4L6TB

Gm1 bound form of the ecx ab5 holotoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
MTPQNITDLCNEYQNTMIYSLNKEIATYTESLAGKREMVIISFSNGATFQVEVPGSQHLESQKRPLERMKDTLRAAYFTGIKISKLCAWTNKSPNSIAAIELSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECXA
publication title EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 25
structure length 105
sequence length 105
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4l6tB00
1BCPF 3R2TA 1HTLD 1MD2D 1LTBD 4RGNA 3BYYB 1EFID 2AQ2B 5FKAC 1HXYD 2IJ0A 1XTCD 3BVZA 3BVGA 1I4HA 4K6LA 1JWSD 1TS3A 2XNAC 3O13A 1D5XC 1PRTD 4RFBA 2SEBD 1FNVA 5ELEA 1EWCA 2RDGA 1L0YB 1SE2A 1EU3A 3DWQA 4OHJA 1PTOF 3SEBA 1DYQA 1RCVD 5FK9C 1SE4A 2TSSA 1BCPC 1UUPA 2G9HD 1KTKA 2RDHA 1SJED 4RGTA 1EEFD 1RD9D 1LTGD 1KLGD 1LO5D 4O1NA 1LT4D 1BXTA 2XRSD 1LLRD 1PTOH 1CHQD 1PYWD 1SJHD 1V1PB 4L63B 5TSSA 3R2IA 2NTTA 1TS4A 1SBBB 2CHBD 1V1OA 4RGOS 3URYA 1ENFA 1JCKB 1TY2A 1BCPD 1V1PA 1PTOC 3BYTB 3W2DA 4ZYSA 3EA6A 1ET9A 4DXGA 4RH6A 1HQRD 1LTSD 2ICIA 1D5MC 2IPKD 3MC0B 5ELFA 1BCPB 1PRTB 1CQVA 1S5CD 1LTAD 1I4GA 1TS5A 1F77A 5I4DA 4DXFA 1RF2D 2NTSA 1KLUD 3BZDB 1FD7D 4TSSA 5ELBA 1I4RA 1DJRD 3BVMA 3CHBD 1D5ZC 1SEBD 4RCOA 1PTOD 1JWMD 2XRQD 1PTOB 1HA5A 3V05A 3MFGA 4UDUC 4C56C 1AN8A 1I4PA 2O2LD 2QILA 4Z9CB 3DWAA 1TS2A 1CK1A 1ESFA 5D3IB 1LT5D 1LTTD 3KLSX 2Z8LA 2AQ1B 5ELDA 1ET6A 1L0XB 4L6TB 1M4VA 3OWEB 1PRTF 1G8ZD 1GOZA 3GP7A 1I4QA 3EFXD 1S5DD 1FGBD 2WV6D 3TSSA 1B1ZA 2XN9C 1LTID 1TY0A 1I4XA 4RHSA 1QILA 1SE3A 4BWGB 2AQ3B 3R8BA 1EEID 1B44D 4RGMA 1JWUD 1FNWA 1CHPD 4RHRA 1LT3D 1RDPD 2J4XA 1PZJD 5D3DA 1LT6D 1STEA 1AW7A 1S5FD 1LTRD 1S5BD 1S5ED 1CT1D 1PRTC 1JQYD 1SXTA 5ELCA 1XXGA 1PZID 3DWPA 1EU4A 1PZKD 1UNSA 2QEJC 1T5XD 1D6EC 1FNUA 2R61A 1JR0D
chains in the Genus database with same CATH superfamily
1STYA 3I4NB 2EYLA 2E5LQ 4A3IG 1X56A 1H95A 1EFID 1XNRL 3L0OA 1UEBA 4XDXA 1A3TA 2BE5D 2F0LA 1I6HH 3M4YA 2UUCQ 2N55A 4DV6Q 4ZUIA 2E2IH 1HZBA 1B9MA 2IY5B 1UUPA 3HOVG 1ICWA 3IAYA 3PO2G 4L5SA 1TWHH 3FKIG 1UWVA 3TZUA 3HOWH 4O2DA 3HOZG 3SE0A 1YHQA 2O4XA 1Q12A 3RUZA 4RGOS 4A3EB 2XWBB 3ICEA 1CKOA 2L15A 3T51B 2NZ1D 4JPBW 4JI4Q 3C46A 2Q2IA 3ULLA 3W1BA 3J80L 5IOCA 2LSSA 2Z6KC 4AQYL 4JV5L 4XT3B 1Q81C 2PQAB 1TT2A 2IL8A 3OHXC 2LFNA 1TIID 4EVOA 2VUMB 4DV7L 2NUCA 1YVCA 1EYCA 2M9VA 2PQAA 1BF4A 1R4QB 2XRQD 4RMFA 3E6ZX 3KBGA 2JA6H 1F2MA 2ZXOA 2JSOA 4ZKCB 2BE5C 5EJWA 4A3FB 2MFIA 2HT1A 3D4RA 3HKZB 1VQ9A 4P2CB 1ASYA 1C48A 1J6QA 4DUYL 1I50B 1JOOA 1PH3A 2CW0C 2MQHA 4C1NK 3PIOA 1B8AA 4ME3A 3PF5A 4KK7A 3S1NB 3S16H 2L55A 1DXMA 1S5FD 1EY7A 3SR1A 1TWCB 3U4ZA 2IHFA 2JA5H 5CC4A 5IP9H 3A7AB 3IKJA 3ULJA 4A3EG 3BJUA 5M3FB 2WFWA 4IOCA 2UXBL 4HIOA 3EBEA 3I4LA 3GTMH 1GHJA 1HXYD 2BDNA 2K50A 1Z6HA 5EAYA 5EPJA 1A62A 1GO3E 1I4HA 1BQQT 3P1HA 2EVBA 2L0CA 4K6LA 3ERSX 1E1TA 1Z7TA 1X32A 3S2HB 3TMEA 2VY3A 3ZJYC 3GD7A 4LF4L 1QOHA 2PI2E 2ATWA 4S3SA 1I3QB 4YCUA 1G51A 2KVMA 4HMJA 1K83H 2F0KA 1YEZA 3CAMA 2VUMG 1RCVD 2F0HA 2V1CC 1A2UA 4NKLA 4YY3L 2VQEQ 2EIFA 3SK8A 2K5HA 2H4OA 3VA5A 1MBYA 5IT9L 5M5WH 4JBJA 1PTOH 1H9SB 2RKSA 4GN5A 5IYCH 1VQ4A 4JI8Q 1N36L 3R3OA 1GUGA 3NP8A 1J9OA 2OTLA 1HPCA 1ML0D 1WD1A 1H9SA 1PTOC 3C3LA 4AYBB 3VYTA 1WD0A 3Q24A 4A3BH 3HKZG 1CTMA 2SNMA 4ZAIA 4C3IH 4J1MA 3E9IA 4DF7A 4DXFA 2K03A 1FD7D 2VNUD 3MA2B 3DEPA 1V9PA 3J80E 4NDXA 4EGVA 4BY1H 1NUCA 3DUZA 1BBUA 1HR0W 2P5ZX 3X3MA 4P74A 3GV3A 4N9TA 3UDXA 4X3SA 4IUVA 4IUTA 1JJCB 2RSNA 4RCNA 3MAQA 1DONA 1B2TA 5D3IB 1HUNA 2K14A 4IFDG 5M3FG 1LTLA 1WYDA 1WFQA 4DV5L 4BXXG 1S5DD 5C3EB 1TY0A 2F0GA 1SSOA 4BY7B 2B2UC 4HR7B 5FO7B 2JEAI 5JJKA 3T4AC 2AQ3B 3PGZA 4YWKA 3A56A 2OCEA 4Q0FA 2R3ZA 4DR1L 4IALA 4QIWE 1SR3A 3PUXA 2BDOA 1S5ED 3B6YA 3KFUA 1EU4A 4NW2A 1FNUA 3BVMA 1EFWA 1IBLL 2NVXB 3K57A 1G91A 1HH2P 1ENAA 1EYAA 3L3OC 5KIXA 4AYBG 1S3OA 2E5LL 1STBA 1JWSD 1VQ5A 5LMUQ 4BS9A 1A15A 5M3MH 1SMYC 1SNPA 1PH7A 3SXHA 4JOIA 1Y14B 1SE4A 5LMNW 2K4KA 3D31A 3OTOQ 4UY8C 1Y1WB 2R93H 2DNEA 2RBMA 4DV6L 4C3HB 2NVQH 1EIGA 4QY7A 1WCMH 4KMUC 2WKCA 4DKAC 1GUTA 1Q1BA 1U4PA 2A6EC 2FJ2A 5ISRA 3I3CA 1LUZA 2BOSA 5I2XA 2XIWA 4AH6A 5A35A 1L1OB 2KCTA 1DZ1A 2CFMA 3E0EA 2CQAA 1PH1A 4KI0A 5CV4A 3EA6A 2KCMA 4RA8A 1TU2B 4JI4L 1V8QA 2L5TA 2D5DA 1J5EQ 2KQ3A 1STHA 3BZCA 5C3EG 1EY6A 5JEAH 4QGUA 4BY7G 4WFN3 1ESRA 5CGKA 2ALYB 3GTPH 4JBMA 4YIJA 1D1KA 3OIPA 3U9OA 3TP5A 2F4IA 1HJPA 2NWGA 3OW2A 4A3JH 2EY1A 4XTCS 3I70A 1GUWA 5IYDH 3E9HA 1YNNC 3K0XA 3RZOH 1QVCA 3PUZA 3RD4A 4JVZA 1M4VA 4O0AA 5GQOA 4N8X1 3EFXD 2Y0SE 4F87A 2YTVA 4KV6A 5IGBA 3NTKA 4ULLA 1RTOA 1LT3D 1K73C 4C2MH 2B2YC 1IHZA 5J3BA 1NMGA 3EN2A 3IFDA 3J80i 5JJZA 1Y1WG 4C3HG 1QZGA 1O80A 3KK7A 4JC0A 5G3LD 1JICA 1E1OA 5IGGA 1SYCA 3GDEA 2D62A 4K5WA 1U4RA 4A4IA 2EYOA 1SLJA 2F0DA 5GADC 1XTCD 4RKBA 2M00A 1A63A 5HGTA 1PRTD 3G4SA 1C8CA 2OEOA 1AFPA 3M9BA 1F2YA 1FNVA 1TWGB 5FLXc 1AP0A 4JI7Q 1VMPA 4XQQA 4NB3A 5FK9C 4B3TL 2A69D 3I73A 3GTKH 1JJGA 1BOSA 3M3YH 1LO5D 2EYMA 1R4PB 1E22A 3GQBA 5KEEA 3DXJC 3J7ZC 3L7ZC 2VQEL 2K05A 4LF5Q 2BA0A 1HNZQ 2RCNA 2JA7H 2F0QA 1Y1VB 5CV6A 2PQEA 2WAQE 1X3QA 2B8GA 2K75A 2E74C 1W6JA 2OXPA 3VR4A 1CQVA 4QB4A 2HUGA 4QF4A 1LTAD 1SNMA 2IX0A 1SNCA 3CD6A 2X69A 3TREA 1RODA 3S14H 4M8AA 4KJNA 2NN6G 2FINB 3GTQH 5C4XB 4XXEA 1YJ9A 4P72A 4A3GH 1HRJA 1ILQA 2K5NA 2ASBA 1GUOA 2K5WA 4OIJA 2JA6B 4X6AH 1LT5D 3IL8A 1Q8IA 2ZJQA 3A7LA 3S2DB 2ZTCA 3UDIA 5E4WC 2Z9HA 1PH2A 2VB2X 2E2JH 1G2TA 1HNWQ 5COYA 3Q0AA 5C44B 2BA1A 4A3CH 2F3WA 2K1BA 3RZDH 1JMCA 5CBAE 1EEID 4OWXB 4IPDA 1CHPD 3Q8DA 1VQLA 4R4IA 2I5MX 5IP7H 3D6WA 4DFAA 3S16B 4DU9A 3A5UA 4PNYA 1YJWA 2K7VA 1Q8KA 4B08A 2I07B 4DUYQ 3KF8B 5D65A 4IUNA 3HOWG 5DNFA 5M5XH 1WTPA 1HTLD 2DY7A 1HTPA 1KABA 2AQ2B 3SK4A 1MJEA 3KF8A 1B3AA 4NXNQ 3EROA 4F88A 1MJCA 1PH5A 1STAA 4KKTA 4DNRB 2K5QA 3KJOA 4R8IA 1SYEA 4H02A 1S72A 3HOYH 2D0PA 5LMNL 4RFBA 1DOKA 3GTLH 2Q8IB 2TMPA 2N3SA 2WP8J 4HJ9A 4JBWA 5IYBH 5LMUL 1AH9A 1VQJA 1IBMQ 3PMFA 4QUFA 5GAGC 1RD9D 1K8MA 3MZ5A 1PFBA 2EJGC 2PW7A 4GKJQ 2F0EA 1X3EA 5C4XG 2EDGA 5LL6X 4B3SQ 4XYOA 2R7ZH 3H3VI 4GS3A 5M5YH 3CCUA 2IHEA 5EBCA 2JA6G 1JOQA 1F9PA 3S15H 4DXGA 4A3DH 1B9NA 2EYFA 2ICIA 1IW7D 4DR6Q 2FHTA 1FGUA 4LW1A 5KGUA 1WVLA 2EYJA 4OEMB 5I4DA 1RF2D 1TR5A 3CW2C 1SYBA 2V4DA 1DJRD 1J5EL 2B63H 2A8VA 3CQZH 2F0NA 3CC7A 3RLOA 3I4MB 2F0IA 5EKIA 1M8AA 3QO2A 4UDUC 4A3IB 1YITA 3M4OB 1YNJC 4HJ5A 1QNUA 2CH4A 4DNIA 4CJ1B 3J81c 4PMBA 4FYDA 1LTTD 1EIFA 1QWYA 2Z8LA 2LY7A 2B8FA 4IUUA 3KLSA 2F0MA 1ET6A 3HRZC 2NVYB 1EY8A 3G7LA 3CMEA 2N78A 3HFZB 2EOTA 1H9KA 1JORA 2HIVA 1UE1A 1VF7A 4CDDC 4DV1Q 1X3FA 4RGMA 4GOPB 3NK9A 3PCOB 4R1JA 1RDPD 1IKMA 5D3DA 3PIP3 4DAMA 3MXUA 5GAEC 1GVPA 3MTSA 4GOPA 3AU7A 4A93H 4DV5Q 4LFBQ 4OWTB 3FRPB 3PIO3 1X55A 3BDLA 4K5VA 5BN5A 4MN3A 5IYCG 4CKEA 4CDCC 1MKHA 2A68D 3H09A 1XNQQ 3MFYA 4IN3A 1C9OA 2EYPA 3K58A 1MSHA 5A2QE 5ELEA 1EWCA 2RDGA 1VMCA 2QCPX 5IIFA 2PYKA 4YCVA 1YIJA 1AE3A 2HDLA 1F9SA 4C3IG 2L12A 4H7BA 1IBLQ 3F2DA 1B50A 2KENA 4JI7L 3R93A 4GN4B 4FNFA 3P7JA 3I4MG 1SJHD 1IBKQ 4MHEA 2JA8H 2KOLA 2NVTB 3S1QH 4XT1B 2RHQB 3A8KE 1B4OA 1U9RA 3TP7A 3A8JE 4X3UA 1KRTA 2YU9H 1SROA 2VQFQ 1VQHA 4HJAA 4LF5L 1CSPA 4A3LG 3W2DA 4FXDA 4ZYSA 4DR5Q 5EPKA 3CRKC 1HNZL 2F3VA 1D5MC 1CFMA 3FPPA 5ELFA 5KYIA 1QVFA 4LMQD 3ZYYX 4TVAB 4ZQ3A 1NE3A 4BA2I 4RAUC 5C0XJ 5H1SE 1M90C 1D2BA 1A3UA 1EIHA 2M2LA 3CHBD 5ELNA 2WB1E 4RCOA 3CXCA 2KCNA 1WTXA 4A3KB 1TKWB 4UP8A 2F0PA 1AZPA 4K5XA 2G5DA 3H6MA 1UE7A 2J7ZA 5G3LF 2B29A 4IURA 2ZTEA 2O2LD 5E7NA 2YYZA 4R4OA 4KY6A 1ASZA 1YHAA 1MGSA 3U58A 1QE6A 1X6OA 2KA7A 2ZTDA 1G8ZD 1PRTF 1E3PA 2NB0A 2N88A 1E0BA 3KBXA 3CMAA 2MO1A 3WOEA 1HNWL 4PG3A 1NBWA 1RL2A 4WRDA 1X65A 2Y0SG 4NMZA 3A0JA 2B2VA 4RHRA 4OGQC 4C3JB 2N8NA 3GTJB 5BR8Q 2CQOA 2J4XA 4P75A 5M3MG 1ZEQX 2Z4IA 1SFOB 2ZT9C 4ALPA 1KRSA 1PZID 3DWPA 4U673 1Q86C 3D4DA 3PUVA 1WCMG 3G71A 3PIPA 3TRZA 2NZOA 3BYYB 3EIVA 2D2CC 4IPGA 3HOUH 4Y7NH 2O5JC 3W3AA 1CA5A 2XGTA 2MUYA 2RDFA 4XQNA 3I91A 1K3BC 3G6JB 1QCBD 4U68A 4NXNL 1L0YB 3KUPA 2XVSA 3NSWA 1RTNA 1M1KC 2RA4A 4B3ML 4DV0Q 5JEAG 5C4JH 1HQMC 2DUDA 4A3KG 1LTGD 1KDAA 4C1NI 1ILPA 1IBML 1XMOL 4HAEA 5TSSA 3HOXH 2BH2A 1K28A 1O7ZA 3HS0C 4GKJL 1AE2A 3M4PA 1I6VC 3K6OA 1VQNA 4JI5Q 3KOJA 4B3SL 4IFDI 4NP5A 3EJIA 4K6DA 2WINB 1GXDC 1NSNS 4OELB 4B3TQ 3JAMc 1PRTB 5DM73 3WDNA 2WAQG 4QL5A 3K7AB 3T1HQ 4OO1I 1HZAA 4NXMQ 1I4GA 2HCIA 2DN8A 2F0OA 4MIUA 4DR6L 2JP1A 2EXZA 1IL8A 2IX3A 1VQAA 1R9TH 1GD7A 2B3GA 4C3JG 1QVGA 2RHSB 2MHVA 3CRLC 2I0QA 1O78A 1EOTA 1NCVA 1JC7A 4X62Q 3H3VH 4XYQA 3RN5A 1PH6A 2I5HA 1HR0Q 2CCZA 1D8LA 1X9NA 2VW9A 3C1EA 3RMHA 2ENBA 3SGIA 5IE8A 3H0GB 3I7FA 1VQPA 3M7GA 3J7AV 1HNXQ 3H3VC 4LF6Q 4ZUJA 1WTRA 2RSOA 4LFAQ 1WTHA 3K59A 2B2WA 1VQBA 3GP7A 3I56A 5CV8A 2L11A 1LTID 4HJ7A 4ID6A 4WJ3M 1G291 1MI2A 1WI5A 1CZWA 5C3XA 1OXUA 3R8BA 1SNQA 1O7YA 3JC66 4R4QA 4HIMA 2FXQA 1EL0A 4DV1L 5DLQE 5CV5A 4FF4A 2HIXA 1XJVA 1JB3A 1NAPA 3P75A 5ELCA 1UNSA 3G6EA 2DY8A 1JR0D 4LFBL 3PO3H 3S17H 1LTBD 3AFQA 3ERQA 1U5KA 3T16A 3GTGH 1KL9A 1YZ6A 1XPUA 1TWAH 4JI6Q 3D4WA 1KDCA 2K5DA 2GA4B 4R9WA 2UXDQ 1QJOA 2K5VA 1XNQL 3D0FA 2I5LX 5D14A 3Q22A 1Z47A 1VQGA 4FF3A 1HHVA 3GTLB 2XSCA 5FO9B 2TSSA 3BS1A 5EKKA 3HOVH 4KHVA 2J0TD 3PO2H 3FKIH 5HGQA 1Z9FA 1CUKA 1CHQD 2OQKA 1OO9B 1K9MC 1YHBA 1SBBB 2CHBD 2L9HA 5LMNQ 3VA7A 4IJHA 3E0JA 1V1QA 1IBKL 1NR2A 3H0GG 5BN4A 4FF2A 3OMGA 3T1YQ 1X3GA 2F4VQ 3MEHA 4ILWA 5JOBA 1F9RA 2VQFL 3GTOB 1BCPB 1TWFB 4DR5L 2KBNA 3U4VA 4B9WA 1VQ6A 1ONLA 4ZKBB 3S1MB 1IYJB 2JQOA 5CV7A 2C35B 4EQNA 3OW7A 1Q3LA 4OX9Q 2AUKA 1HA5A 3ULPA 1N33Q 2X6LA 4G7OC 1VQMA 4CGYB 2FFKB 5IP7G 1TS2A 3F1ZA 1ESFA 1HUMA 3I4NH 1VS0A 5BN3A 1L1OA 3H15A 5FO8B 1U4MA 4DA2A 1ZKOA 4GLAC 2ZXRA 5FJ8H 2GVAA 4F8MA 1B44D 1FNWA 3ND8A 3HOYG 4TKOB 4ZK9B 2YV5A 3HEJA 2WB1B 1I5FA 1PFNA 4JG2A 3TZDA 2WIIB 1SN8A 1S5BD 2HHHQ 5BR8L 1JQYD 2VL6A 3K5LA 1EWIA 1UE6A 4A3EH 2E2HB 4OHJA 2XWJB 1G6PA 3H94A 4NPSA 4LNQA 4G57A 5C0XI 4G7ZC 4BBSB 2PCFB 1F9QA 3VDYA 4E6IA 2GVBA 2MGSA 2XNAC 1B70B 3M85A 1RIPA 2PNRC 4A3DG 2B2TA 1SE2A 4K0KQ 1UEAB 1VF5C 4GKKQ 5T1GA 1X54A 2VUMH 4BBRB 3CF5A 2E76C 4KJOA 5CV9A 2NN6I 4LUZA 4O1NA 4DNTB 2B63G 2QDBA 2C9OA 5C5LA 1BNZA 1LLRD 1PYWD 1V1PB 2B2VC 4L63B 3J7A5 4DV0L 4FP5D 4A3MH 3HKSA 4GLXA 3FEWX 4I7ZC 1JCKB 2JJQA 1E2ZA 1GUNA 1V1PA 1AEXA 1EQVA 1Y8PB 2AUJD 2SDFA 3AB9A 3BYTB 1Q90A 3K8AA 3STBD 4F7XA 5IWAQ 4A3FH 1P16A 1WOCA 1MHWC 3K5OA 4OONA 4JI5L 5HURA 5AJ3Q 2HD3A 5J1ZA 1I50H 4DV4L 1I6HB 2KHSA 1CKMA 5GROA 2VB3X 2E2IB 3T1HL 4NXML 4OL7A 4GNXB 3F2BA 3CCLA 3S1NH 3CKIB 1TWHB 2WB1G 4K2LA 5IGDA 5EGTA 3HOWB 4IUPA 1CQFA 1EQRA 2OT2A 1PXUA 2NZHA 1TWCH 3QOLA 4GNXA 4A76A 3IRBA 1AN8A 2QILA 1WTWA 4IFDH 4X62L 5M3FH 3GO5A 4M1UB 1PYBA 1HR0L 4CBVA 1GKHA 4BBSG 4L6TB 1K3RA 1C4QA 3Q6SA 4P73A 4OO1H 1IXRA 4L5QA 4BXXH 2WACA 2WV6D 1E24A 1HNXL 1G2SA 2JXMB 4G4KA 2Q8TA 4LF6L 3S2HH 4LFAL 5K36G 3VYSA 1I3QH 1J8IA 1KDBA 2L4NA 4BBRG 2PI2A 3J7AF 5C4HA 3D8GA 3I8ZA 3EVQA 1PRTC 3OMCA 4DPGA 1XXGA 4IPHA 2QEJC 1DGSA 5ELDA 2A73B 5JJLA 1OTCA 1NR4A 2NBFA 4OXPA 4RGNA 1U4LA 2A69C 4Y52H 4IFDJ 4JI3Q 4YWMA 5JVG3 4HIDA 2DGYA 1NMFA 5FLXL 3FVQA 4JK1C 3FDTA 4JI6L 1WJJA 3MXPA 2UXDL 4IOAA 3VYUA 2Z4HA 1KNEA 3VR6A 4DR3Q 3DM3A 3NPPA 1FR3A 2IWHA 3TDQA 5A2QL 1JE4A 4J15A 1X3PA 2JA5B 1K0SA 4FDBA 1YBYA 4X3KA 5I6YA 2ZJPA 5CBEE 5NUCA 1ENFA 2K33A 1BCPD 1KAAA 1A2TA 2EY6A 3PSIA 1H9JA 3D3RA 3GTMB 4B3MQ 2UUBQ 3KF6B 1VQEA 1W6KA 1U0LA 4TRDA 2HCCA 2IX1A 3UDFA 3T1YL 4IPCA 2F4VL 1LABA 2PW5A 1XMOQ 4BY7H 1H9MA 3F8TA 1KLUD 1K83B 4TSSA 3KF6A 3QG1A 4XIGS 1ZYRD 4BA1I 4QIWB 3OPOA 3A8IE 3LNNA 3CCMA 4DK6C 2E75C 5M5WB 1PTOB 3RLNA 1XPRA 3K5MA 4DR4Q 2RQXA 1OXTA 2F0WA 4KHPL 4QUCA 2LKVA 1HZCA 5JPMC 1B3QA 4OX9L 3ITPA 4N8FA 1N33L 4KTAA 3CPWA 5FOBB 3KLSX 2NVXH 4L8JA 4RG1A 3LWEA 3FP9A 1VQ7A 2KJXA 3A54A 3CCJA 3U50C 4QCLA 4A3BB 4WORA 1GOZA 4C3IB 1DCZA 3TSSA 1EZ6A 4KD3A 1WTOA 1I4XA 1S40A 4RHSA 4EQOA 3NTIA 4OWWB 4BY1B 3SK5A 1HZ9A 4JOIC 4MTNA 1SNDA 4IJLA 3DEOA 2A6HD 2CH4W 1A6XA 1CM9A 4HN7A 3HP3A 4C3HH 1JJ2A 2BH8A 2EXDA 3T53B 2JA5G 1MSGA 5IP9G 4DV3Q 2NYZD 4X66Q 1D6EC 2EYHA 3H91A 2HHHL 1PFMA 1MD2D 5T1IA 4ZRZA 4APVA 1EY9A 1QZHA 2B2UA 1O7IA 1PLFA 1L1OC 1A8VA 1QNKA 5EBDA 3S1RH 3NUCA 4UAIA 4HCSA 4I7AA 2RDHA 4K0KL 2HQEA 2Z1CA 4GKKL 5FLXE 1IW7C 1PMRA 4L5TA 1LT4D 4LK1C 3OYYA 3C1FA 4CDEC 1VDZA 2F0UA 3RR5A 1CKNB 1STNA 2Q2HA 5C0XH 1GJXA 2PO4A 5M9OA 1I94Q 4G7HC 3ND9A 4DAYB 5FLMH 2Y0SB 2YTXA 4UPAA 1TXYA 4FXGC 3J80c 4HIKA 4A3BG 4HTHA 3MVVA 2QA4A 5CR3A 1TVXA 3LGJA 5IWAL 1EY0A 2Q2TA 5M3MB 3RNUA 2NTSA 3BZDB 5AJ3L 2R92H 4DAYA 4YCWA 2NN6H 1Q7YC 4BY1G 3W1GA 2AMCB 1SYGA 4KD4A 2R93B 2NVQB 2VS1A 5JAVA 4X65Q 2UUAL 1WCMB 1Q46A 3I2ZA 3MFGA 5IGCA 2KCCA 3J81L 3PV0A 1K8OA 4N9PA 2AQ1B 1BO0A 2E8GA 1K8AC 4H44C 1STGA 2Z0SA 4K14A 3OWEB 2DJFC 3J7YW 3E3XA 5L37A 3PO3G 3NENA 2F03A 4POFA 1SE3A 4JI2Q 2OWOA 1TWGH 3BU2A 5ELOA 1UE5A 3GTPB 1IL2A 3T56B 1DOLA 4PQXA 1FJGQ 2PZUA 1PZJD 1LT6D 2A68C 4J6HA 4K8JA 4A3JB 4KLKA 4H13C 1BUVT 4PZ8A 2CW0D 2LXJA 3L9AX 3SVMA 3RZOB 2WAQB 3FPUB 1SMXA 4GNXC 4IUQA 2KECA 1Y1VH 4UP7A 3TS2A 2OTJA 3BVZA 1OXXK 1HFNA 4DR7Q 3F2UA 4J8QA 4ODGA 3AMUA 1EY4A 2Q2UA 2EY5A 3A55A 2LXKA 4JI3L 4CKBA 2G9DA 4IO9A 1EU3A 3KJPA 2JK8A 1ICFB 1PFSA 3SEBA 2F0JA 1VQKA 1SYDA 2B2YA 4C2MB 2DJGC 1PVOA 1L0WA 2PZTA 2R93G 1BXTA 5C4XH 2KUMA 4DR3L 4DUZQ 3SK6A 5IT9c 2F0VA 1N32Q 4DR2Q 4IQZA 4JI1Q 3PF4A 4A3MB 3S2DH 3I55A 4RH6A 1L2FA 4MTKA 5CYUA 3I4NG 5I9PA 4B3RQ 3DHQA 5C44H 2UUBL 1SRUA 1T9HA 4XQJA 5FJ8G 3QR8A 1PTOD 1TQOA 3MHBA 3GTKB 3M3YB 1VCIA 1NNXA 1JB7A 4A3JG 3ONAB 1W2BA 5I2YA 2Z6BA 3BDCA 4TQUS 4DV4Q 3A5ZB 4LJZC 4DR4L 5IYDG 3NELA 2JA7B 3EQLC 1FYCA 3QOJA 3K0YA 4DK0A 3KLWA 1BBXC 3KDFB 3J81E 2R7DA 2VXWA 1FGBD 2N49A 3RLFA 3CCVA 5E4XA 1QILA 1T5EA 1HCZA 2O5IC 3S14B 2X6GA 5I9OA 4HSVA 2RCFA 3KDFA 1W3SA 1NY4A 3GTQB 3CU7A 1H9RA 2MO0A 3T13A 3NQIA 2UXCQ 2ZXPA 1GUSA 2K6AA 4A3GB 5C5MA 3LWUA 1XMQQ 1BCPF 2JEBI 1KHIA 5IGFA 1EUJA 4DV3L 4A3MG 4JBKA 4X66L 3TQYA 3F2CA 2K04A 2E2JB 3UE1A 2EPBA 3BVGA 4LFCQ 3G48A 2F0FA 1D5XC 1MIUA 2A19A 1V43A 2D9UA 4A3FG 4X3TA 3RZDB 3NHHA 3TN2A 4LF9Q 2EQSA 3WOFA 2QEXA 1G6ZA 1DD2A 3HG9A 1IYVA 1KTKA 4ZLTF 1EEFD 1VQIA 1N9WA 3I4MH 4HSPA 1BDOA 1IYUA 3MEFA 4A3IH 3SDZA 1JOKA 2NTTA 1F2LA 3KYHC 3M4OH 2AWNA 1K8GA 1SMYD 4ZCKA 2JE6I 1RKNA 1SE8A 5M5XB 3URYA 1HFGA 2QF7A 2LS01 5AFWA 2D0OA 2ICEC 2JA7G 4A3LH 1O7LA 5E1FA 3JAML 5IODA 1KD1C 1HQRD 2H5XA 5IGEA 4LF8Q 1JT8A 3HOYB 1I94L 1XWEA 2NVYH 2PZWA 3PUWA 4DK1A 1TS5A 2A6ED 1UAPA 4K2KA 2ID0A 2OF1A 2FMMA 5ELBA 4OO1G 3CCSA 3HOZH 4CDFC 1ENCA 1PH8A 1SAPA 4JW0A 3OIQA 2E2DC 1CA6A 3V05A 2EY2A 1XPOA 2SNSA 4GOPC 3CP0A 4FXKC 4X65L 4CKCA 4DV2Q 4A3GG 1QB5D 2R7ZB 1E2WA 1I4PA 5M5YB 4Z9CB 5HY6A 5IY0A 5DAUA 1DOMA 1VQDA 3S15B 1VQCA 4A75A 4A3DB 1EYDA 3DLLA 2F1MA 3TBIB 4X64Q 4A3CG 5J22A 2ZM6Q 5KNDA 2B63B 1JWUD 3CQZB 4KHPQ 1YNND 2CKZB 3L2PA 1PHJA 4JI2L 2A5HA 3I90A 4EQ5A 4GN3B 3BDOA 1STEA 4FVMA 1SYFA 2F0SA 3IFTA 1EQTA 2UUCL 2MP1A 1SXTA 4QMGA 1FJGL 2RF4A 2KEEA 2NVTH 3AQQA 1S4ZA 4JYAQ 3R2TA 4Q5VA 1B7YB 1E2VA 3MXNB 3VR5A 4V190 3QIAA 3S24A 1VQFA 3O13A 1VQ8A 5IT9E 1BBWA 2OQ0A 3MXNA 2ES2A 4DR7L 3DWQA 3J81i 4YHHQ 4IZ8A 2IW3A 5IYBG 1DYQA 1RHPA 2EE1A 3TS0A 2UU9Q 3OSOA 3M4QA 4UP9A 1LACA 4RGTA 4A3KH 3S1RB 2PMZE 4A93B 1DM0B 1V1OA 1EOVA 2R7ZG 5C4ZA 4DUZL 1N32L 3CPFA 4DR2L 4EQPA 5J39A 4JI1L 1CZGA 4KN4C 1ET9A 4CJ0B 1YNXA 1LTSD 2EZVA 2IPKD 1EZ8A 3FMCA 1S5CD 5JJIA 1F77A 5CMDA 3TEHB 1PDQA 1KC8C 4B3RL 5JVH3 3JAME 4C3JH 3GTJH 1LYLA 2R92B 2IT1A 3P20A 1Q1EA 2HQLA 2CVRA 1SFOH 5JEAJ 3C2PA 4LUOA 1NJIC 2JA8B 2PNHA 1N34Q 3S1QB 3QWNA 4L5RC 1F2ZA 4KKSA 3MXGA 2YU9B 3DWAA 1Y8OB 1CK1A 1ZXTA 4R8NA 4JI0Q 1IZ6A 3J81j 4CJ2C 1VQOA 4JCVE 1OXVA 5LL6S 2F0TA 1EQQA 1YJNA 4DK3C 1BVSA 2EJFC 3AFPA 2UUAQ 1A3VA 1C7YA 4P71A 1EWHA 1PYSB 3NWTA 4RWSC 3CCQA 4LF7Q 2QW7A 3N6RA 3RN2A 2C5CA 2DNCA 1K0RA 1LTRD 4CHTB 3K7UC 4A93G 2JYOA 4ABNA 2R7FA 1Y69U 2AKWB 2UXCL 1XNRQ 3D6CA 4WJWA 2Z6KA 2K28A 3NBIA 1RJTA 2K32A 3WWVA 1JE5A 2IJ0A 1XMQL 5C0XG 2K52A 4FO2A 3CC4A 1TS3A 4JI8L 5LHY1 4KN7C 3K7AH 3K80C 3M7NA 5FLMG 2WKDA 4LFCL 2XTIA 3HZXA 3NWSA 1PTOF 2MNAA 2KHIA 2QKIC 3MWYW 3STBC 2G9HD 1E7ZA 1SJED 1C0AA 1KXLA 4LF9L 1KLGD 3E5SA 2RVLA 2R92G 2MJ8A 2XRSD 4O42A 3UE0A 3PUYA 3R2IA 3UDGA 3W5OA 3K5NA 5EKLA 1TS4A 4PZ6A 2JA8G 1EY5A 2FMCA 3OWFA 1B53A 4AQYQ 3H0GH 1TY2A 1KIXA 3PQIA 4JV5Q 4UHVA 3HOUB 3I4OA 3HKZE 4Y7NB 3MC0B 2KHJA 5C6AA 2H1EA 2B2WC 3NXWA 1FVIA 3TP8A 4DV7Q 3CCRA 4YWLA 2YTYA 5I6WA 1SDFA 2L1BA 4LF8L 1HA6A 2F3IA 5KNBA 1CSQA 2JN4A 4LAAA 4LWCA 2AWOA 5C4JB 3GV6A 1XTDA 5C3WA 4HJ8A 1JWMD 4EX5A 4KY7A 4QQBX 3HOXB 5CORA 4PMWA 3CC2A 2KEDA 2A74C 3X3NA 3BG3A 3A74A 5DEHA 4C56C 5EPLA 1GHKA 4R4CA 1XX8A 3VR3A 1XYIA 3ER0A 5E3FA 4DV2L 1BKBA 5EQ0A 5C3EH 1L0XB 1D1IA 2K01A 4HMIA 3CCEA 1Q82C 3Q23A 4POGA 1B1ZA 2XN9C 3OOCA 4AIMA 3K81C 4GZYC 1Y1VG 1YNJD 4BWGB 1GM5A 4X64L 1R9TB 3QB3A 2VZAA 2EJMA 2ZM6L 4GLVB 1PH4A 4V0BA 3V96A 3JAMi 2BCOA 3KLRA 4PMCA 1CT1D 4PV1C 2UXBQ 1QUQB 2JA9A 3HGBA 4R4TA 2R6GA 4DGZA 1AZQA 4WJ4A 1T5XD 5K5PA 3NTHA 2R61A 4AYBE 3VYRA 3OTOL 3AEVA 4KY5A 3HOUG 5FKAC 1QUQA 3VR2A 4JYAL 4LF4Q 1QG7A 3BZKA 3GTOH 2ZJRA 4KKUA 3DMUA 3FHWA 2SOBA 4LUVA 1TWFH 2SEBD 3S9WA 1CI3M 4YY3Q 1WTQA 3S1MH 1Y1WH 3NEMA 2AHOB 5C44G 1BCPC 3NBHB 5DM63 1II3A 4YHHL 1N36Q 5F2DA 5KYLA 1EYGA 2UU9L 4RKLA 1KQSA 1KNAA 1WTVA 4MNOA 3HOXG 4K8IA 1LV9A 2GN5A 3UI2A 3NBHA 4OIKA 2QGQA 3NQTA 4DAVA 1ZYRC 3PO3B 3S17B 2QDLA 1IKLA 3GTGB 4QJFA 1TWAB 3QJYA 4HEDA 5JPNC 2I46A 1I4RA 5KRUA 1D5ZC 1SEBD 3HOVB 3V2TA 1P8LA 4KHZA 1SNOA 3PO2B 3TP6A 3FKIB 3HOZB 4FF1A 4B9XA 3SHLA 1YI2A 1PV4A 1N8RC 1PH9A 2PMZB 1NTGA 4HCEA 3LX0A 2E2HH 1CKNA 5GAHC 3AYHB 4PZ7A 2B39A 1FL0A 2HDMA 1N34L 2A1AA 1A0IA 2F52A 1EIYB 1PA6A 2A6HC 4BBSH 3U9SA 1KAWA 4ME5A 4JI0L 3I72A 1I4QA 5KNCA 1OXSC 2MPMA 5K36H 4DR1Q 3N52A 2B2TC 2Q8RE 4I65A 2PPBC 4BBRH 4H0LC 1Y8NB 4DAPA 4LF7L 2CWPA 1AW7A 1BR9A 3DM1A 2CWAA 4DN4M 4MZ9A 1PZKD 1LM0A 1D7QA 3NE5B 2LMCB
chains in the Genus database with same CATH topology
1STYA 3I4NB 2EYLA 1EFID 4XDXA 1A3TA 2BE5D 2F0LA 3M4YA 2N55A 4ZUIA 1B9MA 1UUPA 1ICWA 3IAYA 3TZUA 3SE0A 2O4XA 1Q12A 3RUZA 4RGOS 4A3EB 2XWBB 3T51B 2NZ1D 3C46A 3J80L 5IOCA 4XT3B 1TT2A 2IL8A 3OHXC 2LFNA 1TIID 4EVOA 2VUMB 2NUCA 1EYCA 2M9VA 1BF4A 1R4QB 2XRQD 3E6ZX 3KBGA 1F2MA 2ZXOA 2JSOA 4ZKCB 2BE5C 5EJWA 4A3FB 3D4RA 3HKZB 4P2CB 1C48A 1I50B 1JOOA 2CW0C 4C1NK 4KK7A 3S1NB 2L55A 1DXMA 1S5FD 1EY7A 3SR1A 1TWCB 5CC4A 3A7AB 3IKJA 5M3FB 3I4LA 1GHJA 1HXYD 2BDNA 1Z6HA 5EPJA 1I4HA 3P1HA 4K6LA 1BQQT 2EVBA 2L0CA 1Z7TA 1X32A 3S2HB 3TMEA 3GD7A 1QOHA 4S3SA 1I3QB 4HMJA 2KVMA 2F0KA 1RCVD 2F0HA 1A2UA 4NKLA 3SK8A 2H4OA 3VA5A 1MBYA 5IT9L 1PTOH 1H9SB 2RKSA 3R3OA 1GUGA 3NP8A 1J9OA 1HPCA 1ML0D 1WD1A 1H9SA 1PTOC 3C3LA 4AYBB 3VYTA 1WD0A 3Q24A 1CTMA 2SNMA 4ZAIA 4J1MA 4DF7A 4DXFA 2K03A 1FD7D 2VNUD 3MA2B 3DEPA 3J80E 4NDXA 4EGVA 1NUCA 3DUZA 3X3MA 3GV3A 4N9TA 4X3SA 4IUVA 4IUTA 2RSNA 4RCNA 3MAQA 1DONA 1B2TA 5D3IB 1HUNA 4IFDG 1S5DD 5C3EB 1TY0A 2F0GA 1SSOA 4BY7B 2B2UC 4HR7B 5FO7B 2JEAI 3T4AC 2AQ3B 3A56A 4Q0FA 2R3ZA 4IALA 3PUXA 2BDOA 1S5ED 1EU4A 4NW2A 1FNUA 3BVMA 2NVXB 3K57A 1G91A 1ENAA 1EYAA 3L3OC 5KIXA 1STBA 1JWSD 4BS9A 1A15A 1SMYC 1SNPA 3SXHA 1SE4A 3D31A 1Y1WB 2DNEA 2RBMA 4C3HB 1EIGA 4KMUC 2WKCA 1GUTA 1Q1BA 1U4PA 2A6EC 2FJ2A 5ISRA 3I3CA 2BOSA 5I2XA 2XIWA 5A35A 1DZ1A 2CQAA 4KI0A 5CV4A 3EA6A 4RA8A 1TU2B 1V8QA 2L5TA 2D5DA 2KQ3A 1STHA 1EY6A 5JEAH 4WFN3 1ESRA 5CGKA 4YIJA 1D1KA 3OIPA 3U9OA 3TP5A 2F4IA 2NWGA 2EY1A 4XTCS 3I70A 1GUWA 1YNNC 3PUZA 3RD4A 1M4VA 3EFXD 4F87A 4KV6A 5IGBA 3NTKA 4ULLA 1RTOA 1LT3D 2B2YC 1IHZA 3IFDA 5JJZA 4C3HG 1O80A 3KK7A 5G3LD 1JICA 5IGGA 1SYCA 2D62A 4K5WA 1U4RA 2EYOA 2F0DA 1XTCD 4RKBA 2M00A 5HGTA 1PRTD 1C8CA 1AFPA 2OEOA 1F2YA 1FNVA 1TWGB 1AP0A 1VMPA 4XQQA 5FK9C 2A69D 3I73A 1BOSA 1LO5D 2EYMA 1R4PB 3GQBA 5KEEA 3DXJC 3L7ZC 2K05A 2BA0A 2F0QA 1Y1VB 5CV6A 2PQEA 1X3QA 2B8GA 2E74C 1W6JA 2OXPA 3VR4A 1CQVA 4QB4A 2HUGA 4QF4A 1LTAD 1SNMA 2IX0A 1SNCA 2X69A 1RODA 4M8AA 4KJNA 2NN6G 2FINB 5C4XB 4XXEA 1HRJA 1ILQA 1GUOA 2K5WA 4OIJA 2JA6B 1LT5D 3IL8A 1Q8IA 3A7LA 3S2DB 5E4WC 2VB2X 1G2TA 5COYA 3Q0AA 5C44B 2BA1A 2F3WA 2K1BA 5CBAE 1EEID 1CHPD 3D6WA 4DFAA 3S16B 4DU9A 4PNYA 2K7VA 4B08A 2I07B 5D65A 4IUNA 5DNFA 1WTPA 1HTLD 2DY7A 1HTPA 1KABA 2AQ2B 3SK4A 3KF8A 1B3AA 3EROA 4F88A 1STAA 4KKTA 4DNRB 2K5QA 4R8IA 1SYEA 4RFBA 1DOKA 2Q8IB 2TMPA 2WP8J 4JBWA 3PMFA 4QUFA 1RD9D 1K8MA 3MZ5A 1PFBA 2EJGC 2PW7A 2F0EA 2EDGA 5LL6X 4XYOA 5EBCA 1JOQA 1F9PA 4DXGA 1B9NA 2EYFA 2ICIA 1IW7D 2FHTA 5KGUA 1WVLA 2EYJA 5I4DA 1RF2D 1TR5A 1SYBA 2V4DA 1DJRD 2F0NA 3I4MB 2F0IA 5EKIA 1M8AA 3QO2A 4UDUC 4A3IB 3M4OB 1YNJC 1QNUA 4CJ1B 4PMBA 4FYDA 1LTTD 1QWYA 2Z8LA 2LY7A 2B8FA 4IUUA 3KLSA 2F0MA 1ET6A 3HRZC 2NVYB 1EY8A 3G7LA 2EOTA 1H9KA 1JORA 1VF7A 4RGMA 3NK9A 1RDPD 1IKMA 5D3DA 3PIP3 3MXUA 3MTSA 3AU7A 3FRPB 3PIO3 3BDLA 4K5VA 5BN5A 4MN3A 4CKEA 2A68D 3H09A 3MFYA 4IN3A 2EYPA 3K58A 1MSHA 5A2QE 5ELEA 1EWCA 2RDGA 1VMCA 2QCPX 5IIFA 2PYKA 2HDLA 1F9SA 4C3IG 2L12A 4H7BA 1B50A 3R93A 4FNFA 3P7JA 1SJHD 4MHEA 2KOLA 2NVTB 4XT1B 3A8KE 1B4OA 1U9RA 3TP7A 3A8JE 4X3UA 4FXDA 3W2DA 4ZYSA 5EPKA 3CRKC 2F3VA 1D5MC 1CFMA 3FPPA 5ELFA 5KYIA 4LMQD 3ZYYX 4ZQ3A 4BA2I 4RAUC 5C0XJ 1D2BA 1A3UA 1EIHA 2M2LA 3CHBD 4RCOA 2KCNA 1WTXA 4A3KB 1TKWB 2F0PA 1AZPA 4K5XA 3H6MA 5G3LF 2J7ZA 4IURA 2O2LD 2YYZA 4KY6A 1MGSA 1QE6A 2KA7A 1G8ZD 1PRTF 2NB0A 2N88A 1E0BA 3KBXA 3WOEA 4WRDA 4NMZA 2B2VA 4RHRA 4OGQC 4C3JB 3GTJB 2J4XA 1ZEQX 2Z4IA 1SFOB 2ZT9C 1PZID 3DWPA 4U673 3D4DA 3PUVA 3BYYB 2D2CC 2O5JC 3W3AA 1CA5A 2MUYA 2RDFA 4XQNA 3I91A 3G6JB 1QCBD 4U68A 1L0YB 3KUPA 2XVSA 3NSWA 1RTNA 2RA4A 5JEAG 1HQMC 1LTGD 1KDAA 4C1NI 1ILPA 4HAEA 5TSSA 1O7ZA 3HS0C 1I6VC 3K6OA 4IFDI 4NP5A 3EJIA 4K6DA 2WINB 1GXDC 1NSNS 5DM73 1PRTB 3WDNA 3K7AB 4OO1I 1I4GA 2HCIA 2DN8A 2F0OA 4MIUA 2JP1A 2EXZA 1IL8A 2IX3A 4C3JG 2MHVA 3CRLC 1O78A 1EOTA 1NCVA 1JC7A 4XYQA 3C1EA 3RMHA 2ENBA 3H0GB 3M7GA 3J7AV 3H3VC 4ZUJA 1WTRA 2RSOA 3K59A 2B2WA 3GP7A 5CV8A 2L11A 1LTID 4ID6A 1G291 1MI2A 1CZWA 5C3XA 1OXUA 3R8BA 1SNQA 1O7YA 1EL0A 5CV5A 4FF4A 1JB3A 1NAPA 3P75A 5ELCA 1UNSA 2DY8A 1JR0D 1LTBD 3ERQA 3T16A 3D4WA 1KDCA 2K5DA 2GA4B 4R9WA 1QJOA 5D14A 3Q22A 1Z47A 4FF3A 1HHVA 3GTLB 2XSCA 5FO9B 2TSSA 3BS1A 5EKKA 4KHVA 2J0TD 1CHQD 1OO9B 2CHBD 1SBBB 2L9HA 3VA7A 3E0JA 1NR2A 5BN4A 4FF2A 3OMGA 3MEHA 4ILWA 5JOBA 1F9RA 3GTOB 1BCPB 1TWFB 4B9WA 1ONLA 4ZKBB 3S1MB 5CV7A 4EQNA 3OW7A 1Q3LA 2AUKA 1HA5A 2X6LA 4G7OC 4CGYB 2FFKB 1TS2A 1ESFA 1HUMA 5BN3A 5FO8B 1U4MA 4DA2A 1ZKOA 2ZXRA 4F8MA 1B44D 1FNWA 3ND8A 4TKOB 4ZK9B 3HEJA 2WB1B 1PFNA 3TZDA 2WIIB 1S5BD 1JQYD 3K5LA 2E2HB 4OHJA 2XWJB 3H94A 4G57A 5C0XI 4G7ZC 4BBSB 2PCFB 1F9QA 4E6IA 2MGSA 2XNAC 3M85A 2PNRC 2B2TA 1SE2A 1UEAB 1VF5C 5T1GA 4BBRB 2E76C 4KJOA 5CV9A 2NN6I 4O1NA 4DNTB 2QDBA 2C9OA 5C5LA 1BNZA 1LLRD 1PYWD 1V1PB 2B2VC 4L63B 4FP5D 3FEWX 4I7ZC 1JCKB 1E2ZA 1GUNA 1V1PA 1AEXA 1EQVA 1Y8PB 2AUJD 2SDFA 3AB9A 3BYTB 1Q90A 4F7XA 3K5OA 5HURA 5J1ZA 1I6HB 2KHSA 2VB3X 2E2IB 4OL7A 3CKIB 1TWHB 5IGDA 4K2LA 5EGTA 3HOWB 4IUPA 1CQFA 2OT2A 1PXUA 3QOLA 1AN8A 2QILA 1WTWA 4IFDH 3GO5A 4M1UB 4CBVA 4L6TB 1C4QA 3Q6SA 4OO1H 2WACA 2WV6D 1G2SA 2JXMB 4G4KA 2Q8TA 5K36G 3VYSA 1J8IA 1KDBA 2L4NA 3J7AF 5C4HA 3D8GA 3I8ZA 3EVQA 1PRTC 3OMCA 1XXGA 2QEJC 5ELDA 2A73B 1NR4A 2NBFA 4RGNA 1U4LA 2A69C 4IFDJ 5JVG3 5FLXL 3FVQA 4JK1C 3FDTA 3MXPA 3VYUA 2Z4HA 1KNEA 3VR6A 3NPPA 1FR3A 2IWHA 3TDQA 5A2QL 1JE4A 1X3PA 2JA5B 4X3KA 5I6YA 5CBEE 5NUCA 1ENFA 2K33A 1BCPD 1KAAA 1A2TA 2EY6A 3GTMB 1H9JA 3D3RA 1W6KA 4TRDA 2HCCA 2IX1A 1LABA 2PW5A 1H9MA 1KLUD 1K83B 4TSSA 3QG1A 4XIGS 1ZYRD 4BA1I 4QIWB 3OPOA 3A8IE 3LNNA 2E75C 5M5WB 1PTOB 3K5MA 2RQXA 1OXTA 2F0WA 4QUCA 2LKVA 5JPMC 3ITPA 4KTAA 5FOBB 3KLSX 4L8JA 3LWEA 2KJXA 3A54A 4QCLA 4A3BB 4WORA 1GOZA 4C3IB 1DCZA 3TSSA 1EZ6A 4KD3A 1WTOA 1I4XA 4EQOA 4RHSA 3NTIA 4BY1B 3SK5A 1SNDA 3DEOA 2A6HD 1A6XA 1CM9A 4HN7A 3HP3A 3T53B 1MSGA 2NYZD 1D6EC 2EYHA 3H91A 1PFMA 1MD2D 5T1IA 4ZRZA 1EY9A 2B2UA 1PLFA 1QNKA 5EBDA 3NUCA 4UAIA 4HCSA 2RDHA 2HQEA 2Z1CA 5FLXE 1IW7C 1PMRA 1LT4D 4LK1C 3C1FA 1VDZA 2F0UA 1STNA 5C0XH 1GJXA 2PO4A 5M9OA 4G7HC 3ND9A 2Y0SB 4FXGC 4HTHA 3MVVA 5CR3A 1TVXA 1EY0A 5M3MB 2NTSA 3BZDB 4DAYA 2NN6H 1SYGA 4KD4A 2R93B 2NVQB 5JAVA 1WCMB 3MFGA 5IGCA 2KCCA 3J81L 3PV0A 1K8OA 4N9PA 2AQ1B 1BO0A 4H44C 1STGA 4K14A 3OWEB 3J7YW 2F03A 1SE3A 3GTPB 3T56B 1DOLA 4PQXA 2PZUA 1PZJD 1LT6D 2A68C 4J6HA 4K8JA 4A3JB 4H13C 1BUVT 2CW0D 3L9AX 3SVMA 3RZOB 2WAQB 3FPUB 4IUQA 2KECA 3BVZA 1OXXK 1HFNA 3F2UA 4J8QA 4ODGA 3AMUA 1EY4A 2EY5A 3A55A 4CKBA 2G9DA 1EU3A 3SEBA 2F0JA 1SYDA 2B2YA 4C2MB 2PZTA 1BXTA 2KUMA 3SK6A 2F0VA 4IQZA 4A3MB 4RH6A 5CYUA 5I9PA 3DHQA 4XQJA 1PTOD 1TQOA 3MHBA 3GTKB 3M3YB 1VCIA 3ONAB 5I2YA 3BDCA 4TQUS 4LJZC 2JA7B 3EQLC 1FYCA 3QOJA 3K0YA 4DK0A 1BBXC 3J81E 2VXWA 1FGBD 3RLFA 5E4XA 1QILA 1T5EA 1HCZA 2O5IC 3S14B 2X6GA 5I9OA 4HSVA 3GTQB 3CU7A 1H9RA 3T13A 3NQIA 2ZXPA 1GUSA 2K6AA 4A3GB 5C5MA 3LWUA 1BCPF 2JEBI 5IGFA 2K04A 2E2JB 2EPBA 3BVGA 2F0FA 1D5XC 1V43A 2D9UA 3RZDB 4X3TA 3NHHA 3TN2A 3WOFA 1G6ZA 1DD2A 3HG9A 1IYVA 1KTKA 4ZLTF 1EEFD 4HSPA 1BDOA 1IYUA 3SDZA 1JOKA 2NTTA 1F2LA 2AWNA 1SMYD 2JE6I 1RKNA 5M5XB 3URYA 1HFGA 2QF7A 2LS01 5AFWA 2ICEC 1O7LA 5E1FA 3JAML 5IODA 1HQRD 5IGEA 3HOYB 1XWEA 2PZWA 3PUWA 4DK1A 1TS5A 2A6ED 1UAPA 4K2KA 2ID0A 2OF1A 2FMMA 5ELBA 4OO1G 1ENCA 1SAPA 3OIQA 2E2DC 1CA6A 3V05A 2EY2A 2SNSA 4FXKC 4CKCA 2R7ZB 1QB5D 1E2WA 1I4PA 5M5YB 4Z9CB 5DAUA 1DOMA 3S15B 4A3DB 1EYDA 2F1MA 3TBIB 5J22A 5KNDA 2B63B 1JWUD 3CQZB 1YNND 2A5HA 3I90A 3BDOA 1STEA 4FVMA 1SYFA 2F0SA 3IFTA 1EQTA 2MP1A 1SXTA 4QMGA 2KEEA 1S4ZA 3R2TA 4Q5VA 1E2VA 3VR5A 4V190 3QIAA 3O13A 5IT9E 3MXNA 3DWQA 4IZ8A 2IW3A 1DYQA 1RHPA 2EE1A 3OSOA 1LACA 4RGTA 3S1RB 4A93B 1DM0B 1V1OA 5C4ZA 4EQPA 5J39A 1CZGA 4KN4C 1ET9A 4CJ0B 1LTSD 2EZVA 2IPKD 1EZ8A 3FMCA 1S5CD 1F77A 5CMDA 1PDQA 5JVH3 3JAME 2R92B 2IT1A 3P20A 1Q1EA 2CVRA 5JEAJ 3C2PA 2JA8B 3S1QB 3QWNA 1F2ZA 4KKSA 3MXGA 2YU9B 3DWAA 1Y8OB 1CK1A 1ZXTA 4R8NA 4CJ2C 5LL6S 1OXVA 2F0TA 2EJFC 1A3VA 1EWHA 3NWTA 4RWSC 3N6RA 2C5CA 2DNCA 1LTRD 4CHTB 2JYOA 4ABNA 1Y69U 3D6CA 4WJWA 2K28A 3NBIA 1RJTA 2K32A 2IJ0A 5C0XG 4FO2A 1TS3A 5LHY1 4KN7C 3M7NA 2WKDA 3HZXA 3NWSA 1PTOF 2QKIC 3MWYW 2G9HD 1SJED 1KLGD 3E5SA 2RVLA 2MJ8A 2XRSD 4O42A 3PUYA 3R2IA 3K5NA 5EKLA 1TS4A 1EY5A 2FMCA 3OWFA 1B53A 1TY2A 3HOUB 4Y7NB 3MC0B 5C6AA 2H1EA 2B2WC 3NXWA 3TP8A 5I6WA 1SDFA 2L1BA 1HA6A 5KNBA 4LAAA 2AWOA 5C4JB 3GV6A 5C3WA 1JWMD 4KY7A 3HOXB 5CORA 4PMWA 2KEDA 2A74C 3X3NA 3BG3A 5DEHA 4C56C 5EPLA 1GHKA 1XX8A 3VR3A 1XYIA 5E3FA 5EQ0A 1L0XB 1D1IA 2K01A 4HMIA 3Q23A 1B1ZA 2XN9C 3OOCA 4GZYC 1YNJD 4BWGB 1R9TB 3QB3A 2EJMA 4V0BA 3V96A 2BCOA 3KLRA 4PMCA 1CT1D 4PV1C 3HGBA 2R6GA 4DGZA 1AZQA 1T5XD 5K5PA 3NTHA 2R61A 3VYRA 4KY5A 5FKAC 3VR2A 1QG7A 4KKUA 3DMUA 2SOBA 2SEBD 3S9WA 1CI3M 1WTQA 1BCPC 5DM63 1II3A 5F2DA 5KYLA 4RKLA 1KNAA 1WTVA 4K8IA 1LV9A 3UI2A 3NBHA 4OIKA 3NQTA 4DAVA 1ZYRC 3PO3B 3S17B 1IKLA 3GTGB 1TWAB 3QJYA 4HEDA 5JPNC 2I46A 1I4RA 5KRUA 1D5ZC 1SEBD 3HOVB 3V2TA 4KHZA 1SNOA 3PO2B 3TP6A 3FKIB 3HOZB 4FF1A 4B9XA 3SHLA 2PMZB 4HCEA 3LX0A 2B39A 2HDMA 2A6HC 3U9SA 4ME5A 3I72A 1I4QA 5KNCA 1OXSC 2MPMA 5K36H 3N52A 2B2TC 2Q8RE 4I65A 2PPBC 4H0LC 1Y8NB 4DAPA 1AW7A 1BR9A 3DM1A 4DN4M 1PZKD 3NE5B 2LMCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCP F;  3R2T A;  1HTL D;  1MD2 D;  1LTB D;  4RGN A;  3BYY B;  1EFI D;  2AQ2 B;  5FKA C;  1HXY D;  2IJ0 A;  1XTC D;  3BVZ A;  3BVG A;  1I4H A;  4K6L A;  1JWS D;  1TS3 A;  2XNA C;  3O13 A;  1D5X C;  1PRT D;  4RFB A;  2SEB D;  1FNV A;  5ELE A;  1EWC A;  2RDG A;  1L0Y B;  1SE2 A;  1EU3 A;  3DWQ A;  4OHJ A;  1PTO F;  3SEB A;  1DYQ A;  1RCV D;  5FK9 C;  1SE4 A;  2TSS A;  1BCP C;  1UUP A;  2G9H D;  1KTK A;  2RDH A;  1SJE D;  4RGT A;  1EEF D;  1RD9 D;  1LTG D;  1KLG D;  1LO5 D;  4O1N A;  1LT4 D;  1BXT A;  2XRS D;  1LLR D;  1PTO H;  1CHQ D;  1PYW D;  1SJH D;  1V1P B;  4L63 B;  5TSS A;  3R2I A;  2NTT A;  1TS4 A;  1SBB B;  2CHB D;  1V1O A;  4RGO S;  3URY A;  1ENF A;  1JCK B;  1TY2 A;  1BCP D;  1V1P A;  1PTO C;  3BYT B;  3W2D A;  4ZYS A;  3EA6 A;  1ET9 A;  4DXG A;  4RH6 A;  1HQR D;  1LTS D;  2ICI A;  1D5M C;  2IPK D;  3MC0 B;  5ELF A;  1BCP B;  1PRT B;  1CQV A;  1S5C D;  1LTA D;  1I4G A;  1TS5 A;  1F77 A;  5I4D A;  4DXF A;  1RF2 D;  2NTS A;  1KLU D;  3BZD B;  1FD7 D;  4TSS A;  5ELB A;  1I4R A;  1DJR D;  3BVM A;  3CHB D;  1D5Z C;  1SEB D;  4RCO A;  1PTO D;  1JWM D;  2XRQ D;  1PTO B;  1HA5 A;  3V05 A;  3MFG A;  4UDU C;  4C56 C;  1AN8 A;  1I4P A;  2O2L D;  2QIL A;  4Z9C B;  3DWA A;  1TS2 A;  1CK1 A;  1ESF A;  5D3I B;  1LT5 D;  1LTT D;  3KLS X;  2Z8L A;  2AQ1 B;  5ELD A;  1ET6 A;  1L0X B;  4L6T B;  1M4V A;  3OWE B;  1PRT F;  1G8Z D;  1GOZ A;  3GP7 A;  1I4Q A;  3EFX D;  1S5D D;  1FGB D;  2WV6 D;  3TSS A;  1B1Z A;  2XN9 C;  1LTI D;  1TY0 A;  1I4X A;  4RHS A;  1QIL A;  1SE3 A;  4BWG B;  2AQ3 B;  3R8B A;  1EEI D;  1B44 D;  4RGM A;  1JWU D;  1FNW A;  1CHP D;  4RHR A;  1LT3 D;  1RDP D;  2J4X A;  1PZJ D;  5D3D A;  1LT6 D;  1STE A;  1AW7 A;  1S5F D;  1LTR D;  1S5B D;  1S5E D;  1CT1 D;  1PRT C;  1JQY D;  1SXT A;  5ELC A;  1XXG A;  1PZI D;  3DWP A;  1EU4 A;  1PZK D;  1UNS A;  2QEJ C;  1T5X D;  1D6E C;  1FNU A;  2R61 A;  1JR0 D; 
#chains in the Genus database with same CATH topology
 1STY A;  3I4N B;  2EYL A;  2E5L Q;  4A3I G;  1X56 A;  1H95 A;  1EFI D;  1XNR L;  3L0O A;  1UEB A;  4XDX A;  1A3T A;  2BE5 D;  2F0L A;  1I6H H;  3M4Y A;  2UUC Q;  2N55 A;  4DV6 Q;  4ZUI A;  2E2I H;  1HZB A;  1B9M A;  2IY5 B;  1UUP A;  3HOV G;  1ICW A;  3IAY A;  3PO2 G;  4L5S A;  1TWH H;  3FKI G;  1UWV A;  3TZU A;  3HOW H;  4O2D A;  3HOZ G;  3SE0 A;  1YHQ A;  2O4X A;  1Q12 A;  3RUZ A;  4RGO S;  4A3E B;  2XWB B;  3ICE A;  1CKO A;  2L15 A;  3T51 B;  2NZ1 D;  4JPB W;  4JI4 Q;  3C46 A;  2Q2I A;  3ULL A;  3W1B A;  3J80 L;  5IOC A;  2LSS A;  2Z6K C;  4AQY L;  4JV5 L;  4XT3 B;  1Q81 C;  2PQA B;  1TT2 A;  2IL8 A;  3OHX C;  2LFN A;  1TII D;  4EVO A;  2VUM B;  4DV7 L;  2NUC A;  1YVC A;  1EYC A;  2M9V A;  2PQA A;  1BF4 A;  1R4Q B;  2XRQ D;  4RMF A;  3E6Z X;  3KBG A;  2JA6 H;  1F2M A;  2ZXO A;  2JSO A;  4ZKC B;  2BE5 C;  5EJW A;  4A3F B;  2MFI A;  2HT1 A;  3D4R A;  3HKZ B;  1VQ9 A;  4P2C B;  1ASY A;  1C48 A;  1J6Q A;  4DUY L;  1I50 B;  1JOO A;  1PH3 A;  2CW0 C;  2MQH A;  4C1N K;  3PIO A;  1B8A A;  4ME3 A;  3PF5 A;  4KK7 A;  3S1N B;  3S16 H;  2L55 A;  1DXM A;  1S5F D;  1EY7 A;  3SR1 A;  1TWC B;  3U4Z A;  2IHF A;  2JA5 H;  5CC4 A;  5IP9 H;  3A7A B;  3IKJ A;  3ULJ A;  4A3E G;  3BJU A;  5M3F B;  2WFW A;  4IOC A;  2UXB L;  4HIO A;  3EBE A;  3I4L A;  3GTM H;  1GHJ A;  1HXY D;  2BDN A;  2K50 A;  1Z6H A;  5EAY A;  5EPJ A;  1A62 A;  1GO3 E;  1I4H A;  1BQQ T;  3P1H A;  2EVB A;  2L0C A;  4K6L A;  3ERS X;  1E1T A;  1Z7T A;  1X32 A;  3S2H B;  3TME A;  2VY3 A;  3ZJY C;  3GD7 A;  4LF4 L;  1QOH A;  2PI2 E;  2ATW A;  4S3S A;  1I3Q B;  4YCU A;  1G51 A;  2KVM A;  4HMJ A;  1K83 H;  2F0K A;  1YEZ A;  3CAM A;  2VUM G;  1RCV D;  2F0H A;  2V1C C;  1A2U A;  4NKL A;  4YY3 L;  2VQE Q;  2EIF A;  3SK8 A;  2K5H A;  2H4O A;  3VA5 A;  1MBY A;  5IT9 L;  5M5W H;  4JBJ A;  1PTO H;  1H9S B;  2RKS A;  4GN5 A;  5IYC H;  1VQ4 A;  4JI8 Q;  1N36 L;  3R3O A;  1GUG A;  3NP8 A;  1J9O A;  2OTL A;  1HPC A;  1ML0 D;  1WD1 A;  1H9S A;  1PTO C;  3C3L A;  4AYB B;  3VYT A;  1WD0 A;  3Q24 A;  4A3B H;  3HKZ G;  1CTM A;  2SNM A;  4ZAI A;  4C3I H;  4J1M A;  3E9I A;  4DF7 A;  4DXF A;  2K03 A;  1FD7 D;  2VNU D;  3MA2 B;  3DEP A;  1V9P A;  3J80 E;  4NDX A;  4EGV A;  4BY1 H;  1NUC A;  3DUZ A;  1BBU A;  1HR0 W;  2P5Z X;  3X3M A;  4P74 A;  3GV3 A;  4N9T A;  3UDX A;  4X3S A;  4IUV A;  4IUT A;  1JJC B;  2RSN A;  4RCN A;  3MAQ A;  1DON A;  1B2T A;  5D3I B;  1HUN A;  2K14 A;  4IFD G;  5M3F G;  1LTL A;  1WYD A;  1WFQ A;  4DV5 L;  4BXX G;  1S5D D;  5C3E B;  1TY0 A;  2F0G A;  1SSO A;  4BY7 B;  2B2U C;  4HR7 B;  5FO7 B;  2JEA I;  5JJK A;  3T4A C;  2AQ3 B;  3PGZ A;  4YWK A;  3A56 A;  2OCE A;  4Q0F A;  2R3Z A;  4DR1 L;  4IAL A;  4QIW E;  1SR3 A;  3PUX A;  2BDO A;  1S5E D;  3B6Y A;  3KFU A;  1EU4 A;  4NW2 A;  1FNU A;  3BVM A;  1EFW A;  1IBL L;  2NVX B;  3K57 A;  1G91 A;  1HH2 P;  1ENA A;  1EYA A;  3L3O C;  5KIX A;  4AYB G;  1S3O A;  2E5L L;  1STB A;  1JWS D;  1VQ5 A;  5LMU Q;  4BS9 A;  1A15 A;  5M3M H;  1SMY C;  1SNP A;  1PH7 A;  3SXH A;  4JOI A;  1Y14 B;  1SE4 A;  5LMN W;  2K4K A;  3D31 A;  3OTO Q;  4UY8 C;  1Y1W B;  2R93 H;  2DNE A;  2RBM A;  4DV6 L;  4C3H B;  2NVQ H;  1EIG A;  4QY7 A;  1WCM H;  4KMU C;  2WKC A;  4DKA C;  1GUT A;  1Q1B A;  1U4P A;  2A6E C;  2FJ2 A;  5ISR A;  3I3C A;  1LUZ A;  2BOS A;  5I2X A;  2XIW A;  4AH6 A;  5A35 A;  1L1O B;  2KCT A;  1DZ1 A;  2CFM A;  3E0E A;  2CQA A;  1PH1 A;  4KI0 A;  5CV4 A;  3EA6 A;  2KCM A;  4RA8 A;  1TU2 B;  4JI4 L;  1V8Q A;  2L5T A;  2D5D A;  1J5E Q;  2KQ3 A;  1STH A;  3BZC A;  5C3E G;  1EY6 A;  5JEA H;  4QGU A;  4BY7 G;  4WFN 3;  1ESR A;  5CGK A;  2ALY B;  3GTP H;  4JBM A;  4YIJ A;  1D1K A;  3OIP A;  3U9O A;  3TP5 A;  2F4I A;  1HJP A;  2NWG A;  3OW2 A;  4A3J H;  2EY1 A;  4XTC S;  3I70 A;  1GUW A;  5IYD H;  3E9H A;  1YNN C;  3K0X A;  3RZO H;  1QVC A;  3PUZ A;  3RD4 A;  4JVZ A;  1M4V A;  4O0A A;  5GQO A;  4N8X 1;  3EFX D;  2Y0S E;  4F87 A;  2YTV A;  4KV6 A;  5IGB A;  3NTK A;  4ULL A;  1RTO A;  1LT3 D;  1K73 C;  4C2M H;  2B2Y C;  1IHZ A;  5J3B A;  1NMG A;  3EN2 A;  3IFD A;  3J80 i;  5JJZ A;  1Y1W G;  4C3H G;  1QZG A;  1O80 A;  3KK7 A;  4JC0 A;  5G3L D;  1JIC A;  1E1O A;  5IGG A;  1SYC A;  3GDE A;  2D62 A;  4K5W A;  1U4R A;  4A4I A;  2EYO A;  1SLJ A;  2F0D A;  5GAD C;  1XTC D;  4RKB A;  2M00 A;  1A63 A;  5HGT A;  1PRT D;  3G4S A;  1C8C A;  2OEO A;  1AFP A;  3M9B A;  1F2Y A;  1FNV A;  1TWG B;  5FLX c;  1AP0 A;  4JI7 Q;  1VMP A;  4XQQ A;  4NB3 A;  5FK9 C;  4B3T L;  2A69 D;  3I73 A;  3GTK H;  1JJG A;  1BOS A;  3M3Y H;  1LO5 D;  2EYM A;  1R4P B;  1E22 A;  3GQB A;  5KEE A;  3DXJ C;  3J7Z C;  3L7Z C;  2VQE L;  2K05 A;  4LF5 Q;  2BA0 A;  1HNZ Q;  2RCN A;  2JA7 H;  2F0Q A;  1Y1V B;  5CV6 A;  2PQE A;  2WAQ E;  1X3Q A;  2B8G A;  2K75 A;  2E74 C;  1W6J A;  2OXP A;  3VR4 A;  1CQV A;  4QB4 A;  2HUG A;  4QF4 A;  1LTA D;  1SNM A;  2IX0 A;  1SNC A;  3CD6 A;  2X69 A;  3TRE A;  1ROD A;  3S14 H;  4M8A A;  4KJN A;  2NN6 G;  2FIN B;  3GTQ H;  5C4X B;  4XXE A;  1YJ9 A;  4P72 A;  4A3G H;  1HRJ A;  1ILQ A;  2K5N A;  2ASB A;  1GUO A;  2K5W A;  4OIJ A;  2JA6 B;  4X6A H;  1LT5 D;  3IL8 A;  1Q8I A;  2ZJQ A;  3A7L A;  3S2D B;  2ZTC A;  3UDI A;  5E4W C;  2Z9H A;  1PH2 A;  2VB2 X;  2E2J H;  1G2T A;  1HNW Q;  5COY A;  3Q0A A;  5C44 B;  2BA1 A;  4A3C H;  2F3W A;  2K1B A;  3RZD H;  1JMC A;  5CBA E;  1EEI D;  4OWX B;  4IPD A;  1CHP D;  3Q8D A;  1VQL A;  4R4I A;  2I5M X;  5IP7 H;  3D6W A;  4DFA A;  3S16 B;  4DU9 A;  3A5U A;  4PNY A;  1YJW A;  2K7V A;  1Q8K A;  4B08 A;  2I07 B;  4DUY Q;  3KF8 B;  5D65 A;  4IUN A;  3HOW G;  5DNF A;  5M5X H;  1WTP A;  1HTL D;  2DY7 A;  1HTP A;  1KAB A;  2AQ2 B;  3SK4 A;  1MJE A;  3KF8 A;  1B3A A;  4NXN Q;  3ERO A;  4F88 A;  1MJC A;  1PH5 A;  1STA A;  4KKT A;  4DNR B;  2K5Q A;  3KJO A;  4R8I A;  1SYE A;  4H02 A;  1S72 A;  3HOY H;  2D0P A;  5LMN L;  4RFB A;  1DOK A;  3GTL H;  2Q8I B;  2TMP A;  2N3S A;  2WP8 J;  4HJ9 A;  4JBW A;  5IYB H;  5LMU L;  1AH9 A;  1VQJ A;  1IBM Q;  3PMF A;  4QUF A;  5GAG C;  1RD9 D;  1K8M A;  3MZ5 A;  1PFB A;  2EJG C;  2PW7 A;  4GKJ Q;  2F0E A;  1X3E A;  5C4X G;  2EDG A;  5LL6 X;  4B3S Q;  4XYO A;  2R7Z H;  3H3V I;  4GS3 A;  5M5Y H;  3CCU A;  2IHE A;  5EBC A;  2JA6 G;  1JOQ A;  1F9P A;  3S15 H;  4DXG A;  4A3D H;  1B9N A;  2EYF A;  2ICI A;  1IW7 D;  4DR6 Q;  2FHT A;  1FGU A;  4LW1 A;  5KGU A;  1WVL A;  2EYJ A;  4OEM B;  5I4D A;  1RF2 D;  1TR5 A;  3CW2 C;  1SYB A;  2V4D A;  1DJR D;  1J5E L;  2B63 H;  2A8V A;  3CQZ H;  2F0N A;  3CC7 A;  3RLO A;  3I4M B;  2F0I A;  5EKI A;  1M8A A;  3QO2 A;  4UDU C;  4A3I B;  1YIT A;  3M4O B;  1YNJ C;  4HJ5 A;  1QNU A;  2CH4 A;  4DNI A;  4CJ1 B;  3J81 c;  4PMB A;  4FYD A;  1LTT D;  1EIF A;  1QWY A;  2Z8L A;  2LY7 A;  2B8F A;  4IUU A;  3KLS A;  2F0M A;  1ET6 A;  3HRZ C;  2NVY B;  1EY8 A;  3G7L A;  3CME A;  2N78 A;  3HFZ B;  2EOT A;  1H9K A;  1JOR A;  2HIV A;  1UE1 A;  1VF7 A;  4CDD C;  4DV1 Q;  1X3F A;  4RGM A;  4GOP B;  3NK9 A;  3PCO B;  4R1J A;  1RDP D;  1IKM A;  5D3D A;  3PIP 3;  4DAM A;  3MXU A;  5GAE C;  1GVP A;  3MTS A;  4GOP A;  3AU7 A;  4A93 H;  4DV5 Q;  4LFB Q;  4OWT B;  3FRP B;  3PIO 3;  1X55 A;  3BDL A;  4K5V A;  5BN5 A;  4MN3 A;  5IYC G;  4CKE A;  4CDC C;  1MKH A;  2A68 D;  3H09 A;  1XNQ Q;  3MFY A;  4IN3 A;  1C9O A;  2EYP A;  3K58 A;  1MSH A;  5A2Q E;  5ELE A;  1EWC A;  2RDG A;  1VMC A;  2QCP X;  5IIF A;  2PYK A;  4YCV A;  1YIJ A;  1AE3 A;  2HDL A;  1F9S A;  4C3I G;  2L12 A;  4H7B A;  1IBL Q;  3F2D A;  1B50 A;  2KEN A;  4JI7 L;  3R93 A;  4GN4 B;  4FNF A;  3P7J A;  3I4M G;  1SJH D;  1IBK Q;  4MHE A;  2JA8 H;  2KOL A;  2NVT B;  3S1Q H;  4XT1 B;  2RHQ B;  3A8K E;  1B4O A;  1U9R A;  3TP7 A;  3A8J E;  4X3U A;  1KRT A;  2YU9 H;  1SRO A;  2VQF Q;  1VQH A;  4HJA A;  4LF5 L;  1CSP A;  4A3L G;  3W2D A;  4FXD A;  4ZYS A;  4DR5 Q;  5EPK A;  3CRK C;  1HNZ L;  2F3V A;  1D5M C;  1CFM A;  3FPP A;  5ELF A;  5KYI A;  1QVF A;  4LMQ D;  3ZYY X;  4TVA B;  4ZQ3 A;  1NE3 A;  4BA2 I;  4RAU C;  5C0X J;  5H1S E;  1M90 C;  1D2B A;  1A3U A;  1EIH A;  2M2L A;  3CHB D;  5ELN A;  2WB1 E;  4RCO A;  3CXC A;  2KCN A;  1WTX A;  4A3K B;  1TKW B;  4UP8 A;  2F0P A;  1AZP A;  4K5X A;  2G5D A;  3H6M A;  1UE7 A;  2J7Z A;  5G3L F;  2B29 A;  4IUR A;  2ZTE A;  2O2L D;  5E7N A;  2YYZ A;  4R4O A;  4KY6 A;  1ASZ A;  1YHA A;  1MGS A;  3U58 A;  1QE6 A;  1X6O A;  2KA7 A;  2ZTD A;  1G8Z D;  1PRT F;  1E3P A;  2NB0 A;  2N88 A;  1E0B A;  3KBX A;  3CMA A;  2MO1 A;  3WOE A;  1HNW L;  4PG3 A;  1NBW A;  1RL2 A;  4WRD A;  1X65 A;  2Y0S G;  4NMZ A;  3A0J A;  2B2V A;  4RHR A;  4OGQ C;  4C3J B;  2N8N A;  3GTJ B;  5BR8 Q;  2CQO A;  2J4X A;  4P75 A;  5M3M G;  1ZEQ X;  2Z4I A;  1SFO B;  2ZT9 C;  4ALP A;  1KRS A;  1PZI D;  3DWP A;  4U67 3;  1Q86 C;  3D4D A;  3PUV A;  1WCM G;  3G71 A;  3PIP A;  3TRZ A;  2NZO A;  3BYY B;  3EIV A;  2D2C C;  4IPG A;  3HOU H;  4Y7N H;  2O5J C;  3W3A A;  1CA5 A;  2XGT A;  2MUY A;  2RDF A;  4XQN A;  3I91 A;  1K3B C;  3G6J B;  1QCB D;  4U68 A;  4NXN L;  1L0Y B;  3KUP A;  2XVS A;  3NSW A;  1RTN A;  1M1K C;  2RA4 A;  4B3M L;  4DV0 Q;  5JEA G;  5C4J H;  1HQM C;  2DUD A;  4A3K G;  1LTG D;  1KDA A;  4C1N I;  1ILP A;  1IBM L;  1XMO L;  4HAE A;  5TSS A;  3HOX H;  2BH2 A;  1K28 A;  1O7Z A;  3HS0 C;  4GKJ L;  1AE2 A;  3M4P A;  1I6V C;  3K6O A;  1VQN A;  4JI5 Q;  3KOJ A;  4B3S L;  4IFD I;  4NP5 A;  3EJI A;  4K6D A;  2WIN B;  1GXD C;  1NSN S;  4OEL B;  4B3T Q;  3JAM c;  1PRT B;  5DM7 3;  3WDN A;  2WAQ G;  4QL5 A;  3K7A B;  3T1H Q;  4OO1 I;  1HZA A;  4NXM Q;  1I4G A;  2HCI A;  2DN8 A;  2F0O A;  4MIU A;  4DR6 L;  2JP1 A;  2EXZ A;  1IL8 A;  2IX3 A;  1VQA A;  1R9T H;  1GD7 A;  2B3G A;  4C3J G;  1QVG A;  2RHS B;  2MHV A;  3CRL C;  2I0Q A;  1O78 A;  1EOT A;  1NCV A;  1JC7 A;  4X62 Q;  3H3V H;  4XYQ A;  3RN5 A;  1PH6 A;  2I5H A;  1HR0 Q;  2CCZ A;  1D8L A;  1X9N A;  2VW9 A;  3C1E A;  3RMH A;  2ENB A;  3SGI A;  5IE8 A;  3H0G B;  3I7F A;  1VQP A;  3M7G A;  3J7A V;  1HNX Q;  3H3V C;  4LF6 Q;  4ZUJ A;  1WTR A;  2RSO A;  4LFA Q;  1WTH A;  3K59 A;  2B2W A;  1VQB A;  3GP7 A;  3I56 A;  5CV8 A;  2L11 A;  1LTI D;  4HJ7 A;  4ID6 A;  4WJ3 M;  1G29 1;  1MI2 A;  1WI5 A;  1CZW A;  5C3X A;  1OXU A;  3R8B A;  1SNQ A;  1O7Y A;  3JC6 6;  4R4Q A;  4HIM A;  2FXQ A;  1EL0 A;  4DV1 L;  5DLQ E;  5CV5 A;  4FF4 A;  2HIX A;  1XJV A;  1JB3 A;  1NAP A;  3P75 A;  5ELC A;  1UNS A;  3G6E A;  2DY8 A;  1JR0 D;  4LFB L;  3PO3 H;  3S17 H;  1LTB D;  3AFQ A;  3ERQ A;  1U5K A;  3T16 A;  3GTG H;  1KL9 A;  1YZ6 A;  1XPU A;  1TWA H;  4JI6 Q;  3D4W A;  1KDC A;  2K5D A;  2GA4 B;  4R9W A;  2UXD Q;  1QJO A;  2K5V A;  1XNQ L;  3D0F A;  2I5L X;  5D14 A;  3Q22 A;  1Z47 A;  1VQG A;  4FF3 A;  1HHV A;  3GTL B;  2XSC A;  5FO9 B;  2TSS A;  3BS1 A;  5EKK A;  3HOV H;  4KHV A;  2J0T D;  3PO2 H;  3FKI H;  5HGQ A;  1Z9F A;  1CUK A;  1CHQ D;  2OQK A;  1OO9 B;  1K9M C;  1YHB A;  1SBB B;  2CHB D;  2L9H A;  5LMN Q;  3VA7 A;  4IJH A;  3E0J A;  1V1Q A;  1IBK L;  1NR2 A;  3H0G G;  5BN4 A;  4FF2 A;  3OMG A;  3T1Y Q;  1X3G A;  2F4V Q;  3MEH A;  4ILW A;  5JOB A;  1F9R A;  2VQF L;  3GTO B;  1BCP B;  1TWF B;  4DR5 L;  2KBN A;  3U4V A;  4B9W A;  1VQ6 A;  1ONL A;  4ZKB B;  3S1M B;  1IYJ B;  2JQO A;  5CV7 A;  2C35 B;  4EQN A;  3OW7 A;  1Q3L A;  4OX9 Q;  2AUK A;  1HA5 A;  3ULP A;  1N33 Q;  2X6L A;  4G7O C;  1VQM A;  4CGY B;  2FFK B;  5IP7 G;  1TS2 A;  3F1Z A;  1ESF A;  1HUM A;  3I4N H;  1VS0 A;  5BN3 A;  1L1O A;  3H15 A;  5FO8 B;  1U4M A;  4DA2 A;  1ZKO A;  4GLA C;  2ZXR A;  5FJ8 H;  2GVA A;  4F8M A;  1B44 D;  1FNW A;  3ND8 A;  3HOY G;  4TKO B;  4ZK9 B;  2YV5 A;  3HEJ A;  2WB1 B;  1I5F A;  1PFN A;  4JG2 A;  3TZD A;  2WII B;  1SN8 A;  1S5B D;  2HHH Q;  5BR8 L;  1JQY D;  2VL6 A;  3K5L A;  1EWI A;  1UE6 A;  4A3E H;  2E2H B;  4OHJ A;  2XWJ B;  1G6P A;  3H94 A;  4NPS A;  4LNQ A;  4G57 A;  5C0X I;  4G7Z C;  4BBS B;  2PCF B;  1F9Q A;  3VDY A;  4E6I A;  2GVB A;  2MGS A;  2XNA C;  1B70 B;  3M85 A;  1RIP A;  2PNR C;  4A3D G;  2B2T A;  1SE2 A;  4K0K Q;  1UEA B;  1VF5 C;  4GKK Q;  5T1G A;  1X54 A;  2VUM H;  4BBR B;  3CF5 A;  2E76 C;  4KJO A;  5CV9 A;  2NN6 I;  4LUZ A;  4O1N A;  4DNT B;  2B63 G;  2QDB A;  2C9O A;  5C5L A;  1BNZ A;  1LLR D;  1PYW D;  1V1P B;  2B2V C;  4L63 B;  3J7A 5;  4DV0 L;  4FP5 D;  4A3M H;  3HKS A;  4GLX A;  3FEW X;  4I7Z C;  1JCK B;  2JJQ A;  1E2Z A;  1GUN A;  1V1P A;  1AEX A;  1EQV A;  1Y8P B;  2AUJ D;  2SDF A;  3AB9 A;  3BYT B;  1Q90 A;  3K8A A;  3STB D;  4F7X A;  5IWA Q;  4A3F H;  1P16 A;  1WOC A;  1MHW C;  3K5O A;  4OON A;  4JI5 L;  5HUR A;  5AJ3 Q;  2HD3 A;  5J1Z A;  1I50 H;  4DV4 L;  1I6H B;  2KHS A;  1CKM A;  5GRO A;  2VB3 X;  2E2I B;  3T1H L;  4NXM L;  4OL7 A;  4GNX B;  3F2B A;  3CCL A;  3S1N H;  3CKI B;  1TWH B;  2WB1 G;  4K2L A;  5IGD A;  5EGT A;  3HOW B;  4IUP A;  1CQF A;  1EQR A;  2OT2 A;  1PXU A;  2NZH A;  1TWC H;  3QOL A;  4GNX A;  4A76 A;  3IRB A;  1AN8 A;  2QIL A;  1WTW A;  4IFD H;  4X62 L;  5M3F H;  3GO5 A;  4M1U B;  1PYB A;  1HR0 L;  4CBV A;  1GKH A;  4BBS G;  4L6T B;  1K3R A;  1C4Q A;  3Q6S A;  4P73 A;  4OO1 H;  1IXR A;  4L5Q A;  4BXX H;  2WAC A;  2WV6 D;  1E24 A;  1HNX L;  1G2S A;  2JXM B;  4G4K A;  2Q8T A;  4LF6 L;  3S2H H;  4LFA L;  5K36 G;  3VYS A;  1I3Q H;  1J8I A;  1KDB A;  2L4N A;  4BBR G;  2PI2 A;  3J7A F;  5C4H A;  3D8G A;  3I8Z A;  3EVQ A;  1PRT C;  3OMC A;  4DPG A;  1XXG A;  4IPH A;  2QEJ C;  1DGS A;  5ELD A;  2A73 B;  5JJL A;  1OTC A;  1NR4 A;  2NBF A;  4OXP A;  4RGN A;  1U4L A;  2A69 C;  4Y52 H;  4IFD J;  4JI3 Q;  4YWM A;  5JVG 3;  4HID A;  2DGY A;  1NMF A;  5FLX L;  3FVQ A;  4JK1 C;  3FDT A;  4JI6 L;  1WJJ A;  3MXP A;  2UXD L;  4IOA A;  3VYU A;  2Z4H A;  1KNE A;  3VR6 A;  4DR3 Q;  3DM3 A;  3NPP A;  1FR3 A;  2IWH A;  3TDQ A;  5A2Q L;  1JE4 A;  4J15 A;  1X3P A;  2JA5 B;  1K0S A;  4FDB A;  1YBY A;  4X3K A;  5I6Y A;  2ZJP A;  5CBE E;  5NUC A;  1ENF A;  2K33 A;  1BCP D;  1KAA A;  1A2T A;  2EY6 A;  3PSI A;  1H9J A;  3D3R A;  3GTM B;  4B3M Q;  2UUB Q;  3KF6 B;  1VQE A;  1W6K A;  1U0L A;  4TRD A;  2HCC A;  2IX1 A;  3UDF A;  3T1Y L;  4IPC A;  2F4V L;  1LAB A;  2PW5 A;  1XMO Q;  4BY7 H;  1H9M A;  3F8T A;  1KLU D;  1K83 B;  4TSS A;  3KF6 A;  3QG1 A;  4XIG S;  1ZYR D;  4BA1 I;  4QIW B;  3OPO A;  3A8I E;  3LNN A;  3CCM A;  4DK6 C;  2E75 C;  5M5W B;  1PTO B;  3RLN A;  1XPR A;  3K5M A;  4DR4 Q;  2RQX A;  1OXT A;  2F0W A;  4KHP L;  4QUC A;  2LKV A;  1HZC A;  5JPM C;  1B3Q A;  4OX9 L;  3ITP A;  4N8F A;  1N33 L;  4KTA A;  3CPW A;  5FOB B;  3KLS X;  2NVX H;  4L8J A;  4RG1 A;  3LWE A;  3FP9 A;  1VQ7 A;  2KJX A;  3A54 A;  3CCJ A;  3U50 C;  4QCL A;  4A3B B;  4WOR A;  1GOZ A;  4C3I B;  1DCZ A;  3TSS A;  1EZ6 A;  4KD3 A;  1WTO A;  1I4X A;  1S40 A;  4RHS A;  4EQO A;  3NTI A;  4OWW B;  4BY1 B;  3SK5 A;  1HZ9 A;  4JOI C;  4MTN A;  1SND A;  4IJL A;  3DEO A;  2A6H D;  2CH4 W;  1A6X A;  1CM9 A;  4HN7 A;  3HP3 A;  4C3H H;  1JJ2 A;  2BH8 A;  2EXD A;  3T53 B;  2JA5 G;  1MSG A;  5IP9 G;  4DV3 Q;  2NYZ D;  4X66 Q;  1D6E C;  2EYH A;  3H91 A;  2HHH L;  1PFM A;  1MD2 D;  5T1I A;  4ZRZ A;  4APV A;  1EY9 A;  1QZH A;  2B2U A;  1O7I A;  1PLF A;  1L1O C;  1A8V A;  1QNK A;  5EBD A;  3S1R H;  3NUC A;  4UAI A;  4HCS A;  4I7A A;  2RDH A;  4K0K L;  2HQE A;  2Z1C A;  4GKK L;  5FLX E;  1IW7 C;  1PMR A;  4L5T A;  1LT4 D;  4LK1 C;  3OYY A;  3C1F A;  4CDE C;  1VDZ A;  2F0U A;  3RR5 A;  1CKN B;  1STN A;  2Q2H A;  5C0X H;  1GJX A;  2PO4 A;  5M9O A;  1I94 Q;  4G7H C;  3ND9 A;  4DAY B;  5FLM H;  2Y0S B;  2YTX A;  4UPA A;  1TXY A;  4FXG C;  3J80 c;  4HIK A;  4A3B G;  4HTH A;  3MVV A;  2QA4 A;  5CR3 A;  1TVX A;  3LGJ A;  5IWA L;  1EY0 A;  2Q2T A;  5M3M B;  3RNU A;  2NTS A;  3BZD B;  5AJ3 L;  2R92 H;  4DAY A;  4YCW A;  2NN6 H;  1Q7Y C;  4BY1 G;  3W1G A;  2AMC B;  1SYG A;  4KD4 A;  2R93 B;  2NVQ B;  2VS1 A;  5JAV A;  4X65 Q;  2UUA L;  1WCM B;  1Q46 A;  3I2Z A;  3MFG A;  5IGC A;  2KCC A;  3J81 L;  3PV0 A;  1K8O A;  4N9P A;  2AQ1 B;  1BO0 A;  2E8G A;  1K8A C;  4H44 C;  1STG A;  2Z0S A;  4K14 A;  3OWE B;  2DJF C;  3J7Y W;  3E3X A;  5L37 A;  3PO3 G;  3NEN A;  2F03 A;  4POF A;  1SE3 A;  4JI2 Q;  2OWO A;  1TWG H;  3BU2 A;  5ELO A;  1UE5 A;  3GTP B;  1IL2 A;  3T56 B;  1DOL A;  4PQX A;  1FJG Q;  2PZU A;  1PZJ D;  1LT6 D;  2A68 C;  4J6H A;  4K8J A;  4A3J B;  4KLK A;  4H13 C;  1BUV T;  4PZ8 A;  2CW0 D;  2LXJ A;  3L9A X;  3SVM A;  3RZO B;  2WAQ B;  3FPU B;  1SMX A;  4GNX C;  4IUQ A;  2KEC A;  1Y1V H;  4UP7 A;  3TS2 A;  2OTJ A;  3BVZ A;  1OXX K;  1HFN A;  4DR7 Q;  3F2U A;  4J8Q A;  4ODG A;  3AMU A;  1EY4 A;  2Q2U A;  2EY5 A;  3A55 A;  2LXK A;  4JI3 L;  4CKB A;  2G9D A;  4IO9 A;  1EU3 A;  3KJP A;  2JK8 A;  1ICF B;  1PFS A;  3SEB A;  2F0J A;  1VQK A;  1SYD A;  2B2Y A;  4C2M B;  2DJG C;  1PVO A;  1L0W A;  2PZT A;  2R93 G;  1BXT A;  5C4X H;  2KUM A;  4DR3 L;  4DUZ Q;  3SK6 A;  5IT9 c;  2F0V A;  1N32 Q;  4DR2 Q;  4IQZ A;  4JI1 Q;  3PF4 A;  4A3M B;  3S2D H;  3I55 A;  4RH6 A;  1L2F A;  4MTK A;  5CYU A;  3I4N G;  5I9P A;  4B3R Q;  3DHQ A;  5C44 H;  2UUB L;  1SRU A;  1T9H A;  4XQJ A;  5FJ8 G;  3QR8 A;  1PTO D;  1TQO A;  3MHB A;  3GTK B;  3M3Y B;  1VCI A;  1NNX A;  1JB7 A;  4A3J G;  3ONA B;  1W2B A;  5I2Y A;  2Z6B A;  3BDC A;  4TQU S;  4DV4 Q;  3A5Z B;  4LJZ C;  4DR4 L;  5IYD G;  3NEL A;  2JA7 B;  3EQL C;  1FYC A;  3QOJ A;  3K0Y A;  4DK0 A;  3KLW A;  1BBX C;  3KDF B;  3J81 E;  2R7D A;  2VXW A;  1FGB D;  2N49 A;  3RLF A;  3CCV A;  5E4X A;  1QIL A;  1T5E A;  1HCZ A;  2O5I C;  3S14 B;  2X6G A;  5I9O A;  4HSV A;  2RCF A;  3KDF A;  1W3S A;  1NY4 A;  3GTQ B;  3CU7 A;  1H9R A;  2MO0 A;  3T13 A;  3NQI A;  2UXC Q;  2ZXP A;  1GUS A;  2K6A A;  4A3G B;  5C5M A;  3LWU A;  1XMQ Q;  1BCP F;  2JEB I;  1KHI A;  5IGF A;  1EUJ A;  4DV3 L;  4A3M G;  4JBK A;  4X66 L;  3TQY A;  3F2C A;  2K04 A;  2E2J B;  3UE1 A;  2EPB A;  3BVG A;  4LFC Q;  3G48 A;  2F0F A;  1D5X C;  1MIU A;  2A19 A;  1V43 A;  2D9U A;  4A3F G;  4X3T A;  3RZD B;  3NHH A;  3TN2 A;  4LF9 Q;  2EQS A;  3WOF A;  2QEX A;  1G6Z A;  1DD2 A;  3HG9 A;  1IYV A;  1KTK A;  4ZLT F;  1EEF D;  1VQI A;  1N9W A;  3I4M H;  4HSP A;  1BDO A;  1IYU A;  3MEF A;  4A3I H;  3SDZ A;  1JOK A;  2NTT A;  1F2L A;  3KYH C;  3M4O H;  2AWN A;  1K8G A;  1SMY D;  4ZCK A;  2JE6 I;  1RKN A;  1SE8 A;  5M5X B;  3URY A;  1HFG A;  2QF7 A;  2LS0 1;  5AFW A;  2D0O A;  2ICE C;  2JA7 G;  4A3L H;  1O7L A;  5E1F A;  3JAM L;  5IOD A;  1KD1 C;  1HQR D;  2H5X A;  5IGE A;  4LF8 Q;  1JT8 A;  3HOY B;  1I94 L;  1XWE A;  2NVY H;  2PZW A;  3PUW A;  4DK1 A;  1TS5 A;  2A6E D;  1UAP A;  4K2K A;  2ID0 A;  2OF1 A;  2FMM A;  5ELB A;  4OO1 G;  3CCS A;  3HOZ H;  4CDF C;  1ENC A;  1PH8 A;  1SAP A;  4JW0 A;  3OIQ A;  2E2D C;  1CA6 A;  3V05 A;  2EY2 A;  1XPO A;  2SNS A;  4GOP C;  3CP0 A;  4FXK C;  4X65 L;  4CKC A;  4DV2 Q;  4A3G G;  1QB5 D;  2R7Z B;  1E2W A;  1I4P A;  5M5Y B;  4Z9C B;  5HY6 A;  5IY0 A;  5DAU A;  1DOM A;  1VQD A;  3S15 B;  1VQC A;  4A75 A;  4A3D B;  1EYD A;  3DLL A;  2F1M A;  3TBI B;  4X64 Q;  4A3C G;  5J22 A;  2ZM6 Q;  5KND A;  2B63 B;  1JWU D;  3CQZ B;  4KHP Q;  1YNN D;  2CKZ B;  3L2P A;  1PHJ A;  4JI2 L;  2A5H A;  3I90 A;  4EQ5 A;  4GN3 B;  3BDO A;  1STE A;  4FVM A;  1SYF A;  2F0S A;  3IFT A;  1EQT A;  2UUC L;  2MP1 A;  1SXT A;  4QMG A;  1FJG L;  2RF4 A;  2KEE A;  2NVT H;  3AQQ A;  1S4Z A;  4JYA Q;  3R2T A;  4Q5V A;  1B7Y B;  1E2V A;  3MXN B;  3VR5 A;  4V19 0;  3QIA A;  3S24 A;  1VQF A;  3O13 A;  1VQ8 A;  5IT9 E;  1BBW A;  2OQ0 A;  3MXN A;  2ES2 A;  4DR7 L;  3DWQ A;  3J81 i;  4YHH Q;  4IZ8 A;  2IW3 A;  5IYB G;  1DYQ A;  1RHP A;  2EE1 A;  3TS0 A;  2UU9 Q;  3OSO A;  3M4Q A;  4UP9 A;  1LAC A;  4RGT A;  4A3K H;  3S1R B;  2PMZ E;  4A93 B;  1DM0 B;  1V1O A;  1EOV A;  2R7Z G;  5C4Z A;  4DUZ L;  1N32 L;  3CPF A;  4DR2 L;  4EQP A;  5J39 A;  4JI1 L;  1CZG A;  4KN4 C;  1ET9 A;  4CJ0 B;  1YNX A;  1LTS D;  2EZV A;  2IPK D;  1EZ8 A;  3FMC A;  1S5C D;  5JJI A;  1F77 A;  5CMD A;  3TEH B;  1PDQ A;  1KC8 C;  4B3R L;  5JVH 3;  3JAM E;  4C3J H;  3GTJ H;  1LYL A;  2R92 B;  2IT1 A;  3P20 A;  1Q1E A;  2HQL A;  2CVR A;  1SFO H;  5JEA J;  3C2P A;  4LUO A;  1NJI C;  2JA8 B;  2PNH A;  1N34 Q;  3S1Q B;  3QWN A;  4L5R C;  1F2Z A;  4KKS A;  3MXG A;  2YU9 B;  3DWA A;  1Y8O B;  1CK1 A;  1ZXT A;  4R8N A;  4JI0 Q;  1IZ6 A;  3J81 j;  4CJ2 C;  1VQO A;  4JCV E;  1OXV A;  5LL6 S;  2F0T A;  1EQQ A;  1YJN A;  4DK3 C;  1BVS A;  2EJF C;  3AFP A;  2UUA Q;  1A3V A;  1C7Y A;  4P71 A;  1EWH A;  1PYS B;  3NWT A;  4RWS C;  3CCQ A;  4LF7 Q;  2QW7 A;  3N6R A;  3RN2 A;  2C5C A;  2DNC A;  1K0R A;  1LTR D;  4CHT B;  3K7U C;  4A93 G;  2JYO A;  4ABN A;  2R7F A;  1Y69 U;  2AKW B;  2UXC L;  1XNR Q;  3D6C A;  4WJW A;  2Z6K A;  2K28 A;  3NBI A;  1RJT A;  2K32 A;  3WWV A;  1JE5 A;  2IJ0 A;  1XMQ L;  5C0X G;  2K52 A;  4FO2 A;  3CC4 A;  1TS3 A;  4JI8 L;  5LHY 1;  4KN7 C;  3K7A H;  3K80 C;  3M7N A;  5FLM G;  2WKD A;  4LFC L;  2XTI A;  3HZX A;  3NWS A;  1PTO F;  2MNA A;  2KHI A;  2QKI C;  3MWY W;  3STB C;  2G9H D;  1E7Z A;  1SJE D;  1C0A A;  1KXL A;  4LF9 L;  1KLG D;  3E5S A;  2RVL A;  2R92 G;  2MJ8 A;  2XRS D;  4O42 A;  3UE0 A;  3PUY A;  3R2I A;  3UDG A;  3W5O A;  3K5N A;  5EKL A;  1TS4 A;  4PZ6 A;  2JA8 G;  1EY5 A;  2FMC A;  3OWF A;  1B53 A;  4AQY Q;  3H0G H;  1TY2 A;  1KIX A;  3PQI A;  4JV5 Q;  4UHV A;  3HOU B;  3I4O A;  3HKZ E;  4Y7N B;  3MC0 B;  2KHJ A;  5C6A A;  2H1E A;  2B2W C;  3NXW A;  1FVI A;  3TP8 A;  4DV7 Q;  3CCR A;  4YWL A;  2YTY A;  5I6W A;  1SDF A;  2L1B A;  4LF8 L;  1HA6 A;  2F3I A;  5KNB A;  1CSQ A;  2JN4 A;  4LAA A;  4LWC A;  2AWO A;  5C4J B;  3GV6 A;  1XTD A;  5C3W A;  4HJ8 A;  1JWM D;  4EX5 A;  4KY7 A;  4QQB X;  3HOX B;  5COR A;  4PMW A;  3CC2 A;  2KED A;  2A74 C;  3X3N A;  3BG3 A;  3A74 A;  5DEH A;  4C56 C;  5EPL A;  1GHK A;  4R4C A;  1XX8 A;  3VR3 A;  1XYI A;  3ER0 A;  5E3F A;  4DV2 L;  1BKB A;  5EQ0 A;  5C3E H;  1L0X B;  1D1I A;  2K01 A;  4HMI A;  3CCE A;  1Q82 C;  3Q23 A;  4POG A;  1B1Z A;  2XN9 C;  3OOC A;  4AIM A;  3K81 C;  4GZY C;  1Y1V G;  1YNJ D;  4BWG B;  1GM5 A;  4X64 L;  1R9T B;  3QB3 A;  2VZA A;  2EJM A;  2ZM6 L;  4GLV B;  1PH4 A;  4V0B A;  3V96 A;  3JAM i;  2BCO A;  3KLR A;  4PMC A;  1CT1 D;  4PV1 C;  2UXB Q;  1QUQ B;  2JA9 A;  3HGB A;  4R4T A;  2R6G A;  4DGZ A;  1AZQ A;  4WJ4 A;  1T5X D;  5K5P A;  3NTH A;  2R61 A;  4AYB E;  3VYR A;  3OTO L;  3AEV A;  4KY5 A;  3HOU G;  5FKA C;  1QUQ A;  3VR2 A;  4JYA L;  4LF4 Q;  1QG7 A;  3BZK A;  3GTO H;  2ZJR A;  4KKU A;  3DMU A;  3FHW A;  2SOB A;  4LUV A;  1TWF H;  2SEB D;  3S9W A;  1CI3 M;  4YY3 Q;  1WTQ A;  3S1M H;  1Y1W H;  3NEM A;  2AHO B;  5C44 G;  1BCP C;  3NBH B;  5DM6 3;  1II3 A;  4YHH L;  1N36 Q;  5F2D A;  5KYL A;  1EYG A;  2UU9 L;  4RKL A;  1KQS A;  1KNA A;  1WTV A;  4MNO A;  3HOX G;  4K8I A;  1LV9 A;  2GN5 A;  3UI2 A;  3NBH A;  4OIK A;  2QGQ A;  3NQT A;  4DAV A;  1ZYR C;  3PO3 B;  3S17 B;  2QDL A;  1IKL A;  3GTG B;  4QJF A;  1TWA B;  3QJY A;  4HED A;  5JPN C;  2I46 A;  1I4R A;  5KRU A;  1D5Z C;  1SEB D;  3HOV B;  3V2T A;  1P8L A;  4KHZ A;  1SNO A;  3PO2 B;  3TP6 A;  3FKI B;  3HOZ B;  4FF1 A;  4B9X A;  3SHL A;  1YI2 A;  1PV4 A;  1N8R C;  1PH9 A;  2PMZ B;  1NTG A;  4HCE A;  3LX0 A;  2E2H H;  1CKN A;  5GAH C;  3AYH B;  4PZ7 A;  2B39 A;  1FL0 A;  2HDM A;  1N34 L;  2A1A A;  1A0I A;  2F52 A;  1EIY B;  1PA6 A;  2A6H C;  4BBS H;  3U9S A;  1KAW A;  4ME5 A;  4JI0 L;  3I72 A;  1I4Q A;  5KNC A;  1OXS C;  2MPM A;  5K36 H;  4DR1 Q;  3N52 A;  2B2T C;  2Q8R E;  4I65 A;  2PPB C;  4BBR H;  4H0L C;  1Y8N B;  4DAP A;  4LF7 L;  2CWP A;  1AW7 A;  1BR9 A;  3DM1 A;  2CWA A;  4DN4 M;  4MZ9 A;  1PZK D;  1LM0 A;  1D7Q A;  3NE5 B;  2LMC B; 
#chains in the Genus database with same CATH homology
 1STY A;  3I4N B;  2EYL A;  1EFI D;  4XDX A;  1A3T A;  2BE5 D;  2F0L A;  3M4Y A;  2N55 A;  4ZUI A;  1B9M A;  1UUP A;  1ICW A;  3IAY A;  3TZU A;  3SE0 A;  2O4X A;  1Q12 A;  3RUZ A;  4RGO S;  4A3E B;  2XWB B;  3T51 B;  2NZ1 D;  3C46 A;  3J80 L;  5IOC A;  4XT3 B;  1TT2 A;  2IL8 A;  3OHX C;  2LFN A;  1TII D;  4EVO A;  2VUM B;  2NUC A;  1EYC A;  2M9V A;  1BF4 A;  1R4Q B;  2XRQ D;  3E6Z X;  3KBG A;  1F2M A;  2ZXO A;  2JSO A;  4ZKC B;  2BE5 C;  5EJW A;  4A3F B;  3D4R A;  3HKZ B;  4P2C B;  1C48 A;  1I50 B;  1JOO A;  2CW0 C;  4C1N K;  4KK7 A;  3S1N B;  2L55 A;  1DXM A;  1S5F D;  1EY7 A;  3SR1 A;  1TWC B;  5CC4 A;  3A7A B;  3IKJ A;  5M3F B;  3I4L A;  1GHJ A;  1HXY D;  2BDN A;  1Z6H A;  5EPJ A;  1I4H A;  3P1H A;  4K6L A;  1BQQ T;  2EVB A;  2L0C A;  1Z7T A;  1X32 A;  3S2H B;  3TME A;  3GD7 A;  1QOH A;  4S3S A;  1I3Q B;  4HMJ A;  2KVM A;  2F0K A;  1RCV D;  2F0H A;  1A2U A;  4NKL A;  3SK8 A;  2H4O A;  3VA5 A;  1MBY A;  5IT9 L;  1PTO H;  1H9S B;  2RKS A;  3R3O A;  1GUG A;  3NP8 A;  1J9O A;  1HPC A;  1ML0 D;  1WD1 A;  1H9S A;  1PTO C;  3C3L A;  4AYB B;  3VYT A;  1WD0 A;  3Q24 A;  1CTM A;  2SNM A;  4ZAI A;  4J1M A;  4DF7 A;  4DXF A;  2K03 A;  1FD7 D;  2VNU D;  3MA2 B;  3DEP A;  3J80 E;  4NDX A;  4EGV A;  1NUC A;  3DUZ A;  3X3M A;  3GV3 A;  4N9T A;  4X3S A;  4IUV A;  4IUT A;  2RSN A;  4RCN A;  3MAQ A;  1DON A;  1B2T A;  5D3I B;  1HUN A;  4IFD G;  1S5D D;  5C3E B;  1TY0 A;  2F0G A;  1SSO A;  4BY7 B;  2B2U C;  4HR7 B;  5FO7 B;  2JEA I;  3T4A C;  2AQ3 B;  3A56 A;  4Q0F A;  2R3Z A;  4IAL A;  3PUX A;  2BDO A;  1S5E D;  1EU4 A;  4NW2 A;  1FNU A;  3BVM A;  2NVX B;  3K57 A;  1G91 A;  1ENA A;  1EYA A;  3L3O C;  5KIX A;  1STB A;  1JWS D;  4BS9 A;  1A15 A;  1SMY C;  1SNP A;  3SXH A;  1SE4 A;  3D31 A;  1Y1W B;  2DNE A;  2RBM A;  4C3H B;  1EIG A;  4KMU C;  2WKC A;  1GUT A;  1Q1B A;  1U4P A;  2A6E C;  2FJ2 A;  5ISR A;  3I3C A;  2BOS A;  5I2X A;  2XIW A;  5A35 A;  1DZ1 A;  2CQA A;  4KI0 A;  5CV4 A;  3EA6 A;  4RA8 A;  1TU2 B;  1V8Q A;  2L5T A;  2D5D A;  2KQ3 A;  1STH A;  1EY6 A;  5JEA H;  4WFN 3;  1ESR A;  5CGK A;  4YIJ A;  1D1K A;  3OIP A;  3U9O A;  3TP5 A;  2F4I A;  2NWG A;  2EY1 A;  4XTC S;  3I70 A;  1GUW A;  1YNN C;  3PUZ A;  3RD4 A;  1M4V A;  3EFX D;  4F87 A;  4KV6 A;  5IGB A;  3NTK A;  4ULL A;  1RTO A;  1LT3 D;  2B2Y C;  1IHZ A;  3IFD A;  5JJZ A;  4C3H G;  1O80 A;  3KK7 A;  5G3L D;  1JIC A;  5IGG A;  1SYC A;  2D62 A;  4K5W A;  1U4R A;  2EYO A;  2F0D A;  1XTC D;  4RKB A;  2M00 A;  5HGT A;  1PRT D;  1C8C A;  1AFP A;  2OEO A;  1F2Y A;  1FNV A;  1TWG B;  1AP0 A;  1VMP A;  4XQQ A;  5FK9 C;  2A69 D;  3I73 A;  1BOS A;  1LO5 D;  2EYM A;  1R4P B;  3GQB A;  5KEE A;  3DXJ C;  3L7Z C;  2K05 A;  2BA0 A;  2F0Q A;  1Y1V B;  5CV6 A;  2PQE A;  1X3Q A;  2B8G A;  2E74 C;  1W6J A;  2OXP A;  3VR4 A;  1CQV A;  4QB4 A;  2HUG A;  4QF4 A;  1LTA D;  1SNM A;  2IX0 A;  1SNC A;  2X69 A;  1ROD A;  4M8A A;  4KJN A;  2NN6 G;  2FIN B;  5C4X B;  4XXE A;  1HRJ A;  1ILQ A;  1GUO A;  2K5W A;  4OIJ A;  2JA6 B;  1LT5 D;  3IL8 A;  1Q8I A;  3A7L A;  3S2D B;  5E4W C;  2VB2 X;  1G2T A;  5COY A;  3Q0A A;  5C44 B;  2BA1 A;  2F3W A;  2K1B A;  5CBA E;  1EEI D;  1CHP D;  3D6W A;  4DFA A;  3S16 B;  4DU9 A;  4PNY A;  2K7V A;  4B08 A;  2I07 B;  5D65 A;  4IUN A;  5DNF A;  1WTP A;  1HTL D;  2DY7 A;  1HTP A;  1KAB A;  2AQ2 B;  3SK4 A;  3KF8 A;  1B3A A;  3ERO A;  4F88 A;  1STA A;  4KKT A;  4DNR B;  2K5Q A;  4R8I A;  1SYE A;  4RFB A;  1DOK A;  2Q8I B;  2TMP A;  2WP8 J;  4JBW A;  3PMF A;  4QUF A;  1RD9 D;  1K8M A;  3MZ5 A;  1PFB A;  2EJG C;  2PW7 A;  2F0E A;  2EDG A;  5LL6 X;  4XYO A;  5EBC A;  1JOQ A;  1F9P A;  4DXG A;  1B9N A;  2EYF A;  2ICI A;  1IW7 D;  2FHT A;  5KGU A;  1WVL A;  2EYJ A;  5I4D A;  1RF2 D;  1TR5 A;  1SYB A;  2V4D A;  1DJR D;  2F0N A;  3I4M B;  2F0I A;  5EKI A;  1M8A A;  3QO2 A;  4UDU C;  4A3I B;  3M4O B;  1YNJ C;  1QNU A;  4CJ1 B;  4PMB A;  4FYD A;  1LTT D;  1QWY A;  2Z8L A;  2LY7 A;  2B8F A;  4IUU A;  3KLS A;  2F0M A;  1ET6 A;  3HRZ C;  2NVY B;  1EY8 A;  3G7L A;  2EOT A;  1H9K A;  1JOR A;  1VF7 A;  4RGM A;  3NK9 A;  1RDP D;  1IKM A;  5D3D A;  3PIP 3;  3MXU A;  3MTS A;  3AU7 A;  3FRP B;  3PIO 3;  3BDL A;  4K5V A;  5BN5 A;  4MN3 A;  4CKE A;  2A68 D;  3H09 A;  3MFY A;  4IN3 A;  2EYP A;  3K58 A;  1MSH A;  5A2Q E;  5ELE A;  1EWC A;  2RDG A;  1VMC A;  2QCP X;  5IIF A;  2PYK A;  2HDL A;  1F9S A;  4C3I G;  2L12 A;  4H7B A;  1B50 A;  3R93 A;  4FNF A;  3P7J A;  1SJH D;  4MHE A;  2KOL A;  2NVT B;  4XT1 B;  3A8K E;  1B4O A;  1U9R A;  3TP7 A;  3A8J E;  4X3U A;  4FXD A;  3W2D A;  4ZYS A;  5EPK A;  3CRK C;  2F3V A;  1D5M C;  1CFM A;  3FPP A;  5ELF A;  5KYI A;  4LMQ D;  3ZYY X;  4ZQ3 A;  4BA2 I;  4RAU C;  5C0X J;  1D2B A;  1A3U A;  1EIH A;  2M2L A;  3CHB D;  4RCO A;  2KCN A;  1WTX A;  4A3K B;  1TKW B;  2F0P A;  1AZP A;  4K5X A;  3H6M A;  5G3L F;  2J7Z A;  4IUR A;  2O2L D;  2YYZ A;  4KY6 A;  1MGS A;  1QE6 A;  2KA7 A;  1G8Z D;  1PRT F;  2NB0 A;  2N88 A;  1E0B A;  3KBX A;  3WOE A;  4WRD A;  4NMZ A;  2B2V A;  4RHR A;  4OGQ C;  4C3J B;  3GTJ B;  2J4X A;  1ZEQ X;  2Z4I A;  1SFO B;  2ZT9 C;  1PZI D;  3DWP A;  4U67 3;  3D4D A;  3PUV A;  3BYY B;  2D2C C;  2O5J C;  3W3A A;  1CA5 A;  2MUY A;  2RDF A;  4XQN A;  3I91 A;  3G6J B;  1QCB D;  4U68 A;  1L0Y B;  3KUP A;  2XVS A;  3NSW A;  1RTN A;  2RA4 A;  5JEA G;  1HQM C;  1LTG D;  1KDA A;  4C1N I;  1ILP A;  4HAE A;  5TSS A;  1O7Z A;  3HS0 C;  1I6V C;  3K6O A;  4IFD I;  4NP5 A;  3EJI A;  4K6D A;  2WIN B;  1GXD C;  1NSN S;  5DM7 3;  1PRT B;  3WDN A;  3K7A B;  4OO1 I;  1I4G A;  2HCI A;  2DN8 A;  2F0O A;  4MIU A;  2JP1 A;  2EXZ A;  1IL8 A;  2IX3 A;  4C3J G;  2MHV A;  3CRL C;  1O78 A;  1EOT A;  1NCV A;  1JC7 A;  4XYQ A;  3C1E A;  3RMH A;  2ENB A;  3H0G B;  3M7G A;  3J7A V;  3H3V C;  4ZUJ A;  1WTR A;  2RSO A;  3K59 A;  2B2W A;  3GP7 A;  5CV8 A;  2L11 A;  1LTI D;  4ID6 A;  1G29 1;  1MI2 A;  1CZW A;  5C3X A;  1OXU A;  3R8B A;  1SNQ A;  1O7Y A;  1EL0 A;  5CV5 A;  4FF4 A;  1JB3 A;  1NAP A;  3P75 A;  5ELC A;  1UNS A;  2DY8 A;  1JR0 D;  1LTB D;  3ERQ A;  3T16 A;  3D4W A;  1KDC A;  2K5D A;  2GA4 B;  4R9W A;  1QJO A;  5D14 A;  3Q22 A;  1Z47 A;  4FF3 A;  1HHV A;  3GTL B;  2XSC A;  5FO9 B;  2TSS A;  3BS1 A;  5EKK A;  4KHV A;  2J0T D;  1CHQ D;  1OO9 B;  2CHB D;  1SBB B;  2L9H A;  3VA7 A;  3E0J A;  1NR2 A;  5BN4 A;  4FF2 A;  3OMG A;  3MEH A;  4ILW A;  5JOB A;  1F9R A;  3GTO B;  1BCP B;  1TWF B;  4B9W A;  1ONL A;  4ZKB B;  3S1M B;  5CV7 A;  4EQN A;  3OW7 A;  1Q3L A;  2AUK A;  1HA5 A;  2X6L A;  4G7O C;  4CGY B;  2FFK B;  1TS2 A;  1ESF A;  1HUM A;  5BN3 A;  5FO8 B;  1U4M A;  4DA2 A;  1ZKO A;  2ZXR A;  4F8M A;  1B44 D;  1FNW A;  3ND8 A;  4TKO B;  4ZK9 B;  3HEJ A;  2WB1 B;  1PFN A;  3TZD A;  2WII B;  1S5B D;  1JQY D;  3K5L A;  2E2H B;  4OHJ A;  2XWJ B;  3H94 A;  4G57 A;  5C0X I;  4G7Z C;  4BBS B;  2PCF B;  1F9Q A;  4E6I A;  2MGS A;  2XNA C;  3M85 A;  2PNR C;  2B2T A;  1SE2 A;  1UEA B;  1VF5 C;  5T1G A;  4BBR B;  2E76 C;  4KJO A;  5CV9 A;  2NN6 I;  4O1N A;  4DNT B;  2QDB A;  2C9O A;  5C5L A;  1BNZ A;  1LLR D;  1PYW D;  1V1P B;  2B2V C;  4L63 B;  4FP5 D;  3FEW X;  4I7Z C;  1JCK B;  1E2Z A;  1GUN A;  1V1P A;  1AEX A;  1EQV A;  1Y8P B;  2AUJ D;  2SDF A;  3AB9 A;  3BYT B;  1Q90 A;  4F7X A;  3K5O A;  5HUR A;  5J1Z A;  1I6H B;  2KHS A;  2VB3 X;  2E2I B;  4OL7 A;  3CKI B;  1TWH B;  5IGD A;  4K2L A;  5EGT A;  3HOW B;  4IUP A;  1CQF A;  2OT2 A;  1PXU A;  3QOL A;  1AN8 A;  2QIL A;  1WTW A;  4IFD H;  3GO5 A;  4M1U B;  4CBV A;  4L6T B;  1C4Q A;  3Q6S A;  4OO1 H;  2WAC A;  2WV6 D;  1G2S A;  2JXM B;  4G4K A;  2Q8T A;  5K36 G;  3VYS A;  1J8I A;  1KDB A;  2L4N A;  3J7A F;  5C4H A;  3D8G A;  3I8Z A;  3EVQ A;  1PRT C;  3OMC A;  1XXG A;  2QEJ C;  5ELD A;  2A73 B;  1NR4 A;  2NBF A;  4RGN A;  1U4L A;  2A69 C;  4IFD J;  5JVG 3;  5FLX L;  3FVQ A;  4JK1 C;  3FDT A;  3MXP A;  3VYU A;  2Z4H A;  1KNE A;  3VR6 A;  3NPP A;  1FR3 A;  2IWH A;  3TDQ A;  5A2Q L;  1JE4 A;  1X3P A;  2JA5 B;  4X3K A;  5I6Y A;  5CBE E;  5NUC A;  1ENF A;  2K33 A;  1BCP D;  1KAA A;  1A2T A;  2EY6 A;  3GTM B;  1H9J A;  3D3R A;  1W6K A;  4TRD A;  2HCC A;  2IX1 A;  1LAB A;  2PW5 A;  1H9M A;  1KLU D;  1K83 B;  4TSS A;  3QG1 A;  4XIG S;  1ZYR D;  4BA1 I;  4QIW B;  3OPO A;  3A8I E;  3LNN A;  2E75 C;  5M5W B;  1PTO B;  3K5M A;  2RQX A;  1OXT A;  2F0W A;  4QUC A;  2LKV A;  5JPM C;  3ITP A;  4KTA A;  5FOB B;  3KLS X;  4L8J A;  3LWE A;  2KJX A;  3A54 A;  4QCL A;  4A3B B;  4WOR A;  1GOZ A;  4C3I B;  1DCZ A;  3TSS A;  1EZ6 A;  4KD3 A;  1WTO A;  1I4X A;  4EQO A;  4RHS A;  3NTI A;  4BY1 B;  3SK5 A;  1SND A;  3DEO A;  2A6H D;  1A6X A;  1CM9 A;  4HN7 A;  3HP3 A;  3T53 B;  1MSG A;  2NYZ D;  1D6E C;  2EYH A;  3H91 A;  1PFM A;  1MD2 D;  5T1I A;  4ZRZ A;  1EY9 A;  2B2U A;  1PLF A;  1QNK A;  5EBD A;  3NUC A;  4UAI A;  4HCS A;  2RDH A;  2HQE A;  2Z1C A;  5FLX E;  1IW7 C;  1PMR A;  1LT4 D;  4LK1 C;  3C1F A;  1VDZ A;  2F0U A;  1STN A;  5C0X H;  1GJX A;  2PO4 A;  5M9O A;  4G7H C;  3ND9 A;  2Y0S B;  4FXG C;  4HTH A;  3MVV A;  5CR3 A;  1TVX A;  1EY0 A;  5M3M B;  2NTS A;  3BZD B;  4DAY A;  2NN6 H;  1SYG A;  4KD4 A;  2R93 B;  2NVQ B;  5JAV A;  1WCM B;  3MFG A;  5IGC A;  2KCC A;  3J81 L;  3PV0 A;  1K8O A;  4N9P A;  2AQ1 B;  1BO0 A;  4H44 C;  1STG A;  4K14 A;  3OWE B;  3J7Y W;  2F03 A;  1SE3 A;  3GTP B;  3T56 B;  1DOL A;  4PQX A;  2PZU A;  1PZJ D;  1LT6 D;  2A68 C;  4J6H A;  4K8J A;  4A3J B;  4H13 C;  1BUV T;  2CW0 D;  3L9A X;  3SVM A;  3RZO B;  2WAQ B;  3FPU B;  4IUQ A;  2KEC A;  3BVZ A;  1OXX K;  1HFN A;  3F2U A;  4J8Q A;  4ODG A;  3AMU A;  1EY4 A;  2EY5 A;  3A55 A;  4CKB A;  2G9D A;  1EU3 A;  3SEB A;  2F0J A;  1SYD A;  2B2Y A;  4C2M B;  2PZT A;  1BXT A;  2KUM A;  3SK6 A;  2F0V A;  4IQZ A;  4A3M B;  4RH6 A;  5CYU A;  5I9P A;  3DHQ A;  4XQJ A;  1PTO D;  1TQO A;  3MHB A;  3GTK B;  3M3Y B;  1VCI A;  3ONA B;  5I2Y A;  3BDC A;  4TQU S;  4LJZ C;  2JA7 B;  3EQL C;  1FYC A;  3QOJ A;  3K0Y A;  4DK0 A;  1BBX C;  3J81 E;  2VXW A;  1FGB D;  3RLF A;  5E4X A;  1QIL A;  1T5E A;  1HCZ A;  2O5I C;  3S14 B;  2X6G A;  5I9O A;  4HSV A;  3GTQ B;  3CU7 A;  1H9R A;  3T13 A;  3NQI A;  2ZXP A;  1GUS A;  2K6A A;  4A3G B;  5C5M A;  3LWU A;  1BCP F;  2JEB I;  5IGF A;  2K04 A;  2E2J B;  2EPB A;  3BVG A;  2F0F A;  1D5X C;  1V43 A;  2D9U A;  3RZD B;  4X3T A;  3NHH A;  3TN2 A;  3WOF A;  1G6Z A;  1DD2 A;  3HG9 A;  1IYV A;  1KTK A;  4ZLT F;  1EEF D;  4HSP A;  1BDO A;  1IYU A;  3SDZ A;  1JOK A;  2NTT A;  1F2L A;  2AWN A;  1SMY D;  2JE6 I;  1RKN A;  5M5X B;  3URY A;  1HFG A;  2QF7 A;  2LS0 1;  5AFW A;  2ICE C;  1O7L A;  5E1F A;  3JAM L;  5IOD A;  1HQR D;  5IGE A;  3HOY B;  1XWE A;  2PZW A;  3PUW A;  4DK1 A;  1TS5 A;  2A6E D;  1UAP A;  4K2K A;  2ID0 A;  2OF1 A;  2FMM A;  5ELB A;  4OO1 G;  1ENC A;  1SAP A;  3OIQ A;  2E2D C;  1CA6 A;  3V05 A;  2EY2 A;  2SNS A;  4FXK C;  4CKC A;  2R7Z B;  1QB5 D;  1E2W A;  1I4P A;  5M5Y B;  4Z9C B;  5DAU A;  1DOM A;  3S15 B;  4A3D B;  1EYD A;  2F1M A;  3TBI B;  5J22 A;  5KND A;  2B63 B;  1JWU D;  3CQZ B;  1YNN D;  2A5H A;  3I90 A;  3BDO A;  1STE A;  4FVM A;  1SYF A;  2F0S A;  3IFT A;  1EQT A;  2MP1 A;  1SXT A;  4QMG A;  2KEE A;  1S4Z A;  3R2T A;  4Q5V A;  1E2V A;  3VR5 A;  4V19 0;  3QIA A;  3O13 A;  5IT9 E;  3MXN A;  3DWQ A;  4IZ8 A;  2IW3 A;  1DYQ A;  1RHP A;  2EE1 A;  3OSO A;  1LAC A;  4RGT A;  3S1R B;  4A93 B;  1DM0 B;  1V1O A;  5C4Z A;  4EQP A;  5J39 A;  1CZG A;  4KN4 C;  1ET9 A;  4CJ0 B;  1LTS D;  2EZV A;  2IPK D;  1EZ8 A;  3FMC A;  1S5C D;  1F77 A;  5CMD A;  1PDQ A;  5JVH 3;  3JAM E;  2R92 B;  2IT1 A;  3P20 A;  1Q1E A;  2CVR A;  5JEA J;  3C2P A;  2JA8 B;  3S1Q B;  3QWN A;  1F2Z A;  4KKS A;  3MXG A;  2YU9 B;  3DWA A;  1Y8O B;  1CK1 A;  1ZXT A;  4R8N A;  4CJ2 C;  5LL6 S;  1OXV A;  2F0T A;  2EJF C;  1A3V A;  1EWH A;  3NWT A;  4RWS C;  3N6R A;  2C5C A;  2DNC A;  1LTR D;  4CHT B;  2JYO A;  4ABN A;  1Y69 U;  3D6C A;  4WJW A;  2K28 A;  3NBI A;  1RJT A;  2K32 A;  2IJ0 A;  5C0X G;  4FO2 A;  1TS3 A;  5LHY 1;  4KN7 C;  3M7N A;  2WKD A;  3HZX A;  3NWS A;  1PTO F;  2QKI C;  3MWY W;  2G9H D;  1SJE D;  1KLG D;  3E5S A;  2RVL A;  2MJ8 A;  2XRS D;  4O42 A;  3PUY A;  3R2I A;  3K5N A;  5EKL A;  1TS4 A;  1EY5 A;  2FMC A;  3OWF A;  1B53 A;  1TY2 A;  3HOU B;  4Y7N B;  3MC0 B;  5C6A A;  2H1E A;  2B2W C;  3NXW A;  3TP8 A;  5I6W A;  1SDF A;  2L1B A;  1HA6 A;  5KNB A;  4LAA A;  2AWO A;  5C4J B;  3GV6 A;  5C3W A;  1JWM D;  4KY7 A;  3HOX B;  5COR A;  4PMW A;  2KED A;  2A74 C;  3X3N A;  3BG3 A;  5DEH A;  4C56 C;  5EPL A;  1GHK A;  1XX8 A;  3VR3 A;  1XYI A;  5E3F A;  5EQ0 A;  1L0X B;  1D1I A;  2K01 A;  4HMI A;  3Q23 A;  1B1Z A;  2XN9 C;  3OOC A;  4GZY C;  1YNJ D;  4BWG B;  1R9T B;  3QB3 A;  2EJM A;  4V0B A;  3V96 A;  2BCO A;  3KLR A;  4PMC A;  1CT1 D;  4PV1 C;  3HGB A;  2R6G A;  4DGZ A;  1AZQ A;  1T5X D;  5K5P A;  3NTH A;  2R61 A;  3VYR A;  4KY5 A;  5FKA C;  3VR2 A;  1QG7 A;  4KKU A;  3DMU A;  2SOB A;  2SEB D;  3S9W A;  1CI3 M;  1WTQ A;  1BCP C;  5DM6 3;  1II3 A;  5F2D A;  5KYL A;  4RKL A;  1KNA A;  1WTV A;  4K8I A;  1LV9 A;  3UI2 A;  3NBH A;  4OIK A;  3NQT A;  4DAV A;  1ZYR C;  3PO3 B;  3S17 B;  1IKL A;  3GTG B;  1TWA B;  3QJY A;  4HED A;  5JPN C;  2I46 A;  1I4R A;  5KRU A;  1D5Z C;  1SEB D;  3HOV B;  3V2T A;  4KHZ A;  1SNO A;  3PO2 B;  3TP6 A;  3FKI B;  3HOZ B;  4FF1 A;  4B9X A;  3SHL A;  2PMZ B;  4HCE A;  3LX0 A;  2B39 A;  2HDM A;  2A6H C;  3U9S A;  4ME5 A;  3I72 A;  1I4Q A;  5KNC A;  1OXS C;  2MPM A;  5K36 H;  3N52 A;  2B2T C;  2Q8R E;  4I65 A;  2PPB C;  4H0L C;  1Y8N B;  4DAP A;  1AW7 A;  1BR9 A;  3DM1 A;  4DN4 M;  1PZK D;  3NE5 B;  2LMC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...