4F87A

X-ray crystal structure of plycb
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
VSGVQGFLFHTDGKESYGYRAFINGVEIGIKDIETVQGFQQIIPSINISKSDVEAIRKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein, viral protein
molecule keywords PlyCB
publication title X-ray crystal structure of the streptococcal specific phage lysin PlyC.
pubmed doi rcsb
source organism Streptococcus phage c1
total genus 15
structure length 61
sequence length 61
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.850 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f87A00
4ZRZA 4F87A 4F88A
chains in the Genus database with same CATH superfamily
2K7VA 2SDFA 2K4KA 4NDXA 4OX9L 3QWNA 2M2LA 4WJWA 4R4TA 5C3XA 5IYDG 2WIIB 3PO2G 2LXJA 1D2BA 1NR4A 3EIVA 4DR7L 4AYBG 2JK8A 4HEDA 1OXUA 1A3UA 1TWHB 3RD4A 4FO2A 2PYKA 1C7YA 1KLGD 4TQUS 1L1OB 3V96A 2R92B 3RLNA 3UDIA 3LWEA 4DUYL 1DGSA 4PG3A 3VYUA 4C3HB 1CA6A 2OQKA 5ELDA 4UAIA 4X62L 1SYGA 2F0MA 2AMCB 4JVZA 1QB5D 1EY8A 1AZQA 4IQZA 1SRUA 3PIPA 5HURA 2KUMA 2B2WA 1B53A 3J81E 5E4WC 3STBD 3CW2C 2I0QA 1IZ6A 1WTVA 5KNCA 4RGTA 4JI4L 2AQ2B 4P75A 3P7JA 4X65L 2Z0SA 1XPRA 3FVQA 5T1GA 1TWHH 5E4XA 3E9HA 3PIO3 2EJMA 4IJLA 2CFMA 1DJRD 1HNWQ 5FJ8G 2EY2A 3T1YQ 1SR3A 2R92H 3RN2A 4A3MB 3T4AC 1BQQT 1H9SA 4X66Q 4IPGA 1LACA 1WD0A 1A15A 2RBMA 3HKZE 3FRPB 4C3HH 2OWOA 2FHTA 3RUZA 3J7AV 3FPUB 1ONLA 1EIYB 4A76A 4KTAA 2F0TA 1IBKQ 1HZCA 1ET6A 1M4VA 1TU2B 2A6EC 3KUPA 4GS3A 3DLLA 3I4NG 5AJ3L 3AB9A 3ULPA 4TKOB 3GTMB 2Q8IB 2H5XA 1N32Q 2D0PA 2QKIC 5FO9B 3DMUA 1HHVA 2J0TD 4DAYB 3Q22A 5KGUA 1D8LA 1UWVA 4DF7A 5FOBB 1IW7C 5IP9G 4A3IB 4IN3A 4DV7Q 2AUJD 2NVYB 1UNSA 4L5TA 4HMJA 2Z6KA 1CSQA 2Z1CA 2OEOA 2YTXA 4XDXA 2ASBA 3X3MA 2DY7A 2EDGA 1ILPA 2JEAI 2R3ZA 2RCNA 2HCIA 1YJNA 2I5MX 3AFPA 4WRDA 1STGA 1BKBA 2PZWA 1ML0D 3I2ZA 3HKZG 3KF8B 3A5UA 1QG7A 1VMPA 5C4HA 3GTMH 4UP7A 3V2TA 3BS1A 1E24A 3EA6A 5IOCA 1STHA 1AE3A 3TDQA 2RDFA 1N33Q 1EZ6A 1ESFA 2Z9HA 4M8AA 1XTDA 4A3IH 1NR2A 4CJ0B 2NVYH 4C3IG 3RN5A 1HNWL 1EWHA 3CRKC 3T1YL 2IX1A 1FNVA 5C5LA 1ZKOA 1RKNA 2ATWA 1NMFA 2GN5A 4X66L 4K2KA 4KD4A 1XMQL 4C1NI 2RSOA 4CDCC 1CUKA 3PCOB 2VUMG 2MO1A 1SNQA 4A3DG 2UXBQ 1KLUD 3QIAA 3NQTA 1SMYC 3CPFA 3K8AA 4OL7A 1EQQA 1HNXQ 1HTPA 1SNOA 1S3OA 1PA6A 4DXFA 1TWCB 4CDEC 2EJGC 3UI2A 1N32L 3EJIA 2ICIA 2OQ0A 1EYAA 1Q46A 3TP6A 3HOUB 5G3LF 1K83B 3KLSA 3GTGB 1LLRD 3CC7A 1F9PA 3CCMA 3Q8DA 2XWBB 4DV7L 1OXXK 4OONA 5G3LD 1G91A 1B4OA 3VYSA 4RG1A 3HOZG 4BBSG 5L37A 3NTHA 3D8GA 2Y0SE 1XNRL 3C3LA 2WB1G 1EY9A 2AUKA 1LABA 3P75A 4KK7A 1JJ2A 5JEAH 2A5HA 1B8AA 1EFWA 3RLFA 3CC4A 5EKKA 1CZWA 3AEVA 4GLVB 1FYCA 2R7ZB 3I73A 4EGVA 3I72A 2DY8A 5JPMC 1EY4A 4ZK9B 2H1EA 3DUZA 1B2TA 1A2UA 2F0JA 1VDZA 1ASZA 1TWCH 3PO3B 3SXHA 5IGFA 2DNCA 4PZ8A 1GUOA 2EYOA 4DU9A 3HOUH 1K83H 1N33L 4O1NA 1LT6D 2A6HD 3GTGH 5I9PA 3I55A 2KEDA 1CM9A 3S17B 1IBLQ 2DJFC 3MWYW 1O80A 4AH6A 1GUWA 1DOMA 4L8JA 1JOQA 1PFMA 5C4JB 2XSCA 1JWUD 4RKLA 2BA0A 2B2WC 2F0QA 3K5OA 5HY6A 1PRTB 3SHLA 1F2LA 3MXNB 5FKAC 3M85A 2R7ZH 2O5JC 2NWGA 4CKEA 2UXBL 1I6HB 4R4QA 2ZM6L 1OXSC 1EQRA 2LSSA 5D14A 5BN4A 4L63B 1J8IA 4K5WA 4JPBW 4ODGA 2BE5D 4IUNA 5D3DA 2YV5A 2JQOA 4ILWA 4FF2A 1HNXL 3PO3H 2WFWA 1JORA 1SLJA 1GUGA 3IAYA 4POFA 1TVXA 5I4DA 1PYBA 2KVMA 2KHJA 4YWKA 5KNDA 1PHJA 5EPLA 3S17H 3MA2B 1YEZA 3TZUA 1WVLA 1FJGQ 1B44D 4F7XA 1WCMG 1Q1BA 3CCSA 1G51A 1N34Q 1U4RA 4JI5Q 1AN8A 5C4JH 5DAUA 1X54A 1VQCA 1SAPA 1D5MC 5CYUA 1LTSD 1Z9FA 1Q90A 2MQHA 2KOLA 4JC0A 4KI0A 3HOVB 4KY6A 3K5LA 1MSGA 1QNKA 3SE0A 1BXTA 3H91A 2L55A 1MJEA 2ES2A 1K8MA 2NN6I 4KD3A 5LL6S 1S40A 4UY8C 5M5WH 1VQPA 1Q86C 5C4XG 1PRTF 1SYEA 1D7QA 1EY7A 2L12A 2Z6KC 1GJXA 1RD9D 3H0GG 1ESRA 3M4YA 1PRTD 2E5LL 1I94Q 4OO1G 5C44G 1C0AA 3VYRA 4B3MQ 1WTPA 2GVAA 1PZJD 4RCOA 2VW9A 1IBLL 3S1QB 1TS3A 3FKIB 1Y8PB 3O13A 2ZTEA 2EY6A 4G7ZC 2Y0SB 5FLMG 2QW7A 2CQAA 1B7YB 4A3GG 2YYZA 1K3BC 2B8GA 1X6OA 1YVCA 4ME3A 1V1OA 3W1GA 5JVG3 3DM1A 1U4MA 1S72A 1Y1WB 4JOIA 3WOFA 5DM63 2EYMA 3HOVH 1PVOA 1GHKA 3SK4A 1H9JA 3T16A 4BA2I 5LMUQ 3E5SA 1LM0A 1Z6HA 3I4OA 1KQSA 3G71A 4MZ9A 2RDGA 4DV6L 1LO5D 2HQLA 5E1FA 3U9SA 1HNZQ 3JAMi 2E74C 1JCKB 4F87A 4CKCA 1QWYA 4IPCA 4A3CH 1YNND 2A69C 4DV3Q 3NK9A 3NHHA 4NXML 2UUBQ 1D5ZC 3ICEA 3S1QH 3FKIH 1NTGA 2MHVA 4QGUA 1N34L 4IPDA 3OPOA 2JJQA 4MHEA 1PMRA 1D6EC 4DR6Q 1LTBD 3J81i 4B3RQ 1ET9A 2HHHL 4NKLA 2F0NA 5GAEC 3J7A5 4AQYL 3MZ5A 2E2JB 2BOSA 3TSSA 4LF9Q 3CCRA 2MUYA 2JA7B 3NBHB 2A1AA 3T56B 2XRQD 4KY7A 2HT1A 3KK7A 3A0JA 4QMGA 2EPBA 3S14B 1QILA 4DR2Q 3TZDA 3OOCA 1YHAA 2B3GA 1LT5D 1D5XC 2PQEA 5BN5A 1JC7A 1S4ZA 1I94L 2F0KA 3RZOB 3ITPA 4A3FB 4B3ML 3UDXA 1SYCA 4IALA 5JEAJ 2UUCQ 2MFIA 3AYHB 4DNIA 2VY3A 1L2FA 1Y8OB 4JI0Q 2L11A 1AW7A 1XX8A 4DV1Q 5CV6A 1C8CA 2AQ3B 3HG9A 1BOSA 2DN8A 1SFOH 1EY6A 1MBYA 2I5HA 2NVTB 4KN7C 3CD6A 3KFUA 2QEJC 1SNPA 2E2JH 2JA7H 1SNCA 2K5HA 3K58A 2KCTA 3I7FA 2K33A 1CHPD 3I8ZA 4O42A 5CORA 2NTTA 1LTGD 4YY3Q 3S14H 5EKLA 3ERSX 1HJPA 4YCUA 1HNZL 1D1IA 4EVOA 5CMDA 4XQQA 2YTYA 1G6ZA 2F4IA 4H44C 2K5DA 2B2YA 3RZOH 2LY7A 2VB3X 1EUJA 3BVGA 4A3FH 4V0BA 4K14A 1PH5A 1T5XD 3FP9A 2WV6D 2UUBL 1KRSA 3NP8A 3SR1A 4BS9A 2K05A 4DAVA 1GHJA 3T51B 2JXMB 3CCJA 4A3KG 4A3JG 4DR6L 2NN6G 4B3RL 2NVTH 1KC8C 4GN3B 4H02A 1JMCA 4WFN3 1X9NA 5ISRA 1SYBA 1O78A 3S2HB 4LF9L 3SVMA 2JE6I 2E75C 1Y8NB 1W6JA 5CV7A 3QG1A 4PQXA 3GTQB 1Q7YC 1WTWA 1VS0A 4DR2L 1X55A 1SEBD 2N78A 1IYUA 3R8BA 2OF1A 1WYDA 2JEBI 5DEHA 1PYSB 2C5CA 3CP0A 4OX9Q 2IHFA 4HSPA 1KDCA 3K57A 4CDDC 4QUFA 4DR7Q 2KECA 3DM3A 3NWTA 3K6OA 2JA5B 2E76C 4DV1L 2NZ1D 3U4VA 3IL8A 1NCVA 4KV6A 2BDNA 1W6KA 2C9OA 3FPPA 1VQIA 2OTLA 4KKSA 2JA9A 1TQOA 3S2HH 3NE5B 4DUYQ 1K8AC 4JBMA 5EJWA 2OCEA 4X62Q 4DV5Q 3GTQH 4P73A 3GTPB 4YY3L 3FMCA 4ZUJA 4B3TL 2R92G 1PTOC 1HCZA 2KENA 2QF7A 4DR4Q 3TP7A 1CKNB 5F2DA 4C3HG 1DD2A 4JOIC 2EOTA 5GQOA 5IYBH 4BBRH 1J9OA 3ERQA 1TR5A 3OW7A 3CU7A 4N8X1 4GKJQ 3NEMA 2F3WA 2N3SA 1FGUA 3EVQA 1L0YB 3MXNA 3D4RA 5JJIA 3HOXB 1OXVA 3FHWA 1M8AA 4O0AA 2R7FA 1S5CD 4HR7B 4PV1C 2UUAQ 2K03A 3GTPH 4EQ5A 3CCEA 1PH7A 4MNOA 2I5LX 4A3MG 2B2UA 1BCPC 1X56A 5IGCA 3AU7A 3MFYA 5AJ3Q 5FLXc 1B3QA 1YNJD 4Y7NH 1V9PA 3OSOA 3T53B 3CCVA 5FLXE 4HJ9A 4M1UB 5EGTA 4CJ1B 5HGQA 1G6PA 1JE5A 4FF1A 2PO4A 4PMWA 4IZ8A 1EIHA 1I6VC 3PUYA 1BBUA 3DWAA 4RAUC 2PW7A 4RA8A 3JAMc 2QEXA 3KBGA 4TVAB 3HOXH 3JAME 3S16B 1QUQA 1SJED 5J22A 3S1RB 4UPAA 2NYZD 2RHQB 3KDFA 3F2BA 5I2XA 4LFCL 2XRSD 5I2YA 1JB7A 2EYFA 4DV5L 1MSHA 2F0WA 2A73B 2E2DC 4ULLA 4APVA 4L5SA 3F2DA 3J81c 1X3PA 4EX5A 4DR4L 4LF8L 1L0WA 3URYA 1F2ZA 4KLKA 2PQAB 3G6JB 3KYHC 3T1HQ 1EEFD 1RODA 2KHIA 4MTNA 4LF4L 4X3UA 4FXDA 2A68C 3B6YA 4LFAL 4GKJL 4KHPQ 5EAYA 4A3EB 4R4OA 1F9QA 3G48A 3MHBA 1VQFA 1F2YA 1SBBB 3S16H 4A3LH 4L5QA 1E3PA 1EOTA 1Q1EA 5IYCH 2G9DA 3S1RH 2B2YC 1G291 4QB4A 1BVSA 4NPSA 1XMQQ 2UUAL 1JJCB 3C1EA 4IURA 1XWEA 1W2BA 4GKKQ 5A2QL 1UAPA 3ZYYX 4JBJA 2F0LA 4XYQA 4RHSA 1ZYRC 2BH8A 3DEOA 5JEAG 3MAQA 5K5PA 5CBEE 3ER0A 4R4CA 4KY5A 1HQMC 2LKVA 1XYIA 4P71A 4RWSC 4GOPB 2PNRC 4L5RC 2UXDL 2F0SA 1H9RA 1CK1A 4A3EH 3MXGA 1A8VA 1XNQQ 2M9VA 1KRTA 3KF6B 3HOUG 1XNRQ 2X69A 3NBHA 2FFKB 2VZAA 4C1NK 3KLWA 3SDZA 1TKWB 3WWVA 2M00A 1D1KA 2EYLA 2Q2UA 1I3QB 4MIUA 4ZKCB 3ULJA 3H3VC 2EYJA 1FD7D 4R4IA 2O2LD 3K7UC 5AFWA 1YITA 2WAQB 3K59A 2X6GA 2RA4A 2PZUA 2SNMA 2R7ZG 1C48A 4OIKA 5TSSA 3T1HL 4DXGA 1V1PA 3A8JE 3IKJA 1CQFA 3I3CA 1YHBA 3VA7A 4KHPL 1B3AA 1BCPF 3PO3G 2OT2A 3M4OH 1X3QA 4HIOA 3OIPA 1A62A 1PH6A 3M7GA 4JYAL 1B1ZA 1WTOA 4RCNA 2RF4A 2XN9C 4BA1I 2O4XA 1BCPD 4QUCA 4HJ5A 3BYYB 1I3QH 3ND9A 5FLXL 2ALYB 4IUTA 1IYVA 5M3FB 2RSNA 4K6LA 1CTMA 3ONAB 2ZM6Q 4QIWB 4DNTB 4GKKL 2O5IC 4UP8A 3UE1A 3EFXD 2K01A 5M9OA 1S5ED 1SE4A 1EWCA 1IYJB 5K36H 2B63B 4QCLA 4QY7A 1U9RA 2EYPA 3JAML 4Y52H 3OWEB 3E6ZX 4TSSA 3K5NA 3WDNA 4FF3A 3QB3A 3HZXA 1MKHA 1CT1D 4IFDH 2B2UC 1A6XA 1X3FA 2D9UA 1XNQL 1NAPA 4DAPA 2ENBA 5ELCA 3HRZC 4G7OC 1PZKD 3J81L 3W2DA 1Q82C 2F1MA 3H94A 3K5MA 5M3FH 5IT9E 2EXZA 3NSWA 3IRBA 4P74A 3J80i 1TIID 2NB0A 1VQ5A 4S3SA 1VQHA 2B63H 3HOVG 1JR0D 3I4NH 4HCEA 5DNFA 4EQNA 4G57A 1MIUA 2E5LQ 1NE3A 1I4PA 3CPWA 2LMCB 3BZKA 4KKTA 5BN3A 1AP0A 1E2WA 1MGSA 1ENFA 4Q0FA 1AEXA 1G2SA 2X6LA 3A7AB 2ZJQA 3X3NA 3UE0A 5IP9H 4A3CG 3RNUA 4QJFA 3BVMA 4IOCA 2HUGA 2A6ED 4X3SA 1B9NA 1YI2A 1BO0A 3FKIG 1ZYRD 1KIXA 1WOCA 2Y0SG 5GAGC 3E0EA 3A5ZB 1STEA 4DV6Q 4U673 2D62A 3A74A 5M5WB 1Y1WG 3KJPA 4POGA 1AFPA 2Z4HA 4MTKA 2FINB 2DUDA 1IW7D 3HFZB 3S1MB 1A0IA 3CQZB 2CW0C 5I6WA 1JICA 4QL5A 1Q81C 1HZAA 1NSNS 1R4PB 3TMEA 4NXMQ 3G6EA 2KJXA 4OWTB 1PFSA 2K5QA 4K5VA 3GQBA 2PZTA 1ICFB 2Z4IA 3GTKB 3H6MA 4YHHL 1L0XB 2HHHQ 3I70A 4DFAA 4OGQC 4AQYQ 4K8IA 1HQRD 1Q12A 2B2TA 4RKBA 1QVGA 1K73C 1JJGA 2ID0A 1SE8A 3MC0B 3NUCA 3PIP3 1IXRA 2NUCA 5IWAQ 1MHWC 5IODA 4ZCKA 1M90C 1G2TA 4DUZQ 4J6HA 3S1MH 5A35A 3CCQA 2UXCQ 3KLSX 3CQZH 5FO8B 3LNNA 4V190 3MVVA 5IP7H 4RGNA 3I4MB 2BDOA 4NP5A 1F9SA 1T9HA 4NW2A 3GV3A 1E2ZA 3VYTA 3NENA 4BWGB 1YNXA 5LMNW 1BBXC 2PMZB 3RZDB 4AIMA 1LTAD 1L1OA 4CBVA 4IUUA 3GTKH 1JT8A 3SK6A 1YJ9A 3QOJA 4B3SL 1FVIA 4DAMA 2AWNA 1SMYD 1DOKA 4A3FG 1FL0A 4J15A 1CKMA 1BDOA 4OEMB 4CGYB 1DCZA 1STAA 3S9WA 2JA6B 3T13A 3CMEA 3J7YW 1SNDA 2R7DA 5J3BA 5I9OA 2BA1A 2DGYA 3SK5A 2F0HA 2QDLA 2ZXPA 5ELNA 4OWWB 4H7BA 3I4MH 2RCFA 4CHTB 3RZDH 1ZXTA 3TS2A 2LXKA 4C2MB 2R93B 3D31A 4RMFA 4HCSA 4JI7L 2MNAA 3NTIA 4GZYC 1SFOB 2N88A 4FF4A 1K3RA 1IKMA 4ZQ3A 1JWSD 2JA6H 2PNHA 4A75A 3AMUA 1QJOA 1IKLA 4DNRB 3ZJYC 4BXXH 5IWAL 1E0BA 1PYWD 4DUZL 4GLXA 4IFDJ 1BUVT 2HD3A 3EN2A 2UXCL 2F03A 3OMCA 4DAYA 4XTCS 3DHQA 3NTKA 5C0XH 2EZVA 3PIOA 2JA8B 1ICWA 1ZEQX 1GKHA 1VQMA 3P20A 5KRUA 4C2MH 3WOEA 2R93H 4JI8Q 4KKUA 4LK1C 4LAAA 4HIKA 5LMNQ 3KF6A 4DV4Q 1O7IA 4P2CB 1GXDC 4EQOA 4DV2Q 1JB3A 1R9TB 1Q8IA 5ELOA 2EQSA 3D3RA 1I50B 2Q8RE 2FJ2A 1IL8A 4ZUIA 4LMQD 1XXGA 3BDLA 5IYBG 2MP1A 3W5OA 1RDPD 3D6WA 2JA5G 1KL9A 1GD7A 2ZJRA 3U4ZA 2Z8LA 2J7ZA 4OXPA 3PUVA 2SOBA 4R8IA 3KF8A 4X3TA 1SSOA 5D3IB 4WJ4A 2XWJB 1C4QA 1Z7TA 2NBFA 3U50C 1DZ1A 1Z47A 1WD1A 4B3TQ 5M5XB 3GTJB 4CKBA 1KABA 1QE6A 4I7AA 1RJTA 1TWAB 1QCBD 1S5FD 1MD2D 3TQYA 3H09A 4ABNA 5NUCA 2JA8H 5M3MB 2PI2E 1Y14B 1RTNA 1EIGA 5EPJA 3J80c 4OO1H 3VR2A 4A3BB 3J80E 2BCOA 5J39A 1T5EA 1R9TH 5HGTA 1I50H 3HEJA 2HIXA 2F0FA 3KBXA 1FR3A 3HOYB 1GUSA 1S5DD 4FVMA 2E2HB 2R61A 1ENCA 1TXYA 4JI1Q 2F52A 3BZCA 5M5XH 2IY5B 2VQFQ 3GTJH 3STBC 3HOXG 5T1IA 2F0UA 1TWAH 3HOWB 4BY7B 2IPKD 5M3MH 3K0XA 2HQEA 3LX0A 3PUWA 4DK1A 1CKOA 1I4GA 3A56A 3M3YB 4IFDI 3OIQA 3CKIB 1PLFA 1A63A 5JJZA 1U5KA 1K8OA 2B2TC 1MI2A 3BG3A 2JN4A 1VQ8A 3F8TA 2N55A 3CC2A 4BBRB 3TN2A 3CMAA 4JI8L 1OTCA 1CA5A 4A3BH 5LMNL 4DV4L 3L0OA 1PFBA 4DV2L 4HSVA 3SEBA 2E8GA 3HOYH 1QVFA 1DM0B 2QCPX 2N8NA 4FXGC 2L9HA 4C3JB 1EZ8A 2E2HH 1E1TA 2KA7A 1JWMD 4LFCQ 1ILQA 1HFGA 1SYDA 3R2IA 3Q0AA 5JAVA 2A69D 2HDLA 4A3LG 1L1OC 1K0RA 3Q24A 3EROA 3HOWH 4BY7H 1JOOA 1J5EQ 4PNYA 5IYCG 1PFNA 3M3YH 4LF8Q 2F3IA 4Y7NB 1QZHA 1A3VA 1S5BD 1F77A 3PUZA 1EQTA 2ICEC 4LF4Q 1BNZA 1E7ZA 2Q2TA 4LFAQ 1CI3M 3H15A 3A8IE 4E6IA 5C4ZA 1CZGA 3M9BA 4C3JH 1XPUA 3TP8A 2OTJA 4LUZA 1NY4A 1Q8KA 4A3EG 2SEBD 1VQAA 4HJ7A 4K2LA 1GUNA 4JI1L 1SN8A 2VQFL 3OWFA 4YWLA 3EBEA 1PH9A 4KN4C 4JBWA 2ZJPA 5FK9C 1HZ9A 4PMBA 2GVBA 1SE2A 2WAQE 4CDFC 4DR1Q 2EVBA 2QILA 2L1BA 1EYGA 1HPCA 4GNXB 4IUQA 4FYDA 2UXDQ 4UP9A 1PZID 5C3EB 1W3SA 3BZDB 5E7NA 2Q2IA 2ZXOA 1EYCA 1N36Q 4KJOA 1BBWA 4X6AH 3A54A 1AZPA 5C0XJ 2KCMA 2TSSA 2KEEA 3GTOB 4A3IG 1QZGA 1EU4A 4ALPA 5DM73 3BJUA 2L15A 2AQ1B 4B9WA 4KHZA 4QIWE 2QA4A 1J5EL 4BY1B 3J80L 4A93B 3E0JA 2SNSA 5KIXA 1I4XA 2QGQA 1PTOB 1X32A 1M1KC 3S2DH 3VR5A 3QR8A 1VF7A 3GTLB 4LFBQ 3FEWX 3A7LA 3I91A 1VQGA 4J1MA 1V1QA 2WAQG 2B39A 5C3EH 3MEFA 3QO2A 3M4QA 4NMZA 3QJYA 5K36G 2YTVA 1LTID 4JV5Q 1VQJA 5IGDA 4JYAQ 3CCLA 1YZ6A 5ELEA 4R9WA 5LHY1 1VQ6A 4LWCA 3GTOH 4UDUC 4HJ8A 1YJWA 1VQEA 3ULLA 4ID6A 2PW5A 4IFDG 1SROA 4XIGS 5EBCA 2K50A 1UEAB 4RGOS 5EBDA 2RKSA 1UE5A 1Y1VB 1UE6A 1F2MA 3M4PA 5IE8A 1STBA 4JI2L 4BY1H 4A93H 1NBWA 2R6GA 2F4VQ 5EQ0A 1PTOH 1LUZA 1JE4A 1BCPB 1II3A 4DR1L 1QVCA 2A6HC 2N49A 1EY5A 1TWGB 5M3FG 3GTLH 1PH3A 2K75A 2QDBA 4NXNQ 3J7AF 2MPMA 2WP8J 3PUXA 1VQ4A 2VS1A 1HA5A 2D0OA 5M5YB 2B63G 1PTOF 2XNAC 4JK1C 3PO2B 1XMOL 2L0CA 4ME5A 4AYBB 4DK6C 3M4OB 1N36L 1PH8A 1CSPA 4ZRZA 1PTOD 1U4PA 1NNXA 2RQXA 5GROA 1BR9A 1HXYD 1EIFA 5C0XI 4K0KQ 2BE5C 1R4QB 4LF6Q 2CVRA 1Y1VH 1X3EA 2AHOB 3FDTA 4U68A 4WJ3M 2D5DA 1WTXA 1RIPA 5DLQE 1TY0A 1E1OA 4A3MH 1EOVA 3VA5A 4ZLTF 3R93A 1TWGH 1HZBA 1Q3LA 4LFBL 5D65A 4R1JA 2KBNA 2DJGC 5M5YH 1I4RA 5IYDH 1KD1C 1TWFB 3PO2H 1K0SA 4JV5L 4DR3Q 2FMCA 5COYA 4K6DA 4JI3Q 1VQ9A 3LWUA 5KYLA 4DGZA 5IGGA 2DNEA 2CHBD 2EIFA 3N52A 1H9KA 2WINB 4G4KA 4JCVE 1LYLA 1C9OA 3U58A 2WB1E 1PRTC 4IUVA 2F4VL 4OO1I 5C5MA 2G9HD 4ZAIA 3I4NB 2CWAA 1RHPA 4F88A 1GOZA 3J81j 3M7NA 5EKIA 2A8VA 1EWIA 3L7ZC 4NXNL 2IHEA 4LF5Q 1TWFH 3GP7A 1IBKL 1RTOA 3TS0A 1NJIC 5CV5A 2YU9B 3DWQA 3MEHA 4JI6Q 3U9OA 2PMZE 1HR0W 4YIJA 4YHHQ 5IP7G 2ZTCA 2F0IA 4UHVA 2KCCA 5FJ8H 4XQJA 3NXWA 1V43A 2IW3A 1EL0A 3HP3A 2JYOA 5IT9c 4QQBX 1JOKA 3NELA 4JBKA 4K0KL 1SYFA 1O7YA 3MXUA 1A3TA 4LF6L 4G7HC 1PV4A 2IT1A 4HIMA 4B08A 4EQPA 5IGEA 5IY0A 1YNNC 2A68D 3VDYA 2F0GA 3HKZB 4IUPA 5H1SE 4P72A 1JQYD 1WFQA 3L2PA 4LNQA 4FDBA 5CC4A 3EQLC 3QOLA 4DKAC 3SK8A 1KTKA 3A8KE 1YIJA 5JPNC 4OIJA 1WTQA 2YU9H 3GV6A 1PH2A 1H9MA 3DWPA 1MJCA 3I90A 4DR3L 4B3SQ 3I4MG 4O2DA 4JI3L 4FP5D 3F2CA 1X65A 4C3IB 1RF2D 2B2VA 1WTHA 1UE7A 2K6AA 2G5DA 3SGIA 2FMMA 1TS4A 2K28A 2HIVA 4GN4B 1KAWA 4B9XA 3OHXC 2XTIA 1IBMQ 3H3VH 2CH4A 1LTLA 1DYQA 1CKNA 2WKCA 4RH6A 4FNFA 4HJAA 4I7ZC 2VUMB 3CXCA 1EY0A 4A3DB 3TP5A 1K9MC 3OW2A 1EFID 3TEHB 2JA6G 3D6CA 3E3XA 4DK0A 1KNEA 2KQ3A 4F8MA 1LTRD 2IWHA 4LJZC 4BXXG 4LF5L 2K52A 4HN7A 1UEBA 4JI6L 3I4LA 4JI7Q 5C0XG 1N9WA 2V4DA 3CRLC 2CQOA 1HR0Q 3E9IA 4C3IH 1I5FA 2K04A 1SJHD 1DXMA 1SMXA 3HGBA 3HOZB 4BBSB 3OTOQ 2R93G 3C2PA 5BR8Q 2WB1B 1OXTA 2PI2A 1ENAA 3NWSA 4ZKBB 2VUMH 2PCFB 4A3DH 2MJ8A 2A19A 4PZ7A 4GNXA 4YCWA 1EYDA 3S1NB 1VQBA 2K5VA 2V1CC 2JA7G 4OELB 3TREA 2AWOA 1AE2A 1KHIA 2A74C 1CQVA 1QUQB 3S24A 3C1FA 4IO9A 2F0OA 5GAHC 1I6HH 3K7AB 4GN5A 3RMHA 3KDFB 2K32A 5CBAE 4DR5Q 2JA8G 1H95A 2I07B 4XQNA 3P1HA 2Q2HA 3TBIB 2BH2A 3MTSA 1LT3D 4CJ2C 1HFNA 3AQQA 2CCZA 3HOZH 2CWPA 4BBSH 2JSOA 4Q5VA 4N9PA 4DK3C 4IPHA 1GM5A 4ZYSA 3JC66 1HH2P 3RR5A 5LL6X 1IBML 4H0LC 2NZHA 4PZ6A 2LS01 1N8RC 2D2CC 5IGBA 3S1NH 2PQAA 1OO9B 2K1BA 1P8LA 2PPBC 3UDGA 2ZXRA 4OWXB 4X3KA 1VMCA 3KJOA 1STYA 4DV0Q 4JW0A 1WI5A 3CF5A 3G4SA 1H9SB 1U4LA 3K7AH 3MFGA 2NVXB 2RHSB 1EU3A 5IT9L 1J6QA 4RFBA 4H13C 5M3MG 4RGMA 1P16A 4MN3A 1WCMB 1GUTA 4XT1B 1HR0L 5JJKA 2H4OA 3D0FA 2TMPA 1PH4A 3VR6A 1KAAA 1VQLA 2CH4W 2B8FA 3NQIA 4PMCA 3OTOL 1VQOA 3AFQA 3S15B 4A3BG 2JP1A 4LUOA 5BR8L 1E22A 1FJGL 1Y69U 1PDQA 4LF7Q 2KHSA 2P5ZX 5JVH3 2NZOA 3IFDA 4JI5L 4OHJA 1RL2A 3HOYG 3BDOA 3C46A 1Y1WH 1B70B 1V8QA 1VF5C 2KCNA 4GOPA 5J1ZA 1LTTD 3GDEA 5ELBA 1LV9A 3NPPA 5C4XB 1HUMA 5JOBA 1DOLA 2NVXH 3V05A 1QNUA 2J4XA 3H0GB 4R8NA 3R2TA 1CFMA 3HOWG 4BY7G 2OXPA 5EPKA 5C44B 2Q8TA 4DR5L 1WCMH 4TRDA 2NVQB 3BVZA 4HMIA 5E3FA 3D4WA 5ELFA 2GA4B 1WJJA 1E2VA 4BBRG 3S15H 3Q23A 4FXKC 4LW1A 2NTSA 4A3GB 2C35B 3HS0C 4DA2A 1TS2A 2EYHA 3RLOA 2CW0D 1I4QA 1YNJC 3PF5A 5KEEA 2EXDA 1V1PB 2MO0A 4L6TB 3K81C 3GD7A 3PSIA 2F0PA 2IX3A 3F1ZA 1AH9A 2EE1A 3W3AA 4JG2A 5CR3A 3G7LA 4C3JG 1GO3E 3BDCA 5C4XH 2VQEQ 2VB2X 3CCUA 1KDBA 3VR3A 1IHZA 2B2VC 4RHRA 2L5TA 2K5NA 4DV0L 2IJ0A 3H0GH 4N8FA 1FNUA 3Q6SA 3HKSA 3K0YA 4NB3A 5KNBA 2VL6A 5LMUL 1VQ7A 2L4NA 3TRZA 2UU9Q 2I46A 4KJNA 5C44H 4A4IA 2NVQH 1KXLA 5CV9A 3NBIA 3L3OC 4HIDA 2K14A 2CKZB 1TT2A 2F0VA 5FLMH 4A3GH 4XYOA 3MXPA 1SNMA 4HTHA 1VCIA 1EQVA 1GVPA 4DV3L 1STNA 1F9RA 5CGKA 4LF7L 2XGTA 1XJVA 3DXJC 3I56A 2AKWB 1SE3A 1RCVD 3BU2A 3J7ZC 1QOHA 4WORA 1LT4D 2FXQA 1TY2A 2XIWA 4C56C 2RVLA 1FGBD 4K5XA 4X64Q 3DEPA 2ZTDA 2WKDA 1HRJA 5FO7B 1CHQD 2B29A 3IFTA 4GNXC 1VQDA 5KYIA 2LFNA 2EJFC 1FNWA 4I65A 2XVSA 4J8QA 1WTRA 1VQKA 2EY1A 1K8GA 5GADC 3PQIA 5C3EG 2E2IB 4XXEA 3R3OA 5CV8A 2UUCL 1NUCA 3PGZA 5A2QE 3PV0A 1KDAA 3OYYA 3KLRA 4JI0L 1HA6A 4IJHA 2MGSA 2EY5A 2VQEL 3BYTB 1PH1A 4HAEA 3CAMA 1IL2A 1K28A 4DN4M 3W1BA 2VNUD 2UU9L 4YCVA 4BY1G 4A93G 1XTCD 1UE1A 1X3GA 2F3VA 1HUNA 2F0EA 2ZT9C 1PXUA 3L9AX 5I6YA 3H3VI 2F0DA 4K8JA 1ASYA 3GO5A 1TS5A 4A3KB 4AYBE 2Z6BA 2E2IH 4A3JB 4KHVA 4JI4Q 1G8ZD 1U0LA 4X65Q 1VQNA 1B50A 2K5WA 2JA5H 1DONA 4KMUC 3F2UA 1EEID 5JJLA 5CV4A 3VR4A 4IOAA 3ND8A 2HDMA 1NMGA 1BF4A 3N6RA 4JI2Q 1SDFA 3OMGA 4LUVA 2IL8A 5C6AA 3LGJA 3PMFA 1HTLD 3PF4A 1B9MA 1KNAA 1YBYA 3D4DA 3S2DB 3UDFA 1Y1VG 1UUPA 4X64L 3K80C 1I4HA 4XT3B 4QF4A 2RDHA 5C3WA 2VXWA 3KOJA 2HCCA 1O7LA 2IX0A 4YWMA 2WACA 5IIFA 3A55A 4GLAC 1O7ZA 1XMOQ 4DPGA 4N9TA 1A2TA 3CHBD 1XPOA 4A3KH 1SXTA 4Z9CB 4A3JH 4GOPC 2NN6H 1YHQA
chains in the Genus database with same CATH topology
2K7VA 2SDFA 4NDXA 3QWNA 2M2LA 4WJWA 5C3XA 2WIIB 1D2BA 1NR4A 4HEDA 1OXUA 1A3UA 1TWHB 3RD4A 4FO2A 2PYKA 1KLGD 4TQUS 3V96A 2R92B 3LWEA 3VYUA 4C3HB 1CA6A 5ELDA 4UAIA 1SYGA 2F0MA 1QB5D 1EY8A 1AZQA 4IQZA 5HURA 2KUMA 2B2WA 1B53A 3J81E 5E4WC 1WTVA 5KNCA 4RGTA 2AQ2B 3P7JA 3FVQA 5T1GA 5E4XA 3PIO3 2EJMA 1DJRD 2EY2A 4A3MB 3T4AC 1BQQT 1H9SA 1WD0A 1LACA 1A15A 2RBMA 3FRPB 2FHTA 3RUZA 3J7AV 3FPUB 1ONLA 4KTAA 2F0TA 1ET6A 1M4VA 1TU2B 2A6EC 3KUPA 3AB9A 4TKOB 3GTMB 2Q8IB 2QKIC 5FO9B 3DMUA 1HHVA 2J0TD 3Q22A 5KGUA 4DF7A 5FOBB 1IW7C 4A3IB 4IN3A 2AUJD 2NVYB 1UNSA 4HMJA 2Z1CA 2OEOA 4XDXA 3X3MA 2DY7A 2EDGA 1ILPA 2JEAI 2R3ZA 2HCIA 4WRDA 1STGA 2PZWA 1ML0D 1QG7A 1VMPA 5C4HA 3V2TA 3BS1A 3EA6A 5IOCA 1STHA 3TDQA 2RDFA 1EZ6A 1ESFA 4M8AA 1NR2A 4CJ0B 4C3IG 1EWHA 3CRKC 2IX1A 1FNVA 5C5LA 1ZKOA 1RKNA 4K2KA 4KD4A 4C1NI 2RSOA 1SNQA 1KLUD 3QIAA 3NQTA 1SMYC 4OL7A 1HTPA 1SNOA 4DXFA 1TWCB 2EJGC 3UI2A 3EJIA 2ICIA 1EYAA 3TP6A 3HOUB 5G3LF 1K83B 3KLSA 3GTGB 1LLRD 1F9PA 2XWBB 1OXXK 5G3LD 1G91A 1B4OA 3VYSA 3NTHA 3D8GA 3C3LA 1EY9A 2AUKA 1LABA 3P75A 4KK7A 5JEAH 2A5HA 3RLFA 5EKKA 1CZWA 1FYCA 2R7ZB 3I73A 4EGVA 3I72A 2DY8A 5JPMC 1EY4A 4ZK9B 2H1EA 3DUZA 1B2TA 1A2UA 2F0JA 1VDZA 3PO3B 3SXHA 5IGFA 2DNCA 1GUOA 2EYOA 4DU9A 4O1NA 1LT6D 2A6HD 5I9PA 3S17B 2KEDA 1CM9A 3MWYW 1O80A 1GUWA 1DOMA 4L8JA 1JOQA 1PFMA 5C4JB 2XSCA 1JWUD 4RKLA 2BA0A 2B2WC 2F0QA 3K5OA 1PRTB 3SHLA 1F2LA 5FKAC 3M85A 2O5JC 2NWGA 4CKEA 1I6HB 1OXSC 5D14A 5BN4A 4L63B 1J8IA 4K5WA 4ODGA 2BE5D 4IUNA 5D3DA 4FF2A 4ILWA 1JORA 1GUGA 3IAYA 1TVXA 5I4DA 2KVMA 5KNDA 5EPLA 3MA2B 3TZUA 1WVLA 1B44D 4F7XA 1Q1BA 1U4RA 1AN8A 5DAUA 1SAPA 1D5MC 5CYUA 1LTSD 1Q90A 2KOLA 4KI0A 3HOVB 4KY6A 3K5LA 1MSGA 1QNKA 3SE0A 1BXTA 3H91A 2L55A 1K8MA 2NN6I 4KD3A 5LL6S 1PRTF 1SYEA 1EY7A 2L12A 1GJXA 1RD9D 1ESRA 3M4YA 1PRTD 4OO1G 3VYRA 1WTPA 1PZJD 4RCOA 3S1QB 1TS3A 3FKIB 1Y8PB 3O13A 2EY6A 4G7ZC 2Y0SB 2CQAA 2YYZA 2B8GA 1V1OA 5JVG3 3DM1A 1U4MA 1Y1WB 3WOFA 5DM63 2EYMA 1GHKA 3SK4A 1H9JA 3T16A 4BA2I 3E5SA 1Z6HA 2RDGA 1LO5D 5E1FA 3U9SA 2E74C 1JCKB 4F87A 4CKCA 1QWYA 1YNND 2A69C 3NK9A 3NHHA 1D5ZC 2MHVA 3OPOA 4MHEA 1PMRA 1D6EC 1LTBD 1ET9A 4NKLA 2F0NA 3MZ5A 2E2JB 2BOSA 3TSSA 2MUYA 2JA7B 3T56B 2XRQD 4KY7A 3KK7A 4QMGA 2EPBA 3S14B 1QILA 3TZDA 3OOCA 1LT5D 1D5XC 2PQEA 5BN5A 1JC7A 1S4ZA 2F0KA 3RZOB 3ITPA 4A3FB 1SYCA 4IALA 5JEAJ 1Y8OB 2L11A 1AW7A 1XX8A 5CV6A 1C8CA 2AQ3B 3HG9A 1BOSA 2DN8A 1EY6A 1MBYA 2NVTB 4KN7C 2QEJC 1SNPA 1SNCA 3K58A 2K33A 1CHPD 3I8ZA 4O42A 5CORA 2NTTA 1LTGD 5EKLA 1D1IA 4EVOA 5CMDA 4XQQA 1G6ZA 2F4IA 4H44C 2K5DA 2B2YA 2LY7A 2VB3X 3BVGA 4V0BA 4K14A 1T5XD 2WV6D 3NP8A 3SR1A 4BS9A 2K05A 4DAVA 1GHJA 3T51B 2JXMB 2NN6G 4WFN3 5ISRA 1SYBA 1O78A 3S2HB 3SVMA 2JE6I 2E75C 1Y8NB 1W6JA 5CV7A 3QG1A 4PQXA 3GTQB 1WTWA 1SEBD 1IYUA 3R8BA 2OF1A 2JEBI 5DEHA 2C5CA 4HSPA 1KDCA 3K57A 4QUFA 2JA5B 2KECA 3NWTA 3K6OA 2E76C 2NZ1D 3IL8A 1NCVA 4KV6A 2BDNA 1W6KA 2C9OA 3FPPA 4KKSA 1TQOA 3NE5B 5EJWA 3GTPB 3FMCA 4ZUJA 1PTOC 1HCZA 2QF7A 3TP7A 5F2DA 4C3HG 1DD2A 2EOTA 1J9OA 3ERQA 1TR5A 3OW7A 3CU7A 2F3WA 3EVQA 1L0YB 3MXNA 3D4RA 3HOXB 1OXVA 1M8AA 1S5CD 4HR7B 4PV1C 2K03A 2B2UA 1BCPC 5IGCA 3AU7A 3MFYA 1YNJD 3OSOA 3T53B 5FLXE 4M1UB 5EGTA 4CJ1B 4FF1A 2PO4A 4PMWA 4IZ8A 1EIHA 1I6VC 3PUYA 3DWAA 4RAUC 2PW7A 4RA8A 3KBGA 3JAME 3S16B 1SJED 5J22A 3S1RB 2NYZD 5I2XA 2XRSD 5I2YA 2EYFA 1MSHA 2F0WA 2A73B 2E2DC 4ULLA 1X3PA 3URYA 1F2ZA 3G6JB 1EEFD 1RODA 4X3UA 4FXDA 2A68C 4A3EB 1F9QA 3MHBA 1F2YA 1SBBB 1EOTA 1Q1EA 2G9DA 2B2YC 1G291 4QB4A 3C1EA 4IURA 1XWEA 5A2QL 1UAPA 3ZYYX 2F0LA 4XYQA 4RHSA 1ZYRC 3DEOA 5JEAG 3MAQA 5K5PA 5CBEE 4KY5A 1HQMC 2LKVA 1XYIA 4RWSC 2PNRC 2F0SA 1H9RA 1CK1A 3MXGA 2M9VA 2X69A 3NBHA 2FFKB 4C1NK 3SDZA 1TKWB 2M00A 1D1KA 2EYLA 1I3QB 4MIUA 4ZKCB 3H3VC 2EYJA 1FD7D 2O2LD 5AFWA 2WAQB 3K59A 2X6GA 2RA4A 2PZUA 2SNMA 1C48A 4OIKA 5TSSA 4DXGA 1V1PA 3A8JE 3IKJA 1CQFA 3I3CA 3VA7A 1B3AA 1BCPF 2OT2A 1X3QA 3OIPA 3M7GA 1B1ZA 1WTOA 4RCNA 4BA1I 2XN9C 2O4XA 1BCPD 4QUCA 3BYYB 3ND9A 5FLXL 4IUTA 1IYVA 5M3FB 2RSNA 4K6LA 1CTMA 3ONAB 4QIWB 4DNTB 2O5IC 3EFXD 2K01A 5M9OA 1S5ED 1SE4A 1EWCA 5K36H 2B63B 4QCLA 1U9RA 2EYPA 3JAML 3OWEB 3E6ZX 4TSSA 3K5NA 3WDNA 4FF3A 3QB3A 3HZXA 1CT1D 4IFDH 2B2UC 1A6XA 2D9UA 1NAPA 4DAPA 2ENBA 5ELCA 3HRZC 4G7OC 1PZKD 3J81L 3W2DA 2F1MA 3H94A 3K5MA 5IT9E 2EXZA 3NSWA 1TIID 2NB0A 4S3SA 1JR0D 4HCEA 5DNFA 4EQNA 4G57A 1I4PA 2LMCB 5BN3A 4KKTA 1AP0A 1E2WA 1MGSA 1ENFA 4Q0FA 1AEXA 1G2SA 2X6LA 3A7AB 3X3NA 3BVMA 2HUGA 2A6ED 4X3SA 1B9NA 1BO0A 1ZYRD 1STEA 4U673 2D62A 5M5WB 1AFPA 2Z4HA 2FINB 1IW7D 3S1MB 3CQZB 2CW0C 5I6WA 1JICA 1NSNS 1R4PB 3TMEA 2KJXA 2K5QA 4K5VA 3GQBA 2PZTA 2Z4IA 3GTKB 3H6MA 1L0XB 3I70A 4DFAA 4OGQC 4K8IA 1HQRD 1Q12A 2B2TA 4RKBA 2ID0A 3MC0B 3PIP3 3NUCA 2NUCA 5IODA 1G2TA 4J6HA 5A35A 3KLSX 5FO8B 3LNNA 4V190 3MVVA 4RGNA 3I4MB 2BDOA 4NP5A 1F9SA 4NW2A 3GV3A 1E2ZA 3VYTA 4BWGB 1BBXC 2PMZB 3RZDB 1LTAD 4CBVA 4IUUA 3SK6A 3QOJA 2AWNA 1SMYD 1DOKA 1BDOA 4CGYB 1DCZA 1STAA 3S9WA 2JA6B 3T13A 3J7YW 1SNDA 5I9OA 2BA1A 3SK5A 2F0HA 2ZXPA 4H7BA 4CHTB 1ZXTA 4C2MB 2R93B 3D31A 4HCSA 3NTIA 4GZYC 1SFOB 2N88A 4FF4A 1IKMA 4ZQ3A 1JWSD 3AMUA 1QJOA 1IKLA 4DNRB 1E0BA 1PYWD 4IFDJ 1BUVT 2F03A 3OMCA 4DAYA 4XTCS 3DHQA 3NTKA 5C0XH 2EZVA 2JA8B 1ICWA 1ZEQX 3P20A 5KRUA 3WOEA 4KKUA 4LK1C 4LAAA 4P2CB 1GXDC 4EQOA 1JB3A 1R9TB 1Q8IA 3D3RA 1I50B 2Q8RE 2FJ2A 1IL8A 4ZUIA 4LMQD 1XXGA 3BDLA 2MP1A 1RDPD 3D6WA 2Z8LA 2J7ZA 3PUVA 2SOBA 4R8IA 3KF8A 4X3TA 1SSOA 5D3IB 2XWJB 1C4QA 1Z7TA 2NBFA 1DZ1A 1Z47A 1WD1A 5M5XB 3GTJB 4CKBA 1KABA 1QE6A 1RJTA 1TWAB 1QCBD 1S5FD 1MD2D 4ABNA 3H09A 5NUCA 5M3MB 1RTNA 1EIGA 5EPJA 4OO1H 3VR2A 4A3BB 3J80E 2BCOA 5J39A 1T5EA 5HGTA 3HEJA 2F0FA 3KBXA 1FR3A 3HOYB 1GUSA 1S5DD 4FVMA 2E2HB 2R61A 1ENCA 5T1IA 2F0UA 3HOWB 4BY7B 2IPKD 2HQEA 3LX0A 3PUWA 4DK1A 1I4GA 3A56A 3M3YB 4IFDI 3OIQA 3CKIB 1PLFA 5JJZA 1K8OA 2B2TC 1MI2A 3BG3A 2N55A 4BBRB 3TN2A 1CA5A 1PFBA 4HSVA 3SEBA 1DM0B 2QCPX 4FXGC 2L9HA 4C3JB 1EZ8A 2KA7A 1JWMD 1ILQA 1HFGA 1SYDA 3R2IA 3Q0AA 5JAVA 2A69D 2HDLA 3Q24A 3EROA 1JOOA 4PNYA 1PFNA 4Y7NB 1A3VA 1S5BD 1F77A 3PUZA 1EQTA 2ICEC 1BNZA 1CI3M 3A8IE 4E6IA 5C4ZA 1CZGA 3TP8A 2SEBD 4K2LA 1GUNA 3OWFA 4KN4C 4JBWA 5FK9C 4PMBA 1SE2A 2EVBA 2QILA 2L1BA 1HPCA 4IUQA 4FYDA 1PZID 5C3EB 3BZDB 2ZXOA 1EYCA 4KJOA 3A54A 1AZPA 5C0XJ 2TSSA 2KEEA 3GTOB 1EU4A 5DM73 2AQ1B 4B9WA 4KHZA 4BY1B 3J80L 4A93B 3E0JA 2SNSA 5KIXA 1I4XA 1PTOB 1X32A 3VR5A 1VF7A 3GTLB 3FEWX 3A7LA 3I91A 4J1MA 2B39A 3QO2A 4NMZA 3QJYA 5K36G 1LTID 5IGDA 5ELEA 4R9WA 5LHY1 4UDUC 4ID6A 2PW5A 4IFDG 4XIGS 5EBCA 1UEAB 4RGOS 5EBDA 2RKSA 1Y1VB 1F2MA 1STBA 2R6GA 5EQ0A 1PTOH 1JE4A 1BCPB 1II3A 2A6HC 1EY5A 1TWGB 2QDBA 3J7AF 2MPMA 2WP8J 3PUXA 1HA5A 5M5YB 1PTOF 2XNAC 4JK1C 3PO2B 2L0CA 4ME5A 4AYBB 3M4OB 4ZRZA 1PTOD 1U4PA 2RQXA 1BR9A 1HXYD 5C0XI 2BE5C 1R4QB 2CVRA 3FDTA 4U68A 2D5DA 1WTXA 1TY0A 3VA5A 4ZLTF 3R93A 1Q3LA 5D65A 1I4RA 1TWFB 2FMCA 5COYA 4K6DA 3LWUA 5KYLA 4DGZA 5IGGA 2DNEA 2CHBD 3N52A 1H9KA 2WINB 4G4KA 1PRTC 4IUVA 4OO1I 5C5MA 2G9HD 4ZAIA 3I4NB 1RHPA 4F88A 1GOZA 3M7NA 5EKIA 3L7ZC 3GP7A 1RTOA 5CV5A 2YU9B 3DWQA 3MEHA 3U9OA 4YIJA 2F0IA 2KCCA 4XQJA 3NXWA 1V43A 2IW3A 1EL0A 3HP3A 2JYOA 1JOKA 1SYFA 1O7YA 3MXUA 1A3TA 4G7HC 2IT1A 4B08A 4EQPA 5IGEA 1YNNC 2A68D 2F0GA 3HKZB 4IUPA 1JQYD 5CC4A 3EQLC 3QOLA 3SK8A 1KTKA 3A8KE 5JPNC 4OIJA 1WTQA 3GV6A 1H9MA 3DWPA 3I90A 4FP5D 4C3IB 1RF2D 2B2VA 2K6AA 2FMMA 1TS4A 2K28A 4B9XA 3OHXC 1DYQA 2WKCA 4RH6A 4FNFA 4I7ZC 2VUMB 1EY0A 4A3DB 3TP5A 1EFID 3D6CA 4DK0A 1KNEA 2KQ3A 4F8MA 1LTRD 2IWHA 4LJZC 4HN7A 3I4LA 5C0XG 2V4DA 3CRLC 2K04A 1SJHD 1DXMA 3HGBA 3HOZB 4BBSB 3C2PA 2WB1B 1OXTA 1ENAA 3NWSA 4ZKBB 2PCFB 2MJ8A 1EYDA 3S1NB 2AWOA 2A74C 1CQVA 3C1FA 2F0OA 3K7AB 3RMHA 2K32A 5CBAE 2I07B 4XQNA 3P1HA 3TBIB 3MTSA 1LT3D 4CJ2C 1HFNA 2JSOA 4Q5VA 4N9PA 4ZYSA 5LL6X 4H0LC 2LS01 2D2CC 5IGBA 1OO9B 2K1BA 2PPBC 2ZXRA 4X3KA 1VMCA 1STYA 1H9SB 1U4LA 3MFGA 2NVXB 1EU3A 5IT9L 4RFBA 4H13C 4RGMA 4MN3A 1WCMB 1GUTA 4XT1B 2H4OA 2TMPA 3VR6A 1KAAA 3NQIA 2B8FA 4PMCA 3S15B 2JP1A 1Y69U 1PDQA 2KHSA 5JVH3 3IFDA 4OHJA 3BDOA 3C46A 1V8QA 1VF5C 2KCNA 5J1ZA 1LTTD 5ELBA 1LV9A 3NPPA 5C4XB 1HUMA 5JOBA 1DOLA 3V05A 1QNUA 2J4XA 3H0GB 4R8NA 3R2TA 1CFMA 2OXPA 5EPKA 5C44B 2Q8TA 4TRDA 2NVQB 3BVZA 4HMIA 5E3FA 3D4WA 5ELFA 2GA4B 1E2VA 3Q23A 4FXKC 2NTSA 4A3GB 3HS0C 4DA2A 1TS2A 2EYHA 2CW0D 1I4QA 1YNJC 5KEEA 1V1PB 4L6TB 3GD7A 2F0PA 2IX3A 2EE1A 3W3AA 5CR3A 3G7LA 4C3JG 3BDCA 2VB2X 1KDBA 3VR3A 1IHZA 2B2VC 4RHRA 2L5TA 2IJ0A 5KNBA 1FNUA 3Q6SA 3K0YA 2L4NA 2I46A 4KJNA 5CV9A 3L3OC 3NBIA 1TT2A 2F0VA 4XYOA 3MXPA 1SNMA 4HTHA 1VCIA 1EQVA 1STNA 1F9RA 5CGKA 3DXJC 1SE3A 1RCVD 1QOHA 4WORA 1LT4D 1TY2A 2XIWA 4C56C 2RVLA 1FGBD 4K5XA 3DEPA 2WKDA 1HRJA 5FO7B 1CHQD 3IFTA 5KYIA 2LFNA 2EJFC 1FNWA 4I65A 2XVSA 4J8QA 1WTRA 2EY1A 2E2IB 4XXEA 3R3OA 5CV8A 1NUCA 5A2QE 3PV0A 1KDAA 3KLRA 1HA6A 2MGSA 2EY5A 3BYTB 4HAEA 4DN4M 2VNUD 1XTCD 2F3VA 1HUNA 2F0EA 2ZT9C 1PXUA 3L9AX 5I6YA 2F0DA 4K8JA 3GO5A 1TS5A 4A3KB 4A3JB 4KHVA 1G8ZD 1B50A 2K5WA 1DONA 4KMUC 3F2UA 1EEID 5CV4A 3VR4A 3ND8A 2HDMA 1BF4A 3N6RA 1SDFA 3OMGA 2IL8A 5C6AA 3PMFA 1HTLD 1B9MA 1KNAA 3D4DA 3S2DB 1UUPA 4XT3B 1I4HA 4QF4A 2RDHA 5C3WA 2VXWA 2HCCA 1O7LA 2IX0A 2WACA 5IIFA 3A55A 1O7ZA 4N9TA 1A2TA 3CHBD 1SXTA 4Z9CB 2NN6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRZ A;  4F87 A;  4F88 A; 
#chains in the Genus database with same CATH topology
 2K7V A;  2SDF A;  2K4K A;  4NDX A;  4OX9 L;  3QWN A;  2M2L A;  4WJW A;  4R4T A;  5C3X A;  5IYD G;  2WII B;  3PO2 G;  2LXJ A;  1D2B A;  1NR4 A;  3EIV A;  4DR7 L;  4AYB G;  2JK8 A;  4HED A;  1OXU A;  1A3U A;  1TWH B;  3RD4 A;  4FO2 A;  2PYK A;  1C7Y A;  1KLG D;  4TQU S;  1L1O B;  3V96 A;  2R92 B;  3RLN A;  3UDI A;  3LWE A;  4DUY L;  1DGS A;  4PG3 A;  3VYU A;  4C3H B;  1CA6 A;  2OQK A;  5ELD A;  4UAI A;  4X62 L;  1SYG A;  2F0M A;  2AMC B;  4JVZ A;  1QB5 D;  1EY8 A;  1AZQ A;  4IQZ A;  1SRU A;  3PIP A;  5HUR A;  2KUM A;  2B2W A;  1B53 A;  3J81 E;  5E4W C;  3STB D;  3CW2 C;  2I0Q A;  1IZ6 A;  1WTV A;  5KNC A;  4RGT A;  4JI4 L;  2AQ2 B;  4P75 A;  3P7J A;  4X65 L;  2Z0S A;  1XPR A;  3FVQ A;  5T1G A;  1TWH H;  5E4X A;  3E9H A;  3PIO 3;  2EJM A;  4IJL A;  2CFM A;  1DJR D;  1HNW Q;  5FJ8 G;  2EY2 A;  3T1Y Q;  1SR3 A;  2R92 H;  3RN2 A;  4A3M B;  3T4A C;  1BQQ T;  1H9S A;  4X66 Q;  4IPG A;  1LAC A;  1WD0 A;  1A15 A;  2RBM A;  3HKZ E;  3FRP B;  4C3H H;  2OWO A;  2FHT A;  3RUZ A;  3J7A V;  3FPU B;  1ONL A;  1EIY B;  4A76 A;  4KTA A;  2F0T A;  1IBK Q;  1HZC A;  1ET6 A;  1M4V A;  1TU2 B;  2A6E C;  3KUP A;  4GS3 A;  3DLL A;  3I4N G;  5AJ3 L;  3AB9 A;  3ULP A;  4TKO B;  3GTM B;  2Q8I B;  2H5X A;  1N32 Q;  2D0P A;  2QKI C;  5FO9 B;  3DMU A;  1HHV A;  2J0T D;  4DAY B;  3Q22 A;  5KGU A;  1D8L A;  1UWV A;  4DF7 A;  5FOB B;  1IW7 C;  5IP9 G;  4A3I B;  4IN3 A;  4DV7 Q;  2AUJ D;  2NVY B;  1UNS A;  4L5T A;  4HMJ A;  2Z6K A;  1CSQ A;  2Z1C A;  2OEO A;  2YTX A;  4XDX A;  2ASB A;  3X3M A;  2DY7 A;  2EDG A;  1ILP A;  2JEA I;  2R3Z A;  2RCN A;  2HCI A;  1YJN A;  2I5M X;  3AFP A;  4WRD A;  1STG A;  1BKB A;  2PZW A;  1ML0 D;  3I2Z A;  3HKZ G;  3KF8 B;  3A5U A;  1QG7 A;  1VMP A;  5C4H A;  3GTM H;  4UP7 A;  3V2T A;  3BS1 A;  1E24 A;  3EA6 A;  5IOC A;  1STH A;  1AE3 A;  3TDQ A;  2RDF A;  1N33 Q;  1EZ6 A;  1ESF A;  2Z9H A;  4M8A A;  1XTD A;  4A3I H;  1NR2 A;  4CJ0 B;  2NVY H;  4C3I G;  3RN5 A;  1HNW L;  1EWH A;  3CRK C;  3T1Y L;  2IX1 A;  1FNV A;  5C5L A;  1ZKO A;  1RKN A;  2ATW A;  1NMF A;  2GN5 A;  4X66 L;  4K2K A;  4KD4 A;  1XMQ L;  4C1N I;  2RSO A;  4CDC C;  1CUK A;  3PCO B;  2VUM G;  2MO1 A;  1SNQ A;  4A3D G;  2UXB Q;  1KLU D;  3QIA A;  3NQT A;  1SMY C;  3CPF A;  3K8A A;  4OL7 A;  1EQQ A;  1HNX Q;  1HTP A;  1SNO A;  1S3O A;  1PA6 A;  4DXF A;  1TWC B;  4CDE C;  2EJG C;  3UI2 A;  1N32 L;  3EJI A;  2ICI A;  2OQ0 A;  1EYA A;  1Q46 A;  3TP6 A;  3HOU B;  5G3L F;  1K83 B;  3KLS A;  3GTG B;  1LLR D;  3CC7 A;  1F9P A;  3CCM A;  3Q8D A;  2XWB B;  4DV7 L;  1OXX K;  4OON A;  5G3L D;  1G91 A;  1B4O A;  3VYS A;  4RG1 A;  3HOZ G;  4BBS G;  5L37 A;  3NTH A;  3D8G A;  2Y0S E;  1XNR L;  3C3L A;  2WB1 G;  1EY9 A;  2AUK A;  1LAB A;  3P75 A;  4KK7 A;  1JJ2 A;  5JEA H;  2A5H A;  1B8A A;  1EFW A;  3RLF A;  3CC4 A;  5EKK A;  1CZW A;  3AEV A;  4GLV B;  1FYC A;  2R7Z B;  3I73 A;  4EGV A;  3I72 A;  2DY8 A;  5JPM C;  1EY4 A;  4ZK9 B;  2H1E A;  3DUZ A;  1B2T A;  1A2U A;  2F0J A;  1VDZ A;  1ASZ A;  1TWC H;  3PO3 B;  3SXH A;  5IGF A;  2DNC A;  4PZ8 A;  1GUO A;  2EYO A;  4DU9 A;  3HOU H;  1K83 H;  1N33 L;  4O1N A;  1LT6 D;  2A6H D;  3GTG H;  5I9P A;  3I55 A;  2KED A;  1CM9 A;  3S17 B;  1IBL Q;  2DJF C;  3MWY W;  1O80 A;  4AH6 A;  1GUW A;  1DOM A;  4L8J A;  1JOQ A;  1PFM A;  5C4J B;  2XSC A;  1JWU D;  4RKL A;  2BA0 A;  2B2W C;  2F0Q A;  3K5O A;  5HY6 A;  1PRT B;  3SHL A;  1F2L A;  3MXN B;  5FKA C;  3M85 A;  2R7Z H;  2O5J C;  2NWG A;  4CKE A;  2UXB L;  1I6H B;  4R4Q A;  2ZM6 L;  1OXS C;  1EQR A;  2LSS A;  5D14 A;  5BN4 A;  4L63 B;  1J8I A;  4K5W A;  4JPB W;  4ODG A;  2BE5 D;  4IUN A;  5D3D A;  2YV5 A;  2JQO A;  4ILW A;  4FF2 A;  1HNX L;  3PO3 H;  2WFW A;  1JOR A;  1SLJ A;  1GUG A;  3IAY A;  4POF A;  1TVX A;  5I4D A;  1PYB A;  2KVM A;  2KHJ A;  4YWK A;  5KND A;  1PHJ A;  5EPL A;  3S17 H;  3MA2 B;  1YEZ A;  3TZU A;  1WVL A;  1FJG Q;  1B44 D;  4F7X A;  1WCM G;  1Q1B A;  3CCS A;  1G51 A;  1N34 Q;  1U4R A;  4JI5 Q;  1AN8 A;  5C4J H;  5DAU A;  1X54 A;  1VQC A;  1SAP A;  1D5M C;  5CYU A;  1LTS D;  1Z9F A;  1Q90 A;  2MQH A;  2KOL A;  4JC0 A;  4KI0 A;  3HOV B;  4KY6 A;  3K5L A;  1MSG A;  1QNK A;  3SE0 A;  1BXT A;  3H91 A;  2L55 A;  1MJE A;  2ES2 A;  1K8M A;  2NN6 I;  4KD3 A;  5LL6 S;  1S40 A;  4UY8 C;  5M5W H;  1VQP A;  1Q86 C;  5C4X G;  1PRT F;  1SYE A;  1D7Q A;  1EY7 A;  2L12 A;  2Z6K C;  1GJX A;  1RD9 D;  3H0G G;  1ESR A;  3M4Y A;  1PRT D;  2E5L L;  1I94 Q;  4OO1 G;  5C44 G;  1C0A A;  3VYR A;  4B3M Q;  1WTP A;  2GVA A;  1PZJ D;  4RCO A;  2VW9 A;  1IBL L;  3S1Q B;  1TS3 A;  3FKI B;  1Y8P B;  3O13 A;  2ZTE A;  2EY6 A;  4G7Z C;  2Y0S B;  5FLM G;  2QW7 A;  2CQA A;  1B7Y B;  4A3G G;  2YYZ A;  1K3B C;  2B8G A;  1X6O A;  1YVC A;  4ME3 A;  1V1O A;  3W1G A;  5JVG 3;  3DM1 A;  1U4M A;  1S72 A;  1Y1W B;  4JOI A;  3WOF A;  5DM6 3;  2EYM A;  3HOV H;  1PVO A;  1GHK A;  3SK4 A;  1H9J A;  3T16 A;  4BA2 I;  5LMU Q;  3E5S A;  1LM0 A;  1Z6H A;  3I4O A;  1KQS A;  3G71 A;  4MZ9 A;  2RDG A;  4DV6 L;  1LO5 D;  2HQL A;  5E1F A;  3U9S A;  1HNZ Q;  3JAM i;  2E74 C;  1JCK B;  4F87 A;  4CKC A;  1QWY A;  4IPC A;  4A3C H;  1YNN D;  2A69 C;  4DV3 Q;  3NK9 A;  3NHH A;  4NXM L;  2UUB Q;  1D5Z C;  3ICE A;  3S1Q H;  3FKI H;  1NTG A;  2MHV A;  4QGU A;  1N34 L;  4IPD A;  3OPO A;  2JJQ A;  4MHE A;  1PMR A;  1D6E C;  4DR6 Q;  1LTB D;  3J81 i;  4B3R Q;  1ET9 A;  2HHH L;  4NKL A;  2F0N A;  5GAE C;  3J7A 5;  4AQY L;  3MZ5 A;  2E2J B;  2BOS A;  3TSS A;  4LF9 Q;  3CCR A;  2MUY A;  2JA7 B;  3NBH B;  2A1A A;  3T56 B;  2XRQ D;  4KY7 A;  2HT1 A;  3KK7 A;  3A0J A;  4QMG A;  2EPB A;  3S14 B;  1QIL A;  4DR2 Q;  3TZD A;  3OOC A;  1YHA A;  2B3G A;  1LT5 D;  1D5X C;  2PQE A;  5BN5 A;  1JC7 A;  1S4Z A;  1I94 L;  2F0K A;  3RZO B;  3ITP A;  4A3F B;  4B3M L;  3UDX A;  1SYC A;  4IAL A;  5JEA J;  2UUC Q;  2MFI A;  3AYH B;  4DNI A;  2VY3 A;  1L2F A;  1Y8O B;  4JI0 Q;  2L11 A;  1AW7 A;  1XX8 A;  4DV1 Q;  5CV6 A;  1C8C A;  2AQ3 B;  3HG9 A;  1BOS A;  2DN8 A;  1SFO H;  1EY6 A;  1MBY A;  2I5H A;  2NVT B;  4KN7 C;  3CD6 A;  3KFU A;  2QEJ C;  1SNP A;  2E2J H;  2JA7 H;  1SNC A;  2K5H A;  3K58 A;  2KCT A;  3I7F A;  2K33 A;  1CHP D;  3I8Z A;  4O42 A;  5COR A;  2NTT A;  1LTG D;  4YY3 Q;  3S14 H;  5EKL A;  3ERS X;  1HJP A;  4YCU A;  1HNZ L;  1D1I A;  4EVO A;  5CMD A;  4XQQ A;  2YTY A;  1G6Z A;  2F4I A;  4H44 C;  2K5D A;  2B2Y A;  3RZO H;  2LY7 A;  2VB3 X;  1EUJ A;  3BVG A;  4A3F H;  4V0B A;  4K14 A;  1PH5 A;  1T5X D;  3FP9 A;  2WV6 D;  2UUB L;  1KRS A;  3NP8 A;  3SR1 A;  4BS9 A;  2K05 A;  4DAV A;  1GHJ A;  3T51 B;  2JXM B;  3CCJ A;  4A3K G;  4A3J G;  4DR6 L;  2NN6 G;  4B3R L;  2NVT H;  1KC8 C;  4GN3 B;  4H02 A;  1JMC A;  4WFN 3;  1X9N A;  5ISR A;  1SYB A;  1O78 A;  3S2H B;  4LF9 L;  3SVM A;  2JE6 I;  2E75 C;  1Y8N B;  1W6J A;  5CV7 A;  3QG1 A;  4PQX A;  3GTQ B;  1Q7Y C;  1WTW A;  1VS0 A;  4DR2 L;  1X55 A;  1SEB D;  2N78 A;  1IYU A;  3R8B A;  2OF1 A;  1WYD A;  2JEB I;  5DEH A;  1PYS B;  2C5C A;  3CP0 A;  4OX9 Q;  2IHF A;  4HSP A;  1KDC A;  3K57 A;  4CDD C;  4QUF A;  4DR7 Q;  2KEC A;  3DM3 A;  3NWT A;  3K6O A;  2JA5 B;  2E76 C;  4DV1 L;  2NZ1 D;  3U4V A;  3IL8 A;  1NCV A;  4KV6 A;  2BDN A;  1W6K A;  2C9O A;  3FPP A;  1VQI A;  2OTL A;  4KKS A;  2JA9 A;  1TQO A;  3S2H H;  3NE5 B;  4DUY Q;  1K8A C;  4JBM A;  5EJW A;  2OCE A;  4X62 Q;  4DV5 Q;  3GTQ H;  4P73 A;  3GTP B;  4YY3 L;  3FMC A;  4ZUJ A;  4B3T L;  2R92 G;  1PTO C;  1HCZ A;  2KEN A;  2QF7 A;  4DR4 Q;  3TP7 A;  1CKN B;  5F2D A;  4C3H G;  1DD2 A;  4JOI C;  2EOT A;  5GQO A;  5IYB H;  4BBR H;  1J9O A;  3ERQ A;  1TR5 A;  3OW7 A;  3CU7 A;  4N8X 1;  4GKJ Q;  3NEM A;  2F3W A;  2N3S A;  1FGU A;  3EVQ A;  1L0Y B;  3MXN A;  3D4R A;  5JJI A;  3HOX B;  1OXV A;  3FHW A;  1M8A A;  4O0A A;  2R7F A;  1S5C D;  4HR7 B;  4PV1 C;  2UUA Q;  2K03 A;  3GTP H;  4EQ5 A;  3CCE A;  1PH7 A;  4MNO A;  2I5L X;  4A3M G;  2B2U A;  1BCP C;  1X56 A;  5IGC A;  3AU7 A;  3MFY A;  5AJ3 Q;  5FLX c;  1B3Q A;  1YNJ D;  4Y7N H;  1V9P A;  3OSO A;  3T53 B;  3CCV A;  5FLX E;  4HJ9 A;  4M1U B;  5EGT A;  4CJ1 B;  5HGQ A;  1G6P A;  1JE5 A;  4FF1 A;  2PO4 A;  4PMW A;  4IZ8 A;  1EIH A;  1I6V C;  3PUY A;  1BBU A;  3DWA A;  4RAU C;  2PW7 A;  4RA8 A;  3JAM c;  2QEX A;  3KBG A;  4TVA B;  3HOX H;  3JAM E;  3S16 B;  1QUQ A;  1SJE D;  5J22 A;  3S1R B;  4UPA A;  2NYZ D;  2RHQ B;  3KDF A;  3F2B A;  5I2X A;  4LFC L;  2XRS D;  5I2Y A;  1JB7 A;  2EYF A;  4DV5 L;  1MSH A;  2F0W A;  2A73 B;  2E2D C;  4ULL A;  4APV A;  4L5S A;  3F2D A;  3J81 c;  1X3P A;  4EX5 A;  4DR4 L;  4LF8 L;  1L0W A;  3URY A;  1F2Z A;  4KLK A;  2PQA B;  3G6J B;  3KYH C;  3T1H Q;  1EEF D;  1ROD A;  2KHI A;  4MTN A;  4LF4 L;  4X3U A;  4FXD A;  2A68 C;  3B6Y A;  4LFA L;  4GKJ L;  4KHP Q;  5EAY A;  4A3E B;  4R4O A;  1F9Q A;  3G48 A;  3MHB A;  1VQF A;  1F2Y A;  1SBB B;  3S16 H;  4A3L H;  4L5Q A;  1E3P A;  1EOT A;  1Q1E A;  5IYC H;  2G9D A;  3S1R H;  2B2Y C;  1G29 1;  4QB4 A;  1BVS A;  4NPS A;  1XMQ Q;  2UUA L;  1JJC B;  3C1E A;  4IUR A;  1XWE A;  1W2B A;  4GKK Q;  5A2Q L;  1UAP A;  3ZYY X;  4JBJ A;  2F0L A;  4XYQ A;  4RHS A;  1ZYR C;  2BH8 A;  3DEO A;  5JEA G;  3MAQ A;  5K5P A;  5CBE E;  3ER0 A;  4R4C A;  4KY5 A;  1HQM C;  2LKV A;  1XYI A;  4P71 A;  4RWS C;  4GOP B;  2PNR C;  4L5R C;  2UXD L;  2F0S A;  1H9R A;  1CK1 A;  4A3E H;  3MXG A;  1A8V A;  1XNQ Q;  2M9V A;  1KRT A;  3KF6 B;  3HOU G;  1XNR Q;  2X69 A;  3NBH A;  2FFK B;  2VZA A;  4C1N K;  3KLW A;  3SDZ A;  1TKW B;  3WWV A;  2M00 A;  1D1K A;  2EYL A;  2Q2U A;  1I3Q B;  4MIU A;  4ZKC B;  3ULJ A;  3H3V C;  2EYJ A;  1FD7 D;  4R4I A;  2O2L D;  3K7U C;  5AFW A;  1YIT A;  2WAQ B;  3K59 A;  2X6G A;  2RA4 A;  2PZU A;  2SNM A;  2R7Z G;  1C48 A;  4OIK A;  5TSS A;  3T1H L;  4DXG A;  1V1P A;  3A8J E;  3IKJ A;  1CQF A;  3I3C A;  1YHB A;  3VA7 A;  4KHP L;  1B3A A;  1BCP F;  3PO3 G;  2OT2 A;  3M4O H;  1X3Q A;  4HIO A;  3OIP A;  1A62 A;  1PH6 A;  3M7G A;  4JYA L;  1B1Z A;  1WTO A;  4RCN A;  2RF4 A;  2XN9 C;  4BA1 I;  2O4X A;  1BCP D;  4QUC A;  4HJ5 A;  3BYY B;  1I3Q H;  3ND9 A;  5FLX L;  2ALY B;  4IUT A;  1IYV A;  5M3F B;  2RSN A;  4K6L A;  1CTM A;  3ONA B;  2ZM6 Q;  4QIW B;  4DNT B;  4GKK L;  2O5I C;  4UP8 A;  3UE1 A;  3EFX D;  2K01 A;  5M9O A;  1S5E D;  1SE4 A;  1EWC A;  1IYJ B;  5K36 H;  2B63 B;  4QCL A;  4QY7 A;  1U9R A;  2EYP A;  3JAM L;  4Y52 H;  3OWE B;  3E6Z X;  4TSS A;  3K5N A;  3WDN A;  4FF3 A;  3QB3 A;  3HZX A;  1MKH A;  1CT1 D;  4IFD H;  2B2U C;  1A6X A;  1X3F A;  2D9U A;  1XNQ L;  1NAP A;  4DAP A;  2ENB A;  5ELC A;  3HRZ C;  4G7O C;  1PZK D;  3J81 L;  3W2D A;  1Q82 C;  2F1M A;  3H94 A;  3K5M A;  5M3F H;  5IT9 E;  2EXZ A;  3NSW A;  3IRB A;  4P74 A;  3J80 i;  1TII D;  2NB0 A;  1VQ5 A;  4S3S A;  1VQH A;  2B63 H;  3HOV G;  1JR0 D;  3I4N H;  4HCE A;  5DNF A;  4EQN A;  4G57 A;  1MIU A;  2E5L Q;  1NE3 A;  1I4P A;  3CPW A;  2LMC B;  3BZK A;  4KKT A;  5BN3 A;  1AP0 A;  1E2W A;  1MGS A;  1ENF A;  4Q0F A;  1AEX A;  1G2S A;  2X6L A;  3A7A B;  2ZJQ A;  3X3N A;  3UE0 A;  5IP9 H;  4A3C G;  3RNU A;  4QJF A;  3BVM A;  4IOC A;  2HUG A;  2A6E D;  4X3S A;  1B9N A;  1YI2 A;  1BO0 A;  3FKI G;  1ZYR D;  1KIX A;  1WOC A;  2Y0S G;  5GAG C;  3E0E A;  3A5Z B;  1STE A;  4DV6 Q;  4U67 3;  2D62 A;  3A74 A;  5M5W B;  1Y1W G;  3KJP A;  4POG A;  1AFP A;  2Z4H A;  4MTK A;  2FIN B;  2DUD A;  1IW7 D;  3HFZ B;  3S1M B;  1A0I A;  3CQZ B;  2CW0 C;  5I6W A;  1JIC A;  4QL5 A;  1Q81 C;  1HZA A;  1NSN S;  1R4P B;  3TME A;  4NXM Q;  3G6E A;  2KJX A;  4OWT B;  1PFS A;  2K5Q A;  4K5V A;  3GQB A;  2PZT A;  1ICF B;  2Z4I A;  3GTK B;  3H6M A;  4YHH L;  1L0X B;  2HHH Q;  3I70 A;  4DFA A;  4OGQ C;  4AQY Q;  4K8I A;  1HQR D;  1Q12 A;  2B2T A;  4RKB A;  1QVG A;  1K73 C;  1JJG A;  2ID0 A;  1SE8 A;  3MC0 B;  3NUC A;  3PIP 3;  1IXR A;  2NUC A;  5IWA Q;  1MHW C;  5IOD A;  4ZCK A;  1M90 C;  1G2T A;  4DUZ Q;  4J6H A;  3S1M H;  5A35 A;  3CCQ A;  2UXC Q;  3KLS X;  3CQZ H;  5FO8 B;  3LNN A;  4V19 0;  3MVV A;  5IP7 H;  4RGN A;  3I4M B;  2BDO A;  4NP5 A;  1F9S A;  1T9H A;  4NW2 A;  3GV3 A;  1E2Z A;  3VYT A;  3NEN A;  4BWG B;  1YNX A;  5LMN W;  1BBX C;  2PMZ B;  3RZD B;  4AIM A;  1LTA D;  1L1O A;  4CBV A;  4IUU A;  3GTK H;  1JT8 A;  3SK6 A;  1YJ9 A;  3QOJ A;  4B3S L;  1FVI A;  4DAM A;  2AWN A;  1SMY D;  1DOK A;  4A3F G;  1FL0 A;  4J15 A;  1CKM A;  1BDO A;  4OEM B;  4CGY B;  1DCZ A;  1STA A;  3S9W A;  2JA6 B;  3T13 A;  3CME A;  3J7Y W;  1SND A;  2R7D A;  5J3B A;  5I9O A;  2BA1 A;  2DGY A;  3SK5 A;  2F0H A;  2QDL A;  2ZXP A;  5ELN A;  4OWW B;  4H7B A;  3I4M H;  2RCF A;  4CHT B;  3RZD H;  1ZXT A;  3TS2 A;  2LXK A;  4C2M B;  2R93 B;  3D31 A;  4RMF A;  4HCS A;  4JI7 L;  2MNA A;  3NTI A;  4GZY C;  1SFO B;  2N88 A;  4FF4 A;  1K3R A;  1IKM A;  4ZQ3 A;  1JWS D;  2JA6 H;  2PNH A;  4A75 A;  3AMU A;  1QJO A;  1IKL A;  4DNR B;  3ZJY C;  4BXX H;  5IWA L;  1E0B A;  1PYW D;  4DUZ L;  4GLX A;  4IFD J;  1BUV T;  2HD3 A;  3EN2 A;  2UXC L;  2F03 A;  3OMC A;  4DAY A;  4XTC S;  3DHQ A;  3NTK A;  5C0X H;  2EZV A;  3PIO A;  2JA8 B;  1ICW A;  1ZEQ X;  1GKH A;  1VQM A;  3P20 A;  5KRU A;  4C2M H;  3WOE A;  2R93 H;  4JI8 Q;  4KKU A;  4LK1 C;  4LAA A;  4HIK A;  5LMN Q;  3KF6 A;  4DV4 Q;  1O7I A;  4P2C B;  1GXD C;  4EQO A;  4DV2 Q;  1JB3 A;  1R9T B;  1Q8I A;  5ELO A;  2EQS A;  3D3R A;  1I50 B;  2Q8R E;  2FJ2 A;  1IL8 A;  4ZUI A;  4LMQ D;  1XXG A;  3BDL A;  5IYB G;  2MP1 A;  3W5O A;  1RDP D;  3D6W A;  2JA5 G;  1KL9 A;  1GD7 A;  2ZJR A;  3U4Z A;  2Z8L A;  2J7Z A;  4OXP A;  3PUV A;  2SOB A;  4R8I A;  3KF8 A;  4X3T A;  1SSO A;  5D3I B;  4WJ4 A;  2XWJ B;  1C4Q A;  1Z7T A;  2NBF A;  3U50 C;  1DZ1 A;  1Z47 A;  1WD1 A;  4B3T Q;  5M5X B;  3GTJ B;  4CKB A;  1KAB A;  1QE6 A;  4I7A A;  1RJT A;  1TWA B;  1QCB D;  1S5F D;  1MD2 D;  3TQY A;  3H09 A;  4ABN A;  5NUC A;  2JA8 H;  5M3M B;  2PI2 E;  1Y14 B;  1RTN A;  1EIG A;  5EPJ A;  3J80 c;  4OO1 H;  3VR2 A;  4A3B B;  3J80 E;  2BCO A;  5J39 A;  1T5E A;  1R9T H;  5HGT A;  1I50 H;  3HEJ A;  2HIX A;  2F0F A;  3KBX A;  1FR3 A;  3HOY B;  1GUS A;  1S5D D;  4FVM A;  2E2H B;  2R61 A;  1ENC A;  1TXY A;  4JI1 Q;  2F52 A;  3BZC A;  5M5X H;  2IY5 B;  2VQF Q;  3GTJ H;  3STB C;  3HOX G;  5T1I A;  2F0U A;  1TWA H;  3HOW B;  4BY7 B;  2IPK D;  5M3M H;  3K0X A;  2HQE A;  3LX0 A;  3PUW A;  4DK1 A;  1CKO A;  1I4G A;  3A56 A;  3M3Y B;  4IFD I;  3OIQ A;  3CKI B;  1PLF A;  1A63 A;  5JJZ A;  1U5K A;  1K8O A;  2B2T C;  1MI2 A;  3BG3 A;  2JN4 A;  1VQ8 A;  3F8T A;  2N55 A;  3CC2 A;  4BBR B;  3TN2 A;  3CMA A;  4JI8 L;  1OTC A;  1CA5 A;  4A3B H;  5LMN L;  4DV4 L;  3L0O A;  1PFB A;  4DV2 L;  4HSV A;  3SEB A;  2E8G A;  3HOY H;  1QVF A;  1DM0 B;  2QCP X;  2N8N A;  4FXG C;  2L9H A;  4C3J B;  1EZ8 A;  2E2H H;  1E1T A;  2KA7 A;  1JWM D;  4LFC Q;  1ILQ A;  1HFG A;  1SYD A;  3R2I A;  3Q0A A;  5JAV A;  2A69 D;  2HDL A;  4A3L G;  1L1O C;  1K0R A;  3Q24 A;  3ERO A;  3HOW H;  4BY7 H;  1JOO A;  1J5E Q;  4PNY A;  5IYC G;  1PFN A;  3M3Y H;  4LF8 Q;  2F3I A;  4Y7N B;  1QZH A;  1A3V A;  1S5B D;  1F77 A;  3PUZ A;  1EQT A;  2ICE C;  4LF4 Q;  1BNZ A;  1E7Z A;  2Q2T A;  4LFA Q;  1CI3 M;  3H15 A;  3A8I E;  4E6I A;  5C4Z A;  1CZG A;  3M9B A;  4C3J H;  1XPU A;  3TP8 A;  2OTJ A;  4LUZ A;  1NY4 A;  1Q8K A;  4A3E G;  2SEB D;  1VQA A;  4HJ7 A;  4K2L A;  1GUN A;  4JI1 L;  1SN8 A;  2VQF L;  3OWF A;  4YWL A;  3EBE A;  1PH9 A;  4KN4 C;  4JBW A;  2ZJP A;  5FK9 C;  1HZ9 A;  4PMB A;  2GVB A;  1SE2 A;  2WAQ E;  4CDF C;  4DR1 Q;  2EVB A;  2QIL A;  2L1B A;  1EYG A;  1HPC A;  4GNX B;  4IUQ A;  4FYD A;  2UXD Q;  4UP9 A;  1PZI D;  5C3E B;  1W3S A;  3BZD B;  5E7N A;  2Q2I A;  2ZXO A;  1EYC A;  1N36 Q;  4KJO A;  1BBW A;  4X6A H;  3A54 A;  1AZP A;  5C0X J;  2KCM A;  2TSS A;  2KEE A;  3GTO B;  4A3I G;  1QZG A;  1EU4 A;  4ALP A;  5DM7 3;  3BJU A;  2L15 A;  2AQ1 B;  4B9W A;  4KHZ A;  4QIW E;  2QA4 A;  1J5E L;  4BY1 B;  3J80 L;  4A93 B;  3E0J A;  2SNS A;  5KIX A;  1I4X A;  2QGQ A;  1PTO B;  1X32 A;  1M1K C;  3S2D H;  3VR5 A;  3QR8 A;  1VF7 A;  3GTL B;  4LFB Q;  3FEW X;  3A7L A;  3I91 A;  1VQG A;  4J1M A;  1V1Q A;  2WAQ G;  2B39 A;  5C3E H;  3MEF A;  3QO2 A;  3M4Q A;  4NMZ A;  3QJY A;  5K36 G;  2YTV A;  1LTI D;  4JV5 Q;  1VQJ A;  5IGD A;  4JYA Q;  3CCL A;  1YZ6 A;  5ELE A;  4R9W A;  5LHY 1;  1VQ6 A;  4LWC A;  3GTO H;  4UDU C;  4HJ8 A;  1YJW A;  1VQE A;  3ULL A;  4ID6 A;  2PW5 A;  4IFD G;  1SRO A;  4XIG S;  5EBC A;  2K50 A;  1UEA B;  4RGO S;  5EBD A;  2RKS A;  1UE5 A;  1Y1V B;  1UE6 A;  1F2M A;  3M4P A;  5IE8 A;  1STB A;  4JI2 L;  4BY1 H;  4A93 H;  1NBW A;  2R6G A;  2F4V Q;  5EQ0 A;  1PTO H;  1LUZ A;  1JE4 A;  1BCP B;  1II3 A;  4DR1 L;  1QVC A;  2A6H C;  2N49 A;  1EY5 A;  1TWG B;  5M3F G;  3GTL H;  1PH3 A;  2K75 A;  2QDB A;  4NXN Q;  3J7A F;  2MPM A;  2WP8 J;  3PUX A;  1VQ4 A;  2VS1 A;  1HA5 A;  2D0O A;  5M5Y B;  2B63 G;  1PTO F;  2XNA C;  4JK1 C;  3PO2 B;  1XMO L;  2L0C A;  4ME5 A;  4AYB B;  4DK6 C;  3M4O B;  1N36 L;  1PH8 A;  1CSP A;  4ZRZ A;  1PTO D;  1U4P A;  1NNX A;  2RQX A;  5GRO A;  1BR9 A;  1HXY D;  1EIF A;  5C0X I;  4K0K Q;  2BE5 C;  1R4Q B;  4LF6 Q;  2CVR A;  1Y1V H;  1X3E A;  2AHO B;  3FDT A;  4U68 A;  4WJ3 M;  2D5D A;  1WTX A;  1RIP A;  5DLQ E;  1TY0 A;  1E1O A;  4A3M H;  1EOV A;  3VA5 A;  4ZLT F;  3R93 A;  1TWG H;  1HZB A;  1Q3L A;  4LFB L;  5D65 A;  4R1J A;  2KBN A;  2DJG C;  5M5Y H;  1I4R A;  5IYD H;  1KD1 C;  1TWF B;  3PO2 H;  1K0S A;  4JV5 L;  4DR3 Q;  2FMC A;  5COY A;  4K6D A;  4JI3 Q;  1VQ9 A;  3LWU A;  5KYL A;  4DGZ A;  5IGG A;  2DNE A;  2CHB D;  2EIF A;  3N52 A;  1H9K A;  2WIN B;  4G4K A;  4JCV E;  1LYL A;  1C9O A;  3U58 A;  2WB1 E;  1PRT C;  4IUV A;  2F4V L;  4OO1 I;  5C5M A;  2G9H D;  4ZAI A;  3I4N B;  2CWA A;  1RHP A;  4F88 A;  1GOZ A;  3J81 j;  3M7N A;  5EKI A;  2A8V A;  1EWI A;  3L7Z C;  4NXN L;  2IHE A;  4LF5 Q;  1TWF H;  3GP7 A;  1IBK L;  1RTO A;  3TS0 A;  1NJI C;  5CV5 A;  2YU9 B;  3DWQ A;  3MEH A;  4JI6 Q;  3U9O A;  2PMZ E;  1HR0 W;  4YIJ A;  4YHH Q;  5IP7 G;  2ZTC A;  2F0I A;  4UHV A;  2KCC A;  5FJ8 H;  4XQJ A;  3NXW A;  1V43 A;  2IW3 A;  1EL0 A;  3HP3 A;  2JYO A;  5IT9 c;  4QQB X;  1JOK A;  3NEL A;  4JBK A;  4K0K L;  1SYF A;  1O7Y A;  3MXU A;  1A3T A;  4LF6 L;  4G7H C;  1PV4 A;  2IT1 A;  4HIM A;  4B08 A;  4EQP A;  5IGE A;  5IY0 A;  1YNN C;  2A68 D;  3VDY A;  2F0G A;  3HKZ B;  4IUP A;  5H1S E;  4P72 A;  1JQY D;  1WFQ A;  3L2P A;  4LNQ A;  4FDB A;  5CC4 A;  3EQL C;  3QOL A;  4DKA C;  3SK8 A;  1KTK A;  3A8K E;  1YIJ A;  5JPN C;  4OIJ A;  1WTQ A;  2YU9 H;  3GV6 A;  1PH2 A;  1H9M A;  3DWP A;  1MJC A;  3I90 A;  4DR3 L;  4B3S Q;  3I4M G;  4O2D A;  4JI3 L;  4FP5 D;  3F2C A;  1X65 A;  4C3I B;  1RF2 D;  2B2V A;  1WTH A;  1UE7 A;  2K6A A;  2G5D A;  3SGI A;  2FMM A;  1TS4 A;  2K28 A;  2HIV A;  4GN4 B;  1KAW A;  4B9X A;  3OHX C;  2XTI A;  1IBM Q;  3H3V H;  2CH4 A;  1LTL A;  1DYQ A;  1CKN A;  2WKC A;  4RH6 A;  4FNF A;  4HJA A;  4I7Z C;  2VUM B;  3CXC A;  1EY0 A;  4A3D B;  3TP5 A;  1K9M C;  3OW2 A;  1EFI D;  3TEH B;  2JA6 G;  3D6C A;  3E3X A;  4DK0 A;  1KNE A;  2KQ3 A;  4F8M A;  1LTR D;  2IWH A;  4LJZ C;  4BXX G;  4LF5 L;  2K52 A;  4HN7 A;  1UEB A;  4JI6 L;  3I4L A;  4JI7 Q;  5C0X G;  1N9W A;  2V4D A;  3CRL C;  2CQO A;  1HR0 Q;  3E9I A;  4C3I H;  1I5F A;  2K04 A;  1SJH D;  1DXM A;  1SMX A;  3HGB A;  3HOZ B;  4BBS B;  3OTO Q;  2R93 G;  3C2P A;  5BR8 Q;  2WB1 B;  1OXT A;  2PI2 A;  1ENA A;  3NWS A;  4ZKB B;  2VUM H;  2PCF B;  4A3D H;  2MJ8 A;  2A19 A;  4PZ7 A;  4GNX A;  4YCW A;  1EYD A;  3S1N B;  1VQB A;  2K5V A;  2V1C C;  2JA7 G;  4OEL B;  3TRE A;  2AWO A;  1AE2 A;  1KHI A;  2A74 C;  1CQV A;  1QUQ B;  3S24 A;  3C1F A;  4IO9 A;  2F0O A;  5GAH C;  1I6H H;  3K7A B;  4GN5 A;  3RMH A;  3KDF B;  2K32 A;  5CBA E;  4DR5 Q;  2JA8 G;  1H95 A;  2I07 B;  4XQN A;  3P1H A;  2Q2H A;  3TBI B;  2BH2 A;  3MTS A;  1LT3 D;  4CJ2 C;  1HFN A;  3AQQ A;  2CCZ A;  3HOZ H;  2CWP A;  4BBS H;  2JSO A;  4Q5V A;  4N9P A;  4DK3 C;  4IPH A;  1GM5 A;  4ZYS A;  3JC6 6;  1HH2 P;  3RR5 A;  5LL6 X;  1IBM L;  4H0L C;  2NZH A;  4PZ6 A;  2LS0 1;  1N8R C;  2D2C C;  5IGB A;  3S1N H;  2PQA A;  1OO9 B;  2K1B A;  1P8L A;  2PPB C;  3UDG A;  2ZXR A;  4OWX B;  4X3K A;  1VMC A;  3KJO A;  1STY A;  4DV0 Q;  4JW0 A;  1WI5 A;  3CF5 A;  3G4S A;  1H9S B;  1U4L A;  3K7A H;  3MFG A;  2NVX B;  2RHS B;  1EU3 A;  5IT9 L;  1J6Q A;  4RFB A;  4H13 C;  5M3M G;  4RGM A;  1P16 A;  4MN3 A;  1WCM B;  1GUT A;  4XT1 B;  1HR0 L;  5JJK A;  2H4O A;  3D0F A;  2TMP A;  1PH4 A;  3VR6 A;  1KAA A;  1VQL A;  2CH4 W;  2B8F A;  3NQI A;  4PMC A;  3OTO L;  1VQO A;  3AFQ A;  3S15 B;  4A3B G;  2JP1 A;  4LUO A;  5BR8 L;  1E22 A;  1FJG L;  1Y69 U;  1PDQ A;  4LF7 Q;  2KHS A;  2P5Z X;  5JVH 3;  2NZO A;  3IFD A;  4JI5 L;  4OHJ A;  1RL2 A;  3HOY G;  3BDO A;  3C46 A;  1Y1W H;  1B70 B;  1V8Q A;  1VF5 C;  2KCN A;  4GOP A;  5J1Z A;  1LTT D;  3GDE A;  5ELB A;  1LV9 A;  3NPP A;  5C4X B;  1HUM A;  5JOB A;  1DOL A;  2NVX H;  3V05 A;  1QNU A;  2J4X A;  3H0G B;  4R8N A;  3R2T A;  1CFM A;  3HOW G;  4BY7 G;  2OXP A;  5EPK A;  5C44 B;  2Q8T A;  4DR5 L;  1WCM H;  4TRD A;  2NVQ B;  3BVZ A;  4HMI A;  5E3F A;  3D4W A;  5ELF A;  2GA4 B;  1WJJ A;  1E2V A;  4BBR G;  3S15 H;  3Q23 A;  4FXK C;  4LW1 A;  2NTS A;  4A3G B;  2C35 B;  3HS0 C;  4DA2 A;  1TS2 A;  2EYH A;  3RLO A;  2CW0 D;  1I4Q A;  1YNJ C;  3PF5 A;  5KEE A;  2EXD A;  1V1P B;  2MO0 A;  4L6T B;  3K81 C;  3GD7 A;  3PSI A;  2F0P A;  2IX3 A;  3F1Z A;  1AH9 A;  2EE1 A;  3W3A A;  4JG2 A;  5CR3 A;  3G7L A;  4C3J G;  1GO3 E;  3BDC A;  5C4X H;  2VQE Q;  2VB2 X;  3CCU A;  1KDB A;  3VR3 A;  1IHZ A;  2B2V C;  4RHR A;  2L5T A;  2K5N A;  4DV0 L;  2IJ0 A;  3H0G H;  4N8F A;  1FNU A;  3Q6S A;  3HKS A;  3K0Y A;  4NB3 A;  5KNB A;  2VL6 A;  5LMU L;  1VQ7 A;  2L4N A;  3TRZ A;  2UU9 Q;  2I46 A;  4KJN A;  5C44 H;  4A4I A;  2NVQ H;  1KXL A;  5CV9 A;  3NBI A;  3L3O C;  4HID A;  2K14 A;  2CKZ B;  1TT2 A;  2F0V A;  5FLM H;  4A3G H;  4XYO A;  3MXP A;  1SNM A;  4HTH A;  1VCI A;  1EQV A;  1GVP A;  4DV3 L;  1STN A;  1F9R A;  5CGK A;  4LF7 L;  2XGT A;  1XJV A;  3DXJ C;  3I56 A;  2AKW B;  1SE3 A;  1RCV D;  3BU2 A;  3J7Z C;  1QOH A;  4WOR A;  1LT4 D;  2FXQ A;  1TY2 A;  2XIW A;  4C56 C;  2RVL A;  1FGB D;  4K5X A;  4X64 Q;  3DEP A;  2ZTD A;  2WKD A;  1HRJ A;  5FO7 B;  1CHQ D;  2B29 A;  3IFT A;  4GNX C;  1VQD A;  5KYI A;  2LFN A;  2EJF C;  1FNW A;  4I65 A;  2XVS A;  4J8Q A;  1WTR A;  1VQK A;  2EY1 A;  1K8G A;  5GAD C;  3PQI A;  5C3E G;  2E2I B;  4XXE A;  3R3O A;  5CV8 A;  2UUC L;  1NUC A;  3PGZ A;  5A2Q E;  3PV0 A;  1KDA A;  3OYY A;  3KLR A;  4JI0 L;  1HA6 A;  4IJH A;  2MGS A;  2EY5 A;  2VQE L;  3BYT B;  1PH1 A;  4HAE A;  3CAM A;  1IL2 A;  1K28 A;  4DN4 M;  3W1B A;  2VNU D;  2UU9 L;  4YCV A;  4BY1 G;  4A93 G;  1XTC D;  1UE1 A;  1X3G A;  2F3V A;  1HUN A;  2F0E A;  2ZT9 C;  1PXU A;  3L9A X;  5I6Y A;  3H3V I;  2F0D A;  4K8J A;  1ASY A;  3GO5 A;  1TS5 A;  4A3K B;  4AYB E;  2Z6B A;  2E2I H;  4A3J B;  4KHV A;  4JI4 Q;  1G8Z D;  1U0L A;  4X65 Q;  1VQN A;  1B50 A;  2K5W A;  2JA5 H;  1DON A;  4KMU C;  3F2U A;  1EEI D;  5JJL A;  5CV4 A;  3VR4 A;  4IOA A;  3ND8 A;  2HDM A;  1NMG A;  1BF4 A;  3N6R A;  4JI2 Q;  1SDF A;  3OMG A;  4LUV A;  2IL8 A;  5C6A A;  3LGJ A;  3PMF A;  1HTL D;  3PF4 A;  1B9M A;  1KNA A;  1YBY A;  3D4D A;  3S2D B;  3UDF A;  1Y1V G;  1UUP A;  4X64 L;  3K80 C;  1I4H A;  4XT3 B;  4QF4 A;  2RDH A;  5C3W A;  2VXW A;  3KOJ A;  2HCC A;  1O7L A;  2IX0 A;  4YWM A;  2WAC A;  5IIF A;  3A55 A;  4GLA C;  1O7Z A;  1XMO Q;  4DPG A;  4N9T A;  1A2T A;  3CHB D;  1XPO A;  4A3K H;  1SXT A;  4Z9C B;  4A3J H;  4GOP C;  2NN6 H;  1YHQ A; 
#chains in the Genus database with same CATH homology
 2K7V A;  2SDF A;  4NDX A;  3QWN A;  2M2L A;  4WJW A;  5C3X A;  2WII B;  1D2B A;  1NR4 A;  4HED A;  1OXU A;  1A3U A;  1TWH B;  3RD4 A;  4FO2 A;  2PYK A;  1KLG D;  4TQU S;  3V96 A;  2R92 B;  3LWE A;  3VYU A;  4C3H B;  1CA6 A;  5ELD A;  4UAI A;  1SYG A;  2F0M A;  1QB5 D;  1EY8 A;  1AZQ A;  4IQZ A;  5HUR A;  2KUM A;  2B2W A;  1B53 A;  3J81 E;  5E4W C;  1WTV A;  5KNC A;  4RGT A;  2AQ2 B;  3P7J A;  3FVQ A;  5T1G A;  5E4X A;  3PIO 3;  2EJM A;  1DJR D;  2EY2 A;  4A3M B;  3T4A C;  1BQQ T;  1H9S A;  1WD0 A;  1LAC A;  1A15 A;  2RBM A;  3FRP B;  2FHT A;  3RUZ A;  3J7A V;  3FPU B;  1ONL A;  4KTA A;  2F0T A;  1ET6 A;  1M4V A;  1TU2 B;  2A6E C;  3KUP A;  3AB9 A;  4TKO B;  3GTM B;  2Q8I B;  2QKI C;  5FO9 B;  3DMU A;  1HHV A;  2J0T D;  3Q22 A;  5KGU A;  4DF7 A;  5FOB B;  1IW7 C;  4A3I B;  4IN3 A;  2AUJ D;  2NVY B;  1UNS A;  4HMJ A;  2Z1C A;  2OEO A;  4XDX A;  3X3M A;  2DY7 A;  2EDG A;  1ILP A;  2JEA I;  2R3Z A;  2HCI A;  4WRD A;  1STG A;  2PZW A;  1ML0 D;  1QG7 A;  1VMP A;  5C4H A;  3V2T A;  3BS1 A;  3EA6 A;  5IOC A;  1STH A;  3TDQ A;  2RDF A;  1EZ6 A;  1ESF A;  4M8A A;  1NR2 A;  4CJ0 B;  4C3I G;  1EWH A;  3CRK C;  2IX1 A;  1FNV A;  5C5L A;  1ZKO A;  1RKN A;  4K2K A;  4KD4 A;  4C1N I;  2RSO A;  1SNQ A;  1KLU D;  3QIA A;  3NQT A;  1SMY C;  4OL7 A;  1HTP A;  1SNO A;  4DXF A;  1TWC B;  2EJG C;  3UI2 A;  3EJI A;  2ICI A;  1EYA A;  3TP6 A;  3HOU B;  5G3L F;  1K83 B;  3KLS A;  3GTG B;  1LLR D;  1F9P A;  2XWB B;  1OXX K;  5G3L D;  1G91 A;  1B4O A;  3VYS A;  3NTH A;  3D8G A;  3C3L A;  1EY9 A;  2AUK A;  1LAB A;  3P75 A;  4KK7 A;  5JEA H;  2A5H A;  3RLF A;  5EKK A;  1CZW A;  1FYC A;  2R7Z B;  3I73 A;  4EGV A;  3I72 A;  2DY8 A;  5JPM C;  1EY4 A;  4ZK9 B;  2H1E A;  3DUZ A;  1B2T A;  1A2U A;  2F0J A;  1VDZ A;  3PO3 B;  3SXH A;  5IGF A;  2DNC A;  1GUO A;  2EYO A;  4DU9 A;  4O1N A;  1LT6 D;  2A6H D;  5I9P A;  3S17 B;  2KED A;  1CM9 A;  3MWY W;  1O80 A;  1GUW A;  1DOM A;  4L8J A;  1JOQ A;  1PFM A;  5C4J B;  2XSC A;  1JWU D;  4RKL A;  2BA0 A;  2B2W C;  2F0Q A;  3K5O A;  1PRT B;  3SHL A;  1F2L A;  5FKA C;  3M85 A;  2O5J C;  2NWG A;  4CKE A;  1I6H B;  1OXS C;  5D14 A;  5BN4 A;  4L63 B;  1J8I A;  4K5W A;  4ODG A;  2BE5 D;  4IUN A;  5D3D A;  4FF2 A;  4ILW A;  1JOR A;  1GUG A;  3IAY A;  1TVX A;  5I4D A;  2KVM A;  5KND A;  5EPL A;  3MA2 B;  3TZU A;  1WVL A;  1B44 D;  4F7X A;  1Q1B A;  1U4R A;  1AN8 A;  5DAU A;  1SAP A;  1D5M C;  5CYU A;  1LTS D;  1Q90 A;  2KOL A;  4KI0 A;  3HOV B;  4KY6 A;  3K5L A;  1MSG A;  1QNK A;  3SE0 A;  1BXT A;  3H91 A;  2L55 A;  1K8M A;  2NN6 I;  4KD3 A;  5LL6 S;  1PRT F;  1SYE A;  1EY7 A;  2L12 A;  1GJX A;  1RD9 D;  1ESR A;  3M4Y A;  1PRT D;  4OO1 G;  3VYR A;  1WTP A;  1PZJ D;  4RCO A;  3S1Q B;  1TS3 A;  3FKI B;  1Y8P B;  3O13 A;  2EY6 A;  4G7Z C;  2Y0S B;  2CQA A;  2YYZ A;  2B8G A;  1V1O A;  5JVG 3;  3DM1 A;  1U4M A;  1Y1W B;  3WOF A;  5DM6 3;  2EYM A;  1GHK A;  3SK4 A;  1H9J A;  3T16 A;  4BA2 I;  3E5S A;  1Z6H A;  2RDG A;  1LO5 D;  5E1F A;  3U9S A;  2E74 C;  1JCK B;  4F87 A;  4CKC A;  1QWY A;  1YNN D;  2A69 C;  3NK9 A;  3NHH A;  1D5Z C;  2MHV A;  3OPO A;  4MHE A;  1PMR A;  1D6E C;  1LTB D;  1ET9 A;  4NKL A;  2F0N A;  3MZ5 A;  2E2J B;  2BOS A;  3TSS A;  2MUY A;  2JA7 B;  3T56 B;  2XRQ D;  4KY7 A;  3KK7 A;  4QMG A;  2EPB A;  3S14 B;  1QIL A;  3TZD A;  3OOC A;  1LT5 D;  1D5X C;  2PQE A;  5BN5 A;  1JC7 A;  1S4Z A;  2F0K A;  3RZO B;  3ITP A;  4A3F B;  1SYC A;  4IAL A;  5JEA J;  1Y8O B;  2L11 A;  1AW7 A;  1XX8 A;  5CV6 A;  1C8C A;  2AQ3 B;  3HG9 A;  1BOS A;  2DN8 A;  1EY6 A;  1MBY A;  2NVT B;  4KN7 C;  2QEJ C;  1SNP A;  1SNC A;  3K58 A;  2K33 A;  1CHP D;  3I8Z A;  4O42 A;  5COR A;  2NTT A;  1LTG D;  5EKL A;  1D1I A;  4EVO A;  5CMD A;  4XQQ A;  1G6Z A;  2F4I A;  4H44 C;  2K5D A;  2B2Y A;  2LY7 A;  2VB3 X;  3BVG A;  4V0B A;  4K14 A;  1T5X D;  2WV6 D;  3NP8 A;  3SR1 A;  4BS9 A;  2K05 A;  4DAV A;  1GHJ A;  3T51 B;  2JXM B;  2NN6 G;  4WFN 3;  5ISR A;  1SYB A;  1O78 A;  3S2H B;  3SVM A;  2JE6 I;  2E75 C;  1Y8N B;  1W6J A;  5CV7 A;  3QG1 A;  4PQX A;  3GTQ B;  1WTW A;  1SEB D;  1IYU A;  3R8B A;  2OF1 A;  2JEB I;  5DEH A;  2C5C A;  4HSP A;  1KDC A;  3K57 A;  4QUF A;  2JA5 B;  2KEC A;  3NWT A;  3K6O A;  2E76 C;  2NZ1 D;  3IL8 A;  1NCV A;  4KV6 A;  2BDN A;  1W6K A;  2C9O A;  3FPP A;  4KKS A;  1TQO A;  3NE5 B;  5EJW A;  3GTP B;  3FMC A;  4ZUJ A;  1PTO C;  1HCZ A;  2QF7 A;  3TP7 A;  5F2D A;  4C3H G;  1DD2 A;  2EOT A;  1J9O A;  3ERQ A;  1TR5 A;  3OW7 A;  3CU7 A;  2F3W A;  3EVQ A;  1L0Y B;  3MXN A;  3D4R A;  3HOX B;  1OXV A;  1M8A A;  1S5C D;  4HR7 B;  4PV1 C;  2K03 A;  2B2U A;  1BCP C;  5IGC A;  3AU7 A;  3MFY A;  1YNJ D;  3OSO A;  3T53 B;  5FLX E;  4M1U B;  5EGT A;  4CJ1 B;  4FF1 A;  2PO4 A;  4PMW A;  4IZ8 A;  1EIH A;  1I6V C;  3PUY A;  3DWA A;  4RAU C;  2PW7 A;  4RA8 A;  3KBG A;  3JAM E;  3S16 B;  1SJE D;  5J22 A;  3S1R B;  2NYZ D;  5I2X A;  2XRS D;  5I2Y A;  2EYF A;  1MSH A;  2F0W A;  2A73 B;  2E2D C;  4ULL A;  1X3P A;  3URY A;  1F2Z A;  3G6J B;  1EEF D;  1ROD A;  4X3U A;  4FXD A;  2A68 C;  4A3E B;  1F9Q A;  3MHB A;  1F2Y A;  1SBB B;  1EOT A;  1Q1E A;  2G9D A;  2B2Y C;  1G29 1;  4QB4 A;  3C1E A;  4IUR A;  1XWE A;  5A2Q L;  1UAP A;  3ZYY X;  2F0L A;  4XYQ A;  4RHS A;  1ZYR C;  3DEO A;  5JEA G;  3MAQ A;  5K5P A;  5CBE E;  4KY5 A;  1HQM C;  2LKV A;  1XYI A;  4RWS C;  2PNR C;  2F0S A;  1H9R A;  1CK1 A;  3MXG A;  2M9V A;  2X69 A;  3NBH A;  2FFK B;  4C1N K;  3SDZ A;  1TKW B;  2M00 A;  1D1K A;  2EYL A;  1I3Q B;  4MIU A;  4ZKC B;  3H3V C;  2EYJ A;  1FD7 D;  2O2L D;  5AFW A;  2WAQ B;  3K59 A;  2X6G A;  2RA4 A;  2PZU A;  2SNM A;  1C48 A;  4OIK A;  5TSS A;  4DXG A;  1V1P A;  3A8J E;  3IKJ A;  1CQF A;  3I3C A;  3VA7 A;  1B3A A;  1BCP F;  2OT2 A;  1X3Q A;  3OIP A;  3M7G A;  1B1Z A;  1WTO A;  4RCN A;  4BA1 I;  2XN9 C;  2O4X A;  1BCP D;  4QUC A;  3BYY B;  3ND9 A;  5FLX L;  4IUT A;  1IYV A;  5M3F B;  2RSN A;  4K6L A;  1CTM A;  3ONA B;  4QIW B;  4DNT B;  2O5I C;  3EFX D;  2K01 A;  5M9O A;  1S5E D;  1SE4 A;  1EWC A;  5K36 H;  2B63 B;  4QCL A;  1U9R A;  2EYP A;  3JAM L;  3OWE B;  3E6Z X;  4TSS A;  3K5N A;  3WDN A;  4FF3 A;  3QB3 A;  3HZX A;  1CT1 D;  4IFD H;  2B2U C;  1A6X A;  2D9U A;  1NAP A;  4DAP A;  2ENB A;  5ELC A;  3HRZ C;  4G7O C;  1PZK D;  3J81 L;  3W2D A;  2F1M A;  3H94 A;  3K5M A;  5IT9 E;  2EXZ A;  3NSW A;  1TII D;  2NB0 A;  4S3S A;  1JR0 D;  4HCE A;  5DNF A;  4EQN A;  4G57 A;  1I4P A;  2LMC B;  5BN3 A;  4KKT A;  1AP0 A;  1E2W A;  1MGS A;  1ENF A;  4Q0F A;  1AEX A;  1G2S A;  2X6L A;  3A7A B;  3X3N A;  3BVM A;  2HUG A;  2A6E D;  4X3S A;  1B9N A;  1BO0 A;  1ZYR D;  1STE A;  4U67 3;  2D62 A;  5M5W B;  1AFP A;  2Z4H A;  2FIN B;  1IW7 D;  3S1M B;  3CQZ B;  2CW0 C;  5I6W A;  1JIC A;  1NSN S;  1R4P B;  3TME A;  2KJX A;  2K5Q A;  4K5V A;  3GQB A;  2PZT A;  2Z4I A;  3GTK B;  3H6M A;  1L0X B;  3I70 A;  4DFA A;  4OGQ C;  4K8I A;  1HQR D;  1Q12 A;  2B2T A;  4RKB A;  2ID0 A;  3MC0 B;  3PIP 3;  3NUC A;  2NUC A;  5IOD A;  1G2T A;  4J6H A;  5A35 A;  3KLS X;  5FO8 B;  3LNN A;  4V19 0;  3MVV A;  4RGN A;  3I4M B;  2BDO A;  4NP5 A;  1F9S A;  4NW2 A;  3GV3 A;  1E2Z A;  3VYT A;  4BWG B;  1BBX C;  2PMZ B;  3RZD B;  1LTA D;  4CBV A;  4IUU A;  3SK6 A;  3QOJ A;  2AWN A;  1SMY D;  1DOK A;  1BDO A;  4CGY B;  1DCZ A;  1STA A;  3S9W A;  2JA6 B;  3T13 A;  3J7Y W;  1SND A;  5I9O A;  2BA1 A;  3SK5 A;  2F0H A;  2ZXP A;  4H7B A;  4CHT B;  1ZXT A;  4C2M B;  2R93 B;  3D31 A;  4HCS A;  3NTI A;  4GZY C;  1SFO B;  2N88 A;  4FF4 A;  1IKM A;  4ZQ3 A;  1JWS D;  3AMU A;  1QJO A;  1IKL A;  4DNR B;  1E0B A;  1PYW D;  4IFD J;  1BUV T;  2F03 A;  3OMC A;  4DAY A;  4XTC S;  3DHQ A;  3NTK A;  5C0X H;  2EZV A;  2JA8 B;  1ICW A;  1ZEQ X;  3P20 A;  5KRU A;  3WOE A;  4KKU A;  4LK1 C;  4LAA A;  4P2C B;  1GXD C;  4EQO A;  1JB3 A;  1R9T B;  1Q8I A;  3D3R A;  1I50 B;  2Q8R E;  2FJ2 A;  1IL8 A;  4ZUI A;  4LMQ D;  1XXG A;  3BDL A;  2MP1 A;  1RDP D;  3D6W A;  2Z8L A;  2J7Z A;  3PUV A;  2SOB A;  4R8I A;  3KF8 A;  4X3T A;  1SSO A;  5D3I B;  2XWJ B;  1C4Q A;  1Z7T A;  2NBF A;  1DZ1 A;  1Z47 A;  1WD1 A;  5M5X B;  3GTJ B;  4CKB A;  1KAB A;  1QE6 A;  1RJT A;  1TWA B;  1QCB D;  1S5F D;  1MD2 D;  4ABN A;  3H09 A;  5NUC A;  5M3M B;  1RTN A;  1EIG A;  5EPJ A;  4OO1 H;  3VR2 A;  4A3B B;  3J80 E;  2BCO A;  5J39 A;  1T5E A;  5HGT A;  3HEJ A;  2F0F A;  3KBX A;  1FR3 A;  3HOY B;  1GUS A;  1S5D D;  4FVM A;  2E2H B;  2R61 A;  1ENC A;  5T1I A;  2F0U A;  3HOW B;  4BY7 B;  2IPK D;  2HQE A;  3LX0 A;  3PUW A;  4DK1 A;  1I4G A;  3A56 A;  3M3Y B;  4IFD I;  3OIQ A;  3CKI B;  1PLF A;  5JJZ A;  1K8O A;  2B2T C;  1MI2 A;  3BG3 A;  2N55 A;  4BBR B;  3TN2 A;  1CA5 A;  1PFB A;  4HSV A;  3SEB A;  1DM0 B;  2QCP X;  4FXG C;  2L9H A;  4C3J B;  1EZ8 A;  2KA7 A;  1JWM D;  1ILQ A;  1HFG A;  1SYD A;  3R2I A;  3Q0A A;  5JAV A;  2A69 D;  2HDL A;  3Q24 A;  3ERO A;  1JOO A;  4PNY A;  1PFN A;  4Y7N B;  1A3V A;  1S5B D;  1F77 A;  3PUZ A;  1EQT A;  2ICE C;  1BNZ A;  1CI3 M;  3A8I E;  4E6I A;  5C4Z A;  1CZG A;  3TP8 A;  2SEB D;  4K2L A;  1GUN A;  3OWF A;  4KN4 C;  4JBW A;  5FK9 C;  4PMB A;  1SE2 A;  2EVB A;  2QIL A;  2L1B A;  1HPC A;  4IUQ A;  4FYD A;  1PZI D;  5C3E B;  3BZD B;  2ZXO A;  1EYC A;  4KJO A;  3A54 A;  1AZP A;  5C0X J;  2TSS A;  2KEE A;  3GTO B;  1EU4 A;  5DM7 3;  2AQ1 B;  4B9W A;  4KHZ A;  4BY1 B;  3J80 L;  4A93 B;  3E0J A;  2SNS A;  5KIX A;  1I4X A;  1PTO B;  1X32 A;  3VR5 A;  1VF7 A;  3GTL B;  3FEW X;  3A7L A;  3I91 A;  4J1M A;  2B39 A;  3QO2 A;  4NMZ A;  3QJY A;  5K36 G;  1LTI D;  5IGD A;  5ELE A;  4R9W A;  5LHY 1;  4UDU C;  4ID6 A;  2PW5 A;  4IFD G;  4XIG S;  5EBC A;  1UEA B;  4RGO S;  5EBD A;  2RKS A;  1Y1V B;  1F2M A;  1STB A;  2R6G A;  5EQ0 A;  1PTO H;  1JE4 A;  1BCP B;  1II3 A;  2A6H C;  1EY5 A;  1TWG B;  2QDB A;  3J7A F;  2MPM A;  2WP8 J;  3PUX A;  1HA5 A;  5M5Y B;  1PTO F;  2XNA C;  4JK1 C;  3PO2 B;  2L0C A;  4ME5 A;  4AYB B;  3M4O B;  4ZRZ A;  1PTO D;  1U4P A;  2RQX A;  1BR9 A;  1HXY D;  5C0X I;  2BE5 C;  1R4Q B;  2CVR A;  3FDT A;  4U68 A;  2D5D A;  1WTX A;  1TY0 A;  3VA5 A;  4ZLT F;  3R93 A;  1Q3L A;  5D65 A;  1I4R A;  1TWF B;  2FMC A;  5COY A;  4K6D A;  3LWU A;  5KYL A;  4DGZ A;  5IGG A;  2DNE A;  2CHB D;  3N52 A;  1H9K A;  2WIN B;  4G4K A;  1PRT C;  4IUV A;  4OO1 I;  5C5M A;  2G9H D;  4ZAI A;  3I4N B;  1RHP A;  4F88 A;  1GOZ A;  3M7N A;  5EKI A;  3L7Z C;  3GP7 A;  1RTO A;  5CV5 A;  2YU9 B;  3DWQ A;  3MEH A;  3U9O A;  4YIJ A;  2F0I A;  2KCC A;  4XQJ A;  3NXW A;  1V43 A;  2IW3 A;  1EL0 A;  3HP3 A;  2JYO A;  1JOK A;  1SYF A;  1O7Y A;  3MXU A;  1A3T A;  4G7H C;  2IT1 A;  4B08 A;  4EQP A;  5IGE A;  1YNN C;  2A68 D;  2F0G A;  3HKZ B;  4IUP A;  1JQY D;  5CC4 A;  3EQL C;  3QOL A;  3SK8 A;  1KTK A;  3A8K E;  5JPN C;  4OIJ A;  1WTQ A;  3GV6 A;  1H9M A;  3DWP A;  3I90 A;  4FP5 D;  4C3I B;  1RF2 D;  2B2V A;  2K6A A;  2FMM A;  1TS4 A;  2K28 A;  4B9X A;  3OHX C;  1DYQ A;  2WKC A;  4RH6 A;  4FNF A;  4I7Z C;  2VUM B;  1EY0 A;  4A3D B;  3TP5 A;  1EFI D;  3D6C A;  4DK0 A;  1KNE A;  2KQ3 A;  4F8M A;  1LTR D;  2IWH A;  4LJZ C;  4HN7 A;  3I4L A;  5C0X G;  2V4D A;  3CRL C;  2K04 A;  1SJH D;  1DXM A;  3HGB A;  3HOZ B;  4BBS B;  3C2P A;  2WB1 B;  1OXT A;  1ENA A;  3NWS A;  4ZKB B;  2PCF B;  2MJ8 A;  1EYD A;  3S1N B;  2AWO A;  2A74 C;  1CQV A;  3C1F A;  2F0O A;  3K7A B;  3RMH A;  2K32 A;  5CBA E;  2I07 B;  4XQN A;  3P1H A;  3TBI B;  3MTS A;  1LT3 D;  4CJ2 C;  1HFN A;  2JSO A;  4Q5V A;  4N9P A;  4ZYS A;  5LL6 X;  4H0L C;  2LS0 1;  2D2C C;  5IGB A;  1OO9 B;  2K1B A;  2PPB C;  2ZXR A;  4X3K A;  1VMC A;  1STY A;  1H9S B;  1U4L A;  3MFG A;  2NVX B;  1EU3 A;  5IT9 L;  4RFB A;  4H13 C;  4RGM A;  4MN3 A;  1WCM B;  1GUT A;  4XT1 B;  2H4O A;  2TMP A;  3VR6 A;  1KAA A;  3NQI A;  2B8F A;  4PMC A;  3S15 B;  2JP1 A;  1Y69 U;  1PDQ A;  2KHS A;  5JVH 3;  3IFD A;  4OHJ A;  3BDO A;  3C46 A;  1V8Q A;  1VF5 C;  2KCN A;  5J1Z A;  1LTT D;  5ELB A;  1LV9 A;  3NPP A;  5C4X B;  1HUM A;  5JOB A;  1DOL A;  3V05 A;  1QNU A;  2J4X A;  3H0G B;  4R8N A;  3R2T A;  1CFM A;  2OXP A;  5EPK A;  5C44 B;  2Q8T A;  4TRD A;  2NVQ B;  3BVZ A;  4HMI A;  5E3F A;  3D4W A;  5ELF A;  2GA4 B;  1E2V A;  3Q23 A;  4FXK C;  2NTS A;  4A3G B;  3HS0 C;  4DA2 A;  1TS2 A;  2EYH A;  2CW0 D;  1I4Q A;  1YNJ C;  5KEE A;  1V1P B;  4L6T B;  3GD7 A;  2F0P A;  2IX3 A;  2EE1 A;  3W3A A;  5CR3 A;  3G7L A;  4C3J G;  3BDC A;  2VB2 X;  1KDB A;  3VR3 A;  1IHZ A;  2B2V C;  4RHR A;  2L5T A;  2IJ0 A;  5KNB A;  1FNU A;  3Q6S A;  3K0Y A;  2L4N A;  2I46 A;  4KJN A;  5CV9 A;  3L3O C;  3NBI A;  1TT2 A;  2F0V A;  4XYO A;  3MXP A;  1SNM A;  4HTH A;  1VCI A;  1EQV A;  1STN A;  1F9R A;  5CGK A;  3DXJ C;  1SE3 A;  1RCV D;  1QOH A;  4WOR A;  1LT4 D;  1TY2 A;  2XIW A;  4C56 C;  2RVL A;  1FGB D;  4K5X A;  3DEP A;  2WKD A;  1HRJ A;  5FO7 B;  1CHQ D;  3IFT A;  5KYI A;  2LFN A;  2EJF C;  1FNW A;  4I65 A;  2XVS A;  4J8Q A;  1WTR A;  2EY1 A;  2E2I B;  4XXE A;  3R3O A;  5CV8 A;  1NUC A;  5A2Q E;  3PV0 A;  1KDA A;  3KLR A;  1HA6 A;  2MGS A;  2EY5 A;  3BYT B;  4HAE A;  4DN4 M;  2VNU D;  1XTC D;  2F3V A;  1HUN A;  2F0E A;  2ZT9 C;  1PXU A;  3L9A X;  5I6Y A;  2F0D A;  4K8J A;  3GO5 A;  1TS5 A;  4A3K B;  4A3J B;  4KHV A;  1G8Z D;  1B50 A;  2K5W A;  1DON A;  4KMU C;  3F2U A;  1EEI D;  5CV4 A;  3VR4 A;  3ND8 A;  2HDM A;  1BF4 A;  3N6R A;  1SDF A;  3OMG A;  2IL8 A;  5C6A A;  3PMF A;  1HTL D;  1B9M A;  1KNA A;  3D4D A;  3S2D B;  1UUP A;  4XT3 B;  1I4H A;  4QF4 A;  2RDH A;  5C3W A;  2VXW A;  2HCC A;  1O7L A;  2IX0 A;  2WAC A;  5IIF A;  3A55 A;  1O7Z A;  4N9T A;  1A2T A;  3CHB D;  1SXT A;  4Z9C B;  2NN6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...