2KCTA

Solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Cytochrome c-type biogenesis protein CcmE
publication title Solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g.
rcsb
source organism Desulfovibrio vulgaris str. hildenborough
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2kctA01
1SROA 4UPAA 2K5HA 3PF5A 4C3JH 1E1TA 4JCVE 1PH2A 1MJCA 3PUWA 1SMXA 3RZDH 4YWMA 3S1RH 1J5EQ 1C7YA 1A8VA 2Y0SE 3PUVA 4H02A 2PI2A 4R4QA 1VQCA 3RLFA 3WWVA 5IP7G 2N3SA 4TVAB 1N32Q 1LUZA 2R7ZH 4R4OA 3JAMc 4A3CG 2RHSB 2ZM6Q 1HZCA 3U50C 3TEHB 1TWGH 2R93G 5AJ3Q 4LF5Q 4JV5L 1OTCA 1CKNB 4DNIA 3K7AH 1PYSB 3I4OA 2R92G 4DUZL 2LXKA 1G51A 1Q1BA 1OXUA 4DV1L 4HJAA 4A3KG 1YVCA 4HJ9A 1JE5A 2UXBL 5E7NA 2HT1A 1C9OA 2PQAB 3CCVA 4Y52H 5IYBG 1I5FA 5C0XG 1XMOL 1N34L 1VQ4A 5IP9H 5LMUQ 4JI2L 2ZTDA 1N9WA 5C4JH 1D7QA 1YHQA 4P73A 1IBKQ 4IJHA 4BY7H 2K5VA 3FKIG 2E5LQ 3U4ZA 4OO1G 1L1OC 1UE6A 2R6GA 1PHJA 4OO1I 1HJPA 1YHBA 4DAMA 4JYAL 4JI5L 4L5QA 2VW9A 3G71A 2CKZB 1X3GA 4J15A 4DV4L 4MTNA 5FLMG 5BR8Q 3PIOA 1CKOA 2L15A 4JI6L 2HQLA 4APVA 1TWCH 2OQ0A 3CCEA 1FJGL 4XTCS 2KHJA 4UY8C 3CC4A 4HJ8A 3GTOH 1AH9A 4LFAQ 3UE1A 1VQGA 3M4OH 2Q2TA 1YITA 1Y1WG 2NN6G 1Q46A 4KHZA 2UUBQ 1A0IA 5IWAQ 3GO5A 3J81j 3SGIA 1YJNA 4Y7NH 3GDEA 5FLXc 1WI5A 1VQNA 2ZJRA 1WCMG 5GADC 4IJLA 4LUOA 3CD6A 1OXSC 1PH1A 4B3MQ 3FHWA 2IX0A 2WAQE 1X56A 1Y1VH 3STBD 1NMGA 4A3MG 3KFUA 2YTVA 1A63A 1JJCB 5C4XG 4HIOA 1CKMA 3E0EA 1Z9FA 4QJFA 2ZJPA 4QIWE 1ASYA 1EOVA 3H0GH 3E9IA 3I4NH 3UE0A 1EQQA 1R9TH 1Q86C 1L1OB 3ERSX 1JT8A 1YI2A 4A3DG 1HZAA 4LNQA 2YV5A 4DR4L 3S16H 1EIFA 3HOXG 4DAYB 1YNXA 4X64Q 1FGUA 4BY1H 3DLLA 1TWHH 5HY6A 3CPWA 3STBC 4IOCA 1M90C 1B8AA 1EUJA 2CWAA 4MNOA 4UP9A 5M3MG 1SR3A 4BXXH 1VQPA 4A3BH 4GKKL 4GLVB 4X62L 2CCZA 1SRUA 3BZKA 3T1HL 3UDFA 5IE8A 1XJVA 4A93H 3LGJA 2JA5G 2F4VL 3F2BA 2UU9L 1VS0A 4JI4Q 2JA7H 3S1QH 3CCRA 1TWFH 3I55A 3M3YH 2VY3A 1YBYA 4DR3Q 1E7ZA 3A74A 2EIFA 1EIYB 2K50A 4IPGA 3S24A 1LYLA 1NTGA 1KRTA 3PUZA 5GAGC 1QVCA 2ID0A 1S3OA 4PZ7A 3RN2A 1PV4A 4DUYL 4GNXA 2ZTCA 1E22A 4DV7L 2LXJA 2MFIA 4OXPA 4DK6C 3RNUA 2KHIA 4A3EG 4PZ6A 2Q2UA 1UE1A 1HZ9A 3HOZH 1XNQL 2PNHA 2JA6G 1GKHA 3L0OA 1WYDA 4YHHL 4DR2L 2PQAA 2K52A 4POFA 1VQOA 2E2HH 1Z47A 2VZAA 3IRBA 3KJOA 2BH8A 3GD7A 1HNZL 1VQKA 4QL5A 2HHHL 2MNAA 3GTPH 5M3FG 1JMCA 3J7A5 5EAYA 3RN5A 2NVYH 4LF7Q 3M4QA 1QVGA 1HR0Q 1K83H 2N78A 3HOVG 2EQSA 1IBML 2Z6KA 4P74A 3FP9A 4LF8Q 3AYHB 1JJGA 4LWCA 2PMZE 5LMNW 3PSIA 2IT1A 4YCVA 1K9MC 4UP8A 1BBUA 4P75A 4QGUA 2HIVA 1VQMA 4O0AA 4JI7Q 2GN5A 2JQOA 4X65L 1YIJA 1HNXL 4C2MH 4BBRG 4A3FH 1Q81C 1EYGA 1VQEA 3PUXA 5FJ8H 4GN4B 4GOPC 3F1ZA 4YCUA 4YWLA 4DR1L 2UUCQ 2VUMH 3PO3H 1D8LA 3PF4A 4DV2L 1G291 2IHEA 1SE8A 1XMQQ 2OTJA 1VQJA 5IYCG 2RF4A 4JI8Q 1WFQA 4A3IG 4A76A 1KRSA 4YY3Q 3KYHC 4C3HH 2OCEA 2VQEQ 3AFQA 1VQAA 4IPHA 4A4IA 1WJJA 1VQDA 4A3JG 3HOWG 5JEAG 2UXDL 1N32L 3MEFA 3ULPA 3M4PA 4GLAC 4RMFA 2AWOA 4R4CA 1BKBA 2BA1A 2ZM6L 3TRZA 1DGSA 4ME3A 3NEMA 4DV6Q 5AJ3L 4GLXA 2OWOA 2K14A 4JBMA 2YTYA 2VNUD 2AHOB 1K3RA 1K0RA 4IPCA 1L1OA 4UP7A 3A5UA 4DR6Q 4JV5Q 4WJ4A 4DKAC 1N33Q 2FXQA 2R7ZG 4P71A 4PZ8A 1QZGA 1VQIA 2VQFQ 1EQRA 2JA8H 3HOYH 2QA4A 5LMUL 3L2PA 3CXCA 1HR0W 2UXBQ 3CC7A 1QUQB 3GTKH 1IBKL 1N34Q 4DPGA 1XMOQ 3AFPA 2E5LL 1NY4A 4KLKA 2E8GA 3E9HA 4XIGS 3K80C 2YTXA 1Q7YC 5C44G 2Q2IA 4GOPB 1IBLQ 2UXCQ 3CMEA 2I5MX 3K0XA 1T9HA 3T1YQ 1M1KC 5IP9G 2F52A 4NXMQ 2E2IH 3JC66 3J7ZC 2NVTH 4JI5Q 4B3SQ 2E2JH 4A3GG 4GN5A 5BR8L 5IYDH 4LFBL 3F2CA 1UE7A 4YCWA 4AQYL 2VL6A 1Y1WH 3Q8DA 2KENA 3I2ZA 4JBJA 4DR2Q 4JI6Q 4GN3B 1P16A 1HH2P 1TWAH 4A3LG 2UUAQ 4DR4Q 4OWXB 2JA9A 4JBWA 3OTOQ 1HNWL 2GVBA 1B70B 2NVXH 4B3RQ 1WCMH 1Q8KA 2UUBL 4HIMA 1PA6A 3W5OA 3CCQA 4IFDG 4IFDI 2I5HA 1KHIA 5M5XH 5C4XH 4OX9Q 1I6HH 2WFWA 3HFZB 3K7UC 1PH9A 2JK8A 2R7FA 3J80i 4B3ML 2XGTA 1PFSA 3U58A 3BZCA 1XTDA 3K81C 1VQ9A 4IFDJ 1KQSA 4BBSH 2NVQH 1X55A 3GTMH 2A19A 3KF6A 4JC0A 3S17H 3A5ZB 5LMNQ 2JEBI 3M9BA 2B63G 3EN2A 4AIMA 1Y1VG 3S2HH 4GKJL 1VQHA 2ZTEA 1KXLA 4X64L 3S1NH 3TS0A 1PH6A 1EWIA 1X54A 3KOJA 3AQQA 4LW1A 4AH6A 3RLOA 4B3TL 1Q12A 4LF4Q 4LF9Q 3I4NG 4DR7L 1XNRQ 4R1JA 1P8LA 1HZBA 3UDIA 1OXTA 3NENA 1Q1EA 3PUYA 2MQHA 4QQBX 1YEZA 3H3VH 4DV5L 4R4IA 3T1HQ 4JI4L 1CUKA 3GTLH 4NXNQ 4KHPQ 5IT9c 1LTLA 3ICEA 4BXXG 4IO9A 2KBNA 4JBKA 5C3EG 4DV3Q 4DR3L 4DR5L 1CKNA 3D31A 2NZOA 3UDGA 2I5LX 4DV0Q 5JJLA 2PI2E 3HOUG 2JA7G 3W1GA 1B7YB 3I4MH 3PCOB 1YZ6A 1NE3A 3CCJA 1PYBA 2N49A 4QY7A 3G4SA 4R4TA 1I94Q 4LF6Q 5C0XJ 1GM5A 4DUYQ 1VQBA 1SFOH 2H5XA 5M3FH 1PH5A 3H3VI 1LM0A 2K75A 1V43A 3PV0A 4JI1Q 2F3IA 2K4KA 3NELA 5GAEC 3M7NA 4POGA 3CCMA 1XNQQ 2DUDA 1X9NA 3CC2A 3U4VA 3HOVH 1O7IA 4JOIA 4K0KL 3K8AA 3KDFB 1UE5A 3ER0A 4X66Q 4JI3L 1YJ9A 2HHHQ 4LF7L 3J80c 4GNXC 4LFCQ 3HOZG 2R7DA 3I56A 2JJQA 2CFMA 3F2DA 4LF8L 4BBRH 4TQUS 4JI0L 2C35B 4WJ3M 3RLNA 4FDBA 4X6AH 4JI7L 3F8TA 2KCMA 1N36Q 3KF8B 5IP7H 1PH4A 2Z0SA 4A3IH 4A3CH 3CQZH 1J5EL 2R93H 1QZHA 1X3EA 1XMQL 3HOWH 2R92H 4C3IH 3AEVA 4DR1Q 2MO0A 2Z6KC 4DV2Q 3PO2G 1IXRA 1J6QA 3CF5A 4A3KH 4LF5L 4A3FG 1GVPA 1IYJB 2VQEL 1KL9A 5FJ8G 5JJIA 4OONA 4HJ7A 1KC8C 1EFWA 5IYBH 2VUMG 2VS1A 3PO3G 2B29A 1L2FA 2UXDQ 4HIKA 1IZ6A 4NB3A 4DUZQ 1XPRA 4DV6L 1OXVA 3FKIH 2IX1A 4DV1Q 3UDXA 1C0AA 1E1OA 1OXXK 3VDYA 3CP0A 4DR6L 4GNXB 3CW2C 5M5YH 1AE2A 1U5KA 4LUVA 1N33L 4JI2Q 1MIUA 1I3QH 2VQFL 3NBHB 2WP8J 5FLMH 1XPUA 2DGYA 1XPOA 4IPDA 5C44H 3B6YA 2WB1G 1MKHA 1I50H 1K8GA 2A1AA 2RHQB 4AYBG 5C0XI 4JYAQ 1N8RC 4BY7G 3BU2A 4A3GH 1X3FA 1RL2A 1W2BA 1IBLL 1VQ8A 4DV4Q 2UXCL 3T1YL 1VQFA 1PH8A 2JA8G 1PH3A 3HOYG 3S14H 4NXML 1TXYA 5ELOA 1X6OA 3OYYA 1H95A 3S2DH 1BBWA 2YYZA 1KAWA 3CPFA 4B3SL 1SN8A 1YJWA 4LFAL 1IL2A 1SLJA 3ULLA 1FJGQ 2A8VA 4A3LH 4NPSA 3HKZG 2N8NA 3CMAA 2V1CC 3I7FA 5IWAL 2QEXA 2ATWA 3L7ZC 4DK3C 4LFBQ 3H15A 4AQYQ 2KCTA 3TREA 4A3MH 3OTOL 2UUAL 5K36G 1VQ7A 4B3RL 2Q2HA 3CCSA 4PMWA 5IYDG 3J81i 1HNWQ 3DM3A 5GROA 2JE6I 5DLQE 1L0WA 1QVFA 4A3DH 3G48A 2NN6I 1VCIA 1Y14B 2HIXA 4OX9L 3HOXH 1PVOA 1VQ5A 2CWPA 1W3SA 1E24A 1JB7A 2ES2A 1V1QA 2D0OA 5IY0A 3KDFA 5M3MH 3MXNB 1NJIC 3S1MH 5J3BA 2Y0SG 2B63H 2K5NA 1KD1C 1GO3E 4OWTB 3KLWA 4LUZA 2JA5H 2CQOA 3H0GG 1ASZA 1CSQA 4L5TA 5LMNL 5ELNA 1E3PA 2IY5B 4GKKQ 4GKJQ 2B3GA 4L5RC 4X62Q 4P72A 4BY1G 4LF4L 4BBSG 4LF9L 2LSSA 1S72A 1X65A 2QGQA 4OWWB 4BA2I 1XNRL 2F4VQ 4BA1I 1KIXA 2UU9Q 1NMFA 4A3BG 4B3TQ 4O2DA 4DR7Q 5C3EH 2D62A 1K73C 2OTLA 4KHPL 4A93G 3JAMi 4KI0A 1AE3A 4NXNL 5JEAJ 3PGZA 1VQ6A 1FL0A 1U0LA 4EX5A 4A3EH 3W1BA 4DV5Q 2BH2A 4MZ9A 1Q82C 4DV3L 1UWVA 2JA6H 3HOUH 1RIPA 3GTGH 3RR5A 3M85A 4DV0L 2JEAI 3G6EA 4DR5Q 4JG2A 4DV7Q 2ALYB 1PH7A 5GQOA 2AWNA 1CSPA 2BA0A 1VQLA 1K8AC 2GVAA 3EIVA 2WB1E 1I94L 4LF6L 2NZHA 4EQ5A 1YHAA 4YHHQ 2XTIA 1QUQA 3D0FA 3TQYA 4AYBE 2AKWB 5GAHC 4A75A 1BVSA 1HNZQ 2OQKA 1G6PA 4GS3A 1A62A 3RZOH 3J81c 4JI1L 1S40A 3CCLA 3I4MG 1HR0L 4GOPA 4HJ5A 1JJ2A 3HKSA 2YU9H 5HGQA 1UEBA 4X66L 3S15H 4HIDA 4YWKA 1WOCA 3ZJYC 3KJPA 3HKZE 4ALPA 5H1SE 1IBMQ 4LFCL 4K0KQ 1NBWA 1V9PA 2I0QA 2EXDA 4JI3Q 2WAQG 2MO1A 2AMCB 3CAMA 5M5WH 1MJEA 3A0JA 4PG3A 5IYCH 2ASBA 3GTQH 3KF6B 2ZJQA 3CCUA 4X65Q 2UUCL 1HNXQ 3OW2A 5JJKA 1FVIA 2IHFA 4RG1A 4A3JH 4JI8L 4JOIC 4JI0Q 2D0PA 2RCNA 1GD7A 1N36L 4IOAA 3ULJA 3PIPA 4L5SA 3TS2A 4YY3L 3BJUA 3EBEA 3GTJH 3PO2H
chains in the Genus database with same CATH superfamily
1SROA 3K57A 4OHJA 4IN3A 1RODA 1A8VA 3A56A 3OWEB 1PRTD 3D4DA 3RLFA 3WWVA 5IP7G 1PXUA 2EJFC 1LUZA 2I07B 2R7ZH 1RF2D 1HZCA 2K03A 2KA7A 5AJ3Q 1OTCA 4DNIA 3C1EA 4CDCC 3HOZB 1PYSB 3I4OA 4UHVA 4ZKBB 1D5ZC 1SYDA 4CJ1B 4OGQC 3V96A 2HT1A 1PRTC 1LTRD 1XMOL 2MUYA 3C1FA 3NHHA 4IJHA 1K83B 1NAPA 4BY7H 3T56B 2L5TA 1HJPA 4JYAL 2VW9A 3G71A 1ZXTA 5JVG3 1EQTA 1X3GA 1EOTA 2Q8TA 5BR8Q 4C2MB 3PIOA 1HUNA 3S1RB 3VR2A 1JWUD 2EE1A 1TWCH 3PO3B 4XTCS 3GTOH 2F0OA 2NTSA 4HJ8A 3CC4A 3WOFA 1VQGA 1YITA 4C3HB 5I6WA 1D1IA 2NN6G 1Y1WG 5IWAQ 2AQ3B 3GO5A 3NTHA 1WI5A 2ZXRA 1VQNA 2NB0A 4FF3A 1SYEA 5C4ZA 1X56A 1WTXA 1H9SB 4HEDA 1NMGA 4NW2A 2YTVA 1JJCB 3H91A 4QJFA 4QB4A 1Z9FA 3MTSA 5DM63 2F0SA 1CTMA 1EOVA 5ELDA 3E9IA 1Y69U 3ERSX 1G91A 2CH4W 1YI2A 1B1ZA 1A3VA 2F0VA 4A3DG 3EA6A 4R8NA 3GTKB 2AUKA 4DAYB 3BS1A 3DEPA 4WORA 1FGUA 4BXXH 2D2CC 4GKKL 3UDFA 3I91A 4A93H 2E2IB 3FPUB 3LGJA 4HR7B 3F2BA 2NVTB 5K5PA 2UU9L 3CKIB 2E2JB 2F0QA 4R9WA 2VY3A 4CGYB 3J7YW 4DR3Q 1K28A 3A74A 2EIFA 3S24A 1TWAB 1NTGA 1CFMA 1LT4D 2Z1CA 1WCMB 4PZ7A 1JWMD 4G4KA 1A2TA 4PMBA 3KUPA 1HXYD 4FYDA 2LXJA 5A2QE 3NBHA 2B2TC 2ZXPA 1LT3D 1LT5D 3QR8A 2JA6G 1GKHA 3HOUG 2K52A 5I4DA 3KJOA 2BH8A 3GD7A 3SK4A 1DZ1A 2NVQB 2EY5A 1H9MA 3S17B 4DN4M 3RN5A 3KBXA 4K2KA 1JQYD 1ICWA 2IT1A 4YCVA 4Z9CB 4UP8A 4IUTA 5LHY1 1F9PA 1JICA 3PUXA 2JN4A 1KABA 3F1ZA 1NR2A 4YCUA 4GOPC 3W3AA 3A8JE 5EQ0A 2OTJA 1SE8A 1VQJA 1LV9A 1EYAA 1RD9D 4A76A 1KRSA 3SVMA 3KYHC 4EVOA 3AFQA 4KY6A 2XRSD 1TS5A 1WJJA 3HOWG 1T5EA 1ZEQX 2SEBD 2AWOA 1H9SA 2ZM6L 1GUSA 3TRZA 3NEMA 4DV6Q 4CDDC 5G3LD 4WJ4A 4JV5Q 1F2LA 1N33Q 2KJXA 3MA2B 4DAYA 1S5BD 4HAEA 1EL0A 3HS0C 4DF7A 1IBKL 2G5DA 1N34Q 4DPGA 1TU2B 2YTXA 1Q7YC 2UXCQ 2Q2IA 2QEJC 3JAME 4GOPB 1IBLQ 3K0XA 5CGKA 3FEWX 1M1KC 3EQLC 2F52A 3PIP3 1Z6HA 3IKJA 3NE5B 5FO9B 3J7ZC 5A2QL 1QCBD 4K5VA 4JI6Q 4GN3B 1HH2P 2EJGC 3OTOQ 2JA9A 4JBWA 2K33A 1GUNA 1RDPD 3DXJC 1WVLA 1PA6A 2KCCA 4IFDG 4DNTB 2WFWA 3HZXA 1PH9A 1H9KA 2JK8A 2K5DA 2R7FA 4KKSA 3J80i 4B3ML 1E2VA 1VQ9A 5KNCA 4BBSH 4ZKCB 1LABA 2A19A 1LT6D 2K5WA 2Z8LA 3AB9A 2B63G 4ZQ3A 2JEBI 3M9BA 4RCOA 1O80A 2ICIA 1VQHA 4X64L 4LW1A 3I4NG 4DR7L 4R1JA 1P8LA 1HZBA 1OXTA 3PUYA 3H3VH 3I73A 4R4IA 3T1HQ 4KHPQ 1CUKA 4N8FA 1O7YA 2KUMA 3CRLC 2KBNA 1JR0D 1SNOA 2I5LX 1I6HB 3VA7A 3W1GA 1B7YB 5EGTA 2KEDA 2N49A 3G4SA 2ICEC 1RTOA 3TP5A 4A3DB 1Y8PB 4ZUJA 3ZYYX 1SFOH 2H5XA 4TSSA 5M3FH 1LM0A 3DM1A 3PV0A 4JI1Q 3A7LA 1TY0A 3CCMA 3JAML 3SE0A 3TZDA 4X66Q 1YJ9A 1H9JA 3J80c 4GNXC 4U673 1K0SA 1DD2A 2K28A 4TQUS 4X6AH 3F2UA 4IUPA 4XQJA 1EY5A 1G2SA 3KF8B 1N36Q 3R8BA 1VMCA 3DWAA 4A3CH 3CQZH 2CVRA 5ELCA 4WFN3 1S5DD 1XMQL 5JEAH 4YIJA 2JA6B 3HOUB 2MO0A 4DV2Q 3PO2G 1J6QA 4A3FG 1GVPA 1IYJB 3T51B 1KL9A 2VQEL 1EFWA 4HJ7A 2CHBD 2B29A 4EGVA 2UXDQ 3FKIH 4O42A 2IX1A 1U9RA 3NUCA 4GNXB 4K14A 5M5YH 1U5KA 2WKDA 1XYIA 3DWQA 3HEJA 1TT2A 5C44H 1F2ZA 2WB1G 4I65A 2F0FA 1I50H 1U4RA 4JYAQ 1RL2A 1FD7D 3T1YL 2JA8G 3HOYG 1PH3A 1E0BA 4WRDA 4NXML 3OYYA 3LX0A 4B3SL 2JXMB 1YJWA 4X3SA 3CMAA 3TMEA 5IWAL 4C3JB 3RZDB 5LL6X 3TREA 5K36G 1VQ7A 2R3ZA 2OT2A 2NWGA 1BUVT 4PMWA 5IYDG 5DAUA 3J81i 1F9QA 1EIHA 3VA5A 3VYSA 1QVFA 2HCCA 1VCIA 1Y14B 4OX9L 3K7AB 2CWPA 1E24A 2ES2A 2SDFA 1V1QA 4F7XA 5IY0A 2DJGC 5M3MH 3S1MH 4RKBA 2EVBA 1JOKA 1HA6A 1GO3E 1ZKOA 5J39A 2IPKD 2FJ2A 2CQOA 3H0GG 4F87A 3PIO3 2JP1A 1M8AA 3I4LA 4GKKQ 4GKJQ 3DMUA 4LF9L 2LSSA 1S72A 2SOBA 3KF8A 3SK6A 1XNRL 4JPBW 2UU9Q 4KJNA 1NMFA 4A3BG 2D62A 2NYZD 2EYFA 3PGZA 1SNCA 3QWNA 4DV5Q 2BH2A 4MZ9A 4XXEA 3LWUA 1UWVA 2EXZA 4S3SA 3M85A 2VB2X 3PMFA 2JEAI 3G6EA 1EQVA 4DR5Q 3CU7A 4JG2A 4KHVA 4TRDA 2ALYB 3H3VC 1CK1A 4Y7NB 1CSPA 3D6WA 2EY2A 2GVAA 2F0KA 2WB1E 5DNFA 1S5CD 4LF6L 1WTOA 2E75C 3TQYA 2K01A 1SYGA 3RZOH 3J81c 2N88A 1S40A 5IGDA 3I4NB 1F77A 2YU9H 1KLUD 1TVXA 2KHSA 4LFCL 4BY1B 4K0KQ 1NBWA 1V9PA 1H9RA 2WAQG 1CM9A 2A6ED 2AMCB 2CH4A 5IYCH 2F0GA 1BCPF 3R93A 2F0LA 1Q90A 3OOCA 4RWSC 3OWFA 3K58A 4CDEC 4A3JH 2Z6BA 1II3A 4FP5D 3PIPA 3M3YB 4L5SA 3TS2A 2MGSA 4GZYC 1ILPA 3VYTA 2K5HA 2A6EC 1MJCA 3S1RH 4DAVA 2XWBB 3L9AX 1J5EQ 2BCOA 3R2IA 3PUVA 1C48A 1EY0A 4R4QA 1C8CA 1L0YB 1HFNA 4C3HG 1OO9B 2RHSB 5CV4A 2ZM6Q 1JWSD 2X6LA 1TWGH 2HQEA 2R93G 4JV5L 1CKNB 2RCFA 2XRQD 2R92G 4DUZL 1G51A 4ZRZA 3SHLA 1D5XC 2E2HB 4HJAA 4A3KG 2B2UA 4ZUIA 3GTPB 1C9OA 3CCVA 5IYBG 1N34L 3M4YA 1EIGA 1SMYD 4JI2L 1D7QA 5C4JH 4OIJA 4NDXA 1IBKQ 2ZT9C 2K5VA 2WIIB 1PHJA 2G9DA 5CORA 3QG1A 1YHBA 2F4IA 2RA4A 4L5QA 1V8QA 2CKZB 2LY7A 2K5QA 1RCVD 2J0TD 4J15A 2SNSA 1SMYC 1MSHA 5CV6A 4A3FB 2L15A 4JI6L 2HQLA 4APVA 5ELEA 2KHJA 1LTBD 4B9WA 4QF4A 3MAQA 1LLRD 1U4LA 2F03A 1WCMG 1X3QA 4Q0FA 4IJLA 4LUOA 5GADC 1PH1A 4B3MQ 2WAQE 1Y1VH 3LWEA 2Z9HA 2WB1B 3KFUA 1GUGA 4K5WA 2ZJPA 2XNAC 1ASYA 3UE0A 1KDCA 1EQQA 1ZYRD 2B2VC 2K05A 4H7BA 1PZID 3OMCA 2JA8B 3HOYB 1CA5A 4LNQA 2YV5A 2J7ZA 4FXDA 2IW3A 1K3BC 1EIFA 3NBIA 4X64Q 3DLLA 1AZPA 1B8AA 1EUJA 1QOHA 1MI2A 3L3OC 2O5IC 4X62L 2KECA 1SRUA 3BZKA 2CCZA 3T1HL 4UDUC 1XJVA 3BDOA 1QILA 2A74C 1D1KA 5IODA 1VS0A 3S1QH 1HTLD 1TWFH 2F0UA 3VR4A 1B50A 1EIYB 1LYLA 1BR9A 1S3OA 3QOLA 2ZTCA 4IURA 3QB3A 2MFIA 2H4OA 3RNUA 5C4XB 2DN8A 4N9PA 4A3EG 5EPKA 4K5XA 4CDFC 5EBDA 4DR2L 3E3XA 1VQOA 1PTOH 2VZAA 2M00A 4DK0A 5D3IB 2NVYH 3M4QA 1SDFA 1HR0Q 3S2HB 1B3QA 3WOEA 1STYA 5D3DA 1IBML 3FP9A 2PMZE 5KRUA 1FNVA 4G7ZC 4QGUA 3SXHA 3ITPA 1HNXL 1EYGA 4B08A 5FJ8H 2VUMH 4DV2L 2IHEA 1XMQQ 2F0TA 5DEHA 1WFQA 4A3IG 4FF2A 1PTOF 3IFDA 5IGGA 2VQEQ 1VQAA 2UXDL 1EYCA 1N32L 1F9SA 3M4PA 4RMFA 4ME3A 2RDFA 4GLXA 2OWOA 4JBMA 2VNUD 4UP7A 1K0RA 2WAQB 1XXGA 2QDLA 2R7ZG 1QZGA 3HOVB 4L63B 3D4RA 5LMUL 3L2PA 1HR0W 1NUCA 2UXBQ 1BOSA 3SEBA 1QUQB 1RTNA 1JOOA 3AFPA 2E5LL 3VYRA 4XIGS 1B44D 4BBRB 1F2YA 1QE6A 3T1YQ 3DEOA 4NXMQ 1DXMA 1LO5D 1XTCD 4B3SQ 4JI5Q 4DK1A 2QW7A 4YCWA 1Y1WH 2R93B 3I2ZA 1P16A 4A3LG 2R92B 1BDOA 1B70B 2NVXH 4A3KB 3T4AC 4MN3A 5KEEA 1PRTB 1EY9A 1WD1A 3SR1A 5C5MA 2B2VA 5M5XH 3MXPA 1STGA 4OX9Q 1I6HH 3HFZB 4LJZC 4K6DA 3BZCA 5FK9C 4PQXA 4NKLA 1ET9A 3GTMH 2NTTA 3KF6A 3A55A 3A7AB 4GKJL 1Q8IA 4ZAIA 1JB3A 5D14A 1E2WA 3QO2A 4DNRB 3TS0A 3S1NH 1EWIA 3KOJA 3AQQA 2F0JA 4LF9Q 3RLOA 4A3GB 1TS2A 2L1BA 2PMZB 3DHQA 1UUPA 1XNRQ 2A73B 1Q1EA 3AU7A 4DV5L 3GTLH 3MC0B 4BXXG 3P20A 1A2UA 4JBKA 1AFPA 5EBCA 4DR5L 4L8JA 2NZOA 3UDGA 3GV3A 2XWJB 3BYTB 2HD3A 2PI2E 4KN4C 1I4RA 3I4MH 3PCOB 1QWYA 4LF6Q 5C0XJ 4DUYQ 1PH5A 2K75A 1V43A 5KNBA 5C4HA 1SEBD 2K4KA 3S9WA 5GAEC 2B2WA 2DUDA 1EZ8A 1X9NA 1TIID 4KD4A 4K0KL 1LTTD 1UE5A 3KDFB 2PZTA 2K32A 3KLSA 4LF7L 4LFCQ 5CBEE 4OL7A 4DU9A 2JJQA 3ERQA 2CFMA 3F2DA 2QDBA 4G7OC 2C35B 3RLNA 4FDBA 1SXTA 3FVQA 4JI7L 1W6JA 4RFBA 3TBIB 3GP7A 3IFTA 5C3EB 5LL6S 2Z0SA 4EQOA 1SYFA 1J5EL 2BOSA 4A3EB 1QZHA 3HOWH 1IKLA 4C3IH 3AEVA 4DR1Q 2Z6KC 5E4WC 1SE4A 5CMDA 4FO2A 3GTGB 4C3JG 4I7ZC 5JJIA 2WACA 3GQBA 1KC8C 2VS1A 1EY4A 1ENFA 1FNWA 1AN8A 4JW0A 4HIKA 1IZ6A 4DUZQ 4ZYSA 1XPRA 4OO1H 5CBAE 1E1OA 3KK7A 4RGTA 4IUNA 3CP0A 3CW2C 3NP8A 1AE2A 1GUTA 4JI2Q 1I4GA 2CQAA 3MVVA 1I3QH 2L0CA 5FLMH 3S15B 4DXFA 4MHEA 5HGTA 3B6YA 1MKHA 4CHTB 1K8GA 2RHQB 1Z7TA 4DFAA 3BU2A 4A3IB 1X3FA 1W2BA 1VQFA 1PH8A 1MSGA 3S14H 1TXYA 1B2TA 4F8MA 3S2DH 2YYZA 1J9OA 2D5DA 3ULLA 2EYJA 4NPSA 3GTJB 2V1CC 3I7FA 1ILQA 2QEXA 2ATWA 4LFBQ 4NMZA 4A3MH 2KCTA 3C46A 4O1NA 2Q2HA 1RJTA 1A3TA 3TP8A 2R7ZB 5GROA 3RD4A 2FMCA 2NN6I 1PVOA 3HOXH 2HDLA 1STEA 1W3SA 1JB7A 1MBYA 1JCKB 5M9OA 2D0OA 3KDFA 1NJIC 2B63H 4ABNA 4IQZA 4CJ2C 3R2TA 3P75A 2EDGA 3NPPA 2JA5H 3NK9A 4BY7B 2EY6A 1CSQA 5FLXE 3A54A 3I72A 5ELNA 5JVH3 4G7HC 3MXUA 3NTKA 4BWGB 2B3GA 4X62Q 1EEFD 5C3WA 4BY1G 4BBSG 2F0EA 2QGQA 2WKCA 4BA2I 1LTAD 1STNA 4PV1C 4B3TQ 3X3MA 4IUVA 2B2TA 1SNQA 3JAMi 1AE3A 1TWCB 3IL8A 4NXNL 3N52A 1U0LA 3ND9A 3W1BA 3GTOB 2J4XA 2K6AA 1EU4A 3LNNA 2MHVA 1IKMA 1PH7A 5GQOA 2AWNA 2AUJD 5JOBA 1G2TA 4DR2Q 3E0JA 2XTIA 2AKWB 4ZCKA 5GAHC 4A75A 2KEEA 5NUCA 4KV6A 1G6PA 3OW7A 3CCLA 1HR0L 2C5CA 4GOPA 4HJ5A 2F3VA 1UEBA 1BO0A 5FO8B 3ZJYC 3C2PA 1IBMQ 4XYOA 1KDAA 1CA6A 4JI3Q 2MO1A 3CAMA 5M5WH 1MJEA 4HMJA 3GTQH 3NXWA 4TKOB 2ZJQA 3CCUA 1HNXQ 4A93B 2LKVA 1FVIA 2IHFA 3I8ZA 4RG1A 2E2DC 5C3XA 4JOIC 4JI0Q 2RCNA 2TMPA 3ULJA 1HRJA 1AP0A 3BDLA 3PO2H 2QF7A 2CW0D 3PF5A 1E1TA 1PH2A 4RKLA 3D8GA 3PUWA 3IAYA 4YWMA 2PI2A 1N32Q 2N3SA 4TVAB 4R4OA 3JAMc 4A3CG 4H13C 1IYUA 3MZ5A 1UAPA 2F3WA 4LF5Q 2SNMA 5FLXL 2CW0C 1Q1BA 1OXUA 2XSCA 4X3TA 4DV1L 1NR4A 1JE5A 2UXBL 4Y52H 1PFBA 5C0XG 1VQ4A 5IP9H 5LMUQ 1X3PA 1YHQA 1PLFA 4DXGA 3OPOA 3FKIG 2E5LQ 1L1OC 1UE6A 4OO1I 1L0XB 1KDBA 4JI5L 2KCNA 1DOMA 4MTNA 4CKEA 4DV4L 1CKOA 1PYWD 3TZUA 3CCEA 5K36H 1ENCA 3MWYW 5IGEA 3M4OH 4KHZA 3KLRA 1A0IA 1BNZA 1SYBA 1LACA 3SGIA 1FYCA 1TS3A 2F0PA 5IGCA 3J81j 1YJNA 2LS01 3GDEA 4ZLTF 5FLXc 3FHWA 1EWCA 3GV6A 3FRPB 2PPBC 3V05A 5C4XG 1A63A 1TR5A 1CKMA 3H0GH 1HA5A 4G57A 1R9TH 1Q86C 1L1OB 1IHZA 1JT8A 1HZAA 1EU3A 2K7VA 3S16H 1QNUA 1LTID 2L12A 2RQXA 1TWHH 5HY6A 3CPWA 1S5ED 4IOCA 1M90C 4UP9A 5M3MG 3MHBA 1SR3A 4C56C 4A3BH 4GLVB 4MTKA 4LMQD 5BN4A 5IE8A 1HPCA 1UNSA 1KTKA 3NTIA 2RKSA 2JA7H 3I55A 1SNMA 1Y8NB 3C3LA 2K50A 4IPGA 5EPJA 3QJYA 1KRTA 5GAGC 2ID0A 4RHRA 4DUYL 2IJ0A 4GNXA 4OXPA 2JSOA 1J8IA 4PZ6A 5I9OA 3A8IE 1DM0B 4KK7A 3HOZH 3BG3A 2XVSA 4YHHL 4MIUA 3FMCA 1M4VA 1Z47A 3IRBA 5KYLA 2MNAA 3VYUA 1JMCA 4BBSB 5EAYA 3N6RA 4LF7Q 1QVGA 3Q22A 1FGBD 5J1ZA 3PQIA 1K83H 3HOVG 3BVGA 4FXGC 1HHVA 4P74A 2KQ3A 3AYHB 1JJGA 5EKKA 1ONLA 2M2LA 3PSIA 5LMNW 1IW7D 2HIVA 4JI7Q 4C2MH 4BBRG 1Q81C 3K5OA 1VQEA 4DR1L 2UUCQ 4KKTA 3PO3H 2KOLA 2RSOA 3G7LA 2RF4A 4JI8Q 5IYCG 2EYLA 5CR3A 5EKIA 4YY3Q 4C3HH 1IW7C 2DY8A 4A4IA 4IPHA 4A3JG 3WDNA 1LTGD 3MEFA 3ULPA 1BKBA 1B9MA 4JK1C 2PYKA 5DM73 1SFOB 2K14A 5M3FB 4NP5A 2YTYA 3RMHA 3CHBD 1NCVA 4HCEA 4IPCA 1L1OA 3A5UA 2FXQA 4V0BA 4P71A 2PQEA 1YNJD 1VQIA 1ET6A 1FR3A 3CC7A 3GTKH 3OIQA 1I4PA 1NY4A 4KLKA 2E8GA 3E9HA 1B3AA 3CMEA 2H1EA 1F2MA 4QUCA 3J7AV 2E2IH 1YNJC 2E76C 2EPBA 2NVTH 2E2JH 4A3GG 2N55A 3EROA 4LFBL 3F2CA 1UE7A 1HUMA 1PRTF 3CQZB 2KENA 1GOZA 1SJED 1TWAH 2O2LD 3G6JB 5AFWA 3URYA 1WCMH 2UUBL 4HIMA 2JYOA 3E5SA 4ULLA 3W5OA 5IIFA 3CCQA 2OXPA 3H94A 3K7UC 1EY7A 3SK8A 3FKIB 4K8IA 2XGTA 1PFSA 4IUQA 1XTDA 1I4QA 2NUCA 5E1FA 5M5YB 5ISRA 1UEAB 3BVZA 2NVQH 4JC0A 3S17H 5CV9A 3A5ZB 2I46A 1Y1VG 5C44B 2ZTEA 3P7JA 4FVMA 1I50B 1ZYRC 3TP7A 4J6HA 1TY2A 4DR4Q 1X54A 4AH6A 4RAUC 2EYMA 1Q12A 2L4NA 4B3TL 3Q23A 2X69A 3UDIA 1MGSA 3NENA 2MQHA 4QQBX 1YEZA 1S5FD 4JI4L 4NXNQ 3ICEA 1BCPD 4IO9A 2A5HA 3ONAB 5C3EG 1IYVA 1CKNA 3MFGA 4XT3B 5L37A 5JJLA 2KVMA 1U4MA 3SDZA 4KY5A 4R4TA 3KBGA 1BCPC 2Z4HA 4U68A 5M3MB 3S1MB 4POGA 1XNQQ 3CC2A 1O7IA 2A69D 2X6GA 5KYIA 1WTWA 2QCPX 4JI3L 2HHHQ 1O7ZA 2BDNA 2EY1A 1JC7A 2R7DA 1A15A 3R3OA 3VR5A 4HSPA 4LF8L 1JOQA 2FINB 4XYQA 1PFMA 2L11A 4JI0L 2F0IA 4WJ3M 4X3UA 1EEID 2A69C 1CZGA 5CV8A 5IP7H 4R8IA 1PH4A 4L6TB 4A3IH 1A3UA 2FHTA 4X3KA 3A8KE 2EYOA 1X3EA 2QILA 1PDQA 1CQFA 2WINB 1IXRA 3CF5A 1BCPB 4LF5L 5FJ8G 4RHSA 4OONA 2VUMG 4HSVA 1EFID 3Q6SA 1BF4A 4ZK9B 3BYYB 1OXVA 4DV1Q 3BZDB 1EY6A 1RKNA 4DR6L 3RZOB 4LUVA 3DWPA 1MHWC 4DA2A 2YU9B 1EY8A 2VQFL 3NBHB 2WP8J 5JAVA 1XPOA 1PFNA 3MXGA 4IPDA 2BDOA 2FFKB 3M7GA 2ZXOA 3EFXD 4AYBG 4RH6A 4BY7G 4XT1B 1VQ8A 4DV4Q 2NN6H 3QOJA 1TKWB 1X6OA 2DJFC 4I7AA 4A3JB 3TN2A 2A8VA 4A3LH 5IGFA 1DOKA 3HKZG 4KKUA 2L55A 1U4PA 3L7ZC 3H15A 4AQYQ 2UUAL 5IOCA 1KLGD 4B3RL 1BQQT 1KNEA 3CCSA 3D6CA 5G3LF 1HNWQ 2JE6I 1SJHD 3OHXC 1TWGB 4A3DH 1QG7A 1VQ5A 1SBBB 4K8JA 4HN7A 2PO4A 3MXNB 2Y0SG 4N9TA 3K59A 2K5NA 3MFYA 4OWTB 3KLWA 4LUZA 1GUOA 2AQ1B 5C4JB 5LMNL 2MP1A 5J22A 1E3PA 1D6EC 4LF4L 3MEHA 1STHA 1HFGA 1VMPA 1HQMC 1K73C 2EJMA 2OTLA 4A93G 5JEAJ 2HCIA 1VQ6A 1FL0A 4EX5A 1CZWA 4DV3L 2JA6H 3HOUH 1RIPA 4B9XA 2F0HA 3RR5A 4DV0L 2OF1A 2BE5D 4P2CB 4N8X1 2HDMA 1PTOD 2BA0A 5JPMC 1K8AC 3EIVA 1HCZA 1I94L 2NZHA 4EQ5A 4YHHQ 1Y1VB 1QUQA 4AYBE 4C1NK 2RBMA 3HG9A 1BVSA 1EZ6A 2OQKA 4GS3A 1A62A 3I4MG 4CKCA 2BE5C 1CQVA 1JJ2A 3HKSA 1PTOC 3KJPA 1WOCA 4ALPA 3HKZE 5H1SE 2EXDA 3K0YA 5I2XA 3A0JA 4PG3A 1WD0A 1STAA 1CHPD 4ILWA 2UUCL 5JJKA 3OW2A 1VDZA 5D65A 3S1QB 4JI8L 1ENAA 1TWFB 2D0PA 1BXTA 1R4QB 4YY3L 3BJUA 2LMCB 1TQOA 4UPAA 4C3JH 4JCVE 1SMXA 3BDCA 3RZDH 4CBVA 1C7YA 4XDXA 2Y0SE 4H02A 3J80E 2E74C 3TP6A 1VQCA 5I6YA 1WTPA 1QJOA 2HUGA 3FDTA 4F88A 1XWEA 3U50C 3TEHB 2F1MA 4RA8A 1TS4A 3K7AH 1GJXA 4C3IG 1WTRA 1LTSD 2LXKA 3MXNA 2M9VA 4M1UB 1K8OA 1PTOB 1ESFA 1T5XD 1YVCA 4HJ9A 5E7NA 2PQAB 1G6ZA 5ELFA 1I5FA 2F0NA 2ZTDA 1N9WA 2NVYB 5BN3A 4P73A 2PZWA 2EOTA 4OO1G 3U4ZA 2R6GA 4K2LA 1WTQA 1PMRA 5CV7A 4DAMA 5BN5A 4H0LC 2IL8A 5FLMG 3K5MA 4IFDH 2TSSA 2VUMB 2OQ0A 1FJGL 1I6VC 2B2YC 4RCNA 4UY8C 1AH9A 4LFAQ 3UE1A 3E6ZX 2Q2TA 3Q24A 1Q46A 2UUBQ 3HGBA 4KTAA 2P5ZX 4Y7NH 2ZJRA 3CD6A 1OXSC 2IX0A 2OEOA 3STBD 4A3MG 1PZJD 4HIOA 2F0DA 3E0EA 4AYBB 4QIWE 3I4NH 1O78A 2PW5A 4DR4L 3HOXG 2C9OA 3NWSA 1YNXA 4BY1H 3STBC 3HKZB 1JORA 2CWAA 4MNOA 2L9HA 1VQPA 2VB3X 2DY7A 2JA5G 3J80L 2F4VL 4JI4Q 3OSOA 3CCRA 5ELBA 3M3YH 5JPNC 4FXKC 1YBYA 1XX8A 1Y1WB 1E7ZA 3EJIA 1DCZA 1G8ZD 2FMMA 2NVXB 3PUZA 3RN2A 1QVCA 1PV4A 3CRKC 2Y0SB 1PZKD 1STBA 1E22A 3OMGA 4DV7L 2PW7A 4HMIA 4DK6C 2KHIA 5M5XB 4CJ0B 1UE1A 4CKBA 2Q2UA 1HZ9A 5IT9E 1XNQL 2PNHA 3HP3A 3L0OA 1WYDA 2PQAA 4POFA 3H6MA 2E2HH 1QNKA 1HNZL 1VQKA 2HHHL 3J7A5 4QL5A 2F0WA 5M3FG 3GTPH 3GTMB 1MD2D 4IALA 2N78A 2EQSA 1GHJA 1WTVA 2QKIC 1I4HA 2RVLA 2Z6KA 3S1NB 4LF8Q 1S4ZA 4LWCA 1SSOA 3OIPA 1GUWA 1K9MC 5EJWA 1BBUA 4P75A 1VQMA 2ENBA 4O0AA 3UI2A 2GN5A 1DOLA 2JQOA 4X65L 1YIJA 3QIAA 3HRZC 4A3FH 4BS9A 1SE2A 4GN4B 3GTLB 4YWLA 1D8LA 4KMUC 3V2TA 3PF4A 1G291 3T16A 3I70A 3J81E 4J8QA 4WJWA 2OCEA 1Y8OB 2LFNA 3TDQA 3Q0AA 4FF1A 1VQDA 3D3RA 5JEAG 3I4MB 5EKLA 4EQPA 4GLAC 4R4CA 2BA1A 5CC4A 1ML0D 1DGSA 5AJ3L 3X3NA 4IUUA 2GA4B 4H44C 4UAIA 5C0XH 2AHOB 1K3RA 4DR6Q 3I3CA 4DKAC 1WTHA 4PZ8A 4QIWB 2VQFQ 1EQRA 2JA8H 3HOYH 1EWHA 4C1NI 2QA4A 3CXCA 5I2YA 2Z4IA 1XMOQ 1D2BA 4OIKA 3BVMA 1VF7A 4EQNA 3K80C 5C44G 2B2YA 2I5MX 3K5LA 1T9HA 5IP9G 2B2UC 5CV5A 1B53A 3JC66 1D5MC 1Q3LA 4GN5A 1HQRD 5BR8L 5IYDH 3AMUA 1ICFB 1CHQD 4LK1C 4AQYL 2VL6A 3Q8DA 4JBJA 2PNRC 5TSSA 3HOWB 5IT9L 4C3IB 2UUAQ 5C5LA 4OWXB 1HNWL 2GVBA 5FOBB 4B3RQ 1Q8KA 1F9RA 4M8AA 1RHPA 1V1OA 1VF5C 4FNFA 4IFDI 1C4QA 2I5HA 1KHIA 5C4XH 5F2DA 4ME5A 3U58A 2RDHA 3K81C 4IFDJ 2EYHA 1YNND 3KLSX 1KQSA 5E3FA 1X55A 1ESRA 5KNDA 2VXWA 1I3QB 5LMNQ 3S2HH 3EN2A 4AIMA 1KXLA 4KY7A 2EZVA 3J81L 1PH6A 4LF4Q 4LAAA 2IX3A 1YNNC 3S14B 3TSSA 5COYA 2K1BA 3S2DB 5IT9c 1LTLA 4KD3A 4JVZA 5HURA 4DV3Q 4DR3L 3D31A 4A3MB 3W2DA 4DV0Q 3VR6A 2JA7G 1YZ6A 3FPPA 1NE3A 3CCJA 3U9SA 1PYBA 4QY7A 1QB5D 1I94Q 1GM5A 1VQBA 1BBXC 3HOXB 4RGNA 1SYCA 3H3VI 1A6XA 3J7AF 2F3IA 3NELA 5KIXA 3M7NA 4RGOS 2B63B 1CI3M 3U4VA 3HOVH 4JOIA 3K8AA 3ER0A 5T1IA 2B39A 2JA5B 3HOZG 2WV6D 2A6HD 3I56A 2XN9C 3NSWA 4DAPA 2RDGA 5FO7B 1B9NA 4BBRH 2RSNA 1KNAA 3F8TA 2KCMA 3I90A 4V190 2A6HC 2R93H 2R92H 5JJZA 1SNDA 4A3KH 2O5JC 5IYBH 3EVQA 3PO3G 4QMGA 1L2FA 2K04A 4NB3A 4DV6L 1W6KA 1C0AA 3UDXA 1OXXK 3VDYA 5EPLA 1N33L 1V1PB 1MIUA 1AZQA 1AW7A 1XPUA 2DGYA 2DNEA 3RUZA 4OELB 2B8FA 2A1AA 2V4DA 1EYDA 2F0MA 5C0XI 5M5WB 2MJ8A 1N8RC 4HTHA 5T1GA 5C6AA 3NQIA 3GTQB 4A3GH 2UXCL 1IBLL 5FKAC 4PNYA 1GXDC 5ELOA 1H95A 4IZ8A 1BBWA 3CPFA 1KAWA 1SN8A 4LFAL 1IL2A 1SLJA 1FJGQ 1AEXA 2N8NA 3PO2B 4DK3C 4ODGA 2EYPA 4DGZA 3OTOL 3P1HA 3SK5A 4KJOA 1SAPA 3DM3A 4Q5VA 1L0WA 5DLQE 2DNCA 1DONA 2XIWA 3G48A 2HIXA 2B8GA 1R4PB 1DYQA 2A68D 5A35A 4J1MA 5J3BA 1O7LA 1KD1C 1SNPA 4K6LA 5I9PA 2R61A 1ASZA 1CT1D 4L5TA 2IY5B 2A68C 4QCLA 1SE3A 4ID6A 4L5RC 4P72A 1X65A 4OWWB 2IWHA 2F4VQ 4BA1I 1KIXA 1KAAA 4O2DA 1K8MA 4DR7Q 5C3EH 1I4XA 2Q8IB 3ND8A 4KHPL 4KI0A 2NZ1D 1X32A 4A3EH 1Q82C 3M4OB 4XQNA 3NQTA 3GTGH 4OEMB 3U9OA 3D4WA 1JE4A 3DUZA 4DV7Q 2MPMA 3VR3A 1IL8A 5KGUA 1VQLA 3O13A 1B4OA 1YHAA 3D0FA 4RGMA 5CYUA 1V1PA 1HNZQ 4XQQA 2D9UA 4PMCA 2AQ2B 4JI1L 3H0GB 1NSNS 1R9TB 2G9HD 5E4XA 1DJRD 1HTPA 1NNXA 5HGQA 2PZUA 4X66L 3S15H 4KN7C 3K5NA 1GHKA 4HIDA 4YWKA 3S16B 4FF4A 3K6OA 4HCSA 3NWTA 2I0QA 1TWHB 1E2ZA 2Q8RE 4E6IA 3T13A 2O4XA 4A3BB 2ASBA 3KF6B 1FNUA 2NBFA 2PCFB 4X65Q 3T53B 5IGBA 2B2WC 2JA7B 4IOAA 1N36L 1GD7A 3H09A 4QUFA 3EBEA 3GTJH
chains in the Genus database with same CATH topology
1SROA 4UPAA 2K5HA 3PF5A 4C3JH 1E1TA 4JCVE 1PH2A 1MJCA 3PUWA 1SMXA 3RZDH 4YWMA 3S1RH 1J5EQ 1C7YA 1A8VA 2Y0SE 3PUVA 4H02A 2PI2A 4R4QA 1VQCA 3RLFA 3WWVA 5IP7G 2N3SA 4TVAB 1N32Q 1LUZA 2R7ZH 4R4OA 3JAMc 4A3CG 2RHSB 2ZM6Q 1HZCA 3U50C 3TEHB 1TWGH 2R93G 5AJ3Q 4LF5Q 4JV5L 1OTCA 1CKNB 4DNIA 3K7AH 1PYSB 3I4OA 2R92G 4DUZL 2LXKA 1G51A 1Q1BA 1OXUA 4DV1L 4HJAA 4A3KG 1YVCA 4HJ9A 1JE5A 2UXBL 5E7NA 2HT1A 1C9OA 2PQAB 3CCVA 4Y52H 5IYBG 1I5FA 5C0XG 1XMOL 1N34L 1VQ4A 5IP9H 5LMUQ 4JI2L 2ZTDA 1N9WA 5C4JH 1D7QA 1YHQA 4P73A 1IBKQ 4IJHA 4BY7H 2K5VA 3FKIG 2E5LQ 3U4ZA 4OO1G 1L1OC 1UE6A 2R6GA 1PHJA 4OO1I 1HJPA 1YHBA 4DAMA 4JYAL 4JI5L 4L5QA 2VW9A 3G71A 2CKZB 1X3GA 4J15A 4DV4L 4MTNA 5FLMG 5BR8Q 3PIOA 1CKOA 2L15A 4JI6L 2HQLA 4APVA 1TWCH 2OQ0A 3CCEA 1FJGL 4XTCS 2KHJA 4UY8C 3CC4A 4HJ8A 3GTOH 1AH9A 4LFAQ 3UE1A 1VQGA 3M4OH 2Q2TA 1YITA 1Y1WG 2NN6G 1Q46A 4KHZA 2UUBQ 1A0IA 5IWAQ 3GO5A 3J81j 3SGIA 1YJNA 4Y7NH 3GDEA 5FLXc 1WI5A 1VQNA 2ZJRA 1WCMG 5GADC 4IJLA 4LUOA 3CD6A 1OXSC 1PH1A 4B3MQ 3FHWA 2IX0A 2WAQE 1X56A 1Y1VH 3STBD 1NMGA 4A3MG 3KFUA 2YTVA 1A63A 1JJCB 5C4XG 4HIOA 1CKMA 3E0EA 1Z9FA 4QJFA 2ZJPA 4QIWE 1ASYA 1EOVA 3H0GH 3E9IA 3I4NH 3UE0A 1EQQA 1R9TH 1Q86C 1L1OB 3ERSX 1JT8A 1YI2A 4A3DG 1HZAA 4LNQA 2YV5A 4DR4L 3S16H 1EIFA 3HOXG 4DAYB 1YNXA 4X64Q 1FGUA 4BY1H 3DLLA 1TWHH 5HY6A 3CPWA 3STBC 4IOCA 1M90C 1B8AA 1EUJA 2CWAA 4MNOA 4UP9A 5M3MG 1SR3A 4BXXH 1VQPA 4A3BH 4GKKL 4GLVB 4X62L 2CCZA 1SRUA 3BZKA 3T1HL 3UDFA 5IE8A 1XJVA 4A93H 3LGJA 2JA5G 2F4VL 3F2BA 2UU9L 1VS0A 4JI4Q 2JA7H 3S1QH 3CCRA 1TWFH 3I55A 3M3YH 2VY3A 1YBYA 4DR3Q 1E7ZA 3A74A 2EIFA 1EIYB 2K50A 4IPGA 3S24A 1LYLA 1NTGA 1KRTA 3PUZA 5GAGC 1QVCA 2ID0A 1S3OA 4PZ7A 3RN2A 1PV4A 4DUYL 4GNXA 2ZTCA 1E22A 4DV7L 2LXJA 2MFIA 4OXPA 4DK6C 3RNUA 2KHIA 4A3EG 4PZ6A 2Q2UA 1UE1A 1HZ9A 3HOZH 1XNQL 2PNHA 2JA6G 1GKHA 3L0OA 1WYDA 4YHHL 4DR2L 2PQAA 2K52A 4POFA 1VQOA 2E2HH 1Z47A 2VZAA 3IRBA 3KJOA 2BH8A 3GD7A 1HNZL 1VQKA 4QL5A 2HHHL 2MNAA 3GTPH 5M3FG 1JMCA 3J7A5 5EAYA 3RN5A 2NVYH 4LF7Q 3M4QA 1QVGA 1HR0Q 1K83H 2N78A 3HOVG 2EQSA 1IBML 2Z6KA 4P74A 3FP9A 4LF8Q 3AYHB 1JJGA 4LWCA 2PMZE 5LMNW 3PSIA 2IT1A 4YCVA 1K9MC 4UP8A 1BBUA 4P75A 4QGUA 2HIVA 1VQMA 4O0AA 4JI7Q 2GN5A 2JQOA 4X65L 1YIJA 1HNXL 4C2MH 4BBRG 4A3FH 1Q81C 1EYGA 1VQEA 3PUXA 5FJ8H 4GN4B 4GOPC 3F1ZA 4YCUA 4YWLA 4DR1L 2UUCQ 2VUMH 3PO3H 1D8LA 3PF4A 4DV2L 1G291 2IHEA 1SE8A 1XMQQ 2OTJA 1VQJA 5IYCG 2RF4A 4JI8Q 1WFQA 4A3IG 4A76A 1KRSA 4YY3Q 3KYHC 4C3HH 2OCEA 2VQEQ 3AFQA 1VQAA 4IPHA 4A4IA 1WJJA 1VQDA 4A3JG 3HOWG 5JEAG 2UXDL 1N32L 3MEFA 3ULPA 3M4PA 4GLAC 4RMFA 2AWOA 4R4CA 1BKBA 2BA1A 2ZM6L 3TRZA 1DGSA 4ME3A 3NEMA 4DV6Q 5AJ3L 4GLXA 2OWOA 2K14A 4JBMA 2YTYA 2VNUD 2AHOB 1K3RA 1K0RA 4IPCA 1L1OA 4UP7A 3A5UA 4DR6Q 4JV5Q 4WJ4A 4DKAC 1N33Q 2FXQA 2R7ZG 4P71A 4PZ8A 1QZGA 1VQIA 2VQFQ 1EQRA 2JA8H 3HOYH 2QA4A 5LMUL 3L2PA 3CXCA 1HR0W 2UXBQ 3CC7A 1QUQB 3GTKH 1IBKL 1N34Q 4DPGA 1XMOQ 3AFPA 2E5LL 1NY4A 4KLKA 2E8GA 3E9HA 4XIGS 3K80C 2YTXA 1Q7YC 5C44G 2Q2IA 4GOPB 1IBLQ 2UXCQ 3CMEA 2I5MX 3K0XA 1T9HA 3T1YQ 1M1KC 5IP9G 2F52A 4NXMQ 2E2IH 3JC66 3J7ZC 2NVTH 4JI5Q 4B3SQ 2E2JH 4A3GG 4GN5A 5BR8L 5IYDH 4LFBL 3F2CA 1UE7A 4YCWA 4AQYL 2VL6A 1Y1WH 3Q8DA 2KENA 3I2ZA 4JBJA 4DR2Q 4JI6Q 4GN3B 1P16A 1HH2P 1TWAH 4A3LG 2UUAQ 4DR4Q 4OWXB 2JA9A 4JBWA 3OTOQ 1HNWL 2GVBA 1B70B 2NVXH 4B3RQ 1WCMH 1Q8KA 2UUBL 4HIMA 1PA6A 3W5OA 3CCQA 4IFDG 4IFDI 2I5HA 1KHIA 5M5XH 5C4XH 4OX9Q 1I6HH 2WFWA 3HFZB 3K7UC 1PH9A 2JK8A 2R7FA 3J80i 4B3ML 2XGTA 1PFSA 3U58A 3BZCA 1XTDA 3K81C 1VQ9A 4IFDJ 1KQSA 4BBSH 2NVQH 1X55A 3GTMH 2A19A 3KF6A 4JC0A 3S17H 3A5ZB 5LMNQ 2JEBI 3M9BA 2B63G 3EN2A 4AIMA 1Y1VG 3S2HH 4GKJL 1VQHA 2ZTEA 1KXLA 4X64L 3S1NH 3TS0A 1PH6A 1EWIA 1X54A 3KOJA 3AQQA 4LW1A 4AH6A 3RLOA 4B3TL 1Q12A 4LF4Q 4LF9Q 3I4NG 4DR7L 1XNRQ 4R1JA 1P8LA 1HZBA 3UDIA 1OXTA 3NENA 1Q1EA 3PUYA 2MQHA 4QQBX 1YEZA 3H3VH 4DV5L 4R4IA 3T1HQ 4JI4L 1CUKA 3GTLH 4NXNQ 4KHPQ 5IT9c 1LTLA 3ICEA 4BXXG 4IO9A 2KBNA 4JBKA 5C3EG 4DV3Q 4DR3L 4DR5L 1CKNA 3D31A 2NZOA 3UDGA 2I5LX 4DV0Q 5JJLA 2PI2E 3HOUG 2JA7G 3W1GA 1B7YB 3I4MH 3PCOB 1YZ6A 1NE3A 3CCJA 1PYBA 2N49A 4QY7A 3G4SA 4R4TA 1I94Q 4LF6Q 5C0XJ 1GM5A 4DUYQ 1VQBA 1SFOH 2H5XA 5M3FH 1PH5A 3H3VI 1LM0A 2K75A 1V43A 3PV0A 4JI1Q 2F3IA 2K4KA 3NELA 5GAEC 3M7NA 4POGA 3CCMA 1XNQQ 2DUDA 1X9NA 3CC2A 3U4VA 3HOVH 1O7IA 4JOIA 4K0KL 3K8AA 3KDFB 1UE5A 3ER0A 4X66Q 4JI3L 1YJ9A 2HHHQ 4LF7L 3J80c 4GNXC 4LFCQ 3HOZG 2R7DA 3I56A 2JJQA 2CFMA 3F2DA 4LF8L 4BBRH 4TQUS 4JI0L 2C35B 4WJ3M 3RLNA 4FDBA 4X6AH 4JI7L 3F8TA 2KCMA 1N36Q 3KF8B 5IP7H 1PH4A 2Z0SA 4A3IH 4A3CH 3CQZH 1J5EL 2R93H 1QZHA 1X3EA 1XMQL 3HOWH 2R92H 4C3IH 3AEVA 4DR1Q 2MO0A 2Z6KC 4DV2Q 3PO2G 1IXRA 1J6QA 3CF5A 4A3KH 4LF5L 4A3FG 1GVPA 1IYJB 2VQEL 1KL9A 5FJ8G 5JJIA 4OONA 4HJ7A 1KC8C 1EFWA 5IYBH 2VUMG 2VS1A 3PO3G 2B29A 1L2FA 2UXDQ 4HIKA 1IZ6A 4NB3A 4DUZQ 1XPRA 4DV6L 1OXVA 3FKIH 2IX1A 4DV1Q 3UDXA 1C0AA 1E1OA 1OXXK 3VDYA 3CP0A 4DR6L 4GNXB 3CW2C 5M5YH 1AE2A 1U5KA 4LUVA 1N33L 4JI2Q 1MIUA 1I3QH 2VQFL 3NBHB 2WP8J 5FLMH 1XPUA 2DGYA 1XPOA 4IPDA 5C44H 3B6YA 2WB1G 1MKHA 1I50H 1K8GA 2A1AA 2RHQB 4AYBG 5C0XI 4JYAQ 1N8RC 4BY7G 3BU2A 4A3GH 1X3FA 1RL2A 1W2BA 1IBLL 1VQ8A 4DV4Q 2UXCL 3T1YL 1VQFA 1PH8A 2JA8G 1PH3A 3HOYG 3S14H 4NXML 1TXYA 5ELOA 1X6OA 3OYYA 1H95A 3S2DH 1BBWA 2YYZA 1KAWA 3CPFA 4B3SL 1SN8A 1YJWA 4LFAL 1IL2A 1SLJA 3ULLA 1FJGQ 2A8VA 4A3LH 4NPSA 3HKZG 2N8NA 3CMAA 2V1CC 3I7FA 5IWAL 2QEXA 2ATWA 3L7ZC 4DK3C 4LFBQ 3H15A 4AQYQ 2KCTA 3TREA 4A3MH 3OTOL 2UUAL 5K36G 1VQ7A 4B3RL 2Q2HA 3CCSA 4PMWA 5IYDG 3J81i 1HNWQ 3DM3A 5GROA 2JE6I 5DLQE 1L0WA 1QVFA 4A3DH 3G48A 2NN6I 1VCIA 1Y14B 2HIXA 4OX9L 3HOXH 1PVOA 1VQ5A 2CWPA 1W3SA 1E24A 1JB7A 2ES2A 1V1QA 2D0OA 5IY0A 3KDFA 5M3MH 3MXNB 1NJIC 3S1MH 5J3BA 2Y0SG 2B63H 2K5NA 1KD1C 1GO3E 4OWTB 3KLWA 4LUZA 2JA5H 2CQOA 3H0GG 1ASZA 1CSQA 4L5TA 5LMNL 5ELNA 1E3PA 2IY5B 4GKKQ 4GKJQ 2B3GA 4L5RC 4X62Q 4P72A 4BY1G 4LF4L 4BBSG 4LF9L 2LSSA 1S72A 1X65A 2QGQA 4OWWB 4BA2I 1XNRL 2F4VQ 4BA1I 1KIXA 2UU9Q 1NMFA 4A3BG 4B3TQ 4O2DA 4DR7Q 5C3EH 2D62A 1K73C 2OTLA 4KHPL 4A93G 3JAMi 4KI0A 1AE3A 4NXNL 5JEAJ 3PGZA 1VQ6A 1FL0A 1U0LA 4EX5A 4A3EH 3W1BA 4DV5Q 2BH2A 4MZ9A 1Q82C 4DV3L 1UWVA 2JA6H 3HOUH 1RIPA 3GTGH 3RR5A 3M85A 4DV0L 2JEAI 3G6EA 4DR5Q 4JG2A 4DV7Q 2ALYB 1PH7A 5GQOA 2AWNA 1CSPA 2BA0A 1VQLA 1K8AC 2GVAA 3EIVA 2WB1E 1I94L 4LF6L 2NZHA 4EQ5A 1YHAA 4YHHQ 2XTIA 1QUQA 3D0FA 3TQYA 4AYBE 2AKWB 5GAHC 4A75A 1BVSA 1HNZQ 2OQKA 1G6PA 4GS3A 1A62A 3RZOH 3J81c 4JI1L 1S40A 3CCLA 3I4MG 1HR0L 4GOPA 4HJ5A 1JJ2A 3HKSA 2YU9H 5HGQA 1UEBA 4X66L 3S15H 4HIDA 4YWKA 1WOCA 3ZJYC 3KJPA 3HKZE 4ALPA 5H1SE 1IBMQ 4LFCL 4K0KQ 1NBWA 1V9PA 2I0QA 2EXDA 4JI3Q 2WAQG 2MO1A 2AMCB 3CAMA 5M5WH 1MJEA 3A0JA 4PG3A 5IYCH 2ASBA 3GTQH 3KF6B 2ZJQA 3CCUA 4X65Q 2UUCL 1HNXQ 3OW2A 5JJKA 1FVIA 2IHFA 4RG1A 4A3JH 4JI8L 4JOIC 4JI0Q 2D0PA 2RCNA 1GD7A 1N36L 4IOAA 3ULJA 3PIPA 4L5SA 3TS2A 4YY3L 3BJUA 3EBEA 3GTJH 3PO2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRO A;  4UPA A;  2K5H A;  3PF5 A;  4C3J H;  1E1T A;  4JCV E;  1PH2 A;  1MJC A;  3PUW A;  1SMX A;  3RZD H;  4YWM A;  3S1R H;  1J5E Q;  1C7Y A;  1A8V A;  2Y0S E;  3PUV A;  4H02 A;  2PI2 A;  4R4Q A;  1VQC A;  3RLF A;  3WWV A;  5IP7 G;  2N3S A;  4TVA B;  1N32 Q;  1LUZ A;  2R7Z H;  4R4O A;  3JAM c;  4A3C G;  2RHS B;  2ZM6 Q;  1HZC A;  3U50 C;  3TEH B;  1TWG H;  2R93 G;  5AJ3 Q;  4LF5 Q;  4JV5 L;  1OTC A;  1CKN B;  4DNI A;  3K7A H;  1PYS B;  3I4O A;  2R92 G;  4DUZ L;  2LXK A;  1G51 A;  1Q1B A;  1OXU A;  4DV1 L;  4HJA A;  4A3K G;  1YVC A;  4HJ9 A;  1JE5 A;  2UXB L;  5E7N A;  2HT1 A;  1C9O A;  2PQA B;  3CCV A;  4Y52 H;  5IYB G;  1I5F A;  5C0X G;  1XMO L;  1N34 L;  1VQ4 A;  5IP9 H;  5LMU Q;  4JI2 L;  2ZTD A;  1N9W A;  5C4J H;  1D7Q A;  1YHQ A;  4P73 A;  1IBK Q;  4IJH A;  4BY7 H;  2K5V A;  3FKI G;  2E5L Q;  3U4Z A;  4OO1 G;  1L1O C;  1UE6 A;  2R6G A;  1PHJ A;  4OO1 I;  1HJP A;  1YHB A;  4DAM A;  4JYA L;  4JI5 L;  4L5Q A;  2VW9 A;  3G71 A;  2CKZ B;  1X3G A;  4J15 A;  4DV4 L;  4MTN A;  5FLM G;  5BR8 Q;  3PIO A;  1CKO A;  2L15 A;  4JI6 L;  2HQL A;  4APV A;  1TWC H;  2OQ0 A;  3CCE A;  1FJG L;  4XTC S;  2KHJ A;  4UY8 C;  3CC4 A;  4HJ8 A;  3GTO H;  1AH9 A;  4LFA Q;  3UE1 A;  1VQG A;  3M4O H;  2Q2T A;  1YIT A;  1Y1W G;  2NN6 G;  1Q46 A;  4KHZ A;  2UUB Q;  1A0I A;  5IWA Q;  3GO5 A;  3J81 j;  3SGI A;  1YJN A;  4Y7N H;  3GDE A;  5FLX c;  1WI5 A;  1VQN A;  2ZJR A;  1WCM G;  5GAD C;  4IJL A;  4LUO A;  3CD6 A;  1OXS C;  1PH1 A;  4B3M Q;  3FHW A;  2IX0 A;  2WAQ E;  1X56 A;  1Y1V H;  3STB D;  1NMG A;  4A3M G;  3KFU A;  2YTV A;  1A63 A;  1JJC B;  5C4X G;  4HIO A;  1CKM A;  3E0E A;  1Z9F A;  4QJF A;  2ZJP A;  4QIW E;  1ASY A;  1EOV A;  3H0G H;  3E9I A;  3I4N H;  3UE0 A;  1EQQ A;  1R9T H;  1Q86 C;  1L1O B;  3ERS X;  1JT8 A;  1YI2 A;  4A3D G;  1HZA A;  4LNQ A;  2YV5 A;  4DR4 L;  3S16 H;  1EIF A;  3HOX G;  4DAY B;  1YNX A;  4X64 Q;  1FGU A;  4BY1 H;  3DLL A;  1TWH H;  5HY6 A;  3CPW A;  3STB C;  4IOC A;  1M90 C;  1B8A A;  1EUJ A;  2CWA A;  4MNO A;  4UP9 A;  5M3M G;  1SR3 A;  4BXX H;  1VQP A;  4A3B H;  4GKK L;  4GLV B;  4X62 L;  2CCZ A;  1SRU A;  3BZK A;  3T1H L;  3UDF A;  5IE8 A;  1XJV A;  4A93 H;  3LGJ A;  2JA5 G;  2F4V L;  3F2B A;  2UU9 L;  1VS0 A;  4JI4 Q;  2JA7 H;  3S1Q H;  3CCR A;  1TWF H;  3I55 A;  3M3Y H;  2VY3 A;  1YBY A;  4DR3 Q;  1E7Z A;  3A74 A;  2EIF A;  1EIY B;  2K50 A;  4IPG A;  3S24 A;  1LYL A;  1NTG A;  1KRT A;  3PUZ A;  5GAG C;  1QVC A;  2ID0 A;  1S3O A;  4PZ7 A;  3RN2 A;  1PV4 A;  4DUY L;  4GNX A;  2ZTC A;  1E22 A;  4DV7 L;  2LXJ A;  2MFI A;  4OXP A;  4DK6 C;  3RNU A;  2KHI A;  4A3E G;  4PZ6 A;  2Q2U A;  1UE1 A;  1HZ9 A;  3HOZ H;  1XNQ L;  2PNH A;  2JA6 G;  1GKH A;  3L0O A;  1WYD A;  4YHH L;  4DR2 L;  2PQA A;  2K52 A;  4POF A;  1VQO A;  2E2H H;  1Z47 A;  2VZA A;  3IRB A;  3KJO A;  2BH8 A;  3GD7 A;  1HNZ L;  1VQK A;  4QL5 A;  2HHH L;  2MNA A;  3GTP H;  5M3F G;  1JMC A;  3J7A 5;  5EAY A;  3RN5 A;  2NVY H;  4LF7 Q;  3M4Q A;  1QVG A;  1HR0 Q;  1K83 H;  2N78 A;  3HOV G;  2EQS A;  1IBM L;  2Z6K A;  4P74 A;  3FP9 A;  4LF8 Q;  3AYH B;  1JJG A;  4LWC A;  2PMZ E;  5LMN W;  3PSI A;  2IT1 A;  4YCV A;  1K9M C;  4UP8 A;  1BBU A;  4P75 A;  4QGU A;  2HIV A;  1VQM A;  4O0A A;  4JI7 Q;  2GN5 A;  2JQO A;  4X65 L;  1YIJ A;  1HNX L;  4C2M H;  4BBR G;  4A3F H;  1Q81 C;  1EYG A;  1VQE A;  3PUX A;  5FJ8 H;  4GN4 B;  4GOP C;  3F1Z A;  4YCU A;  4YWL A;  4DR1 L;  2UUC Q;  2VUM H;  3PO3 H;  1D8L A;  3PF4 A;  4DV2 L;  1G29 1;  2IHE A;  1SE8 A;  1XMQ Q;  2OTJ A;  1VQJ A;  5IYC G;  2RF4 A;  4JI8 Q;  1WFQ A;  4A3I G;  4A76 A;  1KRS A;  4YY3 Q;  3KYH C;  4C3H H;  2OCE A;  2VQE Q;  3AFQ A;  1VQA A;  4IPH A;  4A4I A;  1WJJ A;  1VQD A;  4A3J G;  3HOW G;  5JEA G;  2UXD L;  1N32 L;  3MEF A;  3ULP A;  3M4P A;  4GLA C;  4RMF A;  2AWO A;  4R4C A;  1BKB A;  2BA1 A;  2ZM6 L;  3TRZ A;  1DGS A;  4ME3 A;  3NEM A;  4DV6 Q;  5AJ3 L;  4GLX A;  2OWO A;  2K14 A;  4JBM A;  2YTY A;  2VNU D;  2AHO B;  1K3R A;  1K0R A;  4IPC A;  1L1O A;  4UP7 A;  3A5U A;  4DR6 Q;  4JV5 Q;  4WJ4 A;  4DKA C;  1N33 Q;  2FXQ A;  2R7Z G;  4P71 A;  4PZ8 A;  1QZG A;  1VQI A;  2VQF Q;  1EQR A;  2JA8 H;  3HOY H;  2QA4 A;  5LMU L;  3L2P A;  3CXC A;  1HR0 W;  2UXB Q;  3CC7 A;  1QUQ B;  3GTK H;  1IBK L;  1N34 Q;  4DPG A;  1XMO Q;  3AFP A;  2E5L L;  1NY4 A;  4KLK A;  2E8G A;  3E9H A;  4XIG S;  3K80 C;  2YTX A;  1Q7Y C;  5C44 G;  2Q2I A;  4GOP B;  1IBL Q;  2UXC Q;  3CME A;  2I5M X;  3K0X A;  1T9H A;  3T1Y Q;  1M1K C;  5IP9 G;  2F52 A;  4NXM Q;  2E2I H;  3JC6 6;  3J7Z C;  2NVT H;  4JI5 Q;  4B3S Q;  2E2J H;  4A3G G;  4GN5 A;  5BR8 L;  5IYD H;  4LFB L;  3F2C A;  1UE7 A;  4YCW A;  4AQY L;  2VL6 A;  1Y1W H;  3Q8D A;  2KEN A;  3I2Z A;  4JBJ A;  4DR2 Q;  4JI6 Q;  4GN3 B;  1P16 A;  1HH2 P;  1TWA H;  4A3L G;  2UUA Q;  4DR4 Q;  4OWX B;  2JA9 A;  4JBW A;  3OTO Q;  1HNW L;  2GVB A;  1B70 B;  2NVX H;  4B3R Q;  1WCM H;  1Q8K A;  2UUB L;  4HIM A;  1PA6 A;  3W5O A;  3CCQ A;  4IFD G;  4IFD I;  2I5H A;  1KHI A;  5M5X H;  5C4X H;  4OX9 Q;  1I6H H;  2WFW A;  3HFZ B;  3K7U C;  1PH9 A;  2JK8 A;  2R7F A;  3J80 i;  4B3M L;  2XGT A;  1PFS A;  3U58 A;  3BZC A;  1XTD A;  3K81 C;  1VQ9 A;  4IFD J;  1KQS A;  4BBS H;  2NVQ H;  1X55 A;  3GTM H;  2A19 A;  3KF6 A;  4JC0 A;  3S17 H;  3A5Z B;  5LMN Q;  2JEB I;  3M9B A;  2B63 G;  3EN2 A;  4AIM A;  1Y1V G;  3S2H H;  4GKJ L;  1VQH A;  2ZTE A;  1KXL A;  4X64 L;  3S1N H;  3TS0 A;  1PH6 A;  1EWI A;  1X54 A;  3KOJ A;  3AQQ A;  4LW1 A;  4AH6 A;  3RLO A;  4B3T L;  1Q12 A;  4LF4 Q;  4LF9 Q;  3I4N G;  4DR7 L;  1XNR Q;  4R1J A;  1P8L A;  1HZB A;  3UDI A;  1OXT A;  3NEN A;  1Q1E A;  3PUY A;  2MQH A;  4QQB X;  1YEZ A;  3H3V H;  4DV5 L;  4R4I A;  3T1H Q;  4JI4 L;  1CUK A;  3GTL H;  4NXN Q;  4KHP Q;  5IT9 c;  1LTL A;  3ICE A;  4BXX G;  4IO9 A;  2KBN A;  4JBK A;  5C3E G;  4DV3 Q;  4DR3 L;  4DR5 L;  1CKN A;  3D31 A;  2NZO A;  3UDG A;  2I5L X;  4DV0 Q;  5JJL A;  2PI2 E;  3HOU G;  2JA7 G;  3W1G A;  1B7Y B;  3I4M H;  3PCO B;  1YZ6 A;  1NE3 A;  3CCJ A;  1PYB A;  2N49 A;  4QY7 A;  3G4S A;  4R4T A;  1I94 Q;  4LF6 Q;  5C0X J;  1GM5 A;  4DUY Q;  1VQB A;  1SFO H;  2H5X A;  5M3F H;  1PH5 A;  3H3V I;  1LM0 A;  2K75 A;  1V43 A;  3PV0 A;  4JI1 Q;  2F3I A;  2K4K A;  3NEL A;  5GAE C;  3M7N A;  4POG A;  3CCM A;  1XNQ Q;  2DUD A;  1X9N A;  3CC2 A;  3U4V A;  3HOV H;  1O7I A;  4JOI A;  4K0K L;  3K8A A;  3KDF B;  1UE5 A;  3ER0 A;  4X66 Q;  4JI3 L;  1YJ9 A;  2HHH Q;  4LF7 L;  3J80 c;  4GNX C;  4LFC Q;  3HOZ G;  2R7D A;  3I56 A;  2JJQ A;  2CFM A;  3F2D A;  4LF8 L;  4BBR H;  4TQU S;  4JI0 L;  2C35 B;  4WJ3 M;  3RLN A;  4FDB A;  4X6A H;  4JI7 L;  3F8T A;  2KCM A;  1N36 Q;  3KF8 B;  5IP7 H;  1PH4 A;  2Z0S A;  4A3I H;  4A3C H;  3CQZ H;  1J5E L;  2R93 H;  1QZH A;  1X3E A;  1XMQ L;  3HOW H;  2R92 H;  4C3I H;  3AEV A;  4DR1 Q;  2MO0 A;  2Z6K C;  4DV2 Q;  3PO2 G;  1IXR A;  1J6Q A;  3CF5 A;  4A3K H;  4LF5 L;  4A3F G;  1GVP A;  1IYJ B;  2VQE L;  1KL9 A;  5FJ8 G;  5JJI A;  4OON A;  4HJ7 A;  1KC8 C;  1EFW A;  5IYB H;  2VUM G;  2VS1 A;  3PO3 G;  2B29 A;  1L2F A;  2UXD Q;  4HIK A;  1IZ6 A;  4NB3 A;  4DUZ Q;  1XPR A;  4DV6 L;  1OXV A;  3FKI H;  2IX1 A;  4DV1 Q;  3UDX A;  1C0A A;  1E1O A;  1OXX K;  3VDY A;  3CP0 A;  4DR6 L;  4GNX B;  3CW2 C;  5M5Y H;  1AE2 A;  1U5K A;  4LUV A;  1N33 L;  4JI2 Q;  1MIU A;  1I3Q H;  2VQF L;  3NBH B;  2WP8 J;  5FLM H;  1XPU A;  2DGY A;  1XPO A;  4IPD A;  5C44 H;  3B6Y A;  2WB1 G;  1MKH A;  1I50 H;  1K8G A;  2A1A A;  2RHQ B;  4AYB G;  5C0X I;  4JYA Q;  1N8R C;  4BY7 G;  3BU2 A;  4A3G H;  1X3F A;  1RL2 A;  1W2B A;  1IBL L;  1VQ8 A;  4DV4 Q;  2UXC L;  3T1Y L;  1VQF A;  1PH8 A;  2JA8 G;  1PH3 A;  3HOY G;  3S14 H;  4NXM L;  1TXY A;  5ELO A;  1X6O A;  3OYY A;  1H95 A;  3S2D H;  1BBW A;  2YYZ A;  1KAW A;  3CPF A;  4B3S L;  1SN8 A;  1YJW A;  4LFA L;  1IL2 A;  1SLJ A;  3ULL A;  1FJG Q;  2A8V A;  4A3L H;  4NPS A;  3HKZ G;  2N8N A;  3CMA A;  2V1C C;  3I7F A;  5IWA L;  2QEX A;  2ATW A;  3L7Z C;  4DK3 C;  4LFB Q;  3H15 A;  4AQY Q;  2KCT A;  3TRE A;  4A3M H;  3OTO L;  2UUA L;  5K36 G;  1VQ7 A;  4B3R L;  2Q2H A;  3CCS A;  4PMW A;  5IYD G;  3J81 i;  1HNW Q;  3DM3 A;  5GRO A;  2JE6 I;  5DLQ E;  1L0W A;  1QVF A;  4A3D H;  3G48 A;  2NN6 I;  1VCI A;  1Y14 B;  2HIX A;  4OX9 L;  3HOX H;  1PVO A;  1VQ5 A;  2CWP A;  1W3S A;  1E24 A;  1JB7 A;  2ES2 A;  1V1Q A;  2D0O A;  5IY0 A;  3KDF A;  5M3M H;  3MXN B;  1NJI C;  3S1M H;  5J3B A;  2Y0S G;  2B63 H;  2K5N A;  1KD1 C;  1GO3 E;  4OWT B;  3KLW A;  4LUZ A;  2JA5 H;  2CQO A;  3H0G G;  1ASZ A;  1CSQ A;  4L5T A;  5LMN L;  5ELN A;  1E3P A;  2IY5 B;  4GKK Q;  4GKJ Q;  2B3G A;  4L5R C;  4X62 Q;  4P72 A;  4BY1 G;  4LF4 L;  4BBS G;  4LF9 L;  2LSS A;  1S72 A;  1X65 A;  2QGQ A;  4OWW B;  4BA2 I;  1XNR L;  2F4V Q;  4BA1 I;  1KIX A;  2UU9 Q;  1NMF A;  4A3B G;  4B3T Q;  4O2D A;  4DR7 Q;  5C3E H;  2D62 A;  1K73 C;  2OTL A;  4KHP L;  4A93 G;  3JAM i;  4KI0 A;  1AE3 A;  4NXN L;  5JEA J;  3PGZ A;  1VQ6 A;  1FL0 A;  1U0L A;  4EX5 A;  4A3E H;  3W1B A;  4DV5 Q;  2BH2 A;  4MZ9 A;  1Q82 C;  4DV3 L;  1UWV A;  2JA6 H;  3HOU H;  1RIP A;  3GTG H;  3RR5 A;  3M85 A;  4DV0 L;  2JEA I;  3G6E A;  4DR5 Q;  4JG2 A;  4DV7 Q;  2ALY B;  1PH7 A;  5GQO A;  2AWN A;  1CSP A;  2BA0 A;  1VQL A;  1K8A C;  2GVA A;  3EIV A;  2WB1 E;  1I94 L;  4LF6 L;  2NZH A;  4EQ5 A;  1YHA A;  4YHH Q;  2XTI A;  1QUQ A;  3D0F A;  3TQY A;  4AYB E;  2AKW B;  5GAH C;  4A75 A;  1BVS A;  1HNZ Q;  2OQK A;  1G6P A;  4GS3 A;  1A62 A;  3RZO H;  3J81 c;  4JI1 L;  1S40 A;  3CCL A;  3I4M G;  1HR0 L;  4GOP A;  4HJ5 A;  1JJ2 A;  3HKS A;  2YU9 H;  5HGQ A;  1UEB A;  4X66 L;  3S15 H;  4HID A;  4YWK A;  1WOC A;  3ZJY C;  3KJP A;  3HKZ E;  4ALP A;  5H1S E;  1IBM Q;  4LFC L;  4K0K Q;  1NBW A;  1V9P A;  2I0Q A;  2EXD A;  4JI3 Q;  2WAQ G;  2MO1 A;  2AMC B;  3CAM A;  5M5W H;  1MJE A;  3A0J A;  4PG3 A;  5IYC H;  2ASB A;  3GTQ H;  3KF6 B;  2ZJQ A;  3CCU A;  4X65 Q;  2UUC L;  1HNX Q;  3OW2 A;  5JJK A;  1FVI A;  2IHF A;  4RG1 A;  4A3J H;  4JI8 L;  4JOI C;  4JI0 Q;  2D0P A;  2RCN A;  1GD7 A;  1N36 L;  4IOA A;  3ULJ A;  3PIP A;  4L5S A;  3TS2 A;  4YY3 L;  3BJU A;  3EBE A;  3GTJ H;  3PO2 H; 
#chains in the Genus database with same CATH topology
 1SRO A;  3K57 A;  4OHJ A;  4IN3 A;  1ROD A;  1A8V A;  3A56 A;  3OWE B;  1PRT D;  3D4D A;  3RLF A;  3WWV A;  5IP7 G;  1PXU A;  2EJF C;  1LUZ A;  2I07 B;  2R7Z H;  1RF2 D;  1HZC A;  2K03 A;  2KA7 A;  5AJ3 Q;  1OTC A;  4DNI A;  3C1E A;  4CDC C;  3HOZ B;  1PYS B;  3I4O A;  4UHV A;  4ZKB B;  1D5Z C;  1SYD A;  4CJ1 B;  4OGQ C;  3V96 A;  2HT1 A;  1PRT C;  1LTR D;  1XMO L;  2MUY A;  3C1F A;  3NHH A;  4IJH A;  1K83 B;  1NAP A;  4BY7 H;  3T56 B;  2L5T A;  1HJP A;  4JYA L;  2VW9 A;  3G71 A;  1ZXT A;  5JVG 3;  1EQT A;  1X3G A;  1EOT A;  2Q8T A;  5BR8 Q;  4C2M B;  3PIO A;  1HUN A;  3S1R B;  3VR2 A;  1JWU D;  2EE1 A;  1TWC H;  3PO3 B;  4XTC S;  3GTO H;  2F0O A;  2NTS A;  4HJ8 A;  3CC4 A;  3WOF A;  1VQG A;  1YIT A;  4C3H B;  5I6W A;  1D1I A;  2NN6 G;  1Y1W G;  5IWA Q;  2AQ3 B;  3GO5 A;  3NTH A;  1WI5 A;  2ZXR A;  1VQN A;  2NB0 A;  4FF3 A;  1SYE A;  5C4Z A;  1X56 A;  1WTX A;  1H9S B;  4HED A;  1NMG A;  4NW2 A;  2YTV A;  1JJC B;  3H91 A;  4QJF A;  4QB4 A;  1Z9F A;  3MTS A;  5DM6 3;  2F0S A;  1CTM A;  1EOV A;  5ELD A;  3E9I A;  1Y69 U;  3ERS X;  1G91 A;  2CH4 W;  1YI2 A;  1B1Z A;  1A3V A;  2F0V A;  4A3D G;  3EA6 A;  4R8N A;  3GTK B;  2AUK A;  4DAY B;  3BS1 A;  3DEP A;  4WOR A;  1FGU A;  4BXX H;  2D2C C;  4GKK L;  3UDF A;  3I91 A;  4A93 H;  2E2I B;  3FPU B;  3LGJ A;  4HR7 B;  3F2B A;  2NVT B;  5K5P A;  2UU9 L;  3CKI B;  2E2J B;  2F0Q A;  4R9W A;  2VY3 A;  4CGY B;  3J7Y W;  4DR3 Q;  1K28 A;  3A74 A;  2EIF A;  3S24 A;  1TWA B;  1NTG A;  1CFM A;  1LT4 D;  2Z1C A;  1WCM B;  4PZ7 A;  1JWM D;  4G4K A;  1A2T A;  4PMB A;  3KUP A;  1HXY D;  4FYD A;  2LXJ A;  5A2Q E;  3NBH A;  2B2T C;  2ZXP A;  1LT3 D;  1LT5 D;  3QR8 A;  2JA6 G;  1GKH A;  3HOU G;  2K52 A;  5I4D A;  3KJO A;  2BH8 A;  3GD7 A;  3SK4 A;  1DZ1 A;  2NVQ B;  2EY5 A;  1H9M A;  3S17 B;  4DN4 M;  3RN5 A;  3KBX A;  4K2K A;  1JQY D;  1ICW A;  2IT1 A;  4YCV A;  4Z9C B;  4UP8 A;  4IUT A;  5LHY 1;  1F9P A;  1JIC A;  3PUX A;  2JN4 A;  1KAB A;  3F1Z A;  1NR2 A;  4YCU A;  4GOP C;  3W3A A;  3A8J E;  5EQ0 A;  2OTJ A;  1SE8 A;  1VQJ A;  1LV9 A;  1EYA A;  1RD9 D;  4A76 A;  1KRS A;  3SVM A;  3KYH C;  4EVO A;  3AFQ A;  4KY6 A;  2XRS D;  1TS5 A;  1WJJ A;  3HOW G;  1T5E A;  1ZEQ X;  2SEB D;  2AWO A;  1H9S A;  2ZM6 L;  1GUS A;  3TRZ A;  3NEM A;  4DV6 Q;  4CDD C;  5G3L D;  4WJ4 A;  4JV5 Q;  1F2L A;  1N33 Q;  2KJX A;  3MA2 B;  4DAY A;  1S5B D;  4HAE A;  1EL0 A;  3HS0 C;  4DF7 A;  1IBK L;  2G5D A;  1N34 Q;  4DPG A;  1TU2 B;  2YTX A;  1Q7Y C;  2UXC Q;  2Q2I A;  2QEJ C;  3JAM E;  4GOP B;  1IBL Q;  3K0X A;  5CGK A;  3FEW X;  1M1K C;  3EQL C;  2F52 A;  3PIP 3;  1Z6H A;  3IKJ A;  3NE5 B;  5FO9 B;  3J7Z C;  5A2Q L;  1QCB D;  4K5V A;  4JI6 Q;  4GN3 B;  1HH2 P;  2EJG C;  3OTO Q;  2JA9 A;  4JBW A;  2K33 A;  1GUN A;  1RDP D;  3DXJ C;  1WVL A;  1PA6 A;  2KCC A;  4IFD G;  4DNT B;  2WFW A;  3HZX A;  1PH9 A;  1H9K A;  2JK8 A;  2K5D A;  2R7F A;  4KKS A;  3J80 i;  4B3M L;  1E2V A;  1VQ9 A;  5KNC A;  4BBS H;  4ZKC B;  1LAB A;  2A19 A;  1LT6 D;  2K5W A;  2Z8L A;  3AB9 A;  2B63 G;  4ZQ3 A;  2JEB I;  3M9B A;  4RCO A;  1O80 A;  2ICI A;  1VQH A;  4X64 L;  4LW1 A;  3I4N G;  4DR7 L;  4R1J A;  1P8L A;  1HZB A;  1OXT A;  3PUY A;  3H3V H;  3I73 A;  4R4I A;  3T1H Q;  4KHP Q;  1CUK A;  4N8F A;  1O7Y A;  2KUM A;  3CRL C;  2KBN A;  1JR0 D;  1SNO A;  2I5L X;  1I6H B;  3VA7 A;  3W1G A;  1B7Y B;  5EGT A;  2KED A;  2N49 A;  3G4S A;  2ICE C;  1RTO A;  3TP5 A;  4A3D B;  1Y8P B;  4ZUJ A;  3ZYY X;  1SFO H;  2H5X A;  4TSS A;  5M3F H;  1LM0 A;  3DM1 A;  3PV0 A;  4JI1 Q;  3A7L A;  1TY0 A;  3CCM A;  3JAM L;  3SE0 A;  3TZD A;  4X66 Q;  1YJ9 A;  1H9J A;  3J80 c;  4GNX C;  4U67 3;  1K0S A;  1DD2 A;  2K28 A;  4TQU S;  4X6A H;  3F2U A;  4IUP A;  4XQJ A;  1EY5 A;  1G2S A;  3KF8 B;  1N36 Q;  3R8B A;  1VMC A;  3DWA A;  4A3C H;  3CQZ H;  2CVR A;  5ELC A;  4WFN 3;  1S5D D;  1XMQ L;  5JEA H;  4YIJ A;  2JA6 B;  3HOU B;  2MO0 A;  4DV2 Q;  3PO2 G;  1J6Q A;  4A3F G;  1GVP A;  1IYJ B;  3T51 B;  1KL9 A;  2VQE L;  1EFW A;  4HJ7 A;  2CHB D;  2B29 A;  4EGV A;  2UXD Q;  3FKI H;  4O42 A;  2IX1 A;  1U9R A;  3NUC A;  4GNX B;  4K14 A;  5M5Y H;  1U5K A;  2WKD A;  1XYI A;  3DWQ A;  3HEJ A;  1TT2 A;  5C44 H;  1F2Z A;  2WB1 G;  4I65 A;  2F0F A;  1I50 H;  1U4R A;  4JYA Q;  1RL2 A;  1FD7 D;  3T1Y L;  2JA8 G;  3HOY G;  1PH3 A;  1E0B A;  4WRD A;  4NXM L;  3OYY A;  3LX0 A;  4B3S L;  2JXM B;  1YJW A;  4X3S A;  3CMA A;  3TME A;  5IWA L;  4C3J B;  3RZD B;  5LL6 X;  3TRE A;  5K36 G;  1VQ7 A;  2R3Z A;  2OT2 A;  2NWG A;  1BUV T;  4PMW A;  5IYD G;  5DAU A;  3J81 i;  1F9Q A;  1EIH A;  3VA5 A;  3VYS A;  1QVF A;  2HCC A;  1VCI A;  1Y14 B;  4OX9 L;  3K7A B;  2CWP A;  1E24 A;  2ES2 A;  2SDF A;  1V1Q A;  4F7X A;  5IY0 A;  2DJG C;  5M3M H;  3S1M H;  4RKB A;  2EVB A;  1JOK A;  1HA6 A;  1GO3 E;  1ZKO A;  5J39 A;  2IPK D;  2FJ2 A;  2CQO A;  3H0G G;  4F87 A;  3PIO 3;  2JP1 A;  1M8A A;  3I4L A;  4GKK Q;  4GKJ Q;  3DMU A;  4LF9 L;  2LSS A;  1S72 A;  2SOB A;  3KF8 A;  3SK6 A;  1XNR L;  4JPB W;  2UU9 Q;  4KJN A;  1NMF A;  4A3B G;  2D62 A;  2NYZ D;  2EYF A;  3PGZ A;  1SNC A;  3QWN A;  4DV5 Q;  2BH2 A;  4MZ9 A;  4XXE A;  3LWU A;  1UWV A;  2EXZ A;  4S3S A;  3M85 A;  2VB2 X;  3PMF A;  2JEA I;  3G6E A;  1EQV A;  4DR5 Q;  3CU7 A;  4JG2 A;  4KHV A;  4TRD A;  2ALY B;  3H3V C;  1CK1 A;  4Y7N B;  1CSP A;  3D6W A;  2EY2 A;  2GVA A;  2F0K A;  2WB1 E;  5DNF A;  1S5C D;  4LF6 L;  1WTO A;  2E75 C;  3TQY A;  2K01 A;  1SYG A;  3RZO H;  3J81 c;  2N88 A;  1S40 A;  5IGD A;  3I4N B;  1F77 A;  2YU9 H;  1KLU D;  1TVX A;  2KHS A;  4LFC L;  4BY1 B;  4K0K Q;  1NBW A;  1V9P A;  1H9R A;  2WAQ G;  1CM9 A;  2A6E D;  2AMC B;  2CH4 A;  5IYC H;  2F0G A;  1BCP F;  3R93 A;  2F0L A;  1Q90 A;  3OOC A;  4RWS C;  3OWF A;  3K58 A;  4CDE C;  4A3J H;  2Z6B A;  1II3 A;  4FP5 D;  3PIP A;  3M3Y B;  4L5S A;  3TS2 A;  2MGS A;  4GZY C;  1ILP A;  3VYT A;  2K5H A;  2A6E C;  1MJC A;  3S1R H;  4DAV A;  2XWB B;  3L9A X;  1J5E Q;  2BCO A;  3R2I A;  3PUV A;  1C48 A;  1EY0 A;  4R4Q A;  1C8C A;  1L0Y B;  1HFN A;  4C3H G;  1OO9 B;  2RHS B;  5CV4 A;  2ZM6 Q;  1JWS D;  2X6L A;  1TWG H;  2HQE A;  2R93 G;  4JV5 L;  1CKN B;  2RCF A;  2XRQ D;  2R92 G;  4DUZ L;  1G51 A;  4ZRZ A;  3SHL A;  1D5X C;  2E2H B;  4HJA A;  4A3K G;  2B2U A;  4ZUI A;  3GTP B;  1C9O A;  3CCV A;  5IYB G;  1N34 L;  3M4Y A;  1EIG A;  1SMY D;  4JI2 L;  1D7Q A;  5C4J H;  4OIJ A;  4NDX A;  1IBK Q;  2ZT9 C;  2K5V A;  2WII B;  1PHJ A;  2G9D A;  5COR A;  3QG1 A;  1YHB A;  2F4I A;  2RA4 A;  4L5Q A;  1V8Q A;  2CKZ B;  2LY7 A;  2K5Q A;  1RCV D;  2J0T D;  4J15 A;  2SNS A;  1SMY C;  1MSH A;  5CV6 A;  4A3F B;  2L15 A;  4JI6 L;  2HQL A;  4APV A;  5ELE A;  2KHJ A;  1LTB D;  4B9W A;  4QF4 A;  3MAQ A;  1LLR D;  1U4L A;  2F03 A;  1WCM G;  1X3Q A;  4Q0F A;  4IJL A;  4LUO A;  5GAD C;  1PH1 A;  4B3M Q;  2WAQ E;  1Y1V H;  3LWE A;  2Z9H A;  2WB1 B;  3KFU A;  1GUG A;  4K5W A;  2ZJP A;  2XNA C;  1ASY A;  3UE0 A;  1KDC A;  1EQQ A;  1ZYR D;  2B2V C;  2K05 A;  4H7B A;  1PZI D;  3OMC A;  2JA8 B;  3HOY B;  1CA5 A;  4LNQ A;  2YV5 A;  2J7Z A;  4FXD A;  2IW3 A;  1K3B C;  1EIF A;  3NBI A;  4X64 Q;  3DLL A;  1AZP A;  1B8A A;  1EUJ A;  1QOH A;  1MI2 A;  3L3O C;  2O5I C;  4X62 L;  2KEC A;  1SRU A;  3BZK A;  2CCZ A;  3T1H L;  4UDU C;  1XJV A;  3BDO A;  1QIL A;  2A74 C;  1D1K A;  5IOD A;  1VS0 A;  3S1Q H;  1HTL D;  1TWF H;  2F0U A;  3VR4 A;  1B50 A;  1EIY B;  1LYL A;  1BR9 A;  1S3O A;  3QOL A;  2ZTC A;  4IUR A;  3QB3 A;  2MFI A;  2H4O A;  3RNU A;  5C4X B;  2DN8 A;  4N9P A;  4A3E G;  5EPK A;  4K5X A;  4CDF C;  5EBD A;  4DR2 L;  3E3X A;  1VQO A;  1PTO H;  2VZA A;  2M00 A;  4DK0 A;  5D3I B;  2NVY H;  3M4Q A;  1SDF A;  1HR0 Q;  3S2H B;  1B3Q A;  3WOE A;  1STY A;  5D3D A;  1IBM L;  3FP9 A;  2PMZ E;  5KRU A;  1FNV A;  4G7Z C;  4QGU A;  3SXH A;  3ITP A;  1HNX L;  1EYG A;  4B08 A;  5FJ8 H;  2VUM H;  4DV2 L;  2IHE A;  1XMQ Q;  2F0T A;  5DEH A;  1WFQ A;  4A3I G;  4FF2 A;  1PTO F;  3IFD A;  5IGG A;  2VQE Q;  1VQA A;  2UXD L;  1EYC A;  1N32 L;  1F9S A;  3M4P A;  4RMF A;  4ME3 A;  2RDF A;  4GLX A;  2OWO A;  4JBM A;  2VNU D;  4UP7 A;  1K0R A;  2WAQ B;  1XXG A;  2QDL A;  2R7Z G;  1QZG A;  3HOV B;  4L63 B;  3D4R A;  5LMU L;  3L2P A;  1HR0 W;  1NUC A;  2UXB Q;  1BOS A;  3SEB A;  1QUQ B;  1RTN A;  1JOO A;  3AFP A;  2E5L L;  3VYR A;  4XIG S;  1B44 D;  4BBR B;  1F2Y A;  1QE6 A;  3T1Y Q;  3DEO A;  4NXM Q;  1DXM A;  1LO5 D;  1XTC D;  4B3S Q;  4JI5 Q;  4DK1 A;  2QW7 A;  4YCW A;  1Y1W H;  2R93 B;  3I2Z A;  1P16 A;  4A3L G;  2R92 B;  1BDO A;  1B70 B;  2NVX H;  4A3K B;  3T4A C;  4MN3 A;  5KEE A;  1PRT B;  1EY9 A;  1WD1 A;  3SR1 A;  5C5M A;  2B2V A;  5M5X H;  3MXP A;  1STG A;  4OX9 Q;  1I6H H;  3HFZ B;  4LJZ C;  4K6D A;  3BZC A;  5FK9 C;  4PQX A;  4NKL A;  1ET9 A;  3GTM H;  2NTT A;  3KF6 A;  3A55 A;  3A7A B;  4GKJ L;  1Q8I A;  4ZAI A;  1JB3 A;  5D14 A;  1E2W A;  3QO2 A;  4DNR B;  3TS0 A;  3S1N H;  1EWI A;  3KOJ A;  3AQQ A;  2F0J A;  4LF9 Q;  3RLO A;  4A3G B;  1TS2 A;  2L1B A;  2PMZ B;  3DHQ A;  1UUP A;  1XNR Q;  2A73 B;  1Q1E A;  3AU7 A;  4DV5 L;  3GTL H;  3MC0 B;  4BXX G;  3P20 A;  1A2U A;  4JBK A;  1AFP A;  5EBC A;  4DR5 L;  4L8J A;  2NZO A;  3UDG A;  3GV3 A;  2XWJ B;  3BYT B;  2HD3 A;  2PI2 E;  4KN4 C;  1I4R A;  3I4M H;  3PCO B;  1QWY A;  4LF6 Q;  5C0X J;  4DUY Q;  1PH5 A;  2K75 A;  1V43 A;  5KNB A;  5C4H A;  1SEB D;  2K4K A;  3S9W A;  5GAE C;  2B2W A;  2DUD A;  1EZ8 A;  1X9N A;  1TII D;  4KD4 A;  4K0K L;  1LTT D;  1UE5 A;  3KDF B;  2PZT A;  2K32 A;  3KLS A;  4LF7 L;  4LFC Q;  5CBE E;  4OL7 A;  4DU9 A;  2JJQ A;  3ERQ A;  2CFM A;  3F2D A;  2QDB A;  4G7O C;  2C35 B;  3RLN A;  4FDB A;  1SXT A;  3FVQ A;  4JI7 L;  1W6J A;  4RFB A;  3TBI B;  3GP7 A;  3IFT A;  5C3E B;  5LL6 S;  2Z0S A;  4EQO A;  1SYF A;  1J5E L;  2BOS A;  4A3E B;  1QZH A;  3HOW H;  1IKL A;  4C3I H;  3AEV A;  4DR1 Q;  2Z6K C;  5E4W C;  1SE4 A;  5CMD A;  4FO2 A;  3GTG B;  4C3J G;  4I7Z C;  5JJI A;  2WAC A;  3GQB A;  1KC8 C;  2VS1 A;  1EY4 A;  1ENF A;  1FNW A;  1AN8 A;  4JW0 A;  4HIK A;  1IZ6 A;  4DUZ Q;  4ZYS A;  1XPR A;  4OO1 H;  5CBA E;  1E1O A;  3KK7 A;  4RGT A;  4IUN A;  3CP0 A;  3CW2 C;  3NP8 A;  1AE2 A;  1GUT A;  4JI2 Q;  1I4G A;  2CQA A;  3MVV A;  1I3Q H;  2L0C A;  5FLM H;  3S15 B;  4DXF A;  4MHE A;  5HGT A;  3B6Y A;  1MKH A;  4CHT B;  1K8G A;  2RHQ B;  1Z7T A;  4DFA A;  3BU2 A;  4A3I B;  1X3F A;  1W2B A;  1VQF A;  1PH8 A;  1MSG A;  3S14 H;  1TXY A;  1B2T A;  4F8M A;  3S2D H;  2YYZ A;  1J9O A;  2D5D A;  3ULL A;  2EYJ A;  4NPS A;  3GTJ B;  2V1C C;  3I7F A;  1ILQ A;  2QEX A;  2ATW A;  4LFB Q;  4NMZ A;  4A3M H;  2KCT A;  3C46 A;  4O1N A;  2Q2H A;  1RJT A;  1A3T A;  3TP8 A;  2R7Z B;  5GRO A;  3RD4 A;  2FMC A;  2NN6 I;  1PVO A;  3HOX H;  2HDL A;  1STE A;  1W3S A;  1JB7 A;  1MBY A;  1JCK B;  5M9O A;  2D0O A;  3KDF A;  1NJI C;  2B63 H;  4ABN A;  4IQZ A;  4CJ2 C;  3R2T A;  3P75 A;  2EDG A;  3NPP A;  2JA5 H;  3NK9 A;  4BY7 B;  2EY6 A;  1CSQ A;  5FLX E;  3A54 A;  3I72 A;  5ELN A;  5JVH 3;  4G7H C;  3MXU A;  3NTK A;  4BWG B;  2B3G A;  4X62 Q;  1EEF D;  5C3W A;  4BY1 G;  4BBS G;  2F0E A;  2QGQ A;  2WKC A;  4BA2 I;  1LTA D;  1STN A;  4PV1 C;  4B3T Q;  3X3M A;  4IUV A;  2B2T A;  1SNQ A;  3JAM i;  1AE3 A;  1TWC B;  3IL8 A;  4NXN L;  3N52 A;  1U0L A;  3ND9 A;  3W1B A;  3GTO B;  2J4X A;  2K6A A;  1EU4 A;  3LNN A;  2MHV A;  1IKM A;  1PH7 A;  5GQO A;  2AWN A;  2AUJ D;  5JOB A;  1G2T A;  4DR2 Q;  3E0J A;  2XTI A;  2AKW B;  4ZCK A;  5GAH C;  4A75 A;  2KEE A;  5NUC A;  4KV6 A;  1G6P A;  3OW7 A;  3CCL A;  1HR0 L;  2C5C A;  4GOP A;  4HJ5 A;  2F3V A;  1UEB A;  1BO0 A;  5FO8 B;  3ZJY C;  3C2P A;  1IBM Q;  4XYO A;  1KDA A;  1CA6 A;  4JI3 Q;  2MO1 A;  3CAM A;  5M5W H;  1MJE A;  4HMJ A;  3GTQ H;  3NXW A;  4TKO B;  2ZJQ A;  3CCU A;  1HNX Q;  4A93 B;  2LKV A;  1FVI A;  2IHF A;  3I8Z A;  4RG1 A;  2E2D C;  5C3X A;  4JOI C;  4JI0 Q;  2RCN A;  2TMP A;  3ULJ A;  1HRJ A;  1AP0 A;  3BDL A;  3PO2 H;  2QF7 A;  2CW0 D;  3PF5 A;  1E1T A;  1PH2 A;  4RKL A;  3D8G A;  3PUW A;  3IAY A;  4YWM A;  2PI2 A;  1N32 Q;  2N3S A;  4TVA B;  4R4O A;  3JAM c;  4A3C G;  4H13 C;  1IYU A;  3MZ5 A;  1UAP A;  2F3W A;  4LF5 Q;  2SNM A;  5FLX L;  2CW0 C;  1Q1B A;  1OXU A;  2XSC A;  4X3T A;  4DV1 L;  1NR4 A;  1JE5 A;  2UXB L;  4Y52 H;  1PFB A;  5C0X G;  1VQ4 A;  5IP9 H;  5LMU Q;  1X3P A;  1YHQ A;  1PLF A;  4DXG A;  3OPO A;  3FKI G;  2E5L Q;  1L1O C;  1UE6 A;  4OO1 I;  1L0X B;  1KDB A;  4JI5 L;  2KCN A;  1DOM A;  4MTN A;  4CKE A;  4DV4 L;  1CKO A;  1PYW D;  3TZU A;  3CCE A;  5K36 H;  1ENC A;  3MWY W;  5IGE A;  3M4O H;  4KHZ A;  3KLR A;  1A0I A;  1BNZ A;  1SYB A;  1LAC A;  3SGI A;  1FYC A;  1TS3 A;  2F0P A;  5IGC A;  3J81 j;  1YJN A;  2LS0 1;  3GDE A;  4ZLT F;  5FLX c;  3FHW A;  1EWC A;  3GV6 A;  3FRP B;  2PPB C;  3V05 A;  5C4X G;  1A63 A;  1TR5 A;  1CKM A;  3H0G H;  1HA5 A;  4G57 A;  1R9T H;  1Q86 C;  1L1O B;  1IHZ A;  1JT8 A;  1HZA A;  1EU3 A;  2K7V A;  3S16 H;  1QNU A;  1LTI D;  2L12 A;  2RQX A;  1TWH H;  5HY6 A;  3CPW A;  1S5E D;  4IOC A;  1M90 C;  4UP9 A;  5M3M G;  3MHB A;  1SR3 A;  4C56 C;  4A3B H;  4GLV B;  4MTK A;  4LMQ D;  5BN4 A;  5IE8 A;  1HPC A;  1UNS A;  1KTK A;  3NTI A;  2RKS A;  2JA7 H;  3I55 A;  1SNM A;  1Y8N B;  3C3L A;  2K50 A;  4IPG A;  5EPJ A;  3QJY A;  1KRT A;  5GAG C;  2ID0 A;  4RHR A;  4DUY L;  2IJ0 A;  4GNX A;  4OXP A;  2JSO A;  1J8I A;  4PZ6 A;  5I9O A;  3A8I E;  1DM0 B;  4KK7 A;  3HOZ H;  3BG3 A;  2XVS A;  4YHH L;  4MIU A;  3FMC A;  1M4V A;  1Z47 A;  3IRB A;  5KYL A;  2MNA A;  3VYU A;  1JMC A;  4BBS B;  5EAY A;  3N6R A;  4LF7 Q;  1QVG A;  3Q22 A;  1FGB D;  5J1Z A;  3PQI A;  1K83 H;  3HOV G;  3BVG A;  4FXG C;  1HHV A;  4P74 A;  2KQ3 A;  3AYH B;  1JJG A;  5EKK A;  1ONL A;  2M2L A;  3PSI A;  5LMN W;  1IW7 D;  2HIV A;  4JI7 Q;  4C2M H;  4BBR G;  1Q81 C;  3K5O A;  1VQE A;  4DR1 L;  2UUC Q;  4KKT A;  3PO3 H;  2KOL A;  2RSO A;  3G7L A;  2RF4 A;  4JI8 Q;  5IYC G;  2EYL A;  5CR3 A;  5EKI A;  4YY3 Q;  4C3H H;  1IW7 C;  2DY8 A;  4A4I A;  4IPH A;  4A3J G;  3WDN A;  1LTG D;  3MEF A;  3ULP A;  1BKB A;  1B9M A;  4JK1 C;  2PYK A;  5DM7 3;  1SFO B;  2K14 A;  5M3F B;  4NP5 A;  2YTY A;  3RMH A;  3CHB D;  1NCV A;  4HCE A;  4IPC A;  1L1O A;  3A5U A;  2FXQ A;  4V0B A;  4P71 A;  2PQE A;  1YNJ D;  1VQI A;  1ET6 A;  1FR3 A;  3CC7 A;  3GTK H;  3OIQ A;  1I4P A;  1NY4 A;  4KLK A;  2E8G A;  3E9H A;  1B3A A;  3CME A;  2H1E A;  1F2M A;  4QUC A;  3J7A V;  2E2I H;  1YNJ C;  2E76 C;  2EPB A;  2NVT H;  2E2J H;  4A3G G;  2N55 A;  3ERO A;  4LFB L;  3F2C A;  1UE7 A;  1HUM A;  1PRT F;  3CQZ B;  2KEN A;  1GOZ A;  1SJE D;  1TWA H;  2O2L D;  3G6J B;  5AFW A;  3URY A;  1WCM H;  2UUB L;  4HIM A;  2JYO A;  3E5S A;  4ULL A;  3W5O A;  5IIF A;  3CCQ A;  2OXP A;  3H94 A;  3K7U C;  1EY7 A;  3SK8 A;  3FKI B;  4K8I A;  2XGT A;  1PFS A;  4IUQ A;  1XTD A;  1I4Q A;  2NUC A;  5E1F A;  5M5Y B;  5ISR A;  1UEA B;  3BVZ A;  2NVQ H;  4JC0 A;  3S17 H;  5CV9 A;  3A5Z B;  2I46 A;  1Y1V G;  5C44 B;  2ZTE A;  3P7J A;  4FVM A;  1I50 B;  1ZYR C;  3TP7 A;  4J6H A;  1TY2 A;  4DR4 Q;  1X54 A;  4AH6 A;  4RAU C;  2EYM A;  1Q12 A;  2L4N A;  4B3T L;  3Q23 A;  2X69 A;  3UDI A;  1MGS A;  3NEN A;  2MQH A;  4QQB X;  1YEZ A;  1S5F D;  4JI4 L;  4NXN Q;  3ICE A;  1BCP D;  4IO9 A;  2A5H A;  3ONA B;  5C3E G;  1IYV A;  1CKN A;  3MFG A;  4XT3 B;  5L37 A;  5JJL A;  2KVM A;  1U4M A;  3SDZ A;  4KY5 A;  4R4T A;  3KBG A;  1BCP C;  2Z4H A;  4U68 A;  5M3M B;  3S1M B;  4POG A;  1XNQ Q;  3CC2 A;  1O7I A;  2A69 D;  2X6G A;  5KYI A;  1WTW A;  2QCP X;  4JI3 L;  2HHH Q;  1O7Z A;  2BDN A;  2EY1 A;  1JC7 A;  2R7D A;  1A15 A;  3R3O A;  3VR5 A;  4HSP A;  4LF8 L;  1JOQ A;  2FIN B;  4XYQ A;  1PFM A;  2L11 A;  4JI0 L;  2F0I A;  4WJ3 M;  4X3U A;  1EEI D;  2A69 C;  1CZG A;  5CV8 A;  5IP7 H;  4R8I A;  1PH4 A;  4L6T B;  4A3I H;  1A3U A;  2FHT A;  4X3K A;  3A8K E;  2EYO A;  1X3E A;  2QIL A;  1PDQ A;  1CQF A;  2WIN B;  1IXR A;  3CF5 A;  1BCP B;  4LF5 L;  5FJ8 G;  4RHS A;  4OON A;  2VUM G;  4HSV A;  1EFI D;  3Q6S A;  1BF4 A;  4ZK9 B;  3BYY B;  1OXV A;  4DV1 Q;  3BZD B;  1EY6 A;  1RKN A;  4DR6 L;  3RZO B;  4LUV A;  3DWP A;  1MHW C;  4DA2 A;  2YU9 B;  1EY8 A;  2VQF L;  3NBH B;  2WP8 J;  5JAV A;  1XPO A;  1PFN A;  3MXG A;  4IPD A;  2BDO A;  2FFK B;  3M7G A;  2ZXO A;  3EFX D;  4AYB G;  4RH6 A;  4BY7 G;  4XT1 B;  1VQ8 A;  4DV4 Q;  2NN6 H;  3QOJ A;  1TKW B;  1X6O A;  2DJF C;  4I7A A;  4A3J B;  3TN2 A;  2A8V A;  4A3L H;  5IGF A;  1DOK A;  3HKZ G;  4KKU A;  2L55 A;  1U4P A;  3L7Z C;  3H15 A;  4AQY Q;  2UUA L;  5IOC A;  1KLG D;  4B3R L;  1BQQ T;  1KNE A;  3CCS A;  3D6C A;  5G3L F;  1HNW Q;  2JE6 I;  1SJH D;  3OHX C;  1TWG B;  4A3D H;  1QG7 A;  1VQ5 A;  1SBB B;  4K8J A;  4HN7 A;  2PO4 A;  3MXN B;  2Y0S G;  4N9T A;  3K59 A;  2K5N A;  3MFY A;  4OWT B;  3KLW A;  4LUZ A;  1GUO A;  2AQ1 B;  5C4J B;  5LMN L;  2MP1 A;  5J22 A;  1E3P A;  1D6E C;  4LF4 L;  3MEH A;  1STH A;  1HFG A;  1VMP A;  1HQM C;  1K73 C;  2EJM A;  2OTL A;  4A93 G;  5JEA J;  2HCI A;  1VQ6 A;  1FL0 A;  4EX5 A;  1CZW A;  4DV3 L;  2JA6 H;  3HOU H;  1RIP A;  4B9X A;  2F0H A;  3RR5 A;  4DV0 L;  2OF1 A;  2BE5 D;  4P2C B;  4N8X 1;  2HDM A;  1PTO D;  2BA0 A;  5JPM C;  1K8A C;  3EIV A;  1HCZ A;  1I94 L;  2NZH A;  4EQ5 A;  4YHH Q;  1Y1V B;  1QUQ A;  4AYB E;  4C1N K;  2RBM A;  3HG9 A;  1BVS A;  1EZ6 A;  2OQK A;  4GS3 A;  1A62 A;  3I4M G;  4CKC A;  2BE5 C;  1CQV A;  1JJ2 A;  3HKS A;  1PTO C;  3KJP A;  1WOC A;  4ALP A;  3HKZ E;  5H1S E;  2EXD A;  3K0Y A;  5I2X A;  3A0J A;  4PG3 A;  1WD0 A;  1STA A;  1CHP D;  4ILW A;  2UUC L;  5JJK A;  3OW2 A;  1VDZ A;  5D65 A;  3S1Q B;  4JI8 L;  1ENA A;  1TWF B;  2D0P A;  1BXT A;  1R4Q B;  4YY3 L;  3BJU A;  2LMC B;  1TQO A;  4UPA A;  4C3J H;  4JCV E;  1SMX A;  3BDC A;  3RZD H;  4CBV A;  1C7Y A;  4XDX A;  2Y0S E;  4H02 A;  3J80 E;  2E74 C;  3TP6 A;  1VQC A;  5I6Y A;  1WTP A;  1QJO A;  2HUG A;  3FDT A;  4F88 A;  1XWE A;  3U50 C;  3TEH B;  2F1M A;  4RA8 A;  1TS4 A;  3K7A H;  1GJX A;  4C3I G;  1WTR A;  1LTS D;  2LXK A;  3MXN A;  2M9V A;  4M1U B;  1K8O A;  1PTO B;  1ESF A;  1T5X D;  1YVC A;  4HJ9 A;  5E7N A;  2PQA B;  1G6Z A;  5ELF A;  1I5F A;  2F0N A;  2ZTD A;  1N9W A;  2NVY B;  5BN3 A;  4P73 A;  2PZW A;  2EOT A;  4OO1 G;  3U4Z A;  2R6G A;  4K2L A;  1WTQ A;  1PMR A;  5CV7 A;  4DAM A;  5BN5 A;  4H0L C;  2IL8 A;  5FLM G;  3K5M A;  4IFD H;  2TSS A;  2VUM B;  2OQ0 A;  1FJG L;  1I6V C;  2B2Y C;  4RCN A;  4UY8 C;  1AH9 A;  4LFA Q;  3UE1 A;  3E6Z X;  2Q2T A;  3Q24 A;  1Q46 A;  2UUB Q;  3HGB A;  4KTA A;  2P5Z X;  4Y7N H;  2ZJR A;  3CD6 A;  1OXS C;  2IX0 A;  2OEO A;  3STB D;  4A3M G;  1PZJ D;  4HIO A;  2F0D A;  3E0E A;  4AYB B;  4QIW E;  3I4N H;  1O78 A;  2PW5 A;  4DR4 L;  3HOX G;  2C9O A;  3NWS A;  1YNX A;  4BY1 H;  3STB C;  3HKZ B;  1JOR A;  2CWA A;  4MNO A;  2L9H A;  1VQP A;  2VB3 X;  2DY7 A;  2JA5 G;  3J80 L;  2F4V L;  4JI4 Q;  3OSO A;  3CCR A;  5ELB A;  3M3Y H;  5JPN C;  4FXK C;  1YBY A;  1XX8 A;  1Y1W B;  1E7Z A;  3EJI A;  1DCZ A;  1G8Z D;  2FMM A;  2NVX B;  3PUZ A;  3RN2 A;  1QVC A;  1PV4 A;  3CRK C;  2Y0S B;  1PZK D;  1STB A;  1E22 A;  3OMG A;  4DV7 L;  2PW7 A;  4HMI A;  4DK6 C;  2KHI A;  5M5X B;  4CJ0 B;  1UE1 A;  4CKB A;  2Q2U A;  1HZ9 A;  5IT9 E;  1XNQ L;  2PNH A;  3HP3 A;  3L0O A;  1WYD A;  2PQA A;  4POF A;  3H6M A;  2E2H H;  1QNK A;  1HNZ L;  1VQK A;  2HHH L;  3J7A 5;  4QL5 A;  2F0W A;  5M3F G;  3GTP H;  3GTM B;  1MD2 D;  4IAL A;  2N78 A;  2EQS A;  1GHJ A;  1WTV A;  2QKI C;  1I4H A;  2RVL A;  2Z6K A;  3S1N B;  4LF8 Q;  1S4Z A;  4LWC A;  1SSO A;  3OIP A;  1GUW A;  1K9M C;  5EJW A;  1BBU A;  4P75 A;  1VQM A;  2ENB A;  4O0A A;  3UI2 A;  2GN5 A;  1DOL A;  2JQO A;  4X65 L;  1YIJ A;  3QIA A;  3HRZ C;  4A3F H;  4BS9 A;  1SE2 A;  4GN4 B;  3GTL B;  4YWL A;  1D8L A;  4KMU C;  3V2T A;  3PF4 A;  1G29 1;  3T16 A;  3I70 A;  3J81 E;  4J8Q A;  4WJW A;  2OCE A;  1Y8O B;  2LFN A;  3TDQ A;  3Q0A A;  4FF1 A;  1VQD A;  3D3R A;  5JEA G;  3I4M B;  5EKL A;  4EQP A;  4GLA C;  4R4C A;  2BA1 A;  5CC4 A;  1ML0 D;  1DGS A;  5AJ3 L;  3X3N A;  4IUU A;  2GA4 B;  4H44 C;  4UAI A;  5C0X H;  2AHO B;  1K3R A;  4DR6 Q;  3I3C A;  4DKA C;  1WTH A;  4PZ8 A;  4QIW B;  2VQF Q;  1EQR A;  2JA8 H;  3HOY H;  1EWH A;  4C1N I;  2QA4 A;  3CXC A;  5I2Y A;  2Z4I A;  1XMO Q;  1D2B A;  4OIK A;  3BVM A;  1VF7 A;  4EQN A;  3K80 C;  5C44 G;  2B2Y A;  2I5M X;  3K5L A;  1T9H A;  5IP9 G;  2B2U C;  5CV5 A;  1B53 A;  3JC6 6;  1D5M C;  1Q3L A;  4GN5 A;  1HQR D;  5BR8 L;  5IYD H;  3AMU A;  1ICF B;  1CHQ D;  4LK1 C;  4AQY L;  2VL6 A;  3Q8D A;  4JBJ A;  2PNR C;  5TSS A;  3HOW B;  5IT9 L;  4C3I B;  2UUA Q;  5C5L A;  4OWX B;  1HNW L;  2GVB A;  5FOB B;  4B3R Q;  1Q8K A;  1F9R A;  4M8A A;  1RHP A;  1V1O A;  1VF5 C;  4FNF A;  4IFD I;  1C4Q A;  2I5H A;  1KHI A;  5C4X H;  5F2D A;  4ME5 A;  3U58 A;  2RDH A;  3K81 C;  4IFD J;  2EYH A;  1YNN D;  3KLS X;  1KQS A;  5E3F A;  1X55 A;  1ESR A;  5KND A;  2VXW A;  1I3Q B;  5LMN Q;  3S2H H;  3EN2 A;  4AIM A;  1KXL A;  4KY7 A;  2EZV A;  3J81 L;  1PH6 A;  4LF4 Q;  4LAA A;  2IX3 A;  1YNN C;  3S14 B;  3TSS A;  5COY A;  2K1B A;  3S2D B;  5IT9 c;  1LTL A;  4KD3 A;  4JVZ A;  5HUR A;  4DV3 Q;  4DR3 L;  3D31 A;  4A3M B;  3W2D A;  4DV0 Q;  3VR6 A;  2JA7 G;  1YZ6 A;  3FPP A;  1NE3 A;  3CCJ A;  3U9S A;  1PYB A;  4QY7 A;  1QB5 D;  1I94 Q;  1GM5 A;  1VQB A;  1BBX C;  3HOX B;  4RGN A;  1SYC A;  3H3V I;  1A6X A;  3J7A F;  2F3I A;  3NEL A;  5KIX A;  3M7N A;  4RGO S;  2B63 B;  1CI3 M;  3U4V A;  3HOV H;  4JOI A;  3K8A A;  3ER0 A;  5T1I A;  2B39 A;  2JA5 B;  3HOZ G;  2WV6 D;  2A6H D;  3I56 A;  2XN9 C;  3NSW A;  4DAP A;  2RDG A;  5FO7 B;  1B9N A;  4BBR H;  2RSN A;  1KNA A;  3F8T A;  2KCM A;  3I90 A;  4V19 0;  2A6H C;  2R93 H;  2R92 H;  5JJZ A;  1SND A;  4A3K H;  2O5J C;  5IYB H;  3EVQ A;  3PO3 G;  4QMG A;  1L2F A;  2K04 A;  4NB3 A;  4DV6 L;  1W6K A;  1C0A A;  3UDX A;  1OXX K;  3VDY A;  5EPL A;  1N33 L;  1V1P B;  1MIU A;  1AZQ A;  1AW7 A;  1XPU A;  2DGY A;  2DNE A;  3RUZ A;  4OEL B;  2B8F A;  2A1A A;  2V4D A;  1EYD A;  2F0M A;  5C0X I;  5M5W B;  2MJ8 A;  1N8R C;  4HTH A;  5T1G A;  5C6A A;  3NQI A;  3GTQ B;  4A3G H;  2UXC L;  1IBL L;  5FKA C;  4PNY A;  1GXD C;  5ELO A;  1H95 A;  4IZ8 A;  1BBW A;  3CPF A;  1KAW A;  1SN8 A;  4LFA L;  1IL2 A;  1SLJ A;  1FJG Q;  1AEX A;  2N8N A;  3PO2 B;  4DK3 C;  4ODG A;  2EYP A;  4DGZ A;  3OTO L;  3P1H A;  3SK5 A;  4KJO A;  1SAP A;  3DM3 A;  4Q5V A;  1L0W A;  5DLQ E;  2DNC A;  1DON A;  2XIW A;  3G48 A;  2HIX A;  2B8G A;  1R4P B;  1DYQ A;  2A68 D;  5A35 A;  4J1M A;  5J3B A;  1O7L A;  1KD1 C;  1SNP A;  4K6L A;  5I9P A;  2R61 A;  1ASZ A;  1CT1 D;  4L5T A;  2IY5 B;  2A68 C;  4QCL A;  1SE3 A;  4ID6 A;  4L5R C;  4P72 A;  1X65 A;  4OWW B;  2IWH A;  2F4V Q;  4BA1 I;  1KIX A;  1KAA A;  4O2D A;  1K8M A;  4DR7 Q;  5C3E H;  1I4X A;  2Q8I B;  3ND8 A;  4KHP L;  4KI0 A;  2NZ1 D;  1X32 A;  4A3E H;  1Q82 C;  3M4O B;  4XQN A;  3NQT A;  3GTG H;  4OEM B;  3U9O A;  3D4W A;  1JE4 A;  3DUZ A;  4DV7 Q;  2MPM A;  3VR3 A;  1IL8 A;  5KGU A;  1VQL A;  3O13 A;  1B4O A;  1YHA A;  3D0F A;  4RGM A;  5CYU A;  1V1P A;  1HNZ Q;  4XQQ A;  2D9U A;  4PMC A;  2AQ2 B;  4JI1 L;  3H0G B;  1NSN S;  1R9T B;  2G9H D;  5E4X A;  1DJR D;  1HTP A;  1NNX A;  5HGQ A;  2PZU A;  4X66 L;  3S15 H;  4KN7 C;  3K5N A;  1GHK A;  4HID A;  4YWK A;  3S16 B;  4FF4 A;  3K6O A;  4HCS A;  3NWT A;  2I0Q A;  1TWH B;  1E2Z A;  2Q8R E;  4E6I A;  3T13 A;  2O4X A;  4A3B B;  2ASB A;  3KF6 B;  1FNU A;  2NBF A;  2PCF B;  4X65 Q;  3T53 B;  5IGB A;  2B2W C;  2JA7 B;  4IOA A;  1N36 L;  1GD7 A;  3H09 A;  4QUF A;  3EBE A;  3GTJ H; 
#chains in the Genus database with same CATH homology
 1SRO A;  4UPA A;  2K5H A;  3PF5 A;  4C3J H;  1E1T A;  4JCV E;  1PH2 A;  1MJC A;  3PUW A;  1SMX A;  3RZD H;  4YWM A;  3S1R H;  1J5E Q;  1C7Y A;  1A8V A;  2Y0S E;  3PUV A;  4H02 A;  2PI2 A;  4R4Q A;  1VQC A;  3RLF A;  3WWV A;  5IP7 G;  2N3S A;  4TVA B;  1N32 Q;  1LUZ A;  2R7Z H;  4R4O A;  3JAM c;  4A3C G;  2RHS B;  2ZM6 Q;  1HZC A;  3U50 C;  3TEH B;  1TWG H;  2R93 G;  5AJ3 Q;  4LF5 Q;  4JV5 L;  1OTC A;  1CKN B;  4DNI A;  3K7A H;  1PYS B;  3I4O A;  2R92 G;  4DUZ L;  2LXK A;  1G51 A;  1Q1B A;  1OXU A;  4DV1 L;  4HJA A;  4A3K G;  1YVC A;  4HJ9 A;  1JE5 A;  2UXB L;  5E7N A;  2HT1 A;  1C9O A;  2PQA B;  3CCV A;  4Y52 H;  5IYB G;  1I5F A;  5C0X G;  1XMO L;  1N34 L;  1VQ4 A;  5IP9 H;  5LMU Q;  4JI2 L;  2ZTD A;  1N9W A;  5C4J H;  1D7Q A;  1YHQ A;  4P73 A;  1IBK Q;  4IJH A;  4BY7 H;  2K5V A;  3FKI G;  2E5L Q;  3U4Z A;  4OO1 G;  1L1O C;  1UE6 A;  2R6G A;  1PHJ A;  4OO1 I;  1HJP A;  1YHB A;  4DAM A;  4JYA L;  4JI5 L;  4L5Q A;  2VW9 A;  3G71 A;  2CKZ B;  1X3G A;  4J15 A;  4DV4 L;  4MTN A;  5FLM G;  5BR8 Q;  3PIO A;  1CKO A;  2L15 A;  4JI6 L;  2HQL A;  4APV A;  1TWC H;  2OQ0 A;  3CCE A;  1FJG L;  4XTC S;  2KHJ A;  4UY8 C;  3CC4 A;  4HJ8 A;  3GTO H;  1AH9 A;  4LFA Q;  3UE1 A;  1VQG A;  3M4O H;  2Q2T A;  1YIT A;  1Y1W G;  2NN6 G;  1Q46 A;  4KHZ A;  2UUB Q;  1A0I A;  5IWA Q;  3GO5 A;  3J81 j;  3SGI A;  1YJN A;  4Y7N H;  3GDE A;  5FLX c;  1WI5 A;  1VQN A;  2ZJR A;  1WCM G;  5GAD C;  4IJL A;  4LUO A;  3CD6 A;  1OXS C;  1PH1 A;  4B3M Q;  3FHW A;  2IX0 A;  2WAQ E;  1X56 A;  1Y1V H;  3STB D;  1NMG A;  4A3M G;  3KFU A;  2YTV A;  1A63 A;  1JJC B;  5C4X G;  4HIO A;  1CKM A;  3E0E A;  1Z9F A;  4QJF A;  2ZJP A;  4QIW E;  1ASY A;  1EOV A;  3H0G H;  3E9I A;  3I4N H;  3UE0 A;  1EQQ A;  1R9T H;  1Q86 C;  1L1O B;  3ERS X;  1JT8 A;  1YI2 A;  4A3D G;  1HZA A;  4LNQ A;  2YV5 A;  4DR4 L;  3S16 H;  1EIF A;  3HOX G;  4DAY B;  1YNX A;  4X64 Q;  1FGU A;  4BY1 H;  3DLL A;  1TWH H;  5HY6 A;  3CPW A;  3STB C;  4IOC A;  1M90 C;  1B8A A;  1EUJ A;  2CWA A;  4MNO A;  4UP9 A;  5M3M G;  1SR3 A;  4BXX H;  1VQP A;  4A3B H;  4GKK L;  4GLV B;  4X62 L;  2CCZ A;  1SRU A;  3BZK A;  3T1H L;  3UDF A;  5IE8 A;  1XJV A;  4A93 H;  3LGJ A;  2JA5 G;  2F4V L;  3F2B A;  2UU9 L;  1VS0 A;  4JI4 Q;  2JA7 H;  3S1Q H;  3CCR A;  1TWF H;  3I55 A;  3M3Y H;  2VY3 A;  1YBY A;  4DR3 Q;  1E7Z A;  3A74 A;  2EIF A;  1EIY B;  2K50 A;  4IPG A;  3S24 A;  1LYL A;  1NTG A;  1KRT A;  3PUZ A;  5GAG C;  1QVC A;  2ID0 A;  1S3O A;  4PZ7 A;  3RN2 A;  1PV4 A;  4DUY L;  4GNX A;  2ZTC A;  1E22 A;  4DV7 L;  2LXJ A;  2MFI A;  4OXP A;  4DK6 C;  3RNU A;  2KHI A;  4A3E G;  4PZ6 A;  2Q2U A;  1UE1 A;  1HZ9 A;  3HOZ H;  1XNQ L;  2PNH A;  2JA6 G;  1GKH A;  3L0O A;  1WYD A;  4YHH L;  4DR2 L;  2PQA A;  2K52 A;  4POF A;  1VQO A;  2E2H H;  1Z47 A;  2VZA A;  3IRB A;  3KJO A;  2BH8 A;  3GD7 A;  1HNZ L;  1VQK A;  4QL5 A;  2HHH L;  2MNA A;  3GTP H;  5M3F G;  1JMC A;  3J7A 5;  5EAY A;  3RN5 A;  2NVY H;  4LF7 Q;  3M4Q A;  1QVG A;  1HR0 Q;  1K83 H;  2N78 A;  3HOV G;  2EQS A;  1IBM L;  2Z6K A;  4P74 A;  3FP9 A;  4LF8 Q;  3AYH B;  1JJG A;  4LWC A;  2PMZ E;  5LMN W;  3PSI A;  2IT1 A;  4YCV A;  1K9M C;  4UP8 A;  1BBU A;  4P75 A;  4QGU A;  2HIV A;  1VQM A;  4O0A A;  4JI7 Q;  2GN5 A;  2JQO A;  4X65 L;  1YIJ A;  1HNX L;  4C2M H;  4BBR G;  4A3F H;  1Q81 C;  1EYG A;  1VQE A;  3PUX A;  5FJ8 H;  4GN4 B;  4GOP C;  3F1Z A;  4YCU A;  4YWL A;  4DR1 L;  2UUC Q;  2VUM H;  3PO3 H;  1D8L A;  3PF4 A;  4DV2 L;  1G29 1;  2IHE A;  1SE8 A;  1XMQ Q;  2OTJ A;  1VQJ A;  5IYC G;  2RF4 A;  4JI8 Q;  1WFQ A;  4A3I G;  4A76 A;  1KRS A;  4YY3 Q;  3KYH C;  4C3H H;  2OCE A;  2VQE Q;  3AFQ A;  1VQA A;  4IPH A;  4A4I A;  1WJJ A;  1VQD A;  4A3J G;  3HOW G;  5JEA G;  2UXD L;  1N32 L;  3MEF A;  3ULP A;  3M4P A;  4GLA C;  4RMF A;  2AWO A;  4R4C A;  1BKB A;  2BA1 A;  2ZM6 L;  3TRZ A;  1DGS A;  4ME3 A;  3NEM A;  4DV6 Q;  5AJ3 L;  4GLX A;  2OWO A;  2K14 A;  4JBM A;  2YTY A;  2VNU D;  2AHO B;  1K3R A;  1K0R A;  4IPC A;  1L1O A;  4UP7 A;  3A5U A;  4DR6 Q;  4JV5 Q;  4WJ4 A;  4DKA C;  1N33 Q;  2FXQ A;  2R7Z G;  4P71 A;  4PZ8 A;  1QZG A;  1VQI A;  2VQF Q;  1EQR A;  2JA8 H;  3HOY H;  2QA4 A;  5LMU L;  3L2P A;  3CXC A;  1HR0 W;  2UXB Q;  3CC7 A;  1QUQ B;  3GTK H;  1IBK L;  1N34 Q;  4DPG A;  1XMO Q;  3AFP A;  2E5L L;  1NY4 A;  4KLK A;  2E8G A;  3E9H A;  4XIG S;  3K80 C;  2YTX A;  1Q7Y C;  5C44 G;  2Q2I A;  4GOP B;  1IBL Q;  2UXC Q;  3CME A;  2I5M X;  3K0X A;  1T9H A;  3T1Y Q;  1M1K C;  5IP9 G;  2F52 A;  4NXM Q;  2E2I H;  3JC6 6;  3J7Z C;  2NVT H;  4JI5 Q;  4B3S Q;  2E2J H;  4A3G G;  4GN5 A;  5BR8 L;  5IYD H;  4LFB L;  3F2C A;  1UE7 A;  4YCW A;  4AQY L;  2VL6 A;  1Y1W H;  3Q8D A;  2KEN A;  3I2Z A;  4JBJ A;  4DR2 Q;  4JI6 Q;  4GN3 B;  1P16 A;  1HH2 P;  1TWA H;  4A3L G;  2UUA Q;  4DR4 Q;  4OWX B;  2JA9 A;  4JBW A;  3OTO Q;  1HNW L;  2GVB A;  1B70 B;  2NVX H;  4B3R Q;  1WCM H;  1Q8K A;  2UUB L;  4HIM A;  1PA6 A;  3W5O A;  3CCQ A;  4IFD G;  4IFD I;  2I5H A;  1KHI A;  5M5X H;  5C4X H;  4OX9 Q;  1I6H H;  2WFW A;  3HFZ B;  3K7U C;  1PH9 A;  2JK8 A;  2R7F A;  3J80 i;  4B3M L;  2XGT A;  1PFS A;  3U58 A;  3BZC A;  1XTD A;  3K81 C;  1VQ9 A;  4IFD J;  1KQS A;  4BBS H;  2NVQ H;  1X55 A;  3GTM H;  2A19 A;  3KF6 A;  4JC0 A;  3S17 H;  3A5Z B;  5LMN Q;  2JEB I;  3M9B A;  2B63 G;  3EN2 A;  4AIM A;  1Y1V G;  3S2H H;  4GKJ L;  1VQH A;  2ZTE A;  1KXL A;  4X64 L;  3S1N H;  3TS0 A;  1PH6 A;  1EWI A;  1X54 A;  3KOJ A;  3AQQ A;  4LW1 A;  4AH6 A;  3RLO A;  4B3T L;  1Q12 A;  4LF4 Q;  4LF9 Q;  3I4N G;  4DR7 L;  1XNR Q;  4R1J A;  1P8L A;  1HZB A;  3UDI A;  1OXT A;  3NEN A;  1Q1E A;  3PUY A;  2MQH A;  4QQB X;  1YEZ A;  3H3V H;  4DV5 L;  4R4I A;  3T1H Q;  4JI4 L;  1CUK A;  3GTL H;  4NXN Q;  4KHP Q;  5IT9 c;  1LTL A;  3ICE A;  4BXX G;  4IO9 A;  2KBN A;  4JBK A;  5C3E G;  4DV3 Q;  4DR3 L;  4DR5 L;  1CKN A;  3D31 A;  2NZO A;  3UDG A;  2I5L X;  4DV0 Q;  5JJL A;  2PI2 E;  3HOU G;  2JA7 G;  3W1G A;  1B7Y B;  3I4M H;  3PCO B;  1YZ6 A;  1NE3 A;  3CCJ A;  1PYB A;  2N49 A;  4QY7 A;  3G4S A;  4R4T A;  1I94 Q;  4LF6 Q;  5C0X J;  1GM5 A;  4DUY Q;  1VQB A;  1SFO H;  2H5X A;  5M3F H;  1PH5 A;  3H3V I;  1LM0 A;  2K75 A;  1V43 A;  3PV0 A;  4JI1 Q;  2F3I A;  2K4K A;  3NEL A;  5GAE C;  3M7N A;  4POG A;  3CCM A;  1XNQ Q;  2DUD A;  1X9N A;  3CC2 A;  3U4V A;  3HOV H;  1O7I A;  4JOI A;  4K0K L;  3K8A A;  3KDF B;  1UE5 A;  3ER0 A;  4X66 Q;  4JI3 L;  1YJ9 A;  2HHH Q;  4LF7 L;  3J80 c;  4GNX C;  4LFC Q;  3HOZ G;  2R7D A;  3I56 A;  2JJQ A;  2CFM A;  3F2D A;  4LF8 L;  4BBR H;  4TQU S;  4JI0 L;  2C35 B;  4WJ3 M;  3RLN A;  4FDB A;  4X6A H;  4JI7 L;  3F8T A;  2KCM A;  1N36 Q;  3KF8 B;  5IP7 H;  1PH4 A;  2Z0S A;  4A3I H;  4A3C H;  3CQZ H;  1J5E L;  2R93 H;  1QZH A;  1X3E A;  1XMQ L;  3HOW H;  2R92 H;  4C3I H;  3AEV A;  4DR1 Q;  2MO0 A;  2Z6K C;  4DV2 Q;  3PO2 G;  1IXR A;  1J6Q A;  3CF5 A;  4A3K H;  4LF5 L;  4A3F G;  1GVP A;  1IYJ B;  2VQE L;  1KL9 A;  5FJ8 G;  5JJI A;  4OON A;  4HJ7 A;  1KC8 C;  1EFW A;  5IYB H;  2VUM G;  2VS1 A;  3PO3 G;  2B29 A;  1L2F A;  2UXD Q;  4HIK A;  1IZ6 A;  4NB3 A;  4DUZ Q;  1XPR A;  4DV6 L;  1OXV A;  3FKI H;  2IX1 A;  4DV1 Q;  3UDX A;  1C0A A;  1E1O A;  1OXX K;  3VDY A;  3CP0 A;  4DR6 L;  4GNX B;  3CW2 C;  5M5Y H;  1AE2 A;  1U5K A;  4LUV A;  1N33 L;  4JI2 Q;  1MIU A;  1I3Q H;  2VQF L;  3NBH B;  2WP8 J;  5FLM H;  1XPU A;  2DGY A;  1XPO A;  4IPD A;  5C44 H;  3B6Y A;  2WB1 G;  1MKH A;  1I50 H;  1K8G A;  2A1A A;  2RHQ B;  4AYB G;  5C0X I;  4JYA Q;  1N8R C;  4BY7 G;  3BU2 A;  4A3G H;  1X3F A;  1RL2 A;  1W2B A;  1IBL L;  1VQ8 A;  4DV4 Q;  2UXC L;  3T1Y L;  1VQF A;  1PH8 A;  2JA8 G;  1PH3 A;  3HOY G;  3S14 H;  4NXM L;  1TXY A;  5ELO A;  1X6O A;  3OYY A;  1H95 A;  3S2D H;  1BBW A;  2YYZ A;  1KAW A;  3CPF A;  4B3S L;  1SN8 A;  1YJW A;  4LFA L;  1IL2 A;  1SLJ A;  3ULL A;  1FJG Q;  2A8V A;  4A3L H;  4NPS A;  3HKZ G;  2N8N A;  3CMA A;  2V1C C;  3I7F A;  5IWA L;  2QEX A;  2ATW A;  3L7Z C;  4DK3 C;  4LFB Q;  3H15 A;  4AQY Q;  2KCT A;  3TRE A;  4A3M H;  3OTO L;  2UUA L;  5K36 G;  1VQ7 A;  4B3R L;  2Q2H A;  3CCS A;  4PMW A;  5IYD G;  3J81 i;  1HNW Q;  3DM3 A;  5GRO A;  2JE6 I;  5DLQ E;  1L0W A;  1QVF A;  4A3D H;  3G48 A;  2NN6 I;  1VCI A;  1Y14 B;  2HIX A;  4OX9 L;  3HOX H;  1PVO A;  1VQ5 A;  2CWP A;  1W3S A;  1E24 A;  1JB7 A;  2ES2 A;  1V1Q A;  2D0O A;  5IY0 A;  3KDF A;  5M3M H;  3MXN B;  1NJI C;  3S1M H;  5J3B A;  2Y0S G;  2B63 H;  2K5N A;  1KD1 C;  1GO3 E;  4OWT B;  3KLW A;  4LUZ A;  2JA5 H;  2CQO A;  3H0G G;  1ASZ A;  1CSQ A;  4L5T A;  5LMN L;  5ELN A;  1E3P A;  2IY5 B;  4GKK Q;  4GKJ Q;  2B3G A;  4L5R C;  4X62 Q;  4P72 A;  4BY1 G;  4LF4 L;  4BBS G;  4LF9 L;  2LSS A;  1S72 A;  1X65 A;  2QGQ A;  4OWW B;  4BA2 I;  1XNR L;  2F4V Q;  4BA1 I;  1KIX A;  2UU9 Q;  1NMF A;  4A3B G;  4B3T Q;  4O2D A;  4DR7 Q;  5C3E H;  2D62 A;  1K73 C;  2OTL A;  4KHP L;  4A93 G;  3JAM i;  4KI0 A;  1AE3 A;  4NXN L;  5JEA J;  3PGZ A;  1VQ6 A;  1FL0 A;  1U0L A;  4EX5 A;  4A3E H;  3W1B A;  4DV5 Q;  2BH2 A;  4MZ9 A;  1Q82 C;  4DV3 L;  1UWV A;  2JA6 H;  3HOU H;  1RIP A;  3GTG H;  3RR5 A;  3M85 A;  4DV0 L;  2JEA I;  3G6E A;  4DR5 Q;  4JG2 A;  4DV7 Q;  2ALY B;  1PH7 A;  5GQO A;  2AWN A;  1CSP A;  2BA0 A;  1VQL A;  1K8A C;  2GVA A;  3EIV A;  2WB1 E;  1I94 L;  4LF6 L;  2NZH A;  4EQ5 A;  1YHA A;  4YHH Q;  2XTI A;  1QUQ A;  3D0F A;  3TQY A;  4AYB E;  2AKW B;  5GAH C;  4A75 A;  1BVS A;  1HNZ Q;  2OQK A;  1G6P A;  4GS3 A;  1A62 A;  3RZO H;  3J81 c;  4JI1 L;  1S40 A;  3CCL A;  3I4M G;  1HR0 L;  4GOP A;  4HJ5 A;  1JJ2 A;  3HKS A;  2YU9 H;  5HGQ A;  1UEB A;  4X66 L;  3S15 H;  4HID A;  4YWK A;  1WOC A;  3ZJY C;  3KJP A;  3HKZ E;  4ALP A;  5H1S E;  1IBM Q;  4LFC L;  4K0K Q;  1NBW A;  1V9P A;  2I0Q A;  2EXD A;  4JI3 Q;  2WAQ G;  2MO1 A;  2AMC B;  3CAM A;  5M5W H;  1MJE A;  3A0J A;  4PG3 A;  5IYC H;  2ASB A;  3GTQ H;  3KF6 B;  2ZJQ A;  3CCU A;  4X65 Q;  2UUC L;  1HNX Q;  3OW2 A;  5JJK A;  1FVI A;  2IHF A;  4RG1 A;  4A3J H;  4JI8 L;  4JOI C;  4JI0 Q;  2D0P A;  2RCN A;  1GD7 A;  1N36 L;  4IOA A;  3ULJ A;  3PIP A;  4L5S A;  3TS2 A;  4YY3 L;  3BJU A;  3EBE A;  3GTJ H;  3PO2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...