4B3RL

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3rL00
1E1OA 5BR8Q 1HH2P 1HZCA 4GOPA 2UU9Q 2VUMG 3EIVA 1G51A 2VQEL 4ALPA 1YIJA 1UE6A 2JK8A 2B29A 2CFMA 4A3KH 4IPDA 3J81i 1WFQA 4APVA 4JI6L 4A3GG 1OXVA 2R93H 1VQ8A 1CKOA 5ELOA 2I0QA 3CCJA 3KOJA 4C3JH 4JI7Q 4JI3Q 4LF9L 1S40A 1N33L 2XTIA 1JMCA 4JYAQ 2UXBQ 4A4IA 4X62Q 3G6EA 1VQCA 2PI2A 1A62A 4AH6A 5IWAQ 2JQOA 2YTXA 2JA9A 1PH6A 2GVAA 3H3VH 3PF4A 4JV5Q 1M90C 4R1JA 3L2PA 1TWHH 2NVQH 5GQOA 3HOUH 1YITA 1JE5A 1UEBA 5IYCH 3CCMA 3KFUA 3NEMA 3J81j 4DV3Q 2UXDQ 2FXQA 4HJ5A 1XMOL 4IPCA 1XNRQ 3HOWH 1UE1A 3KF8B 1BVSA 3TREA 2JA7G 4LFCL 5IYBG 4KI0A 1FJGL 1PH8A 1I94L 2Y0SE 4OO1G 2OTJA 5AJ3Q 1IBLL 2I5LX 1N36L 2E2JH 3AYHB 4LFBL 2GN5A 4L5TA 3JC66 4A76A 1PVOA 2K75A 4A3IG 1YEZA 4PZ8A 3J7ZC 3K80C 4EQ5A 3G71A 3S16H 2ZTCA 3OW2A 4NB3A 1WI5A 1BBUA 1Y1WG 4DUZL 1JT8A 2VL6A 4POGA 2HIXA 3BZCA 3S24A 3U50C 1KHIA 5C3EG 3PUVA 2ZJRA 1SFOH 1CSPA 4HIKA 5IYDH 1MJEA 4RMFA 2MO1A 2VUMH 4A3FH 3F2CA 2UUBL 1V43A 3BU2A 1EWIA 1Y1VG 3M4PA 4JI1L 5FLXc 1M1KC 5C0XI 1VQ9A 5C4JH 4DUYQ 4QQBX 1AE3A 1Q86C 1GKHA 2K5NA 1VQPA 2LXKA 2MNAA 3CCEA 4A3GH 3D0FA 4OXPA 3H15A 3AFQA 2K50A 3CW2C 5LMNL 3GTOH 1WYDA 1Y14B 2RHQB 3DM3A 4GS3A 2N8NA 1GVPA 4UP8A 4A93H 1N32Q 1DGSA 2B63G 2UUCQ 2JA6H 3MEFA 1PV4A 4B3SL 4HJ7A 2NN6G 1HZAA 5FJ8G 1E24A 3CMEA 4A3EG 4LNQA 2VW9A 4LF4L 2WFWA 1G291 3F8TA 3AEVA 2JA7H 5IYBH 3RN5A 2UUAL 4IFDJ 4AQYQ 4MZ9A 3KYHC 4PMWA 1X3GA 1IBKQ 3I56A 2JEAI 4JCVE 2JA5H 2BA1A 2JE6I 1VQ6A 3E9HA 4RG1A 2C35B 4A3IH 1HNXQ 3I4NG 3PF5A 3ULLA 5LMNW 5IE8A 3KLWA 2K5VA 4X65L 4DV4L 4JI5Q 4LFAL 1YJWA 1XNQL 2YTYA 5BR8L 2IHFA 3CD6A 2UU9L 4LF5Q 5C3EH 2K52A 1X3EA 4GN5A 3UE0A 2ID0A 2PMZE 4IO9A 4KHPQ 3U4ZA 4B3TQ 1NTGA 1LUZA 3I4OA 3W5OA 1Y1VH 3OYYA 3I4MG 1Q12A 4JI3L 4HJ9A 4Y7NH 1VQ5A 4L5QA 3GTMH 2D0OA 3M7NA 1KAWA 3CQZH 4UP9A 4A3CG 4X62L 4JYAL 2UXBL 4WJ4A 4C3HH 4A3LG 1L1OB 4GN4B 2L15A 5IWAL 2OCEA 4JV5L 2R7ZH 4HIDA 5C4XG 4A3BG 4IFDI 2B63H 1MIUA 4DR2Q 3JAMc 2UXDL 2IX1A 3HOXG 1XNRL 3CCUA 1CKMA 1L1OC 2BH8A 3GDEA 1IBMQ 1J5EL 3EN2A 3ICEA 3M9BA 1QVCA 4DAYB 4K0KL 2R7FA 4UPAA 1C0AA 3IRBA 2Q2UA 3UDXA 2EXDA 2JEBI 5AJ3L 1VQDA 5M5YH 1XJVA 1A63A 1I5FA 4R4CA 4C3IH 1UE7A 2D0PA 5M3FG 1PFSA 2LXJA 3KJPA 3AQQA 2QA4A 4P73A 1YHBA 4P74A 5GAHC 4GLXA 3S2HH 4WJ3M 2MQHA 4XIGS 4DV6Q 4DK3C 2PQAB 2AWNA 4QIWE 3G4SA 1PH2A 2BH2A 2GVBA 3CCQA 1S72A 1WJJA 1K73C 2CQOA 3S1MH 4Y52H 1IYJB 1Z47A 2EIFA 4POFA 1S3OA 3U4VA 4JI2Q 2E5LL 2MFIA 1L0WA 5JEAJ 2PQAA 1OXTA 1X9NA 1HR0Q 4A3MH 3I4MH 3NBHB 1X65A 4UY8C 3B6YA 1VQIA 1I6HH 4A3CH 1N32L 1LM0A 1E3PA 1QUQB 4AYBG 1YJ9A 3HKSA 4DV5Q 2K14A 1KIXA 4IJHA 1EOVA 3S1RH 5C0XJ 3BZKA 3W1BA 5H1SE 3SGIA 4BBSG 3S1QH 2RHSB 5C4XH 3CAMA 2Q2TA 4A3BH 3FP9A 3PUWA 1WCMG 2E2HH 2OQKA 1OXUA 2HQLA 3U58A 2YYZA 1VQBA 3HOXH 2YV5A 1QUQA 1VQKA 1KRSA 1CUKA 1MJCA 4GN3B 1FVIA 2VZAA 4JI0Q 3HKZG 2QGQA 1IBKL 3CF5A 1HNWQ 1N34Q 1AH9A 2AMCB 4IOAA 2Q2HA 4UP7A 1ASZA 2R92G 2RF4A 1BKBA 1HNXL 2VQFL 3Q8DA 4A3DG 1YNXA 3T1HQ 1HNZQ 3K7UC 2UXCQ 4NXMQ 2ZTEA 3TS0A 2KBNA 4BA1I 4BY7G 2F4VQ 4LW1A 3HFZB 4LF5L 1WOCA 1VQNA 5LMUQ 1N8RC 3HOVG 1VQGA 4JBWA 4LF6Q 4KHPL 1W3SA 4IOCA 2ZTDA 3FKIG 3J80c 4DV0Q 1XPRA 1KXLA 2V1CC 3NENA 4TVAB 2ZM6Q 1L2FA 2KCMA 4JC0A 3ULJA 1YI2A 4BXXG 3RLFA 1VQJA 3PIPA 2CWAA 3K81C 1VQFA 3I2ZA 1K8AC 2F52A 2Q2IA 4HIOA 1VQAA 2WAQG 3MXNB 1Z9FA 3WWVA 3BJUA 4OWXB 3GTQH 1PH1A 4L5RC 1X3FA 4DV7Q 3KDFB 4JI4Q 1NY4A 4DR2L 4LF7Q 1VQ7A 4BBSH 1CSQA 1X54A 1E1TA 4QY7A 1WCMH 2AWOA 4DR1Q 2K4KA 1UWVA 3GTPH 3TS2A 2WB1G 1XNQQ 1B70B 5M5WH 4B3MQ 1N9WA 4A3LH 2LSSA 4YY3Q 4P75A 2QEXA 1K3RA 3KDFA 4QGUA 4JBKA 1XPUA 3PGZA 4LF9Q 1YBYA 3RLNA 3AFPA 1N33Q 4DKAC 4OONA 2H5XA 3E0EA 4PG3A 4KHZA 3PIOA 2R92H 3F2BA 1U0LA 2ES2A 4DV6L 4A3DH 2ALYB 2R7DA 1Y1WH 1FGUA 1J6QA 3A74A 3T1YQ 4PZ7A 3J80i 4R4QA 4YWLA 1GD7A 3A5UA 4BY7H 1XMOQ 4LF8Q 4DR4Q 1H95A 3F1ZA 4BA2I 1IL2A 4X6AH 5IP9G 5M5XH 3GTJH 1PH5A 1KD1C 3FKIH 1BBWA 1RL2A 4DAMA 5C44G 1HR0L 1FJGQ 4JI7L 1W2BA 4OWTB 5M3MG 2VY3A 4JBJA 1PA6A 4KLKA 4NPSA 3GTGH 1OXSC 3UDFA 1HZ9A 2NVXH 4IJLA 3W1GA 3H0GG 4DV5L 4GNXC 2OWOA 2IHEA 3CC4A 3S17H 2AHOB 4DUZQ 4BBRG 3H3VI 3GTLH 4DV3L 1JJCB 3CCVA 4DV2Q 1PHJA 3NELA 4B3RQ 2HHHQ 2Z6KC 1IXRA 4YCWA 4OX9Q 2VS1A 1R9TH 2R93G 1L1OA 4MTNA 2WP8J 1K0RA 5FJ8H 5IP7G 1V9PA 4H02A 4JOIC 4A3EH 4A75A 3K8AA 4AYBE 3HOZG 1G6PA 3J81c 1HNWL 1N34L 3PUZA 3CC7A 4HIMA 1VCIA 5LMNQ 2IY5B 1VQMA 1A0IA 1Q46A 2KHIA 2N3SA 3T1HL 1HNZL 4O0AA 2CKZB 5EAYA 1QZGA 5GADC 4OWWB 3J7A5 3I4NH 4DV1Q 2ZJPA 2I5MX 4NXML 5IT9c 2UXCL 4JBMA 2F4VL 1SMXA 3PCOB 3CP0A 5LMUL 3KF6B 4FDBA 4IPHA 4YWMA 3HKZE 1VQ4A 1YVCA 4GKJQ 3G48A 4LF6L 4QL5A 4BY1G 4DV0L 1NBWA 1HZBA 4DUYL 2ZM6L 3GO5A 4XTCS 5IP9H 4K0KQ 1KL9A 1XMQQ 1TWFH 1CKNB 3KF6A 3S1NH 1QZHA 5M3MH 4R4TA 5J3BA 2AKWB 1VQLA 2NZOA 3PUXA 2PNHA 3JAMi 2K5HA 4JI8Q 4A3JG 3H0GH 4DV7L 1C7YA 2UUCL 1X55A 4LFAQ 4DV4Q 3GTKH 1YJNA 1EIFA 4GOPC 3RR5A 3K0XA 1U5KA 4O2DA 4BBRH 1KQSA 4LF7L 1JJGA 1CKNA 3A0JA 1Q8KA 4X66Q 4A3FG 1TWGH 3PO2G 1K83H 4C2MH 4DR1L 3K7AH 2B3GA 4LWCA 1YHQA 4B3ML 3VDYA 3TQYA 5HGQA 2WAQE 1X6OA 4YY3L 1JJ2A 1PH9A 5IP7H 2R6GA 4AQYL 4NXNQ 2A1AA 4OO1I 2IX0A 3HOZH 1QVFA 3EBEA 4EX5A 1EIYB 3RZOH 4A93G 2E8GA 5IY0A 1Q82C 1D7QA 5M3FH 3PSIA 4DR6Q 3RN2A 2JA6G 4JI5L 1XPOA 2WB1E 3T1YL 4DR5Q 1Q1EA 3PV0A 2YU9H 4GKKQ 1MKHA 4LF8L 5GAEC 1SE8A 3OTOQ 4DR4L 1XTDA 1KC8C 1AE2A 4LUOA 1GM5A 3TEHB 1PH7A 4DR3Q 1J5EQ 4B3TL 5K36G 4BY1H 2XGTA 4TQUS 4X64Q 3CPWA 1VQEA 5JJKA 1KRTA 1Q7YC 2D62A 1YZ6A 2I5HA 3S2DH 2JA5G 4YHHQ 3M85A 5DLQE 5JEAG 1V1QA 1O7IA 3RZDH 5ELNA 4LUZA 1PYBA 2HIVA 3DLLA 3PO3G 3CCLA 2KHJA 4R4IA 4A3JH 2N78A 4DR7Q 1IZ6A 2NVYH 1T9HA 4L5SA 1K8GA 4DV2L 4B3RL 3CCRA 5GAGC 2HHHL 5C0XG 5IYDG 1IBML 4GLVB 2VQEQ 4DK6C 4OX9L 1D8LA 3PO2H 2PI2E 2NN6I 2Z0SA 3M3YH 3CXCA 1NJIC 1PH3A 2E5LQ 4JI6Q 5FLMG 2F3IA 3CCSA 1RIPA 1NMFA 2ZJQA 4J15A 1EQRA 1PH4A 3L7ZC 4YCUA 1C9OA 3CC2A 2KENA 2Y0SG 1UE5A 2R7ZG 3I7FA 1NE3A 4P72A 4QJFA 4DV1L 3M4OH 4JG2A 5JJLA 1B8AA 2JJQA 4DPGA 1P8LA 3S15H 3UE1A 4GKJL 3A5ZB 5JJIA 2A8VA 1SROA 2CCZA 1FL0A 4HJ8A 2E2IH 3UDGA 2CWPA 3HOVH 1SN8A 2RCNA 3HOYG 4JI2L 4GNXB 4LUVA 5GROA 3FHWA 3GD7A 2BA0A 1TWCH 4HJAA 1EQQA 1I94Q 4LFCQ 1ASYA 3S14H 1XMQL 4YCVA 1SRUA 1N36Q 1IBLQ 4ME3A 3ERSX 4LFBQ 2DUDA 5E7NA 1Q81C 3LGJA 2VNUD 4PZ6A 4BXXH 2MO0A 1LTLA 2NZHA 3CMAA 4GLAC 3STBC 2DGYA 2VQFQ 2JA8G 4JI8L 2OTLA 3UDIA 4GNXA 1TXYA 3M4QA 1NMGA 2A19A 2ASBA 3PO3H 1Q1BA 1PYSB 2N49A 4X66L 4A3KG 1TWAH 4AIMA 1E7ZA 1I3QH 2Z6KA 1A8VA 2KCTA 4P71A 3RNUA 4JI1Q 1VQHA 2UUBQ 1YHAA 4A3MG 3CPFA 4JI0L 1QVGA 4MNOA 3E9IA 4JOIA 4NXNL 3RLOA 2ATWA 3TRZA 1HJPA 5FLMH 1VS0A 1SLJA 1VQOA 1HR0W 4R4OA 5HY6A 1EFWA 3F2DA 2YTVA 3KJOA 4DR6L 4DNIA 4YWKA 3HOUG 1X56A 1K9MC 5IYCG 2IT1A 4DR5L 2EQSA 1EUJA 4B3SQ 1SR3A 4GKKL 3L0OA 3HOWG 3OTOL 1P16A 1EYGA 1B7YB 4DR3L 3ULPA 4IPGA 4X64L 1OXXK 4LF4Q 3HOYH 3ZJYC 2NVTH 2HT1A 5C44H 2UUAQ 4YHHL 4GOPB 3D31A 1E22A 3PUYA 1LYLA 1GO3E 3ER0A 2OQ0A 4IFDG 3I55A 1I50H 1JB7A 3STBD 2JA8H 1OTCA 4X65Q 4JI4L 4DR7L
chains in the Genus database with same CATH superfamily
1H9RA 1Y8OB 3LWEA 4GOPA 2UU9Q 1V1PB 3S1NB 4ALPA 3FPUB 1LTAD 1YIJA 1CQFA 2JK8A 1GUTA 4A3KH 4IPDA 4PMCA 1RTOA 3P1HA 1CKOA 3H0GB 3X3NA 3KOJA 4C3JH 1K28A 3VYRA 1STGA 4A4IA 5IWAQ 2EY1A 2JQOA 2KA7A 3H3VH 4DK1A 3RUZA 1YITA 3CCMA 3HOZB 4HJ5A 4IPCA 5ELCA 1EY9A 1UE1A 2JA7G 5IYBG 4OO1G 2OTJA 5KNDA 2E2JH 4LFBL 1CA6A 1PVOA 4J6HA 1HA5A 1IKLA 3J7ZC 3S16H 1HUMA 5LHY1 3GP7A 1WI5A 1BBUA 5JOBA 4DUZL 2HIXA 2FMCA 2JN4A 2B2YA 1MJEA 4K6LA 4RMFA 2MO1A 1G2SA 3I91A 2UUBL 3PMFA 3M4PA 4JI1L 5C0XI 4QQBX 1VQPA 3QOLA 2F0SA 3D0FA 3AFQA 1Y8NB 3GTOH 3CW2C 1TY0A 1SBBB 2K1BA 1WYDA 1Z6HA 2N8NA 1PZJD 4ILWA 1EY5A 2NN6G 5IOCA 1E24A 2WFWA 2QDBA 2JA7H 5IYBH 3RN5A 4OO1H 4IFDJ 4F88A 1IBKQ 1X3GA 2J0TD 1S4ZA 3MC0B 1XX8A 3VYSA 3I4NG 5JEAH 2E2IB 5LMNW 1XNQL 4RH6A 4JI5Q 1TWCB 1WD1A 2YTYA 2UU9L 2K52A 2PMZE 3D6WA 4KHPQ 5KYIA 5CBAE 1BQQT 3I4OA 4HCSA 4Y7NH 1F9SA 1SDFA 1JQYD 4UP9A 3FVQA 1L0YB 3FEWX 5IWAL 4GN4B 1IW7D 1EU3A 1H9MA 2B2VC 5C4XG 2A6EC 5JPMC 1B53A 2E75C 3CCUA 2CQAA 1IBMQ 1HRJA 3ICEA 3EN2A 4DAYB 1QVCA 2ICIA 1PRTC 1A6XA 5C4HA 1XJVA 1I5FA 2R61A 1ICWA 4P74A 5GAHC 1DJRD 2PQAB 2D2CC 1W6JA 1MSGA 2GVBA 4IQZA 3OMGA 3S1MH 2C5CA 2EIFA 3FPPA 4CJ1B 1X9NA 2JA8B 4A3MH 2WKDA 1G6ZA 2MGSA 4TSSA 1XYIA 1LM0A 1I6VC 1QUQB 3HKSA 4DV5Q 4A3KB 5C0XJ 5H1SE 2RDFA 1MI2A 4C3JB 3S1QH 2IW3A 5C4XH 2K5QA 3FP9A 1OXUA 3HEJA 1I4HA 1CUKA 4FXKC 4JI0Q 2QGQA 4IUNA 1IBKL 1F9PA 1BF4A 2EYHA 1R4QB 2AMCB 4IOAA 1ASZA 2RF4A 1QNUA 1YNXA 4UHVA 3T53B 3T1HQ 3J7AF 1CZWA 4BA1I 5FLXL 4F8MA 2E2JB 4BS9A 5LMUQ 3BG3A 4KKUA 1HFGA 4KV6A 4KHPL 3J80c 3VR4A 3S16B 2V1CC 3NENA 4TVAB 2ZM6Q 4KKSA 1L2FA 3J7AV 1K8AC 4CKCA 2WAQG 2P5ZX 2FFKB 3GTQH 1PH1A 1NY4A 1EYAA 1CSQA 3QB3A 5A2QL 3GTOB 1QNKA 3A8KE 3MXNA 2WB1G 5M5WH 5IGDA 1TY2A 2QEXA 1ILPA 1K3RA 1XPUA 2A73B 3PGZA 2F03A 1YBYA 4IUQA 3S15B 5CV5A 1CQVA 3E0EA 4OONA 3PIOA 2NUCA 5JPNC 4KD3A 1JB3A 1F9QA 2JYOA 2PYKA 5CV7A 4M1UB 2F0VA 5HURA 2JA7B 4PZ7A 4R4QA 3OSOA 5I9OA 2Q8IB 4FXGC 3F1ZA 1IL2A 1SE4A 2KEDA 5CV4A 4JI7L 1W2BA 3K5NA 2M00A 2HDLA 2Z9HA 3GTGH 4ZLTF 1OXSC 3NPPA 1HZ9A 2L55A 2OWOA 4DV5L 1NUCA 2L0CA 3S17H 1AN8A 3H3VI 4Y7NB 2PPBC 4IZ8A 4DV3L 1V8QA 3CCVA 3NELA 2HHHQ 1H9KA 1D6EC 3TP8A 2J7ZA 4A3EH 4A75A 2A6HC 3PUZA 1EFID 3K58A 4IFDG 3T1HL 1MBYA 3J7A5 4DV1Q 2I07B 3VR2A 4JBMA 1SMXA 5LMUL 4IPHA 3MZ5A 4DXFA 4ID6A 4QL5A 3VA5A 1HZBA 4DUYL 2ZM6L 1KL9A 3R93A 1WTRA 3S9WA 5LL6X 3E3XA 1XMQQ 2RSNA 1LLRD 4V0BA 4F7XA 3KF6A 3S1MB 1SYDA 1ZEQX 4R4TA 4E6IA 1WTWA 3IL8A 4IUPA 1SYEA 5ELEA 1X55A 1AW7A 4LFAQ 4DGZA 4DV4Q 3GTKH 4A3MB 3RR5A 3BVMA 1CKNA 1LABA 4X66Q 3PO2G 4C2MH 3K7AH 4LWCA 2WAQE 2EVBA 1PTOH 4OO1I 3S1QB 4EX5A 4NMZA 5M3FH 5C3XA 3MXUA 5DNFA 4KN4C 4CKBA 2WB1E 4DR5Q 1Q1EA 4RCOA 3BYTB 1EZ8A 4LUOA 4DR3Q 4KK7A 2MUYA 2XGTA 1KRTA 3GV6A 1YZ6A 3S2DH 4YHHQ 3M85A 2SNMA 1JOKA 4I7ZC 1GUNA 2HIVA 4KN7C 2N78A 4DR7Q 4L5SA 2SDFA 2HHHL 5C0XG 4DK6C 1D8LA 3PO2H 2NN6I 2Z0SA 4L63B 4HTHA 4K6DA 5BN3A 1STAA 2E5LQ 3GTQB 4XYQA 5FLMG 2IX3A 2SOBA 1EQRA 3L7ZC 5DEHA 2Y0SG 1UE5A 1GUWA 2EE1A 4DV1L 3NWSA 5M5WB 4JG2A 1FGBD 3NP8A 2XN9C 3HP3A 2D5DA 1SROA 4Q0FA 2CCZA 4HJ8A 3UDGA 2CWPA 3HOVH 2RCNA 4LUVA 5GROA 1CTMA 4LFCQ 3S14H 1XMQL 2VNUD 1LO5D 3ERSX 3KUPA 2R3ZA 1Q81C 1CI3M 1B3QA 1LTLA 2NZHA 3STBC 2A69D 2XSCA 3AB9A 4FF2A 1BCPD 4GNXA 1ZXTA 1I4RA 1TXYA 4X66L 3NTKA 3GTGB 1GUOA 3TZUA 4KD4A 4AIMA 1H9SA 2Z6KA 1RF2D 4OELB 2KCTA 5C0XH 4YIJA 1HHVA 4FF1A 1QVGA 4MNOA 3E9IA 2ATWA 3TRZA 3S17B 4QMGA 5FLMH 1SLJA 4G57A 5E1FA 3T4AC 2NTTA 5T1IA 3C1FA 1EFWA 4NDXA 1ENFA 4A3EB 2IT1A 4DR5L 5IGBA 3HOWG 4DR3L 3O13A 1OXXK 1KAAA 4NW2A 4JK1C 1I4QA 2UUAQ 4YHHL 4GOPB 4N8X1 4U673 1E22A 2Z8LA 3PUYA 1E0BA 3ER0A 1JB7A 4X65Q 4DR7L 1E1OA 3R8BA 1SJED 3WOFA 3D6CA 3EIVA 1GOZA 1UE6A 3DEOA 5FO9B 1AZPA 4CHTB 4CDFC 4APVA 4Z9CB 2CW0C 1OXVA 2R93H 5ELOA 3CCJA 2KEEA 3GTKB 1QE6A 2XTIA 1JMCA 4C2MB 3SXHA 3AU7A 3DM1A 3K7AB 4AH6A 2JA9A 2QF7A 2SEBD 3PF4A 3RD4A 1M90C 5K5PA 3L2PA 4HSVA 5CV8A 4OHJA 4TRDA 1PTOB 3NEMA 2UXDQ 2FXQA 3HOWH 3W2DA 5M3FB 1LT6D 3TREA 2B2WC 4LFCL 3SK5A 4KI0A 1FJGL 1PH8A 4F87A 2Y0SE 4MN3A 3AYHB 1PMRA 1BO0A 3H94A 1SYFA 3MAQA 1YEZA 1F9RA 4G4KA 4EQ5A 3G71A 3OW2A 3KF8A 2WKCA 1G8ZD 4KJOA 1JT8A 3BZCA 1SFOH 3S24A 1KHIA 2PZWA 2V4DA 3S2DB 3OMCA 3D3RA 3MHBA 4RGNA 1BR9A 4A3FH 1RODA 1V43A 2J4XA 1EWIA 1VQ9A 5FLXc 4RKBA 5C4JH 1Q86C 1SE3A 4N9PA 4C3HG 2K50A 5LMNL 2XNAC 1D5MC 4GS3A 1GVPA 3PO2B 2E2DC 1SSOA 1VF5C 5E4XA 4ZKBB 2UUCQ 2F0WA 4HJ7A 4FXDA 2E76C 2A68D 2K04A 1MD2D 5FJ8G 3CMEA 2EZVA 1E2VA 1RJTA 4JPBW 3AEVA 1ENAA 2UUAL 2SNSA 2D9UA 4C3IG 4AQYQ 3C3LA 3K6OA 5E4WC 4PMWA 1I4XA 3ERQA 1QWYA 3CRLC 4JCVE 2RDGA 2BA1A 2DJFC 2JE6I 1VQ6A 2B39A 2C35B 3HOVB 1KDCA 3ULLA 3ZYYX 2K5VA 4RGOS 4X65L 3S14B 1YJWA 2IHFA 4CDCC 1GJXA 3UE0A 5CBEE 2NBFA 3EFXD 3VR6A 1PFMA 4B3TQ 1NTGA 3H09A 3W5OA 4DK0A 5CGKA 1Q12A 1VQ5A 3BVGA 4C3HH 4K8JA 3J80E 1L1OB 1NAPA 1NCVA 2L15A 3TBIB 5KIXA 2FINB 5IGGA 4A3BG 4IFDI 1LTRD 3SHLA 4IN3A 3JAMc 2UXDL 4R9WA 1S5FD 3HOXG 2KHSA 4MTKA 1CKMA 1J5EL 3M9BA 3U9OA 2L12A 2F3WA 1BUVT 2N55A 4H44C 1TQOA 1MSHA 2Q2UA 2EXDA 2JEBI 2K6AA 1EQVA 1S5CD 1JE4A 5M5YH 5I4DA 1A63A 4R4CA 4C3IH 2D0PA 5IGEA 1EIGA 1YNJD 3MFYA 2QA4A 1WTQA 3S2HH 5EKKA 1UAPA 5DM63 1IYUA 3EQLC 1PH2A 4XQQA 1SNDA 1WJJA 5LL6S 1JWUD 3A8JE 3C46A 2K5WA 4H7BA 1Z47A 1KABA 1QCBD 4POFA 2QCPX 2MFIA 2WACA 4KTAA 3NBIA 2EYMA 1XTCD 3DWQA 1ESRA 3B6YA 1I6HH 1EQTA 2K28A 1KIXA 1YJ9A 2K14A 4IJHA 1EOVA 4C1NK 4JW0A 3TMEA 2R93B 5C5MA 3TZDA 2EXZA 4BBSG 4A3BH 3CAMA 3RMHA 4WRDA 3NBHA 1GXDC 4RGMA 5G3LD 3HOXH 4Q5VA 2AUJD 1O78A 3SE0A 1KTKA 2VZAA 3R3OA 1T5XD 1HNWQ 1BDOA 1IHZA 1X3QA 1AH9A 2A6HD 2VQFL 3HOWB 3Q8DA 5IGFA 2NWGA 1TVXA 2EY6A 5I6WA 3K57A 3I4LA 4BY7G 1VQNA 1WOCA 5C6AA 5F2DA 3BZDB 1VQGA 2EPBA 2PQEA 4JBWA 2HD3A 1DM0B 1XPRA 1WVLA 1ONLA 4JC0A 1VQFA 4ZAIA 2O5IC 2Q2IA 4UAIA 4HIOA 3C2PA 3MXNB 4A3FB 3LX0A 1QB5D 1A3UA 5C4JB 5ISRA 1AFPA 4CDDC 4LF7Q 4BBSH 2NYZD 1E1TA 2XWJB 2AQ2B 3GTPH 1UWVA 2BOSA 2F0UA 2KCNA 4YY3Q 4P75A 1C8CA 2F3VA 3KDFA 1II3A 4LF9Q 3RLNA 3AFPA 1N33Q 2G5DA 4TKOB 1J9OA 5FOBB 2ALYB 3QWNA 1BCPF 2R7DA 3A74A 1ET9A 4N9TA 4WFN3 4BY7H 1XMOQ 4LF8Q 4DR4Q 4BA2I 4K5VA 3GTJH 1KD1C 3KLSA 5C44G 4DAMA 2IL8A 3P7JA 4OWTB 3SK8A 5M3MG 1PA6A 1KLUD 4KLKA 2K03A 1D5ZC 4NPSA 2L5TA 3EA6A 1G2TA 1LTSD 2FMMA 3W1GA 2KOLA 2IHEA 3N52A 1EY6A 4BBRG 5JAVA 3GTLH 2DNCA 4DV2Q 2NN6H 4C3HB 4OX9Q 1R9TH 1L1OA 2WP8J 5IP7G 4RHSA 2F0QA 3OPOA 2KQ3A 3J81c 1HNWL 1ZYRD 4ZUJA 4HIMA 1G91A 3MXPA 1LTGD 1Q46A 4OWWB 4O0AA 5EAYA 1QZGA 2B2TA 1GHJA 3I4NH 2F0JA 5M5YB 1STEA 2B8GA 3KF6B 4FDBA 4YWMA 4C3IB 1IYVA 5TSSA 1YVCA 3G48A 1UNSA 3K5MA 4RFBA 2Z1CA 4BY1G 1AP0A 4ULLA 3S2HB 3TP6A 2LKVA 3CHBD 5A35A 1TWFH 1PDQA 1JORA 1CKNB 4XT3B 5M3MH 1SNQA 2AKWB 1D2BA 1VQLA 2B2UC 3JAMi 1TKWB 2L1BA 4PQXA 4PNYA 4K5XA 1CHPD 4BWGB 2EYOA 1CA5A 1EIFA 4GOPC 4LF7L 4BBRH 1U5KA 1JJGA 4H13C 3I70A 1K83H 4PMBA 1I6HB 1YHQA 1X6OA 4YY3L 5IIFA 1PH9A 5IP7H 1YNNC 2R6GA 2IX0A 4A3BB 3EBEA 3RZOH 4A93G 1SMYC 3PSIA 3HOXB 4DR6Q 2QILA 3RN2A 2JA6G 4X3TA 4JI5L 1XPOA 4J1MA 3SDZA 4B9XA 4GKKQ 1MKHA 4LF8L 4EGVA 2C9OA 2PMZB 4DR4L 1GM5A 1PH7A 1L0XB 2OT2A 4BY1H 4TQUS 2BE5C 1WD0A 1Q7YC 1PTOC 2I5HA 3BYYB 2JA5G 5ELNA 5D3IB 1PYBA 4P2CB 3PO3G 4X3KA 2B2YC 2KHJA 2F0PA 1IZ6A 2NVYH 1HUNA 1T9HA 1B4OA 4DV2L 3TN2A 3TP7A 2X6GA 5IYDG 1IBML 4GLVB 2VQEQ 4OX9L 4S3SA 3CXCA 2F0FA 1PH3A 2F0MA 1EEID 1Q90A 1UEAB 1B9NA 4YCUA 4BBSB 1O7ZA 5I6YA 2R7ZG 2BCOA 1PTOF 2TMPA 1EL0A 1Z7TA 3M4OH 5JJLA 2GA4B 1TS5A 1B8AA 4XT1B 3OW7A 4DPGA 1P8LA 3UE1A 3A5ZB 1JICA 5JJIA 2A8VA 1SXTA 4WJWA 3OIQA 5ELFA 1CFMA 1SN8A 3ITPA 4GNXB 2I46A 1F2MA 1I94Q 4YCVA 1SRUA 5KEEA 1N36Q 3GV3A 5E7NA 3LGJA 4PZ6A 3C1EA 4BY7B 1T5EA 4V190 4LAAA 4GLAC 3KLSX 3JAML 2A5HA 1H9SB 3H6MA 2DGYA 1K8OA 1W6KA 2IWHA 3GTJB 3NQIA 1NMGA 3WOEA 3PO3H 1SYGA 1KDBA 2DY8A 2ENBA 1EEFD 4ABNA 2B8FA 1TWAH 3G6JB 1E7ZA 5IYDH 3RNUA 2L11A 4U68A 3CPFA 4JI0L 4HCEA 4JOIA 1EIHA 1EY7A 3NSWA 3GTLB 2XIWA 3QJYA 4MHEA 2QW7A 3F2DA 5FLXE 1R9TB 4DR6L 1XXGA 3NWTA 2XWBB 5IYCG 2WIIB 1SR3A 4GKKL 3L0OA 2MJ8A 3ULPA 4R8IA 4CDEC 2AQ3B 3ZJYC 3I4NB 4EQPA 2HQEA 3ONAB 1I4GA 1UUPA 4EQOA 1ILQA 1LYLA 1GO3E 2OQ0A 1WTOA 1I50H 5EJWA 5A2QE 4HMJA 1TWFB 1HH2P 1HZCA 5KRUA 2VQEL 5M3MB 3H91A 3J81i 2FJ2A 3R2TA 2I0QA 3MVVA 4L6TB 4JI3Q 1ESFA 1AEXA 1S40A 2F0LA 2TSSA 1B1ZA 4BBRB 5C4XB 3VR5A 4X62Q 2MHVA 1K83B 5EPLA 2L9HA 1A62A 1RKNA 4IFDH 4JV5Q 1TIID 1R4PB 1A3VA 3DHQA 5IYCH 3J81j 1BCPB 3RZOB 5CYUA 3E5SA 3KF8B 4EQNA 1D1KA 1DCZA 1WTVA 1I94L 4RWSC 1N36L 2GN5A 4L5TA 3JC66 3JAME 4A76A 3F2UA 1U4PA 4A3IG 4PZ8A 3OOCA 2PO4A 5HGTA 4NB3A 1Y1WG 4BY1B 2KUMA 4XYOA 3U50C 1O7LA 3R2IA 3PUVA 5C3EG 2ZJRA 4RCNA 1EY0A 1CSPA 1D5XC 2F0IA 1STHA 3PIP3 1Y8PB 3F2CA 3BU2A 3D4RA 1Y1VG 4K2KA 1M1KC 1GKHA 3CCEA 3H15A 2NVYB 4O1NA 1Y14B 4UP8A 1GUSA 5EKIA 2F0EA 1DGSA 4DNTB 3T56B 3MEFA 1HZAA 1HQMC 1GUGA 2VW9A 2ZXOA 3VR3A 3M4OB 3F8TA 1FNVA 4K8IA 1PZID 5T1GA 1Q8IA 3EVQA 3KYHC 3SK4A 4KY6A 2JEAI 1PXUA 1STYA 2M2LA 4A3IH 1LTTD 3PF5A 5IE8A 3KLWA 4IALA 4LFAL 4DV4L 2O4XA 4QF4A 3T16A 4XQNA 4LF5Q 5C3EH 3TDQA 1J8IA 3J81L 2ID0A 4IO9A 4ZCKA 2WAQB 1ENCA 1Y1VH 3OYYA 5KNBA 3QOJA 4IURA 3Q24A 4JI3L 4HJ9A 3GTMH 2D0OA 3M7NA 1KAWA 3CQZH 4X62L 2CVRA 3BS1A 4OEMB 4A3LG 2LS01 5FO7B 1TWAB 3CKIB 1HTLD 2OCEA 4JV5L 2WB1B 3M7GA 1MIUA 2H1EA 3A56A 2BH8A 3GDEA 3ND8A 1QG7A 2R7FA 1C0AA 3URYA 1B2TA 3UDXA 1VQDA 5E3FA 1VMPA 1UE7A 2PW5A 1M8AA 1PFSA 1BOSA 3KJPA 3AQQA 4P73A 1YHBA 5EKLA 4GLXA 4DV6Q 4DK3C 2Z6BA 4QIWE 1O80A 1U4RA 4DF7A 3G4SA 2BH2A 3CCQA 3SVMA 5ELDA 3BDLA 2CQOA 4Y52H 1TT2A 3U4VA 5IGCA 1K8MA 4JI2Q 2E5LL 2VB2X 5JEAJ 1I50B 4DNRB 1OXTA 3QG1A 1Y69U 1HR0Q 4CJ0B 3NBHB 1X65A 4DFAA 1VQIA 5BN4A 4DU9A 3CU7A 1K0SA 1V1OA 1ZKOA 2K32A 3SGIA 1SJHD 1DOKA 2RHSB 2Q2TA 2OEOA 3PUWA 1WCMG 2OQKA 1CK1A 2HQLA 2A6ED 1VF7A 2YV5A 1FNWA 1KRSA 1VQKA 1TR5A 1FVIA 2BDOA 1PRTD 1N34Q 4UP7A 1BKBA 1HNZQ 3HS0C 3H3VC 2EYJA 2UXCQ 1ET6A 4NXMQ 1DYQA 2KBNA 3J81E 3NXWA 4LF5L 3NK9A 2X69A 1JC7A 1W3SA 3FKIG 4ODGA 1X32A 2K01A 2N88A 4KJNA 3VA7A 3ULJA 2CH4W 3RLFA 1DOMA 1VQJA 1NR2A 2CWAA 3K81C 3I2ZA 4BXXG 2LFNA 2RA4A 3WWVA 1KLGD 4L5RC 1X3FA 3KDFB 1A15A 4JI4Q 1X54A 2F4IA 4QY7A 1WCMH 2EYPA 4DR1Q 3TS2A 4B3MQ 5EGTA 1A2TA 4ZQ3A 4JBKA 1X3PA 2A74C 3J7YW 2EOTA 1H9JA 2EYLA 2RDHA 3F2BA 1FNUA 4DV6L 1BBXC 4QIWB 1FGUA 2AUKA 1J6QA 5JVH3 3SEBA 1DOLA 4YWLA 3A5UA 2HCIA 4X6AH 3A7LA 5IP9G 4A3IB 1KNEA 3QR8A 1STBA 3FKIH 1HR0L 1DZ1A 1KNAA 2VY3A 5C3EB 1F2LA 3UDFA 4GNXC 1F77A 2AHOB 1Y1VB 4DUZQ 2B2VA 4OIJA 3BDCA 3MWYW 3GTMB 4NP5A 4K14A 3CQZB 2Z6KC 4RA8A 2F0KA 2VS1A 2VXWA 4MTNA 5FJ8H 1K0RA 3D4DA 3G7LA 4H02A 2Y0SB 3BVZA 3K8AA 5J22A 4HMIA 1N34L 3CC7A 2IJ0A 5KGUA 5KNCA 2N3SA 1JR0D 1HNZL 4FYDA 2CKZB 1RTNA 4K5WA 5GADC 2UXCL 4NXML 5IT9c 1HCZA 4H0LC 2DN8A 3E6ZX 1VQ4A 4GKJQ 5ELBA 3VYTA 3DWAA 1EY8A 3GO5A 5IP9H 4K0KQ 2F1MA 1QZHA 3TP5A 5J3BA 1FYCA 2NZOA 4OGQC 2Z4IA 2PNHA 2F0OA 3PUXA 4WORA 4JI8Q 4A3JG 2UUCL 3HG9A 2RVLA 4CGYB 2G9DA 1YJNA 3HRZC 4O2DA 1ICFB 1Q8KA 4XDXA 1TWGH 4DR1L 4B3ML 3TQYA 1JJ2A 1VDZA 4AQYL 4NXNQ 2JXMB 4MIUA 5COYA 2E8GA 1Q82C 1D7QA 1E2ZA 4LK1C 1A3TA 3OHXC 1OO9B 5DAUA 5NUCA 2YU9H 4DN4M 2JP1A 5GAEC 3OTOQ 1XTDA 1AE2A 3V2TA 4B3TL 5K36G 4X64Q 1VQEA 1SFOB 2A69C 2K5DA 1BCPC 5DLQE 1S5DD 5JEAG 1V1QA 1O7IA 5JJZA 2F0HA 2KVMA 3RZDH 4LJZC 3DLLA 3CCLA 3DEPA 3KLRA 1RHPA 4R4IA 4A3JH 4RHRA 5J39A 3CCRA 1JWSD 4DA2A 3M3YH 3NTHA 4JI6Q 1IKMA 5AFWA 3CCSA 5BN5A 1NMFA 3TSSA 2ZJQA 4J15A 2CH4A 4QUCA 1PH4A 1NNXA 2ZT9C 2KENA 1WCMB 3I7FA 1QILA 3KBXA 4IUUA 4P72A 4G7HC 1TS3A 2JJQA 3T51B 3S15H 4IUTA 4GKJL 3GQBA 4G7OC 3K5LA 3HOYG 4K0KL 4HJAA 3GD7A 2BA0A 2JSOA 5K36H 1IBLQ 1LT4D 3WDNA 1SNMA 2LMCB 4ME3A 3L9AX 1EY4A 3CMAA 2XRSD 4QUFA 5I9PA 3I90A 4JI8L 4G7ZC 2OTLA 3IFDA 1MGSA 3FKIB 2VB3X 1DXMA 2A19A 1Q1BA 1PYSB 1I3QH 1RDPD 1A8VA 3EJIA 2XRQD 4A3MG 4NXNL 1F2ZA 1HJPA 2RQXA 4NKLA 1VQOA 1HR0W 4R4OA 2WV6D 5HY6A 3ND9A 4ZKCB 1IL8A 2YTVA 4DNIA 1CT1D 2EJGC 4YWKA 3LWUA 3HOUG 5IODA 1K9MC 5M9OA 4B3SQ 3OTOL 1EYGA 1B7YB 4ZUIA 4IPGA 4X64L 4LF4Q 2ZXRA 3DMUA 2L4NA 3HOYH 2NVTH 5C44H 1LV9A 2DNEA 3D31A 1LACA 3I72A 2MPMA 3STBD 2HCCA 1HTPA 1PFNA 1LTID 4X3SA 5BR8Q 4KKTA 1A2UA 2VUMG 4KY5A 1G51A 2QDLA 2B29A 2CFMA 2HDMA 4J8QA 2EY5A 1WFQA 2PZTA 1CZGA 4JI6L 4A3GG 1VQ8A 4JI7Q 4LF9L 3UI2A 1N33L 1MHWC 4CBVA 4JYAQ 1PRTF 1V1PA 2UXBQ 3G6EA 1TWGB 1VQCA 2PI2A 2KECA 2YTXA 1PH6A 2GVAA 2O2LD 4OIKA 3HOUH 2A68C 4R1JA 1TWHH 3FRPB 5GQOA 2NVQH 3V96A 1JE5A 1UEBA 3KFUA 1KDAA 4DV3Q 1XMOL 1XNRQ 2EYFA 1BVSA 2RBMA 5AJ3Q 1IBLL 2I5LX 3X3MA 2YU9B 1TS2A 2K75A 1PZKD 3K80C 4DAVA 2ZTCA 2RKSA 2VL6A 4POGA 4HIKA 3E0JA 3T13A 3Q23A 2NTSA 2VUMH 4X3UA 1F2YA 1SAPA 3RZDB 4DUYQ 1AE3A 2K5NA 4A3GH 2LXKA 2MNAA 4A3JB 4OXPA 4IUVA 2CW0D 3N6RA 3DM3A 2RHQB 3M4YA 1N32Q 4A93H 4HN7A 1LT5D 3GTPB 2F0NA 3M3YB 2B63G 2JA6H 1EZ6A 3W3AA 1PV4A 1K3BC 4B3SL 5EPKA 1JWMD 2PNRC 2CHBD 2ZXPA 4A3EG 4LNQA 4LF4L 1SYBA 3PIO3 1SEBD 1G291 1S5ED 1YNJC 4MZ9A 1NR4A 3I56A 4I65A 2JA5H 1FD7D 2QKIC 4HEDA 3E9HA 4RG1A 1HNXQ 1JOOA 5CORA 5BR8L 3CD6A 2XVSA 5CC4A 1X3EA 2KCCA 4GN5A 4GZYC 4CJ2C 4FO2A 3VYUA 1HA6A 3U4ZA 1SE2A 1LUZA 2EDGA 3I4MG 2F0GA 4FNFA 4KHVA 2EY2A 4L5QA 5IT9L 4JYAL 4RGTA 4A3CG 2UXBL 4WJ4A 1ML0D 2LY7A 2NB0A 4XXEA 4C56C 1I3QB 2R7ZH 4HIDA 2B63H 4DR2Q 2IX1A 5C4ZA 1XNRL 1L1OC 4UPAA 3IRBA 5JVG3 5AJ3L 1HQRD 1HFNA 2E74C 2NZ1D 3MTSA 5M3FG 3P20A 2B2TC 2LXJA 3MXGA 4DAYA 4HSPA 4WJ3M 2MQHA 4XIGS 2AWNA 3HOYB 1O7YA 2NVTB 1RCVD 1TS4A 2H4OA 3HZXA 3I8ZA 5C44B 5J1ZA 1S72A 1K73C 3DUZA 2PZUA 1CHQD 1IYJB 1SYCA 3AMUA 1S3OA 5G3LF 2Q8RE 1L0WA 2PQAA 3SK6A 3I4MH 4I7AA 4UY8C 2G9HD 5EBCA 4A3CH 1N32L 1E3PA 4AYBG 1HXYD 1EU4A 3S1RH 3BZKA 3W1BA 2RSOA 4ZYSA 3A7AB 2E2HH 2EJFC 3U58A 2YYZA 1VQBA 1QUQA 1VMCA 4JVZA 1MJCA 4GN3B 1AZQA 2B2WA 3HKZG 3HOUB 3NQTA 1TWHB 2NVQB 1C4QA 3CF5A 1NSNS 1BXTA 1SNPA 2Q2HA 2R92G 1HNXL 4HR7B 4A3DG 3A55A 3K7UC 3OIPA 4B08A 4DXGA 2ZTEA 3TS0A 2F4VQ 4LW1A 3HFZB 4M8AA 5D14A 1BNZA 1N8RC 3HOVG 3NHHA 2M9VA 4LF6Q 1TU2B 4IOCA 2ZTDA 4DV0Q 1KXLA 4B9WA 5EPJA 3A8IE 3D4WA 5IT9E 3MA2B 2K7VA 3I73A 1YI2A 1CM9A 2KCMA 3K5OA 3PIPA 1IW7C 2F52A 3DWPA 1VQAA 5FO8B 1SNCA 1Z9FA 3BDOA 2VUMB 1FR3A 3BJUA 4OWXB 4DV7Q 4A3GB 4DR2L 2FHTA 1VQ7A 1I4PA 3FMCA 4KY7A 2AWOA 2K4KA 2PCFB 4A93B 1B70B 1N9WA 1ZYRC 2LSSA 3QO2A 1QOHA 4QGUA 2HUGA 2JA6B 1C48A 2OF1A 4DKAC 4PG3A 2H5XA 3OWFA 4KHZA 2R92H 1D1IA 1U0LA 2ES2A 4A3DH 3IFTA 1Y1WH 4UDUC 3IKJA 3T1YQ 3J80i 1GD7A 3U9SA 2F0DA 4QCLA 2F0TA 3EROA 2JA5B 1H95A 5M5XH 1RD9D 1PH5A 1BBWA 1RL2A 1FJGQ 5EBDA 3PO3B 4JBJA 4ZRZA 2Q8TA 2NVXH 4IJLA 5D3DA 3H0GG 3NE5B 3MFGA 1PRTB 4RKLA 4EVOA 3CC4A 1U9RA 3P75A 1JJCB 1PHJA 4B3RQ 1IXRA 1M4VA 4ME5A 4YCWA 4FP5D 4CKEA 2R93G 1STNA 1WTHA 4HAEA 2BDNA 1V9PA 4JOIC 1WTXA 2R7ZB 4AYBE 4OL7A 3HOZG 1G6PA 1JOQA 2B63B 1PLFA 4DAPA 1VCIA 5LMNQ 2IY5B 1VQMA 1A0IA 2KHIA 3KK7A 2ZJPA 1LT3D 2I5MX 3NUCA 2F4VL 5I2YA 3PCOB 3CP0A 3HKZE 4LF6L 3PQIA 3Q22A 4DV0L 1NBWA 4XTCS 3FDTA 1EYCA 1EWCA 1EYDA 3S1NH 3NTIA 4QB4A 4A3LH 1C7YA 2K5HA 3H0GH 4DV7L 1S5BD 3K0XA 3I4MB 1B50A 1KQSA 4A3FG 3A0JA 5D65A 2B3GA 4RAUC 3VDYA 5EQ0A 5HGQA 5KYLA 3S1RB 4FF4A 2A1AA 3HOZH 2DJGC 1EIYB 1QVFA 2E2HB 5IY0A 3QIAA 2ICEC 3LNNA 3J80L 3T1YL 3PV0A 1XWEA 1SE8A 1KC8C 3K0YA 3TEHB 1J5EQ 1E2WA 3CPWA 5JJKA 2D62A 1WTPA 3CRKC 5CV6A 2OXPA 4LUZA 1HPCA 5C3WA 4FF3A 5FKAC 5L37A 1K8GA 4B3RL 5GAGC 2RCFA 2QEJC 5CV9A 1GHKA 3V05A 2PI2E 3Q0AA 1NJIC 2MP1A 4K2LA 4O42A 4AYBB 1B3AA 2F3IA 1RIPA 1YNND 1PYWD 1C9OA 3CC2A 2EJMA 5C5LA 2WINB 1NE3A 4QJFA 1SMYD 3IAYA 3OWEB 2X6LA 2Z4HA 2K33A 3HKZB 1PFBA 1DONA 2IPKD 1FL0A 2E2IH 2R92B 4JI2L 3Q6SA 3FHWA 1EQQA 4A3DB 1TWCH 1ASYA 4N8FA 1Y1WB 2AQ1B 4LFBQ 3A54A 2DUDA 2BE5D 3MEHA 4BXXH 2MO0A 1PTOD 2VQFQ 2JA8G 3UDIA 2K05A 1LTBD 5M5XB 4KMUC 2O5JC 2PW7A 3M4QA 2ASBA 3K59A 4PV1C 2N49A 1JCKB 4A3KG 1QJOA 2KJXA 2NVXB 4P71A 2UUBQ 4JI1Q 1SNOA 1U4MA 1VQHA 1YHAA 3DXJC 4C3JG 5CMDA 1U4LA 3RLOA 5FK9C 1VS0A 3D8GA 3KJOA 4ZK9B 3HGBA 1X56A 3I3CA 2EQSA 1EUJA 2DY7A 4FVMA 4XQJA 1B44D 4LMQD 4R8NA 1P16A 3L3OC 5I2XA 5CR3A 4L8JA 2HT1A 1EOTA 1DD2A 1EWHA 1Q3LA 1B9MA 3SR1A 3KBGA 5DM73 4C1NI 3I55A 2JA8H 2B2UA 1OTCA 1XNQQ 4JI4L
chains in the Genus database with same CATH topology
1E1OA 5BR8Q 1HH2P 1HZCA 4GOPA 2UU9Q 2VUMG 3EIVA 1G51A 2VQEL 4ALPA 1YIJA 1UE6A 2JK8A 2B29A 2CFMA 4A3KH 4IPDA 3J81i 1WFQA 4APVA 4JI6L 4A3GG 1OXVA 2R93H 1VQ8A 1CKOA 5ELOA 2I0QA 3CCJA 3KOJA 4C3JH 4JI7Q 4JI3Q 4LF9L 1S40A 1N33L 2XTIA 1JMCA 4JYAQ 2UXBQ 4A4IA 4X62Q 3G6EA 1VQCA 2PI2A 1A62A 4AH6A 5IWAQ 2JQOA 2YTXA 2JA9A 1PH6A 2GVAA 3H3VH 3PF4A 4JV5Q 1M90C 4R1JA 3L2PA 1TWHH 2NVQH 5GQOA 3HOUH 1YITA 1JE5A 1UEBA 5IYCH 3CCMA 3KFUA 3NEMA 3J81j 4DV3Q 2UXDQ 2FXQA 4HJ5A 1XMOL 4IPCA 1XNRQ 3HOWH 1UE1A 3KF8B 1BVSA 3TREA 2JA7G 4LFCL 5IYBG 4KI0A 1FJGL 1PH8A 1I94L 2Y0SE 4OO1G 2OTJA 5AJ3Q 1IBLL 2I5LX 1N36L 2E2JH 3AYHB 4LFBL 2GN5A 4L5TA 3JC66 4A76A 1PVOA 2K75A 4A3IG 1YEZA 4PZ8A 3J7ZC 3K80C 4EQ5A 3G71A 3S16H 2ZTCA 3OW2A 4NB3A 1WI5A 1BBUA 1Y1WG 4DUZL 1JT8A 2VL6A 4POGA 2HIXA 3BZCA 3S24A 3U50C 1KHIA 5C3EG 3PUVA 2ZJRA 1SFOH 1CSPA 4HIKA 5IYDH 1MJEA 4RMFA 2MO1A 2VUMH 4A3FH 3F2CA 2UUBL 1V43A 3BU2A 1EWIA 1Y1VG 3M4PA 4JI1L 5FLXc 1M1KC 5C0XI 1VQ9A 5C4JH 4DUYQ 4QQBX 1AE3A 1Q86C 1GKHA 2K5NA 1VQPA 2LXKA 2MNAA 3CCEA 4A3GH 3D0FA 4OXPA 3H15A 3AFQA 2K50A 3CW2C 5LMNL 3GTOH 1WYDA 1Y14B 2RHQB 3DM3A 4GS3A 2N8NA 1GVPA 4UP8A 4A93H 1N32Q 1DGSA 2B63G 2UUCQ 2JA6H 3MEFA 1PV4A 4B3SL 4HJ7A 2NN6G 1HZAA 5FJ8G 1E24A 3CMEA 4A3EG 4LNQA 2VW9A 4LF4L 2WFWA 1G291 3F8TA 3AEVA 2JA7H 5IYBH 3RN5A 2UUAL 4IFDJ 4AQYQ 4MZ9A 3KYHC 4PMWA 1X3GA 1IBKQ 3I56A 2JEAI 4JCVE 2JA5H 2BA1A 2JE6I 1VQ6A 3E9HA 4RG1A 2C35B 4A3IH 1HNXQ 3I4NG 3PF5A 3ULLA 5LMNW 5IE8A 3KLWA 2K5VA 4X65L 4DV4L 4JI5Q 4LFAL 1YJWA 1XNQL 2YTYA 5BR8L 2IHFA 3CD6A 2UU9L 4LF5Q 5C3EH 2K52A 1X3EA 4GN5A 3UE0A 2ID0A 2PMZE 4IO9A 4KHPQ 3U4ZA 4B3TQ 1NTGA 1LUZA 3I4OA 3W5OA 1Y1VH 3OYYA 3I4MG 1Q12A 4JI3L 4HJ9A 4Y7NH 1VQ5A 4L5QA 3GTMH 2D0OA 3M7NA 1KAWA 3CQZH 4UP9A 4A3CG 4X62L 4JYAL 2UXBL 4WJ4A 4C3HH 4A3LG 1L1OB 4GN4B 2L15A 5IWAL 2OCEA 4JV5L 2R7ZH 4HIDA 5C4XG 4A3BG 4IFDI 2B63H 1MIUA 4DR2Q 3JAMc 2UXDL 2IX1A 3HOXG 1XNRL 3CCUA 1CKMA 1L1OC 2BH8A 3GDEA 1IBMQ 1J5EL 3EN2A 3ICEA 3M9BA 1QVCA 4DAYB 4K0KL 2R7FA 4UPAA 1C0AA 3IRBA 2Q2UA 3UDXA 2EXDA 2JEBI 5AJ3L 1VQDA 5M5YH 1XJVA 1A63A 1I5FA 4R4CA 4C3IH 1UE7A 2D0PA 5M3FG 1PFSA 2LXJA 3KJPA 3AQQA 2QA4A 4P73A 1YHBA 4P74A 5GAHC 4GLXA 3S2HH 4WJ3M 2MQHA 4XIGS 4DV6Q 4DK3C 2PQAB 2AWNA 4QIWE 3G4SA 1PH2A 2BH2A 2GVBA 3CCQA 1S72A 1WJJA 1K73C 2CQOA 3S1MH 4Y52H 1IYJB 1Z47A 2EIFA 4POFA 1S3OA 3U4VA 4JI2Q 2E5LL 2MFIA 1L0WA 5JEAJ 2PQAA 1OXTA 1X9NA 1HR0Q 4A3MH 3I4MH 3NBHB 1X65A 4UY8C 3B6YA 1VQIA 1I6HH 4A3CH 1N32L 1LM0A 1E3PA 1QUQB 4AYBG 1YJ9A 3HKSA 4DV5Q 2K14A 1KIXA 4IJHA 1EOVA 3S1RH 5C0XJ 3BZKA 3W1BA 5H1SE 3SGIA 4BBSG 3S1QH 2RHSB 5C4XH 3CAMA 2Q2TA 4A3BH 3FP9A 3PUWA 1WCMG 2E2HH 2OQKA 1OXUA 2HQLA 3U58A 2YYZA 1VQBA 3HOXH 2YV5A 1QUQA 1VQKA 1KRSA 1CUKA 1MJCA 4GN3B 1FVIA 2VZAA 4JI0Q 3HKZG 2QGQA 1IBKL 3CF5A 1HNWQ 1N34Q 1AH9A 2AMCB 4IOAA 2Q2HA 4UP7A 1ASZA 2R92G 2RF4A 1BKBA 1HNXL 2VQFL 3Q8DA 4A3DG 1YNXA 3T1HQ 1HNZQ 3K7UC 2UXCQ 4NXMQ 2ZTEA 3TS0A 2KBNA 4BA1I 4BY7G 2F4VQ 4LW1A 3HFZB 4LF5L 1WOCA 1VQNA 5LMUQ 1N8RC 3HOVG 1VQGA 4JBWA 4LF6Q 4KHPL 1W3SA 4IOCA 2ZTDA 3FKIG 3J80c 4DV0Q 1XPRA 1KXLA 2V1CC 3NENA 4TVAB 2ZM6Q 1L2FA 2KCMA 4JC0A 3ULJA 1YI2A 4BXXG 3RLFA 1VQJA 3PIPA 2CWAA 3K81C 1VQFA 3I2ZA 1K8AC 2F52A 2Q2IA 4HIOA 1VQAA 2WAQG 3MXNB 1Z9FA 3WWVA 3BJUA 4OWXB 3GTQH 1PH1A 4L5RC 1X3FA 4DV7Q 3KDFB 4JI4Q 1NY4A 4DR2L 4LF7Q 1VQ7A 4BBSH 1CSQA 1X54A 1E1TA 4QY7A 1WCMH 2AWOA 4DR1Q 2K4KA 1UWVA 3GTPH 3TS2A 2WB1G 1XNQQ 1B70B 5M5WH 4B3MQ 1N9WA 4A3LH 2LSSA 4YY3Q 4P75A 2QEXA 1K3RA 3KDFA 4QGUA 4JBKA 1XPUA 3PGZA 4LF9Q 1YBYA 3RLNA 3AFPA 1N33Q 4DKAC 4OONA 2H5XA 3E0EA 4PG3A 4KHZA 3PIOA 2R92H 3F2BA 1U0LA 2ES2A 4DV6L 4A3DH 2ALYB 2R7DA 1Y1WH 1FGUA 1J6QA 3A74A 3T1YQ 4PZ7A 3J80i 4R4QA 4YWLA 1GD7A 3A5UA 4BY7H 1XMOQ 4LF8Q 4DR4Q 1H95A 3F1ZA 4BA2I 1IL2A 4X6AH 5IP9G 5M5XH 3GTJH 1PH5A 1KD1C 3FKIH 1BBWA 1RL2A 4DAMA 5C44G 1HR0L 1FJGQ 4JI7L 1W2BA 4OWTB 5M3MG 2VY3A 4JBJA 1PA6A 4KLKA 4NPSA 3GTGH 1OXSC 3UDFA 1HZ9A 2NVXH 4IJLA 3W1GA 3H0GG 4DV5L 4GNXC 2OWOA 2IHEA 3CC4A 3S17H 2AHOB 4DUZQ 4BBRG 3H3VI 3GTLH 4DV3L 1JJCB 3CCVA 4DV2Q 1PHJA 3NELA 4B3RQ 2HHHQ 2Z6KC 1IXRA 4YCWA 4OX9Q 2VS1A 1R9TH 2R93G 1L1OA 4MTNA 2WP8J 1K0RA 5FJ8H 5IP7G 1V9PA 4H02A 4JOIC 4A3EH 4A75A 3K8AA 4AYBE 3HOZG 1G6PA 3J81c 1HNWL 1N34L 3PUZA 3CC7A 4HIMA 1VCIA 5LMNQ 2IY5B 1VQMA 1A0IA 1Q46A 2KHIA 2N3SA 3T1HL 1HNZL 4O0AA 2CKZB 5EAYA 1QZGA 5GADC 4OWWB 3J7A5 3I4NH 4DV1Q 2ZJPA 2I5MX 4NXML 5IT9c 2UXCL 4JBMA 2F4VL 1SMXA 3PCOB 3CP0A 5LMUL 3KF6B 4FDBA 4IPHA 4YWMA 3HKZE 1VQ4A 1YVCA 4GKJQ 3G48A 4LF6L 4QL5A 4BY1G 4DV0L 1NBWA 1HZBA 4DUYL 2ZM6L 3GO5A 4XTCS 5IP9H 4K0KQ 1KL9A 1XMQQ 1TWFH 1CKNB 3KF6A 3S1NH 1QZHA 5M3MH 4R4TA 5J3BA 2AKWB 1VQLA 2NZOA 3PUXA 2PNHA 3JAMi 2K5HA 4JI8Q 4A3JG 3H0GH 4DV7L 1C7YA 2UUCL 1X55A 4LFAQ 4DV4Q 3GTKH 1YJNA 1EIFA 4GOPC 3RR5A 3K0XA 1U5KA 4O2DA 4BBRH 1KQSA 4LF7L 1JJGA 1CKNA 3A0JA 1Q8KA 4X66Q 4A3FG 1TWGH 3PO2G 1K83H 4C2MH 4DR1L 3K7AH 2B3GA 4LWCA 1YHQA 4B3ML 3VDYA 3TQYA 5HGQA 2WAQE 1X6OA 4YY3L 1JJ2A 1PH9A 5IP7H 2R6GA 4AQYL 4NXNQ 2A1AA 4OO1I 2IX0A 3HOZH 1QVFA 3EBEA 4EX5A 1EIYB 3RZOH 4A93G 2E8GA 5IY0A 1Q82C 1D7QA 5M3FH 3PSIA 4DR6Q 3RN2A 2JA6G 4JI5L 1XPOA 2WB1E 3T1YL 4DR5Q 1Q1EA 3PV0A 2YU9H 4GKKQ 1MKHA 4LF8L 5GAEC 1SE8A 3OTOQ 4DR4L 1XTDA 1KC8C 1AE2A 4LUOA 1GM5A 3TEHB 1PH7A 4DR3Q 1J5EQ 4B3TL 5K36G 4BY1H 2XGTA 4TQUS 4X64Q 3CPWA 1VQEA 5JJKA 1KRTA 1Q7YC 2D62A 1YZ6A 2I5HA 3S2DH 2JA5G 4YHHQ 3M85A 5DLQE 5JEAG 1V1QA 1O7IA 3RZDH 5ELNA 4LUZA 1PYBA 2HIVA 3DLLA 3PO3G 3CCLA 2KHJA 4R4IA 4A3JH 2N78A 4DR7Q 1IZ6A 2NVYH 1T9HA 4L5SA 1K8GA 4DV2L 4B3RL 3CCRA 5GAGC 2HHHL 5C0XG 5IYDG 1IBML 4GLVB 2VQEQ 4DK6C 4OX9L 1D8LA 3PO2H 2PI2E 2NN6I 2Z0SA 3M3YH 3CXCA 1NJIC 1PH3A 2E5LQ 4JI6Q 5FLMG 2F3IA 3CCSA 1RIPA 1NMFA 2ZJQA 4J15A 1EQRA 1PH4A 3L7ZC 4YCUA 1C9OA 3CC2A 2KENA 2Y0SG 1UE5A 2R7ZG 3I7FA 1NE3A 4P72A 4QJFA 4DV1L 3M4OH 4JG2A 5JJLA 1B8AA 2JJQA 4DPGA 1P8LA 3S15H 3UE1A 4GKJL 3A5ZB 5JJIA 2A8VA 1SROA 2CCZA 1FL0A 4HJ8A 2E2IH 3UDGA 2CWPA 3HOVH 1SN8A 2RCNA 3HOYG 4JI2L 4GNXB 4LUVA 5GROA 3FHWA 3GD7A 2BA0A 1TWCH 4HJAA 1EQQA 1I94Q 4LFCQ 1ASYA 3S14H 1XMQL 4YCVA 1SRUA 1N36Q 1IBLQ 4ME3A 3ERSX 4LFBQ 2DUDA 5E7NA 1Q81C 3LGJA 2VNUD 4PZ6A 4BXXH 2MO0A 1LTLA 2NZHA 3CMAA 4GLAC 3STBC 2DGYA 2VQFQ 2JA8G 4JI8L 2OTLA 3UDIA 4GNXA 1TXYA 3M4QA 1NMGA 2A19A 2ASBA 3PO3H 1Q1BA 1PYSB 2N49A 4X66L 4A3KG 1TWAH 4AIMA 1E7ZA 1I3QH 2Z6KA 1A8VA 2KCTA 4P71A 3RNUA 4JI1Q 1VQHA 2UUBQ 1YHAA 4A3MG 3CPFA 4JI0L 1QVGA 4MNOA 3E9IA 4JOIA 4NXNL 3RLOA 2ATWA 3TRZA 1HJPA 5FLMH 1VS0A 1SLJA 1VQOA 1HR0W 4R4OA 5HY6A 1EFWA 3F2DA 2YTVA 3KJOA 4DR6L 4DNIA 4YWKA 3HOUG 1X56A 1K9MC 5IYCG 2IT1A 4DR5L 2EQSA 1EUJA 4B3SQ 1SR3A 4GKKL 3L0OA 3HOWG 3OTOL 1P16A 1EYGA 1B7YB 4DR3L 3ULPA 4IPGA 4X64L 1OXXK 4LF4Q 3HOYH 3ZJYC 2NVTH 2HT1A 5C44H 2UUAQ 4YHHL 4GOPB 3D31A 1E22A 3PUYA 1LYLA 1GO3E 3ER0A 2OQ0A 4IFDG 3I55A 1I50H 1JB7A 3STBD 2JA8H 1OTCA 4X65Q 4JI4L 4DR7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  5BR8 Q;  1HH2 P;  1HZC A;  4GOP A;  2UU9 Q;  2VUM G;  3EIV A;  1G51 A;  2VQE L;  4ALP A;  1YIJ A;  1UE6 A;  2JK8 A;  2B29 A;  2CFM A;  4A3K H;  4IPD A;  3J81 i;  1WFQ A;  4APV A;  4JI6 L;  4A3G G;  1OXV A;  2R93 H;  1VQ8 A;  1CKO A;  5ELO A;  2I0Q A;  3CCJ A;  3KOJ A;  4C3J H;  4JI7 Q;  4JI3 Q;  4LF9 L;  1S40 A;  1N33 L;  2XTI A;  1JMC A;  4JYA Q;  2UXB Q;  4A4I A;  4X62 Q;  3G6E A;  1VQC A;  2PI2 A;  1A62 A;  4AH6 A;  5IWA Q;  2JQO A;  2YTX A;  2JA9 A;  1PH6 A;  2GVA A;  3H3V H;  3PF4 A;  4JV5 Q;  1M90 C;  4R1J A;  3L2P A;  1TWH H;  2NVQ H;  5GQO A;  3HOU H;  1YIT A;  1JE5 A;  1UEB A;  5IYC H;  3CCM A;  3KFU A;  3NEM A;  3J81 j;  4DV3 Q;  2UXD Q;  2FXQ A;  4HJ5 A;  1XMO L;  4IPC A;  1XNR Q;  3HOW H;  1UE1 A;  3KF8 B;  1BVS A;  3TRE A;  2JA7 G;  4LFC L;  5IYB G;  4KI0 A;  1FJG L;  1PH8 A;  1I94 L;  2Y0S E;  4OO1 G;  2OTJ A;  5AJ3 Q;  1IBL L;  2I5L X;  1N36 L;  2E2J H;  3AYH B;  4LFB L;  2GN5 A;  4L5T A;  3JC6 6;  4A76 A;  1PVO A;  2K75 A;  4A3I G;  1YEZ A;  4PZ8 A;  3J7Z C;  3K80 C;  4EQ5 A;  3G71 A;  3S16 H;  2ZTC A;  3OW2 A;  4NB3 A;  1WI5 A;  1BBU A;  1Y1W G;  4DUZ L;  1JT8 A;  2VL6 A;  4POG A;  2HIX A;  3BZC A;  3S24 A;  3U50 C;  1KHI A;  5C3E G;  3PUV A;  2ZJR A;  1SFO H;  1CSP A;  4HIK A;  5IYD H;  1MJE A;  4RMF A;  2MO1 A;  2VUM H;  4A3F H;  3F2C A;  2UUB L;  1V43 A;  3BU2 A;  1EWI A;  1Y1V G;  3M4P A;  4JI1 L;  5FLX c;  1M1K C;  5C0X I;  1VQ9 A;  5C4J H;  4DUY Q;  4QQB X;  1AE3 A;  1Q86 C;  1GKH A;  2K5N A;  1VQP A;  2LXK A;  2MNA A;  3CCE A;  4A3G H;  3D0F A;  4OXP A;  3H15 A;  3AFQ A;  2K50 A;  3CW2 C;  5LMN L;  3GTO H;  1WYD A;  1Y14 B;  2RHQ B;  3DM3 A;  4GS3 A;  2N8N A;  1GVP A;  4UP8 A;  4A93 H;  1N32 Q;  1DGS A;  2B63 G;  2UUC Q;  2JA6 H;  3MEF A;  1PV4 A;  4B3S L;  4HJ7 A;  2NN6 G;  1HZA A;  5FJ8 G;  1E24 A;  3CME A;  4A3E G;  4LNQ A;  2VW9 A;  4LF4 L;  2WFW A;  1G29 1;  3F8T A;  3AEV A;  2JA7 H;  5IYB H;  3RN5 A;  2UUA L;  4IFD J;  4AQY Q;  4MZ9 A;  3KYH C;  4PMW A;  1X3G A;  1IBK Q;  3I56 A;  2JEA I;  4JCV E;  2JA5 H;  2BA1 A;  2JE6 I;  1VQ6 A;  3E9H A;  4RG1 A;  2C35 B;  4A3I H;  1HNX Q;  3I4N G;  3PF5 A;  3ULL A;  5LMN W;  5IE8 A;  3KLW A;  2K5V A;  4X65 L;  4DV4 L;  4JI5 Q;  4LFA L;  1YJW A;  1XNQ L;  2YTY A;  5BR8 L;  2IHF A;  3CD6 A;  2UU9 L;  4LF5 Q;  5C3E H;  2K52 A;  1X3E A;  4GN5 A;  3UE0 A;  2ID0 A;  2PMZ E;  4IO9 A;  4KHP Q;  3U4Z A;  4B3T Q;  1NTG A;  1LUZ A;  3I4O A;  3W5O A;  1Y1V H;  3OYY A;  3I4M G;  1Q12 A;  4JI3 L;  4HJ9 A;  4Y7N H;  1VQ5 A;  4L5Q A;  3GTM H;  2D0O A;  3M7N A;  1KAW A;  3CQZ H;  4UP9 A;  4A3C G;  4X62 L;  4JYA L;  2UXB L;  4WJ4 A;  4C3H H;  4A3L G;  1L1O B;  4GN4 B;  2L15 A;  5IWA L;  2OCE A;  4JV5 L;  2R7Z H;  4HID A;  5C4X G;  4A3B G;  4IFD I;  2B63 H;  1MIU A;  4DR2 Q;  3JAM c;  2UXD L;  2IX1 A;  3HOX G;  1XNR L;  3CCU A;  1CKM A;  1L1O C;  2BH8 A;  3GDE A;  1IBM Q;  1J5E L;  3EN2 A;  3ICE A;  3M9B A;  1QVC A;  4DAY B;  4K0K L;  2R7F A;  4UPA A;  1C0A A;  3IRB A;  2Q2U A;  3UDX A;  2EXD A;  2JEB I;  5AJ3 L;  1VQD A;  5M5Y H;  1XJV A;  1A63 A;  1I5F A;  4R4C A;  4C3I H;  1UE7 A;  2D0P A;  5M3F G;  1PFS A;  2LXJ A;  3KJP A;  3AQQ A;  2QA4 A;  4P73 A;  1YHB A;  4P74 A;  5GAH C;  4GLX A;  3S2H H;  4WJ3 M;  2MQH A;  4XIG S;  4DV6 Q;  4DK3 C;  2PQA B;  2AWN A;  4QIW E;  3G4S A;  1PH2 A;  2BH2 A;  2GVB A;  3CCQ A;  1S72 A;  1WJJ A;  1K73 C;  2CQO A;  3S1M H;  4Y52 H;  1IYJ B;  1Z47 A;  2EIF A;  4POF A;  1S3O A;  3U4V A;  4JI2 Q;  2E5L L;  2MFI A;  1L0W A;  5JEA J;  2PQA A;  1OXT A;  1X9N A;  1HR0 Q;  4A3M H;  3I4M H;  3NBH B;  1X65 A;  4UY8 C;  3B6Y A;  1VQI A;  1I6H H;  4A3C H;  1N32 L;  1LM0 A;  1E3P A;  1QUQ B;  4AYB G;  1YJ9 A;  3HKS A;  4DV5 Q;  2K14 A;  1KIX A;  4IJH A;  1EOV A;  3S1R H;  5C0X J;  3BZK A;  3W1B A;  5H1S E;  3SGI A;  4BBS G;  3S1Q H;  2RHS B;  5C4X H;  3CAM A;  2Q2T A;  4A3B H;  3FP9 A;  3PUW A;  1WCM G;  2E2H H;  2OQK A;  1OXU A;  2HQL A;  3U58 A;  2YYZ A;  1VQB A;  3HOX H;  2YV5 A;  1QUQ A;  1VQK A;  1KRS A;  1CUK A;  1MJC A;  4GN3 B;  1FVI A;  2VZA A;  4JI0 Q;  3HKZ G;  2QGQ A;  1IBK L;  3CF5 A;  1HNW Q;  1N34 Q;  1AH9 A;  2AMC B;  4IOA A;  2Q2H A;  4UP7 A;  1ASZ A;  2R92 G;  2RF4 A;  1BKB A;  1HNX L;  2VQF L;  3Q8D A;  4A3D G;  1YNX A;  3T1H Q;  1HNZ Q;  3K7U C;  2UXC Q;  4NXM Q;  2ZTE A;  3TS0 A;  2KBN A;  4BA1 I;  4BY7 G;  2F4V Q;  4LW1 A;  3HFZ B;  4LF5 L;  1WOC A;  1VQN A;  5LMU Q;  1N8R C;  3HOV G;  1VQG A;  4JBW A;  4LF6 Q;  4KHP L;  1W3S A;  4IOC A;  2ZTD A;  3FKI G;  3J80 c;  4DV0 Q;  1XPR A;  1KXL A;  2V1C C;  3NEN A;  4TVA B;  2ZM6 Q;  1L2F A;  2KCM A;  4JC0 A;  3ULJ A;  1YI2 A;  4BXX G;  3RLF A;  1VQJ A;  3PIP A;  2CWA A;  3K81 C;  1VQF A;  3I2Z A;  1K8A C;  2F52 A;  2Q2I A;  4HIO A;  1VQA A;  2WAQ G;  3MXN B;  1Z9F A;  3WWV A;  3BJU A;  4OWX B;  3GTQ H;  1PH1 A;  4L5R C;  1X3F A;  4DV7 Q;  3KDF B;  4JI4 Q;  1NY4 A;  4DR2 L;  4LF7 Q;  1VQ7 A;  4BBS H;  1CSQ A;  1X54 A;  1E1T A;  4QY7 A;  1WCM H;  2AWO A;  4DR1 Q;  2K4K A;  1UWV A;  3GTP H;  3TS2 A;  2WB1 G;  1XNQ Q;  1B70 B;  5M5W H;  4B3M Q;  1N9W A;  4A3L H;  2LSS A;  4YY3 Q;  4P75 A;  2QEX A;  1K3R A;  3KDF A;  4QGU A;  4JBK A;  1XPU A;  3PGZ A;  4LF9 Q;  1YBY A;  3RLN A;  3AFP A;  1N33 Q;  4DKA C;  4OON A;  2H5X A;  3E0E A;  4PG3 A;  4KHZ A;  3PIO A;  2R92 H;  3F2B A;  1U0L A;  2ES2 A;  4DV6 L;  4A3D H;  2ALY B;  2R7D A;  1Y1W H;  1FGU A;  1J6Q A;  3A74 A;  3T1Y Q;  4PZ7 A;  3J80 i;  4R4Q A;  4YWL A;  1GD7 A;  3A5U A;  4BY7 H;  1XMO Q;  4LF8 Q;  4DR4 Q;  1H95 A;  3F1Z A;  4BA2 I;  1IL2 A;  4X6A H;  5IP9 G;  5M5X H;  3GTJ H;  1PH5 A;  1KD1 C;  3FKI H;  1BBW A;  1RL2 A;  4DAM A;  5C44 G;  1HR0 L;  1FJG Q;  4JI7 L;  1W2B A;  4OWT B;  5M3M G;  2VY3 A;  4JBJ A;  1PA6 A;  4KLK A;  4NPS A;  3GTG H;  1OXS C;  3UDF A;  1HZ9 A;  2NVX H;  4IJL A;  3W1G A;  3H0G G;  4DV5 L;  4GNX C;  2OWO A;  2IHE A;  3CC4 A;  3S17 H;  2AHO B;  4DUZ Q;  4BBR G;  3H3V I;  3GTL H;  4DV3 L;  1JJC B;  3CCV A;  4DV2 Q;  1PHJ A;  3NEL A;  4B3R Q;  2HHH Q;  2Z6K C;  1IXR A;  4YCW A;  4OX9 Q;  2VS1 A;  1R9T H;  2R93 G;  1L1O A;  4MTN A;  2WP8 J;  1K0R A;  5FJ8 H;  5IP7 G;  1V9P A;  4H02 A;  4JOI C;  4A3E H;  4A75 A;  3K8A A;  4AYB E;  3HOZ G;  1G6P A;  3J81 c;  1HNW L;  1N34 L;  3PUZ A;  3CC7 A;  4HIM A;  1VCI A;  5LMN Q;  2IY5 B;  1VQM A;  1A0I A;  1Q46 A;  2KHI A;  2N3S A;  3T1H L;  1HNZ L;  4O0A A;  2CKZ B;  5EAY A;  1QZG A;  5GAD C;  4OWW B;  3J7A 5;  3I4N H;  4DV1 Q;  2ZJP A;  2I5M X;  4NXM L;  5IT9 c;  2UXC L;  4JBM A;  2F4V L;  1SMX A;  3PCO B;  3CP0 A;  5LMU L;  3KF6 B;  4FDB A;  4IPH A;  4YWM A;  3HKZ E;  1VQ4 A;  1YVC A;  4GKJ Q;  3G48 A;  4LF6 L;  4QL5 A;  4BY1 G;  4DV0 L;  1NBW A;  1HZB A;  4DUY L;  2ZM6 L;  3GO5 A;  4XTC S;  5IP9 H;  4K0K Q;  1KL9 A;  1XMQ Q;  1TWF H;  1CKN B;  3KF6 A;  3S1N H;  1QZH A;  5M3M H;  4R4T A;  5J3B A;  2AKW B;  1VQL A;  2NZO A;  3PUX A;  2PNH A;  3JAM i;  2K5H A;  4JI8 Q;  4A3J G;  3H0G H;  4DV7 L;  1C7Y A;  2UUC L;  1X55 A;  4LFA Q;  4DV4 Q;  3GTK H;  1YJN A;  1EIF A;  4GOP C;  3RR5 A;  3K0X A;  1U5K A;  4O2D A;  4BBR H;  1KQS A;  4LF7 L;  1JJG A;  1CKN A;  3A0J A;  1Q8K A;  4X66 Q;  4A3F G;  1TWG H;  3PO2 G;  1K83 H;  4C2M H;  4DR1 L;  3K7A H;  2B3G A;  4LWC A;  1YHQ A;  4B3M L;  3VDY A;  3TQY A;  5HGQ A;  2WAQ E;  1X6O A;  4YY3 L;  1JJ2 A;  1PH9 A;  5IP7 H;  2R6G A;  4AQY L;  4NXN Q;  2A1A A;  4OO1 I;  2IX0 A;  3HOZ H;  1QVF A;  3EBE A;  4EX5 A;  1EIY B;  3RZO H;  4A93 G;  2E8G A;  5IY0 A;  1Q82 C;  1D7Q A;  5M3F H;  3PSI A;  4DR6 Q;  3RN2 A;  2JA6 G;  4JI5 L;  1XPO A;  2WB1 E;  3T1Y L;  4DR5 Q;  1Q1E A;  3PV0 A;  2YU9 H;  4GKK Q;  1MKH A;  4LF8 L;  5GAE C;  1SE8 A;  3OTO Q;  4DR4 L;  1XTD A;  1KC8 C;  1AE2 A;  4LUO A;  1GM5 A;  3TEH B;  1PH7 A;  4DR3 Q;  1J5E Q;  4B3T L;  5K36 G;  4BY1 H;  2XGT A;  4TQU S;  4X64 Q;  3CPW A;  1VQE A;  5JJK A;  1KRT A;  1Q7Y C;  2D62 A;  1YZ6 A;  2I5H A;  3S2D H;  2JA5 G;  4YHH Q;  3M85 A;  5DLQ E;  5JEA G;  1V1Q A;  1O7I A;  3RZD H;  5ELN A;  4LUZ A;  1PYB A;  2HIV A;  3DLL A;  3PO3 G;  3CCL A;  2KHJ A;  4R4I A;  4A3J H;  2N78 A;  4DR7 Q;  1IZ6 A;  2NVY H;  1T9H A;  4L5S A;  1K8G A;  4DV2 L;  4B3R L;  3CCR A;  5GAG C;  2HHH L;  5C0X G;  5IYD G;  1IBM L;  4GLV B;  2VQE Q;  4DK6 C;  4OX9 L;  1D8L A;  3PO2 H;  2PI2 E;  2NN6 I;  2Z0S A;  3M3Y H;  3CXC A;  1NJI C;  1PH3 A;  2E5L Q;  4JI6 Q;  5FLM G;  2F3I A;  3CCS A;  1RIP A;  1NMF A;  2ZJQ A;  4J15 A;  1EQR A;  1PH4 A;  3L7Z C;  4YCU A;  1C9O A;  3CC2 A;  2KEN A;  2Y0S G;  1UE5 A;  2R7Z G;  3I7F A;  1NE3 A;  4P72 A;  4QJF A;  4DV1 L;  3M4O H;  4JG2 A;  5JJL A;  1B8A A;  2JJQ A;  4DPG A;  1P8L A;  3S15 H;  3UE1 A;  4GKJ L;  3A5Z B;  5JJI A;  2A8V A;  1SRO A;  2CCZ A;  1FL0 A;  4HJ8 A;  2E2I H;  3UDG A;  2CWP A;  3HOV H;  1SN8 A;  2RCN A;  3HOY G;  4JI2 L;  4GNX B;  4LUV A;  5GRO A;  3FHW A;  3GD7 A;  2BA0 A;  1TWC H;  4HJA A;  1EQQ A;  1I94 Q;  4LFC Q;  1ASY A;  3S14 H;  1XMQ L;  4YCV A;  1SRU A;  1N36 Q;  1IBL Q;  4ME3 A;  3ERS X;  4LFB Q;  2DUD A;  5E7N A;  1Q81 C;  3LGJ A;  2VNU D;  4PZ6 A;  4BXX H;  2MO0 A;  1LTL A;  2NZH A;  3CMA A;  4GLA C;  3STB C;  2DGY A;  2VQF Q;  2JA8 G;  4JI8 L;  2OTL A;  3UDI A;  4GNX A;  1TXY A;  3M4Q A;  1NMG A;  2A19 A;  2ASB A;  3PO3 H;  1Q1B A;  1PYS B;  2N49 A;  4X66 L;  4A3K G;  1TWA H;  4AIM A;  1E7Z A;  1I3Q H;  2Z6K A;  1A8V A;  2KCT A;  4P71 A;  3RNU A;  4JI1 Q;  1VQH A;  2UUB Q;  1YHA A;  4A3M G;  3CPF A;  4JI0 L;  1QVG A;  4MNO A;  3E9I A;  4JOI A;  4NXN L;  3RLO A;  2ATW A;  3TRZ A;  1HJP A;  5FLM H;  1VS0 A;  1SLJ A;  1VQO A;  1HR0 W;  4R4O A;  5HY6 A;  1EFW A;  3F2D A;  2YTV A;  3KJO A;  4DR6 L;  4DNI A;  4YWK A;  3HOU G;  1X56 A;  1K9M C;  5IYC G;  2IT1 A;  4DR5 L;  2EQS A;  1EUJ A;  4B3S Q;  1SR3 A;  4GKK L;  3L0O A;  3HOW G;  3OTO L;  1P16 A;  1EYG A;  1B7Y B;  4DR3 L;  3ULP A;  4IPG A;  4X64 L;  1OXX K;  4LF4 Q;  3HOY H;  3ZJY C;  2NVT H;  2HT1 A;  5C44 H;  2UUA Q;  4YHH L;  4GOP B;  3D31 A;  1E22 A;  3PUY A;  1LYL A;  1GO3 E;  3ER0 A;  2OQ0 A;  4IFD G;  3I55 A;  1I50 H;  1JB7 A;  3STB D;  2JA8 H;  1OTC A;  4X65 Q;  4JI4 L;  4DR7 L; 
#chains in the Genus database with same CATH topology
 1H9R A;  1Y8O B;  3LWE A;  4GOP A;  2UU9 Q;  1V1P B;  3S1N B;  4ALP A;  3FPU B;  1LTA D;  1YIJ A;  1CQF A;  2JK8 A;  1GUT A;  4A3K H;  4IPD A;  4PMC A;  1RTO A;  3P1H A;  1CKO A;  3H0G B;  3X3N A;  3KOJ A;  4C3J H;  1K28 A;  3VYR A;  1STG A;  4A4I A;  5IWA Q;  2EY1 A;  2JQO A;  2KA7 A;  3H3V H;  4DK1 A;  3RUZ A;  1YIT A;  3CCM A;  3HOZ B;  4HJ5 A;  4IPC A;  5ELC A;  1EY9 A;  1UE1 A;  2JA7 G;  5IYB G;  4OO1 G;  2OTJ A;  5KND A;  2E2J H;  4LFB L;  1CA6 A;  1PVO A;  4J6H A;  1HA5 A;  1IKL A;  3J7Z C;  3S16 H;  1HUM A;  5LHY 1;  3GP7 A;  1WI5 A;  1BBU A;  5JOB A;  4DUZ L;  2HIX A;  2FMC A;  2JN4 A;  2B2Y A;  1MJE A;  4K6L A;  4RMF A;  2MO1 A;  1G2S A;  3I91 A;  2UUB L;  3PMF A;  3M4P A;  4JI1 L;  5C0X I;  4QQB X;  1VQP A;  3QOL A;  2F0S A;  3D0F A;  3AFQ A;  1Y8N B;  3GTO H;  3CW2 C;  1TY0 A;  1SBB B;  2K1B A;  1WYD A;  1Z6H A;  2N8N A;  1PZJ D;  4ILW A;  1EY5 A;  2NN6 G;  5IOC A;  1E24 A;  2WFW A;  2QDB A;  2JA7 H;  5IYB H;  3RN5 A;  4OO1 H;  4IFD J;  4F88 A;  1IBK Q;  1X3G A;  2J0T D;  1S4Z A;  3MC0 B;  1XX8 A;  3VYS A;  3I4N G;  5JEA H;  2E2I B;  5LMN W;  1XNQ L;  4RH6 A;  4JI5 Q;  1TWC B;  1WD1 A;  2YTY A;  2UU9 L;  2K52 A;  2PMZ E;  3D6W A;  4KHP Q;  5KYI A;  5CBA E;  1BQQ T;  3I4O A;  4HCS A;  4Y7N H;  1F9S A;  1SDF A;  1JQY D;  4UP9 A;  3FVQ A;  1L0Y B;  3FEW X;  5IWA L;  4GN4 B;  1IW7 D;  1EU3 A;  1H9M A;  2B2V C;  5C4X G;  2A6E C;  5JPM C;  1B53 A;  2E75 C;  3CCU A;  2CQA A;  1IBM Q;  1HRJ A;  3ICE A;  3EN2 A;  4DAY B;  1QVC A;  2ICI A;  1PRT C;  1A6X A;  5C4H A;  1XJV A;  1I5F A;  2R61 A;  1ICW A;  4P74 A;  5GAH C;  1DJR D;  2PQA B;  2D2C C;  1W6J A;  1MSG A;  2GVB A;  4IQZ A;  3OMG A;  3S1M H;  2C5C A;  2EIF A;  3FPP A;  4CJ1 B;  1X9N A;  2JA8 B;  4A3M H;  2WKD A;  1G6Z A;  2MGS A;  4TSS A;  1XYI A;  1LM0 A;  1I6V C;  1QUQ B;  3HKS A;  4DV5 Q;  4A3K B;  5C0X J;  5H1S E;  2RDF A;  1MI2 A;  4C3J B;  3S1Q H;  2IW3 A;  5C4X H;  2K5Q A;  3FP9 A;  1OXU A;  3HEJ A;  1I4H A;  1CUK A;  4FXK C;  4JI0 Q;  2QGQ A;  4IUN A;  1IBK L;  1F9P A;  1BF4 A;  2EYH A;  1R4Q B;  2AMC B;  4IOA A;  1ASZ A;  2RF4 A;  1QNU A;  1YNX A;  4UHV A;  3T53 B;  3T1H Q;  3J7A F;  1CZW A;  4BA1 I;  5FLX L;  4F8M A;  2E2J B;  4BS9 A;  5LMU Q;  3BG3 A;  4KKU A;  1HFG A;  4KV6 A;  4KHP L;  3J80 c;  3VR4 A;  3S16 B;  2V1C C;  3NEN A;  4TVA B;  2ZM6 Q;  4KKS A;  1L2F A;  3J7A V;  1K8A C;  4CKC A;  2WAQ G;  2P5Z X;  2FFK B;  3GTQ H;  1PH1 A;  1NY4 A;  1EYA A;  1CSQ A;  3QB3 A;  5A2Q L;  3GTO B;  1QNK A;  3A8K E;  3MXN A;  2WB1 G;  5M5W H;  5IGD A;  1TY2 A;  2QEX A;  1ILP A;  1K3R A;  1XPU A;  2A73 B;  3PGZ A;  2F03 A;  1YBY A;  4IUQ A;  3S15 B;  5CV5 A;  1CQV A;  3E0E A;  4OON A;  3PIO A;  2NUC A;  5JPN C;  4KD3 A;  1JB3 A;  1F9Q A;  2JYO A;  2PYK A;  5CV7 A;  4M1U B;  2F0V A;  5HUR A;  2JA7 B;  4PZ7 A;  4R4Q A;  3OSO A;  5I9O A;  2Q8I B;  4FXG C;  3F1Z A;  1IL2 A;  1SE4 A;  2KED A;  5CV4 A;  4JI7 L;  1W2B A;  3K5N A;  2M00 A;  2HDL A;  2Z9H A;  3GTG H;  4ZLT F;  1OXS C;  3NPP A;  1HZ9 A;  2L55 A;  2OWO A;  4DV5 L;  1NUC A;  2L0C A;  3S17 H;  1AN8 A;  3H3V I;  4Y7N B;  2PPB C;  4IZ8 A;  4DV3 L;  1V8Q A;  3CCV A;  3NEL A;  2HHH Q;  1H9K A;  1D6E C;  3TP8 A;  2J7Z A;  4A3E H;  4A75 A;  2A6H C;  3PUZ A;  1EFI D;  3K58 A;  4IFD G;  3T1H L;  1MBY A;  3J7A 5;  4DV1 Q;  2I07 B;  3VR2 A;  4JBM A;  1SMX A;  5LMU L;  4IPH A;  3MZ5 A;  4DXF A;  4ID6 A;  4QL5 A;  3VA5 A;  1HZB A;  4DUY L;  2ZM6 L;  1KL9 A;  3R93 A;  1WTR A;  3S9W A;  5LL6 X;  3E3X A;  1XMQ Q;  2RSN A;  1LLR D;  4V0B A;  4F7X A;  3KF6 A;  3S1M B;  1SYD A;  1ZEQ X;  4R4T A;  4E6I A;  1WTW A;  3IL8 A;  4IUP A;  1SYE A;  5ELE A;  1X55 A;  1AW7 A;  4LFA Q;  4DGZ A;  4DV4 Q;  3GTK H;  4A3M B;  3RR5 A;  3BVM A;  1CKN A;  1LAB A;  4X66 Q;  3PO2 G;  4C2M H;  3K7A H;  4LWC A;  2WAQ E;  2EVB A;  1PTO H;  4OO1 I;  3S1Q B;  4EX5 A;  4NMZ A;  5M3F H;  5C3X A;  3MXU A;  5DNF A;  4KN4 C;  4CKB A;  2WB1 E;  4DR5 Q;  1Q1E A;  4RCO A;  3BYT B;  1EZ8 A;  4LUO A;  4DR3 Q;  4KK7 A;  2MUY A;  2XGT A;  1KRT A;  3GV6 A;  1YZ6 A;  3S2D H;  4YHH Q;  3M85 A;  2SNM A;  1JOK A;  4I7Z C;  1GUN A;  2HIV A;  4KN7 C;  2N78 A;  4DR7 Q;  4L5S A;  2SDF A;  2HHH L;  5C0X G;  4DK6 C;  1D8L A;  3PO2 H;  2NN6 I;  2Z0S A;  4L63 B;  4HTH A;  4K6D A;  5BN3 A;  1STA A;  2E5L Q;  3GTQ B;  4XYQ A;  5FLM G;  2IX3 A;  2SOB A;  1EQR A;  3L7Z C;  5DEH A;  2Y0S G;  1UE5 A;  1GUW A;  2EE1 A;  4DV1 L;  3NWS A;  5M5W B;  4JG2 A;  1FGB D;  3NP8 A;  2XN9 C;  3HP3 A;  2D5D A;  1SRO A;  4Q0F A;  2CCZ A;  4HJ8 A;  3UDG A;  2CWP A;  3HOV H;  2RCN A;  4LUV A;  5GRO A;  1CTM A;  4LFC Q;  3S14 H;  1XMQ L;  2VNU D;  1LO5 D;  3ERS X;  3KUP A;  2R3Z A;  1Q81 C;  1CI3 M;  1B3Q A;  1LTL A;  2NZH A;  3STB C;  2A69 D;  2XSC A;  3AB9 A;  4FF2 A;  1BCP D;  4GNX A;  1ZXT A;  1I4R A;  1TXY A;  4X66 L;  3NTK A;  3GTG B;  1GUO A;  3TZU A;  4KD4 A;  4AIM A;  1H9S A;  2Z6K A;  1RF2 D;  4OEL B;  2KCT A;  5C0X H;  4YIJ A;  1HHV A;  4FF1 A;  1QVG A;  4MNO A;  3E9I A;  2ATW A;  3TRZ A;  3S17 B;  4QMG A;  5FLM H;  1SLJ A;  4G57 A;  5E1F A;  3T4A C;  2NTT A;  5T1I A;  3C1F A;  1EFW A;  4NDX A;  1ENF A;  4A3E B;  2IT1 A;  4DR5 L;  5IGB A;  3HOW G;  4DR3 L;  3O13 A;  1OXX K;  1KAA A;  4NW2 A;  4JK1 C;  1I4Q A;  2UUA Q;  4YHH L;  4GOP B;  4N8X 1;  4U67 3;  1E22 A;  2Z8L A;  3PUY A;  1E0B A;  3ER0 A;  1JB7 A;  4X65 Q;  4DR7 L;  1E1O A;  3R8B A;  1SJE D;  3WOF A;  3D6C A;  3EIV A;  1GOZ A;  1UE6 A;  3DEO A;  5FO9 B;  1AZP A;  4CHT B;  4CDF C;  4APV A;  4Z9C B;  2CW0 C;  1OXV A;  2R93 H;  5ELO A;  3CCJ A;  2KEE A;  3GTK B;  1QE6 A;  2XTI A;  1JMC A;  4C2M B;  3SXH A;  3AU7 A;  3DM1 A;  3K7A B;  4AH6 A;  2JA9 A;  2QF7 A;  2SEB D;  3PF4 A;  3RD4 A;  1M90 C;  5K5P A;  3L2P A;  4HSV A;  5CV8 A;  4OHJ A;  4TRD A;  1PTO B;  3NEM A;  2UXD Q;  2FXQ A;  3HOW H;  3W2D A;  5M3F B;  1LT6 D;  3TRE A;  2B2W C;  4LFC L;  3SK5 A;  4KI0 A;  1FJG L;  1PH8 A;  4F87 A;  2Y0S E;  4MN3 A;  3AYH B;  1PMR A;  1BO0 A;  3H94 A;  1SYF A;  3MAQ A;  1YEZ A;  1F9R A;  4G4K A;  4EQ5 A;  3G71 A;  3OW2 A;  3KF8 A;  2WKC A;  1G8Z D;  4KJO A;  1JT8 A;  3BZC A;  1SFO H;  3S24 A;  1KHI A;  2PZW A;  2V4D A;  3S2D B;  3OMC A;  3D3R A;  3MHB A;  4RGN A;  1BR9 A;  4A3F H;  1ROD A;  1V43 A;  2J4X A;  1EWI A;  1VQ9 A;  5FLX c;  4RKB A;  5C4J H;  1Q86 C;  1SE3 A;  4N9P A;  4C3H G;  2K50 A;  5LMN L;  2XNA C;  1D5M C;  4GS3 A;  1GVP A;  3PO2 B;  2E2D C;  1SSO A;  1VF5 C;  5E4X A;  4ZKB B;  2UUC Q;  2F0W A;  4HJ7 A;  4FXD A;  2E76 C;  2A68 D;  2K04 A;  1MD2 D;  5FJ8 G;  3CME A;  2EZV A;  1E2V A;  1RJT A;  4JPB W;  3AEV A;  1ENA A;  2UUA L;  2SNS A;  2D9U A;  4C3I G;  4AQY Q;  3C3L A;  3K6O A;  5E4W C;  4PMW A;  1I4X A;  3ERQ A;  1QWY A;  3CRL C;  4JCV E;  2RDG A;  2BA1 A;  2DJF C;  2JE6 I;  1VQ6 A;  2B39 A;  2C35 B;  3HOV B;  1KDC A;  3ULL A;  3ZYY X;  2K5V A;  4RGO S;  4X65 L;  3S14 B;  1YJW A;  2IHF A;  4CDC C;  1GJX A;  3UE0 A;  5CBE E;  2NBF A;  3EFX D;  3VR6 A;  1PFM A;  4B3T Q;  1NTG A;  3H09 A;  3W5O A;  4DK0 A;  5CGK A;  1Q12 A;  1VQ5 A;  3BVG A;  4C3H H;  4K8J A;  3J80 E;  1L1O B;  1NAP A;  1NCV A;  2L15 A;  3TBI B;  5KIX A;  2FIN B;  5IGG A;  4A3B G;  4IFD I;  1LTR D;  3SHL A;  4IN3 A;  3JAM c;  2UXD L;  4R9W A;  1S5F D;  3HOX G;  2KHS A;  4MTK A;  1CKM A;  1J5E L;  3M9B A;  3U9O A;  2L12 A;  2F3W A;  1BUV T;  2N55 A;  4H44 C;  1TQO A;  1MSH A;  2Q2U A;  2EXD A;  2JEB I;  2K6A A;  1EQV A;  1S5C D;  1JE4 A;  5M5Y H;  5I4D A;  1A63 A;  4R4C A;  4C3I H;  2D0P A;  5IGE A;  1EIG A;  1YNJ D;  3MFY A;  2QA4 A;  1WTQ A;  3S2H H;  5EKK A;  1UAP A;  5DM6 3;  1IYU A;  3EQL C;  1PH2 A;  4XQQ A;  1SND A;  1WJJ A;  5LL6 S;  1JWU D;  3A8J E;  3C46 A;  2K5W A;  4H7B A;  1Z47 A;  1KAB A;  1QCB D;  4POF A;  2QCP X;  2MFI A;  2WAC A;  4KTA A;  3NBI A;  2EYM A;  1XTC D;  3DWQ A;  1ESR A;  3B6Y A;  1I6H H;  1EQT A;  2K28 A;  1KIX A;  1YJ9 A;  2K14 A;  4IJH A;  1EOV A;  4C1N K;  4JW0 A;  3TME A;  2R93 B;  5C5M A;  3TZD A;  2EXZ A;  4BBS G;  4A3B H;  3CAM A;  3RMH A;  4WRD A;  3NBH A;  1GXD C;  4RGM A;  5G3L D;  3HOX H;  4Q5V A;  2AUJ D;  1O78 A;  3SE0 A;  1KTK A;  2VZA A;  3R3O A;  1T5X D;  1HNW Q;  1BDO A;  1IHZ A;  1X3Q A;  1AH9 A;  2A6H D;  2VQF L;  3HOW B;  3Q8D A;  5IGF A;  2NWG A;  1TVX A;  2EY6 A;  5I6W A;  3K57 A;  3I4L A;  4BY7 G;  1VQN A;  1WOC A;  5C6A A;  5F2D A;  3BZD B;  1VQG A;  2EPB A;  2PQE A;  4JBW A;  2HD3 A;  1DM0 B;  1XPR A;  1WVL A;  1ONL A;  4JC0 A;  1VQF A;  4ZAI A;  2O5I C;  2Q2I A;  4UAI A;  4HIO A;  3C2P A;  3MXN B;  4A3F B;  3LX0 A;  1QB5 D;  1A3U A;  5C4J B;  5ISR A;  1AFP A;  4CDD C;  4LF7 Q;  4BBS H;  2NYZ D;  1E1T A;  2XWJ B;  2AQ2 B;  3GTP H;  1UWV A;  2BOS A;  2F0U A;  2KCN A;  4YY3 Q;  4P75 A;  1C8C A;  2F3V A;  3KDF A;  1II3 A;  4LF9 Q;  3RLN A;  3AFP A;  1N33 Q;  2G5D A;  4TKO B;  1J9O A;  5FOB B;  2ALY B;  3QWN A;  1BCP F;  2R7D A;  3A74 A;  1ET9 A;  4N9T A;  4WFN 3;  4BY7 H;  1XMO Q;  4LF8 Q;  4DR4 Q;  4BA2 I;  4K5V A;  3GTJ H;  1KD1 C;  3KLS A;  5C44 G;  4DAM A;  2IL8 A;  3P7J A;  4OWT B;  3SK8 A;  5M3M G;  1PA6 A;  1KLU D;  4KLK A;  2K03 A;  1D5Z C;  4NPS A;  2L5T A;  3EA6 A;  1G2T A;  1LTS D;  2FMM A;  3W1G A;  2KOL A;  2IHE A;  3N52 A;  1EY6 A;  4BBR G;  5JAV A;  3GTL H;  2DNC A;  4DV2 Q;  2NN6 H;  4C3H B;  4OX9 Q;  1R9T H;  1L1O A;  2WP8 J;  5IP7 G;  4RHS A;  2F0Q A;  3OPO A;  2KQ3 A;  3J81 c;  1HNW L;  1ZYR D;  4ZUJ A;  4HIM A;  1G91 A;  3MXP A;  1LTG D;  1Q46 A;  4OWW B;  4O0A A;  5EAY A;  1QZG A;  2B2T A;  1GHJ A;  3I4N H;  2F0J A;  5M5Y B;  1STE A;  2B8G A;  3KF6 B;  4FDB A;  4YWM A;  4C3I B;  1IYV A;  5TSS A;  1YVC A;  3G48 A;  1UNS A;  3K5M A;  4RFB A;  2Z1C A;  4BY1 G;  1AP0 A;  4ULL A;  3S2H B;  3TP6 A;  2LKV A;  3CHB D;  5A35 A;  1TWF H;  1PDQ A;  1JOR A;  1CKN B;  4XT3 B;  5M3M H;  1SNQ A;  2AKW B;  1D2B A;  1VQL A;  2B2U C;  3JAM i;  1TKW B;  2L1B A;  4PQX A;  4PNY A;  4K5X A;  1CHP D;  4BWG B;  2EYO A;  1CA5 A;  1EIF A;  4GOP C;  4LF7 L;  4BBR H;  1U5K A;  1JJG A;  4H13 C;  3I70 A;  1K83 H;  4PMB A;  1I6H B;  1YHQ A;  1X6O A;  4YY3 L;  5IIF A;  1PH9 A;  5IP7 H;  1YNN C;  2R6G A;  2IX0 A;  4A3B B;  3EBE A;  3RZO H;  4A93 G;  1SMY C;  3PSI A;  3HOX B;  4DR6 Q;  2QIL A;  3RN2 A;  2JA6 G;  4X3T A;  4JI5 L;  1XPO A;  4J1M A;  3SDZ A;  4B9X A;  4GKK Q;  1MKH A;  4LF8 L;  4EGV A;  2C9O A;  2PMZ B;  4DR4 L;  1GM5 A;  1PH7 A;  1L0X B;  2OT2 A;  4BY1 H;  4TQU S;  2BE5 C;  1WD0 A;  1Q7Y C;  1PTO C;  2I5H A;  3BYY B;  2JA5 G;  5ELN A;  5D3I B;  1PYB A;  4P2C B;  3PO3 G;  4X3K A;  2B2Y C;  2KHJ A;  2F0P A;  1IZ6 A;  2NVY H;  1HUN A;  1T9H A;  1B4O A;  4DV2 L;  3TN2 A;  3TP7 A;  2X6G A;  5IYD G;  1IBM L;  4GLV B;  2VQE Q;  4OX9 L;  4S3S A;  3CXC A;  2F0F A;  1PH3 A;  2F0M A;  1EEI D;  1Q90 A;  1UEA B;  1B9N A;  4YCU A;  4BBS B;  1O7Z A;  5I6Y A;  2R7Z G;  2BCO A;  1PTO F;  2TMP A;  1EL0 A;  1Z7T A;  3M4O H;  5JJL A;  2GA4 B;  1TS5 A;  1B8A A;  4XT1 B;  3OW7 A;  4DPG A;  1P8L A;  3UE1 A;  3A5Z B;  1JIC A;  5JJI A;  2A8V A;  1SXT A;  4WJW A;  3OIQ A;  5ELF A;  1CFM A;  1SN8 A;  3ITP A;  4GNX B;  2I46 A;  1F2M A;  1I94 Q;  4YCV A;  1SRU A;  5KEE A;  1N36 Q;  3GV3 A;  5E7N A;  3LGJ A;  4PZ6 A;  3C1E A;  4BY7 B;  1T5E A;  4V19 0;  4LAA A;  4GLA C;  3KLS X;  3JAM L;  2A5H A;  1H9S B;  3H6M A;  2DGY A;  1K8O A;  1W6K A;  2IWH A;  3GTJ B;  3NQI A;  1NMG A;  3WOE A;  3PO3 H;  1SYG A;  1KDB A;  2DY8 A;  2ENB A;  1EEF D;  4ABN A;  2B8F A;  1TWA H;  3G6J B;  1E7Z A;  5IYD H;  3RNU A;  2L11 A;  4U68 A;  3CPF A;  4JI0 L;  4HCE A;  4JOI A;  1EIH A;  1EY7 A;  3NSW A;  3GTL B;  2XIW A;  3QJY A;  4MHE A;  2QW7 A;  3F2D A;  5FLX E;  1R9T B;  4DR6 L;  1XXG A;  3NWT A;  2XWB B;  5IYC G;  2WII B;  1SR3 A;  4GKK L;  3L0O A;  2MJ8 A;  3ULP A;  4R8I A;  4CDE C;  2AQ3 B;  3ZJY C;  3I4N B;  4EQP A;  2HQE A;  3ONA B;  1I4G A;  1UUP A;  4EQO A;  1ILQ A;  1LYL A;  1GO3 E;  2OQ0 A;  1WTO A;  1I50 H;  5EJW A;  5A2Q E;  4HMJ A;  1TWF B;  1HH2 P;  1HZC A;  5KRU A;  2VQE L;  5M3M B;  3H91 A;  3J81 i;  2FJ2 A;  3R2T A;  2I0Q A;  3MVV A;  4L6T B;  4JI3 Q;  1ESF A;  1AEX A;  1S40 A;  2F0L A;  2TSS A;  1B1Z A;  4BBR B;  5C4X B;  3VR5 A;  4X62 Q;  2MHV A;  1K83 B;  5EPL A;  2L9H A;  1A62 A;  1RKN A;  4IFD H;  4JV5 Q;  1TII D;  1R4P B;  1A3V A;  3DHQ A;  5IYC H;  3J81 j;  1BCP B;  3RZO B;  5CYU A;  3E5S A;  3KF8 B;  4EQN A;  1D1K A;  1DCZ A;  1WTV A;  1I94 L;  4RWS C;  1N36 L;  2GN5 A;  4L5T A;  3JC6 6;  3JAM E;  4A76 A;  3F2U A;  1U4P A;  4A3I G;  4PZ8 A;  3OOC A;  2PO4 A;  5HGT A;  4NB3 A;  1Y1W G;  4BY1 B;  2KUM A;  4XYO A;  3U50 C;  1O7L A;  3R2I A;  3PUV A;  5C3E G;  2ZJR A;  4RCN A;  1EY0 A;  1CSP A;  1D5X C;  2F0I A;  1STH A;  3PIP 3;  1Y8P B;  3F2C A;  3BU2 A;  3D4R A;  1Y1V G;  4K2K A;  1M1K C;  1GKH A;  3CCE A;  3H15 A;  2NVY B;  4O1N A;  1Y14 B;  4UP8 A;  1GUS A;  5EKI A;  2F0E A;  1DGS A;  4DNT B;  3T56 B;  3MEF A;  1HZA A;  1HQM C;  1GUG A;  2VW9 A;  2ZXO A;  3VR3 A;  3M4O B;  3F8T A;  1FNV A;  4K8I A;  1PZI D;  5T1G A;  1Q8I A;  3EVQ A;  3KYH C;  3SK4 A;  4KY6 A;  2JEA I;  1PXU A;  1STY A;  2M2L A;  4A3I H;  1LTT D;  3PF5 A;  5IE8 A;  3KLW A;  4IAL A;  4LFA L;  4DV4 L;  2O4X A;  4QF4 A;  3T16 A;  4XQN A;  4LF5 Q;  5C3E H;  3TDQ A;  1J8I A;  3J81 L;  2ID0 A;  4IO9 A;  4ZCK A;  2WAQ B;  1ENC A;  1Y1V H;  3OYY A;  5KNB A;  3QOJ A;  4IUR A;  3Q24 A;  4JI3 L;  4HJ9 A;  3GTM H;  2D0O A;  3M7N A;  1KAW A;  3CQZ H;  4X62 L;  2CVR A;  3BS1 A;  4OEM B;  4A3L G;  2LS0 1;  5FO7 B;  1TWA B;  3CKI B;  1HTL D;  2OCE A;  4JV5 L;  2WB1 B;  3M7G A;  1MIU A;  2H1E A;  3A56 A;  2BH8 A;  3GDE A;  3ND8 A;  1QG7 A;  2R7F A;  1C0A A;  3URY A;  1B2T A;  3UDX A;  1VQD A;  5E3F A;  1VMP A;  1UE7 A;  2PW5 A;  1M8A A;  1PFS A;  1BOS A;  3KJP A;  3AQQ A;  4P73 A;  1YHB A;  5EKL A;  4GLX A;  4DV6 Q;  4DK3 C;  2Z6B A;  4QIW E;  1O80 A;  1U4R A;  4DF7 A;  3G4S A;  2BH2 A;  3CCQ A;  3SVM A;  5ELD A;  3BDL A;  2CQO A;  4Y52 H;  1TT2 A;  3U4V A;  5IGC A;  1K8M A;  4JI2 Q;  2E5L L;  2VB2 X;  5JEA J;  1I50 B;  4DNR B;  1OXT A;  3QG1 A;  1Y69 U;  1HR0 Q;  4CJ0 B;  3NBH B;  1X65 A;  4DFA A;  1VQI A;  5BN4 A;  4DU9 A;  3CU7 A;  1K0S A;  1V1O A;  1ZKO A;  2K32 A;  3SGI A;  1SJH D;  1DOK A;  2RHS B;  2Q2T A;  2OEO A;  3PUW A;  1WCM G;  2OQK A;  1CK1 A;  2HQL A;  2A6E D;  1VF7 A;  2YV5 A;  1FNW A;  1KRS A;  1VQK A;  1TR5 A;  1FVI A;  2BDO A;  1PRT D;  1N34 Q;  4UP7 A;  1BKB A;  1HNZ Q;  3HS0 C;  3H3V C;  2EYJ A;  2UXC Q;  1ET6 A;  4NXM Q;  1DYQ A;  2KBN A;  3J81 E;  3NXW A;  4LF5 L;  3NK9 A;  2X69 A;  1JC7 A;  1W3S A;  3FKI G;  4ODG A;  1X32 A;  2K01 A;  2N88 A;  4KJN A;  3VA7 A;  3ULJ A;  2CH4 W;  3RLF A;  1DOM A;  1VQJ A;  1NR2 A;  2CWA A;  3K81 C;  3I2Z A;  4BXX G;  2LFN A;  2RA4 A;  3WWV A;  1KLG D;  4L5R C;  1X3F A;  3KDF B;  1A15 A;  4JI4 Q;  1X54 A;  2F4I A;  4QY7 A;  1WCM H;  2EYP A;  4DR1 Q;  3TS2 A;  4B3M Q;  5EGT A;  1A2T A;  4ZQ3 A;  4JBK A;  1X3P A;  2A74 C;  3J7Y W;  2EOT A;  1H9J A;  2EYL A;  2RDH A;  3F2B A;  1FNU A;  4DV6 L;  1BBX C;  4QIW B;  1FGU A;  2AUK A;  1J6Q A;  5JVH 3;  3SEB A;  1DOL A;  4YWL A;  3A5U A;  2HCI A;  4X6A H;  3A7L A;  5IP9 G;  4A3I B;  1KNE A;  3QR8 A;  1STB A;  3FKI H;  1HR0 L;  1DZ1 A;  1KNA A;  2VY3 A;  5C3E B;  1F2L A;  3UDF A;  4GNX C;  1F77 A;  2AHO B;  1Y1V B;  4DUZ Q;  2B2V A;  4OIJ A;  3BDC A;  3MWY W;  3GTM B;  4NP5 A;  4K14 A;  3CQZ B;  2Z6K C;  4RA8 A;  2F0K A;  2VS1 A;  2VXW A;  4MTN A;  5FJ8 H;  1K0R A;  3D4D A;  3G7L A;  4H02 A;  2Y0S B;  3BVZ A;  3K8A A;  5J22 A;  4HMI A;  1N34 L;  3CC7 A;  2IJ0 A;  5KGU A;  5KNC A;  2N3S A;  1JR0 D;  1HNZ L;  4FYD A;  2CKZ B;  1RTN A;  4K5W A;  5GAD C;  2UXC L;  4NXM L;  5IT9 c;  1HCZ A;  4H0L C;  2DN8 A;  3E6Z X;  1VQ4 A;  4GKJ Q;  5ELB A;  3VYT A;  3DWA A;  1EY8 A;  3GO5 A;  5IP9 H;  4K0K Q;  2F1M A;  1QZH A;  3TP5 A;  5J3B A;  1FYC A;  2NZO A;  4OGQ C;  2Z4I A;  2PNH A;  2F0O A;  3PUX A;  4WOR A;  4JI8 Q;  4A3J G;  2UUC L;  3HG9 A;  2RVL A;  4CGY B;  2G9D A;  1YJN A;  3HRZ C;  4O2D A;  1ICF B;  1Q8K A;  4XDX A;  1TWG H;  4DR1 L;  4B3M L;  3TQY A;  1JJ2 A;  1VDZ A;  4AQY L;  4NXN Q;  2JXM B;  4MIU A;  5COY A;  2E8G A;  1Q82 C;  1D7Q A;  1E2Z A;  4LK1 C;  1A3T A;  3OHX C;  1OO9 B;  5DAU A;  5NUC A;  2YU9 H;  4DN4 M;  2JP1 A;  5GAE C;  3OTO Q;  1XTD A;  1AE2 A;  3V2T A;  4B3T L;  5K36 G;  4X64 Q;  1VQE A;  1SFO B;  2A69 C;  2K5D A;  1BCP C;  5DLQ E;  1S5D D;  5JEA G;  1V1Q A;  1O7I A;  5JJZ A;  2F0H A;  2KVM A;  3RZD H;  4LJZ C;  3DLL A;  3CCL A;  3DEP A;  3KLR A;  1RHP A;  4R4I A;  4A3J H;  4RHR A;  5J39 A;  3CCR A;  1JWS D;  4DA2 A;  3M3Y H;  3NTH A;  4JI6 Q;  1IKM A;  5AFW A;  3CCS A;  5BN5 A;  1NMF A;  3TSS A;  2ZJQ A;  4J15 A;  2CH4 A;  4QUC A;  1PH4 A;  1NNX A;  2ZT9 C;  2KEN A;  1WCM B;  3I7F A;  1QIL A;  3KBX A;  4IUU A;  4P72 A;  4G7H C;  1TS3 A;  2JJQ A;  3T51 B;  3S15 H;  4IUT A;  4GKJ L;  3GQB A;  4G7O C;  3K5L A;  3HOY G;  4K0K L;  4HJA A;  3GD7 A;  2BA0 A;  2JSO A;  5K36 H;  1IBL Q;  1LT4 D;  3WDN A;  1SNM A;  2LMC B;  4ME3 A;  3L9A X;  1EY4 A;  3CMA A;  2XRS D;  4QUF A;  5I9P A;  3I90 A;  4JI8 L;  4G7Z C;  2OTL A;  3IFD A;  1MGS A;  3FKI B;  2VB3 X;  1DXM A;  2A19 A;  1Q1B A;  1PYS B;  1I3Q H;  1RDP D;  1A8V A;  3EJI A;  2XRQ D;  4A3M G;  4NXN L;  1F2Z A;  1HJP A;  2RQX A;  4NKL A;  1VQO A;  1HR0 W;  4R4O A;  2WV6 D;  5HY6 A;  3ND9 A;  4ZKC B;  1IL8 A;  2YTV A;  4DNI A;  1CT1 D;  2EJG C;  4YWK A;  3LWU A;  3HOU G;  5IOD A;  1K9M C;  5M9O A;  4B3S Q;  3OTO L;  1EYG A;  1B7Y B;  4ZUI A;  4IPG A;  4X64 L;  4LF4 Q;  2ZXR A;  3DMU A;  2L4N A;  3HOY H;  2NVT H;  5C44 H;  1LV9 A;  2DNE A;  3D31 A;  1LAC A;  3I72 A;  2MPM A;  3STB D;  2HCC A;  1HTP A;  1PFN A;  1LTI D;  4X3S A;  5BR8 Q;  4KKT A;  1A2U A;  2VUM G;  4KY5 A;  1G51 A;  2QDL A;  2B29 A;  2CFM A;  2HDM A;  4J8Q A;  2EY5 A;  1WFQ A;  2PZT A;  1CZG A;  4JI6 L;  4A3G G;  1VQ8 A;  4JI7 Q;  4LF9 L;  3UI2 A;  1N33 L;  1MHW C;  4CBV A;  4JYA Q;  1PRT F;  1V1P A;  2UXB Q;  3G6E A;  1TWG B;  1VQC A;  2PI2 A;  2KEC A;  2YTX A;  1PH6 A;  2GVA A;  2O2L D;  4OIK A;  3HOU H;  2A68 C;  4R1J A;  1TWH H;  3FRP B;  5GQO A;  2NVQ H;  3V96 A;  1JE5 A;  1UEB A;  3KFU A;  1KDA A;  4DV3 Q;  1XMO L;  1XNR Q;  2EYF A;  1BVS A;  2RBM A;  5AJ3 Q;  1IBL L;  2I5L X;  3X3M A;  2YU9 B;  1TS2 A;  2K75 A;  1PZK D;  3K80 C;  4DAV A;  2ZTC A;  2RKS A;  2VL6 A;  4POG A;  4HIK A;  3E0J A;  3T13 A;  3Q23 A;  2NTS A;  2VUM H;  4X3U A;  1F2Y A;  1SAP A;  3RZD B;  4DUY Q;  1AE3 A;  2K5N A;  4A3G H;  2LXK A;  2MNA A;  4A3J B;  4OXP A;  4IUV A;  2CW0 D;  3N6R A;  3DM3 A;  2RHQ B;  3M4Y A;  1N32 Q;  4A93 H;  4HN7 A;  1LT5 D;  3GTP B;  2F0N A;  3M3Y B;  2B63 G;  2JA6 H;  1EZ6 A;  3W3A A;  1PV4 A;  1K3B C;  4B3S L;  5EPK A;  1JWM D;  2PNR C;  2CHB D;  2ZXP A;  4A3E G;  4LNQ A;  4LF4 L;  1SYB A;  3PIO 3;  1SEB D;  1G29 1;  1S5E D;  1YNJ C;  4MZ9 A;  1NR4 A;  3I56 A;  4I65 A;  2JA5 H;  1FD7 D;  2QKI C;  4HED A;  3E9H A;  4RG1 A;  1HNX Q;  1JOO A;  5COR A;  5BR8 L;  3CD6 A;  2XVS A;  5CC4 A;  1X3E A;  2KCC A;  4GN5 A;  4GZY C;  4CJ2 C;  4FO2 A;  3VYU A;  1HA6 A;  3U4Z A;  1SE2 A;  1LUZ A;  2EDG A;  3I4M G;  2F0G A;  4FNF A;  4KHV A;  2EY2 A;  4L5Q A;  5IT9 L;  4JYA L;  4RGT A;  4A3C G;  2UXB L;  4WJ4 A;  1ML0 D;  2LY7 A;  2NB0 A;  4XXE A;  4C56 C;  1I3Q B;  2R7Z H;  4HID A;  2B63 H;  4DR2 Q;  2IX1 A;  5C4Z A;  1XNR L;  1L1O C;  4UPA A;  3IRB A;  5JVG 3;  5AJ3 L;  1HQR D;  1HFN A;  2E74 C;  2NZ1 D;  3MTS A;  5M3F G;  3P20 A;  2B2T C;  2LXJ A;  3MXG A;  4DAY A;  4HSP A;  4WJ3 M;  2MQH A;  4XIG S;  2AWN A;  3HOY B;  1O7Y A;  2NVT B;  1RCV D;  1TS4 A;  2H4O A;  3HZX A;  3I8Z A;  5C44 B;  5J1Z A;  1S72 A;  1K73 C;  3DUZ A;  2PZU A;  1CHQ D;  1IYJ B;  1SYC A;  3AMU A;  1S3O A;  5G3L F;  2Q8R E;  1L0W A;  2PQA A;  3SK6 A;  3I4M H;  4I7A A;  4UY8 C;  2G9H D;  5EBC A;  4A3C H;  1N32 L;  1E3P A;  4AYB G;  1HXY D;  1EU4 A;  3S1R H;  3BZK A;  3W1B A;  2RSO A;  4ZYS A;  3A7A B;  2E2H H;  2EJF C;  3U58 A;  2YYZ A;  1VQB A;  1QUQ A;  1VMC A;  4JVZ A;  1MJC A;  4GN3 B;  1AZQ A;  2B2W A;  3HKZ G;  3HOU B;  3NQT A;  1TWH B;  2NVQ B;  1C4Q A;  3CF5 A;  1NSN S;  1BXT A;  1SNP A;  2Q2H A;  2R92 G;  1HNX L;  4HR7 B;  4A3D G;  3A55 A;  3K7U C;  3OIP A;  4B08 A;  4DXG A;  2ZTE A;  3TS0 A;  2F4V Q;  4LW1 A;  3HFZ B;  4M8A A;  5D14 A;  1BNZ A;  1N8R C;  3HOV G;  3NHH A;  2M9V A;  4LF6 Q;  1TU2 B;  4IOC A;  2ZTD A;  4DV0 Q;  1KXL A;  4B9W A;  5EPJ A;  3A8I E;  3D4W A;  5IT9 E;  3MA2 B;  2K7V A;  3I73 A;  1YI2 A;  1CM9 A;  2KCM A;  3K5O A;  3PIP A;  1IW7 C;  2F52 A;  3DWP A;  1VQA A;  5FO8 B;  1SNC A;  1Z9F A;  3BDO A;  2VUM B;  1FR3 A;  3BJU A;  4OWX B;  4DV7 Q;  4A3G B;  4DR2 L;  2FHT A;  1VQ7 A;  1I4P A;  3FMC A;  4KY7 A;  2AWO A;  2K4K A;  2PCF B;  4A93 B;  1B70 B;  1N9W A;  1ZYR C;  2LSS A;  3QO2 A;  1QOH A;  4QGU A;  2HUG A;  2JA6 B;  1C48 A;  2OF1 A;  4DKA C;  4PG3 A;  2H5X A;  3OWF A;  4KHZ A;  2R92 H;  1D1I A;  1U0L A;  2ES2 A;  4A3D H;  3IFT A;  1Y1W H;  4UDU C;  3IKJ A;  3T1Y Q;  3J80 i;  1GD7 A;  3U9S A;  2F0D A;  4QCL A;  2F0T A;  3ERO A;  2JA5 B;  1H95 A;  5M5X H;  1RD9 D;  1PH5 A;  1BBW A;  1RL2 A;  1FJG Q;  5EBD A;  3PO3 B;  4JBJ A;  4ZRZ A;  2Q8T A;  2NVX H;  4IJL A;  5D3D A;  3H0G G;  3NE5 B;  3MFG A;  1PRT B;  4RKL A;  4EVO A;  3CC4 A;  1U9R A;  3P75 A;  1JJC B;  1PHJ A;  4B3R Q;  1IXR A;  1M4V A;  4ME5 A;  4YCW A;  4FP5 D;  4CKE A;  2R93 G;  1STN A;  1WTH A;  4HAE A;  2BDN A;  1V9P A;  4JOI C;  1WTX A;  2R7Z B;  4AYB E;  4OL7 A;  3HOZ G;  1G6P A;  1JOQ A;  2B63 B;  1PLF A;  4DAP A;  1VCI A;  5LMN Q;  2IY5 B;  1VQM A;  1A0I A;  2KHI A;  3KK7 A;  2ZJP A;  1LT3 D;  2I5M X;  3NUC A;  2F4V L;  5I2Y A;  3PCO B;  3CP0 A;  3HKZ E;  4LF6 L;  3PQI A;  3Q22 A;  4DV0 L;  1NBW A;  4XTC S;  3FDT A;  1EYC A;  1EWC A;  1EYD A;  3S1N H;  3NTI A;  4QB4 A;  4A3L H;  1C7Y A;  2K5H A;  3H0G H;  4DV7 L;  1S5B D;  3K0X A;  3I4M B;  1B50 A;  1KQS A;  4A3F G;  3A0J A;  5D65 A;  2B3G A;  4RAU C;  3VDY A;  5EQ0 A;  5HGQ A;  5KYL A;  3S1R B;  4FF4 A;  2A1A A;  3HOZ H;  2DJG C;  1EIY B;  1QVF A;  2E2H B;  5IY0 A;  3QIA A;  2ICE C;  3LNN A;  3J80 L;  3T1Y L;  3PV0 A;  1XWE A;  1SE8 A;  1KC8 C;  3K0Y A;  3TEH B;  1J5E Q;  1E2W A;  3CPW A;  5JJK A;  2D62 A;  1WTP A;  3CRK C;  5CV6 A;  2OXP A;  4LUZ A;  1HPC A;  5C3W A;  4FF3 A;  5FKA C;  5L37 A;  1K8G A;  4B3R L;  5GAG C;  2RCF A;  2QEJ C;  5CV9 A;  1GHK A;  3V05 A;  2PI2 E;  3Q0A A;  1NJI C;  2MP1 A;  4K2L A;  4O42 A;  4AYB B;  1B3A A;  2F3I A;  1RIP A;  1YNN D;  1PYW D;  1C9O A;  3CC2 A;  2EJM A;  5C5L A;  2WIN B;  1NE3 A;  4QJF A;  1SMY D;  3IAY A;  3OWE B;  2X6L A;  2Z4H A;  2K33 A;  3HKZ B;  1PFB A;  1DON A;  2IPK D;  1FL0 A;  2E2I H;  2R92 B;  4JI2 L;  3Q6S A;  3FHW A;  1EQQ A;  4A3D B;  1TWC H;  1ASY A;  4N8F A;  1Y1W B;  2AQ1 B;  4LFB Q;  3A54 A;  2DUD A;  2BE5 D;  3MEH A;  4BXX H;  2MO0 A;  1PTO D;  2VQF Q;  2JA8 G;  3UDI A;  2K05 A;  1LTB D;  5M5X B;  4KMU C;  2O5J C;  2PW7 A;  3M4Q A;  2ASB A;  3K59 A;  4PV1 C;  2N49 A;  1JCK B;  4A3K G;  1QJO A;  2KJX A;  2NVX B;  4P71 A;  2UUB Q;  4JI1 Q;  1SNO A;  1U4M A;  1VQH A;  1YHA A;  3DXJ C;  4C3J G;  5CMD A;  1U4L A;  3RLO A;  5FK9 C;  1VS0 A;  3D8G A;  3KJO A;  4ZK9 B;  3HGB A;  1X56 A;  3I3C A;  2EQS A;  1EUJ A;  2DY7 A;  4FVM A;  4XQJ A;  1B44 D;  4LMQ D;  4R8N A;  1P16 A;  3L3O C;  5I2X A;  5CR3 A;  4L8J A;  2HT1 A;  1EOT A;  1DD2 A;  1EWH A;  1Q3L A;  1B9M A;  3SR1 A;  3KBG A;  5DM7 3;  4C1N I;  3I55 A;  2JA8 H;  2B2U A;  1OTC A;  1XNQ Q;  4JI4 L; 
#chains in the Genus database with same CATH homology
 1E1O A;  5BR8 Q;  1HH2 P;  1HZC A;  4GOP A;  2UU9 Q;  2VUM G;  3EIV A;  1G51 A;  2VQE L;  4ALP A;  1YIJ A;  1UE6 A;  2JK8 A;  2B29 A;  2CFM A;  4A3K H;  4IPD A;  3J81 i;  1WFQ A;  4APV A;  4JI6 L;  4A3G G;  1OXV A;  2R93 H;  1VQ8 A;  1CKO A;  5ELO A;  2I0Q A;  3CCJ A;  3KOJ A;  4C3J H;  4JI7 Q;  4JI3 Q;  4LF9 L;  1S40 A;  1N33 L;  2XTI A;  1JMC A;  4JYA Q;  2UXB Q;  4A4I A;  4X62 Q;  3G6E A;  1VQC A;  2PI2 A;  1A62 A;  4AH6 A;  5IWA Q;  2JQO A;  2YTX A;  2JA9 A;  1PH6 A;  2GVA A;  3H3V H;  3PF4 A;  4JV5 Q;  1M90 C;  4R1J A;  3L2P A;  1TWH H;  2NVQ H;  5GQO A;  3HOU H;  1YIT A;  1JE5 A;  1UEB A;  5IYC H;  3CCM A;  3KFU A;  3NEM A;  3J81 j;  4DV3 Q;  2UXD Q;  2FXQ A;  4HJ5 A;  1XMO L;  4IPC A;  1XNR Q;  3HOW H;  1UE1 A;  3KF8 B;  1BVS A;  3TRE A;  2JA7 G;  4LFC L;  5IYB G;  4KI0 A;  1FJG L;  1PH8 A;  1I94 L;  2Y0S E;  4OO1 G;  2OTJ A;  5AJ3 Q;  1IBL L;  2I5L X;  1N36 L;  2E2J H;  3AYH B;  4LFB L;  2GN5 A;  4L5T A;  3JC6 6;  4A76 A;  1PVO A;  2K75 A;  4A3I G;  1YEZ A;  4PZ8 A;  3J7Z C;  3K80 C;  4EQ5 A;  3G71 A;  3S16 H;  2ZTC A;  3OW2 A;  4NB3 A;  1WI5 A;  1BBU A;  1Y1W G;  4DUZ L;  1JT8 A;  2VL6 A;  4POG A;  2HIX A;  3BZC A;  3S24 A;  3U50 C;  1KHI A;  5C3E G;  3PUV A;  2ZJR A;  1SFO H;  1CSP A;  4HIK A;  5IYD H;  1MJE A;  4RMF A;  2MO1 A;  2VUM H;  4A3F H;  3F2C A;  2UUB L;  1V43 A;  3BU2 A;  1EWI A;  1Y1V G;  3M4P A;  4JI1 L;  5FLX c;  1M1K C;  5C0X I;  1VQ9 A;  5C4J H;  4DUY Q;  4QQB X;  1AE3 A;  1Q86 C;  1GKH A;  2K5N A;  1VQP A;  2LXK A;  2MNA A;  3CCE A;  4A3G H;  3D0F A;  4OXP A;  3H15 A;  3AFQ A;  2K50 A;  3CW2 C;  5LMN L;  3GTO H;  1WYD A;  1Y14 B;  2RHQ B;  3DM3 A;  4GS3 A;  2N8N A;  1GVP A;  4UP8 A;  4A93 H;  1N32 Q;  1DGS A;  2B63 G;  2UUC Q;  2JA6 H;  3MEF A;  1PV4 A;  4B3S L;  4HJ7 A;  2NN6 G;  1HZA A;  5FJ8 G;  1E24 A;  3CME A;  4A3E G;  4LNQ A;  2VW9 A;  4LF4 L;  2WFW A;  1G29 1;  3F8T A;  3AEV A;  2JA7 H;  5IYB H;  3RN5 A;  2UUA L;  4IFD J;  4AQY Q;  4MZ9 A;  3KYH C;  4PMW A;  1X3G A;  1IBK Q;  3I56 A;  2JEA I;  4JCV E;  2JA5 H;  2BA1 A;  2JE6 I;  1VQ6 A;  3E9H A;  4RG1 A;  2C35 B;  4A3I H;  1HNX Q;  3I4N G;  3PF5 A;  3ULL A;  5LMN W;  5IE8 A;  3KLW A;  2K5V A;  4X65 L;  4DV4 L;  4JI5 Q;  4LFA L;  1YJW A;  1XNQ L;  2YTY A;  5BR8 L;  2IHF A;  3CD6 A;  2UU9 L;  4LF5 Q;  5C3E H;  2K52 A;  1X3E A;  4GN5 A;  3UE0 A;  2ID0 A;  2PMZ E;  4IO9 A;  4KHP Q;  3U4Z A;  4B3T Q;  1NTG A;  1LUZ A;  3I4O A;  3W5O A;  1Y1V H;  3OYY A;  3I4M G;  1Q12 A;  4JI3 L;  4HJ9 A;  4Y7N H;  1VQ5 A;  4L5Q A;  3GTM H;  2D0O A;  3M7N A;  1KAW A;  3CQZ H;  4UP9 A;  4A3C G;  4X62 L;  4JYA L;  2UXB L;  4WJ4 A;  4C3H H;  4A3L G;  1L1O B;  4GN4 B;  2L15 A;  5IWA L;  2OCE A;  4JV5 L;  2R7Z H;  4HID A;  5C4X G;  4A3B G;  4IFD I;  2B63 H;  1MIU A;  4DR2 Q;  3JAM c;  2UXD L;  2IX1 A;  3HOX G;  1XNR L;  3CCU A;  1CKM A;  1L1O C;  2BH8 A;  3GDE A;  1IBM Q;  1J5E L;  3EN2 A;  3ICE A;  3M9B A;  1QVC A;  4DAY B;  4K0K L;  2R7F A;  4UPA A;  1C0A A;  3IRB A;  2Q2U A;  3UDX A;  2EXD A;  2JEB I;  5AJ3 L;  1VQD A;  5M5Y H;  1XJV A;  1A63 A;  1I5F A;  4R4C A;  4C3I H;  1UE7 A;  2D0P A;  5M3F G;  1PFS A;  2LXJ A;  3KJP A;  3AQQ A;  2QA4 A;  4P73 A;  1YHB A;  4P74 A;  5GAH C;  4GLX A;  3S2H H;  4WJ3 M;  2MQH A;  4XIG S;  4DV6 Q;  4DK3 C;  2PQA B;  2AWN A;  4QIW E;  3G4S A;  1PH2 A;  2BH2 A;  2GVB A;  3CCQ A;  1S72 A;  1WJJ A;  1K73 C;  2CQO A;  3S1M H;  4Y52 H;  1IYJ B;  1Z47 A;  2EIF A;  4POF A;  1S3O A;  3U4V A;  4JI2 Q;  2E5L L;  2MFI A;  1L0W A;  5JEA J;  2PQA A;  1OXT A;  1X9N A;  1HR0 Q;  4A3M H;  3I4M H;  3NBH B;  1X65 A;  4UY8 C;  3B6Y A;  1VQI A;  1I6H H;  4A3C H;  1N32 L;  1LM0 A;  1E3P A;  1QUQ B;  4AYB G;  1YJ9 A;  3HKS A;  4DV5 Q;  2K14 A;  1KIX A;  4IJH A;  1EOV A;  3S1R H;  5C0X J;  3BZK A;  3W1B A;  5H1S E;  3SGI A;  4BBS G;  3S1Q H;  2RHS B;  5C4X H;  3CAM A;  2Q2T A;  4A3B H;  3FP9 A;  3PUW A;  1WCM G;  2E2H H;  2OQK A;  1OXU A;  2HQL A;  3U58 A;  2YYZ A;  1VQB A;  3HOX H;  2YV5 A;  1QUQ A;  1VQK A;  1KRS A;  1CUK A;  1MJC A;  4GN3 B;  1FVI A;  2VZA A;  4JI0 Q;  3HKZ G;  2QGQ A;  1IBK L;  3CF5 A;  1HNW Q;  1N34 Q;  1AH9 A;  2AMC B;  4IOA A;  2Q2H A;  4UP7 A;  1ASZ A;  2R92 G;  2RF4 A;  1BKB A;  1HNX L;  2VQF L;  3Q8D A;  4A3D G;  1YNX A;  3T1H Q;  1HNZ Q;  3K7U C;  2UXC Q;  4NXM Q;  2ZTE A;  3TS0 A;  2KBN A;  4BA1 I;  4BY7 G;  2F4V Q;  4LW1 A;  3HFZ B;  4LF5 L;  1WOC A;  1VQN A;  5LMU Q;  1N8R C;  3HOV G;  1VQG A;  4JBW A;  4LF6 Q;  4KHP L;  1W3S A;  4IOC A;  2ZTD A;  3FKI G;  3J80 c;  4DV0 Q;  1XPR A;  1KXL A;  2V1C C;  3NEN A;  4TVA B;  2ZM6 Q;  1L2F A;  2KCM A;  4JC0 A;  3ULJ A;  1YI2 A;  4BXX G;  3RLF A;  1VQJ A;  3PIP A;  2CWA A;  3K81 C;  1VQF A;  3I2Z A;  1K8A C;  2F52 A;  2Q2I A;  4HIO A;  1VQA A;  2WAQ G;  3MXN B;  1Z9F A;  3WWV A;  3BJU A;  4OWX B;  3GTQ H;  1PH1 A;  4L5R C;  1X3F A;  4DV7 Q;  3KDF B;  4JI4 Q;  1NY4 A;  4DR2 L;  4LF7 Q;  1VQ7 A;  4BBS H;  1CSQ A;  1X54 A;  1E1T A;  4QY7 A;  1WCM H;  2AWO A;  4DR1 Q;  2K4K A;  1UWV A;  3GTP H;  3TS2 A;  2WB1 G;  1XNQ Q;  1B70 B;  5M5W H;  4B3M Q;  1N9W A;  4A3L H;  2LSS A;  4YY3 Q;  4P75 A;  2QEX A;  1K3R A;  3KDF A;  4QGU A;  4JBK A;  1XPU A;  3PGZ A;  4LF9 Q;  1YBY A;  3RLN A;  3AFP A;  1N33 Q;  4DKA C;  4OON A;  2H5X A;  3E0E A;  4PG3 A;  4KHZ A;  3PIO A;  2R92 H;  3F2B A;  1U0L A;  2ES2 A;  4DV6 L;  4A3D H;  2ALY B;  2R7D A;  1Y1W H;  1FGU A;  1J6Q A;  3A74 A;  3T1Y Q;  4PZ7 A;  3J80 i;  4R4Q A;  4YWL A;  1GD7 A;  3A5U A;  4BY7 H;  1XMO Q;  4LF8 Q;  4DR4 Q;  1H95 A;  3F1Z A;  4BA2 I;  1IL2 A;  4X6A H;  5IP9 G;  5M5X H;  3GTJ H;  1PH5 A;  1KD1 C;  3FKI H;  1BBW A;  1RL2 A;  4DAM A;  5C44 G;  1HR0 L;  1FJG Q;  4JI7 L;  1W2B A;  4OWT B;  5M3M G;  2VY3 A;  4JBJ A;  1PA6 A;  4KLK A;  4NPS A;  3GTG H;  1OXS C;  3UDF A;  1HZ9 A;  2NVX H;  4IJL A;  3W1G A;  3H0G G;  4DV5 L;  4GNX C;  2OWO A;  2IHE A;  3CC4 A;  3S17 H;  2AHO B;  4DUZ Q;  4BBR G;  3H3V I;  3GTL H;  4DV3 L;  1JJC B;  3CCV A;  4DV2 Q;  1PHJ A;  3NEL A;  4B3R Q;  2HHH Q;  2Z6K C;  1IXR A;  4YCW A;  4OX9 Q;  2VS1 A;  1R9T H;  2R93 G;  1L1O A;  4MTN A;  2WP8 J;  1K0R A;  5FJ8 H;  5IP7 G;  1V9P A;  4H02 A;  4JOI C;  4A3E H;  4A75 A;  3K8A A;  4AYB E;  3HOZ G;  1G6P A;  3J81 c;  1HNW L;  1N34 L;  3PUZ A;  3CC7 A;  4HIM A;  1VCI A;  5LMN Q;  2IY5 B;  1VQM A;  1A0I A;  1Q46 A;  2KHI A;  2N3S A;  3T1H L;  1HNZ L;  4O0A A;  2CKZ B;  5EAY A;  1QZG A;  5GAD C;  4OWW B;  3J7A 5;  3I4N H;  4DV1 Q;  2ZJP A;  2I5M X;  4NXM L;  5IT9 c;  2UXC L;  4JBM A;  2F4V L;  1SMX A;  3PCO B;  3CP0 A;  5LMU L;  3KF6 B;  4FDB A;  4IPH A;  4YWM A;  3HKZ E;  1VQ4 A;  1YVC A;  4GKJ Q;  3G48 A;  4LF6 L;  4QL5 A;  4BY1 G;  4DV0 L;  1NBW A;  1HZB A;  4DUY L;  2ZM6 L;  3GO5 A;  4XTC S;  5IP9 H;  4K0K Q;  1KL9 A;  1XMQ Q;  1TWF H;  1CKN B;  3KF6 A;  3S1N H;  1QZH A;  5M3M H;  4R4T A;  5J3B A;  2AKW B;  1VQL A;  2NZO A;  3PUX A;  2PNH A;  3JAM i;  2K5H A;  4JI8 Q;  4A3J G;  3H0G H;  4DV7 L;  1C7Y A;  2UUC L;  1X55 A;  4LFA Q;  4DV4 Q;  3GTK H;  1YJN A;  1EIF A;  4GOP C;  3RR5 A;  3K0X A;  1U5K A;  4O2D A;  4BBR H;  1KQS A;  4LF7 L;  1JJG A;  1CKN A;  3A0J A;  1Q8K A;  4X66 Q;  4A3F G;  1TWG H;  3PO2 G;  1K83 H;  4C2M H;  4DR1 L;  3K7A H;  2B3G A;  4LWC A;  1YHQ A;  4B3M L;  3VDY A;  3TQY A;  5HGQ A;  2WAQ E;  1X6O A;  4YY3 L;  1JJ2 A;  1PH9 A;  5IP7 H;  2R6G A;  4AQY L;  4NXN Q;  2A1A A;  4OO1 I;  2IX0 A;  3HOZ H;  1QVF A;  3EBE A;  4EX5 A;  1EIY B;  3RZO H;  4A93 G;  2E8G A;  5IY0 A;  1Q82 C;  1D7Q A;  5M3F H;  3PSI A;  4DR6 Q;  3RN2 A;  2JA6 G;  4JI5 L;  1XPO A;  2WB1 E;  3T1Y L;  4DR5 Q;  1Q1E A;  3PV0 A;  2YU9 H;  4GKK Q;  1MKH A;  4LF8 L;  5GAE C;  1SE8 A;  3OTO Q;  4DR4 L;  1XTD A;  1KC8 C;  1AE2 A;  4LUO A;  1GM5 A;  3TEH B;  1PH7 A;  4DR3 Q;  1J5E Q;  4B3T L;  5K36 G;  4BY1 H;  2XGT A;  4TQU S;  4X64 Q;  3CPW A;  1VQE A;  5JJK A;  1KRT A;  1Q7Y C;  2D62 A;  1YZ6 A;  2I5H A;  3S2D H;  2JA5 G;  4YHH Q;  3M85 A;  5DLQ E;  5JEA G;  1V1Q A;  1O7I A;  3RZD H;  5ELN A;  4LUZ A;  1PYB A;  2HIV A;  3DLL A;  3PO3 G;  3CCL A;  2KHJ A;  4R4I A;  4A3J H;  2N78 A;  4DR7 Q;  1IZ6 A;  2NVY H;  1T9H A;  4L5S A;  1K8G A;  4DV2 L;  4B3R L;  3CCR A;  5GAG C;  2HHH L;  5C0X G;  5IYD G;  1IBM L;  4GLV B;  2VQE Q;  4DK6 C;  4OX9 L;  1D8L A;  3PO2 H;  2PI2 E;  2NN6 I;  2Z0S A;  3M3Y H;  3CXC A;  1NJI C;  1PH3 A;  2E5L Q;  4JI6 Q;  5FLM G;  2F3I A;  3CCS A;  1RIP A;  1NMF A;  2ZJQ A;  4J15 A;  1EQR A;  1PH4 A;  3L7Z C;  4YCU A;  1C9O A;  3CC2 A;  2KEN A;  2Y0S G;  1UE5 A;  2R7Z G;  3I7F A;  1NE3 A;  4P72 A;  4QJF A;  4DV1 L;  3M4O H;  4JG2 A;  5JJL A;  1B8A A;  2JJQ A;  4DPG A;  1P8L A;  3S15 H;  3UE1 A;  4GKJ L;  3A5Z B;  5JJI A;  2A8V A;  1SRO A;  2CCZ A;  1FL0 A;  4HJ8 A;  2E2I H;  3UDG A;  2CWP A;  3HOV H;  1SN8 A;  2RCN A;  3HOY G;  4JI2 L;  4GNX B;  4LUV A;  5GRO A;  3FHW A;  3GD7 A;  2BA0 A;  1TWC H;  4HJA A;  1EQQ A;  1I94 Q;  4LFC Q;  1ASY A;  3S14 H;  1XMQ L;  4YCV A;  1SRU A;  1N36 Q;  1IBL Q;  4ME3 A;  3ERS X;  4LFB Q;  2DUD A;  5E7N A;  1Q81 C;  3LGJ A;  2VNU D;  4PZ6 A;  4BXX H;  2MO0 A;  1LTL A;  2NZH A;  3CMA A;  4GLA C;  3STB C;  2DGY A;  2VQF Q;  2JA8 G;  4JI8 L;  2OTL A;  3UDI A;  4GNX A;  1TXY A;  3M4Q A;  1NMG A;  2A19 A;  2ASB A;  3PO3 H;  1Q1B A;  1PYS B;  2N49 A;  4X66 L;  4A3K G;  1TWA H;  4AIM A;  1E7Z A;  1I3Q H;  2Z6K A;  1A8V A;  2KCT A;  4P71 A;  3RNU A;  4JI1 Q;  1VQH A;  2UUB Q;  1YHA A;  4A3M G;  3CPF A;  4JI0 L;  1QVG A;  4MNO A;  3E9I A;  4JOI A;  4NXN L;  3RLO A;  2ATW A;  3TRZ A;  1HJP A;  5FLM H;  1VS0 A;  1SLJ A;  1VQO A;  1HR0 W;  4R4O A;  5HY6 A;  1EFW A;  3F2D A;  2YTV A;  3KJO A;  4DR6 L;  4DNI A;  4YWK A;  3HOU G;  1X56 A;  1K9M C;  5IYC G;  2IT1 A;  4DR5 L;  2EQS A;  1EUJ A;  4B3S Q;  1SR3 A;  4GKK L;  3L0O A;  3HOW G;  3OTO L;  1P16 A;  1EYG A;  1B7Y B;  4DR3 L;  3ULP A;  4IPG A;  4X64 L;  1OXX K;  4LF4 Q;  3HOY H;  3ZJY C;  2NVT H;  2HT1 A;  5C44 H;  2UUA Q;  4YHH L;  4GOP B;  3D31 A;  1E22 A;  3PUY A;  1LYL A;  1GO3 E;  3ER0 A;  2OQ0 A;  4IFD G;  3I55 A;  1I50 H;  1JB7 A;  3STB D;  2JA8 H;  1OTC A;  4X65 Q;  4JI4 L;  4DR7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...