5CV8A

Crystal structure of staphylococcal nuclease variant delta+phs v23d/t62h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/T62H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv8A00
2HQEA 4EQPA 1F2ZA 1STHA 2F0NA 4PNYA 1A2UA 3QOJA 3SHLA 5CGKA 5E1FA 2EYPA 3D4DA 4ME5A 5I9OA 1NSNS 1KABA 4IZ8A 4DGZA 4KJNA 5I9PA 3D4WA 4K5VA 1TT2A 3P1HA 4ID6A 1SNOA 3NUCA 5C4HA 4NDXA 2RDFA 2O4XA 2PYKA 3MEHA 5NUCA 4WORA 1EYAA 2QDBA 5CV9A 3SR1A 4E6IA 3SK5A 3DMUA 1STNA 3MZ5A 4RKBA 5CV5A 2SNSA 1EY0A 4EVOA 5IGDA 1SNPA 3MVVA 3NXWA 3VA5A 1KDBA 5EKLA 4KY6A 1EQVA 3SXHA 3TMEA 2EY2A 3SK6A 5JAVA 4F8MA 5C3WA 5ISRA 5F2DA 2EY6A 5J22A 1NUCA 2ENBA 4NKLA 5EKKA 1EYDA 1II3A 5I6YA 4B9WA 2F0FA 1STAA 1A2TA 4N9TA 1EY4A 3DHQA 2EY1A 2PZWA 4ZUJA 1SNDA 1KDCA 2EYOA 2EXZA 2PZTA 2F0GA 3H6MA 1F2YA 2F0EA 3HZXA 3OMGA 2PZUA 4HMJA 5E3FA 4KY7A 4QF4A 5K5PA 2WACA 3E5SA 1KDAA 4J6HA 1EY5A 2F0UA 4QB4A 5DEHA 2F0QA 3TP6A 5CC4A 4MIUA 4K8IA 4K8JA 1IHZA 4K6DA 3D8GA 5EGTA 2F0PA 4K14A 3MHBA 1EZ8A 2F3VA 4OL7A 3TP5A 5HURA 5JOBA 3C1EA 4B9XA 3EJIA 4TRDA 4KV6A 1RKNA 2F0KA 1ENAA 2RKSA 4EQNA 4K5WA 5IGCA 3LX0A 4HMIA 4DFAA 5IOCA 5CV4A 3QOLA 5CV6A 5KIXA 3TP7A 5I6WA 1F2MA 2F0SA 2M00A 2OF1A 1SNQA 5CV7A 3NHHA 3ITPA 2RBMA 1SYDA 1SYGA 4KHVA 4HTHA 2NUCA 3HEJA 4J1MA 4KJOA 4KD4A 3SK4A 5IIFA 2F0MA 2F0DA 5IGGA 2F0HA 2KHSA 3OMCA 4R8NA 4DF7A 5KYLA 2F0TA 4N9PA 2EYHA 4H7BA 2F0JA 1EY7A 5HGTA 5M9OA 4K2LA 2OXPA 2SNMA 5CR3A 5IGFA 5IGEA 5IGBA 1STBA 3R3OA 2EYJA 3NQTA 4ZUIA 5C5LA 5KYIA 3MXPA 2F0IA 3P75A 1STGA 1A3UA 2EYMA 2OEOA 2EY5A 4PMBA 1SNMA 4I65A 4PMCA 1JOKA 1A3VA 4K5XA 4NMZA 5KRUA 2SOBA 4YIJA 1SYCA 5C3XA 4IALA 3BDLA 4G57A 4LAAA 4RKLA 4WRDA 3BDCA 2KQ3A 2PW7A 1JORA 1STYA 4ODGA 5J1ZA 4KD3A 2LKVA 3S9WA 1TQOA 1SNCA 1JOQA 3T16A 4DU9A 3OSOA 1EZ6A 1TR5A 3OWFA 3T13A 1A3TA 3EVQA 3NK9A 4S3SA 4F7XA 2PQEA 3ERQA 5CV8A 5KEEA 2F3WA 1AEXA 1ENCA 3C1FA 3RUZA 5C4ZA 4QMGA 1JOOA 3NP8A 3PMFA 4EQOA 2F0OA 5C6AA 1U9RA 4ZQ3A 5J39A 1KAAA 4NP5A 3TP8A 3D6CA 4IUNA 1SYBA 2EYFA 1EY9A 1EY6A 3U9OA 5KGUA 4KTAA 3EROA 1SYFA 2F0LA 2F0WA 1SYEA 2PW5A 4KY5A 5C5MA 3QB3A 2EYLA 1EY8A 5IODA 5DAUA 4K2KA 2F0VA 1EYCA 3SK8A 3V2TA
chains in the Genus database with same CATH superfamily
5HGQA 5E1FA 3D4DA 2D62A 2OQ0A 1CI3M 3M9BA 3M4OH 1Q8IA 1SDFA 4DR5L 2AWNA 3NUCA 4PZ6A 1BVSA 1C9OA 2D0OA 2HHHL 2LXKA 1EFID 2K03A 1XMQQ 1ICWA 1ET6A 2ALYB 4A93G 5ELFA 5JJLA 3SDZA 5EPLA 4RGTA 2D9UA 2ZXPA 2EY2A 2B39A 4OGQC 3SK6A 5M3MH 1I5FA 1PTOB 4RCOA 3MA2B 1I50B 3H94A 4PQXA 1HR0L 4IUUA 3S15H 1CKOA 5DEHA 1LTTD 3S16B 1W3SA 5AFWA 4IFDG 1QNKA 1V1QA 4A3IB 4LFCQ 2B2WA 4A3DB 1PXUA 3STBD 1OXUA 5HURA 4B9XA 1EEID 2NVYH 2VY3A 4C3JB 2F0KA 4DR7L 5M5YB 4QUFA 1D1IA 1E3PA 1LTBD 2WB1E 1SMYD 4JI4L 1YNND 4HAEA 3W1GA 4LF5Q 1PH1A 2JJQA 2KOLA 2RBMA 1SYDA 3J81c 3LWEA 4KD4A 4P72A 3F1ZA 1SROA 1UE6A 2OCEA 1L1OB 2EYHA 4H7BA 1K8MA 3BDOA 4JI6L 2A6HD 1QB5D 4DV2L 2K7VA 2LXJA 2F0IA 1VQCA 3W3AA 2ZTDA 1E2WA 1KXLA 2B2UC 3SVMA 4JI8Q 1A6XA 3BDLA 4G57A 3T1HL 1NNXA 4KD3A 3G4SA 2TMPA 3TRZA 1PTOC 2Z1CA 4DUYL 3PO3G 5EKIA 3T13A 3VR5A 2YYZA 1U0LA 4DR5Q 1K9MC 1AEXA 4JYAL 3KLWA 5C0XJ 2VS1A 4IUNA 2K1BA 3CCLA 3GTJH 3AQQA 4JI3L 4HR7B 3EQLC 3VDYA 4A3JG 1EIGA 4CKBA 3AEVA 2NZOA 2EDGA 2JA6H 2EJMA 2Q2TA 1Z47A 3I73A 1EOVA 1V43A 1V1PA 2KCTA 3I55A 5I9OA 4U68A 4UPAA 4XT3B 4KJNA 5I9PA 1MSGA 1HR0Q 1L1OC 4GOPA 4DV4L 2HD3A 3RR5A 4HSPA 1MD2D 4FXGC 5CMDA 3NXWA 2DY8A 1U5KA 3FRPB 4X3KA 3NPPA 1BCPB 1QZHA 1QWYA 2M9VA 5C3WA 1M8AA 1NUCA 1S3OA 2F0FA 3K7AB 1A2TA 1M90C 1UWVA 4JI4Q 4IJLA 1B4OA 3E9IA 3J81E 1K83B 1N36L 1H9SA 3GTKH 3NE5B 1N9WA 5DM73 1U4LA 4Y7NH 3MFGA 5C4XH 3DEOA 1GKHA 4R1JA 3L9AX 3ER0A 4JI6Q 1F9SA 1X3QA 5JPNC 1VQGA 1Y8PB 1RD9D 2R7FA 3BVMA 3A5UA 5DNFA 3I4NG 4PV1C 1HCZA 1CKMA 4TKOB 3GTOB 2F0SA 2Q8TA 3KF6A 1SNQA 2XWJB 5EQ0A 4KJOA 4RGMA 2CHBD 3HOUH 3A5ZB 4DUYQ 5KYLA 3UDIA 4B3SL 1GUSA 4O42A 3GTQB 4DR3Q 4P73A 4KKSA 4JYAQ 1TWGB 1BDOA 4BA1I 1A62A 2E8GA 2Y0SG 4JC0A 4C2MB 3TSSA 5FO7B 2F03A 4JI3Q 2IT1A 2BA0A 3NENA 2SOBA 5IWAQ 3CD6A 4CDCC 1STYA 4DAMA 5C0XH 3U9SA 4C56C 2NZ1D 2JA5H 3RMHA 1D5MC 2NTSA 3NQIA 1Q82C 2PQEA 2VUMG 1B50A 3EBEA 5E4XA 2J4XA 1JCKB 1KAAA 3FKIG 3CHBD 2IHFA 2NVTB 2Z4HA 4DR2L 1XPUA 4LF4L 2CWAA 5LL6X 5HY6A 4GLXA 1IYJB 5IODA 4K2KA 1D5XC 3TBIB 4FYDA 4BBSH 1LLRD 2L0CA 2Q2UA 4M1UB 1F2ZA 2A8VA 3HS0C 3S1QH 4WJ3M 4POGA 2KVMA 1KHIA 3D31A 2WFWA 1CA6A 2EQSA 3A8KE 3PUXA 1B53A 3R2TA 3I91A 1WFQA 5IGFA 2QDBA 1E2VA 4A3CH 5CV5A 1U4RA 3C2PA 3EIVA 1Y8NB 2PNHA 4DUZL 4GKKQ 1X56A 1J6QA 4MTNA 1KD1C 3KF8B 1SE2A 1BNZA 1KL9A 2CQAA 2D5DA 3TP8A 4BY1H 2F0EA 1UUPA 1F2LA 2B3GA 3M85A 3GTMB 1EY5A 4BBRB 2KCNA 3TREA 1X3EA 1CKNB 3K0YA 4NXML 1DXMA 2LS01 2F3VA 3MTSA 2MPMA 3S14B 5C0XI 3OOCA 1I4HA 1HR0W 3J7A5 1SJHD 4GNXC 1E1OA 1XJVA 5EAYA 1VQEA 2Q2IA 3H15A 3ND9A 2NUCA 2F0MA 1PTOH 1QVCA 1I50H 3A8JE 1LV9A 1STBA 1R4PB 2QEXA 3S16H 3STBC 3F2DA 1Y1WG 4JPBW 3MXPA 5KYIA 1PH7A 4KN4C 1STGA 4A3IH 4IN3A 4A3DH 1ICFB 5A2QL 1NY4A 1BBXC 4PMCA 3BU2A 4DKAC 4P71A 5KRUA 4L6TB 1SYCA 4C3JH 4WRDA 1SMYC 5M5YH 1X65A 2XIWA 1KC8C 1YNNC 1S5BD 1MIUA 5IYCH 3MEFA 5LMUL 1CT1D 4KK7A 2R61A 3OWFA 4JI2Q 1HQRD 4LF7L 3DWQA 3URYA 1JWSD 4LNQA 1JOOA 2A6HC 4JOIA 1GM5A 1U9RA 3OIQA 1LT4D 3VR3A 3DM1A 2FFKB 4DUZQ 2VQFL 3HOWG 3B6YA 3RZDB 2JA7B 1I4RA 4RG1A 1D8LA 3FDTA 3GQBA 3HOVG 4ABNA 3DLLA 3CCMA 5BR8Q 1KIXA 4KKUA 4IZ8A 1C0AA 2IWHA 3U50C 2PMZB 3A0JA 3MEHA 1PYBA 1STNA 4LUZA 2N88A 4LW1A 1I4GA 5EKLA 5FJ8H 1YVCA 3SXHA 5CBAE 2ZM6L 1LTLA 1EYDA 2AUKA 4DV0L 1OXTA 2MGSA 4CHTB 1XWEA 4LK1C 2PZTA 1N33L 2RDGA 2F0GA 3HG9A 2PZUA 5E3FA 2R7ZG 3HKZG 2KENA 3T53B 3S24A 1KDAA 3IL8A 5FO8B 4P2CB 5IP7G 1C8CA 4K6LA 2N8NA 2UUCL 3D8GA 1AH9A 2WP8J 3MHBA 1EZ8A 2IX1A 1PH2A 2EXDA 3FPUB 2XSCA 1UE5A 1K8AC 4CDEC 2CFMA 1Q8KA 2I46A 4DPGA 2QGQA 2CH4A 3S1MB 3PCOB 3P7JA 1YEZA 4GNXA 1FGBD 5FO9B 1S5ED 1GUTA 1I94L 1EQTA 1YNJD 4X3TA 2OT2A 3CQZB 1VQLA 3K7AH 3K5OA 5D3DA 3OW7A 4LJZC 3RLNA 1Y8OB 4X6AH 1K83H 2AQ2B 3EFXD 2RVLA 4YY3Q 4LF7Q 5FOBB 3KFUA 2AQ3B 2UU9L 1CFMA 2UUBL 1A3UA 4DV5L 1AN8A 3D4RA 5M3FB 4H44C 4XYQA 2FXQA 4AYBG 2RQXA 5C3EG 4LAAA 3CCEA 5J1ZA 2PQAB 4B3RL 3HOXG 3GTOH 2WAQB 1CK1A 2JA8G 2BOSA 4BY7B 5FK9C 1A0IA 1JQYD 4FXDA 3GTQH 5JVH3 1E22A 1ML0D 2I5LX 3R93A 1TWGH 5FLXc 2PW5A 3MXGA 1HA6A 1DONA 5DAUA 4C2MH 2ZM6Q 3ERSX 3VA7A 1F9RA 4PZ8A 1STHA 4JV5Q 4RGOS 3SEBA 1QCBD 1FJGL 1N33Q 1NSNS 1LTRD 2B29A 1O7ZA 1SFOB 3S1RB 4XT1B 2RDFA 1KLGD 3SR1A 2UUCQ 1YHBA 3SK5A 2SNSA 1FYCA 3S1NB 1Q3LA 3S2DB 3K80C 3T51B 1K8OA 2B2VC 2NVTH 4BWGB 3HOYB 3J81j 5DM63 1S4ZA 2EXZA 3H6MA 1VQ4A 1I94Q 2J7ZA 1JE4A 4QF4A 2R6GA 4YWKA 1C4QA 3BZCA 4X3UA 3TP6A 1K0SA 1TS4A 2QILA 5ELEA 4K8JA 1EIFA 1KNAA 4QUCA 4G7ZC 5EGTA 4IPHA 2UU9Q 3E9HA 3TP5A 1EIHA 2C5CA 1ZYRD 1N34L 2UUBQ 1RKNA 4DV5Q 5M5WB 2ZXRA 5I4DA 1TWFB 4JBJA 2K5HA 4JBKA 3T1YL 3QOLA 1I3QB 3CCRA 1NBWA 2B63G 1EEFD 1CHPD 3A56A 1GD7A 4KKTA 3HEJA 4B3RQ 5IGGA 1Q46A 4RMFA 5M9OA 3GTMH 5CR3A 4RHRA 4LWCA 4BBRH 3R2IA 2Q2HA 3DWPA 4DR6L 2IJ0A 2PMZE 3GV3A 3CC7A 3PF5A 1QUQA 1L2FA 5FLXE 3RLFA 4HCSA 1BCPD 2JP1A 3S14H 2DY7A 3HOZB 2G9HD 1EQRA 1FJGQ 1X9NA 4DU9A 1EZ6A 1TR5A 2QF7A 4LF6Q 1JC7A 4LFBQ 3J7AF 2E74C 1B9NA 3TEHB 1O7YA 3Q8DA 1ENCA 2X69A 1B3QA 2JA9A 1B7YB 1H9KA 2BDNA 5C6AA 2O5JC 1A8VA 2WB1G 3U9OA 1SYBA 2KEEA 1NCVA 1CTMA 2FMCA 3SK8A 5C4XG 3KLRA 2HT1A 2KHIA 4QIWB 2NVQB 4ZLTF 1XNQQ 2RDHA 5E7NA 4A3MG 2KCMA 4C3HG 3P1HA 1Y14B 2F4VL 2CW0D 4WORA 5CV9A 1S40A 2NZHA 2Z6KC 2OTJA 1QILA 4RH6A 3CCSA 1QG7A 4GLVB 1KRTA 1UEAB 1M1KC 2K5WA 4IOCA 4TVAB 4B9WA 2DNCA 4N9TA 1VMCA 2EJGC 1YI2A 4XQQA 2E2JB 4HIMA 1CZWA 2A68D 4EQ5A 3RZDH 2JA7H 2WACA 2GVBA 5C44G 2A1AA 1TY0A 1RCVD 3J81L 3PSIA 4ILWA 1OXXK 4K8IA 2WAQE 2FINB 1ILQA 3MAQA 1EYGA 3CC2A 5ELBA 1WVLA 3AFPA 4APVA 1SE3A 4DR6Q 5C0XG 2BCOA 1XPRA 4EQNA 3OHXC 4IO9A 5KNDA 1IZ6A 3V96A 1VQ8A 2H5XA 3KDFB 3KYHC 4V190 3I56A 3SK4A 4X62L 2QKIC 2K05A 1CUKA 4DAYA 1Z9FA 3PO3B 2PI2E 1TWHB 2F3IA 2MUYA 3DM3A 5HGTA 5C4JB 3J81i 3R3OA 5C5LA 2NWGA 1L0YB 4YHHL 1I4QA 2K6AA 4C1NK 4A3LG 3KLSX 2XRQD 1JWMD 1VCIA 4I7AA 4NXNL 4DK3C 1PTOF 3S9WA 1VQPA 3S1MH 3JAMc 1YNJC 3NELA 2HCCA 5GAEC 1CQVA 1JOQA 1XTDA 2JQOA 1XMOL 1E7ZA 3CQZH 2B2YC 4DR1L 1DOLA 2F4VQ 5TSSA 2YV5A 1L0XB 1UAPA 1EY9A 4X65L 4GS3A 1JB3A 4BY1G 2JEBI 4B08A 2UXCQ 1Y1VG 5M3FH 4GN3B 3ULPA 1XYIA 3MXNB 2BH8A 2B2TA 4PNYA 5CGKA 3CCJA 4FXKC 4C3IG 2EJFC 5K36G 1LT6D 1XX8A 4E6IA 1PFNA 5IYDH 4IPCA 3DMUA 3NBHB 4BY7H 3A7LA 3K8AA 2HHHQ 3MWYW 1SNPA 4A75A 1KDBA 4OWWB 2SDFA 3A55A 3UE1A 5J22A 1VQFA 3I4NB 3KBXA 2FHTA 2DGYA 4MZ9A 5D14A 2ID0A 2QCPX 1TWCB 2EY1A 4UP9A 1B70B 1CM9A 4A3FG 3M7NA 3Q0AA 4HMJA 1G8ZD 3BYYB 2F0UA 4A3IG 5BN5A 4A3DG 1SXTA 3C3LA 3LWUA 5G3LD 2I5HA 4C3JG 1Q1BA 1SFOH 3S1RH 1ESRA 5IP9H 1MBYA 4TRDA 4O0AA 4YHHQ 1HNXL 3LX0A 4HMIA 4DR7Q 3S1NH 3S2DH 4A3KB 1PDQA 2K75A 4NXNQ 2D0PA 1JMCA 3JAME 4MNOA 4ZRZA 4DV7L 3HOYH 3GP7A 3IFDA 3PIPA 5GQOA 3NSWA 1PH4A 4QIWE 1XMOQ 2ZTEA 4X66L 3K57A 2VUMB 1PH8A 4DV2Q 1RIPA 5DLQE 1BCPF 3CCVA 1GO3E 1ZYRC 4L63B 3E6ZX 4I65A 2K04A 1AP0A 3KLSA 3AMUA 5M5WH 2MHVA 1TWFH 3KJPA 1RL2A 2O5IC 3T1HQ 1K73C 1I3QH 4EX5A 1UE7A 3I2ZA 3I72A 4NW2A 5KNCA 2JSOA 3EVQA 5KEEA 4DV1L 3BS1A 3ERQA 2KHJA 2B2YA 1PFSA 1TIID 2Z0SA 5J39A 1W6KA 2L55A 1C7YA 1EUJA 2F0WA 2JXMB 4P75A 3GTLB 5EBCA 3NWSA 1BCPC 3L2PA 2B2UA 5CYUA 3J7ZC 2JK8A 4XQNA 1TS3A 1A2UA 2NYZD 3HOZH 1EIYB 1WCMB 1B8AA 1Q12A 4ID6A 2IL8A 1SRUA 1DGSA 4DV4Q 1TWAB 3GD7A 1VDZA 1C48A 1T5XD 4KI0A 5ELCA 2PO4A 2YTYA 4M8AA 1MJCA 1I6HB 1GVPA 1X32A 1NR2A 5FLMH 1VQ7A 1HZBA 4GZYC 1BF4A 3QOJA 2P5ZX 3PIO3 1F2YA 1PH3A 5A35A 1R4QB 2E2IB 4DV7Q 1FL0A 2F0QA 1N36Q 2NVQH 2E2DC 3X3NA 1X54A 4X66Q 1IHZA 1VQOA 2CW0C 1L1OA 4FF1A 3RZOB 2BH2A 1TS2A 4FO2A 1O7IA 1ENAA 3S2HB 3CU7A 1SN8A 1EU3A 4DXGA 2Z4IA 1SYGA 2WKCA 4KHVA 2A68C 1BKBA 3FEWX 3OMCA 3I3CA 2E2JH 4QL5A 4DV1Q 3SE0A 2UUAL 1FNWA 4B3SQ 1H9RA 2L11A 1UEBA 4HSVA 3I90A 2PCFB 1PFMA 1O7LA 4XQJA 2R93B 4RA8A 1WTWA 2Z8LA 4NB3A 4G7HC 1AFPA 2HQLA 5C3XA 4OIKA 1YJNA 1PLFA 5EBDA 2BDOA 2CWPA 1TQOA 2EE1A 1TU2B 4UP7A 1AZPA 3T16A 3MXUA 1KRSA 4GN5A 4S3SA 1DJRD 1PZID 2K32A 3AB9A 4QGUA 2E2HB 1YITA 1WJJA 3PO3H 1TWHH 3G6EA 1LABA 3CP0A 4NP5A 3IFTA 5C4JH 2EYFA 1MJEA 1DYQA 2NTTA 3UI2A 4L5RC 4IJHA 2NN6H 3CW2C 4H02A 3OIPA 4DR2Q 4LF4Q 2EYLA 2YU9B 1TVXA 2K50A 2TSSA 4KMUC 1QJOA 3QIAA 4EQPA 2F0NA 4CKCA 1VQNA 4HJAA 2BE5D 3O13A 2PNRC 2R7ZB 3CC4A 1A15A 3OWEB 4DV3L 2NVXB 4BA2I 3D4WA 4K5VA 3K0XA 5C4HA 1PRTD 4HJ9A 3MZ5A 4WJWA 1XNRL 1VF7A 3J80c 2X6LA 3ICEA 2EZVA 1II3A 1WOCA 2PZWA 4CJ0B 4IQZA 1ET9A 3OMGA 3CPWA 5LL6S 2RCFA 4JCVE 4OWTB 3H0GG 5BN3A 1GUOA 1B1ZA 1YNXA 3M3YB 4NPSA 1G2SA 4B3TL 4K6DA 3G48A 1G6PA 3M4PA 1J8IA 4NXMQ 3EN2A 3EJIA 1PH5A 1IL2A 2R92B 3BZKA 4AYBB 5C3EB 1CSQA 4J8QA 3S17B 1UE1A 4O2DA 3TP7A 4DK6C 3PO2B 4A4IA 2WV6D 5JJKA 3I4NH 4HTHA 4J1MA 4ALPA 1TWCH 4G4KA 2KHSA 3HOXB 4KHZA 4DF7A 1FNUA 2K4KA 2VB3X 2JA8B 2UXBL 2NN6I 2GN5A 2KEDA 1QUQB 4R8IA 1IL8A 1D5ZC 3NQTA 4CJ2C 2RSOA 3DUZA 3AYHB 3MC0B 4A3GB 5ELNA 3BJUA 5GROA 5FLXL 1DD2A 1J5EL 2ZJQA 1E24A 1H95A 2N78A 1SNCA 1H9MA 4A3KH 2XWBB 2ATWA 3ULJA 5LMUQ 3NTHA 3K7UC 1JICA 1SJED 3C1FA 1VS0A 2KCCA 4QMGA 3NP8A 3PMFA 5JEAJ 1IYVA 1VQHA 4N8X1 1AZQA 3J80E 2VUMH 1XNRQ 3GTPB 5IYBH 1SYEA 1HTLD 3PQIA 4A3BB 2JA7G 1W2BA 2VQFQ 4OO1H 4K0KL 2F0VA 4R4CA 5GADC 2DJFC 2AWOA 1HZ9A 4OXPA 1I4XA 1P8LA 4ZYSA 3KF8A 4AQYL 2RSNA 4PG3A 3I4LA 4B3ML 3EA6A 4DGZA 1TT2A 1AE2A 1LUZA 1PMRA 2VB2X 3CPFA 5JJZA 2PYKA 4CDFC 5L37A 1G291 4B3TQ 3I4MB 4UHVA 5M3MG 4R4QA 1D6EC 2N49A 1CKNA 1S5CD 2HUGA 1EQVA 1SLJA 3H3VH 2EPBA 3ONAB 3PF4A 3GTLH 1EY4A 3BYTB 2B63B 3HZXA 2EYOA 4DV0Q 5K5PA 4KY7A 2L4NA 1DM0B 4DNTB 3BG3A 4RWSC 2UXBQ 1WCMH 1RTOA 3RLOA 2ICIA 2UXDL 4QCLA 1HJPA 1ZXTA 1OTCA 4FF3A 2RKSA 4DA2A 4DFAA 1TWAH 2K5DA 1D7QA 1HRJA 1J5EQ 4I7ZC 3NHHA 1M4VA 3ITPA 3SGIA 4KN7C 1DCZA 2F0DA 1I6HH 2FJ2A 2L9HA 4Z9CB 1D1KA 1F9QA 1N8RC 1V1OA 2E2IH 5KNBA 4DAVA 3VYUA 4Y52H 3L3OC 3AU7A 1R9TB 1LACA 1LYLA 4CKEA 4L5SA 5D65A 3NBIA 2IHEA 4LF9L 1SR3A 1K28A 4FDBA 3RZOH 1PHJA 2WAQG 3S2HH 2F4IA 5JEAH 4JW0A 5GAGC 2QDLA 4BY7G 4A3EB 4AQYQ 3NK9A 3F2BA 1S5FD 4F7XA 4A3MB 1PRTB 5CV8A 1K8GA 4B3MQ 1G2TA 3G71A 4C3HB 3RUZA 1NJIC 3G6JB 1X6OA 3GTGB 1GOZA 1HZCA 1KQSA 2F0OA 2JA6G 1VQDA 3Q22A 3EROA 1HTPA 3GDEA 1JWUD 1FD7D 2R93H 1G51A 2K52A 4AYBE 4WFN3 3Q23A 2G5DA 3HOWB 2K33A 3QO2A 3ND8A 5C44B 3U58A 3K5MA 2AUJD 2B2WC 2O4XA 3VR6A 4LF8L 2JN4A 4F88A 4RGNA 4XYOA 1RTNA 4FF4A 1Z6HA 5BN4A 4A93B 2E2HH 1PZKD 1X3GA 1VF5C 3HOYG 2AHOB 2MO0A 3DXJC 1V1PB 1Q1EA 3BVGA 3BZDB 2XN9C 1F77A 2L5TA 3QG1A 2YU9H 3X3MA 4IPGA 2AKWB 2A5HA 2B8FA 2BE5C 4YWMA 4GOPB 2OTLA 3OTOL 4EGVA 1OXVA 3W2DA 1Q7YC 1PRTC 2R7ZH 1G91A 1U4MA 1HNWL 1WTQA 2H1EA 1G6ZA 2NVXH 4HJ5A 5IE8A 2Z9HA 5EPKA 5IP7H 1XPOA 4DK1A 1O78A 2RA4A 3ULLA 1N34Q 5IGCA 1NMGA 2J0TD 2VZAA 5CV4A 4LF9Q 2B2VA 4ULLA 4F87A 4POFA 4UY8C 3HOUG 3T1YQ 1VQJA 4OELB 1BUVT 2XGTA 1H9SB 1ZEQX 4MHEA 4DN4M 1K3BC 2EOTA 2PQAA 3GV6A 4R8NA 3HFZB 3JAML 2LY7A 3WWVA 4ZK9B 3IKJA 5IGBA 1PA6A 4IOAA 3M3YH 1TXYA 5IY0A 4JI8L 2JA5G 3KF6B 3HOZG 4ZAIA 1Y1VB 4IALA 2R92H 3PUYA 4U673 1JORA 1ESFA 4FNFA 5C3EH 2ZXOA 3S17H 3U4VA 4JI1L 1PH9A 1YHAA 1HFNA 2Z6BA 3PO2H 2QEJC 2PI2A 2IY5B 4C3IB 2IX0A 4GOPC 2QA4A 3HOXH 4HIDA 3JAMi 4LF8Q 4UDUC 3NWTA 2JA8H 4YCWA 3KK7A 3D6CA 2CQOA 4YCUA 1MI2A 4DNIA 1IYUA 3JC66 5FLMG 4BBSG 4XIGS 1YBYA 2ZTCA 5J3BA 3UDXA 4A3JB 4A3GH 3ZJYC 2KECA 5GAHC 1DOKA 3V2TA 1CQFA 1NAPA 2D2CC 4A3FB 1N32L 2I5MX 2N3SA 4LFAL 4A3CG 4HJ7A 4RAUC 3VR4A 4X3SA 1UNSA 2MP1A 3TZUA 3OTOQ 4WJ4A 4RKBA 2IPKD 1HNWQ 1MHWC 3D3RA 4BS9A 4EVOA 5IGDA 3UE0A 1CSPA 1MKHA 2MQHA 3TMEA 2MNAA 1PYSB 4F8MA 1WTHA 4ZKBB 4NKLA 5I6YA 3GTPH 2HDLA 4A3BH 1IW7D 4HN7A 1EU4A 4OONA 2EIFA 2G9DA 1BOSA 3CRLC 2HIXA 1MSHA 4ME3A 4ZKCB 5COYA 2F0PA 4K14A 1BQQT 2Z6KA 3Q6SA 4OWXB 4HCEA 3I4MH 1CA5A 5IOCA 5M5XB 1HZAA 3K59A 5LMNW 2KBNA 2M00A 4HIKA 2CKZB 2A69D 4JI1Q 4J15A 2F0HA 4YWLA 2B63H 2E76C 4X62Q 1QZGA 4Q5VA 1LM0A 4DR3L 3CAMA 2NN6G 3K58A 2MFIA 4R4TA 3LNNA 4ZUIA 3L7ZC 4RFBA 2EY5A 3KOJA 3G7LA 1S72A 1JOKA 5IWAL 2R7DA 2Y0SB 4K5XA 5IYCG 4YIJA 1FGUA 3KUPA 3TDQA 1X3FA 4IFDJ 2LFNA 4HIOA 1N32Q 1EWCA 3I8ZA 4LFAQ 4LUVA 3PIOA 1BBUA 2F3WA 2A19A 5IT9L 1V9PA 2MO1A 4DR1Q 4ZQ3A 4OX9L 4IUTA 2RHQB 1EY6A 3NEMA 5CBEE 1A63A 3FKIB 4PMWA 4KTAA 2A73B 1SYFA 4KY5A 2QW7A 4CJ1B 4X65Q 1LTSD 5ELDA 1RODA 1EY8A 3CKIB 1R9TH 1T5EA 3WOFA 2NBFA 1MGSA 4DK0A 3J7AV 3QJYA 1HFGA 1RHPA 5T1IA 1HNZL 3QWNA 4A3EH 5FJ8G 4A3MH 2XVSA 1GHKA 2ZJPA 4C3HH 4GKKL 3MVVA 3GTGH 1B9MA 1GHJA 2MJ8A 5F2DA 4BXXH 3E0JA 2GVAA 1IKLA 2KUMA 1SSOA 5EJWA 3TN2A 1B2TA 4UAIA 1HUNA 1GUNA 3KDFA 2E5LL 2EVBA 1E2ZA 3HOWH 5IT9c 1EL0A 1HUMA 4DXFA 1OO9B 5C44H 2DUDA 1I4PA 4JG2A 1HH2P 4OL7A 2KJXA 1JB7A 1KAWA 2ES2A 3OW2A 4DAPA 4A3KG 3CF5A 1HNXQ 4A93H 5I6WA 1F2MA 3A8IE 4KHPL 2AMCB 2XRSD 1HPCA 1NMFA 1W6JA 1Q86C 1IBKL 1IBLL 2ZT9C 1DOMA 1VQIA 1EY7A 2F0JA 4JOIC 5IYBG 3RN2A 2SNMA 1XXGA 2VQEL 4OO1G 4OX9Q 1HA5A 1AW7A 2OEOA 3K5NA 4IFDH 1Y1WB 1SNMA 1QNUA 4GNXB 4NMZA 3H3VC 3GO5A 2CVRA 3PIP3 4MN3A 2K5QA 2LSSA 2KQ3A 1ZKOA 4A3LH 5AJ3L 3W1BA 3MXNA 4JI2L 5JJIA 3OSOA 1QOHA 4P74A 2RHSB 2JYOA 1LTGD 1HNZQ 2A6ED 5C4ZA 2C9OA 4EQOA 3MFYA 4O1NA 3K5LA 1SMXA 3NBHA 1YIJA 2R3ZA 1VQBA 1RDPD 3DEPA 3J80L 3KJOA 3QR8A 2OWOA 1JJ2A 2DJGC 5EPJA 2HQEA 5BR8L 2IW3A 3HOVB 1Y1VH 1EFWA 1VQMA 1WCMG 2EYPA 3T4AC 2F52A 2E5LQ 3H0GB 4JVZA 2I07B 5IT9E 3TS2A 4NDXA 2DN8A 2YTVA 3D6WA 4C3IH 1EY0A 1CHQD 5K36H 2K28A 2Q8RE 1J9OA 3T56B 2ICEC 5ISRA 2ZJRA 4RCNA 2JE6I 2ENBA 3F8TA 3VYTA 1PVOA 1Z7TA 2Y0SE 1O80A 2BA1A 2N55A 1WI5A 3HRZC 3J80i 1SNDA 4KHPQ 4A3JH 3IRBA 4OHJA 4J6HA 4A3FH 3HKZB 4IFDI 1BR9A 3A7AB 4UP8A 1IBKQ 1IBLQ 3FHWA 1TY2A 1SE8A 1Q81C 4PZ7A 2VQEQ 3C1EA 1K0RA 4A76A 4G7OC 4FVMA 5JEAG 4K5WA 1NE3A 1VQ5A 2A74C 1E0BA 5KIXA 3AFQA 5JVG3 3U4ZA 1GUGA 4HEDA 1IW7C 4V0BA 2O2LD 5LHY1 5AJ3Q 5IIFA 1NTGA 4BBRG 3HKSA 1YHQA 1F9PA 4YY3L 2L1BA 5G3LF 1YJ9A 3UDFA 4K2LA 1YZ6A 2UUAQ 1P16A 3P75A 3D0FA 4N8FA 2R93G 4PMBA 4XTCS 3R8BA 3L0OA 4XDXA 4QQBX 4JI7L 4L5TA 3FP9A 5E4WC 1WTRA 3A54A 2HDMA 4RKLA 2YTXA 1RJTA 4KLKA 4L5QA 3BDCA 5M5XH 3P20A 1SAPA 3M4OB 1V8QA 2A69C 1BO0A 1BXTA 1FR3A 1KLUD 5T1GA 4LUOA 1QVGA 2I0QA 1FNVA 4FP5D 1BBWA 1U4PA 1LO5D 1WD1A 5M3MB 5KGUA 2Q8IB 3H09A 3PUWA 2RCNA 5ELOA 3I7FA 4JI5L 3TQYA 1EWHA 3W5OA 2F1MA 1CZGA 4JV5L 3RN5A 1TKWB 3S15B 3M4QA 4DV6L 1ASYA 2RF4A 3SHLA 2V4DA 2X6GA 4ME5A 1KABA 1E1TA 3C46A 1LT3D 3J7YW 1X55A 5D3IB 1JJCB 4DV3Q 3IAYA 5NUCA 3LGJA 1S5DD 2NVYB 4FF2A 1EYAA 1LTAD 4KY6A 4YCVA 4X64L 1JR0D 3PGZA 1GXDC 3FKIH 1STAA 4ZUJA 1PZJD 1DZ1A 3NTIA 1WTVA 4JI0L 3E5SA 1JE5A 3I70A 5CC4A 3PUZA 2WKDA 1K3RA 4Q0FA 1IBML 3DWAA 3PUVA 2WINB 2R92G 5JOBA 3VYSA 3M4YA 1YJWA 3ZYYX 4C1NI 4HJ8A 2OQKA 1IXRA 3FVQA 4IPDA 3F2UA 4JI7Q 3PO2G 5CV6A 2LMCB 3I4OA 3HP3A 5JPMC 1EWIA 3UDGA 5CV7A 1GUWA 3H91A 1PTOD 5H1SE 1VQ9A 3CXCA 3N52A 1RF2D 3GTJB 3CCQA 2OXPA 5LMNL 1B44D 4ZCKA 3FPPA 5A2QE 4A3GG 3RD4A 2EYMA 2JA6B 1LTID 4AIMA 1B3AA 2L15A 1VQ6A 4IUPA 3CMEA 4JI5Q 1STEA 1PFBA 4ODGA 4R9WA 2LKVA 1WTXA 4DAYB 1ASZA 4OEMB 4R4OA 1WTOA 4LF6L 3CCUA 4LFBL 4DV6Q 3M7GA 4GN4B 4DR4L 4LMQD 1A3TA 2VL6A 1FVIA 2DNEA 4DNRB 3HKZE 2K5NA 1LT5D 5M3FG 4OO1I 4A3BG 3V05A 5CORA 1VMPA 1NR4A 3E0EA 4JK1C 2WB1B 2F0LA 2VXWA 5C5MA 3QB3A 2FMMA 4IUQA 4X64Q 1Y1WH 1AE3A 4MTKA 1EYCA 4QJFA 1VQAA 3GTKB 4K0KQ 4Y7NB 2AQ1B 1XNQL 5C4XB 1WYDA 4JBWA 1KTKA 5IYDG 1D2BA 1PYWD 2KA7A 4AH6A 2L12A 5FKAC 4JI0Q 1SNOA 4GKJL 3I4MG 1QE6A 1OXSC 2A6EC 4IURA 3VYRA 2CH4W 1HQMC 1WTPA 1IBMQ 4CDDC 4CGYB 2VNUD 4OIJA 3H3VI 3VA5A 2XNAC 3CMAA 4RHSA 1EOTA 5JAVA 3CRKC 2K14A 2EY6A 3WOEA 2JEAI 4L8JA 5EKKA 2E75C 3WDNA 3Q24A 3KBGA 3DHQA 3HOUB 4CBVA 1ILPA 1HHVA 1KDCA 1QVFA 1JT8A 3FMCA 1KNEA 3E3XA 4H0LC 2M2LA 4TQUS 1PRTF 1I6VC 3K81C 2CCZA 4QB4A 3HOVH 5IP9G 2SEBD 4MIUA 3VR2A 4H13C 1JJGA 1XMQL 2IX3A 3H0GH 5LMNQ 2HCIA 1SEBD 2V1CC 4KV6A 2WIIB 2UXDQ 1H9JA 5I2XA 1T9HA 2JA5B 3NTKA 2OF1A 1L0WA 1HXYD 3PV0A 1SE4A 1XTCD 2HIVA 1X3PA 1PH6A 3N6RA 4QY7A 2GA4B 2F0TA 4LFCL 4DR4Q 4N9PA 2PPBC 3TS0A 5IGEA 1EQQA 2EYJA 2K5VA 4GLAC 2ASBA 3OPOA 3RNUA 1ENFA 2NB0A 4BBSB 1A3VA 4R4IA 1PV4A 1VQKA 1GJXA 3S1QB 4LF5L 2B2TC 2PW7A 4JBMA 1Y69U 4A3EG 3K6OA 1SBBB 3BVZA 2K01A 4GKJQ 4IUVA 1WD0A 4BXXG 4TSSA 2B8GA 1ONLA 2C35B 3TZDA 2UXCL 4XXEA 3OYYA 1TS5A 3HGBA 5I2YA 3F2CA 4BY1B 2VW9A 1IKMA 1Q90A 2H4OA 3A74A 2XTIA
chains in the Genus database with same CATH topology
5E1FA 3D4DA 2D62A 1CI3M 1Q8IA 1SDFA 2AWNA 3NUCA 1EFID 2K03A 1ICWA 1ET6A 5ELFA 3SDZA 5EPLA 4RGTA 2D9UA 2ZXPA 2EY2A 2B39A 4OGQC 3SK6A 1PTOB 4RCOA 3MA2B 1I50B 3H94A 4PQXA 4IUUA 5DEHA 1LTTD 3S16B 4IFDG 5AFWA 1QNKA 4A3IB 2B2WA 4A3DB 1PXUA 1OXUA 5HURA 4B9XA 1EEID 1Q90A 4C3JB 2F0KA 5M5YB 4QUFA 1D1IA 1LTBD 1SMYD 1YNND 4HAEA 2KOLA 2RBMA 1SYDA 3LWEA 4KD4A 2EYHA 4H7BA 1K8MA 3BDOA 2A6HD 1QB5D 2K7VA 2F0IA 3W3AA 1E2WA 2B2UC 3SVMA 1A6XA 3BDLA 4G57A 4KD3A 2TMPA 1PTOC 2Z1CA 5EKIA 3T13A 3VR5A 2YYZA 1AEXA 5C0XJ 4IUNA 2K1BA 4HR7B 3EQLC 1EIGA 4CKBA 2EDGA 2EJMA 1Z47A 3I73A 1V43A 1V1PA 5I9OA 4U68A 4XT3B 4KJNA 5I9PA 1MSGA 4HSPA 1MD2D 4FXGC 5CMDA 3NXWA 2DY8A 3FRPB 4X3KA 3NPPA 1BCPB 1QWYA 2M9VA 5C3WA 1M8AA 1NUCA 2F0FA 3K7AB 1A2TA 1B4OA 3J81E 1K83B 1H9SA 3NE5B 5DM73 1U4LA 3MFGA 3DEOA 3L9AX 1F9SA 1X3QA 5JPNC 1Y8PB 1RD9D 3BVMA 5DNFA 4PV1C 1HCZA 4TKOB 3GTOB 2F0SA 2Q8TA 1SNQA 2XWJB 5EQ0A 4KJOA 4RGMA 2CHBD 5KYLA 1GUSA 4O42A 3GTQB 4KKSA 1TWGB 1BDOA 4BA1I 4C2MB 3TSSA 5FO7B 2F03A 2IT1A 2BA0A 2SOBA 1STYA 5C0XH 3U9SA 4C56C 2NZ1D 3RMHA 1D5MC 2NTSA 3NQIA 2PQEA 1B50A 5E4XA 2J4XA 1JCKB 1KAAA 3CHBD 2NVTB 2Z4HA 5LL6X 5IODA 4K2KA 3TBIB 4FYDA 1LLRD 2L0CA 4M1UB 1F2ZA 3HS0C 2KVMA 3D31A 1CA6A 3A8KE 3PUXA 1B53A 3I91A 3R2TA 5IGFA 2QDBA 1E2VA 5CV5A 1U4RA 3C2PA 1Y8NB 1SE2A 1BNZA 2CQAA 2D5DA 3TP8A 2F0EA 1UUPA 1F2LA 3M85A 3GTMB 1EY5A 4BBRB 2KCNA 3K0YA 1DXMA 2LS01 2F3VA 3MTSA 2MPMA 3S14B 5C0XI 3OOCA 1I4HA 1SJHD 3ND9A 2NUCA 2F0MA 1PTOH 3A8JE 1LV9A 1STBA 1R4PB 5KYIA 3MXPA 4KN4C 1STGA 4IN3A 5A2QL 1BBXC 4PMCA 5KRUA 4L6TB 1SYCA 4WRDA 1SMYC 2XIWA 1YNNC 1S5BD 1CT1D 4KK7A 2R61A 3OWFA 1HQRD 3DWQA 3URYA 1JWSD 1JOOA 2A6HC 1U9RA 3OIQA 1LT4D 3VR3A 3DM1A 2FFKB 3RZDB 2JA7B 1I4RA 3FDTA 3GQBA 4ABNA 4KKUA 4IZ8A 2IWHA 2PMZB 3MEHA 1STNA 2N88A 1I4GA 5EKLA 3SXHA 5CBAE 1EYDA 2AUKA 1OXTA 2MGSA 4CHTB 1XWEA 4LK1C 2PZTA 2RDGA 2F0GA 3HG9A 2PZUA 5E3FA 3T53B 1KDAA 3IL8A 5FO8B 4P2CB 1C8CA 4K6LA 3D8GA 2WP8J 3MHBA 1EZ8A 2IX1A 3FPUB 2XSCA 2I46A 3S1MB 3P7JA 1FGBD 5FO9B 1S5ED 1GUTA 1EQTA 1YNJD 4X3TA 2OT2A 3CQZB 3K5OA 5D3DA 3OW7A 4LJZC 1Y8OB 2AQ2B 3EFXD 2RVLA 5FOBB 2AQ3B 1CFMA 1A3UA 1AN8A 3D4RA 5M3FB 4H44C 4XYQA 2RQXA 4LAAA 5J1ZA 2WAQB 1CK1A 2BOSA 4BY7B 5FK9C 1JQYD 4FXDA 5JVH3 1ML0D 3R93A 2PW5A 3MXGA 1HA6A 1DONA 5DAUA 3VA7A 1F9RA 1STHA 4RGOS 3SEBA 1QCBD 1NSNS 1LTRD 1O7ZA 1SFOB 3S1RB 4XT1B 2RDFA 1KLGD 3SR1A 3SK5A 2SNSA 1FYCA 3S1NB 1Q3LA 3S2DB 3T51B 1K8OA 2B2VC 4BWGB 3HOYB 5DM63 1S4ZA 2EXZA 3H6MA 2J7ZA 1JE4A 4QF4A 2R6GA 1C4QA 4X3UA 3TP6A 1TS4A 2QILA 5ELEA 4K8JA 1KNAA 4QUCA 4G7ZC 5EGTA 3TP5A 1EIHA 2C5CA 1ZYRD 1RKNA 5M5WB 2ZXRA 5I4DA 1TWFB 3QOLA 1I3QB 1EEFD 1CHPD 3A56A 4KKTA 3HEJA 5IGGA 5M9OA 5CR3A 4RHRA 3R2IA 3DWPA 2IJ0A 3GV3A 5FLXE 3RLFA 4HCSA 1BCPD 2JP1A 2DY7A 3HOZB 2G9HD 4DU9A 1EZ6A 1TR5A 2QF7A 1JC7A 3J7AF 2E74C 1B9NA 1O7YA 1ENCA 2X69A 1H9KA 2BDNA 5C6AA 2O5JC 3U9OA 1SYBA 2KEEA 1CTMA 2FMCA 3SK8A 3KLRA 4QIWB 2NVQB 4ZLTF 2RDHA 4C3HG 3P1HA 2CW0D 4WORA 5CV9A 1QILA 4RH6A 1QG7A 1UEAB 2K5WA 4B9WA 2DNCA 4N9TA 1VMCA 2EJGC 4XQQA 2E2JB 1CZWA 2A68D 2WACA 1TY0A 1RCVD 3J81L 4ILWA 1OXXK 4K8IA 2FINB 1ILQA 3MAQA 5ELBA 1WVLA 1SE3A 5C0XG 2BCOA 4EQNA 3OHXC 5KNDA 3V96A 4V190 3SK4A 2QKIC 2K05A 4DAYA 3PO3B 1TWHB 2MUYA 5HGTA 5C4JB 3R3OA 5C5LA 2NWGA 1L0YB 1I4QA 2K6AA 4C1NK 3KLSX 2XRQD 1JWMD 1VCIA 1PTOF 3S9WA 1YNJC 2HCCA 1CQVA 1JOQA 2B2YC 1DOLA 5TSSA 1L0XB 1UAPA 1EY9A 1JB3A 2JEBI 4B08A 1XYIA 2B2TA 4PNYA 5CGKA 4FXKC 4C3IG 2EJFC 5K36G 1LT6D 1XX8A 4E6IA 1PFNA 3DMUA 3A7LA 3MWYW 1SNPA 1KDBA 2SDFA 3A55A 5J22A 3I4NB 2FHTA 3KBXA 5D14A 2ID0A 2QCPX 1TWCB 2EY1A 1CM9A 3M7NA 3Q0AA 4HMJA 1G8ZD 3BYYB 2F0UA 5BN5A 1SXTA 3C3LA 3LWUA 5G3LD 4C3JG 1Q1BA 1ESRA 1MBYA 4TRDA 3LX0A 4HMIA 4A3KB 1PDQA 3JAME 4ZRZA 3GP7A 3IFDA 3NSWA 3K57A 2VUMB 1BCPF 1ZYRC 4L63B 3E6ZX 4I65A 2K04A 1AP0A 3KLSA 3AMUA 2MHVA 2O5IC 3I72A 4NW2A 5KNCA 2JSOA 3EVQA 5KEEA 3BS1A 3ERQA 2B2YA 1TIID 5J39A 1W6KA 2L55A 2F0WA 2JXMB 3GTLB 5EBCA 3NWSA 1BCPC 2B2UA 5CYUA 4XQNA 1TS3A 1A2UA 2NYZD 1WCMB 1Q12A 4ID6A 2IL8A 1TWAB 3GD7A 1VDZA 1C48A 1T5XD 4KI0A 5ELCA 2PO4A 4M8AA 1I6HB 1X32A 1NR2A 4GZYC 1BF4A 3QOJA 3PIO3 1F2YA 5A35A 1R4QB 2E2IB 2F0QA 2E2DC 3X3NA 1IHZA 2CW0C 4FF1A 3RZOB 1TS2A 4FO2A 1ENAA 3S2HB 3CU7A 1EU3A 4DXGA 2Z4IA 1SYGA 2WKCA 4KHVA 2A68C 3FEWX 3OMCA 3I3CA 3SE0A 1FNWA 1H9RA 2L11A 4HSVA 3I90A 2PCFB 1PFMA 1O7LA 4XQJA 2R93B 4RA8A 1WTWA 2Z8LA 4G7HC 1AFPA 5C3XA 4OIKA 1PLFA 5EBDA 2BDOA 1TQOA 2EE1A 1TU2B 1AZPA 3T16A 3MXUA 4S3SA 1DJRD 1PZID 2K32A 3AB9A 2E2HB 1LABA 4NP5A 3IFTA 2EYFA 1DYQA 2NTTA 3UI2A 2NN6H 3OIPA 2EYLA 2YU9B 1TVXA 2TSSA 4KMUC 1QJOA 3QIAA 4EQPA 2F0NA 4CKCA 2BE5D 3O13A 2PNRC 2R7ZB 1A15A 3OWEB 2NVXB 4BA2I 3D4WA 4K5VA 5C4HA 1PRTD 3MZ5A 4WJWA 1VF7A 2X6LA 2EZVA 1II3A 2PZWA 4CJ0B 4IQZA 1ET9A 3OMGA 5LL6S 5BN3A 1GUOA 1B1ZA 3M3YB 1G2SA 4K6DA 1J8IA 3EJIA 2R92B 4AYBB 5C3EB 4J8QA 3S17B 3TP7A 3PO2B 2WV6D 4HTHA 4J1MA 4G4KA 2KHSA 3HOXB 4KHZA 4DF7A 1FNUA 2VB3X 2JA8B 2NN6I 2KEDA 4R8IA 1IL8A 1D5ZC 3NQTA 4CJ2C 2RSOA 3DUZA 3MC0B 4A3GB 5FLXL 1DD2A 1SNCA 1H9MA 2XWBB 3NTHA 1JICA 1SJED 3C1FA 2KCCA 4QMGA 3NP8A 3PMFA 5JEAJ 1IYVA 1AZQA 3J80E 3GTPB 1SYEA 1HTLD 4A3BB 4OO1H 2F0VA 2AWOA 1I4XA 4ZYSA 3KF8A 2RSNA 3I4LA 3EA6A 4DGZA 1TT2A 1PMRA 2VB2X 5JJZA 2PYKA 1G291 3I4MB 1D6EC 1S5CD 2HUGA 1EQVA 2EPBA 3ONAB 1EY4A 3BYTB 2B63B 3HZXA 2EYOA 5K5PA 4KY7A 2L4NA 1DM0B 4DNTB 3BG3A 4RWSC 1RTOA 2ICIA 4QCLA 1ZXTA 4FF3A 2RKSA 4DA2A 4DFAA 2K5DA 1HRJA 4I7ZC 3NHHA 1M4VA 3ITPA 4KN7C 1DCZA 2F0DA 2FJ2A 2L9HA 4Z9CB 1D1KA 1F9QA 1V1OA 5KNBA 4DAVA 3VYUA 3L3OC 3AU7A 1R9TB 1LACA 4CKEA 5D65A 3NBIA 2F4IA 5JEAH 4A3EB 3NK9A 1S5FD 4F7XA 4A3MB 1PRTB 5CV8A 1G2TA 4C3HB 3RUZA 3G6JB 3GTGB 1GOZA 2F0OA 3Q22A 3EROA 1HTPA 1JWUD 1FD7D 4WFN3 3Q23A 3HOWB 2K33A 3QO2A 3ND8A 5C44B 3K5MA 2AUJD 2B2WC 2O4XA 3VR6A 4F88A 4RGNA 4XYOA 1RTNA 4FF4A 1Z6HA 5BN4A 4A93B 1PZKD 1VF5C 3DXJC 1V1PB 1Q1EA 3BVGA 3BZDB 2XN9C 1F77A 2L5TA 3QG1A 3X3MA 2A5HA 2B8FA 2BE5C 4EGVA 1OXVA 3W2DA 1PRTC 1G91A 1U4MA 1WTQA 2H1EA 1G6ZA 5EPKA 4DK1A 1O78A 2RA4A 5IGCA 2J0TD 5CV4A 2B2VA 4ULLA 4F87A 1BUVT 1H9SB 1ZEQX 4MHEA 4DN4M 3GV6A 2EOTA 4R8NA 3JAML 2LY7A 4ZK9B 3IKJA 5IGBA 4ZAIA 1Y1VB 4IALA 3PUYA 4U673 1JORA 1ESFA 4FNFA 2ZXOA 1HFNA 2QEJC 4C3IB 2IX0A 4UDUC 3NWTA 3KK7A 3D6CA 1MI2A 1IYUA 4XIGS 4A3JB 2KECA 1DOKA 3V2TA 1CQFA 1NAPA 2D2CC 4A3FB 4RAUC 3VR4A 4X3SA 1UNSA 2MP1A 3TZUA 4RKBA 2IPKD 3D3RA 4BS9A 4EVOA 5IGDA 3TMEA 4F8MA 4ZKBB 4NKLA 5I6YA 2HDLA 1IW7D 4HN7A 1EU4A 2G9DA 1BOSA 3CRLC 1MSHA 4ZKCB 5COYA 2F0PA 4K14A 1BQQT 3Q6SA 4HCEA 1CA5A 5IOCA 5M5XB 3K59A 2M00A 2A69D 2F0HA 2E76C 4Q5VA 2NN6G 3K58A 3LNNA 4ZUIA 3L7ZC 4RFBA 2EY5A 3G7LA 1JOKA 2Y0SB 4K5XA 4YIJA 3KUPA 3TDQA 4IFDJ 2LFNA 1EWCA 3I8ZA 2F3WA 5IT9L 4ZQ3A 4IUTA 1EY6A 5CBEE 3FKIB 4PMWA 4KTAA 2A73B 1SYFA 4KY5A 4CJ1B 1LTSD 5ELDA 1RODA 1EY8A 3CKIB 1T5EA 3WOFA 2NBFA 1MGSA 4DK0A 3J7AV 3QJYA 1HFGA 1RHPA 5T1IA 3QWNA 1GHKA 2XVSA 3MVVA 1B9MA 1GHJA 2MJ8A 5F2DA 3E0JA 1IKLA 2KUMA 1SSOA 5EJWA 3TN2A 1B2TA 4UAIA 1HUNA 1GUNA 2EVBA 1E2ZA 1EL0A 1HUMA 4DXFA 1OO9B 1I4PA 4OL7A 2KJXA 4DAPA 5I6WA 1F2MA 3A8IE 2XRSD 1HPCA 1W6JA 2ZT9C 1DOMA 2F0JA 1EY7A 2SNMA 1XXGA 4OO1G 1HA5A 1AW7A 2OEOA 3K5NA 4IFDH 1Y1WB 1SNMA 1QNUA 4NMZA 3H3VC 3GO5A 2CVRA 3PIP3 4MN3A 2K5QA 2KQ3A 1ZKOA 3MXNA 3OSOA 1QOHA 2JYOA 1LTGD 2A6ED 5C4ZA 2C9OA 4EQOA 3MFYA 4O1NA 3K5LA 3NBHA 2R3ZA 1RDPD 3DEPA 3J80L 5EPJA 2HQEA 2IW3A 3HOVB 2EYPA 3T4AC 3H0GB 2I07B 5IT9E 4NDXA 2DN8A 3D6WA 1EY0A 1CHQD 5K36H 2K28A 2Q8RE 1J9OA 3T56B 2ICEC 5ISRA 4RCNA 2JE6I 2ENBA 3VYTA 1Z7TA 1O80A 2BA1A 2N55A 3HRZC 1SNDA 4OHJA 4J6HA 3HKZB 4IFDI 1BR9A 3A7AB 1TY2A 3C1EA 4G7OC 4FVMA 5JEAG 4K5WA 2A74C 1E0BA 5KIXA 5JVG3 1GUGA 4HEDA 1IW7C 4V0BA 2O2LD 5LHY1 5IIFA 1F9PA 2L1BA 5G3LF 4K2LA 3P75A 4PMBA 4XTCS 3R8BA 4XDXA 5E4WC 1WTRA 3A54A 2HDMA 4RKLA 1RJTA 3BDCA 3P20A 1SAPA 3M4OB 1V8QA 2A69C 1BO0A 1BXTA 1FR3A 1KLUD 5T1GA 1FNVA 4FP5D 1U4PA 1LO5D 1WD1A 5M3MB 5KGUA 2Q8IB 3H09A 3PUWA 1EWHA 2F1MA 1CZGA 1TKWB 3S15B 3SHLA 2V4DA 2X6GA 4ME5A 1KABA 3C46A 1LT3D 3J7YW 5D3IB 3IAYA 5NUCA 1S5DD 2NVYB 4FF2A 1EYAA 1LTAD 4KY6A 1JR0D 1GXDC 1STAA 4ZUJA 1PZJD 1DZ1A 3NTIA 1WTVA 3E5SA 3I70A 5CC4A 3PUZA 2WKDA 4Q0FA 3DWAA 3PUVA 2WINB 5JOBA 3VYSA 3M4YA 3ZYYX 4C1NI 3FVQA 3F2UA 5CV6A 2LMCB 3HP3A 5JPMC 5CV7A 1GUWA 3H91A 1PTOD 3N52A 1RF2D 3GTJB 2OXPA 1B44D 3FPPA 5A2QE 3RD4A 2EYMA 2JA6B 1LTID 1B3AA 4IUPA 1STEA 1PFBA 4ODGA 4R9WA 2LKVA 1WTXA 1WTOA 3M7GA 4LMQD 1A3TA 2DNEA 4DNRB 1LT5D 4OO1I 3V05A 5CORA 1VMPA 1NR4A 4JK1C 2WB1B 2F0LA 2VXWA 5C5MA 3QB3A 2FMMA 4IUQA 1EYCA 3GTKB 4Y7NB 2AQ1B 5C4XB 4JBWA 1KTKA 1D2BA 1PYWD 2KA7A 2L12A 5FKAC 1SNOA 1QE6A 1OXSC 2A6EC 4IURA 3VYRA 1HQMC 1WTPA 4CGYB 2VNUD 4OIJA 3VA5A 2XNAC 4RHSA 1EOTA 5JAVA 3CRKC 2EY6A 3WOEA 2JEAI 4L8JA 5EKKA 2E75C 3WDNA 3Q24A 3KBGA 3DHQA 3HOUB 4CBVA 1ILPA 1HHVA 1KDCA 3FMCA 1KNEA 4H0LC 2M2LA 4TQUS 1PRTF 1I6VC 4QB4A 2SEBD 4MIUA 3VR2A 4H13C 2IX3A 2HCIA 1SEBD 4KV6A 2WIIB 1H9JA 5I2XA 2JA5B 3NTKA 2OF1A 1HXYD 3PV0A 1SE4A 1XTCD 1X3PA 3N6RA 2GA4B 2F0TA 4N9PA 2PPBC 5IGEA 2EYJA 3OPOA 1ENFA 2NB0A 4BBSB 1A3VA 1GJXA 3S1QB 2B2TC 2PW7A 1Y69U 3K6OA 1SBBB 3BVZA 2K01A 4IUVA 1WD0A 4TSSA 2B8GA 1ONLA 3TZDA 4XXEA 1TS5A 3HGBA 5I2YA 4BY1B 1IKMA 1NCVA 2H4OA 1D5XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQE A;  4EQP A;  1F2Z A;  1STH A;  2F0N A;  4PNY A;  1A2U A;  3QOJ A;  3SHL A;  5CGK A;  5E1F A;  2EYP A;  3D4D A;  4ME5 A;  5I9O A;  1NSN S;  1KAB A;  4IZ8 A;  4DGZ A;  4KJN A;  5I9P A;  3D4W A;  4K5V A;  1TT2 A;  3P1H A;  4ID6 A;  1SNO A;  3NUC A;  5C4H A;  4NDX A;  2RDF A;  2O4X A;  2PYK A;  3MEH A;  5NUC A;  4WOR A;  1EYA A;  2QDB A;  5CV9 A;  3SR1 A;  4E6I A;  3SK5 A;  3DMU A;  1STN A;  3MZ5 A;  4RKB A;  5CV5 A;  2SNS A;  1EY0 A;  4EVO A;  5IGD A;  1SNP A;  3MVV A;  3NXW A;  3VA5 A;  1KDB A;  5EKL A;  4KY6 A;  1EQV A;  3SXH A;  3TME A;  2EY2 A;  3SK6 A;  5JAV A;  4F8M A;  5C3W A;  5ISR A;  5F2D A;  2EY6 A;  5J22 A;  1NUC A;  2ENB A;  4NKL A;  5EKK A;  1EYD A;  1II3 A;  5I6Y A;  4B9W A;  2F0F A;  1STA A;  1A2T A;  4N9T A;  1EY4 A;  3DHQ A;  2EY1 A;  2PZW A;  4ZUJ A;  1SND A;  1KDC A;  2EYO A;  2EXZ A;  2PZT A;  2F0G A;  3H6M A;  1F2Y A;  2F0E A;  3HZX A;  3OMG A;  2PZU A;  4HMJ A;  5E3F A;  4KY7 A;  4QF4 A;  5K5P A;  2WAC A;  3E5S A;  1KDA A;  4J6H A;  1EY5 A;  2F0U A;  4QB4 A;  5DEH A;  2F0Q A;  3TP6 A;  5CC4 A;  4MIU A;  4K8I A;  4K8J A;  1IHZ A;  4K6D A;  3D8G A;  5EGT A;  2F0P A;  4K14 A;  3MHB A;  1EZ8 A;  2F3V A;  4OL7 A;  3TP5 A;  5HUR A;  5JOB A;  3C1E A;  4B9X A;  3EJI A;  4TRD A;  4KV6 A;  1RKN A;  2F0K A;  1ENA A;  2RKS A;  4EQN A;  4K5W A;  5IGC A;  3LX0 A;  4HMI A;  4DFA A;  5IOC A;  5CV4 A;  3QOL A;  5CV6 A;  5KIX A;  3TP7 A;  5I6W A;  1F2M A;  2F0S A;  2M00 A;  2OF1 A;  1SNQ A;  5CV7 A;  3NHH A;  3ITP A;  2RBM A;  1SYD A;  1SYG A;  4KHV A;  4HTH A;  2NUC A;  3HEJ A;  4J1M A;  4KJO A;  4KD4 A;  3SK4 A;  5IIF A;  2F0M A;  2F0D A;  5IGG A;  2F0H A;  2KHS A;  3OMC A;  4R8N A;  4DF7 A;  5KYL A;  2F0T A;  4N9P A;  2EYH A;  4H7B A;  2F0J A;  1EY7 A;  5HGT A;  5M9O A;  4K2L A;  2OXP A;  2SNM A;  5CR3 A;  5IGF A;  5IGE A;  5IGB A;  1STB A;  3R3O A;  2EYJ A;  3NQT A;  4ZUI A;  5C5L A;  5KYI A;  3MXP A;  2F0I A;  3P75 A;  1STG A;  1A3U A;  2EYM A;  2OEO A;  2EY5 A;  4PMB A;  1SNM A;  4I65 A;  4PMC A;  1JOK A;  1A3V A;  4K5X A;  4NMZ A;  5KRU A;  2SOB A;  4YIJ A;  1SYC A;  5C3X A;  4IAL A;  3BDL A;  4G57 A;  4LAA A;  4RKL A;  4WRD A;  3BDC A;  2KQ3 A;  2PW7 A;  1JOR A;  1STY A;  4ODG A;  5J1Z A;  4KD3 A;  2LKV A;  3S9W A;  1TQO A;  1SNC A;  1JOQ A;  3T16 A;  4DU9 A;  3OSO A;  1EZ6 A;  1TR5 A;  3OWF A;  3T13 A;  1A3T A;  3EVQ A;  3NK9 A;  4S3S A;  4F7X A;  2PQE A;  3ERQ A;  5CV8 A;  5KEE A;  2F3W A;  1AEX A;  1ENC A;  3C1F A;  3RUZ A;  5C4Z A;  4QMG A;  1JOO A;  3NP8 A;  3PMF A;  4EQO A;  2F0O A;  5C6A A;  1U9R A;  4ZQ3 A;  5J39 A;  1KAA A;  4NP5 A;  3TP8 A;  3D6C A;  4IUN A;  1SYB A;  2EYF A;  1EY9 A;  1EY6 A;  3U9O A;  5KGU A;  4KTA A;  3ERO A;  1SYF A;  2F0L A;  2F0W A;  1SYE A;  2PW5 A;  4KY5 A;  5C5M A;  3QB3 A;  2EYL A;  1EY8 A;  5IOD A;  5DAU A;  4K2K A;  2F0V A;  1EYC A;  3SK8 A;  3V2T A; 
#chains in the Genus database with same CATH topology
 5HGQ A;  5E1F A;  3D4D A;  2D62 A;  2OQ0 A;  1CI3 M;  3M9B A;  3M4O H;  1Q8I A;  1SDF A;  4DR5 L;  2AWN A;  3NUC A;  4PZ6 A;  1BVS A;  1C9O A;  2D0O A;  2HHH L;  2LXK A;  1EFI D;  2K03 A;  1XMQ Q;  1ICW A;  1ET6 A;  2ALY B;  4A93 G;  5ELF A;  5JJL A;  3SDZ A;  5EPL A;  4RGT A;  2D9U A;  2ZXP A;  2EY2 A;  2B39 A;  4OGQ C;  3SK6 A;  5M3M H;  1I5F A;  1PTO B;  4RCO A;  3MA2 B;  1I50 B;  3H94 A;  4PQX A;  1HR0 L;  4IUU A;  3S15 H;  1CKO A;  5DEH A;  1LTT D;  3S16 B;  1W3S A;  5AFW A;  4IFD G;  1QNK A;  1V1Q A;  4A3I B;  4LFC Q;  2B2W A;  4A3D B;  1PXU A;  3STB D;  1OXU A;  5HUR A;  4B9X A;  1EEI D;  2NVY H;  2VY3 A;  4C3J B;  2F0K A;  4DR7 L;  5M5Y B;  4QUF A;  1D1I A;  1E3P A;  1LTB D;  2WB1 E;  1SMY D;  4JI4 L;  1YNN D;  4HAE A;  3W1G A;  4LF5 Q;  1PH1 A;  2JJQ A;  2KOL A;  2RBM A;  1SYD A;  3J81 c;  3LWE A;  4KD4 A;  4P72 A;  3F1Z A;  1SRO A;  1UE6 A;  2OCE A;  1L1O B;  2EYH A;  4H7B A;  1K8M A;  3BDO A;  4JI6 L;  2A6H D;  1QB5 D;  4DV2 L;  2K7V A;  2LXJ A;  2F0I A;  1VQC A;  3W3A A;  2ZTD A;  1E2W A;  1KXL A;  2B2U C;  3SVM A;  4JI8 Q;  1A6X A;  3BDL A;  4G57 A;  3T1H L;  1NNX A;  4KD3 A;  3G4S A;  2TMP A;  3TRZ A;  1PTO C;  2Z1C A;  4DUY L;  3PO3 G;  5EKI A;  3T13 A;  3VR5 A;  2YYZ A;  1U0L A;  4DR5 Q;  1K9M C;  1AEX A;  4JYA L;  3KLW A;  5C0X J;  2VS1 A;  4IUN A;  2K1B A;  3CCL A;  3GTJ H;  3AQQ A;  4JI3 L;  4HR7 B;  3EQL C;  3VDY A;  4A3J G;  1EIG A;  4CKB A;  3AEV A;  2NZO A;  2EDG A;  2JA6 H;  2EJM A;  2Q2T A;  1Z47 A;  3I73 A;  1EOV A;  1V43 A;  1V1P A;  2KCT A;  3I55 A;  5I9O A;  4U68 A;  4UPA A;  4XT3 B;  4KJN A;  5I9P A;  1MSG A;  1HR0 Q;  1L1O C;  4GOP A;  4DV4 L;  2HD3 A;  3RR5 A;  4HSP A;  1MD2 D;  4FXG C;  5CMD A;  3NXW A;  2DY8 A;  1U5K A;  3FRP B;  4X3K A;  3NPP A;  1BCP B;  1QZH A;  1QWY A;  2M9V A;  5C3W A;  1M8A A;  1NUC A;  1S3O A;  2F0F A;  3K7A B;  1A2T A;  1M90 C;  1UWV A;  4JI4 Q;  4IJL A;  1B4O A;  3E9I A;  3J81 E;  1K83 B;  1N36 L;  1H9S A;  3GTK H;  3NE5 B;  1N9W A;  5DM7 3;  1U4L A;  4Y7N H;  3MFG A;  5C4X H;  3DEO A;  1GKH A;  4R1J A;  3L9A X;  3ER0 A;  4JI6 Q;  1F9S A;  1X3Q A;  5JPN C;  1VQG A;  1Y8P B;  1RD9 D;  2R7F A;  3BVM A;  3A5U A;  5DNF A;  3I4N G;  4PV1 C;  1HCZ A;  1CKM A;  4TKO B;  3GTO B;  2F0S A;  2Q8T A;  3KF6 A;  1SNQ A;  2XWJ B;  5EQ0 A;  4KJO A;  4RGM A;  2CHB D;  3HOU H;  3A5Z B;  4DUY Q;  5KYL A;  3UDI A;  4B3S L;  1GUS A;  4O42 A;  3GTQ B;  4DR3 Q;  4P73 A;  4KKS A;  4JYA Q;  1TWG B;  1BDO A;  4BA1 I;  1A62 A;  2E8G A;  2Y0S G;  4JC0 A;  4C2M B;  3TSS A;  5FO7 B;  2F03 A;  4JI3 Q;  2IT1 A;  2BA0 A;  3NEN A;  2SOB A;  5IWA Q;  3CD6 A;  4CDC C;  1STY A;  4DAM A;  5C0X H;  3U9S A;  4C56 C;  2NZ1 D;  2JA5 H;  3RMH A;  1D5M C;  2NTS A;  3NQI A;  1Q82 C;  2PQE A;  2VUM G;  1B50 A;  3EBE A;  5E4X A;  2J4X A;  1JCK B;  1KAA A;  3FKI G;  3CHB D;  2IHF A;  2NVT B;  2Z4H A;  4DR2 L;  1XPU A;  4LF4 L;  2CWA A;  5LL6 X;  5HY6 A;  4GLX A;  1IYJ B;  5IOD A;  4K2K A;  1D5X C;  3TBI B;  4FYD A;  4BBS H;  1LLR D;  2L0C A;  2Q2U A;  4M1U B;  1F2Z A;  2A8V A;  3HS0 C;  3S1Q H;  4WJ3 M;  4POG A;  2KVM A;  1KHI A;  3D31 A;  2WFW A;  1CA6 A;  2EQS A;  3A8K E;  3PUX A;  1B53 A;  3R2T A;  3I91 A;  1WFQ A;  5IGF A;  2QDB A;  1E2V A;  4A3C H;  5CV5 A;  1U4R A;  3C2P A;  3EIV A;  1Y8N B;  2PNH A;  4DUZ L;  4GKK Q;  1X56 A;  1J6Q A;  4MTN A;  1KD1 C;  3KF8 B;  1SE2 A;  1BNZ A;  1KL9 A;  2CQA A;  2D5D A;  3TP8 A;  4BY1 H;  2F0E A;  1UUP A;  1F2L A;  2B3G A;  3M85 A;  3GTM B;  1EY5 A;  4BBR B;  2KCN A;  3TRE A;  1X3E A;  1CKN B;  3K0Y A;  4NXM L;  1DXM A;  2LS0 1;  2F3V A;  3MTS A;  2MPM A;  3S14 B;  5C0X I;  3OOC A;  1I4H A;  1HR0 W;  3J7A 5;  1SJH D;  4GNX C;  1E1O A;  1XJV A;  5EAY A;  1VQE A;  2Q2I A;  3H15 A;  3ND9 A;  2NUC A;  2F0M A;  1PTO H;  1QVC A;  1I50 H;  3A8J E;  1LV9 A;  1STB A;  1R4P B;  2QEX A;  3S16 H;  3STB C;  3F2D A;  1Y1W G;  4JPB W;  3MXP A;  5KYI A;  1PH7 A;  4KN4 C;  1STG A;  4A3I H;  4IN3 A;  4A3D H;  1ICF B;  5A2Q L;  1NY4 A;  1BBX C;  4PMC A;  3BU2 A;  4DKA C;  4P71 A;  5KRU A;  4L6T B;  1SYC A;  4C3J H;  4WRD A;  1SMY C;  5M5Y H;  1X65 A;  2XIW A;  1KC8 C;  1YNN C;  1S5B D;  1MIU A;  5IYC H;  3MEF A;  5LMU L;  1CT1 D;  4KK7 A;  2R61 A;  3OWF A;  4JI2 Q;  1HQR D;  4LF7 L;  3DWQ A;  3URY A;  1JWS D;  4LNQ A;  1JOO A;  2A6H C;  4JOI A;  1GM5 A;  1U9R A;  3OIQ A;  1LT4 D;  3VR3 A;  3DM1 A;  2FFK B;  4DUZ Q;  2VQF L;  3HOW G;  3B6Y A;  3RZD B;  2JA7 B;  1I4R A;  4RG1 A;  1D8L A;  3FDT A;  3GQB A;  3HOV G;  4ABN A;  3DLL A;  3CCM A;  5BR8 Q;  1KIX A;  4KKU A;  4IZ8 A;  1C0A A;  2IWH A;  3U50 C;  2PMZ B;  3A0J A;  3MEH A;  1PYB A;  1STN A;  4LUZ A;  2N88 A;  4LW1 A;  1I4G A;  5EKL A;  5FJ8 H;  1YVC A;  3SXH A;  5CBA E;  2ZM6 L;  1LTL A;  1EYD A;  2AUK A;  4DV0 L;  1OXT A;  2MGS A;  4CHT B;  1XWE A;  4LK1 C;  2PZT A;  1N33 L;  2RDG A;  2F0G A;  3HG9 A;  2PZU A;  5E3F A;  2R7Z G;  3HKZ G;  2KEN A;  3T53 B;  3S24 A;  1KDA A;  3IL8 A;  5FO8 B;  4P2C B;  5IP7 G;  1C8C A;  4K6L A;  2N8N A;  2UUC L;  3D8G A;  1AH9 A;  2WP8 J;  3MHB A;  1EZ8 A;  2IX1 A;  1PH2 A;  2EXD A;  3FPU B;  2XSC A;  1UE5 A;  1K8A C;  4CDE C;  2CFM A;  1Q8K A;  2I46 A;  4DPG A;  2QGQ A;  2CH4 A;  3S1M B;  3PCO B;  3P7J A;  1YEZ A;  4GNX A;  1FGB D;  5FO9 B;  1S5E D;  1GUT A;  1I94 L;  1EQT A;  1YNJ D;  4X3T A;  2OT2 A;  3CQZ B;  1VQL A;  3K7A H;  3K5O A;  5D3D A;  3OW7 A;  4LJZ C;  3RLN A;  1Y8O B;  4X6A H;  1K83 H;  2AQ2 B;  3EFX D;  2RVL A;  4YY3 Q;  4LF7 Q;  5FOB B;  3KFU A;  2AQ3 B;  2UU9 L;  1CFM A;  2UUB L;  1A3U A;  4DV5 L;  1AN8 A;  3D4R A;  5M3F B;  4H44 C;  4XYQ A;  2FXQ A;  4AYB G;  2RQX A;  5C3E G;  4LAA A;  3CCE A;  5J1Z A;  2PQA B;  4B3R L;  3HOX G;  3GTO H;  2WAQ B;  1CK1 A;  2JA8 G;  2BOS A;  4BY7 B;  5FK9 C;  1A0I A;  1JQY D;  4FXD A;  3GTQ H;  5JVH 3;  1E22 A;  1ML0 D;  2I5L X;  3R93 A;  1TWG H;  5FLX c;  2PW5 A;  3MXG A;  1HA6 A;  1DON A;  5DAU A;  4C2M H;  2ZM6 Q;  3ERS X;  3VA7 A;  1F9R A;  4PZ8 A;  1STH A;  4JV5 Q;  4RGO S;  3SEB A;  1QCB D;  1FJG L;  1N33 Q;  1NSN S;  1LTR D;  2B29 A;  1O7Z A;  1SFO B;  3S1R B;  4XT1 B;  2RDF A;  1KLG D;  3SR1 A;  2UUC Q;  1YHB A;  3SK5 A;  2SNS A;  1FYC A;  3S1N B;  1Q3L A;  3S2D B;  3K80 C;  3T51 B;  1K8O A;  2B2V C;  2NVT H;  4BWG B;  3HOY B;  3J81 j;  5DM6 3;  1S4Z A;  2EXZ A;  3H6M A;  1VQ4 A;  1I94 Q;  2J7Z A;  1JE4 A;  4QF4 A;  2R6G A;  4YWK A;  1C4Q A;  3BZC A;  4X3U A;  3TP6 A;  1K0S A;  1TS4 A;  2QIL A;  5ELE A;  4K8J A;  1EIF A;  1KNA A;  4QUC A;  4G7Z C;  5EGT A;  4IPH A;  2UU9 Q;  3E9H A;  3TP5 A;  1EIH A;  2C5C A;  1ZYR D;  1N34 L;  2UUB Q;  1RKN A;  4DV5 Q;  5M5W B;  2ZXR A;  5I4D A;  1TWF B;  4JBJ A;  2K5H A;  4JBK A;  3T1Y L;  3QOL A;  1I3Q B;  3CCR A;  1NBW A;  2B63 G;  1EEF D;  1CHP D;  3A56 A;  1GD7 A;  4KKT A;  3HEJ A;  4B3R Q;  5IGG A;  1Q46 A;  4RMF A;  5M9O A;  3GTM H;  5CR3 A;  4RHR A;  4LWC A;  4BBR H;  3R2I A;  2Q2H A;  3DWP A;  4DR6 L;  2IJ0 A;  2PMZ E;  3GV3 A;  3CC7 A;  3PF5 A;  1QUQ A;  1L2F A;  5FLX E;  3RLF A;  4HCS A;  1BCP D;  2JP1 A;  3S14 H;  2DY7 A;  3HOZ B;  2G9H D;  1EQR A;  1FJG Q;  1X9N A;  4DU9 A;  1EZ6 A;  1TR5 A;  2QF7 A;  4LF6 Q;  1JC7 A;  4LFB Q;  3J7A F;  2E74 C;  1B9N A;  3TEH B;  1O7Y A;  3Q8D A;  1ENC A;  2X69 A;  1B3Q A;  2JA9 A;  1B7Y B;  1H9K A;  2BDN A;  5C6A A;  2O5J C;  1A8V A;  2WB1 G;  3U9O A;  1SYB A;  2KEE A;  1NCV A;  1CTM A;  2FMC A;  3SK8 A;  5C4X G;  3KLR A;  2HT1 A;  2KHI A;  4QIW B;  2NVQ B;  4ZLT F;  1XNQ Q;  2RDH A;  5E7N A;  4A3M G;  2KCM A;  4C3H G;  3P1H A;  1Y14 B;  2F4V L;  2CW0 D;  4WOR A;  5CV9 A;  1S40 A;  2NZH A;  2Z6K C;  2OTJ A;  1QIL A;  4RH6 A;  3CCS A;  1QG7 A;  4GLV B;  1KRT A;  1UEA B;  1M1K C;  2K5W A;  4IOC A;  4TVA B;  4B9W A;  2DNC A;  4N9T A;  1VMC A;  2EJG C;  1YI2 A;  4XQQ A;  2E2J B;  4HIM A;  1CZW A;  2A68 D;  4EQ5 A;  3RZD H;  2JA7 H;  2WAC A;  2GVB A;  5C44 G;  2A1A A;  1TY0 A;  1RCV D;  3J81 L;  3PSI A;  4ILW A;  1OXX K;  4K8I A;  2WAQ E;  2FIN B;  1ILQ A;  3MAQ A;  1EYG A;  3CC2 A;  5ELB A;  1WVL A;  3AFP A;  4APV A;  1SE3 A;  4DR6 Q;  5C0X G;  2BCO A;  1XPR A;  4EQN A;  3OHX C;  4IO9 A;  5KND A;  1IZ6 A;  3V96 A;  1VQ8 A;  2H5X A;  3KDF B;  3KYH C;  4V19 0;  3I56 A;  3SK4 A;  4X62 L;  2QKI C;  2K05 A;  1CUK A;  4DAY A;  1Z9F A;  3PO3 B;  2PI2 E;  1TWH B;  2F3I A;  2MUY A;  3DM3 A;  5HGT A;  5C4J B;  3J81 i;  3R3O A;  5C5L A;  2NWG A;  1L0Y B;  4YHH L;  1I4Q A;  2K6A A;  4C1N K;  4A3L G;  3KLS X;  2XRQ D;  1JWM D;  1VCI A;  4I7A A;  4NXN L;  4DK3 C;  1PTO F;  3S9W A;  1VQP A;  3S1M H;  3JAM c;  1YNJ C;  3NEL A;  2HCC A;  5GAE C;  1CQV A;  1JOQ A;  1XTD A;  2JQO A;  1XMO L;  1E7Z A;  3CQZ H;  2B2Y C;  4DR1 L;  1DOL A;  2F4V Q;  5TSS A;  2YV5 A;  1L0X B;  1UAP A;  1EY9 A;  4X65 L;  4GS3 A;  1JB3 A;  4BY1 G;  2JEB I;  4B08 A;  2UXC Q;  1Y1V G;  5M3F H;  4GN3 B;  3ULP A;  1XYI A;  3MXN B;  2BH8 A;  2B2T A;  4PNY A;  5CGK A;  3CCJ A;  4FXK C;  4C3I G;  2EJF C;  5K36 G;  1LT6 D;  1XX8 A;  4E6I A;  1PFN A;  5IYD H;  4IPC A;  3DMU A;  3NBH B;  4BY7 H;  3A7L A;  3K8A A;  2HHH Q;  3MWY W;  1SNP A;  4A75 A;  1KDB A;  4OWW B;  2SDF A;  3A55 A;  3UE1 A;  5J22 A;  1VQF A;  3I4N B;  3KBX A;  2FHT A;  2DGY A;  4MZ9 A;  5D14 A;  2ID0 A;  2QCP X;  1TWC B;  2EY1 A;  4UP9 A;  1B70 B;  1CM9 A;  4A3F G;  3M7N A;  3Q0A A;  4HMJ A;  1G8Z D;  3BYY B;  2F0U A;  4A3I G;  5BN5 A;  4A3D G;  1SXT A;  3C3L A;  3LWU A;  5G3L D;  2I5H A;  4C3J G;  1Q1B A;  1SFO H;  3S1R H;  1ESR A;  5IP9 H;  1MBY A;  4TRD A;  4O0A A;  4YHH Q;  1HNX L;  3LX0 A;  4HMI A;  4DR7 Q;  3S1N H;  3S2D H;  4A3K B;  1PDQ A;  2K75 A;  4NXN Q;  2D0P A;  1JMC A;  3JAM E;  4MNO A;  4ZRZ A;  4DV7 L;  3HOY H;  3GP7 A;  3IFD A;  3PIP A;  5GQO A;  3NSW A;  1PH4 A;  4QIW E;  1XMO Q;  2ZTE A;  4X66 L;  3K57 A;  2VUM B;  1PH8 A;  4DV2 Q;  1RIP A;  5DLQ E;  1BCP F;  3CCV A;  1GO3 E;  1ZYR C;  4L63 B;  3E6Z X;  4I65 A;  2K04 A;  1AP0 A;  3KLS A;  3AMU A;  5M5W H;  2MHV A;  1TWF H;  3KJP A;  1RL2 A;  2O5I C;  3T1H Q;  1K73 C;  1I3Q H;  4EX5 A;  1UE7 A;  3I2Z A;  3I72 A;  4NW2 A;  5KNC A;  2JSO A;  3EVQ A;  5KEE A;  4DV1 L;  3BS1 A;  3ERQ A;  2KHJ A;  2B2Y A;  1PFS A;  1TII D;  2Z0S A;  5J39 A;  1W6K A;  2L55 A;  1C7Y A;  1EUJ A;  2F0W A;  2JXM B;  4P75 A;  3GTL B;  5EBC A;  3NWS A;  1BCP C;  3L2P A;  2B2U A;  5CYU A;  3J7Z C;  2JK8 A;  4XQN A;  1TS3 A;  1A2U A;  2NYZ D;  3HOZ H;  1EIY B;  1WCM B;  1B8A A;  1Q12 A;  4ID6 A;  2IL8 A;  1SRU A;  1DGS A;  4DV4 Q;  1TWA B;  3GD7 A;  1VDZ A;  1C48 A;  1T5X D;  4KI0 A;  5ELC A;  2PO4 A;  2YTY A;  4M8A A;  1MJC A;  1I6H B;  1GVP A;  1X32 A;  1NR2 A;  5FLM H;  1VQ7 A;  1HZB A;  4GZY C;  1BF4 A;  3QOJ A;  2P5Z X;  3PIO 3;  1F2Y A;  1PH3 A;  5A35 A;  1R4Q B;  2E2I B;  4DV7 Q;  1FL0 A;  2F0Q A;  1N36 Q;  2NVQ H;  2E2D C;  3X3N A;  1X54 A;  4X66 Q;  1IHZ A;  1VQO A;  2CW0 C;  1L1O A;  4FF1 A;  3RZO B;  2BH2 A;  1TS2 A;  4FO2 A;  1O7I A;  1ENA A;  3S2H B;  3CU7 A;  1SN8 A;  1EU3 A;  4DXG A;  2Z4I A;  1SYG A;  2WKC A;  4KHV A;  2A68 C;  1BKB A;  3FEW X;  3OMC A;  3I3C A;  2E2J H;  4QL5 A;  4DV1 Q;  3SE0 A;  2UUA L;  1FNW A;  4B3S Q;  1H9R A;  2L11 A;  1UEB A;  4HSV A;  3I90 A;  2PCF B;  1PFM A;  1O7L A;  4XQJ A;  2R93 B;  4RA8 A;  1WTW A;  2Z8L A;  4NB3 A;  4G7H C;  1AFP A;  2HQL A;  5C3X A;  4OIK A;  1YJN A;  1PLF A;  5EBD A;  2BDO A;  2CWP A;  1TQO A;  2EE1 A;  1TU2 B;  4UP7 A;  1AZP A;  3T16 A;  3MXU A;  1KRS A;  4GN5 A;  4S3S A;  1DJR D;  1PZI D;  2K32 A;  3AB9 A;  4QGU A;  2E2H B;  1YIT A;  1WJJ A;  3PO3 H;  1TWH H;  3G6E A;  1LAB A;  3CP0 A;  4NP5 A;  3IFT A;  5C4J H;  2EYF A;  1MJE A;  1DYQ A;  2NTT A;  3UI2 A;  4L5R C;  4IJH A;  2NN6 H;  3CW2 C;  4H02 A;  3OIP A;  4DR2 Q;  4LF4 Q;  2EYL A;  2YU9 B;  1TVX A;  2K50 A;  2TSS A;  4KMU C;  1QJO A;  3QIA A;  4EQP A;  2F0N A;  4CKC A;  1VQN A;  4HJA A;  2BE5 D;  3O13 A;  2PNR C;  2R7Z B;  3CC4 A;  1A15 A;  3OWE B;  4DV3 L;  2NVX B;  4BA2 I;  3D4W A;  4K5V A;  3K0X A;  5C4H A;  1PRT D;  4HJ9 A;  3MZ5 A;  4WJW A;  1XNR L;  1VF7 A;  3J80 c;  2X6L A;  3ICE A;  2EZV A;  1II3 A;  1WOC A;  2PZW A;  4CJ0 B;  4IQZ A;  1ET9 A;  3OMG A;  3CPW A;  5LL6 S;  2RCF A;  4JCV E;  4OWT B;  3H0G G;  5BN3 A;  1GUO A;  1B1Z A;  1YNX A;  3M3Y B;  4NPS A;  1G2S A;  4B3T L;  4K6D A;  3G48 A;  1G6P A;  3M4P A;  1J8I A;  4NXM Q;  3EN2 A;  3EJI A;  1PH5 A;  1IL2 A;  2R92 B;  3BZK A;  4AYB B;  5C3E B;  1CSQ A;  4J8Q A;  3S17 B;  1UE1 A;  4O2D A;  3TP7 A;  4DK6 C;  3PO2 B;  4A4I A;  2WV6 D;  5JJK A;  3I4N H;  4HTH A;  4J1M A;  4ALP A;  1TWC H;  4G4K A;  2KHS A;  3HOX B;  4KHZ A;  4DF7 A;  1FNU A;  2K4K A;  2VB3 X;  2JA8 B;  2UXB L;  2NN6 I;  2GN5 A;  2KED A;  1QUQ B;  4R8I A;  1IL8 A;  1D5Z C;  3NQT A;  4CJ2 C;  2RSO A;  3DUZ A;  3AYH B;  3MC0 B;  4A3G B;  5ELN A;  3BJU A;  5GRO A;  5FLX L;  1DD2 A;  1J5E L;  2ZJQ A;  1E24 A;  1H95 A;  2N78 A;  1SNC A;  1H9M A;  4A3K H;  2XWB B;  2ATW A;  3ULJ A;  5LMU Q;  3NTH A;  3K7U C;  1JIC A;  1SJE D;  3C1F A;  1VS0 A;  2KCC A;  4QMG A;  3NP8 A;  3PMF A;  5JEA J;  1IYV A;  1VQH A;  4N8X 1;  1AZQ A;  3J80 E;  2VUM H;  1XNR Q;  3GTP B;  5IYB H;  1SYE A;  1HTL D;  3PQI A;  4A3B B;  2JA7 G;  1W2B A;  2VQF Q;  4OO1 H;  4K0K L;  2F0V A;  4R4C A;  5GAD C;  2DJF C;  2AWO A;  1HZ9 A;  4OXP A;  1I4X A;  1P8L A;  4ZYS A;  3KF8 A;  4AQY L;  2RSN A;  4PG3 A;  3I4L A;  4B3M L;  3EA6 A;  4DGZ A;  1TT2 A;  1AE2 A;  1LUZ A;  1PMR A;  2VB2 X;  3CPF A;  5JJZ A;  2PYK A;  4CDF C;  5L37 A;  1G29 1;  4B3T Q;  3I4M B;  4UHV A;  5M3M G;  4R4Q A;  1D6E C;  2N49 A;  1CKN A;  1S5C D;  2HUG A;  1EQV A;  1SLJ A;  3H3V H;  2EPB A;  3ONA B;  3PF4 A;  3GTL H;  1EY4 A;  3BYT B;  2B63 B;  3HZX A;  2EYO A;  4DV0 Q;  5K5P A;  4KY7 A;  2L4N A;  1DM0 B;  4DNT B;  3BG3 A;  4RWS C;  2UXB Q;  1WCM H;  1RTO A;  3RLO A;  2ICI A;  2UXD L;  4QCL A;  1HJP A;  1ZXT A;  1OTC A;  4FF3 A;  2RKS A;  4DA2 A;  4DFA A;  1TWA H;  2K5D A;  1D7Q A;  1HRJ A;  1J5E Q;  4I7Z C;  3NHH A;  1M4V A;  3ITP A;  3SGI A;  4KN7 C;  1DCZ A;  2F0D A;  1I6H H;  2FJ2 A;  2L9H A;  4Z9C B;  1D1K A;  1F9Q A;  1N8R C;  1V1O A;  2E2I H;  5KNB A;  4DAV A;  3VYU A;  4Y52 H;  3L3O C;  3AU7 A;  1R9T B;  1LAC A;  1LYL A;  4CKE A;  4L5S A;  5D65 A;  3NBI A;  2IHE A;  4LF9 L;  1SR3 A;  1K28 A;  4FDB A;  3RZO H;  1PHJ A;  2WAQ G;  3S2H H;  2F4I A;  5JEA H;  4JW0 A;  5GAG C;  2QDL A;  4BY7 G;  4A3E B;  4AQY Q;  3NK9 A;  3F2B A;  1S5F D;  4F7X A;  4A3M B;  1PRT B;  5CV8 A;  1K8G A;  4B3M Q;  1G2T A;  3G71 A;  4C3H B;  3RUZ A;  1NJI C;  3G6J B;  1X6O A;  3GTG B;  1GOZ A;  1HZC A;  1KQS A;  2F0O A;  2JA6 G;  1VQD A;  3Q22 A;  3ERO A;  1HTP A;  3GDE A;  1JWU D;  1FD7 D;  2R93 H;  1G51 A;  2K52 A;  4AYB E;  4WFN 3;  3Q23 A;  2G5D A;  3HOW B;  2K33 A;  3QO2 A;  3ND8 A;  5C44 B;  3U58 A;  3K5M A;  2AUJ D;  2B2W C;  2O4X A;  3VR6 A;  4LF8 L;  2JN4 A;  4F88 A;  4RGN A;  4XYO A;  1RTN A;  4FF4 A;  1Z6H A;  5BN4 A;  4A93 B;  2E2H H;  1PZK D;  1X3G A;  1VF5 C;  3HOY G;  2AHO B;  2MO0 A;  3DXJ C;  1V1P B;  1Q1E A;  3BVG A;  3BZD B;  2XN9 C;  1F77 A;  2L5T A;  3QG1 A;  2YU9 H;  3X3M A;  4IPG A;  2AKW B;  2A5H A;  2B8F A;  2BE5 C;  4YWM A;  4GOP B;  2OTL A;  3OTO L;  4EGV A;  1OXV A;  3W2D A;  1Q7Y C;  1PRT C;  2R7Z H;  1G91 A;  1U4M A;  1HNW L;  1WTQ A;  2H1E A;  1G6Z A;  2NVX H;  4HJ5 A;  5IE8 A;  2Z9H A;  5EPK A;  5IP7 H;  1XPO A;  4DK1 A;  1O78 A;  2RA4 A;  3ULL A;  1N34 Q;  5IGC A;  1NMG A;  2J0T D;  2VZA A;  5CV4 A;  4LF9 Q;  2B2V A;  4ULL A;  4F87 A;  4POF A;  4UY8 C;  3HOU G;  3T1Y Q;  1VQJ A;  4OEL B;  1BUV T;  2XGT A;  1H9S B;  1ZEQ X;  4MHE A;  4DN4 M;  1K3B C;  2EOT A;  2PQA A;  3GV6 A;  4R8N A;  3HFZ B;  3JAM L;  2LY7 A;  3WWV A;  4ZK9 B;  3IKJ A;  5IGB A;  1PA6 A;  4IOA A;  3M3Y H;  1TXY A;  5IY0 A;  4JI8 L;  2JA5 G;  3KF6 B;  3HOZ G;  4ZAI A;  1Y1V B;  4IAL A;  2R92 H;  3PUY A;  4U67 3;  1JOR A;  1ESF A;  4FNF A;  5C3E H;  2ZXO A;  3S17 H;  3U4V A;  4JI1 L;  1PH9 A;  1YHA A;  1HFN A;  2Z6B A;  3PO2 H;  2QEJ C;  2PI2 A;  2IY5 B;  4C3I B;  2IX0 A;  4GOP C;  2QA4 A;  3HOX H;  4HID A;  3JAM i;  4LF8 Q;  4UDU C;  3NWT A;  2JA8 H;  4YCW A;  3KK7 A;  3D6C A;  2CQO A;  4YCU A;  1MI2 A;  4DNI A;  1IYU A;  3JC6 6;  5FLM G;  4BBS G;  4XIG S;  1YBY A;  2ZTC A;  5J3B A;  3UDX A;  4A3J B;  4A3G H;  3ZJY C;  2KEC A;  5GAH C;  1DOK A;  3V2T A;  1CQF A;  1NAP A;  2D2C C;  4A3F B;  1N32 L;  2I5M X;  2N3S A;  4LFA L;  4A3C G;  4HJ7 A;  4RAU C;  3VR4 A;  4X3S A;  1UNS A;  2MP1 A;  3TZU A;  3OTO Q;  4WJ4 A;  4RKB A;  2IPK D;  1HNW Q;  1MHW C;  3D3R A;  4BS9 A;  4EVO A;  5IGD A;  3UE0 A;  1CSP A;  1MKH A;  2MQH A;  3TME A;  2MNA A;  1PYS B;  4F8M A;  1WTH A;  4ZKB B;  4NKL A;  5I6Y A;  3GTP H;  2HDL A;  4A3B H;  1IW7 D;  4HN7 A;  1EU4 A;  4OON A;  2EIF A;  2G9D A;  1BOS A;  3CRL C;  2HIX A;  1MSH A;  4ME3 A;  4ZKC B;  5COY A;  2F0P A;  4K14 A;  1BQQ T;  2Z6K A;  3Q6S A;  4OWX B;  4HCE A;  3I4M H;  1CA5 A;  5IOC A;  5M5X B;  1HZA A;  3K59 A;  5LMN W;  2KBN A;  2M00 A;  4HIK A;  2CKZ B;  2A69 D;  4JI1 Q;  4J15 A;  2F0H A;  4YWL A;  2B63 H;  2E76 C;  4X62 Q;  1QZG A;  4Q5V A;  1LM0 A;  4DR3 L;  3CAM A;  2NN6 G;  3K58 A;  2MFI A;  4R4T A;  3LNN A;  4ZUI A;  3L7Z C;  4RFB A;  2EY5 A;  3KOJ A;  3G7L A;  1S72 A;  1JOK A;  5IWA L;  2R7D A;  2Y0S B;  4K5X A;  5IYC G;  4YIJ A;  1FGU A;  3KUP A;  3TDQ A;  1X3F A;  4IFD J;  2LFN A;  4HIO A;  1N32 Q;  1EWC A;  3I8Z A;  4LFA Q;  4LUV A;  3PIO A;  1BBU A;  2F3W A;  2A19 A;  5IT9 L;  1V9P A;  2MO1 A;  4DR1 Q;  4ZQ3 A;  4OX9 L;  4IUT A;  2RHQ B;  1EY6 A;  3NEM A;  5CBE E;  1A63 A;  3FKI B;  4PMW A;  4KTA A;  2A73 B;  1SYF A;  4KY5 A;  2QW7 A;  4CJ1 B;  4X65 Q;  1LTS D;  5ELD A;  1ROD A;  1EY8 A;  3CKI B;  1R9T H;  1T5E A;  3WOF A;  2NBF A;  1MGS A;  4DK0 A;  3J7A V;  3QJY A;  1HFG A;  1RHP A;  5T1I A;  1HNZ L;  3QWN A;  4A3E H;  5FJ8 G;  4A3M H;  2XVS A;  1GHK A;  2ZJP A;  4C3H H;  4GKK L;  3MVV A;  3GTG H;  1B9M A;  1GHJ A;  2MJ8 A;  5F2D A;  4BXX H;  3E0J A;  2GVA A;  1IKL A;  2KUM A;  1SSO A;  5EJW A;  3TN2 A;  1B2T A;  4UAI A;  1HUN A;  1GUN A;  3KDF A;  2E5L L;  2EVB A;  1E2Z A;  3HOW H;  5IT9 c;  1EL0 A;  1HUM A;  4DXF A;  1OO9 B;  5C44 H;  2DUD A;  1I4P A;  4JG2 A;  1HH2 P;  4OL7 A;  2KJX A;  1JB7 A;  1KAW A;  2ES2 A;  3OW2 A;  4DAP A;  4A3K G;  3CF5 A;  1HNX Q;  4A93 H;  5I6W A;  1F2M A;  3A8I E;  4KHP L;  2AMC B;  2XRS D;  1HPC A;  1NMF A;  1W6J A;  1Q86 C;  1IBK L;  1IBL L;  2ZT9 C;  1DOM A;  1VQI A;  1EY7 A;  2F0J A;  4JOI C;  5IYB G;  3RN2 A;  2SNM A;  1XXG A;  2VQE L;  4OO1 G;  4OX9 Q;  1HA5 A;  1AW7 A;  2OEO A;  3K5N A;  4IFD H;  1Y1W B;  1SNM A;  1QNU A;  4GNX B;  4NMZ A;  3H3V C;  3GO5 A;  2CVR A;  3PIP 3;  4MN3 A;  2K5Q A;  2LSS A;  2KQ3 A;  1ZKO A;  4A3L H;  5AJ3 L;  3W1B A;  3MXN A;  4JI2 L;  5JJI A;  3OSO A;  1QOH A;  4P74 A;  2RHS B;  2JYO A;  1LTG D;  1HNZ Q;  2A6E D;  5C4Z A;  2C9O A;  4EQO A;  3MFY A;  4O1N A;  3K5L A;  1SMX A;  3NBH A;  1YIJ A;  2R3Z A;  1VQB A;  1RDP D;  3DEP A;  3J80 L;  3KJO A;  3QR8 A;  2OWO A;  1JJ2 A;  2DJG C;  5EPJ A;  2HQE A;  5BR8 L;  2IW3 A;  3HOV B;  1Y1V H;  1EFW A;  1VQM A;  1WCM G;  2EYP A;  3T4A C;  2F52 A;  2E5L Q;  3H0G B;  4JVZ A;  2I07 B;  5IT9 E;  3TS2 A;  4NDX A;  2DN8 A;  2YTV A;  3D6W A;  4C3I H;  1EY0 A;  1CHQ D;  5K36 H;  2K28 A;  2Q8R E;  1J9O A;  3T56 B;  2ICE C;  5ISR A;  2ZJR A;  4RCN A;  2JE6 I;  2ENB A;  3F8T A;  3VYT A;  1PVO A;  1Z7T A;  2Y0S E;  1O80 A;  2BA1 A;  2N55 A;  1WI5 A;  3HRZ C;  3J80 i;  1SND A;  4KHP Q;  4A3J H;  3IRB A;  4OHJ A;  4J6H A;  4A3F H;  3HKZ B;  4IFD I;  1BR9 A;  3A7A B;  4UP8 A;  1IBK Q;  1IBL Q;  3FHW A;  1TY2 A;  1SE8 A;  1Q81 C;  4PZ7 A;  2VQE Q;  3C1E A;  1K0R A;  4A76 A;  4G7O C;  4FVM A;  5JEA G;  4K5W A;  1NE3 A;  1VQ5 A;  2A74 C;  1E0B A;  5KIX A;  3AFQ A;  5JVG 3;  3U4Z A;  1GUG A;  4HED A;  1IW7 C;  4V0B A;  2O2L D;  5LHY 1;  5AJ3 Q;  5IIF A;  1NTG A;  4BBR G;  3HKS A;  1YHQ A;  1F9P A;  4YY3 L;  2L1B A;  5G3L F;  1YJ9 A;  3UDF A;  4K2L A;  1YZ6 A;  2UUA Q;  1P16 A;  3P75 A;  3D0F A;  4N8F A;  2R93 G;  4PMB A;  4XTC S;  3R8B A;  3L0O A;  4XDX A;  4QQB X;  4JI7 L;  4L5T A;  3FP9 A;  5E4W C;  1WTR A;  3A54 A;  2HDM A;  4RKL A;  2YTX A;  1RJT A;  4KLK A;  4L5Q A;  3BDC A;  5M5X H;  3P20 A;  1SAP A;  3M4O B;  1V8Q A;  2A69 C;  1BO0 A;  1BXT A;  1FR3 A;  1KLU D;  5T1G A;  4LUO A;  1QVG A;  2I0Q A;  1FNV A;  4FP5 D;  1BBW A;  1U4P A;  1LO5 D;  1WD1 A;  5M3M B;  5KGU A;  2Q8I B;  3H09 A;  3PUW A;  2RCN A;  5ELO A;  3I7F A;  4JI5 L;  3TQY A;  1EWH A;  3W5O A;  2F1M A;  1CZG A;  4JV5 L;  3RN5 A;  1TKW B;  3S15 B;  3M4Q A;  4DV6 L;  1ASY A;  2RF4 A;  3SHL A;  2V4D A;  2X6G A;  4ME5 A;  1KAB A;  1E1T A;  3C46 A;  1LT3 D;  3J7Y W;  1X55 A;  5D3I B;  1JJC B;  4DV3 Q;  3IAY A;  5NUC A;  3LGJ A;  1S5D D;  2NVY B;  4FF2 A;  1EYA A;  1LTA D;  4KY6 A;  4YCV A;  4X64 L;  1JR0 D;  3PGZ A;  1GXD C;  3FKI H;  1STA A;  4ZUJ A;  1PZJ D;  1DZ1 A;  3NTI A;  1WTV A;  4JI0 L;  3E5S A;  1JE5 A;  3I70 A;  5CC4 A;  3PUZ A;  2WKD A;  1K3R A;  4Q0F A;  1IBM L;  3DWA A;  3PUV A;  2WIN B;  2R92 G;  5JOB A;  3VYS A;  3M4Y A;  1YJW A;  3ZYY X;  4C1N I;  4HJ8 A;  2OQK A;  1IXR A;  3FVQ A;  4IPD A;  3F2U A;  4JI7 Q;  3PO2 G;  5CV6 A;  2LMC B;  3I4O A;  3HP3 A;  5JPM C;  1EWI A;  3UDG A;  5CV7 A;  1GUW A;  3H91 A;  1PTO D;  5H1S E;  1VQ9 A;  3CXC A;  3N52 A;  1RF2 D;  3GTJ B;  3CCQ A;  2OXP A;  5LMN L;  1B44 D;  4ZCK A;  3FPP A;  5A2Q E;  4A3G G;  3RD4 A;  2EYM A;  2JA6 B;  1LTI D;  4AIM A;  1B3A A;  2L15 A;  1VQ6 A;  4IUP A;  3CME A;  4JI5 Q;  1STE A;  1PFB A;  4ODG A;  4R9W A;  2LKV A;  1WTX A;  4DAY B;  1ASZ A;  4OEM B;  4R4O A;  1WTO A;  4LF6 L;  3CCU A;  4LFB L;  4DV6 Q;  3M7G A;  4GN4 B;  4DR4 L;  4LMQ D;  1A3T A;  2VL6 A;  1FVI A;  2DNE A;  4DNR B;  3HKZ E;  2K5N A;  1LT5 D;  5M3F G;  4OO1 I;  4A3B G;  3V05 A;  5COR A;  1VMP A;  1NR4 A;  3E0E A;  4JK1 C;  2WB1 B;  2F0L A;  2VXW A;  5C5M A;  3QB3 A;  2FMM A;  4IUQ A;  4X64 Q;  1Y1W H;  1AE3 A;  4MTK A;  1EYC A;  4QJF A;  1VQA A;  3GTK B;  4K0K Q;  4Y7N B;  2AQ1 B;  1XNQ L;  5C4X B;  1WYD A;  4JBW A;  1KTK A;  5IYD G;  1D2B A;  1PYW D;  2KA7 A;  4AH6 A;  2L12 A;  5FKA C;  4JI0 Q;  1SNO A;  4GKJ L;  3I4M G;  1QE6 A;  1OXS C;  2A6E C;  4IUR A;  3VYR A;  2CH4 W;  1HQM C;  1WTP A;  1IBM Q;  4CDD C;  4CGY B;  2VNU D;  4OIJ A;  3H3V I;  3VA5 A;  2XNA C;  3CMA A;  4RHS A;  1EOT A;  5JAV A;  3CRK C;  2K14 A;  2EY6 A;  3WOE A;  2JEA I;  4L8J A;  5EKK A;  2E75 C;  3WDN A;  3Q24 A;  3KBG A;  3DHQ A;  3HOU B;  4CBV A;  1ILP A;  1HHV A;  1KDC A;  1QVF A;  1JT8 A;  3FMC A;  1KNE A;  3E3X A;  4H0L C;  2M2L A;  4TQU S;  1PRT F;  1I6V C;  3K81 C;  2CCZ A;  4QB4 A;  3HOV H;  5IP9 G;  2SEB D;  4MIU A;  3VR2 A;  4H13 C;  1JJG A;  1XMQ L;  2IX3 A;  3H0G H;  5LMN Q;  2HCI A;  1SEB D;  2V1C C;  4KV6 A;  2WII B;  2UXD Q;  1H9J A;  5I2X A;  1T9H A;  2JA5 B;  3NTK A;  2OF1 A;  1L0W A;  1HXY D;  3PV0 A;  1SE4 A;  1XTC D;  2HIV A;  1X3P A;  1PH6 A;  3N6R A;  4QY7 A;  2GA4 B;  2F0T A;  4LFC L;  4DR4 Q;  4N9P A;  2PPB C;  3TS0 A;  5IGE A;  1EQQ A;  2EYJ A;  2K5V A;  4GLA C;  2ASB A;  3OPO A;  3RNU A;  1ENF A;  2NB0 A;  4BBS B;  1A3V A;  4R4I A;  1PV4 A;  1VQK A;  1GJX A;  3S1Q B;  4LF5 L;  2B2T C;  2PW7 A;  4JBM A;  1Y69 U;  4A3E G;  3K6O A;  1SBB B;  3BVZ A;  2K01 A;  4GKJ Q;  4IUV A;  1WD0 A;  4BXX G;  4TSS A;  2B8G A;  1ONL A;  2C35 B;  3TZD A;  2UXC L;  4XXE A;  3OYY A;  1TS5 A;  3HGB A;  5I2Y A;  3F2C A;  4BY1 B;  2VW9 A;  1IKM A;  1Q90 A;  2H4O A;  3A74 A;  2XTI A; 
#chains in the Genus database with same CATH homology
 5E1F A;  3D4D A;  2D62 A;  1CI3 M;  1Q8I A;  1SDF A;  2AWN A;  3NUC A;  1EFI D;  2K03 A;  1ICW A;  1ET6 A;  5ELF A;  3SDZ A;  5EPL A;  4RGT A;  2D9U A;  2ZXP A;  2EY2 A;  2B39 A;  4OGQ C;  3SK6 A;  1PTO B;  4RCO A;  3MA2 B;  1I50 B;  3H94 A;  4PQX A;  4IUU A;  5DEH A;  1LTT D;  3S16 B;  4IFD G;  5AFW A;  1QNK A;  4A3I B;  2B2W A;  4A3D B;  1PXU A;  1OXU A;  5HUR A;  4B9X A;  1EEI D;  1Q90 A;  4C3J B;  2F0K A;  5M5Y B;  4QUF A;  1D1I A;  1LTB D;  1SMY D;  1YNN D;  4HAE A;  2KOL A;  2RBM A;  1SYD A;  3LWE A;  4KD4 A;  2EYH A;  4H7B A;  1K8M A;  3BDO A;  2A6H D;  1QB5 D;  2K7V A;  2F0I A;  3W3A A;  1E2W A;  2B2U C;  3SVM A;  1A6X A;  3BDL A;  4G57 A;  4KD3 A;  2TMP A;  1PTO C;  2Z1C A;  5EKI A;  3T13 A;  3VR5 A;  2YYZ A;  1AEX A;  5C0X J;  4IUN A;  2K1B A;  4HR7 B;  3EQL C;  1EIG A;  4CKB A;  2EDG A;  2EJM A;  1Z47 A;  3I73 A;  1V43 A;  1V1P A;  5I9O A;  4U68 A;  4XT3 B;  4KJN A;  5I9P A;  1MSG A;  4HSP A;  1MD2 D;  4FXG C;  5CMD A;  3NXW A;  2DY8 A;  3FRP B;  4X3K A;  3NPP A;  1BCP B;  1QWY A;  2M9V A;  5C3W A;  1M8A A;  1NUC A;  2F0F A;  3K7A B;  1A2T A;  1B4O A;  3J81 E;  1K83 B;  1H9S A;  3NE5 B;  5DM7 3;  1U4L A;  3MFG A;  3DEO A;  3L9A X;  1F9S A;  1X3Q A;  5JPN C;  1Y8P B;  1RD9 D;  3BVM A;  5DNF A;  4PV1 C;  1HCZ A;  4TKO B;  3GTO B;  2F0S A;  2Q8T A;  1SNQ A;  2XWJ B;  5EQ0 A;  4KJO A;  4RGM A;  2CHB D;  5KYL A;  1GUS A;  4O42 A;  3GTQ B;  4KKS A;  1TWG B;  1BDO A;  4BA1 I;  4C2M B;  3TSS A;  5FO7 B;  2F03 A;  2IT1 A;  2BA0 A;  2SOB A;  1STY A;  5C0X H;  3U9S A;  4C56 C;  2NZ1 D;  3RMH A;  1D5M C;  2NTS A;  3NQI A;  2PQE A;  1B50 A;  5E4X A;  2J4X A;  1JCK B;  1KAA A;  3CHB D;  2NVT B;  2Z4H A;  5LL6 X;  5IOD A;  4K2K A;  3TBI B;  4FYD A;  1LLR D;  2L0C A;  4M1U B;  1F2Z A;  3HS0 C;  2KVM A;  3D31 A;  1CA6 A;  3A8K E;  3PUX A;  1B53 A;  3I91 A;  3R2T A;  5IGF A;  2QDB A;  1E2V A;  5CV5 A;  1U4R A;  3C2P A;  1Y8N B;  1SE2 A;  1BNZ A;  2CQA A;  2D5D A;  3TP8 A;  2F0E A;  1UUP A;  1F2L A;  3M85 A;  3GTM B;  1EY5 A;  4BBR B;  2KCN A;  3K0Y A;  1DXM A;  2LS0 1;  2F3V A;  3MTS A;  2MPM A;  3S14 B;  5C0X I;  3OOC A;  1I4H A;  1SJH D;  3ND9 A;  2NUC A;  2F0M A;  1PTO H;  3A8J E;  1LV9 A;  1STB A;  1R4P B;  5KYI A;  3MXP A;  4KN4 C;  1STG A;  4IN3 A;  5A2Q L;  1BBX C;  4PMC A;  5KRU A;  4L6T B;  1SYC A;  4WRD A;  1SMY C;  2XIW A;  1YNN C;  1S5B D;  1CT1 D;  4KK7 A;  2R61 A;  3OWF A;  1HQR D;  3DWQ A;  3URY A;  1JWS D;  1JOO A;  2A6H C;  1U9R A;  3OIQ A;  1LT4 D;  3VR3 A;  3DM1 A;  2FFK B;  3RZD B;  2JA7 B;  1I4R A;  3FDT A;  3GQB A;  4ABN A;  4KKU A;  4IZ8 A;  2IWH A;  2PMZ B;  3MEH A;  1STN A;  2N88 A;  1I4G A;  5EKL A;  3SXH A;  5CBA E;  1EYD A;  2AUK A;  1OXT A;  2MGS A;  4CHT B;  1XWE A;  4LK1 C;  2PZT A;  2RDG A;  2F0G A;  3HG9 A;  2PZU A;  5E3F A;  3T53 B;  1KDA A;  3IL8 A;  5FO8 B;  4P2C B;  1C8C A;  4K6L A;  3D8G A;  2WP8 J;  3MHB A;  1EZ8 A;  2IX1 A;  3FPU B;  2XSC A;  2I46 A;  3S1M B;  3P7J A;  1FGB D;  5FO9 B;  1S5E D;  1GUT A;  1EQT A;  1YNJ D;  4X3T A;  2OT2 A;  3CQZ B;  3K5O A;  5D3D A;  3OW7 A;  4LJZ C;  1Y8O B;  2AQ2 B;  3EFX D;  2RVL A;  5FOB B;  2AQ3 B;  1CFM A;  1A3U A;  1AN8 A;  3D4R A;  5M3F B;  4H44 C;  4XYQ A;  2RQX A;  4LAA A;  5J1Z A;  2WAQ B;  1CK1 A;  2BOS A;  4BY7 B;  5FK9 C;  1JQY D;  4FXD A;  5JVH 3;  1ML0 D;  3R93 A;  2PW5 A;  3MXG A;  1HA6 A;  1DON A;  5DAU A;  3VA7 A;  1F9R A;  1STH A;  4RGO S;  3SEB A;  1QCB D;  1NSN S;  1LTR D;  1O7Z A;  1SFO B;  3S1R B;  4XT1 B;  2RDF A;  1KLG D;  3SR1 A;  3SK5 A;  2SNS A;  1FYC A;  3S1N B;  1Q3L A;  3S2D B;  3T51 B;  1K8O A;  2B2V C;  4BWG B;  3HOY B;  5DM6 3;  1S4Z A;  2EXZ A;  3H6M A;  2J7Z A;  1JE4 A;  4QF4 A;  2R6G A;  1C4Q A;  4X3U A;  3TP6 A;  1TS4 A;  2QIL A;  5ELE A;  4K8J A;  1KNA A;  4QUC A;  4G7Z C;  5EGT A;  3TP5 A;  1EIH A;  2C5C A;  1ZYR D;  1RKN A;  5M5W B;  2ZXR A;  5I4D A;  1TWF B;  3QOL A;  1I3Q B;  1EEF D;  1CHP D;  3A56 A;  4KKT A;  3HEJ A;  5IGG A;  5M9O A;  5CR3 A;  4RHR A;  3R2I A;  3DWP A;  2IJ0 A;  3GV3 A;  5FLX E;  3RLF A;  4HCS A;  1BCP D;  2JP1 A;  2DY7 A;  3HOZ B;  2G9H D;  4DU9 A;  1EZ6 A;  1TR5 A;  2QF7 A;  1JC7 A;  3J7A F;  2E74 C;  1B9N A;  1O7Y A;  1ENC A;  2X69 A;  1H9K A;  2BDN A;  5C6A A;  2O5J C;  3U9O A;  1SYB A;  2KEE A;  1CTM A;  2FMC A;  3SK8 A;  3KLR A;  4QIW B;  2NVQ B;  4ZLT F;  2RDH A;  4C3H G;  3P1H A;  2CW0 D;  4WOR A;  5CV9 A;  1QIL A;  4RH6 A;  1QG7 A;  1UEA B;  2K5W A;  4B9W A;  2DNC A;  4N9T A;  1VMC A;  2EJG C;  4XQQ A;  2E2J B;  1CZW A;  2A68 D;  2WAC A;  1TY0 A;  1RCV D;  3J81 L;  4ILW A;  1OXX K;  4K8I A;  2FIN B;  1ILQ A;  3MAQ A;  5ELB A;  1WVL A;  1SE3 A;  5C0X G;  2BCO A;  4EQN A;  3OHX C;  5KND A;  3V96 A;  4V19 0;  3SK4 A;  2QKI C;  2K05 A;  4DAY A;  3PO3 B;  1TWH B;  2MUY A;  5HGT A;  5C4J B;  3R3O A;  5C5L A;  2NWG A;  1L0Y B;  1I4Q A;  2K6A A;  4C1N K;  3KLS X;  2XRQ D;  1JWM D;  1VCI A;  1PTO F;  3S9W A;  1YNJ C;  2HCC A;  1CQV A;  1JOQ A;  2B2Y C;  1DOL A;  5TSS A;  1L0X B;  1UAP A;  1EY9 A;  1JB3 A;  2JEB I;  4B08 A;  1XYI A;  2B2T A;  4PNY A;  5CGK A;  4FXK C;  4C3I G;  2EJF C;  5K36 G;  1LT6 D;  1XX8 A;  4E6I A;  1PFN A;  3DMU A;  3A7L A;  3MWY W;  1SNP A;  1KDB A;  2SDF A;  3A55 A;  5J22 A;  3I4N B;  2FHT A;  3KBX A;  5D14 A;  2ID0 A;  2QCP X;  1TWC B;  2EY1 A;  1CM9 A;  3M7N A;  3Q0A A;  4HMJ A;  1G8Z D;  3BYY B;  2F0U A;  5BN5 A;  1SXT A;  3C3L A;  3LWU A;  5G3L D;  4C3J G;  1Q1B A;  1ESR A;  1MBY A;  4TRD A;  3LX0 A;  4HMI A;  4A3K B;  1PDQ A;  3JAM E;  4ZRZ A;  3GP7 A;  3IFD A;  3NSW A;  3K57 A;  2VUM B;  1BCP F;  1ZYR C;  4L63 B;  3E6Z X;  4I65 A;  2K04 A;  1AP0 A;  3KLS A;  3AMU A;  2MHV A;  2O5I C;  3I72 A;  4NW2 A;  5KNC A;  2JSO A;  3EVQ A;  5KEE A;  3BS1 A;  3ERQ A;  2B2Y A;  1TII D;  5J39 A;  1W6K A;  2L55 A;  2F0W A;  2JXM B;  3GTL B;  5EBC A;  3NWS A;  1BCP C;  2B2U A;  5CYU A;  4XQN A;  1TS3 A;  1A2U A;  2NYZ D;  1WCM B;  1Q12 A;  4ID6 A;  2IL8 A;  1TWA B;  3GD7 A;  1VDZ A;  1C48 A;  1T5X D;  4KI0 A;  5ELC A;  2PO4 A;  4M8A A;  1I6H B;  1X32 A;  1NR2 A;  4GZY C;  1BF4 A;  3QOJ A;  3PIO 3;  1F2Y A;  5A35 A;  1R4Q B;  2E2I B;  2F0Q A;  2E2D C;  3X3N A;  1IHZ A;  2CW0 C;  4FF1 A;  3RZO B;  1TS2 A;  4FO2 A;  1ENA A;  3S2H B;  3CU7 A;  1EU3 A;  4DXG A;  2Z4I A;  1SYG A;  2WKC A;  4KHV A;  2A68 C;  3FEW X;  3OMC A;  3I3C A;  3SE0 A;  1FNW A;  1H9R A;  2L11 A;  4HSV A;  3I90 A;  2PCF B;  1PFM A;  1O7L A;  4XQJ A;  2R93 B;  4RA8 A;  1WTW A;  2Z8L A;  4G7H C;  1AFP A;  5C3X A;  4OIK A;  1PLF A;  5EBD A;  2BDO A;  1TQO A;  2EE1 A;  1TU2 B;  1AZP A;  3T16 A;  3MXU A;  4S3S A;  1DJR D;  1PZI D;  2K32 A;  3AB9 A;  2E2H B;  1LAB A;  4NP5 A;  3IFT A;  2EYF A;  1DYQ A;  2NTT A;  3UI2 A;  2NN6 H;  3OIP A;  2EYL A;  2YU9 B;  1TVX A;  2TSS A;  4KMU C;  1QJO A;  3QIA A;  4EQP A;  2F0N A;  4CKC A;  2BE5 D;  3O13 A;  2PNR C;  2R7Z B;  1A15 A;  3OWE B;  2NVX B;  4BA2 I;  3D4W A;  4K5V A;  5C4H A;  1PRT D;  3MZ5 A;  4WJW A;  1VF7 A;  2X6L A;  2EZV A;  1II3 A;  2PZW A;  4CJ0 B;  4IQZ A;  1ET9 A;  3OMG A;  5LL6 S;  5BN3 A;  1GUO A;  1B1Z A;  3M3Y B;  1G2S A;  4K6D A;  1J8I A;  3EJI A;  2R92 B;  4AYB B;  5C3E B;  4J8Q A;  3S17 B;  3TP7 A;  3PO2 B;  2WV6 D;  4HTH A;  4J1M A;  4G4K A;  2KHS A;  3HOX B;  4KHZ A;  4DF7 A;  1FNU A;  2VB3 X;  2JA8 B;  2NN6 I;  2KED A;  4R8I A;  1IL8 A;  1D5Z C;  3NQT A;  4CJ2 C;  2RSO A;  3DUZ A;  3MC0 B;  4A3G B;  5FLX L;  1DD2 A;  1SNC A;  1H9M A;  2XWB B;  3NTH A;  1JIC A;  1SJE D;  3C1F A;  2KCC A;  4QMG A;  3NP8 A;  3PMF A;  5JEA J;  1IYV A;  1AZQ A;  3J80 E;  3GTP B;  1SYE A;  1HTL D;  4A3B B;  4OO1 H;  2F0V A;  2AWO A;  1I4X A;  4ZYS A;  3KF8 A;  2RSN A;  3I4L A;  3EA6 A;  4DGZ A;  1TT2 A;  1PMR A;  2VB2 X;  5JJZ A;  2PYK A;  1G29 1;  3I4M B;  1D6E C;  1S5C D;  2HUG A;  1EQV A;  2EPB A;  3ONA B;  1EY4 A;  3BYT B;  2B63 B;  3HZX A;  2EYO A;  5K5P A;  4KY7 A;  2L4N A;  1DM0 B;  4DNT B;  3BG3 A;  4RWS C;  1RTO A;  2ICI A;  4QCL A;  1ZXT A;  4FF3 A;  2RKS A;  4DA2 A;  4DFA A;  2K5D A;  1HRJ A;  4I7Z C;  3NHH A;  1M4V A;  3ITP A;  4KN7 C;  1DCZ A;  2F0D A;  2FJ2 A;  2L9H A;  4Z9C B;  1D1K A;  1F9Q A;  1V1O A;  5KNB A;  4DAV A;  3VYU A;  3L3O C;  3AU7 A;  1R9T B;  1LAC A;  4CKE A;  5D65 A;  3NBI A;  2F4I A;  5JEA H;  4A3E B;  3NK9 A;  1S5F D;  4F7X A;  4A3M B;  1PRT B;  5CV8 A;  1G2T A;  4C3H B;  3RUZ A;  3G6J B;  3GTG B;  1GOZ A;  2F0O A;  3Q22 A;  3ERO A;  1HTP A;  1JWU D;  1FD7 D;  4WFN 3;  3Q23 A;  3HOW B;  2K33 A;  3QO2 A;  3ND8 A;  5C44 B;  3K5M A;  2AUJ D;  2B2W C;  2O4X A;  3VR6 A;  4F88 A;  4RGN A;  4XYO A;  1RTN A;  4FF4 A;  1Z6H A;  5BN4 A;  4A93 B;  1PZK D;  1VF5 C;  3DXJ C;  1V1P B;  1Q1E A;  3BVG A;  3BZD B;  2XN9 C;  1F77 A;  2L5T A;  3QG1 A;  3X3M A;  2A5H A;  2B8F A;  2BE5 C;  4EGV A;  1OXV A;  3W2D A;  1PRT C;  1G91 A;  1U4M A;  1WTQ A;  2H1E A;  1G6Z A;  5EPK A;  4DK1 A;  1O78 A;  2RA4 A;  5IGC A;  2J0T D;  5CV4 A;  2B2V A;  4ULL A;  4F87 A;  1BUV T;  1H9S B;  1ZEQ X;  4MHE A;  4DN4 M;  3GV6 A;  2EOT A;  4R8N A;  3JAM L;  2LY7 A;  4ZK9 B;  3IKJ A;  5IGB A;  4ZAI A;  1Y1V B;  4IAL A;  3PUY A;  4U67 3;  1JOR A;  1ESF A;  4FNF A;  2ZXO A;  1HFN A;  2QEJ C;  4C3I B;  2IX0 A;  4UDU C;  3NWT A;  3KK7 A;  3D6C A;  1MI2 A;  1IYU A;  4XIG S;  4A3J B;  2KEC A;  1DOK A;  3V2T A;  1CQF A;  1NAP A;  2D2C C;  4A3F B;  4RAU C;  3VR4 A;  4X3S A;  1UNS A;  2MP1 A;  3TZU A;  4RKB A;  2IPK D;  3D3R A;  4BS9 A;  4EVO A;  5IGD A;  3TME A;  4F8M A;  4ZKB B;  4NKL A;  5I6Y A;  2HDL A;  1IW7 D;  4HN7 A;  1EU4 A;  2G9D A;  1BOS A;  3CRL C;  1MSH A;  4ZKC B;  5COY A;  2F0P A;  4K14 A;  1BQQ T;  3Q6S A;  4HCE A;  1CA5 A;  5IOC A;  5M5X B;  3K59 A;  2M00 A;  2A69 D;  2F0H A;  2E76 C;  4Q5V A;  2NN6 G;  3K58 A;  3LNN A;  4ZUI A;  3L7Z C;  4RFB A;  2EY5 A;  3G7L A;  1JOK A;  2Y0S B;  4K5X A;  4YIJ A;  3KUP A;  3TDQ A;  4IFD J;  2LFN A;  1EWC A;  3I8Z A;  2F3W A;  5IT9 L;  4ZQ3 A;  4IUT A;  1EY6 A;  5CBE E;  3FKI B;  4PMW A;  4KTA A;  2A73 B;  1SYF A;  4KY5 A;  4CJ1 B;  1LTS D;  5ELD A;  1ROD A;  1EY8 A;  3CKI B;  1T5E A;  3WOF A;  2NBF A;  1MGS A;  4DK0 A;  3J7A V;  3QJY A;  1HFG A;  1RHP A;  5T1I A;  3QWN A;  1GHK A;  2XVS A;  3MVV A;  1B9M A;  1GHJ A;  2MJ8 A;  5F2D A;  3E0J A;  1IKL A;  2KUM A;  1SSO A;  5EJW A;  3TN2 A;  1B2T A;  4UAI A;  1HUN A;  1GUN A;  2EVB A;  1E2Z A;  1EL0 A;  1HUM A;  4DXF A;  1OO9 B;  1I4P A;  4OL7 A;  2KJX A;  4DAP A;  5I6W A;  1F2M A;  3A8I E;  2XRS D;  1HPC A;  1W6J A;  2ZT9 C;  1DOM A;  2F0J A;  1EY7 A;  2SNM A;  1XXG A;  4OO1 G;  1HA5 A;  1AW7 A;  2OEO A;  3K5N A;  4IFD H;  1Y1W B;  1SNM A;  1QNU A;  4NMZ A;  3H3V C;  3GO5 A;  2CVR A;  3PIP 3;  4MN3 A;  2K5Q A;  2KQ3 A;  1ZKO A;  3MXN A;  3OSO A;  1QOH A;  2JYO A;  1LTG D;  2A6E D;  5C4Z A;  2C9O A;  4EQO A;  3MFY A;  4O1N A;  3K5L A;  3NBH A;  2R3Z A;  1RDP D;  3DEP A;  3J80 L;  5EPJ A;  2HQE A;  2IW3 A;  3HOV B;  2EYP A;  3T4A C;  3H0G B;  2I07 B;  5IT9 E;  4NDX A;  2DN8 A;  3D6W A;  1EY0 A;  1CHQ D;  5K36 H;  2K28 A;  2Q8R E;  1J9O A;  3T56 B;  2ICE C;  5ISR A;  4RCN A;  2JE6 I;  2ENB A;  3VYT A;  1Z7T A;  1O80 A;  2BA1 A;  2N55 A;  3HRZ C;  1SND A;  4OHJ A;  4J6H A;  3HKZ B;  4IFD I;  1BR9 A;  3A7A B;  1TY2 A;  3C1E A;  4G7O C;  4FVM A;  5JEA G;  4K5W A;  2A74 C;  1E0B A;  5KIX A;  5JVG 3;  1GUG A;  4HED A;  1IW7 C;  4V0B A;  2O2L D;  5LHY 1;  5IIF A;  1F9P A;  2L1B A;  5G3L F;  4K2L A;  3P75 A;  4PMB A;  4XTC S;  3R8B A;  4XDX A;  5E4W C;  1WTR A;  3A54 A;  2HDM A;  4RKL A;  1RJT A;  3BDC A;  3P20 A;  1SAP A;  3M4O B;  1V8Q A;  2A69 C;  1BO0 A;  1BXT A;  1FR3 A;  1KLU D;  5T1G A;  1FNV A;  4FP5 D;  1U4P A;  1LO5 D;  1WD1 A;  5M3M B;  5KGU A;  2Q8I B;  3H09 A;  3PUW A;  1EWH A;  2F1M A;  1CZG A;  1TKW B;  3S15 B;  3SHL A;  2V4D A;  2X6G A;  4ME5 A;  1KAB A;  3C46 A;  1LT3 D;  3J7Y W;  5D3I B;  3IAY A;  5NUC A;  1S5D D;  2NVY B;  4FF2 A;  1EYA A;  1LTA D;  4KY6 A;  1JR0 D;  1GXD C;  1STA A;  4ZUJ A;  1PZJ D;  1DZ1 A;  3NTI A;  1WTV A;  3E5S A;  3I70 A;  5CC4 A;  3PUZ A;  2WKD A;  4Q0F A;  3DWA A;  3PUV A;  2WIN B;  5JOB A;  3VYS A;  3M4Y A;  3ZYY X;  4C1N I;  3FVQ A;  3F2U A;  5CV6 A;  2LMC B;  3HP3 A;  5JPM C;  5CV7 A;  1GUW A;  3H91 A;  1PTO D;  3N52 A;  1RF2 D;  3GTJ B;  2OXP A;  1B44 D;  3FPP A;  5A2Q E;  3RD4 A;  2EYM A;  2JA6 B;  1LTI D;  1B3A A;  4IUP A;  1STE A;  1PFB A;  4ODG A;  4R9W A;  2LKV A;  1WTX A;  1WTO A;  3M7G A;  4LMQ D;  1A3T A;  2DNE A;  4DNR B;  1LT5 D;  4OO1 I;  3V05 A;  5COR A;  1VMP A;  1NR4 A;  4JK1 C;  2WB1 B;  2F0L A;  2VXW A;  5C5M A;  3QB3 A;  2FMM A;  4IUQ A;  1EYC A;  3GTK B;  4Y7N B;  2AQ1 B;  5C4X B;  4JBW A;  1KTK A;  1D2B A;  1PYW D;  2KA7 A;  2L12 A;  5FKA C;  1SNO A;  1QE6 A;  1OXS C;  2A6E C;  4IUR A;  3VYR A;  1HQM C;  1WTP A;  4CGY B;  2VNU D;  4OIJ A;  3VA5 A;  2XNA C;  4RHS A;  1EOT A;  5JAV A;  3CRK C;  2EY6 A;  3WOE A;  2JEA I;  4L8J A;  5EKK A;  2E75 C;  3WDN A;  3Q24 A;  3KBG A;  3DHQ A;  3HOU B;  4CBV A;  1ILP A;  1HHV A;  1KDC A;  3FMC A;  1KNE A;  4H0L C;  2M2L A;  4TQU S;  1PRT F;  1I6V C;  4QB4 A;  2SEB D;  4MIU A;  3VR2 A;  4H13 C;  2IX3 A;  2HCI A;  1SEB D;  4KV6 A;  2WII B;  1H9J A;  5I2X A;  2JA5 B;  3NTK A;  2OF1 A;  1HXY D;  3PV0 A;  1SE4 A;  1XTC D;  1X3P A;  3N6R A;  2GA4 B;  2F0T A;  4N9P A;  2PPB C;  5IGE A;  2EYJ A;  3OPO A;  1ENF A;  2NB0 A;  4BBS B;  1A3V A;  1GJX A;  3S1Q B;  2B2T C;  2PW7 A;  1Y69 U;  3K6O A;  1SBB B;  3BVZ A;  2K01 A;  4IUV A;  1WD0 A;  4TSS A;  2B8G A;  1ONL A;  3TZD A;  4XXE A;  1TS5 A;  3HGB A;  5I2Y A;  4BY1 B;  1IKM A;  1NCV A;  2H4O A;  1D5X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...