4S3SA

Crystal structure of staphylococcal nuclease variant delta+phs i92k/v23a at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTAKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Buried ionizable residues
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4s3sA00
2EYLA 5J22A 3SXHA 2PYKA 5IIFA 2F0SA 1SYDA 4RKLA 4K14A 4KJOA 4NP5A 2PW7A 3SK4A 5IGDA 1SYCA 5IODA 3TP7A 2F0PA 5CV7A 1A3TA 2F0VA 5CV8A 3OWFA 1EY7A 3MZ5A 4IZ8A 5E3FA 5I9PA 5KYLA 1KDCA 3NK9A 4R8NA 4ODGA 5DAUA 1II3A 2F0HA 3TP5A 1AEXA 1IHZA 1SNPA 1TR5A 3E5SA 1U9RA 1STNA 4LAAA 1EY9A 2EXZA 5KEEA 2EYPA 3QOLA 4KY7A 4NMZA 4K5VA 5C3XA 4MIUA 5K5PA 5J1ZA 5C5LA 2SNSA 1KDAA 3R3OA 4KY5A 4I65A 4OL7A 5DEHA 2EY1A 4KD4A 5C6AA 4WORA 1EY5A 1SNOA 5E1FA 3BDCA 5C3WA 5IGCA 3C1FA 4G57A 1KDBA 3NP8A 1EY8A 3MVVA 3P75A 4KHVA 4KV6A 1SNCA 2F0MA 4NDXA 2KQ3A 3V2TA 4HMIA 5JOBA 4KTAA 4DGZA 4F7XA 2EY2A 3D4DA 1ENCA 1STHA 4PMBA 4DF7A 4DU9A 1F2ZA 5M9OA 3MHBA 5J39A 2F0DA 4H7BA 5CC4A 2F0KA 4QF4A 4EQNA 3MXPA 2F0JA 5CV4A 4WRDA 5IGBA 2F0IA 2EY6A 4K5WA 1F2MA 5CV6A 1JOQA 2EY5A 5CV5A 5F2DA 3S9WA 4K2KA 1F2YA 4K6DA 1EY6A 4HMJA 3C1EA 4K8JA 1EZ6A 4B9WA 3D6CA 5CGKA 1STYA 1JOOA 4KY6A 2F3WA 2OXPA 2RBMA 1RKNA 4HTHA 3T13A 4EQOA 3NUCA 5C4ZA 1TT2A 2M00A 3BDLA 3QOJA 5I9OA 5IGGA 1EY4A 3OMCA 1SNQA 3P1HA 4K5XA 3SR1A 1STAA 2NUCA 4K8IA 2F0EA 2PZUA 2F0OA 3OMGA 5EKKA 5EGTA 2EYFA 2F0FA 4N9PA 1EYDA 1EQVA 2WACA 2F0TA 2EYMA 4QMGA 3D8GA 2KHSA 1SYGA 3VA5A 1ENAA 4PMCA 1EYAA 3HZXA 1JOKA 4NKLA 1A2TA 5C5MA 3SK8A 2EYOA 4S3SA 3EJIA 2F0GA 3MEHA 4EVOA 4IALA 1SNDA 4QB4A 4ZUJA 2RDFA 5IGFA 3QB3A 4EQPA 5HGTA 4YIJA 1EYCA 1EY0A 3T16A 3EROA 2F0WA 2HQEA 3PMFA 4N9TA 1SYEA 1A3VA 5NUCA 3ITPA 3SK5A 4B9XA 3ERQA 2PW5A 1TQOA 4PNYA 3D4WA 3HEJA 3NXWA 5I6WA 2EYHA 1SYFA 5IGEA 4TRDA 5JAVA 5I6YA 2F0UA 1EZ8A 4IUNA 5C4HA 1STBA 3NQTA 1A2UA 2PZTA 2F0LA 2OEOA 5KYIA 4KD3A 2F0QA 3DHQA 2F3VA 2OF1A 3TMEA 4J6HA 5HURA 1KAAA 4ZUIA 5KIXA 5ISRA 2RKSA 2SOBA 2LKVA 4J1MA 5CV9A 2QDBA 3TP6A 4ME5A 4E6IA 3SK6A 1SYBA 3TP8A 2F0NA 1A3UA 1SNMA 4F8MA 4K2LA 5IOCA 2EYJA 1STGA 5EKLA 3SHLA 5KGUA 1KABA 5KRUA 5CR3A 4ZQ3A 1NSNS 3DMUA 3EVQA 3LX0A 3NHHA 2SNMA 1JORA 2O4XA 4KJNA 3RUZA 3H6MA 4RKBA 4DFAA 2ENBA 2PZWA 3OSOA 3U9OA 4ID6A 2PQEA 1NUCA
chains in the Genus database with same CATH superfamily
2Z1CA 2NVQB 4K14A 1PMRA 5CV7A 2JA7H 1LTTD 2XN9C 2XIWA 3CHBD 4MN3A 4QCLA 4JBKA 1Y1VG 4IZ8A 5I9PA 2K32A 4H13C 4OIJA 4L5RC 1MSGA 2ZTCA 1JMCA 1UNSA 1N36L 1E22A 2IX1A 3HOZG 4LWCA 1TR5A 1J5EL 5KEEA 1YITA 1GXDC 3NWSA 3I90A 2UXBQ 5C4XB 3R3OA 3GTPH 5IT9c 3BDCA 5IT9E 2MGSA 2X6GA 3GO5A 2ZJQA 2ALYB 3IFDA 2FXQA 3FKIH 4F7XA 1ENCA 1I50H 1PYBA 1RTOA 3UDXA 2F0KA 2YTYA 1CI3M 3A5ZB 4R4IA 4X65Q 1E1TA 2NVYH 1MI2A 1JWSD 3DWAA 4JBMA 4QUFA 3K7UC 2HD3A 4HMJA 1N32Q 1LTAD 2Q8TA 3I4MG 1MKHA 1LUZA 1WTQA 4JYAL 1HA5A 3NUCA 3W1GA 3QOJA 4A3BH 1VQDA 3PF5A 2LXKA 3K6OA 2PPBC 1Q1BA 2R7DA 4K8IA 2N88A 3R8BA 2NTTA 4HJ9A 1B9MA 1R4QB 1K73C 4BBRB 4LNQA 1HNWQ 1PFMA 3W2DA 3I4MH 1A15A 4YIJA 2H1EA 3I4NB 4A3BG 1ZKOA 1VQ6A 3MXUA 4RMFA 4RAUC 2RHSB 2DY8A 2AQ2B 2CW0C 4ZYSA 1F9RA 4B3MQ 1WTPA 2EYHA 4CBVA 2EQSA 3I70A 4MNOA 2F3VA 4X3TA 2A69C 4P75A 3SEBA 1CZGA 1AW7A 4FP5D 1FL0A 3SK6A 5KGUA 2EYJA 5JEAJ 4MTKA 2PI2A 2VB2X 3LX0A 1ASZA 2SNMA 2Q2TA 5IT9L 1PTOF 4IQZA 2WFWA 1LM0A 1WTRA 3CQZH 3FDTA 1CSQA 3GDEA 1BCPD 3KUPA 2QEJC 1OO9B 4NP5A 2Z9HA 1QOHA 4LUZA 4A3GG 4C3HB 2NVYB 2JA6H 3RN2A 1PDQA 2K6AA 1SAPA 2L55A 3GV6A 3AFQA 4ODGA 5E4XA 1VQNA 1SNPA 3U4ZA 4A3JB 2PQAB 5EPKA 4LF9L 1ZYRC 3A0JA 2EYPA 5FO7B 2EXDA 4GKJQ 1DOLA 5C6AA 4UDUC 3C1FA 4G57A 3MVVA 4KV6A 3VYTA 4C3JG 5BN5A 4JI4L 1TIID 2OQ0A 4HJ8A 1F2ZA 1G91A 1STEA 2HIVA 3M4QA 3KLSA 3D31A 4IPHA 3V05A 3L3OC 4KLKA 1Z7TA 5CV6A 4ALPA 2PI2E 4DR5L 1M1KC 4YWKA 1JOQA 2KHIA 5C44B 2N3SA 1HZCA 1O7YA 1HH2P 3TN2A 4B9WA 3C1EA 2CW0D 3BG3A 3E9IA 1RODA 4JI0L 2Z8LA 2OXPA 1XX8A 1GVPA 2CQAA 4IUUA 1SMYD 3S16B 4LFBL 4OWTB 3MEFA 1PH2A 3OW2A 2K5DA 4GLVB 1JR0D 2EE1A 5IYDG 4A3MG 4H44C 4GN5A 1EQVA 2JEAI 2F0TA 2EYMA 2UUBL 1WCMG 5JVG3 3U58A 3M3YB 2LSSA 2QGQA 3L7ZC 4RCOA 4AQYQ 1EL0A 4ZLTF 3KLWA 3HOZH 4UP9A 3T4AC 2R93B 1QCBD 1D7QA 2BDNA 1P8LA 1NMGA 4CKEA 4XDXA 1QVFA 4UY8C 4Y7NB 5C4JB 4JCVE 1JC7A 4XIGS 3UE0A 5M3MB 2LKVA 2EOTA 1R9TB 1YJ9A 4R8IA 3F1ZA 1TY2A 1PA6A 3K80C 2BH2A 2VNUD 1TWHB 3J81E 3X3NA 1WD1A 4AYBG 1HUNA 1PH8A 1E2ZA 1EOTA 4ID6A 4DNRB 2PZUA 4LFCL 2XRQD 4DR4L 1U4PA 3SK4A 1VMPA 2EPBA 1HHVA 4JI6Q 1Y1WB 1IYJB 4JI4Q 4BA2I 1H9MA 2M2LA 4C1NK 4QQBX 4XTCS 1CHQD 4X66L 5FLXE 3H09A 1S5DD 5K5PA 4GLAC 4DAPA 2JA5B 3H91A 4WORA 1KDBA 2E2HB 1SNCA 3C46A 1JB7A 3K57A 1GUOA 4PMBA 3MA2B 4RH6A 2R7ZH 3MHBA 3BDOA 1KLUD 2F0DA 4B3SQ 5CC4A 3AYHB 1SSOA 4QF4A 5C44H 1M90C 4Y7NH 2EY5A 1NR2A 4K6DA 1DCZA 1LTSD 4J15A 4RCNA 1G6PA 2N55A 1EU3A 2HIXA 4ILWA 5ELDA 2RF4A 4DA2A 1HR0L 4A3KH 4FF1A 3S1RB 5IWAL 1S40A 1H9KA 5FJ8G 1HNXL 1Y8OB 3S1MB 2I5HA 1AH9A 3W1BA 1ENAA 3WOEA 1DOMA 1I4GA 2F03A 2UU9Q 3GTJH 5E7NA 1FJGL 2KCNA 4OEMB 2MO1A 3BU2A 4HJ7A 1XMOL 2NTSA 2HUGA 1SYEA 3MWYW 4A3MB 1UE6A 1G6ZA 1I4HA 3HS0C 3K5LA 3NEMA 2ZT9C 3U50C 1KC8C 4PZ8A 1VQEA 2HCIA 2OF1A 4HN7A 2BE5C 4DV0L 1K9MC 1VS0A 2K04A 4ZUIA 3ZYYX 2F4IA 1LTID 3N52A 1MJEA 4LFBQ 4LFAQ 4DPGA 5D65A 2ZXOA 3M4YA 3VR2A 2JA5H 1NBWA 4DUYL 3SHLA 2C5CA 2D62A 4RGTA 3S1QH 5FLMG 3RUZA 2AUKA 1SRUA 1RF2D 4TKOB 3DEOA 3U9OA 2PW7A 2DY7A 4JI7L 1V1PA 2A1AA 1K3RA 4X64Q 1LT6D 4KJOA 1WYDA 3GTGH 2F0PA 1CHPD 2LXJA 1LTGD 3RLNA 4JI0Q 3E3XA 2NN6G 2R7FA 1EEFD 2F4VQ 4WFN3 3NWTA 4KKTA 2R6GA 3PUWA 2UUAQ 4LW1A 1B3AA 4IPCA 1Q8KA 1XMQQ 1BUVT 4BXXG 1EY5A 1SMYC 2HDLA 1XNRL 1LO5D 1NR4A 4KHVA 3TREA 3HFZB 1CTMA 2NZOA 4DU9A 3UE1A 3HOYH 1D1KA 4MTNA 4A93H 4BBRG 4C2MH 1DOKA 4X65L 1E2VA 3ER0A 2F0JA 2LY7A 3CC4A 2C35B 1JJCB 1F2MA 3AB9A 1KQSA 3PO3B 3NE5B 1K28A 3S9WA 2A6HC 1ICWA 5IP7H 1Q46A 4UHVA 4NW2A 2RBMA 4B3TL 2RSNA 3TS0A 3I72A 3NTHA 2KEEA 4L5TA 1DGSA 4JI8L 4DR2Q 2JJQA 2HHHL 2EJMA 1G8ZD 1VQCA 2ZM6L 4CDDC 3NTIA 3BVMA 1JOKA 4A3FG 3O13A 4HJAA 4QIWE 3DWQA 1E3PA 3GTOH 2O5IC 4ABNA 1SE4A 2DN8A 4PZ7A 4XYQA 1CQVA 3Q23A 4GKKQ 1EYGA 3PUZA 4BY7H 1PFNA 2JA6G 3IAYA 3WDNA 2O2LD 3BZKA 4B9XA 3F2CA 1PH4A 3OHXC 3NENA 2FMCA 2X69A 4TRDA 2ZXRA 3I7FA 1WD0A 2RHQB 4JI1Q 3CQZB 1Y1VB 4IN3A 1PTOB 1Z47A 4RGNA 3JAML 1QILA 3KDFA 1S5FD 1EIYB 1PZJD 3M85A 1KNAA 1WCMB 3GTPB 1HNXQ 1NSNS 2F4VL 1VMCA 1GOZA 2B2UC 4ZAIA 1ENFA 1IBKQ 4A3JH 2G9HD 2QILA 5JPMC 1BR9A 2DJGC 4ME3A 3S1NB 4FXKC 4LF4Q 1TXYA 3MXNB 2F52A 3KLRA 1U0LA 2CKZB 2KCTA 1FGBD 3AQQA 5GAGC 4R8NA 5DAUA 3KBGA 1XXGA 5GADC 2B2WA 4C3IG 2E5LL 3KYHC 2IPKD 1FGUA 2CH4W 2C9OA 4ZRZA 2FFKB 5J1ZA 1U4RA 1D5ZC 4BY7B 1L1OA 5ELEA 1EY8A 4EQ5A 1YNJC 4B3TQ 1G2SA 4C2MB 2OCEA 5FLMH 5HY6A 1QUQB 2CWAA 2A68D 2RDHA 2QCPX 2A68C 1RL2A 5CBAE 3QJYA 1F77A 1V1OA 3Q24A 4M1UB 4YCWA 3CCUA 1H9SA 2E75C 4IUVA 4X64L 4C3HG 1F2YA 1I3QB 4X62L 3HKZG 5C0XI 2F3WA 1KXLA 1BNZA 4GKKL 2JA8G 4MHEA 4HIDA 2GVAA 3GTMB 3DUZA 3PO2G 2JYOA 2F0OA 3P7JA 3G48A 5EGTA 2D9UA 4Z9CB 2EJFC 2QKIC 5EAYA 2L9HA 3HOUH 4FXDA 2KHSA 4A3JG 4JV5L 3RZOH 2F0GA 2B2UA 3S14B 1SNDA 4JI3Q 3JAME 4EQPA 5M5WB 1XPUA 2G5DA 3J7A5 1RD9D 1S5BD 3I4MB 2Z6KC 4A75A 4TQUS 2IJ0A 3UDGA 5FO9B 5NUCA 1E2WA 3A7LA 2CQOA 1NNXA 4O1NA 1VQ9A 4NXNQ 4BS9A 4JOIA 4PNYA 2L5TA 2KA7A 4K6LA 3TZUA 2Z0SA 1KNEA 1STBA 3VR6A 4DUZQ 4YCUA 3TDQA 3ICEA 3EFXD 1WCMH 1AN8A 3GQBA 3A7AB 4MZ9A 3BYYB 3NSWA 4BA1I 5IOCA 3R93A 4A3LG 1XTCD 1KABA 1OXVA 2ZM6Q 2DNCA 1QWYA 4DR7L 5BN4A 1W2BA 4LF9Q 3S1RH 2PZWA 4GKJL 4LFCQ 2JA8B 1NUCA 3S17H 4C3HH 2PYKA 2K52A 1I6VC 1KHIA 2QEXA 2XTIA 1FD7D 1Q90A 2KECA 2JN4A 3K59A 4HCSA 3CF5A 3EQLC 4UP8A 1N33L 5IY0A 5FLXc 4U68A 4AIMA 1YNNC 1NAPA 4P2CB 2MO0A 1D5XC 2VQEQ 4DR2L 1Q81C 3QOLA 1CKNB 1H9RA 5M5WH 2IX3A 3RMHA 3HKSA 3CCRA 1B7YB 1PRTD 4BY7G 1EOVA 2AKWB 1S4ZA 4RHRA 2K1BA 4APVA 3STBC 2YU9H 3HOWB 1Q3LA 3S14H 2BE5D 2L1BA 1STHA 4DF7A 3J81c 4OWXB 3EBEA 3RLOA 4A3KB 2B8FA 3OW7A 1N9WA 3D3RA 4TVAB 1VQPA 1HNZQ 4H0LC 3MFYA 3CCVA 3RD4A 1B9NA 2B2TA 3M7NA 4JV5Q 3K58A 2BDOA 4FNFA 2DNEA 2OTJA 5K36G 4DK6C 1HR0Q 2VW9A 4HTHA 1TS5A 4AYBE 2WKCA 3HOVH 1Q12A 2KVMA 2Q8RE 3AFPA 3OMCA 2XWJB 1Y69U 2MNAA 3PIPA 2VL6A 1N36Q 1VQJA 1QB5D 3PO3H 1VQ7A 3HOZB 2EYOA 3K5OA 2Y0SB 1CKOA 5IGFA 2RA4A 3QO2A 3VA7A 1XMOQ 4DR6Q 3M3YH 5DNFA 1GM5A 1K83B 1N34L 3ITPA 4CJ0B 3OPOA 1F9SA 3H94A 3D4WA 3HEJA 1WTHA 1PH7A 2EVBA 5GQOA 4QGUA 1U5KA 2QF7A 3TSSA 2F0QA 1LTRD 1HFGA 1N32L 5A2QL 4DV5L 4KI0A 1U4LA 4JI6L 4FF2A 5M3MH 3ND9A 1VQKA 2WAQG 2WB1G 2ATWA 5KNCA 3NHHA 4AYBB 2A73B 5LMUQ 4X66Q 3C2PA 3S15B 4QB4A 2R93H 2KCCA 2R7ZG 1EWCA 4HIOA 1CT1D 3HOVB 3I2ZA 3U9SA 1A3TA 3IL8A 1EY7A 5E3FA 3LGJA 5DLQE 2Q2HA 3FKIB 4BY1B 4XT1B 1ESRA 5D3DA 4OO1G 1HPCA 2E2IH 2NBFA 3TZDA 4BY1G 3OIQA 2UUCL 4KK7A 1CK1A 3T1HL 4A4IA 1HXYD 5CBEE 1LABA 3H3VH 1UE7A 5G3LD 3S2HB 4QL5A 2R61A 1K0RA 3OIPA 2Z4HA 1RJTA 3I73A 3K7AH 5EQ0A 2X6LA 1T9HA 4H7BA 1UEBA 2EIFA 1F9QA 3HG9A 2NN6H 2K50A 1GUNA 4K5WA 2A5HA 2O5JC 1TWAB 3GTLH 3TEHB 1L1OC 1S3OA 2VS1A 1YIJA 1IL8A 1EZ6A 1DZ1A 1IKMA 4EQOA 1RKNA 3CCLA 1EY4A 5IE8A 1Y8PB 1JE4A 1VQOA 2VQFQ 4UAIA 3G6EA 2ES2A 1WI5A 2K5VA 3ERSX 4DV1L 1SYGA 1EYAA 4NKLA 5C3EH 1F9PA 1S72A 1DONA 2K01A 2R93G 3UDFA 1JJ2A 2RDFA 4DV0Q 5HGTA 3PF4A 1H9JA 1Y8NB 1ZYRD 1LV9A 2CFMA 2HQEA 4FVMA 1WOCA 4NB3A 3CCJA 3W3AA 3GTQH 3RZOB 4IUTA 4LMQD 3M4OB 5KYIA 5GROA 3PO2H 5M5XB 1LT4D 4LUOA 1VF5C 3A8JE 3TP8A 3HOXH 2K5HA 1UE5A 2H5XA 4HCEA 4J8QA 3J81j 1MD2D 3IFTA 2Z6BA 5JJIA 2JA9A 3GTMH 2JP1A 2UUAL 3AEVA 3RN5A 1PLFA 1L0YB 4O0AA 4DV2L 3HOVG 4YHHQ 3TP7A 1VQ5A 1B3QA 3I4LA 5D14A 4G7OC 4H02A 5KYLA 2B2WC 3FMCA 2MJ8A 1HR0W 5ELOA 1YHAA 1KLGD 1VQLA 1S5ED 3VR3A 1TS2A 5C3EB 4HEDA 1C8CA 4K5VA 2A6EC 3C3LA 5KNDA 4GOPA 4A3IG 1HQRD 1FNWA 4UP7A 1RIPA 5E1FA 1V43A 3FPPA 3K7AB 2DGYA 1AZPA 3P75A 3S1QB 4K0KQ 4C3JH 3J80L 5JOBA 1YHBA 3ULLA 4JI8Q 2KOLA 1XPRA 1N34Q 4AH6A 5FLXL 4B3RQ 2JA7B 1Y1WG 3PGZA 4JI2Q 3MXNA 1J9OA 4P74A 4R1JA 4K8JA 4IOCA 3KF8B 2ZXPA 3D6CA 2EDGA 4KY6A 4X6AH 3BDLA 5C0XH 2JE6I 4RWSC 1DXMA 4K5XA 2XGTA 5EJWA 3T1HQ 2HDMA 1K8AC 2XVSA 1RCVD 4QMGA 4OHJA 4RGOS 3A8IE 4R4OA 1YHQA 1SXTA 4JI1L 4I7AA 5FOBB 4OX9L 3IRBA 5T1GA 3QB3A 5LL6X 1QVGA 1PRTF 1X3GA 5EKIA 4OGQC 1QUQA 1E7ZA 1A3VA 2FMMA 5JEAH 1S5CD 4A3GH 3VR4A 1GO3E 1Y14B 1H9SB 1C0AA 4DUZL 3D4RA 1IBKL 2NB0A 5C4HA 2MP1A 3CCSA 3MAQA 1PZKD 3QG1A 2FJ2A 2Q8IB 4YWMA 2P5ZX 1QE6A 3TMEA 1KAAA 1LTLA 2RKSA 2CVRA 2KHJA 5JEAG 3TP6A 5CMDA 1PHJA 3OWEB 4PZ6A 1Q7YC 3PO3G 1X3FA 4JC0A 5ELFA 3ULJA 3H0GG 2JA7G 5KRUA 3NQIA 4QUCA 1VQBA 2O4XA 1LTBD 1M8AA 3OSOA 4OO1H 2PQEA 4PMWA 5LMNW 1CZWA 4L63B 1HTLD 2QA4A 4DV7L 1V1QA 2MFIA 2B2YC 3CCQA 4JYAQ 3VDYA 1SROA 4HJ5A 1WTXA 4A3FB 1UUPA 2XWBB 4R4TA 4DV6Q 1KAWA 5TSSA 2L15A 1X65A 3V96A 4V0BA 2NVXB 3F2BA 3DEPA 1AEXA 1YNND 3VR5A 5C3EG 1U9RA 1IW7C 4LAAA 1PH1A 4A3LH 1KIXA 4POGA 4NMZA 2VQFL 4DV4L 5C5LA 2EY1A 1KL9A 1KRTA 4P71A 2RQXA 4GS3A 2NYZD 4NDXA 4YWLA 5IP9G 2R92H 3HOUG 3CMEA 1O7IA 2RDGA 2K5WA 1ASYA 2KBNA 2WAQE 3S24A 3ULPA 5IYCG 2OQKA 2IT1A 4DV3Q 2F0IA 3PIO3 3CPFA 2F1MA 4YHHL 3GV3A 3GD7A 3NBIA 3CRLC 5H1SE 3GTKH 1LYLA 3CW2C 2SDFA 1TWFH 1WTOA 1X32A 3T13A 3Q22A 1TT2A 5FK9C 5IYBH 3J7AV 4OXPA 1STAA 1JQYD 1R4PB 1X3EA 3E0EA 1Q8IA 4QIWB 2WACA 4IJHA 4NPSA 1O7LA 4A3EB 2UU9L 1PH5A 1BOSA 1ZEQX 5FKAC 1FJGQ 2EJGC 1MGSA 1JJGA 4A3GB 1CKMA 1PVOA 3EROA 3HKZB 4M8AA 1VQHA 4LF6Q 3CD6A 5K36H 2BA1A 1O7ZA 1YJWA 5JAVA 3UI2A 2L0CA 1EZ8A 3NBHB 4IUNA 2A19A 4FO2A 2OEOA 3T1YQ 1ILQA 1HZBA 2PMZB 4DV5Q 3DWPA 5JPNC 5C0XJ 4LF8L 3PV0A 1JICA 3M7GA 1EFWA 3KF6A 4JVZA 1RHPA 2J0TD 3BVZA 1PRTB 1JORA 1W6KA 2JA8H 1I6HB 4DAVA 1PFBA 2J7ZA 4DK3C 1XJVA 3F2UA 4IFDH 5FO8B 1GUGA 2IX0A 3NPPA 3WWVA 1DJRD 3ND8A 1HNWL 3JAMi 3KJOA 1FNUA 1HFNA 3U4VA 4FF3A 2B2YA 1PH9A 4LUVA 1XTDA 5E4WC 3Q8DA 3E5SA 3H0GH 2EXZA 3GTQB 4I7ZC 3LNNA 4AQYL 4KHZA 4IUQA 3CP0A 3TBIB 2JSOA 4A3DB 3FRPB 1D2BA 1EQRA 2F0MA 2JQOA 2KQ3A 3PUXA 3K81C 4KTAA 2VUMH 1OXTA 1X56A 4V190 4CJ1B 1K8MA 3MXPA 1Z9FA 1X9NA 4WJ4A 4WRDA 5IGBA 2ZJRA 3KOJA 1WJJA 5CV5A 1SMXA 1FYCA 1VQMA 1QNKA 4LF4L 3I4NG 4A3BB 1ESFA 1DD2A 5BR8Q 2UXCL 4DK1A 1XPOA 2A6ED 1YNXA 2E8GA 3F2DA 3TS2A 1JE5A 1PTOD 1LLRD 3G71A 2F0EA 4DV1Q 4R4CA 1X55A 4G4KA 1AZQA 3NTKA 4IJLA 1JB3A 1I6HH 1TWCB 1EYCA 2IW3A 5LMNQ 1PFSA 2I07B 4OONA 2KEDA 1BCPB 1I5FA 4F87A 4GOPC 4X3SA 5L37A 3QIAA 1B4OA 3D6WA 1BBWA 3HRZC 1HRJA 3TQYA 1RTNA 3S2DH 1CKNA 4DR5Q 1P16A 1LT5D 3URYA 2AMCB 1X6OA 1IBML 1ZXTA 2N8NA 2QDBA 1J8IA 4B08A 3S2HH 1FR3A 1ML0D 3HP3A 4RFBA 3J7ZC 4FDBA 3PIP3 1TS3A 1X3QA 4ZCKA 1HUMA 4FF4A 4DNTB 2UUBQ 1H95A 4DV2Q 2EYLA 3A55A 2ZJPA 2JA6B 4LF6L 4YY3Q 1VQIA 2QW7A 1TWAH 3GTLB 3K5NA 3EIVA 1G291 4HSPA 4N8X1 1SBBB 4A3CH 1EWIA 1YZ6A 4NXNL 2V4DA 3TP5A 1HZ9A 3CAMA 3DXJC 3S17B 1QG7A 1TWCH 2E2IB 4KD4A 1U4MA 1L0WA 3NP8A 4JI5L 1A62A 3D4DA 1UE1A 3BS1A 1VQ8A 2K4KA 5IYCH 4A3KG 2EZVA 3MXGA 2NWGA 4CDCC 4JW0A 1GJXA 4BBSH 3CCEA 1KD1C 2AQ1B 1R9TH 4A3DG 1OXXK 1TKWB 4OIKA 5DM73 1I94Q 1A63A 4BY1H 4DR4Q 3W5OA 2IY5B 4A3FH 1B44D 3SR1A 4CHTB 4R4QA 4A3IB 1PV4A 1BBXC 3STBD 1K8GA 4IFDJ 4JI3L 3VYSA 2M9VA 3HZXA 4ZKBB 4JI7Q 3GTKB 1TWHH 2A69D 5M3FB 1HZAA 3D0FA 1BBUA 3CC7A 2E76C 3PMFA 5EBDA 1J5EQ 2K75A 3PSIA 3ERQA 1RDPD 2PCFB 2GVBA 1OXSC 4KKUA 1Y1WH 2I46A 2F0UA 1HNZL 3PQIA 2OTLA 1A2UA 2PZTA 5HURA 2YU9B 3HOWH 4YY3L 4J1MA 1A8VA 2VXWA 3MTSA 4TSSA 3HOXG 2G9DA 3UDIA 2NVTB 1WFQA 1NJIC 5IYDH 4IURA 3BZCA 4L6TB 4UPAA 3CU7A 1VQFA 1SE3A 3H6MA 2TMPA 2YTVA 1VCIA 3BVGA 3HOWG 4GN3B 4OO1I 4CGYB 5LMNL 4CKCA 1SYDA 5IGDA 4DR3Q 3S1NH 4LF5Q 1IYUA 5CV8A 1BCPF 3PUYA 4CDEC 4CDFC 1EIGA 1O78A 1II3A 1QZGA 1I4PA 3SDZA 1EY9A 1I50B 2HQLA 2Q2IA 5C3XA 3R2TA 3KJPA 1QNUA 2E2HH 2J4XA 4I65A 1IXRA 1SNOA 1GD7A 4IUPA 4RA8A 2A8VA 5IGCA 3S1MH 1HJPA 2D0PA 3I3CA 4LFAL 1UWVA 1TWFB 2B63G 3K0XA 3P20A 4GNXC 2JXMB 4FYDA 1G51A 3J7YW 1CA6A 1K0SA 3JAMc 2EY6A 3OOCA 3FVQA 1BKBA 4OX9Q 1EY6A 4RGMA 1ILPA 5I2XA 5EPLA 4RHSA 3KF6B 3KFUA 4G7HC 1SNQA 1GHKA 2WP8J 2YTXA 5EKKA 4GZYC 1JWMD 2F0FA 2Z4IA 1SFOH 3D8GA 1WVLA 4L8JA 4PMCA 1A2TA 3L2PA 2PNRC 1MBYA 4S3SA 3CRKC 4EVOA 1XMQL 2LMCB 2K03A 3G7LA 4JI5Q 2MQHA 2WIIB 2K28A 2F0WA 4N9TA 4KN7C 4NXML 3M9BA 1A0IA 1Q82C 2VUMB 5LHY1 1BQQT 3NXWA 5IYBG 4EGVA 1ET9A 3I56A 5C0XG 2NVXH 1IBLL 1JCKB 1SE2A 1X54A 3QWNA 3ZJYC 2F3IA 1ONLA 2LS01 4PQXA 5CV9A 1B70B 1TVXA 4ME5A 1YVCA 2OWOA 3B6YA 1SNMA 4DR1Q 4BBSG 3I91A 4KMUC 1N8RC 3SVMA 1EWHA 4RKBA 3I4OA 4DV4Q 2B63B 1EQTA 3HOUB 3RLFA 4IPGA 2DJFC 5EBCA 4GNXB 1ICFB 2ZTEA 1SE8A 4CJ2C 1SYCA 3H3VC 4RG1A 3MZ5A 1KDCA 1SFOB 5JJKA 1M4VA 4X3KA 4CKBA 1NTGA 3R2IA 2GA4B 1G2TA 1XYIA 2YV5A 4L5SA 2SNSA 1KDAA 5DEHA 2V1CC 3JC66 3M4PA 5C4JH 1IKLA 2KJXA 1B8AA 1Q1EA 2K5NA 1A6XA 3V2TA 3AU7A 1KRSA 5G3LF 3T51B 2B8GA 4A76A 2RVLA 3S16H 2K14A 4LJZC 5LL6S 1DM0B 2NVQH 5CV4A 3SE0A 2K33A 1D6EC 1Y1VH 2BCOA 2ID0A 2JK8A 5ELCA 5FJ8H 4LF5L 4DN4M 2K5QA 2BA0A 5JVH3 1XNQQ 1GUWA 4C3JB 1AFPA 1CM9A 1L0XB 3SGIA 1E0BA 5C4ZA 1LT3D 5ELNA 1JWUD 2GN5A 5M5YB 5IGGA 4DAYA 1W6JA 1K8OA 1HA6A 1D8LA 4A3EG 1EIHA 1XWEA 2SEBD 1BCPC 3HGBA 5C4XH 2VUMG 5IWAQ 2KUMA 4GOPB 2E5LQ 1AP0A 2PNHA 3RZDB 1I4XA 3HKZE 1BXTA 3LWEA 3SK8A 3VA5A 4JBWA 4U673 4P72A 1SEBD 3T1YL 4IALA 4HSVA 2AWOA 1IL2A 1N33Q 2B63H 1YBYA 1V9PA 2E2DC 1EQQA 4XQJA 4K0KL 1TU2B 2KCMA 2UXDL 2L11A 1TQOA 1NMFA 2Z6KA 5IGEA 3I55A 2CCZA 5IP7G 1W3SA 3E9HA 5KNBA 2N49A 3KF8A 1IBMQ 3TRZA 3A56A 5KIXA 2SOBA 1EIFA 1A3UA 4BBRH 1TS4A 1VF7A 4K2LA 1HTPA 1CA5A 3E0JA 4B3SL 5CR3A 3DMUA 2NZ1D 2RCFA 4DFAA 1CQFA 1PYWD 1BVSA 1EFID 3I4NH 1T5XD 2RSOA 3CKIB 2N78A 5J22A 5IIFA 2F0SA 1GHJA 2OT2A 4RKLA 1D1IA 1PTOC 5M3FG 3S15H 2PMZE 1GUSA 5D3IB 2B2VC 3VYRA 1E1OA 1PH6A 1IW7D 4KHPQ 2AWNA 2CWPA 1IHZA 2NN6I 1K83H 3J81L 1C7YA 3HOYG 1C48A 5CYUA 1OXUA 2CH4A 4KKSA 2L12A 4BBSB 5I2YA 4OL7A 3H0GB 3LWUA 5AJ3Q 1SJHD 3J80i 3GTGB 1DYQA 2IHFA 2UXBL 4DR6L 3RZDH 3DM3A 4GN4B 1IYVA 3FEWX 3CPWA 3A74A 5JJZA 4HIMA 2EY2A 2ZTDA 4OELB 5M9OA 2XRSD 4C3IB 4B3RL 2B2VA 4DR7Q 2B29A 2TSSA 3PCOB 2WAQB 1BDOA 1KTKA 4LF7Q 3NBHA 5CORA 2A74C 4K2KA 4IFDG 1TWGH 1STYA 1JOOA 2D5DA 2K7VA 2B2TC 3GTJB 3K5MA 3GP7A 4PG3A 2NUCA 1Q86C 4GLXA 2B39A 4DR1L 4A3MH 1UEAB 1PYSB 2ICEC 4DNIA 5HGQA 2I5MX 5C5MA 1K3BC 1GKHA 1VDZA 1T5EA 1SDFA 1EY0A 1V1PB 1C4QA 4IOAA 4QY7A 3T53B 3CXCA 5J3BA 2AUJD 3SK5A 5AFWA 3A54A 4X3UA 1C9OA 5I6WA 1AE3A 3Q6SA 2WB1B 4F88A 2UUCQ 2ASBA 1SYFA 2B3GA 4A3EH 2PQAA 3NQTA 5T1IA 1X3PA 1E24A 3GTOB 1XNRQ 1PZID 3S2DB 2H4OA 3FP9A 3EN2A 4DAMA 4E6IA 5C44G 4F8MA 5C4XG 1UAPA 5ELBA 5GAHC 4IFDI 1O80A 2LFNA 3J80E 3VYUA 1TWGB 2R3ZA 1MJCA 4DXFA 2NZHA 4DR3L 3CC2A 1V8QA 2L4NA 2Y0SG 4ZKCB 4OWWB 1XNQL 3K0YA 2R92B 3KLSX 1YJNA 3OTOL 3MFGA 2F0HA 3HOYB 1STNA 1QVCA 4Q0FA 4A93B 3J80c 1SR3A 4C1NI 3T56B 5GAEC 3RNUA 1WTWA 4KY5A 2A6HD 3HOXB 1PRTC 4POFA 3M4OH 4XQNA 4JBJA 1CSPA 1VQAA 2R7ZB 4DGZA 1PXUA 4Q5VA 1NCVA 5M3FH 4DK0A 3FHWA 3X3MA 4DV3L 5J39A 4P73A 2HT1A 1IZ6A 2WKDA 3BZDB 2UXDQ 1MIUA 5LMUL 2KENA 3OYYA 5F2DA 2WV6D 4A3DH 2WB1E 3L0OA 4ULLA 2PO4A 5CGKA 4HAEA 1HCZA 4X62Q 4KHPL 3DLLA 2M00A 2BOSA 5I9OA 1AE2A 4XQQA 4FXGC 1EU4A 2CHBD 1SJED 3OMGA 2EYFA 4WJWA 1HQMC 4ZK9B 3AMUA 1EYDA 5AJ3L 3CMAA 1SN8A 1Z6HA 2XSCA 3DM1A 4A3IH 1BF4A 2VY3A 3N6RA 1I3QH 3F8TA 3MEHA 1J6QA 5M5YH 1L2FA 4NXMQ 5DM63 4DXGA 1BO0A 4EX5A 4PV1C 1MHWC 1I4QA 4N8FA 1CUKA 4G7ZC 1QZHA 3IKJA 4BWGB 4LF7L 1IBLQ 3KK7A 1I4RA 2RCNA 2F0LA 4KD3A 4LF8Q 1B53A 2I5LX 2FINB 3NELA 4J6HA 1MSHA 4A3CG 1YEZA 2VB3X 3H15A 5BR8L 2D0OA 2UXCQ 2JA5G 2F0NA 2MPMA 3MC0B 1STGA 5EKLA 4Y52H 4JG2A 4HR7B 3A5UA 4QJFA 1VQ4A 1VQGA 4YCVA 2XNAC 4XXEA 2DUDA 2IHEA 2IL8A 1D5MC 5IP9H 2R92G 3SXHA 3G6JB 4JPBW 5IODA 2I0QA 3PIOA 2Q2UA 2F0VA 3OWFA 4DUYQ 3Q0AA 3NK9A 2AQ3B 2MUYA 5EPJA 1LACA 3CCMA 3ONAB 4KY7A 1EEID 3BYTB 4MIUA 2VQEL 2E2JB 4L5QA 2QDLA 1B50A 3KDFB 2NVTH 4KN4C 5C3WA 2FHTA 1CFMA 1GUTA 4HMIA 4C56C 4R9WA 2ICIA 2Y0SE 4A93G 2BH8A 4EQNA 1F2LA 3FKIG 1WTVA 4IPDA 5M5XH 4B3ML 2WINB 4HIKA 1FVIA 4GNXA 2JEBI 3H3VI 3J81i 3WOFA 3OTOQ 3EA6A 1YNJD 4O2DA 4IO9A 2MHVA 1OTCA 3G4SA 1QJOA 1B2TA 1EUJA 4C3IH 1NY4A 4BXXH 3P1HA 5A35A 1B1ZA 4N9PA 5A2QE 2HCCA 2D2CC 3KBXA 3EJIA 4DV7Q 4WJ3M 4O42A 5COYA 1L1OB 1TY0A 4ZUJA 5JJLA 3T16A 4DV6L 2VZAA 2K05A 4JOIC 3J7AF 2AHOB 1PH3A 2HHHQ 2PW5A 2IWHA 1ET6A 4XT3B 3RR5A 3PO2B 5I6YA 1YI2A 3E6ZX 4LK1C 1NE3A 3BJUA 3DHQA 3PUVA 4JK1C 2YYZA 3L9AX 4JI2L 5ISRA 1FNVA 2E74C 2E2JH 1I94L 4DAYB 1PTOH 1SYBA 5M3MG 5I4DA 1SLJA 4ZQ3A 3A8KE 3EVQA 4KJNA 5BN3A 2ENBA 3I8ZA 3FPUB 4DKAC 1JT8A 3K8AA 3QR8A 4XYOA
chains in the Genus database with same CATH topology
2Z1CA 2NVQB 4K14A 1PMRA 5CV7A 1LTTD 2XN9C 2XIWA 3CHBD 4MN3A 4QCLA 4IZ8A 5I9PA 2K32A 4H13C 4OIJA 1MSGA 1UNSA 2IX1A 1TR5A 5KEEA 1GXDC 3NWSA 3I90A 5C4XB 3R3OA 3BDCA 5IT9E 2MGSA 2X6GA 3GO5A 3IFDA 4F7XA 1ENCA 1RTOA 2F0KA 1CI3M 1MI2A 1JWSD 3DWAA 4QUFA 4HMJA 1LTAD 2Q8TA 1WTQA 1HA5A 3NUCA 3QOJA 3K6OA 2PPBC 1Q1BA 4K8IA 2N88A 3R8BA 2NTTA 1B9MA 1R4QB 4BBRB 1PFMA 3W2DA 1A15A 4YIJA 2H1EA 3I4NB 1ZKOA 3MXUA 4RAUC 2DY8A 2AQ2B 2CW0C 4ZYSA 1F9RA 1WTPA 2EYHA 4CBVA 3I70A 2F3VA 4X3TA 2A69C 3SEBA 1CZGA 1AW7A 4FP5D 3SK6A 5KGUA 2EYJA 5JEAJ 2VB2X 3LX0A 2SNMA 5IT9L 1PTOF 4IQZA 1WTRA 3FDTA 1BCPD 3KUPA 2QEJC 1OO9B 4NP5A 1QOHA 4C3HB 2NVYB 1PDQA 2K6AA 1SAPA 2L55A 3GV6A 4ODGA 5E4XA 1SNPA 4A3JB 5EPKA 1ZYRC 5FO7B 2EYPA 1DOLA 5C6AA 4UDUC 3C1FA 4G57A 3MVVA 4KV6A 3VYTA 4C3JG 5BN5A 1TIID 1F2ZA 1G91A 1STEA 3KLSA 3D31A 3V05A 3L3OC 1Z7TA 5CV6A 1JOQA 5C44B 1O7YA 3TN2A 4B9WA 3C1EA 2CW0D 3BG3A 1RODA 2Z8LA 2OXPA 1XX8A 4IUUA 2CQAA 1SMYD 3S16B 2K5DA 1JR0D 2EE1A 4H44C 1EQVA 2JEAI 2F0TA 2EYMA 5JVG3 3M3YB 4RCOA 3L7ZC 1EL0A 4ZLTF 3T4AC 2R93B 1QCBD 2BDNA 4CKEA 4XDXA 4Y7NB 5C4JB 1JC7A 4XIGS 5M3MB 2LKVA 2EOTA 1R9TB 4R8IA 1TY2A 2VNUD 1TWHB 3J81E 3X3NA 1WD1A 1HUNA 1E2ZA 1EOTA 4ID6A 4DNRB 2PZUA 2XRQD 1U4PA 3SK4A 1VMPA 2EPBA 1HHVA 1Y1WB 4BA2I 1H9MA 2M2LA 4C1NK 4XTCS 1CHQD 5FLXE 3H09A 1S5DD 5K5PA 4DAPA 2JA5B 3H91A 4WORA 1KDBA 2E2HB 1SNCA 3C46A 3K57A 1GUOA 4PMBA 3MA2B 4RH6A 3MHBA 3BDOA 1KLUD 2F0DA 5CC4A 4QF4A 1SSOA 2EY5A 1NR2A 4K6DA 1DCZA 1LTSD 4RCNA 2N55A 1EU3A 4ILWA 5ELDA 4DA2A 4FF1A 3S1RB 1H9KA 1Y8OB 3S1MB 1ENAA 3WOEA 1DOMA 1I4GA 2F03A 2KCNA 2NTSA 2HUGA 1SYEA 3MWYW 4A3MB 1G6ZA 1I4HA 3HS0C 3K5LA 2ZT9C 2HCIA 2OF1A 4HN7A 2BE5C 4ZUIA 2K04A 3ZYYX 2F4IA 1LTID 3N52A 5D65A 2ZXOA 3M4YA 3VR2A 3SHLA 2C5CA 2D62A 4RGTA 3RUZA 2AUKA 1RF2D 4TKOB 3DEOA 3U9OA 2PW7A 2DY7A 1V1PA 1LT6D 4KJOA 2F0PA 1CHPD 1LTGD 2NN6G 1EEFD 4WFN3 3NWTA 4KKTA 2R6GA 3PUWA 1B3AA 1BUVT 1EY5A 1SMYC 2HDLA 1LO5D 1NR4A 4KHVA 1CTMA 4DU9A 1D1KA 1DOKA 1E2VA 2F0JA 2LY7A 1F2MA 3AB9A 3PO3B 3NE5B 3S9WA 2A6HC 1ICWA 4NW2A 2RBMA 2RSNA 3I72A 3NTHA 2KEEA 2EJMA 1G8ZD 3NTIA 3BVMA 1JOKA 3O13A 3DWQA 2O5IC 4ABNA 1SE4A 2DN8A 4XYQA 1CQVA 3Q23A 3PUZA 1PFNA 3IAYA 3WDNA 2O2LD 4B9XA 3OHXC 2FMCA 2X69A 4TRDA 2ZXRA 1WD0A 3CQZB 1Y1VB 1PTOB 4IN3A 1Z47A 3JAML 4RGNA 1QILA 1S5FD 1PZJD 3M85A 1KNAA 1WCMB 3GTPB 1NSNS 1VMCA 1GOZA 2B2UC 4ZAIA 1ENFA 2G9HD 2QILA 5JPMC 1BR9A 3S1NB 4FXKC 3KLRA 1FGBD 4R8NA 5DAUA 3KBGA 1XXGA 2B2WA 4C3IG 2IPKD 4ZRZA 2C9OA 2FFKB 5J1ZA 1U4RA 1D5ZC 4BY7B 5ELEA 1EY8A 1YNJC 1G2SA 4C2MB 2A68D 2RDHA 2QCPX 2A68C 5CBAE 3QJYA 1F77A 1V1OA 3Q24A 4M1UB 1H9SA 2E75C 4IUVA 4C3HG 1F2YA 1I3QB 5C0XI 2F3WA 1BNZA 4MHEA 3GTMB 3DUZA 2JYOA 2F0OA 3P7JA 5EGTA 2D9UA 4Z9CB 2EJFC 2QKIC 4FXDA 2L9HA 2KHSA 2F0GA 2B2UA 3S14B 1SNDA 3JAME 4EQPA 5M5WB 1RD9D 1S5BD 3I4MB 4TQUS 2IJ0A 5FO9B 5NUCA 1E2WA 3A7LA 4O1NA 4BS9A 4PNYA 2L5TA 2KA7A 4K6LA 3TZUA 1KNEA 1STBA 3VR6A 3TDQA 3EFXD 1AN8A 3GQBA 3A7AB 3BYYB 3NSWA 4BA1I 5IOCA 3R93A 1XTCD 1KABA 1OXVA 2DNCA 1QWYA 5BN4A 2PZWA 2JA8B 1NUCA 2PYKA 1I6VC 1FD7D 1Q90A 2KECA 3K59A 4HCSA 3EQLC 4U68A 1YNNC 1NAPA 4P2CB 1D5XC 3QOLA 1H9RA 2IX3A 3RMHA 1PRTD 1S4ZA 4RHRA 2K1BA 3HOWB 1Q3LA 2BE5D 2L1BA 1STHA 4DF7A 4A3KB 2B8FA 3OW7A 3D3RA 4H0LC 3MFYA 3RD4A 1B9NA 2B2TA 3M7NA 3K58A 2BDOA 4FNFA 2DNEA 5K36G 4HTHA 1TS5A 2WKCA 1Q12A 2KVMA 2Q8RE 3OMCA 1Y69U 2XWJB 1QB5D 3HOZB 2EYOA 3K5OA 2Y0SB 5IGFA 2RA4A 3QO2A 3VA7A 5DNFA 1K83B 3ITPA 4CJ0B 3OPOA 1F9SA 3H94A 3D4WA 3HEJA 2EVBA 3TSSA 2QF7A 2F0QA 1LTRD 1HFGA 5A2QL 4KI0A 1U4LA 4FF2A 3ND9A 5KNCA 3NHHA 4AYBB 2A73B 3C2PA 3S15B 4QB4A 2KCCA 1EWCA 1CT1D 3HOVB 3U9SA 1A3TA 3IL8A 1EY7A 5E3FA 3FKIB 4BY1B 4XT1B 1ESRA 5D3DA 4OO1G 1HPCA 2NBFA 3TZDA 3OIQA 4KK7A 1CK1A 1HXYD 5CBEE 1LABA 5G3LD 3S2HB 2R61A 3OIPA 2Z4HA 1RJTA 3I73A 5EQ0A 2X6LA 4H7BA 1F9QA 3HG9A 2NN6H 1GUNA 4K5WA 2A5HA 2O5JC 1TWAB 1IL8A 1EZ6A 1DZ1A 1IKMA 4EQOA 1RKNA 1EY4A 1Y8PB 1JE4A 4UAIA 1SYGA 1EYAA 4NKLA 1DONA 1F9PA 2K01A 2RDFA 5HGTA 1H9JA 1Y8NB 1ZYRD 1LV9A 2HQEA 4FVMA 3W3AA 3RZOB 4IUTA 4LMQD 3M4OB 5KYIA 5M5XB 1LT4D 1VF5C 3A8JE 3TP8A 4HCEA 4J8QA 1MD2D 3IFTA 2JP1A 1PLFA 1L0YB 3TP7A 3I4LA 5D14A 4G7OC 5KYLA 2B2WC 3FMCA 2MJ8A 1KLGD 1S5ED 3VR3A 5C3EB 1TS2A 4HEDA 1C8CA 4K5VA 2A6EC 3C3LA 5KNDA 1HQRD 1FNWA 5E1FA 1V43A 3FPPA 3K7AB 1AZPA 3P75A 3S1QB 3J80L 5JOBA 2KOLA 5FLXL 2JA7B 3MXNA 1J9OA 4K8JA 2ZXPA 3D6CA 2EDGA 4KY6A 3BDLA 5C0XH 2JE6I 4RWSC 1DXMA 4K5XA 5EJWA 2HDMA 2XVSA 1RCVD 4QMGA 4OHJA 4RGOS 3A8IE 1SXTA 5FOBB 5T1GA 3QB3A 5LL6X 1PRTF 5EKIA 4OGQC 5JEAH 1A3VA 2FMMA 1S5CD 3VR4A 1H9SB 3D4RA 2NB0A 5C4HA 2MP1A 3MAQA 1PZKD 3QG1A 2FJ2A 2Q8IB 3TMEA 1QE6A 1KAAA 2RKSA 2CVRA 5JEAG 3TP6A 5CMDA 3OWEB 5ELFA 5KRUA 3NQIA 4QUCA 2O4XA 1LTBD 1M8AA 3OSOA 4OO1H 2PQEA 4PMWA 1CZWA 4L63B 1HTLD 2B2YC 1WTXA 4A3FB 1UUPA 2XWBB 5TSSA 3V96A 4V0BA 2NVXB 3DEPA 1AEXA 1YNND 3VR5A 1U9RA 1IW7C 4LAAA 4NMZA 5C5LA 2EY1A 2RQXA 2NYZD 4NDXA 2RDGA 2K5WA 2IT1A 2F0IA 3PIO3 2F1MA 3GV3A 3GD7A 3NBIA 3CRLC 2SDFA 1WTOA 1X32A 3T13A 3Q22A 1TT2A 5FK9C 3J7AV 1STAA 1JQYD 1R4PB 1Q8IA 4QIWB 2WACA 1O7LA 4A3EB 1BOSA 1ZEQX 5FKAC 2EJGC 1MGSA 4A3GB 3EROA 3HKZB 4M8AA 5K36H 2BA1A 1O7ZA 5JAVA 3UI2A 2L0CA 1EZ8A 4IUNA 4FO2A 2OEOA 1ILQA 2PMZB 3DWPA 5JPNC 5C0XJ 3PV0A 1JICA 3M7GA 1RHPA 2J0TD 3BVZA 1PRTB 1JORA 1W6KA 1I6HB 4DAVA 1PFBA 2J7ZA 4IFDH 3F2UA 5FO8B 1GUGA 2IX0A 3NPPA 1DJRD 3ND8A 1FNUA 1HFNA 4FF3A 2B2YA 5E4WC 3E5SA 2EXZA 3GTQB 4I7ZC 3LNNA 4KHZA 4IUQA 3TBIB 2JSOA 4A3DB 3FRPB 1D2BA 2F0MA 3PUXA 2KQ3A 4KTAA 1OXTA 4V190 4CJ1B 1K8MA 3MXPA 4WRDA 5IGBA 5CV5A 1FYCA 1DD2A 1QNKA 4A3BB 1ESFA 4DK1A 2A6ED 1PTOD 1LLRD 2F0EA 4G4KA 1AZQA 3NTKA 1JB3A 1TWCB 1EYCA 2IW3A 2I07B 2KEDA 1BCPB 4F87A 4X3SA 3QIAA 1B4OA 3D6WA 3HRZC 1HRJA 1RTNA 1LT5D 3URYA 1ZXTA 2QDBA 1J8IA 4B08A 1FR3A 1ML0D 3HP3A 4RFBA 3PIP3 1TS3A 1X3QA 1HUMA 4FF4A 4DNTB 2EYLA 3A55A 2JA6B 3GTLB 3K5NA 1G291 4HSPA 1SBBB 2V4DA 3TP5A 3DXJC 3S17B 1QG7A 2E2IB 4KD4A 1U4MA 3NP8A 3D4DA 3BS1A 2EZVA 3MXGA 2NWGA 1GJXA 2AQ1B 1OXXK 1TKWB 4OIKA 5DM73 1B44D 3SR1A 4CHTB 4A3IB 1BBXC 4IFDJ 3VYSA 2M9VA 3HZXA 4ZKBB 3GTKB 2A69D 5M3FB 2E76C 3PMFA 5EBDA 3ERQA 1RDPD 2PCFB 1OXSC 4KKUA 2I46A 2F0UA 1A2UA 2PZTA 5HURA 2YU9B 4J1MA 2VXWA 3MTSA 4TSSA 2G9DA 2NVTB 4IURA 4L6TB 3CU7A 1SE3A 3H6MA 2TMPA 1VCIA 3BVGA 4OO1I 4CGYB 4CKCA 1SYDA 5IGDA 1IYUA 5CV8A 1BCPF 3PUYA 1EIGA 1O78A 1II3A 1I4PA 3SDZA 1EY9A 1I50B 5C3XA 3R2TA 1QNUA 2J4XA 4I65A 1SNOA 4IUPA 4RA8A 5IGCA 3I3CA 1TWFB 3P20A 2JXMB 4FYDA 3J7YW 1CA6A 2EY6A 3OOCA 3FVQA 1EY6A 4RGMA 1ILPA 5I2XA 5EPLA 4RHSA 4G7HC 1SNQA 1GHKA 2WP8J 4GZYC 5EKKA 1JWMD 2F0FA 2Z4IA 3D8GA 1WVLA 4L8JA 4PMCA 1A2TA 2PNRC 1MBYA 4S3SA 3CRKC 4EVOA 2LMCB 2K03A 3G7LA 2WIIB 2K28A 2F0WA 4N9TA 4KN7C 2VUMB 5LHY1 1BQQT 3NXWA 4EGVA 1ET9A 5C0XG 1JCKB 1SE2A 3QWNA 1ONLA 2LS01 4PQXA 5CV9A 1TVXA 4ME5A 1SNMA 3I91A 4KMUC 3SVMA 1EWHA 4RKBA 2B63B 1EQTA 3HOUB 3RLFA 5EBCA 4CJ2C 1SYCA 3H3VC 3MZ5A 1KDCA 1SFOB 1M4VA 4X3KA 4CKBA 3R2IA 2GA4B 1G2TA 1XYIA 2SNSA 1KDAA 5DEHA 1IKLA 2KJXA 1Q1EA 1A6XA 3V2TA 3AU7A 5G3LF 3T51B 2B8GA 2RVLA 4LJZC 5LL6S 1DM0B 5CV4A 3SE0A 2K33A 1D6EC 2BCOA 2ID0A 5ELCA 4DN4M 2K5QA 2BA0A 5JVH3 1GUWA 4C3JB 1AFPA 1CM9A 1L0XB 1E0BA 5C4ZA 1LT3D 5M5YB 1JWUD 5IGGA 4DAYA 1W6JA 1K8OA 1HA6A 1EIHA 1XWEA 2SEBD 1BCPC 3HGBA 2KUMA 1AP0A 3RZDB 1I4XA 3VA5A 1BXTA 3LWEA 3SK8A 4JBWA 4U673 1SEBD 4IALA 4HSVA 2AWOA 2E2DC 4XQJA 1TU2B 2L11A 1TQOA 5IGEA 5KNBA 3KF8A 3A56A 5KIXA 2SOBA 1A3UA 1TS4A 1VF7A 4K2LA 1HTPA 1CA5A 3E0JA 5CR3A 3DMUA 2NZ1D 4DFAA 1CQFA 1PYWD 1EFID 1T5XD 2RSOA 3CKIB 5J22A 5IIFA 2F0SA 1GHJA 2OT2A 4RKLA 1D1IA 1PTOC 1GUSA 5D3IB 2B2VC 3VYRA 1IW7D 2AWNA 1IHZA 2NN6I 3J81L 1C48A 5CYUA 1OXUA 4KKSA 2L12A 4BBSB 5I2YA 4OL7A 3H0GB 3LWUA 1SJHD 3GTGB 1DYQA 1IYVA 3FEWX 5JJZA 2EY2A 5M9OA 2XRSD 4C3IB 2B2VA 2TSSA 2WAQB 1BDOA 1KTKA 3NBHA 5CORA 2A74C 4K2KA 4IFDG 1STYA 1JOOA 2D5DA 2K7VA 2B2TC 3GTJB 3K5MA 3GP7A 2NUCA 2B39A 1UEAB 2ICEC 5C5MA 1VDZA 1T5EA 1SDFA 1EY0A 1V1PB 1C4QA 3T53B 2AUJD 3SK5A 5AFWA 3A54A 4X3UA 5I6WA 3Q6SA 2WB1B 4F88A 1SYFA 3NQTA 5T1IA 1X3PA 3GTOB 1PZID 3S2DB 2H4OA 4E6IA 4F8MA 1UAPA 5ELBA 4IFDI 1O80A 2LFNA 3J80E 3VYUA 1TWGB 2R3ZA 4DXFA 1V8QA 2L4NA 4ZKCB 3K0YA 2R92B 3KLSX 3MFGA 2F0HA 3HOYB 1STNA 4Q0FA 4A93B 4C1NI 3T56B 1WTWA 4KY5A 2A6HD 3HOXB 1PRTC 4XQNA 2R7ZB 4DGZA 1PXUA 4Q5VA 1NCVA 4DK0A 3X3MA 5J39A 2WKDA 3BZDB 5F2DA 2WV6D 4ULLA 2PO4A 5CGKA 4HAEA 1HCZA 2M00A 2BOSA 5I9OA 4XQQA 4FXGC 1EU4A 2CHBD 1SJED 3OMGA 2EYFA 4WJWA 1HQMC 4ZK9B 3AMUA 1EYDA 1Z6HA 2XSCA 3DM1A 1BF4A 3N6RA 3MEHA 5DM63 4DXGA 1BO0A 4PV1C 1I4QA 4G7ZC 3IKJA 4BWGB 3KK7A 1I4RA 2F0LA 4KD3A 1B53A 2FINB 4J6HA 1MSHA 2VB3X 2F0NA 2MPMA 3MC0B 1STGA 5EKLA 4HR7B 2XNAC 4XXEA 2IL8A 1D5MC 3SXHA 3G6JB 5IODA 2F0VA 3OWFA 3Q0AA 3NK9A 2AQ3B 2MUYA 5EPJA 1LACA 3ONAB 4KY7A 1EEID 3BYTB 4MIUA 2E2JB 1B50A 4KN4C 5C3WA 2FHTA 1CFMA 1GUTA 4HMIA 4C56C 4R9WA 2ICIA 4EQNA 1F2LA 1WTVA 2WINB 2JEBI 3WOFA 3EA6A 1YNJD 2MHVA 1QJOA 1B2TA 3P1HA 5A35A 1B1ZA 4N9PA 5A2QE 2HCCA 2D2CC 3KBXA 3EJIA 4O42A 5COYA 1TY0A 4ZUJA 3T16A 2K05A 3J7AF 2PW5A 2IWHA 1ET6A 4XT3B 3PO2B 5I6YA 3E6ZX 4LK1C 3DHQA 3PUVA 4JK1C 2YYZA 3L9AX 5ISRA 1FNVA 2E74C 1PTOH 1SYBA 5I4DA 4ZQ3A 3A8KE 3EVQA 4KJNA 5BN3A 2ENBA 3I8ZA 3FPUB 4XYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYL A;  5J22 A;  3SXH A;  2PYK A;  5IIF A;  2F0S A;  1SYD A;  4RKL A;  4K14 A;  4KJO A;  4NP5 A;  2PW7 A;  3SK4 A;  5IGD A;  1SYC A;  5IOD A;  3TP7 A;  2F0P A;  5CV7 A;  1A3T A;  2F0V A;  5CV8 A;  3OWF A;  1EY7 A;  3MZ5 A;  4IZ8 A;  5E3F A;  5I9P A;  5KYL A;  1KDC A;  3NK9 A;  4R8N A;  4ODG A;  5DAU A;  1II3 A;  2F0H A;  3TP5 A;  1AEX A;  1IHZ A;  1SNP A;  1TR5 A;  3E5S A;  1U9R A;  1STN A;  4LAA A;  1EY9 A;  2EXZ A;  5KEE A;  2EYP A;  3QOL A;  4KY7 A;  4NMZ A;  4K5V A;  5C3X A;  4MIU A;  5K5P A;  5J1Z A;  5C5L A;  2SNS A;  1KDA A;  3R3O A;  4KY5 A;  4I65 A;  4OL7 A;  5DEH A;  2EY1 A;  4KD4 A;  5C6A A;  4WOR A;  1EY5 A;  1SNO A;  5E1F A;  3BDC A;  5C3W A;  5IGC A;  3C1F A;  4G57 A;  1KDB A;  3NP8 A;  1EY8 A;  3MVV A;  3P75 A;  4KHV A;  4KV6 A;  1SNC A;  2F0M A;  4NDX A;  2KQ3 A;  3V2T A;  4HMI A;  5JOB A;  4KTA A;  4DGZ A;  4F7X A;  2EY2 A;  3D4D A;  1ENC A;  1STH A;  4PMB A;  4DF7 A;  4DU9 A;  1F2Z A;  5M9O A;  3MHB A;  5J39 A;  2F0D A;  4H7B A;  5CC4 A;  2F0K A;  4QF4 A;  4EQN A;  3MXP A;  2F0J A;  5CV4 A;  4WRD A;  5IGB A;  2F0I A;  2EY6 A;  4K5W A;  1F2M A;  5CV6 A;  1JOQ A;  2EY5 A;  5CV5 A;  5F2D A;  3S9W A;  4K2K A;  1F2Y A;  4K6D A;  1EY6 A;  4HMJ A;  3C1E A;  4K8J A;  1EZ6 A;  4B9W A;  3D6C A;  5CGK A;  1STY A;  1JOO A;  4KY6 A;  2F3W A;  2OXP A;  2RBM A;  1RKN A;  4HTH A;  3T13 A;  4EQO A;  3NUC A;  5C4Z A;  1TT2 A;  2M00 A;  3BDL A;  3QOJ A;  5I9O A;  5IGG A;  1EY4 A;  3OMC A;  1SNQ A;  3P1H A;  4K5X A;  3SR1 A;  1STA A;  2NUC A;  4K8I A;  2F0E A;  2PZU A;  2F0O A;  3OMG A;  5EKK A;  5EGT A;  2EYF A;  2F0F A;  4N9P A;  1EYD A;  1EQV A;  2WAC A;  2F0T A;  2EYM A;  4QMG A;  3D8G A;  2KHS A;  1SYG A;  3VA5 A;  1ENA A;  4PMC A;  1EYA A;  3HZX A;  1JOK A;  4NKL A;  1A2T A;  5C5M A;  3SK8 A;  2EYO A;  4S3S A;  3EJI A;  2F0G A;  3MEH A;  4EVO A;  4IAL A;  1SND A;  4QB4 A;  4ZUJ A;  2RDF A;  5IGF A;  3QB3 A;  4EQP A;  5HGT A;  4YIJ A;  1EYC A;  1EY0 A;  3T16 A;  3ERO A;  2F0W A;  2HQE A;  3PMF A;  4N9T A;  1SYE A;  1A3V A;  5NUC A;  3ITP A;  3SK5 A;  4B9X A;  3ERQ A;  2PW5 A;  1TQO A;  4PNY A;  3D4W A;  3HEJ A;  3NXW A;  5I6W A;  2EYH A;  1SYF A;  5IGE A;  4TRD A;  5JAV A;  5I6Y A;  2F0U A;  1EZ8 A;  4IUN A;  5C4H A;  1STB A;  3NQT A;  1A2U A;  2PZT A;  2F0L A;  2OEO A;  5KYI A;  4KD3 A;  2F0Q A;  3DHQ A;  2F3V A;  2OF1 A;  3TME A;  4J6H A;  5HUR A;  1KAA A;  4ZUI A;  5KIX A;  5ISR A;  2RKS A;  2SOB A;  2LKV A;  4J1M A;  5CV9 A;  2QDB A;  3TP6 A;  4ME5 A;  4E6I A;  3SK6 A;  1SYB A;  3TP8 A;  2F0N A;  1A3U A;  1SNM A;  4F8M A;  4K2L A;  5IOC A;  2EYJ A;  1STG A;  5EKL A;  3SHL A;  5KGU A;  1KAB A;  5KRU A;  5CR3 A;  4ZQ3 A;  1NSN S;  3DMU A;  3EVQ A;  3LX0 A;  3NHH A;  2SNM A;  1JOR A;  2O4X A;  4KJN A;  3RUZ A;  3H6M A;  4RKB A;  4DFA A;  2ENB A;  2PZW A;  3OSO A;  3U9O A;  4ID6 A;  2PQE A;  1NUC A; 
#chains in the Genus database with same CATH topology
 2Z1C A;  2NVQ B;  4K14 A;  1PMR A;  5CV7 A;  2JA7 H;  1LTT D;  2XN9 C;  2XIW A;  3CHB D;  4MN3 A;  4QCL A;  4JBK A;  1Y1V G;  4IZ8 A;  5I9P A;  2K32 A;  4H13 C;  4OIJ A;  4L5R C;  1MSG A;  2ZTC A;  1JMC A;  1UNS A;  1N36 L;  1E22 A;  2IX1 A;  3HOZ G;  4LWC A;  1TR5 A;  1J5E L;  5KEE A;  1YIT A;  1GXD C;  3NWS A;  3I90 A;  2UXB Q;  5C4X B;  3R3O A;  3GTP H;  5IT9 c;  3BDC A;  5IT9 E;  2MGS A;  2X6G A;  3GO5 A;  2ZJQ A;  2ALY B;  3IFD A;  2FXQ A;  3FKI H;  4F7X A;  1ENC A;  1I50 H;  1PYB A;  1RTO A;  3UDX A;  2F0K A;  2YTY A;  1CI3 M;  3A5Z B;  4R4I A;  4X65 Q;  1E1T A;  2NVY H;  1MI2 A;  1JWS D;  3DWA A;  4JBM A;  4QUF A;  3K7U C;  2HD3 A;  4HMJ A;  1N32 Q;  1LTA D;  2Q8T A;  3I4M G;  1MKH A;  1LUZ A;  1WTQ A;  4JYA L;  1HA5 A;  3NUC A;  3W1G A;  3QOJ A;  4A3B H;  1VQD A;  3PF5 A;  2LXK A;  3K6O A;  2PPB C;  1Q1B A;  2R7D A;  4K8I A;  2N88 A;  3R8B A;  2NTT A;  4HJ9 A;  1B9M A;  1R4Q B;  1K73 C;  4BBR B;  4LNQ A;  1HNW Q;  1PFM A;  3W2D A;  3I4M H;  1A15 A;  4YIJ A;  2H1E A;  3I4N B;  4A3B G;  1ZKO A;  1VQ6 A;  3MXU A;  4RMF A;  4RAU C;  2RHS B;  2DY8 A;  2AQ2 B;  2CW0 C;  4ZYS A;  1F9R A;  4B3M Q;  1WTP A;  2EYH A;  4CBV A;  2EQS A;  3I70 A;  4MNO A;  2F3V A;  4X3T A;  2A69 C;  4P75 A;  3SEB A;  1CZG A;  1AW7 A;  4FP5 D;  1FL0 A;  3SK6 A;  5KGU A;  2EYJ A;  5JEA J;  4MTK A;  2PI2 A;  2VB2 X;  3LX0 A;  1ASZ A;  2SNM A;  2Q2T A;  5IT9 L;  1PTO F;  4IQZ A;  2WFW A;  1LM0 A;  1WTR A;  3CQZ H;  3FDT A;  1CSQ A;  3GDE A;  1BCP D;  3KUP A;  2QEJ C;  1OO9 B;  4NP5 A;  2Z9H A;  1QOH A;  4LUZ A;  4A3G G;  4C3H B;  2NVY B;  2JA6 H;  3RN2 A;  1PDQ A;  2K6A A;  1SAP A;  2L55 A;  3GV6 A;  3AFQ A;  4ODG A;  5E4X A;  1VQN A;  1SNP A;  3U4Z A;  4A3J B;  2PQA B;  5EPK A;  4LF9 L;  1ZYR C;  3A0J A;  2EYP A;  5FO7 B;  2EXD A;  4GKJ Q;  1DOL A;  5C6A A;  4UDU C;  3C1F A;  4G57 A;  3MVV A;  4KV6 A;  3VYT A;  4C3J G;  5BN5 A;  4JI4 L;  1TII D;  2OQ0 A;  4HJ8 A;  1F2Z A;  1G91 A;  1STE A;  2HIV A;  3M4Q A;  3KLS A;  3D31 A;  4IPH A;  3V05 A;  3L3O C;  4KLK A;  1Z7T A;  5CV6 A;  4ALP A;  2PI2 E;  4DR5 L;  1M1K C;  4YWK A;  1JOQ A;  2KHI A;  5C44 B;  2N3S A;  1HZC A;  1O7Y A;  1HH2 P;  3TN2 A;  4B9W A;  3C1E A;  2CW0 D;  3BG3 A;  3E9I A;  1ROD A;  4JI0 L;  2Z8L A;  2OXP A;  1XX8 A;  1GVP A;  2CQA A;  4IUU A;  1SMY D;  3S16 B;  4LFB L;  4OWT B;  3MEF A;  1PH2 A;  3OW2 A;  2K5D A;  4GLV B;  1JR0 D;  2EE1 A;  5IYD G;  4A3M G;  4H44 C;  4GN5 A;  1EQV A;  2JEA I;  2F0T A;  2EYM A;  2UUB L;  1WCM G;  5JVG 3;  3U58 A;  3M3Y B;  2LSS A;  2QGQ A;  3L7Z C;  4RCO A;  4AQY Q;  1EL0 A;  4ZLT F;  3KLW A;  3HOZ H;  4UP9 A;  3T4A C;  2R93 B;  1QCB D;  1D7Q A;  2BDN A;  1P8L A;  1NMG A;  4CKE A;  4XDX A;  1QVF A;  4UY8 C;  4Y7N B;  5C4J B;  4JCV E;  1JC7 A;  4XIG S;  3UE0 A;  5M3M B;  2LKV A;  2EOT A;  1R9T B;  1YJ9 A;  4R8I A;  3F1Z A;  1TY2 A;  1PA6 A;  3K80 C;  2BH2 A;  2VNU D;  1TWH B;  3J81 E;  3X3N A;  1WD1 A;  4AYB G;  1HUN A;  1PH8 A;  1E2Z A;  1EOT A;  4ID6 A;  4DNR B;  2PZU A;  4LFC L;  2XRQ D;  4DR4 L;  1U4P A;  3SK4 A;  1VMP A;  2EPB A;  1HHV A;  4JI6 Q;  1Y1W B;  1IYJ B;  4JI4 Q;  4BA2 I;  1H9M A;  2M2L A;  4C1N K;  4QQB X;  4XTC S;  1CHQ D;  4X66 L;  5FLX E;  3H09 A;  1S5D D;  5K5P A;  4GLA C;  4DAP A;  2JA5 B;  3H91 A;  4WOR A;  1KDB A;  2E2H B;  1SNC A;  3C46 A;  1JB7 A;  3K57 A;  1GUO A;  4PMB A;  3MA2 B;  4RH6 A;  2R7Z H;  3MHB A;  3BDO A;  1KLU D;  2F0D A;  4B3S Q;  5CC4 A;  3AYH B;  1SSO A;  4QF4 A;  5C44 H;  1M90 C;  4Y7N H;  2EY5 A;  1NR2 A;  4K6D A;  1DCZ A;  1LTS D;  4J15 A;  4RCN A;  1G6P A;  2N55 A;  1EU3 A;  2HIX A;  4ILW A;  5ELD A;  2RF4 A;  4DA2 A;  1HR0 L;  4A3K H;  4FF1 A;  3S1R B;  5IWA L;  1S40 A;  1H9K A;  5FJ8 G;  1HNX L;  1Y8O B;  3S1M B;  2I5H A;  1AH9 A;  3W1B A;  1ENA A;  3WOE A;  1DOM A;  1I4G A;  2F03 A;  2UU9 Q;  3GTJ H;  5E7N A;  1FJG L;  2KCN A;  4OEM B;  2MO1 A;  3BU2 A;  4HJ7 A;  1XMO L;  2NTS A;  2HUG A;  1SYE A;  3MWY W;  4A3M B;  1UE6 A;  1G6Z A;  1I4H A;  3HS0 C;  3K5L A;  3NEM A;  2ZT9 C;  3U50 C;  1KC8 C;  4PZ8 A;  1VQE A;  2HCI A;  2OF1 A;  4HN7 A;  2BE5 C;  4DV0 L;  1K9M C;  1VS0 A;  2K04 A;  4ZUI A;  3ZYY X;  2F4I A;  1LTI D;  3N52 A;  1MJE A;  4LFB Q;  4LFA Q;  4DPG A;  5D65 A;  2ZXO A;  3M4Y A;  3VR2 A;  2JA5 H;  1NBW A;  4DUY L;  3SHL A;  2C5C A;  2D62 A;  4RGT A;  3S1Q H;  5FLM G;  3RUZ A;  2AUK A;  1SRU A;  1RF2 D;  4TKO B;  3DEO A;  3U9O A;  2PW7 A;  2DY7 A;  4JI7 L;  1V1P A;  2A1A A;  1K3R A;  4X64 Q;  1LT6 D;  4KJO A;  1WYD A;  3GTG H;  2F0P A;  1CHP D;  2LXJ A;  1LTG D;  3RLN A;  4JI0 Q;  3E3X A;  2NN6 G;  2R7F A;  1EEF D;  2F4V Q;  4WFN 3;  3NWT A;  4KKT A;  2R6G A;  3PUW A;  2UUA Q;  4LW1 A;  1B3A A;  4IPC A;  1Q8K A;  1XMQ Q;  1BUV T;  4BXX G;  1EY5 A;  1SMY C;  2HDL A;  1XNR L;  1LO5 D;  1NR4 A;  4KHV A;  3TRE A;  3HFZ B;  1CTM A;  2NZO A;  4DU9 A;  3UE1 A;  3HOY H;  1D1K A;  4MTN A;  4A93 H;  4BBR G;  4C2M H;  1DOK A;  4X65 L;  1E2V A;  3ER0 A;  2F0J A;  2LY7 A;  3CC4 A;  2C35 B;  1JJC B;  1F2M A;  3AB9 A;  1KQS A;  3PO3 B;  3NE5 B;  1K28 A;  3S9W A;  2A6H C;  1ICW A;  5IP7 H;  1Q46 A;  4UHV A;  4NW2 A;  2RBM A;  4B3T L;  2RSN A;  3TS0 A;  3I72 A;  3NTH A;  2KEE A;  4L5T A;  1DGS A;  4JI8 L;  4DR2 Q;  2JJQ A;  2HHH L;  2EJM A;  1G8Z D;  1VQC A;  2ZM6 L;  4CDD C;  3NTI A;  3BVM A;  1JOK A;  4A3F G;  3O13 A;  4HJA A;  4QIW E;  3DWQ A;  1E3P A;  3GTO H;  2O5I C;  4ABN A;  1SE4 A;  2DN8 A;  4PZ7 A;  4XYQ A;  1CQV A;  3Q23 A;  4GKK Q;  1EYG A;  3PUZ A;  4BY7 H;  1PFN A;  2JA6 G;  3IAY A;  3WDN A;  2O2L D;  3BZK A;  4B9X A;  3F2C A;  1PH4 A;  3OHX C;  3NEN A;  2FMC A;  2X69 A;  4TRD A;  2ZXR A;  3I7F A;  1WD0 A;  2RHQ B;  4JI1 Q;  3CQZ B;  1Y1V B;  4IN3 A;  1PTO B;  1Z47 A;  4RGN A;  3JAM L;  1QIL A;  3KDF A;  1S5F D;  1EIY B;  1PZJ D;  3M85 A;  1KNA A;  1WCM B;  3GTP B;  1HNX Q;  1NSN S;  2F4V L;  1VMC A;  1GOZ A;  2B2U C;  4ZAI A;  1ENF A;  1IBK Q;  4A3J H;  2G9H D;  2QIL A;  5JPM C;  1BR9 A;  2DJG C;  4ME3 A;  3S1N B;  4FXK C;  4LF4 Q;  1TXY A;  3MXN B;  2F52 A;  3KLR A;  1U0L A;  2CKZ B;  2KCT A;  1FGB D;  3AQQ A;  5GAG C;  4R8N A;  5DAU A;  3KBG A;  1XXG A;  5GAD C;  2B2W A;  4C3I G;  2E5L L;  3KYH C;  2IPK D;  1FGU A;  2CH4 W;  2C9O A;  4ZRZ A;  2FFK B;  5J1Z A;  1U4R A;  1D5Z C;  4BY7 B;  1L1O A;  5ELE A;  1EY8 A;  4EQ5 A;  1YNJ C;  4B3T Q;  1G2S A;  4C2M B;  2OCE A;  5FLM H;  5HY6 A;  1QUQ B;  2CWA A;  2A68 D;  2RDH A;  2QCP X;  2A68 C;  1RL2 A;  5CBA E;  3QJY A;  1F77 A;  1V1O A;  3Q24 A;  4M1U B;  4YCW A;  3CCU A;  1H9S A;  2E75 C;  4IUV A;  4X64 L;  4C3H G;  1F2Y A;  1I3Q B;  4X62 L;  3HKZ G;  5C0X I;  2F3W A;  1KXL A;  1BNZ A;  4GKK L;  2JA8 G;  4MHE A;  4HID A;  2GVA A;  3GTM B;  3DUZ A;  3PO2 G;  2JYO A;  2F0O A;  3P7J A;  3G48 A;  5EGT A;  2D9U A;  4Z9C B;  2EJF C;  2QKI C;  5EAY A;  2L9H A;  3HOU H;  4FXD A;  2KHS A;  4A3J G;  4JV5 L;  3RZO H;  2F0G A;  2B2U A;  3S14 B;  1SND A;  4JI3 Q;  3JAM E;  4EQP A;  5M5W B;  1XPU A;  2G5D A;  3J7A 5;  1RD9 D;  1S5B D;  3I4M B;  2Z6K C;  4A75 A;  4TQU S;  2IJ0 A;  3UDG A;  5FO9 B;  5NUC A;  1E2W A;  3A7L A;  2CQO A;  1NNX A;  4O1N A;  1VQ9 A;  4NXN Q;  4BS9 A;  4JOI A;  4PNY A;  2L5T A;  2KA7 A;  4K6L A;  3TZU A;  2Z0S A;  1KNE A;  1STB A;  3VR6 A;  4DUZ Q;  4YCU A;  3TDQ A;  3ICE A;  3EFX D;  1WCM H;  1AN8 A;  3GQB A;  3A7A B;  4MZ9 A;  3BYY B;  3NSW A;  4BA1 I;  5IOC A;  3R93 A;  4A3L G;  1XTC D;  1KAB A;  1OXV A;  2ZM6 Q;  2DNC A;  1QWY A;  4DR7 L;  5BN4 A;  1W2B A;  4LF9 Q;  3S1R H;  2PZW A;  4GKJ L;  4LFC Q;  2JA8 B;  1NUC A;  3S17 H;  4C3H H;  2PYK A;  2K52 A;  1I6V C;  1KHI A;  2QEX A;  2XTI A;  1FD7 D;  1Q90 A;  2KEC A;  2JN4 A;  3K59 A;  4HCS A;  3CF5 A;  3EQL C;  4UP8 A;  1N33 L;  5IY0 A;  5FLX c;  4U68 A;  4AIM A;  1YNN C;  1NAP A;  4P2C B;  2MO0 A;  1D5X C;  2VQE Q;  4DR2 L;  1Q81 C;  3QOL A;  1CKN B;  1H9R A;  5M5W H;  2IX3 A;  3RMH A;  3HKS A;  3CCR A;  1B7Y B;  1PRT D;  4BY7 G;  1EOV A;  2AKW B;  1S4Z A;  4RHR A;  2K1B A;  4APV A;  3STB C;  2YU9 H;  3HOW B;  1Q3L A;  3S14 H;  2BE5 D;  2L1B A;  1STH A;  4DF7 A;  3J81 c;  4OWX B;  3EBE A;  3RLO A;  4A3K B;  2B8F A;  3OW7 A;  1N9W A;  3D3R A;  4TVA B;  1VQP A;  1HNZ Q;  4H0L C;  3MFY A;  3CCV A;  3RD4 A;  1B9N A;  2B2T A;  3M7N A;  4JV5 Q;  3K58 A;  2BDO A;  4FNF A;  2DNE A;  2OTJ A;  5K36 G;  4DK6 C;  1HR0 Q;  2VW9 A;  4HTH A;  1TS5 A;  4AYB E;  2WKC A;  3HOV H;  1Q12 A;  2KVM A;  2Q8R E;  3AFP A;  3OMC A;  2XWJ B;  1Y69 U;  2MNA A;  3PIP A;  2VL6 A;  1N36 Q;  1VQJ A;  1QB5 D;  3PO3 H;  1VQ7 A;  3HOZ B;  2EYO A;  3K5O A;  2Y0S B;  1CKO A;  5IGF A;  2RA4 A;  3QO2 A;  3VA7 A;  1XMO Q;  4DR6 Q;  3M3Y H;  5DNF A;  1GM5 A;  1K83 B;  1N34 L;  3ITP A;  4CJ0 B;  3OPO A;  1F9S A;  3H94 A;  3D4W A;  3HEJ A;  1WTH A;  1PH7 A;  2EVB A;  5GQO A;  4QGU A;  1U5K A;  2QF7 A;  3TSS A;  2F0Q A;  1LTR D;  1HFG A;  1N32 L;  5A2Q L;  4DV5 L;  4KI0 A;  1U4L A;  4JI6 L;  4FF2 A;  5M3M H;  3ND9 A;  1VQK A;  2WAQ G;  2WB1 G;  2ATW A;  5KNC A;  3NHH A;  4AYB B;  2A73 B;  5LMU Q;  4X66 Q;  3C2P A;  3S15 B;  4QB4 A;  2R93 H;  2KCC A;  2R7Z G;  1EWC A;  4HIO A;  1CT1 D;  3HOV B;  3I2Z A;  3U9S A;  1A3T A;  3IL8 A;  1EY7 A;  5E3F A;  3LGJ A;  5DLQ E;  2Q2H A;  3FKI B;  4BY1 B;  4XT1 B;  1ESR A;  5D3D A;  4OO1 G;  1HPC A;  2E2I H;  2NBF A;  3TZD A;  4BY1 G;  3OIQ A;  2UUC L;  4KK7 A;  1CK1 A;  3T1H L;  4A4I A;  1HXY D;  5CBE E;  1LAB A;  3H3V H;  1UE7 A;  5G3L D;  3S2H B;  4QL5 A;  2R61 A;  1K0R A;  3OIP A;  2Z4H A;  1RJT A;  3I73 A;  3K7A H;  5EQ0 A;  2X6L A;  1T9H A;  4H7B A;  1UEB A;  2EIF A;  1F9Q A;  3HG9 A;  2NN6 H;  2K50 A;  1GUN A;  4K5W A;  2A5H A;  2O5J C;  1TWA B;  3GTL H;  3TEH B;  1L1O C;  1S3O A;  2VS1 A;  1YIJ A;  1IL8 A;  1EZ6 A;  1DZ1 A;  1IKM A;  4EQO A;  1RKN A;  3CCL A;  1EY4 A;  5IE8 A;  1Y8P B;  1JE4 A;  1VQO A;  2VQF Q;  4UAI A;  3G6E A;  2ES2 A;  1WI5 A;  2K5V A;  3ERS X;  4DV1 L;  1SYG A;  1EYA A;  4NKL A;  5C3E H;  1F9P A;  1S72 A;  1DON A;  2K01 A;  2R93 G;  3UDF A;  1JJ2 A;  2RDF A;  4DV0 Q;  5HGT A;  3PF4 A;  1H9J A;  1Y8N B;  1ZYR D;  1LV9 A;  2CFM A;  2HQE A;  4FVM A;  1WOC A;  4NB3 A;  3CCJ A;  3W3A A;  3GTQ H;  3RZO B;  4IUT A;  4LMQ D;  3M4O B;  5KYI A;  5GRO A;  3PO2 H;  5M5X B;  1LT4 D;  4LUO A;  1VF5 C;  3A8J E;  3TP8 A;  3HOX H;  2K5H A;  1UE5 A;  2H5X A;  4HCE A;  4J8Q A;  3J81 j;  1MD2 D;  3IFT A;  2Z6B A;  5JJI A;  2JA9 A;  3GTM H;  2JP1 A;  2UUA L;  3AEV A;  3RN5 A;  1PLF A;  1L0Y B;  4O0A A;  4DV2 L;  3HOV G;  4YHH Q;  3TP7 A;  1VQ5 A;  1B3Q A;  3I4L A;  5D14 A;  4G7O C;  4H02 A;  5KYL A;  2B2W C;  3FMC A;  2MJ8 A;  1HR0 W;  5ELO A;  1YHA A;  1KLG D;  1VQL A;  1S5E D;  3VR3 A;  1TS2 A;  5C3E B;  4HED A;  1C8C A;  4K5V A;  2A6E C;  3C3L A;  5KND A;  4GOP A;  4A3I G;  1HQR D;  1FNW A;  4UP7 A;  1RIP A;  5E1F A;  1V43 A;  3FPP A;  3K7A B;  2DGY A;  1AZP A;  3P75 A;  3S1Q B;  4K0K Q;  4C3J H;  3J80 L;  5JOB A;  1YHB A;  3ULL A;  4JI8 Q;  2KOL A;  1XPR A;  1N34 Q;  4AH6 A;  5FLX L;  4B3R Q;  2JA7 B;  1Y1W G;  3PGZ A;  4JI2 Q;  3MXN A;  1J9O A;  4P74 A;  4R1J A;  4K8J A;  4IOC A;  3KF8 B;  2ZXP A;  3D6C A;  2EDG A;  4KY6 A;  4X6A H;  3BDL A;  5C0X H;  2JE6 I;  4RWS C;  1DXM A;  4K5X A;  2XGT A;  5EJW A;  3T1H Q;  2HDM A;  1K8A C;  2XVS A;  1RCV D;  4QMG A;  4OHJ A;  4RGO S;  3A8I E;  4R4O A;  1YHQ A;  1SXT A;  4JI1 L;  4I7A A;  5FOB B;  4OX9 L;  3IRB A;  5T1G A;  3QB3 A;  5LL6 X;  1QVG A;  1PRT F;  1X3G A;  5EKI A;  4OGQ C;  1QUQ A;  1E7Z A;  1A3V A;  2FMM A;  5JEA H;  1S5C D;  4A3G H;  3VR4 A;  1GO3 E;  1Y14 B;  1H9S B;  1C0A A;  4DUZ L;  3D4R A;  1IBK L;  2NB0 A;  5C4H A;  2MP1 A;  3CCS A;  3MAQ A;  1PZK D;  3QG1 A;  2FJ2 A;  2Q8I B;  4YWM A;  2P5Z X;  1QE6 A;  3TME A;  1KAA A;  1LTL A;  2RKS A;  2CVR A;  2KHJ A;  5JEA G;  3TP6 A;  5CMD A;  1PHJ A;  3OWE B;  4PZ6 A;  1Q7Y C;  3PO3 G;  1X3F A;  4JC0 A;  5ELF A;  3ULJ A;  3H0G G;  2JA7 G;  5KRU A;  3NQI A;  4QUC A;  1VQB A;  2O4X A;  1LTB D;  1M8A A;  3OSO A;  4OO1 H;  2PQE A;  4PMW A;  5LMN W;  1CZW A;  4L63 B;  1HTL D;  2QA4 A;  4DV7 L;  1V1Q A;  2MFI A;  2B2Y C;  3CCQ A;  4JYA Q;  3VDY A;  1SRO A;  4HJ5 A;  1WTX A;  4A3F B;  1UUP A;  2XWB B;  4R4T A;  4DV6 Q;  1KAW A;  5TSS A;  2L15 A;  1X65 A;  3V96 A;  4V0B A;  2NVX B;  3F2B A;  3DEP A;  1AEX A;  1YNN D;  3VR5 A;  5C3E G;  1U9R A;  1IW7 C;  4LAA A;  1PH1 A;  4A3L H;  1KIX A;  4POG A;  4NMZ A;  2VQF L;  4DV4 L;  5C5L A;  2EY1 A;  1KL9 A;  1KRT A;  4P71 A;  2RQX A;  4GS3 A;  2NYZ D;  4NDX A;  4YWL A;  5IP9 G;  2R92 H;  3HOU G;  3CME A;  1O7I A;  2RDG A;  2K5W A;  1ASY A;  2KBN A;  2WAQ E;  3S24 A;  3ULP A;  5IYC G;  2OQK A;  2IT1 A;  4DV3 Q;  2F0I A;  3PIO 3;  3CPF A;  2F1M A;  4YHH L;  3GV3 A;  3GD7 A;  3NBI A;  3CRL C;  5H1S E;  3GTK H;  1LYL A;  3CW2 C;  2SDF A;  1TWF H;  1WTO A;  1X32 A;  3T13 A;  3Q22 A;  1TT2 A;  5FK9 C;  5IYB H;  3J7A V;  4OXP A;  1STA A;  1JQY D;  1R4P B;  1X3E A;  3E0E A;  1Q8I A;  4QIW B;  2WAC A;  4IJH A;  4NPS A;  1O7L A;  4A3E B;  2UU9 L;  1PH5 A;  1BOS A;  1ZEQ X;  5FKA C;  1FJG Q;  2EJG C;  1MGS A;  1JJG A;  4A3G B;  1CKM A;  1PVO A;  3ERO A;  3HKZ B;  4M8A A;  1VQH A;  4LF6 Q;  3CD6 A;  5K36 H;  2BA1 A;  1O7Z A;  1YJW A;  5JAV A;  3UI2 A;  2L0C A;  1EZ8 A;  3NBH B;  4IUN A;  2A19 A;  4FO2 A;  2OEO A;  3T1Y Q;  1ILQ A;  1HZB A;  2PMZ B;  4DV5 Q;  3DWP A;  5JPN C;  5C0X J;  4LF8 L;  3PV0 A;  1JIC A;  3M7G A;  1EFW A;  3KF6 A;  4JVZ A;  1RHP A;  2J0T D;  3BVZ A;  1PRT B;  1JOR A;  1W6K A;  2JA8 H;  1I6H B;  4DAV A;  1PFB A;  2J7Z A;  4DK3 C;  1XJV A;  3F2U A;  4IFD H;  5FO8 B;  1GUG A;  2IX0 A;  3NPP A;  3WWV A;  1DJR D;  3ND8 A;  1HNW L;  3JAM i;  3KJO A;  1FNU A;  1HFN A;  3U4V A;  4FF3 A;  2B2Y A;  1PH9 A;  4LUV A;  1XTD A;  5E4W C;  3Q8D A;  3E5S A;  3H0G H;  2EXZ A;  3GTQ B;  4I7Z C;  3LNN A;  4AQY L;  4KHZ A;  4IUQ A;  3CP0 A;  3TBI B;  2JSO A;  4A3D B;  3FRP B;  1D2B A;  1EQR A;  2F0M A;  2JQO A;  2KQ3 A;  3PUX A;  3K81 C;  4KTA A;  2VUM H;  1OXT A;  1X56 A;  4V19 0;  4CJ1 B;  1K8M A;  3MXP A;  1Z9F A;  1X9N A;  4WJ4 A;  4WRD A;  5IGB A;  2ZJR A;  3KOJ A;  1WJJ A;  5CV5 A;  1SMX A;  1FYC A;  1VQM A;  1QNK A;  4LF4 L;  3I4N G;  4A3B B;  1ESF A;  1DD2 A;  5BR8 Q;  2UXC L;  4DK1 A;  1XPO A;  2A6E D;  1YNX A;  2E8G A;  3F2D A;  3TS2 A;  1JE5 A;  1PTO D;  1LLR D;  3G71 A;  2F0E A;  4DV1 Q;  4R4C A;  1X55 A;  4G4K A;  1AZQ A;  3NTK A;  4IJL A;  1JB3 A;  1I6H H;  1TWC B;  1EYC A;  2IW3 A;  5LMN Q;  1PFS A;  2I07 B;  4OON A;  2KED A;  1BCP B;  1I5F A;  4F87 A;  4GOP C;  4X3S A;  5L37 A;  3QIA A;  1B4O A;  3D6W A;  1BBW A;  3HRZ C;  1HRJ A;  3TQY A;  1RTN A;  3S2D H;  1CKN A;  4DR5 Q;  1P16 A;  1LT5 D;  3URY A;  2AMC B;  1X6O A;  1IBM L;  1ZXT A;  2N8N A;  2QDB A;  1J8I A;  4B08 A;  3S2H H;  1FR3 A;  1ML0 D;  3HP3 A;  4RFB A;  3J7Z C;  4FDB A;  3PIP 3;  1TS3 A;  1X3Q A;  4ZCK A;  1HUM A;  4FF4 A;  4DNT B;  2UUB Q;  1H95 A;  4DV2 Q;  2EYL A;  3A55 A;  2ZJP A;  2JA6 B;  4LF6 L;  4YY3 Q;  1VQI A;  2QW7 A;  1TWA H;  3GTL B;  3K5N A;  3EIV A;  1G29 1;  4HSP A;  4N8X 1;  1SBB B;  4A3C H;  1EWI A;  1YZ6 A;  4NXN L;  2V4D A;  3TP5 A;  1HZ9 A;  3CAM A;  3DXJ C;  3S17 B;  1QG7 A;  1TWC H;  2E2I B;  4KD4 A;  1U4M A;  1L0W A;  3NP8 A;  4JI5 L;  1A62 A;  3D4D A;  1UE1 A;  3BS1 A;  1VQ8 A;  2K4K A;  5IYC H;  4A3K G;  2EZV A;  3MXG A;  2NWG A;  4CDC C;  4JW0 A;  1GJX A;  4BBS H;  3CCE A;  1KD1 C;  2AQ1 B;  1R9T H;  4A3D G;  1OXX K;  1TKW B;  4OIK A;  5DM7 3;  1I94 Q;  1A63 A;  4BY1 H;  4DR4 Q;  3W5O A;  2IY5 B;  4A3F H;  1B44 D;  3SR1 A;  4CHT B;  4R4Q A;  4A3I B;  1PV4 A;  1BBX C;  3STB D;  1K8G A;  4IFD J;  4JI3 L;  3VYS A;  2M9V A;  3HZX A;  4ZKB B;  4JI7 Q;  3GTK B;  1TWH H;  2A69 D;  5M3F B;  1HZA A;  3D0F A;  1BBU A;  3CC7 A;  2E76 C;  3PMF A;  5EBD A;  1J5E Q;  2K75 A;  3PSI A;  3ERQ A;  1RDP D;  2PCF B;  2GVB A;  1OXS C;  4KKU A;  1Y1W H;  2I46 A;  2F0U A;  1HNZ L;  3PQI A;  2OTL A;  1A2U A;  2PZT A;  5HUR A;  2YU9 B;  3HOW H;  4YY3 L;  4J1M A;  1A8V A;  2VXW A;  3MTS A;  4TSS A;  3HOX G;  2G9D A;  3UDI A;  2NVT B;  1WFQ A;  1NJI C;  5IYD H;  4IUR A;  3BZC A;  4L6T B;  4UPA A;  3CU7 A;  1VQF A;  1SE3 A;  3H6M A;  2TMP A;  2YTV A;  1VCI A;  3BVG A;  3HOW G;  4GN3 B;  4OO1 I;  4CGY B;  5LMN L;  4CKC A;  1SYD A;  5IGD A;  4DR3 Q;  3S1N H;  4LF5 Q;  1IYU A;  5CV8 A;  1BCP F;  3PUY A;  4CDE C;  4CDF C;  1EIG A;  1O78 A;  1II3 A;  1QZG A;  1I4P A;  3SDZ A;  1EY9 A;  1I50 B;  2HQL A;  2Q2I A;  5C3X A;  3R2T A;  3KJP A;  1QNU A;  2E2H H;  2J4X A;  4I65 A;  1IXR A;  1SNO A;  1GD7 A;  4IUP A;  4RA8 A;  2A8V A;  5IGC A;  3S1M H;  1HJP A;  2D0P A;  3I3C A;  4LFA L;  1UWV A;  1TWF B;  2B63 G;  3K0X A;  3P20 A;  4GNX C;  2JXM B;  4FYD A;  1G51 A;  3J7Y W;  1CA6 A;  1K0S A;  3JAM c;  2EY6 A;  3OOC A;  3FVQ A;  1BKB A;  4OX9 Q;  1EY6 A;  4RGM A;  1ILP A;  5I2X A;  5EPL A;  4RHS A;  3KF6 B;  3KFU A;  4G7H C;  1SNQ A;  1GHK A;  2WP8 J;  2YTX A;  5EKK A;  4GZY C;  1JWM D;  2F0F A;  2Z4I A;  1SFO H;  3D8G A;  1WVL A;  4L8J A;  4PMC A;  1A2T A;  3L2P A;  2PNR C;  1MBY A;  4S3S A;  3CRK C;  4EVO A;  1XMQ L;  2LMC B;  2K03 A;  3G7L A;  4JI5 Q;  2MQH A;  2WII B;  2K28 A;  2F0W A;  4N9T A;  4KN7 C;  4NXM L;  3M9B A;  1A0I A;  1Q82 C;  2VUM B;  5LHY 1;  1BQQ T;  3NXW A;  5IYB G;  4EGV A;  1ET9 A;  3I56 A;  5C0X G;  2NVX H;  1IBL L;  1JCK B;  1SE2 A;  1X54 A;  3QWN A;  3ZJY C;  2F3I A;  1ONL A;  2LS0 1;  4PQX A;  5CV9 A;  1B70 B;  1TVX A;  4ME5 A;  1YVC A;  2OWO A;  3B6Y A;  1SNM A;  4DR1 Q;  4BBS G;  3I91 A;  4KMU C;  1N8R C;  3SVM A;  1EWH A;  4RKB A;  3I4O A;  4DV4 Q;  2B63 B;  1EQT A;  3HOU B;  3RLF A;  4IPG A;  2DJF C;  5EBC A;  4GNX B;  1ICF B;  2ZTE A;  1SE8 A;  4CJ2 C;  1SYC A;  3H3V C;  4RG1 A;  3MZ5 A;  1KDC A;  1SFO B;  5JJK A;  1M4V A;  4X3K A;  4CKB A;  1NTG A;  3R2I A;  2GA4 B;  1G2T A;  1XYI A;  2YV5 A;  4L5S A;  2SNS A;  1KDA A;  5DEH A;  2V1C C;  3JC6 6;  3M4P A;  5C4J H;  1IKL A;  2KJX A;  1B8A A;  1Q1E A;  2K5N A;  1A6X A;  3V2T A;  3AU7 A;  1KRS A;  5G3L F;  3T51 B;  2B8G A;  4A76 A;  2RVL A;  3S16 H;  2K14 A;  4LJZ C;  5LL6 S;  1DM0 B;  2NVQ H;  5CV4 A;  3SE0 A;  2K33 A;  1D6E C;  1Y1V H;  2BCO A;  2ID0 A;  2JK8 A;  5ELC A;  5FJ8 H;  4LF5 L;  4DN4 M;  2K5Q A;  2BA0 A;  5JVH 3;  1XNQ Q;  1GUW A;  4C3J B;  1AFP A;  1CM9 A;  1L0X B;  3SGI A;  1E0B A;  5C4Z A;  1LT3 D;  5ELN A;  1JWU D;  2GN5 A;  5M5Y B;  5IGG A;  4DAY A;  1W6J A;  1K8O A;  1HA6 A;  1D8L A;  4A3E G;  1EIH A;  1XWE A;  2SEB D;  1BCP C;  3HGB A;  5C4X H;  2VUM G;  5IWA Q;  2KUM A;  4GOP B;  2E5L Q;  1AP0 A;  2PNH A;  3RZD B;  1I4X A;  3HKZ E;  1BXT A;  3LWE A;  3SK8 A;  3VA5 A;  4JBW A;  4U67 3;  4P72 A;  1SEB D;  3T1Y L;  4IAL A;  4HSV A;  2AWO A;  1IL2 A;  1N33 Q;  2B63 H;  1YBY A;  1V9P A;  2E2D C;  1EQQ A;  4XQJ A;  4K0K L;  1TU2 B;  2KCM A;  2UXD L;  2L11 A;  1TQO A;  1NMF A;  2Z6K A;  5IGE A;  3I55 A;  2CCZ A;  5IP7 G;  1W3S A;  3E9H A;  5KNB A;  2N49 A;  3KF8 A;  1IBM Q;  3TRZ A;  3A56 A;  5KIX A;  2SOB A;  1EIF A;  1A3U A;  4BBR H;  1TS4 A;  1VF7 A;  4K2L A;  1HTP A;  1CA5 A;  3E0J A;  4B3S L;  5CR3 A;  3DMU A;  2NZ1 D;  2RCF A;  4DFA A;  1CQF A;  1PYW D;  1BVS A;  1EFI D;  3I4N H;  1T5X D;  2RSO A;  3CKI B;  2N78 A;  5J22 A;  5IIF A;  2F0S A;  1GHJ A;  2OT2 A;  4RKL A;  1D1I A;  1PTO C;  5M3F G;  3S15 H;  2PMZ E;  1GUS A;  5D3I B;  2B2V C;  3VYR A;  1E1O A;  1PH6 A;  1IW7 D;  4KHP Q;  2AWN A;  2CWP A;  1IHZ A;  2NN6 I;  1K83 H;  3J81 L;  1C7Y A;  3HOY G;  1C48 A;  5CYU A;  1OXU A;  2CH4 A;  4KKS A;  2L12 A;  4BBS B;  5I2Y A;  4OL7 A;  3H0G B;  3LWU A;  5AJ3 Q;  1SJH D;  3J80 i;  3GTG B;  1DYQ A;  2IHF A;  2UXB L;  4DR6 L;  3RZD H;  3DM3 A;  4GN4 B;  1IYV A;  3FEW X;  3CPW A;  3A74 A;  5JJZ A;  4HIM A;  2EY2 A;  2ZTD A;  4OEL B;  5M9O A;  2XRS D;  4C3I B;  4B3R L;  2B2V A;  4DR7 Q;  2B29 A;  2TSS A;  3PCO B;  2WAQ B;  1BDO A;  1KTK A;  4LF7 Q;  3NBH A;  5COR A;  2A74 C;  4K2K A;  4IFD G;  1TWG H;  1STY A;  1JOO A;  2D5D A;  2K7V A;  2B2T C;  3GTJ B;  3K5M A;  3GP7 A;  4PG3 A;  2NUC A;  1Q86 C;  4GLX A;  2B39 A;  4DR1 L;  4A3M H;  1UEA B;  1PYS B;  2ICE C;  4DNI A;  5HGQ A;  2I5M X;  5C5M A;  1K3B C;  1GKH A;  1VDZ A;  1T5E A;  1SDF A;  1EY0 A;  1V1P B;  1C4Q A;  4IOA A;  4QY7 A;  3T53 B;  3CXC A;  5J3B A;  2AUJ D;  3SK5 A;  5AFW A;  3A54 A;  4X3U A;  1C9O A;  5I6W A;  1AE3 A;  3Q6S A;  2WB1 B;  4F88 A;  2UUC Q;  2ASB A;  1SYF A;  2B3G A;  4A3E H;  2PQA A;  3NQT A;  5T1I A;  1X3P A;  1E24 A;  3GTO B;  1XNR Q;  1PZI D;  3S2D B;  2H4O A;  3FP9 A;  3EN2 A;  4DAM A;  4E6I A;  5C44 G;  4F8M A;  5C4X G;  1UAP A;  5ELB A;  5GAH C;  4IFD I;  1O80 A;  2LFN A;  3J80 E;  3VYU A;  1TWG B;  2R3Z A;  1MJC A;  4DXF A;  2NZH A;  4DR3 L;  3CC2 A;  1V8Q A;  2L4N A;  2Y0S G;  4ZKC B;  4OWW B;  1XNQ L;  3K0Y A;  2R92 B;  3KLS X;  1YJN A;  3OTO L;  3MFG A;  2F0H A;  3HOY B;  1STN A;  1QVC A;  4Q0F A;  4A93 B;  3J80 c;  1SR3 A;  4C1N I;  3T56 B;  5GAE C;  3RNU A;  1WTW A;  4KY5 A;  2A6H D;  3HOX B;  1PRT C;  4POF A;  3M4O H;  4XQN A;  4JBJ A;  1CSP A;  1VQA A;  2R7Z B;  4DGZ A;  1PXU A;  4Q5V A;  1NCV A;  5M3F H;  4DK0 A;  3FHW A;  3X3M A;  4DV3 L;  5J39 A;  4P73 A;  2HT1 A;  1IZ6 A;  2WKD A;  3BZD B;  2UXD Q;  1MIU A;  5LMU L;  2KEN A;  3OYY A;  5F2D A;  2WV6 D;  4A3D H;  2WB1 E;  3L0O A;  4ULL A;  2PO4 A;  5CGK A;  4HAE A;  1HCZ A;  4X62 Q;  4KHP L;  3DLL A;  2M00 A;  2BOS A;  5I9O A;  1AE2 A;  4XQQ A;  4FXG C;  1EU4 A;  2CHB D;  1SJE D;  3OMG A;  2EYF A;  4WJW A;  1HQM C;  4ZK9 B;  3AMU A;  1EYD A;  5AJ3 L;  3CMA A;  1SN8 A;  1Z6H A;  2XSC A;  3DM1 A;  4A3I H;  1BF4 A;  2VY3 A;  3N6R A;  1I3Q H;  3F8T A;  3MEH A;  1J6Q A;  5M5Y H;  1L2F A;  4NXM Q;  5DM6 3;  4DXG A;  1BO0 A;  4EX5 A;  4PV1 C;  1MHW C;  1I4Q A;  4N8F A;  1CUK A;  4G7Z C;  1QZH A;  3IKJ A;  4BWG B;  4LF7 L;  1IBL Q;  3KK7 A;  1I4R A;  2RCN A;  2F0L A;  4KD3 A;  4LF8 Q;  1B53 A;  2I5L X;  2FIN B;  3NEL A;  4J6H A;  1MSH A;  4A3C G;  1YEZ A;  2VB3 X;  3H15 A;  5BR8 L;  2D0O A;  2UXC Q;  2JA5 G;  2F0N A;  2MPM A;  3MC0 B;  1STG A;  5EKL A;  4Y52 H;  4JG2 A;  4HR7 B;  3A5U A;  4QJF A;  1VQ4 A;  1VQG A;  4YCV A;  2XNA C;  4XXE A;  2DUD A;  2IHE A;  2IL8 A;  1D5M C;  5IP9 H;  2R92 G;  3SXH A;  3G6J B;  4JPB W;  5IOD A;  2I0Q A;  3PIO A;  2Q2U A;  2F0V A;  3OWF A;  4DUY Q;  3Q0A A;  3NK9 A;  2AQ3 B;  2MUY A;  5EPJ A;  1LAC A;  3CCM A;  3ONA B;  4KY7 A;  1EEI D;  3BYT B;  4MIU A;  2VQE L;  2E2J B;  4L5Q A;  2QDL A;  1B50 A;  3KDF B;  2NVT H;  4KN4 C;  5C3W A;  2FHT A;  1CFM A;  1GUT A;  4HMI A;  4C56 C;  4R9W A;  2ICI A;  2Y0S E;  4A93 G;  2BH8 A;  4EQN A;  1F2L A;  3FKI G;  1WTV A;  4IPD A;  5M5X H;  4B3M L;  2WIN B;  4HIK A;  1FVI A;  4GNX A;  2JEB I;  3H3V I;  3J81 i;  3WOF A;  3OTO Q;  3EA6 A;  1YNJ D;  4O2D A;  4IO9 A;  2MHV A;  1OTC A;  3G4S A;  1QJO A;  1B2T A;  1EUJ A;  4C3I H;  1NY4 A;  4BXX H;  3P1H A;  5A35 A;  1B1Z A;  4N9P A;  5A2Q E;  2HCC A;  2D2C C;  3KBX A;  3EJI A;  4DV7 Q;  4WJ3 M;  4O42 A;  5COY A;  1L1O B;  1TY0 A;  4ZUJ A;  5JJL A;  3T16 A;  4DV6 L;  2VZA A;  2K05 A;  4JOI C;  3J7A F;  2AHO B;  1PH3 A;  2HHH Q;  2PW5 A;  2IWH A;  1ET6 A;  4XT3 B;  3RR5 A;  3PO2 B;  5I6Y A;  1YI2 A;  3E6Z X;  4LK1 C;  1NE3 A;  3BJU A;  3DHQ A;  3PUV A;  4JK1 C;  2YYZ A;  3L9A X;  4JI2 L;  5ISR A;  1FNV A;  2E74 C;  2E2J H;  1I94 L;  4DAY B;  1PTO H;  1SYB A;  5M3M G;  5I4D A;  1SLJ A;  4ZQ3 A;  3A8K E;  3EVQ A;  4KJN A;  5BN3 A;  2ENB A;  3I8Z A;  3FPU B;  4DKA C;  1JT8 A;  3K8A A;  3QR8 A;  4XYO A; 
#chains in the Genus database with same CATH homology
 2Z1C A;  2NVQ B;  4K14 A;  1PMR A;  5CV7 A;  1LTT D;  2XN9 C;  2XIW A;  3CHB D;  4MN3 A;  4QCL A;  4IZ8 A;  5I9P A;  2K32 A;  4H13 C;  4OIJ A;  1MSG A;  1UNS A;  2IX1 A;  1TR5 A;  5KEE A;  1GXD C;  3NWS A;  3I90 A;  5C4X B;  3R3O A;  3BDC A;  5IT9 E;  2MGS A;  2X6G A;  3GO5 A;  3IFD A;  4F7X A;  1ENC A;  1RTO A;  2F0K A;  1CI3 M;  1MI2 A;  1JWS D;  3DWA A;  4QUF A;  4HMJ A;  1LTA D;  2Q8T A;  1WTQ A;  1HA5 A;  3NUC A;  3QOJ A;  3K6O A;  2PPB C;  1Q1B A;  4K8I A;  2N88 A;  3R8B A;  2NTT A;  1B9M A;  1R4Q B;  4BBR B;  1PFM A;  3W2D A;  1A15 A;  4YIJ A;  2H1E A;  3I4N B;  1ZKO A;  3MXU A;  4RAU C;  2DY8 A;  2AQ2 B;  2CW0 C;  4ZYS A;  1F9R A;  1WTP A;  2EYH A;  4CBV A;  3I70 A;  2F3V A;  4X3T A;  2A69 C;  3SEB A;  1CZG A;  1AW7 A;  4FP5 D;  3SK6 A;  5KGU A;  2EYJ A;  5JEA J;  2VB2 X;  3LX0 A;  2SNM A;  5IT9 L;  1PTO F;  4IQZ A;  1WTR A;  3FDT A;  1BCP D;  3KUP A;  2QEJ C;  1OO9 B;  4NP5 A;  1QOH A;  4C3H B;  2NVY B;  1PDQ A;  2K6A A;  1SAP A;  2L55 A;  3GV6 A;  4ODG A;  5E4X A;  1SNP A;  4A3J B;  5EPK A;  1ZYR C;  5FO7 B;  2EYP A;  1DOL A;  5C6A A;  4UDU C;  3C1F A;  4G57 A;  3MVV A;  4KV6 A;  3VYT A;  4C3J G;  5BN5 A;  1TII D;  1F2Z A;  1G91 A;  1STE A;  3KLS A;  3D31 A;  3V05 A;  3L3O C;  1Z7T A;  5CV6 A;  1JOQ A;  5C44 B;  1O7Y A;  3TN2 A;  4B9W A;  3C1E A;  2CW0 D;  3BG3 A;  1ROD A;  2Z8L A;  2OXP A;  1XX8 A;  4IUU A;  2CQA A;  1SMY D;  3S16 B;  2K5D A;  1JR0 D;  2EE1 A;  4H44 C;  1EQV A;  2JEA I;  2F0T A;  2EYM A;  5JVG 3;  3M3Y B;  4RCO A;  3L7Z C;  1EL0 A;  4ZLT F;  3T4A C;  2R93 B;  1QCB D;  2BDN A;  4CKE A;  4XDX A;  4Y7N B;  5C4J B;  1JC7 A;  4XIG S;  5M3M B;  2LKV A;  2EOT A;  1R9T B;  4R8I A;  1TY2 A;  2VNU D;  1TWH B;  3J81 E;  3X3N A;  1WD1 A;  1HUN A;  1E2Z A;  1EOT A;  4ID6 A;  4DNR B;  2PZU A;  2XRQ D;  1U4P A;  3SK4 A;  1VMP A;  2EPB A;  1HHV A;  1Y1W B;  4BA2 I;  1H9M A;  2M2L A;  4C1N K;  4XTC S;  1CHQ D;  5FLX E;  3H09 A;  1S5D D;  5K5P A;  4DAP A;  2JA5 B;  3H91 A;  4WOR A;  1KDB A;  2E2H B;  1SNC A;  3C46 A;  3K57 A;  1GUO A;  4PMB A;  3MA2 B;  4RH6 A;  3MHB A;  3BDO A;  1KLU D;  2F0D A;  5CC4 A;  4QF4 A;  1SSO A;  2EY5 A;  1NR2 A;  4K6D A;  1DCZ A;  1LTS D;  4RCN A;  2N55 A;  1EU3 A;  4ILW A;  5ELD A;  4DA2 A;  4FF1 A;  3S1R B;  1H9K A;  1Y8O B;  3S1M B;  1ENA A;  3WOE A;  1DOM A;  1I4G A;  2F03 A;  2KCN A;  2NTS A;  2HUG A;  1SYE A;  3MWY W;  4A3M B;  1G6Z A;  1I4H A;  3HS0 C;  3K5L A;  2ZT9 C;  2HCI A;  2OF1 A;  4HN7 A;  2BE5 C;  4ZUI A;  2K04 A;  3ZYY X;  2F4I A;  1LTI D;  3N52 A;  5D65 A;  2ZXO A;  3M4Y A;  3VR2 A;  3SHL A;  2C5C A;  2D62 A;  4RGT A;  3RUZ A;  2AUK A;  1RF2 D;  4TKO B;  3DEO A;  3U9O A;  2PW7 A;  2DY7 A;  1V1P A;  1LT6 D;  4KJO A;  2F0P A;  1CHP D;  1LTG D;  2NN6 G;  1EEF D;  4WFN 3;  3NWT A;  4KKT A;  2R6G A;  3PUW A;  1B3A A;  1BUV T;  1EY5 A;  1SMY C;  2HDL A;  1LO5 D;  1NR4 A;  4KHV A;  1CTM A;  4DU9 A;  1D1K A;  1DOK A;  1E2V A;  2F0J A;  2LY7 A;  1F2M A;  3AB9 A;  3PO3 B;  3NE5 B;  3S9W A;  2A6H C;  1ICW A;  4NW2 A;  2RBM A;  2RSN A;  3I72 A;  3NTH A;  2KEE A;  2EJM A;  1G8Z D;  3NTI A;  3BVM A;  1JOK A;  3O13 A;  3DWQ A;  2O5I C;  4ABN A;  1SE4 A;  2DN8 A;  4XYQ A;  1CQV A;  3Q23 A;  3PUZ A;  1PFN A;  3IAY A;  3WDN A;  2O2L D;  4B9X A;  3OHX C;  2FMC A;  2X69 A;  4TRD A;  2ZXR A;  1WD0 A;  3CQZ B;  1Y1V B;  1PTO B;  4IN3 A;  1Z47 A;  3JAM L;  4RGN A;  1QIL A;  1S5F D;  1PZJ D;  3M85 A;  1KNA A;  1WCM B;  3GTP B;  1NSN S;  1VMC A;  1GOZ A;  2B2U C;  4ZAI A;  1ENF A;  2G9H D;  2QIL A;  5JPM C;  1BR9 A;  3S1N B;  4FXK C;  3KLR A;  1FGB D;  4R8N A;  5DAU A;  3KBG A;  1XXG A;  2B2W A;  4C3I G;  2IPK D;  4ZRZ A;  2C9O A;  2FFK B;  5J1Z A;  1U4R A;  1D5Z C;  4BY7 B;  5ELE A;  1EY8 A;  1YNJ C;  1G2S A;  4C2M B;  2A68 D;  2RDH A;  2QCP X;  2A68 C;  5CBA E;  3QJY A;  1F77 A;  1V1O A;  3Q24 A;  4M1U B;  1H9S A;  2E75 C;  4IUV A;  4C3H G;  1F2Y A;  1I3Q B;  5C0X I;  2F3W A;  1BNZ A;  4MHE A;  3GTM B;  3DUZ A;  2JYO A;  2F0O A;  3P7J A;  5EGT A;  2D9U A;  4Z9C B;  2EJF C;  2QKI C;  4FXD A;  2L9H A;  2KHS A;  2F0G A;  2B2U A;  3S14 B;  1SND A;  3JAM E;  4EQP A;  5M5W B;  1RD9 D;  1S5B D;  3I4M B;  4TQU S;  2IJ0 A;  5FO9 B;  5NUC A;  1E2W A;  3A7L A;  4O1N A;  4BS9 A;  4PNY A;  2L5T A;  2KA7 A;  4K6L A;  3TZU A;  1KNE A;  1STB A;  3VR6 A;  3TDQ A;  3EFX D;  1AN8 A;  3GQB A;  3A7A B;  3BYY B;  3NSW A;  4BA1 I;  5IOC A;  3R93 A;  1XTC D;  1KAB A;  1OXV A;  2DNC A;  1QWY A;  5BN4 A;  2PZW A;  2JA8 B;  1NUC A;  2PYK A;  1I6V C;  1FD7 D;  1Q90 A;  2KEC A;  3K59 A;  4HCS A;  3EQL C;  4U68 A;  1YNN C;  1NAP A;  4P2C B;  1D5X C;  3QOL A;  1H9R A;  2IX3 A;  3RMH A;  1PRT D;  1S4Z A;  4RHR A;  2K1B A;  3HOW B;  1Q3L A;  2BE5 D;  2L1B A;  1STH A;  4DF7 A;  4A3K B;  2B8F A;  3OW7 A;  3D3R A;  4H0L C;  3MFY A;  3RD4 A;  1B9N A;  2B2T A;  3M7N A;  3K58 A;  2BDO A;  4FNF A;  2DNE A;  5K36 G;  4HTH A;  1TS5 A;  2WKC A;  1Q12 A;  2KVM A;  2Q8R E;  3OMC A;  1Y69 U;  2XWJ B;  1QB5 D;  3HOZ B;  2EYO A;  3K5O A;  2Y0S B;  5IGF A;  2RA4 A;  3QO2 A;  3VA7 A;  5DNF A;  1K83 B;  3ITP A;  4CJ0 B;  3OPO A;  1F9S A;  3H94 A;  3D4W A;  3HEJ A;  2EVB A;  3TSS A;  2QF7 A;  2F0Q A;  1LTR D;  1HFG A;  5A2Q L;  4KI0 A;  1U4L A;  4FF2 A;  3ND9 A;  5KNC A;  3NHH A;  4AYB B;  2A73 B;  3C2P A;  3S15 B;  4QB4 A;  2KCC A;  1EWC A;  1CT1 D;  3HOV B;  3U9S A;  1A3T A;  3IL8 A;  1EY7 A;  5E3F A;  3FKI B;  4BY1 B;  4XT1 B;  1ESR A;  5D3D A;  4OO1 G;  1HPC A;  2NBF A;  3TZD A;  3OIQ A;  4KK7 A;  1CK1 A;  1HXY D;  5CBE E;  1LAB A;  5G3L D;  3S2H B;  2R61 A;  3OIP A;  2Z4H A;  1RJT A;  3I73 A;  5EQ0 A;  2X6L A;  4H7B A;  1F9Q A;  3HG9 A;  2NN6 H;  1GUN A;  4K5W A;  2A5H A;  2O5J C;  1TWA B;  1IL8 A;  1EZ6 A;  1DZ1 A;  1IKM A;  4EQO A;  1RKN A;  1EY4 A;  1Y8P B;  1JE4 A;  4UAI A;  1SYG A;  1EYA A;  4NKL A;  1DON A;  1F9P A;  2K01 A;  2RDF A;  5HGT A;  1H9J A;  1Y8N B;  1ZYR D;  1LV9 A;  2HQE A;  4FVM A;  3W3A A;  3RZO B;  4IUT A;  4LMQ D;  3M4O B;  5KYI A;  5M5X B;  1LT4 D;  1VF5 C;  3A8J E;  3TP8 A;  4HCE A;  4J8Q A;  1MD2 D;  3IFT A;  2JP1 A;  1PLF A;  1L0Y B;  3TP7 A;  3I4L A;  5D14 A;  4G7O C;  5KYL A;  2B2W C;  3FMC A;  2MJ8 A;  1KLG D;  1S5E D;  3VR3 A;  5C3E B;  1TS2 A;  4HED A;  1C8C A;  4K5V A;  2A6E C;  3C3L A;  5KND A;  1HQR D;  1FNW A;  5E1F A;  1V43 A;  3FPP A;  3K7A B;  1AZP A;  3P75 A;  3S1Q B;  3J80 L;  5JOB A;  2KOL A;  5FLX L;  2JA7 B;  3MXN A;  1J9O A;  4K8J A;  2ZXP A;  3D6C A;  2EDG A;  4KY6 A;  3BDL A;  5C0X H;  2JE6 I;  4RWS C;  1DXM A;  4K5X A;  5EJW A;  2HDM A;  2XVS A;  1RCV D;  4QMG A;  4OHJ A;  4RGO S;  3A8I E;  1SXT A;  5FOB B;  5T1G A;  3QB3 A;  5LL6 X;  1PRT F;  5EKI A;  4OGQ C;  5JEA H;  1A3V A;  2FMM A;  1S5C D;  3VR4 A;  1H9S B;  3D4R A;  2NB0 A;  5C4H A;  2MP1 A;  3MAQ A;  1PZK D;  3QG1 A;  2FJ2 A;  2Q8I B;  3TME A;  1QE6 A;  1KAA A;  2RKS A;  2CVR A;  5JEA G;  3TP6 A;  5CMD A;  3OWE B;  5ELF A;  5KRU A;  3NQI A;  4QUC A;  2O4X A;  1LTB D;  1M8A A;  3OSO A;  4OO1 H;  2PQE A;  4PMW A;  1CZW A;  4L63 B;  1HTL D;  2B2Y C;  1WTX A;  4A3F B;  1UUP A;  2XWB B;  5TSS A;  3V96 A;  4V0B A;  2NVX B;  3DEP A;  1AEX A;  1YNN D;  3VR5 A;  1U9R A;  1IW7 C;  4LAA A;  4NMZ A;  5C5L A;  2EY1 A;  2RQX A;  2NYZ D;  4NDX A;  2RDG A;  2K5W A;  2IT1 A;  2F0I A;  3PIO 3;  2F1M A;  3GV3 A;  3GD7 A;  3NBI A;  3CRL C;  2SDF A;  1WTO A;  1X32 A;  3T13 A;  3Q22 A;  1TT2 A;  5FK9 C;  3J7A V;  1STA A;  1JQY D;  1R4P B;  1Q8I A;  4QIW B;  2WAC A;  1O7L A;  4A3E B;  1BOS A;  1ZEQ X;  5FKA C;  2EJG C;  1MGS A;  4A3G B;  3ERO A;  3HKZ B;  4M8A A;  5K36 H;  2BA1 A;  1O7Z A;  5JAV A;  3UI2 A;  2L0C A;  1EZ8 A;  4IUN A;  4FO2 A;  2OEO A;  1ILQ A;  2PMZ B;  3DWP A;  5JPN C;  5C0X J;  3PV0 A;  1JIC A;  3M7G A;  1RHP A;  2J0T D;  3BVZ A;  1PRT B;  1JOR A;  1W6K A;  1I6H B;  4DAV A;  1PFB A;  2J7Z A;  4IFD H;  3F2U A;  5FO8 B;  1GUG A;  2IX0 A;  3NPP A;  1DJR D;  3ND8 A;  1FNU A;  1HFN A;  4FF3 A;  2B2Y A;  5E4W C;  3E5S A;  2EXZ A;  3GTQ B;  4I7Z C;  3LNN A;  4KHZ A;  4IUQ A;  3TBI B;  2JSO A;  4A3D B;  3FRP B;  1D2B A;  2F0M A;  3PUX A;  2KQ3 A;  4KTA A;  1OXT A;  4V19 0;  4CJ1 B;  1K8M A;  3MXP A;  4WRD A;  5IGB A;  5CV5 A;  1FYC A;  1DD2 A;  1QNK A;  4A3B B;  1ESF A;  4DK1 A;  2A6E D;  1PTO D;  1LLR D;  2F0E A;  4G4K A;  1AZQ A;  3NTK A;  1JB3 A;  1TWC B;  1EYC A;  2IW3 A;  2I07 B;  2KED A;  1BCP B;  4F87 A;  4X3S A;  3QIA A;  1B4O A;  3D6W A;  3HRZ C;  1HRJ A;  1RTN A;  1LT5 D;  3URY A;  1ZXT A;  2QDB A;  1J8I A;  4B08 A;  1FR3 A;  1ML0 D;  3HP3 A;  4RFB A;  3PIP 3;  1TS3 A;  1X3Q A;  1HUM A;  4FF4 A;  4DNT B;  2EYL A;  3A55 A;  2JA6 B;  3GTL B;  3K5N A;  1G29 1;  4HSP A;  1SBB B;  2V4D A;  3TP5 A;  3DXJ C;  3S17 B;  1QG7 A;  2E2I B;  4KD4 A;  1U4M A;  3NP8 A;  3D4D A;  3BS1 A;  2EZV A;  3MXG A;  2NWG A;  1GJX A;  2AQ1 B;  1OXX K;  1TKW B;  4OIK A;  5DM7 3;  1B44 D;  3SR1 A;  4CHT B;  4A3I B;  1BBX C;  4IFD J;  3VYS A;  2M9V A;  3HZX A;  4ZKB B;  3GTK B;  2A69 D;  5M3F B;  2E76 C;  3PMF A;  5EBD A;  3ERQ A;  1RDP D;  2PCF B;  1OXS C;  4KKU A;  2I46 A;  2F0U A;  1A2U A;  2PZT A;  5HUR A;  2YU9 B;  4J1M A;  2VXW A;  3MTS A;  4TSS A;  2G9D A;  2NVT B;  4IUR A;  4L6T B;  3CU7 A;  1SE3 A;  3H6M A;  2TMP A;  1VCI A;  3BVG A;  4OO1 I;  4CGY B;  4CKC A;  1SYD A;  5IGD A;  1IYU A;  5CV8 A;  1BCP F;  3PUY A;  1EIG A;  1O78 A;  1II3 A;  1I4P A;  3SDZ A;  1EY9 A;  1I50 B;  5C3X A;  3R2T A;  1QNU A;  2J4X A;  4I65 A;  1SNO A;  4IUP A;  4RA8 A;  5IGC A;  3I3C A;  1TWF B;  3P20 A;  2JXM B;  4FYD A;  3J7Y W;  1CA6 A;  2EY6 A;  3OOC A;  3FVQ A;  1EY6 A;  4RGM A;  1ILP A;  5I2X A;  5EPL A;  4RHS A;  4G7H C;  1SNQ A;  1GHK A;  2WP8 J;  4GZY C;  5EKK A;  1JWM D;  2F0F A;  2Z4I A;  3D8G A;  1WVL A;  4L8J A;  4PMC A;  1A2T A;  2PNR C;  1MBY A;  4S3S A;  3CRK C;  4EVO A;  2LMC B;  2K03 A;  3G7L A;  2WII B;  2K28 A;  2F0W A;  4N9T A;  4KN7 C;  2VUM B;  5LHY 1;  1BQQ T;  3NXW A;  4EGV A;  1ET9 A;  5C0X G;  1JCK B;  1SE2 A;  3QWN A;  1ONL A;  2LS0 1;  4PQX A;  5CV9 A;  1TVX A;  4ME5 A;  1SNM A;  3I91 A;  4KMU C;  3SVM A;  1EWH A;  4RKB A;  2B63 B;  1EQT A;  3HOU B;  3RLF A;  5EBC A;  4CJ2 C;  1SYC A;  3H3V C;  3MZ5 A;  1KDC A;  1SFO B;  1M4V A;  4X3K A;  4CKB A;  3R2I A;  2GA4 B;  1G2T A;  1XYI A;  2SNS A;  1KDA A;  5DEH A;  1IKL A;  2KJX A;  1Q1E A;  1A6X A;  3V2T A;  3AU7 A;  5G3L F;  3T51 B;  2B8G A;  2RVL A;  4LJZ C;  5LL6 S;  1DM0 B;  5CV4 A;  3SE0 A;  2K33 A;  1D6E C;  2BCO A;  2ID0 A;  5ELC A;  4DN4 M;  2K5Q A;  2BA0 A;  5JVH 3;  1GUW A;  4C3J B;  1AFP A;  1CM9 A;  1L0X B;  1E0B A;  5C4Z A;  1LT3 D;  5M5Y B;  1JWU D;  5IGG A;  4DAY A;  1W6J A;  1K8O A;  1HA6 A;  1EIH A;  1XWE A;  2SEB D;  1BCP C;  3HGB A;  2KUM A;  1AP0 A;  3RZD B;  1I4X A;  3VA5 A;  1BXT A;  3LWE A;  3SK8 A;  4JBW A;  4U67 3;  1SEB D;  4IAL A;  4HSV A;  2AWO A;  2E2D C;  4XQJ A;  1TU2 B;  2L11 A;  1TQO A;  5IGE A;  5KNB A;  3KF8 A;  3A56 A;  5KIX A;  2SOB A;  1A3U A;  1TS4 A;  1VF7 A;  4K2L A;  1HTP A;  1CA5 A;  3E0J A;  5CR3 A;  3DMU A;  2NZ1 D;  4DFA A;  1CQF A;  1PYW D;  1EFI D;  1T5X D;  2RSO A;  3CKI B;  5J22 A;  5IIF A;  2F0S A;  1GHJ A;  2OT2 A;  4RKL A;  1D1I A;  1PTO C;  1GUS A;  5D3I B;  2B2V C;  3VYR A;  1IW7 D;  2AWN A;  1IHZ A;  2NN6 I;  3J81 L;  1C48 A;  5CYU A;  1OXU A;  4KKS A;  2L12 A;  4BBS B;  5I2Y A;  4OL7 A;  3H0G B;  3LWU A;  1SJH D;  3GTG B;  1DYQ A;  1IYV A;  3FEW X;  5JJZ A;  2EY2 A;  5M9O A;  2XRS D;  4C3I B;  2B2V A;  2TSS A;  2WAQ B;  1BDO A;  1KTK A;  3NBH A;  5COR A;  2A74 C;  4K2K A;  4IFD G;  1STY A;  1JOO A;  2D5D A;  2K7V A;  2B2T C;  3GTJ B;  3K5M A;  3GP7 A;  2NUC A;  2B39 A;  1UEA B;  2ICE C;  5C5M A;  1VDZ A;  1T5E A;  1SDF A;  1EY0 A;  1V1P B;  1C4Q A;  3T53 B;  2AUJ D;  3SK5 A;  5AFW A;  3A54 A;  4X3U A;  5I6W A;  3Q6S A;  2WB1 B;  4F88 A;  1SYF A;  3NQT A;  5T1I A;  1X3P A;  3GTO B;  1PZI D;  3S2D B;  2H4O A;  4E6I A;  4F8M A;  1UAP A;  5ELB A;  4IFD I;  1O80 A;  2LFN A;  3J80 E;  3VYU A;  1TWG B;  2R3Z A;  4DXF A;  1V8Q A;  2L4N A;  4ZKC B;  3K0Y A;  2R92 B;  3KLS X;  3MFG A;  2F0H A;  3HOY B;  1STN A;  4Q0F A;  4A93 B;  4C1N I;  3T56 B;  1WTW A;  4KY5 A;  2A6H D;  3HOX B;  1PRT C;  4XQN A;  2R7Z B;  4DGZ A;  1PXU A;  4Q5V A;  1NCV A;  4DK0 A;  3X3M A;  5J39 A;  2WKD A;  3BZD B;  5F2D A;  2WV6 D;  4ULL A;  2PO4 A;  5CGK A;  4HAE A;  1HCZ A;  2M00 A;  2BOS A;  5I9O A;  4XQQ A;  4FXG C;  1EU4 A;  2CHB D;  1SJE D;  3OMG A;  2EYF A;  4WJW A;  1HQM C;  4ZK9 B;  3AMU A;  1EYD A;  1Z6H A;  2XSC A;  3DM1 A;  1BF4 A;  3N6R A;  3MEH A;  5DM6 3;  4DXG A;  1BO0 A;  4PV1 C;  1I4Q A;  4G7Z C;  3IKJ A;  4BWG B;  3KK7 A;  1I4R A;  2F0L A;  4KD3 A;  1B53 A;  2FIN B;  4J6H A;  1MSH A;  2VB3 X;  2F0N A;  2MPM A;  3MC0 B;  1STG A;  5EKL A;  4HR7 B;  2XNA C;  4XXE A;  2IL8 A;  1D5M C;  3SXH A;  3G6J B;  5IOD A;  2F0V A;  3OWF A;  3Q0A A;  3NK9 A;  2AQ3 B;  2MUY A;  5EPJ A;  1LAC A;  3ONA B;  4KY7 A;  1EEI D;  3BYT B;  4MIU A;  2E2J B;  1B50 A;  4KN4 C;  5C3W A;  2FHT A;  1CFM A;  1GUT A;  4HMI A;  4C56 C;  4R9W A;  2ICI A;  4EQN A;  1F2L A;  1WTV A;  2WIN B;  2JEB I;  3WOF A;  3EA6 A;  1YNJ D;  2MHV A;  1QJO A;  1B2T A;  3P1H A;  5A35 A;  1B1Z A;  4N9P A;  5A2Q E;  2HCC A;  2D2C C;  3KBX A;  3EJI A;  4O42 A;  5COY A;  1TY0 A;  4ZUJ A;  3T16 A;  2K05 A;  3J7A F;  2PW5 A;  2IWH A;  1ET6 A;  4XT3 B;  3PO2 B;  5I6Y A;  3E6Z X;  4LK1 C;  3DHQ A;  3PUV A;  4JK1 C;  2YYZ A;  3L9A X;  5ISR A;  1FNV A;  2E74 C;  1PTO H;  1SYB A;  5I4D A;  4ZQ3 A;  3A8K E;  3EVQ A;  4KJN A;  5BN3 A;  2ENB A;  3I8Z A;  3FPU B;  4XYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...