3H15A

Crystal structure of replication initiation factor mcm10-id bound to ssdna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
173
structure length
173
Chain Sequence
QYHVEKFSGLRIRKPRVSSSEMERKMNGRKLIRLAQLQNKIATEKLEEEDWVTFGVIVKKITPQSSNNGKTFSIWRLNDLKDLDKYISLFLFGDVHKEHWKTDQGTVIGLLNANPMKPKEGTDEVCLSVDNPQKVLLMGDAVDLGTCKARKKNGDPCTQMVNLNDCEYCQYHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein MCM10 homolog
publication title Physical Interactions between Mcm10, DNA, and DNA Polymerase {alpha}.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Replication/dna
total genus 36
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09329 zf-primase Primase zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h15A00
4JBMA 5IP7G 1VQ5A 3TEHB 1XNQL 4X65Q 3MXNB 2E8GA 4J15A 4EX5A 2ZJQA 5JJIA 4RG1A 1N8RC 1HNXQ 1TWGH 3I4MG 4HIKA 1UE1A 2JJQA 1NE3A 2PQAB 4IPDA 4A3KH 4NXMQ 3HOWH 2WB1G 1IZ6A 3E9IA 1CKMA 1XMOL 1PH9A 1JE5A 1JT8A 2H5XA 3AQQA 4GLVB 1HR0L 1TWFH 4LF9L 1I6HH 3JC66 3HOUH 1OXUA 4JI5L 4QGUA 4GN5A 3RZOH 4POFA 2VZAA 4IOCA 5LMNL 1VQNA 1WCMG 2B3GA 4DV3Q 1QZGA 3DM3A 4JI1Q 4LF6L 2PQAA 2JA6H 2K5HA 3PV0A 4DUZQ 1HZ9A 2ZTEA 1L0WA 1HZCA 1CKNB 3H0GH 4TVAB 4YCWA 1XMQQ 1G6PA 4GN3B 1L2FA 3CXCA 1D8LA 2CCZA 3HKZG 3CD6A 4BY7H 4A3FG 3RLOA 4JI7L 4R4TA 4ME3A 2AHOB 4UY8C 1IBKL 4KI0A 1J6QA 2F52A 2VQEQ 2ZJRA 4YWKA 1CKNA 1GM5A 2UXCL 2UXDL 5J3BA 1CKOA 3PO2H 1GKHA 1P16A 2K4KA 3HOZH 1EIYB 3S24A 1Y14B 1YVCA 5FJ8G 4TQUS 1IXRA 3K7AH 4UP8A 1XPOA 4R4CA 4JC0A 1N32L 1T9HA 1Q82C 1TXYA 2K52A 1L1OC 1XPUA 1IYJB 1K3RA 1SLJA 5BR8Q 2F3IA 5C4XH 1OTCA 2UUAQ 1Q86C 1N34L 4DV3L 1B70B 3CC7A 4YCUA 4JI1L 3CC4A 2I5LX 4O2DA 2D62A 4NXNL 3CPWA 1SROA 4MNOA 4JI8Q 2HT1A 4A93G 3PF5A 1SN8A 2NVQH 1HZBA 2BA0A 1JJGA 1N36Q 5GROA 3F2BA 5M5WH 5IYCH 1G51A 4AIMA 4JI3L 2R93H 1VQOA 4JYAQ 1LTLA 3ULPA 1W2BA 4LFBQ 2HIVA 4MTNA 5ELOA 3U50C 3CCEA 1N33L 4LFAQ 3I7FA 4H02A 2A8VA 3W1GA 4PZ8A 1NMFA 1U5KA 3EIVA 3KF8B 3J7A5 1KC8C 2HHHQ 4B3TQ 4DR7L 2D0PA 2B63G 5M3MH 1PYSB 4B3MQ 2JA8H 1YJNA 5IY0A 1B7YB 1A63A 1WYDA 1YHQA 2VUMG 3NEMA 1Z47A 1A8VA 3M85A 3CAMA 4BXXG 2K5NA 3JAMi 2OCEA 4JI6L 3OTOL 3HOXG 4IFDI 4BBRH 1BBUA 2ZTDA 2K50A 5JEAJ 3RN5A 3G6EA 1Z9FA 2UU9Q 1VQ6A 4GKJQ 1EQQA 2B63H 1KAWA 4JCVE 1VQPA 4JOIC 2NVTH 4JV5L 2KHJA 4A3LG 4A3CH 3KJPA 4EQ5A 2E5LL 1H95A 4JBWA 2C35B 3M9BA 4B3RQ 4DAYB 3TRZA 1HH2P 3I56A 1KQSA 2R7ZG 4DV2L 5C0XJ 1FGUA 4O0AA 2PI2A 4PG3A 3W1BA 1YHBA 3KDFB 4QQBX 4IJLA 1Q81C 1KL9A 1YEZA 3KOJA 2Y0SG 3RNUA 4JYAL 1R9TH 2JEAI 1KXLA 1TWHH 1X6OA 4DV4Q 2R7FA 4LUOA 4JI0Q 3W5OA 1HNWQ 4DKAC 4A3JH 4QY7A 2EXDA 1VQLA 2HHHL 1VQHA 3J81j 5IYBG 1HNZL 2MO0A 4A3DG 5HGQA 3I4NG 4LF7Q 2ASBA 4A3BG 1PH1A 2YTYA 2CQOA 2VY3A 3J80i 4LF8Q 2VNUD 3RLFA 1C9OA 4UP7A 5AJ3Q 4HJ5A 2UUBQ 2B29A 2GVBA 1EOVA 1YHAA 1WFQA 2Q2IA 3UE0A 4QJFA 4GNXC 4HJ7A 2L15A 2V1CC 3L7ZC 2WAQE 1OXTA 4R4OA 5IWAQ 4DR2L 4L5QA 4DV5Q 1PH3A 2UU9L 3ICEA 1L1OB 3MEFA 4XTCS 3PSIA 3GTQH 1I94Q 4YHHL 3AFQA 1E22A 2E2JH 1Q7YC 2GN5A 4WJ3M 1VQ9A 1AH9A 4JBKA 4X62Q 1XNRL 4IJHA 1QVCA 1IBLL 3KJOA 1ASYA 2F4VL 4DR6L 3HFZB 4IFDJ 1VQIA 1VQBA 2NZOA 1QVGA 5ELNA 5GADC 1EWIA 2XTIA 5IP7H 4DV0Q 2QEXA 3F8TA 1BBWA 1SMXA 1K73C 2E2IH 2LXKA 3KLWA 1L1OA 2CWAA 5HY6A 3I4MH 3GTKH 2ATWA 3LGJA 4LF5L 1PH6A 1IBML 1UE7A 2BH8A 3UDXA 3ZJYC 3AFPA 4DV4L 1S40A 1FJGL 4DV1L 4FDBA 4DR4Q 2JA7G 3BZKA 3GO5A 4KHPQ 3F2CA 1P8LA 1E1TA 4X64Q 2RHQB 4IO9A 3PO3G 2UXBL 5K36G 3HKSA 4K0KL 1GD7A 1WCMH 4HIOA 4YWLA 2FXQA 2PMZE 4OX9Q 5IP9G 4GS3A 1C7YA 2R92G 4DR3L 4KHZA 1AE2A 3FKIG 2UUBL 1VQGA 1PH2A 2YTXA 4X65L 4PZ7A 3J80c 2LSSA 3UE1A 2JA7H 1HNXL 4LF4Q 2ZM6Q 2UUCQ 4DPGA 4LWCA 4IPGA 4NXML 3BJUA 1I5FA 5GAHC 4YY3Q 4DAMA 3CCUA 2DGYA 2AWOA 1WOCA 4P74A 4AQYQ 4DV7Q 4A3FH 1K8GA 4DR5Q 4Y7NH 1HZAA 3AYHB 5LMUQ 5C4JH 4WJ4A 1UE6A 4LUZA 1TWCH 5C0XI 1M90C 2Q2TA 4DV0L 5FLXc 2IY5B 2I5HA 2AKWB 4A3MG 2GVAA 1YIJA 2EQSA 2ALYB 1JMCA 4OWWB 2JE6I 4YCVA 3UDFA 1PA6A 2JA5G 5FLMG 1K0RA 2I5MX 4JOIA 5FJ8H 4DUZL 3S14H 4OO1I 1SE8A 2EIFA 3PIOA 3S1RH 1JJ2A 2MFIA 4GKKQ 1K9MC 4AYBG 3H15A 3GTMH 1XMQL 3S15H 4KHPL 3U58A 2KCTA 5IT9c 4JI2Q 2DUDA 1I3QH 3STBD 4DUYQ 1KHIA 3T1HQ 4MZ9A 1Q12A 2Z0SA 2YU9H 3STBC 1JB7A 2NN6I 1S3OA 2WP8J 3PUXA 1LYLA 1B8AA 3GDEA 3OW2A 5C44G 1VQMA 4A93H 2N8NA 2VQEL 3CCMA 1V43A 3S2DH 1CUKA 2WFWA 4GN4B 4UP9A 4GNXB 3HOVG 2D0OA 3G4SA 3CCRA 1X3GA 4RMFA 2ZM6L 3CCLA 4LF4L 2WB1E 4JI4Q 3HOYG 1VQDA 1EUJA 1PHJA 2IX1A 4YY3L 3U4VA 3CQZH 1UWVA 3KF6B 4BY1G 1YNXA 4DR5L 5JEAG 4A76A 3A0JA 4HJ9A 1PH4A 1NMGA 3D31A 3G48A 4X6AH 5BR8L 1K83H 3U4ZA 4GNXA 4DR1Q 1VQKA 2UUAL 2YYZA 4A3IG 3GTOH 2BA1A 1E3PA 4L5TA 4OONA 1Q8KA 4R4QA 2VUMH 4BXXH 4JI8L 1Y1VG 1VQCA 3Q8DA 4LFCQ 1X65A 2CKZB 1KRSA 3KF6A 3HOXH 1N36L 1QVFA 3PCOB 1OXVA 4NB3A 5C0XG 3NBHB 4GLXA 1EFWA 2NVXH 4HJ8A 3TS2A 1PH5A 1E1OA 4APVA 1XNQQ 3HKZE 4GLAC 1KRTA 4LFBL 1G291 1PYBA 4A3LH 4BBSG 1QUQB 4LFAL 2MQHA 3S2HH 3ERSX 2BH2A 3PUVA 5M5YH 1J5EQ 2NVYH 1PVOA 3K0XA 4NPSA 5GAGC 4A75A 4B3TL 4L5RC 1HJPA 3E9HA 1NY4A 3J81i 1V1QA 1XMOQ 3S17H 4B3ML 2R7ZH 1N9WA 1HR0Q 2OQKA 1DGSA 4ALPA 4JI5Q 3GTPH 1O7IA 3DLLA 3RN2A 3OYYA 5C3EG 4JI4L 1XTDA 1QUQA 3K7UC 3S16H 4DNIA 1Y1WG 1MJCA 5M3FG 4B3SQ 1HR0W 3S1MH 4GKJL 3JAMc 4JBJA 4PZ6A 1A0IA 1SR3A 1EIFA 5IYBH 5EAYA 4C3IH 4A3DH 1E7ZA 1JJCB 4GOPA 3I4NH 4DR1L 4A3BH 1MIUA 3CW2C 4A3KG 5GQOA 3HOWG 1XPRA 4IFDG 2OTLA 4B3RL 2MNAA 5E7NA 2HIXA 3CC2A 1VCIA 4JI7Q 2RHSB 1YBYA 1VQJA 3HOUG 1IBKQ 2KBNA 3B6YA 3L2PA 3D0FA 3CCSA 2OQ0A 1XJVA 3KFUA 3GD7A 1NTGA 1E24A 3F1ZA 2VW9A 3GTGH 2UXCQ 2UXDQ 2Z6KC 3GTLH 1VQAA 4JI0L 2JA6G 4AH6A 3CPFA 1BKBA 3BU2A 1VQEA 3KYHC 5IE8A 3CCVA 2A19A 1J5EL 3M4OH 1HNWL 1SRUA 3CMAA 3CF5A 3H0GG 4C3HH 1N32Q 2OTJA 4LF7L 3EBEA 1VQ4A 3EN2A 1ASZA 1YZ6A 2LXJA 5DLQE 3J81c 1GVPA 1X9NA 2E2HH 4LF8L 1RL2A 2CFMA 1N34Q 3K80C 5AJ3L 1YITA 1UEBA 1TWAH 4P71A 1VQ7A 4BY7G 2N78A 1VQFA 4NXNQ 1D7QA 4GOPC 1FL0A 1X3FA 2Q2UA 2JQOA 4PMWA 4UPAA 3WWVA 4C3JH 4C2MH 5IWAL 4DV5L 4B3SL 5JJKA 4IOAA 5IYDG 3M4QA 1I94L 3PO3H 3FP9A 3T1YQ 3PO2G 3PUYA 2IHEA 2VQFQ 3H3VH 4JI3Q 3HOZG 3PF4A 4X62L 1Q1EA 2IHFA 3S1NH 1X56A 5M5XH 5JJLA 5IP9H 1Q46A 1N33Q 3F2DA 3BZCA 2R92H 2NZHA 3M3YH 2R6GA 3FKIH 3E0EA 2R7DA 4HJAA 4A3GG 4DR7Q 2Y0SE 4DK6C 3IRBA 4DK3C 1FVIA 4IPHA 3K81C 5C4XG 1OXXK 3GTJH 5IYDH 3J7ZC 3I4OA 1SFOH 4DR4L 4OWXB 3PUWA 1RIPA 4X64L 4X66Q 3G71A 1UE5A 2MO1A 4JI6Q 3OTOQ 3K8AA 3SGIA 1QZHA 3I2ZA 1GO3E 3RR5A 5IYCG 2Q2HA 2VS1A 4A3GH 2R93G 2WAQG 4A3MH 3NELA 1KIXA 4OX9L 4OXPA 2JA5H 4JV5Q 5FLMH 2K75A 2N3SA 2E5LQ 2RCNA 4YWMA 3NENA 1LM0A 4BA1I 4IPCA 4Y52H 5M3MG 2UUCL 4A3EG 1C0AA 3I55A 1A62A 4DV2Q 4LNQA 2JA8G 3ULJA 3RZDH 3T1YL 1PFSA 2VQFL 2AWNA 2QA4A 4AQYL 2ZTCA 4DV6Q 4DV7L 4XIGS 4P72A 3PUZA 2ES2A 4LUVA 1U0LA 3CCJA 5LMUL 1PH7A 5C44H 4BBRG 4P75A 1X3EA 4BA2I 4A4IA 2ID0A 2PNHA 3S1QH 1VQ8A 1I50H 3TREA 3HOVH 2IT1A 1HNZQ 1K8AC 4A3EH 3AEVA 4A3CG 4R4IA 2JK8A 1WJJA 3HOYH 1M1KC 4GKKL 1LUZA 1S72A 3CCQA 4BY1H 1CSPA 1YI2A 1IL2A 2JA9A 2K5VA 3PGZA 4X66L 4JI2L 1BVSA 1W3SA 4DR2Q 3TS0A 4DUYL 3T1HL 1EQRA 4A3IH 2KCMA 4OO1G 2QGQA 3FHWA 4YHHQ 3M7NA 1PH8A 2YV5A 3M4PA 3TQYA 2OWOA 3A5UA 2Z6KA 1KD1C 1Y1VH 1XNRQ 2F4VQ 1IBLQ 4DR6Q 2PI2E 1AE3A 1YJ9A 4A3JG 1YJWA 5H1SE 1Q1BA 3A74A 4GOPB 4LF9Q 2I0QA 2HQLA 1NJIC 1CSQA 1WI5A 1VS0A 2JEBI 1MKHA 5GAEC 3ULLA 3UDIA 1V9PA 2XGTA 4R1JA 5LMNQ 2NN6G 3CMEA 4HIMA 2KENA 1EYGA 3CP0A 1NBWA 4LF6Q 4BBSH 4QL5A 2CWPA 3RLNA 4LW1A 4LF5Q 4DV6L 1IBMQ 3H3VI 2KHIA 1FJGQ 2AMCB 2YTVA 2RF4A 4DV1Q 2N49A 4QIWE 2ZJPA 5LMNW 3PIPA 4P73A 1PV4A 1MJEA 3ER0A 4POGA 2IX0A 4OWTB 4KLKA 2A1AA 2VL6A 4JG2A 2UXBQ 1OXSC 3UDGA 3A5ZB 4K0KQ 5C3EH 3VDYA 2K14A 1X54A 3KDFA 4LFCL 1X55A 4AYBE 1Y1WH 4HIDA 5M3FH 3L0OA 4DR3Q 4L5SA
chains in the Genus database with same CATH superfamily
5IP7G 3H3VC 1XNQL 1II3A 2VUMB 2EYJA 3RD4A 1FR3A 3QOLA 1CKMA 3NTIA 1PH9A 4BY1B 5HGTA 2H5XA 2ZXOA 4GLVB 4RCNA 5EPJA 3JC66 1OXUA 4GN5A 2WINB 4IUQA 2QDBA 1CTMA 3QO2A 1DJRD 3MXNA 4ZQ3A 4POFA 5LMNL 1WCMG 4DV3Q 4LF6L 2K7VA 2K5HA 3S17B 4DUZQ 3P1HA 4WJWA 2R7ZB 2CW0C 4IN3A 2TMPA 4YCWA 2A69D 5IGDA 1EQVA 1L2FA 2A69C 4FXKC 5EKKA 1K0SA 4RGOS 4DNRB 1NR2A 4PNYA 3DWQA 1TS5A 4A3FG 4G57A 4UY8C 2F52A 3GP7A 1EY4A 3LWUA 1PRTB 1GM5A 2UXCL 5J3BA 1CKOA 1P16A 1LTRD 3S24A 5FJ8G 4TQUS 3E3XA 1AEXA 5HURA 1XPOA 1CI3M 1XPUA 1K3RA 3GTLB 3FPUB 1T5EA 4HCSA 2D62A 4NXNL 3CPWA 4PMCA 1SROA 1RDPD 2CQAA 4MNOA 2HT1A 4A93G 3PF5A 2HDMA 5A35A 2AQ3B 1HZBA 1JJGA 2LY7A 1B3QA 2DN8A 5J39A 2E2HB 2F0SA 1GUGA 1ET9A 2QCPX 4LFBQ 3DM1A 1CHPD 2F0VA 4PZ8A 4C3JB 1NMFA 1MSHA 3T53B 1PYSB 1EY9A 1DOMA 1JICA 1B7YB 2VUMG 3NEMA 4JPBW 3EROA 5ISRA 4BXXG 3HEJA 1MBYA 1PRTC 4KKSA 3NK9A 3NP8A 4IZ8A 2K50A 3KF8A 4IFDI 1VQ6A 3G6EA 3ERQA 2XRSD 1F2MA 2KHJA 2WV6D 4A3LG 3KJPA 1D1IA 1BR9A 1H95A 1PZKD 4DF7A 3TRZA 1XWEA 1HH2P 2R7ZG 4PG3A 4A3GB 3W1BA 3IFTA 2JA5B 3V2TA 1MD2D 1HFGA 4OIKA 2EPBA 4XT3B 5KGUA 4OO1H 1RTOA 1WTOA 1H9RA 2R7FA 4JI0Q 5IOCA 2A6ED 4DKAC 2EXDA 1VQLA 3J81j 2A6EC 2MO0A 3P75A 3I4NG 1PH1A 3NBHA 2NN6H 2XIWA 2K04A 1GXDC 3TP6A 4LF8Q 2RDHA 1C9OA 1SJHD 1CQVA 1C8CA 3UE0A 4HJ7A 3L7ZC 1WTWA 4R4OA 1JWSD 4L5QA 2LMCB 1PH3A 4X3TA 1U4LA 1L1OB 4XTCS 1S5ED 1E22A 2RKSA 5CYUA 2E2JH 2PW5A 1AH9A 4JBKA 1XNRL 4IJHA 4CDCC 1IBLL 2R61A 3KJOA 1ASYA 4DR6L 1VQIA 5ELNA 5GADC 1NNXA 2QEXA 5L37A 3KLWA 5HY6A 3I4MH 4C56C 2H1EA 1ICWA 3LGJA 2BH8A 4DV4L 1S40A 2FINB 1W6KA 4CHTB 2E75C 3GO5A 3TP5A 1S5FD 4C3JG 1E1TA 4KY7A 3W2DA 3BS1A 2F0GA 4IO9A 2UXBL 5K36G 4BBSB 3HKSA 1GD7A 2FXQA 2WKDA 5IP9G 4GS3A 1SAPA 2KHSA 1ICFB 2O4XA 2UUBL 1VQGA 3OWFA 4PZ7A 3J80c 3UE1A 4PV1C 4LF4Q 2ZM6Q 4DPGA 4MTKA 1LABA 4QUCA 4NXML 1ESRA 1I5FA 4J8QA 3J81E 5G3LF 4P74A 4DV7Q 4DR5Q 3ONAB 4LUZA 1TWCH 1H9JA 1TWGB 5C0XI 4DV0L 5FLXc 2F0OA 4IUNA 5JPMC 3GTQB 5CV9A 1YIJA 3HOWB 2JA5G 2Q8TA 5FLMG 1K0RA 2I5MX 4JOIA 3NQIA 4J1MA 4ZKBB 3S14H 1DZ1A 3CRKC 3RZOB 1K9MC 4KHPL 3OIPA 1ESFA 3TN2A 3PIP3 1A3VA 3GTKB 4C1NI 1JB7A 3PUXA 2BOSA 1LYLA 3H0GB 1L0YB 2VQEL 1B50A 1CUKA 1HQMC 2WFWA 3EVQA 4GNXB 2D0OA 3CHBD 3SXHA 1X3PA 3TDQA 1VQDA 1EUJA 1PHJA 4BY7B 1H9SB 4YY3L 3D6CA 2AQ2B 1UWVA 2KECA 1F9RA 1C48A 3MXUA 3A0JA 1PH4A 3G48A 4CJ0B 3PO2B 1K83H 2F0IA 4DR1Q 2RSOA 1Y8NB 4OONA 4R4QA 5D3IB 1K28A 4OEMB 4XQNA 4JW0A 2Z9HA 3U9OA 1QVFA 2CKZB 1KNAA 1KRSA 4NB3A 4DAVA 2NVXH 2EZVA 1KRTA 1G291 5IGBA 1GUSA 4BBSG 1QUQB 3S2HH 1SNPA 3C1EA 3K5LA 2O5IC 2NVYH 1I4RA 3K0XA 4KK7A 4NPSA 3OPOA 4EQOA 4K2KA 4A75A 1XX8A 4B3ML 1TQOA 1HR0Q 2P5ZX 3GTPH 1JCKB 1G2TA 1F9QA 3R2TA 1Y1WG 3HG9A 5M3MB 4EVOA 1MI2A 4C3IH 4A3DH 1E7ZA 1JJCB 2XWBB 4GOPA 4A3BH 3CW2C 3QWNA 1ZXTA 3HOWG 1XPRA 1WTVA 2MNAA 3CC2A 5J1ZA 4JI7Q 2B63B 2NVTB 3CCSA 3GD7A 4CGYB 2VW9A 3KUPA 3D4DA 1SE4A 5FO8B 2PMZB 1J5EL 3CPFA 1BKBA 3KYHC 1VQEA 5KEEA 4QF4A 3M4OH 1HNWL 5JAVA 4XYQA 3H0GG 2M9VA 3GV3A 3J7AV 1N32Q 3I72A 2OTJA 1VQ4A 3C3LA 2LXJA 1DXMA 1TWHB 4ME5A 1I4GA 1B53A 1RL2A 5AJ3L 5F2DA 5A2QL 1VQ7A 4BY7G 2N78A 4A3JB 1D7QA 1V1OA 4JVZA 3WWVA 5JJKA 4C2MH 4IALA 3M4QA 1I94L 3FP9A 1BQQT 3PO2G 2RBMA 2IHEA 2Y0SB 4JI3Q 4X62L 1Q1EA 4KJNA 5IT9L 3F2DA 1MGSA 4MN3A 1EY5A 3E0EA 5FKAC 2R7DA 1Z6HA 4K5XA 1E2VA 4DK3C 1D6EC 5I4DA 4IPHA 3DHQA 1V1PA 2IPKD 1SFOH 1T5XD 4L63B 2PNRC 1SYGA 4N8FA 4X66Q 3OTOQ 2Q8RE 1EWHA 2VS1A 1ZYRD 3WOFA 4OX9L 4CKCA 3K58A 1ZYRC 2E5LQ 2RCNA 1RKNA 4OELB 3NENA 4KN7C 1A3TA 1G8ZD 1TVXA 4NMZA 5M3MG 1C0AA 3I55A 1A62A 1I4HA 2H4OA 3RZDH 5EGTA 2K5WA 2VQFL 2RQXA 5EJWA 4AQYL 1GHJA 4P72A 3PUZA 1DM0B 1RD9D 4LUVA 4DNTB 3ND9A 3CCJA 5C44H 2JA7B 1X3EA 3NUCA 1BCPD 2EY6A 2PNHA 4K8IA 4B9XA 3DWAA 4ID6A 3HOVH 1BCPC 1K8AC 4OHJA 2JK8A 1WJJA 3MXPA 2R92B 5C4JB 3DXJC 1CZGA 3FKIB 5JVG3 3PGZA 2F0KA 3T1HL 2QGQA 3OIQA 4UAIA 1PH8A 2OWOA 3T16A 1Y1VH 2F4VQ 1NR4A 4LF9Q 4A3JG 1SYDA 1Q1BA 3A74A 3H6MA 2I0QA 1Q8IA 1MKHA 4ZLTF 3MEHA 1NBWA 2CWPA 3A55A 3SVMA 4DV6L 2KUMA 3DEOA 3S2DB 4DV1Q 2YTVA 2RF4A 2HD3A 3NXWA 5CBEE 2E76C 5LMNW 1W6JA 2EYLA 1MJEA 3C46A 4KLKA 5I2XA 1SYBA 2A1AA 1OXSC 2K14A 4E6IA 4LFCL 1D5XC 2RDGA 2ICIA 2BE5C 3F2UA 5T1IA 3WOEA 5M3FH 4L5SA 3PIO3 3GTOB 3TEHB 4EX5A 4RG1A 1N8RC 1HNXQ 3OWEB 1EY6A 4F7XA 2PQAB 4A3KH 4IFDH 4HSVA 1XMOL 1JT8A 2F0EA 4EGVA 4NDXA 3AQQA 1TWFH 3HOUH 4JI5L 4QGUA 3D6WA 2VZAA 4IOCA 1TY0A 3OMGA 4JI1Q 3FVQA 3QB3A 1S4ZA 3E6ZX 2JA6H 3L9AX 3PV0A 1HZ9A 5I2YA 1LTAD 1HZCA 3VYRA 1EU3A 4CKBA 1O7ZA 1D1KA 1G6PA 5EPKA 3BDOA 1D8LA 3S16B 4ODGA 1PZJD 1MHWC 3CD6A 3EQLC 2HCCA 3RLOA 4ME3A 4B9WA 1O7YA 1IBKL 1PFNA 1PTOD 2A6HD 1CKNA 3T51B 2A6HC 2NTSA 1GKHA 2K4KA 3HOZH 2E74C 1Y14B 4OL7A 4I7ZC 3K7AH 3K5NA 1Q82C 5E3FA 3IAYA 5EKIA 1IYJB 1SEBD 1SLJA 5BR8Q 5C4XH 3J80E 1OTCA 1N34L 3FRPB 4DV3L 3CC4A 4YCUA 2I5LX 4O2DA 1PRTF 4JI8Q 4C3HB 2NVQH 1SN8A 4XQJA 2BA0A 5KNBA 1HUNA 5J22A 2F3WA 5IYCH 1WTRA 2R93H 1PTOH 1W2BA 5FLXE 1TWAB 5ELOA 3CCEA 2A8VA 4K5WA 2LS01 1SYCA 3EIVA 2HHHQ 4B3TQ 1GUWA 3PO3B 3SEBA 3H09A 3SHLA 1YJNA 5KYIA 3K6OA 5M5XB 4K5VA 3VYUA 1YHQA 1Z47A 3M85A 1B9NA 2OCEA 2PZUA 4DFAA 4JI6L 1B4OA 2K01A 1BBUA 2ZTDA 4GKJQ 1ILQA 2UU9Q 1G2SA 4JK1C 4JCVE 4JOIC 4JV5L 1QNKA 4A3CH 2EE1A 4JBWA 2JP1A 1QWYA 3M9BA 1HA5A 3R3OA 4DAYB 1EYCA 3UI2A 5CR3A 1JORA 1H9SA 4CJ2C 4DV2L 2PI2A 4QIWB 2IW3A 1YHBA 4IJLA 1Q81C 3KOJA 3ZYYX 1R9TH 2F3VA 1VDZA 1NSNS 4XDXA 3W5OA 2KEEA 4QY7A 1VQHA 3RMHA 5IYBG 1HNZL 3DUZA 4ZKCB 5HGQA 4LF7Q 1KABA 3C1FA 2I07B 4FYDA 3RUZA 3S1QB 1E0BA 1OXTA 4DR2L 4A3EB 4H7BA 1QJOA 3HOYB 4YHHL 1F2ZA 1EYAA 3SDZA 1QVCA 3HFZB 4TSSA 1BDOA 4H44C 1QVGA 1EEID 4M1UB 2QKIC 4C3HG 5IP7H 4A3IB 3F8TA 1BBWA 2E2IH 2LXKA 2CWAA 1XXGA 3VA7A 3IKJA 4RHSA 1PH6A 1FJGL 4X3SA 4DA2A 1LT4D 4DR4Q 1F2LA 5ELBA 3TBIB 3F2CA 1P8LA 2K28A 3PO3G 1CQFA 1WCMH 2XN9C 2PMZE 1LT6D 2EYMA 1PH2A 4X65L 2K5QA 2C9OA 1LTGD 1LV9A 2PPBC 2DGYA 1WOCA 2DY7A 4A3FH 1K8GA 3C2PA 4Y7NH 1HZAA 3A8JE 1UE6A 1M90C 3OOCA 2GVAA 5ELEA 3SK6A 2JE6I 3UDFA 5FJ8H 1PFBA 1SE8A 2EIFA 2J0TD 3S1RH 1I6HB 3VA5A 3H15A 3I8ZA 1XMQL 3U58A 1TY2A 1KDBA 5IT9c 4G7HC 3QG1A 3A54A 1CK1A 4DUYQ 4OGQC 1KHIA 4K8JA 3BG3A 4MZ9A 5FOBB 2YU9H 1S3OA 1RJTA 1VQMA 1WVLA 2PCFB 4A93H 3CCMA 4UP9A 4GN4B 3CCLA 1X3GA 4LF4L 1RHPA 5C5LA 2ZM6L 4ZUIA 3J7YW 4QMGA 3K57A 3HOYG 1Y8OB 4QCLA 1RCVD 3KF6B 4I7AA 4BY1G 1YNXA 4DR5L 4A76A 4HJ9A 1NMGA 4X6AH 2I46A 1VQKA 1IW7D 1EFID 4A3IG 3W3AA 2UUAL 1HA6A 4L5TA 3NE5B 1IW7C 2VUMH 1SYFA 2K5DA 4IUTA 4BXXH 4FF2A 1VQCA 5C3XA 1N36L 1PH5A 1XNQQ 4A3LH 4LFAL 4KY6A 3PUVA 2PZWA 3S14B 1JE4A 4L5RC 2NTTA 1HJPA 3S17H 1NY4A 3J81i 2RCFA 2R7ZH 1HPCA 2A74C 5IODA 1LT5D 2OQKA 2WAQB 4UDUC 4UHVA 3E0JA 3OYYA 3LWEA 2KQ3A 3K7UC 1PYWD 3NPPA 4PZ6A 1STBA 2MPMA 1U4MA 2JA8B 1SR3A 1EIFA 3EJIA 3I4NH 2PZTA 4DR1L 3WDNA 1GUOA 3CRLC 4B3RL 1CFMA 4F87A 4BBRB 5JJZA 2RHSB 4ZRZA 1FYCA 2KBNA 3L2PA 2WACA 1DYQA 1E24A 1NTGA 3GTGH 2UXCQ 2K03A 3GTLH 4CBVA 5EBDA 2B2YA 2WKCA 1XYIA 1LLRD 1D2BA 1FNVA 3EBEA 1GUTA 4KN4C 5DLQE 1GVPA 1IKLA 1X9NA 2E2HH 1TU2B 4MIUA 2Z8LA 1IYUA 4P71A 1PZID 4NXNQ 1FL0A 2Q2UA 5IWAL 4UPAA 4C3JH 4DV5L 3NTKA 2AUKA 3NSWA 3R8BA 5IYDG 5K36H 3KLRA 2IHFA 1X56A 3MFYA 5IP9H 1Q46A 1WTQA 1SNCA 1V8QA 2R6GA 3PQIA 1X32A 1B1ZA 4HJAA 4A3GG 2PO4A 4DK6C 3IRBA 1E2ZA 2L4NA 4IUUA 5I6WA 5IYDH 2CH4A 2B39A 1HTPA 3PUWA 2FMCA 3GQBA 4YIJA 3KLSA 2XWJB 1RIPA 4X64L 4KD4A 2IX3A 2Q2HA 1JC7A 4A3GH 2WAQG 3L3OC 3NELA 1Q90A 1I4PA 2JN4A 2JA5H 5FLMH 4ILWA 2K75A 2N3SA 4YWMA 5C6AA 5EBCA 4IPCA 4Y52H 4L8JA 2UUCL 2JA8G 1LTTD 1IKMA 3OHXC 5JOBA 1PFSA 2ZXRA 2A68D 1BO0A 5CV5A 2ES2A 1PXUA 2A68C 1CA6A 5LMUL 4BBRG 4BA2I 4A4IA 1PMRA 3LNNA 2L12A 4DU9A 5D14A 2BCOA 1K8OA 3TZDA 5KYLA 1M1KC 4GKKL 3CCQA 1H9MA 4G4KA 3IFDA 2JA9A 2K5VA 4X66L 4JI2L 4TKOB 3HP3A 1K8MA 3TS0A 1EQRA 4ZK9B 3NHHA 1JOQA 1WD1A 5FO9B 3JAML 4HN7A 3SK4A 3M4PA 4RKLA 3TQYA 2Z6KA 1XNRQ 1IBLQ 4DR6Q 3S15B 1YJ9A 4LK1C 1HCZA 1O7LA 1EL0A 4BWGB 2B2UA 1CSQA 3OMCA 1I3QB 1VS0A 5GAEC 5D3DA 2XGTA 4U673 4BBSH 4R8IA 4LW1A 3Q0AA 3H3VI 3D8GA 1SNOA 5CV8A 4QIWE 3PIPA 1UNSA 4DAYA 2EJGC 3TMEA 2UXBQ 3RZDB 3MHBA 3UDGA 1KDAA 1M8AA 1BUVT 3CQZB 1KAAA 1X54A 3K0YA 1Q3LA 1X55A 1Y1WH 3L0OA 5C44B 4JBMA 5BN3A 5EKLA 1VQ5A 3MXNB 4J15A 2N55A 1TWGH 1UE1A 2JJQA 1ML0D 2DY8A 1NE3A 4NXMQ 3HOWH 1IZ6A 3E9IA 3HOXB 1RODA 1JE5A 2MJ8A 3U9SA 3J7AF 5CV4A 4LF9L 4FVMA 4GZYC 3RZOH 1EIHA 1J8IA 1F9PA 5M5YB 2RSNA 5CMDA 1DOKA 1QZGA 1BBXC 1I6VC 2DJFC 3I4LA 1SMYD 3AMUA 2OT2A 2QF7A 3H0GH 4TVAB 1E2WA 2N88A 3CXCA 1BCPB 4HMIA 2CCZA 3S1MB 4BY7H 3FPPA 4R4TA 2G9DA 3AU7A 3X3NA 4N9PA 1J6QA 2AQ1B 2VQEQ 2ZJRA 1EWCA 2UXDL 3PO2H 1WTXA 1UUPA 1EIYB 1YVCA 4RGTA 1IXRA 1DONA 4HMJA 2Q8IB 3MZ5A 4R4CA 1T9HA 3NBIA 3QR8A 1TXYA 1HFNA 1STNA 2HCIA 4A3KB 1B70B 3K5MA 3CC7A 4JI1L 2RVLA 4H0LC 1X3QA 3F2BA 5M5WH 1G51A 3MA2B 1AZQA 1VQOA 5A2QE 4JYAQ 1LTLA 3NTHA 2HIVA 3U50C 1N33L 1U5KA 3VR5A 5G3LD 3KF8B 4DR7L 2B63G 3CU7A 4B08A 5M3MH 4B3MQ 3M3YB 5DNFA 5IT9E 4FF3A 2K5NA 3BDCA 1TKWB 3HOXG 1CT1D 1HXYD 5JEAJ 3NQTA 1DOLA 1EQQA 1DCZA 3GTJB 2B63H 1KAWA 2B2TA 1VQPA 2NVTH 4IUVA 5JVH3 4EQ5A 1LTBD 3K7AB 2X6GA 4ABNA 1VF7A 1AN8A 4V0BA 1KQSA 5C0XJ 1WTHA 1GOZA 1STGA 4A3MB 3KDFB 3MXGA 4QQBX 1KL9A 2Y0SG 1R4PB 2JEAI 1JWUD 4X3UA 1KXLA 1TWHH 1X6OA 2F0QA 1AW7A 2K1BA 4LUOA 3BYYB 2MUYA 3EFXD 4AYBB 2NVQB 1HNWQ 4A3JH 2HHHL 1HQRD 1QILA 4ULLA 2ASBA 2R93B 2YTYA 4G7OC 3M4YA 2CQOA 5TSSA 3J80i 2VNUD 1G91A 4X3KA 4UP7A 5AJ3Q 4HJ5A 1M4VA 2B29A 1WFQA 1I50B 2L15A 4HSPA 2WAQE 3VR4A 1D5MC 2UU9L 2PQEA 3MEFA 3PSIA 4EQNA 1I94Q 3AFQA 3GV6A 1Q7YC 4CDEC 2GN5A 1XTCD 4X62Q 2D2CC 1VQBA 1VMPA 2XTIA 5IIFA 2RDFA 2KCCA 3URYA 1L1OA 2K6AA 1BNZA 4LF5L 2KOLA 1IBML 1UE7A 3ZJYC 2F0WA 1A3UA 1Z7TA 4O1NA 3BVZA 4FDBA 4NP5A 2JA7G 3BZKA 1GJXA 3K59A 2RHQB 1K3BC 4DGZA 3T4AC 1F77A 4K0KL 1SBBB 4FP5D 3A56A 2EYPA 4HIOA 1TS3A 4YWLA 1R9TB 4OX9Q 5NUCA 1C7YA 5DM63 4IUPA 2R92G 4DR3L 3FKIG 3QJYA 3T56B 1EZ8A 2B2WA 1FNUA 2JA7H 2LSSA 1PTOC 3SR1A 3SK8A 4LWCA 5C3EB 4IPGA 5EQ0A 5GAHC 4RCOA 4DAMA 3CCUA 4AQYQ 2XSCA 2FHTA 3AYHB 1O78A 4KY5A 2L55A 5C4JH 4WJ4A 2R3ZA 2EYHA 2IY5B 2I5HA 3MAQA 4A3MG 1GHKA 1PDQA 4YCVA 4FF4A 4XT1B 4DUZL 1L0XB 3PIOA 1A2TA 4J6HA 4AYBG 3GTMH 2XNAC 3D4RA 1Y69U 3STBD 4HEDA 3T1HQ 2K33A 5IGFA 3PMFA 3STBC 2WP8J 1EU4A 3QIAA 4FXDA 3GDEA 3OW2A 2N8NA 4OIJA 3S2DH 2MP1A 3BZDB 2XVSA 4MHEA 5E4WC 4JI4Q 3I70A 2IX1A 1EY7A 1A2UA 3U4VA 2HQEA 5JEAG 2ENBA 3D31A 4GNXA 3GTOH 2BA1A 1E3PA 4L6TB 5I9PA 3I90A 1PLFA 3Q8DA 4LFCQ 1X65A 1GUNA 2Z6BA 5C0XG 5M9OA 4GLXA 3V96A 3TS2A 2KVMA 4GLAC 2EDGA 4LFBL 1PYBA 5DAUA 3S9WA 1QOHA 2OEOA 2B8FA 1R4QB 5GAGC 2L1BA 1XMOQ 1V1QA 1DGSA 4ALPA 4JI5Q 1O7IA 3DLLA 4S3SA 2CH4W 5C3EG 1I4QA 1XTDA 2NZ1D 1QUQA 4RFBA 3S16H 5CC4A 1JB3A 5I6YA 1BXTA 3OW7A 3TP7A 4B3SQ 1HR0W 2D5DA 2Z4HA 3JAMc 1A0IA 5CBAE 1TS2A 5IYBH 4I65A 1A6XA 2EYOA 1KLGD 2OTLA 5E7NA 3N6RA 2HIXA 1VCIA 1G6ZA 4Q0FA 4RKBA 1VQJA 2F0FA 1IBKQ 3NWTA 1XJVA 1KTKA 3D0FA 2OQ0A 3KFUA 1JOKA 3F1ZA 4N9TA 1HHVA 2Z6KC 4JI0L 2KCNA 5LL6S 4AH6A 3CCVA 2A19A 2B2UC 4P2CB 1SRUA 3CMAA 2ICEC 2B2VA 4C3HH 2DJGC 3EN2A 4PMBA 1YZ6A 2L0CA 1ASZA 4LF8L 2ZXPA 1N34Q 3K80C 1TWAH 4KMUC 1IHZA 4H13C 2CW0D 4GOPC 4PMWA 2FFKB 3PO3H 1EYDA 3T1YQ 1V1PB 3S1NH 2X6LA 3H3VH 3PF4A 5JJLA 5M5XH 3BZCA 2NZHA 2IL8A 3R2IA 2BDOA 4WRDA 3A8KE 2Y0SE 1STEA 2E2JB 5KNCA 3I4NB 1OXXK 4ZYSA 3I4OA 3H91A 1TT2A 2EYFA 4HCEA 4NW2A 4OWXB 4NKLA 1QB5D 1SJED 3G71A 4FO2A 4JI6Q 2MO1A 2NWGA 1QZHA 3I4MB 3MWYW 3GTGB 2WB1B 4OXPA 4JV5Q 2SNSA 5AFWA 2KJXA 5C5MA 2F0NA 1LM0A 4BA1I 4HR7B 1FNWA 1U9RA 4A3EG 4DV2Q 3ULJA 2SOBA 4LJZC 5ELCA 5IGEA 3MFGA 5C4HA 4DV7L 1WD0A 2VB3X 4XIGS 1U0LA 1PH7A 1U4RA 4HAEA 3S1QH 1VQ8A 2IT1A 1HNZQ 3AEVA 4A3EH 3HKZB 5DM73 3HOYH 2CVRA 2EVBA 4BY1H 1PRTD 1IL2A 1TWCB 3KBGA 4FXGC 5LL6X 4DR2Q 4A3IH 4OO1G 4YHHQ 3M7NA 2EJFC 1NUCA 4KV6A 1AE3A 1J9OA 4HTHA 3AB9A 5C4ZA 1SYEA 1WI5A 1NJIC 3ULLA 1B3AA 3UDIA 1V9PA 4R1JA 5LMNQ 3D4WA 2NN6G 4HIMA 4LF6Q 3CP0A 4QL5A 2F0MA 1FJGQ 2SDFA 2N49A 2ZJPA 3Q23A 2V4DA 1EY8A 2IX0A 4OWTB 3NWSA 4TRDA 3A5ZB 2F0JA 4BS9A 3KDFA 4DR3Q 1HUMA 3FDTA 4AYBE 3J81L 1K83B 2B2TC 2IWHA 1LO5D 2L9HA 4X65Q 4CJ1B 2E8GA 2ZJQA 5JJIA 3I4MG 4HIKA 2NUCA 4KJOA 4IPDA 1ET6A 2WB1G 4KKUA 2L5TA 3A7LA 2NVXB 2M2LA 1HR0L 1I6HH 1O80A 2G9HD 3HZXA 4R9WA 3S2HB 2SEBD 3D3RA 3VYSA 1UAPA 1VQNA 1EY0A 2B3GA 2NVYB 1EIGA 3DM3A 2PQAA 3A7AB 3R93A 2FMMA 2ZTEA 4ZUJA 3SE0A 1L0WA 1CKNB 5BN5A 3GTPB 1B44D 4LMQD 1XMQQ 4LAAA 4GN3B 5CGKA 4M8AA 2EY1A 3HKZG 2IJ0A 4JI7L 1MSGA 2AHOB 3K5OA 4K2LA 4C3IB 1A15A 4KI0A 4A3DB 4A3BB 4YWKA 2F0LA 1JR0D 1JWMD 2JSOA 1LTID 1S5DD 2JXMB 4UP8A 1Y1WB 5DEHA 2VXWA 2EY2A 4JC0A 3TZUA 1BCPF 1N32L 2F0TA 2K52A 1L1OC 2O2LD 1TR5A 2SNMA 2F3IA 3DMUA 1Q86C 2UUAQ 1F2YA 3M4OB 1YNND 1LACA 2ZT9C 1YNNC 1N36Q 5GROA 1CA5A 4AIMA 4IQZA 4JI3L 4RAUC 5KRUA 1QCBD 2EOTA 3ULPA 1KNEA 4MTNA 1EZ6A 3FEWX 4LFAQ 3I7FA 4H02A 3W1GA 2B2WC 4C2MB 3J7A5 1KC8C 1BOSA 5IGGA 2J4XA 2D0PA 2EY5A 2JA8H 1CZWA 5IY0A 1A63A 1WYDA 3P20A 1A8VA 3CAMA 4RGMA 2EJMA 3JAMi 2BDNA 3OTOL 4BBRH 2PYKA 3RN5A 1Z9FA 5FK9C 1SFOB 1S5BD 4KKTA 2E5LL 4C1NK 4FF1A 2C35B 5BN4A 4B3RQ 3HRZC 5E4XA 4Z9CB 3I56A 1FGUA 4O0AA 1EOTA 1DD2A 1YEZA 4XYOA 3RNUA 4JYAL 1Y8PB 4DV4Q 5EPLA 3SK5A 3HS0C 2Z4IA 4C3IG 5M5WB 4A3DG 2KA7A 4A3BG 2A73B 2E2DC 3M7GA 4DK1A 5K5PA 3VR3A 1FGBD 2VY3A 3G7LA 3RLFA 1C4QA 2C5CA 2UUBQ 2GVBA 1EOVA 1YHAA 2F0DA 1AP0A 1ENAA 2Q2IA 4QJFA 4GNXC 1B2TA 3HOVB 2V1CC 4V190 5IWAQ 4DV5Q 3ICEA 4CKEA 3GTQH 4WJ3M 1VQ9A 5CV7A 4IFDJ 2F4VL 4K6DA 2NZOA 3X3MA 1PTOF 2FJ2A 1EWIA 5E1FA 4DV0Q 1SMXA 4RGNA 5CV6A 3JAME 1K73C 4DAPA 4F8MA 3GTKH 5JPNC 2ATWA 1Y1VB 4KD3A 3UDXA 3AFPA 4DK0A 4DV1L 1SMYC 1QNUA 4KHPQ 1SNMA 5T1GA 2QEJC 4X64Q 2NYZD 1JOOA 4DN4M 4U68A 2MGSA 1H9KA 4KHZA 1AE2A 2XRQD 2WIIB 2YTXA 2D9UA 1HNXL 1LT3D 2UUCQ 2LFNA 1KLUD 3BJUA 4YY3Q 5M3FB 2AWOA 3VR2A 4IURA 2LKVA 2Z1CA 5LMUQ 1SDFA 2PW7A 2Q2TA 3Q24A 1FD7D 2AKWB 1JMCA 4OWWB 2EQSA 2ALYB 1PA6A 2HDLA 4OO1I 1QE6A 2B2VC 1JJ2A 1TWFB 2MFIA 3HOUB 4GKKQ 3S15H 1I4XA 1SE3A 1QG7A 2KCTA 4JI2Q 2DUDA 5KIXA 2M00A 3I91A 1I3QH 2JA6B 1Q12A 2Z0SA 4EQPA 2NN6I 4ZAIA 1B8AA 5C44G 1V43A 4KTAA 4RA8A 1HTLD 3HOVG 3G4SA 3CCRA 4RMFA 5FO7B 2WB1E 2CHBD 3I3CA 4XQQA 1CHQD 3CQZH 1ONLA 3Q6SA 5IGCA 1D5ZC 5KNDA 5BR8L 3U4ZA 1NCVA 3HOZB 2YYZA 3HGBA 1Q8KA 3CKIB 3DWPA 1IYVA 4JI8L 1Y1VG 4N8X1 1RF2D 3H94A 4PQXA 3KF6A 3HOXH 3MVVA 2HUGA 3PCOB 1OXVA 1EFWA 3T13A 3NBHB 2F0PA 4HJ8A 5C4XB 2KEDA 3V05A 1E1OA 4APVA 3HKZE 2MQHA 3ERSX 2BH2A 5M5YH 1J5EQ 1PVOA 2K05A 3BVGA 5ELFA 3Q22A 4B3TL 3E9HA 1NAPA 1S5CD 3GTMB 1N9WA 4DXGA 2J7ZA 1PTOB 2RA4A 3ITPA 3RN2A 1EQTA 3QOJA 1AZPA 1PFMA 4JI4L 2TSSA 4DNIA 4CDFC 1F9SA 1MJCA 5M3FG 3LX0A 3S1MH 4GKJL 4JBJA 2EXZA 5EAYA 1SNQA 2K32A 1MIUA 3ND8A 4QUFA 4A3KG 3MTSA 5GQOA 4IFDG 4RWSC 1TIID 1JQYD 2DNEA 4K14A 2BE5D 3OSOA 1EEFD 1YBYA 3I73A 3HOUG 3E5SA 3B6YA 2NBFA 4WFN3 2UXDQ 1VQAA 2F0UA 2JA6G 3J80L 2GA4B 5IE8A 3BU2A 1U4PA 3CF5A 1CM9A 3A8IE 1OO9B 4LF7L 3MC0B 1YNJD 3J81c 1VF5C 2CFMA 1YNJC 4K6LA 1YITA 1UEBA 4ZCKA 1KDCA 1B9MA 1VQFA 5FLXL 1ENFA 4Q5VA 1X3FA 4B3SL 2JQOA 4IOAA 2B8GA 4XXEA 2OF1A 3PUYA 2VQFQ 3M3YH 1IL8A 4QB4A 3HOZG 3P7JA 2MHVA 1N33Q 2R92H 2X69A 1UEAB 1ENCA 3FKIH 2VB2X 3G6JB 4KHVA 5I9OA 4DR7Q 1FVIA 2B2YC 4RHRA 4O42A 3K81C 5C4XG 5C3WA 3GTJH 3J7ZC 1SE2A 3VR6A 4DR4L 2F4IA 3KBXA 1ZKOA 1UE5A 3K8AA 3SGIA 2E2IB 3I2ZA 3N52A 1GO3E 2QDLA 3RR5A 5IYCG 1AFPA 1TS4A 2R93G 4A3MH 1KIXA 3TSSA 2F03A 5COYA 3DEPA 1SSOA 3IL8A 1SNDA 4LNQA 4R8NA 1WCMB 2JYOA 3T1YL 3VYTA 2A5HA 5CORA 2AWNA 2QA4A 5D65A 2L11A 2ZTCA 4DV6Q 3TP8A 3BDLA 1RTNA 4P75A 1LTSD 2ID0A 5ELDA 1I50H 1ZEQX 3TREA 2F1MA 2AUJD 4A3CG 4R4IA 3S1NB 4F88A 4A3FB 4DXFA 4Y7NB 1LUZA 1S72A 1CSPA 1YI2A 5JEAH 4G7ZC 1BVSA 1W3SA 4FNFA 1STHA 4DUYL 2KCMA 3FHWA 4RH6A 2YV5A 2DNCA 2QILA 3S1RB 3A5UA 1KD1C 2PI2E 1YJWA 5H1SE 4GOPB 5C0XH 3BVMA 2HQLA 2JEBI 2O5JC 3KLSX 1BF4A 1VMCA 2YU9B 3CMEA 1SXTA 2KENA 1EYGA 3RLNA 3BYTB 4LF5Q 4A93B 2OXPA 1IBMQ 2KHIA 2AMCB 2QW7A 5LHY1 1WTPA 1HRJA 4P73A 1PV4A 2NB0A 3ER0A 4POGA 1STAA 2VL6A 4JG2A 1ILPA 3FMCA 3O13A 4K0KQ 5C3EH 3VDYA 4CDDC 2F0HA 4WORA 4HIDA 1STYA 3KK7A 2G5DA 3EA6A
chains in the Genus database with same CATH topology
4JBMA 5IP7G 1VQ5A 3TEHB 1XNQL 4X65Q 3MXNB 2E8GA 4J15A 4EX5A 2ZJQA 5JJIA 4RG1A 1N8RC 1HNXQ 1TWGH 3I4MG 4HIKA 1UE1A 2JJQA 1NE3A 2PQAB 4IPDA 4A3KH 4NXMQ 3HOWH 2WB1G 1IZ6A 3E9IA 1CKMA 1XMOL 1PH9A 1JE5A 1JT8A 2H5XA 3AQQA 4GLVB 1HR0L 1TWFH 4LF9L 1I6HH 3JC66 3HOUH 1OXUA 4JI5L 4QGUA 4GN5A 3RZOH 4POFA 2VZAA 4IOCA 5LMNL 1VQNA 1WCMG 2B3GA 4DV3Q 1QZGA 3DM3A 4JI1Q 4LF6L 2PQAA 2JA6H 2K5HA 3PV0A 4DUZQ 1HZ9A 2ZTEA 1L0WA 1HZCA 1CKNB 3H0GH 4TVAB 4YCWA 1XMQQ 1G6PA 4GN3B 1L2FA 3CXCA 1D8LA 2CCZA 3HKZG 3CD6A 4BY7H 4A3FG 3RLOA 4JI7L 4R4TA 4ME3A 2AHOB 4UY8C 1IBKL 4KI0A 1J6QA 2F52A 2VQEQ 2ZJRA 4YWKA 1CKNA 1GM5A 2UXCL 2UXDL 5J3BA 1CKOA 3PO2H 1GKHA 1P16A 2K4KA 3HOZH 1EIYB 3S24A 1Y14B 1YVCA 5FJ8G 4TQUS 1IXRA 3K7AH 4UP8A 1XPOA 4R4CA 4JC0A 1N32L 1T9HA 1Q82C 1TXYA 2K52A 1L1OC 1XPUA 1IYJB 1K3RA 1SLJA 5BR8Q 2F3IA 5C4XH 1OTCA 2UUAQ 1Q86C 1N34L 4DV3L 1B70B 3CC7A 4YCUA 4JI1L 3CC4A 2I5LX 4O2DA 2D62A 4NXNL 3CPWA 1SROA 4MNOA 4JI8Q 2HT1A 4A93G 3PF5A 1SN8A 2NVQH 1HZBA 2BA0A 1JJGA 1N36Q 5GROA 3F2BA 5M5WH 5IYCH 1G51A 4AIMA 4JI3L 2R93H 1VQOA 4JYAQ 1LTLA 3ULPA 1W2BA 4LFBQ 2HIVA 4MTNA 5ELOA 3U50C 3CCEA 1N33L 4LFAQ 3I7FA 4H02A 2A8VA 3W1GA 4PZ8A 1NMFA 1U5KA 3EIVA 3KF8B 3J7A5 1KC8C 2HHHQ 4B3TQ 4DR7L 2D0PA 2B63G 5M3MH 1PYSB 4B3MQ 2JA8H 1YJNA 5IY0A 1B7YB 1A63A 1WYDA 1YHQA 2VUMG 3NEMA 1Z47A 1A8VA 3M85A 3CAMA 4BXXG 2K5NA 3JAMi 2OCEA 4JI6L 3OTOL 3HOXG 4IFDI 4BBRH 1BBUA 2ZTDA 2K50A 5JEAJ 3RN5A 3G6EA 1Z9FA 2UU9Q 1VQ6A 4GKJQ 1EQQA 2B63H 1KAWA 4JCVE 1VQPA 4JOIC 2NVTH 4JV5L 2KHJA 4A3LG 4A3CH 3KJPA 4EQ5A 2E5LL 1H95A 4JBWA 2C35B 3M9BA 4B3RQ 4DAYB 3TRZA 1HH2P 3I56A 1KQSA 2R7ZG 4DV2L 5C0XJ 1FGUA 4O0AA 2PI2A 4PG3A 3W1BA 1YHBA 3KDFB 4QQBX 4IJLA 1Q81C 1KL9A 1YEZA 3KOJA 2Y0SG 3RNUA 4JYAL 1R9TH 2JEAI 1KXLA 1TWHH 1X6OA 4DV4Q 2R7FA 4LUOA 4JI0Q 3W5OA 1HNWQ 4DKAC 4A3JH 4QY7A 2EXDA 1VQLA 2HHHL 1VQHA 3J81j 5IYBG 1HNZL 2MO0A 4A3DG 5HGQA 3I4NG 4LF7Q 2ASBA 4A3BG 1PH1A 2YTYA 2CQOA 2VY3A 3J80i 4LF8Q 2VNUD 3RLFA 1C9OA 4UP7A 5AJ3Q 4HJ5A 2UUBQ 2B29A 2GVBA 1EOVA 1YHAA 1WFQA 2Q2IA 3UE0A 4QJFA 4GNXC 4HJ7A 2L15A 2V1CC 3L7ZC 2WAQE 1OXTA 4R4OA 5IWAQ 4DR2L 4L5QA 4DV5Q 1PH3A 2UU9L 3ICEA 1L1OB 3MEFA 4XTCS 3PSIA 3GTQH 1I94Q 4YHHL 3AFQA 1E22A 2E2JH 1Q7YC 2GN5A 4WJ3M 1VQ9A 1AH9A 4JBKA 4X62Q 1XNRL 4IJHA 1QVCA 1IBLL 3KJOA 1ASYA 2F4VL 4DR6L 3HFZB 4IFDJ 1VQIA 1VQBA 2NZOA 1QVGA 5ELNA 5GADC 1EWIA 2XTIA 5IP7H 4DV0Q 2QEXA 3F8TA 1BBWA 1SMXA 1K73C 2E2IH 2LXKA 3KLWA 1L1OA 2CWAA 5HY6A 3I4MH 3GTKH 2ATWA 3LGJA 4LF5L 1PH6A 1IBML 1UE7A 2BH8A 3UDXA 3ZJYC 3AFPA 4DV4L 1S40A 1FJGL 4DV1L 4FDBA 4DR4Q 2JA7G 3BZKA 3GO5A 4KHPQ 3F2CA 1P8LA 1E1TA 4X64Q 2RHQB 4IO9A 3PO3G 2UXBL 5K36G 3HKSA 4K0KL 1GD7A 1WCMH 4HIOA 4YWLA 2FXQA 2PMZE 4OX9Q 5IP9G 4GS3A 1C7YA 2R92G 4DR3L 4KHZA 1AE2A 3FKIG 2UUBL 1VQGA 1PH2A 2YTXA 4X65L 4PZ7A 3J80c 2LSSA 3UE1A 2JA7H 1HNXL 4LF4Q 2ZM6Q 2UUCQ 4DPGA 4LWCA 4IPGA 4NXML 3BJUA 1I5FA 5GAHC 4YY3Q 4DAMA 3CCUA 2DGYA 2AWOA 1WOCA 4P74A 4AQYQ 4DV7Q 4A3FH 1K8GA 4DR5Q 4Y7NH 1HZAA 3AYHB 5LMUQ 5C4JH 4WJ4A 1UE6A 4LUZA 1TWCH 5C0XI 1M90C 2Q2TA 4DV0L 5FLXc 2IY5B 2I5HA 2AKWB 4A3MG 2GVAA 1YIJA 2EQSA 2ALYB 1JMCA 4OWWB 2JE6I 4YCVA 3UDFA 1PA6A 2JA5G 5FLMG 1K0RA 2I5MX 4JOIA 5FJ8H 4DUZL 3S14H 4OO1I 1SE8A 2EIFA 3PIOA 3S1RH 1JJ2A 2MFIA 4GKKQ 1K9MC 4AYBG 3H15A 3GTMH 1XMQL 3S15H 4KHPL 3U58A 2KCTA 5IT9c 4JI2Q 2DUDA 1I3QH 3STBD 4DUYQ 1KHIA 3T1HQ 4MZ9A 1Q12A 2Z0SA 2YU9H 3STBC 1JB7A 2NN6I 1S3OA 2WP8J 3PUXA 1LYLA 1B8AA 3GDEA 3OW2A 5C44G 1VQMA 4A93H 2N8NA 2VQEL 3CCMA 1V43A 3S2DH 1CUKA 2WFWA 4GN4B 4UP9A 4GNXB 3HOVG 2D0OA 3G4SA 3CCRA 1X3GA 4RMFA 2ZM6L 3CCLA 4LF4L 2WB1E 4JI4Q 3HOYG 1VQDA 1EUJA 1PHJA 2IX1A 4YY3L 3U4VA 3CQZH 1UWVA 3KF6B 4BY1G 1YNXA 4DR5L 5JEAG 4A76A 3A0JA 4HJ9A 1PH4A 1NMGA 3D31A 3G48A 4X6AH 5BR8L 1K83H 3U4ZA 4GNXA 4DR1Q 1VQKA 2UUAL 2YYZA 4A3IG 3GTOH 2BA1A 1E3PA 4L5TA 4OONA 1Q8KA 4R4QA 2VUMH 4BXXH 4JI8L 1Y1VG 1VQCA 3Q8DA 4LFCQ 1X65A 2CKZB 1KRSA 3KF6A 3HOXH 1N36L 1QVFA 3PCOB 1OXVA 4NB3A 5C0XG 3NBHB 4GLXA 1EFWA 2NVXH 4HJ8A 3TS2A 1PH5A 1E1OA 4APVA 1XNQQ 3HKZE 4GLAC 1KRTA 4LFBL 1G291 1PYBA 4A3LH 4BBSG 1QUQB 4LFAL 2MQHA 3S2HH 3ERSX 2BH2A 3PUVA 5M5YH 1J5EQ 2NVYH 1PVOA 3K0XA 4NPSA 5GAGC 4A75A 4B3TL 4L5RC 1HJPA 3E9HA 1NY4A 3J81i 1V1QA 1XMOQ 3S17H 4B3ML 2R7ZH 1N9WA 1HR0Q 2OQKA 1DGSA 4ALPA 4JI5Q 3GTPH 1O7IA 3DLLA 3RN2A 3OYYA 5C3EG 4JI4L 1XTDA 1QUQA 3K7UC 3S16H 4DNIA 1Y1WG 1MJCA 5M3FG 4B3SQ 1HR0W 3S1MH 4GKJL 3JAMc 4JBJA 4PZ6A 1A0IA 1SR3A 1EIFA 5IYBH 5EAYA 4C3IH 4A3DH 1E7ZA 1JJCB 4GOPA 3I4NH 4DR1L 4A3BH 1MIUA 3CW2C 4A3KG 5GQOA 3HOWG 1XPRA 4IFDG 2OTLA 4B3RL 2MNAA 5E7NA 2HIXA 3CC2A 1VCIA 4JI7Q 2RHSB 1YBYA 1VQJA 3HOUG 1IBKQ 2KBNA 3B6YA 3L2PA 3D0FA 3CCSA 2OQ0A 1XJVA 3KFUA 3GD7A 1NTGA 1E24A 3F1ZA 2VW9A 3GTGH 2UXCQ 2UXDQ 2Z6KC 3GTLH 1VQAA 4JI0L 2JA6G 4AH6A 3CPFA 1BKBA 3BU2A 1VQEA 3KYHC 5IE8A 3CCVA 2A19A 1J5EL 3M4OH 1HNWL 1SRUA 3CMAA 3CF5A 3H0GG 4C3HH 1N32Q 2OTJA 4LF7L 3EBEA 1VQ4A 3EN2A 1ASZA 1YZ6A 2LXJA 5DLQE 3J81c 1GVPA 1X9NA 2E2HH 4LF8L 1RL2A 2CFMA 1N34Q 3K80C 5AJ3L 1YITA 1UEBA 1TWAH 4P71A 1VQ7A 4BY7G 2N78A 1VQFA 4NXNQ 1D7QA 4GOPC 1FL0A 1X3FA 2Q2UA 2JQOA 4PMWA 4UPAA 3WWVA 4C3JH 4C2MH 5IWAL 4DV5L 4B3SL 5JJKA 4IOAA 5IYDG 3M4QA 1I94L 3PO3H 3FP9A 3T1YQ 3PO2G 3PUYA 2IHEA 2VQFQ 3H3VH 4JI3Q 3HOZG 3PF4A 4X62L 1Q1EA 2IHFA 3S1NH 1X56A 5M5XH 5JJLA 5IP9H 1Q46A 1N33Q 3F2DA 3BZCA 2R92H 2NZHA 3M3YH 2R6GA 3FKIH 3E0EA 2R7DA 4HJAA 4A3GG 4DR7Q 2Y0SE 4DK6C 3IRBA 4DK3C 1FVIA 4IPHA 3K81C 5C4XG 1OXXK 3GTJH 5IYDH 3J7ZC 3I4OA 1SFOH 4DR4L 4OWXB 3PUWA 1RIPA 4X64L 4X66Q 3G71A 1UE5A 2MO1A 4JI6Q 3OTOQ 3K8AA 3SGIA 1QZHA 3I2ZA 1GO3E 3RR5A 5IYCG 2Q2HA 2VS1A 4A3GH 2R93G 2WAQG 4A3MH 3NELA 1KIXA 4OX9L 4OXPA 2JA5H 4JV5Q 5FLMH 2K75A 2N3SA 2E5LQ 2RCNA 4YWMA 3NENA 1LM0A 4BA1I 4IPCA 4Y52H 5M3MG 2UUCL 4A3EG 1C0AA 3I55A 1A62A 4DV2Q 4LNQA 2JA8G 3ULJA 3RZDH 3T1YL 1PFSA 2VQFL 2AWNA 2QA4A 4AQYL 2ZTCA 4DV6Q 4DV7L 4XIGS 4P72A 3PUZA 2ES2A 4LUVA 1U0LA 3CCJA 5LMUL 1PH7A 5C44H 4BBRG 4P75A 1X3EA 4BA2I 4A4IA 2ID0A 2PNHA 3S1QH 1VQ8A 1I50H 3TREA 3HOVH 2IT1A 1HNZQ 1K8AC 4A3EH 3AEVA 4A3CG 4R4IA 2JK8A 1WJJA 3HOYH 1M1KC 4GKKL 1LUZA 1S72A 3CCQA 4BY1H 1CSPA 1YI2A 1IL2A 2JA9A 2K5VA 3PGZA 4X66L 4JI2L 1BVSA 1W3SA 4DR2Q 3TS0A 4DUYL 3T1HL 1EQRA 4A3IH 2KCMA 4OO1G 2QGQA 3FHWA 4YHHQ 3M7NA 1PH8A 2YV5A 3M4PA 3TQYA 2OWOA 3A5UA 2Z6KA 1KD1C 1Y1VH 1XNRQ 2F4VQ 1IBLQ 4DR6Q 2PI2E 1AE3A 1YJ9A 4A3JG 1YJWA 5H1SE 1Q1BA 3A74A 4GOPB 4LF9Q 2I0QA 2HQLA 1NJIC 1CSQA 1WI5A 1VS0A 2JEBI 1MKHA 5GAEC 3ULLA 3UDIA 1V9PA 2XGTA 4R1JA 5LMNQ 2NN6G 3CMEA 4HIMA 2KENA 1EYGA 3CP0A 1NBWA 4LF6Q 4BBSH 4QL5A 2CWPA 3RLNA 4LW1A 4LF5Q 4DV6L 1IBMQ 3H3VI 2KHIA 1FJGQ 2AMCB 2YTVA 2RF4A 4DV1Q 2N49A 4QIWE 2ZJPA 5LMNW 3PIPA 4P73A 1PV4A 1MJEA 3ER0A 4POGA 2IX0A 4OWTB 4KLKA 2A1AA 2VL6A 4JG2A 2UXBQ 1OXSC 3UDGA 3A5ZB 4K0KQ 5C3EH 3VDYA 2K14A 1X54A 3KDFA 4LFCL 1X55A 4AYBE 1Y1WH 4HIDA 5M3FH 3L0OA 4DR3Q 4L5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBM A;  5IP7 G;  1VQ5 A;  3TEH B;  1XNQ L;  4X65 Q;  3MXN B;  2E8G A;  4J15 A;  4EX5 A;  2ZJQ A;  5JJI A;  4RG1 A;  1N8R C;  1HNX Q;  1TWG H;  3I4M G;  4HIK A;  1UE1 A;  2JJQ A;  1NE3 A;  2PQA B;  4IPD A;  4A3K H;  4NXM Q;  3HOW H;  2WB1 G;  1IZ6 A;  3E9I A;  1CKM A;  1XMO L;  1PH9 A;  1JE5 A;  1JT8 A;  2H5X A;  3AQQ A;  4GLV B;  1HR0 L;  1TWF H;  4LF9 L;  1I6H H;  3JC6 6;  3HOU H;  1OXU A;  4JI5 L;  4QGU A;  4GN5 A;  3RZO H;  4POF A;  2VZA A;  4IOC A;  5LMN L;  1VQN A;  1WCM G;  2B3G A;  4DV3 Q;  1QZG A;  3DM3 A;  4JI1 Q;  4LF6 L;  2PQA A;  2JA6 H;  2K5H A;  3PV0 A;  4DUZ Q;  1HZ9 A;  2ZTE A;  1L0W A;  1HZC A;  1CKN B;  3H0G H;  4TVA B;  4YCW A;  1XMQ Q;  1G6P A;  4GN3 B;  1L2F A;  3CXC A;  1D8L A;  2CCZ A;  3HKZ G;  3CD6 A;  4BY7 H;  4A3F G;  3RLO A;  4JI7 L;  4R4T A;  4ME3 A;  2AHO B;  4UY8 C;  1IBK L;  4KI0 A;  1J6Q A;  2F52 A;  2VQE Q;  2ZJR A;  4YWK A;  1CKN A;  1GM5 A;  2UXC L;  2UXD L;  5J3B A;  1CKO A;  3PO2 H;  1GKH A;  1P16 A;  2K4K A;  3HOZ H;  1EIY B;  3S24 A;  1Y14 B;  1YVC A;  5FJ8 G;  4TQU S;  1IXR A;  3K7A H;  4UP8 A;  1XPO A;  4R4C A;  4JC0 A;  1N32 L;  1T9H A;  1Q82 C;  1TXY A;  2K52 A;  1L1O C;  1XPU A;  1IYJ B;  1K3R A;  1SLJ A;  5BR8 Q;  2F3I A;  5C4X H;  1OTC A;  2UUA Q;  1Q86 C;  1N34 L;  4DV3 L;  1B70 B;  3CC7 A;  4YCU A;  4JI1 L;  3CC4 A;  2I5L X;  4O2D A;  2D62 A;  4NXN L;  3CPW A;  1SRO A;  4MNO A;  4JI8 Q;  2HT1 A;  4A93 G;  3PF5 A;  1SN8 A;  2NVQ H;  1HZB A;  2BA0 A;  1JJG A;  1N36 Q;  5GRO A;  3F2B A;  5M5W H;  5IYC H;  1G51 A;  4AIM A;  4JI3 L;  2R93 H;  1VQO A;  4JYA Q;  1LTL A;  3ULP A;  1W2B A;  4LFB Q;  2HIV A;  4MTN A;  5ELO A;  3U50 C;  3CCE A;  1N33 L;  4LFA Q;  3I7F A;  4H02 A;  2A8V A;  3W1G A;  4PZ8 A;  1NMF A;  1U5K A;  3EIV A;  3KF8 B;  3J7A 5;  1KC8 C;  2HHH Q;  4B3T Q;  4DR7 L;  2D0P A;  2B63 G;  5M3M H;  1PYS B;  4B3M Q;  2JA8 H;  1YJN A;  5IY0 A;  1B7Y B;  1A63 A;  1WYD A;  1YHQ A;  2VUM G;  3NEM A;  1Z47 A;  1A8V A;  3M85 A;  3CAM A;  4BXX G;  2K5N A;  3JAM i;  2OCE A;  4JI6 L;  3OTO L;  3HOX G;  4IFD I;  4BBR H;  1BBU A;  2ZTD A;  2K50 A;  5JEA J;  3RN5 A;  3G6E A;  1Z9F A;  2UU9 Q;  1VQ6 A;  4GKJ Q;  1EQQ A;  2B63 H;  1KAW A;  4JCV E;  1VQP A;  4JOI C;  2NVT H;  4JV5 L;  2KHJ A;  4A3L G;  4A3C H;  3KJP A;  4EQ5 A;  2E5L L;  1H95 A;  4JBW A;  2C35 B;  3M9B A;  4B3R Q;  4DAY B;  3TRZ A;  1HH2 P;  3I56 A;  1KQS A;  2R7Z G;  4DV2 L;  5C0X J;  1FGU A;  4O0A A;  2PI2 A;  4PG3 A;  3W1B A;  1YHB A;  3KDF B;  4QQB X;  4IJL A;  1Q81 C;  1KL9 A;  1YEZ A;  3KOJ A;  2Y0S G;  3RNU A;  4JYA L;  1R9T H;  2JEA I;  1KXL A;  1TWH H;  1X6O A;  4DV4 Q;  2R7F A;  4LUO A;  4JI0 Q;  3W5O A;  1HNW Q;  4DKA C;  4A3J H;  4QY7 A;  2EXD A;  1VQL A;  2HHH L;  1VQH A;  3J81 j;  5IYB G;  1HNZ L;  2MO0 A;  4A3D G;  5HGQ A;  3I4N G;  4LF7 Q;  2ASB A;  4A3B G;  1PH1 A;  2YTY A;  2CQO A;  2VY3 A;  3J80 i;  4LF8 Q;  2VNU D;  3RLF A;  1C9O A;  4UP7 A;  5AJ3 Q;  4HJ5 A;  2UUB Q;  2B29 A;  2GVB A;  1EOV A;  1YHA A;  1WFQ A;  2Q2I A;  3UE0 A;  4QJF A;  4GNX C;  4HJ7 A;  2L15 A;  2V1C C;  3L7Z C;  2WAQ E;  1OXT A;  4R4O A;  5IWA Q;  4DR2 L;  4L5Q A;  4DV5 Q;  1PH3 A;  2UU9 L;  3ICE A;  1L1O B;  3MEF A;  4XTC S;  3PSI A;  3GTQ H;  1I94 Q;  4YHH L;  3AFQ A;  1E22 A;  2E2J H;  1Q7Y C;  2GN5 A;  4WJ3 M;  1VQ9 A;  1AH9 A;  4JBK A;  4X62 Q;  1XNR L;  4IJH A;  1QVC A;  1IBL L;  3KJO A;  1ASY A;  2F4V L;  4DR6 L;  3HFZ B;  4IFD J;  1VQI A;  1VQB A;  2NZO A;  1QVG A;  5ELN A;  5GAD C;  1EWI A;  2XTI A;  5IP7 H;  4DV0 Q;  2QEX A;  3F8T A;  1BBW A;  1SMX A;  1K73 C;  2E2I H;  2LXK A;  3KLW A;  1L1O A;  2CWA A;  5HY6 A;  3I4M H;  3GTK H;  2ATW A;  3LGJ A;  4LF5 L;  1PH6 A;  1IBM L;  1UE7 A;  2BH8 A;  3UDX A;  3ZJY C;  3AFP A;  4DV4 L;  1S40 A;  1FJG L;  4DV1 L;  4FDB A;  4DR4 Q;  2JA7 G;  3BZK A;  3GO5 A;  4KHP Q;  3F2C A;  1P8L A;  1E1T A;  4X64 Q;  2RHQ B;  4IO9 A;  3PO3 G;  2UXB L;  5K36 G;  3HKS A;  4K0K L;  1GD7 A;  1WCM H;  4HIO A;  4YWL A;  2FXQ A;  2PMZ E;  4OX9 Q;  5IP9 G;  4GS3 A;  1C7Y A;  2R92 G;  4DR3 L;  4KHZ A;  1AE2 A;  3FKI G;  2UUB L;  1VQG A;  1PH2 A;  2YTX A;  4X65 L;  4PZ7 A;  3J80 c;  2LSS A;  3UE1 A;  2JA7 H;  1HNX L;  4LF4 Q;  2ZM6 Q;  2UUC Q;  4DPG A;  4LWC A;  4IPG A;  4NXM L;  3BJU A;  1I5F A;  5GAH C;  4YY3 Q;  4DAM A;  3CCU A;  2DGY A;  2AWO A;  1WOC A;  4P74 A;  4AQY Q;  4DV7 Q;  4A3F H;  1K8G A;  4DR5 Q;  4Y7N H;  1HZA A;  3AYH B;  5LMU Q;  5C4J H;  4WJ4 A;  1UE6 A;  4LUZ A;  1TWC H;  5C0X I;  1M90 C;  2Q2T A;  4DV0 L;  5FLX c;  2IY5 B;  2I5H A;  2AKW B;  4A3M G;  2GVA A;  1YIJ A;  2EQS A;  2ALY B;  1JMC A;  4OWW B;  2JE6 I;  4YCV A;  3UDF A;  1PA6 A;  2JA5 G;  5FLM G;  1K0R A;  2I5M X;  4JOI A;  5FJ8 H;  4DUZ L;  3S14 H;  4OO1 I;  1SE8 A;  2EIF A;  3PIO A;  3S1R H;  1JJ2 A;  2MFI A;  4GKK Q;  1K9M C;  4AYB G;  3H15 A;  3GTM H;  1XMQ L;  3S15 H;  4KHP L;  3U58 A;  2KCT A;  5IT9 c;  4JI2 Q;  2DUD A;  1I3Q H;  3STB D;  4DUY Q;  1KHI A;  3T1H Q;  4MZ9 A;  1Q12 A;  2Z0S A;  2YU9 H;  3STB C;  1JB7 A;  2NN6 I;  1S3O A;  2WP8 J;  3PUX A;  1LYL A;  1B8A A;  3GDE A;  3OW2 A;  5C44 G;  1VQM A;  4A93 H;  2N8N A;  2VQE L;  3CCM A;  1V43 A;  3S2D H;  1CUK A;  2WFW A;  4GN4 B;  4UP9 A;  4GNX B;  3HOV G;  2D0O A;  3G4S A;  3CCR A;  1X3G A;  4RMF A;  2ZM6 L;  3CCL A;  4LF4 L;  2WB1 E;  4JI4 Q;  3HOY G;  1VQD A;  1EUJ A;  1PHJ A;  2IX1 A;  4YY3 L;  3U4V A;  3CQZ H;  1UWV A;  3KF6 B;  4BY1 G;  1YNX A;  4DR5 L;  5JEA G;  4A76 A;  3A0J A;  4HJ9 A;  1PH4 A;  1NMG A;  3D31 A;  3G48 A;  4X6A H;  5BR8 L;  1K83 H;  3U4Z A;  4GNX A;  4DR1 Q;  1VQK A;  2UUA L;  2YYZ A;  4A3I G;  3GTO H;  2BA1 A;  1E3P A;  4L5T A;  4OON A;  1Q8K A;  4R4Q A;  2VUM H;  4BXX H;  4JI8 L;  1Y1V G;  1VQC A;  3Q8D A;  4LFC Q;  1X65 A;  2CKZ B;  1KRS A;  3KF6 A;  3HOX H;  1N36 L;  1QVF A;  3PCO B;  1OXV A;  4NB3 A;  5C0X G;  3NBH B;  4GLX A;  1EFW A;  2NVX H;  4HJ8 A;  3TS2 A;  1PH5 A;  1E1O A;  4APV A;  1XNQ Q;  3HKZ E;  4GLA C;  1KRT A;  4LFB L;  1G29 1;  1PYB A;  4A3L H;  4BBS G;  1QUQ B;  4LFA L;  2MQH A;  3S2H H;  3ERS X;  2BH2 A;  3PUV A;  5M5Y H;  1J5E Q;  2NVY H;  1PVO A;  3K0X A;  4NPS A;  5GAG C;  4A75 A;  4B3T L;  4L5R C;  1HJP A;  3E9H A;  1NY4 A;  3J81 i;  1V1Q A;  1XMO Q;  3S17 H;  4B3M L;  2R7Z H;  1N9W A;  1HR0 Q;  2OQK A;  1DGS A;  4ALP A;  4JI5 Q;  3GTP H;  1O7I A;  3DLL A;  3RN2 A;  3OYY A;  5C3E G;  4JI4 L;  1XTD A;  1QUQ A;  3K7U C;  3S16 H;  4DNI A;  1Y1W G;  1MJC A;  5M3F G;  4B3S Q;  1HR0 W;  3S1M H;  4GKJ L;  3JAM c;  4JBJ A;  4PZ6 A;  1A0I A;  1SR3 A;  1EIF A;  5IYB H;  5EAY A;  4C3I H;  4A3D H;  1E7Z A;  1JJC B;  4GOP A;  3I4N H;  4DR1 L;  4A3B H;  1MIU A;  3CW2 C;  4A3K G;  5GQO A;  3HOW G;  1XPR A;  4IFD G;  2OTL A;  4B3R L;  2MNA A;  5E7N A;  2HIX A;  3CC2 A;  1VCI A;  4JI7 Q;  2RHS B;  1YBY A;  1VQJ A;  3HOU G;  1IBK Q;  2KBN A;  3B6Y A;  3L2P A;  3D0F A;  3CCS A;  2OQ0 A;  1XJV A;  3KFU A;  3GD7 A;  1NTG A;  1E24 A;  3F1Z A;  2VW9 A;  3GTG H;  2UXC Q;  2UXD Q;  2Z6K C;  3GTL H;  1VQA A;  4JI0 L;  2JA6 G;  4AH6 A;  3CPF A;  1BKB A;  3BU2 A;  1VQE A;  3KYH C;  5IE8 A;  3CCV A;  2A19 A;  1J5E L;  3M4O H;  1HNW L;  1SRU A;  3CMA A;  3CF5 A;  3H0G G;  4C3H H;  1N32 Q;  2OTJ A;  4LF7 L;  3EBE A;  1VQ4 A;  3EN2 A;  1ASZ A;  1YZ6 A;  2LXJ A;  5DLQ E;  3J81 c;  1GVP A;  1X9N A;  2E2H H;  4LF8 L;  1RL2 A;  2CFM A;  1N34 Q;  3K80 C;  5AJ3 L;  1YIT A;  1UEB A;  1TWA H;  4P71 A;  1VQ7 A;  4BY7 G;  2N78 A;  1VQF A;  4NXN Q;  1D7Q A;  4GOP C;  1FL0 A;  1X3F A;  2Q2U A;  2JQO A;  4PMW A;  4UPA A;  3WWV A;  4C3J H;  4C2M H;  5IWA L;  4DV5 L;  4B3S L;  5JJK A;  4IOA A;  5IYD G;  3M4Q A;  1I94 L;  3PO3 H;  3FP9 A;  3T1Y Q;  3PO2 G;  3PUY A;  2IHE A;  2VQF Q;  3H3V H;  4JI3 Q;  3HOZ G;  3PF4 A;  4X62 L;  1Q1E A;  2IHF A;  3S1N H;  1X56 A;  5M5X H;  5JJL A;  5IP9 H;  1Q46 A;  1N33 Q;  3F2D A;  3BZC A;  2R92 H;  2NZH A;  3M3Y H;  2R6G A;  3FKI H;  3E0E A;  2R7D A;  4HJA A;  4A3G G;  4DR7 Q;  2Y0S E;  4DK6 C;  3IRB A;  4DK3 C;  1FVI A;  4IPH A;  3K81 C;  5C4X G;  1OXX K;  3GTJ H;  5IYD H;  3J7Z C;  3I4O A;  1SFO H;  4DR4 L;  4OWX B;  3PUW A;  1RIP A;  4X64 L;  4X66 Q;  3G71 A;  1UE5 A;  2MO1 A;  4JI6 Q;  3OTO Q;  3K8A A;  3SGI A;  1QZH A;  3I2Z A;  1GO3 E;  3RR5 A;  5IYC G;  2Q2H A;  2VS1 A;  4A3G H;  2R93 G;  2WAQ G;  4A3M H;  3NEL A;  1KIX A;  4OX9 L;  4OXP A;  2JA5 H;  4JV5 Q;  5FLM H;  2K75 A;  2N3S A;  2E5L Q;  2RCN A;  4YWM A;  3NEN A;  1LM0 A;  4BA1 I;  4IPC A;  4Y52 H;  5M3M G;  2UUC L;  4A3E G;  1C0A A;  3I55 A;  1A62 A;  4DV2 Q;  4LNQ A;  2JA8 G;  3ULJ A;  3RZD H;  3T1Y L;  1PFS A;  2VQF L;  2AWN A;  2QA4 A;  4AQY L;  2ZTC A;  4DV6 Q;  4DV7 L;  4XIG S;  4P72 A;  3PUZ A;  2ES2 A;  4LUV A;  1U0L A;  3CCJ A;  5LMU L;  1PH7 A;  5C44 H;  4BBR G;  4P75 A;  1X3E A;  4BA2 I;  4A4I A;  2ID0 A;  2PNH A;  3S1Q H;  1VQ8 A;  1I50 H;  3TRE A;  3HOV H;  2IT1 A;  1HNZ Q;  1K8A C;  4A3E H;  3AEV A;  4A3C G;  4R4I A;  2JK8 A;  1WJJ A;  3HOY H;  1M1K C;  4GKK L;  1LUZ A;  1S72 A;  3CCQ A;  4BY1 H;  1CSP A;  1YI2 A;  1IL2 A;  2JA9 A;  2K5V A;  3PGZ A;  4X66 L;  4JI2 L;  1BVS A;  1W3S A;  4DR2 Q;  3TS0 A;  4DUY L;  3T1H L;  1EQR A;  4A3I H;  2KCM A;  4OO1 G;  2QGQ A;  3FHW A;  4YHH Q;  3M7N A;  1PH8 A;  2YV5 A;  3M4P A;  3TQY A;  2OWO A;  3A5U A;  2Z6K A;  1KD1 C;  1Y1V H;  1XNR Q;  2F4V Q;  1IBL Q;  4DR6 Q;  2PI2 E;  1AE3 A;  1YJ9 A;  4A3J G;  1YJW A;  5H1S E;  1Q1B A;  3A74 A;  4GOP B;  4LF9 Q;  2I0Q A;  2HQL A;  1NJI C;  1CSQ A;  1WI5 A;  1VS0 A;  2JEB I;  1MKH A;  5GAE C;  3ULL A;  3UDI A;  1V9P A;  2XGT A;  4R1J A;  5LMN Q;  2NN6 G;  3CME A;  4HIM A;  2KEN A;  1EYG A;  3CP0 A;  1NBW A;  4LF6 Q;  4BBS H;  4QL5 A;  2CWP A;  3RLN A;  4LW1 A;  4LF5 Q;  4DV6 L;  1IBM Q;  3H3V I;  2KHI A;  1FJG Q;  2AMC B;  2YTV A;  2RF4 A;  4DV1 Q;  2N49 A;  4QIW E;  2ZJP A;  5LMN W;  3PIP A;  4P73 A;  1PV4 A;  1MJE A;  3ER0 A;  4POG A;  2IX0 A;  4OWT B;  4KLK A;  2A1A A;  2VL6 A;  4JG2 A;  2UXB Q;  1OXS C;  3UDG A;  3A5Z B;  4K0K Q;  5C3E H;  3VDY A;  2K14 A;  1X54 A;  3KDF A;  4LFC L;  1X55 A;  4AYB E;  1Y1W H;  4HID A;  5M3F H;  3L0O A;  4DR3 Q;  4L5S A; 
#chains in the Genus database with same CATH topology
 5IP7 G;  3H3V C;  1XNQ L;  1II3 A;  2VUM B;  2EYJ A;  3RD4 A;  1FR3 A;  3QOL A;  1CKM A;  3NTI A;  1PH9 A;  4BY1 B;  5HGT A;  2H5X A;  2ZXO A;  4GLV B;  4RCN A;  5EPJ A;  3JC6 6;  1OXU A;  4GN5 A;  2WIN B;  4IUQ A;  2QDB A;  1CTM A;  3QO2 A;  1DJR D;  3MXN A;  4ZQ3 A;  4POF A;  5LMN L;  1WCM G;  4DV3 Q;  4LF6 L;  2K7V A;  2K5H A;  3S17 B;  4DUZ Q;  3P1H A;  4WJW A;  2R7Z B;  2CW0 C;  4IN3 A;  2TMP A;  4YCW A;  2A69 D;  5IGD A;  1EQV A;  1L2F A;  2A69 C;  4FXK C;  5EKK A;  1K0S A;  4RGO S;  4DNR B;  1NR2 A;  4PNY A;  3DWQ A;  1TS5 A;  4A3F G;  4G57 A;  4UY8 C;  2F52 A;  3GP7 A;  1EY4 A;  3LWU A;  1PRT B;  1GM5 A;  2UXC L;  5J3B A;  1CKO A;  1P16 A;  1LTR D;  3S24 A;  5FJ8 G;  4TQU S;  3E3X A;  1AEX A;  5HUR A;  1XPO A;  1CI3 M;  1XPU A;  1K3R A;  3GTL B;  3FPU B;  1T5E A;  4HCS A;  2D62 A;  4NXN L;  3CPW A;  4PMC A;  1SRO A;  1RDP D;  2CQA A;  4MNO A;  2HT1 A;  4A93 G;  3PF5 A;  2HDM A;  5A35 A;  2AQ3 B;  1HZB A;  1JJG A;  2LY7 A;  1B3Q A;  2DN8 A;  5J39 A;  2E2H B;  2F0S A;  1GUG A;  1ET9 A;  2QCP X;  4LFB Q;  3DM1 A;  1CHP D;  2F0V A;  4PZ8 A;  4C3J B;  1NMF A;  1MSH A;  3T53 B;  1PYS B;  1EY9 A;  1DOM A;  1JIC A;  1B7Y B;  2VUM G;  3NEM A;  4JPB W;  3ERO A;  5ISR A;  4BXX G;  3HEJ A;  1MBY A;  1PRT C;  4KKS A;  3NK9 A;  3NP8 A;  4IZ8 A;  2K50 A;  3KF8 A;  4IFD I;  1VQ6 A;  3G6E A;  3ERQ A;  2XRS D;  1F2M A;  2KHJ A;  2WV6 D;  4A3L G;  3KJP A;  1D1I A;  1BR9 A;  1H95 A;  1PZK D;  4DF7 A;  3TRZ A;  1XWE A;  1HH2 P;  2R7Z G;  4PG3 A;  4A3G B;  3W1B A;  3IFT A;  2JA5 B;  3V2T A;  1MD2 D;  1HFG A;  4OIK A;  2EPB A;  4XT3 B;  5KGU A;  4OO1 H;  1RTO A;  1WTO A;  1H9R A;  2R7F A;  4JI0 Q;  5IOC A;  2A6E D;  4DKA C;  2EXD A;  1VQL A;  3J81 j;  2A6E C;  2MO0 A;  3P75 A;  3I4N G;  1PH1 A;  3NBH A;  2NN6 H;  2XIW A;  2K04 A;  1GXD C;  3TP6 A;  4LF8 Q;  2RDH A;  1C9O A;  1SJH D;  1CQV A;  1C8C A;  3UE0 A;  4HJ7 A;  3L7Z C;  1WTW A;  4R4O A;  1JWS D;  4L5Q A;  2LMC B;  1PH3 A;  4X3T A;  1U4L A;  1L1O B;  4XTC S;  1S5E D;  1E22 A;  2RKS A;  5CYU A;  2E2J H;  2PW5 A;  1AH9 A;  4JBK A;  1XNR L;  4IJH A;  4CDC C;  1IBL L;  2R61 A;  3KJO A;  1ASY A;  4DR6 L;  1VQI A;  5ELN A;  5GAD C;  1NNX A;  2QEX A;  5L37 A;  3KLW A;  5HY6 A;  3I4M H;  4C56 C;  2H1E A;  1ICW A;  3LGJ A;  2BH8 A;  4DV4 L;  1S40 A;  2FIN B;  1W6K A;  4CHT B;  2E75 C;  3GO5 A;  3TP5 A;  1S5F D;  4C3J G;  1E1T A;  4KY7 A;  3W2D A;  3BS1 A;  2F0G A;  4IO9 A;  2UXB L;  5K36 G;  4BBS B;  3HKS A;  1GD7 A;  2FXQ A;  2WKD A;  5IP9 G;  4GS3 A;  1SAP A;  2KHS A;  1ICF B;  2O4X A;  2UUB L;  1VQG A;  3OWF A;  4PZ7 A;  3J80 c;  3UE1 A;  4PV1 C;  4LF4 Q;  2ZM6 Q;  4DPG A;  4MTK A;  1LAB A;  4QUC A;  4NXM L;  1ESR A;  1I5F A;  4J8Q A;  3J81 E;  5G3L F;  4P74 A;  4DV7 Q;  4DR5 Q;  3ONA B;  4LUZ A;  1TWC H;  1H9J A;  1TWG B;  5C0X I;  4DV0 L;  5FLX c;  2F0O A;  4IUN A;  5JPM C;  3GTQ B;  5CV9 A;  1YIJ A;  3HOW B;  2JA5 G;  2Q8T A;  5FLM G;  1K0R A;  2I5M X;  4JOI A;  3NQI A;  4J1M A;  4ZKB B;  3S14 H;  1DZ1 A;  3CRK C;  3RZO B;  1K9M C;  4KHP L;  3OIP A;  1ESF A;  3TN2 A;  3PIP 3;  1A3V A;  3GTK B;  4C1N I;  1JB7 A;  3PUX A;  2BOS A;  1LYL A;  3H0G B;  1L0Y B;  2VQE L;  1B50 A;  1CUK A;  1HQM C;  2WFW A;  3EVQ A;  4GNX B;  2D0O A;  3CHB D;  3SXH A;  1X3P A;  3TDQ A;  1VQD A;  1EUJ A;  1PHJ A;  4BY7 B;  1H9S B;  4YY3 L;  3D6C A;  2AQ2 B;  1UWV A;  2KEC A;  1F9R A;  1C48 A;  3MXU A;  3A0J A;  1PH4 A;  3G48 A;  4CJ0 B;  3PO2 B;  1K83 H;  2F0I A;  4DR1 Q;  2RSO A;  1Y8N B;  4OON A;  4R4Q A;  5D3I B;  1K28 A;  4OEM B;  4XQN A;  4JW0 A;  2Z9H A;  3U9O A;  1QVF A;  2CKZ B;  1KNA A;  1KRS A;  4NB3 A;  4DAV A;  2NVX H;  2EZV A;  1KRT A;  1G29 1;  5IGB A;  1GUS A;  4BBS G;  1QUQ B;  3S2H H;  1SNP A;  3C1E A;  3K5L A;  2O5I C;  2NVY H;  1I4R A;  3K0X A;  4KK7 A;  4NPS A;  3OPO A;  4EQO A;  4K2K A;  4A75 A;  1XX8 A;  4B3M L;  1TQO A;  1HR0 Q;  2P5Z X;  3GTP H;  1JCK B;  1G2T A;  1F9Q A;  3R2T A;  1Y1W G;  3HG9 A;  5M3M B;  4EVO A;  1MI2 A;  4C3I H;  4A3D H;  1E7Z A;  1JJC B;  2XWB B;  4GOP A;  4A3B H;  3CW2 C;  3QWN A;  1ZXT A;  3HOW G;  1XPR A;  1WTV A;  2MNA A;  3CC2 A;  5J1Z A;  4JI7 Q;  2B63 B;  2NVT B;  3CCS A;  3GD7 A;  4CGY B;  2VW9 A;  3KUP A;  3D4D A;  1SE4 A;  5FO8 B;  2PMZ B;  1J5E L;  3CPF A;  1BKB A;  3KYH C;  1VQE A;  5KEE A;  4QF4 A;  3M4O H;  1HNW L;  5JAV A;  4XYQ A;  3H0G G;  2M9V A;  3GV3 A;  3J7A V;  1N32 Q;  3I72 A;  2OTJ A;  1VQ4 A;  3C3L A;  2LXJ A;  1DXM A;  1TWH B;  4ME5 A;  1I4G A;  1B53 A;  1RL2 A;  5AJ3 L;  5F2D A;  5A2Q L;  1VQ7 A;  4BY7 G;  2N78 A;  4A3J B;  1D7Q A;  1V1O A;  4JVZ A;  3WWV A;  5JJK A;  4C2M H;  4IAL A;  3M4Q A;  1I94 L;  3FP9 A;  1BQQ T;  3PO2 G;  2RBM A;  2IHE A;  2Y0S B;  4JI3 Q;  4X62 L;  1Q1E A;  4KJN A;  5IT9 L;  3F2D A;  1MGS A;  4MN3 A;  1EY5 A;  3E0E A;  5FKA C;  2R7D A;  1Z6H A;  4K5X A;  1E2V A;  4DK3 C;  1D6E C;  5I4D A;  4IPH A;  3DHQ A;  1V1P A;  2IPK D;  1SFO H;  1T5X D;  4L63 B;  2PNR C;  1SYG A;  4N8F A;  4X66 Q;  3OTO Q;  2Q8R E;  1EWH A;  2VS1 A;  1ZYR D;  3WOF A;  4OX9 L;  4CKC A;  3K58 A;  1ZYR C;  2E5L Q;  2RCN A;  1RKN A;  4OEL B;  3NEN A;  4KN7 C;  1A3T A;  1G8Z D;  1TVX A;  4NMZ A;  5M3M G;  1C0A A;  3I55 A;  1A62 A;  1I4H A;  2H4O A;  3RZD H;  5EGT A;  2K5W A;  2VQF L;  2RQX A;  5EJW A;  4AQY L;  1GHJ A;  4P72 A;  3PUZ A;  1DM0 B;  1RD9 D;  4LUV A;  4DNT B;  3ND9 A;  3CCJ A;  5C44 H;  2JA7 B;  1X3E A;  3NUC A;  1BCP D;  2EY6 A;  2PNH A;  4K8I A;  4B9X A;  3DWA A;  4ID6 A;  3HOV H;  1BCP C;  1K8A C;  4OHJ A;  2JK8 A;  1WJJ A;  3MXP A;  2R92 B;  5C4J B;  3DXJ C;  1CZG A;  3FKI B;  5JVG 3;  3PGZ A;  2F0K A;  3T1H L;  2QGQ A;  3OIQ A;  4UAI A;  1PH8 A;  2OWO A;  3T16 A;  1Y1V H;  2F4V Q;  1NR4 A;  4LF9 Q;  4A3J G;  1SYD A;  1Q1B A;  3A74 A;  3H6M A;  2I0Q A;  1Q8I A;  1MKH A;  4ZLT F;  3MEH A;  1NBW A;  2CWP A;  3A55 A;  3SVM A;  4DV6 L;  2KUM A;  3DEO A;  3S2D B;  4DV1 Q;  2YTV A;  2RF4 A;  2HD3 A;  3NXW A;  5CBE E;  2E76 C;  5LMN W;  1W6J A;  2EYL A;  1MJE A;  3C46 A;  4KLK A;  5I2X A;  1SYB A;  2A1A A;  1OXS C;  2K14 A;  4E6I A;  4LFC L;  1D5X C;  2RDG A;  2ICI A;  2BE5 C;  3F2U A;  5T1I A;  3WOE A;  5M3F H;  4L5S A;  3PIO 3;  3GTO B;  3TEH B;  4EX5 A;  4RG1 A;  1N8R C;  1HNX Q;  3OWE B;  1EY6 A;  4F7X A;  2PQA B;  4A3K H;  4IFD H;  4HSV A;  1XMO L;  1JT8 A;  2F0E A;  4EGV A;  4NDX A;  3AQQ A;  1TWF H;  3HOU H;  4JI5 L;  4QGU A;  3D6W A;  2VZA A;  4IOC A;  1TY0 A;  3OMG A;  4JI1 Q;  3FVQ A;  3QB3 A;  1S4Z A;  3E6Z X;  2JA6 H;  3L9A X;  3PV0 A;  1HZ9 A;  5I2Y A;  1LTA D;  1HZC A;  3VYR A;  1EU3 A;  4CKB A;  1O7Z A;  1D1K A;  1G6P A;  5EPK A;  3BDO A;  1D8L A;  3S16 B;  4ODG A;  1PZJ D;  1MHW C;  3CD6 A;  3EQL C;  2HCC A;  3RLO A;  4ME3 A;  4B9W A;  1O7Y A;  1IBK L;  1PFN A;  1PTO D;  2A6H D;  1CKN A;  3T51 B;  2A6H C;  2NTS A;  1GKH A;  2K4K A;  3HOZ H;  2E74 C;  1Y14 B;  4OL7 A;  4I7Z C;  3K7A H;  3K5N A;  1Q82 C;  5E3F A;  3IAY A;  5EKI A;  1IYJ B;  1SEB D;  1SLJ A;  5BR8 Q;  5C4X H;  3J80 E;  1OTC A;  1N34 L;  3FRP B;  4DV3 L;  3CC4 A;  4YCU A;  2I5L X;  4O2D A;  1PRT F;  4JI8 Q;  4C3H B;  2NVQ H;  1SN8 A;  4XQJ A;  2BA0 A;  5KNB A;  1HUN A;  5J22 A;  2F3W A;  5IYC H;  1WTR A;  2R93 H;  1PTO H;  1W2B A;  5FLX E;  1TWA B;  5ELO A;  3CCE A;  2A8V A;  4K5W A;  2LS0 1;  1SYC A;  3EIV A;  2HHH Q;  4B3T Q;  1GUW A;  3PO3 B;  3SEB A;  3H09 A;  3SHL A;  1YJN A;  5KYI A;  3K6O A;  5M5X B;  4K5V A;  3VYU A;  1YHQ A;  1Z47 A;  3M85 A;  1B9N A;  2OCE A;  2PZU A;  4DFA A;  4JI6 L;  1B4O A;  2K01 A;  1BBU A;  2ZTD A;  4GKJ Q;  1ILQ A;  2UU9 Q;  1G2S A;  4JK1 C;  4JCV E;  4JOI C;  4JV5 L;  1QNK A;  4A3C H;  2EE1 A;  4JBW A;  2JP1 A;  1QWY A;  3M9B A;  1HA5 A;  3R3O A;  4DAY B;  1EYC A;  3UI2 A;  5CR3 A;  1JOR A;  1H9S A;  4CJ2 C;  4DV2 L;  2PI2 A;  4QIW B;  2IW3 A;  1YHB A;  4IJL A;  1Q81 C;  3KOJ A;  3ZYY X;  1R9T H;  2F3V A;  1VDZ A;  1NSN S;  4XDX A;  3W5O A;  2KEE A;  4QY7 A;  1VQH A;  3RMH A;  5IYB G;  1HNZ L;  3DUZ A;  4ZKC B;  5HGQ A;  4LF7 Q;  1KAB A;  3C1F A;  2I07 B;  4FYD A;  3RUZ A;  3S1Q B;  1E0B A;  1OXT A;  4DR2 L;  4A3E B;  4H7B A;  1QJO A;  3HOY B;  4YHH L;  1F2Z A;  1EYA A;  3SDZ A;  1QVC A;  3HFZ B;  4TSS A;  1BDO A;  4H44 C;  1QVG A;  1EEI D;  4M1U B;  2QKI C;  4C3H G;  5IP7 H;  4A3I B;  3F8T A;  1BBW A;  2E2I H;  2LXK A;  2CWA A;  1XXG A;  3VA7 A;  3IKJ A;  4RHS A;  1PH6 A;  1FJG L;  4X3S A;  4DA2 A;  1LT4 D;  4DR4 Q;  1F2L A;  5ELB A;  3TBI B;  3F2C A;  1P8L A;  2K28 A;  3PO3 G;  1CQF A;  1WCM H;  2XN9 C;  2PMZ E;  1LT6 D;  2EYM A;  1PH2 A;  4X65 L;  2K5Q A;  2C9O A;  1LTG D;  1LV9 A;  2PPB C;  2DGY A;  1WOC A;  2DY7 A;  4A3F H;  1K8G A;  3C2P A;  4Y7N H;  1HZA A;  3A8J E;  1UE6 A;  1M90 C;  3OOC A;  2GVA A;  5ELE A;  3SK6 A;  2JE6 I;  3UDF A;  5FJ8 H;  1PFB A;  1SE8 A;  2EIF A;  2J0T D;  3S1R H;  1I6H B;  3VA5 A;  3H15 A;  3I8Z A;  1XMQ L;  3U58 A;  1TY2 A;  1KDB A;  5IT9 c;  4G7H C;  3QG1 A;  3A54 A;  1CK1 A;  4DUY Q;  4OGQ C;  1KHI A;  4K8J A;  3BG3 A;  4MZ9 A;  5FOB B;  2YU9 H;  1S3O A;  1RJT A;  1VQM A;  1WVL A;  2PCF B;  4A93 H;  3CCM A;  4UP9 A;  4GN4 B;  3CCL A;  1X3G A;  4LF4 L;  1RHP A;  5C5L A;  2ZM6 L;  4ZUI A;  3J7Y W;  4QMG A;  3K57 A;  3HOY G;  1Y8O B;  4QCL A;  1RCV D;  3KF6 B;  4I7A A;  4BY1 G;  1YNX A;  4DR5 L;  4A76 A;  4HJ9 A;  1NMG A;  4X6A H;  2I46 A;  1VQK A;  1IW7 D;  1EFI D;  4A3I G;  3W3A A;  2UUA L;  1HA6 A;  4L5T A;  3NE5 B;  1IW7 C;  2VUM H;  1SYF A;  2K5D A;  4IUT A;  4BXX H;  4FF2 A;  1VQC A;  5C3X A;  1N36 L;  1PH5 A;  1XNQ Q;  4A3L H;  4LFA L;  4KY6 A;  3PUV A;  2PZW A;  3S14 B;  1JE4 A;  4L5R C;  2NTT A;  1HJP A;  3S17 H;  1NY4 A;  3J81 i;  2RCF A;  2R7Z H;  1HPC A;  2A74 C;  5IOD A;  1LT5 D;  2OQK A;  2WAQ B;  4UDU C;  4UHV A;  3E0J A;  3OYY A;  3LWE A;  2KQ3 A;  3K7U C;  1PYW D;  3NPP A;  4PZ6 A;  1STB A;  2MPM A;  1U4M A;  2JA8 B;  1SR3 A;  1EIF A;  3EJI A;  3I4N H;  2PZT A;  4DR1 L;  3WDN A;  1GUO A;  3CRL C;  4B3R L;  1CFM A;  4F87 A;  4BBR B;  5JJZ A;  2RHS B;  4ZRZ A;  1FYC A;  2KBN A;  3L2P A;  2WAC A;  1DYQ A;  1E24 A;  1NTG A;  3GTG H;  2UXC Q;  2K03 A;  3GTL H;  4CBV A;  5EBD A;  2B2Y A;  2WKC A;  1XYI A;  1LLR D;  1D2B A;  1FNV A;  3EBE A;  1GUT A;  4KN4 C;  5DLQ E;  1GVP A;  1IKL A;  1X9N A;  2E2H H;  1TU2 B;  4MIU A;  2Z8L A;  1IYU A;  4P71 A;  1PZI D;  4NXN Q;  1FL0 A;  2Q2U A;  5IWA L;  4UPA A;  4C3J H;  4DV5 L;  3NTK A;  2AUK A;  3NSW A;  3R8B A;  5IYD G;  5K36 H;  3KLR A;  2IHF A;  1X56 A;  3MFY A;  5IP9 H;  1Q46 A;  1WTQ A;  1SNC A;  1V8Q A;  2R6G A;  3PQI A;  1X32 A;  1B1Z A;  4HJA A;  4A3G G;  2PO4 A;  4DK6 C;  3IRB A;  1E2Z A;  2L4N A;  4IUU A;  5I6W A;  5IYD H;  2CH4 A;  2B39 A;  1HTP A;  3PUW A;  2FMC A;  3GQB A;  4YIJ A;  3KLS A;  2XWJ B;  1RIP A;  4X64 L;  4KD4 A;  2IX3 A;  2Q2H A;  1JC7 A;  4A3G H;  2WAQ G;  3L3O C;  3NEL A;  1Q90 A;  1I4P A;  2JN4 A;  2JA5 H;  5FLM H;  4ILW A;  2K75 A;  2N3S A;  4YWM A;  5C6A A;  5EBC A;  4IPC A;  4Y52 H;  4L8J A;  2UUC L;  2JA8 G;  1LTT D;  1IKM A;  3OHX C;  5JOB A;  1PFS A;  2ZXR A;  2A68 D;  1BO0 A;  5CV5 A;  2ES2 A;  1PXU A;  2A68 C;  1CA6 A;  5LMU L;  4BBR G;  4BA2 I;  4A4I A;  1PMR A;  3LNN A;  2L12 A;  4DU9 A;  5D14 A;  2BCO A;  1K8O A;  3TZD A;  5KYL A;  1M1K C;  4GKK L;  3CCQ A;  1H9M A;  4G4K A;  3IFD A;  2JA9 A;  2K5V A;  4X66 L;  4JI2 L;  4TKO B;  3HP3 A;  1K8M A;  3TS0 A;  1EQR A;  4ZK9 B;  3NHH A;  1JOQ A;  1WD1 A;  5FO9 B;  3JAM L;  4HN7 A;  3SK4 A;  3M4P A;  4RKL A;  3TQY A;  2Z6K A;  1XNR Q;  1IBL Q;  4DR6 Q;  3S15 B;  1YJ9 A;  4LK1 C;  1HCZ A;  1O7L A;  1EL0 A;  4BWG B;  2B2U A;  1CSQ A;  3OMC A;  1I3Q B;  1VS0 A;  5GAE C;  5D3D A;  2XGT A;  4U67 3;  4BBS H;  4R8I A;  4LW1 A;  3Q0A A;  3H3V I;  3D8G A;  1SNO A;  5CV8 A;  4QIW E;  3PIP A;  1UNS A;  4DAY A;  2EJG C;  3TME A;  2UXB Q;  3RZD B;  3MHB A;  3UDG A;  1KDA A;  1M8A A;  1BUV T;  3CQZ B;  1KAA A;  1X54 A;  3K0Y A;  1Q3L A;  1X55 A;  1Y1W H;  3L0O A;  5C44 B;  4JBM A;  5BN3 A;  5EKL A;  1VQ5 A;  3MXN B;  4J15 A;  2N55 A;  1TWG H;  1UE1 A;  2JJQ A;  1ML0 D;  2DY8 A;  1NE3 A;  4NXM Q;  3HOW H;  1IZ6 A;  3E9I A;  3HOX B;  1ROD A;  1JE5 A;  2MJ8 A;  3U9S A;  3J7A F;  5CV4 A;  4LF9 L;  4FVM A;  4GZY C;  3RZO H;  1EIH A;  1J8I A;  1F9P A;  5M5Y B;  2RSN A;  5CMD A;  1DOK A;  1QZG A;  1BBX C;  1I6V C;  2DJF C;  3I4L A;  1SMY D;  3AMU A;  2OT2 A;  2QF7 A;  3H0G H;  4TVA B;  1E2W A;  2N88 A;  3CXC A;  1BCP B;  4HMI A;  2CCZ A;  3S1M B;  4BY7 H;  3FPP A;  4R4T A;  2G9D A;  3AU7 A;  3X3N A;  4N9P A;  1J6Q A;  2AQ1 B;  2VQE Q;  2ZJR A;  1EWC A;  2UXD L;  3PO2 H;  1WTX A;  1UUP A;  1EIY B;  1YVC A;  4RGT A;  1IXR A;  1DON A;  4HMJ A;  2Q8I B;  3MZ5 A;  4R4C A;  1T9H A;  3NBI A;  3QR8 A;  1TXY A;  1HFN A;  1STN A;  2HCI A;  4A3K B;  1B70 B;  3K5M A;  3CC7 A;  4JI1 L;  2RVL A;  4H0L C;  1X3Q A;  3F2B A;  5M5W H;  1G51 A;  3MA2 B;  1AZQ A;  1VQO A;  5A2Q E;  4JYA Q;  1LTL A;  3NTH A;  2HIV A;  3U50 C;  1N33 L;  1U5K A;  3VR5 A;  5G3L D;  3KF8 B;  4DR7 L;  2B63 G;  3CU7 A;  4B08 A;  5M3M H;  4B3M Q;  3M3Y B;  5DNF A;  5IT9 E;  4FF3 A;  2K5N A;  3BDC A;  1TKW B;  3HOX G;  1CT1 D;  1HXY D;  5JEA J;  3NQT A;  1DOL A;  1EQQ A;  1DCZ A;  3GTJ B;  2B63 H;  1KAW A;  2B2T A;  1VQP A;  2NVT H;  4IUV A;  5JVH 3;  4EQ5 A;  1LTB D;  3K7A B;  2X6G A;  4ABN A;  1VF7 A;  1AN8 A;  4V0B A;  1KQS A;  5C0X J;  1WTH A;  1GOZ A;  1STG A;  4A3M B;  3KDF B;  3MXG A;  4QQB X;  1KL9 A;  2Y0S G;  1R4P B;  2JEA I;  1JWU D;  4X3U A;  1KXL A;  1TWH H;  1X6O A;  2F0Q A;  1AW7 A;  2K1B A;  4LUO A;  3BYY B;  2MUY A;  3EFX D;  4AYB B;  2NVQ B;  1HNW Q;  4A3J H;  2HHH L;  1HQR D;  1QIL A;  4ULL A;  2ASB A;  2R93 B;  2YTY A;  4G7O C;  3M4Y A;  2CQO A;  5TSS A;  3J80 i;  2VNU D;  1G91 A;  4X3K A;  4UP7 A;  5AJ3 Q;  4HJ5 A;  1M4V A;  2B29 A;  1WFQ A;  1I50 B;  2L15 A;  4HSP A;  2WAQ E;  3VR4 A;  1D5M C;  2UU9 L;  2PQE A;  3MEF A;  3PSI A;  4EQN A;  1I94 Q;  3AFQ A;  3GV6 A;  1Q7Y C;  4CDE C;  2GN5 A;  1XTC D;  4X62 Q;  2D2C C;  1VQB A;  1VMP A;  2XTI A;  5IIF A;  2RDF A;  2KCC A;  3URY A;  1L1O A;  2K6A A;  1BNZ A;  4LF5 L;  2KOL A;  1IBM L;  1UE7 A;  3ZJY C;  2F0W A;  1A3U A;  1Z7T A;  4O1N A;  3BVZ A;  4FDB A;  4NP5 A;  2JA7 G;  3BZK A;  1GJX A;  3K59 A;  2RHQ B;  1K3B C;  4DGZ A;  3T4A C;  1F77 A;  4K0K L;  1SBB B;  4FP5 D;  3A56 A;  2EYP A;  4HIO A;  1TS3 A;  4YWL A;  1R9T B;  4OX9 Q;  5NUC A;  1C7Y A;  5DM6 3;  4IUP A;  2R92 G;  4DR3 L;  3FKI G;  3QJY A;  3T56 B;  1EZ8 A;  2B2W A;  1FNU A;  2JA7 H;  2LSS A;  1PTO C;  3SR1 A;  3SK8 A;  4LWC A;  5C3E B;  4IPG A;  5EQ0 A;  5GAH C;  4RCO A;  4DAM A;  3CCU A;  4AQY Q;  2XSC A;  2FHT A;  3AYH B;  1O78 A;  4KY5 A;  2L55 A;  5C4J H;  4WJ4 A;  2R3Z A;  2EYH A;  2IY5 B;  2I5H A;  3MAQ A;  4A3M G;  1GHK A;  1PDQ A;  4YCV A;  4FF4 A;  4XT1 B;  4DUZ L;  1L0X B;  3PIO A;  1A2T A;  4J6H A;  4AYB G;  3GTM H;  2XNA C;  3D4R A;  1Y69 U;  3STB D;  4HED A;  3T1H Q;  2K33 A;  5IGF A;  3PMF A;  3STB C;  2WP8 J;  1EU4 A;  3QIA A;  4FXD A;  3GDE A;  3OW2 A;  2N8N A;  4OIJ A;  3S2D H;  2MP1 A;  3BZD B;  2XVS A;  4MHE A;  5E4W C;  4JI4 Q;  3I70 A;  2IX1 A;  1EY7 A;  1A2U A;  3U4V A;  2HQE A;  5JEA G;  2ENB A;  3D31 A;  4GNX A;  3GTO H;  2BA1 A;  1E3P A;  4L6T B;  5I9P A;  3I90 A;  1PLF A;  3Q8D A;  4LFC Q;  1X65 A;  1GUN A;  2Z6B A;  5C0X G;  5M9O A;  4GLX A;  3V96 A;  3TS2 A;  2KVM A;  4GLA C;  2EDG A;  4LFB L;  1PYB A;  5DAU A;  3S9W A;  1QOH A;  2OEO A;  2B8F A;  1R4Q B;  5GAG C;  2L1B A;  1XMO Q;  1V1Q A;  1DGS A;  4ALP A;  4JI5 Q;  1O7I A;  3DLL A;  4S3S A;  2CH4 W;  5C3E G;  1I4Q A;  1XTD A;  2NZ1 D;  1QUQ A;  4RFB A;  3S16 H;  5CC4 A;  1JB3 A;  5I6Y A;  1BXT A;  3OW7 A;  3TP7 A;  4B3S Q;  1HR0 W;  2D5D A;  2Z4H A;  3JAM c;  1A0I A;  5CBA E;  1TS2 A;  5IYB H;  4I65 A;  1A6X A;  2EYO A;  1KLG D;  2OTL A;  5E7N A;  3N6R A;  2HIX A;  1VCI A;  1G6Z A;  4Q0F A;  4RKB A;  1VQJ A;  2F0F A;  1IBK Q;  3NWT A;  1XJV A;  1KTK A;  3D0F A;  2OQ0 A;  3KFU A;  1JOK A;  3F1Z A;  4N9T A;  1HHV A;  2Z6K C;  4JI0 L;  2KCN A;  5LL6 S;  4AH6 A;  3CCV A;  2A19 A;  2B2U C;  4P2C B;  1SRU A;  3CMA A;  2ICE C;  2B2V A;  4C3H H;  2DJG C;  3EN2 A;  4PMB A;  1YZ6 A;  2L0C A;  1ASZ A;  4LF8 L;  2ZXP A;  1N34 Q;  3K80 C;  1TWA H;  4KMU C;  1IHZ A;  4H13 C;  2CW0 D;  4GOP C;  4PMW A;  2FFK B;  3PO3 H;  1EYD A;  3T1Y Q;  1V1P B;  3S1N H;  2X6L A;  3H3V H;  3PF4 A;  5JJL A;  5M5X H;  3BZC A;  2NZH A;  2IL8 A;  3R2I A;  2BDO A;  4WRD A;  3A8K E;  2Y0S E;  1STE A;  2E2J B;  5KNC A;  3I4N B;  1OXX K;  4ZYS A;  3I4O A;  3H91 A;  1TT2 A;  2EYF A;  4HCE A;  4NW2 A;  4OWX B;  4NKL A;  1QB5 D;  1SJE D;  3G71 A;  4FO2 A;  4JI6 Q;  2MO1 A;  2NWG A;  1QZH A;  3I4M B;  3MWY W;  3GTG B;  2WB1 B;  4OXP A;  4JV5 Q;  2SNS A;  5AFW A;  2KJX A;  5C5M A;  2F0N A;  1LM0 A;  4BA1 I;  4HR7 B;  1FNW A;  1U9R A;  4A3E G;  4DV2 Q;  3ULJ A;  2SOB A;  4LJZ C;  5ELC A;  5IGE A;  3MFG A;  5C4H A;  4DV7 L;  1WD0 A;  2VB3 X;  4XIG S;  1U0L A;  1PH7 A;  1U4R A;  4HAE A;  3S1Q H;  1VQ8 A;  2IT1 A;  1HNZ Q;  3AEV A;  4A3E H;  3HKZ B;  5DM7 3;  3HOY H;  2CVR A;  2EVB A;  4BY1 H;  1PRT D;  1IL2 A;  1TWC B;  3KBG A;  4FXG C;  5LL6 X;  4DR2 Q;  4A3I H;  4OO1 G;  4YHH Q;  3M7N A;  2EJF C;  1NUC A;  4KV6 A;  1AE3 A;  1J9O A;  4HTH A;  3AB9 A;  5C4Z A;  1SYE A;  1WI5 A;  1NJI C;  3ULL A;  1B3A A;  3UDI A;  1V9P A;  4R1J A;  5LMN Q;  3D4W A;  2NN6 G;  4HIM A;  4LF6 Q;  3CP0 A;  4QL5 A;  2F0M A;  1FJG Q;  2SDF A;  2N49 A;  2ZJP A;  3Q23 A;  2V4D A;  1EY8 A;  2IX0 A;  4OWT B;  3NWS A;  4TRD A;  3A5Z B;  2F0J A;  4BS9 A;  3KDF A;  4DR3 Q;  1HUM A;  3FDT A;  4AYB E;  3J81 L;  1K83 B;  2B2T C;  2IWH A;  1LO5 D;  2L9H A;  4X65 Q;  4CJ1 B;  2E8G A;  2ZJQ A;  5JJI A;  3I4M G;  4HIK A;  2NUC A;  4KJO A;  4IPD A;  1ET6 A;  2WB1 G;  4KKU A;  2L5T A;  3A7L A;  2NVX B;  2M2L A;  1HR0 L;  1I6H H;  1O80 A;  2G9H D;  3HZX A;  4R9W A;  3S2H B;  2SEB D;  3D3R A;  3VYS A;  1UAP A;  1VQN A;  1EY0 A;  2B3G A;  2NVY B;  1EIG A;  3DM3 A;  2PQA A;  3A7A B;  3R93 A;  2FMM A;  2ZTE A;  4ZUJ A;  3SE0 A;  1L0W A;  1CKN B;  5BN5 A;  3GTP B;  1B44 D;  4LMQ D;  1XMQ Q;  4LAA A;  4GN3 B;  5CGK A;  4M8A A;  2EY1 A;  3HKZ G;  2IJ0 A;  4JI7 L;  1MSG A;  2AHO B;  3K5O A;  4K2L A;  4C3I B;  1A15 A;  4KI0 A;  4A3D B;  4A3B B;  4YWK A;  2F0L A;  1JR0 D;  1JWM D;  2JSO A;  1LTI D;  1S5D D;  2JXM B;  4UP8 A;  1Y1W B;  5DEH A;  2VXW A;  2EY2 A;  4JC0 A;  3TZU A;  1BCP F;  1N32 L;  2F0T A;  2K52 A;  1L1O C;  2O2L D;  1TR5 A;  2SNM A;  2F3I A;  3DMU A;  1Q86 C;  2UUA Q;  1F2Y A;  3M4O B;  1YNN D;  1LAC A;  2ZT9 C;  1YNN C;  1N36 Q;  5GRO A;  1CA5 A;  4AIM A;  4IQZ A;  4JI3 L;  4RAU C;  5KRU A;  1QCB D;  2EOT A;  3ULP A;  1KNE A;  4MTN A;  1EZ6 A;  3FEW X;  4LFA Q;  3I7F A;  4H02 A;  3W1G A;  2B2W C;  4C2M B;  3J7A 5;  1KC8 C;  1BOS A;  5IGG A;  2J4X A;  2D0P A;  2EY5 A;  2JA8 H;  1CZW A;  5IY0 A;  1A63 A;  1WYD A;  3P20 A;  1A8V A;  3CAM A;  4RGM A;  2EJM A;  3JAM i;  2BDN A;  3OTO L;  4BBR H;  2PYK A;  3RN5 A;  1Z9F A;  5FK9 C;  1SFO B;  1S5B D;  4KKT A;  2E5L L;  4C1N K;  4FF1 A;  2C35 B;  5BN4 A;  4B3R Q;  3HRZ C;  5E4X A;  4Z9C B;  3I56 A;  1FGU A;  4O0A A;  1EOT A;  1DD2 A;  1YEZ A;  4XYO A;  3RNU A;  4JYA L;  1Y8P B;  4DV4 Q;  5EPL A;  3SK5 A;  3HS0 C;  2Z4I A;  4C3I G;  5M5W B;  4A3D G;  2KA7 A;  4A3B G;  2A73 B;  2E2D C;  3M7G A;  4DK1 A;  5K5P A;  3VR3 A;  1FGB D;  2VY3 A;  3G7L A;  3RLF A;  1C4Q A;  2C5C A;  2UUB Q;  2GVB A;  1EOV A;  1YHA A;  2F0D A;  1AP0 A;  1ENA A;  2Q2I A;  4QJF A;  4GNX C;  1B2T A;  3HOV B;  2V1C C;  4V19 0;  5IWA Q;  4DV5 Q;  3ICE A;  4CKE A;  3GTQ H;  4WJ3 M;  1VQ9 A;  5CV7 A;  4IFD J;  2F4V L;  4K6D A;  2NZO A;  3X3M A;  1PTO F;  2FJ2 A;  1EWI A;  5E1F A;  4DV0 Q;  1SMX A;  4RGN A;  5CV6 A;  3JAM E;  1K73 C;  4DAP A;  4F8M A;  3GTK H;  5JPN C;  2ATW A;  1Y1V B;  4KD3 A;  3UDX A;  3AFP A;  4DK0 A;  4DV1 L;  1SMY C;  1QNU A;  4KHP Q;  1SNM A;  5T1G A;  2QEJ C;  4X64 Q;  2NYZ D;  1JOO A;  4DN4 M;  4U68 A;  2MGS A;  1H9K A;  4KHZ A;  1AE2 A;  2XRQ D;  2WII B;  2YTX A;  2D9U A;  1HNX L;  1LT3 D;  2UUC Q;  2LFN A;  1KLU D;  3BJU A;  4YY3 Q;  5M3F B;  2AWO A;  3VR2 A;  4IUR A;  2LKV A;  2Z1C A;  5LMU Q;  1SDF A;  2PW7 A;  2Q2T A;  3Q24 A;  1FD7 D;  2AKW B;  1JMC A;  4OWW B;  2EQS A;  2ALY B;  1PA6 A;  2HDL A;  4OO1 I;  1QE6 A;  2B2V C;  1JJ2 A;  1TWF B;  2MFI A;  3HOU B;  4GKK Q;  3S15 H;  1I4X A;  1SE3 A;  1QG7 A;  2KCT A;  4JI2 Q;  2DUD A;  5KIX A;  2M00 A;  3I91 A;  1I3Q H;  2JA6 B;  1Q12 A;  2Z0S A;  4EQP A;  2NN6 I;  4ZAI A;  1B8A A;  5C44 G;  1V43 A;  4KTA A;  4RA8 A;  1HTL D;  3HOV G;  3G4S A;  3CCR A;  4RMF A;  5FO7 B;  2WB1 E;  2CHB D;  3I3C A;  4XQQ A;  1CHQ D;  3CQZ H;  1ONL A;  3Q6S A;  5IGC A;  1D5Z C;  5KND A;  5BR8 L;  3U4Z A;  1NCV A;  3HOZ B;  2YYZ A;  3HGB A;  1Q8K A;  3CKI B;  3DWP A;  1IYV A;  4JI8 L;  1Y1V G;  4N8X 1;  1RF2 D;  3H94 A;  4PQX A;  3KF6 A;  3HOX H;  3MVV A;  2HUG A;  3PCO B;  1OXV A;  1EFW A;  3T13 A;  3NBH B;  2F0P A;  4HJ8 A;  5C4X B;  2KED A;  3V05 A;  1E1O A;  4APV A;  3HKZ E;  2MQH A;  3ERS X;  2BH2 A;  5M5Y H;  1J5E Q;  1PVO A;  2K05 A;  3BVG A;  5ELF A;  3Q22 A;  4B3T L;  3E9H A;  1NAP A;  1S5C D;  3GTM B;  1N9W A;  4DXG A;  2J7Z A;  1PTO B;  2RA4 A;  3ITP A;  3RN2 A;  1EQT A;  3QOJ A;  1AZP A;  1PFM A;  4JI4 L;  2TSS A;  4DNI A;  4CDF C;  1F9S A;  1MJC A;  5M3F G;  3LX0 A;  3S1M H;  4GKJ L;  4JBJ A;  2EXZ A;  5EAY A;  1SNQ A;  2K32 A;  1MIU A;  3ND8 A;  4QUF A;  4A3K G;  3MTS A;  5GQO A;  4IFD G;  4RWS C;  1TII D;  1JQY D;  2DNE A;  4K14 A;  2BE5 D;  3OSO A;  1EEF D;  1YBY A;  3I73 A;  3HOU G;  3E5S A;  3B6Y A;  2NBF A;  4WFN 3;  2UXD Q;  1VQA A;  2F0U A;  2JA6 G;  3J80 L;  2GA4 B;  5IE8 A;  3BU2 A;  1U4P A;  3CF5 A;  1CM9 A;  3A8I E;  1OO9 B;  4LF7 L;  3MC0 B;  1YNJ D;  3J81 c;  1VF5 C;  2CFM A;  1YNJ C;  4K6L A;  1YIT A;  1UEB A;  4ZCK A;  1KDC A;  1B9M A;  1VQF A;  5FLX L;  1ENF A;  4Q5V A;  1X3F A;  4B3S L;  2JQO A;  4IOA A;  2B8G A;  4XXE A;  2OF1 A;  3PUY A;  2VQF Q;  3M3Y H;  1IL8 A;  4QB4 A;  3HOZ G;  3P7J A;  2MHV A;  1N33 Q;  2R92 H;  2X69 A;  1UEA B;  1ENC A;  3FKI H;  2VB2 X;  3G6J B;  4KHV A;  5I9O A;  4DR7 Q;  1FVI A;  2B2Y C;  4RHR A;  4O42 A;  3K81 C;  5C4X G;  5C3W A;  3GTJ H;  3J7Z C;  1SE2 A;  3VR6 A;  4DR4 L;  2F4I A;  3KBX A;  1ZKO A;  1UE5 A;  3K8A A;  3SGI A;  2E2I B;  3I2Z A;  3N52 A;  1GO3 E;  2QDL A;  3RR5 A;  5IYC G;  1AFP A;  1TS4 A;  2R93 G;  4A3M H;  1KIX A;  3TSS A;  2F03 A;  5COY A;  3DEP A;  1SSO A;  3IL8 A;  1SND A;  4LNQ A;  4R8N A;  1WCM B;  2JYO A;  3T1Y L;  3VYT A;  2A5H A;  5COR A;  2AWN A;  2QA4 A;  5D65 A;  2L11 A;  2ZTC A;  4DV6 Q;  3TP8 A;  3BDL A;  1RTN A;  4P75 A;  1LTS D;  2ID0 A;  5ELD A;  1I50 H;  1ZEQ X;  3TRE A;  2F1M A;  2AUJ D;  4A3C G;  4R4I A;  3S1N B;  4F88 A;  4A3F B;  4DXF A;  4Y7N B;  1LUZ A;  1S72 A;  1CSP A;  1YI2 A;  5JEA H;  4G7Z C;  1BVS A;  1W3S A;  4FNF A;  1STH A;  4DUY L;  2KCM A;  3FHW A;  4RH6 A;  2YV5 A;  2DNC A;  2QIL A;  3S1R B;  3A5U A;  1KD1 C;  2PI2 E;  1YJW A;  5H1S E;  4GOP B;  5C0X H;  3BVM A;  2HQL A;  2JEB I;  2O5J C;  3KLS X;  1BF4 A;  1VMC A;  2YU9 B;  3CME A;  1SXT A;  2KEN A;  1EYG A;  3RLN A;  3BYT B;  4LF5 Q;  4A93 B;  2OXP A;  1IBM Q;  2KHI A;  2AMC B;  2QW7 A;  5LHY 1;  1WTP A;  1HRJ A;  4P73 A;  1PV4 A;  2NB0 A;  3ER0 A;  4POG A;  1STA A;  2VL6 A;  4JG2 A;  1ILP A;  3FMC A;  3O13 A;  4K0K Q;  5C3E H;  3VDY A;  4CDD C;  2F0H A;  4WOR A;  4HID A;  1STY A;  3KK7 A;  2G5D A;  3EA6 A; 
#chains in the Genus database with same CATH homology
 4JBM A;  5IP7 G;  1VQ5 A;  3TEH B;  1XNQ L;  4X65 Q;  3MXN B;  2E8G A;  4J15 A;  4EX5 A;  2ZJQ A;  5JJI A;  4RG1 A;  1N8R C;  1HNX Q;  1TWG H;  3I4M G;  4HIK A;  1UE1 A;  2JJQ A;  1NE3 A;  2PQA B;  4IPD A;  4A3K H;  4NXM Q;  3HOW H;  2WB1 G;  1IZ6 A;  3E9I A;  1CKM A;  1XMO L;  1PH9 A;  1JE5 A;  1JT8 A;  2H5X A;  3AQQ A;  4GLV B;  1HR0 L;  1TWF H;  4LF9 L;  1I6H H;  3JC6 6;  3HOU H;  1OXU A;  4JI5 L;  4QGU A;  4GN5 A;  3RZO H;  4POF A;  2VZA A;  4IOC A;  5LMN L;  1VQN A;  1WCM G;  2B3G A;  4DV3 Q;  1QZG A;  3DM3 A;  4JI1 Q;  4LF6 L;  2PQA A;  2JA6 H;  2K5H A;  3PV0 A;  4DUZ Q;  1HZ9 A;  2ZTE A;  1L0W A;  1HZC A;  1CKN B;  3H0G H;  4TVA B;  4YCW A;  1XMQ Q;  1G6P A;  4GN3 B;  1L2F A;  3CXC A;  1D8L A;  2CCZ A;  3HKZ G;  3CD6 A;  4BY7 H;  4A3F G;  3RLO A;  4JI7 L;  4R4T A;  4ME3 A;  2AHO B;  4UY8 C;  1IBK L;  4KI0 A;  1J6Q A;  2F52 A;  2VQE Q;  2ZJR A;  4YWK A;  1CKN A;  1GM5 A;  2UXC L;  2UXD L;  5J3B A;  1CKO A;  3PO2 H;  1GKH A;  1P16 A;  2K4K A;  3HOZ H;  1EIY B;  3S24 A;  1Y14 B;  1YVC A;  5FJ8 G;  4TQU S;  1IXR A;  3K7A H;  4UP8 A;  1XPO A;  4R4C A;  4JC0 A;  1N32 L;  1T9H A;  1Q82 C;  1TXY A;  2K52 A;  1L1O C;  1XPU A;  1IYJ B;  1K3R A;  1SLJ A;  5BR8 Q;  2F3I A;  5C4X H;  1OTC A;  2UUA Q;  1Q86 C;  1N34 L;  4DV3 L;  1B70 B;  3CC7 A;  4YCU A;  4JI1 L;  3CC4 A;  2I5L X;  4O2D A;  2D62 A;  4NXN L;  3CPW A;  1SRO A;  4MNO A;  4JI8 Q;  2HT1 A;  4A93 G;  3PF5 A;  1SN8 A;  2NVQ H;  1HZB A;  2BA0 A;  1JJG A;  1N36 Q;  5GRO A;  3F2B A;  5M5W H;  5IYC H;  1G51 A;  4AIM A;  4JI3 L;  2R93 H;  1VQO A;  4JYA Q;  1LTL A;  3ULP A;  1W2B A;  4LFB Q;  2HIV A;  4MTN A;  5ELO A;  3U50 C;  3CCE A;  1N33 L;  4LFA Q;  3I7F A;  4H02 A;  2A8V A;  3W1G A;  4PZ8 A;  1NMF A;  1U5K A;  3EIV A;  3KF8 B;  3J7A 5;  1KC8 C;  2HHH Q;  4B3T Q;  4DR7 L;  2D0P A;  2B63 G;  5M3M H;  1PYS B;  4B3M Q;  2JA8 H;  1YJN A;  5IY0 A;  1B7Y B;  1A63 A;  1WYD A;  1YHQ A;  2VUM G;  3NEM A;  1Z47 A;  1A8V A;  3M85 A;  3CAM A;  4BXX G;  2K5N A;  3JAM i;  2OCE A;  4JI6 L;  3OTO L;  3HOX G;  4IFD I;  4BBR H;  1BBU A;  2ZTD A;  2K50 A;  5JEA J;  3RN5 A;  3G6E A;  1Z9F A;  2UU9 Q;  1VQ6 A;  4GKJ Q;  1EQQ A;  2B63 H;  1KAW A;  4JCV E;  1VQP A;  4JOI C;  2NVT H;  4JV5 L;  2KHJ A;  4A3L G;  4A3C H;  3KJP A;  4EQ5 A;  2E5L L;  1H95 A;  4JBW A;  2C35 B;  3M9B A;  4B3R Q;  4DAY B;  3TRZ A;  1HH2 P;  3I56 A;  1KQS A;  2R7Z G;  4DV2 L;  5C0X J;  1FGU A;  4O0A A;  2PI2 A;  4PG3 A;  3W1B A;  1YHB A;  3KDF B;  4QQB X;  4IJL A;  1Q81 C;  1KL9 A;  1YEZ A;  3KOJ A;  2Y0S G;  3RNU A;  4JYA L;  1R9T H;  2JEA I;  1KXL A;  1TWH H;  1X6O A;  4DV4 Q;  2R7F A;  4LUO A;  4JI0 Q;  3W5O A;  1HNW Q;  4DKA C;  4A3J H;  4QY7 A;  2EXD A;  1VQL A;  2HHH L;  1VQH A;  3J81 j;  5IYB G;  1HNZ L;  2MO0 A;  4A3D G;  5HGQ A;  3I4N G;  4LF7 Q;  2ASB A;  4A3B G;  1PH1 A;  2YTY A;  2CQO A;  2VY3 A;  3J80 i;  4LF8 Q;  2VNU D;  3RLF A;  1C9O A;  4UP7 A;  5AJ3 Q;  4HJ5 A;  2UUB Q;  2B29 A;  2GVB A;  1EOV A;  1YHA A;  1WFQ A;  2Q2I A;  3UE0 A;  4QJF A;  4GNX C;  4HJ7 A;  2L15 A;  2V1C C;  3L7Z C;  2WAQ E;  1OXT A;  4R4O A;  5IWA Q;  4DR2 L;  4L5Q A;  4DV5 Q;  1PH3 A;  2UU9 L;  3ICE A;  1L1O B;  3MEF A;  4XTC S;  3PSI A;  3GTQ H;  1I94 Q;  4YHH L;  3AFQ A;  1E22 A;  2E2J H;  1Q7Y C;  2GN5 A;  4WJ3 M;  1VQ9 A;  1AH9 A;  4JBK A;  4X62 Q;  1XNR L;  4IJH A;  1QVC A;  1IBL L;  3KJO A;  1ASY A;  2F4V L;  4DR6 L;  3HFZ B;  4IFD J;  1VQI A;  1VQB A;  2NZO A;  1QVG A;  5ELN A;  5GAD C;  1EWI A;  2XTI A;  5IP7 H;  4DV0 Q;  2QEX A;  3F8T A;  1BBW A;  1SMX A;  1K73 C;  2E2I H;  2LXK A;  3KLW A;  1L1O A;  2CWA A;  5HY6 A;  3I4M H;  3GTK H;  2ATW A;  3LGJ A;  4LF5 L;  1PH6 A;  1IBM L;  1UE7 A;  2BH8 A;  3UDX A;  3ZJY C;  3AFP A;  4DV4 L;  1S40 A;  1FJG L;  4DV1 L;  4FDB A;  4DR4 Q;  2JA7 G;  3BZK A;  3GO5 A;  4KHP Q;  3F2C A;  1P8L A;  1E1T A;  4X64 Q;  2RHQ B;  4IO9 A;  3PO3 G;  2UXB L;  5K36 G;  3HKS A;  4K0K L;  1GD7 A;  1WCM H;  4HIO A;  4YWL A;  2FXQ A;  2PMZ E;  4OX9 Q;  5IP9 G;  4GS3 A;  1C7Y A;  2R92 G;  4DR3 L;  4KHZ A;  1AE2 A;  3FKI G;  2UUB L;  1VQG A;  1PH2 A;  2YTX A;  4X65 L;  4PZ7 A;  3J80 c;  2LSS A;  3UE1 A;  2JA7 H;  1HNX L;  4LF4 Q;  2ZM6 Q;  2UUC Q;  4DPG A;  4LWC A;  4IPG A;  4NXM L;  3BJU A;  1I5F A;  5GAH C;  4YY3 Q;  4DAM A;  3CCU A;  2DGY A;  2AWO A;  1WOC A;  4P74 A;  4AQY Q;  4DV7 Q;  4A3F H;  1K8G A;  4DR5 Q;  4Y7N H;  1HZA A;  3AYH B;  5LMU Q;  5C4J H;  4WJ4 A;  1UE6 A;  4LUZ A;  1TWC H;  5C0X I;  1M90 C;  2Q2T A;  4DV0 L;  5FLX c;  2IY5 B;  2I5H A;  2AKW B;  4A3M G;  2GVA A;  1YIJ A;  2EQS A;  2ALY B;  1JMC A;  4OWW B;  2JE6 I;  4YCV A;  3UDF A;  1PA6 A;  2JA5 G;  5FLM G;  1K0R A;  2I5M X;  4JOI A;  5FJ8 H;  4DUZ L;  3S14 H;  4OO1 I;  1SE8 A;  2EIF A;  3PIO A;  3S1R H;  1JJ2 A;  2MFI A;  4GKK Q;  1K9M C;  4AYB G;  3H15 A;  3GTM H;  1XMQ L;  3S15 H;  4KHP L;  3U58 A;  2KCT A;  5IT9 c;  4JI2 Q;  2DUD A;  1I3Q H;  3STB D;  4DUY Q;  1KHI A;  3T1H Q;  4MZ9 A;  1Q12 A;  2Z0S A;  2YU9 H;  3STB C;  1JB7 A;  2NN6 I;  1S3O A;  2WP8 J;  3PUX A;  1LYL A;  1B8A A;  3GDE A;  3OW2 A;  5C44 G;  1VQM A;  4A93 H;  2N8N A;  2VQE L;  3CCM A;  1V43 A;  3S2D H;  1CUK A;  2WFW A;  4GN4 B;  4UP9 A;  4GNX B;  3HOV G;  2D0O A;  3G4S A;  3CCR A;  1X3G A;  4RMF A;  2ZM6 L;  3CCL A;  4LF4 L;  2WB1 E;  4JI4 Q;  3HOY G;  1VQD A;  1EUJ A;  1PHJ A;  2IX1 A;  4YY3 L;  3U4V A;  3CQZ H;  1UWV A;  3KF6 B;  4BY1 G;  1YNX A;  4DR5 L;  5JEA G;  4A76 A;  3A0J A;  4HJ9 A;  1PH4 A;  1NMG A;  3D31 A;  3G48 A;  4X6A H;  5BR8 L;  1K83 H;  3U4Z A;  4GNX A;  4DR1 Q;  1VQK A;  2UUA L;  2YYZ A;  4A3I G;  3GTO H;  2BA1 A;  1E3P A;  4L5T A;  4OON A;  1Q8K A;  4R4Q A;  2VUM H;  4BXX H;  4JI8 L;  1Y1V G;  1VQC A;  3Q8D A;  4LFC Q;  1X65 A;  2CKZ B;  1KRS A;  3KF6 A;  3HOX H;  1N36 L;  1QVF A;  3PCO B;  1OXV A;  4NB3 A;  5C0X G;  3NBH B;  4GLX A;  1EFW A;  2NVX H;  4HJ8 A;  3TS2 A;  1PH5 A;  1E1O A;  4APV A;  1XNQ Q;  3HKZ E;  4GLA C;  1KRT A;  4LFB L;  1G29 1;  1PYB A;  4A3L H;  4BBS G;  1QUQ B;  4LFA L;  2MQH A;  3S2H H;  3ERS X;  2BH2 A;  3PUV A;  5M5Y H;  1J5E Q;  2NVY H;  1PVO A;  3K0X A;  4NPS A;  5GAG C;  4A75 A;  4B3T L;  4L5R C;  1HJP A;  3E9H A;  1NY4 A;  3J81 i;  1V1Q A;  1XMO Q;  3S17 H;  4B3M L;  2R7Z H;  1N9W A;  1HR0 Q;  2OQK A;  1DGS A;  4ALP A;  4JI5 Q;  3GTP H;  1O7I A;  3DLL A;  3RN2 A;  3OYY A;  5C3E G;  4JI4 L;  1XTD A;  1QUQ A;  3K7U C;  3S16 H;  4DNI A;  1Y1W G;  1MJC A;  5M3F G;  4B3S Q;  1HR0 W;  3S1M H;  4GKJ L;  3JAM c;  4JBJ A;  4PZ6 A;  1A0I A;  1SR3 A;  1EIF A;  5IYB H;  5EAY A;  4C3I H;  4A3D H;  1E7Z A;  1JJC B;  4GOP A;  3I4N H;  4DR1 L;  4A3B H;  1MIU A;  3CW2 C;  4A3K G;  5GQO A;  3HOW G;  1XPR A;  4IFD G;  2OTL A;  4B3R L;  2MNA A;  5E7N A;  2HIX A;  3CC2 A;  1VCI A;  4JI7 Q;  2RHS B;  1YBY A;  1VQJ A;  3HOU G;  1IBK Q;  2KBN A;  3B6Y A;  3L2P A;  3D0F A;  3CCS A;  2OQ0 A;  1XJV A;  3KFU A;  3GD7 A;  1NTG A;  1E24 A;  3F1Z A;  2VW9 A;  3GTG H;  2UXC Q;  2UXD Q;  2Z6K C;  3GTL H;  1VQA A;  4JI0 L;  2JA6 G;  4AH6 A;  3CPF A;  1BKB A;  3BU2 A;  1VQE A;  3KYH C;  5IE8 A;  3CCV A;  2A19 A;  1J5E L;  3M4O H;  1HNW L;  1SRU A;  3CMA A;  3CF5 A;  3H0G G;  4C3H H;  1N32 Q;  2OTJ A;  4LF7 L;  3EBE A;  1VQ4 A;  3EN2 A;  1ASZ A;  1YZ6 A;  2LXJ A;  5DLQ E;  3J81 c;  1GVP A;  1X9N A;  2E2H H;  4LF8 L;  1RL2 A;  2CFM A;  1N34 Q;  3K80 C;  5AJ3 L;  1YIT A;  1UEB A;  1TWA H;  4P71 A;  1VQ7 A;  4BY7 G;  2N78 A;  1VQF A;  4NXN Q;  1D7Q A;  4GOP C;  1FL0 A;  1X3F A;  2Q2U A;  2JQO A;  4PMW A;  4UPA A;  3WWV A;  4C3J H;  4C2M H;  5IWA L;  4DV5 L;  4B3S L;  5JJK A;  4IOA A;  5IYD G;  3M4Q A;  1I94 L;  3PO3 H;  3FP9 A;  3T1Y Q;  3PO2 G;  3PUY A;  2IHE A;  2VQF Q;  3H3V H;  4JI3 Q;  3HOZ G;  3PF4 A;  4X62 L;  1Q1E A;  2IHF A;  3S1N H;  1X56 A;  5M5X H;  5JJL A;  5IP9 H;  1Q46 A;  1N33 Q;  3F2D A;  3BZC A;  2R92 H;  2NZH A;  3M3Y H;  2R6G A;  3FKI H;  3E0E A;  2R7D A;  4HJA A;  4A3G G;  4DR7 Q;  2Y0S E;  4DK6 C;  3IRB A;  4DK3 C;  1FVI A;  4IPH A;  3K81 C;  5C4X G;  1OXX K;  3GTJ H;  5IYD H;  3J7Z C;  3I4O A;  1SFO H;  4DR4 L;  4OWX B;  3PUW A;  1RIP A;  4X64 L;  4X66 Q;  3G71 A;  1UE5 A;  2MO1 A;  4JI6 Q;  3OTO Q;  3K8A A;  3SGI A;  1QZH A;  3I2Z A;  1GO3 E;  3RR5 A;  5IYC G;  2Q2H A;  2VS1 A;  4A3G H;  2R93 G;  2WAQ G;  4A3M H;  3NEL A;  1KIX A;  4OX9 L;  4OXP A;  2JA5 H;  4JV5 Q;  5FLM H;  2K75 A;  2N3S A;  2E5L Q;  2RCN A;  4YWM A;  3NEN A;  1LM0 A;  4BA1 I;  4IPC A;  4Y52 H;  5M3M G;  2UUC L;  4A3E G;  1C0A A;  3I55 A;  1A62 A;  4DV2 Q;  4LNQ A;  2JA8 G;  3ULJ A;  3RZD H;  3T1Y L;  1PFS A;  2VQF L;  2AWN A;  2QA4 A;  4AQY L;  2ZTC A;  4DV6 Q;  4DV7 L;  4XIG S;  4P72 A;  3PUZ A;  2ES2 A;  4LUV A;  1U0L A;  3CCJ A;  5LMU L;  1PH7 A;  5C44 H;  4BBR G;  4P75 A;  1X3E A;  4BA2 I;  4A4I A;  2ID0 A;  2PNH A;  3S1Q H;  1VQ8 A;  1I50 H;  3TRE A;  3HOV H;  2IT1 A;  1HNZ Q;  1K8A C;  4A3E H;  3AEV A;  4A3C G;  4R4I A;  2JK8 A;  1WJJ A;  3HOY H;  1M1K C;  4GKK L;  1LUZ A;  1S72 A;  3CCQ A;  4BY1 H;  1CSP A;  1YI2 A;  1IL2 A;  2JA9 A;  2K5V A;  3PGZ A;  4X66 L;  4JI2 L;  1BVS A;  1W3S A;  4DR2 Q;  3TS0 A;  4DUY L;  3T1H L;  1EQR A;  4A3I H;  2KCM A;  4OO1 G;  2QGQ A;  3FHW A;  4YHH Q;  3M7N A;  1PH8 A;  2YV5 A;  3M4P A;  3TQY A;  2OWO A;  3A5U A;  2Z6K A;  1KD1 C;  1Y1V H;  1XNR Q;  2F4V Q;  1IBL Q;  4DR6 Q;  2PI2 E;  1AE3 A;  1YJ9 A;  4A3J G;  1YJW A;  5H1S E;  1Q1B A;  3A74 A;  4GOP B;  4LF9 Q;  2I0Q A;  2HQL A;  1NJI C;  1CSQ A;  1WI5 A;  1VS0 A;  2JEB I;  1MKH A;  5GAE C;  3ULL A;  3UDI A;  1V9P A;  2XGT A;  4R1J A;  5LMN Q;  2NN6 G;  3CME A;  4HIM A;  2KEN A;  1EYG A;  3CP0 A;  1NBW A;  4LF6 Q;  4BBS H;  4QL5 A;  2CWP A;  3RLN A;  4LW1 A;  4LF5 Q;  4DV6 L;  1IBM Q;  3H3V I;  2KHI A;  1FJG Q;  2AMC B;  2YTV A;  2RF4 A;  4DV1 Q;  2N49 A;  4QIW E;  2ZJP A;  5LMN W;  3PIP A;  4P73 A;  1PV4 A;  1MJE A;  3ER0 A;  4POG A;  2IX0 A;  4OWT B;  4KLK A;  2A1A A;  2VL6 A;  4JG2 A;  2UXB Q;  1OXS C;  3UDG A;  3A5Z B;  4K0K Q;  5C3E H;  3VDY A;  2K14 A;  1X54 A;  3KDF A;  4LFC L;  1X55 A;  4AYB E;  1Y1W H;  4HID A;  5M3F H;  3L0O A;  4DR3 Q;  4L5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...