4L6TB

Gm1 bound form of the ecx ab5 holotoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
MTPQNITDLCNEYQNTMIYSLNKEIATYTESLAGKREMVIISFSNGATFQVEVPGSQHLESQKRPLERMKDTLRAAYFTGIKISKLCAWTNKSPNSIAAIELSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ECXA
total genus 25
structure length 105
sequence length 105
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4l6tB00
1PZID 1TS2A 4L6TB 1KTKA 4RH6A 1I4XA 1SXTA 4RHSA 3EFXD 4K6LA 1FNUA 5ELEA 1LTTD 4OHJA 1I4PA 2Z8LA 3GP7A 3BVMA 4BWGB 3TSSA 1LTGD 1QILA 3R2IA 1ET9A 1FD7D 1HA5A 1UNSA 1D6EC 1S5FD 1BCPF 4ZYSA 3CHBD 2RDGA 1B1ZA 1EWCA 1MD2D 2NTSA 1RF2D 3URYA 1LTSD 5FK9C 1LT6D 1EU3A 1L0YB 1TS5A 1FGBD 2ICIA 3V05A 2G9HD 2CHBD 1SE2A 1I4RA 3MFGA 3DWAA 1SE3A 2WV6D 2AQ3B 2SEBD 2IJ0A 1PTOH 1KLGD 1AN8A 1BXTA 1AW7A 1L0XB 1FNVA 1LT3D 2XRSD 2XN9C 1ET6A 2J4XA 4RHRA 3BVZA 4TSSA 1PYWD 1I4QA 2R61A 1DYQA 1SJED 1D5XC 1STEA 5ELBA 1SJHD 1CT1D 1XXGA 5TSSA 1KLUD 1EU4A 1PTOB 1BCPC 2TSSA 4O1NA 1EEFD 1PRTC 3W2DA 1TS3A 4UDUC 1JWSD 1I4HA 2QEJC 1D5ZC 1PZKD 1HXYD 2AQ1B 5I4DA 3OWEB 5FKAC 2RDHA 5ELDA 1S5BD 4RGNA 1V1PA 3BVGA 1CHPD 1TS4A 1I4GA 3R8BA 1RCVD 4Z9CB 1PRTD 1SBBB 3O13A 1HQRD 2XNAC 1V1OA 1PTOF 1RD9D 2XRQD 1B44D 1ENFA 1GOZA 4DXGA 1SEBD 2IPKD 1CK1A 1CHQD 5ELCA 1S5CD 5ELFA 1CQVA 1S5DD 1G8ZD 1TY0A 4C56C 1EFID 1JCKB 1V1PB 1LTBD 1LO5D 1TY2A 4RFBA 1JR0D 1D5MC 3MC0B 3SEBA 1LLRD 1FNWA 1F77A 1PTOD 4DXFA 4RCOA 1PTOC 5D3DA 1PZJD 4RGOS 1S5ED 1LTID 1PRTF 1DJRD 1SE4A 1M4VA 1EEID 2QILA 3BYTB 5D3IB 2O2LD 1HTLD 1XTCD 3R2TA 4L63B 1PRTB 1JWMD 3BYYB 1BCPD 1UUPA 1LT4D 1LTAD 1JWUD 3EA6A 4RGMA 2AQ2B 3BZDB 2NTTA 3DWPA 3KLSX 1LTRD 1ESFA 1JQYD 1BCPB 1LT5D 4RGTA 1RDPD 1T5XD 3DWQA
chains in the Genus database with same CATH superfamily
4IALA 4GLAC 1TU2B 3EFXD 3E5SA 2KEEA 1K28A 4HN7A 3HOUG 1YNXA 2F03A 3B6YA 2BDOA 4LF8L 1EIHA 4RA8A 5T1IA 4HMIA 2F0PA 1JOQA 1YHQA 4KKUA 5EPKA 2B2TA 4A3KG 4BY7H 2R92H 3KBGA 3TP7A 3ER0A 3MEFA 1GVPA 2NN6H 1BUVT 1WJJA 2KOLA 4YCWA 5CV9A 3I3CA 2UUBL 2GA4B 1L1OB 2A6EC 3S1QH 1AE3A 3PUYA 4A3IB 2I07B 1VQ5A 1NUCA 1E1OA 1QUQB 1XNQQ 1HA6A 2KCCA 2N8NA 3GV6A 5CV4A 4J15A 2NN6I 5CBEE 4B9WA 2CH4A 2IX0A 4FXKC 1FYCA 4IPGA 2JA6B 2KEDA 5E4WC 2KHIA 4QB4A 2K52A 1NMFA 1PH4A 1U9RA 3H15A 5CV6A 4JI4Q 3M7GA 2LFNA 2JA5G 1G6ZA 5EJWA 4UDUC 3J7YW 4H0LC 1NNXA 4MIUA 4L8JA 4OIJA 3K58A 2EQSA 2RDHA 5FKAC 1H9SB 2F1MA 3F2CA 3PGZA 2CWAA 1QNUA 3O13A 4IJLA 4DR2Q 4AH6A 3TN2A 3ERSX 4DXGA 1X3GA 2MUYA 2ZJPA 2J0TD 1G8ZD 4OL7A 4AIMA 2A6ED 3CC7A 1SSOA 3SEBA 3FMCA 5M3MB 1XPUA 2P5ZX 4Q0FA 1WTHA 2G5DA 1L1OA 2Z4IA 3PIP3 4KHZA 2VS1A 1X9NA 3KBXA 4BY1B 1RIPA 4JI6Q 5LMNQ 4G57A 1I6HB 5I9OA 4L63B 2Y0SE 3K5MA 1LT4D 1QVFA 3S2DH 4Y52H 4KY5A 1V9PA 1PH8A 2ASBA 4ZRZA 4OO1G 1RDPD 2R93H 1GHJA 2B2UC 4IN3A 1I4XA 4R4QA 1A0IA 4LF5L 1DOMA 3OIQA 3QOJA 1GUSA 2HUGA 1Q7YC 5JJKA 1EY9A 3K81C 4WFN3 1A8VA 5C3EH 4BA2I 1EYAA 4IPCA 3VYTA 4FF4A 3W3AA 4PZ7A 2OXPA 3RNUA 3AEVA 4F87A 4FO2A 4X62L 4K2LA 1SDFA 1HNZL 3A7AB 3K7AH 5LMUL 2CHBD 1GO3E 1H9KA 4KD4A 2AUJD 1JB3A 4WJ3M 2Q8IB 3NBHB 4QIWB 2A5HA 3WDNA 3JAML 3I55A 3KJPA 4WRDA 4HJAA 3STBD 1I94L 1GJXA 3BVZA 4QF4A 1DZ1A 3G6EA 4G7ZC 4A3FH 2X6GA 1H9JA 1OO9B 1XXGA 1O7ZA 1KL9A 1R9TH 2JEBI 3F2UA 3GTLB 1CKMA 2F0KA 2N78A 4A3MH 3BU2A 2UXCL 3DEPA 1XMQQ 5C44G 2JEAI 3CF5A 1N36L 3NENA 3D3RA 3PO2H 2I0QA 3M4OH 1TWAB 3G71A 2B39A 2D5DA 3FDTA 4DR1Q 3Q23A 3H3VH 1V1OA 2A68C 1J6QA 1SRUA 3P75A 1SR3A 3RLFA 3ITPA 1EY7A 3A74A 4DNIA 1W2BA 1A2TA 2QCPX 1G6PA 1NY4A 5ELCA 5IGGA 1I3QH 3PIOA 4A3CG 3NK9A 5I2XA 3ULJA 4JBWA 1LTBD 1Q81C 3WOFA 3GTPB 1LM0A 3MEHA 3PUVA 2ZTEA 5GAHC 3OTOQ 1IW7D 3HOUB 1J9OA 4P2CB 1K3RA 3GTLH 1AEXA 1M4VA 4TRDA 4ODGA 2UUAQ 1VF7A 4BBRH 1HTPA 5J39A 1PHJA 4R1JA 3U58A 2F3VA 4A3BH 1KDAA 1PYSB 1HFGA 2AWNA 2Q2HA 3SHLA 1TWAH 4DV0Q 2WFWA 1BCPB 4FDBA 4NKLA 1UAPA 2F4IA 1KNEA 3E9IA 2E2IB 4L6TB 4CJ1B 1SXTA 4M8AA 4K2KA 5CYUA 2YU9H 2EJGC 2PPBC 3E9HA 1I50H 5C3EG 1LTGD 1UNSA 4QY7A 4GN3B 3I70A 1S5FD 3M4PA 4QGUA 1VQJA 1WD0A 1MI2A 4DAVA 4LUOA 4Y7NH 1ICWA 1U0LA 2DN8A 2F0UA 3OIPA 1EQTA 3MWYW 5EKLA 2YTXA 4PMCA 1EZ8A 1YJ9A 5BR8Q 4X62Q 3VR3A 3MHBA 1TWCH 4P73A 4QL5A 4C3JG 1XWEA 2EJFC 2F0FA 4LJZC 4ZKCB 2XRSD 5M5XB 4HCSA 4IUTA 1NAPA 3DMUA 1QWYA 4NB3A 3J81L 3FKIH 1F9PA 4CDDC 1XMOL 1E3PA 2OWOA 2A6HD 4DK3C 2QA4A 1DOLA 3A56A 1PZKD 4DR3Q 5I4DA 2K05A 1JOOA 4RGNA 3I4LA 3H0GG 4ID6A 3R8BA 4X3KA 1RCVD 2DY7A 1M90C 3RD4A 3GTKB 2HDLA 4YCVA 4HIKA 2XNAC 2Z6KA 4K5VA 1BBUA 2KHSA 1GM5A 4QIWE 3BG3A 1JCKB 2VUMB 1PXUA 5EKKA 4DUZL 4MZ9A 1Y1VG 3MXGA 3M9BA 5C4JB 1FGUA 4RGOS 1ENCA 2AWOA 5K36H 3RLNA 1ONLA 2RBMA 5C5LA 4JI4L 2E76C 1EYGA 1N34Q 4YY3L 1SYBA 4A3DH 4NPSA 4JOIA 1QE6A 2A74C 4BBRB 3FP9A 3RUZA 5IYDH 1CSPA 1R4PB 4H7BA 4HMJA 2F0NA 3VR2A 1WTPA 4RHSA 1OXXK 1Z6HA 2R92G 1QNKA 2BE5D 5GAEC 1FNUA 2K75A 3N52A 4CHTB 2Z1CA 4OHJA 1HNZQ 4JI0L 5JJLA 2EYJA 5FLXE 1WTWA 1ET9A 3E0EA 2GVAA 3MAQA 2EJMA 5IWAL 2F0DA 3H09A 4FXGC 2EYLA 4ZUJA 1XJVA 2ID0A 3K0XA 5BN4A 4I7AA 4DV6Q 1B50A 2R7ZH 4K5WA 1BBXC 1LT6D 1KC8C 1X6OA 4EVOA 4WJ4A 2F0EA 1SE2A 3IL8A 2AQ3B 1K8OA 2AHOB 4IUUA 3SK8A 3FKIG 2CWPA 1VQ6A 4A3KB 1OXVA 2D0OA 3CCQA 4TSSA 2VXWA 2KECA 1G51A 1I4QA 3X3MA 1PH9A 1EY6A 5C5MA 3KDFA 1VQEA 2BE5C 2EYOA 2LXJA 1PRTC 3QO2A 1Q82C 3EROA 4GKJL 2NYZD 5M3MG 2IWHA 1YHAA 4LF7Q 1JE5A 4P74A 1X3PA 1EOTA 3VA5A 3T1YL 1OXSC 3TREA 2QEXA 1HR0L 4WJWA 4E6IA 4UAIA 2QW7A 3K5LA 4YHHL 4HJ7A 1GOZA 1ESRA 4DR5Q 1IZ6A 1S5CD 2F0LA 5CMDA 3I2ZA 1PH3A 1TY2A 4XQJA 4DR5L 1D5MC 5FOBB 3Q8DA 2VQEL 2ICEC 4ZK9B 1F77A 2CCZA 2A69D 5IYCH 1CA6A 1IXRA 1Q1BA 3G6JB 1CZWA 2OQ0A 2QKIC 3OW7A 3MZ5A 1K73C 1QVGA 3PO2B 1SYDA 1XMQL 1NR4A 1WCMB 4OWWB 1IYUA 2FHTA 1YITA 5J3BA 4RGMA 4CKCA 3C46A 2WINB 3HRZC 4C3IH 3R3OA 1EUJA 3D6WA 3EBEA 2CH4W 3NWSA 3A8IE 4F8MA 1KXLA 1NCVA 2Q2TA 1LTLA 2Z6BA 5M5WH 1STBA 1PFNA 3AQQA 1LTTD 1VS0A 3SK6A 2B63B 4FP5D 2OT2A 4L5TA 1WYDA 4QQBX 1A2UA 1D6EC 5F2DA 2PQAB 4S3SA 1X3FA 5CV8A 2L5TA 3OTOL 4JI3Q 3H3VI 1X32A 4EX5A 3H0GH 4LF9Q 2RF4A 2E75C 4DV6L 1MJCA 3V05A 4HJ5A 3MFGA 1O7IA 2BA0A 3DWAA 4A3MG 3I4MB 3NQTA 4K0KL 1PTOH 2B2VC 4KY7A 3NPPA 4JI5L 2L11A 1HJPA 3UDXA 3LWEA 5C4XG 3ONAB 1VQFA 3CPFA 3DUZA 2NZ1D 5KYIA 3CCSA 2R61A 3S1RH 3GTGB 1YJNA 1MJEA 1TR5A 4FF3A 1EU4A 3Q24A 1BCPC 2CW0D 1RODA 2ZM6L 3KJOA 1PDQA 1V8QA 3K7AB 4HIMA 4A3JG 2N49A 5EPLA 4DR1L 1WCMH 2F3WA 3HKZG 4K6DA 4G7HC 1UE1A 1IL8A 4BY7B 5JEAH 1VQIA 5IIFA 4K14A 5ELFA 1JC7A 4PMBA 1KAWA 2JA7G 2C9OA 5KNBA 1KHIA 3MC0B 2RHSB 1IKMA 2L4NA 1KDCA 5D14A 1SFOH 4X65L 1Q3LA 1O78A 1SMYC 2SNMA 4ZLTF 3J81j 4CKBA 4OO1H 2H1EA 4OO1I 3K57A 2KHJA 2IL8A 2R7DA 4KKTA 4C3HG 5BN3A 2KCMA 3S15B 2WB1G 4RWSC 4LFAL 1JWMD 2RHQB 1X3QA 5ELNA 3UDIA 3TP6A 1RHPA 3NXWA 1E2ZA 4BBRG 2BDNA 2F4VL 4X3TA 1IL2A 2I5LX 1TKWB 4EQOA 3S2HB 4OWXB 2EDGA 1PLFA 3DWQA 2ZTDA 2OF1A 4H44C 4KHPQ 4J1MA 5JVH3 5M3FG 5JOBA 5DNFA 1L2FA 1N34L 2CKZB 3BVMA 4YIJA 3K5NA 5C4JH 3R2IA 5IGCA 1C8CA 3K7UC 1IHZA 5HGTA 1F9QA 4R4IA 2NZOA 4GN4B 2NTSA 1RTNA 4KHVA 1UEBA 2JQOA 1TS5A 1E24A 3H0GB 5C44H 3KLRA 3TZDA 2WAQB 5C0XI 1SE3A 4HIOA 1VQKA 1XYIA 3S2HH 1SNQA 1CA5A 3M85A 3M3YB 1F2LA 3FEWX 3BDLA 2RQXA 4KKSA 4LF7L 1CFMA 2N3SA 2RCNA 2BCOA 4R8NA 2UUBQ 4XQQA 4GOPC 1PTOB 2NVYB 2Y0SG 1KABA 3CQZB 1BF4A 2JYOA 2SOBA 3W2DA 2RKSA 3S15H 4XT3B 3IKJA 3S17H 1Y1WB 1C0AA 2LS01 3HOXH 3HZXA 4C3HH 4DUYQ 2BH8A 4LF9L 3D4DA 1PRTD 4R4OA 3HOYG 1PVOA 2AMCB 5EPJA 1S40A 1P16A 4C2MH 1PTOF 3D8GA 3L0OA 4BY7G 1SEBD 2PCFB 3HKZB 2Z6KC 3HOUH 3NP8A 2WAQG 4HSVA 5C6AA 5GQOA 4DF7A 2MGSA 2FXQA 4GS3A 4B08A 3ULPA 5IGEA 5JAVA 3NTIA 4KK7A 1A62A 2OEOA 3A0JA 4DR7L 2FMMA 3KDFB 3HOWB 2LXKA 3E6ZX 3DWPA 4N9PA 1FJGQ 4FNFA 4A3DB 1AE2A 4CGYB 5IT9L 4B3SQ 4N9TA 1VQPA 4UY8C 3DM3A 5IP9G 3HGBA 4IUPA 1TWFB 2L55A 2VZAA 1V43A 3U4VA 4DV2L 2CW0C 3OOCA 1MHWC 1TWHB 1I6HH 3SVMA 2HDMA 3VYSA 3CC4A 1RJTA 2RDGA 1W6KA 1VMPA 1O80A 2WB1B 4RKBA 4POFA 2D62A 3I4NB 4OXPA 2JA7H 1NBWA 2UUCL 3QJYA 5NUCA 1GUGA 4M1UB 1LABA 2EIFA 3NTKA 2B2TC 5IOCA 3H3VC 3M4OB 2R7ZB 3TZUA 2ZM6Q 3KK7A 4QMGA 4CJ0B 1U4LA 2OCEA 2SEBD 3S9WA 1VQCA 4UHVA 2JA7B 1YI2A 1WCMG 2XN9C 4RHRA 2ZT9C 3CCVA 3NEMA 1PFSA 1HZAA 1DYQA 3J81E 4BXXG 4Q5VA 3HOZG 1LV9A 1CI3M 1Q46A 2NVYH 2MQHA 4A3EH 1JWSD 4IJHA 4ZKBB 3RZDB 3ND8A 4DR7Q 3GTGH 5IP7G 3U4ZA 2WACA 4DAPA 1Q86C 1CHPD 1NSNS 4ME3A 1QOHA 3GTMH 3TS0A 1HUNA 1VQBA 4L5QA 3HFZB 1EWHA 4A3BB 3UDGA 2VL6A 2F0MA 2E2JB 2OTLA 5C4XB 3RMHA 1HR0Q 3SGIA 3WWVA 4YY3Q 1JMCA 4C56C 4DU9A 2IHFA 3OSOA 1TXYA 3EN2A 3SXHA 4JC0A 4XQNA 2E2JH 1KNAA 3G4SA 1JJGA 1BOSA 1NR2A 1SE4A 4FF1A 2K4KA 1F9SA 1UE6A 2UXBQ 1FL0A 1HTLD 1BQQT 1QB5D 1N32L 3FKIB 1VQHA 3K0YA 4UPAA 5EGTA 2Q2UA 3GTJH 1PH5A 4BBSH 3TP8A 1I5FA 1T5XD 3CHBD 2WKDA 4C3IG 4GNXC 1CSQA 4R4CA 1TS2A 3S1QB 2ES2A 3HS0C 2JN4A 4FF2A 1SYGA 1W6JA 4K6LA 1VQ8A 3HOZB 1XPOA 5M5XH 2K7VA 3CMAA 3PIPA 1VQ9A 3OHXC 4DAYA 2XTIA 3A55A 1VMCA 1QZGA 3KYHC 4U673 4B3RL 1U5KA 4OX9Q 2C5CA 3T51B 1TVXA 4A3LG 1PH7A 1MSHA 5AFWA 1HPCA 1LACA 4IFDG 3MA2B 1SROA 2R7ZG 4X66Q 4ME5A 2EYMA 4IPHA 2XIWA 3LX0A 3I4NG 3GTJB 4RAUC 2O5IC 4LFBL 2Z4HA 5GAGC 2B29A 3L2PA 4A76A 1BXTA 1HNWQ 1LT3D 3QG1A 1EL0A 3L7ZC 2JA6G 4JK1C 1SJED 3NHHA 3BZCA 1CKOA 3KLSA 4B9XA 4DAMA 2HCCA 3HOWH 1KLUD 2QF7A 4OEMB 4O1NA 4XIGS 5DLQE 1D2BA 1VQAA 2N88A 5IYDG 5JPMC 3TQYA 1ILQA 2K04A 2JXMB 3OMCA 1S4ZA 2PZUA 2NVXH 1D5ZC 4A3DG 4PQXA 4PMWA 4ULLA 1BBWA 4XYOA 3T1HL 5K36G 1YBYA 4LFBQ 1T5EA 5L37A 3S14H 5I6YA 1TQOA 1EIGA 4IUNA 3AFPA 1SNMA 2V4DA 4X3UA 1L1OC 2IPKD 2KJXA 1S72A 4X6AH 4DN4M 3MXPA 2JA9A 4X65Q 1ZYRD 1D1IA 2VY3A 3SDZA 1EFWA 2PNHA 3GTQH 1PFBA 4UP9A 1BVSA 2L0CA 3HOVB 3AYHB 4JV5Q 5D3DA 2IX3A 1B2TA 2LMCB 1XMOQ 3S17B 1NE3A 1MKHA 3U9OA 4DV3L 1STNA 4L5SA 1DGSA 2B2UA 3HOYB 4PZ6A 3C1EA 4X64Q 4U68A 1WTVA 1Q8IA 4LFCQ 4IFDI 4XT1B 3V2TA 4K8JA 3CQZH 4MTNA 4IZ8A 4RH6A 5IP7H 5M5YH 5BR8L 4XDXA 5JVG3 1U4MA 4KD3A 1TWCB 1I4PA 2Z8LA 2EYPA 3BJUA 1PH6A 2CQOA 4DPGA 3STBC 1WTOA 3K5OA 3KF6B 5JEAJ 4OONA 2JA6H 2E5LL 3T1YQ 3IFDA 1B70B 3S1NH 2FJ2A 1X55A 2RSOA 3P20A 4DR3L 5DAUA 2VQFL 1HNXQ 3T13A 5FLMG 3MXNA 4BBSB 1GUWA 2VUMG 2E2DC 3GTKH 1STYA 2FFKB 4XTCS 4JBJA 1Y8PB 1FR3A 2YYZA 1DXMA 3HP3A 4O42A 2WIIB 1UE5A 4DR2L 4AQYL 2K50A 1VQMA 4UP8A 4DV1L 1PMRA 2K1BA 3HG9A 1XNRL 1A15A 5IP9H 1Y69U 4GKKQ 1UEAB 3IAYA 4OX9L 4JPBW 4LUVA 2IY5B 2VQFQ 4ZUIA 4X3SA 1HNXL 2JA8B 1CTMA 3S1NB 1XNRQ 1S5BD 2ENBA 2OTJA 1TS4A 4A3IH 2K5DA 2B2WC 1I3QB 4Z9CB 1PH2A 3QB3A 4A3GG 1VQGA 4H13C 2YV5A 4JI7L 4DR4Q 3FPPA 3OYYA 1ENFA 3P1HA 4KN7C 2M00A 4YCUA 2K5QA 2VB3X 1DM0B 5IGFA 1TY0A 2B2WA 4C3JB 1LO5D 4C2MB 3BZKA 5CBAE 3CRLC 3UE1A 1HH2P 2EXDA 4QJFA 4QUFA 1PTOD 3DEOA 1K8GA 4JCVE 4XYQA 2K28A 1PRTF 1DJRD 1IBLQ 3NUCA 4PV1C 5D3IB 5IY0A 4CBVA 4DV4Q 4DR6Q 3R2TA 2K33A 1DOKA 1TWGB 2MFIA 2PQAA 4GLVB 2UXDL 1GHKA 3I91A 3W1BA 2UUCQ 3FHWA 1LTRD 1SNCA 4HTHA 4JI2Q 5A35A 1EQQA 5C3EB 1UWVA 2D9UA 1P8LA 4JI3L 1O7LA 2B2YC 1SYCA 5ELEA 3TRZA 2NVXB 4R8IA 5FO9B 5EBCA 3I4MH 3MXNB 2K14A 1JJCB 2L9HA 3Q6SA 1S3OA 3TBIB 3FVQA 1HA5A 3JC66 3HOVH 2V1CC 1G2TA 1MD2D 1SNOA 1JOKA 4LUZA 1D1KA 3NBIA 1U4RA 2I5HA 4DKAC 1YVCA 2E2HB 3T1HQ 4JI8Q 4A3CH 1QG7A 2F0SA 4HJ9A 1EYDA 1ICFB 3D0FA 4R4TA 1K0SA 2JA8G 1QVCA 1Q1EA 3IRBA 2WV6D 3X3NA 3C2PA 1VDZA 1AN8A 1ZKOA 1SN8A 5GROA 1D7QA 4NXNL 4MTKA 3CCEA 4RKLA 1F2ZA 4EQ5A 4I65A 4KJOA 3E0JA 3D4RA 5KYLA 4EGVA 2PW5A 3TDQA 2R93G 3MXUA 1VQ7A 3VDYA 4A93H 1CUKA 4B3TQ 3FRPB 3J81c 4BA1I 2PZTA 1Y1WH 5M3FH 1HXYD 3QOLA 4YHHQ 2HIVA 3GD7A 5JJZA 1Q8KA 5ELDA 2OQKA 2R3ZA 3CMEA 4LW1A 2QDLA 1ASZA 2Z0SA 5A2QE 1A6XA 2XRQD 2JK8A 1IBKQ 2DJGC 1WTXA 1B53A 2HD3A 2LY7A 1SNDA 3G7LA 1EFID 4MNOA 1YJWA 1KQSA 3L3OC 2LKVA 1FNWA 2J7ZA 4DXFA 4B3ML 2HIXA 1J5EL 1S5ED 2DGYA 4TQUS 4CDCC 1TIID 1HZ9A 3GTPH 1EEID 3MFYA 2A68D 2VUMH 1H9MA 2DJFC 4DK0A 4EQPA 5DM63 3S16B 1JWUD 2JA5H 3F1ZA 2NUCA 3EA6A 2EY5A 1R4QB 2SDFA 3KLSX 1PH1A 1JT8A 1LT5D 3QIAA 1PYBA 1ILPA 5C3XA 5IYBH 5EKIA 2M2LA 1EIYB 3HOVG 4LMQD 1YNJD 2F0OA 2R93B 1JICA 1GXDC 2KENA 1XX8A 4ZYSA 2BH2A 2DY8A 2EOTA 1EWCA 1HCZA 3S1MH 3KF8A 3LWUA 2MJ8A 3GQBA 1AZPA 3UDFA 1D8LA 5E1FA 4RMFA 1Z7TA 3U9SA 1L0YB 4BY1G 5EBDA 2ICIA 1EY8A 3TS2A 3C3LA 2AKWB 4Y7NB 2EY6A 4B3TL 3S1MB 1F9RA 3HEJA 1DD2A 4DA2A 4DV0L 1VQNA 4JI2L 4LFCL 2E2HH 1PV4A 5IODA 4DGZA 4GNXB 1FVIA 2F0WA 1HFNA 5T1GA 3VYRA 5IGDA 4IURA 4GOPB 1HUMA 2IX1A 5ELBA 1CT1D 2SNSA 3NQIA 2TSSA 1IBLL 2K32A 3AU7A 2EZVA 1SAPA 4NP5A 3I90A 4A93B 1CZGA 4JYAL 2L15A 3IFTA 3KFUA 1A3TA 4YWMA 3J80E 3OWEB 2JA5B 5FJ8G 4A3GH 3A5UA 5J22A 1H95A 2XGTA 3A5ZB 2UUAL 1I4GA 4DV7Q 3EQLC 4AQYQ 2K5HA 1STGA 2UU9Q 1AP0A 1B44D 2FINB 4PNYA 4DV4L 4DR6L 1EY4A 3KF8B 4V190 1S5DD 4RG1A 2MP1A 5FLXL 3S24A 4DV2Q 3ERQA 2NN6G 1EY0A 4N8FA 5IYCG 1NTGA 2XSCA 1IBMQ 4KY6A 3CCUA 1PTOC 1PA6A 1TWFH 3H91A 4KN4C 1YZ6A 2QILA 4CDEC 3H94A 2O2LD 3J7ZC 2E2IH 1PRTB 1Y14B 2NWGA 1LTAD 4A3GB 2VB2X 4KHPL 1HQMC 3TMEA 4DV3Q 3CAMA 2D2CC 3EIVA 1O7YA 1KD1C 4JBMA 1ZXTA 3BDOA 2TMPA 2B8FA 4HEDA 1N8RC 4GZYC 2KCNA 4OELB 1JB7A 1Z9FA 2YTVA 3CCRA 3CCLA 1T9HA 1GKHA 2X69A 1FD7D 2PQEA 3F2BA 1EZ6A 2WAQE 3GV3A 2PMZB 5G3LF 4GKJQ 2FMCA 1II3A 2XWJB 2CQAA 1HNWL 1LTSD 1E2WA 4J8QA 4BBSG 3I73A 3I4OA 3A7LA 5AJ3L 3HOXB 4LF6L 2RVLA 2E74C 2MO1A 2F52A 5FJ8H 1FGBD 2EYHA 2PW7A 5DEHA 3RZDH 2G9HD 2PMZE 1B9MA 1WI5A 2A8VA 1R9TB 1W3SA 5FO8B 1TWHH 1L0XB 3HKZE 5C3WA 1X54A 4LF4Q 4B3RQ 1MIUA 1STHA 1SMYD 2L1BA 1SMXA 4QCLA 2BOSA 3N6RA 3OW2A 1BKBA 4JG2A 2XVSA 1GUNA 1I4HA 3FPUB 4GOPA 1XTDA 4HAEA 5E4XA 2RCFA 4K0KQ 4JBKA 3I8ZA 1SBBB 3UI2A 1A63A 2MPMA 1N36Q 2EY1A 5C0XH 4IUQA 3C1FA 1B8AA 4ZAIA 3TEHB 3T56B 4A75A 1YNJC 2UXBL 5CR3A 1VF5C 2CFMA 1I6VC 5KRUA 5HGQA 3PF5A 5IYBG 4A3EB 3M7NA 5LL6X 4GKKL 4A4IA 4RCOA 2Z9HA 2ZXOA 4POGA 3ULLA 3I4NH 1GUTA 1A3VA 3I7FA 1BNZA 4JI7Q 1MGSA 3QR8A 1E22A 3CC2A 2B3GA 4JI8L 1ESFA 2R6GA 3BS1A 1G2SA 4MN3A 2NVQB 2F0JA 1OTCA 2ATWA 1TWGH 3NSWA 1SLJA 2NVTB 3D4WA 5M3MH 1YNNC 3CPWA 2ZXPA 5EQ0A 1HR0W 4YWKA 4JVZA 1STAA 3K8AA 3CCJA 2HQEA 1LUZA 1K0RA 2NZHA 4APVA 1E1TA 5FK9C 3SE0A 3JAME 2K01A 2A1AA 4C3HB 3F8TA 2JSOA 1F2MA 1EU3A 2EY2A 5D65A 1XPRA 3NELA 1K83H 4B3SL 1EQVA 1Y1WG 5GADC 4HSPA 3OPOA 2A19A 3CU7A 2QDBA 2IHEA 2IJ0A 5LMNW 1VCIA 3HKSA 1FNVA 2A73B 4CKEA 1ET6A 3PSIA 1K3BC 3PMFA 2EXZA 4DFAA 1Q12A 4UP7A 1IBML 2F0TA 3A54A 2F0GA 3NE5B 3K59A 1CQFA 1H9SA 4R9WA 5IT9E 1EEFD 4DNTB 1SYEA 4LF4L 4IPDA 5DM73 4GLXA 2F0VA 1PFMA 3CCMA 4C3IB 3J80i 2AQ1B 3UE0A 4JI5Q 3NBHA 3R93A 4BY1H 3KLWA 3JAMi 3HOYH 2F0HA 4V0BA 5LMNL 2RSNA 5K5PA 2DNEA 3HOXG 2IT1A 1WTRA 1EYCA 3MVVA 2HCIA 5HY6A 4DK1A 1SFOB 3NTHA 4LFAQ 1KDBA 3CXCA 3GTQB 1V1PB 2F0QA 4BXXH 3H6MA 4DV1Q 2K5VA 3D6CA 3CD6A 1AFPA 3M4YA 3I4MG 2UXDQ 4AYBE 1QZHA 4DK6C 5M5YB 4XXEA 2H5XA 2EE1A 5CV7A 1Y1VH 4G4KA 3MTSA 4JOIC 4KJNA 3RLOA 4NXMQ 5LHY1 4G7OC 1N9WA 5FLXc 1N33L 4ZQ3A 5M5WB 4JYAQ 1J5EQ 2UXCQ 1RKNA 2ALYB 2D0PA 2ZTCA 3T4AC 4HCEA 2GN5A 4LF5Q 2N55A 1N33Q 4FXDA 5LL6S 2KA7A 3DHQA 1JQYD 1B3AA 1M1KC 2B63G 2WP8J 2K5NA 3J80L 1OXUA 4QUCA 2LSSA 1C48A 2K6AA 3J7A5 3M3YH 2Q8RE 2A69C 4O0AA 4KV6A 3GP7A 3PO3H 1EIFA 3M4QA 4IO9A 2PI2A 2R7FA 5E7NA 4OWTB 3F2DA 1B4OA 3URYA 1A3UA 1KRTA 3VR4A 4KTAA 3OMGA 3PO3B 4A3IG 1SE8A 2EVBA 1DONA 5HURA 1C9OA 2EYFA 3EVQA 4IOAA 1ASYA 2F0IA 1KAAA 4A93G 3OWFA 1AH9A 3GTOH 1BDOA 1BR9A 4NMZA 1C4QA 4LF8Q 3EJIA 3PF4A 1AW7A 3PQIA 2O5JC 1YHBA 4JW0A 3KOJA 3A8JE 4ZCKA 2B63H 1D5XC 5LMUQ 3AB9A 5TSSA 3RR5A 4IQZA 1H9RA 2Q2IA 4HIDA 1HHVA 1RL2A 2NVQH 3RN2A 5KGUA 2JA8H 2HT1A 2WB1E 1IKLA 1K9MC 5JEAG 5KEEA 1LYLA 1WOCA 3RN5A 3CP0A 4DV5L 4GN5A 1XNQL 3V96A 1JORA 4A3BG 1CKNB 1RD9D 1GD7A 1ENAA 1YEZA 1BO0A 4CDFC 3GO5A 2DNCA 4P72A 1NJIC 4DNRB 2ZJRA 1JR0D 2E8GA 5ELOA 1IBKL 3S14B 3U50C 2NBFA 4JI1L 4HJ8A 1K83B 4H02A 5C4XH 2Q8TA 4F7XA 5I9PA 4LNQA 4MHEA 2NB0A 1JJ2A 3BDCA 1QCBD 3PO3G 4GNXA 3J80c 4B3MQ 1TT2A 3BYYB 1E2VA 4PG3A 2ZXRA 2NTTA 2X6LA 3PO2G 4X66L 1OXTA 1VQ4A 4KLKA 1PZID 1KTKA 1VQOA 1QJOA 2VQEQ 2Y0SB 3SK5A 2NVTH 3D31A 3TSSA 1QILA 1WFQA 1MSGA 4AYBB 3P7JA 4JI6L 3KUPA 2F4VQ 4ALPA 3ICEA 4IFDJ 1X3EA 5JJIA 4TVAB 2YTYA 4A3FG 4CJ2C 3K6OA 1CKNA 2H4OA 3WOEA 3W1GA 2PI2E 4EQNA 1WD1A 5EAYA 3ZYYX 3PIO3 2B2VA 2AUKA 3E3XA 4KMUC 2BA1A 2K03A 1X56A 1DCZA 1I94Q 3CW2C 2MNAA 2IW3A 1FJGL 2EPBA 3AFQA 3CKIB 3HOWG 4WORA 2KQ3A 2DUDA 3A8KE 2C35B 1E0BA 2HQLA 2PO4A 5C4ZA 4A3KH 1HRJA 2B8GA 2GVBA 1KIXA 1SJHD 4IUVA 5COYA 5IWAQ 2I46A 4LK1C 5IE8A 5FLMH 4IOCA 5CGKA 4ABNA 1G291 2QEJC 3I56A 4DR4L 2JE6I 4NXNQ 2XWBB 1SYFA 1CM9A 5FO7B 5ISRA 1IYVA 1NMGA 3Q0AA 2RDFA 4YWLA 2WKCA 3J81i 1EOVA 5C4HA 4IFDH 5J1ZA 3KF6A 4JV5L 2VNUD 2MO0A 4A3JH 4LAAA 4C1NI 1HZCA 1F2YA 1GUOA 1HZBA 3S16H 4RCNA 4FYDA 1ZEQX 4DV5Q 5H1SE 3QWNA 2M9VA 4J6HA 4KI0A 2RA4A 4RFBA 3T16A 5CORA 1SNPA 4BS9A 2PZWA 3PUXA 3VR5A 1IW7C 1Y8NB 3DM1A 1I50B 5KNCA 2HHHQ 2ZJQA 2KBNA 1J8IA 2R92B 4C1NK 1EY5A 3CRKC 3L9AX 3K80C 1RTOA 3BYTB 4DUYL 1WTQA 4P75A 2KUMA 2UU9L 3AMUA 1EQRA 2AQ2B 3BZDB 2KVMA 5IT9c 4RGTA 5G3LD 4NXML 3SK4A 2E5LQ 3PUZA 3PV0A 2QGQA 4PZ8A 1K8MA 4NW2A 4HR7B 1VQDA 4BWGB 1G91A 1Y1VB 3DXJC 1M8AA 2K5WA 1C7YA 1JE4A 1BCPF 2B2YA 5C0XJ 1B1ZA 1RF2D 2MHVA 3ND9A 5IGBA 4DV7L 1YNND 3JAMc 3GDEA 5KNDA 1B9NA 1MBYA 3T53B 5M3FB 3W5OA 3LGJA 1N32Q 1I4RA 1U4PA 5C0XG 2A6HC 4A3EG 4I7ZC 3VA7A 3RZOH 1Z47A 2L12A 3HOZH 4DAYB 3VR6A 1KLGD 3LNNA 1B7YB 4L5RC 1E7ZA 4TKOB 4A3FB 2PYKA 2J4XA 4N8X1 1Q90A 1PYWD 4AYBG 5CC4A 5A2QL 4OGQC 1STEA 3J7AV 3GTOB 3S1RB 1WVLA 3GTMB 4K5XA 4LWCA 5JPNC 1TS3A 1L0WA 2PNRC 3G48A 5C44B 1ZYRC 2G9DA 3VYUA 5E3FA 3PCOB 4OIKA 1V1PA 3BVGA 5KIXA 5AJ3Q 1Y8OB 2CVRA 3NWTA 2HHHL 1HQRD 4A3LH 1K8AC 2KCTA 4O2DA 3RZOB 3I72A 1ML0D 3DLLA 4JI1Q 1CK1A 1UE7A 1CHQD 1CQVA 2JJQA 2F3IA 4NDXA 1X65A 2YU9B 4A3JB 4X64L 3ZJYC 3SR1A 2I5MX 5I6WA 4P71A 4FVMA 1LLRD 4ILWA 3Q22A 1VQLA 1PZJD 1QUQA 1LTID 5BN5A 4DUZQ 4K8IA 1AZQA 4C3JH 2O4XA 4LF6Q 3S2DB 1XTCD 1B3QA 1EWIA 5CV5A 3TP5A 1BCPD 1UUPA 1KRSA 2VW9A 5M9OA 4F88A 1YIJA 1V1QA 3J7AF 3PUWA 1IYJB 2JP1A 4JI0Q 4A3MB 5I2YA
chains in the Genus database with same CATH topology
4IALA 1TU2B 3EFXD 3E5SA 2KEEA 4HN7A 2F03A 2BDOA 1EIHA 4RA8A 5T1IA 4HMIA 2F0PA 1JOQA 4KKUA 5EPKA 2B2TA 3KBGA 3TP7A 2NN6H 1BUVT 2KOLA 5CV9A 3I3CA 2GA4B 2A6EC 3PUYA 4A3IB 2I07B 1NUCA 1HA6A 2KCCA 3GV6A 5CV4A 2NN6I 5CBEE 4B9WA 2IX0A 4FXKC 1FYCA 2JA6B 2KEDA 5E4WC 4QB4A 1U9RA 5CV6A 3M7GA 2LFNA 1G6ZA 5EJWA 4UDUC 3J7YW 4H0LC 4MIUA 4L8JA 4OIJA 3K58A 5FKAC 2RDHA 1H9SB 2F1MA 1QNUA 3O13A 3TN2A 4DXGA 2MUYA 2J0TD 1G8ZD 4OL7A 2A6ED 1SSOA 3SEBA 3FMCA 5M3MB 4Q0FA 2Z4IA 3PIP3 4KHZA 3KBXA 4BY1B 4G57A 1I6HB 5I9OA 4L63B 3K5MA 1LT4D 4KY5A 4ZRZA 4OO1G 1RDPD 1GHJA 2B2UC 4IN3A 1I4XA 1DOMA 3OIQA 3QOJA 1GUSA 2HUGA 1EY9A 4BA2I 4WFN3 1EYAA 3VYTA 4FF4A 3W3AA 2OXPA 4F87A 4FO2A 4K2LA 1SDFA 3A7AB 2CHBD 1H9KA 4KD4A 2AUJD 1JB3A 2Q8IB 4QIWB 2A5HA 3WDNA 3JAML 4WRDA 1GJXA 3BVZA 4QF4A 1DZ1A 4G7ZC 2X6GA 1H9JA 1OO9B 1XXGA 1O7ZA 2JEBI 3F2UA 3GTLB 2F0KA 3DEPA 2JEAI 3D3RA 1TWAB 2B39A 2D5DA 3FDTA 3Q23A 1V1OA 2A68C 3RLFA 3P75A 3ITPA 1EY7A 1A2TA 2QCPX 5ELCA 5IGGA 3NK9A 5I2XA 4JBWA 1LTBD 3WOFA 3GTPB 3MEHA 3PUVA 1IW7D 3HOUB 1J9OA 4P2CB 1AEXA 1M4VA 4TRDA 4ODGA 1VF7A 5J39A 1HTPA 2F3VA 1KDAA 1HFGA 2AWNA 3SHLA 1BCPB 4NKLA 1UAPA 2F4IA 1KNEA 2E2IB 4L6TB 4CJ1B 1SXTA 4M8AA 4K2KA 5CYUA 2EJGC 2PPBC 1LTGD 1UNSA 3I70A 1S5FD 1WD0A 1MI2A 4DAVA 1ICWA 2DN8A 2F0UA 3OIPA 1EQTA 3MWYW 5EKLA 4PMCA 1EZ8A 3VR3A 3MHBA 4C3JG 1XWEA 2EJFC 2F0FA 4LJZC 4ZKCB 2XRSD 5M5XB 4HCSA 4IUTA 1NAPA 3DMUA 1QWYA 3J81L 1F9PA 2A6HD 1DOLA 3A56A 1PZKD 5I4DA 2K05A 1JOOA 4RGNA 3I4LA 4ID6A 3R8BA 4X3KA 1RCVD 2DY7A 3GTKB 3RD4A 2HDLA 2XNAC 4K5VA 2KHSA 3BG3A 1JCKB 2VUMB 1PXUA 5EKKA 3MXGA 5C4JB 4RGOS 1ENCA 2AWOA 5K36H 1ONLA 2RBMA 5C5LA 2E76C 1SYBA 1QE6A 2A74C 4BBRB 3RUZA 1R4PB 4H7BA 4HMJA 2F0NA 3VR2A 1WTPA 4RHSA 1OXXK 1Z6HA 1QNKA 2BE5D 1FNUA 3N52A 4CHTB 2Z1CA 4OHJA 2EYJA 5FLXE 1WTWA 1ET9A 3MAQA 2EJMA 2F0DA 3H09A 4FXGC 2EYLA 4ZUJA 2ID0A 5BN4A 1B50A 4K5WA 1BBXC 1LT6D 4EVOA 2F0EA 1SE2A 3IL8A 2AQ3B 1K8OA 4IUUA 3SK8A 4A3KB 1OXVA 4TSSA 2VXWA 2KECA 1I4QA 3X3MA 1EY6A 5C5MA 2BE5C 2EYOA 1PRTC 3QO2A 3EROA 2NYZD 2IWHA 1X3PA 1EOTA 3VA5A 1OXSC 4WJWA 4E6IA 4UAIA 3K5LA 1GOZA 1ESRA 1S5CD 2F0LA 5CMDA 1TY2A 4XQJA 1D5MC 5FOBB 2ICEC 4ZK9B 1F77A 2A69D 1CA6A 1Q1BA 3G6JB 1CZWA 2QKIC 3OW7A 3MZ5A 3PO2B 1SYDA 1NR4A 1WCMB 1IYUA 2FHTA 4RGMA 4CKCA 3C46A 2WINB 3HRZC 3D6WA 3R3OA 3NWSA 3A8IE 4F8MA 1NCVA 1STBA 1PFNA 1LTTD 3SK6A 2B63B 4FP5D 2OT2A 1A2UA 1D6EC 5F2DA 4S3SA 5CV8A 2L5TA 1X32A 2E75C 3V05A 3MFGA 2BA0A 3DWAA 3I4MB 3NQTA 1PTOH 2B2VC 4KY7A 3NPPA 2L11A 3LWEA 3ONAB 3DUZA 2NZ1D 5KYIA 2R61A 3GTGB 4FF3A 1TR5A 1EU4A 3Q24A 1BCPC 2CW0D 1RODA 1PDQA 1V8QA 3K7AB 5EPLA 2F3WA 4K6DA 4G7HC 1IL8A 4BY7B 5JEAH 5IIFA 4K14A 5ELFA 1JC7A 4PMBA 2C9OA 5KNBA 3MC0B 1IKMA 2L4NA 1KDCA 5D14A 1Q3LA 1O78A 1SMYC 2SNMA 4ZLTF 4CKBA 4OO1H 2H1EA 4OO1I 3K57A 2IL8A 4C3HG 4KKTA 5BN3A 3S15B 4RWSC 1JWMD 1X3QA 3TP6A 1RHPA 3NXWA 1E2ZA 2BDNA 4X3TA 1TKWB 4EQOA 3S2HB 2EDGA 1PLFA 3DWQA 2OF1A 4H44C 4J1MA 5JVH3 5JOBA 5DNFA 3BVMA 4YIJA 3K5NA 3R2IA 5IGCA 1C8CA 1IHZA 5HGTA 1F9QA 2NTSA 1RTNA 4KHVA 1TS5A 3H0GB 3KLRA 3TZDA 2WAQB 5C0XI 1SE3A 1XYIA 1SNQA 1CA5A 3M85A 3M3YB 1F2LA 3FEWX 3BDLA 2RQXA 4KKSA 1CFMA 2BCOA 4R8NA 4XQQA 1PTOB 2NVYB 1KABA 3CQZB 1BF4A 2JYOA 2SOBA 3W2DA 2RKSA 4XT3B 3IKJA 1Y1WB 2LS01 3HZXA 3D4DA 1PRTD 5EPJA 1PTOF 3D8GA 1SEBD 2PCFB 3HKZB 3NP8A 4HSVA 5C6AA 4DF7A 2MGSA 4B08A 5IGEA 5JAVA 3NTIA 4KK7A 2OEOA 2FMMA 3HOWB 3E6ZX 3DWPA 4N9PA 4FNFA 4A3DB 4CGYB 5IT9L 4N9TA 3HGBA 1TWFB 2L55A 4IUPA 1V43A 2CW0C 3OOCA 1TWHB 3SVMA 2HDMA 3VYSA 1RJTA 2RDGA 1W6KA 1VMPA 1O80A 2WB1B 4RKBA 2D62A 3I4NB 3QJYA 5NUCA 1GUGA 4M1UB 1LABA 3NTKA 2B2TC 5IOCA 3H3VC 3M4OB 2R7ZB 3TZUA 3KK7A 4QMGA 4CJ0B 1U4LA 2SEBD 3S9WA 2JA7B 2XN9C 4RHRA 2ZT9C 1DYQA 3J81E 4Q5VA 1LV9A 1CI3M 1JWSD 3RZDB 4ZKBB 3ND8A 2WACA 4DAPA 1CHPD 1NSNS 1QOHA 1HUNA 1EWHA 4A3BB 2F0MA 2E2JB 5C4XB 3RMHA 4C56C 4DU9A 3OSOA 3SXHA 4XQNA 1KNAA 1SE4A 1BOSA 1NR2A 4FF1A 1F9SA 1HTLD 1BQQT 1QB5D 3FKIB 3K0YA 5EGTA 3TP8A 1T5XD 3CHBD 4C3IG 2WKDA 1TS2A 3S1QB 3HS0C 4FF2A 1SYGA 1W6JA 4K6LA 3HOZB 2K7VA 3OHXC 4DAYA 3A55A 1VMCA 4U673 2C5CA 3T51B 1TVXA 1MSHA 5AFWA 1HPCA 1LACA 4IFDG 3MA2B 4ME5A 2EYMA 2XIWA 3LX0A 3GTJB 4RAUC 2O5IC 2Z4HA 1BXTA 1LT3D 3QG1A 1EL0A 3L7ZC 4JK1C 1SJED 3NHHA 3KLSA 4B9XA 2HCCA 1KLUD 2QF7A 4O1NA 4XIGS 1D2BA 2N88A 5JPMC 1ILQA 2K04A 2JXMB 3OMCA 1S4ZA 2PZUA 1D5ZC 4PQXA 4PMWA 4ULLA 4XYOA 5K36G 1T5EA 5I6YA 1TQOA 1EIGA 4IUNA 1SNMA 2V4DA 4X3UA 2KJXA 2IPKD 4DN4M 3MXPA 1ZYRD 1D1IA 3SDZA 1PFBA 2L0CA 3HOVB 5D3DA 2IX3A 1B2TA 2LMCB 3S17B 3U9OA 1STNA 2B2UA 3HOYB 3C1EA 4U68A 1WTVA 1Q8IA 4IFDI 4XT1B 3V2TA 4K8JA 4IZ8A 4RH6A 5JVG3 4XDXA 1U4MA 4KD3A 1TWCB 1I4PA 2Z8LA 2EYPA 1WTOA 3K5OA 5JEAJ 3IFDA 2FJ2A 2RSOA 3P20A 5DAUA 3T13A 3MXNA 4BBSB 1GUWA 2E2DC 1STYA 2FFKB 4XTCS 1Y8PB 1FR3A 2YYZA 1DXMA 3HP3A 4O42A 2WIIB 1PMRA 2K1BA 3HG9A 1A15A 1Y69U 1UEAB 3IAYA 4ZUIA 4X3SA 2JA8B 1CTMA 3S1NB 1S5BD 2ENBA 1TS4A 2K5DA 2B2WC 1I3QB 4Z9CB 3QB3A 4H13C 3FPPA 1ENFA 3P1HA 4KN7C 2M00A 2K5QA 2VB3X 1DM0B 5IGFA 1TY0A 2B2WA 4C3JB 1LO5D 4C2MB 5CBAE 3CRLC 4QUFA 1PTOD 3DEOA 4XYQA 2K28A 1PRTF 1DJRD 3NUCA 4PV1C 5D3IB 4CBVA 3R2TA 2K33A 1DOKA 1TWGB 1GHKA 3I91A 4HTHA 1LTRD 1SNCA 5A35A 5C3EB 2D9UA 1O7LA 2B2YC 1SYCA 5ELEA 2NVXB 4R8IA 5FO9B 5EBCA 3Q6SA 2L9HA 3TBIB 3FVQA 1HA5A 1G2TA 1MD2D 1SNOA 1JOKA 1D1KA 3NBIA 1U4RA 2E2HB 1QG7A 2F0SA 1EYDA 1Q1EA 2WV6D 3X3NA 3C2PA 1VDZA 1AN8A 1ZKOA 4RKLA 1F2ZA 4I65A 4KJOA 3E0JA 3D4RA 5KYLA 4EGVA 2PW5A 3TDQA 3MXUA 3FRPB 4BA1I 2PZTA 1HXYD 3QOLA 3GD7A 5JJZA 5ELDA 2R3ZA 5A2QE 1A6XA 2XRQD 1WTXA 1B53A 2LY7A 1SNDA 3G7LA 1EFID 3L3OC 2LKVA 1FNWA 2J7ZA 4DXFA 1S5ED 4TQUS 1TIID 1EEID 3MFYA 2A68D 1H9MA 4DK0A 4EQPA 5DM63 3S16B 1JWUD 2NUCA 3EA6A 2EY5A 1R4QB 2SDFA 3KLSX 1LT5D 3QIAA 1ILPA 5C3XA 5EKIA 2M2LA 4LMQD 1YNJD 2F0OA 2R93B 1JICA 1GXDC 1XX8A 4ZYSA 2DY8A 2EOTA 1EWCA 1HCZA 3KF8A 3LWUA 2MJ8A 3GQBA 1AZPA 5E1FA 1Z7TA 3U9SA 1L0YB 5EBDA 2ICIA 1EY8A 3C3LA 4Y7NB 2EY6A 3S1MB 1F9RA 3HEJA 1DD2A 4DA2A 5IODA 4DGZA 2F0WA 1HFNA 5T1GA 3VYRA 5IGDA 4IURA 2IX1A 1HUMA 5ELBA 1CT1D 2SNSA 3NQIA 2TSSA 2K32A 3AU7A 2EZVA 1SAPA 4NP5A 3I90A 4A93B 1CZGA 3IFTA 1A3TA 3J80E 3OWEB 2JA5B 5J22A 1I4GA 3EQLC 1STGA 1AP0A 1B44D 2FINB 4PNYA 1EY4A 4V190 1S5DD 2MP1A 5FLXL 3ERQA 2NN6G 1EY0A 2XSCA 4KY6A 1PTOC 3H91A 4KN4C 2QILA 3H94A 2O2LD 1PRTB 2NWGA 1LTAD 4A3GB 2VB2X 1HQMC 3TMEA 2D2CC 1O7YA 1ZXTA 3BDOA 2TMPA 2B8FA 4HEDA 4GZYC 2KCNA 2X69A 1FD7D 2PQEA 1EZ6A 3GV3A 2PMZB 5G3LF 2FMCA 1II3A 2XWJB 2CQAA 1LTSD 1E2WA 4J8QA 3I73A 3A7LA 3HOXB 2RVLA 2E74C 1FGBD 2EYHA 2PW7A 5DEHA 2G9HD 1B9MA 1R9TB 5FO8B 1L0XB 5C3WA 1STHA 1SMYD 2L1BA 4QCLA 2BOSA 3N6RA 2XVSA 1GUNA 1I4HA 3FPUB 4HAEA 5E4XA 3I8ZA 1SBBB 3UI2A 2MPMA 2EY1A 5C0XH 4IUQA 3C1FA 4ZAIA 3T56B 1YNJC 5CR3A 1VF5C 1I6VC 5KRUA 4A3EB 3M7NA 5LL6X 4RCOA 2ZXOA 1GUTA 1A3VA 1BNZA 1MGSA 1ESFA 2R6GA 3BS1A 1G2SA 4MN3A 2NVQB 2F0JA 3NSWA 2NVTB 3D4WA 1YNNC 2ZXPA 5EQ0A 1STAA 2HQEA 3SE0A 5FK9C 3JAME 2K01A 4C3HB 2JSOA 1F2MA 1EU3A 2EY2A 5D65A 1EQVA 4HSPA 3OPOA 3CU7A 2QDBA 2IJ0A 1VCIA 1FNVA 2A73B 4CKEA 1ET6A 3PMFA 4DFAA 2EXZA 1Q12A 2F0TA 3A54A 2F0GA 3NE5B 3K59A 1CQFA 1H9SA 4R9WA 5IT9E 1EEFD 4DNTB 1SYEA 5DM73 2F0VA 1PFMA 4C3IB 2AQ1B 3NBHA 3R93A 2F0HA 4V0BA 2RSNA 5K5PA 2DNEA 2IT1A 1WTRA 1EYCA 3MVVA 2HCIA 4DK1A 1SFOB 3NTHA 1KDBA 3GTQB 1V1PB 2F0QA 3H6MA 3D6CA 1AFPA 3M4YA 5M5YB 4XXEA 2EE1A 5CV7A 4G4KA 3MTSA 4KJNA 5LHY1 4G7OC 4ZQ3A 5M5WB 1RKNA 3T4AC 4HCEA 2N55A 4FXDA 5LL6S 2KA7A 3DHQA 1JQYD 1B3AA 2WP8J 3J80L 1OXUA 4QUCA 1C48A 2K6AA 2Q8RE 2A69C 4KV6A 3GP7A 1B4OA 3URYA 1A3UA 3VR4A 4KTAA 3OMGA 3PO3B 2EVBA 1DONA 5HURA 2EYFA 3EVQA 2F0IA 1KAAA 3OWFA 1BDOA 1BR9A 4NMZA 1C4QA 3EJIA 1AW7A 2O5JC 3A8JE 1D5XC 3AB9A 5TSSA 4IQZA 1H9RA 1HHVA 5KGUA 1IKLA 5JEAG 5KEEA 3V96A 1JORA 1RD9D 1ENAA 1BO0A 3GO5A 2DNCA 4DNRB 1JR0D 3S14B 2NBFA 1K83B 5I9PA 2Q8TA 4F7XA 4MHEA 2NB0A 3BDCA 1QCBD 1TT2A 3BYYB 1E2VA 2ZXRA 2NTTA 2X6LA 1OXTA 1PZID 1KTKA 1QJOA 2Y0SB 3SK5A 3D31A 3TSSA 1QILA 1MSGA 4AYBB 3P7JA 3KUPA 4IFDJ 4CJ2C 3K6OA 2H4OA 3WOEA 1WD1A 4EQNA 3ZYYX 3PIO3 2B2VA 2AUKA 4KMUC 2BA1A 2K03A 1DCZA 2IW3A 2EPBA 3CKIB 4WORA 2KQ3A 3A8KE 1E0BA 2PO4A 5C4ZA 1HRJA 2B8GA 1SJHD 4IUVA 5COYA 2I46A 4LK1C 5CGKA 4ABNA 1G291 2QEJC 2JE6I 2XWBB 1SYFA 1CM9A 5ISRA 5FO7B 1IYVA 3Q0AA 2RDFA 2WKCA 5C4HA 4IFDH 5J1ZA 2VNUD 4LAAA 4C1NI 1F2YA 1GUOA 4RCNA 4FYDA 1ZEQX 3QWNA 2M9VA 4J6HA 4KI0A 2RA4A 4RFBA 3T16A 5CORA 1SNPA 4BS9A 2PZWA 3PUXA 3VR5A 1IW7C 1Y8NB 3DM1A 1I50B 5KNCA 1J8IA 2R92B 4C1NK 1EY5A 3CRKC 3L9AX 1RTOA 3BYTB 1WTQA 2KUMA 3AMUA 2AQ2B 3BZDB 2KVMA 4RGTA 5G3LD 3SK4A 3PUZA 3PV0A 1K8MA 4NW2A 4HR7B 4BWGB 1G91A 1Y1VB 3DXJC 1M8AA 2K5WA 1JE4A 1BCPF 2B2YA 5C0XJ 1B1ZA 1RF2D 2MHVA 3ND9A 5IGBA 1YNND 5KNDA 1B9NA 1MBYA 3T53B 5M3FB 1I4RA 1U4PA 5C0XG 2A6HC 4I7ZC 3VA7A 1Z47A 2L12A 3VR6A 1KLGD 3LNNA 4TKOB 4A3FB 2PYKA 2J4XA 1Q90A 1PYWD 5CC4A 5A2QL 4OGQC 1STEA 3J7AV 3GTOB 3S1RB 1WVLA 3GTMB 4K5XA 5JPNC 1TS3A 2PNRC 5C44B 1ZYRC 2G9DA 3VYUA 5E3FA 4OIKA 1V1PA 3BVGA 5KIXA 1Y8OB 2CVRA 3NWTA 1HQRD 3RZOB 3I72A 1ML0D 1CK1A 1CHQD 1CQVA 4NDXA 2YU9B 4A3JB 3SR1A 5I6WA 4FVMA 1LLRD 4ILWA 3Q22A 1PZJD 1LTID 5BN5A 4K8IA 1AZQA 2O4XA 3S2DB 1XTCD 5CV5A 3TP5A 1BCPD 1UUPA 5M9OA 4F88A 3J7AF 3PUWA 2JP1A 4A3MB 5I2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZI D;  1TS2 A;  4L6T B;  1KTK A;  4RH6 A;  1I4X A;  1SXT A;  4RHS A;  3EFX D;  4K6L A;  1FNU A;  5ELE A;  1LTT D;  4OHJ A;  1I4P A;  2Z8L A;  3GP7 A;  3BVM A;  4BWG B;  3TSS A;  1LTG D;  1QIL A;  3R2I A;  1ET9 A;  1FD7 D;  1HA5 A;  1UNS A;  1D6E C;  1S5F D;  1BCP F;  4ZYS A;  3CHB D;  2RDG A;  1B1Z A;  1EWC A;  1MD2 D;  2NTS A;  1RF2 D;  3URY A;  1LTS D;  5FK9 C;  1LT6 D;  1EU3 A;  1L0Y B;  1TS5 A;  1FGB D;  2ICI A;  3V05 A;  2G9H D;  2CHB D;  1SE2 A;  1I4R A;  3MFG A;  3DWA A;  1SE3 A;  2WV6 D;  2AQ3 B;  2SEB D;  2IJ0 A;  1PTO H;  1KLG D;  1AN8 A;  1BXT A;  1AW7 A;  1L0X B;  1FNV A;  1LT3 D;  2XRS D;  2XN9 C;  1ET6 A;  2J4X A;  4RHR A;  3BVZ A;  4TSS A;  1PYW D;  1I4Q A;  2R61 A;  1DYQ A;  1SJE D;  1D5X C;  1STE A;  5ELB A;  1SJH D;  1CT1 D;  1XXG A;  5TSS A;  1KLU D;  1EU4 A;  1PTO B;  1BCP C;  2TSS A;  4O1N A;  1EEF D;  1PRT C;  3W2D A;  1TS3 A;  4UDU C;  1JWS D;  1I4H A;  2QEJ C;  1D5Z C;  1PZK D;  1HXY D;  2AQ1 B;  5I4D A;  3OWE B;  5FKA C;  2RDH A;  5ELD A;  1S5B D;  4RGN A;  1V1P A;  3BVG A;  1CHP D;  1TS4 A;  1I4G A;  3R8B A;  1RCV D;  4Z9C B;  1PRT D;  1SBB B;  3O13 A;  1HQR D;  2XNA C;  1V1O A;  1PTO F;  1RD9 D;  2XRQ D;  1B44 D;  1ENF A;  1GOZ A;  4DXG A;  1SEB D;  2IPK D;  1CK1 A;  1CHQ D;  5ELC A;  1S5C D;  5ELF A;  1CQV A;  1S5D D;  1G8Z D;  1TY0 A;  4C56 C;  1EFI D;  1JCK B;  1V1P B;  1LTB D;  1LO5 D;  1TY2 A;  4RFB A;  1JR0 D;  1D5M C;  3MC0 B;  3SEB A;  1LLR D;  1FNW A;  1F77 A;  1PTO D;  4DXF A;  4RCO A;  1PTO C;  5D3D A;  1PZJ D;  4RGO S;  1S5E D;  1LTI D;  1PRT F;  1DJR D;  1SE4 A;  1M4V A;  1EEI D;  2QIL A;  3BYT B;  5D3I B;  2O2L D;  1HTL D;  1XTC D;  3R2T A;  4L63 B;  1PRT B;  1JWM D;  3BYY B;  1BCP D;  1UUP A;  1LT4 D;  1LTA D;  1JWU D;  3EA6 A;  4RGM A;  2AQ2 B;  3BZD B;  2NTT A;  3DWP A;  3KLS X;  1LTR D;  1ESF A;  1JQY D;  1BCP B;  1LT5 D;  4RGT A;  1RDP D;  1T5X D;  3DWQ A; 
#chains in the Genus database with same CATH topology
 4IAL A;  4GLA C;  1TU2 B;  3EFX D;  3E5S A;  2KEE A;  1K28 A;  4HN7 A;  3HOU G;  1YNX A;  2F03 A;  3B6Y A;  2BDO A;  4LF8 L;  1EIH A;  4RA8 A;  5T1I A;  4HMI A;  2F0P A;  1JOQ A;  1YHQ A;  4KKU A;  5EPK A;  2B2T A;  4A3K G;  4BY7 H;  2R92 H;  3KBG A;  3TP7 A;  3ER0 A;  3MEF A;  1GVP A;  2NN6 H;  1BUV T;  1WJJ A;  2KOL A;  4YCW A;  5CV9 A;  3I3C A;  2UUB L;  2GA4 B;  1L1O B;  2A6E C;  3S1Q H;  1AE3 A;  3PUY A;  4A3I B;  2I07 B;  1VQ5 A;  1NUC A;  1E1O A;  1QUQ B;  1XNQ Q;  1HA6 A;  2KCC A;  2N8N A;  3GV6 A;  5CV4 A;  4J15 A;  2NN6 I;  5CBE E;  4B9W A;  2CH4 A;  2IX0 A;  4FXK C;  1FYC A;  4IPG A;  2JA6 B;  2KED A;  5E4W C;  2KHI A;  4QB4 A;  2K52 A;  1NMF A;  1PH4 A;  1U9R A;  3H15 A;  5CV6 A;  4JI4 Q;  3M7G A;  2LFN A;  2JA5 G;  1G6Z A;  5EJW A;  4UDU C;  3J7Y W;  4H0L C;  1NNX A;  4MIU A;  4L8J A;  4OIJ A;  3K58 A;  2EQS A;  2RDH A;  5FKA C;  1H9S B;  2F1M A;  3F2C A;  3PGZ A;  2CWA A;  1QNU A;  3O13 A;  4IJL A;  4DR2 Q;  4AH6 A;  3TN2 A;  3ERS X;  4DXG A;  1X3G A;  2MUY A;  2ZJP A;  2J0T D;  1G8Z D;  4OL7 A;  4AIM A;  2A6E D;  3CC7 A;  1SSO A;  3SEB A;  3FMC A;  5M3M B;  1XPU A;  2P5Z X;  4Q0F A;  1WTH A;  2G5D A;  1L1O A;  2Z4I A;  3PIP 3;  4KHZ A;  2VS1 A;  1X9N A;  3KBX A;  4BY1 B;  1RIP A;  4JI6 Q;  5LMN Q;  4G57 A;  1I6H B;  5I9O A;  4L63 B;  2Y0S E;  3K5M A;  1LT4 D;  1QVF A;  3S2D H;  4Y52 H;  4KY5 A;  1V9P A;  1PH8 A;  2ASB A;  4ZRZ A;  4OO1 G;  1RDP D;  2R93 H;  1GHJ A;  2B2U C;  4IN3 A;  1I4X A;  4R4Q A;  1A0I A;  4LF5 L;  1DOM A;  3OIQ A;  3QOJ A;  1GUS A;  2HUG A;  1Q7Y C;  5JJK A;  1EY9 A;  3K81 C;  4WFN 3;  1A8V A;  5C3E H;  4BA2 I;  1EYA A;  4IPC A;  3VYT A;  4FF4 A;  3W3A A;  4PZ7 A;  2OXP A;  3RNU A;  3AEV A;  4F87 A;  4FO2 A;  4X62 L;  4K2L A;  1SDF A;  1HNZ L;  3A7A B;  3K7A H;  5LMU L;  2CHB D;  1GO3 E;  1H9K A;  4KD4 A;  2AUJ D;  1JB3 A;  4WJ3 M;  2Q8I B;  3NBH B;  4QIW B;  2A5H A;  3WDN A;  3JAM L;  3I55 A;  3KJP A;  4WRD A;  4HJA A;  3STB D;  1I94 L;  1GJX A;  3BVZ A;  4QF4 A;  1DZ1 A;  3G6E A;  4G7Z C;  4A3F H;  2X6G A;  1H9J A;  1OO9 B;  1XXG A;  1O7Z A;  1KL9 A;  1R9T H;  2JEB I;  3F2U A;  3GTL B;  1CKM A;  2F0K A;  2N78 A;  4A3M H;  3BU2 A;  2UXC L;  3DEP A;  1XMQ Q;  5C44 G;  2JEA I;  3CF5 A;  1N36 L;  3NEN A;  3D3R A;  3PO2 H;  2I0Q A;  3M4O H;  1TWA B;  3G71 A;  2B39 A;  2D5D A;  3FDT A;  4DR1 Q;  3Q23 A;  3H3V H;  1V1O A;  2A68 C;  1J6Q A;  1SRU A;  3P75 A;  1SR3 A;  3RLF A;  3ITP A;  1EY7 A;  3A74 A;  4DNI A;  1W2B A;  1A2T A;  2QCP X;  1G6P A;  1NY4 A;  5ELC A;  5IGG A;  1I3Q H;  3PIO A;  4A3C G;  3NK9 A;  5I2X A;  3ULJ A;  4JBW A;  1LTB D;  1Q81 C;  3WOF A;  3GTP B;  1LM0 A;  3MEH A;  3PUV A;  2ZTE A;  5GAH C;  3OTO Q;  1IW7 D;  3HOU B;  1J9O A;  4P2C B;  1K3R A;  3GTL H;  1AEX A;  1M4V A;  4TRD A;  4ODG A;  2UUA Q;  1VF7 A;  4BBR H;  1HTP A;  5J39 A;  1PHJ A;  4R1J A;  3U58 A;  2F3V A;  4A3B H;  1KDA A;  1PYS B;  1HFG A;  2AWN A;  2Q2H A;  3SHL A;  1TWA H;  4DV0 Q;  2WFW A;  1BCP B;  4FDB A;  4NKL A;  1UAP A;  2F4I A;  1KNE A;  3E9I A;  2E2I B;  4L6T B;  4CJ1 B;  1SXT A;  4M8A A;  4K2K A;  5CYU A;  2YU9 H;  2EJG C;  2PPB C;  3E9H A;  1I50 H;  5C3E G;  1LTG D;  1UNS A;  4QY7 A;  4GN3 B;  3I70 A;  1S5F D;  3M4P A;  4QGU A;  1VQJ A;  1WD0 A;  1MI2 A;  4DAV A;  4LUO A;  4Y7N H;  1ICW A;  1U0L A;  2DN8 A;  2F0U A;  3OIP A;  1EQT A;  3MWY W;  5EKL A;  2YTX A;  4PMC A;  1EZ8 A;  1YJ9 A;  5BR8 Q;  4X62 Q;  3VR3 A;  3MHB A;  1TWC H;  4P73 A;  4QL5 A;  4C3J G;  1XWE A;  2EJF C;  2F0F A;  4LJZ C;  4ZKC B;  2XRS D;  5M5X B;  4HCS A;  4IUT A;  1NAP A;  3DMU A;  1QWY A;  4NB3 A;  3J81 L;  3FKI H;  1F9P A;  4CDD C;  1XMO L;  1E3P A;  2OWO A;  2A6H D;  4DK3 C;  2QA4 A;  1DOL A;  3A56 A;  1PZK D;  4DR3 Q;  5I4D A;  2K05 A;  1JOO A;  4RGN A;  3I4L A;  3H0G G;  4ID6 A;  3R8B A;  4X3K A;  1RCV D;  2DY7 A;  1M90 C;  3RD4 A;  3GTK B;  2HDL A;  4YCV A;  4HIK A;  2XNA C;  2Z6K A;  4K5V A;  1BBU A;  2KHS A;  1GM5 A;  4QIW E;  3BG3 A;  1JCK B;  2VUM B;  1PXU A;  5EKK A;  4DUZ L;  4MZ9 A;  1Y1V G;  3MXG A;  3M9B A;  5C4J B;  1FGU A;  4RGO S;  1ENC A;  2AWO A;  5K36 H;  3RLN A;  1ONL A;  2RBM A;  5C5L A;  4JI4 L;  2E76 C;  1EYG A;  1N34 Q;  4YY3 L;  1SYB A;  4A3D H;  4NPS A;  4JOI A;  1QE6 A;  2A74 C;  4BBR B;  3FP9 A;  3RUZ A;  5IYD H;  1CSP A;  1R4P B;  4H7B A;  4HMJ A;  2F0N A;  3VR2 A;  1WTP A;  4RHS A;  1OXX K;  1Z6H A;  2R92 G;  1QNK A;  2BE5 D;  5GAE C;  1FNU A;  2K75 A;  3N52 A;  4CHT B;  2Z1C A;  4OHJ A;  1HNZ Q;  4JI0 L;  5JJL A;  2EYJ A;  5FLX E;  1WTW A;  1ET9 A;  3E0E A;  2GVA A;  3MAQ A;  2EJM A;  5IWA L;  2F0D A;  3H09 A;  4FXG C;  2EYL A;  4ZUJ A;  1XJV A;  2ID0 A;  3K0X A;  5BN4 A;  4I7A A;  4DV6 Q;  1B50 A;  2R7Z H;  4K5W A;  1BBX C;  1LT6 D;  1KC8 C;  1X6O A;  4EVO A;  4WJ4 A;  2F0E A;  1SE2 A;  3IL8 A;  2AQ3 B;  1K8O A;  2AHO B;  4IUU A;  3SK8 A;  3FKI G;  2CWP A;  1VQ6 A;  4A3K B;  1OXV A;  2D0O A;  3CCQ A;  4TSS A;  2VXW A;  2KEC A;  1G51 A;  1I4Q A;  3X3M A;  1PH9 A;  1EY6 A;  5C5M A;  3KDF A;  1VQE A;  2BE5 C;  2EYO A;  2LXJ A;  1PRT C;  3QO2 A;  1Q82 C;  3ERO A;  4GKJ L;  2NYZ D;  5M3M G;  2IWH A;  1YHA A;  4LF7 Q;  1JE5 A;  4P74 A;  1X3P A;  1EOT A;  3VA5 A;  3T1Y L;  1OXS C;  3TRE A;  2QEX A;  1HR0 L;  4WJW A;  4E6I A;  4UAI A;  2QW7 A;  3K5L A;  4YHH L;  4HJ7 A;  1GOZ A;  1ESR A;  4DR5 Q;  1IZ6 A;  1S5C D;  2F0L A;  5CMD A;  3I2Z A;  1PH3 A;  1TY2 A;  4XQJ A;  4DR5 L;  1D5M C;  5FOB B;  3Q8D A;  2VQE L;  2ICE C;  4ZK9 B;  1F77 A;  2CCZ A;  2A69 D;  5IYC H;  1CA6 A;  1IXR A;  1Q1B A;  3G6J B;  1CZW A;  2OQ0 A;  2QKI C;  3OW7 A;  3MZ5 A;  1K73 C;  1QVG A;  3PO2 B;  1SYD A;  1XMQ L;  1NR4 A;  1WCM B;  4OWW B;  1IYU A;  2FHT A;  1YIT A;  5J3B A;  4RGM A;  4CKC A;  3C46 A;  2WIN B;  3HRZ C;  4C3I H;  3R3O A;  1EUJ A;  3D6W A;  3EBE A;  2CH4 W;  3NWS A;  3A8I E;  4F8M A;  1KXL A;  1NCV A;  2Q2T A;  1LTL A;  2Z6B A;  5M5W H;  1STB A;  1PFN A;  3AQQ A;  1LTT D;  1VS0 A;  3SK6 A;  2B63 B;  4FP5 D;  2OT2 A;  4L5T A;  1WYD A;  4QQB X;  1A2U A;  1D6E C;  5F2D A;  2PQA B;  4S3S A;  1X3F A;  5CV8 A;  2L5T A;  3OTO L;  4JI3 Q;  3H3V I;  1X32 A;  4EX5 A;  3H0G H;  4LF9 Q;  2RF4 A;  2E75 C;  4DV6 L;  1MJC A;  3V05 A;  4HJ5 A;  3MFG A;  1O7I A;  2BA0 A;  3DWA A;  4A3M G;  3I4M B;  3NQT A;  4K0K L;  1PTO H;  2B2V C;  4KY7 A;  3NPP A;  4JI5 L;  2L11 A;  1HJP A;  3UDX A;  3LWE A;  5C4X G;  3ONA B;  1VQF A;  3CPF A;  3DUZ A;  2NZ1 D;  5KYI A;  3CCS A;  2R61 A;  3S1R H;  3GTG B;  1YJN A;  1MJE A;  1TR5 A;  4FF3 A;  1EU4 A;  3Q24 A;  1BCP C;  2CW0 D;  1ROD A;  2ZM6 L;  3KJO A;  1PDQ A;  1V8Q A;  3K7A B;  4HIM A;  4A3J G;  2N49 A;  5EPL A;  4DR1 L;  1WCM H;  2F3W A;  3HKZ G;  4K6D A;  4G7H C;  1UE1 A;  1IL8 A;  4BY7 B;  5JEA H;  1VQI A;  5IIF A;  4K14 A;  5ELF A;  1JC7 A;  4PMB A;  1KAW A;  2JA7 G;  2C9O A;  5KNB A;  1KHI A;  3MC0 B;  2RHS B;  1IKM A;  2L4N A;  1KDC A;  5D14 A;  1SFO H;  4X65 L;  1Q3L A;  1O78 A;  1SMY C;  2SNM A;  4ZLT F;  3J81 j;  4CKB A;  4OO1 H;  2H1E A;  4OO1 I;  3K57 A;  2KHJ A;  2IL8 A;  2R7D A;  4KKT A;  4C3H G;  5BN3 A;  2KCM A;  3S15 B;  2WB1 G;  4RWS C;  4LFA L;  1JWM D;  2RHQ B;  1X3Q A;  5ELN A;  3UDI A;  3TP6 A;  1RHP A;  3NXW A;  1E2Z A;  4BBR G;  2BDN A;  2F4V L;  4X3T A;  1IL2 A;  2I5L X;  1TKW B;  4EQO A;  3S2H B;  4OWX B;  2EDG A;  1PLF A;  3DWQ A;  2ZTD A;  2OF1 A;  4H44 C;  4KHP Q;  4J1M A;  5JVH 3;  5M3F G;  5JOB A;  5DNF A;  1L2F A;  1N34 L;  2CKZ B;  3BVM A;  4YIJ A;  3K5N A;  5C4J H;  3R2I A;  5IGC A;  1C8C A;  3K7U C;  1IHZ A;  5HGT A;  1F9Q A;  4R4I A;  2NZO A;  4GN4 B;  2NTS A;  1RTN A;  4KHV A;  1UEB A;  2JQO A;  1TS5 A;  1E24 A;  3H0G B;  5C44 H;  3KLR A;  3TZD A;  2WAQ B;  5C0X I;  1SE3 A;  4HIO A;  1VQK A;  1XYI A;  3S2H H;  1SNQ A;  1CA5 A;  3M85 A;  3M3Y B;  1F2L A;  3FEW X;  3BDL A;  2RQX A;  4KKS A;  4LF7 L;  1CFM A;  2N3S A;  2RCN A;  2BCO A;  4R8N A;  2UUB Q;  4XQQ A;  4GOP C;  1PTO B;  2NVY B;  2Y0S G;  1KAB A;  3CQZ B;  1BF4 A;  2JYO A;  2SOB A;  3W2D A;  2RKS A;  3S15 H;  4XT3 B;  3IKJ A;  3S17 H;  1Y1W B;  1C0A A;  2LS0 1;  3HOX H;  3HZX A;  4C3H H;  4DUY Q;  2BH8 A;  4LF9 L;  3D4D A;  1PRT D;  4R4O A;  3HOY G;  1PVO A;  2AMC B;  5EPJ A;  1S40 A;  1P16 A;  4C2M H;  1PTO F;  3D8G A;  3L0O A;  4BY7 G;  1SEB D;  2PCF B;  3HKZ B;  2Z6K C;  3HOU H;  3NP8 A;  2WAQ G;  4HSV A;  5C6A A;  5GQO A;  4DF7 A;  2MGS A;  2FXQ A;  4GS3 A;  4B08 A;  3ULP A;  5IGE A;  5JAV A;  3NTI A;  4KK7 A;  1A62 A;  2OEO A;  3A0J A;  4DR7 L;  2FMM A;  3KDF B;  3HOW B;  2LXK A;  3E6Z X;  3DWP A;  4N9P A;  1FJG Q;  4FNF A;  4A3D B;  1AE2 A;  4CGY B;  5IT9 L;  4B3S Q;  4N9T A;  1VQP A;  4UY8 C;  3DM3 A;  5IP9 G;  3HGB A;  4IUP A;  1TWF B;  2L55 A;  2VZA A;  1V43 A;  3U4V A;  4DV2 L;  2CW0 C;  3OOC A;  1MHW C;  1TWH B;  1I6H H;  3SVM A;  2HDM A;  3VYS A;  3CC4 A;  1RJT A;  2RDG A;  1W6K A;  1VMP A;  1O80 A;  2WB1 B;  4RKB A;  4POF A;  2D62 A;  3I4N B;  4OXP A;  2JA7 H;  1NBW A;  2UUC L;  3QJY A;  5NUC A;  1GUG A;  4M1U B;  1LAB A;  2EIF A;  3NTK A;  2B2T C;  5IOC A;  3H3V C;  3M4O B;  2R7Z B;  3TZU A;  2ZM6 Q;  3KK7 A;  4QMG A;  4CJ0 B;  1U4L A;  2OCE A;  2SEB D;  3S9W A;  1VQC A;  4UHV A;  2JA7 B;  1YI2 A;  1WCM G;  2XN9 C;  4RHR A;  2ZT9 C;  3CCV A;  3NEM A;  1PFS A;  1HZA A;  1DYQ A;  3J81 E;  4BXX G;  4Q5V A;  3HOZ G;  1LV9 A;  1CI3 M;  1Q46 A;  2NVY H;  2MQH A;  4A3E H;  1JWS D;  4IJH A;  4ZKB B;  3RZD B;  3ND8 A;  4DR7 Q;  3GTG H;  5IP7 G;  3U4Z A;  2WAC A;  4DAP A;  1Q86 C;  1CHP D;  1NSN S;  4ME3 A;  1QOH A;  3GTM H;  3TS0 A;  1HUN A;  1VQB A;  4L5Q A;  3HFZ B;  1EWH A;  4A3B B;  3UDG A;  2VL6 A;  2F0M A;  2E2J B;  2OTL A;  5C4X B;  3RMH A;  1HR0 Q;  3SGI A;  3WWV A;  4YY3 Q;  1JMC A;  4C56 C;  4DU9 A;  2IHF A;  3OSO A;  1TXY A;  3EN2 A;  3SXH A;  4JC0 A;  4XQN A;  2E2J H;  1KNA A;  3G4S A;  1JJG A;  1BOS A;  1NR2 A;  1SE4 A;  4FF1 A;  2K4K A;  1F9S A;  1UE6 A;  2UXB Q;  1FL0 A;  1HTL D;  1BQQ T;  1QB5 D;  1N32 L;  3FKI B;  1VQH A;  3K0Y A;  4UPA A;  5EGT A;  2Q2U A;  3GTJ H;  1PH5 A;  4BBS H;  3TP8 A;  1I5F A;  1T5X D;  3CHB D;  2WKD A;  4C3I G;  4GNX C;  1CSQ A;  4R4C A;  1TS2 A;  3S1Q B;  2ES2 A;  3HS0 C;  2JN4 A;  4FF2 A;  1SYG A;  1W6J A;  4K6L A;  1VQ8 A;  3HOZ B;  1XPO A;  5M5X H;  2K7V A;  3CMA A;  3PIP A;  1VQ9 A;  3OHX C;  4DAY A;  2XTI A;  3A55 A;  1VMC A;  1QZG A;  3KYH C;  4U67 3;  4B3R L;  1U5K A;  4OX9 Q;  2C5C A;  3T51 B;  1TVX A;  4A3L G;  1PH7 A;  1MSH A;  5AFW A;  1HPC A;  1LAC A;  4IFD G;  3MA2 B;  1SRO A;  2R7Z G;  4X66 Q;  4ME5 A;  2EYM A;  4IPH A;  2XIW A;  3LX0 A;  3I4N G;  3GTJ B;  4RAU C;  2O5I C;  4LFB L;  2Z4H A;  5GAG C;  2B29 A;  3L2P A;  4A76 A;  1BXT A;  1HNW Q;  1LT3 D;  3QG1 A;  1EL0 A;  3L7Z C;  2JA6 G;  4JK1 C;  1SJE D;  3NHH A;  3BZC A;  1CKO A;  3KLS A;  4B9X A;  4DAM A;  2HCC A;  3HOW H;  1KLU D;  2QF7 A;  4OEM B;  4O1N A;  4XIG S;  5DLQ E;  1D2B A;  1VQA A;  2N88 A;  5IYD G;  5JPM C;  3TQY A;  1ILQ A;  2K04 A;  2JXM B;  3OMC A;  1S4Z A;  2PZU A;  2NVX H;  1D5Z C;  4A3D G;  4PQX A;  4PMW A;  4ULL A;  1BBW A;  4XYO A;  3T1H L;  5K36 G;  1YBY A;  4LFB Q;  1T5E A;  5L37 A;  3S14 H;  5I6Y A;  1TQO A;  1EIG A;  4IUN A;  3AFP A;  1SNM A;  2V4D A;  4X3U A;  1L1O C;  2IPK D;  2KJX A;  1S72 A;  4X6A H;  4DN4 M;  3MXP A;  2JA9 A;  4X65 Q;  1ZYR D;  1D1I A;  2VY3 A;  3SDZ A;  1EFW A;  2PNH A;  3GTQ H;  1PFB A;  4UP9 A;  1BVS A;  2L0C A;  3HOV B;  3AYH B;  4JV5 Q;  5D3D A;  2IX3 A;  1B2T A;  2LMC B;  1XMO Q;  3S17 B;  1NE3 A;  1MKH A;  3U9O A;  4DV3 L;  1STN A;  4L5S A;  1DGS A;  2B2U A;  3HOY B;  4PZ6 A;  3C1E A;  4X64 Q;  4U68 A;  1WTV A;  1Q8I A;  4LFC Q;  4IFD I;  4XT1 B;  3V2T A;  4K8J A;  3CQZ H;  4MTN A;  4IZ8 A;  4RH6 A;  5IP7 H;  5M5Y H;  5BR8 L;  4XDX A;  5JVG 3;  1U4M A;  4KD3 A;  1TWC B;  1I4P A;  2Z8L A;  2EYP A;  3BJU A;  1PH6 A;  2CQO A;  4DPG A;  3STB C;  1WTO A;  3K5O A;  3KF6 B;  5JEA J;  4OON A;  2JA6 H;  2E5L L;  3T1Y Q;  3IFD A;  1B70 B;  3S1N H;  2FJ2 A;  1X55 A;  2RSO A;  3P20 A;  4DR3 L;  5DAU A;  2VQF L;  1HNX Q;  3T13 A;  5FLM G;  3MXN A;  4BBS B;  1GUW A;  2VUM G;  2E2D C;  3GTK H;  1STY A;  2FFK B;  4XTC S;  4JBJ A;  1Y8P B;  1FR3 A;  2YYZ A;  1DXM A;  3HP3 A;  4O42 A;  2WII B;  1UE5 A;  4DR2 L;  4AQY L;  2K50 A;  1VQM A;  4UP8 A;  4DV1 L;  1PMR A;  2K1B A;  3HG9 A;  1XNR L;  1A15 A;  5IP9 H;  1Y69 U;  4GKK Q;  1UEA B;  3IAY A;  4OX9 L;  4JPB W;  4LUV A;  2IY5 B;  2VQF Q;  4ZUI A;  4X3S A;  1HNX L;  2JA8 B;  1CTM A;  3S1N B;  1XNR Q;  1S5B D;  2ENB A;  2OTJ A;  1TS4 A;  4A3I H;  2K5D A;  2B2W C;  1I3Q B;  4Z9C B;  1PH2 A;  3QB3 A;  4A3G G;  1VQG A;  4H13 C;  2YV5 A;  4JI7 L;  4DR4 Q;  3FPP A;  3OYY A;  1ENF A;  3P1H A;  4KN7 C;  2M00 A;  4YCU A;  2K5Q A;  2VB3 X;  1DM0 B;  5IGF A;  1TY0 A;  2B2W A;  4C3J B;  1LO5 D;  4C2M B;  3BZK A;  5CBA E;  3CRL C;  3UE1 A;  1HH2 P;  2EXD A;  4QJF A;  4QUF A;  1PTO D;  3DEO A;  1K8G A;  4JCV E;  4XYQ A;  2K28 A;  1PRT F;  1DJR D;  1IBL Q;  3NUC A;  4PV1 C;  5D3I B;  5IY0 A;  4CBV A;  4DV4 Q;  4DR6 Q;  3R2T A;  2K33 A;  1DOK A;  1TWG B;  2MFI A;  2PQA A;  4GLV B;  2UXD L;  1GHK A;  3I91 A;  3W1B A;  2UUC Q;  3FHW A;  1LTR D;  1SNC A;  4HTH A;  4JI2 Q;  5A35 A;  1EQQ A;  5C3E B;  1UWV A;  2D9U A;  1P8L A;  4JI3 L;  1O7L A;  2B2Y C;  1SYC A;  5ELE A;  3TRZ A;  2NVX B;  4R8I A;  5FO9 B;  5EBC A;  3I4M H;  3MXN B;  2K14 A;  1JJC B;  2L9H A;  3Q6S A;  1S3O A;  3TBI B;  3FVQ A;  1HA5 A;  3JC6 6;  3HOV H;  2V1C C;  1G2T A;  1MD2 D;  1SNO A;  1JOK A;  4LUZ A;  1D1K A;  3NBI A;  1U4R A;  2I5H A;  4DKA C;  1YVC A;  2E2H B;  3T1H Q;  4JI8 Q;  4A3C H;  1QG7 A;  2F0S A;  4HJ9 A;  1EYD A;  1ICF B;  3D0F A;  4R4T A;  1K0S A;  2JA8 G;  1QVC A;  1Q1E A;  3IRB A;  2WV6 D;  3X3N A;  3C2P A;  1VDZ A;  1AN8 A;  1ZKO A;  1SN8 A;  5GRO A;  1D7Q A;  4NXN L;  4MTK A;  3CCE A;  4RKL A;  1F2Z A;  4EQ5 A;  4I65 A;  4KJO A;  3E0J A;  3D4R A;  5KYL A;  4EGV A;  2PW5 A;  3TDQ A;  2R93 G;  3MXU A;  1VQ7 A;  3VDY A;  4A93 H;  1CUK A;  4B3T Q;  3FRP B;  3J81 c;  4BA1 I;  2PZT A;  1Y1W H;  5M3F H;  1HXY D;  3QOL A;  4YHH Q;  2HIV A;  3GD7 A;  5JJZ A;  1Q8K A;  5ELD A;  2OQK A;  2R3Z A;  3CME A;  4LW1 A;  2QDL A;  1ASZ A;  2Z0S A;  5A2Q E;  1A6X A;  2XRQ D;  2JK8 A;  1IBK Q;  2DJG C;  1WTX A;  1B53 A;  2HD3 A;  2LY7 A;  1SND A;  3G7L A;  1EFI D;  4MNO A;  1YJW A;  1KQS A;  3L3O C;  2LKV A;  1FNW A;  2J7Z A;  4DXF A;  4B3M L;  2HIX A;  1J5E L;  1S5E D;  2DGY A;  4TQU S;  4CDC C;  1TII D;  1HZ9 A;  3GTP H;  1EEI D;  3MFY A;  2A68 D;  2VUM H;  1H9M A;  2DJF C;  4DK0 A;  4EQP A;  5DM6 3;  3S16 B;  1JWU D;  2JA5 H;  3F1Z A;  2NUC A;  3EA6 A;  2EY5 A;  1R4Q B;  2SDF A;  3KLS X;  1PH1 A;  1JT8 A;  1LT5 D;  3QIA A;  1PYB A;  1ILP A;  5C3X A;  5IYB H;  5EKI A;  2M2L A;  1EIY B;  3HOV G;  4LMQ D;  1YNJ D;  2F0O A;  2R93 B;  1JIC A;  1GXD C;  2KEN A;  1XX8 A;  4ZYS A;  2BH2 A;  2DY8 A;  2EOT A;  1EWC A;  1HCZ A;  3S1M H;  3KF8 A;  3LWU A;  2MJ8 A;  3GQB A;  1AZP A;  3UDF A;  1D8L A;  5E1F A;  4RMF A;  1Z7T A;  3U9S A;  1L0Y B;  4BY1 G;  5EBD A;  2ICI A;  1EY8 A;  3TS2 A;  3C3L A;  2AKW B;  4Y7N B;  2EY6 A;  4B3T L;  3S1M B;  1F9R A;  3HEJ A;  1DD2 A;  4DA2 A;  4DV0 L;  1VQN A;  4JI2 L;  4LFC L;  2E2H H;  1PV4 A;  5IOD A;  4DGZ A;  4GNX B;  1FVI A;  2F0W A;  1HFN A;  5T1G A;  3VYR A;  5IGD A;  4IUR A;  4GOP B;  1HUM A;  2IX1 A;  5ELB A;  1CT1 D;  2SNS A;  3NQI A;  2TSS A;  1IBL L;  2K32 A;  3AU7 A;  2EZV A;  1SAP A;  4NP5 A;  3I90 A;  4A93 B;  1CZG A;  4JYA L;  2L15 A;  3IFT A;  3KFU A;  1A3T A;  4YWM A;  3J80 E;  3OWE B;  2JA5 B;  5FJ8 G;  4A3G H;  3A5U A;  5J22 A;  1H95 A;  2XGT A;  3A5Z B;  2UUA L;  1I4G A;  4DV7 Q;  3EQL C;  4AQY Q;  2K5H A;  1STG A;  2UU9 Q;  1AP0 A;  1B44 D;  2FIN B;  4PNY A;  4DV4 L;  4DR6 L;  1EY4 A;  3KF8 B;  4V19 0;  1S5D D;  4RG1 A;  2MP1 A;  5FLX L;  3S24 A;  4DV2 Q;  3ERQ A;  2NN6 G;  1EY0 A;  4N8F A;  5IYC G;  1NTG A;  2XSC A;  1IBM Q;  4KY6 A;  3CCU A;  1PTO C;  1PA6 A;  1TWF H;  3H91 A;  4KN4 C;  1YZ6 A;  2QIL A;  4CDE C;  3H94 A;  2O2L D;  3J7Z C;  2E2I H;  1PRT B;  1Y14 B;  2NWG A;  1LTA D;  4A3G B;  2VB2 X;  4KHP L;  1HQM C;  3TME A;  4DV3 Q;  3CAM A;  2D2C C;  3EIV A;  1O7Y A;  1KD1 C;  4JBM A;  1ZXT A;  3BDO A;  2TMP A;  2B8F A;  4HED A;  1N8R C;  4GZY C;  2KCN A;  4OEL B;  1JB7 A;  1Z9F A;  2YTV A;  3CCR A;  3CCL A;  1T9H A;  1GKH A;  2X69 A;  1FD7 D;  2PQE A;  3F2B A;  1EZ6 A;  2WAQ E;  3GV3 A;  2PMZ B;  5G3L F;  4GKJ Q;  2FMC A;  1II3 A;  2XWJ B;  2CQA A;  1HNW L;  1LTS D;  1E2W A;  4J8Q A;  4BBS G;  3I73 A;  3I4O A;  3A7L A;  5AJ3 L;  3HOX B;  4LF6 L;  2RVL A;  2E74 C;  2MO1 A;  2F52 A;  5FJ8 H;  1FGB D;  2EYH A;  2PW7 A;  5DEH A;  3RZD H;  2G9H D;  2PMZ E;  1B9M A;  1WI5 A;  2A8V A;  1R9T B;  1W3S A;  5FO8 B;  1TWH H;  1L0X B;  3HKZ E;  5C3W A;  1X54 A;  4LF4 Q;  4B3R Q;  1MIU A;  1STH A;  1SMY D;  2L1B A;  1SMX A;  4QCL A;  2BOS A;  3N6R A;  3OW2 A;  1BKB A;  4JG2 A;  2XVS A;  1GUN A;  1I4H A;  3FPU B;  4GOP A;  1XTD A;  4HAE A;  5E4X A;  2RCF A;  4K0K Q;  4JBK A;  3I8Z A;  1SBB B;  3UI2 A;  1A63 A;  2MPM A;  1N36 Q;  2EY1 A;  5C0X H;  4IUQ A;  3C1F A;  1B8A A;  4ZAI A;  3TEH B;  3T56 B;  4A75 A;  1YNJ C;  2UXB L;  5CR3 A;  1VF5 C;  2CFM A;  1I6V C;  5KRU A;  5HGQ A;  3PF5 A;  5IYB G;  4A3E B;  3M7N A;  5LL6 X;  4GKK L;  4A4I A;  4RCO A;  2Z9H A;  2ZXO A;  4POG A;  3ULL A;  3I4N H;  1GUT A;  1A3V A;  3I7F A;  1BNZ A;  4JI7 Q;  1MGS A;  3QR8 A;  1E22 A;  3CC2 A;  2B3G A;  4JI8 L;  1ESF A;  2R6G A;  3BS1 A;  1G2S A;  4MN3 A;  2NVQ B;  2F0J A;  1OTC A;  2ATW A;  1TWG H;  3NSW A;  1SLJ A;  2NVT B;  3D4W A;  5M3M H;  1YNN C;  3CPW A;  2ZXP A;  5EQ0 A;  1HR0 W;  4YWK A;  4JVZ A;  1STA A;  3K8A A;  3CCJ A;  2HQE A;  1LUZ A;  1K0R A;  2NZH A;  4APV A;  1E1T A;  5FK9 C;  3SE0 A;  3JAM E;  2K01 A;  2A1A A;  4C3H B;  3F8T A;  2JSO A;  1F2M A;  1EU3 A;  2EY2 A;  5D65 A;  1XPR A;  3NEL A;  1K83 H;  4B3S L;  1EQV A;  1Y1W G;  5GAD C;  4HSP A;  3OPO A;  2A19 A;  3CU7 A;  2QDB A;  2IHE A;  2IJ0 A;  5LMN W;  1VCI A;  3HKS A;  1FNV A;  2A73 B;  4CKE A;  1ET6 A;  3PSI A;  1K3B C;  3PMF A;  2EXZ A;  4DFA A;  1Q12 A;  4UP7 A;  1IBM L;  2F0T A;  3A54 A;  2F0G A;  3NE5 B;  3K59 A;  1CQF A;  1H9S A;  4R9W A;  5IT9 E;  1EEF D;  4DNT B;  1SYE A;  4LF4 L;  4IPD A;  5DM7 3;  4GLX A;  2F0V A;  1PFM A;  3CCM A;  4C3I B;  3J80 i;  2AQ1 B;  3UE0 A;  4JI5 Q;  3NBH A;  3R93 A;  4BY1 H;  3KLW A;  3JAM i;  3HOY H;  2F0H A;  4V0B A;  5LMN L;  2RSN A;  5K5P A;  2DNE A;  3HOX G;  2IT1 A;  1WTR A;  1EYC A;  3MVV A;  2HCI A;  5HY6 A;  4DK1 A;  1SFO B;  3NTH A;  4LFA Q;  1KDB A;  3CXC A;  3GTQ B;  1V1P B;  2F0Q A;  4BXX H;  3H6M A;  4DV1 Q;  2K5V A;  3D6C A;  3CD6 A;  1AFP A;  3M4Y A;  3I4M G;  2UXD Q;  4AYB E;  1QZH A;  4DK6 C;  5M5Y B;  4XXE A;  2H5X A;  2EE1 A;  5CV7 A;  1Y1V H;  4G4K A;  3MTS A;  4JOI C;  4KJN A;  3RLO A;  4NXM Q;  5LHY 1;  4G7O C;  1N9W A;  5FLX c;  1N33 L;  4ZQ3 A;  5M5W B;  4JYA Q;  1J5E Q;  2UXC Q;  1RKN A;  2ALY B;  2D0P A;  2ZTC A;  3T4A C;  4HCE A;  2GN5 A;  4LF5 Q;  2N55 A;  1N33 Q;  4FXD A;  5LL6 S;  2KA7 A;  3DHQ A;  1JQY D;  1B3A A;  1M1K C;  2B63 G;  2WP8 J;  2K5N A;  3J80 L;  1OXU A;  4QUC A;  2LSS A;  1C48 A;  2K6A A;  3J7A 5;  3M3Y H;  2Q8R E;  2A69 C;  4O0A A;  4KV6 A;  3GP7 A;  3PO3 H;  1EIF A;  3M4Q A;  4IO9 A;  2PI2 A;  2R7F A;  5E7N A;  4OWT B;  3F2D A;  1B4O A;  3URY A;  1A3U A;  1KRT A;  3VR4 A;  4KTA A;  3OMG A;  3PO3 B;  4A3I G;  1SE8 A;  2EVB A;  1DON A;  5HUR A;  1C9O A;  2EYF A;  3EVQ A;  4IOA A;  1ASY A;  2F0I A;  1KAA A;  4A93 G;  3OWF A;  1AH9 A;  3GTO H;  1BDO A;  1BR9 A;  4NMZ A;  1C4Q A;  4LF8 Q;  3EJI A;  3PF4 A;  1AW7 A;  3PQI A;  2O5J C;  1YHB A;  4JW0 A;  3KOJ A;  3A8J E;  4ZCK A;  2B63 H;  1D5X C;  5LMU Q;  3AB9 A;  5TSS A;  3RR5 A;  4IQZ A;  1H9R A;  2Q2I A;  4HID A;  1HHV A;  1RL2 A;  2NVQ H;  3RN2 A;  5KGU A;  2JA8 H;  2HT1 A;  2WB1 E;  1IKL A;  1K9M C;  5JEA G;  5KEE A;  1LYL A;  1WOC A;  3RN5 A;  3CP0 A;  4DV5 L;  4GN5 A;  1XNQ L;  3V96 A;  1JOR A;  4A3B G;  1CKN B;  1RD9 D;  1GD7 A;  1ENA A;  1YEZ A;  1BO0 A;  4CDF C;  3GO5 A;  2DNC A;  4P72 A;  1NJI C;  4DNR B;  2ZJR A;  1JR0 D;  2E8G A;  5ELO A;  1IBK L;  3S14 B;  3U50 C;  2NBF A;  4JI1 L;  4HJ8 A;  1K83 B;  4H02 A;  5C4X H;  2Q8T A;  4F7X A;  5I9P A;  4LNQ A;  4MHE A;  2NB0 A;  1JJ2 A;  3BDC A;  1QCB D;  3PO3 G;  4GNX A;  3J80 c;  4B3M Q;  1TT2 A;  3BYY B;  1E2V A;  4PG3 A;  2ZXR A;  2NTT A;  2X6L A;  3PO2 G;  4X66 L;  1OXT A;  1VQ4 A;  4KLK A;  1PZI D;  1KTK A;  1VQO A;  1QJO A;  2VQE Q;  2Y0S B;  3SK5 A;  2NVT H;  3D31 A;  3TSS A;  1QIL A;  1WFQ A;  1MSG A;  4AYB B;  3P7J A;  4JI6 L;  3KUP A;  2F4V Q;  4ALP A;  3ICE A;  4IFD J;  1X3E A;  5JJI A;  4TVA B;  2YTY A;  4A3F G;  4CJ2 C;  3K6O A;  1CKN A;  2H4O A;  3WOE A;  3W1G A;  2PI2 E;  4EQN A;  1WD1 A;  5EAY A;  3ZYY X;  3PIO 3;  2B2V A;  2AUK A;  3E3X A;  4KMU C;  2BA1 A;  2K03 A;  1X56 A;  1DCZ A;  1I94 Q;  3CW2 C;  2MNA A;  2IW3 A;  1FJG L;  2EPB A;  3AFQ A;  3CKI B;  3HOW G;  4WOR A;  2KQ3 A;  2DUD A;  3A8K E;  2C35 B;  1E0B A;  2HQL A;  2PO4 A;  5C4Z A;  4A3K H;  1HRJ A;  2B8G A;  2GVB A;  1KIX A;  1SJH D;  4IUV A;  5COY A;  5IWA Q;  2I46 A;  4LK1 C;  5IE8 A;  5FLM H;  4IOC A;  5CGK A;  4ABN A;  1G29 1;  2QEJ C;  3I56 A;  4DR4 L;  2JE6 I;  4NXN Q;  2XWB B;  1SYF A;  1CM9 A;  5FO7 B;  5ISR A;  1IYV A;  1NMG A;  3Q0A A;  2RDF A;  4YWL A;  2WKC A;  3J81 i;  1EOV A;  5C4H A;  4IFD H;  5J1Z A;  3KF6 A;  4JV5 L;  2VNU D;  2MO0 A;  4A3J H;  4LAA A;  4C1N I;  1HZC A;  1F2Y A;  1GUO A;  1HZB A;  3S16 H;  4RCN A;  4FYD A;  1ZEQ X;  4DV5 Q;  5H1S E;  3QWN A;  2M9V A;  4J6H A;  4KI0 A;  2RA4 A;  4RFB A;  3T16 A;  5COR A;  1SNP A;  4BS9 A;  2PZW A;  3PUX A;  3VR5 A;  1IW7 C;  1Y8N B;  3DM1 A;  1I50 B;  5KNC A;  2HHH Q;  2ZJQ A;  2KBN A;  1J8I A;  2R92 B;  4C1N K;  1EY5 A;  3CRK C;  3L9A X;  3K80 C;  1RTO A;  3BYT B;  4DUY L;  1WTQ A;  4P75 A;  2KUM A;  2UU9 L;  3AMU A;  1EQR A;  2AQ2 B;  3BZD B;  2KVM A;  5IT9 c;  4RGT A;  5G3L D;  4NXM L;  3SK4 A;  2E5L Q;  3PUZ A;  3PV0 A;  2QGQ A;  4PZ8 A;  1K8M A;  4NW2 A;  4HR7 B;  1VQD A;  4BWG B;  1G91 A;  1Y1V B;  3DXJ C;  1M8A A;  2K5W A;  1C7Y A;  1JE4 A;  1BCP F;  2B2Y A;  5C0X J;  1B1Z A;  1RF2 D;  2MHV A;  3ND9 A;  5IGB A;  4DV7 L;  1YNN D;  3JAM c;  3GDE A;  5KND A;  1B9N A;  1MBY A;  3T53 B;  5M3F B;  3W5O A;  3LGJ A;  1N32 Q;  1I4R A;  1U4P A;  5C0X G;  2A6H C;  4A3E G;  4I7Z C;  3VA7 A;  3RZO H;  1Z47 A;  2L12 A;  3HOZ H;  4DAY B;  3VR6 A;  1KLG D;  3LNN A;  1B7Y B;  4L5R C;  1E7Z A;  4TKO B;  4A3F B;  2PYK A;  2J4X A;  4N8X 1;  1Q90 A;  1PYW D;  4AYB G;  5CC4 A;  5A2Q L;  4OGQ C;  1STE A;  3J7A V;  3GTO B;  3S1R B;  1WVL A;  3GTM B;  4K5X A;  4LWC A;  5JPN C;  1TS3 A;  1L0W A;  2PNR C;  3G48 A;  5C44 B;  1ZYR C;  2G9D A;  3VYU A;  5E3F A;  3PCO B;  4OIK A;  1V1P A;  3BVG A;  5KIX A;  5AJ3 Q;  1Y8O B;  2CVR A;  3NWT A;  2HHH L;  1HQR D;  4A3L H;  1K8A C;  2KCT A;  4O2D A;  3RZO B;  3I72 A;  1ML0 D;  3DLL A;  4JI1 Q;  1CK1 A;  1UE7 A;  1CHQ D;  1CQV A;  2JJQ A;  2F3I A;  4NDX A;  1X65 A;  2YU9 B;  4A3J B;  4X64 L;  3ZJY C;  3SR1 A;  2I5M X;  5I6W A;  4P71 A;  4FVM A;  1LLR D;  4ILW A;  3Q22 A;  1VQL A;  1PZJ D;  1QUQ A;  1LTI D;  5BN5 A;  4DUZ Q;  4K8I A;  1AZQ A;  4C3J H;  2O4X A;  4LF6 Q;  3S2D B;  1XTC D;  1B3Q A;  1EWI A;  5CV5 A;  3TP5 A;  1BCP D;  1UUP A;  1KRS A;  2VW9 A;  5M9O A;  4F88 A;  1YIJ A;  1V1Q A;  3J7A F;  3PUW A;  1IYJ B;  2JP1 A;  4JI0 Q;  4A3M B;  5I2Y A; 
#chains in the Genus database with same CATH homology
 4IAL A;  1TU2 B;  3EFX D;  3E5S A;  2KEE A;  4HN7 A;  2F03 A;  2BDO A;  1EIH A;  4RA8 A;  5T1I A;  4HMI A;  2F0P A;  1JOQ A;  4KKU A;  5EPK A;  2B2T A;  3KBG A;  3TP7 A;  2NN6 H;  1BUV T;  2KOL A;  5CV9 A;  3I3C A;  2GA4 B;  2A6E C;  3PUY A;  4A3I B;  2I07 B;  1NUC A;  1HA6 A;  2KCC A;  3GV6 A;  5CV4 A;  2NN6 I;  5CBE E;  4B9W A;  2IX0 A;  4FXK C;  1FYC A;  2JA6 B;  2KED A;  5E4W C;  4QB4 A;  1U9R A;  5CV6 A;  3M7G A;  2LFN A;  1G6Z A;  5EJW A;  4UDU C;  3J7Y W;  4H0L C;  4MIU A;  4L8J A;  4OIJ A;  3K58 A;  5FKA C;  2RDH A;  1H9S B;  2F1M A;  1QNU A;  3O13 A;  3TN2 A;  4DXG A;  2MUY A;  2J0T D;  1G8Z D;  4OL7 A;  2A6E D;  1SSO A;  3SEB A;  3FMC A;  5M3M B;  4Q0F A;  2Z4I A;  3PIP 3;  4KHZ A;  3KBX A;  4BY1 B;  4G57 A;  1I6H B;  5I9O A;  4L63 B;  3K5M A;  1LT4 D;  4KY5 A;  4ZRZ A;  4OO1 G;  1RDP D;  1GHJ A;  2B2U C;  4IN3 A;  1I4X A;  1DOM A;  3OIQ A;  3QOJ A;  1GUS A;  2HUG A;  1EY9 A;  4BA2 I;  4WFN 3;  1EYA A;  3VYT A;  4FF4 A;  3W3A A;  2OXP A;  4F87 A;  4FO2 A;  4K2L A;  1SDF A;  3A7A B;  2CHB D;  1H9K A;  4KD4 A;  2AUJ D;  1JB3 A;  2Q8I B;  4QIW B;  2A5H A;  3WDN A;  3JAM L;  4WRD A;  1GJX A;  3BVZ A;  4QF4 A;  1DZ1 A;  4G7Z C;  2X6G A;  1H9J A;  1OO9 B;  1XXG A;  1O7Z A;  2JEB I;  3F2U A;  3GTL B;  2F0K A;  3DEP A;  2JEA I;  3D3R A;  1TWA B;  2B39 A;  2D5D A;  3FDT A;  3Q23 A;  1V1O A;  2A68 C;  3RLF A;  3P75 A;  3ITP A;  1EY7 A;  1A2T A;  2QCP X;  5ELC A;  5IGG A;  3NK9 A;  5I2X A;  4JBW A;  1LTB D;  3WOF A;  3GTP B;  3MEH A;  3PUV A;  1IW7 D;  3HOU B;  1J9O A;  4P2C B;  1AEX A;  1M4V A;  4TRD A;  4ODG A;  1VF7 A;  5J39 A;  1HTP A;  2F3V A;  1KDA A;  1HFG A;  2AWN A;  3SHL A;  1BCP B;  4NKL A;  1UAP A;  2F4I A;  1KNE A;  2E2I B;  4L6T B;  4CJ1 B;  1SXT A;  4M8A A;  4K2K A;  5CYU A;  2EJG C;  2PPB C;  1LTG D;  1UNS A;  3I70 A;  1S5F D;  1WD0 A;  1MI2 A;  4DAV A;  1ICW A;  2DN8 A;  2F0U A;  3OIP A;  1EQT A;  3MWY W;  5EKL A;  4PMC A;  1EZ8 A;  3VR3 A;  3MHB A;  4C3J G;  1XWE A;  2EJF C;  2F0F A;  4LJZ C;  4ZKC B;  2XRS D;  5M5X B;  4HCS A;  4IUT A;  1NAP A;  3DMU A;  1QWY A;  3J81 L;  1F9P A;  2A6H D;  1DOL A;  3A56 A;  1PZK D;  5I4D A;  2K05 A;  1JOO A;  4RGN A;  3I4L A;  4ID6 A;  3R8B A;  4X3K A;  1RCV D;  2DY7 A;  3GTK B;  3RD4 A;  2HDL A;  2XNA C;  4K5V A;  2KHS A;  3BG3 A;  1JCK B;  2VUM B;  1PXU A;  5EKK A;  3MXG A;  5C4J B;  4RGO S;  1ENC A;  2AWO A;  5K36 H;  1ONL A;  2RBM A;  5C5L A;  2E76 C;  1SYB A;  1QE6 A;  2A74 C;  4BBR B;  3RUZ A;  1R4P B;  4H7B A;  4HMJ A;  2F0N A;  3VR2 A;  1WTP A;  4RHS A;  1OXX K;  1Z6H A;  1QNK A;  2BE5 D;  1FNU A;  3N52 A;  4CHT B;  2Z1C A;  4OHJ A;  2EYJ A;  5FLX E;  1WTW A;  1ET9 A;  3MAQ A;  2EJM A;  2F0D A;  3H09 A;  4FXG C;  2EYL A;  4ZUJ A;  2ID0 A;  5BN4 A;  1B50 A;  4K5W A;  1BBX C;  1LT6 D;  4EVO A;  2F0E A;  1SE2 A;  3IL8 A;  2AQ3 B;  1K8O A;  4IUU A;  3SK8 A;  4A3K B;  1OXV A;  4TSS A;  2VXW A;  2KEC A;  1I4Q A;  3X3M A;  1EY6 A;  5C5M A;  2BE5 C;  2EYO A;  1PRT C;  3QO2 A;  3ERO A;  2NYZ D;  2IWH A;  1X3P A;  1EOT A;  3VA5 A;  1OXS C;  4WJW A;  4E6I A;  4UAI A;  3K5L A;  1GOZ A;  1ESR A;  1S5C D;  2F0L A;  5CMD A;  1TY2 A;  4XQJ A;  1D5M C;  5FOB B;  2ICE C;  4ZK9 B;  1F77 A;  2A69 D;  1CA6 A;  1Q1B A;  3G6J B;  1CZW A;  2QKI C;  3OW7 A;  3MZ5 A;  3PO2 B;  1SYD A;  1NR4 A;  1WCM B;  1IYU A;  2FHT A;  4RGM A;  4CKC A;  3C46 A;  2WIN B;  3HRZ C;  3D6W A;  3R3O A;  3NWS A;  3A8I E;  4F8M A;  1NCV A;  1STB A;  1PFN A;  1LTT D;  3SK6 A;  2B63 B;  4FP5 D;  2OT2 A;  1A2U A;  1D6E C;  5F2D A;  4S3S A;  5CV8 A;  2L5T A;  1X32 A;  2E75 C;  3V05 A;  3MFG A;  2BA0 A;  3DWA A;  3I4M B;  3NQT A;  1PTO H;  2B2V C;  4KY7 A;  3NPP A;  2L11 A;  3LWE A;  3ONA B;  3DUZ A;  2NZ1 D;  5KYI A;  2R61 A;  3GTG B;  4FF3 A;  1TR5 A;  1EU4 A;  3Q24 A;  1BCP C;  2CW0 D;  1ROD A;  1PDQ A;  1V8Q A;  3K7A B;  5EPL A;  2F3W A;  4K6D A;  4G7H C;  1IL8 A;  4BY7 B;  5JEA H;  5IIF A;  4K14 A;  5ELF A;  1JC7 A;  4PMB A;  2C9O A;  5KNB A;  3MC0 B;  1IKM A;  2L4N A;  1KDC A;  5D14 A;  1Q3L A;  1O78 A;  1SMY C;  2SNM A;  4ZLT F;  4CKB A;  4OO1 H;  2H1E A;  4OO1 I;  3K57 A;  2IL8 A;  4C3H G;  4KKT A;  5BN3 A;  3S15 B;  4RWS C;  1JWM D;  1X3Q A;  3TP6 A;  1RHP A;  3NXW A;  1E2Z A;  2BDN A;  4X3T A;  1TKW B;  4EQO A;  3S2H B;  2EDG A;  1PLF A;  3DWQ A;  2OF1 A;  4H44 C;  4J1M A;  5JVH 3;  5JOB A;  5DNF A;  3BVM A;  4YIJ A;  3K5N A;  3R2I A;  5IGC A;  1C8C A;  1IHZ A;  5HGT A;  1F9Q A;  2NTS A;  1RTN A;  4KHV A;  1TS5 A;  3H0G B;  3KLR A;  3TZD A;  2WAQ B;  5C0X I;  1SE3 A;  1XYI A;  1SNQ A;  1CA5 A;  3M85 A;  3M3Y B;  1F2L A;  3FEW X;  3BDL A;  2RQX A;  4KKS A;  1CFM A;  2BCO A;  4R8N A;  4XQQ A;  1PTO B;  2NVY B;  1KAB A;  3CQZ B;  1BF4 A;  2JYO A;  2SOB A;  3W2D A;  2RKS A;  4XT3 B;  3IKJ A;  1Y1W B;  2LS0 1;  3HZX A;  3D4D A;  1PRT D;  5EPJ A;  1PTO F;  3D8G A;  1SEB D;  2PCF B;  3HKZ B;  3NP8 A;  4HSV A;  5C6A A;  4DF7 A;  2MGS A;  4B08 A;  5IGE A;  5JAV A;  3NTI A;  4KK7 A;  2OEO A;  2FMM A;  3HOW B;  3E6Z X;  3DWP A;  4N9P A;  4FNF A;  4A3D B;  4CGY B;  5IT9 L;  4N9T A;  3HGB A;  1TWF B;  2L55 A;  4IUP A;  1V43 A;  2CW0 C;  3OOC A;  1TWH B;  3SVM A;  2HDM A;  3VYS A;  1RJT A;  2RDG A;  1W6K A;  1VMP A;  1O80 A;  2WB1 B;  4RKB A;  2D62 A;  3I4N B;  3QJY A;  5NUC A;  1GUG A;  4M1U B;  1LAB A;  3NTK A;  2B2T C;  5IOC A;  3H3V C;  3M4O B;  2R7Z B;  3TZU A;  3KK7 A;  4QMG A;  4CJ0 B;  1U4L A;  2SEB D;  3S9W A;  2JA7 B;  2XN9 C;  4RHR A;  2ZT9 C;  1DYQ A;  3J81 E;  4Q5V A;  1LV9 A;  1CI3 M;  1JWS D;  3RZD B;  4ZKB B;  3ND8 A;  2WAC A;  4DAP A;  1CHP D;  1NSN S;  1QOH A;  1HUN A;  1EWH A;  4A3B B;  2F0M A;  2E2J B;  5C4X B;  3RMH A;  4C56 C;  4DU9 A;  3OSO A;  3SXH A;  4XQN A;  1KNA A;  1SE4 A;  1BOS A;  1NR2 A;  4FF1 A;  1F9S A;  1HTL D;  1BQQ T;  1QB5 D;  3FKI B;  3K0Y A;  5EGT A;  3TP8 A;  1T5X D;  3CHB D;  4C3I G;  2WKD A;  1TS2 A;  3S1Q B;  3HS0 C;  4FF2 A;  1SYG A;  1W6J A;  4K6L A;  3HOZ B;  2K7V A;  3OHX C;  4DAY A;  3A55 A;  1VMC A;  4U67 3;  2C5C A;  3T51 B;  1TVX A;  1MSH A;  5AFW A;  1HPC A;  1LAC A;  4IFD G;  3MA2 B;  4ME5 A;  2EYM A;  2XIW A;  3LX0 A;  3GTJ B;  4RAU C;  2O5I C;  2Z4H A;  1BXT A;  1LT3 D;  3QG1 A;  1EL0 A;  3L7Z C;  4JK1 C;  1SJE D;  3NHH A;  3KLS A;  4B9X A;  2HCC A;  1KLU D;  2QF7 A;  4O1N A;  4XIG S;  1D2B A;  2N88 A;  5JPM C;  1ILQ A;  2K04 A;  2JXM B;  3OMC A;  1S4Z A;  2PZU A;  1D5Z C;  4PQX A;  4PMW A;  4ULL A;  4XYO A;  5K36 G;  1T5E A;  5I6Y A;  1TQO A;  1EIG A;  4IUN A;  1SNM A;  2V4D A;  4X3U A;  2KJX A;  2IPK D;  4DN4 M;  3MXP A;  1ZYR D;  1D1I A;  3SDZ A;  1PFB A;  2L0C A;  3HOV B;  5D3D A;  2IX3 A;  1B2T A;  2LMC B;  3S17 B;  3U9O A;  1STN A;  2B2U A;  3HOY B;  3C1E A;  4U68 A;  1WTV A;  1Q8I A;  4IFD I;  4XT1 B;  3V2T A;  4K8J A;  4IZ8 A;  4RH6 A;  5JVG 3;  4XDX A;  1U4M A;  4KD3 A;  1TWC B;  1I4P A;  2Z8L A;  2EYP A;  1WTO A;  3K5O A;  5JEA J;  3IFD A;  2FJ2 A;  2RSO A;  3P20 A;  5DAU A;  3T13 A;  3MXN A;  4BBS B;  1GUW A;  2E2D C;  1STY A;  2FFK B;  4XTC S;  1Y8P B;  1FR3 A;  2YYZ A;  1DXM A;  3HP3 A;  4O42 A;  2WII B;  1PMR A;  2K1B A;  3HG9 A;  1A15 A;  1Y69 U;  1UEA B;  3IAY A;  4ZUI A;  4X3S A;  2JA8 B;  1CTM A;  3S1N B;  1S5B D;  2ENB A;  1TS4 A;  2K5D A;  2B2W C;  1I3Q B;  4Z9C B;  3QB3 A;  4H13 C;  3FPP A;  1ENF A;  3P1H A;  4KN7 C;  2M00 A;  2K5Q A;  2VB3 X;  1DM0 B;  5IGF A;  1TY0 A;  2B2W A;  4C3J B;  1LO5 D;  4C2M B;  5CBA E;  3CRL C;  4QUF A;  1PTO D;  3DEO A;  4XYQ A;  2K28 A;  1PRT F;  1DJR D;  3NUC A;  4PV1 C;  5D3I B;  4CBV A;  3R2T A;  2K33 A;  1DOK A;  1TWG B;  1GHK A;  3I91 A;  4HTH A;  1LTR D;  1SNC A;  5A35 A;  5C3E B;  2D9U A;  1O7L A;  2B2Y C;  1SYC A;  5ELE A;  2NVX B;  4R8I A;  5FO9 B;  5EBC A;  3Q6S A;  2L9H A;  3TBI B;  3FVQ A;  1HA5 A;  1G2T A;  1MD2 D;  1SNO A;  1JOK A;  1D1K A;  3NBI A;  1U4R A;  2E2H B;  1QG7 A;  2F0S A;  1EYD A;  1Q1E A;  2WV6 D;  3X3N A;  3C2P A;  1VDZ A;  1AN8 A;  1ZKO A;  4RKL A;  1F2Z A;  4I65 A;  4KJO A;  3E0J A;  3D4R A;  5KYL A;  4EGV A;  2PW5 A;  3TDQ A;  3MXU A;  3FRP B;  4BA1 I;  2PZT A;  1HXY D;  3QOL A;  3GD7 A;  5JJZ A;  5ELD A;  2R3Z A;  5A2Q E;  1A6X A;  2XRQ D;  1WTX A;  1B53 A;  2LY7 A;  1SND A;  3G7L A;  1EFI D;  3L3O C;  2LKV A;  1FNW A;  2J7Z A;  4DXF A;  1S5E D;  4TQU S;  1TII D;  1EEI D;  3MFY A;  2A68 D;  1H9M A;  4DK0 A;  4EQP A;  5DM6 3;  3S16 B;  1JWU D;  2NUC A;  3EA6 A;  2EY5 A;  1R4Q B;  2SDF A;  3KLS X;  1LT5 D;  3QIA A;  1ILP A;  5C3X A;  5EKI A;  2M2L A;  4LMQ D;  1YNJ D;  2F0O A;  2R93 B;  1JIC A;  1GXD C;  1XX8 A;  4ZYS A;  2DY8 A;  2EOT A;  1EWC A;  1HCZ A;  3KF8 A;  3LWU A;  2MJ8 A;  3GQB A;  1AZP A;  5E1F A;  1Z7T A;  3U9S A;  1L0Y B;  5EBD A;  2ICI A;  1EY8 A;  3C3L A;  4Y7N B;  2EY6 A;  3S1M B;  1F9R A;  3HEJ A;  1DD2 A;  4DA2 A;  5IOD A;  4DGZ A;  2F0W A;  1HFN A;  5T1G A;  3VYR A;  5IGD A;  4IUR A;  2IX1 A;  1HUM A;  5ELB A;  1CT1 D;  2SNS A;  3NQI A;  2TSS A;  2K32 A;  3AU7 A;  2EZV A;  1SAP A;  4NP5 A;  3I90 A;  4A93 B;  1CZG A;  3IFT A;  1A3T A;  3J80 E;  3OWE B;  2JA5 B;  5J22 A;  1I4G A;  3EQL C;  1STG A;  1AP0 A;  1B44 D;  2FIN B;  4PNY A;  1EY4 A;  4V19 0;  1S5D D;  2MP1 A;  5FLX L;  3ERQ A;  2NN6 G;  1EY0 A;  2XSC A;  4KY6 A;  1PTO C;  3H91 A;  4KN4 C;  2QIL A;  3H94 A;  2O2L D;  1PRT B;  2NWG A;  1LTA D;  4A3G B;  2VB2 X;  1HQM C;  3TME A;  2D2C C;  1O7Y A;  1ZXT A;  3BDO A;  2TMP A;  2B8F A;  4HED A;  4GZY C;  2KCN A;  2X69 A;  1FD7 D;  2PQE A;  1EZ6 A;  3GV3 A;  2PMZ B;  5G3L F;  2FMC A;  1II3 A;  2XWJ B;  2CQA A;  1LTS D;  1E2W A;  4J8Q A;  3I73 A;  3A7L A;  3HOX B;  2RVL A;  2E74 C;  1FGB D;  2EYH A;  2PW7 A;  5DEH A;  2G9H D;  1B9M A;  1R9T B;  5FO8 B;  1L0X B;  5C3W A;  1STH A;  1SMY D;  2L1B A;  4QCL A;  2BOS A;  3N6R A;  2XVS A;  1GUN A;  1I4H A;  3FPU B;  4HAE A;  5E4X A;  3I8Z A;  1SBB B;  3UI2 A;  2MPM A;  2EY1 A;  5C0X H;  4IUQ A;  3C1F A;  4ZAI A;  3T56 B;  1YNJ C;  5CR3 A;  1VF5 C;  1I6V C;  5KRU A;  4A3E B;  3M7N A;  5LL6 X;  4RCO A;  2ZXO A;  1GUT A;  1A3V A;  1BNZ A;  1MGS A;  1ESF A;  2R6G A;  3BS1 A;  1G2S A;  4MN3 A;  2NVQ B;  2F0J A;  3NSW A;  2NVT B;  3D4W A;  1YNN C;  2ZXP A;  5EQ0 A;  1STA A;  2HQE A;  3SE0 A;  5FK9 C;  3JAM E;  2K01 A;  4C3H B;  2JSO A;  1F2M A;  1EU3 A;  2EY2 A;  5D65 A;  1EQV A;  4HSP A;  3OPO A;  3CU7 A;  2QDB A;  2IJ0 A;  1VCI A;  1FNV A;  2A73 B;  4CKE A;  1ET6 A;  3PMF A;  4DFA A;  2EXZ A;  1Q12 A;  2F0T A;  3A54 A;  2F0G A;  3NE5 B;  3K59 A;  1CQF A;  1H9S A;  4R9W A;  5IT9 E;  1EEF D;  4DNT B;  1SYE A;  5DM7 3;  2F0V A;  1PFM A;  4C3I B;  2AQ1 B;  3NBH A;  3R93 A;  2F0H A;  4V0B A;  2RSN A;  5K5P A;  2DNE A;  2IT1 A;  1WTR A;  1EYC A;  3MVV A;  2HCI A;  4DK1 A;  1SFO B;  3NTH A;  1KDB A;  3GTQ B;  1V1P B;  2F0Q A;  3H6M A;  3D6C A;  1AFP A;  3M4Y A;  5M5Y B;  4XXE A;  2EE1 A;  5CV7 A;  4G4K A;  3MTS A;  4KJN A;  5LHY 1;  4G7O C;  4ZQ3 A;  5M5W B;  1RKN A;  3T4A C;  4HCE A;  2N55 A;  4FXD A;  5LL6 S;  2KA7 A;  3DHQ A;  1JQY D;  1B3A A;  2WP8 J;  3J80 L;  1OXU A;  4QUC A;  1C48 A;  2K6A A;  2Q8R E;  2A69 C;  4KV6 A;  3GP7 A;  1B4O A;  3URY A;  1A3U A;  3VR4 A;  4KTA A;  3OMG A;  3PO3 B;  2EVB A;  1DON A;  5HUR A;  2EYF A;  3EVQ A;  2F0I A;  1KAA A;  3OWF A;  1BDO A;  1BR9 A;  4NMZ A;  1C4Q A;  3EJI A;  1AW7 A;  2O5J C;  3A8J E;  1D5X C;  3AB9 A;  5TSS A;  4IQZ A;  1H9R A;  1HHV A;  5KGU A;  1IKL A;  5JEA G;  5KEE A;  3V96 A;  1JOR A;  1RD9 D;  1ENA A;  1BO0 A;  3GO5 A;  2DNC A;  4DNR B;  1JR0 D;  3S14 B;  2NBF A;  1K83 B;  5I9P A;  2Q8T A;  4F7X A;  4MHE A;  2NB0 A;  3BDC A;  1QCB D;  1TT2 A;  3BYY B;  1E2V A;  2ZXR A;  2NTT A;  2X6L A;  1OXT A;  1PZI D;  1KTK A;  1QJO A;  2Y0S B;  3SK5 A;  3D31 A;  3TSS A;  1QIL A;  1MSG A;  4AYB B;  3P7J A;  3KUP A;  4IFD J;  4CJ2 C;  3K6O A;  2H4O A;  3WOE A;  1WD1 A;  4EQN A;  3ZYY X;  3PIO 3;  2B2V A;  2AUK A;  4KMU C;  2BA1 A;  2K03 A;  1DCZ A;  2IW3 A;  2EPB A;  3CKI B;  4WOR A;  2KQ3 A;  3A8K E;  1E0B A;  2PO4 A;  5C4Z A;  1HRJ A;  2B8G A;  1SJH D;  4IUV A;  5COY A;  2I46 A;  4LK1 C;  5CGK A;  4ABN A;  1G29 1;  2QEJ C;  2JE6 I;  2XWB B;  1SYF A;  1CM9 A;  5ISR A;  5FO7 B;  1IYV A;  3Q0A A;  2RDF A;  2WKC A;  5C4H A;  4IFD H;  5J1Z A;  2VNU D;  4LAA A;  4C1N I;  1F2Y A;  1GUO A;  4RCN A;  4FYD A;  1ZEQ X;  3QWN A;  2M9V A;  4J6H A;  4KI0 A;  2RA4 A;  4RFB A;  3T16 A;  5COR A;  1SNP A;  4BS9 A;  2PZW A;  3PUX A;  3VR5 A;  1IW7 C;  1Y8N B;  3DM1 A;  1I50 B;  5KNC A;  1J8I A;  2R92 B;  4C1N K;  1EY5 A;  3CRK C;  3L9A X;  1RTO A;  3BYT B;  1WTQ A;  2KUM A;  3AMU A;  2AQ2 B;  3BZD B;  2KVM A;  4RGT A;  5G3L D;  3SK4 A;  3PUZ A;  3PV0 A;  1K8M A;  4NW2 A;  4HR7 B;  4BWG B;  1G91 A;  1Y1V B;  3DXJ C;  1M8A A;  2K5W A;  1JE4 A;  1BCP F;  2B2Y A;  5C0X J;  1B1Z A;  1RF2 D;  2MHV A;  3ND9 A;  5IGB A;  1YNN D;  5KND A;  1B9N A;  1MBY A;  3T53 B;  5M3F B;  1I4R A;  1U4P A;  5C0X G;  2A6H C;  4I7Z C;  3VA7 A;  1Z47 A;  2L12 A;  3VR6 A;  1KLG D;  3LNN A;  4TKO B;  4A3F B;  2PYK A;  2J4X A;  1Q90 A;  1PYW D;  5CC4 A;  5A2Q L;  4OGQ C;  1STE A;  3J7A V;  3GTO B;  3S1R B;  1WVL A;  3GTM B;  4K5X A;  5JPN C;  1TS3 A;  2PNR C;  5C44 B;  1ZYR C;  2G9D A;  3VYU A;  5E3F A;  4OIK A;  1V1P A;  3BVG A;  5KIX A;  1Y8O B;  2CVR A;  3NWT A;  1HQR D;  3RZO B;  3I72 A;  1ML0 D;  1CK1 A;  1CHQ D;  1CQV A;  4NDX A;  2YU9 B;  4A3J B;  3SR1 A;  5I6W A;  4FVM A;  1LLR D;  4ILW A;  3Q22 A;  1PZJ D;  1LTI D;  5BN5 A;  4K8I A;  1AZQ A;  2O4X A;  3S2D B;  1XTC D;  5CV5 A;  3TP5 A;  1BCP D;  1UUP A;  5M9O A;  4F88 A;  3J7A F;  3PUW A;  2JP1 A;  4A3M B;  5I2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...