2KCTA

Solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
MATPQDKLHTVRLFGTVAADGLTMLDGAPGVRFRLEDKDNTSKTVWVLYKGAVPDTFKPGVEVIIEGGLAPGEDTFKARTLMTKCPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c-type biogenesis protein CcmE
publication title Solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g.
rcsb
source organism Desulfovibrio vulgaris str. hildenborough
molecule tags Chaperone
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2kctA01
2KENA 4WJ4A 3UDFA 2VQEQ 3RZOH 5M5XH 2OTLA 1PH9A 5C3EG 1X9NA 3EIVA 3TQYA 1C0AA 4PG3A 2B3GA 2WP8J 1PVOA 3KF6B 4YWMA 4YHHL 1JE5A 1PYSB 4IJHA 1S40A 1A0IA 1HH2P 4R1JA 3RNUA 4JYAQ 4TQUS 1E3PA 3OYYA 1G291 1SE8A 3K7AH 4B3TQ 3ULJA 4MNOA 2NZOA 1DGSA 4JI4Q 3CD6A 3I56A 1XNRL 1YITA 3TS2A 1TWFH 1K83H 4X66L 4JI1L 4DR5L 1D8LA 2VL6A 2UXBQ 3GDEA 3ULLA 4LUZA 1I94L 2D62A 4JC0A 1A63A 3WWVA 3HOYH 4C2MH 3BU2A 5IYBH 4DV3L 3T1YQ 4A3IH 1SFOH 3PO3H 3H15A 5H1SE 4IOAA 3KOJA 4MTNA 1VQPA 4B3SL 5FJ8H 4QIWE 4KHZA 1VQAA 3A5UA 1J6QA 1WOCA 1C9OA 4DAMA 2F4VQ 4BY1H 4EQ5A 3HOWG 1N36Q 3HOUG 3CMEA 1JJCB 1VQGA 4POFA 1PYBA 1HZAA 5IYCH 3PUXA 5C0XI 1WCMG 2JA5G 2A8VA 3HOVH 2K5NA 1TWCH 3CCSA 1XPRA 4IFDI 1EQRA 2E5LL 2HHHQ 4JI3L 3H0GH 1NTGA 3AFQA 1SRUA 3CCJA 4DV5L 4JG2A 4ALPA 1HZ9A 1PH4A 1K8GA 4ME3A 1IXRA 1MKHA 1VQFA 3JAMc 2DUDA 1VQ4A 1T9HA 4LF5L 4LFCL 4JCVE 3HOZH 4OWTB 3OW2A 3M85A 3G48A 1YJWA 1GM5A 4XIGS 3CCRA 4A93G 1VQMA 4JBKA 1YBYA 1CSPA 4OX9Q 4B3RL 5IE8A 3HOYG 3TEHB 5GADC 3F1ZA 1FGUA 4LUOA 5IYBG 2R7FA 3PUVA 5C0XG 4HJ8A 1EYGA 1FJGQ 3KYHC 3M4OH 1V43A 3PIPA 5HGQA 5C44G 3I4NG 4DV4L 2JA8H 4R4QA 4IPHA 4A3KH 3L0OA 2Z6KC 3CPWA 1J5EL 4DR4L 4BY1G 4A3MH 1W3SA 1IBKL 2UXCL 5IYDH 3PUYA 3HOVG 1WYDA 3CCEA 3S1RH 5J3BA 4LW1A 4HJ9A 5LMUL 2WAQG 2CCZA 2E2JH 2UU9L 3W1GA 3KFUA 2WB1E 2R7ZH 1Q86C 3GD7A 2A1AA 5M3MH 2PQAB 3E0EA 5IY0A 2VNUD 2PI2E 3CW2C 5ELOA 4X65L 3D0FA 1OTCA 2ZM6Q 1X3EA 4JBJA 5FLMH 1I6HH 2HIXA 2JA6H 1YZ6A 3DLLA 3UDGA 1E7ZA 3G71A 1PHJA 3U4ZA 4QQBX 5EAYA 1LM0A 1YVCA 2RHQB 1EQQA 1M90C 3GTOH 5AJ3L 4BBRG 4DV7L 4A75A 3KF6A 4JI0L 5BR8Q 3ICEA 2VS1A 1TWAH 4DR2Q 3UDXA 1W2BA 1NE3A 2F3IA 4LF6Q 4A3CG 4DNIA 1VQOA 2UXDL 4K0KQ 1VQ7A 5M5WH 2VW9A 3GTMH 1K3RA 1IYJB 4A3MG 4P74A 1M1KC 4JYAL 1X65A 4R4IA 2C35B 1YHBA 4GNXB 4GS3A 4B3TL 1ASZA 5M3MG 4OWWB 4IO9A 5LMNW 4UP7A 4JI4L 2YYZA 3RLNA 2Q2HA 1N9WA 4YCUA 3OTOQ 3AQQA 1Z9FA 2MFIA 2V1CC 4P71A 1XMOQ 2UXBL 1VQCA 2EXDA 3J81i 4L5RC 1JMCA 2CWPA 2UUBQ 2N49A 2EIFA 3T1YL 1HJPA 1Q12A 1BBWA 3PSIA 2K4KA 1N34Q 1D7QA 3HFZB 2ATWA 4X6AH 3M3YH 1QVCA 2F4VL 3NEMA 1VQHA 2RHSB 3J81c 3CCMA 3H3VI 3ERSX 4DV2Q 1N36L 1SMXA 4YWLA 3PUWA 2LXJA 3HOWH 3K81C 3HOUH 3K80C 4OXPA 1P8LA 2HT1A 2JA5H 4OO1I 3KJPA 1E22A 2CQOA 1G51A 1WCMH 4Y7NH 3GTLH 2ZJRA 2HHHL 4IJLA 4JI7Q 2GVAA 4UPAA 4YCWA 3BZCA 5ELNA 2JA7G 3TRZA 1I5FA 3PO2G 1PV4A 4AQYL 2JEAI 4DUZQ 2HQLA 1A62A 4LF4Q 4APVA 4GLXA 4R4CA 3CC4A 4L5TA 5GAGC 2AWNA 1KIXA 2K52A 1HZCA 1EUJA 1WJJA 3B6YA 3CAMA 4KI0A 2E8GA 1YEZA 5C4JH 3J7ZC 2PNHA 1PH3A 1PH8A 1VQLA 2N78A 4OX9L 4A93H 2ASBA 1RL2A 2H5XA 3AFPA 3A5ZB 4DR3Q 1SLJA 1FJGL 4PZ8A 4UP9A 3J80i 1KQSA 4OO1G 1XMQQ 3PF4A 3S15H 3CQZH 4LFAL 5LMNQ 5C44H 4LF7Q 3I4NH 3L2PA 2PQAA 2AHOB 5IT9c 1XNQQ 3GTPH 1K8AC 4PZ6A 2D0OA 1GD7A 1QUQA 1AE3A 1NY4A 4DUYQ 4KLKA 4A3DG 3K7UC 1CKNB 1K9MC 3GTGH 1VQNA 1MJCA 4IOCA 3CMAA 3CC2A 1UEBA 4DR1Q 1PH5A 4JI2Q 2OWOA 1OXVA 4RG1A 4DV0Q 4K0KL 2ZM6L 3LGJA 1IBLQ 1KRTA 4B3MQ 4A3BH 5IP9G 2UUAQ 1XNRQ 3CXCA 1HNXQ 2YTVA 5HY6A 3RN5A 4JI6L 3D31A 3S2DH 2AMCB 2ALYB 4BBRH 1B7YB 1L2FA 1PH6A 4DR2L 3I2ZA 4DR7Q 3EN2A 4LF6L 1B70B 4DKAC 1Q1EA 2KHJA 3CC7A 3VDYA 1E1OA 2JA9A 2WAQE 4GLAC 3SGIA 1HR0W 4A3CH 2NVYH 4A3JG 4DV1Q 1HNWL 1PH2A 4HIKA 2R92G 3PF5A 4GKJL 4XTCS 3UE0A 4DV6Q 4JV5Q 4O2DA 1IZ6A 5GQOA 4NXNQ 4C3JH 1X54A 1WI5A 4AH6A 1UE5A 3HKZG 1X3FA 3M9BA 3RLOA 2VUMH 3OTOL 1GO3E 1OXSC 1VQ6A 1CKOA 2VZAA 2PMZE 1XMOL 1Q8KA 1IBML 4LF9Q 4HJ5A 4A3BG 2IT1A 1PH1A 2VQFQ 1RIPA 2GN5A 2UUBL 5JJKA 4OONA 4QGUA 4DR6Q 2ID0A 4QY7A 4R4OA 4GOPB 1Y1VG 3CP0A 1Q1BA 1N34L 2UUCL 2Q2UA 4DK6C 4IPDA 1OXTA 2D0PA 2MO1A 3K0XA 2R93G 1KRSA 1BKBA 2VQEL 4DV2L 4AIMA 1EWIA 4BA1I 4A76A 1EOVA 1C7YA 2E5LQ 1U0LA 2Y0SG 3A0JA 5JJIA 2MQHA 3STBD 4X62Q 2MNAA 2E2IH 3NENA 3F2BA 4YY3Q 4KHPQ 2R6GA 3STBC 2I0QA 1WFQA 4JI7L 2JJQA 2PI2A 2Q2IA 1K0RA 3FP9A 2IHEA 4LF5Q 3E9IA 1E24A 3PO2H 2BH2A 1TWGH 2JA7H 3W5OA 4LF8Q 2JQOA 4LF4L 2VUMG 2BA0A 4BY7G 1LYLA 1B8AA 1R9TH 3IRBA 2AWOA 1HR0Q 1NMGA 3G6EA 2HIVA 2GVBA 4QJFA 5M5YH 2OTJA 3RN2A 5C4XG 1MJEA 4GN3B 5E7NA 4A3FH 1Y1WH 3F2CA 4DR3L 3A74A 3S1NH 3H3VH 1YJNA 1KAWA 4DR4Q 1U5KA 2LSSA 4P72A 1XMQL 4X64Q 1QZHA 1CKNA 3G4SA 3J81j 3U4VA 4EX5A 2UXCQ 5LMNL 4DPGA 1GKHA 1Z47A 2ES2A 3PGZA 4LF7L 5FLXc 1X3GA 3GTKH 1XNQL 1PA6A 1AE2A 2IHFA 4HJAA 1FVIA 3KJOA 1TXYA 2E2HH 3GTQH 3I4MH 1JJGA 3I7FA 4YCVA 4GOPC 2BA1A 1YI2A 2NN6G 2F52A 4A3DH 3AEVA 4LFBQ 1JT8A 4DR1L 1QVFA 5M3FG 4BXXH 1BVSA 2IX0A 3AYHB 1VQKA 4RMFA 4DAYB 4DV0L 1LUZA 1ASYA 1IBLL 4BBSG 1K73C 1AH9A 3NELA 3TREA 1HZBA 1L1OB 5GAEC 2UUAL 5IWAQ 4FDBA 4AYBG 5AJ3Q 1S72A 1QZGA 5JEAG 4GKKQ 5IP9H 1HNXL 1E1TA 5DLQE 2NVQH 4GNXC 3F2DA 5GROA 1UE7A 2LXKA 4A3FG 1VQIA 1Y1WG 1QVGA 3ULPA 5JJLA 2NZHA 3S16H 2YTYA 1VQ9A 4DR7L 2UXDQ 1VCIA 2JK8A 4J15A 3HOXH 2NVTH 3M4QA 3CF5A 4LUVA 4NXMQ 3ZJYC 4H02A 1VQEA 1CSQA 1N32Q 3Q8DA 4C3HH 4DV1L 4L5SA 3I4MG 2KHIA 3T1HQ 4A3JH 2JE6I 4POGA 1XTDA 2A19A 2R92H 1YHAA 4O0AA 3CCUA 2KCMA 4DV6L 4JV5L 2YV5A 1NBWA 3KDFB 4NXNL 1I50H 3BJUA 2ZJQA 3J80c 1KXLA 2R7DA 1X55A 3CCQA 4A3EH 2WFWA 4JI5Q 2B63H 4JI8Q 3EBEA 4BXXG 2ZTCA 3FHWA 3KLWA 4A3GG 4GOPA 1P16A 1CKMA 4PMWA 3PIOA 2CKZB 4LF9L 3FKIG 2VQFL 1KL9A 2MO0A 4JBWA 1VQ8A 4GN4B 1NMFA 4JBMA 4DR6L 1YIJA 2QA4A 1CUKA 4TVAB 1KHIA 5JEAJ 1UWVA 1HNZQ 3GO5A 1S3OA 3JAMi 1Y1VH 3GTJH 5BR8L 3HOXG 2K75A 1JB7A 1EIFA 2ZTEA 1L1OC 1YHQA 1VQDA 2R93H 4L5QA 4GNXA 4GLVB 4YHHQ 3S24A 1FL0A 1UE6A 4P75A 4X62L 2YTXA 1I3QH 3HKZE 4GN5A 4IPGA 3HKSA 4YY3L 4KHPL 1SROA 3L7ZC 5IP7H 1MIUA 2I5LX 4WJ3M 4AQYQ 2K5VA 2CFMA 4UP8A 4Y52H 4A3EG 3RZDH 2B63G 1N33Q 4LF8L 1YJ9A 2KCTA 4IPCA 4X66Q 4P73A 4JI1Q 1JJ2A 3U58A 4DR5Q 3RR5A 4HIMA 2XTIA 1HR0L 4LNQA 1I94Q 4BY7H 3NBHB 2CWAA 1V9PA 4A3IG 4HIOA 1Q7YC 1EFWA 4YWKA 2Q2TA 4JOIC 3PO3G 2I5HA 5C4XH 4DV3Q 5FJ8G 2EQSA 3PCOB 4A3LH 2I5MX 3JC66 1LTLA 4LFAQ 4B3SQ 4MZ9A 4IFDG 5GAHC 4X64L 2OCEA 2AKWB 1KC8C 1TWHH 2K50A 1H95A 2Y0SE 4NB3A 4C3IH 4QL5A 2BH8A 4LWCA 2N8NA 5IYCG 3J7A5 2JEBI 3UE1A 1OXXK 1VQ5A 3S1QH 3H0GG 4A4IA 3KF8B 2VY3A 1OXUA 4OWXB 4JI3Q 2IX1A 5K36G 4DV5Q 3DM3A 3MXNB 3CCVA 5IP7G 4LFBL 4HJ7A 1L1OA 1EIYB 1QUQB 1SR3A 3MEFA 3HOZG 1VS0A 2RCNA 5M3FH 1IL2A 1A8VA 2WB1G 4LFCQ 2QEXA 1BBUA 3PV0A 1Y14B 4DUZL 4BBSH 2NN6I 4JI6Q 4GKKL 5IWAL 1XJVA 3I4OA 1NJIC 2ZTDA 1V1QA 1Q81C 4B3RQ 2IY5B 3M4PA 3U50C 3F8TA 2DGYA 2Z0SA 1L0WA 5C0XJ 3E9HA 2QGQA 1VQJA 1SN8A 4A3LG 2JA8G 4A3KG 1VQBA 5C3EH 1XPUA 4DV4Q 4IFDJ 3UDIA 1HNWQ 1YNXA 4NPSA 1J5EQ 3S2HH 3KDFA 4NXML 1Q46A 5IYDG 2NVXH 1G6PA 4JOIA 1N32L 4GKJQ 1IBKQ 2XGTA 4R4TA 2L15A 3T1HL 2K14A 4PZ7A 2N3SA 1X56A 4DK3C 3RLFA 1XPOA 1N8RC 2Z6KA 5LMUQ 4HIDA 2UU9Q 3CPFA 2R7ZG 2FXQA 2K5HA 2OQKA 3TS0A 4DUYL 3BZKA 2B29A 4JI5L 4JI8L 4X65Q 3ER0A 2KBNA 5FLMG 1X6OA 4AYBE 1IBMQ 4JI2L 3W1BA 2ZJPA 2YU9H 4UY8C 2JA6G 3S17H 1Q82C 3S14H 3S1MH 1N33L 4A3GH 2OQ0A 1GVPA 3PUZA 3CCLA 4BA2I 1KD1C 3FKIH 4B3ML 1PFSA 2RF4A 2UUCQ 3I55A 1PH7A 4DV7Q 3M7NA 4JI0Q 3K8AA 1HNZL 1UE1A 1O7IA
chains in the Genus database with same CATH superfamily
2KENA 4WJ4A 1CQFA 4YIJA 1D1KA 4PG3A 2B3GA 2A69C 5E3FA 1K28A 4CKEA 1PYSB 4IJHA 4IUNA 3RNUA 4CDCC 1G291 2K05A 3ULJA 4MNOA 4HN7A 4RH6A 2NZOA 1DGSA 3RZDB 5EPLA 3I56A 1YITA 1TWFH 3U9SA 3A54A 2VL6A 4LUZA 1S5FD 1EIGA 2NYZD 5JJZA 3OSOA 2XWBB 4JC0A 4N9PA 3T1YQ 3JAML 3PO3H 5H1SE 4IOAA 4MTNA 3I90A 1G8ZD 1VQAA 1DOKA 1J6QA 3P75A 2F4VQ 4EQ5A 3HOWG 2IPKD 3CMEA 1JJCB 1PYBA 1HZAA 5C0XI 3PUXA 2A8VA 2K5NA 3CU7A 4IFDI 1EY6A 4JI3L 3S9WA 4DV5L 4HMIA 3CCJA 1ENFA 4ALPA 1VQFA 3NTIA 3NWSA 1VQ4A 3IFDA 1T9HA 5M3FB 2L9HA 3EQLC 4TSSA 3G48A 1J9OA 2EJGC 3CCRA 1STEA 5JPNC 1YBYA 4AYBB 4EQNA 3T56B 3PUVA 1QNUA 5C0XG 1EYGA 3NP8A 5IGDA 5HGQA 4X3UA 1YNJD 5C44G 3I4NG 4RFBA 3U9OA 3V2TA 2UXCL 1A3UA 1B4OA 4UAIA 3PUYA 3L3OC 3KFUA 3R93A 2JYOA 1Q86C 4IUTA 1SE2A 2A1AA 4DN4M 4QUFA 3EA6A 5IY0A 1SEBD 5ELOA 2YU9B 1KLGD 2B2WC 3S14B 2EYMA 2RSNA 3G71A 2A68C 3R2TA 3FKIB 2A74C 4M8AA 4FYDA 1LM0A 1M90C 4XDXA 4IUPA 4BBRG 3KF6A 2EOTA 4KMUC 5BR8Q 3RZOB 5FK9C 4DR2Q 4IZ8A 4LF6Q 4ZKCB 1VQ7A 5M5WH 2VW9A 3VR3A 1TIID 4QIWB 4A3MG 1TS4A 4ZYSA 4KJNA 2RSOA 3OWFA 2C35B 1YHBA 4OL7A 5BN5A 5C4HA 2QDBA 4OWWB 3J81L 4IO9A 4UP7A 3RLNA 1Q90A 2Q2HA 4CGYB 3OTOQ 4RA8A 3AQQA 2EXDA 3J81i 5KNBA 1JMCA 2Z6BA 4KKSA 4CHTB 2FINB 4A3IB 2N49A 2EIFA 3T1YL 1BBWA 4XT1B 3PSIA 1D7QA 1PFNA 1AW7A 2ATWA 4X6AH 3M3YH 2F4VL 3NEMA 3ERSX 4DV2Q 2HD3A 1SMXA 4YWLA 1QCBD 1QILA 4OXPA 2JA5H 3KJPA 1TWCB 3H0GB 4RCOA 3AU7A 2KEEA 4KTAA 2GVAA 4UPAA 3PO2G 3BZCA 3TRZA 5M9OA 1B9NA 4DUZQ 4LF4Q 4GLXA 3A7AB 3B6YA 3MVVA 5IGEA 3OWEB 1VQLA 1ICFB 2H5XA 3AFPA 1C48A 2EYHA 1ENAA 3S15H 2H4OA 1FR3A 3KF8A 2RVLA 3L2PA 1RKNA 4RGTA 2CHBD 5IT9c 1NUCA 3GTPH 5J1ZA 3S1RB 4GZYC 1NY4A 2E2JB 1EYCA 4DUYQ 3K7UC 1CKNB 1DJRD 3CMAA 3BYTB 2OWOA 3D8GA 1OXVA 4RG1A 4DV0Q 5KYIA 2Z4HA 2IW3A 4B3MQ 4P2CB 1C4QA 1X3PA 1C8CA 5IP9G 1HUMA 2F0VA 1HNXQ 4KY6A 2AMCB 3BDOA 1K0SA 2XRSD 4DR2L 2MGSA 1B44D 4LF6L 2KHJA 3CC7A 2JA9A 2WAQE 3SGIA 3GTMB 4A3JG 4DV1Q 1PH2A 3PF5A 3IAYA 4XTCS 4DV6Q 4JVZA 5L37A 1IZ6A 5GQOA 3T53B 4NXNQ 5T1IA 1WI5A 1GUNA 1UE5A 3HZXA 1X3FA 3LWEA 3RLOA 1V8QA 3OTOL 1OXSC 4NP5A 1VQ6A 1CKOA 1CK1A 2PMZE 4IUUA 1WTWA 1IBML 4ME5A 4ULLA 2BOSA 5KYLA 1EQTA 1LTSD 2JXMB 4WFN3 2ID0A 4O42A 4IPDA 1S5CD 3K0XA 1KRSA 4DU9A 3FVQA 4DV2L 3T4AC 3HOWB 1EWIA 2L55A 1IHZA 3STBD 3SDZA 3F2BA 2QW7A 4KHPQ 3E5SA 2R6GA 3OIPA 5CV9A 3C1FA 2DJFC 3W3AA 2F3WA 1KNEA 2JA7H 1CTMA 4S3SA 3W5OA 3GQBA 4PMCA 4LF8Q 4LF4L 4BY7G 4G57A 3IRBA 4FXGC 4NDXA 3MXUA 5ELBA 2HIVA 1G6ZA 4QJFA 3QB3A 3RN2A 3F2CA 4LAAA 3S1NH 1B53A 1JOOA 2O5JC 3N52A 4X64Q 3CQZB 5C4ZA 5C44B 3I4NB 1GKHA 1Z47A 5FLXc 1X3GA 3K5OA 1AE2A 2SNMA 2E2HH 1B3AA 2JP1A 3I7FA 4GOPC 3ZYYX 4A3DH 1EY7A 3WDNA 1CI3M 4JW0A 1QVFA 1I4QA 3C46A 1UNSA 2IX0A 3PIO3 1VQKA 4RMFA 4DV0L 1LUZA 2KCNA 2KVMA 1SMYC 3NELA 3TREA 1S72A 1HNXL 5DLQE 3W2DA 4GNXC 1VQIA 3OPOA 4BBRB 4NMZA 3K5NA 2A6ED 5EKLA 2UXDQ 1LV9A 4OIKA 3M4OB 2NVTH 4LUVA 3ZJYC 4HAEA 3K58A 4DV1L 1EY4A 2EY5A 1L0YB 1DYQA 2EJFC 4A3MB 3MWYW 2R92H 4O0AA 4F88A 2KCMA 4DV6L 3KDFB 4NXNL 1I50H 4HEDA 3EBEA 1F2LA 4A3GG 1P16A 1SJHD 3MXPA 1TS5A 3GV6A 1O7ZA 1SNQA 2EJMA 4GN4B 5I9PA 3NQTA 4PNYA 4I7ZC 1CZWA 1Y1VH 2EVBA 2IX3A 4RGNA 4LMQD 1PTOH 1ONLA 2B2TC 4TRDA 1RCVD 2YTXA 3HKZE 1F77A 4KHPL 5I2YA 2B2UA 2CFMA 3PO2B 1GUGA 3DMUA 2DN8A 2PZUA 4LF8L 4U68A 4P73A 1M4VA 1STBA 2CWAA 3Q22A 2I46A 2Q2TA 4A3FB 4JPBW 4IN3A 3MHBA 3JC66 1PRTF 4X64L 2AKWB 4FF1A 4QL5A 4LWCA 3V05A 2N8NA 5IYCG 3BG3A 4C1NK 3S1QB 3UE1A 1VQ5A 3QG1A 4MN3A 1OXUA 4OWXB 5K36G 5E4WC 3MXNB 2PQEA 3GTLB 1QE6A 5IP7G 1HQRD 1L1OA 1EIYB 1I4XA 1SR3A 3HOZG 4K5XA 1A8VA 1HA6A 3SE0A 2QEXA 1BBUA 3PV0A 2QKIC 4LJZC 1STHA 1XJVA 1Q81C 2Z0SA 3J80E 4A3LG 1VQJA 1STYA 5EBCA 2JA8G 1XPUA 2ZXRA 2HDMA 1HNWQ 1YNXA 4NPSA 2EYFA 2WKDA 1J5EQ 3S2HH 1TKWB 1G6PA 2ENBA 3J7AV 4GKJQ 4A3JB 4DK3C 4RAUC 2K5QA 2F1MA 2UU9Q 2R7ZG 2OQKA 2Z1CA 4A3EB 2B29A 1WTVA 3H91A 2DNCA 4AYBE 2ZJPA 4UY8C 3C1EA 1Q82C 3VYUA 1TQOA 1PFSA 2UUCQ 3NK9A 1PH7A 2RKSA 1O7IA 3UDFA 2VQEQ 5M5XH 1X9NA 3EIVA 3TQYA 2QF7A 3ITPA 2XSCA 1ZEQX 1U4MA 3VR5A 1A0IA 1ENCA 1HH2P 4R1JA 1H9KA 2K1BA 3OYYA 4RHSA 4B3TQ 4K2LA 4ODGA 2H1EA 5IT9L 1KDAA 3CD6A 1M8AA 2R61A 1CHQD 3TS2A 5CV4A 2G9HD 2KUMA 2UXBQ 4BY7B 4K8IA 3MC0B 4G7HC 3PIP3 5JAVA 1QNKA 5C0XH 3H15A 2ICIA 1VQPA 3FPPA 5FJ8H 1DOLA 4QIWE 2FJ2A 4IFDH 3A5UA 1LT4D 2JSOA 1VQGA 3R2IA 1EQRA 2E5LL 2HHHQ 4QMGA 1NTGA 2F0MA 5ELCA 2N55A 1KABA 4HR7B 4JG2A 1IXRA 3KLRA 2K5WA 2PW5A 4OWTB 3M85A 5I6YA 2PO4A 1YJWA 5T1GA 3H6MA 1GM5A 4XIGS 3Q0AA 4A93G 1GHJA 2HCIA 4X3TA 3HOYG 3F1ZA 5IYBG 1FJGQ 2R7FA 3M4OH 2FFKB 3KYHC 1X32A 1I4PA 4DAVA 3OIQA 1SNMA 5C3EB 4DR4L 5D65A 4A3KH 3HG9A 1A3VA 1J5EL 4BY1G 5EGTA 1W3SA 4A3MH 1LACA 5IYDH 2OT2A 4RGOS 3HOVG 3GTKB 4XYQA 4LW1A 2F0IA 2UU9L 1BCPC 5CV7A 3FMCA 3K5LA 2VNUD 3D0FA 2ZM6Q 2F0QA 1GOZA 2DNEA 1I6HH 5IGGA 2JA6H 4A3GB 3UDGA 1PHJA 1HRJA 3GTOH 1EQQA 4KKTA 3J7AF 1TWAH 2PZWA 2DY8A 4A3CG 2PYKA 5CYUA 1BR9A 3GP7A 4P74A 5G3LD 1X65A 4GNXB 3K7AB 4C3JG 1DOMA 4B3TL 5FLXL 2MUYA 4K14A 5LL6X 5LMNW 1MHWC 2YYZA 4YCUA 3NXWA 1K83B 5CORA 2D9UA 2V1CC 4P71A 2UXBL 4NKLA 1VQCA 4L5RC 2JN4A 1V1PA 4C2MB 1Q12A 5EKIA 3LX0A 4IURA 1QVCA 4L6TB 3G7LA 2LXJA 3HOUH 4OO1I 1JCKB 2MHVA 1E22A 1G51A 1WCMH 2J4XA 3GTLH 2HHHL 4O1NA 5ELNA 4KY7A 3NBHA 4AQYL 3HOZB 5E4XA 1X3QA 3CC4A 1FGBD 2K32A 1N33L 1WJJA 1KTKA 3NE5B 2PNHA 1PH8A 2TSSA 1RL2A 3A5ZB 4B9XA 1FJGL 1SLJA 4KY5A 1I4GA 2A6EC 2BDOA 5CGKA 1KQSA 2EYLA 5BN3A 4OO1G 4FXDA 1O7LA 3URYA 2JA8B 3FDTA 3K6OA 1HFGA 2FMMA 1QG7A 1F2MA 5KNCA 3A55A 2AHOB 2NUCA 1XNQQ 4PZ6A 2G9DA 1AE3A 3GTGH 1U9RA 2R7ZB 1MJCA 1UEBA 1KDBA 2SEBD 3NTHA 3NPPA 2ZM6L 1T5EA 1KRTA 3VYTA 1XNRQ 2F0KA 3RN5A 2LY7A 3S2DH 1PH6A 4KD3A 4EQPA 3RD4A 4G7OC 4DKAC 1Q1EA 2F0GA 1E1OA 3BYYB 1HR0W 5HURA 4HIKA 4WJWA 2EYOA 2V4DA 3SVMA 4XXEA 1EU4A 1SYCA 3HEJA 3SK5A 2J7ZA 3M9BA 5KNDA 1LTTD 1O78A 3NHHA 5JPMC 1SYFA 3ND8A 2GN5A 3D3RA 3C3LA 5JJKA 4QGUA 1FNUA 3CP0A 1Q1BA 3EVQA 1VMPA 4WORA 3R8BA 1OXTA 4H0LC 2R93G 1BKBA 1EWHA 2AQ2B 4Z9CB 1YNND 3A0JA 4Y7NB 2MQHA 4DK0A 4X62Q 5JJIA 2E2IH 1AP0A 2L4NA 3I70A 1SYGA 2Q2IA 1LT3D 2B39A 4LF5Q 3FP9A 1E24A 2M2LA 2L11A 1VF7A 1LYLA 5C4JB 3G6EA 2OTJA 4A93B 2AUKA 5C4XG 1MJEA 1DCZA 4F87A 1XYIA 4K5VA 3A74A 4DAPA 3HOYB 3H3VH 1SFOB 2F0JA 1U5KA 4C3IG 1QZHA 1CKNA 3TP6A 4DPGA 3PGZA 3NWTA 3GTKH 4BY1B 1XNQL 2IHFA 2AQ3B 1NR4A 3GTQH 1GUSA 3HOVB 4YCVA 2XN9C 2BA1A 1E2ZA 2NN6G 2F52A 4KK7A 3AEVA 4LFBQ 1JT8A 1CHPD 3DWAA 3P20A 4DAYB 1ASYA 4BBSG 2BCOA 1K73C 5GAEC 1XNRL 5IWAQ 4FDBA 5AJ3Q 2Q8RE 1QZGA 5JEAG 5GROA 1UE7A 2LXKA 4A3FG 1QVGA 3ULPA 3A7LA 5JJLA 3V96A 2G5DA 1VQ9A 5DNFA 2JK8A 1PFMA 3M4YA 4X3KA 3M4QA 3CF5A 2WIIB 2NVYB 1VQEA 4H02A 4C3HH 3I4MG 2KHIA 4CBVA 1E2WA 1JQYD 3PMFA 4R8NA 2A19A 1IKMA 3CCUA 2L0CA 2EDGA 3TSSA 1GHKA 4C3JB 3J80c 2R7DA 3VA7A 1LT5D 2Z9HA 4JI8Q 4BXXG 1A2UA 2ZTCA 3M7GA 1ZKOA 1PTOD 1JC7A 3I73A 3PQIA 3FHWA 1JWMD 1CKMA 2B2VA 1IW7D 2B2YA 5CR3A 3KLSX 1A3TA 1EZ6A 1NMFA 4JBMA 1BCPB 1YIJA 1CUKA 4TVAB 5JOBA 3H94A 1HNZQ 4ZLTF 5BR8L 3HOXG 1L1OC 2CW0D 4PQXA 1EIHA 4L5QA 1F2ZA 4YHHQ 2HQEA 3MFYA 4X62L 4GN5A 3HKSA 4N9TA 1AZQA 5IP7H 1MIUA 2EE1A 2I5LX 2K5VA 2K01A 1EOTA 1TWGB 4A3EG 2ZXOA 3RZDH 2KCTA 4IPCA 1H9JA 1JJ2A 2XRQD 2OEOA 3RR5A 4DR5Q 5M5YB 3NSWA 1Q7YC 4HIOA 4YWKA 3PO3G 3MA2B 2I5HA 4DV3Q 4A3LH 4LFAQ 5GAHC 2ZXPA 1H95A 4N8FA 2BH8A 4MHEA 4FF4A 2XWJB 4A4IA 2SNSA 3KF8B 4KKUA 1Z7TA 3I8ZA 1EY0A 4LFBL 2BE5D 4HSVA 2K33A 5M3FH 1IL2A 2WB1G 1SJED 4H13C 4XQNA 4FP5D 1SYBA 4DUZL 1RHPA 1SSOA 4JI6Q 3EJIA 5IWAL 3T13A 3I4OA 1Q3LA 1EFID 1FNVA 2ZTDA 2NVQB 2LFNA 3U50C 2DGYA 3S16B 5DM73 5I6WA 1QOHA 1ET9A 1VQBA 4DV4Q 1EL0A 1JWUD 3KDFA 4IALA 2XGTA 1MI2A 4R9WA 2N3SA 1X56A 3O13A 5LMUQ 1BDOA 3CPFA 2K5HA 2MJ8A 2F0TA 4DUYL 1NR2A 3BZKA 2EZVA 2B63B 3D4WA 4JI8L 3ER0A 2YU9H 3E3XA 3S14H 1MD2D 1G2TA 1GVPA 3PUZA 3BS1A 4OIJA 3KBXA 1IKLA 3FKIH 3SHLA 4B3ML 3DXJC 1LTID 3I55A 4XYOA 3HS0C 1NNXA 3FEWX 4JI0Q 3Q23A 1HNZL 4KD4A 3RZOH 2QCPX 1FYCA 4KHVA 1DD2A 5C3EG 3MEHA 3MFGA 1SE3A 2R93B 2WP8J 1PVOA 3SEBA 4YWMA 2EYJA 4YHHL 1S40A 1I3QB 5FO7B 4JYAQ 4TQUS 4BS9A 1E3PA 1H9MA 1ZXTA 1SE8A 1SYDA 1JE4A 1II3A 3X3MA 2F0PA 4DR5L 1D8LA 3DEOA 1H9SA 5I4DA 2K5DA 2RCFA 1A63A 3WWVA 3HOYH 5C4XB 5IYBH 4A3IH 4DV3L 1SFOH 1GUOA 4RKBA 3KOJA 1PDQA 1TWHB 1BNZA 1WOCA 1VF5C 1FD7D 4V0BA 3MXNA 4E6IA 4C3IB 5C3XA 4BY1H 2OF1A 2RBMA 1N36Q 2JA5G 3HOVH 1HFNA 1TWCH 3CCSA 1XPRA 3ND9A 1LABA 2KHSA 3H0GH 1SRUA 3OMCA 1LO5D 1HZ9A 1PH4A 4ME3A 3JAMc 5J39A 3DM1A 1D1IA 4RKLA 2EY6A 2M9VA 4JCVE 1TY0A 1LLRD 1BQQT 4BBSB 1CFMA 2SOBA 4RHRA 4JBKA 4K6DA 4OX9Q 5KGUA 1F9RA 5GADC 4LUOA 1FGUA 2RDFA 4HJ8A 1V43A 3MZ5A 1XXGA 2VXWA 2QILA 4DV4L 4R4QA 3L0OA 2Z6KC 3CPWA 1KAAA 1YNJC 4N8X1 2NVXB 2IJ0A 1UEAB 1PZID 2PCFB 2XNAC 3CCEA 3S1RH 3I4MB 1F9QA 4HJ9A 5EPJA 5LMUL 2E2JH 4J6HA 1JWSD 5A2QE 1RF2D 4OELB 2PQAB 2PI2E 3CW2C 1CM9A 1OTCA 1B3QA 1X3EA 3S1MB 5FLMH 3DLLA 1E7ZA 2TMPA 3DWPA 4QQBX 5EAYA 2RDGA 2NB0A 4HSPA 1LTAD 4JI0L 2LKVA 3UDXA 1NE3A 2F3IA 4ID6A 4DNIA 3SK6A 2UXDL 3HOXB 4J8QA 2F03A 3SXHA 3GTMH 1K3RA 4DFAA 5BN4A 1YNNC 1GXDC 4JYAL 4R4IA 2LMCB 4GS3A 4PMBA 1ASZA 5M3MG 1EEID 1N9WA 1TWFB 1QWYA 1Z9FA 3QR8A 3TZDA 1XMOQ 1MBYA 1S5BD 1U4LA 3WOEA 2CWPA 1HQMC 2UUBQ 1I4RA 3PO3B 1HJPA 1N34Q 2QEJC 2RHSB 3J81c 1N36L 3HOWH 3K80C 1W6JA 1P8LA 2CQOA 4F7XA 2ZJRA 3KLSA 5K5PA 3GV3A 3SR1A 2JA7G 1T5XD 1PV4A 1SAPA 2HQLA 1A62A 1GJXA 4APVA 2WB1B 5GAGC 1KIXA 2K52A 1HZCA 1YEZA 1PH3A 1LTBD 4K5WA 2N78A 4OX9L 4EQOA 2ASBA 3L9AX 4DR3Q 3J80i 1XMQQ 5CV6A 2D5DA 1O7YA 2A73B 3PF4A 3CQZH 1EWCA 5LMNQ 2CQAA 2E2DC 5C44H 3I4NH 3C2PA 2X6GA 1HHVA 1K8AC 3NQIA 2D0OA 1GD7A 1QUQA 3D6WA 3DUZA 4KLKA 4A3DG 2O4XA 1K9MC 2J0TD 1VQNA 3CC2A 4DR1Q 3MTSA 1PH5A 2XVSA 3D4RA 4JI2Q 3LWUA 1PTOC 2KOLA 3K0YA 1D5XC 4ZAIA 2UUAQ 3CXCA 3A8KE 4EVOA 2YTVA 5HY6A 1WD0A 1PFBA 1UUPA 2ALYB 4BBRH 1L2FA 1B70B 3VDYA 5AFWA 5M5WB 4R8IA 1HNWL 1QJOA 2R92G 4GKJL 2SDFA 1B9MA 4JV5Q 1WTQA 3D6CA 1DM0B 2RA4A 5EQ0A 1GO3E 1LTRD 3S17B 1XMOL 1WD1A 4A3BG 3BDCA 1A6XA 4C1NI 3TZUA 2UUBL 4QB4A 4DR6Q 1SXTA 4R4OA 4GOPB 1A15A 1Y1VG 5J22A 1N34L 2UUCL 2E76C 2Q2UA 3M3YB 1NSNS 4DK6C 2ZT9C 4DNRB 1IYVA 2VQEL 4AIMA 1K8OA 1ML0D 2JA5B 1D5ZC 1U0LA 2Y0SG 1RDPD 1STNA 2NZ1D 3STBC 1VMCA 4I65A 5D14A 1WFQA 2PI2A 5IIFA 2IHEA 1A2TA 4NW2A 3PO2H 4DK1A 2EPBA 3KBGA 2VUMG 1ESRA 1HR0Q 1NMGA 1PMRA 2F0LA 2ICEC 2GVBA 3EROA 2F0HA 5E7NA 4A3FH 1HXYD 1F9PA 2P5ZX 1PXUA 4DR3L 2LSSA 1XMQL 3S15B 4XQQA 3G4SA 3JAME 3U4VA 2UXCQ 4JK1C 5LMNL 2ES2A 3GTPB 3S1QH 3I4MH 1FVIA 1TXYA 1ICWA 1JJGA 2KECA 1PRTD 4XT3B 3OHXC 3AMUA 2B2YC 1Q8IA 1ET6A 4DR1L 1F2YA 2B8FA 1BVSA 4BXXH 3AYHB 1EQVA 1SMYD 3HRZC 1L0XB 3OMGA 4CKCA 3F2UA 2IL8A 3TMEA 4OHJA 1RTOA 2UUAL 3KUPA 4GKKQ 1TT2A 5IP9H 4ZK9B 3D4DA 3F2DA 1EZ8A 2A5HA 1DXMA 4CKBA 1Y1WG 4DXGA 1D2BA 2NZHA 2QDLA 4J15A 2PW7A 3HOXH 1BCPF 4Q0FA 3QWNA 4NXMQ 3I72A 1CSQA 1N32Q 3Q8DA 3QIAA 4KJOA 2F3VA 4L5SA 4A3JH 2JE6I 2KCCA 1XWEA 4POGA 1XTDA 3T16A 4JV5L 1KLUD 1NBWA 2ZJQA 3RMHA 1KXLA 1SNCA 1X55A 4A3EH 1KDCA 4UHVA 4ZKBB 5M3MB 3Q24A 5D3IB 4PMWA 1PZKD 4ABNA 3PIOA 3N6RA 2MO0A 5ELFA 4G7ZC 1S4ZA 3VYRA 1EYAA 4DR6L 1TS3A 1KHIA 5JEAJ 3GO5A 3JAMi 1V1PB 4UDUC 1RD9D 4K6LA 2K75A 1JB7A 2ZTEA 1YHQA 1VQDA 1HPCA 3ONAB 4CJ1B 1FL0A 4P75A 1FNWA 2F0UA 3RUZA 4BWGB 1LT6D 5ELEA 1E0BA 2JA7B 3H09A 2B63G 2F0OA 1YJ9A 4X66Q 4JI1Q 1R4PB 3U58A 3J81E 2XTIA 4HIMA 5JVH3 1I94Q 1HR0L 3NBHB 4LNQA 4BY7H 4HMJA 2BDNA 1EFWA 3OOCA 4C56C 5IODA 5FJ8G 3S1NB 2CH4A 2I5MX 4IFDG 1LTLA 4B3SQ 1HTPA 4MZ9A 1RODA 5A35A 5CBEE 4NB3A 2I07B 3J7A5 3FPUB 2JEBI 1OXXK 4U673 1GUWA 4L8JA 2E2HB 4J1MA 1O80A 4ZRZA 4DAYA 2L12A 2IX1A 2K04A 1H9RA 4A3DB 3MEFA 3P1HA 4CDDC 1VS0A 2RDHA 4LFCQ 5EJWA 1Y14B 2NN6I 4GKKL 1NJIC 4B3RQ 2IY5B 2DJGC 3SK8A 2QGQA 4RWSC 1ILQA 4A3KG 2NVTB 1ZYRD 5C3EH 2PPBC 3UDIA 3CHBD 4LK1C 4NXML 1Q46A 5IYDG 4JOIA 3MAQA 1N32L 1IBKQ 3E0JA 4R4TA 2L15A 4PZ7A 1XPOA 2R92B 1CA5A 4HTHA 3TS0A 1I50B 2WACA 3VYSA 2O2LD 4X65Q 2K6AA 1X6OA 1IBMQ 3S17H 3W1BA 2JA6G 4A3GH 2OQ0A 3CCLA 4A3BB 3K5MA 3A8IE 4DV7Q 3K8AA 1Y8OB 1Y1VB 2OTLA 1PH9A 1PTOB 1C0AA 2OXPA 3KF6B 1JE5A 2B2UC 2KQ3A 2Y0SB 4WRDA 1BF4A 3K7AH 2M00A 4PV1C 1EY5A 4JI4Q 4FXKC 3TP5A 1K83H 4X66L 4JI1L 2VUMB 5CV5A 5ISRA 3GDEA 3ULLA 1I94L 2D62A 4ZCKA 5TSSA 5ELDA 4C2MH 3BU2A 1HUNA 3TDQA 4B3SL 4KHZA 2Z8LA 1C9OA 4DAMA 3QJYA 3HOUG 2A6HD 4POFA 4HCSA 5IYCH 1WCMG 4DF7A 3DWQA 4QF4A 3AFQA 5K36H 1K8GA 1MKHA 3NTKA 2KJXA 2DUDA 1HA5A 2WV6D 4LF5L 4LFCL 3I91A 3HOZH 3OW2A 5E1FA 1VQMA 1R9TB 3QOJA 1CSPA 1OO9B 4B3RL 2HUGA 5IE8A 3TEHB 1XX8A 1SNPA 1Y1WB 3PIPA 2Q8IB 1I6VC 1WVLA 4ILWA 4IPHA 2JA8H 3S2HB 5CMDA 3A8JE 1IBKL 1RTNA 1WYDA 1BCPD 5J3BA 1WTXA 2WAQG 4I7AA 5NUCA 2CCZA 3W1GA 2WB1E 3CRLC 2R7ZH 3GD7A 2E75C 3VR2A 3WOFA 3HP3A 3E0EA 5EKKA 2EYPA 5M3MH 5CBAE 1HTLD 4X65L 3BVZA 4JBJA 1E2VA 5C6AA 2HIXA 1YZ6A 3TP7A 2C5CA 3IFTA 5LHY1 3TP8A 3U4ZA 5C3WA 1YVCA 2RHQB 1ILPA 4IUVA 5AJ3L 4DV7L 4A75A 1CA6A 3ICEA 2VS1A 5CC4A 5M5XB 5EPKA 1JORA 1W2BA 2L5TA 2X69A 1AZPA 1VQOA 4K0KQ 1IYJB 1M1KC 2PNRC 4ZUJA 2Q8TA 3H3VC 5F2DA 5C5MA 1IL8A 3KK7A 4JI4L 1QB5D 2GA4B 1SE4A 2MFIA 1AFPA 1TY2A 2FMCA 2B2WA 1K8MA 2K4KA 5DAUA 3MXGA 3HFZB 4DNTB 1S5ED 1R4QB 5IOCA 1EYDA 1VQHA 3GTJB 3CCMA 3H3VI 2A69D 3PUWA 4FNFA 3K81C 5I9OA 2HT1A 2VB2X 1PRTC 4Y7NH 3QO2A 3BVGA 3AB9A 3VR4A 4KN4C 4IJLA 1SDFA 1WTRA 1XTCD 4JI7Q 2AQ1B 4YCWA 4DGZA 3BZDB 1I5FA 4IQZA 1BBXC 2Z4IA 4QCLA 4FF2A 2JEAI 4H44C 4R4CA 2EY2A 4L5TA 2AWNA 4FF3A 4KI0A 1EUJA 5C4JH 3CAMA 3J7ZC 2E8GA 1UE1A 1B2TA 4A93H 2NBFA 4PZ8A 4UP9A 4FVMA 5FO9B 1STAA 4A3KB 4LFAL 1K3BC 1WTHA 4LF7Q 4B08A 1TR5A 2PQAA 1I4HA 3OW7A 4RGMA 5EBDA 3TN2A 1TS2A 4IOCA 1S5DD 1WTPA 2C9OA 3LGJA 1IBLQ 3K57A 3EFXD 1I6HB 2JA6B 1Z6HA 4A3BH 2O5IC 2B8GA 1MSGA 4MIUA 3GTOB 3CRKC 2XIWA 4JI6L 3D31A 1SBBB 2F4IA 1TWAB 4K8JA 1B7YB 5G3LF 4DR7Q 2K7VA 3I2ZA 4XQJA 3EN2A 4M1UB 3R3OA 4C3HG 4K0KL 4GLAC 1WTOA 4A3CH 2NVYH 4B9WA 2K28A 3UE0A 4O2DA 4C3JH 1X54A 4AH6A 3HKZG 2VUMH 2NTSA 2E74C 3X3NA 2VZAA 1VDZA 1Q8KA 1U4PA 1JOKA 4KV6A 4HJ5A 4LF9Q 2IT1A 2R3ZA 2A68D 1PH1A 1MSHA 2CVRA 2VQFQ 1RIPA 3ERQA 4OONA 1CT1D 4IUQA 4QY7A 1H9SB 4X3SA 1JB3A 1LTGD 2D0PA 2MO1A 4K2KA 3J7YW 4BA1I 4A76A 1EOVA 3HOUB 1C7YA 2E5LQ 3TBIB 1WCMB 1STGA 2MNAA 3NENA 5FO8B 1CQVA 4YY3Q 4V190 1UAPA 2F0NA 2NWGA 4ZQ3A 4CDEC 2I0QA 4FO2A 2JJQA 2NTTA 4JI7L 1K0RA 3E9IA 2BH2A 1TWGH 2F0WA 2PZTA 2K03A 2JQOA 4F8MA 4CDFC 5I2XA 2BA0A 1V1OA 1Y8PB 3E6ZX 5IT9E 1B8AA 1R9TH 2AWOA 1DONA 1EY8A 5M5YH 4GN3B 1Y1WH 3I4LA 1YJNA 1KAWA 4DR4Q 4P72A 1AEXA 1J8IA 4CJ0B 1ZYRC 3K59A 4OO1H 3J81j 2MPMA 4EX5A 2F0FA 4LF7L 1PA6A 4HJAA 5C5LA 3KJOA 5A2QL 5IGBA 5KEEA 1BO0A 3GTGB 1YI2A 3DEPA 2WAQB 4L63B 2D2CC 3IKJA 1RJTA 1KNAA 5M3FG 4CJ2C 1PYWD 1G2SA 2MP1A 1IBLL 1AH9A 3A56A 1HZBA 1L1OB 5CV8A 3SK4A 4AYBG 1E1TA 2NVQH 3J80L 1PLFA 3S2DB 2PMZB 4DXFA 3G6JB 4QUCA 3S16H 2F0EA 1NAPA 2YTYA 4DR7L 1VCIA 1EEFD 1F9SA 4H7BA 3Q6SA 1Y8NB 4Q5VA 3VA5A 3T1HQ 1U4RA 2KA7A 2IWHA 1YHAA 2F0DA 2WINB 2YV5A 3BJUA 3CCQA 4JI5Q 2WFWA 2B63H 4RCNA 3KLWA 4GOPA 2EY1A 1BOSA 2CKZB 5JVG3 4LF9L 1JICA 3NUCA 3FKIG 5DEHA 3UI2A 2VQFL 1KL9A 5KIXA 2N88A 4JBWA 1VQ8A 1IW7C 3QOLA 1D5MC 1TU2B 2F0SA 2QA4A 1UWVA 1S3OA 3GTJH 1EIFA 1SNOA 2R93H 2A6HC 4GNXA 4GLVB 3S24A 1GUTA 2CW0C 1UE6A 2WKCA 3BDLA 2E2IB 1I3QH 4IPGA 4YY3L 1SROA 3L7ZC 1Y69U 4WJ3M 2VB3X 4G4KA 4AQYQ 1JR0D 1W6KA 3CKIB 4KN7C 4UP8A 4Y52H 5DM63 3I3CA 1N33Q 5FOBB 5FLXE 1HCZA 4EGVA 3HGBA 1V9PA 4A3IG 4JOIC 5C4XH 5IGFA 1EY9A 2EQSA 3PCOB 5LL6S 1SYEA 1KC8C 2OCEA 1TWHH 1SNDA 2K50A 2Y0SE 4C3IH 2FHTA 1B50A 4OEMB 3GTQB 3FRPB 3H0GG 1DZ1A 2VY3A 1PZJD 4JI3Q 5FKAC 2DY7A 2CH4W 4DV5Q 3DM3A 2EXZA 3CCVA 1BXTA 2NN6H 4HJ7A 1CZGA 1QUQB 1AN8A 2B2TA 1ESFA 4MTKA 2RCNA 1NCVA 3T51B 2HDLA 3P7JA 4TKOB 2BE5C 3BVMA 1D6EC 4BBSH 1TVXA 1PRTB 5IGCA 1V1QA 5D3DA 3M4PA 1IYUA 4OGQC 3F8TA 3VR6A 5HGTA 1L0WA 1BUVT 5JEAH 5C0XJ 3E9HA 1SN8A 4ZUIA 4HCEA 3IL8A 1JOQA 4IFDJ 2NVXH 4C3HB 3DHQA 1PTOF 2K14A 3T1HL 3RLFA 1G91A 2RQXA 1MGSA 2Z6KA 1N8RC 3LNNA 2L1BA 4HIDA 2FXQA 3NBIA 2AUJD 2B2VC 4JI5L 2KBNA 3HKZB 5FLMG 4JI2L 4DA2A 3S1MH 1B1ZA 4BA2I 1KD1C 2KEDA 2RF4A 2HCCA 5COYA 3M7NA 5KRUA 2X6LA 2LS01 1EU3A
chains in the Genus database with same CATH topology
2KENA 4WJ4A 3UDFA 2VQEQ 3RZOH 5M5XH 2OTLA 1PH9A 5C3EG 1X9NA 3EIVA 3TQYA 1C0AA 4PG3A 2B3GA 2WP8J 1PVOA 3KF6B 4YWMA 4YHHL 1JE5A 1PYSB 4IJHA 1S40A 1A0IA 1HH2P 4R1JA 3RNUA 4JYAQ 4TQUS 1E3PA 3OYYA 1G291 1SE8A 3K7AH 4B3TQ 3ULJA 4MNOA 2NZOA 1DGSA 4JI4Q 3CD6A 3I56A 1XNRL 1YITA 3TS2A 1TWFH 1K83H 4X66L 4JI1L 4DR5L 1D8LA 2VL6A 2UXBQ 3GDEA 3ULLA 4LUZA 1I94L 2D62A 4JC0A 1A63A 3WWVA 3HOYH 4C2MH 3BU2A 5IYBH 4DV3L 3T1YQ 4A3IH 1SFOH 3PO3H 3H15A 5H1SE 4IOAA 3KOJA 4MTNA 1VQPA 4B3SL 5FJ8H 4QIWE 4KHZA 1VQAA 3A5UA 1J6QA 1WOCA 1C9OA 4DAMA 2F4VQ 4BY1H 4EQ5A 3HOWG 1N36Q 3HOUG 3CMEA 1JJCB 1VQGA 4POFA 1PYBA 1HZAA 5IYCH 3PUXA 5C0XI 1WCMG 2JA5G 2A8VA 3HOVH 2K5NA 1TWCH 3CCSA 1XPRA 4IFDI 1EQRA 2E5LL 2HHHQ 4JI3L 3H0GH 1NTGA 3AFQA 1SRUA 3CCJA 4DV5L 4JG2A 4ALPA 1HZ9A 1PH4A 1K8GA 4ME3A 1IXRA 1MKHA 1VQFA 3JAMc 2DUDA 1VQ4A 1T9HA 4LF5L 4LFCL 4JCVE 3HOZH 4OWTB 3OW2A 3M85A 3G48A 1YJWA 1GM5A 4XIGS 3CCRA 4A93G 1VQMA 4JBKA 1YBYA 1CSPA 4OX9Q 4B3RL 5IE8A 3HOYG 3TEHB 5GADC 3F1ZA 1FGUA 4LUOA 5IYBG 2R7FA 3PUVA 5C0XG 4HJ8A 1EYGA 1FJGQ 3KYHC 3M4OH 1V43A 3PIPA 5HGQA 5C44G 3I4NG 4DV4L 2JA8H 4R4QA 4IPHA 4A3KH 3L0OA 2Z6KC 3CPWA 1J5EL 4DR4L 4BY1G 4A3MH 1W3SA 1IBKL 2UXCL 5IYDH 3PUYA 3HOVG 1WYDA 3CCEA 3S1RH 5J3BA 4LW1A 4HJ9A 5LMUL 2WAQG 2CCZA 2E2JH 2UU9L 3W1GA 3KFUA 2WB1E 2R7ZH 1Q86C 3GD7A 2A1AA 5M3MH 2PQAB 3E0EA 5IY0A 2VNUD 2PI2E 3CW2C 5ELOA 4X65L 3D0FA 1OTCA 2ZM6Q 1X3EA 4JBJA 5FLMH 1I6HH 2HIXA 2JA6H 1YZ6A 3DLLA 3UDGA 1E7ZA 3G71A 1PHJA 3U4ZA 4QQBX 5EAYA 1LM0A 1YVCA 2RHQB 1EQQA 1M90C 3GTOH 5AJ3L 4BBRG 4DV7L 4A75A 3KF6A 4JI0L 5BR8Q 3ICEA 2VS1A 1TWAH 4DR2Q 3UDXA 1W2BA 1NE3A 2F3IA 4LF6Q 4A3CG 4DNIA 1VQOA 2UXDL 4K0KQ 1VQ7A 5M5WH 2VW9A 3GTMH 1K3RA 1IYJB 4A3MG 4P74A 1M1KC 4JYAL 1X65A 4R4IA 2C35B 1YHBA 4GNXB 4GS3A 4B3TL 1ASZA 5M3MG 4OWWB 4IO9A 5LMNW 4UP7A 4JI4L 2YYZA 3RLNA 2Q2HA 1N9WA 4YCUA 3OTOQ 3AQQA 1Z9FA 2MFIA 2V1CC 4P71A 1XMOQ 2UXBL 1VQCA 2EXDA 3J81i 4L5RC 1JMCA 2CWPA 2UUBQ 2N49A 2EIFA 3T1YL 1HJPA 1Q12A 1BBWA 3PSIA 2K4KA 1N34Q 1D7QA 3HFZB 2ATWA 4X6AH 3M3YH 1QVCA 2F4VL 3NEMA 1VQHA 2RHSB 3J81c 3CCMA 3H3VI 3ERSX 4DV2Q 1N36L 1SMXA 4YWLA 3PUWA 2LXJA 3HOWH 3K81C 3HOUH 3K80C 4OXPA 1P8LA 2HT1A 2JA5H 4OO1I 3KJPA 1E22A 2CQOA 1G51A 1WCMH 4Y7NH 3GTLH 2ZJRA 2HHHL 4IJLA 4JI7Q 2GVAA 4UPAA 4YCWA 3BZCA 5ELNA 2JA7G 3TRZA 1I5FA 3PO2G 1PV4A 4AQYL 2JEAI 4DUZQ 2HQLA 1A62A 4LF4Q 4APVA 4GLXA 4R4CA 3CC4A 4L5TA 5GAGC 2AWNA 1KIXA 2K52A 1HZCA 1EUJA 1WJJA 3B6YA 3CAMA 4KI0A 2E8GA 1YEZA 5C4JH 3J7ZC 2PNHA 1PH3A 1PH8A 1VQLA 2N78A 4OX9L 4A93H 2ASBA 1RL2A 2H5XA 3AFPA 3A5ZB 4DR3Q 1SLJA 1FJGL 4PZ8A 4UP9A 3J80i 1KQSA 4OO1G 1XMQQ 3PF4A 3S15H 3CQZH 4LFAL 5LMNQ 5C44H 4LF7Q 3I4NH 3L2PA 2PQAA 2AHOB 5IT9c 1XNQQ 3GTPH 1K8AC 4PZ6A 2D0OA 1GD7A 1QUQA 1AE3A 1NY4A 4DUYQ 4KLKA 4A3DG 3K7UC 1CKNB 1K9MC 3GTGH 1VQNA 1MJCA 4IOCA 3CMAA 3CC2A 1UEBA 4DR1Q 1PH5A 4JI2Q 2OWOA 1OXVA 4RG1A 4DV0Q 4K0KL 2ZM6L 3LGJA 1IBLQ 1KRTA 4B3MQ 4A3BH 5IP9G 2UUAQ 1XNRQ 3CXCA 1HNXQ 2YTVA 5HY6A 3RN5A 4JI6L 3D31A 3S2DH 2AMCB 2ALYB 4BBRH 1B7YB 1L2FA 1PH6A 4DR2L 3I2ZA 4DR7Q 3EN2A 4LF6L 1B70B 4DKAC 1Q1EA 2KHJA 3CC7A 3VDYA 1E1OA 2JA9A 2WAQE 4GLAC 3SGIA 1HR0W 4A3CH 2NVYH 4A3JG 4DV1Q 1HNWL 1PH2A 4HIKA 2R92G 3PF5A 4GKJL 4XTCS 3UE0A 4DV6Q 4JV5Q 4O2DA 1IZ6A 5GQOA 4NXNQ 4C3JH 1X54A 1WI5A 4AH6A 1UE5A 3HKZG 1X3FA 3M9BA 3RLOA 2VUMH 3OTOL 1GO3E 1OXSC 1VQ6A 1CKOA 2VZAA 2PMZE 1XMOL 1Q8KA 1IBML 4LF9Q 4HJ5A 4A3BG 2IT1A 1PH1A 2VQFQ 1RIPA 2GN5A 2UUBL 5JJKA 4OONA 4QGUA 4DR6Q 2ID0A 4QY7A 4R4OA 4GOPB 1Y1VG 3CP0A 1Q1BA 1N34L 2UUCL 2Q2UA 4DK6C 4IPDA 1OXTA 2D0PA 2MO1A 3K0XA 2R93G 1KRSA 1BKBA 2VQEL 4DV2L 4AIMA 1EWIA 4BA1I 4A76A 1EOVA 1C7YA 2E5LQ 1U0LA 2Y0SG 3A0JA 5JJIA 2MQHA 3STBD 4X62Q 2MNAA 2E2IH 3NENA 3F2BA 4YY3Q 4KHPQ 2R6GA 3STBC 2I0QA 1WFQA 4JI7L 2JJQA 2PI2A 2Q2IA 1K0RA 3FP9A 2IHEA 4LF5Q 3E9IA 1E24A 3PO2H 2BH2A 1TWGH 2JA7H 3W5OA 4LF8Q 2JQOA 4LF4L 2VUMG 2BA0A 4BY7G 1LYLA 1B8AA 1R9TH 3IRBA 2AWOA 1HR0Q 1NMGA 3G6EA 2HIVA 2GVBA 4QJFA 5M5YH 2OTJA 3RN2A 5C4XG 1MJEA 4GN3B 5E7NA 4A3FH 1Y1WH 3F2CA 4DR3L 3A74A 3S1NH 3H3VH 1YJNA 1KAWA 4DR4Q 1U5KA 2LSSA 4P72A 1XMQL 4X64Q 1QZHA 1CKNA 3G4SA 3J81j 3U4VA 4EX5A 2UXCQ 5LMNL 4DPGA 1GKHA 1Z47A 2ES2A 3PGZA 4LF7L 5FLXc 1X3GA 3GTKH 1XNQL 1PA6A 1AE2A 2IHFA 4HJAA 1FVIA 3KJOA 1TXYA 2E2HH 3GTQH 3I4MH 1JJGA 3I7FA 4YCVA 4GOPC 2BA1A 1YI2A 2NN6G 2F52A 4A3DH 3AEVA 4LFBQ 1JT8A 4DR1L 1QVFA 5M3FG 4BXXH 1BVSA 2IX0A 3AYHB 1VQKA 4RMFA 4DAYB 4DV0L 1LUZA 1ASYA 1IBLL 4BBSG 1K73C 1AH9A 3NELA 3TREA 1HZBA 1L1OB 5GAEC 2UUAL 5IWAQ 4FDBA 4AYBG 5AJ3Q 1S72A 1QZGA 5JEAG 4GKKQ 5IP9H 1HNXL 1E1TA 5DLQE 2NVQH 4GNXC 3F2DA 5GROA 1UE7A 2LXKA 4A3FG 1VQIA 1Y1WG 1QVGA 3ULPA 5JJLA 2NZHA 3S16H 2YTYA 1VQ9A 4DR7L 2UXDQ 1VCIA 2JK8A 4J15A 3HOXH 2NVTH 3M4QA 3CF5A 4LUVA 4NXMQ 3ZJYC 4H02A 1VQEA 1CSQA 1N32Q 3Q8DA 4C3HH 4DV1L 4L5SA 3I4MG 2KHIA 3T1HQ 4A3JH 2JE6I 4POGA 1XTDA 2A19A 2R92H 1YHAA 4O0AA 3CCUA 2KCMA 4DV6L 4JV5L 2YV5A 1NBWA 3KDFB 4NXNL 1I50H 3BJUA 2ZJQA 3J80c 1KXLA 2R7DA 1X55A 3CCQA 4A3EH 2WFWA 4JI5Q 2B63H 4JI8Q 3EBEA 4BXXG 2ZTCA 3FHWA 3KLWA 4A3GG 4GOPA 1P16A 1CKMA 4PMWA 3PIOA 2CKZB 4LF9L 3FKIG 2VQFL 1KL9A 2MO0A 4JBWA 1VQ8A 4GN4B 1NMFA 4JBMA 4DR6L 1YIJA 2QA4A 1CUKA 4TVAB 1KHIA 5JEAJ 1UWVA 1HNZQ 3GO5A 1S3OA 3JAMi 1Y1VH 3GTJH 5BR8L 3HOXG 2K75A 1JB7A 1EIFA 2ZTEA 1L1OC 1YHQA 1VQDA 2R93H 4L5QA 4GNXA 4GLVB 4YHHQ 3S24A 1FL0A 1UE6A 4P75A 4X62L 2YTXA 1I3QH 3HKZE 4GN5A 4IPGA 3HKSA 4YY3L 4KHPL 1SROA 3L7ZC 5IP7H 1MIUA 2I5LX 4WJ3M 4AQYQ 2K5VA 2CFMA 4UP8A 4Y52H 4A3EG 3RZDH 2B63G 1N33Q 4LF8L 1YJ9A 2KCTA 4IPCA 4X66Q 4P73A 4JI1Q 1JJ2A 3U58A 4DR5Q 3RR5A 4HIMA 2XTIA 1HR0L 4LNQA 1I94Q 4BY7H 3NBHB 2CWAA 1V9PA 4A3IG 4HIOA 1Q7YC 1EFWA 4YWKA 2Q2TA 4JOIC 3PO3G 2I5HA 5C4XH 4DV3Q 5FJ8G 2EQSA 3PCOB 4A3LH 2I5MX 3JC66 1LTLA 4LFAQ 4B3SQ 4MZ9A 4IFDG 5GAHC 4X64L 2OCEA 2AKWB 1KC8C 1TWHH 2K50A 1H95A 2Y0SE 4NB3A 4C3IH 4QL5A 2BH8A 4LWCA 2N8NA 5IYCG 3J7A5 2JEBI 3UE1A 1OXXK 1VQ5A 3S1QH 3H0GG 4A4IA 3KF8B 2VY3A 1OXUA 4OWXB 4JI3Q 2IX1A 5K36G 4DV5Q 3DM3A 3MXNB 3CCVA 5IP7G 4LFBL 4HJ7A 1L1OA 1EIYB 1QUQB 1SR3A 3MEFA 3HOZG 1VS0A 2RCNA 5M3FH 1IL2A 1A8VA 2WB1G 4LFCQ 2QEXA 1BBUA 3PV0A 1Y14B 4DUZL 4BBSH 2NN6I 4JI6Q 4GKKL 5IWAL 1XJVA 3I4OA 1NJIC 2ZTDA 1V1QA 1Q81C 4B3RQ 2IY5B 3M4PA 3U50C 3F8TA 2DGYA 2Z0SA 1L0WA 5C0XJ 3E9HA 2QGQA 1VQJA 1SN8A 4A3LG 2JA8G 4A3KG 1VQBA 5C3EH 1XPUA 4DV4Q 4IFDJ 3UDIA 1HNWQ 1YNXA 4NPSA 1J5EQ 3S2HH 3KDFA 4NXML 1Q46A 5IYDG 2NVXH 1G6PA 4JOIA 1N32L 4GKJQ 1IBKQ 2XGTA 4R4TA 2L15A 3T1HL 2K14A 4PZ7A 2N3SA 1X56A 4DK3C 3RLFA 1XPOA 1N8RC 2Z6KA 5LMUQ 4HIDA 2UU9Q 3CPFA 2R7ZG 2FXQA 2K5HA 2OQKA 3TS0A 4DUYL 3BZKA 2B29A 4JI5L 4JI8L 4X65Q 3ER0A 2KBNA 5FLMG 1X6OA 4AYBE 1IBMQ 4JI2L 3W1BA 2ZJPA 2YU9H 4UY8C 2JA6G 3S17H 1Q82C 3S14H 3S1MH 1N33L 4A3GH 2OQ0A 1GVPA 3PUZA 3CCLA 4BA2I 1KD1C 3FKIH 4B3ML 1PFSA 2RF4A 2UUCQ 3I55A 1PH7A 4DV7Q 3M7NA 4JI0Q 3K8AA 1HNZL 1UE1A 1O7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEN A;  4WJ4 A;  3UDF A;  2VQE Q;  3RZO H;  5M5X H;  2OTL A;  1PH9 A;  5C3E G;  1X9N A;  3EIV A;  3TQY A;  1C0A A;  4PG3 A;  2B3G A;  2WP8 J;  1PVO A;  3KF6 B;  4YWM A;  4YHH L;  1JE5 A;  1PYS B;  4IJH A;  1S40 A;  1A0I A;  1HH2 P;  4R1J A;  3RNU A;  4JYA Q;  4TQU S;  1E3P A;  3OYY A;  1G29 1;  1SE8 A;  3K7A H;  4B3T Q;  3ULJ A;  4MNO A;  2NZO A;  1DGS A;  4JI4 Q;  3CD6 A;  3I56 A;  1XNR L;  1YIT A;  3TS2 A;  1TWF H;  1K83 H;  4X66 L;  4JI1 L;  4DR5 L;  1D8L A;  2VL6 A;  2UXB Q;  3GDE A;  3ULL A;  4LUZ A;  1I94 L;  2D62 A;  4JC0 A;  1A63 A;  3WWV A;  3HOY H;  4C2M H;  3BU2 A;  5IYB H;  4DV3 L;  3T1Y Q;  4A3I H;  1SFO H;  3PO3 H;  3H15 A;  5H1S E;  4IOA A;  3KOJ A;  4MTN A;  1VQP A;  4B3S L;  5FJ8 H;  4QIW E;  4KHZ A;  1VQA A;  3A5U A;  1J6Q A;  1WOC A;  1C9O A;  4DAM A;  2F4V Q;  4BY1 H;  4EQ5 A;  3HOW G;  1N36 Q;  3HOU G;  3CME A;  1JJC B;  1VQG A;  4POF A;  1PYB A;  1HZA A;  5IYC H;  3PUX A;  5C0X I;  1WCM G;  2JA5 G;  2A8V A;  3HOV H;  2K5N A;  1TWC H;  3CCS A;  1XPR A;  4IFD I;  1EQR A;  2E5L L;  2HHH Q;  4JI3 L;  3H0G H;  1NTG A;  3AFQ A;  1SRU A;  3CCJ A;  4DV5 L;  4JG2 A;  4ALP A;  1HZ9 A;  1PH4 A;  1K8G A;  4ME3 A;  1IXR A;  1MKH A;  1VQF A;  3JAM c;  2DUD A;  1VQ4 A;  1T9H A;  4LF5 L;  4LFC L;  4JCV E;  3HOZ H;  4OWT B;  3OW2 A;  3M85 A;  3G48 A;  1YJW A;  1GM5 A;  4XIG S;  3CCR A;  4A93 G;  1VQM A;  4JBK A;  1YBY A;  1CSP A;  4OX9 Q;  4B3R L;  5IE8 A;  3HOY G;  3TEH B;  5GAD C;  3F1Z A;  1FGU A;  4LUO A;  5IYB G;  2R7F A;  3PUV A;  5C0X G;  4HJ8 A;  1EYG A;  1FJG Q;  3KYH C;  3M4O H;  1V43 A;  3PIP A;  5HGQ A;  5C44 G;  3I4N G;  4DV4 L;  2JA8 H;  4R4Q A;  4IPH A;  4A3K H;  3L0O A;  2Z6K C;  3CPW A;  1J5E L;  4DR4 L;  4BY1 G;  4A3M H;  1W3S A;  1IBK L;  2UXC L;  5IYD H;  3PUY A;  3HOV G;  1WYD A;  3CCE A;  3S1R H;  5J3B A;  4LW1 A;  4HJ9 A;  5LMU L;  2WAQ G;  2CCZ A;  2E2J H;  2UU9 L;  3W1G A;  3KFU A;  2WB1 E;  2R7Z H;  1Q86 C;  3GD7 A;  2A1A A;  5M3M H;  2PQA B;  3E0E A;  5IY0 A;  2VNU D;  2PI2 E;  3CW2 C;  5ELO A;  4X65 L;  3D0F A;  1OTC A;  2ZM6 Q;  1X3E A;  4JBJ A;  5FLM H;  1I6H H;  2HIX A;  2JA6 H;  1YZ6 A;  3DLL A;  3UDG A;  1E7Z A;  3G71 A;  1PHJ A;  3U4Z A;  4QQB X;  5EAY A;  1LM0 A;  1YVC A;  2RHQ B;  1EQQ A;  1M90 C;  3GTO H;  5AJ3 L;  4BBR G;  4DV7 L;  4A75 A;  3KF6 A;  4JI0 L;  5BR8 Q;  3ICE A;  2VS1 A;  1TWA H;  4DR2 Q;  3UDX A;  1W2B A;  1NE3 A;  2F3I A;  4LF6 Q;  4A3C G;  4DNI A;  1VQO A;  2UXD L;  4K0K Q;  1VQ7 A;  5M5W H;  2VW9 A;  3GTM H;  1K3R A;  1IYJ B;  4A3M G;  4P74 A;  1M1K C;  4JYA L;  1X65 A;  4R4I A;  2C35 B;  1YHB A;  4GNX B;  4GS3 A;  4B3T L;  1ASZ A;  5M3M G;  4OWW B;  4IO9 A;  5LMN W;  4UP7 A;  4JI4 L;  2YYZ A;  3RLN A;  2Q2H A;  1N9W A;  4YCU A;  3OTO Q;  3AQQ A;  1Z9F A;  2MFI A;  2V1C C;  4P71 A;  1XMO Q;  2UXB L;  1VQC A;  2EXD A;  3J81 i;  4L5R C;  1JMC A;  2CWP A;  2UUB Q;  2N49 A;  2EIF A;  3T1Y L;  1HJP A;  1Q12 A;  1BBW A;  3PSI A;  2K4K A;  1N34 Q;  1D7Q A;  3HFZ B;  2ATW A;  4X6A H;  3M3Y H;  1QVC A;  2F4V L;  3NEM A;  1VQH A;  2RHS B;  3J81 c;  3CCM A;  3H3V I;  3ERS X;  4DV2 Q;  1N36 L;  1SMX A;  4YWL A;  3PUW A;  2LXJ A;  3HOW H;  3K81 C;  3HOU H;  3K80 C;  4OXP A;  1P8L A;  2HT1 A;  2JA5 H;  4OO1 I;  3KJP A;  1E22 A;  2CQO A;  1G51 A;  1WCM H;  4Y7N H;  3GTL H;  2ZJR A;  2HHH L;  4IJL A;  4JI7 Q;  2GVA A;  4UPA A;  4YCW A;  3BZC A;  5ELN A;  2JA7 G;  3TRZ A;  1I5F A;  3PO2 G;  1PV4 A;  4AQY L;  2JEA I;  4DUZ Q;  2HQL A;  1A62 A;  4LF4 Q;  4APV A;  4GLX A;  4R4C A;  3CC4 A;  4L5T A;  5GAG C;  2AWN A;  1KIX A;  2K52 A;  1HZC A;  1EUJ A;  1WJJ A;  3B6Y A;  3CAM A;  4KI0 A;  2E8G A;  1YEZ A;  5C4J H;  3J7Z C;  2PNH A;  1PH3 A;  1PH8 A;  1VQL A;  2N78 A;  4OX9 L;  4A93 H;  2ASB A;  1RL2 A;  2H5X A;  3AFP A;  3A5Z B;  4DR3 Q;  1SLJ A;  1FJG L;  4PZ8 A;  4UP9 A;  3J80 i;  1KQS A;  4OO1 G;  1XMQ Q;  3PF4 A;  3S15 H;  3CQZ H;  4LFA L;  5LMN Q;  5C44 H;  4LF7 Q;  3I4N H;  3L2P A;  2PQA A;  2AHO B;  5IT9 c;  1XNQ Q;  3GTP H;  1K8A C;  4PZ6 A;  2D0O A;  1GD7 A;  1QUQ A;  1AE3 A;  1NY4 A;  4DUY Q;  4KLK A;  4A3D G;  3K7U C;  1CKN B;  1K9M C;  3GTG H;  1VQN A;  1MJC A;  4IOC A;  3CMA A;  3CC2 A;  1UEB A;  4DR1 Q;  1PH5 A;  4JI2 Q;  2OWO A;  1OXV A;  4RG1 A;  4DV0 Q;  4K0K L;  2ZM6 L;  3LGJ A;  1IBL Q;  1KRT A;  4B3M Q;  4A3B H;  5IP9 G;  2UUA Q;  1XNR Q;  3CXC A;  1HNX Q;  2YTV A;  5HY6 A;  3RN5 A;  4JI6 L;  3D31 A;  3S2D H;  2AMC B;  2ALY B;  4BBR H;  1B7Y B;  1L2F A;  1PH6 A;  4DR2 L;  3I2Z A;  4DR7 Q;  3EN2 A;  4LF6 L;  1B70 B;  4DKA C;  1Q1E A;  2KHJ A;  3CC7 A;  3VDY A;  1E1O A;  2JA9 A;  2WAQ E;  4GLA C;  3SGI A;  1HR0 W;  4A3C H;  2NVY H;  4A3J G;  4DV1 Q;  1HNW L;  1PH2 A;  4HIK A;  2R92 G;  3PF5 A;  4GKJ L;  4XTC S;  3UE0 A;  4DV6 Q;  4JV5 Q;  4O2D A;  1IZ6 A;  5GQO A;  4NXN Q;  4C3J H;  1X54 A;  1WI5 A;  4AH6 A;  1UE5 A;  3HKZ G;  1X3F A;  3M9B A;  3RLO A;  2VUM H;  3OTO L;  1GO3 E;  1OXS C;  1VQ6 A;  1CKO A;  2VZA A;  2PMZ E;  1XMO L;  1Q8K A;  1IBM L;  4LF9 Q;  4HJ5 A;  4A3B G;  2IT1 A;  1PH1 A;  2VQF Q;  1RIP A;  2GN5 A;  2UUB L;  5JJK A;  4OON A;  4QGU A;  4DR6 Q;  2ID0 A;  4QY7 A;  4R4O A;  4GOP B;  1Y1V G;  3CP0 A;  1Q1B A;  1N34 L;  2UUC L;  2Q2U A;  4DK6 C;  4IPD A;  1OXT A;  2D0P A;  2MO1 A;  3K0X A;  2R93 G;  1KRS A;  1BKB A;  2VQE L;  4DV2 L;  4AIM A;  1EWI A;  4BA1 I;  4A76 A;  1EOV A;  1C7Y A;  2E5L Q;  1U0L A;  2Y0S G;  3A0J A;  5JJI A;  2MQH A;  3STB D;  4X62 Q;  2MNA A;  2E2I H;  3NEN A;  3F2B A;  4YY3 Q;  4KHP Q;  2R6G A;  3STB C;  2I0Q A;  1WFQ A;  4JI7 L;  2JJQ A;  2PI2 A;  2Q2I A;  1K0R A;  3FP9 A;  2IHE A;  4LF5 Q;  3E9I A;  1E24 A;  3PO2 H;  2BH2 A;  1TWG H;  2JA7 H;  3W5O A;  4LF8 Q;  2JQO A;  4LF4 L;  2VUM G;  2BA0 A;  4BY7 G;  1LYL A;  1B8A A;  1R9T H;  3IRB A;  2AWO A;  1HR0 Q;  1NMG A;  3G6E A;  2HIV A;  2GVB A;  4QJF A;  5M5Y H;  2OTJ A;  3RN2 A;  5C4X G;  1MJE A;  4GN3 B;  5E7N A;  4A3F H;  1Y1W H;  3F2C A;  4DR3 L;  3A74 A;  3S1N H;  3H3V H;  1YJN A;  1KAW A;  4DR4 Q;  1U5K A;  2LSS A;  4P72 A;  1XMQ L;  4X64 Q;  1QZH A;  1CKN A;  3G4S A;  3J81 j;  3U4V A;  4EX5 A;  2UXC Q;  5LMN L;  4DPG A;  1GKH A;  1Z47 A;  2ES2 A;  3PGZ A;  4LF7 L;  5FLX c;  1X3G A;  3GTK H;  1XNQ L;  1PA6 A;  1AE2 A;  2IHF A;  4HJA A;  1FVI A;  3KJO A;  1TXY A;  2E2H H;  3GTQ H;  3I4M H;  1JJG A;  3I7F A;  4YCV A;  4GOP C;  2BA1 A;  1YI2 A;  2NN6 G;  2F52 A;  4A3D H;  3AEV A;  4LFB Q;  1JT8 A;  4DR1 L;  1QVF A;  5M3F G;  4BXX H;  1BVS A;  2IX0 A;  3AYH B;  1VQK A;  4RMF A;  4DAY B;  4DV0 L;  1LUZ A;  1ASY A;  1IBL L;  4BBS G;  1K73 C;  1AH9 A;  3NEL A;  3TRE A;  1HZB A;  1L1O B;  5GAE C;  2UUA L;  5IWA Q;  4FDB A;  4AYB G;  5AJ3 Q;  1S72 A;  1QZG A;  5JEA G;  4GKK Q;  5IP9 H;  1HNX L;  1E1T A;  5DLQ E;  2NVQ H;  4GNX C;  3F2D A;  5GRO A;  1UE7 A;  2LXK A;  4A3F G;  1VQI A;  1Y1W G;  1QVG A;  3ULP A;  5JJL A;  2NZH A;  3S16 H;  2YTY A;  1VQ9 A;  4DR7 L;  2UXD Q;  1VCI A;  2JK8 A;  4J15 A;  3HOX H;  2NVT H;  3M4Q A;  3CF5 A;  4LUV A;  4NXM Q;  3ZJY C;  4H02 A;  1VQE A;  1CSQ A;  1N32 Q;  3Q8D A;  4C3H H;  4DV1 L;  4L5S A;  3I4M G;  2KHI A;  3T1H Q;  4A3J H;  2JE6 I;  4POG A;  1XTD A;  2A19 A;  2R92 H;  1YHA A;  4O0A A;  3CCU A;  2KCM A;  4DV6 L;  4JV5 L;  2YV5 A;  1NBW A;  3KDF B;  4NXN L;  1I50 H;  3BJU A;  2ZJQ A;  3J80 c;  1KXL A;  2R7D A;  1X55 A;  3CCQ A;  4A3E H;  2WFW A;  4JI5 Q;  2B63 H;  4JI8 Q;  3EBE A;  4BXX G;  2ZTC A;  3FHW A;  3KLW A;  4A3G G;  4GOP A;  1P16 A;  1CKM A;  4PMW A;  3PIO A;  2CKZ B;  4LF9 L;  3FKI G;  2VQF L;  1KL9 A;  2MO0 A;  4JBW A;  1VQ8 A;  4GN4 B;  1NMF A;  4JBM A;  4DR6 L;  1YIJ A;  2QA4 A;  1CUK A;  4TVA B;  1KHI A;  5JEA J;  1UWV A;  1HNZ Q;  3GO5 A;  1S3O A;  3JAM i;  1Y1V H;  3GTJ H;  5BR8 L;  3HOX G;  2K75 A;  1JB7 A;  1EIF A;  2ZTE A;  1L1O C;  1YHQ A;  1VQD A;  2R93 H;  4L5Q A;  4GNX A;  4GLV B;  4YHH Q;  3S24 A;  1FL0 A;  1UE6 A;  4P75 A;  4X62 L;  2YTX A;  1I3Q H;  3HKZ E;  4GN5 A;  4IPG A;  3HKS A;  4YY3 L;  4KHP L;  1SRO A;  3L7Z C;  5IP7 H;  1MIU A;  2I5L X;  4WJ3 M;  4AQY Q;  2K5V A;  2CFM A;  4UP8 A;  4Y52 H;  4A3E G;  3RZD H;  2B63 G;  1N33 Q;  4LF8 L;  1YJ9 A;  2KCT A;  4IPC A;  4X66 Q;  4P73 A;  4JI1 Q;  1JJ2 A;  3U58 A;  4DR5 Q;  3RR5 A;  4HIM A;  2XTI A;  1HR0 L;  4LNQ A;  1I94 Q;  4BY7 H;  3NBH B;  2CWA A;  1V9P A;  4A3I G;  4HIO A;  1Q7Y C;  1EFW A;  4YWK A;  2Q2T A;  4JOI C;  3PO3 G;  2I5H A;  5C4X H;  4DV3 Q;  5FJ8 G;  2EQS A;  3PCO B;  4A3L H;  2I5M X;  3JC6 6;  1LTL A;  4LFA Q;  4B3S Q;  4MZ9 A;  4IFD G;  5GAH C;  4X64 L;  2OCE A;  2AKW B;  1KC8 C;  1TWH H;  2K50 A;  1H95 A;  2Y0S E;  4NB3 A;  4C3I H;  4QL5 A;  2BH8 A;  4LWC A;  2N8N A;  5IYC G;  3J7A 5;  2JEB I;  3UE1 A;  1OXX K;  1VQ5 A;  3S1Q H;  3H0G G;  4A4I A;  3KF8 B;  2VY3 A;  1OXU A;  4OWX B;  4JI3 Q;  2IX1 A;  5K36 G;  4DV5 Q;  3DM3 A;  3MXN B;  3CCV A;  5IP7 G;  4LFB L;  4HJ7 A;  1L1O A;  1EIY B;  1QUQ B;  1SR3 A;  3MEF A;  3HOZ G;  1VS0 A;  2RCN A;  5M3F H;  1IL2 A;  1A8V A;  2WB1 G;  4LFC Q;  2QEX A;  1BBU A;  3PV0 A;  1Y14 B;  4DUZ L;  4BBS H;  2NN6 I;  4JI6 Q;  4GKK L;  5IWA L;  1XJV A;  3I4O A;  1NJI C;  2ZTD A;  1V1Q A;  1Q81 C;  4B3R Q;  2IY5 B;  3M4P A;  3U50 C;  3F8T A;  2DGY A;  2Z0S A;  1L0W A;  5C0X J;  3E9H A;  2QGQ A;  1VQJ A;  1SN8 A;  4A3L G;  2JA8 G;  4A3K G;  1VQB A;  5C3E H;  1XPU A;  4DV4 Q;  4IFD J;  3UDI A;  1HNW Q;  1YNX A;  4NPS A;  1J5E Q;  3S2H H;  3KDF A;  4NXM L;  1Q46 A;  5IYD G;  2NVX H;  1G6P A;  4JOI A;  1N32 L;  4GKJ Q;  1IBK Q;  2XGT A;  4R4T A;  2L15 A;  3T1H L;  2K14 A;  4PZ7 A;  2N3S A;  1X56 A;  4DK3 C;  3RLF A;  1XPO A;  1N8R C;  2Z6K A;  5LMU Q;  4HID A;  2UU9 Q;  3CPF A;  2R7Z G;  2FXQ A;  2K5H A;  2OQK A;  3TS0 A;  4DUY L;  3BZK A;  2B29 A;  4JI5 L;  4JI8 L;  4X65 Q;  3ER0 A;  2KBN A;  5FLM G;  1X6O A;  4AYB E;  1IBM Q;  4JI2 L;  3W1B A;  2ZJP A;  2YU9 H;  4UY8 C;  2JA6 G;  3S17 H;  1Q82 C;  3S14 H;  3S1M H;  1N33 L;  4A3G H;  2OQ0 A;  1GVP A;  3PUZ A;  3CCL A;  4BA2 I;  1KD1 C;  3FKI H;  4B3M L;  1PFS A;  2RF4 A;  2UUC Q;  3I55 A;  1PH7 A;  4DV7 Q;  3M7N A;  4JI0 Q;  3K8A A;  1HNZ L;  1UE1 A;  1O7I A; 
#chains in the Genus database with same CATH topology
 2KEN A;  4WJ4 A;  1CQF A;  4YIJ A;  1D1K A;  4PG3 A;  2B3G A;  2A69 C;  5E3F A;  1K28 A;  4CKE A;  1PYS B;  4IJH A;  4IUN A;  3RNU A;  4CDC C;  1G29 1;  2K05 A;  3ULJ A;  4MNO A;  4HN7 A;  4RH6 A;  2NZO A;  1DGS A;  3RZD B;  5EPL A;  3I56 A;  1YIT A;  1TWF H;  3U9S A;  3A54 A;  2VL6 A;  4LUZ A;  1S5F D;  1EIG A;  2NYZ D;  5JJZ A;  3OSO A;  2XWB B;  4JC0 A;  4N9P A;  3T1Y Q;  3JAM L;  3PO3 H;  5H1S E;  4IOA A;  4MTN A;  3I90 A;  1G8Z D;  1VQA A;  1DOK A;  1J6Q A;  3P75 A;  2F4V Q;  4EQ5 A;  3HOW G;  2IPK D;  3CME A;  1JJC B;  1PYB A;  1HZA A;  5C0X I;  3PUX A;  2A8V A;  2K5N A;  3CU7 A;  4IFD I;  1EY6 A;  4JI3 L;  3S9W A;  4DV5 L;  4HMI A;  3CCJ A;  1ENF A;  4ALP A;  1VQF A;  3NTI A;  3NWS A;  1VQ4 A;  3IFD A;  1T9H A;  5M3F B;  2L9H A;  3EQL C;  4TSS A;  3G48 A;  1J9O A;  2EJG C;  3CCR A;  1STE A;  5JPN C;  1YBY A;  4AYB B;  4EQN A;  3T56 B;  3PUV A;  1QNU A;  5C0X G;  1EYG A;  3NP8 A;  5IGD A;  5HGQ A;  4X3U A;  1YNJ D;  5C44 G;  3I4N G;  4RFB A;  3U9O A;  3V2T A;  2UXC L;  1A3U A;  1B4O A;  4UAI A;  3PUY A;  3L3O C;  3KFU A;  3R93 A;  2JYO A;  1Q86 C;  4IUT A;  1SE2 A;  2A1A A;  4DN4 M;  4QUF A;  3EA6 A;  5IY0 A;  1SEB D;  5ELO A;  2YU9 B;  1KLG D;  2B2W C;  3S14 B;  2EYM A;  2RSN A;  3G71 A;  2A68 C;  3R2T A;  3FKI B;  2A74 C;  4M8A A;  4FYD A;  1LM0 A;  1M90 C;  4XDX A;  4IUP A;  4BBR G;  3KF6 A;  2EOT A;  4KMU C;  5BR8 Q;  3RZO B;  5FK9 C;  4DR2 Q;  4IZ8 A;  4LF6 Q;  4ZKC B;  1VQ7 A;  5M5W H;  2VW9 A;  3VR3 A;  1TII D;  4QIW B;  4A3M G;  1TS4 A;  4ZYS A;  4KJN A;  2RSO A;  3OWF A;  2C35 B;  1YHB A;  4OL7 A;  5BN5 A;  5C4H A;  2QDB A;  4OWW B;  3J81 L;  4IO9 A;  4UP7 A;  3RLN A;  1Q90 A;  2Q2H A;  4CGY B;  3OTO Q;  4RA8 A;  3AQQ A;  2EXD A;  3J81 i;  5KNB A;  1JMC A;  2Z6B A;  4KKS A;  4CHT B;  2FIN B;  4A3I B;  2N49 A;  2EIF A;  3T1Y L;  1BBW A;  4XT1 B;  3PSI A;  1D7Q A;  1PFN A;  1AW7 A;  2ATW A;  4X6A H;  3M3Y H;  2F4V L;  3NEM A;  3ERS X;  4DV2 Q;  2HD3 A;  1SMX A;  4YWL A;  1QCB D;  1QIL A;  4OXP A;  2JA5 H;  3KJP A;  1TWC B;  3H0G B;  4RCO A;  3AU7 A;  2KEE A;  4KTA A;  2GVA A;  4UPA A;  3PO2 G;  3BZC A;  3TRZ A;  5M9O A;  1B9N A;  4DUZ Q;  4LF4 Q;  4GLX A;  3A7A B;  3B6Y A;  3MVV A;  5IGE A;  3OWE B;  1VQL A;  1ICF B;  2H5X A;  3AFP A;  1C48 A;  2EYH A;  1ENA A;  3S15 H;  2H4O A;  1FR3 A;  3KF8 A;  2RVL A;  3L2P A;  1RKN A;  4RGT A;  2CHB D;  5IT9 c;  1NUC A;  3GTP H;  5J1Z A;  3S1R B;  4GZY C;  1NY4 A;  2E2J B;  1EYC A;  4DUY Q;  3K7U C;  1CKN B;  1DJR D;  3CMA A;  3BYT B;  2OWO A;  3D8G A;  1OXV A;  4RG1 A;  4DV0 Q;  5KYI A;  2Z4H A;  2IW3 A;  4B3M Q;  4P2C B;  1C4Q A;  1X3P A;  1C8C A;  5IP9 G;  1HUM A;  2F0V A;  1HNX Q;  4KY6 A;  2AMC B;  3BDO A;  1K0S A;  2XRS D;  4DR2 L;  2MGS A;  1B44 D;  4LF6 L;  2KHJ A;  3CC7 A;  2JA9 A;  2WAQ E;  3SGI A;  3GTM B;  4A3J G;  4DV1 Q;  1PH2 A;  3PF5 A;  3IAY A;  4XTC S;  4DV6 Q;  4JVZ A;  5L37 A;  1IZ6 A;  5GQO A;  3T53 B;  4NXN Q;  5T1I A;  1WI5 A;  1GUN A;  1UE5 A;  3HZX A;  1X3F A;  3LWE A;  3RLO A;  1V8Q A;  3OTO L;  1OXS C;  4NP5 A;  1VQ6 A;  1CKO A;  1CK1 A;  2PMZ E;  4IUU A;  1WTW A;  1IBM L;  4ME5 A;  4ULL A;  2BOS A;  5KYL A;  1EQT A;  1LTS D;  2JXM B;  4WFN 3;  2ID0 A;  4O42 A;  4IPD A;  1S5C D;  3K0X A;  1KRS A;  4DU9 A;  3FVQ A;  4DV2 L;  3T4A C;  3HOW B;  1EWI A;  2L55 A;  1IHZ A;  3STB D;  3SDZ A;  3F2B A;  2QW7 A;  4KHP Q;  3E5S A;  2R6G A;  3OIP A;  5CV9 A;  3C1F A;  2DJF C;  3W3A A;  2F3W A;  1KNE A;  2JA7 H;  1CTM A;  4S3S A;  3W5O A;  3GQB A;  4PMC A;  4LF8 Q;  4LF4 L;  4BY7 G;  4G57 A;  3IRB A;  4FXG C;  4NDX A;  3MXU A;  5ELB A;  2HIV A;  1G6Z A;  4QJF A;  3QB3 A;  3RN2 A;  3F2C A;  4LAA A;  3S1N H;  1B53 A;  1JOO A;  2O5J C;  3N52 A;  4X64 Q;  3CQZ B;  5C4Z A;  5C44 B;  3I4N B;  1GKH A;  1Z47 A;  5FLX c;  1X3G A;  3K5O A;  1AE2 A;  2SNM A;  2E2H H;  1B3A A;  2JP1 A;  3I7F A;  4GOP C;  3ZYY X;  4A3D H;  1EY7 A;  3WDN A;  1CI3 M;  4JW0 A;  1QVF A;  1I4Q A;  3C46 A;  1UNS A;  2IX0 A;  3PIO 3;  1VQK A;  4RMF A;  4DV0 L;  1LUZ A;  2KCN A;  2KVM A;  1SMY C;  3NEL A;  3TRE A;  1S72 A;  1HNX L;  5DLQ E;  3W2D A;  4GNX C;  1VQI A;  3OPO A;  4BBR B;  4NMZ A;  3K5N A;  2A6E D;  5EKL A;  2UXD Q;  1LV9 A;  4OIK A;  3M4O B;  2NVT H;  4LUV A;  3ZJY C;  4HAE A;  3K58 A;  4DV1 L;  1EY4 A;  2EY5 A;  1L0Y B;  1DYQ A;  2EJF C;  4A3M B;  3MWY W;  2R92 H;  4O0A A;  4F88 A;  2KCM A;  4DV6 L;  3KDF B;  4NXN L;  1I50 H;  4HED A;  3EBE A;  1F2L A;  4A3G G;  1P16 A;  1SJH D;  3MXP A;  1TS5 A;  3GV6 A;  1O7Z A;  1SNQ A;  2EJM A;  4GN4 B;  5I9P A;  3NQT A;  4PNY A;  4I7Z C;  1CZW A;  1Y1V H;  2EVB A;  2IX3 A;  4RGN A;  4LMQ D;  1PTO H;  1ONL A;  2B2T C;  4TRD A;  1RCV D;  2YTX A;  3HKZ E;  1F77 A;  4KHP L;  5I2Y A;  2B2U A;  2CFM A;  3PO2 B;  1GUG A;  3DMU A;  2DN8 A;  2PZU A;  4LF8 L;  4U68 A;  4P73 A;  1M4V A;  1STB A;  2CWA A;  3Q22 A;  2I46 A;  2Q2T A;  4A3F B;  4JPB W;  4IN3 A;  3MHB A;  3JC6 6;  1PRT F;  4X64 L;  2AKW B;  4FF1 A;  4QL5 A;  4LWC A;  3V05 A;  2N8N A;  5IYC G;  3BG3 A;  4C1N K;  3S1Q B;  3UE1 A;  1VQ5 A;  3QG1 A;  4MN3 A;  1OXU A;  4OWX B;  5K36 G;  5E4W C;  3MXN B;  2PQE A;  3GTL B;  1QE6 A;  5IP7 G;  1HQR D;  1L1O A;  1EIY B;  1I4X A;  1SR3 A;  3HOZ G;  4K5X A;  1A8V A;  1HA6 A;  3SE0 A;  2QEX A;  1BBU A;  3PV0 A;  2QKI C;  4LJZ C;  1STH A;  1XJV A;  1Q81 C;  2Z0S A;  3J80 E;  4A3L G;  1VQJ A;  1STY A;  5EBC A;  2JA8 G;  1XPU A;  2ZXR A;  2HDM A;  1HNW Q;  1YNX A;  4NPS A;  2EYF A;  2WKD A;  1J5E Q;  3S2H H;  1TKW B;  1G6P A;  2ENB A;  3J7A V;  4GKJ Q;  4A3J B;  4DK3 C;  4RAU C;  2K5Q A;  2F1M A;  2UU9 Q;  2R7Z G;  2OQK A;  2Z1C A;  4A3E B;  2B29 A;  1WTV A;  3H91 A;  2DNC A;  4AYB E;  2ZJP A;  4UY8 C;  3C1E A;  1Q82 C;  3VYU A;  1TQO A;  1PFS A;  2UUC Q;  3NK9 A;  1PH7 A;  2RKS A;  1O7I A;  3UDF A;  2VQE Q;  5M5X H;  1X9N A;  3EIV A;  3TQY A;  2QF7 A;  3ITP A;  2XSC A;  1ZEQ X;  1U4M A;  3VR5 A;  1A0I A;  1ENC A;  1HH2 P;  4R1J A;  1H9K A;  2K1B A;  3OYY A;  4RHS A;  4B3T Q;  4K2L A;  4ODG A;  2H1E A;  5IT9 L;  1KDA A;  3CD6 A;  1M8A A;  2R61 A;  1CHQ D;  3TS2 A;  5CV4 A;  2G9H D;  2KUM A;  2UXB Q;  4BY7 B;  4K8I A;  3MC0 B;  4G7H C;  3PIP 3;  5JAV A;  1QNK A;  5C0X H;  3H15 A;  2ICI A;  1VQP A;  3FPP A;  5FJ8 H;  1DOL A;  4QIW E;  2FJ2 A;  4IFD H;  3A5U A;  1LT4 D;  2JSO A;  1VQG A;  3R2I A;  1EQR A;  2E5L L;  2HHH Q;  4QMG A;  1NTG A;  2F0M A;  5ELC A;  2N55 A;  1KAB A;  4HR7 B;  4JG2 A;  1IXR A;  3KLR A;  2K5W A;  2PW5 A;  4OWT B;  3M85 A;  5I6Y A;  2PO4 A;  1YJW A;  5T1G A;  3H6M A;  1GM5 A;  4XIG S;  3Q0A A;  4A93 G;  1GHJ A;  2HCI A;  4X3T A;  3HOY G;  3F1Z A;  5IYB G;  1FJG Q;  2R7F A;  3M4O H;  2FFK B;  3KYH C;  1X32 A;  1I4P A;  4DAV A;  3OIQ A;  1SNM A;  5C3E B;  4DR4 L;  5D65 A;  4A3K H;  3HG9 A;  1A3V A;  1J5E L;  4BY1 G;  5EGT A;  1W3S A;  4A3M H;  1LAC A;  5IYD H;  2OT2 A;  4RGO S;  3HOV G;  3GTK B;  4XYQ A;  4LW1 A;  2F0I A;  2UU9 L;  1BCP C;  5CV7 A;  3FMC A;  3K5L A;  2VNU D;  3D0F A;  2ZM6 Q;  2F0Q A;  1GOZ A;  2DNE A;  1I6H H;  5IGG A;  2JA6 H;  4A3G B;  3UDG A;  1PHJ A;  1HRJ A;  3GTO H;  1EQQ A;  4KKT A;  3J7A F;  1TWA H;  2PZW A;  2DY8 A;  4A3C G;  2PYK A;  5CYU A;  1BR9 A;  3GP7 A;  4P74 A;  5G3L D;  1X65 A;  4GNX B;  3K7A B;  4C3J G;  1DOM A;  4B3T L;  5FLX L;  2MUY A;  4K14 A;  5LL6 X;  5LMN W;  1MHW C;  2YYZ A;  4YCU A;  3NXW A;  1K83 B;  5COR A;  2D9U A;  2V1C C;  4P71 A;  2UXB L;  4NKL A;  1VQC A;  4L5R C;  2JN4 A;  1V1P A;  4C2M B;  1Q12 A;  5EKI A;  3LX0 A;  4IUR A;  1QVC A;  4L6T B;  3G7L A;  2LXJ A;  3HOU H;  4OO1 I;  1JCK B;  2MHV A;  1E22 A;  1G51 A;  1WCM H;  2J4X A;  3GTL H;  2HHH L;  4O1N A;  5ELN A;  4KY7 A;  3NBH A;  4AQY L;  3HOZ B;  5E4X A;  1X3Q A;  3CC4 A;  1FGB D;  2K32 A;  1N33 L;  1WJJ A;  1KTK A;  3NE5 B;  2PNH A;  1PH8 A;  2TSS A;  1RL2 A;  3A5Z B;  4B9X A;  1FJG L;  1SLJ A;  4KY5 A;  1I4G A;  2A6E C;  2BDO A;  5CGK A;  1KQS A;  2EYL A;  5BN3 A;  4OO1 G;  4FXD A;  1O7L A;  3URY A;  2JA8 B;  3FDT A;  3K6O A;  1HFG A;  2FMM A;  1QG7 A;  1F2M A;  5KNC A;  3A55 A;  2AHO B;  2NUC A;  1XNQ Q;  4PZ6 A;  2G9D A;  1AE3 A;  3GTG H;  1U9R A;  2R7Z B;  1MJC A;  1UEB A;  1KDB A;  2SEB D;  3NTH A;  3NPP A;  2ZM6 L;  1T5E A;  1KRT A;  3VYT A;  1XNR Q;  2F0K A;  3RN5 A;  2LY7 A;  3S2D H;  1PH6 A;  4KD3 A;  4EQP A;  3RD4 A;  4G7O C;  4DKA C;  1Q1E A;  2F0G A;  1E1O A;  3BYY B;  1HR0 W;  5HUR A;  4HIK A;  4WJW A;  2EYO A;  2V4D A;  3SVM A;  4XXE A;  1EU4 A;  1SYC A;  3HEJ A;  3SK5 A;  2J7Z A;  3M9B A;  5KND A;  1LTT D;  1O78 A;  3NHH A;  5JPM C;  1SYF A;  3ND8 A;  2GN5 A;  3D3R A;  3C3L A;  5JJK A;  4QGU A;  1FNU A;  3CP0 A;  1Q1B A;  3EVQ A;  1VMP A;  4WOR A;  3R8B A;  1OXT A;  4H0L C;  2R93 G;  1BKB A;  1EWH A;  2AQ2 B;  4Z9C B;  1YNN D;  3A0J A;  4Y7N B;  2MQH A;  4DK0 A;  4X62 Q;  5JJI A;  2E2I H;  1AP0 A;  2L4N A;  3I70 A;  1SYG A;  2Q2I A;  1LT3 D;  2B39 A;  4LF5 Q;  3FP9 A;  1E24 A;  2M2L A;  2L11 A;  1VF7 A;  1LYL A;  5C4J B;  3G6E A;  2OTJ A;  4A93 B;  2AUK A;  5C4X G;  1MJE A;  1DCZ A;  4F87 A;  1XYI A;  4K5V A;  3A74 A;  4DAP A;  3HOY B;  3H3V H;  1SFO B;  2F0J A;  1U5K A;  4C3I G;  1QZH A;  1CKN A;  3TP6 A;  4DPG A;  3PGZ A;  3NWT A;  3GTK H;  4BY1 B;  1XNQ L;  2IHF A;  2AQ3 B;  1NR4 A;  3GTQ H;  1GUS A;  3HOV B;  4YCV A;  2XN9 C;  2BA1 A;  1E2Z A;  2NN6 G;  2F52 A;  4KK7 A;  3AEV A;  4LFB Q;  1JT8 A;  1CHP D;  3DWA A;  3P20 A;  4DAY B;  1ASY A;  4BBS G;  2BCO A;  1K73 C;  5GAE C;  1XNR L;  5IWA Q;  4FDB A;  5AJ3 Q;  2Q8R E;  1QZG A;  5JEA G;  5GRO A;  1UE7 A;  2LXK A;  4A3F G;  1QVG A;  3ULP A;  3A7L A;  5JJL A;  3V96 A;  2G5D A;  1VQ9 A;  5DNF A;  2JK8 A;  1PFM A;  3M4Y A;  4X3K A;  3M4Q A;  3CF5 A;  2WII B;  2NVY B;  1VQE A;  4H02 A;  4C3H H;  3I4M G;  2KHI A;  4CBV A;  1E2W A;  1JQY D;  3PMF A;  4R8N A;  2A19 A;  1IKM A;  3CCU A;  2L0C A;  2EDG A;  3TSS A;  1GHK A;  4C3J B;  3J80 c;  2R7D A;  3VA7 A;  1LT5 D;  2Z9H A;  4JI8 Q;  4BXX G;  1A2U A;  2ZTC A;  3M7G A;  1ZKO A;  1PTO D;  1JC7 A;  3I73 A;  3PQI A;  3FHW A;  1JWM D;  1CKM A;  2B2V A;  1IW7 D;  2B2Y A;  5CR3 A;  3KLS X;  1A3T A;  1EZ6 A;  1NMF A;  4JBM A;  1BCP B;  1YIJ A;  1CUK A;  4TVA B;  5JOB A;  3H94 A;  1HNZ Q;  4ZLT F;  5BR8 L;  3HOX G;  1L1O C;  2CW0 D;  4PQX A;  1EIH A;  4L5Q A;  1F2Z A;  4YHH Q;  2HQE A;  3MFY A;  4X62 L;  4GN5 A;  3HKS A;  4N9T A;  1AZQ A;  5IP7 H;  1MIU A;  2EE1 A;  2I5L X;  2K5V A;  2K01 A;  1EOT A;  1TWG B;  4A3E G;  2ZXO A;  3RZD H;  2KCT A;  4IPC A;  1H9J A;  1JJ2 A;  2XRQ D;  2OEO A;  3RR5 A;  4DR5 Q;  5M5Y B;  3NSW A;  1Q7Y C;  4HIO A;  4YWK A;  3PO3 G;  3MA2 B;  2I5H A;  4DV3 Q;  4A3L H;  4LFA Q;  5GAH C;  2ZXP A;  1H95 A;  4N8F A;  2BH8 A;  4MHE A;  4FF4 A;  2XWJ B;  4A4I A;  2SNS A;  3KF8 B;  4KKU A;  1Z7T A;  3I8Z A;  1EY0 A;  4LFB L;  2BE5 D;  4HSV A;  2K33 A;  5M3F H;  1IL2 A;  2WB1 G;  1SJE D;  4H13 C;  4XQN A;  4FP5 D;  1SYB A;  4DUZ L;  1RHP A;  1SSO A;  4JI6 Q;  3EJI A;  5IWA L;  3T13 A;  3I4O A;  1Q3L A;  1EFI D;  1FNV A;  2ZTD A;  2NVQ B;  2LFN A;  3U50 C;  2DGY A;  3S16 B;  5DM7 3;  5I6W A;  1QOH A;  1ET9 A;  1VQB A;  4DV4 Q;  1EL0 A;  1JWU D;  3KDF A;  4IAL A;  2XGT A;  1MI2 A;  4R9W A;  2N3S A;  1X56 A;  3O13 A;  5LMU Q;  1BDO A;  3CPF A;  2K5H A;  2MJ8 A;  2F0T A;  4DUY L;  1NR2 A;  3BZK A;  2EZV A;  2B63 B;  3D4W A;  4JI8 L;  3ER0 A;  2YU9 H;  3E3X A;  3S14 H;  1MD2 D;  1G2T A;  1GVP A;  3PUZ A;  3BS1 A;  4OIJ A;  3KBX A;  1IKL A;  3FKI H;  3SHL A;  4B3M L;  3DXJ C;  1LTI D;  3I55 A;  4XYO A;  3HS0 C;  1NNX A;  3FEW X;  4JI0 Q;  3Q23 A;  1HNZ L;  4KD4 A;  3RZO H;  2QCP X;  1FYC A;  4KHV A;  1DD2 A;  5C3E G;  3MEH A;  3MFG A;  1SE3 A;  2R93 B;  2WP8 J;  1PVO A;  3SEB A;  4YWM A;  2EYJ A;  4YHH L;  1S40 A;  1I3Q B;  5FO7 B;  4JYA Q;  4TQU S;  4BS9 A;  1E3P A;  1H9M A;  1ZXT A;  1SE8 A;  1SYD A;  1JE4 A;  1II3 A;  3X3M A;  2F0P A;  4DR5 L;  1D8L A;  3DEO A;  1H9S A;  5I4D A;  2K5D A;  2RCF A;  1A63 A;  3WWV A;  3HOY H;  5C4X B;  5IYB H;  4A3I H;  4DV3 L;  1SFO H;  1GUO A;  4RKB A;  3KOJ A;  1PDQ A;  1TWH B;  1BNZ A;  1WOC A;  1VF5 C;  1FD7 D;  4V0B A;  3MXN A;  4E6I A;  4C3I B;  5C3X A;  4BY1 H;  2OF1 A;  2RBM A;  1N36 Q;  2JA5 G;  3HOV H;  1HFN A;  1TWC H;  3CCS A;  1XPR A;  3ND9 A;  1LAB A;  2KHS A;  3H0G H;  1SRU A;  3OMC A;  1LO5 D;  1HZ9 A;  1PH4 A;  4ME3 A;  3JAM c;  5J39 A;  3DM1 A;  1D1I A;  4RKL A;  2EY6 A;  2M9V A;  4JCV E;  1TY0 A;  1LLR D;  1BQQ T;  4BBS B;  1CFM A;  2SOB A;  4RHR A;  4JBK A;  4K6D A;  4OX9 Q;  5KGU A;  1F9R A;  5GAD C;  4LUO A;  1FGU A;  2RDF A;  4HJ8 A;  1V43 A;  3MZ5 A;  1XXG A;  2VXW A;  2QIL A;  4DV4 L;  4R4Q A;  3L0O A;  2Z6K C;  3CPW A;  1KAA A;  1YNJ C;  4N8X 1;  2NVX B;  2IJ0 A;  1UEA B;  1PZI D;  2PCF B;  2XNA C;  3CCE A;  3S1R H;  3I4M B;  1F9Q A;  4HJ9 A;  5EPJ A;  5LMU L;  2E2J H;  4J6H A;  1JWS D;  5A2Q E;  1RF2 D;  4OEL B;  2PQA B;  2PI2 E;  3CW2 C;  1CM9 A;  1OTC A;  1B3Q A;  1X3E A;  3S1M B;  5FLM H;  3DLL A;  1E7Z A;  2TMP A;  3DWP A;  4QQB X;  5EAY A;  2RDG A;  2NB0 A;  4HSP A;  1LTA D;  4JI0 L;  2LKV A;  3UDX A;  1NE3 A;  2F3I A;  4ID6 A;  4DNI A;  3SK6 A;  2UXD L;  3HOX B;  4J8Q A;  2F03 A;  3SXH A;  3GTM H;  1K3R A;  4DFA A;  5BN4 A;  1YNN C;  1GXD C;  4JYA L;  4R4I A;  2LMC B;  4GS3 A;  4PMB A;  1ASZ A;  5M3M G;  1EEI D;  1N9W A;  1TWF B;  1QWY A;  1Z9F A;  3QR8 A;  3TZD A;  1XMO Q;  1MBY A;  1S5B D;  1U4L A;  3WOE A;  2CWP A;  1HQM C;  2UUB Q;  1I4R A;  3PO3 B;  1HJP A;  1N34 Q;  2QEJ C;  2RHS B;  3J81 c;  1N36 L;  3HOW H;  3K80 C;  1W6J A;  1P8L A;  2CQO A;  4F7X A;  2ZJR A;  3KLS A;  5K5P A;  3GV3 A;  3SR1 A;  2JA7 G;  1T5X D;  1PV4 A;  1SAP A;  2HQL A;  1A62 A;  1GJX A;  4APV A;  2WB1 B;  5GAG C;  1KIX A;  2K52 A;  1HZC A;  1YEZ A;  1PH3 A;  1LTB D;  4K5W A;  2N78 A;  4OX9 L;  4EQO A;  2ASB A;  3L9A X;  4DR3 Q;  3J80 i;  1XMQ Q;  5CV6 A;  2D5D A;  1O7Y A;  2A73 B;  3PF4 A;  3CQZ H;  1EWC A;  5LMN Q;  2CQA A;  2E2D C;  5C44 H;  3I4N H;  3C2P A;  2X6G A;  1HHV A;  1K8A C;  3NQI A;  2D0O A;  1GD7 A;  1QUQ A;  3D6W A;  3DUZ A;  4KLK A;  4A3D G;  2O4X A;  1K9M C;  2J0T D;  1VQN A;  3CC2 A;  4DR1 Q;  3MTS A;  1PH5 A;  2XVS A;  3D4R A;  4JI2 Q;  3LWU A;  1PTO C;  2KOL A;  3K0Y A;  1D5X C;  4ZAI A;  2UUA Q;  3CXC A;  3A8K E;  4EVO A;  2YTV A;  5HY6 A;  1WD0 A;  1PFB A;  1UUP A;  2ALY B;  4BBR H;  1L2F A;  1B70 B;  3VDY A;  5AFW A;  5M5W B;  4R8I A;  1HNW L;  1QJO A;  2R92 G;  4GKJ L;  2SDF A;  1B9M A;  4JV5 Q;  1WTQ A;  3D6C A;  1DM0 B;  2RA4 A;  5EQ0 A;  1GO3 E;  1LTR D;  3S17 B;  1XMO L;  1WD1 A;  4A3B G;  3BDC A;  1A6X A;  4C1N I;  3TZU A;  2UUB L;  4QB4 A;  4DR6 Q;  1SXT A;  4R4O A;  4GOP B;  1A15 A;  1Y1V G;  5J22 A;  1N34 L;  2UUC L;  2E76 C;  2Q2U A;  3M3Y B;  1NSN S;  4DK6 C;  2ZT9 C;  4DNR B;  1IYV A;  2VQE L;  4AIM A;  1K8O A;  1ML0 D;  2JA5 B;  1D5Z C;  1U0L A;  2Y0S G;  1RDP D;  1STN A;  2NZ1 D;  3STB C;  1VMC A;  4I65 A;  5D14 A;  1WFQ A;  2PI2 A;  5IIF A;  2IHE A;  1A2T A;  4NW2 A;  3PO2 H;  4DK1 A;  2EPB A;  3KBG A;  2VUM G;  1ESR A;  1HR0 Q;  1NMG A;  1PMR A;  2F0L A;  2ICE C;  2GVB A;  3ERO A;  2F0H A;  5E7N A;  4A3F H;  1HXY D;  1F9P A;  2P5Z X;  1PXU A;  4DR3 L;  2LSS A;  1XMQ L;  3S15 B;  4XQQ A;  3G4S A;  3JAM E;  3U4V A;  2UXC Q;  4JK1 C;  5LMN L;  2ES2 A;  3GTP B;  3S1Q H;  3I4M H;  1FVI A;  1TXY A;  1ICW A;  1JJG A;  2KEC A;  1PRT D;  4XT3 B;  3OHX C;  3AMU A;  2B2Y C;  1Q8I A;  1ET6 A;  4DR1 L;  1F2Y A;  2B8F A;  1BVS A;  4BXX H;  3AYH B;  1EQV A;  1SMY D;  3HRZ C;  1L0X B;  3OMG A;  4CKC A;  3F2U A;  2IL8 A;  3TME A;  4OHJ A;  1RTO A;  2UUA L;  3KUP A;  4GKK Q;  1TT2 A;  5IP9 H;  4ZK9 B;  3D4D A;  3F2D A;  1EZ8 A;  2A5H A;  1DXM A;  4CKB A;  1Y1W G;  4DXG A;  1D2B A;  2NZH A;  2QDL A;  4J15 A;  2PW7 A;  3HOX H;  1BCP F;  4Q0F A;  3QWN A;  4NXM Q;  3I72 A;  1CSQ A;  1N32 Q;  3Q8D A;  3QIA A;  4KJO A;  2F3V A;  4L5S A;  4A3J H;  2JE6 I;  2KCC A;  1XWE A;  4POG A;  1XTD A;  3T16 A;  4JV5 L;  1KLU D;  1NBW A;  2ZJQ A;  3RMH A;  1KXL A;  1SNC A;  1X55 A;  4A3E H;  1KDC A;  4UHV A;  4ZKB B;  5M3M B;  3Q24 A;  5D3I B;  4PMW A;  1PZK D;  4ABN A;  3PIO A;  3N6R A;  2MO0 A;  5ELF A;  4G7Z C;  1S4Z A;  3VYR A;  1EYA A;  4DR6 L;  1TS3 A;  1KHI A;  5JEA J;  3GO5 A;  3JAM i;  1V1P B;  4UDU C;  1RD9 D;  4K6L A;  2K75 A;  1JB7 A;  2ZTE A;  1YHQ A;  1VQD A;  1HPC A;  3ONA B;  4CJ1 B;  1FL0 A;  4P75 A;  1FNW A;  2F0U A;  3RUZ A;  4BWG B;  1LT6 D;  5ELE A;  1E0B A;  2JA7 B;  3H09 A;  2B63 G;  2F0O A;  1YJ9 A;  4X66 Q;  4JI1 Q;  1R4P B;  3U58 A;  3J81 E;  2XTI A;  4HIM A;  5JVH 3;  1I94 Q;  1HR0 L;  3NBH B;  4LNQ A;  4BY7 H;  4HMJ A;  2BDN A;  1EFW A;  3OOC A;  4C56 C;  5IOD A;  5FJ8 G;  3S1N B;  2CH4 A;  2I5M X;  4IFD G;  1LTL A;  4B3S Q;  1HTP A;  4MZ9 A;  1ROD A;  5A35 A;  5CBE E;  4NB3 A;  2I07 B;  3J7A 5;  3FPU B;  2JEB I;  1OXX K;  4U67 3;  1GUW A;  4L8J A;  2E2H B;  4J1M A;  1O80 A;  4ZRZ A;  4DAY A;  2L12 A;  2IX1 A;  2K04 A;  1H9R A;  4A3D B;  3MEF A;  3P1H A;  4CDD C;  1VS0 A;  2RDH A;  4LFC Q;  5EJW A;  1Y14 B;  2NN6 I;  4GKK L;  1NJI C;  4B3R Q;  2IY5 B;  2DJG C;  3SK8 A;  2QGQ A;  4RWS C;  1ILQ A;  4A3K G;  2NVT B;  1ZYR D;  5C3E H;  2PPB C;  3UDI A;  3CHB D;  4LK1 C;  4NXM L;  1Q46 A;  5IYD G;  4JOI A;  3MAQ A;  1N32 L;  1IBK Q;  3E0J A;  4R4T A;  2L15 A;  4PZ7 A;  1XPO A;  2R92 B;  1CA5 A;  4HTH A;  3TS0 A;  1I50 B;  2WAC A;  3VYS A;  2O2L D;  4X65 Q;  2K6A A;  1X6O A;  1IBM Q;  3S17 H;  3W1B A;  2JA6 G;  4A3G H;  2OQ0 A;  3CCL A;  4A3B B;  3K5M A;  3A8I E;  4DV7 Q;  3K8A A;  1Y8O B;  1Y1V B;  2OTL A;  1PH9 A;  1PTO B;  1C0A A;  2OXP A;  3KF6 B;  1JE5 A;  2B2U C;  2KQ3 A;  2Y0S B;  4WRD A;  1BF4 A;  3K7A H;  2M00 A;  4PV1 C;  1EY5 A;  4JI4 Q;  4FXK C;  3TP5 A;  1K83 H;  4X66 L;  4JI1 L;  2VUM B;  5CV5 A;  5ISR A;  3GDE A;  3ULL A;  1I94 L;  2D62 A;  4ZCK A;  5TSS A;  5ELD A;  4C2M H;  3BU2 A;  1HUN A;  3TDQ A;  4B3S L;  4KHZ A;  2Z8L A;  1C9O A;  4DAM A;  3QJY A;  3HOU G;  2A6H D;  4POF A;  4HCS A;  5IYC H;  1WCM G;  4DF7 A;  3DWQ A;  4QF4 A;  3AFQ A;  5K36 H;  1K8G A;  1MKH A;  3NTK A;  2KJX A;  2DUD A;  1HA5 A;  2WV6 D;  4LF5 L;  4LFC L;  3I91 A;  3HOZ H;  3OW2 A;  5E1F A;  1VQM A;  1R9T B;  3QOJ A;  1CSP A;  1OO9 B;  4B3R L;  2HUG A;  5IE8 A;  3TEH B;  1XX8 A;  1SNP A;  1Y1W B;  3PIP A;  2Q8I B;  1I6V C;  1WVL A;  4ILW A;  4IPH A;  2JA8 H;  3S2H B;  5CMD A;  3A8J E;  1IBK L;  1RTN A;  1WYD A;  1BCP D;  5J3B A;  1WTX A;  2WAQ G;  4I7A A;  5NUC A;  2CCZ A;  3W1G A;  2WB1 E;  3CRL C;  2R7Z H;  3GD7 A;  2E75 C;  3VR2 A;  3WOF A;  3HP3 A;  3E0E A;  5EKK A;  2EYP A;  5M3M H;  5CBA E;  1HTL D;  4X65 L;  3BVZ A;  4JBJ A;  1E2V A;  5C6A A;  2HIX A;  1YZ6 A;  3TP7 A;  2C5C A;  3IFT A;  5LHY 1;  3TP8 A;  3U4Z A;  5C3W A;  1YVC A;  2RHQ B;  1ILP A;  4IUV A;  5AJ3 L;  4DV7 L;  4A75 A;  1CA6 A;  3ICE A;  2VS1 A;  5CC4 A;  5M5X B;  5EPK A;  1JOR A;  1W2B A;  2L5T A;  2X69 A;  1AZP A;  1VQO A;  4K0K Q;  1IYJ B;  1M1K C;  2PNR C;  4ZUJ A;  2Q8T A;  3H3V C;  5F2D A;  5C5M A;  1IL8 A;  3KK7 A;  4JI4 L;  1QB5 D;  2GA4 B;  1SE4 A;  2MFI A;  1AFP A;  1TY2 A;  2FMC A;  2B2W A;  1K8M A;  2K4K A;  5DAU A;  3MXG A;  3HFZ B;  4DNT B;  1S5E D;  1R4Q B;  5IOC A;  1EYD A;  1VQH A;  3GTJ B;  3CCM A;  3H3V I;  2A69 D;  3PUW A;  4FNF A;  3K81 C;  5I9O A;  2HT1 A;  2VB2 X;  1PRT C;  4Y7N H;  3QO2 A;  3BVG A;  3AB9 A;  3VR4 A;  4KN4 C;  4IJL A;  1SDF A;  1WTR A;  1XTC D;  4JI7 Q;  2AQ1 B;  4YCW A;  4DGZ A;  3BZD B;  1I5F A;  4IQZ A;  1BBX C;  2Z4I A;  4QCL A;  4FF2 A;  2JEA I;  4H44 C;  4R4C A;  2EY2 A;  4L5T A;  2AWN A;  4FF3 A;  4KI0 A;  1EUJ A;  5C4J H;  3CAM A;  3J7Z C;  2E8G A;  1UE1 A;  1B2T A;  4A93 H;  2NBF A;  4PZ8 A;  4UP9 A;  4FVM A;  5FO9 B;  1STA A;  4A3K B;  4LFA L;  1K3B C;  1WTH A;  4LF7 Q;  4B08 A;  1TR5 A;  2PQA A;  1I4H A;  3OW7 A;  4RGM A;  5EBD A;  3TN2 A;  1TS2 A;  4IOC A;  1S5D D;  1WTP A;  2C9O A;  3LGJ A;  1IBL Q;  3K57 A;  3EFX D;  1I6H B;  2JA6 B;  1Z6H A;  4A3B H;  2O5I C;  2B8G A;  1MSG A;  4MIU A;  3GTO B;  3CRK C;  2XIW A;  4JI6 L;  3D31 A;  1SBB B;  2F4I A;  1TWA B;  4K8J A;  1B7Y B;  5G3L F;  4DR7 Q;  2K7V A;  3I2Z A;  4XQJ A;  3EN2 A;  4M1U B;  3R3O A;  4C3H G;  4K0K L;  4GLA C;  1WTO A;  4A3C H;  2NVY H;  4B9W A;  2K28 A;  3UE0 A;  4O2D A;  4C3J H;  1X54 A;  4AH6 A;  3HKZ G;  2VUM H;  2NTS A;  2E74 C;  3X3N A;  2VZA A;  1VDZ A;  1Q8K A;  1U4P A;  1JOK A;  4KV6 A;  4HJ5 A;  4LF9 Q;  2IT1 A;  2R3Z A;  2A68 D;  1PH1 A;  1MSH A;  2CVR A;  2VQF Q;  1RIP A;  3ERQ A;  4OON A;  1CT1 D;  4IUQ A;  4QY7 A;  1H9S B;  4X3S A;  1JB3 A;  1LTG D;  2D0P A;  2MO1 A;  4K2K A;  3J7Y W;  4BA1 I;  4A76 A;  1EOV A;  3HOU B;  1C7Y A;  2E5L Q;  3TBI B;  1WCM B;  1STG A;  2MNA A;  3NEN A;  5FO8 B;  1CQV A;  4YY3 Q;  4V19 0;  1UAP A;  2F0N A;  2NWG A;  4ZQ3 A;  4CDE C;  2I0Q A;  4FO2 A;  2JJQ A;  2NTT A;  4JI7 L;  1K0R A;  3E9I A;  2BH2 A;  1TWG H;  2F0W A;  2PZT A;  2K03 A;  2JQO A;  4F8M A;  4CDF C;  5I2X A;  2BA0 A;  1V1O A;  1Y8P B;  3E6Z X;  5IT9 E;  1B8A A;  1R9T H;  2AWO A;  1DON A;  1EY8 A;  5M5Y H;  4GN3 B;  1Y1W H;  3I4L A;  1YJN A;  1KAW A;  4DR4 Q;  4P72 A;  1AEX A;  1J8I A;  4CJ0 B;  1ZYR C;  3K59 A;  4OO1 H;  3J81 j;  2MPM A;  4EX5 A;  2F0F A;  4LF7 L;  1PA6 A;  4HJA A;  5C5L A;  3KJO A;  5A2Q L;  5IGB A;  5KEE A;  1BO0 A;  3GTG B;  1YI2 A;  3DEP A;  2WAQ B;  4L63 B;  2D2C C;  3IKJ A;  1RJT A;  1KNA A;  5M3F G;  4CJ2 C;  1PYW D;  1G2S A;  2MP1 A;  1IBL L;  1AH9 A;  3A56 A;  1HZB A;  1L1O B;  5CV8 A;  3SK4 A;  4AYB G;  1E1T A;  2NVQ H;  3J80 L;  1PLF A;  3S2D B;  2PMZ B;  4DXF A;  3G6J B;  4QUC A;  3S16 H;  2F0E A;  1NAP A;  2YTY A;  4DR7 L;  1VCI A;  1EEF D;  1F9S A;  4H7B A;  3Q6S A;  1Y8N B;  4Q5V A;  3VA5 A;  3T1H Q;  1U4R A;  2KA7 A;  2IWH A;  1YHA A;  2F0D A;  2WIN B;  2YV5 A;  3BJU A;  3CCQ A;  4JI5 Q;  2WFW A;  2B63 H;  4RCN A;  3KLW A;  4GOP A;  2EY1 A;  1BOS A;  2CKZ B;  5JVG 3;  4LF9 L;  1JIC A;  3NUC A;  3FKI G;  5DEH A;  3UI2 A;  2VQF L;  1KL9 A;  5KIX A;  2N88 A;  4JBW A;  1VQ8 A;  1IW7 C;  3QOL A;  1D5M C;  1TU2 B;  2F0S A;  2QA4 A;  1UWV A;  1S3O A;  3GTJ H;  1EIF A;  1SNO A;  2R93 H;  2A6H C;  4GNX A;  4GLV B;  3S24 A;  1GUT A;  2CW0 C;  1UE6 A;  2WKC A;  3BDL A;  2E2I B;  1I3Q H;  4IPG A;  4YY3 L;  1SRO A;  3L7Z C;  1Y69 U;  4WJ3 M;  2VB3 X;  4G4K A;  4AQY Q;  1JR0 D;  1W6K A;  3CKI B;  4KN7 C;  4UP8 A;  4Y52 H;  5DM6 3;  3I3C A;  1N33 Q;  5FOB B;  5FLX E;  1HCZ A;  4EGV A;  3HGB A;  1V9P A;  4A3I G;  4JOI C;  5C4X H;  5IGF A;  1EY9 A;  2EQS A;  3PCO B;  5LL6 S;  1SYE A;  1KC8 C;  2OCE A;  1TWH H;  1SND A;  2K50 A;  2Y0S E;  4C3I H;  2FHT A;  1B50 A;  4OEM B;  3GTQ B;  3FRP B;  3H0G G;  1DZ1 A;  2VY3 A;  1PZJ D;  4JI3 Q;  5FKA C;  2DY7 A;  2CH4 W;  4DV5 Q;  3DM3 A;  2EXZ A;  3CCV A;  1BXT A;  2NN6 H;  4HJ7 A;  1CZG A;  1QUQ B;  1AN8 A;  2B2T A;  1ESF A;  4MTK A;  2RCN A;  1NCV A;  3T51 B;  2HDL A;  3P7J A;  4TKO B;  2BE5 C;  3BVM A;  1D6E C;  4BBS H;  1TVX A;  1PRT B;  5IGC A;  1V1Q A;  5D3D A;  3M4P A;  1IYU A;  4OGQ C;  3F8T A;  3VR6 A;  5HGT A;  1L0W A;  1BUV T;  5JEA H;  5C0X J;  3E9H A;  1SN8 A;  4ZUI A;  4HCE A;  3IL8 A;  1JOQ A;  4IFD J;  2NVX H;  4C3H B;  3DHQ A;  1PTO F;  2K14 A;  3T1H L;  3RLF A;  1G91 A;  2RQX A;  1MGS A;  2Z6K A;  1N8R C;  3LNN A;  2L1B A;  4HID A;  2FXQ A;  3NBI A;  2AUJ D;  2B2V C;  4JI5 L;  2KBN A;  3HKZ B;  5FLM G;  4JI2 L;  4DA2 A;  3S1M H;  1B1Z A;  4BA2 I;  1KD1 C;  2KED A;  2RF4 A;  2HCC A;  5COY A;  3M7N A;  5KRU A;  2X6L A;  2LS0 1;  1EU3 A; 
#chains in the Genus database with same CATH homology
 2KEN A;  4WJ4 A;  3UDF A;  2VQE Q;  3RZO H;  5M5X H;  2OTL A;  1PH9 A;  5C3E G;  1X9N A;  3EIV A;  3TQY A;  1C0A A;  4PG3 A;  2B3G A;  2WP8 J;  1PVO A;  3KF6 B;  4YWM A;  4YHH L;  1JE5 A;  1PYS B;  4IJH A;  1S40 A;  1A0I A;  1HH2 P;  4R1J A;  3RNU A;  4JYA Q;  4TQU S;  1E3P A;  3OYY A;  1G29 1;  1SE8 A;  3K7A H;  4B3T Q;  3ULJ A;  4MNO A;  2NZO A;  1DGS A;  4JI4 Q;  3CD6 A;  3I56 A;  1XNR L;  1YIT A;  3TS2 A;  1TWF H;  1K83 H;  4X66 L;  4JI1 L;  4DR5 L;  1D8L A;  2VL6 A;  2UXB Q;  3GDE A;  3ULL A;  4LUZ A;  1I94 L;  2D62 A;  4JC0 A;  1A63 A;  3WWV A;  3HOY H;  4C2M H;  3BU2 A;  5IYB H;  4DV3 L;  3T1Y Q;  4A3I H;  1SFO H;  3PO3 H;  3H15 A;  5H1S E;  4IOA A;  3KOJ A;  4MTN A;  1VQP A;  4B3S L;  5FJ8 H;  4QIW E;  4KHZ A;  1VQA A;  3A5U A;  1J6Q A;  1WOC A;  1C9O A;  4DAM A;  2F4V Q;  4BY1 H;  4EQ5 A;  3HOW G;  1N36 Q;  3HOU G;  3CME A;  1JJC B;  1VQG A;  4POF A;  1PYB A;  1HZA A;  5IYC H;  3PUX A;  5C0X I;  1WCM G;  2JA5 G;  2A8V A;  3HOV H;  2K5N A;  1TWC H;  3CCS A;  1XPR A;  4IFD I;  1EQR A;  2E5L L;  2HHH Q;  4JI3 L;  3H0G H;  1NTG A;  3AFQ A;  1SRU A;  3CCJ A;  4DV5 L;  4JG2 A;  4ALP A;  1HZ9 A;  1PH4 A;  1K8G A;  4ME3 A;  1IXR A;  1MKH A;  1VQF A;  3JAM c;  2DUD A;  1VQ4 A;  1T9H A;  4LF5 L;  4LFC L;  4JCV E;  3HOZ H;  4OWT B;  3OW2 A;  3M85 A;  3G48 A;  1YJW A;  1GM5 A;  4XIG S;  3CCR A;  4A93 G;  1VQM A;  4JBK A;  1YBY A;  1CSP A;  4OX9 Q;  4B3R L;  5IE8 A;  3HOY G;  3TEH B;  5GAD C;  3F1Z A;  1FGU A;  4LUO A;  5IYB G;  2R7F A;  3PUV A;  5C0X G;  4HJ8 A;  1EYG A;  1FJG Q;  3KYH C;  3M4O H;  1V43 A;  3PIP A;  5HGQ A;  5C44 G;  3I4N G;  4DV4 L;  2JA8 H;  4R4Q A;  4IPH A;  4A3K H;  3L0O A;  2Z6K C;  3CPW A;  1J5E L;  4DR4 L;  4BY1 G;  4A3M H;  1W3S A;  1IBK L;  2UXC L;  5IYD H;  3PUY A;  3HOV G;  1WYD A;  3CCE A;  3S1R H;  5J3B A;  4LW1 A;  4HJ9 A;  5LMU L;  2WAQ G;  2CCZ A;  2E2J H;  2UU9 L;  3W1G A;  3KFU A;  2WB1 E;  2R7Z H;  1Q86 C;  3GD7 A;  2A1A A;  5M3M H;  2PQA B;  3E0E A;  5IY0 A;  2VNU D;  2PI2 E;  3CW2 C;  5ELO A;  4X65 L;  3D0F A;  1OTC A;  2ZM6 Q;  1X3E A;  4JBJ A;  5FLM H;  1I6H H;  2HIX A;  2JA6 H;  1YZ6 A;  3DLL A;  3UDG A;  1E7Z A;  3G71 A;  1PHJ A;  3U4Z A;  4QQB X;  5EAY A;  1LM0 A;  1YVC A;  2RHQ B;  1EQQ A;  1M90 C;  3GTO H;  5AJ3 L;  4BBR G;  4DV7 L;  4A75 A;  3KF6 A;  4JI0 L;  5BR8 Q;  3ICE A;  2VS1 A;  1TWA H;  4DR2 Q;  3UDX A;  1W2B A;  1NE3 A;  2F3I A;  4LF6 Q;  4A3C G;  4DNI A;  1VQO A;  2UXD L;  4K0K Q;  1VQ7 A;  5M5W H;  2VW9 A;  3GTM H;  1K3R A;  1IYJ B;  4A3M G;  4P74 A;  1M1K C;  4JYA L;  1X65 A;  4R4I A;  2C35 B;  1YHB A;  4GNX B;  4GS3 A;  4B3T L;  1ASZ A;  5M3M G;  4OWW B;  4IO9 A;  5LMN W;  4UP7 A;  4JI4 L;  2YYZ A;  3RLN A;  2Q2H A;  1N9W A;  4YCU A;  3OTO Q;  3AQQ A;  1Z9F A;  2MFI A;  2V1C C;  4P71 A;  1XMO Q;  2UXB L;  1VQC A;  2EXD A;  3J81 i;  4L5R C;  1JMC A;  2CWP A;  2UUB Q;  2N49 A;  2EIF A;  3T1Y L;  1HJP A;  1Q12 A;  1BBW A;  3PSI A;  2K4K A;  1N34 Q;  1D7Q A;  3HFZ B;  2ATW A;  4X6A H;  3M3Y H;  1QVC A;  2F4V L;  3NEM A;  1VQH A;  2RHS B;  3J81 c;  3CCM A;  3H3V I;  3ERS X;  4DV2 Q;  1N36 L;  1SMX A;  4YWL A;  3PUW A;  2LXJ A;  3HOW H;  3K81 C;  3HOU H;  3K80 C;  4OXP A;  1P8L A;  2HT1 A;  2JA5 H;  4OO1 I;  3KJP A;  1E22 A;  2CQO A;  1G51 A;  1WCM H;  4Y7N H;  3GTL H;  2ZJR A;  2HHH L;  4IJL A;  4JI7 Q;  2GVA A;  4UPA A;  4YCW A;  3BZC A;  5ELN A;  2JA7 G;  3TRZ A;  1I5F A;  3PO2 G;  1PV4 A;  4AQY L;  2JEA I;  4DUZ Q;  2HQL A;  1A62 A;  4LF4 Q;  4APV A;  4GLX A;  4R4C A;  3CC4 A;  4L5T A;  5GAG C;  2AWN A;  1KIX A;  2K52 A;  1HZC A;  1EUJ A;  1WJJ A;  3B6Y A;  3CAM A;  4KI0 A;  2E8G A;  1YEZ A;  5C4J H;  3J7Z C;  2PNH A;  1PH3 A;  1PH8 A;  1VQL A;  2N78 A;  4OX9 L;  4A93 H;  2ASB A;  1RL2 A;  2H5X A;  3AFP A;  3A5Z B;  4DR3 Q;  1SLJ A;  1FJG L;  4PZ8 A;  4UP9 A;  3J80 i;  1KQS A;  4OO1 G;  1XMQ Q;  3PF4 A;  3S15 H;  3CQZ H;  4LFA L;  5LMN Q;  5C44 H;  4LF7 Q;  3I4N H;  3L2P A;  2PQA A;  2AHO B;  5IT9 c;  1XNQ Q;  3GTP H;  1K8A C;  4PZ6 A;  2D0O A;  1GD7 A;  1QUQ A;  1AE3 A;  1NY4 A;  4DUY Q;  4KLK A;  4A3D G;  3K7U C;  1CKN B;  1K9M C;  3GTG H;  1VQN A;  1MJC A;  4IOC A;  3CMA A;  3CC2 A;  1UEB A;  4DR1 Q;  1PH5 A;  4JI2 Q;  2OWO A;  1OXV A;  4RG1 A;  4DV0 Q;  4K0K L;  2ZM6 L;  3LGJ A;  1IBL Q;  1KRT A;  4B3M Q;  4A3B H;  5IP9 G;  2UUA Q;  1XNR Q;  3CXC A;  1HNX Q;  2YTV A;  5HY6 A;  3RN5 A;  4JI6 L;  3D31 A;  3S2D H;  2AMC B;  2ALY B;  4BBR H;  1B7Y B;  1L2F A;  1PH6 A;  4DR2 L;  3I2Z A;  4DR7 Q;  3EN2 A;  4LF6 L;  1B70 B;  4DKA C;  1Q1E A;  2KHJ A;  3CC7 A;  3VDY A;  1E1O A;  2JA9 A;  2WAQ E;  4GLA C;  3SGI A;  1HR0 W;  4A3C H;  2NVY H;  4A3J G;  4DV1 Q;  1HNW L;  1PH2 A;  4HIK A;  2R92 G;  3PF5 A;  4GKJ L;  4XTC S;  3UE0 A;  4DV6 Q;  4JV5 Q;  4O2D A;  1IZ6 A;  5GQO A;  4NXN Q;  4C3J H;  1X54 A;  1WI5 A;  4AH6 A;  1UE5 A;  3HKZ G;  1X3F A;  3M9B A;  3RLO A;  2VUM H;  3OTO L;  1GO3 E;  1OXS C;  1VQ6 A;  1CKO A;  2VZA A;  2PMZ E;  1XMO L;  1Q8K A;  1IBM L;  4LF9 Q;  4HJ5 A;  4A3B G;  2IT1 A;  1PH1 A;  2VQF Q;  1RIP A;  2GN5 A;  2UUB L;  5JJK A;  4OON A;  4QGU A;  4DR6 Q;  2ID0 A;  4QY7 A;  4R4O A;  4GOP B;  1Y1V G;  3CP0 A;  1Q1B A;  1N34 L;  2UUC L;  2Q2U A;  4DK6 C;  4IPD A;  1OXT A;  2D0P A;  2MO1 A;  3K0X A;  2R93 G;  1KRS A;  1BKB A;  2VQE L;  4DV2 L;  4AIM A;  1EWI A;  4BA1 I;  4A76 A;  1EOV A;  1C7Y A;  2E5L Q;  1U0L A;  2Y0S G;  3A0J A;  5JJI A;  2MQH A;  3STB D;  4X62 Q;  2MNA A;  2E2I H;  3NEN A;  3F2B A;  4YY3 Q;  4KHP Q;  2R6G A;  3STB C;  2I0Q A;  1WFQ A;  4JI7 L;  2JJQ A;  2PI2 A;  2Q2I A;  1K0R A;  3FP9 A;  2IHE A;  4LF5 Q;  3E9I A;  1E24 A;  3PO2 H;  2BH2 A;  1TWG H;  2JA7 H;  3W5O A;  4LF8 Q;  2JQO A;  4LF4 L;  2VUM G;  2BA0 A;  4BY7 G;  1LYL A;  1B8A A;  1R9T H;  3IRB A;  2AWO A;  1HR0 Q;  1NMG A;  3G6E A;  2HIV A;  2GVB A;  4QJF A;  5M5Y H;  2OTJ A;  3RN2 A;  5C4X G;  1MJE A;  4GN3 B;  5E7N A;  4A3F H;  1Y1W H;  3F2C A;  4DR3 L;  3A74 A;  3S1N H;  3H3V H;  1YJN A;  1KAW A;  4DR4 Q;  1U5K A;  2LSS A;  4P72 A;  1XMQ L;  4X64 Q;  1QZH A;  1CKN A;  3G4S A;  3J81 j;  3U4V A;  4EX5 A;  2UXC Q;  5LMN L;  4DPG A;  1GKH A;  1Z47 A;  2ES2 A;  3PGZ A;  4LF7 L;  5FLX c;  1X3G A;  3GTK H;  1XNQ L;  1PA6 A;  1AE2 A;  2IHF A;  4HJA A;  1FVI A;  3KJO A;  1TXY A;  2E2H H;  3GTQ H;  3I4M H;  1JJG A;  3I7F A;  4YCV A;  4GOP C;  2BA1 A;  1YI2 A;  2NN6 G;  2F52 A;  4A3D H;  3AEV A;  4LFB Q;  1JT8 A;  4DR1 L;  1QVF A;  5M3F G;  4BXX H;  1BVS A;  2IX0 A;  3AYH B;  1VQK A;  4RMF A;  4DAY B;  4DV0 L;  1LUZ A;  1ASY A;  1IBL L;  4BBS G;  1K73 C;  1AH9 A;  3NEL A;  3TRE A;  1HZB A;  1L1O B;  5GAE C;  2UUA L;  5IWA Q;  4FDB A;  4AYB G;  5AJ3 Q;  1S72 A;  1QZG A;  5JEA G;  4GKK Q;  5IP9 H;  1HNX L;  1E1T A;  5DLQ E;  2NVQ H;  4GNX C;  3F2D A;  5GRO A;  1UE7 A;  2LXK A;  4A3F G;  1VQI A;  1Y1W G;  1QVG A;  3ULP A;  5JJL A;  2NZH A;  3S16 H;  2YTY A;  1VQ9 A;  4DR7 L;  2UXD Q;  1VCI A;  2JK8 A;  4J15 A;  3HOX H;  2NVT H;  3M4Q A;  3CF5 A;  4LUV A;  4NXM Q;  3ZJY C;  4H02 A;  1VQE A;  1CSQ A;  1N32 Q;  3Q8D A;  4C3H H;  4DV1 L;  4L5S A;  3I4M G;  2KHI A;  3T1H Q;  4A3J H;  2JE6 I;  4POG A;  1XTD A;  2A19 A;  2R92 H;  1YHA A;  4O0A A;  3CCU A;  2KCM A;  4DV6 L;  4JV5 L;  2YV5 A;  1NBW A;  3KDF B;  4NXN L;  1I50 H;  3BJU A;  2ZJQ A;  3J80 c;  1KXL A;  2R7D A;  1X55 A;  3CCQ A;  4A3E H;  2WFW A;  4JI5 Q;  2B63 H;  4JI8 Q;  3EBE A;  4BXX G;  2ZTC A;  3FHW A;  3KLW A;  4A3G G;  4GOP A;  1P16 A;  1CKM A;  4PMW A;  3PIO A;  2CKZ B;  4LF9 L;  3FKI G;  2VQF L;  1KL9 A;  2MO0 A;  4JBW A;  1VQ8 A;  4GN4 B;  1NMF A;  4JBM A;  4DR6 L;  1YIJ A;  2QA4 A;  1CUK A;  4TVA B;  1KHI A;  5JEA J;  1UWV A;  1HNZ Q;  3GO5 A;  1S3O A;  3JAM i;  1Y1V H;  3GTJ H;  5BR8 L;  3HOX G;  2K75 A;  1JB7 A;  1EIF A;  2ZTE A;  1L1O C;  1YHQ A;  1VQD A;  2R93 H;  4L5Q A;  4GNX A;  4GLV B;  4YHH Q;  3S24 A;  1FL0 A;  1UE6 A;  4P75 A;  4X62 L;  2YTX A;  1I3Q H;  3HKZ E;  4GN5 A;  4IPG A;  3HKS A;  4YY3 L;  4KHP L;  1SRO A;  3L7Z C;  5IP7 H;  1MIU A;  2I5L X;  4WJ3 M;  4AQY Q;  2K5V A;  2CFM A;  4UP8 A;  4Y52 H;  4A3E G;  3RZD H;  2B63 G;  1N33 Q;  4LF8 L;  1YJ9 A;  2KCT A;  4IPC A;  4X66 Q;  4P73 A;  4JI1 Q;  1JJ2 A;  3U58 A;  4DR5 Q;  3RR5 A;  4HIM A;  2XTI A;  1HR0 L;  4LNQ A;  1I94 Q;  4BY7 H;  3NBH B;  2CWA A;  1V9P A;  4A3I G;  4HIO A;  1Q7Y C;  1EFW A;  4YWK A;  2Q2T A;  4JOI C;  3PO3 G;  2I5H A;  5C4X H;  4DV3 Q;  5FJ8 G;  2EQS A;  3PCO B;  4A3L H;  2I5M X;  3JC6 6;  1LTL A;  4LFA Q;  4B3S Q;  4MZ9 A;  4IFD G;  5GAH C;  4X64 L;  2OCE A;  2AKW B;  1KC8 C;  1TWH H;  2K50 A;  1H95 A;  2Y0S E;  4NB3 A;  4C3I H;  4QL5 A;  2BH8 A;  4LWC A;  2N8N A;  5IYC G;  3J7A 5;  2JEB I;  3UE1 A;  1OXX K;  1VQ5 A;  3S1Q H;  3H0G G;  4A4I A;  3KF8 B;  2VY3 A;  1OXU A;  4OWX B;  4JI3 Q;  2IX1 A;  5K36 G;  4DV5 Q;  3DM3 A;  3MXN B;  3CCV A;  5IP7 G;  4LFB L;  4HJ7 A;  1L1O A;  1EIY B;  1QUQ B;  1SR3 A;  3MEF A;  3HOZ G;  1VS0 A;  2RCN A;  5M3F H;  1IL2 A;  1A8V A;  2WB1 G;  4LFC Q;  2QEX A;  1BBU A;  3PV0 A;  1Y14 B;  4DUZ L;  4BBS H;  2NN6 I;  4JI6 Q;  4GKK L;  5IWA L;  1XJV A;  3I4O A;  1NJI C;  2ZTD A;  1V1Q A;  1Q81 C;  4B3R Q;  2IY5 B;  3M4P A;  3U50 C;  3F8T A;  2DGY A;  2Z0S A;  1L0W A;  5C0X J;  3E9H A;  2QGQ A;  1VQJ A;  1SN8 A;  4A3L G;  2JA8 G;  4A3K G;  1VQB A;  5C3E H;  1XPU A;  4DV4 Q;  4IFD J;  3UDI A;  1HNW Q;  1YNX A;  4NPS A;  1J5E Q;  3S2H H;  3KDF A;  4NXM L;  1Q46 A;  5IYD G;  2NVX H;  1G6P A;  4JOI A;  1N32 L;  4GKJ Q;  1IBK Q;  2XGT A;  4R4T A;  2L15 A;  3T1H L;  2K14 A;  4PZ7 A;  2N3S A;  1X56 A;  4DK3 C;  3RLF A;  1XPO A;  1N8R C;  2Z6K A;  5LMU Q;  4HID A;  2UU9 Q;  3CPF A;  2R7Z G;  2FXQ A;  2K5H A;  2OQK A;  3TS0 A;  4DUY L;  3BZK A;  2B29 A;  4JI5 L;  4JI8 L;  4X65 Q;  3ER0 A;  2KBN A;  5FLM G;  1X6O A;  4AYB E;  1IBM Q;  4JI2 L;  3W1B A;  2ZJP A;  2YU9 H;  4UY8 C;  2JA6 G;  3S17 H;  1Q82 C;  3S14 H;  3S1M H;  1N33 L;  4A3G H;  2OQ0 A;  1GVP A;  3PUZ A;  3CCL A;  4BA2 I;  1KD1 C;  3FKI H;  4B3M L;  1PFS A;  2RF4 A;  2UUC Q;  3I55 A;  1PH7 A;  4DV7 Q;  3M7N A;  4JI0 Q;  3K8A A;  1HNZ L;  1UE1 A;  1O7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...