5CV8A

Crystal structure of staphylococcal nuclease variant delta+phs v23d/t62h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/T62H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv8A00
3P1HA 1STNA 2F3VA 5NUCA 4B9WA 1JOQA 1EY8A 4K5WA 1JORA 1NSNS 4NDXA 4QB4A 2OXPA 2NUCA 3OMGA 3C1EA 3QOLA 2F0WA 3VA5A 5CGKA 3MEHA 3QOJA 5CV5A 4S3SA 1SYBA 4YIJA 3SR1A 2F0LA 4PMCA 2F0OA 4ME5A 5JOBA 4K5XA 4DU9A 5C4ZA 1RKNA 2F0UA 1STAA 2HQEA 4I65A 5CV8A 2PW5A 2F0HA 2M00A 4K2KA 2SNSA 5E1FA 5IGDA 2LKVA 5I9OA 3NP8A 5IIFA 1ENAA 5KIXA 1TT2A 3T16A 3T13A 3C1FA 2SOBA 2F0IA 3MXPA 2F0EA 5CV6A 5CV9A 2PW7A 2F0FA 4K8IA 4KV6A 4TRDA 1A2UA 3HEJA 5EGTA 4IALA 2F0SA 2EY2A 1SNMA 3DMUA 2EYJA 4WRDA 1STBA 1U9RA 2WACA 5EKLA 2PZUA 1SYDA 3MHBA 4OL7A 4KHVA 1EY5A 3SK6A 3V2TA 5C3WA 2KQ3A 4F8MA 5KEEA 3SK5A 4NKLA 2F0DA 4ODGA 2PQEA 1KDBA 4EVOA 1KDAA 3ITPA 5IGFA 3OSOA 5C4HA 3OMCA 1A3VA 5C5LA 2EY5A 2F0JA 3R3OA 4J1MA 4K8JA 4KD3A 2EYPA 2KHSA 4LAAA 4J6HA 5F2DA 3TMEA 4EQNA 2F0PA 2OF1A 3U9OA 4NP5A 5CC4A 3TP6A 2RDFA 4KJOA 4ZUIA 5HGTA 4MIUA 5KYIA 5M9OA 5EKKA 2RBMA 2F0VA 1EY9A 3D4WA 1F2YA 4IUNA 1SYGA 4K2LA 4QF4A 4E6IA 4PMBA 1SNDA 3ERQA 4ZQ3A 4N9PA 5K5PA 4KY7A 1SYFA 3EROA 3QB3A 4G57A 1SNCA 3EJIA 1EY7A 1SNOA 4EQOA 4KD4A 5I6WA 4HTHA 4DF7A 4DGZA 5KGUA 1A3TA 3D6CA 3EVQA 3OWFA 4WORA 1II3A 5E3FA 4ID6A 5IGGA 4KY5A 3NHHA 4N9TA 4K6DA 1NUCA 2F0KA 1STGA 2EYOA 3BDLA 3H6MA 2QDBA 3LX0A 3NXWA 3P75A 4K5VA 4DFAA 2PZWA 3D4DA 2ENBA 5IGCA 2F0TA 1KABA 5IGEA 2F0GA 4F7XA 5IODA 1EZ6A 1EY4A 5J1ZA 4RKBA 3TP5A 1A3UA 5KRUA 3DHQA 4K14A 1EYAA 2O4XA 3D8GA 4QMGA 2PZTA 5CR3A 3RUZA 1EZ8A 2EYHA 4KJNA 3PMFA 1ENCA 5DAUA 3SXHA 5IOCA 1F2MA 1EQVA 5J39A 1SNQA 5CV4A 1AEXA 4HMJA 1EY0A 1SNPA 4HMIA 2F0QA 1KDCA 5I9PA 5J22A 1EYCA 1EY6A 5CV7A 4R8NA 1A2TA 4ZUJA 3BDCA 2F0NA 5HURA 4EQPA 3SHLA 4RKLA 1STHA 1EYDA 2EYLA 2F0MA 2PYKA 3TP7A 3MZ5A 5C6AA 4KTAA 3NK9A 3SK8A 1SYCA 1KAAA 3SK4A 2OEOA 1TR5A 1IHZA 2SNMA 2EY6A 3HZXA 3TP8A 2EYMA 4KY6A 1TQOA 5JAVA 4PNYA 4B9XA 2EYFA 3E5SA 3MVVA 1F2ZA 4H7BA 5C5MA 1JOKA 5C3XA 3S9WA 3NQTA 5ISRA 5IGBA 4NMZA 1STYA 2RKSA 5KYLA 4IZ8A 1JOOA 5DEHA 5I6YA 2EXZA 3NUCA 2F3WA 1SYEA 2EY1A
chains in the Genus database with same CATH superfamily
4KN4C 2DN8A 1HZ9A 2ZXOA 2NVTB 2GVBA 4UAIA 2G5DA 1DJRD 3C1EA 4IJLA 5IYDG 3DLLA 4YIJA 1YITA 1ONLA 1I4RA 1BQQT 4DPGA 2XGTA 4X3TA 3KYHC 3URYA 2A6EC 2EIFA 4DAVA 1SBBB 2N88A 1F9PA 5JJIA 1I3QB 2QW7A 2OCEA 3CCSA 2JA5B 3TBIB 1PH1A 3IL8A 1YIJA 4DV2L 1LTID 4MN3A 5TSSA 5IT9c 5IWAL 1EU3A 2E2DC 4YWMA 3EFXD 4FP5D 3S1NH 5FLXc 2VUMG 4IUNA 1SYGA 4LFCQ 4A75A 3BU2A 2KHJA 4RMFA 1H9RA 2RCFA 5C0XG 1RDPD 2L15A 1A3TA 1N33L 4BBSG 4X62Q 4KY5A 4JI7Q 4O0AA 2F0KA 1V1PB 1RF2D 2PZWA 1DXMA 2M9VA 2X69A 5FLXL 3DEOA 4IFDI 2OTJA 3AB9A 3IKJA 4A3KG 2E2HB 1PTOD 2WAQG 1Y1VH 1TWFB 4JI8Q 4OHJA 3CW2C 3NBHB 2K14A 1CQFA 3ND8A 2F0QA 1SRUA 2JA6B 1HNWQ 3K5LA 2R92G 4JI4L 1QZHA 3FDTA 2EE1A 2UUCQ 3BVZA 3CHBD 3K7AB 3GTLH 2IW3A 2KA7A 4EX5A 5CBEE 1D6EC 5HGQA 2F52A 3TP8A 3I3CA 3T56B 1FR3A 3B6YA 4KMUC 4B9XA 1S3OA 3S2HB 1TWHB 2I5LX 1GXDC 4IUTA 2K50A 1IXRA 3G48A 4OO1I 5DEHA 4A3JH 1I50B 1XPOA 1VDZA 1SLJA 1RTOA 4FF1A 4L8JA 2HCIA 2X6GA 1JJGA 2O5JC 2VQEQ 4K0KL 3ICEA 1Z7TA 3PO2B 2Y0SG 3X3NA 4X65Q 4QUCA 1U4LA 3CXCA 2ASBA 1CKNB 2BDNA 1JB7A 1NY4A 5M5YB 3T13A 4X62L 2SOBA 5C3EH 3FHWA 2H4OA 1CUKA 4GLVB 4PQXA 1G91A 4LUZA 4GS3A 1OXXK 4KHVA 1B44D 1J6QA 5JPNC 1B9NA 3I4LA 3E9IA 4NKLA 1KDBA 1EIYB 2NVXH 5BR8Q 3GTQB 4EGVA 2K01A 5EPLA 2VUMH 2JYOA 1JICA 1MD2D 3CCJA 1WTRA 1GHKA 2OF1A 1SXTA 1CZGA 1D1KA 1G8ZD 1O7LA 2Z6BA 4A3BG 1PRTD 1HQMC 5C0XH 2CVRA 4IURA 1K73C 2VW9A 4G57A 1B1ZA 5FO7B 2FMMA 1C0AA 1ENFA 3KLRA 4OIKA 3U9SA 4WORA 2E2IH 5D14A 5E3FA 4ID6A 3NHHA 3TREA 4DR5L 1F77A 4A3KH 2JA9A 4BS9A 1HZAA 3PF4A 4F7XA 4C3IH 1JQYD 1JB3A 1N32L 4NXML 5CR3A 2OT2A 3RZOH 4BY7G 5JVG3 4CBVA 4LF4Q 2F4VQ 3M3YB 2K32A 5IP9H 1E22A 2DNEA 3GD7A 4A3EG 1Q3LA 4OELB 1PHJA 2UXDL 3LWEA 3QR8A 2VZAA 3SK4A 3TZDA 1IKLA 3PIPA 3ER0A 4PNYA 4B3ML 3CKIB 1E2WA 5M5XH 3HOXB 3U4ZA 1E0BA 4IN3A 2RF4A 4UP8A 1KAWA 2A69C 5EKIA 4DR7L 1CQVA 3NUCA 1QNKA 4CKEA 1FNWA 1TVXA 4YCVA 4N8X1 2OQ0A 3S15H 1WD1A 4BA1I 3FKIG 3TS2A 3I4OA 1H9JA 4WJ3M 4B3RL 3F2CA 1D5MC 5M3FB 5ELEA 3Q24A 2F0UA 3BZKA 3GTJH 3DUZA 4QIWB 1HNXQ 2KVMA 1PTOH 2HDMA 3HOZH 4AYBG 3Q0AA 4JCVE 3NEMA 4LF6Q 1DONA 4KV6A 1IL8A 2F0FA 5I2XA 4HJ9A 4IFDJ 1NAPA 3E0EA 1STBA 4HIOA 1WTPA 1Y69U 1EY5A 2UUAQ 1H9SB 2XRQD 3PO3H 1U4PA 5EAYA 4LF4L 5AJ3L 2ZXPA 2KENA 3OMCA 3W1GA 1PFNA 5KNDA 1Q90A 1X54A 4A3BH 1UEBA 2R93B 1W6KA 2RCNA 1FNVA 1JWSD 3O13A 4DUYL 1KLGD 1XNRQ 1CTMA 1B2TA 1B50A 1YNJC 2K6AA 4JI1Q 2ICIA 4KHPL 1Y1WH 3F2DA 1K83B 2XVSA 3TZUA 4PG3A 3A0JA 1NR4A 5IGGA 1PFSA 1BF4A 4J8QA 1STGA 3M4QA 4IPCA 2QILA 2JA5G 2JEBI 4V0BA 4OX9L 2QEXA 3VYSA 4LF8Q 3M7NA 4GNXA 1VQKA 2BE5C 3KOJA 3P20A 4TQUS 1M8AA 4A3EH 2ZJQA 2N8NA 1KRSA 4DNIA 2HHHL 2JE6I 3RLNA 1Y8NB 3C3LA 3I4MB 2ZJPA 4JK1C 3CPFA 5GAHC 1LTSD 3F2BA 2K5DA 1TQOA 4JPBW 4MTNA 1STEA 1ESRA 2B39A 1QUQA 2OWOA 5KYLA 3CAMA 2AUJD 2EXZA 2D0PA 1GUOA 1LACA 2F3VA 4GOPB 1W3SA 3PUXA 1NSNS 3R2IA 1X3GA 5GADC 2Z6KA 1EL0A 1EWIA 3VA5A 3ND9A 1SEBD 3AYHB 5E7NA 4LNQA 1SYBA 2WKDA 1C8CA 1L1OA 2CQOA 5LMNQ 2HQEA 5K36G 5E1FA 1PZJD 2M00A 1BCPB 4PZ7A 5I9OA 2CW0C 4DN4M 4YHHQ 2A19A 2QCPX 5FJ8G 3ZYYX 1N8RC 1A2UA 1HTLD 4DV0Q 2EYJA 3W3AA 5EKLA 2R61A 4UPAA 3SK6A 3G6JB 2NVTH 2KHIA 3OTOQ 1HA5A 2FHTA 4DR6L 1MGSA 1LABA 4CGYB 4LUOA 1B4OA 2EOTA 2EY5A 2LFNA 1RTNA 1CZWA 3Q8DA 5J22A 4FYDA 3PO2G 3HKZE 1VMCA 4MIUA 4M1UB 2JEAI 2NBFA 1VQHA 3ULJA 1AZQA 1SNDA 1BDOA 4BBSB 5JEAH 1I3QH 1I94L 3EROA 3DXJC 3I55A 4DF7A 1AN8A 4BBRB 2JA5H 2GVAA 4XQNA 2AUKA 3L3OC 2F03A 2N3SA 5EPJA 3TS0A 1GJXA 2VXWA 1BKBA 2HQLA 2XWJB 4FF2A 3UDFA 4LF9Q 4IOAA 3GP7A 4GNXC 1PTOC 2R92B 3DWAA 3HRZC 1SNQA 4L5RC 1BXTA 1VQEA 1FJGL 1EY6A 2NN6G 2FINB 2IX1A 1BBWA 2F0MA 2PYKA 4JI2Q 4JI6L 1SYCA 4B08A 3F8TA 1UE5A 5ELOA 3M4PA 4OEMB 1PYBA 4NXNL 4DV6Q 3S9WA 2CKZB 1SDFA 1K28A 4YY3Q 2E2HH 3TN2A 3VR5A 2AMCB 4DXFA 3OW7A 1VQAA 2VL6A 2YTYA 1TWFH 1SSOA 1LTRD 3I4NG 4A3GH 4B9WA 1ASYA 2Y0SB 5IP7G 2JA6H 3QIAA 2AQ1B 1LT5D 2EQSA 4P72A 1WTVA 4JI5L 5K36H 2Z6KC 3D0FA 4QY7A 3RMHA 1FGBD 1X32A 5JOBA 4OWWB 1FL0A 1I6VC 1K8OA 1L1OC 2F0HA 3S2HH 4HJ8A 1NBWA 1SE2A 1TWHH 2GN5A 2R7FA 1M4VA 3S2DB 1YVCA 4POFA 3F2UA 1F9QA 1XNQL 1G291 1I50H 2IPKD 3JAMi 2JA7B 3L9AX 1SNMA 5J3BA 3A5UA 3HOXG 2A68D 3K59A 3V2TA 1UNSA 4LFAQ 5KEEA 2L9HA 2Z0SA 2F0DA 2PQEA 4ZAIA 3ITPA 2A6HC 3KJOA 2QA4A 1DD2A 3PO2H 3FPUB 1EIGA 3F1ZA 3GTOB 4RGNA 2L4NA 4RH6A 4NB3A 1IW7D 1VQ4A 4NP5A 2RDFA 5M9OA 4DR3Q 2RBMA 2K7VA 5M5YH 2VS1A 5K5PA 2F3IA 1LO5D 5FO8B 1PH7A 3HOVB 4G4KA 2DNCA 3EJIA 1EY7A 1SNOA 4QL5A 1MKHA 3D6CA 3OWFA 2DJGC 1IBML 1XPRA 1ZEQX 1V43A 1I5FA 4K5XA 4IUUA 3D6WA 3NXWA 4K5VA 5M5WB 1Q46A 4BY7B 3PCOB 2RHSB 1KIXA 1MHWC 3GTQH 1CI3M 1UWVA 1EFWA 4PMWA 3OIQA 1B3AA 1X3PA 1EYAA 1NTGA 1VF5C 2IL8A 2NN6H 1EZ8A 2VB2X 5CORA 3ERSX 4GKKL 1L0YB 3PUYA 1GUTA 4FNFA 5I2YA 1YJ9A 2R93G 1IBKL 4MNOA 3BDCA 3TDQA 3OPOA 2MO1A 2D0OA 4P74A 3A7LA 4OIJA 5L37A 1KC8C 1S72A 3N52A 3VA7A 3D4RA 5IYCG 1T5EA 1G2SA 3HZXA 3AQQA 3MVVA 2C9OA 2Z4IA 1X56A 2V4DA 5DM63 4DV2Q 1VQ6A 2PNHA 3BVGA 3FKIB 1D8LA 4RGOS 1BCPD 5ELBA 1SAPA 4FDBA 1WCMG 5IWAQ 5IT9E 2Q8RE 3BYYB 4K5WA 3M3YH 3PSIA 2E76C 3CCQA 4RGTA 3PUZA 2OXPA 3HOYH 4R4TA 2ZXRA 1Z9FA 4DR3L 3QOLA 4C1NK 3S24A 5CV5A 3VYTA 4AYBB 5C4ZA 4NW2A 4I7ZC 1VQ9A 4C3JB 4GZYC 5CV8A 1I4PA 4HJ7A 5KIXA 1TT2A 1N33Q 3HOXH 2RDHA 4TRDA 1SR3A 3MEFA 4G7HC 4A3LH 2UXBL 5EGTA 2A1AA 4WRDA 1U9RA 2WACA 3PIO3 2TMPA 4QCLA 4KLKA 1OXUA 1X9NA 1BBXC 2R3ZA 1S5ED 1VQOA 1A3VA 2F0JA 5M3FH 4J1MA 5C4XG 3A8JE 3M4OB 3I91A 2KHSA 2Q8TA 2H1EA 4JI4Q 4ME3A 2AHOB 1B9MA 4KKUA 1NNXA 1YNNC 5CC4A 1N34L 1UE7A 3CCMA 1ET9A 4HJAA 1EY9A 4E6IA 2D2CC 2LSSA 4N9PA 1BBUA 1HZCA 3WDNA 3QB3A 3HG9A 2L55A 5IYBG 4EQOA 3IAYA 2ALYB 3GTPB 4ABNA 3S1MB 3RNUA 1O80A 2QDBA 2WP8J 4DK6C 2ENBA 2F0TA 5IGEA 2R93H 3RLFA 3GTKB 3S17B 5IE8A 4QMGA 2EYHA 1W2BA 1ENCA 3SXHA 4K0KQ 1N36L 1JMCA 1PLFA 1CSPA 4CJ2C 3NSWA 5IT9L 1CT1D 1E2VA 4YCWA 1STHA 1XWEA 3X3MA 2PMZE 2EPBA 1K83H 2ZTDA 2OEOA 1RHPA 4P73A 1Q82C 1BOSA 2EJFC 1HXYD 2XWBB 3HP3A 4BBRG 3K8AA 1LT6D 5CMDA 1C7YA 2LS01 2L5TA 3E3XA 2X6LA 5C3XA 1JT8A 2NVQB 3MXGA 2VY3A 3IFTA 4R4QA 2QDLA 4CKBA 1EZ6A 1SYEA 2WAQE 4GN3B 1GO3E 3HOWB 1P8LA 1E24A 4HIMA 2D5DA 1YJNA 2HD3A 2DGYA 4JI0L 3RN2A 3I4MH 2RQXA 1VQDA 3MXUA 3Q23A 3J81E 4I65A 2B2YC 4K2KA 4R1JA 3KK7A 1I4GA 1WD0A 5CV9A 3MXPA 4DR5Q 3SE0A 1KRTA 1BO0A 1HPCA 2PZUA 5IYDH 3SDZA 2WINB 5C3WA 1N32Q 1G6PA 3BJUA 4NXMQ 1EEID 4ODGA 3H94A 1EOTA 2Z4HA 1DOKA 3UDIA 3ZJYC 4A76A 4KD3A 3LNNA 3STBC 4J6HA 1ICWA 3P7JA 2UXDQ 1CSQA 4DNRB 4B3SL 2VB3X 5C44B 3IRBA 4XT3B 4F87A 1SN8A 1EU4A 4DV7L 1VQLA 4B3MQ 2R7ZB 3L7ZC 5T1GA 3HKZB 1DOMA 3EVQA 2N55A 1II3A 1X3EA 3Q22A 2VNUD 3GDEA 4DR1L 2JA7G 1NUCA 3PGZA 4DR7Q 5IGCA 2ZM6L 1RODA 2JA8B 4C3HB 4Z9CB 5BN3A 1X3FA 4BY1G 3E0JA 2H5XA 4B3RQ 1Q8KA 1AW7A 4LF7L 3J81c 4FF3A 1EY0A 4DA2A 2NZOA 2R6GA 4BBSH 4R8NA 1FD7D 1V9PA 1XMQL 3M4YA 4GOPA 2ATWA 4DAYA 3MTSA 4BBRH 1OXTA 2K5WA 3HOVG 4L5SA 1IHZA 3ONAB 4LWCA 1LTAD 2HT1A 1C9OA 3I56A 4GLXA 3NENA 3I4NB 3BS1A 1O7IA 3J81L 1FVIA 2NYZD 3PQIA 1YJWA 1IYJB 3FVQA 2R92H 5AJ3Q 4POGA 4X6AH 2D62A 4DR4L 4KN7C 3EA6A 1STNA 1K3RA 1EY8A 1K0RA 4RHRA 3JAMc 4DUYQ 3U4VA 1SMYD 1IZ6A 1XMOL 3T1HL 3DEPA 2K33A 2ID0A 4S3SA 1WYDA 3M7GA 4ZYSA 3JC66 1QILA 5EJWA 2FMCA 4KHPQ 2UXCL 1DYQA 1Q81C 3NP8A 2N49A 4A4IA 4DNTB 3WOEA 1PH5A 1NCVA 2L12A 3HEJA 1PTOF 1EIHA 4OX9Q 4IPHA 2BCOA 2A68C 3L0OA 3OWEB 5GQOA 2EVBA 2QGQA 3CCRA 1E3PA 3MXNA 1SROA 3CQZB 1OTCA 1QJOA 2XIWA 4LF5L 1JJCB 3QWNA 2KEEA 1S5FD 3BG3A 3R3OA 1IW7C 2HHHQ 3N6RA 1LUZA 5FK9C 3I73A 3VDYA 2K04A 3J80i 2K28A 3S2DH 4C3JG 3L2PA 1A0IA 3EIVA 5A2QE 1S5DD 1XX8A 1VQPA 2JA7H 1CHQD 4JYAL 5ELDA 2GA4B 3NTIA 4H44C 1CKOA 3P75A 2PI2E 4DFAA 4DV5L 3UE1A 1TS5A 2IJ0A 3QO2A 3GTOH 1PH6A 1KD1C 3A74A 4C1NI 1D5ZC 2O4XA 2K52A 3RUZA 2I0QA 4HAEA 3H3VH 3D31A 1AEXA 4A3DG 4HMIA 1X55A 3HOVH 4L6TB 4UP9A 3SHLA 5BN5A 4GOPC 3TP7A 3CCVA 1I6HB 5EQ0A 1K8GA 1ICFB 4A3CG 3CCLA 4FXGC 5M5WH 4BY7H 4DK1A 4APVA 2EYFA 1WCMB 4A3IG 2BH2A 5ISRA 2A6ED 2BH8A 4X3SA 5ELFA 1TIID 4DR6Q 1BCPC 2DY8A 2NZHA 3AFQA 3K0YA 2EY1A 1JE4A 1PRTF 3MA2B 4Y7NB 1BUVT 4DV4L 1GOZA 4WJ4A 5DNFA 3A5ZB 2WB1B 4IFDG 3PIP3 4PV1C 1DOLA 4GN5A 1EUJA 4DK3C 1EWCA 3CD6A 1IKMA 1VQBA 2MNAA 2F0LA 1Q7YC 5LMUL 1I94Q 4A93G 3HGBA 4X66L 1ENAA 1Z47A 4XYQA 3MAQA 2ZTCA 3C1FA 4IUPA 1WVLA 4HIKA 3FKIH 5JVH3 3KF6B 1JWMD 2EY2A 2BDOA 3CPWA 2AQ3B 4BXXG 5A2QL 3NTHA 2NWGA 5C4XB 2K1BA 2D9UA 1YZ6A 4OO1G 4L5QA 2RVLA 5IGFA 3K5NA 4B3TL 3HOWG 1JC7A 2I5MX 3J7AV 3M9BA 1FJGQ 4K8JA 4TVAB 4A3FG 3TMEA 4R9WA 4C3JH 4JI6Q 2JXMB 3RZDB 4PMBA 1MJEA 1TWCB 1U4MA 3TRZA 2YTXA 4CJ1B 1HNZL 2C5CA 4NXNQ 1Y14B 2B2VA 4RCOA 2AWOA 4KI0A 1R9TB 1G6ZA 1WOCA 2UUBL 1QCBD 1KABA 3A55A 2QKIC 1QOHA 2B8FA 1D1IA 5KRUA 3M4OH 1OO9B 5M3MB 2K4KA 3H0GG 4JI5Q 5J39A 3T1YL 4BA2I 1CKMA 4YCUA 2ZJRA 3RD4A 5DLQE 2KBNA 5D3DA 4C56C 3UE0A 1UE6A 5GAEC 2F0NA 3KFUA 3A56A 1QVFA 1GHJA 1S4ZA 5C44G 4KTAA 1HCZA 2IHFA 3GTPH 2WKCA 1TR5A 1XNQQ 5C4JB 4FXKC 1SE3A 4X64L 2R7ZG 2EYMA 5G3LF 3HKZG 3A8KE 5E4WC 3AEVA 2Q2IA 1TS2A 1JOOA 3KUPA 3S14B 3S17H 5H1SE 3VYUA 2JA8G 4IFDH 3S16B 2IY5B 4C3HG 1QG7A 4RWSC 2PI2A 1F9RA 4QB4A 2PQAB 2LXKA 5CGKA 4YWKA 2CHBD 4QJFA 1ET6A 5C0XI 5E4XA 2E75C 4DK0A 5IGDA 2LXJA 3K57A 2LKVA 3J7ZC 4DV1L 2K03A 3RLOA 3T16A 1K8AC 3RR5A 1IBMQ 4R4OA 4BXXH 1PFBA 2NVQH 4RAUC 3S1QB 3H3VC 3CF5A 4OO1H 3HOWH 4G7ZC 1UAPA 1KNEA 4JI3L 3CC7A 1HR0W 4GKKQ 3K6OA 1Q1EA 5C4HA 4OXPA 2A8VA 3K7AH 4CDEC 3VR4A 1HRJA 1IBKQ 4ZK9B 1BVSA 1QB5D 2LMCB 2Z1CA 5FJ8H 4JBMA 4LFBL 2F0PA 3U9OA 5KYIA 4ZUIA 5HGTA 2PPBC 4JV5L 3T4AC 1O7YA 3KJPA 4DV3L 1VCIA 2LY7A 3EBEA 4HTHA 3M85A 1W6JA 4OWXB 2NVYB 2B2TA 4NPSA 3GQBA 2CH4A 2B2VC 4R4IA 3UDXA 3H6MA 1T9HA 2I07B 3VR3A 1TKWB 3G7LA 1SFOB 4BY1B 3FPPA 2WFWA 1V1PA 1VQMA 3BDOA 4FVMA 3I8ZA 3TP5A 3MFGA 3NWTA 4IPGA 4GKJL 5D3IB 1TWGB 2A69D 3E9HA 3CP0A 4X3KA 1PRTC 1UEAB 1QZGA 1DZ1A 4X3UA 2K5QA 1EQTA 5C44H 1SNPA 2M2LA 1PV4A 2CWPA 3NBHA 1QWYA 1H9MA 1LYLA 4QIWE 1GM5A 3G6EA 4RKLA 2VQFL 2R7ZH 3MZ5A 2B8GA 1SMXA 2MQHA 4H0LC 3U50C 3HFZB 3PIOA 3K58A 1CA5A 3C2PA 2HDLA 2EY6A 2UXBQ 1QUQB 2JA8H 4H7BA 2YU9B 2EDGA 4C3HH 1A8VA 3HS0C 2XRSD 3V05A 1LTTD 4C2MB 1HHVA 4A3MB 3I70A 4RG1A 4ZUJA 3EN2A 3KLWA 1Y1WB 1OXSC 1JOQA 1D2BA 1R4PB 4UDUC 2IX0A 3GTGB 1JWUD 1SMYC 1UE1A 3NPPA 1N34Q 1L1OB 2KCTA 2KCCA 3H3VI 3S1RB 2ES2A 5I4DA 1VQCA 3OOCA 3NELA 5JJLA 2SNSA 1IBLL 1CKNA 3I4NH 3WOFA 3HOUB 5IP7H 1CM9A 1YNJD 2RA4A 2B63B 1L0WA 2BA1A 3W5OA 2WIIB 4F8MA 1HQRD 4F88A 1T5XD 1TU2B 1IL2A 1KDAA 2MHVA 1LLRD 4V190 1N36Q 1CHPD 5C5LA 2WB1G 1TWAB 1PH8A 2E5LL 1S5CD 2B2YA 3GTMB 2JK8A 2BE5D 4MTKA 5I6YA 1VS0A 3VYRA 4AQYL 2NB0A 4HEDA 2NZ1D 1M90C 4HSVA 3OYYA 4ILWA 1PDQA 1NR2A 1Y1VG 3BZCA 4ZCKA 4KD4A 2XNAC 3W1BA 2EZVA 2K5NA 3SVMA 2G9DA 5CYUA 2B2TC 5JPMC 3CQZH 1DGSA 3CC4A 4HSPA 2F0GA 1Q86C 5J1ZA 2JN4A 4A3DB 1U5KA 2F4IA 4UP7A 1B8AA 2AWNA 1YBYA 3PMFA 4JI0Q 1EQVA 4XQQA 3CMEA 5D65A 5C0XJ 2WV6D 4A3JG 1KDCA 1EQRA 2CWAA 1HTPA 4TSSA 1I4QA 4K6LA 1V1OA 2CQAA 2OTLA 3NK9A 2OQKA 4A3IB 2KCMA 2IWHA 2I5HA 5AFWA 1MIUA 2L0CA 2FFKB 3I90A 3PUWA 2MJ8A 2Q2HA 2CW0D 1E2ZA 4Q0FA 3DWQA 4UHVA 1QNUA 1TS4A 1JR0D 3MWYW 3TQYA 5C3EG 5HY6A 5M3MG 1FNUA 2XN9C 1TY2A 5IYCH 2JJQA 4A93B 2V1CC 2FXQA 1O78A 1X3QA 1HR0Q 4ZLTF 3MEHA 1I6HH 4GN4B 4B3SQ 3SGIA 3SR1A 4PMCA 2F0OA 4ME5A 1P16A 4HCEA 1RKNA 1HH2P 1J5EL 2E74C 1STAA 1PFMA 4DV7Q 2UU9L 3QJYA 1ZYRD 1WCMH 2F0IA 1WTHA 2F0EA 4DR1Q 1VQGA 2PW7A 1SJHD 4K8IA 4IALA 2ZM6Q 3DMUA 3K80C 1SYDA 2IHEA 4Y7NH 2RSOA 1VF7A 1L0XB 4A3FB 1CA6A 4QUFA 4CDCC 2Q2TA 3OIPA 1H9SA 4LF7Q 1MI2A 4HCSA 4XXEA 2EYPA 4XQJA 4RCNA 4UY8C 1XMQQ 5F2DA 4C3IG 2ZTEA 4A3GB 1YHBA 1Q12A 1F9SA 1SNCA 1BCPF 1PZKD 2MUYA 1DM0B 1TXYA 2KJXA 1RCVD 5IP9G 3LGJA 1EWHA 2BOSA 4K6DA 5C4XH 3BDLA 4L5TA 4PZ8A 4KKTA 3KDFB 1H9KA 3GV3A 4L63B 3H0GB 4DR4Q 3KBXA 1PH3A 1EY4A 4U68A 2Y0SE 3Q6SA 3H09A 1A3UA 3BZDB 4XIGS 4K14A 3D8GA 1VQ7A 2E2JB 3FMCA 2MGSA 1XMOQ 3I72A 3JAME 3T1HQ 1HR0L 5IYBH 5CV4A 3RZDH 4HN7A 2BA0A 4M8AA 1XTCD 1TWCH 1A62A 2UXCQ 2MPMA 4EQPA 3BYTB 2CH4W 4Y52H 1L2FA 4CDFC 4LFCL 1R9TH 4QQBX 1LTBD 3NBIA 3W2DA 2YTVA 3E5SA 3G4SA 1LTGD 4JI7L 5DM73 5M3MH 3T51B 1TY0A 2B2UA 4LF5Q 3HOZG 4FO2A 2KCNA 3A8IE 3P1HA 1PXUA 3K5OA 2ICEC 2JP1A 1G51A 3KF6A 1BR9A 1GKHA 1MBYA 4O1NA 2EJMA 3R8BA 4I7AA 1R4QB 4JI8L 1QVCA 2A6HD 4LJZC 1D7QA 3KF8B 5LMNW 3IFDA 4DU9A 3TEHB 3PO3G 3R93A 5C4JH 1HNWL 1X65A 1JCKB 2PW5A 4JYAQ 1V8QA 2UUCL 3A7AB 4BWGB 1G2TA 2L1BA 2QEJC 3S14H 2B29A 4DV5Q 3S16H 5JJKA 2SEBD 1AE2A 3MHBA 3UI2A 4O42A 4A3MG 1WFQA 1Y1WG 4G7OC 2NN6I 4QGUA 1EQQA 5BN4A 1FGUA 4EQNA 3MC0B 3TP6A 4KJOA 4FF4A 5EKKA 2VQEL 2F0VA 4DR2Q 2HIXA 1A6XA 2I46A 4ZQ3A 4KY7A 4X65L 3JAML 3S1QH 1MSGA 2A5HA 4XYOA 3KLSA 3HOYB 2KUMA 2Z9HA 1B7YB 4DUZQ 1GUWA 1HFNA 1VQFA 2XSCA 3AMUA 4JBJA 3HOUG 1U0LA 2B63G 1Q1BA 1GD7A 4P71A 1SE4A 1WI5A 3LX0A 1NMGA 3D4DA 1XJVA 3H15A 1PH9A 4DV4Q 1F2LA 2PNRC 3DHQA 1B70B 3ULPA 1O7ZA 3PUVA 4KJNA 5DAUA 2NTTA 1RJTA 5BR8L 2DJFC 1NJIC 1C48A 4CDDC 4HMJA 4IQZA 4AYBE 2K05A 5JEAJ 5LMUQ 2PCFB 5FO9B 1EYCA 4Q5VA 1A2TA 5HURA 4MZ9A 2P5ZX 2RSNA 4RGMA 3A54A 4X66Q 2NVYH 2PQAA 1KAAA 5FKAC 2B3GA 5FLMG 4ALPA 1DCZA 1SFOH 1J8IA 2J0TD 4BY1H 3CRLC 3FP9A 2J7ZA 2L11A 3PF5A 1TWGH 1E7ZA 4B3TQ 3AFPA 2B2UC 3HKSA 1HUNA 3CU7A 1B53A 1JORA 1YEZA 4N8FA 1AZPA 1AH9A 2RDGA 2YYZA 2DUDA 5G3LD 2F0WA 3FRPB 1NE3A 4RHSA 4JG2A 4DR2L 2F4VL 1VQJA 1PZID 1ASZA 1HNZQ 3S1NB 5LHY1 1ILQA 1YNND 4DUZL 4WJWA 2YU9H 4XT1B 1Q8IA 2UUBQ 4C2MH 1ML0D 4A3MH 2EXDA 1ZXTA 2CCZA 1PH2A 5JEAG 4IJHA 1Y8PB 3R2TA 2KQ3A 3GTGH 2Z8LA 3SK5A 2A73B 4JVZA 1WTXA 2K5HA 5ELNA 3CRKC 4LMQD 5EBDA 3T1YQ 4P2CB 1M1KC 1EEFD 1EYGA 2CFMA 3S1RH 4LAAA 5ELCA 1RD9D 2MO0A 2E8GA 1EFID 3I2ZA 1Y1VB 4JOIA 2KECA 2RHQB 1PH4A 1I4HA 3D4WA 3ERQA 2HUGA 4J15A 2DY7A 2F1MA 3HOUH 4X64Q 2B63H 1ILPA 2XTIA 2Q8IB 1HNXL 5LL6S 4DGZA 3CMAA 3GTLB 2JSOA 4RFBA 3BVMA 4LF6L 1CK1A 4WFN3 1U4RA 4R4CA 1K8MA 1S40A 1TWAH 3K81C 4A3JB 2UUAL 3GTMH 2PZTA 1F2MA 1QE6A 1A15A 4OWTB 4DAYB 5CV7A 5JJZA 5T1IA 1NMFA 2HCCA 1KLUD 4YWLA 5FLMH 1XXGA 4A3GG 3EQLC 1XNRL 4DV1Q 1I4XA 2JA6G 2O5IC 4JI1L 1WTOA 1CFMA 3ULLA 3WWVA 1BNZA 2O2LD 4JBWA 3NQTA 3J81j 4A3DH 5C3EB 4IZ8A 1IYUA 4JI3Q 3RN5A 4LUVA 4XDXA 4LF8L 1WTWA 4OGQC 1GUNA 5KNCA 4LK1C 2IT1A 4EQ5A 5CBAE 4A3CH 4LFBQ 1UUPA 5EPKA 4U673 3UDGA 3CC2A 1MSHA 4JV5Q 2NVXB 3I7FA 3QOJA 3K5MA 4A3IH 1HZBA 1XTDA 2VUMB 1TS3A 4DV3Q 3S1MH 4KK7A 3G71A 4IOCA 1GUSA 3STBD 3NTKA 4KKSA 1ZYRC 1JE5A 2PMZB 5FOBB 3NWSA 1YHAA 3DM1A 4ZKBB 3LWUA 3GTKH 1ESFA 3K7UC 2R7DA 2C35B 1HJPA 3MXNB 4OL7A 2E2IB 1AP0A 1K3BC 4A3KB 4GKJQ 3KBGA 4A93H 4EVOA 3OSOA 3C46A 2YV5A 2WAQB 4C3IB 4AIMA 4DKAC 1WTQA 1Z6HA 4TKOB 3DWPA 5EBCA 3RZOB 1KL9A 1WJJA 1ZKOA 2VQFQ 1E1OA 3J7AF 4CKCA 4K2LA 4JOIC 3MFYA 3J7YW 1K9MC 1SYFA 5LMNL 1KQSA 1LM0A 2B2WA 1EIFA 2TSSA 5KNBA 4YHHL 2PO4A 4IO9A 1HA6A 1RL2A 2AQ2B 4A3FH 2Q2UA 5KGUA 4DV0L 3OW2A 1VQ8A 1YNXA 5M5XB 1HFGA 4RKBA 1GUGA 4R8IA 3J81i 4O2DA 3OTOL 3DM3A 3TSSA 1JJ2A 3PV0A 1B3QA 1QVGA 3S15B 2KEDA 1AFPA 1Y8OB 4JC0A 1KHIA 1IBLQ 5C6AA 1HUMA 2K5VA 1IYVA 1OXVA 1S5BD 1C4QA 3H91A 1PMRA 3HOYG 3GTJB 2SNMA 4P75A 1SE8A 4GNXB 1PTOB 1VQIA 3H0GH 3HOZB 4ZRZA 1JOKA 3J80E 5IGBA 1STYA 3SEBA 1VQNA 1J9OA 2E2JH 2G9HD 4HR7B 4CJ0B 1AE3A 1MJCA 2JQOA 5NUCA 2E5LQ 4LF9L 4NDXA 4A3LG 1LTLA 2SDFA 3PO3B 2NUCA 3OMGA 4HIDA 2J4XA 4AQYQ 3QG1A 3OHXC 2IX3A 3E6ZX 4A3BB 2AKWB 3T53B 1EOVA 2K75A 2NTSA 2KOLA 5IIFA 4JI2L 1H95A 5M3FG 1KXLA 1A63A 1KTKA 5CV6A 4CHTB 4PZ6A 1N9WA 2MP1A 1V1QA 2F0SA 3GV6A 3VR2A 4IPDA 1LT4D 4DV6L 1PYSB 3CCEA 3NQIA 3AU7A 4YY3L 3NE5B 3FEWX 3J7A5 1RIPA 2N78A 4AH6A 2A74C 3KDFA 5GROA 4GLAC 5A35A 2MFIA 4XTCS 2HIVA 1E1TA 4A3EB 1XPUA 3D3RA 4IUQA 1F2YA 2FJ2A 4QF4A 1KNAA 4H02A 1XYIA 4JW0A 2ZT9C 5I6WA 3J80c 3GO5A 2B2WC 1VQ5A 4ZKCB 4N9TA 5IY0A 3K0XA 4DXGA 2EYOA 1LV9A 1PYWD 4JBKA 5IODA 1X6OA 3VR6A 1PRTB 2WB1E 4LFAL 4ULLA 4DAMA 4IUVA 5IOCA 1D5XC 3J80L 1LT3D 1PVOA 3V96A 4MHEA 1SJED 5I9PA 1K0SA 1J5EQ 4H13C 4KHZA 4LW1A 3KLSX 2UU9Q 1EYDA 2EYLA 1GVPA 5LL6X 4HJ5A 3SK8A 5FLXE 5COYA 1FYCA 2EJGC 3KF8A 4KY6A 5JAVA 1PA6A 3I4MG 5C5MA 1F2ZA 4FXDA 1VMPA 4RA8A 4DAPA 4NMZA 2RKSA 3CCUA 2QF7A 4OONA 1YHQA 5GAGC 2F3WA 1YI2A 3U58A
chains in the Genus database with same CATH topology
4KN4C 2DN8A 2ZXOA 2NVTB 4UAIA 1DJRD 3C1EA 4YIJA 1ONLA 1I4RA 1BQQT 4X3TA 3URYA 2A6EC 4DAVA 1SBBB 2N88A 1F9PA 1I3QB 2JA5B 3TBIB 3IL8A 1LTID 4MN3A 5TSSA 1EU3A 2E2DC 3EFXD 4FP5D 4IUNA 1SYGA 1H9RA 5C0XG 1RDPD 1A3TA 4KY5A 2F0KA 1V1PB 1RF2D 2PZWA 1DXMA 2M9VA 2X69A 5FLXL 3DEOA 4IFDI 3AB9A 3IKJA 2E2HB 1PTOD 1TWFB 4OHJA 1CQFA 3ND8A 2F0QA 2JA6B 3K5LA 3FDTA 2EE1A 3BVZA 3CHBD 3K7AB 2IW3A 2KA7A 5CBEE 1D6EC 3TP8A 3I3CA 3T56B 1FR3A 4KMUC 4B9XA 3S2HB 1TWHB 4IUTA 1GXDC 4OO1I 5DEHA 1I50B 1VDZA 1RTOA 4FF1A 4L8JA 2HCIA 2X6GA 2O5JC 1Z7TA 3PO2B 3X3NA 4QUCA 1U4LA 2BDNA 5M5YB 3T13A 2SOBA 2H4OA 4PQXA 1G91A 1OXXK 4KHVA 1B44D 5JPNC 1B9NA 3I4LA 4NKLA 1KDBA 3GTQB 4EGVA 2K01A 5EPLA 2JYOA 1JICA 1MD2D 1WTRA 1GHKA 2OF1A 1SXTA 1CZGA 1D1KA 1G8ZD 1O7LA 1PRTD 1HQMC 5C0XH 2CVRA 4IURA 4G57A 1B1ZA 5FO7B 2FMMA 1ENFA 3KLRA 4OIKA 3U9SA 4WORA 5D14A 5E3FA 4ID6A 3NHHA 1F77A 4BS9A 4F7XA 1JQYD 1JB3A 5CR3A 2OT2A 5JVG3 4CBVA 3M3YB 2K32A 2DNEA 3GD7A 1Q3LA 3LWEA 3SK4A 3TZDA 1IKLA 4PNYA 3CKIB 1E2WA 3HOXB 1E0BA 4IN3A 2A69C 5EKIA 1CQVA 3NUCA 1QNKA 4CKEA 1FNWA 1TVXA 1WD1A 4BA1I 1H9JA 1D5MC 5M3FB 5ELEA 3Q24A 2F0UA 3DUZA 4QIWB 2KVMA 1PTOH 2HDMA 3Q0AA 1DONA 4KV6A 1IL8A 2F0FA 5I2XA 4IFDJ 1NAPA 1STBA 1WTPA 1Y69U 1EY5A 1H9SB 2XRQD 1U4PA 2ZXPA 3OMCA 1PFNA 5KNDA 1Q90A 2R93B 1W6KA 1FNVA 1JWSD 3O13A 1KLGD 1CTMA 1B2TA 1B50A 1YNJC 2K6AA 2ICIA 1K83B 2XVSA 3TZUA 1NR4A 5IGGA 1BF4A 4J8QA 1STGA 2QILA 2JEBI 4V0BA 3VYSA 3M7NA 2BE5C 3P20A 4TQUS 1M8AA 2JE6I 1Y8NB 3C3LA 3I4MB 4JK1C 1LTSD 2K5DA 1TQOA 1STEA 1ESRA 2B39A 5KYLA 2AUJD 2EXZA 1GUOA 1LACA 2F3VA 3PUXA 1NSNS 3R2IA 1EL0A 3VA5A 3ND9A 1SEBD 1SYBA 2WKDA 1C8CA 2HQEA 5K36G 5E1FA 1PZJD 2M00A 1BCPB 5I9OA 2CW0C 4DN4M 2QCPX 3ZYYX 1A2UA 1HTLD 2EYJA 3W3AA 5EKLA 2R61A 3SK6A 3G6JB 1HA5A 2FHTA 1MGSA 1LABA 4CGYB 1B4OA 2EOTA 2EY5A 2LFNA 1RTNA 1CZWA 5J22A 4FYDA 4MIUA 1VMCA 4M1UB 2JEAI 2NBFA 1AZQA 1SNDA 1BDOA 4BBSB 5JEAH 3EROA 3DXJC 4DF7A 1AN8A 4BBRB 4XQNA 2AUKA 3L3OC 2F03A 5EPJA 1GJXA 2VXWA 2XWJB 4FF2A 3GP7A 1PTOC 2R92B 3DWAA 3HRZC 1SNQA 1BXTA 1EY6A 2NN6G 2FINB 2IX1A 2F0MA 2PYKA 1SYCA 4B08A 3S9WA 1SDFA 3TN2A 3VR5A 4DXFA 3OW7A 1SSOA 1LTRD 4B9WA 2Y0SB 3QIAA 2AQ1B 1LT5D 1WTVA 5K36H 3RMHA 1FGBD 1X32A 5JOBA 1K8OA 1I6VC 2F0HA 1SE2A 3S2DB 1M4VA 3F2UA 1F9QA 1G291 2IPKD 2JA7B 3L9AX 1SNMA 2A68D 3K59A 3V2TA 1UNSA 5KEEA 2L9HA 2F0DA 2PQEA 4ZAIA 3ITPA 2A6HC 1DD2A 3FPUB 1EIGA 3GTOB 4RGNA 2L4NA 4RH6A 1IW7D 4NP5A 2RDFA 5M9OA 2RBMA 2K7VA 5K5PA 1LO5D 5FO8B 3HOVB 4G4KA 2DNCA 3EJIA 1EY7A 1SNOA 3D6CA 3OWFA 1ZEQX 1V43A 4K5XA 4IUUA 3D6WA 3NXWA 4K5VA 5M5WB 4BY7B 1CI3M 4PMWA 3OIQA 1B3AA 1X3PA 1EYAA 1VF5C 5CORA 2IL8A 1EZ8A 2NN6H 2VB2X 1L0YB 3PUYA 1GUTA 4FNFA 5I2YA 3BDCA 3TDQA 3OPOA 3A7LA 4OIJA 3N52A 3VA7A 3D4RA 1T5EA 1G2SA 3HZXA 3MVVA 2C9OA 2Z4IA 2V4DA 5DM63 3BVGA 3FKIB 4RGOS 1BCPD 5ELBA 1SAPA 5IT9E 2Q8RE 3BYYB 4K5WA 2E76C 4RGTA 3PUZA 2OXPA 2ZXRA 3QOLA 4C1NK 5CV5A 3VYTA 4AYBB 5C4ZA 4NW2A 4I7ZC 4C3JB 4GZYC 5CV8A 1I4PA 5KIXA 1TT2A 2RDHA 4TRDA 4G7HC 5EGTA 4WRDA 1U9RA 2WACA 3PIO3 2TMPA 4QCLA 1OXUA 1BBXC 2R3ZA 1S5ED 1A3VA 2F0JA 4J1MA 3A8JE 3M4OB 3I91A 2KHSA 2Q8TA 2H1EA 1B9MA 4KKUA 1YNNC 5CC4A 1ET9A 1EY9A 4E6IA 2D2CC 4N9PA 3WDNA 3QB3A 3HG9A 2L55A 4EQOA 3IAYA 3GTPB 4ABNA 3S1MB 1O80A 2QDBA 2WP8J 2ENBA 2F0TA 5IGEA 3RLFA 3GTKB 3S17B 4QMGA 2EYHA 1ENCA 3SXHA 1PLFA 4CJ2C 3NSWA 5IT9L 1CT1D 1E2VA 1STHA 1XWEA 3X3MA 2EPBA 2OEOA 1RHPA 1BOSA 2EJFC 1HXYD 2XWBB 3HP3A 1LT6D 5CMDA 2LS01 2L5TA 2X6LA 5C3XA 2NVQB 3MXGA 3IFTA 4CKBA 1SYEA 1EZ6A 3HOWB 2D5DA 2RQXA 3MXUA 3Q23A 3J81E 4I65A 2B2YC 4K2KA 3KK7A 1I4GA 1WD0A 5CV9A 3MXPA 3SE0A 1BO0A 1HPCA 2PZUA 3SDZA 2WINB 5C3WA 1EEID 4ODGA 3H94A 1EOTA 2Z4HA 1DOKA 4KD3A 3LNNA 4J6HA 1ICWA 3P7JA 4DNRB 2VB3X 5C44B 4XT3B 4F87A 1EU4A 2R7ZB 3L7ZC 5T1GA 3HKZB 1DOMA 3EVQA 2N55A 1II3A 3Q22A 2VNUD 1NUCA 5IGCA 1RODA 2JA8B 4C3HB 4Z9CB 5BN3A 3E0JA 1AW7A 4FF3A 1EY0A 4DA2A 2R6GA 4R8NA 1FD7D 3M4YA 4DAYA 3MTSA 1OXTA 2K5WA 1IHZA 3ONAB 1LTAD 3I4NB 3BS1A 3J81L 2NYZD 3FVQA 2D62A 4KN7C 3EA6A 1STNA 1EY8A 4RHRA 1SMYD 3DEPA 2K33A 2ID0A 4S3SA 3M7GA 4ZYSA 1QILA 5EJWA 2FMCA 1DYQA 3NP8A 4DNTB 3WOEA 1NCVA 2L12A 3HEJA 1PTOF 1EIHA 2BCOA 2A68C 3OWEB 2EVBA 3MXNA 3CQZB 1QJOA 2XIWA 3QWNA 2KEEA 1S5FD 3BG3A 3R3OA 1IW7C 3N6RA 5FK9C 3I73A 2K04A 2K28A 4C3JG 5A2QE 1S5DD 1XX8A 1CHQD 5ELDA 2GA4B 3NTIA 4H44C 3P75A 4DFAA 1TS5A 2IJ0A 3QO2A 4C1NI 1D5ZC 2O4XA 3RUZA 4HAEA 3D31A 1AEXA 4HMIA 4L6TB 3SHLA 5BN5A 3TP7A 1I6HB 5EQ0A 4FXGC 4DK1A 2EYFA 1WCMB 5ISRA 2A6ED 4X3SA 5ELFA 1TIID 1BCPC 2DY8A 3K0YA 2EY1A 1JE4A 1PRTF 3MA2B 4Y7NB 1BUVT 1GOZA 5DNFA 2WB1B 4IFDG 3PIP3 4PV1C 1DOLA 1EWCA 1IKMA 2F0LA 3HGBA 1ENAA 1Z47A 4XYQA 3MAQA 3C1FA 4IUPA 1WVLA 5JVH3 1JWMD 2EY2A 2BDOA 2AQ3B 5A2QL 3NTHA 2NWGA 5C4XB 2K1BA 2D9UA 4OO1G 5IGFA 2RVLA 3K5NA 1JC7A 3J7AV 4K8JA 3TMEA 4R9WA 2JXMB 3RZDB 4PMBA 1TWCB 1U4MA 4CJ1B 2C5CA 2B2VA 4RCOA 2AWOA 4KI0A 1R9TB 1G6ZA 1QCBD 1KABA 3A55A 2QKIC 1QOHA 2B8FA 1D1IA 5KRUA 1OO9B 5M3MB 5J39A 4BA2I 3RD4A 5D3DA 4C56C 2F0NA 3A56A 1GHJA 1S4ZA 4KTAA 1HCZA 2WKCA 1TR5A 5C4JB 4FXKC 1SE3A 2EYMA 5G3LF 3A8KE 5E4WC 1TS2A 1JOOA 3KUPA 3S14B 3VYUA 4IFDH 3S16B 4C3HG 1QG7A 4RWSC 1F9RA 4QB4A 5CGKA 2CHBD 1ET6A 5C0XI 5E4XA 2E75C 4DK0A 5IGDA 3K57A 2LKVA 2K03A 3T16A 1PFBA 4RAUC 3S1QB 3H3VC 4OO1H 4G7ZC 1UAPA 1KNEA 3K6OA 1Q1EA 5C4HA 3VR4A 1HRJA 4ZK9B 1QB5D 2LMCB 2Z1CA 2F0PA 3U9OA 5KYIA 4ZUIA 5HGTA 2PPBC 3T4AC 1O7YA 1VCIA 2LY7A 4HTHA 3M85A 1W6JA 2NVYB 2B2TA 3GQBA 2B2VC 3H6MA 2I07B 3VR3A 1TKWB 3G7LA 1SFOB 4BY1B 3FPPA 1V1PA 3BDOA 4FVMA 3I8ZA 3TP5A 3MFGA 3NWTA 5D3IB 1TWGB 2A69D 4X3KA 1PRTC 1UEAB 1DZ1A 4X3UA 2K5QA 1EQTA 1SNPA 2M2LA 3NBHA 1QWYA 1H9MA 4RKLA 3MZ5A 2B8GA 4H0LC 3K58A 1CA5A 3C2PA 2HDLA 2EY6A 4H7BA 2YU9B 2EDGA 3HS0C 2XRSD 3V05A 1LTTD 4C2MB 1HHVA 4A3MB 3I70A 4ZUJA 1Y1WB 1OXSC 1JOQA 1D2BA 1R4PB 4UDUC 2IX0A 3GTGB 1JWUD 1SMYC 3NPPA 2KCCA 3S1RB 5I4DA 3OOCA 2SNSA 3WOFA 3HOUB 1CM9A 1YNJD 2RA4A 2B63B 2BA1A 2WIIB 4F8MA 1HQRD 4F88A 1T5XD 1TU2B 1KDAA 2MHVA 1LLRD 4V190 1CHPD 5C5LA 1TWAB 1S5CD 2B2YA 3GTMB 2BE5D 5I6YA 3VYRA 2NB0A 4HEDA 2NZ1D 4HSVA 4ILWA 1PDQA 1NR2A 4KD4A 2XNAC 2EZVA 3SVMA 2G9DA 5CYUA 2B2TC 5JPMC 4HSPA 2F0GA 5J1ZA 4A3DB 2F4IA 2AWNA 3PMFA 1EQVA 4XQQA 5D65A 5C0XJ 2WV6D 1KDCA 1HTPA 4TSSA 1I4QA 4K6LA 1V1OA 2CQAA 3NK9A 4A3IB 2IWHA 5AFWA 2L0CA 2FFKB 3I90A 3PUWA 2MJ8A 2CW0D 1E2ZA 4Q0FA 3DWQA 1QNUA 1TS4A 1JR0D 3MWYW 1FNUA 2XN9C 1TY2A 4A93B 1O78A 1X3QA 4ZLTF 3MEHA 3SR1A 4PMCA 2F0OA 4ME5A 4HCEA 1RKNA 2E74C 1STAA 1PFMA 3QJYA 1ZYRD 2F0IA 2F0EA 2PW7A 1SJHD 4K8IA 4IALA 3DMUA 1SYDA 2RSOA 1VF7A 1L0XB 4A3FB 1CA6A 4QUFA 3OIPA 1H9SA 1MI2A 4HCSA 4XXEA 2EYPA 4XQJA 4RCNA 5F2DA 4C3IG 4A3GB 1Q12A 1F9SA 1SNCA 1BCPF 1PZKD 2MUYA 1DM0B 2KJXA 1RCVD 1EWHA 2BOSA 4K6DA 3BDLA 4KKTA 1H9KA 3GV3A 4L63B 3H0GB 3KBXA 1EY4A 4U68A 3Q6SA 3H09A 1A3UA 3BZDB 4XIGS 4K14A 3D8GA 2E2JB 3FMCA 2MGSA 3I72A 3JAME 5CV4A 4HN7A 2BA0A 4M8AA 1XTCD 2MPMA 4EQPA 3BYTB 1LTBD 3NBIA 3W2DA 3E5SA 1LTGD 5DM73 3T51B 1TY0A 2B2UA 4FO2A 2KCNA 3A8IE 3P1HA 1PXUA 3K5OA 2ICEC 2JP1A 1BR9A 1MBYA 3R8BA 4O1NA 2EJMA 1R4QB 2A6HD 4LJZC 3IFDA 4DU9A 3R93A 1JCKB 2PW5A 1V8QA 3A7AB 4BWGB 1G2TA 2L1BA 2QEJC 2SEBD 3MHBA 3UI2A 4O42A 4G7OC 2NN6I 5BN4A 4EQNA 3MC0B 3TP6A 4KJOA 4FF4A 5EKKA 2F0VA 1A6XA 2I46A 4ZQ3A 4KY7A 3JAML 1MSGA 2A5HA 4XYOA 3KLSA 3HOYB 2KUMA 1GUWA 1HFNA 2XSCA 3AMUA 1Q1BA 1SE4A 3LX0A 3D4DA 1F2LA 2PNRC 3DHQA 1O7ZA 3PUVA 4KJNA 5DAUA 2NTTA 1RJTA 1C48A 4HMJA 4IQZA 2K05A 5JEAJ 2PCFB 5FO9B 1EYCA 4Q5VA 1A2TA 5HURA 2RSNA 4RGMA 3A54A 1KAAA 5FKAC 1DCZA 1J8IA 2J0TD 3CRLC 2J7ZA 2L11A 2B2UC 1HUNA 3CU7A 1B53A 1JORA 1AZPA 2RDGA 2YYZA 5G3LD 2F0WA 3FRPB 4RHSA 1PZID 3S1NB 5LHY1 1ILQA 1YNND 4WJWA 4XT1B 1Q8IA 1ML0D 1ZXTA 5JEAG 1Y8PB 3R2TA 2KQ3A 2Z8LA 3SK5A 2A73B 1WTXA 3CRKC 4LMQD 5EBDA 4P2CB 1EEFD 4LAAA 5ELCA 1RD9D 1EFID 1Y1VB 2KECA 1I4HA 3D4WA 3ERQA 2HUGA 2DY7A 2F1MA 1ILPA 2Q8IB 5LL6S 4DGZA 3GTLB 2JSOA 4RFBA 3BVMA 1CK1A 4WFN3 1U4RA 1K8MA 4A3JB 2PZTA 1F2MA 1QE6A 1A15A 5CV7A 5JJZA 5T1IA 2HCCA 1KLUD 1XXGA 3EQLC 1I4XA 2O5IC 1WTOA 1CFMA 1BNZA 2O2LD 4JBWA 3NQTA 5C3EB 4IZ8A 1IYUA 4XDXA 1WTWA 4OGQC 1GUNA 5KNCA 4LK1C 2IT1A 5CBAE 1UUPA 5EPKA 4U673 2NVXB 1MSHA 3QOJA 3K5MA 2VUMB 1TS3A 4KK7A 1GUSA 3NTKA 4KKSA 1ZYRC 2PMZB 5FOBB 3NWSA 3DM1A 4ZKBB 3LWUA 1ESFA 4OL7A 2E2IB 1AP0A 4A3KB 3KBGA 4EVOA 3OSOA 3C46A 2WAQB 4C3IB 1WTQA 1Z6HA 4TKOB 3DWPA 5EBCA 3RZOB 1ZKOA 3J7AF 4CKCA 4K2LA 3MFYA 3J7YW 1SYFA 2B2WA 2TSSA 5KNBA 2PO4A 1HA6A 2AQ2B 5KGUA 5M5XB 1HFGA 4RKBA 1GUGA 4R8IA 3TSSA 3PV0A 3S15B 2KEDA 1AFPA 1Y8OB 1IYVA 5C6AA 1HUMA 1OXVA 1S5BD 1C4QA 3H91A 1PMRA 3GTJB 2SNMA 1PTOB 3HOZB 4ZRZA 1JOKA 3J80E 5IGBA 1STYA 3SEBA 1J9OA 2G9HD 4HR7B 4CJ0B 5NUCA 4NDXA 2SDFA 3PO3B 2NUCA 3OMGA 2J4XA 3QG1A 3OHXC 2IX3A 3E6ZX 4A3BB 3T53B 2NTSA 2KOLA 5IIFA 1KTKA 5CV6A 4CHTB 2MP1A 2F0SA 3GV6A 3VR2A 1LT4D 3NQIA 3AU7A 3NE5B 3FEWX 2A74C 5A35A 4XTCS 4A3EB 3D3RA 4IUQA 1F2YA 2FJ2A 4QF4A 1KNAA 1XYIA 2ZT9C 5I6WA 3GO5A 2B2WC 4ZKCB 4N9TA 4DXGA 2EYOA 1LV9A 1PYWD 5IODA 3VR6A 1PRTB 4ULLA 4IUVA 5IOCA 1D5XC 3J80L 1LT3D 3V96A 4MHEA 1SJED 5I9PA 4H13C 4KHZA 3KLSX 1EYDA 2EYLA 5LL6X 3SK8A 5FLXE 5COYA 1FYCA 2EJGC 3KF8A 4KY6A 5JAVA 5C5MA 1F2ZA 4FXDA 1VMPA 4RA8A 4DAPA 4NMZA 2RKSA 2QF7A 2F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1H A;  1STN A;  2F3V A;  5NUC A;  4B9W A;  1JOQ A;  1EY8 A;  4K5W A;  1JOR A;  1NSN S;  4NDX A;  4QB4 A;  2OXP A;  2NUC A;  3OMG A;  3C1E A;  3QOL A;  2F0W A;  3VA5 A;  5CGK A;  3MEH A;  3QOJ A;  5CV5 A;  4S3S A;  1SYB A;  4YIJ A;  3SR1 A;  2F0L A;  4PMC A;  2F0O A;  4ME5 A;  5JOB A;  4K5X A;  4DU9 A;  5C4Z A;  1RKN A;  2F0U A;  1STA A;  2HQE A;  4I65 A;  5CV8 A;  2PW5 A;  2F0H A;  2M00 A;  4K2K A;  2SNS A;  5E1F A;  5IGD A;  2LKV A;  5I9O A;  3NP8 A;  5IIF A;  1ENA A;  5KIX A;  1TT2 A;  3T16 A;  3T13 A;  3C1F A;  2SOB A;  2F0I A;  3MXP A;  2F0E A;  5CV6 A;  5CV9 A;  2PW7 A;  2F0F A;  4K8I A;  4KV6 A;  4TRD A;  1A2U A;  3HEJ A;  5EGT A;  4IAL A;  2F0S A;  2EY2 A;  1SNM A;  3DMU A;  2EYJ A;  4WRD A;  1STB A;  1U9R A;  2WAC A;  5EKL A;  2PZU A;  1SYD A;  3MHB A;  4OL7 A;  4KHV A;  1EY5 A;  3SK6 A;  3V2T A;  5C3W A;  2KQ3 A;  4F8M A;  5KEE A;  3SK5 A;  4NKL A;  2F0D A;  4ODG A;  2PQE A;  1KDB A;  4EVO A;  1KDA A;  3ITP A;  5IGF A;  3OSO A;  5C4H A;  3OMC A;  1A3V A;  5C5L A;  2EY5 A;  2F0J A;  3R3O A;  4J1M A;  4K8J A;  4KD3 A;  2EYP A;  2KHS A;  4LAA A;  4J6H A;  5F2D A;  3TME A;  4EQN A;  2F0P A;  2OF1 A;  3U9O A;  4NP5 A;  5CC4 A;  3TP6 A;  2RDF A;  4KJO A;  4ZUI A;  5HGT A;  4MIU A;  5KYI A;  5M9O A;  5EKK A;  2RBM A;  2F0V A;  1EY9 A;  3D4W A;  1F2Y A;  4IUN A;  1SYG A;  4K2L A;  4QF4 A;  4E6I A;  4PMB A;  1SND A;  3ERQ A;  4ZQ3 A;  4N9P A;  5K5P A;  4KY7 A;  1SYF A;  3ERO A;  3QB3 A;  4G57 A;  1SNC A;  3EJI A;  1EY7 A;  1SNO A;  4EQO A;  4KD4 A;  5I6W A;  4HTH A;  4DF7 A;  4DGZ A;  5KGU A;  1A3T A;  3D6C A;  3EVQ A;  3OWF A;  4WOR A;  1II3 A;  5E3F A;  4ID6 A;  5IGG A;  4KY5 A;  3NHH A;  4N9T A;  4K6D A;  1NUC A;  2F0K A;  1STG A;  2EYO A;  3BDL A;  3H6M A;  2QDB A;  3LX0 A;  3NXW A;  3P75 A;  4K5V A;  4DFA A;  2PZW A;  3D4D A;  2ENB A;  5IGC A;  2F0T A;  1KAB A;  5IGE A;  2F0G A;  4F7X A;  5IOD A;  1EZ6 A;  1EY4 A;  5J1Z A;  4RKB A;  3TP5 A;  1A3U A;  5KRU A;  3DHQ A;  4K14 A;  1EYA A;  2O4X A;  3D8G A;  4QMG A;  2PZT A;  5CR3 A;  3RUZ A;  1EZ8 A;  2EYH A;  4KJN A;  3PMF A;  1ENC A;  5DAU A;  3SXH A;  5IOC A;  1F2M A;  1EQV A;  5J39 A;  1SNQ A;  5CV4 A;  1AEX A;  4HMJ A;  1EY0 A;  1SNP A;  4HMI A;  2F0Q A;  1KDC A;  5I9P A;  5J22 A;  1EYC A;  1EY6 A;  5CV7 A;  4R8N A;  1A2T A;  4ZUJ A;  3BDC A;  2F0N A;  5HUR A;  4EQP A;  3SHL A;  4RKL A;  1STH A;  1EYD A;  2EYL A;  2F0M A;  2PYK A;  3TP7 A;  3MZ5 A;  5C6A A;  4KTA A;  3NK9 A;  3SK8 A;  1SYC A;  1KAA A;  3SK4 A;  2OEO A;  1TR5 A;  1IHZ A;  2SNM A;  2EY6 A;  3HZX A;  3TP8 A;  2EYM A;  4KY6 A;  1TQO A;  5JAV A;  4PNY A;  4B9X A;  2EYF A;  3E5S A;  3MVV A;  1F2Z A;  4H7B A;  5C5M A;  1JOK A;  5C3X A;  3S9W A;  3NQT A;  5ISR A;  5IGB A;  4NMZ A;  1STY A;  2RKS A;  5KYL A;  4IZ8 A;  1JOO A;  5DEH A;  5I6Y A;  2EXZ A;  3NUC A;  2F3W A;  1SYE A;  2EY1 A; 
#chains in the Genus database with same CATH topology
 4KN4 C;  2DN8 A;  1HZ9 A;  2ZXO A;  2NVT B;  2GVB A;  4UAI A;  2G5D A;  1DJR D;  3C1E A;  4IJL A;  5IYD G;  3DLL A;  4YIJ A;  1YIT A;  1ONL A;  1I4R A;  1BQQ T;  4DPG A;  2XGT A;  4X3T A;  3KYH C;  3URY A;  2A6E C;  2EIF A;  4DAV A;  1SBB B;  2N88 A;  1F9P A;  5JJI A;  1I3Q B;  2QW7 A;  2OCE A;  3CCS A;  2JA5 B;  3TBI B;  1PH1 A;  3IL8 A;  1YIJ A;  4DV2 L;  1LTI D;  4MN3 A;  5TSS A;  5IT9 c;  5IWA L;  1EU3 A;  2E2D C;  4YWM A;  3EFX D;  4FP5 D;  3S1N H;  5FLX c;  2VUM G;  4IUN A;  1SYG A;  4LFC Q;  4A75 A;  3BU2 A;  2KHJ A;  4RMF A;  1H9R A;  2RCF A;  5C0X G;  1RDP D;  2L15 A;  1A3T A;  1N33 L;  4BBS G;  4X62 Q;  4KY5 A;  4JI7 Q;  4O0A A;  2F0K A;  1V1P B;  1RF2 D;  2PZW A;  1DXM A;  2M9V A;  2X69 A;  5FLX L;  3DEO A;  4IFD I;  2OTJ A;  3AB9 A;  3IKJ A;  4A3K G;  2E2H B;  1PTO D;  2WAQ G;  1Y1V H;  1TWF B;  4JI8 Q;  4OHJ A;  3CW2 C;  3NBH B;  2K14 A;  1CQF A;  3ND8 A;  2F0Q A;  1SRU A;  2JA6 B;  1HNW Q;  3K5L A;  2R92 G;  4JI4 L;  1QZH A;  3FDT A;  2EE1 A;  2UUC Q;  3BVZ A;  3CHB D;  3K7A B;  3GTL H;  2IW3 A;  2KA7 A;  4EX5 A;  5CBE E;  1D6E C;  5HGQ A;  2F52 A;  3TP8 A;  3I3C A;  3T56 B;  1FR3 A;  3B6Y A;  4KMU C;  4B9X A;  1S3O A;  3S2H B;  1TWH B;  2I5L X;  1GXD C;  4IUT A;  2K50 A;  1IXR A;  3G48 A;  4OO1 I;  5DEH A;  4A3J H;  1I50 B;  1XPO A;  1VDZ A;  1SLJ A;  1RTO A;  4FF1 A;  4L8J A;  2HCI A;  2X6G A;  1JJG A;  2O5J C;  2VQE Q;  4K0K L;  3ICE A;  1Z7T A;  3PO2 B;  2Y0S G;  3X3N A;  4X65 Q;  4QUC A;  1U4L A;  3CXC A;  2ASB A;  1CKN B;  2BDN A;  1JB7 A;  1NY4 A;  5M5Y B;  3T13 A;  4X62 L;  2SOB A;  5C3E H;  3FHW A;  2H4O A;  1CUK A;  4GLV B;  4PQX A;  1G91 A;  4LUZ A;  4GS3 A;  1OXX K;  4KHV A;  1B44 D;  1J6Q A;  5JPN C;  1B9N A;  3I4L A;  3E9I A;  4NKL A;  1KDB A;  1EIY B;  2NVX H;  5BR8 Q;  3GTQ B;  4EGV A;  2K01 A;  5EPL A;  2VUM H;  2JYO A;  1JIC A;  1MD2 D;  3CCJ A;  1WTR A;  1GHK A;  2OF1 A;  1SXT A;  1CZG A;  1D1K A;  1G8Z D;  1O7L A;  2Z6B A;  4A3B G;  1PRT D;  1HQM C;  5C0X H;  2CVR A;  4IUR A;  1K73 C;  2VW9 A;  4G57 A;  1B1Z A;  5FO7 B;  2FMM A;  1C0A A;  1ENF A;  3KLR A;  4OIK A;  3U9S A;  4WOR A;  2E2I H;  5D14 A;  5E3F A;  4ID6 A;  3NHH A;  3TRE A;  4DR5 L;  1F77 A;  4A3K H;  2JA9 A;  4BS9 A;  1HZA A;  3PF4 A;  4F7X A;  4C3I H;  1JQY D;  1JB3 A;  1N32 L;  4NXM L;  5CR3 A;  2OT2 A;  3RZO H;  4BY7 G;  5JVG 3;  4CBV A;  4LF4 Q;  2F4V Q;  3M3Y B;  2K32 A;  5IP9 H;  1E22 A;  2DNE A;  3GD7 A;  4A3E G;  1Q3L A;  4OEL B;  1PHJ A;  2UXD L;  3LWE A;  3QR8 A;  2VZA A;  3SK4 A;  3TZD A;  1IKL A;  3PIP A;  3ER0 A;  4PNY A;  4B3M L;  3CKI B;  1E2W A;  5M5X H;  3HOX B;  3U4Z A;  1E0B A;  4IN3 A;  2RF4 A;  4UP8 A;  1KAW A;  2A69 C;  5EKI A;  4DR7 L;  1CQV A;  3NUC A;  1QNK A;  4CKE A;  1FNW A;  1TVX A;  4YCV A;  4N8X 1;  2OQ0 A;  3S15 H;  1WD1 A;  4BA1 I;  3FKI G;  3TS2 A;  3I4O A;  1H9J A;  4WJ3 M;  4B3R L;  3F2C A;  1D5M C;  5M3F B;  5ELE A;  3Q24 A;  2F0U A;  3BZK A;  3GTJ H;  3DUZ A;  4QIW B;  1HNX Q;  2KVM A;  1PTO H;  2HDM A;  3HOZ H;  4AYB G;  3Q0A A;  4JCV E;  3NEM A;  4LF6 Q;  1DON A;  4KV6 A;  1IL8 A;  2F0F A;  5I2X A;  4HJ9 A;  4IFD J;  1NAP A;  3E0E A;  1STB A;  4HIO A;  1WTP A;  1Y69 U;  1EY5 A;  2UUA Q;  1H9S B;  2XRQ D;  3PO3 H;  1U4P A;  5EAY A;  4LF4 L;  5AJ3 L;  2ZXP A;  2KEN A;  3OMC A;  3W1G A;  1PFN A;  5KND A;  1Q90 A;  1X54 A;  4A3B H;  1UEB A;  2R93 B;  1W6K A;  2RCN A;  1FNV A;  1JWS D;  3O13 A;  4DUY L;  1KLG D;  1XNR Q;  1CTM A;  1B2T A;  1B50 A;  1YNJ C;  2K6A A;  4JI1 Q;  2ICI A;  4KHP L;  1Y1W H;  3F2D A;  1K83 B;  2XVS A;  3TZU A;  4PG3 A;  3A0J A;  1NR4 A;  5IGG A;  1PFS A;  1BF4 A;  4J8Q A;  1STG A;  3M4Q A;  4IPC A;  2QIL A;  2JA5 G;  2JEB I;  4V0B A;  4OX9 L;  2QEX A;  3VYS A;  4LF8 Q;  3M7N A;  4GNX A;  1VQK A;  2BE5 C;  3KOJ A;  3P20 A;  4TQU S;  1M8A A;  4A3E H;  2ZJQ A;  2N8N A;  1KRS A;  4DNI A;  2HHH L;  2JE6 I;  3RLN A;  1Y8N B;  3C3L A;  3I4M B;  2ZJP A;  4JK1 C;  3CPF A;  5GAH C;  1LTS D;  3F2B A;  2K5D A;  1TQO A;  4JPB W;  4MTN A;  1STE A;  1ESR A;  2B39 A;  1QUQ A;  2OWO A;  5KYL A;  3CAM A;  2AUJ D;  2EXZ A;  2D0P A;  1GUO A;  1LAC A;  2F3V A;  4GOP B;  1W3S A;  3PUX A;  1NSN S;  3R2I A;  1X3G A;  5GAD C;  2Z6K A;  1EL0 A;  1EWI A;  3VA5 A;  3ND9 A;  1SEB D;  3AYH B;  5E7N A;  4LNQ A;  1SYB A;  2WKD A;  1C8C A;  1L1O A;  2CQO A;  5LMN Q;  2HQE A;  5K36 G;  5E1F A;  1PZJ D;  2M00 A;  1BCP B;  4PZ7 A;  5I9O A;  2CW0 C;  4DN4 M;  4YHH Q;  2A19 A;  2QCP X;  5FJ8 G;  3ZYY X;  1N8R C;  1A2U A;  1HTL D;  4DV0 Q;  2EYJ A;  3W3A A;  5EKL A;  2R61 A;  4UPA A;  3SK6 A;  3G6J B;  2NVT H;  2KHI A;  3OTO Q;  1HA5 A;  2FHT A;  4DR6 L;  1MGS A;  1LAB A;  4CGY B;  4LUO A;  1B4O A;  2EOT A;  2EY5 A;  2LFN A;  1RTN A;  1CZW A;  3Q8D A;  5J22 A;  4FYD A;  3PO2 G;  3HKZ E;  1VMC A;  4MIU A;  4M1U B;  2JEA I;  2NBF A;  1VQH A;  3ULJ A;  1AZQ A;  1SND A;  1BDO A;  4BBS B;  5JEA H;  1I3Q H;  1I94 L;  3ERO A;  3DXJ C;  3I55 A;  4DF7 A;  1AN8 A;  4BBR B;  2JA5 H;  2GVA A;  4XQN A;  2AUK A;  3L3O C;  2F03 A;  2N3S A;  5EPJ A;  3TS0 A;  1GJX A;  2VXW A;  1BKB A;  2HQL A;  2XWJ B;  4FF2 A;  3UDF A;  4LF9 Q;  4IOA A;  3GP7 A;  4GNX C;  1PTO C;  2R92 B;  3DWA A;  3HRZ C;  1SNQ A;  4L5R C;  1BXT A;  1VQE A;  1FJG L;  1EY6 A;  2NN6 G;  2FIN B;  2IX1 A;  1BBW A;  2F0M A;  2PYK A;  4JI2 Q;  4JI6 L;  1SYC A;  4B08 A;  3F8T A;  1UE5 A;  5ELO A;  3M4P A;  4OEM B;  1PYB A;  4NXN L;  4DV6 Q;  3S9W A;  2CKZ B;  1SDF A;  1K28 A;  4YY3 Q;  2E2H H;  3TN2 A;  3VR5 A;  2AMC B;  4DXF A;  3OW7 A;  1VQA A;  2VL6 A;  2YTY A;  1TWF H;  1SSO A;  1LTR D;  3I4N G;  4A3G H;  4B9W A;  1ASY A;  2Y0S B;  5IP7 G;  2JA6 H;  3QIA A;  2AQ1 B;  1LT5 D;  2EQS A;  4P72 A;  1WTV A;  4JI5 L;  5K36 H;  2Z6K C;  3D0F A;  4QY7 A;  3RMH A;  1FGB D;  1X32 A;  5JOB A;  4OWW B;  1FL0 A;  1I6V C;  1K8O A;  1L1O C;  2F0H A;  3S2H H;  4HJ8 A;  1NBW A;  1SE2 A;  1TWH H;  2GN5 A;  2R7F A;  1M4V A;  3S2D B;  1YVC A;  4POF A;  3F2U A;  1F9Q A;  1XNQ L;  1G29 1;  1I50 H;  2IPK D;  3JAM i;  2JA7 B;  3L9A X;  1SNM A;  5J3B A;  3A5U A;  3HOX G;  2A68 D;  3K59 A;  3V2T A;  1UNS A;  4LFA Q;  5KEE A;  2L9H A;  2Z0S A;  2F0D A;  2PQE A;  4ZAI A;  3ITP A;  2A6H C;  3KJO A;  2QA4 A;  1DD2 A;  3PO2 H;  3FPU B;  1EIG A;  3F1Z A;  3GTO B;  4RGN A;  2L4N A;  4RH6 A;  4NB3 A;  1IW7 D;  1VQ4 A;  4NP5 A;  2RDF A;  5M9O A;  4DR3 Q;  2RBM A;  2K7V A;  5M5Y H;  2VS1 A;  5K5P A;  2F3I A;  1LO5 D;  5FO8 B;  1PH7 A;  3HOV B;  4G4K A;  2DNC A;  3EJI A;  1EY7 A;  1SNO A;  4QL5 A;  1MKH A;  3D6C A;  3OWF A;  2DJG C;  1IBM L;  1XPR A;  1ZEQ X;  1V43 A;  1I5F A;  4K5X A;  4IUU A;  3D6W A;  3NXW A;  4K5V A;  5M5W B;  1Q46 A;  4BY7 B;  3PCO B;  2RHS B;  1KIX A;  1MHW C;  3GTQ H;  1CI3 M;  1UWV A;  1EFW A;  4PMW A;  3OIQ A;  1B3A A;  1X3P A;  1EYA A;  1NTG A;  1VF5 C;  2IL8 A;  2NN6 H;  1EZ8 A;  2VB2 X;  5COR A;  3ERS X;  4GKK L;  1L0Y B;  3PUY A;  1GUT A;  4FNF A;  5I2Y A;  1YJ9 A;  2R93 G;  1IBK L;  4MNO A;  3BDC A;  3TDQ A;  3OPO A;  2MO1 A;  2D0O A;  4P74 A;  3A7L A;  4OIJ A;  5L37 A;  1KC8 C;  1S72 A;  3N52 A;  3VA7 A;  3D4R A;  5IYC G;  1T5E A;  1G2S A;  3HZX A;  3AQQ A;  3MVV A;  2C9O A;  2Z4I A;  1X56 A;  2V4D A;  5DM6 3;  4DV2 Q;  1VQ6 A;  2PNH A;  3BVG A;  3FKI B;  1D8L A;  4RGO S;  1BCP D;  5ELB A;  1SAP A;  4FDB A;  1WCM G;  5IWA Q;  5IT9 E;  2Q8R E;  3BYY B;  4K5W A;  3M3Y H;  3PSI A;  2E76 C;  3CCQ A;  4RGT A;  3PUZ A;  2OXP A;  3HOY H;  4R4T A;  2ZXR A;  1Z9F A;  4DR3 L;  3QOL A;  4C1N K;  3S24 A;  5CV5 A;  3VYT A;  4AYB B;  5C4Z A;  4NW2 A;  4I7Z C;  1VQ9 A;  4C3J B;  4GZY C;  5CV8 A;  1I4P A;  4HJ7 A;  5KIX A;  1TT2 A;  1N33 Q;  3HOX H;  2RDH A;  4TRD A;  1SR3 A;  3MEF A;  4G7H C;  4A3L H;  2UXB L;  5EGT A;  2A1A A;  4WRD A;  1U9R A;  2WAC A;  3PIO 3;  2TMP A;  4QCL A;  4KLK A;  1OXU A;  1X9N A;  1BBX C;  2R3Z A;  1S5E D;  1VQO A;  1A3V A;  2F0J A;  5M3F H;  4J1M A;  5C4X G;  3A8J E;  3M4O B;  3I91 A;  2KHS A;  2Q8T A;  2H1E A;  4JI4 Q;  4ME3 A;  2AHO B;  1B9M A;  4KKU A;  1NNX A;  1YNN C;  5CC4 A;  1N34 L;  1UE7 A;  3CCM A;  1ET9 A;  4HJA A;  1EY9 A;  4E6I A;  2D2C C;  2LSS A;  4N9P A;  1BBU A;  1HZC A;  3WDN A;  3QB3 A;  3HG9 A;  2L55 A;  5IYB G;  4EQO A;  3IAY A;  2ALY B;  3GTP B;  4ABN A;  3S1M B;  3RNU A;  1O80 A;  2QDB A;  2WP8 J;  4DK6 C;  2ENB A;  2F0T A;  5IGE A;  2R93 H;  3RLF A;  3GTK B;  3S17 B;  5IE8 A;  4QMG A;  2EYH A;  1W2B A;  1ENC A;  3SXH A;  4K0K Q;  1N36 L;  1JMC A;  1PLF A;  1CSP A;  4CJ2 C;  3NSW A;  5IT9 L;  1CT1 D;  1E2V A;  4YCW A;  1STH A;  1XWE A;  3X3M A;  2PMZ E;  2EPB A;  1K83 H;  2ZTD A;  2OEO A;  1RHP A;  4P73 A;  1Q82 C;  1BOS A;  2EJF C;  1HXY D;  2XWB B;  3HP3 A;  4BBR G;  3K8A A;  1LT6 D;  5CMD A;  1C7Y A;  2LS0 1;  2L5T A;  3E3X A;  2X6L A;  5C3X A;  1JT8 A;  2NVQ B;  3MXG A;  2VY3 A;  3IFT A;  4R4Q A;  2QDL A;  4CKB A;  1EZ6 A;  1SYE A;  2WAQ E;  4GN3 B;  1GO3 E;  3HOW B;  1P8L A;  1E24 A;  4HIM A;  2D5D A;  1YJN A;  2HD3 A;  2DGY A;  4JI0 L;  3RN2 A;  3I4M H;  2RQX A;  1VQD A;  3MXU A;  3Q23 A;  3J81 E;  4I65 A;  2B2Y C;  4K2K A;  4R1J A;  3KK7 A;  1I4G A;  1WD0 A;  5CV9 A;  3MXP A;  4DR5 Q;  3SE0 A;  1KRT A;  1BO0 A;  1HPC A;  2PZU A;  5IYD H;  3SDZ A;  2WIN B;  5C3W A;  1N32 Q;  1G6P A;  3BJU A;  4NXM Q;  1EEI D;  4ODG A;  3H94 A;  1EOT A;  2Z4H A;  1DOK A;  3UDI A;  3ZJY C;  4A76 A;  4KD3 A;  3LNN A;  3STB C;  4J6H A;  1ICW A;  3P7J A;  2UXD Q;  1CSQ A;  4DNR B;  4B3S L;  2VB3 X;  5C44 B;  3IRB A;  4XT3 B;  4F87 A;  1SN8 A;  1EU4 A;  4DV7 L;  1VQL A;  4B3M Q;  2R7Z B;  3L7Z C;  5T1G A;  3HKZ B;  1DOM A;  3EVQ A;  2N55 A;  1II3 A;  1X3E A;  3Q22 A;  2VNU D;  3GDE A;  4DR1 L;  2JA7 G;  1NUC A;  3PGZ A;  4DR7 Q;  5IGC A;  2ZM6 L;  1ROD A;  2JA8 B;  4C3H B;  4Z9C B;  5BN3 A;  1X3F A;  4BY1 G;  3E0J A;  2H5X A;  4B3R Q;  1Q8K A;  1AW7 A;  4LF7 L;  3J81 c;  4FF3 A;  1EY0 A;  4DA2 A;  2NZO A;  2R6G A;  4BBS H;  4R8N A;  1FD7 D;  1V9P A;  1XMQ L;  3M4Y A;  4GOP A;  2ATW A;  4DAY A;  3MTS A;  4BBR H;  1OXT A;  2K5W A;  3HOV G;  4L5S A;  1IHZ A;  3ONA B;  4LWC A;  1LTA D;  2HT1 A;  1C9O A;  3I56 A;  4GLX A;  3NEN A;  3I4N B;  3BS1 A;  1O7I A;  3J81 L;  1FVI A;  2NYZ D;  3PQI A;  1YJW A;  1IYJ B;  3FVQ A;  2R92 H;  5AJ3 Q;  4POG A;  4X6A H;  2D62 A;  4DR4 L;  4KN7 C;  3EA6 A;  1STN A;  1K3R A;  1EY8 A;  1K0R A;  4RHR A;  3JAM c;  4DUY Q;  3U4V A;  1SMY D;  1IZ6 A;  1XMO L;  3T1H L;  3DEP A;  2K33 A;  2ID0 A;  4S3S A;  1WYD A;  3M7G A;  4ZYS A;  3JC6 6;  1QIL A;  5EJW A;  2FMC A;  4KHP Q;  2UXC L;  1DYQ A;  1Q81 C;  3NP8 A;  2N49 A;  4A4I A;  4DNT B;  3WOE A;  1PH5 A;  1NCV A;  2L12 A;  3HEJ A;  1PTO F;  1EIH A;  4OX9 Q;  4IPH A;  2BCO A;  2A68 C;  3L0O A;  3OWE B;  5GQO A;  2EVB A;  2QGQ A;  3CCR A;  1E3P A;  3MXN A;  1SRO A;  3CQZ B;  1OTC A;  1QJO A;  2XIW A;  4LF5 L;  1JJC B;  3QWN A;  2KEE A;  1S5F D;  3BG3 A;  3R3O A;  1IW7 C;  2HHH Q;  3N6R A;  1LUZ A;  5FK9 C;  3I73 A;  3VDY A;  2K04 A;  3J80 i;  2K28 A;  3S2D H;  4C3J G;  3L2P A;  1A0I A;  3EIV A;  5A2Q E;  1S5D D;  1XX8 A;  1VQP A;  2JA7 H;  1CHQ D;  4JYA L;  5ELD A;  2GA4 B;  3NTI A;  4H44 C;  1CKO A;  3P75 A;  2PI2 E;  4DFA A;  4DV5 L;  3UE1 A;  1TS5 A;  2IJ0 A;  3QO2 A;  3GTO H;  1PH6 A;  1KD1 C;  3A74 A;  4C1N I;  1D5Z C;  2O4X A;  2K52 A;  3RUZ A;  2I0Q A;  4HAE A;  3H3V H;  3D31 A;  1AEX A;  4A3D G;  4HMI A;  1X55 A;  3HOV H;  4L6T B;  4UP9 A;  3SHL A;  5BN5 A;  4GOP C;  3TP7 A;  3CCV A;  1I6H B;  5EQ0 A;  1K8G A;  1ICF B;  4A3C G;  3CCL A;  4FXG C;  5M5W H;  4BY7 H;  4DK1 A;  4APV A;  2EYF A;  1WCM B;  4A3I G;  2BH2 A;  5ISR A;  2A6E D;  2BH8 A;  4X3S A;  5ELF A;  1TII D;  4DR6 Q;  1BCP C;  2DY8 A;  2NZH A;  3AFQ A;  3K0Y A;  2EY1 A;  1JE4 A;  1PRT F;  3MA2 B;  4Y7N B;  1BUV T;  4DV4 L;  1GOZ A;  4WJ4 A;  5DNF A;  3A5Z B;  2WB1 B;  4IFD G;  3PIP 3;  4PV1 C;  1DOL A;  4GN5 A;  1EUJ A;  4DK3 C;  1EWC A;  3CD6 A;  1IKM A;  1VQB A;  2MNA A;  2F0L A;  1Q7Y C;  5LMU L;  1I94 Q;  4A93 G;  3HGB A;  4X66 L;  1ENA A;  1Z47 A;  4XYQ A;  3MAQ A;  2ZTC A;  3C1F A;  4IUP A;  1WVL A;  4HIK A;  3FKI H;  5JVH 3;  3KF6 B;  1JWM D;  2EY2 A;  2BDO A;  3CPW A;  2AQ3 B;  4BXX G;  5A2Q L;  3NTH A;  2NWG A;  5C4X B;  2K1B A;  2D9U A;  1YZ6 A;  4OO1 G;  4L5Q A;  2RVL A;  5IGF A;  3K5N A;  4B3T L;  3HOW G;  1JC7 A;  2I5M X;  3J7A V;  3M9B A;  1FJG Q;  4K8J A;  4TVA B;  4A3F G;  3TME A;  4R9W A;  4C3J H;  4JI6 Q;  2JXM B;  3RZD B;  4PMB A;  1MJE A;  1TWC B;  1U4M A;  3TRZ A;  2YTX A;  4CJ1 B;  1HNZ L;  2C5C A;  4NXN Q;  1Y14 B;  2B2V A;  4RCO A;  2AWO A;  4KI0 A;  1R9T B;  1G6Z A;  1WOC A;  2UUB L;  1QCB D;  1KAB A;  3A55 A;  2QKI C;  1QOH A;  2B8F A;  1D1I A;  5KRU A;  3M4O H;  1OO9 B;  5M3M B;  2K4K A;  3H0G G;  4JI5 Q;  5J39 A;  3T1Y L;  4BA2 I;  1CKM A;  4YCU A;  2ZJR A;  3RD4 A;  5DLQ E;  2KBN A;  5D3D A;  4C56 C;  3UE0 A;  1UE6 A;  5GAE C;  2F0N A;  3KFU A;  3A56 A;  1QVF A;  1GHJ A;  1S4Z A;  5C44 G;  4KTA A;  1HCZ A;  2IHF A;  3GTP H;  2WKC A;  1TR5 A;  1XNQ Q;  5C4J B;  4FXK C;  1SE3 A;  4X64 L;  2R7Z G;  2EYM A;  5G3L F;  3HKZ G;  3A8K E;  5E4W C;  3AEV A;  2Q2I A;  1TS2 A;  1JOO A;  3KUP A;  3S14 B;  3S17 H;  5H1S E;  3VYU A;  2JA8 G;  4IFD H;  3S16 B;  2IY5 B;  4C3H G;  1QG7 A;  4RWS C;  2PI2 A;  1F9R A;  4QB4 A;  2PQA B;  2LXK A;  5CGK A;  4YWK A;  2CHB D;  4QJF A;  1ET6 A;  5C0X I;  5E4X A;  2E75 C;  4DK0 A;  5IGD A;  2LXJ A;  3K57 A;  2LKV A;  3J7Z C;  4DV1 L;  2K03 A;  3RLO A;  3T16 A;  1K8A C;  3RR5 A;  1IBM Q;  4R4O A;  4BXX H;  1PFB A;  2NVQ H;  4RAU C;  3S1Q B;  3H3V C;  3CF5 A;  4OO1 H;  3HOW H;  4G7Z C;  1UAP A;  1KNE A;  4JI3 L;  3CC7 A;  1HR0 W;  4GKK Q;  3K6O A;  1Q1E A;  5C4H A;  4OXP A;  2A8V A;  3K7A H;  4CDE C;  3VR4 A;  1HRJ A;  1IBK Q;  4ZK9 B;  1BVS A;  1QB5 D;  2LMC B;  2Z1C A;  5FJ8 H;  4JBM A;  4LFB L;  2F0P A;  3U9O A;  5KYI A;  4ZUI A;  5HGT A;  2PPB C;  4JV5 L;  3T4A C;  1O7Y A;  3KJP A;  4DV3 L;  1VCI A;  2LY7 A;  3EBE A;  4HTH A;  3M85 A;  1W6J A;  4OWX B;  2NVY B;  2B2T A;  4NPS A;  3GQB A;  2CH4 A;  2B2V C;  4R4I A;  3UDX A;  3H6M A;  1T9H A;  2I07 B;  3VR3 A;  1TKW B;  3G7L A;  1SFO B;  4BY1 B;  3FPP A;  2WFW A;  1V1P A;  1VQM A;  3BDO A;  4FVM A;  3I8Z A;  3TP5 A;  3MFG A;  3NWT A;  4IPG A;  4GKJ L;  5D3I B;  1TWG B;  2A69 D;  3E9H A;  3CP0 A;  4X3K A;  1PRT C;  1UEA B;  1QZG A;  1DZ1 A;  4X3U A;  2K5Q A;  1EQT A;  5C44 H;  1SNP A;  2M2L A;  1PV4 A;  2CWP A;  3NBH A;  1QWY A;  1H9M A;  1LYL A;  4QIW E;  1GM5 A;  3G6E A;  4RKL A;  2VQF L;  2R7Z H;  3MZ5 A;  2B8G A;  1SMX A;  2MQH A;  4H0L C;  3U50 C;  3HFZ B;  3PIO A;  3K58 A;  1CA5 A;  3C2P A;  2HDL A;  2EY6 A;  2UXB Q;  1QUQ B;  2JA8 H;  4H7B A;  2YU9 B;  2EDG A;  4C3H H;  1A8V A;  3HS0 C;  2XRS D;  3V05 A;  1LTT D;  4C2M B;  1HHV A;  4A3M B;  3I70 A;  4RG1 A;  4ZUJ A;  3EN2 A;  3KLW A;  1Y1W B;  1OXS C;  1JOQ A;  1D2B A;  1R4P B;  4UDU C;  2IX0 A;  3GTG B;  1JWU D;  1SMY C;  1UE1 A;  3NPP A;  1N34 Q;  1L1O B;  2KCT A;  2KCC A;  3H3V I;  3S1R B;  2ES2 A;  5I4D A;  1VQC A;  3OOC A;  3NEL A;  5JJL A;  2SNS A;  1IBL L;  1CKN A;  3I4N H;  3WOF A;  3HOU B;  5IP7 H;  1CM9 A;  1YNJ D;  2RA4 A;  2B63 B;  1L0W A;  2BA1 A;  3W5O A;  2WII B;  4F8M A;  1HQR D;  4F88 A;  1T5X D;  1TU2 B;  1IL2 A;  1KDA A;  2MHV A;  1LLR D;  4V19 0;  1N36 Q;  1CHP D;  5C5L A;  2WB1 G;  1TWA B;  1PH8 A;  2E5L L;  1S5C D;  2B2Y A;  3GTM B;  2JK8 A;  2BE5 D;  4MTK A;  5I6Y A;  1VS0 A;  3VYR A;  4AQY L;  2NB0 A;  4HED A;  2NZ1 D;  1M90 C;  4HSV A;  3OYY A;  4ILW A;  1PDQ A;  1NR2 A;  1Y1V G;  3BZC A;  4ZCK A;  4KD4 A;  2XNA C;  3W1B A;  2EZV A;  2K5N A;  3SVM A;  2G9D A;  5CYU A;  2B2T C;  5JPM C;  3CQZ H;  1DGS A;  3CC4 A;  4HSP A;  2F0G A;  1Q86 C;  5J1Z A;  2JN4 A;  4A3D B;  1U5K A;  2F4I A;  4UP7 A;  1B8A A;  2AWN A;  1YBY A;  3PMF A;  4JI0 Q;  1EQV A;  4XQQ A;  3CME A;  5D65 A;  5C0X J;  2WV6 D;  4A3J G;  1KDC A;  1EQR A;  2CWA A;  1HTP A;  4TSS A;  1I4Q A;  4K6L A;  1V1O A;  2CQA A;  2OTL A;  3NK9 A;  2OQK A;  4A3I B;  2KCM A;  2IWH A;  2I5H A;  5AFW A;  1MIU A;  2L0C A;  2FFK B;  3I90 A;  3PUW A;  2MJ8 A;  2Q2H A;  2CW0 D;  1E2Z A;  4Q0F A;  3DWQ A;  4UHV A;  1QNU A;  1TS4 A;  1JR0 D;  3MWY W;  3TQY A;  5C3E G;  5HY6 A;  5M3M G;  1FNU A;  2XN9 C;  1TY2 A;  5IYC H;  2JJQ A;  4A93 B;  2V1C C;  2FXQ A;  1O78 A;  1X3Q A;  1HR0 Q;  4ZLT F;  3MEH A;  1I6H H;  4GN4 B;  4B3S Q;  3SGI A;  3SR1 A;  4PMC A;  2F0O A;  4ME5 A;  1P16 A;  4HCE A;  1RKN A;  1HH2 P;  1J5E L;  2E74 C;  1STA A;  1PFM A;  4DV7 Q;  2UU9 L;  3QJY A;  1ZYR D;  1WCM H;  2F0I A;  1WTH A;  2F0E A;  4DR1 Q;  1VQG A;  2PW7 A;  1SJH D;  4K8I A;  4IAL A;  2ZM6 Q;  3DMU A;  3K80 C;  1SYD A;  2IHE A;  4Y7N H;  2RSO A;  1VF7 A;  1L0X B;  4A3F B;  1CA6 A;  4QUF A;  4CDC C;  2Q2T A;  3OIP A;  1H9S A;  4LF7 Q;  1MI2 A;  4HCS A;  4XXE A;  2EYP A;  4XQJ A;  4RCN A;  4UY8 C;  1XMQ Q;  5F2D A;  4C3I G;  2ZTE A;  4A3G B;  1YHB A;  1Q12 A;  1F9S A;  1SNC A;  1BCP F;  1PZK D;  2MUY A;  1DM0 B;  1TXY A;  2KJX A;  1RCV D;  5IP9 G;  3LGJ A;  1EWH A;  2BOS A;  4K6D A;  5C4X H;  3BDL A;  4L5T A;  4PZ8 A;  4KKT A;  3KDF B;  1H9K A;  3GV3 A;  4L63 B;  3H0G B;  4DR4 Q;  3KBX A;  1PH3 A;  1EY4 A;  4U68 A;  2Y0S E;  3Q6S A;  3H09 A;  1A3U A;  3BZD B;  4XIG S;  4K14 A;  3D8G A;  1VQ7 A;  2E2J B;  3FMC A;  2MGS A;  1XMO Q;  3I72 A;  3JAM E;  3T1H Q;  1HR0 L;  5IYB H;  5CV4 A;  3RZD H;  4HN7 A;  2BA0 A;  4M8A A;  1XTC D;  1TWC H;  1A62 A;  2UXC Q;  2MPM A;  4EQP A;  3BYT B;  2CH4 W;  4Y52 H;  1L2F A;  4CDF C;  4LFC L;  1R9T H;  4QQB X;  1LTB D;  3NBI A;  3W2D A;  2YTV A;  3E5S A;  3G4S A;  1LTG D;  4JI7 L;  5DM7 3;  5M3M H;  3T51 B;  1TY0 A;  2B2U A;  4LF5 Q;  3HOZ G;  4FO2 A;  2KCN A;  3A8I E;  3P1H A;  1PXU A;  3K5O A;  2ICE C;  2JP1 A;  1G51 A;  3KF6 A;  1BR9 A;  1GKH A;  1MBY A;  4O1N A;  2EJM A;  3R8B A;  4I7A A;  1R4Q B;  4JI8 L;  1QVC A;  2A6H D;  4LJZ C;  1D7Q A;  3KF8 B;  5LMN W;  3IFD A;  4DU9 A;  3TEH B;  3PO3 G;  3R93 A;  5C4J H;  1HNW L;  1X65 A;  1JCK B;  2PW5 A;  4JYA Q;  1V8Q A;  2UUC L;  3A7A B;  4BWG B;  1G2T A;  2L1B A;  2QEJ C;  3S14 H;  2B29 A;  4DV5 Q;  3S16 H;  5JJK A;  2SEB D;  1AE2 A;  3MHB A;  3UI2 A;  4O42 A;  4A3M G;  1WFQ A;  1Y1W G;  4G7O C;  2NN6 I;  4QGU A;  1EQQ A;  5BN4 A;  1FGU A;  4EQN A;  3MC0 B;  3TP6 A;  4KJO A;  4FF4 A;  5EKK A;  2VQE L;  2F0V A;  4DR2 Q;  2HIX A;  1A6X A;  2I46 A;  4ZQ3 A;  4KY7 A;  4X65 L;  3JAM L;  3S1Q H;  1MSG A;  2A5H A;  4XYO A;  3KLS A;  3HOY B;  2KUM A;  2Z9H A;  1B7Y B;  4DUZ Q;  1GUW A;  1HFN A;  1VQF A;  2XSC A;  3AMU A;  4JBJ A;  3HOU G;  1U0L A;  2B63 G;  1Q1B A;  1GD7 A;  4P71 A;  1SE4 A;  1WI5 A;  3LX0 A;  1NMG A;  3D4D A;  1XJV A;  3H15 A;  1PH9 A;  4DV4 Q;  1F2L A;  2PNR C;  3DHQ A;  1B70 B;  3ULP A;  1O7Z A;  3PUV A;  4KJN A;  5DAU A;  2NTT A;  1RJT A;  5BR8 L;  2DJF C;  1NJI C;  1C48 A;  4CDD C;  4HMJ A;  4IQZ A;  4AYB E;  2K05 A;  5JEA J;  5LMU Q;  2PCF B;  5FO9 B;  1EYC A;  4Q5V A;  1A2T A;  5HUR A;  4MZ9 A;  2P5Z X;  2RSN A;  4RGM A;  3A54 A;  4X66 Q;  2NVY H;  2PQA A;  1KAA A;  5FKA C;  2B3G A;  5FLM G;  4ALP A;  1DCZ A;  1SFO H;  1J8I A;  2J0T D;  4BY1 H;  3CRL C;  3FP9 A;  2J7Z A;  2L11 A;  3PF5 A;  1TWG H;  1E7Z A;  4B3T Q;  3AFP A;  2B2U C;  3HKS A;  1HUN A;  3CU7 A;  1B53 A;  1JOR A;  1YEZ A;  4N8F A;  1AZP A;  1AH9 A;  2RDG A;  2YYZ A;  2DUD A;  5G3L D;  2F0W A;  3FRP B;  1NE3 A;  4RHS A;  4JG2 A;  4DR2 L;  2F4V L;  1VQJ A;  1PZI D;  1ASZ A;  1HNZ Q;  3S1N B;  5LHY 1;  1ILQ A;  1YNN D;  4DUZ L;  4WJW A;  2YU9 H;  4XT1 B;  1Q8I A;  2UUB Q;  4C2M H;  1ML0 D;  4A3M H;  2EXD A;  1ZXT A;  2CCZ A;  1PH2 A;  5JEA G;  4IJH A;  1Y8P B;  3R2T A;  2KQ3 A;  3GTG H;  2Z8L A;  3SK5 A;  2A73 B;  4JVZ A;  1WTX A;  2K5H A;  5ELN A;  3CRK C;  4LMQ D;  5EBD A;  3T1Y Q;  4P2C B;  1M1K C;  1EEF D;  1EYG A;  2CFM A;  3S1R H;  4LAA A;  5ELC A;  1RD9 D;  2MO0 A;  2E8G A;  1EFI D;  3I2Z A;  1Y1V B;  4JOI A;  2KEC A;  2RHQ B;  1PH4 A;  1I4H A;  3D4W A;  3ERQ A;  2HUG A;  4J15 A;  2DY7 A;  2F1M A;  3HOU H;  4X64 Q;  2B63 H;  1ILP A;  2XTI A;  2Q8I B;  1HNX L;  5LL6 S;  4DGZ A;  3CMA A;  3GTL B;  2JSO A;  4RFB A;  3BVM A;  4LF6 L;  1CK1 A;  4WFN 3;  1U4R A;  4R4C A;  1K8M A;  1S40 A;  1TWA H;  3K81 C;  4A3J B;  2UUA L;  3GTM H;  2PZT A;  1F2M A;  1QE6 A;  1A15 A;  4OWT B;  4DAY B;  5CV7 A;  5JJZ A;  5T1I A;  1NMF A;  2HCC A;  1KLU D;  4YWL A;  5FLM H;  1XXG A;  4A3G G;  3EQL C;  1XNR L;  4DV1 Q;  1I4X A;  2JA6 G;  2O5I C;  4JI1 L;  1WTO A;  1CFM A;  3ULL A;  3WWV A;  1BNZ A;  2O2L D;  4JBW A;  3NQT A;  3J81 j;  4A3D H;  5C3E B;  4IZ8 A;  1IYU A;  4JI3 Q;  3RN5 A;  4LUV A;  4XDX A;  4LF8 L;  1WTW A;  4OGQ C;  1GUN A;  5KNC A;  4LK1 C;  2IT1 A;  4EQ5 A;  5CBA E;  4A3C H;  4LFB Q;  1UUP A;  5EPK A;  4U67 3;  3UDG A;  3CC2 A;  1MSH A;  4JV5 Q;  2NVX B;  3I7F A;  3QOJ A;  3K5M A;  4A3I H;  1HZB A;  1XTD A;  2VUM B;  1TS3 A;  4DV3 Q;  3S1M H;  4KK7 A;  3G71 A;  4IOC A;  1GUS A;  3STB D;  3NTK A;  4KKS A;  1ZYR C;  1JE5 A;  2PMZ B;  5FOB B;  3NWS A;  1YHA A;  3DM1 A;  4ZKB B;  3LWU A;  3GTK H;  1ESF A;  3K7U C;  2R7D A;  2C35 B;  1HJP A;  3MXN B;  4OL7 A;  2E2I B;  1AP0 A;  1K3B C;  4A3K B;  4GKJ Q;  3KBG A;  4A93 H;  4EVO A;  3OSO A;  3C46 A;  2YV5 A;  2WAQ B;  4C3I B;  4AIM A;  4DKA C;  1WTQ A;  1Z6H A;  4TKO B;  3DWP A;  5EBC A;  3RZO B;  1KL9 A;  1WJJ A;  1ZKO A;  2VQF Q;  1E1O A;  3J7A F;  4CKC A;  4K2L A;  4JOI C;  3MFY A;  3J7Y W;  1K9M C;  1SYF A;  5LMN L;  1KQS A;  1LM0 A;  2B2W A;  1EIF A;  2TSS A;  5KNB A;  4YHH L;  2PO4 A;  4IO9 A;  1HA6 A;  1RL2 A;  2AQ2 B;  4A3F H;  2Q2U A;  5KGU A;  4DV0 L;  3OW2 A;  1VQ8 A;  1YNX A;  5M5X B;  1HFG A;  4RKB A;  1GUG A;  4R8I A;  3J81 i;  4O2D A;  3OTO L;  3DM3 A;  3TSS A;  1JJ2 A;  3PV0 A;  1B3Q A;  1QVG A;  3S15 B;  2KED A;  1AFP A;  1Y8O B;  4JC0 A;  1KHI A;  1IBL Q;  5C6A A;  1HUM A;  2K5V A;  1IYV A;  1OXV A;  1S5B D;  1C4Q A;  3H91 A;  1PMR A;  3HOY G;  3GTJ B;  2SNM A;  4P75 A;  1SE8 A;  4GNX B;  1PTO B;  1VQI A;  3H0G H;  3HOZ B;  4ZRZ A;  1JOK A;  3J80 E;  5IGB A;  1STY A;  3SEB A;  1VQN A;  1J9O A;  2E2J H;  2G9H D;  4HR7 B;  4CJ0 B;  1AE3 A;  1MJC A;  2JQO A;  5NUC A;  2E5L Q;  4LF9 L;  4NDX A;  4A3L G;  1LTL A;  2SDF A;  3PO3 B;  2NUC A;  3OMG A;  4HID A;  2J4X A;  4AQY Q;  3QG1 A;  3OHX C;  2IX3 A;  3E6Z X;  4A3B B;  2AKW B;  3T53 B;  1EOV A;  2K75 A;  2NTS A;  2KOL A;  5IIF A;  4JI2 L;  1H95 A;  5M3F G;  1KXL A;  1A63 A;  1KTK A;  5CV6 A;  4CHT B;  4PZ6 A;  1N9W A;  2MP1 A;  1V1Q A;  2F0S A;  3GV6 A;  3VR2 A;  4IPD A;  1LT4 D;  4DV6 L;  1PYS B;  3CCE A;  3NQI A;  3AU7 A;  4YY3 L;  3NE5 B;  3FEW X;  3J7A 5;  1RIP A;  2N78 A;  4AH6 A;  2A74 C;  3KDF A;  5GRO A;  4GLA C;  5A35 A;  2MFI A;  4XTC S;  2HIV A;  1E1T A;  4A3E B;  1XPU A;  3D3R A;  4IUQ A;  1F2Y A;  2FJ2 A;  4QF4 A;  1KNA A;  4H02 A;  1XYI A;  4JW0 A;  2ZT9 C;  5I6W A;  3J80 c;  3GO5 A;  2B2W C;  1VQ5 A;  4ZKC B;  4N9T A;  5IY0 A;  3K0X A;  4DXG A;  2EYO A;  1LV9 A;  1PYW D;  4JBK A;  5IOD A;  1X6O A;  3VR6 A;  1PRT B;  2WB1 E;  4LFA L;  4ULL A;  4DAM A;  4IUV A;  5IOC A;  1D5X C;  3J80 L;  1LT3 D;  1PVO A;  3V96 A;  4MHE A;  1SJE D;  5I9P A;  1K0S A;  1J5E Q;  4H13 C;  4KHZ A;  4LW1 A;  3KLS X;  2UU9 Q;  1EYD A;  2EYL A;  1GVP A;  5LL6 X;  4HJ5 A;  3SK8 A;  5FLX E;  5COY A;  1FYC A;  2EJG C;  3KF8 A;  4KY6 A;  5JAV A;  1PA6 A;  3I4M G;  5C5M A;  1F2Z A;  4FXD A;  1VMP A;  4RA8 A;  4DAP A;  4NMZ A;  2RKS A;  3CCU A;  2QF7 A;  4OON A;  1YHQ A;  5GAG C;  2F3W A;  1YI2 A;  3U58 A; 
#chains in the Genus database with same CATH homology
 4KN4 C;  2DN8 A;  2ZXO A;  2NVT B;  4UAI A;  1DJR D;  3C1E A;  4YIJ A;  1ONL A;  1I4R A;  1BQQ T;  4X3T A;  3URY A;  2A6E C;  4DAV A;  1SBB B;  2N88 A;  1F9P A;  1I3Q B;  2JA5 B;  3TBI B;  3IL8 A;  1LTI D;  4MN3 A;  5TSS A;  1EU3 A;  2E2D C;  3EFX D;  4FP5 D;  4IUN A;  1SYG A;  1H9R A;  5C0X G;  1RDP D;  1A3T A;  4KY5 A;  2F0K A;  1V1P B;  1RF2 D;  2PZW A;  1DXM A;  2M9V A;  2X69 A;  5FLX L;  3DEO A;  4IFD I;  3AB9 A;  3IKJ A;  2E2H B;  1PTO D;  1TWF B;  4OHJ A;  1CQF A;  3ND8 A;  2F0Q A;  2JA6 B;  3K5L A;  3FDT A;  2EE1 A;  3BVZ A;  3CHB D;  3K7A B;  2IW3 A;  2KA7 A;  5CBE E;  1D6E C;  3TP8 A;  3I3C A;  3T56 B;  1FR3 A;  4KMU C;  4B9X A;  3S2H B;  1TWH B;  4IUT A;  1GXD C;  4OO1 I;  5DEH A;  1I50 B;  1VDZ A;  1RTO A;  4FF1 A;  4L8J A;  2HCI A;  2X6G A;  2O5J C;  1Z7T A;  3PO2 B;  3X3N A;  4QUC A;  1U4L A;  2BDN A;  5M5Y B;  3T13 A;  2SOB A;  2H4O A;  4PQX A;  1G91 A;  1OXX K;  4KHV A;  1B44 D;  5JPN C;  1B9N A;  3I4L A;  4NKL A;  1KDB A;  3GTQ B;  4EGV A;  2K01 A;  5EPL A;  2JYO A;  1JIC A;  1MD2 D;  1WTR A;  1GHK A;  2OF1 A;  1SXT A;  1CZG A;  1D1K A;  1G8Z D;  1O7L A;  1PRT D;  1HQM C;  5C0X H;  2CVR A;  4IUR A;  4G57 A;  1B1Z A;  5FO7 B;  2FMM A;  1ENF A;  3KLR A;  4OIK A;  3U9S A;  4WOR A;  5D14 A;  5E3F A;  4ID6 A;  3NHH A;  1F77 A;  4BS9 A;  4F7X A;  1JQY D;  1JB3 A;  5CR3 A;  2OT2 A;  5JVG 3;  4CBV A;  3M3Y B;  2K32 A;  2DNE A;  3GD7 A;  1Q3L A;  3LWE A;  3SK4 A;  3TZD A;  1IKL A;  4PNY A;  3CKI B;  1E2W A;  3HOX B;  1E0B A;  4IN3 A;  2A69 C;  5EKI A;  1CQV A;  3NUC A;  1QNK A;  4CKE A;  1FNW A;  1TVX A;  1WD1 A;  4BA1 I;  1H9J A;  1D5M C;  5M3F B;  5ELE A;  3Q24 A;  2F0U A;  3DUZ A;  4QIW B;  2KVM A;  1PTO H;  2HDM A;  3Q0A A;  1DON A;  4KV6 A;  1IL8 A;  2F0F A;  5I2X A;  4IFD J;  1NAP A;  1STB A;  1WTP A;  1Y69 U;  1EY5 A;  1H9S B;  2XRQ D;  1U4P A;  2ZXP A;  3OMC A;  1PFN A;  5KND A;  1Q90 A;  2R93 B;  1W6K A;  1FNV A;  1JWS D;  3O13 A;  1KLG D;  1CTM A;  1B2T A;  1B50 A;  1YNJ C;  2K6A A;  2ICI A;  1K83 B;  2XVS A;  3TZU A;  1NR4 A;  5IGG A;  1BF4 A;  4J8Q A;  1STG A;  2QIL A;  2JEB I;  4V0B A;  3VYS A;  3M7N A;  2BE5 C;  3P20 A;  4TQU S;  1M8A A;  2JE6 I;  1Y8N B;  3C3L A;  3I4M B;  4JK1 C;  1LTS D;  2K5D A;  1TQO A;  1STE A;  1ESR A;  2B39 A;  5KYL A;  2AUJ D;  2EXZ A;  1GUO A;  1LAC A;  2F3V A;  3PUX A;  1NSN S;  3R2I A;  1EL0 A;  3VA5 A;  3ND9 A;  1SEB D;  1SYB A;  2WKD A;  1C8C A;  2HQE A;  5K36 G;  5E1F A;  1PZJ D;  2M00 A;  1BCP B;  5I9O A;  2CW0 C;  4DN4 M;  2QCP X;  3ZYY X;  1A2U A;  1HTL D;  2EYJ A;  3W3A A;  5EKL A;  2R61 A;  3SK6 A;  3G6J B;  1HA5 A;  2FHT A;  1MGS A;  1LAB A;  4CGY B;  1B4O A;  2EOT A;  2EY5 A;  2LFN A;  1RTN A;  1CZW A;  5J22 A;  4FYD A;  4MIU A;  1VMC A;  4M1U B;  2JEA I;  2NBF A;  1AZQ A;  1SND A;  1BDO A;  4BBS B;  5JEA H;  3ERO A;  3DXJ C;  4DF7 A;  1AN8 A;  4BBR B;  4XQN A;  2AUK A;  3L3O C;  2F03 A;  5EPJ A;  1GJX A;  2VXW A;  2XWJ B;  4FF2 A;  3GP7 A;  1PTO C;  2R92 B;  3DWA A;  3HRZ C;  1SNQ A;  1BXT A;  1EY6 A;  2NN6 G;  2FIN B;  2IX1 A;  2F0M A;  2PYK A;  1SYC A;  4B08 A;  3S9W A;  1SDF A;  3TN2 A;  3VR5 A;  4DXF A;  3OW7 A;  1SSO A;  1LTR D;  4B9W A;  2Y0S B;  3QIA A;  2AQ1 B;  1LT5 D;  1WTV A;  5K36 H;  3RMH A;  1FGB D;  1X32 A;  5JOB A;  1K8O A;  1I6V C;  2F0H A;  1SE2 A;  3S2D B;  1M4V A;  3F2U A;  1F9Q A;  1G29 1;  2IPK D;  2JA7 B;  3L9A X;  1SNM A;  2A68 D;  3K59 A;  3V2T A;  1UNS A;  5KEE A;  2L9H A;  2F0D A;  2PQE A;  4ZAI A;  3ITP A;  2A6H C;  1DD2 A;  3FPU B;  1EIG A;  3GTO B;  4RGN A;  2L4N A;  4RH6 A;  1IW7 D;  4NP5 A;  2RDF A;  5M9O A;  2RBM A;  2K7V A;  5K5P A;  1LO5 D;  5FO8 B;  3HOV B;  4G4K A;  2DNC A;  3EJI A;  1EY7 A;  1SNO A;  3D6C A;  3OWF A;  1ZEQ X;  1V43 A;  4K5X A;  4IUU A;  3D6W A;  3NXW A;  4K5V A;  5M5W B;  4BY7 B;  1CI3 M;  4PMW A;  3OIQ A;  1B3A A;  1X3P A;  1EYA A;  1VF5 C;  5COR A;  2IL8 A;  1EZ8 A;  2NN6 H;  2VB2 X;  1L0Y B;  3PUY A;  1GUT A;  4FNF A;  5I2Y A;  3BDC A;  3TDQ A;  3OPO A;  3A7L A;  4OIJ A;  3N52 A;  3VA7 A;  3D4R A;  1T5E A;  1G2S A;  3HZX A;  3MVV A;  2C9O A;  2Z4I A;  2V4D A;  5DM6 3;  3BVG A;  3FKI B;  4RGO S;  1BCP D;  5ELB A;  1SAP A;  5IT9 E;  2Q8R E;  3BYY B;  4K5W A;  2E76 C;  4RGT A;  3PUZ A;  2OXP A;  2ZXR A;  3QOL A;  4C1N K;  5CV5 A;  3VYT A;  4AYB B;  5C4Z A;  4NW2 A;  4I7Z C;  4C3J B;  4GZY C;  5CV8 A;  1I4P A;  5KIX A;  1TT2 A;  2RDH A;  4TRD A;  4G7H C;  5EGT A;  4WRD A;  1U9R A;  2WAC A;  3PIO 3;  2TMP A;  4QCL A;  1OXU A;  1BBX C;  2R3Z A;  1S5E D;  1A3V A;  2F0J A;  4J1M A;  3A8J E;  3M4O B;  3I91 A;  2KHS A;  2Q8T A;  2H1E A;  1B9M A;  4KKU A;  1YNN C;  5CC4 A;  1ET9 A;  1EY9 A;  4E6I A;  2D2C C;  4N9P A;  3WDN A;  3QB3 A;  3HG9 A;  2L55 A;  4EQO A;  3IAY A;  3GTP B;  4ABN A;  3S1M B;  1O80 A;  2QDB A;  2WP8 J;  2ENB A;  2F0T A;  5IGE A;  3RLF A;  3GTK B;  3S17 B;  4QMG A;  2EYH A;  1ENC A;  3SXH A;  1PLF A;  4CJ2 C;  3NSW A;  5IT9 L;  1CT1 D;  1E2V A;  1STH A;  1XWE A;  3X3M A;  2EPB A;  2OEO A;  1RHP A;  1BOS A;  2EJF C;  1HXY D;  2XWB B;  3HP3 A;  1LT6 D;  5CMD A;  2LS0 1;  2L5T A;  2X6L A;  5C3X A;  2NVQ B;  3MXG A;  3IFT A;  4CKB A;  1SYE A;  1EZ6 A;  3HOW B;  2D5D A;  2RQX A;  3MXU A;  3Q23 A;  3J81 E;  4I65 A;  2B2Y C;  4K2K A;  3KK7 A;  1I4G A;  1WD0 A;  5CV9 A;  3MXP A;  3SE0 A;  1BO0 A;  1HPC A;  2PZU A;  3SDZ A;  2WIN B;  5C3W A;  1EEI D;  4ODG A;  3H94 A;  1EOT A;  2Z4H A;  1DOK A;  4KD3 A;  3LNN A;  4J6H A;  1ICW A;  3P7J A;  4DNR B;  2VB3 X;  5C44 B;  4XT3 B;  4F87 A;  1EU4 A;  2R7Z B;  3L7Z C;  5T1G A;  3HKZ B;  1DOM A;  3EVQ A;  2N55 A;  1II3 A;  3Q22 A;  2VNU D;  1NUC A;  5IGC A;  1ROD A;  2JA8 B;  4C3H B;  4Z9C B;  5BN3 A;  3E0J A;  1AW7 A;  4FF3 A;  1EY0 A;  4DA2 A;  2R6G A;  4R8N A;  1FD7 D;  3M4Y A;  4DAY A;  3MTS A;  1OXT A;  2K5W A;  1IHZ A;  3ONA B;  1LTA D;  3I4N B;  3BS1 A;  3J81 L;  2NYZ D;  3FVQ A;  2D62 A;  4KN7 C;  3EA6 A;  1STN A;  1EY8 A;  4RHR A;  1SMY D;  3DEP A;  2K33 A;  2ID0 A;  4S3S A;  3M7G A;  4ZYS A;  1QIL A;  5EJW A;  2FMC A;  1DYQ A;  3NP8 A;  4DNT B;  3WOE A;  1NCV A;  2L12 A;  3HEJ A;  1PTO F;  1EIH A;  2BCO A;  2A68 C;  3OWE B;  2EVB A;  3MXN A;  3CQZ B;  1QJO A;  2XIW A;  3QWN A;  2KEE A;  1S5F D;  3BG3 A;  3R3O A;  1IW7 C;  3N6R A;  5FK9 C;  3I73 A;  2K04 A;  2K28 A;  4C3J G;  5A2Q E;  1S5D D;  1XX8 A;  1CHQ D;  5ELD A;  2GA4 B;  3NTI A;  4H44 C;  3P75 A;  4DFA A;  1TS5 A;  2IJ0 A;  3QO2 A;  4C1N I;  1D5Z C;  2O4X A;  3RUZ A;  4HAE A;  3D31 A;  1AEX A;  4HMI A;  4L6T B;  3SHL A;  5BN5 A;  3TP7 A;  1I6H B;  5EQ0 A;  4FXG C;  4DK1 A;  2EYF A;  1WCM B;  5ISR A;  2A6E D;  4X3S A;  5ELF A;  1TII D;  1BCP C;  2DY8 A;  3K0Y A;  2EY1 A;  1JE4 A;  1PRT F;  3MA2 B;  4Y7N B;  1BUV T;  1GOZ A;  5DNF A;  2WB1 B;  4IFD G;  3PIP 3;  4PV1 C;  1DOL A;  1EWC A;  1IKM A;  2F0L A;  3HGB A;  1ENA A;  1Z47 A;  4XYQ A;  3MAQ A;  3C1F A;  4IUP A;  1WVL A;  5JVH 3;  1JWM D;  2EY2 A;  2BDO A;  2AQ3 B;  5A2Q L;  3NTH A;  2NWG A;  5C4X B;  2K1B A;  2D9U A;  4OO1 G;  5IGF A;  2RVL A;  3K5N A;  1JC7 A;  3J7A V;  4K8J A;  3TME A;  4R9W A;  2JXM B;  3RZD B;  4PMB A;  1TWC B;  1U4M A;  4CJ1 B;  2C5C A;  2B2V A;  4RCO A;  2AWO A;  4KI0 A;  1R9T B;  1G6Z A;  1QCB D;  1KAB A;  3A55 A;  2QKI C;  1QOH A;  2B8F A;  1D1I A;  5KRU A;  1OO9 B;  5M3M B;  5J39 A;  4BA2 I;  3RD4 A;  5D3D A;  4C56 C;  2F0N A;  3A56 A;  1GHJ A;  1S4Z A;  4KTA A;  1HCZ A;  2WKC A;  1TR5 A;  5C4J B;  4FXK C;  1SE3 A;  2EYM A;  5G3L F;  3A8K E;  5E4W C;  1TS2 A;  1JOO A;  3KUP A;  3S14 B;  3VYU A;  4IFD H;  3S16 B;  4C3H G;  1QG7 A;  4RWS C;  1F9R A;  4QB4 A;  5CGK A;  2CHB D;  1ET6 A;  5C0X I;  5E4X A;  2E75 C;  4DK0 A;  5IGD A;  3K57 A;  2LKV A;  2K03 A;  3T16 A;  1PFB A;  4RAU C;  3S1Q B;  3H3V C;  4OO1 H;  4G7Z C;  1UAP A;  1KNE A;  3K6O A;  1Q1E A;  5C4H A;  3VR4 A;  1HRJ A;  4ZK9 B;  1QB5 D;  2LMC B;  2Z1C A;  2F0P A;  3U9O A;  5KYI A;  4ZUI A;  5HGT A;  2PPB C;  3T4A C;  1O7Y A;  1VCI A;  2LY7 A;  4HTH A;  3M85 A;  1W6J A;  2NVY B;  2B2T A;  3GQB A;  2B2V C;  3H6M A;  2I07 B;  3VR3 A;  1TKW B;  3G7L A;  1SFO B;  4BY1 B;  3FPP A;  1V1P A;  3BDO A;  4FVM A;  3I8Z A;  3TP5 A;  3MFG A;  3NWT A;  5D3I B;  1TWG B;  2A69 D;  4X3K A;  1PRT C;  1UEA B;  1DZ1 A;  4X3U A;  2K5Q A;  1EQT A;  1SNP A;  2M2L A;  3NBH A;  1QWY A;  1H9M A;  4RKL A;  3MZ5 A;  2B8G A;  4H0L C;  3K58 A;  1CA5 A;  3C2P A;  2HDL A;  2EY6 A;  4H7B A;  2YU9 B;  2EDG A;  3HS0 C;  2XRS D;  3V05 A;  1LTT D;  4C2M B;  1HHV A;  4A3M B;  3I70 A;  4ZUJ A;  1Y1W B;  1OXS C;  1JOQ A;  1D2B A;  1R4P B;  4UDU C;  2IX0 A;  3GTG B;  1JWU D;  1SMY C;  3NPP A;  2KCC A;  3S1R B;  5I4D A;  3OOC A;  2SNS A;  3WOF A;  3HOU B;  1CM9 A;  1YNJ D;  2RA4 A;  2B63 B;  2BA1 A;  2WII B;  4F8M A;  1HQR D;  4F88 A;  1T5X D;  1TU2 B;  1KDA A;  2MHV A;  1LLR D;  4V19 0;  1CHP D;  5C5L A;  1TWA B;  1S5C D;  2B2Y A;  3GTM B;  2BE5 D;  5I6Y A;  3VYR A;  2NB0 A;  4HED A;  2NZ1 D;  4HSV A;  4ILW A;  1PDQ A;  1NR2 A;  4KD4 A;  2XNA C;  2EZV A;  3SVM A;  2G9D A;  5CYU A;  2B2T C;  5JPM C;  4HSP A;  2F0G A;  5J1Z A;  4A3D B;  2F4I A;  2AWN A;  3PMF A;  1EQV A;  4XQQ A;  5D65 A;  5C0X J;  2WV6 D;  1KDC A;  1HTP A;  4TSS A;  1I4Q A;  4K6L A;  1V1O A;  2CQA A;  3NK9 A;  4A3I B;  2IWH A;  5AFW A;  2L0C A;  2FFK B;  3I90 A;  3PUW A;  2MJ8 A;  2CW0 D;  1E2Z A;  4Q0F A;  3DWQ A;  1QNU A;  1TS4 A;  1JR0 D;  3MWY W;  1FNU A;  2XN9 C;  1TY2 A;  4A93 B;  1O78 A;  1X3Q A;  4ZLT F;  3MEH A;  3SR1 A;  4PMC A;  2F0O A;  4ME5 A;  4HCE A;  1RKN A;  2E74 C;  1STA A;  1PFM A;  3QJY A;  1ZYR D;  2F0I A;  2F0E A;  2PW7 A;  1SJH D;  4K8I A;  4IAL A;  3DMU A;  1SYD A;  2RSO A;  1VF7 A;  1L0X B;  4A3F B;  1CA6 A;  4QUF A;  3OIP A;  1H9S A;  1MI2 A;  4HCS A;  4XXE A;  2EYP A;  4XQJ A;  4RCN A;  5F2D A;  4C3I G;  4A3G B;  1Q12 A;  1F9S A;  1SNC A;  1BCP F;  1PZK D;  2MUY A;  1DM0 B;  2KJX A;  1RCV D;  1EWH A;  2BOS A;  4K6D A;  3BDL A;  4KKT A;  1H9K A;  3GV3 A;  4L63 B;  3H0G B;  3KBX A;  1EY4 A;  4U68 A;  3Q6S A;  3H09 A;  1A3U A;  3BZD B;  4XIG S;  4K14 A;  3D8G A;  2E2J B;  3FMC A;  2MGS A;  3I72 A;  3JAM E;  5CV4 A;  4HN7 A;  2BA0 A;  4M8A A;  1XTC D;  2MPM A;  4EQP A;  3BYT B;  1LTB D;  3NBI A;  3W2D A;  3E5S A;  1LTG D;  5DM7 3;  3T51 B;  1TY0 A;  2B2U A;  4FO2 A;  2KCN A;  3A8I E;  3P1H A;  1PXU A;  3K5O A;  2ICE C;  2JP1 A;  1BR9 A;  1MBY A;  3R8B A;  4O1N A;  2EJM A;  1R4Q B;  2A6H D;  4LJZ C;  3IFD A;  4DU9 A;  3R93 A;  1JCK B;  2PW5 A;  1V8Q A;  3A7A B;  4BWG B;  1G2T A;  2L1B A;  2QEJ C;  2SEB D;  3MHB A;  3UI2 A;  4O42 A;  4G7O C;  2NN6 I;  5BN4 A;  4EQN A;  3MC0 B;  3TP6 A;  4KJO A;  4FF4 A;  5EKK A;  2F0V A;  1A6X A;  2I46 A;  4ZQ3 A;  4KY7 A;  3JAM L;  1MSG A;  2A5H A;  4XYO A;  3KLS A;  3HOY B;  2KUM A;  1GUW A;  1HFN A;  2XSC A;  3AMU A;  1Q1B A;  1SE4 A;  3LX0 A;  3D4D A;  1F2L A;  2PNR C;  3DHQ A;  1O7Z A;  3PUV A;  4KJN A;  5DAU A;  2NTT A;  1RJT A;  1C48 A;  4HMJ A;  4IQZ A;  2K05 A;  5JEA J;  2PCF B;  5FO9 B;  1EYC A;  4Q5V A;  1A2T A;  5HUR A;  2RSN A;  4RGM A;  3A54 A;  1KAA A;  5FKA C;  1DCZ A;  1J8I A;  2J0T D;  3CRL C;  2J7Z A;  2L11 A;  2B2U C;  1HUN A;  3CU7 A;  1B53 A;  1JOR A;  1AZP A;  2RDG A;  2YYZ A;  5G3L D;  2F0W A;  3FRP B;  4RHS A;  1PZI D;  3S1N B;  5LHY 1;  1ILQ A;  1YNN D;  4WJW A;  4XT1 B;  1Q8I A;  1ML0 D;  1ZXT A;  5JEA G;  1Y8P B;  3R2T A;  2KQ3 A;  2Z8L A;  3SK5 A;  2A73 B;  1WTX A;  3CRK C;  4LMQ D;  5EBD A;  4P2C B;  1EEF D;  4LAA A;  5ELC A;  1RD9 D;  1EFI D;  1Y1V B;  2KEC A;  1I4H A;  3D4W A;  3ERQ A;  2HUG A;  2DY7 A;  2F1M A;  1ILP A;  2Q8I B;  5LL6 S;  4DGZ A;  3GTL B;  2JSO A;  4RFB A;  3BVM A;  1CK1 A;  4WFN 3;  1U4R A;  1K8M A;  4A3J B;  2PZT A;  1F2M A;  1QE6 A;  1A15 A;  5CV7 A;  5JJZ A;  5T1I A;  2HCC A;  1KLU D;  1XXG A;  3EQL C;  1I4X A;  2O5I C;  1WTO A;  1CFM A;  1BNZ A;  2O2L D;  4JBW A;  3NQT A;  5C3E B;  4IZ8 A;  1IYU A;  4XDX A;  1WTW A;  4OGQ C;  1GUN A;  5KNC A;  4LK1 C;  2IT1 A;  5CBA E;  1UUP A;  5EPK A;  4U67 3;  2NVX B;  1MSH A;  3QOJ A;  3K5M A;  2VUM B;  1TS3 A;  4KK7 A;  1GUS A;  3NTK A;  4KKS A;  1ZYR C;  2PMZ B;  5FOB B;  3NWS A;  3DM1 A;  4ZKB B;  3LWU A;  1ESF A;  4OL7 A;  2E2I B;  1AP0 A;  4A3K B;  3KBG A;  4EVO A;  3OSO A;  3C46 A;  2WAQ B;  4C3I B;  1WTQ A;  1Z6H A;  4TKO B;  3DWP A;  5EBC A;  3RZO B;  1ZKO A;  3J7A F;  4CKC A;  4K2L A;  3MFY A;  3J7Y W;  1SYF A;  2B2W A;  2TSS A;  5KNB A;  2PO4 A;  1HA6 A;  2AQ2 B;  5KGU A;  5M5X B;  1HFG A;  4RKB A;  1GUG A;  4R8I A;  3TSS A;  3PV0 A;  3S15 B;  2KED A;  1AFP A;  1Y8O B;  1IYV A;  5C6A A;  1HUM A;  1OXV A;  1S5B D;  1C4Q A;  3H91 A;  1PMR A;  3GTJ B;  2SNM A;  1PTO B;  3HOZ B;  4ZRZ A;  1JOK A;  3J80 E;  5IGB A;  1STY A;  3SEB A;  1J9O A;  2G9H D;  4HR7 B;  4CJ0 B;  5NUC A;  4NDX A;  2SDF A;  3PO3 B;  2NUC A;  3OMG A;  2J4X A;  3QG1 A;  3OHX C;  2IX3 A;  3E6Z X;  4A3B B;  3T53 B;  2NTS A;  2KOL A;  5IIF A;  1KTK A;  5CV6 A;  4CHT B;  2MP1 A;  2F0S A;  3GV6 A;  3VR2 A;  1LT4 D;  3NQI A;  3AU7 A;  3NE5 B;  3FEW X;  2A74 C;  5A35 A;  4XTC S;  4A3E B;  3D3R A;  4IUQ A;  1F2Y A;  2FJ2 A;  4QF4 A;  1KNA A;  1XYI A;  2ZT9 C;  5I6W A;  3GO5 A;  2B2W C;  4ZKC B;  4N9T A;  4DXG A;  2EYO A;  1LV9 A;  1PYW D;  5IOD A;  3VR6 A;  1PRT B;  4ULL A;  4IUV A;  5IOC A;  1D5X C;  3J80 L;  1LT3 D;  3V96 A;  4MHE A;  1SJE D;  5I9P A;  4H13 C;  4KHZ A;  3KLS X;  1EYD A;  2EYL A;  5LL6 X;  3SK8 A;  5FLX E;  5COY A;  1FYC A;  2EJG C;  3KF8 A;  4KY6 A;  5JAV A;  5C5M A;  1F2Z A;  4FXD A;  1VMP A;  4RA8 A;  4DAP A;  4NMZ A;  2RKS A;  2QF7 A;  2F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...