1K83H

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1k83H00
4X66Q 3CCQA 1XMQQ 3M7NA 1GM5A 1VQBA 4DV4L 3PO3H 4JV5L 1SRUA 2NVQH 1R9TH 4POGA 2RCNA 1VQGA 3UDIA 4IPHA 4X6AH 5AJ3L 4KLKA 1JJCB 2JE6I 4PZ6A 2BH8A 2IHEA 4PMWA 4GN5A 3S1QH 1FL0A 1HZCA 3M9BA 3G6EA 4O2DA 3EN2A 1VQ8A 1NTGA 3CAMA 2YU9H 4JI4Q 1CSPA 4LUOA 1EYGA 1QUQA 4FDBA 2MNAA 1N36L 2B63H 4IPCA 5GAHC 3CCJA 5M3FH 3UE0A 2JEAI 1GKHA 1SMXA 2CQOA 4JI7L 1IBKL 2NZHA 3CMAA 4A3JH 2UUBQ 3VDYA 1XNRL 3OTOL 4IFDI 4DV5L 2IX0A 4BBSH 1VQFA 4QJFA 2K75A 2YTYA 4A3EG 1SN8A 2B3GA 3CCMA 4DUZL 4YCWA 1SE8A 4JBMA 2AHOB 4DR4Q 2Y0SE 4JI1L 1QUQB 1O7IA 3CW2C 3TS0A 3H15A 1WOCA 3I4NG 1VQAA 2V1CC 3CC4A 1SLJA 2VY3A 4EX5A 5C0XJ 4PZ8A 1S3OA 4J15A 1EWIA 1WFQA 1YBYA 2RHQB 4GN3B 3PUXA 1HNZL 3S17H 4KI0A 3GDEA 3J80i 1IBLL 2I0QA 2UU9L 2KCMA 1FJGQ 1W3SA 4B3TL 4LF7Q 4LF4Q 2JA9A 2UXCQ 3T1YQ 5FJ8G 3F2BA 4JI8L 4A3KG 2PI2E 3TRZA 1IZ6A 2WAQG 3JAMc 3RZDH 1VQPA 2F52A 3KDFA 3T1HQ 4K0KQ 4HJAA 4ALPA 5C4JH 3S24A 1YITA 1XJVA 4DAMA 4QQBX 4A3IH 4LW1A 1Q8KA 4DV2L 5IYCG 3PUWA 2CWPA 4LF5L 3CP0A 3KLWA 1VQLA 4JOIC 3L2PA 1YJNA 2D0PA 3FKIH 1TWCH 1VQEA 1D7QA 1X6OA 3ULPA 4OO1G 1XMOL 4P74A 1YJWA 2VQEQ 4X66L 2E2HH 4JI3Q 3S15H 1VQDA 1X54A 2N49A 3J81j 3A5UA 4A3FG 1LYLA 4DV4Q 2KHIA 4JV5Q 1TWGH 3I4MG 2E2JH 5LMNL 1Q81C 4HIMA 1M90C 4EQ5A 3U50C 4APVA 1X55A 1L1OC 5AJ3Q 1UEBA 4X64L 3SGIA 2NVXH 3HOUG 4GOPB 3RLNA 4YWLA 3K81C 3PUYA 4UPAA 1IL2A 3HOZH 5IYCH 3M4PA 1QVFA 3RLOA 2VNUD 4IO9A 1I3QH 4R4QA 1X3GA 1NY4A 3K0XA 5IY0A 1N36Q 1MJCA 4IPDA 3W1GA 1JJ2A 3D31A 3GTKH 4JI7Q 1IBKQ 1A62A 1WI5A 4GLAC 1EFWA 1XNRQ 3OTOQ 1SROA 3ICEA 2LSSA 5LMUL 1RIPA 1SR3A 4DV5Q 5M3MH 1KD1C 1V9PA 4L5QA 1VQHA 2IHFA 3A0JA 4LUVA 4ME3A 3CCEA 4GNXC 2JA5G 4GKKL 4QIWE 4B3RL 4DUZQ 3TS2A 1KL9A 1Z9FA 1VS0A 4P73A 4JI1Q 1DGSA 4LNQA 2Q2HA 3A74A 1WCMG 4LF6L 3PGZA 1PH7A 3E9IA 4AH6A 4H02A 2R93G 2JA6G 1HNZQ 1FGUA 1VQOA 1X3FA 2WP8J 1PH1A 2IX1A 4IOCA 5C0XG 2LXJA 1IBLQ 1XPUA 4AYBE 2UU9Q 4JYAL 4IFDJ 4WJ3M 1TXYA 1U0LA 3HKZE 5FLMH 1HJPA 1AE3A 2ZTDA 1TWFH 3U4VA 2PNHA 4B3TQ 4OWWB 1VQ6A 2MO0A 1LTLA 1PYSB 2I5MX 4JG2A 3PO3G 1E1TA 3M4QA 2K5HA 4GLVB 1YI2A 1EIFA 3AYHB 4GN4B 1KHIA 2E5LL 1WJJA 2JA7H 1UE6A 1WCMH 2CWAA 2DGYA 1I94L 3S1NH 2R7ZH 4WJ4A 3J81c 3BZCA 1IBML 4DV7L 4DR5L 1I50H 4B3ML 4DV2Q 4LF5Q 1V1QA 5JJKA 1U5KA 2CCZA 2ZM6L 3RR5A 2UUAL 2B63G 3NBHB 2Z6KC 1A0IA 2RF4A 1Q86C 2N78A 2MFIA 1XMOQ 1N34L 1X56A 1PH2A 4A3JG 4B3SL 1N33L 2ES2A 4C3HH 5GROA 1HR0L 5K36G 2AMCB 2WFWA 3KOJA 4GKJL 3PUVA 3D0FA 2ZJRA 5LMNQ 1VQJA 4BBSG 4HJ8A 4JI6L 4NPSA 3STBD 4X64Q 1XPOA 3I55A 2H5XA 4A3DG 3RN5A 2K5VA 5ELNA 3I56A 1NJIC 3CPWA 3J7A5 3RNUA 1B70B 3HOVH 2WB1G 1X9NA 1C9OA 3UDGA 5DLQE 2NVTH 4UP9A 3K8AA 4X65L 1BVSA 3TQYA 4MZ9A 2Q2TA 3G4SA 3KJPA 4DR1Q 3PUZA 1V43A 5IWAL 5LMUQ 2C35B 2KHJA 4TQUS 2VZAA 1LM0A 3Q8DA 4L5TA 1VCIA 4UY8C 4YY3L 4BY7H 3CCSA 4DV1Q 4A3DH 4PZ7A 4JBWA 4B3RQ 1GVPA 2KCTA 1Y1WH 1YVCA 2BA0A 2KENA 5IE8A 1KXLA 4DV0L 4LF8L 2NN6I 4YWMA 4LFAL 3PIOA 4LF6Q 4DK3C 2MO1A 4XTCS 4A3IG 1PH5A 1PHJA 3GTQH 2CFMA 4R4IA 4JYAQ 2PQAA 1H95A 1IXRA 3FKIG 3CXCA 1VQNA 5JJLA 3KJOA 3NELA 3S1MH 3CC7A 4IFDG 4HIOA 2VUMH 2K4KA 1Y14B 2IT1A 2E2IH 2UXBL 3AFPA 1VQMA 1P8LA 4YWKA 3AFQA 4O0AA 2E5LQ 1OXXK 3NEMA 2OTLA 1FVIA 2I5LX 1EUJA 3L0OA 3STBC 1I94Q 5JEAG 3PV0A 2Y0SG 1HZ9A 1WYDA 3HOZG 1IBMQ 2PQAB 4DV7Q 4DR5Q 4DR3L 1A8VA 2HIXA 4GOPA 1S40A 4B3MQ 5GQOA 2UXDL 1MIUA 2ZM6Q 2QA4A 3CCRA 5LMNW 2UUAQ 1Y1VH 2UUCL 4C3IH 3J7ZC 3ZJYC 1N32L 1OXTA 1TWHH 2EQSA 2YTVA 1N34Q 4B3SQ 1N33Q 4LF8Q 4BBRH 5C3EH 1HR0Q 5M3MG 4GKJQ 3J80c 1BBWA 1UE5A 2QEXA 1UE7A 3PCOB 4JI6Q 4LF9L 1PYBA 1YNXA 1CKNA 5ELOA 2Q2UA 3H0GH 3KYHC 1JMCA 3S2DH 2BA1A 1HNXL 3KFUA 1OXSC 1KRSA 4KHZA 4NB3A 4XIGS 3AEVA 5C4XH 3RN2A 1Q7YC 5C44H 1L0WA 4YHHL 2MQHA 2OCEA 2PI2A 5HGQA 3CCVA 4X65Q 3K80C 4HIDA 2L15A 4C2MH 4DR1L 2GN5A 4JOIA 2GVBA 2QGQA 4L5SA 2F3IA 4MNOA 5IWAQ 5BR8L 1CKNB 2A1AA 5FLMG 1PH4A 1YHAA 4NXNL 1YEZA 4DV6L 4LUZA 4P71A 4R4OA 4DV1L 4YY3Q 1JB7A 4P72A 3U58A 5M5YH 2JA8H 1BKBA 4JCVE 3TEHB 4DV0Q 1BBUA 4LFAQ 1L1OA 4JI2Q 1PH6A 3CC2A 2OWOA 2R7ZG 2JK8A 4DR6L 2Q2IA 3I4OA 4A3GH 3W5OA 4QY7A 4C3JH 3ER0A 1VQ9A 2ID0A 4IOAA 2K5NA 3PIPA 5GAEC 4BY1H 4DR7L 1KC8C 1G6PA 1A63A 3M3YH 1NMFA 3TREA 1KAWA 1YHQA 4RG1A 3ULLA 1K73C 1VQ5A 1VQ7A 3H3VI 2UXBQ 5JEAJ 1L1OB 1SFOH 1VQKA 1AE2A 3GTPH 2ALYB 4GNXA 3A5ZB 3AQQA 1J5EL 2E8GA 1JT8A 4BXXH 1I6HH 3HOYH 2HHHL 3LGJA 4A3MH 1PA6A 4DR3Q 1EIYB 3HOVG 1RL2A 2AWNA 4OWTB 3PO2H 1HR0W 2UXDQ 1GO3E 2VL6A 3CQZH 4Y7NH 3JC66 2R7FA 3GO5A 2HIVA 4IPGA 2XGTA 4DR2L 2UUCQ 4AYBG 3PF4A 2R6GA 1N32Q 4QGUA 2LXKA 3CMEA 3HKZG 4A3LH 2ZJPA 1PVOA 1JJGA 4GNXB 3G71A 4X62L 2GVAA 1HH2P 4HJ5A 5IYDH 1E7ZA 2A8VA 3E0EA 3EBEA 4LF9Q 4BY7G 4UP8A 1QZGA 1LUZA 4HIKA 4R4CA 4TVAB 1Y1WG 3HOXG 1ASYA 5IP9H 1HNXQ 1NMGA 3PF5A 3CCLA 4IJHA 4PG3A 5IP7H 2A19A 1UE1A 4JI5L 4YHHQ 4JI0L 3S14H 2K50A 1K3RA 3HOWH 4P75A 1W2BA 1CUKA 3K7UC 2OTJA 1CKMA 3W1BA 3GTGH 2Z6KA 3MEFA 5BR8Q 1KQSA 4A75A 3H3VH 3ERSX 4QL5A 4L5RC 4NXNQ 3B6YA 1CKOA 3L7ZC 5GADC 4DV6Q 3HFZB 2VUMG 1XTDA 3HOXH 1T9HA 4GKKQ 1AH9A 3NENA 4JI2L 1PH9A 3GTJH 4JC0A 4DR6Q 1C7YA 3M85A 3E9HA 4A3CH 1G291 2VQFL 3JAMi 1HNWL 3UDXA 4DR7Q 1TWAH 3BJUA 1M1KC 1Y1VG 4DNIA 4LFBL 2XTIA 2WAQE 4BBRG 3KF6A 5C3EG 1OXUA 4AQYL 4GOPC 1Q1BA 3F8TA 2B29A 4YCVA 4LFCL 3K7AH 1J5EQ 3H0GG 4IJLA 1JE5A 2BH2A 5E7NA 2HHHQ 1Q1EA 2NN6G 5IT9c 5JJIA 2AKWB 1X3EA 3S16H 4OO1I 1CSQA 1D8LA 3ULJA 4DUYQ 5C4XG 3UDFA 2ZTCA 5C44G 3F1ZA 4OX9L 2F4VL 3DM3A 3I7FA 4R1JA 1EQRA 4A3EH 1Q82C 4DR2Q 1K9MC 2HQLA 1QZHA 3KF6B 5FLXc 4DV3L 1K8GA 4Y52H 1UWVA 4MTNA 2IY5B 1PH3A 3HKSA 4X62Q 5IYBG 1N9WA 2ASBA 2N8NA 2D62A 4DK6C 3I2ZA 3FHWA 4DKAC 3I4NH 3DLLA 2HT1A 4KHPL 2ZTEA 1VQIA 5M5XH 1XPRA 1OTCA 2FXQA 2JA8G 1GD7A 4YCUA 1PFSA 1VQCA 4NXML 3MXNB 2K52A 1XNQL 2R92G 3GTOH 5M5WH 1K8AC 4JI5Q 4A3GG 4JI0Q 1HZBA 4A76A 2N3SA 2R7DA 2YYZA 1B8AA 1ASZA 4JBKA 1KRTA 1P16A 3FP9A 4R4TA 1XMQL 1X65A 4BY1G 5FJ8H 3KDFB 5IYBH 4A3KH 2I5HA 3U4ZA 1G51A 1EQQA 4RMFA 1EOVA 2OQKA 1YJ9A 1YZ6A 1IYJB 4BA2I 1PV4A 3RLFA 2D0OA 2AWOA 4JI4L 3S2HH 2R92H 1YIJA 2VW9A 3BU2A 4BXXG 1MKHA 3HOYG 5C0XI 3GTMH 2JQOA 2VQFQ 1MJEA 4A3MG 3F2CA 2UUBL 1PH8A 1OXVA 2CKZB 4OONA 2K14A 4A3FH 3PO2G 1HNWQ 3I4MH 1HZAA 2NVYH 2PMZE 1E3PA 3J81i 3CF5A 1K83H 2JJQA 3G48A 3HOUH 4A3BG 2KBNA 4LFBQ 4OXPA 1L2FA 4DAYB 4A3LG 5HY6A 1QVCA 1NBWA 5IYDG 4DR4L 4A93G 1Z47A 3IRBA 4AQYQ 3CCUA 4LFCQ 2DUDA 1B7YB 4DPGA 3OW2A 1KIXA 2YV5A 1C0AA 5IP9G 2YTXA 4DUYL 3F2DA 3UE1A 2NZOA 1K0RA 3KF8B 1FJGL 3WWVA 5IP7G 4OX9Q 2F4VQ 5EAYA 4HJ9A 4A3BH 1E24A 1QVGA 2ATWA 2JA7G 2JA5H 2Z0SA 4LF7L 3HOWG 4DV3Q 4LF4L 1Q46A 2UXCL 3T1YL 1NE3A 3EIVA 3GTLH 1YHBA 4GLXA 4A93H 2ZJQA 4HJ7A 3RZOH 4JI8Q 4K0KL 3T1HL 2VS1A 1E22A 4LWCA 4A4IA 3PSIA 4OWXB 1J6QA 3CPFA 2WB1E 3GD7A 4POFA 3M4OH 2EXDA 5GAGC 3S1RH 4KHPQ 2JA6H 1S72A 2R93H 3CD6A 2EIFA 5J3BA 2JEBI 1Q12A 4UP7A 5H1SE 4AIMA 2RHSB 4JBJA 2OQ0A 4NXMQ 1XNQQ 1E1OA 3BZKA 3OYYA 1N8RC 1I5FA 4BA1I 4A3CG 5M3FG 2VQEL 1VQ4A 4GS3A 4JI3L
chains in the Genus database with same CATH superfamily
4X66Q 3CCQA 1XMQQ 4DV4L 4FXGC 4FYDA 1B53A 1SRUA 3FVQA 1B3AA 1R9TH 4POGA 2RCNA 2EE1A 4IPHA 3X3NA 5AJ3L 1SYEA 4O42A 4PMWA 1BCPD 1R9TB 2HDLA 3M9BA 2F03A 2FJ2A 4LUOA 1QUQA 1N36L 2B63H 2Z4HA 4IN3A 1LTTD 4EQPA 5IT9E 1GKHA 1SMXA 1TQOA 2CQOA 3MC0B 4RA8A 3P1HA 1E2ZA 1I4HA 2B2VC 2B63B 4J6HA 4OGQC 2O5IC 2JSOA 4A3EG 4YCWA 1SE8A 5E4XA 4DR4Q 2WIIB 3QB3A 5C0XJ 4PZ8A 2EZVA 2ICEC 4KI0A 3GDEA 3V96A 1YNNC 1IBLL 1MSHA 1NUCA 1ZYRD 4LF7Q 4LF4Q 4IZ8A 5FJ8G 3ITPA 3F2BA 3JAMc 3KDFA 3I70A 2EDGA 3Q0AA 2RCFA 1AZQA 2CWPA 4LF5L 2K28A 3CP0A 3KLWA 1YJNA 2D0PA 5D14A 5C3WA 1X6OA 2E2HH 2EVBA 1VQDA 1TS4A 3J81j 1CI3M 1LYLA 3T56B 2KHIA 3K0YA 2E2HB 4HIMA 3VA5A 1M90C 5DM73 1X55A 2MUYA 3SGIA 5JEAH 3PUYA 3N6RA 5ELCA 2M2LA 2VNUD 4IO9A 2RKSA 3MFYA 2Y0SB 1GUOA 1NY4A 1U4RA 3L9AX 3P20A 1GUWA 5IODA 4JI7Q 1IBKQ 1WI5A 4PQXA 1EFWA 3ICEA 5IGCA 1F77A 4DV5Q 2EYJA 1ZYRC 5G3LF 1KD1C 2A69D 4CJ0B 4GNXC 3D3RA 3TS2A 1BQQT 1PFMA 1Z9FA 4P73A 4LNQA 4DXGA 1CZGA 3E9IA 1EU4A 4H02A 2R93G 2JA6G 1Z6HA 1HNZQ 1X3FA 1EEID 4IOCA 3DWPA 2UU9Q 1M4VA 5FLMH 1HJPA 2IW3A 4B3TQ 4OWWB 2PNHA 2MO0A 3PO3G 2JYOA 4JG2A 3GV6A 3M4QA 3AYHB 1KHIA 1WJJA 2JA7H 3H3VC 3S1NH 2EYOA 2R7ZH 5FLXL 1IBML 2CQAA 2JA7B 3VR5A 3S1NB 2R7ZB 3IL8A 5T1GA 3NBHB 2Z6KC 2RF4A 2MFIA 3Q22A 1N34L 4A3JG 4B3SL 4S3SA 1SE2A 2ES2A 2F0FA 5GROA 4C3HH 3DXJC 2AQ2B 2NYZD 2ZJRA 2A69C 4GZYC 2N88A 3STBD 4RH6A 4C3HB 4LAAA 4X64Q 1XPOA 1VMCA 4F7XA 5ELNA 4QIWB 1AP0A 4Q5VA 1SNPA 3RNUA 1Y8NB 1SNMA 2LY7A 2WB1G 3HOVH 1PTOF 1ZKOA 4UP9A 3KLRA 3HOVB 3W2DA 2A68D 3PUZA 4H13C 4AYBB 2C35B 4KJNA 1LM0A 5JOBA 2WKCA 2EXZA 4BY7H 4C1NK 4B3RQ 3GTGB 2BA0A 2PO4A 5IE8A 4LF8L 2NN6I 4BY7B 1BNZA 1KTKA 4A3IG 4K14A 2KCNA 4RGOS 4R4IA 4NW2A 2K5DA 1Y8PB 1SJED 2PQAA 1TY2A 1A15A 3S1MH 1RTNA 3CC7A 4XYQA 2IT1A 3OIPA 4XQJA 4ZUIA 1DYQA 4O0AA 3S1MB 2EYHA 2OTLA 3DWQA 3STBC 1I94Q 1EUJA 1F2YA 3TP5A 2K33A 1WYDA 2L1BA 3TP6A 4GOPA 1A8VA 1K3BC 4QB4A 3PIP3 1K0SA 2MP1A 2UUAQ 2EQSA 1CK1A 1FYCA 2FINB 2YTVA 2A68C 1I4GA 1VF7A 3J80c 4WJWA 1TT2A 4LF9L 1CKNA 3KYHC 3C1FA 2NN6H 2G9HD 1KRSA 4HSPA 4KHZA 4XIGS 5C4XH 3RN2A 5KNDA 2MQHA 2OCEA 5HGQA 4I7AA 5F2DA 5LL6X 2Z6BA 2L15A 3QG1A 5C4XB 4EQNA 2QDBA 1DM0B 1YNJC 5BR8L 2K5QA 4NXNL 1YEZA 4DV1L 4K5WA 4R4OA 5L37A 4YY3Q 2J4XA 5JVH3 4IUVA 3T13A 1BBUA 2F0EA 1L1OA 4LFAQ 4JI2Q 1PH6A 3NSWA 4QY7A 4C3JH 1VQ9A 3D4RA 3MXGA 2K5NA 1MSGA 3PIPA 4BY1H 4C3JB 1A63A 2QKIC 5K5PA 1NMFA 1KAWA 1LTAD 4RG1A 2CW0D 2A73B 2L5TA 1K73C 4BY1B 2AUKA 1QG7A 1SFOH 1VQKA 4IUTA 3GTPH 3OHXC 3MXUA 4RGMA 1JT8A 1SFOB 3GTPB 4DR3Q 1HQMC 2B2YC 1RL2A 4OWTB 3PO2H 1HR0W 3JAML 3H91A 4G7OC 2KEDA 4ZQ3A 1LACA 2XGTA 4X3SA 3PO2B 4QGUA 1PVOA 4KHVA 2X6LA 4XDXA 1QNUA 3G71A 1HH2P 1LLRD 4UP8A 4HIKA 3A7LA 1IKLA 3L3OC 4TVAB 1Y1WG 2DJFC 3HOXG 4IUNA 3BS1A 1HNXQ 1U4LA 3D8GA 5IP7H 4P75A 4OIJA 1W2BA 1EY6A 2OTJA 3QJYA 1SAPA 2CW0C 1CKOA 1PZJD 3K57A 3HOXH 5KYIA 4DR6Q 3HOXB 3E9HA 3BYTB 2VQFL 4EVOA 3JAMi 3F2UA 2EY2A 2K5WA 3UDXA 3EA6A 2K6AA 3BJUA 1Q8IA 4L6TB 2XTIA 2RBMA 2WAQE 3R93A 1Q90A 4BBRG 1GOZA 3KBGA 1Q1BA 2B29A 4YCVA 4LFCL 3BDLA 1KABA 2BH2A 4Z9CB 5E7NA 4YIJA 2AKWB 3S16H 4OO1I 1IL8A 2ZTCA 2SOBA 3DM3A 4DA2A 3S16B 1EQRA 4RKBA 4DR2Q 2PZWA 5E3FA 2ASBA 3I2ZA 3FHWA 3DHQA 3EROA 4DKAC 2F0PA 2HT1A 3ONAB 1SSOA 4KHPL 3OMCA 1VQIA 2ZTEA 2A5HA 5I6YA 2DN8A 3SK6A 1CFMA 1PFSA 4NXML 3MXNB 2K52A 3GTOH 5M5WH 2WV6D 1HZBA 4A76A 2N3SA 4JK1C 2KECA 1P16A 2QEJC 1H9RA 3GTOB 1X65A 5M5WB 3KDFB 2JXMB 3U4ZA 1G51A 1YJ9A 2EJMA 1V1PA 4BA2I 1PYWD 1I4XA 3K5OA 3EFXD 3K5LA 1EYCA 4JI4L 1YIJA 2VW9A 3BU2A 3HOYG 4OO1H 2JQOA 2K1BA 1FNVA 4DK1A 3F2CA 2UUBL 1PRTB 4A3FH 1HNWQ 1SEBD 1ZXTA 2FFKB 1E3PA 4G57A 5C5LA 4A3BG 4IUPA 2KBNA 4A3FB 4DAYB 1TY0A 1HA5A 1EEFD 4UHVA 3IRBA 4F88A 1GUTA 1EU3A 3KBXA 1K8MA 4CJ1B 3A8KE 4DPGA 1BDOA 3V2TA 2NZOA 4M1UB 3VR2A 1WTQA 4JPBW 4OX9Q 4A3BH 1QVGA 3SK8A 2SDFA 4XQQA 1WD1A 4N8X1 2UXCL 4CDFC 4A3BB 2ZJQA 1EOTA 1T5EA 1LABA 4OWXB 3CPFA 3S1RH 3CD6A 2JEBI 5AFWA 1PFBA 4UP7A 2OXPA 4JBJA 3S1RB 3J80L 1E1OA 3OYYA 3QO2A 1RF2D 5EPKA 4A3CG 2IX3A 4ZAIA 2VQEL 4GS3A 1LTSD 3SHLA 3NE5B 2NVQH 4X6AH 2EYFA 2PMZB 4ZYSA 4PZ6A 1HCZA 2NVQB 3EN2A 1VQ8A 3CAMA 4C1NI 1EYGA 4FDBA 2MNAA 3GQBA 4MN3A 5GAHC 4LK1C 1SBBB 3K58A 1WTVA 1HUNA 4FF1A 3OTOL 5K36H 1SNCA 2RSNA 1NR4A 4K8JA 3SDZA 2YTYA 1SN8A 2B3GA 2F3VA 1O7YA 2RSOA 3CCMA 2ICIA 2AHOB 4JI1L 3I4NG 1B4OA 3NUCA 2Q8RE 1SLJA 2VY3A 5BN4A 1YBYA 4GN3B 3PUXA 3J80i 1XYIA 2L0CA 2LS01 1DOKA 1FJGQ 4CDDC 1EZ8A 1ESRA 1EQVA 5FO7B 5LHY1 3R2IA 3T1YQ 3MXPA 2EY6A 4JI8L 4A3KG 2NBFA 1IZ6A 1VQPA 4K0KQ 5IGEA 4HJAA 5CGKA 4FXDA 1YITA 4QCLA 2HCCA 3QOJA 4LW1A 1WTXA 4DV2L 1LT3D 1CT1D 2PYKA 3FDTA 1VQLA 4JOIC 1MHWC 3FKIH 4XT1B 1VQEA 4ZKBB 1XMOL 4P74A 3S15H 1X54A 3FKIB 4JV5Q 3I4MG 5LMNL 1Q81C 3S15B 1H9JA 3HOUG 1MI2A 4GOPB 4YWLA 2VB3X 4UPAA 5CBAE 1IL2A 3M4PA 1EL0A 3RLOA 2HD3A 1I3QH 1HFNA 5IY0A 2RDFA 1GJXA 1I3QB 4FO2A 1JJ2A 3HGBA 1RD9D 1XNRQ 4CGYB 5M3MH 1V9PA 2WACA 3A0JA 3D4DA 4I7ZC 4LUVA 4ME3A 5CR3A 2JA5G 4QF4A 3NQIA 2B2WC 5M3MB 5CV9A 4DUZQ 3HRZC 2F0WA 1VS0A 2Q2HA 4XQNA 1WCMG 2XWBB 3BYYB 3QWNA 2WP8J 3RUZA 5CV4A 4JYAL 3I90A 2LXJA 5C0XG 1B9MA 1XPUA 4WJ3M 1HPCA 2FMMA 1U0LA 3HKZE 5IOCA 1LTLA 1PYSB 3O13A 1E1TA 2K5HA 1W6KA 3T16A 3MFGA 4GN4B 1WCMH 3Q24A 1PMRA 1STBA 4WJ4A 3J81c 5IIFA 4DR5L 1CA5A 5IGDA 1WCMB 4B3ML 4XYOA 4KD3A 1V1QA 1YNND 5JJKA 1O78A 1CHQD 2ZM6L 3RR5A 3VA7A 5EBDA 2B63G 4IQZA 1N33L 2Q8IB 3SXHA 2WFWA 1S5DD 3PUVA 3D0FA 4IURA 1VQJA 3NP8A 2B2UC 4NPSA 5A35A 1K28A 3I55A 2K5VA 3MA2B 2NB0A 3QOLA 4QMGA 4LJZC 1NJIC 1DOLA 1B70B 2SEBD 5EPLA 2RA4A 3K8AA 3TQYA 1DD2A 4K6LA 4MZ9A 4PMCA 1XX8A 1RTOA 1V43A 5IWAL 5LMUQ 3U9SA 4HR7B 2KHJA 4TQUS 2VZAA 4L5TA 4GKKQ 1VCIA 4DV1Q 4JBWA 2KENA 3MAQA 2O2LD 1KXLA 4DV0L 4LF6Q 2MO1A 3P75A 3SK5A 4XTCS 1QB5D 1GHJA 4V190 1H95A 4R8NA 2B8GA 1FNUA 1PRTF 2B2VA 2K4KA 3UI2A 2E2IH 3AFPA 2VUMH 1P8LA 3OOCA 2E5LQ 1OXXK 5FK9C 1VMPA 2D9UA 2VUMB 2E2IB 5JEAG 3PV0A 2Y0SG 2CH4A 4DV7Q 4ZKCB 1SYBA 2UXDL 3CCRA 1O80A 1Y1VH 2LKVA 1N32L 4RWSC 1B1ZA 3WOFA 1Y1VB 1HR0Q 5C3EH 4K6DA 4GKJQ 2QEXA 1T5XD 3PCOB 4JI6Q 1PYBA 5C3EB 3S2DH 1TKWB 4WRDA 2BA1A 1SNDA 3KFUA 3EQLC 3AEVA 1Q7YC 5C44H 2NTSA 1LTID 4YHHL 3S2DB 1ENAA 4X65Q 4HIDA 3C46A 1GUGA 4DR1L 2GN5A 5C44B 2Q8TA 2IJ0A 2GVBA 4L5SA 3DEOA 3IKJA 5KYLA 5FLMG 3LNNA 1QILA 1BBXC 4DV6L 2QF7A 1KDCA 1IYVA 3NWTA 4P72A 5M5YH 1H9MA 3URYA 1BKBA 4JCVE 5M9OA 3CC2A 2JA7G 4UDUC 3E6ZX 4H44C 2OWOA 2R7ZG 2Q2IA 2K05A 4K5XA 3W5OA 5M5YB 3ER0A 1BXTA 5GAEC 4DR7L 2KJXA 4KKTA 1JOKA 1SYFA 4J1MA 1FR3A 3TREA 5I4DA 2CH4W 3ULLA 1BR9A 2UXBQ 5JEAJ 3EVQA 4C3HG 1PTOD 1BUVT 1AE2A 2ALYB 1ICWA 4GNXA 1J5EL 4BXXH 3R2TA 5HURA 4A3MH 5I2XA 5E4WC 1JWMD 3HOVG 4M8AA 3AU7A 1GO3E 2VL6A 4CJ2C 4A3MB 1UAPA 2E74C 5J39A 2R7FA 3GO5A 2UUCQ 3PF4A 1DXMA 4AYBG 2R6GA 1DJRD 1JJGA 1PZKD 5IYDH 4X62L 1E7ZA 3E0EA 4KN4C 1JOQA 3MHBA 1PFNA 1QCBD 4BY7G 3I3CA 1QZGA 1LUZA 4A93B 4R4CA 1A2UA 5IP9H 1NMGA 3PF5A 1WTRA 2Z8LA 2J7ZA 4JI5L 1UE1A 2QILA 2K50A 4WORA 3SK4A 5KEEA 4XXEA 3GTGH 2Z6KA 4A75A 3ERSX 4PMBA 3L7ZC 2GA4B 4FF3A 1XTDA 1PTOC 1T9HA 2P5ZX 1AH9A 1FNWA 3GTJH 5KGUA 4ZRZA 3KLSX 3GTJB 1YNJD 1LO5D 1JC7A 2D5DA 2BE5D 3MEHA 4B08A 4LFBL 4ABNA 3E3XA 5DNFA 3J80E 4GOPC 1BO0A 5EKKA 5I2YA 4IJLA 1WVLA 3K5MA 2HHHQ 3G7LA 1Q1EA 1O7ZA 2NN6G 3J7AF 1G6ZA 1D8LA 4KMUC 3ULJA 5C4XG 2F4VL 2BDNA 4H7BA 3VR6A 3I7FA 4QQBX 2HQLA 3VR3A 3KF6B 4DV3L 3J81L 4MTNA 3AB9A 1PH3A 1G2SA 3GV3A 5IYBG 1N9WA 2A74C 2D62A 3DLLA 1B3QA 1XWEA 5LL6S 5M5XH 1XPRA 5CC4A 1IKMA 2DNCA 3ND9A 5M5XB 1VQCA 3T51B 2R92G 5HGTA 3TDQA 4JI0Q 2R7DA 4C3JG 3FP9A 4R4TA 1XMQL 3X3MA 4BY1G 5IYBH 5EKLA 4ZLTF 2I5HA 2QW7A 2BE5C 1JORA 1E2VA 1D1KA 1YZ6A 1IYJB 1AN8A 4FP5D 5KRUA 1RDPD 2WAQB 1PV4A 3RLFA 4QUCA 3I91A 3LX0A 2R92H 1EYDA 1QE6A 4EGVA 5JPNC 2AUJD 5ELFA 2XN9C 4CHTB 2R92B 5C3XA 3PO2G 3BDCA 2F0OA 3J81i 2NWGA 4OXPA 1ML0D 4DR4L 1EIHA 4AQYQ 3R3OA 4KKUA 5C4HA 1B7YB 1KIXA 2YV5A 1EY9A 4DUYL 1ET6A 2YTXA 3UE1A 1K0RA 2E76C 3KF8B 3WWVA 5IP7G 2NTTA 5T1IA 2ATWA 4LF7L 4LF4L 4JVZA 1NE3A 1DONA 4KJOA 5J22A 4JI8Q 4LWCA 4A4IA 3NPPA 2WB1E 2EXDA 5GAGC 5A2QE 5J3BA 3C2PA 5C4ZA 5H1SE 4AIMA 1XNQQ 1X32A 1N8RC 1RJTA 5M3FG 2E2JH 4X3KA 2B2YA 1GM5A 2K04A 2E2JB 4OEMB 3D6CA 1VQGA 5CV5A 4G7HC 2JE6I 2BH8A 2IHEA 4GN5A 3G6EA 2VB2X 4O2DA 1EY0A 2F0MA 1NTGA 1Q3LA 2YU9H 2L11A 4IPCA 3CCJA 5M3FH 3UE0A 1E0BA 2JEAI 2YU9B 4JI7L 1IBKL 3IFDA 2NZHA 3VDYA 2F0HA 5M3FB 4IFDI 1JE4A 4DV5L 2IX0A 1I4PA 2LMCB 2RDGA 4BBSH 1VF5C 2K75A 2F0QA 3NTIA 4JBMA 1U4PA 4BBSB 1QUQB 1O7IA 3CW2C 3TS0A 3H15A 2V1CC 4A3DB 4EX5A 3T4AC 1HNZL 1EWIA 4ILWA 1SXTA 2RHQB 2KA7A 1G8ZD 2I0QA 2UU9L 2KCMA 2L9HA 1JB3A 2NZ1D 4B3TL 1ICFB 3FRPB 2MHVA 2F0VA 3RZDH 2EYLA 4LMQD 2F52A 3KLSA 3T1HQ 1BF4A 4ALPA 5C4JH 2B2TA 4RCNA 3RZDB 1Q8KA 5IYCG 3PUWA 5BN5A 5C4JB 4KV6A 2B39A 1D7QA 1B9NA 3H09A 3ULPA 4OO1G 3QR8A 1YJWA 4JI3Q 4IFDH 3A5UA 4A3FG 4DV4Q 3ND8A 3AMUA 3N52A 3U50C 4EQ5A 4IALA 5AJ3Q 4X64L 2NVXH 2FHTA 2QCPX 3SR1A 1JR0D 3HOZH 5IYCH 1QVFA 3A7AB 2HQEA 1J8IA 2NVXB 4R4QA 1X3GA 3K0XA 4CKBA 1N36Q 3HOZB 1MJCA 3OSOA 2MPMA 3W1GA 4DXFA 3D31A 3GTKH 4TKOB 1F9QA 2NUCA 4IUQA 2LSSA 1RIPA 3I4LA 5C6AA 1UEAB 3GTKB 3CCEA 4B3RL 4N9TA 1H9SA 1SDFA 1B44D 1BCPB 2JN4A 3A74A 3J7YW 3PGZA 1PH7A 3CHBD 4N8FA 1FD7D 1S5FD 2IX1A 2L12A 1IBLQ 4IFDJ 1D2BA 1TXYA 2XWJB 1AE3A 1VQ6A 3H94A 3NBHA 3U4VA 2F0SA 4GLVB 1YI2A 2CWAA 2DGYA 1I94L 3TP8A 1JOOA 2PZTA 1I50H 4NKLA 3K6OA 4LF5Q 2CCZA 1C4QA 4K8IA 2UUAL 1I50B 1A3UA 2N78A 1X56A 1HTPA 5K36G 2Z9HA 3M7GA 1A3TA 4HJ8A 1LTRD 2H5XA 3I56A 3J7A5 4DK0A 3HS0C 3UDGA 5DLQE 1BVSA 2K03A 3NXWA 2D2CC 4ODGA 2XSCA 5FKAC 4DR1Q 2X69A 5FLXE 3HKZB 3Q8DA 2IL8A 4YY3L 3CCSA 5CV6A 2EYPA 1WTPA 1GVPA 2KCTA 1YVCA 1LT4D 4LFAL 4DN4M 5KIXA 4DK3C 3QIAA 3GTQH 4QUFA 2CFMA 1IXRA 2V4DA 3FKIG 5JJLA 4OIKA 3GTQB 1U9RA 3KJOA 3NELA 2ZXOA 1D1IA 3TN2A 3DEPA 4HIOA 2PNRC 1Y14B 1SJHD 2QDLA 1WTHA 2HCIA 5J1ZA 3GP7A 1FVIA 3L0OA 2RVLA 1NNXA 1IBMQ 2PQAB 4IUUA 4DR3L 2HIXA 2TMPA 2EJFC 2QA4A 5LMNW 1A6XA 4C3IH 3J7ZC 3ZJYC 1OXTA 1TWHH 1N34Q 2G9DA 4B3SQ 2IPKD 3CRKC 4C3IB 1I6VC 5M3MG 1TWHB 1UE7A 5ELOA 3ZYYX 2Q2UA 3H0GH 1JMCA 4HTHA 3G6JB 1Y8OB 1HNXL 4NB3A 3H0GB 1D5ZC 1L0WA 3D6WA 3OPOA 3CCVA 4C2MH 3NWSA 4WFN3 1PDQA 2K32A 4JOIA 2QGQA 2CVRA 1K8OA 4HEDA 4MNOA 1CKNB 4C2MB 2A1AA 1PH4A 1YHAA 2HDMA 1HFGA 3NTHA 4LUZA 4P71A 1JB7A 1ESFA 3U58A 2JA8H 2I07B 4LF8Q 3TEHB 4DR6L 4A3GH 3J81E 3LWEA 4FF4A 4V0BA 2JA8B 1G91A 4HN7A 5KNBA 1VDZA 4A3GB 3FMCA 1KC8C 3W3AA 3M3YH 2HUGA 1HRJA 5I6WA 1YHQA 1VQ5A 4Q0FA 3U9OA 3M3YB 1L1OB 1ENFA 3A5ZB 1I6HH 2B2WA 1R4PB 1I4QA 1Y69U 1PA6A 1I6HB 2XRSD 1H9KA 1F9RA 2HIVA 4IPGA 4DR2L 4OELB 3TMEA 1D6EC 2LXKA 4A3LH 2ZJPA 1CQVA 1SE4A 4HJ5A 2A8VA 2F4IA 3EBEA 4LF9Q 1LV9A 1CHPD 2E75C 3J7AV 3CCLA 4IJHA 3VYSA 3S14H 1PRTD 5CORA 1K3RA 3HOWH 5CV8A 3K7UC 1MD2D 2F0UA 3S14B 1ET9A 1I4RA 5JPMC 3MEFA 1SYDA 5BR8Q 3MTSA 3HOWB 4NXNQ 4QL5A 4L5RC 3B6YA 1W6JA 5GADC 1KDAA 3HFZB 2VUMG 4ME5A 3JAME 1S4ZA 1KLUD 4RGNA 4DGZA 3NENA 3M4YA 2B2UA 4H0LC 2EYMA 3I72A 4NP5A 3M85A 1PXUA 1CZWA 1C7YA 1G291 1DCZA 2R61A 3SEBA 1STNA 2DY8A 1HNWL 4U673 1TWAH 1Y1VG 1QWYA 4DNIA 4DNTB 1GHKA 4TSSA 1TR5A 2XIWA 1HHVA 1TWAB 5C3EG 1OXUA 2F0LA 3CRLC 2C5CA 1SMYC 3F8TA 1V1OA 3K7AH 2EY1A 1JE5A 1PLFA 2SNSA 5IT9c 5JJIA 1X3EA 5G3LD 4OHJA 3K7AB 1BCPF 4DUYQ 1QNKA 5C44G 2ZXRA 3F1ZA 4OX9L 1PRTC 1LT5D 4R1JA 3MXNA 2FMCA 4A3EH 1QZHA 1A3VA 5IGBA 3EJIA 2OF1A 4A3EB 3V05A 2N8NA 1GUNA 1SYCA 3IFTA 1OTCA 2F0NA 1BCPC 3FPPA 4KD4A 2BDOA 1K8AC 2YYZA 1B8AA 4JBKA 1KRTA 2KCCA 3WOEA 5FJ8H 1EOVA 5ELEA 1STYA 1GXDC 1KLGD 5IGFA 2AWOA 4DAYA 4DU9A 2BOSA 1LT6D 3S2HH 4BXXG 1MKHA 3RMHA 4DFAA 2VQFQ 4A3MG 3S2HB 4ZUJA 2CKZB 4HSVA 4ZK9B 3R8BA 3BVMA 1HZAA 3T53B 1V1PB 3CF5A 4K5VA 3G48A 1NBWA 5IYDG 4A93G 1JICA 2OEOA 3CCUA 3NTKA 2F1MA 4LFCQ 2DUDA 1CM9A 2O4XA 1C0AA 4U68A 5IP9G 2O5JC 3TSSA 1FJGL 1X3PA 5EAYA 3D4WA 4X3UA 1M8AA 5KNCA 1E24A 3S9WA 1STGA 1H9SB 2Z0SA 4G4KA 2B8FA 2WINB 1Q46A 3T1YL 4B9WA 1YHBA 4GLXA 5DAUA 4A93H 1R4QB 4KY5A 4K0KL 4PNYA 1RHPA 2VS1A 3PSIA 4PV1C 3M4OH 4KHPQ 3FEWX 3GD7A 4POFA 2R93H 2JA6H 1RKNA 1S72A 4EQOA 1Q12A 1PZID 1TVXA 3M4OB 2RHSB 4NXMQ 2R93B 2JA6B 4BA1I 5DEHA 2M00A 5D3DA 1VQ4A 3NK9A 1RODA 3HP3A 3M7NA 3SE0A 1QOHA 1VQBA 2KEEA 2PZUA 3SVMA 3BZDB 3PO3H 4JV5L 4HCEA 3Q23A 3UDIA 4KLKA 3PO3B 1JJCB 1EWCA 1IW7D 3I8ZA 1AZPA 4RCOA 3S1QH 1FL0A 1F2MA 1EY5A 1HZCA 1TS5A 4FF2A 1EQTA 3TBIB 4JI4Q 1CSPA 3S1QB 4CBVA 5EJWA 2PPBC 2Z4IA 3ERQA 2F0JA 3CMAA 4A3JH 2UUBQ 1BOSA 1XNRL 4B9XA 3FPUB 1IHZA 1VQFA 4MTKA 4QJFA 4A3JB 2CHBD 1EWHA 4DUZL 1D5XC 1ILQA 4KK7A 2Y0SE 5JAVA 3OW7A 4RKLA 1WOCA 1VQAA 4J8QA 5CV7A 3CC4A 4RGTA 1CQFA 1S3OA 4J15A 1WFQA 2WB1B 1STAA 3S17H 2A6ED 4FVMA 4K2KA 3TZUA 1AEXA 3S17B 1UUPA 1W3SA 1SNOA 3MWYW 2JA9A 2UXCQ 1EIGA 2OT2A 2PI2E 3Q6SA 3TRZA 2WAQG 1KNEA 3E0JA 3K5NA 1TIID 1IW7C 5TSSA 3S24A 1XJVA 4DAMA 5EPJA 2H4OA 4A3IH 2F3WA 4DAPA 3P7JA 3L2PA 5D65A 4O1NA 4A3IB 1TWCH 5I9PA 1ENCA 2VQEQ 4X66L 2N49A 2F0GA 1TWCB 4Y52H 5I9OA 1TWGH 1C48A 4APVA 1L1OC 5EQ0A 1UEBA 1QJOA 1TWGB 1WTWA 3RLNA 3K81C 4BWGB 5ISRA 5CMDA 1J9OA 3OWEB 3KUPA 1F2ZA 4IPDA 1EY4A 2A6EC 3IAYA 1A62A 4GLAC 3OTOQ 1SROA 2K7VA 5LMUL 1SR3A 2ZXPA 4L5QA 5COYA 1VQHA 2IHFA 3DWAA 4GKKL 4QIWE 2JP1A 2PW5A 1S5CD 1KL9A 4JI1Q 1DGSA 4LF6L 4FNFA 2KUMA 4AH6A 3MZ5A 1FGUA 1VQOA 1PH1A 1G2TA 5CYUA 4AYBE 2ZTDA 1TWFH 3BVZA 5IT9L 1F9PA 1TU2B 2I5MX 2E5LL 1EIFA 1TWFB 1UE6A 3PIO3 5BN3A 3BZCA 4DV7L 4DV2Q 1S5BD 2H1EA 2ENBA 1U5KA 4KY6A 4RHSA 1KAAA 1A0IA 1Q86C 1XMOQ 1NAPA 2VXWA 1PH2A 4NMZA 1CA6A 1HR0L 2PQEA 2AMCB 3KOJA 4RHRA 4GKJL 5LMNQ 4HAEA 4BBSG 4R8IA 4JI6L 2R3ZA 5DM63 1U4MA 4HMIA 4A3DG 3RN5A 3I73A 3CPWA 2RQXA 1D5MC 3CU7A 1X9NA 1C9OA 2NVTH 4X65L 2F0KA 4MIUA 1II3A 2Q2TA 1HXYD 3G4SA 3KJPA 4L63B 3KK7A 2NVTB 1DZ1A 1F9SA 1WTOA 3RD4A 1MBYA 5JJZA 4UY8C 4A3DH 4PZ7A 2G5DA 1Y1WH 2KOLA 1JWUD 4YWMA 3NHHA 3PIOA 2EJGC 4KN7C 1Y1WB 2E2DC 1PH5A 1PHJA 1WD0A 4JYAQ 2A6HD 3CXCA 1VQNA 4C56C 2EOTA 3C1EA 3HEJA 3HZXA 4IFDG 2UXBL 2B2TC 4R9WA 1VQMA 4YWKA 3AFQA 4HMJA 1E2WA 3NEMA 4ULLA 3CKIB 2I5LX 1EFID 1GUSA 1AFPA 1HZ9A 4F87A 3HOZG 4CKEA 4DR5Q 1S40A 4B3MQ 5GQOA 5EBCA 1MIUA 2ZM6Q 3MVVA 2UUCL 1KNAA 3NBIA 1N33Q 3PMFA 1HTLD 4BBRH 1AW7A 4F8MA 1BBWA 1UE5A 4IOAA 1YNXA 4BBRB 3PQIA 4JW0A 3A55A 3E5SA 3H6MA 5EKIA 1OXSC 2AQ1B 2PI2A 5C5MA 3K80C 2M9VA 1ZEQX 2A6HC 2F3IA 5IWAQ 2ZT9C 2AQ3B 5ELDA 2TSSA 4E6IA 1HA6A 4DV0Q 2WKDA 5FO9B 2JK8A 3I4OA 2BCOA 2ID0A 1LTGD 5FOBB 2F0DA 1G6PA 2DY7A 2KHSA 2EPBA 2MJ8A 2PW7A 4KKSA 4OL7A 5FO8B 4RAUC 5NUCA 1VQ7A 1RCVD 3HG9A 3H3VI 1XXGA 3AQQA 2E8GA 3A56A 3HOYH 4DAVA 2HHHL 3LGJA 1EIYB 2AWNA 3HOYB 2UXDQ 1FGBD 3BVGA 2IWHA 4KY7A 3CQZH 4Y7NH 3JC66 1DOMA 1N32Q 3CMEA 3HKZG 3CQZB 4Y7NB 4GNXB 2GVAA 1HQRD 1V8QA 2RDHA 3DM1A 4X3TA 5JVG3 2C9OA 2DNEA 1L0YB 4CDEC 1ASYA 4XT3B 4N9PA 1XTCD 1KDBA 4K2LA 1NSNS 2SNMA 4PG3A 2A19A 4YHHQ 4JI0L 4P2CB 2K01A 3VR4A 1TS3A 1CUKA 1ONLA 4CDCC 2KQ3A 1CKMA 4RFBA 3W1BA 1KQSA 1X3QA 3H3VH 1EYAA 3A8JE 4DV6Q 3OMGA 1HUMA 1C8CA 1SNQA 4JI2L 1MGSA 1PH9A 4JC0A 3OIQA 4A3CH 3A54A 2XRQD 4DR7Q 1S5ED 3A8IE 1M1KC 3DUZA 2XNAC 4C3IG 1O7LA 2J0TD 1NCVA 4L8JA 3KF6A 4NDXA 3BDOA 4AQYL 1SYGA 1JQYD 3LWUA 1J5EQ 1UNSA 3H0GG 1A2TA 1CSQA 5EGTA 3WDNA 3UDFA 1STEA 2F0TA 1B2TA 2I46A 3K59A 1Q82C 1K9MC 1K8GA 5FLXc 1UWVA 2IY5B 1PTOH 1SE3A 1LTBD 3HKSA 1EZ6A 4ID6A 4X62Q 4DK6C 3I4NH 1NR2A 1PTOB 2DJGC 3VYUA 3OWFA 2Z1CA 1B50A 4ZCKA 4BS9A 3I4NB 2FXQA 2JA8G 1GD7A 4YCUA 1XNQL 4CKCA 2LFNA 1Z7TA 4JI5Q 4A3GG 2XVSA 1JCKB 1ASZA 4MHEA 4DNRB 2F0IA 4KTAA 5D3IB 4A3KH 1EQQA 1L0XB 4RMFA 2OQKA 2N55A 5E1FA 2L55A 1ILPA 4TRDA 2EY5A 4A3KB 2X6GA 2D0OA 5C0XI 3GTMH 3TZDA 1STHA 1MJEA 2L4NA 1PH8A 1OXVA 4OONA 2K14A 5A2QL 3GTMB 3I4MH 2NVYH 2PMZE 1K83H 3KF8A 2JJQA 3HOUH 3BG3A 4LFBQ 1JWSD 1L2FA 3I4MB 2NVYB 4A3LG 5CBEE 5HY6A 1QVCA 1K83B 1Z47A 1OO9B 3HOUB 3NQTA 1EY8A 4HCSA 3TP7A 2PCFB 3OW2A 3VYTA 3VYRA 4UAIA 3F2DA 2F4VQ 3DMUA 4HJ9A 2JA5H 3HOWG 4DV3Q 3GTLH 3EIVA 3C3LA 4HJ7A 3RZOH 2JA5B 1SMYD 3T1HL 1TS2A 1E22A 2MGSA 4G7ZC 4DF7A 3GTLB 1EY7A 1J6QA 5ELBA 1IYUA 3RZOB 5IGGA 2EIFA 4FXKC 1CTMA 5C0XH 2OQ0A 3BZKA 1F2LA 1I5FA 4I65A 2KVMA 4JI3L
chains in the Genus database with same CATH topology
4X66Q 3CCQA 1XMQQ 3M7NA 1GM5A 1VQBA 4DV4L 3PO3H 4JV5L 1SRUA 2NVQH 1R9TH 4POGA 2RCNA 1VQGA 3UDIA 4IPHA 4X6AH 5AJ3L 4KLKA 1JJCB 2JE6I 4PZ6A 2BH8A 2IHEA 4PMWA 4GN5A 3S1QH 1FL0A 1HZCA 3M9BA 3G6EA 4O2DA 3EN2A 1VQ8A 1NTGA 3CAMA 2YU9H 4JI4Q 1CSPA 4LUOA 1EYGA 1QUQA 4FDBA 2MNAA 1N36L 2B63H 4IPCA 5GAHC 3CCJA 5M3FH 3UE0A 2JEAI 1GKHA 1SMXA 2CQOA 4JI7L 1IBKL 2NZHA 3CMAA 4A3JH 2UUBQ 3VDYA 1XNRL 3OTOL 4IFDI 4DV5L 2IX0A 4BBSH 1VQFA 4QJFA 2K75A 2YTYA 4A3EG 1SN8A 2B3GA 3CCMA 4DUZL 4YCWA 1SE8A 4JBMA 2AHOB 4DR4Q 2Y0SE 4JI1L 1QUQB 1O7IA 3CW2C 3TS0A 3H15A 1WOCA 3I4NG 1VQAA 2V1CC 3CC4A 1SLJA 2VY3A 4EX5A 5C0XJ 4PZ8A 1S3OA 4J15A 1EWIA 1WFQA 1YBYA 2RHQB 4GN3B 3PUXA 1HNZL 3S17H 4KI0A 3GDEA 3J80i 1IBLL 2I0QA 2UU9L 2KCMA 1FJGQ 1W3SA 4B3TL 4LF7Q 4LF4Q 2JA9A 2UXCQ 3T1YQ 5FJ8G 3F2BA 4JI8L 4A3KG 2PI2E 3TRZA 1IZ6A 2WAQG 3JAMc 3RZDH 1VQPA 2F52A 3KDFA 3T1HQ 4K0KQ 4HJAA 4ALPA 5C4JH 3S24A 1YITA 1XJVA 4DAMA 4QQBX 4A3IH 4LW1A 1Q8KA 4DV2L 5IYCG 3PUWA 2CWPA 4LF5L 3CP0A 3KLWA 1VQLA 4JOIC 3L2PA 1YJNA 2D0PA 3FKIH 1TWCH 1VQEA 1D7QA 1X6OA 3ULPA 4OO1G 1XMOL 4P74A 1YJWA 2VQEQ 4X66L 2E2HH 4JI3Q 3S15H 1VQDA 1X54A 2N49A 3J81j 3A5UA 4A3FG 1LYLA 4DV4Q 2KHIA 4JV5Q 1TWGH 3I4MG 2E2JH 5LMNL 1Q81C 4HIMA 1M90C 4EQ5A 3U50C 4APVA 1X55A 1L1OC 5AJ3Q 1UEBA 4X64L 3SGIA 2NVXH 3HOUG 4GOPB 3RLNA 4YWLA 3K81C 3PUYA 4UPAA 1IL2A 3HOZH 5IYCH 3M4PA 1QVFA 3RLOA 2VNUD 4IO9A 1I3QH 4R4QA 1X3GA 1NY4A 3K0XA 5IY0A 1N36Q 1MJCA 4IPDA 3W1GA 1JJ2A 3D31A 3GTKH 4JI7Q 1IBKQ 1A62A 1WI5A 4GLAC 1EFWA 1XNRQ 3OTOQ 1SROA 3ICEA 2LSSA 5LMUL 1RIPA 1SR3A 4DV5Q 5M3MH 1KD1C 1V9PA 4L5QA 1VQHA 2IHFA 3A0JA 4LUVA 4ME3A 3CCEA 4GNXC 2JA5G 4GKKL 4QIWE 4B3RL 4DUZQ 3TS2A 1KL9A 1Z9FA 1VS0A 4P73A 4JI1Q 1DGSA 4LNQA 2Q2HA 3A74A 1WCMG 4LF6L 3PGZA 1PH7A 3E9IA 4AH6A 4H02A 2R93G 2JA6G 1HNZQ 1FGUA 1VQOA 1X3FA 2WP8J 1PH1A 2IX1A 4IOCA 5C0XG 2LXJA 1IBLQ 1XPUA 4AYBE 2UU9Q 4JYAL 4IFDJ 4WJ3M 1TXYA 1U0LA 3HKZE 5FLMH 1HJPA 1AE3A 2ZTDA 1TWFH 3U4VA 2PNHA 4B3TQ 4OWWB 1VQ6A 2MO0A 1LTLA 1PYSB 2I5MX 4JG2A 3PO3G 1E1TA 3M4QA 2K5HA 4GLVB 1YI2A 1EIFA 3AYHB 4GN4B 1KHIA 2E5LL 1WJJA 2JA7H 1UE6A 1WCMH 2CWAA 2DGYA 1I94L 3S1NH 2R7ZH 4WJ4A 3J81c 3BZCA 1IBML 4DV7L 4DR5L 1I50H 4B3ML 4DV2Q 4LF5Q 1V1QA 5JJKA 1U5KA 2CCZA 2ZM6L 3RR5A 2UUAL 2B63G 3NBHB 2Z6KC 1A0IA 2RF4A 1Q86C 2N78A 2MFIA 1XMOQ 1N34L 1X56A 1PH2A 4A3JG 4B3SL 1N33L 2ES2A 4C3HH 5GROA 1HR0L 5K36G 2AMCB 2WFWA 3KOJA 4GKJL 3PUVA 3D0FA 2ZJRA 5LMNQ 1VQJA 4BBSG 4HJ8A 4JI6L 4NPSA 3STBD 4X64Q 1XPOA 3I55A 2H5XA 4A3DG 3RN5A 2K5VA 5ELNA 3I56A 1NJIC 3CPWA 3J7A5 3RNUA 1B70B 3HOVH 2WB1G 1X9NA 1C9OA 3UDGA 5DLQE 2NVTH 4UP9A 3K8AA 4X65L 1BVSA 3TQYA 4MZ9A 2Q2TA 3G4SA 3KJPA 4DR1Q 3PUZA 1V43A 5IWAL 5LMUQ 2C35B 2KHJA 4TQUS 2VZAA 1LM0A 3Q8DA 4L5TA 1VCIA 4UY8C 4YY3L 4BY7H 3CCSA 4DV1Q 4A3DH 4PZ7A 4JBWA 4B3RQ 1GVPA 2KCTA 1Y1WH 1YVCA 2BA0A 2KENA 5IE8A 1KXLA 4DV0L 4LF8L 2NN6I 4YWMA 4LFAL 3PIOA 4LF6Q 4DK3C 2MO1A 4XTCS 4A3IG 1PH5A 1PHJA 3GTQH 2CFMA 4R4IA 4JYAQ 2PQAA 1H95A 1IXRA 3FKIG 3CXCA 1VQNA 5JJLA 3KJOA 3NELA 3S1MH 3CC7A 4IFDG 4HIOA 2VUMH 2K4KA 1Y14B 2IT1A 2E2IH 2UXBL 3AFPA 1VQMA 1P8LA 4YWKA 3AFQA 4O0AA 2E5LQ 1OXXK 3NEMA 2OTLA 1FVIA 2I5LX 1EUJA 3L0OA 3STBC 1I94Q 5JEAG 3PV0A 2Y0SG 1HZ9A 1WYDA 3HOZG 1IBMQ 2PQAB 4DV7Q 4DR5Q 4DR3L 1A8VA 2HIXA 4GOPA 1S40A 4B3MQ 5GQOA 2UXDL 1MIUA 2ZM6Q 2QA4A 3CCRA 5LMNW 2UUAQ 1Y1VH 2UUCL 4C3IH 3J7ZC 3ZJYC 1N32L 1OXTA 1TWHH 2EQSA 2YTVA 1N34Q 4B3SQ 1N33Q 4LF8Q 4BBRH 5C3EH 1HR0Q 5M3MG 4GKJQ 3J80c 1BBWA 1UE5A 2QEXA 1UE7A 3PCOB 4JI6Q 4LF9L 1PYBA 1YNXA 1CKNA 5ELOA 2Q2UA 3H0GH 3KYHC 1JMCA 3S2DH 2BA1A 1HNXL 3KFUA 1OXSC 1KRSA 4KHZA 4NB3A 4XIGS 3AEVA 5C4XH 3RN2A 1Q7YC 5C44H 1L0WA 4YHHL 2MQHA 2OCEA 2PI2A 5HGQA 3CCVA 4X65Q 3K80C 4HIDA 2L15A 4C2MH 4DR1L 2GN5A 4JOIA 2GVBA 2QGQA 4L5SA 2F3IA 4MNOA 5IWAQ 5BR8L 1CKNB 2A1AA 5FLMG 1PH4A 1YHAA 4NXNL 1YEZA 4DV6L 4LUZA 4P71A 4R4OA 4DV1L 4YY3Q 1JB7A 4P72A 3U58A 5M5YH 2JA8H 1BKBA 4JCVE 3TEHB 4DV0Q 1BBUA 4LFAQ 1L1OA 4JI2Q 1PH6A 3CC2A 2OWOA 2R7ZG 2JK8A 4DR6L 2Q2IA 3I4OA 4A3GH 3W5OA 4QY7A 4C3JH 3ER0A 1VQ9A 2ID0A 4IOAA 2K5NA 3PIPA 5GAEC 4BY1H 4DR7L 1KC8C 1G6PA 1A63A 3M3YH 1NMFA 3TREA 1KAWA 1YHQA 4RG1A 3ULLA 1K73C 1VQ5A 1VQ7A 3H3VI 2UXBQ 5JEAJ 1L1OB 1SFOH 1VQKA 1AE2A 3GTPH 2ALYB 4GNXA 3A5ZB 3AQQA 1J5EL 2E8GA 1JT8A 4BXXH 1I6HH 3HOYH 2HHHL 3LGJA 4A3MH 1PA6A 4DR3Q 1EIYB 3HOVG 1RL2A 2AWNA 4OWTB 3PO2H 1HR0W 2UXDQ 1GO3E 2VL6A 3CQZH 4Y7NH 3JC66 2R7FA 3GO5A 2HIVA 4IPGA 2XGTA 4DR2L 2UUCQ 4AYBG 3PF4A 2R6GA 1N32Q 4QGUA 2LXKA 3CMEA 3HKZG 4A3LH 2ZJPA 1PVOA 1JJGA 4GNXB 3G71A 4X62L 2GVAA 1HH2P 4HJ5A 5IYDH 1E7ZA 2A8VA 3E0EA 3EBEA 4LF9Q 4BY7G 4UP8A 1QZGA 1LUZA 4HIKA 4R4CA 4TVAB 1Y1WG 3HOXG 1ASYA 5IP9H 1HNXQ 1NMGA 3PF5A 3CCLA 4IJHA 4PG3A 5IP7H 2A19A 1UE1A 4JI5L 4YHHQ 4JI0L 3S14H 2K50A 1K3RA 3HOWH 4P75A 1W2BA 1CUKA 3K7UC 2OTJA 1CKMA 3W1BA 3GTGH 2Z6KA 3MEFA 5BR8Q 1KQSA 4A75A 3H3VH 3ERSX 4QL5A 4L5RC 4NXNQ 3B6YA 1CKOA 3L7ZC 5GADC 4DV6Q 3HFZB 2VUMG 1XTDA 3HOXH 1T9HA 4GKKQ 1AH9A 3NENA 4JI2L 1PH9A 3GTJH 4JC0A 4DR6Q 1C7YA 3M85A 3E9HA 4A3CH 1G291 2VQFL 3JAMi 1HNWL 3UDXA 4DR7Q 1TWAH 3BJUA 1M1KC 1Y1VG 4DNIA 4LFBL 2XTIA 2WAQE 4BBRG 3KF6A 5C3EG 1OXUA 4AQYL 4GOPC 1Q1BA 3F8TA 2B29A 4YCVA 4LFCL 3K7AH 1J5EQ 3H0GG 4IJLA 1JE5A 2BH2A 5E7NA 2HHHQ 1Q1EA 2NN6G 5IT9c 5JJIA 2AKWB 1X3EA 3S16H 4OO1I 1CSQA 1D8LA 3ULJA 4DUYQ 5C4XG 3UDFA 2ZTCA 5C44G 3F1ZA 4OX9L 2F4VL 3DM3A 3I7FA 4R1JA 1EQRA 4A3EH 1Q82C 4DR2Q 1K9MC 2HQLA 1QZHA 3KF6B 5FLXc 4DV3L 1K8GA 4Y52H 1UWVA 4MTNA 2IY5B 1PH3A 3HKSA 4X62Q 5IYBG 1N9WA 2ASBA 2N8NA 2D62A 4DK6C 3I2ZA 3FHWA 4DKAC 3I4NH 3DLLA 2HT1A 4KHPL 2ZTEA 1VQIA 5M5XH 1XPRA 1OTCA 2FXQA 2JA8G 1GD7A 4YCUA 1PFSA 1VQCA 4NXML 3MXNB 2K52A 1XNQL 2R92G 3GTOH 5M5WH 1K8AC 4JI5Q 4A3GG 4JI0Q 1HZBA 4A76A 2N3SA 2R7DA 2YYZA 1B8AA 1ASZA 4JBKA 1KRTA 1P16A 3FP9A 4R4TA 1XMQL 1X65A 4BY1G 5FJ8H 3KDFB 5IYBH 4A3KH 2I5HA 3U4ZA 1G51A 1EQQA 4RMFA 1EOVA 2OQKA 1YJ9A 1YZ6A 1IYJB 4BA2I 1PV4A 3RLFA 2D0OA 2AWOA 4JI4L 3S2HH 2R92H 1YIJA 2VW9A 3BU2A 4BXXG 1MKHA 3HOYG 5C0XI 3GTMH 2JQOA 2VQFQ 1MJEA 4A3MG 3F2CA 2UUBL 1PH8A 1OXVA 2CKZB 4OONA 2K14A 4A3FH 3PO2G 1HNWQ 3I4MH 1HZAA 2NVYH 2PMZE 1E3PA 3J81i 3CF5A 1K83H 2JJQA 3G48A 3HOUH 4A3BG 2KBNA 4LFBQ 4OXPA 1L2FA 4DAYB 4A3LG 5HY6A 1QVCA 1NBWA 5IYDG 4DR4L 4A93G 1Z47A 3IRBA 4AQYQ 3CCUA 4LFCQ 2DUDA 1B7YB 4DPGA 3OW2A 1KIXA 2YV5A 1C0AA 5IP9G 2YTXA 4DUYL 3F2DA 3UE1A 2NZOA 1K0RA 3KF8B 1FJGL 3WWVA 5IP7G 4OX9Q 2F4VQ 5EAYA 4HJ9A 4A3BH 1E24A 1QVGA 2ATWA 2JA7G 2JA5H 2Z0SA 4LF7L 3HOWG 4DV3Q 4LF4L 1Q46A 2UXCL 3T1YL 1NE3A 3EIVA 3GTLH 1YHBA 4GLXA 4A93H 2ZJQA 4HJ7A 3RZOH 4JI8Q 4K0KL 3T1HL 2VS1A 1E22A 4LWCA 4A4IA 3PSIA 4OWXB 1J6QA 3CPFA 2WB1E 3GD7A 4POFA 3M4OH 2EXDA 5GAGC 3S1RH 4KHPQ 2JA6H 1S72A 2R93H 3CD6A 2EIFA 5J3BA 2JEBI 1Q12A 4UP7A 5H1SE 4AIMA 2RHSB 4JBJA 2OQ0A 4NXMQ 1XNQQ 1E1OA 3BZKA 3OYYA 1N8RC 1I5FA 4BA1I 4A3CG 5M3FG 2VQEL 1VQ4A 4GS3A 4JI3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 Q;  3CCQ A;  1XMQ Q;  3M7N A;  1GM5 A;  1VQB A;  4DV4 L;  3PO3 H;  4JV5 L;  1SRU A;  2NVQ H;  1R9T H;  4POG A;  2RCN A;  1VQG A;  3UDI A;  4IPH A;  4X6A H;  5AJ3 L;  4KLK A;  1JJC B;  2JE6 I;  4PZ6 A;  2BH8 A;  2IHE A;  4PMW A;  4GN5 A;  3S1Q H;  1FL0 A;  1HZC A;  3M9B A;  3G6E A;  4O2D A;  3EN2 A;  1VQ8 A;  1NTG A;  3CAM A;  2YU9 H;  4JI4 Q;  1CSP A;  4LUO A;  1EYG A;  1QUQ A;  4FDB A;  2MNA A;  1N36 L;  2B63 H;  4IPC A;  5GAH C;  3CCJ A;  5M3F H;  3UE0 A;  2JEA I;  1GKH A;  1SMX A;  2CQO A;  4JI7 L;  1IBK L;  2NZH A;  3CMA A;  4A3J H;  2UUB Q;  3VDY A;  1XNR L;  3OTO L;  4IFD I;  4DV5 L;  2IX0 A;  4BBS H;  1VQF A;  4QJF A;  2K75 A;  2YTY A;  4A3E G;  1SN8 A;  2B3G A;  3CCM A;  4DUZ L;  4YCW A;  1SE8 A;  4JBM A;  2AHO B;  4DR4 Q;  2Y0S E;  4JI1 L;  1QUQ B;  1O7I A;  3CW2 C;  3TS0 A;  3H15 A;  1WOC A;  3I4N G;  1VQA A;  2V1C C;  3CC4 A;  1SLJ A;  2VY3 A;  4EX5 A;  5C0X J;  4PZ8 A;  1S3O A;  4J15 A;  1EWI A;  1WFQ A;  1YBY A;  2RHQ B;  4GN3 B;  3PUX A;  1HNZ L;  3S17 H;  4KI0 A;  3GDE A;  3J80 i;  1IBL L;  2I0Q A;  2UU9 L;  2KCM A;  1FJG Q;  1W3S A;  4B3T L;  4LF7 Q;  4LF4 Q;  2JA9 A;  2UXC Q;  3T1Y Q;  5FJ8 G;  3F2B A;  4JI8 L;  4A3K G;  2PI2 E;  3TRZ A;  1IZ6 A;  2WAQ G;  3JAM c;  3RZD H;  1VQP A;  2F52 A;  3KDF A;  3T1H Q;  4K0K Q;  4HJA A;  4ALP A;  5C4J H;  3S24 A;  1YIT A;  1XJV A;  4DAM A;  4QQB X;  4A3I H;  4LW1 A;  1Q8K A;  4DV2 L;  5IYC G;  3PUW A;  2CWP A;  4LF5 L;  3CP0 A;  3KLW A;  1VQL A;  4JOI C;  3L2P A;  1YJN A;  2D0P A;  3FKI H;  1TWC H;  1VQE A;  1D7Q A;  1X6O A;  3ULP A;  4OO1 G;  1XMO L;  4P74 A;  1YJW A;  2VQE Q;  4X66 L;  2E2H H;  4JI3 Q;  3S15 H;  1VQD A;  1X54 A;  2N49 A;  3J81 j;  3A5U A;  4A3F G;  1LYL A;  4DV4 Q;  2KHI A;  4JV5 Q;  1TWG H;  3I4M G;  2E2J H;  5LMN L;  1Q81 C;  4HIM A;  1M90 C;  4EQ5 A;  3U50 C;  4APV A;  1X55 A;  1L1O C;  5AJ3 Q;  1UEB A;  4X64 L;  3SGI A;  2NVX H;  3HOU G;  4GOP B;  3RLN A;  4YWL A;  3K81 C;  3PUY A;  4UPA A;  1IL2 A;  3HOZ H;  5IYC H;  3M4P A;  1QVF A;  3RLO A;  2VNU D;  4IO9 A;  1I3Q H;  4R4Q A;  1X3G A;  1NY4 A;  3K0X A;  5IY0 A;  1N36 Q;  1MJC A;  4IPD A;  3W1G A;  1JJ2 A;  3D31 A;  3GTK H;  4JI7 Q;  1IBK Q;  1A62 A;  1WI5 A;  4GLA C;  1EFW A;  1XNR Q;  3OTO Q;  1SRO A;  3ICE A;  2LSS A;  5LMU L;  1RIP A;  1SR3 A;  4DV5 Q;  5M3M H;  1KD1 C;  1V9P A;  4L5Q A;  1VQH A;  2IHF A;  3A0J A;  4LUV A;  4ME3 A;  3CCE A;  4GNX C;  2JA5 G;  4GKK L;  4QIW E;  4B3R L;  4DUZ Q;  3TS2 A;  1KL9 A;  1Z9F A;  1VS0 A;  4P73 A;  4JI1 Q;  1DGS A;  4LNQ A;  2Q2H A;  3A74 A;  1WCM G;  4LF6 L;  3PGZ A;  1PH7 A;  3E9I A;  4AH6 A;  4H02 A;  2R93 G;  2JA6 G;  1HNZ Q;  1FGU A;  1VQO A;  1X3F A;  2WP8 J;  1PH1 A;  2IX1 A;  4IOC A;  5C0X G;  2LXJ A;  1IBL Q;  1XPU A;  4AYB E;  2UU9 Q;  4JYA L;  4IFD J;  4WJ3 M;  1TXY A;  1U0L A;  3HKZ E;  5FLM H;  1HJP A;  1AE3 A;  2ZTD A;  1TWF H;  3U4V A;  2PNH A;  4B3T Q;  4OWW B;  1VQ6 A;  2MO0 A;  1LTL A;  1PYS B;  2I5M X;  4JG2 A;  3PO3 G;  1E1T A;  3M4Q A;  2K5H A;  4GLV B;  1YI2 A;  1EIF A;  3AYH B;  4GN4 B;  1KHI A;  2E5L L;  1WJJ A;  2JA7 H;  1UE6 A;  1WCM H;  2CWA A;  2DGY A;  1I94 L;  3S1N H;  2R7Z H;  4WJ4 A;  3J81 c;  3BZC A;  1IBM L;  4DV7 L;  4DR5 L;  1I50 H;  4B3M L;  4DV2 Q;  4LF5 Q;  1V1Q A;  5JJK A;  1U5K A;  2CCZ A;  2ZM6 L;  3RR5 A;  2UUA L;  2B63 G;  3NBH B;  2Z6K C;  1A0I A;  2RF4 A;  1Q86 C;  2N78 A;  2MFI A;  1XMO Q;  1N34 L;  1X56 A;  1PH2 A;  4A3J G;  4B3S L;  1N33 L;  2ES2 A;  4C3H H;  5GRO A;  1HR0 L;  5K36 G;  2AMC B;  2WFW A;  3KOJ A;  4GKJ L;  3PUV A;  3D0F A;  2ZJR A;  5LMN Q;  1VQJ A;  4BBS G;  4HJ8 A;  4JI6 L;  4NPS A;  3STB D;  4X64 Q;  1XPO A;  3I55 A;  2H5X A;  4A3D G;  3RN5 A;  2K5V A;  5ELN A;  3I56 A;  1NJI C;  3CPW A;  3J7A 5;  3RNU A;  1B70 B;  3HOV H;  2WB1 G;  1X9N A;  1C9O A;  3UDG A;  5DLQ E;  2NVT H;  4UP9 A;  3K8A A;  4X65 L;  1BVS A;  3TQY A;  4MZ9 A;  2Q2T A;  3G4S A;  3KJP A;  4DR1 Q;  3PUZ A;  1V43 A;  5IWA L;  5LMU Q;  2C35 B;  2KHJ A;  4TQU S;  2VZA A;  1LM0 A;  3Q8D A;  4L5T A;  1VCI A;  4UY8 C;  4YY3 L;  4BY7 H;  3CCS A;  4DV1 Q;  4A3D H;  4PZ7 A;  4JBW A;  4B3R Q;  1GVP A;  2KCT A;  1Y1W H;  1YVC A;  2BA0 A;  2KEN A;  5IE8 A;  1KXL A;  4DV0 L;  4LF8 L;  2NN6 I;  4YWM A;  4LFA L;  3PIO A;  4LF6 Q;  4DK3 C;  2MO1 A;  4XTC S;  4A3I G;  1PH5 A;  1PHJ A;  3GTQ H;  2CFM A;  4R4I A;  4JYA Q;  2PQA A;  1H95 A;  1IXR A;  3FKI G;  3CXC A;  1VQN A;  5JJL A;  3KJO A;  3NEL A;  3S1M H;  3CC7 A;  4IFD G;  4HIO A;  2VUM H;  2K4K A;  1Y14 B;  2IT1 A;  2E2I H;  2UXB L;  3AFP A;  1VQM A;  1P8L A;  4YWK A;  3AFQ A;  4O0A A;  2E5L Q;  1OXX K;  3NEM A;  2OTL A;  1FVI A;  2I5L X;  1EUJ A;  3L0O A;  3STB C;  1I94 Q;  5JEA G;  3PV0 A;  2Y0S G;  1HZ9 A;  1WYD A;  3HOZ G;  1IBM Q;  2PQA B;  4DV7 Q;  4DR5 Q;  4DR3 L;  1A8V A;  2HIX A;  4GOP A;  1S40 A;  4B3M Q;  5GQO A;  2UXD L;  1MIU A;  2ZM6 Q;  2QA4 A;  3CCR A;  5LMN W;  2UUA Q;  1Y1V H;  2UUC L;  4C3I H;  3J7Z C;  3ZJY C;  1N32 L;  1OXT A;  1TWH H;  2EQS A;  2YTV A;  1N34 Q;  4B3S Q;  1N33 Q;  4LF8 Q;  4BBR H;  5C3E H;  1HR0 Q;  5M3M G;  4GKJ Q;  3J80 c;  1BBW A;  1UE5 A;  2QEX A;  1UE7 A;  3PCO B;  4JI6 Q;  4LF9 L;  1PYB A;  1YNX A;  1CKN A;  5ELO A;  2Q2U A;  3H0G H;  3KYH C;  1JMC A;  3S2D H;  2BA1 A;  1HNX L;  3KFU A;  1OXS C;  1KRS A;  4KHZ A;  4NB3 A;  4XIG S;  3AEV A;  5C4X H;  3RN2 A;  1Q7Y C;  5C44 H;  1L0W A;  4YHH L;  2MQH A;  2OCE A;  2PI2 A;  5HGQ A;  3CCV A;  4X65 Q;  3K80 C;  4HID A;  2L15 A;  4C2M H;  4DR1 L;  2GN5 A;  4JOI A;  2GVB A;  2QGQ A;  4L5S A;  2F3I A;  4MNO A;  5IWA Q;  5BR8 L;  1CKN B;  2A1A A;  5FLM G;  1PH4 A;  1YHA A;  4NXN L;  1YEZ A;  4DV6 L;  4LUZ A;  4P71 A;  4R4O A;  4DV1 L;  4YY3 Q;  1JB7 A;  4P72 A;  3U58 A;  5M5Y H;  2JA8 H;  1BKB A;  4JCV E;  3TEH B;  4DV0 Q;  1BBU A;  4LFA Q;  1L1O A;  4JI2 Q;  1PH6 A;  3CC2 A;  2OWO A;  2R7Z G;  2JK8 A;  4DR6 L;  2Q2I A;  3I4O A;  4A3G H;  3W5O A;  4QY7 A;  4C3J H;  3ER0 A;  1VQ9 A;  2ID0 A;  4IOA A;  2K5N A;  3PIP A;  5GAE C;  4BY1 H;  4DR7 L;  1KC8 C;  1G6P A;  1A63 A;  3M3Y H;  1NMF A;  3TRE A;  1KAW A;  1YHQ A;  4RG1 A;  3ULL A;  1K73 C;  1VQ5 A;  1VQ7 A;  3H3V I;  2UXB Q;  5JEA J;  1L1O B;  1SFO H;  1VQK A;  1AE2 A;  3GTP H;  2ALY B;  4GNX A;  3A5Z B;  3AQQ A;  1J5E L;  2E8G A;  1JT8 A;  4BXX H;  1I6H H;  3HOY H;  2HHH L;  3LGJ A;  4A3M H;  1PA6 A;  4DR3 Q;  1EIY B;  3HOV G;  1RL2 A;  2AWN A;  4OWT B;  3PO2 H;  1HR0 W;  2UXD Q;  1GO3 E;  2VL6 A;  3CQZ H;  4Y7N H;  3JC6 6;  2R7F A;  3GO5 A;  2HIV A;  4IPG A;  2XGT A;  4DR2 L;  2UUC Q;  4AYB G;  3PF4 A;  2R6G A;  1N32 Q;  4QGU A;  2LXK A;  3CME A;  3HKZ G;  4A3L H;  2ZJP A;  1PVO A;  1JJG A;  4GNX B;  3G71 A;  4X62 L;  2GVA A;  1HH2 P;  4HJ5 A;  5IYD H;  1E7Z A;  2A8V A;  3E0E A;  3EBE A;  4LF9 Q;  4BY7 G;  4UP8 A;  1QZG A;  1LUZ A;  4HIK A;  4R4C A;  4TVA B;  1Y1W G;  3HOX G;  1ASY A;  5IP9 H;  1HNX Q;  1NMG A;  3PF5 A;  3CCL A;  4IJH A;  4PG3 A;  5IP7 H;  2A19 A;  1UE1 A;  4JI5 L;  4YHH Q;  4JI0 L;  3S14 H;  2K50 A;  1K3R A;  3HOW H;  4P75 A;  1W2B A;  1CUK A;  3K7U C;  2OTJ A;  1CKM A;  3W1B A;  3GTG H;  2Z6K A;  3MEF A;  5BR8 Q;  1KQS A;  4A75 A;  3H3V H;  3ERS X;  4QL5 A;  4L5R C;  4NXN Q;  3B6Y A;  1CKO A;  3L7Z C;  5GAD C;  4DV6 Q;  3HFZ B;  2VUM G;  1XTD A;  3HOX H;  1T9H A;  4GKK Q;  1AH9 A;  3NEN A;  4JI2 L;  1PH9 A;  3GTJ H;  4JC0 A;  4DR6 Q;  1C7Y A;  3M85 A;  3E9H A;  4A3C H;  1G29 1;  2VQF L;  3JAM i;  1HNW L;  3UDX A;  4DR7 Q;  1TWA H;  3BJU A;  1M1K C;  1Y1V G;  4DNI A;  4LFB L;  2XTI A;  2WAQ E;  4BBR G;  3KF6 A;  5C3E G;  1OXU A;  4AQY L;  4GOP C;  1Q1B A;  3F8T A;  2B29 A;  4YCV A;  4LFC L;  3K7A H;  1J5E Q;  3H0G G;  4IJL A;  1JE5 A;  2BH2 A;  5E7N A;  2HHH Q;  1Q1E A;  2NN6 G;  5IT9 c;  5JJI A;  2AKW B;  1X3E A;  3S16 H;  4OO1 I;  1CSQ A;  1D8L A;  3ULJ A;  4DUY Q;  5C4X G;  3UDF A;  2ZTC A;  5C44 G;  3F1Z A;  4OX9 L;  2F4V L;  3DM3 A;  3I7F A;  4R1J A;  1EQR A;  4A3E H;  1Q82 C;  4DR2 Q;  1K9M C;  2HQL A;  1QZH A;  3KF6 B;  5FLX c;  4DV3 L;  1K8G A;  4Y52 H;  1UWV A;  4MTN A;  2IY5 B;  1PH3 A;  3HKS A;  4X62 Q;  5IYB G;  1N9W A;  2ASB A;  2N8N A;  2D62 A;  4DK6 C;  3I2Z A;  3FHW A;  4DKA C;  3I4N H;  3DLL A;  2HT1 A;  4KHP L;  2ZTE A;  1VQI A;  5M5X H;  1XPR A;  1OTC A;  2FXQ A;  2JA8 G;  1GD7 A;  4YCU A;  1PFS A;  1VQC A;  4NXM L;  3MXN B;  2K52 A;  1XNQ L;  2R92 G;  3GTO H;  5M5W H;  1K8A C;  4JI5 Q;  4A3G G;  4JI0 Q;  1HZB A;  4A76 A;  2N3S A;  2R7D A;  2YYZ A;  1B8A A;  1ASZ A;  4JBK A;  1KRT A;  1P16 A;  3FP9 A;  4R4T A;  1XMQ L;  1X65 A;  4BY1 G;  5FJ8 H;  3KDF B;  5IYB H;  4A3K H;  2I5H A;  3U4Z A;  1G51 A;  1EQQ A;  4RMF A;  1EOV A;  2OQK A;  1YJ9 A;  1YZ6 A;  1IYJ B;  4BA2 I;  1PV4 A;  3RLF A;  2D0O A;  2AWO A;  4JI4 L;  3S2H H;  2R92 H;  1YIJ A;  2VW9 A;  3BU2 A;  4BXX G;  1MKH A;  3HOY G;  5C0X I;  3GTM H;  2JQO A;  2VQF Q;  1MJE A;  4A3M G;  3F2C A;  2UUB L;  1PH8 A;  1OXV A;  2CKZ B;  4OON A;  2K14 A;  4A3F H;  3PO2 G;  1HNW Q;  3I4M H;  1HZA A;  2NVY H;  2PMZ E;  1E3P A;  3J81 i;  3CF5 A;  1K83 H;  2JJQ A;  3G48 A;  3HOU H;  4A3B G;  2KBN A;  4LFB Q;  4OXP A;  1L2F A;  4DAY B;  4A3L G;  5HY6 A;  1QVC A;  1NBW A;  5IYD G;  4DR4 L;  4A93 G;  1Z47 A;  3IRB A;  4AQY Q;  3CCU A;  4LFC Q;  2DUD A;  1B7Y B;  4DPG A;  3OW2 A;  1KIX A;  2YV5 A;  1C0A A;  5IP9 G;  2YTX A;  4DUY L;  3F2D A;  3UE1 A;  2NZO A;  1K0R A;  3KF8 B;  1FJG L;  3WWV A;  5IP7 G;  4OX9 Q;  2F4V Q;  5EAY A;  4HJ9 A;  4A3B H;  1E24 A;  1QVG A;  2ATW A;  2JA7 G;  2JA5 H;  2Z0S A;  4LF7 L;  3HOW G;  4DV3 Q;  4LF4 L;  1Q46 A;  2UXC L;  3T1Y L;  1NE3 A;  3EIV A;  3GTL H;  1YHB A;  4GLX A;  4A93 H;  2ZJQ A;  4HJ7 A;  3RZO H;  4JI8 Q;  4K0K L;  3T1H L;  2VS1 A;  1E22 A;  4LWC A;  4A4I A;  3PSI A;  4OWX B;  1J6Q A;  3CPF A;  2WB1 E;  3GD7 A;  4POF A;  3M4O H;  2EXD A;  5GAG C;  3S1R H;  4KHP Q;  2JA6 H;  1S72 A;  2R93 H;  3CD6 A;  2EIF A;  5J3B A;  2JEB I;  1Q12 A;  4UP7 A;  5H1S E;  4AIM A;  2RHS B;  4JBJ A;  2OQ0 A;  4NXM Q;  1XNQ Q;  1E1O A;  3BZK A;  3OYY A;  1N8R C;  1I5F A;  4BA1 I;  4A3C G;  5M3F G;  2VQE L;  1VQ4 A;  4GS3 A;  4JI3 L; 
#chains in the Genus database with same CATH topology
 4X66 Q;  3CCQ A;  1XMQ Q;  4DV4 L;  4FXG C;  4FYD A;  1B53 A;  1SRU A;  3FVQ A;  1B3A A;  1R9T H;  4POG A;  2RCN A;  2EE1 A;  4IPH A;  3X3N A;  5AJ3 L;  1SYE A;  4O42 A;  4PMW A;  1BCP D;  1R9T B;  2HDL A;  3M9B A;  2F03 A;  2FJ2 A;  4LUO A;  1QUQ A;  1N36 L;  2B63 H;  2Z4H A;  4IN3 A;  1LTT D;  4EQP A;  5IT9 E;  1GKH A;  1SMX A;  1TQO A;  2CQO A;  3MC0 B;  4RA8 A;  3P1H A;  1E2Z A;  1I4H A;  2B2V C;  2B63 B;  4J6H A;  4OGQ C;  2O5I C;  2JSO A;  4A3E G;  4YCW A;  1SE8 A;  5E4X A;  4DR4 Q;  2WII B;  3QB3 A;  5C0X J;  4PZ8 A;  2EZV A;  2ICE C;  4KI0 A;  3GDE A;  3V96 A;  1YNN C;  1IBL L;  1MSH A;  1NUC A;  1ZYR D;  4LF7 Q;  4LF4 Q;  4IZ8 A;  5FJ8 G;  3ITP A;  3F2B A;  3JAM c;  3KDF A;  3I70 A;  2EDG A;  3Q0A A;  2RCF A;  1AZQ A;  2CWP A;  4LF5 L;  2K28 A;  3CP0 A;  3KLW A;  1YJN A;  2D0P A;  5D14 A;  5C3W A;  1X6O A;  2E2H H;  2EVB A;  1VQD A;  1TS4 A;  3J81 j;  1CI3 M;  1LYL A;  3T56 B;  2KHI A;  3K0Y A;  2E2H B;  4HIM A;  3VA5 A;  1M90 C;  5DM7 3;  1X55 A;  2MUY A;  3SGI A;  5JEA H;  3PUY A;  3N6R A;  5ELC A;  2M2L A;  2VNU D;  4IO9 A;  2RKS A;  3MFY A;  2Y0S B;  1GUO A;  1NY4 A;  1U4R A;  3L9A X;  3P20 A;  1GUW A;  5IOD A;  4JI7 Q;  1IBK Q;  1WI5 A;  4PQX A;  1EFW A;  3ICE A;  5IGC A;  1F77 A;  4DV5 Q;  2EYJ A;  1ZYR C;  5G3L F;  1KD1 C;  2A69 D;  4CJ0 B;  4GNX C;  3D3R A;  3TS2 A;  1BQQ T;  1PFM A;  1Z9F A;  4P73 A;  4LNQ A;  4DXG A;  1CZG A;  3E9I A;  1EU4 A;  4H02 A;  2R93 G;  2JA6 G;  1Z6H A;  1HNZ Q;  1X3F A;  1EEI D;  4IOC A;  3DWP A;  2UU9 Q;  1M4V A;  5FLM H;  1HJP A;  2IW3 A;  4B3T Q;  4OWW B;  2PNH A;  2MO0 A;  3PO3 G;  2JYO A;  4JG2 A;  3GV6 A;  3M4Q A;  3AYH B;  1KHI A;  1WJJ A;  2JA7 H;  3H3V C;  3S1N H;  2EYO A;  2R7Z H;  5FLX L;  1IBM L;  2CQA A;  2JA7 B;  3VR5 A;  3S1N B;  2R7Z B;  3IL8 A;  5T1G A;  3NBH B;  2Z6K C;  2RF4 A;  2MFI A;  3Q22 A;  1N34 L;  4A3J G;  4B3S L;  4S3S A;  1SE2 A;  2ES2 A;  2F0F A;  5GRO A;  4C3H H;  3DXJ C;  2AQ2 B;  2NYZ D;  2ZJR A;  2A69 C;  4GZY C;  2N88 A;  3STB D;  4RH6 A;  4C3H B;  4LAA A;  4X64 Q;  1XPO A;  1VMC A;  4F7X A;  5ELN A;  4QIW B;  1AP0 A;  4Q5V A;  1SNP A;  3RNU A;  1Y8N B;  1SNM A;  2LY7 A;  2WB1 G;  3HOV H;  1PTO F;  1ZKO A;  4UP9 A;  3KLR A;  3HOV B;  3W2D A;  2A68 D;  3PUZ A;  4H13 C;  4AYB B;  2C35 B;  4KJN A;  1LM0 A;  5JOB A;  2WKC A;  2EXZ A;  4BY7 H;  4C1N K;  4B3R Q;  3GTG B;  2BA0 A;  2PO4 A;  5IE8 A;  4LF8 L;  2NN6 I;  4BY7 B;  1BNZ A;  1KTK A;  4A3I G;  4K14 A;  2KCN A;  4RGO S;  4R4I A;  4NW2 A;  2K5D A;  1Y8P B;  1SJE D;  2PQA A;  1TY2 A;  1A15 A;  3S1M H;  1RTN A;  3CC7 A;  4XYQ A;  2IT1 A;  3OIP A;  4XQJ A;  4ZUI A;  1DYQ A;  4O0A A;  3S1M B;  2EYH A;  2OTL A;  3DWQ A;  3STB C;  1I94 Q;  1EUJ A;  1F2Y A;  3TP5 A;  2K33 A;  1WYD A;  2L1B A;  3TP6 A;  4GOP A;  1A8V A;  1K3B C;  4QB4 A;  3PIP 3;  1K0S A;  2MP1 A;  2UUA Q;  2EQS A;  1CK1 A;  1FYC A;  2FIN B;  2YTV A;  2A68 C;  1I4G A;  1VF7 A;  3J80 c;  4WJW A;  1TT2 A;  4LF9 L;  1CKN A;  3KYH C;  3C1F A;  2NN6 H;  2G9H D;  1KRS A;  4HSP A;  4KHZ A;  4XIG S;  5C4X H;  3RN2 A;  5KND A;  2MQH A;  2OCE A;  5HGQ A;  4I7A A;  5F2D A;  5LL6 X;  2Z6B A;  2L15 A;  3QG1 A;  5C4X B;  4EQN A;  2QDB A;  1DM0 B;  1YNJ C;  5BR8 L;  2K5Q A;  4NXN L;  1YEZ A;  4DV1 L;  4K5W A;  4R4O A;  5L37 A;  4YY3 Q;  2J4X A;  5JVH 3;  4IUV A;  3T13 A;  1BBU A;  2F0E A;  1L1O A;  4LFA Q;  4JI2 Q;  1PH6 A;  3NSW A;  4QY7 A;  4C3J H;  1VQ9 A;  3D4R A;  3MXG A;  2K5N A;  1MSG A;  3PIP A;  4BY1 H;  4C3J B;  1A63 A;  2QKI C;  5K5P A;  1NMF A;  1KAW A;  1LTA D;  4RG1 A;  2CW0 D;  2A73 B;  2L5T A;  1K73 C;  4BY1 B;  2AUK A;  1QG7 A;  1SFO H;  1VQK A;  4IUT A;  3GTP H;  3OHX C;  3MXU A;  4RGM A;  1JT8 A;  1SFO B;  3GTP B;  4DR3 Q;  1HQM C;  2B2Y C;  1RL2 A;  4OWT B;  3PO2 H;  1HR0 W;  3JAM L;  3H91 A;  4G7O C;  2KED A;  4ZQ3 A;  1LAC A;  2XGT A;  4X3S A;  3PO2 B;  4QGU A;  1PVO A;  4KHV A;  2X6L A;  4XDX A;  1QNU A;  3G71 A;  1HH2 P;  1LLR D;  4UP8 A;  4HIK A;  3A7L A;  1IKL A;  3L3O C;  4TVA B;  1Y1W G;  2DJF C;  3HOX G;  4IUN A;  3BS1 A;  1HNX Q;  1U4L A;  3D8G A;  5IP7 H;  4P75 A;  4OIJ A;  1W2B A;  1EY6 A;  2OTJ A;  3QJY A;  1SAP A;  2CW0 C;  1CKO A;  1PZJ D;  3K57 A;  3HOX H;  5KYI A;  4DR6 Q;  3HOX B;  3E9H A;  3BYT B;  2VQF L;  4EVO A;  3JAM i;  3F2U A;  2EY2 A;  2K5W A;  3UDX A;  3EA6 A;  2K6A A;  3BJU A;  1Q8I A;  4L6T B;  2XTI A;  2RBM A;  2WAQ E;  3R93 A;  1Q90 A;  4BBR G;  1GOZ A;  3KBG A;  1Q1B A;  2B29 A;  4YCV A;  4LFC L;  3BDL A;  1KAB A;  2BH2 A;  4Z9C B;  5E7N A;  4YIJ A;  2AKW B;  3S16 H;  4OO1 I;  1IL8 A;  2ZTC A;  2SOB A;  3DM3 A;  4DA2 A;  3S16 B;  1EQR A;  4RKB A;  4DR2 Q;  2PZW A;  5E3F A;  2ASB A;  3I2Z A;  3FHW A;  3DHQ A;  3ERO A;  4DKA C;  2F0P A;  2HT1 A;  3ONA B;  1SSO A;  4KHP L;  3OMC A;  1VQI A;  2ZTE A;  2A5H A;  5I6Y A;  2DN8 A;  3SK6 A;  1CFM A;  1PFS A;  4NXM L;  3MXN B;  2K52 A;  3GTO H;  5M5W H;  2WV6 D;  1HZB A;  4A76 A;  2N3S A;  4JK1 C;  2KEC A;  1P16 A;  2QEJ C;  1H9R A;  3GTO B;  1X65 A;  5M5W B;  3KDF B;  2JXM B;  3U4Z A;  1G51 A;  1YJ9 A;  2EJM A;  1V1P A;  4BA2 I;  1PYW D;  1I4X A;  3K5O A;  3EFX D;  3K5L A;  1EYC A;  4JI4 L;  1YIJ A;  2VW9 A;  3BU2 A;  3HOY G;  4OO1 H;  2JQO A;  2K1B A;  1FNV A;  4DK1 A;  3F2C A;  2UUB L;  1PRT B;  4A3F H;  1HNW Q;  1SEB D;  1ZXT A;  2FFK B;  1E3P A;  4G57 A;  5C5L A;  4A3B G;  4IUP A;  2KBN A;  4A3F B;  4DAY B;  1TY0 A;  1HA5 A;  1EEF D;  4UHV A;  3IRB A;  4F88 A;  1GUT A;  1EU3 A;  3KBX A;  1K8M A;  4CJ1 B;  3A8K E;  4DPG A;  1BDO A;  3V2T A;  2NZO A;  4M1U B;  3VR2 A;  1WTQ A;  4JPB W;  4OX9 Q;  4A3B H;  1QVG A;  3SK8 A;  2SDF A;  4XQQ A;  1WD1 A;  4N8X 1;  2UXC L;  4CDF C;  4A3B B;  2ZJQ A;  1EOT A;  1T5E A;  1LAB A;  4OWX B;  3CPF A;  3S1R H;  3CD6 A;  2JEB I;  5AFW A;  1PFB A;  4UP7 A;  2OXP A;  4JBJ A;  3S1R B;  3J80 L;  1E1O A;  3OYY A;  3QO2 A;  1RF2 D;  5EPK A;  4A3C G;  2IX3 A;  4ZAI A;  2VQE L;  4GS3 A;  1LTS D;  3SHL A;  3NE5 B;  2NVQ H;  4X6A H;  2EYF A;  2PMZ B;  4ZYS A;  4PZ6 A;  1HCZ A;  2NVQ B;  3EN2 A;  1VQ8 A;  3CAM A;  4C1N I;  1EYG A;  4FDB A;  2MNA A;  3GQB A;  4MN3 A;  5GAH C;  4LK1 C;  1SBB B;  3K58 A;  1WTV A;  1HUN A;  4FF1 A;  3OTO L;  5K36 H;  1SNC A;  2RSN A;  1NR4 A;  4K8J A;  3SDZ A;  2YTY A;  1SN8 A;  2B3G A;  2F3V A;  1O7Y A;  2RSO A;  3CCM A;  2ICI A;  2AHO B;  4JI1 L;  3I4N G;  1B4O A;  3NUC A;  2Q8R E;  1SLJ A;  2VY3 A;  5BN4 A;  1YBY A;  4GN3 B;  3PUX A;  3J80 i;  1XYI A;  2L0C A;  2LS0 1;  1DOK A;  1FJG Q;  4CDD C;  1EZ8 A;  1ESR A;  1EQV A;  5FO7 B;  5LHY 1;  3R2I A;  3T1Y Q;  3MXP A;  2EY6 A;  4JI8 L;  4A3K G;  2NBF A;  1IZ6 A;  1VQP A;  4K0K Q;  5IGE A;  4HJA A;  5CGK A;  4FXD A;  1YIT A;  4QCL A;  2HCC A;  3QOJ A;  4LW1 A;  1WTX A;  4DV2 L;  1LT3 D;  1CT1 D;  2PYK A;  3FDT A;  1VQL A;  4JOI C;  1MHW C;  3FKI H;  4XT1 B;  1VQE A;  4ZKB B;  1XMO L;  4P74 A;  3S15 H;  1X54 A;  3FKI B;  4JV5 Q;  3I4M G;  5LMN L;  1Q81 C;  3S15 B;  1H9J A;  3HOU G;  1MI2 A;  4GOP B;  4YWL A;  2VB3 X;  4UPA A;  5CBA E;  1IL2 A;  3M4P A;  1EL0 A;  3RLO A;  2HD3 A;  1I3Q H;  1HFN A;  5IY0 A;  2RDF A;  1GJX A;  1I3Q B;  4FO2 A;  1JJ2 A;  3HGB A;  1RD9 D;  1XNR Q;  4CGY B;  5M3M H;  1V9P A;  2WAC A;  3A0J A;  3D4D A;  4I7Z C;  4LUV A;  4ME3 A;  5CR3 A;  2JA5 G;  4QF4 A;  3NQI A;  2B2W C;  5M3M B;  5CV9 A;  4DUZ Q;  3HRZ C;  2F0W A;  1VS0 A;  2Q2H A;  4XQN A;  1WCM G;  2XWB B;  3BYY B;  3QWN A;  2WP8 J;  3RUZ A;  5CV4 A;  4JYA L;  3I90 A;  2LXJ A;  5C0X G;  1B9M A;  1XPU A;  4WJ3 M;  1HPC A;  2FMM A;  1U0L A;  3HKZ E;  5IOC A;  1LTL A;  1PYS B;  3O13 A;  1E1T A;  2K5H A;  1W6K A;  3T16 A;  3MFG A;  4GN4 B;  1WCM H;  3Q24 A;  1PMR A;  1STB A;  4WJ4 A;  3J81 c;  5IIF A;  4DR5 L;  1CA5 A;  5IGD A;  1WCM B;  4B3M L;  4XYO A;  4KD3 A;  1V1Q A;  1YNN D;  5JJK A;  1O78 A;  1CHQ D;  2ZM6 L;  3RR5 A;  3VA7 A;  5EBD A;  2B63 G;  4IQZ A;  1N33 L;  2Q8I B;  3SXH A;  2WFW A;  1S5D D;  3PUV A;  3D0F A;  4IUR A;  1VQJ A;  3NP8 A;  2B2U C;  4NPS A;  5A35 A;  1K28 A;  3I55 A;  2K5V A;  3MA2 B;  2NB0 A;  3QOL A;  4QMG A;  4LJZ C;  1NJI C;  1DOL A;  1B70 B;  2SEB D;  5EPL A;  2RA4 A;  3K8A A;  3TQY A;  1DD2 A;  4K6L A;  4MZ9 A;  4PMC A;  1XX8 A;  1RTO A;  1V43 A;  5IWA L;  5LMU Q;  3U9S A;  4HR7 B;  2KHJ A;  4TQU S;  2VZA A;  4L5T A;  4GKK Q;  1VCI A;  4DV1 Q;  4JBW A;  2KEN A;  3MAQ A;  2O2L D;  1KXL A;  4DV0 L;  4LF6 Q;  2MO1 A;  3P75 A;  3SK5 A;  4XTC S;  1QB5 D;  1GHJ A;  4V19 0;  1H95 A;  4R8N A;  2B8G A;  1FNU A;  1PRT F;  2B2V A;  2K4K A;  3UI2 A;  2E2I H;  3AFP A;  2VUM H;  1P8L A;  3OOC A;  2E5L Q;  1OXX K;  5FK9 C;  1VMP A;  2D9U A;  2VUM B;  2E2I B;  5JEA G;  3PV0 A;  2Y0S G;  2CH4 A;  4DV7 Q;  4ZKC B;  1SYB A;  2UXD L;  3CCR A;  1O80 A;  1Y1V H;  2LKV A;  1N32 L;  4RWS C;  1B1Z A;  3WOF A;  1Y1V B;  1HR0 Q;  5C3E H;  4K6D A;  4GKJ Q;  2QEX A;  1T5X D;  3PCO B;  4JI6 Q;  1PYB A;  5C3E B;  3S2D H;  1TKW B;  4WRD A;  2BA1 A;  1SND A;  3KFU A;  3EQL C;  3AEV A;  1Q7Y C;  5C44 H;  2NTS A;  1LTI D;  4YHH L;  3S2D B;  1ENA A;  4X65 Q;  4HID A;  3C46 A;  1GUG A;  4DR1 L;  2GN5 A;  5C44 B;  2Q8T A;  2IJ0 A;  2GVB A;  4L5S A;  3DEO A;  3IKJ A;  5KYL A;  5FLM G;  3LNN A;  1QIL A;  1BBX C;  4DV6 L;  2QF7 A;  1KDC A;  1IYV A;  3NWT A;  4P72 A;  5M5Y H;  1H9M A;  3URY A;  1BKB A;  4JCV E;  5M9O A;  3CC2 A;  2JA7 G;  4UDU C;  3E6Z X;  4H44 C;  2OWO A;  2R7Z G;  2Q2I A;  2K05 A;  4K5X A;  3W5O A;  5M5Y B;  3ER0 A;  1BXT A;  5GAE C;  4DR7 L;  2KJX A;  4KKT A;  1JOK A;  1SYF A;  4J1M A;  1FR3 A;  3TRE A;  5I4D A;  2CH4 W;  3ULL A;  1BR9 A;  2UXB Q;  5JEA J;  3EVQ A;  4C3H G;  1PTO D;  1BUV T;  1AE2 A;  2ALY B;  1ICW A;  4GNX A;  1J5E L;  4BXX H;  3R2T A;  5HUR A;  4A3M H;  5I2X A;  5E4W C;  1JWM D;  3HOV G;  4M8A A;  3AU7 A;  1GO3 E;  2VL6 A;  4CJ2 C;  4A3M B;  1UAP A;  2E74 C;  5J39 A;  2R7F A;  3GO5 A;  2UUC Q;  3PF4 A;  1DXM A;  4AYB G;  2R6G A;  1DJR D;  1JJG A;  1PZK D;  5IYD H;  4X62 L;  1E7Z A;  3E0E A;  4KN4 C;  1JOQ A;  3MHB A;  1PFN A;  1QCB D;  4BY7 G;  3I3C A;  1QZG A;  1LUZ A;  4A93 B;  4R4C A;  1A2U A;  5IP9 H;  1NMG A;  3PF5 A;  1WTR A;  2Z8L A;  2J7Z A;  4JI5 L;  1UE1 A;  2QIL A;  2K50 A;  4WOR A;  3SK4 A;  5KEE A;  4XXE A;  3GTG H;  2Z6K A;  4A75 A;  3ERS X;  4PMB A;  3L7Z C;  2GA4 B;  4FF3 A;  1XTD A;  1PTO C;  1T9H A;  2P5Z X;  1AH9 A;  1FNW A;  3GTJ H;  5KGU A;  4ZRZ A;  3KLS X;  3GTJ B;  1YNJ D;  1LO5 D;  1JC7 A;  2D5D A;  2BE5 D;  3MEH A;  4B08 A;  4LFB L;  4ABN A;  3E3X A;  5DNF A;  3J80 E;  4GOP C;  1BO0 A;  5EKK A;  5I2Y A;  4IJL A;  1WVL A;  3K5M A;  2HHH Q;  3G7L A;  1Q1E A;  1O7Z A;  2NN6 G;  3J7A F;  1G6Z A;  1D8L A;  4KMU C;  3ULJ A;  5C4X G;  2F4V L;  2BDN A;  4H7B A;  3VR6 A;  3I7F A;  4QQB X;  2HQL A;  3VR3 A;  3KF6 B;  4DV3 L;  3J81 L;  4MTN A;  3AB9 A;  1PH3 A;  1G2S A;  3GV3 A;  5IYB G;  1N9W A;  2A74 C;  2D62 A;  3DLL A;  1B3Q A;  1XWE A;  5LL6 S;  5M5X H;  1XPR A;  5CC4 A;  1IKM A;  2DNC A;  3ND9 A;  5M5X B;  1VQC A;  3T51 B;  2R92 G;  5HGT A;  3TDQ A;  4JI0 Q;  2R7D A;  4C3J G;  3FP9 A;  4R4T A;  1XMQ L;  3X3M A;  4BY1 G;  5IYB H;  5EKL A;  4ZLT F;  2I5H A;  2QW7 A;  2BE5 C;  1JOR A;  1E2V A;  1D1K A;  1YZ6 A;  1IYJ B;  1AN8 A;  4FP5 D;  5KRU A;  1RDP D;  2WAQ B;  1PV4 A;  3RLF A;  4QUC A;  3I91 A;  3LX0 A;  2R92 H;  1EYD A;  1QE6 A;  4EGV A;  5JPN C;  2AUJ D;  5ELF A;  2XN9 C;  4CHT B;  2R92 B;  5C3X A;  3PO2 G;  3BDC A;  2F0O A;  3J81 i;  2NWG A;  4OXP A;  1ML0 D;  4DR4 L;  1EIH A;  4AQY Q;  3R3O A;  4KKU A;  5C4H A;  1B7Y B;  1KIX A;  2YV5 A;  1EY9 A;  4DUY L;  1ET6 A;  2YTX A;  3UE1 A;  1K0R A;  2E76 C;  3KF8 B;  3WWV A;  5IP7 G;  2NTT A;  5T1I A;  2ATW A;  4LF7 L;  4LF4 L;  4JVZ A;  1NE3 A;  1DON A;  4KJO A;  5J22 A;  4JI8 Q;  4LWC A;  4A4I A;  3NPP A;  2WB1 E;  2EXD A;  5GAG C;  5A2Q E;  5J3B A;  3C2P A;  5C4Z A;  5H1S E;  4AIM A;  1XNQ Q;  1X32 A;  1N8R C;  1RJT A;  5M3F G;  2E2J H;  4X3K A;  2B2Y A;  1GM5 A;  2K04 A;  2E2J B;  4OEM B;  3D6C A;  1VQG A;  5CV5 A;  4G7H C;  2JE6 I;  2BH8 A;  2IHE A;  4GN5 A;  3G6E A;  2VB2 X;  4O2D A;  1EY0 A;  2F0M A;  1NTG A;  1Q3L A;  2YU9 H;  2L11 A;  4IPC A;  3CCJ A;  5M3F H;  3UE0 A;  1E0B A;  2JEA I;  2YU9 B;  4JI7 L;  1IBK L;  3IFD A;  2NZH A;  3VDY A;  2F0H A;  5M3F B;  4IFD I;  1JE4 A;  4DV5 L;  2IX0 A;  1I4P A;  2LMC B;  2RDG A;  4BBS H;  1VF5 C;  2K75 A;  2F0Q A;  3NTI A;  4JBM A;  1U4P A;  4BBS B;  1QUQ B;  1O7I A;  3CW2 C;  3TS0 A;  3H15 A;  2V1C C;  4A3D B;  4EX5 A;  3T4A C;  1HNZ L;  1EWI A;  4ILW A;  1SXT A;  2RHQ B;  2KA7 A;  1G8Z D;  2I0Q A;  2UU9 L;  2KCM A;  2L9H A;  1JB3 A;  2NZ1 D;  4B3T L;  1ICF B;  3FRP B;  2MHV A;  2F0V A;  3RZD H;  2EYL A;  4LMQ D;  2F52 A;  3KLS A;  3T1H Q;  1BF4 A;  4ALP A;  5C4J H;  2B2T A;  4RCN A;  3RZD B;  1Q8K A;  5IYC G;  3PUW A;  5BN5 A;  5C4J B;  4KV6 A;  2B39 A;  1D7Q A;  1B9N A;  3H09 A;  3ULP A;  4OO1 G;  3QR8 A;  1YJW A;  4JI3 Q;  4IFD H;  3A5U A;  4A3F G;  4DV4 Q;  3ND8 A;  3AMU A;  3N52 A;  3U50 C;  4EQ5 A;  4IAL A;  5AJ3 Q;  4X64 L;  2NVX H;  2FHT A;  2QCP X;  3SR1 A;  1JR0 D;  3HOZ H;  5IYC H;  1QVF A;  3A7A B;  2HQE A;  1J8I A;  2NVX B;  4R4Q A;  1X3G A;  3K0X A;  4CKB A;  1N36 Q;  3HOZ B;  1MJC A;  3OSO A;  2MPM A;  3W1G A;  4DXF A;  3D31 A;  3GTK H;  4TKO B;  1F9Q A;  2NUC A;  4IUQ A;  2LSS A;  1RIP A;  3I4L A;  5C6A A;  1UEA B;  3GTK B;  3CCE A;  4B3R L;  4N9T A;  1H9S A;  1SDF A;  1B44 D;  1BCP B;  2JN4 A;  3A74 A;  3J7Y W;  3PGZ A;  1PH7 A;  3CHB D;  4N8F A;  1FD7 D;  1S5F D;  2IX1 A;  2L12 A;  1IBL Q;  4IFD J;  1D2B A;  1TXY A;  2XWJ B;  1AE3 A;  1VQ6 A;  3H94 A;  3NBH A;  3U4V A;  2F0S A;  4GLV B;  1YI2 A;  2CWA A;  2DGY A;  1I94 L;  3TP8 A;  1JOO A;  2PZT A;  1I50 H;  4NKL A;  3K6O A;  4LF5 Q;  2CCZ A;  1C4Q A;  4K8I A;  2UUA L;  1I50 B;  1A3U A;  2N78 A;  1X56 A;  1HTP A;  5K36 G;  2Z9H A;  3M7G A;  1A3T A;  4HJ8 A;  1LTR D;  2H5X A;  3I56 A;  3J7A 5;  4DK0 A;  3HS0 C;  3UDG A;  5DLQ E;  1BVS A;  2K03 A;  3NXW A;  2D2C C;  4ODG A;  2XSC A;  5FKA C;  4DR1 Q;  2X69 A;  5FLX E;  3HKZ B;  3Q8D A;  2IL8 A;  4YY3 L;  3CCS A;  5CV6 A;  2EYP A;  1WTP A;  1GVP A;  2KCT A;  1YVC A;  1LT4 D;  4LFA L;  4DN4 M;  5KIX A;  4DK3 C;  3QIA A;  3GTQ H;  4QUF A;  2CFM A;  1IXR A;  2V4D A;  3FKI G;  5JJL A;  4OIK A;  3GTQ B;  1U9R A;  3KJO A;  3NEL A;  2ZXO A;  1D1I A;  3TN2 A;  3DEP A;  4HIO A;  2PNR C;  1Y14 B;  1SJH D;  2QDL A;  1WTH A;  2HCI A;  5J1Z A;  3GP7 A;  1FVI A;  3L0O A;  2RVL A;  1NNX A;  1IBM Q;  2PQA B;  4IUU A;  4DR3 L;  2HIX A;  2TMP A;  2EJF C;  2QA4 A;  5LMN W;  1A6X A;  4C3I H;  3J7Z C;  3ZJY C;  1OXT A;  1TWH H;  1N34 Q;  2G9D A;  4B3S Q;  2IPK D;  3CRK C;  4C3I B;  1I6V C;  5M3M G;  1TWH B;  1UE7 A;  5ELO A;  3ZYY X;  2Q2U A;  3H0G H;  1JMC A;  4HTH A;  3G6J B;  1Y8O B;  1HNX L;  4NB3 A;  3H0G B;  1D5Z C;  1L0W A;  3D6W A;  3OPO A;  3CCV A;  4C2M H;  3NWS A;  4WFN 3;  1PDQ A;  2K32 A;  4JOI A;  2QGQ A;  2CVR A;  1K8O A;  4HED A;  4MNO A;  1CKN B;  4C2M B;  2A1A A;  1PH4 A;  1YHA A;  2HDM A;  1HFG A;  3NTH A;  4LUZ A;  4P71 A;  1JB7 A;  1ESF A;  3U58 A;  2JA8 H;  2I07 B;  4LF8 Q;  3TEH B;  4DR6 L;  4A3G H;  3J81 E;  3LWE A;  4FF4 A;  4V0B A;  2JA8 B;  1G91 A;  4HN7 A;  5KNB A;  1VDZ A;  4A3G B;  3FMC A;  1KC8 C;  3W3A A;  3M3Y H;  2HUG A;  1HRJ A;  5I6W A;  1YHQ A;  1VQ5 A;  4Q0F A;  3U9O A;  3M3Y B;  1L1O B;  1ENF A;  3A5Z B;  1I6H H;  2B2W A;  1R4P B;  1I4Q A;  1Y69 U;  1PA6 A;  1I6H B;  2XRS D;  1H9K A;  1F9R A;  2HIV A;  4IPG A;  4DR2 L;  4OEL B;  3TME A;  1D6E C;  2LXK A;  4A3L H;  2ZJP A;  1CQV A;  1SE4 A;  4HJ5 A;  2A8V A;  2F4I A;  3EBE A;  4LF9 Q;  1LV9 A;  1CHP D;  2E75 C;  3J7A V;  3CCL A;  4IJH A;  3VYS A;  3S14 H;  1PRT D;  5COR A;  1K3R A;  3HOW H;  5CV8 A;  3K7U C;  1MD2 D;  2F0U A;  3S14 B;  1ET9 A;  1I4R A;  5JPM C;  3MEF A;  1SYD A;  5BR8 Q;  3MTS A;  3HOW B;  4NXN Q;  4QL5 A;  4L5R C;  3B6Y A;  1W6J A;  5GAD C;  1KDA A;  3HFZ B;  2VUM G;  4ME5 A;  3JAM E;  1S4Z A;  1KLU D;  4RGN A;  4DGZ A;  3NEN A;  3M4Y A;  2B2U A;  4H0L C;  2EYM A;  3I72 A;  4NP5 A;  3M85 A;  1PXU A;  1CZW A;  1C7Y A;  1G29 1;  1DCZ A;  2R61 A;  3SEB A;  1STN A;  2DY8 A;  1HNW L;  4U67 3;  1TWA H;  1Y1V G;  1QWY A;  4DNI A;  4DNT B;  1GHK A;  4TSS A;  1TR5 A;  2XIW A;  1HHV A;  1TWA B;  5C3E G;  1OXU A;  2F0L A;  3CRL C;  2C5C A;  1SMY C;  3F8T A;  1V1O A;  3K7A H;  2EY1 A;  1JE5 A;  1PLF A;  2SNS A;  5IT9 c;  5JJI A;  1X3E A;  5G3L D;  4OHJ A;  3K7A B;  1BCP F;  4DUY Q;  1QNK A;  5C44 G;  2ZXR A;  3F1Z A;  4OX9 L;  1PRT C;  1LT5 D;  4R1J A;  3MXN A;  2FMC A;  4A3E H;  1QZH A;  1A3V A;  5IGB A;  3EJI A;  2OF1 A;  4A3E B;  3V05 A;  2N8N A;  1GUN A;  1SYC A;  3IFT A;  1OTC A;  2F0N A;  1BCP C;  3FPP A;  4KD4 A;  2BDO A;  1K8A C;  2YYZ A;  1B8A A;  4JBK A;  1KRT A;  2KCC A;  3WOE A;  5FJ8 H;  1EOV A;  5ELE A;  1STY A;  1GXD C;  1KLG D;  5IGF A;  2AWO A;  4DAY A;  4DU9 A;  2BOS A;  1LT6 D;  3S2H H;  4BXX G;  1MKH A;  3RMH A;  4DFA A;  2VQF Q;  4A3M G;  3S2H B;  4ZUJ A;  2CKZ B;  4HSV A;  4ZK9 B;  3R8B A;  3BVM A;  1HZA A;  3T53 B;  1V1P B;  3CF5 A;  4K5V A;  3G48 A;  1NBW A;  5IYD G;  4A93 G;  1JIC A;  2OEO A;  3CCU A;  3NTK A;  2F1M A;  4LFC Q;  2DUD A;  1CM9 A;  2O4X A;  1C0A A;  4U68 A;  5IP9 G;  2O5J C;  3TSS A;  1FJG L;  1X3P A;  5EAY A;  3D4W A;  4X3U A;  1M8A A;  5KNC A;  1E24 A;  3S9W A;  1STG A;  1H9S B;  2Z0S A;  4G4K A;  2B8F A;  2WIN B;  1Q46 A;  3T1Y L;  4B9W A;  1YHB A;  4GLX A;  5DAU A;  4A93 H;  1R4Q B;  4KY5 A;  4K0K L;  4PNY A;  1RHP A;  2VS1 A;  3PSI A;  4PV1 C;  3M4O H;  4KHP Q;  3FEW X;  3GD7 A;  4POF A;  2R93 H;  2JA6 H;  1RKN A;  1S72 A;  4EQO A;  1Q12 A;  1PZI D;  1TVX A;  3M4O B;  2RHS B;  4NXM Q;  2R93 B;  2JA6 B;  4BA1 I;  5DEH A;  2M00 A;  5D3D A;  1VQ4 A;  3NK9 A;  1ROD A;  3HP3 A;  3M7N A;  3SE0 A;  1QOH A;  1VQB A;  2KEE A;  2PZU A;  3SVM A;  3BZD B;  3PO3 H;  4JV5 L;  4HCE A;  3Q23 A;  3UDI A;  4KLK A;  3PO3 B;  1JJC B;  1EWC A;  1IW7 D;  3I8Z A;  1AZP A;  4RCO A;  3S1Q H;  1FL0 A;  1F2M A;  1EY5 A;  1HZC A;  1TS5 A;  4FF2 A;  1EQT A;  3TBI B;  4JI4 Q;  1CSP A;  3S1Q B;  4CBV A;  5EJW A;  2PPB C;  2Z4I A;  3ERQ A;  2F0J A;  3CMA A;  4A3J H;  2UUB Q;  1BOS A;  1XNR L;  4B9X A;  3FPU B;  1IHZ A;  1VQF A;  4MTK A;  4QJF A;  4A3J B;  2CHB D;  1EWH A;  4DUZ L;  1D5X C;  1ILQ A;  4KK7 A;  2Y0S E;  5JAV A;  3OW7 A;  4RKL A;  1WOC A;  1VQA A;  4J8Q A;  5CV7 A;  3CC4 A;  4RGT A;  1CQF A;  1S3O A;  4J15 A;  1WFQ A;  2WB1 B;  1STA A;  3S17 H;  2A6E D;  4FVM A;  4K2K A;  3TZU A;  1AEX A;  3S17 B;  1UUP A;  1W3S A;  1SNO A;  3MWY W;  2JA9 A;  2UXC Q;  1EIG A;  2OT2 A;  2PI2 E;  3Q6S A;  3TRZ A;  2WAQ G;  1KNE A;  3E0J A;  3K5N A;  1TII D;  1IW7 C;  5TSS A;  3S24 A;  1XJV A;  4DAM A;  5EPJ A;  2H4O A;  4A3I H;  2F3W A;  4DAP A;  3P7J A;  3L2P A;  5D65 A;  4O1N A;  4A3I B;  1TWC H;  5I9P A;  1ENC A;  2VQE Q;  4X66 L;  2N49 A;  2F0G A;  1TWC B;  4Y52 H;  5I9O A;  1TWG H;  1C48 A;  4APV A;  1L1O C;  5EQ0 A;  1UEB A;  1QJO A;  1TWG B;  1WTW A;  3RLN A;  3K81 C;  4BWG B;  5ISR A;  5CMD A;  1J9O A;  3OWE B;  3KUP A;  1F2Z A;  4IPD A;  1EY4 A;  2A6E C;  3IAY A;  1A62 A;  4GLA C;  3OTO Q;  1SRO A;  2K7V A;  5LMU L;  1SR3 A;  2ZXP A;  4L5Q A;  5COY A;  1VQH A;  2IHF A;  3DWA A;  4GKK L;  4QIW E;  2JP1 A;  2PW5 A;  1S5C D;  1KL9 A;  4JI1 Q;  1DGS A;  4LF6 L;  4FNF A;  2KUM A;  4AH6 A;  3MZ5 A;  1FGU A;  1VQO A;  1PH1 A;  1G2T A;  5CYU A;  4AYB E;  2ZTD A;  1TWF H;  3BVZ A;  5IT9 L;  1F9P A;  1TU2 B;  2I5M X;  2E5L L;  1EIF A;  1TWF B;  1UE6 A;  3PIO 3;  5BN3 A;  3BZC A;  4DV7 L;  4DV2 Q;  1S5B D;  2H1E A;  2ENB A;  1U5K A;  4KY6 A;  4RHS A;  1KAA A;  1A0I A;  1Q86 C;  1XMO Q;  1NAP A;  2VXW A;  1PH2 A;  4NMZ A;  1CA6 A;  1HR0 L;  2PQE A;  2AMC B;  3KOJ A;  4RHR A;  4GKJ L;  5LMN Q;  4HAE A;  4BBS G;  4R8I A;  4JI6 L;  2R3Z A;  5DM6 3;  1U4M A;  4HMI A;  4A3D G;  3RN5 A;  3I73 A;  3CPW A;  2RQX A;  1D5M C;  3CU7 A;  1X9N A;  1C9O A;  2NVT H;  4X65 L;  2F0K A;  4MIU A;  1II3 A;  2Q2T A;  1HXY D;  3G4S A;  3KJP A;  4L63 B;  3KK7 A;  2NVT B;  1DZ1 A;  1F9S A;  1WTO A;  3RD4 A;  1MBY A;  5JJZ A;  4UY8 C;  4A3D H;  4PZ7 A;  2G5D A;  1Y1W H;  2KOL A;  1JWU D;  4YWM A;  3NHH A;  3PIO A;  2EJG C;  4KN7 C;  1Y1W B;  2E2D C;  1PH5 A;  1PHJ A;  1WD0 A;  4JYA Q;  2A6H D;  3CXC A;  1VQN A;  4C56 C;  2EOT A;  3C1E A;  3HEJ A;  3HZX A;  4IFD G;  2UXB L;  2B2T C;  4R9W A;  1VQM A;  4YWK A;  3AFQ A;  4HMJ A;  1E2W A;  3NEM A;  4ULL A;  3CKI B;  2I5L X;  1EFI D;  1GUS A;  1AFP A;  1HZ9 A;  4F87 A;  3HOZ G;  4CKE A;  4DR5 Q;  1S40 A;  4B3M Q;  5GQO A;  5EBC A;  1MIU A;  2ZM6 Q;  3MVV A;  2UUC L;  1KNA A;  3NBI A;  1N33 Q;  3PMF A;  1HTL D;  4BBR H;  1AW7 A;  4F8M A;  1BBW A;  1UE5 A;  4IOA A;  1YNX A;  4BBR B;  3PQI A;  4JW0 A;  3A55 A;  3E5S A;  3H6M A;  5EKI A;  1OXS C;  2AQ1 B;  2PI2 A;  5C5M A;  3K80 C;  2M9V A;  1ZEQ X;  2A6H C;  2F3I A;  5IWA Q;  2ZT9 C;  2AQ3 B;  5ELD A;  2TSS A;  4E6I A;  1HA6 A;  4DV0 Q;  2WKD A;  5FO9 B;  2JK8 A;  3I4O A;  2BCO A;  2ID0 A;  1LTG D;  5FOB B;  2F0D A;  1G6P A;  2DY7 A;  2KHS A;  2EPB A;  2MJ8 A;  2PW7 A;  4KKS A;  4OL7 A;  5FO8 B;  4RAU C;  5NUC A;  1VQ7 A;  1RCV D;  3HG9 A;  3H3V I;  1XXG A;  3AQQ A;  2E8G A;  3A56 A;  3HOY H;  4DAV A;  2HHH L;  3LGJ A;  1EIY B;  2AWN A;  3HOY B;  2UXD Q;  1FGB D;  3BVG A;  2IWH A;  4KY7 A;  3CQZ H;  4Y7N H;  3JC6 6;  1DOM A;  1N32 Q;  3CME A;  3HKZ G;  3CQZ B;  4Y7N B;  4GNX B;  2GVA A;  1HQR D;  1V8Q A;  2RDH A;  3DM1 A;  4X3T A;  5JVG 3;  2C9O A;  2DNE A;  1L0Y B;  4CDE C;  1ASY A;  4XT3 B;  4N9P A;  1XTC D;  1KDB A;  4K2L A;  1NSN S;  2SNM A;  4PG3 A;  2A19 A;  4YHH Q;  4JI0 L;  4P2C B;  2K01 A;  3VR4 A;  1TS3 A;  1CUK A;  1ONL A;  4CDC C;  2KQ3 A;  1CKM A;  4RFB A;  3W1B A;  1KQS A;  1X3Q A;  3H3V H;  1EYA A;  3A8J E;  4DV6 Q;  3OMG A;  1HUM A;  1C8C A;  1SNQ A;  4JI2 L;  1MGS A;  1PH9 A;  4JC0 A;  3OIQ A;  4A3C H;  3A54 A;  2XRQ D;  4DR7 Q;  1S5E D;  3A8I E;  1M1K C;  3DUZ A;  2XNA C;  4C3I G;  1O7L A;  2J0T D;  1NCV A;  4L8J A;  3KF6 A;  4NDX A;  3BDO A;  4AQY L;  1SYG A;  1JQY D;  3LWU A;  1J5E Q;  1UNS A;  3H0G G;  1A2T A;  1CSQ A;  5EGT A;  3WDN A;  3UDF A;  1STE A;  2F0T A;  1B2T A;  2I46 A;  3K59 A;  1Q82 C;  1K9M C;  1K8G A;  5FLX c;  1UWV A;  2IY5 B;  1PTO H;  1SE3 A;  1LTB D;  3HKS A;  1EZ6 A;  4ID6 A;  4X62 Q;  4DK6 C;  3I4N H;  1NR2 A;  1PTO B;  2DJG C;  3VYU A;  3OWF A;  2Z1C A;  1B50 A;  4ZCK A;  4BS9 A;  3I4N B;  2FXQ A;  2JA8 G;  1GD7 A;  4YCU A;  1XNQ L;  4CKC A;  2LFN A;  1Z7T A;  4JI5 Q;  4A3G G;  2XVS A;  1JCK B;  1ASZ A;  4MHE A;  4DNR B;  2F0I A;  4KTA A;  5D3I B;  4A3K H;  1EQQ A;  1L0X B;  4RMF A;  2OQK A;  2N55 A;  5E1F A;  2L55 A;  1ILP A;  4TRD A;  2EY5 A;  4A3K B;  2X6G A;  2D0O A;  5C0X I;  3GTM H;  3TZD A;  1STH A;  1MJE A;  2L4N A;  1PH8 A;  1OXV A;  4OON A;  2K14 A;  5A2Q L;  3GTM B;  3I4M H;  2NVY H;  2PMZ E;  1K83 H;  3KF8 A;  2JJQ A;  3HOU H;  3BG3 A;  4LFB Q;  1JWS D;  1L2F A;  3I4M B;  2NVY B;  4A3L G;  5CBE E;  5HY6 A;  1QVC A;  1K83 B;  1Z47 A;  1OO9 B;  3HOU B;  3NQT A;  1EY8 A;  4HCS A;  3TP7 A;  2PCF B;  3OW2 A;  3VYT A;  3VYR A;  4UAI A;  3F2D A;  2F4V Q;  3DMU A;  4HJ9 A;  2JA5 H;  3HOW G;  4DV3 Q;  3GTL H;  3EIV A;  3C3L A;  4HJ7 A;  3RZO H;  2JA5 B;  1SMY D;  3T1H L;  1TS2 A;  1E22 A;  2MGS A;  4G7Z C;  4DF7 A;  3GTL B;  1EY7 A;  1J6Q A;  5ELB A;  1IYU A;  3RZO B;  5IGG A;  2EIF A;  4FXK C;  1CTM A;  5C0X H;  2OQ0 A;  3BZK A;  1F2L A;  1I5F A;  4I65 A;  2KVM A;  4JI3 L; 
#chains in the Genus database with same CATH homology
 4X66 Q;  3CCQ A;  1XMQ Q;  3M7N A;  1GM5 A;  1VQB A;  4DV4 L;  3PO3 H;  4JV5 L;  1SRU A;  2NVQ H;  1R9T H;  4POG A;  2RCN A;  1VQG A;  3UDI A;  4IPH A;  4X6A H;  5AJ3 L;  4KLK A;  1JJC B;  2JE6 I;  4PZ6 A;  2BH8 A;  2IHE A;  4PMW A;  4GN5 A;  3S1Q H;  1FL0 A;  1HZC A;  3M9B A;  3G6E A;  4O2D A;  3EN2 A;  1VQ8 A;  1NTG A;  3CAM A;  2YU9 H;  4JI4 Q;  1CSP A;  4LUO A;  1EYG A;  1QUQ A;  4FDB A;  2MNA A;  1N36 L;  2B63 H;  4IPC A;  5GAH C;  3CCJ A;  5M3F H;  3UE0 A;  2JEA I;  1GKH A;  1SMX A;  2CQO A;  4JI7 L;  1IBK L;  2NZH A;  3CMA A;  4A3J H;  2UUB Q;  3VDY A;  1XNR L;  3OTO L;  4IFD I;  4DV5 L;  2IX0 A;  4BBS H;  1VQF A;  4QJF A;  2K75 A;  2YTY A;  4A3E G;  1SN8 A;  2B3G A;  3CCM A;  4DUZ L;  4YCW A;  1SE8 A;  4JBM A;  2AHO B;  4DR4 Q;  2Y0S E;  4JI1 L;  1QUQ B;  1O7I A;  3CW2 C;  3TS0 A;  3H15 A;  1WOC A;  3I4N G;  1VQA A;  2V1C C;  3CC4 A;  1SLJ A;  2VY3 A;  4EX5 A;  5C0X J;  4PZ8 A;  1S3O A;  4J15 A;  1EWI A;  1WFQ A;  1YBY A;  2RHQ B;  4GN3 B;  3PUX A;  1HNZ L;  3S17 H;  4KI0 A;  3GDE A;  3J80 i;  1IBL L;  2I0Q A;  2UU9 L;  2KCM A;  1FJG Q;  1W3S A;  4B3T L;  4LF7 Q;  4LF4 Q;  2JA9 A;  2UXC Q;  3T1Y Q;  5FJ8 G;  3F2B A;  4JI8 L;  4A3K G;  2PI2 E;  3TRZ A;  1IZ6 A;  2WAQ G;  3JAM c;  3RZD H;  1VQP A;  2F52 A;  3KDF A;  3T1H Q;  4K0K Q;  4HJA A;  4ALP A;  5C4J H;  3S24 A;  1YIT A;  1XJV A;  4DAM A;  4QQB X;  4A3I H;  4LW1 A;  1Q8K A;  4DV2 L;  5IYC G;  3PUW A;  2CWP A;  4LF5 L;  3CP0 A;  3KLW A;  1VQL A;  4JOI C;  3L2P A;  1YJN A;  2D0P A;  3FKI H;  1TWC H;  1VQE A;  1D7Q A;  1X6O A;  3ULP A;  4OO1 G;  1XMO L;  4P74 A;  1YJW A;  2VQE Q;  4X66 L;  2E2H H;  4JI3 Q;  3S15 H;  1VQD A;  1X54 A;  2N49 A;  3J81 j;  3A5U A;  4A3F G;  1LYL A;  4DV4 Q;  2KHI A;  4JV5 Q;  1TWG H;  3I4M G;  2E2J H;  5LMN L;  1Q81 C;  4HIM A;  1M90 C;  4EQ5 A;  3U50 C;  4APV A;  1X55 A;  1L1O C;  5AJ3 Q;  1UEB A;  4X64 L;  3SGI A;  2NVX H;  3HOU G;  4GOP B;  3RLN A;  4YWL A;  3K81 C;  3PUY A;  4UPA A;  1IL2 A;  3HOZ H;  5IYC H;  3M4P A;  1QVF A;  3RLO A;  2VNU D;  4IO9 A;  1I3Q H;  4R4Q A;  1X3G A;  1NY4 A;  3K0X A;  5IY0 A;  1N36 Q;  1MJC A;  4IPD A;  3W1G A;  1JJ2 A;  3D31 A;  3GTK H;  4JI7 Q;  1IBK Q;  1A62 A;  1WI5 A;  4GLA C;  1EFW A;  1XNR Q;  3OTO Q;  1SRO A;  3ICE A;  2LSS A;  5LMU L;  1RIP A;  1SR3 A;  4DV5 Q;  5M3M H;  1KD1 C;  1V9P A;  4L5Q A;  1VQH A;  2IHF A;  3A0J A;  4LUV A;  4ME3 A;  3CCE A;  4GNX C;  2JA5 G;  4GKK L;  4QIW E;  4B3R L;  4DUZ Q;  3TS2 A;  1KL9 A;  1Z9F A;  1VS0 A;  4P73 A;  4JI1 Q;  1DGS A;  4LNQ A;  2Q2H A;  3A74 A;  1WCM G;  4LF6 L;  3PGZ A;  1PH7 A;  3E9I A;  4AH6 A;  4H02 A;  2R93 G;  2JA6 G;  1HNZ Q;  1FGU A;  1VQO A;  1X3F A;  2WP8 J;  1PH1 A;  2IX1 A;  4IOC A;  5C0X G;  2LXJ A;  1IBL Q;  1XPU A;  4AYB E;  2UU9 Q;  4JYA L;  4IFD J;  4WJ3 M;  1TXY A;  1U0L A;  3HKZ E;  5FLM H;  1HJP A;  1AE3 A;  2ZTD A;  1TWF H;  3U4V A;  2PNH A;  4B3T Q;  4OWW B;  1VQ6 A;  2MO0 A;  1LTL A;  1PYS B;  2I5M X;  4JG2 A;  3PO3 G;  1E1T A;  3M4Q A;  2K5H A;  4GLV B;  1YI2 A;  1EIF A;  3AYH B;  4GN4 B;  1KHI A;  2E5L L;  1WJJ A;  2JA7 H;  1UE6 A;  1WCM H;  2CWA A;  2DGY A;  1I94 L;  3S1N H;  2R7Z H;  4WJ4 A;  3J81 c;  3BZC A;  1IBM L;  4DV7 L;  4DR5 L;  1I50 H;  4B3M L;  4DV2 Q;  4LF5 Q;  1V1Q A;  5JJK A;  1U5K A;  2CCZ A;  2ZM6 L;  3RR5 A;  2UUA L;  2B63 G;  3NBH B;  2Z6K C;  1A0I A;  2RF4 A;  1Q86 C;  2N78 A;  2MFI A;  1XMO Q;  1N34 L;  1X56 A;  1PH2 A;  4A3J G;  4B3S L;  1N33 L;  2ES2 A;  4C3H H;  5GRO A;  1HR0 L;  5K36 G;  2AMC B;  2WFW A;  3KOJ A;  4GKJ L;  3PUV A;  3D0F A;  2ZJR A;  5LMN Q;  1VQJ A;  4BBS G;  4HJ8 A;  4JI6 L;  4NPS A;  3STB D;  4X64 Q;  1XPO A;  3I55 A;  2H5X A;  4A3D G;  3RN5 A;  2K5V A;  5ELN A;  3I56 A;  1NJI C;  3CPW A;  3J7A 5;  3RNU A;  1B70 B;  3HOV H;  2WB1 G;  1X9N A;  1C9O A;  3UDG A;  5DLQ E;  2NVT H;  4UP9 A;  3K8A A;  4X65 L;  1BVS A;  3TQY A;  4MZ9 A;  2Q2T A;  3G4S A;  3KJP A;  4DR1 Q;  3PUZ A;  1V43 A;  5IWA L;  5LMU Q;  2C35 B;  2KHJ A;  4TQU S;  2VZA A;  1LM0 A;  3Q8D A;  4L5T A;  1VCI A;  4UY8 C;  4YY3 L;  4BY7 H;  3CCS A;  4DV1 Q;  4A3D H;  4PZ7 A;  4JBW A;  4B3R Q;  1GVP A;  2KCT A;  1Y1W H;  1YVC A;  2BA0 A;  2KEN A;  5IE8 A;  1KXL A;  4DV0 L;  4LF8 L;  2NN6 I;  4YWM A;  4LFA L;  3PIO A;  4LF6 Q;  4DK3 C;  2MO1 A;  4XTC S;  4A3I G;  1PH5 A;  1PHJ A;  3GTQ H;  2CFM A;  4R4I A;  4JYA Q;  2PQA A;  1H95 A;  1IXR A;  3FKI G;  3CXC A;  1VQN A;  5JJL A;  3KJO A;  3NEL A;  3S1M H;  3CC7 A;  4IFD G;  4HIO A;  2VUM H;  2K4K A;  1Y14 B;  2IT1 A;  2E2I H;  2UXB L;  3AFP A;  1VQM A;  1P8L A;  4YWK A;  3AFQ A;  4O0A A;  2E5L Q;  1OXX K;  3NEM A;  2OTL A;  1FVI A;  2I5L X;  1EUJ A;  3L0O A;  3STB C;  1I94 Q;  5JEA G;  3PV0 A;  2Y0S G;  1HZ9 A;  1WYD A;  3HOZ G;  1IBM Q;  2PQA B;  4DV7 Q;  4DR5 Q;  4DR3 L;  1A8V A;  2HIX A;  4GOP A;  1S40 A;  4B3M Q;  5GQO A;  2UXD L;  1MIU A;  2ZM6 Q;  2QA4 A;  3CCR A;  5LMN W;  2UUA Q;  1Y1V H;  2UUC L;  4C3I H;  3J7Z C;  3ZJY C;  1N32 L;  1OXT A;  1TWH H;  2EQS A;  2YTV A;  1N34 Q;  4B3S Q;  1N33 Q;  4LF8 Q;  4BBR H;  5C3E H;  1HR0 Q;  5M3M G;  4GKJ Q;  3J80 c;  1BBW A;  1UE5 A;  2QEX A;  1UE7 A;  3PCO B;  4JI6 Q;  4LF9 L;  1PYB A;  1YNX A;  1CKN A;  5ELO A;  2Q2U A;  3H0G H;  3KYH C;  1JMC A;  3S2D H;  2BA1 A;  1HNX L;  3KFU A;  1OXS C;  1KRS A;  4KHZ A;  4NB3 A;  4XIG S;  3AEV A;  5C4X H;  3RN2 A;  1Q7Y C;  5C44 H;  1L0W A;  4YHH L;  2MQH A;  2OCE A;  2PI2 A;  5HGQ A;  3CCV A;  4X65 Q;  3K80 C;  4HID A;  2L15 A;  4C2M H;  4DR1 L;  2GN5 A;  4JOI A;  2GVB A;  2QGQ A;  4L5S A;  2F3I A;  4MNO A;  5IWA Q;  5BR8 L;  1CKN B;  2A1A A;  5FLM G;  1PH4 A;  1YHA A;  4NXN L;  1YEZ A;  4DV6 L;  4LUZ A;  4P71 A;  4R4O A;  4DV1 L;  4YY3 Q;  1JB7 A;  4P72 A;  3U58 A;  5M5Y H;  2JA8 H;  1BKB A;  4JCV E;  3TEH B;  4DV0 Q;  1BBU A;  4LFA Q;  1L1O A;  4JI2 Q;  1PH6 A;  3CC2 A;  2OWO A;  2R7Z G;  2JK8 A;  4DR6 L;  2Q2I A;  3I4O A;  4A3G H;  3W5O A;  4QY7 A;  4C3J H;  3ER0 A;  1VQ9 A;  2ID0 A;  4IOA A;  2K5N A;  3PIP A;  5GAE C;  4BY1 H;  4DR7 L;  1KC8 C;  1G6P A;  1A63 A;  3M3Y H;  1NMF A;  3TRE A;  1KAW A;  1YHQ A;  4RG1 A;  3ULL A;  1K73 C;  1VQ5 A;  1VQ7 A;  3H3V I;  2UXB Q;  5JEA J;  1L1O B;  1SFO H;  1VQK A;  1AE2 A;  3GTP H;  2ALY B;  4GNX A;  3A5Z B;  3AQQ A;  1J5E L;  2E8G A;  1JT8 A;  4BXX H;  1I6H H;  3HOY H;  2HHH L;  3LGJ A;  4A3M H;  1PA6 A;  4DR3 Q;  1EIY B;  3HOV G;  1RL2 A;  2AWN A;  4OWT B;  3PO2 H;  1HR0 W;  2UXD Q;  1GO3 E;  2VL6 A;  3CQZ H;  4Y7N H;  3JC6 6;  2R7F A;  3GO5 A;  2HIV A;  4IPG A;  2XGT A;  4DR2 L;  2UUC Q;  4AYB G;  3PF4 A;  2R6G A;  1N32 Q;  4QGU A;  2LXK A;  3CME A;  3HKZ G;  4A3L H;  2ZJP A;  1PVO A;  1JJG A;  4GNX B;  3G71 A;  4X62 L;  2GVA A;  1HH2 P;  4HJ5 A;  5IYD H;  1E7Z A;  2A8V A;  3E0E A;  3EBE A;  4LF9 Q;  4BY7 G;  4UP8 A;  1QZG A;  1LUZ A;  4HIK A;  4R4C A;  4TVA B;  1Y1W G;  3HOX G;  1ASY A;  5IP9 H;  1HNX Q;  1NMG A;  3PF5 A;  3CCL A;  4IJH A;  4PG3 A;  5IP7 H;  2A19 A;  1UE1 A;  4JI5 L;  4YHH Q;  4JI0 L;  3S14 H;  2K50 A;  1K3R A;  3HOW H;  4P75 A;  1W2B A;  1CUK A;  3K7U C;  2OTJ A;  1CKM A;  3W1B A;  3GTG H;  2Z6K A;  3MEF A;  5BR8 Q;  1KQS A;  4A75 A;  3H3V H;  3ERS X;  4QL5 A;  4L5R C;  4NXN Q;  3B6Y A;  1CKO A;  3L7Z C;  5GAD C;  4DV6 Q;  3HFZ B;  2VUM G;  1XTD A;  3HOX H;  1T9H A;  4GKK Q;  1AH9 A;  3NEN A;  4JI2 L;  1PH9 A;  3GTJ H;  4JC0 A;  4DR6 Q;  1C7Y A;  3M85 A;  3E9H A;  4A3C H;  1G29 1;  2VQF L;  3JAM i;  1HNW L;  3UDX A;  4DR7 Q;  1TWA H;  3BJU A;  1M1K C;  1Y1V G;  4DNI A;  4LFB L;  2XTI A;  2WAQ E;  4BBR G;  3KF6 A;  5C3E G;  1OXU A;  4AQY L;  4GOP C;  1Q1B A;  3F8T A;  2B29 A;  4YCV A;  4LFC L;  3K7A H;  1J5E Q;  3H0G G;  4IJL A;  1JE5 A;  2BH2 A;  5E7N A;  2HHH Q;  1Q1E A;  2NN6 G;  5IT9 c;  5JJI A;  2AKW B;  1X3E A;  3S16 H;  4OO1 I;  1CSQ A;  1D8L A;  3ULJ A;  4DUY Q;  5C4X G;  3UDF A;  2ZTC A;  5C44 G;  3F1Z A;  4OX9 L;  2F4V L;  3DM3 A;  3I7F A;  4R1J A;  1EQR A;  4A3E H;  1Q82 C;  4DR2 Q;  1K9M C;  2HQL A;  1QZH A;  3KF6 B;  5FLX c;  4DV3 L;  1K8G A;  4Y52 H;  1UWV A;  4MTN A;  2IY5 B;  1PH3 A;  3HKS A;  4X62 Q;  5IYB G;  1N9W A;  2ASB A;  2N8N A;  2D62 A;  4DK6 C;  3I2Z A;  3FHW A;  4DKA C;  3I4N H;  3DLL A;  2HT1 A;  4KHP L;  2ZTE A;  1VQI A;  5M5X H;  1XPR A;  1OTC A;  2FXQ A;  2JA8 G;  1GD7 A;  4YCU A;  1PFS A;  1VQC A;  4NXM L;  3MXN B;  2K52 A;  1XNQ L;  2R92 G;  3GTO H;  5M5W H;  1K8A C;  4JI5 Q;  4A3G G;  4JI0 Q;  1HZB A;  4A76 A;  2N3S A;  2R7D A;  2YYZ A;  1B8A A;  1ASZ A;  4JBK A;  1KRT A;  1P16 A;  3FP9 A;  4R4T A;  1XMQ L;  1X65 A;  4BY1 G;  5FJ8 H;  3KDF B;  5IYB H;  4A3K H;  2I5H A;  3U4Z A;  1G51 A;  1EQQ A;  4RMF A;  1EOV A;  2OQK A;  1YJ9 A;  1YZ6 A;  1IYJ B;  4BA2 I;  1PV4 A;  3RLF A;  2D0O A;  2AWO A;  4JI4 L;  3S2H H;  2R92 H;  1YIJ A;  2VW9 A;  3BU2 A;  4BXX G;  1MKH A;  3HOY G;  5C0X I;  3GTM H;  2JQO A;  2VQF Q;  1MJE A;  4A3M G;  3F2C A;  2UUB L;  1PH8 A;  1OXV A;  2CKZ B;  4OON A;  2K14 A;  4A3F H;  3PO2 G;  1HNW Q;  3I4M H;  1HZA A;  2NVY H;  2PMZ E;  1E3P A;  3J81 i;  3CF5 A;  1K83 H;  2JJQ A;  3G48 A;  3HOU H;  4A3B G;  2KBN A;  4LFB Q;  4OXP A;  1L2F A;  4DAY B;  4A3L G;  5HY6 A;  1QVC A;  1NBW A;  5IYD G;  4DR4 L;  4A93 G;  1Z47 A;  3IRB A;  4AQY Q;  3CCU A;  4LFC Q;  2DUD A;  1B7Y B;  4DPG A;  3OW2 A;  1KIX A;  2YV5 A;  1C0A A;  5IP9 G;  2YTX A;  4DUY L;  3F2D A;  3UE1 A;  2NZO A;  1K0R A;  3KF8 B;  1FJG L;  3WWV A;  5IP7 G;  4OX9 Q;  2F4V Q;  5EAY A;  4HJ9 A;  4A3B H;  1E24 A;  1QVG A;  2ATW A;  2JA7 G;  2JA5 H;  2Z0S A;  4LF7 L;  3HOW G;  4DV3 Q;  4LF4 L;  1Q46 A;  2UXC L;  3T1Y L;  1NE3 A;  3EIV A;  3GTL H;  1YHB A;  4GLX A;  4A93 H;  2ZJQ A;  4HJ7 A;  3RZO H;  4JI8 Q;  4K0K L;  3T1H L;  2VS1 A;  1E22 A;  4LWC A;  4A4I A;  3PSI A;  4OWX B;  1J6Q A;  3CPF A;  2WB1 E;  3GD7 A;  4POF A;  3M4O H;  2EXD A;  5GAG C;  3S1R H;  4KHP Q;  2JA6 H;  1S72 A;  2R93 H;  3CD6 A;  2EIF A;  5J3B A;  2JEB I;  1Q12 A;  4UP7 A;  5H1S E;  4AIM A;  2RHS B;  4JBJ A;  2OQ0 A;  4NXM Q;  1XNQ Q;  1E1O A;  3BZK A;  3OYY A;  1N8R C;  1I5F A;  4BA1 I;  4A3C G;  5M3F G;  2VQE L;  1VQ4 A;  4GS3 A;  4JI3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...