA 2BH2A 3PO3G 1QZGA 4DUZL 2KJXA 2EXDA 1AFPA 4JK1C 2NBFA 3PSIA 3CF5A 4LFAL 2HIVA 2GVBA 5LL6S 3T16A 5J1ZA 3J81j 1XXGA 2ICEC 4NPSA 4B3TQ 3E5SA 4R4CA 2F0SA 3VR6A 2J0TD 2LXJA 2KOLA 2MFIA 4LWCA 4AQYL 1HZCA 1KNEA 1LTLA 3M4QA 3MXPA 5KNBA 2AMCB 1UWVA 1MI2A 3EN2A 3K7AH 4RKLA 3T1YQ 4Q5VA 1E22A 2JE6I 1HFGA 2JP1A 3W2DA 5IGBA 4DV0Q 4K6LA 2K75A 2DNCA 1PH3A 3CU7A 2HD3A 1JMCA 2UXCQ 4JYAQ 4RCNA 4O42A 1TIID 2K50A 1M1KC 1ZXTA 1EQVA 2VXWA 4JI5Q 1CK1A 5EJWA 3I56A 1SJHD 3QB3A 3R2TA 1Q7YC 1MJEA 3L0OA 1VQGA 5I2XA 4C2MH 4BS9A 2QF7A 2PMZB 2YU9B 1BVSA 2E74C 4OWWB 3MA2B 3ND9A 1SBBB 5KRUA 1QJOA 2PPBC 1B3QA 4QUCA 3CMAA 1M8AA 2F0KA 2NN6G 4RGTA 4WRDA 4JPBW 1QUQA 3CRKC 4DK0A 2NYZD 1LTBD 3BYYB 1I5FA 3A56A 1S40A 2I5MX 4JI3L 2ZXRA 3HOZB 1TS4A 2A73B 2C35B 3GTPB 1HCZA 3TSSA 4JOIA 4A3GB 3EBEA 4KMUC 2H1EA 5IE8A 2K5DA 4C3JB 1SNMA 3G7LA 2F0VA 2E2IB 1LT6D 1GUTA 3B6YA 4OONA 1Q8IA 4DK6C 1D1KA 1TS2A 2RBMA 5E3FA 4Y52H 4DU9A 3A5ZB 4DV3L 3J80L 2EE1A 1IBML 2PQEA 3AB9A 1D5MC 3HOZG 4IPHA 4NMZA 1UE6A 4A3GG 1GKHA 3MXGA 1RIPA 2ATWA 4C3IG 4C3JG 1EYGA 1Y1VB 2Z8LA 4YY3Q 2KCNA 5M3FH 4P73A 5FOBB 3JC66 3CCEA 2NVXH 3SHLA 1CSPA 2WFWA 4FVMA 3HOUH 3K6OA 4C3IH 2NZHA 3E3XA 4FF2A 3WWVA 3S1QB 4IUUA 1EIGA 4LF7Q 1PZKD 3BZDB 5IT9c 4YCVA 1CI3M 4KY6A 4A3MH 3H3VI 2RSNA 4H02A 2RDHA 2JA9A 5HURA 1AE2A 2PNHA 5C4HA 1Y1VG 1A63A 4OELB 1A8VA 1K0RA 1B9NA 4A3LH 1IL2A 1I4RA 1Y14B 4BA2I 3H09A 1DD2A 1SYBA 1GUGA 5LMNW 1BCPC 5CR3A 1N32L 3OSOA 2EVBA 3GTMH 1C48A 2HCCA 4ULLA 1Q46A 4X62Q 1H95A 4I65A 4RHRA 1EY0A 1X3FA 5ELFA 4OHJA 4JI4Q 2TSSA 2IHEA 1IZ6A 3N6RA 3RLNA 2ICIA 1CKOA 1BBWA 5M5YH 2MNAA 1JORA 1T5EA 1Q12A 1IL8A 3I4NH 1SE3A 4LUZA 2JEAI 1WTHA 4GOPC 3J81c 3URYA 1JWMD 3CQZB 1RKNA 1K83H 3KFUA 2KQ3A 2EYFA 3R8BA 5C44H 2MGSA 4AYBG 4KHPQ 4CJ2C 4C3HB 1K8OA 4M8AA 4LF6Q 3K5NA 1BQQT 3K5LA 4ZCKA 4KJOA 5C4JH 1J5EL 1E2VA 2GVAA 4IZ8A 3AYHB 1MSGA 4HN7A 4JI2L 2B8FA 2G9DA 1XX8A 2KCTA 1Z9FA 3I2ZA 4DV2L 3U50C 2AWOA 2J7ZA 1LM0A 2LKVA 3CC7A 2MP1A 4C3HG 3ERSX 2R92B 2ZJPA 2UXDL 1ICWA 1VQOA 1LTID 3J7YW 4DK3C 1AW7A 4WORA 2I5HA 4IALA 1RCVD 4YHHQ 1YVCA 1LV9A 5C0XI 1YJWA 4LF5L 1XNQL 1FNUA 2Z6KA 1VMPA 3CCMA 1O7ZA 1I50B 1JJ2A 4DR2L 1STHA 1PRTF 1XPOA 1I94Q 1HNXL 2R92G 2FXQA 4DR7L 2H5XA 1GUNA 4GLAC 3R2IA 3GV3A 2X69A 4HJAA 1CA6A 5IP9H 2NVYB 3C2PA 1PH2A 1L1OC 2QW7A 3RUZA 4R4OA 4Q0FA 4LF4L 4X6AH 1EZ8A 1EQRA 1WD0A 1YHQA 4KK7A 3D3RA 1XMOQ 3ITPA 3M4PA 5EBDA 2Q2TA 1J8IA 4MTNA 1PTOH 4QJFA 2L5TA 1BR9A 1O78A 5GQOA 1RTNA 5E1FA 2X6LA 1MIUA 3SDZA 2B2YC 4U68A 4A3IH 1O7LA 4C56C 2CWAA 2F4VL 3VR3A 4O2DA 1TWGH 5KGUA 1EIFA 1F2LA 2E5LQ 2NVTH 2K14A 2HHHL 1R9TB 2R3ZA 3L3OC 1WD1A 5LMNL 2R7ZB 2QILA 2JYOA 1LTTD 1U9RA 4KLKA 4ZYSA 1Q86C 1EL0A 2DJFC 2K5HA 5I6WA 5CBAE 3NWTA 3T1YL 2DNEA 4DR3L 1NJIC 1H9JA 1EY7A 4DV0L 1Y8PB 1O7YA 1STGA 3PCOB 3TBIB 4G4KA 4G7OC 2ZT9C 3PQIA 1UE7A 5IYBG 3M7GA 4LJZC 5E7NA 2UXCL 2Z0SA 4JYAL 2MO1A 4FXDA 2R7ZG 1X32A 2EPBA 3VR4A 3HOXH 3Q24A 4H0LC 3RZDB 5IYBH 2ZXOA 1ESFA 3ICEA 4OEMB 1HA5A 3PMFA 2JA5H 2FMCA 2AUKA 1CM9A 1NAPA 3OMGA 3SK4A 3E0JA 4FYDA 3MC0B 4JI0Q 5JVH3 1Y1WB 1X56A 1QOHA 4KKUA 2NB0A 1XMQL 2RVLA 1NCVA 2KHJA 1B1ZA 2NZ1D 5IGCA 4DR5Q 3TS0A 2O5JC 1PH9A 3H91A 1EY5A 3S17B 1SNQA 3CCVA 4NB3A 3S1RB 1SFOB 2E75C 2DN8A 4KV6A 4LFBQ 1P8LA 1VQ5A 4UY8C 1LTRD 2WV6D 3SGIA 1VQ4A 1Y1WG 3IKJA 5C4XB 2EYLA 4LUOA 2XN9C 2C9OA 5JVG3 1Q82C 1Y8NB 1YITA 3EVQA 1Z7TA 4NP5A 5TSSA 4HJ8A 4MTKA 4FXGC 1SDFA 2PMZE 5J39A 4ZKCB 3DM3A 4XXEA 4IUTA 3NP8A 2KENA 2K4KA 1DOKA 3WOEA 5C4XG 2SEBD 2Z9HA 1JR0D 1Y8OB 1PYBA 1HR0W 5D3DA 1VQHA 1TWAH 3ULLA 2A69D 4K5VA 1OXSC 4DK1A 1T5XD 1HTPA 5JJZA 2D2CC 3NUCA 4YY3L 2ZJRA 2A8VA 2F0QA 5ISRA 1QE6A 1RHPA 1SROA 5M9OA 5FLXL 3S2HH 2JQOA 2ZTEA 2RCNA 4OWXB 5M5WH 2FFKB 1VMCA 2LY7A 3N52A 3HOVG 3CXCA 4IPCA 1SYGA 4DV1L 4GN3B 1D2BA 1I6VC 4MZ9A 4LF7L 1LACA 2CH4A 2YTXA 4J15A 3KDFB 3J80c 1H9SA 3K0YA 3PIOA 4HMJA 2WACA 4I7ZC 3HOVH 3GTOB 1OO9B 3GTKB 2VUMB 3H0GB 3K0XA 2A68C 2Z6BA 4KHVA 3FMCA 4YIJA 2V4DA 2B2UC 1DXMA 4DR1Q 1BBXC 4JI7Q 1EWIA 1EU4A 5IT9E 1HNWL 1G51A 4F88A 4Z9CB 4H13C 1EEFD 2L11A 4DF7A 1D8LA 1KXLA 1SN8A 2QDLA 2RA4A 4JC0A 5GAGC 1QVGA 4IFDJ 3H0GG 3DLLA 2UXBL 3I72A 1WVLA 1G291 1H9SB 3I73A 5J3BA 1S3OA 4NW2A 1WCMH 4KN7C 1B44D 4KI0A 2EOTA 3SXHA 4BY7H 2EJFC 1C9OA 4ODGA 2L55A 3M3YB 1JQYD 3C1FA 4I7AA 3ERQA 4GZYC 5C3XA 4IJHA 1STEA 5C6AA 3K57A 1NY4A 2E2HH 4JVZA 2CHBD 5T1GA 3SK6A 3SK8A 3L9AX 1CZWA 1JJCB 1JJGA 1II3A 4TQUS 2WIIB 4HCSA 4L5QA 4PG3A 4AYBE 2R7DA 3DHQA 5FLMG 1C4QA 4RH6A 3CC4A 4PZ7A 2ZM6Q 4UPAA 1PLFA 1E2ZA 1CQVA 4A3BH 5JEAG 1E3PA 2EJMA 4K14A 5EPJA 2MO0A 3RMHA 2EYHA 4KTAA 1F2MA 1SE2A 4DV7Q 2G9HD 3IL8A 3WOFA 3J7A5 2A19A 3EFXD 3UE0A 1HR0L 1KDBA 2UUCQ 4MIUA 4BY1B 1TWHB 4FXKC 5M5XB 3A7LA 2VQEQ 3VA5A 1KAWA 2HIXA 4L5RC 2IW3A 3MXUA 1XWEA 1TQOA 2DUDA 2JA6B 4EX5A 1VQ8A 3A8KE 2AKWB 4BA1I 1X54A 4XT3B 4CKBA 2BE5C 5C0XH 1LABA 1A3VA 1MGSA 1NSNS 3VA7A 1I6HH 5GROA 1XMOL 3BDOA 1E2WA 4BY1G 1K28A 3SK5A 4DKAC 3S1MH 1FJGQ 1WTOA 1BNZA 3W5OA 2IL8A 4BBSB 3I8ZA 2FINB 3BZKA 1U4PA 2UU9Q 5EKLA 4GKJQ 3A5UA 4A4IA 4FNFA 2JA6G 1UAPA 1VQAA 4HEDA 3PIPA 2B2WC 2XVSA 3Q0AA 2PI2A 4LW1A 4IUPA 1IYUA 1A2UA 3T4AC 3P1HA 5CV6A 2E5LL 1ET9A 2EY2A 2KHIA 2WKCA 3C46A 4POGA 2E2JB 3GTQH 3A8IE 4BBSG 1VQCA 5JPMC 1AH9A 5C3EB 3SVMA 4A3CG 4KHZA 1YJNA 1DM0B 5DLQE 3Q23A 3T1HL 1BCPD 1TVXA 5IWAQ 3OOCA 4A75A 3KYHC 3I4LA 5LMUL 1LT5D 4A3CH 2OTJA 3G6EA 2SNSA 3UDIA 3ZYYX 2NZOA 4P71A 5CBEE 4HIMA 3VYSA 2JA7H 2ZJQA 3NQTA 1PHJA 4QL5A 3TP7A 3PO3H 5A35A 5CV9A 2B2TC 3KLSA 1KQSA 4CDFC 3P20A 1JICA 1PH7A 2QA4A 1D6EC 3EROA 3FPUB 3T51B 3HKSA 2GN5A 4JI0L 3QIAA 3CCLA 3TQYA 3Q6SA 2XTIA 1SXTA 1S5DD 1Z47A 2FJ2A 2VQFQ 2F0PA 1LTAD 1M4VA 1D5ZC 2PCFB 3E9IA 2EY6A 1AZPA 4ZRZA 2A1AA 2YTVA 4DGZA 4XTCS 1J6QA 1RJTA 2H4OA 3I3CA 4QF4A 1BXTA 1M90C 1DGSA 3UDFA 2F3VA 3VR5A 4C1NI 3JAMi 1VQFA 4P75A 4DA2A 1K8GA 3FP9A 1E1OA 1TR5A 2RHQB 3D8GA 1YBYA 3RLFA 1B50A 2KECA 2MHVA 1U5KA 1L0WA 4IQZA 3MAQA 4IFDG 3FKIB 1RF2D 3S24A 1WYDA 1V1PB 1VQ9A 1SYFA 1PZJD 4RKBA 4PQXA 5C5LA 4JBJA 1S5ED 2JA8B 1EYDA 3MFGA 2K52A 4A3FB 1NE3A 5J22A 3CD6A 3OPOA 4FF3A 2O5IC 1S5BD 3VYTA 1Q90A 1CHQD 3FKIG 4HTHA 5CV4A 5IP7G 3NXWA 5COYA 4B3RQ 1YNJC 4JI8L 3NTKA 4JI6Q 2JA8G 3BYTB 1F2ZA 1HJPA 1B70B 4J8QA 5IP7H 4A3FG 1NMGA 1KTKA 2NN6H 5EKIA 3W1GA 4HAEA 3MXNB 4WJWA 2OWOA 2NVQB 1SNCA 2YU9H 3PO2B 1TU2B 3OIQA 3ER0A 1G91A 3NQIA 1E7ZA 2ID0A 2B63B 5NUCA 2KA7A 3K81C 1EIHA 3E9HA 4X65L 3NSWA 3G4SA 1X55A 4JI7L 4R8IA 2RSOA 2KHSA 4RGNA 1JOOA 3KLWA 2D9UA 4JI1Q 1YIJA 4UHVA 3VYRA 4U673 1F9PA 2A74C 2MJ8A 3HFZB 1SJED 2CVRA 3DXJC 3BS1A 3PO2G 1HZ9A 2Y0SB 4CDEC 5BN3A 3H3VC 2L12A 4HMIA 3HOZH 1F9SA 3GTPH 3GO5A 1B2TA 5KYIA 2B63G 4A3GH 2BCOA 1Q3LA 4C3JH 4DR6L 2E2IH 2CFMA 2JJQA 4ZK9B 1D1IA 1Y69U 1QNKA 3J7ZC 3E6ZX 4QCLA 1LO5D 5IGFA 1GHKA 1V1OA 2Y0SG 5D14A 2F0OA 5JAVA 3FEWX 4PMBA 5CMDA 1HNZL 1KD1C 4YCWA 3GDEA 1Y1VH 3HS0C 4PNYA 1ASZA 1ILQA 3Q8DA 4G57A 1ICFB 2K5NA 2Z1CA 3I4OA 4XT1B 1KNAA 4JG2A 4UAIA 4GKKL 4GNXA 4JW0A 1SE8A 3S1QH 2UUBL 1EOTA 4V0BA 2ZM6L 2F0GA 4A3DB 2D62A 1KLUD 4NDXA 2OT2A 3BU2A 1PH5A 4ME3A 4LMQD 3HG9A 5CGKA 5CORA 5D3IB 4LFCQ 3NELA 2D0PA 4P72A 5LL6X 1U4RA 3EIVA 1GUOA 1IXRA 4A76A 2VQEL 3PUWA 2ZTDA 3NTHA 4PV1C 3S1NB 2I07B 3M9BA 2B2VA 4A3DG 1U0LA 1LTGD 4RGOS 4GNXB 3RN2A 4B9WA 3M7NA 1HPCA 3W3AA 3IAYA 5I9OA 3L7ZC 4CKEA 1GUWA 3HP3A 2F0LA 2EY5A 1VQJA 1FGUA 3CQZH 4OX9L 2QDBA 3STBC 3BZCA 4BWGB 1STAA 4CBVA 4ME5A 3M4OB 3TEHB 3UE1A 1O80A 4F87A 2N88A 1TS3A 3QOJA 2IWHA 4C3HH 1WTPA 4DV4L 1LT3D 1W2BA 1B3AA 4ILWA 4LUVA 1KABA 2WAQB 4DAYA 2A68D 2XRSD 4X64Q 3EJIA 1Q8KA 4A93B 4LNQA 5IIFA 1SNDA 3X3MA 3AEVA 3BJUA 1HHVA 3CCQA 1GOZA 1X6OA 3HOYB 1G2TA 4MHEA 1JC7A 3F2CA 3PUYA 1GD7A 2F0WA 1XNRQ 4JBKA 3TMEA 4RHSA 3T13A 4JV5Q 1RTOA 1LTSD 2R92H 2WAQG 3TZUA 2EDGA 4X66Q 1S5CD 4A3EB 4A93G 3A55A 2OXPA 4RMFA 4DAYB 2O2LD 4DPGA 4KY7A 3HOYG 1WTRA 1YZ6A 4Y7NB 1O7IA 4WJ3M 1G8ZD 3DMUA 4B3TL 1I50H 4R4TA 3JAML 5ELNA 1ET6A 3LGJA 5EPLA 4DXGA 2NVYH 2EQSA 1W3SA 1KRTA 3PF5A 4FO2A 1L2FA 3GTGB 5I6YA 4NKLA 1PYWD 3KJPA 1MJCA 5G3LD 3BVZA 2G5DA 1S72A 1Q1BA 4HIOA 1UE5A 1WTWA 2A5HA 3ZJYC 2PI2E 4E6IA 5JEAJ 4HJ9A 1ZYRC 3CCSA 1KC8C 2B29A 2K32A 4OIKA 1F77A 5IYDG 1OXTA 4HSVA 3EA6A 3QR8A 3OTOQ 4OGQC 1GO3E 3FDTA 1CT1D 1UEAB 1H9MA 4C1NK 5FK9C 4KN4C 1PRTC 4DUYQ 2D0OA 5KYLA 4WFN3 4JI5L 2KVMA 4PZ6A 2FHTA 1R9TH 2R93B 2K6AA 3KLRA 3CAMA 2R7ZH 1KRSA 4LF8Q 2F0UA 1IKLA 1K3BC 5EAYA 2TMPA 2MUYA 4G7ZC 3G6JB 4A3KB 3S14B 1MSHA 4IOAA 1WTVA 4B08A 4QUFA 3SE0A 1K73C 2PZUA 3RZOB 3KF8B 2QEJC 1T9HA 4KKSA 3QOLA 3W1BA 2F03A 1JB7A 2K05A 2R93G 5A2QL 2BE5D 3OWFA 3S16B 4B3RL 4ID6A 1I4HA 4GN4B 4IFDI 3RZDH 2VB3X 4JI6L 2VL6A 2RKSA 4A3KG 2SOBA 4BBRB 2XSCA 4AQYQ 2VW9A 1F9QA 3BDCA 4GS3A 2JXMB 3S2DB 2DJGC 3D4RA 2SDFA 4R4QA 1Y1WH 5E4XA 3DUZA 1ENFA 4NXNQ 2XIWA 2QEXA 1EWCA 4A3JB 4K2LA 1EIYB 3LNNA 4B3SQ 1NNXA 4QQBX 5HGQA 4RCOA 1HZBA 4K0KQ 3CC2A 4ZKBB 3S17H 4CDCC 2Q2UA 2ES2A 4H44C 2CQAA 1SNOA 4BBRG 1SFOH 3S1RH 2NN6I 1LYLA 1X9NA 2Q8RE 2VB2X 1C7YA 3KDFA 1RL2A 5CV7A 5C4XH 4BXXG 4A3JG 3T53B 4L8JA 1J9OA 4UP8A 4FP5D 2Q2HA 1JE4A 1PFBA 2BOSA 3OHXC 3AFPA 4OO1G 3BG3A 1TWFB 1FVIA 1DOMA 2RHSB 2A6HC 1A6XA 2BA1A 5H1SE 2IX3A 1LT4D 3SR1A 2MQHA 2X6GA 4IURA 4DNTB 3KBGA 1B53A 3QWNA 1CUKA 3GTLB 4QIWB 1YNNC 1DJRD 1IW7C 2E2DC 3AFQA 3TP6A 1Q81C 3D31A 3CHBD 4JOIC 4JI3Q 1AEXA 3CPWA 1TWCB 2Y0SE 1QVCA 1UNSA 1WTXA 2MPMA 4ABNA 2KBNA 2HDMA 1A3TA 2B8GA 1YHAA 3HKZB 2LFNA 4X62L 1BUVT 3F2DA 2VUMG 1IHZA 4PZ8A 1XTDA 1MKHA
chains in the Genus database with same CATH topology
1UUPA 3AMUA 3IFDA 3K5OA 3BVMA 2Q8TA 3P7JA 4M1UB 3NPPA 1S4ZA 3PIO3 1W6JA 1SMYC 2AUJD 2F0NA 2YYZA 5DAUA 2WKDA 3GV6A 1EYCA 1SNPA 1BCPB 3J81E 5JOBA 1NUCA 2EYPA 1EY9A 1FNVA 3F2UA 2R6GA 1KLGD 2Z4HA 4RA8A 1RDPD 1YNJD 4TSSA 4CHTB 3A54A 3KUPA 1S5FD 4L6TB 2RDGA 1AZQA 2F0TA 1OXXK 1JWSD 1EY6A 1I3QB 2F0MA 2HQEA 3CRLC 4KD4A 1PFNA 2I46A 5JEAH 1DCZA 4LK1C 3MHBA 4QMGA 3GTJB 4X3UA 2K04A 5KEEA 3O13A 1EQTA 1BF4A 3VYUA 3C3LA 3J7AF 2F0DA 2PW5A 4F8MA 1I4PA 3I4MB 3S15B 1PTOC 4KJNA 1BOSA 1SYCA 3AU7A 4KD3A 4FF4A 4R8NA 3Q22A 3NBIA 2B2YA 2KEDA 4PMCA 1AN8A 3M85A 3HOWB 5M3MB 2PW7A 3R3OA 1B4OA 3GP7A 2RDFA 4TRDA 1HUNA 1DZ1A 1B9MA 2DY7A 1BDOA 2B39A 1CA5A 2L0CA 1SYEA 2R61A 1F2YA 2K1BA 1NR4A 5D65A 1TY2A 1XYIA 3PIP3 1FD7D 2ZXPA 1HRJA 1L0YB 1OXVA 3X3NA 3K7AB 2L4NA 3PV0A 2AWNA 2IX1A 1FYCA 4K8IA 2EJGC 3TDQA 1V1PA 1HQMC 1ZKOA 1MD2D 5I9PA 4OIJA 2OEOA 1HUMA 1PRTB 5T1IA 1PDQA 3DEOA 3D6CA 3KLSX 5DEHA 1CHPD 2J4XA 4CJ0B 1QILA 2PNRC 4C2MB 2CW0C 4EQPA 4XDXA 3BDLA 5AFWA 1QG7A 1ENCA 1KDAA 1SAPA 2EYJA 4CJ1B 4IFDH 2K28A 2M00A 4O1NA 1JB3A 1WTQA 3MXNA 2WINB 4JBWA 3MEHA 3OW7A 1H9RA 3A8JE 3MWYW 5JPNC 5ELEA 4K5XA 2XNAC 5DM63 5EBCA 5E4WC 3R93A 2BA0A 5IOCA 1AP0A 1TY0A 2A6EC 1TKWB 1Q1EA 3H6MA 3HRZC 3MFYA 4K5WA 4RWSC 4P2CB 2WP8J 1R4PB 3NTIA 2B2UA 3QJYA 4OO1I 1BCPF 1HA6A 3J80E 5M3FB 2NVXB 3HOUB 1A3UA 1ZYRD 3H94A 4C3IB 2XRQD 3FRPB 5I2YA 1STYA 4A3MB 4K8JA 3VR2A 1PRTD 3U9OA 1PFMA 1I4QA 2XWBB 3MVVA 2F0EA 3U9SA 3HZXA 3A7AB 4ZUIA 5IGGA 3GTMB 4ZAIA 4UDUC 3TN2A 2K01A 4J1MA 2LMCB 1FR3A 2D5DA 4H7BA 5DM73 5M5YB 1TS5A 1DONA 3I4NB 3QG1A 5KIXA 3OMCA 5IGEA 1EWHA 4IUNA 1K83B 5C44B 2PYKA 3TP5A 2KCCA 4RGMA 5C4JB 2NWGA 4XQJA 4AYBB 2GA4B 2F0HA 3D4DA 2N55A 2F0JA 3J7AV 2PO4A 2WB1B 1FGBD 4ZLTF 2PZTA 2Q8IB 5C5MA 5FO7B 1SEBD 1GHJA 1OXUA 3TP8A 5HGTA 4IN3A 2A6HD 5BN4A 4V190 2IT1A 2O4XA 1U4LA 1ESRA 5KNDA 1GUSA 4EGVA 2B2WA 3NE5B 1GJXA 5K5PA 3PUXA 4S3SA 3V05A 5KNCA 1YNND 2K7VA 1CQFA 4TKOB 1IW7D 2LS01 2EXZA 3K59A 5FO9B 1ZEQX 3NWSA 1HFNA 4OL7A 3EQLC 1PTOB 4G7HC 2IX0A 3ONAB 3DM1A 1PXUA 4A3IB 5EPKA 1VCIA 1LLRD 1V8QA 1TWGB 3T56B 1A2TA 4K2KA 1VDZA 2NVTB 5DNFA 1SMYD 5FO8B 5BN5A 4B9XA 3JAME 2B2TA 2QKIC 1ILPA 4LAAA 3WDNA 2FMMA 2K5QA 3BVGA 1EEID 1EFID 1HTLD 1STBA 3QO2A 2HCIA 3V2TA 4DNRB 2KUMA 2F0IA 1CTMA 1EY4A 3HOXB 1JOKA 2Z4IA 1JWUD 2DY8A 3CKIB 1GXDC 2JA5B 3KF8A 4DXFA 2AQ3B 4EQNA 2AQ2B 2BDNA 5LHY1 5EGTA 1SE4A 1L0XB 5CV8A 2M9VA 2L9HA 1JOQA 5FKAC 2JSOA 4DN4M 1H9KA 5ELBA 4X3KA 2K03A 4EQOA 3LX0A 4N9PA 3PUZA 1G2SA 5C0XJ 1F9RA 1XTCD 1W6KA 3D6WA 5A2QE 5EQ0A 1HQRD 1C8CA 1PMRA 5EKKA 1PTOD 1I4XA 3MTSA 3S9WA 2F4IA 1I4GA 1PZID 2IPKD 2F1MA 4HCEA 1FNWA 1KAAA 1X3PA 3OIPA 1BO0A 2ENBA 4EVOA 1Z6HA 4DFAA 2AQ1B 2NTSA 1TWAB 3K58A 4XYOA 3I90A 4DAPA 3FVQA 1VF7A 3OWEB 3S2HB 5M5WB 3HEJA 1VF5C 3NHHA 2HDLA 5FLXE 2F0FA 3HOVB 1IYVA 3LWUA 4XQNA 4IUVA 4KY5A 4OO1H 2L1BA 1ML0D 1QWYA 4X3SA 3I70A 1IKMA 3KBXA 4FF1A 5G3LF 1X3QA 5K36G 2KEEA 4KKTA 5IODA 4DAVA 4R9WA 1U4MA 4PMWA 2XWJB 1WCMB 5ELCA 3DEPA 5K36H 1EYAA 5CV5A 3UI2A 1RD9D 3GQBA 1EU3A 4HR7B 2HUGA 4BY7B 1QB5D 1KDCA 5IT9L 3DWQA 4ZQ3A 4XQQA 2E2HB 2CW0D 5I4DA 1HXYD 2QCPX 5C3WA 2EYOA 4QB4A 2IJ0A 4L63B 3I91A 5CC4A 3KK7A 4RFBA 3FPPA 4XIGS 4X3TA 1RODA 3NK9A 4A3BB 1DYQA 1PTOF 3IFTA 2JEBI 2OF1A 3J81L 1STNA 1SYDA 3MZ5A 1A15A 3K5MA 1R4QB 4ZUJA 1NR2A 2E76C 3HGBA 4J6HA 2A6ED 1QCBD 1G6ZA 2NUCA 1CFMA 4IUQA 4N9TA 5CYUA 4CGYB 2NTTA 1EZ6A 1I6HB 1D5XC 3GD7A 2RQXA 2EYMA 1ENAA 3S1MB 1E0BA 1V43A 3ND8A 4RAUC 2B2VC 1CZGA 2EY1A 3LWEA 3TZDA 5C0XG 5F2DA 3V96A 3NBHA 2EZVA 4K6DA 2F3WA 3P75A 3GTQB 5ELDA 3DWAA 1TT2A 2PZWA 2K5WA 2VNUD 3DWPA 5C4ZA 4XYQA 4MN3A 1ONLA 1JCKB 2K33A 1QNUA 2JA7B 1MBYA 2SNMA 3M4YA 2BDOA 4F7XA 1SSOA 3C1EA 5IGDA 3PO3B 3D4WA 2C5CA 4CKCA 1EY8A 3PUVA 3SEBA 2A69C 1DOLA 2M2LA 3RD4A 4HSPA 1K8MA 2KJXA 1AFPA 4JK1C 2NBFA 5LL6S 3T16A 5J1ZA 1XXGA 2ICEC 3E5SA 2F0SA 3VR6A 2J0TD 2KOLA 1KNEA 3MXPA 5KNBA 1MI2A 4RKLA 4Q5VA 2JE6I 1HFGA 2JP1A 3W2DA 5IGBA 4K6LA 2DNCA 3CU7A 4RCNA 4O42A 1TIID 1ZXTA 1EQVA 2VXWA 1CK1A 5EJWA 1SJHD 3QB3A 3R2TA 5I2XA 4BS9A 2QF7A 2PMZB 2YU9B 2E74C 3MA2B 3ND9A 1SBBB 5KRUA 1QJOA 2PPBC 4QUCA 1M8AA 2F0KA 2NN6G 4RGTA 4WRDA 3CRKC 4DK0A 2NYZD 1LTBD 3BYYB 3A56A 2ZXRA 3HOZB 1TS4A 2A73B 3GTPB 1HCZA 3TSSA 4A3GB 4KMUC 2H1EA 2K5DA 4C3JB 1SNMA 3G7LA 2F0VA 2E2IB 1LT6D 1GUTA 1Q8IA 1D1KA 1TS2A 2RBMA 5E3FA 4DU9A 3J80L 2EE1A 2PQEA 3AB9A 1D5MC 4NMZA 3MXGA 4C3IG 4C3JG 1Y1VB 2Z8LA 2KCNA 5FOBB 3SHLA 4FVMA 3K6OA 4FF2A 3S1QB 4IUUA 1EIGA 1PZKD 3BZDB 1CI3M 4KY6A 2RSNA 2RDHA 5HURA 5C4HA 1B9NA 1I4RA 4BA2I 3H09A 1DD2A 1SYBA 1GUGA 1BCPC 5CR3A 3OSOA 2EVBA 1C48A 2HCCA 4ULLA 4I65A 4RHRA 1EY0A 5ELFA 4OHJA 2TSSA 3N6RA 2ICIA 1JORA 1T5EA 1Q12A 1IL8A 1SE3A 2JEAI 3URYA 1JWMD 3CQZB 1RKNA 2KQ3A 2EYFA 3R8BA 2MGSA 4CJ2C 4C3HB 1K8OA 4M8AA 3K5NA 1BQQT 3K5LA 4KJOA 1E2VA 4IZ8A 1MSGA 4HN7A 2B8FA 2G9DA 1XX8A 2AWOA 2J7ZA 2LKVA 2MP1A 4C3HG 2R92B 1ICWA 1LTID 3J7YW 1AW7A 4WORA 4IALA 1RCVD 1LV9A 5C0XI 1FNUA 1VMPA 1O7ZA 1I50B 1STHA 1PRTF 1GUNA 3R2IA 3GV3A 2X69A 1CA6A 2NVYB 3C2PA 3RUZA 4Q0FA 1EZ8A 1WD0A 4KK7A 3D3RA 3ITPA 5EBDA 1J8IA 1PTOH 2L5TA 1BR9A 1O78A 1RTNA 5E1FA 2X6LA 3SDZA 2B2YC 4U68A 1O7LA 4C56C 3VR3A 5KGUA 1F2LA 1R9TB 2R3ZA 3L3OC 1WD1A 2R7ZB 2QILA 2JYOA 1LTTD 1U9RA 4ZYSA 1EL0A 5I6WA 5CBAE 3NWTA 2DNEA 1H9JA 1EY7A 1Y8PB 1O7YA 1STGA 3TBIB 4G4KA 4G7OC 2ZT9C 3M7GA 4LJZC 4FXDA 1X32A 2EPBA 3VR4A 3Q24A 4H0LC 3RZDB 2ZXOA 1ESFA 1HA5A 3PMFA 2FMCA 2AUKA 1CM9A 1NAPA 3OMGA 3SK4A 3E0JA 4FYDA 3MC0B 5JVH3 1Y1WB 1QOHA 4KKUA 2NB0A 2RVLA 1NCVA 1B1ZA 2NZ1D 5IGCA 2O5JC 3H91A 1EY5A 3S17B 1SNQA 1SFOB 3S1RB 2E75C 2DN8A 4KV6A 1LTRD 2WV6D 3IKJA 5C4XB 2EYLA 2XN9C 2C9OA 5JVG3 1Y8NB 3EVQA 1Z7TA 4NP5A 5TSSA 4FXGC 1SDFA 5J39A 4ZKCB 4XXEA 4IUTA 3NP8A 1DOKA 3WOEA 2SEBD 1JR0D 1Y8OB 5D3DA 2A69D 4K5VA 1OXSC 4DK1A 1T5XD 1HTPA 5JJZA 2D2CC 3NUCA 2F0QA 5ISRA 1QE6A 1RHPA 5M9OA 5FLXL 2FFKB 1VMCA 2LY7A 3N52A 1SYGA 1D2BA 1I6VC 1LACA 1H9SA 3K0YA 4HMJA 2WACA 4I7ZC 3GTOB 2VUMB 1OO9B 3GTKB 3H0GB 2A68C 4KHVA 3FMCA 4YIJA 2V4DA 2B2UC 1DXMA 1BBXC 1EU4A 5IT9E 4F88A 4Z9CB 4H13C 1EEFD 2L11A 4DF7A 2RA4A 4IFDJ 3I72A 1WVLA 1G291 1H9SB 3I73A 4NW2A 4KN7C 1B44D 4KI0A 2EOTA 3SXHA 2EJFC 4ODGA 2L55A 3M3YB 1JQYD 3C1FA 3ERQA 4GZYC 5C3XA 1STEA 5C6AA 3K57A 2CHBD 5T1GA 3SK6A 3SK8A 3L9AX 1CZWA 1II3A 4TQUS 2WIIB 4HCSA 3DHQA 1C4QA 4RH6A 1PLFA 1E2ZA 1CQVA 5JEAG 2EJMA 4K14A 5EPJA 3RMHA 2EYHA 4KTAA 1F2MA 1SE2A 2G9HD 3IL8A 3WOFA 3EFXD 1KDBA 4MIUA 4BY1B 1TWHB 4FXKC 5M5XB 3A7LA 3VA5A 2IW3A 3MXUA 1XWEA 1TQOA 2JA6B 3A8KE 4BA1I 4XT3B 4CKBA 2BE5C 5C0XH 1LABA 1A3VA 1MGSA 1NSNS 3VA7A 3BDOA 1E2WA 3SK5A 1WTOA 1BNZA 2IL8A 4BBSB 3I8ZA 2FINB 1U4PA 5EKLA 4FNFA 1UAPA 4HEDA 2B2WC 2XVSA 3Q0AA 4IUPA 1IYUA 1A2UA 3T4AC 3P1HA 5CV6A 1ET9A 2EY2A 2WKCA 3C46A 2E2JB 3A8IE 5JPMC 5C3EB 3SVMA 4KHZA 1DM0B 3Q23A 1BCPD 1TVXA 3OOCA 3I4LA 1LT5D 2SNSA 3ZYYX 5CBEE 3VYSA 3NQTA 3TP7A 5A35A 5CV9A 2B2TC 3KLSA 3P20A 1JICA 1D6EC 3EROA 3FPUB 3T51B 3QIAA 3Q6SA 1SXTA 1S5DD 1Z47A 2FJ2A 2F0PA 1LTAD 1M4VA 1D5ZC 2PCFB 2EY6A 1AZPA 4ZRZA 4DGZA 4XTCS 1RJTA 2H4OA 3I3CA 4QF4A 1BXTA 2F3VA 3VR5A 4C1NI 4DA2A 1TR5A 3D8GA 3RLFA 1B50A 2KECA 2MHVA 4IQZA 3MAQA 4IFDG 3FKIB 1RF2D 1V1PB 1SYFA 1PZJD 4RKBA 4PQXA 5C5LA 1S5ED 2JA8B 1EYDA 3MFGA 4A3FB 5J22A 3OPOA 4FF3A 2O5IC 1S5BD 3VYTA 1Q90A 1CHQD 4HTHA 5CV4A 3NXWA 5COYA 1YNJC 3NTKA 3BYTB 1F2ZA 4J8QA 1KTKA 2NN6H 5EKIA 4HAEA 4WJWA 2NVQB 1SNCA 3PO2B 1TU2B 3OIQA 1G91A 3NQIA 2ID0A 2B63B 5NUCA 2KA7A 1EIHA 3NSWA 4R8IA 2RSOA 2KHSA 4RGNA 1JOOA 2D9UA 3VYRA 4U673 1F9PA 2A74C 2MJ8A 1SJED 2CVRA 3DXJC 3BS1A 2Y0SB 5BN3A 3H3VC 2L12A 4HMIA 1F9SA 3GO5A 1B2TA 5KYIA 2BCOA 1Q3LA 4ZK9B 1D1IA 1Y69U 1QNKA 3E6ZX 4QCLA 1LO5D 5IGFA 1GHKA 1V1OA 5D14A 2F0OA 5JAVA 3FEWX 4PMBA 5CMDA 3HS0C 4PNYA 1ILQA 4G57A 2Z1CA 4XT1B 1KNAA 4UAIA 1EOTA 4V0BA 2F0GA 4A3DB 2D62A 1KLUD 4NDXA 2OT2A 5CGKA 4LMQD 3HG9A 5CORA 5D3IB 5LL6X 1U4RA 1GUOA 3PUWA 3NTHA 4PV1C 3S1NB 2I07B 2B2VA 1LTGD 4RGOS 4B9WA 3M7NA 1HPCA 3W3AA 3IAYA 5I9OA 3L7ZC 4CKEA 1GUWA 3HP3A 2F0LA 2EY5A 2QDBA 4CBVA 4BWGB 1STAA 3M4OB 4ME5A 1O80A 4F87A 2N88A 1TS3A 3QOJA 2IWHA 1WTPA 1LT3D 1B3AA 4ILWA 1KABA 2WAQB 4DAYA 2A68D 2XRSD 3EJIA 4A93B 5IIFA 1SNDA 3X3MA 1HHVA 1GOZA 3HOYB 1G2TA 4MHEA 1JC7A 3PUYA 2F0WA 3TMEA 4RHSA 3T13A 1RTOA 1LTSD 3TZUA 2EDGA 1S5CD 4A3EB 3A55A 2OXPA 2O2LD 4KY7A 1WTRA 4Y7NB 1G8ZD 3DMUA 3JAML 1ET6A 5EPLA 4DXGA 4FO2A 3GTGB 5I6YA 4NKLA 1PYWD 5G3LD 3BVZA 1Q1BA 1WTWA 2A5HA 4E6IA 5JEAJ 1ZYRC 2K32A 4OIKA 1F77A 1OXTA 4HSVA 3EA6A 4OGQC 3FDTA 1CT1D 1UEAB 1H9MA 4C1NK 5FK9C 4KN4C 1PRTC 5KYLA 4WFN3 2KVMA 2FHTA 2R93B 2K6AA 3KLRA 2F0UA 1IKLA 2TMPA 2MUYA 4G7ZC 3G6JB 4A3KB 3S14B 1MSHA 1WTVA 4B08A 4QUFA 3SE0A 2PZUA 3RZOB 2QEJC 4KKSA 3QOLA 2F03A 2K05A 5A2QL 2BE5D 3OWFA 3S16B 4ID6A 1I4HA 4IFDI 2VB3X 2RKSA 2SOBA 4BBRB 2XSCA 1F9QA 3BDCA 2JXMB 3S2DB 3D4RA 2SDFA 5E4XA 3DUZA 1ENFA 2XIWA 1EWCA 4A3JB 4K2LA 3LNNA 4RCOA 4ZKBB 4H44C 2CQAA 1SNOA 2NN6I 2Q8RE 2VB2X 5CV7A 3T53B 4L8JA 1J9OA 4FP5D 1JE4A 1PFBA 2BOSA 3OHXC 4OO1G 3BG3A 1TWFB 1DOMA 2A6HC 1A6XA 2BA1A 2IX3A 1LT4D 3SR1A 2X6GA 4IURA 4DNTB 3KBGA 1B53A 3QWNA 3GTLB 4QIWB 1YNNC 1DJRD 1IW7C 2E2DC 3TP6A 3D31A 3CHBD 1AEXA 1TWCB 1UNSA 1WTXA 2MPMA 4ABNA 2HDMA 1A3TA 2B8GA 3HKZB 2LFNA 1BUVT 1IHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XN9 C;  1UUP A;  1PZK D;  4BWG B;  4RGN A;  1JWU D;  1AN8 A;  3BZD B;  3W2D A;  4K6L A;  3BVM A;  2RDH A;  5TSS A;  4DXF A;  2QEJ C;  2AQ3 B;  1TS3 A;  3GP7 A;  1D6E C;  2AQ2 B;  1SJE D;  1FGB D;  1LT3 D;  4RH6 A;  1PTO H;  1I4H A;  1SXT A;  1S5D D;  2XRS D;  1TY0 A;  2SEB D;  1LTA D;  1M4V A;  1JR0 D;  1I4R A;  2R61 A;  1D5Z C;  1SE4 A;  1L0X B;  1CK1 A;  5D3D A;  1CQV A;  1BCP B;  5ELC A;  1BCP C;  5ELD A;  1GOZ A;  1SEB D;  1RD9 D;  1SJH D;  1EU3 A;  1SE2 A;  4C56 C;  5FKA C;  1BXT A;  1T5X D;  3R2T A;  2G9H D;  3DWA A;  4RHR A;  1TY2 A;  3DWP A;  1ENF A;  1BCP F;  4RHS A;  5ELF A;  1LO5 D;  3EFX D;  1FNV A;  4OHJ A;  1LTS D;  2TSS A;  1EWC A;  5ELB A;  2ICI A;  1V1O A;  1FD7 D;  3DWQ A;  1KLG D;  2QIL A;  1LTT D;  4ZYS A;  1JCK B;  5I4D A;  1S5C D;  1RDP D;  1SE3 A;  4RCO A;  4TSS A;  1XTC D;  2XRQ D;  1L0Y B;  1SBB B;  3URY A;  1JWM D;  1S5F D;  2O2L D;  2RDG A;  4L6T B;  1HXY D;  1HQR D;  3V05 A;  2IJ0 A;  1JWS D;  3R8B A;  1G8Z D;  1PTO D;  1RF2 D;  4L63 B;  4RGT A;  1PRT D;  1I4X A;  1V1P B;  1V1P A;  1I4G A;  1PZI D;  1PZJ D;  2IPK D;  1LTB D;  1MD2 D;  3BYY B;  4RFB A;  1FNW A;  1S5E D;  3SEB A;  1ET6 A;  1I4Q A;  1PTO B;  4DXG A;  1TS4 A;  1PRT B;  3MFG A;  1EU4 A;  3TSS A;  2AQ1 B;  1ESF A;  1KLU D;  2NTS A;  1HA5 A;  3KLS X;  4Z9C B;  1CHP D;  1DYQ A;  1PTO F;  1PYW D;  1EEF D;  1S5B D;  5D3I B;  3BVZ A;  1LT6 D;  1LLR D;  2J4X A;  1CHQ D;  1QIL A;  4UDU C;  3MC0 B;  1LT4 D;  3O13 A;  1TS2 A;  3OWE B;  1ET9 A;  1B1Z A;  1F77 A;  1TS5 A;  1XXG A;  1D5M C;  1I4P A;  1LTI D;  3BYT B;  1B44 D;  3EA6 A;  1AW7 A;  1DJR D;  1CT1 D;  1LTG D;  1RCV D;  4RGO S;  1KTK A;  1PTO C;  5FK9 C;  1JQY D;  1PRT C;  1BCP D;  4O1N A;  3BVG A;  1FNU A;  3CHB D;  2Z8L A;  1EEI D;  1EFI D;  1UNS A;  1HTL D;  1LTR D;  1LT5 D;  1STE A;  2WV6 D;  1PRT F;  2NTT A;  2CHB D;  1D5X C;  5ELE A;  2XNA C;  4RGM A;  3R2I A; 
#chains in the Genus database with same CATH topology
 4JI4 L;  4OXP A;  1IBK Q;  1UUP A;  4TVA B;  1PV4 A;  3AMU A;  3IFD A;  3K5O A;  3BVM A;  2LXK A;  2Q8T A;  2VUM H;  3P7J A;  3GTO H;  1CKM A;  1NBW A;  3GTK H;  4M1U B;  1IBM Q;  4LFC L;  3H0G H;  3NPP A;  4RG1 A;  1S4Z A;  2QGQ A;  2N78 A;  3PIO 3;  1W6J A;  1SMY C;  2AUJ D;  2F0N A;  2YYZ A;  5DAU A;  4GOP A;  3HKZ G;  2K5V A;  2WKD A;  3GV6 A;  1EYC A;  4KHP L;  4FDB A;  1SNP A;  3KJO A;  1BCP B;  4LF6 L;  4DV5 Q;  3J81 E;  5JOB A;  1NUC A;  2EYP A;  1EY9 A;  1FNV A;  3F2U A;  2R6G A;  1KLG D;  2Z4H A;  3UDX A;  4LF9 Q;  4RA8 A;  1RDP D;  1YNJ D;  4TSS A;  1FL0 A;  4EQ5 A;  4CHT B;  4GOP B;  3A54 A;  2F52 A;  3KUP A;  3M3Y H;  4O0A A;  1S5F D;  2F3I A;  2N49 A;  2RDG A;  4L6T B;  1AZQ A;  1IBL Q;  2F0T A;  1OXX K;  1HZA A;  1JWS D;  4AIM A;  1EY6 A;  1P16 A;  5FLM H;  1D7Q A;  1XPU A;  1XJV A;  4YHH L;  1N32 Q;  1I3Q B;  2F0M A;  2HQE A;  2CCZ A;  3CRL C;  4KD4 A;  1PFN A;  2I46 A;  5JEA H;  1DCZ A;  4LK1 C;  3MHB A;  1E24 A;  4QMG A;  1I94 L;  3GTJ B;  4X3U A;  3F1Z A;  2K04 A;  1BBU A;  1K9M C;  1XNR L;  5KEE A;  2RF4 A;  3O13 A;  1EQT A;  1BF4 A;  4JV5 L;  2Q2I A;  1TXY A;  5JJK A;  1UEB A;  1L1O A;  3VYU A;  1C0A A;  3C3L A;  2HT1 A;  3J7A F;  2F0D A;  2PW5 A;  4F8M A;  1WOC A;  1I4P A;  2JK8 A;  5AJ3 Q;  3I4M B;  2XGT A;  3S15 B;  1PTO C;  4KJN A;  1BOS A;  1SYC A;  1J5E Q;  4BY1 H;  1TWH H;  2WAQ E;  3AU7 A;  4KD3 A;  5M5X H;  5IYC G;  4FF4 A;  3TS2 A;  4UP9 A;  4R8N A;  3Q22 A;  3NBI A;  2B2Y A;  1K0S A;  2KED A;  5GAE C;  2AHO B;  3F2B A;  4PMC A;  3I4M G;  1N34 Q;  1L1O B;  2JA6 H;  1AN8 A;  3M85 A;  3TRE A;  1CKN B;  3HOW B;  5M3M B;  2PW7 A;  3F8T A;  3R3O A;  1B4O A;  3GP7 A;  2RDF A;  4TRD A;  1HUN A;  1DZ1 A;  1B9M A;  2DY7 A;  1BDO A;  2B39 A;  1CA5 A;  1X3E A;  2L0C A;  1SYE A;  4BBS H;  2Z6K C;  2R61 A;  1F2Y A;  2K1B A;  4APV A;  3JAM c;  1NR4 A;  3CCJ A;  1HNX Q;  5D65 A;  3HOW G;  2RCF A;  5M3M G;  1TY2 A;  4DUY L;  1XYI A;  1KL9 A;  5C3E G;  3PIP 3;  1VS0 A;  3NEN A;  2E2J H;  1FD7 D;  4LF8 L;  2ZXP A;  5JJL A;  3U4Z A;  1L0Y B;  1OXV A;  5C3E H;  3X3N A;  5JJI A;  1HRJ A;  2N8N A;  1NMF A;  4NXM Q;  3TRZ A;  3K7A B;  1K3R A;  2L4N A;  1WJJ A;  3PV0 A;  2AWN A;  1PA6 A;  2IX1 A;  4DR5 L;  1FYC A;  4K8I A;  4HIK A;  2EJG C;  3TDQ A;  1V1P A;  4CDD C;  1HQM C;  3AQQ A;  1ZKO A;  3I7F A;  1MD2 D;  5I9P A;  4OIJ A;  2OEO A;  1HUM A;  4LFB L;  2F4V Q;  1PRT B;  5T1I A;  1PDQ A;  3PF4 A;  3DEO A;  5GAD C;  3D6C A;  3KLS X;  5DEH A;  2HHH Q;  1CHP D;  3STB D;  5LMN Q;  2J4X A;  4CJ0 B;  1QIL A;  2PNR C;  4C2M B;  2CW0 C;  4NXN L;  4EQP A;  4XDX A;  4DR3 Q;  3BDL A;  2VY3 A;  4B3S L;  3RN5 A;  3FHW A;  4YCU A;  5AFW A;  2VS1 A;  1QG7 A;  1ENC A;  2CH4 W;  1YI2 A;  1KDA A;  4K0K L;  1SAP A;  2EYJ A;  4CJ1 B;  4IFD H;  2K28 A;  2M00 A;  4O1N A;  1JB3 A;  1WTQ A;  3MXN A;  2WIN B;  4JBW A;  3MEH A;  3OW7 A;  4QGU A;  1H9R A;  3A8J E;  3MWY W;  2IY5 B;  5JPN C;  4DNI A;  5ELE A;  4K5X A;  2XNA C;  3IRB A;  4MNO A;  5DM6 3;  1OTC A;  5EBC A;  5E4W C;  3R93 A;  2BA0 A;  3FKI H;  1XMQ Q;  5IOC A;  4IOC A;  1EOV A;  2JA8 H;  2B3G A;  4P74 A;  1TY0 A;  1AP0 A;  2A6E C;  1TKW B;  1Q1E A;  4A3F H;  3H6M A;  3HRZ C;  3MFY A;  4K5W A;  4RWS C;  4P2C B;  2WP8 J;  1R4P B;  2UUA Q;  4DR1 L;  3U4V A;  3NTI A;  2B2U A;  1VQN A;  3QJY A;  4OO1 I;  1BCP F;  1HA6 A;  3J80 E;  5FLX c;  5M3F B;  2NVX B;  3HOU B;  1A3U A;  1ZYR D;  2L15 A;  3H94 A;  4WJ4 A;  4C3I B;  2XRQ D;  3FRP B;  4YWM A;  5I2Y A;  1IBK L;  1STY A;  4JBM A;  4A3M B;  4IPG A;  2NVQ H;  4K8J A;  3MEF A;  3VR2 A;  3PO2 H;  1PRT D;  3U9O A;  1PFM A;  1QUQ B;  3PGZ A;  3G71 A;  3KOJ A;  5M3F G;  2B63 H;  5FJ8 G;  4JCV E;  1I4Q A;  4QIW E;  4DR4 Q;  3HOU G;  2XWB B;  4IPD A;  3MVV A;  1GM5 A;  1X3G A;  2F0E A;  3U9S A;  3CPF A;  3HZX A;  4DV5 L;  5FJ8 H;  3A7A B;  4ZUI A;  5IGG A;  4A3M G;  3GTM B;  2N3S A;  2ALY B;  4ZAI A;  4UDU C;  3TN2 A;  2K01 A;  5BR8 Q;  4DV1 Q;  4UP7 A;  2OTL A;  4J1M A;  3HKZ E;  2OQK A;  2LMC B;  1FR3 A;  2D5D A;  4H7B A;  5DM7 3;  5M5Y B;  1TS5 A;  4LF9 L;  1DON A;  1G6P A;  3I4N B;  3QG1 A;  5KIX A;  4A3L G;  4DV6 Q;  3OMC A;  3E0E A;  5IGE A;  3ULJ A;  2ASB A;  4DAM A;  1EWH A;  4IUN A;  1IBL L;  2V1C C;  1PH4 A;  1K83 B;  3H15 A;  4N8F A;  1EQQ A;  5C44 B;  2PYK A;  1HNW Q;  3TP5 A;  2I0Q A;  4DV7 L;  2KCC A;  3UDG A;  4RGM A;  2PQA A;  5C4J B;  2NWG A;  2UUC L;  3I4N G;  4XQJ A;  4AYB B;  2GA4 B;  2F0H A;  3G48 A;  4YWL A;  3D4D A;  2UXB Q;  2N55 A;  2F0J A;  4GLV B;  3OW2 A;  3J7A V;  2PO4 A;  1VQL A;  2WB1 B;  5C44 G;  1FGB D;  4N8X 1;  4ZLT F;  2PZT A;  3K80 C;  2Q8I B;  4A3D H;  5C5M A;  5FO7 B;  1CSQ A;  5AJ3 L;  3L2P A;  1ASY A;  1SEB D;  1GHJ A;  2PQA B;  1OXU A;  3TP8 A;  1VQM A;  1E1T A;  1FJG L;  5HGT A;  1N33 Q;  5ELO A;  4IN3 A;  4HJ7 A;  2A6H D;  5BN4 A;  4V19 0;  2WB1 G;  3CME A;  2E8G A;  2IT1 A;  2OCE A;  4IJL A;  2UU9 L;  4GKJ L;  2O4X A;  2CKZ B;  1U4L A;  2EIF A;  3S1N H;  1ESR A;  5KND A;  1GUS A;  2B2W A;  4EGV A;  3NE5 B;  1N34 L;  5K5P A;  1GJX A;  3PUX A;  4S3S A;  3V05 A;  5KNC A;  1YNN D;  2K7V A;  1CQF A;  4TKO B;  1IW7 D;  4OWT B;  2LS0 1;  2EXZ A;  3K59 A;  1N36 Q;  3J81 i;  5FO9 B;  1ZEQ X;  3NWS A;  1HFN A;  2OQ0 A;  4OL7 A;  3EQL C;  1PTO B;  4G7H C;  5IWA L;  2IX0 A;  3M4O H;  1KHI A;  3ONA B;  1A0I A;  1GVP A;  1HR0 Q;  1A62 A;  5IP9 G;  3DM1 A;  1PXU A;  1IYJ B;  4A3I B;  5EPK A;  1VCI A;  1LLR D;  4HID A;  1V8Q A;  1TWG B;  3T56 B;  1A2T A;  4K2K A;  1VDZ A;  4A93 H;  1EFW A;  3RLO A;  2NVT B;  5DNF A;  1SMY D;  5FO8 B;  5BN5 A;  4B9X A;  3JAM E;  2B2T A;  2QKI C;  1ILP A;  1VQ6 A;  4LAA A;  3HOY H;  1SLJ A;  2BH8 A;  3WDN A;  3ULP A;  2FMM A;  4B3M Q;  1VQ7 A;  2VQF L;  4NXM L;  4A3E G;  2K5Q A;  3BVG A;  4A3I G;  1EEI D;  1EFI D;  1HTL D;  1STB A;  3QO2 A;  2HCI A;  3V2T A;  4A3E H;  1PVO A;  4DNR B;  2KUM A;  2F0I A;  5GAH C;  1CTM A;  1EY4 A;  3HOX B;  1JOK A;  2Z4I A;  1JWU D;  1PH8 A;  2DY8 A;  4Y7N H;  3CKI B;  3RR5 A;  4R4I A;  1GXD C;  3I55 A;  2JA5 B;  3KF8 A;  4DXF A;  2AQ3 B;  1HH2 P;  4EQN A;  3NEM A;  1B8A A;  2AQ2 B;  2BDN A;  1BKB A;  5IYD H;  2JN4 A;  3CP0 A;  3T1H Q;  5LHY 1;  3GTG H;  5EGT A;  1KIX A;  1SE4 A;  1L0X B;  5CV8 A;  3HOX G;  4ALP A;  1XPR A;  2M9V A;  5LMU Q;  2L9H A;  1JOQ A;  5FKA C;  4HJ5 A;  4DUZ Q;  2JA5 G;  2JSO A;  3A74 A;  4DN4 M;  4LFA Q;  5L37 A;  1H9K A;  5ELB A;  4X3K A;  2K03 A;  4EQO A;  3LX0 A;  4N9P A;  3PUZ A;  1G2S A;  5C0X J;  1F9R A;  1XTC D;  1W6K A;  4R1J A;  1YHB A;  3D6W A;  5A2Q E;  5EQ0 A;  1HQR D;  1YJ9 A;  4IO9 A;  1C8C A;  1PMR A;  1VQI A;  1JT8 A;  5EKK A;  1AE3 A;  1PTO D;  2R93 H;  1I4X A;  3MTS A;  3S9W A;  2F4I A;  1I4G A;  1PZI D;  2IPK D;  2F1M A;  4HCE A;  1FNW A;  1KAA A;  1X3P A;  3OIP A;  5IY0 A;  1MHW C;  1BO0 A;  1NTG A;  2ENB A;  4EVO A;  4A3K H;  1Z6H A;  4DFA A;  3S14 H;  2AQ1 B;  2NTS A;  3RZO H;  1TWA B;  3K58 A;  4XYO A;  3I90 A;  2UUA L;  1YNX A;  4DAP A;  3FVQ A;  3S16 H;  1VF7 A;  3OWE B;  4JI1 L;  3S2H B;  5M5W B;  4BBR H;  3HEJ A;  1VF5 C;  3NHH A;  2HDL A;  3S2D H;  4GN5 A;  1QZH A;  5FLX E;  4BXX H;  2F0F A;  4A3J H;  3HOV B;  1IYV A;  3LWU A;  4XQN A;  4IUV A;  1VQP A;  4KY5 A;  1YEZ A;  4OO1 H;  2L1B A;  1ML0 D;  2ZTC A;  4DR4 L;  1QWY A;  4X3S A;  3I70 A;  4JI8 Q;  1IKM A;  3KBX A;  2CWP A;  4FF1 A;  5G3L F;  3RNU A;  1X3Q A;  5K36 G;  1PFS A;  2KEE A;  5BR8 L;  2YV5 A;  4KKT A;  5IOD A;  4DAV A;  4R9W A;  1U4M A;  4PMW A;  1TWF H;  2XWJ B;  1WCM B;  5ELC A;  3DEP A;  2CQO A;  5K36 H;  1EYA A;  5CV5 A;  3UI2 A;  1RD9 D;  3GQB A;  1EU3 A;  4DV6 L;  4HR7 B;  2HUG A;  4BY7 B;  1VQD A;  1QB5 D;  1KDC A;  1VQK A;  4X65 Q;  5IT9 L;  4DV3 Q;  1VQE A;  3DWQ A;  4ZQ3 A;  4XQQ A;  1VQB A;  3GTL H;  1WFQ A;  2E2H B;  2CW0 D;  5I4D A;  3K8A A;  1WCM G;  1LUZ A;  1PH6 A;  1HXY D;  2QCP X;  5C3W A;  3H3V H;  1QVF A;  2EYO A;  4QB4 A;  4BY7 G;  1TWC H;  2IJ0 A;  4L63 B;  3I91 A;  5CC4 A;  3KK7 A;  4RFB A;  4DR6 Q;  1B7Y B;  3FPP A;  4XIG S;  3J80 i;  1JE5 A;  2I5L X;  4X3T A;  2HQL A;  2R7F A;  2LSS A;  1ROD A;  1PH1 A;  3NK9 A;  4A3B B;  1DYQ A;  1PTO F;  2P5Z X;  3IFT A;  2JEB I;  1N33 L;  2OF1 A;  3J81 L;  1SMX A;  1STN A;  1SYD A;  3MZ5 A;  1A15 A;  3K5M A;  3D0F A;  1R4Q B;  4ZUJ A;  1HNZ Q;  1X65 A;  1NR2 A;  2E76 C;  3HGB A;  3OYY A;  4J6H A;  2A6E D;  4GNX C;  1QCB D;  5HY6 A;  4X64 L;  4A3B G;  4AH6 A;  1G6Z A;  4YWK A;  2WB1 E;  2VZA A;  4GKK Q;  2UUB Q;  2NUC A;  1UE1 A;  1CFM A;  4IUQ A;  1N36 L;  4N9T A;  5CYU A;  4CGY B;  2NTT A;  1EZ6 A;  1I6H B;  1D5X C;  3GD7 A;  2RQX A;  2EYM A;  1K8A C;  1ENA A;  3S1M B;  3VDY A;  1E0B A;  1CKN A;  1V43 A;  4X66 L;  2YTY A;  3ND8 A;  4RAU C;  2B2V C;  1CZG A;  1V1Q A;  1N9W A;  2EY1 A;  1V9P A;  3LWE A;  4QY7 A;  3KF6 A;  3TZD A;  1I3Q H;  5C0X G;  5F2D A;  3A0J A;  3V96 A;  3NBH A;  2EZV A;  4K6D A;  2F3W A;  3P75 A;  3GTJ H;  4JI2 Q;  3GTQ B;  5ELD A;  4DV2 Q;  1N8R C;  3CCU A;  3DWA A;  4GLX A;  3K7U C;  4B3M L;  1TT2 A;  2PZW A;  2K5W A;  2VNU D;  5IYC H;  3DWP A;  5C4Z A;  4OX9 Q;  4XYQ A;  4MN3 A;  2UXD Q;  1EUJ A;  2KCM A;  3I4M H;  1ONL A;  1JCK B;  2K33 A;  3KF6 B;  3S15 H;  1QNU A;  3U58 A;  2JA7 B;  1MBY A;  2SNM A;  4LF5 Q;  1XNQ Q;  2IHF A;  4DV4 Q;  3M4Y A;  2BDO A;  3NBH B;  4F7X A;  1PYS B;  1SSO A;  2DGY A;  3C1E A;  5IGD A;  3PO3 B;  3D4W A;  3CCR A;  2C5C A;  4L5S A;  4DR2 Q;  3OTO L;  4CKC A;  1EY8 A;  1SR3 A;  4POF A;  1WI5 A;  4DR7 Q;  3PUV A;  3SEB A;  3CW2 C;  2A69 C;  4L5T A;  1DOL A;  2JA7 G;  2M2L A;  4LF4 Q;  3HOW H;  1SRU A;  5M3M H;  3RD4 A;  4HSP A;  1K8M A;  2BH2 A;  3PO3 G;  1QZG A;  4DUZ L;  2KJX A;  2EXD A;  1AFP A;  4JK1 C;  2NBF A;  3PSI A;  3CF5 A;  4LFA L;  2HIV A;  2GVB A;  5LL6 S;  3T16 A;  5J1Z A;  3J81 j;  1XXG A;  2ICE C;  4NPS A;  4B3T Q;  3E5S A;  4R4C A;  2F0S A;  3VR6 A;  2J0T D;  2LXJ A;  2KOL A;  2MFI A;  4LWC A;  4AQY L;  1HZC A;  1KNE A;  1LTL A;  3M4Q A;  3MXP A;  5KNB A;  2AMC B;  1UWV A;  1MI2 A;  3EN2 A;  3K7A H;  4RKL A;  3T1Y Q;  4Q5V A;  1E22 A;  2JE6 I;  1HFG A;  2JP1 A;  3W2D A;  5IGB A;  4DV0 Q;  4K6L A;  2K75 A;  2DNC A;  1PH3 A;  3CU7 A;  2HD3 A;  1JMC A;  2UXC Q;  4JYA Q;  4RCN A;  4O42 A;  1TII D;  2K50 A;  1M1K C;  1ZXT A;  1EQV A;  2VXW A;  4JI5 Q;  1CK1 A;  5EJW A;  3I56 A;  1SJH D;  3QB3 A;  3R2T A;  1Q7Y C;  1MJE A;  3L0O A;  1VQG A;  5I2X A;  4C2M H;  4BS9 A;  2QF7 A;  2PMZ B;  2YU9 B;  1BVS A;  2E74 C;  4OWW B;  3MA2 B;  3ND9 A;  1SBB B;  5KRU A;  1QJO A;  2PPB C;  1B3Q A;  4QUC A;  3CMA A;  1M8A A;  2F0K A;  2NN6 G;  4RGT A;  4WRD A;  4JPB W;  1QUQ A;  3CRK C;  4DK0 A;  2NYZ D;  1LTB D;  3BYY B;  1I5F A;  3A56 A;  1S40 A;  2I5M X;  4JI3 L;  2ZXR A;  3HOZ B;  1TS4 A;  2A73 B;  2C35 B;  3GTP B;  1HCZ A;  3TSS A;  4JOI A;  4A3G B;  3EBE A;  4KMU C;  2H1E A;  5IE8 A;  2K5D A;  4C3J B;  1SNM A;  3G7L A;  2F0V A;  2E2I B;  1LT6 D;  1GUT A;  3B6Y A;  4OON A;  1Q8I A;  4DK6 C;  1D1K A;  1TS2 A;  2RBM A;  5E3F A;  4Y52 H;  4DU9 A;  3A5Z B;  4DV3 L;  3J80 L;  2EE1 A;  1IBM L;  2PQE A;  3AB9 A;  1D5M C;  3HOZ G;  4IPH A;  4NMZ A;  1UE6 A;  4A3G G;  1GKH A;  3MXG A;  1RIP A;  2ATW A;  4C3I G;  4C3J G;  1EYG A;  1Y1V B;  2Z8L A;  4YY3 Q;  2KCN A;  5M3F H;  4P73 A;  5FOB B;  3JC6 6;  3CCE A;  2NVX H;  3SHL A;  1CSP A;  2WFW A;  4FVM A;  3HOU H;  3K6O A;  4C3I H;  2NZH A;  3E3X A;  4FF2 A;  3WWV A;  3S1Q B;  4IUU A;  1EIG A;  4LF7 Q;  1PZK D;  3BZD B;  5IT9 c;  4YCV A;  1CI3 M;  4KY6 A;  4A3M H;  3H3V I;  2RSN A;  4H02 A;  2RDH A;  2JA9 A;  5HUR A;  1AE2 A;  2PNH A;  5C4H A;  1Y1V G;  1A63 A;  4OEL B;  1A8V A;  1K0R A;  1B9N A;  4A3L H;  1IL2 A;  1I4R A;  1Y14 B;  4BA2 I;  3H09 A;  1DD2 A;  1SYB A;  1GUG A;  5LMN W;  1BCP C;  5CR3 A;  1N32 L;  3OSO A;  2EVB A;  3GTM H;  1C48 A;  2HCC A;  4ULL A;  1Q46 A;  4X62 Q;  1H95 A;  4I65 A;  4RHR A;  1EY0 A;  1X3F A;  5ELF A;  4OHJ A;  4JI4 Q;  2TSS A;  2IHE A;  1IZ6 A;  3N6R A;  3RLN A;  2ICI A;  1CKO A;  1BBW A;  5M5Y H;  2MNA A;  1JOR A;  1T5E A;  1Q12 A;  1IL8 A;  3I4N H;  1SE3 A;  4LUZ A;  2JEA I;  1WTH A;  4GOP C;  3J81 c;  3URY A;  1JWM D;  3CQZ B;  1RKN A;  1K83 H;  3KFU A;  2KQ3 A;  2EYF A;  3R8B A;  5C44 H;  2MGS A;  4AYB G;  4KHP Q;  4CJ2 C;  4C3H B;  1K8O A;  4M8A A;  4LF6 Q;  3K5N A;  1BQQ T;  3K5L A;  4ZCK A;  4KJO A;  5C4J H;  1J5E L;  1E2V A;  2GVA A;  4IZ8 A;  3AYH B;  1MSG A;  4HN7 A;  4JI2 L;  2B8F A;  2G9D A;  1XX8 A;  2KCT A;  1Z9F A;  3I2Z A;  4DV2 L;  3U50 C;  2AWO A;  2J7Z A;  1LM0 A;  2LKV A;  3CC7 A;  2MP1 A;  4C3H G;  3ERS X;  2R92 B;  2ZJP A;  2UXD L;  1ICW A;  1VQO A;  1LTI D;  3J7Y W;  4DK3 C;  1AW7 A;  4WOR A;  2I5H A;  4IAL A;  1RCV D;  4YHH Q;  1YVC A;  1LV9 A;  5C0X I;  1YJW A;  4LF5 L;  1XNQ L;  1FNU A;  2Z6K A;  1VMP A;  3CCM A;  1O7Z A;  1I50 B;  1JJ2 A;  4DR2 L;  1STH A;  1PRT F;  1XPO A;  1I94 Q;  1HNX L;  2R92 G;  2FXQ A;  4DR7 L;  2H5X A;  1GUN A;  4GLA C;  3R2I A;  3GV3 A;  2X69 A;  4HJA A;  1CA6 A;  5IP9 H;  2NVY B;  3C2P A;  1PH2 A;  1L1O C;  2QW7 A;  3RUZ A;  4R4O A;  4Q0F A;  4LF4 L;  4X6A H;  1EZ8 A;  1EQR A;  1WD0 A;  1YHQ A;  4KK7 A;  3D3R A;  1XMO Q;  3ITP A;  3M4P A;  5EBD A;  2Q2T A;  1J8I A;  4MTN A;  1PTO H;  4QJF A;  2L5T A;  1BR9 A;  1O78 A;  5GQO A;  1RTN A;  5E1F A;  2X6L A;  1MIU A;  3SDZ A;  2B2Y C;  4U68 A;  4A3I H;  1O7L A;  4C56 C;  2CWA A;  2F4V L;  3VR3 A;  4O2D A;  1TWG H;  5KGU A;  1EIF A;  1F2L A;  2E5L Q;  2NVT H;  2K14 A;  2HHH L;  1R9T B;  2R3Z A;  3L3O C;  1WD1 A;  5LMN L;  2R7Z B;  2QIL A;  2JYO A;  1LTT D;  1U9R A;  4KLK A;  4ZYS A;  1Q86 C;  1EL0 A;  2DJF C;  2K5H A;  5I6W A;  5CBA E;  3NWT A;  3T1Y L;  2DNE A;  4DR3 L;  1NJI C;  1H9J A;  1EY7 A;  4DV0 L;  1Y8P B;  1O7Y A;  1STG A;  3PCO B;  3TBI B;  4G4K A;  4G7O C;  2ZT9 C;  3PQI A;  1UE7 A;  5IYB G;  3M7G A;  4LJZ C;  5E7N A;  2UXC L;  2Z0S A;  4JYA L;  2MO1 A;  4FXD A;  2R7Z G;  1X32 A;  2EPB A;  3VR4 A;  3HOX H;  3Q24 A;  4H0L C;  3RZD B;  5IYB H;  2ZXO A;  1ESF A;  3ICE A;  4OEM B;  1HA5 A;  3PMF A;  2JA5 H;  2FMC A;  2AUK A;  1CM9 A;  1NAP A;  3OMG A;  3SK4 A;  3E0J A;  4FYD A;  3MC0 B;  4JI0 Q;  5JVH 3;  1Y1W B;  1X56 A;  1QOH A;  4KKU A;  2NB0 A;  1XMQ L;  2RVL A;  1NCV A;  2KHJ A;  1B1Z A;  2NZ1 D;  5IGC A;  4DR5 Q;  3TS0 A;  2O5J C;  1PH9 A;  3H91 A;  1EY5 A;  3S17 B;  1SNQ A;  3CCV A;  4NB3 A;  3S1R B;  1SFO B;  2E75 C;  2DN8 A;  4KV6 A;  4LFB Q;  1P8L A;  1VQ5 A;  4UY8 C;  1LTR D;  2WV6 D;  3SGI A;  1VQ4 A;  1Y1W G;  3IKJ A;  5C4X B;  2EYL A;  4LUO A;  2XN9 C;  2C9O A;  5JVG 3;  1Q82 C;  1Y8N B;  1YIT A;  3EVQ A;  1Z7T A;  4NP5 A;  5TSS A;  4HJ8 A;  4MTK A;  4FXG C;  1SDF A;  2PMZ E;  5J39 A;  4ZKC B;  3DM3 A;  4XXE A;  4IUT A;  3NP8 A;  2KEN A;  2K4K A;  1DOK A;  3WOE A;  5C4X G;  2SEB D;  2Z9H A;  1JR0 D;  1Y8O B;  1PYB A;  1HR0 W;  5D3D A;  1VQH A;  1TWA H;  3ULL A;  2A69 D;  4K5V A;  1OXS C;  4DK1 A;  1T5X D;  1HTP A;  5JJZ A;  2D2C C;  3NUC A;  4YY3 L;  2ZJR A;  2A8V A;  2F0Q A;  5ISR A;  1QE6 A;  1RHP A;  1SRO A;  5M9O A;  5FLX L;  3S2H H;  2JQO A;  2ZTE A;  2RCN A;  4OWX B;  5M5W H;  2FFK B;  1VMC A;  2LY7 A;  3N52 A;  3HOV G;  3CXC A;  4IPC A;  1SYG A;  4DV1 L;  4GN3 B;  1D2B A;  1I6V C;  4MZ9 A;  4LF7 L;  1LAC A;  2CH4 A;  2YTX A;  4J15 A;  3KDF B;  3J80 c;  1H9S A;  3K0Y A;  3PIO A;  4HMJ A;  2WAC A;  4I7Z C;  3HOV H;  3GTO B;  1OO9 B;  3GTK B;  2VUM B;  3H0G B;  3K0X A;  2A68 C;  2Z6B A;  4KHV A;  3FMC A;  4YIJ A;  2V4D A;  2B2U C;  1DXM A;  4DR1 Q;  1BBX C;  4JI7 Q;  1EWI A;  1EU4 A;  5IT9 E;  1HNW L;  1G51 A;  4F88 A;  4Z9C B;  4H13 C;  1EEF D;  2L11 A;  4DF7 A;  1D8L A;  1KXL A;  1SN8 A;  2QDL A;  2RA4 A;  4JC0 A;  5GAG C;  1QVG A;  4IFD J;  3H0G G;  3DLL A;  2UXB L;  3I72 A;  1WVL A;  1G29 1;  1H9S B;  3I73 A;  5J3B A;  1S3O A;  4NW2 A;  1WCM H;  4KN7 C;  1B44 D;  4KI0 A;  2EOT A;  3SXH A;  4BY7 H;  2EJF C;  1C9O A;  4ODG A;  2L55 A;  3M3Y B;  1JQY D;  3C1F A;  4I7A A;  3ERQ A;  4GZY C;  5C3X A;  4IJH A;  1STE A;  5C6A A;  3K57 A;  1NY4 A;  2E2H H;  4JVZ A;  2CHB D;  5T1G A;  3SK6 A;  3SK8 A;  3L9A X;  1CZW A;  1JJC B;  1JJG A;  1II3 A;  4TQU S;  2WII B;  4HCS A;  4L5Q A;  4PG3 A;  4AYB E;  2R7D A;  3DHQ A;  5FLM G;  1C4Q A;  4RH6 A;  3CC4 A;  4PZ7 A;  2ZM6 Q;  4UPA A;  1PLF A;  1E2Z A;  1CQV A;  4A3B H;  5JEA G;  1E3P A;  2EJM A;  4K14 A;  5EPJ A;  2MO0 A;  3RMH A;  2EYH A;  4KTA A;  1F2M A;  1SE2 A;  4DV7 Q;  2G9H D;  3IL8 A;  3WOF A;  3J7A 5;  2A19 A;  3EFX D;  3UE0 A;  1HR0 L;  1KDB A;  2UUC Q;  4MIU A;  4BY1 B;  1TWH B;  4FXK C;  5M5X B;  3A7L A;  2VQE Q;  3VA5 A;  1KAW A;  2HIX A;  4L5R C;  2IW3 A;  3MXU A;  1XWE A;  1TQO A;  2DUD A;  2JA6 B;  4EX5 A;  1VQ8 A;  3A8K E;  2AKW B;  4BA1 I;  1X54 A;  4XT3 B;  4CKB A;  2BE5 C;  5C0X H;  1LAB A;  1A3V A;  1MGS A;  1NSN S;  3VA7 A;  1I6H H;  5GRO A;  1XMO L;  3BDO A;  1E2W A;  4BY1 G;  1K28 A;  3SK5 A;  4DKA C;  3S1M H;  1FJG Q;  1WTO A;  1BNZ A;  3W5O A;  2IL8 A;  4BBS B;  3I8Z A;  2FIN B;  3BZK A;  1U4P A;  2UU9 Q;  5EKL A;  4GKJ Q;  3A5U A;  4A4I A;  4FNF A;  2JA6 G;  1UAP A;  1VQA A;  4HED A;  3PIP A;  2B2W C;  2XVS A;  3Q0A A;  2PI2 A;  4LW1 A;  4IUP A;  1IYU A;  1A2U A;  3T4A C;  3P1H A;  5CV6 A;  2E5L L;  1ET9 A;  2EY2 A;  2KHI A;  2WKC A;  3C46 A;  4POG A;  2E2J B;  3GTQ H;  3A8I E;  4BBS G;  1VQC A;  5JPM C;  1AH9 A;  5C3E B;  3SVM A;  4A3C G;  4KHZ A;  1YJN A;  1DM0 B;  5DLQ E;  3Q23 A;  3T1H L;  1BCP D;  1TVX A;  5IWA Q;  3OOC A;  4A75 A;  3KYH C;  3I4L A;  5LMU L;  1LT5 D;  4A3C H;  2OTJ A;  3G6E A;  2SNS A;  3UDI A;  3ZYY X;  2NZO A;  4P71 A;  5CBE E;  4HIM A;  3VYS A;  2JA7 H;  2ZJQ A;  3NQT A;  1PHJ A;  4QL5 A;  3TP7 A;  3PO3 H;  5A35 A;  5CV9 A;  2B2T C;  3KLS A;  1KQS A;  4CDF C;  3P20 A;  1JIC A;  1PH7 A;  2QA4 A;  1D6E C;  3ERO A;  3FPU B;  3T51 B;  3HKS A;  2GN5 A;  4JI0 L;  3QIA A;  3CCL A;  3TQY A;  3Q6S A;  2XTI A;  1SXT A;  1S5D D;  1Z47 A;  2FJ2 A;  2VQF Q;  2F0P A;  1LTA D;  1M4V A;  1D5Z C;  2PCF B;  3E9I A;  2EY6 A;  1AZP A;  4ZRZ A;  2A1A A;  2YTV A;  4DGZ A;  4XTC S;  1J6Q A;  1RJT A;  2H4O A;  3I3C A;  4QF4 A;  1BXT A;  1M90 C;  1DGS A;  3UDF A;  2F3V A;  3VR5 A;  4C1N I;  3JAM i;  1VQF A;  4P75 A;  4DA2 A;  1K8G A;  3FP9 A;  1E1O A;  1TR5 A;  2RHQ B;  3D8G A;  1YBY A;  3RLF A;  1B50 A;  2KEC A;  2MHV A;  1U5K A;  1L0W A;  4IQZ A;  3MAQ A;  4IFD G;  3FKI B;  1RF2 D;  3S24 A;  1WYD A;  1V1P B;  1VQ9 A;  1SYF A;  1PZJ D;  4RKB A;  4PQX A;  5C5L A;  4JBJ A;  1S5E D;  2JA8 B;  1EYD A;  3MFG A;  2K52 A;  4A3F B;  1NE3 A;  5J22 A;  3CD6 A;  3OPO A;  4FF3 A;  2O5I C;  1S5B D;  3VYT A;  1Q90 A;  1CHQ D;  3FKI G;  4HTH A;  5CV4 A;  5IP7 G;  3NXW A;  5COY A;  4B3R Q;  1YNJ C;  4JI8 L;  3NTK A;  4JI6 Q;  2JA8 G;  3BYT B;  1F2Z A;  1HJP A;  1B70 B;  4J8Q A;  5IP7 H;  4A3F G;  1NMG A;  1KTK A;  2NN6 H;  5EKI A;  3W1G A;  4HAE A;  3MXN B;  4WJW A;  2OWO A;  2NVQ B;  1SNC A;  2YU9 H;  3PO2 B;  1TU2 B;  3OIQ A;  3ER0 A;  1G91 A;  3NQI A;  1E7Z A;  2ID0 A;  2B63 B;  5NUC A;  2KA7 A;  3K81 C;  1EIH A;  3E9H A;  4X65 L;  3NSW A;  3G4S A;  1X55 A;  4JI7 L;  4R8I A;  2RSO A;  2KHS A;  4RGN A;  1JOO A;  3KLW A;  2D9U A;  4JI1 Q;  1YIJ A;  4UHV A;  3VYR A;  4U67 3;  1F9P A;  2A74 C;  2MJ8 A;  3HFZ B;  1SJE D;  2CVR A;  3DXJ C;  3BS1 A;  3PO2 G;  1HZ9 A;  2Y0S B;  4CDE C;  5BN3 A;  3H3V C;  2L12 A;  4HMI A;  3HOZ H;  1F9S A;  3GTP H;  3GO5 A;  1B2T A;  5KYI A;  2B63 G;  4A3G H;  2BCO A;  1Q3L A;  4C3J H;  4DR6 L;  2E2I H;  2CFM A;  2JJQ A;  4ZK9 B;  1D1I A;  1Y69 U;  1QNK A;  3J7Z C;  3E6Z X;  4QCL A;  1LO5 D;  5IGF A;  1GHK A;  1V1O A;  2Y0S G;  5D14 A;  2F0O A;  5JAV A;  3FEW X;  4PMB A;  5CMD A;  1HNZ L;  1KD1 C;  4YCW A;  3GDE A;  1Y1V H;  3HS0 C;  4PNY A;  1ASZ A;  1ILQ A;  3Q8D A;  4G57 A;  1ICF B;  2K5N A;  2Z1C A;  3I4O A;  4XT1 B;  1KNA A;  4JG2 A;  4UAI A;  4GKK L;  4GNX A;  4JW0 A;  1SE8 A;  3S1Q H;  2UUB L;  1EOT A;  4V0B A;  2ZM6 L;  2F0G A;  4A3D B;  2D62 A;  1KLU D;  4NDX A;  2OT2 A;  3BU2 A;  1PH5 A;  4ME3 A;  4LMQ D;  3HG9 A;  5CGK A;  5COR A;  5D3I B;  4LFC Q;  3NEL A;  2D0P A;  4P72 A;  5LL6 X;  1U4R A;  3EIV A;  1GUO A;  1IXR A;  4A76 A;  2VQE L;  3PUW A;  2ZTD A;  3NTH A;  4PV1 C;  3S1N B;  2I07 B;  3M9B A;  2B2V A;  4A3D G;  1U0L A;  1LTG D;  4RGO S;  4GNX B;  3RN2 A;  4B9W A;  3M7N A;  1HPC A;  3W3A A;  3IAY A;  5I9O A;  3L7Z C;  4CKE A;  1GUW A;  3HP3 A;  2F0L A;  2EY5 A;  1VQJ A;  1FGU A;  3CQZ H;  4OX9 L;  2QDB A;  3STB C;  3BZC A;  4BWG B;  1STA A;  4CBV A;  4ME5 A;  3M4O B;  3TEH B;  3UE1 A;  1O80 A;  4F87 A;  2N88 A;  1TS3 A;  3QOJ A;  2IWH A;  4C3H H;  1WTP A;  4DV4 L;  1LT3 D;  1W2B A;  1B3A A;  4ILW A;  4LUV A;  1KAB A;  2WAQ B;  4DAY A;  2A68 D;  2XRS D;  4X64 Q;  3EJI A;  1Q8K A;  4A93 B;  4LNQ A;  5IIF A;  1SND A;  3X3M A;  3AEV A;  3BJU A;  1HHV A;  3CCQ A;  1GOZ A;  1X6O A;  3HOY B;  1G2T A;  4MHE A;  1JC7 A;  3F2C A;  3PUY A;  1GD7 A;  2F0W A;  1XNR Q;  4JBK A;  3TME A;  4RHS A;  3T13 A;  4JV5 Q;  1RTO A;  1LTS D;  2R92 H;  2WAQ G;  3TZU A;  2EDG A;  4X66 Q;  1S5C D;  4A3E B;  4A93 G;  3A55 A;  2OXP A;  4RMF A;  4DAY B;  2O2L D;  4DPG A;  4KY7 A;  3HOY G;  1WTR A;  1YZ6 A;  4Y7N B;  1O7I A;  4WJ3 M;  1G8Z D;  3DMU A;  4B3T L;  1I50 H;  4R4T A;  3JAM L;  5ELN A;  1ET6 A;  3LGJ A;  5EPL A;  4DXG A;  2NVY H;  2EQS A;  1W3S A;  1KRT A;  3PF5 A;  4FO2 A;  1L2F A;  3GTG B;  5I6Y A;  4NKL A;  1PYW D;  3KJP A;  1MJC A;  5G3L D;  3BVZ A;  2G5D A;  1S72 A;  1Q1B A;  4HIO A;  1UE5 A;  1WTW A;  2A5H A;  3ZJY C;  2PI2 E;  4E6I A;  5JEA J;  4HJ9 A;  1ZYR C;  3CCS A;  1KC8 C;  2B29 A;  2K32 A;  4OIK A;  1F77 A;  5IYD G;  1OXT A;  4HSV A;  3EA6 A;  3QR8 A;  3OTO Q;  4OGQ C;  1GO3 E;  3FDT A;  1CT1 D;  1UEA B;  1H9M A;  4C1N K;  5FK9 C;  4KN4 C;  1PRT C;  4DUY Q;  2D0O A;  5KYL A;  4WFN 3;  4JI5 L;  2KVM A;  4PZ6 A;  2FHT A;  1R9T H;  2R93 B;  2K6A A;  3KLR A;  3CAM A;  2R7Z H;  1KRS A;  4LF8 Q;  2F0U A;  1IKL A;  1K3B C;  5EAY A;  2TMP A;  2MUY A;  4G7Z C;  3G6J B;  4A3K B;  3S14 B;  1MSH A;  4IOA A;  1WTV A;  4B08 A;  4QUF A;  3SE0 A;  1K73 C;  2PZU A;  3RZO B;  3KF8 B;  2QEJ C;  1T9H A;  4KKS A;  3QOL A;  3W1B A;  2F03 A;  1JB7 A;  2K05 A;  2R93 G;  5A2Q L;  2BE5 D;  3OWF A;  3S16 B;  4B3R L;  4ID6 A;  1I4H A;  4GN4 B;  4IFD I;  3RZD H;  2VB3 X;  4JI6 L;  2VL6 A;  2RKS A;  4A3K G;  2SOB A;  4BBR B;  2XSC A;  4AQY Q;  2VW9 A;  1F9Q A;  3BDC A;  4GS3 A;  2JXM B;  3S2D B;  2DJG C;  3D4R A;  2SDF A;  4R4Q A;  1Y1W H;  5E4X A;  3DUZ A;  1ENF A;  4NXN Q;  2XIW A;  2QEX A;  1EWC A;  4A3J B;  4K2L A;  1EIY B;  3LNN A;  4B3S Q;  1NNX A;  4QQB X;  5HGQ A;  4RCO A;  1HZB A;  4K0K Q;  3CC2 A;  4ZKB B;  3S17 H;  4CDC C;  2Q2U A;  2ES2 A;  4H44 C;  2CQA A;  1SNO A;  4BBR G;  1SFO H;  3S1R H;  2NN6 I;  1LYL A;  1X9N A;  2Q8R E;  2VB2 X;  1C7Y A;  3KDF A;  1RL2 A;  5CV7 A;  5C4X H;  4BXX G;  4A3J G;  3T53 B;  4L8J A;  1J9O A;  4UP8 A;  4FP5 D;  2Q2H A;  1JE4 A;  1PFB A;  2BOS A;  3OHX C;  3AFP A;  4OO1 G;  3BG3 A;  1TWF B;  1FVI A;  1DOM A;  2RHS B;  2A6H C;  1A6X A;  2BA1 A;  5H1S E;  2IX3 A;  1LT4 D;  3SR1 A;  2MQH A;  2X6G A;  4IUR A;  4DNT B;  3KBG A;  1B53 A;  3QWN A;  1CUK A;  3GTL B;  4QIW B;  1YNN C;  1DJR D;  1IW7 C;  2E2D C;  3AFQ A;  3TP6 A;  1Q81 C;  3D31 A;  3CHB D;  4JOI C;  4JI3 Q;  1AEX A;  3CPW A;  1TWC B;  2Y0S E;  1QVC A;  1UNS A;  1WTX A;  2MPM A;  4ABN A;  2KBN A;  2HDM A;  1A3T A;  2B8G A;  1YHA A;  3HKZ B;  2LFN A;  4X62 L;  1BUV T;  3F2D A;  2VUM G;  1IHZ A;  4PZ8 A;  1XTD A;  1MKH A; 
#chains in the Genus database with same CATH homology
 1UUP A;  3AMU A;  3IFD A;  3K5O A;  3BVM A;  2Q8T A;  3P7J A;  4M1U B;  3NPP A;  1S4Z A;  3PIO 3;  1W6J A;  1SMY C;  2AUJ D;  2F0N A;  2YYZ A;  5DAU A;  2WKD A;  3GV6 A;  1EYC A;  1SNP A;  1BCP B;  3J81 E;  5JOB A;  1NUC A;  2EYP A;  1EY9 A;  1FNV A;  3F2U A;  2R6G A;  1KLG D;  2Z4H A;  4RA8 A;  1RDP D;  1YNJ D;  4TSS A;  4CHT B;  3A54 A;  3KUP A;  1S5F D;  4L6T B;  2RDG A;  1AZQ A;  2F0T A;  1OXX K;  1JWS D;  1EY6 A;  1I3Q B;  2F0M A;  2HQE A;  3CRL C;  4KD4 A;  1PFN A;  2I46 A;  5JEA H;  1DCZ A;  4LK1 C;  3MHB A;  4QMG A;  3GTJ B;  4X3U A;  2K04 A;  5KEE A;  3O13 A;  1EQT A;  1BF4 A;  3VYU A;  3C3L A;  3J7A F;  2F0D A;  2PW5 A;  4F8M A;  1I4P A;  3I4M B;  3S15 B;  1PTO C;  4KJN A;  1BOS A;  1SYC A;  3AU7 A;  4KD3 A;  4FF4 A;  4R8N A;  3Q22 A;  3NBI A;  2B2Y A;  2KED A;  4PMC A;  1AN8 A;  3M85 A;  3HOW B;  5M3M B;  2PW7 A;  3R3O A;  1B4O A;  3GP7 A;  2RDF A;  4TRD A;  1HUN A;  1DZ1 A;  1B9M A;  2DY7 A;  1BDO A;  2B39 A;  1CA5 A;  2L0C A;  1SYE A;  2R61 A;  1F2Y A;  2K1B A;  1NR4 A;  5D65 A;  1TY2 A;  1XYI A;  3PIP 3;  1FD7 D;  2ZXP A;  1HRJ A;  1L0Y B;  1OXV A;  3X3N A;  3K7A B;  2L4N A;  3PV0 A;  2AWN A;  2IX1 A;  1FYC A;  4K8I A;  2EJG C;  3TDQ A;  1V1P A;  1HQM C;  1ZKO A;  1MD2 D;  5I9P A;  4OIJ A;  2OEO A;  1HUM A;  1PRT B;  5T1I A;  1PDQ A;  3DEO A;  3D6C A;  3KLS X;  5DEH A;  1CHP D;  2J4X A;  4CJ0 B;  1QIL A;  2PNR C;  4C2M B;  2CW0 C;  4EQP A;  4XDX A;  3BDL A;  5AFW A;  1QG7 A;  1ENC A;  1KDA A;  1SAP A;  2EYJ A;  4CJ1 B;  4IFD H;  2K28 A;  2M00 A;  4O1N A;  1JB3 A;  1WTQ A;  3MXN A;  2WIN B;  4JBW A;  3MEH A;  3OW7 A;  1H9R A;  3A8J E;  3MWY W;  5JPN C;  5ELE A;  4K5X A;  2XNA C;  5DM6 3;  5EBC A;  5E4W C;  3R93 A;  2BA0 A;  5IOC A;  1AP0 A;  1TY0 A;  2A6E C;  1TKW B;  1Q1E A;  3H6M A;  3HRZ C;  3MFY A;  4K5W A;  4RWS C;  4P2C B;  2WP8 J;  1R4P B;  3NTI A;  2B2U A;  3QJY A;  4OO1 I;  1BCP F;  1HA6 A;  3J80 E;  5M3F B;  2NVX B;  3HOU B;  1A3U A;  1ZYR D;  3H94 A;  4C3I B;  2XRQ D;  3FRP B;  5I2Y A;  1STY A;  4A3M B;  4K8J A;  3VR2 A;  1PRT D;  3U9O A;  1PFM A;  1I4Q A;  2XWB B;  3MVV A;  2F0E A;  3U9S A;  3HZX A;  3A7A B;  4ZUI A;  5IGG A;  3GTM B;  4ZAI A;  4UDU C;  3TN2 A;  2K01 A;  4J1M A;  2LMC B;  1FR3 A;  2D5D A;  4H7B A;  5DM7 3;  5M5Y B;  1TS5 A;  1DON A;  3I4N B;  3QG1 A;  5KIX A;  3OMC A;  5IGE A;  1EWH A;  4IUN A;  1K83 B;  5C44 B;  2PYK A;  3TP5 A;  2KCC A;  4RGM A;  5C4J B;  2NWG A;  4XQJ A;  4AYB B;  2GA4 B;  2F0H A;  3D4D A;  2N55 A;  2F0J A;  3J7A V;  2PO4 A;  2WB1 B;  1FGB D;  4ZLT F;  2PZT A;  2Q8I B;  5C5M A;  5FO7 B;  1SEB D;  1GHJ A;  1OXU A;  3TP8 A;  5HGT A;  4IN3 A;  2A6H D;  5BN4 A;  4V19 0;  2IT1 A;  2O4X A;  1U4L A;  1ESR A;  5KND A;  1GUS A;  4EGV A;  2B2W A;  3NE5 B;  1GJX A;  5K5P A;  3PUX A;  4S3S A;  3V05 A;  5KNC A;  1YNN D;  2K7V A;  1CQF A;  4TKO B;  1IW7 D;  2LS0 1;  2EXZ A;  3K59 A;  5FO9 B;  1ZEQ X;  3NWS A;  1HFN A;  4OL7 A;  3EQL C;  1PTO B;  4G7H C;  2IX0 A;  3ONA B;  3DM1 A;  1PXU A;  4A3I B;  5EPK A;  1VCI A;  1LLR D;  1V8Q A;  1TWG B;  3T56 B;  1A2T A;  4K2K A;  1VDZ A;  2NVT B;  5DNF A;  1SMY D;  5FO8 B;  5BN5 A;  4B9X A;  3JAM E;  2B2T A;  2QKI C;  1ILP A;  4LAA A;  3WDN A;  2FMM A;  2K5Q A;  3BVG A;  1EEI D;  1EFI D;  1HTL D;  1STB A;  3QO2 A;  2HCI A;  3V2T A;  4DNR B;  2KUM A;  2F0I A;  1CTM A;  1EY4 A;  3HOX B;  1JOK A;  2Z4I A;  1JWU D;  2DY8 A;  3CKI B;  1GXD C;  2JA5 B;  3KF8 A;  4DXF A;  2AQ3 B;  4EQN A;  2AQ2 B;  2BDN A;  5LHY 1;  5EGT A;  1SE4 A;  1L0X B;  5CV8 A;  2M9V A;  2L9H A;  1JOQ A;  5FKA C;  2JSO A;  4DN4 M;  1H9K A;  5ELB A;  4X3K A;  2K03 A;  4EQO A;  3LX0 A;  4N9P A;  3PUZ A;  1G2S A;  5C0X J;  1F9R A;  1XTC D;  1W6K A;  3D6W A;  5A2Q E;  5EQ0 A;  1HQR D;  1C8C A;  1PMR A;  5EKK A;  1PTO D;  1I4X A;  3MTS A;  3S9W A;  2F4I A;  1I4G A;  1PZI D;  2IPK D;  2F1M A;  4HCE A;  1FNW A;  1KAA A;  1X3P A;  3OIP A;  1BO0 A;  2ENB A;  4EVO A;  1Z6H A;  4DFA A;  2AQ1 B;  2NTS A;  1TWA B;  3K58 A;  4XYO A;  3I90 A;  4DAP A;  3FVQ A;  1VF7 A;  3OWE B;  3S2H B;  5M5W B;  3HEJ A;  1VF5 C;  3NHH A;  2HDL A;  5FLX E;  2F0F A;  3HOV B;  1IYV A;  3LWU A;  4XQN A;  4IUV A;  4KY5 A;  4OO1 H;  2L1B A;  1ML0 D;  1QWY A;  4X3S A;  3I70 A;  1IKM A;  3KBX A;  4FF1 A;  5G3L F;  1X3Q A;  5K36 G;  2KEE A;  4KKT A;  5IOD A;  4DAV A;  4R9W A;  1U4M A;  4PMW A;  2XWJ B;  1WCM B;  5ELC A;  3DEP A;  5K36 H;  1EYA A;  5CV5 A;  3UI2 A;  1RD9 D;  3GQB A;  1EU3 A;  4HR7 B;  2HUG A;  4BY7 B;  1QB5 D;  1KDC A;  5IT9 L;  3DWQ A;  4ZQ3 A;  4XQQ A;  2E2H B;  2CW0 D;  5I4D A;  1HXY D;  2QCP X;  5C3W A;  2EYO A;  4QB4 A;  2IJ0 A;  4L63 B;  3I91 A;  5CC4 A;  3KK7 A;  4RFB A;  3FPP A;  4XIG S;  4X3T A;  1ROD A;  3NK9 A;  4A3B B;  1DYQ A;  1PTO F;  3IFT A;  2JEB I;  2OF1 A;  3J81 L;  1STN A;  1SYD A;  3MZ5 A;  1A15 A;  3K5M A;  1R4Q B;  4ZUJ A;  1NR2 A;  2E76 C;  3HGB A;  4J6H A;  2A6E D;  1QCB D;  1G6Z A;  2NUC A;  1CFM A;  4IUQ A;  4N9T A;  5CYU A;  4CGY B;  2NTT A;  1EZ6 A;  1I6H B;  1D5X C;  3GD7 A;  2RQX A;  2EYM A;  1ENA A;  3S1M B;  1E0B A;  1V43 A;  3ND8 A;  4RAU C;  2B2V C;  1CZG A;  2EY1 A;  3LWE A;  3TZD A;  5C0X G;  5F2D A;  3V96 A;  3NBH A;  2EZV A;  4K6D A;  2F3W A;  3P75 A;  3GTQ B;  5ELD A;  3DWA A;  1TT2 A;  2PZW A;  2K5W A;  2VNU D;  3DWP A;  5C4Z A;  4XYQ A;  4MN3 A;  1ONL A;  1JCK B;  2K33 A;  1QNU A;  2JA7 B;  1MBY A;  2SNM A;  3M4Y A;  2BDO A;  4F7X A;  1SSO A;  3C1E A;  5IGD A;  3PO3 B;  3D4W A;  2C5C A;  4CKC A;  1EY8 A;  3PUV A;  3SEB A;  2A69 C;  1DOL A;  2M2L A;  3RD4 A;  4HSP A;  1K8M A;  2KJX A;  1AFP A;  4JK1 C;  2NBF A;  5LL6 S;  3T16 A;  5J1Z A;  1XXG A;  2ICE C;  3E5S A;  2F0S A;  3VR6 A;  2J0T D;  2KOL A;  1KNE A;  3MXP A;  5KNB A;  1MI2 A;  4RKL A;  4Q5V A;  2JE6 I;  1HFG A;  2JP1 A;  3W2D A;  5IGB A;  4K6L A;  2DNC A;  3CU7 A;  4RCN A;  4O42 A;  1TII D;  1ZXT A;  1EQV A;  2VXW A;  1CK1 A;  5EJW A;  1SJH D;  3QB3 A;  3R2T A;  5I2X A;  4BS9 A;  2QF7 A;  2PMZ B;  2YU9 B;  2E74 C;  3MA2 B;  3ND9 A;  1SBB B;  5KRU A;  1QJO A;  2PPB C;  4QUC A;  1M8A A;  2F0K A;  2NN6 G;  4RGT A;  4WRD A;  3CRK C;  4DK0 A;  2NYZ D;  1LTB D;  3BYY B;  3A56 A;  2ZXR A;  3HOZ B;  1TS4 A;  2A73 B;  3GTP B;  1HCZ A;  3TSS A;  4A3G B;  4KMU C;  2H1E A;  2K5D A;  4C3J B;  1SNM A;  3G7L A;  2F0V A;  2E2I B;  1LT6 D;  1GUT A;  1Q8I A;  1D1K A;  1TS2 A;  2RBM A;  5E3F A;  4DU9 A;  3J80 L;  2EE1 A;  2PQE A;  3AB9 A;  1D5M C;  4NMZ A;  3MXG A;  4C3I G;  4C3J G;  1Y1V B;  2Z8L A;  2KCN A;  5FOB B;  3SHL A;  4FVM A;  3K6O A;  4FF2 A;  3S1Q B;  4IUU A;  1EIG A;  1PZK D;  3BZD B;  1CI3 M;  4KY6 A;  2RSN A;  2RDH A;  5HUR A;  5C4H A;  1B9N A;  1I4R A;  4BA2 I;  3H09 A;  1DD2 A;  1SYB A;  1GUG A;  1BCP C;  5CR3 A;  3OSO A;  2EVB A;  1C48 A;  2HCC A;  4ULL A;  4I65 A;  4RHR A;  1EY0 A;  5ELF A;  4OHJ A;  2TSS A;  3N6R A;  2ICI A;  1JOR A;  1T5E A;  1Q12 A;  1IL8 A;  1SE3 A;  2JEA I;  3URY A;  1JWM D;  3CQZ B;  1RKN A;  2KQ3 A;  2EYF A;  3R8B A;  2MGS A;  4CJ2 C;  4C3H B;  1K8O A;  4M8A A;  3K5N A;  1BQQ T;  3K5L A;  4KJO A;  1E2V A;  4IZ8 A;  1MSG A;  4HN7 A;  2B8F A;  2G9D A;  1XX8 A;  2AWO A;  2J7Z A;  2LKV A;  2MP1 A;  4C3H G;  2R92 B;  1ICW A;  1LTI D;  3J7Y W;  1AW7 A;  4WOR A;  4IAL A;  1RCV D;  1LV9 A;  5C0X I;  1FNU A;  1VMP A;  1O7Z A;  1I50 B;  1STH A;  1PRT F;  1GUN A;  3R2I A;  3GV3 A;  2X69 A;  1CA6 A;  2NVY B;  3C2P A;  3RUZ A;  4Q0F A;  1EZ8 A;  1WD0 A;  4KK7 A;  3D3R A;  3ITP A;  5EBD A;  1J8I A;  1PTO H;  2L5T A;  1BR9 A;  1O78 A;  1RTN A;  5E1F A;  2X6L A;  3SDZ A;  2B2Y C;  4U68 A;  1O7L A;  4C56 C;  3VR3 A;  5KGU A;  1F2L A;  1R9T B;  2R3Z A;  3L3O C;  1WD1 A;  2R7Z B;  2QIL A;  2JYO A;  1LTT D;  1U9R A;  4ZYS A;  1EL0 A;  5I6W A;  5CBA E;  3NWT A;  2DNE A;  1H9J A;  1EY7 A;  1Y8P B;  1O7Y A;  1STG A;  3TBI B;  4G4K A;  4G7O C;  2ZT9 C;  3M7G A;  4LJZ C;  4FXD A;  1X32 A;  2EPB A;  3VR4 A;  3Q24 A;  4H0L C;  3RZD B;  2ZXO A;  1ESF A;  1HA5 A;  3PMF A;  2FMC A;  2AUK A;  1CM9 A;  1NAP A;  3OMG A;  3SK4 A;  3E0J A;  4FYD A;  3MC0 B;  5JVH 3;  1Y1W B;  1QOH A;  4KKU A;  2NB0 A;  2RVL A;  1NCV A;  1B1Z A;  2NZ1 D;  5IGC A;  2O5J C;  3H91 A;  1EY5 A;  3S17 B;  1SNQ A;  1SFO B;  3S1R B;  2E75 C;  2DN8 A;  4KV6 A;  1LTR D;  2WV6 D;  3IKJ A;  5C4X B;  2EYL A;  2XN9 C;  2C9O A;  5JVG 3;  1Y8N B;  3EVQ A;  1Z7T A;  4NP5 A;  5TSS A;  4FXG C;  1SDF A;  5J39 A;  4ZKC B;  4XXE A;  4IUT A;  3NP8 A;  1DOK A;  3WOE A;  2SEB D;  1JR0 D;  1Y8O B;  5D3D A;  2A69 D;  4K5V A;  1OXS C;  4DK1 A;  1T5X D;  1HTP A;  5JJZ A;  2D2C C;  3NUC A;  2F0Q A;  5ISR A;  1QE6 A;  1RHP A;  5M9O A;  5FLX L;  2FFK B;  1VMC A;  2LY7 A;  3N52 A;  1SYG A;  1D2B A;  1I6V C;  1LAC A;  1H9S A;  3K0Y A;  4HMJ A;  2WAC A;  4I7Z C;  3GTO B;  2VUM B;  1OO9 B;  3GTK B;  3H0G B;  2A68 C;  4KHV A;  3FMC A;  4YIJ A;  2V4D A;  2B2U C;  1DXM A;  1BBX C;  1EU4 A;  5IT9 E;  4F88 A;  4Z9C B;  4H13 C;  1EEF D;  2L11 A;  4DF7 A;  2RA4 A;  4IFD J;  3I72 A;  1WVL A;  1G29 1;  1H9S B;  3I73 A;  4NW2 A;  4KN7 C;  1B44 D;  4KI0 A;  2EOT A;  3SXH A;  2EJF C;  4ODG A;  2L55 A;  3M3Y B;  1JQY D;  3C1F A;  3ERQ A;  4GZY C;  5C3X A;  1STE A;  5C6A A;  3K57 A;  2CHB D;  5T1G A;  3SK6 A;  3SK8 A;  3L9A X;  1CZW A;  1II3 A;  4TQU S;  2WII B;  4HCS A;  3DHQ A;  1C4Q A;  4RH6 A;  1PLF A;  1E2Z A;  1CQV A;  5JEA G;  2EJM A;  4K14 A;  5EPJ A;  3RMH A;  2EYH A;  4KTA A;  1F2M A;  1SE2 A;  2G9H D;  3IL8 A;  3WOF A;  3EFX D;  1KDB A;  4MIU A;  4BY1 B;  1TWH B;  4FXK C;  5M5X B;  3A7L A;  3VA5 A;  2IW3 A;  3MXU A;  1XWE A;  1TQO A;  2JA6 B;  3A8K E;  4BA1 I;  4XT3 B;  4CKB A;  2BE5 C;  5C0X H;  1LAB A;  1A3V A;  1MGS A;  1NSN S;  3VA7 A;  3BDO A;  1E2W A;  3SK5 A;  1WTO A;  1BNZ A;  2IL8 A;  4BBS B;  3I8Z A;  2FIN B;  1U4P A;  5EKL A;  4FNF A;  1UAP A;  4HED A;  2B2W C;  2XVS A;  3Q0A A;  4IUP A;  1IYU A;  1A2U A;  3T4A C;  3P1H A;  5CV6 A;  1ET9 A;  2EY2 A;  2WKC A;  3C46 A;  2E2J B;  3A8I E;  5JPM C;  5C3E B;  3SVM A;  4KHZ A;  1DM0 B;  3Q23 A;  1BCP D;  1TVX A;  3OOC A;  3I4L A;  1LT5 D;  2SNS A;  3ZYY X;  5CBE E;  3VYS A;  3NQT A;  3TP7 A;  5A35 A;  5CV9 A;  2B2T C;  3KLS A;  3P20 A;  1JIC A;  1D6E C;  3ERO A;  3FPU B;  3T51 B;  3QIA A;  3Q6S A;  1SXT A;  1S5D D;  1Z47 A;  2FJ2 A;  2F0P A;  1LTA D;  1M4V A;  1D5Z C;  2PCF B;  2EY6 A;  1AZP A;  4ZRZ A;  4DGZ A;  4XTC S;  1RJT A;  2H4O A;  3I3C A;  4QF4 A;  1BXT A;  2F3V A;  3VR5 A;  4C1N I;  4DA2 A;  1TR5 A;  3D8G A;  3RLF A;  1B50 A;  2KEC A;  2MHV A;  4IQZ A;  3MAQ A;  4IFD G;  3FKI B;  1RF2 D;  1V1P B;  1SYF A;  1PZJ D;  4RKB A;  4PQX A;  5C5L A;  1S5E D;  2JA8 B;  1EYD A;  3MFG A;  4A3F B;  5J22 A;  3OPO A;  4FF3 A;  2O5I C;  1S5B D;  3VYT A;  1Q90 A;  1CHQ D;  4HTH A;  5CV4 A;  3NXW A;  5COY A;  1YNJ C;  3NTK A;  3BYT B;  1F2Z A;  4J8Q A;  1KTK A;  2NN6 H;  5EKI A;  4HAE A;  4WJW A;  2NVQ B;  1SNC A;  3PO2 B;  1TU2 B;  3OIQ A;  1G91 A;  3NQI A;  2ID0 A;  2B63 B;  5NUC A;  2KA7 A;  1EIH A;  3NSW A;  4R8I A;  2RSO A;  2KHS A;  4RGN A;  1JOO A;  2D9U A;  3VYR A;  4U67 3;  1F9P A;  2A74 C;  2MJ8 A;  1SJE D;  2CVR A;  3DXJ C;  3BS1 A;  2Y0S B;  5BN3 A;  3H3V C;  2L12 A;  4HMI A;  1F9S A;  3GO5 A;  1B2T A;  5KYI A;  2BCO A;  1Q3L A;  4ZK9 B;  1D1I A;  1Y69 U;  1QNK A;  3E6Z X;  4QCL A;  1LO5 D;  5IGF A;  1GHK A;  1V1O A;  5D14 A;  2F0O A;  5JAV A;  3FEW X;  4PMB A;  5CMD A;  3HS0 C;  4PNY A;  1ILQ A;  4G57 A;  2Z1C A;  4XT1 B;  1KNA A;  4UAI A;  1EOT A;  4V0B A;  2F0G A;  4A3D B;  2D62 A;  1KLU D;  4NDX A;  2OT2 A;  5CGK A;  4LMQ D;  3HG9 A;  5COR A;  5D3I B;  5LL6 X;  1U4R A;  1GUO A;  3PUW A;  3NTH A;  4PV1 C;  3S1N B;  2I07 B;  2B2V A;  1LTG D;  4RGO S;  4B9W A;  3M7N A;  1HPC A;  3W3A A;  3IAY A;  5I9O A;  3L7Z C;  4CKE A;  1GUW A;  3HP3 A;  2F0L A;  2EY5 A;  2QDB A;  4CBV A;  4BWG B;  1STA A;  3M4O B;  4ME5 A;  1O80 A;  4F87 A;  2N88 A;  1TS3 A;  3QOJ A;  2IWH A;  1WTP A;  1LT3 D;  1B3A A;  4ILW A;  1KAB A;  2WAQ B;  4DAY A;  2A68 D;  2XRS D;  3EJI A;  4A93 B;  5IIF A;  1SND A;  3X3M A;  1HHV A;  1GOZ A;  3HOY B;  1G2T A;  4MHE A;  1JC7 A;  3PUY A;  2F0W A;  3TME A;  4RHS A;  3T13 A;  1RTO A;  1LTS D;  3TZU A;  2EDG A;  1S5C D;  4A3E B;  3A55 A;  2OXP A;  2O2L D;  4KY7 A;  1WTR A;  4Y7N B;  1G8Z D;  3DMU A;  3JAM L;  1ET6 A;  5EPL A;  4DXG A;  4FO2 A;  3GTG B;  5I6Y A;  4NKL A;  1PYW D;  5G3L D;  3BVZ A;  1Q1B A;  1WTW A;  2A5H A;  4E6I A;  5JEA J;  1ZYR C;  2K32 A;  4OIK A;  1F77 A;  1OXT A;  4HSV A;  3EA6 A;  4OGQ C;  3FDT A;  1CT1 D;  1UEA B;  1H9M A;  4C1N K;  5FK9 C;  4KN4 C;  1PRT C;  5KYL A;  4WFN 3;  2KVM A;  2FHT A;  2R93 B;  2K6A A;  3KLR A;  2F0U A;  1IKL A;  2TMP A;  2MUY A;  4G7Z C;  3G6J B;  4A3K B;  3S14 B;  1MSH A;  1WTV A;  4B08 A;  4QUF A;  3SE0 A;  2PZU A;  3RZO B;  2QEJ C;  4KKS A;  3QOL A;  2F03 A;  2K05 A;  5A2Q L;  2BE5 D;  3OWF A;  3S16 B;  4ID6 A;  1I4H A;  4IFD I;  2VB3 X;  2RKS A;  2SOB A;  4BBR B;  2XSC A;  1F9Q A;  3BDC A;  2JXM B;  3S2D B;  3D4R A;  2SDF A;  5E4X A;  3DUZ A;  1ENF A;  2XIW A;  1EWC A;  4A3J B;  4K2L A;  3LNN A;  4RCO A;  4ZKB B;  4H44 C;  2CQA A;  1SNO A;  2NN6 I;  2Q8R E;  2VB2 X;  5CV7 A;  3T53 B;  4L8J A;  1J9O A;  4FP5 D;  1JE4 A;  1PFB A;  2BOS A;  3OHX C;  4OO1 G;  3BG3 A;  1TWF B;  1DOM A;  2A6H C;  1A6X A;  2BA1 A;  2IX3 A;  1LT4 D;  3SR1 A;  2X6G A;  4IUR A;  4DNT B;  3KBG A;  1B53 A;  3QWN A;  3GTL B;  4QIW B;  1YNN C;  1DJR D;  1IW7 C;  2E2D C;  3TP6 A;  3D31 A;  3CHB D;  1AEX A;  1TWC B;  1UNS A;  1WTX A;  2MPM A;  4ABN A;  2HDM A;  1A3T A;  2B8G A;  3HKZ B;  2LFN A;  1BUV T;  1IHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...