4B3RL

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rL00
4LUOA 1JB7A 4A3GG 1J5EL 2NVXH 5JJLA 3F2BA 4IPGA 4DNIA 1EIFA 1LM0A 1WFQA 2ZJQA 3TS2A 3KJPA 4TQUS 3F2DA 4OO1G 4LF8L 1VQCA 1K73C 2ZTCA 1K9MC 2VQFL 1BBWA 4PMWA 3STBD 5C3EH 3A5ZB 1N33L 3BZCA 4UP9A 4HIDA 1L1OA 4APVA 5IP7G 2YTYA 4PZ7A 1QVCA 2AMCB 1I94Q 2IHEA 1N36Q 4B3TL 2UXCQ 2Q2IA 1OXTA 1OXUA 4BY1H 2GVAA 4LFBL 1AE2A 5M5YH 2I5HA 4HIKA 1L1OB 3CF5A 4LF6Q 4X66L 4IFDI 4ALPA 2QA4A 1HNZQ 2ZTDA 5M3MH 1HJPA 3G71A 5LMNL 5M3FG 4LUVA 4R4QA 5FLXc 4GNXB 1IBML 4R1JA 4JI1L 2WAQG 2H5XA 4MZ9A 1K0RA 4IO9A 1VQMA 4OX9Q 3A0JA 1W2BA 2JA5H 1AE3A 4DR4L 4A3BG 1Y14B 4DUYL 1VQPA 3HOZH 1A63A 3Q8DA 4BBSG 2YTVA 3RLNA 4BBRH 5GROA 3PIPA 4LF6L 1HH2P 1D7QA 1VQHA 2XGTA 1R9TH 1HR0L 2YU9H 1XPRA 2MNAA 2YYZA 2BH8A 2NN6G 4JI8Q 3UE0A 1YJ9A 1YJWA 2NZHA 2B3GA 1KXLA 1BVSA 2N78A 2VS1A 5H1SE 1CSQA 1BBUA 1EUJA 2ZTEA 4QJFA 3M9BA 3D0FA 1OXSC 4JG2A 4MNOA 2UXDQ 2PQAA 4RG1A 3S2DH 4X65L 1E7ZA 1QZHA 4DV2Q 2NVYH 4DR7L 3CXCA 3CCRA 4JI1Q 5GAHC 2KHJA 4JI4L 1HR0Q 3CC7A 4KHPQ 4X6AH 2WP8J 5IYDH 1W3SA 3AFPA 1TWAH 5IT9c 1HR0W 4JI0Q 1CKNA 1N36L 4B3MQ 1K3RA 3T1HQ 3NEMA 1IBKL 2R7ZH 3PF5A 1G6PA 2VY3A 3FKIG 4L5TA 1X9NA 1KIXA 3CP0A 4BY7G 4A3KH 1EQQA 3PGZA 4JI4Q 1HNWQ 4X62Q 5LMNW 3HOWG 1WOCA 2B29A 1HZBA 4DR3L 4HJ9A 1OTCA 1RIPA 3CCQA 3EN2A 1I3QH 1G51A 1I5FA 1N34L 1UE6A 4JBJA 4A3BH 3F1ZA 4JV5Q 5IYCH 2HHHL 4JI3L 2A1AA 4JI2L 4P71A 3VDYA 3I4NG 1FGUA 5JEAJ 3KOJA 4DUYQ 3H0GG 1WCMG 1YHAA 2OQ0A 2Z6KA 3JC66 4IPHA 2VW9A 4DV1L 1EFWA 1I6HH 3HOUG 4A3JG 2R7ZG 4DV5Q 4DR3Q 4A3MG 1C7YA 3RN5A 1ASZA 3RZDH 1PH6A 1KAWA 3K0XA 4J15A 3H3VI 1PH4A 3S24A 1QUQB 1HNWL 1NBWA 1N32Q 1VQ4A 1S40A 3JAMi 4XTCS 4LFCL 1I94L 1UE7A 2E8GA 3DLLA 4X65Q 3B6YA 1OXVA 1TWCH 3UDXA 4JI6L 4AQYL 4A3JH 3ULLA 2OWOA 2DUDA 3E0EA 1NJIC 1X6OA 1SFOH 3CC2A 3FP9A 2R93G 4BXXG 3KLWA 4LF7Q 3U50C 1VQ7A 4P72A 4DV5L 3PUVA 2JQOA 4DV4Q 2N49A 4LF9Q 1VS0A 4X64L 1VQJA 4AH6A 4BBSH 4GKKQ 3HOZG 1YHBA 1P8LA 5LMNQ 1KD1C 1SN8A 3HOWH 2JA5G 4AQYQ 1N9WA 3GO5A 3FHWA 4OX9L 4K0KL 3S15H 2D0PA 2R93H 2L15A 1C0AA 2BA1A 1KL9A 1HZAA 2PI2E 3GTJH 3HOVG 2AWNA 3M4PA 4YCUA 3F8TA 3HOXH 1YITA 1JE5A 5JJIA 2R92G 2CWAA 1XNRQ 5K36G 3DM3A 3K80C 4DK6C 2WAQE 1LYLA 5M5XH 1VQNA 5C0XG 1Q81C 1L0WA 4C3JH 3J7ZC 4A3IG 3I7FA 4OO1I 4AYBG 2IY5B 4DUZL 4NPSA 4A3MH 1FJGQ 4HJ5A 2UU9Q 2R7DA 3CCVA 3CMEA 2JJQA 1CKMA 4A4IA 1WYDA 5GQOA 2JA6H 4YCVA 1E3PA 4NXMQ 5C3EG 2B63H 4JYAQ 2D0OA 2C35B 4YY3Q 1XMOL 3NENA 4HJ8A 1Q1BA 4DR6Q 3PV0A 3GTPH 1QUQA 2NVTH 2MO1A 2K52A 5E7NA 1PH3A 2HIXA 2ZJPA 3S14H 2IT1A 4A3GH 4TVAB 1JJ2A 2PQAB 4YWLA 2KBNA 4DAMA 1IXRA 2PNHA 5FJ8G 2JEAI 2N8NA 4PZ6A 2I0QA 1E22A 1UEBA 1Y1VH 2D62A 4JI5L 4HIMA 4LF4L 4JOIA 1A8VA 3I4OA 3CPWA 4X62L 4DUZQ 4OXPA 3J80i 5IP9H 3G4SA 2E5LQ 2EQSA 2QGQA 2RHQB 1CKNB 2F4VQ 4A76A 4B3ML 4NXNQ 1VQ8A 4GN5A 2K5NA 4DR2L 1K83H 1XPOA 2PMZE 3K8AA 1SRUA 5IWAQ 4O2DA 1EOVA 1B70B 1X55A 1L1OC 3T1YQ 1PH8A 2ID0A 3TREA 4DV0Q 4C3IH 2CWPA 2ASBA 3CW2C 1KQSA 1TXYA 1GVPA 1YHQA 1SMXA 1IBLL 2RHSB 1EYGA 5IP7H 4DV7Q 2ES2A 1IL2A 3MEFA 3KF6B 4DR2Q 4KI0A 4A3CH 1N32L 3CMAA 3GTGH 1GD7A 2VQFQ 2AHOB 4GLXA 2GVBA 4GN3B 1VQBA 2PI2A 3BZKA 3HKZG 2F4VL 5ELOA 4JI6Q 1HZ9A 4KHZA 1IYJB 4MTNA 4QL5A 2ZM6Q 2CQOA 3HKSA 4JBWA 3MXNB 4LWCA 4A3FH 4A93H 1PVOA 4Y52H 2A19A 1E24A 1IBLQ 2YTXA 3HOVH 3H15A 1VQ5A 3OTOL 1HNZL 3I55A 2OCEA 4UP7A 2KCMA 1A62A 4IJLA 3E9IA 1IBMQ 1MJCA 1Z9FA 4LFAL 1MKHA 2NZOA 4RMFA 5FJ8H 4DV7L 4QIWE 3W1BA 5IE8A 1QVGA 5C4XH 2ATWA 4K0KQ 2VQEQ 4DV3L 4A3FG 4A3DH 1YVCA 1UE1A 3J81c 3BU2A 1Q7YC 4R4TA 4A3LH 3TQYA 2K75A 4DR4Q 1S72A 1N34Q 2XTIA 2V1CC 2LXJA 1VQFA 3EBEA 3KF8B 4IFDG 1VQKA 4HIOA 4O0AA 2UXBQ 4LNQA 4P74A 5FLMH 4JI3Q 5IY0A 1HNXQ 2VQEL 4DV3Q 3UDGA 4JBKA 3GTMH 2BA0A 1PV4A 2ZJRA 4A75A 2E2JH 4A3LG 4L5RC 4GOPB 1QVFA 1A0IA 3OYYA 2UUBQ 4B3RL 3CCMA 4QGUA 1TWHH 3PO2G 4OONA 1XTDA 3HOXG 2Y0SG 3PF4A 4JI7Q 3CAMA 1YJNA 4A3EH 4DPGA 1WCMH 4DR6L 4KHPL 5JJKA 4C2MH 3AQQA 1UE5A 2CFMA 4DV6L 2UUCQ 2ZM6L 2RCNA 3NBHB 1Q86C 3J81i 1X3FA 1Y1VG 3CQZH 4LW1A 1IBKQ 2VZAA 4JCVE 2YV5A 3KFUA 1PH9A 1L2FA 1H95A 1YBYA 4UPAA 2E5LL 1I50H 3TRZA 3I2ZA 3M3YH 4GN4B 3BJUA 4AIMA 3KF6A 4LFAQ 4A3KG 4OWTB 3HOYH 4BXXH 4QQBX 3PIOA 4EX5A 3PO3G 2UXDL 4A3CG 4ME3A 3J7A5 1KHIA 4JC0A 1GKHA 4IFDJ 1N8RC 4B3TQ 2UXCL 1VQDA 4JOIC 3S17H 1S3OA 1XJVA 2EIFA 3CCLA 3CD6A 1V1QA 4IOAA 3S1RH 2N3SA 5ELNA 3PCOB 1YZ6A 3L7ZC 3E9HA 4EQ5A 2IHFA 1UWVA 5IYBH 2UUCL 2JA8G 3ULPA 1K8AC 3CC4A 1ASYA 3G48A 1VQ9A 1YEZA 4YHHL 2NN6I 1Q8KA 2QEXA 4DV1Q 1K8GA 1YI2A 2Y0SE 5LMUQ 2IX1A 2OTJA 3S16H 2UXBL 1FL0A 2VL6A 1Q1EA 2WB1E 4DAYB 1SE8A 1Y1WG 1M1KC 5GAGC 1JMCA 1XNRL 4WJ4A 2K4KA 4QY7A 3PO3H 2HQLA 3CCSA 2R7FA 3GTKH 3PUYA 4BA2I 3HOYG 5IP9G 4LUZA 5M5WH 1VQ6A 3U58A 2IX0A 3STBC 1HZCA 1PYBA 4BBRG 1P16A 5C0XJ 3I4MH 1EIYB 4NXML 3K81C 4DV4L 4GLVB 4IJHA 4YY3L 1VQIA 1XMOQ 1KRSA 4LF9L 2HT1A 2Q2HA 3U4VA 3JAMc 3CCUA 3RLOA 3K7AH 1E1TA 4XIGS 4POGA 3S2HH 1Q46A 2B63G 3PUZA 5M3MG 1XMQL 2JA6G 1VQAA 1PYSB 3S1MH 1NTGA 2BH2A 1C9OA 4DV2L 3UE1A 1VQGA 3OW2A 1GO3E 3ERSX 1XPUA 1X3GA 3AYHB 4GNXA 5C4JH 3T1HL 1VQLA 3CPFA 1SROA 3IRBA 1E1OA 4X66Q 5IYDG 4IPDA 2A8VA 4R4OA 4GLAC 1JJCB 1SR3A 2EXDA 1PHJA 3TEHB 3ZJYC 4A3IH 4Y7NH 2Q2TA 4B3SQ 4HJ7A 5IYBG 2JA8H 1CSPA 2AKWB 2JK8A 3GD7A 5HGQA 5FLMG 1OXXK 3ULJA 3UDFA 2E2HH 2Z6KC 2WB1G 3M4QA 2GN5A 3ICEA 2I5LX 1MJEA 5GADC 4LF7L 4H02A 4DV0L 3A5UA 1X56A 2K5HA 3G6EA 5LMUL 3I4NH 2JEBI 2HHHQ 2JA7G 2ALYB 1AH9A 5BR8Q 4PZ8A 1B8AA 4DR1L 4A3DG 1NY4A 3HFZB 1V43A 3EIVA 1PH5A 2K14A 3M4OH 1NMGA 2R6GA 3S1QH 4UY8C 3RZOH 5C4XG 4GKJQ 1G291 2NVQH 4GNXC 4X64Q 1J6QA 2K5VA 2AWOA 2LXKA 1SLJA 1J5EQ 3CCEA 2JA7H 4DR7Q 5JEAG 2KCTA 3AFQA 2LSSA 4AYBE 2VNUD 2K50A 5M3FH 1Q82C 1NE3A 1B7YB 4KLKA 4LFCQ 2F3IA 4WJ3M 1MIUA 1YNXA 4JI0L 4A93G 2Z0SA 1PH2A 4DR5L 3NELA 4GKJL 1RL2A 3L2PA 1EQRA 5HY6A 5GAEC 3K7UC 2OTLA 4BY1G 4HJAA 2CCZA 2WFWA 4GS3A 4L5QA 3KJOA 4GOPC 1CUKA 3M85A 4LFBQ 4PG3A 1XNQL 3PUWA 3TS0A 5C44H 4P75A 3U4ZA 2Q2UA 4JBMA 2I5MX 2UU9L 4R4IA 3HOUH 4YWKA 4YCWA 4GKKL 4P73A 3S1NH 3H0GH 3J80c 4DKAC 2KHIA 3RLFA 3SGIA 4DR5Q 1GM5A 1JJGA 4NB3A 4OWWB 4JI2Q 5IYCG 1QZGA 5C0XI 3UDIA 5AJ3Q 4L5SA 1PH1A 2MFIA 4FDBA 1Q12A 3KYHC 1LUZA 3I4MG 3L0OA 1LTLA 1YIJA 2HIVA 2VUMG 1VQOA 5BR8L 3KDFB 4DR1Q 4BY7H 3GDEA 5EAYA 1JT8A 4NXNL 3FKIH 3OTOQ 4POFA 3AEVA 2JE6I 1Z47A 5DLQE 1FJGL 1VCIA 2OQKA 5IWAL 5J3BA 1Y1WH 3PO2H 1WJJA 4YWMA 1IZ6A 3W5OA 2DGYA 1X65A 3F2CA 1KRTA 2CKZB 1EWIA 2UUAL 4C3HH 4DV6Q 2E2IH 1X54A 4OWXB 1WI5A 3I56A 3WWVA 1XMQQ 4LF5Q 4DK3C 1U0LA 1T9HA 3J81j 2MQHA 3LGJA 1PH7A 1DGSA 1NMFA 3RNUA 4JYAL 3A74A 5C44G 1TWFH 2MO0A 3PUXA 1D8LA 4BA1I 4B3SL 1VQEA 3KDFA 1HNXL 3D31A 1XNQQ 4LF8Q 3H3VH 3ER0A 4LF5L 1X3EA 3RN2A 3GTLH 3GTOH 3RR5A 2F52A 1PFSA 1N33Q 2R92H 4JI5Q 2KENA 4UP8A 2UUAQ 3CCJA 2UUBL 4LF4Q 1PA6A 1TWGH 3M7NA 1O7IA 1CKOA 3W1GA 4YHHQ 1KC8C 5AJ3L 4IOCA 3HKZE 4JV5L 1BKBA 1U5KA 4B3RQ 3T1YL 2FXQA 2RF4A 1FVIA 3PSIA 4IPCA 2JA9A 4JI8L 4A3EG 4R4CA 3GTQH 2VUMH 1M90C 1V9PA 4GOPA 4JI7L
chains in the Genus database with same CATH superfamily
4X3KA 2O5JC 4IPGA 1EIFA 1LM0A 1RF2D 3GTLB 1K73C 4K14A 5C3EH 5IP7G 2YTYA 1PMRA 4PZ7A 1Z7TA 4BS9A 2PPBC 3E0JA 3A7LA 4F87A 4CDEC 3D3RA 1GUWA 1STNA 3CF5A 4LF6Q 4BY7B 4ALPA 2L11A 2QA4A 1FGBD 2F0GA 3SEBA 3NBIA 3S1RB 2H5XA 1U9RA 4K2KA 4Q0FA 4J8QA 1VQPA 3Q8DA 2YTVA 2RDGA 1VQHA 2XGTA 1R9TH 2YU9H 1Z6HA 1XPRA 1U4PA 2YYZA 3UE0A 3KLSX 1YJWA 1BVSA 3VR5A 1BBUA 1EEID 2ZTEA 1PTOH 4JG2A 4ZUJA 2UXDQ 3MFGA 3K59A 1RDPD 2KHJA 4JI4L 5CYUA 3ERQA 4X6AH 5ELCA 5IYDH 1ICWA 1W3SA 1X32A 2X6LA 1W6JA 1TY0A 1G6PA 2VY3A 2EY6A 2NWGA 1XX8A 2Z6BA 1KIXA 2HD3A 3HEJA 4BY7G 1SEBD 2IX3A 3PGZA 3E6ZX 2P5ZX 4JI4Q 4X62Q 3D6WA 4DR3L 3NK9A 1WVLA 1RIPA 1OTCA 1I5FA 3HOWB 1UE6A 3SK4A 3KBXA 1DOKA 5IGEA 5IYCH 2HHHL 3HOVB 4JI3L 4JPBW 2A1AA 5TSSA 3BYYB 4P71A 1SE2A 3TMEA 1GUTA 5BN3A 2OQ0A 3JC66 1EFWA 5ELFA 1KDBA 3BDOA 5DM63 2E2JB 4A3MG 3RZDH 5KNBA 1N32Q 4XTCS 4LFCL 1F2MA 1UE7A 3DLLA 3OW7A 4KY5A 3UDXA 1TWCH 5LL6S 4JI6L 1SNQA 2XRSD 2OWOA 2DUDA 3VYTA 1X6OA 3TP5A 2F0PA 3CC2A 3FP9A 2R93G 4BXXG 3L3OC 3KLWA 5A2QE 4XXEA 3U50C 3MFYA 1VQ7A 2F03A 1B3QA 1G8ZD 2JQOA 3QWNA 4LF9Q 2N49A 2PW7A 1W6KA 4BBSH 4FF1A 3T56B 2F0SA 1I3QB 2EVBA 2JA5G 1N9WA 3GO5A 4OX9L 1GUGA 5IODA 2JA6B 1HZAA 1KL9A 2HDLA 2PI2E 4QF4A 3GTJH 3HOVG 1JOQA 1PTOC 2NVYB 1EIGA 3NWSA 2CWAA 4C3HB 1SYGA 2Z4HA 1VQNA 1TQOA 1BCPD 4DUZL 2WINB 4NPSA 1FJGQ 1PLFA 1SYBA 4A4IA 5GQOA 1O7LA 4IURA 3S2DB 2X69A 4JYAQ 2D0OA 1Y1WB 3PO2B 3NENA 1SFOB 1Q1BA 4KD3A 4DR6Q 1QUQA 3DWAA 3NTIA 1ET9A 1SNOA 2HIXA 2MUYA 3HOZB 4TVAB 4FXGC 4JW0A 1PZKD 5FJ8G 2JEAI 4PZ6A 1RKNA 2D62A 4HIMA 4LF4L 1A8VA 4DUZQ 2ZT9C 5IP9H 5C44B 3G4SA 3NWTA 2K7VA 4CDFC 2QGQA 2RHQB 2IL8A 4FF4A 1CKNB 1KLUD 2Y0SB 3R3OA 2PMZE 5IWAQ 1HQMC 2B2UA 3TREA 2B39A 5AFWA 4QMGA 1LT4D 1KQSA 3MZ5A 2XVSA 4DV7Q 1IL2A 1E2VA 1E2WA 3GTGH 2B63B 1CT1D 3A7AB 4GN3B 1VQBA 3BZKA 2K05A 3HGBA 1HZ9A 4KHZA 3HKSA 2PZUA 1ZXTA 4CBVA 3SR1A 4OL7A 5IGBA 3VR2A 1WD1A 2M2LA 4DXFA 4UP7A 1H9JA 1JWUD 1RTNA 1IBMQ 4LFAL 1S5CD 3W1BA 5CV8A 5C4XH 2Q8IB 2ATWA 5E3FA 2VQEQ 1ZYRD 1EYCA 3HZXA 4A3DH 1JICA 1UE1A 4A3LH 5EQ0A 3TQYA 3VR6A 2KCCA 3D6CA 2SEBD 1EY6A 5M3FB 1SBBB 4CKCA 3KF8B 3U9OA 2XWBB 4LK1C 3EVQA 4JI3Q 3N52A 2VQEL 4DNTB 1TKWB 4CKBA 2BA0A 4A3LG 1PFBA 4L5RC 2PYKA 4QGUA 3K5OA 4OONA 2WV6D 4RKBA 1EZ8A 4FVMA 3PF4A 3PO3B 3CAMA 1YJNA 3HOUB 4DR6L 5EGTA 4KHPL 2BE5C 2F0NA 2CW0D 1UE5A 3NBHB 4UDUC 2VZAA 4JCVE 3KFUA 1M8AA 1WTWA 1YBYA 3LNNA 1EU3A 1F9QA 3I2ZA 3M3YH 1PYWD 3TRZA 3BJUA 1CTMA 4OWTB 5L37A 1TWHB 4BXXH 2SNSA 1STAA 1U4RA 4ME3A 3FKIB 4JC0A 2B2VA 2UXCL 3QR8A 5IGFA 3CHBD 1XJVA 2KHSA 4IOAA 5D65A 5ELNA 4EQ5A 1UWVA 2XN9C 3ULPA 5ISRA 1VQ9A 3SXHA 5E1FA 1YI2A 2Y0SE 1Y1WG 4K2LA 2EYLA 3NSWA 5CV6A 4ZAIA 3PUYA 4BA2I 3HOYG 5IP9G 4LUZA 1STYA 3U58A 3HS0C 3NUCA 5KGUA 1HZCA 2O2LD 1A15A 5C0XJ 1GHKA 3K81C 3OWFA 2HT1A 1TT2A 2HCCA 3K7AH 4MHEA 4XIGS 4QIWB 3PUZA 1SAPA 3HOXB 1VQAA 2BH2A 2VUMB 1VQGA 1BUVT 3AYHB 1K8OA 5C4JH 1VQLA 1SSOA 1SROA 3IRBA 4X66Q 3I90A 4G7OC 4ME5A 2A6EC 2KEEA 1JJCB 3TEHB 4HJ7A 1CSPA 3GD7A 5FLMG 1OXXK 3UI2A 1PRTF 3J7AV 2WB1G 1A6XA 2GN5A 3H6MA 4LF7L 4NMZA 3R2TA 2RVLA 3G6EA 2MJ8A 4FP5D 2ALYB 1AH9A 5FO7B 3EIVA 4MTKA 2K14A 4UY8C 4RAUC 1CQFA 2F0QA 1LTAD 3JAME 2JA7H 2E2DC 3CCEA 1AFPA 4KN4C 3SHLA 4AYBE 4C56C 4PQXA 1Q82C 1NE3A 4LFCQ 1NAPA 2F3IA 1YNXA 3N6RA 1HFNA 1S5FD 4LAAA 3GTMB 1RL2A 3L2PA 1EQRA 1F9RA 2M00A 2EPBA 4BY1G 2NUCA 1NR4A 1LTBD 4Y7NB 4PG3A 1XNQL 5C44H 4JBMA 1NNXA 2I5MX 2TSSA 5C3EB 2UU9L 4R4IA 1GHJA 4YWKA 4GKKL 1EL0A 3CU7A 4DAPA 3R8BA 5EBCA 3RUZA 3DXJC 4O1NA 4NB3A 1EFID 5JJZA 4OWWB 4JI2Q 1QZGA 5C0XI 1TWAB 1PH1A 3Q6SA 4FDBA 1LUZA 5EKLA 1LTLA 4XT1B 4K8JA 3QOLA 3KDFB 4BY7H 3GDEA 1D1IA 3OTOQ 2HCIA 2JE6I 1Z47A 5DLQE 1FJGL 1T5EA 5J3BA 2KCNA 1Y1WH 2A73B 1WJJA 2DGYA 1X65A 3SDZA 4A3IB 1R4QB 3HG9A 2CW0C 2BE5D 3OMCA 4LF5Q 2JSOA 1O7ZA 4KN7C 2F1MA 2MQHA 3LGJA 3A74A 2F0EA 2MO0A 3PUXA 1LTTD 3VA7A 3NP8A 2ICIA 4EQOA 4LF8Q 2EJGC 3ER0A 1DONA 4RFBA 1X3EA 4ID6A 3GTPB 1LABA 1TU2B 3RR5A 1N33Q 2KENA 4UP8A 2UUAQ 2K03A 4LF4Q 3I3CA 3I8ZA 1O7IA 4YHHQ 2EXZA 4JV5L 1U5KA 4ULLA 2FXQA 3PSIA 1FVIA 2KECA 2PZTA 4IPCA 4R4CA 1QG7A 4HCEA 5I4DA 1V9PA 3KK7A 4G7ZC 1JB7A 4A3GG 4U68A 5I6WA 2ZJQA 1RHPA 2WKDA 3BVGA 3MWYW 4OGQC 4TQUS 4R8IA 4LF8L 1K9MC 2L55A 2R92B 2KJXA 1N33L 4ILWA 2MPMA 4APVA 1HCZA 1L0XB 2K5WA 1I94Q 2IHEA 2GVAA 4C3JG 1HRJA 3EQLC 5CR3A 2EZVA 2K33A 4K5XA 1SMYD 2ZTDA 2B2YC 4WORA 3G71A 5LMNL 3S1NB 3ND9A 2A6ED 4LUVA 4GNXB 2B8GA 1IBML 4R1JA 1VQMA 2PW5A 1W2BA 1WTPA 1AE3A 4RA8A 4DUYL 1JQYD 3PIPA 1HH2P 2MNAA 4JI8Q 2F0UA 2N78A 2VS1A 2E75C 2BDOA 2PQAA 3S2DH 3P20A 4DV2Q 2I07B 2NVYH 3T51B 2EYPA 1B44D 3CXCA 5GAHC 5FOBB 5C3WA 4KHPQ 1FD7D 4IALA 3I4LA 1H9KA 1PRTB 3HRZC 2D9UA 1GJXA 1K3RA 1SNCA 4B08A 3K57A 1LTRD 1STGA 2WACA 3EROA 1EQQA 5C4XB 1II3A 4QB4A 1HNWQ 3AU7A 5IT9E 1WOCA 4TRDA 4HJ9A 1N34L 3CCQA 1H9SA 3EN2A 5HGTA 3F1ZA 4JV5Q 1PFMA 1MHWC 3W3AA 3I91A 5LL6X 2LMCB 5JEAJ 3H0GG 1CA5A 1WCMG 2VB3X 1I6HH 5C4HA 2M9VA 3HOUG 4QUCA 1CFMA 1D5XC 1ASZA 1SJED 2IPKD 1PH6A 2EDGA 1HNWL 3H3VI 1QUQB 1VQ4A 1B50A 1I94L 2E8GA 2K5DA 1OXVA 5KRUA 4A3JH 3VA5A 4S3SA 2F0TA 3BVMA 2FHTA 2SDFA 2QCPX 4BBRB 4DV5L 4HMJA 4LJZC 5JVG3 1VS0A 4X64L 1WTRA 4GKKQ 3HOZG 1P8LA 1KD1C 3I4MB 3NTKA 2XSCA 4H7BA 4AQYQ 1IKMA 3FHWA 4HMIA 1DZ1A 3DEPA 5KNCA 2SNMA 2L15A 1L0YB 1A2TA 2BA1A 2AWNA 2IW3A 3M4PA 1YITA 2LS01 1JOKA 5E4XA 1JE5A 2R92G 1LO5D 1LYLA 1L0WA 2IY5B 1SE4A 2D2CC 4HJ5A 3EA6A 4NDXA 2JJQA 1A3UA 1E3PA 5C3EG 2C35B 4YY3Q 1F2ZA 3PV0A 5JOBA 3S14H 3HP3A 2ZJPA 1BR9A 2IT1A 5HURA 1WTVA 4YWLA 1DJRD 4F8MA 2PNHA 2R7ZB 1E22A 1Y1VH 3I70A 4JK1C 1CM9A 3I4OA 4EQNA 4X62L 4OXPA 2E5LQ 2H4OA 2KUMA 4EVOA 2KA7A 3E5SA 1UUPA 2F4VQ 4A76A 4B3ML 4NXNQ 1VQ8A 4GN5A 1XTCD 1X3PA 1SMYC 3NQIA 4O2DA 1EOVA 4AYBB 1PH8A 4XDXA 4DV0Q 1VDZA 1BDOA 3AB9A 1YNND 3X3NA 5DM73 2CVRA 1HUMA 2WAQB 2RHSB 1SNDA 4DR2Q 1I6VC 1N32L 3EJIA 1LT6D 2AHOB 4RCNA 3Q0AA 2PI2A 2OXPA 3HKZG 5FO9B 2F4VL 5ELOA 4JI6Q 2F3WA 2ZM6Q 1IYJB 3T4AC 4A3FH 3MXNB 4DXGA 5EPKA 1HQRD 3Q24A 3J7YW 2DJGC 4C2MB 1HNZL 3I55A 2KCMA 1A62A 1IYUA 4KKTA 2CH4A 3DUZA 3DHQA 4DV3L 1GXDC 4NKLA 5C5MA 1YVCA 3BU2A 1Q7YC 1S72A 2R93B 1B9NA 2XTIA 4M1UB 4ZKBB 4P74A 5FLMH 1HNXQ 2MHVA 4DV3Q 5A2QL 1QCBD 1FR3A 1PTOF 3TP7A 1D5MC 2NB0A 1G2TA 1A0IA 3OYYA 2UUBQ 1TS3A 4B3RL 5KYLA 3HOXG 1PXUA 4DPGA 3FVQA 3S15B 2NTSA 5A35A 5FLXE 4RHRA 3AQQA 2RCNA 4R8NA 3KBGA 1BF4A 1JOOA 2BOSA 3URYA 2DY8A 3M4OB 1NSNS 4QCLA 4AIMA 4QQBX 4A3KG 5LHY1 3HOYH 4ZK9B 3PO3G 2EY2A 3J7A5 4A3CG 1GKHA 1VQDA 1S3OA 3CCLA 3CD6A 3SVMA 2N3SA 3RZDB 2JA8G 2IHFA 5K5PA 1K8AC 2FMCA 1YEZA 1JORA 1K8GA 1Q8KA 2QEXA 4KKUA 5LMUQ 4A3GB 1G6ZA 2UXBL 1FL0A 4DAYB 1Q1EA 5KNDA 1M1KC 5GAGC 2K4KA 3F2UA 5J1ZA 4WFN3 1AP0A 1K28A 2PMZB 1BBXC 5M5WH 1SYFA 2KQ3A 3STBC 5CV5A 4DU9A 2JA5B 3RMHA 3A55A 4YY3L 1KRSA 4CDCC 3JAMc 5KYIA 3RLOA 3H09A 3S2HH 2IJ0A 1SE3A 2B63G 2AQ3B 1PYSB 1NTGA 3VR4A 5F2DA 5C6AA 1C9OA 1S5DD 1XPUA 4GNXA 2PQEA 3CPFA 1E1OA 4IPDA 4R4OA 2EXDA 1PHJA 4B3SQ 3ZJYC 4A3IH 2Q2TA 1C48A 2JA8H 3QO2A 2JK8A 5HGQA 2E2HH 5K36H 3ULJA 2Z6KC 1BCPF 3ICEA 4C1NK 2I5LX 2PNRC 2QF7A 2F3VA 3A54A 2B2VC 2K5HA 2JEBI 1I4XA 4DR1L 4PZ8A 1B8AA 4A3DG 1FNWA 1PH5A 1H9MA 3M4OH 1NMGA 2R6GA 3RZOH 4P2CB 1G291 4BWGB 2EOTA 2AWOA 2LXKA 5DNFA 1J5EQ 4DR7Q 1CHQD 2LSSA 1QWYA 3K58A 3WOEA 1AZQA 1RCVD 5T1IA 1MIUA 5CMDA 3H91A 4JI0L 4A93G 1SYEA 1TVXA 3BZDB 5HY6A 2OTLA 3K7UC 1EY0A 5CC4A 5IGDA 4LFBQ 4R9WA 3ONAB 2A5HA 3ND8A 3U4ZA 1I4RA 1TS5A 3MA2B 3S1NH 3H0GH 1IL8A 3SGIA 1LTID 4ODGA 5AJ3Q 3KYHC 2HIVA 2L1BA 1VQOA 2NVQB 3J81E 5BR8L 5EAYA 2KOLA 1B53A 1PTOB 5IWAL 1U4LA 3A8IE 2UUAL 1KRTA 2KEDA 4OWXB 2DJFC 4A93B 2BCOA 4HSVA 1U0LA 4X3TA 2DNEA 3VYSA 5CV9A 2FINB 5JPNC 1PH7A 1DGSA 2DNCA 4JYAL 3RD4A 2Z9HA 3VYRA 2EYFA 4BA1I 4B3SL 1EY9A 2Q8RE 1XNQQ 3C1FA 3H3VH 2O5IC 3GTLH 2EY1A 3OIPA 5FKAC 1PA6A 2XIWA 4N9PA 4RGTA 3W1GA 3NQTA 1SXTA 1BKBA 4B3RQ 2JA9A 1KAAA 1STBA 5ELDA 4A3EG 2K28A 1QVFA 1B1ZA 2ZXRA 4LUOA 1J5EL 2NVXH 3S1QB 2CH4W 2YU9B 4DNIA 3TS2A 3QG1A 2PZWA 3KJPA 4OO1G 4G7HC 2SOBA 2V4DA 4C3IB 1BBWA 4PMWA 3STBD 4UP9A 3TDQA 1L1OA 3MTSA 4DK0A 2B2WA 2AMCB 1CHPD 1NUCA 1N36Q 4B3TL 5CGKA 4BY1H 5M5YH 1EY7A 1NR2A 1L1OB 4X66L 3CKIB 1I4QA 1FNVA 1HJPA 4UHVA 1A2UA 4R4QA 5FLXc 5J39A 1K3BC 2WAQG 4MZ9A 3ZYYX 3A0JA 3M7GA 4DR4L 4XT3B 3HOZH 1A63A 1I4HA 4BBRH 4EQPA 3D4DA 5GROA 1D7QA 2HUGA 1HR0L 3K7AB 4DK1A 2BH8A 2NZHA 2B3GA 1KXLA 5H1SE 1EUJA 4ZRZA 2F0KA 4QJFA 1WCMB 3M9BA 3D0FA 1OXSC 4MNOA 3GTGB 4RG1A 4X65L 1E7ZA 2FJ2A 1QZHA 1V8QA 3CCRA 4JI1Q 2RDHA 2F0LA 1HR0Q 2WP8J 2A6HC 1JWMD 3AFPA 5IT9c 1ML0D 1HR0W 4JI0Q 4HN7A 4B9XA 3IFTA 3T1HQ 5EPLA 1QOHA 1STHA 2F4IA 2G9DA 4L5TA 3QB3A 4IUQA 1BXTA 1TY2A 2L12A 4A3KH 3HOWG 2B29A 4BBSB 1HZBA 3AMUA 1F9SA 1I3QH 1WTHA 1D2BA 4KV6A 2B2TC 5E4WC 4JI2L 3TP8A 3I4NG 1FGUA 3KOJA 3GTJB 2VW9A 4J6HA 5JVH3 4IPHA 1UNSA 2L5TA 1RODA 5D3IB 2R7ZG 4DV5Q 1Y8OB 3I73A 1HTPA 1KAWA 1AZPA 3K0XA 1PH4A 4A3MB 2EJFC 4C1NI 2RQXA 4AQYL 2CHBD 1SFOH 4OELB 4EGVA 4LF7Q 1R4PB 3DWQA 3OIQA 1DCZA 4P72A 5KIXA 3PUVA 4HEDA 2AQ1B 1VQJA 1YHBA 5LMNQ 1SNMA 1IW7D 3HOWH 2X6GA 3A8KE 4K0KL 2J4XA 4H44C 4OEMB 1PDQA 3D8GA 4CKEA 4A3JB 4NW2A 4YCUA 3F8TA 2EJMA 2RDFA 4X3SA 5IOCA 2AUJD 3BYTB 3J81L 1XNRQ 1I4GA 4CJ0B 4DK6C 2LKVA 2WAQE 3KLRA 1Q81C 3CRKC 4C3JH 3I7FA 4OO1I 4AYBG 1MBYA 3O13A 4KMUC 3J7AF 4FF3A 4IFDH 1CKMA 1ZYRC 1WYDA 3DM1A 2JA6H 4NXMQ 2I46A 4H0LC 4HJ8A 3NBHA 3GTPH 1JWSD 2K52A 3HKZB 5E7NA 3VYUA 2RKSA 4A3GH 4XYOA 2KBNA 4DAMA 2F0VA 1LT5D 2I0QA 4JI5L 4JOIA 3CPWA 1NCVA 3SE0A 4FYDA 2CQAA 1CI3M 1EWHA 1WTOA 1O80A 1SDFA 4IN3A 1GUOA 2K5NA 4DR2L 1F2LA 2WB1B 1XPOA 2A68C 1SRUA 3K8AA 5JPMC 3SK5A 1QNUA 1RTOA 3T1YQ 2VXWA 1LACA 1GOZA 2ID0A 4KTAA 2ASBA 4WJWA 3TZUA 3CW2C 1EYDA 1WTXA 2F0DA 1GVPA 1DOMA 1UAPA 1CA6A 1DD2A 1IBLL 5IP7H 4KI0A 1I4PA 3CMAA 1GD7A 2VQFQ 3C2PA 5IGGA 4GLXA 2FFKB 2GVBA 1M4VA 4I7ZC 3PIP3 4MTNA 1XWEA 4QL5A 2E2IB 3NE5B 4LWCA 4A93H 1PVOA 2JA7B 1E24A 1G91A 1IBLQ 2YTXA 2BDNA 3H15A 1Y1VB 2IWHA 4JVZA 3OTOL 1Y69U 5FK9C 2OCEA 1VQ5A 4IJLA 5IIFA 2A6HD 1MJCA 2F0JA 1MKHA 5I2XA 2NZOA 1ENAA 4RMFA 5FJ8H 1J8IA 4QIWE 2HQEA 4K0KQ 4I7AA 4A3FG 1G2SA 3MAQA 4K8IA 2K75A 4DR4Q 2E2HB 1N34Q 2V1CC 1VQFA 3EBEA 4IFDG 1VQKA 4O0AA 5C5LA 4ZLTF 4LNQA 1KABA 1IHZA 5C4ZA 1B4OA 2G5DA 4ZUIA 1PV4A 4JBKA 3GTMH 3OOCA 4A75A 3BS1A 5EJWA 1H9SB 3P75A 5T1GA 3PO2G 4XQNA 2WIIB 1XTDA 2K1BA 5CV7A 1WCMH 3W2DA 1S4ZA 2CFMA 1RD9D 1Q86C 1X3FA 1Y1VG 5BN5A 2YV5A 1EZ6A 2J0TD 2DN8A 1L2FA 2E5LL 1I50H 1Y8NB 4CJ2C 1PZID 3P7JA 4GN4B 2QDLA 3X3MA 3KF6A 4LFAQ 4EX5A 3DEOA 2UXDL 3E3XA 2KVMA 2F0FA 3DWPA 3MXNA 3S17H 2EIFA 1V1QA 2PCFB 1HA5A 3OSOA 1IW7C 1IKLA 2F0HA 5IYBH 3L7ZC 4KKSA 1LT3D 4RHSA 3CC4A 1ASYA 2IX1A 4KJNA 3IL8A 2WB1E 1SE8A 4WJ4A 3S9WA 2F0OA 3J80L 1RJTA 4QY7A 3PO3H 2HQLA 1UEAB 1SYCA 3QJYA 3CCSA 2R7FA 1QILA 1V1PA 2A74C 3PIO3 2NN6H 4RWSC 1VQ6A 1O78A 1PYBA 2E74C 5EKIA 4M8AA 3I4MH 1EIYB 4NXML 4DV4L 4IJHA 2Q2HA 3CCUA 2B2YA 1E1TA 4POGA 4PMCA 4DGZA 1Q46A 5M3MG 2JA6G 3S1MH 3I4NB 1PZJD 4DV2L 3UE1A 1GO3E 5I6YA 1WTQA 3ERSX 1X3GA 3T1HL 5IYDG 1SR3A 1KNAA 3T16A 5IYBG 5I2YA 2AKWB 4RGOS 2RBMA 1QNKA 4IUPA 1EU4A 5D14A 3T53B 5IT9L 5FLXL 2A68D 3DMUA 4IQZA 4DV0L 3A5UA 5LMUL 3GP7A 3L9AX 2JA7G 3NHHA 4RGNA 1CQVA 1V43A 1BOSA 3FDTA 1VMCA 4K6LA 4O42A 4GNXC 1PFNA 1J6QA 3FPUB 4A3BB 2K5VA 1SLJA 2LY7A 2KCTA 2VNUD 3NPPA 4K5WA 3IKJA 4RCOA 4WJ3M 4WRDA 1PH2A 4DR5L 4BY1B 4GKJL 1J9OA 3S16B 2XRQD 4HJAA 1SYDA 3KJOA 4GOPC 1CUKA 4HTHA 3PUWA 4P75A 3GTKB 4A3EB 4NP5A 2HDMA 5I9OA 1EYAA 3J80c 2KHIA 4OIJA 3BDLA 4C3IG 4DR5Q 1GM5A 3IAYA 2RA4A 1JJGA 5IYCG 4C3HG 1ILQA 3UDIA 4L5SA 2EYOA 2N55A 3I4MG 5M5YB 3L0OA 2QDBA 4FXDA 1F77A 3BDCA 1JT8A 3FRPB 4NXNL 4IUNA 4POFA 1VCIA 1B3AA 4G57A 2K01A 4YWMA 3W5OA 3NTHA 4ZCKA 4B3MQ 4C3HH 1B2TA 2E2IH 1X54A 1BO0A 3WWVA 2XNAC 5M9OA 3K0YA 4N9TA 1V1PB 1T9HA 3R2IA 2N88A 3V05A 1NMFA 4FO2A 1ENFA 3RNUA 3D4WA 5C44G 1TWFH 1XYIA 1D8LA 1TIID 4CJ1B 1K8MA 2MGSA 3H3VC 2NVTB 3GTOH 1PFSA 2R92H 4IUVA 4JI5Q 3CCJA 4KK7A 1EWCA 1GUNA 2RCFA 3HKZE 3T1YL 5D3DA 4FNFA 4CDDC 2R61A 2VUMH 2MP1A 4UAIA 3K5MA 4KY7A 5C4JB 5JJLA 3F2BA 1K83B 1WFQA 3F2DA 1VQCA 4J1MA 2ZTCA 1YNJC 2VQFL 3A5ZB 3BZCA 1HFGA 4HIDA 5G3LF 1QVCA 2UXCQ 4IZ8A 2Q2IA 1OXTA 1HUNA 1OXUA 4LFBL 4KHVA 3TSSA 4OO1H 1AE2A 2Z8LA 3V96A 2G9HD 5CBAE 2I5HA 2XWJB 4HIKA 1MSGA 4IFDI 1HNZQ 5M3MH 5M3FG 3BG3A 4DNRB 4XQJA 3CRLC 1GUSA 4JI1L 4OX9Q 1K0RA 4IO9A 2JA5H 4A3BG 1Y14B 2ENBA 4BBSG 4DA2A 3RLNA 1VF7A 2F0WA 4LF6L 1EQVA 2A69D 3OWEB 3WDNA 2NN6G 1ILPA 1YJ9A 1I6HB 3PQIA 1CSQA 4HSPA 3TZDA 5CV4A 4FF2A 1F2YA 2JN4A 2K5QA 4DR7L 1B9MA 4DF7A 3CQZB 1OO9B 4Q5VA 3CC7A 3OMGA 5C0XH 1TWAH 1S5ED 1CKNA 1N36L 1MD2D 3T13A 3NEMA 1IBKL 2R7ZH 4HAEA 3PF5A 4PNYA 3KF8A 3FKIG 1X9NA 3CP0A 1TS2A 4GZYC 3TBIB 2QILA 1Q8IA 1LLRD 3R93A 5LMNW 3GQBA 5ELEA 1G51A 4JBJA 4A3BH 1JE4A 3BVZA 1TWGB 1SNPA 3VDYA 4DUYQ 1YHAA 2Z6KA 1PRTC 4DV1L 3K6OA 4A3JG 4YIJA 4G4KA 1IYVA 2R3ZA 4L8JA 4DR3Q 1STEA 1LTSD 1C7YA 1KDCA 3RN5A 5C3XA 3SK8A 4J15A 3S24A 1NBWA 1S40A 3JAMi 1BCPB 2EY5A 4X65Q 5CORA 3B6YA 3ULLA 1NJIC 3E0EA 2AQ2B 1AW7A 4L6TB 4A3KB 2J7ZA 3MC0B 3NXWA 4DV4Q 4AH6A 1LTGD 1FNUA 1BNZA 4PV1C 1SN8A 3C46A 3S15H 2D0PA 3LWEA 5DAUA 3LX0A 3S17B 2R93H 1C0AA 4KD4A 3HOXH 5JJIA 5K36G 3DM3A 3K80C 5CBEE 3C3LA 2C5CA 1Y8PB 5M5XH 2D5DA 1JR0D 5C0XG 3J7ZC 4A3IG 2EYMA 4A3MH 2UU9Q 2R7DA 3CCVA 3CMEA 1ENCA 2ZXPA 1CZWA 1Q3LA 1TR5A 2B2UC 4YCVA 2B63H 1XMOL 1KNEA 1YNJD 3C1EA 2RSOA 2NVTH 2MO1A 2GA4B 1PH3A 1KLGD 1JJ2A 1DM0B 2PQAB 1IXRA 1I50B 2N8NA 1ONLA 1UEBA 2OF1A 3GV6A 2WKCA 3J80E 1HA6A 1E0BA 1HXYD 1F9PA 3J80i 4I65A 1MSHA 2EQSA 3MVVA 2QEJC 3Q23A 1U4MA 1K83H 4A3FB 2B2WC 1B70B 1X55A 1L1OC 3KLSA 1JB3A 4C3IH 2CWPA 2FMMA 1TWCB 1JC7A 2DY7A 3MXPA 1TXYA 1HPCA 3MXUA 1YHQA 1SMXA 1EYGA 2ES2A 3MEFA 1FYCA 3KF6B 3TP6A 1MI2A 4A3CH 4OIKA 2A69C 1V1OA 4L63B 5COYA 1X3QA 2CQOA 2L4NA 4JBWA 4Y52H 3LWUA 4N8X1 1HTLD 2A19A 2NZ1D 4DFAA 4ZKCB 3HOVH 1TS4A 5I9PA 3E9IA 5ELBA 1Z9FA 3TN2A 1JCKB 1AEXA 2QW7A 4DV7L 5M5XB 5IE8A 1QVGA 1EY5A 3M3YB 1A3VA 2B2TA 4E6IA 3J81c 3GTOB 4R4TA 5EPJA 2K32A 2Z1CA 1VF5C 2LFNA 2LXJA 1WD0A 4HIOA 2UXBQ 1EOTA 3I72A 5IY0A 4X3UA 2VB2X 3MHBA 3UDGA 1D5ZC 3GTQB 1CK1A 2ZJRA 2E2JH 4GOPB 1D6EC 1S5BD 4ABNA 1PRTD 3CCMA 1TWHH 4HCSA 3SK6A 2Y0SG 1EY8A 4JI7Q 2OEOA 4A3EH 1A3TA 3A56A 5JJKA 1BQQT 1C4QA 3QOJA 4OHJA 4C2MH 4DV6L 2UUCQ 2ZM6L 1EY4A 2JXMB 3J81i 1KTKA 1QE6A 1YNNC 3CQZH 4LW1A 1IBKQ 2RSNA 3S14B 4DAYA 1PH9A 1H95A 4UPAA 1E2ZA 5KEEA 3D4RA 3PIOA 2L9HA 1KHIA 4IFDJ 1N8RC 4B3TQ 5M3MB 4JOIC 1ZEQX 5NUCA 3S1RH 4K5VA 3PCOB 1YZ6A 2UUCL 3E9HA 1K0SA 4CGYB 4RKLA 1DYQA 3G48A 2EYJA 4YHHL 4DV1Q 2NN6I 2JA8B 3KUPA 3G6JB 2OTJA 3S16H 2VL6A 1JMCA 1XNRL 1DXMA 3MXGA 4RGMA 1AN8A 3GTKH 1KDAA 2IX0A 2ZXOA 3M4YA 1EEFD 4F7XA 5DEHA 4BBRG 1P16A 2QKIC 5FO8B 2JYOA 4GLVB 1XMOQ 4LF9L 1VQIA 1VMPA 2PO4A 3U4VA 1R9TB 2EE1A 1DOLA 4LMQD 1XMQL 5JAVA 2Z4IA 2K6AA 2OT2A 1T5XD 3OW2A 1Q90A 3Q22A 1MGSA 4F88A 2NYZD 3FPPA 2JP1A 2NTTA 4GLAC 2A8VA 1HHVA 4Y7NH 4DN4M 2B8FA 3UDFA 4N8FA 3M4QA 2NBFA 2F0IA 4QUFA 1MJEA 2Q8TA 5GADC 4H02A 4XQQA 1X56A 3I4NH 2HHHQ 1TWFB 5M5WB 5BR8Q 3MEHA 4FXKC 1H9RA 1EQTA 1NY4A 3HFZB 5C4XG 3S1QH 2NVXB 4A3DB 4GKJQ 2NVQH 4X64Q 4IUTA 3QIAA 3FMCA 5JEAG 3AFQA 2K50A 5M3FH 3K5NA 1ZKOA 3VR3A 1B7YB 4KLKA 4V190 3S1MB 2AUKA 4PMBA 2EYHA 4B9WA 2Z0SA 1ICFB 3NELA 4KJOA 5GAEC 3U9SA 2CCZA 4IUUA 2WFWA 4L5QA 4GS3A 1CZGA 5BN4A 2C9OA 3G7LA 3M85A 3HOYB 1ESFA 4TSSA 3RZOB 3TS0A 2Q2UA 3OHXC 3HOUH 3ITPA 1C8CA 4MN3A 4YCWA 1EIHA 4P73A 4H13C 4DKAC 3EFXD 3RLFA 4MIUA 5EBDA 3WOFA 3H94A 2O4XA 2MFIA 3V2TA 1Q12A 3GV3A 1YIJA 2VUMG 2K04A 1O7YA 3FEWX 4DR1Q 4RH6A 4TKOB 3FKIH 2TMPA 4U673 5G3LD 3AEVA 2OQKA 3PMFA 4CHTB 3PO2H 4KY6A 1IZ6A 5IGCA 3F2CA 2CKZB 1EWIA 2ICEC 4DV6Q 1WI5A 3I56A 5J22A 1XMQQ 2L0CA 1ET6A 4DK3C 3S2HB 4XYQA 2F0MA 4HR7B 3J81j 1ESRA 1QB5D 2E76C 1VQEA 3KDFA 3H0GB 3A8JE 3P1HA 4ZQ3A 5EKKA 3D31A 1HNXL 1LV9A 1QJOA 4LF5L 1D1KA 3RN2A 4K6DA 1XXGA 1PTOD 2F52A 3JAML 2UUBL 1TWGH 3M7NA 4DAVA 1CKOA 3IFDA 1KC8C 5AJ3L 5JEAH 4IOCA 1BCPC 4V0BA 3K5LA 4ZYSA 1SJHD 2RF4A 4Z9CB 4JI8L 3GTQH 1M90C 2H1EA 3OPOA 4GOPA 4JI7L 4C3JB
chains in the Genus database with same CATH topology
4LUOA 1JB7A 4A3GG 1J5EL 2NVXH 5JJLA 3F2BA 4IPGA 4DNIA 1EIFA 1LM0A 1WFQA 2ZJQA 3TS2A 3KJPA 4TQUS 3F2DA 4OO1G 4LF8L 1VQCA 1K73C 2ZTCA 1K9MC 2VQFL 1BBWA 4PMWA 3STBD 5C3EH 3A5ZB 1N33L 3BZCA 4UP9A 4HIDA 1L1OA 4APVA 5IP7G 2YTYA 4PZ7A 1QVCA 2AMCB 1I94Q 2IHEA 1N36Q 4B3TL 2UXCQ 2Q2IA 1OXTA 1OXUA 4BY1H 2GVAA 4LFBL 1AE2A 5M5YH 2I5HA 4HIKA 1L1OB 3CF5A 4LF6Q 4X66L 4IFDI 4ALPA 2QA4A 1HNZQ 2ZTDA 5M3MH 1HJPA 3G71A 5LMNL 5M3FG 4LUVA 4R4QA 5FLXc 4GNXB 1IBML 4R1JA 4JI1L 2WAQG 2H5XA 4MZ9A 1K0RA 4IO9A 1VQMA 4OX9Q 3A0JA 1W2BA 2JA5H 1AE3A 4DR4L 4A3BG 1Y14B 4DUYL 1VQPA 3HOZH 1A63A 3Q8DA 4BBSG 2YTVA 3RLNA 4BBRH 5GROA 3PIPA 4LF6L 1HH2P 1D7QA 1VQHA 2XGTA 1R9TH 1HR0L 2YU9H 1XPRA 2MNAA 2YYZA 2BH8A 2NN6G 4JI8Q 3UE0A 1YJ9A 1YJWA 2NZHA 2B3GA 1KXLA 1BVSA 2N78A 2VS1A 5H1SE 1CSQA 1BBUA 1EUJA 2ZTEA 4QJFA 3M9BA 3D0FA 1OXSC 4JG2A 4MNOA 2UXDQ 2PQAA 4RG1A 3S2DH 4X65L 1E7ZA 1QZHA 4DV2Q 2NVYH 4DR7L 3CXCA 3CCRA 4JI1Q 5GAHC 2KHJA 4JI4L 1HR0Q 3CC7A 4KHPQ 4X6AH 2WP8J 5IYDH 1W3SA 3AFPA 1TWAH 5IT9c 1HR0W 4JI0Q 1CKNA 1N36L 4B3MQ 1K3RA 3T1HQ 3NEMA 1IBKL 2R7ZH 3PF5A 1G6PA 2VY3A 3FKIG 4L5TA 1X9NA 1KIXA 3CP0A 4BY7G 4A3KH 1EQQA 3PGZA 4JI4Q 1HNWQ 4X62Q 5LMNW 3HOWG 1WOCA 2B29A 1HZBA 4DR3L 4HJ9A 1OTCA 1RIPA 3CCQA 3EN2A 1I3QH 1G51A 1I5FA 1N34L 1UE6A 4JBJA 4A3BH 3F1ZA 4JV5Q 5IYCH 2HHHL 4JI3L 2A1AA 4JI2L 4P71A 3VDYA 3I4NG 1FGUA 5JEAJ 3KOJA 4DUYQ 3H0GG 1WCMG 1YHAA 2OQ0A 2Z6KA 3JC66 4IPHA 2VW9A 4DV1L 1EFWA 1I6HH 3HOUG 4A3JG 2R7ZG 4DV5Q 4DR3Q 4A3MG 1C7YA 3RN5A 1ASZA 3RZDH 1PH6A 1KAWA 3K0XA 4J15A 3H3VI 1PH4A 3S24A 1QUQB 1HNWL 1NBWA 1N32Q 1VQ4A 1S40A 3JAMi 4XTCS 4LFCL 1I94L 1UE7A 2E8GA 3DLLA 4X65Q 3B6YA 1OXVA 1TWCH 3UDXA 4JI6L 4AQYL 4A3JH 3ULLA 2OWOA 2DUDA 3E0EA 1NJIC 1X6OA 1SFOH 3CC2A 3FP9A 2R93G 4BXXG 3KLWA 4LF7Q 3U50C 1VQ7A 4P72A 4DV5L 3PUVA 2JQOA 4DV4Q 2N49A 4LF9Q 1VS0A 4X64L 1VQJA 4AH6A 4BBSH 4GKKQ 3HOZG 1YHBA 1P8LA 5LMNQ 1KD1C 1SN8A 3HOWH 2JA5G 4AQYQ 1N9WA 3GO5A 3FHWA 4OX9L 4K0KL 3S15H 2D0PA 2R93H 2L15A 1C0AA 2BA1A 1KL9A 1HZAA 2PI2E 3GTJH 3HOVG 2AWNA 3M4PA 4YCUA 3F8TA 3HOXH 1YITA 1JE5A 5JJIA 2R92G 2CWAA 1XNRQ 5K36G 3DM3A 3K80C 4DK6C 2WAQE 1LYLA 5M5XH 1VQNA 5C0XG 1Q81C 1L0WA 4C3JH 3J7ZC 4A3IG 3I7FA 4OO1I 4AYBG 2IY5B 4DUZL 4NPSA 4A3MH 1FJGQ 4HJ5A 2UU9Q 2R7DA 3CCVA 3CMEA 2JJQA 1CKMA 4A4IA 1WYDA 5GQOA 2JA6H 4YCVA 1E3PA 4NXMQ 5C3EG 2B63H 4JYAQ 2D0OA 2C35B 4YY3Q 1XMOL 3NENA 4HJ8A 1Q1BA 4DR6Q 3PV0A 3GTPH 1QUQA 2NVTH 2MO1A 2K52A 5E7NA 1PH3A 2HIXA 2ZJPA 3S14H 2IT1A 4A3GH 4TVAB 1JJ2A 2PQAB 4YWLA 2KBNA 4DAMA 1IXRA 2PNHA 5FJ8G 2JEAI 2N8NA 4PZ6A 2I0QA 1E22A 1UEBA 1Y1VH 2D62A 4JI5L 4HIMA 4LF4L 4JOIA 1A8VA 3I4OA 3CPWA 4X62L 4DUZQ 4OXPA 3J80i 5IP9H 3G4SA 2E5LQ 2EQSA 2QGQA 2RHQB 1CKNB 2F4VQ 4A76A 4B3ML 4NXNQ 1VQ8A 4GN5A 2K5NA 4DR2L 1K83H 1XPOA 2PMZE 3K8AA 1SRUA 5IWAQ 4O2DA 1EOVA 1B70B 1X55A 1L1OC 3T1YQ 1PH8A 2ID0A 3TREA 4DV0Q 4C3IH 2CWPA 2ASBA 3CW2C 1KQSA 1TXYA 1GVPA 1YHQA 1SMXA 1IBLL 2RHSB 1EYGA 5IP7H 4DV7Q 2ES2A 1IL2A 3MEFA 3KF6B 4DR2Q 4KI0A 4A3CH 1N32L 3CMAA 3GTGH 1GD7A 2VQFQ 2AHOB 4GLXA 2GVBA 4GN3B 1VQBA 2PI2A 3BZKA 3HKZG 2F4VL 5ELOA 4JI6Q 1HZ9A 4KHZA 1IYJB 4MTNA 4QL5A 2ZM6Q 2CQOA 3HKSA 4JBWA 3MXNB 4LWCA 4A3FH 4A93H 1PVOA 4Y52H 2A19A 1E24A 1IBLQ 2YTXA 3HOVH 3H15A 1VQ5A 3OTOL 1HNZL 3I55A 2OCEA 4UP7A 2KCMA 1A62A 4IJLA 3E9IA 1IBMQ 1MJCA 1Z9FA 4LFAL 1MKHA 2NZOA 4RMFA 5FJ8H 4DV7L 4QIWE 3W1BA 5IE8A 1QVGA 5C4XH 2ATWA 4K0KQ 2VQEQ 4DV3L 4A3FG 4A3DH 1YVCA 1UE1A 3J81c 3BU2A 1Q7YC 4R4TA 4A3LH 3TQYA 2K75A 4DR4Q 1S72A 1N34Q 2XTIA 2V1CC 2LXJA 1VQFA 3EBEA 3KF8B 4IFDG 1VQKA 4HIOA 4O0AA 2UXBQ 4LNQA 4P74A 5FLMH 4JI3Q 5IY0A 1HNXQ 2VQEL 4DV3Q 3UDGA 4JBKA 3GTMH 2BA0A 1PV4A 2ZJRA 4A75A 2E2JH 4A3LG 4L5RC 4GOPB 1QVFA 1A0IA 3OYYA 2UUBQ 4B3RL 3CCMA 4QGUA 1TWHH 3PO2G 4OONA 1XTDA 3HOXG 2Y0SG 3PF4A 4JI7Q 3CAMA 1YJNA 4A3EH 4DPGA 1WCMH 4DR6L 4KHPL 5JJKA 4C2MH 3AQQA 1UE5A 2CFMA 4DV6L 2UUCQ 2ZM6L 2RCNA 3NBHB 1Q86C 3J81i 1X3FA 1Y1VG 3CQZH 4LW1A 1IBKQ 2VZAA 4JCVE 2YV5A 3KFUA 1PH9A 1L2FA 1H95A 1YBYA 4UPAA 2E5LL 1I50H 3TRZA 3I2ZA 3M3YH 4GN4B 3BJUA 4AIMA 3KF6A 4LFAQ 4A3KG 4OWTB 3HOYH 4BXXH 4QQBX 3PIOA 4EX5A 3PO3G 2UXDL 4A3CG 4ME3A 3J7A5 1KHIA 4JC0A 1GKHA 4IFDJ 1N8RC 4B3TQ 2UXCL 1VQDA 4JOIC 3S17H 1S3OA 1XJVA 2EIFA 3CCLA 3CD6A 1V1QA 4IOAA 3S1RH 2N3SA 5ELNA 3PCOB 1YZ6A 3L7ZC 3E9HA 4EQ5A 2IHFA 1UWVA 5IYBH 2UUCL 2JA8G 3ULPA 1K8AC 3CC4A 1ASYA 3G48A 1VQ9A 1YEZA 4YHHL 2NN6I 1Q8KA 2QEXA 4DV1Q 1K8GA 1YI2A 2Y0SE 5LMUQ 2IX1A 2OTJA 3S16H 2UXBL 1FL0A 2VL6A 1Q1EA 2WB1E 4DAYB 1SE8A 1Y1WG 1M1KC 5GAGC 1JMCA 1XNRL 4WJ4A 2K4KA 4QY7A 3PO3H 2HQLA 3CCSA 2R7FA 3GTKH 3PUYA 4BA2I 3HOYG 5IP9G 4LUZA 5M5WH 1VQ6A 3U58A 2IX0A 3STBC 1HZCA 1PYBA 4BBRG 1P16A 5C0XJ 3I4MH 1EIYB 4NXML 3K81C 4DV4L 4GLVB 4IJHA 4YY3L 1VQIA 1XMOQ 1KRSA 4LF9L 2HT1A 2Q2HA 3U4VA 3JAMc 3CCUA 3RLOA 3K7AH 1E1TA 4XIGS 4POGA 3S2HH 1Q46A 2B63G 3PUZA 5M3MG 1XMQL 2JA6G 1VQAA 1PYSB 3S1MH 1NTGA 2BH2A 1C9OA 4DV2L 3UE1A 1VQGA 3OW2A 1GO3E 3ERSX 1XPUA 1X3GA 3AYHB 4GNXA 5C4JH 3T1HL 1VQLA 3CPFA 1SROA 3IRBA 1E1OA 4X66Q 5IYDG 4IPDA 2A8VA 4R4OA 4GLAC 1JJCB 1SR3A 2EXDA 1PHJA 3TEHB 3ZJYC 4A3IH 4Y7NH 2Q2TA 4B3SQ 4HJ7A 5IYBG 2JA8H 1CSPA 2AKWB 2JK8A 3GD7A 5HGQA 5FLMG 1OXXK 3ULJA 3UDFA 2E2HH 2Z6KC 2WB1G 3M4QA 2GN5A 3ICEA 2I5LX 1MJEA 5GADC 4LF7L 4H02A 4DV0L 3A5UA 1X56A 2K5HA 3G6EA 5LMUL 3I4NH 2JEBI 2HHHQ 2JA7G 2ALYB 1AH9A 5BR8Q 4PZ8A 1B8AA 4DR1L 4A3DG 1NY4A 3HFZB 1V43A 3EIVA 1PH5A 2K14A 3M4OH 1NMGA 2R6GA 3S1QH 4UY8C 3RZOH 5C4XG 4GKJQ 1G291 2NVQH 4GNXC 4X64Q 1J6QA 2K5VA 2AWOA 2LXKA 1SLJA 1J5EQ 3CCEA 2JA7H 4DR7Q 5JEAG 2KCTA 3AFQA 2LSSA 4AYBE 2VNUD 2K50A 5M3FH 1Q82C 1NE3A 1B7YB 4KLKA 4LFCQ 2F3IA 4WJ3M 1MIUA 1YNXA 4JI0L 4A93G 2Z0SA 1PH2A 4DR5L 3NELA 4GKJL 1RL2A 3L2PA 1EQRA 5HY6A 5GAEC 3K7UC 2OTLA 4BY1G 4HJAA 2CCZA 2WFWA 4GS3A 4L5QA 3KJOA 4GOPC 1CUKA 3M85A 4LFBQ 4PG3A 1XNQL 3PUWA 3TS0A 5C44H 4P75A 3U4ZA 2Q2UA 4JBMA 2I5MX 2UU9L 4R4IA 3HOUH 4YWKA 4YCWA 4GKKL 4P73A 3S1NH 3H0GH 3J80c 4DKAC 2KHIA 3RLFA 3SGIA 4DR5Q 1GM5A 1JJGA 4NB3A 4OWWB 4JI2Q 5IYCG 1QZGA 5C0XI 3UDIA 5AJ3Q 4L5SA 1PH1A 2MFIA 4FDBA 1Q12A 3KYHC 1LUZA 3I4MG 3L0OA 1LTLA 1YIJA 2HIVA 2VUMG 1VQOA 5BR8L 3KDFB 4DR1Q 4BY7H 3GDEA 5EAYA 1JT8A 4NXNL 3FKIH 3OTOQ 4POFA 3AEVA 2JE6I 1Z47A 5DLQE 1FJGL 1VCIA 2OQKA 5IWAL 5J3BA 1Y1WH 3PO2H 1WJJA 4YWMA 1IZ6A 3W5OA 2DGYA 1X65A 3F2CA 1KRTA 2CKZB 1EWIA 2UUAL 4C3HH 4DV6Q 2E2IH 1X54A 4OWXB 1WI5A 3I56A 3WWVA 1XMQQ 4LF5Q 4DK3C 1U0LA 1T9HA 3J81j 2MQHA 3LGJA 1PH7A 1DGSA 1NMFA 3RNUA 4JYAL 3A74A 5C44G 1TWFH 2MO0A 3PUXA 1D8LA 4BA1I 4B3SL 1VQEA 3KDFA 1HNXL 3D31A 1XNQQ 4LF8Q 3H3VH 3ER0A 4LF5L 1X3EA 3RN2A 3GTLH 3GTOH 3RR5A 2F52A 1PFSA 1N33Q 2R92H 4JI5Q 2KENA 4UP8A 2UUAQ 3CCJA 2UUBL 4LF4Q 1PA6A 1TWGH 3M7NA 1O7IA 1CKOA 3W1GA 4YHHQ 1KC8C 5AJ3L 4IOCA 3HKZE 4JV5L 1BKBA 1U5KA 4B3RQ 3T1YL 2FXQA 2RF4A 1FVIA 3PSIA 4IPCA 2JA9A 4JI8L 4A3EG 4R4CA 3GTQH 2VUMH 1M90C 1V9PA 4GOPA 4JI7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUO A;  1JB7 A;  4A3G G;  1J5E L;  2NVX H;  5JJL A;  3F2B A;  4IPG A;  4DNI A;  1EIF A;  1LM0 A;  1WFQ A;  2ZJQ A;  3TS2 A;  3KJP A;  4TQU S;  3F2D A;  4OO1 G;  4LF8 L;  1VQC A;  1K73 C;  2ZTC A;  1K9M C;  2VQF L;  1BBW A;  4PMW A;  3STB D;  5C3E H;  3A5Z B;  1N33 L;  3BZC A;  4UP9 A;  4HID A;  1L1O A;  4APV A;  5IP7 G;  2YTY A;  4PZ7 A;  1QVC A;  2AMC B;  1I94 Q;  2IHE A;  1N36 Q;  4B3T L;  2UXC Q;  2Q2I A;  1OXT A;  1OXU A;  4BY1 H;  2GVA A;  4LFB L;  1AE2 A;  5M5Y H;  2I5H A;  4HIK A;  1L1O B;  3CF5 A;  4LF6 Q;  4X66 L;  4IFD I;  4ALP A;  2QA4 A;  1HNZ Q;  2ZTD A;  5M3M H;  1HJP A;  3G71 A;  5LMN L;  5M3F G;  4LUV A;  4R4Q A;  5FLX c;  4GNX B;  1IBM L;  4R1J A;  4JI1 L;  2WAQ G;  2H5X A;  4MZ9 A;  1K0R A;  4IO9 A;  1VQM A;  4OX9 Q;  3A0J A;  1W2B A;  2JA5 H;  1AE3 A;  4DR4 L;  4A3B G;  1Y14 B;  4DUY L;  1VQP A;  3HOZ H;  1A63 A;  3Q8D A;  4BBS G;  2YTV A;  3RLN A;  4BBR H;  5GRO A;  3PIP A;  4LF6 L;  1HH2 P;  1D7Q A;  1VQH A;  2XGT A;  1R9T H;  1HR0 L;  2YU9 H;  1XPR A;  2MNA A;  2YYZ A;  2BH8 A;  2NN6 G;  4JI8 Q;  3UE0 A;  1YJ9 A;  1YJW A;  2NZH A;  2B3G A;  1KXL A;  1BVS A;  2N78 A;  2VS1 A;  5H1S E;  1CSQ A;  1BBU A;  1EUJ A;  2ZTE A;  4QJF A;  3M9B A;  3D0F A;  1OXS C;  4JG2 A;  4MNO A;  2UXD Q;  2PQA A;  4RG1 A;  3S2D H;  4X65 L;  1E7Z A;  1QZH A;  4DV2 Q;  2NVY H;  4DR7 L;  3CXC A;  3CCR A;  4JI1 Q;  5GAH C;  2KHJ A;  4JI4 L;  1HR0 Q;  3CC7 A;  4KHP Q;  4X6A H;  2WP8 J;  5IYD H;  1W3S A;  3AFP A;  1TWA H;  5IT9 c;  1HR0 W;  4JI0 Q;  1CKN A;  1N36 L;  4B3M Q;  1K3R A;  3T1H Q;  3NEM A;  1IBK L;  2R7Z H;  3PF5 A;  1G6P A;  2VY3 A;  3FKI G;  4L5T A;  1X9N A;  1KIX A;  3CP0 A;  4BY7 G;  4A3K H;  1EQQ A;  3PGZ A;  4JI4 Q;  1HNW Q;  4X62 Q;  5LMN W;  3HOW G;  1WOC A;  2B29 A;  1HZB A;  4DR3 L;  4HJ9 A;  1OTC A;  1RIP A;  3CCQ A;  3EN2 A;  1I3Q H;  1G51 A;  1I5F A;  1N34 L;  1UE6 A;  4JBJ A;  4A3B H;  3F1Z A;  4JV5 Q;  5IYC H;  2HHH L;  4JI3 L;  2A1A A;  4JI2 L;  4P71 A;  3VDY A;  3I4N G;  1FGU A;  5JEA J;  3KOJ A;  4DUY Q;  3H0G G;  1WCM G;  1YHA A;  2OQ0 A;  2Z6K A;  3JC6 6;  4IPH A;  2VW9 A;  4DV1 L;  1EFW A;  1I6H H;  3HOU G;  4A3J G;  2R7Z G;  4DV5 Q;  4DR3 Q;  4A3M G;  1C7Y A;  3RN5 A;  1ASZ A;  3RZD H;  1PH6 A;  1KAW A;  3K0X A;  4J15 A;  3H3V I;  1PH4 A;  3S24 A;  1QUQ B;  1HNW L;  1NBW A;  1N32 Q;  1VQ4 A;  1S40 A;  3JAM i;  4XTC S;  4LFC L;  1I94 L;  1UE7 A;  2E8G A;  3DLL A;  4X65 Q;  3B6Y A;  1OXV A;  1TWC H;  3UDX A;  4JI6 L;  4AQY L;  4A3J H;  3ULL A;  2OWO A;  2DUD A;  3E0E A;  1NJI C;  1X6O A;  1SFO H;  3CC2 A;  3FP9 A;  2R93 G;  4BXX G;  3KLW A;  4LF7 Q;  3U50 C;  1VQ7 A;  4P72 A;  4DV5 L;  3PUV A;  2JQO A;  4DV4 Q;  2N49 A;  4LF9 Q;  1VS0 A;  4X64 L;  1VQJ A;  4AH6 A;  4BBS H;  4GKK Q;  3HOZ G;  1YHB A;  1P8L A;  5LMN Q;  1KD1 C;  1SN8 A;  3HOW H;  2JA5 G;  4AQY Q;  1N9W A;  3GO5 A;  3FHW A;  4OX9 L;  4K0K L;  3S15 H;  2D0P A;  2R93 H;  2L15 A;  1C0A A;  2BA1 A;  1KL9 A;  1HZA A;  2PI2 E;  3GTJ H;  3HOV G;  2AWN A;  3M4P A;  4YCU A;  3F8T A;  3HOX H;  1YIT A;  1JE5 A;  5JJI A;  2R92 G;  2CWA A;  1XNR Q;  5K36 G;  3DM3 A;  3K80 C;  4DK6 C;  2WAQ E;  1LYL A;  5M5X H;  1VQN A;  5C0X G;  1Q81 C;  1L0W A;  4C3J H;  3J7Z C;  4A3I G;  3I7F A;  4OO1 I;  4AYB G;  2IY5 B;  4DUZ L;  4NPS A;  4A3M H;  1FJG Q;  4HJ5 A;  2UU9 Q;  2R7D A;  3CCV A;  3CME A;  2JJQ A;  1CKM A;  4A4I A;  1WYD A;  5GQO A;  2JA6 H;  4YCV A;  1E3P A;  4NXM Q;  5C3E G;  2B63 H;  4JYA Q;  2D0O A;  2C35 B;  4YY3 Q;  1XMO L;  3NEN A;  4HJ8 A;  1Q1B A;  4DR6 Q;  3PV0 A;  3GTP H;  1QUQ A;  2NVT H;  2MO1 A;  2K52 A;  5E7N A;  1PH3 A;  2HIX A;  2ZJP A;  3S14 H;  2IT1 A;  4A3G H;  4TVA B;  1JJ2 A;  2PQA B;  4YWL A;  2KBN A;  4DAM A;  1IXR A;  2PNH A;  5FJ8 G;  2JEA I;  2N8N A;  4PZ6 A;  2I0Q A;  1E22 A;  1UEB A;  1Y1V H;  2D62 A;  4JI5 L;  4HIM A;  4LF4 L;  4JOI A;  1A8V A;  3I4O A;  3CPW A;  4X62 L;  4DUZ Q;  4OXP A;  3J80 i;  5IP9 H;  3G4S A;  2E5L Q;  2EQS A;  2QGQ A;  2RHQ B;  1CKN B;  2F4V Q;  4A76 A;  4B3M L;  4NXN Q;  1VQ8 A;  4GN5 A;  2K5N A;  4DR2 L;  1K83 H;  1XPO A;  2PMZ E;  3K8A A;  1SRU A;  5IWA Q;  4O2D A;  1EOV A;  1B70 B;  1X55 A;  1L1O C;  3T1Y Q;  1PH8 A;  2ID0 A;  3TRE A;  4DV0 Q;  4C3I H;  2CWP A;  2ASB A;  3CW2 C;  1KQS A;  1TXY A;  1GVP A;  1YHQ A;  1SMX A;  1IBL L;  2RHS B;  1EYG A;  5IP7 H;  4DV7 Q;  2ES2 A;  1IL2 A;  3MEF A;  3KF6 B;  4DR2 Q;  4KI0 A;  4A3C H;  1N32 L;  3CMA A;  3GTG H;  1GD7 A;  2VQF Q;  2AHO B;  4GLX A;  2GVB A;  4GN3 B;  1VQB A;  2PI2 A;  3BZK A;  3HKZ G;  2F4V L;  5ELO A;  4JI6 Q;  1HZ9 A;  4KHZ A;  1IYJ B;  4MTN A;  4QL5 A;  2ZM6 Q;  2CQO A;  3HKS A;  4JBW A;  3MXN B;  4LWC A;  4A3F H;  4A93 H;  1PVO A;  4Y52 H;  2A19 A;  1E24 A;  1IBL Q;  2YTX A;  3HOV H;  3H15 A;  1VQ5 A;  3OTO L;  1HNZ L;  3I55 A;  2OCE A;  4UP7 A;  2KCM A;  1A62 A;  4IJL A;  3E9I A;  1IBM Q;  1MJC A;  1Z9F A;  4LFA L;  1MKH A;  2NZO A;  4RMF A;  5FJ8 H;  4DV7 L;  4QIW E;  3W1B A;  5IE8 A;  1QVG A;  5C4X H;  2ATW A;  4K0K Q;  2VQE Q;  4DV3 L;  4A3F G;  4A3D H;  1YVC A;  1UE1 A;  3J81 c;  3BU2 A;  1Q7Y C;  4R4T A;  4A3L H;  3TQY A;  2K75 A;  4DR4 Q;  1S72 A;  1N34 Q;  2XTI A;  2V1C C;  2LXJ A;  1VQF A;  3EBE A;  3KF8 B;  4IFD G;  1VQK A;  4HIO A;  4O0A A;  2UXB Q;  4LNQ A;  4P74 A;  5FLM H;  4JI3 Q;  5IY0 A;  1HNX Q;  2VQE L;  4DV3 Q;  3UDG A;  4JBK A;  3GTM H;  2BA0 A;  1PV4 A;  2ZJR A;  4A75 A;  2E2J H;  4A3L G;  4L5R C;  4GOP B;  1QVF A;  1A0I A;  3OYY A;  2UUB Q;  4B3R L;  3CCM A;  4QGU A;  1TWH H;  3PO2 G;  4OON A;  1XTD A;  3HOX G;  2Y0S G;  3PF4 A;  4JI7 Q;  3CAM A;  1YJN A;  4A3E H;  4DPG A;  1WCM H;  4DR6 L;  4KHP L;  5JJK A;  4C2M H;  3AQQ A;  1UE5 A;  2CFM A;  4DV6 L;  2UUC Q;  2ZM6 L;  2RCN A;  3NBH B;  1Q86 C;  3J81 i;  1X3F A;  1Y1V G;  3CQZ H;  4LW1 A;  1IBK Q;  2VZA A;  4JCV E;  2YV5 A;  3KFU A;  1PH9 A;  1L2F A;  1H95 A;  1YBY A;  4UPA A;  2E5L L;  1I50 H;  3TRZ A;  3I2Z A;  3M3Y H;  4GN4 B;  3BJU A;  4AIM A;  3KF6 A;  4LFA Q;  4A3K G;  4OWT B;  3HOY H;  4BXX H;  4QQB X;  3PIO A;  4EX5 A;  3PO3 G;  2UXD L;  4A3C G;  4ME3 A;  3J7A 5;  1KHI A;  4JC0 A;  1GKH A;  4IFD J;  1N8R C;  4B3T Q;  2UXC L;  1VQD A;  4JOI C;  3S17 H;  1S3O A;  1XJV A;  2EIF A;  3CCL A;  3CD6 A;  1V1Q A;  4IOA A;  3S1R H;  2N3S A;  5ELN A;  3PCO B;  1YZ6 A;  3L7Z C;  3E9H A;  4EQ5 A;  2IHF A;  1UWV A;  5IYB H;  2UUC L;  2JA8 G;  3ULP A;  1K8A C;  3CC4 A;  1ASY A;  3G48 A;  1VQ9 A;  1YEZ A;  4YHH L;  2NN6 I;  1Q8K A;  2QEX A;  4DV1 Q;  1K8G A;  1YI2 A;  2Y0S E;  5LMU Q;  2IX1 A;  2OTJ A;  3S16 H;  2UXB L;  1FL0 A;  2VL6 A;  1Q1E A;  2WB1 E;  4DAY B;  1SE8 A;  1Y1W G;  1M1K C;  5GAG C;  1JMC A;  1XNR L;  4WJ4 A;  2K4K A;  4QY7 A;  3PO3 H;  2HQL A;  3CCS A;  2R7F A;  3GTK H;  3PUY A;  4BA2 I;  3HOY G;  5IP9 G;  4LUZ A;  5M5W H;  1VQ6 A;  3U58 A;  2IX0 A;  3STB C;  1HZC A;  1PYB A;  4BBR G;  1P16 A;  5C0X J;  3I4M H;  1EIY B;  4NXM L;  3K81 C;  4DV4 L;  4GLV B;  4IJH A;  4YY3 L;  1VQI A;  1XMO Q;  1KRS A;  4LF9 L;  2HT1 A;  2Q2H A;  3U4V A;  3JAM c;  3CCU A;  3RLO A;  3K7A H;  1E1T A;  4XIG S;  4POG A;  3S2H H;  1Q46 A;  2B63 G;  3PUZ A;  5M3M G;  1XMQ L;  2JA6 G;  1VQA A;  1PYS B;  3S1M H;  1NTG A;  2BH2 A;  1C9O A;  4DV2 L;  3UE1 A;  1VQG A;  3OW2 A;  1GO3 E;  3ERS X;  1XPU A;  1X3G A;  3AYH B;  4GNX A;  5C4J H;  3T1H L;  1VQL A;  3CPF A;  1SRO A;  3IRB A;  1E1O A;  4X66 Q;  5IYD G;  4IPD A;  2A8V A;  4R4O A;  4GLA C;  1JJC B;  1SR3 A;  2EXD A;  1PHJ A;  3TEH B;  3ZJY C;  4A3I H;  4Y7N H;  2Q2T A;  4B3S Q;  4HJ7 A;  5IYB G;  2JA8 H;  1CSP A;  2AKW B;  2JK8 A;  3GD7 A;  5HGQ A;  5FLM G;  1OXX K;  3ULJ A;  3UDF A;  2E2H H;  2Z6K C;  2WB1 G;  3M4Q A;  2GN5 A;  3ICE A;  2I5L X;  1MJE A;  5GAD C;  4LF7 L;  4H02 A;  4DV0 L;  3A5U A;  1X56 A;  2K5H A;  3G6E A;  5LMU L;  3I4N H;  2JEB I;  2HHH Q;  2JA7 G;  2ALY B;  1AH9 A;  5BR8 Q;  4PZ8 A;  1B8A A;  4DR1 L;  4A3D G;  1NY4 A;  3HFZ B;  1V43 A;  3EIV A;  1PH5 A;  2K14 A;  3M4O H;  1NMG A;  2R6G A;  3S1Q H;  4UY8 C;  3RZO H;  5C4X G;  4GKJ Q;  1G29 1;  2NVQ H;  4GNX C;  4X64 Q;  1J6Q A;  2K5V A;  2AWO A;  2LXK A;  1SLJ A;  1J5E Q;  3CCE A;  2JA7 H;  4DR7 Q;  5JEA G;  2KCT A;  3AFQ A;  2LSS A;  4AYB E;  2VNU D;  2K50 A;  5M3F H;  1Q82 C;  1NE3 A;  1B7Y B;  4KLK A;  4LFC Q;  2F3I A;  4WJ3 M;  1MIU A;  1YNX A;  4JI0 L;  4A93 G;  2Z0S A;  1PH2 A;  4DR5 L;  3NEL A;  4GKJ L;  1RL2 A;  3L2P A;  1EQR A;  5HY6 A;  5GAE C;  3K7U C;  2OTL A;  4BY1 G;  4HJA A;  2CCZ A;  2WFW A;  4GS3 A;  4L5Q A;  3KJO A;  4GOP C;  1CUK A;  3M85 A;  4LFB Q;  4PG3 A;  1XNQ L;  3PUW A;  3TS0 A;  5C44 H;  4P75 A;  3U4Z A;  2Q2U A;  4JBM A;  2I5M X;  2UU9 L;  4R4I A;  3HOU H;  4YWK A;  4YCW A;  4GKK L;  4P73 A;  3S1N H;  3H0G H;  3J80 c;  4DKA C;  2KHI A;  3RLF A;  3SGI A;  4DR5 Q;  1GM5 A;  1JJG A;  4NB3 A;  4OWW B;  4JI2 Q;  5IYC G;  1QZG A;  5C0X I;  3UDI A;  5AJ3 Q;  4L5S A;  1PH1 A;  2MFI A;  4FDB A;  1Q12 A;  3KYH C;  1LUZ A;  3I4M G;  3L0O A;  1LTL A;  1YIJ A;  2HIV A;  2VUM G;  1VQO A;  5BR8 L;  3KDF B;  4DR1 Q;  4BY7 H;  3GDE A;  5EAY A;  1JT8 A;  4NXN L;  3FKI H;  3OTO Q;  4POF A;  3AEV A;  2JE6 I;  1Z47 A;  5DLQ E;  1FJG L;  1VCI A;  2OQK A;  5IWA L;  5J3B A;  1Y1W H;  3PO2 H;  1WJJ A;  4YWM A;  1IZ6 A;  3W5O A;  2DGY A;  1X65 A;  3F2C A;  1KRT A;  2CKZ B;  1EWI A;  2UUA L;  4C3H H;  4DV6 Q;  2E2I H;  1X54 A;  4OWX B;  1WI5 A;  3I56 A;  3WWV A;  1XMQ Q;  4LF5 Q;  4DK3 C;  1U0L A;  1T9H A;  3J81 j;  2MQH A;  3LGJ A;  1PH7 A;  1DGS A;  1NMF A;  3RNU A;  4JYA L;  3A74 A;  5C44 G;  1TWF H;  2MO0 A;  3PUX A;  1D8L A;  4BA1 I;  4B3S L;  1VQE A;  3KDF A;  1HNX L;  3D31 A;  1XNQ Q;  4LF8 Q;  3H3V H;  3ER0 A;  4LF5 L;  1X3E A;  3RN2 A;  3GTL H;  3GTO H;  3RR5 A;  2F52 A;  1PFS A;  1N33 Q;  2R92 H;  4JI5 Q;  2KEN A;  4UP8 A;  2UUA Q;  3CCJ A;  2UUB L;  4LF4 Q;  1PA6 A;  1TWG H;  3M7N A;  1O7I A;  1CKO A;  3W1G A;  4YHH Q;  1KC8 C;  5AJ3 L;  4IOC A;  3HKZ E;  4JV5 L;  1BKB A;  1U5K A;  4B3R Q;  3T1Y L;  2FXQ A;  2RF4 A;  1FVI A;  3PSI A;  4IPC A;  2JA9 A;  4JI8 L;  4A3E G;  4R4C A;  3GTQ H;  2VUM H;  1M90 C;  1V9P A;  4GOP A;  4JI7 L; 
#chains in the Genus database with same CATH topology
 4X3K A;  2O5J C;  4IPG A;  1EIF A;  1LM0 A;  1RF2 D;  3GTL B;  1K73 C;  4K14 A;  5C3E H;  5IP7 G;  2YTY A;  1PMR A;  4PZ7 A;  1Z7T A;  4BS9 A;  2PPB C;  3E0J A;  3A7L A;  4F87 A;  4CDE C;  3D3R A;  1GUW A;  1STN A;  3CF5 A;  4LF6 Q;  4BY7 B;  4ALP A;  2L11 A;  2QA4 A;  1FGB D;  2F0G A;  3SEB A;  3NBI A;  3S1R B;  2H5X A;  1U9R A;  4K2K A;  4Q0F A;  4J8Q A;  1VQP A;  3Q8D A;  2YTV A;  2RDG A;  1VQH A;  2XGT A;  1R9T H;  2YU9 H;  1Z6H A;  1XPR A;  1U4P A;  2YYZ A;  3UE0 A;  3KLS X;  1YJW A;  1BVS A;  3VR5 A;  1BBU A;  1EEI D;  2ZTE A;  1PTO H;  4JG2 A;  4ZUJ A;  2UXD Q;  3MFG A;  3K59 A;  1RDP D;  2KHJ A;  4JI4 L;  5CYU A;  3ERQ A;  4X6A H;  5ELC A;  5IYD H;  1ICW A;  1W3S A;  1X32 A;  2X6L A;  1W6J A;  1TY0 A;  1G6P A;  2VY3 A;  2EY6 A;  2NWG A;  1XX8 A;  2Z6B A;  1KIX A;  2HD3 A;  3HEJ A;  4BY7 G;  1SEB D;  2IX3 A;  3PGZ A;  3E6Z X;  2P5Z X;  4JI4 Q;  4X62 Q;  3D6W A;  4DR3 L;  3NK9 A;  1WVL A;  1RIP A;  1OTC A;  1I5F A;  3HOW B;  1UE6 A;  3SK4 A;  3KBX A;  1DOK A;  5IGE A;  5IYC H;  2HHH L;  3HOV B;  4JI3 L;  4JPB W;  2A1A A;  5TSS A;  3BYY B;  4P71 A;  1SE2 A;  3TME A;  1GUT A;  5BN3 A;  2OQ0 A;  3JC6 6;  1EFW A;  5ELF A;  1KDB A;  3BDO A;  5DM6 3;  2E2J B;  4A3M G;  3RZD H;  5KNB A;  1N32 Q;  4XTC S;  4LFC L;  1F2M A;  1UE7 A;  3DLL A;  3OW7 A;  4KY5 A;  3UDX A;  1TWC H;  5LL6 S;  4JI6 L;  1SNQ A;  2XRS D;  2OWO A;  2DUD A;  3VYT A;  1X6O A;  3TP5 A;  2F0P A;  3CC2 A;  3FP9 A;  2R93 G;  4BXX G;  3L3O C;  3KLW A;  5A2Q E;  4XXE A;  3U50 C;  3MFY A;  1VQ7 A;  2F03 A;  1B3Q A;  1G8Z D;  2JQO A;  3QWN A;  4LF9 Q;  2N49 A;  2PW7 A;  1W6K A;  4BBS H;  4FF1 A;  3T56 B;  2F0S A;  1I3Q B;  2EVB A;  2JA5 G;  1N9W A;  3GO5 A;  4OX9 L;  1GUG A;  5IOD A;  2JA6 B;  1HZA A;  1KL9 A;  2HDL A;  2PI2 E;  4QF4 A;  3GTJ H;  3HOV G;  1JOQ A;  1PTO C;  2NVY B;  1EIG A;  3NWS A;  2CWA A;  4C3H B;  1SYG A;  2Z4H A;  1VQN A;  1TQO A;  1BCP D;  4DUZ L;  2WIN B;  4NPS A;  1FJG Q;  1PLF A;  1SYB A;  4A4I A;  5GQO A;  1O7L A;  4IUR A;  3S2D B;  2X69 A;  4JYA Q;  2D0O A;  1Y1W B;  3PO2 B;  3NEN A;  1SFO B;  1Q1B A;  4KD3 A;  4DR6 Q;  1QUQ A;  3DWA A;  3NTI A;  1ET9 A;  1SNO A;  2HIX A;  2MUY A;  3HOZ B;  4TVA B;  4FXG C;  4JW0 A;  1PZK D;  5FJ8 G;  2JEA I;  4PZ6 A;  1RKN A;  2D62 A;  4HIM A;  4LF4 L;  1A8V A;  4DUZ Q;  2ZT9 C;  5IP9 H;  5C44 B;  3G4S A;  3NWT A;  2K7V A;  4CDF C;  2QGQ A;  2RHQ B;  2IL8 A;  4FF4 A;  1CKN B;  1KLU D;  2Y0S B;  3R3O A;  2PMZ E;  5IWA Q;  1HQM C;  2B2U A;  3TRE A;  2B39 A;  5AFW A;  4QMG A;  1LT4 D;  1KQS A;  3MZ5 A;  2XVS A;  4DV7 Q;  1IL2 A;  1E2V A;  1E2W A;  3GTG H;  2B63 B;  1CT1 D;  3A7A B;  4GN3 B;  1VQB A;  3BZK A;  2K05 A;  3HGB A;  1HZ9 A;  4KHZ A;  3HKS A;  2PZU A;  1ZXT A;  4CBV A;  3SR1 A;  4OL7 A;  5IGB A;  3VR2 A;  1WD1 A;  2M2L A;  4DXF A;  4UP7 A;  1H9J A;  1JWU D;  1RTN A;  1IBM Q;  4LFA L;  1S5C D;  3W1B A;  5CV8 A;  5C4X H;  2Q8I B;  2ATW A;  5E3F A;  2VQE Q;  1ZYR D;  1EYC A;  3HZX A;  4A3D H;  1JIC A;  1UE1 A;  4A3L H;  5EQ0 A;  3TQY A;  3VR6 A;  2KCC A;  3D6C A;  2SEB D;  1EY6 A;  5M3F B;  1SBB B;  4CKC A;  3KF8 B;  3U9O A;  2XWB B;  4LK1 C;  3EVQ A;  4JI3 Q;  3N52 A;  2VQE L;  4DNT B;  1TKW B;  4CKB A;  2BA0 A;  4A3L G;  1PFB A;  4L5R C;  2PYK A;  4QGU A;  3K5O A;  4OON A;  2WV6 D;  4RKB A;  1EZ8 A;  4FVM A;  3PF4 A;  3PO3 B;  3CAM A;  1YJN A;  3HOU B;  4DR6 L;  5EGT A;  4KHP L;  2BE5 C;  2F0N A;  2CW0 D;  1UE5 A;  3NBH B;  4UDU C;  2VZA A;  4JCV E;  3KFU A;  1M8A A;  1WTW A;  1YBY A;  3LNN A;  1EU3 A;  1F9Q A;  3I2Z A;  3M3Y H;  1PYW D;  3TRZ A;  3BJU A;  1CTM A;  4OWT B;  5L37 A;  1TWH B;  4BXX H;  2SNS A;  1STA A;  1U4R A;  4ME3 A;  3FKI B;  4JC0 A;  2B2V A;  2UXC L;  3QR8 A;  5IGF A;  3CHB D;  1XJV A;  2KHS A;  4IOA A;  5D65 A;  5ELN A;  4EQ5 A;  1UWV A;  2XN9 C;  3ULP A;  5ISR A;  1VQ9 A;  3SXH A;  5E1F A;  1YI2 A;  2Y0S E;  1Y1W G;  4K2L A;  2EYL A;  3NSW A;  5CV6 A;  4ZAI A;  3PUY A;  4BA2 I;  3HOY G;  5IP9 G;  4LUZ A;  1STY A;  3U58 A;  3HS0 C;  3NUC A;  5KGU A;  1HZC A;  2O2L D;  1A15 A;  5C0X J;  1GHK A;  3K81 C;  3OWF A;  2HT1 A;  1TT2 A;  2HCC A;  3K7A H;  4MHE A;  4XIG S;  4QIW B;  3PUZ A;  1SAP A;  3HOX B;  1VQA A;  2BH2 A;  2VUM B;  1VQG A;  1BUV T;  3AYH B;  1K8O A;  5C4J H;  1VQL A;  1SSO A;  1SRO A;  3IRB A;  4X66 Q;  3I90 A;  4G7O C;  4ME5 A;  2A6E C;  2KEE A;  1JJC B;  3TEH B;  4HJ7 A;  1CSP A;  3GD7 A;  5FLM G;  1OXX K;  3UI2 A;  1PRT F;  3J7A V;  2WB1 G;  1A6X A;  2GN5 A;  3H6M A;  4LF7 L;  4NMZ A;  3R2T A;  2RVL A;  3G6E A;  2MJ8 A;  4FP5 D;  2ALY B;  1AH9 A;  5FO7 B;  3EIV A;  4MTK A;  2K14 A;  4UY8 C;  4RAU C;  1CQF A;  2F0Q A;  1LTA D;  3JAM E;  2JA7 H;  2E2D C;  3CCE A;  1AFP A;  4KN4 C;  3SHL A;  4AYB E;  4C56 C;  4PQX A;  1Q82 C;  1NE3 A;  4LFC Q;  1NAP A;  2F3I A;  1YNX A;  3N6R A;  1HFN A;  1S5F D;  4LAA A;  3GTM B;  1RL2 A;  3L2P A;  1EQR A;  1F9R A;  2M00 A;  2EPB A;  4BY1 G;  2NUC A;  1NR4 A;  1LTB D;  4Y7N B;  4PG3 A;  1XNQ L;  5C44 H;  4JBM A;  1NNX A;  2I5M X;  2TSS A;  5C3E B;  2UU9 L;  4R4I A;  1GHJ A;  4YWK A;  4GKK L;  1EL0 A;  3CU7 A;  4DAP A;  3R8B A;  5EBC A;  3RUZ A;  3DXJ C;  4O1N A;  4NB3 A;  1EFI D;  5JJZ A;  4OWW B;  4JI2 Q;  1QZG A;  5C0X I;  1TWA B;  1PH1 A;  3Q6S A;  4FDB A;  1LUZ A;  5EKL A;  1LTL A;  4XT1 B;  4K8J A;  3QOL A;  3KDF B;  4BY7 H;  3GDE A;  1D1I A;  3OTO Q;  2HCI A;  2JE6 I;  1Z47 A;  5DLQ E;  1FJG L;  1T5E A;  5J3B A;  2KCN A;  1Y1W H;  2A73 B;  1WJJ A;  2DGY A;  1X65 A;  3SDZ A;  4A3I B;  1R4Q B;  3HG9 A;  2CW0 C;  2BE5 D;  3OMC A;  4LF5 Q;  2JSO A;  1O7Z A;  4KN7 C;  2F1M A;  2MQH A;  3LGJ A;  3A74 A;  2F0E A;  2MO0 A;  3PUX A;  1LTT D;  3VA7 A;  3NP8 A;  2ICI A;  4EQO A;  4LF8 Q;  2EJG C;  3ER0 A;  1DON A;  4RFB A;  1X3E A;  4ID6 A;  3GTP B;  1LAB A;  1TU2 B;  3RR5 A;  1N33 Q;  2KEN A;  4UP8 A;  2UUA Q;  2K03 A;  4LF4 Q;  3I3C A;  3I8Z A;  1O7I A;  4YHH Q;  2EXZ A;  4JV5 L;  1U5K A;  4ULL A;  2FXQ A;  3PSI A;  1FVI A;  2KEC A;  2PZT A;  4IPC A;  4R4C A;  1QG7 A;  4HCE A;  5I4D A;  1V9P A;  3KK7 A;  4G7Z C;  1JB7 A;  4A3G G;  4U68 A;  5I6W A;  2ZJQ A;  1RHP A;  2WKD A;  3BVG A;  3MWY W;  4OGQ C;  4TQU S;  4R8I A;  4LF8 L;  1K9M C;  2L55 A;  2R92 B;  2KJX A;  1N33 L;  4ILW A;  2MPM A;  4APV A;  1HCZ A;  1L0X B;  2K5W A;  1I94 Q;  2IHE A;  2GVA A;  4C3J G;  1HRJ A;  3EQL C;  5CR3 A;  2EZV A;  2K33 A;  4K5X A;  1SMY D;  2ZTD A;  2B2Y C;  4WOR A;  3G71 A;  5LMN L;  3S1N B;  3ND9 A;  2A6E D;  4LUV A;  4GNX B;  2B8G A;  1IBM L;  4R1J A;  1VQM A;  2PW5 A;  1W2B A;  1WTP A;  1AE3 A;  4RA8 A;  4DUY L;  1JQY D;  3PIP A;  1HH2 P;  2MNA A;  4JI8 Q;  2F0U A;  2N78 A;  2VS1 A;  2E75 C;  2BDO A;  2PQA A;  3S2D H;  3P20 A;  4DV2 Q;  2I07 B;  2NVY H;  3T51 B;  2EYP A;  1B44 D;  3CXC A;  5GAH C;  5FOB B;  5C3W A;  4KHP Q;  1FD7 D;  4IAL A;  3I4L A;  1H9K A;  1PRT B;  3HRZ C;  2D9U A;  1GJX A;  1K3R A;  1SNC A;  4B08 A;  3K57 A;  1LTR D;  1STG A;  2WAC A;  3ERO A;  1EQQ A;  5C4X B;  1II3 A;  4QB4 A;  1HNW Q;  3AU7 A;  5IT9 E;  1WOC A;  4TRD A;  4HJ9 A;  1N34 L;  3CCQ A;  1H9S A;  3EN2 A;  5HGT A;  3F1Z A;  4JV5 Q;  1PFM A;  1MHW C;  3W3A A;  3I91 A;  5LL6 X;  2LMC B;  5JEA J;  3H0G G;  1CA5 A;  1WCM G;  2VB3 X;  1I6H H;  5C4H A;  2M9V A;  3HOU G;  4QUC A;  1CFM A;  1D5X C;  1ASZ A;  1SJE D;  2IPK D;  1PH6 A;  2EDG A;  1HNW L;  3H3V I;  1QUQ B;  1VQ4 A;  1B50 A;  1I94 L;  2E8G A;  2K5D A;  1OXV A;  5KRU A;  4A3J H;  3VA5 A;  4S3S A;  2F0T A;  3BVM A;  2FHT A;  2SDF A;  2QCP X;  4BBR B;  4DV5 L;  4HMJ A;  4LJZ C;  5JVG 3;  1VS0 A;  4X64 L;  1WTR A;  4GKK Q;  3HOZ G;  1P8L A;  1KD1 C;  3I4M B;  3NTK A;  2XSC A;  4H7B A;  4AQY Q;  1IKM A;  3FHW A;  4HMI A;  1DZ1 A;  3DEP A;  5KNC A;  2SNM A;  2L15 A;  1L0Y B;  1A2T A;  2BA1 A;  2AWN A;  2IW3 A;  3M4P A;  1YIT A;  2LS0 1;  1JOK A;  5E4X A;  1JE5 A;  2R92 G;  1LO5 D;  1LYL A;  1L0W A;  2IY5 B;  1SE4 A;  2D2C C;  4HJ5 A;  3EA6 A;  4NDX A;  2JJQ A;  1A3U A;  1E3P A;  5C3E G;  2C35 B;  4YY3 Q;  1F2Z A;  3PV0 A;  5JOB A;  3S14 H;  3HP3 A;  2ZJP A;  1BR9 A;  2IT1 A;  5HUR A;  1WTV A;  4YWL A;  1DJR D;  4F8M A;  2PNH A;  2R7Z B;  1E22 A;  1Y1V H;  3I70 A;  4JK1 C;  1CM9 A;  3I4O A;  4EQN A;  4X62 L;  4OXP A;  2E5L Q;  2H4O A;  2KUM A;  4EVO A;  2KA7 A;  3E5S A;  1UUP A;  2F4V Q;  4A76 A;  4B3M L;  4NXN Q;  1VQ8 A;  4GN5 A;  1XTC D;  1X3P A;  1SMY C;  3NQI A;  4O2D A;  1EOV A;  4AYB B;  1PH8 A;  4XDX A;  4DV0 Q;  1VDZ A;  1BDO A;  3AB9 A;  1YNN D;  3X3N A;  5DM7 3;  2CVR A;  1HUM A;  2WAQ B;  2RHS B;  1SND A;  4DR2 Q;  1I6V C;  1N32 L;  3EJI A;  1LT6 D;  2AHO B;  4RCN A;  3Q0A A;  2PI2 A;  2OXP A;  3HKZ G;  5FO9 B;  2F4V L;  5ELO A;  4JI6 Q;  2F3W A;  2ZM6 Q;  1IYJ B;  3T4A C;  4A3F H;  3MXN B;  4DXG A;  5EPK A;  1HQR D;  3Q24 A;  3J7Y W;  2DJG C;  4C2M B;  1HNZ L;  3I55 A;  2KCM A;  1A62 A;  1IYU A;  4KKT A;  2CH4 A;  3DUZ A;  3DHQ A;  4DV3 L;  1GXD C;  4NKL A;  5C5M A;  1YVC A;  3BU2 A;  1Q7Y C;  1S72 A;  2R93 B;  1B9N A;  2XTI A;  4M1U B;  4ZKB B;  4P74 A;  5FLM H;  1HNX Q;  2MHV A;  4DV3 Q;  5A2Q L;  1QCB D;  1FR3 A;  1PTO F;  3TP7 A;  1D5M C;  2NB0 A;  1G2T A;  1A0I A;  3OYY A;  2UUB Q;  1TS3 A;  4B3R L;  5KYL A;  3HOX G;  1PXU A;  4DPG A;  3FVQ A;  3S15 B;  2NTS A;  5A35 A;  5FLX E;  4RHR A;  3AQQ A;  2RCN A;  4R8N A;  3KBG A;  1BF4 A;  1JOO A;  2BOS A;  3URY A;  2DY8 A;  3M4O B;  1NSN S;  4QCL A;  4AIM A;  4QQB X;  4A3K G;  5LHY 1;  3HOY H;  4ZK9 B;  3PO3 G;  2EY2 A;  3J7A 5;  4A3C G;  1GKH A;  1VQD A;  1S3O A;  3CCL A;  3CD6 A;  3SVM A;  2N3S A;  3RZD B;  2JA8 G;  2IHF A;  5K5P A;  1K8A C;  2FMC A;  1YEZ A;  1JOR A;  1K8G A;  1Q8K A;  2QEX A;  4KKU A;  5LMU Q;  4A3G B;  1G6Z A;  2UXB L;  1FL0 A;  4DAY B;  1Q1E A;  5KND A;  1M1K C;  5GAG C;  2K4K A;  3F2U A;  5J1Z A;  4WFN 3;  1AP0 A;  1K28 A;  2PMZ B;  1BBX C;  5M5W H;  1SYF A;  2KQ3 A;  3STB C;  5CV5 A;  4DU9 A;  2JA5 B;  3RMH A;  3A55 A;  4YY3 L;  1KRS A;  4CDC C;  3JAM c;  5KYI A;  3RLO A;  3H09 A;  3S2H H;  2IJ0 A;  1SE3 A;  2B63 G;  2AQ3 B;  1PYS B;  1NTG A;  3VR4 A;  5F2D A;  5C6A A;  1C9O A;  1S5D D;  1XPU A;  4GNX A;  2PQE A;  3CPF A;  1E1O A;  4IPD A;  4R4O A;  2EXD A;  1PHJ A;  4B3S Q;  3ZJY C;  4A3I H;  2Q2T A;  1C48 A;  2JA8 H;  3QO2 A;  2JK8 A;  5HGQ A;  2E2H H;  5K36 H;  3ULJ A;  2Z6K C;  1BCP F;  3ICE A;  4C1N K;  2I5L X;  2PNR C;  2QF7 A;  2F3V A;  3A54 A;  2B2V C;  2K5H A;  2JEB I;  1I4X A;  4DR1 L;  4PZ8 A;  1B8A A;  4A3D G;  1FNW A;  1PH5 A;  1H9M A;  3M4O H;  1NMG A;  2R6G A;  3RZO H;  4P2C B;  1G29 1;  4BWG B;  2EOT A;  2AWO A;  2LXK A;  5DNF A;  1J5E Q;  4DR7 Q;  1CHQ D;  2LSS A;  1QWY A;  3K58 A;  3WOE A;  1AZQ A;  1RCV D;  5T1I A;  1MIU A;  5CMD A;  3H91 A;  4JI0 L;  4A93 G;  1SYE A;  1TVX A;  3BZD B;  5HY6 A;  2OTL A;  3K7U C;  1EY0 A;  5CC4 A;  5IGD A;  4LFB Q;  4R9W A;  3ONA B;  2A5H A;  3ND8 A;  3U4Z A;  1I4R A;  1TS5 A;  3MA2 B;  3S1N H;  3H0G H;  1IL8 A;  3SGI A;  1LTI D;  4ODG A;  5AJ3 Q;  3KYH C;  2HIV A;  2L1B A;  1VQO A;  2NVQ B;  3J81 E;  5BR8 L;  5EAY A;  2KOL A;  1B53 A;  1PTO B;  5IWA L;  1U4L A;  3A8I E;  2UUA L;  1KRT A;  2KED A;  4OWX B;  2DJF C;  4A93 B;  2BCO A;  4HSV A;  1U0L A;  4X3T A;  2DNE A;  3VYS A;  5CV9 A;  2FIN B;  5JPN C;  1PH7 A;  1DGS A;  2DNC A;  4JYA L;  3RD4 A;  2Z9H A;  3VYR A;  2EYF A;  4BA1 I;  4B3S L;  1EY9 A;  2Q8R E;  1XNQ Q;  3C1F A;  3H3V H;  2O5I C;  3GTL H;  2EY1 A;  3OIP A;  5FKA C;  1PA6 A;  2XIW A;  4N9P A;  4RGT A;  3W1G A;  3NQT A;  1SXT A;  1BKB A;  4B3R Q;  2JA9 A;  1KAA A;  1STB A;  5ELD A;  4A3E G;  2K28 A;  1QVF A;  1B1Z A;  2ZXR A;  4LUO A;  1J5E L;  2NVX H;  3S1Q B;  2CH4 W;  2YU9 B;  4DNI A;  3TS2 A;  3QG1 A;  2PZW A;  3KJP A;  4OO1 G;  4G7H C;  2SOB A;  2V4D A;  4C3I B;  1BBW A;  4PMW A;  3STB D;  4UP9 A;  3TDQ A;  1L1O A;  3MTS A;  4DK0 A;  2B2W A;  2AMC B;  1CHP D;  1NUC A;  1N36 Q;  4B3T L;  5CGK A;  4BY1 H;  5M5Y H;  1EY7 A;  1NR2 A;  1L1O B;  4X66 L;  3CKI B;  1I4Q A;  1FNV A;  1HJP A;  4UHV A;  1A2U A;  4R4Q A;  5FLX c;  5J39 A;  1K3B C;  2WAQ G;  4MZ9 A;  3ZYY X;  3A0J A;  3M7G A;  4DR4 L;  4XT3 B;  3HOZ H;  1A63 A;  1I4H A;  4BBR H;  4EQP A;  3D4D A;  5GRO A;  1D7Q A;  2HUG A;  1HR0 L;  3K7A B;  4DK1 A;  2BH8 A;  2NZH A;  2B3G A;  1KXL A;  5H1S E;  1EUJ A;  4ZRZ A;  2F0K A;  4QJF A;  1WCM B;  3M9B A;  3D0F A;  1OXS C;  4MNO A;  3GTG B;  4RG1 A;  4X65 L;  1E7Z A;  2FJ2 A;  1QZH A;  1V8Q A;  3CCR A;  4JI1 Q;  2RDH A;  2F0L A;  1HR0 Q;  2WP8 J;  2A6H C;  1JWM D;  3AFP A;  5IT9 c;  1ML0 D;  1HR0 W;  4JI0 Q;  4HN7 A;  4B9X A;  3IFT A;  3T1H Q;  5EPL A;  1QOH A;  1STH A;  2F4I A;  2G9D A;  4L5T A;  3QB3 A;  4IUQ A;  1BXT A;  1TY2 A;  2L12 A;  4A3K H;  3HOW G;  2B29 A;  4BBS B;  1HZB A;  3AMU A;  1F9S A;  1I3Q H;  1WTH A;  1D2B A;  4KV6 A;  2B2T C;  5E4W C;  4JI2 L;  3TP8 A;  3I4N G;  1FGU A;  3KOJ A;  3GTJ B;  2VW9 A;  4J6H A;  5JVH 3;  4IPH A;  1UNS A;  2L5T A;  1ROD A;  5D3I B;  2R7Z G;  4DV5 Q;  1Y8O B;  3I73 A;  1HTP A;  1KAW A;  1AZP A;  3K0X A;  1PH4 A;  4A3M B;  2EJF C;  4C1N I;  2RQX A;  4AQY L;  2CHB D;  1SFO H;  4OEL B;  4EGV A;  4LF7 Q;  1R4P B;  3DWQ A;  3OIQ A;  1DCZ A;  4P72 A;  5KIX A;  3PUV A;  4HED A;  2AQ1 B;  1VQJ A;  1YHB A;  5LMN Q;  1SNM A;  1IW7 D;  3HOW H;  2X6G A;  3A8K E;  4K0K L;  2J4X A;  4H44 C;  4OEM B;  1PDQ A;  3D8G A;  4CKE A;  4A3J B;  4NW2 A;  4YCU A;  3F8T A;  2EJM A;  2RDF A;  4X3S A;  5IOC A;  2AUJ D;  3BYT B;  3J81 L;  1XNR Q;  1I4G A;  4CJ0 B;  4DK6 C;  2LKV A;  2WAQ E;  3KLR A;  1Q81 C;  3CRK C;  4C3J H;  3I7F A;  4OO1 I;  4AYB G;  1MBY A;  3O13 A;  4KMU C;  3J7A F;  4FF3 A;  4IFD H;  1CKM A;  1ZYR C;  1WYD A;  3DM1 A;  2JA6 H;  4NXM Q;  2I46 A;  4H0L C;  4HJ8 A;  3NBH A;  3GTP H;  1JWS D;  2K52 A;  3HKZ B;  5E7N A;  3VYU A;  2RKS A;  4A3G H;  4XYO A;  2KBN A;  4DAM A;  2F0V A;  1LT5 D;  2I0Q A;  4JI5 L;  4JOI A;  3CPW A;  1NCV A;  3SE0 A;  4FYD A;  2CQA A;  1CI3 M;  1EWH A;  1WTO A;  1O80 A;  1SDF A;  4IN3 A;  1GUO A;  2K5N A;  4DR2 L;  1F2L A;  2WB1 B;  1XPO A;  2A68 C;  1SRU A;  3K8A A;  5JPM C;  3SK5 A;  1QNU A;  1RTO A;  3T1Y Q;  2VXW A;  1LAC A;  1GOZ A;  2ID0 A;  4KTA A;  2ASB A;  4WJW A;  3TZU A;  3CW2 C;  1EYD A;  1WTX A;  2F0D A;  1GVP A;  1DOM A;  1UAP A;  1CA6 A;  1DD2 A;  1IBL L;  5IP7 H;  4KI0 A;  1I4P A;  3CMA A;  1GD7 A;  2VQF Q;  3C2P A;  5IGG A;  4GLX A;  2FFK B;  2GVB A;  1M4V A;  4I7Z C;  3PIP 3;  4MTN A;  1XWE A;  4QL5 A;  2E2I B;  3NE5 B;  4LWC A;  4A93 H;  1PVO A;  2JA7 B;  1E24 A;  1G91 A;  1IBL Q;  2YTX A;  2BDN A;  3H15 A;  1Y1V B;  2IWH A;  4JVZ A;  3OTO L;  1Y69 U;  5FK9 C;  2OCE A;  1VQ5 A;  4IJL A;  5IIF A;  2A6H D;  1MJC A;  2F0J A;  1MKH A;  5I2X A;  2NZO A;  1ENA A;  4RMF A;  5FJ8 H;  1J8I A;  4QIW E;  2HQE A;  4K0K Q;  4I7A A;  4A3F G;  1G2S A;  3MAQ A;  4K8I A;  2K75 A;  4DR4 Q;  2E2H B;  1N34 Q;  2V1C C;  1VQF A;  3EBE A;  4IFD G;  1VQK A;  4O0A A;  5C5L A;  4ZLT F;  4LNQ A;  1KAB A;  1IHZ A;  5C4Z A;  1B4O A;  2G5D A;  4ZUI A;  1PV4 A;  4JBK A;  3GTM H;  3OOC A;  4A75 A;  3BS1 A;  5EJW A;  1H9S B;  3P75 A;  5T1G A;  3PO2 G;  4XQN A;  2WII B;  1XTD A;  2K1B A;  5CV7 A;  1WCM H;  3W2D A;  1S4Z A;  2CFM A;  1RD9 D;  1Q86 C;  1X3F A;  1Y1V G;  5BN5 A;  2YV5 A;  1EZ6 A;  2J0T D;  2DN8 A;  1L2F A;  2E5L L;  1I50 H;  1Y8N B;  4CJ2 C;  1PZI D;  3P7J A;  4GN4 B;  2QDL A;  3X3M A;  3KF6 A;  4LFA Q;  4EX5 A;  3DEO A;  2UXD L;  3E3X A;  2KVM A;  2F0F A;  3DWP A;  3MXN A;  3S17 H;  2EIF A;  1V1Q A;  2PCF B;  1HA5 A;  3OSO A;  1IW7 C;  1IKL A;  2F0H A;  5IYB H;  3L7Z C;  4KKS A;  1LT3 D;  4RHS A;  3CC4 A;  1ASY A;  2IX1 A;  4KJN A;  3IL8 A;  2WB1 E;  1SE8 A;  4WJ4 A;  3S9W A;  2F0O A;  3J80 L;  1RJT A;  4QY7 A;  3PO3 H;  2HQL A;  1UEA B;  1SYC A;  3QJY A;  3CCS A;  2R7F A;  1QIL A;  1V1P A;  2A74 C;  3PIO 3;  2NN6 H;  4RWS C;  1VQ6 A;  1O78 A;  1PYB A;  2E74 C;  5EKI A;  4M8A A;  3I4M H;  1EIY B;  4NXM L;  4DV4 L;  4IJH A;  2Q2H A;  3CCU A;  2B2Y A;  1E1T A;  4POG A;  4PMC A;  4DGZ A;  1Q46 A;  5M3M G;  2JA6 G;  3S1M H;  3I4N B;  1PZJ D;  4DV2 L;  3UE1 A;  1GO3 E;  5I6Y A;  1WTQ A;  3ERS X;  1X3G A;  3T1H L;  5IYD G;  1SR3 A;  1KNA A;  3T16 A;  5IYB G;  5I2Y A;  2AKW B;  4RGO S;  2RBM A;  1QNK A;  4IUP A;  1EU4 A;  5D14 A;  3T53 B;  5IT9 L;  5FLX L;  2A68 D;  3DMU A;  4IQZ A;  4DV0 L;  3A5U A;  5LMU L;  3GP7 A;  3L9A X;  2JA7 G;  3NHH A;  4RGN A;  1CQV A;  1V43 A;  1BOS A;  3FDT A;  1VMC A;  4K6L A;  4O42 A;  4GNX C;  1PFN A;  1J6Q A;  3FPU B;  4A3B B;  2K5V A;  1SLJ A;  2LY7 A;  2KCT A;  2VNU D;  3NPP A;  4K5W A;  3IKJ A;  4RCO A;  4WJ3 M;  4WRD A;  1PH2 A;  4DR5 L;  4BY1 B;  4GKJ L;  1J9O A;  3S16 B;  2XRQ D;  4HJA A;  1SYD A;  3KJO A;  4GOP C;  1CUK A;  4HTH A;  3PUW A;  4P75 A;  3GTK B;  4A3E B;  4NP5 A;  2HDM A;  5I9O A;  1EYA A;  3J80 c;  2KHI A;  4OIJ A;  3BDL A;  4C3I G;  4DR5 Q;  1GM5 A;  3IAY A;  2RA4 A;  1JJG A;  5IYC G;  4C3H G;  1ILQ A;  3UDI A;  4L5S A;  2EYO A;  2N55 A;  3I4M G;  5M5Y B;  3L0O A;  2QDB A;  4FXD A;  1F77 A;  3BDC A;  1JT8 A;  3FRP B;  4NXN L;  4IUN A;  4POF A;  1VCI A;  1B3A A;  4G57 A;  2K01 A;  4YWM A;  3W5O A;  3NTH A;  4ZCK A;  4B3M Q;  4C3H H;  1B2T A;  2E2I H;  1X54 A;  1BO0 A;  3WWV A;  2XNA C;  5M9O A;  3K0Y A;  4N9T A;  1V1P B;  1T9H A;  3R2I A;  2N88 A;  3V05 A;  1NMF A;  4FO2 A;  1ENF A;  3RNU A;  3D4W A;  5C44 G;  1TWF H;  1XYI A;  1D8L A;  1TII D;  4CJ1 B;  1K8M A;  2MGS A;  3H3V C;  2NVT B;  3GTO H;  1PFS A;  2R92 H;  4IUV A;  4JI5 Q;  3CCJ A;  4KK7 A;  1EWC A;  1GUN A;  2RCF A;  3HKZ E;  3T1Y L;  5D3D A;  4FNF A;  4CDD C;  2R61 A;  2VUM H;  2MP1 A;  4UAI A;  3K5M A;  4KY7 A;  5C4J B;  5JJL A;  3F2B A;  1K83 B;  1WFQ A;  3F2D A;  1VQC A;  4J1M A;  2ZTC A;  1YNJ C;  2VQF L;  3A5Z B;  3BZC A;  1HFG A;  4HID A;  5G3L F;  1QVC A;  2UXC Q;  4IZ8 A;  2Q2I A;  1OXT A;  1HUN A;  1OXU A;  4LFB L;  4KHV A;  3TSS A;  4OO1 H;  1AE2 A;  2Z8L A;  3V96 A;  2G9H D;  5CBA E;  2I5H A;  2XWJ B;  4HIK A;  1MSG A;  4IFD I;  1HNZ Q;  5M3M H;  5M3F G;  3BG3 A;  4DNR B;  4XQJ A;  3CRL C;  1GUS A;  4JI1 L;  4OX9 Q;  1K0R A;  4IO9 A;  2JA5 H;  4A3B G;  1Y14 B;  2ENB A;  4BBS G;  4DA2 A;  3RLN A;  1VF7 A;  2F0W A;  4LF6 L;  1EQV A;  2A69 D;  3OWE B;  3WDN A;  2NN6 G;  1ILP A;  1YJ9 A;  1I6H B;  3PQI A;  1CSQ A;  4HSP A;  3TZD A;  5CV4 A;  4FF2 A;  1F2Y A;  2JN4 A;  2K5Q A;  4DR7 L;  1B9M A;  4DF7 A;  3CQZ B;  1OO9 B;  4Q5V A;  3CC7 A;  3OMG A;  5C0X H;  1TWA H;  1S5E D;  1CKN A;  1N36 L;  1MD2 D;  3T13 A;  3NEM A;  1IBK L;  2R7Z H;  4HAE A;  3PF5 A;  4PNY A;  3KF8 A;  3FKI G;  1X9N A;  3CP0 A;  1TS2 A;  4GZY C;  3TBI B;  2QIL A;  1Q8I A;  1LLR D;  3R93 A;  5LMN W;  3GQB A;  5ELE A;  1G51 A;  4JBJ A;  4A3B H;  1JE4 A;  3BVZ A;  1TWG B;  1SNP A;  3VDY A;  4DUY Q;  1YHA A;  2Z6K A;  1PRT C;  4DV1 L;  3K6O A;  4A3J G;  4YIJ A;  4G4K A;  1IYV A;  2R3Z A;  4L8J A;  4DR3 Q;  1STE A;  1LTS D;  1C7Y A;  1KDC A;  3RN5 A;  5C3X A;  3SK8 A;  4J15 A;  3S24 A;  1NBW A;  1S40 A;  3JAM i;  1BCP B;  2EY5 A;  4X65 Q;  5COR A;  3B6Y A;  3ULL A;  1NJI C;  3E0E A;  2AQ2 B;  1AW7 A;  4L6T B;  4A3K B;  2J7Z A;  3MC0 B;  3NXW A;  4DV4 Q;  4AH6 A;  1LTG D;  1FNU A;  1BNZ A;  4PV1 C;  1SN8 A;  3C46 A;  3S15 H;  2D0P A;  3LWE A;  5DAU A;  3LX0 A;  3S17 B;  2R93 H;  1C0A A;  4KD4 A;  3HOX H;  5JJI A;  5K36 G;  3DM3 A;  3K80 C;  5CBE E;  3C3L A;  2C5C A;  1Y8P B;  5M5X H;  2D5D A;  1JR0 D;  5C0X G;  3J7Z C;  4A3I G;  2EYM A;  4A3M H;  2UU9 Q;  2R7D A;  3CCV A;  3CME A;  1ENC A;  2ZXP A;  1CZW A;  1Q3L A;  1TR5 A;  2B2U C;  4YCV A;  2B63 H;  1XMO L;  1KNE A;  1YNJ D;  3C1E A;  2RSO A;  2NVT H;  2MO1 A;  2GA4 B;  1PH3 A;  1KLG D;  1JJ2 A;  1DM0 B;  2PQA B;  1IXR A;  1I50 B;  2N8N A;  1ONL A;  1UEB A;  2OF1 A;  3GV6 A;  2WKC A;  3J80 E;  1HA6 A;  1E0B A;  1HXY D;  1F9P A;  3J80 i;  4I65 A;  1MSH A;  2EQS A;  3MVV A;  2QEJ C;  3Q23 A;  1U4M A;  1K83 H;  4A3F B;  2B2W C;  1B70 B;  1X55 A;  1L1O C;  3KLS A;  1JB3 A;  4C3I H;  2CWP A;  2FMM A;  1TWC B;  1JC7 A;  2DY7 A;  3MXP A;  1TXY A;  1HPC A;  3MXU A;  1YHQ A;  1SMX A;  1EYG A;  2ES2 A;  3MEF A;  1FYC A;  3KF6 B;  3TP6 A;  1MI2 A;  4A3C H;  4OIK A;  2A69 C;  1V1O A;  4L63 B;  5COY A;  1X3Q A;  2CQO A;  2L4N A;  4JBW A;  4Y52 H;  3LWU A;  4N8X 1;  1HTL D;  2A19 A;  2NZ1 D;  4DFA A;  4ZKC B;  3HOV H;  1TS4 A;  5I9P A;  3E9I A;  5ELB A;  1Z9F A;  3TN2 A;  1JCK B;  1AEX A;  2QW7 A;  4DV7 L;  5M5X B;  5IE8 A;  1QVG A;  1EY5 A;  3M3Y B;  1A3V A;  2B2T A;  4E6I A;  3J81 c;  3GTO B;  4R4T A;  5EPJ A;  2K32 A;  2Z1C A;  1VF5 C;  2LFN A;  2LXJ A;  1WD0 A;  4HIO A;  2UXB Q;  1EOT A;  3I72 A;  5IY0 A;  4X3U A;  2VB2 X;  3MHB A;  3UDG A;  1D5Z C;  3GTQ B;  1CK1 A;  2ZJR A;  2E2J H;  4GOP B;  1D6E C;  1S5B D;  4ABN A;  1PRT D;  3CCM A;  1TWH H;  4HCS A;  3SK6 A;  2Y0S G;  1EY8 A;  4JI7 Q;  2OEO A;  4A3E H;  1A3T A;  3A56 A;  5JJK A;  1BQQ T;  1C4Q A;  3QOJ A;  4OHJ A;  4C2M H;  4DV6 L;  2UUC Q;  2ZM6 L;  1EY4 A;  2JXM B;  3J81 i;  1KTK A;  1QE6 A;  1YNN C;  3CQZ H;  4LW1 A;  1IBK Q;  2RSN A;  3S14 B;  4DAY A;  1PH9 A;  1H95 A;  4UPA A;  1E2Z A;  5KEE A;  3D4R A;  3PIO A;  2L9H A;  1KHI A;  4IFD J;  1N8R C;  4B3T Q;  5M3M B;  4JOI C;  1ZEQ X;  5NUC A;  3S1R H;  4K5V A;  3PCO B;  1YZ6 A;  2UUC L;  3E9H A;  1K0S A;  4CGY B;  4RKL A;  1DYQ A;  3G48 A;  2EYJ A;  4YHH L;  4DV1 Q;  2NN6 I;  2JA8 B;  3KUP A;  3G6J B;  2OTJ A;  3S16 H;  2VL6 A;  1JMC A;  1XNR L;  1DXM A;  3MXG A;  4RGM A;  1AN8 A;  3GTK H;  1KDA A;  2IX0 A;  2ZXO A;  3M4Y A;  1EEF D;  4F7X A;  5DEH A;  4BBR G;  1P16 A;  2QKI C;  5FO8 B;  2JYO A;  4GLV B;  1XMO Q;  4LF9 L;  1VQI A;  1VMP A;  2PO4 A;  3U4V A;  1R9T B;  2EE1 A;  1DOL A;  4LMQ D;  1XMQ L;  5JAV A;  2Z4I A;  2K6A A;  2OT2 A;  1T5X D;  3OW2 A;  1Q90 A;  3Q22 A;  1MGS A;  4F88 A;  2NYZ D;  3FPP A;  2JP1 A;  2NTT A;  4GLA C;  2A8V A;  1HHV A;  4Y7N H;  4DN4 M;  2B8F A;  3UDF A;  4N8F A;  3M4Q A;  2NBF A;  2F0I A;  4QUF A;  1MJE A;  2Q8T A;  5GAD C;  4H02 A;  4XQQ A;  1X56 A;  3I4N H;  2HHH Q;  1TWF B;  5M5W B;  5BR8 Q;  3MEH A;  4FXK C;  1H9R A;  1EQT A;  1NY4 A;  3HFZ B;  5C4X G;  3S1Q H;  2NVX B;  4A3D B;  4GKJ Q;  2NVQ H;  4X64 Q;  4IUT A;  3QIA A;  3FMC A;  5JEA G;  3AFQ A;  2K50 A;  5M3F H;  3K5N A;  1ZKO A;  3VR3 A;  1B7Y B;  4KLK A;  4V19 0;  3S1M B;  2AUK A;  4PMB A;  2EYH A;  4B9W A;  2Z0S A;  1ICF B;  3NEL A;  4KJO A;  5GAE C;  3U9S A;  2CCZ A;  4IUU A;  2WFW A;  4L5Q A;  4GS3 A;  1CZG A;  5BN4 A;  2C9O A;  3G7L A;  3M85 A;  3HOY B;  1ESF A;  4TSS A;  3RZO B;  3TS0 A;  2Q2U A;  3OHX C;  3HOU H;  3ITP A;  1C8C A;  4MN3 A;  4YCW A;  1EIH A;  4P73 A;  4H13 C;  4DKA C;  3EFX D;  3RLF A;  4MIU A;  5EBD A;  3WOF A;  3H94 A;  2O4X A;  2MFI A;  3V2T A;  1Q12 A;  3GV3 A;  1YIJ A;  2VUM G;  2K04 A;  1O7Y A;  3FEW X;  4DR1 Q;  4RH6 A;  4TKO B;  3FKI H;  2TMP A;  4U67 3;  5G3L D;  3AEV A;  2OQK A;  3PMF A;  4CHT B;  3PO2 H;  4KY6 A;  1IZ6 A;  5IGC A;  3F2C A;  2CKZ B;  1EWI A;  2ICE C;  4DV6 Q;  1WI5 A;  3I56 A;  5J22 A;  1XMQ Q;  2L0C A;  1ET6 A;  4DK3 C;  3S2H B;  4XYQ A;  2F0M A;  4HR7 B;  3J81 j;  1ESR A;  1QB5 D;  2E76 C;  1VQE A;  3KDF A;  3H0G B;  3A8J E;  3P1H A;  4ZQ3 A;  5EKK A;  3D31 A;  1HNX L;  1LV9 A;  1QJO A;  4LF5 L;  1D1K A;  3RN2 A;  4K6D A;  1XXG A;  1PTO D;  2F52 A;  3JAM L;  2UUB L;  1TWG H;  3M7N A;  4DAV A;  1CKO A;  3IFD A;  1KC8 C;  5AJ3 L;  5JEA H;  4IOC A;  1BCP C;  4V0B A;  3K5L A;  4ZYS A;  1SJH D;  2RF4 A;  4Z9C B;  4JI8 L;  3GTQ H;  1M90 C;  2H1E A;  3OPO A;  4GOP A;  4JI7 L;  4C3J B; 
#chains in the Genus database with same CATH homology
 4LUO A;  1JB7 A;  4A3G G;  1J5E L;  2NVX H;  5JJL A;  3F2B A;  4IPG A;  4DNI A;  1EIF A;  1LM0 A;  1WFQ A;  2ZJQ A;  3TS2 A;  3KJP A;  4TQU S;  3F2D A;  4OO1 G;  4LF8 L;  1VQC A;  1K73 C;  2ZTC A;  1K9M C;  2VQF L;  1BBW A;  4PMW A;  3STB D;  5C3E H;  3A5Z B;  1N33 L;  3BZC A;  4UP9 A;  4HID A;  1L1O A;  4APV A;  5IP7 G;  2YTY A;  4PZ7 A;  1QVC A;  2AMC B;  1I94 Q;  2IHE A;  1N36 Q;  4B3T L;  2UXC Q;  2Q2I A;  1OXT A;  1OXU A;  4BY1 H;  2GVA A;  4LFB L;  1AE2 A;  5M5Y H;  2I5H A;  4HIK A;  1L1O B;  3CF5 A;  4LF6 Q;  4X66 L;  4IFD I;  4ALP A;  2QA4 A;  1HNZ Q;  2ZTD A;  5M3M H;  1HJP A;  3G71 A;  5LMN L;  5M3F G;  4LUV A;  4R4Q A;  5FLX c;  4GNX B;  1IBM L;  4R1J A;  4JI1 L;  2WAQ G;  2H5X A;  4MZ9 A;  1K0R A;  4IO9 A;  1VQM A;  4OX9 Q;  3A0J A;  1W2B A;  2JA5 H;  1AE3 A;  4DR4 L;  4A3B G;  1Y14 B;  4DUY L;  1VQP A;  3HOZ H;  1A63 A;  3Q8D A;  4BBS G;  2YTV A;  3RLN A;  4BBR H;  5GRO A;  3PIP A;  4LF6 L;  1HH2 P;  1D7Q A;  1VQH A;  2XGT A;  1R9T H;  1HR0 L;  2YU9 H;  1XPR A;  2MNA A;  2YYZ A;  2BH8 A;  2NN6 G;  4JI8 Q;  3UE0 A;  1YJ9 A;  1YJW A;  2NZH A;  2B3G A;  1KXL A;  1BVS A;  2N78 A;  2VS1 A;  5H1S E;  1CSQ A;  1BBU A;  1EUJ A;  2ZTE A;  4QJF A;  3M9B A;  3D0F A;  1OXS C;  4JG2 A;  4MNO A;  2UXD Q;  2PQA A;  4RG1 A;  3S2D H;  4X65 L;  1E7Z A;  1QZH A;  4DV2 Q;  2NVY H;  4DR7 L;  3CXC A;  3CCR A;  4JI1 Q;  5GAH C;  2KHJ A;  4JI4 L;  1HR0 Q;  3CC7 A;  4KHP Q;  4X6A H;  2WP8 J;  5IYD H;  1W3S A;  3AFP A;  1TWA H;  5IT9 c;  1HR0 W;  4JI0 Q;  1CKN A;  1N36 L;  4B3M Q;  1K3R A;  3T1H Q;  3NEM A;  1IBK L;  2R7Z H;  3PF5 A;  1G6P A;  2VY3 A;  3FKI G;  4L5T A;  1X9N A;  1KIX A;  3CP0 A;  4BY7 G;  4A3K H;  1EQQ A;  3PGZ A;  4JI4 Q;  1HNW Q;  4X62 Q;  5LMN W;  3HOW G;  1WOC A;  2B29 A;  1HZB A;  4DR3 L;  4HJ9 A;  1OTC A;  1RIP A;  3CCQ A;  3EN2 A;  1I3Q H;  1G51 A;  1I5F A;  1N34 L;  1UE6 A;  4JBJ A;  4A3B H;  3F1Z A;  4JV5 Q;  5IYC H;  2HHH L;  4JI3 L;  2A1A A;  4JI2 L;  4P71 A;  3VDY A;  3I4N G;  1FGU A;  5JEA J;  3KOJ A;  4DUY Q;  3H0G G;  1WCM G;  1YHA A;  2OQ0 A;  2Z6K A;  3JC6 6;  4IPH A;  2VW9 A;  4DV1 L;  1EFW A;  1I6H H;  3HOU G;  4A3J G;  2R7Z G;  4DV5 Q;  4DR3 Q;  4A3M G;  1C7Y A;  3RN5 A;  1ASZ A;  3RZD H;  1PH6 A;  1KAW A;  3K0X A;  4J15 A;  3H3V I;  1PH4 A;  3S24 A;  1QUQ B;  1HNW L;  1NBW A;  1N32 Q;  1VQ4 A;  1S40 A;  3JAM i;  4XTC S;  4LFC L;  1I94 L;  1UE7 A;  2E8G A;  3DLL A;  4X65 Q;  3B6Y A;  1OXV A;  1TWC H;  3UDX A;  4JI6 L;  4AQY L;  4A3J H;  3ULL A;  2OWO A;  2DUD A;  3E0E A;  1NJI C;  1X6O A;  1SFO H;  3CC2 A;  3FP9 A;  2R93 G;  4BXX G;  3KLW A;  4LF7 Q;  3U50 C;  1VQ7 A;  4P72 A;  4DV5 L;  3PUV A;  2JQO A;  4DV4 Q;  2N49 A;  4LF9 Q;  1VS0 A;  4X64 L;  1VQJ A;  4AH6 A;  4BBS H;  4GKK Q;  3HOZ G;  1YHB A;  1P8L A;  5LMN Q;  1KD1 C;  1SN8 A;  3HOW H;  2JA5 G;  4AQY Q;  1N9W A;  3GO5 A;  3FHW A;  4OX9 L;  4K0K L;  3S15 H;  2D0P A;  2R93 H;  2L15 A;  1C0A A;  2BA1 A;  1KL9 A;  1HZA A;  2PI2 E;  3GTJ H;  3HOV G;  2AWN A;  3M4P A;  4YCU A;  3F8T A;  3HOX H;  1YIT A;  1JE5 A;  5JJI A;  2R92 G;  2CWA A;  1XNR Q;  5K36 G;  3DM3 A;  3K80 C;  4DK6 C;  2WAQ E;  1LYL A;  5M5X H;  1VQN A;  5C0X G;  1Q81 C;  1L0W A;  4C3J H;  3J7Z C;  4A3I G;  3I7F A;  4OO1 I;  4AYB G;  2IY5 B;  4DUZ L;  4NPS A;  4A3M H;  1FJG Q;  4HJ5 A;  2UU9 Q;  2R7D A;  3CCV A;  3CME A;  2JJQ A;  1CKM A;  4A4I A;  1WYD A;  5GQO A;  2JA6 H;  4YCV A;  1E3P A;  4NXM Q;  5C3E G;  2B63 H;  4JYA Q;  2D0O A;  2C35 B;  4YY3 Q;  1XMO L;  3NEN A;  4HJ8 A;  1Q1B A;  4DR6 Q;  3PV0 A;  3GTP H;  1QUQ A;  2NVT H;  2MO1 A;  2K52 A;  5E7N A;  1PH3 A;  2HIX A;  2ZJP A;  3S14 H;  2IT1 A;  4A3G H;  4TVA B;  1JJ2 A;  2PQA B;  4YWL A;  2KBN A;  4DAM A;  1IXR A;  2PNH A;  5FJ8 G;  2JEA I;  2N8N A;  4PZ6 A;  2I0Q A;  1E22 A;  1UEB A;  1Y1V H;  2D62 A;  4JI5 L;  4HIM A;  4LF4 L;  4JOI A;  1A8V A;  3I4O A;  3CPW A;  4X62 L;  4DUZ Q;  4OXP A;  3J80 i;  5IP9 H;  3G4S A;  2E5L Q;  2EQS A;  2QGQ A;  2RHQ B;  1CKN B;  2F4V Q;  4A76 A;  4B3M L;  4NXN Q;  1VQ8 A;  4GN5 A;  2K5N A;  4DR2 L;  1K83 H;  1XPO A;  2PMZ E;  3K8A A;  1SRU A;  5IWA Q;  4O2D A;  1EOV A;  1B70 B;  1X55 A;  1L1O C;  3T1Y Q;  1PH8 A;  2ID0 A;  3TRE A;  4DV0 Q;  4C3I H;  2CWP A;  2ASB A;  3CW2 C;  1KQS A;  1TXY A;  1GVP A;  1YHQ A;  1SMX A;  1IBL L;  2RHS B;  1EYG A;  5IP7 H;  4DV7 Q;  2ES2 A;  1IL2 A;  3MEF A;  3KF6 B;  4DR2 Q;  4KI0 A;  4A3C H;  1N32 L;  3CMA A;  3GTG H;  1GD7 A;  2VQF Q;  2AHO B;  4GLX A;  2GVB A;  4GN3 B;  1VQB A;  2PI2 A;  3BZK A;  3HKZ G;  2F4V L;  5ELO A;  4JI6 Q;  1HZ9 A;  4KHZ A;  1IYJ B;  4MTN A;  4QL5 A;  2ZM6 Q;  2CQO A;  3HKS A;  4JBW A;  3MXN B;  4LWC A;  4A3F H;  4A93 H;  1PVO A;  4Y52 H;  2A19 A;  1E24 A;  1IBL Q;  2YTX A;  3HOV H;  3H15 A;  1VQ5 A;  3OTO L;  1HNZ L;  3I55 A;  2OCE A;  4UP7 A;  2KCM A;  1A62 A;  4IJL A;  3E9I A;  1IBM Q;  1MJC A;  1Z9F A;  4LFA L;  1MKH A;  2NZO A;  4RMF A;  5FJ8 H;  4DV7 L;  4QIW E;  3W1B A;  5IE8 A;  1QVG A;  5C4X H;  2ATW A;  4K0K Q;  2VQE Q;  4DV3 L;  4A3F G;  4A3D H;  1YVC A;  1UE1 A;  3J81 c;  3BU2 A;  1Q7Y C;  4R4T A;  4A3L H;  3TQY A;  2K75 A;  4DR4 Q;  1S72 A;  1N34 Q;  2XTI A;  2V1C C;  2LXJ A;  1VQF A;  3EBE A;  3KF8 B;  4IFD G;  1VQK A;  4HIO A;  4O0A A;  2UXB Q;  4LNQ A;  4P74 A;  5FLM H;  4JI3 Q;  5IY0 A;  1HNX Q;  2VQE L;  4DV3 Q;  3UDG A;  4JBK A;  3GTM H;  2BA0 A;  1PV4 A;  2ZJR A;  4A75 A;  2E2J H;  4A3L G;  4L5R C;  4GOP B;  1QVF A;  1A0I A;  3OYY A;  2UUB Q;  4B3R L;  3CCM A;  4QGU A;  1TWH H;  3PO2 G;  4OON A;  1XTD A;  3HOX G;  2Y0S G;  3PF4 A;  4JI7 Q;  3CAM A;  1YJN A;  4A3E H;  4DPG A;  1WCM H;  4DR6 L;  4KHP L;  5JJK A;  4C2M H;  3AQQ A;  1UE5 A;  2CFM A;  4DV6 L;  2UUC Q;  2ZM6 L;  2RCN A;  3NBH B;  1Q86 C;  3J81 i;  1X3F A;  1Y1V G;  3CQZ H;  4LW1 A;  1IBK Q;  2VZA A;  4JCV E;  2YV5 A;  3KFU A;  1PH9 A;  1L2F A;  1H95 A;  1YBY A;  4UPA A;  2E5L L;  1I50 H;  3TRZ A;  3I2Z A;  3M3Y H;  4GN4 B;  3BJU A;  4AIM A;  3KF6 A;  4LFA Q;  4A3K G;  4OWT B;  3HOY H;  4BXX H;  4QQB X;  3PIO A;  4EX5 A;  3PO3 G;  2UXD L;  4A3C G;  4ME3 A;  3J7A 5;  1KHI A;  4JC0 A;  1GKH A;  4IFD J;  1N8R C;  4B3T Q;  2UXC L;  1VQD A;  4JOI C;  3S17 H;  1S3O A;  1XJV A;  2EIF A;  3CCL A;  3CD6 A;  1V1Q A;  4IOA A;  3S1R H;  2N3S A;  5ELN A;  3PCO B;  1YZ6 A;  3L7Z C;  3E9H A;  4EQ5 A;  2IHF A;  1UWV A;  5IYB H;  2UUC L;  2JA8 G;  3ULP A;  1K8A C;  3CC4 A;  1ASY A;  3G48 A;  1VQ9 A;  1YEZ A;  4YHH L;  2NN6 I;  1Q8K A;  2QEX A;  4DV1 Q;  1K8G A;  1YI2 A;  2Y0S E;  5LMU Q;  2IX1 A;  2OTJ A;  3S16 H;  2UXB L;  1FL0 A;  2VL6 A;  1Q1E A;  2WB1 E;  4DAY B;  1SE8 A;  1Y1W G;  1M1K C;  5GAG C;  1JMC A;  1XNR L;  4WJ4 A;  2K4K A;  4QY7 A;  3PO3 H;  2HQL A;  3CCS A;  2R7F A;  3GTK H;  3PUY A;  4BA2 I;  3HOY G;  5IP9 G;  4LUZ A;  5M5W H;  1VQ6 A;  3U58 A;  2IX0 A;  3STB C;  1HZC A;  1PYB A;  4BBR G;  1P16 A;  5C0X J;  3I4M H;  1EIY B;  4NXM L;  3K81 C;  4DV4 L;  4GLV B;  4IJH A;  4YY3 L;  1VQI A;  1XMO Q;  1KRS A;  4LF9 L;  2HT1 A;  2Q2H A;  3U4V A;  3JAM c;  3CCU A;  3RLO A;  3K7A H;  1E1T A;  4XIG S;  4POG A;  3S2H H;  1Q46 A;  2B63 G;  3PUZ A;  5M3M G;  1XMQ L;  2JA6 G;  1VQA A;  1PYS B;  3S1M H;  1NTG A;  2BH2 A;  1C9O A;  4DV2 L;  3UE1 A;  1VQG A;  3OW2 A;  1GO3 E;  3ERS X;  1XPU A;  1X3G A;  3AYH B;  4GNX A;  5C4J H;  3T1H L;  1VQL A;  3CPF A;  1SRO A;  3IRB A;  1E1O A;  4X66 Q;  5IYD G;  4IPD A;  2A8V A;  4R4O A;  4GLA C;  1JJC B;  1SR3 A;  2EXD A;  1PHJ A;  3TEH B;  3ZJY C;  4A3I H;  4Y7N H;  2Q2T A;  4B3S Q;  4HJ7 A;  5IYB G;  2JA8 H;  1CSP A;  2AKW B;  2JK8 A;  3GD7 A;  5HGQ A;  5FLM G;  1OXX K;  3ULJ A;  3UDF A;  2E2H H;  2Z6K C;  2WB1 G;  3M4Q A;  2GN5 A;  3ICE A;  2I5L X;  1MJE A;  5GAD C;  4LF7 L;  4H02 A;  4DV0 L;  3A5U A;  1X56 A;  2K5H A;  3G6E A;  5LMU L;  3I4N H;  2JEB I;  2HHH Q;  2JA7 G;  2ALY B;  1AH9 A;  5BR8 Q;  4PZ8 A;  1B8A A;  4DR1 L;  4A3D G;  1NY4 A;  3HFZ B;  1V43 A;  3EIV A;  1PH5 A;  2K14 A;  3M4O H;  1NMG A;  2R6G A;  3S1Q H;  4UY8 C;  3RZO H;  5C4X G;  4GKJ Q;  1G29 1;  2NVQ H;  4GNX C;  4X64 Q;  1J6Q A;  2K5V A;  2AWO A;  2LXK A;  1SLJ A;  1J5E Q;  3CCE A;  2JA7 H;  4DR7 Q;  5JEA G;  2KCT A;  3AFQ A;  2LSS A;  4AYB E;  2VNU D;  2K50 A;  5M3F H;  1Q82 C;  1NE3 A;  1B7Y B;  4KLK A;  4LFC Q;  2F3I A;  4WJ3 M;  1MIU A;  1YNX A;  4JI0 L;  4A93 G;  2Z0S A;  1PH2 A;  4DR5 L;  3NEL A;  4GKJ L;  1RL2 A;  3L2P A;  1EQR A;  5HY6 A;  5GAE C;  3K7U C;  2OTL A;  4BY1 G;  4HJA A;  2CCZ A;  2WFW A;  4GS3 A;  4L5Q A;  3KJO A;  4GOP C;  1CUK A;  3M85 A;  4LFB Q;  4PG3 A;  1XNQ L;  3PUW A;  3TS0 A;  5C44 H;  4P75 A;  3U4Z A;  2Q2U A;  4JBM A;  2I5M X;  2UU9 L;  4R4I A;  3HOU H;  4YWK A;  4YCW A;  4GKK L;  4P73 A;  3S1N H;  3H0G H;  3J80 c;  4DKA C;  2KHI A;  3RLF A;  3SGI A;  4DR5 Q;  1GM5 A;  1JJG A;  4NB3 A;  4OWW B;  4JI2 Q;  5IYC G;  1QZG A;  5C0X I;  3UDI A;  5AJ3 Q;  4L5S A;  1PH1 A;  2MFI A;  4FDB A;  1Q12 A;  3KYH C;  1LUZ A;  3I4M G;  3L0O A;  1LTL A;  1YIJ A;  2HIV A;  2VUM G;  1VQO A;  5BR8 L;  3KDF B;  4DR1 Q;  4BY7 H;  3GDE A;  5EAY A;  1JT8 A;  4NXN L;  3FKI H;  3OTO Q;  4POF A;  3AEV A;  2JE6 I;  1Z47 A;  5DLQ E;  1FJG L;  1VCI A;  2OQK A;  5IWA L;  5J3B A;  1Y1W H;  3PO2 H;  1WJJ A;  4YWM A;  1IZ6 A;  3W5O A;  2DGY A;  1X65 A;  3F2C A;  1KRT A;  2CKZ B;  1EWI A;  2UUA L;  4C3H H;  4DV6 Q;  2E2I H;  1X54 A;  4OWX B;  1WI5 A;  3I56 A;  3WWV A;  1XMQ Q;  4LF5 Q;  4DK3 C;  1U0L A;  1T9H A;  3J81 j;  2MQH A;  3LGJ A;  1PH7 A;  1DGS A;  1NMF A;  3RNU A;  4JYA L;  3A74 A;  5C44 G;  1TWF H;  2MO0 A;  3PUX A;  1D8L A;  4BA1 I;  4B3S L;  1VQE A;  3KDF A;  1HNX L;  3D31 A;  1XNQ Q;  4LF8 Q;  3H3V H;  3ER0 A;  4LF5 L;  1X3E A;  3RN2 A;  3GTL H;  3GTO H;  3RR5 A;  2F52 A;  1PFS A;  1N33 Q;  2R92 H;  4JI5 Q;  2KEN A;  4UP8 A;  2UUA Q;  3CCJ A;  2UUB L;  4LF4 Q;  1PA6 A;  1TWG H;  3M7N A;  1O7I A;  1CKO A;  3W1G A;  4YHH Q;  1KC8 C;  5AJ3 L;  4IOC A;  3HKZ E;  4JV5 L;  1BKB A;  1U5K A;  4B3R Q;  3T1Y L;  2FXQ A;  2RF4 A;  1FVI A;  3PSI A;  4IPC A;  2JA9 A;  4JI8 L;  4A3E G;  4R4C A;  3GTQ H;  2VUM H;  1M90 C;  1V9P A;  4GOP A;  4JI7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...