4B3RL

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rL00
1HZCA 4KLKA 5IYBG 5K36G 4DV4Q 1KIXA 1PH6A 2PNHA 1PYSB 1P16A 1VS0A 3BU2A 4JI3Q 3I4OA 1Q7YC 1MKHA 4UPAA 5M5YH 4R4IA 1S40A 2E2JH 4LF6L 3H3VI 2AWNA 5BR8L 2WFWA 1PH4A 3GD7A 2WB1E 2K50A 1LM0A 4K0KL 3KFUA 3H0GH 1KRTA 3RZOH 3S15H 1AH9A 4APVA 1B8AA 3PO3H 3A5UA 3CCEA 4A3CH 1VQLA 2BH2A 3GDEA 2BA1A 4WJ4A 4P74A 2D62A 3BJUA 3NEMA 3L7ZC 5IYDG 4HJAA 1QUQB 1JT8A 3EIVA 3HOZG 4LFCQ 3K81C 1CKNA 2AMCB 1VQIA 2Z6KC 1QVCA 3AYHB 3KF6B 4BBRG 3JAMc 1K73C 5FJ8G 3TS2A 1U0LA 2NN6G 3STBC 4R4TA 4DR7Q 4YWLA 1WFQA 3HKZG 5FJ8H 3CCQA 4JI6Q 1HZ9A 2YTVA 1KHIA 1VQEA 3J81j 4DV5L 1PH5A 2UXDL 4BY1G 4DPGA 2JA6H 1YNXA 1YJ9A 2VY3A 4POGA 1BVSA 1SRUA 2MFIA 1XNRL 3AEVA 2IY5B 2JE6I 3KJPA 2ZJRA 2QGQA 3ULJA 1XMOL 4P73A 1YBYA 2K14A 3KF8B 3RLNA 3T1HQ 1VQ9A 4IO9A 4A93G 1XMQL 4DR1Q 1I6HH 2R7ZG 5IP7H 1S72A 1VQ8A 2JEAI 3S2HH 2N49A 3M7NA 3NELA 3DLLA 1Q82C 3A74A 2B63G 4DR3L 4B3ML 4GNXA 1K8GA 3HOYH 2VQEL 4LUOA 2BA0A 3G4SA 1TWCH 3GTOH 2E2IH 1XJVA 2QA4A 3CD6A 4A4IA 3AFQA 4YY3Q 4X66Q 4IOAA 3J7ZC 4JI4L 2EXDA 4YHHQ 1XPRA 4IJHA 1NJIC 4NPSA 1ASZA 3I4NH 1BKBA 4DUZQ 2CCZA 2E5LQ 4A3DG 4DV4L 5JEAJ 4PZ8A 1EQRA 4HJ5A 2CFMA 5C4XH 1EUJA 4JI3L 3A0JA 3UE0A 1E3PA 3GO5A 1V9PA 4IPGA 1VQ4A 1E1OA 2KCTA 3L0OA 4GLVB 1ASYA 1OTCA 2MO1A 4JI1L 1NY4A 5FLMH 1YI2A 2VL6A 3PO2G 4LF6Q 4QIWE 5BR8Q 2VS1A 1LUZA 5C0XJ 4B3TL 3ER0A 3UDXA 3CC7A 4LFBQ 2PQAA 3I7FA 2K5NA 3PO2H 1L1OC 4K0KQ 2H5XA 2K52A 1IZ6A 3RN5A 1I5FA 2CQOA 4A3JG 2HT1A 4JYAQ 2Z6KA 2RF4A 3M85A 2UU9L 4QL5A 3K7UC 1K0RA 1Q86C 4C3JH 4OWXB 1EIFA 3F2DA 4LFCL 3S1MH 3RLOA 3EN2A 2XTIA 4JBJA 3AQQA 3KYHC 2R7DA 2YTXA 4HIOA 1G291 4A3KG 3CC4A 4LFAL 1TXYA 3ICEA 1PH8A 3HOWG 1SFOH 4JI6L 4KI0A 3CXCA 1YHAA 3UE1A 1X9NA 1HNZL 3GTKH 3HOXG 3G6EA 4DV1Q 1SROA 3I55A 4DV5Q 4KHPQ 5C3EG 2UXDQ 4HIMA 4O2DA 1KRSA 4GS3A 2ZJPA 4DR2Q 3TREA 2OWOA 5C3EH 4JI0Q 4GN5A 3T1HL 3CAMA 2K5HA 4NXNQ 4DR1L 1UE5A 2Q2TA 4R4CA 2R93H 2YV5A 1XMQQ 3IRBA 4DKAC 1GD7A 5IP9H 5M3MH 4GOPC 3TEHB 1KQSA 1E1TA 2JA5G 1UE7A 3FP9A 4DR3Q 2UUAQ 3DM3A 4DV6L 2PI2E 2E8GA 4X66L 4GNXC 3PUZA 2WB1G 4YHHL 4L5RC 2A19A 3PGZA 1A8VA 2NVYH 2JA6G 4MNOA 1TWHH 4YWMA 4DUZL 4JCVE 2R92H 2I0QA 4JI7Q 2NVXH 4XIGS 4LW1A 4JI5L 1QVFA 1E24A 4TVAB 2K4KA 1Q12A 1PA6A 3M4OH 3PUXA 1L1OA 4A3LG 2JK8A 4AIMA 3H0GG 4DV2L 1K8AC 4AH6A 4JI1Q 4AYBG 3PO3G 4LFBL 1KAWA 1Q8KA 1UE6A 4YCWA 4A3BG 3TS0A 4A3CG 2FXQA 1GO3E 2PQAB 4GLXA 3VDYA 4B3TQ 4A3LH 3CC2A 1VQFA 1A63A 2NN6I 4A3BH 4BY7G 4LNQA 1WJJA 5C44H 3PV0A 3I4MH 4JYAL 1EQQA 4QY7A 1GKHA 1EYGA 4A3GG 4BY7H 4H02A 4OO1G 2RHQB 1AE2A 3PUWA 2YTYA 1QZGA 2UU9Q 3CCLA 4A3GH 1PVOA 1VQKA 1XNQQ 2QEXA 1JJ2A 1IXRA 3PUVA 3OW2A 1K3RA 1V1QA 2V1CC 4JC0A 4R4OA 3J80i 4LFAQ 1HR0L 3HOUH 2AHOB 3KLWA 4Y7NH 1PH7A 4A3EG 1SMXA 4DV1L 5GQOA 1HNZQ 3GTMH 4KHPL 3J81i 1FGUA 2D0PA 1HJPA 4A3EH 2IX1A 2JA8H 5E7NA 2UUBQ 4DR2L 4JI0L 2ZTDA 4NXNL 1UWVA 1UEBA 2HQLA 2Z0SA 3M4QA 4JG2A 5IYCH 2VQFL 1RL2A 5JEAG 4GOPA 5IP7G 1Y1WH 4UY8C 3HFZB 1V43A 5FLXc 3H3VH 1YJWA 1SE8A 1N34L 1I3QH 4JI8Q 4LF5L 1QVGA 3U58A 1TWGH 2YU9H 4BXXH 2N3SA 5GAGC 5LMNW 4HJ8A 3HOYG 3MXNB 5IWAL 2DUDA 2UUAL 4L5QA 5C0XG 1NE3A 1W2BA 2UUCQ 4IFDG 2IX0A 4LUZA 3SGIA 4C3IH 5LMNQ 4DV6Q 1I94L 2ASBA 1VQHA 1VQCA 1VQNA 5IT9c 4RG1A 1PV4A 4PZ7A 1O7IA 2CKZB 3RR5A 2PMZE 3MEFA 3I4NG 2UXCL 1Y1VH 3STBD 4JI7L 4TQUS 5C4XG 2IHEA 5JJLA 1SN8A 4ME3A 4LF8L 1Z9FA 3K7AH 1XPOA 4JI5Q 5FLMG 4DV0L 4J15A 2L15A 3H15A 2KENA 3OYYA 3CF5A 1L1OB 1X54A 3PF5A 2Y0SE 4FDBA 4UP8A 4DV2Q 1VQPA 2Q2UA 4OXPA 4IFDJ 3K8AA 1VQ7A 5LMUL 1D8LA 3PIPA 4BBSH 1VQAA 2GVBA 1N8RC 3UDGA 3S17H 2A1AA 3AFPA 2GVAA 1IBKL 2MO0A 1XNQL 2JEBI 1HNWQ 3CCMA 1IYJB 3OTOL 1HR0W 1YIJA 1CKNB 1JMCA 2ALYB 4NXMQ 4R4QA 3E9IA 2OTLA 1KL9A 1HZBA 2ATWA 1J5EQ 1I50H 4GKJL 1HR0Q 1Q1BA 1CUKA 2R7FA 3CPWA 3PF4A 2E2HH 4DR4Q 1YVCA 4GN3B 4IPHA 2UUBL 2JA9A 2NVTH 1E7ZA 3G48A 1CKOA 2WAQE 1XTDA 3GTQH 4B3SL 3ULPA 2R93G 4HIDA 4JOIC 4GOPB 1PH1A 2VQFQ 4OWWB 2EIFA 4JI8L 5IP9G 1Y14B 3B6YA 5M3MG 4X62Q 3S1RH 1N32L 3UDIA 5GROA 1OXSC 1YZ6A 1N34Q 1EIYB 3U4ZA 2OQ0A 1GM5A 2XGTA 4DUYQ 3E0EA 3CCVA 1JB7A 4LF5Q 4POFA 4AQYQ 2UUCL 1Q81C 4YWKA 5H1SE 4GNXB 5IWAQ 5LMNL 1MIUA 1YHQA 1M1KC 4WJ3M 1M90C 1L2FA 3CMAA 3CPFA 4B3RL 1I94Q 2KCMA 3K80C 4C2MH 1YITA 1D7QA 1J6QA 1W3SA 1BBWA 2OQKA 2ZTCA 2R92G 1WCMH 4GKKQ 1IBLQ 2I5LX 2UXCQ 1P8LA 4YCVA 2JJQA 1L0WA 1C0AA 2JA7H 3HOVH 1B7YB 4L5TA 3W1BA 3M3YH 2F52A 3D0FA 3FKIG 3K0XA 2MNAA 3EBEA 4A3FH 4OX9L 4LF8Q 1LYLA 1X3FA 3FKIH 1Z47A 4DV0Q 4JV5L 2RHSB 4O0AA 2YYZA 4OO1I 1B70B 3TRZA 1WI5A 3E9HA 4LWCA 2NZOA 3NBHB 5C44G 1NMGA 3I4MG 1WOCA 2NZHA 4A3IH 1YEZA 2MQHA 5LMUQ 4JBKA 4DR5Q 2VUMH 4BA2I 2BH8A 4R1JA 1NMFA 4GLAC 4X64Q 2PI2A 4DAYB 1VQMA 5AJ3L 1OXTA 3U4VA 4A3MH 1HNWL 3CMEA 3M9BA 5GAEC 1IBKQ 2UXBQ 4LF7L 4NXML 1YHBA 5DLQE 1S3OA 3OTOQ 4EQ5A 5IYBH 3HOUG 2GN5A 3KJOA 4P71A 1J5EL 3BZCA 3CCJA 2DGYA 2JA8G 1N36Q 4DR4L 4GKJQ 1AE3A 5IY0A 1VQBA 4JOIA 5IYCG 1IBML 1HNXL 1R9TH 1Y1WG 3KDFA 3S2DH 3J7A5 5C0XI 1CSQA 1SR3A 4IFDI 4PMWA 4BXXG 4B3SQ 4X62L 1X56A 4RMFA 4OWTB 1FL0A 1QZHA 2D0OA 4JI2Q 5IYDH 2KHJA 4DUYL 4DR6Q 1N32Q 3KOJA 2ZM6Q 1VQ6A 1A62A 4AQYL 3HOZH 4HJ7A 4AYBE 2OCEA 1NBWA 3D31A 5ELOA 4BBRH 3G71A 4A76A 1N33Q 1RIPA 2ZJQA 3LGJA 1T9HA 3ULLA 2K5VA 4QQBX 2A8VA 4Y52H 4HJ9A 3NENA 2Y0SG 4B3RQ 1Y1VG 4DK6C 2HIXA 2F4VQ 4GKKL 1IBLL 4IPDA 1GVPA 3PCOB 4BY1H 4JBMA 1K83H 4X65Q 4DK3C 4DV3L 1UE1A 2I5HA 3GTLH 3BZKA 3S16H 1Q1EA 2HHHQ 3S1QH 3PUYA 1NTGA 3S24A 1KC8C 4DV7Q 1C9OA 1X55A 4LF4L 1C7YA 2IHFA 3HKZE 3PIOA 1KXLA 4C3HH 1JE5A 1HZAA 1TWFH 4A93H 4OX9Q 3F2BA 2R7ZH 2OTJA 1G6PA 4QGUA 4UP7A 2KBNA 3T1YQ 2WP8J 4JV5Q 3S1NH 2B63H 2HIVA 1A0IA 4BBSG 3ERSX 4LF9Q 2VNUD 3A5ZB 3M4PA 5M5XH 3Q8DA 1VQDA 2AKWB 4DR5L 1X65A 2EQSA 3TQYA 1H95A 4X64L 3S14H 3FHWA 4IPCA 3RN2A 2R6GA 1FJGQ 3CP0A 5J3BA 3J80c 1MJCA 1YJNA 1FVIA 2UXBL 1VCIA 1WYDA 2WAQG 5AJ3Q 4HIKA 2C35B 2I5MX 4EX5A 1PH9A 5JJKA 5HGQA 1OXVA 2LXJA 1LTLA 1Q46A 3W5OA 3J81c 4LF7Q 4A3DH 4X6AH 2RCNA 4BA1I 5GADC 3ZJYC 3L2PA 2F3IA 4UP9A 5GAHC 4YCUA 2Q2IA 3HKSA 1N36L 2ID0A 5JJIA 3F8TA 1KD1C 2ES2A 1JJGA 5IE8A 1OXXK 2AWOA 1VQJA 1IBMQ 5EAYA 1E22A 3W1GA 3KDFB 1VQ5A 1HNXQ 4MTNA 4PZ6A 1BBUA 1TWAH 4A3JH 1QUQA 2CWPA 3I2ZA 2B29A 3GTJH 2IT1A 4KHZA 4JI2L 3F1ZA 4PG3A 2VW9A 4DR6L 2ZM6L 3RNUA 4IJLA 3KF6A 3U50C 4L5SA 2NVQH 4IOCA 4JBWA 4DR7L 1N33L 1OXUA 1CSPA 1CKMA 4P75A 4A3KH 3UDFA 4XTCS 3HOWH 3CW2C 4DNIA 2KHIA 1DGSA 1EWIA 2K75A 1MJEA 1PH2A 2CWAA 1X3EA 2N8NA 3F2CA 1WCMG 3JAMi 2F4VL 1K9MC 4X65L 3HOXH 2LXKA 3PSIA 4GN4B 1EFWA 5M5WH 1VQOA 1IL2A 2JQOA 4A75A 1XNRQ 2HHHL 1G51A 4P72A 4DV3Q 1VQGA 1PH3A 2JA7G 3HOVG 1U5KA 1EOVA 1XMOQ 4DV7L 4A3FG 4ALPA 3GTPH 3WWVA 3CCUA 1SLJA 5ELNA 3JC66 4LF4Q 3CCSA 3T1YL 1PHJA 5M3FG 1XPUA 3GTGH 5HY6A 1PFSA 4B3MQ 3CQZH 5M3FH 1N9WA 2N78A 4LF9L 4A3IG 4QJFA 2JA5H 2VQEQ 2VUMG 3RZDH 1X6OA 2LSSA 2ZTEA 4YY3L 3RLFA 1X3GA 4MZ9A 1JJCB 1FJGL 4DAMA 5C4JH 4LUVA 2VZAA 4A3MG 1HH2P 3CCRA 4JI4Q 2E5LL 3I56A 4NB3A 4OONA 1PYBA 2B3GA 2Q2HA
chains in the Genus database with same CATH superfamily
1HZCA 3QO2A 2RCFA 3NTHA 4HSPA 1SSOA 1PYSB 4K8JA 1STHA 2E2JH 4LF6L 5BR8L 3GD7A 2WB1E 4K0KL 1XYIA 3RD4A 3PMFA 4ABNA 1VMPA 4OGQC 2D62A 3BJUA 5IYDG 1STAA 4HJAA 1JT8A 3CRKC 2EY1A 3K81C 3K7AB 2F0MA 2ZXPA 2DJGC 1VQIA 3KF6B 2B2WC 1HXYD 2NN6G 2CW0C 1WFQA 5D65A 2FMMA 4WJWA 3CCQA 2YTVA 1VQEA 1EZ6A 2UXDL 1XXGA 2RSOA 4QF4A 1SRUA 5LL6X 5BN3A 1I4XA 3ULJA 5IODA 4P73A 1ONLA 3EQLC 1VF5C 1LLRD 2CH4W 1I6HH 2R7ZG 1CZGA 3NELA 2PZUA 3DEPA 2KA7A 1AZQA 3MEHA 1JQYD 3CHBD 2LY7A 5C0XH 4IFDH 1JOQA 1SYEA 3AFQA 3GTQB 3K6OA 4JI4L 2EXDA 5IGCA 1NJIC 4NPSA 5FKAC 3I4NH 3T53B 1BKBA 4DUZQ 2CCZA 4DV4L 4PZ8A 3A7LA 2CFMA 1QCBD 2DN8A 2IPKD 1SNMA 5K5PA 3A0JA 3SDZA 4IPGA 4ZYSA 1YI2A 3O13A 4L6TB 4CKEA 1LUZA 5C0XJ 3NBHA 3I7FA 4BWGB 2K6AA 4TSSA 2K52A 1B50A 1CTMA 2NVYB 2CQOA 2PPBC 4DAYA 2UU9L 3K7UC 4EVOA 2PZTA 4IUPA 3BDOA 3SK5A 3AQQA 3KYHC 2YTXA 3CC4A 3M4YA 4A3KG 1RCVD 1TXYA 1PH8A 1SFOH 4JI6L 5DAUA 5EPJA 2ZXOA 5KRUA 3GTKH 3HOXG 3I4LA 4A3IB 3I55A 1NCVA 5C3EG 2EJMA 4HIMA 5IGBA 2OWOA 3TREA 3BYTB 5C3EH 1KTKA 3BG3A 1HHVA 2XN9C 1SNCA 3NQTA 4K14A 4UHVA 1WD0A 2YV5A 3SK8A 1GD7A 5IP9H 4NMZA 3NTIA 4DR3Q 3DM3A 4DV6L 3K58A 2A6ED 3C1EA 1F2MA 2P5ZX 3PUZA 2WB1G 3IKJA 4ZAIA 1EFID 2NVYH 2JA6G 3MZ5A 1ESRA 4XIGS 1PTOD 3D6WA 4LW1A 1I4QA 4DNTB 5JVG3 1GJXA 3OHXC 1E24A 1C4QA 2K4KA 1Q12A 3M4OH 4A3LG 3HKZB 4XQJA 2FMCA 4JI1Q 2N55A 4A3LH 3TS0A 4B3TQ 3CC2A 1VQFA 4BY1B 3EFXD 1O7ZA 3MFYA 1RF2D 5IGGA 1SE4A 1D5ZC 4QY7A 3S16B 3S1QB 1GKHA 4OO1G 2RHQB 3MXUA 1RTNA 3CCLA 4JPBW 4C3HB 1TWFB 1TKWB 2QEXA 4X3KA 4KKUA 5KEEA 1XNQQ 1STGA 4H0LC 4C1NK 2F0DA 1V1QA 2V1CC 5ISRA 1SJED 3HG9A 2KJXA 1SMXA 5GQOA 1FGUA 2IWHA 1HJPA 4I65A 2AQ2B 5KNDA 2UUBQ 2XWBB 4N8X1 1UEBA 2Z0SA 5IYCH 1LV9A 1Y1WH 5IP7G 3IFDA 2WAQB 1SE8A 4BXXH 4X3SA 4LF5L 1QVGA 5COYA 1TWGH 5GAGC 4HJ8A 1KABA 2DUDA 3MFGA 2NB0A 3FMCA 1NE3A 3ONAB 1VQHA 1ENFA 1VQCA 1J8IA 3BVGA 1O7IA 2CKZB 4PZ7A 2PMZE 3MEFA 3K5LA 5CV6A 3JAML 1UUPA 4RKLA 3OW7A 1B44D 1DZ1A 3H6MA 5E4WC 4IURA 4RCNA 1A2TA 1XPOA 4DV0L 1BUVT 4F87A 1X54A 3PF5A 3OSOA 4KD3A 4UP8A 1D5XC 1EY6A 1DOKA 5LMUL 3WOEA 2EYOA 3PIPA 4BBSH 2GVBA 3V96A 1SYBA 1IL8A 5A2QL 2E75C 1E0BA 5I4DA 5FOBB 4K2LA 2K32A 3GTPB 2MO0A 2K5QA 1HNWQ 3OTOL 1LTID 5C6AA 1MGSA 5EPLA 3E9IA 1KL9A 1A3UA 2ATWA 4U68A 1LT6D 4OEMB 1HCZA 4K5WA 3G48A 4A3MB 4OWWB 1K28A 4MTKA 2PO4A 5GROA 1OXSC 1YZ6A 3R2TA 3U4ZA 2F0LA 3RUZA 4CDDC 3NSWA 2DY8A 4AQYQ 1II3A 2UUCL 3Q24A 1MIUA 3CMAA 2BOSA 3PO3B 4FF3A 1I94Q 3K80C 1YITA 1R9TB 1S5FD 1LTAD 1W3SA 1WCMH 1XX8A 1EIGA 1C0AA 3M3YH 3W1BA 2HD3A 1JWSD 4KJNA 4X3TA 4A3FH 5KGUA 1BQQT 1Z47A 3RMHA 1PTOF 2RHSB 4KHVA 4KKSA 3I3CA 3D4DA 3MTSA 3NBHB 5EQ0A 3JAME 5C44G 2XWJB 2MQHA 4JBKA 2VUMH 2BH8A 3SR1A 4DAYB 1VQMA 1K8OA 4A3MH 3CMEA 3DHQA 1IBKQ 1S3OA 1J5EL 4R8NA 5A2QE 3GTOB 1XWEA 5IGFA 4MHEA 3QB3A 1HNXL 1R9TH 3S2DH 1CSQA 4ZKCB 3P20A 1X56A 3D3RA 2FINB 1ILQA 2B2TC 1LT3D 4OL7A 5EKIA 3M7GA 1DM0B 1BO0A 4DUYL 2ZM6Q 1VQ6A 3HOZH 4RGMA 2DY7A 3D31A 4A76A 4C3IG 3ULLA 3PO2B 1PZKD 2A8VA 4HJ9A 1SYFA 3L3OC 1FR3A 1Y1VG 4DK6C 2HIXA 4GKKL 1IBLL 3AB9A 5I2YA 1JC7A 1UE1A 4C3JB 3GTLH 1EU3A 2F3VA 3KLSA 2K5WA 2HDLA 1C7YA 4DK1A 1KXLA 1V1PB 1JE5A 5D14A 2G9HD 2OTJA 1G6PA 3T1YQ 1ENCA 3S1NH 4JV5Q 5ELEA 1FNUA 5F2DA 4LF9Q 2VNUD 5M5XH 4IPCA 2F0IA 3CP0A 1X3QA 2IL8A 2BDNA 1VCIA 3TMEA 2E74C 4EX5A 1PH9A 5M3MB 1Q46A 4A3DH 4LF7Q 4BA1I 3ZJYC 1D1IA 5NUCA 3CQZB 2M00A 5IT9L 5GAHC 1ZXTA 3IFTA 3QOLA 1JJGA 3D6CA 1IBMQ 2A6EC 2K7VA 2XRSD 4MTNA 2B2WA 3SVMA 4HN7A 1IYUA 2HQEA 2SDFA 3KF6A 4F88A 1OXUA 1CKMA 1PTOC 3HOWH 1MJEA 2KHIA 2JYOA 2F4VL 3I4MB 3Q0AA 4X65L 2LXKA 4XT1B 4TRDA 2HDMA 2JA7G 3HOVG 1UEAB 4A3GB 2NZ1D 2NTSA 2KEEA 3JC66 4LF4Q 1PLFA 5M3FG 1TIID 1S5BD 1UNSA 4K5XA 1EEFD 4B3MQ 3CQZH 5M3FH 2X6GA 2JA5H 2VQEQ 3RZDH 2ZTEA 3RLFA 1X3GA 1CA6A 1EZ8A 3ZYYX 1U4MA 3I56A 3BS1A 4OONA 2ENBA 3HS0C 5IYBG 5K36G 3DM1A 5C4HA 5HURA 4UPAA 4R4IA 3H3VI 1QG7A 2AWNA 2WFWA 4KK7A 1PH4A 1LM0A 3S15H 3RZOH 5E1FA 1SNOA 4APVA 4RHSA 1QUQB 5IT9E 3EIVA 1RJTA 1FGBD 4LFCQ 2Z6KC 1LT4D 1PYWD 1QVCA 3AYHB 4BBRG 2E76C 5FJ8G 2OF1A 3KUPA 4RA8A 4J1MA 2OXPA 5FJ8H 2KOLA 5JPMC 4MN3A 3J81j 3T16A 1KNEA 4DPGA 3E0JA 1YJ9A 1HUNA 1Y8NB 4JVZA 2JE6I 3KJPA 1SYGA 4CDFC 3W2DA 3D4WA 3RLNA 3T1HQ 4A93G 5JEAH 1VQ8A 1S72A 1PFNA 2JEAI 4TKOB 3DLLA 2AUJD 3A74A 3TZDA 1EWHA 2B63G 4DR3L 3FPPA 3HOYH 2MUYA 1LTBD 2BA0A 4N9TA 2F03A 1TWCH 2NVTB 3A7AB 1XJVA 2KUMA 1PFBA 4X66Q 4IOAA 3J7ZC 3A8JE 1XPRA 3H09A 1ASZA 4HR7B 2MHVA 3S1RB 4RGTA 1I4HA 5JEAJ 1HUMA 1EQRA 4JW0A 4OELB 4QB4A 5C4XH 5DM63 1EUJA 4JI3L 2F0TA 1VQ4A 1E1OA 5J1ZA 1HTPA 4JI1L 2VL6A 3W3AA 4QIWE 2QCPX 4B3TL 5C3WA 3CC7A 4KMUC 1L1OC 2H5XA 3RN5A 4A3JG 2HT1A 4JYAQ 2RF4A 3M85A 2QDBA 4FXDA 4ZK9B 4OWXB 3F2DA 2Z9HA 3VR3A 3RLOA 5E4XA 2XTIA 4JBJA 3QWNA 2R7DA 4HIOA 1G291 5L37A 1GHKA 2KEDA 1TS3A 4KI0A 1X9NA 3UE1A 3J7AF 3G6EA 1EY4A 5I6YA 1SNDA 1F2YA 1EQTA 4DR2Q 5I6WA 3VR2A 2AQ3B 2ICEC 4DR1L 2QF7A 3QOJA 2R93H 3Q23A 2E2DC 1XMQQ 3IRBA 4GOPC 3HOUB 5IOCA 1UE7A 5D3DA 2UUAQ 3GTMB 2EYPA 3TP8A 1PRTB 2PI2E 1D2BA 2F0PA 2KVMA 4YHHL 2A19A 1A8VA 3VYTA 1EWCA 2CHBD 3T51B 2I0QA 1CFMA 4JI7Q 2NVXH 1M8AA 2G9DA 4G7ZC 2C9OA 2MPMA 3VR6A 5D3IB 2JK8A 1S5CD 5CC4A 4AYBG 4LFBL 4A3BG 3MC0B 2PQAB 1GO3E 4GLXA 1A63A 1K83B 2NN6I 4A3BH 4BY7G 1WJJA 1A3TA 1EQQA 4BY7H 3HGBA 3VR4A 4NKLA 3K0YA 3PUWA 1PVOA 1AFPA 2R7ZB 3HEJA 4DK0A 4FO2A 3G7LA 3PUVA 4R4OA 4FXKC 4JC0A 3HOUH 2AHOB 3KLWA 4A3EG 4DV1L 3GTMH 3X3NA 4KHPL 2QDLA 3KK7A 2D0PA 5EKLA 3ND9A 4DAPA 4A3EH 2JA8H 4WORA 4JI0L 4M8AA 4NXNL 1UWVA 2HQLA 4UY8C 3P1HA 4KJOA 4PMCA 4KN4C 1YJWA 1I3QH 2SNSA 4JI8Q 2F0EA 2N3SA 3PQIA 5LMNW 2M2LA 1I50B 5G3LD 5CV7A 5C0XG 3F2UA 1W2BA 4IFDG 2E2HB 1Q3LA 5LMNQ 1I94L 1K0SA 2ASBA 1D5MC 1VQNA 2X69A 4RG1A 4HCEA 3I4NG 4CHTB 2XSCA 5KYLA 1NR2A 3STBD 1PFMA 1IHZA 1CT1D 1GUTA 3K7AH 2RDHA 4JI5Q 3H15A 4A3KB 3OYYA 5IIFA 4MIUA 2Y0SE 1Y8OB 4DV2Q 4IFDJ 1VQ7A 1A3VA 3HOXB 1D8LA 5M5WB 1VQAA 1B53A 2EYMA 3UDGA 2A1AA 5ELBA 2GVAA 3DWPA 2EOTA 1IBKL 1CK1A 2A68D 2JEBI 1KLUD 1BCPD 1HR0W 3I73A 1NR4A 2WV6D 1JMCA 1LTTD 3GTGB 1BBXC 1HZBA 1TY0A 1I50H 1HR0Q 4V0BA 1ML0D 1CUKA 2E2HH 1YVCA 5CGKA 1ET9A 2WAQE 3GTQH 3TBIB 1GHJA 2RBMA 4JOIC 5ELDA 5TSSA 1GOZA 2H1EA 5IP9G 3B6YA 4X62Q 1N34Q 1EIYB 2OQ0A 3DUZA 1PMRA 4CDEC 2KCNA 1T5EA 1ET6A 5H1SE 5IWAQ 1M1KC 1M90C 1L2FA 1WTRA 3NBIA 4HAEA 1J6QA 1BBWA 2XIWA 4XQQA 1HA6A 2B2VA 4R8IA 1Z7TA 3GV6A 3MHBA 3NE5B 2ICIA 4YCVA 2B39A 4Q5VA 3D0FA 3AU7A 1V1PA 3EBEA 4UDUC 4KN7C 1ICFB 3OIPA 4JV5L 2EY5A 3CKIB 2YYZA 4OO1I 4DNRB 1TS4A 3E9HA 4LWCA 5JVH3 2CQAA 2NZOA 1WOCA 4A3IH 1YEZA 4DR5Q 4K6LA 4GLAC 4R1JA 1ESFA 3SEBA 4X64Q 1AN8A 4O42A 4O1NA 1OXTA 3T4AC 3U4VA 3PIP3 1HRJA 2RKSA 4LF7L 2B2UA 4CJ0B 4NXML 1YHBA 2GN5A 2JXMB 3KJOA 1HFNA 3CCJA 4DR4L 1O78A 4GKJQ 1AE3A 2E2IB 1B1ZA 2O2LD 1IBML 5IYCG 4QCLA 3U9OA 1Y1WG 5KNCA 2AUKA 3J7A5 2EYLA 5BN5A 4PMWA 4BXXG 4OWTB 2K1BA 2D0OA 2H4OA 5T1IA 2KHJA 4KKTA 3KOJA 1N32Q 2A73B 2PW5A 2HCIA 5ELOA 1RIPA 2ZJQA 1T9HA 4QQBX 5C5MA 2OT2A 2Y0SG 1JICA 4BY1H 4DK3C 1TWAB 1PZID 2I5HA 3BZKA 3S16H 1Q1EA 3S1QH 1EY0A 3PUYA 3S1MB 4LMQD 2NVQB 1NTGA 1KC8C 4LF4L 1X55A 1TR5A 2IHFA 4C3HH 1TWFH 1HZAA 4XT3B 3F2BA 4UP7A 4WFN3 4BBSG 3ERSX 1SNPA 1MD2D 3M4PA 1X65A 2EQSA 3TQYA 5FO8B 4K2KA 1E2WA 3FHWA 1FJGQ 2R6GA 3J80c 1YJNA 2UXBL 1WYDA 2WAQG 5AJ3Q 2C35B 3HRZC 2PNRC 1OXVA 2LXJA 3J81c 1RDPD 1JCKB 1A2UA 1DYQA 4V190 5GADC 1QOHA 1BCPF 1K8MA 4UP9A 4EQPA 1N36L 2RDFA 3HKSA 1WVLA 5C4JB 1VQJA 2ZXRA 2B8FA 5EAYA 1FD7D 1TWHB 1EY9A 1BBUA 1TWAH 4S3SA 1VDZA 1QUQA 1CM9A 2CWPA 2EDGA 3I2ZA 2IT1A 3KBXA 4JI2L 4DR6L 3ND8A 4IJLA 4L5SA 2NVQH 4JBWA 2IW3A 2F0GA 1N33L 5M5YB 5CV4A 4HEDA 4P75A 4DA2A 1LABA 3CW2C 4DNIA 3H0GB 2CWAA 3J80L 1WCMG 3JAMi 1H9MA 5C44B 5ELFA 1EFWA 3ITPA 1JOKA 4GN4B 1IL2A 1LACA 1B4OA 4A75A 3J81L 4P72A 2HHHL 4FVMA 4DV7L 4A3FG 3GTPH 4GZYC 2EXZA 3LWEA 5ELNA 1XPUA 3MXNA 4Y7NB 1H9RA 3Q6SA 3WOFA 1N9WA 4IALA 3NQIA 4RCOA 4QJFA 4Z9CB 2VUMG 2CVRA 2O5IC 4G7OC 4LAAA 3LX0A 4DAMA 5C4JH 4LUVA 4A3MG 3TDQA 3HZXA 4JI4Q 4H13C 4OIJA 2Q2HA 1C48A 4KLKA 2YU9B 3S2HB 3SHLA 4IN3A 4DV4Q 1EY5A 1KIXA 2QKIC 5CORA 2PNHA 2KHSA 1MBYA 1E2VA 3BU2A 1Q7YC 1MKHA 1B3QA 5M5YH 1S40A 2JP1A 4C3IB 2J7ZA 2Q8RE 2K50A 2I07B 3H0GH 1KRTA 3Q22A 1B8AA 3PO3H 3A5UA 3CCEA 4A3CH 2B2YA 2BA1A 4WJ4A 4G7HC 3NEMA 3HOZG 3GP7A 3NTKA 1CKNA 2AMCB 4ZQ3A 3TS2A 1K73C 3STBC 4DR7Q 4YWLA 2WACA 4JI6Q 2XRQD 2F0SA 5CBAE 1H9JA 1PH5A 1L0XB 1YNXA 4POGA 1BVSA 2MFIA 2Z6BA 1XNRL 3S17B 2QGQA 4FP5D 1XMOL 1YBYA 2K14A 1PDQA 4IO9A 3I72A 1XMQL 2TSSA 3K57A 3S2HH 2N49A 4IUUA 3J80E 1CZWA 1Q82C 2A68C 1BCPC 1TY2A 1K8GA 4LUOA 1IW7D 4XQNA 3G4SA 3J81E 3GTOH 1LTGD 3A54A 3CD6A 4IZ8A 1Q90A 4YY3Q 1Z6HA 5JJZA 4ODGA 3A55A 4IJHA 5HGTA 3FDTA 4A3DG 2BCOA 4DAVA 4BS9A 3UE0A 1E3PA 4GLVB 2NUCA 2J0TD 1Y8PB 5FLMH 1NY4A 5AFWA 3PO2G 1HFGA 1SE2A 2VS1A 3ER0A 4RGNA 4RKBA 2PQAA 3PO2H 1IZ6A 1ENAA 4DXGA 1I5FA 4C3JG 2G5DA 2R92B 4QL5A 1K0RA 5A35A 4C3JH 3FEWX 3HOVB 1EIFA 1CA5A 2JA7B 1PTOB 4DN4M 5C3XA 2VB3X 2EJFC 3IL8A 3FKIB 3ICEA 3HOWG 1YHAA 3V2TA 2L0CA 2OEOA 2A69D 5EJWA 1S4ZA 4DV5Q 1KRSA 3G6JB 4GN5A 1F9PA 4PQXA 1EEID 1VMCA 4R4CA 1U9RA 3R2IA 4DKAC 5M3MH 1MSGA 1KQSA 1UAPA 1EYDA 1E1TA 2JA5G 3I70A 2E8GA 1S5DD 4GNXC 3DXJC 1S5ED 5CV9A 4MNOA 4YWMA 4DUZL 2MP1A 1BR9A 2R92H 4RHRA 4JI5L 1QILA 5EPKA 2A5HA 4BBRB 1GUSA 4KV6A 1PA6A 3PUXA 2R3ZA 4DV2L 1K8AC 4KY5A 4NDXA 2F0WA 2FXQA 1GUGA 4LNQA 3PV0A 3I4MH 3HP3A 1EYGA 4A3GG 1AE2A 1QZGA 3U9SA 4A3GH 4OIKA 4A93B 1SBBB 3ERQA 3OIQA 1IXRA 3OW2A 1K3RA 4LFAQ 1HR0L 2B63B 3NUCA 3TP7A 1HNZQ 4PMBA 5E7NA 3OWEB 3S14B 2HCCA 2O4XA 3T13A 4DFAA 3M4QA 3MVVA 1RL2A 5JEAG 3K5NA 3H3VH 1N34L 1EY8A 1AW7A 3U58A 1BNZA 3DWQA 3HOYG 1G6ZA 1WTWA 3MXNB 5IWAL 4L5QA 2EYJA 2UUCQ 2IX0A 4LUZA 3SGIA 3SK6A 4IUNA 4KD4A 1E2ZA 3RR5A 4R9WA 2RDGA 5CYUA 4A3JB 2NWGA 1TS2A 4HSVA 4H44C 5C4XG 3V05A 2IHEA 4ZLTF 5CMDA 1SN8A 1B3AA 1RD9D 1PZJD 1T5XD 3C1FA 1YNJD 2L15A 1SNQA 2KENA 3VYSA 2FHTA 3MA2B 1L1OB 1JWUD 1VQPA 2Q2UA 4C2MB 3K8AA 3MXGA 1TU2B 3K59A 4ZUIA 1AZPA 3FRPB 3BDCA 4F7XA 2ZT9C 4U673 2I46A 1XNQL 3CCMA 1IYJB 2DNEA 1YIJA 1CKNB 2XNAC 1H9KA 3EVQA 5CBEE 1JWMD 1STYA 1J5EQ 1QNKA 4GKJL 4NW2A 1Q1BA 1DCZA 2R7FA 1ZEQX 2D9UA 3R3OA 2EYFA 4IPHA 2UUBL 2JA9A 2NVTH 1O80A 1CKOA 3C46A 4L8JA 5LL6S 1LO5D 4HIDA 3A8KE 4GOPB 2R93G 2VQFQ 2EIFA 1Y14B 3S1RH 1N32L 2PYKA 3UDIA 2IJ0A 1GM5A 2XGTA 4RAUC 4DUYQ 2E2JB 4YWKA 1H9SB 2A6HD 4WJ3M 1JR0D 3CPFA 4AYBB 1ICWA 3WDNA 4C2MH 4FYDA 2OQKA 4GKKQ 1IBLQ 2I5LX 2UXCQ 1P8LA 2L9HA 2JJQA 1JB3A 1B7YB 4L5TA 2SOBA 4XDXA 4LF8Q 3VR5A 5I9OA 2JN4A 4CJ1B 3VYUA 3NWSA 3LNNA 3K5MA 3J7AV 1NMGA 2WIIB 1NAPA 5T1GA 5KIXA 1GUWA 4BA2I 4CGYB 1NMFA 3OMCA 5AJ3L 1HNWL 1I6HB 5GAEC 1FNVA 1IKLA 4B9XA 5DLQE 4EQ5A 3HOUG 2QEJC 1A6XA 3BZCA 2KCCA 2WINB 2DGYA 2JA8G 5IY0A 1VQBA 2A74C 1JE4A 1GXDC 1CHQD 1CI3M 4JK1C 4QIWB 5JOBA 1IW7C 3I4NB 4DXFA 5C0XI 1SR3A 4IFDI 4B3SQ 2L55A 2XVSA 5IYDH 4AQYL 1DOMA 2DNCA 4HJ7A 2L12A 2NN6H 1MSHA 3BVMA 2KECA 2SNMA 4IUTA 4HTHA 4B3RQ 2IX3A 5E3FA 2F4VQ 4IPDA 3PCOB 1K83H 4X65Q 1C8CA 2VXWA 4KY7A 1AP0A 2SEBD 1LT5D 5DEHA 2PCFB 2D5DA 1SYCA 3HKZE 4XYQA 2F0JA 3PIOA 3CU7A 4E6IA 1SFOB 4OX9Q 2R7ZH 4QGUA 3BVZA 5I2XA 3GTKB 3NPPA 1D6EC 2AQ1B 1B9MA 1D1KA 1A0IA 2HIVA 4I7AA 1WD1A 1ILPA 1DONA 3A5ZB 3OPOA 3Q8DA 5C3EB 1H95A 2K05A 2A69C 4F8MA 3RN2A 1FVIA 1SE3A 4HIKA 5KNBA 2I5MX 5JJKA 4FF2A 5HGQA 4C1NI 4X6AH 1STNA 1BOSA 1EY7A 2Q2IA 5EGTA 2ID0A 5JJIA 3F8TA 1KD1C 3FPUB 2ES2A 4X3UA 4K8IA 1SXTA 1OXXK 3R8BA 3EA6A 2WB1B 3KDFB 2B2TA 1Q8IA 1JOOA 2EZVA 4PZ6A 1F9QA 2JA6B 2NBFA 4PNYA 2B29A 4K5VA 4KHZA 3F1ZA 4PG3A 2ZM6L 3RNUA 2NYZD 4IOCA 4M1UB 4DR7L 3M4OB 2RSNA 1CSPA 2HUGA 1EYCA 4A3KH 3BDLA 2K75A 4KY6A 1PH2A 4NP5A 1TQOA 3D4RA 1K9MC 3HOXH 3PSIA 1G2TA 1W6JA 2F0UA 5M5WH 2FJ2A 1VQOA 2Q8TA 1G51A 4DV3Q 3QR8A 5KYIA 1EOVA 1VF7A 3CCUA 3C3LA 4HCSA 3CCSA 3T1YL 2BE5D 3GTGH 5HY6A 2RVLA 4LF9L 4A3IG 1WTHA 4YY3L 4P2CB 2JSOA 1JJCB 2VZAA 1EQVA 1HH2P 3CCRA 1ZKOA 1Y1WB 2B3GA 3MWYW 4L63B 2JA6H 1TWGB 4ZRZA 3KBGA 1YNND 1PH6A 4K6DA 1P16A 1VS0A 1XTCD 4JI3Q 3I4OA 4CKBA 5DNFA 1HQRD 3NHHA 2VB2X 2F0KA 3KFUA 1AH9A 2Y0SB 1VQLA 2BH2A 1JORA 3GDEA 3QJYA 4ZKBB 4P74A 1WTVA 4QMGA 1LTRD 3L7ZC 3TSSA 2L1BA 4XXEA 3BZDB 1ZYRD 4OO1H 3GQBA 3JAMc 1U0LA 3MXPA 4YIJA 4R4TA 1CQFA 3HKZG 2X6LA 5CV5A 1HZ9A 1KHIA 4DV5L 1F2LA 4IQZA 5G3LF 4BY1G 4BBSB 1YNJC 5EBDA 3I8ZA 2VY3A 4C56C 4CBVA 2F0HA 4RFBA 3AEVA 3TP6A 2ZJRA 2IY5B 5I9PA 5EKKA 3SE0A 3KF8B 5C5LA 1SMYD 1VQ9A 4C3HG 3OMGA 4DR1Q 5IP7H 3M7NA 3GV3A 4B3ML 4GNXA 2VQEL 1F2ZA 1V8QA 4ZCKA 4LJZC 4J8QA 3X3MA 3VA7A 2E2IH 2QA4A 4A4IA 4YHHQ 1MHWC 4QUFA 2E5LQ 1O7LA 1HPCA 4HJ5A 1F9SA 1EU4A 1M4VA 3GO5A 4J6HA 1V9PA 2PZWA 2KCTA 3URYA 3L0OA 1ASYA 1OTCA 2LS01 2MO1A 5IGEA 2B8GA 4ZUJA 4LF6Q 1GUNA 5BR8Q 3UDXA 2L11A 4LFBQ 2K5NA 4K0KQ 1WCMB 1FNWA 3OWFA 5FK9C 2A6HC 2Z6KA 1BDOA 1Q86C 3IAYA 3M3YB 4LFCL 5JAVA 3S1MH 4A3FB 3EN2A 2R61A 4LFAL 1DJRD 2F0QA 3CXCA 1HNZL 4G57A 3I90A 4CDCC 2KQ3A 4DV1Q 3KLRA 1SROA 2VUMB 4KHPQ 2UXDQ 3EJIA 3VA5A 4O2DA 3BYYB 4GS3A 4JI0Q 2ZJPA 1TVXA 5C4ZA 3T1HL 3CAMA 2K5HA 2N88A 1LTSD 4NXNQ 4XYOA 3I91A 1STBA 1UE5A 1MI2A 1O7YA 2Q2TA 2EE1A 2V4DA 1QE6A 5JPNC 1R4QB 3TEHB 3H91A 2L4NA 3FP9A 3E5SA 1AEXA 2Q8IB 1F9RA 4X66L 2EVBA 4PV1C 4L5RC 3S2DB 1J9OA 2Z8LA 3DEOA 1U4LA 3PGZA 1V1OA 3N52A 3NK9A 4RH6A 1TWHH 4JCVE 2EPBA 2D2CC 2PMZB 1KDCA 3HOZB 3TP5A 1QVFA 2MGSA 4TVAB 3AMUA 1L1OA 4FF1A 4AIMA 1A15A 2Z4IA 3H0GG 4UAIA 4AH6A 3PO3G 1KAWA 1Q8KA 1UE6A 4YCWA 1DXMA 2Z1CA 4A3CG 3VDYA 1I4PA 5CV8A 4JYAL 1Y1VB 3CRLC 5C44H 3GTLB 1G91A 4H02A 2UU9Q 2YTYA 1VQKA 4RWSC 1CQVA 1JJ2A 3J80i 1EL0A 3S1NB 5CR3A 2K03A 4Y7NH 5EBCA 1PH7A 1WTXA 4FNFA 5M5XB 1PRTD 1G2SA 3J81i 2IX1A 3J7YW 4DR2L 5FO9B 2ZTDA 2PQEA 1EIHA 3SXHA 2K04A 2K33A 4JG2A 1TT2A 4N8FA 2VQFL 4GOPA 1QNUA 4WRDA 3HFZB 1V43A 5FLXc 4A3DB 1BCPB 2YU9H 2RA4A 1I6VC 3NP8A 2UUAL 1RODA 2K28A 1OO9B 1H9SA 1SDFA 4C3IH 2F3WA 4DV6Q 3K5OA 3EROA 5IT9c 2DJFC 1PV4A 2NTTA 3KLSX 2UXCL 1Y1VH 4QUCA 5BN4A 4JI7L 4Q0FA 2CW0D 4TQUS 1Y69U 3DMUA 5JJLA 1G8ZD 2LKVA 4ILWA 2B2VC 4ME3A 3TZUA 4LF8L 4ID6A 1Z9FA 1L0YB 5FLMG 1SJHD 4J15A 4ULLA 1B2TA 3CF5A 3HOWB 4FDBA 4OXPA 4N9PA 2QILA 5FLXL 1N8RC 3NXWA 5IGDA 3S17H 1SYDA 2BDOA 3AFPA 2FFKB 3FVQA 3QIAA 1GUOA 1SAPA 4G4KA 5J22A 4NXMQ 2ALYB 2CH4A 4EQNA 4R4QA 1SEBD 2OTLA 5M3FB 2B2UC 1F77A 2JA5B 2WKDA 3RZDB 3CPWA 3PF4A 4DR4Q 2BE5C 4GN3B 1R4PB 1E7ZA 4B08A 1XTDA 4OHJA 4B3SL 2EY2A 3ULPA 1PH1A 4HMIA 4JI8L 4CJ2C 5M3MG 1U4RA 1BXTA 1QB5D 2QW7A 1JB7A 1BF4A 4LF5Q 3E0EA 3CCVA 2F0OA 3E6ZX 4POFA 1EOTA 1Q81C 4GNXB 5LMNL 1YNNC 4IUVA 1YHQA 3S15B 3RZOB 1X32A 1DD2A 4B3RL 3C2PA 2KCMA 1D7QA 2ZTCA 4DF7A 1IKMA 2R92G 3NWTA 1L0WA 2JA7H 3HOVH 2F52A 3A8IE 3FKIG 3K0XA 1B9NA 1RHPA 2MNAA 4OX9L 4CKCA 1PTOH 1LYLA 3H94A 1X3FA 1I4RA 3FKIH 4EQOA 4DV0Q 1CHPD 3E3XA 4O0AA 1ZYRC 2J4XA 1B70B 3TN2A 1WI5A 3TRZA 1NSNS 5DM73 3I4MG 1WTOA 2MJ8A 3VYRA 2M9VA 4FF4A 2NZHA 5LMUQ 2EY6A 1X3PA 4KTAA 3N6RA 1I4GA 2PI2A 3M9BA 2UXBQ 3P75A 4RGOS 2PW7A 2WKCA 1W6KA 3OTOQ 5IYBH 3H3VC 5K36H 4P71A 1SMYC 3HOYB 4I7ZC 5FLXE 1TWCB 1N36Q 4DGZA 1K3BC 4JOIA 1NNXA 1KNAA 1PRTF 3KDFA 5M9OA 2LMCB 1PXUA 4X62L 4RMFA 4EGVA 1FL0A 3LWUA 1QZHA 5C4XB 4JI2Q 4HMJA 3UI2A 3MAQA 4DR6Q 1KAAA 1KLGD 3SK4A 2F0FA 1NUCA 1A62A 1IYVA 4AYBE 2OCEA 1NBWA 4BBRH 1HQMC 3G71A 1N33Q 3LGJA 3DWAA 2K5VA 2L5TA 1QJOA 2F0NA 4Y52H 1DOLA 3NENA 2EJGC 1FYCA 4JBMA 1GVPA 4DV3L 1QWYA 3GTJB 3QG1A 2HHHQ 3S24A 1U4PA 4DV7Q 1C9OA 4A93H 2KBNA 2RQXA 3OOCA 2WP8J 2Z4HA 2B63H 1TS5A 4DU9A 4DR5L 1VQDA 2AKWB 4X64L 3D8GA 3S14H 5J3BA 3A56A 1EYAA 1MJCA 4B9WA 1HTLD 2R93B 1WTQA 1LTLA 1RTOA 3W5OA 3L9AX 2RCNA 3L2PA 2F3IA 5FO7B 2F0VA 4YCUA 2F1MA 2K5DA 2C5CA 5IE8A 2AWOA 1E22A 3T56B 3W1GA 1VQ5A 1KDAA 1HNXQ 1RKNA 4A3JH 3P7JA 2NVXB 3R93A 3GTJH 4IUQA 2VW9A 1KDBA 2B2YC 3U50C 1WTPA 4LK1C 3UDFA 4XTCS 1DGSA 1EWIA 2LFNA 3F2CA 1X3EA 2N8NA 4A3BB 4ME5A 2GA4B 4BY7B 2JQOA 1XNRQ 5J39A 1PH3A 1VQGA 1U5KA 3KF8A 2O5JC 3S9WA 2TMPA 1XMOQ 5LHY1 4ALPA 3WWVA 1SLJA 2K01A 1HA5A 4H7BA 5ELCA 1PHJA 1PFSA 3PIO3 2N78A 4A3EB 2JA8B 1X6OA 2LSSA 4FXGC 4MZ9A 1STEA 1FJGL 2F4IA 1PRTC 2EYHA 2E5LL 4NB3A 1PYBA 1I3QB
chains in the Genus database with same CATH topology
1HZCA 4KLKA 5IYBG 5K36G 4DV4Q 1KIXA 1PH6A 2PNHA 1PYSB 1P16A 1VS0A 3BU2A 4JI3Q 3I4OA 1Q7YC 1MKHA 4UPAA 5M5YH 4R4IA 1S40A 2E2JH 4LF6L 3H3VI 2AWNA 5BR8L 2WFWA 1PH4A 3GD7A 2WB1E 2K50A 1LM0A 4K0KL 3KFUA 3H0GH 1KRTA 3RZOH 3S15H 1AH9A 4APVA 1B8AA 3PO3H 3A5UA 3CCEA 4A3CH 1VQLA 2BH2A 3GDEA 2BA1A 4WJ4A 4P74A 2D62A 3BJUA 3NEMA 3L7ZC 5IYDG 4HJAA 1QUQB 1JT8A 3EIVA 3HOZG 4LFCQ 3K81C 1CKNA 2AMCB 1VQIA 2Z6KC 1QVCA 3AYHB 3KF6B 4BBRG 3JAMc 1K73C 5FJ8G 3TS2A 1U0LA 2NN6G 3STBC 4R4TA 4DR7Q 4YWLA 1WFQA 3HKZG 5FJ8H 3CCQA 4JI6Q 1HZ9A 2YTVA 1KHIA 1VQEA 3J81j 4DV5L 1PH5A 2UXDL 4BY1G 4DPGA 2JA6H 1YNXA 1YJ9A 2VY3A 4POGA 1BVSA 1SRUA 2MFIA 1XNRL 3AEVA 2IY5B 2JE6I 3KJPA 2ZJRA 2QGQA 3ULJA 1XMOL 4P73A 1YBYA 2K14A 3KF8B 3RLNA 3T1HQ 1VQ9A 4IO9A 4A93G 1XMQL 4DR1Q 1I6HH 2R7ZG 5IP7H 1S72A 1VQ8A 2JEAI 3S2HH 2N49A 3M7NA 3NELA 3DLLA 1Q82C 3A74A 2B63G 4DR3L 4B3ML 4GNXA 1K8GA 3HOYH 2VQEL 4LUOA 2BA0A 3G4SA 1TWCH 3GTOH 2E2IH 1XJVA 2QA4A 3CD6A 4A4IA 3AFQA 4YY3Q 4X66Q 4IOAA 3J7ZC 4JI4L 2EXDA 4YHHQ 1XPRA 4IJHA 1NJIC 4NPSA 1ASZA 3I4NH 1BKBA 4DUZQ 2CCZA 2E5LQ 4A3DG 4DV4L 5JEAJ 4PZ8A 1EQRA 4HJ5A 2CFMA 5C4XH 1EUJA 4JI3L 3A0JA 3UE0A 1E3PA 3GO5A 1V9PA 4IPGA 1VQ4A 1E1OA 2KCTA 3L0OA 4GLVB 1ASYA 1OTCA 2MO1A 4JI1L 1NY4A 5FLMH 1YI2A 2VL6A 3PO2G 4LF6Q 4QIWE 5BR8Q 2VS1A 1LUZA 5C0XJ 4B3TL 3ER0A 3UDXA 3CC7A 4LFBQ 2PQAA 3I7FA 2K5NA 3PO2H 1L1OC 4K0KQ 2H5XA 2K52A 1IZ6A 3RN5A 1I5FA 2CQOA 4A3JG 2HT1A 4JYAQ 2Z6KA 2RF4A 3M85A 2UU9L 4QL5A 3K7UC 1K0RA 1Q86C 4C3JH 4OWXB 1EIFA 3F2DA 4LFCL 3S1MH 3RLOA 3EN2A 2XTIA 4JBJA 3AQQA 3KYHC 2R7DA 2YTXA 4HIOA 1G291 4A3KG 3CC4A 4LFAL 1TXYA 3ICEA 1PH8A 3HOWG 1SFOH 4JI6L 4KI0A 3CXCA 1YHAA 3UE1A 1X9NA 1HNZL 3GTKH 3HOXG 3G6EA 4DV1Q 1SROA 3I55A 4DV5Q 4KHPQ 5C3EG 2UXDQ 4HIMA 4O2DA 1KRSA 4GS3A 2ZJPA 4DR2Q 3TREA 2OWOA 5C3EH 4JI0Q 4GN5A 3T1HL 3CAMA 2K5HA 4NXNQ 4DR1L 1UE5A 2Q2TA 4R4CA 2R93H 2YV5A 1XMQQ 3IRBA 4DKAC 1GD7A 5IP9H 5M3MH 4GOPC 3TEHB 1KQSA 1E1TA 2JA5G 1UE7A 3FP9A 4DR3Q 2UUAQ 3DM3A 4DV6L 2PI2E 2E8GA 4X66L 4GNXC 3PUZA 2WB1G 4YHHL 4L5RC 2A19A 3PGZA 1A8VA 2NVYH 2JA6G 4MNOA 1TWHH 4YWMA 4DUZL 4JCVE 2R92H 2I0QA 4JI7Q 2NVXH 4XIGS 4LW1A 4JI5L 1QVFA 1E24A 4TVAB 2K4KA 1Q12A 1PA6A 3M4OH 3PUXA 1L1OA 4A3LG 2JK8A 4AIMA 3H0GG 4DV2L 1K8AC 4AH6A 4JI1Q 4AYBG 3PO3G 4LFBL 1KAWA 1Q8KA 1UE6A 4YCWA 4A3BG 3TS0A 4A3CG 2FXQA 1GO3E 2PQAB 4GLXA 3VDYA 4B3TQ 4A3LH 3CC2A 1VQFA 1A63A 2NN6I 4A3BH 4BY7G 4LNQA 1WJJA 5C44H 3PV0A 3I4MH 4JYAL 1EQQA 4QY7A 1GKHA 1EYGA 4A3GG 4BY7H 4H02A 4OO1G 2RHQB 1AE2A 3PUWA 2YTYA 1QZGA 2UU9Q 3CCLA 4A3GH 1PVOA 1VQKA 1XNQQ 2QEXA 1JJ2A 1IXRA 3PUVA 3OW2A 1K3RA 1V1QA 2V1CC 4JC0A 4R4OA 3J80i 4LFAQ 1HR0L 3HOUH 2AHOB 3KLWA 4Y7NH 1PH7A 4A3EG 1SMXA 4DV1L 5GQOA 1HNZQ 3GTMH 4KHPL 3J81i 1FGUA 2D0PA 1HJPA 4A3EH 2IX1A 2JA8H 5E7NA 2UUBQ 4DR2L 4JI0L 2ZTDA 4NXNL 1UWVA 1UEBA 2HQLA 2Z0SA 3M4QA 4JG2A 5IYCH 2VQFL 1RL2A 5JEAG 4GOPA 5IP7G 1Y1WH 4UY8C 3HFZB 1V43A 5FLXc 3H3VH 1YJWA 1SE8A 1N34L 1I3QH 4JI8Q 4LF5L 1QVGA 3U58A 1TWGH 2YU9H 4BXXH 2N3SA 5GAGC 5LMNW 4HJ8A 3HOYG 3MXNB 5IWAL 2DUDA 2UUAL 4L5QA 5C0XG 1NE3A 1W2BA 2UUCQ 4IFDG 2IX0A 4LUZA 3SGIA 4C3IH 5LMNQ 4DV6Q 1I94L 2ASBA 1VQHA 1VQCA 1VQNA 5IT9c 4RG1A 1PV4A 4PZ7A 1O7IA 2CKZB 3RR5A 2PMZE 3MEFA 3I4NG 2UXCL 1Y1VH 3STBD 4JI7L 4TQUS 5C4XG 2IHEA 5JJLA 1SN8A 4ME3A 4LF8L 1Z9FA 3K7AH 1XPOA 4JI5Q 5FLMG 4DV0L 4J15A 2L15A 3H15A 2KENA 3OYYA 3CF5A 1L1OB 1X54A 3PF5A 2Y0SE 4FDBA 4UP8A 4DV2Q 1VQPA 2Q2UA 4OXPA 4IFDJ 3K8AA 1VQ7A 5LMUL 1D8LA 3PIPA 4BBSH 1VQAA 2GVBA 1N8RC 3UDGA 3S17H 2A1AA 3AFPA 2GVAA 1IBKL 2MO0A 1XNQL 2JEBI 1HNWQ 3CCMA 1IYJB 3OTOL 1HR0W 1YIJA 1CKNB 1JMCA 2ALYB 4NXMQ 4R4QA 3E9IA 2OTLA 1KL9A 1HZBA 2ATWA 1J5EQ 1I50H 4GKJL 1HR0Q 1Q1BA 1CUKA 2R7FA 3CPWA 3PF4A 2E2HH 4DR4Q 1YVCA 4GN3B 4IPHA 2UUBL 2JA9A 2NVTH 1E7ZA 3G48A 1CKOA 2WAQE 1XTDA 3GTQH 4B3SL 3ULPA 2R93G 4HIDA 4JOIC 4GOPB 1PH1A 2VQFQ 4OWWB 2EIFA 4JI8L 5IP9G 1Y14B 3B6YA 5M3MG 4X62Q 3S1RH 1N32L 3UDIA 5GROA 1OXSC 1YZ6A 1N34Q 1EIYB 3U4ZA 2OQ0A 1GM5A 2XGTA 4DUYQ 3E0EA 3CCVA 1JB7A 4LF5Q 4POFA 4AQYQ 2UUCL 1Q81C 4YWKA 5H1SE 4GNXB 5IWAQ 5LMNL 1MIUA 1YHQA 1M1KC 4WJ3M 1M90C 1L2FA 3CMAA 3CPFA 4B3RL 1I94Q 2KCMA 3K80C 4C2MH 1YITA 1D7QA 1J6QA 1W3SA 1BBWA 2OQKA 2ZTCA 2R92G 1WCMH 4GKKQ 1IBLQ 2I5LX 2UXCQ 1P8LA 4YCVA 2JJQA 1L0WA 1C0AA 2JA7H 3HOVH 1B7YB 4L5TA 3W1BA 3M3YH 2F52A 3D0FA 3FKIG 3K0XA 2MNAA 3EBEA 4A3FH 4OX9L 4LF8Q 1LYLA 1X3FA 3FKIH 1Z47A 4DV0Q 4JV5L 2RHSB 4O0AA 2YYZA 4OO1I 1B70B 3TRZA 1WI5A 3E9HA 4LWCA 2NZOA 3NBHB 5C44G 1NMGA 3I4MG 1WOCA 2NZHA 4A3IH 1YEZA 2MQHA 5LMUQ 4JBKA 4DR5Q 2VUMH 4BA2I 2BH8A 4R1JA 1NMFA 4GLAC 4X64Q 2PI2A 4DAYB 1VQMA 5AJ3L 1OXTA 3U4VA 4A3MH 1HNWL 3CMEA 3M9BA 5GAEC 1IBKQ 2UXBQ 4LF7L 4NXML 1YHBA 5DLQE 1S3OA 3OTOQ 4EQ5A 5IYBH 3HOUG 2GN5A 3KJOA 4P71A 1J5EL 3BZCA 3CCJA 2DGYA 2JA8G 1N36Q 4DR4L 4GKJQ 1AE3A 5IY0A 1VQBA 4JOIA 5IYCG 1IBML 1HNXL 1R9TH 1Y1WG 3KDFA 3S2DH 3J7A5 5C0XI 1CSQA 1SR3A 4IFDI 4PMWA 4BXXG 4B3SQ 4X62L 1X56A 4RMFA 4OWTB 1FL0A 1QZHA 2D0OA 4JI2Q 5IYDH 2KHJA 4DUYL 4DR6Q 1N32Q 3KOJA 2ZM6Q 1VQ6A 1A62A 4AQYL 3HOZH 4HJ7A 4AYBE 2OCEA 1NBWA 3D31A 5ELOA 4BBRH 3G71A 4A76A 1N33Q 1RIPA 2ZJQA 3LGJA 1T9HA 3ULLA 2K5VA 4QQBX 2A8VA 4Y52H 4HJ9A 3NENA 2Y0SG 4B3RQ 1Y1VG 4DK6C 2HIXA 2F4VQ 4GKKL 1IBLL 4IPDA 1GVPA 3PCOB 4BY1H 4JBMA 1K83H 4X65Q 4DK3C 4DV3L 1UE1A 2I5HA 3GTLH 3BZKA 3S16H 1Q1EA 2HHHQ 3S1QH 3PUYA 1NTGA 3S24A 1KC8C 4DV7Q 1C9OA 1X55A 4LF4L 1C7YA 2IHFA 3HKZE 3PIOA 1KXLA 4C3HH 1JE5A 1HZAA 1TWFH 4A93H 4OX9Q 3F2BA 2R7ZH 2OTJA 1G6PA 4QGUA 4UP7A 2KBNA 3T1YQ 2WP8J 4JV5Q 3S1NH 2B63H 2HIVA 1A0IA 4BBSG 3ERSX 4LF9Q 2VNUD 3A5ZB 3M4PA 5M5XH 3Q8DA 1VQDA 2AKWB 4DR5L 1X65A 2EQSA 3TQYA 1H95A 4X64L 3S14H 3FHWA 4IPCA 3RN2A 2R6GA 1FJGQ 3CP0A 5J3BA 3J80c 1MJCA 1YJNA 1FVIA 2UXBL 1VCIA 1WYDA 2WAQG 5AJ3Q 4HIKA 2C35B 2I5MX 4EX5A 1PH9A 5JJKA 5HGQA 1OXVA 2LXJA 1LTLA 1Q46A 3W5OA 3J81c 4LF7Q 4A3DH 4X6AH 2RCNA 4BA1I 5GADC 3ZJYC 3L2PA 2F3IA 4UP9A 5GAHC 4YCUA 2Q2IA 3HKSA 1N36L 2ID0A 5JJIA 3F8TA 1KD1C 2ES2A 1JJGA 5IE8A 1OXXK 2AWOA 1VQJA 1IBMQ 5EAYA 1E22A 3W1GA 3KDFB 1VQ5A 1HNXQ 4MTNA 4PZ6A 1BBUA 1TWAH 4A3JH 1QUQA 2CWPA 3I2ZA 2B29A 3GTJH 2IT1A 4KHZA 4JI2L 3F1ZA 4PG3A 2VW9A 4DR6L 2ZM6L 3RNUA 4IJLA 3KF6A 3U50C 4L5SA 2NVQH 4IOCA 4JBWA 4DR7L 1N33L 1OXUA 1CSPA 1CKMA 4P75A 4A3KH 3UDFA 4XTCS 3HOWH 3CW2C 4DNIA 2KHIA 1DGSA 1EWIA 2K75A 1MJEA 1PH2A 2CWAA 1X3EA 2N8NA 3F2CA 1WCMG 3JAMi 2F4VL 1K9MC 4X65L 3HOXH 2LXKA 3PSIA 4GN4B 1EFWA 5M5WH 1VQOA 1IL2A 2JQOA 4A75A 1XNRQ 2HHHL 1G51A 4P72A 4DV3Q 1VQGA 1PH3A 2JA7G 3HOVG 1U5KA 1EOVA 1XMOQ 4DV7L 4A3FG 4ALPA 3GTPH 3WWVA 3CCUA 1SLJA 5ELNA 3JC66 4LF4Q 3CCSA 3T1YL 1PHJA 5M3FG 1XPUA 3GTGH 5HY6A 1PFSA 4B3MQ 3CQZH 5M3FH 1N9WA 2N78A 4LF9L 4A3IG 4QJFA 2JA5H 2VQEQ 2VUMG 3RZDH 1X6OA 2LSSA 2ZTEA 4YY3L 3RLFA 1X3GA 4MZ9A 1JJCB 1FJGL 4DAMA 5C4JH 4LUVA 2VZAA 4A3MG 1HH2P 3CCRA 4JI4Q 2E5LL 3I56A 4NB3A 4OONA 1PYBA 2B3GA 2Q2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZC A;  4KLK A;  5IYB G;  5K36 G;  4DV4 Q;  1KIX A;  1PH6 A;  2PNH A;  1PYS B;  1P16 A;  1VS0 A;  3BU2 A;  4JI3 Q;  3I4O A;  1Q7Y C;  1MKH A;  4UPA A;  5M5Y H;  4R4I A;  1S40 A;  2E2J H;  4LF6 L;  3H3V I;  2AWN A;  5BR8 L;  2WFW A;  1PH4 A;  3GD7 A;  2WB1 E;  2K50 A;  1LM0 A;  4K0K L;  3KFU A;  3H0G H;  1KRT A;  3RZO H;  3S15 H;  1AH9 A;  4APV A;  1B8A A;  3PO3 H;  3A5U A;  3CCE A;  4A3C H;  1VQL A;  2BH2 A;  3GDE A;  2BA1 A;  4WJ4 A;  4P74 A;  2D62 A;  3BJU A;  3NEM A;  3L7Z C;  5IYD G;  4HJA A;  1QUQ B;  1JT8 A;  3EIV A;  3HOZ G;  4LFC Q;  3K81 C;  1CKN A;  2AMC B;  1VQI A;  2Z6K C;  1QVC A;  3AYH B;  3KF6 B;  4BBR G;  3JAM c;  1K73 C;  5FJ8 G;  3TS2 A;  1U0L A;  2NN6 G;  3STB C;  4R4T A;  4DR7 Q;  4YWL A;  1WFQ A;  3HKZ G;  5FJ8 H;  3CCQ A;  4JI6 Q;  1HZ9 A;  2YTV A;  1KHI A;  1VQE A;  3J81 j;  4DV5 L;  1PH5 A;  2UXD L;  4BY1 G;  4DPG A;  2JA6 H;  1YNX A;  1YJ9 A;  2VY3 A;  4POG A;  1BVS A;  1SRU A;  2MFI A;  1XNR L;  3AEV A;  2IY5 B;  2JE6 I;  3KJP A;  2ZJR A;  2QGQ A;  3ULJ A;  1XMO L;  4P73 A;  1YBY A;  2K14 A;  3KF8 B;  3RLN A;  3T1H Q;  1VQ9 A;  4IO9 A;  4A93 G;  1XMQ L;  4DR1 Q;  1I6H H;  2R7Z G;  5IP7 H;  1S72 A;  1VQ8 A;  2JEA I;  3S2H H;  2N49 A;  3M7N A;  3NEL A;  3DLL A;  1Q82 C;  3A74 A;  2B63 G;  4DR3 L;  4B3M L;  4GNX A;  1K8G A;  3HOY H;  2VQE L;  4LUO A;  2BA0 A;  3G4S A;  1TWC H;  3GTO H;  2E2I H;  1XJV A;  2QA4 A;  3CD6 A;  4A4I A;  3AFQ A;  4YY3 Q;  4X66 Q;  4IOA A;  3J7Z C;  4JI4 L;  2EXD A;  4YHH Q;  1XPR A;  4IJH A;  1NJI C;  4NPS A;  1ASZ A;  3I4N H;  1BKB A;  4DUZ Q;  2CCZ A;  2E5L Q;  4A3D G;  4DV4 L;  5JEA J;  4PZ8 A;  1EQR A;  4HJ5 A;  2CFM A;  5C4X H;  1EUJ A;  4JI3 L;  3A0J A;  3UE0 A;  1E3P A;  3GO5 A;  1V9P A;  4IPG A;  1VQ4 A;  1E1O A;  2KCT A;  3L0O A;  4GLV B;  1ASY A;  1OTC A;  2MO1 A;  4JI1 L;  1NY4 A;  5FLM H;  1YI2 A;  2VL6 A;  3PO2 G;  4LF6 Q;  4QIW E;  5BR8 Q;  2VS1 A;  1LUZ A;  5C0X J;  4B3T L;  3ER0 A;  3UDX A;  3CC7 A;  4LFB Q;  2PQA A;  3I7F A;  2K5N A;  3PO2 H;  1L1O C;  4K0K Q;  2H5X A;  2K52 A;  1IZ6 A;  3RN5 A;  1I5F A;  2CQO A;  4A3J G;  2HT1 A;  4JYA Q;  2Z6K A;  2RF4 A;  3M85 A;  2UU9 L;  4QL5 A;  3K7U C;  1K0R A;  1Q86 C;  4C3J H;  4OWX B;  1EIF A;  3F2D A;  4LFC L;  3S1M H;  3RLO A;  3EN2 A;  2XTI A;  4JBJ A;  3AQQ A;  3KYH C;  2R7D A;  2YTX A;  4HIO A;  1G29 1;  4A3K G;  3CC4 A;  4LFA L;  1TXY A;  3ICE A;  1PH8 A;  3HOW G;  1SFO H;  4JI6 L;  4KI0 A;  3CXC A;  1YHA A;  3UE1 A;  1X9N A;  1HNZ L;  3GTK H;  3HOX G;  3G6E A;  4DV1 Q;  1SRO A;  3I55 A;  4DV5 Q;  4KHP Q;  5C3E G;  2UXD Q;  4HIM A;  4O2D A;  1KRS A;  4GS3 A;  2ZJP A;  4DR2 Q;  3TRE A;  2OWO A;  5C3E H;  4JI0 Q;  4GN5 A;  3T1H L;  3CAM A;  2K5H A;  4NXN Q;  4DR1 L;  1UE5 A;  2Q2T A;  4R4C A;  2R93 H;  2YV5 A;  1XMQ Q;  3IRB A;  4DKA C;  1GD7 A;  5IP9 H;  5M3M H;  4GOP C;  3TEH B;  1KQS A;  1E1T A;  2JA5 G;  1UE7 A;  3FP9 A;  4DR3 Q;  2UUA Q;  3DM3 A;  4DV6 L;  2PI2 E;  2E8G A;  4X66 L;  4GNX C;  3PUZ A;  2WB1 G;  4YHH L;  4L5R C;  2A19 A;  3PGZ A;  1A8V A;  2NVY H;  2JA6 G;  4MNO A;  1TWH H;  4YWM A;  4DUZ L;  4JCV E;  2R92 H;  2I0Q A;  4JI7 Q;  2NVX H;  4XIG S;  4LW1 A;  4JI5 L;  1QVF A;  1E24 A;  4TVA B;  2K4K A;  1Q12 A;  1PA6 A;  3M4O H;  3PUX A;  1L1O A;  4A3L G;  2JK8 A;  4AIM A;  3H0G G;  4DV2 L;  1K8A C;  4AH6 A;  4JI1 Q;  4AYB G;  3PO3 G;  4LFB L;  1KAW A;  1Q8K A;  1UE6 A;  4YCW A;  4A3B G;  3TS0 A;  4A3C G;  2FXQ A;  1GO3 E;  2PQA B;  4GLX A;  3VDY A;  4B3T Q;  4A3L H;  3CC2 A;  1VQF A;  1A63 A;  2NN6 I;  4A3B H;  4BY7 G;  4LNQ A;  1WJJ A;  5C44 H;  3PV0 A;  3I4M H;  4JYA L;  1EQQ A;  4QY7 A;  1GKH A;  1EYG A;  4A3G G;  4BY7 H;  4H02 A;  4OO1 G;  2RHQ B;  1AE2 A;  3PUW A;  2YTY A;  1QZG A;  2UU9 Q;  3CCL A;  4A3G H;  1PVO A;  1VQK A;  1XNQ Q;  2QEX A;  1JJ2 A;  1IXR A;  3PUV A;  3OW2 A;  1K3R A;  1V1Q A;  2V1C C;  4JC0 A;  4R4O A;  3J80 i;  4LFA Q;  1HR0 L;  3HOU H;  2AHO B;  3KLW A;  4Y7N H;  1PH7 A;  4A3E G;  1SMX A;  4DV1 L;  5GQO A;  1HNZ Q;  3GTM H;  4KHP L;  3J81 i;  1FGU A;  2D0P A;  1HJP A;  4A3E H;  2IX1 A;  2JA8 H;  5E7N A;  2UUB Q;  4DR2 L;  4JI0 L;  2ZTD A;  4NXN L;  1UWV A;  1UEB A;  2HQL A;  2Z0S A;  3M4Q A;  4JG2 A;  5IYC H;  2VQF L;  1RL2 A;  5JEA G;  4GOP A;  5IP7 G;  1Y1W H;  4UY8 C;  3HFZ B;  1V43 A;  5FLX c;  3H3V H;  1YJW A;  1SE8 A;  1N34 L;  1I3Q H;  4JI8 Q;  4LF5 L;  1QVG A;  3U58 A;  1TWG H;  2YU9 H;  4BXX H;  2N3S A;  5GAG C;  5LMN W;  4HJ8 A;  3HOY G;  3MXN B;  5IWA L;  2DUD A;  2UUA L;  4L5Q A;  5C0X G;  1NE3 A;  1W2B A;  2UUC Q;  4IFD G;  2IX0 A;  4LUZ A;  3SGI A;  4C3I H;  5LMN Q;  4DV6 Q;  1I94 L;  2ASB A;  1VQH A;  1VQC A;  1VQN A;  5IT9 c;  4RG1 A;  1PV4 A;  4PZ7 A;  1O7I A;  2CKZ B;  3RR5 A;  2PMZ E;  3MEF A;  3I4N G;  2UXC L;  1Y1V H;  3STB D;  4JI7 L;  4TQU S;  5C4X G;  2IHE A;  5JJL A;  1SN8 A;  4ME3 A;  4LF8 L;  1Z9F A;  3K7A H;  1XPO A;  4JI5 Q;  5FLM G;  4DV0 L;  4J15 A;  2L15 A;  3H15 A;  2KEN A;  3OYY A;  3CF5 A;  1L1O B;  1X54 A;  3PF5 A;  2Y0S E;  4FDB A;  4UP8 A;  4DV2 Q;  1VQP A;  2Q2U A;  4OXP A;  4IFD J;  3K8A A;  1VQ7 A;  5LMU L;  1D8L A;  3PIP A;  4BBS H;  1VQA A;  2GVB A;  1N8R C;  3UDG A;  3S17 H;  2A1A A;  3AFP A;  2GVA A;  1IBK L;  2MO0 A;  1XNQ L;  2JEB I;  1HNW Q;  3CCM A;  1IYJ B;  3OTO L;  1HR0 W;  1YIJ A;  1CKN B;  1JMC A;  2ALY B;  4NXM Q;  4R4Q A;  3E9I A;  2OTL A;  1KL9 A;  1HZB A;  2ATW A;  1J5E Q;  1I50 H;  4GKJ L;  1HR0 Q;  1Q1B A;  1CUK A;  2R7F A;  3CPW A;  3PF4 A;  2E2H H;  4DR4 Q;  1YVC A;  4GN3 B;  4IPH A;  2UUB L;  2JA9 A;  2NVT H;  1E7Z A;  3G48 A;  1CKO A;  2WAQ E;  1XTD A;  3GTQ H;  4B3S L;  3ULP A;  2R93 G;  4HID A;  4JOI C;  4GOP B;  1PH1 A;  2VQF Q;  4OWW B;  2EIF A;  4JI8 L;  5IP9 G;  1Y14 B;  3B6Y A;  5M3M G;  4X62 Q;  3S1R H;  1N32 L;  3UDI A;  5GRO A;  1OXS C;  1YZ6 A;  1N34 Q;  1EIY B;  3U4Z A;  2OQ0 A;  1GM5 A;  2XGT A;  4DUY Q;  3E0E A;  3CCV A;  1JB7 A;  4LF5 Q;  4POF A;  4AQY Q;  2UUC L;  1Q81 C;  4YWK A;  5H1S E;  4GNX B;  5IWA Q;  5LMN L;  1MIU A;  1YHQ A;  1M1K C;  4WJ3 M;  1M90 C;  1L2F A;  3CMA A;  3CPF A;  4B3R L;  1I94 Q;  2KCM A;  3K80 C;  4C2M H;  1YIT A;  1D7Q A;  1J6Q A;  1W3S A;  1BBW A;  2OQK A;  2ZTC A;  2R92 G;  1WCM H;  4GKK Q;  1IBL Q;  2I5L X;  2UXC Q;  1P8L A;  4YCV A;  2JJQ A;  1L0W A;  1C0A A;  2JA7 H;  3HOV H;  1B7Y B;  4L5T A;  3W1B A;  3M3Y H;  2F52 A;  3D0F A;  3FKI G;  3K0X A;  2MNA A;  3EBE A;  4A3F H;  4OX9 L;  4LF8 Q;  1LYL A;  1X3F A;  3FKI H;  1Z47 A;  4DV0 Q;  4JV5 L;  2RHS B;  4O0A A;  2YYZ A;  4OO1 I;  1B70 B;  3TRZ A;  1WI5 A;  3E9H A;  4LWC A;  2NZO A;  3NBH B;  5C44 G;  1NMG A;  3I4M G;  1WOC A;  2NZH A;  4A3I H;  1YEZ A;  2MQH A;  5LMU Q;  4JBK A;  4DR5 Q;  2VUM H;  4BA2 I;  2BH8 A;  4R1J A;  1NMF A;  4GLA C;  4X64 Q;  2PI2 A;  4DAY B;  1VQM A;  5AJ3 L;  1OXT A;  3U4V A;  4A3M H;  1HNW L;  3CME A;  3M9B A;  5GAE C;  1IBK Q;  2UXB Q;  4LF7 L;  4NXM L;  1YHB A;  5DLQ E;  1S3O A;  3OTO Q;  4EQ5 A;  5IYB H;  3HOU G;  2GN5 A;  3KJO A;  4P71 A;  1J5E L;  3BZC A;  3CCJ A;  2DGY A;  2JA8 G;  1N36 Q;  4DR4 L;  4GKJ Q;  1AE3 A;  5IY0 A;  1VQB A;  4JOI A;  5IYC G;  1IBM L;  1HNX L;  1R9T H;  1Y1W G;  3KDF A;  3S2D H;  3J7A 5;  5C0X I;  1CSQ A;  1SR3 A;  4IFD I;  4PMW A;  4BXX G;  4B3S Q;  4X62 L;  1X56 A;  4RMF A;  4OWT B;  1FL0 A;  1QZH A;  2D0O A;  4JI2 Q;  5IYD H;  2KHJ A;  4DUY L;  4DR6 Q;  1N32 Q;  3KOJ A;  2ZM6 Q;  1VQ6 A;  1A62 A;  4AQY L;  3HOZ H;  4HJ7 A;  4AYB E;  2OCE A;  1NBW A;  3D31 A;  5ELO A;  4BBR H;  3G71 A;  4A76 A;  1N33 Q;  1RIP A;  2ZJQ A;  3LGJ A;  1T9H A;  3ULL A;  2K5V A;  4QQB X;  2A8V A;  4Y52 H;  4HJ9 A;  3NEN A;  2Y0S G;  4B3R Q;  1Y1V G;  4DK6 C;  2HIX A;  2F4V Q;  4GKK L;  1IBL L;  4IPD A;  1GVP A;  3PCO B;  4BY1 H;  4JBM A;  1K83 H;  4X65 Q;  4DK3 C;  4DV3 L;  1UE1 A;  2I5H A;  3GTL H;  3BZK A;  3S16 H;  1Q1E A;  2HHH Q;  3S1Q H;  3PUY A;  1NTG A;  3S24 A;  1KC8 C;  4DV7 Q;  1C9O A;  1X55 A;  4LF4 L;  1C7Y A;  2IHF A;  3HKZ E;  3PIO A;  1KXL A;  4C3H H;  1JE5 A;  1HZA A;  1TWF H;  4A93 H;  4OX9 Q;  3F2B A;  2R7Z H;  2OTJ A;  1G6P A;  4QGU A;  4UP7 A;  2KBN A;  3T1Y Q;  2WP8 J;  4JV5 Q;  3S1N H;  2B63 H;  2HIV A;  1A0I A;  4BBS G;  3ERS X;  4LF9 Q;  2VNU D;  3A5Z B;  3M4P A;  5M5X H;  3Q8D A;  1VQD A;  2AKW B;  4DR5 L;  1X65 A;  2EQS A;  3TQY A;  1H95 A;  4X64 L;  3S14 H;  3FHW A;  4IPC A;  3RN2 A;  2R6G A;  1FJG Q;  3CP0 A;  5J3B A;  3J80 c;  1MJC A;  1YJN A;  1FVI A;  2UXB L;  1VCI A;  1WYD A;  2WAQ G;  5AJ3 Q;  4HIK A;  2C35 B;  2I5M X;  4EX5 A;  1PH9 A;  5JJK A;  5HGQ A;  1OXV A;  2LXJ A;  1LTL A;  1Q46 A;  3W5O A;  3J81 c;  4LF7 Q;  4A3D H;  4X6A H;  2RCN A;  4BA1 I;  5GAD C;  3ZJY C;  3L2P A;  2F3I A;  4UP9 A;  5GAH C;  4YCU A;  2Q2I A;  3HKS A;  1N36 L;  2ID0 A;  5JJI A;  3F8T A;  1KD1 C;  2ES2 A;  1JJG A;  5IE8 A;  1OXX K;  2AWO A;  1VQJ A;  1IBM Q;  5EAY A;  1E22 A;  3W1G A;  3KDF B;  1VQ5 A;  1HNX Q;  4MTN A;  4PZ6 A;  1BBU A;  1TWA H;  4A3J H;  1QUQ A;  2CWP A;  3I2Z A;  2B29 A;  3GTJ H;  2IT1 A;  4KHZ A;  4JI2 L;  3F1Z A;  4PG3 A;  2VW9 A;  4DR6 L;  2ZM6 L;  3RNU A;  4IJL A;  3KF6 A;  3U50 C;  4L5S A;  2NVQ H;  4IOC A;  4JBW A;  4DR7 L;  1N33 L;  1OXU A;  1CSP A;  1CKM A;  4P75 A;  4A3K H;  3UDF A;  4XTC S;  3HOW H;  3CW2 C;  4DNI A;  2KHI A;  1DGS A;  1EWI A;  2K75 A;  1MJE A;  1PH2 A;  2CWA A;  1X3E A;  2N8N A;  3F2C A;  1WCM G;  3JAM i;  2F4V L;  1K9M C;  4X65 L;  3HOX H;  2LXK A;  3PSI A;  4GN4 B;  1EFW A;  5M5W H;  1VQO A;  1IL2 A;  2JQO A;  4A75 A;  1XNR Q;  2HHH L;  1G51 A;  4P72 A;  4DV3 Q;  1VQG A;  1PH3 A;  2JA7 G;  3HOV G;  1U5K A;  1EOV A;  1XMO Q;  4DV7 L;  4A3F G;  4ALP A;  3GTP H;  3WWV A;  3CCU A;  1SLJ A;  5ELN A;  3JC6 6;  4LF4 Q;  3CCS A;  3T1Y L;  1PHJ A;  5M3F G;  1XPU A;  3GTG H;  5HY6 A;  1PFS A;  4B3M Q;  3CQZ H;  5M3F H;  1N9W A;  2N78 A;  4LF9 L;  4A3I G;  4QJF A;  2JA5 H;  2VQE Q;  2VUM G;  3RZD H;  1X6O A;  2LSS A;  2ZTE A;  4YY3 L;  3RLF A;  1X3G A;  4MZ9 A;  1JJC B;  1FJG L;  4DAM A;  5C4J H;  4LUV A;  2VZA A;  4A3M G;  1HH2 P;  3CCR A;  4JI4 Q;  2E5L L;  3I56 A;  4NB3 A;  4OON A;  1PYB A;  2B3G A;  2Q2H A; 
#chains in the Genus database with same CATH topology
 1HZC A;  3QO2 A;  2RCF A;  3NTH A;  4HSP A;  1SSO A;  1PYS B;  4K8J A;  1STH A;  2E2J H;  4LF6 L;  5BR8 L;  3GD7 A;  2WB1 E;  4K0K L;  1XYI A;  3RD4 A;  3PMF A;  4ABN A;  1VMP A;  4OGQ C;  2D62 A;  3BJU A;  5IYD G;  1STA A;  4HJA A;  1JT8 A;  3CRK C;  2EY1 A;  3K81 C;  3K7A B;  2F0M A;  2ZXP A;  2DJG C;  1VQI A;  3KF6 B;  2B2W C;  1HXY D;  2NN6 G;  2CW0 C;  1WFQ A;  5D65 A;  2FMM A;  4WJW A;  3CCQ A;  2YTV A;  1VQE A;  1EZ6 A;  2UXD L;  1XXG A;  2RSO A;  4QF4 A;  1SRU A;  5LL6 X;  5BN3 A;  1I4X A;  3ULJ A;  5IOD A;  4P73 A;  1ONL A;  3EQL C;  1VF5 C;  1LLR D;  2CH4 W;  1I6H H;  2R7Z G;  1CZG A;  3NEL A;  2PZU A;  3DEP A;  2KA7 A;  1AZQ A;  3MEH A;  1JQY D;  3CHB D;  2LY7 A;  5C0X H;  4IFD H;  1JOQ A;  1SYE A;  3AFQ A;  3GTQ B;  3K6O A;  4JI4 L;  2EXD A;  5IGC A;  1NJI C;  4NPS A;  5FKA C;  3I4N H;  3T53 B;  1BKB A;  4DUZ Q;  2CCZ A;  4DV4 L;  4PZ8 A;  3A7L A;  2CFM A;  1QCB D;  2DN8 A;  2IPK D;  1SNM A;  5K5P A;  3A0J A;  3SDZ A;  4IPG A;  4ZYS A;  1YI2 A;  3O13 A;  4L6T B;  4CKE A;  1LUZ A;  5C0X J;  3NBH A;  3I7F A;  4BWG B;  2K6A A;  4TSS A;  2K52 A;  1B50 A;  1CTM A;  2NVY B;  2CQO A;  2PPB C;  4DAY A;  2UU9 L;  3K7U C;  4EVO A;  2PZT A;  4IUP A;  3BDO A;  3SK5 A;  3AQQ A;  3KYH C;  2YTX A;  3CC4 A;  3M4Y A;  4A3K G;  1RCV D;  1TXY A;  1PH8 A;  1SFO H;  4JI6 L;  5DAU A;  5EPJ A;  2ZXO A;  5KRU A;  3GTK H;  3HOX G;  3I4L A;  4A3I B;  3I55 A;  1NCV A;  5C3E G;  2EJM A;  4HIM A;  5IGB A;  2OWO A;  3TRE A;  3BYT B;  5C3E H;  1KTK A;  3BG3 A;  1HHV A;  2XN9 C;  1SNC A;  3NQT A;  4K14 A;  4UHV A;  1WD0 A;  2YV5 A;  3SK8 A;  1GD7 A;  5IP9 H;  4NMZ A;  3NTI A;  4DR3 Q;  3DM3 A;  4DV6 L;  3K58 A;  2A6E D;  3C1E A;  1F2M A;  2P5Z X;  3PUZ A;  2WB1 G;  3IKJ A;  4ZAI A;  1EFI D;  2NVY H;  2JA6 G;  3MZ5 A;  1ESR A;  4XIG S;  1PTO D;  3D6W A;  4LW1 A;  1I4Q A;  4DNT B;  5JVG 3;  1GJX A;  3OHX C;  1E24 A;  1C4Q A;  2K4K A;  1Q12 A;  3M4O H;  4A3L G;  3HKZ B;  4XQJ A;  2FMC A;  4JI1 Q;  2N55 A;  4A3L H;  3TS0 A;  4B3T Q;  3CC2 A;  1VQF A;  4BY1 B;  3EFX D;  1O7Z A;  3MFY A;  1RF2 D;  5IGG A;  1SE4 A;  1D5Z C;  4QY7 A;  3S16 B;  3S1Q B;  1GKH A;  4OO1 G;  2RHQ B;  3MXU A;  1RTN A;  3CCL A;  4JPB W;  4C3H B;  1TWF B;  1TKW B;  2QEX A;  4X3K A;  4KKU A;  5KEE A;  1XNQ Q;  1STG A;  4H0L C;  4C1N K;  2F0D A;  1V1Q A;  2V1C C;  5ISR A;  1SJE D;  3HG9 A;  2KJX A;  1SMX A;  5GQO A;  1FGU A;  2IWH A;  1HJP A;  4I65 A;  2AQ2 B;  5KND A;  2UUB Q;  2XWB B;  4N8X 1;  1UEB A;  2Z0S A;  5IYC H;  1LV9 A;  1Y1W H;  5IP7 G;  3IFD A;  2WAQ B;  1SE8 A;  4BXX H;  4X3S A;  4LF5 L;  1QVG A;  5COY A;  1TWG H;  5GAG C;  4HJ8 A;  1KAB A;  2DUD A;  3MFG A;  2NB0 A;  3FMC A;  1NE3 A;  3ONA B;  1VQH A;  1ENF A;  1VQC A;  1J8I A;  3BVG A;  1O7I A;  2CKZ B;  4PZ7 A;  2PMZ E;  3MEF A;  3K5L A;  5CV6 A;  3JAM L;  1UUP A;  4RKL A;  3OW7 A;  1B44 D;  1DZ1 A;  3H6M A;  5E4W C;  4IUR A;  4RCN A;  1A2T A;  1XPO A;  4DV0 L;  1BUV T;  4F87 A;  1X54 A;  3PF5 A;  3OSO A;  4KD3 A;  4UP8 A;  1D5X C;  1EY6 A;  1DOK A;  5LMU L;  3WOE A;  2EYO A;  3PIP A;  4BBS H;  2GVB A;  3V96 A;  1SYB A;  1IL8 A;  5A2Q L;  2E75 C;  1E0B A;  5I4D A;  5FOB B;  4K2L A;  2K32 A;  3GTP B;  2MO0 A;  2K5Q A;  1HNW Q;  3OTO L;  1LTI D;  5C6A A;  1MGS A;  5EPL A;  3E9I A;  1KL9 A;  1A3U A;  2ATW A;  4U68 A;  1LT6 D;  4OEM B;  1HCZ A;  4K5W A;  3G48 A;  4A3M B;  4OWW B;  1K28 A;  4MTK A;  2PO4 A;  5GRO A;  1OXS C;  1YZ6 A;  3R2T A;  3U4Z A;  2F0L A;  3RUZ A;  4CDD C;  3NSW A;  2DY8 A;  4AQY Q;  1II3 A;  2UUC L;  3Q24 A;  1MIU A;  3CMA A;  2BOS A;  3PO3 B;  4FF3 A;  1I94 Q;  3K80 C;  1YIT A;  1R9T B;  1S5F D;  1LTA D;  1W3S A;  1WCM H;  1XX8 A;  1EIG A;  1C0A A;  3M3Y H;  3W1B A;  2HD3 A;  1JWS D;  4KJN A;  4X3T A;  4A3F H;  5KGU A;  1BQQ T;  1Z47 A;  3RMH A;  1PTO F;  2RHS B;  4KHV A;  4KKS A;  3I3C A;  3D4D A;  3MTS A;  3NBH B;  5EQ0 A;  3JAM E;  5C44 G;  2XWJ B;  2MQH A;  4JBK A;  2VUM H;  2BH8 A;  3SR1 A;  4DAY B;  1VQM A;  1K8O A;  4A3M H;  3CME A;  3DHQ A;  1IBK Q;  1S3O A;  1J5E L;  4R8N A;  5A2Q E;  3GTO B;  1XWE A;  5IGF A;  4MHE A;  3QB3 A;  1HNX L;  1R9T H;  3S2D H;  1CSQ A;  4ZKC B;  3P20 A;  1X56 A;  3D3R A;  2FIN B;  1ILQ A;  2B2T C;  1LT3 D;  4OL7 A;  5EKI A;  3M7G A;  1DM0 B;  1BO0 A;  4DUY L;  2ZM6 Q;  1VQ6 A;  3HOZ H;  4RGM A;  2DY7 A;  3D31 A;  4A76 A;  4C3I G;  3ULL A;  3PO2 B;  1PZK D;  2A8V A;  4HJ9 A;  1SYF A;  3L3O C;  1FR3 A;  1Y1V G;  4DK6 C;  2HIX A;  4GKK L;  1IBL L;  3AB9 A;  5I2Y A;  1JC7 A;  1UE1 A;  4C3J B;  3GTL H;  1EU3 A;  2F3V A;  3KLS A;  2K5W A;  2HDL A;  1C7Y A;  4DK1 A;  1KXL A;  1V1P B;  1JE5 A;  5D14 A;  2G9H D;  2OTJ A;  1G6P A;  3T1Y Q;  1ENC A;  3S1N H;  4JV5 Q;  5ELE A;  1FNU A;  5F2D A;  4LF9 Q;  2VNU D;  5M5X H;  4IPC A;  2F0I A;  3CP0 A;  1X3Q A;  2IL8 A;  2BDN A;  1VCI A;  3TME A;  2E74 C;  4EX5 A;  1PH9 A;  5M3M B;  1Q46 A;  4A3D H;  4LF7 Q;  4BA1 I;  3ZJY C;  1D1I A;  5NUC A;  3CQZ B;  2M00 A;  5IT9 L;  5GAH C;  1ZXT A;  3IFT A;  3QOL A;  1JJG A;  3D6C A;  1IBM Q;  2A6E C;  2K7V A;  2XRS D;  4MTN A;  2B2W A;  3SVM A;  4HN7 A;  1IYU A;  2HQE A;  2SDF A;  3KF6 A;  4F88 A;  1OXU A;  1CKM A;  1PTO C;  3HOW H;  1MJE A;  2KHI A;  2JYO A;  2F4V L;  3I4M B;  3Q0A A;  4X65 L;  2LXK A;  4XT1 B;  4TRD A;  2HDM A;  2JA7 G;  3HOV G;  1UEA B;  4A3G B;  2NZ1 D;  2NTS A;  2KEE A;  3JC6 6;  4LF4 Q;  1PLF A;  5M3F G;  1TII D;  1S5B D;  1UNS A;  4K5X A;  1EEF D;  4B3M Q;  3CQZ H;  5M3F H;  2X6G A;  2JA5 H;  2VQE Q;  3RZD H;  2ZTE A;  3RLF A;  1X3G A;  1CA6 A;  1EZ8 A;  3ZYY X;  1U4M A;  3I56 A;  3BS1 A;  4OON A;  2ENB A;  3HS0 C;  5IYB G;  5K36 G;  3DM1 A;  5C4H A;  5HUR A;  4UPA A;  4R4I A;  3H3V I;  1QG7 A;  2AWN A;  2WFW A;  4KK7 A;  1PH4 A;  1LM0 A;  3S15 H;  3RZO H;  5E1F A;  1SNO A;  4APV A;  4RHS A;  1QUQ B;  5IT9 E;  3EIV A;  1RJT A;  1FGB D;  4LFC Q;  2Z6K C;  1LT4 D;  1PYW D;  1QVC A;  3AYH B;  4BBR G;  2E76 C;  5FJ8 G;  2OF1 A;  3KUP A;  4RA8 A;  4J1M A;  2OXP A;  5FJ8 H;  2KOL A;  5JPM C;  4MN3 A;  3J81 j;  3T16 A;  1KNE A;  4DPG A;  3E0J A;  1YJ9 A;  1HUN A;  1Y8N B;  4JVZ A;  2JE6 I;  3KJP A;  1SYG A;  4CDF C;  3W2D A;  3D4W A;  3RLN A;  3T1H Q;  4A93 G;  5JEA H;  1VQ8 A;  1S72 A;  1PFN A;  2JEA I;  4TKO B;  3DLL A;  2AUJ D;  3A74 A;  3TZD A;  1EWH A;  2B63 G;  4DR3 L;  3FPP A;  3HOY H;  2MUY A;  1LTB D;  2BA0 A;  4N9T A;  2F03 A;  1TWC H;  2NVT B;  3A7A B;  1XJV A;  2KUM A;  1PFB A;  4X66 Q;  4IOA A;  3J7Z C;  3A8J E;  1XPR A;  3H09 A;  1ASZ A;  4HR7 B;  2MHV A;  3S1R B;  4RGT A;  1I4H A;  5JEA J;  1HUM A;  1EQR A;  4JW0 A;  4OEL B;  4QB4 A;  5C4X H;  5DM6 3;  1EUJ A;  4JI3 L;  2F0T A;  1VQ4 A;  1E1O A;  5J1Z A;  1HTP A;  4JI1 L;  2VL6 A;  3W3A A;  4QIW E;  2QCP X;  4B3T L;  5C3W A;  3CC7 A;  4KMU C;  1L1O C;  2H5X A;  3RN5 A;  4A3J G;  2HT1 A;  4JYA Q;  2RF4 A;  3M85 A;  2QDB A;  4FXD A;  4ZK9 B;  4OWX B;  3F2D A;  2Z9H A;  3VR3 A;  3RLO A;  5E4X A;  2XTI A;  4JBJ A;  3QWN A;  2R7D A;  4HIO A;  1G29 1;  5L37 A;  1GHK A;  2KED A;  1TS3 A;  4KI0 A;  1X9N A;  3UE1 A;  3J7A F;  3G6E A;  1EY4 A;  5I6Y A;  1SND A;  1F2Y A;  1EQT A;  4DR2 Q;  5I6W A;  3VR2 A;  2AQ3 B;  2ICE C;  4DR1 L;  2QF7 A;  3QOJ A;  2R93 H;  3Q23 A;  2E2D C;  1XMQ Q;  3IRB A;  4GOP C;  3HOU B;  5IOC A;  1UE7 A;  5D3D A;  2UUA Q;  3GTM B;  2EYP A;  3TP8 A;  1PRT B;  2PI2 E;  1D2B A;  2F0P A;  2KVM A;  4YHH L;  2A19 A;  1A8V A;  3VYT A;  1EWC A;  2CHB D;  3T51 B;  2I0Q A;  1CFM A;  4JI7 Q;  2NVX H;  1M8A A;  2G9D A;  4G7Z C;  2C9O A;  2MPM A;  3VR6 A;  5D3I B;  2JK8 A;  1S5C D;  5CC4 A;  4AYB G;  4LFB L;  4A3B G;  3MC0 B;  2PQA B;  1GO3 E;  4GLX A;  1A63 A;  1K83 B;  2NN6 I;  4A3B H;  4BY7 G;  1WJJ A;  1A3T A;  1EQQ A;  4BY7 H;  3HGB A;  3VR4 A;  4NKL A;  3K0Y A;  3PUW A;  1PVO A;  1AFP A;  2R7Z B;  3HEJ A;  4DK0 A;  4FO2 A;  3G7L A;  3PUV A;  4R4O A;  4FXK C;  4JC0 A;  3HOU H;  2AHO B;  3KLW A;  4A3E G;  4DV1 L;  3GTM H;  3X3N A;  4KHP L;  2QDL A;  3KK7 A;  2D0P A;  5EKL A;  3ND9 A;  4DAP A;  4A3E H;  2JA8 H;  4WOR A;  4JI0 L;  4M8A A;  4NXN L;  1UWV A;  2HQL A;  4UY8 C;  3P1H A;  4KJO A;  4PMC A;  4KN4 C;  1YJW A;  1I3Q H;  2SNS A;  4JI8 Q;  2F0E A;  2N3S A;  3PQI A;  5LMN W;  2M2L A;  1I50 B;  5G3L D;  5CV7 A;  5C0X G;  3F2U A;  1W2B A;  4IFD G;  2E2H B;  1Q3L A;  5LMN Q;  1I94 L;  1K0S A;  2ASB A;  1D5M C;  1VQN A;  2X69 A;  4RG1 A;  4HCE A;  3I4N G;  4CHT B;  2XSC A;  5KYL A;  1NR2 A;  3STB D;  1PFM A;  1IHZ A;  1CT1 D;  1GUT A;  3K7A H;  2RDH A;  4JI5 Q;  3H15 A;  4A3K B;  3OYY A;  5IIF A;  4MIU A;  2Y0S E;  1Y8O B;  4DV2 Q;  4IFD J;  1VQ7 A;  1A3V A;  3HOX B;  1D8L A;  5M5W B;  1VQA A;  1B53 A;  2EYM A;  3UDG A;  2A1A A;  5ELB A;  2GVA A;  3DWP A;  2EOT A;  1IBK L;  1CK1 A;  2A68 D;  2JEB I;  1KLU D;  1BCP D;  1HR0 W;  3I73 A;  1NR4 A;  2WV6 D;  1JMC A;  1LTT D;  3GTG B;  1BBX C;  1HZB A;  1TY0 A;  1I50 H;  1HR0 Q;  4V0B A;  1ML0 D;  1CUK A;  2E2H H;  1YVC A;  5CGK A;  1ET9 A;  2WAQ E;  3GTQ H;  3TBI B;  1GHJ A;  2RBM A;  4JOI C;  5ELD A;  5TSS A;  1GOZ A;  2H1E A;  5IP9 G;  3B6Y A;  4X62 Q;  1N34 Q;  1EIY B;  2OQ0 A;  3DUZ A;  1PMR A;  4CDE C;  2KCN A;  1T5E A;  1ET6 A;  5H1S E;  5IWA Q;  1M1K C;  1M90 C;  1L2F A;  1WTR A;  3NBI A;  4HAE A;  1J6Q A;  1BBW A;  2XIW A;  4XQQ A;  1HA6 A;  2B2V A;  4R8I A;  1Z7T A;  3GV6 A;  3MHB A;  3NE5 B;  2ICI A;  4YCV A;  2B39 A;  4Q5V A;  3D0F A;  3AU7 A;  1V1P A;  3EBE A;  4UDU C;  4KN7 C;  1ICF B;  3OIP A;  4JV5 L;  2EY5 A;  3CKI B;  2YYZ A;  4OO1 I;  4DNR B;  1TS4 A;  3E9H A;  4LWC A;  5JVH 3;  2CQA A;  2NZO A;  1WOC A;  4A3I H;  1YEZ A;  4DR5 Q;  4K6L A;  4GLA C;  4R1J A;  1ESF A;  3SEB A;  4X64 Q;  1AN8 A;  4O42 A;  4O1N A;  1OXT A;  3T4A C;  3U4V A;  3PIP 3;  1HRJ A;  2RKS A;  4LF7 L;  2B2U A;  4CJ0 B;  4NXM L;  1YHB A;  2GN5 A;  2JXM B;  3KJO A;  1HFN A;  3CCJ A;  4DR4 L;  1O78 A;  4GKJ Q;  1AE3 A;  2E2I B;  1B1Z A;  2O2L D;  1IBM L;  5IYC G;  4QCL A;  3U9O A;  1Y1W G;  5KNC A;  2AUK A;  3J7A 5;  2EYL A;  5BN5 A;  4PMW A;  4BXX G;  4OWT B;  2K1B A;  2D0O A;  2H4O A;  5T1I A;  2KHJ A;  4KKT A;  3KOJ A;  1N32 Q;  2A73 B;  2PW5 A;  2HCI A;  5ELO A;  1RIP A;  2ZJQ A;  1T9H A;  4QQB X;  5C5M A;  2OT2 A;  2Y0S G;  1JIC A;  4BY1 H;  4DK3 C;  1TWA B;  1PZI D;  2I5H A;  3BZK A;  3S16 H;  1Q1E A;  3S1Q H;  1EY0 A;  3PUY A;  3S1M B;  4LMQ D;  2NVQ B;  1NTG A;  1KC8 C;  4LF4 L;  1X55 A;  1TR5 A;  2IHF A;  4C3H H;  1TWF H;  1HZA A;  4XT3 B;  3F2B A;  4UP7 A;  4WFN 3;  4BBS G;  3ERS X;  1SNP A;  1MD2 D;  3M4P A;  1X65 A;  2EQS A;  3TQY A;  5FO8 B;  4K2K A;  1E2W A;  3FHW A;  1FJG Q;  2R6G A;  3J80 c;  1YJN A;  2UXB L;  1WYD A;  2WAQ G;  5AJ3 Q;  2C35 B;  3HRZ C;  2PNR C;  1OXV A;  2LXJ A;  3J81 c;  1RDP D;  1JCK B;  1A2U A;  1DYQ A;  4V19 0;  5GAD C;  1QOH A;  1BCP F;  1K8M A;  4UP9 A;  4EQP A;  1N36 L;  2RDF A;  3HKS A;  1WVL A;  5C4J B;  1VQJ A;  2ZXR A;  2B8F A;  5EAY A;  1FD7 D;  1TWH B;  1EY9 A;  1BBU A;  1TWA H;  4S3S A;  1VDZ A;  1QUQ A;  1CM9 A;  2CWP A;  2EDG A;  3I2Z A;  2IT1 A;  3KBX A;  4JI2 L;  4DR6 L;  3ND8 A;  4IJL A;  4L5S A;  2NVQ H;  4JBW A;  2IW3 A;  2F0G A;  1N33 L;  5M5Y B;  5CV4 A;  4HED A;  4P75 A;  4DA2 A;  1LAB A;  3CW2 C;  4DNI A;  3H0G B;  2CWA A;  3J80 L;  1WCM G;  3JAM i;  1H9M A;  5C44 B;  5ELF A;  1EFW A;  3ITP A;  1JOK A;  4GN4 B;  1IL2 A;  1LAC A;  1B4O A;  4A75 A;  3J81 L;  4P72 A;  2HHH L;  4FVM A;  4DV7 L;  4A3F G;  3GTP H;  4GZY C;  2EXZ A;  3LWE A;  5ELN A;  1XPU A;  3MXN A;  4Y7N B;  1H9R A;  3Q6S A;  3WOF A;  1N9W A;  4IAL A;  3NQI A;  4RCO A;  4QJF A;  4Z9C B;  2VUM G;  2CVR A;  2O5I C;  4G7O C;  4LAA A;  3LX0 A;  4DAM A;  5C4J H;  4LUV A;  4A3M G;  3TDQ A;  3HZX A;  4JI4 Q;  4H13 C;  4OIJ A;  2Q2H A;  1C48 A;  4KLK A;  2YU9 B;  3S2H B;  3SHL A;  4IN3 A;  4DV4 Q;  1EY5 A;  1KIX A;  2QKI C;  5COR A;  2PNH A;  2KHS A;  1MBY A;  1E2V A;  3BU2 A;  1Q7Y C;  1MKH A;  1B3Q A;  5M5Y H;  1S40 A;  2JP1 A;  4C3I B;  2J7Z A;  2Q8R E;  2K50 A;  2I07 B;  3H0G H;  1KRT A;  3Q22 A;  1B8A A;  3PO3 H;  3A5U A;  3CCE A;  4A3C H;  2B2Y A;  2BA1 A;  4WJ4 A;  4G7H C;  3NEM A;  3HOZ G;  3GP7 A;  3NTK A;  1CKN A;  2AMC B;  4ZQ3 A;  3TS2 A;  1K73 C;  3STB C;  4DR7 Q;  4YWL A;  2WAC A;  4JI6 Q;  2XRQ D;  2F0S A;  5CBA E;  1H9J A;  1PH5 A;  1L0X B;  1YNX A;  4POG A;  1BVS A;  2MFI A;  2Z6B A;  1XNR L;  3S17 B;  2QGQ A;  4FP5 D;  1XMO L;  1YBY A;  2K14 A;  1PDQ A;  4IO9 A;  3I72 A;  1XMQ L;  2TSS A;  3K57 A;  3S2H H;  2N49 A;  4IUU A;  3J80 E;  1CZW A;  1Q82 C;  2A68 C;  1BCP C;  1TY2 A;  1K8G A;  4LUO A;  1IW7 D;  4XQN A;  3G4S A;  3J81 E;  3GTO H;  1LTG D;  3A54 A;  3CD6 A;  4IZ8 A;  1Q90 A;  4YY3 Q;  1Z6H A;  5JJZ A;  4ODG A;  3A55 A;  4IJH A;  5HGT A;  3FDT A;  4A3D G;  2BCO A;  4DAV A;  4BS9 A;  3UE0 A;  1E3P A;  4GLV B;  2NUC A;  2J0T D;  1Y8P B;  5FLM H;  1NY4 A;  5AFW A;  3PO2 G;  1HFG A;  1SE2 A;  2VS1 A;  3ER0 A;  4RGN A;  4RKB A;  2PQA A;  3PO2 H;  1IZ6 A;  1ENA A;  4DXG A;  1I5F A;  4C3J G;  2G5D A;  2R92 B;  4QL5 A;  1K0R A;  5A35 A;  4C3J H;  3FEW X;  3HOV B;  1EIF A;  1CA5 A;  2JA7 B;  1PTO B;  4DN4 M;  5C3X A;  2VB3 X;  2EJF C;  3IL8 A;  3FKI B;  3ICE A;  3HOW G;  1YHA A;  3V2T A;  2L0C A;  2OEO A;  2A69 D;  5EJW A;  1S4Z A;  4DV5 Q;  1KRS A;  3G6J B;  4GN5 A;  1F9P A;  4PQX A;  1EEI D;  1VMC A;  4R4C A;  1U9R A;  3R2I A;  4DKA C;  5M3M H;  1MSG A;  1KQS A;  1UAP A;  1EYD A;  1E1T A;  2JA5 G;  3I70 A;  2E8G A;  1S5D D;  4GNX C;  3DXJ C;  1S5E D;  5CV9 A;  4MNO A;  4YWM A;  4DUZ L;  2MP1 A;  1BR9 A;  2R92 H;  4RHR A;  4JI5 L;  1QIL A;  5EPK A;  2A5H A;  4BBR B;  1GUS A;  4KV6 A;  1PA6 A;  3PUX A;  2R3Z A;  4DV2 L;  1K8A C;  4KY5 A;  4NDX A;  2F0W A;  2FXQ A;  1GUG A;  4LNQ A;  3PV0 A;  3I4M H;  3HP3 A;  1EYG A;  4A3G G;  1AE2 A;  1QZG A;  3U9S A;  4A3G H;  4OIK A;  4A93 B;  1SBB B;  3ERQ A;  3OIQ A;  1IXR A;  3OW2 A;  1K3R A;  4LFA Q;  1HR0 L;  2B63 B;  3NUC A;  3TP7 A;  1HNZ Q;  4PMB A;  5E7N A;  3OWE B;  3S14 B;  2HCC A;  2O4X A;  3T13 A;  4DFA A;  3M4Q A;  3MVV A;  1RL2 A;  5JEA G;  3K5N A;  3H3V H;  1N34 L;  1EY8 A;  1AW7 A;  3U58 A;  1BNZ A;  3DWQ A;  3HOY G;  1G6Z A;  1WTW A;  3MXN B;  5IWA L;  4L5Q A;  2EYJ A;  2UUC Q;  2IX0 A;  4LUZ A;  3SGI A;  3SK6 A;  4IUN A;  4KD4 A;  1E2Z A;  3RR5 A;  4R9W A;  2RDG A;  5CYU A;  4A3J B;  2NWG A;  1TS2 A;  4HSV A;  4H44 C;  5C4X G;  3V05 A;  2IHE A;  4ZLT F;  5CMD A;  1SN8 A;  1B3A A;  1RD9 D;  1PZJ D;  1T5X D;  3C1F A;  1YNJ D;  2L15 A;  1SNQ A;  2KEN A;  3VYS A;  2FHT A;  3MA2 B;  1L1O B;  1JWU D;  1VQP A;  2Q2U A;  4C2M B;  3K8A A;  3MXG A;  1TU2 B;  3K59 A;  4ZUI A;  1AZP A;  3FRP B;  3BDC A;  4F7X A;  2ZT9 C;  4U67 3;  2I46 A;  1XNQ L;  3CCM A;  1IYJ B;  2DNE A;  1YIJ A;  1CKN B;  2XNA C;  1H9K A;  3EVQ A;  5CBE E;  1JWM D;  1STY A;  1J5E Q;  1QNK A;  4GKJ L;  4NW2 A;  1Q1B A;  1DCZ A;  2R7F A;  1ZEQ X;  2D9U A;  3R3O A;  2EYF A;  4IPH A;  2UUB L;  2JA9 A;  2NVT H;  1O80 A;  1CKO A;  3C46 A;  4L8J A;  5LL6 S;  1LO5 D;  4HID A;  3A8K E;  4GOP B;  2R93 G;  2VQF Q;  2EIF A;  1Y14 B;  3S1R H;  1N32 L;  2PYK A;  3UDI A;  2IJ0 A;  1GM5 A;  2XGT A;  4RAU C;  4DUY Q;  2E2J B;  4YWK A;  1H9S B;  2A6H D;  4WJ3 M;  1JR0 D;  3CPF A;  4AYB B;  1ICW A;  3WDN A;  4C2M H;  4FYD A;  2OQK A;  4GKK Q;  1IBL Q;  2I5L X;  2UXC Q;  1P8L A;  2L9H A;  2JJQ A;  1JB3 A;  1B7Y B;  4L5T A;  2SOB A;  4XDX A;  4LF8 Q;  3VR5 A;  5I9O A;  2JN4 A;  4CJ1 B;  3VYU A;  3NWS A;  3LNN A;  3K5M A;  3J7A V;  1NMG A;  2WII B;  1NAP A;  5T1G A;  5KIX A;  1GUW A;  4BA2 I;  4CGY B;  1NMF A;  3OMC A;  5AJ3 L;  1HNW L;  1I6H B;  5GAE C;  1FNV A;  1IKL A;  4B9X A;  5DLQ E;  4EQ5 A;  3HOU G;  2QEJ C;  1A6X A;  3BZC A;  2KCC A;  2WIN B;  2DGY A;  2JA8 G;  5IY0 A;  1VQB A;  2A74 C;  1JE4 A;  1GXD C;  1CHQ D;  1CI3 M;  4JK1 C;  4QIW B;  5JOB A;  1IW7 C;  3I4N B;  4DXF A;  5C0X I;  1SR3 A;  4IFD I;  4B3S Q;  2L55 A;  2XVS A;  5IYD H;  4AQY L;  1DOM A;  2DNC A;  4HJ7 A;  2L12 A;  2NN6 H;  1MSH A;  3BVM A;  2KEC A;  2SNM A;  4IUT A;  4HTH A;  4B3R Q;  2IX3 A;  5E3F A;  2F4V Q;  4IPD A;  3PCO B;  1K83 H;  4X65 Q;  1C8C A;  2VXW A;  4KY7 A;  1AP0 A;  2SEB D;  1LT5 D;  5DEH A;  2PCF B;  2D5D A;  1SYC A;  3HKZ E;  4XYQ A;  2F0J A;  3PIO A;  3CU7 A;  4E6I A;  1SFO B;  4OX9 Q;  2R7Z H;  4QGU A;  3BVZ A;  5I2X A;  3GTK B;  3NPP A;  1D6E C;  2AQ1 B;  1B9M A;  1D1K A;  1A0I A;  2HIV A;  4I7A A;  1WD1 A;  1ILP A;  1DON A;  3A5Z B;  3OPO A;  3Q8D A;  5C3E B;  1H95 A;  2K05 A;  2A69 C;  4F8M A;  3RN2 A;  1FVI A;  1SE3 A;  4HIK A;  5KNB A;  2I5M X;  5JJK A;  4FF2 A;  5HGQ A;  4C1N I;  4X6A H;  1STN A;  1BOS A;  1EY7 A;  2Q2I A;  5EGT A;  2ID0 A;  5JJI A;  3F8T A;  1KD1 C;  3FPU B;  2ES2 A;  4X3U A;  4K8I A;  1SXT A;  1OXX K;  3R8B A;  3EA6 A;  2WB1 B;  3KDF B;  2B2T A;  1Q8I A;  1JOO A;  2EZV A;  4PZ6 A;  1F9Q A;  2JA6 B;  2NBF A;  4PNY A;  2B29 A;  4K5V A;  4KHZ A;  3F1Z A;  4PG3 A;  2ZM6 L;  3RNU A;  2NYZ D;  4IOC A;  4M1U B;  4DR7 L;  3M4O B;  2RSN A;  1CSP A;  2HUG A;  1EYC A;  4A3K H;  3BDL A;  2K75 A;  4KY6 A;  1PH2 A;  4NP5 A;  1TQO A;  3D4R A;  1K9M C;  3HOX H;  3PSI A;  1G2T A;  1W6J A;  2F0U A;  5M5W H;  2FJ2 A;  1VQO A;  2Q8T A;  1G51 A;  4DV3 Q;  3QR8 A;  5KYI A;  1EOV A;  1VF7 A;  3CCU A;  3C3L A;  4HCS A;  3CCS A;  3T1Y L;  2BE5 D;  3GTG H;  5HY6 A;  2RVL A;  4LF9 L;  4A3I G;  1WTH A;  4YY3 L;  4P2C B;  2JSO A;  1JJC B;  2VZA A;  1EQV A;  1HH2 P;  3CCR A;  1ZKO A;  1Y1W B;  2B3G A;  3MWY W;  4L63 B;  2JA6 H;  1TWG B;  4ZRZ A;  3KBG A;  1YNN D;  1PH6 A;  4K6D A;  1P16 A;  1VS0 A;  1XTC D;  4JI3 Q;  3I4O A;  4CKB A;  5DNF A;  1HQR D;  3NHH A;  2VB2 X;  2F0K A;  3KFU A;  1AH9 A;  2Y0S B;  1VQL A;  2BH2 A;  1JOR A;  3GDE A;  3QJY A;  4ZKB B;  4P74 A;  1WTV A;  4QMG A;  1LTR D;  3L7Z C;  3TSS A;  2L1B A;  4XXE A;  3BZD B;  1ZYR D;  4OO1 H;  3GQB A;  3JAM c;  1U0L A;  3MXP A;  4YIJ A;  4R4T A;  1CQF A;  3HKZ G;  2X6L A;  5CV5 A;  1HZ9 A;  1KHI A;  4DV5 L;  1F2L A;  4IQZ A;  5G3L F;  4BY1 G;  4BBS B;  1YNJ C;  5EBD A;  3I8Z A;  2VY3 A;  4C56 C;  4CBV A;  2F0H A;  4RFB A;  3AEV A;  3TP6 A;  2ZJR A;  2IY5 B;  5I9P A;  5EKK A;  3SE0 A;  3KF8 B;  5C5L A;  1SMY D;  1VQ9 A;  4C3H G;  3OMG A;  4DR1 Q;  5IP7 H;  3M7N A;  3GV3 A;  4B3M L;  4GNX A;  2VQE L;  1F2Z A;  1V8Q A;  4ZCK A;  4LJZ C;  4J8Q A;  3X3M A;  3VA7 A;  2E2I H;  2QA4 A;  4A4I A;  4YHH Q;  1MHW C;  4QUF A;  2E5L Q;  1O7L A;  1HPC A;  4HJ5 A;  1F9S A;  1EU4 A;  1M4V A;  3GO5 A;  4J6H A;  1V9P A;  2PZW A;  2KCT A;  3URY A;  3L0O A;  1ASY A;  1OTC A;  2LS0 1;  2MO1 A;  5IGE A;  2B8G A;  4ZUJ A;  4LF6 Q;  1GUN A;  5BR8 Q;  3UDX A;  2L11 A;  4LFB Q;  2K5N A;  4K0K Q;  1WCM B;  1FNW A;  3OWF A;  5FK9 C;  2A6H C;  2Z6K A;  1BDO A;  1Q86 C;  3IAY A;  3M3Y B;  4LFC L;  5JAV A;  3S1M H;  4A3F B;  3EN2 A;  2R61 A;  4LFA L;  1DJR D;  2F0Q A;  3CXC A;  1HNZ L;  4G57 A;  3I90 A;  4CDC C;  2KQ3 A;  4DV1 Q;  3KLR A;  1SRO A;  2VUM B;  4KHP Q;  2UXD Q;  3EJI A;  3VA5 A;  4O2D A;  3BYY B;  4GS3 A;  4JI0 Q;  2ZJP A;  1TVX A;  5C4Z A;  3T1H L;  3CAM A;  2K5H A;  2N88 A;  1LTS D;  4NXN Q;  4XYO A;  3I91 A;  1STB A;  1UE5 A;  1MI2 A;  1O7Y A;  2Q2T A;  2EE1 A;  2V4D A;  1QE6 A;  5JPN C;  1R4Q B;  3TEH B;  3H91 A;  2L4N A;  3FP9 A;  3E5S A;  1AEX A;  2Q8I B;  1F9R A;  4X66 L;  2EVB A;  4PV1 C;  4L5R C;  3S2D B;  1J9O A;  2Z8L A;  3DEO A;  1U4L A;  3PGZ A;  1V1O A;  3N52 A;  3NK9 A;  4RH6 A;  1TWH H;  4JCV E;  2EPB A;  2D2C C;  2PMZ B;  1KDC A;  3HOZ B;  3TP5 A;  1QVF A;  2MGS A;  4TVA B;  3AMU A;  1L1O A;  4FF1 A;  4AIM A;  1A15 A;  2Z4I A;  3H0G G;  4UAI A;  4AH6 A;  3PO3 G;  1KAW A;  1Q8K A;  1UE6 A;  4YCW A;  1DXM A;  2Z1C A;  4A3C G;  3VDY A;  1I4P A;  5CV8 A;  4JYA L;  1Y1V B;  3CRL C;  5C44 H;  3GTL B;  1G91 A;  4H02 A;  2UU9 Q;  2YTY A;  1VQK A;  4RWS C;  1CQV A;  1JJ2 A;  3J80 i;  1EL0 A;  3S1N B;  5CR3 A;  2K03 A;  4Y7N H;  5EBC A;  1PH7 A;  1WTX A;  4FNF A;  5M5X B;  1PRT D;  1G2S A;  3J81 i;  2IX1 A;  3J7Y W;  4DR2 L;  5FO9 B;  2ZTD A;  2PQE A;  1EIH A;  3SXH A;  2K04 A;  2K33 A;  4JG2 A;  1TT2 A;  4N8F A;  2VQF L;  4GOP A;  1QNU A;  4WRD A;  3HFZ B;  1V43 A;  5FLX c;  4A3D B;  1BCP B;  2YU9 H;  2RA4 A;  1I6V C;  3NP8 A;  2UUA L;  1ROD A;  2K28 A;  1OO9 B;  1H9S A;  1SDF A;  4C3I H;  2F3W A;  4DV6 Q;  3K5O A;  3ERO A;  5IT9 c;  2DJF C;  1PV4 A;  2NTT A;  3KLS X;  2UXC L;  1Y1V H;  4QUC A;  5BN4 A;  4JI7 L;  4Q0F A;  2CW0 D;  4TQU S;  1Y69 U;  3DMU A;  5JJL A;  1G8Z D;  2LKV A;  4ILW A;  2B2V C;  4ME3 A;  3TZU A;  4LF8 L;  4ID6 A;  1Z9F A;  1L0Y B;  5FLM G;  1SJH D;  4J15 A;  4ULL A;  1B2T A;  3CF5 A;  3HOW B;  4FDB A;  4OXP A;  4N9P A;  2QIL A;  5FLX L;  1N8R C;  3NXW A;  5IGD A;  3S17 H;  1SYD A;  2BDO A;  3AFP A;  2FFK B;  3FVQ A;  3QIA A;  1GUO A;  1SAP A;  4G4K A;  5J22 A;  4NXM Q;  2ALY B;  2CH4 A;  4EQN A;  4R4Q A;  1SEB D;  2OTL A;  5M3F B;  2B2U C;  1F77 A;  2JA5 B;  2WKD A;  3RZD B;  3CPW A;  3PF4 A;  4DR4 Q;  2BE5 C;  4GN3 B;  1R4P B;  1E7Z A;  4B08 A;  1XTD A;  4OHJ A;  4B3S L;  2EY2 A;  3ULP A;  1PH1 A;  4HMI A;  4JI8 L;  4CJ2 C;  5M3M G;  1U4R A;  1BXT A;  1QB5 D;  2QW7 A;  1JB7 A;  1BF4 A;  4LF5 Q;  3E0E A;  3CCV A;  2F0O A;  3E6Z X;  4POF A;  1EOT A;  1Q81 C;  4GNX B;  5LMN L;  1YNN C;  4IUV A;  1YHQ A;  3S15 B;  3RZO B;  1X32 A;  1DD2 A;  4B3R L;  3C2P A;  2KCM A;  1D7Q A;  2ZTC A;  4DF7 A;  1IKM A;  2R92 G;  3NWT A;  1L0W A;  2JA7 H;  3HOV H;  2F52 A;  3A8I E;  3FKI G;  3K0X A;  1B9N A;  1RHP A;  2MNA A;  4OX9 L;  4CKC A;  1PTO H;  1LYL A;  3H94 A;  1X3F A;  1I4R A;  3FKI H;  4EQO A;  4DV0 Q;  1CHP D;  3E3X A;  4O0A A;  1ZYR C;  2J4X A;  1B70 B;  3TN2 A;  1WI5 A;  3TRZ A;  1NSN S;  5DM7 3;  3I4M G;  1WTO A;  2MJ8 A;  3VYR A;  2M9V A;  4FF4 A;  2NZH A;  5LMU Q;  2EY6 A;  1X3P A;  4KTA A;  3N6R A;  1I4G A;  2PI2 A;  3M9B A;  2UXB Q;  3P75 A;  4RGO S;  2PW7 A;  2WKC A;  1W6K A;  3OTO Q;  5IYB H;  3H3V C;  5K36 H;  4P71 A;  1SMY C;  3HOY B;  4I7Z C;  5FLX E;  1TWC B;  1N36 Q;  4DGZ A;  1K3B C;  4JOI A;  1NNX A;  1KNA A;  1PRT F;  3KDF A;  5M9O A;  2LMC B;  1PXU A;  4X62 L;  4RMF A;  4EGV A;  1FL0 A;  3LWU A;  1QZH A;  5C4X B;  4JI2 Q;  4HMJ A;  3UI2 A;  3MAQ A;  4DR6 Q;  1KAA A;  1KLG D;  3SK4 A;  2F0F A;  1NUC A;  1A62 A;  1IYV A;  4AYB E;  2OCE A;  1NBW A;  4BBR H;  1HQM C;  3G71 A;  1N33 Q;  3LGJ A;  3DWA A;  2K5V A;  2L5T A;  1QJO A;  2F0N A;  4Y52 H;  1DOL A;  3NEN A;  2EJG C;  1FYC A;  4JBM A;  1GVP A;  4DV3 L;  1QWY A;  3GTJ B;  3QG1 A;  2HHH Q;  3S24 A;  1U4P A;  4DV7 Q;  1C9O A;  4A93 H;  2KBN A;  2RQX A;  3OOC A;  2WP8 J;  2Z4H A;  2B63 H;  1TS5 A;  4DU9 A;  4DR5 L;  1VQD A;  2AKW B;  4X64 L;  3D8G A;  3S14 H;  5J3B A;  3A56 A;  1EYA A;  1MJC A;  4B9W A;  1HTL D;  2R93 B;  1WTQ A;  1LTL A;  1RTO A;  3W5O A;  3L9A X;  2RCN A;  3L2P A;  2F3I A;  5FO7 B;  2F0V A;  4YCU A;  2F1M A;  2K5D A;  2C5C A;  5IE8 A;  2AWO A;  1E22 A;  3T56 B;  3W1G A;  1VQ5 A;  1KDA A;  1HNX Q;  1RKN A;  4A3J H;  3P7J A;  2NVX B;  3R93 A;  3GTJ H;  4IUQ A;  2VW9 A;  1KDB A;  2B2Y C;  3U50 C;  1WTP A;  4LK1 C;  3UDF A;  4XTC S;  1DGS A;  1EWI A;  2LFN A;  3F2C A;  1X3E A;  2N8N A;  4A3B B;  4ME5 A;  2GA4 B;  4BY7 B;  2JQO A;  1XNR Q;  5J39 A;  1PH3 A;  1VQG A;  1U5K A;  3KF8 A;  2O5J C;  3S9W A;  2TMP A;  1XMO Q;  5LHY 1;  4ALP A;  3WWV A;  1SLJ A;  2K01 A;  1HA5 A;  4H7B A;  5ELC A;  1PHJ A;  1PFS A;  3PIO 3;  2N78 A;  4A3E B;  2JA8 B;  1X6O A;  2LSS A;  4FXG C;  4MZ9 A;  1STE A;  1FJG L;  2F4I A;  1PRT C;  2EYH A;  2E5L L;  4NB3 A;  1PYB A;  1I3Q B; 
#chains in the Genus database with same CATH homology
 1HZC A;  4KLK A;  5IYB G;  5K36 G;  4DV4 Q;  1KIX A;  1PH6 A;  2PNH A;  1PYS B;  1P16 A;  1VS0 A;  3BU2 A;  4JI3 Q;  3I4O A;  1Q7Y C;  1MKH A;  4UPA A;  5M5Y H;  4R4I A;  1S40 A;  2E2J H;  4LF6 L;  3H3V I;  2AWN A;  5BR8 L;  2WFW A;  1PH4 A;  3GD7 A;  2WB1 E;  2K50 A;  1LM0 A;  4K0K L;  3KFU A;  3H0G H;  1KRT A;  3RZO H;  3S15 H;  1AH9 A;  4APV A;  1B8A A;  3PO3 H;  3A5U A;  3CCE A;  4A3C H;  1VQL A;  2BH2 A;  3GDE A;  2BA1 A;  4WJ4 A;  4P74 A;  2D62 A;  3BJU A;  3NEM A;  3L7Z C;  5IYD G;  4HJA A;  1QUQ B;  1JT8 A;  3EIV A;  3HOZ G;  4LFC Q;  3K81 C;  1CKN A;  2AMC B;  1VQI A;  2Z6K C;  1QVC A;  3AYH B;  3KF6 B;  4BBR G;  3JAM c;  1K73 C;  5FJ8 G;  3TS2 A;  1U0L A;  2NN6 G;  3STB C;  4R4T A;  4DR7 Q;  4YWL A;  1WFQ A;  3HKZ G;  5FJ8 H;  3CCQ A;  4JI6 Q;  1HZ9 A;  2YTV A;  1KHI A;  1VQE A;  3J81 j;  4DV5 L;  1PH5 A;  2UXD L;  4BY1 G;  4DPG A;  2JA6 H;  1YNX A;  1YJ9 A;  2VY3 A;  4POG A;  1BVS A;  1SRU A;  2MFI A;  1XNR L;  3AEV A;  2IY5 B;  2JE6 I;  3KJP A;  2ZJR A;  2QGQ A;  3ULJ A;  1XMO L;  4P73 A;  1YBY A;  2K14 A;  3KF8 B;  3RLN A;  3T1H Q;  1VQ9 A;  4IO9 A;  4A93 G;  1XMQ L;  4DR1 Q;  1I6H H;  2R7Z G;  5IP7 H;  1S72 A;  1VQ8 A;  2JEA I;  3S2H H;  2N49 A;  3M7N A;  3NEL A;  3DLL A;  1Q82 C;  3A74 A;  2B63 G;  4DR3 L;  4B3M L;  4GNX A;  1K8G A;  3HOY H;  2VQE L;  4LUO A;  2BA0 A;  3G4S A;  1TWC H;  3GTO H;  2E2I H;  1XJV A;  2QA4 A;  3CD6 A;  4A4I A;  3AFQ A;  4YY3 Q;  4X66 Q;  4IOA A;  3J7Z C;  4JI4 L;  2EXD A;  4YHH Q;  1XPR A;  4IJH A;  1NJI C;  4NPS A;  1ASZ A;  3I4N H;  1BKB A;  4DUZ Q;  2CCZ A;  2E5L Q;  4A3D G;  4DV4 L;  5JEA J;  4PZ8 A;  1EQR A;  4HJ5 A;  2CFM A;  5C4X H;  1EUJ A;  4JI3 L;  3A0J A;  3UE0 A;  1E3P A;  3GO5 A;  1V9P A;  4IPG A;  1VQ4 A;  1E1O A;  2KCT A;  3L0O A;  4GLV B;  1ASY A;  1OTC A;  2MO1 A;  4JI1 L;  1NY4 A;  5FLM H;  1YI2 A;  2VL6 A;  3PO2 G;  4LF6 Q;  4QIW E;  5BR8 Q;  2VS1 A;  1LUZ A;  5C0X J;  4B3T L;  3ER0 A;  3UDX A;  3CC7 A;  4LFB Q;  2PQA A;  3I7F A;  2K5N A;  3PO2 H;  1L1O C;  4K0K Q;  2H5X A;  2K52 A;  1IZ6 A;  3RN5 A;  1I5F A;  2CQO A;  4A3J G;  2HT1 A;  4JYA Q;  2Z6K A;  2RF4 A;  3M85 A;  2UU9 L;  4QL5 A;  3K7U C;  1K0R A;  1Q86 C;  4C3J H;  4OWX B;  1EIF A;  3F2D A;  4LFC L;  3S1M H;  3RLO A;  3EN2 A;  2XTI A;  4JBJ A;  3AQQ A;  3KYH C;  2R7D A;  2YTX A;  4HIO A;  1G29 1;  4A3K G;  3CC4 A;  4LFA L;  1TXY A;  3ICE A;  1PH8 A;  3HOW G;  1SFO H;  4JI6 L;  4KI0 A;  3CXC A;  1YHA A;  3UE1 A;  1X9N A;  1HNZ L;  3GTK H;  3HOX G;  3G6E A;  4DV1 Q;  1SRO A;  3I55 A;  4DV5 Q;  4KHP Q;  5C3E G;  2UXD Q;  4HIM A;  4O2D A;  1KRS A;  4GS3 A;  2ZJP A;  4DR2 Q;  3TRE A;  2OWO A;  5C3E H;  4JI0 Q;  4GN5 A;  3T1H L;  3CAM A;  2K5H A;  4NXN Q;  4DR1 L;  1UE5 A;  2Q2T A;  4R4C A;  2R93 H;  2YV5 A;  1XMQ Q;  3IRB A;  4DKA C;  1GD7 A;  5IP9 H;  5M3M H;  4GOP C;  3TEH B;  1KQS A;  1E1T A;  2JA5 G;  1UE7 A;  3FP9 A;  4DR3 Q;  2UUA Q;  3DM3 A;  4DV6 L;  2PI2 E;  2E8G A;  4X66 L;  4GNX C;  3PUZ A;  2WB1 G;  4YHH L;  4L5R C;  2A19 A;  3PGZ A;  1A8V A;  2NVY H;  2JA6 G;  4MNO A;  1TWH H;  4YWM A;  4DUZ L;  4JCV E;  2R92 H;  2I0Q A;  4JI7 Q;  2NVX H;  4XIG S;  4LW1 A;  4JI5 L;  1QVF A;  1E24 A;  4TVA B;  2K4K A;  1Q12 A;  1PA6 A;  3M4O H;  3PUX A;  1L1O A;  4A3L G;  2JK8 A;  4AIM A;  3H0G G;  4DV2 L;  1K8A C;  4AH6 A;  4JI1 Q;  4AYB G;  3PO3 G;  4LFB L;  1KAW A;  1Q8K A;  1UE6 A;  4YCW A;  4A3B G;  3TS0 A;  4A3C G;  2FXQ A;  1GO3 E;  2PQA B;  4GLX A;  3VDY A;  4B3T Q;  4A3L H;  3CC2 A;  1VQF A;  1A63 A;  2NN6 I;  4A3B H;  4BY7 G;  4LNQ A;  1WJJ A;  5C44 H;  3PV0 A;  3I4M H;  4JYA L;  1EQQ A;  4QY7 A;  1GKH A;  1EYG A;  4A3G G;  4BY7 H;  4H02 A;  4OO1 G;  2RHQ B;  1AE2 A;  3PUW A;  2YTY A;  1QZG A;  2UU9 Q;  3CCL A;  4A3G H;  1PVO A;  1VQK A;  1XNQ Q;  2QEX A;  1JJ2 A;  1IXR A;  3PUV A;  3OW2 A;  1K3R A;  1V1Q A;  2V1C C;  4JC0 A;  4R4O A;  3J80 i;  4LFA Q;  1HR0 L;  3HOU H;  2AHO B;  3KLW A;  4Y7N H;  1PH7 A;  4A3E G;  1SMX A;  4DV1 L;  5GQO A;  1HNZ Q;  3GTM H;  4KHP L;  3J81 i;  1FGU A;  2D0P A;  1HJP A;  4A3E H;  2IX1 A;  2JA8 H;  5E7N A;  2UUB Q;  4DR2 L;  4JI0 L;  2ZTD A;  4NXN L;  1UWV A;  1UEB A;  2HQL A;  2Z0S A;  3M4Q A;  4JG2 A;  5IYC H;  2VQF L;  1RL2 A;  5JEA G;  4GOP A;  5IP7 G;  1Y1W H;  4UY8 C;  3HFZ B;  1V43 A;  5FLX c;  3H3V H;  1YJW A;  1SE8 A;  1N34 L;  1I3Q H;  4JI8 Q;  4LF5 L;  1QVG A;  3U58 A;  1TWG H;  2YU9 H;  4BXX H;  2N3S A;  5GAG C;  5LMN W;  4HJ8 A;  3HOY G;  3MXN B;  5IWA L;  2DUD A;  2UUA L;  4L5Q A;  5C0X G;  1NE3 A;  1W2B A;  2UUC Q;  4IFD G;  2IX0 A;  4LUZ A;  3SGI A;  4C3I H;  5LMN Q;  4DV6 Q;  1I94 L;  2ASB A;  1VQH A;  1VQC A;  1VQN A;  5IT9 c;  4RG1 A;  1PV4 A;  4PZ7 A;  1O7I A;  2CKZ B;  3RR5 A;  2PMZ E;  3MEF A;  3I4N G;  2UXC L;  1Y1V H;  3STB D;  4JI7 L;  4TQU S;  5C4X G;  2IHE A;  5JJL A;  1SN8 A;  4ME3 A;  4LF8 L;  1Z9F A;  3K7A H;  1XPO A;  4JI5 Q;  5FLM G;  4DV0 L;  4J15 A;  2L15 A;  3H15 A;  2KEN A;  3OYY A;  3CF5 A;  1L1O B;  1X54 A;  3PF5 A;  2Y0S E;  4FDB A;  4UP8 A;  4DV2 Q;  1VQP A;  2Q2U A;  4OXP A;  4IFD J;  3K8A A;  1VQ7 A;  5LMU L;  1D8L A;  3PIP A;  4BBS H;  1VQA A;  2GVB A;  1N8R C;  3UDG A;  3S17 H;  2A1A A;  3AFP A;  2GVA A;  1IBK L;  2MO0 A;  1XNQ L;  2JEB I;  1HNW Q;  3CCM A;  1IYJ B;  3OTO L;  1HR0 W;  1YIJ A;  1CKN B;  1JMC A;  2ALY B;  4NXM Q;  4R4Q A;  3E9I A;  2OTL A;  1KL9 A;  1HZB A;  2ATW A;  1J5E Q;  1I50 H;  4GKJ L;  1HR0 Q;  1Q1B A;  1CUK A;  2R7F A;  3CPW A;  3PF4 A;  2E2H H;  4DR4 Q;  1YVC A;  4GN3 B;  4IPH A;  2UUB L;  2JA9 A;  2NVT H;  1E7Z A;  3G48 A;  1CKO A;  2WAQ E;  1XTD A;  3GTQ H;  4B3S L;  3ULP A;  2R93 G;  4HID A;  4JOI C;  4GOP B;  1PH1 A;  2VQF Q;  4OWW B;  2EIF A;  4JI8 L;  5IP9 G;  1Y14 B;  3B6Y A;  5M3M G;  4X62 Q;  3S1R H;  1N32 L;  3UDI A;  5GRO A;  1OXS C;  1YZ6 A;  1N34 Q;  1EIY B;  3U4Z A;  2OQ0 A;  1GM5 A;  2XGT A;  4DUY Q;  3E0E A;  3CCV A;  1JB7 A;  4LF5 Q;  4POF A;  4AQY Q;  2UUC L;  1Q81 C;  4YWK A;  5H1S E;  4GNX B;  5IWA Q;  5LMN L;  1MIU A;  1YHQ A;  1M1K C;  4WJ3 M;  1M90 C;  1L2F A;  3CMA A;  3CPF A;  4B3R L;  1I94 Q;  2KCM A;  3K80 C;  4C2M H;  1YIT A;  1D7Q A;  1J6Q A;  1W3S A;  1BBW A;  2OQK A;  2ZTC A;  2R92 G;  1WCM H;  4GKK Q;  1IBL Q;  2I5L X;  2UXC Q;  1P8L A;  4YCV A;  2JJQ A;  1L0W A;  1C0A A;  2JA7 H;  3HOV H;  1B7Y B;  4L5T A;  3W1B A;  3M3Y H;  2F52 A;  3D0F A;  3FKI G;  3K0X A;  2MNA A;  3EBE A;  4A3F H;  4OX9 L;  4LF8 Q;  1LYL A;  1X3F A;  3FKI H;  1Z47 A;  4DV0 Q;  4JV5 L;  2RHS B;  4O0A A;  2YYZ A;  4OO1 I;  1B70 B;  3TRZ A;  1WI5 A;  3E9H A;  4LWC A;  2NZO A;  3NBH B;  5C44 G;  1NMG A;  3I4M G;  1WOC A;  2NZH A;  4A3I H;  1YEZ A;  2MQH A;  5LMU Q;  4JBK A;  4DR5 Q;  2VUM H;  4BA2 I;  2BH8 A;  4R1J A;  1NMF A;  4GLA C;  4X64 Q;  2PI2 A;  4DAY B;  1VQM A;  5AJ3 L;  1OXT A;  3U4V A;  4A3M H;  1HNW L;  3CME A;  3M9B A;  5GAE C;  1IBK Q;  2UXB Q;  4LF7 L;  4NXM L;  1YHB A;  5DLQ E;  1S3O A;  3OTO Q;  4EQ5 A;  5IYB H;  3HOU G;  2GN5 A;  3KJO A;  4P71 A;  1J5E L;  3BZC A;  3CCJ A;  2DGY A;  2JA8 G;  1N36 Q;  4DR4 L;  4GKJ Q;  1AE3 A;  5IY0 A;  1VQB A;  4JOI A;  5IYC G;  1IBM L;  1HNX L;  1R9T H;  1Y1W G;  3KDF A;  3S2D H;  3J7A 5;  5C0X I;  1CSQ A;  1SR3 A;  4IFD I;  4PMW A;  4BXX G;  4B3S Q;  4X62 L;  1X56 A;  4RMF A;  4OWT B;  1FL0 A;  1QZH A;  2D0O A;  4JI2 Q;  5IYD H;  2KHJ A;  4DUY L;  4DR6 Q;  1N32 Q;  3KOJ A;  2ZM6 Q;  1VQ6 A;  1A62 A;  4AQY L;  3HOZ H;  4HJ7 A;  4AYB E;  2OCE A;  1NBW A;  3D31 A;  5ELO A;  4BBR H;  3G71 A;  4A76 A;  1N33 Q;  1RIP A;  2ZJQ A;  3LGJ A;  1T9H A;  3ULL A;  2K5V A;  4QQB X;  2A8V A;  4Y52 H;  4HJ9 A;  3NEN A;  2Y0S G;  4B3R Q;  1Y1V G;  4DK6 C;  2HIX A;  2F4V Q;  4GKK L;  1IBL L;  4IPD A;  1GVP A;  3PCO B;  4BY1 H;  4JBM A;  1K83 H;  4X65 Q;  4DK3 C;  4DV3 L;  1UE1 A;  2I5H A;  3GTL H;  3BZK A;  3S16 H;  1Q1E A;  2HHH Q;  3S1Q H;  3PUY A;  1NTG A;  3S24 A;  1KC8 C;  4DV7 Q;  1C9O A;  1X55 A;  4LF4 L;  1C7Y A;  2IHF A;  3HKZ E;  3PIO A;  1KXL A;  4C3H H;  1JE5 A;  1HZA A;  1TWF H;  4A93 H;  4OX9 Q;  3F2B A;  2R7Z H;  2OTJ A;  1G6P A;  4QGU A;  4UP7 A;  2KBN A;  3T1Y Q;  2WP8 J;  4JV5 Q;  3S1N H;  2B63 H;  2HIV A;  1A0I A;  4BBS G;  3ERS X;  4LF9 Q;  2VNU D;  3A5Z B;  3M4P A;  5M5X H;  3Q8D A;  1VQD A;  2AKW B;  4DR5 L;  1X65 A;  2EQS A;  3TQY A;  1H95 A;  4X64 L;  3S14 H;  3FHW A;  4IPC A;  3RN2 A;  2R6G A;  1FJG Q;  3CP0 A;  5J3B A;  3J80 c;  1MJC A;  1YJN A;  1FVI A;  2UXB L;  1VCI A;  1WYD A;  2WAQ G;  5AJ3 Q;  4HIK A;  2C35 B;  2I5M X;  4EX5 A;  1PH9 A;  5JJK A;  5HGQ A;  1OXV A;  2LXJ A;  1LTL A;  1Q46 A;  3W5O A;  3J81 c;  4LF7 Q;  4A3D H;  4X6A H;  2RCN A;  4BA1 I;  5GAD C;  3ZJY C;  3L2P A;  2F3I A;  4UP9 A;  5GAH C;  4YCU A;  2Q2I A;  3HKS A;  1N36 L;  2ID0 A;  5JJI A;  3F8T A;  1KD1 C;  2ES2 A;  1JJG A;  5IE8 A;  1OXX K;  2AWO A;  1VQJ A;  1IBM Q;  5EAY A;  1E22 A;  3W1G A;  3KDF B;  1VQ5 A;  1HNX Q;  4MTN A;  4PZ6 A;  1BBU A;  1TWA H;  4A3J H;  1QUQ A;  2CWP A;  3I2Z A;  2B29 A;  3GTJ H;  2IT1 A;  4KHZ A;  4JI2 L;  3F1Z A;  4PG3 A;  2VW9 A;  4DR6 L;  2ZM6 L;  3RNU A;  4IJL A;  3KF6 A;  3U50 C;  4L5S A;  2NVQ H;  4IOC A;  4JBW A;  4DR7 L;  1N33 L;  1OXU A;  1CSP A;  1CKM A;  4P75 A;  4A3K H;  3UDF A;  4XTC S;  3HOW H;  3CW2 C;  4DNI A;  2KHI A;  1DGS A;  1EWI A;  2K75 A;  1MJE A;  1PH2 A;  2CWA A;  1X3E A;  2N8N A;  3F2C A;  1WCM G;  3JAM i;  2F4V L;  1K9M C;  4X65 L;  3HOX H;  2LXK A;  3PSI A;  4GN4 B;  1EFW A;  5M5W H;  1VQO A;  1IL2 A;  2JQO A;  4A75 A;  1XNR Q;  2HHH L;  1G51 A;  4P72 A;  4DV3 Q;  1VQG A;  1PH3 A;  2JA7 G;  3HOV G;  1U5K A;  1EOV A;  1XMO Q;  4DV7 L;  4A3F G;  4ALP A;  3GTP H;  3WWV A;  3CCU A;  1SLJ A;  5ELN A;  3JC6 6;  4LF4 Q;  3CCS A;  3T1Y L;  1PHJ A;  5M3F G;  1XPU A;  3GTG H;  5HY6 A;  1PFS A;  4B3M Q;  3CQZ H;  5M3F H;  1N9W A;  2N78 A;  4LF9 L;  4A3I G;  4QJF A;  2JA5 H;  2VQE Q;  2VUM G;  3RZD H;  1X6O A;  2LSS A;  2ZTE A;  4YY3 L;  3RLF A;  1X3G A;  4MZ9 A;  1JJC B;  1FJG L;  4DAM A;  5C4J H;  4LUV A;  2VZA A;  4A3M G;  1HH2 P;  3CCR A;  4JI4 Q;  2E5L L;  3I56 A;  4NB3 A;  4OON A;  1PYB A;  2B3G A;  2Q2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...