4S3SA

Crystal structure of staphylococcal nuclease variant delta+phs i92k/v23a at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTAKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Buried ionizable residues
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4s3sA00
3TP8A 1STHA 2F0VA 3NP8A 5CV5A 4EQOA 5DAUA 2F0PA 3TP7A 4N9TA 3SHLA 3OWFA 4RKLA 2PYKA 3SXHA 3OMCA 2EYMA 3EJIA 4J6HA 1TT2A 3P1HA 2F0UA 4HTHA 4K8IA 4ME5A 3DMUA 3QB3A 3QOJA 2PW5A 3ITPA 1EZ8A 4IUNA 4KY7A 1II3A 3VA5A 5F2DA 5HURA 5IGGA 1NUCA 1SYDA 3H6MA 1JOKA 2F0TA 3MZ5A 4QMGA 1F2YA 4KY5A 5CV8A 3MEHA 1KDAA 5CV6A 4S3SA 4KV6A 2F0GA 2F0QA 5IGEA 1KAAA 3MVVA 2RKSA 3DHQA 2PZWA 5I9OA 5JAVA 2F0JA 4K14A 5IOCA 4K6DA 4PNYA 5C6AA 3D8GA 5KIXA 1JOQA 3TP6A 3P75A 2NUCA 2EY5A 2F0EA 2F0SA 2KHSA 3EVQA 2LKVA 4H7BA 4ZUIA 5J1ZA 5CC4A 1F2ZA 5EGTA 1SYBA 4NKLA 3OMGA 4KTAA 4K5VA 3EROA 2F0LA 2F3VA 4R8NA 4WRDA 5C3XA 4NDXA 5IGCA 2EYHA 1AEXA 2F3WA 3NQTA 2EYFA 5IGDA 4KD4A 4ZUJA 5J22A 1JORA 2EY1A 5NUCA 3C1EA 3HEJA 4NP5A 1NSNS 5KRUA 5KYLA 2EYPA 1TR5A 4IZ8A 3T13A 4IALA 1IHZA 2RBMA 1EY8A 5ISRA 2M00A 4J1MA 1STBA 2PW7A 2PZUA 2F0IA 3RUZA 4RKBA 4B9WA 5IIFA 3NK9A 3S9WA 4K2KA 5KYIA 4KY6A 1EY7A 5K5PA 1KDCA 1KDBA 5CGKA 4K5XA 3SR1A 3ERQA 3LX0A 4K8JA 4WORA 4NMZA 1A2UA 1SYEA 1U9RA 3D4DA 2KQ3A 3SK6A 5I6WA 5I6YA 4PMBA 5EKLA 4HMJA 1SNMA 3V2TA 2EY2A 3MXPA 1ENAA 5JOBA 3OSOA 1EY5A 1A3TA 2EY6A 3SK8A 4DFAA 5J39A 1ENCA 1EYDA 5KGUA 3D6CA 2F0FA 2EYLA 3NHHA 3R3OA 4ID6A 1STNA 4DGZA 1RKNA 4OL7A 2F0NA 4E6IA 4K5WA 4TRDA 4ODGA 3TMEA 3E5SA 1STAA 3TP5A 4I65A 1EYCA 4EQNA 4KJOA 1STGA 1SNCA 4MIUA 1SNPA 3BDLA 4DU9A 2F0DA 2F0MA 3PMFA 1SYCA 5E3FA 1EYAA 2PZTA 2F0OA 1EY6A 3D4WA 5C4ZA 5C5MA 1SNQA 1EZ6A 2WACA 4F7XA 5IODA 2HQEA 4HMIA 4EVOA 5EKKA 1KABA 5C3WA 2SOBA 1SNOA 2OEOA 4G57A 2ENBA 3HZXA 1STYA 3U9OA 5I9PA 5CV7A 5E1FA 2SNSA 1F2MA 2EYOA 1A3VA 2EYJA 2RDFA 1JOOA 3NXWA 4QB4A 3SK5A 4DF7A 1EY9A 1SNDA 1A3UA 2F0WA 3QOLA 4B9XA 5DEHA 5KEEA 1EY0A 4PMCA 1SYGA 2OF1A 3NUCA 4K2LA 4KD3A 4KJNA 4N9PA 2EXZA 5CV4A 3SK4A 2F0HA 5C5LA 1SYFA 5HGTA 2QDBA 2O4XA 3T16A 3MHBA 1TQOA 2PQEA 2SNMA 5IGBA 5M9OA 4LAAA 4F8MA 5IGFA 3BDCA 4YIJA 1EQVA 3C1FA 4EQPA 1EY4A 1A2TA 4ZQ3A 4QF4A 2OXPA 5CR3A 5CV9A 2F0KA 4KHVA 5C4HA
chains in the Genus database with same CATH superfamily
5EPJA 4OO1G 1D5XC 1ZYRD 5IT9c 2NVXH 3SHLA 2PNRC 2Z4IA 4HCSA 5LMUL 2LMCB 1IYJB 4K0KL 5C4XB 2EYMA 3TREA 4QJFA 4MHEA 2ZT9C 3W5OA 5DLQE 5EBDA 2F0GA 3K5OA 3HOXB 4LF7Q 5LL6S 3RLNA 2Q2HA 3BS1A 3K6OA 1IW7D 1CUKA 4JI8L 1X3GA 3JAME 3U4VA 4JI1L 4X3TA 2OTLA 1YHBA 3HEJA 5KRUA 1NSNS 1EIGA 2K75A 3F2DA 4QIWB 3I4MG 4YWLA 4IUTA 1HCZA 4X6AH 2PMZB 1U4MA 3J81E 3MC0B 2XNAC 3A8KE 4K6LA 5CGKA 2CW0D 4A3DH 2UXCQ 3CCMA 2AQ1B 4BXXG 4GLXA 4DV3L 3V2TA 1UEAB 1KC8C 4DFAA 3J80i 1WCMH 2F3IA 4ID6A 4DV5Q 4ULLA 1DOLA 1JE4A 3L9AX 4L63B 2KCMA 4K5WA 1PYBA 4C3HH 1QZHA 3TP5A 3K5NA 3A55A 3UI2A 4KJOA 4BBRH 1U5KA 2J0TD 5A2QL 4DU9A 3PMFA 2BCOA 3CCEA 5E3FA 5C0XI 5LMUQ 1XPRA 4K0KQ 4A3BG 2FXQA 5IODA 2JQOA 2NBFA 1KABA 3OW2A 3PQIA 3A5UA 3J7AV 2H5XA 1F2MA 4DXFA 3CCLA 1H9JA 1NTGA 3GV3A 1EIFA 1EY0A 1JJCB 1SYGA 4BBSB 5ELNA 2EJGC 4RG1A 2QEJC 5C0XG 2E2IB 1A62A 4H02A 4JI8Q 4ILWA 4QF4A 1PFBA 4KHVA 4YY3L 2Y0SE 4O0AA 2QA4A 3K0XA 3MXNA 3QWNA 1K3RA 1B2TA 2EIFA 2PNHA 4KY7A 4XTCS 2WAQB 3I90A 3PIO3 1CTMA 3MZ5A 5DM63 3E9IA 3PO2B 1EQRA 3HOVG 2KOLA 2KVMA 1U4RA 2V4DA 3ZJYC 1S5FD 5IP7H 4DV3Q 2NVTB 2SEBD 4K6DA 3MXGA 1F9SA 3EVQA 5IGGA 2NZHA 4P71A 4DV1L 1SYBA 3OMGA 3OIPA 4DK6C 2A68C 3DLLA 2CKZB 3J7YW 2QILA 3M4OB 4TQUS 4JW0A 1CA5A 4HJ5A 2N55A 4RKBA 1SR3A 2LS01 1PRTB 4C3IB 3AMUA 4P72A 1B3AA 1X3PA 3L3OC 5BN5A 1KHIA 3Q24A 3I7FA 4UPAA 3SK6A 5EPKA 4NXML 4DA2A 1MBYA 2KCTA 5HGQA 2JA7B 3EBEA 1FVIA 1EY5A 4RHRA 3IRBA 3R2IA 3UE0A 2IHEA 2K6AA 1VQKA 1NR4A 1YVCA 2WB1E 2QKIC 4CJ0B 2EYLA 3GQBA 1F9RA 1RKNA 2B63H 3H15A 1BCPC 1X55A 1IYUA 4ODGA 3TMEA 4DR2L 3OOCA 1V1OA 4EQNA 2UUAL 1ILPA 3BVMA 1MJEA 4O2DA 4C3JB 2K28A 5M3FH 4KN7C 3KBGA 4HSVA 4LF9Q 4HMIA 2B39A 3PIOA 1F9PA 3GP7A 2KUMA 4G57A 3CCVA 1A3VA 2RDFA 1V9PA 4CBVA 1IYVA 5JEAH 3BYYB 2F03A 1SNDA 4LF8Q 3NUCA 5JPMC 4DV1Q 5M5WH 3Q8DA 2O4XA 2WFWA 5M9OA 2UUBL 4B3ML 3DWQA 1NNXA 1A2TA 1SE8A 3OPOA 1C0AA 1CSQA 2EJFC 3T4AC 3M4PA 1PTOF 1CZGA 2H4OA 3M7GA 1R4QB 2HCCA 4AYBB 5M3MB 4X62L 3C46A 1HZAA 4TVAB 3STBC 3HOUG 4FF1A 1KNAA 4IUNA 1IKLA 3RZDB 3HOYG 1RL2A 3S2DB 5C3EB 1TWAH 3IKJA 1KDAA 5IGEA 4NXMQ 2I5HA 3CCUA 3HS0C 3UDIA 4FXGC 5JVH3 1VQ9A 1JT8A 4PQXA 1CM9A 1PTOD 4IURA 1QCBD 4Q0FA 2L12A 1BNZA 3JAMi 1UEBA 1V1PA 2XWJB 2F3WA 3GTMB 1XXGA 4DR2Q 4DUZQ 4GLVB 1B3QA 4MN3A 3BVZA 3PO3B 2JA6H 4A3KG 1TR5A 4GKJL 3J81i 4X3UA 1SE2A 4KY6A 4A3JH 1QVCA 4K5XA 4QCLA 1D2BA 4FP5D 1GKHA 3NTHA 1IBKL 3K80C 1CHPD 1E0BA 1TWGB 2N49A 1A3TA 1G8ZD 2F4VL 2L11A 1K0SA 4DGZA 2UUBQ 4B3MQ 3P20A 1MGSA 4NPSA 1EYGA 2K01A 1YNNC 3K58A 2AKWB 2RHQB 4IN3A 1HR0L 4A3LH 1PH2A 3UDXA 5COYA 1BXTA 2F0MA 1SYCA 1RTOA 1EYAA 4X62Q 1UAPA 1WCMG 2PQAB 4DAYB 1EL0A 3VR5A 1B1ZA 2PI2E 1STYA 1OTCA 4HR7B 3G4SA 2MGSA 1PMRA 2ALYB 4RGNA 4POFA 3I4LA 1WTVA 4JI7L 4XYOA 5GQOA 3PUYA 4KJNA 2NZ1D 3E3XA 4GNXC 1AN8A 3R93A 5FLXc 3K7UC 1I3QB 2Q2IA 4JBJA 4R1JA 2ZXOA 3Q23A 2F0KA 4BY1H 1HTLD 3I4MB 1WYDA 1LABA 4RGTA 2RCFA 4GKJQ 3TP7A 1N33Q 1HUMA 1GUNA 3NQIA 2Z6KC 4RFBA 3F2UA 1ET9A 3FKIG 3KLRA 2ZTDA 4PG3A 1CKNB 3V05A 5F2DA 1NUCA 3H6MA 1X9NA 2NTTA 4ZYSA 1HHVA 2B2YA 2F0QA 1Z47A 3L7ZC 4Y7NH 4GLAC 3S16B 5KNCA 1IBKQ 2HCIA 1UE1A 4JV5L 1SAPA 3P75A 2F4VQ 3RR5A 3URYA 5M5XH 3S1NH 4X3SA 2FFKB 1Q8IA 3M3YH 1WTHA 4ZUJA 1S5BD 3C1EA 1HR0Q 2VZAA 5IYDH 4MNOA 5IP7G 4HIOA 1CK1A 2PQAA 2PZUA 4A3BB 1EU3A 3CC4A 2Q2TA 1JWSD 1XMQL 3S1QB 3I4NH 4K8JA 3AB9A 3C2PA 4NMZA 4FVMA 4JBMA 1U9RA 3GTOB 5I6WA 5LHY1 2NN6H 2IX3A 3NBHB 1I4XA 2JA8H 3HKZE 2EY2A 2A6ED 3G7LA 4I7AA 5JOBA 4DR3L 2DGYA 4JI7Q 3KBXA 1AFPA 1VQEA 2C9OA 1I4QA 1TWCH 4FDBA 2NWGA 1AH9A 1OXTA 4DV6L 5C44G 4A3IG 1CKMA 2E2HH 4LFCL 1OXVA 5J3BA 2BOSA 1K8MA 3CP0A 4KHZA 2Z1CA 4EX5A 4LWCA 2A19A 3BG3A 5JPNC 3NE5B 1X32A 4GS3A 4DPGA 2PPBC 4LMQD 2F0DA 5C4JH 2GA4B 2JEAI 3M7NA 1EFID 3AYHB 3TN2A 3RN5A 2FINB 3GTKB 3KF8B 1AP0A 1EWIA 3HOVB 4IQZA 5EAYA 1SBBB 3SK5A 3NXWA 4TKOB 2X69A 1HA5A 4B9XA 2OT2A 1HZCA 1GOZA 4JV5Q 2XSCA 4H44C 4L5TA 1YI2A 3S1MH 2EXZA 3SK4A 3DM1A 1I50B 2ES2A 1U0LA 2E2DC 4F8MA 3S15H 1AE3A 5CBAE 4EQ5A 1JCKB 4A3EH 5ELBA 3X3NA 2DUDA 4DK3C 5T1GA 4G7ZC 1NAPA 1TWHH 1GUSA 3H91A 1KQSA 4ME5A 1LLRD 3NBHA 4XT1B 2MNAA 4BY7H 1U4LA 3DWPA 4V190 3MVVA 4LF5L 1DYQA 5JAVA 5C6AA 3CC7A 1NJIC 1KIXA 1TY2A 4DR3Q 5I4DA 1FL0A 4JBWA 3OW7A 3G6JB 2NVQH 4DV6Q 1R4PB 1KNEA 4AIMA 1AEXA 1EOTA 1B9MA 3T1YL 4LFCQ 1O78A 3N6RA 3ERSX 1WTPA 2E5LL 4R4QA 3MFGA 2MP1A 5FLXL 2K7VA 4IALA 1IHZA 5FLMG 2PW7A 2JK8A 4Z9CB 5D3IB 1KRTA 5IIFA 3S9WA 3D3RA 5KYIA 3KF8A 1MD2D 2HQLA 1WD0A 4KHPL 3CXCA 1VMCA 4CDCC 4L5QA 1KXLA 2VQFL 2YU9B 2HD3A 3GTPH 5I6YA 4PMBA 4HJ8A 1NMFA 3K81C 4H0LC 1ENAA 3OSOA 2EPBA 2RVLA 2EY6A 3CQZB 1CT1D 2OQKA 3W3AA 4JYAL 1STNA 4OL7A 1EIHA 3EQLC 4PZ6A 2JA5H 2MFIA 3VR2A 1CQVA 1YJWA 3HRZC 3HOYB 1P16A 4EVOA 2OEOA 3HZXA 4X3KA 1TKWB 4LF5Q 4A3LG 3AFQA 4HSPA 2NVXB 5E4WC 1CKOA 2C35B 1H95A 5KEEA 4HIDA 2X6GA 3EN2A 2LSSA 1Q81C 1FNWA 5ELEA 3T16A 5DM73 4BA1I 3T1YQ 3I91A 3VYSA 5IY0A 3PF4A 3H0GH 1CQFA 2OXPA 1C4QA 1ENFA 3TS0A 2R61A 1OXXK 3T53B 2BDNA 4H13C 2NYZD 3V96A 5FK9C 1GO3E 3BVGA 1LT5D 2E74C 1N34L 3LWUA 5ELFA 1S3OA 2JYOA 4KHPQ 5IT9E 1JOKA 1ESRA 1F2YA 3KLWA 1PYWD 2WIIB 2VQFQ 4LFAL 3M85A 4BY1G 1KAAA 1EIYB 4CKCA 4JOIC 3D8GA 3I55A 1J9OA 4IPHA 3TP6A 3FPPA 4JI5L 2OQ0A 4QUCA 3T51B 2UU9L 5CC4A 4JYAQ 1PH9A 1QNUA 3SVMA 1WOCA 4ME3A 2EYFA 4P73A 2D5DA 2ZTEA 2UXDL 4IZ8A 1EY8A 2B2WC 2M00A 1NCVA 1WCMB 3U50C 3RMHA 1BBUA 1PA6A 2TMPA 3S1RB 1GXDC 1NMGA 4R9WA 1X3EA 4BBRB 4OIKA 2R92H 2A6HD 4OELB 4UY8C 2KJXA 3CPWA 1IL8A 2E2JB 1ZYRC 4A3GH 1X54A 3IAYA 1ZKOA 2K14A 1VF7A 2B3GA 4RAUC 4C1NK 3J80L 1LO5D 1L1OA 2NN6G 3TRZA 2JA8G 3K7AH 1SJHD 2F4IA 3NBIA 1DOKA 3FKIB 1VQ6A 3I70A 2NVYH 1RODA 1L0WA 1D5ZC 4HIKA 2VUMH 4CHTB 1IW7C 1KD1C 1VQLA 4DV4L 4LFAQ 1QOHA 4QB4A 4OXPA 1M4VA 5DNFA 4GOPC 1LYLA 1XTDA 2B8GA 4C2MH 3KOJA 2ZM6Q 3GTLB 4JI5Q 2HIVA 2UU9Q 1TQOA 2CW0C 3GTGH 1GUGA 4EQPA 4PMWA 1W2BA 2UXDQ 2HDMA 4IFDH 1SFOH 2JXMB 3TP8A 2Z4HA 1C48A 4EQOA 2K03A 1I4PA 2ICEC 4RGMA 4QIWE 1LV9A 3A0JA 4HTHA 4KI0A 2PW5A 5HURA 2PMZE 2L55A 2B2VA 2ZJPA 3GDEA 2F0JA 5EQ0A 1XX8A 1BKBA 3AFPA 3GD7A 2IX1A 4A3CG 1JOQA 4LFBL 2NUCA 2XTIA 4RHSA 4LJZC 4ZUIA 4P2CB 5EGTA 4JI1Q 5C44B 2K5DA 4A3IB 3ER0A 3VR3A 2VY3A 2O5JC 4HAEA 1A63A 1Q8KA 3E0JA 3HOWH 2FMMA 2F0IA 1ONLA 1JICA 2JN4A 3Q22A 2B63B 2V1CC 1SXTA 4IPCA 4DV4Q 1ILQA 3RLOA 1TS5A 3VDYA 3MXPA 5M3FB 2A69D 3PUWA 4IO9A 1ICFB 3F8TA 1PFNA 2D0PA 2CWAA 1K9MC 3AQQA 3KJOA 3E5SA 1Y1VH 3VA7A 1E3PA 2AWNA 1LTAD 5D65A 3S17H 2K5QA 1JJGA 2F0OA 5M5WB 2KCNA 4QY7A 1MJCA 1SJED 1PVOA 1WI5A 2JA5G 5CV7A 2BE5D 1HQMC 1BBWA 1PH7A 2WAQE 2NB0A 1JOOA 4XXEA 2L9HA 2CH4A 1A3UA 2B2TC 1GJXA 4LFBQ 4K2LA 4C1NI 5CYUA 4AH6A 4FF2A 1RIPA 5GAGC 2TSSA 1RDPD 4YY3Q 3I8ZA 1EQVA 1A8VA 4IUVA 1TWAB 2DN8A 1LTID 2MJ8A 1PRTF 4ZKCB 2F0VA 3OWFA 2KEDA 5JJLA 3TSSA 2YTYA 3DWAA 5LMNW 3NEMA 2RDHA 3H0GG 4CKEA 1G6ZA 3CMEA 3QO2A 5D3DA 5M5YH 4V0BA 1FNUA 2ICIA 1PRTD 4XYQA 4A3JB 2LKVA 1FR3A 1TS4A 1E2VA 2IWHA 4K5VA 3KFUA 3DM3A 2YTXA 2Z9HA 2VB2X 3NQTA 3A7LA 1XMOL 2EY1A 4L6TB 3JAML 2K04A 1Z6HA 4J1MA 5IYBH 1HQRD 4GKKL 2LXJA 3MA2B 1Y1WH 4FXKC 4IOCA 1LT6D 3ERQA 2JA7H 3J81L 2L1BA 1A2UA 3BZCA 5EKLA 1EEFD 2AUJD 1R9TH 1RD9D 3DEPA 3RN2A 3KUPA 3LGJA 1EYDA 2UUAQ 4A3MH 4MZ9A 4GNXB 4RGOS 1PTOH 3L2PA 1KL9A 1YEZA 3T1HL 1T5XD 2B8FA 2ZTCA 4U673 3I72A 4QL5A 1DZ1A 4IUQA 1EY6A 3R8BA 5C5MA 1PTOC 2RCNA 4DR1L 5IP9H 3OWEB 4R4OA 1UE5A 1QNKA 4AYBE 3OYYA 4POGA 1VQFA 5AFWA 1T9HA 5E1FA 4BY1B 3KYHC 4A3DG 3DEOA 1HZ9A 1KAWA 4KD3A 2AMCB 4ZK9B 1XPOA 3K5LA 2RA4A 1JWMD 1PV4A 2SNMA 1RCVD 3MFYA 2ASBA 2R7ZH 4IFDI 3PUVA 3TZUA 2VUMG 1NY4A 1XMOQ 5M3MH 4ZCKA 3I73A 4Y7NB 3F2BA 1KTKA 1K73C 3CHBD 3NP8A 3RZDH 1YHQA 3U9SA 3KJPA 2F0PA 4N9TA 2O5IC 2EQSA 4C3HG 1XJVA 4GKKQ 5M5XB 1YITA 3S1NB 2IPKD 4B3SL 4DUYL 4WJ3M 4BBRG 3M3YB 2XVSA 4DAPA 3EA6A 5FJ8H 4CJ2C 4JCVE 2A73B 2J7ZA 2CQOA 4IFDG 3KLSX 1GHJA 1B8AA 5KIXA 2LXKA 3MEFA 4OWWB 2MO1A 4GNXA 1HNWL 4NW2A 5IGCA 1Y8NB 3GV6A 1X56A 1HUNA 1QUQB 1F2LA 4KKSA 5BR8L 3T1HQ 1N36L 2JA8B 1BUVT 2XN9C 3T13A 1HFGA 4G7OC 4K2KA 2Z6KA 2ATWA 1KDCA 4DR1Q 2BH2A 3OIQA 2WINB 2E2HB 3CCJA 4UAIA 1TWGH 1RHPA 4X65L 1NBWA 1NE3A 5KNBA 2JA9A 3HOWG 4IOAA 2CVRA 1FJGL 5C4JB 1PH6A 1M8AA 3I56A 3SK8A 2B2YC 4A4IA 4DAVA 2PCFB 3S14H 3R3OA 4OO1H 1AW7A 1J8IA 1NR2A 2L15A 4E6IA 1DM0B 2JJQA 2Y0SG 4DAYA 2HT1A 4I65A 4IJLA 4O42A 1HH2P 4MIUA 1SNPA 3I4OA 3SE0A 3S1MB 2JSOA 5C4ZA 5FO9B 2OCEA 3PCOB 4F7XA 2RSNA 4LF6L 3S15B 5C3WA 2MUYA 3IFTA 4B3SQ 4DUYQ 3AU7A 4R4CA 1SDFA 4DR7L 1X65A 3VR4A 4HJ7A 1Y1VG 2KEEA 3QOLA 3FRPB 1TWHB 1STEA 2OF1A 1RF2D 5JJZA 2F0HA 1I6VC 4OGQC 4CDEC 1HNWQ 1MIUA 3I4MH 1QUQA 5FKAC 1CKNA 1VQDA 1AZPA 5BR8Q 1N36Q 4YCVA 1S40A 2ZJRA 2A6EC 2B63G 1ESFA 4BXXH 4JC0A 3QG1A 2WKCA 2M9VA 3B6YA 3EJIA 2NVQB 4K8IA 3T56B 1C9OA 1YZ6A 3J7A5 3GTJH 4RA8A 1HJPA 1EOVA 4KY5A 4X65Q 5M3FG 2I0QA 1S5DD 3J7AF 1VQOA 1FJGQ 3FDTA 4K14A 3H94A 1ICWA 2WB1G 1TWFH 3FPUB 1K83H 3UDFA 1F2ZA 4NKLA 4A93H 3FP9A 1SEBD 4R8NA 4XQQA 2BA1A 3VYTA 1A6XA 5JEAG 2EYHA 1Q46A 2XWBB 4JI6L 4EGVA 3AEVA 4TSSA 4A3BH 1PFSA 1O7ZA 2DNEA 3GTPB 3HOZH 4RMFA 4LW1A 5KYLA 1XNQL 1XMQQ 5GAHC 1IZ6A 1STBA 3E9HA 3HFZB 1K0RA 1TS3A 3BZDB 4LF6Q 1J6QA 3F1ZA 2JA5B 4DV7L 4DR7Q 1Q7YC 1DXMA 2L4NA 5GROA 5JJKA 1PHJA 1ZEQX 1JB7A 2QF7A 4P74A 5C0XH 1CZWA 3J80c 1I4HA 1HNZL 1TU2B 5IYBG 1L0YB 1ASZA 1Y8OB 5BN3A 1TXYA 3CRLC 1Y1WG 1ZXTA 3HGBA 1UNSA 2E76C 1STAA 1U4PA 5A2QE 4DXGA 3RZOH 1TVXA 1SMYD 4I7ZC 1B50A 1Q90A 3BU2A 3A8JE 1VQBA 4PZ7A 3L0OA 1WVLA 4ZLTF 4A3MG 2JA6G 2B2UC 2ENBA 3MTSA 3H0GB 3H3VH 2M2LA 2KBNA 2LY7A 3KF6B 2RHSB 4A3JG 5DEHA 1HXYD 1VQHA 2FJ2A 2IY5B 3H3VC 1VQIA 1VCIA 3W1BA 2XGTA 2VB3X 3QIAA 4YCWA 5IP9G 1EWHA 5H1SE 4JI6Q 4IFDJ 4R8IA 1LT3D 1DOMA 5CV9A 5C4HA 1XNQQ 1O80A 1MSHA 4G4KA 3NELA 1VQPA 1VF5C 5DAUA 3S2HH 4JBKA 1H9KA 4JI4L 1FGBD 1I5FA 3BYTB 2R93H 3ND9A 4DNTB 2E8GA 5EPLA 2R7ZG 1N9WA 4DV7Q 1YNJD 4KN4C 1I6HH 4CJ1B 1XPUA 4S3SA 1KRSA 3DHQA 4DR5L 1HNZQ 2D9UA 2L0CA 5FO8B 1S5CD 5BN4A 2E5LQ 4LF4L 2F3VA 2MHVA 5EJWA 2K50A 4YHHL 1CSPA 2BH8A 2H1EA 3NPPA 4NP5A 1M1KC 4A3FH 1N8RC 4A3GB 2YTVA 1D7QA 1EY7A 4WJWA 1LTGD 1SE4A 1KDBA 1VMPA 3KF6A 1EEID 3CQZH 1E24A 3R2TA 1XTCD 1JB3A 4A3DB 1Z7TA 3M9BA 4XQJA 3D31A 4JOIA 3PGZA 4U68A 1MSGA 2IL8A 5IWAL 4GOPB 5J39A 1FNVA 1ENCA 2NVYB 1SRUA 1XNRL 2VNUD 2WP8J 1O7YA 2I07B 4M1UB 2VUMB 4TRDA 1A15A 4FYDA 1VQ4A 3HOUH 1E22A 1Q1BA 4HCEA 3HOYH 1T5EA 4UP9A 1QB5D 4C2MB 1X6OA 4C3HB 3ULPA 2NN6I 3ULLA 2BA0A 3CD6A 2PO4A 1QJOA 4JI4Q 2DJGC 2DJFC 2G5DA 3GTGB 4ZAIA 2AQ3B 5IYDG 2XRQD 1BF4A 4HJAA 3K57A 3WWVA 1IKMA 1SFOB 3BZKA 1EY9A 3SGIA 1IBML 4G7HC 4DR5Q 3I4NG 4GN4B 2ZXPA 1D8LA 4N9PA 3CPFA 4A3KH 4UDUC 5C5LA 1B70B 1K8GA 4LF4Q 4DKAC 4CGYB 2VW9A 4YHHQ 1ASYA 1OXSC 2VXWA 4DK1A 1N34Q 3TQYA 2A6HC 1EWCA 3CRKC 2K52A 1V43A 4N8FA 5JEAJ 4J6HA 1TT2A 3P1HA 2F0UA 1L1OC 3ONAB 3QB3A 3CU7A 1H9SB 2KCCA 4KKUA 1SYDA 2EZVA 2F0TA 4XDXA 4QMGA 3GTQH 4KV6A 3MXNB 3HKZG 3HOWB 1YJNA 4GOPA 1TS2A 1V1QA 2PZWA 2IX0A 2QW7A 3KDFB 3JAMc 5IWAQ 1VQCA 4LUZA 1YBYA 4IPDA 5I2YA 5C4XH 1XNRQ 1B44D 1VS0A 4F87A 2Y0SB 2FMCA 3J7ZC 5CBEE 4Q5VA 4GN5A 2IT1A 1Q86C 3J81c 2I5LX 5NUCA 2QEXA 4OWTB 3RLFA 1QVGA 3HOXH 3NTIA 2HHHL 3S1RH 1PLFA 2GVBA 2AHOB 2DNCA 2E75C 2XRSD 4A3EG 1GHKA 1E2ZA 3TEHB 2QCPX 4A93G 3LX0A 2CFMA 2E2JH 1Y1VB 2XIWA 2IHFA 2NTSA 4N8X1 3HOZG 4L5SA 4F88A 3S17B 4HMJA 2K32A 1IBMQ 1EQTA 4J15A 4NB3A 2B2VC 2EDGA 4DNRB 4BY7G 1JC7A 2N8NA 1BCPB 3NHHA 3PV0A 3QR8A 4MTNA 3HP3A 2R6GA 1WJJA 2WV6D 3D6WA 3W1GA 3FKIH 1GM5A 1JMCA 1PZKD 1STGA 3D4RA 4APVA 3BDLA 1OXUA 5L37A 1H9SA 3D4WA 1SNQA 3H3VI 3BJUA 2G9HD 4IPGA 5E7NA 2A68D 1K8AC 2SOBA 3PF5A 2Q8TA 1CA6A 4FO2A 4R4IA 3U9OA 5T1IA 3GTLH 2SNSA 3KDFA 5TSSA 4LF9L 4O1NA 2I46A 1UUPA 1LTRD 2WB1B 3FEWX 3GO5A 4B08A 4JI2L 1SROA 1HR0W 3NTKA 2VQEL 2KENA 4CDDC 2HUGA 1BCPF 4B3TL 1VQ8A 5HGTA 2QDBA 4LF8L 1E1TA 4R4TA 2ZJQA 1BBXC 2MQHA 1C8CA 3C1FA 1EY4A 3W2DA 1VQMA 2ZXRA 3IFDA 5CR3A 5M5YB 2HHHQ 2Q2UA 2A5HA 1EUJA 2A69C 2QGQA 2A8VA 1W6JA 3H09A 1TIID 1WTQA 3SXHA 4BBSH 2GN5A 2DY7A 4IJHA 1EZ8A 1II3A 1BCPD 2EJMA 4OHJA 1VQNA 3Q0AA 3UE1A 2E2IH 2B29A 3BDOA 5CV6A 5C44H 2RKSA 4A3IH 5IT9L 2B2TA 5I9OA 1RTNA 5IOCA 2CH4W 4BA2I 3Q6SA 5A35A 1Y1WB 2C5CA 4HN7A 2R93G 4L8JA 1E2WA 1UWVA 1I4GA 2K05A 2BE5C 4KD4A 3PO2H 4XT3B 1SSOA 5EBCA 5KNDA 2RBMA 1R9TB 1G6PA 2NVTH 4DUZL 1IXRA 1V1PB 4YWKA 4KK7A 5K5PA 2K33A 3JC66 4A3MB 1K28A 2JA6B 1X3FA 1EU4A 1MI2A 3A74A 1M90C 2RQXA 3SR1A 4WORA 1PTOB 4M8AA 1SYEA 3M4OH 1JE5A 3IL8A 1SNMA 4JI2Q 4A3FG 2VQEQ 1IL2A 3M4QA 5ELDA 3STBD 4B3TQ 1VQJA 2F0FA 1YNXA 4KKTA 1S4ZA 4CDFC 4C3IH 4OIJA 5IE8A 1YIJA 2I5MX 1EYCA 1BVSA 2K5WA 1PXUA 3A8IE 4FF4A 1PRTC 2PZTA 2SDFA 1WD1A 2Q8IB 3D0FA 4UHVA 2R7ZB 2KECA 1S5ED 3E6ZX 3PIP3 1GUOA 1X3QA 1QWYA 1CFMA 4C3JH 4P75A 4LUOA 3EIVA 5I2XA 5CV4A 2ID0A 1KLGD 1SYFA 5FLMH 2R92G 2MPMA 1Y14B 4YIJA 1DGSA 3LNNA 1G2TA 1PZID 3S24A 4ALPA 1EFWA 1SE3A 4JPBW 5HY6A 1LUZA 4A3GG 3MAQA 1LTSD 1G2SA 2D62A 3MXUA 3PSIA 4XQNA 3KLSA 1B4OA 1ML0D 1I94L 1BQQT 3G71A 1B53A 4J8QA 5GADC 1Y69U 3K8AA 3OMCA 2HIXA 2R7DA 4A75A 4OONA 1N33L 3VA5A 2K4KA 3A56A 1YNND 2RSOA 2QDLA 4NXNL 4Y52H 3WDNA 2Q8RE 3TBIB 4LNQA 3UDGA 2F0LA 5C3XA 4NDXA 3SEBA 5FLXE 3S2DH 4YWMA 3K59A 2RDGA 5C3EH 1JORA 1LTBD 2R3ZA 3X3MA 3RNUA 2X6LA 2CWPA 3S14B 4PV1C 1I4RA 4FF3A 2R7FA 5C4XG 1O7IA 3PIPA 3HKSA 3WOEA 5C0XJ 2JE6I 2KA7A 3GTMH 1JQYD 1Q1EA 4QGUA 3D4DA 2KQ3A 1F9QA 1JJ2A 3K0YA 1CHQD 3CCRA 3I4NB 3PO3H 5JVG3 3HOXG 3F2CA 3CF5A 2L5TA 2CHBD 4DN4M 5KGUA 5ELCA 1KLUD 4WJ4A 2F0NA 3ICEA 1MHWC 1TWCB 4JI3L 2OWOA 3QJYA 2K5HA 1JR0D 4RCOA 5IYCH 2PI2A 2P5ZX 4LK1C 1HZBA 1SLJA 2WKDA 1I94Q 5K36H 2D0OA 4OEMB 1E7ZA 1AZQA 3ZYYX 2DY8A 1EZ6A 2EOTA 4QUFA 2LFNA 5EKKA 4DAMA 1BR9A 1LTTD 3HKZB 2GVAA 3NWTA 4NXNQ 2EYJA 3HG9A 1LM0A 2CQAA 2KHIA 1Y8PB 2F0WA 1SMXA 1XWEA 4PMCA 1F77A 1J5EL 3MHBA 2HDLA 2PQEA 5LMNL 5CMDA 1S72A 1L0XB 3GTJB 1HNXL 1TY0A 2VS1A 3I2ZA 1VQAA 1PH4A 2D2CC 1W3SA 3NWSA 4UP7A 3DUZA 1TWFB 2IJ0A 2Z8LA 4A3EB 1BO0A 1K83B 1WTOA 4RKLA 1O7LA 2PYKA 1Q12A 4A93B 5FOBB 4FXDA 2BDOA 3QOJA 2YV5A 4DR4L 1DCZA 1FD7D 1I3QH 3FVQA 3HOZB 4DV0L 1PDQA 3NSWA 4A76A 5ELOA 3E0EA 1K3BC 1G91A 4BY7B 2F0SA 2KHSA 3A7AB 4KTAA 1SN8A 4BBSG 1Q3LA 2F1MA 4HIMA 1AE2A 1BOSA 1HFNA 1FYCA 1N32L 1B7YB 5J22A 1HTPA 4JI3Q 5CORA 4IUUA 1B9NA 4C56C 4JG2A 3S16H 4AQYL 1PZJD 4DK0A 1OO9B 3LWEA 3RUZA 3N52A 1VQ7A 3NK9A 2AWOA 1VQGA 4FNFA 5E4XA 4X64L 4KMUC 5EKIA 1QZGA 2A74C 4GN3B 3RZOB 2WAQG 1G51A 2K5NA 3CW2C 3PO2G 1PH3A 4JVZA 4CKBA 2K1BA 1DJRD 4JK1C 1HRJA 3EFXD 3CMAA 4BWGB 1W6KA 1J5EQ 2AQ2B 1P8LA 3RD4A 4YCUA 2UXBL 5LMNQ 1WFQA 4ABNA 3S1QH 3J80E 1LTLA 2JP1A 1XYIA 1HNXQ 4B3RL 1E1OA 3I3CA 4UP8A 3FMCA 2YYZA 3CKIB 1PFMA 3TDQA 5AJ3L 5GAEC 3GTOH 1SNCA 4XIGS 3O13A 3PUZA 4MTKA 1UE6A 1K8OA 1HPCA 5LL6X 2HQEA 3VR6A 1IBLL 1D1KA 4A3CH 1SNOA 4DR4Q 4DV2L 3DXJC 2K5VA 1CI3M 1GVPA 1L2FA 3SDZA 4C3IG 4QQBX 2UUCL 2EYOA 4DV0Q 2F52A 1DD2A 3C3LA 4WFN3 3G6EA 2A1AA 1VQ5A 1V8QA 3S2HB 3ND8A 2JA7G 4GZYC 1QE6A 3CC2A 2R93B 5IGBA 2IW3A 5IGFA 3BDCA 1I6HB 2N3SA 4RCNA 3GTKH 4ZQ3A 1N32Q 3HOVH 1VDZA 2FHTA 1STHA 5CV5A 1Z9FA 4AQYQ 3ULJA 4C3JG 3VYRA 2Z0SA 4IUPA 3K5MA 4BS9A 4X64Q 4OX9L 2KHJA 3G48A 4HJ9A 3DMUA 2B2UA 3ITPA 1I50H 3U4ZA 3KK7A 1A0IA 4JI0L 1EQQA 5CV8A 4OWXB 2EXDA 3MEHA 3MWYW 1MKHA 2EVBA 2G9DA 4A3FB 1GD7A 3J81j 1SMYC 4PNYA 4RWSC 2EY5A 2F0EA 4H7BA 5J1ZA 3PUXA 1PH1A 4DR6L 2RF4A 2Z6BA 4X66L 3OTOL 1LT4D 2UXBQ 3EROA 4WRDA 2CCZA 4ZKBB 1BDOA 1GUTA 4B3RQ 1GUWA 3M4YA 1D6EC 5IGDA 5AJ3Q 4RH6A 2EYPA 2EE1A 1WTRA 3OHXC 4KLKA 5ISRA 4DNIA 4B9WA 5D14A 4ZRZA 1D1IA 2VL6A 4AYBG 5M3MG 1IBLQ 2J4XA 1PYSB 4DV2Q 4HEDA 1QVFA 2JEBI 3HOUB 1LACA 4L5RC 2UUCQ 3U58A 1YJ9A 5C3EG 2N88A 3TZDA 4LUVA 1FGUA 1UE7A 5JJIA 4LF7L 1ET6A 1JWUD 1H9RA 5FJ8G 2R92B 3D6CA 1RJTA 2O2LD 2AUKA 3CAMA 3WOFA 1D5MC 1DONA 1YNJC 2N78A 5G3LF 1YHAA 2YU9H 3PO3G 3A5ZB 1PH8A 3A54A 5FO7B 4A3KB 3NENA 4OX9Q 2OTJA 2WACA 2UXCL 3TS2A 3CCSA 3K7AB 1Q82C 1G291 4JI0Q 1L1OB 4OO1I 5I9PA 1H9MA 3CCQA 1PH5A 4DF7A 5IYCG 1QILA 5G3LD 1HA6A 5K36G 4PZ8A 3VYUA 3FHWA 2NZOA 4DR6Q 4X66Q 4DV5L 3OTOQ 4LAAA 1WTXA 1WTWA 2B2WA 2MO0A 2ZM6L 3GTQB 3P7JA 1C7YA 1QG7A
chains in the Genus database with same CATH topology
5EPJA 4OO1G 1D5XC 1ZYRD 3SHLA 2PNRC 2Z4IA 4HCSA 2LMCB 5C4XB 2EYMA 4MHEA 2ZT9C 5EBDA 2F0GA 3K5OA 3HOXB 5LL6S 3BS1A 3K6OA 1IW7D 3JAME 4X3TA 3HEJA 5KRUA 1NSNS 1EIGA 4QIWB 4IUTA 1HCZA 2PMZB 1U4MA 3J81E 3MC0B 2XNAC 3A8KE 4K6LA 5CGKA 2CW0D 2AQ1B 3V2TA 1UEAB 4DFAA 4ID6A 4ULLA 1DOLA 1JE4A 3L9AX 4L63B 4K5WA 3TP5A 3K5NA 3A55A 3UI2A 4KJOA 2J0TD 5A2QL 4DU9A 3PMFA 2BCOA 5E3FA 5C0XI 5IODA 2NBFA 1KABA 3J7AV 1F2MA 4DXFA 1H9JA 3GV3A 1EY0A 1SYGA 4BBSB 2EJGC 2QEJC 5C0XG 2E2IB 4ILWA 4QF4A 1PFBA 4KHVA 3MXNA 3QWNA 1B2TA 4KY7A 4XTCS 2WAQB 3I90A 3PIO3 1CTMA 3MZ5A 5DM63 3PO2B 2KOLA 2KVMA 1U4RA 2V4DA 1S5FD 2NVTB 2SEBD 4K6DA 3MXGA 1F9SA 3EVQA 5IGGA 1SYBA 3OMGA 3OIPA 2A68C 3J7YW 2QILA 3M4OB 4TQUS 1CA5A 2N55A 4RKBA 2LS01 1PRTB 4C3IB 3AMUA 1B3AA 1X3PA 3L3OC 5BN5A 3Q24A 3SK6A 5EPKA 4DA2A 1MBYA 2JA7B 1EY5A 4RHRA 3R2IA 2K6AA 1NR4A 4CJ0B 2QKIC 2EYLA 3GQBA 1F9RA 1RKNA 1BCPC 1IYUA 4ODGA 3TMEA 3OOCA 1V1OA 4EQNA 1ILPA 3BVMA 4C3JB 2K28A 4KN7C 3KBGA 4HSVA 4HMIA 2B39A 1F9PA 3GP7A 2KUMA 4G57A 1A3VA 2RDFA 4CBVA 1IYVA 5JEAH 3BYYB 2F03A 1SNDA 3NUCA 5JPMC 2O4XA 5M9OA 3DWQA 3OPOA 1A2TA 2EJFC 3T4AC 1PTOF 1CZGA 2H4OA 3M7GA 1R4QB 2HCCA 4AYBB 5M3MB 3C46A 4FF1A 1KNAA 4IUNA 1IKLA 3RZDB 3S2DB 5C3EB 3IKJA 1KDAA 5IGEA 3HS0C 4FXGC 5JVH3 4PQXA 1CM9A 1PTOD 4IURA 1QCBD 4Q0FA 2L12A 1BNZA 1V1PA 2XWJB 2F3WA 3GTMB 1XXGA 4MN3A 3PO3B 3BVZA 1TR5A 4X3UA 1SE2A 4KY6A 4K5XA 4QCLA 1D2BA 4FP5D 3NTHA 1CHPD 1E0BA 1TWGB 1A3TA 1G8ZD 2L11A 4DGZA 3P20A 1MGSA 2K01A 1YNNC 3K58A 4IN3A 5COYA 1BXTA 2F0MA 1SYCA 1RTOA 1EYAA 1UAPA 1EL0A 3VR5A 1B1ZA 1STYA 4HR7B 2MGSA 1PMRA 4RGNA 3I4LA 1WTVA 4XYOA 3PUYA 4KJNA 2NZ1D 1AN8A 3R93A 1I3QB 2ZXOA 3Q23A 2F0KA 1HTLD 3I4MB 1LABA 4RGTA 3TP7A 1HUMA 1GUNA 3NQIA 4RFBA 3F2UA 1ET9A 3KLRA 3V05A 5F2DA 1NUCA 3H6MA 2NTTA 4ZYSA 1HHVA 2B2YA 2F0QA 1Z47A 3L7ZC 3S16B 5KNCA 2HCIA 1SAPA 3P75A 3URYA 4X3SA 2FFKB 1Q8IA 4ZUJA 1S5BD 3C1EA 1CK1A 2PZUA 4A3BB 1EU3A 1JWSD 3S1QB 4K8JA 3AB9A 3C2PA 4NMZA 4FVMA 1U9RA 3GTOB 5I6WA 5LHY1 2NN6H 2IX3A 1I4XA 2EY2A 2A6ED 3G7LA 5JOBA 3KBXA 1AFPA 2C9OA 1I4QA 2NWGA 1OXTA 1OXVA 2BOSA 1K8MA 4KHZA 2Z1CA 3BG3A 5JPNC 3NE5B 1X32A 2PPBC 4LMQD 2F0DA 2GA4B 2JEAI 3M7NA 1EFID 3TN2A 2FINB 3GTKB 1AP0A 3HOVB 4IQZA 1SBBB 3SK5A 3NXWA 4TKOB 2X69A 1HA5A 4B9XA 2OT2A 1GOZA 2XSCA 4H44C 2EXZA 3SK4A 3DM1A 1I50B 2E2DC 4F8MA 5CBAE 1JCKB 5ELBA 3X3NA 5T1GA 4G7ZC 1NAPA 1GUSA 3H91A 4ME5A 1LLRD 3NBHA 4XT1B 1U4LA 3DWPA 4V190 3MVVA 1DYQA 5JAVA 5C6AA 1TY2A 5I4DA 4JBWA 3OW7A 3G6JB 1R4PB 1KNEA 1AEXA 1EOTA 1B9MA 1O78A 3N6RA 1WTPA 3MFGA 2MP1A 5FLXL 2K7VA 4IALA 1IHZA 2PW7A 4Z9CB 5D3IB 5IIFA 3S9WA 3D3RA 5KYIA 3KF8A 1MD2D 1WD0A 1VMCA 2YU9B 5I6YA 4PMBA 4H0LC 1ENAA 3OSOA 2EPBA 2RVLA 2EY6A 3CQZB 1CT1D 3W3AA 1STNA 4OL7A 1EIHA 3EQLC 3VR2A 1CQVA 3HRZC 3HOYB 4EVOA 2OEOA 3HZXA 4X3KA 1TKWB 4HSPA 2NVXB 5E4WC 5KEEA 2X6GA 1FNWA 5ELEA 3T16A 5DM73 4BA1I 3I91A 3VYSA 1CQFA 2OXPA 1C4QA 1ENFA 2R61A 1OXXK 3T53B 2BDNA 4H13C 2NYZD 3V96A 5FK9C 3BVGA 1LT5D 2E74C 3LWUA 5ELFA 2JYOA 5IT9E 1JOKA 1ESRA 1F2YA 1PYWD 2WIIB 3M85A 1KAAA 4CKCA 3D8GA 1J9OA 3TP6A 3FPPA 4QUCA 3T51B 5CC4A 1QNUA 3SVMA 2EYFA 2D5DA 4IZ8A 1EY8A 2B2WC 2M00A 1NCVA 1WCMB 3RMHA 2TMPA 3S1RB 1GXDC 4R9WA 4BBRB 4OIKA 2A6HD 2KJXA 1IL8A 2E2JB 1ZYRC 3IAYA 1ZKOA 1VF7A 4RAUC 4C1NK 3J80L 1LO5D 2NN6G 1SJHD 2F4IA 3NBIA 1DOKA 3FKIB 3I70A 1RODA 1D5ZC 4CHTB 1IW7C 1QOHA 4QB4A 1M4VA 5DNFA 2B8GA 3GTLB 1TQOA 2CW0C 1GUGA 4EQPA 4PMWA 2HDMA 4IFDH 2JXMB 3TP8A 2Z4HA 1C48A 4EQOA 2K03A 1I4PA 2ICEC 4RGMA 1LV9A 4HTHA 4KI0A 2PW5A 5HURA 2L55A 2B2VA 2F0JA 5EQ0A 1XX8A 3GD7A 2IX1A 1JOQA 2NUCA 4RHSA 4LJZC 4ZUIA 4P2CB 5EGTA 5C44B 2K5DA 4A3IB 3VR3A 2O5JC 4HAEA 3E0JA 2FMMA 2F0IA 1ONLA 1JICA 3Q22A 2B63B 1SXTA 1ILQA 1TS5A 3MXPA 5M3FB 2A69D 3PUWA 1PFNA 3E5SA 3VA7A 2AWNA 1LTAD 5D65A 2K5QA 2F0OA 5M5WB 2KCNA 1SJED 5CV7A 2BE5D 1HQMC 2NB0A 1JOOA 4XXEA 2L9HA 1A3UA 2B2TC 1GJXA 4K2LA 4C1NI 5CYUA 4FF2A 2TSSA 1RDPD 3I8ZA 1EQVA 4IUVA 1TWAB 2DN8A 1LTID 2MJ8A 1PRTF 4ZKCB 2F0VA 3OWFA 2KEDA 3TSSA 3DWAA 2RDHA 4CKEA 1G6ZA 3QO2A 5D3DA 4V0BA 1FNUA 2ICIA 1PRTD 4XYQA 4A3JB 2LKVA 1FR3A 1TS4A 1E2VA 2IWHA 4K5VA 2VB2X 3NQTA 3A7LA 2EY1A 4L6TB 3JAML 2K04A 1Z6HA 4J1MA 1HQRD 3MA2B 4FXKC 1LT6D 3ERQA 3J81L 2L1BA 1A2UA 5EKLA 1EEFD 2AUJD 1RD9D 3DEPA 3KUPA 1EYDA 4RGOS 1PTOH 1T5XD 2B8FA 4U673 3I72A 1DZ1A 4IUQA 1EY6A 3R8BA 5C5MA 1PTOC 3OWEB 1QNKA 5AFWA 5E1FA 4BY1B 3DEOA 4KD3A 4ZK9B 3K5LA 2RA4A 1JWMD 2SNMA 1RCVD 3MFYA 4IFDI 3PUVA 3TZUA 3I73A 4Y7NB 1KTKA 3CHBD 3NP8A 3U9SA 2F0PA 4N9TA 2O5IC 4C3HG 5M5XB 3S1NB 2IPKD 3M3YB 2XVSA 4DAPA 3EA6A 4CJ2C 2A73B 2J7ZA 4IFDG 3KLSX 1GHJA 5KIXA 4NW2A 5IGCA 1Y8NB 3GV6A 1HUNA 1F2LA 4KKSA 2JA8B 1BUVT 2XN9C 3T13A 1HFGA 4G7OC 4K2KA 1KDCA 3OIQA 2WINB 2E2HB 4UAIA 1RHPA 5KNBA 2CVRA 5C4JB 1M8AA 3SK8A 2B2YC 4DAVA 2PCFB 3R3OA 4OO1H 1AW7A 1J8IA 1NR2A 4E6IA 1DM0B 4DAYA 4I65A 4O42A 4MIUA 1SNPA 3SE0A 3S1MB 2JSOA 5C4ZA 5FO9B 4F7XA 2RSNA 3S15B 5C3WA 2MUYA 3IFTA 3AU7A 1SDFA 3VR4A 2KEEA 3QOLA 3FRPB 1TWHB 1STEA 2OF1A 1RF2D 5JJZA 2F0HA 1I6VC 4OGQC 5FKAC 1AZPA 2A6EC 1ESFA 3QG1A 2WKCA 2M9VA 3EJIA 2NVQB 4K8IA 3T56B 4RA8A 4KY5A 1S5DD 3J7AF 3FDTA 4K14A 3H94A 1ICWA 3FPUB 1F2ZA 4NKLA 1SEBD 4R8NA 4XQQA 2BA1A 3VYTA 1A6XA 5JEAG 2EYHA 2XWBB 4EGVA 4TSSA 2DNEA 1O7ZA 3GTPB 5KYLA 1STBA 1TS3A 3BZDB 2JA5B 1DXMA 2L4NA 1ZEQX 2QF7A 5C0XH 1CZWA 1I4HA 1TU2B 1L0YB 1Y8OB 5BN3A 3CRLC 1ZXTA 3HGBA 1UNSA 2E76C 1STAA 1U4PA 5A2QE 4DXGA 1TVXA 1SMYD 4I7ZC 1B50A 1Q90A 3A8JE 1WVLA 4ZLTF 2B2UC 2ENBA 3MTSA 3H0GB 2M2LA 2LY7A 5DEHA 1HXYD 2FJ2A 3H3VC 1VCIA 2VB3X 3QIAA 1EWHA 4IFDJ 4R8IA 1LT3D 1DOMA 5CV9A 5C4HA 1O80A 1MSHA 4G4KA 1VF5C 5DAUA 1H9KA 1FGBD 3BYTB 3ND9A 4DNTB 5EPLA 1YNJD 4KN4C 4CJ1B 4S3SA 3DHQA 2D9UA 2L0CA 5FO8B 1S5CD 5BN4A 2F3VA 2MHVA 5EJWA 2H1EA 3NPPA 4NP5A 4A3GB 1EY7A 4WJWA 1LTGD 1SE4A 1KDBA 1VMPA 1EEID 3R2TA 1XTCD 1JB3A 4A3DB 1Z7TA 4XQJA 3D31A 4U68A 1MSGA 2IL8A 5J39A 1FNVA 1ENCA 2NVYB 2VNUD 2WP8J 1O7YA 2I07B 4M1UB 2VUMB 4TRDA 1A15A 4FYDA 1Q1BA 4HCEA 1T5EA 1QB5D 4C2MB 4C3HB 2NN6I 2BA0A 2PO4A 1QJOA 3GTGB 4ZAIA 2AQ3B 2XRQD 1BF4A 3K57A 1IKMA 1SFOB 1EY9A 4G7HC 2ZXPA 4N9PA 4UDUC 5C5LA 4CGYB 1OXSC 2VXWA 4DK1A 2A6HC 1EWCA 3CRKC 1V43A 5JEAJ 4J6HA 1TT2A 3P1HA 2F0UA 3ONAB 3QB3A 3CU7A 1H9SB 2KCCA 4KKUA 1SYDA 2EZVA 2F0TA 4XDXA 4QMGA 4KV6A 3HOWB 1TS2A 2PZWA 2IX0A 5I2YA 1B44D 4F87A 2Y0SB 2FMCA 5CBEE 4Q5VA 2IT1A 5NUCA 3RLFA 3NTIA 1PLFA 2DNCA 2E75C 2XRSD 1GHKA 1E2ZA 2QCPX 3LX0A 1Y1VB 2XIWA 2NTSA 4F88A 3S17B 4HMJA 2K32A 1EQTA 2B2VC 2EDGA 4DNRB 1JC7A 3NHHA 1BCPB 3PV0A 3HP3A 2R6GA 2WV6D 3D6WA 1PZKD 1STGA 3D4RA 3BDLA 1OXUA 1H9SA 3D4WA 1SNQA 2G9HD 2A68D 2SOBA 2Q8TA 1CA6A 4FO2A 3U9OA 5T1IA 2SNSA 5TSSA 4O1NA 2I46A 1UUPA 1LTRD 2WB1B 3FEWX 3GO5A 4B08A 3NTKA 2HUGA 1BCPF 5HGTA 2QDBA 1BBXC 1C8CA 3C1FA 1EY4A 3W2DA 2ZXRA 3IFDA 5CR3A 5M5YB 2A5HA 2A69C 1W6JA 3H09A 1TIID 1WTQA 3SXHA 2DY7A 1EZ8A 1II3A 1BCPD 2EJMA 4OHJA 3Q0AA 3BDOA 5CV6A 2RKSA 5IT9L 2B2TA 5I9OA 1RTNA 5IOCA 4BA2I 3Q6SA 5A35A 1Y1WB 2C5CA 4HN7A 4L8JA 1E2WA 1I4GA 2K05A 2BE5C 4KD4A 4XT3B 1SSOA 5EBCA 5KNDA 2RBMA 1R9TB 1V1PB 4KK7A 5K5PA 2K33A 4A3MB 2JA6B 1EU4A 1MI2A 2RQXA 3SR1A 4WORA 1PTOB 4M8AA 1SYEA 3IL8A 1SNMA 5ELDA 2F0FA 4KKTA 1S4ZA 4OIJA 1EYCA 2K5WA 1PXUA 3A8IE 4FF4A 1PRTC 2PZTA 2SDFA 1WD1A 2Q8IB 2R7ZB 2KECA 1S5ED 3E6ZX 3PIP3 1GUOA 1X3QA 1QWYA 1CFMA 5I2XA 5CV4A 2ID0A 1KLGD 1SYFA 2MPMA 4YIJA 3LNNA 1G2TA 1PZID 1SE3A 3MAQA 1LTSD 1G2SA 2D62A 3MXUA 4XQNA 3KLSA 1B4OA 1ML0D 1BQQT 1B53A 4J8QA 1Y69U 3OMCA 3VA5A 3A56A 1YNND 2RSOA 3WDNA 2Q8RE 3TBIB 2F0LA 5C3XA 4NDXA 3SEBA 5FLXE 3K59A 2RDGA 1JORA 1LTBD 2R3ZA 3X3MA 2X6LA 3S14B 4PV1C 1I4RA 4FF3A 3WOEA 5C0XJ 2JE6I 2KA7A 1JQYD 1Q1EA 3D4DA 2KQ3A 1F9QA 3K0YA 1CHQD 3I4NB 5JVG3 2L5TA 2CHBD 4DN4M 5KGUA 5ELCA 1KLUD 2F0NA 1TWCB 3QJYA 4RCOA 1JR0D 4LK1C 2WKDA 5K36H 1AZQA 3ZYYX 2DY8A 1EZ6A 2EOTA 4QUFA 2LFNA 5EKKA 1BR9A 1LTTD 3HKZB 3NWTA 2EYJA 3HG9A 2CQAA 1Y8PB 2F0WA 1XWEA 4PMCA 1F77A 3MHBA 2HDLA 2PQEA 5CMDA 1L0XB 3GTJB 1TY0A 2D2CC 3NWSA 3DUZA 1TWFB 2IJ0A 2Z8LA 4A3EB 1BO0A 1K83B 1WTOA 4RKLA 1O7LA 2PYKA 1Q12A 4A93B 5FOBB 4FXDA 2BDOA 3QOJA 1DCZA 1FD7D 3FVQA 3HOZB 1PDQA 3NSWA 1G91A 4BY7B 2F0SA 2KHSA 3A7AB 4KTAA 1Q3LA 2F1MA 1BOSA 1HFNA 1FYCA 5J22A 1HTPA 5CORA 4IUUA 1B9NA 4C56C 1PZJD 4DK0A 1OO9B 3LWEA 3RUZA 3N52A 3NK9A 2AWOA 4FNFA 5E4XA 4KMUC 5EKIA 2A74C 3RZOB 4CKBA 2K1BA 1DJRD 4JK1C 1HRJA 3EFXD 4BWGB 1W6KA 2AQ2B 3RD4A 4ABNA 3J80E 1XYIA 2JP1A 3I3CA 3FMCA 2YYZA 3CKIB 1PFMA 3TDQA 1SNCA 4XIGS 3O13A 3PUZA 1K8OA 1HPCA 5LL6X 2HQEA 3VR6A 1D1KA 1SNOA 3DXJC 1CI3M 3SDZA 4C3IG 2EYOA 1DD2A 3C3LA 4WFN3 1V8QA 3S2HB 3ND8A 4GZYC 1QE6A 2R93B 5IGBA 2IW3A 5IGFA 3BDCA 1I6HB 4RCNA 4ZQ3A 1VDZA 2FHTA 1STHA 5CV5A 4C3JG 3VYRA 4IUPA 3K5MA 4BS9A 3DMUA 2B2UA 3ITPA 3KK7A 5CV8A 3MEHA 3MWYW 2EVBA 2G9DA 4A3FB 1SMYC 4PNYA 4RWSC 2EY5A 2F0EA 4H7BA 5J1ZA 3PUXA 1LT4D 3EROA 4WRDA 4ZKBB 1BDOA 1GUTA 1GUWA 3M4YA 1D6EC 5IGDA 4RH6A 2EYPA 2EE1A 1WTRA 3OHXC 5ISRA 4B9WA 5D14A 4ZRZA 1D1IA 2J4XA 4HEDA 2JEBI 3HOUB 1LACA 2N88A 3TZDA 1ET6A 1JWUD 1H9RA 2R92B 3D6CA 1RJTA 2O2LD 2AUKA 3WOFA 1D5MC 1DONA 1YNJC 5G3LF 3A54A 5FO7B 4A3KB 2WACA 3K7AB 1G291 4OO1I 5I9PA 1H9MA 4DF7A 1QILA 5G3LD 1HA6A 5K36G 3VYUA 4LAAA 1WTXA 1WTWA 2B2WA 3GTQB 3P7JA 1QG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP8 A;  1STH A;  2F0V A;  3NP8 A;  5CV5 A;  4EQO A;  5DAU A;  2F0P A;  3TP7 A;  4N9T A;  3SHL A;  3OWF A;  4RKL A;  2PYK A;  3SXH A;  3OMC A;  2EYM A;  3EJI A;  4J6H A;  1TT2 A;  3P1H A;  2F0U A;  4HTH A;  4K8I A;  4ME5 A;  3DMU A;  3QB3 A;  3QOJ A;  2PW5 A;  3ITP A;  1EZ8 A;  4IUN A;  4KY7 A;  1II3 A;  3VA5 A;  5F2D A;  5HUR A;  5IGG A;  1NUC A;  1SYD A;  3H6M A;  1JOK A;  2F0T A;  3MZ5 A;  4QMG A;  1F2Y A;  4KY5 A;  5CV8 A;  3MEH A;  1KDA A;  5CV6 A;  4S3S A;  4KV6 A;  2F0G A;  2F0Q A;  5IGE A;  1KAA A;  3MVV A;  2RKS A;  3DHQ A;  2PZW A;  5I9O A;  5JAV A;  2F0J A;  4K14 A;  5IOC A;  4K6D A;  4PNY A;  5C6A A;  3D8G A;  5KIX A;  1JOQ A;  3TP6 A;  3P75 A;  2NUC A;  2EY5 A;  2F0E A;  2F0S A;  2KHS A;  3EVQ A;  2LKV A;  4H7B A;  4ZUI A;  5J1Z A;  5CC4 A;  1F2Z A;  5EGT A;  1SYB A;  4NKL A;  3OMG A;  4KTA A;  4K5V A;  3ERO A;  2F0L A;  2F3V A;  4R8N A;  4WRD A;  5C3X A;  4NDX A;  5IGC A;  2EYH A;  1AEX A;  2F3W A;  3NQT A;  2EYF A;  5IGD A;  4KD4 A;  4ZUJ A;  5J22 A;  1JOR A;  2EY1 A;  5NUC A;  3C1E A;  3HEJ A;  4NP5 A;  1NSN S;  5KRU A;  5KYL A;  2EYP A;  1TR5 A;  4IZ8 A;  3T13 A;  4IAL A;  1IHZ A;  2RBM A;  1EY8 A;  5ISR A;  2M00 A;  4J1M A;  1STB A;  2PW7 A;  2PZU A;  2F0I A;  3RUZ A;  4RKB A;  4B9W A;  5IIF A;  3NK9 A;  3S9W A;  4K2K A;  5KYI A;  4KY6 A;  1EY7 A;  5K5P A;  1KDC A;  1KDB A;  5CGK A;  4K5X A;  3SR1 A;  3ERQ A;  3LX0 A;  4K8J A;  4WOR A;  4NMZ A;  1A2U A;  1SYE A;  1U9R A;  3D4D A;  2KQ3 A;  3SK6 A;  5I6W A;  5I6Y A;  4PMB A;  5EKL A;  4HMJ A;  1SNM A;  3V2T A;  2EY2 A;  3MXP A;  1ENA A;  5JOB A;  3OSO A;  1EY5 A;  1A3T A;  2EY6 A;  3SK8 A;  4DFA A;  5J39 A;  1ENC A;  1EYD A;  5KGU A;  3D6C A;  2F0F A;  2EYL A;  3NHH A;  3R3O A;  4ID6 A;  1STN A;  4DGZ A;  1RKN A;  4OL7 A;  2F0N A;  4E6I A;  4K5W A;  4TRD A;  4ODG A;  3TME A;  3E5S A;  1STA A;  3TP5 A;  4I65 A;  1EYC A;  4EQN A;  4KJO A;  1STG A;  1SNC A;  4MIU A;  1SNP A;  3BDL A;  4DU9 A;  2F0D A;  2F0M A;  3PMF A;  1SYC A;  5E3F A;  1EYA A;  2PZT A;  2F0O A;  1EY6 A;  3D4W A;  5C4Z A;  5C5M A;  1SNQ A;  1EZ6 A;  2WAC A;  4F7X A;  5IOD A;  2HQE A;  4HMI A;  4EVO A;  5EKK A;  1KAB A;  5C3W A;  2SOB A;  1SNO A;  2OEO A;  4G57 A;  2ENB A;  3HZX A;  1STY A;  3U9O A;  5I9P A;  5CV7 A;  5E1F A;  2SNS A;  1F2M A;  2EYO A;  1A3V A;  2EYJ A;  2RDF A;  1JOO A;  3NXW A;  4QB4 A;  3SK5 A;  4DF7 A;  1EY9 A;  1SND A;  1A3U A;  2F0W A;  3QOL A;  4B9X A;  5DEH A;  5KEE A;  1EY0 A;  4PMC A;  1SYG A;  2OF1 A;  3NUC A;  4K2L A;  4KD3 A;  4KJN A;  4N9P A;  2EXZ A;  5CV4 A;  3SK4 A;  2F0H A;  5C5L A;  1SYF A;  5HGT A;  2QDB A;  2O4X A;  3T16 A;  3MHB A;  1TQO A;  2PQE A;  2SNM A;  5IGB A;  5M9O A;  4LAA A;  4F8M A;  5IGF A;  3BDC A;  4YIJ A;  1EQV A;  3C1F A;  4EQP A;  1EY4 A;  1A2T A;  4ZQ3 A;  4QF4 A;  2OXP A;  5CR3 A;  5CV9 A;  2F0K A;  4KHV A;  5C4H A; 
#chains in the Genus database with same CATH topology
 5EPJ A;  4OO1 G;  1D5X C;  1ZYR D;  5IT9 c;  2NVX H;  3SHL A;  2PNR C;  2Z4I A;  4HCS A;  5LMU L;  2LMC B;  1IYJ B;  4K0K L;  5C4X B;  2EYM A;  3TRE A;  4QJF A;  4MHE A;  2ZT9 C;  3W5O A;  5DLQ E;  5EBD A;  2F0G A;  3K5O A;  3HOX B;  4LF7 Q;  5LL6 S;  3RLN A;  2Q2H A;  3BS1 A;  3K6O A;  1IW7 D;  1CUK A;  4JI8 L;  1X3G A;  3JAM E;  3U4V A;  4JI1 L;  4X3T A;  2OTL A;  1YHB A;  3HEJ A;  5KRU A;  1NSN S;  1EIG A;  2K75 A;  3F2D A;  4QIW B;  3I4M G;  4YWL A;  4IUT A;  1HCZ A;  4X6A H;  2PMZ B;  1U4M A;  3J81 E;  3MC0 B;  2XNA C;  3A8K E;  4K6L A;  5CGK A;  2CW0 D;  4A3D H;  2UXC Q;  3CCM A;  2AQ1 B;  4BXX G;  4GLX A;  4DV3 L;  3V2T A;  1UEA B;  1KC8 C;  4DFA A;  3J80 i;  1WCM H;  2F3I A;  4ID6 A;  4DV5 Q;  4ULL A;  1DOL A;  1JE4 A;  3L9A X;  4L63 B;  2KCM A;  4K5W A;  1PYB A;  4C3H H;  1QZH A;  3TP5 A;  3K5N A;  3A55 A;  3UI2 A;  4KJO A;  4BBR H;  1U5K A;  2J0T D;  5A2Q L;  4DU9 A;  3PMF A;  2BCO A;  3CCE A;  5E3F A;  5C0X I;  5LMU Q;  1XPR A;  4K0K Q;  4A3B G;  2FXQ A;  5IOD A;  2JQO A;  2NBF A;  1KAB A;  3OW2 A;  3PQI A;  3A5U A;  3J7A V;  2H5X A;  1F2M A;  4DXF A;  3CCL A;  1H9J A;  1NTG A;  3GV3 A;  1EIF A;  1EY0 A;  1JJC B;  1SYG A;  4BBS B;  5ELN A;  2EJG C;  4RG1 A;  2QEJ C;  5C0X G;  2E2I B;  1A62 A;  4H02 A;  4JI8 Q;  4ILW A;  4QF4 A;  1PFB A;  4KHV A;  4YY3 L;  2Y0S E;  4O0A A;  2QA4 A;  3K0X A;  3MXN A;  3QWN A;  1K3R A;  1B2T A;  2EIF A;  2PNH A;  4KY7 A;  4XTC S;  2WAQ B;  3I90 A;  3PIO 3;  1CTM A;  3MZ5 A;  5DM6 3;  3E9I A;  3PO2 B;  1EQR A;  3HOV G;  2KOL A;  2KVM A;  1U4R A;  2V4D A;  3ZJY C;  1S5F D;  5IP7 H;  4DV3 Q;  2NVT B;  2SEB D;  4K6D A;  3MXG A;  1F9S A;  3EVQ A;  5IGG A;  2NZH A;  4P71 A;  4DV1 L;  1SYB A;  3OMG A;  3OIP A;  4DK6 C;  2A68 C;  3DLL A;  2CKZ B;  3J7Y W;  2QIL A;  3M4O B;  4TQU S;  4JW0 A;  1CA5 A;  4HJ5 A;  2N55 A;  4RKB A;  1SR3 A;  2LS0 1;  1PRT B;  4C3I B;  3AMU A;  4P72 A;  1B3A A;  1X3P A;  3L3O C;  5BN5 A;  1KHI A;  3Q24 A;  3I7F A;  4UPA A;  3SK6 A;  5EPK A;  4NXM L;  4DA2 A;  1MBY A;  2KCT A;  5HGQ A;  2JA7 B;  3EBE A;  1FVI A;  1EY5 A;  4RHR A;  3IRB A;  3R2I A;  3UE0 A;  2IHE A;  2K6A A;  1VQK A;  1NR4 A;  1YVC A;  2WB1 E;  2QKI C;  4CJ0 B;  2EYL A;  3GQB A;  1F9R A;  1RKN A;  2B63 H;  3H15 A;  1BCP C;  1X55 A;  1IYU A;  4ODG A;  3TME A;  4DR2 L;  3OOC A;  1V1O A;  4EQN A;  2UUA L;  1ILP A;  3BVM A;  1MJE A;  4O2D A;  4C3J B;  2K28 A;  5M3F H;  4KN7 C;  3KBG A;  4HSV A;  4LF9 Q;  4HMI A;  2B39 A;  3PIO A;  1F9P A;  3GP7 A;  2KUM A;  4G57 A;  3CCV A;  1A3V A;  2RDF A;  1V9P A;  4CBV A;  1IYV A;  5JEA H;  3BYY B;  2F03 A;  1SND A;  4LF8 Q;  3NUC A;  5JPM C;  4DV1 Q;  5M5W H;  3Q8D A;  2O4X A;  2WFW A;  5M9O A;  2UUB L;  4B3M L;  3DWQ A;  1NNX A;  1A2T A;  1SE8 A;  3OPO A;  1C0A A;  1CSQ A;  2EJF C;  3T4A C;  3M4P A;  1PTO F;  1CZG A;  2H4O A;  3M7G A;  1R4Q B;  2HCC A;  4AYB B;  5M3M B;  4X62 L;  3C46 A;  1HZA A;  4TVA B;  3STB C;  3HOU G;  4FF1 A;  1KNA A;  4IUN A;  1IKL A;  3RZD B;  3HOY G;  1RL2 A;  3S2D B;  5C3E B;  1TWA H;  3IKJ A;  1KDA A;  5IGE A;  4NXM Q;  2I5H A;  3CCU A;  3HS0 C;  3UDI A;  4FXG C;  5JVH 3;  1VQ9 A;  1JT8 A;  4PQX A;  1CM9 A;  1PTO D;  4IUR A;  1QCB D;  4Q0F A;  2L12 A;  1BNZ A;  3JAM i;  1UEB A;  1V1P A;  2XWJ B;  2F3W A;  3GTM B;  1XXG A;  4DR2 Q;  4DUZ Q;  4GLV B;  1B3Q A;  4MN3 A;  3BVZ A;  3PO3 B;  2JA6 H;  4A3K G;  1TR5 A;  4GKJ L;  3J81 i;  4X3U A;  1SE2 A;  4KY6 A;  4A3J H;  1QVC A;  4K5X A;  4QCL A;  1D2B A;  4FP5 D;  1GKH A;  3NTH A;  1IBK L;  3K80 C;  1CHP D;  1E0B A;  1TWG B;  2N49 A;  1A3T A;  1G8Z D;  2F4V L;  2L11 A;  1K0S A;  4DGZ A;  2UUB Q;  4B3M Q;  3P20 A;  1MGS A;  4NPS A;  1EYG A;  2K01 A;  1YNN C;  3K58 A;  2AKW B;  2RHQ B;  4IN3 A;  1HR0 L;  4A3L H;  1PH2 A;  3UDX A;  5COY A;  1BXT A;  2F0M A;  1SYC A;  1RTO A;  1EYA A;  4X62 Q;  1UAP A;  1WCM G;  2PQA B;  4DAY B;  1EL0 A;  3VR5 A;  1B1Z A;  2PI2 E;  1STY A;  1OTC A;  4HR7 B;  3G4S A;  2MGS A;  1PMR A;  2ALY B;  4RGN A;  4POF A;  3I4L A;  1WTV A;  4JI7 L;  4XYO A;  5GQO A;  3PUY A;  4KJN A;  2NZ1 D;  3E3X A;  4GNX C;  1AN8 A;  3R93 A;  5FLX c;  3K7U C;  1I3Q B;  2Q2I A;  4JBJ A;  4R1J A;  2ZXO A;  3Q23 A;  2F0K A;  4BY1 H;  1HTL D;  3I4M B;  1WYD A;  1LAB A;  4RGT A;  2RCF A;  4GKJ Q;  3TP7 A;  1N33 Q;  1HUM A;  1GUN A;  3NQI A;  2Z6K C;  4RFB A;  3F2U A;  1ET9 A;  3FKI G;  3KLR A;  2ZTD A;  4PG3 A;  1CKN B;  3V05 A;  5F2D A;  1NUC A;  3H6M A;  1X9N A;  2NTT A;  4ZYS A;  1HHV A;  2B2Y A;  2F0Q A;  1Z47 A;  3L7Z C;  4Y7N H;  4GLA C;  3S16 B;  5KNC A;  1IBK Q;  2HCI A;  1UE1 A;  4JV5 L;  1SAP A;  3P75 A;  2F4V Q;  3RR5 A;  3URY A;  5M5X H;  3S1N H;  4X3S A;  2FFK B;  1Q8I A;  3M3Y H;  1WTH A;  4ZUJ A;  1S5B D;  3C1E A;  1HR0 Q;  2VZA A;  5IYD H;  4MNO A;  5IP7 G;  4HIO A;  1CK1 A;  2PQA A;  2PZU A;  4A3B B;  1EU3 A;  3CC4 A;  2Q2T A;  1JWS D;  1XMQ L;  3S1Q B;  3I4N H;  4K8J A;  3AB9 A;  3C2P A;  4NMZ A;  4FVM A;  4JBM A;  1U9R A;  3GTO B;  5I6W A;  5LHY 1;  2NN6 H;  2IX3 A;  3NBH B;  1I4X A;  2JA8 H;  3HKZ E;  2EY2 A;  2A6E D;  3G7L A;  4I7A A;  5JOB A;  4DR3 L;  2DGY A;  4JI7 Q;  3KBX A;  1AFP A;  1VQE A;  2C9O A;  1I4Q A;  1TWC H;  4FDB A;  2NWG A;  1AH9 A;  1OXT A;  4DV6 L;  5C44 G;  4A3I G;  1CKM A;  2E2H H;  4LFC L;  1OXV A;  5J3B A;  2BOS A;  1K8M A;  3CP0 A;  4KHZ A;  2Z1C A;  4EX5 A;  4LWC A;  2A19 A;  3BG3 A;  5JPN C;  3NE5 B;  1X32 A;  4GS3 A;  4DPG A;  2PPB C;  4LMQ D;  2F0D A;  5C4J H;  2GA4 B;  2JEA I;  3M7N A;  1EFI D;  3AYH B;  3TN2 A;  3RN5 A;  2FIN B;  3GTK B;  3KF8 B;  1AP0 A;  1EWI A;  3HOV B;  4IQZ A;  5EAY A;  1SBB B;  3SK5 A;  3NXW A;  4TKO B;  2X69 A;  1HA5 A;  4B9X A;  2OT2 A;  1HZC A;  1GOZ A;  4JV5 Q;  2XSC A;  4H44 C;  4L5T A;  1YI2 A;  3S1M H;  2EXZ A;  3SK4 A;  3DM1 A;  1I50 B;  2ES2 A;  1U0L A;  2E2D C;  4F8M A;  3S15 H;  1AE3 A;  5CBA E;  4EQ5 A;  1JCK B;  4A3E H;  5ELB A;  3X3N A;  2DUD A;  4DK3 C;  5T1G A;  4G7Z C;  1NAP A;  1TWH H;  1GUS A;  3H91 A;  1KQS A;  4ME5 A;  1LLR D;  3NBH A;  4XT1 B;  2MNA A;  4BY7 H;  1U4L A;  3DWP A;  4V19 0;  3MVV A;  4LF5 L;  1DYQ A;  5JAV A;  5C6A A;  3CC7 A;  1NJI C;  1KIX A;  1TY2 A;  4DR3 Q;  5I4D A;  1FL0 A;  4JBW A;  3OW7 A;  3G6J B;  2NVQ H;  4DV6 Q;  1R4P B;  1KNE A;  4AIM A;  1AEX A;  1EOT A;  1B9M A;  3T1Y L;  4LFC Q;  1O78 A;  3N6R A;  3ERS X;  1WTP A;  2E5L L;  4R4Q A;  3MFG A;  2MP1 A;  5FLX L;  2K7V A;  4IAL A;  1IHZ A;  5FLM G;  2PW7 A;  2JK8 A;  4Z9C B;  5D3I B;  1KRT A;  5IIF A;  3S9W A;  3D3R A;  5KYI A;  3KF8 A;  1MD2 D;  2HQL A;  1WD0 A;  4KHP L;  3CXC A;  1VMC A;  4CDC C;  4L5Q A;  1KXL A;  2VQF L;  2YU9 B;  2HD3 A;  3GTP H;  5I6Y A;  4PMB A;  4HJ8 A;  1NMF A;  3K81 C;  4H0L C;  1ENA A;  3OSO A;  2EPB A;  2RVL A;  2EY6 A;  3CQZ B;  1CT1 D;  2OQK A;  3W3A A;  4JYA L;  1STN A;  4OL7 A;  1EIH A;  3EQL C;  4PZ6 A;  2JA5 H;  2MFI A;  3VR2 A;  1CQV A;  1YJW A;  3HRZ C;  3HOY B;  1P16 A;  4EVO A;  2OEO A;  3HZX A;  4X3K A;  1TKW B;  4LF5 Q;  4A3L G;  3AFQ A;  4HSP A;  2NVX B;  5E4W C;  1CKO A;  2C35 B;  1H95 A;  5KEE A;  4HID A;  2X6G A;  3EN2 A;  2LSS A;  1Q81 C;  1FNW A;  5ELE A;  3T16 A;  5DM7 3;  4BA1 I;  3T1Y Q;  3I91 A;  3VYS A;  5IY0 A;  3PF4 A;  3H0G H;  1CQF A;  2OXP A;  1C4Q A;  1ENF A;  3TS0 A;  2R61 A;  1OXX K;  3T53 B;  2BDN A;  4H13 C;  2NYZ D;  3V96 A;  5FK9 C;  1GO3 E;  3BVG A;  1LT5 D;  2E74 C;  1N34 L;  3LWU A;  5ELF A;  1S3O A;  2JYO A;  4KHP Q;  5IT9 E;  1JOK A;  1ESR A;  1F2Y A;  3KLW A;  1PYW D;  2WII B;  2VQF Q;  4LFA L;  3M85 A;  4BY1 G;  1KAA A;  1EIY B;  4CKC A;  4JOI C;  3D8G A;  3I55 A;  1J9O A;  4IPH A;  3TP6 A;  3FPP A;  4JI5 L;  2OQ0 A;  4QUC A;  3T51 B;  2UU9 L;  5CC4 A;  4JYA Q;  1PH9 A;  1QNU A;  3SVM A;  1WOC A;  4ME3 A;  2EYF A;  4P73 A;  2D5D A;  2ZTE A;  2UXD L;  4IZ8 A;  1EY8 A;  2B2W C;  2M00 A;  1NCV A;  1WCM B;  3U50 C;  3RMH A;  1BBU A;  1PA6 A;  2TMP A;  3S1R B;  1GXD C;  1NMG A;  4R9W A;  1X3E A;  4BBR B;  4OIK A;  2R92 H;  2A6H D;  4OEL B;  4UY8 C;  2KJX A;  3CPW A;  1IL8 A;  2E2J B;  1ZYR C;  4A3G H;  1X54 A;  3IAY A;  1ZKO A;  2K14 A;  1VF7 A;  2B3G A;  4RAU C;  4C1N K;  3J80 L;  1LO5 D;  1L1O A;  2NN6 G;  3TRZ A;  2JA8 G;  3K7A H;  1SJH D;  2F4I A;  3NBI A;  1DOK A;  3FKI B;  1VQ6 A;  3I70 A;  2NVY H;  1ROD A;  1L0W A;  1D5Z C;  4HIK A;  2VUM H;  4CHT B;  1IW7 C;  1KD1 C;  1VQL A;  4DV4 L;  4LFA Q;  1QOH A;  4QB4 A;  4OXP A;  1M4V A;  5DNF A;  4GOP C;  1LYL A;  1XTD A;  2B8G A;  4C2M H;  3KOJ A;  2ZM6 Q;  3GTL B;  4JI5 Q;  2HIV A;  2UU9 Q;  1TQO A;  2CW0 C;  3GTG H;  1GUG A;  4EQP A;  4PMW A;  1W2B A;  2UXD Q;  2HDM A;  4IFD H;  1SFO H;  2JXM B;  3TP8 A;  2Z4H A;  1C48 A;  4EQO A;  2K03 A;  1I4P A;  2ICE C;  4RGM A;  4QIW E;  1LV9 A;  3A0J A;  4HTH A;  4KI0 A;  2PW5 A;  5HUR A;  2PMZ E;  2L55 A;  2B2V A;  2ZJP A;  3GDE A;  2F0J A;  5EQ0 A;  1XX8 A;  1BKB A;  3AFP A;  3GD7 A;  2IX1 A;  4A3C G;  1JOQ A;  4LFB L;  2NUC A;  2XTI A;  4RHS A;  4LJZ C;  4ZUI A;  4P2C B;  5EGT A;  4JI1 Q;  5C44 B;  2K5D A;  4A3I B;  3ER0 A;  3VR3 A;  2VY3 A;  2O5J C;  4HAE A;  1A63 A;  1Q8K A;  3E0J A;  3HOW H;  2FMM A;  2F0I A;  1ONL A;  1JIC A;  2JN4 A;  3Q22 A;  2B63 B;  2V1C C;  1SXT A;  4IPC A;  4DV4 Q;  1ILQ A;  3RLO A;  1TS5 A;  3VDY A;  3MXP A;  5M3F B;  2A69 D;  3PUW A;  4IO9 A;  1ICF B;  3F8T A;  1PFN A;  2D0P A;  2CWA A;  1K9M C;  3AQQ A;  3KJO A;  3E5S A;  1Y1V H;  3VA7 A;  1E3P A;  2AWN A;  1LTA D;  5D65 A;  3S17 H;  2K5Q A;  1JJG A;  2F0O A;  5M5W B;  2KCN A;  4QY7 A;  1MJC A;  1SJE D;  1PVO A;  1WI5 A;  2JA5 G;  5CV7 A;  2BE5 D;  1HQM C;  1BBW A;  1PH7 A;  2WAQ E;  2NB0 A;  1JOO A;  4XXE A;  2L9H A;  2CH4 A;  1A3U A;  2B2T C;  1GJX A;  4LFB Q;  4K2L A;  4C1N I;  5CYU A;  4AH6 A;  4FF2 A;  1RIP A;  5GAG C;  2TSS A;  1RDP D;  4YY3 Q;  3I8Z A;  1EQV A;  1A8V A;  4IUV A;  1TWA B;  2DN8 A;  1LTI D;  2MJ8 A;  1PRT F;  4ZKC B;  2F0V A;  3OWF A;  2KED A;  5JJL A;  3TSS A;  2YTY A;  3DWA A;  5LMN W;  3NEM A;  2RDH A;  3H0G G;  4CKE A;  1G6Z A;  3CME A;  3QO2 A;  5D3D A;  5M5Y H;  4V0B A;  1FNU A;  2ICI A;  1PRT D;  4XYQ A;  4A3J B;  2LKV A;  1FR3 A;  1TS4 A;  1E2V A;  2IWH A;  4K5V A;  3KFU A;  3DM3 A;  2YTX A;  2Z9H A;  2VB2 X;  3NQT A;  3A7L A;  1XMO L;  2EY1 A;  4L6T B;  3JAM L;  2K04 A;  1Z6H A;  4J1M A;  5IYB H;  1HQR D;  4GKK L;  2LXJ A;  3MA2 B;  1Y1W H;  4FXK C;  4IOC A;  1LT6 D;  3ERQ A;  2JA7 H;  3J81 L;  2L1B A;  1A2U A;  3BZC A;  5EKL A;  1EEF D;  2AUJ D;  1R9T H;  1RD9 D;  3DEP A;  3RN2 A;  3KUP A;  3LGJ A;  1EYD A;  2UUA Q;  4A3M H;  4MZ9 A;  4GNX B;  4RGO S;  1PTO H;  3L2P A;  1KL9 A;  1YEZ A;  3T1H L;  1T5X D;  2B8F A;  2ZTC A;  4U67 3;  3I72 A;  4QL5 A;  1DZ1 A;  4IUQ A;  1EY6 A;  3R8B A;  5C5M A;  1PTO C;  2RCN A;  4DR1 L;  5IP9 H;  3OWE B;  4R4O A;  1UE5 A;  1QNK A;  4AYB E;  3OYY A;  4POG A;  1VQF A;  5AFW A;  1T9H A;  5E1F A;  4BY1 B;  3KYH C;  4A3D G;  3DEO A;  1HZ9 A;  1KAW A;  4KD3 A;  2AMC B;  4ZK9 B;  1XPO A;  3K5L A;  2RA4 A;  1JWM D;  1PV4 A;  2SNM A;  1RCV D;  3MFY A;  2ASB A;  2R7Z H;  4IFD I;  3PUV A;  3TZU A;  2VUM G;  1NY4 A;  1XMO Q;  5M3M H;  4ZCK A;  3I73 A;  4Y7N B;  3F2B A;  1KTK A;  1K73 C;  3CHB D;  3NP8 A;  3RZD H;  1YHQ A;  3U9S A;  3KJP A;  2F0P A;  4N9T A;  2O5I C;  2EQS A;  4C3H G;  1XJV A;  4GKK Q;  5M5X B;  1YIT A;  3S1N B;  2IPK D;  4B3S L;  4DUY L;  4WJ3 M;  4BBR G;  3M3Y B;  2XVS A;  4DAP A;  3EA6 A;  5FJ8 H;  4CJ2 C;  4JCV E;  2A73 B;  2J7Z A;  2CQO A;  4IFD G;  3KLS X;  1GHJ A;  1B8A A;  5KIX A;  2LXK A;  3MEF A;  4OWW B;  2MO1 A;  4GNX A;  1HNW L;  4NW2 A;  5IGC A;  1Y8N B;  3GV6 A;  1X56 A;  1HUN A;  1QUQ B;  1F2L A;  4KKS A;  5BR8 L;  3T1H Q;  1N36 L;  2JA8 B;  1BUV T;  2XN9 C;  3T13 A;  1HFG A;  4G7O C;  4K2K A;  2Z6K A;  2ATW A;  1KDC A;  4DR1 Q;  2BH2 A;  3OIQ A;  2WIN B;  2E2H B;  3CCJ A;  4UAI A;  1TWG H;  1RHP A;  4X65 L;  1NBW A;  1NE3 A;  5KNB A;  2JA9 A;  3HOW G;  4IOA A;  2CVR A;  1FJG L;  5C4J B;  1PH6 A;  1M8A A;  3I56 A;  3SK8 A;  2B2Y C;  4A4I A;  4DAV A;  2PCF B;  3S14 H;  3R3O A;  4OO1 H;  1AW7 A;  1J8I A;  1NR2 A;  2L15 A;  4E6I A;  1DM0 B;  2JJQ A;  2Y0S G;  4DAY A;  2HT1 A;  4I65 A;  4IJL A;  4O42 A;  1HH2 P;  4MIU A;  1SNP A;  3I4O A;  3SE0 A;  3S1M B;  2JSO A;  5C4Z A;  5FO9 B;  2OCE A;  3PCO B;  4F7X A;  2RSN A;  4LF6 L;  3S15 B;  5C3W A;  2MUY A;  3IFT A;  4B3S Q;  4DUY Q;  3AU7 A;  4R4C A;  1SDF A;  4DR7 L;  1X65 A;  3VR4 A;  4HJ7 A;  1Y1V G;  2KEE A;  3QOL A;  3FRP B;  1TWH B;  1STE A;  2OF1 A;  1RF2 D;  5JJZ A;  2F0H A;  1I6V C;  4OGQ C;  4CDE C;  1HNW Q;  1MIU A;  3I4M H;  1QUQ A;  5FKA C;  1CKN A;  1VQD A;  1AZP A;  5BR8 Q;  1N36 Q;  4YCV A;  1S40 A;  2ZJR A;  2A6E C;  2B63 G;  1ESF A;  4BXX H;  4JC0 A;  3QG1 A;  2WKC A;  2M9V A;  3B6Y A;  3EJI A;  2NVQ B;  4K8I A;  3T56 B;  1C9O A;  1YZ6 A;  3J7A 5;  3GTJ H;  4RA8 A;  1HJP A;  1EOV A;  4KY5 A;  4X65 Q;  5M3F G;  2I0Q A;  1S5D D;  3J7A F;  1VQO A;  1FJG Q;  3FDT A;  4K14 A;  3H94 A;  1ICW A;  2WB1 G;  1TWF H;  3FPU B;  1K83 H;  3UDF A;  1F2Z A;  4NKL A;  4A93 H;  3FP9 A;  1SEB D;  4R8N A;  4XQQ A;  2BA1 A;  3VYT A;  1A6X A;  5JEA G;  2EYH A;  1Q46 A;  2XWB B;  4JI6 L;  4EGV A;  3AEV A;  4TSS A;  4A3B H;  1PFS A;  1O7Z A;  2DNE A;  3GTP B;  3HOZ H;  4RMF A;  4LW1 A;  5KYL A;  1XNQ L;  1XMQ Q;  5GAH C;  1IZ6 A;  1STB A;  3E9H A;  3HFZ B;  1K0R A;  1TS3 A;  3BZD B;  4LF6 Q;  1J6Q A;  3F1Z A;  2JA5 B;  4DV7 L;  4DR7 Q;  1Q7Y C;  1DXM A;  2L4N A;  5GRO A;  5JJK A;  1PHJ A;  1ZEQ X;  1JB7 A;  2QF7 A;  4P74 A;  5C0X H;  1CZW A;  3J80 c;  1I4H A;  1HNZ L;  1TU2 B;  5IYB G;  1L0Y B;  1ASZ A;  1Y8O B;  5BN3 A;  1TXY A;  3CRL C;  1Y1W G;  1ZXT A;  3HGB A;  1UNS A;  2E76 C;  1STA A;  1U4P A;  5A2Q E;  4DXG A;  3RZO H;  1TVX A;  1SMY D;  4I7Z C;  1B50 A;  1Q90 A;  3BU2 A;  3A8J E;  1VQB A;  4PZ7 A;  3L0O A;  1WVL A;  4ZLT F;  4A3M G;  2JA6 G;  2B2U C;  2ENB A;  3MTS A;  3H0G B;  3H3V H;  2M2L A;  2KBN A;  2LY7 A;  3KF6 B;  2RHS B;  4A3J G;  5DEH A;  1HXY D;  1VQH A;  2FJ2 A;  2IY5 B;  3H3V C;  1VQI A;  1VCI A;  3W1B A;  2XGT A;  2VB3 X;  3QIA A;  4YCW A;  5IP9 G;  1EWH A;  5H1S E;  4JI6 Q;  4IFD J;  4R8I A;  1LT3 D;  1DOM A;  5CV9 A;  5C4H A;  1XNQ Q;  1O80 A;  1MSH A;  4G4K A;  3NEL A;  1VQP A;  1VF5 C;  5DAU A;  3S2H H;  4JBK A;  1H9K A;  4JI4 L;  1FGB D;  1I5F A;  3BYT B;  2R93 H;  3ND9 A;  4DNT B;  2E8G A;  5EPL A;  2R7Z G;  1N9W A;  4DV7 Q;  1YNJ D;  4KN4 C;  1I6H H;  4CJ1 B;  1XPU A;  4S3S A;  1KRS A;  3DHQ A;  4DR5 L;  1HNZ Q;  2D9U A;  2L0C A;  5FO8 B;  1S5C D;  5BN4 A;  2E5L Q;  4LF4 L;  2F3V A;  2MHV A;  5EJW A;  2K50 A;  4YHH L;  1CSP A;  2BH8 A;  2H1E A;  3NPP A;  4NP5 A;  1M1K C;  4A3F H;  1N8R C;  4A3G B;  2YTV A;  1D7Q A;  1EY7 A;  4WJW A;  1LTG D;  1SE4 A;  1KDB A;  1VMP A;  3KF6 A;  1EEI D;  3CQZ H;  1E24 A;  3R2T A;  1XTC D;  1JB3 A;  4A3D B;  1Z7T A;  3M9B A;  4XQJ A;  3D31 A;  4JOI A;  3PGZ A;  4U68 A;  1MSG A;  2IL8 A;  5IWA L;  4GOP B;  5J39 A;  1FNV A;  1ENC A;  2NVY B;  1SRU A;  1XNR L;  2VNU D;  2WP8 J;  1O7Y A;  2I07 B;  4M1U B;  2VUM B;  4TRD A;  1A15 A;  4FYD A;  1VQ4 A;  3HOU H;  1E22 A;  1Q1B A;  4HCE A;  3HOY H;  1T5E A;  4UP9 A;  1QB5 D;  4C2M B;  1X6O A;  4C3H B;  3ULP A;  2NN6 I;  3ULL A;  2BA0 A;  3CD6 A;  2PO4 A;  1QJO A;  4JI4 Q;  2DJG C;  2DJF C;  2G5D A;  3GTG B;  4ZAI A;  2AQ3 B;  5IYD G;  2XRQ D;  1BF4 A;  4HJA A;  3K57 A;  3WWV A;  1IKM A;  1SFO B;  3BZK A;  1EY9 A;  3SGI A;  1IBM L;  4G7H C;  4DR5 Q;  3I4N G;  4GN4 B;  2ZXP A;  1D8L A;  4N9P A;  3CPF A;  4A3K H;  4UDU C;  5C5L A;  1B70 B;  1K8G A;  4LF4 Q;  4DKA C;  4CGY B;  2VW9 A;  4YHH Q;  1ASY A;  1OXS C;  2VXW A;  4DK1 A;  1N34 Q;  3TQY A;  2A6H C;  1EWC A;  3CRK C;  2K52 A;  1V43 A;  4N8F A;  5JEA J;  4J6H A;  1TT2 A;  3P1H A;  2F0U A;  1L1O C;  3ONA B;  3QB3 A;  3CU7 A;  1H9S B;  2KCC A;  4KKU A;  1SYD A;  2EZV A;  2F0T A;  4XDX A;  4QMG A;  3GTQ H;  4KV6 A;  3MXN B;  3HKZ G;  3HOW B;  1YJN A;  4GOP A;  1TS2 A;  1V1Q A;  2PZW A;  2IX0 A;  2QW7 A;  3KDF B;  3JAM c;  5IWA Q;  1VQC A;  4LUZ A;  1YBY A;  4IPD A;  5I2Y A;  5C4X H;  1XNR Q;  1B44 D;  1VS0 A;  4F87 A;  2Y0S B;  2FMC A;  3J7Z C;  5CBE E;  4Q5V A;  4GN5 A;  2IT1 A;  1Q86 C;  3J81 c;  2I5L X;  5NUC A;  2QEX A;  4OWT B;  3RLF A;  1QVG A;  3HOX H;  3NTI A;  2HHH L;  3S1R H;  1PLF A;  2GVB A;  2AHO B;  2DNC A;  2E75 C;  2XRS D;  4A3E G;  1GHK A;  1E2Z A;  3TEH B;  2QCP X;  4A93 G;  3LX0 A;  2CFM A;  2E2J H;  1Y1V B;  2XIW A;  2IHF A;  2NTS A;  4N8X 1;  3HOZ G;  4L5S A;  4F88 A;  3S17 B;  4HMJ A;  2K32 A;  1IBM Q;  1EQT A;  4J15 A;  4NB3 A;  2B2V C;  2EDG A;  4DNR B;  4BY7 G;  1JC7 A;  2N8N A;  1BCP B;  3NHH A;  3PV0 A;  3QR8 A;  4MTN A;  3HP3 A;  2R6G A;  1WJJ A;  2WV6 D;  3D6W A;  3W1G A;  3FKI H;  1GM5 A;  1JMC A;  1PZK D;  1STG A;  3D4R A;  4APV A;  3BDL A;  1OXU A;  5L37 A;  1H9S A;  3D4W A;  1SNQ A;  3H3V I;  3BJU A;  2G9H D;  4IPG A;  5E7N A;  2A68 D;  1K8A C;  2SOB A;  3PF5 A;  2Q8T A;  1CA6 A;  4FO2 A;  4R4I A;  3U9O A;  5T1I A;  3GTL H;  2SNS A;  3KDF A;  5TSS A;  4LF9 L;  4O1N A;  2I46 A;  1UUP A;  1LTR D;  2WB1 B;  3FEW X;  3GO5 A;  4B08 A;  4JI2 L;  1SRO A;  1HR0 W;  3NTK A;  2VQE L;  2KEN A;  4CDD C;  2HUG A;  1BCP F;  4B3T L;  1VQ8 A;  5HGT A;  2QDB A;  4LF8 L;  1E1T A;  4R4T A;  2ZJQ A;  1BBX C;  2MQH A;  1C8C A;  3C1F A;  1EY4 A;  3W2D A;  1VQM A;  2ZXR A;  3IFD A;  5CR3 A;  5M5Y B;  2HHH Q;  2Q2U A;  2A5H A;  1EUJ A;  2A69 C;  2QGQ A;  2A8V A;  1W6J A;  3H09 A;  1TII D;  1WTQ A;  3SXH A;  4BBS H;  2GN5 A;  2DY7 A;  4IJH A;  1EZ8 A;  1II3 A;  1BCP D;  2EJM A;  4OHJ A;  1VQN A;  3Q0A A;  3UE1 A;  2E2I H;  2B29 A;  3BDO A;  5CV6 A;  5C44 H;  2RKS A;  4A3I H;  5IT9 L;  2B2T A;  5I9O A;  1RTN A;  5IOC A;  2CH4 W;  4BA2 I;  3Q6S A;  5A35 A;  1Y1W B;  2C5C A;  4HN7 A;  2R93 G;  4L8J A;  1E2W A;  1UWV A;  1I4G A;  2K05 A;  2BE5 C;  4KD4 A;  3PO2 H;  4XT3 B;  1SSO A;  5EBC A;  5KND A;  2RBM A;  1R9T B;  1G6P A;  2NVT H;  4DUZ L;  1IXR A;  1V1P B;  4YWK A;  4KK7 A;  5K5P A;  2K33 A;  3JC6 6;  4A3M B;  1K28 A;  2JA6 B;  1X3F A;  1EU4 A;  1MI2 A;  3A74 A;  1M90 C;  2RQX A;  3SR1 A;  4WOR A;  1PTO B;  4M8A A;  1SYE A;  3M4O H;  1JE5 A;  3IL8 A;  1SNM A;  4JI2 Q;  4A3F G;  2VQE Q;  1IL2 A;  3M4Q A;  5ELD A;  3STB D;  4B3T Q;  1VQJ A;  2F0F A;  1YNX A;  4KKT A;  1S4Z A;  4CDF C;  4C3I H;  4OIJ A;  5IE8 A;  1YIJ A;  2I5M X;  1EYC A;  1BVS A;  2K5W A;  1PXU A;  3A8I E;  4FF4 A;  1PRT C;  2PZT A;  2SDF A;  1WD1 A;  2Q8I B;  3D0F A;  4UHV A;  2R7Z B;  2KEC A;  1S5E D;  3E6Z X;  3PIP 3;  1GUO A;  1X3Q A;  1QWY A;  1CFM A;  4C3J H;  4P75 A;  4LUO A;  3EIV A;  5I2X A;  5CV4 A;  2ID0 A;  1KLG D;  1SYF A;  5FLM H;  2R92 G;  2MPM A;  1Y14 B;  4YIJ A;  1DGS A;  3LNN A;  1G2T A;  1PZI D;  3S24 A;  4ALP A;  1EFW A;  1SE3 A;  4JPB W;  5HY6 A;  1LUZ A;  4A3G G;  3MAQ A;  1LTS D;  1G2S A;  2D62 A;  3MXU A;  3PSI A;  4XQN A;  3KLS A;  1B4O A;  1ML0 D;  1I94 L;  1BQQ T;  3G71 A;  1B53 A;  4J8Q A;  5GAD C;  1Y69 U;  3K8A A;  3OMC A;  2HIX A;  2R7D A;  4A75 A;  4OON A;  1N33 L;  3VA5 A;  2K4K A;  3A56 A;  1YNN D;  2RSO A;  2QDL A;  4NXN L;  4Y52 H;  3WDN A;  2Q8R E;  3TBI B;  4LNQ A;  3UDG A;  2F0L A;  5C3X A;  4NDX A;  3SEB A;  5FLX E;  3S2D H;  4YWM A;  3K59 A;  2RDG A;  5C3E H;  1JOR A;  1LTB D;  2R3Z A;  3X3M A;  3RNU A;  2X6L A;  2CWP A;  3S14 B;  4PV1 C;  1I4R A;  4FF3 A;  2R7F A;  5C4X G;  1O7I A;  3PIP A;  3HKS A;  3WOE A;  5C0X J;  2JE6 I;  2KA7 A;  3GTM H;  1JQY D;  1Q1E A;  4QGU A;  3D4D A;  2KQ3 A;  1F9Q A;  1JJ2 A;  3K0Y A;  1CHQ D;  3CCR A;  3I4N B;  3PO3 H;  5JVG 3;  3HOX G;  3F2C A;  3CF5 A;  2L5T A;  2CHB D;  4DN4 M;  5KGU A;  5ELC A;  1KLU D;  4WJ4 A;  2F0N A;  3ICE A;  1MHW C;  1TWC B;  4JI3 L;  2OWO A;  3QJY A;  2K5H A;  1JR0 D;  4RCO A;  5IYC H;  2PI2 A;  2P5Z X;  4LK1 C;  1HZB A;  1SLJ A;  2WKD A;  1I94 Q;  5K36 H;  2D0O A;  4OEM B;  1E7Z A;  1AZQ A;  3ZYY X;  2DY8 A;  1EZ6 A;  2EOT A;  4QUF A;  2LFN A;  5EKK A;  4DAM A;  1BR9 A;  1LTT D;  3HKZ B;  2GVA A;  3NWT A;  4NXN Q;  2EYJ A;  3HG9 A;  1LM0 A;  2CQA A;  2KHI A;  1Y8P B;  2F0W A;  1SMX A;  1XWE A;  4PMC A;  1F77 A;  1J5E L;  3MHB A;  2HDL A;  2PQE A;  5LMN L;  5CMD A;  1S72 A;  1L0X B;  3GTJ B;  1HNX L;  1TY0 A;  2VS1 A;  3I2Z A;  1VQA A;  1PH4 A;  2D2C C;  1W3S A;  3NWS A;  4UP7 A;  3DUZ A;  1TWF B;  2IJ0 A;  2Z8L A;  4A3E B;  1BO0 A;  1K83 B;  1WTO A;  4RKL A;  1O7L A;  2PYK A;  1Q12 A;  4A93 B;  5FOB B;  4FXD A;  2BDO A;  3QOJ A;  2YV5 A;  4DR4 L;  1DCZ A;  1FD7 D;  1I3Q H;  3FVQ A;  3HOZ B;  4DV0 L;  1PDQ A;  3NSW A;  4A76 A;  5ELO A;  3E0E A;  1K3B C;  1G91 A;  4BY7 B;  2F0S A;  2KHS A;  3A7A B;  4KTA A;  1SN8 A;  4BBS G;  1Q3L A;  2F1M A;  4HIM A;  1AE2 A;  1BOS A;  1HFN A;  1FYC A;  1N32 L;  1B7Y B;  5J22 A;  1HTP A;  4JI3 Q;  5COR A;  4IUU A;  1B9N A;  4C56 C;  4JG2 A;  3S16 H;  4AQY L;  1PZJ D;  4DK0 A;  1OO9 B;  3LWE A;  3RUZ A;  3N52 A;  1VQ7 A;  3NK9 A;  2AWO A;  1VQG A;  4FNF A;  5E4X A;  4X64 L;  4KMU C;  5EKI A;  1QZG A;  2A74 C;  4GN3 B;  3RZO B;  2WAQ G;  1G51 A;  2K5N A;  3CW2 C;  3PO2 G;  1PH3 A;  4JVZ A;  4CKB A;  2K1B A;  1DJR D;  4JK1 C;  1HRJ A;  3EFX D;  3CMA A;  4BWG B;  1W6K A;  1J5E Q;  2AQ2 B;  1P8L A;  3RD4 A;  4YCU A;  2UXB L;  5LMN Q;  1WFQ A;  4ABN A;  3S1Q H;  3J80 E;  1LTL A;  2JP1 A;  1XYI A;  1HNX Q;  4B3R L;  1E1O A;  3I3C A;  4UP8 A;  3FMC A;  2YYZ A;  3CKI B;  1PFM A;  3TDQ A;  5AJ3 L;  5GAE C;  3GTO H;  1SNC A;  4XIG S;  3O13 A;  3PUZ A;  4MTK A;  1UE6 A;  1K8O A;  1HPC A;  5LL6 X;  2HQE A;  3VR6 A;  1IBL L;  1D1K A;  4A3C H;  1SNO A;  4DR4 Q;  4DV2 L;  3DXJ C;  2K5V A;  1CI3 M;  1GVP A;  1L2F A;  3SDZ A;  4C3I G;  4QQB X;  2UUC L;  2EYO A;  4DV0 Q;  2F52 A;  1DD2 A;  3C3L A;  4WFN 3;  3G6E A;  2A1A A;  1VQ5 A;  1V8Q A;  3S2H B;  3ND8 A;  2JA7 G;  4GZY C;  1QE6 A;  3CC2 A;  2R93 B;  5IGB A;  2IW3 A;  5IGF A;  3BDC A;  1I6H B;  2N3S A;  4RCN A;  3GTK H;  4ZQ3 A;  1N32 Q;  3HOV H;  1VDZ A;  2FHT A;  1STH A;  5CV5 A;  1Z9F A;  4AQY Q;  3ULJ A;  4C3J G;  3VYR A;  2Z0S A;  4IUP A;  3K5M A;  4BS9 A;  4X64 Q;  4OX9 L;  2KHJ A;  3G48 A;  4HJ9 A;  3DMU A;  2B2U A;  3ITP A;  1I50 H;  3U4Z A;  3KK7 A;  1A0I A;  4JI0 L;  1EQQ A;  5CV8 A;  4OWX B;  2EXD A;  3MEH A;  3MWY W;  1MKH A;  2EVB A;  2G9D A;  4A3F B;  1GD7 A;  3J81 j;  1SMY C;  4PNY A;  4RWS C;  2EY5 A;  2F0E A;  4H7B A;  5J1Z A;  3PUX A;  1PH1 A;  4DR6 L;  2RF4 A;  2Z6B A;  4X66 L;  3OTO L;  1LT4 D;  2UXB Q;  3ERO A;  4WRD A;  2CCZ A;  4ZKB B;  1BDO A;  1GUT A;  4B3R Q;  1GUW A;  3M4Y A;  1D6E C;  5IGD A;  5AJ3 Q;  4RH6 A;  2EYP A;  2EE1 A;  1WTR A;  3OHX C;  4KLK A;  5ISR A;  4DNI A;  4B9W A;  5D14 A;  4ZRZ A;  1D1I A;  2VL6 A;  4AYB G;  5M3M G;  1IBL Q;  2J4X A;  1PYS B;  4DV2 Q;  4HED A;  1QVF A;  2JEB I;  3HOU B;  1LAC A;  4L5R C;  2UUC Q;  3U58 A;  1YJ9 A;  5C3E G;  2N88 A;  3TZD A;  4LUV A;  1FGU A;  1UE7 A;  5JJI A;  4LF7 L;  1ET6 A;  1JWU D;  1H9R A;  5FJ8 G;  2R92 B;  3D6C A;  1RJT A;  2O2L D;  2AUK A;  3CAM A;  3WOF A;  1D5M C;  1DON A;  1YNJ C;  2N78 A;  5G3L F;  1YHA A;  2YU9 H;  3PO3 G;  3A5Z B;  1PH8 A;  3A54 A;  5FO7 B;  4A3K B;  3NEN A;  4OX9 Q;  2OTJ A;  2WAC A;  2UXC L;  3TS2 A;  3CCS A;  3K7A B;  1Q82 C;  1G29 1;  4JI0 Q;  1L1O B;  4OO1 I;  5I9P A;  1H9M A;  3CCQ A;  1PH5 A;  4DF7 A;  5IYC G;  1QIL A;  5G3L D;  1HA6 A;  5K36 G;  4PZ8 A;  3VYU A;  3FHW A;  2NZO A;  4DR6 Q;  4X66 Q;  4DV5 L;  3OTO Q;  4LAA A;  1WTX A;  1WTW A;  2B2W A;  2MO0 A;  2ZM6 L;  3GTQ B;  3P7J A;  1C7Y A;  1QG7 A; 
#chains in the Genus database with same CATH homology
 5EPJ A;  4OO1 G;  1D5X C;  1ZYR D;  3SHL A;  2PNR C;  2Z4I A;  4HCS A;  2LMC B;  5C4X B;  2EYM A;  4MHE A;  2ZT9 C;  5EBD A;  2F0G A;  3K5O A;  3HOX B;  5LL6 S;  3BS1 A;  3K6O A;  1IW7 D;  3JAM E;  4X3T A;  3HEJ A;  5KRU A;  1NSN S;  1EIG A;  4QIW B;  4IUT A;  1HCZ A;  2PMZ B;  1U4M A;  3J81 E;  3MC0 B;  2XNA C;  3A8K E;  4K6L A;  5CGK A;  2CW0 D;  2AQ1 B;  3V2T A;  1UEA B;  4DFA A;  4ID6 A;  4ULL A;  1DOL A;  1JE4 A;  3L9A X;  4L63 B;  4K5W A;  3TP5 A;  3K5N A;  3A55 A;  3UI2 A;  4KJO A;  2J0T D;  5A2Q L;  4DU9 A;  3PMF A;  2BCO A;  5E3F A;  5C0X I;  5IOD A;  2NBF A;  1KAB A;  3J7A V;  1F2M A;  4DXF A;  1H9J A;  3GV3 A;  1EY0 A;  1SYG A;  4BBS B;  2EJG C;  2QEJ C;  5C0X G;  2E2I B;  4ILW A;  4QF4 A;  1PFB A;  4KHV A;  3MXN A;  3QWN A;  1B2T A;  4KY7 A;  4XTC S;  2WAQ B;  3I90 A;  3PIO 3;  1CTM A;  3MZ5 A;  5DM6 3;  3PO2 B;  2KOL A;  2KVM A;  1U4R A;  2V4D A;  1S5F D;  2NVT B;  2SEB D;  4K6D A;  3MXG A;  1F9S A;  3EVQ A;  5IGG A;  1SYB A;  3OMG A;  3OIP A;  2A68 C;  3J7Y W;  2QIL A;  3M4O B;  4TQU S;  1CA5 A;  2N55 A;  4RKB A;  2LS0 1;  1PRT B;  4C3I B;  3AMU A;  1B3A A;  1X3P A;  3L3O C;  5BN5 A;  3Q24 A;  3SK6 A;  5EPK A;  4DA2 A;  1MBY A;  2JA7 B;  1EY5 A;  4RHR A;  3R2I A;  2K6A A;  1NR4 A;  4CJ0 B;  2QKI C;  2EYL A;  3GQB A;  1F9R A;  1RKN A;  1BCP C;  1IYU A;  4ODG A;  3TME A;  3OOC A;  1V1O A;  4EQN A;  1ILP A;  3BVM A;  4C3J B;  2K28 A;  4KN7 C;  3KBG A;  4HSV A;  4HMI A;  2B39 A;  1F9P A;  3GP7 A;  2KUM A;  4G57 A;  1A3V A;  2RDF A;  4CBV A;  1IYV A;  5JEA H;  3BYY B;  2F03 A;  1SND A;  3NUC A;  5JPM C;  2O4X A;  5M9O A;  3DWQ A;  3OPO A;  1A2T A;  2EJF C;  3T4A C;  1PTO F;  1CZG A;  2H4O A;  3M7G A;  1R4Q B;  2HCC A;  4AYB B;  5M3M B;  3C46 A;  4FF1 A;  1KNA A;  4IUN A;  1IKL A;  3RZD B;  3S2D B;  5C3E B;  3IKJ A;  1KDA A;  5IGE A;  3HS0 C;  4FXG C;  5JVH 3;  4PQX A;  1CM9 A;  1PTO D;  4IUR A;  1QCB D;  4Q0F A;  2L12 A;  1BNZ A;  1V1P A;  2XWJ B;  2F3W A;  3GTM B;  1XXG A;  4MN3 A;  3PO3 B;  3BVZ A;  1TR5 A;  4X3U A;  1SE2 A;  4KY6 A;  4K5X A;  4QCL A;  1D2B A;  4FP5 D;  3NTH A;  1CHP D;  1E0B A;  1TWG B;  1A3T A;  1G8Z D;  2L11 A;  4DGZ A;  3P20 A;  1MGS A;  2K01 A;  1YNN C;  3K58 A;  4IN3 A;  5COY A;  1BXT A;  2F0M A;  1SYC A;  1RTO A;  1EYA A;  1UAP A;  1EL0 A;  3VR5 A;  1B1Z A;  1STY A;  4HR7 B;  2MGS A;  1PMR A;  4RGN A;  3I4L A;  1WTV A;  4XYO A;  3PUY A;  4KJN A;  2NZ1 D;  1AN8 A;  3R93 A;  1I3Q B;  2ZXO A;  3Q23 A;  2F0K A;  1HTL D;  3I4M B;  1LAB A;  4RGT A;  3TP7 A;  1HUM A;  1GUN A;  3NQI A;  4RFB A;  3F2U A;  1ET9 A;  3KLR A;  3V05 A;  5F2D A;  1NUC A;  3H6M A;  2NTT A;  4ZYS A;  1HHV A;  2B2Y A;  2F0Q A;  1Z47 A;  3L7Z C;  3S16 B;  5KNC A;  2HCI A;  1SAP A;  3P75 A;  3URY A;  4X3S A;  2FFK B;  1Q8I A;  4ZUJ A;  1S5B D;  3C1E A;  1CK1 A;  2PZU A;  4A3B B;  1EU3 A;  1JWS D;  3S1Q B;  4K8J A;  3AB9 A;  3C2P A;  4NMZ A;  4FVM A;  1U9R A;  3GTO B;  5I6W A;  5LHY 1;  2NN6 H;  2IX3 A;  1I4X A;  2EY2 A;  2A6E D;  3G7L A;  5JOB A;  3KBX A;  1AFP A;  2C9O A;  1I4Q A;  2NWG A;  1OXT A;  1OXV A;  2BOS A;  1K8M A;  4KHZ A;  2Z1C A;  3BG3 A;  5JPN C;  3NE5 B;  1X32 A;  2PPB C;  4LMQ D;  2F0D A;  2GA4 B;  2JEA I;  3M7N A;  1EFI D;  3TN2 A;  2FIN B;  3GTK B;  1AP0 A;  3HOV B;  4IQZ A;  1SBB B;  3SK5 A;  3NXW A;  4TKO B;  2X69 A;  1HA5 A;  4B9X A;  2OT2 A;  1GOZ A;  2XSC A;  4H44 C;  2EXZ A;  3SK4 A;  3DM1 A;  1I50 B;  2E2D C;  4F8M A;  5CBA E;  1JCK B;  5ELB A;  3X3N A;  5T1G A;  4G7Z C;  1NAP A;  1GUS A;  3H91 A;  4ME5 A;  1LLR D;  3NBH A;  4XT1 B;  1U4L A;  3DWP A;  4V19 0;  3MVV A;  1DYQ A;  5JAV A;  5C6A A;  1TY2 A;  5I4D A;  4JBW A;  3OW7 A;  3G6J B;  1R4P B;  1KNE A;  1AEX A;  1EOT A;  1B9M A;  1O78 A;  3N6R A;  1WTP A;  3MFG A;  2MP1 A;  5FLX L;  2K7V A;  4IAL A;  1IHZ A;  2PW7 A;  4Z9C B;  5D3I B;  5IIF A;  3S9W A;  3D3R A;  5KYI A;  3KF8 A;  1MD2 D;  1WD0 A;  1VMC A;  2YU9 B;  5I6Y A;  4PMB A;  4H0L C;  1ENA A;  3OSO A;  2EPB A;  2RVL A;  2EY6 A;  3CQZ B;  1CT1 D;  3W3A A;  1STN A;  4OL7 A;  1EIH A;  3EQL C;  3VR2 A;  1CQV A;  3HRZ C;  3HOY B;  4EVO A;  2OEO A;  3HZX A;  4X3K A;  1TKW B;  4HSP A;  2NVX B;  5E4W C;  5KEE A;  2X6G A;  1FNW A;  5ELE A;  3T16 A;  5DM7 3;  4BA1 I;  3I91 A;  3VYS A;  1CQF A;  2OXP A;  1C4Q A;  1ENF A;  2R61 A;  1OXX K;  3T53 B;  2BDN A;  4H13 C;  2NYZ D;  3V96 A;  5FK9 C;  3BVG A;  1LT5 D;  2E74 C;  3LWU A;  5ELF A;  2JYO A;  5IT9 E;  1JOK A;  1ESR A;  1F2Y A;  1PYW D;  2WII B;  3M85 A;  1KAA A;  4CKC A;  3D8G A;  1J9O A;  3TP6 A;  3FPP A;  4QUC A;  3T51 B;  5CC4 A;  1QNU A;  3SVM A;  2EYF A;  2D5D A;  4IZ8 A;  1EY8 A;  2B2W C;  2M00 A;  1NCV A;  1WCM B;  3RMH A;  2TMP A;  3S1R B;  1GXD C;  4R9W A;  4BBR B;  4OIK A;  2A6H D;  2KJX A;  1IL8 A;  2E2J B;  1ZYR C;  3IAY A;  1ZKO A;  1VF7 A;  4RAU C;  4C1N K;  3J80 L;  1LO5 D;  2NN6 G;  1SJH D;  2F4I A;  3NBI A;  1DOK A;  3FKI B;  3I70 A;  1ROD A;  1D5Z C;  4CHT B;  1IW7 C;  1QOH A;  4QB4 A;  1M4V A;  5DNF A;  2B8G A;  3GTL B;  1TQO A;  2CW0 C;  1GUG A;  4EQP A;  4PMW A;  2HDM A;  4IFD H;  2JXM B;  3TP8 A;  2Z4H A;  1C48 A;  4EQO A;  2K03 A;  1I4P A;  2ICE C;  4RGM A;  1LV9 A;  4HTH A;  4KI0 A;  2PW5 A;  5HUR A;  2L55 A;  2B2V A;  2F0J A;  5EQ0 A;  1XX8 A;  3GD7 A;  2IX1 A;  1JOQ A;  2NUC A;  4RHS A;  4LJZ C;  4ZUI A;  4P2C B;  5EGT A;  5C44 B;  2K5D A;  4A3I B;  3VR3 A;  2O5J C;  4HAE A;  3E0J A;  2FMM A;  2F0I A;  1ONL A;  1JIC A;  3Q22 A;  2B63 B;  1SXT A;  1ILQ A;  1TS5 A;  3MXP A;  5M3F B;  2A69 D;  3PUW A;  1PFN A;  3E5S A;  3VA7 A;  2AWN A;  1LTA D;  5D65 A;  2K5Q A;  2F0O A;  5M5W B;  2KCN A;  1SJE D;  5CV7 A;  2BE5 D;  1HQM C;  2NB0 A;  1JOO A;  4XXE A;  2L9H A;  1A3U A;  2B2T C;  1GJX A;  4K2L A;  4C1N I;  5CYU A;  4FF2 A;  2TSS A;  1RDP D;  3I8Z A;  1EQV A;  4IUV A;  1TWA B;  2DN8 A;  1LTI D;  2MJ8 A;  1PRT F;  4ZKC B;  2F0V A;  3OWF A;  2KED A;  3TSS A;  3DWA A;  2RDH A;  4CKE A;  1G6Z A;  3QO2 A;  5D3D A;  4V0B A;  1FNU A;  2ICI A;  1PRT D;  4XYQ A;  4A3J B;  2LKV A;  1FR3 A;  1TS4 A;  1E2V A;  2IWH A;  4K5V A;  2VB2 X;  3NQT A;  3A7L A;  2EY1 A;  4L6T B;  3JAM L;  2K04 A;  1Z6H A;  4J1M A;  1HQR D;  3MA2 B;  4FXK C;  1LT6 D;  3ERQ A;  3J81 L;  2L1B A;  1A2U A;  5EKL A;  1EEF D;  2AUJ D;  1RD9 D;  3DEP A;  3KUP A;  1EYD A;  4RGO S;  1PTO H;  1T5X D;  2B8F A;  4U67 3;  3I72 A;  1DZ1 A;  4IUQ A;  1EY6 A;  3R8B A;  5C5M A;  1PTO C;  3OWE B;  1QNK A;  5AFW A;  5E1F A;  4BY1 B;  3DEO A;  4KD3 A;  4ZK9 B;  3K5L A;  2RA4 A;  1JWM D;  2SNM A;  1RCV D;  3MFY A;  4IFD I;  3PUV A;  3TZU A;  3I73 A;  4Y7N B;  1KTK A;  3CHB D;  3NP8 A;  3U9S A;  2F0P A;  4N9T A;  2O5I C;  4C3H G;  5M5X B;  3S1N B;  2IPK D;  3M3Y B;  2XVS A;  4DAP A;  3EA6 A;  4CJ2 C;  2A73 B;  2J7Z A;  4IFD G;  3KLS X;  1GHJ A;  5KIX A;  4NW2 A;  5IGC A;  1Y8N B;  3GV6 A;  1HUN A;  1F2L A;  4KKS A;  2JA8 B;  1BUV T;  2XN9 C;  3T13 A;  1HFG A;  4G7O C;  4K2K A;  1KDC A;  3OIQ A;  2WIN B;  2E2H B;  4UAI A;  1RHP A;  5KNB A;  2CVR A;  5C4J B;  1M8A A;  3SK8 A;  2B2Y C;  4DAV A;  2PCF B;  3R3O A;  4OO1 H;  1AW7 A;  1J8I A;  1NR2 A;  4E6I A;  1DM0 B;  4DAY A;  4I65 A;  4O42 A;  4MIU A;  1SNP A;  3SE0 A;  3S1M B;  2JSO A;  5C4Z A;  5FO9 B;  4F7X A;  2RSN A;  3S15 B;  5C3W A;  2MUY A;  3IFT A;  3AU7 A;  1SDF A;  3VR4 A;  2KEE A;  3QOL A;  3FRP B;  1TWH B;  1STE A;  2OF1 A;  1RF2 D;  5JJZ A;  2F0H A;  1I6V C;  4OGQ C;  5FKA C;  1AZP A;  2A6E C;  1ESF A;  3QG1 A;  2WKC A;  2M9V A;  3EJI A;  2NVQ B;  4K8I A;  3T56 B;  4RA8 A;  4KY5 A;  1S5D D;  3J7A F;  3FDT A;  4K14 A;  3H94 A;  1ICW A;  3FPU B;  1F2Z A;  4NKL A;  1SEB D;  4R8N A;  4XQQ A;  2BA1 A;  3VYT A;  1A6X A;  5JEA G;  2EYH A;  2XWB B;  4EGV A;  4TSS A;  2DNE A;  1O7Z A;  3GTP B;  5KYL A;  1STB A;  1TS3 A;  3BZD B;  2JA5 B;  1DXM A;  2L4N A;  1ZEQ X;  2QF7 A;  5C0X H;  1CZW A;  1I4H A;  1TU2 B;  1L0Y B;  1Y8O B;  5BN3 A;  3CRL C;  1ZXT A;  3HGB A;  1UNS A;  2E76 C;  1STA A;  1U4P A;  5A2Q E;  4DXG A;  1TVX A;  1SMY D;  4I7Z C;  1B50 A;  1Q90 A;  3A8J E;  1WVL A;  4ZLT F;  2B2U C;  2ENB A;  3MTS A;  3H0G B;  2M2L A;  2LY7 A;  5DEH A;  1HXY D;  2FJ2 A;  3H3V C;  1VCI A;  2VB3 X;  3QIA A;  1EWH A;  4IFD J;  4R8I A;  1LT3 D;  1DOM A;  5CV9 A;  5C4H A;  1O80 A;  1MSH A;  4G4K A;  1VF5 C;  5DAU A;  1H9K A;  1FGB D;  3BYT B;  3ND9 A;  4DNT B;  5EPL A;  1YNJ D;  4KN4 C;  4CJ1 B;  4S3S A;  3DHQ A;  2D9U A;  2L0C A;  5FO8 B;  1S5C D;  5BN4 A;  2F3V A;  2MHV A;  5EJW A;  2H1E A;  3NPP A;  4NP5 A;  4A3G B;  1EY7 A;  4WJW A;  1LTG D;  1SE4 A;  1KDB A;  1VMP A;  1EEI D;  3R2T A;  1XTC D;  1JB3 A;  4A3D B;  1Z7T A;  4XQJ A;  3D31 A;  4U68 A;  1MSG A;  2IL8 A;  5J39 A;  1FNV A;  1ENC A;  2NVY B;  2VNU D;  2WP8 J;  1O7Y A;  2I07 B;  4M1U B;  2VUM B;  4TRD A;  1A15 A;  4FYD A;  1Q1B A;  4HCE A;  1T5E A;  1QB5 D;  4C2M B;  4C3H B;  2NN6 I;  2BA0 A;  2PO4 A;  1QJO A;  3GTG B;  4ZAI A;  2AQ3 B;  2XRQ D;  1BF4 A;  3K57 A;  1IKM A;  1SFO B;  1EY9 A;  4G7H C;  2ZXP A;  4N9P A;  4UDU C;  5C5L A;  4CGY B;  1OXS C;  2VXW A;  4DK1 A;  2A6H C;  1EWC A;  3CRK C;  1V43 A;  5JEA J;  4J6H A;  1TT2 A;  3P1H A;  2F0U A;  3ONA B;  3QB3 A;  3CU7 A;  1H9S B;  2KCC A;  4KKU A;  1SYD A;  2EZV A;  2F0T A;  4XDX A;  4QMG A;  4KV6 A;  3HOW B;  1TS2 A;  2PZW A;  2IX0 A;  5I2Y A;  1B44 D;  4F87 A;  2Y0S B;  2FMC A;  5CBE E;  4Q5V A;  2IT1 A;  5NUC A;  3RLF A;  3NTI A;  1PLF A;  2DNC A;  2E75 C;  2XRS D;  1GHK A;  1E2Z A;  2QCP X;  3LX0 A;  1Y1V B;  2XIW A;  2NTS A;  4F88 A;  3S17 B;  4HMJ A;  2K32 A;  1EQT A;  2B2V C;  2EDG A;  4DNR B;  1JC7 A;  3NHH A;  1BCP B;  3PV0 A;  3HP3 A;  2R6G A;  2WV6 D;  3D6W A;  1PZK D;  1STG A;  3D4R A;  3BDL A;  1OXU A;  1H9S A;  3D4W A;  1SNQ A;  2G9H D;  2A68 D;  2SOB A;  2Q8T A;  1CA6 A;  4FO2 A;  3U9O A;  5T1I A;  2SNS A;  5TSS A;  4O1N A;  2I46 A;  1UUP A;  1LTR D;  2WB1 B;  3FEW X;  3GO5 A;  4B08 A;  3NTK A;  2HUG A;  1BCP F;  5HGT A;  2QDB A;  1BBX C;  1C8C A;  3C1F A;  1EY4 A;  3W2D A;  2ZXR A;  3IFD A;  5CR3 A;  5M5Y B;  2A5H A;  2A69 C;  1W6J A;  3H09 A;  1TII D;  1WTQ A;  3SXH A;  2DY7 A;  1EZ8 A;  1II3 A;  1BCP D;  2EJM A;  4OHJ A;  3Q0A A;  3BDO A;  5CV6 A;  2RKS A;  5IT9 L;  2B2T A;  5I9O A;  1RTN A;  5IOC A;  4BA2 I;  3Q6S A;  5A35 A;  1Y1W B;  2C5C A;  4HN7 A;  4L8J A;  1E2W A;  1I4G A;  2K05 A;  2BE5 C;  4KD4 A;  4XT3 B;  1SSO A;  5EBC A;  5KND A;  2RBM A;  1R9T B;  1V1P B;  4KK7 A;  5K5P A;  2K33 A;  4A3M B;  2JA6 B;  1EU4 A;  1MI2 A;  2RQX A;  3SR1 A;  4WOR A;  1PTO B;  4M8A A;  1SYE A;  3IL8 A;  1SNM A;  5ELD A;  2F0F A;  4KKT A;  1S4Z A;  4OIJ A;  1EYC A;  2K5W A;  1PXU A;  3A8I E;  4FF4 A;  1PRT C;  2PZT A;  2SDF A;  1WD1 A;  2Q8I B;  2R7Z B;  2KEC A;  1S5E D;  3E6Z X;  3PIP 3;  1GUO A;  1X3Q A;  1QWY A;  1CFM A;  5I2X A;  5CV4 A;  2ID0 A;  1KLG D;  1SYF A;  2MPM A;  4YIJ A;  3LNN A;  1G2T A;  1PZI D;  1SE3 A;  3MAQ A;  1LTS D;  1G2S A;  2D62 A;  3MXU A;  4XQN A;  3KLS A;  1B4O A;  1ML0 D;  1BQQ T;  1B53 A;  4J8Q A;  1Y69 U;  3OMC A;  3VA5 A;  3A56 A;  1YNN D;  2RSO A;  3WDN A;  2Q8R E;  3TBI B;  2F0L A;  5C3X A;  4NDX A;  3SEB A;  5FLX E;  3K59 A;  2RDG A;  1JOR A;  1LTB D;  2R3Z A;  3X3M A;  2X6L A;  3S14 B;  4PV1 C;  1I4R A;  4FF3 A;  3WOE A;  5C0X J;  2JE6 I;  2KA7 A;  1JQY D;  1Q1E A;  3D4D A;  2KQ3 A;  1F9Q A;  3K0Y A;  1CHQ D;  3I4N B;  5JVG 3;  2L5T A;  2CHB D;  4DN4 M;  5KGU A;  5ELC A;  1KLU D;  2F0N A;  1TWC B;  3QJY A;  4RCO A;  1JR0 D;  4LK1 C;  2WKD A;  5K36 H;  1AZQ A;  3ZYY X;  2DY8 A;  1EZ6 A;  2EOT A;  4QUF A;  2LFN A;  5EKK A;  1BR9 A;  1LTT D;  3HKZ B;  3NWT A;  2EYJ A;  3HG9 A;  2CQA A;  1Y8P B;  2F0W A;  1XWE A;  4PMC A;  1F77 A;  3MHB A;  2HDL A;  2PQE A;  5CMD A;  1L0X B;  3GTJ B;  1TY0 A;  2D2C C;  3NWS A;  3DUZ A;  1TWF B;  2IJ0 A;  2Z8L A;  4A3E B;  1BO0 A;  1K83 B;  1WTO A;  4RKL A;  1O7L A;  2PYK A;  1Q12 A;  4A93 B;  5FOB B;  4FXD A;  2BDO A;  3QOJ A;  1DCZ A;  1FD7 D;  3FVQ A;  3HOZ B;  1PDQ A;  3NSW A;  1G91 A;  4BY7 B;  2F0S A;  2KHS A;  3A7A B;  4KTA A;  1Q3L A;  2F1M A;  1BOS A;  1HFN A;  1FYC A;  5J22 A;  1HTP A;  5COR A;  4IUU A;  1B9N A;  4C56 C;  1PZJ D;  4DK0 A;  1OO9 B;  3LWE A;  3RUZ A;  3N52 A;  3NK9 A;  2AWO A;  4FNF A;  5E4X A;  4KMU C;  5EKI A;  2A74 C;  3RZO B;  4CKB A;  2K1B A;  1DJR D;  4JK1 C;  1HRJ A;  3EFX D;  4BWG B;  1W6K A;  2AQ2 B;  3RD4 A;  4ABN A;  3J80 E;  1XYI A;  2JP1 A;  3I3C A;  3FMC A;  2YYZ A;  3CKI B;  1PFM A;  3TDQ A;  1SNC A;  4XIG S;  3O13 A;  3PUZ A;  1K8O A;  1HPC A;  5LL6 X;  2HQE A;  3VR6 A;  1D1K A;  1SNO A;  3DXJ C;  1CI3 M;  3SDZ A;  4C3I G;  2EYO A;  1DD2 A;  3C3L A;  4WFN 3;  1V8Q A;  3S2H B;  3ND8 A;  4GZY C;  1QE6 A;  2R93 B;  5IGB A;  2IW3 A;  5IGF A;  3BDC A;  1I6H B;  4RCN A;  4ZQ3 A;  1VDZ A;  2FHT A;  1STH A;  5CV5 A;  4C3J G;  3VYR A;  4IUP A;  3K5M A;  4BS9 A;  3DMU A;  2B2U A;  3ITP A;  3KK7 A;  5CV8 A;  3MEH A;  3MWY W;  2EVB A;  2G9D A;  4A3F B;  1SMY C;  4PNY A;  4RWS C;  2EY5 A;  2F0E A;  4H7B A;  5J1Z A;  3PUX A;  1LT4 D;  3ERO A;  4WRD A;  4ZKB B;  1BDO A;  1GUT A;  1GUW A;  3M4Y A;  1D6E C;  5IGD A;  4RH6 A;  2EYP A;  2EE1 A;  1WTR A;  3OHX C;  5ISR A;  4B9W A;  5D14 A;  4ZRZ A;  1D1I A;  2J4X A;  4HED A;  2JEB I;  3HOU B;  1LAC A;  2N88 A;  3TZD A;  1ET6 A;  1JWU D;  1H9R A;  2R92 B;  3D6C A;  1RJT A;  2O2L D;  2AUK A;  3WOF A;  1D5M C;  1DON A;  1YNJ C;  5G3L F;  3A54 A;  5FO7 B;  4A3K B;  2WAC A;  3K7A B;  1G29 1;  4OO1 I;  5I9P A;  1H9M A;  4DF7 A;  1QIL A;  5G3L D;  1HA6 A;  5K36 G;  3VYU A;  4LAA A;  1WTX A;  1WTW A;  2B2W A;  3GTQ B;  3P7J A;  1QG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...