4S3SA

Crystal structure of staphylococcal nuclease variant delta+phs i92k/v23a at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTAKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Buried ionizable residues
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4s3sA00
1EYAA 2F0SA 2F0MA 4I65A 1EZ6A 4IALA 1U9RA 2F3WA 1IHZA 1SYEA 3H6MA 3OMCA 4IZ8A 4N9TA 1EY8A 4NMZA 5DAUA 5J39A 4K8JA 1A3UA 2F0VA 3EJIA 4HMIA 4QF4A 2F0QA 5C5MA 5JAVA 2OXPA 3D6CA 4WORA 5IIFA 4OL7A 3TP8A 4QB4A 4ZUIA 1A2TA 3SK4A 3QOJA 2PW7A 3R3OA 4DU9A 1F2ZA 4K14A 5CV8A 1STAA 3E5SA 5C4HA 3MVVA 2EY6A 5IODA 2F0WA 3NP8A 5JOBA 3NK9A 1ENAA 2F0GA 3LX0A 5KIXA 1TT2A 1EY7A 3SHLA 1TQOA 5EKKA 5CR3A 3SR1A 4WRDA 4DGZA 4KD4A 1AEXA 5IOCA 3NHHA 3NUCA 5IGCA 3DHQA 3D4DA 2F0FA 1SNDA 3NQTA 5CC4A 3RUZA 2HQEA 4KV6A 2M00A 3T13A 4HMJA 2O4XA 4K2KA 5IGDA 4ME5A 5EKLA 2F0JA 2EY1A 3QOLA 4NDXA 3P75A 4QMGA 4RKLA 4K5VA 4K6DA 1SNPA 1KABA 2F0HA 5F2DA 5I6YA 5ISRA 3D8GA 2F0DA 5CV7A 3EROA 4EVOA 5CGKA 1A2UA 1SNQA 5C4ZA 4MIUA 4KY5A 1II3A 1EQVA 4F8MA 1EYDA 4J6HA 4ID6A 5C3WA 1JOOA 2F0PA 2F0KA 2EYLA 3BDLA 2F0EA 1A3VA 2SNSA 3DMUA 3HZXA 5C3XA 2F0TA 2EY2A 3SK5A 5HURA 3C1FA 1JOKA 4S3SA 1SYFA 3T16A 4ZUJA 2SOBA 5E1FA 2PQEA 5KGUA 2EYOA 1ENCA 3D4WA 3P1HA 5HGTA 4PMBA 4K5XA 2EXZA 2KHSA 1EZ8A 3HEJA 4EQNA 1KDCA 5C5LA 1SNCA 4DFAA 2EYPA 5KYLA 2F0OA 5NUCA 3TP7A 5I9PA 1EY9A 3SXHA 5KEEA 4K2LA 1KDAA 2PZUA 4KHVA 2F0IA 5J1ZA 3EVQA 5KYIA 2EY5A 2SNMA 4LAAA 1TR5A 4HTHA 5CV9A 1SYCA 2F3VA 4KJNA 1RKNA 1KDBA 2PYKA 1EY5A 2NUCA 3ITPA 4KJOA 3QB3A 3SK6A 3PMFA 1EY4A 4KTAA 5E3FA 3NXWA 5KRUA 1SYDA 5CV6A 2KQ3A 2EYMA 4PMCA 4R8NA 3MEHA 3OWFA 1EY0A 5IGBA 1SYGA 5IGFA 3TP6A 1NSNS 2PZWA 1SNMA 4G57A 1STYA 2OF1A 3TMEA 4DF7A 3C1EA 5I9OA 3VA5A 4NP5A 4ODGA 4B9XA 2EYFA 3MHBA 4KY7A 4B9WA 1F2YA 2EYHA 5IGEA 2PW5A 4E6IA 4K5WA 4TRDA 5K5PA 4KD3A 1SYBA 1STHA 4IUNA 4F7XA 1STGA 5IGGA 4EQPA 1EY6A 5J22A 4N9PA 4PNYA 2RDFA 2WACA 3U9OA 1KAAA 1A3TA 4RKBA 3MZ5A 5CV5A 3TP5A 3OMGA 3BDCA 5C6AA 2EYJA 3S9WA 2F0UA 2LKVA 2RBMA 3ERQA 4YIJA 5DEHA 5CV4A 4EQOA 2OEOA 1JOQA 3SK8A 5M9OA 1JORA 3V2TA 1EYCA 1F2MA 4H7BA 4NKLA 2RKSA 4KY6A 5I6WA 1SNOA 2F0NA 3OSOA 2ENBA 1NUCA 4J1MA 2F0LA 1STBA 2PZTA 4K8IA 5EGTA 3MXPA 1STNA 4ZQ3A 2QDBA
chains in the Genus database with same CATH superfamily
1U9RA 3SE0A 2F0VA 1RCVD 1SJED 2RSNA 2EJGC 3HOXG 3ULJA 1TU2B 1J5EQ 3J7A5 4J8QA 2Y0SG 3EA6A 2B3GA 3I73A 5M3MG 1EY7A 3AFPA 2XRQD 2ICIA 4HIKA 2R7ZB 4ZRZA 3GTKH 5C0XI 3I4NB 1J8IA 1RTNA 4BY1B 3S1MB 2KEDA 2CWAA 3SK8A 4K6DA 1CT1D 4DR6L 2IY5B 3F2UA 4JI8Q 3DXJC 4M1UB 4O42A 1TIID 1A2UA 3ZJYC 1CA6A 4LF7Q 5EKIA 4CKCA 2JA8B 4BXXH 3HOXH 1SRUA 2AWNA 3G7LA 1X6OA 4XQNA 3P1HA 4FDBA 5D3DA 4A3GB 5IWAL 1PTOB 1RF2D 2UXBQ 1LTTD 4DFAA 5M3MH 5NUCA 1HTLD 3TQYA 1TWHH 4LUZA 3NBIA 4GS3A 4P73A 1XTCD 4DUZL 2JEAI 2F4VQ 4ZLTF 2Q2IA 1IZ6A 5EAYA 2JA7B 5HY6A 4GNXA 1EY0A 3AEVA 1RD9D 1VQHA 3KF6A 1SNMA 4C1NI 2IW3A 2ZTDA 3TMEA 1SJHD 1X55A 2N3SA 4QCLA 1YVCA 4ODGA 4DN4M 1S5DD 4K0KQ 2JJQA 4A3FB 1AP0A 5I2YA 3M7NA 1SYBA 3F1ZA 1NJIC 3JAME 4JI6L 3J7YW 3T1HQ 1EIGA 1YI2A 2DJGC 4LFBL 1TS4A 2WKCA 4NXML 3JC66 3K58A 4GOPA 1NMFA 4OX9Q 2B2YA 1JOQA 3KLRA 1IXRA 2ZM6L 1XNQQ 1U0LA 4A76A 4Y7NH 4X3KA 2B2UA 1SMYD 1R4QB 4DAYA 1Q1EA 2CH4W 2NVXB 3V05A 1A3UA 2VZAA 2H4OA 3PQIA 1NR4A 2JP1A 2D62A 4TSSA 4DU9A 4G4KA 1HZ9A 2L9HA 1STAA 5G3LF 1QB5D 4H13C 5C4HA 4H02A 1LT3D 3BS1A 3GTKB 3NP8A 1QVCA 1DONA 3WDNA 5JVG3 3SR1A 4R9WA 3GV6A 1JQYD 2NB0A 3DWQA 3E0JA 2NWGA 5ELOA 1GUOA 3RUZA 3FMCA 1HNXL 4PV1C 4R4OA 2OTJA 1E2VA 2AWOA 3FDTA 1SNPA 2G5DA 1B7YB 3KYHC 2A6HC 5T1GA 2R3ZA 1F9SA 4DK6C 5D3IB 5BN5A 4MIUA 1AFPA 1GHJA 4P71A 3R2TA 2EYLA 1JC7A 2Y0SB 2EY2A 2JK8A 3T53B 5H1SE 2FXQA 2UXCQ 5M3MB 1Q12A 3GTPH 1VQEA 1P8LA 1VS0A 3CQZH 5FLXE 5DLQE 3CC7A 2B39A 2KHSA 1CZGA 1S5FD 1FNUA 4KHVA 1SE3A 4AYBE 1L0XB 3GTGH 3DM1A 4KJNA 1EY5A 2MHVA 4YWLA 3I7FA 4KTAA 2Q8TA 1LM0A 2QGQA 3KLWA 5CYUA 3QIAA 2K1BA 3NTKA 4BA1I 1SYGA 3E0EA 2D2CC 4IJLA 5JJLA 2K7VA 3P20A 3STBD 5T1IA 3AQQA 1I4QA 4KMUC 3MHBA 4UHVA 3HKZG 4B3SL 1EIFA 5EJWA 4EQPA 4GLXA 2DUDA 4PZ7A 1N34L 4U68A 3HFZB 3K59A 2LS01 2A74C 3GV3A 1EOTA 1F2MA 4KY6A 3A74A 1SNOA 3FPUB 3H3VC 4N8FA 3EIVA 1X65A 1WVLA 2JQOA 3VYSA 1K28A 2F3WA 1MBYA 1DCZA 3J81i 1ZYRD 1HZBA 4IOCA 2ATWA 2K33A 5FJ8G 3ND9A 1CKMA 1BDOA 3VR4A 3A55A 1PDQA 4QJFA 3U4VA 2BA0A 3F2BA 4NXNL 2EOTA 1TT2A 1TWFB 1TQOA 4WRDA 4B3MQ 4KK7A 3T1YL 1VQFA 1PH7A 1WTQA 2E5LQ 1SNDA 2BOSA 4L5TA 2ZXOA 4GLAC 5IGDA 2HT1A 1PZKD 5ISRA 2VY3A 1HR0W 3HOYG 4EVOA 1PTOD 3I90A 1AE3A 1ONLA 1PXUA 4QY7A 2L0CA 2Z4HA 3DMUA 1W6JA 1R9TB 4IFDJ 4QQBX 3H0GH 2P5ZX 2WKDA 1UE6A 3K57A 1PYWD 4OIKA 4PMBA 5BR8Q 2QDLA 2RCNA 2ZXRA 3NPPA 1PFMA 1N33L 1V1OA 1L1OC 3CC4A 4POGA 1TS5A 4XT1B 2ZTCA 3I4MG 3BZDB 1ASZA 2L5TA 1WI5A 3A8KE 2PYKA 3M4OH 3SK6A 4JBMA 3SDZA 1A6XA 4C2MH 4B08A 1TWGH 4RHRA 2M9VA 4R1JA 1WTRA 1MKHA 2PNRC 1N32L 4A3KG 1T5EA 1UE1A 3TN2A 1B8AA 1V9PA 3I91A 4RGMA 3C1EA 5E4XA 4DR6Q 4OO1I 2R93H 5IYCG 3VR2A 5LMNW 4RH6A 1Z47A 2BE5C 2PI2E 4IUNA 1STGA 1XTDA 1VQ6A 1QNUA 1YJ9A 4V0BA 3BU2A 2XRSD 2LXJA 4RKBA 4UPAA 1R4PB 3KBXA 4A3IB 4WJWA 1ESRA 3I4MH 5IWAQ 1QE6A 2F0NA 2C35B 2DY8A 2SEBD 4K8IA 4LF4Q 1XNRL 4JI1L 4C3JG 2NZHA 4UP7A 5M5XB 1VMPA 5C0XG 2ASBA 1IHZA 3KF8A 3RLNA 1PVOA 3HKZB 1ML0D 4K8JA 4DUZQ 3S16H 3QJYA 4DNIA 3J80E 1BCPC 1RODA 1A2TA 1S4ZA 5IYCH 4LJZC 5CV8A 2UXDL 3MVVA 5JPMC 4XTCS 1SMXA 2CVRA 4LFAL 3BZKA 1HFGA 1TVXA 1AEXA 3E3XA 3NUCA 1HPCA 4LF7L 2CW0D 3NQTA 4UY8C 4XDXA 2LFNA 4ZCKA 1KQSA 1DYQA 2HQEA 4KV6A 4JOIC 3HP3A 3UE1A 3FKIH 4JI2L 1LTBD 2HDMA 3PSIA 4MTNA 4QMGA 4LFBQ 4NXMQ 3MA2B 5E7NA 2A69C 4C3JH 2K50A 1Q7YC 1SFOH 2UXBL 2ZM6Q 5CORA 2XSCA 1EYDA 2YYZA 2VXWA 2C9OA 4AQYL 2EVBA 3CCEA 1EEFD 1YNND 1BUVT 1VQMA 4LW1A 2B2VC 3NQIA 1ENCA 1W6KA 1EWCA 4DA2A 1K3RA 1EZ8A 3Q24A 2YU9H 4N8X1 3M4OB 5ELFA 5IP7G 1PH6A 3MWYW 3ZYYX 3EVQA 3HOYB 4K0KL 2R92G 5GAHC 3QB3A 1Q3LA 2B2YC 1RDPD 5CBAE 2VQEL 1Y69U 1SYDA 4G7HC 1XX8A 2A5HA 4IPCA 2PMZB 3T56B 4X66L 3J81L 4OX9L 2E76C 1F2YA 5A2QL 4I7ZC 4TRDA 5IE8A 1MI2A 1BBWA 3T4AC 2IL8A 4IQZA 5M5WH 3I4MB 1KAAA 1E7ZA 2F1MA 2IJ0A 4GN3B 5C6AA 3KDFA 4A4IA 5IYBG 4H7BA 1CSPA 4NKLA 4OXPA 2HIXA 5I6WA 3CP0A 3GTQH 1LT5D 2R92H 5FO8B 4A3KB 3GP7A 3M3YB 3S16B 1U4LA 2J0TD 1OXXK 2RHSB 4P75A 3R93A 5IT9c 3TEHB 3OW2A 4DNRB 3MXUA 4OGQC 3QO2A 4LNQA 4A93G 4RA8A 1SXTA 5ELCA 3I3CA 1CKNA 1F9QA 1VQLA 1OXUA 4QIWB 3J81j 1I5FA 1B53A 1QNKA 2EPBA 2K4KA 1UWVA 2VL6A 4JV5Q 1LACA 1K3BC 2HD3A 2HIVA 3MFYA 2R7ZG 2NZOA 1KIXA 3RLOA 3M9BA 4C3JB 5C44G 1MJEA 1U4RA 3VR3A 1VQJA 2KHIA 2UXCL 2VNUD 1Q46A 2OTLA 1FGUA 4HEDA 2VS1A 4PQXA 4CBVA 1Y1WG 2F0DA 2L1BA 3HOVG 3GO5A 3O13A 1LTSD 2PCFB 4OIJA 3FRPB 1EQRA 2WFWA 3G6EA 2F0KA 3A54A 2F0TA 4WFN3 1BCPB 2JA8G 2BA1A 1DOKA 3GTLB 5FLMG 4ZUJA 2K5VA 2N55A 2QF7A 4NPSA 1S72A 1Z7TA 1D2BA 1F9RA 4XT3B 4XQJA 3G48A 2ZXPA 1NE3A 2DGYA 1PYSB 4OONA 1EY9A 2GA4B 2R7ZH 1HHVA 3ULLA 3NENA 3KOJA 2EY5A 4NXNQ 5C44H 1V1PA 1SYCA 2Z6KA 1PTOF 3QR8A 1RHPA 2NUCA 3KJOA 1PH8A 1EOVA 4CDDC 1K8MA 3D3RA 3BZCA 4RHSA 1STYA 5M5WB 2C5CA 4IPDA 2IWHA 3L2PA 1Y8OB 5JEAG 1KRSA 1E2ZA 2JA8H 3A0JA 1PH2A 1X32A 3HOZG 1Y14B 5J22A 3JAMc 3S15B 4A3GH 1CA5A 5GROA 1GUGA 2R92B 2HCCA 3RZDH 4FF1A 3ERQA 2ZJRA 1PH5A 2N49A 4KKSA 3W2DA 5M9OA 4KN7C 1VQIA 1N33Q 2A19A 1LTGD 3I4LA 4J1MA 2JSOA 2RA4A 4IUQA 5DAUA 1WTVA 2JA7H 2CWPA 3CRLC 4QF4A 3EJIA 1SEBD 2E5LL 1KLUD 1OO9B 1HTPA 3I2ZA 1CK1A 3S14B 1DXMA 1LYLA 3AB9A 4KN4C 3R3OA 5JEAH 5ELNA 5HGQA 4A3FH 4ABNA 1TWAH 1N32Q 1X3GA 1KNAA 2EY6A 3BVZA 5DM73 2F0WA 3OIPA 3HOZH 2F0GA 1SLJA 3SGIA 1YJNA 1G291 1DOLA 1MSGA 1HA6A 1BVSA 1IL2A 3E9IA 1VQKA 1NTGA 2F0FA 4IFDH 3GDEA 2RSOA 2F03A 1S5ED 4OEMB 3JAMi 4IPHA 3PO3G 2KUMA 2AKWB 5GQOA 3MXGA 5BR8L 1AN8A 4A93B 2AQ3B 2H1EA 2NVXH 4UP9A 1XNRQ 4JI1Q 1A8VA 3I8ZA 3SK5A 4CHTB 4APVA 1ILQA 4YWKA 3TZDA 3Q23A 1AW7A 5E1FA 1D5XC 3RR5A 2MO0A 4GN5A 4LF9L 5FLXc 1BKBA 5C44B 1WCMG 1SNCA 4C3IG 4OO1G 4OHJA 1BBXC 2WP8J 5JPNC 3MXNA 2UXDQ 2E2JB 5AFWA 1TS2A 1Y1WB 1T9HA 3PUVA 3HOVB 1X3FA 5J1ZA 4GKKQ 4LFAQ 4HTHA 1GUNA 2F3VA 1B2TA 1A0IA 3M4QA 2B63G 3A8JE 1EY4A 1BNZA 4L5QA 3H94A 4JI0L 4LUOA 5IGFA 2PPBC 3L3OC 4JI2Q 1Y8NB 4DF7A 4XXEA 4BA2I 4YCUA 4GZYC 1O7LA 3J7AV 3RZDB 2R61A 4LF4L 4A3EG 3DLLA 4AQYQ 1EY6A 4BWGB 4N9PA 1PRTD 5C0XJ 1WTPA 1S5CD 1V43A 5CV5A 2ZTEA 4OO1H 3S1QB 1SROA 3S1NB 1QUQA 4JI5L 3G6JB 1TS3A 1ZXTA 4DV2L 1NUCA 3K5OA 5LMNL 3CD6A 1C4QA 5EPKA 4KHPL 3H6MA 1TY2A 5GADC 1TWAB 1EU3A 2F0QA 1PZJD 1EIYB 4A3LG 3FEWX 3W1BA 3HOZB 2VQEQ 2EJFC 4YCWA 1I4RA 4ZKCB 3E5SA 3LNNA 4X66Q 5JOBA 2K6AA 1EL0A 2ES2A 2KCTA 5EKKA 4IJHA 4LFCL 4DR1L 3D4DA 2HHHL 1N8RC 3GTOB 1BCPD 4HMJA 1IKLA 4CKBA 1PFSA 2NN6I 3C46A 4MN3A 5CGKA 3MAQA 1F77A 4HJAA 4EX5A 1B70B 1HQMC 5E4WC 1YHAA 1XWEA 1PLFA 2RDGA 1UE7A 2EYOA 1G8ZD 3D4WA 1KL9A 4FYDA 2B8GA 2AMCB 1KRTA 4L8JA 2A6EC 2JXMB 3CCVA 3TS2A 1IW7C 1TWFH 3PO3B 2MJ8A 2DJFC 3NTIA 5KEEA 3H15A 4BBSG 1L0YB 1MIUA 3U58A 2B2WA 4LAAA 1TR5A 1UUPA 3OIQA 4KKTA 1RKNA 2E75C 2MGSA 2QW7A 4ILWA 3A8IE 3NBHA 4RGNA 1H95A 3MEHA 1M90C 1YNJD 2RVLA 1F2LA 2WAQE 3H09A 5JJZA 2B29A 3NSWA 1YITA 3K0XA 4KY7A 2A68C 3VDYA 4M8AA 3URYA 1A62A 2QA4A 1R9TH 1WCMB 4C3IB 4PZ6A 2I5LX 1CHPD 1EQTA 1ZKOA 1H9KA 3B6YA 1X56A 3X3NA 2KCNA 3TP5A 2B63B 2MQHA 4A3IG 4MHEA 1H9SB 4DAVA 2ENBA 2NVTB 1PMRA 2D9UA 3GD7A 4JV5L 4N9TA 4DR3L 5LL6X 1D1KA 2OXPA 4LK1C 1GD7A 4A3EB 1GXDC 1O78A 1GUWA 5FK9C 1CTMA 2NVYH 3QOJA 3W3AA 3J80c 1XXGA 1VQPA 2B2TC 1G6PA 2ICEC 4F87A 5FO9B 1KTKA 1ENAA 4BBRG 1M1KC 2JE6I 1Z6HA 2YV5A 2V4DA 1V8QA 3DHQA 5M3FG 3S1RB 2XTIA 1X3QA 4A3IH 3TDQA 1O7IA 4DK3C 2NTTA 4RCNA 2EY1A 3P75A 4UP8A 4K5VA 4GN4B 3VR6A 1HUMA 5TSSA 2FMCA 3G71A 5M5XH 4Q0FA 2Z4IA 3BDLA 4ZAIA 4B3RL 2SNSA 3HOUG 3HZXA 3D31A 4S3SA 4WJ3M 3CMEA 1AZPA 3T16A 1VQ9A 1O7ZA 3K8AA 3I4OA 4A3JG 4A3BG 1WFQA 4R4IA 3J7ZC 2CH4A 3K0YA 3J80i 2KCCA 2F0OA 3M4YA 1V1QA 1KC8C 1M8AA 5JEAJ 3UDIA 2D0OA 2SNMA 5KYIA 1HZCA 3HKSA 1D1IA 3CCSA 4DV6L 3F8TA 4HR7B 1IKMA 3MEFA 3H3VH 1I4GA 1YIJA 1Q1BA 5BN4A 4L5SA 3EQLC 4OWTB 2M2LA 5FJ8H 2BDOA 2NYZD 2ZJPA 2KJXA 5FKAC 3HOUH 3R8BA 5JJKA 2EIFA 2G9DA 5L37A 2RCFA 4HJ5A 4BBSB 3BJUA 4A3BH 4JCVE 4IUPA 1VQ5A 1HH2P 5M5YB 1JORA 1H9MA 1CI3M 3KUPA 1QJOA 2IHEA 4LF9Q 3HOYH 1RIPA 3OSOA 3W5OA 2FHTA 3FP9A 4GKJL 4KLKA 2KCMA 4CGYB 4XYOA 1BQQT 2F0MA 2O5JC 4IALA 2NVYB 1B3AA 5J39A 5JAVA 4HMIA 2F52A 3D0FA 4ZKBB 3LGJA 3RNUA 1VQOA 1XYIA 1PH9A 1XMQL 1HFNA 2AUJD 1VQBA 4JI0Q 1H9JA 1PRTF 3GTJH 2K52A 4JI3L 1JICA 2K14A 3ND8A 5EBCA 4DV7L 2UUCL 2RHQB 4H0LC 3SHLA 3IAYA 3SEBA 1FGBD 1JWUD 1GO3E 4Z9CB 2WB1E 4P72A 2MP1A 3CU7A 3PV0A 1TKWB 3AYHB 2M00A 3P7JA 1S5BD 1BXTA 1FNVA 1U4MA 1G6ZA 3J81E 4A3KH 3S17B 3M3YH 4AYBG 1CUKA 1GKHA 5A2QE 4JI5Q 1DJRD 4ID6A 2QEXA 4DV2Q 2F0EA 1E24A 1MD2D 3X3MA 4GKKL 1QZGA 4MZ9A 5LMNQ 1WD0A 4BBRB 1QVFA 4BS9A 4KHPQ 1KNEA 2X69A 3KK7A 2Q8RE 1YNXA 5C4XG 2VB2X 5M3FB 4X3TA 1UEBA 2XWBB 4HJ9A 2E2IH 2JYOA 4Q5VA 2HCIA 3R2IA 1BCPF 1X3PA 3L9AX 5CV9A 3CCQA 5EKLA 4PMWA 4KJOA 1QWYA 3K7AH 1WJJA 5C0XH 4O0AA 3PMFA 3A5ZB 3NELA 2FINB 3NXWA 1MSHA 3OTOL 4DR1Q 1XMOL 4LFCQ 2HHHQ 1UNSA 3HOUB 3PUXA 4GNXC 3CHBD 1TY0A 4C3HG 1YEZA 1HNWL 3Q22A 3I70A 4NP5A 2EE1A 4A3JB 4A3BB 1LLRD 4FNFA 4E6IA 5K5PA 3GTLH 1E2WA 1TWCH 2L15A 2PQAB 3NWTA 1EWIA 3OWEB 4HSPA 2AHOB 1A3TA 4GOPC 3BDCA 1E1TA 1EEID 4YIJA 1UEAB 2XGTA 2V1CC 2OCEA 4X62L 4IOAA 2A1AA 5EPJA 1PV4A 5EPLA 1STBA 1E1OA 3CMAA 4U673 1IYVA 3CRKC 4YHHL 2B2UC 2K5WA 1EYAA 2QKIC 1D5ZC 1EZ6A 4I65A 2DN8A 3DEOA 5COYA 2IX3A 1PHJA 4O2DA 2UU9L 3GTJB 4X65Q 1YHBA 3UI2A 3BYYB 4G7ZC 4A3CG 4YCVA 2IHFA 4DXFA 3U9SA 4JPBW 3PIP3 4TKOB 4CDCC 4ZUIA 3SK4A 2JA5G 2NN6G 4LF6L 1L1OB 4TQUS 1H9RA 1EFWA 5IODA 1D7QA 1JE4A 4R4TA 5IP7H 3S15H 4L63B 1PFNA 4DUYQ 1CKOA 1HXYD 3MTSA 4R4QA 2Q2TA 2VQFL 1IL8A 1C48A 1J6QA 3KLSA 4IO9A 1LT6D 3S2DB 1Q8KA 5CR3A 2LSSA 3EN2A 3STBC 1I4HA 4H44C 5CV7A 4DV1L 3CXCA 2K5HA 2KECA 4DR4Q 4JBJA 2AUKA 4LF5L 1JJ2A 4V190 4UAIA 4F8MA 2E2HH 2Y0SE 1W2BA 4A3CH 1PYBA 2E2IB 2MO1A 3S14H 4AIMA 2JA5H 1FVIA 2NN6H 1SE4A 4DR3Q 2LY7A 2WAQB 4P2CB 1J9OA 1VQ8A 2EJMA 3VYRA 3NTHA 3OYYA 1JJGA 1KLGD 5IYBH 3K7AB 4OELB 3WOEA 4CJ2C 3SXHA 4K2LA 1KDAA 4RCOA 2N8NA 1YBYA 2F0IA 3Q6SA 1B3QA 1ZYRC 4AYBB 4F88A 1L0WA 2AQ1B 5ELBA 5KRUA 3BYTB 3VA7A 4DK0A 1D8LA 2KQ3A 4K6LA 5DM63 4A93H 3Q8DA 2WB1G 1OXTA 4HJ8A 4G57A 1TWCB 1K83B 2Z9HA 3VA5A 2VUMG 5C4XB 5DNFA 2A6HD 3K5NA 3PIO3 2FFKB 1I6HH 4O1NA 3RZOH 4JI4Q 2LMCB 4B3RQ 1VDZA 2MUYA 4IUVA 4OWXB 4AH6A 3OMGA 3QWNA 2I5MX 3HRZC 3PF4A 1ASYA 3GTMB 2OEOA 3A7AB 4JBWA 3IL8A 2K5QA 3L7ZC 2E2JH 1Y1WH 4LUVA 3HOVH 1WTXA 1AH9A 3DEPA 4DXGA 4DV0L 4C3HB 5I2XA 4FF3A 1ET9A 2F0LA 1JMCA 2KA7A 1GUTA 2DNCA 3MXPA 5IYDG 3C2PA 3K7UC 4EQOA 4GNXB 1EY8A 3KF6B 2HDLA 5FLMH 4DV6Q 1VQDA 3D6CA 4OL7A 1DM0B 3T51B 4QB4A 2JA6G 1AE2A 1K0RA 2PW7A 3ER0A 1Z9FA 4ZYSA 3NK9A 1T5XD 1CM9A 1LUZA 4DGZA 3M4PA 3CCLA 4DR2Q 4GOPB 3S1QH 3BG3A 3S1NH 5LHY1 2F0JA 3U50C 2F0HA 2E2HB 1RL2A 1HA5A 3D8GA 1XPUA 3PUZA 1SE2A 4DAYB 3WOFA 5C4ZA 2JEBI 2JA5B 1QILA 1EQVA 5C3EB 1I4PA 3U4ZA 2CKZB 1QOHA 4MNOA 1Q86C 1GUSA 4GKJQ 3W1GA 1GHKA 1PFBA 2L4NA 5HURA 3C1FA 1JOKA 1EWHA 1SYFA 4JI7L 3CPFA 1X54A 3GQBA 1EU4A 5J3BA 4P74A 1XMQQ 1O7YA 4UDUC 5KYLA 3PF5A 2UUBL 4JI3Q 2DNEA 2J4XA 2O5IC 4DV7Q 2UUCQ 4X3SA 3GTOH 4RAUC 1Q8IA 1PH4A 2BCOA 2EYMA 1PH1A 1G91A 1WD1A 2EQSA 2PZWA 2KBNA 1I6HB 1D6EC 3RZOB 4B9XA 3CCUA 1U5KA 1OXVA 2ID0A 3ICEA 1G2TA 3CAMA 2CW0C 3CPWA 3VYTA 3UDFA 4X64Q 3D4RA 1S3OA 4F7XA 1HR0L 2D5DA 1BR9A 4BXXG 4A3DB 4C1NK 3I56A 2RDFA 4DAMA 4JW0A 3OOCA 3PCOB 4XYQA 3S9WA 1K8GA 2LKVA 3PO3H 1B9MA 3V2TA 1IYUA 1SBBB 2L11A 2MPMA 1LABA 3D6WA 1SDFA 2WB1B 1YNNC 4EGVA 2I46A 1HRJA 5CMDA 2VUMB 1I3QH 1ENFA 1U4PA 1X9NA 3OMCA 4NMZA 3HKZE 1K0SA 4RGTA 1JJCB 1B4OA 3TP8A 3OTOQ 1XMOQ 1ET6A 4JVZA 5I4DA 1UAPA 1WCMH 5LMUL 4C3IH 1HNWQ 2R7DA 3LX0A 3HG9A 4DV4L 5IGCA 5CC4A 2QILA 2BE5D 2B63H 4R8IA 1WTHA 5A35A 4K2KA 2O4XA 2OQ0A 4JOIA 2Q2UA 2GVAA 3CC2A 1IBKQ 1KABA 4HCEA 2MFIA 5LL6S 2NVTH 3EROA 1IBMQ 3IFTA 4X62Q 3CF5A 1NR2A 4MTKA 1O80A 1SNQA 5IY0A 2JA6B 3PO2G 2AQ2B 3QG1A 1Y1VG 1N36L 4RWSC 1FL0A 5IT9L 1B1ZA 4FF4A 1N9WA 4YHHQ 4A3EH 4NB3A 4EQ5A 2B2VA 4BY7G 2UU9Q 4R4CA 4FXKC 1TXYA 3I72A 2K28A 2IPKD 3NEMA 3DM3A 5C5LA 4LF6Q 1GVPA 2HUGA 3TP7A 1CSQA 2EDGA 2XN9C 3S1RH 5KNBA 1PH3A 1VQNA 3F2CA 2N78A 1E22A 4I7AA 2VQFQ 1KAWA 4A3LH 1HNZQ 2PMZE 4YY3Q 3TP6A 3CCMA 1I94L 3PO2H 1Y1VH 3BVMA 1NCVA 2ALYB 4DV1Q 2BH8A 1C9OA 2A69D 2KVMA 4LF5Q 2RDHA 1STHA 4BY7H 1CZWA 1I4XA 2A73B 4X65L 1GM5A 5D65A 2EYJA 4HIMA 1I50H 2IT1A 1I3QB 1EYCA 3TSSA 2KHJA 3PUWA 3ONAB 2RF4A 1DD2A 2K5NA 4TVAB 4DAPA 1STNA 3CCRA 1VQGA 1MGSA 5CV4A 4IZ8A 3SVMA 4DUYL 3MFGA 1DGSA 5C5MA 2K32A 1ICFB 4WORA 2KOLA 3OHXC 3HOXB 3E9HA 4K14A 4DR7L 3RN2A 4DR4L 4QIWE 2DY7A 1EQQA 1RJTA 4FXDA 4BBSH 4G7OC 5IOCA 1YHQA 3G4SA 2PI2A 1G2SA 1TWHB 2HQLA 4DV5Q 1C8CA 3JAML 5M5YH 1I6VC 3T13A 3RMHA 4NDXA 1JE5A 3FPPA 4LMQD 3TBIB 2EZVA 3J81c 4PG3A 5ELDA 3PGZA 3KF8B 4KY5A 1II3A 3PIPA 4DV0Q 2BDNA 2KENA 4KHZA 1A3VA 3FHWA 2Z6BA 2K03A 1NY4A 2SOBA 2PQEA 4L6TB 3BDOA 4HCSA 2VB3X 2IX0A 3S2HH 1JWMD 1VQAA 1EYGA 1W3SA 3VYUA 4LF8L 4JG2A 2PZUA 1HUNA 3CCJA 1DZ1A 4HIDA 3ERSX 2Z6KC 2YTYA 4Y7NB 3PO2B 3M85A 1Y1VB 2XWJB 4JI4L 3S17H 4JYAL 1PZID 4R8NA 3AFQA 5ELEA 2CCZA 1K8AC 1FJGQ 1BBUA 1MHWC 2OF1A 3BVGA 4QL5A 4BY7B 5I9OA 1EIHA 2R6GA 2EYFA 3EFXD 1LV9A 3KJPA 4BBRH 2JN4A 4JC0A 4KD3A 3VR5A 1HZAA 2PNHA 4IFDI 1I50B 3H0GG 1B9NA 5M3FH 1JWSD 2PO4A 5EQ0A 3U9OA 4IUTA 4DR5Q 4JI7Q 4DV3L 2F0UA 5FLXL 5DEHA 1NAPA 2I07B 5AJ3Q 3IFDA 1SN8A 1KD1C 3KLSX 1NBWA 1JB7A 1NMGA 1NNXA 3TREA 3HS0C 3H91A 2UUBQ 3KFUA 1Y8PB 1C0AA 3EBEA 2F0SA 4RGOS 4DR2L 2UUAQ 3PIOA 1GOZA 1X3EA 5IIFA 4NW2A 1VQ4A 4A3JH 3GTPB 3CQZB 3IKJA 2R93G 3AMUA 1BOSA 1LTLA 1CQVA 4QUFA 1E0BA 3RLFA 1IBLL 4POFA 2Z0SA 3DUZA 1G51A 2NVQH 4KD4A 3IRBA 2YTVA 3KDFB 5EBDA 4C56C 1HR0Q 5C4JH 3GTGB 3UDGA 3QOLA 2GN5A 3A56A 2IX1A 2E74C 1B44D 3FVQA 2JA9A 3N6RA 1HJPA 2RQXA 1SE8A 3MC0B 3TS0A 4DK1A 1P16A 3LWUA 5C3WA 1EUJA 2Q2HA 1VQ7A 1PRTC 3S2HB 4X6AH 3M7GA 3Q0AA 1CKNB 2WAQG 2Z8LA 4X3UA 1JB3A 5HGTA 4K5XA 2XNAC 1QG7A 4B3TL 4FVMA 3RD4A 2EYPA 2R7FA 4L5RC 1ICWA 1ESFA 2OT2A 4JK1C 5LMUQ 1Q81C 1H9SA 2CQAA 1KDBA 3S2DH 4X64L 4DV4Q 5E3FA 3K6OA 3FKIG 1J5EL 1C7YA 4WJ4A 5GAEC 3RN5A 1SR3A 1NSNS 3AU7A 1A63A 1OXSC 1FYCA 2X6LA 1HCZA 1STEA 4A3MG 2L55A 3N52A 1N36Q 5IGGA 1JR0D 1WTOA 5JJIA 1LTAD 1SMYC 3OW7A 1F9PA 4JI8L 1JT8A 2L12A 4FP5D 4KKUA 1V1PB 2RKSA 1CFMA 5IP9G 3NE5B 3WWVA 3LWEA 2PZTA 2A8VA 2Z1CA 4JI6Q 3K5LA 4CDFC 3DWPA 2E2DC 1FD7D 3I55A 2XVSA 4FF2A 5CBEE 1B50A 1K83H 2QCPX 2TSSA 1L2FA 3H0GB 3UE0A 5C4XH 2NVQB 1F2ZA 1WOCA 1IBKL 2G9HD 3V96A 4A3MH 1I94Q 1IBML 4CJ0B 1IYJB 5C4JB 5KIXA 2F4VL 3DWAA 2ZT9C 3K81C 4DPGA 3GTMH 2F3IA 1YNJC 2FMMA 4IN3A 2F4IA 4ME5A 4RG1A 2CQOA 1K9MC 2OWOA 4C2MB 4A75A 5IP9H 3ULPA 1TWGB 5I6YA 4C3HH 4IUUA 3HGBA 4GLVB 5C3EG 1JOOA 2F0PA 3T1HL 2ZJQA 2R93B 5C3XA 3A5UA 1HNXQ 1VQCA 1M4VA 5KGUA 2K04A 4QGUA 1FR3A 3J80L 1Q90A 2NTSA 1XNQL 1SAPA 3CW2C 4HAEA 1HNZL 3HEJA 4EQNA 1KXLA 1SSOA 4ULLA 4YY3L 2MNAA 4DR7Q 5K36G 1LTRD 4HSVA 1XPOA 1CQFA 2CHBD 2K75A 2I0QA 2B2WC 1AZQA 2B8FA 3UDXA 1JCKB 4OWWB 2LXKA 1OTCA 3C3LA 3HOWG 4RFBA 5CV6A 4FXGC 1S40A 2I5HA 1Q82C 4FO2A 1HQRD 2GVBA 1GJXA 1PRTB 5C3EH 3TRZA 4CJ1B 4JBKA 4B9WA 2X6GA 4CKEA 2EYHA 5IGEA 2PW5A 4K5WA 4XIGS 3TZUA 1CHQD 2Q8IB 4A3DG 4PNYA 5G3LD 2QEJC 4PZ8A 3NWSA 2FJ2A 3MZ5A 3MXNB 5K36H 3FKIB 2A6ED 2OQKA 1PA6A 3S24A 1IW7D 1K73C 4B3SQ 5EGTA 3I4NG 4LF8Q 1QCBD 2WINB 3CKIB 4ZQ3A 1SFOB 4BY1G 2QDBA 2K5DA 3HOWH 4J15A 2NBFA 1ZEQX 3PUYA 1SYEA 1D5MC 4ZK9B 1N34Q 1A15A 3OPOA 4LWCA 4DV5L 4QUCA 4A3MB 4XQQA 4JYAQ 1BO0A 2J7ZA 4HIOA 2B2TA 2YTXA 1VCIA 2YU9B 1PTOC 4A3DH 2A68D 2CFMA 3NHHA 1QZHA 4A3GG 1YZ6A 1QUQB 3H3VI 4HJ7A 1RTOA 4RKLA 2WIIB 2XIWA 5F2DA 5GAGC 4DV3Q 4DKAC 5KNDA 3I4NH 3K5MA 3F2DA 2VW9A 4BY1H 3S1MH 2VUMH 1VMCA 3T1YQ 4J6HA 1XPRA 4CDEC 2JA7G 4HN7A 3L0OA 5FOBB 4KI0A 5D14A 2PQAA 2EXZA 5BN3A 2D0PA 2TMPA 1KHIA 4IPGA 4A3FG 1KDCA 3K80C 5KNCA 1K8OA 2O2LD 4ALPA 1DOMA 1FJGL 3KBGA 1WTWA 5I9PA 1YJWA 1WYDA 2BH2A 1PTOH 3GTQB 4IURA 1IBLQ 5IYDH 3A7LA 3E6ZX 4IFDG 3ITPA 2K05A 1E3PA 1EFID 1MJCA 2K01A 2EXDA 1FNWA 2SDFA 1LO5D 4PMCA 1LTID 4DR5L 5FO7B 3OWFA 4ME3A 5IGBA 2KEEA 2JA6H 2E8GA 4RMFA 2WV6D 2H5XA 5AJ3L 3J7AF 1ILPA 4DNTB 4B3ML 1L1OA 1UE5A 2N88A 1BF4A 1QVGA 2WACA 1VF5C 2UUAL 2NZ1D 2RBMA 1LT4D 1VF7A 3HOWB 5JVH3 1XJVA 4Y52H 4B3TQ 4YWMA 5IT9E 3NBHB
chains in the Genus database with same CATH topology
1U9RA 3SE0A 2F0VA 1RCVD 1SJED 2RSNA 2EJGC 1TU2B 4J8QA 3EA6A 3I73A 1EY7A 2XRQD 2ICIA 2R7ZB 4ZRZA 5C0XI 3I4NB 1J8IA 1RTNA 4BY1B 3S1MB 2KEDA 3SK8A 4K6DA 1CT1D 3F2UA 3DXJC 4M1UB 4O42A 1TIID 1A2UA 1CA6A 5EKIA 4CKCA 2JA8B 2AWNA 3G7LA 4XQNA 3P1HA 5D3DA 4A3GB 1PTOB 1RF2D 1LTTD 4DFAA 5NUCA 1HTLD 3NBIA 1XTCD 2JEAI 4ZLTF 2JA7B 1EY0A 1RD9D 1SNMA 4C1NI 2IW3A 3TMEA 1SJHD 4QCLA 4ODGA 4DN4M 1S5DD 4A3FB 1AP0A 5I2YA 3M7NA 1SYBA 3JAME 3J7YW 1EIGA 1TS4A 2WKCA 3K58A 2B2YA 1JOQA 3KLRA 4X3KA 2B2UA 1SMYD 1R4QB 4DAYA 1Q1EA 2NVXB 3V05A 1A3UA 2H4OA 1NR4A 2JP1A 2D62A 4TSSA 4DU9A 4G4KA 2L9HA 1STAA 5G3LF 5C4HA 1QB5D 4H13C 1LT3D 3BS1A 3GTKB 3NP8A 1DONA 3WDNA 5JVG3 3SR1A 4R9WA 3GV6A 1JQYD 2NB0A 3DWQA 3E0JA 2NWGA 3RUZA 1GUOA 3FMCA 4PV1C 1E2VA 2AWOA 3FDTA 1SNPA 2A6HC 5T1GA 2R3ZA 1F9SA 5D3IB 5BN5A 4MIUA 1AFPA 1GHJA 3R2TA 2EYLA 1JC7A 2Y0SB 2EY2A 3T53B 5M3MB 1Q12A 5FLXE 2B39A 2KHSA 1CZGA 1S5FD 1FNUA 4KHVA 1SE3A 1L0XB 3DM1A 4KJNA 1EY5A 2MHVA 2Q8TA 4KTAA 5CYUA 3QIAA 2K1BA 3NTKA 4BA1I 1SYGA 2D2CC 2K7VA 3P20A 5T1IA 1I4QA 4KMUC 3MHBA 5EJWA 4EQPA 4U68A 3K59A 2LS01 2A74C 3GV3A 1EOTA 1F2MA 4KY6A 1SNOA 3FPUB 3H3VC 1WVLA 3VYSA 2F3WA 1MBYA 1DCZA 1ZYRD 2K33A 3ND9A 1BDOA 3VR4A 3A55A 1PDQA 2BA0A 2EOTA 1TT2A 1TWFB 1TQOA 4WRDA 4KK7A 1WTQA 1SNDA 2BOSA 2ZXOA 5IGDA 1PZKD 5ISRA 4EVOA 1PTOD 3I90A 1ONLA 1PXUA 2L0CA 2Z4HA 3DMUA 1W6JA 1R9TB 4IFDJ 2WKDA 3K57A 1PYWD 4OIKA 4PMBA 2ZXRA 3NPPA 1PFMA 1V1OA 1TS5A 4XT1B 3BZDB 2L5TA 3A8KE 2PYKA 3SK6A 3SDZA 1A6XA 4B08A 4RHRA 2M9VA 1WTRA 2PNRC 1T5EA 3TN2A 3I91A 4RGMA 5E4XA 3C1EA 4OO1I 3VR2A 4RH6A 1Z47A 2BE5C 4IUNA 1STGA 1QNUA 4V0BA 2XRSD 4RKBA 1R4PB 3KBXA 4A3IB 4WJWA 1ESRA 1QE6A 2F0NA 2DY8A 2SEBD 4K8IA 4C3JG 5M5XB 1VMPA 5C0XG 1IHZA 3KF8A 3HKZB 1ML0D 4K8JA 3QJYA 3J80E 1BCPC 1RODA 1A2TA 1S4ZA 4LJZC 5CV8A 3MVVA 5JPMC 4XTCS 2CVRA 1HFGA 1TVXA 1AEXA 3NUCA 1HPCA 2CW0D 3NQTA 4XDXA 2LFNA 1DYQA 2HQEA 4KV6A 3HP3A 1LTBD 2HDMA 4QMGA 3MA2B 2A69C 5CORA 2XSCA 1EYDA 2YYZA 2VXWA 2C9OA 2EVBA 1EEFD 1YNND 1BUVT 2B2VC 3NQIA 1ENCA 1W6KA 1EWCA 4DA2A 1EZ8A 3Q24A 3M4OB 5ELFA 3MWYW 3ZYYX 3EVQA 3HOYB 3QB3A 1Q3LA 2B2YC 1RDPD 5CBAE 1Y69U 1SYDA 4G7HC 1XX8A 2A5HA 2PMZB 3T56B 3J81L 2E76C 1F2YA 5A2QL 4I7ZC 4TRDA 1MI2A 3T4AC 2IL8A 4IQZA 3I4MB 1KAAA 2F1MA 2IJ0A 5C6AA 4H7BA 4NKLA 5I6WA 1LT5D 5FO8B 4A3KB 3GP7A 3M3YB 3S16B 1U4LA 2J0TD 1OXXK 3R93A 4DNRB 3MXUA 4OGQC 3QO2A 4RA8A 1SXTA 5ELCA 3I3CA 1F9QA 1OXUA 4QIWB 1B53A 1QNKA 2EPBA 1LACA 3MFYA 4C3JB 1U4RA 3VR3A 2VNUD 4HEDA 4CBVA 4PQXA 2F0DA 2L1BA 3GO5A 3O13A 1LTSD 2PCFB 4OIJA 3FRPB 2F0KA 3A54A 2F0TA 4WFN3 1BCPB 2BA1A 1DOKA 3GTLB 4ZUJA 2N55A 2QF7A 1Z7TA 1D2BA 1F9RA 4XT3B 4XQJA 2ZXPA 1HHVA 1EY9A 2GA4B 2EY5A 1V1PA 1SYCA 1PTOF 1RHPA 2NUCA 1K8MA 3D3RA 4RHSA 1STYA 5M5WB 2C5CA 2IWHA 1Y8OB 5JEAG 1E2ZA 1X32A 5J22A 3S15B 1CA5A 1GUGA 2R92B 2HCCA 4FF1A 3ERQA 4KKSA 3W2DA 5M9OA 4KN7C 1LTGD 3I4LA 4J1MA 2JSOA 2RA4A 4IUQA 5DAUA 1WTVA 3CRLC 4QF4A 3EJIA 1SEBD 1KLUD 1OO9B 1HTPA 1CK1A 3S14B 1DXMA 3AB9A 4KN4C 3R3OA 5JEAH 4ABNA 1KNAA 2EY6A 3BVZA 5DM73 2F0WA 3OIPA 2F0GA 1G291 1DOLA 1MSGA 1HA6A 2F0FA 4IFDH 2RSOA 2F03A 1S5ED 2KUMA 3MXGA 1AN8A 4A93B 2AQ3B 2H1EA 3I8ZA 3SK5A 4CHTB 1ILQA 3Q23A 3TZDA 1AW7A 5E1FA 1D5XC 5C44B 1SNCA 4C3IG 4OO1G 4OHJA 1BBXC 2WP8J 5JPNC 3MXNA 2E2JB 5AFWA 1TS2A 1Y1WB 3PUVA 3HOVB 5J1ZA 4HTHA 1GUNA 2F3VA 1B2TA 3A8JE 1EY4A 1BNZA 3H94A 5IGFA 2PPBC 3L3OC 1Y8NB 4DF7A 4XXEA 4BA2I 4GZYC 1O7LA 3J7AV 3RZDB 2R61A 1EY6A 4BWGB 4N9PA 1PRTD 5C0XJ 1WTPA 1S5CD 1V43A 5CV5A 4OO1H 3S1QB 3S1NB 3G6JB 1TS3A 1ZXTA 1NUCA 3K5OA 1C4QA 5EPKA 3H6MA 1TY2A 1TWAB 1EU3A 2F0QA 1PZJD 3FEWX 3HOZB 2EJFC 1I4RA 4ZKCB 3E5SA 3LNNA 5JOBA 2K6AA 1EL0A 5EKKA 3D4DA 3GTOB 1BCPD 4HMJA 1IKLA 4CKBA 2NN6I 3C46A 4MN3A 5CGKA 3MAQA 1F77A 1HQMC 5E4WC 1XWEA 1PLFA 2RDGA 2EYOA 1G8ZD 3D4WA 4FYDA 2B8GA 4L8JA 2A6EC 2JXMB 1IW7C 3PO3B 2MJ8A 3NTIA 5KEEA 1L0YB 2B2WA 4LAAA 1TR5A 1UUPA 3OIQA 4KKTA 1RKNA 2E75C 2MGSA 4ILWA 3A8IE 3NBHA 4RGNA 3MEHA 1YNJD 2RVLA 1F2LA 5JJZA 3H09A 3NSWA 4KY7A 2A68C 4M8AA 3URYA 1WCMB 4C3IB 1CHPD 1EQTA 1ZKOA 1H9KA 3X3NA 2KCNA 3TP5A 2B63B 4MHEA 1H9SB 4DAVA 2ENBA 2NVTB 1PMRA 2D9UA 3GD7A 4N9TA 5LL6X 1D1KA 2OXPA 4LK1C 4A3EB 1GXDC 1O78A 1GUWA 5FK9C 1CTMA 3QOJA 3W3AA 1XXGA 2B2TC 2ICEC 4F87A 5FO9B 1KTKA 1ENAA 2JE6I 1Z6HA 2V4DA 1V8QA 3DHQA 3S1RB 1X3QA 3TDQA 2NTTA 4RCNA 2EY1A 3P75A 4K5VA 3VR6A 1HUMA 5TSSA 2FMCA 4Q0FA 2Z4IA 3BDLA 4ZAIA 2SNSA 3HZXA 3D31A 4S3SA 1AZPA 3T16A 1O7ZA 3K0YA 2KCCA 2F0OA 3M4YA 1M8AA 5JEAJ 5KYIA 2SNMA 1D1IA 1IKMA 4HR7B 1I4GA 1Q1BA 5BN4A 3EQLC 2M2LA 2BDOA 2NYZD 2KJXA 5FKAC 3R8BA 2G9DA 4BBSB 4IUPA 5M5YB 1JORA 1H9MA 1CI3M 3KUPA 1QJOA 3OSOA 2FHTA 4CGYB 4XYOA 1BQQT 2F0MA 2O5JC 4IALA 2NVYB 1B3AA 5J39A 5JAVA 4HMIA 4ZKBB 1XYIA 1HFNA 2AUJD 1H9JA 1PRTF 1JICA 3ND8A 5EBCA 4H0LC 3SHLA 3IAYA 3SEBA 1FGBD 1JWUD 4Z9CB 2MP1A 3CU7A 3PV0A 1TKWB 2M00A 3P7JA 1S5BD 1BXTA 1FNVA 1U4MA 1G6ZA 3J81E 3S17B 5A2QE 1DJRD 4ID6A 2F0EA 3X3MA 1MD2D 1WD0A 4BBRB 4BS9A 1KNEA 2X69A 3KK7A 2Q8RE 2VB2X 5M3FB 4X3TA 2XWBB 2JYOA 4Q5VA 2HCIA 3R2IA 1BCPF 1X3PA 3L9AX 5CV9A 5EKLA 4PMWA 4KJOA 1QWYA 5C0XH 3PMFA 2FINB 3NXWA 1MSHA 1UNSA 3HOUB 3PUXA 3CHBD 1TY0A 4C3HG 3Q22A 3I70A 4NP5A 2EE1A 4A3JB 4A3BB 1LLRD 4FNFA 4E6IA 5K5PA 1E2WA 3NWTA 3OWEB 4HSPA 1A3TA 3BDCA 1EEID 4YIJA 1UEAB 5EPJA 5EPLA 1STBA 4U673 1IYVA 3CRKC 2B2UC 2K5WA 1EYAA 2QKIC 1D5ZC 1EZ6A 4I65A 2DN8A 3DEOA 5COYA 2IX3A 3GTJB 3UI2A 3BYYB 4G7ZC 4DXFA 3U9SA 3PIP3 4TKOB 4ZUIA 3SK4A 2NN6G 4TQUS 1H9RA 5IODA 1JE4A 4L63B 1PFNA 1HXYD 3MTSA 1IL8A 1C48A 3KLSA 1LT6D 3S2DB 5CR3A 1I4HA 4H44C 5CV7A 2KECA 2AUKA 4V190 4UAIA 4F8MA 2E2IB 2NN6H 1SE4A 2LY7A 2WAQB 4P2CB 1J9OA 2EJMA 3VYRA 3NTHA 1KLGD 3K7AB 3WOEA 4CJ2C 3SXHA 4K2LA 1KDAA 4RCOA 2F0IA 3Q6SA 4AYBB 1ZYRC 4F88A 2AQ1B 5ELBA 5KRUA 3BYTB 3VA7A 4DK0A 2KQ3A 4K6LA 5DM63 1OXTA 4G57A 1TWCB 1K83B 3VA5A 5C4XB 5DNFA 2A6HD 3K5NA 3PIO3 2FFKB 4O1NA 2LMCB 1VDZA 2MUYA 4IUVA 3OMGA 3QWNA 3HRZC 3GTMB 2OEOA 3A7AB 4JBWA 3IL8A 2K5QA 3L7ZC 1WTXA 3DEPA 4DXGA 4C3HB 5I2XA 4FF3A 1ET9A 2F0LA 2KA7A 1GUTA 2DNCA 3MXPA 3C2PA 4EQOA 1EY8A 2HDLA 3D6CA 4OL7A 1DM0B 3T51B 4QB4A 2PW7A 4ZYSA 3NK9A 1T5XD 1CM9A 4DGZA 3BG3A 5LHY1 2F0JA 2F0HA 2E2HB 1HA5A 3D8GA 3PUZA 1SE2A 3WOFA 5C4ZA 2JEBI 2JA5B 1QILA 1EQVA 5C3EB 1I4PA 1QOHA 1GUSA 1GHKA 1PFBA 2L4NA 5HURA 3C1FA 1JOKA 1EWHA 1SYFA 3GQBA 1EU4A 1O7YA 4UDUC 5KYLA 2DNEA 2J4XA 2O5IC 4X3SA 4RAUC 1Q8IA 2BCOA 2EYMA 1G91A 1WD1A 2PZWA 1I6HB 1D6EC 3RZOB 4B9XA 1OXVA 2ID0A 1G2TA 2CW0C 3VYTA 3D4RA 4F7XA 2D5DA 1BR9A 4A3DB 4C1NK 2RDFA 3OOCA 4XYQA 3S9WA 2LKVA 1B9MA 3V2TA 1IYUA 1SBBB 2L11A 2MPMA 1LABA 3D6WA 1SDFA 2WB1B 1YNNC 4EGVA 2I46A 1HRJA 5CMDA 2VUMB 1U4PA 1ENFA 3OMCA 4NMZA 4RGTA 1B4OA 3TP8A 1ET6A 5I4DA 1UAPA 3LX0A 3HG9A 5IGCA 5CC4A 2QILA 2BE5D 4R8IA 5A35A 4K2KA 2O4XA 1KABA 4HCEA 5LL6S 3EROA 3IFTA 1NR2A 1O80A 1SNQA 2JA6B 2AQ2B 3QG1A 4RWSC 5IT9L 1B1ZA 4FF4A 2B2VA 4FXKC 3I72A 2K28A 2IPKD 5C5LA 2HUGA 3TP7A 2EDGA 2XN9C 5KNBA 3TP6A 3BVMA 1NCVA 2A69D 2KVMA 2RDHA 1STHA 1CZWA 1I4XA 2A73B 5D65A 2EYJA 2IT1A 1I3QB 1EYCA 3TSSA 3PUWA 3ONAB 1DD2A 4DAPA 1STNA 1MGSA 5CV4A 4IZ8A 3SVMA 3MFGA 5C5MA 2K32A 4WORA 2KOLA 3OHXC 3HOXB 4K14A 2DY7A 1RJTA 4FXDA 4G7OC 5IOCA 1G2SA 1TWHB 1C8CA 3JAML 1I6VC 3T13A 3RMHA 4NDXA 3FPPA 4LMQD 3TBIB 2EZVA 5ELDA 4KY5A 1II3A 2BDNA 4KHZA 1A3VA 2K03A 2SOBA 2PQEA 4L6TB 3BDOA 4HCSA 2VB3X 2IX0A 1JWMD 3VYUA 2PZUA 1HUNA 1DZ1A 4Y7NB 3PO2B 3M85A 1Y1VB 2XWJB 1PZID 4R8NA 5ELEA 2OF1A 3BVGA 4BY7B 5I9OA 1EIHA 2R6GA 2EYFA 3EFXD 1LV9A 4KD3A 3VR5A 4IFDI 1I50B 1B9NA 1JWSD 2PO4A 5EQ0A 3U9OA 4IUTA 2F0UA 5FLXL 5DEHA 1NAPA 2I07B 3IFDA 3KLSX 3HS0C 3H91A 1Y8PB 2F0SA 4RGOS 1GOZA 5IIFA 4NW2A 3GTPB 3CQZB 3IKJA 3AMUA 1BOSA 1CQVA 4QUFA 1E0BA 3RLFA 3DUZA 4KD4A 5EBDA 4C56C 3GTGB 3QOLA 3A56A 2IX1A 2E74C 1B44D 3FVQA 3N6RA 2RQXA 3MC0B 4DK1A 3LWUA 5C3WA 1PRTC 3S2HB 3M7GA 3Q0AA 2Z8LA 4X3UA 1JB3A 5HGTA 4K5XA 2XNAC 1QG7A 4FVMA 3RD4A 2EYPA 1ICWA 1ESFA 2OT2A 4JK1C 1H9SA 2CQAA 1KDBA 5E3FA 3K6OA 1NSNS 3AU7A 1OXSC 1FYCA 2X6LA 1HCZA 1STEA 2L55A 3N52A 5IGGA 1JR0D 1WTOA 1LTAD 1SMYC 3OW7A 1F9PA 2L12A 4FP5D 4KKUA 1V1PB 2RKSA 1CFMA 3NE5B 3LWEA 2PZTA 2Z1CA 3K5LA 3DWPA 2E2DC 1FD7D 2XVSA 4FF2A 5CBEE 1B50A 2QCPX 2TSSA 3H0GB 2NVQB 1F2ZA 2G9HD 3V96A 4CJ0B 5C4JB 5KIXA 3DWAA 2ZT9C 1YNJC 2FMMA 4IN3A 2F4IA 4ME5A 4C2MB 1TWGB 5I6YA 4IUUA 3HGBA 1JOOA 2F0PA 2R93B 5C3XA 1M4VA 5KGUA 2K04A 1FR3A 3J80L 1Q90A 2NTSA 1SAPA 4HAEA 3HEJA 4EQNA 1SSOA 4ULLA 5K36G 1LTRD 4HSVA 1CQFA 2CHBD 2B2WC 1AZQA 2B8FA 1JCKB 3C3LA 4RFBA 5CV6A 4FXGC 4FO2A 1HQRD 1GJXA 1PRTB 4CJ1B 4B9WA 2X6GA 4CKEA 2EYHA 5IGEA 2PW5A 4K5WA 4XIGS 3TZUA 1CHQD 2Q8IB 4PNYA 5G3LD 2QEJC 3NWSA 2FJ2A 3MZ5A 5K36H 3FKIB 2A6ED 1IW7D 5EGTA 1QCBD 2WINB 3CKIB 4ZQ3A 1SFOB 2QDBA 2K5DA 2NBFA 1ZEQX 3PUYA 1SYEA 1D5MC 4ZK9B 1A15A 3OPOA 4QUCA 4A3MB 4XQQA 1BO0A 2J7ZA 2B2TA 1VCIA 2YU9B 1PTOC 2A68D 3NHHA 1RTOA 4RKLA 2WIIB 2XIWA 5F2DA 5KNDA 3K5MA 1VMCA 4J6HA 4HN7A 5FOBB 4KI0A 5D14A 2EXZA 5BN3A 2TMPA 1KDCA 5KNCA 1K8OA 2O2LD 1DOMA 3KBGA 1WTWA 5I9PA 1PTOH 3GTQB 4IURA 3A7LA 3E6ZX 4IFDG 3ITPA 2K05A 1EFID 2K01A 1FNWA 2SDFA 1LO5D 4PMCA 1LTID 5FO7B 3OWFA 5IGBA 2KEEA 2WV6D 3J7AF 1ILPA 4DNTB 2N88A 1BF4A 2WACA 1VF5C 2NZ1D 2RBMA 1LT4D 1VF7A 3HOWB 5JVH3 5IT9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYA A;  2F0S A;  2F0M A;  4I65 A;  1EZ6 A;  4IAL A;  1U9R A;  2F3W A;  1IHZ A;  1SYE A;  3H6M A;  3OMC A;  4IZ8 A;  4N9T A;  1EY8 A;  4NMZ A;  5DAU A;  5J39 A;  4K8J A;  1A3U A;  2F0V A;  3EJI A;  4HMI A;  4QF4 A;  2F0Q A;  5C5M A;  5JAV A;  2OXP A;  3D6C A;  4WOR A;  5IIF A;  4OL7 A;  3TP8 A;  4QB4 A;  4ZUI A;  1A2T A;  3SK4 A;  3QOJ A;  2PW7 A;  3R3O A;  4DU9 A;  1F2Z A;  4K14 A;  5CV8 A;  1STA A;  3E5S A;  5C4H A;  3MVV A;  2EY6 A;  5IOD A;  2F0W A;  3NP8 A;  5JOB A;  3NK9 A;  1ENA A;  2F0G A;  3LX0 A;  5KIX A;  1TT2 A;  1EY7 A;  3SHL A;  1TQO A;  5EKK A;  5CR3 A;  3SR1 A;  4WRD A;  4DGZ A;  4KD4 A;  1AEX A;  5IOC A;  3NHH A;  3NUC A;  5IGC A;  3DHQ A;  3D4D A;  2F0F A;  1SND A;  3NQT A;  5CC4 A;  3RUZ A;  2HQE A;  4KV6 A;  2M00 A;  3T13 A;  4HMJ A;  2O4X A;  4K2K A;  5IGD A;  4ME5 A;  5EKL A;  2F0J A;  2EY1 A;  3QOL A;  4NDX A;  3P75 A;  4QMG A;  4RKL A;  4K5V A;  4K6D A;  1SNP A;  1KAB A;  2F0H A;  5F2D A;  5I6Y A;  5ISR A;  3D8G A;  2F0D A;  5CV7 A;  3ERO A;  4EVO A;  5CGK A;  1A2U A;  1SNQ A;  5C4Z A;  4MIU A;  4KY5 A;  1II3 A;  1EQV A;  4F8M A;  1EYD A;  4J6H A;  4ID6 A;  5C3W A;  1JOO A;  2F0P A;  2F0K A;  2EYL A;  3BDL A;  2F0E A;  1A3V A;  2SNS A;  3DMU A;  3HZX A;  5C3X A;  2F0T A;  2EY2 A;  3SK5 A;  5HUR A;  3C1F A;  1JOK A;  4S3S A;  1SYF A;  3T16 A;  4ZUJ A;  2SOB A;  5E1F A;  2PQE A;  5KGU A;  2EYO A;  1ENC A;  3D4W A;  3P1H A;  5HGT A;  4PMB A;  4K5X A;  2EXZ A;  2KHS A;  1EZ8 A;  3HEJ A;  4EQN A;  1KDC A;  5C5L A;  1SNC A;  4DFA A;  2EYP A;  5KYL A;  2F0O A;  5NUC A;  3TP7 A;  5I9P A;  1EY9 A;  3SXH A;  5KEE A;  4K2L A;  1KDA A;  2PZU A;  4KHV A;  2F0I A;  5J1Z A;  3EVQ A;  5KYI A;  2EY5 A;  2SNM A;  4LAA A;  1TR5 A;  4HTH A;  5CV9 A;  1SYC A;  2F3V A;  4KJN A;  1RKN A;  1KDB A;  2PYK A;  1EY5 A;  2NUC A;  3ITP A;  4KJO A;  3QB3 A;  3SK6 A;  3PMF A;  1EY4 A;  4KTA A;  5E3F A;  3NXW A;  5KRU A;  1SYD A;  5CV6 A;  2KQ3 A;  2EYM A;  4PMC A;  4R8N A;  3MEH A;  3OWF A;  1EY0 A;  5IGB A;  1SYG A;  5IGF A;  3TP6 A;  1NSN S;  2PZW A;  1SNM A;  4G57 A;  1STY A;  2OF1 A;  3TME A;  4DF7 A;  3C1E A;  5I9O A;  3VA5 A;  4NP5 A;  4ODG A;  4B9X A;  2EYF A;  3MHB A;  4KY7 A;  4B9W A;  1F2Y A;  2EYH A;  5IGE A;  2PW5 A;  4E6I A;  4K5W A;  4TRD A;  5K5P A;  4KD3 A;  1SYB A;  1STH A;  4IUN A;  4F7X A;  1STG A;  5IGG A;  4EQP A;  1EY6 A;  5J22 A;  4N9P A;  4PNY A;  2RDF A;  2WAC A;  3U9O A;  1KAA A;  1A3T A;  4RKB A;  3MZ5 A;  5CV5 A;  3TP5 A;  3OMG A;  3BDC A;  5C6A A;  2EYJ A;  3S9W A;  2F0U A;  2LKV A;  2RBM A;  3ERQ A;  4YIJ A;  5DEH A;  5CV4 A;  4EQO A;  2OEO A;  1JOQ A;  3SK8 A;  5M9O A;  1JOR A;  3V2T A;  1EYC A;  1F2M A;  4H7B A;  4NKL A;  2RKS A;  4KY6 A;  5I6W A;  1SNO A;  2F0N A;  3OSO A;  2ENB A;  1NUC A;  4J1M A;  2F0L A;  1STB A;  2PZT A;  4K8I A;  5EGT A;  3MXP A;  1STN A;  4ZQ3 A;  2QDB A; 
#chains in the Genus database with same CATH topology
 1U9R A;  3SE0 A;  2F0V A;  1RCV D;  1SJE D;  2RSN A;  2EJG C;  3HOX G;  3ULJ A;  1TU2 B;  1J5E Q;  3J7A 5;  4J8Q A;  2Y0S G;  3EA6 A;  2B3G A;  3I73 A;  5M3M G;  1EY7 A;  3AFP A;  2XRQ D;  2ICI A;  4HIK A;  2R7Z B;  4ZRZ A;  3GTK H;  5C0X I;  3I4N B;  1J8I A;  1RTN A;  4BY1 B;  3S1M B;  2KED A;  2CWA A;  3SK8 A;  4K6D A;  1CT1 D;  4DR6 L;  2IY5 B;  3F2U A;  4JI8 Q;  3DXJ C;  4M1U B;  4O42 A;  1TII D;  1A2U A;  3ZJY C;  1CA6 A;  4LF7 Q;  5EKI A;  4CKC A;  2JA8 B;  4BXX H;  3HOX H;  1SRU A;  2AWN A;  3G7L A;  1X6O A;  4XQN A;  3P1H A;  4FDB A;  5D3D A;  4A3G B;  5IWA L;  1PTO B;  1RF2 D;  2UXB Q;  1LTT D;  4DFA A;  5M3M H;  5NUC A;  1HTL D;  3TQY A;  1TWH H;  4LUZ A;  3NBI A;  4GS3 A;  4P73 A;  1XTC D;  4DUZ L;  2JEA I;  2F4V Q;  4ZLT F;  2Q2I A;  1IZ6 A;  5EAY A;  2JA7 B;  5HY6 A;  4GNX A;  1EY0 A;  3AEV A;  1RD9 D;  1VQH A;  3KF6 A;  1SNM A;  4C1N I;  2IW3 A;  2ZTD A;  3TME A;  1SJH D;  1X55 A;  2N3S A;  4QCL A;  1YVC A;  4ODG A;  4DN4 M;  1S5D D;  4K0K Q;  2JJQ A;  4A3F B;  1AP0 A;  5I2Y A;  3M7N A;  1SYB A;  3F1Z A;  1NJI C;  3JAM E;  4JI6 L;  3J7Y W;  3T1H Q;  1EIG A;  1YI2 A;  2DJG C;  4LFB L;  1TS4 A;  2WKC A;  4NXM L;  3JC6 6;  3K58 A;  4GOP A;  1NMF A;  4OX9 Q;  2B2Y A;  1JOQ A;  3KLR A;  1IXR A;  2ZM6 L;  1XNQ Q;  1U0L A;  4A76 A;  4Y7N H;  4X3K A;  2B2U A;  1SMY D;  1R4Q B;  4DAY A;  1Q1E A;  2CH4 W;  2NVX B;  3V05 A;  1A3U A;  2VZA A;  2H4O A;  3PQI A;  1NR4 A;  2JP1 A;  2D62 A;  4TSS A;  4DU9 A;  4G4K A;  1HZ9 A;  2L9H A;  1STA A;  5G3L F;  1QB5 D;  4H13 C;  5C4H A;  4H02 A;  1LT3 D;  3BS1 A;  3GTK B;  3NP8 A;  1QVC A;  1DON A;  3WDN A;  5JVG 3;  3SR1 A;  4R9W A;  3GV6 A;  1JQY D;  2NB0 A;  3DWQ A;  3E0J A;  2NWG A;  5ELO A;  1GUO A;  3RUZ A;  3FMC A;  1HNX L;  4PV1 C;  4R4O A;  2OTJ A;  1E2V A;  2AWO A;  3FDT A;  1SNP A;  2G5D A;  1B7Y B;  3KYH C;  2A6H C;  5T1G A;  2R3Z A;  1F9S A;  4DK6 C;  5D3I B;  5BN5 A;  4MIU A;  1AFP A;  1GHJ A;  4P71 A;  3R2T A;  2EYL A;  1JC7 A;  2Y0S B;  2EY2 A;  2JK8 A;  3T53 B;  5H1S E;  2FXQ A;  2UXC Q;  5M3M B;  1Q12 A;  3GTP H;  1VQE A;  1P8L A;  1VS0 A;  3CQZ H;  5FLX E;  5DLQ E;  3CC7 A;  2B39 A;  2KHS A;  1CZG A;  1S5F D;  1FNU A;  4KHV A;  1SE3 A;  4AYB E;  1L0X B;  3GTG H;  3DM1 A;  4KJN A;  1EY5 A;  2MHV A;  4YWL A;  3I7F A;  4KTA A;  2Q8T A;  1LM0 A;  2QGQ A;  3KLW A;  5CYU A;  3QIA A;  2K1B A;  3NTK A;  4BA1 I;  1SYG A;  3E0E A;  2D2C C;  4IJL A;  5JJL A;  2K7V A;  3P20 A;  3STB D;  5T1I A;  3AQQ A;  1I4Q A;  4KMU C;  3MHB A;  4UHV A;  3HKZ G;  4B3S L;  1EIF A;  5EJW A;  4EQP A;  4GLX A;  2DUD A;  4PZ7 A;  1N34 L;  4U68 A;  3HFZ B;  3K59 A;  2LS0 1;  2A74 C;  3GV3 A;  1EOT A;  1F2M A;  4KY6 A;  3A74 A;  1SNO A;  3FPU B;  3H3V C;  4N8F A;  3EIV A;  1X65 A;  1WVL A;  2JQO A;  3VYS A;  1K28 A;  2F3W A;  1MBY A;  1DCZ A;  3J81 i;  1ZYR D;  1HZB A;  4IOC A;  2ATW A;  2K33 A;  5FJ8 G;  3ND9 A;  1CKM A;  1BDO A;  3VR4 A;  3A55 A;  1PDQ A;  4QJF A;  3U4V A;  2BA0 A;  3F2B A;  4NXN L;  2EOT A;  1TT2 A;  1TWF B;  1TQO A;  4WRD A;  4B3M Q;  4KK7 A;  3T1Y L;  1VQF A;  1PH7 A;  1WTQ A;  2E5L Q;  1SND A;  2BOS A;  4L5T A;  2ZXO A;  4GLA C;  5IGD A;  2HT1 A;  1PZK D;  5ISR A;  2VY3 A;  1HR0 W;  3HOY G;  4EVO A;  1PTO D;  3I90 A;  1AE3 A;  1ONL A;  1PXU A;  4QY7 A;  2L0C A;  2Z4H A;  3DMU A;  1W6J A;  1R9T B;  4IFD J;  4QQB X;  3H0G H;  2P5Z X;  2WKD A;  1UE6 A;  3K57 A;  1PYW D;  4OIK A;  4PMB A;  5BR8 Q;  2QDL A;  2RCN A;  2ZXR A;  3NPP A;  1PFM A;  1N33 L;  1V1O A;  1L1O C;  3CC4 A;  4POG A;  1TS5 A;  4XT1 B;  2ZTC A;  3I4M G;  3BZD B;  1ASZ A;  2L5T A;  1WI5 A;  3A8K E;  2PYK A;  3M4O H;  3SK6 A;  4JBM A;  3SDZ A;  1A6X A;  4C2M H;  4B08 A;  1TWG H;  4RHR A;  2M9V A;  4R1J A;  1WTR A;  1MKH A;  2PNR C;  1N32 L;  4A3K G;  1T5E A;  1UE1 A;  3TN2 A;  1B8A A;  1V9P A;  3I91 A;  4RGM A;  3C1E A;  5E4X A;  4DR6 Q;  4OO1 I;  2R93 H;  5IYC G;  3VR2 A;  5LMN W;  4RH6 A;  1Z47 A;  2BE5 C;  2PI2 E;  4IUN A;  1STG A;  1XTD A;  1VQ6 A;  1QNU A;  1YJ9 A;  4V0B A;  3BU2 A;  2XRS D;  2LXJ A;  4RKB A;  4UPA A;  1R4P B;  3KBX A;  4A3I B;  4WJW A;  1ESR A;  3I4M H;  5IWA Q;  1QE6 A;  2F0N A;  2C35 B;  2DY8 A;  2SEB D;  4K8I A;  4LF4 Q;  1XNR L;  4JI1 L;  4C3J G;  2NZH A;  4UP7 A;  5M5X B;  1VMP A;  5C0X G;  2ASB A;  1IHZ A;  3KF8 A;  3RLN A;  1PVO A;  3HKZ B;  1ML0 D;  4K8J A;  4DUZ Q;  3S16 H;  3QJY A;  4DNI A;  3J80 E;  1BCP C;  1ROD A;  1A2T A;  1S4Z A;  5IYC H;  4LJZ C;  5CV8 A;  2UXD L;  3MVV A;  5JPM C;  4XTC S;  1SMX A;  2CVR A;  4LFA L;  3BZK A;  1HFG A;  1TVX A;  1AEX A;  3E3X A;  3NUC A;  1HPC A;  4LF7 L;  2CW0 D;  3NQT A;  4UY8 C;  4XDX A;  2LFN A;  4ZCK A;  1KQS A;  1DYQ A;  2HQE A;  4KV6 A;  4JOI C;  3HP3 A;  3UE1 A;  3FKI H;  4JI2 L;  1LTB D;  2HDM A;  3PSI A;  4MTN A;  4QMG A;  4LFB Q;  4NXM Q;  3MA2 B;  5E7N A;  2A69 C;  4C3J H;  2K50 A;  1Q7Y C;  1SFO H;  2UXB L;  2ZM6 Q;  5COR A;  2XSC A;  1EYD A;  2YYZ A;  2VXW A;  2C9O A;  4AQY L;  2EVB A;  3CCE A;  1EEF D;  1YNN D;  1BUV T;  1VQM A;  4LW1 A;  2B2V C;  3NQI A;  1ENC A;  1W6K A;  1EWC A;  4DA2 A;  1K3R A;  1EZ8 A;  3Q24 A;  2YU9 H;  4N8X 1;  3M4O B;  5ELF A;  5IP7 G;  1PH6 A;  3MWY W;  3ZYY X;  3EVQ A;  3HOY B;  4K0K L;  2R92 G;  5GAH C;  3QB3 A;  1Q3L A;  2B2Y C;  1RDP D;  5CBA E;  2VQE L;  1Y69 U;  1SYD A;  4G7H C;  1XX8 A;  2A5H A;  4IPC A;  2PMZ B;  3T56 B;  4X66 L;  3J81 L;  4OX9 L;  2E76 C;  1F2Y A;  5A2Q L;  4I7Z C;  4TRD A;  5IE8 A;  1MI2 A;  1BBW A;  3T4A C;  2IL8 A;  4IQZ A;  5M5W H;  3I4M B;  1KAA A;  1E7Z A;  2F1M A;  2IJ0 A;  4GN3 B;  5C6A A;  3KDF A;  4A4I A;  5IYB G;  4H7B A;  1CSP A;  4NKL A;  4OXP A;  2HIX A;  5I6W A;  3CP0 A;  3GTQ H;  1LT5 D;  2R92 H;  5FO8 B;  4A3K B;  3GP7 A;  3M3Y B;  3S16 B;  1U4L A;  2J0T D;  1OXX K;  2RHS B;  4P75 A;  3R93 A;  5IT9 c;  3TEH B;  3OW2 A;  4DNR B;  3MXU A;  4OGQ C;  3QO2 A;  4LNQ A;  4A93 G;  4RA8 A;  1SXT A;  5ELC A;  3I3C A;  1CKN A;  1F9Q A;  1VQL A;  1OXU A;  4QIW B;  3J81 j;  1I5F A;  1B53 A;  1QNK A;  2EPB A;  2K4K A;  1UWV A;  2VL6 A;  4JV5 Q;  1LAC A;  1K3B C;  2HD3 A;  2HIV A;  3MFY A;  2R7Z G;  2NZO A;  1KIX A;  3RLO A;  3M9B A;  4C3J B;  5C44 G;  1MJE A;  1U4R A;  3VR3 A;  1VQJ A;  2KHI A;  2UXC L;  2VNU D;  1Q46 A;  2OTL A;  1FGU A;  4HED A;  2VS1 A;  4PQX A;  4CBV A;  1Y1W G;  2F0D A;  2L1B A;  3HOV G;  3GO5 A;  3O13 A;  1LTS D;  2PCF B;  4OIJ A;  3FRP B;  1EQR A;  2WFW A;  3G6E A;  2F0K A;  3A54 A;  2F0T A;  4WFN 3;  1BCP B;  2JA8 G;  2BA1 A;  1DOK A;  3GTL B;  5FLM G;  4ZUJ A;  2K5V A;  2N55 A;  2QF7 A;  4NPS A;  1S72 A;  1Z7T A;  1D2B A;  1F9R A;  4XT3 B;  4XQJ A;  3G48 A;  2ZXP A;  1NE3 A;  2DGY A;  1PYS B;  4OON A;  1EY9 A;  2GA4 B;  2R7Z H;  1HHV A;  3ULL A;  3NEN A;  3KOJ A;  2EY5 A;  4NXN Q;  5C44 H;  1V1P A;  1SYC A;  2Z6K A;  1PTO F;  3QR8 A;  1RHP A;  2NUC A;  3KJO A;  1PH8 A;  1EOV A;  4CDD C;  1K8M A;  3D3R A;  3BZC A;  4RHS A;  1STY A;  5M5W B;  2C5C A;  4IPD A;  2IWH A;  3L2P A;  1Y8O B;  5JEA G;  1KRS A;  1E2Z A;  2JA8 H;  3A0J A;  1PH2 A;  1X32 A;  3HOZ G;  1Y14 B;  5J22 A;  3JAM c;  3S15 B;  4A3G H;  1CA5 A;  5GRO A;  1GUG A;  2R92 B;  2HCC A;  3RZD H;  4FF1 A;  3ERQ A;  2ZJR A;  1PH5 A;  2N49 A;  4KKS A;  3W2D A;  5M9O A;  4KN7 C;  1VQI A;  1N33 Q;  2A19 A;  1LTG D;  3I4L A;  4J1M A;  2JSO A;  2RA4 A;  4IUQ A;  5DAU A;  1WTV A;  2JA7 H;  2CWP A;  3CRL C;  4QF4 A;  3EJI A;  1SEB D;  2E5L L;  1KLU D;  1OO9 B;  1HTP A;  3I2Z A;  1CK1 A;  3S14 B;  1DXM A;  1LYL A;  3AB9 A;  4KN4 C;  3R3O A;  5JEA H;  5ELN A;  5HGQ A;  4A3F H;  4ABN A;  1TWA H;  1N32 Q;  1X3G A;  1KNA A;  2EY6 A;  3BVZ A;  5DM7 3;  2F0W A;  3OIP A;  3HOZ H;  2F0G A;  1SLJ A;  3SGI A;  1YJN A;  1G29 1;  1DOL A;  1MSG A;  1HA6 A;  1BVS A;  1IL2 A;  3E9I A;  1VQK A;  1NTG A;  2F0F A;  4IFD H;  3GDE A;  2RSO A;  2F03 A;  1S5E D;  4OEM B;  3JAM i;  4IPH A;  3PO3 G;  2KUM A;  2AKW B;  5GQO A;  3MXG A;  5BR8 L;  1AN8 A;  4A93 B;  2AQ3 B;  2H1E A;  2NVX H;  4UP9 A;  1XNR Q;  4JI1 Q;  1A8V A;  3I8Z A;  3SK5 A;  4CHT B;  4APV A;  1ILQ A;  4YWK A;  3TZD A;  3Q23 A;  1AW7 A;  5E1F A;  1D5X C;  3RR5 A;  2MO0 A;  4GN5 A;  4LF9 L;  5FLX c;  1BKB A;  5C44 B;  1WCM G;  1SNC A;  4C3I G;  4OO1 G;  4OHJ A;  1BBX C;  2WP8 J;  5JPN C;  3MXN A;  2UXD Q;  2E2J B;  5AFW A;  1TS2 A;  1Y1W B;  1T9H A;  3PUV A;  3HOV B;  1X3F A;  5J1Z A;  4GKK Q;  4LFA Q;  4HTH A;  1GUN A;  2F3V A;  1B2T A;  1A0I A;  3M4Q A;  2B63 G;  3A8J E;  1EY4 A;  1BNZ A;  4L5Q A;  3H94 A;  4JI0 L;  4LUO A;  5IGF A;  2PPB C;  3L3O C;  4JI2 Q;  1Y8N B;  4DF7 A;  4XXE A;  4BA2 I;  4YCU A;  4GZY C;  1O7L A;  3J7A V;  3RZD B;  2R61 A;  4LF4 L;  4A3E G;  3DLL A;  4AQY Q;  1EY6 A;  4BWG B;  4N9P A;  1PRT D;  5C0X J;  1WTP A;  1S5C D;  1V43 A;  5CV5 A;  2ZTE A;  4OO1 H;  3S1Q B;  1SRO A;  3S1N B;  1QUQ A;  4JI5 L;  3G6J B;  1TS3 A;  1ZXT A;  4DV2 L;  1NUC A;  3K5O A;  5LMN L;  3CD6 A;  1C4Q A;  5EPK A;  4KHP L;  3H6M A;  1TY2 A;  5GAD C;  1TWA B;  1EU3 A;  2F0Q A;  1PZJ D;  1EIY B;  4A3L G;  3FEW X;  3W1B A;  3HOZ B;  2VQE Q;  2EJF C;  4YCW A;  1I4R A;  4ZKC B;  3E5S A;  3LNN A;  4X66 Q;  5JOB A;  2K6A A;  1EL0 A;  2ES2 A;  2KCT A;  5EKK A;  4IJH A;  4LFC L;  4DR1 L;  3D4D A;  2HHH L;  1N8R C;  3GTO B;  1BCP D;  4HMJ A;  1IKL A;  4CKB A;  1PFS A;  2NN6 I;  3C46 A;  4MN3 A;  5CGK A;  3MAQ A;  1F77 A;  4HJA A;  4EX5 A;  1B70 B;  1HQM C;  5E4W C;  1YHA A;  1XWE A;  1PLF A;  2RDG A;  1UE7 A;  2EYO A;  1G8Z D;  3D4W A;  1KL9 A;  4FYD A;  2B8G A;  2AMC B;  1KRT A;  4L8J A;  2A6E C;  2JXM B;  3CCV A;  3TS2 A;  1IW7 C;  1TWF H;  3PO3 B;  2MJ8 A;  2DJF C;  3NTI A;  5KEE A;  3H15 A;  4BBS G;  1L0Y B;  1MIU A;  3U58 A;  2B2W A;  4LAA A;  1TR5 A;  1UUP A;  3OIQ A;  4KKT A;  1RKN A;  2E75 C;  2MGS A;  2QW7 A;  4ILW A;  3A8I E;  3NBH A;  4RGN A;  1H95 A;  3MEH A;  1M90 C;  1YNJ D;  2RVL A;  1F2L A;  2WAQ E;  3H09 A;  5JJZ A;  2B29 A;  3NSW A;  1YIT A;  3K0X A;  4KY7 A;  2A68 C;  3VDY A;  4M8A A;  3URY A;  1A62 A;  2QA4 A;  1R9T H;  1WCM B;  4C3I B;  4PZ6 A;  2I5L X;  1CHP D;  1EQT A;  1ZKO A;  1H9K A;  3B6Y A;  1X56 A;  3X3N A;  2KCN A;  3TP5 A;  2B63 B;  2MQH A;  4A3I G;  4MHE A;  1H9S B;  4DAV A;  2ENB A;  2NVT B;  1PMR A;  2D9U A;  3GD7 A;  4JV5 L;  4N9T A;  4DR3 L;  5LL6 X;  1D1K A;  2OXP A;  4LK1 C;  1GD7 A;  4A3E B;  1GXD C;  1O78 A;  1GUW A;  5FK9 C;  1CTM A;  2NVY H;  3QOJ A;  3W3A A;  3J80 c;  1XXG A;  1VQP A;  2B2T C;  1G6P A;  2ICE C;  4F87 A;  5FO9 B;  1KTK A;  1ENA A;  4BBR G;  1M1K C;  2JE6 I;  1Z6H A;  2YV5 A;  2V4D A;  1V8Q A;  3DHQ A;  5M3F G;  3S1R B;  2XTI A;  1X3Q A;  4A3I H;  3TDQ A;  1O7I A;  4DK3 C;  2NTT A;  4RCN A;  2EY1 A;  3P75 A;  4UP8 A;  4K5V A;  4GN4 B;  3VR6 A;  1HUM A;  5TSS A;  2FMC A;  3G71 A;  5M5X H;  4Q0F A;  2Z4I A;  3BDL A;  4ZAI A;  4B3R L;  2SNS A;  3HOU G;  3HZX A;  3D31 A;  4S3S A;  4WJ3 M;  3CME A;  1AZP A;  3T16 A;  1VQ9 A;  1O7Z A;  3K8A A;  3I4O A;  4A3J G;  4A3B G;  1WFQ A;  4R4I A;  3J7Z C;  2CH4 A;  3K0Y A;  3J80 i;  2KCC A;  2F0O A;  3M4Y A;  1V1Q A;  1KC8 C;  1M8A A;  5JEA J;  3UDI A;  2D0O A;  2SNM A;  5KYI A;  1HZC A;  3HKS A;  1D1I A;  3CCS A;  4DV6 L;  3F8T A;  4HR7 B;  1IKM A;  3MEF A;  3H3V H;  1I4G A;  1YIJ A;  1Q1B A;  5BN4 A;  4L5S A;  3EQL C;  4OWT B;  2M2L A;  5FJ8 H;  2BDO A;  2NYZ D;  2ZJP A;  2KJX A;  5FKA C;  3HOU H;  3R8B A;  5JJK A;  2EIF A;  2G9D A;  5L37 A;  2RCF A;  4HJ5 A;  4BBS B;  3BJU A;  4A3B H;  4JCV E;  4IUP A;  1VQ5 A;  1HH2 P;  5M5Y B;  1JOR A;  1H9M A;  1CI3 M;  3KUP A;  1QJO A;  2IHE A;  4LF9 Q;  3HOY H;  1RIP A;  3OSO A;  3W5O A;  2FHT A;  3FP9 A;  4GKJ L;  4KLK A;  2KCM A;  4CGY B;  4XYO A;  1BQQ T;  2F0M A;  2O5J C;  4IAL A;  2NVY B;  1B3A A;  5J39 A;  5JAV A;  4HMI A;  2F52 A;  3D0F A;  4ZKB B;  3LGJ A;  3RNU A;  1VQO A;  1XYI A;  1PH9 A;  1XMQ L;  1HFN A;  2AUJ D;  1VQB A;  4JI0 Q;  1H9J A;  1PRT F;  3GTJ H;  2K52 A;  4JI3 L;  1JIC A;  2K14 A;  3ND8 A;  5EBC A;  4DV7 L;  2UUC L;  2RHQ B;  4H0L C;  3SHL A;  3IAY A;  3SEB A;  1FGB D;  1JWU D;  1GO3 E;  4Z9C B;  2WB1 E;  4P72 A;  2MP1 A;  3CU7 A;  3PV0 A;  1TKW B;  3AYH B;  2M00 A;  3P7J A;  1S5B D;  1BXT A;  1FNV A;  1U4M A;  1G6Z A;  3J81 E;  4A3K H;  3S17 B;  3M3Y H;  4AYB G;  1CUK A;  1GKH A;  5A2Q E;  4JI5 Q;  1DJR D;  4ID6 A;  2QEX A;  4DV2 Q;  2F0E A;  1E24 A;  1MD2 D;  3X3M A;  4GKK L;  1QZG A;  4MZ9 A;  5LMN Q;  1WD0 A;  4BBR B;  1QVF A;  4BS9 A;  4KHP Q;  1KNE A;  2X69 A;  3KK7 A;  2Q8R E;  1YNX A;  5C4X G;  2VB2 X;  5M3F B;  4X3T A;  1UEB A;  2XWB B;  4HJ9 A;  2E2I H;  2JYO A;  4Q5V A;  2HCI A;  3R2I A;  1BCP F;  1X3P A;  3L9A X;  5CV9 A;  3CCQ A;  5EKL A;  4PMW A;  4KJO A;  1QWY A;  3K7A H;  1WJJ A;  5C0X H;  4O0A A;  3PMF A;  3A5Z B;  3NEL A;  2FIN B;  3NXW A;  1MSH A;  3OTO L;  4DR1 Q;  1XMO L;  4LFC Q;  2HHH Q;  1UNS A;  3HOU B;  3PUX A;  4GNX C;  3CHB D;  1TY0 A;  4C3H G;  1YEZ A;  1HNW L;  3Q22 A;  3I70 A;  4NP5 A;  2EE1 A;  4A3J B;  4A3B B;  1LLR D;  4FNF A;  4E6I A;  5K5P A;  3GTL H;  1E2W A;  1TWC H;  2L15 A;  2PQA B;  3NWT A;  1EWI A;  3OWE B;  4HSP A;  2AHO B;  1A3T A;  4GOP C;  3BDC A;  1E1T A;  1EEI D;  4YIJ A;  1UEA B;  2XGT A;  2V1C C;  2OCE A;  4X62 L;  4IOA A;  2A1A A;  5EPJ A;  1PV4 A;  5EPL A;  1STB A;  1E1O A;  3CMA A;  4U67 3;  1IYV A;  3CRK C;  4YHH L;  2B2U C;  2K5W A;  1EYA A;  2QKI C;  1D5Z C;  1EZ6 A;  4I65 A;  2DN8 A;  3DEO A;  5COY A;  2IX3 A;  1PHJ A;  4O2D A;  2UU9 L;  3GTJ B;  4X65 Q;  1YHB A;  3UI2 A;  3BYY B;  4G7Z C;  4A3C G;  4YCV A;  2IHF A;  4DXF A;  3U9S A;  4JPB W;  3PIP 3;  4TKO B;  4CDC C;  4ZUI A;  3SK4 A;  2JA5 G;  2NN6 G;  4LF6 L;  1L1O B;  4TQU S;  1H9R A;  1EFW A;  5IOD A;  1D7Q A;  1JE4 A;  4R4T A;  5IP7 H;  3S15 H;  4L63 B;  1PFN A;  4DUY Q;  1CKO A;  1HXY D;  3MTS A;  4R4Q A;  2Q2T A;  2VQF L;  1IL8 A;  1C48 A;  1J6Q A;  3KLS A;  4IO9 A;  1LT6 D;  3S2D B;  1Q8K A;  5CR3 A;  2LSS A;  3EN2 A;  3STB C;  1I4H A;  4H44 C;  5CV7 A;  4DV1 L;  3CXC A;  2K5H A;  2KEC A;  4DR4 Q;  4JBJ A;  2AUK A;  4LF5 L;  1JJ2 A;  4V19 0;  4UAI A;  4F8M A;  2E2H H;  2Y0S E;  1W2B A;  4A3C H;  1PYB A;  2E2I B;  2MO1 A;  3S14 H;  4AIM A;  2JA5 H;  1FVI A;  2NN6 H;  1SE4 A;  4DR3 Q;  2LY7 A;  2WAQ B;  4P2C B;  1J9O A;  1VQ8 A;  2EJM A;  3VYR A;  3NTH A;  3OYY A;  1JJG A;  1KLG D;  5IYB H;  3K7A B;  4OEL B;  3WOE A;  4CJ2 C;  3SXH A;  4K2L A;  1KDA A;  4RCO A;  2N8N A;  1YBY A;  2F0I A;  3Q6S A;  1B3Q A;  1ZYR C;  4AYB B;  4F88 A;  1L0W A;  2AQ1 B;  5ELB A;  5KRU A;  3BYT B;  3VA7 A;  4DK0 A;  1D8L A;  2KQ3 A;  4K6L A;  5DM6 3;  4A93 H;  3Q8D A;  2WB1 G;  1OXT A;  4HJ8 A;  4G57 A;  1TWC B;  1K83 B;  2Z9H A;  3VA5 A;  2VUM G;  5C4X B;  5DNF A;  2A6H D;  3K5N A;  3PIO 3;  2FFK B;  1I6H H;  4O1N A;  3RZO H;  4JI4 Q;  2LMC B;  4B3R Q;  1VDZ A;  2MUY A;  4IUV A;  4OWX B;  4AH6 A;  3OMG A;  3QWN A;  2I5M X;  3HRZ C;  3PF4 A;  1ASY A;  3GTM B;  2OEO A;  3A7A B;  4JBW A;  3IL8 A;  2K5Q A;  3L7Z C;  2E2J H;  1Y1W H;  4LUV A;  3HOV H;  1WTX A;  1AH9 A;  3DEP A;  4DXG A;  4DV0 L;  4C3H B;  5I2X A;  4FF3 A;  1ET9 A;  2F0L A;  1JMC A;  2KA7 A;  1GUT A;  2DNC A;  3MXP A;  5IYD G;  3C2P A;  3K7U C;  4EQO A;  4GNX B;  1EY8 A;  3KF6 B;  2HDL A;  5FLM H;  4DV6 Q;  1VQD A;  3D6C A;  4OL7 A;  1DM0 B;  3T51 B;  4QB4 A;  2JA6 G;  1AE2 A;  1K0R A;  2PW7 A;  3ER0 A;  1Z9F A;  4ZYS A;  3NK9 A;  1T5X D;  1CM9 A;  1LUZ A;  4DGZ A;  3M4P A;  3CCL A;  4DR2 Q;  4GOP B;  3S1Q H;  3BG3 A;  3S1N H;  5LHY 1;  2F0J A;  3U50 C;  2F0H A;  2E2H B;  1RL2 A;  1HA5 A;  3D8G A;  1XPU A;  3PUZ A;  1SE2 A;  4DAY B;  3WOF A;  5C4Z A;  2JEB I;  2JA5 B;  1QIL A;  1EQV A;  5C3E B;  1I4P A;  3U4Z A;  2CKZ B;  1QOH A;  4MNO A;  1Q86 C;  1GUS A;  4GKJ Q;  3W1G A;  1GHK A;  1PFB A;  2L4N A;  5HUR A;  3C1F A;  1JOK A;  1EWH A;  1SYF A;  4JI7 L;  3CPF A;  1X54 A;  3GQB A;  1EU4 A;  5J3B A;  4P74 A;  1XMQ Q;  1O7Y A;  4UDU C;  5KYL A;  3PF5 A;  2UUB L;  4JI3 Q;  2DNE A;  2J4X A;  2O5I C;  4DV7 Q;  2UUC Q;  4X3S A;  3GTO H;  4RAU C;  1Q8I A;  1PH4 A;  2BCO A;  2EYM A;  1PH1 A;  1G91 A;  1WD1 A;  2EQS A;  2PZW A;  2KBN A;  1I6H B;  1D6E C;  3RZO B;  4B9X A;  3CCU A;  1U5K A;  1OXV A;  2ID0 A;  3ICE A;  1G2T A;  3CAM A;  2CW0 C;  3CPW A;  3VYT A;  3UDF A;  4X64 Q;  3D4R A;  1S3O A;  4F7X A;  1HR0 L;  2D5D A;  1BR9 A;  4BXX G;  4A3D B;  4C1N K;  3I56 A;  2RDF A;  4DAM A;  4JW0 A;  3OOC A;  3PCO B;  4XYQ A;  3S9W A;  1K8G A;  2LKV A;  3PO3 H;  1B9M A;  3V2T A;  1IYU A;  1SBB B;  2L11 A;  2MPM A;  1LAB A;  3D6W A;  1SDF A;  2WB1 B;  1YNN C;  4EGV A;  2I46 A;  1HRJ A;  5CMD A;  2VUM B;  1I3Q H;  1ENF A;  1U4P A;  1X9N A;  3OMC A;  4NMZ A;  3HKZ E;  1K0S A;  4RGT A;  1JJC B;  1B4O A;  3TP8 A;  3OTO Q;  1XMO Q;  1ET6 A;  4JVZ A;  5I4D A;  1UAP A;  1WCM H;  5LMU L;  4C3I H;  1HNW Q;  2R7D A;  3LX0 A;  3HG9 A;  4DV4 L;  5IGC A;  5CC4 A;  2QIL A;  2BE5 D;  2B63 H;  4R8I A;  1WTH A;  5A35 A;  4K2K A;  2O4X A;  2OQ0 A;  4JOI A;  2Q2U A;  2GVA A;  3CC2 A;  1IBK Q;  1KAB A;  4HCE A;  2MFI A;  5LL6 S;  2NVT H;  3ERO A;  1IBM Q;  3IFT A;  4X62 Q;  3CF5 A;  1NR2 A;  4MTK A;  1O80 A;  1SNQ A;  5IY0 A;  2JA6 B;  3PO2 G;  2AQ2 B;  3QG1 A;  1Y1V G;  1N36 L;  4RWS C;  1FL0 A;  5IT9 L;  1B1Z A;  4FF4 A;  1N9W A;  4YHH Q;  4A3E H;  4NB3 A;  4EQ5 A;  2B2V A;  4BY7 G;  2UU9 Q;  4R4C A;  4FXK C;  1TXY A;  3I72 A;  2K28 A;  2IPK D;  3NEM A;  3DM3 A;  5C5L A;  4LF6 Q;  1GVP A;  2HUG A;  3TP7 A;  1CSQ A;  2EDG A;  2XN9 C;  3S1R H;  5KNB A;  1PH3 A;  1VQN A;  3F2C A;  2N78 A;  1E22 A;  4I7A A;  2VQF Q;  1KAW A;  4A3L H;  1HNZ Q;  2PMZ E;  4YY3 Q;  3TP6 A;  3CCM A;  1I94 L;  3PO2 H;  1Y1V H;  3BVM A;  1NCV A;  2ALY B;  4DV1 Q;  2BH8 A;  1C9O A;  2A69 D;  2KVM A;  4LF5 Q;  2RDH A;  1STH A;  4BY7 H;  1CZW A;  1I4X A;  2A73 B;  4X65 L;  1GM5 A;  5D65 A;  2EYJ A;  4HIM A;  1I50 H;  2IT1 A;  1I3Q B;  1EYC A;  3TSS A;  2KHJ A;  3PUW A;  3ONA B;  2RF4 A;  1DD2 A;  2K5N A;  4TVA B;  4DAP A;  1STN A;  3CCR A;  1VQG A;  1MGS A;  5CV4 A;  4IZ8 A;  3SVM A;  4DUY L;  3MFG A;  1DGS A;  5C5M A;  2K32 A;  1ICF B;  4WOR A;  2KOL A;  3OHX C;  3HOX B;  3E9H A;  4K14 A;  4DR7 L;  3RN2 A;  4DR4 L;  4QIW E;  2DY7 A;  1EQQ A;  1RJT A;  4FXD A;  4BBS H;  4G7O C;  5IOC A;  1YHQ A;  3G4S A;  2PI2 A;  1G2S A;  1TWH B;  2HQL A;  4DV5 Q;  1C8C A;  3JAM L;  5M5Y H;  1I6V C;  3T13 A;  3RMH A;  4NDX A;  1JE5 A;  3FPP A;  4LMQ D;  3TBI B;  2EZV A;  3J81 c;  4PG3 A;  5ELD A;  3PGZ A;  3KF8 B;  4KY5 A;  1II3 A;  3PIP A;  4DV0 Q;  2BDN A;  2KEN A;  4KHZ A;  1A3V A;  3FHW A;  2Z6B A;  2K03 A;  1NY4 A;  2SOB A;  2PQE A;  4L6T B;  3BDO A;  4HCS A;  2VB3 X;  2IX0 A;  3S2H H;  1JWM D;  1VQA A;  1EYG A;  1W3S A;  3VYU A;  4LF8 L;  4JG2 A;  2PZU A;  1HUN A;  3CCJ A;  1DZ1 A;  4HID A;  3ERS X;  2Z6K C;  2YTY A;  4Y7N B;  3PO2 B;  3M85 A;  1Y1V B;  2XWJ B;  4JI4 L;  3S17 H;  4JYA L;  1PZI D;  4R8N A;  3AFQ A;  5ELE A;  2CCZ A;  1K8A C;  1FJG Q;  1BBU A;  1MHW C;  2OF1 A;  3BVG A;  4QL5 A;  4BY7 B;  5I9O A;  1EIH A;  2R6G A;  2EYF A;  3EFX D;  1LV9 A;  3KJP A;  4BBR H;  2JN4 A;  4JC0 A;  4KD3 A;  3VR5 A;  1HZA A;  2PNH A;  4IFD I;  1I50 B;  3H0G G;  1B9N A;  5M3F H;  1JWS D;  2PO4 A;  5EQ0 A;  3U9O A;  4IUT A;  4DR5 Q;  4JI7 Q;  4DV3 L;  2F0U A;  5FLX L;  5DEH A;  1NAP A;  2I07 B;  5AJ3 Q;  3IFD A;  1SN8 A;  1KD1 C;  3KLS X;  1NBW A;  1JB7 A;  1NMG A;  1NNX A;  3TRE A;  3HS0 C;  3H91 A;  2UUB Q;  3KFU A;  1Y8P B;  1C0A A;  3EBE A;  2F0S A;  4RGO S;  4DR2 L;  2UUA Q;  3PIO A;  1GOZ A;  1X3E A;  5IIF A;  4NW2 A;  1VQ4 A;  4A3J H;  3GTP B;  3CQZ B;  3IKJ A;  2R93 G;  3AMU A;  1BOS A;  1LTL A;  1CQV A;  4QUF A;  1E0B A;  3RLF A;  1IBL L;  4POF A;  2Z0S A;  3DUZ A;  1G51 A;  2NVQ H;  4KD4 A;  3IRB A;  2YTV A;  3KDF B;  5EBD A;  4C56 C;  1HR0 Q;  5C4J H;  3GTG B;  3UDG A;  3QOL A;  2GN5 A;  3A56 A;  2IX1 A;  2E74 C;  1B44 D;  3FVQ A;  2JA9 A;  3N6R A;  1HJP A;  2RQX A;  1SE8 A;  3MC0 B;  3TS0 A;  4DK1 A;  1P16 A;  3LWU A;  5C3W A;  1EUJ A;  2Q2H A;  1VQ7 A;  1PRT C;  3S2H B;  4X6A H;  3M7G A;  3Q0A A;  1CKN B;  2WAQ G;  2Z8L A;  4X3U A;  1JB3 A;  5HGT A;  4K5X A;  2XNA C;  1QG7 A;  4B3T L;  4FVM A;  3RD4 A;  2EYP A;  2R7F A;  4L5R C;  1ICW A;  1ESF A;  2OT2 A;  4JK1 C;  5LMU Q;  1Q81 C;  1H9S A;  2CQA A;  1KDB A;  3S2D H;  4X64 L;  4DV4 Q;  5E3F A;  3K6O A;  3FKI G;  1J5E L;  1C7Y A;  4WJ4 A;  5GAE C;  3RN5 A;  1SR3 A;  1NSN S;  3AU7 A;  1A63 A;  1OXS C;  1FYC A;  2X6L A;  1HCZ A;  1STE A;  4A3M G;  2L55 A;  3N52 A;  1N36 Q;  5IGG A;  1JR0 D;  1WTO A;  5JJI A;  1LTA D;  1SMY C;  3OW7 A;  1F9P A;  4JI8 L;  1JT8 A;  2L12 A;  4FP5 D;  4KKU A;  1V1P B;  2RKS A;  1CFM A;  5IP9 G;  3NE5 B;  3WWV A;  3LWE A;  2PZT A;  2A8V A;  2Z1C A;  4JI6 Q;  3K5L A;  4CDF C;  3DWP A;  2E2D C;  1FD7 D;  3I55 A;  2XVS A;  4FF2 A;  5CBE E;  1B50 A;  1K83 H;  2QCP X;  2TSS A;  1L2F A;  3H0G B;  3UE0 A;  5C4X H;  2NVQ B;  1F2Z A;  1WOC A;  1IBK L;  2G9H D;  3V96 A;  4A3M H;  1I94 Q;  1IBM L;  4CJ0 B;  1IYJ B;  5C4J B;  5KIX A;  2F4V L;  3DWA A;  2ZT9 C;  3K81 C;  4DPG A;  3GTM H;  2F3I A;  1YNJ C;  2FMM A;  4IN3 A;  2F4I A;  4ME5 A;  4RG1 A;  2CQO A;  1K9M C;  2OWO A;  4C2M B;  4A75 A;  5IP9 H;  3ULP A;  1TWG B;  5I6Y A;  4C3H H;  4IUU A;  3HGB A;  4GLV B;  5C3E G;  1JOO A;  2F0P A;  3T1H L;  2ZJQ A;  2R93 B;  5C3X A;  3A5U A;  1HNX Q;  1VQC A;  1M4V A;  5KGU A;  2K04 A;  4QGU A;  1FR3 A;  3J80 L;  1Q90 A;  2NTS A;  1XNQ L;  1SAP A;  3CW2 C;  4HAE A;  1HNZ L;  3HEJ A;  4EQN A;  1KXL A;  1SSO A;  4ULL A;  4YY3 L;  2MNA A;  4DR7 Q;  5K36 G;  1LTR D;  4HSV A;  1XPO A;  1CQF A;  2CHB D;  2K75 A;  2I0Q A;  2B2W C;  1AZQ A;  2B8F A;  3UDX A;  1JCK B;  4OWW B;  2LXK A;  1OTC A;  3C3L A;  3HOW G;  4RFB A;  5CV6 A;  4FXG C;  1S40 A;  2I5H A;  1Q82 C;  4FO2 A;  1HQR D;  2GVB A;  1GJX A;  1PRT B;  5C3E H;  3TRZ A;  4CJ1 B;  4JBK A;  4B9W A;  2X6G A;  4CKE A;  2EYH A;  5IGE A;  2PW5 A;  4K5W A;  4XIG S;  3TZU A;  1CHQ D;  2Q8I B;  4A3D G;  4PNY A;  5G3L D;  2QEJ C;  4PZ8 A;  3NWS A;  2FJ2 A;  3MZ5 A;  3MXN B;  5K36 H;  3FKI B;  2A6E D;  2OQK A;  1PA6 A;  3S24 A;  1IW7 D;  1K73 C;  4B3S Q;  5EGT A;  3I4N G;  4LF8 Q;  1QCB D;  2WIN B;  3CKI B;  4ZQ3 A;  1SFO B;  4BY1 G;  2QDB A;  2K5D A;  3HOW H;  4J15 A;  2NBF A;  1ZEQ X;  3PUY A;  1SYE A;  1D5M C;  4ZK9 B;  1N34 Q;  1A15 A;  3OPO A;  4LWC A;  4DV5 L;  4QUC A;  4A3M B;  4XQQ A;  4JYA Q;  1BO0 A;  2J7Z A;  4HIO A;  2B2T A;  2YTX A;  1VCI A;  2YU9 B;  1PTO C;  4A3D H;  2A68 D;  2CFM A;  3NHH A;  1QZH A;  4A3G G;  1YZ6 A;  1QUQ B;  3H3V I;  4HJ7 A;  1RTO A;  4RKL A;  2WII B;  2XIW A;  5F2D A;  5GAG C;  4DV3 Q;  4DKA C;  5KND A;  3I4N H;  3K5M A;  3F2D A;  2VW9 A;  4BY1 H;  3S1M H;  2VUM H;  1VMC A;  3T1Y Q;  4J6H A;  1XPR A;  4CDE C;  2JA7 G;  4HN7 A;  3L0O A;  5FOB B;  4KI0 A;  5D14 A;  2PQA A;  2EXZ A;  5BN3 A;  2D0P A;  2TMP A;  1KHI A;  4IPG A;  4A3F G;  1KDC A;  3K80 C;  5KNC A;  1K8O A;  2O2L D;  4ALP A;  1DOM A;  1FJG L;  3KBG A;  1WTW A;  5I9P A;  1YJW A;  1WYD A;  2BH2 A;  1PTO H;  3GTQ B;  4IUR A;  1IBL Q;  5IYD H;  3A7L A;  3E6Z X;  4IFD G;  3ITP A;  2K05 A;  1E3P A;  1EFI D;  1MJC A;  2K01 A;  2EXD A;  1FNW A;  2SDF A;  1LO5 D;  4PMC A;  1LTI D;  4DR5 L;  5FO7 B;  3OWF A;  4ME3 A;  5IGB A;  2KEE A;  2JA6 H;  2E8G A;  4RMF A;  2WV6 D;  2H5X A;  5AJ3 L;  3J7A F;  1ILP A;  4DNT B;  4B3M L;  1L1O A;  1UE5 A;  2N88 A;  1BF4 A;  1QVG A;  2WAC A;  1VF5 C;  2UUA L;  2NZ1 D;  2RBM A;  1LT4 D;  1VF7 A;  3HOW B;  5JVH 3;  1XJV A;  4Y52 H;  4B3T Q;  4YWM A;  5IT9 E;  3NBH B; 
#chains in the Genus database with same CATH homology
 1U9R A;  3SE0 A;  2F0V A;  1RCV D;  1SJE D;  2RSN A;  2EJG C;  1TU2 B;  4J8Q A;  3EA6 A;  3I73 A;  1EY7 A;  2XRQ D;  2ICI A;  2R7Z B;  4ZRZ A;  5C0X I;  3I4N B;  1J8I A;  1RTN A;  4BY1 B;  3S1M B;  2KED A;  3SK8 A;  4K6D A;  1CT1 D;  3F2U A;  3DXJ C;  4M1U B;  4O42 A;  1TII D;  1A2U A;  1CA6 A;  5EKI A;  4CKC A;  2JA8 B;  2AWN A;  3G7L A;  4XQN A;  3P1H A;  5D3D A;  4A3G B;  1PTO B;  1RF2 D;  1LTT D;  4DFA A;  5NUC A;  1HTL D;  3NBI A;  1XTC D;  2JEA I;  4ZLT F;  2JA7 B;  1EY0 A;  1RD9 D;  1SNM A;  4C1N I;  2IW3 A;  3TME A;  1SJH D;  4QCL A;  4ODG A;  4DN4 M;  1S5D D;  4A3F B;  1AP0 A;  5I2Y A;  3M7N A;  1SYB A;  3JAM E;  3J7Y W;  1EIG A;  1TS4 A;  2WKC A;  3K58 A;  2B2Y A;  1JOQ A;  3KLR A;  4X3K A;  2B2U A;  1SMY D;  1R4Q B;  4DAY A;  1Q1E A;  2NVX B;  3V05 A;  1A3U A;  2H4O A;  1NR4 A;  2JP1 A;  2D62 A;  4TSS A;  4DU9 A;  4G4K A;  2L9H A;  1STA A;  5G3L F;  5C4H A;  1QB5 D;  4H13 C;  1LT3 D;  3BS1 A;  3GTK B;  3NP8 A;  1DON A;  3WDN A;  5JVG 3;  3SR1 A;  4R9W A;  3GV6 A;  1JQY D;  2NB0 A;  3DWQ A;  3E0J A;  2NWG A;  3RUZ A;  1GUO A;  3FMC A;  4PV1 C;  1E2V A;  2AWO A;  3FDT A;  1SNP A;  2A6H C;  5T1G A;  2R3Z A;  1F9S A;  5D3I B;  5BN5 A;  4MIU A;  1AFP A;  1GHJ A;  3R2T A;  2EYL A;  1JC7 A;  2Y0S B;  2EY2 A;  3T53 B;  5M3M B;  1Q12 A;  5FLX E;  2B39 A;  2KHS A;  1CZG A;  1S5F D;  1FNU A;  4KHV A;  1SE3 A;  1L0X B;  3DM1 A;  4KJN A;  1EY5 A;  2MHV A;  2Q8T A;  4KTA A;  5CYU A;  3QIA A;  2K1B A;  3NTK A;  4BA1 I;  1SYG A;  2D2C C;  2K7V A;  3P20 A;  5T1I A;  1I4Q A;  4KMU C;  3MHB A;  5EJW A;  4EQP A;  4U68 A;  3K59 A;  2LS0 1;  2A74 C;  3GV3 A;  1EOT A;  1F2M A;  4KY6 A;  1SNO A;  3FPU B;  3H3V C;  1WVL A;  3VYS A;  2F3W A;  1MBY A;  1DCZ A;  1ZYR D;  2K33 A;  3ND9 A;  1BDO A;  3VR4 A;  3A55 A;  1PDQ A;  2BA0 A;  2EOT A;  1TT2 A;  1TWF B;  1TQO A;  4WRD A;  4KK7 A;  1WTQ A;  1SND A;  2BOS A;  2ZXO A;  5IGD A;  1PZK D;  5ISR A;  4EVO A;  1PTO D;  3I90 A;  1ONL A;  1PXU A;  2L0C A;  2Z4H A;  3DMU A;  1W6J A;  1R9T B;  4IFD J;  2WKD A;  3K57 A;  1PYW D;  4OIK A;  4PMB A;  2ZXR A;  3NPP A;  1PFM A;  1V1O A;  1TS5 A;  4XT1 B;  3BZD B;  2L5T A;  3A8K E;  2PYK A;  3SK6 A;  3SDZ A;  1A6X A;  4B08 A;  4RHR A;  2M9V A;  1WTR A;  2PNR C;  1T5E A;  3TN2 A;  3I91 A;  4RGM A;  5E4X A;  3C1E A;  4OO1 I;  3VR2 A;  4RH6 A;  1Z47 A;  2BE5 C;  4IUN A;  1STG A;  1QNU A;  4V0B A;  2XRS D;  4RKB A;  1R4P B;  3KBX A;  4A3I B;  4WJW A;  1ESR A;  1QE6 A;  2F0N A;  2DY8 A;  2SEB D;  4K8I A;  4C3J G;  5M5X B;  1VMP A;  5C0X G;  1IHZ A;  3KF8 A;  3HKZ B;  1ML0 D;  4K8J A;  3QJY A;  3J80 E;  1BCP C;  1ROD A;  1A2T A;  1S4Z A;  4LJZ C;  5CV8 A;  3MVV A;  5JPM C;  4XTC S;  2CVR A;  1HFG A;  1TVX A;  1AEX A;  3NUC A;  1HPC A;  2CW0 D;  3NQT A;  4XDX A;  2LFN A;  1DYQ A;  2HQE A;  4KV6 A;  3HP3 A;  1LTB D;  2HDM A;  4QMG A;  3MA2 B;  2A69 C;  5COR A;  2XSC A;  1EYD A;  2YYZ A;  2VXW A;  2C9O A;  2EVB A;  1EEF D;  1YNN D;  1BUV T;  2B2V C;  3NQI A;  1ENC A;  1W6K A;  1EWC A;  4DA2 A;  1EZ8 A;  3Q24 A;  3M4O B;  5ELF A;  3MWY W;  3ZYY X;  3EVQ A;  3HOY B;  3QB3 A;  1Q3L A;  2B2Y C;  1RDP D;  5CBA E;  1Y69 U;  1SYD A;  4G7H C;  1XX8 A;  2A5H A;  2PMZ B;  3T56 B;  3J81 L;  2E76 C;  1F2Y A;  5A2Q L;  4I7Z C;  4TRD A;  1MI2 A;  3T4A C;  2IL8 A;  4IQZ A;  3I4M B;  1KAA A;  2F1M A;  2IJ0 A;  5C6A A;  4H7B A;  4NKL A;  5I6W A;  1LT5 D;  5FO8 B;  4A3K B;  3GP7 A;  3M3Y B;  3S16 B;  1U4L A;  2J0T D;  1OXX K;  3R93 A;  4DNR B;  3MXU A;  4OGQ C;  3QO2 A;  4RA8 A;  1SXT A;  5ELC A;  3I3C A;  1F9Q A;  1OXU A;  4QIW B;  1B53 A;  1QNK A;  2EPB A;  1LAC A;  3MFY A;  4C3J B;  1U4R A;  3VR3 A;  2VNU D;  4HED A;  4CBV A;  4PQX A;  2F0D A;  2L1B A;  3GO5 A;  3O13 A;  1LTS D;  2PCF B;  4OIJ A;  3FRP B;  2F0K A;  3A54 A;  2F0T A;  4WFN 3;  1BCP B;  2BA1 A;  1DOK A;  3GTL B;  4ZUJ A;  2N55 A;  2QF7 A;  1Z7T A;  1D2B A;  1F9R A;  4XT3 B;  4XQJ A;  2ZXP A;  1HHV A;  1EY9 A;  2GA4 B;  2EY5 A;  1V1P A;  1SYC A;  1PTO F;  1RHP A;  2NUC A;  1K8M A;  3D3R A;  4RHS A;  1STY A;  5M5W B;  2C5C A;  2IWH A;  1Y8O B;  5JEA G;  1E2Z A;  1X32 A;  5J22 A;  3S15 B;  1CA5 A;  1GUG A;  2R92 B;  2HCC A;  4FF1 A;  3ERQ A;  4KKS A;  3W2D A;  5M9O A;  4KN7 C;  1LTG D;  3I4L A;  4J1M A;  2JSO A;  2RA4 A;  4IUQ A;  5DAU A;  1WTV A;  3CRL C;  4QF4 A;  3EJI A;  1SEB D;  1KLU D;  1OO9 B;  1HTP A;  1CK1 A;  3S14 B;  1DXM A;  3AB9 A;  4KN4 C;  3R3O A;  5JEA H;  4ABN A;  1KNA A;  2EY6 A;  3BVZ A;  5DM7 3;  2F0W A;  3OIP A;  2F0G A;  1G29 1;  1DOL A;  1MSG A;  1HA6 A;  2F0F A;  4IFD H;  2RSO A;  2F03 A;  1S5E D;  2KUM A;  3MXG A;  1AN8 A;  4A93 B;  2AQ3 B;  2H1E A;  3I8Z A;  3SK5 A;  4CHT B;  1ILQ A;  3Q23 A;  3TZD A;  1AW7 A;  5E1F A;  1D5X C;  5C44 B;  1SNC A;  4C3I G;  4OO1 G;  4OHJ A;  1BBX C;  2WP8 J;  5JPN C;  3MXN A;  2E2J B;  5AFW A;  1TS2 A;  1Y1W B;  3PUV A;  3HOV B;  5J1Z A;  4HTH A;  1GUN A;  2F3V A;  1B2T A;  3A8J E;  1EY4 A;  1BNZ A;  3H94 A;  5IGF A;  2PPB C;  3L3O C;  1Y8N B;  4DF7 A;  4XXE A;  4BA2 I;  4GZY C;  1O7L A;  3J7A V;  3RZD B;  2R61 A;  1EY6 A;  4BWG B;  4N9P A;  1PRT D;  5C0X J;  1WTP A;  1S5C D;  1V43 A;  5CV5 A;  4OO1 H;  3S1Q B;  3S1N B;  3G6J B;  1TS3 A;  1ZXT A;  1NUC A;  3K5O A;  1C4Q A;  5EPK A;  3H6M A;  1TY2 A;  1TWA B;  1EU3 A;  2F0Q A;  1PZJ D;  3FEW X;  3HOZ B;  2EJF C;  1I4R A;  4ZKC B;  3E5S A;  3LNN A;  5JOB A;  2K6A A;  1EL0 A;  5EKK A;  3D4D A;  3GTO B;  1BCP D;  4HMJ A;  1IKL A;  4CKB A;  2NN6 I;  3C46 A;  4MN3 A;  5CGK A;  3MAQ A;  1F77 A;  1HQM C;  5E4W C;  1XWE A;  1PLF A;  2RDG A;  2EYO A;  1G8Z D;  3D4W A;  4FYD A;  2B8G A;  4L8J A;  2A6E C;  2JXM B;  1IW7 C;  3PO3 B;  2MJ8 A;  3NTI A;  5KEE A;  1L0Y B;  2B2W A;  4LAA A;  1TR5 A;  1UUP A;  3OIQ A;  4KKT A;  1RKN A;  2E75 C;  2MGS A;  4ILW A;  3A8I E;  3NBH A;  4RGN A;  3MEH A;  1YNJ D;  2RVL A;  1F2L A;  5JJZ A;  3H09 A;  3NSW A;  4KY7 A;  2A68 C;  4M8A A;  3URY A;  1WCM B;  4C3I B;  1CHP D;  1EQT A;  1ZKO A;  1H9K A;  3X3N A;  2KCN A;  3TP5 A;  2B63 B;  4MHE A;  1H9S B;  4DAV A;  2ENB A;  2NVT B;  1PMR A;  2D9U A;  3GD7 A;  4N9T A;  5LL6 X;  1D1K A;  2OXP A;  4LK1 C;  4A3E B;  1GXD C;  1O78 A;  1GUW A;  5FK9 C;  1CTM A;  3QOJ A;  3W3A A;  1XXG A;  2B2T C;  2ICE C;  4F87 A;  5FO9 B;  1KTK A;  1ENA A;  2JE6 I;  1Z6H A;  2V4D A;  1V8Q A;  3DHQ A;  3S1R B;  1X3Q A;  3TDQ A;  2NTT A;  4RCN A;  2EY1 A;  3P75 A;  4K5V A;  3VR6 A;  1HUM A;  5TSS A;  2FMC A;  4Q0F A;  2Z4I A;  3BDL A;  4ZAI A;  2SNS A;  3HZX A;  3D31 A;  4S3S A;  1AZP A;  3T16 A;  1O7Z A;  3K0Y A;  2KCC A;  2F0O A;  3M4Y A;  1M8A A;  5JEA J;  5KYI A;  2SNM A;  1D1I A;  1IKM A;  4HR7 B;  1I4G A;  1Q1B A;  5BN4 A;  3EQL C;  2M2L A;  2BDO A;  2NYZ D;  2KJX A;  5FKA C;  3R8B A;  2G9D A;  4BBS B;  4IUP A;  5M5Y B;  1JOR A;  1H9M A;  1CI3 M;  3KUP A;  1QJO A;  3OSO A;  2FHT A;  4CGY B;  4XYO A;  1BQQ T;  2F0M A;  2O5J C;  4IAL A;  2NVY B;  1B3A A;  5J39 A;  5JAV A;  4HMI A;  4ZKB B;  1XYI A;  1HFN A;  2AUJ D;  1H9J A;  1PRT F;  1JIC A;  3ND8 A;  5EBC A;  4H0L C;  3SHL A;  3IAY A;  3SEB A;  1FGB D;  1JWU D;  4Z9C B;  2MP1 A;  3CU7 A;  3PV0 A;  1TKW B;  2M00 A;  3P7J A;  1S5B D;  1BXT A;  1FNV A;  1U4M A;  1G6Z A;  3J81 E;  3S17 B;  5A2Q E;  1DJR D;  4ID6 A;  2F0E A;  3X3M A;  1MD2 D;  1WD0 A;  4BBR B;  4BS9 A;  1KNE A;  2X69 A;  3KK7 A;  2Q8R E;  2VB2 X;  5M3F B;  4X3T A;  2XWB B;  2JYO A;  4Q5V A;  2HCI A;  3R2I A;  1BCP F;  1X3P A;  3L9A X;  5CV9 A;  5EKL A;  4PMW A;  4KJO A;  1QWY A;  5C0X H;  3PMF A;  2FIN B;  3NXW A;  1MSH A;  1UNS A;  3HOU B;  3PUX A;  3CHB D;  1TY0 A;  4C3H G;  3Q22 A;  3I70 A;  4NP5 A;  2EE1 A;  4A3J B;  4A3B B;  1LLR D;  4FNF A;  4E6I A;  5K5P A;  1E2W A;  3NWT A;  3OWE B;  4HSP A;  1A3T A;  3BDC A;  1EEI D;  4YIJ A;  1UEA B;  5EPJ A;  5EPL A;  1STB A;  4U67 3;  1IYV A;  3CRK C;  2B2U C;  2K5W A;  1EYA A;  2QKI C;  1D5Z C;  1EZ6 A;  4I65 A;  2DN8 A;  3DEO A;  5COY A;  2IX3 A;  3GTJ B;  3UI2 A;  3BYY B;  4G7Z C;  4DXF A;  3U9S A;  3PIP 3;  4TKO B;  4ZUI A;  3SK4 A;  2NN6 G;  4TQU S;  1H9R A;  5IOD A;  1JE4 A;  4L63 B;  1PFN A;  1HXY D;  3MTS A;  1IL8 A;  1C48 A;  3KLS A;  1LT6 D;  3S2D B;  5CR3 A;  1I4H A;  4H44 C;  5CV7 A;  2KEC A;  2AUK A;  4V19 0;  4UAI A;  4F8M A;  2E2I B;  2NN6 H;  1SE4 A;  2LY7 A;  2WAQ B;  4P2C B;  1J9O A;  2EJM A;  3VYR A;  3NTH A;  1KLG D;  3K7A B;  3WOE A;  4CJ2 C;  3SXH A;  4K2L A;  1KDA A;  4RCO A;  2F0I A;  3Q6S A;  4AYB B;  1ZYR C;  4F88 A;  2AQ1 B;  5ELB A;  5KRU A;  3BYT B;  3VA7 A;  4DK0 A;  2KQ3 A;  4K6L A;  5DM6 3;  1OXT A;  4G57 A;  1TWC B;  1K83 B;  3VA5 A;  5C4X B;  5DNF A;  2A6H D;  3K5N A;  3PIO 3;  2FFK B;  4O1N A;  2LMC B;  1VDZ A;  2MUY A;  4IUV A;  3OMG A;  3QWN A;  3HRZ C;  3GTM B;  2OEO A;  3A7A B;  4JBW A;  3IL8 A;  2K5Q A;  3L7Z C;  1WTX A;  3DEP A;  4DXG A;  4C3H B;  5I2X A;  4FF3 A;  1ET9 A;  2F0L A;  2KA7 A;  1GUT A;  2DNC A;  3MXP A;  3C2P A;  4EQO A;  1EY8 A;  2HDL A;  3D6C A;  4OL7 A;  1DM0 B;  3T51 B;  4QB4 A;  2PW7 A;  4ZYS A;  3NK9 A;  1T5X D;  1CM9 A;  4DGZ A;  3BG3 A;  5LHY 1;  2F0J A;  2F0H A;  2E2H B;  1HA5 A;  3D8G A;  3PUZ A;  1SE2 A;  3WOF A;  5C4Z A;  2JEB I;  2JA5 B;  1QIL A;  1EQV A;  5C3E B;  1I4P A;  1QOH A;  1GUS A;  1GHK A;  1PFB A;  2L4N A;  5HUR A;  3C1F A;  1JOK A;  1EWH A;  1SYF A;  3GQB A;  1EU4 A;  1O7Y A;  4UDU C;  5KYL A;  2DNE A;  2J4X A;  2O5I C;  4X3S A;  4RAU C;  1Q8I A;  2BCO A;  2EYM A;  1G91 A;  1WD1 A;  2PZW A;  1I6H B;  1D6E C;  3RZO B;  4B9X A;  1OXV A;  2ID0 A;  1G2T A;  2CW0 C;  3VYT A;  3D4R A;  4F7X A;  2D5D A;  1BR9 A;  4A3D B;  4C1N K;  2RDF A;  3OOC A;  4XYQ A;  3S9W A;  2LKV A;  1B9M A;  3V2T A;  1IYU A;  1SBB B;  2L11 A;  2MPM A;  1LAB A;  3D6W A;  1SDF A;  2WB1 B;  1YNN C;  4EGV A;  2I46 A;  1HRJ A;  5CMD A;  2VUM B;  1U4P A;  1ENF A;  3OMC A;  4NMZ A;  4RGT A;  1B4O A;  3TP8 A;  1ET6 A;  5I4D A;  1UAP A;  3LX0 A;  3HG9 A;  5IGC A;  5CC4 A;  2QIL A;  2BE5 D;  4R8I A;  5A35 A;  4K2K A;  2O4X A;  1KAB A;  4HCE A;  5LL6 S;  3ERO A;  3IFT A;  1NR2 A;  1O80 A;  1SNQ A;  2JA6 B;  2AQ2 B;  3QG1 A;  4RWS C;  5IT9 L;  1B1Z A;  4FF4 A;  2B2V A;  4FXK C;  3I72 A;  2K28 A;  2IPK D;  5C5L A;  2HUG A;  3TP7 A;  2EDG A;  2XN9 C;  5KNB A;  3TP6 A;  3BVM A;  1NCV A;  2A69 D;  2KVM A;  2RDH A;  1STH A;  1CZW A;  1I4X A;  2A73 B;  5D65 A;  2EYJ A;  2IT1 A;  1I3Q B;  1EYC A;  3TSS A;  3PUW A;  3ONA B;  1DD2 A;  4DAP A;  1STN A;  1MGS A;  5CV4 A;  4IZ8 A;  3SVM A;  3MFG A;  5C5M A;  2K32 A;  4WOR A;  2KOL A;  3OHX C;  3HOX B;  4K14 A;  2DY7 A;  1RJT A;  4FXD A;  4G7O C;  5IOC A;  1G2S A;  1TWH B;  1C8C A;  3JAM L;  1I6V C;  3T13 A;  3RMH A;  4NDX A;  3FPP A;  4LMQ D;  3TBI B;  2EZV A;  5ELD A;  4KY5 A;  1II3 A;  2BDN A;  4KHZ A;  1A3V A;  2K03 A;  2SOB A;  2PQE A;  4L6T B;  3BDO A;  4HCS A;  2VB3 X;  2IX0 A;  1JWM D;  3VYU A;  2PZU A;  1HUN A;  1DZ1 A;  4Y7N B;  3PO2 B;  3M85 A;  1Y1V B;  2XWJ B;  1PZI D;  4R8N A;  5ELE A;  2OF1 A;  3BVG A;  4BY7 B;  5I9O A;  1EIH A;  2R6G A;  2EYF A;  3EFX D;  1LV9 A;  4KD3 A;  3VR5 A;  4IFD I;  1I50 B;  1B9N A;  1JWS D;  2PO4 A;  5EQ0 A;  3U9O A;  4IUT A;  2F0U A;  5FLX L;  5DEH A;  1NAP A;  2I07 B;  3IFD A;  3KLS X;  3HS0 C;  3H91 A;  1Y8P B;  2F0S A;  4RGO S;  1GOZ A;  5IIF A;  4NW2 A;  3GTP B;  3CQZ B;  3IKJ A;  3AMU A;  1BOS A;  1CQV A;  4QUF A;  1E0B A;  3RLF A;  3DUZ A;  4KD4 A;  5EBD A;  4C56 C;  3GTG B;  3QOL A;  3A56 A;  2IX1 A;  2E74 C;  1B44 D;  3FVQ A;  3N6R A;  2RQX A;  3MC0 B;  4DK1 A;  3LWU A;  5C3W A;  1PRT C;  3S2H B;  3M7G A;  3Q0A A;  2Z8L A;  4X3U A;  1JB3 A;  5HGT A;  4K5X A;  2XNA C;  1QG7 A;  4FVM A;  3RD4 A;  2EYP A;  1ICW A;  1ESF A;  2OT2 A;  4JK1 C;  1H9S A;  2CQA A;  1KDB A;  5E3F A;  3K6O A;  1NSN S;  3AU7 A;  1OXS C;  1FYC A;  2X6L A;  1HCZ A;  1STE A;  2L55 A;  3N52 A;  5IGG A;  1JR0 D;  1WTO A;  1LTA D;  1SMY C;  3OW7 A;  1F9P A;  2L12 A;  4FP5 D;  4KKU A;  1V1P B;  2RKS A;  1CFM A;  3NE5 B;  3LWE A;  2PZT A;  2Z1C A;  3K5L A;  3DWP A;  2E2D C;  1FD7 D;  2XVS A;  4FF2 A;  5CBE E;  1B50 A;  2QCP X;  2TSS A;  3H0G B;  2NVQ B;  1F2Z A;  2G9H D;  3V96 A;  4CJ0 B;  5C4J B;  5KIX A;  3DWA A;  2ZT9 C;  1YNJ C;  2FMM A;  4IN3 A;  2F4I A;  4ME5 A;  4C2M B;  1TWG B;  5I6Y A;  4IUU A;  3HGB A;  1JOO A;  2F0P A;  2R93 B;  5C3X A;  1M4V A;  5KGU A;  2K04 A;  1FR3 A;  3J80 L;  1Q90 A;  2NTS A;  1SAP A;  4HAE A;  3HEJ A;  4EQN A;  1SSO A;  4ULL A;  5K36 G;  1LTR D;  4HSV A;  1CQF A;  2CHB D;  2B2W C;  1AZQ A;  2B8F A;  1JCK B;  3C3L A;  4RFB A;  5CV6 A;  4FXG C;  4FO2 A;  1HQR D;  1GJX A;  1PRT B;  4CJ1 B;  4B9W A;  2X6G A;  4CKE A;  2EYH A;  5IGE A;  2PW5 A;  4K5W A;  4XIG S;  3TZU A;  1CHQ D;  2Q8I B;  4PNY A;  5G3L D;  2QEJ C;  3NWS A;  2FJ2 A;  3MZ5 A;  5K36 H;  3FKI B;  2A6E D;  1IW7 D;  5EGT A;  1QCB D;  2WIN B;  3CKI B;  4ZQ3 A;  1SFO B;  2QDB A;  2K5D A;  2NBF A;  1ZEQ X;  3PUY A;  1SYE A;  1D5M C;  4ZK9 B;  1A15 A;  3OPO A;  4QUC A;  4A3M B;  4XQQ A;  1BO0 A;  2J7Z A;  2B2T A;  1VCI A;  2YU9 B;  1PTO C;  2A68 D;  3NHH A;  1RTO A;  4RKL A;  2WII B;  2XIW A;  5F2D A;  5KND A;  3K5M A;  1VMC A;  4J6H A;  4HN7 A;  5FOB B;  4KI0 A;  5D14 A;  2EXZ A;  5BN3 A;  2TMP A;  1KDC A;  5KNC A;  1K8O A;  2O2L D;  1DOM A;  3KBG A;  1WTW A;  5I9P A;  1PTO H;  3GTQ B;  4IUR A;  3A7L A;  3E6Z X;  4IFD G;  3ITP A;  2K05 A;  1EFI D;  2K01 A;  1FNW A;  2SDF A;  1LO5 D;  4PMC A;  1LTI D;  5FO7 B;  3OWF A;  5IGB A;  2KEE A;  2WV6 D;  3J7A F;  1ILP A;  4DNT B;  2N88 A;  1BF4 A;  2WAC A;  1VF5 C;  2NZ1 D;  2RBM A;  1LT4 D;  1VF7 A;  3HOW B;  5JVH 3;  5IT9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...