3H15A

Crystal structure of replication initiation factor mcm10-id bound to ssdna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
173
structure length
173
Chain Sequence
QYHVEKFSGLRIRKPRVSSSEMERKMNGRKLIRLAQLQNKIATEKLEEEDWVTFGVIVKKITPQSSNNGKTFSIWRLNDLKDLDKYISLFLFGDVHKEHWKTDQGTVIGLLNANPMKPKEGTDEVCLSVDNPQKVLLMGDAVDLGTCKARKKNGDPCTQMVNLNDCEYCQYHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Physical Interactions between Mcm10, DNA, and DNA Polymerase {alpha}.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Replication/dna
molecule keywords Protein MCM10 homolog
total genus 36
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2009-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09329 zf-primase Primase zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h15A00
1EWIA 3T1HL 1UE1A 2VQEL 4BXXG 1K73C 5IT9c 1BBUA 4KHPL 4OO1I 4GNXB 4A3JG 4HIOA 4A3EH 5GADC 3L0OA 4JBMA 3M4QA 3KF8B 5EAYA 5LMNQ 3G6EA 1EIFA 2E5LQ 3U50C 5AJ3L 1UEBA 2K5HA 4X64L 1N34L 1L1OB 1N32Q 2CWAA 1I94Q 1LTLA 4JI5Q 1VQPA 3S1QH 4DV5Q 4EX5A 1SE8A 4B3ML 2R92G 1HNZQ 1VQNA 4B3TQ 5FLMH 3W1GA 3TEHB 1EQRA 3I55A 2UUAL 1G51A 1YHBA 1D8LA 1OXSC 3CCQA 4AQYQ 4A3EG 2UXBQ 1PV4A 2RCNA 2UXDQ 1PH5A 4B3SQ 1GD7A 5ELNA 3PO2G 1AE2A 5M3MG 4QGUA 1VS0A 3F1ZA 3CCVA 3FP9A 4P74A 1KIXA 1PYSB 3PO2H 1VQAA 2VZAA 1E22A 4YY3Q 1DGSA 3HOXG 1WOCA 3G4SA 3CF5A 2ALYB 3NEMA 4PG3A 1PH9A 2UU9Q 1CKNB 1CKNA 3ERSX 2KCTA 5IYBG 2OQKA 3CAMA 4A3KH 1KHIA 2UUCQ 1W3SA 1WJJA 2N8NA 5IE8A 1N32L 4DUZQ 4HIMA 2B63G 3PO3G 4JI5L 5M5XH 1I94L 4DR4Q 4LF5L 2JE6I 1QZGA 5GAGC 2PQAB 3EIVA 1JMCA 1SR3A 3PGZA 4B3TL 4X66L 1KD1C 4JBKA 5JEAJ 2WP8J 4WJ4A 1LUZA 4BA1I 4GNXA 4PMWA 1CKMA 1I6HH 2UXBL 1HZ9A 1A8VA 1YVCA 1SMXA 4LNQA 2FXQA 3ICEA 4A93G 2UXCL 1Z47A 5C4JH 1X3GA 1X3FA 4JI6Q 3CC4A 5M3MH 4YCUA 4YWKA 5BR8Q 3PIPA 5H1SE 1JJ2A 1VQKA 4OX9Q 4X64Q 2OCEA 3J81i 4JI3L 2B3GA 3HOXH 4HJ8A 1PYBA 1PH4A 1N34Q 1NBWA 4LF7Q 1I5FA 4GNXC 1PA6A 5JJIA 3I4MH 1NJIC 5IP7H 1HNZL 3JAMi 4DUZL 1GO3E 4DAYB 1YIJA 4JI4L 2F4VL 3AFPA 4IPGA 1YEZA 4DR7L 4JG2A 2NVQH 3HOYG 4XIGS 3HOUG 5JJLA 1JJGA 4J15A 4X66Q 1AE3A 1HJPA 2UXDL 2ZJPA 3U4ZA 4K0KQ 1I3QH 4DK3C 1V9PA 2I0QA 5K36G 1FGUA 4YCWA 5HY6A 3A5ZB 4X65L 1BKBA 2JQOA 3JAMc 3J7ZC 1VQCA 3KJPA 2IX0A 4AYBG 4A4IA 4DV1Q 1UWVA 4IJLA 5LMNW 4LUOA 1VQFA 4L5RC 2R7ZG 3ULPA 2XTIA 1JE5A 3STBC 3TREA 5C44H 1TWAH 2IHEA 3KDFA 1U0LA 4PZ8A 3S1NH 2E2JH 2K4KA 4P72A 1K0RA 3PUXA 3ER0A 3OTOQ 2IHFA 3CQZH 5ELOA 4BA2I 3K7AH 3ZJYC 1PH2A 2YTXA 1WCMH 4BXXH 1J5EQ 4GN3B 4ME3A 3CXCA 1B70B 5IP9H 5IY0A 3S1MH 3CMAA 4RMFA 1M90C 3F8TA 3CPFA 2LXJA 1Q1BA 3CCRA 3KOJA 4A3LG 2RF4A 1HR0W 2Q2HA 1QZHA 2I5LX 2KHJA 3TS0A 4A3GG 2ZTEA 2K52A 3A74A 4DV3Q 3K8AA 4MTNA 4YWMA 4DR2L 1L1OC 3G48A 4JI1Q 4DKAC 1KRSA 1E1OA 4UY8C 2JEBI 4DPGA 4JI6L 4POGA 4LWCA 1HZBA 2ZTDA 3EBEA 4R4IA 1K9MC 4BY1G 3DLLA 1VQ4A 4A3LH 4OO1G 3GTQH 1VQMA 1Q81C 4QJFA 1HH2P 2XGTA 1SFOH 1JB7A 2JA7G 4KHPQ 3SGIA 5FLXc 1Y1VH 2EXDA 1X65A 2WFWA 2VW9A 4DV7Q 3GTLH 3E9IA 3ULLA 2MFIA 1N33Q 4C3HH 2E5LL 4IO9A 3UDGA 5AJ3Q 2JA5H 1Q8KA 1Q1EA 1QUQB 3HOVH 2R93H 2JK8A 2AKWB 3OW2A 1IZ6A 1CSQA 3AFQA 3DM3A 4DV4L 1J5EL 4L5SA 2AMCB 4OWWB 2VUMG 1WCMG 1QVGA 4A3MG 4DUYQ 4BBRH 4JI7L 1QUQA 3UDIA 1YITA 2A1AA 3GTPH 4AQYL 4QIWE 2N78A 4XTCS 3T1YL 2PMZE 1X9NA 3PUVA 1EYGA 4JI8Q 2EIFA 1L2FA 5C44G 1G291 1U5KA 1K83H 4HJAA 3FHWA 1VQBA 5FLMG 4DR5Q 4LFCQ 4GKJL 4YCVA 1HNXL 3GTJH 2F52A 3GO5A 2ZJRA 4FDBA 3Q8DA 5C3EG 4AH6A 3I4NG 4RG1A 3U4VA 4LF8L 3FKIH 4QQBX 1GVPA 4GLXA 3NBHB 1N36Q 1N33L 4DV2L 5FJ8H 1HNWQ 4ALPA 1K8AC 2UUCL 4R4TA 4EQ5A 2Q2UA 4LF4Q 1PHJA 2BH8A 1L0WA 5DLQE 3A5UA 5M5YH 3RN2A 4GKKQ 4DV4Q 2KCMA 3CCEA 4BBSG 3KF6B 3UDXA 5E7NA 4DV0Q 3RZDH 4NXNL 2ZM6Q 1CKOA 1XNRQ 4O2DA 3K0XA 4OWXB 3H0GG 2E8GA 1KL9A 2HIVA 4GOPC 1UE7A 4UPAA 3CCSA 3H15A 3UDFA 2JEAI 1KC8C 1IBML 3RZOH 2MQHA 2ID0A 4JOIA 4JC0A 2BH2A 3AQQA 4R1JA 5IYDH 3HKZG 4R4OA 3EN2A 4BBSH 2JA8H 2R93G 5BR8L 1XPRA 2MO0A 4POFA 4HIDA 1Q7YC 3M4OH 4C3IH 5C4XG 2NVYH 3FKIG 3J80i 3CW2C 1HZCA 1BBWA 3HOYH 1KRTA 5LMNL 1MIUA 4WJ3M 4R4CA 1HZAA 4UP7A 5IYDG 4JV5L 4GKKL 4H02A 4DV5L 1LYLA 1FVIA 3KJOA 4NXMQ 3CMEA 1Q12A 4IPDA 4LFAL 4YHHL 1YNXA 4A3IH 3AEVA 4JI8L 1V43A 3BZCA 1WI5A 3H0GH 4A3IG 3PF5A 4OWTB 4X6AH 5M5WH 1B7YB 1VQGA 2AWOA 2Y0SE 4YWLA 3M85A 4LF9Q 2DUDA 3RR5A 3J7A5 4LFBL 3E0EA 1HNXQ 1JT8A 1VQ8A 3LGJA 3S24A 1NMGA 1Y1WG 4IOAA 2IT1A 3BJUA 3CCLA 1QVCA 3IRBA 4LUVA 1YI2A 1C0AA 1N36L 2ATWA 3HOVG 5GAEC 4L5TA 4DV2Q 4DAMA 1HNWL 2NZOA 4YY3L 3K7UC 4JBWA 2D62A 1SLJA 4KI0A 4IPCA 4DV6Q 2MO1A 1XMQL 1S72A 4APVA 3I4NH 3BU2A 4JBJA 4C3JH 1R9TH 1SN8A 1E24A 2QA4A 4GOPA 2DGYA 1ASYA 3HOUH 2K75A 3GD7A 3CCJA 2I5HA 2UUBL 2E2HH 2PQAA 1Y1WH 2VL6A 1XJVA 2JA5G 1XNRL 1OTCA 4GOPB 2A8VA 4JV5Q 3F2DA 3JC66 3S1RH 2ES2A 4B3RQ 1EFWA 4KLKA 5JJKA 3B6YA 4LFAQ 5IWAL 1BVSA 4GS3A 3UE0A 1IBMQ 1YBYA 3S2HH 3STBD 2H5XA 2JA7H 1FL0A 4LF9L 4LF6Q 4LFBQ 2K14A 3M7NA 4A93H 2Z0SA 1QVFA 1NE3A 2BA0A 3I2ZA 4O0AA 1L1OA 2GVAA 3KYHC 1XPOA 1XPUA 4R4QA 4QY7A 2PI2A 1WFQA 2B29A 3ULJA 4C2MH 4JI2Q 1GKHA 2VQFL 1UE5A 5M3FG 4HJ7A 1FJGQ 4DV7L 1TWGH 1E7ZA 1EUJA 4HJ9A 4P75A 1MJCA 3PIOA 1XNQQ 4DV6L 1X54A 4IOCA 1XMQQ 1IBLQ 3L2PA 5IYCG 3CP0A 4OXPA 1K3RA 3HKZE 5IP9G 1PH6A 4LF5Q 2B63H 3HFZB 2R7ZH 1VQ6A 1SRUA 1IXRA 1TWFH 3PO3H 3CC2A 4NXML 2NZHA 4A3FH 4DUYL 3TQYA 2F4VQ 4YHHQ 3I7FA 1SROA 3NELA 3AYHB 4JI7Q 3HOZH 4A3CG 2OTJA 2OTLA 3GDEA 2HHHQ 1V1QA 4IFDG 3CPWA 2VS1A 2C35B 2JJQA 4DK6C 1IBKL 4IPHA 2UXCQ 1UE6A 2K5NA 1XMOL 4BY7G 1YHAA 2MNAA 4BBRG 4LF6L 1OXVA 2I5MX 4GN4B 4JYAL 4TQUS 2E2IH 2Q2TA 1NMFA 4DV1L 3T1HQ 3TS2A 1G6PA 2QGQA 2R6GA 1N8RC 3W1BA 4LW1A 1VQ7A 1FJGL 1Z9FA 3H3VH 1AH9A 4LF8Q 2AHOB 1CUKA 5HGQA 1A62A 4MNOA 3RLNA 2VNUD 2CCZA 1PH8A 4LF7L 1HR0Q 2A19A 3K80C 1KAWA 1Y14B 2PI2E 2UUBQ 1IBLL 3KF6A 1X6OA 3PUYA 5GAHC 4A75A 3U58A 1K8GA 2VUMH 1T9HA 4B3MQ 2JA6H 4DR7Q 2KBNA 2NN6I 3GTMH 4GLVB 1J6QA 4HIKA 1VQ9A 4IFDI 2ZM6L 1NTGA 4GN5A 5IWAQ 4NXNQ 2ASBA 4AIMA 4P71A 4K0KL 1PVOA 4OONA 5C0XI 1ASZA 3M3YH 3H3VI 1VQDA 1VQIA 1W2BA 1NY4A 4IJHA 1Q82C 2YU9H 2HQLA 3MXNB 4A76A 4JI1L 1C9OA 2WAQE 4DR1L 4QL5A 4PZ6A 3CD6A 4JYAQ 3J81c 2CQOA 2VQFQ 1P8LA 1GM5A 4JI2L 4Y52H 4IFDJ 3I4MG 3L7ZC 2CWPA 1Q86C 5IYCH 3S15H 3M9BA 4HJ5A 2IY5B 3PV0A 3M4PA 2ZJQA 3HOWG 3D0FA 1XTDA 3I4OA 5FJ8G 1B8AA 3K81C 1PH7A 3GTKH 3PF4A 1X55A 4A3GH 3A0JA 1A0IA 3BZKA 4JI0L 4DR6L 3OYYA 1PH3A 4Y7NH 2R7DA 5LMUQ 1M1KC 3PUWA 1VCIA 2NN6G 1KQSA 1CSPA 3J81j 5IP7G 1VQ5A 1VQJA 4DR4L 1A63A 5J3BA 3RLFA 2Z6KA 3HKSA 1C7YA 2N49A 5IYBH 5C0XG 1OXUA 1JJCB 4A3KG 2VY3A 5GROA 4A3BH 4DR2Q 2K50A 2OQ0A 1O7IA 2YTYA 3GTGH 4DR3L 1Y1VG 4LUZA 1P16A 1Q46A 1TXYA 1XMOQ 2ZTCA 3T1YQ 2YTVA 4KHZA 1TWCH 5C0XJ 3S14H 1TWHH 2KHIA 1KXLA 4A3MH 4BY1H 1RL2A 3MEFA 2RHSB 3WWVA 1VQOA 2JA6G 3NENA 2YYZA 4LFCL 1EIYB 3PUZA 4JCVE 1EQQA 1OXXK 2CFMA 3I56A 2VQEQ 1YJNA 4A3DG 1EOVA 3S2DH 1HR0L 2EQSA 4OX9L 4A3DH 1N9WA 3G71A 1YJ9A 4JI3Q 4A3CH 2F3IA 2QEXA 2R7FA 4JI0Q 2R92H 3CCUA 2WB1G 5LMUL 4JOIC 2WAQG 2HT1A 4AYBE 4DNIA 2JA8G 2NVTH 4JI4Q 1PH1A 2GN5A 1VQEA 3KLWA 1I50H 4B3RL 4BY7H 4A3JH 3HOWH 3D31A 5C3EH 4X62L 1E3PA 4DR3Q 3F2BA 4DR1Q 2Z6KC 1MJEA 2D0OA 4GLAC 4X65Q 1IYJB 4DR5L 2WB1E 3E9HA 4A3FG 4B3SL 4GKJQ 2GVBA 1X3EA 3PCOB 3W5OA 3TRZA 1WYDA 1YJWA 5JEAG 1VQHA 1X56A 1S3OA 2K5VA 4UP8A 4NPSA 1PFSA 3PSIA 3J80c 2D0PA 2OWOA 2HIXA 2BA1A 4TVAB 1S40A 3S17H 2NVXH 2AWNA 4DR6Q 3KFUA 5GQOA 2IX1A 1XNQL 1YZ6A 4LF4L 1LM0A 2Q2IA 3OTOL 1OXTA 2UU9L 3KDFB 3HOZG 2Y0SG 3S16H 1VQLA 1H95A 2RHQB 1YHQA 2PNHA 3UE1A 2JA9A 1D7QA 3CC7A 4PZ7A 4DV0L 4UP9A 2YV5A 4L5QA 2CKZB 2L15A 2KENA 2UUAQ 2N3SA 5C4XH 2HHHL 1MKHA 3GTOH 1E1TA 4DV3L 3VDYA 1RIPA 4X62Q 1IBKQ 3F2CA 2LSSA 3RNUA 4A3BG 4P73A 5M3FH 4MZ9A 3RN5A 1IL2A 2LXKA 3CCMA 4NB3A 2V1CC 3RLOA
chains in the Genus database with same CATH superfamily
3T1HL 5I6YA 4A3KB 5ISRA 1WTXA 2CHBD 4KHPL 1TVXA 2QF7A 5IODA 4OO1I 4QUFA 3L0OA 4C3IG 4JBMA 3O13A 3KF8B 3G6EA 1EIFA 2E5LQ 1A3VA 2K5HA 1EIGA 1N34L 1LTLA 4S3SA 4EX5A 4B3ML 2R92G 4F8MA 3TEHB 1PTOH 4AQYQ 3I72A 2RCNA 2UXDQ 1D1KA 4B3SQ 3NP8A 2Z4HA 1PMRA 5CV4A 3QO2A 4QGUA 3F1ZA 2Q8IB 3CCVA 3FP9A 1PFBA 2L4NA 4O42A 5ELEA 3CF5A 2Z9HA 1GUTA 3K58A 2M00A 3ERSX 1SMYD 1F9QA 2KCTA 2OQKA 1JCKB 5EKKA 5IE8A 4HIMA 2B63G 3PO3G 4DR4Q 2JE6I 3I73A 5GAGC 1EOTA 3EIVA 4H0LC 4HCSA 2L0CA 3KF8A 1KD1C 5T1IA 4OL7A 1FYCA 5ELCA 4WJ4A 2B2VA 2N88A 2MHVA 1CKMA 1B2TA 1A8VA 4EGVA 1O80A 1SMXA 4LNQA 1X3GA 2F4IA 3HKZB 5EPJA 4K6LA 1Z6HA 3A8KE 2ZXOA 1Q90A 1XYIA 1I4QA 2KCNA 4OX9Q 5CBAE 3RZDB 3NBIA 1PH4A 3M4YA 4ZK9B 1G8ZD 5IGEA 4JI4L 4IPGA 2EJFC 2RBMA 4JG2A 2NVQH 5JJLA 2A5HA 3DWPA 3HOUG 1JJGA 1HJPA 1EYAA 2F0WA 2A73B 3IL8A 1EQTA 1FGUA 5HY6A 3Q23A 5I4DA 4DNTB 4LUOA 1TU2B 1K3BC 1W6JA 3STBC 3NE5B 2KOLA 1TWAH 4M8AA 1H9MA 1ZEQX 4PZ8A 4P72A 3PUXA 5C5LA 4KN7C 2IHFA 3CQZH 3K7AH 4BXXH 1FNVA 1B70B 5HGTA 3SK4A 1M90C 3CPFA 4NDXA 3S14B 3KOJA 3A74A 2NBFA 3KBGA 1YNJC 4KJOA 4DKAC 4UY8C 1KABA 2B2UC 2K03A 4CDDC 2F0NA 1SE2A 3GTQH 1VQMA 1Q81C 4R8NA 3K5LA 3TBIB 4KHPQ 1PRTB 1Y1VH 2D2CC 2WFWA 4DV7Q 1PRTF 1N33Q 1GUOA 2FMCA 5C3EB 2E5LL 1Q8KA 3CU7A 3DM3A 4NMZA 3DEPA 1WCMG 4BBRH 2SNMA 2HCIA 1QUQA 5CMDA 2FINB 1MGSA 4AQYL 3MXGA 3R93A 2PMZE 1X9NA 1EYGA 4DAPA 1G291 1K83H 3D6WA 3U9SA 4LFCQ 5DM63 3GTJH 3DMUA 5KGUA 3EJIA 2ZJRA 5C3EG 1GUWA 2EY2A 3I3CA 4RG1A 4BWGB 3R2TA 1HNWQ 1G2TA 1GUNA 1PHJA 2BH8A 3NWSA 3NK9A 5M5YH 3RN2A 4OGQC 4BBSG 3KF6B 5E7NA 3RZDH 2ZM6Q 2LS01 4B9WA 4OWXB 2EZVA 2HIVA 4GOPC 1UE7A 4UPAA 2XVSA 3H15A 3UDFA 4A3FB 2JEAI 1KC8C 1LTAD 2MQHA 2ID0A 4JOIA 1MD2D 4R1JA 3OSOA 3P7JA 3HKZG 4BBSH 2JA8H 2R93G 3VYRA 4HIDA 4C3IH 1F2YA 5FK9C 3CW2C 2LFNA 5LMNL 1HQMC 4KY7A 1SSOA 4UP7A 2JA7B 4H02A 4DV5L 3V2TA 1LYLA 3HGBA 1G2SA 3S2HB 4NXMQ 5DAUA 2D5DA 1M8AA 1VMPA 1WI5A 4N8FA 1LT3D 2NZ1D 4OWTB 3PF5A 1B7YB 3J7A5 2AWOA 4LF9Q 3MWYW 3E0EA 4DGZA 4N8X1 1VQ8A 3LGJA 3S24A 1NMGA 2BOSA 5A2QL 3K5MA 4LUVA 1C0AA 1N36L 2ATWA 1ZXTA 3VA7A 2JSOA 2NZOA 3EROA 1LTTD 1PRTD 3OIQA 3TP5A 4DXGA 1H9SB 4DV6Q 1U4RA 4JBJA 1BOSA 2FHTA 4GOPA 2EYMA 1BCPC 1BBXC 2JA5G 1CHQD 3JC66 5JJKA 3EVQA 3WDNA 3B6YA 1BVSA 4J8QA 2F0PA 3STBD 1F2LA 2F0QA 4LF6Q 3W2DA 5EQ0A 1E2VA 4QY7A 5KYIA 2VQFL 4C2MH 2AUKA 1GKHA 1FJGQ 1UE5A 4DV7L 4EQPA 2XNAC 4P75A 3PIOA 2XWJB 3D4DA 5IYCG 4QF4A 4OXPA 4G57A 3GV6A 3CC2A 2NZHA 4A3FH 1WTOA 1LT6D 4YHHQ 1SE3A 2HHHQ 4IFDG 1CQVA 4XYQA 1VDZA 1IBKL 1EYCA 2F0DA 4BY7G 4BS9A 1YHAA 4BBRG 4X3SA 4GN4B 4TQUS 4CKCA 1NMFA 2R6GA 4KK7A 1UUPA 3NHHA 2B2YC 1VQ7A 2G5DA 2AHOB 2VNUD 4NW2A 2CCZA 1PTOF 4ULLA 4FF3A 1Y14B 5EPKA 1IBLL 3MXUA 4RCOA 1T9HA 1MBYA 3P20A 3FPUB 4ZAIA 4GLVB 3HS0C 4RHRA 4IFDI 2ZM6L 1NTGA 4AIMA 1II3A 4C3HG 2F0JA 1VQDA 1EEID 1VQIA 1W2BA 5JPNC 1K8MA 4A76A 1GHJA 1KLUD 4G7ZC 4PZ6A 3CD6A 4JYAQ 1GM5A 1P8LA 2PPBC 2CWPA 1SMYC 4C3HB 2IY5B 3DWAA 2J4XA 3M4PA 3D4RA 3HOWG 1MSGA 3IFTA 3D0FA 3I4OA 5FJ8G 1PH7A 5T1GA 3A0JA 1A0IA 2CVRA 5C3WA 4DR6L 3OYYA 4X3UA 3PUWA 5I9PA 3J81j 5L37A 1VQ5A 1CK1A 3RLFA 3PIP3 5C0XG 1JJCB 1FNWA 2VY3A 2RKSA 5D14A 3C46A 1QCBD 1Y8OB 2K50A 3JAML 5IGGA 4LUZA 2IL8A 1TXYA 3T1YQ 3S14H 5JAVA 2QCPX 4DAVA 4BY7B 2KHIA 1BO0A 2EXZA 3LNNA 2PCFB 1EY5A 3TP6A 1GXDC 4PNYA 3MEFA 3K7AB 3NENA 3CQZB 1YJNA 4C56C 5KYLA 4FXGC 1EZ6A 1TWAB 2CH4W 4A3CH 1RJTA 3S2DB 4RKLA 1KAAA 1HA5A 2R92H 1B50A 2WB1G 4XQQA 1Z7TA 4IUUA 4XQJA 4K5WA 1DOMA 4K14A 4IUPA 2R93B 3D31A 4DR3Q 4L6TB 4Z9CB 3C2PA 4A3FG 4DR5L 1HXYD 2WB1E 3E9HA 2E2IB 2GVBA 1CZWA 1YJWA 5JEAG 1X56A 1YNJD 3G6JB 1PFSA 1TS2A 3PSIA 4OHJA 2D0PA 1M4VA 3P75A 3S17H 3VR5A 2NVXH 1STBA 3KFUA 5K5PA 1PDQA 3GTKB 2UU9L 2KECA 3J7AF 2VXWA 5JVH3 2CKZB 1S5FD 3VYSA 1I6HB 1V1OA 4XDXA 2HHHL 5KRUA 2OT2A 2PO4A 1B53A 3M3YB 1IBKQ 3F2CA 3RNUA 4FF1A 5CC4A 5EJWA 5M3FH 2V1CC 1STAA 3ONAB 3SDZA 2I46A 4LK1C 1H9JA 3BS1A 4GNXB 4A3JG 4DU9A 4HIOA 4KKUA 4A3EH 1AN8A 3BYTB 4X64L 2OEOA 4H7BA 2E2HB 3X3NA 1ZKOA 1GUSA 3IFDA 1VQNA 5FLMH 1EQRA 3I55A 2UUAL 4RKBA 1D8LA 3KUPA 4IUTA 1A6XA 4A3EG 4UHVA 4ZQ3A 3KK7A 1EYDA 3U9OA 1GJXA 1PZID 1AE2A 2F0IA 1T5EA 3FMCA 2F1MA 3HRZC 5C4JB 1E22A 4YY3Q 2NN6H 4A3IB 2ALYB 4KD4A 1PH9A 4DK1A 1QOHA 4K8IA 4FVMA 1NCVA 4A3KH 3CAMA 2UUCQ 1KHIA 2Q8RE 4HR7B 2F0KA 1I94L 5M5XH 4LF5L 4KY6A 5IGFA 2B8FA 2WKDA 5EBDA 3J80L 1JMCA 4A93B 4B3TL 1D5ZC 4JBKA 5JEAJ 1WTVA 5C6AA 2K5QA 5C4XB 1F2MA 1SJED 4WORA 2UXBL 3IAYA 1HZ9A 1H9RA 1YVCA 3N6RA 2FXQA 2UXCL 4A93G 2F3WA 3C3LA 1X3FA 2JXMB 3EFXD 5M3MH 1EY0A 2PYKA 5BR8Q 3HOUB 1R9TB 1EIHA 5H1SE 2F0LA 1JJ2A 1DXMA 1DCZA 3HOXH 2B3GA 1PYBA 3J80E 4LF7Q 5AFWA 1EWHA 5JJIA 1STGA 1HNZL 1YIJA 1SYCA 1C48A 1I4XA 3AFPA 4XIGS 3SEBA 3VR4A 2PNRC 2B2YA 4CHTB 3BYYB 2ZJPA 1ESRA 4K0KQ 1I3QH 4DA2A 4A3EB 2I0QA 4YCWA 1SYFA 1STHA 5C0XH 1PFNA 1B9NA 1HFGA 2BE5D 5LMNW 3VYTA 2R7ZG 3ULPA 1SNDA 1JE5A 1U4PA 2XTIA 3TREA 2E74C 2K4KA 1K0RA 1LLRD 1F77A 3S9WA 5ELOA 5DNFA 1SNOA 1PH2A 1SYEA 1WCMH 2V4DA 1MI2A 3CXCA 4A3MB 2A6ED 3AMUA 4RMFA 3F8TA 2KJXA 4A3LG 2RF4A 5J1ZA 3J81L 2Q2HA 1HR0W 3QR8A 1K0SA 1V1PB 2KHJA 1ICWA 1I4PA 3GTLB 4MTNA 3MFYA 1KRSA 4HMIA 4JI6L 1HZBA 1SEBD 3EBEA 1BF4A 1A3TA 1VQ4A 3HG9A 3CHBD 1HH2P 3SGIA 5FLXc 1S5ED 1X65A 4CJ1B 1T5XD 2F0OA 5FO7B 3NUCA 4KN4C 3FKIB 3P1HA 2MUYA 1I50B 1IZ6A 3AFQA 1J5EL 2VUMG 3H91A 3OWEB 1HUMA 1DZ1A 1O7LA 3UDIA 1YITA 2A1AA 2E2JB 2N78A 3SK6A 4JI8Q 4QCLA 5C44G 4HAEA 3ITPA 2KEDA 4GKJL 4CJ2C 2A6HC 2DJGC 1X3QA 4IN3A 1HNXL 3QIAA 3TZDA 1O7ZA 1AP0A 3Q8DA 1SXTA 4AH6A 3I4NG 1O78A 3U4VA 4QQBX 3FKIH 4GLXA 1JB3A 3TDQA 1WD1A 5JVG3 3UI2A 2F0VA 1HTLD 3SK8A 2UUCL 4LF4Q 3T16A 2XRSD 2KCMA 3CCEA 3UDXA 4RGNA 2F3VA 5IOCA 1BCPD 1EY7A 1ENAA 4O2DA 3K0XA 1TS3A 4WJWA 4A3GB 1PTOD 3VR2A 2EDGA 3DEOA 5CV7A 1IBML 2HCCA 4JC0A 1EFID 2TMPA 1LTRD 2K33A 5IYDH 3BVZA 3MFGA 4CKBA 5BR8L 1WVLA 2MO0A 2KA7A 1HZCA 3HOYH 1KRTA 2B2WA 3ERQA 4GKKL 5FKAC 4HSPA 3CMEA 1Q12A 4IPDA 4A3IH 3OWFA 1V43A 1U4MA 2A6HD 3H0GH 3S1RB 2K1BA 4RCNA 5M5WH 2CH4A 1Y1WB 2X69A 4IOAA 1Y1WG 3BJUA 1D5MC 1QVCA 3FEWX 1KDBA 3HOVG 5GAEC 4L5TA 4DV2Q 4OELB 4JBWA 4IPCA 1S5DD 2MO1A 1S72A 4APVA 4WRDA 3BU2A 1R9TH 2F0EA 1ASYA 3GD7A 3HOZB 2I5HA 2ZXPA 1XNRL 4GOPB 2K28A 4JV5Q 3S1RH 1HFNA 4KKSA 3E5SA 3SHLA 2SDFA 1YNNC 1HCZA 4GS3A 2C5CA 3UE0A 5IGBA 5C3XA 2H5XA 3L3OC 4LFBQ 2K14A 4A93H 1B44D 2Z0SA 2BA0A 3I2ZA 4O0AA 1XPUA 3HOYB 3C1EA 2PI2A 2NVYB 5M3FG 4FF2A 2AQ1B 1E7ZA 1EUJA 4HJ9A 3MVVA 2ICIA 1NNXA 1PFMA 1X54A 1IBLQ 2WAQB 3BVGA 3CP0A 1K3RA 3HKZE 5IP9G 2QILA 1VQ6A 1IXRA 3PO2B 2F4VQ 3I7FA 3NELA 4A3CG 3AYHB 4U68A 5BN4A 4KJNA 1NAPA 3I4NB 3CPWA 3IKJA 2JJQA 5C4HA 2K04A 4HN7A 1WD0A 4IPHA 1XMOL 2B8GA 4JYAL 1OXVA 2E2IH 4DV1L 1G6PA 2QGQA 3W1BA 4LW1A 4IURA 3H3VH 2K6AA 1IYUA 2A19A 1KAWA 2UUBQ 3KF6A 2A69D 3PUYA 5BN5A 2VUMH 5G3LD 1WTQA 4HIKA 2ASBA 4GN5A 1DJRD 1PTOC 1SBBB 2R3ZA 5IWAQ 3Q24A 4P71A 2Z6BA 2EY6A 1Q82C 2HQLA 4JI1L 2ZXRA 1D1IA 4FXKC 4DR1L 2O2LD 1CT1D 4JI2L 3I4MG 3L7ZC 4HJ5A 5BN3A 2ZJQA 3TN2A 1CHPD 2MPMA 1TY2A 2R7DA 1KQSA 1VF7A 4IUNA 3SE0A 2EYLA 2L5TA 5COYA 3WOFA 2K32A 2Z6KA 1PLFA 2N49A 4Y7NB 4ZUIA 1OXUA 5GROA 2OQ0A 3GTGH 4DR3L 1Y1VG 5IGDA 2YTVA 1TWCH 5C0XJ 2PZUA 2QDBA 1CA5A 1TWHH 1CQFA 1KXLA 4RGMA 1I4RA 1RL2A 2QDLA 2K5WA 1QNUA 1QNKA 1VQOA 3GTJB 1JICA 2JA6G 1EIYB 2YYZA 3PUZA 4JCVE 2O5IC 4C3JG 1K83B 5CV9A 2CFMA 2I07B 4A3DG 1EOVA 1HR0L 5KNBA 2EQSA 1N9WA 1VF5C 3I90A 1YJ9A 1GUGA 1CA6A 2QEXA 2R7FA 1QILA 1RDPD 4DNIA 1PH1A 2Z1CA 3PMFA 4BY7H 2HDMA 1I6VC 1GOZA 1HQRD 2Z6KC 1MJEA 2D0OA 1IYJB 4B3SL 2QKIC 4XT1B 1X3EA 3W5OA 2K5VA 2RVLA 1S3OA 2OWOA 4TVAB 5TSSA 2IX1A 2WACA 1OXTA 5KEEA 3PIO3 4KY5A 1ILPA 2Y0SG 3S16H 1LTSD 2RHQB 3UE1A 2JA9A 4TRDA 1KDAA 2F0SA 4G7HC 2L15A 3S1MB 2KENA 2UUAQ 1SYDA 5C4XH 5FLXL 1JWUD 4X62Q 4P73A 1IL2A 5FO8B 1CZGA 2LXKA 3CCMA 3RLOA 1EWIA 2VQEL 4BXXG 2EYPA 5IT9c 1ILQA 3T13A 4XYOA 4RH6A 2A6EC 4ZKBB 4IALA 4OIJA 5LMNQ 2F0UA 3U50C 3ZYYX 1UEBA 5AJ3L 1L1OB 1I94Q 5LL6S 1WTPA 2NVQB 4DV5Q 1SE8A 3N52A 4U673 4B3TQ 3I4MB 1E2WA 3EQLC 3MA2B 3CCQA 1HPCA 3D4WA 1PV4A 2UXBQ 4UDUC 3GV3A 3KLRA 1GD7A 4H13C 1C4QA 5M3MG 1VS0A 1KIXA 1PYSB 2VZAA 4ZLTF 4KTAA 1Y8PB 1BR9A 1R4PB 1DGSA 1F9RA 3HOXG 1WOCA 3G4SA 2CW0D 3H94A 2IJ0A 3NEMA 4PG3A 1CKNB 2EYFA 4K5VA 5IYBG 3I70A 1W3SA 2F0FA 1WJJA 1N32L 4JI5L 3FRPB 4JK1C 1JE4A 4I65A 4MIUA 2WP8J 2EYHA 1HUNA 1I6HH 1RKNA 4N9TA 3ICEA 4YCUA 2R61A 1I4HA 1ZYRC 4ILWA 3A56A 2NVXB 1EY6A 1N34Q 1I5FA 4GNXC 2BDNA 4PMBA 1JQYD 3LWEA 3I4MH 5IP7H 4DUZL 1GO3E 4DAYB 2JYOA 3NTKA 3URYA 2A74C 3RMHA 4DR7L 2HD3A 3HOYG 1UNSA 4X66Q 1AE3A 4I7ZC 2UXDL 2A69C 4RHSA 4DK3C 3C1FA 5K36G 4ZKCB 2RDHA 2JQOA 1IKLA 1VQCA 2IX0A 4AYBG 2NYZD 1UWVA 2R92B 1VQFA 3K0YA 2NWGA 2XSCA 3E6ZX 5C44H 1NUCA 2IHEA 1U0LA 3KDFA 3S1NH 3BVMA 2RA4A 4C3IB 3WOEA 2EE1A 2YTXA 4HMJA 4LAAA 1J5EQ 1LT4D 5IY0A 3S1MH 2L12A 3HOVB 1Q1BA 2I5LX 3MHBA 3HEJA 5CGKA 4A3BB 4DR2L 1JWSD 1L1OC 1SDFA 3KBXA 1SFOB 1ZYRD 1E1OA 4DPGA 3GTQB 5KIXA 1K9MC 4DK0A 3DLLA 3DXJC 4JVZA 2XGTA 4X3KA 1SFOH 2VW9A 3E9IA 2MFIA 2BE5C 4C3HH 4EQOA 5CV8A 1NSNS 5AJ3Q 3UDGA 3GP7A 1Q1EA 3HOVH 3VR6A 2AKWB 1CSQA 1STYA 5J22A 4ABNA 1QVGA 2A68C 1BCPB 5F2DA 2B2TC 5DM73 3GTPH 4L8JA 4QIWE 3AB9A 3T1YL 3PUVA 1DD2A 4KV6A 2EIFA 3GTPB 3T53B 4CBVA 4HJAA 3FHWA 1IL8A 4J1MA 1VQBA 4BBRB 3JAME 3G7LA 3HP3A 4KKTA 4AYBB 3MXNA 2Z4IA 1TWCB 2IPKD 4LF8L 1N36Q 3NBHB 2WINB 2ENBA 5FJ8H 1DOKA 2CW0C 4R4TA 4TSSA 2EOTA 5NUCA 3A5UA 4JW0A 1NR2A 4GKKQ 4DV4Q 4DV0Q 1JR0D 4OIKA 4LJZC 3H0GG 1KL9A 5CORA 2RSNA 1CTMA 3BZDB 2EYJA 2RDFA 3S15B 1B1ZA 2BH2A 3I4LA 1SJHD 3NQTA 4R4OA 3EN2A 3SK5A 1EEFD 1XPRA 4M1UB 1SNCA 4GZYC 4HCEA 3ND9A 4POFA 1Q7YC 2XRQD 4C2MB 3FKIG 1RODA 1BBWA 4JPBW 1KTKA 3K5OA 2B39A 3OMGA 4WJ3M 4J6HA 4JV5L 4QMGA 2E75C 3AU7A 2SOBA 4YHHL 2GA4B 3BZCA 5EKIA 4X6AH 1VQGA 2Y0SE 3J7YW 4LFBL 2DUDA 3RR5A 1JT8A 3CCLA 3KLSX 1UEAB 3GQBA 1TY0A 1B4OA 1EY8A 2LKVA 1HNWL 4DAMA 1SLJA 4KI0A 3I4NH 4A3LH 2JP1A 4C3JH 1SN8A 1E24A 1BDOA 4RAUC 2DGYA 4CDEC 5E4XA 4K6DA 2PQAA 1XJVA 1DM0B 3F2DA 3A8IE 2R7ZB 2Z8LA 4F87A 4LFAQ 1O7YA 4ID6A 5CV5A 1YBYA 3S2HH 5E1FA 1ESFA 2JA7H 5IIFA 1TS4A 1QVFA 4YIJA 3T51B 1EU3A 4R4QA 3MAQA 1WFQA 2B29A 1CI3M 5KNCA 4HJ7A 4MN3A 4IFDH 3FVQA 1MJCA 1X3PA 1XNQQ 1L0YB 1DONA 1XMQQ 2JA8B 3L2PA 1EQVA 4BBSB 1PH6A 4LF5Q 1LTGD 1SRUA 3S16B 4NXML 1KLGD 2RSOA 3HOZH 2N55A 1JORA 2OTLA 3GDEA 1RF2D 2VS1A 2F0TA 3ND8A 4UAIA 1PXUA 2UXCQ 1UE6A 2ICEC 2G9HD 2RQXA 2I5MX 1J8IA 2Q2TA 2PW7A 1N8RC 2LMCB 4QUCA 1RHPA 4Q0FA 1AH9A 4LF8Q 5HGQA 4MNOA 3RLNA 1F9SA 1PH8A 4LF7L 2EY5A 3K80C 1BUVT 2PI2E 2NVTB 1X6OA 4A75A 3U58A 1G91A 1HRJA 1RTNA 1J6QA 1IW7C 5FO9B 4K0KL 5C0XI 1ASZA 3H3VI 2KVMA 2YU9H 1S5BD 3EA6A 2WAQE 1EWCA 4QL5A 1SAPA 2D9UA 1S4ZA 2CQOA 3J81c 2VQFQ 4Y52H 4IFDJ 3M9BA 4F7XA 2M2LA 3PV0A 5E3FA 4DF7A 5LL6X 2BCOA 1LTBD 1KDCA 3TP8A 1Y1VB 4CKEA 3PF4A 4A3GH 1X55A 3H3VC 1PH3A 4Y7NH 1M1KC 1VCIA 3NWTA 3I91A 1VQJA 3CRLC 4RFBA 1C7YA 5D3IB 5IYBH 1FNUA 2F0MA 1ET9A 5A2QE 4A3BH 2B2WC 1SYBA 1BNZA 4KHZA 3X3MA 3I8ZA 4BY1H 2QEJC 1CM9A 2L11A 3CRKC 5IT9E 3OW7A 4LFCL 2J7ZA 1EQQA 1OXXK 3V96A 2JN4A 3I56A 3TP7A 4C1NK 1FR3A 4A3DB 4WFN3 1V1PA 4QIWB 3G71A 4JI3Q 3R2IA 1EZ8A 1EY4A 4JI0Q 5DEHA 2JA6B 5LMUL 5EGTA 2JA8G 2HT1A 2GN5A 1PYWD 3KLWA 1I50H 1R4QB 3M7GA 4A3JH 1QG7A 2BDOA 5D3DA 3HOWH 4X62L 3PQIA 1Q3LA 4DNRB 4GLAC 4X65Q 2K01A 4GKJQ 2HQEA 5E4WC 4CJ0B 3TRZA 1WYDA 3BDCA 1J9OA 3J80c 4Q5VA 5I9OA 1D5XC 2BA1A 1STNA 4X3TA 2AWNA 2IW3A 4I7AA 4DR6Q 1EU4A 5GQOA 1XNQL 4LF4L 1LM0A 3OTOL 1SYGA 5ELBA 1DYQA 1Q8IA 3KDFB 1TWFB 1H95A 1LT5D 1YHQA 4CDFC 2B63B 2PNHA 1ML0D 3PO3B 3CC7A 5JEAH 4PZ7A 4UP9A 2YV5A 4L5QA 1SNPA 2N3SA 1MKHA 3W3AA 3GTOH 3OOCA 4DV3L 5C4ZA 2NB0A 3RN5A 4NB3A 1A62A 2RCFA 3MZ5A 2J0TD 4B9XA 5IGCA 1PRTC 1UE1A 2WV6D 1AW7A 1K73C 1BBUA 3R3OA 4XQNA 5GADC 1KNAA 3M4QA 5EAYA 1N32Q 1LV9A 2AUJD 1E0BA 2E2DC 2CWAA 4JI5Q 2NTTA 2PMZB 1VQPA 2PZTA 3S1QH 1PZJD 2FMMA 1IYVA 3BDOA 1HNZQ 3W1GA 1AEXA 1G51A 4RA8A 1YHBA 1PTOB 1OXSC 3DUZA 1PH5A 2X6LA 2AQ2B 2L55A 5ELNA 3PO2G 3E3XA 1I4GA 3Q22A 5ELFA 4P74A 5EBCA 4R8IA 3PO2H 1VQAA 2B2TA 3H0GB 5KNDA 2UU9Q 1CKNA 2WB1B 1A15A 2FFKB 1TWGB 1XWEA 2LY7A 2N8NA 1ONLA 3Q0AA 4DUZQ 1PZKD 5J39A 2DY7A 1QZGA 1GHKA 2PQAB 5M5XB 1SR3A 3PGZA 2M9VA 1TS5A 3D3RA 2FJ2A 4X66L 3M4OB 2PW5A 1LUZA 4BA1I 2SEBD 4GNXA 4PMWA 1MSHA 2VB3X 1QJOA 4IUQA 1F9PA 1Z47A 5C4JH 4JI6Q 3RZOB 3OPOA 3CC4A 1A3UA 4YWKA 4IQZA 4KD3A 3PIPA 2ZT9C 1H9KA 3A54A 1VQKA 4X64Q 2OCEA 3DM1A 4JI3L 3J81i 4HJ8A 1NBWA 4FO2A 2B2VC 1AZQA 3H6MA 1PA6A 1B3QA 4L63B 1NJIC 3JAMi 1F2ZA 2F4VL 1YEZA 4J15A 5D65A 4F88A 2MP1A 5M5WB 2EVBA 3U4ZA 5JOBA 4ZUJA 1V9PA 3FDTA 3A5ZB 3NPPA 1BKBA 4X65L 3JAMc 3J7ZC 1V8QA 4V0BA 3TZUA 3KJPA 4A4IA 4DV1Q 4IJLA 4FYDA 2H4OA 2KUMA 1HA6A 4L5RC 2DY8A 2MJ8A 3A55A 5C5MA 2E2JH 1WTWA 2DNEA 1XX8A 3ER0A 3OTOQ 4V190 3GTOB 4ODGA 4BA2I 4P2CB 3ZJYC 5I6WA 1IW7D 2KHSA 4GN3B 4ME3A 5IP9H 3CMAA 1TWHB 1LO5D 2LXJA 4DXFA 3CCRA 4ME5A 3NTHA 1YNND 1QZHA 5HURA 3TS0A 3RUZA 2ZTEA 3K5NA 2OXPA 2K52A 3GTGB 4A3GG 2WIIB 4DV3Q 5IT9L 3K8AA 4YWMA 3G48A 3H09A 4JI1Q 2HDLA 2JEBI 4POGA 4LWCA 2ZTDA 4R4IA 4BY1G 4DFAA 4PV1C 4OO1G 2NTSA 2XIWA 1L0XB 2EJGC 4QJFA 2QW7A 1JB7A 2JA7G 2CQAA 2EXDA 3GTLH 5I2YA 3ULLA 3NSWA 3FPPA 4IO9A 1LTID 2JA5H 1QWYA 1QUQB 5JPMC 2R93H 2JK8A 2K7VA 3OW2A 4DV4L 4L5SA 2AMCB 4OWWB 4OO1H 3NQIA 3DHQA 4A3MG 4DUYQ 4JI7L 1SNQA 1U4LA 3K59A 1JOOA 4XTCS 5JJZA 3CKIB 3A7AB 1L2FA 3GTMB 2Q8TA 1U5KA 2XWBB 2VUMB 5FLMG 4DR5Q 4YCVA 1JOKA 2F52A 3GO5A 1EL0A 4FDBA 1I3QB 2SNSA 2JA5B 1GVPA 3MEHA 1N33L 4DV2L 4ALPA 1K8AC 5EPLA 4EQ5A 2Q2UA 1L0WA 3R8BA 5DLQE 1QE6A 3A7LA 2P5ZX 1JOQA 2EJMA 4NXNL 3HOXB 1CKOA 1XNRQ 2E8GA 1LABA 1U9RA 5M9OA 2G9DA 1K8OA 2H1EA 3RD4A 3Q6SA 4C1NI 3CCSA 4MTKA 1X32A 3TSSA 2C9OA 5M3MB 1IKMA 3RZOH 1DOLA 4DAYA 3AQQA 3SR1A 3NXWA 2EY1A 1Y8NB 4XXEA 2PZWA 2VB2X 4NKLA 1WCMB 4KHVA 3M4OH 5C4XG 1CFMA 2NVYH 1BQQT 3J80i 1TKWB 1MIUA 4R4CA 2RDGA 1HZAA 5IYDG 1RD9D 1STEA 1XXGA 5K36H 1FVIA 5G3LF 3KJOA 4B08A 4LFAL 4IZ8A 1YNXA 3AEVA 4JI8L 3LX0A 4QB4A 4A3IG 2E76C 1OO9B 2DN8A 3BG3A 3M85A 3QWNA 4YWLA 2K5DA 3T4AC 1HNXQ 4HSVA 2IT1A 4FNFA 3IRBA 1YI2A 3F2UA 3TMEA 4MHEA 4YY3L 3K7UC 2D62A 1XMQL 1Y69U 4K2LA 4OEMB 2Y0SB 2QA4A 3HOUH 2K75A 3CCJA 5FLXE 2UUBL 3S1QB 2E2HH 3VYUA 3LWUA 5EKLA 2VL6A 1Y1WH 1OTCA 1S5CD 4K5XA 2A8VA 4N9PA 3QOLA 2ES2A 2NUCA 4B3RQ 1EFWA 4KLKA 1H9SA 1A2UA 4LMQD 5IWAL 4G4KA 5ELDA 1RCVD 1IBMQ 3MXPA 3OMCA 3BDLA 1FL0A 4EQNA 1JC7A 4LF9L 3M7NA 3D6CA 3V05A 1NE3A 1L1OA 2GVAA 3KYHC 1XPOA 4RWSC 3ULJA 1D6EC 4JI2Q 2HUGA 3QB3A 4O1NA 1TT2A 1TWGH 2K05A 5CR3A 4DV6L 4IOCA 2IWHA 3QOJA 2DNCA 1B3AA 1JWMD 2B63H 3HFZB 2R7ZH 3PO3H 1TWFH 1BCPF 3K6OA 4HTHA 4IUVA 4DUYL 3TQYA 1SROA 4JI7Q 2OTJA 4C3JB 1V1QA 1FGBD 3T56B 5A35A 1C8CA 2C35B 3VA5A 4DK6C 1SE4A 5LHY1 2K5NA 3E0JA 2MNAA 4LF6L 4HEDA 3T1HQ 3TS2A 3QJYA 1B9MA 4CGYB 1TR5A 3SXHA 1Z9FA 3HZXA 2IX3A 1FJGL 1CUKA 4A3JB 2A68D 4ZCKA 1RTOA 1HR0Q 3OIPA 2B2UA 1AFPA 5GAHC 4EVOA 1K8GA 4DR7Q 4B3MQ 2JA6H 2KBNA 2NN6I 3GTMH 2MGSA 1VQ9A 4E6IA 4NXNQ 1VMCA 5M3FB 2O4XA 3NBHA 1PVOA 4OONA 3M3YH 1NY4A 4IJHA 3MXNB 1C9OA 3MTSA 2F0HA 4FP5D 4BY1B 1QB5D 1FD7D 1Q86C 5IYCH 1NR4A 3S15H 4ZYSA 1LACA 5CV6A 3L9AX 2KEEA 2OF1A 1XTDA 3GTKH 4FXDA 1B8AA 3K81C 1G6ZA 3BZKA 4JI0L 3NTIA 3J81E 5LMUQ 3S17B 2NN6G 1CSPA 2DJFC 2L1BA 5IP7G 4DR4L 1A63A 2WKCA 5J3BA 3HKSA 4RGOS 4A3KG 5M5YB 2F0GA 1HHVA 4PQXA 2X6GA 3SVMA 4DR2Q 1SNMA 1O7IA 2YTYA 4R9WA 1P16A 1Q46A 3HOWB 1XMOQ 2ZTCA 3QG1A 2O5JC 1MHWC 4KMUC 1WTHA 4A3MH 3MC0B 2RHSB 3WWVA 1TIID 1EY9A 1D2BA 3K57A 1ET6A 1A2TA 3J7AV 1AZPA 2VQEQ 5FOBB 3A8JE 3S2DH 3OHXC 5CBEE 1UAPA 2KQ3A 1ENFA 4OX9L 4A3DH 2F3IA 3CCUA 4JOIC 2WAQG 4AYBE 2NVTH 4JI4Q 4NP5A 1VQEA 1XTCD 2TSSA 4B3RL 2KCCA 4DN4M 1W6KA 1K28A 4FF4A 4CDCC 5C3EH 5CYUA 4ZRZA 1E3PA 3D8GA 3F2BA 4DR1Q 1ICFB 3KLSA 1HTPA 4H44C 4K8JA 3PCOB 5I2XA 1VQHA 4UP8A 1IHZA 2L9HA 4NPSA 2EYOA 2HIXA 1S40A 1BXTA 1YZ6A 2Q2IA 1ENCA 2EPBA 3HOZG 4K2KA 2PQEA 1VQLA 4RGTA 4G7OC 1D7QA 4DV0L 4PMCA 4XT3B 2YU9B 1E1TA 1KNEA 4TKOB 3VR3A 2F03A 3DWQA 3VDYA 1RIPA 2AQ3B 4A3BG 2LSSA 3S1NB 2XN9C 4MZ9A 5C44B 1TQOA 1E2ZA 1WTRA
chains in the Genus database with same CATH topology
1EWIA 3T1HL 1UE1A 2VQEL 4BXXG 1K73C 5IT9c 1BBUA 4KHPL 4OO1I 4GNXB 4A3JG 4HIOA 4A3EH 5GADC 3L0OA 4JBMA 3M4QA 3KF8B 5EAYA 5LMNQ 3G6EA 1EIFA 2E5LQ 3U50C 5AJ3L 1UEBA 2K5HA 4X64L 1N34L 1L1OB 1N32Q 2CWAA 1I94Q 1LTLA 4JI5Q 1VQPA 3S1QH 4DV5Q 4EX5A 1SE8A 4B3ML 2R92G 1HNZQ 1VQNA 4B3TQ 5FLMH 3W1GA 3TEHB 1EQRA 3I55A 2UUAL 1G51A 1YHBA 1D8LA 1OXSC 3CCQA 4AQYQ 4A3EG 2UXBQ 1PV4A 2RCNA 2UXDQ 1PH5A 4B3SQ 1GD7A 5ELNA 3PO2G 1AE2A 5M3MG 4QGUA 1VS0A 3F1ZA 3CCVA 3FP9A 4P74A 1KIXA 1PYSB 3PO2H 1VQAA 2VZAA 1E22A 4YY3Q 1DGSA 3HOXG 1WOCA 3G4SA 3CF5A 2ALYB 3NEMA 4PG3A 1PH9A 2UU9Q 1CKNB 1CKNA 3ERSX 2KCTA 5IYBG 2OQKA 3CAMA 4A3KH 1KHIA 2UUCQ 1W3SA 1WJJA 2N8NA 5IE8A 1N32L 4DUZQ 4HIMA 2B63G 3PO3G 4JI5L 5M5XH 1I94L 4DR4Q 4LF5L 2JE6I 1QZGA 5GAGC 2PQAB 3EIVA 1JMCA 1SR3A 3PGZA 4B3TL 4X66L 1KD1C 4JBKA 5JEAJ 2WP8J 4WJ4A 1LUZA 4BA1I 4GNXA 4PMWA 1CKMA 1I6HH 2UXBL 1HZ9A 1A8VA 1YVCA 1SMXA 4LNQA 2FXQA 3ICEA 4A93G 2UXCL 1Z47A 5C4JH 1X3GA 1X3FA 4JI6Q 3CC4A 5M3MH 4YCUA 4YWKA 5BR8Q 3PIPA 5H1SE 1JJ2A 1VQKA 4OX9Q 4X64Q 2OCEA 3J81i 4JI3L 2B3GA 3HOXH 4HJ8A 1PYBA 1PH4A 1N34Q 1NBWA 4LF7Q 1I5FA 4GNXC 1PA6A 5JJIA 3I4MH 1NJIC 5IP7H 1HNZL 3JAMi 4DUZL 1GO3E 4DAYB 1YIJA 4JI4L 2F4VL 3AFPA 4IPGA 1YEZA 4DR7L 4JG2A 2NVQH 3HOYG 4XIGS 3HOUG 5JJLA 1JJGA 4J15A 4X66Q 1AE3A 1HJPA 2UXDL 2ZJPA 3U4ZA 4K0KQ 1I3QH 4DK3C 1V9PA 2I0QA 5K36G 1FGUA 4YCWA 5HY6A 3A5ZB 4X65L 1BKBA 2JQOA 3JAMc 3J7ZC 1VQCA 3KJPA 2IX0A 4AYBG 4A4IA 4DV1Q 1UWVA 4IJLA 5LMNW 4LUOA 1VQFA 4L5RC 2R7ZG 3ULPA 2XTIA 1JE5A 3STBC 3TREA 5C44H 1TWAH 2IHEA 3KDFA 1U0LA 4PZ8A 3S1NH 2E2JH 2K4KA 4P72A 1K0RA 3PUXA 3ER0A 3OTOQ 2IHFA 3CQZH 5ELOA 4BA2I 3K7AH 3ZJYC 1PH2A 2YTXA 1WCMH 4BXXH 1J5EQ 4GN3B 4ME3A 3CXCA 1B70B 5IP9H 5IY0A 3S1MH 3CMAA 4RMFA 1M90C 3F8TA 3CPFA 2LXJA 1Q1BA 3CCRA 3KOJA 4A3LG 2RF4A 1HR0W 2Q2HA 1QZHA 2I5LX 2KHJA 3TS0A 4A3GG 2ZTEA 2K52A 3A74A 4DV3Q 3K8AA 4MTNA 4YWMA 4DR2L 1L1OC 3G48A 4JI1Q 4DKAC 1KRSA 1E1OA 4UY8C 2JEBI 4DPGA 4JI6L 4POGA 4LWCA 1HZBA 2ZTDA 3EBEA 4R4IA 1K9MC 4BY1G 3DLLA 1VQ4A 4A3LH 4OO1G 3GTQH 1VQMA 1Q81C 4QJFA 1HH2P 2XGTA 1SFOH 1JB7A 2JA7G 4KHPQ 3SGIA 5FLXc 1Y1VH 2EXDA 1X65A 2WFWA 2VW9A 4DV7Q 3GTLH 3E9IA 3ULLA 2MFIA 1N33Q 4C3HH 2E5LL 4IO9A 3UDGA 5AJ3Q 2JA5H 1Q8KA 1Q1EA 1QUQB 3HOVH 2R93H 2JK8A 2AKWB 3OW2A 1IZ6A 1CSQA 3AFQA 3DM3A 4DV4L 1J5EL 4L5SA 2AMCB 4OWWB 2VUMG 1WCMG 1QVGA 4A3MG 4DUYQ 4BBRH 4JI7L 1QUQA 3UDIA 1YITA 2A1AA 3GTPH 4AQYL 4QIWE 2N78A 4XTCS 3T1YL 2PMZE 1X9NA 3PUVA 1EYGA 4JI8Q 2EIFA 1L2FA 5C44G 1G291 1U5KA 1K83H 4HJAA 3FHWA 1VQBA 5FLMG 4DR5Q 4LFCQ 4GKJL 4YCVA 1HNXL 3GTJH 2F52A 3GO5A 2ZJRA 4FDBA 3Q8DA 5C3EG 4AH6A 3I4NG 4RG1A 3U4VA 4LF8L 3FKIH 4QQBX 1GVPA 4GLXA 3NBHB 1N36Q 1N33L 4DV2L 5FJ8H 1HNWQ 4ALPA 1K8AC 2UUCL 4R4TA 4EQ5A 2Q2UA 4LF4Q 1PHJA 2BH8A 1L0WA 5DLQE 3A5UA 5M5YH 3RN2A 4GKKQ 4DV4Q 2KCMA 3CCEA 4BBSG 3KF6B 3UDXA 5E7NA 4DV0Q 3RZDH 4NXNL 2ZM6Q 1CKOA 1XNRQ 4O2DA 3K0XA 4OWXB 3H0GG 2E8GA 1KL9A 2HIVA 4GOPC 1UE7A 4UPAA 3CCSA 3H15A 3UDFA 2JEAI 1KC8C 1IBML 3RZOH 2MQHA 2ID0A 4JOIA 4JC0A 2BH2A 3AQQA 4R1JA 5IYDH 3HKZG 4R4OA 3EN2A 4BBSH 2JA8H 2R93G 5BR8L 1XPRA 2MO0A 4POFA 4HIDA 1Q7YC 3M4OH 4C3IH 5C4XG 2NVYH 3FKIG 3J80i 3CW2C 1HZCA 1BBWA 3HOYH 1KRTA 5LMNL 1MIUA 4WJ3M 4R4CA 1HZAA 4UP7A 5IYDG 4JV5L 4GKKL 4H02A 4DV5L 1LYLA 1FVIA 3KJOA 4NXMQ 3CMEA 1Q12A 4IPDA 4LFAL 4YHHL 1YNXA 4A3IH 3AEVA 4JI8L 1V43A 3BZCA 1WI5A 3H0GH 4A3IG 3PF5A 4OWTB 4X6AH 5M5WH 1B7YB 1VQGA 2AWOA 2Y0SE 4YWLA 3M85A 4LF9Q 2DUDA 3RR5A 3J7A5 4LFBL 3E0EA 1HNXQ 1JT8A 1VQ8A 3LGJA 3S24A 1NMGA 1Y1WG 4IOAA 2IT1A 3BJUA 3CCLA 1QVCA 3IRBA 4LUVA 1YI2A 1C0AA 1N36L 2ATWA 3HOVG 5GAEC 4L5TA 4DV2Q 4DAMA 1HNWL 2NZOA 4YY3L 3K7UC 4JBWA 2D62A 1SLJA 4KI0A 4IPCA 4DV6Q 2MO1A 1XMQL 1S72A 4APVA 3I4NH 3BU2A 4JBJA 4C3JH 1R9TH 1SN8A 1E24A 2QA4A 4GOPA 2DGYA 1ASYA 3HOUH 2K75A 3GD7A 3CCJA 2I5HA 2UUBL 2E2HH 2PQAA 1Y1WH 2VL6A 1XJVA 2JA5G 1XNRL 1OTCA 4GOPB 2A8VA 4JV5Q 3F2DA 3JC66 3S1RH 2ES2A 4B3RQ 1EFWA 4KLKA 5JJKA 3B6YA 4LFAQ 5IWAL 1BVSA 4GS3A 3UE0A 1IBMQ 1YBYA 3S2HH 3STBD 2H5XA 2JA7H 1FL0A 4LF9L 4LF6Q 4LFBQ 2K14A 3M7NA 4A93H 2Z0SA 1QVFA 1NE3A 2BA0A 3I2ZA 4O0AA 1L1OA 2GVAA 3KYHC 1XPOA 1XPUA 4R4QA 4QY7A 2PI2A 1WFQA 2B29A 3ULJA 4C2MH 4JI2Q 1GKHA 2VQFL 1UE5A 5M3FG 4HJ7A 1FJGQ 4DV7L 1TWGH 1E7ZA 1EUJA 4HJ9A 4P75A 1MJCA 3PIOA 1XNQQ 4DV6L 1X54A 4IOCA 1XMQQ 1IBLQ 3L2PA 5IYCG 3CP0A 4OXPA 1K3RA 3HKZE 5IP9G 1PH6A 4LF5Q 2B63H 3HFZB 2R7ZH 1VQ6A 1SRUA 1IXRA 1TWFH 3PO3H 3CC2A 4NXML 2NZHA 4A3FH 4DUYL 3TQYA 2F4VQ 4YHHQ 3I7FA 1SROA 3NELA 3AYHB 4JI7Q 3HOZH 4A3CG 2OTJA 2OTLA 3GDEA 2HHHQ 1V1QA 4IFDG 3CPWA 2VS1A 2C35B 2JJQA 4DK6C 1IBKL 4IPHA 2UXCQ 1UE6A 2K5NA 1XMOL 4BY7G 1YHAA 2MNAA 4BBRG 4LF6L 1OXVA 2I5MX 4GN4B 4JYAL 4TQUS 2E2IH 2Q2TA 1NMFA 4DV1L 3T1HQ 3TS2A 1G6PA 2QGQA 2R6GA 1N8RC 3W1BA 4LW1A 1VQ7A 1FJGL 1Z9FA 3H3VH 1AH9A 4LF8Q 2AHOB 1CUKA 5HGQA 1A62A 4MNOA 3RLNA 2VNUD 2CCZA 1PH8A 4LF7L 1HR0Q 2A19A 3K80C 1KAWA 1Y14B 2PI2E 2UUBQ 1IBLL 3KF6A 1X6OA 3PUYA 5GAHC 4A75A 3U58A 1K8GA 2VUMH 1T9HA 4B3MQ 2JA6H 4DR7Q 2KBNA 2NN6I 3GTMH 4GLVB 1J6QA 4HIKA 1VQ9A 4IFDI 2ZM6L 1NTGA 4GN5A 5IWAQ 4NXNQ 2ASBA 4AIMA 4P71A 4K0KL 1PVOA 4OONA 5C0XI 1ASZA 3M3YH 3H3VI 1VQDA 1VQIA 1W2BA 1NY4A 4IJHA 1Q82C 2YU9H 2HQLA 3MXNB 4A76A 4JI1L 1C9OA 2WAQE 4DR1L 4QL5A 4PZ6A 3CD6A 4JYAQ 3J81c 2CQOA 2VQFQ 1P8LA 1GM5A 4JI2L 4Y52H 4IFDJ 3I4MG 3L7ZC 2CWPA 1Q86C 5IYCH 3S15H 3M9BA 4HJ5A 2IY5B 3PV0A 3M4PA 2ZJQA 3HOWG 3D0FA 1XTDA 3I4OA 5FJ8G 1B8AA 3K81C 1PH7A 3GTKH 3PF4A 1X55A 4A3GH 3A0JA 1A0IA 3BZKA 4JI0L 4DR6L 3OYYA 1PH3A 4Y7NH 2R7DA 5LMUQ 1M1KC 3PUWA 1VCIA 2NN6G 1KQSA 1CSPA 3J81j 5IP7G 1VQ5A 1VQJA 4DR4L 1A63A 5J3BA 3RLFA 2Z6KA 3HKSA 1C7YA 2N49A 5IYBH 5C0XG 1OXUA 1JJCB 4A3KG 2VY3A 5GROA 4A3BH 4DR2Q 2K50A 2OQ0A 1O7IA 2YTYA 3GTGH 4DR3L 1Y1VG 4LUZA 1P16A 1Q46A 1TXYA 1XMOQ 2ZTCA 3T1YQ 2YTVA 4KHZA 1TWCH 5C0XJ 3S14H 1TWHH 2KHIA 1KXLA 4A3MH 4BY1H 1RL2A 3MEFA 2RHSB 3WWVA 1VQOA 2JA6G 3NENA 2YYZA 4LFCL 1EIYB 3PUZA 4JCVE 1EQQA 1OXXK 2CFMA 3I56A 2VQEQ 1YJNA 4A3DG 1EOVA 3S2DH 1HR0L 2EQSA 4OX9L 4A3DH 1N9WA 3G71A 1YJ9A 4JI3Q 4A3CH 2F3IA 2QEXA 2R7FA 4JI0Q 2R92H 3CCUA 2WB1G 5LMUL 4JOIC 2WAQG 2HT1A 4AYBE 4DNIA 2JA8G 2NVTH 4JI4Q 1PH1A 2GN5A 1VQEA 3KLWA 1I50H 4B3RL 4BY7H 4A3JH 3HOWH 3D31A 5C3EH 4X62L 1E3PA 4DR3Q 3F2BA 4DR1Q 2Z6KC 1MJEA 2D0OA 4GLAC 4X65Q 1IYJB 4DR5L 2WB1E 3E9HA 4A3FG 4B3SL 4GKJQ 2GVBA 1X3EA 3PCOB 3W5OA 3TRZA 1WYDA 1YJWA 5JEAG 1VQHA 1X56A 1S3OA 2K5VA 4UP8A 4NPSA 1PFSA 3PSIA 3J80c 2D0PA 2OWOA 2HIXA 2BA1A 4TVAB 1S40A 3S17H 2NVXH 2AWNA 4DR6Q 3KFUA 5GQOA 2IX1A 1XNQL 1YZ6A 4LF4L 1LM0A 2Q2IA 3OTOL 1OXTA 2UU9L 3KDFB 3HOZG 2Y0SG 3S16H 1VQLA 1H95A 2RHQB 1YHQA 2PNHA 3UE1A 2JA9A 1D7QA 3CC7A 4PZ7A 4DV0L 4UP9A 2YV5A 4L5QA 2CKZB 2L15A 2KENA 2UUAQ 2N3SA 5C4XH 2HHHL 1MKHA 3GTOH 1E1TA 4DV3L 3VDYA 1RIPA 4X62Q 1IBKQ 3F2CA 2LSSA 3RNUA 4A3BG 4P73A 5M3FH 4MZ9A 3RN5A 1IL2A 2LXKA 3CCMA 4NB3A 2V1CC 3RLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWI A;  3T1H L;  1UE1 A;  2VQE L;  4BXX G;  1K73 C;  5IT9 c;  1BBU A;  4KHP L;  4OO1 I;  4GNX B;  4A3J G;  4HIO A;  4A3E H;  5GAD C;  3L0O A;  4JBM A;  3M4Q A;  3KF8 B;  5EAY A;  5LMN Q;  3G6E A;  1EIF A;  2E5L Q;  3U50 C;  5AJ3 L;  1UEB A;  2K5H A;  4X64 L;  1N34 L;  1L1O B;  1N32 Q;  2CWA A;  1I94 Q;  1LTL A;  4JI5 Q;  1VQP A;  3S1Q H;  4DV5 Q;  4EX5 A;  1SE8 A;  4B3M L;  2R92 G;  1HNZ Q;  1VQN A;  4B3T Q;  5FLM H;  3W1G A;  3TEH B;  1EQR A;  3I55 A;  2UUA L;  1G51 A;  1YHB A;  1D8L A;  1OXS C;  3CCQ A;  4AQY Q;  4A3E G;  2UXB Q;  1PV4 A;  2RCN A;  2UXD Q;  1PH5 A;  4B3S Q;  1GD7 A;  5ELN A;  3PO2 G;  1AE2 A;  5M3M G;  4QGU A;  1VS0 A;  3F1Z A;  3CCV A;  3FP9 A;  4P74 A;  1KIX A;  1PYS B;  3PO2 H;  1VQA A;  2VZA A;  1E22 A;  4YY3 Q;  1DGS A;  3HOX G;  1WOC A;  3G4S A;  3CF5 A;  2ALY B;  3NEM A;  4PG3 A;  1PH9 A;  2UU9 Q;  1CKN B;  1CKN A;  3ERS X;  2KCT A;  5IYB G;  2OQK A;  3CAM A;  4A3K H;  1KHI A;  2UUC Q;  1W3S A;  1WJJ A;  2N8N A;  5IE8 A;  1N32 L;  4DUZ Q;  4HIM A;  2B63 G;  3PO3 G;  4JI5 L;  5M5X H;  1I94 L;  4DR4 Q;  4LF5 L;  2JE6 I;  1QZG A;  5GAG C;  2PQA B;  3EIV A;  1JMC A;  1SR3 A;  3PGZ A;  4B3T L;  4X66 L;  1KD1 C;  4JBK A;  5JEA J;  2WP8 J;  4WJ4 A;  1LUZ A;  4BA1 I;  4GNX A;  4PMW A;  1CKM A;  1I6H H;  2UXB L;  1HZ9 A;  1A8V A;  1YVC A;  1SMX A;  4LNQ A;  2FXQ A;  3ICE A;  4A93 G;  2UXC L;  1Z47 A;  5C4J H;  1X3G A;  1X3F A;  4JI6 Q;  3CC4 A;  5M3M H;  4YCU A;  4YWK A;  5BR8 Q;  3PIP A;  5H1S E;  1JJ2 A;  1VQK A;  4OX9 Q;  4X64 Q;  2OCE A;  3J81 i;  4JI3 L;  2B3G A;  3HOX H;  4HJ8 A;  1PYB A;  1PH4 A;  1N34 Q;  1NBW A;  4LF7 Q;  1I5F A;  4GNX C;  1PA6 A;  5JJI A;  3I4M H;  1NJI C;  5IP7 H;  1HNZ L;  3JAM i;  4DUZ L;  1GO3 E;  4DAY B;  1YIJ A;  4JI4 L;  2F4V L;  3AFP A;  4IPG A;  1YEZ A;  4DR7 L;  4JG2 A;  2NVQ H;  3HOY G;  4XIG S;  3HOU G;  5JJL A;  1JJG A;  4J15 A;  4X66 Q;  1AE3 A;  1HJP A;  2UXD L;  2ZJP A;  3U4Z A;  4K0K Q;  1I3Q H;  4DK3 C;  1V9P A;  2I0Q A;  5K36 G;  1FGU A;  4YCW A;  5HY6 A;  3A5Z B;  4X65 L;  1BKB A;  2JQO A;  3JAM c;  3J7Z C;  1VQC A;  3KJP A;  2IX0 A;  4AYB G;  4A4I A;  4DV1 Q;  1UWV A;  4IJL A;  5LMN W;  4LUO A;  1VQF A;  4L5R C;  2R7Z G;  3ULP A;  2XTI A;  1JE5 A;  3STB C;  3TRE A;  5C44 H;  1TWA H;  2IHE A;  3KDF A;  1U0L A;  4PZ8 A;  3S1N H;  2E2J H;  2K4K A;  4P72 A;  1K0R A;  3PUX A;  3ER0 A;  3OTO Q;  2IHF A;  3CQZ H;  5ELO A;  4BA2 I;  3K7A H;  3ZJY C;  1PH2 A;  2YTX A;  1WCM H;  4BXX H;  1J5E Q;  4GN3 B;  4ME3 A;  3CXC A;  1B70 B;  5IP9 H;  5IY0 A;  3S1M H;  3CMA A;  4RMF A;  1M90 C;  3F8T A;  3CPF A;  2LXJ A;  1Q1B A;  3CCR A;  3KOJ A;  4A3L G;  2RF4 A;  1HR0 W;  2Q2H A;  1QZH A;  2I5L X;  2KHJ A;  3TS0 A;  4A3G G;  2ZTE A;  2K52 A;  3A74 A;  4DV3 Q;  3K8A A;  4MTN A;  4YWM A;  4DR2 L;  1L1O C;  3G48 A;  4JI1 Q;  4DKA C;  1KRS A;  1E1O A;  4UY8 C;  2JEB I;  4DPG A;  4JI6 L;  4POG A;  4LWC A;  1HZB A;  2ZTD A;  3EBE A;  4R4I A;  1K9M C;  4BY1 G;  3DLL A;  1VQ4 A;  4A3L H;  4OO1 G;  3GTQ H;  1VQM A;  1Q81 C;  4QJF A;  1HH2 P;  2XGT A;  1SFO H;  1JB7 A;  2JA7 G;  4KHP Q;  3SGI A;  5FLX c;  1Y1V H;  2EXD A;  1X65 A;  2WFW A;  2VW9 A;  4DV7 Q;  3GTL H;  3E9I A;  3ULL A;  2MFI A;  1N33 Q;  4C3H H;  2E5L L;  4IO9 A;  3UDG A;  5AJ3 Q;  2JA5 H;  1Q8K A;  1Q1E A;  1QUQ B;  3HOV H;  2R93 H;  2JK8 A;  2AKW B;  3OW2 A;  1IZ6 A;  1CSQ A;  3AFQ A;  3DM3 A;  4DV4 L;  1J5E L;  4L5S A;  2AMC B;  4OWW B;  2VUM G;  1WCM G;  1QVG A;  4A3M G;  4DUY Q;  4BBR H;  4JI7 L;  1QUQ A;  3UDI A;  1YIT A;  2A1A A;  3GTP H;  4AQY L;  4QIW E;  2N78 A;  4XTC S;  3T1Y L;  2PMZ E;  1X9N A;  3PUV A;  1EYG A;  4JI8 Q;  2EIF A;  1L2F A;  5C44 G;  1G29 1;  1U5K A;  1K83 H;  4HJA A;  3FHW A;  1VQB A;  5FLM G;  4DR5 Q;  4LFC Q;  4GKJ L;  4YCV A;  1HNX L;  3GTJ H;  2F52 A;  3GO5 A;  2ZJR A;  4FDB A;  3Q8D A;  5C3E G;  4AH6 A;  3I4N G;  4RG1 A;  3U4V A;  4LF8 L;  3FKI H;  4QQB X;  1GVP A;  4GLX A;  3NBH B;  1N36 Q;  1N33 L;  4DV2 L;  5FJ8 H;  1HNW Q;  4ALP A;  1K8A C;  2UUC L;  4R4T A;  4EQ5 A;  2Q2U A;  4LF4 Q;  1PHJ A;  2BH8 A;  1L0W A;  5DLQ E;  3A5U A;  5M5Y H;  3RN2 A;  4GKK Q;  4DV4 Q;  2KCM A;  3CCE A;  4BBS G;  3KF6 B;  3UDX A;  5E7N A;  4DV0 Q;  3RZD H;  4NXN L;  2ZM6 Q;  1CKO A;  1XNR Q;  4O2D A;  3K0X A;  4OWX B;  3H0G G;  2E8G A;  1KL9 A;  2HIV A;  4GOP C;  1UE7 A;  4UPA A;  3CCS A;  3H15 A;  3UDF A;  2JEA I;  1KC8 C;  1IBM L;  3RZO H;  2MQH A;  2ID0 A;  4JOI A;  4JC0 A;  2BH2 A;  3AQQ A;  4R1J A;  5IYD H;  3HKZ G;  4R4O A;  3EN2 A;  4BBS H;  2JA8 H;  2R93 G;  5BR8 L;  1XPR A;  2MO0 A;  4POF A;  4HID A;  1Q7Y C;  3M4O H;  4C3I H;  5C4X G;  2NVY H;  3FKI G;  3J80 i;  3CW2 C;  1HZC A;  1BBW A;  3HOY H;  1KRT A;  5LMN L;  1MIU A;  4WJ3 M;  4R4C A;  1HZA A;  4UP7 A;  5IYD G;  4JV5 L;  4GKK L;  4H02 A;  4DV5 L;  1LYL A;  1FVI A;  3KJO A;  4NXM Q;  3CME A;  1Q12 A;  4IPD A;  4LFA L;  4YHH L;  1YNX A;  4A3I H;  3AEV A;  4JI8 L;  1V43 A;  3BZC A;  1WI5 A;  3H0G H;  4A3I G;  3PF5 A;  4OWT B;  4X6A H;  5M5W H;  1B7Y B;  1VQG A;  2AWO A;  2Y0S E;  4YWL A;  3M85 A;  4LF9 Q;  2DUD A;  3RR5 A;  3J7A 5;  4LFB L;  3E0E A;  1HNX Q;  1JT8 A;  1VQ8 A;  3LGJ A;  3S24 A;  1NMG A;  1Y1W G;  4IOA A;  2IT1 A;  3BJU A;  3CCL A;  1QVC A;  3IRB A;  4LUV A;  1YI2 A;  1C0A A;  1N36 L;  2ATW A;  3HOV G;  5GAE C;  4L5T A;  4DV2 Q;  4DAM A;  1HNW L;  2NZO A;  4YY3 L;  3K7U C;  4JBW A;  2D62 A;  1SLJ A;  4KI0 A;  4IPC A;  4DV6 Q;  2MO1 A;  1XMQ L;  1S72 A;  4APV A;  3I4N H;  3BU2 A;  4JBJ A;  4C3J H;  1R9T H;  1SN8 A;  1E24 A;  2QA4 A;  4GOP A;  2DGY A;  1ASY A;  3HOU H;  2K75 A;  3GD7 A;  3CCJ A;  2I5H A;  2UUB L;  2E2H H;  2PQA A;  1Y1W H;  2VL6 A;  1XJV A;  2JA5 G;  1XNR L;  1OTC A;  4GOP B;  2A8V A;  4JV5 Q;  3F2D A;  3JC6 6;  3S1R H;  2ES2 A;  4B3R Q;  1EFW A;  4KLK A;  5JJK A;  3B6Y A;  4LFA Q;  5IWA L;  1BVS A;  4GS3 A;  3UE0 A;  1IBM Q;  1YBY A;  3S2H H;  3STB D;  2H5X A;  2JA7 H;  1FL0 A;  4LF9 L;  4LF6 Q;  4LFB Q;  2K14 A;  3M7N A;  4A93 H;  2Z0S A;  1QVF A;  1NE3 A;  2BA0 A;  3I2Z A;  4O0A A;  1L1O A;  2GVA A;  3KYH C;  1XPO A;  1XPU A;  4R4Q A;  4QY7 A;  2PI2 A;  1WFQ A;  2B29 A;  3ULJ A;  4C2M H;  4JI2 Q;  1GKH A;  2VQF L;  1UE5 A;  5M3F G;  4HJ7 A;  1FJG Q;  4DV7 L;  1TWG H;  1E7Z A;  1EUJ A;  4HJ9 A;  4P75 A;  1MJC A;  3PIO A;  1XNQ Q;  4DV6 L;  1X54 A;  4IOC A;  1XMQ Q;  1IBL Q;  3L2P A;  5IYC G;  3CP0 A;  4OXP A;  1K3R A;  3HKZ E;  5IP9 G;  1PH6 A;  4LF5 Q;  2B63 H;  3HFZ B;  2R7Z H;  1VQ6 A;  1SRU A;  1IXR A;  1TWF H;  3PO3 H;  3CC2 A;  4NXM L;  2NZH A;  4A3F H;  4DUY L;  3TQY A;  2F4V Q;  4YHH Q;  3I7F A;  1SRO A;  3NEL A;  3AYH B;  4JI7 Q;  3HOZ H;  4A3C G;  2OTJ A;  2OTL A;  3GDE A;  2HHH Q;  1V1Q A;  4IFD G;  3CPW A;  2VS1 A;  2C35 B;  2JJQ A;  4DK6 C;  1IBK L;  4IPH A;  2UXC Q;  1UE6 A;  2K5N A;  1XMO L;  4BY7 G;  1YHA A;  2MNA A;  4BBR G;  4LF6 L;  1OXV A;  2I5M X;  4GN4 B;  4JYA L;  4TQU S;  2E2I H;  2Q2T A;  1NMF A;  4DV1 L;  3T1H Q;  3TS2 A;  1G6P A;  2QGQ A;  2R6G A;  1N8R C;  3W1B A;  4LW1 A;  1VQ7 A;  1FJG L;  1Z9F A;  3H3V H;  1AH9 A;  4LF8 Q;  2AHO B;  1CUK A;  5HGQ A;  1A62 A;  4MNO A;  3RLN A;  2VNU D;  2CCZ A;  1PH8 A;  4LF7 L;  1HR0 Q;  2A19 A;  3K80 C;  1KAW A;  1Y14 B;  2PI2 E;  2UUB Q;  1IBL L;  3KF6 A;  1X6O A;  3PUY A;  5GAH C;  4A75 A;  3U58 A;  1K8G A;  2VUM H;  1T9H A;  4B3M Q;  2JA6 H;  4DR7 Q;  2KBN A;  2NN6 I;  3GTM H;  4GLV B;  1J6Q A;  4HIK A;  1VQ9 A;  4IFD I;  2ZM6 L;  1NTG A;  4GN5 A;  5IWA Q;  4NXN Q;  2ASB A;  4AIM A;  4P71 A;  4K0K L;  1PVO A;  4OON A;  5C0X I;  1ASZ A;  3M3Y H;  3H3V I;  1VQD A;  1VQI A;  1W2B A;  1NY4 A;  4IJH A;  1Q82 C;  2YU9 H;  2HQL A;  3MXN B;  4A76 A;  4JI1 L;  1C9O A;  2WAQ E;  4DR1 L;  4QL5 A;  4PZ6 A;  3CD6 A;  4JYA Q;  3J81 c;  2CQO A;  2VQF Q;  1P8L A;  1GM5 A;  4JI2 L;  4Y52 H;  4IFD J;  3I4M G;  3L7Z C;  2CWP A;  1Q86 C;  5IYC H;  3S15 H;  3M9B A;  4HJ5 A;  2IY5 B;  3PV0 A;  3M4P A;  2ZJQ A;  3HOW G;  3D0F A;  1XTD A;  3I4O A;  5FJ8 G;  1B8A A;  3K81 C;  1PH7 A;  3GTK H;  3PF4 A;  1X55 A;  4A3G H;  3A0J A;  1A0I A;  3BZK A;  4JI0 L;  4DR6 L;  3OYY A;  1PH3 A;  4Y7N H;  2R7D A;  5LMU Q;  1M1K C;  3PUW A;  1VCI A;  2NN6 G;  1KQS A;  1CSP A;  3J81 j;  5IP7 G;  1VQ5 A;  1VQJ A;  4DR4 L;  1A63 A;  5J3B A;  3RLF A;  2Z6K A;  3HKS A;  1C7Y A;  2N49 A;  5IYB H;  5C0X G;  1OXU A;  1JJC B;  4A3K G;  2VY3 A;  5GRO A;  4A3B H;  4DR2 Q;  2K50 A;  2OQ0 A;  1O7I A;  2YTY A;  3GTG H;  4DR3 L;  1Y1V G;  4LUZ A;  1P16 A;  1Q46 A;  1TXY A;  1XMO Q;  2ZTC A;  3T1Y Q;  2YTV A;  4KHZ A;  1TWC H;  5C0X J;  3S14 H;  1TWH H;  2KHI A;  1KXL A;  4A3M H;  4BY1 H;  1RL2 A;  3MEF A;  2RHS B;  3WWV A;  1VQO A;  2JA6 G;  3NEN A;  2YYZ A;  4LFC L;  1EIY B;  3PUZ A;  4JCV E;  1EQQ A;  1OXX K;  2CFM A;  3I56 A;  2VQE Q;  1YJN A;  4A3D G;  1EOV A;  3S2D H;  1HR0 L;  2EQS A;  4OX9 L;  4A3D H;  1N9W A;  3G71 A;  1YJ9 A;  4JI3 Q;  4A3C H;  2F3I A;  2QEX A;  2R7F A;  4JI0 Q;  2R92 H;  3CCU A;  2WB1 G;  5LMU L;  4JOI C;  2WAQ G;  2HT1 A;  4AYB E;  4DNI A;  2JA8 G;  2NVT H;  4JI4 Q;  1PH1 A;  2GN5 A;  1VQE A;  3KLW A;  1I50 H;  4B3R L;  4BY7 H;  4A3J H;  3HOW H;  3D31 A;  5C3E H;  4X62 L;  1E3P A;  4DR3 Q;  3F2B A;  4DR1 Q;  2Z6K C;  1MJE A;  2D0O A;  4GLA C;  4X65 Q;  1IYJ B;  4DR5 L;  2WB1 E;  3E9H A;  4A3F G;  4B3S L;  4GKJ Q;  2GVB A;  1X3E A;  3PCO B;  3W5O A;  3TRZ A;  1WYD A;  1YJW A;  5JEA G;  1VQH A;  1X56 A;  1S3O A;  2K5V A;  4UP8 A;  4NPS A;  1PFS A;  3PSI A;  3J80 c;  2D0P A;  2OWO A;  2HIX A;  2BA1 A;  4TVA B;  1S40 A;  3S17 H;  2NVX H;  2AWN A;  4DR6 Q;  3KFU A;  5GQO A;  2IX1 A;  1XNQ L;  1YZ6 A;  4LF4 L;  1LM0 A;  2Q2I A;  3OTO L;  1OXT A;  2UU9 L;  3KDF B;  3HOZ G;  2Y0S G;  3S16 H;  1VQL A;  1H95 A;  2RHQ B;  1YHQ A;  2PNH A;  3UE1 A;  2JA9 A;  1D7Q A;  3CC7 A;  4PZ7 A;  4DV0 L;  4UP9 A;  2YV5 A;  4L5Q A;  2CKZ B;  2L15 A;  2KEN A;  2UUA Q;  2N3S A;  5C4X H;  2HHH L;  1MKH A;  3GTO H;  1E1T A;  4DV3 L;  3VDY A;  1RIP A;  4X62 Q;  1IBK Q;  3F2C A;  2LSS A;  3RNU A;  4A3B G;  4P73 A;  5M3F H;  4MZ9 A;  3RN5 A;  1IL2 A;  2LXK A;  3CCM A;  4NB3 A;  2V1C C;  3RLO A; 
#chains in the Genus database with same CATH topology
 3T1H L;  5I6Y A;  4A3K B;  5ISR A;  1WTX A;  2CHB D;  4KHP L;  1TVX A;  2QF7 A;  5IOD A;  4OO1 I;  4QUF A;  3L0O A;  4C3I G;  4JBM A;  3O13 A;  3KF8 B;  3G6E A;  1EIF A;  2E5L Q;  1A3V A;  2K5H A;  1EIG A;  1N34 L;  1LTL A;  4S3S A;  4EX5 A;  4B3M L;  2R92 G;  4F8M A;  3TEH B;  1PTO H;  4AQY Q;  3I72 A;  2RCN A;  2UXD Q;  1D1K A;  4B3S Q;  3NP8 A;  2Z4H A;  1PMR A;  5CV4 A;  3QO2 A;  4QGU A;  3F1Z A;  2Q8I B;  3CCV A;  3FP9 A;  1PFB A;  2L4N A;  4O42 A;  5ELE A;  3CF5 A;  2Z9H A;  1GUT A;  3K58 A;  2M00 A;  3ERS X;  1SMY D;  1F9Q A;  2KCT A;  2OQK A;  1JCK B;  5EKK A;  5IE8 A;  4HIM A;  2B63 G;  3PO3 G;  4DR4 Q;  2JE6 I;  3I73 A;  5GAG C;  1EOT A;  3EIV A;  4H0L C;  4HCS A;  2L0C A;  3KF8 A;  1KD1 C;  5T1I A;  4OL7 A;  1FYC A;  5ELC A;  4WJ4 A;  2B2V A;  2N88 A;  2MHV A;  1CKM A;  1B2T A;  1A8V A;  4EGV A;  1O80 A;  1SMX A;  4LNQ A;  1X3G A;  2F4I A;  3HKZ B;  5EPJ A;  4K6L A;  1Z6H A;  3A8K E;  2ZXO A;  1Q90 A;  1XYI A;  1I4Q A;  2KCN A;  4OX9 Q;  5CBA E;  3RZD B;  3NBI A;  1PH4 A;  3M4Y A;  4ZK9 B;  1G8Z D;  5IGE A;  4JI4 L;  4IPG A;  2EJF C;  2RBM A;  4JG2 A;  2NVQ H;  5JJL A;  2A5H A;  3DWP A;  3HOU G;  1JJG A;  1HJP A;  1EYA A;  2F0W A;  2A73 B;  3IL8 A;  1EQT A;  1FGU A;  5HY6 A;  3Q23 A;  5I4D A;  4DNT B;  4LUO A;  1TU2 B;  1K3B C;  1W6J A;  3STB C;  3NE5 B;  2KOL A;  1TWA H;  4M8A A;  1H9M A;  1ZEQ X;  4PZ8 A;  4P72 A;  3PUX A;  5C5L A;  4KN7 C;  2IHF A;  3CQZ H;  3K7A H;  4BXX H;  1FNV A;  1B70 B;  5HGT A;  3SK4 A;  1M90 C;  3CPF A;  4NDX A;  3S14 B;  3KOJ A;  3A74 A;  2NBF A;  3KBG A;  1YNJ C;  4KJO A;  4DKA C;  4UY8 C;  1KAB A;  2B2U C;  2K03 A;  4CDD C;  2F0N A;  1SE2 A;  3GTQ H;  1VQM A;  1Q81 C;  4R8N A;  3K5L A;  3TBI B;  4KHP Q;  1PRT B;  1Y1V H;  2D2C C;  2WFW A;  4DV7 Q;  1PRT F;  1N33 Q;  1GUO A;  2FMC A;  5C3E B;  2E5L L;  1Q8K A;  3CU7 A;  3DM3 A;  4NMZ A;  3DEP A;  1WCM G;  4BBR H;  2SNM A;  2HCI A;  1QUQ A;  5CMD A;  2FIN B;  1MGS A;  4AQY L;  3MXG A;  3R93 A;  2PMZ E;  1X9N A;  1EYG A;  4DAP A;  1G29 1;  1K83 H;  3D6W A;  3U9S A;  4LFC Q;  5DM6 3;  3GTJ H;  3DMU A;  5KGU A;  3EJI A;  2ZJR A;  5C3E G;  1GUW A;  2EY2 A;  3I3C A;  4RG1 A;  4BWG B;  3R2T A;  1HNW Q;  1G2T A;  1GUN A;  1PHJ A;  2BH8 A;  3NWS A;  3NK9 A;  5M5Y H;  3RN2 A;  4OGQ C;  4BBS G;  3KF6 B;  5E7N A;  3RZD H;  2ZM6 Q;  2LS0 1;  4B9W A;  4OWX B;  2EZV A;  2HIV A;  4GOP C;  1UE7 A;  4UPA A;  2XVS A;  3H15 A;  3UDF A;  4A3F B;  2JEA I;  1KC8 C;  1LTA D;  2MQH A;  2ID0 A;  4JOI A;  1MD2 D;  4R1J A;  3OSO A;  3P7J A;  3HKZ G;  4BBS H;  2JA8 H;  2R93 G;  3VYR A;  4HID A;  4C3I H;  1F2Y A;  5FK9 C;  3CW2 C;  2LFN A;  5LMN L;  1HQM C;  4KY7 A;  1SSO A;  4UP7 A;  2JA7 B;  4H02 A;  4DV5 L;  3V2T A;  1LYL A;  3HGB A;  1G2S A;  3S2H B;  4NXM Q;  5DAU A;  2D5D A;  1M8A A;  1VMP A;  1WI5 A;  4N8F A;  1LT3 D;  2NZ1 D;  4OWT B;  3PF5 A;  1B7Y B;  3J7A 5;  2AWO A;  4LF9 Q;  3MWY W;  3E0E A;  4DGZ A;  4N8X 1;  1VQ8 A;  3LGJ A;  3S24 A;  1NMG A;  2BOS A;  5A2Q L;  3K5M A;  4LUV A;  1C0A A;  1N36 L;  2ATW A;  1ZXT A;  3VA7 A;  2JSO A;  2NZO A;  3ERO A;  1LTT D;  1PRT D;  3OIQ A;  3TP5 A;  4DXG A;  1H9S B;  4DV6 Q;  1U4R A;  4JBJ A;  1BOS A;  2FHT A;  4GOP A;  2EYM A;  1BCP C;  1BBX C;  2JA5 G;  1CHQ D;  3JC6 6;  5JJK A;  3EVQ A;  3WDN A;  3B6Y A;  1BVS A;  4J8Q A;  2F0P A;  3STB D;  1F2L A;  2F0Q A;  4LF6 Q;  3W2D A;  5EQ0 A;  1E2V A;  4QY7 A;  5KYI A;  2VQF L;  4C2M H;  2AUK A;  1GKH A;  1FJG Q;  1UE5 A;  4DV7 L;  4EQP A;  2XNA C;  4P75 A;  3PIO A;  2XWJ B;  3D4D A;  5IYC G;  4QF4 A;  4OXP A;  4G57 A;  3GV6 A;  3CC2 A;  2NZH A;  4A3F H;  1WTO A;  1LT6 D;  4YHH Q;  1SE3 A;  2HHH Q;  4IFD G;  1CQV A;  4XYQ A;  1VDZ A;  1IBK L;  1EYC A;  2F0D A;  4BY7 G;  4BS9 A;  1YHA A;  4BBR G;  4X3S A;  4GN4 B;  4TQU S;  4CKC A;  1NMF A;  2R6G A;  4KK7 A;  1UUP A;  3NHH A;  2B2Y C;  1VQ7 A;  2G5D A;  2AHO B;  2VNU D;  4NW2 A;  2CCZ A;  1PTO F;  4ULL A;  4FF3 A;  1Y14 B;  5EPK A;  1IBL L;  3MXU A;  4RCO A;  1T9H A;  1MBY A;  3P20 A;  3FPU B;  4ZAI A;  4GLV B;  3HS0 C;  4RHR A;  4IFD I;  2ZM6 L;  1NTG A;  4AIM A;  1II3 A;  4C3H G;  2F0J A;  1VQD A;  1EEI D;  1VQI A;  1W2B A;  5JPN C;  1K8M A;  4A76 A;  1GHJ A;  1KLU D;  4G7Z C;  4PZ6 A;  3CD6 A;  4JYA Q;  1GM5 A;  1P8L A;  2PPB C;  2CWP A;  1SMY C;  4C3H B;  2IY5 B;  3DWA A;  2J4X A;  3M4P A;  3D4R A;  3HOW G;  1MSG A;  3IFT A;  3D0F A;  3I4O A;  5FJ8 G;  1PH7 A;  5T1G A;  3A0J A;  1A0I A;  2CVR A;  5C3W A;  4DR6 L;  3OYY A;  4X3U A;  3PUW A;  5I9P A;  3J81 j;  5L37 A;  1VQ5 A;  1CK1 A;  3RLF A;  3PIP 3;  5C0X G;  1JJC B;  1FNW A;  2VY3 A;  2RKS A;  5D14 A;  3C46 A;  1QCB D;  1Y8O B;  2K50 A;  3JAM L;  5IGG A;  4LUZ A;  2IL8 A;  1TXY A;  3T1Y Q;  3S14 H;  5JAV A;  2QCP X;  4DAV A;  4BY7 B;  2KHI A;  1BO0 A;  2EXZ A;  3LNN A;  2PCF B;  1EY5 A;  3TP6 A;  1GXD C;  4PNY A;  3MEF A;  3K7A B;  3NEN A;  3CQZ B;  1YJN A;  4C56 C;  5KYL A;  4FXG C;  1EZ6 A;  1TWA B;  2CH4 W;  4A3C H;  1RJT A;  3S2D B;  4RKL A;  1KAA A;  1HA5 A;  2R92 H;  1B50 A;  2WB1 G;  4XQQ A;  1Z7T A;  4IUU A;  4XQJ A;  4K5W A;  1DOM A;  4K14 A;  4IUP A;  2R93 B;  3D31 A;  4DR3 Q;  4L6T B;  4Z9C B;  3C2P A;  4A3F G;  4DR5 L;  1HXY D;  2WB1 E;  3E9H A;  2E2I B;  2GVB A;  1CZW A;  1YJW A;  5JEA G;  1X56 A;  1YNJ D;  3G6J B;  1PFS A;  1TS2 A;  3PSI A;  4OHJ A;  2D0P A;  1M4V A;  3P75 A;  3S17 H;  3VR5 A;  2NVX H;  1STB A;  3KFU A;  5K5P A;  1PDQ A;  3GTK B;  2UU9 L;  2KEC A;  3J7A F;  2VXW A;  5JVH 3;  2CKZ B;  1S5F D;  3VYS A;  1I6H B;  1V1O A;  4XDX A;  2HHH L;  5KRU A;  2OT2 A;  2PO4 A;  1B53 A;  3M3Y B;  1IBK Q;  3F2C A;  3RNU A;  4FF1 A;  5CC4 A;  5EJW A;  5M3F H;  2V1C C;  1STA A;  3ONA B;  3SDZ A;  2I46 A;  4LK1 C;  1H9J A;  3BS1 A;  4GNX B;  4A3J G;  4DU9 A;  4HIO A;  4KKU A;  4A3E H;  1AN8 A;  3BYT B;  4X64 L;  2OEO A;  4H7B A;  2E2H B;  3X3N A;  1ZKO A;  1GUS A;  3IFD A;  1VQN A;  5FLM H;  1EQR A;  3I55 A;  2UUA L;  4RKB A;  1D8L A;  3KUP A;  4IUT A;  1A6X A;  4A3E G;  4UHV A;  4ZQ3 A;  3KK7 A;  1EYD A;  3U9O A;  1GJX A;  1PZI D;  1AE2 A;  2F0I A;  1T5E A;  3FMC A;  2F1M A;  3HRZ C;  5C4J B;  1E22 A;  4YY3 Q;  2NN6 H;  4A3I B;  2ALY B;  4KD4 A;  1PH9 A;  4DK1 A;  1QOH A;  4K8I A;  4FVM A;  1NCV A;  4A3K H;  3CAM A;  2UUC Q;  1KHI A;  2Q8R E;  4HR7 B;  2F0K A;  1I94 L;  5M5X H;  4LF5 L;  4KY6 A;  5IGF A;  2B8F A;  2WKD A;  5EBD A;  3J80 L;  1JMC A;  4A93 B;  4B3T L;  1D5Z C;  4JBK A;  5JEA J;  1WTV A;  5C6A A;  2K5Q A;  5C4X B;  1F2M A;  1SJE D;  4WOR A;  2UXB L;  3IAY A;  1HZ9 A;  1H9R A;  1YVC A;  3N6R A;  2FXQ A;  2UXC L;  4A93 G;  2F3W A;  3C3L A;  1X3F A;  2JXM B;  3EFX D;  5M3M H;  1EY0 A;  2PYK A;  5BR8 Q;  3HOU B;  1R9T B;  1EIH A;  5H1S E;  2F0L A;  1JJ2 A;  1DXM A;  1DCZ A;  3HOX H;  2B3G A;  1PYB A;  3J80 E;  4LF7 Q;  5AFW A;  1EWH A;  5JJI A;  1STG A;  1HNZ L;  1YIJ A;  1SYC A;  1C48 A;  1I4X A;  3AFP A;  4XIG S;  3SEB A;  3VR4 A;  2PNR C;  2B2Y A;  4CHT B;  3BYY B;  2ZJP A;  1ESR A;  4K0K Q;  1I3Q H;  4DA2 A;  4A3E B;  2I0Q A;  4YCW A;  1SYF A;  1STH A;  5C0X H;  1PFN A;  1B9N A;  1HFG A;  2BE5 D;  5LMN W;  3VYT A;  2R7Z G;  3ULP A;  1SND A;  1JE5 A;  1U4P A;  2XTI A;  3TRE A;  2E74 C;  2K4K A;  1K0R A;  1LLR D;  1F77 A;  3S9W A;  5ELO A;  5DNF A;  1SNO A;  1PH2 A;  1SYE A;  1WCM H;  2V4D A;  1MI2 A;  3CXC A;  4A3M B;  2A6E D;  3AMU A;  4RMF A;  3F8T A;  2KJX A;  4A3L G;  2RF4 A;  5J1Z A;  3J81 L;  2Q2H A;  1HR0 W;  3QR8 A;  1K0S A;  1V1P B;  2KHJ A;  1ICW A;  1I4P A;  3GTL B;  4MTN A;  3MFY A;  1KRS A;  4HMI A;  4JI6 L;  1HZB A;  1SEB D;  3EBE A;  1BF4 A;  1A3T A;  1VQ4 A;  3HG9 A;  3CHB D;  1HH2 P;  3SGI A;  5FLX c;  1S5E D;  1X65 A;  4CJ1 B;  1T5X D;  2F0O A;  5FO7 B;  3NUC A;  4KN4 C;  3FKI B;  3P1H A;  2MUY A;  1I50 B;  1IZ6 A;  3AFQ A;  1J5E L;  2VUM G;  3H91 A;  3OWE B;  1HUM A;  1DZ1 A;  1O7L A;  3UDI A;  1YIT A;  2A1A A;  2E2J B;  2N78 A;  3SK6 A;  4JI8 Q;  4QCL A;  5C44 G;  4HAE A;  3ITP A;  2KED A;  4GKJ L;  4CJ2 C;  2A6H C;  2DJG C;  1X3Q A;  4IN3 A;  1HNX L;  3QIA A;  3TZD A;  1O7Z A;  1AP0 A;  3Q8D A;  1SXT A;  4AH6 A;  3I4N G;  1O78 A;  3U4V A;  4QQB X;  3FKI H;  4GLX A;  1JB3 A;  3TDQ A;  1WD1 A;  5JVG 3;  3UI2 A;  2F0V A;  1HTL D;  3SK8 A;  2UUC L;  4LF4 Q;  3T16 A;  2XRS D;  2KCM A;  3CCE A;  3UDX A;  4RGN A;  2F3V A;  5IOC A;  1BCP D;  1EY7 A;  1ENA A;  4O2D A;  3K0X A;  1TS3 A;  4WJW A;  4A3G B;  1PTO D;  3VR2 A;  2EDG A;  3DEO A;  5CV7 A;  1IBM L;  2HCC A;  4JC0 A;  1EFI D;  2TMP A;  1LTR D;  2K33 A;  5IYD H;  3BVZ A;  3MFG A;  4CKB A;  5BR8 L;  1WVL A;  2MO0 A;  2KA7 A;  1HZC A;  3HOY H;  1KRT A;  2B2W A;  3ERQ A;  4GKK L;  5FKA C;  4HSP A;  3CME A;  1Q12 A;  4IPD A;  4A3I H;  3OWF A;  1V43 A;  1U4M A;  2A6H D;  3H0G H;  3S1R B;  2K1B A;  4RCN A;  5M5W H;  2CH4 A;  1Y1W B;  2X69 A;  4IOA A;  1Y1W G;  3BJU A;  1D5M C;  1QVC A;  3FEW X;  1KDB A;  3HOV G;  5GAE C;  4L5T A;  4DV2 Q;  4OEL B;  4JBW A;  4IPC A;  1S5D D;  2MO1 A;  1S72 A;  4APV A;  4WRD A;  3BU2 A;  1R9T H;  2F0E A;  1ASY A;  3GD7 A;  3HOZ B;  2I5H A;  2ZXP A;  1XNR L;  4GOP B;  2K28 A;  4JV5 Q;  3S1R H;  1HFN A;  4KKS A;  3E5S A;  3SHL A;  2SDF A;  1YNN C;  1HCZ A;  4GS3 A;  2C5C A;  3UE0 A;  5IGB A;  5C3X A;  2H5X A;  3L3O C;  4LFB Q;  2K14 A;  4A93 H;  1B44 D;  2Z0S A;  2BA0 A;  3I2Z A;  4O0A A;  1XPU A;  3HOY B;  3C1E A;  2PI2 A;  2NVY B;  5M3F G;  4FF2 A;  2AQ1 B;  1E7Z A;  1EUJ A;  4HJ9 A;  3MVV A;  2ICI A;  1NNX A;  1PFM A;  1X54 A;  1IBL Q;  2WAQ B;  3BVG A;  3CP0 A;  1K3R A;  3HKZ E;  5IP9 G;  2QIL A;  1VQ6 A;  1IXR A;  3PO2 B;  2F4V Q;  3I7F A;  3NEL A;  4A3C G;  3AYH B;  4U68 A;  5BN4 A;  4KJN A;  1NAP A;  3I4N B;  3CPW A;  3IKJ A;  2JJQ A;  5C4H A;  2K04 A;  4HN7 A;  1WD0 A;  4IPH A;  1XMO L;  2B8G A;  4JYA L;  1OXV A;  2E2I H;  4DV1 L;  1G6P A;  2QGQ A;  3W1B A;  4LW1 A;  4IUR A;  3H3V H;  2K6A A;  1IYU A;  2A19 A;  1KAW A;  2UUB Q;  3KF6 A;  2A69 D;  3PUY A;  5BN5 A;  2VUM H;  5G3L D;  1WTQ A;  4HIK A;  2ASB A;  4GN5 A;  1DJR D;  1PTO C;  1SBB B;  2R3Z A;  5IWA Q;  3Q24 A;  4P71 A;  2Z6B A;  2EY6 A;  1Q82 C;  2HQL A;  4JI1 L;  2ZXR A;  1D1I A;  4FXK C;  4DR1 L;  2O2L D;  1CT1 D;  4JI2 L;  3I4M G;  3L7Z C;  4HJ5 A;  5BN3 A;  2ZJQ A;  3TN2 A;  1CHP D;  2MPM A;  1TY2 A;  2R7D A;  1KQS A;  1VF7 A;  4IUN A;  3SE0 A;  2EYL A;  2L5T A;  5COY A;  3WOF A;  2K32 A;  2Z6K A;  1PLF A;  2N49 A;  4Y7N B;  4ZUI A;  1OXU A;  5GRO A;  2OQ0 A;  3GTG H;  4DR3 L;  1Y1V G;  5IGD A;  2YTV A;  1TWC H;  5C0X J;  2PZU A;  2QDB A;  1CA5 A;  1TWH H;  1CQF A;  1KXL A;  4RGM A;  1I4R A;  1RL2 A;  2QDL A;  2K5W A;  1QNU A;  1QNK A;  1VQO A;  3GTJ B;  1JIC A;  2JA6 G;  1EIY B;  2YYZ A;  3PUZ A;  4JCV E;  2O5I C;  4C3J G;  1K83 B;  5CV9 A;  2CFM A;  2I07 B;  4A3D G;  1EOV A;  1HR0 L;  5KNB A;  2EQS A;  1N9W A;  1VF5 C;  3I90 A;  1YJ9 A;  1GUG A;  1CA6 A;  2QEX A;  2R7F A;  1QIL A;  1RDP D;  4DNI A;  1PH1 A;  2Z1C A;  3PMF A;  4BY7 H;  2HDM A;  1I6V C;  1GOZ A;  1HQR D;  2Z6K C;  1MJE A;  2D0O A;  1IYJ B;  4B3S L;  2QKI C;  4XT1 B;  1X3E A;  3W5O A;  2K5V A;  2RVL A;  1S3O A;  2OWO A;  4TVA B;  5TSS A;  2IX1 A;  2WAC A;  1OXT A;  5KEE A;  3PIO 3;  4KY5 A;  1ILP A;  2Y0S G;  3S16 H;  1LTS D;  2RHQ B;  3UE1 A;  2JA9 A;  4TRD A;  1KDA A;  2F0S A;  4G7H C;  2L15 A;  3S1M B;  2KEN A;  2UUA Q;  1SYD A;  5C4X H;  5FLX L;  1JWU D;  4X62 Q;  4P73 A;  1IL2 A;  5FO8 B;  1CZG A;  2LXK A;  3CCM A;  3RLO A;  1EWI A;  2VQE L;  4BXX G;  2EYP A;  5IT9 c;  1ILQ A;  3T13 A;  4XYO A;  4RH6 A;  2A6E C;  4ZKB B;  4IAL A;  4OIJ A;  5LMN Q;  2F0U A;  3U50 C;  3ZYY X;  1UEB A;  5AJ3 L;  1L1O B;  1I94 Q;  5LL6 S;  1WTP A;  2NVQ B;  4DV5 Q;  1SE8 A;  3N52 A;  4U67 3;  4B3T Q;  3I4M B;  1E2W A;  3EQL C;  3MA2 B;  3CCQ A;  1HPC A;  3D4W A;  1PV4 A;  2UXB Q;  4UDU C;  3GV3 A;  3KLR A;  1GD7 A;  4H13 C;  1C4Q A;  5M3M G;  1VS0 A;  1KIX A;  1PYS B;  2VZA A;  4ZLT F;  4KTA A;  1Y8P B;  1BR9 A;  1R4P B;  1DGS A;  1F9R A;  3HOX G;  1WOC A;  3G4S A;  2CW0 D;  3H94 A;  2IJ0 A;  3NEM A;  4PG3 A;  1CKN B;  2EYF A;  4K5V A;  5IYB G;  3I70 A;  1W3S A;  2F0F A;  1WJJ A;  1N32 L;  4JI5 L;  3FRP B;  4JK1 C;  1JE4 A;  4I65 A;  4MIU A;  2WP8 J;  2EYH A;  1HUN A;  1I6H H;  1RKN A;  4N9T A;  3ICE A;  4YCU A;  2R61 A;  1I4H A;  1ZYR C;  4ILW A;  3A56 A;  2NVX B;  1EY6 A;  1N34 Q;  1I5F A;  4GNX C;  2BDN A;  4PMB A;  1JQY D;  3LWE A;  3I4M H;  5IP7 H;  4DUZ L;  1GO3 E;  4DAY B;  2JYO A;  3NTK A;  3URY A;  2A74 C;  3RMH A;  4DR7 L;  2HD3 A;  3HOY G;  1UNS A;  4X66 Q;  1AE3 A;  4I7Z C;  2UXD L;  2A69 C;  4RHS A;  4DK3 C;  3C1F A;  5K36 G;  4ZKC B;  2RDH A;  2JQO A;  1IKL A;  1VQC A;  2IX0 A;  4AYB G;  2NYZ D;  1UWV A;  2R92 B;  1VQF A;  3K0Y A;  2NWG A;  2XSC A;  3E6Z X;  5C44 H;  1NUC A;  2IHE A;  1U0L A;  3KDF A;  3S1N H;  3BVM A;  2RA4 A;  4C3I B;  3WOE A;  2EE1 A;  2YTX A;  4HMJ A;  4LAA A;  1J5E Q;  1LT4 D;  5IY0 A;  3S1M H;  2L12 A;  3HOV B;  1Q1B A;  2I5L X;  3MHB A;  3HEJ A;  5CGK A;  4A3B B;  4DR2 L;  1JWS D;  1L1O C;  1SDF A;  3KBX A;  1SFO B;  1ZYR D;  1E1O A;  4DPG A;  3GTQ B;  5KIX A;  1K9M C;  4DK0 A;  3DLL A;  3DXJ C;  4JVZ A;  2XGT A;  4X3K A;  1SFO H;  2VW9 A;  3E9I A;  2MFI A;  2BE5 C;  4C3H H;  4EQO A;  5CV8 A;  1NSN S;  5AJ3 Q;  3UDG A;  3GP7 A;  1Q1E A;  3HOV H;  3VR6 A;  2AKW B;  1CSQ A;  1STY A;  5J22 A;  4ABN A;  1QVG A;  2A68 C;  1BCP B;  5F2D A;  2B2T C;  5DM7 3;  3GTP H;  4L8J A;  4QIW E;  3AB9 A;  3T1Y L;  3PUV A;  1DD2 A;  4KV6 A;  2EIF A;  3GTP B;  3T53 B;  4CBV A;  4HJA A;  3FHW A;  1IL8 A;  4J1M A;  1VQB A;  4BBR B;  3JAM E;  3G7L A;  3HP3 A;  4KKT A;  4AYB B;  3MXN A;  2Z4I A;  1TWC B;  2IPK D;  4LF8 L;  1N36 Q;  3NBH B;  2WIN B;  2ENB A;  5FJ8 H;  1DOK A;  2CW0 C;  4R4T A;  4TSS A;  2EOT A;  5NUC A;  3A5U A;  4JW0 A;  1NR2 A;  4GKK Q;  4DV4 Q;  4DV0 Q;  1JR0 D;  4OIK A;  4LJZ C;  3H0G G;  1KL9 A;  5COR A;  2RSN A;  1CTM A;  3BZD B;  2EYJ A;  2RDF A;  3S15 B;  1B1Z A;  2BH2 A;  3I4L A;  1SJH D;  3NQT A;  4R4O A;  3EN2 A;  3SK5 A;  1EEF D;  1XPR A;  4M1U B;  1SNC A;  4GZY C;  4HCE A;  3ND9 A;  4POF A;  1Q7Y C;  2XRQ D;  4C2M B;  3FKI G;  1ROD A;  1BBW A;  4JPB W;  1KTK A;  3K5O A;  2B39 A;  3OMG A;  4WJ3 M;  4J6H A;  4JV5 L;  4QMG A;  2E75 C;  3AU7 A;  2SOB A;  4YHH L;  2GA4 B;  3BZC A;  5EKI A;  4X6A H;  1VQG A;  2Y0S E;  3J7Y W;  4LFB L;  2DUD A;  3RR5 A;  1JT8 A;  3CCL A;  3KLS X;  1UEA B;  3GQB A;  1TY0 A;  1B4O A;  1EY8 A;  2LKV A;  1HNW L;  4DAM A;  1SLJ A;  4KI0 A;  3I4N H;  4A3L H;  2JP1 A;  4C3J H;  1SN8 A;  1E24 A;  1BDO A;  4RAU C;  2DGY A;  4CDE C;  5E4X A;  4K6D A;  2PQA A;  1XJV A;  1DM0 B;  3F2D A;  3A8I E;  2R7Z B;  2Z8L A;  4F87 A;  4LFA Q;  1O7Y A;  4ID6 A;  5CV5 A;  1YBY A;  3S2H H;  5E1F A;  1ESF A;  2JA7 H;  5IIF A;  1TS4 A;  1QVF A;  4YIJ A;  3T51 B;  1EU3 A;  4R4Q A;  3MAQ A;  1WFQ A;  2B29 A;  1CI3 M;  5KNC A;  4HJ7 A;  4MN3 A;  4IFD H;  3FVQ A;  1MJC A;  1X3P A;  1XNQ Q;  1L0Y B;  1DON A;  1XMQ Q;  2JA8 B;  3L2P A;  1EQV A;  4BBS B;  1PH6 A;  4LF5 Q;  1LTG D;  1SRU A;  3S16 B;  4NXM L;  1KLG D;  2RSO A;  3HOZ H;  2N55 A;  1JOR A;  2OTL A;  3GDE A;  1RF2 D;  2VS1 A;  2F0T A;  3ND8 A;  4UAI A;  1PXU A;  2UXC Q;  1UE6 A;  2ICE C;  2G9H D;  2RQX A;  2I5M X;  1J8I A;  2Q2T A;  2PW7 A;  1N8R C;  2LMC B;  4QUC A;  1RHP A;  4Q0F A;  1AH9 A;  4LF8 Q;  5HGQ A;  4MNO A;  3RLN A;  1F9S A;  1PH8 A;  4LF7 L;  2EY5 A;  3K80 C;  1BUV T;  2PI2 E;  2NVT B;  1X6O A;  4A75 A;  3U58 A;  1G91 A;  1HRJ A;  1RTN A;  1J6Q A;  1IW7 C;  5FO9 B;  4K0K L;  5C0X I;  1ASZ A;  3H3V I;  2KVM A;  2YU9 H;  1S5B D;  3EA6 A;  2WAQ E;  1EWC A;  4QL5 A;  1SAP A;  2D9U A;  1S4Z A;  2CQO A;  3J81 c;  2VQF Q;  4Y52 H;  4IFD J;  3M9B A;  4F7X A;  2M2L A;  3PV0 A;  5E3F A;  4DF7 A;  5LL6 X;  2BCO A;  1LTB D;  1KDC A;  3TP8 A;  1Y1V B;  4CKE A;  3PF4 A;  4A3G H;  1X55 A;  3H3V C;  1PH3 A;  4Y7N H;  1M1K C;  1VCI A;  3NWT A;  3I91 A;  1VQJ A;  3CRL C;  4RFB A;  1C7Y A;  5D3I B;  5IYB H;  1FNU A;  2F0M A;  1ET9 A;  5A2Q E;  4A3B H;  2B2W C;  1SYB A;  1BNZ A;  4KHZ A;  3X3M A;  3I8Z A;  4BY1 H;  2QEJ C;  1CM9 A;  2L11 A;  3CRK C;  5IT9 E;  3OW7 A;  4LFC L;  2J7Z A;  1EQQ A;  1OXX K;  3V96 A;  2JN4 A;  3I56 A;  3TP7 A;  4C1N K;  1FR3 A;  4A3D B;  4WFN 3;  1V1P A;  4QIW B;  3G71 A;  4JI3 Q;  3R2I A;  1EZ8 A;  1EY4 A;  4JI0 Q;  5DEH A;  2JA6 B;  5LMU L;  5EGT A;  2JA8 G;  2HT1 A;  2GN5 A;  1PYW D;  3KLW A;  1I50 H;  1R4Q B;  3M7G A;  4A3J H;  1QG7 A;  2BDO A;  5D3D A;  3HOW H;  4X62 L;  3PQI A;  1Q3L A;  4DNR B;  4GLA C;  4X65 Q;  2K01 A;  4GKJ Q;  2HQE A;  5E4W C;  4CJ0 B;  3TRZ A;  1WYD A;  3BDC A;  1J9O A;  3J80 c;  4Q5V A;  5I9O A;  1D5X C;  2BA1 A;  1STN A;  4X3T A;  2AWN A;  2IW3 A;  4I7A A;  4DR6 Q;  1EU4 A;  5GQO A;  1XNQ L;  4LF4 L;  1LM0 A;  3OTO L;  1SYG A;  5ELB A;  1DYQ A;  1Q8I A;  3KDF B;  1TWF B;  1H95 A;  1LT5 D;  1YHQ A;  4CDF C;  2B63 B;  2PNH A;  1ML0 D;  3PO3 B;  3CC7 A;  5JEA H;  4PZ7 A;  4UP9 A;  2YV5 A;  4L5Q A;  1SNP A;  2N3S A;  1MKH A;  3W3A A;  3GTO H;  3OOC A;  4DV3 L;  5C4Z A;  2NB0 A;  3RN5 A;  4NB3 A;  1A62 A;  2RCF A;  3MZ5 A;  2J0T D;  4B9X A;  5IGC A;  1PRT C;  1UE1 A;  2WV6 D;  1AW7 A;  1K73 C;  1BBU A;  3R3O A;  4XQN A;  5GAD C;  1KNA A;  3M4Q A;  5EAY A;  1N32 Q;  1LV9 A;  2AUJ D;  1E0B A;  2E2D C;  2CWA A;  4JI5 Q;  2NTT A;  2PMZ B;  1VQP A;  2PZT A;  3S1Q H;  1PZJ D;  2FMM A;  1IYV A;  3BDO A;  1HNZ Q;  3W1G A;  1AEX A;  1G51 A;  4RA8 A;  1YHB A;  1PTO B;  1OXS C;  3DUZ A;  1PH5 A;  2X6L A;  2AQ2 B;  2L55 A;  5ELN A;  3PO2 G;  3E3X A;  1I4G A;  3Q22 A;  5ELF A;  4P74 A;  5EBC A;  4R8I A;  3PO2 H;  1VQA A;  2B2T A;  3H0G B;  5KND A;  2UU9 Q;  1CKN A;  2WB1 B;  1A15 A;  2FFK B;  1TWG B;  1XWE A;  2LY7 A;  2N8N A;  1ONL A;  3Q0A A;  4DUZ Q;  1PZK D;  5J39 A;  2DY7 A;  1QZG A;  1GHK A;  2PQA B;  5M5X B;  1SR3 A;  3PGZ A;  2M9V A;  1TS5 A;  3D3R A;  2FJ2 A;  4X66 L;  3M4O B;  2PW5 A;  1LUZ A;  4BA1 I;  2SEB D;  4GNX A;  4PMW A;  1MSH A;  2VB3 X;  1QJO A;  4IUQ A;  1F9P A;  1Z47 A;  5C4J H;  4JI6 Q;  3RZO B;  3OPO A;  3CC4 A;  1A3U A;  4YWK A;  4IQZ A;  4KD3 A;  3PIP A;  2ZT9 C;  1H9K A;  3A54 A;  1VQK A;  4X64 Q;  2OCE A;  3DM1 A;  4JI3 L;  3J81 i;  4HJ8 A;  1NBW A;  4FO2 A;  2B2V C;  1AZQ A;  3H6M A;  1PA6 A;  1B3Q A;  4L63 B;  1NJI C;  3JAM i;  1F2Z A;  2F4V L;  1YEZ A;  4J15 A;  5D65 A;  4F88 A;  2MP1 A;  5M5W B;  2EVB A;  3U4Z A;  5JOB A;  4ZUJ A;  1V9P A;  3FDT A;  3A5Z B;  3NPP A;  1BKB A;  4X65 L;  3JAM c;  3J7Z C;  1V8Q A;  4V0B A;  3TZU A;  3KJP A;  4A4I A;  4DV1 Q;  4IJL A;  4FYD A;  2H4O A;  2KUM A;  1HA6 A;  4L5R C;  2DY8 A;  2MJ8 A;  3A55 A;  5C5M A;  2E2J H;  1WTW A;  2DNE A;  1XX8 A;  3ER0 A;  3OTO Q;  4V19 0;  3GTO B;  4ODG A;  4BA2 I;  4P2C B;  3ZJY C;  5I6W A;  1IW7 D;  2KHS A;  4GN3 B;  4ME3 A;  5IP9 H;  3CMA A;  1TWH B;  1LO5 D;  2LXJ A;  4DXF A;  3CCR A;  4ME5 A;  3NTH A;  1YNN D;  1QZH A;  5HUR A;  3TS0 A;  3RUZ A;  2ZTE A;  3K5N A;  2OXP A;  2K52 A;  3GTG B;  4A3G G;  2WII B;  4DV3 Q;  5IT9 L;  3K8A A;  4YWM A;  3G48 A;  3H09 A;  4JI1 Q;  2HDL A;  2JEB I;  4POG A;  4LWC A;  2ZTD A;  4R4I A;  4BY1 G;  4DFA A;  4PV1 C;  4OO1 G;  2NTS A;  2XIW A;  1L0X B;  2EJG C;  4QJF A;  2QW7 A;  1JB7 A;  2JA7 G;  2CQA A;  2EXD A;  3GTL H;  5I2Y A;  3ULL A;  3NSW A;  3FPP A;  4IO9 A;  1LTI D;  2JA5 H;  1QWY A;  1QUQ B;  5JPM C;  2R93 H;  2JK8 A;  2K7V A;  3OW2 A;  4DV4 L;  4L5S A;  2AMC B;  4OWW B;  4OO1 H;  3NQI A;  3DHQ A;  4A3M G;  4DUY Q;  4JI7 L;  1SNQ A;  1U4L A;  3K59 A;  1JOO A;  4XTC S;  5JJZ A;  3CKI B;  3A7A B;  1L2F A;  3GTM B;  2Q8T A;  1U5K A;  2XWB B;  2VUM B;  5FLM G;  4DR5 Q;  4YCV A;  1JOK A;  2F52 A;  3GO5 A;  1EL0 A;  4FDB A;  1I3Q B;  2SNS A;  2JA5 B;  1GVP A;  3MEH A;  1N33 L;  4DV2 L;  4ALP A;  1K8A C;  5EPL A;  4EQ5 A;  2Q2U A;  1L0W A;  3R8B A;  5DLQ E;  1QE6 A;  3A7L A;  2P5Z X;  1JOQ A;  2EJM A;  4NXN L;  3HOX B;  1CKO A;  1XNR Q;  2E8G A;  1LAB A;  1U9R A;  5M9O A;  2G9D A;  1K8O A;  2H1E A;  3RD4 A;  3Q6S A;  4C1N I;  3CCS A;  4MTK A;  1X32 A;  3TSS A;  2C9O A;  5M3M B;  1IKM A;  3RZO H;  1DOL A;  4DAY A;  3AQQ A;  3SR1 A;  3NXW A;  2EY1 A;  1Y8N B;  4XXE A;  2PZW A;  2VB2 X;  4NKL A;  1WCM B;  4KHV A;  3M4O H;  5C4X G;  1CFM A;  2NVY H;  1BQQ T;  3J80 i;  1TKW B;  1MIU A;  4R4C A;  2RDG A;  1HZA A;  5IYD G;  1RD9 D;  1STE A;  1XXG A;  5K36 H;  1FVI A;  5G3L F;  3KJO A;  4B08 A;  4LFA L;  4IZ8 A;  1YNX A;  3AEV A;  4JI8 L;  3LX0 A;  4QB4 A;  4A3I G;  2E76 C;  1OO9 B;  2DN8 A;  3BG3 A;  3M85 A;  3QWN A;  4YWL A;  2K5D A;  3T4A C;  1HNX Q;  4HSV A;  2IT1 A;  4FNF A;  3IRB A;  1YI2 A;  3F2U A;  3TME A;  4MHE A;  4YY3 L;  3K7U C;  2D62 A;  1XMQ L;  1Y69 U;  4K2L A;  4OEM B;  2Y0S B;  2QA4 A;  3HOU H;  2K75 A;  3CCJ A;  5FLX E;  2UUB L;  3S1Q B;  2E2H H;  3VYU A;  3LWU A;  5EKL A;  2VL6 A;  1Y1W H;  1OTC A;  1S5C D;  4K5X A;  2A8V A;  4N9P A;  3QOL A;  2ES2 A;  2NUC A;  4B3R Q;  1EFW A;  4KLK A;  1H9S A;  1A2U A;  4LMQ D;  5IWA L;  4G4K A;  5ELD A;  1RCV D;  1IBM Q;  3MXP A;  3OMC A;  3BDL A;  1FL0 A;  4EQN A;  1JC7 A;  4LF9 L;  3M7N A;  3D6C A;  3V05 A;  1NE3 A;  1L1O A;  2GVA A;  3KYH C;  1XPO A;  4RWS C;  3ULJ A;  1D6E C;  4JI2 Q;  2HUG A;  3QB3 A;  4O1N A;  1TT2 A;  1TWG H;  2K05 A;  5CR3 A;  4DV6 L;  4IOC A;  2IWH A;  3QOJ A;  2DNC A;  1B3A A;  1JWM D;  2B63 H;  3HFZ B;  2R7Z H;  3PO3 H;  1TWF H;  1BCP F;  3K6O A;  4HTH A;  4IUV A;  4DUY L;  3TQY A;  1SRO A;  4JI7 Q;  2OTJ A;  4C3J B;  1V1Q A;  1FGB D;  3T56 B;  5A35 A;  1C8C A;  2C35 B;  3VA5 A;  4DK6 C;  1SE4 A;  5LHY 1;  2K5N A;  3E0J A;  2MNA A;  4LF6 L;  4HED A;  3T1H Q;  3TS2 A;  3QJY A;  1B9M A;  4CGY B;  1TR5 A;  3SXH A;  1Z9F A;  3HZX A;  2IX3 A;  1FJG L;  1CUK A;  4A3J B;  2A68 D;  4ZCK A;  1RTO A;  1HR0 Q;  3OIP A;  2B2U A;  1AFP A;  5GAH C;  4EVO A;  1K8G A;  4DR7 Q;  4B3M Q;  2JA6 H;  2KBN A;  2NN6 I;  3GTM H;  2MGS A;  1VQ9 A;  4E6I A;  4NXN Q;  1VMC A;  5M3F B;  2O4X A;  3NBH A;  1PVO A;  4OON A;  3M3Y H;  1NY4 A;  4IJH A;  3MXN B;  1C9O A;  3MTS A;  2F0H A;  4FP5 D;  4BY1 B;  1QB5 D;  1FD7 D;  1Q86 C;  5IYC H;  1NR4 A;  3S15 H;  4ZYS A;  1LAC A;  5CV6 A;  3L9A X;  2KEE A;  2OF1 A;  1XTD A;  3GTK H;  4FXD A;  1B8A A;  3K81 C;  1G6Z A;  3BZK A;  4JI0 L;  3NTI A;  3J81 E;  5LMU Q;  3S17 B;  2NN6 G;  1CSP A;  2DJF C;  2L1B A;  5IP7 G;  4DR4 L;  1A63 A;  2WKC A;  5J3B A;  3HKS A;  4RGO S;  4A3K G;  5M5Y B;  2F0G A;  1HHV A;  4PQX A;  2X6G A;  3SVM A;  4DR2 Q;  1SNM A;  1O7I A;  2YTY A;  4R9W A;  1P16 A;  1Q46 A;  3HOW B;  1XMO Q;  2ZTC A;  3QG1 A;  2O5J C;  1MHW C;  4KMU C;  1WTH A;  4A3M H;  3MC0 B;  2RHS B;  3WWV A;  1TII D;  1EY9 A;  1D2B A;  3K57 A;  1ET6 A;  1A2T A;  3J7A V;  1AZP A;  2VQE Q;  5FOB B;  3A8J E;  3S2D H;  3OHX C;  5CBE E;  1UAP A;  2KQ3 A;  1ENF A;  4OX9 L;  4A3D H;  2F3I A;  3CCU A;  4JOI C;  2WAQ G;  4AYB E;  2NVT H;  4JI4 Q;  4NP5 A;  1VQE A;  1XTC D;  2TSS A;  4B3R L;  2KCC A;  4DN4 M;  1W6K A;  1K28 A;  4FF4 A;  4CDC C;  5C3E H;  5CYU A;  4ZRZ A;  1E3P A;  3D8G A;  3F2B A;  4DR1 Q;  1ICF B;  3KLS A;  1HTP A;  4H44 C;  4K8J A;  3PCO B;  5I2X A;  1VQH A;  4UP8 A;  1IHZ A;  2L9H A;  4NPS A;  2EYO A;  2HIX A;  1S40 A;  1BXT A;  1YZ6 A;  2Q2I A;  1ENC A;  2EPB A;  3HOZ G;  4K2K A;  2PQE A;  1VQL A;  4RGT A;  4G7O C;  1D7Q A;  4DV0 L;  4PMC A;  4XT3 B;  2YU9 B;  1E1T A;  1KNE A;  4TKO B;  3VR3 A;  2F03 A;  3DWQ A;  3VDY A;  1RIP A;  2AQ3 B;  4A3B G;  2LSS A;  3S1N B;  2XN9 C;  4MZ9 A;  5C44 B;  1TQO A;  1E2Z A;  1WTR A; 
#chains in the Genus database with same CATH homology
 1EWI A;  3T1H L;  1UE1 A;  2VQE L;  4BXX G;  1K73 C;  5IT9 c;  1BBU A;  4KHP L;  4OO1 I;  4GNX B;  4A3J G;  4HIO A;  4A3E H;  5GAD C;  3L0O A;  4JBM A;  3M4Q A;  3KF8 B;  5EAY A;  5LMN Q;  3G6E A;  1EIF A;  2E5L Q;  3U50 C;  5AJ3 L;  1UEB A;  2K5H A;  4X64 L;  1N34 L;  1L1O B;  1N32 Q;  2CWA A;  1I94 Q;  1LTL A;  4JI5 Q;  1VQP A;  3S1Q H;  4DV5 Q;  4EX5 A;  1SE8 A;  4B3M L;  2R92 G;  1HNZ Q;  1VQN A;  4B3T Q;  5FLM H;  3W1G A;  3TEH B;  1EQR A;  3I55 A;  2UUA L;  1G51 A;  1YHB A;  1D8L A;  1OXS C;  3CCQ A;  4AQY Q;  4A3E G;  2UXB Q;  1PV4 A;  2RCN A;  2UXD Q;  1PH5 A;  4B3S Q;  1GD7 A;  5ELN A;  3PO2 G;  1AE2 A;  5M3M G;  4QGU A;  1VS0 A;  3F1Z A;  3CCV A;  3FP9 A;  4P74 A;  1KIX A;  1PYS B;  3PO2 H;  1VQA A;  2VZA A;  1E22 A;  4YY3 Q;  1DGS A;  3HOX G;  1WOC A;  3G4S A;  3CF5 A;  2ALY B;  3NEM A;  4PG3 A;  1PH9 A;  2UU9 Q;  1CKN B;  1CKN A;  3ERS X;  2KCT A;  5IYB G;  2OQK A;  3CAM A;  4A3K H;  1KHI A;  2UUC Q;  1W3S A;  1WJJ A;  2N8N A;  5IE8 A;  1N32 L;  4DUZ Q;  4HIM A;  2B63 G;  3PO3 G;  4JI5 L;  5M5X H;  1I94 L;  4DR4 Q;  4LF5 L;  2JE6 I;  1QZG A;  5GAG C;  2PQA B;  3EIV A;  1JMC A;  1SR3 A;  3PGZ A;  4B3T L;  4X66 L;  1KD1 C;  4JBK A;  5JEA J;  2WP8 J;  4WJ4 A;  1LUZ A;  4BA1 I;  4GNX A;  4PMW A;  1CKM A;  1I6H H;  2UXB L;  1HZ9 A;  1A8V A;  1YVC A;  1SMX A;  4LNQ A;  2FXQ A;  3ICE A;  4A93 G;  2UXC L;  1Z47 A;  5C4J H;  1X3G A;  1X3F A;  4JI6 Q;  3CC4 A;  5M3M H;  4YCU A;  4YWK A;  5BR8 Q;  3PIP A;  5H1S E;  1JJ2 A;  1VQK A;  4OX9 Q;  4X64 Q;  2OCE A;  3J81 i;  4JI3 L;  2B3G A;  3HOX H;  4HJ8 A;  1PYB A;  1PH4 A;  1N34 Q;  1NBW A;  4LF7 Q;  1I5F A;  4GNX C;  1PA6 A;  5JJI A;  3I4M H;  1NJI C;  5IP7 H;  1HNZ L;  3JAM i;  4DUZ L;  1GO3 E;  4DAY B;  1YIJ A;  4JI4 L;  2F4V L;  3AFP A;  4IPG A;  1YEZ A;  4DR7 L;  4JG2 A;  2NVQ H;  3HOY G;  4XIG S;  3HOU G;  5JJL A;  1JJG A;  4J15 A;  4X66 Q;  1AE3 A;  1HJP A;  2UXD L;  2ZJP A;  3U4Z A;  4K0K Q;  1I3Q H;  4DK3 C;  1V9P A;  2I0Q A;  5K36 G;  1FGU A;  4YCW A;  5HY6 A;  3A5Z B;  4X65 L;  1BKB A;  2JQO A;  3JAM c;  3J7Z C;  1VQC A;  3KJP A;  2IX0 A;  4AYB G;  4A4I A;  4DV1 Q;  1UWV A;  4IJL A;  5LMN W;  4LUO A;  1VQF A;  4L5R C;  2R7Z G;  3ULP A;  2XTI A;  1JE5 A;  3STB C;  3TRE A;  5C44 H;  1TWA H;  2IHE A;  3KDF A;  1U0L A;  4PZ8 A;  3S1N H;  2E2J H;  2K4K A;  4P72 A;  1K0R A;  3PUX A;  3ER0 A;  3OTO Q;  2IHF A;  3CQZ H;  5ELO A;  4BA2 I;  3K7A H;  3ZJY C;  1PH2 A;  2YTX A;  1WCM H;  4BXX H;  1J5E Q;  4GN3 B;  4ME3 A;  3CXC A;  1B70 B;  5IP9 H;  5IY0 A;  3S1M H;  3CMA A;  4RMF A;  1M90 C;  3F8T A;  3CPF A;  2LXJ A;  1Q1B A;  3CCR A;  3KOJ A;  4A3L G;  2RF4 A;  1HR0 W;  2Q2H A;  1QZH A;  2I5L X;  2KHJ A;  3TS0 A;  4A3G G;  2ZTE A;  2K52 A;  3A74 A;  4DV3 Q;  3K8A A;  4MTN A;  4YWM A;  4DR2 L;  1L1O C;  3G48 A;  4JI1 Q;  4DKA C;  1KRS A;  1E1O A;  4UY8 C;  2JEB I;  4DPG A;  4JI6 L;  4POG A;  4LWC A;  1HZB A;  2ZTD A;  3EBE A;  4R4I A;  1K9M C;  4BY1 G;  3DLL A;  1VQ4 A;  4A3L H;  4OO1 G;  3GTQ H;  1VQM A;  1Q81 C;  4QJF A;  1HH2 P;  2XGT A;  1SFO H;  1JB7 A;  2JA7 G;  4KHP Q;  3SGI A;  5FLX c;  1Y1V H;  2EXD A;  1X65 A;  2WFW A;  2VW9 A;  4DV7 Q;  3GTL H;  3E9I A;  3ULL A;  2MFI A;  1N33 Q;  4C3H H;  2E5L L;  4IO9 A;  3UDG A;  5AJ3 Q;  2JA5 H;  1Q8K A;  1Q1E A;  1QUQ B;  3HOV H;  2R93 H;  2JK8 A;  2AKW B;  3OW2 A;  1IZ6 A;  1CSQ A;  3AFQ A;  3DM3 A;  4DV4 L;  1J5E L;  4L5S A;  2AMC B;  4OWW B;  2VUM G;  1WCM G;  1QVG A;  4A3M G;  4DUY Q;  4BBR H;  4JI7 L;  1QUQ A;  3UDI A;  1YIT A;  2A1A A;  3GTP H;  4AQY L;  4QIW E;  2N78 A;  4XTC S;  3T1Y L;  2PMZ E;  1X9N A;  3PUV A;  1EYG A;  4JI8 Q;  2EIF A;  1L2F A;  5C44 G;  1G29 1;  1U5K A;  1K83 H;  4HJA A;  3FHW A;  1VQB A;  5FLM G;  4DR5 Q;  4LFC Q;  4GKJ L;  4YCV A;  1HNX L;  3GTJ H;  2F52 A;  3GO5 A;  2ZJR A;  4FDB A;  3Q8D A;  5C3E G;  4AH6 A;  3I4N G;  4RG1 A;  3U4V A;  4LF8 L;  3FKI H;  4QQB X;  1GVP A;  4GLX A;  3NBH B;  1N36 Q;  1N33 L;  4DV2 L;  5FJ8 H;  1HNW Q;  4ALP A;  1K8A C;  2UUC L;  4R4T A;  4EQ5 A;  2Q2U A;  4LF4 Q;  1PHJ A;  2BH8 A;  1L0W A;  5DLQ E;  3A5U A;  5M5Y H;  3RN2 A;  4GKK Q;  4DV4 Q;  2KCM A;  3CCE A;  4BBS G;  3KF6 B;  3UDX A;  5E7N A;  4DV0 Q;  3RZD H;  4NXN L;  2ZM6 Q;  1CKO A;  1XNR Q;  4O2D A;  3K0X A;  4OWX B;  3H0G G;  2E8G A;  1KL9 A;  2HIV A;  4GOP C;  1UE7 A;  4UPA A;  3CCS A;  3H15 A;  3UDF A;  2JEA I;  1KC8 C;  1IBM L;  3RZO H;  2MQH A;  2ID0 A;  4JOI A;  4JC0 A;  2BH2 A;  3AQQ A;  4R1J A;  5IYD H;  3HKZ G;  4R4O A;  3EN2 A;  4BBS H;  2JA8 H;  2R93 G;  5BR8 L;  1XPR A;  2MO0 A;  4POF A;  4HID A;  1Q7Y C;  3M4O H;  4C3I H;  5C4X G;  2NVY H;  3FKI G;  3J80 i;  3CW2 C;  1HZC A;  1BBW A;  3HOY H;  1KRT A;  5LMN L;  1MIU A;  4WJ3 M;  4R4C A;  1HZA A;  4UP7 A;  5IYD G;  4JV5 L;  4GKK L;  4H02 A;  4DV5 L;  1LYL A;  1FVI A;  3KJO A;  4NXM Q;  3CME A;  1Q12 A;  4IPD A;  4LFA L;  4YHH L;  1YNX A;  4A3I H;  3AEV A;  4JI8 L;  1V43 A;  3BZC A;  1WI5 A;  3H0G H;  4A3I G;  3PF5 A;  4OWT B;  4X6A H;  5M5W H;  1B7Y B;  1VQG A;  2AWO A;  2Y0S E;  4YWL A;  3M85 A;  4LF9 Q;  2DUD A;  3RR5 A;  3J7A 5;  4LFB L;  3E0E A;  1HNX Q;  1JT8 A;  1VQ8 A;  3LGJ A;  3S24 A;  1NMG A;  1Y1W G;  4IOA A;  2IT1 A;  3BJU A;  3CCL A;  1QVC A;  3IRB A;  4LUV A;  1YI2 A;  1C0A A;  1N36 L;  2ATW A;  3HOV G;  5GAE C;  4L5T A;  4DV2 Q;  4DAM A;  1HNW L;  2NZO A;  4YY3 L;  3K7U C;  4JBW A;  2D62 A;  1SLJ A;  4KI0 A;  4IPC A;  4DV6 Q;  2MO1 A;  1XMQ L;  1S72 A;  4APV A;  3I4N H;  3BU2 A;  4JBJ A;  4C3J H;  1R9T H;  1SN8 A;  1E24 A;  2QA4 A;  4GOP A;  2DGY A;  1ASY A;  3HOU H;  2K75 A;  3GD7 A;  3CCJ A;  2I5H A;  2UUB L;  2E2H H;  2PQA A;  1Y1W H;  2VL6 A;  1XJV A;  2JA5 G;  1XNR L;  1OTC A;  4GOP B;  2A8V A;  4JV5 Q;  3F2D A;  3JC6 6;  3S1R H;  2ES2 A;  4B3R Q;  1EFW A;  4KLK A;  5JJK A;  3B6Y A;  4LFA Q;  5IWA L;  1BVS A;  4GS3 A;  3UE0 A;  1IBM Q;  1YBY A;  3S2H H;  3STB D;  2H5X A;  2JA7 H;  1FL0 A;  4LF9 L;  4LF6 Q;  4LFB Q;  2K14 A;  3M7N A;  4A93 H;  2Z0S A;  1QVF A;  1NE3 A;  2BA0 A;  3I2Z A;  4O0A A;  1L1O A;  2GVA A;  3KYH C;  1XPO A;  1XPU A;  4R4Q A;  4QY7 A;  2PI2 A;  1WFQ A;  2B29 A;  3ULJ A;  4C2M H;  4JI2 Q;  1GKH A;  2VQF L;  1UE5 A;  5M3F G;  4HJ7 A;  1FJG Q;  4DV7 L;  1TWG H;  1E7Z A;  1EUJ A;  4HJ9 A;  4P75 A;  1MJC A;  3PIO A;  1XNQ Q;  4DV6 L;  1X54 A;  4IOC A;  1XMQ Q;  1IBL Q;  3L2P A;  5IYC G;  3CP0 A;  4OXP A;  1K3R A;  3HKZ E;  5IP9 G;  1PH6 A;  4LF5 Q;  2B63 H;  3HFZ B;  2R7Z H;  1VQ6 A;  1SRU A;  1IXR A;  1TWF H;  3PO3 H;  3CC2 A;  4NXM L;  2NZH A;  4A3F H;  4DUY L;  3TQY A;  2F4V Q;  4YHH Q;  3I7F A;  1SRO A;  3NEL A;  3AYH B;  4JI7 Q;  3HOZ H;  4A3C G;  2OTJ A;  2OTL A;  3GDE A;  2HHH Q;  1V1Q A;  4IFD G;  3CPW A;  2VS1 A;  2C35 B;  2JJQ A;  4DK6 C;  1IBK L;  4IPH A;  2UXC Q;  1UE6 A;  2K5N A;  1XMO L;  4BY7 G;  1YHA A;  2MNA A;  4BBR G;  4LF6 L;  1OXV A;  2I5M X;  4GN4 B;  4JYA L;  4TQU S;  2E2I H;  2Q2T A;  1NMF A;  4DV1 L;  3T1H Q;  3TS2 A;  1G6P A;  2QGQ A;  2R6G A;  1N8R C;  3W1B A;  4LW1 A;  1VQ7 A;  1FJG L;  1Z9F A;  3H3V H;  1AH9 A;  4LF8 Q;  2AHO B;  1CUK A;  5HGQ A;  1A62 A;  4MNO A;  3RLN A;  2VNU D;  2CCZ A;  1PH8 A;  4LF7 L;  1HR0 Q;  2A19 A;  3K80 C;  1KAW A;  1Y14 B;  2PI2 E;  2UUB Q;  1IBL L;  3KF6 A;  1X6O A;  3PUY A;  5GAH C;  4A75 A;  3U58 A;  1K8G A;  2VUM H;  1T9H A;  4B3M Q;  2JA6 H;  4DR7 Q;  2KBN A;  2NN6 I;  3GTM H;  4GLV B;  1J6Q A;  4HIK A;  1VQ9 A;  4IFD I;  2ZM6 L;  1NTG A;  4GN5 A;  5IWA Q;  4NXN Q;  2ASB A;  4AIM A;  4P71 A;  4K0K L;  1PVO A;  4OON A;  5C0X I;  1ASZ A;  3M3Y H;  3H3V I;  1VQD A;  1VQI A;  1W2B A;  1NY4 A;  4IJH A;  1Q82 C;  2YU9 H;  2HQL A;  3MXN B;  4A76 A;  4JI1 L;  1C9O A;  2WAQ E;  4DR1 L;  4QL5 A;  4PZ6 A;  3CD6 A;  4JYA Q;  3J81 c;  2CQO A;  2VQF Q;  1P8L A;  1GM5 A;  4JI2 L;  4Y52 H;  4IFD J;  3I4M G;  3L7Z C;  2CWP A;  1Q86 C;  5IYC H;  3S15 H;  3M9B A;  4HJ5 A;  2IY5 B;  3PV0 A;  3M4P A;  2ZJQ A;  3HOW G;  3D0F A;  1XTD A;  3I4O A;  5FJ8 G;  1B8A A;  3K81 C;  1PH7 A;  3GTK H;  3PF4 A;  1X55 A;  4A3G H;  3A0J A;  1A0I A;  3BZK A;  4JI0 L;  4DR6 L;  3OYY A;  1PH3 A;  4Y7N H;  2R7D A;  5LMU Q;  1M1K C;  3PUW A;  1VCI A;  2NN6 G;  1KQS A;  1CSP A;  3J81 j;  5IP7 G;  1VQ5 A;  1VQJ A;  4DR4 L;  1A63 A;  5J3B A;  3RLF A;  2Z6K A;  3HKS A;  1C7Y A;  2N49 A;  5IYB H;  5C0X G;  1OXU A;  1JJC B;  4A3K G;  2VY3 A;  5GRO A;  4A3B H;  4DR2 Q;  2K50 A;  2OQ0 A;  1O7I A;  2YTY A;  3GTG H;  4DR3 L;  1Y1V G;  4LUZ A;  1P16 A;  1Q46 A;  1TXY A;  1XMO Q;  2ZTC A;  3T1Y Q;  2YTV A;  4KHZ A;  1TWC H;  5C0X J;  3S14 H;  1TWH H;  2KHI A;  1KXL A;  4A3M H;  4BY1 H;  1RL2 A;  3MEF A;  2RHS B;  3WWV A;  1VQO A;  2JA6 G;  3NEN A;  2YYZ A;  4LFC L;  1EIY B;  3PUZ A;  4JCV E;  1EQQ A;  1OXX K;  2CFM A;  3I56 A;  2VQE Q;  1YJN A;  4A3D G;  1EOV A;  3S2D H;  1HR0 L;  2EQS A;  4OX9 L;  4A3D H;  1N9W A;  3G71 A;  1YJ9 A;  4JI3 Q;  4A3C H;  2F3I A;  2QEX A;  2R7F A;  4JI0 Q;  2R92 H;  3CCU A;  2WB1 G;  5LMU L;  4JOI C;  2WAQ G;  2HT1 A;  4AYB E;  4DNI A;  2JA8 G;  2NVT H;  4JI4 Q;  1PH1 A;  2GN5 A;  1VQE A;  3KLW A;  1I50 H;  4B3R L;  4BY7 H;  4A3J H;  3HOW H;  3D31 A;  5C3E H;  4X62 L;  1E3P A;  4DR3 Q;  3F2B A;  4DR1 Q;  2Z6K C;  1MJE A;  2D0O A;  4GLA C;  4X65 Q;  1IYJ B;  4DR5 L;  2WB1 E;  3E9H A;  4A3F G;  4B3S L;  4GKJ Q;  2GVB A;  1X3E A;  3PCO B;  3W5O A;  3TRZ A;  1WYD A;  1YJW A;  5JEA G;  1VQH A;  1X56 A;  1S3O A;  2K5V A;  4UP8 A;  4NPS A;  1PFS A;  3PSI A;  3J80 c;  2D0P A;  2OWO A;  2HIX A;  2BA1 A;  4TVA B;  1S40 A;  3S17 H;  2NVX H;  2AWN A;  4DR6 Q;  3KFU A;  5GQO A;  2IX1 A;  1XNQ L;  1YZ6 A;  4LF4 L;  1LM0 A;  2Q2I A;  3OTO L;  1OXT A;  2UU9 L;  3KDF B;  3HOZ G;  2Y0S G;  3S16 H;  1VQL A;  1H95 A;  2RHQ B;  1YHQ A;  2PNH A;  3UE1 A;  2JA9 A;  1D7Q A;  3CC7 A;  4PZ7 A;  4DV0 L;  4UP9 A;  2YV5 A;  4L5Q A;  2CKZ B;  2L15 A;  2KEN A;  2UUA Q;  2N3S A;  5C4X H;  2HHH L;  1MKH A;  3GTO H;  1E1T A;  4DV3 L;  3VDY A;  1RIP A;  4X62 Q;  1IBK Q;  3F2C A;  2LSS A;  3RNU A;  4A3B G;  4P73 A;  5M3F H;  4MZ9 A;  3RN5 A;  1IL2 A;  2LXK A;  3CCM A;  4NB3 A;  2V1C C;  3RLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...