1C9OA

Crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD-SHOCK PROTEIN
publication title Thermal stability and atomic-resolution crystal structure of the Bacillus caldolyticus cold shock protein.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1c9oA00
2IX1A 1Q12A 3S14H 3GTMH 3ER0A 1SE8A 4POFA 2ZTCA 4DV7Q 4IOCA 1Y14B 4DV0Q 1K3RA 1NMGA 2WAQE 2ZJQA 1V43A 2D0PA 4LFCL 5K36G 4DR5L 1KRSA 4AH6A 2UUAQ 1XTDA 5BR8Q 2F52A 4LF7L 1X56A 3RLOA 1VQOA 4C3IH 3HOUH 3K81C 4A3GH 1W2BA 4ALPA 4B3RL 4NXNQ 1WJJA 4R4QA 2MFIA 3STBC 1Q82C 1QVGA 2OWOA 4QJFA 2QGQA 4DV3Q 1I94Q 3PF5A 2OTJA 4P75A 3K7AH 1VQKA 1PHJA 4JI0L 1PH6A 1HZCA 2VZAA 3U4VA 3HOXH 4JI1Q 4YWMA 3T1YL 1IL2A 4KHPL 1PH2A 2E2JH 2AWOA 2RHQB 2E5LL 3I4NG 1E22A 3HOVG 2E8GA 4JCVE 1E7ZA 1L1OC 4X66L 1JE5A 2OCEA 4HIOA 5AJ3L 1VQ7A 1PVOA 1H95A 1VQAA 4Y7NH 3S2HH 1NBWA 4JI8Q 3CQZH 1SMXA 3M3YH 4R4TA 1K8GA 1HNZQ 2LXJA 3G6EA 3FHWA 1HNWQ 3EN2A 3CCVA 3F8TA 2BH2A 2JA6G 2Z6KA 1VQNA 4IFDI 1VQLA 5C0XG 1MKHA 2JA6H 3ICEA 2GVAA 5M3MG 2HHHL 1N8RC 4LF9L 3PO3G 1LM0A 2WAQG 4DR2L 3PO3H 4DR4L 2K5NA 1LUZA 1N9WA 2ZTEA 3E9IA 4RG1A 4PMWA 3J81c 3KJOA 1XJVA 4JYAL 1HNXQ 2IT1A 1PH3A 2YTXA 3CF5A 1JJGA 3CMAA 1ASYA 1EQRA 4JBMA 2VUMH 4DV0L 3J81j 3H3VH 2UXDL 1VQHA 2N3SA 3J80i 3T1HL 5M5XH 1PH8A 4JI7L 1X9NA 4J15A 4P74A 4GNXC 4BBRG 5JJIA 3H15A 4OX9Q 4DK3C 1TWAH 3CC2A 2JA7H 3J81i 4BBRH 4A75A 2UUAL 4JBKA 2A19A 4APVA 5FLMG 4ME3A 3LGJA 4LF6Q 4JV5Q 4TQUS 2NZOA 3ULLA 4EQ5A 3GTQH 4OWWB 4YCUA 3BZKA 1IXRA 4XTCS 4GLXA 1TWCH 2PNHA 4R1JA 3CCLA 4JI3Q 3EBEA 1EWIA 4DR1L 1CKOA 4DR3L 4A3EG 4B3MQ 4IO9A 2RCNA 2JE6I 4A3EH 2HT1A 2K52A 3S16H 1YIJA 3TS2A 1PV4A 2XTIA 1X65A 1PH4A 3RNUA 1XPUA 5IWAQ 3CCMA 1HZ9A 1XPOA 4DV6L 2PQAB 4UPAA 4R4IA 3A5UA 2NVXH 2VQFL 1L1OA 3KF6A 4A3BH 4UP7A 4YY3L 1I3QH 4DR6L 4BXXG 5FJ8G 2A8VA 4BXXH 1XMQL 2NZHA 1XNRL 5FJ8H 1N32L 3STBD 2KENA 3RR5A 1CKNB 4GKKQ 4IPCA 1X55A 3I56A 2JEBI 1OXVA 3PUVA 2JA8G 1TWHH 1XMOQ 1EYGA 2JA8H 1B8AA 4JI4L 1HNZL 1KHIA 4HJ7A 1S72A 1X54A 1YHBA 4AIMA 1K73C 4A3CH 1I6HH 4A4IA 1IYJB 2R7FA 2OTLA 3AFQA 4DUZQ 4FDBA 3CP0A 1N34L 4LF4Q 2NVTH 4IJHA 4DV2L 2BA0A 1Q86C 4X64Q 1L2FA 2BH8A 4OO1G 3GTGH 2DUDA 3DLLA 4NXMQ 1VS0A 3F2BA 1YITA 2UUBQ 4QGUA 3A74A 1VQCA 3VDYA 3S1NH 5EAYA 4LF5Q 1A63A 2OQKA 2K5VA 3M4PA 1BBUA 4GNXA 1YVCA 1VCIA 3KF8B 1IBLQ 4OX9L 1OXTA 3D0FA 4DV4Q 4C2MH 1YNXA 3PUWA 1C7YA 3HOYH 1PFSA 4DR7L 1YZ6A 1KD1C 3KLWA 4LUVA 1YJ9A 2AHOB 4LWCA 3S15H 4JI2Q 2H5XA 4GOPB 2F4VL 1GVPA 3GTOH 1CKMA 1Z47A 2KCMA 4JC0A 3SGIA 4DPGA 2JA5H 4B3SQ 3EIVA 3CCEA 1MJCA 4HJ5A 3HOZH 4B3ML 3PF4A 1XPRA 3I4OA 5IYCG 3AYHB 3F1ZA 3I4MG 5IYCH 3HFZB 3A0JA 3L0OA 4IPDA 4B3TQ 2Q2UA 3D31A 3I4MH 1E1OA 3G48A 3K8AA 1Y1WG 3CCRA 2K50A 2VY3A 4DNIA 1SROA 2WP8J 4IPHA 1FL0A 1SLJA 1Y1WH 2ES2A 3S1QH 2D62A 1TXYA 2AWNA 3HOUG 5H1SE 2A1AA 3CCJA 1OXSC 5LMUL 4A3GG 3W1GA 4HJAA 1AE2A 1EOVA 2K75A 1XMOL 3RLNA 4YWKA 3S2DH 2RF4A 1BBWA 1C0AA 1X6OA 2JEAI 4LFBL 1IZ6A 5C0XI 3NENA 3Q8DA 1HJPA 3HOXG 4LFAL 1IBKQ 4QL5A 1JMCA 4JOIC 1WI5A 1G51A 3RLFA 4DV5L 2UXBL 2JK8A 1IBML 2UUBL 2B29A 1UE5A 2IY5B 3L7ZC 3H3VI 4IJLA 3KFUA 4JBJA 2Q2HA 4X65Q 1JJ2A 4JI6Q 3KDFB 2I0QA 1O7IA 5IY0A 3GTKH 1G291 1K83H 2UXCL 4LNQA 1B70B 4GN4B 4GKJL 3PUXA 2ALYB 1HR0Q 2LXKA 1N36Q 2CFMA 1Q1EA 2NVYH 2XGTA 2YYZA 1GM5A 1PH5A 2B63G 5GADC 2IX0A 2L15A 1EQQA 2B63H 2KBNA 4KI0A 4MNOA 3F2DA 1AE3A 2WB1E 2ZJPA 2UU9L 4XIGS 3M4OH 1B7YB 3A5ZB 3CAMA 3KYHC 1Q46A 2MO1A 1K0RA 5GAHC 2YV5A 1L0WA 2MO0A 4YHHQ 2YTYA 4DV7L 4HJ8A 4A93G 1KRTA 4NB3A 1NE3A 4A93H 3KJPA 4B3TL 1CUKA 2JA7G 4RMFA 4A3DH 1MJEA 4GOPC 2NVQH 1QVFA 4AQYQ 1D7QA 2ZM6Q 4A76A 4DUYQ 2R93H 5BR8L 3HOWH 1D8LA 1OXUA 3JAMc 5ELOA 2ZJRA 1SR3A 2VL6A 4X62Q 1VQDA 2CWAA 2JQOA 2JA9A 5IP9H 4HIDA 4NXNL 5IP7H 2PQAA 1WYDA 2QEXA 3OTOQ 4DV3L 1I94L 5ELNA 2E2IH 3TS0A 1TWFH 4GS3A 4JOIA 1XNQQ 3IRBA 3PGZA 1CKNA 4JI1L 4A3MH 2OQ0A 1VQJA 4YCWA 3OYYA 3W1BA 1Z9FA 3CCSA 4JI5Q 4A3IG 4POGA 1FJGQ 3RZOH 3UDIA 4A3BG 3BZCA 1W3SA 4A3IH 2WFWA 3RZDH 1X3FA 1N33Q 2YTVA 3CCUA 5FLXc 4X65L 1X3GA 3K7UC 4UY8C 4JG2A 4O0AA 1I5FA 3ERSX 1VQMA 2BA1A 1QUQB 4DKAC 4JI8L 3JC66 3PCOB 4A3CG 4DV1Q 5JJLA 2K14A 1K9MC 5LMNQ 1HNWL 2WB1G 2I5MX 1OXXK 2CKZB 2R7DA 3HKZE 2CWPA 3GO5A 4A3FG 1A62A 5JJKA 4UP9A 3U4ZA 4A3FH 3PSIA 3NEMA 4LFCQ 4PZ6A 4DR5Q 3S17H 4UP8A 2PI2A 1TWGH 5C4XG 1HNXL 3PUYA 1JJCB 5M3FH 4LF7Q 5C4XH 4YHHL 1Q7YC 1CSPA 4GLAC 4L5TA 4AYBE 4DK6C 4OWXB 4A3LG 2UUCQ 1VQ9A 4GOPA 4B3RQ 5C3EG 4A3LH 1S3OA 2MNAA 1KQSA 1U5KA 2F3IA 1RIPA 4LUOA 5C3EH 2VQEQ 1PH1A 1HR0W 3HOYG 4QQBX 1A0IA 4BA1I 2CCZA 4L5SA 1A8VA 1BVSA 4LF6L 1VQBA 3PO2G 4JV5L 1ASZA 1MIUA 4OWTB 4JI0Q 1U0LA 3UE1A 2ZTDA 5M5YH 3PO2H 2JA5G 4KHPQ 3GTJH 1SN8A 3F2CA 2E2HH 2E5LQ 5C44H 3HOZG 4JI3L 1YEZA 1GO3E 4X6AH 1LYLA 5HGQA 4HIMA 4X66Q 1SFOH 2LSSA 4WJ3M 1GKHA 5AJ3Q 4IPGA 2MQHA 4DAYB 5IWAL 1J5EQ 2B3GA 4DV1L 1FGUA 1C9OA 1V9PA 3MEFA 1UWVA 1FJGL 2VUMG 1NTGA 2EIFA 2N49A 4GN5A 5DLQE 1VQEA 3CMEA 2K4KA 4QIWE 1YBYA 2R92H 1G6PA 5GAEC 1N33L 3BJUA 1E24A 5M5WH 4IOAA 1KAWA 3ZJYC 3PV0A 4GKKL 2JJQA 2ASBA 4A3JG 2HHHQ 4LF9Q 2KHIA 4LW1A 4A3JH 3HKZG 3S1MH 3U58A 4DR2Q 4DR4Q 2EXDA 3BU2A 3RN2A 5IE8A 5LMNL 4JYAQ 4PZ7A 4KLKA 4TVAB 2VW9A 2NN6G 4DUZL 3UDGA 3J7A5 1E3PA 3ULPA 4LF4L 3T1HQ 2UXDQ 3FKIG 3H0GG 3KDFA 4JI7Q 4AYBG 4X64L 3CPWA 3FKIH 3H0GH 4A3KG 4BY7G 1VQFA 2N8NA 4A3KH 4NXML 1Q8KA 3PIOA 4BY7H 1LTLA 4GN3B 4QY7A 1P16A 4YWLA 3TREA 3AEVA 4C3HH 4LF5L 1I50H 4O2DA 1KIXA 4OONA 1KL9A 4KHZA 2D0OA 2UUCL 1QZGA 1VQGA 1AH9A 1IBLL 3FP9A 3OW2A 4DV4L 2VQEL 5LMNW 4DR1Q 4DR3Q 1X3EA 4IFDJ 2UU9Q 1J6QA 3G71A 4PZ8A 1PYSB 4JI2L 3I2ZA 3CPFA 1T9HA 4DV6Q 4B3SL 4K0KQ 5IYBG 3J7ZC 1PA6A 3TRZA 5GQOA 5IYBH 2VQFQ 3I4NH 4JBWA 4DR6Q 4YY3Q 3HOVH 3M7NA 4R4CA 1CSQA 1Y1VG 3PUZA 2QA4A 1XMQQ 1XNRQ 1N32Q 3AQQA 2V1CC 2AMCB 1Y1VH 1QZHA 1J5EL 4A3DG 3GTPH 4WJ4A 2KHJA 1S40A 3PIPA 4JI4Q 2R93G 3CC4A 2N78A 1YHAA 3AFPA 3NELA 1K8AC 3HOWG 4OO1I 3S1RH 1PH7A 3I55A 5IT9c 5IP9G 2HIXA 1N34Q 3J80c 2IHFA 5IP7G 4DV2Q 5M3MH 1EFWA 2C35B 3UDXA 1HZAA 3GTLH 2EQSA 4P71A 1KC8C 3TQYA 3RN5A 2VS1A 1VQ4A 2I5LX 1BKBA 1YHQA 3TEHB 2KCTA 3JAMi 1VQPA 3K0XA 4HIKA 4A3MG 1IBKL 5JEAJ 1UE7A 2Y0SE 4R4OA 1V1QA 3M4QA 4YCVA 1QUQA 3M85A 3CC7A 1EIYB 3CXCA 4LF8Q 4L5RC 1FVIA 4DR7Q 1UE1A 5FLMH 4JI6L 2RHSB 5J3BA 1WCMG 4IFDG 5IYDG 1E1TA 2PI2E 4MTNA 3E0EA 1M1KC 4MZ9A 1WCMH 2F4VQ 5IYDH 4BA2I 1EUJA 3NBHB 1NJIC 1GD7A 1NMFA 1HR0L 1OTCA 5E7NA 1N36L 4NPSA 1JT8A 3CCQA 1P8LA 4C3JH 3KOJA 2I5HA 1QVCA 3CD6A 4K0KL 2ATWA 4HJ9A 1UE6A 2FXQA 1YJWA 2AKWB 2CQOA 5M3FG 2GN5A 5HY6A 5LMUQ 2GVBA 4PG3A 1RL2A 3MXNB 2HQLA 3HKSA 3GDEA 1L1OB 4LUZA 3KF6B 1YJNA 4AQYL 1WFQA 2ZM6L 4DUYL 4LFBQ 1WOCA 3ULJA 4LFAQ 4P73A 3W5OA 4X62L 4DAMA 2YU9H 5C44G 3T1YQ 2IHEA 3M9BA 3S24A 1VQ6A 2Y0SG 5C4JH 5GAGC 1VQ5A 2PMZE 4DV5Q 4Y52H 2UXBQ 5JEAG 3CW2C 4BBSG 1IBMQ 3OTOL 4BBSH 2K5HA 1HH2P 2NN6I 3UE0A 1Q81C 1HZBA 4P72A 3WWVA 3GD7A 2DGYA 1NY4A 2ID0A 3B6YA 4GLVB 4BY1G 3U50C 1YI2A 1XNQL 1M90C 4BY1H 4JI5L 4H02A 2R92G 2R6GA 2UXCQ 3DM3A 2Z0SA 5GROA 3G4SA 2Q2IA 4GKJQ 1Q1BA 1KXLA 1EIFA 3E9HA 4LF8L 2VNUD 2R7ZG 4EX5A 1VQ8A 2R7ZH 4OXPA 2Z6KC 2HIVA 4GNXB 3L2PA 1JB7A 1DGSA 4L5QA 3I7FA 1PH9A 1SRUA 1R9TH 3UDFA 1VQIA 2Q2TA 3K80C 1PYBA 1UEBA 5C0XJ
chains in the Genus database with same CATH superfamily
2IX1A 4G7HC 3P20A 1STAA 3GTMH 2RSOA 2EZVA 3D4DA 1SE8A 2ZTCA 2Z9HA 4DV7Q 1Y14B 1R4QB 1XTDA 3W2DA 1I50B 4K6LA 4C3IB 2F52A 3K5OA 2HQEA 3R3OA 5IIFA 3HOUH 3K81C 2J0TD 3STBC 5BN4A 1UAPA 1HFNA 3TMEA 1TY2A 2BE5D 2QGQA 4QJFA 5T1GA 2KOLA 3MAQA 1DOKA 4DV3Q 1PHJA 3HOXH 1FYCA 2K6AA 1G2TA 3I4NG 5FOBB 1E22A 3HOVG 2E8GA 1U4MA 1E7ZA 1JE5A 2OCEA 4HIOA 2CH4W 1PVOA 2DJGC 2XNAC 3M3YB 1SMXA 3V05A 4FF4A 1HNZQ 3S1RB 3EN2A 2Z6KA 1VQLA 4ZK9B 3ICEA 2GVAA 1E2WA 3PO3G 4RKBA 3ZYYX 3PO3H 1L0XB 4DR2L 4DR4L 4Z9CB 2K5NA 1N9WA 3PQIA 1XJVA 1B53A 2IT1A 1PH3A 3WDNA 2YTXA 4JBMA 2JP1A 2BCOA 2NUCA 5M5XH 1K28A 3T56B 2A69D 3H15A 1TWAH 1EY8A 4A75A 2A19A 5FLMG 3LGJA 4LF6Q 4DGZA 4JV5Q 3VR3A 1PFBA 1V1PB 3GTQH 4OWWB 1B1ZA 2JXMB 5J22A 2BOSA 4HCSA 4JI3Q 2PNHA 4A3EB 1CKOA 1RTOA 1PH4A 3RNUA 2NVXB 1XPOA 4R4IA 3A5UA 1FNUA 3FRPB 3MXNA 1L1OA 3H91A 4YY3L 5FJ8G 2FJ2A 1IL8A 5FJ8H 3AU7A 2K5QA 2M2LA 3OHXC 1B8AA 1Z6HA 1K73C 1YHBA 2Z8LA 4A4IA 1LTGD 4DUZQ 1S4ZA 4FDBA 3CP0A 2BA0A 2Y0SB 2EVBA 2BH8A 4OO1G 4OIJA 3F2BA 1YITA 4OO1H 1WTVA 1RKNA 2Q8IB 2OWOA 3A74A 3TZUA 3VDYA 5EAYA 1HQRD 1LTSD 3M4PA 1ZXTA 3D0FA 1HHVA 2EDGA 5JPMC 4C2MH 1YZ6A 1YJ9A 2AHOB 3H3VC 4B3SQ 4JC0A 3NP8A 1HA5A 3NHHA 3I4OA 3BS1A 3F1ZA 3HFZB 3A0JA 3P7JA 2EY5A 1PLFA 1Y1WG 4OIKA 4DNIA 5E4XA 1SROA 1PDQA 1Y1WH 1CFMA 2ES2A 2K1BA 3HOUB 2AWNA 4A3GG 2A1AA 5KYLA 1FNVA 4KJNA 2WV6D 4HSPA 3CKIB 2C9OA 3TP6A 1C0AA 5C5MA 1G8ZD 1X6OA 2JEAI 4LFBL 5IT9E 3HOXB 4LFAL 2RDHA 3J80E 1MD2D 4DK1A 4LMQD 3DHQA 1WI5A 1G51A 4DV5L 2OT2A 2B29A 2IY5B 3D6CA 5CV7A 2A74C 4IJLA 4JBJA 3DEOA 3KDFB 3E0JA 3VR2A 1WD0A 3GTKH 1G291 1K83H 2MPMA 1CK1A 1VF7A 3GV6A 4CKBA 3NTIA 1N36Q 1PH5A 3SDZA 2L15A 1EQQA 3DWQA 2RSNA 1AE3A 2WB1E 1G2SA 5ISRA 2FHTA 1Q8IA 3A5ZB 3CAMA 2DN8A 1K0RA 5GAHC 3C2PA 1L0WA 5M5XB 3MXPA 2NTSA 1TWAB 3KJPA 2JA7G 3I72A 1EOTA 1KLGD 4N9TA 2AQ2B 1D7QA 4MIUA 3ITPA 3HOWH 1STHA 5ELOA 4RFBA 2JA9A 5IP9H 5KYIA 2E74C 4HIDA 4NXNL 5IP7H 2DY8A 2QEXA 1I94L 3Q22A 4QB4A 3W3AA 1K0SA 4GS3A 4JOIA 4RCOA 1CKNA 4K2LA 2OQ0A 3CCSA 4POGA 1GHKA 3URYA 1Z9FA 2M9VA 3RZOH 2F0VA 3BZCA 5TSSA 3FPUB 2WFWA 3MTSA 2YTVA 4X65L 1ET6A 4UY8C 4JG2A 1I5FA 4JI8L 4A3CG 3QIAA 2K14A 5D14A 1PFNA 1K9MC 5LMNQ 2WB1G 1OXXK 2CKZB 2B2UA 3IKJA 4KKUA 1QOHA 1YNJD 2F0GA 3DUZA 1AN8A 2KVMA 2PI2A 2DJFC 2E2DC 5I2YA 1HNXL 3PUYA 4QUCA 4RGNA 1BOSA 1JWSD 2DNEA 4AYBE 2LY7A 4A3LG 1VMCA 4J1MA 4A3LH 4C2MB 2MNAA 4XT3B 1PH1A 3K5LA 4QQBX 3EJIA 3PO2B 1AZQA 4OELB 3Q23A 2JA5G 4RH6A 3HOZG 1YEZA 4XQQA 2ZXRA 1SFOH 1GKHA 1STEA 2MQHA 5IWAL 1Q3LA 3I8ZA 1UWVA 1FJGL 4CKEA 1Y1WB 2K4KA 3P1HA 4A3JB 2KHIA 4DR2Q 1EU4A 4DR4Q 3A7AB 1MGSA 5IE8A 4PZ7A 3SR1A 2VW9A 4KY7A 3UDGA 3J7A5 1E3PA 3FKIB 2B39A 4AYBG 1D5XC 2K32A 2N8NA 1H9JA 4NXML 2DY7A 2MGSA 2PNRC 3WOFA 1RJTA 2ICIA 4IN3A 2O4XA 3FP9A 2VQEL 5DM63 3D6WA 2EYOA 1XYIA 4I7ZC 1PYSB 3TDQA 4JI2L 4HSVA 1XWEA 4IZ8A 4K0KQ 1BCPF 2GA4B 5GQOA 5L37A 1SNPA 4YY3Q 2ENBA 4QIWB 1I4XA 1Y1VG 3EQLC 3NSWA 3S9WA 2QA4A 2EYMA 1KNAA 1Y1VH 5JVH3 1QZHA 3V2TA 1J5EL 3GTPH 1QNUA 2R93G 1YHAA 3NELA 3HOWB 1H9KA 1KTKA 2EPBA 3I55A 2F0UA 2HIXA 4JVZA 5ELCA 4RAUC 2IHFA 2C35B 5JAVA 1QNKA 4TKOB 1G91A 3TQYA 3RN5A 2VS1A 2Z6BA 2I5LX 4ZUIA 1YHQA 1WTHA 3TEHB 2KCTA 1EQVA 5JEAJ 5FLXL 3RZOB 4HEDA 2RVLA 1Z7TA 3FMCA 3TP8A 2K33A 3CXCA 4LF8Q 4JPBW 4HTHA 4L5RC 4DK0A 4JI6L 4IFDG 4OL7A 5IYDG 3E0EA 4IFDH 5IYDH 3IFDA 1EUJA 2J7ZA 1NMFA 3GV3A 2RA4A 3CCQA 4C3JH 3DWPA 3KOJA 2I5HA 5ELBA 3SVMA 4R9WA 3BDCA 1UE6A 1L0YB 1KDCA 2XWBB 3HEJA 3E5SA 5HY6A 1O78A 3A7LA 4HMIA 2GVBA 2A6HC 3D3RA 2FFKB 1K3BC 3M7GA 4MHEA 1J8IA 2F0QA 4FVMA 1WFQA 2ZM6L 4LFBQ 1WOCA 3ULJA 4LFAQ 4P73A 1H9SA 2F0NA 3W5OA 2F1MA 4C1NI 3T1YQ 1GUTA 2IHEA 2B8FA 4DAYA 1Y69U 1VQ6A 5EBDA 1VQ5A 4DV5Q 1SFOB 1GXDC 4Y52H 4QMGA 3OTOL 5J1ZA 1IW7D 1W6KA 4ME5A 3B6YA 5FK9C 2LMCB 4JI5L 2R6GA 3OMGA 1EY6A 1Q1BA 1LT3D 1CA5A 1EIFA 1MI2A 4CDFC 2R7ZB 5JPNC 2RQXA 4EX5A 1TKWB 4GNXB 1R9TB 1TR5A 2X69A 1ILPA 2EE1A 2PPBC 1WVLA 1YNND 2SOBA 1BCPB 4CDDC 2XN9C 4KY5A 1UEBA 4DV1L 1Y8NB 2C5CA 3ER0A 2ZJQA 3PMFA 4LFCL 5K36G 1KRSA 3VYUA 2UUAQ 2Z4IA 4C3IG 1CZGA 1S5BD 3RLOA 4C3IH 1MBYA 4EQPA 1UNSA 1WJJA 1SMYD 2MFIA 4R4QA 1Q82C 4NXNQ 4XQJA 1X32A 3I91A 3PF5A 1I94Q 4J6HA 1PH6A 1FR3A 1NSNS 3V96A 1E2ZA 2A6ED 3OWFA 1LTAD 1PRTC 2KECA 2RHQB 3SK4A 2QCPX 4X66L 1Y1VB 3T4AC 3E6ZX 1VQ7A 1FGBD 1VQAA 4Y7NH 1AZPA 1NBWA 1LT4D 4JI8Q 3CQZH 3M3YH 1QJOA 4UDUC 3G6EA 3FHWA 1I4GA 2JA6G 1VQNA 3J81L 5C4HA 5C0XG 2JA6H 5C0XH 2WAQB 1ICWA 2ZTEA 1HNXQ 1EY9A 3CMAA 1ASYA 4DV0L 3H3VH 1VQHA 2N3SA 1LLRD 2KCCA 4J15A 4GNXC 4H7BA 4OX9Q 4DK3C 3J81i 2AUKA 4JBKA 3NBHA 1BCPC 5ELDA 1E2VA 3NUCA 2NZOA 3F2UA 1LABA 3PF4A 3FVQA 3EBEA 4A3EG 4B3MQ 2RCNA 3TS2A 4A3EH 1JC7A 4C3JB 1YIJA 3SHLA 1X65A 3U9OA 5IWAQ 4DV6L 2PQAB 4UPAA 1PTOB 4L63B 2NVXH 1WTRA 2EYJA 3KF6A 4A3BH 3QOJA 4UP7A 3CHBD 4DR6L 3LX0A 2LKVA 4WORA 1XMQL 2NZHA 3A8JE 2KENA 3RR5A 1D1KA 1X55A 2JA8B 1STBA 1OXVA 4KN4C 1NUCA 2VXWA 1XMOQ 1EYGA 3A55A 4JI4L 1ONLA 5A2QL 4HJ7A 1I6HH 1X54A 2G9DA 1NR2A 2R7FA 4N9PA 3SE0A 1SNMA 2F0SA 4K5WA 2NVTH 4IJHA 4DF7A 1Q86C 2PW7A 1L2FA 1SDFA 2F0EA 3DLLA 4NXMQ 1VS0A 1NNXA 5COYA 4QGUA 4XYOA 3VA7A 1VQCA 3S1NH 1A63A 4CDEC 2K5VA 1BBUA 1YVCA 1K8MA 1M8AA 3J7AV 3VYTA 3T53B 4EQNA 1KD1C 1PZJD 1SNOA 3OMCA 3A54A 4JI2Q 3GTOH 4DPGA 1ZEQX 3CCEA 4F87A 5FO7B 3NWTA 4RGOS 3I4MB 4NMZA 2K7VA 3D4WA 1T5XD 3SK8A 1E1OA 1JE4A 2VY3A 4WRDA 2WP8J 3U9SA 1STGA 3N6RA 3HOUG 4DXFA 5LMUL 3W1GA 4HJAA 1AE2A 1KDBA 3RLNA 4YWKA 3S2DH 5KEEA 1PTOC 3Q24A 4IUPA 1EY5A 3OWEB 4G7OC 1ZYRD 4L8JA 3NENA 3Q8DA 3HOXG 4QL5A 2SDFA 4RHRA 3RLFA 2UXBL 2JK8A 4CJ1B 2UUBL 1UE5A 4Y7NB 4JI6Q 2I0QA 3CQZB 5IY0A 1AEXA 4I65A 2JA6B 2LXKA 2QKIC 1LV9A 4DAVA 3IFTA 2L1BA 2B2WC 4MNOA 1F9PA 4PNYA 1B7YB 2MO1A 1AP0A 2MO0A 4YHHQ 2YTYA 4HJ8A 1I4HA 1V1PA 4B3TL 2ZM6Q 4KKTA 5BR8L 1OXUA 3A56A 1SR3A 2VL6A 2F4IA 1ENAA 2E75C 2E2IB 2QDLA 3OTOQ 1ZKOA 3TS0A 1SYCA 5CC4A 1C48A 3PGZA 4ZCKA 4RGTA 4JI1L 4A3MH 4JI5Q 1JORA 4A3BB 3DWAA 3UDIA 3HS0C 2VB3X 4HN7A 3WOEA 1JR0D 1LTTD 2B2YA 3NBIA 1N33Q 5FLXc 3TN2A 1PMRA 1VQMA 3NQTA 1QUQB 1I6HB 1K8OA 4KHVA 3JC66 3J7AF 4DV1Q 2KEEA 1KABA 4DU9A 1HNWL 2NVTB 5K5PA 2BDNA 1DM0B 3C46A 5JJKA 3U4ZA 4LFCQ 3NEMA 4UP8A 3MXGA 3S1NB 5DM73 1Q7YC 4GLAC 2F0JA 1UUPA 2B8GA 2UUCQ 1CHQD 5C3EG 1JOKA 1KQSA 1U5KA 5C3EH 4KMUC 5I9OA 2CCZA 1BVSA 3PO2G 3GTOB 3KLSA 3PO2H 2K03A 3H09A 4S3SA 3O13A 1TS2A 5C44H 4CKCA 2HDLA 1LYLA 4HIMA 5JEAH 4X66Q 1C9OA 1V9PA 3MEFA 1DZ1A 4EQOA 1NTGA 2EIFA 1ESFA 3CMEA 5M5WB 2R92H 4QIWE 1SE2A 3MC0B 1IKLA 4IOAA 1KAWA 4GKKL 2TSSA 4A3JG 3S2DB 3HKZB 4A3JH 4WFN3 1SAPA 2NN6G 2NN6H 4LF4L 3FKIG 3KDFA 4X64L 3FKIH 4BY7G 1Q8KA 4BY7H 4GN3B 2O2LD 1BQQT 4XYQA 4LF5L 4DXGA 5I2XA 1ICFB 4KTAA 4O2DA 1KIXA 1KL9A 4KHZA 2D0OA 2EYLA 3ND9A 1GUWA 4ZKBB 1TS5A 3CU7A 1IBLL 1BR9A 4R8NA 2A68D 1BBXC 3L9AX 5JOBA 1AW7A 1JWUD 2KJXA 2X6GA 4DV6Q 3BDLA 2EY1A 1PA6A 4UAIA 2F0IA 4DR6Q 1QVGA 2Q8RE 1XMQQ 5JVG3 3JAML 2KHJA 4U68A 5HGTA 4JI4Q 5IOCA 1K8AC 3HOWG 1F9QA 1PH7A 5IP9G 1LT6D 2WACA 4G57A 5IP7G 5M3MH 3SK5A 3BZDB 2CW0C 3UDXA 3GTLH 4P71A 1KC8C 5M9OA 1BKBA 3JAMi 4K5VA 4A3MB 3K0XA 4HIKA 1IBKL 2QDBA 1NCVA 4XXEA 4ILWA 3M85A 2K5DA 4RKLA 1S5FD 2N88A 1FVIA 3I90A 1ET9A 2RHSB 5J3BA 1CQVA 1B9MA 1M1KC 4X3KA 1NJIC 3G7LA 1A3VA 1OTCA 2R61A 4K8JA 2BE5C 5EGTA 1EWHA 2ATWA 4HJ9A 2PZWA 1V8QA 1SYBA 2FXQA 3BYTB 3TSSA 5I4DA 2AKWB 1YJWA 2K04A 1RODA 1WTOA 5LMUQ 2AQ3B 4PG3A 1JWMD 1JQYD 5C3EB 3GDEA 2F0FA 1WTXA 4X3UA 2Z1CA 4DUYL 2YU9B 1VF5C 1BUVT 5CV5A 3DXJC 5C44B 1HPCA 3TP5A 3S24A 3KLRA 1A15A 2UXBQ 4C3HG 1B50A 1Q81C 1QB5D 4ZLTF 5CORA 4C3HH 4BY1B 2DGYA 1NY4A 2AUJD 1XNQL 1IYVA 1W6JA 2R92B 1DOLA 3DM1A 3DM3A 4FYDA 3MEHA 2Q2IA 4G7ZC 2VNUD 1KNEA 3I3CA 2R7ZG 2DNCA 2A69C 1VQ8A 2R7ZH 1DOMA 2HIVA 3EA6A 1PRTF 3L2PA 1DGSA 4L5QA 4FF3A 1QWYA 1PH9A 5EKIA 1R9TH 2Q2TA 5F2DA 4IQZA 1R4PB 1U4PA 5DNFA 3S14H 3N52A 3OIQA 2K01A 1K3RA 2F3VA 3CRLC 2WAQE 1V43A 4DR5L 4BY7B 1LTRD 1G6ZA 5EPJA 1A3UA 4PV1C 5BR8Q 4LF7L 4M8AA 2CH4A 2NZ1D 2RKSA 1X56A 1F2ZA 2NB0A 1W2BA 2XRSD 5EQ0A 1QG7A 4JW0A 2K5WA 4PQXA 5CMDA 2OTJA 4P75A 3AB9A 3K7AH 4NKLA 4JI1Q 4YWMA 4KHPL 5EBCA 1PH2A 2E2JH 2AWOA 2E5LL 3NE5B 4JCVE 3EVQA 1B2TA 3S2HH 4L6TB 3BVGA 1BO0A 2L55A 2KQ3A 2LXJA 5FLXE 4I7AA 1HNWQ 3CCVA 1F2MA 5M3MB 1MKHA 4LF9L 1N8RC 3GTLB 2WAQG 1KAAA 3BVMA 4RG1A 2L0CA 2F0KA 2QEJC 4HR7B 1I4PA 4CDCC 1EQRA 1EQTA 2UXDL 1PH8A 4JI7L 1X9NA 1CHPD 4BBRB 3OW7A 4P74A 5JJIA 5IGDA 1VMPA 4FXKC 4ZAIA 2PZUA 4IUQA 1F9SA 1ESRA 4ME3A 5EKLA 4TQUS 1EYDA 3T51B 3ULLA 4E6IA 1SJHD 4EQ5A 3BZKA 2HDMA 1TWCH 4R1JA 4DR1L 1GOZA 4KK7A 3S16H 2JE6I 4C3JG 1PV4A 1XPUA 5EJWA 1HTLD 3D4RA 5CV4A 1I3QB 2VQFL 1PTOH 4BXXG 1B3QA 4LAAA 2F0HA 4BXXH 1N32L 1U9RA 3STBD 2XVSA 4GKKQ 4IPCA 1PRTB 3H94A 1RF2D 2JEBI 3PUVA 2JA8G 2SEBD 2F0PA 1TWHH 2JA8H 3K5MA 1DYQA 1KHIA 1S72A 2RBMA 1HNZL 2OTLA 1TVXA 1O7LA 3AFQA 5C5LA 3MFYA 1N34L 4LF4Q 2B2TC 4DV2L 1B9NA 4ZYSA 4X64Q 5E3FA 3GTGH 2G5DA 4C3HB 1JOQA 4XQNA 1QE6A 3EFXD 2CVRA 4LF5Q 4GNXA 1PTOF 2PQEA 1VCIA 3KF8B 3X3NA 1UEAB 1OXTA 1IBLQ 3MZ5A 3PUWA 3HOYH 4EGVA 2EXZA 4X3TA 3KLWA 4LWCA 3NQIA 3I4LA 4ZUJA 4GOPB 1GVPA 3TP7A 3SGIA 1MSHA 3S14B 4CJ2C 1LO5D 2VB2X 3EIVA 1MJCA 2ZXPA 5T1IA 4ZKCB 4HJ5A 2EJGC 1XPRA 5DAUA 2MHVA 3I4MG 3L0OA 2F0TA 3I4MH 2Q2UA 3D31A 3C1EA 1B4OA 3K8AA 4OGQC 3S1QB 4EVOA 4IPHA 1SLJA 5I9PA 5G3LF 4BWGB 1TXYA 3D8GA 1SYFA 5H1SE 3CCJA 1OXSC 3MHBA 4IUUA 2I46A 2K75A 3QG1A 1I4QA 3NTKA 1EY7A 2RF4A 5FKAC 1BBWA 1E0BA 3K7AB 1IZ6A 2PO4A 1BXTA 2XIWA 3OOCA 1HJPA 3BVZA 1IBKQ 5I6YA 2E2JB 1EWCA 1JMCA 3OPOA 3RMHA 1YNJC 5IGEA 3S2HB 2Q2HA 5D65A 4KN7C 4X65Q 2IPKD 1HRJA 1X3QA 3KUPA 2UXCL 4GKJL 4GN4B 2R3ZA 1D5MC 2A73B 2NVYB 1F9RA 2ALYB 3PUXA 4ZQ3A 5C3XA 2CFMA 1BDOA 1Q1EA 1GM5A 4QUFA 2B63B 5GADC 2IX0A 3ND8A 4FXDA 1NR4A 2KBNA 3F2DA 2ZJPA 1WTPA 3QJYA 3M4OH 3KYHC 1Q46A 2P5ZX 4A93G 2L12A 4A93H 5KNDA 1HA6A 1CUKA 4X3SA 4RMFA 4A3DH 3VYSA 4GOPC 1QVFA 1TY0A 4DUYQ 1AFPA 1D8LA 5KIXA 3JAMc 4H44C 3NWSA 1TWCB 1VQDA 1EEFD 2TMPA 1RTNA 4DA2A 3S16B 2PQAA 1TWFB 3T13A 3H6MA 5ELNA 1LACA 2E2IH 4H13C 3KBXA 1HUMA 5A2QE 1QILA 1XNQQ 1TIID 3W1BA 1B44D 4YCWA 3OYYA 4A3IB 4OO1I 1FJGQ 4A3BG 3BDOA 3R8BA 3RZDH 5E4WC 1X3GA 1F2YA 3I70A 1TWHB 4O0AA 4F7XA 3ERSX 4B9XA 2BA1A 4DKAC 1EZ6A 1NAPA 3PCOB 1PXUA 3K58A 1WD1A 5JJLA 1EL0A 2HUGA 4IUTA 2I5MX 3S17B 3HKZE 2CWPA 3HP3A 3GTGB 3QR8A 3PSIA 5IGFA 4DR5Q 1C8CA 1HUNA 5C4XB 3VR6A 5M3FH 4LF7Q 1OO9B 2O5IC 4HCEA 1CSPA 4L5TA 3ONAB 1VQ9A 2V4DA 1S3OA 3HOYB 1RIPA 2VQEQ 2CHBD 1HR0W 3T16A 3UI2A 4BA1I 4U673 4L5SA 1VQBA 1MIUA 3UE1A 5M5YH 4KHPQ 3GTJH 1SN8A 2E76C 3F2CA 2E5LQ 1GO3E 3K59A 3GP7A 4IPGA 3K0YA 1J5EQ 5CBAE 2VUMB 1FD7D 1SNQA 4GN5A 5DLQE 1G6PA 3ERQA 5M5WH 2CW0D 5C4ZA 1A3TA 4LF9Q 1C4QA 3HKZG 2IW3A 3U58A 2EXDA 3BU2A 5LL6X 5LMNL 4KLKA 1O7ZA 4TVAB 2KA7A 3ULPA 2UXDQ 3H0GG 4JI7Q 3CPWA 5C3WA 3H0GH 4A3KG 1STNA 2XWJB 4A3KH 3MA2B 3PIOA 4IURA 4QY7A 4YWLA 1P16A 3AEVA 4H0LC 5KRUA 4F8MA 1QZGA 1VQGA 1AH9A 3DMUA 4DV4L 4DR1Q 1X3EA 2XSCA 4IFDJ 4FO2A 1D1IA 3GQBA 1CQFA 1T9HA 2MP1A 5BN3A 3M4OB 3J7ZC 1Y8PB 3TRZA 1SE4A 3HZXA 2VQFQ 3I4NH 3HOVH 3M7NA 1XTCD 2FMCA 5ELEA 1N32Q 3AQQA 2V1CC 2PYKA 4A93B 4A3DB 4K5XA 3MVVA 1IW7C 3PIPA 2N78A 3AFPA 4ODGA 3LWEA 2B2VC 3KLSX 5CYUA 4CBVA 5EPLA 1N34Q 4DV2Q 1EFWA 3KBGA 1HZAA 2EQSA 2QW7A 4Q0FA 1ENCA 1CA6A 1YNNC 2F0LA 1CT1D 4A3MG 3MWYW 1F77A 4TSSA 4R4OA 1V1QA 3M4QA 3RZDB 1QUQA 3E3XA 2IWHA 3K5NA 3FDTA 5JJZA 1LT5D 1EIYB 1DCZA 4QCLA 4N8X1 5FLMH 1WCMB 4GZYC 2LFNA 1WTQA 4KV6A 1E1TA 2PI2E 4MTNA 3Q0AA 1TS3A 2ICEC 1GD7A 3R2IA 3IL8A 3K6OA 1HR0L 5E7NA 2FINB 1SMYC 1JT8A 5IODA 4PMBA 1QVCA 3CD6A 4K0KL 2WINB 5M3FB 2CQOA 2A6EC 3I73A 1HTPA 4WJWA 2ZT9C 1PZID 3MXNB 1EY0A 5KNCA 3HKSA 1YJNA 1L1OB 1TU2B 2NYZD 4AQYL 1SJED 2KHSA 3SEBA 5M5YB 1DJRD 3GTJB 4X62L 2YU9H 1RHPA 2ZXOA 5C44G 2F03A 3M4YA 4HAEA 5C4JH 2PMZE 3G6JB 3CW2C 5JEAG 4BBSG 4BBSH 2K5HA 1HH2P 2AQ1B 3UE0A 3MXUA 3WWVA 5EPKA 4BY1G 2ID0A 1YI2A 1M90C 4BY1H 4H02A 2R92G 5LL6S 2UXCQ 1GUGA 2KCNA 2Z0SA 3J7YW 3G4SA 4GKJQ 1SNDA 4LF8L 1RD9D 4RA8A 4OXPA 1HCZA 2QILA 2Z6KC 4YIJA 3I7FA 3GTMB 3K80C 1PYBA 5C0XJ 4ID6A 1Q12A 1SEBD 2HD3A 2IJ0A 2X6LA 1EIHA 4POFA 1GUNA 4IOCA 1VDZA 4DV0Q 2Z4HA 1NMGA 3H0GB 4P2CB 1A6XA 2L11A 2D0PA 4A3KB 4AH6A 2L9HA 1LTID 5EKKA 1SE3A 4XDXA 1J9OA 1VQOA 3A8KE 3K57A 4A3GH 5IGCA 4ALPA 4B3RL 1WTWA 4K2KA 1CI3M 2PW5A 1A2UA 3JAME 3RD4A 2FMMA 1VQKA 4JI0L 1HZCA 1GHJA 5KNBA 2VZAA 3U4VA 4DNRB 3T1YL 1IL2A 3I4NB 3HOVB 2WIIB 2A6HD 4NP5A 2WKCA 1L1OC 4RHSA 3NK9A 2B2YC 5AJ3L 1H95A 2I07B 5IGBA 2WKDA 5E1FA 5IT9L 3J80L 2H4OA 4R4TA 1K8GA 5CV6A 1PYWD 1BF4A 2BH2A 3F8TA 4IFDI 2RDGA 2F0MA 2HHHL 5M3MG 3PO3B 2EY6A 1Q90A 1LM0A 3KK7A 1LUZA 3E9IA 1JCKB 4PMWA 1GUSA 3J81c 3KJOA 4JYAL 4DNTB 1EYCA 2RDFA 3CF5A 1JJGA 3EROA 2EJFC 2EY2A 2JN4A 4K6DA 5LHY1 3J81j 3J80i 2F0OA 3T1HL 4BBRG 4KKSA 3CC2A 2JA7H 2UUAL 4BBRH 4DFAA 4APVA 3GTQB 1ML0D 4YCUA 4FNFA 1IXRA 1EU3A 4XTCS 4O42A 3P75A 4GLXA 3CCLA 4DR3L 1EWIA 2EJMA 3A8IE 4IALA 3VR5A 4IO9A 2HT1A 4F88A 2K52A 2XTIA 4CJ0B 2D5DA 3CCMA 1HZ9A 3BYYB 1ZYRC 4JK1C 1SNCA 1T5EA 4KD4A 1I3QH 2A8VA 4XT1B 1XNRL 2J4XA 1CKNB 3I56A 4PMCA 4RCNA 1CTMA 5CGKA 4A3CH 4AIMA 3C1FA 1IYJB 1M4VA 1PRTD 5C4JB 5CR3A 4KJOA 4BBSB 2DUDA 3HRZC 2UUBQ 4O1NA 2NBFA 3L3OC 2OQKA 4OX9L 3HGBA 4DV4Q 1DD2A 1KLUD 3OSOA 1YNXA 1RDPD 1C7YA 1PFSA 4DR7L 4LUVA 3S15H 2H5XA 4G4KA 2F4VL 1CKMA 1Z47A 2JSOA 2KCMA 2JA5H 4J8QA 4UHVA 3HOZH 4Q5VA 4B3ML 1ILQA 4OHJA 3CRKC 5IYCG 3AYHB 2KEDA 3TBIB 5IYCH 1BCPD 4IPDA 4B3TQ 3G48A 2HCIA 3CCRA 2K50A 1FL0A 3QO2A 3S1QH 4A3GB 2D62A 1SSOA 5I6WA 1EOVA 1XMOL 2O5JC 2PMZB 3BG3A 4ULLA 4C56C 5C0XI 1JB3A 2B2TA 4RGMA 4JOIC 5CV8A 5FO9B 1IBML 3L7ZC 3H3VI 3FEWX 3KFUA 3GTKB 2F0DA 1K83B 1JJ2A 3NPPA 1SYDA 4LJZC 1O7IA 2F3WA 3SK6A 1JOOA 1JICA 4LNQA 1B70B 2KUMA 4RWSC 1HR0Q 1SXTA 2NVYH 2XGTA 2YYZA 4FF2A 1B3AA 2B63G 2B2UC 4NW2A 3X3MA 2B63H 4KI0A 2UU9L 4XIGS 5CV9A 1EZ8A 1LTBD 4FXGC 1ENFA 2YV5A 4MN3A 1H9MA 1XXGA 2IL8A 1KRTA 4DV7L 4NB3A 1NE3A 2D9UA 2JA7B 3TZDA 4NDXA 1MJEA 1O7YA 2NVQH 4AQYQ 2K28A 4A76A 2R93H 5D3IB 1GJXA 5FO8B 2ZJRA 4X62Q 2CWAA 2Q8TA 2JQOA 1HQMC 1WYDA 2JYOA 4BS9A 4DV3L 1STYA 1TWFH 1MHWC 1PZKD 3IRBA 4ZRZA 4FF1A 2EYHA 1GUOA 4IUVA 3NXWA 1VQJA 3IAYA 2HCCA 2PCFB 4A3IG 5J39A 1W3SA 4B9WA 4A3IH 1X3FA 3CCUA 3QOLA 3K7UC 1DONA 1PTOD 3R2TA 5IGGA 5CBEE 2L5TA 1SYEA 2WB1B 4DN4M 1QCBD 1I4RA 2R7DA 3LNNA 3GO5A 2A68C 4A3FG 1A62A 1U4LA 3AMUA 4R8IA 4UP9A 1U4RA 4A3FH 3S17H 3RUZA 4PZ6A 1FNWA 1TWGH 3KF8A 2MJ8A 5C4XG 5A35A 2IX3A 1JJCB 5C4XH 4OEMB 4YHHL 2A5HA 1Y8OB 4DK6C 4OWXB 1HXYD 4GOPA 4B3RQ 5DEHA 2F3IA 4LUOA 3HOYG 2OF1A 5G3LD 1EEID 1A0IA 3S15B 1TQOA 2H1EA 1A8VA 1O80A 1S5CD 4LF6L 4JV5L 1ASZA 4OWTB 4JI0Q 1U0LA 2ZTDA 2JA5B 1DXMA 3HOZB 2E2HH 4JI3L 4X6AH 5HGQA 2NWGA 1H9SB 2LSSA 4WJ3M 5AJ3Q 4M1UB 4DAYB 1F2LA 2B3GA 1EY4A 1FGUA 2VUMG 2N49A 4CHTB 2VUMH 1VQEA 4IUNA 4LK1C 1YBYA 5GAEC 1N33L 3BJUA 1E24A 3ZJYC 3PV0A 3VA5A 1CM9A 2JJQA 3PIO3 3MFGA 2ASBA 2HHHQ 4LW1A 3S1MH 2LS01 4C1NK 3RN2A 2QF7A 2SNSA 4JYAQ 1RCVD 1EFID 4DUZL 2NTTA 3T1HQ 4AYBB 5NUCA 1EYAA 3J81E 5K36H 1VQFA 2OEOA 4CGYB 1LTLA 5ELFA 3TREA 4MTKA 2XRQD 5HURA 1KDAA 1I50H 4KD3A 4OONA 3HG9A 2UUCL 1SYGA 1D6EC 2PZTA 3OW2A 5LMNW 4DR3Q 1S5DD 1CZWA 1J6QA 3PIP3 3G71A 4K14A 4K8IA 4PZ8A 1MSGA 3I2ZA 3CPFA 1S5ED 4B3SL 1XX8A 2EYPA 5IYBG 4QF4A 4V190 5IYBH 4JBWA 1BNZA 3FPPA 3R93A 3VR4A 4R4CA 5BN5A 3Q6SA 1CSQA 3PUZA 1XNRQ 2CQAA 3GTPB 2AMCB 3LWUA 5KGUA 4A3DG 2NVQB 4WJ4A 2L4NA 1S40A 2R93B 3CC4A 1H9RA 1D5ZC 2OXPA 1X3PA 4DAPA 3S1RH 2G9HD 5IT9c 1V1OA 4TRDA 3J80c 4V0BA 5D3DA 1VQ4A 5C6AA 1I6VC 1VQPA 1UE7A 2Y0SE 2MUYA 4YCVA 4KY6A 3VYRA 3CC7A 3QWNA 1TS4A 4DR7Q 1UE1A 1WCMG 3C3LA 2F4VQ 4MZ9A 1WCMH 2N55A 1IHZA 4BA2I 1D2BA 3NBHB 3QB3A 1N36L 4NPSA 1P8LA 4A3FB 3NTHA 2B2WA 4B08A 1TWGB 1PFMA 3DEPA 5M3FG 2GN5A 4ABNA 1RL2A 2HQLA 2EYFA 4LUZA 3KF6B 2F0WA 2B2VA 2K05A 4FP5D 1HFGA 1TT2A 2E2HB 4DAMA 2M00A 3M9BA 4N8FA 2Y0SG 5GAGC 1EIGA 1IYUA 1IBMQ 1IKMA 2NN6I 2EOTA 3OIPA 1HZBA 4P72A 3GD7A 4GLVB 5AFWA 3U50C 2SNMA 2BDOA 5GROA 1KXLA 4HMJA 3E9HA 2D2CC 1A2TA 1II3A 1JB7A 3S1MB 3SXHA 1SRUA 2RCFA 3UDFA 1VQIA 2UU9Q 1SBBB
chains in the Genus database with same CATH topology
2IX1A 1Q12A 3S14H 3GTMH 3ER0A 1SE8A 4POFA 2ZTCA 4DV7Q 4IOCA 1Y14B 4DV0Q 1K3RA 1NMGA 2WAQE 2ZJQA 1V43A 2D0PA 4LFCL 5K36G 4DR5L 1KRSA 4AH6A 2UUAQ 1XTDA 5BR8Q 2F52A 4LF7L 1X56A 3RLOA 1VQOA 4C3IH 3HOUH 3K81C 4A3GH 1W2BA 4ALPA 4B3RL 4NXNQ 1WJJA 4R4QA 2MFIA 3STBC 1Q82C 1QVGA 2OWOA 4QJFA 2QGQA 4DV3Q 1I94Q 3PF5A 2OTJA 4P75A 3K7AH 1VQKA 1PHJA 4JI0L 1PH6A 1HZCA 2VZAA 3U4VA 3HOXH 4JI1Q 4YWMA 3T1YL 1IL2A 4KHPL 1PH2A 2E2JH 2AWOA 2RHQB 2E5LL 3I4NG 1E22A 3HOVG 2E8GA 4JCVE 1E7ZA 1L1OC 4X66L 1JE5A 2OCEA 4HIOA 5AJ3L 1VQ7A 1PVOA 1H95A 1VQAA 4Y7NH 3S2HH 1NBWA 4JI8Q 3CQZH 1SMXA 3M3YH 4R4TA 1K8GA 1HNZQ 2LXJA 3G6EA 3FHWA 1HNWQ 3EN2A 3CCVA 3F8TA 2BH2A 2JA6G 2Z6KA 1VQNA 4IFDI 1VQLA 5C0XG 1MKHA 2JA6H 3ICEA 2GVAA 5M3MG 2HHHL 1N8RC 4LF9L 3PO3G 1LM0A 2WAQG 4DR2L 3PO3H 4DR4L 2K5NA 1LUZA 1N9WA 2ZTEA 3E9IA 4RG1A 4PMWA 3J81c 3KJOA 1XJVA 4JYAL 1HNXQ 2IT1A 1PH3A 2YTXA 3CF5A 1JJGA 3CMAA 1ASYA 1EQRA 4JBMA 2VUMH 4DV0L 3J81j 3H3VH 2UXDL 1VQHA 2N3SA 3J80i 3T1HL 5M5XH 1PH8A 4JI7L 1X9NA 4J15A 4P74A 4GNXC 4BBRG 5JJIA 3H15A 4OX9Q 4DK3C 1TWAH 3CC2A 2JA7H 3J81i 4BBRH 4A75A 2UUAL 4JBKA 2A19A 4APVA 5FLMG 4ME3A 3LGJA 4LF6Q 4JV5Q 4TQUS 2NZOA 3ULLA 4EQ5A 3GTQH 4OWWB 4YCUA 3BZKA 1IXRA 4XTCS 4GLXA 1TWCH 2PNHA 4R1JA 3CCLA 4JI3Q 3EBEA 1EWIA 4DR1L 1CKOA 4DR3L 4A3EG 4B3MQ 4IO9A 2RCNA 2JE6I 4A3EH 2HT1A 2K52A 3S16H 1YIJA 3TS2A 1PV4A 2XTIA 1X65A 1PH4A 3RNUA 1XPUA 5IWAQ 3CCMA 1HZ9A 1XPOA 4DV6L 2PQAB 4UPAA 4R4IA 3A5UA 2NVXH 2VQFL 1L1OA 3KF6A 4A3BH 4UP7A 4YY3L 1I3QH 4DR6L 4BXXG 5FJ8G 2A8VA 4BXXH 1XMQL 2NZHA 1XNRL 5FJ8H 1N32L 3STBD 2KENA 3RR5A 1CKNB 4GKKQ 4IPCA 1X55A 3I56A 2JEBI 1OXVA 3PUVA 2JA8G 1TWHH 1XMOQ 1EYGA 2JA8H 1B8AA 4JI4L 1HNZL 1KHIA 4HJ7A 1S72A 1X54A 1YHBA 4AIMA 1K73C 4A3CH 1I6HH 4A4IA 1IYJB 2R7FA 2OTLA 3AFQA 4DUZQ 4FDBA 3CP0A 1N34L 4LF4Q 2NVTH 4IJHA 4DV2L 2BA0A 1Q86C 4X64Q 1L2FA 2BH8A 4OO1G 3GTGH 2DUDA 3DLLA 4NXMQ 1VS0A 3F2BA 1YITA 2UUBQ 4QGUA 3A74A 1VQCA 3VDYA 3S1NH 5EAYA 4LF5Q 1A63A 2OQKA 2K5VA 3M4PA 1BBUA 4GNXA 1YVCA 1VCIA 3KF8B 1IBLQ 4OX9L 1OXTA 3D0FA 4DV4Q 4C2MH 1YNXA 3PUWA 1C7YA 3HOYH 1PFSA 4DR7L 1YZ6A 1KD1C 3KLWA 4LUVA 1YJ9A 2AHOB 4LWCA 3S15H 4JI2Q 2H5XA 4GOPB 2F4VL 1GVPA 3GTOH 1CKMA 1Z47A 2KCMA 4JC0A 3SGIA 4DPGA 2JA5H 4B3SQ 3EIVA 3CCEA 1MJCA 4HJ5A 3HOZH 4B3ML 3PF4A 1XPRA 3I4OA 5IYCG 3AYHB 3F1ZA 3I4MG 5IYCH 3HFZB 3A0JA 3L0OA 4IPDA 4B3TQ 2Q2UA 3D31A 3I4MH 1E1OA 3G48A 3K8AA 1Y1WG 3CCRA 2K50A 2VY3A 4DNIA 1SROA 2WP8J 4IPHA 1FL0A 1SLJA 1Y1WH 2ES2A 3S1QH 2D62A 1TXYA 2AWNA 3HOUG 5H1SE 2A1AA 3CCJA 1OXSC 5LMUL 4A3GG 3W1GA 4HJAA 1AE2A 1EOVA 2K75A 1XMOL 3RLNA 4YWKA 3S2DH 2RF4A 1BBWA 1C0AA 1X6OA 2JEAI 4LFBL 1IZ6A 5C0XI 3NENA 3Q8DA 1HJPA 3HOXG 4LFAL 1IBKQ 4QL5A 1JMCA 4JOIC 1WI5A 1G51A 3RLFA 4DV5L 2UXBL 2JK8A 1IBML 2UUBL 2B29A 1UE5A 2IY5B 3L7ZC 3H3VI 4IJLA 3KFUA 4JBJA 2Q2HA 4X65Q 1JJ2A 4JI6Q 3KDFB 2I0QA 1O7IA 5IY0A 3GTKH 1G291 1K83H 2UXCL 4LNQA 1B70B 4GN4B 4GKJL 3PUXA 2ALYB 1HR0Q 2LXKA 1N36Q 2CFMA 1Q1EA 2NVYH 2XGTA 2YYZA 1GM5A 1PH5A 2B63G 5GADC 2IX0A 2L15A 1EQQA 2B63H 2KBNA 4KI0A 4MNOA 3F2DA 1AE3A 2WB1E 2ZJPA 2UU9L 4XIGS 3M4OH 1B7YB 3A5ZB 3CAMA 3KYHC 1Q46A 2MO1A 1K0RA 5GAHC 2YV5A 1L0WA 2MO0A 4YHHQ 2YTYA 4DV7L 4HJ8A 4A93G 1KRTA 4NB3A 1NE3A 4A93H 3KJPA 4B3TL 1CUKA 2JA7G 4RMFA 4A3DH 1MJEA 4GOPC 2NVQH 1QVFA 4AQYQ 1D7QA 2ZM6Q 4A76A 4DUYQ 2R93H 5BR8L 3HOWH 1D8LA 1OXUA 3JAMc 5ELOA 2ZJRA 1SR3A 2VL6A 4X62Q 1VQDA 2CWAA 2JQOA 2JA9A 5IP9H 4HIDA 4NXNL 5IP7H 2PQAA 1WYDA 2QEXA 3OTOQ 4DV3L 1I94L 5ELNA 2E2IH 3TS0A 1TWFH 4GS3A 4JOIA 1XNQQ 3IRBA 3PGZA 1CKNA 4JI1L 4A3MH 2OQ0A 1VQJA 4YCWA 3OYYA 3W1BA 1Z9FA 3CCSA 4JI5Q 4A3IG 4POGA 1FJGQ 3RZOH 3UDIA 4A3BG 3BZCA 1W3SA 4A3IH 2WFWA 3RZDH 1X3FA 1N33Q 2YTVA 3CCUA 5FLXc 4X65L 1X3GA 3K7UC 4UY8C 4JG2A 4O0AA 1I5FA 3ERSX 1VQMA 2BA1A 1QUQB 4DKAC 4JI8L 3JC66 3PCOB 4A3CG 4DV1Q 5JJLA 2K14A 1K9MC 5LMNQ 1HNWL 2WB1G 2I5MX 1OXXK 2CKZB 2R7DA 3HKZE 2CWPA 3GO5A 4A3FG 1A62A 5JJKA 4UP9A 3U4ZA 4A3FH 3PSIA 3NEMA 4LFCQ 4PZ6A 4DR5Q 3S17H 4UP8A 2PI2A 1TWGH 5C4XG 1HNXL 3PUYA 1JJCB 5M3FH 4LF7Q 5C4XH 4YHHL 1Q7YC 1CSPA 4GLAC 4L5TA 4AYBE 4DK6C 4OWXB 4A3LG 2UUCQ 1VQ9A 4GOPA 4B3RQ 5C3EG 4A3LH 1S3OA 2MNAA 1KQSA 1U5KA 2F3IA 1RIPA 4LUOA 5C3EH 2VQEQ 1PH1A 1HR0W 3HOYG 4QQBX 1A0IA 4BA1I 2CCZA 4L5SA 1A8VA 1BVSA 4LF6L 1VQBA 3PO2G 4JV5L 1ASZA 1MIUA 4OWTB 4JI0Q 1U0LA 3UE1A 2ZTDA 5M5YH 3PO2H 2JA5G 4KHPQ 3GTJH 1SN8A 3F2CA 2E2HH 2E5LQ 5C44H 3HOZG 4JI3L 1YEZA 1GO3E 4X6AH 1LYLA 5HGQA 4HIMA 4X66Q 1SFOH 2LSSA 4WJ3M 1GKHA 5AJ3Q 4IPGA 2MQHA 4DAYB 5IWAL 1J5EQ 2B3GA 4DV1L 1FGUA 1C9OA 1V9PA 3MEFA 1UWVA 1FJGL 2VUMG 1NTGA 2EIFA 2N49A 4GN5A 5DLQE 1VQEA 3CMEA 2K4KA 4QIWE 1YBYA 2R92H 1G6PA 5GAEC 1N33L 3BJUA 1E24A 5M5WH 4IOAA 1KAWA 3ZJYC 3PV0A 4GKKL 2JJQA 2ASBA 4A3JG 2HHHQ 4LF9Q 2KHIA 4LW1A 4A3JH 3HKZG 3S1MH 3U58A 4DR2Q 4DR4Q 2EXDA 3BU2A 3RN2A 5IE8A 5LMNL 4JYAQ 4PZ7A 4KLKA 4TVAB 2VW9A 2NN6G 4DUZL 3UDGA 3J7A5 1E3PA 3ULPA 4LF4L 3T1HQ 2UXDQ 3FKIG 3H0GG 3KDFA 4JI7Q 4AYBG 4X64L 3CPWA 3FKIH 3H0GH 4A3KG 4BY7G 1VQFA 2N8NA 4A3KH 4NXML 1Q8KA 3PIOA 4BY7H 1LTLA 4GN3B 4QY7A 1P16A 4YWLA 3TREA 3AEVA 4C3HH 4LF5L 1I50H 4O2DA 1KIXA 4OONA 1KL9A 4KHZA 2D0OA 2UUCL 1QZGA 1VQGA 1AH9A 1IBLL 3FP9A 3OW2A 4DV4L 2VQEL 5LMNW 4DR1Q 4DR3Q 1X3EA 4IFDJ 2UU9Q 1J6QA 3G71A 4PZ8A 1PYSB 4JI2L 3I2ZA 3CPFA 1T9HA 4DV6Q 4B3SL 4K0KQ 5IYBG 3J7ZC 1PA6A 3TRZA 5GQOA 5IYBH 2VQFQ 3I4NH 4JBWA 4DR6Q 4YY3Q 3HOVH 3M7NA 4R4CA 1CSQA 1Y1VG 3PUZA 2QA4A 1XMQQ 1XNRQ 1N32Q 3AQQA 2V1CC 2AMCB 1Y1VH 1QZHA 1J5EL 4A3DG 3GTPH 4WJ4A 2KHJA 1S40A 3PIPA 4JI4Q 2R93G 3CC4A 2N78A 1YHAA 3AFPA 3NELA 1K8AC 3HOWG 4OO1I 3S1RH 1PH7A 3I55A 5IT9c 5IP9G 2HIXA 1N34Q 3J80c 2IHFA 5IP7G 4DV2Q 5M3MH 1EFWA 2C35B 3UDXA 1HZAA 3GTLH 2EQSA 4P71A 1KC8C 3TQYA 3RN5A 2VS1A 1VQ4A 2I5LX 1BKBA 1YHQA 3TEHB 2KCTA 3JAMi 1VQPA 3K0XA 4HIKA 4A3MG 1IBKL 5JEAJ 1UE7A 2Y0SE 4R4OA 1V1QA 3M4QA 4YCVA 1QUQA 3M85A 3CC7A 1EIYB 3CXCA 4LF8Q 4L5RC 1FVIA 4DR7Q 1UE1A 5FLMH 4JI6L 2RHSB 5J3BA 1WCMG 4IFDG 5IYDG 1E1TA 2PI2E 4MTNA 3E0EA 1M1KC 4MZ9A 1WCMH 2F4VQ 5IYDH 4BA2I 1EUJA 3NBHB 1NJIC 1GD7A 1NMFA 1HR0L 1OTCA 5E7NA 1N36L 4NPSA 1JT8A 3CCQA 1P8LA 4C3JH 3KOJA 2I5HA 1QVCA 3CD6A 4K0KL 2ATWA 4HJ9A 1UE6A 2FXQA 1YJWA 2AKWB 2CQOA 5M3FG 2GN5A 5HY6A 5LMUQ 2GVBA 4PG3A 1RL2A 3MXNB 2HQLA 3HKSA 3GDEA 1L1OB 4LUZA 3KF6B 1YJNA 4AQYL 1WFQA 2ZM6L 4DUYL 4LFBQ 1WOCA 3ULJA 4LFAQ 4P73A 3W5OA 4X62L 4DAMA 2YU9H 5C44G 3T1YQ 2IHEA 3M9BA 3S24A 1VQ6A 2Y0SG 5C4JH 5GAGC 1VQ5A 2PMZE 4DV5Q 4Y52H 2UXBQ 5JEAG 3CW2C 4BBSG 1IBMQ 3OTOL 4BBSH 2K5HA 1HH2P 2NN6I 3UE0A 1Q81C 1HZBA 4P72A 3WWVA 3GD7A 2DGYA 1NY4A 2ID0A 3B6YA 4GLVB 4BY1G 3U50C 1YI2A 1XNQL 1M90C 4BY1H 4JI5L 4H02A 2R92G 2R6GA 2UXCQ 3DM3A 2Z0SA 5GROA 3G4SA 2Q2IA 4GKJQ 1Q1BA 1KXLA 1EIFA 3E9HA 4LF8L 2VNUD 2R7ZG 4EX5A 1VQ8A 2R7ZH 4OXPA 2Z6KC 2HIVA 4GNXB 3L2PA 1JB7A 1DGSA 4L5QA 3I7FA 1PH9A 1SRUA 1R9TH 3UDFA 1VQIA 2Q2TA 3K80C 1PYBA 1UEBA 5C0XJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IX1 A;  1Q12 A;  3S14 H;  3GTM H;  3ER0 A;  1SE8 A;  4POF A;  2ZTC A;  4DV7 Q;  4IOC A;  1Y14 B;  4DV0 Q;  1K3R A;  1NMG A;  2WAQ E;  2ZJQ A;  1V43 A;  2D0P A;  4LFC L;  5K36 G;  4DR5 L;  1KRS A;  4AH6 A;  2UUA Q;  1XTD A;  5BR8 Q;  2F52 A;  4LF7 L;  1X56 A;  3RLO A;  1VQO A;  4C3I H;  3HOU H;  3K81 C;  4A3G H;  1W2B A;  4ALP A;  4B3R L;  4NXN Q;  1WJJ A;  4R4Q A;  2MFI A;  3STB C;  1Q82 C;  1QVG A;  2OWO A;  4QJF A;  2QGQ A;  4DV3 Q;  1I94 Q;  3PF5 A;  2OTJ A;  4P75 A;  3K7A H;  1VQK A;  1PHJ A;  4JI0 L;  1PH6 A;  1HZC A;  2VZA A;  3U4V A;  3HOX H;  4JI1 Q;  4YWM A;  3T1Y L;  1IL2 A;  4KHP L;  1PH2 A;  2E2J H;  2AWO A;  2RHQ B;  2E5L L;  3I4N G;  1E22 A;  3HOV G;  2E8G A;  4JCV E;  1E7Z A;  1L1O C;  4X66 L;  1JE5 A;  2OCE A;  4HIO A;  5AJ3 L;  1VQ7 A;  1PVO A;  1H95 A;  1VQA A;  4Y7N H;  3S2H H;  1NBW A;  4JI8 Q;  3CQZ H;  1SMX A;  3M3Y H;  4R4T A;  1K8G A;  1HNZ Q;  2LXJ A;  3G6E A;  3FHW A;  1HNW Q;  3EN2 A;  3CCV A;  3F8T A;  2BH2 A;  2JA6 G;  2Z6K A;  1VQN A;  4IFD I;  1VQL A;  5C0X G;  1MKH A;  2JA6 H;  3ICE A;  2GVA A;  5M3M G;  2HHH L;  1N8R C;  4LF9 L;  3PO3 G;  1LM0 A;  2WAQ G;  4DR2 L;  3PO3 H;  4DR4 L;  2K5N A;  1LUZ A;  1N9W A;  2ZTE A;  3E9I A;  4RG1 A;  4PMW A;  3J81 c;  3KJO A;  1XJV A;  4JYA L;  1HNX Q;  2IT1 A;  1PH3 A;  2YTX A;  3CF5 A;  1JJG A;  3CMA A;  1ASY A;  1EQR A;  4JBM A;  2VUM H;  4DV0 L;  3J81 j;  3H3V H;  2UXD L;  1VQH A;  2N3S A;  3J80 i;  3T1H L;  5M5X H;  1PH8 A;  4JI7 L;  1X9N A;  4J15 A;  4P74 A;  4GNX C;  4BBR G;  5JJI A;  3H15 A;  4OX9 Q;  4DK3 C;  1TWA H;  3CC2 A;  2JA7 H;  3J81 i;  4BBR H;  4A75 A;  2UUA L;  4JBK A;  2A19 A;  4APV A;  5FLM G;  4ME3 A;  3LGJ A;  4LF6 Q;  4JV5 Q;  4TQU S;  2NZO A;  3ULL A;  4EQ5 A;  3GTQ H;  4OWW B;  4YCU A;  3BZK A;  1IXR A;  4XTC S;  4GLX A;  1TWC H;  2PNH A;  4R1J A;  3CCL A;  4JI3 Q;  3EBE A;  1EWI A;  4DR1 L;  1CKO A;  4DR3 L;  4A3E G;  4B3M Q;  4IO9 A;  2RCN A;  2JE6 I;  4A3E H;  2HT1 A;  2K52 A;  3S16 H;  1YIJ A;  3TS2 A;  1PV4 A;  2XTI A;  1X65 A;  1PH4 A;  3RNU A;  1XPU A;  5IWA Q;  3CCM A;  1HZ9 A;  1XPO A;  4DV6 L;  2PQA B;  4UPA A;  4R4I A;  3A5U A;  2NVX H;  2VQF L;  1L1O A;  3KF6 A;  4A3B H;  4UP7 A;  4YY3 L;  1I3Q H;  4DR6 L;  4BXX G;  5FJ8 G;  2A8V A;  4BXX H;  1XMQ L;  2NZH A;  1XNR L;  5FJ8 H;  1N32 L;  3STB D;  2KEN A;  3RR5 A;  1CKN B;  4GKK Q;  4IPC A;  1X55 A;  3I56 A;  2JEB I;  1OXV A;  3PUV A;  2JA8 G;  1TWH H;  1XMO Q;  1EYG A;  2JA8 H;  1B8A A;  4JI4 L;  1HNZ L;  1KHI A;  4HJ7 A;  1S72 A;  1X54 A;  1YHB A;  4AIM A;  1K73 C;  4A3C H;  1I6H H;  4A4I A;  1IYJ B;  2R7F A;  2OTL A;  3AFQ A;  4DUZ Q;  4FDB A;  3CP0 A;  1N34 L;  4LF4 Q;  2NVT H;  4IJH A;  4DV2 L;  2BA0 A;  1Q86 C;  4X64 Q;  1L2F A;  2BH8 A;  4OO1 G;  3GTG H;  2DUD A;  3DLL A;  4NXM Q;  1VS0 A;  3F2B A;  1YIT A;  2UUB Q;  4QGU A;  3A74 A;  1VQC A;  3VDY A;  3S1N H;  5EAY A;  4LF5 Q;  1A63 A;  2OQK A;  2K5V A;  3M4P A;  1BBU A;  4GNX A;  1YVC A;  1VCI A;  3KF8 B;  1IBL Q;  4OX9 L;  1OXT A;  3D0F A;  4DV4 Q;  4C2M H;  1YNX A;  3PUW A;  1C7Y A;  3HOY H;  1PFS A;  4DR7 L;  1YZ6 A;  1KD1 C;  3KLW A;  4LUV A;  1YJ9 A;  2AHO B;  4LWC A;  3S15 H;  4JI2 Q;  2H5X A;  4GOP B;  2F4V L;  1GVP A;  3GTO H;  1CKM A;  1Z47 A;  2KCM A;  4JC0 A;  3SGI A;  4DPG A;  2JA5 H;  4B3S Q;  3EIV A;  3CCE A;  1MJC A;  4HJ5 A;  3HOZ H;  4B3M L;  3PF4 A;  1XPR A;  3I4O A;  5IYC G;  3AYH B;  3F1Z A;  3I4M G;  5IYC H;  3HFZ B;  3A0J A;  3L0O A;  4IPD A;  4B3T Q;  2Q2U A;  3D31 A;  3I4M H;  1E1O A;  3G48 A;  3K8A A;  1Y1W G;  3CCR A;  2K50 A;  2VY3 A;  4DNI A;  1SRO A;  2WP8 J;  4IPH A;  1FL0 A;  1SLJ A;  1Y1W H;  2ES2 A;  3S1Q H;  2D62 A;  1TXY A;  2AWN A;  3HOU G;  5H1S E;  2A1A A;  3CCJ A;  1OXS C;  5LMU L;  4A3G G;  3W1G A;  4HJA A;  1AE2 A;  1EOV A;  2K75 A;  1XMO L;  3RLN A;  4YWK A;  3S2D H;  2RF4 A;  1BBW A;  1C0A A;  1X6O A;  2JEA I;  4LFB L;  1IZ6 A;  5C0X I;  3NEN A;  3Q8D A;  1HJP A;  3HOX G;  4LFA L;  1IBK Q;  4QL5 A;  1JMC A;  4JOI C;  1WI5 A;  1G51 A;  3RLF A;  4DV5 L;  2UXB L;  2JK8 A;  1IBM L;  2UUB L;  2B29 A;  1UE5 A;  2IY5 B;  3L7Z C;  3H3V I;  4IJL A;  3KFU A;  4JBJ A;  2Q2H A;  4X65 Q;  1JJ2 A;  4JI6 Q;  3KDF B;  2I0Q A;  1O7I A;  5IY0 A;  3GTK H;  1G29 1;  1K83 H;  2UXC L;  4LNQ A;  1B70 B;  4GN4 B;  4GKJ L;  3PUX A;  2ALY B;  1HR0 Q;  2LXK A;  1N36 Q;  2CFM A;  1Q1E A;  2NVY H;  2XGT A;  2YYZ A;  1GM5 A;  1PH5 A;  2B63 G;  5GAD C;  2IX0 A;  2L15 A;  1EQQ A;  2B63 H;  2KBN A;  4KI0 A;  4MNO A;  3F2D A;  1AE3 A;  2WB1 E;  2ZJP A;  2UU9 L;  4XIG S;  3M4O H;  1B7Y B;  3A5Z B;  3CAM A;  3KYH C;  1Q46 A;  2MO1 A;  1K0R A;  5GAH C;  2YV5 A;  1L0W A;  2MO0 A;  4YHH Q;  2YTY A;  4DV7 L;  4HJ8 A;  4A93 G;  1KRT A;  4NB3 A;  1NE3 A;  4A93 H;  3KJP A;  4B3T L;  1CUK A;  2JA7 G;  4RMF A;  4A3D H;  1MJE A;  4GOP C;  2NVQ H;  1QVF A;  4AQY Q;  1D7Q A;  2ZM6 Q;  4A76 A;  4DUY Q;  2R93 H;  5BR8 L;  3HOW H;  1D8L A;  1OXU A;  3JAM c;  5ELO A;  2ZJR A;  1SR3 A;  2VL6 A;  4X62 Q;  1VQD A;  2CWA A;  2JQO A;  2JA9 A;  5IP9 H;  4HID A;  4NXN L;  5IP7 H;  2PQA A;  1WYD A;  2QEX A;  3OTO Q;  4DV3 L;  1I94 L;  5ELN A;  2E2I H;  3TS0 A;  1TWF H;  4GS3 A;  4JOI A;  1XNQ Q;  3IRB A;  3PGZ A;  1CKN A;  4JI1 L;  4A3M H;  2OQ0 A;  1VQJ A;  4YCW A;  3OYY A;  3W1B A;  1Z9F A;  3CCS A;  4JI5 Q;  4A3I G;  4POG A;  1FJG Q;  3RZO H;  3UDI A;  4A3B G;  3BZC A;  1W3S A;  4A3I H;  2WFW A;  3RZD H;  1X3F A;  1N33 Q;  2YTV A;  3CCU A;  5FLX c;  4X65 L;  1X3G A;  3K7U C;  4UY8 C;  4JG2 A;  4O0A A;  1I5F A;  3ERS X;  1VQM A;  2BA1 A;  1QUQ B;  4DKA C;  4JI8 L;  3JC6 6;  3PCO B;  4A3C G;  4DV1 Q;  5JJL A;  2K14 A;  1K9M C;  5LMN Q;  1HNW L;  2WB1 G;  2I5M X;  1OXX K;  2CKZ B;  2R7D A;  3HKZ E;  2CWP A;  3GO5 A;  4A3F G;  1A62 A;  5JJK A;  4UP9 A;  3U4Z A;  4A3F H;  3PSI A;  3NEM A;  4LFC Q;  4PZ6 A;  4DR5 Q;  3S17 H;  4UP8 A;  2PI2 A;  1TWG H;  5C4X G;  1HNX L;  3PUY A;  1JJC B;  5M3F H;  4LF7 Q;  5C4X H;  4YHH L;  1Q7Y C;  1CSP A;  4GLA C;  4L5T A;  4AYB E;  4DK6 C;  4OWX B;  4A3L G;  2UUC Q;  1VQ9 A;  4GOP A;  4B3R Q;  5C3E G;  4A3L H;  1S3O A;  2MNA A;  1KQS A;  1U5K A;  2F3I A;  1RIP A;  4LUO A;  5C3E H;  2VQE Q;  1PH1 A;  1HR0 W;  3HOY G;  4QQB X;  1A0I A;  4BA1 I;  2CCZ A;  4L5S A;  1A8V A;  1BVS A;  4LF6 L;  1VQB A;  3PO2 G;  4JV5 L;  1ASZ A;  1MIU A;  4OWT B;  4JI0 Q;  1U0L A;  3UE1 A;  2ZTD A;  5M5Y H;  3PO2 H;  2JA5 G;  4KHP Q;  3GTJ H;  1SN8 A;  3F2C A;  2E2H H;  2E5L Q;  5C44 H;  3HOZ G;  4JI3 L;  1YEZ A;  1GO3 E;  4X6A H;  1LYL A;  5HGQ A;  4HIM A;  4X66 Q;  1SFO H;  2LSS A;  4WJ3 M;  1GKH A;  5AJ3 Q;  4IPG A;  2MQH A;  4DAY B;  5IWA L;  1J5E Q;  2B3G A;  4DV1 L;  1FGU A;  1C9O A;  1V9P A;  3MEF A;  1UWV A;  1FJG L;  2VUM G;  1NTG A;  2EIF A;  2N49 A;  4GN5 A;  5DLQ E;  1VQE A;  3CME A;  2K4K A;  4QIW E;  1YBY A;  2R92 H;  1G6P A;  5GAE C;  1N33 L;  3BJU A;  1E24 A;  5M5W H;  4IOA A;  1KAW A;  3ZJY C;  3PV0 A;  4GKK L;  2JJQ A;  2ASB A;  4A3J G;  2HHH Q;  4LF9 Q;  2KHI A;  4LW1 A;  4A3J H;  3HKZ G;  3S1M H;  3U58 A;  4DR2 Q;  4DR4 Q;  2EXD A;  3BU2 A;  3RN2 A;  5IE8 A;  5LMN L;  4JYA Q;  4PZ7 A;  4KLK A;  4TVA B;  2VW9 A;  2NN6 G;  4DUZ L;  3UDG A;  3J7A 5;  1E3P A;  3ULP A;  4LF4 L;  3T1H Q;  2UXD Q;  3FKI G;  3H0G G;  3KDF A;  4JI7 Q;  4AYB G;  4X64 L;  3CPW A;  3FKI H;  3H0G H;  4A3K G;  4BY7 G;  1VQF A;  2N8N A;  4A3K H;  4NXM L;  1Q8K A;  3PIO A;  4BY7 H;  1LTL A;  4GN3 B;  4QY7 A;  1P16 A;  4YWL A;  3TRE A;  3AEV A;  4C3H H;  4LF5 L;  1I50 H;  4O2D A;  1KIX A;  4OON A;  1KL9 A;  4KHZ A;  2D0O A;  2UUC L;  1QZG A;  1VQG A;  1AH9 A;  1IBL L;  3FP9 A;  3OW2 A;  4DV4 L;  2VQE L;  5LMN W;  4DR1 Q;  4DR3 Q;  1X3E A;  4IFD J;  2UU9 Q;  1J6Q A;  3G71 A;  4PZ8 A;  1PYS B;  4JI2 L;  3I2Z A;  3CPF A;  1T9H A;  4DV6 Q;  4B3S L;  4K0K Q;  5IYB G;  3J7Z C;  1PA6 A;  3TRZ A;  5GQO A;  5IYB H;  2VQF Q;  3I4N H;  4JBW A;  4DR6 Q;  4YY3 Q;  3HOV H;  3M7N A;  4R4C A;  1CSQ A;  1Y1V G;  3PUZ A;  2QA4 A;  1XMQ Q;  1XNR Q;  1N32 Q;  3AQQ A;  2V1C C;  2AMC B;  1Y1V H;  1QZH A;  1J5E L;  4A3D G;  3GTP H;  4WJ4 A;  2KHJ A;  1S40 A;  3PIP A;  4JI4 Q;  2R93 G;  3CC4 A;  2N78 A;  1YHA A;  3AFP A;  3NEL A;  1K8A C;  3HOW G;  4OO1 I;  3S1R H;  1PH7 A;  3I55 A;  5IT9 c;  5IP9 G;  2HIX A;  1N34 Q;  3J80 c;  2IHF A;  5IP7 G;  4DV2 Q;  5M3M H;  1EFW A;  2C35 B;  3UDX A;  1HZA A;  3GTL H;  2EQS A;  4P71 A;  1KC8 C;  3TQY A;  3RN5 A;  2VS1 A;  1VQ4 A;  2I5L X;  1BKB A;  1YHQ A;  3TEH B;  2KCT A;  3JAM i;  1VQP A;  3K0X A;  4HIK A;  4A3M G;  1IBK L;  5JEA J;  1UE7 A;  2Y0S E;  4R4O A;  1V1Q A;  3M4Q A;  4YCV A;  1QUQ A;  3M85 A;  3CC7 A;  1EIY B;  3CXC A;  4LF8 Q;  4L5R C;  1FVI A;  4DR7 Q;  1UE1 A;  5FLM H;  4JI6 L;  2RHS B;  5J3B A;  1WCM G;  4IFD G;  5IYD G;  1E1T A;  2PI2 E;  4MTN A;  3E0E A;  1M1K C;  4MZ9 A;  1WCM H;  2F4V Q;  5IYD H;  4BA2 I;  1EUJ A;  3NBH B;  1NJI C;  1GD7 A;  1NMF A;  1HR0 L;  1OTC A;  5E7N A;  1N36 L;  4NPS A;  1JT8 A;  3CCQ A;  1P8L A;  4C3J H;  3KOJ A;  2I5H A;  1QVC A;  3CD6 A;  4K0K L;  2ATW A;  4HJ9 A;  1UE6 A;  2FXQ A;  1YJW A;  2AKW B;  2CQO A;  5M3F G;  2GN5 A;  5HY6 A;  5LMU Q;  2GVB A;  4PG3 A;  1RL2 A;  3MXN B;  2HQL A;  3HKS A;  3GDE A;  1L1O B;  4LUZ A;  3KF6 B;  1YJN A;  4AQY L;  1WFQ A;  2ZM6 L;  4DUY L;  4LFB Q;  1WOC A;  3ULJ A;  4LFA Q;  4P73 A;  3W5O A;  4X62 L;  4DAM A;  2YU9 H;  5C44 G;  3T1Y Q;  2IHE A;  3M9B A;  3S24 A;  1VQ6 A;  2Y0S G;  5C4J H;  5GAG C;  1VQ5 A;  2PMZ E;  4DV5 Q;  4Y52 H;  2UXB Q;  5JEA G;  3CW2 C;  4BBS G;  1IBM Q;  3OTO L;  4BBS H;  2K5H A;  1HH2 P;  2NN6 I;  3UE0 A;  1Q81 C;  1HZB A;  4P72 A;  3WWV A;  3GD7 A;  2DGY A;  1NY4 A;  2ID0 A;  3B6Y A;  4GLV B;  4BY1 G;  3U50 C;  1YI2 A;  1XNQ L;  1M90 C;  4BY1 H;  4JI5 L;  4H02 A;  2R92 G;  2R6G A;  2UXC Q;  3DM3 A;  2Z0S A;  5GRO A;  3G4S A;  2Q2I A;  4GKJ Q;  1Q1B A;  1KXL A;  1EIF A;  3E9H A;  4LF8 L;  2VNU D;  2R7Z G;  4EX5 A;  1VQ8 A;  2R7Z H;  4OXP A;  2Z6K C;  2HIV A;  4GNX B;  3L2P A;  1JB7 A;  1DGS A;  4L5Q A;  3I7F A;  1PH9 A;  1SRU A;  1R9T H;  3UDF A;  1VQI A;  2Q2T A;  3K80 C;  1PYB A;  1UEB A;  5C0X J; 
#chains in the Genus database with same CATH topology
 2IX1 A;  4G7H C;  3P20 A;  1STA A;  3GTM H;  2RSO A;  2EZV A;  3D4D A;  1SE8 A;  2ZTC A;  2Z9H A;  4DV7 Q;  1Y14 B;  1R4Q B;  1XTD A;  3W2D A;  1I50 B;  4K6L A;  4C3I B;  2F52 A;  3K5O A;  2HQE A;  3R3O A;  5IIF A;  3HOU H;  3K81 C;  2J0T D;  3STB C;  5BN4 A;  1UAP A;  1HFN A;  3TME A;  1TY2 A;  2BE5 D;  2QGQ A;  4QJF A;  5T1G A;  2KOL A;  3MAQ A;  1DOK A;  4DV3 Q;  1PHJ A;  3HOX H;  1FYC A;  2K6A A;  1G2T A;  3I4N G;  5FOB B;  1E22 A;  3HOV G;  2E8G A;  1U4M A;  1E7Z A;  1JE5 A;  2OCE A;  4HIO A;  2CH4 W;  1PVO A;  2DJG C;  2XNA C;  3M3Y B;  1SMX A;  3V05 A;  4FF4 A;  1HNZ Q;  3S1R B;  3EN2 A;  2Z6K A;  1VQL A;  4ZK9 B;  3ICE A;  2GVA A;  1E2W A;  3PO3 G;  4RKB A;  3ZYY X;  3PO3 H;  1L0X B;  4DR2 L;  4DR4 L;  4Z9C B;  2K5N A;  1N9W A;  3PQI A;  1XJV A;  1B53 A;  2IT1 A;  1PH3 A;  3WDN A;  2YTX A;  4JBM A;  2JP1 A;  2BCO A;  2NUC A;  5M5X H;  1K28 A;  3T56 B;  2A69 D;  3H15 A;  1TWA H;  1EY8 A;  4A75 A;  2A19 A;  5FLM G;  3LGJ A;  4LF6 Q;  4DGZ A;  4JV5 Q;  3VR3 A;  1PFB A;  1V1P B;  3GTQ H;  4OWW B;  1B1Z A;  2JXM B;  5J22 A;  2BOS A;  4HCS A;  4JI3 Q;  2PNH A;  4A3E B;  1CKO A;  1RTO A;  1PH4 A;  3RNU A;  2NVX B;  1XPO A;  4R4I A;  3A5U A;  1FNU A;  3FRP B;  3MXN A;  1L1O A;  3H91 A;  4YY3 L;  5FJ8 G;  2FJ2 A;  1IL8 A;  5FJ8 H;  3AU7 A;  2K5Q A;  2M2L A;  3OHX C;  1B8A A;  1Z6H A;  1K73 C;  1YHB A;  2Z8L A;  4A4I A;  1LTG D;  4DUZ Q;  1S4Z A;  4FDB A;  3CP0 A;  2BA0 A;  2Y0S B;  2EVB A;  2BH8 A;  4OO1 G;  4OIJ A;  3F2B A;  1YIT A;  4OO1 H;  1WTV A;  1RKN A;  2Q8I B;  2OWO A;  3A74 A;  3TZU A;  3VDY A;  5EAY A;  1HQR D;  1LTS D;  3M4P A;  1ZXT A;  3D0F A;  1HHV A;  2EDG A;  5JPM C;  4C2M H;  1YZ6 A;  1YJ9 A;  2AHO B;  3H3V C;  4B3S Q;  4JC0 A;  3NP8 A;  1HA5 A;  3NHH A;  3I4O A;  3BS1 A;  3F1Z A;  3HFZ B;  3A0J A;  3P7J A;  2EY5 A;  1PLF A;  1Y1W G;  4OIK A;  4DNI A;  5E4X A;  1SRO A;  1PDQ A;  1Y1W H;  1CFM A;  2ES2 A;  2K1B A;  3HOU B;  2AWN A;  4A3G G;  2A1A A;  5KYL A;  1FNV A;  4KJN A;  2WV6 D;  4HSP A;  3CKI B;  2C9O A;  3TP6 A;  1C0A A;  5C5M A;  1G8Z D;  1X6O A;  2JEA I;  4LFB L;  5IT9 E;  3HOX B;  4LFA L;  2RDH A;  3J80 E;  1MD2 D;  4DK1 A;  4LMQ D;  3DHQ A;  1WI5 A;  1G51 A;  4DV5 L;  2OT2 A;  2B29 A;  2IY5 B;  3D6C A;  5CV7 A;  2A74 C;  4IJL A;  4JBJ A;  3DEO A;  3KDF B;  3E0J A;  3VR2 A;  1WD0 A;  3GTK H;  1G29 1;  1K83 H;  2MPM A;  1CK1 A;  1VF7 A;  3GV6 A;  4CKB A;  3NTI A;  1N36 Q;  1PH5 A;  3SDZ A;  2L15 A;  1EQQ A;  3DWQ A;  2RSN A;  1AE3 A;  2WB1 E;  1G2S A;  5ISR A;  2FHT A;  1Q8I A;  3A5Z B;  3CAM A;  2DN8 A;  1K0R A;  5GAH C;  3C2P A;  1L0W A;  5M5X B;  3MXP A;  2NTS A;  1TWA B;  3KJP A;  2JA7 G;  3I72 A;  1EOT A;  1KLG D;  4N9T A;  2AQ2 B;  1D7Q A;  4MIU A;  3ITP A;  3HOW H;  1STH A;  5ELO A;  4RFB A;  2JA9 A;  5IP9 H;  5KYI A;  2E74 C;  4HID A;  4NXN L;  5IP7 H;  2DY8 A;  2QEX A;  1I94 L;  3Q22 A;  4QB4 A;  3W3A A;  1K0S A;  4GS3 A;  4JOI A;  4RCO A;  1CKN A;  4K2L A;  2OQ0 A;  3CCS A;  4POG A;  1GHK A;  3URY A;  1Z9F A;  2M9V A;  3RZO H;  2F0V A;  3BZC A;  5TSS A;  3FPU B;  2WFW A;  3MTS A;  2YTV A;  4X65 L;  1ET6 A;  4UY8 C;  4JG2 A;  1I5F A;  4JI8 L;  4A3C G;  3QIA A;  2K14 A;  5D14 A;  1PFN A;  1K9M C;  5LMN Q;  2WB1 G;  1OXX K;  2CKZ B;  2B2U A;  3IKJ A;  4KKU A;  1QOH A;  1YNJ D;  2F0G A;  3DUZ A;  1AN8 A;  2KVM A;  2PI2 A;  2DJF C;  2E2D C;  5I2Y A;  1HNX L;  3PUY A;  4QUC A;  4RGN A;  1BOS A;  1JWS D;  2DNE A;  4AYB E;  2LY7 A;  4A3L G;  1VMC A;  4J1M A;  4A3L H;  4C2M B;  2MNA A;  4XT3 B;  1PH1 A;  3K5L A;  4QQB X;  3EJI A;  3PO2 B;  1AZQ A;  4OEL B;  3Q23 A;  2JA5 G;  4RH6 A;  3HOZ G;  1YEZ A;  4XQQ A;  2ZXR A;  1SFO H;  1GKH A;  1STE A;  2MQH A;  5IWA L;  1Q3L A;  3I8Z A;  1UWV A;  1FJG L;  4CKE A;  1Y1W B;  2K4K A;  3P1H A;  4A3J B;  2KHI A;  4DR2 Q;  1EU4 A;  4DR4 Q;  3A7A B;  1MGS A;  5IE8 A;  4PZ7 A;  3SR1 A;  2VW9 A;  4KY7 A;  3UDG A;  3J7A 5;  1E3P A;  3FKI B;  2B39 A;  4AYB G;  1D5X C;  2K32 A;  2N8N A;  1H9J A;  4NXM L;  2DY7 A;  2MGS A;  2PNR C;  3WOF A;  1RJT A;  2ICI A;  4IN3 A;  2O4X A;  3FP9 A;  2VQE L;  5DM6 3;  3D6W A;  2EYO A;  1XYI A;  4I7Z C;  1PYS B;  3TDQ A;  4JI2 L;  4HSV A;  1XWE A;  4IZ8 A;  4K0K Q;  1BCP F;  2GA4 B;  5GQO A;  5L37 A;  1SNP A;  4YY3 Q;  2ENB A;  4QIW B;  1I4X A;  1Y1V G;  3EQL C;  3NSW A;  3S9W A;  2QA4 A;  2EYM A;  1KNA A;  1Y1V H;  5JVH 3;  1QZH A;  3V2T A;  1J5E L;  3GTP H;  1QNU A;  2R93 G;  1YHA A;  3NEL A;  3HOW B;  1H9K A;  1KTK A;  2EPB A;  3I55 A;  2F0U A;  2HIX A;  4JVZ A;  5ELC A;  4RAU C;  2IHF A;  2C35 B;  5JAV A;  1QNK A;  4TKO B;  1G91 A;  3TQY A;  3RN5 A;  2VS1 A;  2Z6B A;  2I5L X;  4ZUI A;  1YHQ A;  1WTH A;  3TEH B;  2KCT A;  1EQV A;  5JEA J;  5FLX L;  3RZO B;  4HED A;  2RVL A;  1Z7T A;  3FMC A;  3TP8 A;  2K33 A;  3CXC A;  4LF8 Q;  4JPB W;  4HTH A;  4L5R C;  4DK0 A;  4JI6 L;  4IFD G;  4OL7 A;  5IYD G;  3E0E A;  4IFD H;  5IYD H;  3IFD A;  1EUJ A;  2J7Z A;  1NMF A;  3GV3 A;  2RA4 A;  3CCQ A;  4C3J H;  3DWP A;  3KOJ A;  2I5H A;  5ELB A;  3SVM A;  4R9W A;  3BDC A;  1UE6 A;  1L0Y B;  1KDC A;  2XWB B;  3HEJ A;  3E5S A;  5HY6 A;  1O78 A;  3A7L A;  4HMI A;  2GVB A;  2A6H C;  3D3R A;  2FFK B;  1K3B C;  3M7G A;  4MHE A;  1J8I A;  2F0Q A;  4FVM A;  1WFQ A;  2ZM6 L;  4LFB Q;  1WOC A;  3ULJ A;  4LFA Q;  4P73 A;  1H9S A;  2F0N A;  3W5O A;  2F1M A;  4C1N I;  3T1Y Q;  1GUT A;  2IHE A;  2B8F A;  4DAY A;  1Y69 U;  1VQ6 A;  5EBD A;  1VQ5 A;  4DV5 Q;  1SFO B;  1GXD C;  4Y52 H;  4QMG A;  3OTO L;  5J1Z A;  1IW7 D;  1W6K A;  4ME5 A;  3B6Y A;  5FK9 C;  2LMC B;  4JI5 L;  2R6G A;  3OMG A;  1EY6 A;  1Q1B A;  1LT3 D;  1CA5 A;  1EIF A;  1MI2 A;  4CDF C;  2R7Z B;  5JPN C;  2RQX A;  4EX5 A;  1TKW B;  4GNX B;  1R9T B;  1TR5 A;  2X69 A;  1ILP A;  2EE1 A;  2PPB C;  1WVL A;  1YNN D;  2SOB A;  1BCP B;  4CDD C;  2XN9 C;  4KY5 A;  1UEB A;  4DV1 L;  1Y8N B;  2C5C A;  3ER0 A;  2ZJQ A;  3PMF A;  4LFC L;  5K36 G;  1KRS A;  3VYU A;  2UUA Q;  2Z4I A;  4C3I G;  1CZG A;  1S5B D;  3RLO A;  4C3I H;  1MBY A;  4EQP A;  1UNS A;  1WJJ A;  1SMY D;  2MFI A;  4R4Q A;  1Q82 C;  4NXN Q;  4XQJ A;  1X32 A;  3I91 A;  3PF5 A;  1I94 Q;  4J6H A;  1PH6 A;  1FR3 A;  1NSN S;  3V96 A;  1E2Z A;  2A6E D;  3OWF A;  1LTA D;  1PRT C;  2KEC A;  2RHQ B;  3SK4 A;  2QCP X;  4X66 L;  1Y1V B;  3T4A C;  3E6Z X;  1VQ7 A;  1FGB D;  1VQA A;  4Y7N H;  1AZP A;  1NBW A;  1LT4 D;  4JI8 Q;  3CQZ H;  3M3Y H;  1QJO A;  4UDU C;  3G6E A;  3FHW A;  1I4G A;  2JA6 G;  1VQN A;  3J81 L;  5C4H A;  5C0X G;  2JA6 H;  5C0X H;  2WAQ B;  1ICW A;  2ZTE A;  1HNX Q;  1EY9 A;  3CMA A;  1ASY A;  4DV0 L;  3H3V H;  1VQH A;  2N3S A;  1LLR D;  2KCC A;  4J15 A;  4GNX C;  4H7B A;  4OX9 Q;  4DK3 C;  3J81 i;  2AUK A;  4JBK A;  3NBH A;  1BCP C;  5ELD A;  1E2V A;  3NUC A;  2NZO A;  3F2U A;  1LAB A;  3PF4 A;  3FVQ A;  3EBE A;  4A3E G;  4B3M Q;  2RCN A;  3TS2 A;  4A3E H;  1JC7 A;  4C3J B;  1YIJ A;  3SHL A;  1X65 A;  3U9O A;  5IWA Q;  4DV6 L;  2PQA B;  4UPA A;  1PTO B;  4L63 B;  2NVX H;  1WTR A;  2EYJ A;  3KF6 A;  4A3B H;  3QOJ A;  4UP7 A;  3CHB D;  4DR6 L;  3LX0 A;  2LKV A;  4WOR A;  1XMQ L;  2NZH A;  3A8J E;  2KEN A;  3RR5 A;  1D1K A;  1X55 A;  2JA8 B;  1STB A;  1OXV A;  4KN4 C;  1NUC A;  2VXW A;  1XMO Q;  1EYG A;  3A55 A;  4JI4 L;  1ONL A;  5A2Q L;  4HJ7 A;  1I6H H;  1X54 A;  2G9D A;  1NR2 A;  2R7F A;  4N9P A;  3SE0 A;  1SNM A;  2F0S A;  4K5W A;  2NVT H;  4IJH A;  4DF7 A;  1Q86 C;  2PW7 A;  1L2F A;  1SDF A;  2F0E A;  3DLL A;  4NXM Q;  1VS0 A;  1NNX A;  5COY A;  4QGU A;  4XYO A;  3VA7 A;  1VQC A;  3S1N H;  1A63 A;  4CDE C;  2K5V A;  1BBU A;  1YVC A;  1K8M A;  1M8A A;  3J7A V;  3VYT A;  3T53 B;  4EQN A;  1KD1 C;  1PZJ D;  1SNO A;  3OMC A;  3A54 A;  4JI2 Q;  3GTO H;  4DPG A;  1ZEQ X;  3CCE A;  4F87 A;  5FO7 B;  3NWT A;  4RGO S;  3I4M B;  4NMZ A;  2K7V A;  3D4W A;  1T5X D;  3SK8 A;  1E1O A;  1JE4 A;  2VY3 A;  4WRD A;  2WP8 J;  3U9S A;  1STG A;  3N6R A;  3HOU G;  4DXF A;  5LMU L;  3W1G A;  4HJA A;  1AE2 A;  1KDB A;  3RLN A;  4YWK A;  3S2D H;  5KEE A;  1PTO C;  3Q24 A;  4IUP A;  1EY5 A;  3OWE B;  4G7O C;  1ZYR D;  4L8J A;  3NEN A;  3Q8D A;  3HOX G;  4QL5 A;  2SDF A;  4RHR A;  3RLF A;  2UXB L;  2JK8 A;  4CJ1 B;  2UUB L;  1UE5 A;  4Y7N B;  4JI6 Q;  2I0Q A;  3CQZ B;  5IY0 A;  1AEX A;  4I65 A;  2JA6 B;  2LXK A;  2QKI C;  1LV9 A;  4DAV A;  3IFT A;  2L1B A;  2B2W C;  4MNO A;  1F9P A;  4PNY A;  1B7Y B;  2MO1 A;  1AP0 A;  2MO0 A;  4YHH Q;  2YTY A;  4HJ8 A;  1I4H A;  1V1P A;  4B3T L;  2ZM6 Q;  4KKT A;  5BR8 L;  1OXU A;  3A56 A;  1SR3 A;  2VL6 A;  2F4I A;  1ENA A;  2E75 C;  2E2I B;  2QDL A;  3OTO Q;  1ZKO A;  3TS0 A;  1SYC A;  5CC4 A;  1C48 A;  3PGZ A;  4ZCK A;  4RGT A;  4JI1 L;  4A3M H;  4JI5 Q;  1JOR A;  4A3B B;  3DWA A;  3UDI A;  3HS0 C;  2VB3 X;  4HN7 A;  3WOE A;  1JR0 D;  1LTT D;  2B2Y A;  3NBI A;  1N33 Q;  5FLX c;  3TN2 A;  1PMR A;  1VQM A;  3NQT A;  1QUQ B;  1I6H B;  1K8O A;  4KHV A;  3JC6 6;  3J7A F;  4DV1 Q;  2KEE A;  1KAB A;  4DU9 A;  1HNW L;  2NVT B;  5K5P A;  2BDN A;  1DM0 B;  3C46 A;  5JJK A;  3U4Z A;  4LFC Q;  3NEM A;  4UP8 A;  3MXG A;  3S1N B;  5DM7 3;  1Q7Y C;  4GLA C;  2F0J A;  1UUP A;  2B8G A;  2UUC Q;  1CHQ D;  5C3E G;  1JOK A;  1KQS A;  1U5K A;  5C3E H;  4KMU C;  5I9O A;  2CCZ A;  1BVS A;  3PO2 G;  3GTO B;  3KLS A;  3PO2 H;  2K03 A;  3H09 A;  4S3S A;  3O13 A;  1TS2 A;  5C44 H;  4CKC A;  2HDL A;  1LYL A;  4HIM A;  5JEA H;  4X66 Q;  1C9O A;  1V9P A;  3MEF A;  1DZ1 A;  4EQO A;  1NTG A;  2EIF A;  1ESF A;  3CME A;  5M5W B;  2R92 H;  4QIW E;  1SE2 A;  3MC0 B;  1IKL A;  4IOA A;  1KAW A;  4GKK L;  2TSS A;  4A3J G;  3S2D B;  3HKZ B;  4A3J H;  4WFN 3;  1SAP A;  2NN6 G;  2NN6 H;  4LF4 L;  3FKI G;  3KDF A;  4X64 L;  3FKI H;  4BY7 G;  1Q8K A;  4BY7 H;  4GN3 B;  2O2L D;  1BQQ T;  4XYQ A;  4LF5 L;  4DXG A;  5I2X A;  1ICF B;  4KTA A;  4O2D A;  1KIX A;  1KL9 A;  4KHZ A;  2D0O A;  2EYL A;  3ND9 A;  1GUW A;  4ZKB B;  1TS5 A;  3CU7 A;  1IBL L;  1BR9 A;  4R8N A;  2A68 D;  1BBX C;  3L9A X;  5JOB A;  1AW7 A;  1JWU D;  2KJX A;  2X6G A;  4DV6 Q;  3BDL A;  2EY1 A;  1PA6 A;  4UAI A;  2F0I A;  4DR6 Q;  1QVG A;  2Q8R E;  1XMQ Q;  5JVG 3;  3JAM L;  2KHJ A;  4U68 A;  5HGT A;  4JI4 Q;  5IOC A;  1K8A C;  3HOW G;  1F9Q A;  1PH7 A;  5IP9 G;  1LT6 D;  2WAC A;  4G57 A;  5IP7 G;  5M3M H;  3SK5 A;  3BZD B;  2CW0 C;  3UDX A;  3GTL H;  4P71 A;  1KC8 C;  5M9O A;  1BKB A;  3JAM i;  4K5V A;  4A3M B;  3K0X A;  4HIK A;  1IBK L;  2QDB A;  1NCV A;  4XXE A;  4ILW A;  3M85 A;  2K5D A;  4RKL A;  1S5F D;  2N88 A;  1FVI A;  3I90 A;  1ET9 A;  2RHS B;  5J3B A;  1CQV A;  1B9M A;  1M1K C;  4X3K A;  1NJI C;  3G7L A;  1A3V A;  1OTC A;  2R61 A;  4K8J A;  2BE5 C;  5EGT A;  1EWH A;  2ATW A;  4HJ9 A;  2PZW A;  1V8Q A;  1SYB A;  2FXQ A;  3BYT B;  3TSS A;  5I4D A;  2AKW B;  1YJW A;  2K04 A;  1ROD A;  1WTO A;  5LMU Q;  2AQ3 B;  4PG3 A;  1JWM D;  1JQY D;  5C3E B;  3GDE A;  2F0F A;  1WTX A;  4X3U A;  2Z1C A;  4DUY L;  2YU9 B;  1VF5 C;  1BUV T;  5CV5 A;  3DXJ C;  5C44 B;  1HPC A;  3TP5 A;  3S24 A;  3KLR A;  1A15 A;  2UXB Q;  4C3H G;  1B50 A;  1Q81 C;  1QB5 D;  4ZLT F;  5COR A;  4C3H H;  4BY1 B;  2DGY A;  1NY4 A;  2AUJ D;  1XNQ L;  1IYV A;  1W6J A;  2R92 B;  1DOL A;  3DM1 A;  3DM3 A;  4FYD A;  3MEH A;  2Q2I A;  4G7Z C;  2VNU D;  1KNE A;  3I3C A;  2R7Z G;  2DNC A;  2A69 C;  1VQ8 A;  2R7Z H;  1DOM A;  2HIV A;  3EA6 A;  1PRT F;  3L2P A;  1DGS A;  4L5Q A;  4FF3 A;  1QWY A;  1PH9 A;  5EKI A;  1R9T H;  2Q2T A;  5F2D A;  4IQZ A;  1R4P B;  1U4P A;  5DNF A;  3S14 H;  3N52 A;  3OIQ A;  2K01 A;  1K3R A;  2F3V A;  3CRL C;  2WAQ E;  1V43 A;  4DR5 L;  4BY7 B;  1LTR D;  1G6Z A;  5EPJ A;  1A3U A;  4PV1 C;  5BR8 Q;  4LF7 L;  4M8A A;  2CH4 A;  2NZ1 D;  2RKS A;  1X56 A;  1F2Z A;  2NB0 A;  1W2B A;  2XRS D;  5EQ0 A;  1QG7 A;  4JW0 A;  2K5W A;  4PQX A;  5CMD A;  2OTJ A;  4P75 A;  3AB9 A;  3K7A H;  4NKL A;  4JI1 Q;  4YWM A;  4KHP L;  5EBC A;  1PH2 A;  2E2J H;  2AWO A;  2E5L L;  3NE5 B;  4JCV E;  3EVQ A;  1B2T A;  3S2H H;  4L6T B;  3BVG A;  1BO0 A;  2L55 A;  2KQ3 A;  2LXJ A;  5FLX E;  4I7A A;  1HNW Q;  3CCV A;  1F2M A;  5M3M B;  1MKH A;  4LF9 L;  1N8R C;  3GTL B;  2WAQ G;  1KAA A;  3BVM A;  4RG1 A;  2L0C A;  2F0K A;  2QEJ C;  4HR7 B;  1I4P A;  4CDC C;  1EQR A;  1EQT A;  2UXD L;  1PH8 A;  4JI7 L;  1X9N A;  1CHP D;  4BBR B;  3OW7 A;  4P74 A;  5JJI A;  5IGD A;  1VMP A;  4FXK C;  4ZAI A;  2PZU A;  4IUQ A;  1F9S A;  1ESR A;  4ME3 A;  5EKL A;  4TQU S;  1EYD A;  3T51 B;  3ULL A;  4E6I A;  1SJH D;  4EQ5 A;  3BZK A;  2HDM A;  1TWC H;  4R1J A;  4DR1 L;  1GOZ A;  4KK7 A;  3S16 H;  2JE6 I;  4C3J G;  1PV4 A;  1XPU A;  5EJW A;  1HTL D;  3D4R A;  5CV4 A;  1I3Q B;  2VQF L;  1PTO H;  4BXX G;  1B3Q A;  4LAA A;  2F0H A;  4BXX H;  1N32 L;  1U9R A;  3STB D;  2XVS A;  4GKK Q;  4IPC A;  1PRT B;  3H94 A;  1RF2 D;  2JEB I;  3PUV A;  2JA8 G;  2SEB D;  2F0P A;  1TWH H;  2JA8 H;  3K5M A;  1DYQ A;  1KHI A;  1S72 A;  2RBM A;  1HNZ L;  2OTL A;  1TVX A;  1O7L A;  3AFQ A;  5C5L A;  3MFY A;  1N34 L;  4LF4 Q;  2B2T C;  4DV2 L;  1B9N A;  4ZYS A;  4X64 Q;  5E3F A;  3GTG H;  2G5D A;  4C3H B;  1JOQ A;  4XQN A;  1QE6 A;  3EFX D;  2CVR A;  4LF5 Q;  4GNX A;  1PTO F;  2PQE A;  1VCI A;  3KF8 B;  3X3N A;  1UEA B;  1OXT A;  1IBL Q;  3MZ5 A;  3PUW A;  3HOY H;  4EGV A;  2EXZ A;  4X3T A;  3KLW A;  4LWC A;  3NQI A;  3I4L A;  4ZUJ A;  4GOP B;  1GVP A;  3TP7 A;  3SGI A;  1MSH A;  3S14 B;  4CJ2 C;  1LO5 D;  2VB2 X;  3EIV A;  1MJC A;  2ZXP A;  5T1I A;  4ZKC B;  4HJ5 A;  2EJG C;  1XPR A;  5DAU A;  2MHV A;  3I4M G;  3L0O A;  2F0T A;  3I4M H;  2Q2U A;  3D31 A;  3C1E A;  1B4O A;  3K8A A;  4OGQ C;  3S1Q B;  4EVO A;  4IPH A;  1SLJ A;  5I9P A;  5G3L F;  4BWG B;  1TXY A;  3D8G A;  1SYF A;  5H1S E;  3CCJ A;  1OXS C;  3MHB A;  4IUU A;  2I46 A;  2K75 A;  3QG1 A;  1I4Q A;  3NTK A;  1EY7 A;  2RF4 A;  5FKA C;  1BBW A;  1E0B A;  3K7A B;  1IZ6 A;  2PO4 A;  1BXT A;  2XIW A;  3OOC A;  1HJP A;  3BVZ A;  1IBK Q;  5I6Y A;  2E2J B;  1EWC A;  1JMC A;  3OPO A;  3RMH A;  1YNJ C;  5IGE A;  3S2H B;  2Q2H A;  5D65 A;  4KN7 C;  4X65 Q;  2IPK D;  1HRJ A;  1X3Q A;  3KUP A;  2UXC L;  4GKJ L;  4GN4 B;  2R3Z A;  1D5M C;  2A73 B;  2NVY B;  1F9R A;  2ALY B;  3PUX A;  4ZQ3 A;  5C3X A;  2CFM A;  1BDO A;  1Q1E A;  1GM5 A;  4QUF A;  2B63 B;  5GAD C;  2IX0 A;  3ND8 A;  4FXD A;  1NR4 A;  2KBN A;  3F2D A;  2ZJP A;  1WTP A;  3QJY A;  3M4O H;  3KYH C;  1Q46 A;  2P5Z X;  4A93 G;  2L12 A;  4A93 H;  5KND A;  1HA6 A;  1CUK A;  4X3S A;  4RMF A;  4A3D H;  3VYS A;  4GOP C;  1QVF A;  1TY0 A;  4DUY Q;  1AFP A;  1D8L A;  5KIX A;  3JAM c;  4H44 C;  3NWS A;  1TWC B;  1VQD A;  1EEF D;  2TMP A;  1RTN A;  4DA2 A;  3S16 B;  2PQA A;  1TWF B;  3T13 A;  3H6M A;  5ELN A;  1LAC A;  2E2I H;  4H13 C;  3KBX A;  1HUM A;  5A2Q E;  1QIL A;  1XNQ Q;  1TII D;  3W1B A;  1B44 D;  4YCW A;  3OYY A;  4A3I B;  4OO1 I;  1FJG Q;  4A3B G;  3BDO A;  3R8B A;  3RZD H;  5E4W C;  1X3G A;  1F2Y A;  3I70 A;  1TWH B;  4O0A A;  4F7X A;  3ERS X;  4B9X A;  2BA1 A;  4DKA C;  1EZ6 A;  1NAP A;  3PCO B;  1PXU A;  3K58 A;  1WD1 A;  5JJL A;  1EL0 A;  2HUG A;  4IUT A;  2I5M X;  3S17 B;  3HKZ E;  2CWP A;  3HP3 A;  3GTG B;  3QR8 A;  3PSI A;  5IGF A;  4DR5 Q;  1C8C A;  1HUN A;  5C4X B;  3VR6 A;  5M3F H;  4LF7 Q;  1OO9 B;  2O5I C;  4HCE A;  1CSP A;  4L5T A;  3ONA B;  1VQ9 A;  2V4D A;  1S3O A;  3HOY B;  1RIP A;  2VQE Q;  2CHB D;  1HR0 W;  3T16 A;  3UI2 A;  4BA1 I;  4U67 3;  4L5S A;  1VQB A;  1MIU A;  3UE1 A;  5M5Y H;  4KHP Q;  3GTJ H;  1SN8 A;  2E76 C;  3F2C A;  2E5L Q;  1GO3 E;  3K59 A;  3GP7 A;  4IPG A;  3K0Y A;  1J5E Q;  5CBA E;  2VUM B;  1FD7 D;  1SNQ A;  4GN5 A;  5DLQ E;  1G6P A;  3ERQ A;  5M5W H;  2CW0 D;  5C4Z A;  1A3T A;  4LF9 Q;  1C4Q A;  3HKZ G;  2IW3 A;  3U58 A;  2EXD A;  3BU2 A;  5LL6 X;  5LMN L;  4KLK A;  1O7Z A;  4TVA B;  2KA7 A;  3ULP A;  2UXD Q;  3H0G G;  4JI7 Q;  3CPW A;  5C3W A;  3H0G H;  4A3K G;  1STN A;  2XWJ B;  4A3K H;  3MA2 B;  3PIO A;  4IUR A;  4QY7 A;  4YWL A;  1P16 A;  3AEV A;  4H0L C;  5KRU A;  4F8M A;  1QZG A;  1VQG A;  1AH9 A;  3DMU A;  4DV4 L;  4DR1 Q;  1X3E A;  2XSC A;  4IFD J;  4FO2 A;  1D1I A;  3GQB A;  1CQF A;  1T9H A;  2MP1 A;  5BN3 A;  3M4O B;  3J7Z C;  1Y8P B;  3TRZ A;  1SE4 A;  3HZX A;  2VQF Q;  3I4N H;  3HOV H;  3M7N A;  1XTC D;  2FMC A;  5ELE A;  1N32 Q;  3AQQ A;  2V1C C;  2PYK A;  4A93 B;  4A3D B;  4K5X A;  3MVV A;  1IW7 C;  3PIP A;  2N78 A;  3AFP A;  4ODG A;  3LWE A;  2B2V C;  3KLS X;  5CYU A;  4CBV A;  5EPL A;  1N34 Q;  4DV2 Q;  1EFW A;  3KBG A;  1HZA A;  2EQS A;  2QW7 A;  4Q0F A;  1ENC A;  1CA6 A;  1YNN C;  2F0L A;  1CT1 D;  4A3M G;  3MWY W;  1F77 A;  4TSS A;  4R4O A;  1V1Q A;  3M4Q A;  3RZD B;  1QUQ A;  3E3X A;  2IWH A;  3K5N A;  3FDT A;  5JJZ A;  1LT5 D;  1EIY B;  1DCZ A;  4QCL A;  4N8X 1;  5FLM H;  1WCM B;  4GZY C;  2LFN A;  1WTQ A;  4KV6 A;  1E1T A;  2PI2 E;  4MTN A;  3Q0A A;  1TS3 A;  2ICE C;  1GD7 A;  3R2I A;  3IL8 A;  3K6O A;  1HR0 L;  5E7N A;  2FIN B;  1SMY C;  1JT8 A;  5IOD A;  4PMB A;  1QVC A;  3CD6 A;  4K0K L;  2WIN B;  5M3F B;  2CQO A;  2A6E C;  3I73 A;  1HTP A;  4WJW A;  2ZT9 C;  1PZI D;  3MXN B;  1EY0 A;  5KNC A;  3HKS A;  1YJN A;  1L1O B;  1TU2 B;  2NYZ D;  4AQY L;  1SJE D;  2KHS A;  3SEB A;  5M5Y B;  1DJR D;  3GTJ B;  4X62 L;  2YU9 H;  1RHP A;  2ZXO A;  5C44 G;  2F03 A;  3M4Y A;  4HAE A;  5C4J H;  2PMZ E;  3G6J B;  3CW2 C;  5JEA G;  4BBS G;  4BBS H;  2K5H A;  1HH2 P;  2AQ1 B;  3UE0 A;  3MXU A;  3WWV A;  5EPK A;  4BY1 G;  2ID0 A;  1YI2 A;  1M90 C;  4BY1 H;  4H02 A;  2R92 G;  5LL6 S;  2UXC Q;  1GUG A;  2KCN A;  2Z0S A;  3J7Y W;  3G4S A;  4GKJ Q;  1SND A;  4LF8 L;  1RD9 D;  4RA8 A;  4OXP A;  1HCZ A;  2QIL A;  2Z6K C;  4YIJ A;  3I7F A;  3GTM B;  3K80 C;  1PYB A;  5C0X J;  4ID6 A;  1Q12 A;  1SEB D;  2HD3 A;  2IJ0 A;  2X6L A;  1EIH A;  4POF A;  1GUN A;  4IOC A;  1VDZ A;  4DV0 Q;  2Z4H A;  1NMG A;  3H0G B;  4P2C B;  1A6X A;  2L11 A;  2D0P A;  4A3K B;  4AH6 A;  2L9H A;  1LTI D;  5EKK A;  1SE3 A;  4XDX A;  1J9O A;  1VQO A;  3A8K E;  3K57 A;  4A3G H;  5IGC A;  4ALP A;  4B3R L;  1WTW A;  4K2K A;  1CI3 M;  2PW5 A;  1A2U A;  3JAM E;  3RD4 A;  2FMM A;  1VQK A;  4JI0 L;  1HZC A;  1GHJ A;  5KNB A;  2VZA A;  3U4V A;  4DNR B;  3T1Y L;  1IL2 A;  3I4N B;  3HOV B;  2WII B;  2A6H D;  4NP5 A;  2WKC A;  1L1O C;  4RHS A;  3NK9 A;  2B2Y C;  5AJ3 L;  1H95 A;  2I07 B;  5IGB A;  2WKD A;  5E1F A;  5IT9 L;  3J80 L;  2H4O A;  4R4T A;  1K8G A;  5CV6 A;  1PYW D;  1BF4 A;  2BH2 A;  3F8T A;  4IFD I;  2RDG A;  2F0M A;  2HHH L;  5M3M G;  3PO3 B;  2EY6 A;  1Q90 A;  1LM0 A;  3KK7 A;  1LUZ A;  3E9I A;  1JCK B;  4PMW A;  1GUS A;  3J81 c;  3KJO A;  4JYA L;  4DNT B;  1EYC A;  2RDF A;  3CF5 A;  1JJG A;  3ERO A;  2EJF C;  2EY2 A;  2JN4 A;  4K6D A;  5LHY 1;  3J81 j;  3J80 i;  2F0O A;  3T1H L;  4BBR G;  4KKS A;  3CC2 A;  2JA7 H;  2UUA L;  4BBR H;  4DFA A;  4APV A;  3GTQ B;  1ML0 D;  4YCU A;  4FNF A;  1IXR A;  1EU3 A;  4XTC S;  4O42 A;  3P75 A;  4GLX A;  3CCL A;  4DR3 L;  1EWI A;  2EJM A;  3A8I E;  4IAL A;  3VR5 A;  4IO9 A;  2HT1 A;  4F88 A;  2K52 A;  2XTI A;  4CJ0 B;  2D5D A;  3CCM A;  1HZ9 A;  3BYY B;  1ZYR C;  4JK1 C;  1SNC A;  1T5E A;  4KD4 A;  1I3Q H;  2A8V A;  4XT1 B;  1XNR L;  2J4X A;  1CKN B;  3I56 A;  4PMC A;  4RCN A;  1CTM A;  5CGK A;  4A3C H;  4AIM A;  3C1F A;  1IYJ B;  1M4V A;  1PRT D;  5C4J B;  5CR3 A;  4KJO A;  4BBS B;  2DUD A;  3HRZ C;  2UUB Q;  4O1N A;  2NBF A;  3L3O C;  2OQK A;  4OX9 L;  3HGB A;  4DV4 Q;  1DD2 A;  1KLU D;  3OSO A;  1YNX A;  1RDP D;  1C7Y A;  1PFS A;  4DR7 L;  4LUV A;  3S15 H;  2H5X A;  4G4K A;  2F4V L;  1CKM A;  1Z47 A;  2JSO A;  2KCM A;  2JA5 H;  4J8Q A;  4UHV A;  3HOZ H;  4Q5V A;  4B3M L;  1ILQ A;  4OHJ A;  3CRK C;  5IYC G;  3AYH B;  2KED A;  3TBI B;  5IYC H;  1BCP D;  4IPD A;  4B3T Q;  3G48 A;  2HCI A;  3CCR A;  2K50 A;  1FL0 A;  3QO2 A;  3S1Q H;  4A3G B;  2D62 A;  1SSO A;  5I6W A;  1EOV A;  1XMO L;  2O5J C;  2PMZ B;  3BG3 A;  4ULL A;  4C56 C;  5C0X I;  1JB3 A;  2B2T A;  4RGM A;  4JOI C;  5CV8 A;  5FO9 B;  1IBM L;  3L7Z C;  3H3V I;  3FEW X;  3KFU A;  3GTK B;  2F0D A;  1K83 B;  1JJ2 A;  3NPP A;  1SYD A;  4LJZ C;  1O7I A;  2F3W A;  3SK6 A;  1JOO A;  1JIC A;  4LNQ A;  1B70 B;  2KUM A;  4RWS C;  1HR0 Q;  1SXT A;  2NVY H;  2XGT A;  2YYZ A;  4FF2 A;  1B3A A;  2B63 G;  2B2U C;  4NW2 A;  3X3M A;  2B63 H;  4KI0 A;  2UU9 L;  4XIG S;  5CV9 A;  1EZ8 A;  1LTB D;  4FXG C;  1ENF A;  2YV5 A;  4MN3 A;  1H9M A;  1XXG A;  2IL8 A;  1KRT A;  4DV7 L;  4NB3 A;  1NE3 A;  2D9U A;  2JA7 B;  3TZD A;  4NDX A;  1MJE A;  1O7Y A;  2NVQ H;  4AQY Q;  2K28 A;  4A76 A;  2R93 H;  5D3I B;  1GJX A;  5FO8 B;  2ZJR A;  4X62 Q;  2CWA A;  2Q8T A;  2JQO A;  1HQM C;  1WYD A;  2JYO A;  4BS9 A;  4DV3 L;  1STY A;  1TWF H;  1MHW C;  1PZK D;  3IRB A;  4ZRZ A;  4FF1 A;  2EYH A;  1GUO A;  4IUV A;  3NXW A;  1VQJ A;  3IAY A;  2HCC A;  2PCF B;  4A3I G;  5J39 A;  1W3S A;  4B9W A;  4A3I H;  1X3F A;  3CCU A;  3QOL A;  3K7U C;  1DON A;  1PTO D;  3R2T A;  5IGG A;  5CBE E;  2L5T A;  1SYE A;  2WB1 B;  4DN4 M;  1QCB D;  1I4R A;  2R7D A;  3LNN A;  3GO5 A;  2A68 C;  4A3F G;  1A62 A;  1U4L A;  3AMU A;  4R8I A;  4UP9 A;  1U4R A;  4A3F H;  3S17 H;  3RUZ A;  4PZ6 A;  1FNW A;  1TWG H;  3KF8 A;  2MJ8 A;  5C4X G;  5A35 A;  2IX3 A;  1JJC B;  5C4X H;  4OEM B;  4YHH L;  2A5H A;  1Y8O B;  4DK6 C;  4OWX B;  1HXY D;  4GOP A;  4B3R Q;  5DEH A;  2F3I A;  4LUO A;  3HOY G;  2OF1 A;  5G3L D;  1EEI D;  1A0I A;  3S15 B;  1TQO A;  2H1E A;  1A8V A;  1O80 A;  1S5C D;  4LF6 L;  4JV5 L;  1ASZ A;  4OWT B;  4JI0 Q;  1U0L A;  2ZTD A;  2JA5 B;  1DXM A;  3HOZ B;  2E2H H;  4JI3 L;  4X6A H;  5HGQ A;  2NWG A;  1H9S B;  2LSS A;  4WJ3 M;  5AJ3 Q;  4M1U B;  4DAY B;  1F2L A;  2B3G A;  1EY4 A;  1FGU A;  2VUM G;  2N49 A;  4CHT B;  2VUM H;  1VQE A;  4IUN A;  4LK1 C;  1YBY A;  5GAE C;  1N33 L;  3BJU A;  1E24 A;  3ZJY C;  3PV0 A;  3VA5 A;  1CM9 A;  2JJQ A;  3PIO 3;  3MFG A;  2ASB A;  2HHH Q;  4LW1 A;  3S1M H;  2LS0 1;  4C1N K;  3RN2 A;  2QF7 A;  2SNS A;  4JYA Q;  1RCV D;  1EFI D;  4DUZ L;  2NTT A;  3T1H Q;  4AYB B;  5NUC A;  1EYA A;  3J81 E;  5K36 H;  1VQF A;  2OEO A;  4CGY B;  1LTL A;  5ELF A;  3TRE A;  4MTK A;  2XRQ D;  5HUR A;  1KDA A;  1I50 H;  4KD3 A;  4OON A;  3HG9 A;  2UUC L;  1SYG A;  1D6E C;  2PZT A;  3OW2 A;  5LMN W;  4DR3 Q;  1S5D D;  1CZW A;  1J6Q A;  3PIP 3;  3G71 A;  4K14 A;  4K8I A;  4PZ8 A;  1MSG A;  3I2Z A;  3CPF A;  1S5E D;  4B3S L;  1XX8 A;  2EYP A;  5IYB G;  4QF4 A;  4V19 0;  5IYB H;  4JBW A;  1BNZ A;  3FPP A;  3R93 A;  3VR4 A;  4R4C A;  5BN5 A;  3Q6S A;  1CSQ A;  3PUZ A;  1XNR Q;  2CQA A;  3GTP B;  2AMC B;  3LWU A;  5KGU A;  4A3D G;  2NVQ B;  4WJ4 A;  2L4N A;  1S40 A;  2R93 B;  3CC4 A;  1H9R A;  1D5Z C;  2OXP A;  1X3P A;  4DAP A;  3S1R H;  2G9H D;  5IT9 c;  1V1O A;  4TRD A;  3J80 c;  4V0B A;  5D3D A;  1VQ4 A;  5C6A A;  1I6V C;  1VQP A;  1UE7 A;  2Y0S E;  2MUY A;  4YCV A;  4KY6 A;  3VYR A;  3CC7 A;  3QWN A;  1TS4 A;  4DR7 Q;  1UE1 A;  1WCM G;  3C3L A;  2F4V Q;  4MZ9 A;  1WCM H;  2N55 A;  1IHZ A;  4BA2 I;  1D2B A;  3NBH B;  3QB3 A;  1N36 L;  4NPS A;  1P8L A;  4A3F B;  3NTH A;  2B2W A;  4B08 A;  1TWG B;  1PFM A;  3DEP A;  5M3F G;  2GN5 A;  4ABN A;  1RL2 A;  2HQL A;  2EYF A;  4LUZ A;  3KF6 B;  2F0W A;  2B2V A;  2K05 A;  4FP5 D;  1HFG A;  1TT2 A;  2E2H B;  4DAM A;  2M00 A;  3M9B A;  4N8F A;  2Y0S G;  5GAG C;  1EIG A;  1IYU A;  1IBM Q;  1IKM A;  2NN6 I;  2EOT A;  3OIP A;  1HZB A;  4P72 A;  3GD7 A;  4GLV B;  5AFW A;  3U50 C;  2SNM A;  2BDO A;  5GRO A;  1KXL A;  4HMJ A;  3E9H A;  2D2C C;  1A2T A;  1II3 A;  1JB7 A;  3S1M B;  3SXH A;  1SRU A;  2RCF A;  3UDF A;  1VQI A;  2UU9 Q;  1SBB B; 
#chains in the Genus database with same CATH homology
 2IX1 A;  1Q12 A;  3S14 H;  3GTM H;  3ER0 A;  1SE8 A;  4POF A;  2ZTC A;  4DV7 Q;  4IOC A;  1Y14 B;  4DV0 Q;  1K3R A;  1NMG A;  2WAQ E;  2ZJQ A;  1V43 A;  2D0P A;  4LFC L;  5K36 G;  4DR5 L;  1KRS A;  4AH6 A;  2UUA Q;  1XTD A;  5BR8 Q;  2F52 A;  4LF7 L;  1X56 A;  3RLO A;  1VQO A;  4C3I H;  3HOU H;  3K81 C;  4A3G H;  1W2B A;  4ALP A;  4B3R L;  4NXN Q;  1WJJ A;  4R4Q A;  2MFI A;  3STB C;  1Q82 C;  1QVG A;  2OWO A;  4QJF A;  2QGQ A;  4DV3 Q;  1I94 Q;  3PF5 A;  2OTJ A;  4P75 A;  3K7A H;  1VQK A;  1PHJ A;  4JI0 L;  1PH6 A;  1HZC A;  2VZA A;  3U4V A;  3HOX H;  4JI1 Q;  4YWM A;  3T1Y L;  1IL2 A;  4KHP L;  1PH2 A;  2E2J H;  2AWO A;  2RHQ B;  2E5L L;  3I4N G;  1E22 A;  3HOV G;  2E8G A;  4JCV E;  1E7Z A;  1L1O C;  4X66 L;  1JE5 A;  2OCE A;  4HIO A;  5AJ3 L;  1VQ7 A;  1PVO A;  1H95 A;  1VQA A;  4Y7N H;  3S2H H;  1NBW A;  4JI8 Q;  3CQZ H;  1SMX A;  3M3Y H;  4R4T A;  1K8G A;  1HNZ Q;  2LXJ A;  3G6E A;  3FHW A;  1HNW Q;  3EN2 A;  3CCV A;  3F8T A;  2BH2 A;  2JA6 G;  2Z6K A;  1VQN A;  4IFD I;  1VQL A;  5C0X G;  1MKH A;  2JA6 H;  3ICE A;  2GVA A;  5M3M G;  2HHH L;  1N8R C;  4LF9 L;  3PO3 G;  1LM0 A;  2WAQ G;  4DR2 L;  3PO3 H;  4DR4 L;  2K5N A;  1LUZ A;  1N9W A;  2ZTE A;  3E9I A;  4RG1 A;  4PMW A;  3J81 c;  3KJO A;  1XJV A;  4JYA L;  1HNX Q;  2IT1 A;  1PH3 A;  2YTX A;  3CF5 A;  1JJG A;  3CMA A;  1ASY A;  1EQR A;  4JBM A;  2VUM H;  4DV0 L;  3J81 j;  3H3V H;  2UXD L;  1VQH A;  2N3S A;  3J80 i;  3T1H L;  5M5X H;  1PH8 A;  4JI7 L;  1X9N A;  4J15 A;  4P74 A;  4GNX C;  4BBR G;  5JJI A;  3H15 A;  4OX9 Q;  4DK3 C;  1TWA H;  3CC2 A;  2JA7 H;  3J81 i;  4BBR H;  4A75 A;  2UUA L;  4JBK A;  2A19 A;  4APV A;  5FLM G;  4ME3 A;  3LGJ A;  4LF6 Q;  4JV5 Q;  4TQU S;  2NZO A;  3ULL A;  4EQ5 A;  3GTQ H;  4OWW B;  4YCU A;  3BZK A;  1IXR A;  4XTC S;  4GLX A;  1TWC H;  2PNH A;  4R1J A;  3CCL A;  4JI3 Q;  3EBE A;  1EWI A;  4DR1 L;  1CKO A;  4DR3 L;  4A3E G;  4B3M Q;  4IO9 A;  2RCN A;  2JE6 I;  4A3E H;  2HT1 A;  2K52 A;  3S16 H;  1YIJ A;  3TS2 A;  1PV4 A;  2XTI A;  1X65 A;  1PH4 A;  3RNU A;  1XPU A;  5IWA Q;  3CCM A;  1HZ9 A;  1XPO A;  4DV6 L;  2PQA B;  4UPA A;  4R4I A;  3A5U A;  2NVX H;  2VQF L;  1L1O A;  3KF6 A;  4A3B H;  4UP7 A;  4YY3 L;  1I3Q H;  4DR6 L;  4BXX G;  5FJ8 G;  2A8V A;  4BXX H;  1XMQ L;  2NZH A;  1XNR L;  5FJ8 H;  1N32 L;  3STB D;  2KEN A;  3RR5 A;  1CKN B;  4GKK Q;  4IPC A;  1X55 A;  3I56 A;  2JEB I;  1OXV A;  3PUV A;  2JA8 G;  1TWH H;  1XMO Q;  1EYG A;  2JA8 H;  1B8A A;  4JI4 L;  1HNZ L;  1KHI A;  4HJ7 A;  1S72 A;  1X54 A;  1YHB A;  4AIM A;  1K73 C;  4A3C H;  1I6H H;  4A4I A;  1IYJ B;  2R7F A;  2OTL A;  3AFQ A;  4DUZ Q;  4FDB A;  3CP0 A;  1N34 L;  4LF4 Q;  2NVT H;  4IJH A;  4DV2 L;  2BA0 A;  1Q86 C;  4X64 Q;  1L2F A;  2BH8 A;  4OO1 G;  3GTG H;  2DUD A;  3DLL A;  4NXM Q;  1VS0 A;  3F2B A;  1YIT A;  2UUB Q;  4QGU A;  3A74 A;  1VQC A;  3VDY A;  3S1N H;  5EAY A;  4LF5 Q;  1A63 A;  2OQK A;  2K5V A;  3M4P A;  1BBU A;  4GNX A;  1YVC A;  1VCI A;  3KF8 B;  1IBL Q;  4OX9 L;  1OXT A;  3D0F A;  4DV4 Q;  4C2M H;  1YNX A;  3PUW A;  1C7Y A;  3HOY H;  1PFS A;  4DR7 L;  1YZ6 A;  1KD1 C;  3KLW A;  4LUV A;  1YJ9 A;  2AHO B;  4LWC A;  3S15 H;  4JI2 Q;  2H5X A;  4GOP B;  2F4V L;  1GVP A;  3GTO H;  1CKM A;  1Z47 A;  2KCM A;  4JC0 A;  3SGI A;  4DPG A;  2JA5 H;  4B3S Q;  3EIV A;  3CCE A;  1MJC A;  4HJ5 A;  3HOZ H;  4B3M L;  3PF4 A;  1XPR A;  3I4O A;  5IYC G;  3AYH B;  3F1Z A;  3I4M G;  5IYC H;  3HFZ B;  3A0J A;  3L0O A;  4IPD A;  4B3T Q;  2Q2U A;  3D31 A;  3I4M H;  1E1O A;  3G48 A;  3K8A A;  1Y1W G;  3CCR A;  2K50 A;  2VY3 A;  4DNI A;  1SRO A;  2WP8 J;  4IPH A;  1FL0 A;  1SLJ A;  1Y1W H;  2ES2 A;  3S1Q H;  2D62 A;  1TXY A;  2AWN A;  3HOU G;  5H1S E;  2A1A A;  3CCJ A;  1OXS C;  5LMU L;  4A3G G;  3W1G A;  4HJA A;  1AE2 A;  1EOV A;  2K75 A;  1XMO L;  3RLN A;  4YWK A;  3S2D H;  2RF4 A;  1BBW A;  1C0A A;  1X6O A;  2JEA I;  4LFB L;  1IZ6 A;  5C0X I;  3NEN A;  3Q8D A;  1HJP A;  3HOX G;  4LFA L;  1IBK Q;  4QL5 A;  1JMC A;  4JOI C;  1WI5 A;  1G51 A;  3RLF A;  4DV5 L;  2UXB L;  2JK8 A;  1IBM L;  2UUB L;  2B29 A;  1UE5 A;  2IY5 B;  3L7Z C;  3H3V I;  4IJL A;  3KFU A;  4JBJ A;  2Q2H A;  4X65 Q;  1JJ2 A;  4JI6 Q;  3KDF B;  2I0Q A;  1O7I A;  5IY0 A;  3GTK H;  1G29 1;  1K83 H;  2UXC L;  4LNQ A;  1B70 B;  4GN4 B;  4GKJ L;  3PUX A;  2ALY B;  1HR0 Q;  2LXK A;  1N36 Q;  2CFM A;  1Q1E A;  2NVY H;  2XGT A;  2YYZ A;  1GM5 A;  1PH5 A;  2B63 G;  5GAD C;  2IX0 A;  2L15 A;  1EQQ A;  2B63 H;  2KBN A;  4KI0 A;  4MNO A;  3F2D A;  1AE3 A;  2WB1 E;  2ZJP A;  2UU9 L;  4XIG S;  3M4O H;  1B7Y B;  3A5Z B;  3CAM A;  3KYH C;  1Q46 A;  2MO1 A;  1K0R A;  5GAH C;  2YV5 A;  1L0W A;  2MO0 A;  4YHH Q;  2YTY A;  4DV7 L;  4HJ8 A;  4A93 G;  1KRT A;  4NB3 A;  1NE3 A;  4A93 H;  3KJP A;  4B3T L;  1CUK A;  2JA7 G;  4RMF A;  4A3D H;  1MJE A;  4GOP C;  2NVQ H;  1QVF A;  4AQY Q;  1D7Q A;  2ZM6 Q;  4A76 A;  4DUY Q;  2R93 H;  5BR8 L;  3HOW H;  1D8L A;  1OXU A;  3JAM c;  5ELO A;  2ZJR A;  1SR3 A;  2VL6 A;  4X62 Q;  1VQD A;  2CWA A;  2JQO A;  2JA9 A;  5IP9 H;  4HID A;  4NXN L;  5IP7 H;  2PQA A;  1WYD A;  2QEX A;  3OTO Q;  4DV3 L;  1I94 L;  5ELN A;  2E2I H;  3TS0 A;  1TWF H;  4GS3 A;  4JOI A;  1XNQ Q;  3IRB A;  3PGZ A;  1CKN A;  4JI1 L;  4A3M H;  2OQ0 A;  1VQJ A;  4YCW A;  3OYY A;  3W1B A;  1Z9F A;  3CCS A;  4JI5 Q;  4A3I G;  4POG A;  1FJG Q;  3RZO H;  3UDI A;  4A3B G;  3BZC A;  1W3S A;  4A3I H;  2WFW A;  3RZD H;  1X3F A;  1N33 Q;  2YTV A;  3CCU A;  5FLX c;  4X65 L;  1X3G A;  3K7U C;  4UY8 C;  4JG2 A;  4O0A A;  1I5F A;  3ERS X;  1VQM A;  2BA1 A;  1QUQ B;  4DKA C;  4JI8 L;  3JC6 6;  3PCO B;  4A3C G;  4DV1 Q;  5JJL A;  2K14 A;  1K9M C;  5LMN Q;  1HNW L;  2WB1 G;  2I5M X;  1OXX K;  2CKZ B;  2R7D A;  3HKZ E;  2CWP A;  3GO5 A;  4A3F G;  1A62 A;  5JJK A;  4UP9 A;  3U4Z A;  4A3F H;  3PSI A;  3NEM A;  4LFC Q;  4PZ6 A;  4DR5 Q;  3S17 H;  4UP8 A;  2PI2 A;  1TWG H;  5C4X G;  1HNX L;  3PUY A;  1JJC B;  5M3F H;  4LF7 Q;  5C4X H;  4YHH L;  1Q7Y C;  1CSP A;  4GLA C;  4L5T A;  4AYB E;  4DK6 C;  4OWX B;  4A3L G;  2UUC Q;  1VQ9 A;  4GOP A;  4B3R Q;  5C3E G;  4A3L H;  1S3O A;  2MNA A;  1KQS A;  1U5K A;  2F3I A;  1RIP A;  4LUO A;  5C3E H;  2VQE Q;  1PH1 A;  1HR0 W;  3HOY G;  4QQB X;  1A0I A;  4BA1 I;  2CCZ A;  4L5S A;  1A8V A;  1BVS A;  4LF6 L;  1VQB A;  3PO2 G;  4JV5 L;  1ASZ A;  1MIU A;  4OWT B;  4JI0 Q;  1U0L A;  3UE1 A;  2ZTD A;  5M5Y H;  3PO2 H;  2JA5 G;  4KHP Q;  3GTJ H;  1SN8 A;  3F2C A;  2E2H H;  2E5L Q;  5C44 H;  3HOZ G;  4JI3 L;  1YEZ A;  1GO3 E;  4X6A H;  1LYL A;  5HGQ A;  4HIM A;  4X66 Q;  1SFO H;  2LSS A;  4WJ3 M;  1GKH A;  5AJ3 Q;  4IPG A;  2MQH A;  4DAY B;  5IWA L;  1J5E Q;  2B3G A;  4DV1 L;  1FGU A;  1C9O A;  1V9P A;  3MEF A;  1UWV A;  1FJG L;  2VUM G;  1NTG A;  2EIF A;  2N49 A;  4GN5 A;  5DLQ E;  1VQE A;  3CME A;  2K4K A;  4QIW E;  1YBY A;  2R92 H;  1G6P A;  5GAE C;  1N33 L;  3BJU A;  1E24 A;  5M5W H;  4IOA A;  1KAW A;  3ZJY C;  3PV0 A;  4GKK L;  2JJQ A;  2ASB A;  4A3J G;  2HHH Q;  4LF9 Q;  2KHI A;  4LW1 A;  4A3J H;  3HKZ G;  3S1M H;  3U58 A;  4DR2 Q;  4DR4 Q;  2EXD A;  3BU2 A;  3RN2 A;  5IE8 A;  5LMN L;  4JYA Q;  4PZ7 A;  4KLK A;  4TVA B;  2VW9 A;  2NN6 G;  4DUZ L;  3UDG A;  3J7A 5;  1E3P A;  3ULP A;  4LF4 L;  3T1H Q;  2UXD Q;  3FKI G;  3H0G G;  3KDF A;  4JI7 Q;  4AYB G;  4X64 L;  3CPW A;  3FKI H;  3H0G H;  4A3K G;  4BY7 G;  1VQF A;  2N8N A;  4A3K H;  4NXM L;  1Q8K A;  3PIO A;  4BY7 H;  1LTL A;  4GN3 B;  4QY7 A;  1P16 A;  4YWL A;  3TRE A;  3AEV A;  4C3H H;  4LF5 L;  1I50 H;  4O2D A;  1KIX A;  4OON A;  1KL9 A;  4KHZ A;  2D0O A;  2UUC L;  1QZG A;  1VQG A;  1AH9 A;  1IBL L;  3FP9 A;  3OW2 A;  4DV4 L;  2VQE L;  5LMN W;  4DR1 Q;  4DR3 Q;  1X3E A;  4IFD J;  2UU9 Q;  1J6Q A;  3G71 A;  4PZ8 A;  1PYS B;  4JI2 L;  3I2Z A;  3CPF A;  1T9H A;  4DV6 Q;  4B3S L;  4K0K Q;  5IYB G;  3J7Z C;  1PA6 A;  3TRZ A;  5GQO A;  5IYB H;  2VQF Q;  3I4N H;  4JBW A;  4DR6 Q;  4YY3 Q;  3HOV H;  3M7N A;  4R4C A;  1CSQ A;  1Y1V G;  3PUZ A;  2QA4 A;  1XMQ Q;  1XNR Q;  1N32 Q;  3AQQ A;  2V1C C;  2AMC B;  1Y1V H;  1QZH A;  1J5E L;  4A3D G;  3GTP H;  4WJ4 A;  2KHJ A;  1S40 A;  3PIP A;  4JI4 Q;  2R93 G;  3CC4 A;  2N78 A;  1YHA A;  3AFP A;  3NEL A;  1K8A C;  3HOW G;  4OO1 I;  3S1R H;  1PH7 A;  3I55 A;  5IT9 c;  5IP9 G;  2HIX A;  1N34 Q;  3J80 c;  2IHF A;  5IP7 G;  4DV2 Q;  5M3M H;  1EFW A;  2C35 B;  3UDX A;  1HZA A;  3GTL H;  2EQS A;  4P71 A;  1KC8 C;  3TQY A;  3RN5 A;  2VS1 A;  1VQ4 A;  2I5L X;  1BKB A;  1YHQ A;  3TEH B;  2KCT A;  3JAM i;  1VQP A;  3K0X A;  4HIK A;  4A3M G;  1IBK L;  5JEA J;  1UE7 A;  2Y0S E;  4R4O A;  1V1Q A;  3M4Q A;  4YCV A;  1QUQ A;  3M85 A;  3CC7 A;  1EIY B;  3CXC A;  4LF8 Q;  4L5R C;  1FVI A;  4DR7 Q;  1UE1 A;  5FLM H;  4JI6 L;  2RHS B;  5J3B A;  1WCM G;  4IFD G;  5IYD G;  1E1T A;  2PI2 E;  4MTN A;  3E0E A;  1M1K C;  4MZ9 A;  1WCM H;  2F4V Q;  5IYD H;  4BA2 I;  1EUJ A;  3NBH B;  1NJI C;  1GD7 A;  1NMF A;  1HR0 L;  1OTC A;  5E7N A;  1N36 L;  4NPS A;  1JT8 A;  3CCQ A;  1P8L A;  4C3J H;  3KOJ A;  2I5H A;  1QVC A;  3CD6 A;  4K0K L;  2ATW A;  4HJ9 A;  1UE6 A;  2FXQ A;  1YJW A;  2AKW B;  2CQO A;  5M3F G;  2GN5 A;  5HY6 A;  5LMU Q;  2GVB A;  4PG3 A;  1RL2 A;  3MXN B;  2HQL A;  3HKS A;  3GDE A;  1L1O B;  4LUZ A;  3KF6 B;  1YJN A;  4AQY L;  1WFQ A;  2ZM6 L;  4DUY L;  4LFB Q;  1WOC A;  3ULJ A;  4LFA Q;  4P73 A;  3W5O A;  4X62 L;  4DAM A;  2YU9 H;  5C44 G;  3T1Y Q;  2IHE A;  3M9B A;  3S24 A;  1VQ6 A;  2Y0S G;  5C4J H;  5GAG C;  1VQ5 A;  2PMZ E;  4DV5 Q;  4Y52 H;  2UXB Q;  5JEA G;  3CW2 C;  4BBS G;  1IBM Q;  3OTO L;  4BBS H;  2K5H A;  1HH2 P;  2NN6 I;  3UE0 A;  1Q81 C;  1HZB A;  4P72 A;  3WWV A;  3GD7 A;  2DGY A;  1NY4 A;  2ID0 A;  3B6Y A;  4GLV B;  4BY1 G;  3U50 C;  1YI2 A;  1XNQ L;  1M90 C;  4BY1 H;  4JI5 L;  4H02 A;  2R92 G;  2R6G A;  2UXC Q;  3DM3 A;  2Z0S A;  5GRO A;  3G4S A;  2Q2I A;  4GKJ Q;  1Q1B A;  1KXL A;  1EIF A;  3E9H A;  4LF8 L;  2VNU D;  2R7Z G;  4EX5 A;  1VQ8 A;  2R7Z H;  4OXP A;  2Z6K C;  2HIV A;  4GNX B;  3L2P A;  1JB7 A;  1DGS A;  4L5Q A;  3I7F A;  1PH9 A;  1SRU A;  1R9T H;  3UDF A;  1VQI A;  2Q2T A;  3K80 C;  1PYB A;  1UEB A;  5C0X J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...