1C9OA

Crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD-SHOCK PROTEIN
publication title Thermal stability and atomic-resolution crystal structure of the Bacillus caldolyticus cold shock protein.
pubmed doi rcsb
molecule tags Transcription
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1c9oA00
5C0XG 4HIDA 1MJEA 3ULJA 5C3EH 3JAMc 4LF4Q 2ZM6L 1Y1WG 4DV1L 4DR5Q 1XNRQ 3CXCA 2A1AA 4HIMA 5C44H 4K0KL 3L0OA 2JQOA 3HKSA 3OW2A 1WCMH 3RN2A 3J80c 2AMCB 2Z6KA 2ATWA 3GTMH 3L7ZC 1I50H 4BY1G 4X66L 3F2BA 4JBMA 4JI4Q 4OXPA 3HOVH 1PH9A 3PGZA 4JI2L 1VS0A 1Q86C 2BA0A 2HT1A 4A93G 4GNXA 1J5EQ 1MKHA 2R92H 1PH2A 2JA5H 1N32Q 3CQZH 4A76A 4GOPC 2QA4A 1YHQA 5AJ3Q 3PCOB 4IPCA 4DV4Q 4BY7G 4AQYL 1XNQL 2H5XA 2UUBQ 1X3GA 2K5NA 2Z6KC 1D8LA 3K7AH 1YIJA 1YITA 4DR2Q 1PH5A 1VQ5A 2R7DA 4WJ3M 1UE7A 3HOUG 1Y1VG 3BZKA 1OXXK 3PF4A 4GNXC 3HOXH 2E2JH 3GTGH 2OCEA 1QVGA 3CCMA 4BXXH 2BA1A 3IRBA 2ES2A 3T1HQ 3F2CA 5C44G 1EIYB 1S3OA 1PA6A 1E7ZA 1WCMG 4POFA 2LXKA 3K7UC 4A3EH 4IFDI 4A3LH 1IBLQ 3UDXA 3HOVG 2PNHA 1SLJA 4C3JH 2N8NA 3GTJH 2K4KA 2I5HA 3M85A 2R92G 2JA9A 4DR1Q 2JA5G 4DV4L 1A63A 5HGQA 4R4IA 4DUZQ 1K0RA 1KL9A 3KFUA 2D0PA 1L1OB 5EAYA 4DR6L 3A0JA 1QVFA 1N9WA 2WB1G 4YWMA 1SRUA 1Q8KA 3PUZA 1CKMA 1EFWA 3CPWA 3H0GH 1JJ2A 4JOIC 1YJWA 4LF8Q 1K83H 1P16A 3HOXG 5C0XI 1QUQA 1U5KA 3NELA 4RMFA 3VDYA 4QIWE 5IWAL 4IFDJ 1JJCB 4HJ8A 4JCVE 3G71A 3T1HL 4LUVA 4C3IH 2E2IH 4LF7L 4BXXG 1WI5A 5GROA 2E8GA 2VQFL 1HNZQ 1E1TA 3RLFA 3TREA 1AE2A 5J3BA 5LMUL 4A3MH 1FJGL 1IBKQ 1IBLL 3I7FA 4A3LG 1BBWA 4DV3Q 4IPDA 4GN5A 2JA7H 4DV5Q 3ZJYC 2KHIA 3FHWA 3K8AA 4JI1Q 4GN4B 3LGJA 3U50C 5M5YH 5FLMH 3H3VH 3CCVA 2WP8J 4X65Q 3M3YH 1V1QA 3HKZG 4EQ5A 1Q46A 2FXQA 4R4OA 4JI7Q 3GTLH 2E5LL 2ID0A 1VQMA 2DGYA 3NEMA 3PIPA 1W2BA 3M4PA 1HJPA 1SR3A 5H1SE 3U58A 3PF5A 1ASYA 1PH8A 3M9BA 4LUZA 4EX5A 4JI3Q 1KRTA 3H0GG 1LTLA 1C0AA 2YV5A 1X54A 3S17H 1WFQA 4DK6C 2ZM6Q 2JEBI 3EBEA 4DV1Q 4JV5L 2UXDL 2YTXA 3S24A 1X6OA 1E24A 3TRZA 4K0KQ 3J81c 2ZJPA 1VQ7A 2HHHL 4JI0L 2NVTH 4IFDG 3BJUA 4A3MG 5IYDH 4DK3C 2VUMH 5FLXc 3CMEA 1EQRA 1HZBA 1TWGH 2JA7G 1GVPA 4X66Q 5FLMG 5LMNL 4IOCA 2I5MX 4DV0L 1HNXL 2UXBL 4LUOA 3HOZH 1PH1A 3D31A 4JI2Q 4APVA 4DV2L 1K9MC 1L2FA 3STBC 1S72A 1PH3A 3M4QA 2JK8A 2WFWA 1MIUA 1E1OA 3EN2A 4A3JH 4YCUA 3TEHB 4AQYQ 1XNQQ 1XMOL 3CD6A 5M3FH 1RIPA 4X64L 1BKBA 3CCEA 1S40A 3DM3A 1FGUA 3CCQA 4A3CH 3CMAA 3RZDH 3FP9A 1OTCA 2CQOA 4C3HH 3CPFA 2KHJA 3PSIA 4JBKA 1IBMQ 1N8RC 1CKNA 1FVIA 2R7FA 2F52A 1X9NA 1G51A 4YCWA 3NENA 3PV0A 4XTCS 1N34L 5M5WH 5LMNW 3GD7A 3S16H 1XJVA 5IYDG 4P74A 2CCZA 2RCNA 2MQHA 3HKZE 1L1OA 1VQ6A 2VUMG 5C4XH 4OO1G 4HJ7A 3PUYA 3M7NA 3TS2A 3KYHC 1KXLA 1VQEA 3HOZG 2Z0SA 4OONA 1R9TH 2VNUD 4GN3B 3GTOH 2ZJRA 4R1JA 1HR0L 4JI8L 1IXRA 2RHQB 3J7A5 4B3ML 1PFSA 4A3JG 1V43A 4OWXB 4DR6Q 3K80C 4O2DA 1L1OC 2K5HA 5M3FG 5IY0A 1A8VA 1VQIA 4GKJQ 3A5ZB 1I6HH 3W1GA 2GVAA 1JE5A 3I55A 1AH9A 2K14A 4P75A 5C3EG 3ER0A 2GVBA 1I94Q 4B3TQ 1PH6A 5IWAQ 2Q2TA 3S1QH 4A75A 5GAGC 1SFOH 1Q81C 2KENA 4DR7L 4LF7Q 1VQJA 3T1YQ 4DV6Q 1XPOA 2PI2E 2VQFQ 2BH8A 5JJKA 4NB3A 1HZ9A 1UEBA 1Q1EA 5LMUQ 4LF5L 1A62A 1FJGQ 1XPRA 4TQUS 1WOCA 4L5SA 1CKNB 3MEFA 4GS3A 3OYYA 3UDFA 4DAYB 1EQQA 1HR0W 5C4XG 3RZOH 3S14H 1IZ6A 3H3VI 3K0XA 4A3IH 4JI5L 2YU9H 3UDIA 2Y0SG 2JA6H 1VQNA 4A4IA 4FDBA 4NXML 3I56A 2E5LQ 1C9OA 4IOAA 2VL6A 3S1MH 1EOVA 1X3FA 3I4NH 5GAEC 1LUZA 2HIVA 3I2ZA 2D62A 5JJIA 1OXVA 1I94L 2A8VA 4B3TL 3AQQA 3MXNB 2PMZE 3TQYA 2XGTA 4LWCA 4AH6A 1SMXA 4X62L 4GKJL 4OX9L 1G291 3T1YL 4B3SL 1A0IA 1GM5A 4DV6L 1VCIA 4GKKL 1VQBA 5M5XH 2EQSA 3KJOA 1KHIA 4A3BH 4JV5Q 2UXDQ 2IY5B 3S15H 3Q8DA 4MTNA 4A3EG 2HHHQ 4JI0Q 4XIGS 5K36G 3S2HH 3AFPA 1O7IA 2LSSA 3SGIA 3A5UA 2AWNA 1KD1C 5IT9c 1WJJA 2MO0A 4OO1I 1PYBA 1VQGA 5LMNQ 4DV0Q 5M3MH 1HNXQ 4A3IG 2UXBQ 4DV2Q 1YBYA 2CWPA 1W3SA 3KF6B 4LFAQ 3CC7A 2CFMA 2JA6G 2HIXA 3E9HA 4P71A 4BA1I 3UDGA 1X65A 1NJIC 4UPAA 3ULLA 1CUKA 1XMOQ 3I4NG 4NXNL 2MNAA 4QQBX 4X64Q 1TWAH 1N36L 4BBSH 3K81C 4A3KH 3KJPA 4A3FH 1MJCA 1FL0A 2AHOB 4DR4L 4IO9A 1C7YA 4A3BG 4JI6L 3GTQH 4H02A 4PG3A 1N34Q 1KIXA 3GTPH 1Y14B 3CCLA 3HFZB 2IHFA 1VQ9A 1LYLA 4DR3L 2UUAL 1YJ9A 1RL2A 2V1CC 2Y0SE 3G48A 5M3MG 3I4OA 5BR8Q 4LFAL 3STBD 1TWHH 3CAMA 2JJQA 4L5QA 4L5TA 1EUJA 1HR0Q 1VQOA 4JI8Q 5DLQE 2OTJA 2BH2A 2Q2HA 4DV7L 4UP7A 1YVCA 4B3MQ 5C4JH 3TS0A 2NZHA 5JJLA 3AYHB 2C35B 1YJNA 2L15A 1XMQL 1VQAA 1K8GA 1SROA 4LFCL 3OTOL 4JYAL 4BBSG 1BBUA 1WYDA 3UE0A 1M90C 2AKWB 3I4MH 2F3IA 4A3KG 2AWOA 3G4SA 4B3RL 4DUYL 3RN5A 2F4VL 1VQDA 1VQFA 1EWIA 1XPUA 4IJHA 2MO1A 3W5OA 1HZCA 3GO5A 4C2MH 3F2DA 1YHBA 5GAHC 2UUCL 1D7QA 2CWAA 4BBRH 3PUXA 2GN5A 1PH4A 5HY6A 2RHSB 4DR7Q 1NBWA 1PV4A 1Q82C 2ZJQA 1OXTA 4HIKA 4DNIA 1QZHA 3F1ZA 3FKIH 1UE5A 4RG1A 5GADC 4LF5Q 4R4TA 2ZTDA 4QJFA 4HIOA 4JBJA 5JEAG 5BR8L 1E22A 3JAMi 5GQOA 4KLKA 2YTYA 2K5VA 1KAWA 2ZTEA 1VQHA 4OWWB 2KBNA 1X55A 4JI5Q 2VS1A 4IPGA 4LFBL 1Q1BA 1KRSA 2NVYH 3HOWH 4DKAC 4YY3L 4NXMQ 3J80i 1IYJB 4GOPA 1VQ4A 1H95A 5IP9H 4A3CG 1N33L 3AEVA 3PO2H 5FJ8H 3BU2A 2KCMA 1OXUA 1JB7A 4AIMA 2OTLA 4LF6L 3I4MG 1HZAA 3CCJA 4MZ9A 2UXCL 4R4CA 3H15A 1YHAA 2UU9L 4YHHL 2ASBA 4X62Q 4IJLA 4OX9Q 4B3SQ 4GKKQ 1PH7A 1DGSA 2N78A 4HJ5A 1VQ8A 1X56A 4BBRG 1ASZA 2PQAA 3HOYH 3KOJA 2VQEL 3ULPA 4DPGA 3CP0A 4A3DH 1YEZA 2NN6G 3KF6A 4UP8A 2NZOA 2R7ZH 1HNWL 3FKIG 4ME3A 3EIVA 2I5LX 1GKHA 1TWCH 2VY3A 1IL2A 3NBHB 1IBML 4LF9L 2EXDA 1I5FA 5IYCH 1HH2P 3CC2A 3G6EA 4LF4L 3KDFA 4R4QA 1T9HA 2VW9A 2ZTCA 4YWKA 4DR5L 2K50A 1XNRL 1I3QH 4ALPA 4P73A 3HOWG 1TWFH 4DAMA 1GO3E 3J7ZC 2KCTA 4NPSA 3CF5A 3PO3H 3B6YA 1NE3A 3D0FA 5IP9G 2NVXH 4JBWA 4JI4L 4NXNQ 2OQKA 4QGUA 3PO2G 1VQCA 2OWOA 4IPHA 5FJ8G 3KLWA 1OXSC 1B8AA 1NMGA 2IT1A 2JEAI 1AE3A 4P72A 1N36Q 3PUVA 2OQ0A 5IE8A 1Z47A 2EIFA 1J5EL 1JMCA 4HJ9A 4GOPB 1G6PA 4PZ6A 2K52A 4JOIA 4JG2A 3J81j 1N32L 1B70B 4DR4Q 5AJ3L 4X6AH 5IP7H 3E0EA 2WAQG 3HOYG 5ELNA 3DLLA 1U0LA 2UUBL 4JI6Q 1PYSB 1CSPA 1EIFA 4LW1A 3M4OH 1CSQA 4A3DG 2QGQA 2R7ZG 3CCUA 4AYBG 3RLNA 4QL5A 4DR2L 1KC8C 1CKOA 4DR3Q 2IX0A 3KF8B 2Q2IA 4GNXB 2UUAQ 2NVQH 3S2DH 1JT8A 3S1NH 1XTDA 4PZ7A 5IYCG 2PQAB 4PMWA 2YYZA 2B63H 2LXJA 1L0WA 2A19A 3BZCA 1BVSA 3ICEA 2MFIA 4GLAC 1KQSA 4A3GH 3S1RH 1UE1A 4DV7Q 4JC0A 3CC4A 4MNOA 3WWVA 3PO3G 1K3RA 3KDFB 4QY7A 1XMQQ 4POGA 4KHPQ 4LFCQ 4J15A 3OTOQ 4OWTB 4JYAQ 1YZ6A 4GLXA 1K73C 3CW2C 1EYGA 1Q12A 4B3RQ 4DR1L 1SE8A 4DUYQ 2F4VQ 2R93H 4DUZL 2JA8H 2B3GA 5IP7G 4O0AA 5JEAJ 1Q7YC 2PI2A 3PUWA 2UUCQ 1VQKA 3RR5A 3E9IA 4TVAB 3U4ZA 1E3PA 2NN6I 2B29A 4KI0A 5C0XJ 1NMFA 2VZAA 2E2HH 4WJ4A 1K8AC 1VQLA 2N49A 2I0QA 2Q2UA 1VQPA 2DUDA 4LF8L 2IHEA 5IYBH 3W1BA 1LM0A 2YTVA 2K75A 5E7NA 2IX1A 1Y1WH 2B63G 4LNQA 3UE1A 1NTGA 3J81i 2ALYB 4KHZA 1HNZL 4LFBQ 1PVOA 2RF4A 4YY3Q 4A3GG 1IBKL 4YWLA 4UY8C 3RLOA 4DV3L 4KHPL 3RNUA 4DV5L 1P8LA 1QUQB 4BY1H 1N33Q 3F8TA 4JI1L 1QZGA 3CCSA 3CCRA 3AFQA 2R6GA 4L5RC 4Y52H 2WAQE 4A3FG 4X65L 2N3SA 4LF6Q 4A93H 1J6QA 1X3EA 4Y7NH 2D0OA 3L2PA 4JI7L 2UXCQ 1NY4A 2UU9Q 2R93G 4AYBE 1V9PA 4YHHQ 2JA8G 2WB1E 3U4VA 4BA2I 1TXYA 1UWVA 2XTIA 4UP9A 4PZ8A 4BY7H 1GD7A 4YCVA 3A74A 1YI2A 2VQEQ 4GLVB 2HQLA 5ELOA 1QVCA 1M1KC 3ERSX 1HNWQ 1Z9FA 3GTKH 4HJAA 3JC66 3PIOA 4JI3L 2JE6I 1B7YB 1UE6A 1Y1VH 1YNXA 2CKZB 3GDEA 1PHJA 2QEXA 3HOUH 4LF9Q 1JJGA 5IYBG 1SN8A
chains in the Genus database with same CATH superfamily
3JAMc 2ZM6L 5IGDA 5CBEE 1TVXA 5J22A 3CXCA 3OW2A 1WCMH 2MJ8A 3MAQA 2Z6KA 3GTMH 3L7ZC 1I50H 1SJED 2HQEA 4OXPA 3PGZA 2HT1A 1VS0A 5CV8A 1LT3D 1K8OA 3BYYB 1J5EQ 1MKHA 1N32Q 1YHQA 1H9MA 3PCOB 4R8NA 3V05A 2H5XA 3A55A 1IW7D 1F9PA 1CT1D 3GTPB 1RKNA 1A3VA 4GNXC 3GV3A 5C44G 1EIYB 4HEDA 1E7ZA 3DWPA 2LXKA 3K7UC 3RD4A 3UDXA 2N8NA 4JPBW 1WTVA 3M85A 1AFPA 5IIFA 3I4MB 2JA5G 4R4IA 4I7AA 1ENAA 2D0PA 1L1OB 5JVG3 2LKVA 1RODA 2M2LA 1F2LA 4J8QA 2B2TC 1JE4A 1SRUA 5CV9A 3OWEB 4IN3A 2KOLA 5EGTA 3D3RA 4JOIC 1P16A 3SEBA 1U5KA 3VDYA 1A6XA 4QIWE 4JCVE 4LUVA 4HTHA 1PMRA 3SK4A 1WI5A 2MGSA 5T1GA 1STAA 3HOWB 3T53B 1HPCA 1PDQA 1BBWA 4IPDA 1L0YB 3N6RA 4DV5Q 3ZJYC 4C3JG 5FLMH 4GN4B 3CHBD 4IURA 1LTID 3GTLH 2ID0A 2DGYA 2F4IA 1HJPA 1HTLD 1SR3A 1VMPA 2WAQB 1ASYA 4HN7A 1PH8A 2K5QA 1KRTA 1TWCB 3BDLA 2YV5A 1ZYRC 1EYAA 1ENCA 4MN3A 1V8QA 2F3VA 3C1FA 2JEBI 3AB9A 3K6OA 4JV5L 3S24A 3Q22A 1E24A 3H6MA 3J81c 1CA6A 3BJUA 3MA2B 4A3MG 1TWFB 3MZ5A 2VUMH 5FLXc 1EQRA 4CHTB 5LMNL 4OO1H 4DV0L 1HNXL 2AQ3B 3HOZH 2PW7A 3D31A 5J39A 1L2FA 1PFNA 2Z8LA 4J6HA 2JK8A 2WFWA 3GP7A 5C3XA 5D3IB 3EN2A 5EPJA 1XNQQ 4DF7A 3CCEA 4A3CH 2E74C 1FGUA 1BXTA 1KTKA 3DM3A 5ELCA 3RZDH 4G7OC 3G7LA 2KHJA 3PSIA 1X9NA 4YCWA 3NENA 4XTCS 2AUJD 1N34L 5M5WH 5LMNW 3S16H 4P74A 4F7XA 4EVOA 1L1OA 2R61A 2B2UC 3KYHC 2F1MA 4R1JA 2RHQB 3EROA 4QUFA 1IKLA 1V43A 4K5VA 4DR6Q 4PMCA 5M3FG 1PZKD 3QO2A 1VQIA 1IHZA 2B2YA 1I6HH 3I55A 4FVMA 4C3HG 2D5DA 3OWFA 1PH6A 3BZDB 5IWAQ 2EYHA 2QDBA 1Q81C 1Y1WB 4LF7Q 3T1YQ 2HCCA 3J80L 5JJKA 5JPNC 1RDPD 4QIWB 4L5SA 1CKNB 3MEFA 1EQQA 3OYYA 4DAYB 5C4XG 3RZOH 3S14H 3H3VI 1STEA 3K0XA 2K6AA 4RWSC 4A93B 4G7ZC 2KHSA 1VQNA 4NXML 2E5LQ 4IOAA 2VL6A 3S1MH 4I7ZC 1X3FA 3I4NH 4BY7B 3I2ZA 2D62A 5JJIA 1LT6D 2A8VA 2LS01 1NR2A 1NAPA 3AQQA 1Y1VB 3TQYA 2XGTA 4K2LA 4B3SL 3T1YL 1SYBA 4V0BA 1VCIA 5M5XH 2QILA 1KHIA 4IQZA 2DY8A 3S15H 2HHHQ 4JI0Q 3S2HH 3FPPA 4XQQA 1K0SA 2AWNA 1BOSA 5IT9c 1WCMB 1TS3A 3QG1A 5CORA 3GTMB 1I50B 1JC7A 1W6KA 4A3IG 1EYDA 2CWPA 3TMEA 3CC7A 4LFAQ 2JA6G 2CFMA 5E1FA 4K5WA 1X65A 2BOSA 3ULLA 1CUKA 2B2VA 1XMOQ 4FO2A 4X64Q 4N9PA 4BBSH 4A3KH 4K5XA 4A3FH 1MJCA 2AHOB 2OXPA 5DM73 4FXGC 1TS5A 3D4RA 1TQOA 4A3BG 4JI6L 2A69D 3GTQH 1DJRD 2DNCA 2V1CC 1JB3A 4CKEA 5KRUA 4O42A 4LFAL 2JJQA 5FKAC 3IKJA 2OTJA 4R9WA 2BH2A 2A6HC 4NMZA 4B3MQ 3QB3A 5C4JH 1STYA 1SROA 4LMQD 1A3TA 2AKWB 2Z6BA 1PTOH 3I91A 4H13C 5G3LF 4DUYL 2F4VL 1EQTA 1VQDA 1VQFA 1DONA 1U4PA 3U9OA 3VR4A 4BBRH 5HY6A 1NBWA 1PV4A 1WTHA 2NN6H 2VB2X 3F1ZA 1ET6A 1SYGA 1UE5A 3OMCA 5GADC 4LF5Q 2ZTDA 1SYCA 4C56C 4PNYA 2YTYA 2K5VA 1KAWA 2ZTEA 1A2TA 1DZ1A 3HRZC 2PW5A 1QNKA 3GTLB 4GOPA 1PTOF 4CJ1B 2F0QA 2B8FA 1JOQA 3NBIA 3WOEA 1DYQA 2BE5C 4R4CA 3H15A 2ASBA 3KF8A 4HJ5A 1X56A 4ME5A 4RGTA 2PQAA 3HOYH 3CP0A 3URYA 2B2YC 4UP8A 5E3FA 2R7ZH 4CJ0B 2IW3A 4ME3A 2B8GA 5IGBA 2VY3A 4LF9L 2J7ZA 2VUMB 4LF4L 1W6JA 2F0NA 2Q8RE 3HOZB 1GO3E 1HCZA 3CF5A 2F0DA 3PO3H 3VR3A 3D0FA 4CKCA 4YIJA 3NXWA 1IKMA 4KN7C 3PO2G 4IPHA 1V1PB 3KLWA 1D5ZC 5CMDA 2QEJC 4LJZC 1N36Q 3PUVA 3RZDB 2EIFA 1G6PA 4N8X1 4PZ6A 3U9SA 4DR4Q 4KD3A 4ID6A 4CDDC 3D6CA 4A3DG 4AYBG 5M5WB 3S16B 4GNXB 3S2DH 2NVQH 1JT8A 1XTDA 5IYCG 2LMCB 3BZCA 1BVSA 3RMHA 1KQSA 1NCVA 3S1RH 3CC4A 4JC0A 4DNRB 3WWVA 1K3RA 3KDFB 4QY7A 1WVLA 3MEHA 3MFYA 4LAAA 4LFCQ 3NPPA 4J15A 1I4HA 1I6HB 1SE8A 1BCPC 2JA8H 1D6EC 2EYOA 5IP7G 2UUCQ 1TIID 4RAUC 1UNSA 1E3PA 3M4YA 2JYOA 2E2HH 1UUPA 3TBIB 1K8AC 2N49A 5IGCA 2I0QA 1A15A 4CDCC 4LF8L 2NB0A 1LM0A 1SSOA 1SMYD 4NP5A 3RZOB 3S14B 2B63G 5EJWA 3RUZA 1WTOA 2L5TA 4GZYC 4KHZA 4KY6A 1HQRD 2XIWA 1B3AA 4A3GG 4YWLA 4IUNA 1GUSA 3VA7A 3S1MB 1JICA 1QUQB 2QDLA 3QIAA 1N33Q 3I4NB 3CCSA 1MI2A 1SAPA 3AFQA 2MUYA 2CH4A 2HCIA 2N3SA 5C5LA 3DHQA 4LF6Q 5BN5A 1EY6A 2UXCQ 2R93G 4YHHQ 4XQNA 2TMPA 1TXYA 4RA8A 4RGMA 1QCBD 3VA5A 1YI2A 5M5XB 3BVGA 1GHKA 2X6GA 3TP6A 4HJAA 3S15B 1CK1A 1UE6A 1PHJA 3S2HB 3GDEA 5EBDA 2EE1A 4HIDA 3ULJA 1V1PA 5TSSA 1Y8PB 1XNRQ 1II3A 1AZPA 2A1AA 4HIMA 4K0KL 1QB5D 3K58A 3L0OA 3HKSA 3RN2A 2FHTA 3EFXD 1MGSA 2AMCB 4JBMA 4BY1G 4X66L 3R3OA 4JI4Q 2XWJB 1DXMA 4GNXA 4BBSB 1UEAB 2ICIA 2M00A 4O1NA 4A3KB 1PH2A 2GA4B 4GOPC 4A3FB 2QCPX 2Z4IA 3MHBA 1S5DD 5KEEA 2UUBQ 2K5NA 2K5DA 2RVLA 1YIJA 1YITA 3GTQB 4DR2Q 1UE7A 2F0KA 3A56A 3HOUG 2EYPA 3HOXH 1EY9A 1RTOA 1SNOA 1BUVT 3I73A 2E2JH 2CQAA 3CRKC 1JWSD 3VYTA 2BA1A 4HSPA 3T1HQ 3F2CA 4ULLA 5EPLA 5C4JB 3HOVG 2QKIC 2E75C 2HDLA 3ND9A 2AUKA 2R92G 1PTOB 5HGQA 5FOBB 1K0RA 3BVZA 1KL9A 3NQTA 1B9NA 4DXFA 2WB1G 4YWMA 2AQ2B 3OW7A 4BBRB 3PUZA 1EY8A 5JVH3 3NWSA 1Q90A 1ICFB 5I6WA 3H0GH 3CPWA 4DN4M 4EQNA 1K83H 1QUQA 3NELA 4QF4A 1GUNA 5KIXA 3T1HL 4C3IH 4BXXG 4XYOA 3IAYA 1HNZQ 2VQFL 4U673 4IFDH 3RLFA 3TP7A 5J3BA 1IBKQ 4A3LG 4DV3Q 2JA7H 3VR2A 1B50A 4B9XA 2K33A 2KHIA 5M5YH 4M1UB 2L9HA 4Q0FA 3H09A 4X65Q 3HKZG 4EQ5A 4HMIA 4JI7Q 4RFBA 1BCPF 4FXDA 2QF7A 3M4PA 2OEOA 3ITPA 2SNMA 3HOYB 4WRDA 4LUZA 2R7ZB 1WTWA 4JI3Q 5EQ0A 1HFNA 2F0OA 2ZM6Q 1B4OA 5LHY1 1ILPA 4KTAA 2UXDL 2R3ZA 2C5CA 3KUPA 1FGBD 2ZJPA 1C8CA 5IYDH 5D3DA 4DK3C 3CMEA 5CV7A 3PO3B 2NZ1D 4IOCA 2I5MX 2UXBL 3AU7A 2CW0C 1QG7A 1K9MC 1G2TA 3TDQA 1S72A 1Z7TA 5ELBA 2HDMA 1MIUA 1E1OA 2B2WA 3TEHB 1M4VA 2AQ1B 3NUCA 1RIPA 3K5NA 3CCQA 4L8JA 3FMCA 4HCSA 1M8AA 1OTCA 4KHVA 3S2DB 1TR5A 3CPFA 2NVQB 2SOBA 3I90A 2B2UA 1FVIA 2DY7A 4ODGA 1G51A 2PYKA 3KBGA 1NR4A 3K0YA 2L55A 3S1RB 2RCNA 4EQPA 4HJ7A 1VQEA 2Z0SA 3KLSX 3SK8A 3GTOH 5C4HA 3P20A 4JI8L 4I65A 1PFSA 4A3JG 2JA8B 4OWXB 5KNBA 1CA5A 2RSNA 3MWYW 2DJGC 5IY0A 1A8VA 1Y69U 1LTAD 2F0SA 2L0CA 3DWQA 4XXEA 3JAML 2GVAA 1JE5A 2E2HB 2EJMA 4P75A 3SE0A 5L37A 5C3EG 4KY7A 1Z6HA 2Q2TA 2F0FA 3S1QH 4A75A 3GQBA 4K6LA 2KENA 1VQJA 3LNNA 2J4XA 3I3CA 1TY0A 2BH8A 1PFBA 3J80E 5K36H 3SR1A 1UEBA 1Q1EA 2A73B 1A62A 1WOCA 1C4QA 3X3MA 5EBCA 4JI5L 2L12A 4OEMB 2Y0SG 2BCOA 5C5MA 3DMUA 4FDBA 3I56A 1YNNC 1BF4A 4RGOS 1L0XB 1PZID 2HIVA 4U68A 2Q8TA 3BS1A 1OXVA 2KQ3A 1O7YA 2WACA 4P2CB 2PMZE 1G291 4GKKL 1GM5A 1VQBA 4JV5Q 2EQSA 2IY5B 1SBBB 4A3EG 1SEBD 3AFPA 2LSSA 4ZQ3A 3A5UA 1KD1C 3DEPA 2XRSD 5EKIA 1WJJA 2MO0A 3FPUB 1STNA 1EEID 1PYBA 1VQGA 3MXUA 5LMNQ 4DV0Q 5M3MH 1HNXQ 5KYLA 1YBYA 3KF6B 3WDNA 4P71A 3UDGA 1NJIC 2ENBA 4NXNL 1TWAH 2KJXA 3HG9A 2N55A 3C1EA 1B2TA 1SNMA 1FL0A 3HOXB 3HEJA 2E2JB 2EY6A 1N34Q 2A6EC 1KABA 3SDZA 3IFDA 1SFOB 1BQQT 1LYLA 4DR3L 1K8MA 1S5CD 1U4RA 5BR8Q 3STBD 5CV5A 1TWHH 3CAMA 4E6IA 1FD7D 5JJLA 2D2CC 2L15A 3M7GA 4CBVA 3I8ZA 2N88A 1GOZA 4OL7A 1SNQA 1LABA 3EVQA 1BCPB 2AWOA 3G4SA 4B3RL 3H0GB 2F0JA 2B2WC 2PZUA 1K83B 2SDFA 4HAEA 3TP5A 3GO5A 3J81L 1YHBA 5GAHC 2CWAA 1LACA 1PH4A 2RHSB 4C3IB 2PZTA 5FLXL 1DOLA 4HIKA 4DNIA 3FKIH 1MD2D 4QJFA 2BDOA 4CDFC 1BR9A 5JEAG 1RD9D 5BR8L 2F0IA 4KLKA 5GQOA 2JA7B 2KBNA 2KECA 3MXPA 5M5YB 2O2LD 3UI2A 4LFBL 1PTOC 2NVYH 4NXMQ 1JWMD 4RH6A 3J80i 5CYUA 1H95A 2J0TD 2ZXOA 2XWBB 1CI3M 3T51B 2KCMA 2F0HA 1JB7A 2OTLA 1GXDC 3I4MG 5DAUA 4B3SQ 1AP0A 1DGSA 1AW7A 5C3WA 1ASZA 4OIKA 1YEZA 3KF6A 2EOTA 1CQVA 4OELB 4JVZA 1IL2A 3NBHB 4TSSA 1IBML 2EXDA 3F2UA 1GUTA 3G6EA 4R4QA 1R4QB 1T9HA 2ZTCA 4DR5L 1B9MA 4XQJA 1I3QH 3HOWG 4DAMA 3J7ZC 4FNFA 3NQIA 2P5ZX 5IP9G 1VMCA 5KNDA 2EY2A 5FJ8G 1B8AA 1NMGA 2IT1A 1AE3A 5DNFA 2OQ0A 1JMCA 4GOPB 4X3TA 3J81j 1B70B 3VR5A 3DM1A 5AJ3L 3C46A 2WAQG 3QR8A 4JI6Q 1E2WA 1CSPA 1CSQA 3RLNA 1CKOA 3PMFA 3KF8B 4L6TB 4XT3B 4K14A 3S1NH 1K28A 1BO0A 2PQAB 2Z4HA 4KK7A 4KKSA 1CFMA 1X3PA 2A19A 4DK0A 1BBXC 2X69A 3GTOB 2F0LA 2MFIA 4GLAC 1S5ED 2F0PA 4MNOA 1LTBD 3QOJA 3QOLA 2KEEA 1FYCA 1KLGD 3MVVA 5T1IA 1EYGA 4DR1L 4DUYQ 2XNAC 2F4VQ 2EYJA 4DUZL 1STHA 3P1HA 1VQKA 3S1QB 5IT9L 3E9IA 5C0XJ 3O13A 2B29A 2G5DA 1STGA 4WJ4A 1Q8IA 3TZUA 1O7LA 2Q2UA 1MHWC 2DUDA 4IALA 1EFID 2OT2A 3CU7A 5E7NA 1RJTA 1SYFA 1HTPA 1ILQA 3H3VC 3D6WA 4UY8C 2IL8A 3RLOA 1EYCA 5JOBA 3RNUA 1P8LA 4JI1L 1QZGA 3FRPB 1GUOA 3E3XA 3L3OC 2QW7A 4DGZA 1PXUA 3KK7A 3NBHA 1X3EA 3L2PA 3TN2A 4PV1C 1U4MA 2WB1E 4UP9A 4PZ8A 2EJFC 1GD7A 4UHVA 4CJ2C 4GLVB 2HQLA 4OHJA 4RCNA 4ZLTF 3ERSX 4RHSA 3GTKH 4FF3A 1JJGA 2XVSA 2QEXA 4LF9Q 5IYBG 5C0XG 1MJEA 5C3EH 5FO9B 4LF4Q 1Y1WG 4DV1L 5M3MB 1EOTA 2C9OA 5C44H 3FEWX 2KCCA 2JQOA 2RCFA 2NBFA 3KLRA 4F88A 1SE2A 4KN4C 4F8MA 1PH9A 4JI2L 1TWAB 2BA0A 4A93G 1H9RA 1WTQA 2JA5H 1WD0A 2QA4A 4C1NK 4IPCA 4DV4Q 4BY7G 4AQYL 1IW7C 1D8LA 4HSVA 1PH5A 5JAVA 4G7HC 1VQ5A 4WJ3M 1Y1VG 1RHPA 1OXXK 3PF4A 2OCEA 3CCMA 1DCZA 1TWHB 3GV6A 1CHQD 1S3OA 1JWUD 1EQVA 1WCMG 4ZAIA 2EYLA 4POFA 4A3EH 4IFDI 3MXGA 1AZQA 5IGGA 3OSOA 3DUZA 1IBLQ 1CHPD 4C3JH 1SLJA 3GTJH 1O78A 3NSWA 4RKLA 3NHHA 4NDXA 2I5HA 1YNJD 4DV4L 4HR7B 3I70A 3SXHA 1N9WA 1TY2A 1Q8KA 2PZWA 4EQOA 2K7VA 2FMMA 3FKIB 1YJWA 4LF8Q 1FR3A 5C0XI 2G9DA 1JJCB 3G71A 4KMUC 2Q8IB 1QWYA 3DXJC 1WTPA 1V1OA 4TKOB 4WFN3 2NVYB 3TREA 1AE2A 1VF7A 4IUQA 5LMUL 4A3MH 1IBLL 1FJGL 3I7FA 1WTRA 4GN5A 2RBMA 3EA6A 1A3UA 3U50C 2O5IC 3H3VH 4M8AA 3CCVA 2NYZD 1WD1A 1RTNA 2WP8J 1V1QA 3VYRA 2FXQA 4R4OA 2EY1A 1R4PB 2H1EA 2VB3X 4F87A 5IODA 1B3QA 3NEMA 3PIPA 2PQEA 1ET9A 5H1SE 1MSHA 4EX5A 4X3SA 3J7AV 1S4ZA 1LTLA 1X54A 4MTKA 4B08A 3S17H 1B44D 1WFQA 1ZYRD 4DK6C 2I07B 2YTXA 3R2IA 5IGEA 1CM9A 3TRZA 2F0MA 4K0KQ 1VQ7A 1I3QB 4DA2A 1TU2B 4KKUA 1HZBA 4KY5A 1GVPA 4X66Q 5FLMG 2HD3A 4LUOA 5DEHA 1PH1A 4APVA 4DV2L 3NWTA 5ELDA 3STBC 4OIJA 1PH3A 4MHEA 3M4QA 2L4NA 4N8FA 2KCNA 2NUCA 1FNWA 3HS0C 4YCUA 3CD6A 4IUUA 5M3FH 2MPMA 1BKBA 1S40A 3CMAA 2RQXA 2K28A 2L1BA 5K5PA 3OHXC 4C3HH 3AMUA 1EEFD 1EIHA 3S1NB 1N8RC 4DFAA 1ZEQX 2R7FA 4C1NI 5I6YA 4KKTA 2M9VA 3BG3A 3PV0A 3QWNA 3GD7A 1XJVA 1LT4D 4PQXA 5HGTA 2VUMG 5C4XH 3V96A 1KDCA 3NTIA 4OO1G 3HGBA 3TS2A 1F2YA 3HOZG 4OONA 3FDTA 1SNDA 1HR0L 3IL8A 2WKCA 3J7A5 4ZUIA 4O2DA 2K5HA 3A5ZB 4J1MA 3JAME 3ER0A 2GVBA 1I94Q 2F0VA 2G9HD 3BVMA 4RCOA 1PYWD 2E76C 1I4QA 1SFOH 5KYIA 2O4XA 4DR7L 4DV6Q 2VQFQ 3A8JE 1HZ9A 2K01A 1EY4A 1X32A 1XPRA 4GS3A 1HR0W 1ZXTA 4A3IH 4DK1A 5I4DA 1LLRD 3SVMA 2YU9H 1EIGA 3UDIA 2JA6H 1RF2D 3K5LA 1JOKA 4IUPA 4QUCA 4ZK9B 1I94L 3GTKB 4RHRA 4EGVA 4AH6A 1SMXA 4X62L 4GKJL 4OX9L 1A0IA 4DV6L 5C3EB 4A3BH 3KJOA 2UXDQ 1TS2A 4CGYB 3Q8DA 4S3SA 4XIGS 3NE5B 5C44B 3E5SA 3SGIA 5I2YA 5E4XA 4OO1I 1C48A 1G8ZD 2UXBQ 2RDFA 3SK5A 1J9OA 2HIXA 1QOHA 1PRTD 2JA5B 4HCEA 2JXMB 3EJIA 3I4NG 2MNAA 3OIQA 3ERQA 4QQBX 3C3LA 5FK9C 3ZYYX 4ZYSA 4IO9A 2A69C 1C7YA 1JORA 3NP8A 5D14A 2EY5A 3HFZB 2IHFA 1VQ9A 2JN4A 2UUAL 3Q6SA 1YJ9A 1RL2A 4A3EB 2ZT9C 2IJ0A 3G48A 3OPOA 2EYFA 4C3JB 1XTCD 4IZ8A 2IX3A 3GTJB 1F2ZA 4L5QA 1DOMA 1EUJA 5COYA 4JI8Q 4X3KA 4DV7L 1TS4A 2A6HD 2RSOA 3AYHB 1XMQL 1K8GA 1VQAA 2EDGA 3KBXA 3OTOL 3H91A 3SHLA 4BBSG 4JYAL 4A3KG 3RN5A 1EWIA 1SNCA 4IJHA 1E2ZA 2MO1A 3W5OA 1XPUA 3I4LA 4C2MH 3J81E 3F2DA 3LX0A 2GN5A 1Q82C 2ZJQA 1OXTA 5FLXE 1EZ6A 3G6JB 5I2XA 4A3MB 4JBJA 5FO8B 3P7JA 5NUCA 3JAMi 2MHVA 2WIIB 5ELFA 3A7LA 1VQHA 4DU9A 1XYIA 1E2VA 1ENFA 1X55A 2LFNA 4JI5Q 1LT5D 3OMGA 4G57A 2K32A 4IPGA 4ZKCB 1KRSA 3VR6A 1S5FD 1ML0D 4DKAC 4YY3L 2A68D 1KDAA 1IYJB 1O7ZA 1KNAA 1X3QA 3PO2H 1E0BA 4UDUC 1OXUA 4AIMA 3R93A 1HZAA 3CCJA 1SYEA 2UU9L 1TT2A 1EWHA 2BE5D 4ZCKA 4GKKQ 1CZGA 3S17B 1ICWA 2CVRA 4BBRG 4CDEC 3KOJA 4DXGA 2VQEL 3ULPA 4A3DH 2NN6G 1HNWL 2NZOA 2NTSA 2I5LX 1GKHA 3EIVA 1I5FA 5IYCH 1HH2P 1JCKB 3CC2A 1CTMA 1KAAA 2VW9A 2K50A 3E6ZX 4ALPA 3NTHA 4P73A 2KCTA 2NVXH 4JBWA 1I6VC 4NXNQ 2K1BA 5EKKA 1VQCA 5M3FB 1OXSC 2JEAI 3DEOA 4P72A 2EXZA 1J5EL 4HJ9A 4XYQA 1N32L 4C3HB 4JG2A 1YNJC 4HMJA 1JOOA 1NUCA 4QMGA 5IP7H 3E0EA 2H4OA 5ELNA 3DLLA 1U0LA 2OF1A 3HOYG 1PYSB 3M4OH 3C2PA 2QGQA 2R7ZG 4QL5A 1KC8C 1HQMC 4DR3Q 2Q2IA 4H0LC 4PZ7A 4PMWA 5C4XB 1HRJA 2B63H 3SK6A 3QJYA 1L0WA 1ESRA 2JSOA 1KNEA 4RKBA 2F0UA 3ICEA 4A3GH 3PO3G 1BDOA 1LO5D 1J8IA 2I46A 3D4WA 4POGA 5C6AA 1K73C 1QILA 3CW2C 4B3RQ 1SE4A 2R93H 3X3NA 1BCPD 2SNSA 4O0AA 5JEAJ 1HXYD 3PUWA 2XN9C 4KJNA 5AFWA 3RR5A 5CR3A 2KEDA 2K04A 4KI0A 2NN6I 5IT9E 2PCFB 2A74C 1NMFA 2VZAA 4L63B 4CKBA 1SMYC 3W1BA 3W3AA 2F0EA 1EY7A 2YTVA 2K75A 5FO7B 4ABNA 2IX1A 4FYDA 2O5JC 4A3IB 2VXWA 5IOCA 3J81i 2ALYB 4LFBQ 1LTTD 2YU9B 2JA6B 1G91A 1LTSD 4DV5L 1DM0B 1LTGD 4BY1H 3F8TA 3CCRA 4L5RC 1J6QA 4Y7NH 2D0OA 5LL6X 2BDNA 1NY4A 4AYBE 2JA8G 5A2QL 1HFGA 4H44C 1M1KC 1QVCA 4A3BB 2A5HA 4ZKBB 1Z9FA 5D65A 3MFGA 3HOUH 2CKZB 2NWGA 1IBMQ 1SN8A 3Q23A 4XT1B 4DR5Q 2F0GA 1D5MC 2KVMA 4KD4A 2FMCA 4JK1C 3J80c 3CKIB 2ATWA 3F2BA 2WINB 3HOVH 1H9SB 3EQLC 1Q86C 2R92H 3CQZH 4A76A 5AJ3Q 5EKLA 2Z1CA 1XNQL 5KGUA 1X3GA 1SYDA 2PMZB 2Z6KC 3E0JA 3K7AH 2V4DA 5CGKA 2R7DA 3BZKA 3WOFA 1RCVD 2JP1A 5LL6S 3OIPA 5F2DA 5E4WC 4PMBA 3GTGH 3S9WA 1MBYA 1QVGA 4BXXH 3IRBA 2ES2A 1PFMA 5I9OA 1PA6A 2F3WA 4A3LH 1HHVA 1LV9A 2HUGA 2PNHA 5JJZA 1PLFA 1VF5C 2EYMA 2K4KA 3P75A 2JA9A 4DR1Q 1A63A 2K5WA 4DUZQ 3KFUA 1T5XD 5EAYA 4DR6L 3A0JA 4C2MB 1QVFA 1D2BA 3T13A 1CKMA 4Z9CB 1EFWA 3A8KE 3T4AC 1JJ2A 2Z9HA 3HOXG 3J7AF 4RMFA 4IFDJ 5IWAL 1S5BD 4MIUA 4HJ8A 5CV6A 5CBAE 2E2IH 4LF7L 2IWHA 5GROA 2E8GA 1E1TA 1FNUA 4IUTA 1SE3A 1F77A 3K8AA 3FHWA 4JI1Q 3VYSA 3LGJA 4N9TA 3PO2B 1AEXA 1EU3A 3M3YH 1Q46A 2E5LL 1VQMA 1PRTC 4WJWA 1H9KA 1W2BA 2ZXRA 1HA5A 3D8GA 1D1IA 3K57A 3MTSA 3U58A 3PF5A 1GUWA 4A3DB 3M9BA 4AYBB 3PIP3 3H0GG 1C0AA 1STBA 4V190 1ONLA 1H9SA 5DM63 1ZKOA 3EBEA 4C3IG 4DV1Q 1U4LA 1X6OA 5HURA 4IFDG 2HHHL 4JI0L 1Y8NB 2NVTH 2NTTA 2PNRC 2JA7G 1TWGH 5C4ZA 2NVXB 3IFTA 4JI2Q 2CW0D 5ELEA 1LTRD 1MSGA 2CHBD 1Q3LA 1IYUA 4A3JH 4AQYQ 1XMOL 4X64L 3M4OB 3TP8A 4H7BA 4FP5D 3FP9A 2CQOA 4DNTB 4R8IA 4JBKA 1WTXA 4WORA 3J7YW 1CKNA 2IPKD 4DAYA 2F0TA 2F52A 2XRQD 4FF4A 1EU4A 2B63B 1SNPA 3TZDA 4BS9A 1SDFA 5IYDG 2CCZA 4IUVA 4A3GB 1KDBA 1HUNA 3HKZE 2MQHA 4K6DA 1VQ6A 3ONAB 4BWGB 4ILWA 3A54A 3PUYA 1K3BC 2L11A 1KXLA 4ZUJA 1R9TH 2VNUD 4GN3B 2ZJRA 3L9AX 2LY7A 3N52A 2DJFC 1IXRA 1F9SA 4B3ML 2A68C 2R93B 2F0WA 3H94A 5JPMC 3K5OA 3K80C 1L1OC 1VDZA 2FINB 5BN4A 3W1GA 1QE6A 1AH9A 4UAIA 2K14A 4JW0A 4B3TQ 1EL0A 1G2SA 5GAGC 2MP1A 3OOCA 3VYUA 1EZ8A 2PI2E 1XPOA 4NB3A 5LMUQ 4LF5L 1FJGQ 4TQUS 1TKWB 3UDFA 4KJOA 1IZ6A 4BY1B 1F9RA 2E2DC 4A4IA 4Y7NB 3Q0AA 4NW2A 3W2DA 1C9OA 1EOVA 3MC0B 1YNND 5GAEC 1LUZA 4B3TL 4B9WA 3HOUB 3MXNB 4LWCA 1Y8OB 5ISRA 4FF2A 1NNXA 3K59A 4DAVA 4MTNA 5K36G 3D4DA 1O7IA 1ESFA 3DWAA 3KLSA 3HOVB 4Q5VA 3Q24A 4DV2Q 1W3SA 3E9HA 4BA1I 2R92B 3CQZB 1OO9B 4UPAA 3I72A 1PRTF 2CH4W 5IGFA 2PPBC 4FXKC 2WB1B 1CQFA 3K7AB 1N36L 3K81C 3KJPA 3CRLC 4TRDA 4DR4L 1EWCA 1I4RA 3GTGB 2B2VC 4H02A 4PG3A 5J1ZA 1KIXA 3GTPH 2A6ED 1Y14B 3CCLA 1HUMA 2Y0SE 5JEAH 2EZVA 5M3MG 4K8IA 1O80A 3I4OA 3T16A 4FF1A 1F2MA 1H9JA 4L5TA 1HR0Q 1VQOA 3HKZB 5DLQE 4X3UA 1I4PA 2Q2HA 4UP7A 1YVCA 3TS0A 2NZHA 2C35B 1YJNA 4LFCL 2X6LA 5G3LD 1BBUA 1WYDA 3UE0A 1M90C 3LWUA 2F3IA 3I4MH 3HP3A 1HZCA 2UUCL 3BYTB 1D7QA 3PUXA 4DR7Q 1G6ZA 2E2IB 2FJ2A 2KUMA 1QZHA 5I9PA 4RG1A 2WV6D 4R4TA 4HIOA 1E22A 1SJHD 2SEBD 3HZXA 4QB4A 1KLUD 4OWWB 2VS1A 1XWEA 3PIO3 3BDCA 1Q1BA 3HOWH 3M3YB 3MXNA 1PTOD 2TSSA 5M9OA 1VQ4A 1UAPA 5IP9H 3NTKA 4A3CG 1D5XC 1N33L 3AEVA 5FJ8H 3BU2A 2EPBA 3PQIA 4LF6L 1DOKA 1EY0A 4MZ9A 2UXCL 1XXGA 1YHAA 4YHHL 4X62Q 4IJLA 4OX9Q 4GKJQ 3FVQA 2N78A 1PH7A 1VQ8A 4DPGA 2FFKB 2RA4A 3FKIG 1TWCH 2DN8A 2RDHA 2NVTB 2ICEC 1IL8A 4NKLA 2DNEA 2WKDA 1TWGB 3KDFA 5CV4A 1U9RA 4YWKA 1GJXA 4DAPA 1XNRL 3ND8A 3R2TA 1TWFH 4NPSA 2KA7A 3B6YA 1NE3A 4A3JB 3V2TA 4JI4L 2OQKA 4KV6A 4QGUA 3TSSA 2OWOA 3A7AB 2B2TA 2EJGC 5IE8A 1Z47A 2PO4A 2K52A 4JOIA 4ZRZA 1JQYD 4X6AH 1QJOA 2UUBL 3A8IE 1EIFA 4LW1A 3CCUA 4DR2L 5A35A 1GUGA 1B1ZA 3LWEA 2RDGA 1I4GA 2IX0A 4K8JA 1BNZA 2UUAQ 4RGNA 4XDXA 2YYZA 2LXJA 2XSCA 1R9TB 3K5MA 4QCLA 2Y0SB 1NSNS 1SXTA 1UE1A 4DV7Q 2ZXPA 2B39A 5CC4A 1XMQQ 3NK9A 4KHPQ 4G4KA 3OTOQ 1I4XA 4OWTB 4JYAQ 1T5EA 1YZ6A 4GLXA 1Q12A 1PZJD 2B3GA 1FNVA 1Q7YC 2PI2A 1HA6A 2K03A 2F03A 4LK1C 4TVAB 3U4ZA 1EY5A 1VQLA 1VQPA 2D9UA 2IHEA 3R8BA 5IYBH 5C0XH 1XX8A 1F9QA 1Y1WH 4LNQA 4K2KA 4OGQC 3UE1A 1NTGA 1JR0D 1HNZL 1PVOA 2RF4A 4YY3Q 1IBKL 4DV3L 4KHPL 1A2UA 2R6GA 4Y52H 2WAQE 4A3FG 1B53A 4X65L 4A93H 1DD2A 1CZWA 3BDOA 3T56B 1IYVA 4JI7L 1AN8A 2UU9Q 1GHJA 1PRTB 1V9PA 5EPKA 2EVBA 3U4VA 2RKSA 5A2QE 4BA2I 1UWVA 2XTIA 4BY7H 1D1KA 4YCVA 3A74A 2VQEQ 5ELOA 5BN3A 1HNWQ 1QNUA 3JC66 3PIOA 5KNCA 4JI3L 1B7YB 1YNXA 1Y1VH 2JE6I 2K05A 3M7NA
chains in the Genus database with same CATH topology
5C0XG 4HIDA 1MJEA 3ULJA 5C3EH 3JAMc 4LF4Q 2ZM6L 1Y1WG 4DV1L 4DR5Q 1XNRQ 3CXCA 2A1AA 4HIMA 5C44H 4K0KL 3L0OA 2JQOA 3HKSA 3OW2A 1WCMH 3RN2A 3J80c 2AMCB 2Z6KA 2ATWA 3GTMH 3L7ZC 1I50H 4BY1G 4X66L 3F2BA 4JBMA 4JI4Q 4OXPA 3HOVH 1PH9A 3PGZA 4JI2L 1VS0A 1Q86C 2BA0A 2HT1A 4A93G 4GNXA 1J5EQ 1MKHA 2R92H 1PH2A 2JA5H 1N32Q 3CQZH 4A76A 4GOPC 2QA4A 1YHQA 5AJ3Q 3PCOB 4IPCA 4DV4Q 4BY7G 4AQYL 1XNQL 2H5XA 2UUBQ 1X3GA 2K5NA 2Z6KC 1D8LA 3K7AH 1YIJA 1YITA 4DR2Q 1PH5A 1VQ5A 2R7DA 4WJ3M 1UE7A 3HOUG 1Y1VG 3BZKA 1OXXK 3PF4A 4GNXC 3HOXH 2E2JH 3GTGH 2OCEA 1QVGA 3CCMA 4BXXH 2BA1A 3IRBA 2ES2A 3T1HQ 3F2CA 5C44G 1EIYB 1S3OA 1PA6A 1E7ZA 1WCMG 4POFA 2LXKA 3K7UC 4A3EH 4IFDI 4A3LH 1IBLQ 3UDXA 3HOVG 2PNHA 1SLJA 4C3JH 2N8NA 3GTJH 2K4KA 2I5HA 3M85A 2R92G 2JA9A 4DR1Q 2JA5G 4DV4L 1A63A 5HGQA 4R4IA 4DUZQ 1K0RA 1KL9A 3KFUA 2D0PA 1L1OB 5EAYA 4DR6L 3A0JA 1QVFA 1N9WA 2WB1G 4YWMA 1SRUA 1Q8KA 3PUZA 1CKMA 1EFWA 3CPWA 3H0GH 1JJ2A 4JOIC 1YJWA 4LF8Q 1K83H 1P16A 3HOXG 5C0XI 1QUQA 1U5KA 3NELA 4RMFA 3VDYA 4QIWE 5IWAL 4IFDJ 1JJCB 4HJ8A 4JCVE 3G71A 3T1HL 4LUVA 4C3IH 2E2IH 4LF7L 4BXXG 1WI5A 5GROA 2E8GA 2VQFL 1HNZQ 1E1TA 3RLFA 3TREA 1AE2A 5J3BA 5LMUL 4A3MH 1FJGL 1IBKQ 1IBLL 3I7FA 4A3LG 1BBWA 4DV3Q 4IPDA 4GN5A 2JA7H 4DV5Q 3ZJYC 2KHIA 3FHWA 3K8AA 4JI1Q 4GN4B 3LGJA 3U50C 5M5YH 5FLMH 3H3VH 3CCVA 2WP8J 4X65Q 3M3YH 1V1QA 3HKZG 4EQ5A 1Q46A 2FXQA 4R4OA 4JI7Q 3GTLH 2E5LL 2ID0A 1VQMA 2DGYA 3NEMA 3PIPA 1W2BA 3M4PA 1HJPA 1SR3A 5H1SE 3U58A 3PF5A 1ASYA 1PH8A 3M9BA 4LUZA 4EX5A 4JI3Q 1KRTA 3H0GG 1LTLA 1C0AA 2YV5A 1X54A 3S17H 1WFQA 4DK6C 2ZM6Q 2JEBI 3EBEA 4DV1Q 4JV5L 2UXDL 2YTXA 3S24A 1X6OA 1E24A 3TRZA 4K0KQ 3J81c 2ZJPA 1VQ7A 2HHHL 4JI0L 2NVTH 4IFDG 3BJUA 4A3MG 5IYDH 4DK3C 2VUMH 5FLXc 3CMEA 1EQRA 1HZBA 1TWGH 2JA7G 1GVPA 4X66Q 5FLMG 5LMNL 4IOCA 2I5MX 4DV0L 1HNXL 2UXBL 4LUOA 3HOZH 1PH1A 3D31A 4JI2Q 4APVA 4DV2L 1K9MC 1L2FA 3STBC 1S72A 1PH3A 3M4QA 2JK8A 2WFWA 1MIUA 1E1OA 3EN2A 4A3JH 4YCUA 3TEHB 4AQYQ 1XNQQ 1XMOL 3CD6A 5M3FH 1RIPA 4X64L 1BKBA 3CCEA 1S40A 3DM3A 1FGUA 3CCQA 4A3CH 3CMAA 3RZDH 3FP9A 1OTCA 2CQOA 4C3HH 3CPFA 2KHJA 3PSIA 4JBKA 1IBMQ 1N8RC 1CKNA 1FVIA 2R7FA 2F52A 1X9NA 1G51A 4YCWA 3NENA 3PV0A 4XTCS 1N34L 5M5WH 5LMNW 3GD7A 3S16H 1XJVA 5IYDG 4P74A 2CCZA 2RCNA 2MQHA 3HKZE 1L1OA 1VQ6A 2VUMG 5C4XH 4OO1G 4HJ7A 3PUYA 3M7NA 3TS2A 3KYHC 1KXLA 1VQEA 3HOZG 2Z0SA 4OONA 1R9TH 2VNUD 4GN3B 3GTOH 2ZJRA 4R1JA 1HR0L 4JI8L 1IXRA 2RHQB 3J7A5 4B3ML 1PFSA 4A3JG 1V43A 4OWXB 4DR6Q 3K80C 4O2DA 1L1OC 2K5HA 5M3FG 5IY0A 1A8VA 1VQIA 4GKJQ 3A5ZB 1I6HH 3W1GA 2GVAA 1JE5A 3I55A 1AH9A 2K14A 4P75A 5C3EG 3ER0A 2GVBA 1I94Q 4B3TQ 1PH6A 5IWAQ 2Q2TA 3S1QH 4A75A 5GAGC 1SFOH 1Q81C 2KENA 4DR7L 4LF7Q 1VQJA 3T1YQ 4DV6Q 1XPOA 2PI2E 2VQFQ 2BH8A 5JJKA 4NB3A 1HZ9A 1UEBA 1Q1EA 5LMUQ 4LF5L 1A62A 1FJGQ 1XPRA 4TQUS 1WOCA 4L5SA 1CKNB 3MEFA 4GS3A 3OYYA 3UDFA 4DAYB 1EQQA 1HR0W 5C4XG 3RZOH 3S14H 1IZ6A 3H3VI 3K0XA 4A3IH 4JI5L 2YU9H 3UDIA 2Y0SG 2JA6H 1VQNA 4A4IA 4FDBA 4NXML 3I56A 2E5LQ 1C9OA 4IOAA 2VL6A 3S1MH 1EOVA 1X3FA 3I4NH 5GAEC 1LUZA 2HIVA 3I2ZA 2D62A 5JJIA 1OXVA 1I94L 2A8VA 4B3TL 3AQQA 3MXNB 2PMZE 3TQYA 2XGTA 4LWCA 4AH6A 1SMXA 4X62L 4GKJL 4OX9L 1G291 3T1YL 4B3SL 1A0IA 1GM5A 4DV6L 1VCIA 4GKKL 1VQBA 5M5XH 2EQSA 3KJOA 1KHIA 4A3BH 4JV5Q 2UXDQ 2IY5B 3S15H 3Q8DA 4MTNA 4A3EG 2HHHQ 4JI0Q 4XIGS 5K36G 3S2HH 3AFPA 1O7IA 2LSSA 3SGIA 3A5UA 2AWNA 1KD1C 5IT9c 1WJJA 2MO0A 4OO1I 1PYBA 1VQGA 5LMNQ 4DV0Q 5M3MH 1HNXQ 4A3IG 2UXBQ 4DV2Q 1YBYA 2CWPA 1W3SA 3KF6B 4LFAQ 3CC7A 2CFMA 2JA6G 2HIXA 3E9HA 4P71A 4BA1I 3UDGA 1X65A 1NJIC 4UPAA 3ULLA 1CUKA 1XMOQ 3I4NG 4NXNL 2MNAA 4QQBX 4X64Q 1TWAH 1N36L 4BBSH 3K81C 4A3KH 3KJPA 4A3FH 1MJCA 1FL0A 2AHOB 4DR4L 4IO9A 1C7YA 4A3BG 4JI6L 3GTQH 4H02A 4PG3A 1N34Q 1KIXA 3GTPH 1Y14B 3CCLA 3HFZB 2IHFA 1VQ9A 1LYLA 4DR3L 2UUAL 1YJ9A 1RL2A 2V1CC 2Y0SE 3G48A 5M3MG 3I4OA 5BR8Q 4LFAL 3STBD 1TWHH 3CAMA 2JJQA 4L5QA 4L5TA 1EUJA 1HR0Q 1VQOA 4JI8Q 5DLQE 2OTJA 2BH2A 2Q2HA 4DV7L 4UP7A 1YVCA 4B3MQ 5C4JH 3TS0A 2NZHA 5JJLA 3AYHB 2C35B 1YJNA 2L15A 1XMQL 1VQAA 1K8GA 1SROA 4LFCL 3OTOL 4JYAL 4BBSG 1BBUA 1WYDA 3UE0A 1M90C 2AKWB 3I4MH 2F3IA 4A3KG 2AWOA 3G4SA 4B3RL 4DUYL 3RN5A 2F4VL 1VQDA 1VQFA 1EWIA 1XPUA 4IJHA 2MO1A 3W5OA 1HZCA 3GO5A 4C2MH 3F2DA 1YHBA 5GAHC 2UUCL 1D7QA 2CWAA 4BBRH 3PUXA 2GN5A 1PH4A 5HY6A 2RHSB 4DR7Q 1NBWA 1PV4A 1Q82C 2ZJQA 1OXTA 4HIKA 4DNIA 1QZHA 3F1ZA 3FKIH 1UE5A 4RG1A 5GADC 4LF5Q 4R4TA 2ZTDA 4QJFA 4HIOA 4JBJA 5JEAG 5BR8L 1E22A 3JAMi 5GQOA 4KLKA 2YTYA 2K5VA 1KAWA 2ZTEA 1VQHA 4OWWB 2KBNA 1X55A 4JI5Q 2VS1A 4IPGA 4LFBL 1Q1BA 1KRSA 2NVYH 3HOWH 4DKAC 4YY3L 4NXMQ 3J80i 1IYJB 4GOPA 1VQ4A 1H95A 5IP9H 4A3CG 1N33L 3AEVA 3PO2H 5FJ8H 3BU2A 2KCMA 1OXUA 1JB7A 4AIMA 2OTLA 4LF6L 3I4MG 1HZAA 3CCJA 4MZ9A 2UXCL 4R4CA 3H15A 1YHAA 2UU9L 4YHHL 2ASBA 4X62Q 4IJLA 4OX9Q 4B3SQ 4GKKQ 1PH7A 1DGSA 2N78A 4HJ5A 1VQ8A 1X56A 4BBRG 1ASZA 2PQAA 3HOYH 3KOJA 2VQEL 3ULPA 4DPGA 3CP0A 4A3DH 1YEZA 2NN6G 3KF6A 4UP8A 2NZOA 2R7ZH 1HNWL 3FKIG 4ME3A 3EIVA 2I5LX 1GKHA 1TWCH 2VY3A 1IL2A 3NBHB 1IBML 4LF9L 2EXDA 1I5FA 5IYCH 1HH2P 3CC2A 3G6EA 4LF4L 3KDFA 4R4QA 1T9HA 2VW9A 2ZTCA 4YWKA 4DR5L 2K50A 1XNRL 1I3QH 4ALPA 4P73A 3HOWG 1TWFH 4DAMA 1GO3E 3J7ZC 2KCTA 4NPSA 3CF5A 3PO3H 3B6YA 1NE3A 3D0FA 5IP9G 2NVXH 4JBWA 4JI4L 4NXNQ 2OQKA 4QGUA 3PO2G 1VQCA 2OWOA 4IPHA 5FJ8G 3KLWA 1OXSC 1B8AA 1NMGA 2IT1A 2JEAI 1AE3A 4P72A 1N36Q 3PUVA 2OQ0A 5IE8A 1Z47A 2EIFA 1J5EL 1JMCA 4HJ9A 4GOPB 1G6PA 4PZ6A 2K52A 4JOIA 4JG2A 3J81j 1N32L 1B70B 4DR4Q 5AJ3L 4X6AH 5IP7H 3E0EA 2WAQG 3HOYG 5ELNA 3DLLA 1U0LA 2UUBL 4JI6Q 1PYSB 1CSPA 1EIFA 4LW1A 3M4OH 1CSQA 4A3DG 2QGQA 2R7ZG 3CCUA 4AYBG 3RLNA 4QL5A 4DR2L 1KC8C 1CKOA 4DR3Q 2IX0A 3KF8B 2Q2IA 4GNXB 2UUAQ 2NVQH 3S2DH 1JT8A 3S1NH 1XTDA 4PZ7A 5IYCG 2PQAB 4PMWA 2YYZA 2B63H 2LXJA 1L0WA 2A19A 3BZCA 1BVSA 3ICEA 2MFIA 4GLAC 1KQSA 4A3GH 3S1RH 1UE1A 4DV7Q 4JC0A 3CC4A 4MNOA 3WWVA 3PO3G 1K3RA 3KDFB 4QY7A 1XMQQ 4POGA 4KHPQ 4LFCQ 4J15A 3OTOQ 4OWTB 4JYAQ 1YZ6A 4GLXA 1K73C 3CW2C 1EYGA 1Q12A 4B3RQ 4DR1L 1SE8A 4DUYQ 2F4VQ 2R93H 4DUZL 2JA8H 2B3GA 5IP7G 4O0AA 5JEAJ 1Q7YC 2PI2A 3PUWA 2UUCQ 1VQKA 3RR5A 3E9IA 4TVAB 3U4ZA 1E3PA 2NN6I 2B29A 4KI0A 5C0XJ 1NMFA 2VZAA 2E2HH 4WJ4A 1K8AC 1VQLA 2N49A 2I0QA 2Q2UA 1VQPA 2DUDA 4LF8L 2IHEA 5IYBH 3W1BA 1LM0A 2YTVA 2K75A 5E7NA 2IX1A 1Y1WH 2B63G 4LNQA 3UE1A 1NTGA 3J81i 2ALYB 4KHZA 1HNZL 4LFBQ 1PVOA 2RF4A 4YY3Q 4A3GG 1IBKL 4YWLA 4UY8C 3RLOA 4DV3L 4KHPL 3RNUA 4DV5L 1P8LA 1QUQB 4BY1H 1N33Q 3F8TA 4JI1L 1QZGA 3CCSA 3CCRA 3AFQA 2R6GA 4L5RC 4Y52H 2WAQE 4A3FG 4X65L 2N3SA 4LF6Q 4A93H 1J6QA 1X3EA 4Y7NH 2D0OA 3L2PA 4JI7L 2UXCQ 1NY4A 2UU9Q 2R93G 4AYBE 1V9PA 4YHHQ 2JA8G 2WB1E 3U4VA 4BA2I 1TXYA 1UWVA 2XTIA 4UP9A 4PZ8A 4BY7H 1GD7A 4YCVA 3A74A 1YI2A 2VQEQ 4GLVB 2HQLA 5ELOA 1QVCA 1M1KC 3ERSX 1HNWQ 1Z9FA 3GTKH 4HJAA 3JC66 3PIOA 4JI3L 2JE6I 1B7YB 1UE6A 1Y1VH 1YNXA 2CKZB 3GDEA 1PHJA 2QEXA 3HOUH 4LF9Q 1JJGA 5IYBG 1SN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X G;  4HID A;  1MJE A;  3ULJ A;  5C3E H;  3JAM c;  4LF4 Q;  2ZM6 L;  1Y1W G;  4DV1 L;  4DR5 Q;  1XNR Q;  3CXC A;  2A1A A;  4HIM A;  5C44 H;  4K0K L;  3L0O A;  2JQO A;  3HKS A;  3OW2 A;  1WCM H;  3RN2 A;  3J80 c;  2AMC B;  2Z6K A;  2ATW A;  3GTM H;  3L7Z C;  1I50 H;  4BY1 G;  4X66 L;  3F2B A;  4JBM A;  4JI4 Q;  4OXP A;  3HOV H;  1PH9 A;  3PGZ A;  4JI2 L;  1VS0 A;  1Q86 C;  2BA0 A;  2HT1 A;  4A93 G;  4GNX A;  1J5E Q;  1MKH A;  2R92 H;  1PH2 A;  2JA5 H;  1N32 Q;  3CQZ H;  4A76 A;  4GOP C;  2QA4 A;  1YHQ A;  5AJ3 Q;  3PCO B;  4IPC A;  4DV4 Q;  4BY7 G;  4AQY L;  1XNQ L;  2H5X A;  2UUB Q;  1X3G A;  2K5N A;  2Z6K C;  1D8L A;  3K7A H;  1YIJ A;  1YIT A;  4DR2 Q;  1PH5 A;  1VQ5 A;  2R7D A;  4WJ3 M;  1UE7 A;  3HOU G;  1Y1V G;  3BZK A;  1OXX K;  3PF4 A;  4GNX C;  3HOX H;  2E2J H;  3GTG H;  2OCE A;  1QVG A;  3CCM A;  4BXX H;  2BA1 A;  3IRB A;  2ES2 A;  3T1H Q;  3F2C A;  5C44 G;  1EIY B;  1S3O A;  1PA6 A;  1E7Z A;  1WCM G;  4POF A;  2LXK A;  3K7U C;  4A3E H;  4IFD I;  4A3L H;  1IBL Q;  3UDX A;  3HOV G;  2PNH A;  1SLJ A;  4C3J H;  2N8N A;  3GTJ H;  2K4K A;  2I5H A;  3M85 A;  2R92 G;  2JA9 A;  4DR1 Q;  2JA5 G;  4DV4 L;  1A63 A;  5HGQ A;  4R4I A;  4DUZ Q;  1K0R A;  1KL9 A;  3KFU A;  2D0P A;  1L1O B;  5EAY A;  4DR6 L;  3A0J A;  1QVF A;  1N9W A;  2WB1 G;  4YWM A;  1SRU A;  1Q8K A;  3PUZ A;  1CKM A;  1EFW A;  3CPW A;  3H0G H;  1JJ2 A;  4JOI C;  1YJW A;  4LF8 Q;  1K83 H;  1P16 A;  3HOX G;  5C0X I;  1QUQ A;  1U5K A;  3NEL A;  4RMF A;  3VDY A;  4QIW E;  5IWA L;  4IFD J;  1JJC B;  4HJ8 A;  4JCV E;  3G71 A;  3T1H L;  4LUV A;  4C3I H;  2E2I H;  4LF7 L;  4BXX G;  1WI5 A;  5GRO A;  2E8G A;  2VQF L;  1HNZ Q;  1E1T A;  3RLF A;  3TRE A;  1AE2 A;  5J3B A;  5LMU L;  4A3M H;  1FJG L;  1IBK Q;  1IBL L;  3I7F A;  4A3L G;  1BBW A;  4DV3 Q;  4IPD A;  4GN5 A;  2JA7 H;  4DV5 Q;  3ZJY C;  2KHI A;  3FHW A;  3K8A A;  4JI1 Q;  4GN4 B;  3LGJ A;  3U50 C;  5M5Y H;  5FLM H;  3H3V H;  3CCV A;  2WP8 J;  4X65 Q;  3M3Y H;  1V1Q A;  3HKZ G;  4EQ5 A;  1Q46 A;  2FXQ A;  4R4O A;  4JI7 Q;  3GTL H;  2E5L L;  2ID0 A;  1VQM A;  2DGY A;  3NEM A;  3PIP A;  1W2B A;  3M4P A;  1HJP A;  1SR3 A;  5H1S E;  3U58 A;  3PF5 A;  1ASY A;  1PH8 A;  3M9B A;  4LUZ A;  4EX5 A;  4JI3 Q;  1KRT A;  3H0G G;  1LTL A;  1C0A A;  2YV5 A;  1X54 A;  3S17 H;  1WFQ A;  4DK6 C;  2ZM6 Q;  2JEB I;  3EBE A;  4DV1 Q;  4JV5 L;  2UXD L;  2YTX A;  3S24 A;  1X6O A;  1E24 A;  3TRZ A;  4K0K Q;  3J81 c;  2ZJP A;  1VQ7 A;  2HHH L;  4JI0 L;  2NVT H;  4IFD G;  3BJU A;  4A3M G;  5IYD H;  4DK3 C;  2VUM H;  5FLX c;  3CME A;  1EQR A;  1HZB A;  1TWG H;  2JA7 G;  1GVP A;  4X66 Q;  5FLM G;  5LMN L;  4IOC A;  2I5M X;  4DV0 L;  1HNX L;  2UXB L;  4LUO A;  3HOZ H;  1PH1 A;  3D31 A;  4JI2 Q;  4APV A;  4DV2 L;  1K9M C;  1L2F A;  3STB C;  1S72 A;  1PH3 A;  3M4Q A;  2JK8 A;  2WFW A;  1MIU A;  1E1O A;  3EN2 A;  4A3J H;  4YCU A;  3TEH B;  4AQY Q;  1XNQ Q;  1XMO L;  3CD6 A;  5M3F H;  1RIP A;  4X64 L;  1BKB A;  3CCE A;  1S40 A;  3DM3 A;  1FGU A;  3CCQ A;  4A3C H;  3CMA A;  3RZD H;  3FP9 A;  1OTC A;  2CQO A;  4C3H H;  3CPF A;  2KHJ A;  3PSI A;  4JBK A;  1IBM Q;  1N8R C;  1CKN A;  1FVI A;  2R7F A;  2F52 A;  1X9N A;  1G51 A;  4YCW A;  3NEN A;  3PV0 A;  4XTC S;  1N34 L;  5M5W H;  5LMN W;  3GD7 A;  3S16 H;  1XJV A;  5IYD G;  4P74 A;  2CCZ A;  2RCN A;  2MQH A;  3HKZ E;  1L1O A;  1VQ6 A;  2VUM G;  5C4X H;  4OO1 G;  4HJ7 A;  3PUY A;  3M7N A;  3TS2 A;  3KYH C;  1KXL A;  1VQE A;  3HOZ G;  2Z0S A;  4OON A;  1R9T H;  2VNU D;  4GN3 B;  3GTO H;  2ZJR A;  4R1J A;  1HR0 L;  4JI8 L;  1IXR A;  2RHQ B;  3J7A 5;  4B3M L;  1PFS A;  4A3J G;  1V43 A;  4OWX B;  4DR6 Q;  3K80 C;  4O2D A;  1L1O C;  2K5H A;  5M3F G;  5IY0 A;  1A8V A;  1VQI A;  4GKJ Q;  3A5Z B;  1I6H H;  3W1G A;  2GVA A;  1JE5 A;  3I55 A;  1AH9 A;  2K14 A;  4P75 A;  5C3E G;  3ER0 A;  2GVB A;  1I94 Q;  4B3T Q;  1PH6 A;  5IWA Q;  2Q2T A;  3S1Q H;  4A75 A;  5GAG C;  1SFO H;  1Q81 C;  2KEN A;  4DR7 L;  4LF7 Q;  1VQJ A;  3T1Y Q;  4DV6 Q;  1XPO A;  2PI2 E;  2VQF Q;  2BH8 A;  5JJK A;  4NB3 A;  1HZ9 A;  1UEB A;  1Q1E A;  5LMU Q;  4LF5 L;  1A62 A;  1FJG Q;  1XPR A;  4TQU S;  1WOC A;  4L5S A;  1CKN B;  3MEF A;  4GS3 A;  3OYY A;  3UDF A;  4DAY B;  1EQQ A;  1HR0 W;  5C4X G;  3RZO H;  3S14 H;  1IZ6 A;  3H3V I;  3K0X A;  4A3I H;  4JI5 L;  2YU9 H;  3UDI A;  2Y0S G;  2JA6 H;  1VQN A;  4A4I A;  4FDB A;  4NXM L;  3I56 A;  2E5L Q;  1C9O A;  4IOA A;  2VL6 A;  3S1M H;  1EOV A;  1X3F A;  3I4N H;  5GAE C;  1LUZ A;  2HIV A;  3I2Z A;  2D62 A;  5JJI A;  1OXV A;  1I94 L;  2A8V A;  4B3T L;  3AQQ A;  3MXN B;  2PMZ E;  3TQY A;  2XGT A;  4LWC A;  4AH6 A;  1SMX A;  4X62 L;  4GKJ L;  4OX9 L;  1G29 1;  3T1Y L;  4B3S L;  1A0I A;  1GM5 A;  4DV6 L;  1VCI A;  4GKK L;  1VQB A;  5M5X H;  2EQS A;  3KJO A;  1KHI A;  4A3B H;  4JV5 Q;  2UXD Q;  2IY5 B;  3S15 H;  3Q8D A;  4MTN A;  4A3E G;  2HHH Q;  4JI0 Q;  4XIG S;  5K36 G;  3S2H H;  3AFP A;  1O7I A;  2LSS A;  3SGI A;  3A5U A;  2AWN A;  1KD1 C;  5IT9 c;  1WJJ A;  2MO0 A;  4OO1 I;  1PYB A;  1VQG A;  5LMN Q;  4DV0 Q;  5M3M H;  1HNX Q;  4A3I G;  2UXB Q;  4DV2 Q;  1YBY A;  2CWP A;  1W3S A;  3KF6 B;  4LFA Q;  3CC7 A;  2CFM A;  2JA6 G;  2HIX A;  3E9H A;  4P71 A;  4BA1 I;  3UDG A;  1X65 A;  1NJI C;  4UPA A;  3ULL A;  1CUK A;  1XMO Q;  3I4N G;  4NXN L;  2MNA A;  4QQB X;  4X64 Q;  1TWA H;  1N36 L;  4BBS H;  3K81 C;  4A3K H;  3KJP A;  4A3F H;  1MJC A;  1FL0 A;  2AHO B;  4DR4 L;  4IO9 A;  1C7Y A;  4A3B G;  4JI6 L;  3GTQ H;  4H02 A;  4PG3 A;  1N34 Q;  1KIX A;  3GTP H;  1Y14 B;  3CCL A;  3HFZ B;  2IHF A;  1VQ9 A;  1LYL A;  4DR3 L;  2UUA L;  1YJ9 A;  1RL2 A;  2V1C C;  2Y0S E;  3G48 A;  5M3M G;  3I4O A;  5BR8 Q;  4LFA L;  3STB D;  1TWH H;  3CAM A;  2JJQ A;  4L5Q A;  4L5T A;  1EUJ A;  1HR0 Q;  1VQO A;  4JI8 Q;  5DLQ E;  2OTJ A;  2BH2 A;  2Q2H A;  4DV7 L;  4UP7 A;  1YVC A;  4B3M Q;  5C4J H;  3TS0 A;  2NZH A;  5JJL A;  3AYH B;  2C35 B;  1YJN A;  2L15 A;  1XMQ L;  1VQA A;  1K8G A;  1SRO A;  4LFC L;  3OTO L;  4JYA L;  4BBS G;  1BBU A;  1WYD A;  3UE0 A;  1M90 C;  2AKW B;  3I4M H;  2F3I A;  4A3K G;  2AWO A;  3G4S A;  4B3R L;  4DUY L;  3RN5 A;  2F4V L;  1VQD A;  1VQF A;  1EWI A;  1XPU A;  4IJH A;  2MO1 A;  3W5O A;  1HZC A;  3GO5 A;  4C2M H;  3F2D A;  1YHB A;  5GAH C;  2UUC L;  1D7Q A;  2CWA A;  4BBR H;  3PUX A;  2GN5 A;  1PH4 A;  5HY6 A;  2RHS B;  4DR7 Q;  1NBW A;  1PV4 A;  1Q82 C;  2ZJQ A;  1OXT A;  4HIK A;  4DNI A;  1QZH A;  3F1Z A;  3FKI H;  1UE5 A;  4RG1 A;  5GAD C;  4LF5 Q;  4R4T A;  2ZTD A;  4QJF A;  4HIO A;  4JBJ A;  5JEA G;  5BR8 L;  1E22 A;  3JAM i;  5GQO A;  4KLK A;  2YTY A;  2K5V A;  1KAW A;  2ZTE A;  1VQH A;  4OWW B;  2KBN A;  1X55 A;  4JI5 Q;  2VS1 A;  4IPG A;  4LFB L;  1Q1B A;  1KRS A;  2NVY H;  3HOW H;  4DKA C;  4YY3 L;  4NXM Q;  3J80 i;  1IYJ B;  4GOP A;  1VQ4 A;  1H95 A;  5IP9 H;  4A3C G;  1N33 L;  3AEV A;  3PO2 H;  5FJ8 H;  3BU2 A;  2KCM A;  1OXU A;  1JB7 A;  4AIM A;  2OTL A;  4LF6 L;  3I4M G;  1HZA A;  3CCJ A;  4MZ9 A;  2UXC L;  4R4C A;  3H15 A;  1YHA A;  2UU9 L;  4YHH L;  2ASB A;  4X62 Q;  4IJL A;  4OX9 Q;  4B3S Q;  4GKK Q;  1PH7 A;  1DGS A;  2N78 A;  4HJ5 A;  1VQ8 A;  1X56 A;  4BBR G;  1ASZ A;  2PQA A;  3HOY H;  3KOJ A;  2VQE L;  3ULP A;  4DPG A;  3CP0 A;  4A3D H;  1YEZ A;  2NN6 G;  3KF6 A;  4UP8 A;  2NZO A;  2R7Z H;  1HNW L;  3FKI G;  4ME3 A;  3EIV A;  2I5L X;  1GKH A;  1TWC H;  2VY3 A;  1IL2 A;  3NBH B;  1IBM L;  4LF9 L;  2EXD A;  1I5F A;  5IYC H;  1HH2 P;  3CC2 A;  3G6E A;  4LF4 L;  3KDF A;  4R4Q A;  1T9H A;  2VW9 A;  2ZTC A;  4YWK A;  4DR5 L;  2K50 A;  1XNR L;  1I3Q H;  4ALP A;  4P73 A;  3HOW G;  1TWF H;  4DAM A;  1GO3 E;  3J7Z C;  2KCT A;  4NPS A;  3CF5 A;  3PO3 H;  3B6Y A;  1NE3 A;  3D0F A;  5IP9 G;  2NVX H;  4JBW A;  4JI4 L;  4NXN Q;  2OQK A;  4QGU A;  3PO2 G;  1VQC A;  2OWO A;  4IPH A;  5FJ8 G;  3KLW A;  1OXS C;  1B8A A;  1NMG A;  2IT1 A;  2JEA I;  1AE3 A;  4P72 A;  1N36 Q;  3PUV A;  2OQ0 A;  5IE8 A;  1Z47 A;  2EIF A;  1J5E L;  1JMC A;  4HJ9 A;  4GOP B;  1G6P A;  4PZ6 A;  2K52 A;  4JOI A;  4JG2 A;  3J81 j;  1N32 L;  1B70 B;  4DR4 Q;  5AJ3 L;  4X6A H;  5IP7 H;  3E0E A;  2WAQ G;  3HOY G;  5ELN A;  3DLL A;  1U0L A;  2UUB L;  4JI6 Q;  1PYS B;  1CSP A;  1EIF A;  4LW1 A;  3M4O H;  1CSQ A;  4A3D G;  2QGQ A;  2R7Z G;  3CCU A;  4AYB G;  3RLN A;  4QL5 A;  4DR2 L;  1KC8 C;  1CKO A;  4DR3 Q;  2IX0 A;  3KF8 B;  2Q2I A;  4GNX B;  2UUA Q;  2NVQ H;  3S2D H;  1JT8 A;  3S1N H;  1XTD A;  4PZ7 A;  5IYC G;  2PQA B;  4PMW A;  2YYZ A;  2B63 H;  2LXJ A;  1L0W A;  2A19 A;  3BZC A;  1BVS A;  3ICE A;  2MFI A;  4GLA C;  1KQS A;  4A3G H;  3S1R H;  1UE1 A;  4DV7 Q;  4JC0 A;  3CC4 A;  4MNO A;  3WWV A;  3PO3 G;  1K3R A;  3KDF B;  4QY7 A;  1XMQ Q;  4POG A;  4KHP Q;  4LFC Q;  4J15 A;  3OTO Q;  4OWT B;  4JYA Q;  1YZ6 A;  4GLX A;  1K73 C;  3CW2 C;  1EYG A;  1Q12 A;  4B3R Q;  4DR1 L;  1SE8 A;  4DUY Q;  2F4V Q;  2R93 H;  4DUZ L;  2JA8 H;  2B3G A;  5IP7 G;  4O0A A;  5JEA J;  1Q7Y C;  2PI2 A;  3PUW A;  2UUC Q;  1VQK A;  3RR5 A;  3E9I A;  4TVA B;  3U4Z A;  1E3P A;  2NN6 I;  2B29 A;  4KI0 A;  5C0X J;  1NMF A;  2VZA A;  2E2H H;  4WJ4 A;  1K8A C;  1VQL A;  2N49 A;  2I0Q A;  2Q2U A;  1VQP A;  2DUD A;  4LF8 L;  2IHE A;  5IYB H;  3W1B A;  1LM0 A;  2YTV A;  2K75 A;  5E7N A;  2IX1 A;  1Y1W H;  2B63 G;  4LNQ A;  3UE1 A;  1NTG A;  3J81 i;  2ALY B;  4KHZ A;  1HNZ L;  4LFB Q;  1PVO A;  2RF4 A;  4YY3 Q;  4A3G G;  1IBK L;  4YWL A;  4UY8 C;  3RLO A;  4DV3 L;  4KHP L;  3RNU A;  4DV5 L;  1P8L A;  1QUQ B;  4BY1 H;  1N33 Q;  3F8T A;  4JI1 L;  1QZG A;  3CCS A;  3CCR A;  3AFQ A;  2R6G A;  4L5R C;  4Y52 H;  2WAQ E;  4A3F G;  4X65 L;  2N3S A;  4LF6 Q;  4A93 H;  1J6Q A;  1X3E A;  4Y7N H;  2D0O A;  3L2P A;  4JI7 L;  2UXC Q;  1NY4 A;  2UU9 Q;  2R93 G;  4AYB E;  1V9P A;  4YHH Q;  2JA8 G;  2WB1 E;  3U4V A;  4BA2 I;  1TXY A;  1UWV A;  2XTI A;  4UP9 A;  4PZ8 A;  4BY7 H;  1GD7 A;  4YCV A;  3A74 A;  1YI2 A;  2VQE Q;  4GLV B;  2HQL A;  5ELO A;  1QVC A;  1M1K C;  3ERS X;  1HNW Q;  1Z9F A;  3GTK H;  4HJA A;  3JC6 6;  3PIO A;  4JI3 L;  2JE6 I;  1B7Y B;  1UE6 A;  1Y1V H;  1YNX A;  2CKZ B;  3GDE A;  1PHJ A;  2QEX A;  3HOU H;  4LF9 Q;  1JJG A;  5IYB G;  1SN8 A; 
#chains in the Genus database with same CATH topology
 3JAM c;  2ZM6 L;  5IGD A;  5CBE E;  1TVX A;  5J22 A;  3CXC A;  3OW2 A;  1WCM H;  2MJ8 A;  3MAQ A;  2Z6K A;  3GTM H;  3L7Z C;  1I50 H;  1SJE D;  2HQE A;  4OXP A;  3PGZ A;  2HT1 A;  1VS0 A;  5CV8 A;  1LT3 D;  1K8O A;  3BYY B;  1J5E Q;  1MKH A;  1N32 Q;  1YHQ A;  1H9M A;  3PCO B;  4R8N A;  3V05 A;  2H5X A;  3A55 A;  1IW7 D;  1F9P A;  1CT1 D;  3GTP B;  1RKN A;  1A3V A;  4GNX C;  3GV3 A;  5C44 G;  1EIY B;  4HED A;  1E7Z A;  3DWP A;  2LXK A;  3K7U C;  3RD4 A;  3UDX A;  2N8N A;  4JPB W;  1WTV A;  3M85 A;  1AFP A;  5IIF A;  3I4M B;  2JA5 G;  4R4I A;  4I7A A;  1ENA A;  2D0P A;  1L1O B;  5JVG 3;  2LKV A;  1ROD A;  2M2L A;  1F2L A;  4J8Q A;  2B2T C;  1JE4 A;  1SRU A;  5CV9 A;  3OWE B;  4IN3 A;  2KOL A;  5EGT A;  3D3R A;  4JOI C;  1P16 A;  3SEB A;  1U5K A;  3VDY A;  1A6X A;  4QIW E;  4JCV E;  4LUV A;  4HTH A;  1PMR A;  3SK4 A;  1WI5 A;  2MGS A;  5T1G A;  1STA A;  3HOW B;  3T53 B;  1HPC A;  1PDQ A;  1BBW A;  4IPD A;  1L0Y B;  3N6R A;  4DV5 Q;  3ZJY C;  4C3J G;  5FLM H;  4GN4 B;  3CHB D;  4IUR A;  1LTI D;  3GTL H;  2ID0 A;  2DGY A;  2F4I A;  1HJP A;  1HTL D;  1SR3 A;  1VMP A;  2WAQ B;  1ASY A;  4HN7 A;  1PH8 A;  2K5Q A;  1KRT A;  1TWC B;  3BDL A;  2YV5 A;  1ZYR C;  1EYA A;  1ENC A;  4MN3 A;  1V8Q A;  2F3V A;  3C1F A;  2JEB I;  3AB9 A;  3K6O A;  4JV5 L;  3S24 A;  3Q22 A;  1E24 A;  3H6M A;  3J81 c;  1CA6 A;  3BJU A;  3MA2 B;  4A3M G;  1TWF B;  3MZ5 A;  2VUM H;  5FLX c;  1EQR A;  4CHT B;  5LMN L;  4OO1 H;  4DV0 L;  1HNX L;  2AQ3 B;  3HOZ H;  2PW7 A;  3D31 A;  5J39 A;  1L2F A;  1PFN A;  2Z8L A;  4J6H A;  2JK8 A;  2WFW A;  3GP7 A;  5C3X A;  5D3I B;  3EN2 A;  5EPJ A;  1XNQ Q;  4DF7 A;  3CCE A;  4A3C H;  2E74 C;  1FGU A;  1BXT A;  1KTK A;  3DM3 A;  5ELC A;  3RZD H;  4G7O C;  3G7L A;  2KHJ A;  3PSI A;  1X9N A;  4YCW A;  3NEN A;  4XTC S;  2AUJ D;  1N34 L;  5M5W H;  5LMN W;  3S16 H;  4P74 A;  4F7X A;  4EVO A;  1L1O A;  2R61 A;  2B2U C;  3KYH C;  2F1M A;  4R1J A;  2RHQ B;  3ERO A;  4QUF A;  1IKL A;  1V43 A;  4K5V A;  4DR6 Q;  4PMC A;  5M3F G;  1PZK D;  3QO2 A;  1VQI A;  1IHZ A;  2B2Y A;  1I6H H;  3I55 A;  4FVM A;  4C3H G;  2D5D A;  3OWF A;  1PH6 A;  3BZD B;  5IWA Q;  2EYH A;  2QDB A;  1Q81 C;  1Y1W B;  4LF7 Q;  3T1Y Q;  2HCC A;  3J80 L;  5JJK A;  5JPN C;  1RDP D;  4QIW B;  4L5S A;  1CKN B;  3MEF A;  1EQQ A;  3OYY A;  4DAY B;  5C4X G;  3RZO H;  3S14 H;  3H3V I;  1STE A;  3K0X A;  2K6A A;  4RWS C;  4A93 B;  4G7Z C;  2KHS A;  1VQN A;  4NXM L;  2E5L Q;  4IOA A;  2VL6 A;  3S1M H;  4I7Z C;  1X3F A;  3I4N H;  4BY7 B;  3I2Z A;  2D62 A;  5JJI A;  1LT6 D;  2A8V A;  2LS0 1;  1NR2 A;  1NAP A;  3AQQ A;  1Y1V B;  3TQY A;  2XGT A;  4K2L A;  4B3S L;  3T1Y L;  1SYB A;  4V0B A;  1VCI A;  5M5X H;  2QIL A;  1KHI A;  4IQZ A;  2DY8 A;  3S15 H;  2HHH Q;  4JI0 Q;  3S2H H;  3FPP A;  4XQQ A;  1K0S A;  2AWN A;  1BOS A;  5IT9 c;  1WCM B;  1TS3 A;  3QG1 A;  5COR A;  3GTM B;  1I50 B;  1JC7 A;  1W6K A;  4A3I G;  1EYD A;  2CWP A;  3TME A;  3CC7 A;  4LFA Q;  2JA6 G;  2CFM A;  5E1F A;  4K5W A;  1X65 A;  2BOS A;  3ULL A;  1CUK A;  2B2V A;  1XMO Q;  4FO2 A;  4X64 Q;  4N9P A;  4BBS H;  4A3K H;  4K5X A;  4A3F H;  1MJC A;  2AHO B;  2OXP A;  5DM7 3;  4FXG C;  1TS5 A;  3D4R A;  1TQO A;  4A3B G;  4JI6 L;  2A69 D;  3GTQ H;  1DJR D;  2DNC A;  2V1C C;  1JB3 A;  4CKE A;  5KRU A;  4O42 A;  4LFA L;  2JJQ A;  5FKA C;  3IKJ A;  2OTJ A;  4R9W A;  2BH2 A;  2A6H C;  4NMZ A;  4B3M Q;  3QB3 A;  5C4J H;  1STY A;  1SRO A;  4LMQ D;  1A3T A;  2AKW B;  2Z6B A;  1PTO H;  3I91 A;  4H13 C;  5G3L F;  4DUY L;  2F4V L;  1EQT A;  1VQD A;  1VQF A;  1DON A;  1U4P A;  3U9O A;  3VR4 A;  4BBR H;  5HY6 A;  1NBW A;  1PV4 A;  1WTH A;  2NN6 H;  2VB2 X;  3F1Z A;  1ET6 A;  1SYG A;  1UE5 A;  3OMC A;  5GAD C;  4LF5 Q;  2ZTD A;  1SYC A;  4C56 C;  4PNY A;  2YTY A;  2K5V A;  1KAW A;  2ZTE A;  1A2T A;  1DZ1 A;  3HRZ C;  2PW5 A;  1QNK A;  3GTL B;  4GOP A;  1PTO F;  4CJ1 B;  2F0Q A;  2B8F A;  1JOQ A;  3NBI A;  3WOE A;  1DYQ A;  2BE5 C;  4R4C A;  3H15 A;  2ASB A;  3KF8 A;  4HJ5 A;  1X56 A;  4ME5 A;  4RGT A;  2PQA A;  3HOY H;  3CP0 A;  3URY A;  2B2Y C;  4UP8 A;  5E3F A;  2R7Z H;  4CJ0 B;  2IW3 A;  4ME3 A;  2B8G A;  5IGB A;  2VY3 A;  4LF9 L;  2J7Z A;  2VUM B;  4LF4 L;  1W6J A;  2F0N A;  2Q8R E;  3HOZ B;  1GO3 E;  1HCZ A;  3CF5 A;  2F0D A;  3PO3 H;  3VR3 A;  3D0F A;  4CKC A;  4YIJ A;  3NXW A;  1IKM A;  4KN7 C;  3PO2 G;  4IPH A;  1V1P B;  3KLW A;  1D5Z C;  5CMD A;  2QEJ C;  4LJZ C;  1N36 Q;  3PUV A;  3RZD B;  2EIF A;  1G6P A;  4N8X 1;  4PZ6 A;  3U9S A;  4DR4 Q;  4KD3 A;  4ID6 A;  4CDD C;  3D6C A;  4A3D G;  4AYB G;  5M5W B;  3S16 B;  4GNX B;  3S2D H;  2NVQ H;  1JT8 A;  1XTD A;  5IYC G;  2LMC B;  3BZC A;  1BVS A;  3RMH A;  1KQS A;  1NCV A;  3S1R H;  3CC4 A;  4JC0 A;  4DNR B;  3WWV A;  1K3R A;  3KDF B;  4QY7 A;  1WVL A;  3MEH A;  3MFY A;  4LAA A;  4LFC Q;  3NPP A;  4J15 A;  1I4H A;  1I6H B;  1SE8 A;  1BCP C;  2JA8 H;  1D6E C;  2EYO A;  5IP7 G;  2UUC Q;  1TII D;  4RAU C;  1UNS A;  1E3P A;  3M4Y A;  2JYO A;  2E2H H;  1UUP A;  3TBI B;  1K8A C;  2N49 A;  5IGC A;  2I0Q A;  1A15 A;  4CDC C;  4LF8 L;  2NB0 A;  1LM0 A;  1SSO A;  1SMY D;  4NP5 A;  3RZO B;  3S14 B;  2B63 G;  5EJW A;  3RUZ A;  1WTO A;  2L5T A;  4GZY C;  4KHZ A;  4KY6 A;  1HQR D;  2XIW A;  1B3A A;  4A3G G;  4YWL A;  4IUN A;  1GUS A;  3VA7 A;  3S1M B;  1JIC A;  1QUQ B;  2QDL A;  3QIA A;  1N33 Q;  3I4N B;  3CCS A;  1MI2 A;  1SAP A;  3AFQ A;  2MUY A;  2CH4 A;  2HCI A;  2N3S A;  5C5L A;  3DHQ A;  4LF6 Q;  5BN5 A;  1EY6 A;  2UXC Q;  2R93 G;  4YHH Q;  4XQN A;  2TMP A;  1TXY A;  4RA8 A;  4RGM A;  1QCB D;  3VA5 A;  1YI2 A;  5M5X B;  3BVG A;  1GHK A;  2X6G A;  3TP6 A;  4HJA A;  3S15 B;  1CK1 A;  1UE6 A;  1PHJ A;  3S2H B;  3GDE A;  5EBD A;  2EE1 A;  4HID A;  3ULJ A;  1V1P A;  5TSS A;  1Y8P B;  1XNR Q;  1II3 A;  1AZP A;  2A1A A;  4HIM A;  4K0K L;  1QB5 D;  3K58 A;  3L0O A;  3HKS A;  3RN2 A;  2FHT A;  3EFX D;  1MGS A;  2AMC B;  4JBM A;  4BY1 G;  4X66 L;  3R3O A;  4JI4 Q;  2XWJ B;  1DXM A;  4GNX A;  4BBS B;  1UEA B;  2ICI A;  2M00 A;  4O1N A;  4A3K B;  1PH2 A;  2GA4 B;  4GOP C;  4A3F B;  2QCP X;  2Z4I A;  3MHB A;  1S5D D;  5KEE A;  2UUB Q;  2K5N A;  2K5D A;  2RVL A;  1YIJ A;  1YIT A;  3GTQ B;  4DR2 Q;  1UE7 A;  2F0K A;  3A56 A;  3HOU G;  2EYP A;  3HOX H;  1EY9 A;  1RTO A;  1SNO A;  1BUV T;  3I73 A;  2E2J H;  2CQA A;  3CRK C;  1JWS D;  3VYT A;  2BA1 A;  4HSP A;  3T1H Q;  3F2C A;  4ULL A;  5EPL A;  5C4J B;  3HOV G;  2QKI C;  2E75 C;  2HDL A;  3ND9 A;  2AUK A;  2R92 G;  1PTO B;  5HGQ A;  5FOB B;  1K0R A;  3BVZ A;  1KL9 A;  3NQT A;  1B9N A;  4DXF A;  2WB1 G;  4YWM A;  2AQ2 B;  3OW7 A;  4BBR B;  3PUZ A;  1EY8 A;  5JVH 3;  3NWS A;  1Q90 A;  1ICF B;  5I6W A;  3H0G H;  3CPW A;  4DN4 M;  4EQN A;  1K83 H;  1QUQ A;  3NEL A;  4QF4 A;  1GUN A;  5KIX A;  3T1H L;  4C3I H;  4BXX G;  4XYO A;  3IAY A;  1HNZ Q;  2VQF L;  4U67 3;  4IFD H;  3RLF A;  3TP7 A;  5J3B A;  1IBK Q;  4A3L G;  4DV3 Q;  2JA7 H;  3VR2 A;  1B50 A;  4B9X A;  2K33 A;  2KHI A;  5M5Y H;  4M1U B;  2L9H A;  4Q0F A;  3H09 A;  4X65 Q;  3HKZ G;  4EQ5 A;  4HMI A;  4JI7 Q;  4RFB A;  1BCP F;  4FXD A;  2QF7 A;  3M4P A;  2OEO A;  3ITP A;  2SNM A;  3HOY B;  4WRD A;  4LUZ A;  2R7Z B;  1WTW A;  4JI3 Q;  5EQ0 A;  1HFN A;  2F0O A;  2ZM6 Q;  1B4O A;  5LHY 1;  1ILP A;  4KTA A;  2UXD L;  2R3Z A;  2C5C A;  3KUP A;  1FGB D;  2ZJP A;  1C8C A;  5IYD H;  5D3D A;  4DK3 C;  3CME A;  5CV7 A;  3PO3 B;  2NZ1 D;  4IOC A;  2I5M X;  2UXB L;  3AU7 A;  2CW0 C;  1QG7 A;  1K9M C;  1G2T A;  3TDQ A;  1S72 A;  1Z7T A;  5ELB A;  2HDM A;  1MIU A;  1E1O A;  2B2W A;  3TEH B;  1M4V A;  2AQ1 B;  3NUC A;  1RIP A;  3K5N A;  3CCQ A;  4L8J A;  3FMC A;  4HCS A;  1M8A A;  1OTC A;  4KHV A;  3S2D B;  1TR5 A;  3CPF A;  2NVQ B;  2SOB A;  3I90 A;  2B2U A;  1FVI A;  2DY7 A;  4ODG A;  1G51 A;  2PYK A;  3KBG A;  1NR4 A;  3K0Y A;  2L55 A;  3S1R B;  2RCN A;  4EQP A;  4HJ7 A;  1VQE A;  2Z0S A;  3KLS X;  3SK8 A;  3GTO H;  5C4H A;  3P20 A;  4JI8 L;  4I65 A;  1PFS A;  4A3J G;  2JA8 B;  4OWX B;  5KNB A;  1CA5 A;  2RSN A;  3MWY W;  2DJG C;  5IY0 A;  1A8V A;  1Y69 U;  1LTA D;  2F0S A;  2L0C A;  3DWQ A;  4XXE A;  3JAM L;  2GVA A;  1JE5 A;  2E2H B;  2EJM A;  4P75 A;  3SE0 A;  5L37 A;  5C3E G;  4KY7 A;  1Z6H A;  2Q2T A;  2F0F A;  3S1Q H;  4A75 A;  3GQB A;  4K6L A;  2KEN A;  1VQJ A;  3LNN A;  2J4X A;  3I3C A;  1TY0 A;  2BH8 A;  1PFB A;  3J80 E;  5K36 H;  3SR1 A;  1UEB A;  1Q1E A;  2A73 B;  1A62 A;  1WOC A;  1C4Q A;  3X3M A;  5EBC A;  4JI5 L;  2L12 A;  4OEM B;  2Y0S G;  2BCO A;  5C5M A;  3DMU A;  4FDB A;  3I56 A;  1YNN C;  1BF4 A;  4RGO S;  1L0X B;  1PZI D;  2HIV A;  4U68 A;  2Q8T A;  3BS1 A;  1OXV A;  2KQ3 A;  1O7Y A;  2WAC A;  4P2C B;  2PMZ E;  1G29 1;  4GKK L;  1GM5 A;  1VQB A;  4JV5 Q;  2EQS A;  2IY5 B;  1SBB B;  4A3E G;  1SEB D;  3AFP A;  2LSS A;  4ZQ3 A;  3A5U A;  1KD1 C;  3DEP A;  2XRS D;  5EKI A;  1WJJ A;  2MO0 A;  3FPU B;  1STN A;  1EEI D;  1PYB A;  1VQG A;  3MXU A;  5LMN Q;  4DV0 Q;  5M3M H;  1HNX Q;  5KYL A;  1YBY A;  3KF6 B;  3WDN A;  4P71 A;  3UDG A;  1NJI C;  2ENB A;  4NXN L;  1TWA H;  2KJX A;  3HG9 A;  2N55 A;  3C1E A;  1B2T A;  1SNM A;  1FL0 A;  3HOX B;  3HEJ A;  2E2J B;  2EY6 A;  1N34 Q;  2A6E C;  1KAB A;  3SDZ A;  3IFD A;  1SFO B;  1BQQ T;  1LYL A;  4DR3 L;  1K8M A;  1S5C D;  1U4R A;  5BR8 Q;  3STB D;  5CV5 A;  1TWH H;  3CAM A;  4E6I A;  1FD7 D;  5JJL A;  2D2C C;  2L15 A;  3M7G A;  4CBV A;  3I8Z A;  2N88 A;  1GOZ A;  4OL7 A;  1SNQ A;  1LAB A;  3EVQ A;  1BCP B;  2AWO A;  3G4S A;  4B3R L;  3H0G B;  2F0J A;  2B2W C;  2PZU A;  1K83 B;  2SDF A;  4HAE A;  3TP5 A;  3GO5 A;  3J81 L;  1YHB A;  5GAH C;  2CWA A;  1LAC A;  1PH4 A;  2RHS B;  4C3I B;  2PZT A;  5FLX L;  1DOL A;  4HIK A;  4DNI A;  3FKI H;  1MD2 D;  4QJF A;  2BDO A;  4CDF C;  1BR9 A;  5JEA G;  1RD9 D;  5BR8 L;  2F0I A;  4KLK A;  5GQO A;  2JA7 B;  2KBN A;  2KEC A;  3MXP A;  5M5Y B;  2O2L D;  3UI2 A;  4LFB L;  1PTO C;  2NVY H;  4NXM Q;  1JWM D;  4RH6 A;  3J80 i;  5CYU A;  1H95 A;  2J0T D;  2ZXO A;  2XWB B;  1CI3 M;  3T51 B;  2KCM A;  2F0H A;  1JB7 A;  2OTL A;  1GXD C;  3I4M G;  5DAU A;  4B3S Q;  1AP0 A;  1DGS A;  1AW7 A;  5C3W A;  1ASZ A;  4OIK A;  1YEZ A;  3KF6 A;  2EOT A;  1CQV A;  4OEL B;  4JVZ A;  1IL2 A;  3NBH B;  4TSS A;  1IBM L;  2EXD A;  3F2U A;  1GUT A;  3G6E A;  4R4Q A;  1R4Q B;  1T9H A;  2ZTC A;  4DR5 L;  1B9M A;  4XQJ A;  1I3Q H;  3HOW G;  4DAM A;  3J7Z C;  4FNF A;  3NQI A;  2P5Z X;  5IP9 G;  1VMC A;  5KND A;  2EY2 A;  5FJ8 G;  1B8A A;  1NMG A;  2IT1 A;  1AE3 A;  5DNF A;  2OQ0 A;  1JMC A;  4GOP B;  4X3T A;  3J81 j;  1B70 B;  3VR5 A;  3DM1 A;  5AJ3 L;  3C46 A;  2WAQ G;  3QR8 A;  4JI6 Q;  1E2W A;  1CSP A;  1CSQ A;  3RLN A;  1CKO A;  3PMF A;  3KF8 B;  4L6T B;  4XT3 B;  4K14 A;  3S1N H;  1K28 A;  1BO0 A;  2PQA B;  2Z4H A;  4KK7 A;  4KKS A;  1CFM A;  1X3P A;  2A19 A;  4DK0 A;  1BBX C;  2X69 A;  3GTO B;  2F0L A;  2MFI A;  4GLA C;  1S5E D;  2F0P A;  4MNO A;  1LTB D;  3QOJ A;  3QOL A;  2KEE A;  1FYC A;  1KLG D;  3MVV A;  5T1I A;  1EYG A;  4DR1 L;  4DUY Q;  2XNA C;  2F4V Q;  2EYJ A;  4DUZ L;  1STH A;  3P1H A;  1VQK A;  3S1Q B;  5IT9 L;  3E9I A;  5C0X J;  3O13 A;  2B29 A;  2G5D A;  1STG A;  4WJ4 A;  1Q8I A;  3TZU A;  1O7L A;  2Q2U A;  1MHW C;  2DUD A;  4IAL A;  1EFI D;  2OT2 A;  3CU7 A;  5E7N A;  1RJT A;  1SYF A;  1HTP A;  1ILQ A;  3H3V C;  3D6W A;  4UY8 C;  2IL8 A;  3RLO A;  1EYC A;  5JOB A;  3RNU A;  1P8L A;  4JI1 L;  1QZG A;  3FRP B;  1GUO A;  3E3X A;  3L3O C;  2QW7 A;  4DGZ A;  1PXU A;  3KK7 A;  3NBH A;  1X3E A;  3L2P A;  3TN2 A;  4PV1 C;  1U4M A;  2WB1 E;  4UP9 A;  4PZ8 A;  2EJF C;  1GD7 A;  4UHV A;  4CJ2 C;  4GLV B;  2HQL A;  4OHJ A;  4RCN A;  4ZLT F;  3ERS X;  4RHS A;  3GTK H;  4FF3 A;  1JJG A;  2XVS A;  2QEX A;  4LF9 Q;  5IYB G;  5C0X G;  1MJE A;  5C3E H;  5FO9 B;  4LF4 Q;  1Y1W G;  4DV1 L;  5M3M B;  1EOT A;  2C9O A;  5C44 H;  3FEW X;  2KCC A;  2JQO A;  2RCF A;  2NBF A;  3KLR A;  4F88 A;  1SE2 A;  4KN4 C;  4F8M A;  1PH9 A;  4JI2 L;  1TWA B;  2BA0 A;  4A93 G;  1H9R A;  1WTQ A;  2JA5 H;  1WD0 A;  2QA4 A;  4C1N K;  4IPC A;  4DV4 Q;  4BY7 G;  4AQY L;  1IW7 C;  1D8L A;  4HSV A;  1PH5 A;  5JAV A;  4G7H C;  1VQ5 A;  4WJ3 M;  1Y1V G;  1RHP A;  1OXX K;  3PF4 A;  2OCE A;  3CCM A;  1DCZ A;  1TWH B;  3GV6 A;  1CHQ D;  1S3O A;  1JWU D;  1EQV A;  1WCM G;  4ZAI A;  2EYL A;  4POF A;  4A3E H;  4IFD I;  3MXG A;  1AZQ A;  5IGG A;  3OSO A;  3DUZ A;  1IBL Q;  1CHP D;  4C3J H;  1SLJ A;  3GTJ H;  1O78 A;  3NSW A;  4RKL A;  3NHH A;  4NDX A;  2I5H A;  1YNJ D;  4DV4 L;  4HR7 B;  3I70 A;  3SXH A;  1N9W A;  1TY2 A;  1Q8K A;  2PZW A;  4EQO A;  2K7V A;  2FMM A;  3FKI B;  1YJW A;  4LF8 Q;  1FR3 A;  5C0X I;  2G9D A;  1JJC B;  3G71 A;  4KMU C;  2Q8I B;  1QWY A;  3DXJ C;  1WTP A;  1V1O A;  4TKO B;  4WFN 3;  2NVY B;  3TRE A;  1AE2 A;  1VF7 A;  4IUQ A;  5LMU L;  4A3M H;  1IBL L;  1FJG L;  3I7F A;  1WTR A;  4GN5 A;  2RBM A;  3EA6 A;  1A3U A;  3U50 C;  2O5I C;  3H3V H;  4M8A A;  3CCV A;  2NYZ D;  1WD1 A;  1RTN A;  2WP8 J;  1V1Q A;  3VYR A;  2FXQ A;  4R4O A;  2EY1 A;  1R4P B;  2H1E A;  2VB3 X;  4F87 A;  5IOD A;  1B3Q A;  3NEM A;  3PIP A;  2PQE A;  1ET9 A;  5H1S E;  1MSH A;  4EX5 A;  4X3S A;  3J7A V;  1S4Z A;  1LTL A;  1X54 A;  4MTK A;  4B08 A;  3S17 H;  1B44 D;  1WFQ A;  1ZYR D;  4DK6 C;  2I07 B;  2YTX A;  3R2I A;  5IGE A;  1CM9 A;  3TRZ A;  2F0M A;  4K0K Q;  1VQ7 A;  1I3Q B;  4DA2 A;  1TU2 B;  4KKU A;  1HZB A;  4KY5 A;  1GVP A;  4X66 Q;  5FLM G;  2HD3 A;  4LUO A;  5DEH A;  1PH1 A;  4APV A;  4DV2 L;  3NWT A;  5ELD A;  3STB C;  4OIJ A;  1PH3 A;  4MHE A;  3M4Q A;  2L4N A;  4N8F A;  2KCN A;  2NUC A;  1FNW A;  3HS0 C;  4YCU A;  3CD6 A;  4IUU A;  5M3F H;  2MPM A;  1BKB A;  1S40 A;  3CMA A;  2RQX A;  2K28 A;  2L1B A;  5K5P A;  3OHX C;  4C3H H;  3AMU A;  1EEF D;  1EIH A;  3S1N B;  1N8R C;  4DFA A;  1ZEQ X;  2R7F A;  4C1N I;  5I6Y A;  4KKT A;  2M9V A;  3BG3 A;  3PV0 A;  3QWN A;  3GD7 A;  1XJV A;  1LT4 D;  4PQX A;  5HGT A;  2VUM G;  5C4X H;  3V96 A;  1KDC A;  3NTI A;  4OO1 G;  3HGB A;  3TS2 A;  1F2Y A;  3HOZ G;  4OON A;  3FDT A;  1SND A;  1HR0 L;  3IL8 A;  2WKC A;  3J7A 5;  4ZUI A;  4O2D A;  2K5H A;  3A5Z B;  4J1M A;  3JAM E;  3ER0 A;  2GVB A;  1I94 Q;  2F0V A;  2G9H D;  3BVM A;  4RCO A;  1PYW D;  2E76 C;  1I4Q A;  1SFO H;  5KYI A;  2O4X A;  4DR7 L;  4DV6 Q;  2VQF Q;  3A8J E;  1HZ9 A;  2K01 A;  1EY4 A;  1X32 A;  1XPR A;  4GS3 A;  1HR0 W;  1ZXT A;  4A3I H;  4DK1 A;  5I4D A;  1LLR D;  3SVM A;  2YU9 H;  1EIG A;  3UDI A;  2JA6 H;  1RF2 D;  3K5L A;  1JOK A;  4IUP A;  4QUC A;  4ZK9 B;  1I94 L;  3GTK B;  4RHR A;  4EGV A;  4AH6 A;  1SMX A;  4X62 L;  4GKJ L;  4OX9 L;  1A0I A;  4DV6 L;  5C3E B;  4A3B H;  3KJO A;  2UXD Q;  1TS2 A;  4CGY B;  3Q8D A;  4S3S A;  4XIG S;  3NE5 B;  5C44 B;  3E5S A;  3SGI A;  5I2Y A;  5E4X A;  4OO1 I;  1C48 A;  1G8Z D;  2UXB Q;  2RDF A;  3SK5 A;  1J9O A;  2HIX A;  1QOH A;  1PRT D;  2JA5 B;  4HCE A;  2JXM B;  3EJI A;  3I4N G;  2MNA A;  3OIQ A;  3ERQ A;  4QQB X;  3C3L A;  5FK9 C;  3ZYY X;  4ZYS A;  4IO9 A;  2A69 C;  1C7Y A;  1JOR A;  3NP8 A;  5D14 A;  2EY5 A;  3HFZ B;  2IHF A;  1VQ9 A;  2JN4 A;  2UUA L;  3Q6S A;  1YJ9 A;  1RL2 A;  4A3E B;  2ZT9 C;  2IJ0 A;  3G48 A;  3OPO A;  2EYF A;  4C3J B;  1XTC D;  4IZ8 A;  2IX3 A;  3GTJ B;  1F2Z A;  4L5Q A;  1DOM A;  1EUJ A;  5COY A;  4JI8 Q;  4X3K A;  4DV7 L;  1TS4 A;  2A6H D;  2RSO A;  3AYH B;  1XMQ L;  1K8G A;  1VQA A;  2EDG A;  3KBX A;  3OTO L;  3H91 A;  3SHL A;  4BBS G;  4JYA L;  4A3K G;  3RN5 A;  1EWI A;  1SNC A;  4IJH A;  1E2Z A;  2MO1 A;  3W5O A;  1XPU A;  3I4L A;  4C2M H;  3J81 E;  3F2D A;  3LX0 A;  2GN5 A;  1Q82 C;  2ZJQ A;  1OXT A;  5FLX E;  1EZ6 A;  3G6J B;  5I2X A;  4A3M B;  4JBJ A;  5FO8 B;  3P7J A;  5NUC A;  3JAM i;  2MHV A;  2WII B;  5ELF A;  3A7L A;  1VQH A;  4DU9 A;  1XYI A;  1E2V A;  1ENF A;  1X55 A;  2LFN A;  4JI5 Q;  1LT5 D;  3OMG A;  4G57 A;  2K32 A;  4IPG A;  4ZKC B;  1KRS A;  3VR6 A;  1S5F D;  1ML0 D;  4DKA C;  4YY3 L;  2A68 D;  1KDA A;  1IYJ B;  1O7Z A;  1KNA A;  1X3Q A;  3PO2 H;  1E0B A;  4UDU C;  1OXU A;  4AIM A;  3R93 A;  1HZA A;  3CCJ A;  1SYE A;  2UU9 L;  1TT2 A;  1EWH A;  2BE5 D;  4ZCK A;  4GKK Q;  1CZG A;  3S17 B;  1ICW A;  2CVR A;  4BBR G;  4CDE C;  3KOJ A;  4DXG A;  2VQE L;  3ULP A;  4A3D H;  2NN6 G;  1HNW L;  2NZO A;  2NTS A;  2I5L X;  1GKH A;  3EIV A;  1I5F A;  5IYC H;  1HH2 P;  1JCK B;  3CC2 A;  1CTM A;  1KAA A;  2VW9 A;  2K50 A;  3E6Z X;  4ALP A;  3NTH A;  4P73 A;  2KCT A;  2NVX H;  4JBW A;  1I6V C;  4NXN Q;  2K1B A;  5EKK A;  1VQC A;  5M3F B;  1OXS C;  2JEA I;  3DEO A;  4P72 A;  2EXZ A;  1J5E L;  4HJ9 A;  4XYQ A;  1N32 L;  4C3H B;  4JG2 A;  1YNJ C;  4HMJ A;  1JOO A;  1NUC A;  4QMG A;  5IP7 H;  3E0E A;  2H4O A;  5ELN A;  3DLL A;  1U0L A;  2OF1 A;  3HOY G;  1PYS B;  3M4O H;  3C2P A;  2QGQ A;  2R7Z G;  4QL5 A;  1KC8 C;  1HQM C;  4DR3 Q;  2Q2I A;  4H0L C;  4PZ7 A;  4PMW A;  5C4X B;  1HRJ A;  2B63 H;  3SK6 A;  3QJY A;  1L0W A;  1ESR A;  2JSO A;  1KNE A;  4RKB A;  2F0U A;  3ICE A;  4A3G H;  3PO3 G;  1BDO A;  1LO5 D;  1J8I A;  2I46 A;  3D4W A;  4POG A;  5C6A A;  1K73 C;  1QIL A;  3CW2 C;  4B3R Q;  1SE4 A;  2R93 H;  3X3N A;  1BCP D;  2SNS A;  4O0A A;  5JEA J;  1HXY D;  3PUW A;  2XN9 C;  4KJN A;  5AFW A;  3RR5 A;  5CR3 A;  2KED A;  2K04 A;  4KI0 A;  2NN6 I;  5IT9 E;  2PCF B;  2A74 C;  1NMF A;  2VZA A;  4L63 B;  4CKB A;  1SMY C;  3W1B A;  3W3A A;  2F0E A;  1EY7 A;  2YTV A;  2K75 A;  5FO7 B;  4ABN A;  2IX1 A;  4FYD A;  2O5J C;  4A3I B;  2VXW A;  5IOC A;  3J81 i;  2ALY B;  4LFB Q;  1LTT D;  2YU9 B;  2JA6 B;  1G91 A;  1LTS D;  4DV5 L;  1DM0 B;  1LTG D;  4BY1 H;  3F8T A;  3CCR A;  4L5R C;  1J6Q A;  4Y7N H;  2D0O A;  5LL6 X;  2BDN A;  1NY4 A;  4AYB E;  2JA8 G;  5A2Q L;  1HFG A;  4H44 C;  1M1K C;  1QVC A;  4A3B B;  2A5H A;  4ZKB B;  1Z9F A;  5D65 A;  3MFG A;  3HOU H;  2CKZ B;  2NWG A;  1IBM Q;  1SN8 A;  3Q23 A;  4XT1 B;  4DR5 Q;  2F0G A;  1D5M C;  2KVM A;  4KD4 A;  2FMC A;  4JK1 C;  3J80 c;  3CKI B;  2ATW A;  3F2B A;  2WIN B;  3HOV H;  1H9S B;  3EQL C;  1Q86 C;  2R92 H;  3CQZ H;  4A76 A;  5AJ3 Q;  5EKL A;  2Z1C A;  1XNQ L;  5KGU A;  1X3G A;  1SYD A;  2PMZ B;  2Z6K C;  3E0J A;  3K7A H;  2V4D A;  5CGK A;  2R7D A;  3BZK A;  3WOF A;  1RCV D;  2JP1 A;  5LL6 S;  3OIP A;  5F2D A;  5E4W C;  4PMB A;  3GTG H;  3S9W A;  1MBY A;  1QVG A;  4BXX H;  3IRB A;  2ES2 A;  1PFM A;  5I9O A;  1PA6 A;  2F3W A;  4A3L H;  1HHV A;  1LV9 A;  2HUG A;  2PNH A;  5JJZ A;  1PLF A;  1VF5 C;  2EYM A;  2K4K A;  3P75 A;  2JA9 A;  4DR1 Q;  1A63 A;  2K5W A;  4DUZ Q;  3KFU A;  1T5X D;  5EAY A;  4DR6 L;  3A0J A;  4C2M B;  1QVF A;  1D2B A;  3T13 A;  1CKM A;  4Z9C B;  1EFW A;  3A8K E;  3T4A C;  1JJ2 A;  2Z9H A;  3HOX G;  3J7A F;  4RMF A;  4IFD J;  5IWA L;  1S5B D;  4MIU A;  4HJ8 A;  5CV6 A;  5CBA E;  2E2I H;  4LF7 L;  2IWH A;  5GRO A;  2E8G A;  1E1T A;  1FNU A;  4IUT A;  1SE3 A;  1F77 A;  3K8A A;  3FHW A;  4JI1 Q;  3VYS A;  3LGJ A;  4N9T A;  3PO2 B;  1AEX A;  1EU3 A;  3M3Y H;  1Q46 A;  2E5L L;  1VQM A;  1PRT C;  4WJW A;  1H9K A;  1W2B A;  2ZXR A;  1HA5 A;  3D8G A;  1D1I A;  3K57 A;  3MTS A;  3U58 A;  3PF5 A;  1GUW A;  4A3D B;  3M9B A;  4AYB B;  3PIP 3;  3H0G G;  1C0A A;  1STB A;  4V19 0;  1ONL A;  1H9S A;  5DM6 3;  1ZKO A;  3EBE A;  4C3I G;  4DV1 Q;  1U4L A;  1X6O A;  5HUR A;  4IFD G;  2HHH L;  4JI0 L;  1Y8N B;  2NVT H;  2NTT A;  2PNR C;  2JA7 G;  1TWG H;  5C4Z A;  2NVX B;  3IFT A;  4JI2 Q;  2CW0 D;  5ELE A;  1LTR D;  1MSG A;  2CHB D;  1Q3L A;  1IYU A;  4A3J H;  4AQY Q;  1XMO L;  4X64 L;  3M4O B;  3TP8 A;  4H7B A;  4FP5 D;  3FP9 A;  2CQO A;  4DNT B;  4R8I A;  4JBK A;  1WTX A;  4WOR A;  3J7Y W;  1CKN A;  2IPK D;  4DAY A;  2F0T A;  2F52 A;  2XRQ D;  4FF4 A;  1EU4 A;  2B63 B;  1SNP A;  3TZD A;  4BS9 A;  1SDF A;  5IYD G;  2CCZ A;  4IUV A;  4A3G B;  1KDB A;  1HUN A;  3HKZ E;  2MQH A;  4K6D A;  1VQ6 A;  3ONA B;  4BWG B;  4ILW A;  3A54 A;  3PUY A;  1K3B C;  2L11 A;  1KXL A;  4ZUJ A;  1R9T H;  2VNU D;  4GN3 B;  2ZJR A;  3L9A X;  2LY7 A;  3N52 A;  2DJF C;  1IXR A;  1F9S A;  4B3M L;  2A68 C;  2R93 B;  2F0W A;  3H94 A;  5JPM C;  3K5O A;  3K80 C;  1L1O C;  1VDZ A;  2FIN B;  5BN4 A;  3W1G A;  1QE6 A;  1AH9 A;  4UAI A;  2K14 A;  4JW0 A;  4B3T Q;  1EL0 A;  1G2S A;  5GAG C;  2MP1 A;  3OOC A;  3VYU A;  1EZ8 A;  2PI2 E;  1XPO A;  4NB3 A;  5LMU Q;  4LF5 L;  1FJG Q;  4TQU S;  1TKW B;  3UDF A;  4KJO A;  1IZ6 A;  4BY1 B;  1F9R A;  2E2D C;  4A4I A;  4Y7N B;  3Q0A A;  4NW2 A;  3W2D A;  1C9O A;  1EOV A;  3MC0 B;  1YNN D;  5GAE C;  1LUZ A;  4B3T L;  4B9W A;  3HOU B;  3MXN B;  4LWC A;  1Y8O B;  5ISR A;  4FF2 A;  1NNX A;  3K59 A;  4DAV A;  4MTN A;  5K36 G;  3D4D A;  1O7I A;  1ESF A;  3DWA A;  3KLS A;  3HOV B;  4Q5V A;  3Q24 A;  4DV2 Q;  1W3S A;  3E9H A;  4BA1 I;  2R92 B;  3CQZ B;  1OO9 B;  4UPA A;  3I72 A;  1PRT F;  2CH4 W;  5IGF A;  2PPB C;  4FXK C;  2WB1 B;  1CQF A;  3K7A B;  1N36 L;  3K81 C;  3KJP A;  3CRL C;  4TRD A;  4DR4 L;  1EWC A;  1I4R A;  3GTG B;  2B2V C;  4H02 A;  4PG3 A;  5J1Z A;  1KIX A;  3GTP H;  2A6E D;  1Y14 B;  3CCL A;  1HUM A;  2Y0S E;  5JEA H;  2EZV A;  5M3M G;  4K8I A;  1O80 A;  3I4O A;  3T16 A;  4FF1 A;  1F2M A;  1H9J A;  4L5T A;  1HR0 Q;  1VQO A;  3HKZ B;  5DLQ E;  4X3U A;  1I4P A;  2Q2H A;  4UP7 A;  1YVC A;  3TS0 A;  2NZH A;  2C35 B;  1YJN A;  4LFC L;  2X6L A;  5G3L D;  1BBU A;  1WYD A;  3UE0 A;  1M90 C;  3LWU A;  2F3I A;  3I4M H;  3HP3 A;  1HZC A;  2UUC L;  3BYT B;  1D7Q A;  3PUX A;  4DR7 Q;  1G6Z A;  2E2I B;  2FJ2 A;  2KUM A;  1QZH A;  5I9P A;  4RG1 A;  2WV6 D;  4R4T A;  4HIO A;  1E22 A;  1SJH D;  2SEB D;  3HZX A;  4QB4 A;  1KLU D;  4OWW B;  2VS1 A;  1XWE A;  3PIO 3;  3BDC A;  1Q1B A;  3HOW H;  3M3Y B;  3MXN A;  1PTO D;  2TSS A;  5M9O A;  1VQ4 A;  1UAP A;  5IP9 H;  3NTK A;  4A3C G;  1D5X C;  1N33 L;  3AEV A;  5FJ8 H;  3BU2 A;  2EPB A;  3PQI A;  4LF6 L;  1DOK A;  1EY0 A;  4MZ9 A;  2UXC L;  1XXG A;  1YHA A;  4YHH L;  4X62 Q;  4IJL A;  4OX9 Q;  4GKJ Q;  3FVQ A;  2N78 A;  1PH7 A;  1VQ8 A;  4DPG A;  2FFK B;  2RA4 A;  3FKI G;  1TWC H;  2DN8 A;  2RDH A;  2NVT B;  2ICE C;  1IL8 A;  4NKL A;  2DNE A;  2WKD A;  1TWG B;  3KDF A;  5CV4 A;  1U9R A;  4YWK A;  1GJX A;  4DAP A;  1XNR L;  3ND8 A;  3R2T A;  1TWF H;  4NPS A;  2KA7 A;  3B6Y A;  1NE3 A;  4A3J B;  3V2T A;  4JI4 L;  2OQK A;  4KV6 A;  4QGU A;  3TSS A;  2OWO A;  3A7A B;  2B2T A;  2EJG C;  5IE8 A;  1Z47 A;  2PO4 A;  2K52 A;  4JOI A;  4ZRZ A;  1JQY D;  4X6A H;  1QJO A;  2UUB L;  3A8I E;  1EIF A;  4LW1 A;  3CCU A;  4DR2 L;  5A35 A;  1GUG A;  1B1Z A;  3LWE A;  2RDG A;  1I4G A;  2IX0 A;  4K8J A;  1BNZ A;  2UUA Q;  4RGN A;  4XDX A;  2YYZ A;  2LXJ A;  2XSC A;  1R9T B;  3K5M A;  4QCL A;  2Y0S B;  1NSN S;  1SXT A;  1UE1 A;  4DV7 Q;  2ZXP A;  2B39 A;  5CC4 A;  1XMQ Q;  3NK9 A;  4KHP Q;  4G4K A;  3OTO Q;  1I4X A;  4OWT B;  4JYA Q;  1T5E A;  1YZ6 A;  4GLX A;  1Q12 A;  1PZJ D;  2B3G A;  1FNV A;  1Q7Y C;  2PI2 A;  1HA6 A;  2K03 A;  2F03 A;  4LK1 C;  4TVA B;  3U4Z A;  1EY5 A;  1VQL A;  1VQP A;  2D9U A;  2IHE A;  3R8B A;  5IYB H;  5C0X H;  1XX8 A;  1F9Q A;  1Y1W H;  4LNQ A;  4K2K A;  4OGQ C;  3UE1 A;  1NTG A;  1JR0 D;  1HNZ L;  1PVO A;  2RF4 A;  4YY3 Q;  1IBK L;  4DV3 L;  4KHP L;  1A2U A;  2R6G A;  4Y52 H;  2WAQ E;  4A3F G;  1B53 A;  4X65 L;  4A93 H;  1DD2 A;  1CZW A;  3BDO A;  3T56 B;  1IYV A;  4JI7 L;  1AN8 A;  2UU9 Q;  1GHJ A;  1PRT B;  1V9P A;  5EPK A;  2EVB A;  3U4V A;  2RKS A;  5A2Q E;  4BA2 I;  1UWV A;  2XTI A;  4BY7 H;  1D1K A;  4YCV A;  3A74 A;  2VQE Q;  5ELO A;  5BN3 A;  1HNW Q;  1QNU A;  3JC6 6;  3PIO A;  5KNC A;  4JI3 L;  1B7Y B;  1YNX A;  1Y1V H;  2JE6 I;  2K05 A;  3M7N A; 
#chains in the Genus database with same CATH homology
 5C0X G;  4HID A;  1MJE A;  3ULJ A;  5C3E H;  3JAM c;  4LF4 Q;  2ZM6 L;  1Y1W G;  4DV1 L;  4DR5 Q;  1XNR Q;  3CXC A;  2A1A A;  4HIM A;  5C44 H;  4K0K L;  3L0O A;  2JQO A;  3HKS A;  3OW2 A;  1WCM H;  3RN2 A;  3J80 c;  2AMC B;  2Z6K A;  2ATW A;  3GTM H;  3L7Z C;  1I50 H;  4BY1 G;  4X66 L;  3F2B A;  4JBM A;  4JI4 Q;  4OXP A;  3HOV H;  1PH9 A;  3PGZ A;  4JI2 L;  1VS0 A;  1Q86 C;  2BA0 A;  2HT1 A;  4A93 G;  4GNX A;  1J5E Q;  1MKH A;  2R92 H;  1PH2 A;  2JA5 H;  1N32 Q;  3CQZ H;  4A76 A;  4GOP C;  2QA4 A;  1YHQ A;  5AJ3 Q;  3PCO B;  4IPC A;  4DV4 Q;  4BY7 G;  4AQY L;  1XNQ L;  2H5X A;  2UUB Q;  1X3G A;  2K5N A;  2Z6K C;  1D8L A;  3K7A H;  1YIJ A;  1YIT A;  4DR2 Q;  1PH5 A;  1VQ5 A;  2R7D A;  4WJ3 M;  1UE7 A;  3HOU G;  1Y1V G;  3BZK A;  1OXX K;  3PF4 A;  4GNX C;  3HOX H;  2E2J H;  3GTG H;  2OCE A;  1QVG A;  3CCM A;  4BXX H;  2BA1 A;  3IRB A;  2ES2 A;  3T1H Q;  3F2C A;  5C44 G;  1EIY B;  1S3O A;  1PA6 A;  1E7Z A;  1WCM G;  4POF A;  2LXK A;  3K7U C;  4A3E H;  4IFD I;  4A3L H;  1IBL Q;  3UDX A;  3HOV G;  2PNH A;  1SLJ A;  4C3J H;  2N8N A;  3GTJ H;  2K4K A;  2I5H A;  3M85 A;  2R92 G;  2JA9 A;  4DR1 Q;  2JA5 G;  4DV4 L;  1A63 A;  5HGQ A;  4R4I A;  4DUZ Q;  1K0R A;  1KL9 A;  3KFU A;  2D0P A;  1L1O B;  5EAY A;  4DR6 L;  3A0J A;  1QVF A;  1N9W A;  2WB1 G;  4YWM A;  1SRU A;  1Q8K A;  3PUZ A;  1CKM A;  1EFW A;  3CPW A;  3H0G H;  1JJ2 A;  4JOI C;  1YJW A;  4LF8 Q;  1K83 H;  1P16 A;  3HOX G;  5C0X I;  1QUQ A;  1U5K A;  3NEL A;  4RMF A;  3VDY A;  4QIW E;  5IWA L;  4IFD J;  1JJC B;  4HJ8 A;  4JCV E;  3G71 A;  3T1H L;  4LUV A;  4C3I H;  2E2I H;  4LF7 L;  4BXX G;  1WI5 A;  5GRO A;  2E8G A;  2VQF L;  1HNZ Q;  1E1T A;  3RLF A;  3TRE A;  1AE2 A;  5J3B A;  5LMU L;  4A3M H;  1FJG L;  1IBK Q;  1IBL L;  3I7F A;  4A3L G;  1BBW A;  4DV3 Q;  4IPD A;  4GN5 A;  2JA7 H;  4DV5 Q;  3ZJY C;  2KHI A;  3FHW A;  3K8A A;  4JI1 Q;  4GN4 B;  3LGJ A;  3U50 C;  5M5Y H;  5FLM H;  3H3V H;  3CCV A;  2WP8 J;  4X65 Q;  3M3Y H;  1V1Q A;  3HKZ G;  4EQ5 A;  1Q46 A;  2FXQ A;  4R4O A;  4JI7 Q;  3GTL H;  2E5L L;  2ID0 A;  1VQM A;  2DGY A;  3NEM A;  3PIP A;  1W2B A;  3M4P A;  1HJP A;  1SR3 A;  5H1S E;  3U58 A;  3PF5 A;  1ASY A;  1PH8 A;  3M9B A;  4LUZ A;  4EX5 A;  4JI3 Q;  1KRT A;  3H0G G;  1LTL A;  1C0A A;  2YV5 A;  1X54 A;  3S17 H;  1WFQ A;  4DK6 C;  2ZM6 Q;  2JEB I;  3EBE A;  4DV1 Q;  4JV5 L;  2UXD L;  2YTX A;  3S24 A;  1X6O A;  1E24 A;  3TRZ A;  4K0K Q;  3J81 c;  2ZJP A;  1VQ7 A;  2HHH L;  4JI0 L;  2NVT H;  4IFD G;  3BJU A;  4A3M G;  5IYD H;  4DK3 C;  2VUM H;  5FLX c;  3CME A;  1EQR A;  1HZB A;  1TWG H;  2JA7 G;  1GVP A;  4X66 Q;  5FLM G;  5LMN L;  4IOC A;  2I5M X;  4DV0 L;  1HNX L;  2UXB L;  4LUO A;  3HOZ H;  1PH1 A;  3D31 A;  4JI2 Q;  4APV A;  4DV2 L;  1K9M C;  1L2F A;  3STB C;  1S72 A;  1PH3 A;  3M4Q A;  2JK8 A;  2WFW A;  1MIU A;  1E1O A;  3EN2 A;  4A3J H;  4YCU A;  3TEH B;  4AQY Q;  1XNQ Q;  1XMO L;  3CD6 A;  5M3F H;  1RIP A;  4X64 L;  1BKB A;  3CCE A;  1S40 A;  3DM3 A;  1FGU A;  3CCQ A;  4A3C H;  3CMA A;  3RZD H;  3FP9 A;  1OTC A;  2CQO A;  4C3H H;  3CPF A;  2KHJ A;  3PSI A;  4JBK A;  1IBM Q;  1N8R C;  1CKN A;  1FVI A;  2R7F A;  2F52 A;  1X9N A;  1G51 A;  4YCW A;  3NEN A;  3PV0 A;  4XTC S;  1N34 L;  5M5W H;  5LMN W;  3GD7 A;  3S16 H;  1XJV A;  5IYD G;  4P74 A;  2CCZ A;  2RCN A;  2MQH A;  3HKZ E;  1L1O A;  1VQ6 A;  2VUM G;  5C4X H;  4OO1 G;  4HJ7 A;  3PUY A;  3M7N A;  3TS2 A;  3KYH C;  1KXL A;  1VQE A;  3HOZ G;  2Z0S A;  4OON A;  1R9T H;  2VNU D;  4GN3 B;  3GTO H;  2ZJR A;  4R1J A;  1HR0 L;  4JI8 L;  1IXR A;  2RHQ B;  3J7A 5;  4B3M L;  1PFS A;  4A3J G;  1V43 A;  4OWX B;  4DR6 Q;  3K80 C;  4O2D A;  1L1O C;  2K5H A;  5M3F G;  5IY0 A;  1A8V A;  1VQI A;  4GKJ Q;  3A5Z B;  1I6H H;  3W1G A;  2GVA A;  1JE5 A;  3I55 A;  1AH9 A;  2K14 A;  4P75 A;  5C3E G;  3ER0 A;  2GVB A;  1I94 Q;  4B3T Q;  1PH6 A;  5IWA Q;  2Q2T A;  3S1Q H;  4A75 A;  5GAG C;  1SFO H;  1Q81 C;  2KEN A;  4DR7 L;  4LF7 Q;  1VQJ A;  3T1Y Q;  4DV6 Q;  1XPO A;  2PI2 E;  2VQF Q;  2BH8 A;  5JJK A;  4NB3 A;  1HZ9 A;  1UEB A;  1Q1E A;  5LMU Q;  4LF5 L;  1A62 A;  1FJG Q;  1XPR A;  4TQU S;  1WOC A;  4L5S A;  1CKN B;  3MEF A;  4GS3 A;  3OYY A;  3UDF A;  4DAY B;  1EQQ A;  1HR0 W;  5C4X G;  3RZO H;  3S14 H;  1IZ6 A;  3H3V I;  3K0X A;  4A3I H;  4JI5 L;  2YU9 H;  3UDI A;  2Y0S G;  2JA6 H;  1VQN A;  4A4I A;  4FDB A;  4NXM L;  3I56 A;  2E5L Q;  1C9O A;  4IOA A;  2VL6 A;  3S1M H;  1EOV A;  1X3F A;  3I4N H;  5GAE C;  1LUZ A;  2HIV A;  3I2Z A;  2D62 A;  5JJI A;  1OXV A;  1I94 L;  2A8V A;  4B3T L;  3AQQ A;  3MXN B;  2PMZ E;  3TQY A;  2XGT A;  4LWC A;  4AH6 A;  1SMX A;  4X62 L;  4GKJ L;  4OX9 L;  1G29 1;  3T1Y L;  4B3S L;  1A0I A;  1GM5 A;  4DV6 L;  1VCI A;  4GKK L;  1VQB A;  5M5X H;  2EQS A;  3KJO A;  1KHI A;  4A3B H;  4JV5 Q;  2UXD Q;  2IY5 B;  3S15 H;  3Q8D A;  4MTN A;  4A3E G;  2HHH Q;  4JI0 Q;  4XIG S;  5K36 G;  3S2H H;  3AFP A;  1O7I A;  2LSS A;  3SGI A;  3A5U A;  2AWN A;  1KD1 C;  5IT9 c;  1WJJ A;  2MO0 A;  4OO1 I;  1PYB A;  1VQG A;  5LMN Q;  4DV0 Q;  5M3M H;  1HNX Q;  4A3I G;  2UXB Q;  4DV2 Q;  1YBY A;  2CWP A;  1W3S A;  3KF6 B;  4LFA Q;  3CC7 A;  2CFM A;  2JA6 G;  2HIX A;  3E9H A;  4P71 A;  4BA1 I;  3UDG A;  1X65 A;  1NJI C;  4UPA A;  3ULL A;  1CUK A;  1XMO Q;  3I4N G;  4NXN L;  2MNA A;  4QQB X;  4X64 Q;  1TWA H;  1N36 L;  4BBS H;  3K81 C;  4A3K H;  3KJP A;  4A3F H;  1MJC A;  1FL0 A;  2AHO B;  4DR4 L;  4IO9 A;  1C7Y A;  4A3B G;  4JI6 L;  3GTQ H;  4H02 A;  4PG3 A;  1N34 Q;  1KIX A;  3GTP H;  1Y14 B;  3CCL A;  3HFZ B;  2IHF A;  1VQ9 A;  1LYL A;  4DR3 L;  2UUA L;  1YJ9 A;  1RL2 A;  2V1C C;  2Y0S E;  3G48 A;  5M3M G;  3I4O A;  5BR8 Q;  4LFA L;  3STB D;  1TWH H;  3CAM A;  2JJQ A;  4L5Q A;  4L5T A;  1EUJ A;  1HR0 Q;  1VQO A;  4JI8 Q;  5DLQ E;  2OTJ A;  2BH2 A;  2Q2H A;  4DV7 L;  4UP7 A;  1YVC A;  4B3M Q;  5C4J H;  3TS0 A;  2NZH A;  5JJL A;  3AYH B;  2C35 B;  1YJN A;  2L15 A;  1XMQ L;  1VQA A;  1K8G A;  1SRO A;  4LFC L;  3OTO L;  4JYA L;  4BBS G;  1BBU A;  1WYD A;  3UE0 A;  1M90 C;  2AKW B;  3I4M H;  2F3I A;  4A3K G;  2AWO A;  3G4S A;  4B3R L;  4DUY L;  3RN5 A;  2F4V L;  1VQD A;  1VQF A;  1EWI A;  1XPU A;  4IJH A;  2MO1 A;  3W5O A;  1HZC A;  3GO5 A;  4C2M H;  3F2D A;  1YHB A;  5GAH C;  2UUC L;  1D7Q A;  2CWA A;  4BBR H;  3PUX A;  2GN5 A;  1PH4 A;  5HY6 A;  2RHS B;  4DR7 Q;  1NBW A;  1PV4 A;  1Q82 C;  2ZJQ A;  1OXT A;  4HIK A;  4DNI A;  1QZH A;  3F1Z A;  3FKI H;  1UE5 A;  4RG1 A;  5GAD C;  4LF5 Q;  4R4T A;  2ZTD A;  4QJF A;  4HIO A;  4JBJ A;  5JEA G;  5BR8 L;  1E22 A;  3JAM i;  5GQO A;  4KLK A;  2YTY A;  2K5V A;  1KAW A;  2ZTE A;  1VQH A;  4OWW B;  2KBN A;  1X55 A;  4JI5 Q;  2VS1 A;  4IPG A;  4LFB L;  1Q1B A;  1KRS A;  2NVY H;  3HOW H;  4DKA C;  4YY3 L;  4NXM Q;  3J80 i;  1IYJ B;  4GOP A;  1VQ4 A;  1H95 A;  5IP9 H;  4A3C G;  1N33 L;  3AEV A;  3PO2 H;  5FJ8 H;  3BU2 A;  2KCM A;  1OXU A;  1JB7 A;  4AIM A;  2OTL A;  4LF6 L;  3I4M G;  1HZA A;  3CCJ A;  4MZ9 A;  2UXC L;  4R4C A;  3H15 A;  1YHA A;  2UU9 L;  4YHH L;  2ASB A;  4X62 Q;  4IJL A;  4OX9 Q;  4B3S Q;  4GKK Q;  1PH7 A;  1DGS A;  2N78 A;  4HJ5 A;  1VQ8 A;  1X56 A;  4BBR G;  1ASZ A;  2PQA A;  3HOY H;  3KOJ A;  2VQE L;  3ULP A;  4DPG A;  3CP0 A;  4A3D H;  1YEZ A;  2NN6 G;  3KF6 A;  4UP8 A;  2NZO A;  2R7Z H;  1HNW L;  3FKI G;  4ME3 A;  3EIV A;  2I5L X;  1GKH A;  1TWC H;  2VY3 A;  1IL2 A;  3NBH B;  1IBM L;  4LF9 L;  2EXD A;  1I5F A;  5IYC H;  1HH2 P;  3CC2 A;  3G6E A;  4LF4 L;  3KDF A;  4R4Q A;  1T9H A;  2VW9 A;  2ZTC A;  4YWK A;  4DR5 L;  2K50 A;  1XNR L;  1I3Q H;  4ALP A;  4P73 A;  3HOW G;  1TWF H;  4DAM A;  1GO3 E;  3J7Z C;  2KCT A;  4NPS A;  3CF5 A;  3PO3 H;  3B6Y A;  1NE3 A;  3D0F A;  5IP9 G;  2NVX H;  4JBW A;  4JI4 L;  4NXN Q;  2OQK A;  4QGU A;  3PO2 G;  1VQC A;  2OWO A;  4IPH A;  5FJ8 G;  3KLW A;  1OXS C;  1B8A A;  1NMG A;  2IT1 A;  2JEA I;  1AE3 A;  4P72 A;  1N36 Q;  3PUV A;  2OQ0 A;  5IE8 A;  1Z47 A;  2EIF A;  1J5E L;  1JMC A;  4HJ9 A;  4GOP B;  1G6P A;  4PZ6 A;  2K52 A;  4JOI A;  4JG2 A;  3J81 j;  1N32 L;  1B70 B;  4DR4 Q;  5AJ3 L;  4X6A H;  5IP7 H;  3E0E A;  2WAQ G;  3HOY G;  5ELN A;  3DLL A;  1U0L A;  2UUB L;  4JI6 Q;  1PYS B;  1CSP A;  1EIF A;  4LW1 A;  3M4O H;  1CSQ A;  4A3D G;  2QGQ A;  2R7Z G;  3CCU A;  4AYB G;  3RLN A;  4QL5 A;  4DR2 L;  1KC8 C;  1CKO A;  4DR3 Q;  2IX0 A;  3KF8 B;  2Q2I A;  4GNX B;  2UUA Q;  2NVQ H;  3S2D H;  1JT8 A;  3S1N H;  1XTD A;  4PZ7 A;  5IYC G;  2PQA B;  4PMW A;  2YYZ A;  2B63 H;  2LXJ A;  1L0W A;  2A19 A;  3BZC A;  1BVS A;  3ICE A;  2MFI A;  4GLA C;  1KQS A;  4A3G H;  3S1R H;  1UE1 A;  4DV7 Q;  4JC0 A;  3CC4 A;  4MNO A;  3WWV A;  3PO3 G;  1K3R A;  3KDF B;  4QY7 A;  1XMQ Q;  4POG A;  4KHP Q;  4LFC Q;  4J15 A;  3OTO Q;  4OWT B;  4JYA Q;  1YZ6 A;  4GLX A;  1K73 C;  3CW2 C;  1EYG A;  1Q12 A;  4B3R Q;  4DR1 L;  1SE8 A;  4DUY Q;  2F4V Q;  2R93 H;  4DUZ L;  2JA8 H;  2B3G A;  5IP7 G;  4O0A A;  5JEA J;  1Q7Y C;  2PI2 A;  3PUW A;  2UUC Q;  1VQK A;  3RR5 A;  3E9I A;  4TVA B;  3U4Z A;  1E3P A;  2NN6 I;  2B29 A;  4KI0 A;  5C0X J;  1NMF A;  2VZA A;  2E2H H;  4WJ4 A;  1K8A C;  1VQL A;  2N49 A;  2I0Q A;  2Q2U A;  1VQP A;  2DUD A;  4LF8 L;  2IHE A;  5IYB H;  3W1B A;  1LM0 A;  2YTV A;  2K75 A;  5E7N A;  2IX1 A;  1Y1W H;  2B63 G;  4LNQ A;  3UE1 A;  1NTG A;  3J81 i;  2ALY B;  4KHZ A;  1HNZ L;  4LFB Q;  1PVO A;  2RF4 A;  4YY3 Q;  4A3G G;  1IBK L;  4YWL A;  4UY8 C;  3RLO A;  4DV3 L;  4KHP L;  3RNU A;  4DV5 L;  1P8L A;  1QUQ B;  4BY1 H;  1N33 Q;  3F8T A;  4JI1 L;  1QZG A;  3CCS A;  3CCR A;  3AFQ A;  2R6G A;  4L5R C;  4Y52 H;  2WAQ E;  4A3F G;  4X65 L;  2N3S A;  4LF6 Q;  4A93 H;  1J6Q A;  1X3E A;  4Y7N H;  2D0O A;  3L2P A;  4JI7 L;  2UXC Q;  1NY4 A;  2UU9 Q;  2R93 G;  4AYB E;  1V9P A;  4YHH Q;  2JA8 G;  2WB1 E;  3U4V A;  4BA2 I;  1TXY A;  1UWV A;  2XTI A;  4UP9 A;  4PZ8 A;  4BY7 H;  1GD7 A;  4YCV A;  3A74 A;  1YI2 A;  2VQE Q;  4GLV B;  2HQL A;  5ELO A;  1QVC A;  1M1K C;  3ERS X;  1HNW Q;  1Z9F A;  3GTK H;  4HJA A;  3JC6 6;  3PIO A;  4JI3 L;  2JE6 I;  1B7Y B;  1UE6 A;  1Y1V H;  1YNX A;  2CKZ B;  3GDE A;  1PHJ A;  2QEX A;  3HOU H;  4LF9 Q;  1JJG A;  5IYB G;  1SN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...