1C9OA

Crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords COLD-SHOCK PROTEIN
publication title Thermal stability and atomic-resolution crystal structure of the Bacillus caldolyticus cold shock protein.
pubmed doi rcsb
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1c9oA00
5C4XH 5JJKA 3KF6A 3PSIA 4A75A 3KYHC 4X64L 1QZHA 2UXDQ 2EQSA 2I5MX 4L5TA 2NVTH 2YTXA 3E0EA 3HOYH 2D0PA 3E9HA 1N33Q 2XGTA 1Y1WH 1HR0W 3F2DA 1RIPA 5JJIA 4DV3Q 1VQKA 1V9PA 1PH2A 4MTNA 3S1RH 3J81i 2B3GA 2YYZA 1E3PA 2QEXA 1EIFA 1I3QH 3UDIA 4NXNQ 4B3RL 1VQNA 5IYCG 4DV4L 1PFSA 4P72A 5C44G 5IT9c 2Y0SG 1X55A 4GN3B 3S15H 1SE8A 5C0XI 4A3FH 1PH4A 1N32L 3PUXA 2NVXH 4BBRG 3J7A5 4A3BH 1HZ9A 2GVAA 3NENA 1D8LA 2E8GA 4DV5Q 4DV6Q 3A0JA 2VNUD 1YZ6A 2JA9A 4X66Q 1VQPA 3H3VH 4OONA 4YWKA 4HIMA 2PI2E 2E2HH 1IBMQ 3CC7A 4LF9Q 2LXJA 1LYLA 2K75A 4XIGS 3RLNA 4A3JH 3TS0A 4LFBQ 2R92G 5IYBG 4PZ8A 2F52A 3W5OA 4LF8L 1XNRL 1VQDA 1A0IA 4TVAB 4LF4Q 1SMXA 4A3MG 4AQYQ 2Q2TA 4LF6L 3I4NH 1Q8KA 3CCLA 3F1ZA 2CQOA 3UE0A 2YV5A 4DV0L 1PA6A 1PH1A 3S1QH 4YHHL 3I4OA 1BVSA 5FLMG 1CKNA 4JI1L 3M9BA 1I5FA 4IJLA 3J80c 1HNXL 3A74A 4AIMA 1VQ9A 2UUCQ 2VQEQ 2JE6I 3NELA 5HGQA 3PCOB 2F3IA 1B7YB 3AYHB 4BA2I 2IX0A 4BXXG 1G51A 3HOVH 4B3TL 1TWHH 4JOIA 4IPDA 4C2MH 3AFQA 3M4PA 5M5YH 1PHJA 4DKAC 4JI5L 2UUAL 3CD6A 4JYAL 2WB1E 3PF4A 2I5HA 1C9OA 1B8AA 2L15A 3F2BA 1YJNA 3CW2C 3HOWG 1RL2A 2CFMA 1FL0A 3HKZG 4JI7Q 5GAHC 5E7NA 2VL6A 3EIVA 4A3KH 2HHHL 2ASBA 3M7NA 3CCRA 1C0AA 3J81c 3M85A 3HOXH 2BH2A 1X65A 4MNOA 3CCMA 4IFDI 4JYAQ 4A3DH 4R1JA 2RF4A 2D0OA 4DR5Q 4UP8A 5IYDH 1EFWA 3PO3G 3S14H 4POGA 2JEAI 1X3EA 4C3IH 1FJGQ 1NBWA 4DUZQ 3OYYA 4BY7G 1HNWL 1PH7A 1VQOA 4JI0Q 2PI2A 4P74A 4NPSA 1GO3E 4ME3A 2UU9Q 1GVPA 3FP9A 5GAEC 4JI8L 1XNQQ 3U50C 3K7AH 3CCQA 2KCTA 1EQQA 1JMCA 1YNXA 4LUZA 3F8TA 2HIVA 1YHQA 2R6GA 4UPAA 5LMNL 2WP8J 3D0FA 3UDXA 3G71A 1HR0Q 2F4VL 2JA7H 1X6OA 4R4IA 4Y52H 1OXXK 1XJVA 1JB7A 2R93G 4GNXB 4BBSG 1L2FA 5C3EG 4X6AH 1NJIC 2JA5G 5IY0A 2YU9H 1E1TA 1Z47A 2BA0A 2KHJA 4IO9A 4QJFA 2JA6H 4OX9L 3CCVA 3CPFA 5C44H 4AYBE 4DR6Q 3CPWA 1L1OC 1N34Q 4NXMQ 4DR1L 1KD1C 3PGZA 3CF5A 2B29A 4BBRH 1L0WA 2MQHA 3G4SA 4DK3C 3T1YQ 2Q2HA 2WAQE 3GTQH 1NE3A 4H02A 1VQIA 3BJUA 4GNXC 4WJ4A 2GN5A 2MFIA 2OWOA 1EOVA 3KF6B 4PMWA 5M3FH 4B3SL 1G291 2A8VA 2I0QA 1EUJA 4EQ5A 1MIUA 1ASYA 2BH8A 1NMGA 1EQRA 2OTLA 2UUBL 3S1NH 1A62A 3GD7A 4DAMA 3FKIH 3CCEA 4KHPQ 3S17H 5IP9H 4DV1L 4BY1G 3H0GG 2VQFQ 4OWXB 2IHEA 4LNQA 3HOZG 4DV2Q 5IWAQ 3S1MH 1JE5A 1WJJA 1A63A 2VUMG 3RNUA 1VQMA 2PQAB 3B6YA 1YJ9A 3I4MH 4DR7Q 1FGUA 3PUYA 5ELOA 4WJ3M 1CUKA 4POFA 1YI2A 1PH6A 4JI3Q 2E2JH 2JQOA 4PZ6A 4JI6Q 2N3SA 2XTIA 3KF8B 5LMUL 4A93H 1UWVA 3W1BA 3RZOH 1IZ6A 1JJGA 2MNAA 1N8RC 3GO5A 1SR3A 3CQZH 2PQAA 3E9IA 5J3BA 2HT1A 3H3VI 3OW2A 4RMFA 2AWNA 1NTGA 1VQFA 4YY3L 3DM3A 3TQYA 5LMNW 4HIKA 1Q7YC 4P73A 4NXNL 5JEAG 1VQ4A 4YCVA 1KRTA 3NEMA 3TS2A 2V1CC 2K4KA 3I56A 5FJ8G 2HIXA 5M5XH 2Y0SE 1PYBA 4R4TA 1UEBA 1X3GA 2PNHA 2ZTCA 3KOJA 3UDGA 3CC4A 2JK8A 1MJCA 2OTJA 3BZKA 1S72A 4DR3Q 1TWAH 2IHFA 3ULJA 3A5UA 3CMEA 4DV5L 1X9NA 1AE3A 4A3CH 4JBKA 3RZDH 2RHSB 3IRBA 4X66L 1QZGA 1CKNB 1JJCB 1GD7A 1KHIA 1VS0A 5M5WH 4DR2Q 1IBML 2NN6G 2MO1A 3HOUG 4JV5Q 3LGJA 5GAGC 2MO0A 1R9TH 2ZTDA 3A5ZB 5GROA 3CCJA 1Q81C 3ICEA 4BY7H 1UE1A 1WCMH 1WOCA 4FDBA 5JEAJ 3RN2A 4LFBL 3I55A 1IXRA 2NZHA 4A3EH 1HNZL 2B63G 5IP7H 5JJLA 4LF4L 3ULPA 1CSQA 4AQYL 4YCUA 1VQ5A 4A3LH 4X65Q 1Y1VG 4DR4Q 3JAMi 2AHOB 4GLAC 1E1OA 4UP7A 1OXVA 1XNRQ 1S40A 3CCSA 4HJ8A 1IBKQ 2UUCL 1MJEA 1HZCA 4R4QA 4A3GG 5M3MH 1YHAA 2N78A 2R93H 5C4XG 1N9WA 1A8VA 2Z0SA 4PG3A 1U0LA 3KLWA 3DLLA 3TREA 4A3IH 4B3MQ 2JA8H 4JOIC 3HOYG 2ES2A 1WYDA 1LTLA 1VCIA 3KDFB 4L5QA 3H15A 1PH3A 1Y1WG 3PUWA 2K5NA 1FVIA 3ZJYC 4LFCQ 4QIWE 4LW1A 4QGUA 3WWVA 4B3TQ 4GKKQ 1N36L 3GTJH 1X54A 1OTCA 4IPGA 1SLJA 1EWIA 3MXNB 1PH8A 3PO2H 3K0XA 3HKZE 3KDFA 1IBLQ 5BR8Q 4L5RC 3S16H 5K36G 4HJ5A 2A19A 1KL9A 1IL2A 3BZCA 3I2ZA 3KJPA 4GOPB 4A3FG 4HIDA 1J5EQ 2HHHQ 5DLQE 4A3GH 4A3BG 3ULLA 2I5LX 4JI4Q 3HKSA 3T1HQ 1SRUA 1K83H 2OQ0A 1KIXA 4C3HH 1JT8A 1QVGA 2CWAA 2R7ZH 1AH9A 1W2BA 1VQCA 1YHBA 1XMQL 3GTPH 4GOPA 3STBD 1Q46A 4DUZL 4KLKA 2Z6KA 4A4IA 1XTDA 4HJ7A 1VQ8A 3FHWA 4JI0L 1JJ2A 4DK6C 3G6EA 4DUYQ 2AKWB 4EX5A 2UXBQ 2CCZA 1YIJA 3S2DH 5C0XG 1VQJA 1Z9FA 3ER0A 4A3JG 4DV7Q 3U4ZA 4YWMA 4JI8Q 3CMAA 3I4NG 3NBHB 1WFQA 1H95A 1E7ZA 4X62Q 1OXTA 5IYCH 4GKJL 3CC2A 3W1GA 4PZ7A 4LUVA 5LMNQ 4QL5A 4LFAQ 4JI2L 4LF5Q 2F4VQ 2GVBA 3OTOL 2E5LQ 2KHIA 4DR6L 1HJPA 4P75A 4NXML 1I94L 3HOVG 1XPUA 1CKMA 3CXCA 2NVYH 3PIPA 1AE2A 4IOCA 1VQEA 2ZM6L 4GLXA 1CSPA 3EN2A 5C0XJ 2OCEA 2WAQG 4R4CA 4OO1I 1OXSC 1Q1BA 2K5VA 1VQHA 4K0KL 4A3KG 1WI5A 5GQOA 2VW9A 3HOXG 2R92H 5IYBH 2LXKA 4O2DA 4DAYB 2WFWA 4AH6A 1NY4A 3CP0A 4BA1I 3HOUH 1UE6A 4A3MH 4YCWA 1KQSA 1TWFH 2UXCQ 3L7ZC 4B3SQ 2ATWA 4A3DG 5AJ3Q 1V43A 1E24A 1PYSB 1XMOL 4KHPL 1OXUA 2YTVA 2VQFL 4LF9L 3VDYA 5IYDG 5FLMH 4DV2L 2UUBQ 5IWAL 4LF7Q 2UXDL 2JJQA 4DR7L 1VQBA 4QQBX 3PV0A 1K9MC 1N33L 3J80i 4JI3L 4X64Q 4BXXH 4DV3L 1TXYA 1QUQB 2A1AA 2KCMA 4JI6L 3S2HH 3K7UC 3J7ZC 4JBJA 4IFDG 3M4QA 4P71A 4LWCA 5HY6A 3HOWH 5LMUQ 1P16A 5GADC 1XPRA 4KI0A 1U5KA 1K3RA 4OXPA 4B3RQ 1QUQA 1T9HA 1X3FA 2JA7G 2EXDA 5H1SE 4DPGA 4DV4Q 3KJOA 1HZAA 2LSSA 4YY3Q 1Y14B 1QVFA 2NZOA 1N32Q 3Q8DA 2R7DA 4DV6L 2JA6G 3M4OH 1KC8C 4NB3A 3S24A 3PO3H 1D7QA 1SFOH 1G6PA 3TEHB 3PUVA 1BKBA 3STBC 4DR3L 3UDFA 3AFPA 5IE8A 3GTKH 2K14A 1YBYA 1C7YA 4DNIA 3RN5A 2ID0A 4IFDJ 2DGYA 1MKHA 4JBWA 4Y7NH 3I7FA 4IPHA 4DR2L 2Q2IA 3AEVA 4JV5L 2JEBI 5M3FG 1B70B 4OWWB 4LF8Q 1M90C 1EYGA 1PH9A 1VQLA 4LF6Q 3RR5A 3FKIG 4QY7A 1CKOA 1HH2P 1P8LA 5IP9G 4X65L 2PMZE 4DV0Q 4DR4L 2EIFA 4YHHQ 2VQEL 1HNZQ 5ELNA 4BBSH 5C3EH 1Q1EA 3HFZB 3PUZA 4JI1Q 3BU2A 4APVA 1HNXQ 2JA5H 3PF5A 3I4MG 2R7FA 4L5SA 1IBKL 2AMCB 4JC0A 3G48A 1LM0A 2CWPA 3PIOA 2WB1G 3L0OA 1Q86C 2ALYB 3JC66 1PV4A 1O7IA 4B3ML 4JI7L 4A93G 4JI5Q 2UUAQ 1X56A 1PH5A 2IY5B 1YJWA 1UE7A 3L2PA 2E2IH 4OO1G 1V1QA 2ZJPA 2QA4A 4KHZA 3F2CA 4LFCL 4JBMA 3M3YH 4GKKL 1Q12A 3U58A 3AQQA 1QVCA 1VQ6A 2K52A 4LUOA 4DR5L 1VQ7A 4RG1A 1W3SA 1IBLL 5BR8L 1N36Q 1BBWA 1KRSA 2N49A 1VQAA 1YVCA 4O0AA 2RCNA 1NMFA 1J5EL 2CKZB 2IT1A 3CAMA 4J15A 4BY1H 3H0GH 1K8GA 1FJGL 3HOZH 5FLXc 4HJ9A 4JI4L 1IYJB 1TWCH 4GN5A 2OQKA 3T1HL 3GTMH 3KFUA 2VUMH 1I6HH 2UU9L 1XNQL 4A3CG 1J6QA 4GN4B 3SGIA 1HNWQ 1Q82C 1E22A 4GOPC 4R4OA 4MZ9A 2Z6KC 3RLFA 4GS3A 3U4VA 1EIYB 1K73C 2BA1A 2DUDA 5EAYA 2KENA 4DUYL 1XMQQ 1KXLA 1K8AC 1HR0L 2UXBL 3D31A 3GTOH 1WCMG 4DV7L 2ZJRA 4A3EG 1ASZA 4JG2A 1PVOA 5IP7G 4HJAA 3JAMc 4A3LG 1L1OB 2K50A 2QGQA 3GTGH 3K8AA 1S3OA 4X62L 2NN6I 4HIOA 2N8NA 1UE5A 1KAWA 1N34L 5FJ8H 1M1KC 4AYBG 4LF5L 4LFAL 1GM5A 2K5HA 4OX9Q 5M3MG 4GKJQ 1L1OA 2E5LL 3GDEA 1VQGA 2C35B 4JI2Q 4DR1Q 3T1YL 4A3IG 2JA8G 1SROA 3TRZA 3EBEA 1YITA 4GLVB 3K80C 3OTOQ 3GTLH 2RHQB 2HQLA 4C3JH 3UE1A 5C4JH 1I94Q 4UY8C 2Q2UA 3ERSX 4IOAA 4GNXA 4IPCA 2YTYA 3K81C 1HZBA 1SN8A 2KBNA 1I50H 2VS1A 2VY3A 2ZM6Q 1YEZA 3PO2G 3RLOA 4TQUS 1DGSA 2B63H 4JCVE 2AWOA 4K0KQ 4ALPA 4YWLA 2UXCL 2H5XA 1TWGH 4UP9A 1Y1VH 4DV1Q 5AJ3L 4IJHA 2ZJQA 2VZAA 1BBUA 2D62A 1XPOA 2ZTEA 2IX1A 3MEFA 2FXQA 4LF7L 3CCUA 3J81j 1GKHA 2NVQH 2R7ZG 1K0RA 1XMOQ 1LUZA 4OWTB 4A76A 4XTCS
chains in the Genus database with same CATH superfamily
2D2CC 5JJKA 4A75A 1QZHA 4Q0FA 3SE0A 2I5MX 3E0EA 2D0PA 2XGTA 1Y1WH 3F2DA 1RIPA 1VQKA 1V9PA 5EBDA 3J81i 3URYA 4NXNQ 3J7YW 1LTRD 5FO9B 5C44G 5IT9c 3J81E 5K36H 2F0EA 4C56C 4A3FH 4FF4A 1N32L 1XTCD 3PUXA 2NVXH 4BBRG 3J7A5 1EYCA 1DZ1A 4DV5Q 2VNUD 3BYYB 2RDFA 2JA9A 3WOFA 1GUSA 4KD4A 4HIMA 1RCVD 4BY1B 3MC0B 1TWCB 2A6ED 5EPLA 5IYBG 1A0IA 5C3WA 3T53B 1ET9A 2KJXA 4LF6L 2AUJD 4X3KA 4F87A 3K6OA 1HNXL 4IJLA 3J80c 4AIMA 1VQ9A 2VQEQ 4DN4M 2B2YA 1A2UA 4IPDA 4C2MH 1PHJA 2WB1E 1EIGA 4DF7A 4RKLA 3R8BA 1GXDC 4A3KH 1SDFA 3J81c 1X65A 1X3QA 4MNOA 5I4DA 4NW2A 4IFDI 1AN8A 1S5DD 4U68A 2RF4A 1PFMA 4UP8A 1EFWA 3PO3G 3G6JB 4DUZQ 1VQOA 1Y1VB 1WVLA 4P74A 1GO3E 4ME3A 3FP9A 3OWFA 1XNQQ 1S5BD 3K7AH 3O13A 2NVQB 2KCTA 2RDGA 4OEMB 1JMCA 3NTIA 5FK9C 3MHBA 4A3GB 2HIVA 5C4XB 4UPAA 3G71A 3UI2A 3D4WA 2FJ2A 4YIJA 2LMCB 3C3LA 4Y52H 2F0HA 1SXTA 1L2FA 4X6AH 1ML0D 1QB5D 1TIID 5IGCA 5IY0A 3PIO3 1Y69U 1E1TA 2YU9H 1Z47A 2BA0A 2KHJA 2KOLA 2JA6H 3KLSA 3S1RB 3CPFA 3CPWA 1LT5D 5C6AA 1KD1C 4HR7B 3WDNA 2AQ3B 2B29A 1L0WA 3NBHA 3S15B 1PTOB 3KUPA 3GTQH 4A3BB 1NE3A 2CHBD 1VQIA 1GHJA 2B2VC 5ELCA 1G291 2I0QA 2CQAA 2F0KA 1KLGD 2UUBL 3S1NH 4KHPQ 1SNMA 3BDOA 4PV1C 4BY1G 1SSOA 4LNQA 4OWXB 2IHEA 3TN2A 4HEDA 5IWAQ 1JE5A 2K01A 3T4AC 3S1MH 1PTOC 2JP1A 3Q23A 5ELOA 3IAYA 1CUKA 1PFBA 1YI2A 5D3IB 2E2JH 3I4NB 2XTIA 3NPPA 2TMPA 1UWVA 4DAYA 1SYCA 1VF5C 2O2LD 1SR3A 2O4XA 3KBXA 4RKBA 1M4VA 4XT1B 4YY3L 5LMNW 1TWHB 1JOKA 1KRTA 2K4KA 1LTBD 4EGVA 1TVXA 3BVMA 4B9WA 3CC4A 4R4TA 1UEBA 2VXWA 2LFNA 3H0GB 2LKVA 2EJMA 3C1FA 2X69A 4JBKA 3T56B 2RHSB 1GD7A 3WOEA 1I6HB 3HP3A 2NN6G 4FYDA 2ZTDA 3A5ZB 1B3QA 1ZYRD 1ICFB 4LFBL 1I4GA 5JEAJ 3P1HA 4C3IB 1ZKOA 3I55A 2NZHA 4A3EH 3ULPA 1CSQA 4AQYL 2A6HD 4X65Q 1Y1VG 4DR4Q 1GUWA 1A2TA 1G2SA 4GLAC 1F9RA 4ZYSA 4HJ8A 2ICEC 1MJEA 1HZCA 4A3GG 3BVZA 3TP6A 5C4XG 2R93H 4IUQA 4A3IH 4J1MA 3VA5A 3TREA 2CH4A 4NKLA 3A8IE 3EFXD 1PH3A 4MIUA 3T16A 4WORA 4B3TQ 1TY0A 1EY9A 5BR8Q 4WFN3 1U9RA 1EY4A 1IL2A 2HHHQ 4G57A 4A3BG 4QMGA 4JI4Q 2M2LA 1A6XA 3HKSA 1PXUA 1EQTA 3NQIA 3J7AF 1HA5A 1D1IA 1E2WA 4UDUC 3GTPH 2KQ3A 3S17B 3OHXC 4HJ7A 1AEXA 3G6EA 4DUYQ 2UXBQ 2CCZA 3S2DH 2PPBC 3I4MB 4DV7Q 1F9QA 1TY2A 4KTAA 3EQLC 4I7AA 4JI8Q 3I4NG 1WFQA 1E7ZA 1LTAD 1IKLA 1LTSD 4LFAQ 3MAQA 2GVBA 3OTOL 4QIWB 4QF4A 1HJPA 4RGNA 2BDNA 1LT6D 3PIPA 3LX0A 1VQEA 1ZEQX 2EYJA 5M5XB 4FXDA 3EN2A 4R4CA 1OXSC 2K5VA 5GQOA 2EY6A 1TWAB 5IYBH 4M1UB 2WFWA 1EEID 2WV6D 2UXCQ 4B3SQ 2ATWA 1JB3A 1V43A 1XMOL 1ILQA 2F3WA 4F8MA 4LF7Q 2UXDL 4C3IG 3VR6A 1K9MC 3DMUA 4X64Q 4JI6L 3SR1A 2L1BA 5I2YA 5EKKA 2K5QA 1TU2B 2X6GA 3M4QA 1KAAA 4P71A 2KCCA 5LMUQ 1P16A 5GADC 1K3RA 4OXPA 4B3RQ 3NTHA 1EFID 2B39A 2LSSA 1Y14B 2NZOA 4A3KB 2RSNA 3M4OH 3PO3H 5FLXE 3PO2B 1G6PA 3PUVA 1WTHA 3STBC 4DR3L 3AFPA 3ERQA 5IE8A 5KYIA 2EYFA 1YBYA 2ID0A 3L3OC 4IFDJ 1MKHA 4DR2L 5JPMC 4C3HB 5M3FG 3NQTA 4NDXA 4O42A 4N9PA 5EKLA 4LF8Q 2R7ZB 1JCKB 2RSOA 3DWPA 1VQLA 1JWUD 2Q8IB 1HH2P 1STGA 5IP9G 4DV0Q 4P2CB 2EIFA 1C48A 1IW7D 3Q0AA 3PUZA 3I4MG 1D6EC 1IBKL 2AMCB 2Z8LA 3G48A 4KKSA 1LM0A 4DK1A 1TS4A 2F0DA 3L0OA 1HQMC 2ALYB 3MFYA 1PV4A 4JI7L 4A93G 1V1QA 1KDBA 5G3LD 4KHZA 3EJIA 1HRJA 4RGTA 4GKKL 1Q12A 3AQQA 5DEHA 4RWSC 3GV6A 3H6MA 1VQ6A 1GHKA 2ZXRA 3BG3A 1W3SA 3VYSA 1IBLL 1NCVA 1AFPA 1BBWA 1KRSA 2N49A 4K2LA 4O0AA 3CAMA 2O5IC 2ICIA 4BY1H 3S1NB 1FJGL 5FLXc 4HJ9A 1IYJB 1TWCH 3VYTA 2OQKA 3KFUA 2E74C 2I46A 1XX8A 4GN4B 3SGIA 1E22A 1S5ED 3HRZC 2Z6KC 4MZ9A 4GS3A 1K73C 5EAYA 1DJRD 2E2JB 1BF4A 1XMQQ 1WTXA 1K8AC 1KXLA 3D31A 2MUYA 3MZ5A 3SK6A 4HJAA 3JAMc 4ULLA 4IFDH 2RA4A 1PZKD 1CFMA 1SMYD 3K8AA 3C46A 1CT1D 1EYDA 5J39A 1C8CA 4FO2A 5CBAE 1UE5A 1FD7D 4LF5L 1I4QA 1WTOA 4ZUIA 3HOWB 2K5HA 2NBFA 1AW7A 1VQGA 4JI2Q 4DR1Q 3TRZA 1SROA 1D5XC 4QUFA 3KBGA 3K80C 2A74C 4UY8C 2Q2UA 2NN6H 2B2VA 2K32A 1SFOB 2VS1A 2VY3A 3PO2G 4OIJA 3TBIB 4DA2A 1CQFA 3OOCA 4KY5A 4DV1Q 1Y1VH 5AJ3L 2BE5C 1BBUA 4HN7A 2F0VA 4C3HG 1ESRA 4KY6A 2NVQH 1GKHA 1G2TA 2R7ZG 1K0RA 4HIDA 1JICA 4A3GH 5C4XH 3NWTA 3PSIA 5J1ZA 1FGBD 3NHHA 3SK8A 1SYFA 2R93B 1N33Q 2KEDA 1HR0W 2JA5B 4DV3Q 4J8QA 3S1RH 4L8JA 2YYZA 4JVZA 2QEXA 1VQNA 2DNCA 4B08A 1BCPD 3K58A 2E2IB 1Q90A 1EZ6A 1BR9A 3S15H 1PTOH 5C0XI 4A3BH 4OL7A 2KUMA 2E8GA 3TDQA 3HGBA 1SE4A 4DV6Q 2A5HA 2A68C 4X66Q 1VQPA 1LV9A 1IBMQ 3CC7A 3HOZB 1WTQA 1CTMA 3K0YA 3GTMB 4ID6A 4XIGS 2F52A 1XNRL 3S2DB 4LF4Q 3I4NH 3CCLA 2CQOA 1PH1A 1CZGA 1H9RA 4YHHL 3I4OA 1BVSA 5FLMG 4O1NA 4JI1L 1I5FA 3GTOB 2AQ2B 1CA5A 2JE6I 1HPCA 4BA2I 1B7YB 3GTGB 1J9OA 1F2MA 2IX0A 1TWHH 3AFQA 3CRKC 5BN3A 3CD6A 1TS3A 1ENFA 1B3AA 2ZT9C 3N52A 2EYLA 3PF4A 1B8AA 3HOWG 2CFMA 1PRTF 3I72A 5IGFA 1Y8NB 2JXMB 3M7NA 2VL6A 4XQNA 2ASBA 3CCRA 1STHA 3T13A 2DY7A 4R9WA 3GTLB 2X6LA 3CCMA 4JYAQ 2EVBA 4HTHA 4DR5Q 1G6ZA 3J80L 1HHVA 2JEAI 2FINB 1J8IA 2IX3A 4C3IH 3GP7A 3OYYA 4FF1A 1GVPA 1K3BC 4LUZA 1NSNS 3F8TA 1YHQA 5LMNL 1UAPA 1PRTD 2WP8J 2A69C 1X6OA 2NVTB 4R4IA 1SJHD 1XJVA 2R93G 1K28A 3HG9A 2JA5G 1B1ZA 4IO9A 1YNNC 4QJFA 4OX9L 3IFDA 1I3QB 1N34Q 1GJXA 4L6TB 1UNSA 2K6AA 2OXPA 4KJOA 5CV5A 5D14A 3QJYA 3IFTA 1H9SA 4DK3C 3I73A 3K5OA 3T1YQ 2WAQE 4H02A 2MFIA 2PQEA 2OWOA 1QOHA 4RAUC 4F7XA 5M3FH 2A8VA 4XYOA 2PCFB 3MWYW 2OTLA 2MJ8A 4DAMA 3S17H 5IP9H 2IL8A 3R93A 3HOZG 1STBA 4DV2Q 3BDLA 5CR3A 5DAUA 4A3JB 2G5DA 2PQAB 5ELBA 1YJ9A 3I4MH 1FGUA 3PUYA 4DR7Q 1PH6A 2JQOA 4A93H 3S1QB 1AZQA 1IZ6A 1E2ZA 1N8RC 3E9IA 1ZXTA 2HT1A 5J22A 4XXEA 3DM3A 2DJGC 3TQYA 1PLFA 4NXNL 2WACA 5JEAG 1VQ4A 1WTRA 3NEMA 5M5YB 2V1CC 3I56A 4DXFA 2VB2X 5KNCA 2HIXA 3R2TA 2F0TA 5M5XH 1PYBA 2ZTCA 1I4RA 5I9PA 3HOXB 1TWAH 3ULJA 4DV5L 2P5ZX 3RUZA 1CKNB 4A3DB 1FR3A 4X3TA 1DD2A 5HURA 2Z4IA 3S14B 4JV5Q 4PQXA 1Q81C 1R9TH 4BY7H 1MHWC 1GUTA 2K04A 1EL0A 2EYOA 2AHOB 1SNPA 1E1OA 4ODGA 2EY5A 1S40A 3CCSA 2K05A 1YHAA 2JA7B 1N9WA 2Z0SA 3LWEA 2MPMA 2F0JA 4B3MQ 2B2TC 2ES2A 2K33A 5E4XA 3KDFB 2K5NA 1FVIA 4QGUA 5ELEA 2RBMA 1N36L 1K8MA 3K59A 1T5EA 3PO2H 3K0XA 4L5RC 5A2QL 2NZ1D 2QILA 1KL9A 1CK1A 4GOPB 5DLQE 3T1HQ 2E76C 1KIXA 4C3HH 1F9PA 1QVGA 1WD0A 2CWAA 2R7ZH 3I90A 1VQCA 4DUZL 5TSSA 5JVH3 2Z6KA 3NP8A 3F2UA 4CDDC 2AKWB 5DM63 1VQJA 1Z9FA 4A3JG 4C1NK 3U4ZA 1ENCA 2R61A 3K5NA 3SK4A 4GKJL 3RZOB 1IYUA 3W1GA 3CC2A 3NE5B 2L0CA 4H13C 2FMMA 4X3SA 3I70A 1LABA 4P75A 3HOVG 1I94L 1XPUA 4RCNA 2NB0A 1AE2A 3PMFA 2OEOA 2HCIA 1G91A 2IPKD 5C0XJ 5CMDA 1RD9D 1VMPA 1WI5A 3HOXG 4DNRB 4BA1I 3RZDB 3L7ZC 4A3DG 4KHPL 1PYSB 2JSOA 3MEHA 4LF9L 5DM73 5LL6X 4NP5A 5C4HA 5FLMH 2UUBQ 5IWAL 1VQBA 4JW0A 3AU7A 1FNUA 5CV6A 1TXYA 2KCMA 1CZWA 4XDXA 5IGGA 3J7ZC 3RD4A 2DY8A 1ET6A 4JBJA 4IFDG 2J0TD 3HOWH 2Z1CA 5I6WA 5M3MB 1XPRA 4KI0A 1QUQA 2JA7G 2EXDA 1EY0A 4DPGA 4DV4Q 3KJOA 4YY3Q 1QVFA 1PYWD 2F0NA 1BOSA 2R7DA 1A3TA 2NWGA 1KDAA 5JOBA 1KC8C 4NB3A 1SFOH 1BKBA 3S16B 5IOCA 3GTKH 2K14A 3RN5A 4JBWA 1SAPA 1A15A 2JEBI 5BN4A 4OWWB 1M90C 1EYGA 1PH9A 3QR8A 1FNWA 1AZPA 2ZXPA 4X65L 4DR4L 4K8IA 4G7HC 2JA5H 3PF5A 4L5SA 1IHZA 4CJ0B 2A73B 1T5XD 1O7IA 2SDFA 3A8KE 4JI5Q 2Y0SB 4K5XA 1X56A 2UUAQ 3L2PA 2E2IH 1K8OA 3ND9A 4JBMA 4DFAA 1FYCA 1JOOA 4KKTA 1QVCA 2B2UA 2K52A 1VQ7A 3ND8A 5BR8L 5C3XA 5M3FB 4HCSA 5I6YA 2RCNA 1NMFA 3U9SA 2PNRC 1Q3LA 3HOZH 3QIAA 1MGSA 4JI4L 1VF7A 3GTMH 4DK0A 2UU9L 1R4QB 5C4ZA 3A54A 1HNWQ 3OMGA 1MBYA 2RCFA 2DUDA 2MP1A 1F77A 4DUYL 1WTWA 2DN8A 1HR0L 2UXBL 4A93B 3GTOH 4DV7L 2ZJRA 1ASZA 4BWGB 2F0IA 2K1BA 3AB9A 1L1OB 5JEAH 3GTGH 2RVLA 3S2HB 4N8X1 3CHBD 2F0PA 2N8NA 2PZUA 4LFAL 2B2WC 1RTOA 3HKZB 5M3MG 2EXZA 2OT2A 3FPPA 1B4OA 4XT3B 5E3FA 2TSSA 1ENAA 3CRLC 3BS1A 5BN5A 3OTOQ 3GTLH 2HQLA 4IOAA 4MTKA 4UAIA 3K81C 1HZBA 4IUUA 4PNYA 3RLOA 4TQUS 1DGSA 3JAML 4BY7B 4IUTA 1R9TB 4JCVE 1X3PA 4YWLA 2UXCL 3E6ZX 5EPJA 4I65A 2ZJQA 2CH4W 2VZAA 1IYVA 2D62A 1XPOA 2ZTEA 1GUOA 4LF7L 3IL8A 5FO8B 1B44D 1DCZA 1QE6A 1XMOQ 4PMWA 4IURA 1LT3D 2F03A 4X64L 2UXDQ 2EQSA 4ABNA 2YTXA 4CDCC 3R3OA 2NVTH 3E9HA 1STYA 5C3EB 4FVMA 5JJIA 1PH2A 4MTNA 2B3GA 1E3PA 4B3RL 1EIFA 1CI3M 1F9SA 1I3QH 5IYCG 1PFSA 2Y0SG 1X55A 4GN3B 1NNXA 4G7ZC 1PH4A 3M3YB 5G3LF 2M00A 3PIP3 4ME5A 1HZ9A 1Y8OB 2GVAA 1D8LA 1PRTB 3A0JA 3V96A 2EYHA 1YZ6A 2Q8TA 1SYEA 4CDFC 1H9JA 4ZK9B 5JPNC 1EIHA 2LXJA 1LYLA 1XXGA 2K75A 3RLNA 4A3JH 2R92G 4PZ8A 4LF8L 4TKOB 5IODA 1U4RA 1EEFD 2XSCA 1SMXA 1CA6A 1GUNA 3S1QH 2YV5A 4DV0L 1PA6A 1CKNA 1WTVA 2BH2A 3M9BA 3ITPA 2F0LA 4H7BA 2UUCQ 3NELA 1PTOD 5HGQA 3PCOB 2EPBA 1XWEA 3NUCA 2FHTA 4BXXG 3HOVH 1A3VA 2B2TA 4ZKCB 4MN3A 3M4PA 5M5YH 4DKAC 4KHVA 2PZTA 1E0BA 1C9OA 2XVSA 2L15A 3NXWA 4ILWA 3CW2C 3F2BA 1RL2A 4JI7Q 1FL0A 3HKZG 2PW5A 1BNZA 5GAHC 3A8JE 3EIVA 5E7NA 1NR4A 1C0AA 3A56A 3M85A 3HOXH 4K6LA 4V190 4K14A 4FP5D 5C4JB 4A3DH 2D0OA 3S14H 4POGA 1SEBD 1I4HA 1LACA 5C5LA 4GZYC 1FJGQ 3E5SA 1NBWA 4BY7G 5ISRA 1PH7A 1TWGB 4JI0Q 2XNAC 2EYPA 4IUNA 2ZXOA 1EQQA 1YNXA 4CJ2C 2QKIC 4CBVA 2JA7H 2F4VL 1SNOA 1OXXK 1JB7A 4EQPA 4GNXB 5C3EG 2EJFC 4DR6Q 2SNSA 4NXMQ 4DR1L 3KLRA 2L9HA 3PGZA 3CF5A 4CKBA 1BCPF 3G4SA 1LT4D 3DWAA 3GTKB 2N88A 3BJUA 4GNXC 4WJ4A 1EOVA 3KF6B 5ELFA 2DNEA 4EQ5A 1MIUA 2BH8A 1NMGA 1SE2A 2KA7A 1A62A 1Q8IA 3QO2A 4DV1L 2SOBA 2VQFQ 4RHRA 1WJJA 3RNUA 4WJ3M 4LMQD 4JI3Q 3N6RA 5C5MA 4PZ6A 3KF8B 2NTTA 1EOTA 2G9DA 4ZUJA 3TP7A 3RZOH 3H3VI 3GO5A 1K0SA 1S5FD 1KABA 1GUGA 1SYDA 3LWUA 2AWNA 3CU7A 3P7JA 1QNUA 2B8FA 1UUPA 3TS2A 2HDLA 1EYAA 1ICWA 2Y0SE 1EQVA 5KNDA 2B8GA 4CGYB 3UDGA 2JK8A 1MJCA 3BZKA 2IHFA 1DXMA 2BCOA 3OMCA 3RZDH 3IRBA 4X66L 1QZGA 1KHIA 3P75A 1IBML 4OELB 2MO1A 1I6VC 1GOZA 3Q6SA 3ICEA 3MXGA 5IT9L 1UE1A 2LY7A 5AFWA 1HA6A 1U4LA 1HNZL 1IXRA 4LF4L 1VQ5A 4V0BA 4G7OC 2PZWA 4HAEA 1XNRQ 1RDPD 5CGKA 5K5PA 2FMCA 1MI2A 4R4QA 5M3MH 2N78A 2I07B 4FF2A 4PG3A 4FXKC 3DLLA 4XYQA 3BVGA 3HOYG 4JOIC 1KNEA 1WYDA 1LTLA 1VCIA 4L5QA 2Q8RE 2D9UA 2Z6BA 2B2UC 4LFCQ 2L11A 4QIWE 3WWVA 3H91A 1X54A 2WKDA 1W6KA 4IPGA 1SLJA 3MXNB 4HMJA 1YNJC 2Z4HA 3M4YA 3HKZE 1O7LA 3S16H 4HJ5A 3W3AA 2KECA 2QF7A 3BZCA 3KJPA 1J5EQ 3FEWX 2PW7A 4JYAL 4R8IA 3TZUA 1WTPA 2EE1A 2OQ0A 3TSSA 1JT8A 1LLRD 2K28A 1B53A 1AH9A 1W2BA 1O7YA 3MFGA 2JN4A 2H1EA 3FKIB 3BZDB 1Q46A 3STBD 4KLKA 1XTDA 1CHPD 2WINB 3J81L 5C0XG 4IALA 5KGUA 4YWMA 5FO7B 1B2TA 1OO9B 4X62Q 1OXTA 5IYCH 1B9NA 2XRQD 3DXJC 4PZ7A 3CQZB 4LUVA 5CV7A 4QL5A 5LMNQ 1D5ZC 2B2WA 2EDGA 3Q24A 2E5LQ 4DXGA 4CKCA 3CXCA 1EU4A 1H9KA 4OIKA 5CC4A 1U4MA 2ZM6L 1U4PA 1ZYRC 2SEBD 2PO4A 4OO1I 4K0KL 3C1EA 1S5CD 1HCZA 2VW9A 3OW7A 2R92H 5ELDA 2LXKA 5LHY1 4O2DA 3L9AX 1ESFA 3HOUH 3CP0A 4YCWA 1TWFH 5M5WB 1OXUA 3VDYA 5IYDG 4KK7A 1JR0D 4DV2L 2NYZD 1B9MA 4L63B 2R3ZA 1QJOA 1WCMB 2JJQA 4DR7L 4QQBX 1NAPA 3FVQA 3J80i 4BXXH 1JE4A 2A1AA 3S2HH 1JQYD 2XWJB 3K7UC 3DEOA 3IKJA 3J80E 3HOVB 4AYBB 4LWCA 1U5KA 1T9HA 1X3FA 1I4XA 2JA8B 5H1SE 1HZAA 1N32Q 3Q8DA 4LK1C 3GTJB 1HTPA 3S24A 1D7QA 3TMEA 4XQQA 3VYRA 4DNIA 2WKCA 4RGOS 2CW0C 3I7FA 3X3NA 2Q2IA 1K83B 4JV5L 3VR2A 4ZRZA 2IJ0A 3H94A 1LTID 4LF6Q 3RR5A 3FKIG 4QY7A 1P8LA 1O78A 4CHTB 4EQOA 2VQEL 1PDQA 5C3EH 1Q1EA 3HFZB 3VR5A 1HNXQ 2BE5D 3VYUA 1RF2D 1KTKA 3PIOA 5JVG3 1PFNA 2BDOA 4B3ML 2RDHA 4KKUA 1AP0A 1PH5A 3D3RA 2IY5B 1YJWA 4OO1G 1O7ZA 2V4DA 3M3YH 1JC7A 4LUOA 5KIXA 2NVYB 3FMCA 4RG1A 3MXPA 1N36Q 1RKNA 3TP8A 1F2LA 1YVCA 4HCEA 4J15A 1PMRA 1K8GA 5CORA 2IW3A 3T1HL 2HQEA 5L37A 4XQJA 1XNQL 4A3CG 1J6QA 1SNCA 4A3MB 4GOPC 3U4VA 2A68D 1BO0A 3GV3A 1WCMG 1V1PB 4JG2A 5IP7G 1BQQT 4A3LG 2K50A 5M9OA 1II3A 2NN6I 4QUCA 5KYLA 2AQ1B 4HIOA 1KAWA 1E2VA 1M1KC 4AYBG 1LO5D 3OIPA 3HZXA 1DM0B 4FF3A 1SYBA 4GKJQ 5EKIA 4K6DA 2JA8G 4K2KA 4NMZA 5IGEA 1I4PA 5NUCA 4RCOA 2XN9C 1SJED 3HS0C 4IUPA 2F0MA 3DWQA 5C4JH 1DOKA 1I94Q 4GNXA 1EY7A 2YTYA 1TKWB 3A55A 3PQIA 1SN8A 1YEZA 3E3XA 2QW7A 1H9MA 1HQRD 3H09A 2AWOA 4ALPA 1S4ZA 1IW7C 4J6HA 5FOBB 1TWGH 4Y7NB 1FNVA 4IJHA 2EY1A 1BUVT 1YNJD 3MEFA 2FXQA 2KEEA 1X32A 5A2QE 3DM1A 3CCUA 3VR4A 3MA2B 1VQMA 4LF9Q 2F3VA 4XTCS 3KF6A 3KYHC 4ZLTF 4L5TA 4U673 3HOYH 4BBSB 4FXGC 2DJFC 2EZVA 2O5JC 1NR2A 3UDIA 3DEPA 4DV4L 4P72A 2A69D 4KMUC 3KF8A 1SE8A 3NENA 2E75C 1UEAB 1YNND 2K5DA 4HSPA 4ZKBB 1EWHA 3H3VH 1C4QA 3D6CA 4OONA 4YWKA 4CDEC 2E2HH 2PI2E 2HDMA 3BDCA 3I91A 2ENBA 1Z7TA 2VUMB 5C0XH 4LFBQ 3TS0A 2C5CA 3W5OA 3DUZA 1SMYC 1VQDA 1SNQA 4TVAB 2F0GA 4AQYQ 4A3MG 2Q2TA 4KJNA 1Q8KA 3SVMA 3F1ZA 3UE0A 3A7AB 2QEJC 4KN7C 3FRPB 3A74A 1LTGD 3Q22A 1JWSD 2MHVA 2F3IA 3AYHB 4HMIA 4KN4C 3X3MA 1G51A 1PZID 4B3TL 1SNDA 4JOIA 1DOLA 2L4NA 3FDTA 3I3CA 2M9VA 4JI5L 3SHLA 2UUAL 2I5HA 1YJNA 3BYTB 4RFBA 3C2PA 2HHHL 2C9OA 2Z9HA 3MVVA 4JK1C 5COYA 4C3JB 2R92B 4R1JA 3HOUB 5IYDH 1TWFB 1BCPB 1I50B 2G9HD 3QOLA 4B9XA 3TP5A 1X3EA 2PMZB 2B63B 5EBCA 2J4XA 3MXNA 1HNWL 2PI2A 3R2IA 4NPSA 5KNBA 2UU9Q 5GAEC 4JI8L 3U50C 3CCQA 4PMBA 5LL6S 1NUCA 2LS01 1QILA 2R6GA 2XIWA 1BCPC 1BBXC 3D0FA 3UDXA 1HR0Q 2CW0D 5FLXL 4QCLA 2EJGC 4EQNA 3D4RA 4BBSG 2F0WA 1Y1WB 2JYOA 1JWMD 1NJIC 5D3DA 1H9SB 1PZJD 3SXHA 1KLUD 3CCVA 4DAPA 5C44H 4AYBE 3T51B 3QG1A 1L1OC 2CVRA 3D6WA 4OHJA 4BBRH 2MQHA 2Q2HA 4A3FB 1VMCA 2NVXB 1HTLD 4G4KA 3P20A 2GN5A 1BXTA 1HXYD 4B3SL 4I7ZC 4JPBW 1EUJA 1ASYA 3NBIA 1EQRA 3GD7A 3FKIH 3CCEA 1SE3A 3H0GG 5E1FA 5I9OA 2VUMG 3VR3A 1RTNA 3B6YA 4POFA 4C1NI 4JI6Q 2N3SA 5LMUL 3W1BA 5CV4A 1JJGA 2MNAA 5J3BA 1HUMA 2PQAA 3CQZH 3I4LA 4OO1H 3SEBA 3OW2A 5IGBA 4RMFA 1NTGA 1VQFA 4HIKA 1Q7YC 4IN3A 4WJWA 2EOTA 4IZ8A 4P73A 3NK9A 1O80A 1PTOF 4YCVA 4C2MB 4K8JA 5FJ8G 4X3UA 1CHQD 1HFGA 3LNNA 4ZCKA 2WAQB 1X3GA 2PNHA 3KOJA 2OTJA 5E4WC 1S72A 4DR3Q 1MSGA 3EROA 3CMEA 3A5UA 1X9NA 1AE3A 4A3CH 4C3JG 1EU3A 1JJCB 1VS0A 5M5WH 4LAAA 4DR2Q 1JOQA 3HOUG 1EY6A 1MD2D 2VB3X 3LGJA 1QCBD 5GAGC 2MO0A 3SDZA 3CCJA 5GROA 1PRTC 5I2XA 1WCMH 1WOCA 4FDBA 3RN2A 5JJLA 2B63G 5IP7H 4PMCA 4A3LH 1DONA 4YCUA 3JAMi 4UP7A 3QB3A 1OXVA 3K7AB 5D65A 5CV8A 4IQZA 3JAME 1IBKQ 2UUCL 3K57A 2F0SA 3KK7A 1A8VA 1A63A 1V8QA 1U0LA 2B2YC 3KLWA 2JA8H 3H15A 3J7AV 1Y1WG 3MTSA 3PUWA 1D5MC 1R4PB 3ZJYC 2YU9B 4DAVA 4LW1A 2JA6B 4GKKQ 3M7GA 3GTJH 1TQOA 1D1KA 1BDOA 1OTCA 4BS9A 1PH8A 1EWIA 2XRSD 1RJTA 3KDFA 1IBLQ 1F2YA 5K36G 5JJZA 5KRUA 2A19A 3I2ZA 4A3FG 3GTQB 3ULLA 2I5LX 1D2BA 1SRUA 1K83H 1XYIA 2NTSA 1IKMA 3CKIB 1YHBA 4RA8A 1XMQL 4GOPA 4A4IA 4OGQC 2AUKA 2F4IA 1VQ8A 4JI0L 3FHWA 4RGMA 1JJ2A 4DK6C 2F0QA 4EX5A 3S1MB 1YIJA 3HOYB 3ER0A 5FKAC 3OPOA 2RKSA 3CMAA 2WB1B 2HCCA 3NBHB 4MHEA 2KCNA 1H95A 2OF1A 4Z9CB 1L0YB 4JI2L 4LF5Q 3HEJA 2H4OA 2F4VQ 2J7ZA 2KHIA 4DR6L 1A3UA 2A6EC 4NXML 3KLSX 1CKMA 2NVYH 1V1PA 4IOCA 2K7VA 3SK5A 4GLXA 1CSPA 4K5WA 1JORA 2OCEA 2WAQG 2E2HB 1DYQA 1Q1BA 1VQHA 4A3KG 3K5LA 2IWHA 5F2DA 2K03A 2HUGA 3RMHA 3FPUB 4DAYB 4AH6A 1NY4A 1UE6A 4KD3A 2FFKB 1TS5A 4A3MH 1KQSA 4S3SA 2QDBA 5AJ3Q 1E24A 4RHSA 2YTVA 3GQBA 2VQFL 4H0LC 3DHQA 1EY8A 4RH6A 4A3EB 3PV0A 1SYGA 2BOSA 1N33L 3H3VC 4FNFA 4JI3L 2WIIB 1TS2A 1QUQB 4DV3L 2F0OA 1STNA 5A35A 2EY2A 5DNFA 3E0JA 1WD1A 3EA6A 5HY6A 1VDZA 2KVMA 1TT2A 4A3IB 3NWSA 3G7LA 1HFNA 4WRDA 1Y8PB 1EY5A 1KDCA 4DV6L 2JA6G 1ONLA 3S9WA 4E6IA 5CBEE 1V1OA 3TEHB 3UDFA 2KHSA 1C7YA 3U9OA 5EJWA 4CJ1B 2DGYA 4Y7NH 4IPHA 5T1IA 3AEVA 1QWYA 5KEEA 1B70B 5CYUA 4KY7A 1CQVA 4TRDA 3GTPB 3A7LA 1CKOA 1STAA 2F0UA 2PMZE 2HD3A 4YHHQ 4DNTB 1HNZQ 5ELNA 5CV9A 3QWNA 4BBSH 4DGZA 4EVOA 4KV6A 4JI1Q 3K5MA 4APVA 3BU2A 3EVQA 4QB4A 2R7FA 4JC0A 3NSWA 2RQXA 2CWPA 2QDLA 4R8NA 5EPKA 1B50A 3V2TA 2WB1G 4ZQ3A 1QG7A 1Q86C 3JC66 5C44B 4Q5VA 2L5TA 2E2DC 1UE7A 1DOMA 2SNMA 3W2DA 2ZJPA 2QA4A 2MGSA 4LFCL 1STEA 3F2CA 4BBRB 1F2ZA 2F0FA 3U58A 3V05A 1G8ZD 4N8FA 2N55A 4DR5L 1ILPA 1KNAA 5IIFA 1VQAA 1LTTD 2NUCA 1J5EL 2CKZB 2IT1A 1QNKA 3H0GH 4H44C 3I8ZA 1EWCA 1TR5A 4GN5A 4F88A 2VUMH 1SBBB 1I6HH 3AMUA 3MXUA 5HGTA 1Q82C 2L55A 4R4OA 4ZAIA 3RLFA 1EIYB 1Z6HA 4LJZC 2BA1A 1CM9A 1RODA 2KENA 3OIQA 3OWEB 2XWBB 1RHPA 3D8GA 4A3EG 1W6JA 1MSHA 2F1MA 4HSVA 1PVOA 1HUNA 2QCPX 2QGQA 3NTKA 1S3OA 4X62L 1N34L 4TSSA 1IL8A 5FJ8H 4N9TA 5IT9E 1GM5A 2K5WA 4OX9Q 1L1OA 2E5LL 3GDEA 2C35B 3T1YL 4A3IG 3EBEA 4M8AA 1YITA 4GLVB 5JAVA 3D4DA 2RHQB 4C3JH 3UE1A 2D5DA 3ERSX 2A6HC 5EQ0A 1EZ8A 3M4OB 3ZYYX 3QOJA 4IPCA 3PO3B 4CKEA 2KBNA 1I50H 2ZM6Q 3VA7A 5EGTA 2EYMA 2B63H 5T1GA 1M8AA 4IUVA 4K0KQ 2GA4B 2H5XA 3ONAB 4UP9A 3OSOA 2PYKA 5IGDA 4K5VA 2L12A 4DU9A 2IX1A 3J81j 3TZDA 1L0XB 4UHVA 1LUZA 4OWTB 4A76A
chains in the Genus database with same CATH topology
5C4XH 5JJKA 3KF6A 3PSIA 4A75A 3KYHC 4X64L 1QZHA 2UXDQ 2EQSA 2I5MX 4L5TA 2NVTH 2YTXA 3E0EA 3HOYH 2D0PA 3E9HA 1N33Q 2XGTA 1Y1WH 1HR0W 3F2DA 1RIPA 5JJIA 4DV3Q 1VQKA 1V9PA 1PH2A 4MTNA 3S1RH 3J81i 2B3GA 2YYZA 1E3PA 2QEXA 1EIFA 1I3QH 3UDIA 4NXNQ 4B3RL 1VQNA 5IYCG 4DV4L 1PFSA 4P72A 5C44G 5IT9c 2Y0SG 1X55A 4GN3B 3S15H 1SE8A 5C0XI 4A3FH 1PH4A 1N32L 3PUXA 2NVXH 4BBRG 3J7A5 4A3BH 1HZ9A 2GVAA 3NENA 1D8LA 2E8GA 4DV5Q 4DV6Q 3A0JA 2VNUD 1YZ6A 2JA9A 4X66Q 1VQPA 3H3VH 4OONA 4YWKA 4HIMA 2PI2E 2E2HH 1IBMQ 3CC7A 4LF9Q 2LXJA 1LYLA 2K75A 4XIGS 3RLNA 4A3JH 3TS0A 4LFBQ 2R92G 5IYBG 4PZ8A 2F52A 3W5OA 4LF8L 1XNRL 1VQDA 1A0IA 4TVAB 4LF4Q 1SMXA 4A3MG 4AQYQ 2Q2TA 4LF6L 3I4NH 1Q8KA 3CCLA 3F1ZA 2CQOA 3UE0A 2YV5A 4DV0L 1PA6A 1PH1A 3S1QH 4YHHL 3I4OA 1BVSA 5FLMG 1CKNA 4JI1L 3M9BA 1I5FA 4IJLA 3J80c 1HNXL 3A74A 4AIMA 1VQ9A 2UUCQ 2VQEQ 2JE6I 3NELA 5HGQA 3PCOB 2F3IA 1B7YB 3AYHB 4BA2I 2IX0A 4BXXG 1G51A 3HOVH 4B3TL 1TWHH 4JOIA 4IPDA 4C2MH 3AFQA 3M4PA 5M5YH 1PHJA 4DKAC 4JI5L 2UUAL 3CD6A 4JYAL 2WB1E 3PF4A 2I5HA 1C9OA 1B8AA 2L15A 3F2BA 1YJNA 3CW2C 3HOWG 1RL2A 2CFMA 1FL0A 3HKZG 4JI7Q 5GAHC 5E7NA 2VL6A 3EIVA 4A3KH 2HHHL 2ASBA 3M7NA 3CCRA 1C0AA 3J81c 3M85A 3HOXH 2BH2A 1X65A 4MNOA 3CCMA 4IFDI 4JYAQ 4A3DH 4R1JA 2RF4A 2D0OA 4DR5Q 4UP8A 5IYDH 1EFWA 3PO3G 3S14H 4POGA 2JEAI 1X3EA 4C3IH 1FJGQ 1NBWA 4DUZQ 3OYYA 4BY7G 1HNWL 1PH7A 1VQOA 4JI0Q 2PI2A 4P74A 4NPSA 1GO3E 4ME3A 2UU9Q 1GVPA 3FP9A 5GAEC 4JI8L 1XNQQ 3U50C 3K7AH 3CCQA 2KCTA 1EQQA 1JMCA 1YNXA 4LUZA 3F8TA 2HIVA 1YHQA 2R6GA 4UPAA 5LMNL 2WP8J 3D0FA 3UDXA 3G71A 1HR0Q 2F4VL 2JA7H 1X6OA 4R4IA 4Y52H 1OXXK 1XJVA 1JB7A 2R93G 4GNXB 4BBSG 1L2FA 5C3EG 4X6AH 1NJIC 2JA5G 5IY0A 2YU9H 1E1TA 1Z47A 2BA0A 2KHJA 4IO9A 4QJFA 2JA6H 4OX9L 3CCVA 3CPFA 5C44H 4AYBE 4DR6Q 3CPWA 1L1OC 1N34Q 4NXMQ 4DR1L 1KD1C 3PGZA 3CF5A 2B29A 4BBRH 1L0WA 2MQHA 3G4SA 4DK3C 3T1YQ 2Q2HA 2WAQE 3GTQH 1NE3A 4H02A 1VQIA 3BJUA 4GNXC 4WJ4A 2GN5A 2MFIA 2OWOA 1EOVA 3KF6B 4PMWA 5M3FH 4B3SL 1G291 2A8VA 2I0QA 1EUJA 4EQ5A 1MIUA 1ASYA 2BH8A 1NMGA 1EQRA 2OTLA 2UUBL 3S1NH 1A62A 3GD7A 4DAMA 3FKIH 3CCEA 4KHPQ 3S17H 5IP9H 4DV1L 4BY1G 3H0GG 2VQFQ 4OWXB 2IHEA 4LNQA 3HOZG 4DV2Q 5IWAQ 3S1MH 1JE5A 1WJJA 1A63A 2VUMG 3RNUA 1VQMA 2PQAB 3B6YA 1YJ9A 3I4MH 4DR7Q 1FGUA 3PUYA 5ELOA 4WJ3M 1CUKA 4POFA 1YI2A 1PH6A 4JI3Q 2E2JH 2JQOA 4PZ6A 4JI6Q 2N3SA 2XTIA 3KF8B 5LMUL 4A93H 1UWVA 3W1BA 3RZOH 1IZ6A 1JJGA 2MNAA 1N8RC 3GO5A 1SR3A 3CQZH 2PQAA 3E9IA 5J3BA 2HT1A 3H3VI 3OW2A 4RMFA 2AWNA 1NTGA 1VQFA 4YY3L 3DM3A 3TQYA 5LMNW 4HIKA 1Q7YC 4P73A 4NXNL 5JEAG 1VQ4A 4YCVA 1KRTA 3NEMA 3TS2A 2V1CC 2K4KA 3I56A 5FJ8G 2HIXA 5M5XH 2Y0SE 1PYBA 4R4TA 1UEBA 1X3GA 2PNHA 2ZTCA 3KOJA 3UDGA 3CC4A 2JK8A 1MJCA 2OTJA 3BZKA 1S72A 4DR3Q 1TWAH 2IHFA 3ULJA 3A5UA 3CMEA 4DV5L 1X9NA 1AE3A 4A3CH 4JBKA 3RZDH 2RHSB 3IRBA 4X66L 1QZGA 1CKNB 1JJCB 1GD7A 1KHIA 1VS0A 5M5WH 4DR2Q 1IBML 2NN6G 2MO1A 3HOUG 4JV5Q 3LGJA 5GAGC 2MO0A 1R9TH 2ZTDA 3A5ZB 5GROA 3CCJA 1Q81C 3ICEA 4BY7H 1UE1A 1WCMH 1WOCA 4FDBA 5JEAJ 3RN2A 4LFBL 3I55A 1IXRA 2NZHA 4A3EH 1HNZL 2B63G 5IP7H 5JJLA 4LF4L 3ULPA 1CSQA 4AQYL 4YCUA 1VQ5A 4A3LH 4X65Q 1Y1VG 4DR4Q 3JAMi 2AHOB 4GLAC 1E1OA 4UP7A 1OXVA 1XNRQ 1S40A 3CCSA 4HJ8A 1IBKQ 2UUCL 1MJEA 1HZCA 4R4QA 4A3GG 5M3MH 1YHAA 2N78A 2R93H 5C4XG 1N9WA 1A8VA 2Z0SA 4PG3A 1U0LA 3KLWA 3DLLA 3TREA 4A3IH 4B3MQ 2JA8H 4JOIC 3HOYG 2ES2A 1WYDA 1LTLA 1VCIA 3KDFB 4L5QA 3H15A 1PH3A 1Y1WG 3PUWA 2K5NA 1FVIA 3ZJYC 4LFCQ 4QIWE 4LW1A 4QGUA 3WWVA 4B3TQ 4GKKQ 1N36L 3GTJH 1X54A 1OTCA 4IPGA 1SLJA 1EWIA 3MXNB 1PH8A 3PO2H 3K0XA 3HKZE 3KDFA 1IBLQ 5BR8Q 4L5RC 3S16H 5K36G 4HJ5A 2A19A 1KL9A 1IL2A 3BZCA 3I2ZA 3KJPA 4GOPB 4A3FG 4HIDA 1J5EQ 2HHHQ 5DLQE 4A3GH 4A3BG 3ULLA 2I5LX 4JI4Q 3HKSA 3T1HQ 1SRUA 1K83H 2OQ0A 1KIXA 4C3HH 1JT8A 1QVGA 2CWAA 2R7ZH 1AH9A 1W2BA 1VQCA 1YHBA 1XMQL 3GTPH 4GOPA 3STBD 1Q46A 4DUZL 4KLKA 2Z6KA 4A4IA 1XTDA 4HJ7A 1VQ8A 3FHWA 4JI0L 1JJ2A 4DK6C 3G6EA 4DUYQ 2AKWB 4EX5A 2UXBQ 2CCZA 1YIJA 3S2DH 5C0XG 1VQJA 1Z9FA 3ER0A 4A3JG 4DV7Q 3U4ZA 4YWMA 4JI8Q 3CMAA 3I4NG 3NBHB 1WFQA 1H95A 1E7ZA 4X62Q 1OXTA 5IYCH 4GKJL 3CC2A 3W1GA 4PZ7A 4LUVA 5LMNQ 4QL5A 4LFAQ 4JI2L 4LF5Q 2F4VQ 2GVBA 3OTOL 2E5LQ 2KHIA 4DR6L 1HJPA 4P75A 4NXML 1I94L 3HOVG 1XPUA 1CKMA 3CXCA 2NVYH 3PIPA 1AE2A 4IOCA 1VQEA 2ZM6L 4GLXA 1CSPA 3EN2A 5C0XJ 2OCEA 2WAQG 4R4CA 4OO1I 1OXSC 1Q1BA 2K5VA 1VQHA 4K0KL 4A3KG 1WI5A 5GQOA 2VW9A 3HOXG 2R92H 5IYBH 2LXKA 4O2DA 4DAYB 2WFWA 4AH6A 1NY4A 3CP0A 4BA1I 3HOUH 1UE6A 4A3MH 4YCWA 1KQSA 1TWFH 2UXCQ 3L7ZC 4B3SQ 2ATWA 4A3DG 5AJ3Q 1V43A 1E24A 1PYSB 1XMOL 4KHPL 1OXUA 2YTVA 2VQFL 4LF9L 3VDYA 5IYDG 5FLMH 4DV2L 2UUBQ 5IWAL 4LF7Q 2UXDL 2JJQA 4DR7L 1VQBA 4QQBX 3PV0A 1K9MC 1N33L 3J80i 4JI3L 4X64Q 4BXXH 4DV3L 1TXYA 1QUQB 2A1AA 2KCMA 4JI6L 3S2HH 3K7UC 3J7ZC 4JBJA 4IFDG 3M4QA 4P71A 4LWCA 5HY6A 3HOWH 5LMUQ 1P16A 5GADC 1XPRA 4KI0A 1U5KA 1K3RA 4OXPA 4B3RQ 1QUQA 1T9HA 1X3FA 2JA7G 2EXDA 5H1SE 4DPGA 4DV4Q 3KJOA 1HZAA 2LSSA 4YY3Q 1Y14B 1QVFA 2NZOA 1N32Q 3Q8DA 2R7DA 4DV6L 2JA6G 3M4OH 1KC8C 4NB3A 3S24A 3PO3H 1D7QA 1SFOH 1G6PA 3TEHB 3PUVA 1BKBA 3STBC 4DR3L 3UDFA 3AFPA 5IE8A 3GTKH 2K14A 1YBYA 1C7YA 4DNIA 3RN5A 2ID0A 4IFDJ 2DGYA 1MKHA 4JBWA 4Y7NH 3I7FA 4IPHA 4DR2L 2Q2IA 3AEVA 4JV5L 2JEBI 5M3FG 1B70B 4OWWB 4LF8Q 1M90C 1EYGA 1PH9A 1VQLA 4LF6Q 3RR5A 3FKIG 4QY7A 1CKOA 1HH2P 1P8LA 5IP9G 4X65L 2PMZE 4DV0Q 4DR4L 2EIFA 4YHHQ 2VQEL 1HNZQ 5ELNA 4BBSH 5C3EH 1Q1EA 3HFZB 3PUZA 4JI1Q 3BU2A 4APVA 1HNXQ 2JA5H 3PF5A 3I4MG 2R7FA 4L5SA 1IBKL 2AMCB 4JC0A 3G48A 1LM0A 2CWPA 3PIOA 2WB1G 3L0OA 1Q86C 2ALYB 3JC66 1PV4A 1O7IA 4B3ML 4JI7L 4A93G 4JI5Q 2UUAQ 1X56A 1PH5A 2IY5B 1YJWA 1UE7A 3L2PA 2E2IH 4OO1G 1V1QA 2ZJPA 2QA4A 4KHZA 3F2CA 4LFCL 4JBMA 3M3YH 4GKKL 1Q12A 3U58A 3AQQA 1QVCA 1VQ6A 2K52A 4LUOA 4DR5L 1VQ7A 4RG1A 1W3SA 1IBLL 5BR8L 1N36Q 1BBWA 1KRSA 2N49A 1VQAA 1YVCA 4O0AA 2RCNA 1NMFA 1J5EL 2CKZB 2IT1A 3CAMA 4J15A 4BY1H 3H0GH 1K8GA 1FJGL 3HOZH 5FLXc 4HJ9A 4JI4L 1IYJB 1TWCH 4GN5A 2OQKA 3T1HL 3GTMH 3KFUA 2VUMH 1I6HH 2UU9L 1XNQL 4A3CG 1J6QA 4GN4B 3SGIA 1HNWQ 1Q82C 1E22A 4GOPC 4R4OA 4MZ9A 2Z6KC 3RLFA 4GS3A 3U4VA 1EIYB 1K73C 2BA1A 2DUDA 5EAYA 2KENA 4DUYL 1XMQQ 1KXLA 1K8AC 1HR0L 2UXBL 3D31A 3GTOH 1WCMG 4DV7L 2ZJRA 4A3EG 1ASZA 4JG2A 1PVOA 5IP7G 4HJAA 3JAMc 4A3LG 1L1OB 2K50A 2QGQA 3GTGH 3K8AA 1S3OA 4X62L 2NN6I 4HIOA 2N8NA 1UE5A 1KAWA 1N34L 5FJ8H 1M1KC 4AYBG 4LF5L 4LFAL 1GM5A 2K5HA 4OX9Q 5M3MG 4GKJQ 1L1OA 2E5LL 3GDEA 1VQGA 2C35B 4JI2Q 4DR1Q 3T1YL 4A3IG 2JA8G 1SROA 3TRZA 3EBEA 1YITA 4GLVB 3K80C 3OTOQ 3GTLH 2RHQB 2HQLA 4C3JH 3UE1A 5C4JH 1I94Q 4UY8C 2Q2UA 3ERSX 4IOAA 4GNXA 4IPCA 2YTYA 3K81C 1HZBA 1SN8A 2KBNA 1I50H 2VS1A 2VY3A 2ZM6Q 1YEZA 3PO2G 3RLOA 4TQUS 1DGSA 2B63H 4JCVE 2AWOA 4K0KQ 4ALPA 4YWLA 2UXCL 2H5XA 1TWGH 4UP9A 1Y1VH 4DV1Q 5AJ3L 4IJHA 2ZJQA 2VZAA 1BBUA 2D62A 1XPOA 2ZTEA 2IX1A 3MEFA 2FXQA 4LF7L 3CCUA 3J81j 1GKHA 2NVQH 2R7ZG 1K0RA 1XMOQ 1LUZA 4OWTB 4A76A 4XTCS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X H;  5JJK A;  3KF6 A;  3PSI A;  4A75 A;  3KYH C;  4X64 L;  1QZH A;  2UXD Q;  2EQS A;  2I5M X;  4L5T A;  2NVT H;  2YTX A;  3E0E A;  3HOY H;  2D0P A;  3E9H A;  1N33 Q;  2XGT A;  1Y1W H;  1HR0 W;  3F2D A;  1RIP A;  5JJI A;  4DV3 Q;  1VQK A;  1V9P A;  1PH2 A;  4MTN A;  3S1R H;  3J81 i;  2B3G A;  2YYZ A;  1E3P A;  2QEX A;  1EIF A;  1I3Q H;  3UDI A;  4NXN Q;  4B3R L;  1VQN A;  5IYC G;  4DV4 L;  1PFS A;  4P72 A;  5C44 G;  5IT9 c;  2Y0S G;  1X55 A;  4GN3 B;  3S15 H;  1SE8 A;  5C0X I;  4A3F H;  1PH4 A;  1N32 L;  3PUX A;  2NVX H;  4BBR G;  3J7A 5;  4A3B H;  1HZ9 A;  2GVA A;  3NEN A;  1D8L A;  2E8G A;  4DV5 Q;  4DV6 Q;  3A0J A;  2VNU D;  1YZ6 A;  2JA9 A;  4X66 Q;  1VQP A;  3H3V H;  4OON A;  4YWK A;  4HIM A;  2PI2 E;  2E2H H;  1IBM Q;  3CC7 A;  4LF9 Q;  2LXJ A;  1LYL A;  2K75 A;  4XIG S;  3RLN A;  4A3J H;  3TS0 A;  4LFB Q;  2R92 G;  5IYB G;  4PZ8 A;  2F52 A;  3W5O A;  4LF8 L;  1XNR L;  1VQD A;  1A0I A;  4TVA B;  4LF4 Q;  1SMX A;  4A3M G;  4AQY Q;  2Q2T A;  4LF6 L;  3I4N H;  1Q8K A;  3CCL A;  3F1Z A;  2CQO A;  3UE0 A;  2YV5 A;  4DV0 L;  1PA6 A;  1PH1 A;  3S1Q H;  4YHH L;  3I4O A;  1BVS A;  5FLM G;  1CKN A;  4JI1 L;  3M9B A;  1I5F A;  4IJL A;  3J80 c;  1HNX L;  3A74 A;  4AIM A;  1VQ9 A;  2UUC Q;  2VQE Q;  2JE6 I;  3NEL A;  5HGQ A;  3PCO B;  2F3I A;  1B7Y B;  3AYH B;  4BA2 I;  2IX0 A;  4BXX G;  1G51 A;  3HOV H;  4B3T L;  1TWH H;  4JOI A;  4IPD A;  4C2M H;  3AFQ A;  3M4P A;  5M5Y H;  1PHJ A;  4DKA C;  4JI5 L;  2UUA L;  3CD6 A;  4JYA L;  2WB1 E;  3PF4 A;  2I5H A;  1C9O A;  1B8A A;  2L15 A;  3F2B A;  1YJN A;  3CW2 C;  3HOW G;  1RL2 A;  2CFM A;  1FL0 A;  3HKZ G;  4JI7 Q;  5GAH C;  5E7N A;  2VL6 A;  3EIV A;  4A3K H;  2HHH L;  2ASB A;  3M7N A;  3CCR A;  1C0A A;  3J81 c;  3M85 A;  3HOX H;  2BH2 A;  1X65 A;  4MNO A;  3CCM A;  4IFD I;  4JYA Q;  4A3D H;  4R1J A;  2RF4 A;  2D0O A;  4DR5 Q;  4UP8 A;  5IYD H;  1EFW A;  3PO3 G;  3S14 H;  4POG A;  2JEA I;  1X3E A;  4C3I H;  1FJG Q;  1NBW A;  4DUZ Q;  3OYY A;  4BY7 G;  1HNW L;  1PH7 A;  1VQO A;  4JI0 Q;  2PI2 A;  4P74 A;  4NPS A;  1GO3 E;  4ME3 A;  2UU9 Q;  1GVP A;  3FP9 A;  5GAE C;  4JI8 L;  1XNQ Q;  3U50 C;  3K7A H;  3CCQ A;  2KCT A;  1EQQ A;  1JMC A;  1YNX A;  4LUZ A;  3F8T A;  2HIV A;  1YHQ A;  2R6G A;  4UPA A;  5LMN L;  2WP8 J;  3D0F A;  3UDX A;  3G71 A;  1HR0 Q;  2F4V L;  2JA7 H;  1X6O A;  4R4I A;  4Y52 H;  1OXX K;  1XJV A;  1JB7 A;  2R93 G;  4GNX B;  4BBS G;  1L2F A;  5C3E G;  4X6A H;  1NJI C;  2JA5 G;  5IY0 A;  2YU9 H;  1E1T A;  1Z47 A;  2BA0 A;  2KHJ A;  4IO9 A;  4QJF A;  2JA6 H;  4OX9 L;  3CCV A;  3CPF A;  5C44 H;  4AYB E;  4DR6 Q;  3CPW A;  1L1O C;  1N34 Q;  4NXM Q;  4DR1 L;  1KD1 C;  3PGZ A;  3CF5 A;  2B29 A;  4BBR H;  1L0W A;  2MQH A;  3G4S A;  4DK3 C;  3T1Y Q;  2Q2H A;  2WAQ E;  3GTQ H;  1NE3 A;  4H02 A;  1VQI A;  3BJU A;  4GNX C;  4WJ4 A;  2GN5 A;  2MFI A;  2OWO A;  1EOV A;  3KF6 B;  4PMW A;  5M3F H;  4B3S L;  1G29 1;  2A8V A;  2I0Q A;  1EUJ A;  4EQ5 A;  1MIU A;  1ASY A;  2BH8 A;  1NMG A;  1EQR A;  2OTL A;  2UUB L;  3S1N H;  1A62 A;  3GD7 A;  4DAM A;  3FKI H;  3CCE A;  4KHP Q;  3S17 H;  5IP9 H;  4DV1 L;  4BY1 G;  3H0G G;  2VQF Q;  4OWX B;  2IHE A;  4LNQ A;  3HOZ G;  4DV2 Q;  5IWA Q;  3S1M H;  1JE5 A;  1WJJ A;  1A63 A;  2VUM G;  3RNU A;  1VQM A;  2PQA B;  3B6Y A;  1YJ9 A;  3I4M H;  4DR7 Q;  1FGU A;  3PUY A;  5ELO A;  4WJ3 M;  1CUK A;  4POF A;  1YI2 A;  1PH6 A;  4JI3 Q;  2E2J H;  2JQO A;  4PZ6 A;  4JI6 Q;  2N3S A;  2XTI A;  3KF8 B;  5LMU L;  4A93 H;  1UWV A;  3W1B A;  3RZO H;  1IZ6 A;  1JJG A;  2MNA A;  1N8R C;  3GO5 A;  1SR3 A;  3CQZ H;  2PQA A;  3E9I A;  5J3B A;  2HT1 A;  3H3V I;  3OW2 A;  4RMF A;  2AWN A;  1NTG A;  1VQF A;  4YY3 L;  3DM3 A;  3TQY A;  5LMN W;  4HIK A;  1Q7Y C;  4P73 A;  4NXN L;  5JEA G;  1VQ4 A;  4YCV A;  1KRT A;  3NEM A;  3TS2 A;  2V1C C;  2K4K A;  3I56 A;  5FJ8 G;  2HIX A;  5M5X H;  2Y0S E;  1PYB A;  4R4T A;  1UEB A;  1X3G A;  2PNH A;  2ZTC A;  3KOJ A;  3UDG A;  3CC4 A;  2JK8 A;  1MJC A;  2OTJ A;  3BZK A;  1S72 A;  4DR3 Q;  1TWA H;  2IHF A;  3ULJ A;  3A5U A;  3CME A;  4DV5 L;  1X9N A;  1AE3 A;  4A3C H;  4JBK A;  3RZD H;  2RHS B;  3IRB A;  4X66 L;  1QZG A;  1CKN B;  1JJC B;  1GD7 A;  1KHI A;  1VS0 A;  5M5W H;  4DR2 Q;  1IBM L;  2NN6 G;  2MO1 A;  3HOU G;  4JV5 Q;  3LGJ A;  5GAG C;  2MO0 A;  1R9T H;  2ZTD A;  3A5Z B;  5GRO A;  3CCJ A;  1Q81 C;  3ICE A;  4BY7 H;  1UE1 A;  1WCM H;  1WOC A;  4FDB A;  5JEA J;  3RN2 A;  4LFB L;  3I55 A;  1IXR A;  2NZH A;  4A3E H;  1HNZ L;  2B63 G;  5IP7 H;  5JJL A;  4LF4 L;  3ULP A;  1CSQ A;  4AQY L;  4YCU A;  1VQ5 A;  4A3L H;  4X65 Q;  1Y1V G;  4DR4 Q;  3JAM i;  2AHO B;  4GLA C;  1E1O A;  4UP7 A;  1OXV A;  1XNR Q;  1S40 A;  3CCS A;  4HJ8 A;  1IBK Q;  2UUC L;  1MJE A;  1HZC A;  4R4Q A;  4A3G G;  5M3M H;  1YHA A;  2N78 A;  2R93 H;  5C4X G;  1N9W A;  1A8V A;  2Z0S A;  4PG3 A;  1U0L A;  3KLW A;  3DLL A;  3TRE A;  4A3I H;  4B3M Q;  2JA8 H;  4JOI C;  3HOY G;  2ES2 A;  1WYD A;  1LTL A;  1VCI A;  3KDF B;  4L5Q A;  3H15 A;  1PH3 A;  1Y1W G;  3PUW A;  2K5N A;  1FVI A;  3ZJY C;  4LFC Q;  4QIW E;  4LW1 A;  4QGU A;  3WWV A;  4B3T Q;  4GKK Q;  1N36 L;  3GTJ H;  1X54 A;  1OTC A;  4IPG A;  1SLJ A;  1EWI A;  3MXN B;  1PH8 A;  3PO2 H;  3K0X A;  3HKZ E;  3KDF A;  1IBL Q;  5BR8 Q;  4L5R C;  3S16 H;  5K36 G;  4HJ5 A;  2A19 A;  1KL9 A;  1IL2 A;  3BZC A;  3I2Z A;  3KJP A;  4GOP B;  4A3F G;  4HID A;  1J5E Q;  2HHH Q;  5DLQ E;  4A3G H;  4A3B G;  3ULL A;  2I5L X;  4JI4 Q;  3HKS A;  3T1H Q;  1SRU A;  1K83 H;  2OQ0 A;  1KIX A;  4C3H H;  1JT8 A;  1QVG A;  2CWA A;  2R7Z H;  1AH9 A;  1W2B A;  1VQC A;  1YHB A;  1XMQ L;  3GTP H;  4GOP A;  3STB D;  1Q46 A;  4DUZ L;  4KLK A;  2Z6K A;  4A4I A;  1XTD A;  4HJ7 A;  1VQ8 A;  3FHW A;  4JI0 L;  1JJ2 A;  4DK6 C;  3G6E A;  4DUY Q;  2AKW B;  4EX5 A;  2UXB Q;  2CCZ A;  1YIJ A;  3S2D H;  5C0X G;  1VQJ A;  1Z9F A;  3ER0 A;  4A3J G;  4DV7 Q;  3U4Z A;  4YWM A;  4JI8 Q;  3CMA A;  3I4N G;  3NBH B;  1WFQ A;  1H95 A;  1E7Z A;  4X62 Q;  1OXT A;  5IYC H;  4GKJ L;  3CC2 A;  3W1G A;  4PZ7 A;  4LUV A;  5LMN Q;  4QL5 A;  4LFA Q;  4JI2 L;  4LF5 Q;  2F4V Q;  2GVB A;  3OTO L;  2E5L Q;  2KHI A;  4DR6 L;  1HJP A;  4P75 A;  4NXM L;  1I94 L;  3HOV G;  1XPU A;  1CKM A;  3CXC A;  2NVY H;  3PIP A;  1AE2 A;  4IOC A;  1VQE A;  2ZM6 L;  4GLX A;  1CSP A;  3EN2 A;  5C0X J;  2OCE A;  2WAQ G;  4R4C A;  4OO1 I;  1OXS C;  1Q1B A;  2K5V A;  1VQH A;  4K0K L;  4A3K G;  1WI5 A;  5GQO A;  2VW9 A;  3HOX G;  2R92 H;  5IYB H;  2LXK A;  4O2D A;  4DAY B;  2WFW A;  4AH6 A;  1NY4 A;  3CP0 A;  4BA1 I;  3HOU H;  1UE6 A;  4A3M H;  4YCW A;  1KQS A;  1TWF H;  2UXC Q;  3L7Z C;  4B3S Q;  2ATW A;  4A3D G;  5AJ3 Q;  1V43 A;  1E24 A;  1PYS B;  1XMO L;  4KHP L;  1OXU A;  2YTV A;  2VQF L;  4LF9 L;  3VDY A;  5IYD G;  5FLM H;  4DV2 L;  2UUB Q;  5IWA L;  4LF7 Q;  2UXD L;  2JJQ A;  4DR7 L;  1VQB A;  4QQB X;  3PV0 A;  1K9M C;  1N33 L;  3J80 i;  4JI3 L;  4X64 Q;  4BXX H;  4DV3 L;  1TXY A;  1QUQ B;  2A1A A;  2KCM A;  4JI6 L;  3S2H H;  3K7U C;  3J7Z C;  4JBJ A;  4IFD G;  3M4Q A;  4P71 A;  4LWC A;  5HY6 A;  3HOW H;  5LMU Q;  1P16 A;  5GAD C;  1XPR A;  4KI0 A;  1U5K A;  1K3R A;  4OXP A;  4B3R Q;  1QUQ A;  1T9H A;  1X3F A;  2JA7 G;  2EXD A;  5H1S E;  4DPG A;  4DV4 Q;  3KJO A;  1HZA A;  2LSS A;  4YY3 Q;  1Y14 B;  1QVF A;  2NZO A;  1N32 Q;  3Q8D A;  2R7D A;  4DV6 L;  2JA6 G;  3M4O H;  1KC8 C;  4NB3 A;  3S24 A;  3PO3 H;  1D7Q A;  1SFO H;  1G6P A;  3TEH B;  3PUV A;  1BKB A;  3STB C;  4DR3 L;  3UDF A;  3AFP A;  5IE8 A;  3GTK H;  2K14 A;  1YBY A;  1C7Y A;  4DNI A;  3RN5 A;  2ID0 A;  4IFD J;  2DGY A;  1MKH A;  4JBW A;  4Y7N H;  3I7F A;  4IPH A;  4DR2 L;  2Q2I A;  3AEV A;  4JV5 L;  2JEB I;  5M3F G;  1B70 B;  4OWW B;  4LF8 Q;  1M90 C;  1EYG A;  1PH9 A;  1VQL A;  4LF6 Q;  3RR5 A;  3FKI G;  4QY7 A;  1CKO A;  1HH2 P;  1P8L A;  5IP9 G;  4X65 L;  2PMZ E;  4DV0 Q;  4DR4 L;  2EIF A;  4YHH Q;  2VQE L;  1HNZ Q;  5ELN A;  4BBS H;  5C3E H;  1Q1E A;  3HFZ B;  3PUZ A;  4JI1 Q;  3BU2 A;  4APV A;  1HNX Q;  2JA5 H;  3PF5 A;  3I4M G;  2R7F A;  4L5S A;  1IBK L;  2AMC B;  4JC0 A;  3G48 A;  1LM0 A;  2CWP A;  3PIO A;  2WB1 G;  3L0O A;  1Q86 C;  2ALY B;  3JC6 6;  1PV4 A;  1O7I A;  4B3M L;  4JI7 L;  4A93 G;  4JI5 Q;  2UUA Q;  1X56 A;  1PH5 A;  2IY5 B;  1YJW A;  1UE7 A;  3L2P A;  2E2I H;  4OO1 G;  1V1Q A;  2ZJP A;  2QA4 A;  4KHZ A;  3F2C A;  4LFC L;  4JBM A;  3M3Y H;  4GKK L;  1Q12 A;  3U58 A;  3AQQ A;  1QVC A;  1VQ6 A;  2K52 A;  4LUO A;  4DR5 L;  1VQ7 A;  4RG1 A;  1W3S A;  1IBL L;  5BR8 L;  1N36 Q;  1BBW A;  1KRS A;  2N49 A;  1VQA A;  1YVC A;  4O0A A;  2RCN A;  1NMF A;  1J5E L;  2CKZ B;  2IT1 A;  3CAM A;  4J15 A;  4BY1 H;  3H0G H;  1K8G A;  1FJG L;  3HOZ H;  5FLX c;  4HJ9 A;  4JI4 L;  1IYJ B;  1TWC H;  4GN5 A;  2OQK A;  3T1H L;  3GTM H;  3KFU A;  2VUM H;  1I6H H;  2UU9 L;  1XNQ L;  4A3C G;  1J6Q A;  4GN4 B;  3SGI A;  1HNW Q;  1Q82 C;  1E22 A;  4GOP C;  4R4O A;  4MZ9 A;  2Z6K C;  3RLF A;  4GS3 A;  3U4V A;  1EIY B;  1K73 C;  2BA1 A;  2DUD A;  5EAY A;  2KEN A;  4DUY L;  1XMQ Q;  1KXL A;  1K8A C;  1HR0 L;  2UXB L;  3D31 A;  3GTO H;  1WCM G;  4DV7 L;  2ZJR A;  4A3E G;  1ASZ A;  4JG2 A;  1PVO A;  5IP7 G;  4HJA A;  3JAM c;  4A3L G;  1L1O B;  2K50 A;  2QGQ A;  3GTG H;  3K8A A;  1S3O A;  4X62 L;  2NN6 I;  4HIO A;  2N8N A;  1UE5 A;  1KAW A;  1N34 L;  5FJ8 H;  1M1K C;  4AYB G;  4LF5 L;  4LFA L;  1GM5 A;  2K5H A;  4OX9 Q;  5M3M G;  4GKJ Q;  1L1O A;  2E5L L;  3GDE A;  1VQG A;  2C35 B;  4JI2 Q;  4DR1 Q;  3T1Y L;  4A3I G;  2JA8 G;  1SRO A;  3TRZ A;  3EBE A;  1YIT A;  4GLV B;  3K80 C;  3OTO Q;  3GTL H;  2RHQ B;  2HQL A;  4C3J H;  3UE1 A;  5C4J H;  1I94 Q;  4UY8 C;  2Q2U A;  3ERS X;  4IOA A;  4GNX A;  4IPC A;  2YTY A;  3K81 C;  1HZB A;  1SN8 A;  2KBN A;  1I50 H;  2VS1 A;  2VY3 A;  2ZM6 Q;  1YEZ A;  3PO2 G;  3RLO A;  4TQU S;  1DGS A;  2B63 H;  4JCV E;  2AWO A;  4K0K Q;  4ALP A;  4YWL A;  2UXC L;  2H5X A;  1TWG H;  4UP9 A;  1Y1V H;  4DV1 Q;  5AJ3 L;  4IJH A;  2ZJQ A;  2VZA A;  1BBU A;  2D62 A;  1XPO A;  2ZTE A;  2IX1 A;  3MEF A;  2FXQ A;  4LF7 L;  3CCU A;  3J81 j;  1GKH A;  2NVQ H;  2R7Z G;  1K0R A;  1XMO Q;  1LUZ A;  4OWT B;  4A76 A;  4XTC S; 
#chains in the Genus database with same CATH topology
 2D2C C;  5JJK A;  4A75 A;  1QZH A;  4Q0F A;  3SE0 A;  2I5M X;  3E0E A;  2D0P A;  2XGT A;  1Y1W H;  3F2D A;  1RIP A;  1VQK A;  1V9P A;  5EBD A;  3J81 i;  3URY A;  4NXN Q;  3J7Y W;  1LTR D;  5FO9 B;  5C44 G;  5IT9 c;  3J81 E;  5K36 H;  2F0E A;  4C56 C;  4A3F H;  4FF4 A;  1N32 L;  1XTC D;  3PUX A;  2NVX H;  4BBR G;  3J7A 5;  1EYC A;  1DZ1 A;  4DV5 Q;  2VNU D;  3BYY B;  2RDF A;  2JA9 A;  3WOF A;  1GUS A;  4KD4 A;  4HIM A;  1RCV D;  4BY1 B;  3MC0 B;  1TWC B;  2A6E D;  5EPL A;  5IYB G;  1A0I A;  5C3W A;  3T53 B;  1ET9 A;  2KJX A;  4LF6 L;  2AUJ D;  4X3K A;  4F87 A;  3K6O A;  1HNX L;  4IJL A;  3J80 c;  4AIM A;  1VQ9 A;  2VQE Q;  4DN4 M;  2B2Y A;  1A2U A;  4IPD A;  4C2M H;  1PHJ A;  2WB1 E;  1EIG A;  4DF7 A;  4RKL A;  3R8B A;  1GXD C;  4A3K H;  1SDF A;  3J81 c;  1X65 A;  1X3Q A;  4MNO A;  5I4D A;  4NW2 A;  4IFD I;  1AN8 A;  1S5D D;  4U68 A;  2RF4 A;  1PFM A;  4UP8 A;  1EFW A;  3PO3 G;  3G6J B;  4DUZ Q;  1VQO A;  1Y1V B;  1WVL A;  4P74 A;  1GO3 E;  4ME3 A;  3FP9 A;  3OWF A;  1XNQ Q;  1S5B D;  3K7A H;  3O13 A;  2NVQ B;  2KCT A;  2RDG A;  4OEM B;  1JMC A;  3NTI A;  5FK9 C;  3MHB A;  4A3G B;  2HIV A;  5C4X B;  4UPA A;  3G71 A;  3UI2 A;  3D4W A;  2FJ2 A;  4YIJ A;  2LMC B;  3C3L A;  4Y52 H;  2F0H A;  1SXT A;  1L2F A;  4X6A H;  1ML0 D;  1QB5 D;  1TII D;  5IGC A;  5IY0 A;  3PIO 3;  1Y69 U;  1E1T A;  2YU9 H;  1Z47 A;  2BA0 A;  2KHJ A;  2KOL A;  2JA6 H;  3KLS A;  3S1R B;  3CPF A;  3CPW A;  1LT5 D;  5C6A A;  1KD1 C;  4HR7 B;  3WDN A;  2AQ3 B;  2B29 A;  1L0W A;  3NBH A;  3S15 B;  1PTO B;  3KUP A;  3GTQ H;  4A3B B;  1NE3 A;  2CHB D;  1VQI A;  1GHJ A;  2B2V C;  5ELC A;  1G29 1;  2I0Q A;  2CQA A;  2F0K A;  1KLG D;  2UUB L;  3S1N H;  4KHP Q;  1SNM A;  3BDO A;  4PV1 C;  4BY1 G;  1SSO A;  4LNQ A;  4OWX B;  2IHE A;  3TN2 A;  4HED A;  5IWA Q;  1JE5 A;  2K01 A;  3T4A C;  3S1M H;  1PTO C;  2JP1 A;  3Q23 A;  5ELO A;  3IAY A;  1CUK A;  1PFB A;  1YI2 A;  5D3I B;  2E2J H;  3I4N B;  2XTI A;  3NPP A;  2TMP A;  1UWV A;  4DAY A;  1SYC A;  1VF5 C;  2O2L D;  1SR3 A;  2O4X A;  3KBX A;  4RKB A;  1M4V A;  4XT1 B;  4YY3 L;  5LMN W;  1TWH B;  1JOK A;  1KRT A;  2K4K A;  1LTB D;  4EGV A;  1TVX A;  3BVM A;  4B9W A;  3CC4 A;  4R4T A;  1UEB A;  2VXW A;  2LFN A;  3H0G B;  2LKV A;  2EJM A;  3C1F A;  2X69 A;  4JBK A;  3T56 B;  2RHS B;  1GD7 A;  3WOE A;  1I6H B;  3HP3 A;  2NN6 G;  4FYD A;  2ZTD A;  3A5Z B;  1B3Q A;  1ZYR D;  1ICF B;  4LFB L;  1I4G A;  5JEA J;  3P1H A;  4C3I B;  1ZKO A;  3I55 A;  2NZH A;  4A3E H;  3ULP A;  1CSQ A;  4AQY L;  2A6H D;  4X65 Q;  1Y1V G;  4DR4 Q;  1GUW A;  1A2T A;  1G2S A;  4GLA C;  1F9R A;  4ZYS A;  4HJ8 A;  2ICE C;  1MJE A;  1HZC A;  4A3G G;  3BVZ A;  3TP6 A;  5C4X G;  2R93 H;  4IUQ A;  4A3I H;  4J1M A;  3VA5 A;  3TRE A;  2CH4 A;  4NKL A;  3A8I E;  3EFX D;  1PH3 A;  4MIU A;  3T16 A;  4WOR A;  4B3T Q;  1TY0 A;  1EY9 A;  5BR8 Q;  4WFN 3;  1U9R A;  1EY4 A;  1IL2 A;  2HHH Q;  4G57 A;  4A3B G;  4QMG A;  4JI4 Q;  2M2L A;  1A6X A;  3HKS A;  1PXU A;  1EQT A;  3NQI A;  3J7A F;  1HA5 A;  1D1I A;  1E2W A;  4UDU C;  3GTP H;  2KQ3 A;  3S17 B;  3OHX C;  4HJ7 A;  1AEX A;  3G6E A;  4DUY Q;  2UXB Q;  2CCZ A;  3S2D H;  2PPB C;  3I4M B;  4DV7 Q;  1F9Q A;  1TY2 A;  4KTA A;  3EQL C;  4I7A A;  4JI8 Q;  3I4N G;  1WFQ A;  1E7Z A;  1LTA D;  1IKL A;  1LTS D;  4LFA Q;  3MAQ A;  2GVB A;  3OTO L;  4QIW B;  4QF4 A;  1HJP A;  4RGN A;  2BDN A;  1LT6 D;  3PIP A;  3LX0 A;  1VQE A;  1ZEQ X;  2EYJ A;  5M5X B;  4FXD A;  3EN2 A;  4R4C A;  1OXS C;  2K5V A;  5GQO A;  2EY6 A;  1TWA B;  5IYB H;  4M1U B;  2WFW A;  1EEI D;  2WV6 D;  2UXC Q;  4B3S Q;  2ATW A;  1JB3 A;  1V43 A;  1XMO L;  1ILQ A;  2F3W A;  4F8M A;  4LF7 Q;  2UXD L;  4C3I G;  3VR6 A;  1K9M C;  3DMU A;  4X64 Q;  4JI6 L;  3SR1 A;  2L1B A;  5I2Y A;  5EKK A;  2K5Q A;  1TU2 B;  2X6G A;  3M4Q A;  1KAA A;  4P71 A;  2KCC A;  5LMU Q;  1P16 A;  5GAD C;  1K3R A;  4OXP A;  4B3R Q;  3NTH A;  1EFI D;  2B39 A;  2LSS A;  1Y14 B;  2NZO A;  4A3K B;  2RSN A;  3M4O H;  3PO3 H;  5FLX E;  3PO2 B;  1G6P A;  3PUV A;  1WTH A;  3STB C;  4DR3 L;  3AFP A;  3ERQ A;  5IE8 A;  5KYI A;  2EYF A;  1YBY A;  2ID0 A;  3L3O C;  4IFD J;  1MKH A;  4DR2 L;  5JPM C;  4C3H B;  5M3F G;  3NQT A;  4NDX A;  4O42 A;  4N9P A;  5EKL A;  4LF8 Q;  2R7Z B;  1JCK B;  2RSO A;  3DWP A;  1VQL A;  1JWU D;  2Q8I B;  1HH2 P;  1STG A;  5IP9 G;  4DV0 Q;  4P2C B;  2EIF A;  1C48 A;  1IW7 D;  3Q0A A;  3PUZ A;  3I4M G;  1D6E C;  1IBK L;  2AMC B;  2Z8L A;  3G48 A;  4KKS A;  1LM0 A;  4DK1 A;  1TS4 A;  2F0D A;  3L0O A;  1HQM C;  2ALY B;  3MFY A;  1PV4 A;  4JI7 L;  4A93 G;  1V1Q A;  1KDB A;  5G3L D;  4KHZ A;  3EJI A;  1HRJ A;  4RGT A;  4GKK L;  1Q12 A;  3AQQ A;  5DEH A;  4RWS C;  3GV6 A;  3H6M A;  1VQ6 A;  1GHK A;  2ZXR A;  3BG3 A;  1W3S A;  3VYS A;  1IBL L;  1NCV A;  1AFP A;  1BBW A;  1KRS A;  2N49 A;  4K2L A;  4O0A A;  3CAM A;  2O5I C;  2ICI A;  4BY1 H;  3S1N B;  1FJG L;  5FLX c;  4HJ9 A;  1IYJ B;  1TWC H;  3VYT A;  2OQK A;  3KFU A;  2E74 C;  2I46 A;  1XX8 A;  4GN4 B;  3SGI A;  1E22 A;  1S5E D;  3HRZ C;  2Z6K C;  4MZ9 A;  4GS3 A;  1K73 C;  5EAY A;  1DJR D;  2E2J B;  1BF4 A;  1XMQ Q;  1WTX A;  1K8A C;  1KXL A;  3D31 A;  2MUY A;  3MZ5 A;  3SK6 A;  4HJA A;  3JAM c;  4ULL A;  4IFD H;  2RA4 A;  1PZK D;  1CFM A;  1SMY D;  3K8A A;  3C46 A;  1CT1 D;  1EYD A;  5J39 A;  1C8C A;  4FO2 A;  5CBA E;  1UE5 A;  1FD7 D;  4LF5 L;  1I4Q A;  1WTO A;  4ZUI A;  3HOW B;  2K5H A;  2NBF A;  1AW7 A;  1VQG A;  4JI2 Q;  4DR1 Q;  3TRZ A;  1SRO A;  1D5X C;  4QUF A;  3KBG A;  3K80 C;  2A74 C;  4UY8 C;  2Q2U A;  2NN6 H;  2B2V A;  2K32 A;  1SFO B;  2VS1 A;  2VY3 A;  3PO2 G;  4OIJ A;  3TBI B;  4DA2 A;  1CQF A;  3OOC A;  4KY5 A;  4DV1 Q;  1Y1V H;  5AJ3 L;  2BE5 C;  1BBU A;  4HN7 A;  2F0V A;  4C3H G;  1ESR A;  4KY6 A;  2NVQ H;  1GKH A;  1G2T A;  2R7Z G;  1K0R A;  4HID A;  1JIC A;  4A3G H;  5C4X H;  3NWT A;  3PSI A;  5J1Z A;  1FGB D;  3NHH A;  3SK8 A;  1SYF A;  2R93 B;  1N33 Q;  2KED A;  1HR0 W;  2JA5 B;  4DV3 Q;  4J8Q A;  3S1R H;  4L8J A;  2YYZ A;  4JVZ A;  2QEX A;  1VQN A;  2DNC A;  4B08 A;  1BCP D;  3K58 A;  2E2I B;  1Q90 A;  1EZ6 A;  1BR9 A;  3S15 H;  1PTO H;  5C0X I;  4A3B H;  4OL7 A;  2KUM A;  2E8G A;  3TDQ A;  3HGB A;  1SE4 A;  4DV6 Q;  2A5H A;  2A68 C;  4X66 Q;  1VQP A;  1LV9 A;  1IBM Q;  3CC7 A;  3HOZ B;  1WTQ A;  1CTM A;  3K0Y A;  3GTM B;  4ID6 A;  4XIG S;  2F52 A;  1XNR L;  3S2D B;  4LF4 Q;  3I4N H;  3CCL A;  2CQO A;  1PH1 A;  1CZG A;  1H9R A;  4YHH L;  3I4O A;  1BVS A;  5FLM G;  4O1N A;  4JI1 L;  1I5F A;  3GTO B;  2AQ2 B;  1CA5 A;  2JE6 I;  1HPC A;  4BA2 I;  1B7Y B;  3GTG B;  1J9O A;  1F2M A;  2IX0 A;  1TWH H;  3AFQ A;  3CRK C;  5BN3 A;  3CD6 A;  1TS3 A;  1ENF A;  1B3A A;  2ZT9 C;  3N52 A;  2EYL A;  3PF4 A;  1B8A A;  3HOW G;  2CFM A;  1PRT F;  3I72 A;  5IGF A;  1Y8N B;  2JXM B;  3M7N A;  2VL6 A;  4XQN A;  2ASB A;  3CCR A;  1STH A;  3T13 A;  2DY7 A;  4R9W A;  3GTL B;  2X6L A;  3CCM A;  4JYA Q;  2EVB A;  4HTH A;  4DR5 Q;  1G6Z A;  3J80 L;  1HHV A;  2JEA I;  2FIN B;  1J8I A;  2IX3 A;  4C3I H;  3GP7 A;  3OYY A;  4FF1 A;  1GVP A;  1K3B C;  4LUZ A;  1NSN S;  3F8T A;  1YHQ A;  5LMN L;  1UAP A;  1PRT D;  2WP8 J;  2A69 C;  1X6O A;  2NVT B;  4R4I A;  1SJH D;  1XJV A;  2R93 G;  1K28 A;  3HG9 A;  2JA5 G;  1B1Z A;  4IO9 A;  1YNN C;  4QJF A;  4OX9 L;  3IFD A;  1I3Q B;  1N34 Q;  1GJX A;  4L6T B;  1UNS A;  2K6A A;  2OXP A;  4KJO A;  5CV5 A;  5D14 A;  3QJY A;  3IFT A;  1H9S A;  4DK3 C;  3I73 A;  3K5O A;  3T1Y Q;  2WAQ E;  4H02 A;  2MFI A;  2PQE A;  2OWO A;  1QOH A;  4RAU C;  4F7X A;  5M3F H;  2A8V A;  4XYO A;  2PCF B;  3MWY W;  2OTL A;  2MJ8 A;  4DAM A;  3S17 H;  5IP9 H;  2IL8 A;  3R93 A;  3HOZ G;  1STB A;  4DV2 Q;  3BDL A;  5CR3 A;  5DAU A;  4A3J B;  2G5D A;  2PQA B;  5ELB A;  1YJ9 A;  3I4M H;  1FGU A;  3PUY A;  4DR7 Q;  1PH6 A;  2JQO A;  4A93 H;  3S1Q B;  1AZQ A;  1IZ6 A;  1E2Z A;  1N8R C;  3E9I A;  1ZXT A;  2HT1 A;  5J22 A;  4XXE A;  3DM3 A;  2DJG C;  3TQY A;  1PLF A;  4NXN L;  2WAC A;  5JEA G;  1VQ4 A;  1WTR A;  3NEM A;  5M5Y B;  2V1C C;  3I56 A;  4DXF A;  2VB2 X;  5KNC A;  2HIX A;  3R2T A;  2F0T A;  5M5X H;  1PYB A;  2ZTC A;  1I4R A;  5I9P A;  3HOX B;  1TWA H;  3ULJ A;  4DV5 L;  2P5Z X;  3RUZ A;  1CKN B;  4A3D B;  1FR3 A;  4X3T A;  1DD2 A;  5HUR A;  2Z4I A;  3S14 B;  4JV5 Q;  4PQX A;  1Q81 C;  1R9T H;  4BY7 H;  1MHW C;  1GUT A;  2K04 A;  1EL0 A;  2EYO A;  2AHO B;  1SNP A;  1E1O A;  4ODG A;  2EY5 A;  1S40 A;  3CCS A;  2K05 A;  1YHA A;  2JA7 B;  1N9W A;  2Z0S A;  3LWE A;  2MPM A;  2F0J A;  4B3M Q;  2B2T C;  2ES2 A;  2K33 A;  5E4X A;  3KDF B;  2K5N A;  1FVI A;  4QGU A;  5ELE A;  2RBM A;  1N36 L;  1K8M A;  3K59 A;  1T5E A;  3PO2 H;  3K0X A;  4L5R C;  5A2Q L;  2NZ1 D;  2QIL A;  1KL9 A;  1CK1 A;  4GOP B;  5DLQ E;  3T1H Q;  2E76 C;  1KIX A;  4C3H H;  1F9P A;  1QVG A;  1WD0 A;  2CWA A;  2R7Z H;  3I90 A;  1VQC A;  4DUZ L;  5TSS A;  5JVH 3;  2Z6K A;  3NP8 A;  3F2U A;  4CDD C;  2AKW B;  5DM6 3;  1VQJ A;  1Z9F A;  4A3J G;  4C1N K;  3U4Z A;  1ENC A;  2R61 A;  3K5N A;  3SK4 A;  4GKJ L;  3RZO B;  1IYU A;  3W1G A;  3CC2 A;  3NE5 B;  2L0C A;  4H13 C;  2FMM A;  4X3S A;  3I70 A;  1LAB A;  4P75 A;  3HOV G;  1I94 L;  1XPU A;  4RCN A;  2NB0 A;  1AE2 A;  3PMF A;  2OEO A;  2HCI A;  1G91 A;  2IPK D;  5C0X J;  5CMD A;  1RD9 D;  1VMP A;  1WI5 A;  3HOX G;  4DNR B;  4BA1 I;  3RZD B;  3L7Z C;  4A3D G;  4KHP L;  1PYS B;  2JSO A;  3MEH A;  4LF9 L;  5DM7 3;  5LL6 X;  4NP5 A;  5C4H A;  5FLM H;  2UUB Q;  5IWA L;  1VQB A;  4JW0 A;  3AU7 A;  1FNU A;  5CV6 A;  1TXY A;  2KCM A;  1CZW A;  4XDX A;  5IGG A;  3J7Z C;  3RD4 A;  2DY8 A;  1ET6 A;  4JBJ A;  4IFD G;  2J0T D;  3HOW H;  2Z1C A;  5I6W A;  5M3M B;  1XPR A;  4KI0 A;  1QUQ A;  2JA7 G;  2EXD A;  1EY0 A;  4DPG A;  4DV4 Q;  3KJO A;  4YY3 Q;  1QVF A;  1PYW D;  2F0N A;  1BOS A;  2R7D A;  1A3T A;  2NWG A;  1KDA A;  5JOB A;  1KC8 C;  4NB3 A;  1SFO H;  1BKB A;  3S16 B;  5IOC A;  3GTK H;  2K14 A;  3RN5 A;  4JBW A;  1SAP A;  1A15 A;  2JEB I;  5BN4 A;  4OWW B;  1M90 C;  1EYG A;  1PH9 A;  3QR8 A;  1FNW A;  1AZP A;  2ZXP A;  4X65 L;  4DR4 L;  4K8I A;  4G7H C;  2JA5 H;  3PF5 A;  4L5S A;  1IHZ A;  4CJ0 B;  2A73 B;  1T5X D;  1O7I A;  2SDF A;  3A8K E;  4JI5 Q;  2Y0S B;  4K5X A;  1X56 A;  2UUA Q;  3L2P A;  2E2I H;  1K8O A;  3ND9 A;  4JBM A;  4DFA A;  1FYC A;  1JOO A;  4KKT A;  1QVC A;  2B2U A;  2K52 A;  1VQ7 A;  3ND8 A;  5BR8 L;  5C3X A;  5M3F B;  4HCS A;  5I6Y A;  2RCN A;  1NMF A;  3U9S A;  2PNR C;  1Q3L A;  3HOZ H;  3QIA A;  1MGS A;  4JI4 L;  1VF7 A;  3GTM H;  4DK0 A;  2UU9 L;  1R4Q B;  5C4Z A;  3A54 A;  1HNW Q;  3OMG A;  1MBY A;  2RCF A;  2DUD A;  2MP1 A;  1F77 A;  4DUY L;  1WTW A;  2DN8 A;  1HR0 L;  2UXB L;  4A93 B;  3GTO H;  4DV7 L;  2ZJR A;  1ASZ A;  4BWG B;  2F0I A;  2K1B A;  3AB9 A;  1L1O B;  5JEA H;  3GTG H;  2RVL A;  3S2H B;  4N8X 1;  3CHB D;  2F0P A;  2N8N A;  2PZU A;  4LFA L;  2B2W C;  1RTO A;  3HKZ B;  5M3M G;  2EXZ A;  2OT2 A;  3FPP A;  1B4O A;  4XT3 B;  5E3F A;  2TSS A;  1ENA A;  3CRL C;  3BS1 A;  5BN5 A;  3OTO Q;  3GTL H;  2HQL A;  4IOA A;  4MTK A;  4UAI A;  3K81 C;  1HZB A;  4IUU A;  4PNY A;  3RLO A;  4TQU S;  1DGS A;  3JAM L;  4BY7 B;  4IUT A;  1R9T B;  4JCV E;  1X3P A;  4YWL A;  2UXC L;  3E6Z X;  5EPJ A;  4I65 A;  2ZJQ A;  2CH4 W;  2VZA A;  1IYV A;  2D62 A;  1XPO A;  2ZTE A;  1GUO A;  4LF7 L;  3IL8 A;  5FO8 B;  1B44 D;  1DCZ A;  1QE6 A;  1XMO Q;  4PMW A;  4IUR A;  1LT3 D;  2F03 A;  4X64 L;  2UXD Q;  2EQS A;  4ABN A;  2YTX A;  4CDC C;  3R3O A;  2NVT H;  3E9H A;  1STY A;  5C3E B;  4FVM A;  5JJI A;  1PH2 A;  4MTN A;  2B3G A;  1E3P A;  4B3R L;  1EIF A;  1CI3 M;  1F9S A;  1I3Q H;  5IYC G;  1PFS A;  2Y0S G;  1X55 A;  4GN3 B;  1NNX A;  4G7Z C;  1PH4 A;  3M3Y B;  5G3L F;  2M00 A;  3PIP 3;  4ME5 A;  1HZ9 A;  1Y8O B;  2GVA A;  1D8L A;  1PRT B;  3A0J A;  3V96 A;  2EYH A;  1YZ6 A;  2Q8T A;  1SYE A;  4CDF C;  1H9J A;  4ZK9 B;  5JPN C;  1EIH A;  2LXJ A;  1LYL A;  1XXG A;  2K75 A;  3RLN A;  4A3J H;  2R92 G;  4PZ8 A;  4LF8 L;  4TKO B;  5IOD A;  1U4R A;  1EEF D;  2XSC A;  1SMX A;  1CA6 A;  1GUN A;  3S1Q H;  2YV5 A;  4DV0 L;  1PA6 A;  1CKN A;  1WTV A;  2BH2 A;  3M9B A;  3ITP A;  2F0L A;  4H7B A;  2UUC Q;  3NEL A;  1PTO D;  5HGQ A;  3PCO B;  2EPB A;  1XWE A;  3NUC A;  2FHT A;  4BXX G;  3HOV H;  1A3V A;  2B2T A;  4ZKC B;  4MN3 A;  3M4P A;  5M5Y H;  4DKA C;  4KHV A;  2PZT A;  1E0B A;  1C9O A;  2XVS A;  2L15 A;  3NXW A;  4ILW A;  3CW2 C;  3F2B A;  1RL2 A;  4JI7 Q;  1FL0 A;  3HKZ G;  2PW5 A;  1BNZ A;  5GAH C;  3A8J E;  3EIV A;  5E7N A;  1NR4 A;  1C0A A;  3A56 A;  3M85 A;  3HOX H;  4K6L A;  4V19 0;  4K14 A;  4FP5 D;  5C4J B;  4A3D H;  2D0O A;  3S14 H;  4POG A;  1SEB D;  1I4H A;  1LAC A;  5C5L A;  4GZY C;  1FJG Q;  3E5S A;  1NBW A;  4BY7 G;  5ISR A;  1PH7 A;  1TWG B;  4JI0 Q;  2XNA C;  2EYP A;  4IUN A;  2ZXO A;  1EQQ A;  1YNX A;  4CJ2 C;  2QKI C;  4CBV A;  2JA7 H;  2F4V L;  1SNO A;  1OXX K;  1JB7 A;  4EQP A;  4GNX B;  5C3E G;  2EJF C;  4DR6 Q;  2SNS A;  4NXM Q;  4DR1 L;  3KLR A;  2L9H A;  3PGZ A;  3CF5 A;  4CKB A;  1BCP F;  3G4S A;  1LT4 D;  3DWA A;  3GTK B;  2N88 A;  3BJU A;  4GNX C;  4WJ4 A;  1EOV A;  3KF6 B;  5ELF A;  2DNE A;  4EQ5 A;  1MIU A;  2BH8 A;  1NMG A;  1SE2 A;  2KA7 A;  1A62 A;  1Q8I A;  3QO2 A;  4DV1 L;  2SOB A;  2VQF Q;  4RHR A;  1WJJ A;  3RNU A;  4WJ3 M;  4LMQ D;  4JI3 Q;  3N6R A;  5C5M A;  4PZ6 A;  3KF8 B;  2NTT A;  1EOT A;  2G9D A;  4ZUJ A;  3TP7 A;  3RZO H;  3H3V I;  3GO5 A;  1K0S A;  1S5F D;  1KAB A;  1GUG A;  1SYD A;  3LWU A;  2AWN A;  3CU7 A;  3P7J A;  1QNU A;  2B8F A;  1UUP A;  3TS2 A;  2HDL A;  1EYA A;  1ICW A;  2Y0S E;  1EQV A;  5KND A;  2B8G A;  4CGY B;  3UDG A;  2JK8 A;  1MJC A;  3BZK A;  2IHF A;  1DXM A;  2BCO A;  3OMC A;  3RZD H;  3IRB A;  4X66 L;  1QZG A;  1KHI A;  3P75 A;  1IBM L;  4OEL B;  2MO1 A;  1I6V C;  1GOZ A;  3Q6S A;  3ICE A;  3MXG A;  5IT9 L;  1UE1 A;  2LY7 A;  5AFW A;  1HA6 A;  1U4L A;  1HNZ L;  1IXR A;  4LF4 L;  1VQ5 A;  4V0B A;  4G7O C;  2PZW A;  4HAE A;  1XNR Q;  1RDP D;  5CGK A;  5K5P A;  2FMC A;  1MI2 A;  4R4Q A;  5M3M H;  2N78 A;  2I07 B;  4FF2 A;  4PG3 A;  4FXK C;  3DLL A;  4XYQ A;  3BVG A;  3HOY G;  4JOI C;  1KNE A;  1WYD A;  1LTL A;  1VCI A;  4L5Q A;  2Q8R E;  2D9U A;  2Z6B A;  2B2U C;  4LFC Q;  2L11 A;  4QIW E;  3WWV A;  3H91 A;  1X54 A;  2WKD A;  1W6K A;  4IPG A;  1SLJ A;  3MXN B;  4HMJ A;  1YNJ C;  2Z4H A;  3M4Y A;  3HKZ E;  1O7L A;  3S16 H;  4HJ5 A;  3W3A A;  2KEC A;  2QF7 A;  3BZC A;  3KJP A;  1J5E Q;  3FEW X;  2PW7 A;  4JYA L;  4R8I A;  3TZU A;  1WTP A;  2EE1 A;  2OQ0 A;  3TSS A;  1JT8 A;  1LLR D;  2K28 A;  1B53 A;  1AH9 A;  1W2B A;  1O7Y A;  3MFG A;  2JN4 A;  2H1E A;  3FKI B;  3BZD B;  1Q46 A;  3STB D;  4KLK A;  1XTD A;  1CHP D;  2WIN B;  3J81 L;  5C0X G;  4IAL A;  5KGU A;  4YWM A;  5FO7 B;  1B2T A;  1OO9 B;  4X62 Q;  1OXT A;  5IYC H;  1B9N A;  2XRQ D;  3DXJ C;  4PZ7 A;  3CQZ B;  4LUV A;  5CV7 A;  4QL5 A;  5LMN Q;  1D5Z C;  2B2W A;  2EDG A;  3Q24 A;  2E5L Q;  4DXG A;  4CKC A;  3CXC A;  1EU4 A;  1H9K A;  4OIK A;  5CC4 A;  1U4M A;  2ZM6 L;  1U4P A;  1ZYR C;  2SEB D;  2PO4 A;  4OO1 I;  4K0K L;  3C1E A;  1S5C D;  1HCZ A;  2VW9 A;  3OW7 A;  2R92 H;  5ELD A;  2LXK A;  5LHY 1;  4O2D A;  3L9A X;  1ESF A;  3HOU H;  3CP0 A;  4YCW A;  1TWF H;  5M5W B;  1OXU A;  3VDY A;  5IYD G;  4KK7 A;  1JR0 D;  4DV2 L;  2NYZ D;  1B9M A;  4L63 B;  2R3Z A;  1QJO A;  1WCM B;  2JJQ A;  4DR7 L;  4QQB X;  1NAP A;  3FVQ A;  3J80 i;  4BXX H;  1JE4 A;  2A1A A;  3S2H H;  1JQY D;  2XWJ B;  3K7U C;  3DEO A;  3IKJ A;  3J80 E;  3HOV B;  4AYB B;  4LWC A;  1U5K A;  1T9H A;  1X3F A;  1I4X A;  2JA8 B;  5H1S E;  1HZA A;  1N32 Q;  3Q8D A;  4LK1 C;  3GTJ B;  1HTP A;  3S24 A;  1D7Q A;  3TME A;  4XQQ A;  3VYR A;  4DNI A;  2WKC A;  4RGO S;  2CW0 C;  3I7F A;  3X3N A;  2Q2I A;  1K83 B;  4JV5 L;  3VR2 A;  4ZRZ A;  2IJ0 A;  3H94 A;  1LTI D;  4LF6 Q;  3RR5 A;  3FKI G;  4QY7 A;  1P8L A;  1O78 A;  4CHT B;  4EQO A;  2VQE L;  1PDQ A;  5C3E H;  1Q1E A;  3HFZ B;  3VR5 A;  1HNX Q;  2BE5 D;  3VYU A;  1RF2 D;  1KTK A;  3PIO A;  5JVG 3;  1PFN A;  2BDO A;  4B3M L;  2RDH A;  4KKU A;  1AP0 A;  1PH5 A;  3D3R A;  2IY5 B;  1YJW A;  4OO1 G;  1O7Z A;  2V4D A;  3M3Y H;  1JC7 A;  4LUO A;  5KIX A;  2NVY B;  3FMC A;  4RG1 A;  3MXP A;  1N36 Q;  1RKN A;  3TP8 A;  1F2L A;  1YVC A;  4HCE A;  4J15 A;  1PMR A;  1K8G A;  5COR A;  2IW3 A;  3T1H L;  2HQE A;  5L37 A;  4XQJ A;  1XNQ L;  4A3C G;  1J6Q A;  1SNC A;  4A3M B;  4GOP C;  3U4V A;  2A68 D;  1BO0 A;  3GV3 A;  1WCM G;  1V1P B;  4JG2 A;  5IP7 G;  1BQQ T;  4A3L G;  2K50 A;  5M9O A;  1II3 A;  2NN6 I;  4QUC A;  5KYL A;  2AQ1 B;  4HIO A;  1KAW A;  1E2V A;  1M1K C;  4AYB G;  1LO5 D;  3OIP A;  3HZX A;  1DM0 B;  4FF3 A;  1SYB A;  4GKJ Q;  5EKI A;  4K6D A;  2JA8 G;  4K2K A;  4NMZ A;  5IGE A;  1I4P A;  5NUC A;  4RCO A;  2XN9 C;  1SJE D;  3HS0 C;  4IUP A;  2F0M A;  3DWQ A;  5C4J H;  1DOK A;  1I94 Q;  4GNX A;  1EY7 A;  2YTY A;  1TKW B;  3A55 A;  3PQI A;  1SN8 A;  1YEZ A;  3E3X A;  2QW7 A;  1H9M A;  1HQR D;  3H09 A;  2AWO A;  4ALP A;  1S4Z A;  1IW7 C;  4J6H A;  5FOB B;  1TWG H;  4Y7N B;  1FNV A;  4IJH A;  2EY1 A;  1BUV T;  1YNJ D;  3MEF A;  2FXQ A;  2KEE A;  1X32 A;  5A2Q E;  3DM1 A;  3CCU A;  3VR4 A;  3MA2 B;  1VQM A;  4LF9 Q;  2F3V A;  4XTC S;  3KF6 A;  3KYH C;  4ZLT F;  4L5T A;  4U67 3;  3HOY H;  4BBS B;  4FXG C;  2DJF C;  2EZV A;  2O5J C;  1NR2 A;  3UDI A;  3DEP A;  4DV4 L;  4P72 A;  2A69 D;  4KMU C;  3KF8 A;  1SE8 A;  3NEN A;  2E75 C;  1UEA B;  1YNN D;  2K5D A;  4HSP A;  4ZKB B;  1EWH A;  3H3V H;  1C4Q A;  3D6C A;  4OON A;  4YWK A;  4CDE C;  2E2H H;  2PI2 E;  2HDM A;  3BDC A;  3I91 A;  2ENB A;  1Z7T A;  2VUM B;  5C0X H;  4LFB Q;  3TS0 A;  2C5C A;  3W5O A;  3DUZ A;  1SMY C;  1VQD A;  1SNQ A;  4TVA B;  2F0G A;  4AQY Q;  4A3M G;  2Q2T A;  4KJN A;  1Q8K A;  3SVM A;  3F1Z A;  3UE0 A;  3A7A B;  2QEJ C;  4KN7 C;  3FRP B;  3A74 A;  1LTG D;  3Q22 A;  1JWS D;  2MHV A;  2F3I A;  3AYH B;  4HMI A;  4KN4 C;  3X3M A;  1G51 A;  1PZI D;  4B3T L;  1SND A;  4JOI A;  1DOL A;  2L4N A;  3FDT A;  3I3C A;  2M9V A;  4JI5 L;  3SHL A;  2UUA L;  2I5H A;  1YJN A;  3BYT B;  4RFB A;  3C2P A;  2HHH L;  2C9O A;  2Z9H A;  3MVV A;  4JK1 C;  5COY A;  4C3J B;  2R92 B;  4R1J A;  3HOU B;  5IYD H;  1TWF B;  1BCP B;  1I50 B;  2G9H D;  3QOL A;  4B9X A;  3TP5 A;  1X3E A;  2PMZ B;  2B63 B;  5EBC A;  2J4X A;  3MXN A;  1HNW L;  2PI2 A;  3R2I A;  4NPS A;  5KNB A;  2UU9 Q;  5GAE C;  4JI8 L;  3U50 C;  3CCQ A;  4PMB A;  5LL6 S;  1NUC A;  2LS0 1;  1QIL A;  2R6G A;  2XIW A;  1BCP C;  1BBX C;  3D0F A;  3UDX A;  1HR0 Q;  2CW0 D;  5FLX L;  4QCL A;  2EJG C;  4EQN A;  3D4R A;  4BBS G;  2F0W A;  1Y1W B;  2JYO A;  1JWM D;  1NJI C;  5D3D A;  1H9S B;  1PZJ D;  3SXH A;  1KLU D;  3CCV A;  4DAP A;  5C44 H;  4AYB E;  3T51 B;  3QG1 A;  1L1O C;  2CVR A;  3D6W A;  4OHJ A;  4BBR H;  2MQH A;  2Q2H A;  4A3F B;  1VMC A;  2NVX B;  1HTL D;  4G4K A;  3P20 A;  2GN5 A;  1BXT A;  1HXY D;  4B3S L;  4I7Z C;  4JPB W;  1EUJ A;  1ASY A;  3NBI A;  1EQR A;  3GD7 A;  3FKI H;  3CCE A;  1SE3 A;  3H0G G;  5E1F A;  5I9O A;  2VUM G;  3VR3 A;  1RTN A;  3B6Y A;  4POF A;  4C1N I;  4JI6 Q;  2N3S A;  5LMU L;  3W1B A;  5CV4 A;  1JJG A;  2MNA A;  5J3B A;  1HUM A;  2PQA A;  3CQZ H;  3I4L A;  4OO1 H;  3SEB A;  3OW2 A;  5IGB A;  4RMF A;  1NTG A;  1VQF A;  4HIK A;  1Q7Y C;  4IN3 A;  4WJW A;  2EOT A;  4IZ8 A;  4P73 A;  3NK9 A;  1O80 A;  1PTO F;  4YCV A;  4C2M B;  4K8J A;  5FJ8 G;  4X3U A;  1CHQ D;  1HFG A;  3LNN A;  4ZCK A;  2WAQ B;  1X3G A;  2PNH A;  3KOJ A;  2OTJ A;  5E4W C;  1S72 A;  4DR3 Q;  1MSG A;  3ERO A;  3CME A;  3A5U A;  1X9N A;  1AE3 A;  4A3C H;  4C3J G;  1EU3 A;  1JJC B;  1VS0 A;  5M5W H;  4LAA A;  4DR2 Q;  1JOQ A;  3HOU G;  1EY6 A;  1MD2 D;  2VB3 X;  3LGJ A;  1QCB D;  5GAG C;  2MO0 A;  3SDZ A;  3CCJ A;  5GRO A;  1PRT C;  5I2X A;  1WCM H;  1WOC A;  4FDB A;  3RN2 A;  5JJL A;  2B63 G;  5IP7 H;  4PMC A;  4A3L H;  1DON A;  4YCU A;  3JAM i;  4UP7 A;  3QB3 A;  1OXV A;  3K7A B;  5D65 A;  5CV8 A;  4IQZ A;  3JAM E;  1IBK Q;  2UUC L;  3K57 A;  2F0S A;  3KK7 A;  1A8V A;  1A63 A;  1V8Q A;  1U0L A;  2B2Y C;  3KLW A;  2JA8 H;  3H15 A;  3J7A V;  1Y1W G;  3MTS A;  3PUW A;  1D5M C;  1R4P B;  3ZJY C;  2YU9 B;  4DAV A;  4LW1 A;  2JA6 B;  4GKK Q;  3M7G A;  3GTJ H;  1TQO A;  1D1K A;  1BDO A;  1OTC A;  4BS9 A;  1PH8 A;  1EWI A;  2XRS D;  1RJT A;  3KDF A;  1IBL Q;  1F2Y A;  5K36 G;  5JJZ A;  5KRU A;  2A19 A;  3I2Z A;  4A3F G;  3GTQ B;  3ULL A;  2I5L X;  1D2B A;  1SRU A;  1K83 H;  1XYI A;  2NTS A;  1IKM A;  3CKI B;  1YHB A;  4RA8 A;  1XMQ L;  4GOP A;  4A4I A;  4OGQ C;  2AUK A;  2F4I A;  1VQ8 A;  4JI0 L;  3FHW A;  4RGM A;  1JJ2 A;  4DK6 C;  2F0Q A;  4EX5 A;  3S1M B;  1YIJ A;  3HOY B;  3ER0 A;  5FKA C;  3OPO A;  2RKS A;  3CMA A;  2WB1 B;  2HCC A;  3NBH B;  4MHE A;  2KCN A;  1H95 A;  2OF1 A;  4Z9C B;  1L0Y B;  4JI2 L;  4LF5 Q;  3HEJ A;  2H4O A;  2F4V Q;  2J7Z A;  2KHI A;  4DR6 L;  1A3U A;  2A6E C;  4NXM L;  3KLS X;  1CKM A;  2NVY H;  1V1P A;  4IOC A;  2K7V A;  3SK5 A;  4GLX A;  1CSP A;  4K5W A;  1JOR A;  2OCE A;  2WAQ G;  2E2H B;  1DYQ A;  1Q1B A;  1VQH A;  4A3K G;  3K5L A;  2IWH A;  5F2D A;  2K03 A;  2HUG A;  3RMH A;  3FPU B;  4DAY B;  4AH6 A;  1NY4 A;  1UE6 A;  4KD3 A;  2FFK B;  1TS5 A;  4A3M H;  1KQS A;  4S3S A;  2QDB A;  5AJ3 Q;  1E24 A;  4RHS A;  2YTV A;  3GQB A;  2VQF L;  4H0L C;  3DHQ A;  1EY8 A;  4RH6 A;  4A3E B;  3PV0 A;  1SYG A;  2BOS A;  1N33 L;  3H3V C;  4FNF A;  4JI3 L;  2WII B;  1TS2 A;  1QUQ B;  4DV3 L;  2F0O A;  1STN A;  5A35 A;  2EY2 A;  5DNF A;  3E0J A;  1WD1 A;  3EA6 A;  5HY6 A;  1VDZ A;  2KVM A;  1TT2 A;  4A3I B;  3NWS A;  3G7L A;  1HFN A;  4WRD A;  1Y8P B;  1EY5 A;  1KDC A;  4DV6 L;  2JA6 G;  1ONL A;  3S9W A;  4E6I A;  5CBE E;  1V1O A;  3TEH B;  3UDF A;  2KHS A;  1C7Y A;  3U9O A;  5EJW A;  4CJ1 B;  2DGY A;  4Y7N H;  4IPH A;  5T1I A;  3AEV A;  1QWY A;  5KEE A;  1B70 B;  5CYU A;  4KY7 A;  1CQV A;  4TRD A;  3GTP B;  3A7L A;  1CKO A;  1STA A;  2F0U A;  2PMZ E;  2HD3 A;  4YHH Q;  4DNT B;  1HNZ Q;  5ELN A;  5CV9 A;  3QWN A;  4BBS H;  4DGZ A;  4EVO A;  4KV6 A;  4JI1 Q;  3K5M A;  4APV A;  3BU2 A;  3EVQ A;  4QB4 A;  2R7F A;  4JC0 A;  3NSW A;  2RQX A;  2CWP A;  2QDL A;  4R8N A;  5EPK A;  1B50 A;  3V2T A;  2WB1 G;  4ZQ3 A;  1QG7 A;  1Q86 C;  3JC6 6;  5C44 B;  4Q5V A;  2L5T A;  2E2D C;  1UE7 A;  1DOM A;  2SNM A;  3W2D A;  2ZJP A;  2QA4 A;  2MGS A;  4LFC L;  1STE A;  3F2C A;  4BBR B;  1F2Z A;  2F0F A;  3U58 A;  3V05 A;  1G8Z D;  4N8F A;  2N55 A;  4DR5 L;  1ILP A;  1KNA A;  5IIF A;  1VQA A;  1LTT D;  2NUC A;  1J5E L;  2CKZ B;  2IT1 A;  1QNK A;  3H0G H;  4H44 C;  3I8Z A;  1EWC A;  1TR5 A;  4GN5 A;  4F88 A;  2VUM H;  1SBB B;  1I6H H;  3AMU A;  3MXU A;  5HGT A;  1Q82 C;  2L55 A;  4R4O A;  4ZAI A;  3RLF A;  1EIY B;  1Z6H A;  4LJZ C;  2BA1 A;  1CM9 A;  1ROD A;  2KEN A;  3OIQ A;  3OWE B;  2XWB B;  1RHP A;  3D8G A;  4A3E G;  1W6J A;  1MSH A;  2F1M A;  4HSV A;  1PVO A;  1HUN A;  2QCP X;  2QGQ A;  3NTK A;  1S3O A;  4X62 L;  1N34 L;  4TSS A;  1IL8 A;  5FJ8 H;  4N9T A;  5IT9 E;  1GM5 A;  2K5W A;  4OX9 Q;  1L1O A;  2E5L L;  3GDE A;  2C35 B;  3T1Y L;  4A3I G;  3EBE A;  4M8A A;  1YIT A;  4GLV B;  5JAV A;  3D4D A;  2RHQ B;  4C3J H;  3UE1 A;  2D5D A;  3ERS X;  2A6H C;  5EQ0 A;  1EZ8 A;  3M4O B;  3ZYY X;  3QOJ A;  4IPC A;  3PO3 B;  4CKE A;  2KBN A;  1I50 H;  2ZM6 Q;  3VA7 A;  5EGT A;  2EYM A;  2B63 H;  5T1G A;  1M8A A;  4IUV A;  4K0K Q;  2GA4 B;  2H5X A;  3ONA B;  4UP9 A;  3OSO A;  2PYK A;  5IGD A;  4K5V A;  2L12 A;  4DU9 A;  2IX1 A;  3J81 j;  3TZD A;  1L0X B;  4UHV A;  1LUZ A;  4OWT B;  4A76 A; 
#chains in the Genus database with same CATH homology
 5C4X H;  5JJK A;  3KF6 A;  3PSI A;  4A75 A;  3KYH C;  4X64 L;  1QZH A;  2UXD Q;  2EQS A;  2I5M X;  4L5T A;  2NVT H;  2YTX A;  3E0E A;  3HOY H;  2D0P A;  3E9H A;  1N33 Q;  2XGT A;  1Y1W H;  1HR0 W;  3F2D A;  1RIP A;  5JJI A;  4DV3 Q;  1VQK A;  1V9P A;  1PH2 A;  4MTN A;  3S1R H;  3J81 i;  2B3G A;  2YYZ A;  1E3P A;  2QEX A;  1EIF A;  1I3Q H;  3UDI A;  4NXN Q;  4B3R L;  1VQN A;  5IYC G;  4DV4 L;  1PFS A;  4P72 A;  5C44 G;  5IT9 c;  2Y0S G;  1X55 A;  4GN3 B;  3S15 H;  1SE8 A;  5C0X I;  4A3F H;  1PH4 A;  1N32 L;  3PUX A;  2NVX H;  4BBR G;  3J7A 5;  4A3B H;  1HZ9 A;  2GVA A;  3NEN A;  1D8L A;  2E8G A;  4DV5 Q;  4DV6 Q;  3A0J A;  2VNU D;  1YZ6 A;  2JA9 A;  4X66 Q;  1VQP A;  3H3V H;  4OON A;  4YWK A;  4HIM A;  2PI2 E;  2E2H H;  1IBM Q;  3CC7 A;  4LF9 Q;  2LXJ A;  1LYL A;  2K75 A;  4XIG S;  3RLN A;  4A3J H;  3TS0 A;  4LFB Q;  2R92 G;  5IYB G;  4PZ8 A;  2F52 A;  3W5O A;  4LF8 L;  1XNR L;  1VQD A;  1A0I A;  4TVA B;  4LF4 Q;  1SMX A;  4A3M G;  4AQY Q;  2Q2T A;  4LF6 L;  3I4N H;  1Q8K A;  3CCL A;  3F1Z A;  2CQO A;  3UE0 A;  2YV5 A;  4DV0 L;  1PA6 A;  1PH1 A;  3S1Q H;  4YHH L;  3I4O A;  1BVS A;  5FLM G;  1CKN A;  4JI1 L;  3M9B A;  1I5F A;  4IJL A;  3J80 c;  1HNX L;  3A74 A;  4AIM A;  1VQ9 A;  2UUC Q;  2VQE Q;  2JE6 I;  3NEL A;  5HGQ A;  3PCO B;  2F3I A;  1B7Y B;  3AYH B;  4BA2 I;  2IX0 A;  4BXX G;  1G51 A;  3HOV H;  4B3T L;  1TWH H;  4JOI A;  4IPD A;  4C2M H;  3AFQ A;  3M4P A;  5M5Y H;  1PHJ A;  4DKA C;  4JI5 L;  2UUA L;  3CD6 A;  4JYA L;  2WB1 E;  3PF4 A;  2I5H A;  1C9O A;  1B8A A;  2L15 A;  3F2B A;  1YJN A;  3CW2 C;  3HOW G;  1RL2 A;  2CFM A;  1FL0 A;  3HKZ G;  4JI7 Q;  5GAH C;  5E7N A;  2VL6 A;  3EIV A;  4A3K H;  2HHH L;  2ASB A;  3M7N A;  3CCR A;  1C0A A;  3J81 c;  3M85 A;  3HOX H;  2BH2 A;  1X65 A;  4MNO A;  3CCM A;  4IFD I;  4JYA Q;  4A3D H;  4R1J A;  2RF4 A;  2D0O A;  4DR5 Q;  4UP8 A;  5IYD H;  1EFW A;  3PO3 G;  3S14 H;  4POG A;  2JEA I;  1X3E A;  4C3I H;  1FJG Q;  1NBW A;  4DUZ Q;  3OYY A;  4BY7 G;  1HNW L;  1PH7 A;  1VQO A;  4JI0 Q;  2PI2 A;  4P74 A;  4NPS A;  1GO3 E;  4ME3 A;  2UU9 Q;  1GVP A;  3FP9 A;  5GAE C;  4JI8 L;  1XNQ Q;  3U50 C;  3K7A H;  3CCQ A;  2KCT A;  1EQQ A;  1JMC A;  1YNX A;  4LUZ A;  3F8T A;  2HIV A;  1YHQ A;  2R6G A;  4UPA A;  5LMN L;  2WP8 J;  3D0F A;  3UDX A;  3G71 A;  1HR0 Q;  2F4V L;  2JA7 H;  1X6O A;  4R4I A;  4Y52 H;  1OXX K;  1XJV A;  1JB7 A;  2R93 G;  4GNX B;  4BBS G;  1L2F A;  5C3E G;  4X6A H;  1NJI C;  2JA5 G;  5IY0 A;  2YU9 H;  1E1T A;  1Z47 A;  2BA0 A;  2KHJ A;  4IO9 A;  4QJF A;  2JA6 H;  4OX9 L;  3CCV A;  3CPF A;  5C44 H;  4AYB E;  4DR6 Q;  3CPW A;  1L1O C;  1N34 Q;  4NXM Q;  4DR1 L;  1KD1 C;  3PGZ A;  3CF5 A;  2B29 A;  4BBR H;  1L0W A;  2MQH A;  3G4S A;  4DK3 C;  3T1Y Q;  2Q2H A;  2WAQ E;  3GTQ H;  1NE3 A;  4H02 A;  1VQI A;  3BJU A;  4GNX C;  4WJ4 A;  2GN5 A;  2MFI A;  2OWO A;  1EOV A;  3KF6 B;  4PMW A;  5M3F H;  4B3S L;  1G29 1;  2A8V A;  2I0Q A;  1EUJ A;  4EQ5 A;  1MIU A;  1ASY A;  2BH8 A;  1NMG A;  1EQR A;  2OTL A;  2UUB L;  3S1N H;  1A62 A;  3GD7 A;  4DAM A;  3FKI H;  3CCE A;  4KHP Q;  3S17 H;  5IP9 H;  4DV1 L;  4BY1 G;  3H0G G;  2VQF Q;  4OWX B;  2IHE A;  4LNQ A;  3HOZ G;  4DV2 Q;  5IWA Q;  3S1M H;  1JE5 A;  1WJJ A;  1A63 A;  2VUM G;  3RNU A;  1VQM A;  2PQA B;  3B6Y A;  1YJ9 A;  3I4M H;  4DR7 Q;  1FGU A;  3PUY A;  5ELO A;  4WJ3 M;  1CUK A;  4POF A;  1YI2 A;  1PH6 A;  4JI3 Q;  2E2J H;  2JQO A;  4PZ6 A;  4JI6 Q;  2N3S A;  2XTI A;  3KF8 B;  5LMU L;  4A93 H;  1UWV A;  3W1B A;  3RZO H;  1IZ6 A;  1JJG A;  2MNA A;  1N8R C;  3GO5 A;  1SR3 A;  3CQZ H;  2PQA A;  3E9I A;  5J3B A;  2HT1 A;  3H3V I;  3OW2 A;  4RMF A;  2AWN A;  1NTG A;  1VQF A;  4YY3 L;  3DM3 A;  3TQY A;  5LMN W;  4HIK A;  1Q7Y C;  4P73 A;  4NXN L;  5JEA G;  1VQ4 A;  4YCV A;  1KRT A;  3NEM A;  3TS2 A;  2V1C C;  2K4K A;  3I56 A;  5FJ8 G;  2HIX A;  5M5X H;  2Y0S E;  1PYB A;  4R4T A;  1UEB A;  1X3G A;  2PNH A;  2ZTC A;  3KOJ A;  3UDG A;  3CC4 A;  2JK8 A;  1MJC A;  2OTJ A;  3BZK A;  1S72 A;  4DR3 Q;  1TWA H;  2IHF A;  3ULJ A;  3A5U A;  3CME A;  4DV5 L;  1X9N A;  1AE3 A;  4A3C H;  4JBK A;  3RZD H;  2RHS B;  3IRB A;  4X66 L;  1QZG A;  1CKN B;  1JJC B;  1GD7 A;  1KHI A;  1VS0 A;  5M5W H;  4DR2 Q;  1IBM L;  2NN6 G;  2MO1 A;  3HOU G;  4JV5 Q;  3LGJ A;  5GAG C;  2MO0 A;  1R9T H;  2ZTD A;  3A5Z B;  5GRO A;  3CCJ A;  1Q81 C;  3ICE A;  4BY7 H;  1UE1 A;  1WCM H;  1WOC A;  4FDB A;  5JEA J;  3RN2 A;  4LFB L;  3I55 A;  1IXR A;  2NZH A;  4A3E H;  1HNZ L;  2B63 G;  5IP7 H;  5JJL A;  4LF4 L;  3ULP A;  1CSQ A;  4AQY L;  4YCU A;  1VQ5 A;  4A3L H;  4X65 Q;  1Y1V G;  4DR4 Q;  3JAM i;  2AHO B;  4GLA C;  1E1O A;  4UP7 A;  1OXV A;  1XNR Q;  1S40 A;  3CCS A;  4HJ8 A;  1IBK Q;  2UUC L;  1MJE A;  1HZC A;  4R4Q A;  4A3G G;  5M3M H;  1YHA A;  2N78 A;  2R93 H;  5C4X G;  1N9W A;  1A8V A;  2Z0S A;  4PG3 A;  1U0L A;  3KLW A;  3DLL A;  3TRE A;  4A3I H;  4B3M Q;  2JA8 H;  4JOI C;  3HOY G;  2ES2 A;  1WYD A;  1LTL A;  1VCI A;  3KDF B;  4L5Q A;  3H15 A;  1PH3 A;  1Y1W G;  3PUW A;  2K5N A;  1FVI A;  3ZJY C;  4LFC Q;  4QIW E;  4LW1 A;  4QGU A;  3WWV A;  4B3T Q;  4GKK Q;  1N36 L;  3GTJ H;  1X54 A;  1OTC A;  4IPG A;  1SLJ A;  1EWI A;  3MXN B;  1PH8 A;  3PO2 H;  3K0X A;  3HKZ E;  3KDF A;  1IBL Q;  5BR8 Q;  4L5R C;  3S16 H;  5K36 G;  4HJ5 A;  2A19 A;  1KL9 A;  1IL2 A;  3BZC A;  3I2Z A;  3KJP A;  4GOP B;  4A3F G;  4HID A;  1J5E Q;  2HHH Q;  5DLQ E;  4A3G H;  4A3B G;  3ULL A;  2I5L X;  4JI4 Q;  3HKS A;  3T1H Q;  1SRU A;  1K83 H;  2OQ0 A;  1KIX A;  4C3H H;  1JT8 A;  1QVG A;  2CWA A;  2R7Z H;  1AH9 A;  1W2B A;  1VQC A;  1YHB A;  1XMQ L;  3GTP H;  4GOP A;  3STB D;  1Q46 A;  4DUZ L;  4KLK A;  2Z6K A;  4A4I A;  1XTD A;  4HJ7 A;  1VQ8 A;  3FHW A;  4JI0 L;  1JJ2 A;  4DK6 C;  3G6E A;  4DUY Q;  2AKW B;  4EX5 A;  2UXB Q;  2CCZ A;  1YIJ A;  3S2D H;  5C0X G;  1VQJ A;  1Z9F A;  3ER0 A;  4A3J G;  4DV7 Q;  3U4Z A;  4YWM A;  4JI8 Q;  3CMA A;  3I4N G;  3NBH B;  1WFQ A;  1H95 A;  1E7Z A;  4X62 Q;  1OXT A;  5IYC H;  4GKJ L;  3CC2 A;  3W1G A;  4PZ7 A;  4LUV A;  5LMN Q;  4QL5 A;  4LFA Q;  4JI2 L;  4LF5 Q;  2F4V Q;  2GVB A;  3OTO L;  2E5L Q;  2KHI A;  4DR6 L;  1HJP A;  4P75 A;  4NXM L;  1I94 L;  3HOV G;  1XPU A;  1CKM A;  3CXC A;  2NVY H;  3PIP A;  1AE2 A;  4IOC A;  1VQE A;  2ZM6 L;  4GLX A;  1CSP A;  3EN2 A;  5C0X J;  2OCE A;  2WAQ G;  4R4C A;  4OO1 I;  1OXS C;  1Q1B A;  2K5V A;  1VQH A;  4K0K L;  4A3K G;  1WI5 A;  5GQO A;  2VW9 A;  3HOX G;  2R92 H;  5IYB H;  2LXK A;  4O2D A;  4DAY B;  2WFW A;  4AH6 A;  1NY4 A;  3CP0 A;  4BA1 I;  3HOU H;  1UE6 A;  4A3M H;  4YCW A;  1KQS A;  1TWF H;  2UXC Q;  3L7Z C;  4B3S Q;  2ATW A;  4A3D G;  5AJ3 Q;  1V43 A;  1E24 A;  1PYS B;  1XMO L;  4KHP L;  1OXU A;  2YTV A;  2VQF L;  4LF9 L;  3VDY A;  5IYD G;  5FLM H;  4DV2 L;  2UUB Q;  5IWA L;  4LF7 Q;  2UXD L;  2JJQ A;  4DR7 L;  1VQB A;  4QQB X;  3PV0 A;  1K9M C;  1N33 L;  3J80 i;  4JI3 L;  4X64 Q;  4BXX H;  4DV3 L;  1TXY A;  1QUQ B;  2A1A A;  2KCM A;  4JI6 L;  3S2H H;  3K7U C;  3J7Z C;  4JBJ A;  4IFD G;  3M4Q A;  4P71 A;  4LWC A;  5HY6 A;  3HOW H;  5LMU Q;  1P16 A;  5GAD C;  1XPR A;  4KI0 A;  1U5K A;  1K3R A;  4OXP A;  4B3R Q;  1QUQ A;  1T9H A;  1X3F A;  2JA7 G;  2EXD A;  5H1S E;  4DPG A;  4DV4 Q;  3KJO A;  1HZA A;  2LSS A;  4YY3 Q;  1Y14 B;  1QVF A;  2NZO A;  1N32 Q;  3Q8D A;  2R7D A;  4DV6 L;  2JA6 G;  3M4O H;  1KC8 C;  4NB3 A;  3S24 A;  3PO3 H;  1D7Q A;  1SFO H;  1G6P A;  3TEH B;  3PUV A;  1BKB A;  3STB C;  4DR3 L;  3UDF A;  3AFP A;  5IE8 A;  3GTK H;  2K14 A;  1YBY A;  1C7Y A;  4DNI A;  3RN5 A;  2ID0 A;  4IFD J;  2DGY A;  1MKH A;  4JBW A;  4Y7N H;  3I7F A;  4IPH A;  4DR2 L;  2Q2I A;  3AEV A;  4JV5 L;  2JEB I;  5M3F G;  1B70 B;  4OWW B;  4LF8 Q;  1M90 C;  1EYG A;  1PH9 A;  1VQL A;  4LF6 Q;  3RR5 A;  3FKI G;  4QY7 A;  1CKO A;  1HH2 P;  1P8L A;  5IP9 G;  4X65 L;  2PMZ E;  4DV0 Q;  4DR4 L;  2EIF A;  4YHH Q;  2VQE L;  1HNZ Q;  5ELN A;  4BBS H;  5C3E H;  1Q1E A;  3HFZ B;  3PUZ A;  4JI1 Q;  3BU2 A;  4APV A;  1HNX Q;  2JA5 H;  3PF5 A;  3I4M G;  2R7F A;  4L5S A;  1IBK L;  2AMC B;  4JC0 A;  3G48 A;  1LM0 A;  2CWP A;  3PIO A;  2WB1 G;  3L0O A;  1Q86 C;  2ALY B;  3JC6 6;  1PV4 A;  1O7I A;  4B3M L;  4JI7 L;  4A93 G;  4JI5 Q;  2UUA Q;  1X56 A;  1PH5 A;  2IY5 B;  1YJW A;  1UE7 A;  3L2P A;  2E2I H;  4OO1 G;  1V1Q A;  2ZJP A;  2QA4 A;  4KHZ A;  3F2C A;  4LFC L;  4JBM A;  3M3Y H;  4GKK L;  1Q12 A;  3U58 A;  3AQQ A;  1QVC A;  1VQ6 A;  2K52 A;  4LUO A;  4DR5 L;  1VQ7 A;  4RG1 A;  1W3S A;  1IBL L;  5BR8 L;  1N36 Q;  1BBW A;  1KRS A;  2N49 A;  1VQA A;  1YVC A;  4O0A A;  2RCN A;  1NMF A;  1J5E L;  2CKZ B;  2IT1 A;  3CAM A;  4J15 A;  4BY1 H;  3H0G H;  1K8G A;  1FJG L;  3HOZ H;  5FLX c;  4HJ9 A;  4JI4 L;  1IYJ B;  1TWC H;  4GN5 A;  2OQK A;  3T1H L;  3GTM H;  3KFU A;  2VUM H;  1I6H H;  2UU9 L;  1XNQ L;  4A3C G;  1J6Q A;  4GN4 B;  3SGI A;  1HNW Q;  1Q82 C;  1E22 A;  4GOP C;  4R4O A;  4MZ9 A;  2Z6K C;  3RLF A;  4GS3 A;  3U4V A;  1EIY B;  1K73 C;  2BA1 A;  2DUD A;  5EAY A;  2KEN A;  4DUY L;  1XMQ Q;  1KXL A;  1K8A C;  1HR0 L;  2UXB L;  3D31 A;  3GTO H;  1WCM G;  4DV7 L;  2ZJR A;  4A3E G;  1ASZ A;  4JG2 A;  1PVO A;  5IP7 G;  4HJA A;  3JAM c;  4A3L G;  1L1O B;  2K50 A;  2QGQ A;  3GTG H;  3K8A A;  1S3O A;  4X62 L;  2NN6 I;  4HIO A;  2N8N A;  1UE5 A;  1KAW A;  1N34 L;  5FJ8 H;  1M1K C;  4AYB G;  4LF5 L;  4LFA L;  1GM5 A;  2K5H A;  4OX9 Q;  5M3M G;  4GKJ Q;  1L1O A;  2E5L L;  3GDE A;  1VQG A;  2C35 B;  4JI2 Q;  4DR1 Q;  3T1Y L;  4A3I G;  2JA8 G;  1SRO A;  3TRZ A;  3EBE A;  1YIT A;  4GLV B;  3K80 C;  3OTO Q;  3GTL H;  2RHQ B;  2HQL A;  4C3J H;  3UE1 A;  5C4J H;  1I94 Q;  4UY8 C;  2Q2U A;  3ERS X;  4IOA A;  4GNX A;  4IPC A;  2YTY A;  3K81 C;  1HZB A;  1SN8 A;  2KBN A;  1I50 H;  2VS1 A;  2VY3 A;  2ZM6 Q;  1YEZ A;  3PO2 G;  3RLO A;  4TQU S;  1DGS A;  2B63 H;  4JCV E;  2AWO A;  4K0K Q;  4ALP A;  4YWL A;  2UXC L;  2H5X A;  1TWG H;  4UP9 A;  1Y1V H;  4DV1 Q;  5AJ3 L;  4IJH A;  2ZJQ A;  2VZA A;  1BBU A;  2D62 A;  1XPO A;  2ZTE A;  2IX1 A;  3MEF A;  2FXQ A;  4LF7 L;  3CCU A;  3J81 j;  1GKH A;  2NVQ H;  2R7Z G;  1K0R A;  1XMO Q;  1LUZ A;  4OWT B;  4A76 A;  4XTC S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...