2KCTA

Solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g.
rcsb
source organism Desulfovibrio vulgaris str. hildenborough
molecule tags Chaperone
molecule keywords Cytochrome c-type biogenesis protein CcmE
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2kctA01
3GTPH 2B29A 3S14H 3HOYG 1L0WA 1HNZL 2VUMG 1WJJA 1N36L 1JMCA 1NJIC 3JC66 4OONA 2BA0A 4HJ9A 3STBC 3DM3A 4K0KL 1PH9A 1VQNA 1VQEA 3UDFA 3CCEA 2Z6KC 3TREA 4QGUA 1CSPA 3EBEA 5IP7G 2JA6G 1VQ6A 4RMFA 4P71A 4BBSG 2UXCL 1X54A 2OWOA 3UE0A 1HZ9A 2VS1A 1Y1WH 2F3IA 1VQFA 3UDXA 1XPOA 1GM5A 3UDIA 2VZAA 4HJAA 3WWVA 4YWKA 1IYJB 1BBWA 5C0XG 2C35B 4A3FG 1PH2A 2UUBL 2K4KA 1FJGL 4DR4Q 2A1AA 3L7ZC 4A3IH 2JEAI 1C0AA 4QL5A 1IBLL 1N32Q 4A3CH 1HNXL 3HOVG 5LMNW 4A3JH 4IFDJ 1G51A 2GN5A 2OTJA 2R93H 2MO1A 3NEMA 4QIWE 3PUVA 4A3LG 3CW2C 4DV2L 2I0QA 2I5HA 4JOIC 2MO0A 1QVCA 3CF5A 4A3MG 4A3KG 1KRTA 4BY7H 3KF6B 3GTKH 3HOWG 3GDEA 2A8VA 4HJ8A 4EQ5A 4JI7L 3ULLA 2Q2UA 2K5NA 1B8AA 2ZTEA 4LUZA 3F2CA 2JA9A 3FKIH 1D8LA 2UU9L 2RHQB 3TS0A 1P8LA 3M4PA 5IP7H 5J3BA 1E1TA 4X65Q 4GKJQ 4QY7A 5IYBG 1KHIA 1IXRA 4OWWB 3M3YH 3J81i 3PO2H 2AHOB 2FXQA 3W1GA 2VQEQ 1OXUA 2VQEL 1JB7A 4QQBX 4GN4B 4BBSH 4AYBE 4O0AA 4LUVA 4DV6L 2JA7G 1X6OA 3CAMA 1HR0L 2UUAL 4DR2L 4R4QA 3KFUA 1TWAH 2WFWA 2CWPA 4YWMA 4IO9A 2E5LQ 1KD1C 4HIOA 3KOJA 5GROA 1GD7A 4X62L 1CKNB 1QVFA 3ERSX 3HOXG 4JBJA 4JI2Q 2D0PA 4AH6A 5ELOA 1XJVA 4JI0L 3A0JA 1PH8A 2R92G 3M4QA 2ZJRA 4DV4Q 4DV4L 1XNQQ 1V9PA 2YTVA 2YTYA 1M90C 5M3MG 4JV5Q 2CCZA 1KRSA 1NY4A 4WJ3M 2EQSA 5JEAG 1CUKA 4GLXA 1G6PA 2ALYB 3K8AA 2JA5H 3U4VA 2RF4A 4LUOA 4JI6Q 1ASYA 3M4OH 3GTMH 1SROA 2QEXA 1BVSA 3G71A 3J7ZC 2VY3A 1PYBA 4DR4L 2JQOA 2K14A 1NMFA 5AJ3Q 4HIKA 3A5UA 2K5HA 1L1OB 2NVYH 1YJ9A 3I4OA 1QVGA 5M3FH 4GLAC 3I4NH 1SMXA 3PIOA 3OTOQ 4POGA 1X9NA 4GOPB 4LFCQ 1Q82C 4JYAL 2Y0SE 4Y52H 4POFA 3HOWH 1EQRA 4A4IA 4X65L 4GNXA 2JE6I 2MQHA 1A62A 4X66Q 4LWCA 1JE5A 2R7ZH 1M1KC 4IFDI 1EUJA 3PUXA 4AYBG 1Q12A 3L2PA 3U58A 3I56A 5K36G 1JJGA 4IPCA 4XTCS 1FGUA 2HQLA 4DUZL 4P75A 4IJLA 2EIFA 2JJQA 2F4VL 1DGSA 3S24A 1S72A 1HNWL 1YBYA 5GQOA 4PMWA 1Y14B 1NTGA 2NVTH 4JBKA 4DR7Q 3H15A 1WOCA 1H95A 1VQIA 4R4TA 1B70B 2HIVA 3BZCA 4XIGS 1QZGA 1WFQA 2K50A 4DV7L 3CPWA 4APVA 4LNQA 1ASZA 4NB3A 5GAEC 4GNXC 3KLWA 1UE6A 4A3EG 1IL2A 3T1YL 2UXCQ 1VQCA 4A3KH 1L1OA 1A0IA 5C0XJ 1SR3A 1K0RA 4YHHL 3MXNB 4B3SL 4JI6L 1EOVA 3I4MH 2L15A 1G291 1Q1EA 3M7NA 1X56A 1U0LA 2ZTDA 2HT1A 1YJNA 5M3FG 3I4NG 3S15H 3BJUA 3PGZA 1A63A 1I3QH 1E22A 1X3EA 4NPSA 1IBMQ 3S1NH 2K52A 4HIDA 4DR6L 2ZM6Q 1K8GA 1YVCA 4GKKQ 5FJ8H 3KYHC 4YY3L 1Y1VG 1HNZQ 2Y0SG 1YEZA 2B3GA 2XTIA 4JBWA 2IX1A 3PO3G 1OXSC 1A8VA 1I6HH 4P74A 4OO1I 4BBRG 2YV5A 3RLNA 3RR5A 1EWIA 4LF4Q 5JJLA 1E24A 1XMOL 1X55A 2LXJA 5IT9c 1PA6A 4L5TA 1MJCA 4TVAB 4X64Q 5C3EG 2UUCQ 1I50H 1CKOA 5JJIA 1CKNA 4B3TQ 4DV6Q 3CCSA 1KL9A 3H0GH 5IP9G 3CCVA 1XMQL 1UE1A 2IHEA 3HOXH 4GN3B 5AJ3L 2KCTA 4JI4Q 1N33L 3M9BA 1I5FA 3SGIA 2AKWB 4C3JH 3T1HL 2JA6H 3D0FA 4PG3A 1N8RC 4A3GG 2UXBL 3STBD 4MZ9A 1SLJA 4JI1L 2UU9Q 3CD6A 1XNRQ 3RZOH 1YNXA 2CKZB 4DR6Q 4OX9Q 4DUYL 5LMNQ 3HKZE 3RLFA 1XPRA 1EIYB 1X65A 2KCMA 1E1OA 3AFQA 4BY7G 3W5OA 3UDGA 4IPDA 1CSQA 1NE3A 3K81C 1YITA 1TWGH 3LGJA 5FJ8G 1XTDA 3PF4A 2JK8A 3CCRA 4LF8Q 2PMZE 5GAHC 5C44G 4BBRH 4KI0A 1VQPA 4DV7Q 5M5XH 4UY8C 3NELA 1MJEA 1Y1VH 5H1SE 3CPFA 4JG2A 4JI3L 1Q7YC 1IBLQ 3KJPA 1LUZA 1N9WA 4MTNA 3F2DA 4JI1Q 3A74A 1PFSA 4LFBQ 5LMUQ 3AYHB 3KDFA 3BU2A 3KF8B 2IY5B 4GN5A 4DR5Q 2UUCL 4C3IH 2E2JH 2PNHA 4FDBA 5FLMG 2K75A 3PUZA 3CMEA 4HIMA 1QZHA 3H3VI 2CQOA 4O2DA 1HH2P 3CQZH 3F2BA 3CCMA 3FKIG 4A3JG 2PQAB 3HOVH 1TWFH 2IT1A 4A3DH 4A3LH 1JJ2A 2NVQH 3HOUG 1K3RA 2N49A 4YCVA 3G6EA 4JI7Q 1W3SA 3GTLH 4A93H 1U5KA 4LF5Q 1O7IA 3U4ZA 3J81c 1MIUA 4YY3Q 5C0XI 1YHQA 4JBMA 4YCUA 4A3BH 4WJ4A 3J80c 4A3FH 1EIFA 2DUDA 4A3IG 2ZTCA 5ELNA 2OTLA 4LW1A 1HZBA 2NN6I 4LFAQ 2N3SA 2R92H 3J7A5 1K83H 1HR0W 4UP7A 3ZJYC 3OTOL 5BR8L 2HIXA 2VQFL 2WP8J 4GKKL 2QA4A 4ALPA 5JEAJ 1VQ4A 1S3OA 2R6GA 3HKZG 1Q1BA 2KBNA 4LF7Q 5LMUL 1WYDA 1SFOH 4NXNL 1PHJA 4L5SA 3PUWA 2YYZA 3UE1A 1VQDA 5IY0A 3S17H 4B3RL 4JI3Q 4IOCA 2BH8A 1WCMH 1VQBA 4UPAA 1GKHA 4AQYL 1TXYA 1V1QA 2UXDL 3K0XA 4DR7L 3K80C 4JC0A 2ATWA 4LFBL 2DGYA 5IYCH 3K7AH 4NXMQ 1R9TH 1VQHA 1JT8A 3D31A 1E3PA 1OXXK 1RL2A 4A3DG 1PH7A 3RN2A 3PO3H 4JI2L 2LXKA 1J5EQ 3E0EA 2YTXA 4YCWA 3MEFA 1JJCB 3TEHB 3ULPA 5GADC 1PH3A 4DUYQ 3I4MG 1XNQL 1Q86C 5IWAL 2KHJA 5C3EH 1Q81C 1SE8A 5C4XH 1VQKA 4BXXH 4DR2Q 4PZ6A 1NBWA 3CMAA 2VL6A 1S40A 2R7FA 2N8NA 3PSIA 4RG1A 4LFCL 1B7YB 1LTLA 4Y7NH 4PZ7A 3RNUA 1PH5A 2AMCB 3JAMi 1CKMA 2Z0SA 4DK3C 4DV3Q 1Q8KA 2IHFA 3CCQA 1PH4A 1I94L 1VQMA 1L1OC 1D7QA 4JYAQ 1HZCA 3J80i 5IE8A 1LM0A 3NBHB 2AWOA 5M5YH 1KAWA 1VQLA 3EN2A 2JA5G 3HOYH 4GKJL 4DV3L 4JCVE 4DV1L 2PI2E 4GNXB 4LF8L 1LYLA 4JV5L 1XMOQ 2A19A 4IJHA 4IPHA 3S1RH 5IYCG 4DV2Q 1YI2A 4BY1H 1MKHA 4R4CA 3J81j 4HJ7A 1GVPA 4DV5Q 2I5MX 4R4OA 4JI8L 3S2HH 1SN8A 2D62A 3E9HA 3Q8DA 2RHSB 3I2ZA 1Y1WG 3S16H 3AFPA 3OYYA 3CCUA 3KDFB 3PUYA 4R4IA 3PO2G 3T1YQ 1NMGA 1N34L 4TQUS 4B3ML 3DLLA 1VQJA 2Q2HA 2NVXH 1J5EL 4AQYQ 2UXDQ 3ICEA 1C9OA 4GLVB 1EQQA 3PF5A 1XPUA 2Q2IA 2ZJQA 1BBUA 5LMNL 1HZAA 3W1BA 2OQKA 4X62Q 4NXML 5EAYA 3H0GG 5IP9H 2E5LL 2CWAA 4QJFA 2JA8G 3GTJH 3CC2A 3ULJA 2F4VQ 3HFZB 1PYSB 1VS0A 1Z9FA 3K7UC 5BR8Q 2K5VA 2VQFQ 4KHZA 4DPGA 2VW9A 3HOZG 1VQGA 4LF9Q 4B3TL 1UEBA 3VDYA 1VQ7A 4OWTB 4A3CG 1HNWQ 4K0KQ 4X64L 1KXLA 4BY1G 1YHAA 3S2DH 1Q46A 4DV0L 1J6QA 1N36Q 3JAMc 4A3EH 1VQ8A 2R7DA 4BA1I 4DNIA 2I5LX 3BZKA 1AE2A 2NZHA 4J15A 1KIXA 3TS2A 1UE7A 3G48A 4KLKA 1WCMG 4ME3A 1EYGA 4A3GH 1PVOA 2ZM6L 4B3SQ 3RZDH 3KJOA 1N32L 5IWAQ 2YU9H 3L0OA 3B6YA 5M3MH 3PIPA 4JI5L 4MNOA 4X6AH 1FJGQ 1VQAA 4IFDG 3FP9A 1UE5A 4DR3L 1YIJA 2B63G 1KQSA 2VUMH 4YHHQ 1L2FA 3CP0A 5HY6A 5FLMH 3PCOB 4DR5L 2E2HH 1VQ5A 1V43A 1IZ6A 1N34Q 4B3MQ 2H5XA 1SRUA 3I55A 4LF7L 3IRBA 2NN6G 2UUBQ 3HOUH 3CC4A 5IYDG 2JA8H 4BA2I 1YHBA 4EX5A 1K73C 2EXDA 3ER0A 4B3RQ 1VCIA 2D0OA 2PI2A 1IBKL 4DUZQ 4C2MH 2BH2A 2RCNA 3G4SA 3GTGH 2KHIA 1QUQA 4JI5Q 1FVIA 4IOAA 2KENA 1HJPA 2E2IH 2E8GA 2WB1E 4DV0Q 2R7ZG 4YWLA 2UXBQ 4X66L 3TRZA 1N33Q 2LSSA 4LF5L 2ZJPA 2UUAQ 3AEVA 5E7NA 2R93G 2F52A 3EIVA 5M5WH 1OTCA 1Z47A 4A76A 1XNRL 1XMQQ 1YZ6A 3AQQA 1X3FA 4OWXB 1PH1A 4C3HH 3T1HQ 1K8AC 2AWNA 2Q2TA 3FHWA 1GO3E 3GD7A 2CFMA 1WI5A 1E7ZA 1P16A 3F1ZA 2NZOA 4DR1L 2WAQG 2B63H 4LF9L 3KF6A 4P73A 1VQOA 4GOPC 4KHPQ 4DAYB 4LF6Q 4H02A 5DLQE 2PQAA 5C44H 4DR1Q 3OW2A 3A5ZB 4R1JA 4PZ8A 2HHHL 3CCJA 3H3VH 1W2BA 1AH9A 4IPGA 3S1MH 4A3BG 4UP9A 1EFWA 1OXTA 2QGQA 1TWCH 5IYBH 3GTOH 5FLXc 1T9HA 2ID0A 4LF4L 5HGQA 4OO1G 4JI0Q 3S1QH 2VNUD 2N78A 2IX0A 5GAGC 2XGTA 2MNAA 1IBKQ 3F8TA 1FL0A 1RIPA 4UP8A 2V1CC 4JI8Q 1QUQB 2OQ0A 1HNXQ 3NENA 1PV4A 2OCEA 2JEBI 4JOIA 4DAMA 4OX9L 4AIMA 4A93G 2GVBA 1YJWA 3HKSA 4DV1Q 1C7YA 3RN5A 1UWVA 3PV0A 3TQYA 4DV5L 4GOPA 5JJKA 1K9MC 3HOZH 4DR3Q 2ES2A 4A3MH 4LF6L 5IYDH 2WB1G 4P72A 3GTQH 4DKAC 2GVAA 4GS3A 4BXXG 5C4XG 3CCLA 3CC7A 2Z6KA 3RLOA 1PH6A 4JI4L 1HR0Q 1BKBA 1TWHH 3U50C 4OXPA 4L5QA 1KC8C 1AE3A 2HHHQ 2ASBA 1X3GA 4KHPL 1VQ9A 3CXCA 5C4JH 2BA1A 4DK6C 3GO5A 4NXNQ 3E9IA 4A75A 1I94Q 4LFAL 3M85A 2WAQE 4L5RC 3I7FA 2MFIA 4HJ5A 2JA7H 1IBML 1OXVA
chains in the Genus database with same CATH superfamily
1B3AA 4R8NA 3HOYG 1U4RA 1WJJA 1MSHA 3MFGA 1O7ZA 4OEMB 1VQEA 3UDFA 4QGUA 4RMFA 2L1BA 2F3IA 3HRZC 3L3OC 3UDIA 4HJAA 2Z9HA 2K7VA 2F0OA 5C4JB 4A3FG 2XIWA 2C35B 3N52A 3H0GB 3DWAA 5T1GA 4I65A 1JWSD 4A3LG 3I72A 3S14B 1HQRD 2JA6B 3CW2C 1UNSA 2AUJD 3D4WA 4A3KG 1EYCA 3DXJC 3GTKH 2PW5A 2QCPX 1F2YA 2Q2UA 2K5NA 1B8AA 4LUZA 5KRUA 3ND8A 3F2CA 3J81L 1TWGB 4KY5A 3TS0A 1I4XA 3M4PA 2WACA 4GKJQ 2B2YA 3X3NA 1DYQA 1KHIA 3M3YH 2BDOA 2AHOB 3W1GA 1Q8IA 4GN4B 2PZUA 4MN3A 4O0AA 1HR0L 2Z4IA 2WFWA 4JVZA 1MI2A 1NUCA 5E4XA 2E2IB 2BE5C 4BY7B 1QVFA 3SK5A 2RSOA 4L8JA 3NBIA 4IQZA 4DAVA 2MGSA 1A15A 5ELOA 4OIJA 1E2VA 3D6WA 1XJVA 4C3JG 4TSSA 1DZ1A 1V9PA 2NZ1D 2YTVA 2YTYA 4FXDA 2XRSD 5M3MG 4JV5Q 2DN8A 2CCZA 3IL8A 2F1MA 2ALYB 3MXGA 3HZXA 3OSOA 2B2YC 5AFWA 1PYBA 4DR4L 1TWAB 1H9JA 5AJ3Q 1JE4A 2K5HA 3D6CA 1WCMB 2LMCB 4X3TA 1F9QA 3LWUA 4LFCQ 2Y0SE 4POFA 4DGZA 3HOWH 2MQHA 3T13A 4LWCA 2HUGA 3PUXA 1Q12A 3L2PA 5G3LD 3DUZA 5K36G 4KKSA 1JJGA 1I3QB 3EVQA 5EJWA 2EIFA 3NWTA 2JJQA 2KEDA 4A3MB 3S24A 5C3EB 1S72A 2PYKA 1CA6A 3GQBA 4HMJA 1XTCD 3H15A 4RGMA 1WFQA 3MA2B 1ASZA 2L5TA 3KLWA 1CHPD 2Q8RE 1G8ZD 1IYUA 1A0IA 4KK7A 1SR3A 3MXNB 4B3SL 4BWGB 2HT1A 3T4AC 5M3FG 1HHVA 3T53B 1I6VC 5EKLA 4H0LC 1BF4A 3S1NH 2K52A 4M8AA 4BY1B 3G6JB 1YVCA 2IX1A 2Y0SG 2XTIA 1A8VA 1I6HH 1MGSA 3D4RA 4LF4Q 3Q23A 1E24A 1PRTB 3ITPA 5IT9c 2LXJA 4L5TA 1MJCA 3SXHA 4X64Q 4RHSA 3H0GH 3GV6A 5IP9G 2MP1A 1UE1A 1XXGA 2SOBA 1SSOA 1HTLD 1I5FA 3SGIA 2AKWB 3A56A 2JXMB 2JA6H 2UXBL 2UU9Q 4JI1L 4RA8A 1XNRQ 3RZOH 1YNXA 2CKZB 4IUUA 4K8IA 4RCOA 1T5EA 4CDFC 3UDGA 4HSPA 1NE3A 1Z6HA 1YITA 1TWGH 2LKVA 1X3PA 2B2VA 5C44G 4DV7Q 1UAPA 2EZVA 2Z4HA 5IGCA 1MJEA 1Q7YC 1H9SA 3RZDB 1LACA 5M3MB 3TDQA 4LFBQ 3AYHB 1M8AA 3KF8B 5FLMG 2K75A 3H3VI 2F0HA 2VUMB 1F2MA 3FKIG 4IURA 1GJXA 4YCVA 4AYBB 4K14A 1W3SA 4A93H 5CV9A 3IFDA 1HTPA 3U4ZA 3C46A 3M7NA 1MIUA 1ENAA 1RCVD 3F2UA 4YY3Q 5C0XI 4JBMA 4WJ4A 5C0XH 1LTRD 3Q22A 2PO4A 1HR0W 3OTOL 1SDFA 4GKKL 1GUGA 1B9MA 1S3OA 2KQ3A 2V4DA 2KBNA 4LF7Q 4NXNL 1PHJA 3PUWA 5EPKA 1VQDA 3I90A 4ZQ3A 1JQYD 4IOCA 1WCMH 1CA5A 1V1QA 3VR5A 4EGVA 5I2XA 4DR7L 1OO9B 5F2DA 3KUPA 1STBA 3PO3H 1J5EQ 1E2WA 5CV7A 2L11A 3WOEA 4YCWA 1XNQL 3KLRA 3MC0B 4S3SA 3C2PA 1KNEA 5C3EH 2TMPA 1SXTA 1Q81C 3MWYW 1A3UA 2VL6A 3NTKA 4Y7NH 4PQXA 1B7YB 1TT2A 4PZ7A 2D9UA 3RNUA 1PH5A 2AMCB 3JAMi 1SE3A 2IHFA 1R9TB 1D7QA 4JYAQ 2EYLA 4JK1C 1JB3A 2RA4A 2AWOA 1STYA 2L0CA 3HOYH 2K04A 4DV3L 4HSVA 4P2CB 4DV1L 1GUNA 1SMYC 4Z9CB 4LF8L 3S9WA 2A19A 4IJHA 1R4QB 4N8FA 5EQ0A 1KLGD 2MPMA 2D62A 3E6ZX 3E9HA 5G3LF 2RHSB 3HS0C 3KDFB 4R4IA 1ZYRC 2EYOA 5KNDA 3PO2G 2F0PA 4A3EB 1N34L 4TQUS 3C1FA 1VQJA 4AQYQ 2UXDQ 1AN8A 4CHTB 4GLVB 1XPUA 2G5DA 2ZJQA 1BBUA 4X62Q 4NXML 2K1BA 1IKMA 2CWAA 1E2ZA 2F3VA 4BS9A 3QR8A 2EYHA 4CDEC 1PYSB 1EZ6A 2R61A 4FF4A 4DPGA 1VQGA 3NSWA 1TS3A 1H9SB 4A3IB 1UEBA 4DFAA 4PNYA 4X64L 5IT9L 5JEAH 5I9OA 2B8FA 1N36Q 4KY7A 5FLXL 4BA1I 2I5LX 3BZKA 4C2MB 1EQVA 2EY5A 2HQEA 1PVOA 1EY4A 5IWAQ 4OIKA 1LV9A 3PIPA 2DJFC 4X6AH 4V0BA 4IFDG 4RHRA 5K5PA 1KQSA 5FLMH 3PCOB 4FVMA 4QUCA 1HFNA 3I55A 3PO2B 2JA8H 1HRJA 3DWQA 3FVQA 1VCIA 5DNFA 2KHIA 5IOCA 1NR2A 1N33Q 1TU2B 3EIVA 5M5WH 4ZLTF 4XDXA 1LT4D 1XMQQ 3AQQA 3NXWA 2JP1A 1A6XA 3T1HQ 1I4HA 1K8AC 3DEPA 2Q2TA 1WI5A 2NZOA 3DMUA 2AQ2B 4LF9L 2F0LA 3NQIA 4P73A 3M4OB 4GOPC 1JORA 4LF6Q 2PQAA 3PO3B 4DR1Q 2N55A 3A5ZB 4PZ8A 4R1JA 4DU9A 5JVH3 1MBYA 4KN7C 1U4LA 3WOFA 4NKLA 4U673 1K0SA 5HGQA 3I4NB 3OMGA 2MNAA 1QOHA 4CKBA 1FNUA 1BNZA 2V1CC 2OQ0A 2RDFA 2ENBA 3NENA 2R7ZB 3OPOA 4JOIA 3OIPA 4DAMA 2DY7A 2GVBA 4DV1Q 4J1MA 4TRDA 2KUMA 1EIHA 3HOZH 1O7YA 4DR3Q 1V1OA 4OGQC 1RD9D 4GS3A 5C5LA 2B2UA 1VMPA 3RLOA 1STNA 1HR0Q 4L5QA 1TQOA 1X3GA 1SBBB 2J0TD 3S1QB 4DF7A 5C4JH 3CXCA 4NXNQ 1DD2A 4A75A 3K5OA 1I94Q 4LFAL 3M85A 4HCSA 4L5RC 2NTTA 3DEOA 3K5NA 3FDTA 2B29A 1KTKA 3S14H 4OO1H 1S5CD 1S5FD 1L0WA 2PNRC 1HNZL 2G9DA 4OONA 4K0KL 5CV8A 3EA6A 2DNCA 2BOSA 2Z6KC 1CSPA 3EBEA 2JA6G 1AW7A 4BBSG 2OWOA 2VS1A 1Y1WH 1GM5A 2D2CC 3UDXA 1XPOA 1ET6A 1BBWA 1PH2A 2K4KA 2A1AA 2LFNA 3M3YB 2VXWA 4QL5A 3BDOA 3RMHA 1GUWA 1TKWB 1HNXL 2JA7B 3HOXB 5EBDA 2GN5A 3NEMA 4HN7A 2BE5D 1B50A 2RSNA 3CF5A 4BY7H 3I91A 1EZ8A 3MFYA 3GDEA 2A8VA 4HJ8A 3KBGA 4EQ5A 2ZTEA 1G91A 4KKTA 5KNBA 2L55A 2JA9A 3FKIH 2UU9L 2RHQB 4CKEA 5IP7H 4QY7A 5IYBG 4OWWB 3A54A 5I6WA 3J81i 3PO2H 3R3OA 5FOBB 1G6ZA 1ZYRD 1GHJA 1LLRD 4A3JB 4FXKC 3CAMA 4DR2L 2CWPA 3P75A 4IO9A 1KD1C 3KOJA 4O42A 5GROA 4X62L 1R4PB 2X6GA 2KCNA 2KJXA 3GTLB 1L0YB 2D0PA 5M5WB 3A0JA 4NDXA 3M4QA 4DV4L 1BDOA 4WJ3M 3PIO3 2EQSA 2A73B 5JEAG 3J7AV 1G6PA 1U4PA 1CK1A 3K8AA 4H44C 3U4VA 2TSSA 3M4OH 1RJTA 1ICFB 1PRTC 1BVSA 5ELFA 1JWUD 2VY3A 4E6IA 1F77A 2K14A 1NMFA 3A5UA 3S17B 1L1OB 4OELB 1YJ9A 2F0WA 5E4WC 1QVGA 3I4NH 4JYAL 1X9NA 4PMCA 1PFMA 4X65L 3J7AF 1EFID 1AP0A 4X66Q 4ODGA 1M1KC 3H6MA 5CV4A 4CJ1B 1HUNA 4IPCA 2HQLA 1IKLA 1K28A 4IJLA 1DGSA 1DOLA 1DXMA 1IL8A 5C4XB 4PMWA 1NTGA 1RKNA 4ZKCB 4JBKA 1I4RA 2JYOA 1H95A 4RGOS 4IALA 3VYRA 4QCLA 1G2TA 3VYSA 3BZCA 4XIGS 1W6JA 4CKCA 1WTRA 5E1FA 3H91A 5GAEC 4GNXC 4A3EG 3PIP3 1VQCA 4A3KH 3KLSA 1L1OA 5C0XJ 2AQ3B 1SAPA 2ICEC 1EOVA 1G291 3D8GA 1X56A 3BYYB 4C3IG 4KD4A 3S15H 3BJUA 2XRQD 3PGZA 2F0JA 3BS1A 1WTOA 1I3QH 1X3EA 4NPSA 3IKJA 4DR6L 3RZOB 2ZM6Q 1SE4A 2FMMA 4GKKQ 3KYHC 1Y1VG 2K5DA 5EKKA 1YEZA 3A8JE 3S2HB 2A6EC 5CBEE 2VB2X 4P74A 4OO1I 2EYMA 4EQNA 3RR5A 1FD7D 2CW0D 1XMOL 2XWBB 1X55A 1PA6A 2X6LA 1VMCA 1Y8PB 3K5LA 5C3EG 2F0SA 2UUCQ 5EBCA 5JJIA 1CKNA 3PQIA 5I6YA 1PTOD 3HOXH 4GN3B 2KCTA 3T1HL 1S5DD 5I2YA 4A3GG 1EY5A 3STBD 2ZT9C 3CD6A 4DR6Q 1VF7A 4DUYL 2QEJC 3HKZE 1PXUA 1C8CA 1STHA 2B2TA 1D5XC 1X65A 1E1OA 3AFQA 3TP8A 4IPDA 4NMZA 1WTXA 2IX3A 2JK8A 3CCRA 3NP8A 5GAHC 4KI0A 5M5XH 3NELA 4KKUA 1Y8OB 2KHSA 2HCIA 1LUZA 4MTNA 1U4MA 4JI1Q 4GN5A 1LTSD 4C3IH 2E2JH 3MZ5A 4NW2A 4HIMA 4O2DA 3M4YA 3HOVH 4A3JG 3ZYYX 2IT1A 1VF5C 2E2HB 3T51B 1K3RA 3G6EA 3J81c 1YHQA 4N8X1 4YCUA 1EYAA 3J80c 1EIFA 2DUDA 2OTLA 5EPLA 2N3SA 3X3MA 1WTVA 1K83H 4YIJA 5A2QL 4UP7A 2VQFL 2HIXA 4MHEA 1ILPA 1B9NA 3HKZG 5LMUL 1WYDA 1S4ZA 3J80E 4B3RL 1VQBA 4UPAA 3LWEA 1GKHA 4HCEA 4JC0A 5CBAE 2DGYA 2B2WA 3K7AH 4NXMQ 1R9TH 4JW0A 4XQQA 3TP6A 1DOMA 2K33A 3BVZA 4G57A 1E0BA 1OXXK 3SHLA 4EVOA 3MVVA 5LL6S 1WTPA 3HOYB 3MEFA 5J22A 3GTOB 2Q8TA 5A2QE 1LTGD 4CDDC 4DR2Q 4PZ6A 1IYVA 1WD0A 2R7FA 2N8NA 1BR9A 4RG1A 5T1IA 4XYQA 3Q6SA 4DK3C 4DV3Q 1Q8KA 1H9KA 3BZDB 4QIWB 1SE2A 3EQLC 4H13C 1HXYD 1L1OC 1I94L 3QO2A 1CHQD 3J80i 5IE8A 4FNFA 3NBHB 1VQLA 3GTJB 4LJZC 4HR7B 3R8BA 1XMOQ 5IYCG 2IJ0A 4CDCC 2LY7A 1ZEQX 3J81j 4HJ7A 1EY6A 2F0NA 2I5MX 4JI8L 3S2HH 3I4LA 1A3TA 3I2ZA 1Y1WG 1TIID 3OYYA 1ZKOA 1NMGA 2IW3A 1ET9A 3E5SA 4G7HC 3VYTA 1J5EL 1C9OA 1TVXA 3TMEA 3PF5A 1CT1D 2Q2IA 1ENFA 4CGYB 3W1BA 5D3IB 2YU9B 2K01A 5M5YB 4KMUC 1F9RA 4QJFA 3OIQA 3CC2A 3ULJA 2F4VQ 4FYDA 3MXNA 5BR8Q 3K7UC 2UXCQ 2K5VA 3ERQA 4LF9Q 2K5QA 4B3TL 2E75C 4UDUC 1VQ7A 3NTHA 2PQEA 2X69A 1YHAA 4DV0L 3TP7A 2HD3A 4A3EH 4FF2A 4DNIA 1BCPB 4J15A 1KIXA 1UE7A 4BBRB 3G48A 1WCMG 1BUVT 2F0IA 1N32L 4B9XA 4MIUA 3FMCA 1V1PB 3AMUA 1RDPD 1FJGQ 3FP9A 4DR3L 1YIJA 3HOVB 4YHHQ 1L2FA 1SNCA 5HY6A 1VQ5A 1V43A 1IZ6A 3A8IE 1CM9A 3I73A 4LF7L 4A3BB 2NN6G 5IYDG 2PZTA 5CC4A 1KABA 2K28A 4EX5A 2I07B 3GV3A 1K73C 3NUCA 2EY1A 4Q0FA 3GTGH 3KLSX 2WB1E 3D4DA 4YWLA 3R2IA 4X66L 3TRZA 1SFOB 3HG9A 2UUAQ 4UAIA 2XWJB 3NK9A 4K6DA 1Z47A 1XNRL 4RWSC 1YZ6A 1X3FA 4OWXB 1PH1A 2CH4A 2AWNA 1H9MA 3FHWA 3F1ZA 3GD7A 1E7ZA 1V1PA 4I7ZC 3NTIA 2WAQG 1WTQA 5NUCA 3HOUB 4QUFA 2F0QA 3BYTB 2E76C 2HHHL 2C9OA 3H3VH 2L12A 1OXTA 4WJWA 1TWCH 4WORA 3GTOH 2ID0A 4LF4L 2K5WA 2VNUD 2IX0A 3E0JA 1ENCA 3F8TA 1ICWA 5FO9B 1XWEA 5IGEA 1JOOA 1A3VA 1MHWC 1YJWA 3HKSA 3PV0A 2Z8LA 4GOPA 5IYDH 2WB1G 4P72A 1BO0A 5JPNC 4DKAC 2GVAA 2XNAC 3AB9A 5CMDA 1PTOB 3CCLA 3BVMA 1PYWD 1PZKD 4JI4L 1BKBA 1KC8C 5CV5A 2ASBA 4KHPL 2BA1A 3GO5A 3E9IA 4RGTA 4CJ0B 3H3VC 3CU7A 4HJ5A 2JA7H 3GTPH 1FNVA 3HGBA 1TY2A 2VUMG 1SYDA 1JMCA 1NJIC 3S1NB 2BA0A 3DM3A 2EJFC 1PH9A 1CQFA 1VDZA 3SK6A 3EFXD 1HFGA 4WFN3 5IP7G 1VQ6A 2EDGA 2UXCL 1X54A 3UE0A 1HZ9A 2RDGA 1VQFA 1IYJB 2WINB 5C0XG 2UUBL 4DR4Q 1FJGL 2EY2A 2KCCA 5J1ZA 2JEAI 5IODA 3S2DB 1IBLL 1N32Q 1IHZA 4H7BA 4XYOA 3SDZA 3HOVG 4A3JH 1UEAB 1G51A 3EJIA 3PUVA 3P7JA 4DXGA 3SVMA 1CTMA 2I5HA 2NB0A 2A6HD 1QVCA 4A3MG 1QNUA 4IUPA 1KRTA 3KF6B 3HOWG 5ELEA 2B2TC 5DM73 5BN3A 3VR6A 1SJHD 3J80L 4QMGA 1KDBA 4KN4C 1E1TA 1D1KA 2FXQA 1OXUA 4QQBX 3H94A 4BBSH 1ML0D 4AYBE 4DV6L 2R93B 1F9PA 2JA7G 1X6OA 4R4QA 1DJRD 5I4DA 3OMCA 4YWMA 2E5LQ 5IIFA 2AQ1B 4HIOA 2Z6BA 1NCVA 4KJNA 3R93A 1BOSA 1EY8A 1GXDC 3ERSX 4NP5A 4ZAIA 3HOXG 4JBJA 5C5MA 4ZUJA 4FP5D 1BCPD 1PH8A 3JAME 2ZJRA 2RDHA 1NY4A 4GLXA 2JA5H 4JI6Q 4LUOA 1STEA 4DXFA 1Y69U 1SROA 4EQPA 3G71A 2VB3X 4OHJA 4HIKA 1TWCB 4ZUIA 3SK8A 3I4OA 3NPPA 4GLAC 1SMXA 3PIOA 3OTOQ 4POGA 4GOPB 1Q82C 3SEBA 4Y52H 5TSSA 1EQRA 4GNXA 2JE6I 5CYUA 4XQJA 1M4VA 1BCPF 3O13A 1D5ZC 4IFDI 1FYCA 1EUJA 2EJMA 3U58A 4XT1B 1SYEA 1B44D 2LS01 4HEDA 3S15B 3KK7A 1FGUA 4P75A 1MSGA 4LAAA 1LTID 3GTMB 1YBYA 2M00A 1Y14B 2F0VA 1PRTD 1VQIA 4R4TA 4Q5VA 1B70B 2HIVA 2O4XA 2EJGC 1QZGA 4DV7L 4NB3A 3QOJA 1UE6A 1IL2A 3H09A 3T1YL 4RKLA 1AZPA 3PMFA 2L15A 2RVLA 1Q1EA 2ICIA 1U0LA 2ZTDA 4C1NI 1S5BD 3I4NG 4XXEA 1KAAA 3S1RB 4HIDA 1TS5A 1K8GA 3MXUA 3FRPB 5FJ8H 4JBWA 1EY9A 5IGDA 1OXSC 2NVTB 4BBRG 3RLNA 3S16B 2OT2A 5JJLA 1AFPA 2DNEA 4TVAB 4F88A 1XYIA 4V190 1EU4A 1I50H 1CKOA 1QILA 3CCVA 1B3QA 3I4MB 3V05A 5AJ3L 4JI4Q 2KOLA 2B8GA 2F0KA 1F2ZA 3D0FA 2ZXPA 5I9PA 1SLJA 3KBXA 2F0TA 2O2LD 2CVRA 4OX9Q 5LMNQ 1TWFB 2H4OA 3RLFA 2K6AA 1XPRA 3TBIB 1EIYB 2KCMA 2L4NA 1D1IA 3LGJA 3K58A 4LF8Q 2R92B 1PFBA 1K83B 3A7AB 2IPKD 3HEJA 4UY8C 2MJ8A 1Y1VH 4JG2A 2EY6A 4JI3L 3KJPA 5IGBA 1BQQT 1N9WA 4BBSB 2A68C 1KLUD 3A74A 1PFSA 4KTAA 2EYPA 1SYCA 1U9RA 3BU2A 3KDFA 5JAVA 2UUCL 4C3JB 1A2UA 4DR5Q 2MUYA 4FDBA 3PUZA 3CMEA 2CQOA 3CQZH 1STAA 2EXZA 1A2TA 2NVQH 3HOUG 2NUCA 4JI7Q 3SK4A 2M2LA 1O7IA 2PPBC 2JA8B 4A3FH 2EVBA 2SEBD 5ELNA 4LW1A 4LFAQ 3DHQA 5IT9E 3ZJYC 5BR8L 1EY0A 2CQAA 2WP8J 2A69D 4M1UB 4ALPA 1LT5D 1VQ4A 5J39A 1K8MA 4MTKA 5FKAC 1Q1BA 4L5SA 1SEBD 2F3WA 4DK0A 4C3IB 2E2JB 3C1EA 2R3ZA 4J6HA 2IWHA 4C3HG 5IY0A 4JI3Q 1YNND 4C3HB 3LNNA 4A3DB 1TXYA 3QWNA 2XVSA 3K0XA 3BVGA 4LFBL 1JC7A 5IYCH 3VYUA 1JOKA 2EYFA 3D31A 1JT8A 1E3PA 4HMIA 1RL2A 4A3DG 3RN2A 3E0EA 3P20A 3TEHB 1JJCB 4FO2A 3ULPA 4HTHA 2KHJA 3W2DA 2A69C 1SE8A 1LABA 1J9OA 5BN5A 3QIAA 1NBWA 1JCKB 1S40A 1J8IA 4DNRB 5FK9C 4U68A 3WDNA 2FMCA 3OWEB 2NVXB 1F9SA 2QKIC 1PTOF 3K7AB 1CZWA 3HOZB 1CFMA 1HZCA 3GP7A 1LM0A 1EY7A 5M9OA 1DCZA 5M5YH 1KAWA 2JA5G 4KV6A 1WD1A 1C48A 5ELBA 1TWHB 1LYLA 2SNSA 3S1RH 5D3DA 1YI2A 4BY1H 1MKHA 3K57A 5ELDA 2QILA 4ZYSA 3T16A 4DV5Q 1SN8A 2F0GA 3U9SA 4LK1C 3S16H 3AFPA 3KF8A 5KIXA 3T1YQ 5EGTA 2Q2HA 3OHXC 1I50B 3RUZA 1RHPA 3A55A 1QWYA 3Q24A 5LMNL 1HZAA 2OQKA 3P1HA 1S5ED 5EAYA 3H0GG 5IP9H 2F0FA 4K6LA 3GTJH 3MHBA 4QF4A 5C3WA 4F8MA 3HFZB 4OL7A 1VS0A 1Z9FA 2VQFQ 3I4MG 1A63A 2VW9A 3IFTA 1T5XD 3VDYA 2QDLA 5JPMC 3VR2A 4A3CG 4K0KQ 3NQTA 1X3QA 4L6TB 1TY0A 3JAMc 1VQ8A 2R7DA 1AE2A 1LO5D 2NZHA 3N6RA 1QE6A 3TS2A 4GZYC 1PZJD 2OEOA 1H9RA 1EYGA 1IW7D 4A3GH 1PDQA 4B3SQ 3RZDH 3KJOA 1O80A 1B2TA 2YU9H 3L0OA 4F87A 1SNMA 5M3MH 1F2LA 4JI5L 2QF7A 3QB3A 2Q8IB 1VQAA 2B63G 3FPPA 3FKIB 4G7OC 2VUMH 3G7LA 3CP0A 4C1NK 4KHVA 4A93B 1N34Q 2H5XA 1SRUA 2PZWA 3HOUH 2EOTA 1YHBA 2EXDA 3ER0A 4K5WA 4R9WA 4B3RQ 2D0OA 2PI2A 4WRDA 1IBKL 2K05A 1GUTA 2B39A 1FVIA 2KENA 2HDLA 2E8GA 4IZ8A 3VR4A 2RCFA 2LSSA 4LF5L 1O78A 5E7NA 3VR3A 5KGUA 1OTCA 2FFKB 4A76A 2H1EA 1Q3LA 4C3HH 5CORA 4DA2A 2RQXA 1GO3E 2O5JC 4DR1L 1I4GA 1QNKA 4X3KA 2FHTA 4XT3B 1VQOA 4H02A 5C44H 1JWMD 1PLFA 4ID6A 3OW2A 4K2LA 1PTOH 5KEEA 3S1MH 1FGBD 3GTGB 2JN4A 1CI3M 4I7AA 5ISRA 4A3BG 1TS2A 2QGQA 1JR0D 4K8JA 2NVYB 1T9HA 5M3FB 5LHY1 3A8KE 2N78A 5GAGC 2PCFB 2HCCA 1UUPA 1HCZA 4UP8A 5JOBA 2M9VA 2NBFA 3HP3A 4AIMA 1AZQA 4A93G 1BCPC 2O5IC 1K3BC 1SYBA 5KYLA 1C7YA 3RN5A 1UWVA 2B63B 4G4KA 3EROA 5JJKA 2ES2A 4LF6L 3J7YW 3FPUB 1JICA 3VA5A 4BXXG 1EQTA 5C4XG 2Z6KA 2DJGC 1TWHH 1SNPA 4OXPA 1AE3A 1QCBD 1TR5A 4DK6C 1JOQA 2WAQE 1HQMC 2RBMA 4A3KB 1PTOC 2HDMA 2EE1A 1IBML 5HURA 1LTAD 2F0EA 1EWHA 4RKBA 4IUQA 1N36L 1G2SA 3JC66 3URYA 3MTSA 4HJ9A 3STBC 1VQNA 3CCEA 2A6ED 2B2UC 3TREA 1SNOA 3QJYA 4P71A 1EIGA 4FF1A 2VZAA 3NBHA 3WWVA 4YWKA 2K03A 4A3IH 3L7ZC 4C56C 1C0AA 2CH4W 4A3CH 5KYIA 5LMNW 4IFDJ 2R93H 2OTJA 2MO1A 4QIWE 1W6KA 1KDAA 3W3AA 4DV2L 2Z1CA 2I0QA 4L63B 4JOIC 2MO0A 1PFNA 1ESRA 3MXPA 1HUMA 4JI7L 3ULLA 5EPJA 2KVMA 1YNJD 4B08A 1D8LA 5C6AA 4IFDH 1RTOA 1KNAA 3R2TA 1P8LA 5J3BA 4X65Q 1DOKA 3BDLA 1IXRA 5M5XB 4DN4M 2JA5B 2F0MA 2VQEQ 2VQEL 1JB7A 2QDBA 4LUVA 3RD4A 4ZRZA 1ILQA 2UUAL 3KFUA 1TWAH 1GD7A 5K36H 1CKNB 2BDNA 3C3LA 1HA6A 5A35A 4JI2Q 3HOWB 1X32A 4AH6A 5FO8B 4JI0L 2OXPA 2R92G 4DV4Q 1XNQQ 1DM0B 1M90C 3A7LA 1KRSA 2WB1B 5DEHA 1CUKA 2RF4A 4KJOA 3SR1A 1ASYA 3GTMH 5C44B 2OF1A 2QEXA 3J7ZC 1Z7TA 2JQOA 3DM1A 4K5XA 5CR3A 4G7ZC 1BXTA 2NVYH 1PMRA 5M3FH 1RF2D 4A4IA 1DONA 2B2WC 1A62A 1QG7A 1JE5A 2R7ZH 1GUSA 1ESFA 1SNDA 3TSSA 4AYBG 2F0UA 5FO7B 1SYFA 4KY6A 4RGNA 3I56A 3MAQA 4XTCS 4DUZL 2F4VL 3K6OA 1HNWL 5GQOA 1I4QA 1II3A 2NVTH 1I6HB 3BDCA 2A68D 4DR7Q 1WOCA 2K50A 3CPWA 4APVA 4LNQA 3OWFA 4YHHL 1K0RA 1YNNC 1WVLA 4JI6L 3I4MH 3BG3A 3SE0A 2EYJA 1YJNA 2XN9C 1WTHA 2JSOA 4IUTA 1B53A 5FLXE 2SDFA 1E22A 1IBMQ 4PMBA 3LX0A 4YY3L 1HNZQ 2B3GA 3PO3G 2GA4B 5C4ZA 2YV5A 5CGKA 4TKOB 1EWIA 1O7LA 1D6EC 1QJOA 1SJED 3AU7A 2B2VC 2DY8A 4B9WA 4ZK9B 3D3RA 4B3TQ 4DV6Q 3CCSA 1KL9A 1XMQL 1I4PA 2IHEA 4ABNA 1N33L 3M9BA 2CHBD 4C3JH 4PG3A 3K5MA 1N8RC 4MZ9A 2KA7A 3L9AX 4R8IA 4BY7G 1LTBD 3W5OA 1RTNA 1CSQA 3NE5B 3ND9A 4J8QA 3K81C 1YNJC 3OOCA 3CRKC 1XTDA 5L37A 5FJ8G 3PF4A 2PMZE 2QW7A 1NSNS 4JPBW 4BBRH 1VQPA 3V2TA 2F4IA 5H1SE 3CPFA 1IBLQ 2A5HA 3F2DA 1K8OA 2KECA 5C4HA 5LMUQ 2IY5B 1EWCA 4N9PA 2PNHA 1QZHA 1HH2P 3CCMA 1QB5D 3F2BA 1WTWA 2PQAB 1V8QA 1TWFH 4A3DH 4A3LH 1JJ2A 2NN6H 2N49A 3VA7A 3GTLH 2WIIB 1U5KA 4LF5Q 4A3BH 1L0XB 4O1NA 5DM63 3CHBD 4A3IG 2ZTCA 1Q90A 3M7GA 1HZBA 2NN6I 2R92H 3J7A5 1Y1VB 2FJ2A 4X3SA 2QA4A 1D5MC 5JEAJ 2A74C 1STGA 2R6GA 2NYZD 4CBVA 1SFOH 1ZXTA 1CQVA 2G9HD 3V96A 2MHVA 2PMZB 4ILWA 1EL0A 4Y7NB 2YYZA 2WKDA 4IUVA 3UE1A 3S17H 3CQZB 2BH8A 3K0YA 1BBXC 4AQYL 2UXDL 1GOZA 2NVQB 3K80C 2ATWA 1KDCA 3HKZB 4K5VA 1VQHA 2EPBA 4A3FB 1PH7A 3U9OA 4JI2L 1EOTA 2LXKA 3TZDA 2YTXA 1RODA 1PH3A 5GADC 4DUYQ 3TN2A 1Q86C 5IWAL 2ZXOA 4ZCKA 5C4XH 1VQKA 4BXXH 1XX8A 3JAML 4DAYA 3CMAA 3I8ZA 3NHHA 1TS4A 1PZID 3PSIA 4LFCL 1LTLA 1LTTD 4FF3A 4K2KA 4KD3A 1FNWA 1CKMA 2Z0SA 1D2BA 3OW7A 5LL6X 3CCQA 1SYGA 4RAUC 5COYA 1PH4A 2NTSA 1VQMA 2SNMA 3GTQB 1EU3A 1EYDA 4RCNA 1GUOA 1B4OA 3EN2A 5KNCA 4GKJL 4JCVE 2PI2E 4GNXB 4JV5L 4N9TA 2KEEA 4IPHA 3ONAB 4CJ2C 2WKCA 4DV2Q 4IN3A 4R4CA 1GVPA 4ME5A 1NR4A 4R4OA 3Q8DA 3Q0AA 2E2DC 2FINB 3CCUA 3PUYA 4B3ML 3GTPB 3DLLA 5D65A 2NVXH 5HGTA 2WV6D 3J81E 4DAPA 3T56B 2IL8A 3ICEA 1EQQA 4ULLA 2NWGA 1B1ZA 1FR3A 5D14A 3QG1A 4PV1C 4DK1A 2WAQB 2E5LL 2JA8G 5E3FA 3IAYA 5JVG3 2J4XA 1SMYD 4KHZA 3HOZG 3CRLC 4RFBA 1ONLA 5BN4A 4OWTB 1HNWQ 1KXLA 4BY1G 3S2DH 1Q46A 1J6QA 2CW0C 2P5ZX 5IGFA 1HPCA 4KLKA 4HAEA 4ME3A 1EEFD 2ZXRA 2ZM6L 2A6HC 1C4QA 3B6YA 2C5CA 2F03A 4DNTB 2E74C 3GTKB 2AUKA 4MNOA 1UE5A 3E3XA 1Y8NB 4ZKBB 3FEWX 4DR5L 5IGGA 2E2HH 2PW7A 4B3MQ 1LT6D 1LT3D 4EQOA 3IRBA 2UUBQ 3CC4A 4BA2I 2F0DA 1CZGA 4DUZQ 4C2MH 2BH2A 2RCNA 1AEXA 3K59A 1GHKA 3G4SA 4JI5Q 1QUQA 1HA5A 4IOAA 4A3GB 2E2IH 1HJPA 2R7ZG 4DV0Q 2UXBQ 1IW7C 3QOLA 4IUNA 5CV6A 3TP5A 2ZJPA 3AEVA 4LMQD 2R93G 4QB4A 4X3UA 2F52A 5ELCA 2CFMA 1PRTF 1P16A 2I46A 3UI2A 4XQNA 2B63H 5DAUA 3KF6A 4KHPQ 4DAYB 5DLQE 2BCOA 2Y0SB 1AH9A 2J7ZA 2RKSA 2K32A 3CCJA 1W2BA 4IPGA 2L9HA 4UP9A 1EFWA 5IYBH 5FLXc 4F7XA 4OO1G 4JI0Q 3S1QH 2D5DA 2N88A 3CKIB 3TZUA 2XGTA 1IBKQ 1FL0A 1RIPA 5JJZA 4JI8Q 1QUQB 1HNXQ 4RH6A 1NAPA 1PV4A 2OCEA 2JEBI 4OX9L 1NNXA 1SNQA 3I70A 3TQYA 4DV5L 5EKIA 1K9MC 3MEHA 4A3MH 3GTQH 4FXGC 3CC7A 3S1MB 3NWSA 1PH6A 2HHHQ 3U50C 1Y1WB 1EEID 2XSCA 1VQ9A 5C3XA 1MD2D 3I3CA 4UHVA 3I7FA 2MFIA 3DWPA 1OXVA
chains in the Genus database with same CATH topology
3GTPH 2B29A 3S14H 3HOYG 1L0WA 1HNZL 2VUMG 1WJJA 1N36L 1JMCA 1NJIC 3JC66 4OONA 2BA0A 4HJ9A 3STBC 3DM3A 4K0KL 1PH9A 1VQNA 1VQEA 3UDFA 3CCEA 2Z6KC 3TREA 4QGUA 1CSPA 3EBEA 5IP7G 2JA6G 1VQ6A 4RMFA 4P71A 4BBSG 2UXCL 1X54A 2OWOA 3UE0A 1HZ9A 2VS1A 1Y1WH 2F3IA 1VQFA 3UDXA 1XPOA 1GM5A 3UDIA 2VZAA 4HJAA 3WWVA 4YWKA 1IYJB 1BBWA 5C0XG 2C35B 4A3FG 1PH2A 2UUBL 2K4KA 1FJGL 4DR4Q 2A1AA 3L7ZC 4A3IH 2JEAI 1C0AA 4QL5A 1IBLL 1N32Q 4A3CH 1HNXL 3HOVG 5LMNW 4A3JH 4IFDJ 1G51A 2GN5A 2OTJA 2R93H 2MO1A 3NEMA 4QIWE 3PUVA 4A3LG 3CW2C 4DV2L 2I0QA 2I5HA 4JOIC 2MO0A 1QVCA 3CF5A 4A3MG 4A3KG 1KRTA 4BY7H 3KF6B 3GTKH 3HOWG 3GDEA 2A8VA 4HJ8A 4EQ5A 4JI7L 3ULLA 2Q2UA 2K5NA 1B8AA 2ZTEA 4LUZA 3F2CA 2JA9A 3FKIH 1D8LA 2UU9L 2RHQB 3TS0A 1P8LA 3M4PA 5IP7H 5J3BA 1E1TA 4X65Q 4GKJQ 4QY7A 5IYBG 1KHIA 1IXRA 4OWWB 3M3YH 3J81i 3PO2H 2AHOB 2FXQA 3W1GA 2VQEQ 1OXUA 2VQEL 1JB7A 4QQBX 4GN4B 4BBSH 4AYBE 4O0AA 4LUVA 4DV6L 2JA7G 1X6OA 3CAMA 1HR0L 2UUAL 4DR2L 4R4QA 3KFUA 1TWAH 2WFWA 2CWPA 4YWMA 4IO9A 2E5LQ 1KD1C 4HIOA 3KOJA 5GROA 1GD7A 4X62L 1CKNB 1QVFA 3ERSX 3HOXG 4JBJA 4JI2Q 2D0PA 4AH6A 5ELOA 1XJVA 4JI0L 3A0JA 1PH8A 2R92G 3M4QA 2ZJRA 4DV4Q 4DV4L 1XNQQ 1V9PA 2YTVA 2YTYA 1M90C 5M3MG 4JV5Q 2CCZA 1KRSA 1NY4A 4WJ3M 2EQSA 5JEAG 1CUKA 4GLXA 1G6PA 2ALYB 3K8AA 2JA5H 3U4VA 2RF4A 4LUOA 4JI6Q 1ASYA 3M4OH 3GTMH 1SROA 2QEXA 1BVSA 3G71A 3J7ZC 2VY3A 1PYBA 4DR4L 2JQOA 2K14A 1NMFA 5AJ3Q 4HIKA 3A5UA 2K5HA 1L1OB 2NVYH 1YJ9A 3I4OA 1QVGA 5M3FH 4GLAC 3I4NH 1SMXA 3PIOA 3OTOQ 4POGA 1X9NA 4GOPB 4LFCQ 1Q82C 4JYAL 2Y0SE 4Y52H 4POFA 3HOWH 1EQRA 4A4IA 4X65L 4GNXA 2JE6I 2MQHA 1A62A 4X66Q 4LWCA 1JE5A 2R7ZH 1M1KC 4IFDI 1EUJA 3PUXA 4AYBG 1Q12A 3L2PA 3U58A 3I56A 5K36G 1JJGA 4IPCA 4XTCS 1FGUA 2HQLA 4DUZL 4P75A 4IJLA 2EIFA 2JJQA 2F4VL 1DGSA 3S24A 1S72A 1HNWL 1YBYA 5GQOA 4PMWA 1Y14B 1NTGA 2NVTH 4JBKA 4DR7Q 3H15A 1WOCA 1H95A 1VQIA 4R4TA 1B70B 2HIVA 3BZCA 4XIGS 1QZGA 1WFQA 2K50A 4DV7L 3CPWA 4APVA 4LNQA 1ASZA 4NB3A 5GAEC 4GNXC 3KLWA 1UE6A 4A3EG 1IL2A 3T1YL 2UXCQ 1VQCA 4A3KH 1L1OA 1A0IA 5C0XJ 1SR3A 1K0RA 4YHHL 3MXNB 4B3SL 4JI6L 1EOVA 3I4MH 2L15A 1G291 1Q1EA 3M7NA 1X56A 1U0LA 2ZTDA 2HT1A 1YJNA 5M3FG 3I4NG 3S15H 3BJUA 3PGZA 1A63A 1I3QH 1E22A 1X3EA 4NPSA 1IBMQ 3S1NH 2K52A 4HIDA 4DR6L 2ZM6Q 1K8GA 1YVCA 4GKKQ 5FJ8H 3KYHC 4YY3L 1Y1VG 1HNZQ 2Y0SG 1YEZA 2B3GA 2XTIA 4JBWA 2IX1A 3PO3G 1OXSC 1A8VA 1I6HH 4P74A 4OO1I 4BBRG 2YV5A 3RLNA 3RR5A 1EWIA 4LF4Q 5JJLA 1E24A 1XMOL 1X55A 2LXJA 5IT9c 1PA6A 4L5TA 1MJCA 4TVAB 4X64Q 5C3EG 2UUCQ 1I50H 1CKOA 5JJIA 1CKNA 4B3TQ 4DV6Q 3CCSA 1KL9A 3H0GH 5IP9G 3CCVA 1XMQL 1UE1A 2IHEA 3HOXH 4GN3B 5AJ3L 2KCTA 4JI4Q 1N33L 3M9BA 1I5FA 3SGIA 2AKWB 4C3JH 3T1HL 2JA6H 3D0FA 4PG3A 1N8RC 4A3GG 2UXBL 3STBD 4MZ9A 1SLJA 4JI1L 2UU9Q 3CD6A 1XNRQ 3RZOH 1YNXA 2CKZB 4DR6Q 4OX9Q 4DUYL 5LMNQ 3HKZE 3RLFA 1XPRA 1EIYB 1X65A 2KCMA 1E1OA 3AFQA 4BY7G 3W5OA 3UDGA 4IPDA 1CSQA 1NE3A 3K81C 1YITA 1TWGH 3LGJA 5FJ8G 1XTDA 3PF4A 2JK8A 3CCRA 4LF8Q 2PMZE 5GAHC 5C44G 4BBRH 4KI0A 1VQPA 4DV7Q 5M5XH 4UY8C 3NELA 1MJEA 1Y1VH 5H1SE 3CPFA 4JG2A 4JI3L 1Q7YC 1IBLQ 3KJPA 1LUZA 1N9WA 4MTNA 3F2DA 4JI1Q 3A74A 1PFSA 4LFBQ 5LMUQ 3AYHB 3KDFA 3BU2A 3KF8B 2IY5B 4GN5A 4DR5Q 2UUCL 4C3IH 2E2JH 2PNHA 4FDBA 5FLMG 2K75A 3PUZA 3CMEA 4HIMA 1QZHA 3H3VI 2CQOA 4O2DA 1HH2P 3CQZH 3F2BA 3CCMA 3FKIG 4A3JG 2PQAB 3HOVH 1TWFH 2IT1A 4A3DH 4A3LH 1JJ2A 2NVQH 3HOUG 1K3RA 2N49A 4YCVA 3G6EA 4JI7Q 1W3SA 3GTLH 4A93H 1U5KA 4LF5Q 1O7IA 3U4ZA 3J81c 1MIUA 4YY3Q 5C0XI 1YHQA 4JBMA 4YCUA 4A3BH 4WJ4A 3J80c 4A3FH 1EIFA 2DUDA 4A3IG 2ZTCA 5ELNA 2OTLA 4LW1A 1HZBA 2NN6I 4LFAQ 2N3SA 2R92H 3J7A5 1K83H 1HR0W 4UP7A 3ZJYC 3OTOL 5BR8L 2HIXA 2VQFL 2WP8J 4GKKL 2QA4A 4ALPA 5JEAJ 1VQ4A 1S3OA 2R6GA 3HKZG 1Q1BA 2KBNA 4LF7Q 5LMUL 1WYDA 1SFOH 4NXNL 1PHJA 4L5SA 3PUWA 2YYZA 3UE1A 1VQDA 5IY0A 3S17H 4B3RL 4JI3Q 4IOCA 2BH8A 1WCMH 1VQBA 4UPAA 1GKHA 4AQYL 1TXYA 1V1QA 2UXDL 3K0XA 4DR7L 3K80C 4JC0A 2ATWA 4LFBL 2DGYA 5IYCH 3K7AH 4NXMQ 1R9TH 1VQHA 1JT8A 3D31A 1E3PA 1OXXK 1RL2A 4A3DG 1PH7A 3RN2A 3PO3H 4JI2L 2LXKA 1J5EQ 3E0EA 2YTXA 4YCWA 3MEFA 1JJCB 3TEHB 3ULPA 5GADC 1PH3A 4DUYQ 3I4MG 1XNQL 1Q86C 5IWAL 2KHJA 5C3EH 1Q81C 1SE8A 5C4XH 1VQKA 4BXXH 4DR2Q 4PZ6A 1NBWA 3CMAA 2VL6A 1S40A 2R7FA 2N8NA 3PSIA 4RG1A 4LFCL 1B7YB 1LTLA 4Y7NH 4PZ7A 3RNUA 1PH5A 2AMCB 3JAMi 1CKMA 2Z0SA 4DK3C 4DV3Q 1Q8KA 2IHFA 3CCQA 1PH4A 1I94L 1VQMA 1L1OC 1D7QA 4JYAQ 1HZCA 3J80i 5IE8A 1LM0A 3NBHB 2AWOA 5M5YH 1KAWA 1VQLA 3EN2A 2JA5G 3HOYH 4GKJL 4DV3L 4JCVE 4DV1L 2PI2E 4GNXB 4LF8L 1LYLA 4JV5L 1XMOQ 2A19A 4IJHA 4IPHA 3S1RH 5IYCG 4DV2Q 1YI2A 4BY1H 1MKHA 4R4CA 3J81j 4HJ7A 1GVPA 4DV5Q 2I5MX 4R4OA 4JI8L 3S2HH 1SN8A 2D62A 3E9HA 3Q8DA 2RHSB 3I2ZA 1Y1WG 3S16H 3AFPA 3OYYA 3CCUA 3KDFB 3PUYA 4R4IA 3PO2G 3T1YQ 1NMGA 1N34L 4TQUS 4B3ML 3DLLA 1VQJA 2Q2HA 2NVXH 1J5EL 4AQYQ 2UXDQ 3ICEA 1C9OA 4GLVB 1EQQA 3PF5A 1XPUA 2Q2IA 2ZJQA 1BBUA 5LMNL 1HZAA 3W1BA 2OQKA 4X62Q 4NXML 5EAYA 3H0GG 5IP9H 2E5LL 2CWAA 4QJFA 2JA8G 3GTJH 3CC2A 3ULJA 2F4VQ 3HFZB 1PYSB 1VS0A 1Z9FA 3K7UC 5BR8Q 2K5VA 2VQFQ 4KHZA 4DPGA 2VW9A 3HOZG 1VQGA 4LF9Q 4B3TL 1UEBA 3VDYA 1VQ7A 4OWTB 4A3CG 1HNWQ 4K0KQ 4X64L 1KXLA 4BY1G 1YHAA 3S2DH 1Q46A 4DV0L 1J6QA 1N36Q 3JAMc 4A3EH 1VQ8A 2R7DA 4BA1I 4DNIA 2I5LX 3BZKA 1AE2A 2NZHA 4J15A 1KIXA 3TS2A 1UE7A 3G48A 4KLKA 1WCMG 4ME3A 1EYGA 4A3GH 1PVOA 2ZM6L 4B3SQ 3RZDH 3KJOA 1N32L 5IWAQ 2YU9H 3L0OA 3B6YA 5M3MH 3PIPA 4JI5L 4MNOA 4X6AH 1FJGQ 1VQAA 4IFDG 3FP9A 1UE5A 4DR3L 1YIJA 2B63G 1KQSA 2VUMH 4YHHQ 1L2FA 3CP0A 5HY6A 5FLMH 3PCOB 4DR5L 2E2HH 1VQ5A 1V43A 1IZ6A 1N34Q 4B3MQ 2H5XA 1SRUA 3I55A 4LF7L 3IRBA 2NN6G 2UUBQ 3HOUH 3CC4A 5IYDG 2JA8H 4BA2I 1YHBA 4EX5A 1K73C 2EXDA 3ER0A 4B3RQ 1VCIA 2D0OA 2PI2A 1IBKL 4DUZQ 4C2MH 2BH2A 2RCNA 3G4SA 3GTGH 2KHIA 1QUQA 4JI5Q 1FVIA 4IOAA 2KENA 1HJPA 2E2IH 2E8GA 2WB1E 4DV0Q 2R7ZG 4YWLA 2UXBQ 4X66L 3TRZA 1N33Q 2LSSA 4LF5L 2ZJPA 2UUAQ 3AEVA 5E7NA 2R93G 2F52A 3EIVA 5M5WH 1OTCA 1Z47A 4A76A 1XNRL 1XMQQ 1YZ6A 3AQQA 1X3FA 4OWXB 1PH1A 4C3HH 3T1HQ 1K8AC 2AWNA 2Q2TA 3FHWA 1GO3E 3GD7A 2CFMA 1WI5A 1E7ZA 1P16A 3F1ZA 2NZOA 4DR1L 2WAQG 2B63H 4LF9L 3KF6A 4P73A 1VQOA 4GOPC 4KHPQ 4DAYB 4LF6Q 4H02A 5DLQE 2PQAA 5C44H 4DR1Q 3OW2A 3A5ZB 4R1JA 4PZ8A 2HHHL 3CCJA 3H3VH 1W2BA 1AH9A 4IPGA 3S1MH 4A3BG 4UP9A 1EFWA 1OXTA 2QGQA 1TWCH 5IYBH 3GTOH 5FLXc 1T9HA 2ID0A 4LF4L 5HGQA 4OO1G 4JI0Q 3S1QH 2VNUD 2N78A 2IX0A 5GAGC 2XGTA 2MNAA 1IBKQ 3F8TA 1FL0A 1RIPA 4UP8A 2V1CC 4JI8Q 1QUQB 2OQ0A 1HNXQ 3NENA 1PV4A 2OCEA 2JEBI 4JOIA 4DAMA 4OX9L 4AIMA 4A93G 2GVBA 1YJWA 3HKSA 4DV1Q 1C7YA 3RN5A 1UWVA 3PV0A 3TQYA 4DV5L 4GOPA 5JJKA 1K9MC 3HOZH 4DR3Q 2ES2A 4A3MH 4LF6L 5IYDH 2WB1G 4P72A 3GTQH 4DKAC 2GVAA 4GS3A 4BXXG 5C4XG 3CCLA 3CC7A 2Z6KA 3RLOA 1PH6A 4JI4L 1HR0Q 1BKBA 1TWHH 3U50C 4OXPA 4L5QA 1KC8C 1AE3A 2HHHQ 2ASBA 1X3GA 4KHPL 1VQ9A 3CXCA 5C4JH 2BA1A 4DK6C 3GO5A 4NXNQ 3E9IA 4A75A 1I94Q 4LFAL 3M85A 2WAQE 4L5RC 3I7FA 2MFIA 4HJ5A 2JA7H 1IBML 1OXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTP H;  2B29 A;  3S14 H;  3HOY G;  1L0W A;  1HNZ L;  2VUM G;  1WJJ A;  1N36 L;  1JMC A;  1NJI C;  3JC6 6;  4OON A;  2BA0 A;  4HJ9 A;  3STB C;  3DM3 A;  4K0K L;  1PH9 A;  1VQN A;  1VQE A;  3UDF A;  3CCE A;  2Z6K C;  3TRE A;  4QGU A;  1CSP A;  3EBE A;  5IP7 G;  2JA6 G;  1VQ6 A;  4RMF A;  4P71 A;  4BBS G;  2UXC L;  1X54 A;  2OWO A;  3UE0 A;  1HZ9 A;  2VS1 A;  1Y1W H;  2F3I A;  1VQF A;  3UDX A;  1XPO A;  1GM5 A;  3UDI A;  2VZA A;  4HJA A;  3WWV A;  4YWK A;  1IYJ B;  1BBW A;  5C0X G;  2C35 B;  4A3F G;  1PH2 A;  2UUB L;  2K4K A;  1FJG L;  4DR4 Q;  2A1A A;  3L7Z C;  4A3I H;  2JEA I;  1C0A A;  4QL5 A;  1IBL L;  1N32 Q;  4A3C H;  1HNX L;  3HOV G;  5LMN W;  4A3J H;  4IFD J;  1G51 A;  2GN5 A;  2OTJ A;  2R93 H;  2MO1 A;  3NEM A;  4QIW E;  3PUV A;  4A3L G;  3CW2 C;  4DV2 L;  2I0Q A;  2I5H A;  4JOI C;  2MO0 A;  1QVC A;  3CF5 A;  4A3M G;  4A3K G;  1KRT A;  4BY7 H;  3KF6 B;  3GTK H;  3HOW G;  3GDE A;  2A8V A;  4HJ8 A;  4EQ5 A;  4JI7 L;  3ULL A;  2Q2U A;  2K5N A;  1B8A A;  2ZTE A;  4LUZ A;  3F2C A;  2JA9 A;  3FKI H;  1D8L A;  2UU9 L;  2RHQ B;  3TS0 A;  1P8L A;  3M4P A;  5IP7 H;  5J3B A;  1E1T A;  4X65 Q;  4GKJ Q;  4QY7 A;  5IYB G;  1KHI A;  1IXR A;  4OWW B;  3M3Y H;  3J81 i;  3PO2 H;  2AHO B;  2FXQ A;  3W1G A;  2VQE Q;  1OXU A;  2VQE L;  1JB7 A;  4QQB X;  4GN4 B;  4BBS H;  4AYB E;  4O0A A;  4LUV A;  4DV6 L;  2JA7 G;  1X6O A;  3CAM A;  1HR0 L;  2UUA L;  4DR2 L;  4R4Q A;  3KFU A;  1TWA H;  2WFW A;  2CWP A;  4YWM A;  4IO9 A;  2E5L Q;  1KD1 C;  4HIO A;  3KOJ A;  5GRO A;  1GD7 A;  4X62 L;  1CKN B;  1QVF A;  3ERS X;  3HOX G;  4JBJ A;  4JI2 Q;  2D0P A;  4AH6 A;  5ELO A;  1XJV A;  4JI0 L;  3A0J A;  1PH8 A;  2R92 G;  3M4Q A;  2ZJR A;  4DV4 Q;  4DV4 L;  1XNQ Q;  1V9P A;  2YTV A;  2YTY A;  1M90 C;  5M3M G;  4JV5 Q;  2CCZ A;  1KRS A;  1NY4 A;  4WJ3 M;  2EQS A;  5JEA G;  1CUK A;  4GLX A;  1G6P A;  2ALY B;  3K8A A;  2JA5 H;  3U4V A;  2RF4 A;  4LUO A;  4JI6 Q;  1ASY A;  3M4O H;  3GTM H;  1SRO A;  2QEX A;  1BVS A;  3G71 A;  3J7Z C;  2VY3 A;  1PYB A;  4DR4 L;  2JQO A;  2K14 A;  1NMF A;  5AJ3 Q;  4HIK A;  3A5U A;  2K5H A;  1L1O B;  2NVY H;  1YJ9 A;  3I4O A;  1QVG A;  5M3F H;  4GLA C;  3I4N H;  1SMX A;  3PIO A;  3OTO Q;  4POG A;  1X9N A;  4GOP B;  4LFC Q;  1Q82 C;  4JYA L;  2Y0S E;  4Y52 H;  4POF A;  3HOW H;  1EQR A;  4A4I A;  4X65 L;  4GNX A;  2JE6 I;  2MQH A;  1A62 A;  4X66 Q;  4LWC A;  1JE5 A;  2R7Z H;  1M1K C;  4IFD I;  1EUJ A;  3PUX A;  4AYB G;  1Q12 A;  3L2P A;  3U58 A;  3I56 A;  5K36 G;  1JJG A;  4IPC A;  4XTC S;  1FGU A;  2HQL A;  4DUZ L;  4P75 A;  4IJL A;  2EIF A;  2JJQ A;  2F4V L;  1DGS A;  3S24 A;  1S72 A;  1HNW L;  1YBY A;  5GQO A;  4PMW A;  1Y14 B;  1NTG A;  2NVT H;  4JBK A;  4DR7 Q;  3H15 A;  1WOC A;  1H95 A;  1VQI A;  4R4T A;  1B70 B;  2HIV A;  3BZC A;  4XIG S;  1QZG A;  1WFQ A;  2K50 A;  4DV7 L;  3CPW A;  4APV A;  4LNQ A;  1ASZ A;  4NB3 A;  5GAE C;  4GNX C;  3KLW A;  1UE6 A;  4A3E G;  1IL2 A;  3T1Y L;  2UXC Q;  1VQC A;  4A3K H;  1L1O A;  1A0I A;  5C0X J;  1SR3 A;  1K0R A;  4YHH L;  3MXN B;  4B3S L;  4JI6 L;  1EOV A;  3I4M H;  2L15 A;  1G29 1;  1Q1E A;  3M7N A;  1X56 A;  1U0L A;  2ZTD A;  2HT1 A;  1YJN A;  5M3F G;  3I4N G;  3S15 H;  3BJU A;  3PGZ A;  1A63 A;  1I3Q H;  1E22 A;  1X3E A;  4NPS A;  1IBM Q;  3S1N H;  2K52 A;  4HID A;  4DR6 L;  2ZM6 Q;  1K8G A;  1YVC A;  4GKK Q;  5FJ8 H;  3KYH C;  4YY3 L;  1Y1V G;  1HNZ Q;  2Y0S G;  1YEZ A;  2B3G A;  2XTI A;  4JBW A;  2IX1 A;  3PO3 G;  1OXS C;  1A8V A;  1I6H H;  4P74 A;  4OO1 I;  4BBR G;  2YV5 A;  3RLN A;  3RR5 A;  1EWI A;  4LF4 Q;  5JJL A;  1E24 A;  1XMO L;  1X55 A;  2LXJ A;  5IT9 c;  1PA6 A;  4L5T A;  1MJC A;  4TVA B;  4X64 Q;  5C3E G;  2UUC Q;  1I50 H;  1CKO A;  5JJI A;  1CKN A;  4B3T Q;  4DV6 Q;  3CCS A;  1KL9 A;  3H0G H;  5IP9 G;  3CCV A;  1XMQ L;  1UE1 A;  2IHE A;  3HOX H;  4GN3 B;  5AJ3 L;  2KCT A;  4JI4 Q;  1N33 L;  3M9B A;  1I5F A;  3SGI A;  2AKW B;  4C3J H;  3T1H L;  2JA6 H;  3D0F A;  4PG3 A;  1N8R C;  4A3G G;  2UXB L;  3STB D;  4MZ9 A;  1SLJ A;  4JI1 L;  2UU9 Q;  3CD6 A;  1XNR Q;  3RZO H;  1YNX A;  2CKZ B;  4DR6 Q;  4OX9 Q;  4DUY L;  5LMN Q;  3HKZ E;  3RLF A;  1XPR A;  1EIY B;  1X65 A;  2KCM A;  1E1O A;  3AFQ A;  4BY7 G;  3W5O A;  3UDG A;  4IPD A;  1CSQ A;  1NE3 A;  3K81 C;  1YIT A;  1TWG H;  3LGJ A;  5FJ8 G;  1XTD A;  3PF4 A;  2JK8 A;  3CCR A;  4LF8 Q;  2PMZ E;  5GAH C;  5C44 G;  4BBR H;  4KI0 A;  1VQP A;  4DV7 Q;  5M5X H;  4UY8 C;  3NEL A;  1MJE A;  1Y1V H;  5H1S E;  3CPF A;  4JG2 A;  4JI3 L;  1Q7Y C;  1IBL Q;  3KJP A;  1LUZ A;  1N9W A;  4MTN A;  3F2D A;  4JI1 Q;  3A74 A;  1PFS A;  4LFB Q;  5LMU Q;  3AYH B;  3KDF A;  3BU2 A;  3KF8 B;  2IY5 B;  4GN5 A;  4DR5 Q;  2UUC L;  4C3I H;  2E2J H;  2PNH A;  4FDB A;  5FLM G;  2K75 A;  3PUZ A;  3CME A;  4HIM A;  1QZH A;  3H3V I;  2CQO A;  4O2D A;  1HH2 P;  3CQZ H;  3F2B A;  3CCM A;  3FKI G;  4A3J G;  2PQA B;  3HOV H;  1TWF H;  2IT1 A;  4A3D H;  4A3L H;  1JJ2 A;  2NVQ H;  3HOU G;  1K3R A;  2N49 A;  4YCV A;  3G6E A;  4JI7 Q;  1W3S A;  3GTL H;  4A93 H;  1U5K A;  4LF5 Q;  1O7I A;  3U4Z A;  3J81 c;  1MIU A;  4YY3 Q;  5C0X I;  1YHQ A;  4JBM A;  4YCU A;  4A3B H;  4WJ4 A;  3J80 c;  4A3F H;  1EIF A;  2DUD A;  4A3I G;  2ZTC A;  5ELN A;  2OTL A;  4LW1 A;  1HZB A;  2NN6 I;  4LFA Q;  2N3S A;  2R92 H;  3J7A 5;  1K83 H;  1HR0 W;  4UP7 A;  3ZJY C;  3OTO L;  5BR8 L;  2HIX A;  2VQF L;  2WP8 J;  4GKK L;  2QA4 A;  4ALP A;  5JEA J;  1VQ4 A;  1S3O A;  2R6G A;  3HKZ G;  1Q1B A;  2KBN A;  4LF7 Q;  5LMU L;  1WYD A;  1SFO H;  4NXN L;  1PHJ A;  4L5S A;  3PUW A;  2YYZ A;  3UE1 A;  1VQD A;  5IY0 A;  3S17 H;  4B3R L;  4JI3 Q;  4IOC A;  2BH8 A;  1WCM H;  1VQB A;  4UPA A;  1GKH A;  4AQY L;  1TXY A;  1V1Q A;  2UXD L;  3K0X A;  4DR7 L;  3K80 C;  4JC0 A;  2ATW A;  4LFB L;  2DGY A;  5IYC H;  3K7A H;  4NXM Q;  1R9T H;  1VQH A;  1JT8 A;  3D31 A;  1E3P A;  1OXX K;  1RL2 A;  4A3D G;  1PH7 A;  3RN2 A;  3PO3 H;  4JI2 L;  2LXK A;  1J5E Q;  3E0E A;  2YTX A;  4YCW A;  3MEF A;  1JJC B;  3TEH B;  3ULP A;  5GAD C;  1PH3 A;  4DUY Q;  3I4M G;  1XNQ L;  1Q86 C;  5IWA L;  2KHJ A;  5C3E H;  1Q81 C;  1SE8 A;  5C4X H;  1VQK A;  4BXX H;  4DR2 Q;  4PZ6 A;  1NBW A;  3CMA A;  2VL6 A;  1S40 A;  2R7F A;  2N8N A;  3PSI A;  4RG1 A;  4LFC L;  1B7Y B;  1LTL A;  4Y7N H;  4PZ7 A;  3RNU A;  1PH5 A;  2AMC B;  3JAM i;  1CKM A;  2Z0S A;  4DK3 C;  4DV3 Q;  1Q8K A;  2IHF A;  3CCQ A;  1PH4 A;  1I94 L;  1VQM A;  1L1O C;  1D7Q A;  4JYA Q;  1HZC A;  3J80 i;  5IE8 A;  1LM0 A;  3NBH B;  2AWO A;  5M5Y H;  1KAW A;  1VQL A;  3EN2 A;  2JA5 G;  3HOY H;  4GKJ L;  4DV3 L;  4JCV E;  4DV1 L;  2PI2 E;  4GNX B;  4LF8 L;  1LYL A;  4JV5 L;  1XMO Q;  2A19 A;  4IJH A;  4IPH A;  3S1R H;  5IYC G;  4DV2 Q;  1YI2 A;  4BY1 H;  1MKH A;  4R4C A;  3J81 j;  4HJ7 A;  1GVP A;  4DV5 Q;  2I5M X;  4R4O A;  4JI8 L;  3S2H H;  1SN8 A;  2D62 A;  3E9H A;  3Q8D A;  2RHS B;  3I2Z A;  1Y1W G;  3S16 H;  3AFP A;  3OYY A;  3CCU A;  3KDF B;  3PUY A;  4R4I A;  3PO2 G;  3T1Y Q;  1NMG A;  1N34 L;  4TQU S;  4B3M L;  3DLL A;  1VQJ A;  2Q2H A;  2NVX H;  1J5E L;  4AQY Q;  2UXD Q;  3ICE A;  1C9O A;  4GLV B;  1EQQ A;  3PF5 A;  1XPU A;  2Q2I A;  2ZJQ A;  1BBU A;  5LMN L;  1HZA A;  3W1B A;  2OQK A;  4X62 Q;  4NXM L;  5EAY A;  3H0G G;  5IP9 H;  2E5L L;  2CWA A;  4QJF A;  2JA8 G;  3GTJ H;  3CC2 A;  3ULJ A;  2F4V Q;  3HFZ B;  1PYS B;  1VS0 A;  1Z9F A;  3K7U C;  5BR8 Q;  2K5V A;  2VQF Q;  4KHZ A;  4DPG A;  2VW9 A;  3HOZ G;  1VQG A;  4LF9 Q;  4B3T L;  1UEB A;  3VDY A;  1VQ7 A;  4OWT B;  4A3C G;  1HNW Q;  4K0K Q;  4X64 L;  1KXL A;  4BY1 G;  1YHA A;  3S2D H;  1Q46 A;  4DV0 L;  1J6Q A;  1N36 Q;  3JAM c;  4A3E H;  1VQ8 A;  2R7D A;  4BA1 I;  4DNI A;  2I5L X;  3BZK A;  1AE2 A;  2NZH A;  4J15 A;  1KIX A;  3TS2 A;  1UE7 A;  3G48 A;  4KLK A;  1WCM G;  4ME3 A;  1EYG A;  4A3G H;  1PVO A;  2ZM6 L;  4B3S Q;  3RZD H;  3KJO A;  1N32 L;  5IWA Q;  2YU9 H;  3L0O A;  3B6Y A;  5M3M H;  3PIP A;  4JI5 L;  4MNO A;  4X6A H;  1FJG Q;  1VQA A;  4IFD G;  3FP9 A;  1UE5 A;  4DR3 L;  1YIJ A;  2B63 G;  1KQS A;  2VUM H;  4YHH Q;  1L2F A;  3CP0 A;  5HY6 A;  5FLM H;  3PCO B;  4DR5 L;  2E2H H;  1VQ5 A;  1V43 A;  1IZ6 A;  1N34 Q;  4B3M Q;  2H5X A;  1SRU A;  3I55 A;  4LF7 L;  3IRB A;  2NN6 G;  2UUB Q;  3HOU H;  3CC4 A;  5IYD G;  2JA8 H;  4BA2 I;  1YHB A;  4EX5 A;  1K73 C;  2EXD A;  3ER0 A;  4B3R Q;  1VCI A;  2D0O A;  2PI2 A;  1IBK L;  4DUZ Q;  4C2M H;  2BH2 A;  2RCN A;  3G4S A;  3GTG H;  2KHI A;  1QUQ A;  4JI5 Q;  1FVI A;  4IOA A;  2KEN A;  1HJP A;  2E2I H;  2E8G A;  2WB1 E;  4DV0 Q;  2R7Z G;  4YWL A;  2UXB Q;  4X66 L;  3TRZ A;  1N33 Q;  2LSS A;  4LF5 L;  2ZJP A;  2UUA Q;  3AEV A;  5E7N A;  2R93 G;  2F52 A;  3EIV A;  5M5W H;  1OTC A;  1Z47 A;  4A76 A;  1XNR L;  1XMQ Q;  1YZ6 A;  3AQQ A;  1X3F A;  4OWX B;  1PH1 A;  4C3H H;  3T1H Q;  1K8A C;  2AWN A;  2Q2T A;  3FHW A;  1GO3 E;  3GD7 A;  2CFM A;  1WI5 A;  1E7Z A;  1P16 A;  3F1Z A;  2NZO A;  4DR1 L;  2WAQ G;  2B63 H;  4LF9 L;  3KF6 A;  4P73 A;  1VQO A;  4GOP C;  4KHP Q;  4DAY B;  4LF6 Q;  4H02 A;  5DLQ E;  2PQA A;  5C44 H;  4DR1 Q;  3OW2 A;  3A5Z B;  4R1J A;  4PZ8 A;  2HHH L;  3CCJ A;  3H3V H;  1W2B A;  1AH9 A;  4IPG A;  3S1M H;  4A3B G;  4UP9 A;  1EFW A;  1OXT A;  2QGQ A;  1TWC H;  5IYB H;  3GTO H;  5FLX c;  1T9H A;  2ID0 A;  4LF4 L;  5HGQ A;  4OO1 G;  4JI0 Q;  3S1Q H;  2VNU D;  2N78 A;  2IX0 A;  5GAG C;  2XGT A;  2MNA A;  1IBK Q;  3F8T A;  1FL0 A;  1RIP A;  4UP8 A;  2V1C C;  4JI8 Q;  1QUQ B;  2OQ0 A;  1HNX Q;  3NEN A;  1PV4 A;  2OCE A;  2JEB I;  4JOI A;  4DAM A;  4OX9 L;  4AIM A;  4A93 G;  2GVB A;  1YJW A;  3HKS A;  4DV1 Q;  1C7Y A;  3RN5 A;  1UWV A;  3PV0 A;  3TQY A;  4DV5 L;  4GOP A;  5JJK A;  1K9M C;  3HOZ H;  4DR3 Q;  2ES2 A;  4A3M H;  4LF6 L;  5IYD H;  2WB1 G;  4P72 A;  3GTQ H;  4DKA C;  2GVA A;  4GS3 A;  4BXX G;  5C4X G;  3CCL A;  3CC7 A;  2Z6K A;  3RLO A;  1PH6 A;  4JI4 L;  1HR0 Q;  1BKB A;  1TWH H;  3U50 C;  4OXP A;  4L5Q A;  1KC8 C;  1AE3 A;  2HHH Q;  2ASB A;  1X3G A;  4KHP L;  1VQ9 A;  3CXC A;  5C4J H;  2BA1 A;  4DK6 C;  3GO5 A;  4NXN Q;  3E9I A;  4A75 A;  1I94 Q;  4LFA L;  3M85 A;  2WAQ E;  4L5R C;  3I7F A;  2MFI A;  4HJ5 A;  2JA7 H;  1IBM L;  1OXV A; 
#chains in the Genus database with same CATH topology
 1B3A A;  4R8N A;  3HOY G;  1U4R A;  1WJJ A;  1MSH A;  3MFG A;  1O7Z A;  4OEM B;  1VQE A;  3UDF A;  4QGU A;  4RMF A;  2L1B A;  2F3I A;  3HRZ C;  3L3O C;  3UDI A;  4HJA A;  2Z9H A;  2K7V A;  2F0O A;  5C4J B;  4A3F G;  2XIW A;  2C35 B;  3N52 A;  3H0G B;  3DWA A;  5T1G A;  4I65 A;  1JWS D;  4A3L G;  3I72 A;  3S14 B;  1HQR D;  2JA6 B;  3CW2 C;  1UNS A;  2AUJ D;  3D4W A;  4A3K G;  1EYC A;  3DXJ C;  3GTK H;  2PW5 A;  2QCP X;  1F2Y A;  2Q2U A;  2K5N A;  1B8A A;  4LUZ A;  5KRU A;  3ND8 A;  3F2C A;  3J81 L;  1TWG B;  4KY5 A;  3TS0 A;  1I4X A;  3M4P A;  2WAC A;  4GKJ Q;  2B2Y A;  3X3N A;  1DYQ A;  1KHI A;  3M3Y H;  2BDO A;  2AHO B;  3W1G A;  1Q8I A;  4GN4 B;  2PZU A;  4MN3 A;  4O0A A;  1HR0 L;  2Z4I A;  2WFW A;  4JVZ A;  1MI2 A;  1NUC A;  5E4X A;  2E2I B;  2BE5 C;  4BY7 B;  1QVF A;  3SK5 A;  2RSO A;  4L8J A;  3NBI A;  4IQZ A;  4DAV A;  2MGS A;  1A15 A;  5ELO A;  4OIJ A;  1E2V A;  3D6W A;  1XJV A;  4C3J G;  4TSS A;  1DZ1 A;  1V9P A;  2NZ1 D;  2YTV A;  2YTY A;  4FXD A;  2XRS D;  5M3M G;  4JV5 Q;  2DN8 A;  2CCZ A;  3IL8 A;  2F1M A;  2ALY B;  3MXG A;  3HZX A;  3OSO A;  2B2Y C;  5AFW A;  1PYB A;  4DR4 L;  1TWA B;  1H9J A;  5AJ3 Q;  1JE4 A;  2K5H A;  3D6C A;  1WCM B;  2LMC B;  4X3T A;  1F9Q A;  3LWU A;  4LFC Q;  2Y0S E;  4POF A;  4DGZ A;  3HOW H;  2MQH A;  3T13 A;  4LWC A;  2HUG A;  3PUX A;  1Q12 A;  3L2P A;  5G3L D;  3DUZ A;  5K36 G;  4KKS A;  1JJG A;  1I3Q B;  3EVQ A;  5EJW A;  2EIF A;  3NWT A;  2JJQ A;  2KED A;  4A3M B;  3S24 A;  5C3E B;  1S72 A;  2PYK A;  1CA6 A;  3GQB A;  4HMJ A;  1XTC D;  3H15 A;  4RGM A;  1WFQ A;  3MA2 B;  1ASZ A;  2L5T A;  3KLW A;  1CHP D;  2Q8R E;  1G8Z D;  1IYU A;  1A0I A;  4KK7 A;  1SR3 A;  3MXN B;  4B3S L;  4BWG B;  2HT1 A;  3T4A C;  5M3F G;  1HHV A;  3T53 B;  1I6V C;  5EKL A;  4H0L C;  1BF4 A;  3S1N H;  2K52 A;  4M8A A;  4BY1 B;  3G6J B;  1YVC A;  2IX1 A;  2Y0S G;  2XTI A;  1A8V A;  1I6H H;  1MGS A;  3D4R A;  4LF4 Q;  3Q23 A;  1E24 A;  1PRT B;  3ITP A;  5IT9 c;  2LXJ A;  4L5T A;  1MJC A;  3SXH A;  4X64 Q;  4RHS A;  3H0G H;  3GV6 A;  5IP9 G;  2MP1 A;  1UE1 A;  1XXG A;  2SOB A;  1SSO A;  1HTL D;  1I5F A;  3SGI A;  2AKW B;  3A56 A;  2JXM B;  2JA6 H;  2UXB L;  2UU9 Q;  4JI1 L;  4RA8 A;  1XNR Q;  3RZO H;  1YNX A;  2CKZ B;  4IUU A;  4K8I A;  4RCO A;  1T5E A;  4CDF C;  3UDG A;  4HSP A;  1NE3 A;  1Z6H A;  1YIT A;  1TWG H;  2LKV A;  1X3P A;  2B2V A;  5C44 G;  4DV7 Q;  1UAP A;  2EZV A;  2Z4H A;  5IGC A;  1MJE A;  1Q7Y C;  1H9S A;  3RZD B;  1LAC A;  5M3M B;  3TDQ A;  4LFB Q;  3AYH B;  1M8A A;  3KF8 B;  5FLM G;  2K75 A;  3H3V I;  2F0H A;  2VUM B;  1F2M A;  3FKI G;  4IUR A;  1GJX A;  4YCV A;  4AYB B;  4K14 A;  1W3S A;  4A93 H;  5CV9 A;  3IFD A;  1HTP A;  3U4Z A;  3C46 A;  3M7N A;  1MIU A;  1ENA A;  1RCV D;  3F2U A;  4YY3 Q;  5C0X I;  4JBM A;  4WJ4 A;  5C0X H;  1LTR D;  3Q22 A;  2PO4 A;  1HR0 W;  3OTO L;  1SDF A;  4GKK L;  1GUG A;  1B9M A;  1S3O A;  2KQ3 A;  2V4D A;  2KBN A;  4LF7 Q;  4NXN L;  1PHJ A;  3PUW A;  5EPK A;  1VQD A;  3I90 A;  4ZQ3 A;  1JQY D;  4IOC A;  1WCM H;  1CA5 A;  1V1Q A;  3VR5 A;  4EGV A;  5I2X A;  4DR7 L;  1OO9 B;  5F2D A;  3KUP A;  1STB A;  3PO3 H;  1J5E Q;  1E2W A;  5CV7 A;  2L11 A;  3WOE A;  4YCW A;  1XNQ L;  3KLR A;  3MC0 B;  4S3S A;  3C2P A;  1KNE A;  5C3E H;  2TMP A;  1SXT A;  1Q81 C;  3MWY W;  1A3U A;  2VL6 A;  3NTK A;  4Y7N H;  4PQX A;  1B7Y B;  1TT2 A;  4PZ7 A;  2D9U A;  3RNU A;  1PH5 A;  2AMC B;  3JAM i;  1SE3 A;  2IHF A;  1R9T B;  1D7Q A;  4JYA Q;  2EYL A;  4JK1 C;  1JB3 A;  2RA4 A;  2AWO A;  1STY A;  2L0C A;  3HOY H;  2K04 A;  4DV3 L;  4HSV A;  4P2C B;  4DV1 L;  1GUN A;  1SMY C;  4Z9C B;  4LF8 L;  3S9W A;  2A19 A;  4IJH A;  1R4Q B;  4N8F A;  5EQ0 A;  1KLG D;  2MPM A;  2D62 A;  3E6Z X;  3E9H A;  5G3L F;  2RHS B;  3HS0 C;  3KDF B;  4R4I A;  1ZYR C;  2EYO A;  5KND A;  3PO2 G;  2F0P A;  4A3E B;  1N34 L;  4TQU S;  3C1F A;  1VQJ A;  4AQY Q;  2UXD Q;  1AN8 A;  4CHT B;  4GLV B;  1XPU A;  2G5D A;  2ZJQ A;  1BBU A;  4X62 Q;  4NXM L;  2K1B A;  1IKM A;  2CWA A;  1E2Z A;  2F3V A;  4BS9 A;  3QR8 A;  2EYH A;  4CDE C;  1PYS B;  1EZ6 A;  2R61 A;  4FF4 A;  4DPG A;  1VQG A;  3NSW A;  1TS3 A;  1H9S B;  4A3I B;  1UEB A;  4DFA A;  4PNY A;  4X64 L;  5IT9 L;  5JEA H;  5I9O A;  2B8F A;  1N36 Q;  4KY7 A;  5FLX L;  4BA1 I;  2I5L X;  3BZK A;  4C2M B;  1EQV A;  2EY5 A;  2HQE A;  1PVO A;  1EY4 A;  5IWA Q;  4OIK A;  1LV9 A;  3PIP A;  2DJF C;  4X6A H;  4V0B A;  4IFD G;  4RHR A;  5K5P A;  1KQS A;  5FLM H;  3PCO B;  4FVM A;  4QUC A;  1HFN A;  3I55 A;  3PO2 B;  2JA8 H;  1HRJ A;  3DWQ A;  3FVQ A;  1VCI A;  5DNF A;  2KHI A;  5IOC A;  1NR2 A;  1N33 Q;  1TU2 B;  3EIV A;  5M5W H;  4ZLT F;  4XDX A;  1LT4 D;  1XMQ Q;  3AQQ A;  3NXW A;  2JP1 A;  1A6X A;  3T1H Q;  1I4H A;  1K8A C;  3DEP A;  2Q2T A;  1WI5 A;  2NZO A;  3DMU A;  2AQ2 B;  4LF9 L;  2F0L A;  3NQI A;  4P73 A;  3M4O B;  4GOP C;  1JOR A;  4LF6 Q;  2PQA A;  3PO3 B;  4DR1 Q;  2N55 A;  3A5Z B;  4PZ8 A;  4R1J A;  4DU9 A;  5JVH 3;  1MBY A;  4KN7 C;  1U4L A;  3WOF A;  4NKL A;  4U67 3;  1K0S A;  5HGQ A;  3I4N B;  3OMG A;  2MNA A;  1QOH A;  4CKB A;  1FNU A;  1BNZ A;  2V1C C;  2OQ0 A;  2RDF A;  2ENB A;  3NEN A;  2R7Z B;  3OPO A;  4JOI A;  3OIP A;  4DAM A;  2DY7 A;  2GVB A;  4DV1 Q;  4J1M A;  4TRD A;  2KUM A;  1EIH A;  3HOZ H;  1O7Y A;  4DR3 Q;  1V1O A;  4OGQ C;  1RD9 D;  4GS3 A;  5C5L A;  2B2U A;  1VMP A;  3RLO A;  1STN A;  1HR0 Q;  4L5Q A;  1TQO A;  1X3G A;  1SBB B;  2J0T D;  3S1Q B;  4DF7 A;  5C4J H;  3CXC A;  4NXN Q;  1DD2 A;  4A75 A;  3K5O A;  1I94 Q;  4LFA L;  3M85 A;  4HCS A;  4L5R C;  2NTT A;  3DEO A;  3K5N A;  3FDT A;  2B29 A;  1KTK A;  3S14 H;  4OO1 H;  1S5C D;  1S5F D;  1L0W A;  2PNR C;  1HNZ L;  2G9D A;  4OON A;  4K0K L;  5CV8 A;  3EA6 A;  2DNC A;  2BOS A;  2Z6K C;  1CSP A;  3EBE A;  2JA6 G;  1AW7 A;  4BBS G;  2OWO A;  2VS1 A;  1Y1W H;  1GM5 A;  2D2C C;  3UDX A;  1XPO A;  1ET6 A;  1BBW A;  1PH2 A;  2K4K A;  2A1A A;  2LFN A;  3M3Y B;  2VXW A;  4QL5 A;  3BDO A;  3RMH A;  1GUW A;  1TKW B;  1HNX L;  2JA7 B;  3HOX B;  5EBD A;  2GN5 A;  3NEM A;  4HN7 A;  2BE5 D;  1B50 A;  2RSN A;  3CF5 A;  4BY7 H;  3I91 A;  1EZ8 A;  3MFY A;  3GDE A;  2A8V A;  4HJ8 A;  3KBG A;  4EQ5 A;  2ZTE A;  1G91 A;  4KKT A;  5KNB A;  2L55 A;  2JA9 A;  3FKI H;  2UU9 L;  2RHQ B;  4CKE A;  5IP7 H;  4QY7 A;  5IYB G;  4OWW B;  3A54 A;  5I6W A;  3J81 i;  3PO2 H;  3R3O A;  5FOB B;  1G6Z A;  1ZYR D;  1GHJ A;  1LLR D;  4A3J B;  4FXK C;  3CAM A;  4DR2 L;  2CWP A;  3P75 A;  4IO9 A;  1KD1 C;  3KOJ A;  4O42 A;  5GRO A;  4X62 L;  1R4P B;  2X6G A;  2KCN A;  2KJX A;  3GTL B;  1L0Y B;  2D0P A;  5M5W B;  3A0J A;  4NDX A;  3M4Q A;  4DV4 L;  1BDO A;  4WJ3 M;  3PIO 3;  2EQS A;  2A73 B;  5JEA G;  3J7A V;  1G6P A;  1U4P A;  1CK1 A;  3K8A A;  4H44 C;  3U4V A;  2TSS A;  3M4O H;  1RJT A;  1ICF B;  1PRT C;  1BVS A;  5ELF A;  1JWU D;  2VY3 A;  4E6I A;  1F77 A;  2K14 A;  1NMF A;  3A5U A;  3S17 B;  1L1O B;  4OEL B;  1YJ9 A;  2F0W A;  5E4W C;  1QVG A;  3I4N H;  4JYA L;  1X9N A;  4PMC A;  1PFM A;  4X65 L;  3J7A F;  1EFI D;  1AP0 A;  4X66 Q;  4ODG A;  1M1K C;  3H6M A;  5CV4 A;  4CJ1 B;  1HUN A;  4IPC A;  2HQL A;  1IKL A;  1K28 A;  4IJL A;  1DGS A;  1DOL A;  1DXM A;  1IL8 A;  5C4X B;  4PMW A;  1NTG A;  1RKN A;  4ZKC B;  4JBK A;  1I4R A;  2JYO A;  1H95 A;  4RGO S;  4IAL A;  3VYR A;  4QCL A;  1G2T A;  3VYS A;  3BZC A;  4XIG S;  1W6J A;  4CKC A;  1WTR A;  5E1F A;  3H91 A;  5GAE C;  4GNX C;  4A3E G;  3PIP 3;  1VQC A;  4A3K H;  3KLS A;  1L1O A;  5C0X J;  2AQ3 B;  1SAP A;  2ICE C;  1EOV A;  1G29 1;  3D8G A;  1X56 A;  3BYY B;  4C3I G;  4KD4 A;  3S15 H;  3BJU A;  2XRQ D;  3PGZ A;  2F0J A;  3BS1 A;  1WTO A;  1I3Q H;  1X3E A;  4NPS A;  3IKJ A;  4DR6 L;  3RZO B;  2ZM6 Q;  1SE4 A;  2FMM A;  4GKK Q;  3KYH C;  1Y1V G;  2K5D A;  5EKK A;  1YEZ A;  3A8J E;  3S2H B;  2A6E C;  5CBE E;  2VB2 X;  4P74 A;  4OO1 I;  2EYM A;  4EQN A;  3RR5 A;  1FD7 D;  2CW0 D;  1XMO L;  2XWB B;  1X55 A;  1PA6 A;  2X6L A;  1VMC A;  1Y8P B;  3K5L A;  5C3E G;  2F0S A;  2UUC Q;  5EBC A;  5JJI A;  1CKN A;  3PQI A;  5I6Y A;  1PTO D;  3HOX H;  4GN3 B;  2KCT A;  3T1H L;  1S5D D;  5I2Y A;  4A3G G;  1EY5 A;  3STB D;  2ZT9 C;  3CD6 A;  4DR6 Q;  1VF7 A;  4DUY L;  2QEJ C;  3HKZ E;  1PXU A;  1C8C A;  1STH A;  2B2T A;  1D5X C;  1X65 A;  1E1O A;  3AFQ A;  3TP8 A;  4IPD A;  4NMZ A;  1WTX A;  2IX3 A;  2JK8 A;  3CCR A;  3NP8 A;  5GAH C;  4KI0 A;  5M5X H;  3NEL A;  4KKU A;  1Y8O B;  2KHS A;  2HCI A;  1LUZ A;  4MTN A;  1U4M A;  4JI1 Q;  4GN5 A;  1LTS D;  4C3I H;  2E2J H;  3MZ5 A;  4NW2 A;  4HIM A;  4O2D A;  3M4Y A;  3HOV H;  4A3J G;  3ZYY X;  2IT1 A;  1VF5 C;  2E2H B;  3T51 B;  1K3R A;  3G6E A;  3J81 c;  1YHQ A;  4N8X 1;  4YCU A;  1EYA A;  3J80 c;  1EIF A;  2DUD A;  2OTL A;  5EPL A;  2N3S A;  3X3M A;  1WTV A;  1K83 H;  4YIJ A;  5A2Q L;  4UP7 A;  2VQF L;  2HIX A;  4MHE A;  1ILP A;  1B9N A;  3HKZ G;  5LMU L;  1WYD A;  1S4Z A;  3J80 E;  4B3R L;  1VQB A;  4UPA A;  3LWE A;  1GKH A;  4HCE A;  4JC0 A;  5CBA E;  2DGY A;  2B2W A;  3K7A H;  4NXM Q;  1R9T H;  4JW0 A;  4XQQ A;  3TP6 A;  1DOM A;  2K33 A;  3BVZ A;  4G57 A;  1E0B A;  1OXX K;  3SHL A;  4EVO A;  3MVV A;  5LL6 S;  1WTP A;  3HOY B;  3MEF A;  5J22 A;  3GTO B;  2Q8T A;  5A2Q E;  1LTG D;  4CDD C;  4DR2 Q;  4PZ6 A;  1IYV A;  1WD0 A;  2R7F A;  2N8N A;  1BR9 A;  4RG1 A;  5T1I A;  4XYQ A;  3Q6S A;  4DK3 C;  4DV3 Q;  1Q8K A;  1H9K A;  3BZD B;  4QIW B;  1SE2 A;  3EQL C;  4H13 C;  1HXY D;  1L1O C;  1I94 L;  3QO2 A;  1CHQ D;  3J80 i;  5IE8 A;  4FNF A;  3NBH B;  1VQL A;  3GTJ B;  4LJZ C;  4HR7 B;  3R8B A;  1XMO Q;  5IYC G;  2IJ0 A;  4CDC C;  2LY7 A;  1ZEQ X;  3J81 j;  4HJ7 A;  1EY6 A;  2F0N A;  2I5M X;  4JI8 L;  3S2H H;  3I4L A;  1A3T A;  3I2Z A;  1Y1W G;  1TII D;  3OYY A;  1ZKO A;  1NMG A;  2IW3 A;  1ET9 A;  3E5S A;  4G7H C;  3VYT A;  1J5E L;  1C9O A;  1TVX A;  3TME A;  3PF5 A;  1CT1 D;  2Q2I A;  1ENF A;  4CGY B;  3W1B A;  5D3I B;  2YU9 B;  2K01 A;  5M5Y B;  4KMU C;  1F9R A;  4QJF A;  3OIQ A;  3CC2 A;  3ULJ A;  2F4V Q;  4FYD A;  3MXN A;  5BR8 Q;  3K7U C;  2UXC Q;  2K5V A;  3ERQ A;  4LF9 Q;  2K5Q A;  4B3T L;  2E75 C;  4UDU C;  1VQ7 A;  3NTH A;  2PQE A;  2X69 A;  1YHA A;  4DV0 L;  3TP7 A;  2HD3 A;  4A3E H;  4FF2 A;  4DNI A;  1BCP B;  4J15 A;  1KIX A;  1UE7 A;  4BBR B;  3G48 A;  1WCM G;  1BUV T;  2F0I A;  1N32 L;  4B9X A;  4MIU A;  3FMC A;  1V1P B;  3AMU A;  1RDP D;  1FJG Q;  3FP9 A;  4DR3 L;  1YIJ A;  3HOV B;  4YHH Q;  1L2F A;  1SNC A;  5HY6 A;  1VQ5 A;  1V43 A;  1IZ6 A;  3A8I E;  1CM9 A;  3I73 A;  4LF7 L;  4A3B B;  2NN6 G;  5IYD G;  2PZT A;  5CC4 A;  1KAB A;  2K28 A;  4EX5 A;  2I07 B;  3GV3 A;  1K73 C;  3NUC A;  2EY1 A;  4Q0F A;  3GTG H;  3KLS X;  2WB1 E;  3D4D A;  4YWL A;  3R2I A;  4X66 L;  3TRZ A;  1SFO B;  3HG9 A;  2UUA Q;  4UAI A;  2XWJ B;  3NK9 A;  4K6D A;  1Z47 A;  1XNR L;  4RWS C;  1YZ6 A;  1X3F A;  4OWX B;  1PH1 A;  2CH4 A;  2AWN A;  1H9M A;  3FHW A;  3F1Z A;  3GD7 A;  1E7Z A;  1V1P A;  4I7Z C;  3NTI A;  2WAQ G;  1WTQ A;  5NUC A;  3HOU B;  4QUF A;  2F0Q A;  3BYT B;  2E76 C;  2HHH L;  2C9O A;  3H3V H;  2L12 A;  1OXT A;  4WJW A;  1TWC H;  4WOR A;  3GTO H;  2ID0 A;  4LF4 L;  2K5W A;  2VNU D;  2IX0 A;  3E0J A;  1ENC A;  3F8T A;  1ICW A;  5FO9 B;  1XWE A;  5IGE A;  1JOO A;  1A3V A;  1MHW C;  1YJW A;  3HKS A;  3PV0 A;  2Z8L A;  4GOP A;  5IYD H;  2WB1 G;  4P72 A;  1BO0 A;  5JPN C;  4DKA C;  2GVA A;  2XNA C;  3AB9 A;  5CMD A;  1PTO B;  3CCL A;  3BVM A;  1PYW D;  1PZK D;  4JI4 L;  1BKB A;  1KC8 C;  5CV5 A;  2ASB A;  4KHP L;  2BA1 A;  3GO5 A;  3E9I A;  4RGT A;  4CJ0 B;  3H3V C;  3CU7 A;  4HJ5 A;  2JA7 H;  3GTP H;  1FNV A;  3HGB A;  1TY2 A;  2VUM G;  1SYD A;  1JMC A;  1NJI C;  3S1N B;  2BA0 A;  3DM3 A;  2EJF C;  1PH9 A;  1CQF A;  1VDZ A;  3SK6 A;  3EFX D;  1HFG A;  4WFN 3;  5IP7 G;  1VQ6 A;  2EDG A;  2UXC L;  1X54 A;  3UE0 A;  1HZ9 A;  2RDG A;  1VQF A;  1IYJ B;  2WIN B;  5C0X G;  2UUB L;  4DR4 Q;  1FJG L;  2EY2 A;  2KCC A;  5J1Z A;  2JEA I;  5IOD A;  3S2D B;  1IBL L;  1N32 Q;  1IHZ A;  4H7B A;  4XYO A;  3SDZ A;  3HOV G;  4A3J H;  1UEA B;  1G51 A;  3EJI A;  3PUV A;  3P7J A;  4DXG A;  3SVM A;  1CTM A;  2I5H A;  2NB0 A;  2A6H D;  1QVC A;  4A3M G;  1QNU A;  4IUP A;  1KRT A;  3KF6 B;  3HOW G;  5ELE A;  2B2T C;  5DM7 3;  5BN3 A;  3VR6 A;  1SJH D;  3J80 L;  4QMG A;  1KDB A;  4KN4 C;  1E1T A;  1D1K A;  2FXQ A;  1OXU A;  4QQB X;  3H94 A;  4BBS H;  1ML0 D;  4AYB E;  4DV6 L;  2R93 B;  1F9P A;  2JA7 G;  1X6O A;  4R4Q A;  1DJR D;  5I4D A;  3OMC A;  4YWM A;  2E5L Q;  5IIF A;  2AQ1 B;  4HIO A;  2Z6B A;  1NCV A;  4KJN A;  3R93 A;  1BOS A;  1EY8 A;  1GXD C;  3ERS X;  4NP5 A;  4ZAI A;  3HOX G;  4JBJ A;  5C5M A;  4ZUJ A;  4FP5 D;  1BCP D;  1PH8 A;  3JAM E;  2ZJR A;  2RDH A;  1NY4 A;  4GLX A;  2JA5 H;  4JI6 Q;  4LUO A;  1STE A;  4DXF A;  1Y69 U;  1SRO A;  4EQP A;  3G71 A;  2VB3 X;  4OHJ A;  4HIK A;  1TWC B;  4ZUI A;  3SK8 A;  3I4O A;  3NPP A;  4GLA C;  1SMX A;  3PIO A;  3OTO Q;  4POG A;  4GOP B;  1Q82 C;  3SEB A;  4Y52 H;  5TSS A;  1EQR A;  4GNX A;  2JE6 I;  5CYU A;  4XQJ A;  1M4V A;  1BCP F;  3O13 A;  1D5Z C;  4IFD I;  1FYC A;  1EUJ A;  2EJM A;  3U58 A;  4XT1 B;  1SYE A;  1B44 D;  2LS0 1;  4HED A;  3S15 B;  3KK7 A;  1FGU A;  4P75 A;  1MSG A;  4LAA A;  1LTI D;  3GTM B;  1YBY A;  2M00 A;  1Y14 B;  2F0V A;  1PRT D;  1VQI A;  4R4T A;  4Q5V A;  1B70 B;  2HIV A;  2O4X A;  2EJG C;  1QZG A;  4DV7 L;  4NB3 A;  3QOJ A;  1UE6 A;  1IL2 A;  3H09 A;  3T1Y L;  4RKL A;  1AZP A;  3PMF A;  2L15 A;  2RVL A;  1Q1E A;  2ICI A;  1U0L A;  2ZTD A;  4C1N I;  1S5B D;  3I4N G;  4XXE A;  1KAA A;  3S1R B;  4HID A;  1TS5 A;  1K8G A;  3MXU A;  3FRP B;  5FJ8 H;  4JBW A;  1EY9 A;  5IGD A;  1OXS C;  2NVT B;  4BBR G;  3RLN A;  3S16 B;  2OT2 A;  5JJL A;  1AFP A;  2DNE A;  4TVA B;  4F88 A;  1XYI A;  4V19 0;  1EU4 A;  1I50 H;  1CKO A;  1QIL A;  3CCV A;  1B3Q A;  3I4M B;  3V05 A;  5AJ3 L;  4JI4 Q;  2KOL A;  2B8G A;  2F0K A;  1F2Z A;  3D0F A;  2ZXP A;  5I9P A;  1SLJ A;  3KBX A;  2F0T A;  2O2L D;  2CVR A;  4OX9 Q;  5LMN Q;  1TWF B;  2H4O A;  3RLF A;  2K6A A;  1XPR A;  3TBI B;  1EIY B;  2KCM A;  2L4N A;  1D1I A;  3LGJ A;  3K58 A;  4LF8 Q;  2R92 B;  1PFB A;  1K83 B;  3A7A B;  2IPK D;  3HEJ A;  4UY8 C;  2MJ8 A;  1Y1V H;  4JG2 A;  2EY6 A;  4JI3 L;  3KJP A;  5IGB A;  1BQQ T;  1N9W A;  4BBS B;  2A68 C;  1KLU D;  3A74 A;  1PFS A;  4KTA A;  2EYP A;  1SYC A;  1U9R A;  3BU2 A;  3KDF A;  5JAV A;  2UUC L;  4C3J B;  1A2U A;  4DR5 Q;  2MUY A;  4FDB A;  3PUZ A;  3CME A;  2CQO A;  3CQZ H;  1STA A;  2EXZ A;  1A2T A;  2NVQ H;  3HOU G;  2NUC A;  4JI7 Q;  3SK4 A;  2M2L A;  1O7I A;  2PPB C;  2JA8 B;  4A3F H;  2EVB A;  2SEB D;  5ELN A;  4LW1 A;  4LFA Q;  3DHQ A;  5IT9 E;  3ZJY C;  5BR8 L;  1EY0 A;  2CQA A;  2WP8 J;  2A69 D;  4M1U B;  4ALP A;  1LT5 D;  1VQ4 A;  5J39 A;  1K8M A;  4MTK A;  5FKA C;  1Q1B A;  4L5S A;  1SEB D;  2F3W A;  4DK0 A;  4C3I B;  2E2J B;  3C1E A;  2R3Z A;  4J6H A;  2IWH A;  4C3H G;  5IY0 A;  4JI3 Q;  1YNN D;  4C3H B;  3LNN A;  4A3D B;  1TXY A;  3QWN A;  2XVS A;  3K0X A;  3BVG A;  4LFB L;  1JC7 A;  5IYC H;  3VYU A;  1JOK A;  2EYF A;  3D31 A;  1JT8 A;  1E3P A;  4HMI A;  1RL2 A;  4A3D G;  3RN2 A;  3E0E A;  3P20 A;  3TEH B;  1JJC B;  4FO2 A;  3ULP A;  4HTH A;  2KHJ A;  3W2D A;  2A69 C;  1SE8 A;  1LAB A;  1J9O A;  5BN5 A;  3QIA A;  1NBW A;  1JCK B;  1S40 A;  1J8I A;  4DNR B;  5FK9 C;  4U68 A;  3WDN A;  2FMC A;  3OWE B;  2NVX B;  1F9S A;  2QKI C;  1PTO F;  3K7A B;  1CZW A;  3HOZ B;  1CFM A;  1HZC A;  3GP7 A;  1LM0 A;  1EY7 A;  5M9O A;  1DCZ A;  5M5Y H;  1KAW A;  2JA5 G;  4KV6 A;  1WD1 A;  1C48 A;  5ELB A;  1TWH B;  1LYL A;  2SNS A;  3S1R H;  5D3D A;  1YI2 A;  4BY1 H;  1MKH A;  3K57 A;  5ELD A;  2QIL A;  4ZYS A;  3T16 A;  4DV5 Q;  1SN8 A;  2F0G A;  3U9S A;  4LK1 C;  3S16 H;  3AFP A;  3KF8 A;  5KIX A;  3T1Y Q;  5EGT A;  2Q2H A;  3OHX C;  1I50 B;  3RUZ A;  1RHP A;  3A55 A;  1QWY A;  3Q24 A;  5LMN L;  1HZA A;  2OQK A;  3P1H A;  1S5E D;  5EAY A;  3H0G G;  5IP9 H;  2F0F A;  4K6L A;  3GTJ H;  3MHB A;  4QF4 A;  5C3W A;  4F8M A;  3HFZ B;  4OL7 A;  1VS0 A;  1Z9F A;  2VQF Q;  3I4M G;  1A63 A;  2VW9 A;  3IFT A;  1T5X D;  3VDY A;  2QDL A;  5JPM C;  3VR2 A;  4A3C G;  4K0K Q;  3NQT A;  1X3Q A;  4L6T B;  1TY0 A;  3JAM c;  1VQ8 A;  2R7D A;  1AE2 A;  1LO5 D;  2NZH A;  3N6R A;  1QE6 A;  3TS2 A;  4GZY C;  1PZJ D;  2OEO A;  1H9R A;  1EYG A;  1IW7 D;  4A3G H;  1PDQ A;  4B3S Q;  3RZD H;  3KJO A;  1O80 A;  1B2T A;  2YU9 H;  3L0O A;  4F87 A;  1SNM A;  5M3M H;  1F2L A;  4JI5 L;  2QF7 A;  3QB3 A;  2Q8I B;  1VQA A;  2B63 G;  3FPP A;  3FKI B;  4G7O C;  2VUM H;  3G7L A;  3CP0 A;  4C1N K;  4KHV A;  4A93 B;  1N34 Q;  2H5X A;  1SRU A;  2PZW A;  3HOU H;  2EOT A;  1YHB A;  2EXD A;  3ER0 A;  4K5W A;  4R9W A;  4B3R Q;  2D0O A;  2PI2 A;  4WRD A;  1IBK L;  2K05 A;  1GUT A;  2B39 A;  1FVI A;  2KEN A;  2HDL A;  2E8G A;  4IZ8 A;  3VR4 A;  2RCF A;  2LSS A;  4LF5 L;  1O78 A;  5E7N A;  3VR3 A;  5KGU A;  1OTC A;  2FFK B;  4A76 A;  2H1E A;  1Q3L A;  4C3H H;  5COR A;  4DA2 A;  2RQX A;  1GO3 E;  2O5J C;  4DR1 L;  1I4G A;  1QNK A;  4X3K A;  2FHT A;  4XT3 B;  1VQO A;  4H02 A;  5C44 H;  1JWM D;  1PLF A;  4ID6 A;  3OW2 A;  4K2L A;  1PTO H;  5KEE A;  3S1M H;  1FGB D;  3GTG B;  2JN4 A;  1CI3 M;  4I7A A;  5ISR A;  4A3B G;  1TS2 A;  2QGQ A;  1JR0 D;  4K8J A;  2NVY B;  1T9H A;  5M3F B;  5LHY 1;  3A8K E;  2N78 A;  5GAG C;  2PCF B;  2HCC A;  1UUP A;  1HCZ A;  4UP8 A;  5JOB A;  2M9V A;  2NBF A;  3HP3 A;  4AIM A;  1AZQ A;  4A93 G;  1BCP C;  2O5I C;  1K3B C;  1SYB A;  5KYL A;  1C7Y A;  3RN5 A;  1UWV A;  2B63 B;  4G4K A;  3ERO A;  5JJK A;  2ES2 A;  4LF6 L;  3J7Y W;  3FPU B;  1JIC A;  3VA5 A;  4BXX G;  1EQT A;  5C4X G;  2Z6K A;  2DJG C;  1TWH H;  1SNP A;  4OXP A;  1AE3 A;  1QCB D;  1TR5 A;  4DK6 C;  1JOQ A;  2WAQ E;  1HQM C;  2RBM A;  4A3K B;  1PTO C;  2HDM A;  2EE1 A;  1IBM L;  5HUR A;  1LTA D;  2F0E A;  1EWH A;  4RKB A;  4IUQ A;  1N36 L;  1G2S A;  3JC6 6;  3URY A;  3MTS A;  4HJ9 A;  3STB C;  1VQN A;  3CCE A;  2A6E D;  2B2U C;  3TRE A;  1SNO A;  3QJY A;  4P71 A;  1EIG A;  4FF1 A;  2VZA A;  3NBH A;  3WWV A;  4YWK A;  2K03 A;  4A3I H;  3L7Z C;  4C56 C;  1C0A A;  2CH4 W;  4A3C H;  5KYI A;  5LMN W;  4IFD J;  2R93 H;  2OTJ A;  2MO1 A;  4QIW E;  1W6K A;  1KDA A;  3W3A A;  4DV2 L;  2Z1C A;  2I0Q A;  4L63 B;  4JOI C;  2MO0 A;  1PFN A;  1ESR A;  3MXP A;  1HUM A;  4JI7 L;  3ULL A;  5EPJ A;  2KVM A;  1YNJ D;  4B08 A;  1D8L A;  5C6A A;  4IFD H;  1RTO A;  1KNA A;  3R2T A;  1P8L A;  5J3B A;  4X65 Q;  1DOK A;  3BDL A;  1IXR A;  5M5X B;  4DN4 M;  2JA5 B;  2F0M A;  2VQE Q;  2VQE L;  1JB7 A;  2QDB A;  4LUV A;  3RD4 A;  4ZRZ A;  1ILQ A;  2UUA L;  3KFU A;  1TWA H;  1GD7 A;  5K36 H;  1CKN B;  2BDN A;  3C3L A;  1HA6 A;  5A35 A;  4JI2 Q;  3HOW B;  1X32 A;  4AH6 A;  5FO8 B;  4JI0 L;  2OXP A;  2R92 G;  4DV4 Q;  1XNQ Q;  1DM0 B;  1M90 C;  3A7L A;  1KRS A;  2WB1 B;  5DEH A;  1CUK A;  2RF4 A;  4KJO A;  3SR1 A;  1ASY A;  3GTM H;  5C44 B;  2OF1 A;  2QEX A;  3J7Z C;  1Z7T A;  2JQO A;  3DM1 A;  4K5X A;  5CR3 A;  4G7Z C;  1BXT A;  2NVY H;  1PMR A;  5M3F H;  1RF2 D;  4A4I A;  1DON A;  2B2W C;  1A62 A;  1QG7 A;  1JE5 A;  2R7Z H;  1GUS A;  1ESF A;  1SND A;  3TSS A;  4AYB G;  2F0U A;  5FO7 B;  1SYF A;  4KY6 A;  4RGN A;  3I56 A;  3MAQ A;  4XTC S;  4DUZ L;  2F4V L;  3K6O A;  1HNW L;  5GQO A;  1I4Q A;  1II3 A;  2NVT H;  1I6H B;  3BDC A;  2A68 D;  4DR7 Q;  1WOC A;  2K50 A;  3CPW A;  4APV A;  4LNQ A;  3OWF A;  4YHH L;  1K0R A;  1YNN C;  1WVL A;  4JI6 L;  3I4M H;  3BG3 A;  3SE0 A;  2EYJ A;  1YJN A;  2XN9 C;  1WTH A;  2JSO A;  4IUT A;  1B53 A;  5FLX E;  2SDF A;  1E22 A;  1IBM Q;  4PMB A;  3LX0 A;  4YY3 L;  1HNZ Q;  2B3G A;  3PO3 G;  2GA4 B;  5C4Z A;  2YV5 A;  5CGK A;  4TKO B;  1EWI A;  1O7L A;  1D6E C;  1QJO A;  1SJE D;  3AU7 A;  2B2V C;  2DY8 A;  4B9W A;  4ZK9 B;  3D3R A;  4B3T Q;  4DV6 Q;  3CCS A;  1KL9 A;  1XMQ L;  1I4P A;  2IHE A;  4ABN A;  1N33 L;  3M9B A;  2CHB D;  4C3J H;  4PG3 A;  3K5M A;  1N8R C;  4MZ9 A;  2KA7 A;  3L9A X;  4R8I A;  4BY7 G;  1LTB D;  3W5O A;  1RTN A;  1CSQ A;  3NE5 B;  3ND9 A;  4J8Q A;  3K81 C;  1YNJ C;  3OOC A;  3CRK C;  1XTD A;  5L37 A;  5FJ8 G;  3PF4 A;  2PMZ E;  2QW7 A;  1NSN S;  4JPB W;  4BBR H;  1VQP A;  3V2T A;  2F4I A;  5H1S E;  3CPF A;  1IBL Q;  2A5H A;  3F2D A;  1K8O A;  2KEC A;  5C4H A;  5LMU Q;  2IY5 B;  1EWC A;  4N9P A;  2PNH A;  1QZH A;  1HH2 P;  3CCM A;  1QB5 D;  3F2B A;  1WTW A;  2PQA B;  1V8Q A;  1TWF H;  4A3D H;  4A3L H;  1JJ2 A;  2NN6 H;  2N49 A;  3VA7 A;  3GTL H;  2WII B;  1U5K A;  4LF5 Q;  4A3B H;  1L0X B;  4O1N A;  5DM6 3;  3CHB D;  4A3I G;  2ZTC A;  1Q90 A;  3M7G A;  1HZB A;  2NN6 I;  2R92 H;  3J7A 5;  1Y1V B;  2FJ2 A;  4X3S A;  2QA4 A;  1D5M C;  5JEA J;  2A74 C;  1STG A;  2R6G A;  2NYZ D;  4CBV A;  1SFO H;  1ZXT A;  1CQV A;  2G9H D;  3V96 A;  2MHV A;  2PMZ B;  4ILW A;  1EL0 A;  4Y7N B;  2YYZ A;  2WKD A;  4IUV A;  3UE1 A;  3S17 H;  3CQZ B;  2BH8 A;  3K0Y A;  1BBX C;  4AQY L;  2UXD L;  1GOZ A;  2NVQ B;  3K80 C;  2ATW A;  1KDC A;  3HKZ B;  4K5V A;  1VQH A;  2EPB A;  4A3F B;  1PH7 A;  3U9O A;  4JI2 L;  1EOT A;  2LXK A;  3TZD A;  2YTX A;  1ROD A;  1PH3 A;  5GAD C;  4DUY Q;  3TN2 A;  1Q86 C;  5IWA L;  2ZXO A;  4ZCK A;  5C4X H;  1VQK A;  4BXX H;  1XX8 A;  3JAM L;  4DAY A;  3CMA A;  3I8Z A;  3NHH A;  1TS4 A;  1PZI D;  3PSI A;  4LFC L;  1LTL A;  1LTT D;  4FF3 A;  4K2K A;  4KD3 A;  1FNW A;  1CKM A;  2Z0S A;  1D2B A;  3OW7 A;  5LL6 X;  3CCQ A;  1SYG A;  4RAU C;  5COY A;  1PH4 A;  2NTS A;  1VQM A;  2SNM A;  3GTQ B;  1EU3 A;  1EYD A;  4RCN A;  1GUO A;  1B4O A;  3EN2 A;  5KNC A;  4GKJ L;  4JCV E;  2PI2 E;  4GNX B;  4JV5 L;  4N9T A;  2KEE A;  4IPH A;  3ONA B;  4CJ2 C;  2WKC A;  4DV2 Q;  4IN3 A;  4R4C A;  1GVP A;  4ME5 A;  1NR4 A;  4R4O A;  3Q8D A;  3Q0A A;  2E2D C;  2FIN B;  3CCU A;  3PUY A;  4B3M L;  3GTP B;  3DLL A;  5D65 A;  2NVX H;  5HGT A;  2WV6 D;  3J81 E;  4DAP A;  3T56 B;  2IL8 A;  3ICE A;  1EQQ A;  4ULL A;  2NWG A;  1B1Z A;  1FR3 A;  5D14 A;  3QG1 A;  4PV1 C;  4DK1 A;  2WAQ B;  2E5L L;  2JA8 G;  5E3F A;  3IAY A;  5JVG 3;  2J4X A;  1SMY D;  4KHZ A;  3HOZ G;  3CRL C;  4RFB A;  1ONL A;  5BN4 A;  4OWT B;  1HNW Q;  1KXL A;  4BY1 G;  3S2D H;  1Q46 A;  1J6Q A;  2CW0 C;  2P5Z X;  5IGF A;  1HPC A;  4KLK A;  4HAE A;  4ME3 A;  1EEF D;  2ZXR A;  2ZM6 L;  2A6H C;  1C4Q A;  3B6Y A;  2C5C A;  2F03 A;  4DNT B;  2E74 C;  3GTK B;  2AUK A;  4MNO A;  1UE5 A;  3E3X A;  1Y8N B;  4ZKB B;  3FEW X;  4DR5 L;  5IGG A;  2E2H H;  2PW7 A;  4B3M Q;  1LT6 D;  1LT3 D;  4EQO A;  3IRB A;  2UUB Q;  3CC4 A;  4BA2 I;  2F0D A;  1CZG A;  4DUZ Q;  4C2M H;  2BH2 A;  2RCN A;  1AEX A;  3K59 A;  1GHK A;  3G4S A;  4JI5 Q;  1QUQ A;  1HA5 A;  4IOA A;  4A3G B;  2E2I H;  1HJP A;  2R7Z G;  4DV0 Q;  2UXB Q;  1IW7 C;  3QOL A;  4IUN A;  5CV6 A;  3TP5 A;  2ZJP A;  3AEV A;  4LMQ D;  2R93 G;  4QB4 A;  4X3U A;  2F52 A;  5ELC A;  2CFM A;  1PRT F;  1P16 A;  2I46 A;  3UI2 A;  4XQN A;  2B63 H;  5DAU A;  3KF6 A;  4KHP Q;  4DAY B;  5DLQ E;  2BCO A;  2Y0S B;  1AH9 A;  2J7Z A;  2RKS A;  2K32 A;  3CCJ A;  1W2B A;  4IPG A;  2L9H A;  4UP9 A;  1EFW A;  5IYB H;  5FLX c;  4F7X A;  4OO1 G;  4JI0 Q;  3S1Q H;  2D5D A;  2N88 A;  3CKI B;  3TZU A;  2XGT A;  1IBK Q;  1FL0 A;  1RIP A;  5JJZ A;  4JI8 Q;  1QUQ B;  1HNX Q;  4RH6 A;  1NAP A;  1PV4 A;  2OCE A;  2JEB I;  4OX9 L;  1NNX A;  1SNQ A;  3I70 A;  3TQY A;  4DV5 L;  5EKI A;  1K9M C;  3MEH A;  4A3M H;  3GTQ H;  4FXG C;  3CC7 A;  3S1M B;  3NWS A;  1PH6 A;  2HHH Q;  3U50 C;  1Y1W B;  1EEI D;  2XSC A;  1VQ9 A;  5C3X A;  1MD2 D;  3I3C A;  4UHV A;  3I7F A;  2MFI A;  3DWP A;  1OXV A; 
#chains in the Genus database with same CATH homology
 3GTP H;  2B29 A;  3S14 H;  3HOY G;  1L0W A;  1HNZ L;  2VUM G;  1WJJ A;  1N36 L;  1JMC A;  1NJI C;  3JC6 6;  4OON A;  2BA0 A;  4HJ9 A;  3STB C;  3DM3 A;  4K0K L;  1PH9 A;  1VQN A;  1VQE A;  3UDF A;  3CCE A;  2Z6K C;  3TRE A;  4QGU A;  1CSP A;  3EBE A;  5IP7 G;  2JA6 G;  1VQ6 A;  4RMF A;  4P71 A;  4BBS G;  2UXC L;  1X54 A;  2OWO A;  3UE0 A;  1HZ9 A;  2VS1 A;  1Y1W H;  2F3I A;  1VQF A;  3UDX A;  1XPO A;  1GM5 A;  3UDI A;  2VZA A;  4HJA A;  3WWV A;  4YWK A;  1IYJ B;  1BBW A;  5C0X G;  2C35 B;  4A3F G;  1PH2 A;  2UUB L;  2K4K A;  1FJG L;  4DR4 Q;  2A1A A;  3L7Z C;  4A3I H;  2JEA I;  1C0A A;  4QL5 A;  1IBL L;  1N32 Q;  4A3C H;  1HNX L;  3HOV G;  5LMN W;  4A3J H;  4IFD J;  1G51 A;  2GN5 A;  2OTJ A;  2R93 H;  2MO1 A;  3NEM A;  4QIW E;  3PUV A;  4A3L G;  3CW2 C;  4DV2 L;  2I0Q A;  2I5H A;  4JOI C;  2MO0 A;  1QVC A;  3CF5 A;  4A3M G;  4A3K G;  1KRT A;  4BY7 H;  3KF6 B;  3GTK H;  3HOW G;  3GDE A;  2A8V A;  4HJ8 A;  4EQ5 A;  4JI7 L;  3ULL A;  2Q2U A;  2K5N A;  1B8A A;  2ZTE A;  4LUZ A;  3F2C A;  2JA9 A;  3FKI H;  1D8L A;  2UU9 L;  2RHQ B;  3TS0 A;  1P8L A;  3M4P A;  5IP7 H;  5J3B A;  1E1T A;  4X65 Q;  4GKJ Q;  4QY7 A;  5IYB G;  1KHI A;  1IXR A;  4OWW B;  3M3Y H;  3J81 i;  3PO2 H;  2AHO B;  2FXQ A;  3W1G A;  2VQE Q;  1OXU A;  2VQE L;  1JB7 A;  4QQB X;  4GN4 B;  4BBS H;  4AYB E;  4O0A A;  4LUV A;  4DV6 L;  2JA7 G;  1X6O A;  3CAM A;  1HR0 L;  2UUA L;  4DR2 L;  4R4Q A;  3KFU A;  1TWA H;  2WFW A;  2CWP A;  4YWM A;  4IO9 A;  2E5L Q;  1KD1 C;  4HIO A;  3KOJ A;  5GRO A;  1GD7 A;  4X62 L;  1CKN B;  1QVF A;  3ERS X;  3HOX G;  4JBJ A;  4JI2 Q;  2D0P A;  4AH6 A;  5ELO A;  1XJV A;  4JI0 L;  3A0J A;  1PH8 A;  2R92 G;  3M4Q A;  2ZJR A;  4DV4 Q;  4DV4 L;  1XNQ Q;  1V9P A;  2YTV A;  2YTY A;  1M90 C;  5M3M G;  4JV5 Q;  2CCZ A;  1KRS A;  1NY4 A;  4WJ3 M;  2EQS A;  5JEA G;  1CUK A;  4GLX A;  1G6P A;  2ALY B;  3K8A A;  2JA5 H;  3U4V A;  2RF4 A;  4LUO A;  4JI6 Q;  1ASY A;  3M4O H;  3GTM H;  1SRO A;  2QEX A;  1BVS A;  3G71 A;  3J7Z C;  2VY3 A;  1PYB A;  4DR4 L;  2JQO A;  2K14 A;  1NMF A;  5AJ3 Q;  4HIK A;  3A5U A;  2K5H A;  1L1O B;  2NVY H;  1YJ9 A;  3I4O A;  1QVG A;  5M3F H;  4GLA C;  3I4N H;  1SMX A;  3PIO A;  3OTO Q;  4POG A;  1X9N A;  4GOP B;  4LFC Q;  1Q82 C;  4JYA L;  2Y0S E;  4Y52 H;  4POF A;  3HOW H;  1EQR A;  4A4I A;  4X65 L;  4GNX A;  2JE6 I;  2MQH A;  1A62 A;  4X66 Q;  4LWC A;  1JE5 A;  2R7Z H;  1M1K C;  4IFD I;  1EUJ A;  3PUX A;  4AYB G;  1Q12 A;  3L2P A;  3U58 A;  3I56 A;  5K36 G;  1JJG A;  4IPC A;  4XTC S;  1FGU A;  2HQL A;  4DUZ L;  4P75 A;  4IJL A;  2EIF A;  2JJQ A;  2F4V L;  1DGS A;  3S24 A;  1S72 A;  1HNW L;  1YBY A;  5GQO A;  4PMW A;  1Y14 B;  1NTG A;  2NVT H;  4JBK A;  4DR7 Q;  3H15 A;  1WOC A;  1H95 A;  1VQI A;  4R4T A;  1B70 B;  2HIV A;  3BZC A;  4XIG S;  1QZG A;  1WFQ A;  2K50 A;  4DV7 L;  3CPW A;  4APV A;  4LNQ A;  1ASZ A;  4NB3 A;  5GAE C;  4GNX C;  3KLW A;  1UE6 A;  4A3E G;  1IL2 A;  3T1Y L;  2UXC Q;  1VQC A;  4A3K H;  1L1O A;  1A0I A;  5C0X J;  1SR3 A;  1K0R A;  4YHH L;  3MXN B;  4B3S L;  4JI6 L;  1EOV A;  3I4M H;  2L15 A;  1G29 1;  1Q1E A;  3M7N A;  1X56 A;  1U0L A;  2ZTD A;  2HT1 A;  1YJN A;  5M3F G;  3I4N G;  3S15 H;  3BJU A;  3PGZ A;  1A63 A;  1I3Q H;  1E22 A;  1X3E A;  4NPS A;  1IBM Q;  3S1N H;  2K52 A;  4HID A;  4DR6 L;  2ZM6 Q;  1K8G A;  1YVC A;  4GKK Q;  5FJ8 H;  3KYH C;  4YY3 L;  1Y1V G;  1HNZ Q;  2Y0S G;  1YEZ A;  2B3G A;  2XTI A;  4JBW A;  2IX1 A;  3PO3 G;  1OXS C;  1A8V A;  1I6H H;  4P74 A;  4OO1 I;  4BBR G;  2YV5 A;  3RLN A;  3RR5 A;  1EWI A;  4LF4 Q;  5JJL A;  1E24 A;  1XMO L;  1X55 A;  2LXJ A;  5IT9 c;  1PA6 A;  4L5T A;  1MJC A;  4TVA B;  4X64 Q;  5C3E G;  2UUC Q;  1I50 H;  1CKO A;  5JJI A;  1CKN A;  4B3T Q;  4DV6 Q;  3CCS A;  1KL9 A;  3H0G H;  5IP9 G;  3CCV A;  1XMQ L;  1UE1 A;  2IHE A;  3HOX H;  4GN3 B;  5AJ3 L;  2KCT A;  4JI4 Q;  1N33 L;  3M9B A;  1I5F A;  3SGI A;  2AKW B;  4C3J H;  3T1H L;  2JA6 H;  3D0F A;  4PG3 A;  1N8R C;  4A3G G;  2UXB L;  3STB D;  4MZ9 A;  1SLJ A;  4JI1 L;  2UU9 Q;  3CD6 A;  1XNR Q;  3RZO H;  1YNX A;  2CKZ B;  4DR6 Q;  4OX9 Q;  4DUY L;  5LMN Q;  3HKZ E;  3RLF A;  1XPR A;  1EIY B;  1X65 A;  2KCM A;  1E1O A;  3AFQ A;  4BY7 G;  3W5O A;  3UDG A;  4IPD A;  1CSQ A;  1NE3 A;  3K81 C;  1YIT A;  1TWG H;  3LGJ A;  5FJ8 G;  1XTD A;  3PF4 A;  2JK8 A;  3CCR A;  4LF8 Q;  2PMZ E;  5GAH C;  5C44 G;  4BBR H;  4KI0 A;  1VQP A;  4DV7 Q;  5M5X H;  4UY8 C;  3NEL A;  1MJE A;  1Y1V H;  5H1S E;  3CPF A;  4JG2 A;  4JI3 L;  1Q7Y C;  1IBL Q;  3KJP A;  1LUZ A;  1N9W A;  4MTN A;  3F2D A;  4JI1 Q;  3A74 A;  1PFS A;  4LFB Q;  5LMU Q;  3AYH B;  3KDF A;  3BU2 A;  3KF8 B;  2IY5 B;  4GN5 A;  4DR5 Q;  2UUC L;  4C3I H;  2E2J H;  2PNH A;  4FDB A;  5FLM G;  2K75 A;  3PUZ A;  3CME A;  4HIM A;  1QZH A;  3H3V I;  2CQO A;  4O2D A;  1HH2 P;  3CQZ H;  3F2B A;  3CCM A;  3FKI G;  4A3J G;  2PQA B;  3HOV H;  1TWF H;  2IT1 A;  4A3D H;  4A3L H;  1JJ2 A;  2NVQ H;  3HOU G;  1K3R A;  2N49 A;  4YCV A;  3G6E A;  4JI7 Q;  1W3S A;  3GTL H;  4A93 H;  1U5K A;  4LF5 Q;  1O7I A;  3U4Z A;  3J81 c;  1MIU A;  4YY3 Q;  5C0X I;  1YHQ A;  4JBM A;  4YCU A;  4A3B H;  4WJ4 A;  3J80 c;  4A3F H;  1EIF A;  2DUD A;  4A3I G;  2ZTC A;  5ELN A;  2OTL A;  4LW1 A;  1HZB A;  2NN6 I;  4LFA Q;  2N3S A;  2R92 H;  3J7A 5;  1K83 H;  1HR0 W;  4UP7 A;  3ZJY C;  3OTO L;  5BR8 L;  2HIX A;  2VQF L;  2WP8 J;  4GKK L;  2QA4 A;  4ALP A;  5JEA J;  1VQ4 A;  1S3O A;  2R6G A;  3HKZ G;  1Q1B A;  2KBN A;  4LF7 Q;  5LMU L;  1WYD A;  1SFO H;  4NXN L;  1PHJ A;  4L5S A;  3PUW A;  2YYZ A;  3UE1 A;  1VQD A;  5IY0 A;  3S17 H;  4B3R L;  4JI3 Q;  4IOC A;  2BH8 A;  1WCM H;  1VQB A;  4UPA A;  1GKH A;  4AQY L;  1TXY A;  1V1Q A;  2UXD L;  3K0X A;  4DR7 L;  3K80 C;  4JC0 A;  2ATW A;  4LFB L;  2DGY A;  5IYC H;  3K7A H;  4NXM Q;  1R9T H;  1VQH A;  1JT8 A;  3D31 A;  1E3P A;  1OXX K;  1RL2 A;  4A3D G;  1PH7 A;  3RN2 A;  3PO3 H;  4JI2 L;  2LXK A;  1J5E Q;  3E0E A;  2YTX A;  4YCW A;  3MEF A;  1JJC B;  3TEH B;  3ULP A;  5GAD C;  1PH3 A;  4DUY Q;  3I4M G;  1XNQ L;  1Q86 C;  5IWA L;  2KHJ A;  5C3E H;  1Q81 C;  1SE8 A;  5C4X H;  1VQK A;  4BXX H;  4DR2 Q;  4PZ6 A;  1NBW A;  3CMA A;  2VL6 A;  1S40 A;  2R7F A;  2N8N A;  3PSI A;  4RG1 A;  4LFC L;  1B7Y B;  1LTL A;  4Y7N H;  4PZ7 A;  3RNU A;  1PH5 A;  2AMC B;  3JAM i;  1CKM A;  2Z0S A;  4DK3 C;  4DV3 Q;  1Q8K A;  2IHF A;  3CCQ A;  1PH4 A;  1I94 L;  1VQM A;  1L1O C;  1D7Q A;  4JYA Q;  1HZC A;  3J80 i;  5IE8 A;  1LM0 A;  3NBH B;  2AWO A;  5M5Y H;  1KAW A;  1VQL A;  3EN2 A;  2JA5 G;  3HOY H;  4GKJ L;  4DV3 L;  4JCV E;  4DV1 L;  2PI2 E;  4GNX B;  4LF8 L;  1LYL A;  4JV5 L;  1XMO Q;  2A19 A;  4IJH A;  4IPH A;  3S1R H;  5IYC G;  4DV2 Q;  1YI2 A;  4BY1 H;  1MKH A;  4R4C A;  3J81 j;  4HJ7 A;  1GVP A;  4DV5 Q;  2I5M X;  4R4O A;  4JI8 L;  3S2H H;  1SN8 A;  2D62 A;  3E9H A;  3Q8D A;  2RHS B;  3I2Z A;  1Y1W G;  3S16 H;  3AFP A;  3OYY A;  3CCU A;  3KDF B;  3PUY A;  4R4I A;  3PO2 G;  3T1Y Q;  1NMG A;  1N34 L;  4TQU S;  4B3M L;  3DLL A;  1VQJ A;  2Q2H A;  2NVX H;  1J5E L;  4AQY Q;  2UXD Q;  3ICE A;  1C9O A;  4GLV B;  1EQQ A;  3PF5 A;  1XPU A;  2Q2I A;  2ZJQ A;  1BBU A;  5LMN L;  1HZA A;  3W1B A;  2OQK A;  4X62 Q;  4NXM L;  5EAY A;  3H0G G;  5IP9 H;  2E5L L;  2CWA A;  4QJF A;  2JA8 G;  3GTJ H;  3CC2 A;  3ULJ A;  2F4V Q;  3HFZ B;  1PYS B;  1VS0 A;  1Z9F A;  3K7U C;  5BR8 Q;  2K5V A;  2VQF Q;  4KHZ A;  4DPG A;  2VW9 A;  3HOZ G;  1VQG A;  4LF9 Q;  4B3T L;  1UEB A;  3VDY A;  1VQ7 A;  4OWT B;  4A3C G;  1HNW Q;  4K0K Q;  4X64 L;  1KXL A;  4BY1 G;  1YHA A;  3S2D H;  1Q46 A;  4DV0 L;  1J6Q A;  1N36 Q;  3JAM c;  4A3E H;  1VQ8 A;  2R7D A;  4BA1 I;  4DNI A;  2I5L X;  3BZK A;  1AE2 A;  2NZH A;  4J15 A;  1KIX A;  3TS2 A;  1UE7 A;  3G48 A;  4KLK A;  1WCM G;  4ME3 A;  1EYG A;  4A3G H;  1PVO A;  2ZM6 L;  4B3S Q;  3RZD H;  3KJO A;  1N32 L;  5IWA Q;  2YU9 H;  3L0O A;  3B6Y A;  5M3M H;  3PIP A;  4JI5 L;  4MNO A;  4X6A H;  1FJG Q;  1VQA A;  4IFD G;  3FP9 A;  1UE5 A;  4DR3 L;  1YIJ A;  2B63 G;  1KQS A;  2VUM H;  4YHH Q;  1L2F A;  3CP0 A;  5HY6 A;  5FLM H;  3PCO B;  4DR5 L;  2E2H H;  1VQ5 A;  1V43 A;  1IZ6 A;  1N34 Q;  4B3M Q;  2H5X A;  1SRU A;  3I55 A;  4LF7 L;  3IRB A;  2NN6 G;  2UUB Q;  3HOU H;  3CC4 A;  5IYD G;  2JA8 H;  4BA2 I;  1YHB A;  4EX5 A;  1K73 C;  2EXD A;  3ER0 A;  4B3R Q;  1VCI A;  2D0O A;  2PI2 A;  1IBK L;  4DUZ Q;  4C2M H;  2BH2 A;  2RCN A;  3G4S A;  3GTG H;  2KHI A;  1QUQ A;  4JI5 Q;  1FVI A;  4IOA A;  2KEN A;  1HJP A;  2E2I H;  2E8G A;  2WB1 E;  4DV0 Q;  2R7Z G;  4YWL A;  2UXB Q;  4X66 L;  3TRZ A;  1N33 Q;  2LSS A;  4LF5 L;  2ZJP A;  2UUA Q;  3AEV A;  5E7N A;  2R93 G;  2F52 A;  3EIV A;  5M5W H;  1OTC A;  1Z47 A;  4A76 A;  1XNR L;  1XMQ Q;  1YZ6 A;  3AQQ A;  1X3F A;  4OWX B;  1PH1 A;  4C3H H;  3T1H Q;  1K8A C;  2AWN A;  2Q2T A;  3FHW A;  1GO3 E;  3GD7 A;  2CFM A;  1WI5 A;  1E7Z A;  1P16 A;  3F1Z A;  2NZO A;  4DR1 L;  2WAQ G;  2B63 H;  4LF9 L;  3KF6 A;  4P73 A;  1VQO A;  4GOP C;  4KHP Q;  4DAY B;  4LF6 Q;  4H02 A;  5DLQ E;  2PQA A;  5C44 H;  4DR1 Q;  3OW2 A;  3A5Z B;  4R1J A;  4PZ8 A;  2HHH L;  3CCJ A;  3H3V H;  1W2B A;  1AH9 A;  4IPG A;  3S1M H;  4A3B G;  4UP9 A;  1EFW A;  1OXT A;  2QGQ A;  1TWC H;  5IYB H;  3GTO H;  5FLX c;  1T9H A;  2ID0 A;  4LF4 L;  5HGQ A;  4OO1 G;  4JI0 Q;  3S1Q H;  2VNU D;  2N78 A;  2IX0 A;  5GAG C;  2XGT A;  2MNA A;  1IBK Q;  3F8T A;  1FL0 A;  1RIP A;  4UP8 A;  2V1C C;  4JI8 Q;  1QUQ B;  2OQ0 A;  1HNX Q;  3NEN A;  1PV4 A;  2OCE A;  2JEB I;  4JOI A;  4DAM A;  4OX9 L;  4AIM A;  4A93 G;  2GVB A;  1YJW A;  3HKS A;  4DV1 Q;  1C7Y A;  3RN5 A;  1UWV A;  3PV0 A;  3TQY A;  4DV5 L;  4GOP A;  5JJK A;  1K9M C;  3HOZ H;  4DR3 Q;  2ES2 A;  4A3M H;  4LF6 L;  5IYD H;  2WB1 G;  4P72 A;  3GTQ H;  4DKA C;  2GVA A;  4GS3 A;  4BXX G;  5C4X G;  3CCL A;  3CC7 A;  2Z6K A;  3RLO A;  1PH6 A;  4JI4 L;  1HR0 Q;  1BKB A;  1TWH H;  3U50 C;  4OXP A;  4L5Q A;  1KC8 C;  1AE3 A;  2HHH Q;  2ASB A;  1X3G A;  4KHP L;  1VQ9 A;  3CXC A;  5C4J H;  2BA1 A;  4DK6 C;  3GO5 A;  4NXN Q;  3E9I A;  4A75 A;  1I94 Q;  4LFA L;  3M85 A;  2WAQ E;  4L5R C;  3I7F A;  2MFI A;  4HJ5 A;  2JA7 H;  1IBM L;  1OXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...