4B3RL

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rL00
4IOAA 2UUCQ 5IYDG 1JB7A 1HH2P 2Q2HA 4JYAQ 4HIOA 4UY8C 2ASBA 2K5NA 3TQYA 3HOXG 1KC8C 3CC2A 4DR2L 1MKHA 4LF7Q 2A19A 4A3GH 2E2JH 1P8LA 1Q86C 4DR7L 3ULLA 3TRZA 5M3MG 1TXYA 2CWAA 5LMUQ 4A3DG 4GNXA 1EQRA 3KF6B 2E2HH 3UDXA 2Z6KC 5C4JH 2MFIA 2PMZE 4A3FG 1VQ9A 3I4OA 1A0IA 2L15A 2V1CC 1GKHA 3FKIH 3RZDH 4LF4L 4A93H 3BU2A 3AQQA 4LFCQ 2JK8A 2K14A 2D0PA 4X64L 3OYYA 3D0FA 3CD6A 3BZCA 1YJWA 1IZ6A 2OWOA 4DR1Q 1QVFA 3U58A 1HR0Q 1SMXA 4KLKA 4X66L 4QQBX 1NMFA 1VQCA 4BY1G 5ELOA 4FDBA 5JEAJ 4AH6A 2ID0A 4DV4L 1OXVA 2N49A 1LUZA 4NPSA 3H0GG 4A76A 1JE5A 1IL2A 4IOCA 1Y1WG 3PUZA 2NZHA 3W5OA 2ZTCA 4JOIC 4QL5A 3STBC 2UU9Q 1YHQA 1EUJA 1UE7A 1I6HH 5GROA 4ME3A 2F52A 4R4QA 3CC4A 1XNRQ 1GVPA 2QA4A 2YU9H 2R6GA 3PF4A 2VQFL 5IYBH 3RN5A 1A63A 1NE3A 3HOVH 3CCLA 2D0OA 3T1HQ 1LYLA 1VQGA 4YHHL 1OTCA 1J5EQ 4JBMA 2BA1A 1WCMH 2NVQH 4IFDJ 4IJHA 4JI8L 3F1ZA 4L5SA 2ZJQA 2EIFA 4DK3C 1A62A 2RF4A 2XGTA 4OONA 1N36L 3S1MH 4DUZQ 3KJOA 1A8VA 2UUBL 4JOIA 1Q1EA 1XMOQ 1L1OA 3I2ZA 4LFAQ 4JI2Q 4A3KG 4LF9L 1YNXA 1HNZQ 4P72A 4C3IH 1VQEA 4DV3L 1XTDA 1SROA 4JI0L 4AQYL 4LUZA 1N9WA 3NELA 3PUXA 1IBLQ 5C0XJ 3H15A 3GO5A 4XTCS 3M4QA 4NXML 2B29A 4LF5L 4JI1Q 3CCRA 3CMEA 1HR0W 1PH4A 1PA6A 1JJ2A 3T1YQ 1PYSB 2OTLA 4XIGS 1HNWQ 4A3MG 1GM5A 4YY3Q 2VS1A 2DGYA 4DUYL 2NN6I 1VQKA 1CUKA 1E24A 4JI5Q 3ICEA 1NJIC 2JA6G 1VS0A 1D8LA 4LUOA 4DAMA 1K9MC 5JJIA 4DKAC 5M3FH 1XMQQ 4OX9Q 2EQSA 4HJ7A 4DV6L 4IFDI 4POFA 5JEAG 1N32Q 4R4CA 4EX5A 4JI6L 3HOUG 4YCUA 4O2DA 4PZ8A 2K52A 2VZAA 4QIWE 3HOYG 1Q82C 4DV7Q 1PH8A 5FLMG 1G6PA 4QY7A 3GTLH 1FL0A 4BXXG 2CKZB 2UXBL 2PI2E 4Y7NH 2PQAA 5C0XI 1G291 3J81c 3CQZH 3HKZE 1FJGL 4IO9A 4BBRH 1PH2A 1FVIA 4LF6L 5H1SE 4K0KQ 3AYHB 5FJ8H 1BVSA 2ALYB 2RHQB 2ZM6Q 2N78A 1IBML 1G51A 3VDYA 1KD1C 1VQ6A 4NB3A 4BA2I 2NN6G 1EIYB 1SLJA 1QZHA 1Q8KA 2D62A 3J80c 3BJUA 1TWAH 4IFDG 3GTOH 4A4IA 2A1AA 3M9BA 1P16A 2Y0SE 1BKBA 3TS0A 4BY7G 4B3RL 2JA8H 3RLNA 3B6YA 1SE8A 4P71A 2UXCL 2LSSA 2YYZA 1K8GA 3K8AA 4A3LG 2R7FA 3CP0A 3UDFA 4OWTB 4GS3A 5C0XG 3BZKA 4JV5Q 4JBJA 1PH7A 1B70B 4A3EH 4DR2Q 2B63G 4HJ9A 3JC66 1IBKQ 5HGQA 5C44G 1GD7A 3PIOA 3J80i 1GO3E 3F2DA 2VUMH 4OO1I 4IPDA 5GAEC 3KYHC 4JI3L 1K83H 1RL2A 2KENA 2MQHA 4C2MH 4B3SQ 2UUAL 4BBSH 1X9NA 1JMCA 4JI7Q 4MNOA 3CPWA 3K0XA 2PI2A 3KOJA 5GAHC 2DUDA 2HHHL 1KIXA 3HOWH 1CKOA 3UDIA 3KJPA 5C4XG 4A3JH 1XPOA 5IWAL 2WP8J 2NVTH 1K3RA 1UE5A 2VNUD 5LMNL 3AFQA 3FP9A 3U4VA 5AJ3Q 4GOPB 4A3IG 2F3IA 2JA7G 1VQ5A 5JJLA 4P74A 2IX1A 1QUQA 4DK6C 4UP8A 5IP7H 2F4VQ 2K50A 1I3QH 1N33Q 2IHEA 4OXPA 3M7NA 2FXQA 4X6AH 5BR8L 4OWWB 2B3GA 4X66Q 2JEAI 1Z47A 2YTVA 4R1JA 3ULPA 2OCEA 1Q46A 1TWCH 2VQEL 5HY6A 3CCQA 3NBHB 4DV1Q 3I4MG 3HOZG 3PUWA 4DV2L 4DR3L 3PO2G 2Q2IA 3PF5A 1KQSA 1HNXQ 1X54A 3KLWA 4X65L 1SRUA 1KXLA 2KCMA 4IPGA 4LWCA 2JJQA 5JJKA 3MXNB 2I5MX 4DR6L 4Y52H 2QEXA 1L0WA 3W1GA 4AYBE 4DR4L 3LGJA 4HIKA 2UUCL 1X6OA 1HZBA 4LFBQ 4GNXB 4JYAL 2Z6KA 3G71A 3TEHB 1XJVA 2R93H 1VQIA 2VQFQ 4GN3B 3K7UC 4MZ9A 4LF7L 4R4IA 1B7YB 2PNHA 3J7A5 1FGUA 1CSQA 2KHIA 5LMUL 3L7ZC 5IYDH 3ERSX 2JA5G 4BA1I 3UDGA 1UWVA 3EN2A 3HOXH 3RLOA 5GADC 2E5LL 1WI5A 1UE6A 1LTLA 4DAYB 4DR5Q 5M3MH 4R4OA 3A5ZB 4LF9Q 3RR5A 4JI0Q 1E1TA 3NENA 1CKMA 4JI4Q 3U50C 4LFCL 1PHJA 1YI2A 1Y1VG 3U4ZA 3J81j 3CC7A 3A5UA 3I4NG 4KHZA 1AE3A 3S2DH 3PGZA 4LF5Q 2VY3A 1K0RA 4IPCA 1MJCA 3FHWA 2GVBA 4DR1L 4A3FH 1C7YA 3KDFA 4H02A 1X3FA 3ZJYC 3DLLA 1VQFA 1MJEA 2Q2UA 1X3GA 4DUYQ 2VL6A 2IT1A 4X62Q 5IT9c 3M85A 1Q1BA 2WAQG 4GKJQ 4NXNQ 2CCZA 1XPUA 2KCTA 1VQNA 4GKKL 4DV5Q 3SGIA 1WFQA 2Y0SG 3CCUA 1QZGA 2CFMA 2ZTDA 1XNQL 3K81C 4BY1H 2UU9L 1D7QA 4UPAA 2NVXH 4UP7A 2Q2TA 3GTJH 1HZ9A 2RCNA 2UXDL 1W3SA 3DM3A 3H0GH 1I94Q 1OXUA 1Y1WH 4L5RC 2R7ZG 3PUYA 1PH5A 1EYGA 4APVA 1NTGA 1VQJA 1V1QA 1KRTA 3T1HL 5IP9G 1L1OB 1YBYA 1JJCB 2AHOB 3S24A 1X65A 1CSPA 4PZ7A 4AIMA 1VQPA 1TWGH 1Y14B 4DUZL 2QGQA 3GTMH 1QVCA 3PIPA 1XMOL 1QVGA 1EQQA 2E2IH 4JI2L 4KHPQ 4B3MQ 1HNZL 4A3CG 3CCVA 4A75A 4IJLA 4A3DH 2H5XA 2MO0A 1IBLL 4PG3A 1UE1A 5ELNA 4C3HH 1J6QA 4JI1L 1MIUA 1E22A 2EXDA 3AFPA 3STBD 3L0OA 1N34Q 1EIFA 3T1YL 2HIXA 4A3KH 4LF8L 3HOUH 4QJFA 4YY3L 3OTOQ 1N8RC 2ATWA 2ZJRA 3EBEA 3Q8DA 1M90C 1CKNA 2JA9A 1XMQL 4OX9L 2OQKA 4DV0Q 2K5VA 1SR3A 4A3GG 4JI3Q 3J81i 4GOPC 1YZ6A 4KI0A 1V43A 1N32L 1HZAA 4A3MH 2PQAB 1YJ9A 1NMGA 2I0QA 1AH9A 4YCWA 4DV7L 1YEZA 2JA6H 1B8AA 4AYBG 3S1QH 1VQ7A 1HZCA 3A74A 1S40A 4YCVA 4DR7Q 3G48A 3CCEA 3ULJA 5M5WH 5J3BA 4A93G 4LUVA 5IP9H 4K0KL 3HOYH 1Q81C 1IYJB 1EWIA 2ZM6L 4HJ5A 5FLMH 2WFWA 4YWLA 3K80C 1SFOH 1VQ4A 4JBKA 1PFSA 4LF4Q 1E7ZA 2VQEQ 3S17H 1LM0A 2GN5A 3PCOB 3KF6A 4DV2Q 4GNXC 3PUVA 1JJGA 5EAYA 1U5KA 4GN4B 4X64Q 4X65Q 3CMAA 1VQ8A 2I5HA 2WB1E 2HQLA 3CCJA 3KF8B 5IE8A 3RNUA 3CW2C 3F2CA 4B3TL 1OXTA 4DV4Q 1EFWA 5DLQE 1L2FA 3F8TA 1VQOA 3G6EA 4JV5L 3G4SA 4BY7H 3UE0A 1BBUA 4WJ4A 1KL9A 4GLAC 5IYBG 1IBKL 3HOVG 4A3LH 1VQLA 1WYDA 4P75A 4P73A 4B3SL 1PH9A 3I56A 1Q12A 1WCMG 4JI7L 3GTPH 1V9PA 1C9OA 2K75A 2E5LQ 2JEBI 1K73C 2B63H 3M3YH 2IHFA 1VQHA 3NEMA 1ASYA 1QUQB 3RZOH 2CQOA 5C44H 2I5LX 2NVYH 4J15A 1O7IA 5LMNW 4YHHQ 1IXRA 4GN5A 4GLXA 4BXXH 2OQ0A 4OO1G 5AJ3L 3D31A 1H95A 4JBWA 4JI8Q 2NZOA 2MNAA 3L2PA 3GTKH 1N36Q 1YJNA 1KHIA 2JE6I 1VQDA 2AWOA 2F4VL 1N33L 3J7ZC 2UUBQ 5C4XH 4L5TA 3K7AH 4A3BG 4DNIA 2C35B 2R92G 4DV3Q 3JAMc 2JA7H 1X3EA 4A3IH 4OWXB 4DV1L 4AQYQ 3IRBA 4L5QA 3OW2A 1AE2A 1XPRA 2Z0SA 2XTIA 3CF5A 1YITA 3I4NH 1HNXL 4NXMQ 4GKKQ 4WJ3M 3HKZG 3W1BA 4LNQA 1TWFH 5M3FG 3S1NH 1HR0L 2AMCB 4JG2A 1EOVA 2MO1A 5GAGC 3GTQH 1XNQQ 3PV0A 3S14H 1L1OC 3I4MH 1RIPA 3PO3G 3PO2H 3HOZH 3A0JA 4LFBL 2UXDQ 5E7NA 1WOCA 5IYCG 4IPHA 3GTGH 4DV6Q 3H3VI 5GQOA 2A8VA 4TVAB 3TS2A 4JI6Q 4HIMA 1PH3A 1X56A 1W2BA 2IX0A 1OXSC 3WWVA 4BBRG 3S1RH 3AEVA 3JAMi 4QGUA 4JC0A 5M5XH 5FJ8G 1M1KC 3E9HA 2YTYA 2KHJA 4HJAA 1E3PA 2LXJA 1DGSA 1S72A 2ZTEA 1ASZA 4TQUS 1XNRL 2KBNA 2UXBQ 4DPGA 4DR5L 1FJGQ 4LF6Q 3KDFB 1IBMQ 2E8GA 2JA5H 1HJPA 2VW9A 4JCVE 3CXCA 3E0EA 1J5EL 2HIVA 4JI4L 2K5HA 2CWPA 3MEFA 3S16H 3CCSA 2JA8G 3TREA 1PV4A 3S15H 2ZJPA 4A3BH 4LF8Q 2R92H 1E1OA 3M4PA 4PMWA 4HJ8A 2OTJA 4LFAL 2ES2A 1TWHH 4X62L 1Y1VH 3GDEA 4A3EG 1Q7YC 4GKJL 4NXNL 4B3RQ 1WJJA 2IY5B 4YWKA 1NBWA 1YHAA 5C3EG 4DV5L 1PH6A 3HKSA 1Z9FA 2K4KA 4LW1A 2VUMG 3CPFA 2GVAA 1HNWL 1S3OA 4R4TA 3PO3H 5FLXc 1YIJA 1YHBA 4HIDA 2WB1G 4BBSG 1PVOA 4JI5L 3E9IA 2N8NA 5IYCH 1PH1A 3M4OH 3HOWG 4A3JG 1I94L 3EIVA 4ALPA 2UXCQ 3ER0A 4C3JH 2UUAQ 4RMFA 2AWNA 5K36G 1VQMA 2BH8A 2HT1A 5IP7G 2HHHQ 1VQAA 3F2BA 5IWAQ 1NY4A 4PZ6A 3RLFA 2WAQE 1K8AC 1BBWA 2R7ZH 2R7DA 5LMNQ 3FKIG 1C0AA 1T9HA 1R9TH 3CAMA 4MTNA 3PSIA 4KHPL 4B3ML 4UP9A 2BA0A 5M5YH 3HFZB 4YWMA 3CCMA 1I5FA 1JT8A 2JQOA 5BR8Q 2BH2A 1OXXK 1CKNB 2N3SA 4GOPA 3RN2A 3H3VH 1X55A 3UE1A 4B3TQ 4EQ5A 1N34L 1VQBA 2LXKA 1UEBA 4DR3Q 1U0LA 1VCIA 4A3CH 2AKWB 4O0AA 2YTXA 3I7FA 1KRSA 3OTOL 4POGA 3I55A 1SN8A 1I50H 2R93G 1YVCA 1PYBA 2RHSB 1KAWA 4DR6Q 3S2HH 5C3EH 3KFUA 5IY0A 4DV0L 4GLVB 4DR4Q 4RG1A 3GD7A 2YV5A
chains in the Genus database with same CATH superfamily
2AUKA 2K28A 4KKSA 2MUYA 2K5NA 3TQYA 2A68C 3CC2A 1CQFA 3I4NH 1SJHD 3C46A 1QOHA 3OMGA 1PFMA 3AB9A 2L12A 1VQ9A 3BG3A 3I4OA 3TDQA 4LJZC 1GKHA 5A35A 3H3VC 4Y7NB 4A93H 4LF4L 4LFCQ 1TS2A 1VMPA 2D0PA 3W3AA 1JC7A 3BZCA 5DM73 4DAYA 1QVFA 3T4AC 1HR0Q 1VQCA 5CBAE 3Q23A 1LTTD 5ELOA 4AH6A 2ID0A 2DN8A 2N49A 2OXPA 1Q90A 1JE5A 1IL2A 4IOCA 2PPBC 1LTGD 3PUZA 2JA8B 3W5OA 2ZTCA 1B9NA 5E3FA 1BNZA 1EUJA 1I6HH 2B2UA 3HS0C 1KLGD 1XNRQ 3R8BA 2QA4A 3PF4A 5IYBH 3O13A 1NE3A 1A63A 4FXDA 4ZLTF 1VMCA 5IGDA 2VUMB 4YHHL 2NVQH 4BBSB 4IJHA 3HOYB 4L5SA 4DK3C 2RF4A 2XGTA 4OONA 3S1MH 2ZT9C 1GUNA 4P72A 1I4QA 1XTDA 1SROA 5IGGA 4AQYL 4R9WA 2KECA 3M4QA 1I3QB 4QMGA 3T1YQ 1PYSB 4F8MA 4A3MG 2QILA 2VS1A 1NSNS 1CUKA 3ICEA 1K9MC 2B2YA 5M3FH 3P75A 1A2UA 5LHY1 4O2DA 1I6VC 1AZQA 2VZAA 1Q82C 4DV7Q 4Q5VA 2K03A 2CKZB 3RZOB 5C44B 1FJGL 3HKZE 4IO9A 4DGZA 4K0KQ 1PH2A 3ERQA 5H1SE 3DWAA 2N78A 3VDYA 4BA2I 1R4QB 3GTKB 2XRSD 1I4GA 4L8JA 1GUGA 1Z7TA 2RA4A 1TWAH 3SK5A 2Y0SE 1SYGA 3DHQA 1HA5A 1EQTA 2IWHA 1SYBA 4C56C 1J9OA 3NE5B 1K8GA 4A3LG 2DJFC 2O5IC 4GS3A 2GA4B 4JV5Q 4NDXA 3HP3A 4A3EH 2B63G 2F0PA 2K05A 4K5VA 4ABNA 4IPDA 3KYHC 1PTOB 5IGBA 3RMHA 4BXXG 1X9NA 4MNOA 3K0XA 3KOJA 3HRZC 1EFID 5GAHC 2WKDA 1ESFA 4CJ0B 1DYQA 3UDIA 2R3ZA 2F0IA 2JP1A 1HFNA 1JWUD 2PZUA 4A3IG 2F0OA 3NWTA 5K36H 1BCPB 1QUQA 5LL6X 4HMJA 4OXPA 4X6AH 4OWWB 1Z47A 1SNMA 2B8GA 2YTVA 3R2TA 4R1JA 5BN4A 5M9OA 1GJXA 4DV1Q 3I4MG 3CCQA 2K6AA 4OO1G 3HOZG 1TWHB 1AEXA 1SRUA 4IPGA 2FMMA 4LWCA 3SDZA 2Z8LA 1STYA 4DR4L 3DWQA 1X6OA 2DY7A 1HZBA 1YNJD 2CVRA 1W6JA 4GNXB 1QWYA 4KKUA 4JYAL 3K0YA 4GN3B 4MZ9A 4LF7L 3KLRA 2CQAA 2MPMA 5LMUL 1CSQA 2KHIA 3NQTA 4A3MB 2JA5G 1TR5A 2KOLA 3NQIA 2Z6BA 1WI5A 1UE6A 4DR5Q 1XYIA 5M3MH 3NSWA 4RGTA 1DD2A 1E1TA 3NENA 5M5WB 3U50C 1PHJA 1YI2A 1Y1VG 4HSPA 3J81j 4KHZA 3S2DH 2RCFA 2K01A 1MJCA 2QEJC 2GVBA 2JN4A 4DR1L 1C7YA 1SDFA 1O78A 3ZJYC 1VQFA 3S9WA 2VL6A 5J39A 2IT1A 3M85A 3GQBA 2WAQG 1HHVA 3ND8A 4GKKL 2XWJB 2HUGA 1JQYD 1WFQA 3CCUA 1QZGA 2UU9L 2WKCA 2Q2TA 4UP7A 2PMZB 3GTJH 1HZ9A 1CA6A 3DM3A 3E0JA 1Y1WH 4L5RC 2R7ZG 4KTAA 4APVA 1G8ZD 3D4WA 1VQJA 1V1QA 2HD3A 3FEWX 5IP9G 1EZ6A 1WVLA 1L1OB 1YBYA 1JWSD 2QF7A 5FO8B 4PZ7A 4AIMA 2PCFB 1XMOL 2EYOA 1QVGA 4JI2L 2NVYB 4A93B 4A3CG 3CCVA 4FVMA 5IGFA 4A3DH 2MO0A 5G3LF 1UE1A 2LFNA 5BN3A 4C3HH 1J6QA 2SNSA 4JI1L 3AFPA 1E22A 3L0OA 2Z4HA 1B44D 2L5TA 4QJFA 3E5SA 4DK1A 4YY3L 3TP8A 2ATWA 5HGTA 1M90C 1HUNA 2CW0C 2K5VA 4PMBA 2FJ2A 2KHSA 3S1NB 1N32L 1YZ6A 1IW7D 2JYOA 4KI0A 2K5WA 3PQIA 1NMGA 5I9OA 3I4MB 3HOZB 1B8AA 4AYBG 2M9VA 1I6HB 1HZCA 2VXWA 5JEAH 2OF1A 2SNMA 5EKKA 4DXFA 5BN5A 2RQXA 2NVQB 5FLMH 2WFWA 3QO2A 1F77A 3S1MB 3W2DA 4LF4Q 5JPNC 3SVMA 1LM0A 2GN5A 2DY8A 1JWMD 3PUVA 4X65Q 4XXEA 2JA5B 1S5FD 2I5HA 2HQLA 1ENAA 4FF2A 3CCJA 4ZAIA 4KKTA 3RNUA 3URYA 5CC4A 3RUZA 3F2CA 4B3TL 1OXTA 1VQOA 4U68A 1H9SA 3T13A 4BY7H 4ME5A 1Y1VB 4C1NK 1BBUA 4WJ4A 5A2QL 1KL9A 1EY8A 4GLAC 5EBDA 1IBKL 2MHVA 1LTBD 1IKMA 3H6MA 2F3WA 2D9UA 1DM0B 4UDUC 1WCMG 4FF3A 1V9PA 2XIWA 2L9HA 4UHVA 3M3YH 3SR1A 1O7IA 4B9XA 4YHHQ 1IXRA 4F88A 3D31A 1H95A 2NZOA 4C1NI 3I91A 1BDOA 3J81L 2JE6I 1VQDA 3J7ZC 1EU4A 5C4XH 2C35B 2X69A 2K1BA 3JAMc 2PZTA 4OWXB 4AQYQ 1H9MA 1AE2A 1BCPF 2XTIA 2Z0SA 4CDFC 1O7LA 3J80L 3CF5A 4G4KA 1X3PA 3HKZG 3H09A 4LNQA 4R8IA 2KCNA 1HR0L 4JG2A 1DCZA 5GAGC 3S14H 3PV0A 1GXDC 1PFBA 1RIPA 3PO3G 5ELEA 5IYCG 1HTPA 3HEJA 4A3EB 4X3KA 1JOOA 1CHQD 1Q8IA 2L4NA 5GQOA 3QIAA 1AW7A 1PH3A 3WWVA 4HEDA 3S1RH 1GUSA 2KHJA 2O5JC 1DOMA 2AUJD 1XNRL 4DPGA 3QG1A 5D65A 1FJGQ 2Q8RE 1U9RA 1G2SA 3DEPA 3KLSA 3TZUA 3E0EA 4X3UA 4ZQ3A 1F2ZA 4AYBB 3S15H 2ZJPA 4RFBA 4LF8Q 2R92H 4PMWA 3M4PA 4HJ8A 3FKIB 2AQ3B 4X62L 1Q7YC 4GKJL 4RHSA 1EL0A 5C3EG 1PH6A 1STNA 1Z9FA 2GVAA 2G9HD 4R4TA 1T5EA 5FLXc 3E9IA 4ZYSA 1B9MA 3M4OH 2NBFA 4A3JG 1EY9A 3EIVA 3ER0A 5HURA 4HTHA 1RF2D 4RMFA 1YNJC 2G5DA 1VQMA 2F4IA 4BS9A 3F2BA 3MAQA 5FO9B 1BBWA 2RDHA 1SNPA 1C0AA 5M3MB 3MXUA 4B3ML 4UP9A 4H7BA 1WCMB 3CCMA 1I5FA 5JAVA 3M7GA 3S2DB 5KIXA 4G7OC 1N34L 2HCCA 2AKWB 4O0AA 2YTXA 3OTOL 4POGA 3I55A 1I50H 1YVCA 3S2HH 5A2QE 1SNDA 4GLVB 5IT9L 1XWEA 4DR4Q 3NBHA 5IYDG 3IL8A 4JYAQ 4HIOA 4J8QA 4UY8C 2ASBA 3OOCA 5LL6S 3HOXG 1KC8C 3GTJB 3MXNA 4LF7Q 4K6LA 4KJNA 5I6WA 5KNDA 1SBBB 4A3GH 1C4QA 1Q86C 3ZYYX 5CV9A 3ULLA 1Y1WB 5LMUQ 4EVOA 5C4JH 2PMZE 1A0IA 1S5DD 4WJWA 1CK1A 3BVZA 3D8GA 1BUVT 2ICEC 4N9PA 3J80E 1YJWA 4A3DB 4DR1Q 4C3HB 1NMFA 2WV6D 3DXJC 4BY1G 4FDBA 1EYDA 4HMIA 1OXVA 1MSHA 1LUZA 5DAUA 3OWEB 4DN4M 4FO2A 2KEDA 4XQJA 1I4XA 1A3UA 2UU9Q 2XWBB 1LT5D 1SE4A 1UE7A 4V190 2BCOA 1F2LA 3F2UA 1PZKD 2JXMB 3IFDA 3J7AF 3HOVH 3CCLA 4RCOA 1LYLA 1IW7C 1VQGA 2BA1A 2XVSA 4IFDJ 2H4OA 4JI8L 3VR6A 5CMDA 2ZJQA 1A62A 1Y8PB 5CV4A 2ZXPA 1Q1EA 1CFMA 4K6DA 1XMOQ 4A3JB 4QB4A 4JI2Q 4A3KG 3HOUG 4DV3L 3VYSA 2F3VA 1N9WA 3NELA 5C0XJ 3GO5A 4XTCS 4NXML 2B29A 4JI1Q 2N88A 3WOFA 3K6OA 2OTLA 1KDAA 1HNWQ 1LACA 4NKLA 5L37A 4YY3Q 4ZKBB 1TWCB 1VQKA 1ENCA 3NPPA 2JA6G 4LUOA 3SK8A 2PW7A 4DAMA 2EQSA 4POFA 1N32Q 4R4CA 1B4OA 4PZ8A 3MWYW 3HOYG 2LKVA 3GTLH 4DU9A 2PI2E 2CH4W 2PQAA 3V96A 1SNCA 4BBRH 4LF6L 1FVIA 4K8IA 3AYHB 5FJ8H 2I07B 4IURA 2RHQB 4HSVA 2SOBA 4OELB 4IZ8A 5C6AA 4OIKA 2NN6G 3I73A 1EIYB 3HOXB 1CTMA 2L55A 2VB3X 1QZHA 1Q8KA 1MGSA 2F0MA 1VF5C 4IFDG 2J0TD 5ELCA 3GTOH 2DNEA 4X3SA 2A1AA 3M9BA 4KN4C 1KABA 3I4NB 4P71A 2LSSA 5IT9E 3CP0A 3KK7A 4OWTB 3UDFA 2LS01 5C0XG 4JBJA 4CDCC 1ZYRC 3KF8A 1IBKQ 3PIOA 2Z1CA 5C44G 3J80i 1GO3E 4OO1I 1S5ED 1IYVA 1TS3A 1AH9A 4EQNA 1K83H 3SXHA 1V1PB 2UUAL 3VYTA 4RAUC 3MC0B 4BY1B 4KMUC 2QDLA 4GZYC 1EIHA 5IWAL 2WP8J 2NVTH 1K3RA 1UE5A 2F0KA 2XRQD 4L63B 5E4XA 1U4LA 3FP9A 3U4VA 2K5DA 2O4XA 1VQ5A 4H44C 2LY7A 4UP8A 3M7NA 2F0VA 5KRUA 5BR8L 4X66Q 3QWNA 1TWGB 1G91A 3PO2G 4DR3L 1STGA 1KQSA 1X54A 4X65L 3I3CA 2EE1A 1W6KA 4DR6L 1UUPA 2I5MX 4Y52H 2QEXA 1B53A 3W1GA 4AYBE 2NZ1D 2K04A 2B2VC 5EQ0A 1PDQA 5EJWA 1F9PA 4A3KB 2E74C 3HOUB 1LT6D 1XJVA 3TEHB 2R93H 4DFAA 3M4OB 1B7YB 1MSGA 1KLUD 4BA1I 2KUMA 3EN2A 3RLOA 3VR4A 2JA6B 3S1QB 3GP7A 4DAYB 2EYHA 4LF9Q 3RR5A 1D2BA 1ET6A 2SEBD 4XT3B 2FFKB 4TKOB 2HCIA 3PGZA 4DF7A 1K0RA 1A6XA 3FHWA 4A3FH 5KNBA 4H02A 3DLLA 2IL8A 2C9OA 4UAIA 4X62Q 4DAVA 4GKJQ 1XPUA 2KCTA 1H9RA 1VQNA 1I50B 4ODGA 3BDCA 4CDEC 3S2HB 4IUUA 4O42A 5FKAC 2ZXOA 2ZTDA 4C3JG 4KY5A 5EKLA 1D7QA 4UPAA 3KBGA 3H0GH 2RDGA 3SEBA 5FOBB 1CQVA 1LO5D 4DNRB 3P7JA 1B50A 1KRTA 3G7LA 3H94A 4PMCA 1U4RA 2NUCA 1Y14B 4DUZL 3GTMH 3PIPA 4X3TA 3GV3A 2E2IH 4B3MQ 1HNZL 1LTSD 4A75A 1VF7A 1BOSA 1MIUA 2EXDA 4RGOS 1PRTB 3STBD 1N34Q 1EIFA 2HIXA 4F7XA 4LF8L 3OTOQ 3A56A 1AN8A 1CKNA 1TQOA 3NWSA 4K5WA 1NAPA 3A54A 4GOPC 1QNUA 1HZAA 5FK9C 2I0QA 2EYPA 3PO2B 1YEZA 3WOEA 5ISRA 3NBIA 1SE3A 4YCVA 4EQOA 3GTGB 4RKBA 1STEA 3HOVB 1V1OA 4A93G 4LUVA 5IP9H 1ZKOA 3SHLA 1CZGA 2J4XA 1IYJB 1WD0A 2RSNA 1FNVA 3T51B 2EYMA 3PCOB 4TRDA 3KF6A 4XYOA 1AZPA 1BQQT 5EAYA 4GN4B 2X6LA 4FF1A 4K14A 2EXZA 3CMAA 2KA7A 1LTRD 2V4DA 4A3BB 1F2YA 3CW2C 4R8NA 3F8TA 3G6EA 3G4SA 4LAAA 2EVBA 5IYBG 5E1FA 4JW0A 1VQLA 1WYDA 1PH9A 4K2KA 4KHVA 1PMRA 4JI7L 3GTPH 1D6EC 2E5LQ 2JEBI 1O80A 1ASYA 1QUQB 1SXTA 2CQOA 2I5LX 1HCZA 4H13C 5EBCA 5CV7A 5EKIA 3OPOA 4M8AA 4GN5A 3R93A 3Q0AA 1HXYD 1K28A 1YNND 4CDDC 4BBRB 4C3JB 4JI8Q 4U673 5AJ3L 3L2PA 1KHIA 2AWOA 2F4VL 2HDMA 1N33L 1DONA 4L5TA 3K7AH 2ZXRA 4DNIA 2K33A 1HQRD 4LMQD 2B2VA 4DV3Q 2JA7H 3A8JE 4ZK9B 1AP0A 3ITPA 3OW2A 1HNXL 4NXMQ 5M5YB 1TWFH 5M3FG 3RD4A 1HTLD 2AMCB 5I6YA 3GTQH 1XNQQ 3BDLA 1KAAA 1RTOA 2EJMA 3LWUA 4LFBL 4YIJA 2A8VA 3TS2A 2Z4IA 3HGBA 2NTTA 1X56A 3BS1A 1FR3A 2IX0A 1Y8NB 4MHEA 3E9HA 2YTYA 4HJAA 4QF4A 2NWGA 4N8X1 2E2DC 4OL7A 1EY4A 2PYKA 3C1FA 4KV6A 4LF6Q 3A8KE 5NUCA 1KDCA 1HJPA 3CXCA 2CWPA 3S16H 4FXGC 1TY2A 3TREA 4IUTA 3FRPB 1PLFA 1E1OA 4BWGB 2ES2A 5G3LD 4A3EG 4NXNL 1WTQA 1F9SA 1WJJA 1NBWA 4DV5L 1TU2B 1EY5A 2SDFA 1I4RA 1HNWL 3PO3H 1YIJA 1MBYA 2WB1G 1TY0A 5IYCH 1PH1A 5EGTA 2R93B 1HA6A 1I94L 1C8CA 3OW7A 4L6TB 1BF4A 2UUAQ 2AWNA 1E2ZA 3CRKC 4J6HA 5K36G 2BH8A 1HRJA 2IJ0A 4HR7B 5IWAQ 4PZ6A 3RLFA 1STBA 2R7DA 4KY7A 1SAPA 3FKIG 1TS5A 2EJFC 2NYZD 4MTNA 3PSIA 2BA0A 2JSOA 3HFZB 4ZUJA 4ZRZA 5BR8Q 4ID6A 3N52A 1KTKA 2BH2A 4GOPA 1K8MA 1ZXTA 3RN2A 1UEBA 4DR3Q 3X3NA 2RHSB 1KAWA 4DR6Q 5C3EH 2A6HD 4Q0FA 1PRTF 4RG1A 4IOAA 1MKHA 2A19A 2CHBD 1F2MA 3H0GB 3A7LA 5M3FB 1P8LA 3TRZA 5M3MG 1TXYA 1DOKA 2BE5D 5DM63 1PFNA 3UDXA 1C48A 5I9PA 1XXGA 3BZDB 1PTOD 2V1CC 3GTMB 1PTOF 3RZDH 3BU2A 5KEEA 1AFPA 3AQQA 2E2IB 1T5XD 2JK8A 4HCEA 4X64L 3CD6A 3D0FA 1IZ6A 1H9SB 3NTHA 3OSOA 3U58A 1SMXA 1SYDA 3U9SA 4KLKA 4X66L 4QQBX 3CU7A 2M00A 1ONLA 3NTIA 1TWAB 5JEAJ 1BCPD 4DV4L 4KD3A 4XQQA 1Y1WG 4ZCKA 3VR3A 4QL5A 1QNKA 3STBC 5CORA 1NNXA 4ME3A 1KDBA 1GVPA 2D2CC 3OIQA 2R61A 2KCCA 2D0OA 2PO4A 1J5EQ 4JBMA 2F0GA 3F1ZA 2WB1B 4A3DG 1N36L 2H1EA 4DUZQ 4C3HG 2UUBL 2XSCA 4JOIA 3I2ZA 4LFAQ 4LF9L 1YNXA 1HNZQ 2AQ1B 2QDBA 4C3IH 1BO0A 2A69D 3CMEA 1HR0W 3H91A 4XIGS 1G2TA 1GM5A 4FYDA 2EY1A 4M1UB 2NN6I 1E24A 3NXWA 2XN9C 1NJIC 1VS0A 3PMFA 1I4HA 2DJGC 1SE2A 4DV6L 3MEHA 4IFDI 5JEAG 4JI6L 3EFXD 1CT1D 1SYFA 3FMCA 4G7HC 2NB0A 2CH4A 1PH8A 4CGYB 5FLMG 4XDXA 2EYJA 5ELFA 2FINB 2UXBL 4Y7NH 5C0XI 1G291 3J81c 4K2LA 1BVSA 2ALYB 1IBML 1VQ6A 4WRDA 3D4RA 3MZ5A 4NB3A 4PV1C 1JCKB 3DMUA 1SLJA 3J80c 4P2CB 3K7AB 4K5XA 2F03A 1UNSA 4JPBW 4A4IA 2JA7B 1YNNC 1BKBA 3A8IE 3TN2A 4MIUA 4BY7G 4FP5D 3E3XA 2JA8H 3RLNA 3B6YA 1TWFB 2PQEA 1SJED 3BZKA 1TS4A 3MA2B 1PH7A 1D5XC 3Q6SA 5D3IB 3T16A 4DR2Q 3JC66 1NR2A 5HGQA 3F2DA 2VUMH 5GAEC 1RL2A 2KENA 2UXCL 4BBSH 1JMCA 4JI7Q 3CPWA 5DNFA 3AMUA 2DUDA 1WTPA 1KIXA 5CV6A 3HOWH 3KJPA 2EJGC 5C4XG 1EWHA 1XPOA 2VNUD 5LMNL 1LTAD 5AJ3Q 3D6WA 5JJLA 4N8FA 4DK6C 1X32A 1TVXA 2A6ED 5IP7H 1I3QH 1N33Q 2F4VQ 3I4NG 3J81E 1G6PA 4CKEA 2JEAI 5CGKA 1HFGA 1L0XB 2XNAC 2OCEA 1Q46A 2EOTA 1GHJA 3NBHB 2Q2IA 3TP5A 3PF5A 2K32A 1S5BD 3KLWA 1Y69U 1HNXQ 1KXLA 2JJQA 3MXNB 2WINB 3LGJA 4HIKA 2UUCL 4IUNA 4LFBQ 3K5NA 1VQIA 2G9DA 2VQFQ 2F0JA 1A2TA 1GOZA 1BR9A 4R4IA 2PNHA 4I65A 2B2WC 1FGUA 1M4VA 3ERSX 3UDGA 2Q8IB 5GADC 3FPPA 2E5LL 1GUTA 4JI0Q 3K5MA 2F0HA 2F0WA 4EGVA 3U4ZA 4B9WA 4LF5Q 1JE4A 3KDFA 1MJEA 2Q2UA 1X3GA 4DUYQ 5IT9c 1TT2A 1BXTA 1Q1BA 3G6JB 1A15A 4NXNQ 2K5QA 2KJXA 2F0FA 3C3LA 3HZXA 4DV5Q 5FO7B 3SGIA 1SNOA 2CFMA 1XNQL 3K81C 3T56B 3IKJA 2NVXH 5JVG3 3TP7A 4BY7B 1I94Q 1OXUA 1EYGA 2A6HC 1NTGA 3T1HL 4DNTB 4NMZA 4QUCA 3D6CA 1SYCA 1X65A 3MXPA 3M3YB 2F0DA 1JICA 3K57A 2O2LD 1F9QA 1Q3LA 1UEAB 2BE5C 4MN3A 4IJLA 1IBLL 5IOCA 4TSSA 1PTOC 2MJ8A 5C4XB 2I46A 1N8RC 3NK9A 3Q8DA 1A3TA 2JA9A 1LTID 1XMQL 1QCBD 4OX9L 4A3GG 1HUMA 4JI3Q 3J81i 1V43A 4XQNA 4A3MH 2PQAB 3S14B 1YJ9A 4FF4A 1BCPC 1VQ7A 3IAYA 3CCEA 1XTCD 4J1MA 4ULLA 3ULJA 5M5WH 5J3BA 3K58A 1JOQA 3S1RB 1Q81C 2ZM6L 1QE6A 5JJZA 1S4ZA 4YWLA 1SFOH 1MHWC 4JBKA 3S17H 2VQEQ 4DV2Q 4GNXC 1U4PA 3VR5A 1U5KA 4IUPA 4X64Q 3N6RA 2PW5A 4KK7A 3SK4A 2WB1E 3OHXC 5KNCA 1STAA 3NUCA 3S15B 3KF8B 4QIWB 1LT4D 1M8AA 1E2WA 5EPKA 5I2XA 1KNAA 3CRLC 3TZDA 4DV4Q 1EFWA 5DLQE 1L2FA 2R92B 2RBMA 5C5LA 5T1IA 3HOVG 2A69C 4A3LH 3Q22A 4P73A 1CM9A 4B3SL 2BDNA 3I56A 1C9OA 4IQZA 2K75A 4V0BA 1K73C 4N9TA 2B63H 2IHFA 3EVQA 2A74C 1DOLA 2QCPX 2NVYH 3V05A 4I7ZC 4BXXH 2OQ0A 1N36Q 5CYUA 1E2VA 5C3XA 5IIFA 2CW0D 2UUBQ 4A3BG 5DEHA 1X3EA 4A3IH 3IRBA 4L5QA 4WJ3M 5JOBA 1TKWB 3W1BA 2HQEA 2EY6A 3S1NH 1WD1A 1WTRA 1EU3A 1EOVA 2B2WA 2RSOA 2EDGA 2TSSA 1L1OC 4CHTB 3I4MH 4OO1H 1D1KA 3L3OC 4WFN3 3HOZH 1B1ZA 3A0JA 4PNYA 4OEMB 4LK1C 2UXDQ 1WOCA 2L11A 4IPHA 2C5CA 4S3SA 4DV6Q 3VA7A 4JI6Q 3MXGA 1QJOA 1W2BA 4F87A 1OXSC 4BBRG 3AEVA 2OEOA 5M5XH 5FJ8G 2X6GA 1Y8OB 1E3PA 3R3OA 1DGSA 1S72A 2ICIA 5IGCA 2UXBQ 3HOWB 1L0YB 3EROA 4A3GB 1CHPD 4I7AA 1IBMQ 2JA5H 1J5EL 4JI4L 2HIVA 2K5HA 3MEFA 4Z9CB 3CCSA 1IHZA 5C4JB 5C5MA 1GHKA 4WORA 5F2DA 1RJTA 1D5ZC 3NP8A 1ML0D 4LFAL 5TSSA 1VDZA 1Y1VH 2A6EC 3Q24A 3HKSA 1PZID 4B08A 1B3AA 1S3OA 1YHBA 2AQ2B 4KY6A 4RHRA 4HIDA 2N8NA 2K7VA 3OIPA 5KGUA 4O1NA 4ALPA 2UXCQ 2FHTA 4H0LC 4HAEA 1VQAA 1NY4A 2R7ZH 1RKNA 5LMNQ 3MVVA 1R9TH 2EYFA 3CAMA 4KHPL 4E6IA 4JK1C 1ENFA 4YWMA 1JT8A 1PXUA 2JQOA 1CKNB 2N3SA 1ILQA 3UE1A 4EQ5A 1VQBA 4A3CH 1KRSA 2WIIB 2R93G 4RH6A 1PYBA 1SNQA 3KFUA 5IY0A 4DV0L 2YV5A 2UUCQ 1IL8A 5ELBA 1JB7A 2D5DA 1HH2P 2Q2HA 2F0UA 3QJYA 4MTKA 2NVXB 5ELDA 2L1BA 4DR2L 2E2JH 4DR7L 3BYYB 1JB3A 2CWAA 4CJ2C 4IN3A 4GNXA 1E0BA 1EQRA 1TIID 3A7AB 1SSOA 3KF6B 2E2HH 1EY7A 2Z6KC 2MFIA 1OO9B 3I4LA 2VB2X 4A3FG 4K8JA 2F0TA 2BOSA 3GTLB 2L15A 2B39A 3FKIH 1F9RA 3NTKA 2B8FA 2K14A 3OYYA 2OWOA 4CBVA 3CHBD 2L0CA 3I90A 3CKIB 5D14A 3K59A 3GTOB 4NPSA 1JOKA 3H0GG 4FXKC 4A76A 3VYRA 1BBXC 5K5PA 2NZHA 5J22A 4JOIC 4IUQA 1YHQA 5GROA 2F52A 4R4QA 4RA8A 1H9KA 3CC4A 4ZUIA 1K8OA 2YU9H 2R6GA 2VQFL 3RN5A 3T1HQ 1OTCA 1K83B 1I4PA 1WCMH 2F0LA 3FPUB 2EIFA 4JVZA 1NCVA 3VA5A 1CZWA 3KJOA 1A8VA 3R2IA 5C3WA 1SFOB 2IX3A 2NVTB 1L1OA 3BYTB 3S17B 4JI0L 1VQEA 1HPCA 4NP5A 5I2YA 2F0SA 4LUZA 3PUXA 1IBLQ 4RGNA 2LMCB 3M4YA 3H15A 3C2PA 1XX8A 1JR0D 4LF5L 4HCSA 3CCRA 1PH4A 4DXGA 1PA6A 1JJ2A 1SMYD 3C1EA 4XT1B 2DGYA 3A55A 4DUYL 4JI5Q 1SEBD 1D8LA 5JJIA 1IYUA 4DKAC 1XMQQ 4OX9Q 1H9JA 4CKCA 4ILWA 4HJ7A 1MD2D 1X3QA 4EX5A 1RDPD 4YCUA 2K52A 4QIWE 1EEID 3DEOA 5CR3A 4QY7A 4EQPA 2B63B 1FL0A 3CQZH 3ND9A 3TBIB 2ZM6Q 3J7AV 3AU7A 1JORA 1G51A 2A73B 3KUPA 1KD1C 2D62A 1QILA 3BJUA 4RCNA 4PQXA 3VYUA 1DJRD 3QOLA 1P16A 3J7YW 4A3IB 3TS0A 4B3RL 4CJ1B 1SE8A 3JAML 1K0SA 2YYZA 4A3FB 3K8AA 3SK6A 4DK0A 2R7FA 2E76C 1G6ZA 1B70B 4HJ9A 1PRTD 1GD7A 4OHJA 1EQVA 1HQMC 1EYAA 4JI3L 2KVMA 2MQHA 3K5OA 4B3SQ 4C2MH 1NR4A 2PI2A 5IODA 1RHPA 5M5XB 2HHHL 1CKOA 4A3JH 2F0NA 3PIO3 3AFQA 4GOPB 2JA7G 2TMPA 2F3IA 4P74A 1FGBD 2IX1A 1EOTA 5KYIA 2K50A 1SYEA 2IHEA 2FXQA 1U4MA 2B3GA 3ONAB 3ULPA 1J8IA 1GUOA 1TWCH 2VQEL 5HY6A 4OIJA 3PUWA 4DV2L 5C4ZA 2KCMA 5JJKA 1STHA 1L0WA 1ET9A 2Z6KA 3G71A 1LV9A 1ESRA 2WAQB 3K7UC 4OGQC 5FLXL 1QB5D 3J7A5 5IYDH 3L7ZC 3WDNA 1UWVA 3HOXH 3BDOA 4CKBA 1LTLA 2B2TC 2N55A 2R7ZB 4R4OA 3A5ZB 5I4DA 3LNNA 1CKMA 1R9TB 4JI4Q 1O7YA 4LFCL 1ZYRD 3CC7A 3A5UA 1AE3A 2VY3A 2F0EA 4IPCA 1S5CD 1X3FA 5JVH3 3L9AX 1CA5A 2A68D 5COYA 1FNUA 1RD9D 2CCZA 3BVGA 5CBEE 2EYLA 1RCVD 1ICWA 2Y0SG 3DM1A 4BY1H 3I70A 2RCNA 2UXDL 4DA2A 4DAPA 1W3SA 1CI3M 4KJOA 5EPJA 3PUYA 2RKSA 1PH5A 1EEFD 1WTWA 5AFWA 2E2JB 3OWFA 1EY6A 3BVMA 3SE0A 1JJCB 2BDOA 2AHOB 3S24A 4QUFA 3GTPB 1CSPA 2E2HB 1VQPA 1TWGH 2QGQA 1QVCA 1FNWA 1EQQA 4KHPQ 3EA6A 1ILPA 4NW2A 1MI2A 2H5XA 1DZ1A 4PG3A 2FMCA 5ELNA 1EY0A 3JAME 3MFYA 3T1YL 4A3KH 3HOUH 2PZWA 3DWPA 3PIP3 5CV5A 5IGEA 2ZJRA 3KLSX 3EBEA 1FYCA 3MFGA 2DNCA 4G7ZC 2OQKA 4DV0Q 1SR3A 1O7ZA 1QG7A 3GTQB 2MGSA 4YCWA 4DV7L 2JA6H 3S1QH 3IFTA 3A74A 2EPBA 1S40A 2YU9B 4DR7Q 3D4DA 3G48A 1LABA 3TP6A 3P20A 1WTHA 4K0KL 3HOYH 1EWIA 4HJ5A 1WTOA 1R4PB 2P5ZX 3K80C 1VQ4A 1PFSA 1DXMA 3T53B 1E7ZA 1JJGA 1UAPA 2NN6H 1VQ8A 3S16B 2KQ3A 4XYQA 1WTVA 5IE8A 4RWSC 4IFDH 2Z9HA 1EIGA 3EQLC 5C4HA 4JV5L 3TMEA 3UE0A 3HKZB 5FLXE 1PZJD 4P75A 3KBXA 1SMYC 5C0XH 1Q12A 3PO3B 3V2TA 3NEMA 1VQHA 3RZOH 1PYWD 1II3A 2Q8TA 5C44H 2IPKD 2EY2A 4J15A 2EY5A 2Y0SB 5LMNW 1RTNA 4GLXA 3CQZB 1ZEQX 3X3MA 4C3IG 4JBWA 2MNAA 3GTKH 1FD7D 2B2UC 1YJNA 3I72A 2ENBA 3VR2A 3NHHA 2R92G 2QW7A 5CV8A 3LWEA 4RKLA 4DV1L 1XPRA 1YITA 4GKKQ 2RVLA 1ICFB 2MO1A 3MTSA 3DUZA 3PO2H 5KYLA 2PNRC 5E7NA 3U9OA 3GTGH 2B2TA 3H3VI 4TVAB 3UI2A 1K3BC 4HIMA 1PTOH 5C3EB 4HN7A 1EZ8A 3JAMi 4QGUA 4JC0A 1LLRD 4C2MB 1M1KC 1IKLA 2LXJA 2ZTEA 1ASZA 2OT2A 4TQUS 2KBNA 2B2YC 1PRTC 2NTSA 4DR5L 1RODA 1A3VA 3FDTA 3KDFB 5E4WC 2J7ZA 1D1IA 3P1HA 2E8GA 2VW9A 4JCVE 1LT3D 2JA8G 1PV4A 2A5HA 2WACA 3MHBA 3LX0A 4IUVA 4A3BH 2OTJA 1KNEA 1GUWA 3RZDB 1TWHH 2MP1A 1NUCA 3GDEA 1Z6HA 4B3RQ 4KN7C 3E6ZX 1B2TA 1WTXA 2IY5B 4YWKA 1YHAA 4KD4A 4LW1A 2K4KA 2VUMG 2M2LA 3CPFA 1B3QA 4BBSG 1PVOA 4JI5L 4IALA 2KEEA 4QCLA 3HOWG 2F0QA 3HG9A 3FVQA 4C3JH 4RGMA 2QKIC 3OMCA 1EYCA 4G57A 5JPMC 2HT1A 4FNFA 5IP7G 2HHHQ 2RDFA 2WAQE 1K8AC 1V1PA 1T9HA 1EWCA 2IW3A 3QB3A 1D5MC 3EJIA 2EZVA 5M5YH 1V8QA 2F1MA 5T1GA 4ZKCB 1OXXK 3D3RA 5EPLA 3H3VH 1X55A 2E75C 3TSSA 4B3TQ 2LXKA 5D3DA 2HDLA 1U0LA 1VCIA 3I8ZA 3QOJA 3I7FA 4C3IB 3K5LA 1SN8A 3GV6A 3QR8A 5J1ZA 3GD7A
chains in the Genus database with same CATH topology
4IOAA 2UUCQ 5IYDG 1JB7A 1HH2P 2Q2HA 4JYAQ 4HIOA 4UY8C 2ASBA 2K5NA 3TQYA 3HOXG 1KC8C 3CC2A 4DR2L 1MKHA 4LF7Q 2A19A 4A3GH 2E2JH 1P8LA 1Q86C 4DR7L 3ULLA 3TRZA 5M3MG 1TXYA 2CWAA 5LMUQ 4A3DG 4GNXA 1EQRA 3KF6B 2E2HH 3UDXA 2Z6KC 5C4JH 2MFIA 2PMZE 4A3FG 1VQ9A 3I4OA 1A0IA 2L15A 2V1CC 1GKHA 3FKIH 3RZDH 4LF4L 4A93H 3BU2A 3AQQA 4LFCQ 2JK8A 2K14A 2D0PA 4X64L 3OYYA 3D0FA 3CD6A 3BZCA 1YJWA 1IZ6A 2OWOA 4DR1Q 1QVFA 3U58A 1HR0Q 1SMXA 4KLKA 4X66L 4QQBX 1NMFA 1VQCA 4BY1G 5ELOA 4FDBA 5JEAJ 4AH6A 2ID0A 4DV4L 1OXVA 2N49A 1LUZA 4NPSA 3H0GG 4A76A 1JE5A 1IL2A 4IOCA 1Y1WG 3PUZA 2NZHA 3W5OA 2ZTCA 4JOIC 4QL5A 3STBC 2UU9Q 1YHQA 1EUJA 1UE7A 1I6HH 5GROA 4ME3A 2F52A 4R4QA 3CC4A 1XNRQ 1GVPA 2QA4A 2YU9H 2R6GA 3PF4A 2VQFL 5IYBH 3RN5A 1A63A 1NE3A 3HOVH 3CCLA 2D0OA 3T1HQ 1LYLA 1VQGA 4YHHL 1OTCA 1J5EQ 4JBMA 2BA1A 1WCMH 2NVQH 4IFDJ 4IJHA 4JI8L 3F1ZA 4L5SA 2ZJQA 2EIFA 4DK3C 1A62A 2RF4A 2XGTA 4OONA 1N36L 3S1MH 4DUZQ 3KJOA 1A8VA 2UUBL 4JOIA 1Q1EA 1XMOQ 1L1OA 3I2ZA 4LFAQ 4JI2Q 4A3KG 4LF9L 1YNXA 1HNZQ 4P72A 4C3IH 1VQEA 4DV3L 1XTDA 1SROA 4JI0L 4AQYL 4LUZA 1N9WA 3NELA 3PUXA 1IBLQ 5C0XJ 3H15A 3GO5A 4XTCS 3M4QA 4NXML 2B29A 4LF5L 4JI1Q 3CCRA 3CMEA 1HR0W 1PH4A 1PA6A 1JJ2A 3T1YQ 1PYSB 2OTLA 4XIGS 1HNWQ 4A3MG 1GM5A 4YY3Q 2VS1A 2DGYA 4DUYL 2NN6I 1VQKA 1CUKA 1E24A 4JI5Q 3ICEA 1NJIC 2JA6G 1VS0A 1D8LA 4LUOA 4DAMA 1K9MC 5JJIA 4DKAC 5M3FH 1XMQQ 4OX9Q 2EQSA 4HJ7A 4DV6L 4IFDI 4POFA 5JEAG 1N32Q 4R4CA 4EX5A 4JI6L 3HOUG 4YCUA 4O2DA 4PZ8A 2K52A 2VZAA 4QIWE 3HOYG 1Q82C 4DV7Q 1PH8A 5FLMG 1G6PA 4QY7A 3GTLH 1FL0A 4BXXG 2CKZB 2UXBL 2PI2E 4Y7NH 2PQAA 5C0XI 1G291 3J81c 3CQZH 3HKZE 1FJGL 4IO9A 4BBRH 1PH2A 1FVIA 4LF6L 5H1SE 4K0KQ 3AYHB 5FJ8H 1BVSA 2ALYB 2RHQB 2ZM6Q 2N78A 1IBML 1G51A 3VDYA 1KD1C 1VQ6A 4NB3A 4BA2I 2NN6G 1EIYB 1SLJA 1QZHA 1Q8KA 2D62A 3J80c 3BJUA 1TWAH 4IFDG 3GTOH 4A4IA 2A1AA 3M9BA 1P16A 2Y0SE 1BKBA 3TS0A 4BY7G 4B3RL 2JA8H 3RLNA 3B6YA 1SE8A 4P71A 2UXCL 2LSSA 2YYZA 1K8GA 3K8AA 4A3LG 2R7FA 3CP0A 3UDFA 4OWTB 4GS3A 5C0XG 3BZKA 4JV5Q 4JBJA 1PH7A 1B70B 4A3EH 4DR2Q 2B63G 4HJ9A 3JC66 1IBKQ 5HGQA 5C44G 1GD7A 3PIOA 3J80i 1GO3E 3F2DA 2VUMH 4OO1I 4IPDA 5GAEC 3KYHC 4JI3L 1K83H 1RL2A 2KENA 2MQHA 4C2MH 4B3SQ 2UUAL 4BBSH 1X9NA 1JMCA 4JI7Q 4MNOA 3CPWA 3K0XA 2PI2A 3KOJA 5GAHC 2DUDA 2HHHL 1KIXA 3HOWH 1CKOA 3UDIA 3KJPA 5C4XG 4A3JH 1XPOA 5IWAL 2WP8J 2NVTH 1K3RA 1UE5A 2VNUD 5LMNL 3AFQA 3FP9A 3U4VA 5AJ3Q 4GOPB 4A3IG 2F3IA 2JA7G 1VQ5A 5JJLA 4P74A 2IX1A 1QUQA 4DK6C 4UP8A 5IP7H 2F4VQ 2K50A 1I3QH 1N33Q 2IHEA 4OXPA 3M7NA 2FXQA 4X6AH 5BR8L 4OWWB 2B3GA 4X66Q 2JEAI 1Z47A 2YTVA 4R1JA 3ULPA 2OCEA 1Q46A 1TWCH 2VQEL 5HY6A 3CCQA 3NBHB 4DV1Q 3I4MG 3HOZG 3PUWA 4DV2L 4DR3L 3PO2G 2Q2IA 3PF5A 1KQSA 1HNXQ 1X54A 3KLWA 4X65L 1SRUA 1KXLA 2KCMA 4IPGA 4LWCA 2JJQA 5JJKA 3MXNB 2I5MX 4DR6L 4Y52H 2QEXA 1L0WA 3W1GA 4AYBE 4DR4L 3LGJA 4HIKA 2UUCL 1X6OA 1HZBA 4LFBQ 4GNXB 4JYAL 2Z6KA 3G71A 3TEHB 1XJVA 2R93H 1VQIA 2VQFQ 4GN3B 3K7UC 4MZ9A 4LF7L 4R4IA 1B7YB 2PNHA 3J7A5 1FGUA 1CSQA 2KHIA 5LMUL 3L7ZC 5IYDH 3ERSX 2JA5G 4BA1I 3UDGA 1UWVA 3EN2A 3HOXH 3RLOA 5GADC 2E5LL 1WI5A 1UE6A 1LTLA 4DAYB 4DR5Q 5M3MH 4R4OA 3A5ZB 4LF9Q 3RR5A 4JI0Q 1E1TA 3NENA 1CKMA 4JI4Q 3U50C 4LFCL 1PHJA 1YI2A 1Y1VG 3U4ZA 3J81j 3CC7A 3A5UA 3I4NG 4KHZA 1AE3A 3S2DH 3PGZA 4LF5Q 2VY3A 1K0RA 4IPCA 1MJCA 3FHWA 2GVBA 4DR1L 4A3FH 1C7YA 3KDFA 4H02A 1X3FA 3ZJYC 3DLLA 1VQFA 1MJEA 2Q2UA 1X3GA 4DUYQ 2VL6A 2IT1A 4X62Q 5IT9c 3M85A 1Q1BA 2WAQG 4GKJQ 4NXNQ 2CCZA 1XPUA 2KCTA 1VQNA 4GKKL 4DV5Q 3SGIA 1WFQA 2Y0SG 3CCUA 1QZGA 2CFMA 2ZTDA 1XNQL 3K81C 4BY1H 2UU9L 1D7QA 4UPAA 2NVXH 4UP7A 2Q2TA 3GTJH 1HZ9A 2RCNA 2UXDL 1W3SA 3DM3A 3H0GH 1I94Q 1OXUA 1Y1WH 4L5RC 2R7ZG 3PUYA 1PH5A 1EYGA 4APVA 1NTGA 1VQJA 1V1QA 1KRTA 3T1HL 5IP9G 1L1OB 1YBYA 1JJCB 2AHOB 3S24A 1X65A 1CSPA 4PZ7A 4AIMA 1VQPA 1TWGH 1Y14B 4DUZL 2QGQA 3GTMH 1QVCA 3PIPA 1XMOL 1QVGA 1EQQA 2E2IH 4JI2L 4KHPQ 4B3MQ 1HNZL 4A3CG 3CCVA 4A75A 4IJLA 4A3DH 2H5XA 2MO0A 1IBLL 4PG3A 1UE1A 5ELNA 4C3HH 1J6QA 4JI1L 1MIUA 1E22A 2EXDA 3AFPA 3STBD 3L0OA 1N34Q 1EIFA 3T1YL 2HIXA 4A3KH 4LF8L 3HOUH 4QJFA 4YY3L 3OTOQ 1N8RC 2ATWA 2ZJRA 3EBEA 3Q8DA 1M90C 1CKNA 2JA9A 1XMQL 4OX9L 2OQKA 4DV0Q 2K5VA 1SR3A 4A3GG 4JI3Q 3J81i 4GOPC 1YZ6A 4KI0A 1V43A 1N32L 1HZAA 4A3MH 2PQAB 1YJ9A 1NMGA 2I0QA 1AH9A 4YCWA 4DV7L 1YEZA 2JA6H 1B8AA 4AYBG 3S1QH 1VQ7A 1HZCA 3A74A 1S40A 4YCVA 4DR7Q 3G48A 3CCEA 3ULJA 5M5WH 5J3BA 4A93G 4LUVA 5IP9H 4K0KL 3HOYH 1Q81C 1IYJB 1EWIA 2ZM6L 4HJ5A 5FLMH 2WFWA 4YWLA 3K80C 1SFOH 1VQ4A 4JBKA 1PFSA 4LF4Q 1E7ZA 2VQEQ 3S17H 1LM0A 2GN5A 3PCOB 3KF6A 4DV2Q 4GNXC 3PUVA 1JJGA 5EAYA 1U5KA 4GN4B 4X64Q 4X65Q 3CMAA 1VQ8A 2I5HA 2WB1E 2HQLA 3CCJA 3KF8B 5IE8A 3RNUA 3CW2C 3F2CA 4B3TL 1OXTA 4DV4Q 1EFWA 5DLQE 1L2FA 3F8TA 1VQOA 3G6EA 4JV5L 3G4SA 4BY7H 3UE0A 1BBUA 4WJ4A 1KL9A 4GLAC 5IYBG 1IBKL 3HOVG 4A3LH 1VQLA 1WYDA 4P75A 4P73A 4B3SL 1PH9A 3I56A 1Q12A 1WCMG 4JI7L 3GTPH 1V9PA 1C9OA 2K75A 2E5LQ 2JEBI 1K73C 2B63H 3M3YH 2IHFA 1VQHA 3NEMA 1ASYA 1QUQB 3RZOH 2CQOA 5C44H 2I5LX 2NVYH 4J15A 1O7IA 5LMNW 4YHHQ 1IXRA 4GN5A 4GLXA 4BXXH 2OQ0A 4OO1G 5AJ3L 3D31A 1H95A 4JBWA 4JI8Q 2NZOA 2MNAA 3L2PA 3GTKH 1N36Q 1YJNA 1KHIA 2JE6I 1VQDA 2AWOA 2F4VL 1N33L 3J7ZC 2UUBQ 5C4XH 4L5TA 3K7AH 4A3BG 4DNIA 2C35B 2R92G 4DV3Q 3JAMc 2JA7H 1X3EA 4A3IH 4OWXB 4DV1L 4AQYQ 3IRBA 4L5QA 3OW2A 1AE2A 1XPRA 2Z0SA 2XTIA 3CF5A 1YITA 3I4NH 1HNXL 4NXMQ 4GKKQ 4WJ3M 3HKZG 3W1BA 4LNQA 1TWFH 5M3FG 3S1NH 1HR0L 2AMCB 4JG2A 1EOVA 2MO1A 5GAGC 3GTQH 1XNQQ 3PV0A 3S14H 1L1OC 3I4MH 1RIPA 3PO3G 3PO2H 3HOZH 3A0JA 4LFBL 2UXDQ 5E7NA 1WOCA 5IYCG 4IPHA 3GTGH 4DV6Q 3H3VI 5GQOA 2A8VA 4TVAB 3TS2A 4JI6Q 4HIMA 1PH3A 1X56A 1W2BA 2IX0A 1OXSC 3WWVA 4BBRG 3S1RH 3AEVA 3JAMi 4QGUA 4JC0A 5M5XH 5FJ8G 1M1KC 3E9HA 2YTYA 2KHJA 4HJAA 1E3PA 2LXJA 1DGSA 1S72A 2ZTEA 1ASZA 4TQUS 1XNRL 2KBNA 2UXBQ 4DPGA 4DR5L 1FJGQ 4LF6Q 3KDFB 1IBMQ 2E8GA 2JA5H 1HJPA 2VW9A 4JCVE 3CXCA 3E0EA 1J5EL 2HIVA 4JI4L 2K5HA 2CWPA 3MEFA 3S16H 3CCSA 2JA8G 3TREA 1PV4A 3S15H 2ZJPA 4A3BH 4LF8Q 2R92H 1E1OA 3M4PA 4PMWA 4HJ8A 2OTJA 4LFAL 2ES2A 1TWHH 4X62L 1Y1VH 3GDEA 4A3EG 1Q7YC 4GKJL 4NXNL 4B3RQ 1WJJA 2IY5B 4YWKA 1NBWA 1YHAA 5C3EG 4DV5L 1PH6A 3HKSA 1Z9FA 2K4KA 4LW1A 2VUMG 3CPFA 2GVAA 1HNWL 1S3OA 4R4TA 3PO3H 5FLXc 1YIJA 1YHBA 4HIDA 2WB1G 4BBSG 1PVOA 4JI5L 3E9IA 2N8NA 5IYCH 1PH1A 3M4OH 3HOWG 4A3JG 1I94L 3EIVA 4ALPA 2UXCQ 3ER0A 4C3JH 2UUAQ 4RMFA 2AWNA 5K36G 1VQMA 2BH8A 2HT1A 5IP7G 2HHHQ 1VQAA 3F2BA 5IWAQ 1NY4A 4PZ6A 3RLFA 2WAQE 1K8AC 1BBWA 2R7ZH 2R7DA 5LMNQ 3FKIG 1C0AA 1T9HA 1R9TH 3CAMA 4MTNA 3PSIA 4KHPL 4B3ML 4UP9A 2BA0A 5M5YH 3HFZB 4YWMA 3CCMA 1I5FA 1JT8A 2JQOA 5BR8Q 2BH2A 1OXXK 1CKNB 2N3SA 4GOPA 3RN2A 3H3VH 1X55A 3UE1A 4B3TQ 4EQ5A 1N34L 1VQBA 2LXKA 1UEBA 4DR3Q 1U0LA 1VCIA 4A3CH 2AKWB 4O0AA 2YTXA 3I7FA 1KRSA 3OTOL 4POGA 3I55A 1SN8A 1I50H 2R93G 1YVCA 1PYBA 2RHSB 1KAWA 4DR6Q 3S2HH 5C3EH 3KFUA 5IY0A 4DV0L 4GLVB 4DR4Q 4RG1A 3GD7A 2YV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOA A;  2UUC Q;  5IYD G;  1JB7 A;  1HH2 P;  2Q2H A;  4JYA Q;  4HIO A;  4UY8 C;  2ASB A;  2K5N A;  3TQY A;  3HOX G;  1KC8 C;  3CC2 A;  4DR2 L;  1MKH A;  4LF7 Q;  2A19 A;  4A3G H;  2E2J H;  1P8L A;  1Q86 C;  4DR7 L;  3ULL A;  3TRZ A;  5M3M G;  1TXY A;  2CWA A;  5LMU Q;  4A3D G;  4GNX A;  1EQR A;  3KF6 B;  2E2H H;  3UDX A;  2Z6K C;  5C4J H;  2MFI A;  2PMZ E;  4A3F G;  1VQ9 A;  3I4O A;  1A0I A;  2L15 A;  2V1C C;  1GKH A;  3FKI H;  3RZD H;  4LF4 L;  4A93 H;  3BU2 A;  3AQQ A;  4LFC Q;  2JK8 A;  2K14 A;  2D0P A;  4X64 L;  3OYY A;  3D0F A;  3CD6 A;  3BZC A;  1YJW A;  1IZ6 A;  2OWO A;  4DR1 Q;  1QVF A;  3U58 A;  1HR0 Q;  1SMX A;  4KLK A;  4X66 L;  4QQB X;  1NMF A;  1VQC A;  4BY1 G;  5ELO A;  4FDB A;  5JEA J;  4AH6 A;  2ID0 A;  4DV4 L;  1OXV A;  2N49 A;  1LUZ A;  4NPS A;  3H0G G;  4A76 A;  1JE5 A;  1IL2 A;  4IOC A;  1Y1W G;  3PUZ A;  2NZH A;  3W5O A;  2ZTC A;  4JOI C;  4QL5 A;  3STB C;  2UU9 Q;  1YHQ A;  1EUJ A;  1UE7 A;  1I6H H;  5GRO A;  4ME3 A;  2F52 A;  4R4Q A;  3CC4 A;  1XNR Q;  1GVP A;  2QA4 A;  2YU9 H;  2R6G A;  3PF4 A;  2VQF L;  5IYB H;  3RN5 A;  1A63 A;  1NE3 A;  3HOV H;  3CCL A;  2D0O A;  3T1H Q;  1LYL A;  1VQG A;  4YHH L;  1OTC A;  1J5E Q;  4JBM A;  2BA1 A;  1WCM H;  2NVQ H;  4IFD J;  4IJH A;  4JI8 L;  3F1Z A;  4L5S A;  2ZJQ A;  2EIF A;  4DK3 C;  1A62 A;  2RF4 A;  2XGT A;  4OON A;  1N36 L;  3S1M H;  4DUZ Q;  3KJO A;  1A8V A;  2UUB L;  4JOI A;  1Q1E A;  1XMO Q;  1L1O A;  3I2Z A;  4LFA Q;  4JI2 Q;  4A3K G;  4LF9 L;  1YNX A;  1HNZ Q;  4P72 A;  4C3I H;  1VQE A;  4DV3 L;  1XTD A;  1SRO A;  4JI0 L;  4AQY L;  4LUZ A;  1N9W A;  3NEL A;  3PUX A;  1IBL Q;  5C0X J;  3H15 A;  3GO5 A;  4XTC S;  3M4Q A;  4NXM L;  2B29 A;  4LF5 L;  4JI1 Q;  3CCR A;  3CME A;  1HR0 W;  1PH4 A;  1PA6 A;  1JJ2 A;  3T1Y Q;  1PYS B;  2OTL A;  4XIG S;  1HNW Q;  4A3M G;  1GM5 A;  4YY3 Q;  2VS1 A;  2DGY A;  4DUY L;  2NN6 I;  1VQK A;  1CUK A;  1E24 A;  4JI5 Q;  3ICE A;  1NJI C;  2JA6 G;  1VS0 A;  1D8L A;  4LUO A;  4DAM A;  1K9M C;  5JJI A;  4DKA C;  5M3F H;  1XMQ Q;  4OX9 Q;  2EQS A;  4HJ7 A;  4DV6 L;  4IFD I;  4POF A;  5JEA G;  1N32 Q;  4R4C A;  4EX5 A;  4JI6 L;  3HOU G;  4YCU A;  4O2D A;  4PZ8 A;  2K52 A;  2VZA A;  4QIW E;  3HOY G;  1Q82 C;  4DV7 Q;  1PH8 A;  5FLM G;  1G6P A;  4QY7 A;  3GTL H;  1FL0 A;  4BXX G;  2CKZ B;  2UXB L;  2PI2 E;  4Y7N H;  2PQA A;  5C0X I;  1G29 1;  3J81 c;  3CQZ H;  3HKZ E;  1FJG L;  4IO9 A;  4BBR H;  1PH2 A;  1FVI A;  4LF6 L;  5H1S E;  4K0K Q;  3AYH B;  5FJ8 H;  1BVS A;  2ALY B;  2RHQ B;  2ZM6 Q;  2N78 A;  1IBM L;  1G51 A;  3VDY A;  1KD1 C;  1VQ6 A;  4NB3 A;  4BA2 I;  2NN6 G;  1EIY B;  1SLJ A;  1QZH A;  1Q8K A;  2D62 A;  3J80 c;  3BJU A;  1TWA H;  4IFD G;  3GTO H;  4A4I A;  2A1A A;  3M9B A;  1P16 A;  2Y0S E;  1BKB A;  3TS0 A;  4BY7 G;  4B3R L;  2JA8 H;  3RLN A;  3B6Y A;  1SE8 A;  4P71 A;  2UXC L;  2LSS A;  2YYZ A;  1K8G A;  3K8A A;  4A3L G;  2R7F A;  3CP0 A;  3UDF A;  4OWT B;  4GS3 A;  5C0X G;  3BZK A;  4JV5 Q;  4JBJ A;  1PH7 A;  1B70 B;  4A3E H;  4DR2 Q;  2B63 G;  4HJ9 A;  3JC6 6;  1IBK Q;  5HGQ A;  5C44 G;  1GD7 A;  3PIO A;  3J80 i;  1GO3 E;  3F2D A;  2VUM H;  4OO1 I;  4IPD A;  5GAE C;  3KYH C;  4JI3 L;  1K83 H;  1RL2 A;  2KEN A;  2MQH A;  4C2M H;  4B3S Q;  2UUA L;  4BBS H;  1X9N A;  1JMC A;  4JI7 Q;  4MNO A;  3CPW A;  3K0X A;  2PI2 A;  3KOJ A;  5GAH C;  2DUD A;  2HHH L;  1KIX A;  3HOW H;  1CKO A;  3UDI A;  3KJP A;  5C4X G;  4A3J H;  1XPO A;  5IWA L;  2WP8 J;  2NVT H;  1K3R A;  1UE5 A;  2VNU D;  5LMN L;  3AFQ A;  3FP9 A;  3U4V A;  5AJ3 Q;  4GOP B;  4A3I G;  2F3I A;  2JA7 G;  1VQ5 A;  5JJL A;  4P74 A;  2IX1 A;  1QUQ A;  4DK6 C;  4UP8 A;  5IP7 H;  2F4V Q;  2K50 A;  1I3Q H;  1N33 Q;  2IHE A;  4OXP A;  3M7N A;  2FXQ A;  4X6A H;  5BR8 L;  4OWW B;  2B3G A;  4X66 Q;  2JEA I;  1Z47 A;  2YTV A;  4R1J A;  3ULP A;  2OCE A;  1Q46 A;  1TWC H;  2VQE L;  5HY6 A;  3CCQ A;  3NBH B;  4DV1 Q;  3I4M G;  3HOZ G;  3PUW A;  4DV2 L;  4DR3 L;  3PO2 G;  2Q2I A;  3PF5 A;  1KQS A;  1HNX Q;  1X54 A;  3KLW A;  4X65 L;  1SRU A;  1KXL A;  2KCM A;  4IPG A;  4LWC A;  2JJQ A;  5JJK A;  3MXN B;  2I5M X;  4DR6 L;  4Y52 H;  2QEX A;  1L0W A;  3W1G A;  4AYB E;  4DR4 L;  3LGJ A;  4HIK A;  2UUC L;  1X6O A;  1HZB A;  4LFB Q;  4GNX B;  4JYA L;  2Z6K A;  3G71 A;  3TEH B;  1XJV A;  2R93 H;  1VQI A;  2VQF Q;  4GN3 B;  3K7U C;  4MZ9 A;  4LF7 L;  4R4I A;  1B7Y B;  2PNH A;  3J7A 5;  1FGU A;  1CSQ A;  2KHI A;  5LMU L;  3L7Z C;  5IYD H;  3ERS X;  2JA5 G;  4BA1 I;  3UDG A;  1UWV A;  3EN2 A;  3HOX H;  3RLO A;  5GAD C;  2E5L L;  1WI5 A;  1UE6 A;  1LTL A;  4DAY B;  4DR5 Q;  5M3M H;  4R4O A;  3A5Z B;  4LF9 Q;  3RR5 A;  4JI0 Q;  1E1T A;  3NEN A;  1CKM A;  4JI4 Q;  3U50 C;  4LFC L;  1PHJ A;  1YI2 A;  1Y1V G;  3U4Z A;  3J81 j;  3CC7 A;  3A5U A;  3I4N G;  4KHZ A;  1AE3 A;  3S2D H;  3PGZ A;  4LF5 Q;  2VY3 A;  1K0R A;  4IPC A;  1MJC A;  3FHW A;  2GVB A;  4DR1 L;  4A3F H;  1C7Y A;  3KDF A;  4H02 A;  1X3F A;  3ZJY C;  3DLL A;  1VQF A;  1MJE A;  2Q2U A;  1X3G A;  4DUY Q;  2VL6 A;  2IT1 A;  4X62 Q;  5IT9 c;  3M85 A;  1Q1B A;  2WAQ G;  4GKJ Q;  4NXN Q;  2CCZ A;  1XPU A;  2KCT A;  1VQN A;  4GKK L;  4DV5 Q;  3SGI A;  1WFQ A;  2Y0S G;  3CCU A;  1QZG A;  2CFM A;  2ZTD A;  1XNQ L;  3K81 C;  4BY1 H;  2UU9 L;  1D7Q A;  4UPA A;  2NVX H;  4UP7 A;  2Q2T A;  3GTJ H;  1HZ9 A;  2RCN A;  2UXD L;  1W3S A;  3DM3 A;  3H0G H;  1I94 Q;  1OXU A;  1Y1W H;  4L5R C;  2R7Z G;  3PUY A;  1PH5 A;  1EYG A;  4APV A;  1NTG A;  1VQJ A;  1V1Q A;  1KRT A;  3T1H L;  5IP9 G;  1L1O B;  1YBY A;  1JJC B;  2AHO B;  3S24 A;  1X65 A;  1CSP A;  4PZ7 A;  4AIM A;  1VQP A;  1TWG H;  1Y14 B;  4DUZ L;  2QGQ A;  3GTM H;  1QVC A;  3PIP A;  1XMO L;  1QVG A;  1EQQ A;  2E2I H;  4JI2 L;  4KHP Q;  4B3M Q;  1HNZ L;  4A3C G;  3CCV A;  4A75 A;  4IJL A;  4A3D H;  2H5X A;  2MO0 A;  1IBL L;  4PG3 A;  1UE1 A;  5ELN A;  4C3H H;  1J6Q A;  4JI1 L;  1MIU A;  1E22 A;  2EXD A;  3AFP A;  3STB D;  3L0O A;  1N34 Q;  1EIF A;  3T1Y L;  2HIX A;  4A3K H;  4LF8 L;  3HOU H;  4QJF A;  4YY3 L;  3OTO Q;  1N8R C;  2ATW A;  2ZJR A;  3EBE A;  3Q8D A;  1M90 C;  1CKN A;  2JA9 A;  1XMQ L;  4OX9 L;  2OQK A;  4DV0 Q;  2K5V A;  1SR3 A;  4A3G G;  4JI3 Q;  3J81 i;  4GOP C;  1YZ6 A;  4KI0 A;  1V43 A;  1N32 L;  1HZA A;  4A3M H;  2PQA B;  1YJ9 A;  1NMG A;  2I0Q A;  1AH9 A;  4YCW A;  4DV7 L;  1YEZ A;  2JA6 H;  1B8A A;  4AYB G;  3S1Q H;  1VQ7 A;  1HZC A;  3A74 A;  1S40 A;  4YCV A;  4DR7 Q;  3G48 A;  3CCE A;  3ULJ A;  5M5W H;  5J3B A;  4A93 G;  4LUV A;  5IP9 H;  4K0K L;  3HOY H;  1Q81 C;  1IYJ B;  1EWI A;  2ZM6 L;  4HJ5 A;  5FLM H;  2WFW A;  4YWL A;  3K80 C;  1SFO H;  1VQ4 A;  4JBK A;  1PFS A;  4LF4 Q;  1E7Z A;  2VQE Q;  3S17 H;  1LM0 A;  2GN5 A;  3PCO B;  3KF6 A;  4DV2 Q;  4GNX C;  3PUV A;  1JJG A;  5EAY A;  1U5K A;  4GN4 B;  4X64 Q;  4X65 Q;  3CMA A;  1VQ8 A;  2I5H A;  2WB1 E;  2HQL A;  3CCJ A;  3KF8 B;  5IE8 A;  3RNU A;  3CW2 C;  3F2C A;  4B3T L;  1OXT A;  4DV4 Q;  1EFW A;  5DLQ E;  1L2F A;  3F8T A;  1VQO A;  3G6E A;  4JV5 L;  3G4S A;  4BY7 H;  3UE0 A;  1BBU A;  4WJ4 A;  1KL9 A;  4GLA C;  5IYB G;  1IBK L;  3HOV G;  4A3L H;  1VQL A;  1WYD A;  4P75 A;  4P73 A;  4B3S L;  1PH9 A;  3I56 A;  1Q12 A;  1WCM G;  4JI7 L;  3GTP H;  1V9P A;  1C9O A;  2K75 A;  2E5L Q;  2JEB I;  1K73 C;  2B63 H;  3M3Y H;  2IHF A;  1VQH A;  3NEM A;  1ASY A;  1QUQ B;  3RZO H;  2CQO A;  5C44 H;  2I5L X;  2NVY H;  4J15 A;  1O7I A;  5LMN W;  4YHH Q;  1IXR A;  4GN5 A;  4GLX A;  4BXX H;  2OQ0 A;  4OO1 G;  5AJ3 L;  3D31 A;  1H95 A;  4JBW A;  4JI8 Q;  2NZO A;  2MNA A;  3L2P A;  3GTK H;  1N36 Q;  1YJN A;  1KHI A;  2JE6 I;  1VQD A;  2AWO A;  2F4V L;  1N33 L;  3J7Z C;  2UUB Q;  5C4X H;  4L5T A;  3K7A H;  4A3B G;  4DNI A;  2C35 B;  2R92 G;  4DV3 Q;  3JAM c;  2JA7 H;  1X3E A;  4A3I H;  4OWX B;  4DV1 L;  4AQY Q;  3IRB A;  4L5Q A;  3OW2 A;  1AE2 A;  1XPR A;  2Z0S A;  2XTI A;  3CF5 A;  1YIT A;  3I4N H;  1HNX L;  4NXM Q;  4GKK Q;  4WJ3 M;  3HKZ G;  3W1B A;  4LNQ A;  1TWF H;  5M3F G;  3S1N H;  1HR0 L;  2AMC B;  4JG2 A;  1EOV A;  2MO1 A;  5GAG C;  3GTQ H;  1XNQ Q;  3PV0 A;  3S14 H;  1L1O C;  3I4M H;  1RIP A;  3PO3 G;  3PO2 H;  3HOZ H;  3A0J A;  4LFB L;  2UXD Q;  5E7N A;  1WOC A;  5IYC G;  4IPH A;  3GTG H;  4DV6 Q;  3H3V I;  5GQO A;  2A8V A;  4TVA B;  3TS2 A;  4JI6 Q;  4HIM A;  1PH3 A;  1X56 A;  1W2B A;  2IX0 A;  1OXS C;  3WWV A;  4BBR G;  3S1R H;  3AEV A;  3JAM i;  4QGU A;  4JC0 A;  5M5X H;  5FJ8 G;  1M1K C;  3E9H A;  2YTY A;  2KHJ A;  4HJA A;  1E3P A;  2LXJ A;  1DGS A;  1S72 A;  2ZTE A;  1ASZ A;  4TQU S;  1XNR L;  2KBN A;  2UXB Q;  4DPG A;  4DR5 L;  1FJG Q;  4LF6 Q;  3KDF B;  1IBM Q;  2E8G A;  2JA5 H;  1HJP A;  2VW9 A;  4JCV E;  3CXC A;  3E0E A;  1J5E L;  2HIV A;  4JI4 L;  2K5H A;  2CWP A;  3MEF A;  3S16 H;  3CCS A;  2JA8 G;  3TRE A;  1PV4 A;  3S15 H;  2ZJP A;  4A3B H;  4LF8 Q;  2R92 H;  1E1O A;  3M4P A;  4PMW A;  4HJ8 A;  2OTJ A;  4LFA L;  2ES2 A;  1TWH H;  4X62 L;  1Y1V H;  3GDE A;  4A3E G;  1Q7Y C;  4GKJ L;  4NXN L;  4B3R Q;  1WJJ A;  2IY5 B;  4YWK A;  1NBW A;  1YHA A;  5C3E G;  4DV5 L;  1PH6 A;  3HKS A;  1Z9F A;  2K4K A;  4LW1 A;  2VUM G;  3CPF A;  2GVA A;  1HNW L;  1S3O A;  4R4T A;  3PO3 H;  5FLX c;  1YIJ A;  1YHB A;  4HID A;  2WB1 G;  4BBS G;  1PVO A;  4JI5 L;  3E9I A;  2N8N A;  5IYC H;  1PH1 A;  3M4O H;  3HOW G;  4A3J G;  1I94 L;  3EIV A;  4ALP A;  2UXC Q;  3ER0 A;  4C3J H;  2UUA Q;  4RMF A;  2AWN A;  5K36 G;  1VQM A;  2BH8 A;  2HT1 A;  5IP7 G;  2HHH Q;  1VQA A;  3F2B A;  5IWA Q;  1NY4 A;  4PZ6 A;  3RLF A;  2WAQ E;  1K8A C;  1BBW A;  2R7Z H;  2R7D A;  5LMN Q;  3FKI G;  1C0A A;  1T9H A;  1R9T H;  3CAM A;  4MTN A;  3PSI A;  4KHP L;  4B3M L;  4UP9 A;  2BA0 A;  5M5Y H;  3HFZ B;  4YWM A;  3CCM A;  1I5F A;  1JT8 A;  2JQO A;  5BR8 Q;  2BH2 A;  1OXX K;  1CKN B;  2N3S A;  4GOP A;  3RN2 A;  3H3V H;  1X55 A;  3UE1 A;  4B3T Q;  4EQ5 A;  1N34 L;  1VQB A;  2LXK A;  1UEB A;  4DR3 Q;  1U0L A;  1VCI A;  4A3C H;  2AKW B;  4O0A A;  2YTX A;  3I7F A;  1KRS A;  3OTO L;  4POG A;  3I55 A;  1SN8 A;  1I50 H;  2R93 G;  1YVC A;  1PYB A;  2RHS B;  1KAW A;  4DR6 Q;  3S2H H;  5C3E H;  3KFU A;  5IY0 A;  4DV0 L;  4GLV B;  4DR4 Q;  4RG1 A;  3GD7 A;  2YV5 A; 
#chains in the Genus database with same CATH topology
 2AUK A;  2K28 A;  4KKS A;  2MUY A;  2K5N A;  3TQY A;  2A68 C;  3CC2 A;  1CQF A;  3I4N H;  1SJH D;  3C46 A;  1QOH A;  3OMG A;  1PFM A;  3AB9 A;  2L12 A;  1VQ9 A;  3BG3 A;  3I4O A;  3TDQ A;  4LJZ C;  1GKH A;  5A35 A;  3H3V C;  4Y7N B;  4A93 H;  4LF4 L;  4LFC Q;  1TS2 A;  1VMP A;  2D0P A;  3W3A A;  1JC7 A;  3BZC A;  5DM7 3;  4DAY A;  1QVF A;  3T4A C;  1HR0 Q;  1VQC A;  5CBA E;  3Q23 A;  1LTT D;  5ELO A;  4AH6 A;  2ID0 A;  2DN8 A;  2N49 A;  2OXP A;  1Q90 A;  1JE5 A;  1IL2 A;  4IOC A;  2PPB C;  1LTG D;  3PUZ A;  2JA8 B;  3W5O A;  2ZTC A;  1B9N A;  5E3F A;  1BNZ A;  1EUJ A;  1I6H H;  2B2U A;  3HS0 C;  1KLG D;  1XNR Q;  3R8B A;  2QA4 A;  3PF4 A;  5IYB H;  3O13 A;  1NE3 A;  1A63 A;  4FXD A;  4ZLT F;  1VMC A;  5IGD A;  2VUM B;  4YHH L;  2NVQ H;  4BBS B;  4IJH A;  3HOY B;  4L5S A;  4DK3 C;  2RF4 A;  2XGT A;  4OON A;  3S1M H;  2ZT9 C;  1GUN A;  4P72 A;  1I4Q A;  1XTD A;  1SRO A;  5IGG A;  4AQY L;  4R9W A;  2KEC A;  3M4Q A;  1I3Q B;  4QMG A;  3T1Y Q;  1PYS B;  4F8M A;  4A3M G;  2QIL A;  2VS1 A;  1NSN S;  1CUK A;  3ICE A;  1K9M C;  2B2Y A;  5M3F H;  3P75 A;  1A2U A;  5LHY 1;  4O2D A;  1I6V C;  1AZQ A;  2VZA A;  1Q82 C;  4DV7 Q;  4Q5V A;  2K03 A;  2CKZ B;  3RZO B;  5C44 B;  1FJG L;  3HKZ E;  4IO9 A;  4DGZ A;  4K0K Q;  1PH2 A;  3ERQ A;  5H1S E;  3DWA A;  2N78 A;  3VDY A;  4BA2 I;  1R4Q B;  3GTK B;  2XRS D;  1I4G A;  4L8J A;  1GUG A;  1Z7T A;  2RA4 A;  1TWA H;  3SK5 A;  2Y0S E;  1SYG A;  3DHQ A;  1HA5 A;  1EQT A;  2IWH A;  1SYB A;  4C56 C;  1J9O A;  3NE5 B;  1K8G A;  4A3L G;  2DJF C;  2O5I C;  4GS3 A;  2GA4 B;  4JV5 Q;  4NDX A;  3HP3 A;  4A3E H;  2B63 G;  2F0P A;  2K05 A;  4K5V A;  4ABN A;  4IPD A;  3KYH C;  1PTO B;  5IGB A;  3RMH A;  4BXX G;  1X9N A;  4MNO A;  3K0X A;  3KOJ A;  3HRZ C;  1EFI D;  5GAH C;  2WKD A;  1ESF A;  4CJ0 B;  1DYQ A;  3UDI A;  2R3Z A;  2F0I A;  2JP1 A;  1HFN A;  1JWU D;  2PZU A;  4A3I G;  2F0O A;  3NWT A;  5K36 H;  1BCP B;  1QUQ A;  5LL6 X;  4HMJ A;  4OXP A;  4X6A H;  4OWW B;  1Z47 A;  1SNM A;  2B8G A;  2YTV A;  3R2T A;  4R1J A;  5BN4 A;  5M9O A;  1GJX A;  4DV1 Q;  3I4M G;  3CCQ A;  2K6A A;  4OO1 G;  3HOZ G;  1TWH B;  1AEX A;  1SRU A;  4IPG A;  2FMM A;  4LWC A;  3SDZ A;  2Z8L A;  1STY A;  4DR4 L;  3DWQ A;  1X6O A;  2DY7 A;  1HZB A;  1YNJ D;  2CVR A;  1W6J A;  4GNX B;  1QWY A;  4KKU A;  4JYA L;  3K0Y A;  4GN3 B;  4MZ9 A;  4LF7 L;  3KLR A;  2CQA A;  2MPM A;  5LMU L;  1CSQ A;  2KHI A;  3NQT A;  4A3M B;  2JA5 G;  1TR5 A;  2KOL A;  3NQI A;  2Z6B A;  1WI5 A;  1UE6 A;  4DR5 Q;  1XYI A;  5M3M H;  3NSW A;  4RGT A;  1DD2 A;  1E1T A;  3NEN A;  5M5W B;  3U50 C;  1PHJ A;  1YI2 A;  1Y1V G;  4HSP A;  3J81 j;  4KHZ A;  3S2D H;  2RCF A;  2K01 A;  1MJC A;  2QEJ C;  2GVB A;  2JN4 A;  4DR1 L;  1C7Y A;  1SDF A;  1O78 A;  3ZJY C;  1VQF A;  3S9W A;  2VL6 A;  5J39 A;  2IT1 A;  3M85 A;  3GQB A;  2WAQ G;  1HHV A;  3ND8 A;  4GKK L;  2XWJ B;  2HUG A;  1JQY D;  1WFQ A;  3CCU A;  1QZG A;  2UU9 L;  2WKC A;  2Q2T A;  4UP7 A;  2PMZ B;  3GTJ H;  1HZ9 A;  1CA6 A;  3DM3 A;  3E0J A;  1Y1W H;  4L5R C;  2R7Z G;  4KTA A;  4APV A;  1G8Z D;  3D4W A;  1VQJ A;  1V1Q A;  2HD3 A;  3FEW X;  5IP9 G;  1EZ6 A;  1WVL A;  1L1O B;  1YBY A;  1JWS D;  2QF7 A;  5FO8 B;  4PZ7 A;  4AIM A;  2PCF B;  1XMO L;  2EYO A;  1QVG A;  4JI2 L;  2NVY B;  4A93 B;  4A3C G;  3CCV A;  4FVM A;  5IGF A;  4A3D H;  2MO0 A;  5G3L F;  1UE1 A;  2LFN A;  5BN3 A;  4C3H H;  1J6Q A;  2SNS A;  4JI1 L;  3AFP A;  1E22 A;  3L0O A;  2Z4H A;  1B44 D;  2L5T A;  4QJF A;  3E5S A;  4DK1 A;  4YY3 L;  3TP8 A;  2ATW A;  5HGT A;  1M90 C;  1HUN A;  2CW0 C;  2K5V A;  4PMB A;  2FJ2 A;  2KHS A;  3S1N B;  1N32 L;  1YZ6 A;  1IW7 D;  2JYO A;  4KI0 A;  2K5W A;  3PQI A;  1NMG A;  5I9O A;  3I4M B;  3HOZ B;  1B8A A;  4AYB G;  2M9V A;  1I6H B;  1HZC A;  2VXW A;  5JEA H;  2OF1 A;  2SNM A;  5EKK A;  4DXF A;  5BN5 A;  2RQX A;  2NVQ B;  5FLM H;  2WFW A;  3QO2 A;  1F77 A;  3S1M B;  3W2D A;  4LF4 Q;  5JPN C;  3SVM A;  1LM0 A;  2GN5 A;  2DY8 A;  1JWM D;  3PUV A;  4X65 Q;  4XXE A;  2JA5 B;  1S5F D;  2I5H A;  2HQL A;  1ENA A;  4FF2 A;  3CCJ A;  4ZAI A;  4KKT A;  3RNU A;  3URY A;  5CC4 A;  3RUZ A;  3F2C A;  4B3T L;  1OXT A;  1VQO A;  4U68 A;  1H9S A;  3T13 A;  4BY7 H;  4ME5 A;  1Y1V B;  4C1N K;  1BBU A;  4WJ4 A;  5A2Q L;  1KL9 A;  1EY8 A;  4GLA C;  5EBD A;  1IBK L;  2MHV A;  1LTB D;  1IKM A;  3H6M A;  2F3W A;  2D9U A;  1DM0 B;  4UDU C;  1WCM G;  4FF3 A;  1V9P A;  2XIW A;  2L9H A;  4UHV A;  3M3Y H;  3SR1 A;  1O7I A;  4B9X A;  4YHH Q;  1IXR A;  4F88 A;  3D31 A;  1H95 A;  2NZO A;  4C1N I;  3I91 A;  1BDO A;  3J81 L;  2JE6 I;  1VQD A;  3J7Z C;  1EU4 A;  5C4X H;  2C35 B;  2X69 A;  2K1B A;  3JAM c;  2PZT A;  4OWX B;  4AQY Q;  1H9M A;  1AE2 A;  1BCP F;  2XTI A;  2Z0S A;  4CDF C;  1O7L A;  3J80 L;  3CF5 A;  4G4K A;  1X3P A;  3HKZ G;  3H09 A;  4LNQ A;  4R8I A;  2KCN A;  1HR0 L;  4JG2 A;  1DCZ A;  5GAG C;  3S14 H;  3PV0 A;  1GXD C;  1PFB A;  1RIP A;  3PO3 G;  5ELE A;  5IYC G;  1HTP A;  3HEJ A;  4A3E B;  4X3K A;  1JOO A;  1CHQ D;  1Q8I A;  2L4N A;  5GQO A;  3QIA A;  1AW7 A;  1PH3 A;  3WWV A;  4HED A;  3S1R H;  1GUS A;  2KHJ A;  2O5J C;  1DOM A;  2AUJ D;  1XNR L;  4DPG A;  3QG1 A;  5D65 A;  1FJG Q;  2Q8R E;  1U9R A;  1G2S A;  3DEP A;  3KLS A;  3TZU A;  3E0E A;  4X3U A;  4ZQ3 A;  1F2Z A;  4AYB B;  3S15 H;  2ZJP A;  4RFB A;  4LF8 Q;  2R92 H;  4PMW A;  3M4P A;  4HJ8 A;  3FKI B;  2AQ3 B;  4X62 L;  1Q7Y C;  4GKJ L;  4RHS A;  1EL0 A;  5C3E G;  1PH6 A;  1STN A;  1Z9F A;  2GVA A;  2G9H D;  4R4T A;  1T5E A;  5FLX c;  3E9I A;  4ZYS A;  1B9M A;  3M4O H;  2NBF A;  4A3J G;  1EY9 A;  3EIV A;  3ER0 A;  5HUR A;  4HTH A;  1RF2 D;  4RMF A;  1YNJ C;  2G5D A;  1VQM A;  2F4I A;  4BS9 A;  3F2B A;  3MAQ A;  5FO9 B;  1BBW A;  2RDH A;  1SNP A;  1C0A A;  5M3M B;  3MXU A;  4B3M L;  4UP9 A;  4H7B A;  1WCM B;  3CCM A;  1I5F A;  5JAV A;  3M7G A;  3S2D B;  5KIX A;  4G7O C;  1N34 L;  2HCC A;  2AKW B;  4O0A A;  2YTX A;  3OTO L;  4POG A;  3I55 A;  1I50 H;  1YVC A;  3S2H H;  5A2Q E;  1SND A;  4GLV B;  5IT9 L;  1XWE A;  4DR4 Q;  3NBH A;  5IYD G;  3IL8 A;  4JYA Q;  4HIO A;  4J8Q A;  4UY8 C;  2ASB A;  3OOC A;  5LL6 S;  3HOX G;  1KC8 C;  3GTJ B;  3MXN A;  4LF7 Q;  4K6L A;  4KJN A;  5I6W A;  5KND A;  1SBB B;  4A3G H;  1C4Q A;  1Q86 C;  3ZYY X;  5CV9 A;  3ULL A;  1Y1W B;  5LMU Q;  4EVO A;  5C4J H;  2PMZ E;  1A0I A;  1S5D D;  4WJW A;  1CK1 A;  3BVZ A;  3D8G A;  1BUV T;  2ICE C;  4N9P A;  3J80 E;  1YJW A;  4A3D B;  4DR1 Q;  4C3H B;  1NMF A;  2WV6 D;  3DXJ C;  4BY1 G;  4FDB A;  1EYD A;  4HMI A;  1OXV A;  1MSH A;  1LUZ A;  5DAU A;  3OWE B;  4DN4 M;  4FO2 A;  2KED A;  4XQJ A;  1I4X A;  1A3U A;  2UU9 Q;  2XWB B;  1LT5 D;  1SE4 A;  1UE7 A;  4V19 0;  2BCO A;  1F2L A;  3F2U A;  1PZK D;  2JXM B;  3IFD A;  3J7A F;  3HOV H;  3CCL A;  4RCO A;  1LYL A;  1IW7 C;  1VQG A;  2BA1 A;  2XVS A;  4IFD J;  2H4O A;  4JI8 L;  3VR6 A;  5CMD A;  2ZJQ A;  1A62 A;  1Y8P B;  5CV4 A;  2ZXP A;  1Q1E A;  1CFM A;  4K6D A;  1XMO Q;  4A3J B;  4QB4 A;  4JI2 Q;  4A3K G;  3HOU G;  4DV3 L;  3VYS A;  2F3V A;  1N9W A;  3NEL A;  5C0X J;  3GO5 A;  4XTC S;  4NXM L;  2B29 A;  4JI1 Q;  2N88 A;  3WOF A;  3K6O A;  2OTL A;  1KDA A;  1HNW Q;  1LAC A;  4NKL A;  5L37 A;  4YY3 Q;  4ZKB B;  1TWC B;  1VQK A;  1ENC A;  3NPP A;  2JA6 G;  4LUO A;  3SK8 A;  2PW7 A;  4DAM A;  2EQS A;  4POF A;  1N32 Q;  4R4C A;  1B4O A;  4PZ8 A;  3MWY W;  3HOY G;  2LKV A;  3GTL H;  4DU9 A;  2PI2 E;  2CH4 W;  2PQA A;  3V96 A;  1SNC A;  4BBR H;  4LF6 L;  1FVI A;  4K8I A;  3AYH B;  5FJ8 H;  2I07 B;  4IUR A;  2RHQ B;  4HSV A;  2SOB A;  4OEL B;  4IZ8 A;  5C6A A;  4OIK A;  2NN6 G;  3I73 A;  1EIY B;  3HOX B;  1CTM A;  2L55 A;  2VB3 X;  1QZH A;  1Q8K A;  1MGS A;  2F0M A;  1VF5 C;  4IFD G;  2J0T D;  5ELC A;  3GTO H;  2DNE A;  4X3S A;  2A1A A;  3M9B A;  4KN4 C;  1KAB A;  3I4N B;  4P71 A;  2LSS A;  5IT9 E;  3CP0 A;  3KK7 A;  4OWT B;  3UDF A;  2LS0 1;  5C0X G;  4JBJ A;  4CDC C;  1ZYR C;  3KF8 A;  1IBK Q;  3PIO A;  2Z1C A;  5C44 G;  3J80 i;  1GO3 E;  4OO1 I;  1S5E D;  1IYV A;  1TS3 A;  1AH9 A;  4EQN A;  1K83 H;  3SXH A;  1V1P B;  2UUA L;  3VYT A;  4RAU C;  3MC0 B;  4BY1 B;  4KMU C;  2QDL A;  4GZY C;  1EIH A;  5IWA L;  2WP8 J;  2NVT H;  1K3R A;  1UE5 A;  2F0K A;  2XRQ D;  4L63 B;  5E4X A;  1U4L A;  3FP9 A;  3U4V A;  2K5D A;  2O4X A;  1VQ5 A;  4H44 C;  2LY7 A;  4UP8 A;  3M7N A;  2F0V A;  5KRU A;  5BR8 L;  4X66 Q;  3QWN A;  1TWG B;  1G91 A;  3PO2 G;  4DR3 L;  1STG A;  1KQS A;  1X54 A;  4X65 L;  3I3C A;  2EE1 A;  1W6K A;  4DR6 L;  1UUP A;  2I5M X;  4Y52 H;  2QEX A;  1B53 A;  3W1G A;  4AYB E;  2NZ1 D;  2K04 A;  2B2V C;  5EQ0 A;  1PDQ A;  5EJW A;  1F9P A;  4A3K B;  2E74 C;  3HOU B;  1LT6 D;  1XJV A;  3TEH B;  2R93 H;  4DFA A;  3M4O B;  1B7Y B;  1MSG A;  1KLU D;  4BA1 I;  2KUM A;  3EN2 A;  3RLO A;  3VR4 A;  2JA6 B;  3S1Q B;  3GP7 A;  4DAY B;  2EYH A;  4LF9 Q;  3RR5 A;  1D2B A;  1ET6 A;  2SEB D;  4XT3 B;  2FFK B;  4TKO B;  2HCI A;  3PGZ A;  4DF7 A;  1K0R A;  1A6X A;  3FHW A;  4A3F H;  5KNB A;  4H02 A;  3DLL A;  2IL8 A;  2C9O A;  4UAI A;  4X62 Q;  4DAV A;  4GKJ Q;  1XPU A;  2KCT A;  1H9R A;  1VQN A;  1I50 B;  4ODG A;  3BDC A;  4CDE C;  3S2H B;  4IUU A;  4O42 A;  5FKA C;  2ZXO A;  2ZTD A;  4C3J G;  4KY5 A;  5EKL A;  1D7Q A;  4UPA A;  3KBG A;  3H0G H;  2RDG A;  3SEB A;  5FOB B;  1CQV A;  1LO5 D;  4DNR B;  3P7J A;  1B50 A;  1KRT A;  3G7L A;  3H94 A;  4PMC A;  1U4R A;  2NUC A;  1Y14 B;  4DUZ L;  3GTM H;  3PIP A;  4X3T A;  3GV3 A;  2E2I H;  4B3M Q;  1HNZ L;  1LTS D;  4A75 A;  1VF7 A;  1BOS A;  1MIU A;  2EXD A;  4RGO S;  1PRT B;  3STB D;  1N34 Q;  1EIF A;  2HIX A;  4F7X A;  4LF8 L;  3OTO Q;  3A56 A;  1AN8 A;  1CKN A;  1TQO A;  3NWS A;  4K5W A;  1NAP A;  3A54 A;  4GOP C;  1QNU A;  1HZA A;  5FK9 C;  2I0Q A;  2EYP A;  3PO2 B;  1YEZ A;  3WOE A;  5ISR A;  3NBI A;  1SE3 A;  4YCV A;  4EQO A;  3GTG B;  4RKB A;  1STE A;  3HOV B;  1V1O A;  4A93 G;  4LUV A;  5IP9 H;  1ZKO A;  3SHL A;  1CZG A;  2J4X A;  1IYJ B;  1WD0 A;  2RSN A;  1FNV A;  3T51 B;  2EYM A;  3PCO B;  4TRD A;  3KF6 A;  4XYO A;  1AZP A;  1BQQ T;  5EAY A;  4GN4 B;  2X6L A;  4FF1 A;  4K14 A;  2EXZ A;  3CMA A;  2KA7 A;  1LTR D;  2V4D A;  4A3B B;  1F2Y A;  3CW2 C;  4R8N A;  3F8T A;  3G6E A;  3G4S A;  4LAA A;  2EVB A;  5IYB G;  5E1F A;  4JW0 A;  1VQL A;  1WYD A;  1PH9 A;  4K2K A;  4KHV A;  1PMR A;  4JI7 L;  3GTP H;  1D6E C;  2E5L Q;  2JEB I;  1O80 A;  1ASY A;  1QUQ B;  1SXT A;  2CQO A;  2I5L X;  1HCZ A;  4H13 C;  5EBC A;  5CV7 A;  5EKI A;  3OPO A;  4M8A A;  4GN5 A;  3R93 A;  3Q0A A;  1HXY D;  1K28 A;  1YNN D;  4CDD C;  4BBR B;  4C3J B;  4JI8 Q;  4U67 3;  5AJ3 L;  3L2P A;  1KHI A;  2AWO A;  2F4V L;  2HDM A;  1N33 L;  1DON A;  4L5T A;  3K7A H;  2ZXR A;  4DNI A;  2K33 A;  1HQR D;  4LMQ D;  2B2V A;  4DV3 Q;  2JA7 H;  3A8J E;  4ZK9 B;  1AP0 A;  3ITP A;  3OW2 A;  1HNX L;  4NXM Q;  5M5Y B;  1TWF H;  5M3F G;  3RD4 A;  1HTL D;  2AMC B;  5I6Y A;  3GTQ H;  1XNQ Q;  3BDL A;  1KAA A;  1RTO A;  2EJM A;  3LWU A;  4LFB L;  4YIJ A;  2A8V A;  3TS2 A;  2Z4I A;  3HGB A;  2NTT A;  1X56 A;  3BS1 A;  1FR3 A;  2IX0 A;  1Y8N B;  4MHE A;  3E9H A;  2YTY A;  4HJA A;  4QF4 A;  2NWG A;  4N8X 1;  2E2D C;  4OL7 A;  1EY4 A;  2PYK A;  3C1F A;  4KV6 A;  4LF6 Q;  3A8K E;  5NUC A;  1KDC A;  1HJP A;  3CXC A;  2CWP A;  3S16 H;  4FXG C;  1TY2 A;  3TRE A;  4IUT A;  3FRP B;  1PLF A;  1E1O A;  4BWG B;  2ES2 A;  5G3L D;  4A3E G;  4NXN L;  1WTQ A;  1F9S A;  1WJJ A;  1NBW A;  4DV5 L;  1TU2 B;  1EY5 A;  2SDF A;  1I4R A;  1HNW L;  3PO3 H;  1YIJ A;  1MBY A;  2WB1 G;  1TY0 A;  5IYC H;  1PH1 A;  5EGT A;  2R93 B;  1HA6 A;  1I94 L;  1C8C A;  3OW7 A;  4L6T B;  1BF4 A;  2UUA Q;  2AWN A;  1E2Z A;  3CRK C;  4J6H A;  5K36 G;  2BH8 A;  1HRJ A;  2IJ0 A;  4HR7 B;  5IWA Q;  4PZ6 A;  3RLF A;  1STB A;  2R7D A;  4KY7 A;  1SAP A;  3FKI G;  1TS5 A;  2EJF C;  2NYZ D;  4MTN A;  3PSI A;  2BA0 A;  2JSO A;  3HFZ B;  4ZUJ A;  4ZRZ A;  5BR8 Q;  4ID6 A;  3N52 A;  1KTK A;  2BH2 A;  4GOP A;  1K8M A;  1ZXT A;  3RN2 A;  1UEB A;  4DR3 Q;  3X3N A;  2RHS B;  1KAW A;  4DR6 Q;  5C3E H;  2A6H D;  4Q0F A;  1PRT F;  4RG1 A;  4IOA A;  1MKH A;  2A19 A;  2CHB D;  1F2M A;  3H0G B;  3A7L A;  5M3F B;  1P8L A;  3TRZ A;  5M3M G;  1TXY A;  1DOK A;  2BE5 D;  5DM6 3;  1PFN A;  3UDX A;  1C48 A;  5I9P A;  1XXG A;  3BZD B;  1PTO D;  2V1C C;  3GTM B;  1PTO F;  3RZD H;  3BU2 A;  5KEE A;  1AFP A;  3AQQ A;  2E2I B;  1T5X D;  2JK8 A;  4HCE A;  4X64 L;  3CD6 A;  3D0F A;  1IZ6 A;  1H9S B;  3NTH A;  3OSO A;  3U58 A;  1SMX A;  1SYD A;  3U9S A;  4KLK A;  4X66 L;  4QQB X;  3CU7 A;  2M00 A;  1ONL A;  3NTI A;  1TWA B;  5JEA J;  1BCP D;  4DV4 L;  4KD3 A;  4XQQ A;  1Y1W G;  4ZCK A;  3VR3 A;  4QL5 A;  1QNK A;  3STB C;  5COR A;  1NNX A;  4ME3 A;  1KDB A;  1GVP A;  2D2C C;  3OIQ A;  2R61 A;  2KCC A;  2D0O A;  2PO4 A;  1J5E Q;  4JBM A;  2F0G A;  3F1Z A;  2WB1 B;  4A3D G;  1N36 L;  2H1E A;  4DUZ Q;  4C3H G;  2UUB L;  2XSC A;  4JOI A;  3I2Z A;  4LFA Q;  4LF9 L;  1YNX A;  1HNZ Q;  2AQ1 B;  2QDB A;  4C3I H;  1BO0 A;  2A69 D;  3CME A;  1HR0 W;  3H91 A;  4XIG S;  1G2T A;  1GM5 A;  4FYD A;  2EY1 A;  4M1U B;  2NN6 I;  1E24 A;  3NXW A;  2XN9 C;  1NJI C;  1VS0 A;  3PMF A;  1I4H A;  2DJG C;  1SE2 A;  4DV6 L;  3MEH A;  4IFD I;  5JEA G;  4JI6 L;  3EFX D;  1CT1 D;  1SYF A;  3FMC A;  4G7H C;  2NB0 A;  2CH4 A;  1PH8 A;  4CGY B;  5FLM G;  4XDX A;  2EYJ A;  5ELF A;  2FIN B;  2UXB L;  4Y7N H;  5C0X I;  1G29 1;  3J81 c;  4K2L A;  1BVS A;  2ALY B;  1IBM L;  1VQ6 A;  4WRD A;  3D4R A;  3MZ5 A;  4NB3 A;  4PV1 C;  1JCK B;  3DMU A;  1SLJ A;  3J80 c;  4P2C B;  3K7A B;  4K5X A;  2F03 A;  1UNS A;  4JPB W;  4A4I A;  2JA7 B;  1YNN C;  1BKB A;  3A8I E;  3TN2 A;  4MIU A;  4BY7 G;  4FP5 D;  3E3X A;  2JA8 H;  3RLN A;  3B6Y A;  1TWF B;  2PQE A;  1SJE D;  3BZK A;  1TS4 A;  3MA2 B;  1PH7 A;  1D5X C;  3Q6S A;  5D3I B;  3T16 A;  4DR2 Q;  3JC6 6;  1NR2 A;  5HGQ A;  3F2D A;  2VUM H;  5GAE C;  1RL2 A;  2KEN A;  2UXC L;  4BBS H;  1JMC A;  4JI7 Q;  3CPW A;  5DNF A;  3AMU A;  2DUD A;  1WTP A;  1KIX A;  5CV6 A;  3HOW H;  3KJP A;  2EJG C;  5C4X G;  1EWH A;  1XPO A;  2VNU D;  5LMN L;  1LTA D;  5AJ3 Q;  3D6W A;  5JJL A;  4N8F A;  4DK6 C;  1X32 A;  1TVX A;  2A6E D;  5IP7 H;  1I3Q H;  1N33 Q;  2F4V Q;  3I4N G;  3J81 E;  1G6P A;  4CKE A;  2JEA I;  5CGK A;  1HFG A;  1L0X B;  2XNA C;  2OCE A;  1Q46 A;  2EOT A;  1GHJ A;  3NBH B;  2Q2I A;  3TP5 A;  3PF5 A;  2K32 A;  1S5B D;  3KLW A;  1Y69 U;  1HNX Q;  1KXL A;  2JJQ A;  3MXN B;  2WIN B;  3LGJ A;  4HIK A;  2UUC L;  4IUN A;  4LFB Q;  3K5N A;  1VQI A;  2G9D A;  2VQF Q;  2F0J A;  1A2T A;  1GOZ A;  1BR9 A;  4R4I A;  2PNH A;  4I65 A;  2B2W C;  1FGU A;  1M4V A;  3ERS X;  3UDG A;  2Q8I B;  5GAD C;  3FPP A;  2E5L L;  1GUT A;  4JI0 Q;  3K5M A;  2F0H A;  2F0W A;  4EGV A;  3U4Z A;  4B9W A;  4LF5 Q;  1JE4 A;  3KDF A;  1MJE A;  2Q2U A;  1X3G A;  4DUY Q;  5IT9 c;  1TT2 A;  1BXT A;  1Q1B A;  3G6J B;  1A15 A;  4NXN Q;  2K5Q A;  2KJX A;  2F0F A;  3C3L A;  3HZX A;  4DV5 Q;  5FO7 B;  3SGI A;  1SNO A;  2CFM A;  1XNQ L;  3K81 C;  3T56 B;  3IKJ A;  2NVX H;  5JVG 3;  3TP7 A;  4BY7 B;  1I94 Q;  1OXU A;  1EYG A;  2A6H C;  1NTG A;  3T1H L;  4DNT B;  4NMZ A;  4QUC A;  3D6C A;  1SYC A;  1X65 A;  3MXP A;  3M3Y B;  2F0D A;  1JIC A;  3K57 A;  2O2L D;  1F9Q A;  1Q3L A;  1UEA B;  2BE5 C;  4MN3 A;  4IJL A;  1IBL L;  5IOC A;  4TSS A;  1PTO C;  2MJ8 A;  5C4X B;  2I46 A;  1N8R C;  3NK9 A;  3Q8D A;  1A3T A;  2JA9 A;  1LTI D;  1XMQ L;  1QCB D;  4OX9 L;  4A3G G;  1HUM A;  4JI3 Q;  3J81 i;  1V43 A;  4XQN A;  4A3M H;  2PQA B;  3S14 B;  1YJ9 A;  4FF4 A;  1BCP C;  1VQ7 A;  3IAY A;  3CCE A;  1XTC D;  4J1M A;  4ULL A;  3ULJ A;  5M5W H;  5J3B A;  3K58 A;  1JOQ A;  3S1R B;  1Q81 C;  2ZM6 L;  1QE6 A;  5JJZ A;  1S4Z A;  4YWL A;  1SFO H;  1MHW C;  4JBK A;  3S17 H;  2VQE Q;  4DV2 Q;  4GNX C;  1U4P A;  3VR5 A;  1U5K A;  4IUP A;  4X64 Q;  3N6R A;  2PW5 A;  4KK7 A;  3SK4 A;  2WB1 E;  3OHX C;  5KNC A;  1STA A;  3NUC A;  3S15 B;  3KF8 B;  4QIW B;  1LT4 D;  1M8A A;  1E2W A;  5EPK A;  5I2X A;  1KNA A;  3CRL C;  3TZD A;  4DV4 Q;  1EFW A;  5DLQ E;  1L2F A;  2R92 B;  2RBM A;  5C5L A;  5T1I A;  3HOV G;  2A69 C;  4A3L H;  3Q22 A;  4P73 A;  1CM9 A;  4B3S L;  2BDN A;  3I56 A;  1C9O A;  4IQZ A;  2K75 A;  4V0B A;  1K73 C;  4N9T A;  2B63 H;  2IHF A;  3EVQ A;  2A74 C;  1DOL A;  2QCP X;  2NVY H;  3V05 A;  4I7Z C;  4BXX H;  2OQ0 A;  1N36 Q;  5CYU A;  1E2V A;  5C3X A;  5IIF A;  2CW0 D;  2UUB Q;  4A3B G;  5DEH A;  1X3E A;  4A3I H;  3IRB A;  4L5Q A;  4WJ3 M;  5JOB A;  1TKW B;  3W1B A;  2HQE A;  2EY6 A;  3S1N H;  1WD1 A;  1WTR A;  1EU3 A;  1EOV A;  2B2W A;  2RSO A;  2EDG A;  2TSS A;  1L1O C;  4CHT B;  3I4M H;  4OO1 H;  1D1K A;  3L3O C;  4WFN 3;  3HOZ H;  1B1Z A;  3A0J A;  4PNY A;  4OEM B;  4LK1 C;  2UXD Q;  1WOC A;  2L11 A;  4IPH A;  2C5C A;  4S3S A;  4DV6 Q;  3VA7 A;  4JI6 Q;  3MXG A;  1QJO A;  1W2B A;  4F87 A;  1OXS C;  4BBR G;  3AEV A;  2OEO A;  5M5X H;  5FJ8 G;  2X6G A;  1Y8O B;  1E3P A;  3R3O A;  1DGS A;  1S72 A;  2ICI A;  5IGC A;  2UXB Q;  3HOW B;  1L0Y B;  3ERO A;  4A3G B;  1CHP D;  4I7A A;  1IBM Q;  2JA5 H;  1J5E L;  4JI4 L;  2HIV A;  2K5H A;  3MEF A;  4Z9C B;  3CCS A;  1IHZ A;  5C4J B;  5C5M A;  1GHK A;  4WOR A;  5F2D A;  1RJT A;  1D5Z C;  3NP8 A;  1ML0 D;  4LFA L;  5TSS A;  1VDZ A;  1Y1V H;  2A6E C;  3Q24 A;  3HKS A;  1PZI D;  4B08 A;  1B3A A;  1S3O A;  1YHB A;  2AQ2 B;  4KY6 A;  4RHR A;  4HID A;  2N8N A;  2K7V A;  3OIP A;  5KGU A;  4O1N A;  4ALP A;  2UXC Q;  2FHT A;  4H0L C;  4HAE A;  1VQA A;  1NY4 A;  2R7Z H;  1RKN A;  5LMN Q;  3MVV A;  1R9T H;  2EYF A;  3CAM A;  4KHP L;  4E6I A;  4JK1 C;  1ENF A;  4YWM A;  1JT8 A;  1PXU A;  2JQO A;  1CKN B;  2N3S A;  1ILQ A;  3UE1 A;  4EQ5 A;  1VQB A;  4A3C H;  1KRS A;  2WII B;  2R93 G;  4RH6 A;  1PYB A;  1SNQ A;  3KFU A;  5IY0 A;  4DV0 L;  2YV5 A;  2UUC Q;  1IL8 A;  5ELB A;  1JB7 A;  2D5D A;  1HH2 P;  2Q2H A;  2F0U A;  3QJY A;  4MTK A;  2NVX B;  5ELD A;  2L1B A;  4DR2 L;  2E2J H;  4DR7 L;  3BYY B;  1JB3 A;  2CWA A;  4CJ2 C;  4IN3 A;  4GNX A;  1E0B A;  1EQR A;  1TII D;  3A7A B;  1SSO A;  3KF6 B;  2E2H H;  1EY7 A;  2Z6K C;  2MFI A;  1OO9 B;  3I4L A;  2VB2 X;  4A3F G;  4K8J A;  2F0T A;  2BOS A;  3GTL B;  2L15 A;  2B39 A;  3FKI H;  1F9R A;  3NTK A;  2B8F A;  2K14 A;  3OYY A;  2OWO A;  4CBV A;  3CHB D;  2L0C A;  3I90 A;  3CKI B;  5D14 A;  3K59 A;  3GTO B;  4NPS A;  1JOK A;  3H0G G;  4FXK C;  4A76 A;  3VYR A;  1BBX C;  5K5P A;  2NZH A;  5J22 A;  4JOI C;  4IUQ A;  1YHQ A;  5GRO A;  2F52 A;  4R4Q A;  4RA8 A;  1H9K A;  3CC4 A;  4ZUI A;  1K8O A;  2YU9 H;  2R6G A;  2VQF L;  3RN5 A;  3T1H Q;  1OTC A;  1K83 B;  1I4P A;  1WCM H;  2F0L A;  3FPU B;  2EIF A;  4JVZ A;  1NCV A;  3VA5 A;  1CZW A;  3KJO A;  1A8V A;  3R2I A;  5C3W A;  1SFO B;  2IX3 A;  2NVT B;  1L1O A;  3BYT B;  3S17 B;  4JI0 L;  1VQE A;  1HPC A;  4NP5 A;  5I2Y A;  2F0S A;  4LUZ A;  3PUX A;  1IBL Q;  4RGN A;  2LMC B;  3M4Y A;  3H15 A;  3C2P A;  1XX8 A;  1JR0 D;  4LF5 L;  4HCS A;  3CCR A;  1PH4 A;  4DXG A;  1PA6 A;  1JJ2 A;  1SMY D;  3C1E A;  4XT1 B;  2DGY A;  3A55 A;  4DUY L;  4JI5 Q;  1SEB D;  1D8L A;  5JJI A;  1IYU A;  4DKA C;  1XMQ Q;  4OX9 Q;  1H9J A;  4CKC A;  4ILW A;  4HJ7 A;  1MD2 D;  1X3Q A;  4EX5 A;  1RDP D;  4YCU A;  2K52 A;  4QIW E;  1EEI D;  3DEO A;  5CR3 A;  4QY7 A;  4EQP A;  2B63 B;  1FL0 A;  3CQZ H;  3ND9 A;  3TBI B;  2ZM6 Q;  3J7A V;  3AU7 A;  1JOR A;  1G51 A;  2A73 B;  3KUP A;  1KD1 C;  2D62 A;  1QIL A;  3BJU A;  4RCN A;  4PQX A;  3VYU A;  1DJR D;  3QOL A;  1P16 A;  3J7Y W;  4A3I B;  3TS0 A;  4B3R L;  4CJ1 B;  1SE8 A;  3JAM L;  1K0S A;  2YYZ A;  4A3F B;  3K8A A;  3SK6 A;  4DK0 A;  2R7F A;  2E76 C;  1G6Z A;  1B70 B;  4HJ9 A;  1PRT D;  1GD7 A;  4OHJ A;  1EQV A;  1HQM C;  1EYA A;  4JI3 L;  2KVM A;  2MQH A;  3K5O A;  4B3S Q;  4C2M H;  1NR4 A;  2PI2 A;  5IOD A;  1RHP A;  5M5X B;  2HHH L;  1CKO A;  4A3J H;  2F0N A;  3PIO 3;  3AFQ A;  4GOP B;  2JA7 G;  2TMP A;  2F3I A;  4P74 A;  1FGB D;  2IX1 A;  1EOT A;  5KYI A;  2K50 A;  1SYE A;  2IHE A;  2FXQ A;  1U4M A;  2B3G A;  3ONA B;  3ULP A;  1J8I A;  1GUO A;  1TWC H;  2VQE L;  5HY6 A;  4OIJ A;  3PUW A;  4DV2 L;  5C4Z A;  2KCM A;  5JJK A;  1STH A;  1L0W A;  1ET9 A;  2Z6K A;  3G71 A;  1LV9 A;  1ESR A;  2WAQ B;  3K7U C;  4OGQ C;  5FLX L;  1QB5 D;  3J7A 5;  5IYD H;  3L7Z C;  3WDN A;  1UWV A;  3HOX H;  3BDO A;  4CKB A;  1LTL A;  2B2T C;  2N55 A;  2R7Z B;  4R4O A;  3A5Z B;  5I4D A;  3LNN A;  1CKM A;  1R9T B;  4JI4 Q;  1O7Y A;  4LFC L;  1ZYR D;  3CC7 A;  3A5U A;  1AE3 A;  2VY3 A;  2F0E A;  4IPC A;  1S5C D;  1X3F A;  5JVH 3;  3L9A X;  1CA5 A;  2A68 D;  5COY A;  1FNU A;  1RD9 D;  2CCZ A;  3BVG A;  5CBE E;  2EYL A;  1RCV D;  1ICW A;  2Y0S G;  3DM1 A;  4BY1 H;  3I70 A;  2RCN A;  2UXD L;  4DA2 A;  4DAP A;  1W3S A;  1CI3 M;  4KJO A;  5EPJ A;  3PUY A;  2RKS A;  1PH5 A;  1EEF D;  1WTW A;  5AFW A;  2E2J B;  3OWF A;  1EY6 A;  3BVM A;  3SE0 A;  1JJC B;  2BDO A;  2AHO B;  3S24 A;  4QUF A;  3GTP B;  1CSP A;  2E2H B;  1VQP A;  1TWG H;  2QGQ A;  1QVC A;  1FNW A;  1EQQ A;  4KHP Q;  3EA6 A;  1ILP A;  4NW2 A;  1MI2 A;  2H5X A;  1DZ1 A;  4PG3 A;  2FMC A;  5ELN A;  1EY0 A;  3JAM E;  3MFY A;  3T1Y L;  4A3K H;  3HOU H;  2PZW A;  3DWP A;  3PIP 3;  5CV5 A;  5IGE A;  2ZJR A;  3KLS X;  3EBE A;  1FYC A;  3MFG A;  2DNC A;  4G7Z C;  2OQK A;  4DV0 Q;  1SR3 A;  1O7Z A;  1QG7 A;  3GTQ B;  2MGS A;  4YCW A;  4DV7 L;  2JA6 H;  3S1Q H;  3IFT A;  3A74 A;  2EPB A;  1S40 A;  2YU9 B;  4DR7 Q;  3D4D A;  3G48 A;  1LAB A;  3TP6 A;  3P20 A;  1WTH A;  4K0K L;  3HOY H;  1EWI A;  4HJ5 A;  1WTO A;  1R4P B;  2P5Z X;  3K80 C;  1VQ4 A;  1PFS A;  1DXM A;  3T53 B;  1E7Z A;  1JJG A;  1UAP A;  2NN6 H;  1VQ8 A;  3S16 B;  2KQ3 A;  4XYQ A;  1WTV A;  5IE8 A;  4RWS C;  4IFD H;  2Z9H A;  1EIG A;  3EQL C;  5C4H A;  4JV5 L;  3TME A;  3UE0 A;  3HKZ B;  5FLX E;  1PZJ D;  4P75 A;  3KBX A;  1SMY C;  5C0X H;  1Q12 A;  3PO3 B;  3V2T A;  3NEM A;  1VQH A;  3RZO H;  1PYW D;  1II3 A;  2Q8T A;  5C44 H;  2IPK D;  2EY2 A;  4J15 A;  2EY5 A;  2Y0S B;  5LMN W;  1RTN A;  4GLX A;  3CQZ B;  1ZEQ X;  3X3M A;  4C3I G;  4JBW A;  2MNA A;  3GTK H;  1FD7 D;  2B2U C;  1YJN A;  3I72 A;  2ENB A;  3VR2 A;  3NHH A;  2R92 G;  2QW7 A;  5CV8 A;  3LWE A;  4RKL A;  4DV1 L;  1XPR A;  1YIT A;  4GKK Q;  2RVL A;  1ICF B;  2MO1 A;  3MTS A;  3DUZ A;  3PO2 H;  5KYL A;  2PNR C;  5E7N A;  3U9O A;  3GTG H;  2B2T A;  3H3V I;  4TVA B;  3UI2 A;  1K3B C;  4HIM A;  1PTO H;  5C3E B;  4HN7 A;  1EZ8 A;  3JAM i;  4QGU A;  4JC0 A;  1LLR D;  4C2M B;  1M1K C;  1IKL A;  2LXJ A;  2ZTE A;  1ASZ A;  2OT2 A;  4TQU S;  2KBN A;  2B2Y C;  1PRT C;  2NTS A;  4DR5 L;  1ROD A;  1A3V A;  3FDT A;  3KDF B;  5E4W C;  2J7Z A;  1D1I A;  3P1H A;  2E8G A;  2VW9 A;  4JCV E;  1LT3 D;  2JA8 G;  1PV4 A;  2A5H A;  2WAC A;  3MHB A;  3LX0 A;  4IUV A;  4A3B H;  2OTJ A;  1KNE A;  1GUW A;  3RZD B;  1TWH H;  2MP1 A;  1NUC A;  3GDE A;  1Z6H A;  4B3R Q;  4KN7 C;  3E6Z X;  1B2T A;  1WTX A;  2IY5 B;  4YWK A;  1YHA A;  4KD4 A;  4LW1 A;  2K4K A;  2VUM G;  2M2L A;  3CPF A;  1B3Q A;  4BBS G;  1PVO A;  4JI5 L;  4IAL A;  2KEE A;  4QCL A;  3HOW G;  2F0Q A;  3HG9 A;  3FVQ A;  4C3J H;  4RGM A;  2QKI C;  3OMC A;  1EYC A;  4G57 A;  5JPM C;  2HT1 A;  4FNF A;  5IP7 G;  2HHH Q;  2RDF A;  2WAQ E;  1K8A C;  1V1P A;  1T9H A;  1EWC A;  2IW3 A;  3QB3 A;  1D5M C;  3EJI A;  2EZV A;  5M5Y H;  1V8Q A;  2F1M A;  5T1G A;  4ZKC B;  1OXX K;  3D3R A;  5EPL A;  3H3V H;  1X55 A;  2E75 C;  3TSS A;  4B3T Q;  2LXK A;  5D3D A;  2HDL A;  1U0L A;  1VCI A;  3I8Z A;  3QOJ A;  3I7F A;  4C3I B;  3K5L A;  1SN8 A;  3GV6 A;  3QR8 A;  5J1Z A;  3GD7 A; 
#chains in the Genus database with same CATH homology
 4IOA A;  2UUC Q;  5IYD G;  1JB7 A;  1HH2 P;  2Q2H A;  4JYA Q;  4HIO A;  4UY8 C;  2ASB A;  2K5N A;  3TQY A;  3HOX G;  1KC8 C;  3CC2 A;  4DR2 L;  1MKH A;  4LF7 Q;  2A19 A;  4A3G H;  2E2J H;  1P8L A;  1Q86 C;  4DR7 L;  3ULL A;  3TRZ A;  5M3M G;  1TXY A;  2CWA A;  5LMU Q;  4A3D G;  4GNX A;  1EQR A;  3KF6 B;  2E2H H;  3UDX A;  2Z6K C;  5C4J H;  2MFI A;  2PMZ E;  4A3F G;  1VQ9 A;  3I4O A;  1A0I A;  2L15 A;  2V1C C;  1GKH A;  3FKI H;  3RZD H;  4LF4 L;  4A93 H;  3BU2 A;  3AQQ A;  4LFC Q;  2JK8 A;  2K14 A;  2D0P A;  4X64 L;  3OYY A;  3D0F A;  3CD6 A;  3BZC A;  1YJW A;  1IZ6 A;  2OWO A;  4DR1 Q;  1QVF A;  3U58 A;  1HR0 Q;  1SMX A;  4KLK A;  4X66 L;  4QQB X;  1NMF A;  1VQC A;  4BY1 G;  5ELO A;  4FDB A;  5JEA J;  4AH6 A;  2ID0 A;  4DV4 L;  1OXV A;  2N49 A;  1LUZ A;  4NPS A;  3H0G G;  4A76 A;  1JE5 A;  1IL2 A;  4IOC A;  1Y1W G;  3PUZ A;  2NZH A;  3W5O A;  2ZTC A;  4JOI C;  4QL5 A;  3STB C;  2UU9 Q;  1YHQ A;  1EUJ A;  1UE7 A;  1I6H H;  5GRO A;  4ME3 A;  2F52 A;  4R4Q A;  3CC4 A;  1XNR Q;  1GVP A;  2QA4 A;  2YU9 H;  2R6G A;  3PF4 A;  2VQF L;  5IYB H;  3RN5 A;  1A63 A;  1NE3 A;  3HOV H;  3CCL A;  2D0O A;  3T1H Q;  1LYL A;  1VQG A;  4YHH L;  1OTC A;  1J5E Q;  4JBM A;  2BA1 A;  1WCM H;  2NVQ H;  4IFD J;  4IJH A;  4JI8 L;  3F1Z A;  4L5S A;  2ZJQ A;  2EIF A;  4DK3 C;  1A62 A;  2RF4 A;  2XGT A;  4OON A;  1N36 L;  3S1M H;  4DUZ Q;  3KJO A;  1A8V A;  2UUB L;  4JOI A;  1Q1E A;  1XMO Q;  1L1O A;  3I2Z A;  4LFA Q;  4JI2 Q;  4A3K G;  4LF9 L;  1YNX A;  1HNZ Q;  4P72 A;  4C3I H;  1VQE A;  4DV3 L;  1XTD A;  1SRO A;  4JI0 L;  4AQY L;  4LUZ A;  1N9W A;  3NEL A;  3PUX A;  1IBL Q;  5C0X J;  3H15 A;  3GO5 A;  4XTC S;  3M4Q A;  4NXM L;  2B29 A;  4LF5 L;  4JI1 Q;  3CCR A;  3CME A;  1HR0 W;  1PH4 A;  1PA6 A;  1JJ2 A;  3T1Y Q;  1PYS B;  2OTL A;  4XIG S;  1HNW Q;  4A3M G;  1GM5 A;  4YY3 Q;  2VS1 A;  2DGY A;  4DUY L;  2NN6 I;  1VQK A;  1CUK A;  1E24 A;  4JI5 Q;  3ICE A;  1NJI C;  2JA6 G;  1VS0 A;  1D8L A;  4LUO A;  4DAM A;  1K9M C;  5JJI A;  4DKA C;  5M3F H;  1XMQ Q;  4OX9 Q;  2EQS A;  4HJ7 A;  4DV6 L;  4IFD I;  4POF A;  5JEA G;  1N32 Q;  4R4C A;  4EX5 A;  4JI6 L;  3HOU G;  4YCU A;  4O2D A;  4PZ8 A;  2K52 A;  2VZA A;  4QIW E;  3HOY G;  1Q82 C;  4DV7 Q;  1PH8 A;  5FLM G;  1G6P A;  4QY7 A;  3GTL H;  1FL0 A;  4BXX G;  2CKZ B;  2UXB L;  2PI2 E;  4Y7N H;  2PQA A;  5C0X I;  1G29 1;  3J81 c;  3CQZ H;  3HKZ E;  1FJG L;  4IO9 A;  4BBR H;  1PH2 A;  1FVI A;  4LF6 L;  5H1S E;  4K0K Q;  3AYH B;  5FJ8 H;  1BVS A;  2ALY B;  2RHQ B;  2ZM6 Q;  2N78 A;  1IBM L;  1G51 A;  3VDY A;  1KD1 C;  1VQ6 A;  4NB3 A;  4BA2 I;  2NN6 G;  1EIY B;  1SLJ A;  1QZH A;  1Q8K A;  2D62 A;  3J80 c;  3BJU A;  1TWA H;  4IFD G;  3GTO H;  4A4I A;  2A1A A;  3M9B A;  1P16 A;  2Y0S E;  1BKB A;  3TS0 A;  4BY7 G;  4B3R L;  2JA8 H;  3RLN A;  3B6Y A;  1SE8 A;  4P71 A;  2UXC L;  2LSS A;  2YYZ A;  1K8G A;  3K8A A;  4A3L G;  2R7F A;  3CP0 A;  3UDF A;  4OWT B;  4GS3 A;  5C0X G;  3BZK A;  4JV5 Q;  4JBJ A;  1PH7 A;  1B70 B;  4A3E H;  4DR2 Q;  2B63 G;  4HJ9 A;  3JC6 6;  1IBK Q;  5HGQ A;  5C44 G;  1GD7 A;  3PIO A;  3J80 i;  1GO3 E;  3F2D A;  2VUM H;  4OO1 I;  4IPD A;  5GAE C;  3KYH C;  4JI3 L;  1K83 H;  1RL2 A;  2KEN A;  2MQH A;  4C2M H;  4B3S Q;  2UUA L;  4BBS H;  1X9N A;  1JMC A;  4JI7 Q;  4MNO A;  3CPW A;  3K0X A;  2PI2 A;  3KOJ A;  5GAH C;  2DUD A;  2HHH L;  1KIX A;  3HOW H;  1CKO A;  3UDI A;  3KJP A;  5C4X G;  4A3J H;  1XPO A;  5IWA L;  2WP8 J;  2NVT H;  1K3R A;  1UE5 A;  2VNU D;  5LMN L;  3AFQ A;  3FP9 A;  3U4V A;  5AJ3 Q;  4GOP B;  4A3I G;  2F3I A;  2JA7 G;  1VQ5 A;  5JJL A;  4P74 A;  2IX1 A;  1QUQ A;  4DK6 C;  4UP8 A;  5IP7 H;  2F4V Q;  2K50 A;  1I3Q H;  1N33 Q;  2IHE A;  4OXP A;  3M7N A;  2FXQ A;  4X6A H;  5BR8 L;  4OWW B;  2B3G A;  4X66 Q;  2JEA I;  1Z47 A;  2YTV A;  4R1J A;  3ULP A;  2OCE A;  1Q46 A;  1TWC H;  2VQE L;  5HY6 A;  3CCQ A;  3NBH B;  4DV1 Q;  3I4M G;  3HOZ G;  3PUW A;  4DV2 L;  4DR3 L;  3PO2 G;  2Q2I A;  3PF5 A;  1KQS A;  1HNX Q;  1X54 A;  3KLW A;  4X65 L;  1SRU A;  1KXL A;  2KCM A;  4IPG A;  4LWC A;  2JJQ A;  5JJK A;  3MXN B;  2I5M X;  4DR6 L;  4Y52 H;  2QEX A;  1L0W A;  3W1G A;  4AYB E;  4DR4 L;  3LGJ A;  4HIK A;  2UUC L;  1X6O A;  1HZB A;  4LFB Q;  4GNX B;  4JYA L;  2Z6K A;  3G71 A;  3TEH B;  1XJV A;  2R93 H;  1VQI A;  2VQF Q;  4GN3 B;  3K7U C;  4MZ9 A;  4LF7 L;  4R4I A;  1B7Y B;  2PNH A;  3J7A 5;  1FGU A;  1CSQ A;  2KHI A;  5LMU L;  3L7Z C;  5IYD H;  3ERS X;  2JA5 G;  4BA1 I;  3UDG A;  1UWV A;  3EN2 A;  3HOX H;  3RLO A;  5GAD C;  2E5L L;  1WI5 A;  1UE6 A;  1LTL A;  4DAY B;  4DR5 Q;  5M3M H;  4R4O A;  3A5Z B;  4LF9 Q;  3RR5 A;  4JI0 Q;  1E1T A;  3NEN A;  1CKM A;  4JI4 Q;  3U50 C;  4LFC L;  1PHJ A;  1YI2 A;  1Y1V G;  3U4Z A;  3J81 j;  3CC7 A;  3A5U A;  3I4N G;  4KHZ A;  1AE3 A;  3S2D H;  3PGZ A;  4LF5 Q;  2VY3 A;  1K0R A;  4IPC A;  1MJC A;  3FHW A;  2GVB A;  4DR1 L;  4A3F H;  1C7Y A;  3KDF A;  4H02 A;  1X3F A;  3ZJY C;  3DLL A;  1VQF A;  1MJE A;  2Q2U A;  1X3G A;  4DUY Q;  2VL6 A;  2IT1 A;  4X62 Q;  5IT9 c;  3M85 A;  1Q1B A;  2WAQ G;  4GKJ Q;  4NXN Q;  2CCZ A;  1XPU A;  2KCT A;  1VQN A;  4GKK L;  4DV5 Q;  3SGI A;  1WFQ A;  2Y0S G;  3CCU A;  1QZG A;  2CFM A;  2ZTD A;  1XNQ L;  3K81 C;  4BY1 H;  2UU9 L;  1D7Q A;  4UPA A;  2NVX H;  4UP7 A;  2Q2T A;  3GTJ H;  1HZ9 A;  2RCN A;  2UXD L;  1W3S A;  3DM3 A;  3H0G H;  1I94 Q;  1OXU A;  1Y1W H;  4L5R C;  2R7Z G;  3PUY A;  1PH5 A;  1EYG A;  4APV A;  1NTG A;  1VQJ A;  1V1Q A;  1KRT A;  3T1H L;  5IP9 G;  1L1O B;  1YBY A;  1JJC B;  2AHO B;  3S24 A;  1X65 A;  1CSP A;  4PZ7 A;  4AIM A;  1VQP A;  1TWG H;  1Y14 B;  4DUZ L;  2QGQ A;  3GTM H;  1QVC A;  3PIP A;  1XMO L;  1QVG A;  1EQQ A;  2E2I H;  4JI2 L;  4KHP Q;  4B3M Q;  1HNZ L;  4A3C G;  3CCV A;  4A75 A;  4IJL A;  4A3D H;  2H5X A;  2MO0 A;  1IBL L;  4PG3 A;  1UE1 A;  5ELN A;  4C3H H;  1J6Q A;  4JI1 L;  1MIU A;  1E22 A;  2EXD A;  3AFP A;  3STB D;  3L0O A;  1N34 Q;  1EIF A;  3T1Y L;  2HIX A;  4A3K H;  4LF8 L;  3HOU H;  4QJF A;  4YY3 L;  3OTO Q;  1N8R C;  2ATW A;  2ZJR A;  3EBE A;  3Q8D A;  1M90 C;  1CKN A;  2JA9 A;  1XMQ L;  4OX9 L;  2OQK A;  4DV0 Q;  2K5V A;  1SR3 A;  4A3G G;  4JI3 Q;  3J81 i;  4GOP C;  1YZ6 A;  4KI0 A;  1V43 A;  1N32 L;  1HZA A;  4A3M H;  2PQA B;  1YJ9 A;  1NMG A;  2I0Q A;  1AH9 A;  4YCW A;  4DV7 L;  1YEZ A;  2JA6 H;  1B8A A;  4AYB G;  3S1Q H;  1VQ7 A;  1HZC A;  3A74 A;  1S40 A;  4YCV A;  4DR7 Q;  3G48 A;  3CCE A;  3ULJ A;  5M5W H;  5J3B A;  4A93 G;  4LUV A;  5IP9 H;  4K0K L;  3HOY H;  1Q81 C;  1IYJ B;  1EWI A;  2ZM6 L;  4HJ5 A;  5FLM H;  2WFW A;  4YWL A;  3K80 C;  1SFO H;  1VQ4 A;  4JBK A;  1PFS A;  4LF4 Q;  1E7Z A;  2VQE Q;  3S17 H;  1LM0 A;  2GN5 A;  3PCO B;  3KF6 A;  4DV2 Q;  4GNX C;  3PUV A;  1JJG A;  5EAY A;  1U5K A;  4GN4 B;  4X64 Q;  4X65 Q;  3CMA A;  1VQ8 A;  2I5H A;  2WB1 E;  2HQL A;  3CCJ A;  3KF8 B;  5IE8 A;  3RNU A;  3CW2 C;  3F2C A;  4B3T L;  1OXT A;  4DV4 Q;  1EFW A;  5DLQ E;  1L2F A;  3F8T A;  1VQO A;  3G6E A;  4JV5 L;  3G4S A;  4BY7 H;  3UE0 A;  1BBU A;  4WJ4 A;  1KL9 A;  4GLA C;  5IYB G;  1IBK L;  3HOV G;  4A3L H;  1VQL A;  1WYD A;  4P75 A;  4P73 A;  4B3S L;  1PH9 A;  3I56 A;  1Q12 A;  1WCM G;  4JI7 L;  3GTP H;  1V9P A;  1C9O A;  2K75 A;  2E5L Q;  2JEB I;  1K73 C;  2B63 H;  3M3Y H;  2IHF A;  1VQH A;  3NEM A;  1ASY A;  1QUQ B;  3RZO H;  2CQO A;  5C44 H;  2I5L X;  2NVY H;  4J15 A;  1O7I A;  5LMN W;  4YHH Q;  1IXR A;  4GN5 A;  4GLX A;  4BXX H;  2OQ0 A;  4OO1 G;  5AJ3 L;  3D31 A;  1H95 A;  4JBW A;  4JI8 Q;  2NZO A;  2MNA A;  3L2P A;  3GTK H;  1N36 Q;  1YJN A;  1KHI A;  2JE6 I;  1VQD A;  2AWO A;  2F4V L;  1N33 L;  3J7Z C;  2UUB Q;  5C4X H;  4L5T A;  3K7A H;  4A3B G;  4DNI A;  2C35 B;  2R92 G;  4DV3 Q;  3JAM c;  2JA7 H;  1X3E A;  4A3I H;  4OWX B;  4DV1 L;  4AQY Q;  3IRB A;  4L5Q A;  3OW2 A;  1AE2 A;  1XPR A;  2Z0S A;  2XTI A;  3CF5 A;  1YIT A;  3I4N H;  1HNX L;  4NXM Q;  4GKK Q;  4WJ3 M;  3HKZ G;  3W1B A;  4LNQ A;  1TWF H;  5M3F G;  3S1N H;  1HR0 L;  2AMC B;  4JG2 A;  1EOV A;  2MO1 A;  5GAG C;  3GTQ H;  1XNQ Q;  3PV0 A;  3S14 H;  1L1O C;  3I4M H;  1RIP A;  3PO3 G;  3PO2 H;  3HOZ H;  3A0J A;  4LFB L;  2UXD Q;  5E7N A;  1WOC A;  5IYC G;  4IPH A;  3GTG H;  4DV6 Q;  3H3V I;  5GQO A;  2A8V A;  4TVA B;  3TS2 A;  4JI6 Q;  4HIM A;  1PH3 A;  1X56 A;  1W2B A;  2IX0 A;  1OXS C;  3WWV A;  4BBR G;  3S1R H;  3AEV A;  3JAM i;  4QGU A;  4JC0 A;  5M5X H;  5FJ8 G;  1M1K C;  3E9H A;  2YTY A;  2KHJ A;  4HJA A;  1E3P A;  2LXJ A;  1DGS A;  1S72 A;  2ZTE A;  1ASZ A;  4TQU S;  1XNR L;  2KBN A;  2UXB Q;  4DPG A;  4DR5 L;  1FJG Q;  4LF6 Q;  3KDF B;  1IBM Q;  2E8G A;  2JA5 H;  1HJP A;  2VW9 A;  4JCV E;  3CXC A;  3E0E A;  1J5E L;  2HIV A;  4JI4 L;  2K5H A;  2CWP A;  3MEF A;  3S16 H;  3CCS A;  2JA8 G;  3TRE A;  1PV4 A;  3S15 H;  2ZJP A;  4A3B H;  4LF8 Q;  2R92 H;  1E1O A;  3M4P A;  4PMW A;  4HJ8 A;  2OTJ A;  4LFA L;  2ES2 A;  1TWH H;  4X62 L;  1Y1V H;  3GDE A;  4A3E G;  1Q7Y C;  4GKJ L;  4NXN L;  4B3R Q;  1WJJ A;  2IY5 B;  4YWK A;  1NBW A;  1YHA A;  5C3E G;  4DV5 L;  1PH6 A;  3HKS A;  1Z9F A;  2K4K A;  4LW1 A;  2VUM G;  3CPF A;  2GVA A;  1HNW L;  1S3O A;  4R4T A;  3PO3 H;  5FLX c;  1YIJ A;  1YHB A;  4HID A;  2WB1 G;  4BBS G;  1PVO A;  4JI5 L;  3E9I A;  2N8N A;  5IYC H;  1PH1 A;  3M4O H;  3HOW G;  4A3J G;  1I94 L;  3EIV A;  4ALP A;  2UXC Q;  3ER0 A;  4C3J H;  2UUA Q;  4RMF A;  2AWN A;  5K36 G;  1VQM A;  2BH8 A;  2HT1 A;  5IP7 G;  2HHH Q;  1VQA A;  3F2B A;  5IWA Q;  1NY4 A;  4PZ6 A;  3RLF A;  2WAQ E;  1K8A C;  1BBW A;  2R7Z H;  2R7D A;  5LMN Q;  3FKI G;  1C0A A;  1T9H A;  1R9T H;  3CAM A;  4MTN A;  3PSI A;  4KHP L;  4B3M L;  4UP9 A;  2BA0 A;  5M5Y H;  3HFZ B;  4YWM A;  3CCM A;  1I5F A;  1JT8 A;  2JQO A;  5BR8 Q;  2BH2 A;  1OXX K;  1CKN B;  2N3S A;  4GOP A;  3RN2 A;  3H3V H;  1X55 A;  3UE1 A;  4B3T Q;  4EQ5 A;  1N34 L;  1VQB A;  2LXK A;  1UEB A;  4DR3 Q;  1U0L A;  1VCI A;  4A3C H;  2AKW B;  4O0A A;  2YTX A;  3I7F A;  1KRS A;  3OTO L;  4POG A;  3I55 A;  1SN8 A;  1I50 H;  2R93 G;  1YVC A;  1PYB A;  2RHS B;  1KAW A;  4DR6 Q;  3S2H H;  5C3E H;  3KFU A;  5IY0 A;  4DV0 L;  4GLV B;  4DR4 Q;  4RG1 A;  3GD7 A;  2YV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...