4F87A

X-ray crystal structure of plycb
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
VSGVQGFLFHTDGKESYGYRAFINGVEIGIKDIETVQGFQQIIPSINISKSDVEAIRKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PlyCB
publication title X-ray crystal structure of the streptococcal specific phage lysin PlyC.
pubmed doi rcsb
source organism Streptococcus phage c1
molecule tags Antimicrobial protein, viral protein
total genus 15
structure length 61
sequence length 61
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.850 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f87A00
4F88A 4ZRZA 4F87A
chains in the Genus database with same CATH superfamily
3D4DA 2JA7H 1NMGA 2IW3A 1NBWA 1VQCA 5DM63 4GNXC 5CV9A 2JA5B 4YHHQ 3DEOA 1TU2B 4Q5VA 1NNXA 3QB3A 2PW5A 4A3BG 1EQTA 2RF4A 3GTQH 3Q23A 5JJZA 1Y14B 2F1MA 3RLFA 1E0BA 2FFKB 1TS3A 5E4XA 4R8IA 1QNKA 1XJVA 2N8NA 1I6HH 1EFID 1KIXA 4P72A 1PXUA 1IW7C 3PQIA 1SE8A 3UE1A 2M00A 1MIUA 3KJPA 5HGQA 2B39A 1XMOQ 3HOXB 4CGYB 4IZ8A 1AZQA 5ELOA 4F7XA 2VQEQ 2JYOA 4P71A 4MN3A 4DAYA 2KCNA 1JOOA 2I0QA 1CA5A 2WIIB 4RGNA 2ICIA 5I2YA 3URYA 1HNXL 1KABA 4N8X1 3GTMB 4GLAC 3UDGA 4JPBW 4KD4A 3SDZA 2E2JH 1HQMC 4RA8A 5I6WA 3OTOL 2YTXA 5DLQE 1WTPA 1XMQQ 1QILA 1G2SA 1Q12A 4IUUA 4LFCL 3F2UA 1ET6A 5EPJA 1VQDA 3HGBA 3VA5A 3STBC 4JW0A 5CV4A 3H6MA 2OTLA 4OWTB 5EKKA 2KUMA 1L0XB 4QUFA 5K36G 4KN7C 2UXDQ 2WACA 3SXHA 4DV4Q 3SR1A 3GTGB 1ICWA 1STAA 1N32L 2ID0A 5ELFA 1HZBA 3HKSA 3ULLA 5IGFA 3GTLB 2AHOB 3PO3G 1STYA 2EDGA 3JC66 4DR7L 2DNEA 4B08A 2K28A 3H3VH 4XQNA 4GLVB 4M1UB 1KDAA 4QUCA 1EIHA 4IUTA 1S72A 1Q46A 5C3EH 4A3IH 1GXDC 1YITA 2HUGA 2ZT9C 3EFXD 2K5NA 1TWGH 5GQOA 2CH4A 2CQAA 4A4IA 4FXDA 1U0LA 2EJMA 3K7AB 1B9MA 3NHHA 4LF8L 4OO1H 1JB7A 4J8QA 1N36L 1JE4A 3J80L 4BA2I 1TQOA 4KMUC 4BBRG 1IYJB 4IPGA 4A3GB 3G6EA 1EYCA 1G91A 2MO1A 5E3FA 3AYHB 4OONA 2RKSA 4XXEA 4GKJQ 1D5ZC 1VQAA 1LT6D 3NELA 4BY7H 4DUZL 3VR5A 1KLGD 2JQOA 2Y0SB 3RN5A 4ZLTF 1I4RA 4UP7A 3HZXA 4IFDH 4OL7A 3IKJA 1V43A 2HHHQ 2NVYH 3BJUA 4DR5L 3K5NA 2HD3A 3L9AX 1B7YB 4RKBA 5LMNW 4DAVA 3VA7A 2X6GA 4R4QA 5KEEA 5M3FH 1C0AA 1EY4A 4YCVA 2OWOA 4RH6A 2NN6I 2YTYA 1WD1A 4R4IA 4OGQC 1MJCA 1GUWA 1ESFA 5FO9B 2R92B 2NN6G 3GTPH 5FLXc 2JA8B 2P5ZX 4DF7A 4DNRB 3EJIA 3A74A 3FHWA 1PTOH 1FNVA 2SOBA 5DAUA 1B3QA 5IIFA 4A3EG 4HIOA 2F4VL 3I70A 5ELCA 1DGSA 1R4QB 1R9TH 4HIMA 2K5HA 5KYLA 2VXWA 2E76C 2K6AA 3HOWB 4IUVA 3J7AV 1CKNA 3S15H 1STGA 3M3YH 2VZAA 1P16A 1NR4A 3H94A 3T4AC 2PO4A 2Y0SE 3D6CA 1TS4A 5ELBA 2K33A 4DNIA 3S2HH 3FKIH 1IYUA 4A3FH 4HMJA 4RAUC 2B2VC 1HNXQ 2EYJA 5JEAG 3BZDB 1KRSA 1EQQA 4NMZA 3P1HA 5KNCA 5A2QL 1VS0A 2EY2A 1UAPA 2JA7B 2A6EC 1V1PA 4LFCQ 5ISRA 4JI3L 4C3JG 2VNUD 2B63G 1UE6A 5M3MH 4BXXG 3G7LA 1TKWB 2KENA 1K0SA 1PZKD 4BY1H 1CKNB 4K5VA 3UE0A 4AYBB 3AU7A 3MA2B 3GTQB 2ZJQA 3KDFB 1IL8A 2PNHA 3X3NA 2B2VA 5BN4A 3B6YA 2YTVA 4PZ8A 4B3SL 2LXKA 1I6HB 1XNRL 1N32Q 2BDOA 2F0LA 4KHVA 5EBDA 4BWGB 3EN2A 1P8LA 1FYCA 3PIPA 4IN3A 4LAAA 3MEHA 5FOBB 3BG3A 4JVZA 4DR7Q 4XIGS 4LF6L 3HFZB 1F9RA 3BYTB 3I4MG 1CUKA 4RHSA 5FLMH 2M9VA 4G7ZC 3VYUA 2ASBA 3NTIA 3R2TA 2D0PA 5IP7H 4CDFC 4DV0L 3S1NH 3WWVA 2AQ2B 3CPFA 3E9HA 2QEXA 3K5OA 4JI6L 4HJ5A 2NZ1D 2E2JB 4L8JA 1GKHA 2PQEA 4HCSA 4K6DA 2K75A 5I6YA 4QL5A 4LF8Q 4UHVA 4QMGA 1ZYRD 1N36Q 3T13A 1STHA 1G8ZD 4PV1C 2F0QA 5IT9c 3E0EA 2A6HC 4APVA 3QWNA 2KHSA 5IYBH 1E1TA 2JK8A 5GROA 2HQEA 4AYBE 3ER0A 3R2IA 4IFDJ 2MHVA 1E1OA 4DUZQ 1UE5A 5FK9C 4DK1A 3GTJH 1SYCA 2EYMA 1LTID 3HOUH 3AFPA 3CCRA 4YCUA 1GOZA 2K5WA 1EEFD 5HGTA 4E6IA 4DR5Q 1GUNA 4I7ZC 5DEHA 2A8VA 3J80E 3QR8A 2ZM6L 2DN8A 3OW7A 1OTCA 1I4GA 1VQGA 4PMCA 4B9XA 4X66Q 1XWEA 5C3EB 4A3IB 3BVZA 1Q81C 1PH5A 3CQZH 2AQ3B 1HFGA 1HZ9A 5IGCA 1V9PA 3S1RH 4YWLA 3GTKH 1VQFA 2F4IA 3KBGA 3V2TA 1TWGB 4HJ7A 4K2LA 1CHQD 1CHPD 1PH3A 1S5FD 3A7LA 2F4VQ 1XX8A 3TRZA 1WI5A 4A3DG 4A93H 4H0LC 1M1KC 1PYWD 1VQ4A 5EPLA 2DUDA 1TVXA 2KHJA 1EY0A 4BY7B 4J1MA 1A2TA 3VYRA 1QG7A 1Y1VG 2EJGC 3GD7A 5GADC 1I94L 1DJRD 1YZ6A 4JOIC 1F77A 1TWHH 4KKUA 1K3RA 2NZHA 4TVAB 2NVYB 2N3SA 3PGZA 3E3XA 1IKLA 3S1QH 3I90A 1IBLL 3J81j 4KN4C 1HZAA 2K50A 4JI3Q 5M3FB 3NXWA 3F2DA 2NB0A 1RDPD 1GM5A 1KL9A 1JORA 1KNEA 4BS9A 3QOLA 3GTPB 5EJWA 2A69D 1SROA 2E74C 3LX0A 2Z4IA 4DV2L 4WFN3 1WTVA 4JOIA 3VYTA 1PTOB 3OMCA 3SEBA 4B3ML 1K83H 3ND9A 1H95A 4HJ9A 1XNRQ 3DWPA 1XTCD 1VQHA 4LW1A 4OXPA 2R61A 4CDDC 4KHPQ 2Z6KC 4K2KA 1BCPC 1R9TB 3N52A 3T51B 2F0JA 4DA2A 4LF6Q 3S15B 3M3YB 4GOPC 1SJED 2Z1CA 3LWEA 3M85A 4JI8Q 4C3IG 1HPCA 4QF4A 1LTGD 5LL6X 1RTOA 3FKIB 2LFNA 4DV0Q 4A3FB 1PH6A 3S2HB 1QUQA 3HOYG 3J81L 4JI6Q 4DFAA 5LMNQ 3H91A 4BBSG 5JJKA 4IJLA 2PQAA 2K1BA 1VQOA 3I56A 2MJ8A 1HUMA 1RD9D 4AH6A 1BOSA 3M4QA 4RGOS 1SNMA 3WOEA 2L4NA 2Z6KA 1LABA 3HRZC 2H4OA 5M5YH 1XXGA 5M3MB 4TSSA 1QVFA 3BDCA 1SE3A 1IYVA 4A3MG 5CV5A 4GOPA 1Y8OB 2OXPA 4F87A 5JPMC 3CAMA 1PA6A 1A0IA 1YHAA 4K8IA 3TEHB 5IY0A 4S3SA 4QCLA 4A3KG 5IYDG 3I4LA 2O5JC 1VQ5A 1WTHA 1Y1WG 1NMFA 1YNND 2KJXA 3BDOA 2IX3A 3P20A 1JJCB 2QGQA 2MNAA 4EQ5A 1WYDA 2JA6H 2PMZB 1X6OA 1X9NA 1ML0D 1K8MA 2NVXH 2EY5A 3RD4A 1BCPB 2L55A 2SNSA 3PUVA 5EBCA 2ZM6Q 1Q8IA 2OEOA 3E6ZX 2WB1G 4R8NA 4DV4L 3R93A 3S1NB 3UDXA 3ICEA 4JI5Q 2B2WA 1HTPA 1PDQA 2KCMA 2F0WA 2QDBA 4UP8A 2DNCA 1YNJC 3H0GG 4JI1L 4GLXA 1JQYD 4QQBX 1O7IA 3D3RA 1U4MA 5JEAH 1CQFA 4JBKA 1BBWA 1G291 1OO9B 4R4TA 1SNQA 3PO2G 4XTCS 3DEPA 4JCVE 3O13A 3UI2A 1PRTC 2O5IC 1SRUA 4C3JH 4EQOA 2B63H 2PZTA 3M4YA 3QJYA 1I94Q 5AFWA 3GTJB 4X3KA 1Q1BA 3NBIA 5GAHC 3F8TA 1C48A 3HOUB 5JPNC 2EXZA 1HJPA 4RGTA 3HOZG 1Q1EA 2LY7A 1WOCA 2I5LX 2PMZE 2RDFA 3TSSA 1CTMA 1IBLQ 3R3OA 1H9JA 2PZWA 2TMPA 5FJ8G 5EAYA 3CC2A 4NB3A 3CQZB 1EZ6A 1SSOA 3S1RB 1PH4A 3GTKB 4N9PA 4L6TB 2L9HA 1PFSA 4ZQ3A 3NQTA 4MIUA 2AWNA 3KF8A 3L7ZC 1WJJA 2CW0C 1W6KA 2UUAL 3KUPA 4EX5A 4WJWA 5LMUL 2YU9H 1M4VA 2RSNA 1VMCA 3MXNA 1JJ2A 2CKZB 1B44D 2YYZA 2WKDA 1TWAH 3Q0AA 4A93B 1F9PA 4PQXA 3SE0A 3K5MA 2VS1A 2J4XA 3BS1A 2EYFA 2BCOA 1PRTB 3U4ZA 1I4XA 1Z9FA 3KLSA 1E2ZA 2R7ZG 3H15A 1TWHB 5BR8L 1YHQA 1KTKA 1C9OA 1A3VA 1LT4D 5CR3A 2N78A 3SGIA 3TMEA 4P74A 3S9WA 3RLNA 5KYIA 2Z9HA 1ENCA 1U4RA 3D0FA 3NBHA 3S1QB 4K8JA 2RQXA 1ET9A 2Q8TA 4NPSA 4GNXA 1LTLA 1I4PA 4H44C 4FDBA 4QY7A 2L11A 1PH1A 2ALYB 2PNRC 3PIO3 4ILWA 2F0EA 2E2HH 3I55A 4ZKBB 3X3MA 1WCMH 1LT5D 1VF7A 3J81E 1K83B 5KGUA 5EKIA 2Q2UA 2FINB 4IPHA 1F2MA 1KLUD 1QE6A 5IYCH 1YNXA 2UXBQ 4GNXB 1RKNA 2XWBB 1EIGA 4DAYB 5K5PA 4PG3A 1M8AA 2A6ED 2JA5G 2C35B 4C1NK 2BOSA 1EL0A 3I91A 4YWMA 1HR0W 3QG1A 3NENA 3HOVH 5JEAJ 2KBNA 3NQIA 3DUZA 4PMWA 4JI1Q 1KC8C 5IE8A 1NUCA 1O7ZA 5IGDA 1Y8NB 3CRLC 2EJFC 4G7OC 2WAQB 4LF5L 4FP5D 3PF4A 5M5YB 3J7A5 1FVIA 5BN3A 3K59A 1WVLA 4DR3L 1MSHA 4QIWB 3HOXG 1XYIA 2DY8A 1A3TA 4GN5A 4KJNA 4N8FA 2F0MA 5D3DA 3G71A 4POFA 1HFNA 1ILQA 3SK5A 4EGVA 1IL2A 3PCOB 4P73A 1SYBA 5C4JH 1QVGA 2UUCQ 4X62L 3PSIA 3OSOA 3EVQA 3U58A 1FJGQ 4YIJA 5CV8A 4FXGC 5M9OA 1TXYA 3A56A 2IY5B 1SXTA 3FVQA 2IL8A 5C0XI 5C44H 2JA6B 3K58A 2VQFQ 2H1EA 3TDQA 1FGUA 1LYLA 3L3OC 5C0XG 2NVXB 1FL0A 2BA1A 3A7AB 1BXTA 2JXMB 2Q2HA 5KRUA 3VR6A 4R9WA 4RMFA 1I3QH 1X54A 1NTGA 3MWYW 4V0BA 4ZAIA 1EZ8A 3I8ZA 1HNWQ 4LFBL 2EVBA 5C4ZA 1LTSD 1IXRA 4UPAA 1I50H 3IAYA 2SNMA 1IBKL 4R4OA 4HMIA 5GAEC 2Q2IA 5E4WC 2UUAQ 1DCZA 2L15A 2WAQE 5LMUQ 2K05A 5JAVA 1EQRA 4X66L 1K8GA 4B3RL 1AE3A 1K0RA 4BBSH 4QIWE 1CA6A 1HCZA 1RTNA 4EVOA 1U4PA 1NE3A 3TP7A 1SN8A 4C3JB 2B63B 4JI0L 4JBWA 1Q86C 4IOAA 1EOTA 3MXGA 1SJHD 1Z6HA 1PH2A 5BR8Q 4DKAC 4A3MH 1X3FA 3MXPA 2IT1A 3TP6A 1SDFA 4OELB 2A19A 1PTOD 4XDXA 5CBEE 3JAML 4WRDA 2UXCQ 2F0PA 1K8OA 3M9BA 4FVMA 1E2VA 1EYGA 1KHIA 2PI2A 3V96A 4RG1A 4A3GG 2LMCB 3FRPB 4LK1C 2NYZD 2R93H 1DONA 2LXJA 3DM1A 4QJFA 3BZCA 3GDEA 2DGYA 3K81C 3D8GA 4DPGA 1J5EL 2UU9Q 2K03A 1YI2A 1GUTA 1YIJA 2L12A 2CCZA 3S2DH 1W6JA 2Y0SG 2O4XA 2AUKA 2N49A 2A68C 1K8AC 3L0OA 4AQYQ 3J80c 4DV1L 3CMAA 1CKOA 2CHBD 2YU9B 1ENFA 2B2YC 1K9MC 3H09A 3MEFA 1HUNA 3A55A 3LNNA 1TWAB 1T9HA 1JMCA 2VUMH 1MKHA 1PYSB 5IP9G 2DJGC 4DR4L 1T5EA 2HQLA 1NR2A 2K04A 1QB5D 1AW7A 1JC7A 2ZTEA 4OWXB 1U9RA 4C3HH 4OIKA 4CJ2C 2I5HA 2RBMA 5CMDA 3CCVA 1SMYD 3CF5A 2JA8G 2R92G 1DZ1A 3CCLA 1EWHA 4KHPL 5C3XA 3BZKA 4JI4Q 2GVBA 5JVH3 4KI0A 1BVSA 2B2YA 2QKIC 4CKBA 2J7ZA 1V1PB 4QGUA 3VYSA 2RCNA 1A63A 4LF5Q 1LACA 2FJ2A 4JI8L 4DR3Q 1CI3M 3KYHC 1KAAA 1BCPD 3HOWG 2WP8J 2PPBC 2XWJB 2E2HB 3BU2A 2D62A 2HIVA 5LMNL 1HHVA 1D5XC 1GUSA 1WCMB 2EYOA 5FO8B 1PYBA 4DAMA 1XTDA 2G9DA 1VQ9A 3MZ5A 4X62Q 1SYFA 3BVMA 3KLRA 4U673 3K5LA 2BA0A 3CMEA 3AEVA 5IGBA 3TREA 3LGJA 4YWKA 3I4NH 2ZJPA 1EU4A 3TP8A 2AWOA 1TWFH 3SVMA 1BKBA 3MHBA 4XYQA 2C5CA 2PI2E 3BVGA 2ATWA 3A5ZB 1BUVT 5GAGC 2B2TC 2ENBA 4DK3C 2KVMA 4AYBG 1GUOA 3EA6A 4UP9A 1VQKA 4YCWA 4A3BH 4LFBQ 3HOVB 2QCPX 5IGEA 1PHJA 4DGZA 1E22A 3PF5A 3JAMi 1LO5D 1IBKQ 2R7ZH 4JV5Q 3M4OH 4MHEA 1LLRD 3CCQA 4LJZC 3RMHA 2KQ3A 4B3RQ 5CV7A 2EYHA 3ITPA 1I5FA 1XPRA 3W1BA 1PFNA 3KF6A 1EWCA 3KOJA 4A3LG 1E24A 2ZXPA 4B9WA 3L2PA 1YVCA 4JI5L 2HDLA 4XT3B 5BN5A 5FKAC 3RR5A 2B2TA 4P75A 4DR2L 3DLLA 4JI0Q 1Z7TA 2NZOA 1L1OC 4A3JG 3DWAA 5C4JB 4FF1A 3J7AF 1HRJA 2OQ0A 1JJGA 2XNAC 4CKCA 4NKLA 4DK0A 4X65Q 4M8AA 5C44B 2BE5D 4KY5A 1ZEQX 2KECA 3ONAB 1D1KA 5D3IB 1A15A 2HCIA 2JP1A 1QJOA 1Q3LA 2PW7A 2F0NA 5IGGA 1G2TA 4LNQA 1I3QB 4J15A 3KF6B 2CQOA 4NDXA 3PUYA 1TWCH 1L1OA 1EYDA 2JN4A 1J5EQ 5K36H 4MNOA 4HIKA 1GJXA 1PRTD 4RFBA 1I50B 1GO3E 5JVG3 4LF4L 2F0UA 4FF2A 1ASYA 3RLOA 3WDNA 4DV1Q 3G6JB 3DM3A 4RKLA 3OYYA 3CHBD 2M2LA 4BBSB 1U5KA 3PO3H 2MQHA 3U9OA 3KJOA 1B3AA 3MFYA 1ILPA 1RHPA 4DR4Q 5C3EG 4TQUS 4A3IG 1QOHA 4H13C 1NAPA 1B2TA 1JOKA 4DXFA 3S17H 4LUZA 2VL6A 3Q8DA 4A3MB 1N33L 1S5ED 4YY3L 4IUQA 1L1OB 1TIID 2WINB 2ZXRA 4DU9A 4UY8C 1HTLD 1BBUA 2G5DA 2G9HD 5A2QE 3ZYYX 4OO1I 1ENAA 1C7YA 2E2DC 1N9WA 3GO5A 1ZXTA 4OO1G 3IFTA 1YBYA 4KTAA 1CQVA 4O0AA 4HIDA 4H02A 1I6VC 1UWVA 2N88A 2OT2A 4BBRH 3EBEA 2L1BA 4ZUJA 2XRSD 2R93B 3EIVA 1Q7YC 3PMFA 2Z0SA 2MPMA 1HH2P 1II3A 4BY7G 4PNYA 1V8QA 1WD0A 4LUOA 3S2DB 3HS0C 2F0FA 1T5XD 1X32A 3SK4A 4L5TA 4DV6L 4NP5A 4UDUC 3RN2A 3TP5A 4ZRZA 1LUZA 2HDMA 3A8KE 4CDCC 3NEMA 5IWAQ 3ULJA 3S1MH 1BBXC 3G48A 1ZYRC 1B70B 4IJHA 1CSPA 1IW7D 5E7NA 3AQQA 3N6RA 4I7AA 2VUMB 1Y8PB 4A3CG 1BQQT 3R8BA 1HXYD 3GP7A 1D2BA 1PTOF 5M3FG 4IQZA 4JBJA 3KK7A 2MFIA 4C3HB 1JE5A 1QUQB 1JB3A 2NBFA 3AFQA 2GVAA 1TY2A 4QB4A 2NN6H 3MVVA 1BDOA 4FF3A 1S5DD 2B8GA 3TQYA 2D2CC 1SNOA 3F1ZA 2C9OA 2PQAB 3K0XA 3VDYA 3A8IE 2MO0A 2UXBL 4A3EH 2RDHA 5KNBA 3K0YA 4KLKA 2NVTH 4IPCA 4K5XA 2NTSA 3STBD 2ZTCA 4GOPB 1W2BA 1EY7A 2CH4W 5E1FA 4P2CB 1A2UA 1HA6A 4DR2Q 1JCKB 2E8GA 2K14A 3CCEA 1E7ZA 5HURA 1J8IA 4A3FG 3FMCA 4ME5A 1Y69U 2HIXA 3NE5B 1S40A 1B1ZA 3BDLA 1H9SA 3I4NB 3RUZA 1LTBD 2AUJD 3BYYB 4JI2L 4A76A 1TWFB 3E0JA 2F0GA 5J39A 1CK1A 1ICFB 2E75C 2FMMA 1MI2A 1RIPA 3NUCA 4X6AH 1RJTA 3ULPA 1SMXA 5M3MG 2CFMA 1EWIA 1E3PA 4BXXH 3ZJYC 4F88A 4BY1G 2UUCL 4ZCKA 3J81c 1BO0A 1FJGL 1SE4A 2K52A 1MJEA 3RZDH 4A3BB 4IALA 2PZUA 3T1YQ 1VDZA 1UE7A 3QOJA 4LF4Q 4L5QA 2Z6BA 1BCPF 2VQFL 2R7ZB 3M4OB 2F0IA 4MZ9A 3HG9A 3S14H 5ELDA 1PH7A 2JA9A 4HCEA 5EQ0A 2PYKA 2JEBI 1D1IA 2KEDA 4Z9CB 2ICEC 2WKCA 3A5UA 5J3BA 5FO7B 3I3CA 1BNZA 5FLMG 1EU3A 3I4MH 1HNWL 1CM9A 2K7VA 2OQKA 2KCTA 3D4WA 4KD3A 2R7FA 2OF1A 3HKZG 1N8RC 1SNPA 1TS5A 5IP7G 2F0OA 1VQJA 1N33Q 3CCMA 1X65A 2N55A 4YY3Q 5F2DA 4ODGA 4FYDA 3DWQA 4KK7A 3GTOH 2A74C 3NP8A 5C4XG 3EQLC 5T1IA 3IFDA 3W5OA 4WJ4A 1PFBA 5C0XJ 1E2WA 1SYDA 4WORA 1SE2A 2IHFA 5IYBG 2EIFA 1DOLA 2K4KA 4X64L 3TBIB 3UDFA 3D31A 1TWCB 1EIYB 4O2DA 5JOBA 4RCNA 1RODA 4C2MH 5IODA 3HP3A 4U68A 1VQ7A 2MP1A 4IPDA 1KD1C 5M5XH 1EYAA 2SEBD 2UXCL 3KF8B 4DV6Q 2K5DA 2VY3A 2F03A 2JSOA 2MGSA 1SNCA 3HOUG 4KV6A 2E2IH 3MXNB 3PO3B 5D65A 2A1AA 2Q8IB 4CBVA 3Q6SA 2KEEA 3G4SA 5KNDA 3RZOH 2UU9L 1WTXA 4Q0FA 1Q90A 3S17B 3PUZA 3TS0A 2F3WA 3GV6A 3FPUB 5LHY1 3OPOA 4A3LH 3WOFA 4CJ1B 3C1FA 4AQYL 2X6LA 2RSOA 2QILA 4KHZA 2FXQA 2V1CC 4R4CA 2K32A 4A3JH 1G6ZA 1YNNC 3NBHB 2XGTA 3PV0A 1WTRA 1YHBA 3M7GA 2A68D 3SK6A 1VQ6A 1A6XA 1PRTF 4X3SA 4BBRB 3V05A 2EY6A 4FXKC 4DUYL 4A93G 4A3DH 2RHQB 3W2DA 1GVPA 5CYUA 5J22A 4LMQD 4C1NI 5JJIA 1D7QA 4ME3A 2J0TD 4JI4L 1F9QA 1Y1VH 3PIOA 3MAQA 5CBAE 4JYAQ 1UEBA 4PZ7A 5FLXL 1M90C 3Q22A 3S1MB 2AQ1B 5CC4A 1SR3A 2F0KA 1SFOH 3K57A 3CCJA 1SBBB 4JI2Q 1X3GA 5I9OA 4TKOB 1Q82C 2B29A 2QEJC 4R1JA 4DAPA 5M5WH 3DHQA 1KXLA 5NUCA 1UEAB 2WFWA 5A35A 1CZGA 1KDCA 1RF2D 2GA4B 3CXCA 2L5TA 2JE6I 2TSSA 4B3TL 3I7FA 3S24A 2NUCA 1EY5A 2JEAI 1I4HA 3IL8A 4OIJA 4A3EB 5EGTA 2XN9C 2F0SA 4ALPA 2A73B 2Q2TA 4G7HC 4FF4A 1O80A 2NVTB 4ID6A 3TZDA 4K14A 2XRQD 2FHTA 2QW7A 2A6HD 3CKIB 2ZJRA 4PMBA 3CC4A 4DXGA 3C2PA 2RHSB 1A3UA 3P7JA 5CORA 1EQVA 2FMCA 1N34L 2D9UA 1W3SA 4CDEC 4C3IH 1FR3A 1MHWC 2EE1A 3KFUA 4JV5L 1VQEA 3C3LA 3HOYH 4XT1B 2YV5A 1ESRA 4GKKQ 1UNSA 1STNA 2LSSA 1EY8A 1PV4A 4CJ0B 1DOMA 4DN4M 1LTTD 1VQIA 4HAEA 3OOCA 1F2YA 1MSGA 1WFQA 4POGA 1WTOA 4XQJA 4IURA 2DY7A 1VQBA 1KAWA 1SEBD 1KNAA 3OMGA 2WAQG 1KRTA 3A0JA 3TZUA 3GQBA 5H1SE 2B2UC 3SK8A 4L5RC 1OXVA 2RA4A 4X64Q 1GUGA 4DV5L 4G4KA 4DR6Q 1V1OA 3KBXA 1VQMA 3I72A 3QO2A 3VR3A 4A3CH 4LUVA 3RZDB 1GHKA 2PCFB 3FDTA 1OXTA 3P75A 4IUNA 4IO9A 2H5XA 1SYEA 3DMUA 4X65L 5C5MA 4A3KH 5IYDH 2B8FA 5J1ZA 3E9IA 1Y1WH 3S14B 4LF7L 2KA7A 2I5MX 2VB2X 4LF9L 2RVLA 4GZYC 1HR0L 2JA6G 1AH9A 1AZPA 1VQ8A 3MC0B 3I4MB 4HEDA 2CVRA 2B2UA 1F2ZA 1OXXK 5IT9L 1JOQA 1NY4A 2QF7A 1PH8A 1IBML 4BA1I 2XTIA 1SAPA 1Q8KA 1CT1D 5EPKA 1B4OA 3VR4A 4HSPA 3GTOB 3FP9A 1PZJD 4XQQA 3KDFA 3CPWA 3H0GH 3PIP3 2F0TA 1JWMD 5CGKA 2F0DA 2EYPA 1XNQL 2AKWB 2BH8A 1SLJA 3OTOQ 1CSQA 3KLSX 1I4QA 2MUYA 2ZXOA 1VQNA 3PO2H 4DUYQ 4TRDA 1R4PB 2EOTA 1JWSD 4C2MB 3D6WA 1XPOA 2K01A 5M5XB 1YEZA 1K73C 3PUWA 2IHEA 5COYA 4OEMB 3NWTA 2DJFC 4MTNA 4OWWB 2E2IB 1F9SA 4CKEA 1SNDA 3J7ZC 1JWUD 3HOZH 1B9NA 3EROA 2F52A 1PVOA 3CRKC 1PFMA 1PZID 1TS2A 3C1EA 1RCVD 3M4PA 1Z47A 4K6LA 3J80i 3CCSA 3U50C 5FJ8H 3H3VC 3RZOB 2WV6D 2O2LD 4NXNL 4UAIA 5AJ3L 3T1HL 1WTWA 3NPPA 1VF5C 4DV3L 1O7YA 1ASZA 3K80C 1SYGA 3K7UC 2F3IA 4L63B 4B3TQ 5ELEA 5IWAL 3JAMc 4A3JB 4A75A 3W3AA 5FLXE 4NXML 3S16H 1S5BD 5LL6S 5G3LD 2JA7G 1UUPA 1STBA 1BR9A 5C4XH 1QZHA 2XIWA 4L5SA 3T56B 3C46A 4LFAL 4A3DB 1OXUA 1L0WA 5JJLA 1EOVA 3NTKA 1X56A 1DXMA 1FD7D 1ONLA 5DM73 5C4HA 1N34Q 5I2XA 1AEXA 1Y1VB 4EQNA 3NSWA 1KDBA 1LTRD 4ULLA 2IPKD 2F3VA 1S5CD 1AN8A 4GN3B 1JR0D 5D14A 3CC7A 1K28A 2NVQH 5TSSA 1QZGA 2VB3X 1FGBD 3OWEB 5ELNA 1UE1A 4XYOA 1SFOB 1G6PA 2IX1A 1VCIA 4Y7NH 2HCCA 3NTHA 4HTHA 1EFWA 4N9TA 1G51A 2IWHA 1QVCA 3ERSX 3CW2C 3OIQA 1BF4A 1WTQA 3IRBA 1U4LA 5M5WB 2EQSA 5C3WA 4DV5Q 2E5LL 4OX9L 4EQPA 4DR1L 1O7LA 5I9PA 3A54A 3K6OA 1CZWA 2Z8LA 3D4RA 3F2CA 4ZYSA 1WCMG 1LTAD 4NW2A 3AB9A 2D0OA 1D6EC 1MGSA 2R7DA 1YJ9A 2D5DA 1PTOC 1YNJD 3OHXC 4LF7Q 3U9SA 1CFMA 4LF9Q 2VW9A 1HR0Q 4K0KL 1GHJA 4K5WA 5IYCG 1GD7A 1V1QA 1L0YB 1F2LA 1HA5A 4DNTB 4JK1C 3T1YL 1KQSA 2NTTA 4C3IB 2HT1A 1PMRA 2JA5H 4J6HA 3CCUA 3TN2A 1IBMQ 2XVSA 3HOYB 3HOVG 3JAME 3VR2A 4DV7L 4DK6C 3MFGA 4HJ8A 3CP0A 3H3VI 5L37A 4RWSC 3I73A 3J7YW 2UUBL 4O1NA 1YJWA 4KKTA 4ZK9B 4JI7L 1XNQQ 5T1GA 5IOCA 1HQRD 1QNUA 4X3UA 4LWCA 1H9KA 4HR7B 3CU7A 1NCVA 3HOXH 2F0VA 2JJQA 3A8JE 1AE2A 5EKLA 5IT9E 1TR5A 2IX0A 2X69A 2RCFA 4G57A 1DD2A 1HNZL 1SMYC 4A3KB 2K5VA 3T16A 1TT2A 2LS01 1Y1WB 2GN5A 1MD2D 1NSNS 4HSVA 3GTMH 3M7NA 2K5QA 4IUPA 2CW0D 5C44G 1B8AA 3OW2A 1QCBD 4GN4B 4ABNA 2QA4A 5C0XH 4JC0A 3ND8A 4B3SQ 4ZUIA 3T53B 3FEWX 4AIMA 1B53A 2Z4HA 2WB1B 2ZTDA 1A62A 4NXNQ 5AJ3Q 2R3ZA 4YHHL 3MTSA 1VQPA 4C56C 3T1HQ 2SDFA 4IFDI 1PLFA 1ZKOA 4DV3Q 4F8MA 5I4DA 4IFDG 5KIXA 1S4ZA 3I4OA 1LV9A 2BDNA 2KCCA 2LKVA 3MXUA 5C5LA 3NK9A 3H0GB 1AFPA 4ZKCB 3GTGH 3SHLA 4NXMQ 2XSCA 2B3GA 1X3PA 3TS2A 4WJ3M 3OWFA 1EY9A 3GTLH 2OTJA 3PO2B 1XMOL 3GV3A 3CD6A 4LFAQ 3ERQA 1QWYA 3E5SA 2R6GA 2VQEL 2BH2A 5C6AA 4JG2A 1CKMA 1C4QA 4RGMA 1MBYA 4BY1B 2CWAA 5HY6A 4PZ6A 2EY1A 4X3TA 1EUJA 4OHJA 2B2WC 3HOZB 1H9MA 1XMQL 3K7AH 2IJ0A 1DOKA 4KKSA 3FPPA 2WB1E 3W1GA 2OCEA 3LWUA 4A3GH 2EZVA 1S3OA 2R93G 3PUXA 4I65A 3FKIG 3AMUA 1IKMA 1EIFA 2CWPA 2E5LQ 4OX9Q 1K3BC 2I46A 4DR1Q 4JYAL 4O42A 3HKZB 2ES2A 2UXDL 2V4DA 3OIPA 3S16B 2BE5C 2Q8RE 3QIAA 1JICA 1X3EA 1LM0A 1LT3D 4K0KQ 5C4XB 4RHRA 1YJNA 2VUMG 1L2FA 4H7BA 5IP9H 4FNFA 1X55A 4JBMA 4Y52H 1AP0A 1JT8A 3U4VA 4V190 2I07B 1RL2A 1J9OA 4GS3A 4C3HG 3K8AA 2F0HA 2R92H 1O78A 2JA8H 2NVQB 1DYQA 1H9SB 4DV7Q 1TY0A 4KY7A 4Y7NB 2EPBA 1B50A 2UUBQ 4IOCA 4MTKA 1EEID 4JI7Q 3UDIA 4KY6A 3RNUA 2KOLA 1XPUA 2A69C 2L0CA 5DNFA 2A5HA 3HEJA 4GKJL 1D8LA 3KLWA 5G3LF 3Q24A 3HOWH 3F2BA 3DXJC 2EYLA 3NWSA 4HJAA 1VQLA 1IHZA 1STEA 2AMCB 1X3QA 3HKZE 1J6QA 1D5MC 4CHTB 4GKKL 1EY6A 2KHIA 1HNZQ 1NJIC 2NWGA 1IZ6A 4RCOA 1FNUA 4HN7A 3J81i 1FNWA 1PH9A 2RDGA 1VMPA 1DM0B 4KJOA 4DV2Q 2HHHL 3I4NG 1H9RA 1HZCA 4FO2A 1A8VA 1OXSC 5CV6A 4B3MQ 2EXDA 1C8CA 4DR6L 3I2ZA 2QDLA
chains in the Genus database with same CATH topology
3D4DA 2IW3A 5DM63 5CV9A 2JA5B 3DEOA 1TU2B 4Q5VA 3QB3A 2PW5A 1EQTA 3Q23A 5JJZA 2F1MA 3RLFA 1E0BA 2FFKB 1TS3A 5E4XA 4R8IA 1QNKA 1EFID 1PXUA 1IW7C 2M00A 2B39A 3HOXB 4CGYB 4IZ8A 1AZQA 4F7XA 2JYOA 4MN3A 4DAYA 2KCNA 1JOOA 1CA5A 2WIIB 4RGNA 2ICIA 5I2YA 3URYA 1KABA 3GTMB 4KD4A 3SDZA 1HQMC 4RA8A 5I6WA 1WTPA 1QILA 1G2SA 1Q12A 4IUUA 3F2UA 1ET6A 5EPJA 3HGBA 3VA5A 5CV4A 3H6MA 5EKKA 2KUMA 1L0XB 4QUFA 5K36G 4KN7C 2WACA 3SXHA 3SR1A 3GTGB 1ICWA 1STAA 2ID0A 5ELFA 5IGFA 3GTLB 1STYA 2EDGA 2DNEA 4B08A 2K28A 4XQNA 4M1UB 1KDAA 4QUCA 1EIHA 4IUTA 1GXDC 2HUGA 2ZT9C 3EFXD 2CQAA 4FXDA 2EJMA 3K7AB 1B9MA 3NHHA 4OO1H 4J8QA 1JE4A 3J80L 4BA2I 1TQOA 4KMUC 4A3GB 1EYCA 1G91A 5E3FA 2RKSA 4XXEA 1D5ZC 1LT6D 3VR5A 1KLGD 2Y0SB 4ZLTF 1I4RA 3HZXA 4IFDH 4OL7A 3IKJA 1V43A 3K5NA 3L9AX 4RKBA 4DAVA 3VA7A 2X6GA 5KEEA 1EY4A 4RH6A 2NN6I 1WD1A 4OGQC 1GUWA 1ESFA 5FO9B 2R92B 2NN6G 2JA8B 4DF7A 4DNRB 3EJIA 1PTOH 1FNVA 2SOBA 5DAUA 5IIFA 3I70A 5ELCA 1R4QB 5KYLA 2VXWA 2E76C 2K6AA 3HOWB 4IUVA 3J7AV 1STGA 3H94A 1NR4A 3T4AC 2PO4A 3D6CA 1TS4A 5ELBA 2K33A 1IYUA 4HMJA 4RAUC 2B2VC 2EYJA 5JEAG 3BZDB 4NMZA 3P1HA 5KNCA 5A2QL 2EY2A 1UAPA 2JA7B 2A6EC 1V1PA 5ISRA 4C3JG 2VNUD 3G7LA 1TKWB 1PZKD 4K5VA 4AYBB 3AU7A 3MA2B 3GTQB 1IL8A 3X3NA 2B2VA 5BN4A 1I6HB 2BDOA 2F0LA 4KHVA 5EBDA 4BWGB 1FYCA 4IN3A 4LAAA 3MEHA 5FOBB 3BG3A 4XIGS 1F9RA 3BYTB 4RHSA 2M9VA 4G7ZC 3VYUA 3NTIA 3R2TA 2AQ2B 3K5OA 2NZ1D 2E2JB 4L8JA 2PQEA 4HCSA 4K6DA 5I6YA 4QMGA 1ZYRD 3T13A 1STHA 1G8ZD 4PV1C 2F0QA 2A6HC 3QWNA 2KHSA 2HQEA 3R2IA 4IFDJ 2MHVA 5FK9C 4DK1A 1SYCA 2EYMA 1LTID 1GOZA 2K5WA 1EEFD 5HGTA 4E6IA 1GUNA 4I7ZC 5DEHA 3J80E 2DN8A 3OW7A 1I4GA 4PMCA 4B9XA 5C3EB 4A3IB 1XWEA 3BVZA 2AQ3B 1HFGA 5IGCA 2F4IA 3KBGA 3V2TA 1TWGB 4K2LA 1CHQD 1CHPD 1S5FD 3A7LA 1XX8A 4H0LC 1PYWD 5EPLA 1TVXA 1EY0A 4BY7B 4J1MA 1A2TA 3VYRA 1QG7A 2EJGC 3GD7A 1DJRD 1F77A 4KKUA 2NVYB 1IKLA 3I90A 4KN4C 5M3FB 3NXWA 2NB0A 1RDPD 1JORA 1KNEA 4BS9A 3QOLA 3GTPB 5EJWA 2A69D 2E74C 3LX0A 2Z4IA 4WFN3 1WTVA 3VYTA 1PTOB 3OMCA 3SEBA 3ND9A 3DWPA 1XTCD 2R61A 4K2KA 1BCPC 1R9TB 3N52A 3T51B 2F0JA 4DA2A 3S15B 3M3YB 1SJED 2Z1CA 3LWEA 3M85A 4C3IG 1HPCA 4QF4A 1LTGD 5LL6X 1RTOA 3FKIB 2LFNA 3S2HB 4A3FB 3J81L 4DFAA 3H91A 2K1BA 2MJ8A 1HUMA 1RD9D 1BOSA 4RGOS 1SNMA 3WOEA 2L4NA 1LABA 3HRZC 2H4OA 1XXGA 5M3MB 4TSSA 3BDCA 1SE3A 1IYVA 5CV5A 1Y8OB 2OXPA 4F87A 5JPMC 4K8IA 4QCLA 4S3SA 3I4LA 2O5JC 1YNND 2KJXA 3BDOA 2IX3A 3P20A 2PMZB 1ML0D 1K8MA 2EY5A 3RD4A 1BCPB 2L55A 2SNSA 3PUVA 5EBCA 1Q8IA 2OEOA 3E6ZX 4R8NA 3R93A 3S1NB 2B2WA 1HTPA 1PDQA 2F0WA 2QDBA 2DNCA 1YNJC 1JQYD 3D3RA 1U4MA 5JEAH 1CQFA 1G291 1OO9B 1SNQA 4XTCS 3DEPA 3O13A 3UI2A 1PRTC 2O5IC 4EQOA 2PZTA 3M4YA 3QJYA 5AFWA 3GTJB 4X3KA 1Q1BA 3NBIA 1C48A 3HOUB 5JPNC 2EXZA 4RGTA 1Q1EA 2LY7A 2RDFA 3TSSA 1CTMA 3R3OA 1H9JA 2PZWA 2TMPA 3CQZB 1EZ6A 1SSOA 3S1RB 3GTKB 4N9PA 4L6TB 2L9HA 4ZQ3A 3NQTA 4MIUA 2AWNA 3KF8A 3L7ZC 2CW0C 1W6KA 3KUPA 4WJWA 1M4VA 2RSNA 1VMCA 3MXNA 1B44D 2YYZA 2WKDA 3Q0AA 4A93B 1F9PA 4PQXA 3SE0A 3K5MA 2J4XA 3BS1A 2EYFA 2BCOA 1PRTB 1I4XA 3KLSA 1E2ZA 1TWHB 1KTKA 1A3VA 1LT4D 5CR3A 3TMEA 3S9WA 5KYIA 1ENCA 1U4RA 3NBHA 3S1QB 4K8JA 2RQXA 1ET9A 2Q8TA 1I4PA 4H44C 2L11A 2PNRC 3PIO3 4ILWA 2F0EA 4ZKBB 3X3MA 1LT5D 1VF7A 3J81E 1K83B 5KGUA 5EKIA 2FINB 1F2MA 1KLUD 1QE6A 1RKNA 2XWBB 1EIGA 5K5PA 1M8AA 2A6ED 4C1NK 2BOSA 1EL0A 3I91A 3QG1A 5JEAJ 3NQIA 3DUZA 4PMWA 1NUCA 1O7ZA 5IGDA 1Y8NB 3CRLC 2EJFC 4G7OC 2WAQB 4FP5D 5M5YB 5BN3A 3K59A 1WVLA 1MSHA 4QIWB 1XYIA 2DY8A 1A3TA 4KJNA 1HFNA 2F0MA 5D3DA 1ILQA 3SK5A 4EGVA 1SYBA 3OSOA 3EVQA 4YIJA 5CV8A 4FXGC 5M9OA 3A56A 1SXTA 3FVQA 2IL8A 5C0XI 2JA6B 3K58A 2H1EA 3TDQA 5C0XG 3L3OC 2NVXB 2BA1A 3A7AB 1BXTA 2JXMB 5KRUA 3VR6A 4R9WA 3MWYW 4V0BA 4ZAIA 1EZ8A 3I8ZA 2EVBA 5C4ZA 1LTSD 3IAYA 2SNMA 4HMIA 5E4WC 1DCZA 2K05A 5JAVA 1CA6A 1HCZA 1RTNA 4EVOA 1U4PA 3TP7A 4C3JB 2B63B 4JBWA 1EOTA 3MXGA 1SJHD 1Z6HA 3MXPA 2IT1A 3TP6A 1SDFA 1PTOD 4XDXA 5CBEE 3JAML 4WRDA 2F0PA 1K8OA 4FVMA 1E2VA 3V96A 2LMCB 3FRPB 4LK1C 2NYZD 1DONA 3DM1A 3D8GA 2K03A 1GUTA 2L12A 1W6JA 2O4XA 2AUKA 2A68C 2CHBD 2YU9B 1ENFA 2B2YC 3H09A 1HUNA 3A55A 3LNNA 1TWAB 1T5EA 1NR2A 2K04A 1QB5D 1AW7A 1JC7A 1U9RA 4OIKA 4CJ2C 2RBMA 5CMDA 1SMYD 1DZ1A 1EWHA 5C3XA 5JVH3 4KI0A 2B2YA 2QKIC 4CKBA 2J7ZA 1V1PB 3VYSA 1LACA 2FJ2A 1CI3M 1KAAA 1BCPD 2WP8J 2PPBC 2XWJB 2E2HB 2D62A 1HHVA 1D5XC 1GUSA 1WCMB 2EYOA 5FO8B 2G9DA 3MZ5A 1SYFA 3BVMA 3KLRA 4U673 3K5LA 2BA0A 5IGBA 1EU4A 3TP8A 2AWOA 3SVMA 3MHBA 4XYQA 2C5CA 3BVGA 1BUVT 2B2TC 2ENBA 2KVMA 1GUOA 3EA6A 3HOVB 2QCPX 5IGEA 4DGZA 1LO5D 4MHEA 1LLRD 4LJZC 3RMHA 2KQ3A 5CV7A 2EYHA 3ITPA 1PFNA 1EWCA 2ZXPA 4B9WA 2HDLA 4XT3B 5BN5A 5FKAC 2B2TA 1Z7TA 3DWAA 5C4JB 4FF1A 3J7AF 1HRJA 2XNAC 4CKCA 4NKLA 4DK0A 4M8AA 5C44B 2BE5D 4KY5A 1ZEQX 2KECA 3ONAB 1D1KA 5D3IB 1A15A 2HCIA 2JP1A 1QJOA 1Q3LA 2PW7A 2F0NA 5IGGA 1G2TA 1I3QB 4NDXA 3PUYA 1EYDA 5K36H 1GJXA 1PRTD 4RFBA 1I50B 5JVG3 2F0UA 4FF2A 3WDNA 3G6JB 4RKLA 3CHBD 2M2LA 4BBSB 3U9OA 1B3AA 3MFYA 1ILPA 1RHPA 4TQUS 1QOHA 4H13C 1NAPA 1B2TA 1JOKA 4DXFA 4A3MB 1S5ED 4IUQA 1TIID 2WINB 2ZXRA 4DU9A 1HTLD 2G9HD 5A2QE 3ZYYX 4OO1I 1ENAA 2E2DC 3GO5A 1ZXTA 4OO1G 3IFTA 4KTAA 1CQVA 1I6VC 2OT2A 2N88A 2L1BA 4ZUJA 2XRSD 2R93B 3PMFA 2MPMA 1II3A 4PNYA 1V8QA 1WD0A 3S2DB 3HS0C 2F0FA 1T5XD 1X32A 3SK4A 4NP5A 4UDUC 3TP5A 4ZRZA 2HDMA 3A8KE 1BBXC 1ZYRC 1IW7D 3N6RA 2VUMB 1Y8PB 1BQQT 3R8BA 1HXYD 3GP7A 1D2BA 1PTOF 4IQZA 3KK7A 4C3HB 2NBFA 1JB3A 1TY2A 4QB4A 2NN6H 3MVVA 1BDOA 4FF3A 1S5DD 2B8GA 2D2CC 1SNOA 2C9OA 3A8IE 2RDHA 5KNBA 3K0YA 4K5XA 2NTSA 1EY7A 5E1FA 4P2CB 1A2UA 1HA6A 1JCKB 5HURA 1J8IA 3FMCA 4ME5A 1Y69U 3NE5B 1B1ZA 3BDLA 1H9SA 3I4NB 3RUZA 1LTBD 2AUJD 3BYYB 1TWFB 3E0JA 2F0GA 5J39A 1CK1A 2E75C 2FMMA 1MI2A 3NUCA 1RJTA 4F88A 1BO0A 1SE4A 4A3BB 4IALA 2PZUA 1VDZA 3QOJA 1BCPF 2R7ZB 3M4OB 2F0IA 3HG9A 5ELDA 4HCEA 5EQ0A 2PYKA 2JEBI 1D1IA 2KEDA 4Z9CB 2ICEC 2WKCA 5FO7B 3I3CA 1BNZA 1EU3A 1CM9A 2K7VA 3D4WA 4KD3A 2OF1A 1SNPA 1TS5A 2F0OA 2N55A 5F2DA 4ODGA 4FYDA 3DWQA 4KK7A 2A74C 3NP8A 3EQLC 5T1IA 3IFDA 1PFBA 5C0XJ 1E2WA 1SYDA 4WORA 1SE2A 1DOLA 3TBIB 3D31A 1TWCB 5JOBA 4RCNA 1RODA 5IODA 3HP3A 4U68A 2MP1A 1EYAA 2SEBD 2K5DA 2F03A 2JSOA 2MGSA 1SNCA 4KV6A 3PO3B 5D65A 2Q8IB 4CBVA 3Q6SA 2KEEA 5KNDA 1WTXA 4Q0FA 1Q90A 3S17B 3PUZA 2F3WA 3GV6A 3FPUB 5LHY1 3OPOA 3WOFA 4CJ1B 3C1FA 2X6LA 2RSOA 2QILA 4KHZA 2K32A 1G6ZA 1YNNC 3PV0A 1WTRA 3M7GA 2A68D 3SK6A 1A6XA 1PRTF 4X3SA 4BBRB 3V05A 2EY6A 4FXKC 3W2DA 5CYUA 5J22A 4LMQD 4C1NI 2J0TD 1F9QA 3MAQA 5CBAE 5FLXL 3Q22A 3S1MB 2AQ1B 5CC4A 2F0KA 3K57A 1SBBB 5I9OA 4TKOB 2QEJC 4DAPA 3DHQA 5NUCA 1UEAB 5A35A 1CZGA 1KDCA 1RF2D 2GA4B 2L5TA 2JE6I 2TSSA 2NUCA 1EY5A 2JEAI 1I4HA 3IL8A 4OIJA 4A3EB 5EGTA 2XN9C 2F0SA 2A73B 4G7HC 4FF4A 1O80A 2NVTB 4ID6A 3TZDA 4K14A 2XRQD 2FHTA 2A6HD 3CKIB 4PMBA 3C2PA 4DXGA 1A3UA 3P7JA 5CORA 1EQVA 2FMCA 2D9UA 1FR3A 2EE1A 3C3LA 4XT1B 1ESRA 1UNSA 1STNA 1EY8A 4CJ0B 1DOMA 4DN4M 1LTTD 4HAEA 3OOCA 1F2YA 1MSGA 1WTOA 4XQJA 4IURA 2DY7A 1SEBD 1KNAA 3OMGA 3TZUA 3GQBA 2B2UC 3SK8A 1OXVA 2RA4A 1GUGA 4G4KA 1V1OA 3KBXA 3I72A 3QO2A 3VR3A 3RZDB 1GHKA 2PCFB 3FDTA 1OXTA 3P75A 4IUNA 1SYEA 3DMUA 5C5MA 2B8FA 5J1ZA 3S14B 2KA7A 2VB2X 2RVLA 4GZYC 1AZPA 3MC0B 3I4MB 4HEDA 2CVRA 2B2UA 1F2ZA 1OXXK 5IT9L 1JOQA 2QF7A 4BA1I 1SAPA 1CT1D 5EPKA 1B4OA 3VR4A 4HSPA 3GTOB 1PZJD 4XQQA 3PIP3 2F0TA 1JWMD 5CGKA 2F0DA 2EYPA 3KLSX 1I4QA 2MUYA 2ZXOA 4TRDA 1R4PB 2EOTA 1JWSD 4C2MB 3D6WA 2K01A 5M5XB 3PUWA 5COYA 3NWTA 2E2IB 1F9SA 4CKEA 1SNDA 1JWUD 1B9NA 3EROA 3CRKC 1PFMA 1PZID 1TS2A 3C1EA 1RCVD 1Z47A 4K6LA 3H3VC 3RZOB 2WV6D 2O2LD 4UAIA 1WTWA 3NPPA 1VF5C 1O7YA 1SYGA 4L63B 5ELEA 4A3JB 3W3AA 5FLXE 1S5BD 5LL6S 5G3LD 1UUPA 1STBA 1BR9A 2XIWA 3T56B 3C46A 4A3DB 1OXUA 3NTKA 1DXMA 1FD7D 1ONLA 5DM73 5C4HA 5I2XA 1AEXA 1Y1VB 4EQNA 3NSWA 1KDBA 1LTRD 4ULLA 2IPKD 2F3VA 1S5CD 1AN8A 1JR0D 5D14A 5TSSA 2VB3X 1FGBD 3OWEB 1SFOB 4XYOA 2IX1A 1VCIA 2HCCA 3NTHA 4HTHA 4N9TA 2IWHA 3OIQA 1BF4A 1WTQA 1U4LA 5M5WB 5C3WA 4EQPA 1O7LA 5I9PA 3A54A 3K6OA 1CZWA 2Z8LA 3D4RA 4ZYSA 1LTAD 4NW2A 3AB9A 1D6EC 1MGSA 2D5DA 1PTOC 1YNJD 3OHXC 3U9SA 1CFMA 1GHJA 4K5WA 1L0YB 1F2LA 1HA5A 4DNTB 4JK1C 2NTTA 4C3IB 1PMRA 4J6HA 3TN2A 2XVSA 3HOYB 3JAME 3VR2A 3MFGA 4RWSC 3I73A 3J7YW 4O1NA 4KKTA 4ZK9B 5T1GA 5IOCA 1HQRD 1QNUA 4X3UA 1H9KA 4HR7B 3CU7A 1NCVA 2F0VA 3A8JE 5EKLA 5IT9E 1TR5A 2IX0A 2X69A 4G57A 1DD2A 1SMYC 4A3KB 3T16A 1TT2A 2LS01 1Y1WB 1MD2D 1NSNS 4HSVA 3M7NA 2K5QA 4IUPA 2CW0D 1QCBD 4ABNA 5C0XH 3ND8A 4ZUIA 3T53B 3FEWX 1B53A 2Z4HA 2WB1B 2R3ZA 3MTSA 4C56C 2SDFA 4IFDI 1PLFA 1ZKOA 4F8MA 5I4DA 4IFDG 5KIXA 1S4ZA 1LV9A 2BDNA 2KCCA 2LKVA 3MXUA 5C5LA 3NK9A 3H0GB 1AFPA 4ZKCB 3SHLA 2XSCA 1X3PA 3OWFA 1EY9A 3PO2B 3GV3A 3ERQA 1QWYA 3E5SA 2R6GA 5C6AA 1C4QA 4RGMA 1MBYA 4BY1B 4X3TA 2EY1A 4OHJA 2B2WC 3HOZB 1H9MA 2IJ0A 1DOKA 4KKSA 3FPPA 3LWUA 2EZVA 3PUXA 4I65A 3AMUA 1IKMA 2I46A 4O42A 3HKZB 2V4DA 3OIPA 3S16B 2BE5C 2Q8RE 3QIAA 1JICA 1LT3D 5C4XB 4RHRA 4H7BA 4FNFA 1AP0A 4V190 2I07B 1J9OA 4C3HG 2F0HA 2NVQB 1O78A 1DYQA 1H9SB 1TY0A 4KY7A 4Y7NB 2EPBA 1B50A 1EEID 4KY6A 2KOLA 2A69C 2L0CA 5DNFA 2A5HA 3HEJA 5G3LF 3Q24A 3DXJC 2EYLA 3NWSA 1IHZA 1STEA 4CHTB 1X3QA 1D5MC 1EY6A 2NWGA 4RCOA 1FNUA 4HN7A 1FNWA 2RDGA 1VMPA 1DM0B 4KJOA 1H9RA 4FO2A 1OXSC 5CV6A 1C8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F88 A;  4ZRZ A;  4F87 A; 
#chains in the Genus database with same CATH topology
 3D4D A;  2JA7 H;  1NMG A;  2IW3 A;  1NBW A;  1VQC A;  5DM6 3;  4GNX C;  5CV9 A;  2JA5 B;  4YHH Q;  3DEO A;  1TU2 B;  4Q5V A;  1NNX A;  3QB3 A;  2PW5 A;  4A3B G;  1EQT A;  2RF4 A;  3GTQ H;  3Q23 A;  5JJZ A;  1Y14 B;  2F1M A;  3RLF A;  1E0B A;  2FFK B;  1TS3 A;  5E4X A;  4R8I A;  1QNK A;  1XJV A;  2N8N A;  1I6H H;  1EFI D;  1KIX A;  4P72 A;  1PXU A;  1IW7 C;  3PQI A;  1SE8 A;  3UE1 A;  2M00 A;  1MIU A;  3KJP A;  5HGQ A;  2B39 A;  1XMO Q;  3HOX B;  4CGY B;  4IZ8 A;  1AZQ A;  5ELO A;  4F7X A;  2VQE Q;  2JYO A;  4P71 A;  4MN3 A;  4DAY A;  2KCN A;  1JOO A;  2I0Q A;  1CA5 A;  2WII B;  4RGN A;  2ICI A;  5I2Y A;  3URY A;  1HNX L;  1KAB A;  4N8X 1;  3GTM B;  4GLA C;  3UDG A;  4JPB W;  4KD4 A;  3SDZ A;  2E2J H;  1HQM C;  4RA8 A;  5I6W A;  3OTO L;  2YTX A;  5DLQ E;  1WTP A;  1XMQ Q;  1QIL A;  1G2S A;  1Q12 A;  4IUU A;  4LFC L;  3F2U A;  1ET6 A;  5EPJ A;  1VQD A;  3HGB A;  3VA5 A;  3STB C;  4JW0 A;  5CV4 A;  3H6M A;  2OTL A;  4OWT B;  5EKK A;  2KUM A;  1L0X B;  4QUF A;  5K36 G;  4KN7 C;  2UXD Q;  2WAC A;  3SXH A;  4DV4 Q;  3SR1 A;  3GTG B;  1ICW A;  1STA A;  1N32 L;  2ID0 A;  5ELF A;  1HZB A;  3HKS A;  3ULL A;  5IGF A;  3GTL B;  2AHO B;  3PO3 G;  1STY A;  2EDG A;  3JC6 6;  4DR7 L;  2DNE A;  4B08 A;  2K28 A;  3H3V H;  4XQN A;  4GLV B;  4M1U B;  1KDA A;  4QUC A;  1EIH A;  4IUT A;  1S72 A;  1Q46 A;  5C3E H;  4A3I H;  1GXD C;  1YIT A;  2HUG A;  2ZT9 C;  3EFX D;  2K5N A;  1TWG H;  5GQO A;  2CH4 A;  2CQA A;  4A4I A;  4FXD A;  1U0L A;  2EJM A;  3K7A B;  1B9M A;  3NHH A;  4LF8 L;  4OO1 H;  1JB7 A;  4J8Q A;  1N36 L;  1JE4 A;  3J80 L;  4BA2 I;  1TQO A;  4KMU C;  4BBR G;  1IYJ B;  4IPG A;  4A3G B;  3G6E A;  1EYC A;  1G91 A;  2MO1 A;  5E3F A;  3AYH B;  4OON A;  2RKS A;  4XXE A;  4GKJ Q;  1D5Z C;  1VQA A;  1LT6 D;  3NEL A;  4BY7 H;  4DUZ L;  3VR5 A;  1KLG D;  2JQO A;  2Y0S B;  3RN5 A;  4ZLT F;  1I4R A;  4UP7 A;  3HZX A;  4IFD H;  4OL7 A;  3IKJ A;  1V43 A;  2HHH Q;  2NVY H;  3BJU A;  4DR5 L;  3K5N A;  2HD3 A;  3L9A X;  1B7Y B;  4RKB A;  5LMN W;  4DAV A;  3VA7 A;  2X6G A;  4R4Q A;  5KEE A;  5M3F H;  1C0A A;  1EY4 A;  4YCV A;  2OWO A;  4RH6 A;  2NN6 I;  2YTY A;  1WD1 A;  4R4I A;  4OGQ C;  1MJC A;  1GUW A;  1ESF A;  5FO9 B;  2R92 B;  2NN6 G;  3GTP H;  5FLX c;  2JA8 B;  2P5Z X;  4DF7 A;  4DNR B;  3EJI A;  3A74 A;  3FHW A;  1PTO H;  1FNV A;  2SOB A;  5DAU A;  1B3Q A;  5IIF A;  4A3E G;  4HIO A;  2F4V L;  3I70 A;  5ELC A;  1DGS A;  1R4Q B;  1R9T H;  4HIM A;  2K5H A;  5KYL A;  2VXW A;  2E76 C;  2K6A A;  3HOW B;  4IUV A;  3J7A V;  1CKN A;  3S15 H;  1STG A;  3M3Y H;  2VZA A;  1P16 A;  1NR4 A;  3H94 A;  3T4A C;  2PO4 A;  2Y0S E;  3D6C A;  1TS4 A;  5ELB A;  2K33 A;  4DNI A;  3S2H H;  3FKI H;  1IYU A;  4A3F H;  4HMJ A;  4RAU C;  2B2V C;  1HNX Q;  2EYJ A;  5JEA G;  3BZD B;  1KRS A;  1EQQ A;  4NMZ A;  3P1H A;  5KNC A;  5A2Q L;  1VS0 A;  2EY2 A;  1UAP A;  2JA7 B;  2A6E C;  1V1P A;  4LFC Q;  5ISR A;  4JI3 L;  4C3J G;  2VNU D;  2B63 G;  1UE6 A;  5M3M H;  4BXX G;  3G7L A;  1TKW B;  2KEN A;  1K0S A;  1PZK D;  4BY1 H;  1CKN B;  4K5V A;  3UE0 A;  4AYB B;  3AU7 A;  3MA2 B;  3GTQ B;  2ZJQ A;  3KDF B;  1IL8 A;  2PNH A;  3X3N A;  2B2V A;  5BN4 A;  3B6Y A;  2YTV A;  4PZ8 A;  4B3S L;  2LXK A;  1I6H B;  1XNR L;  1N32 Q;  2BDO A;  2F0L A;  4KHV A;  5EBD A;  4BWG B;  3EN2 A;  1P8L A;  1FYC A;  3PIP A;  4IN3 A;  4LAA A;  3MEH A;  5FOB B;  3BG3 A;  4JVZ A;  4DR7 Q;  4XIG S;  4LF6 L;  3HFZ B;  1F9R A;  3BYT B;  3I4M G;  1CUK A;  4RHS A;  5FLM H;  2M9V A;  4G7Z C;  3VYU A;  2ASB A;  3NTI A;  3R2T A;  2D0P A;  5IP7 H;  4CDF C;  4DV0 L;  3S1N H;  3WWV A;  2AQ2 B;  3CPF A;  3E9H A;  2QEX A;  3K5O A;  4JI6 L;  4HJ5 A;  2NZ1 D;  2E2J B;  4L8J A;  1GKH A;  2PQE A;  4HCS A;  4K6D A;  2K75 A;  5I6Y A;  4QL5 A;  4LF8 Q;  4UHV A;  4QMG A;  1ZYR D;  1N36 Q;  3T13 A;  1STH A;  1G8Z D;  4PV1 C;  2F0Q A;  5IT9 c;  3E0E A;  2A6H C;  4APV A;  3QWN A;  2KHS A;  5IYB H;  1E1T A;  2JK8 A;  5GRO A;  2HQE A;  4AYB E;  3ER0 A;  3R2I A;  4IFD J;  2MHV A;  1E1O A;  4DUZ Q;  1UE5 A;  5FK9 C;  4DK1 A;  3GTJ H;  1SYC A;  2EYM A;  1LTI D;  3HOU H;  3AFP A;  3CCR A;  4YCU A;  1GOZ A;  2K5W A;  1EEF D;  5HGT A;  4E6I A;  4DR5 Q;  1GUN A;  4I7Z C;  5DEH A;  2A8V A;  3J80 E;  3QR8 A;  2ZM6 L;  2DN8 A;  3OW7 A;  1OTC A;  1I4G A;  1VQG A;  4PMC A;  4B9X A;  4X66 Q;  1XWE A;  5C3E B;  4A3I B;  3BVZ A;  1Q81 C;  1PH5 A;  3CQZ H;  2AQ3 B;  1HFG A;  1HZ9 A;  5IGC A;  1V9P A;  3S1R H;  4YWL A;  3GTK H;  1VQF A;  2F4I A;  3KBG A;  3V2T A;  1TWG B;  4HJ7 A;  4K2L A;  1CHQ D;  1CHP D;  1PH3 A;  1S5F D;  3A7L A;  2F4V Q;  1XX8 A;  3TRZ A;  1WI5 A;  4A3D G;  4A93 H;  4H0L C;  1M1K C;  1PYW D;  1VQ4 A;  5EPL A;  2DUD A;  1TVX A;  2KHJ A;  1EY0 A;  4BY7 B;  4J1M A;  1A2T A;  3VYR A;  1QG7 A;  1Y1V G;  2EJG C;  3GD7 A;  5GAD C;  1I94 L;  1DJR D;  1YZ6 A;  4JOI C;  1F77 A;  1TWH H;  4KKU A;  1K3R A;  2NZH A;  4TVA B;  2NVY B;  2N3S A;  3PGZ A;  3E3X A;  1IKL A;  3S1Q H;  3I90 A;  1IBL L;  3J81 j;  4KN4 C;  1HZA A;  2K50 A;  4JI3 Q;  5M3F B;  3NXW A;  3F2D A;  2NB0 A;  1RDP D;  1GM5 A;  1KL9 A;  1JOR A;  1KNE A;  4BS9 A;  3QOL A;  3GTP B;  5EJW A;  2A69 D;  1SRO A;  2E74 C;  3LX0 A;  2Z4I A;  4DV2 L;  4WFN 3;  1WTV A;  4JOI A;  3VYT A;  1PTO B;  3OMC A;  3SEB A;  4B3M L;  1K83 H;  3ND9 A;  1H95 A;  4HJ9 A;  1XNR Q;  3DWP A;  1XTC D;  1VQH A;  4LW1 A;  4OXP A;  2R61 A;  4CDD C;  4KHP Q;  2Z6K C;  4K2K A;  1BCP C;  1R9T B;  3N52 A;  3T51 B;  2F0J A;  4DA2 A;  4LF6 Q;  3S15 B;  3M3Y B;  4GOP C;  1SJE D;  2Z1C A;  3LWE A;  3M85 A;  4JI8 Q;  4C3I G;  1HPC A;  4QF4 A;  1LTG D;  5LL6 X;  1RTO A;  3FKI B;  2LFN A;  4DV0 Q;  4A3F B;  1PH6 A;  3S2H B;  1QUQ A;  3HOY G;  3J81 L;  4JI6 Q;  4DFA A;  5LMN Q;  3H91 A;  4BBS G;  5JJK A;  4IJL A;  2PQA A;  2K1B A;  1VQO A;  3I56 A;  2MJ8 A;  1HUM A;  1RD9 D;  4AH6 A;  1BOS A;  3M4Q A;  4RGO S;  1SNM A;  3WOE A;  2L4N A;  2Z6K A;  1LAB A;  3HRZ C;  2H4O A;  5M5Y H;  1XXG A;  5M3M B;  4TSS A;  1QVF A;  3BDC A;  1SE3 A;  1IYV A;  4A3M G;  5CV5 A;  4GOP A;  1Y8O B;  2OXP A;  4F87 A;  5JPM C;  3CAM A;  1PA6 A;  1A0I A;  1YHA A;  4K8I A;  3TEH B;  5IY0 A;  4S3S A;  4QCL A;  4A3K G;  5IYD G;  3I4L A;  2O5J C;  1VQ5 A;  1WTH A;  1Y1W G;  1NMF A;  1YNN D;  2KJX A;  3BDO A;  2IX3 A;  3P20 A;  1JJC B;  2QGQ A;  2MNA A;  4EQ5 A;  1WYD A;  2JA6 H;  2PMZ B;  1X6O A;  1X9N A;  1ML0 D;  1K8M A;  2NVX H;  2EY5 A;  3RD4 A;  1BCP B;  2L55 A;  2SNS A;  3PUV A;  5EBC A;  2ZM6 Q;  1Q8I A;  2OEO A;  3E6Z X;  2WB1 G;  4R8N A;  4DV4 L;  3R93 A;  3S1N B;  3UDX A;  3ICE A;  4JI5 Q;  2B2W A;  1HTP A;  1PDQ A;  2KCM A;  2F0W A;  2QDB A;  4UP8 A;  2DNC A;  1YNJ C;  3H0G G;  4JI1 L;  4GLX A;  1JQY D;  4QQB X;  1O7I A;  3D3R A;  1U4M A;  5JEA H;  1CQF A;  4JBK A;  1BBW A;  1G29 1;  1OO9 B;  4R4T A;  1SNQ A;  3PO2 G;  4XTC S;  3DEP A;  4JCV E;  3O13 A;  3UI2 A;  1PRT C;  2O5I C;  1SRU A;  4C3J H;  4EQO A;  2B63 H;  2PZT A;  3M4Y A;  3QJY A;  1I94 Q;  5AFW A;  3GTJ B;  4X3K A;  1Q1B A;  3NBI A;  5GAH C;  3F8T A;  1C48 A;  3HOU B;  5JPN C;  2EXZ A;  1HJP A;  4RGT A;  3HOZ G;  1Q1E A;  2LY7 A;  1WOC A;  2I5L X;  2PMZ E;  2RDF A;  3TSS A;  1CTM A;  1IBL Q;  3R3O A;  1H9J A;  2PZW A;  2TMP A;  5FJ8 G;  5EAY A;  3CC2 A;  4NB3 A;  3CQZ B;  1EZ6 A;  1SSO A;  3S1R B;  1PH4 A;  3GTK B;  4N9P A;  4L6T B;  2L9H A;  1PFS A;  4ZQ3 A;  3NQT A;  4MIU A;  2AWN A;  3KF8 A;  3L7Z C;  1WJJ A;  2CW0 C;  1W6K A;  2UUA L;  3KUP A;  4EX5 A;  4WJW A;  5LMU L;  2YU9 H;  1M4V A;  2RSN A;  1VMC A;  3MXN A;  1JJ2 A;  2CKZ B;  1B44 D;  2YYZ A;  2WKD A;  1TWA H;  3Q0A A;  4A93 B;  1F9P A;  4PQX A;  3SE0 A;  3K5M A;  2VS1 A;  2J4X A;  3BS1 A;  2EYF A;  2BCO A;  1PRT B;  3U4Z A;  1I4X A;  1Z9F A;  3KLS A;  1E2Z A;  2R7Z G;  3H15 A;  1TWH B;  5BR8 L;  1YHQ A;  1KTK A;  1C9O A;  1A3V A;  1LT4 D;  5CR3 A;  2N78 A;  3SGI A;  3TME A;  4P74 A;  3S9W A;  3RLN A;  5KYI A;  2Z9H A;  1ENC A;  1U4R A;  3D0F A;  3NBH A;  3S1Q B;  4K8J A;  2RQX A;  1ET9 A;  2Q8T A;  4NPS A;  4GNX A;  1LTL A;  1I4P A;  4H44 C;  4FDB A;  4QY7 A;  2L11 A;  1PH1 A;  2ALY B;  2PNR C;  3PIO 3;  4ILW A;  2F0E A;  2E2H H;  3I55 A;  4ZKB B;  3X3M A;  1WCM H;  1LT5 D;  1VF7 A;  3J81 E;  1K83 B;  5KGU A;  5EKI A;  2Q2U A;  2FIN B;  4IPH A;  1F2M A;  1KLU D;  1QE6 A;  5IYC H;  1YNX A;  2UXB Q;  4GNX B;  1RKN A;  2XWB B;  1EIG A;  4DAY B;  5K5P A;  4PG3 A;  1M8A A;  2A6E D;  2JA5 G;  2C35 B;  4C1N K;  2BOS A;  1EL0 A;  3I91 A;  4YWM A;  1HR0 W;  3QG1 A;  3NEN A;  3HOV H;  5JEA J;  2KBN A;  3NQI A;  3DUZ A;  4PMW A;  4JI1 Q;  1KC8 C;  5IE8 A;  1NUC A;  1O7Z A;  5IGD A;  1Y8N B;  3CRL C;  2EJF C;  4G7O C;  2WAQ B;  4LF5 L;  4FP5 D;  3PF4 A;  5M5Y B;  3J7A 5;  1FVI A;  5BN3 A;  3K59 A;  1WVL A;  4DR3 L;  1MSH A;  4QIW B;  3HOX G;  1XYI A;  2DY8 A;  1A3T A;  4GN5 A;  4KJN A;  4N8F A;  2F0M A;  5D3D A;  3G71 A;  4POF A;  1HFN A;  1ILQ A;  3SK5 A;  4EGV A;  1IL2 A;  3PCO B;  4P73 A;  1SYB A;  5C4J H;  1QVG A;  2UUC Q;  4X62 L;  3PSI A;  3OSO A;  3EVQ A;  3U58 A;  1FJG Q;  4YIJ A;  5CV8 A;  4FXG C;  5M9O A;  1TXY A;  3A56 A;  2IY5 B;  1SXT A;  3FVQ A;  2IL8 A;  5C0X I;  5C44 H;  2JA6 B;  3K58 A;  2VQF Q;  2H1E A;  3TDQ A;  1FGU A;  1LYL A;  3L3O C;  5C0X G;  2NVX B;  1FL0 A;  2BA1 A;  3A7A B;  1BXT A;  2JXM B;  2Q2H A;  5KRU A;  3VR6 A;  4R9W A;  4RMF A;  1I3Q H;  1X54 A;  1NTG A;  3MWY W;  4V0B A;  4ZAI A;  1EZ8 A;  3I8Z A;  1HNW Q;  4LFB L;  2EVB A;  5C4Z A;  1LTS D;  1IXR A;  4UPA A;  1I50 H;  3IAY A;  2SNM A;  1IBK L;  4R4O A;  4HMI A;  5GAE C;  2Q2I A;  5E4W C;  2UUA Q;  1DCZ A;  2L15 A;  2WAQ E;  5LMU Q;  2K05 A;  5JAV A;  1EQR A;  4X66 L;  1K8G A;  4B3R L;  1AE3 A;  1K0R A;  4BBS H;  4QIW E;  1CA6 A;  1HCZ A;  1RTN A;  4EVO A;  1U4P A;  1NE3 A;  3TP7 A;  1SN8 A;  4C3J B;  2B63 B;  4JI0 L;  4JBW A;  1Q86 C;  4IOA A;  1EOT A;  3MXG A;  1SJH D;  1Z6H A;  1PH2 A;  5BR8 Q;  4DKA C;  4A3M H;  1X3F A;  3MXP A;  2IT1 A;  3TP6 A;  1SDF A;  4OEL B;  2A19 A;  1PTO D;  4XDX A;  5CBE E;  3JAM L;  4WRD A;  2UXC Q;  2F0P A;  1K8O A;  3M9B A;  4FVM A;  1E2V A;  1EYG A;  1KHI A;  2PI2 A;  3V96 A;  4RG1 A;  4A3G G;  2LMC B;  3FRP B;  4LK1 C;  2NYZ D;  2R93 H;  1DON A;  2LXJ A;  3DM1 A;  4QJF A;  3BZC A;  3GDE A;  2DGY A;  3K81 C;  3D8G A;  4DPG A;  1J5E L;  2UU9 Q;  2K03 A;  1YI2 A;  1GUT A;  1YIJ A;  2L12 A;  2CCZ A;  3S2D H;  1W6J A;  2Y0S G;  2O4X A;  2AUK A;  2N49 A;  2A68 C;  1K8A C;  3L0O A;  4AQY Q;  3J80 c;  4DV1 L;  3CMA A;  1CKO A;  2CHB D;  2YU9 B;  1ENF A;  2B2Y C;  1K9M C;  3H09 A;  3MEF A;  1HUN A;  3A55 A;  3LNN A;  1TWA B;  1T9H A;  1JMC A;  2VUM H;  1MKH A;  1PYS B;  5IP9 G;  2DJG C;  4DR4 L;  1T5E A;  2HQL A;  1NR2 A;  2K04 A;  1QB5 D;  1AW7 A;  1JC7 A;  2ZTE A;  4OWX B;  1U9R A;  4C3H H;  4OIK A;  4CJ2 C;  2I5H A;  2RBM A;  5CMD A;  3CCV A;  1SMY D;  3CF5 A;  2JA8 G;  2R92 G;  1DZ1 A;  3CCL A;  1EWH A;  4KHP L;  5C3X A;  3BZK A;  4JI4 Q;  2GVB A;  5JVH 3;  4KI0 A;  1BVS A;  2B2Y A;  2QKI C;  4CKB A;  2J7Z A;  1V1P B;  4QGU A;  3VYS A;  2RCN A;  1A63 A;  4LF5 Q;  1LAC A;  2FJ2 A;  4JI8 L;  4DR3 Q;  1CI3 M;  3KYH C;  1KAA A;  1BCP D;  3HOW G;  2WP8 J;  2PPB C;  2XWJ B;  2E2H B;  3BU2 A;  2D62 A;  2HIV A;  5LMN L;  1HHV A;  1D5X C;  1GUS A;  1WCM B;  2EYO A;  5FO8 B;  1PYB A;  4DAM A;  1XTD A;  2G9D A;  1VQ9 A;  3MZ5 A;  4X62 Q;  1SYF A;  3BVM A;  3KLR A;  4U67 3;  3K5L A;  2BA0 A;  3CME A;  3AEV A;  5IGB A;  3TRE A;  3LGJ A;  4YWK A;  3I4N H;  2ZJP A;  1EU4 A;  3TP8 A;  2AWO A;  1TWF H;  3SVM A;  1BKB A;  3MHB A;  4XYQ A;  2C5C A;  2PI2 E;  3BVG A;  2ATW A;  3A5Z B;  1BUV T;  5GAG C;  2B2T C;  2ENB A;  4DK3 C;  2KVM A;  4AYB G;  1GUO A;  3EA6 A;  4UP9 A;  1VQK A;  4YCW A;  4A3B H;  4LFB Q;  3HOV B;  2QCP X;  5IGE A;  1PHJ A;  4DGZ A;  1E22 A;  3PF5 A;  3JAM i;  1LO5 D;  1IBK Q;  2R7Z H;  4JV5 Q;  3M4O H;  4MHE A;  1LLR D;  3CCQ A;  4LJZ C;  3RMH A;  2KQ3 A;  4B3R Q;  5CV7 A;  2EYH A;  3ITP A;  1I5F A;  1XPR A;  3W1B A;  1PFN A;  3KF6 A;  1EWC A;  3KOJ A;  4A3L G;  1E24 A;  2ZXP A;  4B9W A;  3L2P A;  1YVC A;  4JI5 L;  2HDL A;  4XT3 B;  5BN5 A;  5FKA C;  3RR5 A;  2B2T A;  4P75 A;  4DR2 L;  3DLL A;  4JI0 Q;  1Z7T A;  2NZO A;  1L1O C;  4A3J G;  3DWA A;  5C4J B;  4FF1 A;  3J7A F;  1HRJ A;  2OQ0 A;  1JJG A;  2XNA C;  4CKC A;  4NKL A;  4DK0 A;  4X65 Q;  4M8A A;  5C44 B;  2BE5 D;  4KY5 A;  1ZEQ X;  2KEC A;  3ONA B;  1D1K A;  5D3I B;  1A15 A;  2HCI A;  2JP1 A;  1QJO A;  1Q3L A;  2PW7 A;  2F0N A;  5IGG A;  1G2T A;  4LNQ A;  1I3Q B;  4J15 A;  3KF6 B;  2CQO A;  4NDX A;  3PUY A;  1TWC H;  1L1O A;  1EYD A;  2JN4 A;  1J5E Q;  5K36 H;  4MNO A;  4HIK A;  1GJX A;  1PRT D;  4RFB A;  1I50 B;  1GO3 E;  5JVG 3;  4LF4 L;  2F0U A;  4FF2 A;  1ASY A;  3RLO A;  3WDN A;  4DV1 Q;  3G6J B;  3DM3 A;  4RKL A;  3OYY A;  3CHB D;  2M2L A;  4BBS B;  1U5K A;  3PO3 H;  2MQH A;  3U9O A;  3KJO A;  1B3A A;  3MFY A;  1ILP A;  1RHP A;  4DR4 Q;  5C3E G;  4TQU S;  4A3I G;  1QOH A;  4H13 C;  1NAP A;  1B2T A;  1JOK A;  4DXF A;  3S17 H;  4LUZ A;  2VL6 A;  3Q8D A;  4A3M B;  1N33 L;  1S5E D;  4YY3 L;  4IUQ A;  1L1O B;  1TII D;  2WIN B;  2ZXR A;  4DU9 A;  4UY8 C;  1HTL D;  1BBU A;  2G5D A;  2G9H D;  5A2Q E;  3ZYY X;  4OO1 I;  1ENA A;  1C7Y A;  2E2D C;  1N9W A;  3GO5 A;  1ZXT A;  4OO1 G;  3IFT A;  1YBY A;  4KTA A;  1CQV A;  4O0A A;  4HID A;  4H02 A;  1I6V C;  1UWV A;  2N88 A;  2OT2 A;  4BBR H;  3EBE A;  2L1B A;  4ZUJ A;  2XRS D;  2R93 B;  3EIV A;  1Q7Y C;  3PMF A;  2Z0S A;  2MPM A;  1HH2 P;  1II3 A;  4BY7 G;  4PNY A;  1V8Q A;  1WD0 A;  4LUO A;  3S2D B;  3HS0 C;  2F0F A;  1T5X D;  1X32 A;  3SK4 A;  4L5T A;  4DV6 L;  4NP5 A;  4UDU C;  3RN2 A;  3TP5 A;  4ZRZ A;  1LUZ A;  2HDM A;  3A8K E;  4CDC C;  3NEM A;  5IWA Q;  3ULJ A;  3S1M H;  1BBX C;  3G48 A;  1ZYR C;  1B70 B;  4IJH A;  1CSP A;  1IW7 D;  5E7N A;  3AQQ A;  3N6R A;  4I7A A;  2VUM B;  1Y8P B;  4A3C G;  1BQQ T;  3R8B A;  1HXY D;  3GP7 A;  1D2B A;  1PTO F;  5M3F G;  4IQZ A;  4JBJ A;  3KK7 A;  2MFI A;  4C3H B;  1JE5 A;  1QUQ B;  1JB3 A;  2NBF A;  3AFQ A;  2GVA A;  1TY2 A;  4QB4 A;  2NN6 H;  3MVV A;  1BDO A;  4FF3 A;  1S5D D;  2B8G A;  3TQY A;  2D2C C;  1SNO A;  3F1Z A;  2C9O A;  2PQA B;  3K0X A;  3VDY A;  3A8I E;  2MO0 A;  2UXB L;  4A3E H;  2RDH A;  5KNB A;  3K0Y A;  4KLK A;  2NVT H;  4IPC A;  4K5X A;  2NTS A;  3STB D;  2ZTC A;  4GOP B;  1W2B A;  1EY7 A;  2CH4 W;  5E1F A;  4P2C B;  1A2U A;  1HA6 A;  4DR2 Q;  1JCK B;  2E8G A;  2K14 A;  3CCE A;  1E7Z A;  5HUR A;  1J8I A;  4A3F G;  3FMC A;  4ME5 A;  1Y69 U;  2HIX A;  3NE5 B;  1S40 A;  1B1Z A;  3BDL A;  1H9S A;  3I4N B;  3RUZ A;  1LTB D;  2AUJ D;  3BYY B;  4JI2 L;  4A76 A;  1TWF B;  3E0J A;  2F0G A;  5J39 A;  1CK1 A;  1ICF B;  2E75 C;  2FMM A;  1MI2 A;  1RIP A;  3NUC A;  4X6A H;  1RJT A;  3ULP A;  1SMX A;  5M3M G;  2CFM A;  1EWI A;  1E3P A;  4BXX H;  3ZJY C;  4F88 A;  4BY1 G;  2UUC L;  4ZCK A;  3J81 c;  1BO0 A;  1FJG L;  1SE4 A;  2K52 A;  1MJE A;  3RZD H;  4A3B B;  4IAL A;  2PZU A;  3T1Y Q;  1VDZ A;  1UE7 A;  3QOJ A;  4LF4 Q;  4L5Q A;  2Z6B A;  1BCP F;  2VQF L;  2R7Z B;  3M4O B;  2F0I A;  4MZ9 A;  3HG9 A;  3S14 H;  5ELD A;  1PH7 A;  2JA9 A;  4HCE A;  5EQ0 A;  2PYK A;  2JEB I;  1D1I A;  2KED A;  4Z9C B;  2ICE C;  2WKC A;  3A5U A;  5J3B A;  5FO7 B;  3I3C A;  1BNZ A;  5FLM G;  1EU3 A;  3I4M H;  1HNW L;  1CM9 A;  2K7V A;  2OQK A;  2KCT A;  3D4W A;  4KD3 A;  2R7F A;  2OF1 A;  3HKZ G;  1N8R C;  1SNP A;  1TS5 A;  5IP7 G;  2F0O A;  1VQJ A;  1N33 Q;  3CCM A;  1X65 A;  2N55 A;  4YY3 Q;  5F2D A;  4ODG A;  4FYD A;  3DWQ A;  4KK7 A;  3GTO H;  2A74 C;  3NP8 A;  5C4X G;  3EQL C;  5T1I A;  3IFD A;  3W5O A;  4WJ4 A;  1PFB A;  5C0X J;  1E2W A;  1SYD A;  4WOR A;  1SE2 A;  2IHF A;  5IYB G;  2EIF A;  1DOL A;  2K4K A;  4X64 L;  3TBI B;  3UDF A;  3D31 A;  1TWC B;  1EIY B;  4O2D A;  5JOB A;  4RCN A;  1ROD A;  4C2M H;  5IOD A;  3HP3 A;  4U68 A;  1VQ7 A;  2MP1 A;  4IPD A;  1KD1 C;  5M5X H;  1EYA A;  2SEB D;  2UXC L;  3KF8 B;  4DV6 Q;  2K5D A;  2VY3 A;  2F03 A;  2JSO A;  2MGS A;  1SNC A;  3HOU G;  4KV6 A;  2E2I H;  3MXN B;  3PO3 B;  5D65 A;  2A1A A;  2Q8I B;  4CBV A;  3Q6S A;  2KEE A;  3G4S A;  5KND A;  3RZO H;  2UU9 L;  1WTX A;  4Q0F A;  1Q90 A;  3S17 B;  3PUZ A;  3TS0 A;  2F3W A;  3GV6 A;  3FPU B;  5LHY 1;  3OPO A;  4A3L H;  3WOF A;  4CJ1 B;  3C1F A;  4AQY L;  2X6L A;  2RSO A;  2QIL A;  4KHZ A;  2FXQ A;  2V1C C;  4R4C A;  2K32 A;  4A3J H;  1G6Z A;  1YNN C;  3NBH B;  2XGT A;  3PV0 A;  1WTR A;  1YHB A;  3M7G A;  2A68 D;  3SK6 A;  1VQ6 A;  1A6X A;  1PRT F;  4X3S A;  4BBR B;  3V05 A;  2EY6 A;  4FXK C;  4DUY L;  4A93 G;  4A3D H;  2RHQ B;  3W2D A;  1GVP A;  5CYU A;  5J22 A;  4LMQ D;  4C1N I;  5JJI A;  1D7Q A;  4ME3 A;  2J0T D;  4JI4 L;  1F9Q A;  1Y1V H;  3PIO A;  3MAQ A;  5CBA E;  4JYA Q;  1UEB A;  4PZ7 A;  5FLX L;  1M90 C;  3Q22 A;  3S1M B;  2AQ1 B;  5CC4 A;  1SR3 A;  2F0K A;  1SFO H;  3K57 A;  3CCJ A;  1SBB B;  4JI2 Q;  1X3G A;  5I9O A;  4TKO B;  1Q82 C;  2B29 A;  2QEJ C;  4R1J A;  4DAP A;  5M5W H;  3DHQ A;  1KXL A;  5NUC A;  1UEA B;  2WFW A;  5A35 A;  1CZG A;  1KDC A;  1RF2 D;  2GA4 B;  3CXC A;  2L5T A;  2JE6 I;  2TSS A;  4B3T L;  3I7F A;  3S24 A;  2NUC A;  1EY5 A;  2JEA I;  1I4H A;  3IL8 A;  4OIJ A;  4A3E B;  5EGT A;  2XN9 C;  2F0S A;  4ALP A;  2A73 B;  2Q2T A;  4G7H C;  4FF4 A;  1O80 A;  2NVT B;  4ID6 A;  3TZD A;  4K14 A;  2XRQ D;  2FHT A;  2QW7 A;  2A6H D;  3CKI B;  2ZJR A;  4PMB A;  3CC4 A;  4DXG A;  3C2P A;  2RHS B;  1A3U A;  3P7J A;  5COR A;  1EQV A;  2FMC A;  1N34 L;  2D9U A;  1W3S A;  4CDE C;  4C3I H;  1FR3 A;  1MHW C;  2EE1 A;  3KFU A;  4JV5 L;  1VQE A;  3C3L A;  3HOY H;  4XT1 B;  2YV5 A;  1ESR A;  4GKK Q;  1UNS A;  1STN A;  2LSS A;  1EY8 A;  1PV4 A;  4CJ0 B;  1DOM A;  4DN4 M;  1LTT D;  1VQI A;  4HAE A;  3OOC A;  1F2Y A;  1MSG A;  1WFQ A;  4POG A;  1WTO A;  4XQJ A;  4IUR A;  2DY7 A;  1VQB A;  1KAW A;  1SEB D;  1KNA A;  3OMG A;  2WAQ G;  1KRT A;  3A0J A;  3TZU A;  3GQB A;  5H1S E;  2B2U C;  3SK8 A;  4L5R C;  1OXV A;  2RA4 A;  4X64 Q;  1GUG A;  4DV5 L;  4G4K A;  4DR6 Q;  1V1O A;  3KBX A;  1VQM A;  3I72 A;  3QO2 A;  3VR3 A;  4A3C H;  4LUV A;  3RZD B;  1GHK A;  2PCF B;  3FDT A;  1OXT A;  3P75 A;  4IUN A;  4IO9 A;  2H5X A;  1SYE A;  3DMU A;  4X65 L;  5C5M A;  4A3K H;  5IYD H;  2B8F A;  5J1Z A;  3E9I A;  1Y1W H;  3S14 B;  4LF7 L;  2KA7 A;  2I5M X;  2VB2 X;  4LF9 L;  2RVL A;  4GZY C;  1HR0 L;  2JA6 G;  1AH9 A;  1AZP A;  1VQ8 A;  3MC0 B;  3I4M B;  4HED A;  2CVR A;  2B2U A;  1F2Z A;  1OXX K;  5IT9 L;  1JOQ A;  1NY4 A;  2QF7 A;  1PH8 A;  1IBM L;  4BA1 I;  2XTI A;  1SAP A;  1Q8K A;  1CT1 D;  5EPK A;  1B4O A;  3VR4 A;  4HSP A;  3GTO B;  3FP9 A;  1PZJ D;  4XQQ A;  3KDF A;  3CPW A;  3H0G H;  3PIP 3;  2F0T A;  1JWM D;  5CGK A;  2F0D A;  2EYP A;  1XNQ L;  2AKW B;  2BH8 A;  1SLJ A;  3OTO Q;  1CSQ A;  3KLS X;  1I4Q A;  2MUY A;  2ZXO A;  1VQN A;  3PO2 H;  4DUY Q;  4TRD A;  1R4P B;  2EOT A;  1JWS D;  4C2M B;  3D6W A;  1XPO A;  2K01 A;  5M5X B;  1YEZ A;  1K73 C;  3PUW A;  2IHE A;  5COY A;  4OEM B;  3NWT A;  2DJF C;  4MTN A;  4OWW B;  2E2I B;  1F9S A;  4CKE A;  1SND A;  3J7Z C;  1JWU D;  3HOZ H;  1B9N A;  3ERO A;  2F52 A;  1PVO A;  3CRK C;  1PFM A;  1PZI D;  1TS2 A;  3C1E A;  1RCV D;  3M4P A;  1Z47 A;  4K6L A;  3J80 i;  3CCS A;  3U50 C;  5FJ8 H;  3H3V C;  3RZO B;  2WV6 D;  2O2L D;  4NXN L;  4UAI A;  5AJ3 L;  3T1H L;  1WTW A;  3NPP A;  1VF5 C;  4DV3 L;  1O7Y A;  1ASZ A;  3K80 C;  1SYG A;  3K7U C;  2F3I A;  4L63 B;  4B3T Q;  5ELE A;  5IWA L;  3JAM c;  4A3J B;  4A75 A;  3W3A A;  5FLX E;  4NXM L;  3S16 H;  1S5B D;  5LL6 S;  5G3L D;  2JA7 G;  1UUP A;  1STB A;  1BR9 A;  5C4X H;  1QZH A;  2XIW A;  4L5S A;  3T56 B;  3C46 A;  4LFA L;  4A3D B;  1OXU A;  1L0W A;  5JJL A;  1EOV A;  3NTK A;  1X56 A;  1DXM A;  1FD7 D;  1ONL A;  5DM7 3;  5C4H A;  1N34 Q;  5I2X A;  1AEX A;  1Y1V B;  4EQN A;  3NSW A;  1KDB A;  1LTR D;  4ULL A;  2IPK D;  2F3V A;  1S5C D;  1AN8 A;  4GN3 B;  1JR0 D;  5D14 A;  3CC7 A;  1K28 A;  2NVQ H;  5TSS A;  1QZG A;  2VB3 X;  1FGB D;  3OWE B;  5ELN A;  1UE1 A;  4XYO A;  1SFO B;  1G6P A;  2IX1 A;  1VCI A;  4Y7N H;  2HCC A;  3NTH A;  4HTH A;  1EFW A;  4N9T A;  1G51 A;  2IWH A;  1QVC A;  3ERS X;  3CW2 C;  3OIQ A;  1BF4 A;  1WTQ A;  3IRB A;  1U4L A;  5M5W B;  2EQS A;  5C3W A;  4DV5 Q;  2E5L L;  4OX9 L;  4EQP A;  4DR1 L;  1O7L A;  5I9P A;  3A54 A;  3K6O A;  1CZW A;  2Z8L A;  3D4R A;  3F2C A;  4ZYS A;  1WCM G;  1LTA D;  4NW2 A;  3AB9 A;  2D0O A;  1D6E C;  1MGS A;  2R7D A;  1YJ9 A;  2D5D A;  1PTO C;  1YNJ D;  3OHX C;  4LF7 Q;  3U9S A;  1CFM A;  4LF9 Q;  2VW9 A;  1HR0 Q;  4K0K L;  1GHJ A;  4K5W A;  5IYC G;  1GD7 A;  1V1Q A;  1L0Y B;  1F2L A;  1HA5 A;  4DNT B;  4JK1 C;  3T1Y L;  1KQS A;  2NTT A;  4C3I B;  2HT1 A;  1PMR A;  2JA5 H;  4J6H A;  3CCU A;  3TN2 A;  1IBM Q;  2XVS A;  3HOY B;  3HOV G;  3JAM E;  3VR2 A;  4DV7 L;  4DK6 C;  3MFG A;  4HJ8 A;  3CP0 A;  3H3V I;  5L37 A;  4RWS C;  3I73 A;  3J7Y W;  2UUB L;  4O1N A;  1YJW A;  4KKT A;  4ZK9 B;  4JI7 L;  1XNQ Q;  5T1G A;  5IOC A;  1HQR D;  1QNU A;  4X3U A;  4LWC A;  1H9K A;  4HR7 B;  3CU7 A;  1NCV A;  3HOX H;  2F0V A;  2JJQ A;  3A8J E;  1AE2 A;  5EKL A;  5IT9 E;  1TR5 A;  2IX0 A;  2X69 A;  2RCF A;  4G57 A;  1DD2 A;  1HNZ L;  1SMY C;  4A3K B;  2K5V A;  3T16 A;  1TT2 A;  2LS0 1;  1Y1W B;  2GN5 A;  1MD2 D;  1NSN S;  4HSV A;  3GTM H;  3M7N A;  2K5Q A;  4IUP A;  2CW0 D;  5C44 G;  1B8A A;  3OW2 A;  1QCB D;  4GN4 B;  4ABN A;  2QA4 A;  5C0X H;  4JC0 A;  3ND8 A;  4B3S Q;  4ZUI A;  3T53 B;  3FEW X;  4AIM A;  1B53 A;  2Z4H A;  2WB1 B;  2ZTD A;  1A62 A;  4NXN Q;  5AJ3 Q;  2R3Z A;  4YHH L;  3MTS A;  1VQP A;  4C56 C;  3T1H Q;  2SDF A;  4IFD I;  1PLF A;  1ZKO A;  4DV3 Q;  4F8M A;  5I4D A;  4IFD G;  5KIX A;  1S4Z A;  3I4O A;  1LV9 A;  2BDN A;  2KCC A;  2LKV A;  3MXU A;  5C5L A;  3NK9 A;  3H0G B;  1AFP A;  4ZKC B;  3GTG H;  3SHL A;  4NXM Q;  2XSC A;  2B3G A;  1X3P A;  3TS2 A;  4WJ3 M;  3OWF A;  1EY9 A;  3GTL H;  2OTJ A;  3PO2 B;  1XMO L;  3GV3 A;  3CD6 A;  4LFA Q;  3ERQ A;  1QWY A;  3E5S A;  2R6G A;  2VQE L;  2BH2 A;  5C6A A;  4JG2 A;  1CKM A;  1C4Q A;  4RGM A;  1MBY A;  4BY1 B;  2CWA A;  5HY6 A;  4PZ6 A;  2EY1 A;  4X3T A;  1EUJ A;  4OHJ A;  2B2W C;  3HOZ B;  1H9M A;  1XMQ L;  3K7A H;  2IJ0 A;  1DOK A;  4KKS A;  3FPP A;  2WB1 E;  3W1G A;  2OCE A;  3LWU A;  4A3G H;  2EZV A;  1S3O A;  2R93 G;  3PUX A;  4I65 A;  3FKI G;  3AMU A;  1IKM A;  1EIF A;  2CWP A;  2E5L Q;  4OX9 Q;  1K3B C;  2I46 A;  4DR1 Q;  4JYA L;  4O42 A;  3HKZ B;  2ES2 A;  2UXD L;  2V4D A;  3OIP A;  3S16 B;  2BE5 C;  2Q8R E;  3QIA A;  1JIC A;  1X3E A;  1LM0 A;  1LT3 D;  4K0K Q;  5C4X B;  4RHR A;  1YJN A;  2VUM G;  1L2F A;  4H7B A;  5IP9 H;  4FNF A;  1X55 A;  4JBM A;  4Y52 H;  1AP0 A;  1JT8 A;  3U4V A;  4V19 0;  2I07 B;  1RL2 A;  1J9O A;  4GS3 A;  4C3H G;  3K8A A;  2F0H A;  2R92 H;  1O78 A;  2JA8 H;  2NVQ B;  1DYQ A;  1H9S B;  4DV7 Q;  1TY0 A;  4KY7 A;  4Y7N B;  2EPB A;  1B50 A;  2UUB Q;  4IOC A;  4MTK A;  1EEI D;  4JI7 Q;  3UDI A;  4KY6 A;  3RNU A;  2KOL A;  1XPU A;  2A69 C;  2L0C A;  5DNF A;  2A5H A;  3HEJ A;  4GKJ L;  1D8L A;  3KLW A;  5G3L F;  3Q24 A;  3HOW H;  3F2B A;  3DXJ C;  2EYL A;  3NWS A;  4HJA A;  1VQL A;  1IHZ A;  1STE A;  2AMC B;  1X3Q A;  3HKZ E;  1J6Q A;  1D5M C;  4CHT B;  4GKK L;  1EY6 A;  2KHI A;  1HNZ Q;  1NJI C;  2NWG A;  1IZ6 A;  4RCO A;  1FNU A;  4HN7 A;  3J81 i;  1FNW A;  1PH9 A;  2RDG A;  1VMP A;  1DM0 B;  4KJO A;  4DV2 Q;  2HHH L;  3I4N G;  1H9R A;  1HZC A;  4FO2 A;  1A8V A;  1OXS C;  5CV6 A;  4B3M Q;  2EXD A;  1C8C A;  4DR6 L;  3I2Z A;  2QDL A; 
#chains in the Genus database with same CATH homology
 3D4D A;  2IW3 A;  5DM6 3;  5CV9 A;  2JA5 B;  3DEO A;  1TU2 B;  4Q5V A;  3QB3 A;  2PW5 A;  1EQT A;  3Q23 A;  5JJZ A;  2F1M A;  3RLF A;  1E0B A;  2FFK B;  1TS3 A;  5E4X A;  4R8I A;  1QNK A;  1EFI D;  1PXU A;  1IW7 C;  2M00 A;  2B39 A;  3HOX B;  4CGY B;  4IZ8 A;  1AZQ A;  4F7X A;  2JYO A;  4MN3 A;  4DAY A;  2KCN A;  1JOO A;  1CA5 A;  2WII B;  4RGN A;  2ICI A;  5I2Y A;  3URY A;  1KAB A;  3GTM B;  4KD4 A;  3SDZ A;  1HQM C;  4RA8 A;  5I6W A;  1WTP A;  1QIL A;  1G2S A;  1Q12 A;  4IUU A;  3F2U A;  1ET6 A;  5EPJ A;  3HGB A;  3VA5 A;  5CV4 A;  3H6M A;  5EKK A;  2KUM A;  1L0X B;  4QUF A;  5K36 G;  4KN7 C;  2WAC A;  3SXH A;  3SR1 A;  3GTG B;  1ICW A;  1STA A;  2ID0 A;  5ELF A;  5IGF A;  3GTL B;  1STY A;  2EDG A;  2DNE A;  4B08 A;  2K28 A;  4XQN A;  4M1U B;  1KDA A;  4QUC A;  1EIH A;  4IUT A;  1GXD C;  2HUG A;  2ZT9 C;  3EFX D;  2CQA A;  4FXD A;  2EJM A;  3K7A B;  1B9M A;  3NHH A;  4OO1 H;  4J8Q A;  1JE4 A;  3J80 L;  4BA2 I;  1TQO A;  4KMU C;  4A3G B;  1EYC A;  1G91 A;  5E3F A;  2RKS A;  4XXE A;  1D5Z C;  1LT6 D;  3VR5 A;  1KLG D;  2Y0S B;  4ZLT F;  1I4R A;  3HZX A;  4IFD H;  4OL7 A;  3IKJ A;  1V43 A;  3K5N A;  3L9A X;  4RKB A;  4DAV A;  3VA7 A;  2X6G A;  5KEE A;  1EY4 A;  4RH6 A;  2NN6 I;  1WD1 A;  4OGQ C;  1GUW A;  1ESF A;  5FO9 B;  2R92 B;  2NN6 G;  2JA8 B;  4DF7 A;  4DNR B;  3EJI A;  1PTO H;  1FNV A;  2SOB A;  5DAU A;  5IIF A;  3I70 A;  5ELC A;  1R4Q B;  5KYL A;  2VXW A;  2E76 C;  2K6A A;  3HOW B;  4IUV A;  3J7A V;  1STG A;  3H94 A;  1NR4 A;  3T4A C;  2PO4 A;  3D6C A;  1TS4 A;  5ELB A;  2K33 A;  1IYU A;  4HMJ A;  4RAU C;  2B2V C;  2EYJ A;  5JEA G;  3BZD B;  4NMZ A;  3P1H A;  5KNC A;  5A2Q L;  2EY2 A;  1UAP A;  2JA7 B;  2A6E C;  1V1P A;  5ISR A;  4C3J G;  2VNU D;  3G7L A;  1TKW B;  1PZK D;  4K5V A;  4AYB B;  3AU7 A;  3MA2 B;  3GTQ B;  1IL8 A;  3X3N A;  2B2V A;  5BN4 A;  1I6H B;  2BDO A;  2F0L A;  4KHV A;  5EBD A;  4BWG B;  1FYC A;  4IN3 A;  4LAA A;  3MEH A;  5FOB B;  3BG3 A;  4XIG S;  1F9R A;  3BYT B;  4RHS A;  2M9V A;  4G7Z C;  3VYU A;  3NTI A;  3R2T A;  2AQ2 B;  3K5O A;  2NZ1 D;  2E2J B;  4L8J A;  2PQE A;  4HCS A;  4K6D A;  5I6Y A;  4QMG A;  1ZYR D;  3T13 A;  1STH A;  1G8Z D;  4PV1 C;  2F0Q A;  2A6H C;  3QWN A;  2KHS A;  2HQE A;  3R2I A;  4IFD J;  2MHV A;  5FK9 C;  4DK1 A;  1SYC A;  2EYM A;  1LTI D;  1GOZ A;  2K5W A;  1EEF D;  5HGT A;  4E6I A;  1GUN A;  4I7Z C;  5DEH A;  3J80 E;  2DN8 A;  3OW7 A;  1I4G A;  4PMC A;  4B9X A;  5C3E B;  4A3I B;  1XWE A;  3BVZ A;  2AQ3 B;  1HFG A;  5IGC A;  2F4I A;  3KBG A;  3V2T A;  1TWG B;  4K2L A;  1CHQ D;  1CHP D;  1S5F D;  3A7L A;  1XX8 A;  4H0L C;  1PYW D;  5EPL A;  1TVX A;  1EY0 A;  4BY7 B;  4J1M A;  1A2T A;  3VYR A;  1QG7 A;  2EJG C;  3GD7 A;  1DJR D;  1F77 A;  4KKU A;  2NVY B;  1IKL A;  3I90 A;  4KN4 C;  5M3F B;  3NXW A;  2NB0 A;  1RDP D;  1JOR A;  1KNE A;  4BS9 A;  3QOL A;  3GTP B;  5EJW A;  2A69 D;  2E74 C;  3LX0 A;  2Z4I A;  4WFN 3;  1WTV A;  3VYT A;  1PTO B;  3OMC A;  3SEB A;  3ND9 A;  3DWP A;  1XTC D;  2R61 A;  4K2K A;  1BCP C;  1R9T B;  3N52 A;  3T51 B;  2F0J A;  4DA2 A;  3S15 B;  3M3Y B;  1SJE D;  2Z1C A;  3LWE A;  3M85 A;  4C3I G;  1HPC A;  4QF4 A;  1LTG D;  5LL6 X;  1RTO A;  3FKI B;  2LFN A;  3S2H B;  4A3F B;  3J81 L;  4DFA A;  3H91 A;  2K1B A;  2MJ8 A;  1HUM A;  1RD9 D;  1BOS A;  4RGO S;  1SNM A;  3WOE A;  2L4N A;  1LAB A;  3HRZ C;  2H4O A;  1XXG A;  5M3M B;  4TSS A;  3BDC A;  1SE3 A;  1IYV A;  5CV5 A;  1Y8O B;  2OXP A;  4F87 A;  5JPM C;  4K8I A;  4QCL A;  4S3S A;  3I4L A;  2O5J C;  1YNN D;  2KJX A;  3BDO A;  2IX3 A;  3P20 A;  2PMZ B;  1ML0 D;  1K8M A;  2EY5 A;  3RD4 A;  1BCP B;  2L55 A;  2SNS A;  3PUV A;  5EBC A;  1Q8I A;  2OEO A;  3E6Z X;  4R8N A;  3R93 A;  3S1N B;  2B2W A;  1HTP A;  1PDQ A;  2F0W A;  2QDB A;  2DNC A;  1YNJ C;  1JQY D;  3D3R A;  1U4M A;  5JEA H;  1CQF A;  1G29 1;  1OO9 B;  1SNQ A;  4XTC S;  3DEP A;  3O13 A;  3UI2 A;  1PRT C;  2O5I C;  4EQO A;  2PZT A;  3M4Y A;  3QJY A;  5AFW A;  3GTJ B;  4X3K A;  1Q1B A;  3NBI A;  1C48 A;  3HOU B;  5JPN C;  2EXZ A;  4RGT A;  1Q1E A;  2LY7 A;  2RDF A;  3TSS A;  1CTM A;  3R3O A;  1H9J A;  2PZW A;  2TMP A;  3CQZ B;  1EZ6 A;  1SSO A;  3S1R B;  3GTK B;  4N9P A;  4L6T B;  2L9H A;  4ZQ3 A;  3NQT A;  4MIU A;  2AWN A;  3KF8 A;  3L7Z C;  2CW0 C;  1W6K A;  3KUP A;  4WJW A;  1M4V A;  2RSN A;  1VMC A;  3MXN A;  1B44 D;  2YYZ A;  2WKD A;  3Q0A A;  4A93 B;  1F9P A;  4PQX A;  3SE0 A;  3K5M A;  2J4X A;  3BS1 A;  2EYF A;  2BCO A;  1PRT B;  1I4X A;  3KLS A;  1E2Z A;  1TWH B;  1KTK A;  1A3V A;  1LT4 D;  5CR3 A;  3TME A;  3S9W A;  5KYI A;  1ENC A;  1U4R A;  3NBH A;  3S1Q B;  4K8J A;  2RQX A;  1ET9 A;  2Q8T A;  1I4P A;  4H44 C;  2L11 A;  2PNR C;  3PIO 3;  4ILW A;  2F0E A;  4ZKB B;  3X3M A;  1LT5 D;  1VF7 A;  3J81 E;  1K83 B;  5KGU A;  5EKI A;  2FIN B;  1F2M A;  1KLU D;  1QE6 A;  1RKN A;  2XWB B;  1EIG A;  5K5P A;  1M8A A;  2A6E D;  4C1N K;  2BOS A;  1EL0 A;  3I91 A;  3QG1 A;  5JEA J;  3NQI A;  3DUZ A;  4PMW A;  1NUC A;  1O7Z A;  5IGD A;  1Y8N B;  3CRL C;  2EJF C;  4G7O C;  2WAQ B;  4FP5 D;  5M5Y B;  5BN3 A;  3K59 A;  1WVL A;  1MSH A;  4QIW B;  1XYI A;  2DY8 A;  1A3T A;  4KJN A;  1HFN A;  2F0M A;  5D3D A;  1ILQ A;  3SK5 A;  4EGV A;  1SYB A;  3OSO A;  3EVQ A;  4YIJ A;  5CV8 A;  4FXG C;  5M9O A;  3A56 A;  1SXT A;  3FVQ A;  2IL8 A;  5C0X I;  2JA6 B;  3K58 A;  2H1E A;  3TDQ A;  5C0X G;  3L3O C;  2NVX B;  2BA1 A;  3A7A B;  1BXT A;  2JXM B;  5KRU A;  3VR6 A;  4R9W A;  3MWY W;  4V0B A;  4ZAI A;  1EZ8 A;  3I8Z A;  2EVB A;  5C4Z A;  1LTS D;  3IAY A;  2SNM A;  4HMI A;  5E4W C;  1DCZ A;  2K05 A;  5JAV A;  1CA6 A;  1HCZ A;  1RTN A;  4EVO A;  1U4P A;  3TP7 A;  4C3J B;  2B63 B;  4JBW A;  1EOT A;  3MXG A;  1SJH D;  1Z6H A;  3MXP A;  2IT1 A;  3TP6 A;  1SDF A;  1PTO D;  4XDX A;  5CBE E;  3JAM L;  4WRD A;  2F0P A;  1K8O A;  4FVM A;  1E2V A;  3V96 A;  2LMC B;  3FRP B;  4LK1 C;  2NYZ D;  1DON A;  3DM1 A;  3D8G A;  2K03 A;  1GUT A;  2L12 A;  1W6J A;  2O4X A;  2AUK A;  2A68 C;  2CHB D;  2YU9 B;  1ENF A;  2B2Y C;  3H09 A;  1HUN A;  3A55 A;  3LNN A;  1TWA B;  1T5E A;  1NR2 A;  2K04 A;  1QB5 D;  1AW7 A;  1JC7 A;  1U9R A;  4OIK A;  4CJ2 C;  2RBM A;  5CMD A;  1SMY D;  1DZ1 A;  1EWH A;  5C3X A;  5JVH 3;  4KI0 A;  2B2Y A;  2QKI C;  4CKB A;  2J7Z A;  1V1P B;  3VYS A;  1LAC A;  2FJ2 A;  1CI3 M;  1KAA A;  1BCP D;  2WP8 J;  2PPB C;  2XWJ B;  2E2H B;  2D62 A;  1HHV A;  1D5X C;  1GUS A;  1WCM B;  2EYO A;  5FO8 B;  2G9D A;  3MZ5 A;  1SYF A;  3BVM A;  3KLR A;  4U67 3;  3K5L A;  2BA0 A;  5IGB A;  1EU4 A;  3TP8 A;  2AWO A;  3SVM A;  3MHB A;  4XYQ A;  2C5C A;  3BVG A;  1BUV T;  2B2T C;  2ENB A;  2KVM A;  1GUO A;  3EA6 A;  3HOV B;  2QCP X;  5IGE A;  4DGZ A;  1LO5 D;  4MHE A;  1LLR D;  4LJZ C;  3RMH A;  2KQ3 A;  5CV7 A;  2EYH A;  3ITP A;  1PFN A;  1EWC A;  2ZXP A;  4B9W A;  2HDL A;  4XT3 B;  5BN5 A;  5FKA C;  2B2T A;  1Z7T A;  3DWA A;  5C4J B;  4FF1 A;  3J7A F;  1HRJ A;  2XNA C;  4CKC A;  4NKL A;  4DK0 A;  4M8A A;  5C44 B;  2BE5 D;  4KY5 A;  1ZEQ X;  2KEC A;  3ONA B;  1D1K A;  5D3I B;  1A15 A;  2HCI A;  2JP1 A;  1QJO A;  1Q3L A;  2PW7 A;  2F0N A;  5IGG A;  1G2T A;  1I3Q B;  4NDX A;  3PUY A;  1EYD A;  5K36 H;  1GJX A;  1PRT D;  4RFB A;  1I50 B;  5JVG 3;  2F0U A;  4FF2 A;  3WDN A;  3G6J B;  4RKL A;  3CHB D;  2M2L A;  4BBS B;  3U9O A;  1B3A A;  3MFY A;  1ILP A;  1RHP A;  4TQU S;  1QOH A;  4H13 C;  1NAP A;  1B2T A;  1JOK A;  4DXF A;  4A3M B;  1S5E D;  4IUQ A;  1TII D;  2WIN B;  2ZXR A;  4DU9 A;  1HTL D;  2G9H D;  5A2Q E;  3ZYY X;  4OO1 I;  1ENA A;  2E2D C;  3GO5 A;  1ZXT A;  4OO1 G;  3IFT A;  4KTA A;  1CQV A;  1I6V C;  2OT2 A;  2N88 A;  2L1B A;  4ZUJ A;  2XRS D;  2R93 B;  3PMF A;  2MPM A;  1II3 A;  4PNY A;  1V8Q A;  1WD0 A;  3S2D B;  3HS0 C;  2F0F A;  1T5X D;  1X32 A;  3SK4 A;  4NP5 A;  4UDU C;  3TP5 A;  4ZRZ A;  2HDM A;  3A8K E;  1BBX C;  1ZYR C;  1IW7 D;  3N6R A;  2VUM B;  1Y8P B;  1BQQ T;  3R8B A;  1HXY D;  3GP7 A;  1D2B A;  1PTO F;  4IQZ A;  3KK7 A;  4C3H B;  2NBF A;  1JB3 A;  1TY2 A;  4QB4 A;  2NN6 H;  3MVV A;  1BDO A;  4FF3 A;  1S5D D;  2B8G A;  2D2C C;  1SNO A;  2C9O A;  3A8I E;  2RDH A;  5KNB A;  3K0Y A;  4K5X A;  2NTS A;  1EY7 A;  5E1F A;  4P2C B;  1A2U A;  1HA6 A;  1JCK B;  5HUR A;  1J8I A;  3FMC A;  4ME5 A;  1Y69 U;  3NE5 B;  1B1Z A;  3BDL A;  1H9S A;  3I4N B;  3RUZ A;  1LTB D;  2AUJ D;  3BYY B;  1TWF B;  3E0J A;  2F0G A;  5J39 A;  1CK1 A;  2E75 C;  2FMM A;  1MI2 A;  3NUC A;  1RJT A;  4F88 A;  1BO0 A;  1SE4 A;  4A3B B;  4IAL A;  2PZU A;  1VDZ A;  3QOJ A;  1BCP F;  2R7Z B;  3M4O B;  2F0I A;  3HG9 A;  5ELD A;  4HCE A;  5EQ0 A;  2PYK A;  2JEB I;  1D1I A;  2KED A;  4Z9C B;  2ICE C;  2WKC A;  5FO7 B;  3I3C A;  1BNZ A;  1EU3 A;  1CM9 A;  2K7V A;  3D4W A;  4KD3 A;  2OF1 A;  1SNP A;  1TS5 A;  2F0O A;  2N55 A;  5F2D A;  4ODG A;  4FYD A;  3DWQ A;  4KK7 A;  2A74 C;  3NP8 A;  3EQL C;  5T1I A;  3IFD A;  1PFB A;  5C0X J;  1E2W A;  1SYD A;  4WOR A;  1SE2 A;  1DOL A;  3TBI B;  3D31 A;  1TWC B;  5JOB A;  4RCN A;  1ROD A;  5IOD A;  3HP3 A;  4U68 A;  2MP1 A;  1EYA A;  2SEB D;  2K5D A;  2F03 A;  2JSO A;  2MGS A;  1SNC A;  4KV6 A;  3PO3 B;  5D65 A;  2Q8I B;  4CBV A;  3Q6S A;  2KEE A;  5KND A;  1WTX A;  4Q0F A;  1Q90 A;  3S17 B;  3PUZ A;  2F3W A;  3GV6 A;  3FPU B;  5LHY 1;  3OPO A;  3WOF A;  4CJ1 B;  3C1F A;  2X6L A;  2RSO A;  2QIL A;  4KHZ A;  2K32 A;  1G6Z A;  1YNN C;  3PV0 A;  1WTR A;  3M7G A;  2A68 D;  3SK6 A;  1A6X A;  1PRT F;  4X3S A;  4BBR B;  3V05 A;  2EY6 A;  4FXK C;  3W2D A;  5CYU A;  5J22 A;  4LMQ D;  4C1N I;  2J0T D;  1F9Q A;  3MAQ A;  5CBA E;  5FLX L;  3Q22 A;  3S1M B;  2AQ1 B;  5CC4 A;  2F0K A;  3K57 A;  1SBB B;  5I9O A;  4TKO B;  2QEJ C;  4DAP A;  3DHQ A;  5NUC A;  1UEA B;  5A35 A;  1CZG A;  1KDC A;  1RF2 D;  2GA4 B;  2L5T A;  2JE6 I;  2TSS A;  2NUC A;  1EY5 A;  2JEA I;  1I4H A;  3IL8 A;  4OIJ A;  4A3E B;  5EGT A;  2XN9 C;  2F0S A;  2A73 B;  4G7H C;  4FF4 A;  1O80 A;  2NVT B;  4ID6 A;  3TZD A;  4K14 A;  2XRQ D;  2FHT A;  2A6H D;  3CKI B;  4PMB A;  3C2P A;  4DXG A;  1A3U A;  3P7J A;  5COR A;  1EQV A;  2FMC A;  2D9U A;  1FR3 A;  2EE1 A;  3C3L A;  4XT1 B;  1ESR A;  1UNS A;  1STN A;  1EY8 A;  4CJ0 B;  1DOM A;  4DN4 M;  1LTT D;  4HAE A;  3OOC A;  1F2Y A;  1MSG A;  1WTO A;  4XQJ A;  4IUR A;  2DY7 A;  1SEB D;  1KNA A;  3OMG A;  3TZU A;  3GQB A;  2B2U C;  3SK8 A;  1OXV A;  2RA4 A;  1GUG A;  4G4K A;  1V1O A;  3KBX A;  3I72 A;  3QO2 A;  3VR3 A;  3RZD B;  1GHK A;  2PCF B;  3FDT A;  1OXT A;  3P75 A;  4IUN A;  1SYE A;  3DMU A;  5C5M A;  2B8F A;  5J1Z A;  3S14 B;  2KA7 A;  2VB2 X;  2RVL A;  4GZY C;  1AZP A;  3MC0 B;  3I4M B;  4HED A;  2CVR A;  2B2U A;  1F2Z A;  1OXX K;  5IT9 L;  1JOQ A;  2QF7 A;  4BA1 I;  1SAP A;  1CT1 D;  5EPK A;  1B4O A;  3VR4 A;  4HSP A;  3GTO B;  1PZJ D;  4XQQ A;  3PIP 3;  2F0T A;  1JWM D;  5CGK A;  2F0D A;  2EYP A;  3KLS X;  1I4Q A;  2MUY A;  2ZXO A;  4TRD A;  1R4P B;  2EOT A;  1JWS D;  4C2M B;  3D6W A;  2K01 A;  5M5X B;  3PUW A;  5COY A;  3NWT A;  2E2I B;  1F9S A;  4CKE A;  1SND A;  1JWU D;  1B9N A;  3ERO A;  3CRK C;  1PFM A;  1PZI D;  1TS2 A;  3C1E A;  1RCV D;  1Z47 A;  4K6L A;  3H3V C;  3RZO B;  2WV6 D;  2O2L D;  4UAI A;  1WTW A;  3NPP A;  1VF5 C;  1O7Y A;  1SYG A;  4L63 B;  5ELE A;  4A3J B;  3W3A A;  5FLX E;  1S5B D;  5LL6 S;  5G3L D;  1UUP A;  1STB A;  1BR9 A;  2XIW A;  3T56 B;  3C46 A;  4A3D B;  1OXU A;  3NTK A;  1DXM A;  1FD7 D;  1ONL A;  5DM7 3;  5C4H A;  5I2X A;  1AEX A;  1Y1V B;  4EQN A;  3NSW A;  1KDB A;  1LTR D;  4ULL A;  2IPK D;  2F3V A;  1S5C D;  1AN8 A;  1JR0 D;  5D14 A;  5TSS A;  2VB3 X;  1FGB D;  3OWE B;  1SFO B;  4XYO A;  2IX1 A;  1VCI A;  2HCC A;  3NTH A;  4HTH A;  4N9T A;  2IWH A;  3OIQ A;  1BF4 A;  1WTQ A;  1U4L A;  5M5W B;  5C3W A;  4EQP A;  1O7L A;  5I9P A;  3A54 A;  3K6O A;  1CZW A;  2Z8L A;  3D4R A;  4ZYS A;  1LTA D;  4NW2 A;  3AB9 A;  1D6E C;  1MGS A;  2D5D A;  1PTO C;  1YNJ D;  3OHX C;  3U9S A;  1CFM A;  1GHJ A;  4K5W A;  1L0Y B;  1F2L A;  1HA5 A;  4DNT B;  4JK1 C;  2NTT A;  4C3I B;  1PMR A;  4J6H A;  3TN2 A;  2XVS A;  3HOY B;  3JAM E;  3VR2 A;  3MFG A;  4RWS C;  3I73 A;  3J7Y W;  4O1N A;  4KKT A;  4ZK9 B;  5T1G A;  5IOC A;  1HQR D;  1QNU A;  4X3U A;  1H9K A;  4HR7 B;  3CU7 A;  1NCV A;  2F0V A;  3A8J E;  5EKL A;  5IT9 E;  1TR5 A;  2IX0 A;  2X69 A;  4G57 A;  1DD2 A;  1SMY C;  4A3K B;  3T16 A;  1TT2 A;  2LS0 1;  1Y1W B;  1MD2 D;  1NSN S;  4HSV A;  3M7N A;  2K5Q A;  4IUP A;  2CW0 D;  1QCB D;  4ABN A;  5C0X H;  3ND8 A;  4ZUI A;  3T53 B;  3FEW X;  1B53 A;  2Z4H A;  2WB1 B;  2R3Z A;  3MTS A;  4C56 C;  2SDF A;  4IFD I;  1PLF A;  1ZKO A;  4F8M A;  5I4D A;  4IFD G;  5KIX A;  1S4Z A;  1LV9 A;  2BDN A;  2KCC A;  2LKV A;  3MXU A;  5C5L A;  3NK9 A;  3H0G B;  1AFP A;  4ZKC B;  3SHL A;  2XSC A;  1X3P A;  3OWF A;  1EY9 A;  3PO2 B;  3GV3 A;  3ERQ A;  1QWY A;  3E5S A;  2R6G A;  5C6A A;  1C4Q A;  4RGM A;  1MBY A;  4BY1 B;  4X3T A;  2EY1 A;  4OHJ A;  2B2W C;  3HOZ B;  1H9M A;  2IJ0 A;  1DOK A;  4KKS A;  3FPP A;  3LWU A;  2EZV A;  3PUX A;  4I65 A;  3AMU A;  1IKM A;  2I46 A;  4O42 A;  3HKZ B;  2V4D A;  3OIP A;  3S16 B;  2BE5 C;  2Q8R E;  3QIA A;  1JIC A;  1LT3 D;  5C4X B;  4RHR A;  4H7B A;  4FNF A;  1AP0 A;  4V19 0;  2I07 B;  1J9O A;  4C3H G;  2F0H A;  2NVQ B;  1O78 A;  1DYQ A;  1H9S B;  1TY0 A;  4KY7 A;  4Y7N B;  2EPB A;  1B50 A;  1EEI D;  4KY6 A;  2KOL A;  2A69 C;  2L0C A;  5DNF A;  2A5H A;  3HEJ A;  5G3L F;  3Q24 A;  3DXJ C;  2EYL A;  3NWS A;  1IHZ A;  1STE A;  4CHT B;  1X3Q A;  1D5M C;  1EY6 A;  2NWG A;  4RCO A;  1FNU A;  4HN7 A;  1FNW A;  2RDG A;  1VMP A;  1DM0 B;  4KJO A;  1H9R A;  4FO2 A;  1OXS C;  5CV6 A;  1C8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...