2VUMH

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumH00
1B70B 1X65A 3A5ZB 5LMNQ 1PHJA 2IX1A 1FVIA 1JJGA 2BH8A 1C7YA 1YHAA 3S16H 4BXXG 4J15A 1K73C 3DM3A 1I50H 4GOPB 4LF6Q 4X62L 3H3VI 1VQKA 3I4NH 2JJQA 2V1CC 2VZAA 2BA0A 3L7ZC 1EWIA 2OQ0A 2JA8G 3PO2G 2WB1G 4A4IA 2DUDA 3RLNA 2N3SA 5IP9G 3J7A5 4DR4L 3CMAA 1UE7A 4X66Q 1G291 4P71A 5JEAG 3CXCA 2IY5B 2ALYB 4NXNL 1X6OA 1YJWA 1UE5A 1CKMA 4GNXA 4A3FH 1NTGA 1QVGA 4LF8Q 1PH3A 5GAHC 1N9WA 2Q2HA 2WAQE 4A93G 1MIUA 4AQYQ 1XPRA 4LUVA 1VQPA 4EQ5A 4R4QA 1SRUA 5JEAJ 1BBUA 2Q2IA 1K9MC 4BY1G 4DV4L 4YCUA 3PUXA 1E3PA 2CWAA 4QY7A 4UP7A 1PH9A 4DV6L 4A3EG 1N33Q 1PFSA 1XMQQ 4LNQA 4KHPQ 1VQJA 1IBLQ 1HNWQ 4OX9Q 5AJ3Q 2I5HA 3WWVA 3J7ZC 4DV1Q 3U58A 1JT8A 1LTLA 3JAMi 2UXDL 4A3LH 3ER0A 3ULLA 4YWLA 2E2HH 1FGUA 5IYCG 4YWMA 1YNXA 3ICEA 4BBRG 1PH4A 2UUAL 5M3FG 1S72A 1Y1WH 2NN6I 3CPFA 5IE8A 3CAMA 2QGQA 4FDBA 3RLOA 3ZJYC 5IYDG 4MTNA 4DV7Q 2PQAB 4DUYL 3STBD 3AYHB 3K80C 5C44G 5ELNA 3GD7A 1PH6A 1IL2A 3CPWA 1OTCA 3M3YH 2N78A 2D0OA 2JA7H 1PYBA 2UUBL 4YWKA 3UE1A 3HOUG 4IPDA 3U4VA 2Z0SA 3PSIA 4YCWA 2D0PA 4BA1I 2C35B 4K0KL 2B3GA 4JI1L 4B3SQ 4JG2A 1NMGA 1OXSC 1HZCA 1XTDA 2WP8J 1L1OC 3TS0A 2LSSA 4DV0L 1E7ZA 1TWCH 1WOCA 1EFWA 3FKIG 4B3ML 1Q7YC 5FLXc 5GAGC 1QUQB 1C0AA 1GD7A 1XJVA 4OWXB 1E1OA 4OWWB 2JE6I 2VQFL 1KD1C 4BXXH 2XTIA 3CW2C 5HGQA 4DR2L 2D62A 2WFWA 4LF8L 4PZ6A 1MKHA 2HHHL 3KOJA 1KHIA 1N8RC 3GTGH 2YTVA 4X62Q 4RG1A 3ULPA 2OTLA 3OYYA 3D0FA 3RLFA 2OCEA 2IT1A 2OWOA 2GN5A 1AH9A 3ERSX 4DR4Q 4LWCA 4UP8A 1J5EL 3W5OA 4DUYQ 2F3IA 2HQLA 3CCUA 4HIDA 1TXYA 4DR3Q 3UDGA 1N36L 4NXNQ 4A93H 2KCTA 5IYBG 2I0QA 4A3LG 3TQYA 4DR5L 1X9NA 4POFA 4BY1H 2F4VL 3GTOH 1CKNB 4R4OA 2ATWA 2IHFA 3W1GA 4A3CH 5J3BA 1WI5A 1D8LA 4MZ9A 4DV4Q 2UXCL 2JA5G 5FJ8G 3KF6B 4DV6Q 1SN8A 5LMUL 4DK3C 4P73A 3TS2A 4A3GG 4GOPA 1I3QH 4JC0A 1GKHA 1K83H 1PA6A 2UXDQ 2QEXA 4NPSA 5IYCH 4YHHL 2N49A 4BBRH 1Q1EA 4X6AH 2Y0SG 3I55A 4O2DA 2N8NA 2IHEA 2RHQB 2UUAQ 4JI4L 3A0JA 3OW2A 2MO0A 4L5TA 1L1OB 1Q1BA 4UP9A 4A3MH 5BR8L 1ASZA 2B63G 4JOIC 5C44H 4H02A 4JCVE 2CCZA 4DV3L 2NVQH 4DV2L 3BZKA 1L2FA 3FHWA 1N34L 2PMZE 4XIGS 3BU2A 3HOUH 2KENA 4AH6A 2UUBQ 4JI7L 4DK6C 2E2IH 3M7NA 4JI8L 2K75A 3BJUA 1G51A 4POGA 4GLXA 1EYGA 3I4MH 4IOAA 1GM5A 1V43A 3KF8B 3VDYA 3CC2A 4HJAA 4K0KQ 3T1HL 2ZTCA 4JI1Q 5IP7G 2PI2E 1VQCA 3FKIH 4P72A 1HNZL 1VQ6A 4DV0Q 5FLMH 4B3MQ 2A19A 2VW9A 3KYHC 1E24A 2PQAA 3E0EA 3GDEA 2KHJA 2ZTEA 3KLWA 1SE8A 2NN6G 3GO5A 3PUWA 4MNOA 4TVAB 4DR3L 1EUJA 2VQFQ 3CCSA 2UU9L 5K36G 4DR2Q 4GS3A 1YJ9A 4ME3A 2R6GA 4OO1I 2HHHQ 2HIXA 4GN5A 4GN4B 1PYSB 4GNXC 2R7ZG 3GTMH 4QGUA 4KLKA 2AWOA 4BBSH 5IY0A 1NMFA 2EXDA 3A74A 2JA6H 3KFUA 5GADC 4A3CG 2ZJQA 1J5EQ 4JBJA 3S17H 3S2DH 1WFQA 2K5NA 4GKJL 1N36Q 5IYBH 3GTKH 2K5HA 5JJKA 4OWTB 1HZBA 4DR5Q 3HFZB 2F4VQ 3MXNB 2OTJA 1PH8A 1Z9FA 2JA5H 5FJ8H 2Z6KA 2EQSA 4GLAC 4JI6L 2UXCQ 4A3GH 1HZAA 3NELA 1XPOA 4JYAL 4C3JH 4A3MG 2IX0A 2NVXH 5LMUQ 3KDFB 1Q82C 5M5XH 1WYDA 2ZJRA 1X55A 3S1RH 2YYZA 3GTPH 3H3VH 1SMXA 5GROA 1U5KA 3M4OH 1NBWA 3L2PA 4APVA 3M4QA 1WJJA 2CQOA 4YHHQ 1UE6A 4NXML 1T9HA 4JBMA 3AEVA 4JI0L 2B63H 2K52A 1R9TH 4JI3L 4JI4Q 1V9PA 2OQKA 1K8GA 5BR8Q 3T1YL 1VQ9A 3CCRA 3W1BA 3I4MG 1MJEA 1YZ6A 4LFBL 1CKNA 2JQOA 1I5FA 2AKWB 4DV3Q 1JE5A 4DV2Q 2VUMG 4IFDI 5GQOA 1N34Q 2I5LX 1HJPA 4JI7Q 5FLMG 1YIJA 1Q81C 4JI8Q 4GNXB 3HOZG 4KHZA 1TWAH 2VS1A 1IZ6A 5IP7H 4A3IH 1AE2A 1K8AC 4IOCA 3F2DA 1Q8KA 2RCNA 4R1JA 4YY3L 3T1HQ 4LUZA 1G6PA 4HJ5A 1HNZQ 1W2BA 4DR6L 4C2MH 1Y14B 3EBEA 3CCJA 4DV5L 4BBSG 3J80i 4P74A 4LFCL 3RR5A 3L0OA 3UE0A 4C3HH 2JA9A 2JA6G 3PF5A 3M85A 2YV5A 4X65L 3TREA 4IJHA 1YVCA 1WCMH 2WAQG 1I94L 1LYLA 4EX5A 2UU9Q 3HKSA 3UDFA 3S1QH 5M5WH 1M90C 4ALPA 3GTLH 2E8GA 2R7ZH 3MEFA 3HOYG 2BA1A 3CMEA 3S2HH 1VQIA 2MQHA 3U4ZA 2UUCL 3S14H 3FP9A 4IPCA 1OXXK 1M1KC 1XPUA 2LXKA 3CP0A 1V1QA 4GKKL 3JAMc 3BZCA 3PUYA 1TWFH 3CCEA 3K81C 1PH5A 1VQ8A 2MNAA 5C4JH 4X64L 4A3DG 4GKJQ 3PO3H 1VQGA 2I5MX 4GOPC 3K7UC 1HR0L 3CC4A 5M3MG 4LFAL 1XNQL 2R93H 5IT9c 3G48A 1CKOA 3HOVG 3S15H 4JI6Q 1IBKL 2AMCB 2MFIA 3ULJA 1AE3A 5HY6A 4DR7L 1X54A 1FL0A 3A5UA 4JYAQ 2HIVA 1VQHA 1KRTA 5DLQE 4C3IH 5M5YH 1PH7A 4IJLA 1VQAA 3PF4A 1IBMQ 4GN3B 3GTQH 4OO1G 4HJ7A 2K50A 1E1TA 4HIKA 3RN2A 1S40A 3H0GG 2ES2A 2YTXA 3F8TA 4NXMQ 3I2ZA 2ZM6L 4DR1L 1EQQA 5LMNW 2CWPA 2E5LL 5C0XI 3UDIA 1KRSA 4JI0Q 3F2CA 3Q8DA 4IO9A 1KC8C 4JI3Q 1L0WA 2ASBA 4AIMA 3G6EA 1VQOA 3T1YQ 2VUMH 5IWAL 1LUZA 2MO1A 1ASYA 4L5RC 2K5VA 4LFBQ 2R92H 4PG3A 4DNIA 2BH2A 2ZTDA 4A3IG 2JEAI 4A3BG 2FXQA 1BVSA 3CQZH 1GVPA 1DGSA 4IPHA 4QJFA 2A1AA 3HOZH 1Y1VG 4LF7L 1Z47A 2Q2TA 2NVTH 1H95A 3JC66 2YTYA 1J6QA 4LF5L 3B6YA 4NB3A 4A3KG 2UXBL 4DKAC 4LF4L 1LM0A 1WCMG 2VQEL 4HIOA 4QL5A 3KJPA 3HOXH 1N32L 4UY8C 1OXUA 1Q12A 1CUKA 4YY3Q 3AFPA 1D7QA 3PUZA 3UDXA 1E22A 3J81i 2ID0A 1X3FA 3E9IA 4DR6Q 3CCLA 3RNUA 3J80c 4DV5Q 3SGIA 1YHQA 1HR0W 4LFCQ 1IXRA 2K14A 3M4PA 3STBC 1XMOL 4B3RL 2ZJPA 4WJ4A 1B7YB 4X65Q 1X3GA 3RZDH 1CSQA 1P8LA 3G71A 1P16A 3F2BA 1I94Q 2AWNA 3PGZA 3I7FA 3HOYH 3D31A 3PIOA 1YHBA 5JJIA 4PZ8A 4DPGA 4IFDG 1MJCA 1QUQA 1A8VA 1TWHH 4JI5Q 1FJGL 2VL6A 2QA4A 2A8VA 3PO3G 5ELOA 1KQSA 1VQDA 1IYJB 5EAYA 2UUCQ 2RHSB 1JB7A 4JI2L 4LF9Q 3HOWH 2R93G 3TRZA 1OXVA 3IRBA 4Y7NH 1YJNA 4IFDJ 1A63A 1VQ7A 4A3DH 1JJ2A 2Z6KC 5C3EH 3AQQA 4XTCS 3S1NH 4GKKQ 2VY3A 4DAYB 1IBML 1A62A 3M9BA 4X64Q 5M3MH 2CFMA 1PH1A 1UWVA 2YU9H 3CCMA 2VNUD 3HKZE 4LFAQ 1HR0Q 1CSPA 1TWGH 1XNQQ 3HOVH 4P75A 1XNRL 2GVAA 3NENA 1YI2A 1IBKQ 5C4XG 1B8AA 4DR7Q 3G4SA 2NZOA 2Y0SE 3H0GH 5H1SE 1HNXL 3AFQA 3CF5A 2JK8A 4DUZL 3PIPA 4IPGA 2R92G 3DLLA 1VQEA 3S24A 3KF6A 1PV4A 2RF4A 2ZM6Q 4BY7H 4AYBE 3OTOL 4DR1Q 2AHOB 4B3TL 3EN2A 2E5LQ 1GO3E 4PMWA 1UEBA 4R4IA 4JV5L 1S3OA 4R4TA 4JBWA 3NEMA 5IWAQ 5LMNL 2KBNA 4BA2I 4A3BH 3LGJA 3F1ZA 3HOXG 4L5SA 2GVBA 3K8AA 4KI0A 4OONA 4WJ3M 1VQ4A 1VQNA 1L1OA 1Y1VH 2PI2A 3EIVA 1HH2P 3CCQA 1EIFA 4UPAA 4LF6L 1UE1A 4LF7Q 2L15A 1K3RA 2JEBI 1VS0A 4A3JH 4A3KH 1QZGA 2PNHA 2NVYH 3I56A 4LF5Q 3I4NG 3K7AH 2UXBQ 1QZHA 4LF4Q 2VQEQ 3U50C 1X3EA 4X66L 2WB1E 1N32Q 1QVCA 4JI5L 1OXTA 3J81c 1YITA 5E7NA 1NJIC 1BBWA 3PUVA 4PZ7A 3H15A 4LF9L 2E2JH 3E9HA 2CKZB 5C0XG 4AQYL 4A3FG 4YCVA 3RZOH 4Y52H 2LXJA 2JA8H 1YBYA 3HOWG 3PO2H 4B3RQ 1XMOQ 1X56A 5IP9H 3K0XA 2F52A 1K0RA 1VCIA 2XGTA 1N33L 2K4KA 1EQRA 5C3EG 1XMQL 4KHPL 1HNWL 1IBLL 3GTJH 5C0XJ 2B29A 5AJ3L 4OX9L 4DV1L 1QVFA 1FJGQ 2NZHA 3CD6A 4QQBX 1JJCB 4JBKA 4QIWE 1O7IA 1PVOA 4A76A 1EIYB 1W3SA 3I4OA 4JI2Q 4HJ8A 1SROA 4R4CA 4L5QA 2Q2UA 1PH2A 4A3EH 3S1MH 3NBHB 4A75A 4O0AA 3HKZG 1VQMA 1KL9A 4DV7L 1Y1WG 3RN5A 3CC7A 2R7DA 2KCMA 3KJOA 5JJLA 2H5XA 3PV0A 4TQUS 4DAMA 2KHIA 4RMFA 5C4XH 5GAEC 4BY7G 1KXLA 1XNRQ 4OXPA 1NE3A 3CCVA 1SFOH 2R7FA 5M3FH 1Q86C 4HIMA 2JA7G 1NY4A 1HZ9A 4JOIA 3TEHB 4HJ9A 5IYDH 4GLVB 1C9OA 4LW1A 1HNXQ 1I6HH 1EOVA 4AYBG 1VQ5A 4DUZQ 2HT1A 1VQBA 1BKBA 1A0IA 3J81j 4B3SL 1U0LA 1KIXA 3KDFA 3OTOQ 1RIPA 1SLJA 4B3TQ 2EIFA 3PCOB 1JMCA 4JV5Q 1Q46A 4LUOA 1VQFA 4A3JG 1KAWA 1SR3A 1VQLA 2DGYA 1RL2A 1YEZA
chains in the Genus database with same CATH superfamily
3A5ZB 5LMNQ 1PHJA 1J9OA 3S17B 1A6XA 2DN8A 2K6AA 4IUTA 3S16H 1K73C 3A7LA 1TWHB 4RCNA 1GUTA 1VQKA 1Y8PB 2BA0A 3K5NA 3P7JA 4A4IA 4X66Q 1G291 4P71A 5JEAG 3CXCA 5C6AA 4J6HA 2IY5B 2BOSA 2K03A 4A3FH 1KABA 4GNXA 2Q2HA 2WAQE 5M3MB 1A3TA 4LUVA 2YU9B 1MI2A 1TWGB 5JEAJ 1ZYRD 2DJGC 4QY7A 4UP7A 2RSNA 4DV6L 4A3EG 1HFGA 1LTTD 1XMQQ 1IBLQ 2I5HA 3U58A 1ESFA 3JAMi 2EJMA 1FNVA 4YWLA 4FP5D 3QOLA 5E1FA 5IYCG 4BBRG 5KGUA 2UUAL 3CPFA 5IE8A 3RLOA 5M9OA 4MTNA 3P75A 3STBD 3K80C 2QCPX 5ELNA 3IKJA 1WD0A 2D0OA 4R8IA 2F0OA 3C1FA 4A3KB 3U4VA 1CZGA 3K7AB 4YCWA 4BA1I 1RTNA 1SEBD 4XYQA 3GTLB 1XTDA 2WP8J 3OSOA 3TS0A 1E7ZA 3VR3A 3S14B 3NBHA 1HTLD 1C0AA 1YNNC 2B2UC 4RH6A 3C2PA 1TWFB 3CW2C 5HGQA 4DR2L 3TN2A 1XYIA 1QCBD 1JOQA 4X62Q 4RG1A 2F0NA 5DM73 1F2LA 3D0FA 3RLFA 2OWOA 4QCLA 2NN6H 4DR4Q 2HQLA 2D9UA 5FOBB 4LJZC 4C3IB 4NXNQ 3S1MB 3OMGA 5IYBG 2I0QA 2XWBB 1HUNA 4ZUIA 3GTOH 2ATWA 2IHFA 1QILA 2E75C 4A3CH 4XXEA 4DV4Q 2JA5G 1BCPC 5LMUL 3T53B 2F0KA 1BBXC 3TS2A 3ND8A 4GOPA 4CBVA 4JC0A 3T56B 2RQXA 3L3OC 2PO4A 3TZDA 1Q1EA 2Y0SG 3NBIA 2N8NA 2CW0D 3OW2A 4A3MH 3NP8A 2PZWA 2E76C 3TSSA 4DAYA 1N34L 1STAA 1GXDC 4JI8L 1AW7A 4ZCKA 1EIHA 1G51A 1GUWA 2F4IA 4IOAA 1TQOA 4DN4M 3KF8B 3T1HL 5KYLA 2F03A 4P72A 2F0HA 3NHHA 3ZYYX 5LL6X 4B3MQ 3HOWB 1HXYD 1LTGD 2NN6G 3GO5A 3H91A 4C3HG 3CCSA 1EYAA 4ME3A 4OO1I 1BCPB 2HHHQ 2F0TA 4GN5A 1PYSB 4GNXC 5LHY1 4QGUA 4KLKA 2AWOA 3KFUA 4A3CG 4CKCA 3S2DH 1WFQA 2K5NA 1Y1WB 1SE4A 3MXNB 4HTHA 1CQFA 3VYUA 1Z9FA 4JI6L 2X6GA 2KA7A 4N9PA 1C4QA 1JWUD 2F0LA 2OEOA 4JYAL 1SMYC 4A3MG 5M5XH 1WYDA 1X55A 2B39A 3V2TA 4AYBB 3H3VH 3RD4A 3M4QA 2CQOA 4YHHQ 1O7YA 4JBMA 5CV5A 2FFKB 2B8FA 4A3JB 3CU7A 1EOTA 1TWCB 3Q23A 2L55A 3T1YL 1U9RA 2M9VA 1S4ZA 3W1BA 3NTKA 1NNXA 1MJEA 1YZ6A 2OF1A 1CKNA 5JJZA 2AKWB 2A69D 3K58A 5GQOA 1DOKA 5JPMC 1S5BD 2NTTA 1YIJA 1QWYA 1HUMA 1EQVA 4GNXB 4KHZA 1B53A 1TWAH 1SYGA 5BN4A 5IP7H 1JWSD 4KTAA 4ODGA 3F2DA 2RCNA 1NSNS 1VMPA 4YY3L 4LUZA 5CV4A 5ELBA 4HJ5A 4DR6L 4C2MH 1Y14B 2K33A 3RR5A 3UE0A 3PF5A 3E6ZX 3A54A 4A3EB 5EKLA 3HP3A 3P20A 1BOSA 2R7ZH 3MEFA 3CMEA 1I3QB 4EQPA 1K83B 3U4ZA 1QNKA 2UUCL 3FP9A 1FNUA 3AMUA 1OXXK 1M1KC 1DJRD 1LABA 3PIP3 4BBRB 4GKKL 3TP8A 3BZCA 1CFMA 3PUYA 1PH5A 1VQ8A 4Q5VA 4X64L 1LTBD 2Z1CA 2I5MX 4GOPC 3LX0A 2R93H 2XN9C 1CKOA 3RUZA 3S15H 5E4WC 4DR7L 1O7LA 2E2IB 1KRTA 3HS0C 4XT3B 1VQAA 1S40A 1SYFA 3F8TA 4NXMQ 4RHRA 3MXPA 4TSSA 3KUPA 1X3QA 4WJWA 3KBGA 2E5LL 2F0IA 5IGGA 4N8FA 3Q8DA 3F2CA 4IO9A 4TKOB 4JI3Q 1R4PB 3VR6A 4V0BA 3G6EA 2TMPA 5KNBA 1ASYA 4LFBQ 2R92H 4PG3A 2E74C 3FPUB 1BVSA 1GVPA 4QJFA 2Q2TA 2YTYA 4LF5L 1Y8OB 1KDBA 1JE4A 3KK7A 2UXBL 4DKAC 3KLRA 2VQEL 4HIOA 4QL5A 4DU9A 1N32L 4K2LA 1Q12A 1D7QA 1E22A 4OIKA 3J81i 1X3FA 3RNUA 1PTOC 4LFCQ 3A7AB 1SDFA 3BVZA 5JPNC 2BCOA 1B7YB 2A6ED 4X65Q 3EFXD 2ZJPA 1P8LA 4KN4C 2JA5B 5CBAE 3D31A 1QUQA 1TWHH 1FJGL 2A8VA 1EIGA 2VL6A 2MPMA 2QA4A 1VQDA 1IYJB 4Z9CB 3RMHA 3M4OB 2Y0SB 2RHSB 3UI2A 1JB7A 2R93G 3FPPA 2ZXOA 1OXVA 1V1PA 1DONA 4XTCS 1R9TB 2KCNA 4DAYB 1GUSA 2B8GA 3M9BA 5M3MH 4NP5A 2K5WA 1PH1A 2YU9H 1RKNA 4LFAQ 4E6IA 1TWGH 4P75A 5COYA 1H9JA 3ERQA 1K8MA 2VXWA 1YI2A 5C4XG 5FO7B 1B8AA 1ESRA 1EZ6A 1HNXL 3AFQA 3DMUA 2R92G 1PV4A 4A3IB 2ZM6Q 3N52A 4OGQC 2BDNA 2JN4A 4B3TL 4PMWA 1AZPA 4JV5L 1S3OA 1STEA 5FLXL 1PTOB 4C3HB 4L5SA 2GVBA 5G3LD 4MTKA 2SDFA 3ONAB 3CCQA 3BVMA 4UPAA 1UE1A 2EDGA 2DY7A 3NWSA 2L15A 4A3KH 1QZGA 3I56A 3K7AH 4ZKBB 4LF4Q 1D5XC 4FO2A 1TS4A 1BBWA 2A73B 2PYKA 4PZ7A 5LL6S 2OT2A 4AQYL 4Y52H 4K6LA 5CMDA 1YBYA 4B3RQ 5CV8A 1XMOQ 1X56A 1WTWA 3K0XA 4ABNA 4XT1B 2O4XA 4A3MB 1VCIA 2K4KA 4KHPL 1WD1A 1FNWA 4OX9L 4HMJA 4DGZA 4U68A 1BXTA 5M5YB 4QIWE 3GTQB 2PW7A 3OPOA 1SROA 3VYTA 2K05A 3S1MH 4A75A 3HKZG 3CC7A 1G6ZA 3K59A 2IWHA 1UEAB 5JJLA 3PV0A 1BF4A 4DAMA 4EVOA 3MFYA 1PFMA 3CCVA 2F0MA 1SFOH 4ZQ3A 3TEHB 1H9SA 2NWGA 2A6HC 1EOVA 4CJ0B 2HT1A 4RA8A 4HAEA 1WTHA 3KDFA 2EY1A 1SLJA 2HCIA 1JMCA 5J1ZA 1KAWA 1QE6A 3DWAA 2DGYA 1RL2A 1K0RA 5CV7A 3Q24A 4RHSA 3S2DB 3NK9A 3RZDB 2BH8A 1C7YA 1MGSA 2EYHA 4J15A 4BXXG 3DM3A 1I4GA 3EA6A 2EVBA 4LF6Q 3BVGA 4QMGA 1KLGD 2VZAA 3L7ZC 1EWIA 4FF1A 3W3AA 2WB1G 1GHJA 2NBFA 3L9AX 4KHVA 3CMAA 5M5XB 1X6OA 1YJWA 1CKMA 2JSOA 1KDCA 2PNRC 1PH3A 3PMFA 4A93G 1AP0A 2D2CC 2OXPA 1VQPA 2VB3X 1S5CD 5DAUA 1KNAA 2Q2IA 5ELEA 1LT3D 3PUXA 1E3PA 4F8MA 2HUGA 1PH9A 1N33Q 1PFSA 4LNQA 5KEEA 3WWVA 4DV1Q 1JT8A 1LTLA 2UXDL 1HA5A 1VF5C 4CHTB 3S9WA 3ER0A 2PQEA 1FGUA 1FYCA 4CGYB 1K0SA 1Y1WH 2QGQA 4FDBA 1TWAB 4I65A 1EYCA 5DEHA 5F2DA 4DA2A 1PMRA 4IZ8A 3GD7A 1IL2A 1LTAD 2N78A 4C2MB 1PYBA 2UUBL 1IYVA 3UE1A 3VYRA 2G9DA 1B44D 1ZXTA 4IPDA 3K0YA 1ET9A 4PMCA 1HRJA 2WACA 4K0KL 4X3KA 1FR3A 2B3GA 3R8BA 1NMGA 1HZCA 4WFN3 1BO0A 1EFWA 1TWCH 1WOCA 4EQNA 1STHA 5T1GA 4ZKCB 5FLXc 1QUQB 2I07B 1TVXA 4IUQA 2D62A 2WFWA 3KOJA 3WOEA 1V1PB 2PW5A 5CYUA 1N8RC 2R93B 1DM0B 3DHQA 2OCEA 5JEAH 1F9RA 4LWCA 1TS3A 1J5EL 4HIDA 1N36L 3UDGA 1WTPA 2QF7A 3J7YW 3NXWA 3C3LA 4DR5L 5IGEA 2F4VL 5IT9L 4R4OA 1X32A 4O1NA 3W1GA 5C4XB 1WI5A 4MZ9A 3W2DA 5IODA 5FJ8G 4DV6Q 1DYQA 3LWEA 2PMZB 4DK3C 4RKLA 5I9OA 4A3GG 2LMCB 1I3QH 1PRTC 4NMZA 4TRDA 4C3JG 1K83H 1EY7A 1I6HB 5IYCH 3FRPB 1EWHA 4BBRH 5IT9E 3I55A 3SE0A 4FF4A 2UUAQ 4JI4L 2N55A 3A0JA 4UP9A 1LT4D 2EY5A 1YNJC 4JCVE 1PZJD 4DV3L 4WORA 3BZKA 3HG9A 5EPLA 2EYOA 4G57A 1I50B 4JI7L 2E2IH 3AU7A 4J8QA 1LV9A 3BJUA 2DY8A 1NAPA 4POGA 4GLXA 3I4MH 5EKIA 1MD2D 4HCEA 1E2ZA 1V43A 2Z8LA 3VDYA 2PI2E 4L8JA 1HNZL 2EYMA 3Q0AA 2LFNA 5IGDA 2EYFA 3CD6A 3KYHC 1E24A 2PQAA 4MNOA 2KHJA 1EU3A 3PUWA 1O78A 2UU9L 2A5HA 4DR2Q 4GS3A 2QILA 2R6GA 1CZWA 1EQTA 2HIXA 3D8GA 4LMQD 1I4PA 3VA7A 1UAPA 5IY0A 2E2HB 2EXDA 3A74A 1I4HA 2HD3A 2ZJQA 1CTMA 3E5SA 1G91A 1QNUA 3HKZB 5IYBH 1IKMA 4ZYSA 3GV6A 1TIID 1H9SB 3HFZB 1I4QA 2JA5H 2O5JC 5D3IB 2Z6KA 3OWEB 1HZAA 1XPOA 3WOFA 3SHLA 3KDFB 5LMUQ 2QEJC 2YYZA 1SMXA 3M4OH 1NBWA 3L2PA 3MAQA 1UE6A 1T9HA 3MEHA 1ENAA 4JI0L 1R9TH 4C56C 3X3MA 1V9PA 3DWQA 1K8GA 3CCRA 4NKLA 3I4MG 1I5FA 2RBMA 4K5WA 1JE5A 2VUMG 2ZT9C 2NYZD 1O7ZA 4N8X1 1N34Q 3QIAA 1HJPA 3H09A 1MHWC 3GTGB 1VMCA 4JI8Q 2WB1B 3HOZG 2F0DA 4A3IH 1AE2A 1R4QB 3DXJC 4BS9A 3J81L 3T1HQ 4A93B 3I91A 1W2BA 4G4KA 4RFBA 1DXMA 3J80i 1FGBD 1PTOH 1I4RA 4C3HH 1K3BC 1LYLA 3S1QH 3UDFA 1Q8IA 3J81E 3S2HH 4MN3A 3HOYG 2SEBD 2NUCA 4FVMA 4PMBA 4CKEA 1SFOB 1F2YA 1V1QA 3K81C 4OL7A 2MNAA 1YNND 1OO9B 1HR0L 3CC4A 1XNQL 5IT9c 3HOVG 1B50A 5ELCA 4JI6Q 1IBKL 2AMCB 5I9PA 1TS5A 4JYAQ 1PRTF 3TZUA 5DLQE 1PZID 5M5YH 3GTQH 4OO1G 2K50A 1HFNA 3H0GG 5CR3A 1JOOA 1MBYA 2YTXA 3VYSA 1EQQA 1Z6HA 2CWPA 3Q22A 3OWFA 4CJ1B 1KRSA 3NSWA 3IFDA 1F77A 1VQOA 3AB9A 3T1YQ 1XX8A 1IHZA 3J7AF 4A3IG 3VR5A 1TU2B 5FKAC 1BCPD 1U4PA 2FXQA 3ND9A 1DGSA 4IPHA 2A1AA 1Y1VG 4LF7L 1D5MC 3GTMB 4RGOS 3HOXH 2C5CA 4RKBA 1OXUA 1ILQA 4YY3Q 1CHQD 4FF2A 3NE5B 4FYDA 4DR6Q 3T16A 1EYDA 2K14A 3RZDH 3G71A 3OOCA 3F2BA 4A3GB 4OEMB 4DPGA 4C3JB 3URYA 1MJCA 4JI5Q 5KYIA 1SNDA 1KQSA 3IL8A 2XSCA 2UUCQ 3A8KE 4JI2L 4LF9Q 3A8IE 1JORA 1S5FD 1DCZA 2Z6KC 1I6VC 3S1NH 4GKKQ 2VY3A 1SXTA 3HGBA 4X64Q 3BZDB 2CFMA 2EZVA 1EZ8A 1UWVA 1CSPA 1ONLA 2MJ8A 4EGVA 5T1IA 4DR7Q 3MVVA 2Y0SE 5H1SE 4IPGA 3T51B 3S24A 1DOLA 2V4DA 2AHOB 2E5LQ 4F88A 4K6DA 4GZYC 2E2DC 5FK9C 2XWJB 3K5LA 4JBWA 1AZQA 2RCFA 3NEMA 2KBNA 1GOZA 3F1ZA 3HOXG 4KI0A 1STYA 3X3NA 4G7OC 1SMYD 2CVRA 4ME5A 5BN5A 2ZXPA 1K3RA 2F3WA 2PNHA 4LF5Q 2L1BA 3I4NG 2RSOA 2UXBQ 3OHXC 2FJ2A 2VQEQ 3G6JB 1N32Q 1QVCA 4JI5L 1OXTA 3J81c 1YITA 1NJIC 1DZ1A 4LF9L 2D5DA 4X3TA 3RZOH 2JA8H 3PO2H 5IP9H 2XGTA 1HNWL 2B29A 5AJ3L 1FJGQ 2B2YC 1JJCB 1UNSA 1O7IA 2F0SA 4A76A 4KKTA 1W3SA 3I4OA 4DAVA 4HJ8A 5EJWA 3NQTA 3D6WA 5KIXA 3NBHB 2NTSA 3I4MB 4DV7L 1KLUD 2PZTA 2VUMB 4TQUS 4DXFA 2KHIA 5C4XH 1KXLA 3KLSX 2EJFC 1EY9A 2KCCA 4HIMA 3HOZB 2JA7G 4DAPA 5EBCA 2NVTB 4GLVB 1HNXQ 1I6HH 4IUNA 1M4VA 2EY6A 4B3SL 1RIPA 2A6EC 2EIFA 4B3TQ 3LNNA 4JV5Q 4LUOA 1HPCA 1NR2A 1ILPA 1VQFA 3CRLC 1YEZA 1IYUA 1B70B 2F3VA 2IX1A 1YHAA 2Q8TA 4XQJA 3HOYB 3OMCA 4KJOA 1I50H 4GOPB 3H3VI 2L0CA 2OQ0A 2JA8G 3PO2G 2DUDA 1LTSD 2N3SA 3ITPA 5IP9G 3J7A5 1UE7A 5EPKA 5C3EB 1B1ZA 3R2TA 1NTGA 4LF8Q 4AQYQ 4EQ5A 3HOVB 1SRUA 5I6WA 4DFAA 1BBUA 1K9MC 4BY1G 5IIFA 4KHPQ 3QJYA 3FDTA 1E2WA 4OX9Q 3J7ZC 3H0GB 4A3LH 1O80A 1L0YB 3ULLA 2E2HH 1JR0D 2HDMA 1PH4A 2BE5C 1EY5A 2G9HD 2X6LA 5C3XA 1S72A 4NDXA 2FHTA 3ZJYC 1PTOD 3NTHA 3NQIA 5C44G 1ENFA 2Q8RE 1PH6A 3E0JA 3CPWA 1OTCA 3M3YH 1M8AA 1Y1VB 4H0LC 4YWKA 2F0EA 3LWUA 3QR8A 3HOUG 2P5ZX 2NVYB 3PSIA 3S1QB 3QWNA 2O2LD 5HGTA 4JI1L 3MXGA 3S2HB 3BG3A 1OXSC 1BDOA 2H4OA 3Q6SA 2KJXA 4K2KA 5D3DA 4DV0L 1KDAA 5FLXE 3FKIG 2XNAC 5GAGC 4OWXB 4J1MA 4OWWB 2VQFL 1KD1C 2B2TA 4BXXH 5IOCA 4LF8L 4PZ6A 1MKHA 4X3SA 3VR2A 3GTGH 2AUKA 2K5QA 1SAPA 1SNPA 2ZXRA 3N6RA 1AH9A 5L37A 3ERSX 3BS1A 4S3SA 2F1MA 3MXUA 3JAML 3CCUA 4DR3Q 4A93H 1II3A 4A3LG 1X9NA 4O42A 2LS01 4POFA 1CKNB 4QUFA 3BDLA 2K04A 5J3BA 1D8LA 2UXCL 2IW3A 3JAME 3FMCA 1SN8A 4P73A 1IW7C 1SNMA 2A68C 3T4AC 4JW0A 1PA6A 2UXDQ 2QEXA 4JK1C 2N49A 5JAVA 4X6AH 4H13C 3SXHA 2IHEA 4ZRZA 2RHQB 2EXZA 2MO0A 2B63G 1ASZA 5BR8L 4KKSA 4H02A 4IUUA 3HOXB 1HHVA 3H3VC 4DV2L 2PMZE 3BU2A 2RDHA 5KRUA 1PLFA 4AH6A 2UUBQ 2AUJD 4DK6C 3GP7A 5EBDA 3I4NB 2K75A 3CC2A 4HJAA 4K0KQ 2F0UA 2K1BA 2ZTCA 1F2ZA 5NUCA 5I2XA 1C48A 3J80L 5ELDA 2A19A 2VW9A 2AQ2B 3GDEA 1Q86C 2ZTEA 1SE8A 1XTCD 1A3VA 4TVAB 5C5MA 1EUJA 4DR3L 3S1NB 5CC4A 1EY6A 1X3PA 3I72A 4R9WA 4K5VA 2RDFA 3J80E 4X3UA 2A6HD 3GTMH 4HCSA 3U9OA 4CJ2C 5TSSA 1LTID 2J4XA 4KK7A 4JBJA 1J5EQ 3C1EA 3K6OA 4GKJL 1N36Q 2G5DA 3GTKH 4OWTB 4DR5Q 2F4VQ 1PH8A 5FJ8H 1UUPA 2B2VC 2EQSA 4GLAC 2KEDA 4A3GH 1V1OA 2JA7B 3NELA 4C3JH 2NVXH 3BDOA 1RODA 1Q82C 4DNRB 1U5KA 4APVA 4RGNA 3AEVA 2R61A 5K5PA 1SNQA 2K52A 4ZK9B 5CV9A 4JI4Q 1JC7A 2OQKA 1LT6D 5G3LF 4N9TA 3SDZA 1VQ9A 1WTRA 2JQOA 4DV3Q 1CK1A 1H9KA 2CHBD 4IFDI 1SE3A 1VDZA 2I5LX 1SYDA 4JI7Q 3RZOB 1Q81C 2JA8B 2GA4B 3PO2B 2NB0A 1JCKB 2B2TC 1Q8KA 1TY2A 1PFBA 1HNZQ 4DV5L 4P74A 4BY1B 3L0OA 2JA9A 3M85A 2YV5A 3TREA 1WCMH 2WAQG 1I94L 1U4LA 1EY0A 4FXGC 2UU9Q 3HKSA 4QIWB 4ALPA 2E8GA 2BA1A 3K5OA 2K01A 5I4DA 4C1NI 4IPCA 5D65A 4RWSC 2EJGC 1ET6A 5FO9B 1KTKA 3DUZA 4DK1A 3JAMc 3BDCA 3CCEA 4A3DG 5C4JH 3PO3H 3R2IA 5C44B 5JVG3 2NVQB 1EEFD 3G48A 2TSSA 2WKCA 2MFIA 1F9PA 3HOUB 1X54A 1FL0A 3A5UA 1AFPA 2HIVA 1VQHA 4XYOA 1SYCA 2HDLA 1NCVA 4IJLA 4KKUA 3VA5A 1IBMQ 1E1TA 4M1UB 3SK4A 4ZUJA 2MUYA 4M8AA 4DR1L 4HSVA 5C0XI 3UDIA 1JB3A 3FKIB 4JI0Q 2H1EA 2XIWA 1KC8C 1W6JA 2ASBA 4MHEA 4AIMA 2VUMH 5IWAL 1H9RA 1LUZA 1CM9A 2MO1A 4L5RC 2K5VA 2ZTDA 1ZYRC 1SE2A 4A3BG 4KN7C 1HQMC 2KOLA 1TR5A 3HOZH 3I3CA 1Z47A 1D5ZC 2NVTH 1H95A 1J6QA 4B9WA 4I7ZC 1WCMG 3KJPA 1TS2A 3AFPA 1PRTB 2F0JA 3PUZA 2CQAA 3J80c 1BR9A 1YNJD 3SGIA 1YHQA 3DEPA 1IXRA 3STBC 4XQNA 4WJ4A 1P16A 2AWNA 2Z6BA 3I7FA 3HOYH 5JJIA 3PIOA 2FMMA 3KLSA 3PO3G 5CBEE 3S1RB 5ELOA 3GTPB 3H6MA 1BQQT 3M3YB 1LO5D 3MFGA 1SJHD 5J39A 5KNCA 1VQ7A 4K5XA 5C3EH 3AQQA 1EFID 5JOBA 2B63B 2HQEA 1IBML 1A62A 1EY8A 3TP7A 1CHPD 3CCMA 3HOVH 1HR0Q 2VNUD 1XNQQ 2SOBA 1RD9D 3OIQA 1XNRL 1F9SA 2GVAA 3NENA 1IBKQ 2Z4IA 4K8IA 4OO1H 3A8JE 3H0GH 1QOHA 2XRQD 4RCOA 3PIPA 4DUZL 1GUGA 3KF6A 2RF4A 4BY7H 4AYBE 3OTOL 1E2VA 1T5XD 3EN2A 2KHSA 4R4IA 2I46A 2WKDA 3MHBA 1GJXA 5LMNL 1Y69U 3K8AA 4OONA 4WJ3M 1VQ4A 2F0QA 1L1OA 1VQNA 1Y1VH 1EY4A 3GQBA 1HH2P 5M5WB 1EIFA 1NUCA 4LF7Q 4KY7A 4G7HC 2JEBI 1ICWA 1VS0A 2MHVA 2NVYH 3NUCA 2F0GA 2QDBA 1C8CA 1QZHA 4IURA 4X66L 5E7NA 2CW0C 1F9QA 3K57A 2JP1A 3E9HA 4A3FG 4YCVA 2LXJA 2VB2X 5DNFA 3BYTB 4IN3A 4HSPA 2B2YA 1A2TA 5C3EG 4CDEC 1XMQL 3MA2B 5J22A 1IBLL 2EY2A 1SYBA 1A15A 2IJ0A 2NZHA 3EROA 4QQBX 4ULLA 4F87A 3T13A 1PVOA 4ID6A 4JI2Q 1RDPD 2X69A 4R4CA 4L5QA 1PH2A 3OW7A 4O0AA 4RGTA 2ICEC 2R7DA 4FXKC 3KJOA 4QUCA 5EPJA 2H5XA 1D1KA 4RMFA 4QB4A 4BY7G 1SNCA 1ML0D 1NE3A 3CQZB 5M3FH 1NY4A 4JPBW 4JOIA 2KECA 3A56A 4B08A 1B4OA 3CKIB 4HJ9A 5IYDH 1C9OA 4LW1A 4QF4A 1VQ5A 1VQBA 1BKBA 3MZ5A 2SNMA 5EGTA 3D3RA 1U0LA 5D14A 2Z9HA 1WTVA 5HURA 2J7ZA 4CDDC 1WTQA 5EQ0A 1D2BA 2WAQB 1X65A 5A35A 1ZEQX 1FVIA 3SR1A 1JJGA 3R3OA 4K14A 3GTKB 2KQ3A 1RCVD 2QDLA 4X62L 1STNA 1S5DD 3I4NH 1IKLA 2JJQA 2V1CC 5BN3A 2PCFB 1I4XA 4DR4L 1V8QA 3RLNA 4WRDA 4Y7NB 4KY5A 2NVXB 4A3DB 2ALYB 4NXNL 1STBA 3CHBD 1UE5A 4CDCC 3FVQA 1QVGA 5GAHC 1N9WA 1HQRD 1MIUA 4KD4A 1XPRA 1EU4A 1RHPA 4R4QA 1SSOA 2A69C 4DV4L 4YCUA 5A2QL 2CWAA 1ZKOA 1HNWQ 2SNSA 3BYYB 5ISRA 1VQJA 1E0BA 5AJ3Q 4HR7B 3O13A 4FXDA 4Q0FA 4YWMA 1YNXA 3MWYW 3ICEA 5A2QE 5M3FG 1Q3LA 2NN6I 3CAMA 5IYDG 4DV7Q 3I73A 2PQAB 2XRSD 3AYHB 1WVLA 4A3BB 3DEOA 1B9MA 1PDQA 4KJNA 5KNDA 4C1NK 2JA7H 3SK6A 4CKBA 2Z0SA 2O5IC 1WCMB 3E3XA 2K5DA 2D0PA 2C35B 2RA4A 4B3SQ 4JG2A 1Y8NB 3NPPA 1L1OC 2LSSA 2F0PA 3SVMA 3PIO3 4B3ML 2E2JB 1Q7YC 5DM63 1GD7A 1XJVA 1E1OA 4JVZA 1QB5D 2JE6I 1JWMD 2XTIA 5C4JB 1G8ZD 1KAAA 2HHHL 3GTJB 3PO3B 1KHIA 3D4WA 2YTVA 3ULPA 4YIJA 2OTLA 1NR4A 3OYYA 5ELFA 2IT1A 2GN5A 3J7AV 4UP8A 2EYLA 3W5OA 4DUYQ 5K36H 1D1IA 2F3IA 1TXYA 4UHVA 4KV6A 4CDFC 2KCTA 2K28A 1TT2A 2LKVA 1XXGA 3TQYA 4BY1H 1HCZA 5E3FA 2IPKD 4OELB 3KF6B 1A2UA 3K5MA 3V05A 1SYEA 2IL8A 1GKHA 1Q90A 3HZXA 3TP5A 1LT5D 4NPSA 4YHHL 4UAIA 3A55A 4HEDA 4O2DA 1EEID 5I2YA 1B3AA 1D6EC 4L5TA 1FD7D 1L1OB 1Q1BA 2DJFC 1BCPF 4JOIC 5C44H 3U9SA 2CCZA 2NVQH 3I90A 3TBIB 1QJOA 1L2FA 2JYOA 2LY7A 3FHWA 2M00A 3S16B 4XIGS 4BWGB 2DNCA 3HOUH 2KENA 3D4RA 3M7NA 4IUVA 4DK0A 1HTPA 1EYGA 1GM5A 1B2TA 2FMCA 1MSHA 4JI1Q 5IP7G 2N88A 1VQCA 3FKIH 1S5ED 2MP1A 2PPBC 4LAAA 4A3FB 1VQ6A 4DV0Q 2BDOA 2PZUA 5FLMH 1KNEA 5FO8B 3E0EA 4DUYL 3G7LA 3KLWA 2VQFQ 1B9NA 5K36G 3QB3A 1YJ9A 4UDUC 4GN4B 4OHJA 1EL0A 2R7ZG 4BBSH 1NMFA 1HA6A 2JA6H 2M2LA 2L5TA 5GADC 4ZLTF 4RAUC 3S17H 5C5LA 3DM1A 2IX3A 2K5HA 3TP6A 2B2VA 5JVH3 5JJKA 1HZBA 4BY7B 3I8ZA 2OTJA 4IQZA 2UXCQ 2IX0A 3EJIA 4IUPA 2L12A 2ZJRA 1LTRD 2XVSA 4H44C 3S1RH 3GTPH 1PFNA 5GROA 4L63B 3MTSA 1WJJA 1STGA 4NXML 3VR4A 2F0FA 1TY0A 1T5EA 2B63H 4FNFA 4JI3L 1H9MA 1CT1D 5BR8Q 2HCCA 2KEEA 1U4RA 4LFBL 4KY6A 4DV2Q 1JQYD 3D4DA 4K8JA 5FLMG 2EE1A 1CI3M 3R93A 3FEWX 1L0XB 1BUVT 2VS1A 3DWPA 1IZ6A 1K8AC 4IOCA 2BE5D 2EYPA 4R1JA 3SK5A 1G6PA 1AEXA 1W6KA 4L6TB 4PQXA 1GHKA 3EBEA 2L4NA 3IFTA 3CCJA 4BBSG 4KD3A 4LFCL 5I6YA 3GTOB 2JA6G 3PQIA 4X65L 2B2WA 1MSGA 1YVCA 4IJHA 2EYJA 4LK1C 4EX5A 2EPBA 4R8NA 5M5WH 1M90C 2WIIB 3GTLH 1ICFB 1VQIA 1AN8A 2MQHA 3S14H 1XPUA 2LXKA 4U673 5M3FB 2KUMA 3CP0A 1IL8A 1DOMA 2WV6D 1TWFH 4GKJQ 5AFWA 4IFDH 2CH4W 1VQGA 3NWTA 4EQOA 3K7UC 4LFAL 5M3MG 1U4MA 4H7BA 3ULJA 1AE3A 2ICIA 5HY6A 1K28A 3F2UA 1RJTA 2C9OA 3EQLC 4C3IH 1PH7A 2K7VA 3PF4A 4GN3B 4HJ7A 4HIKA 3RN2A 2ES2A 1DD2A 3I2ZA 2ZM6L 3M7GA 5LMNW 1CQVA 1L0WA 5C4ZA 3D6CA 4DNIA 2BH2A 2Q8IB 2JEAI 3WDNA 4DNTB 2FINB 4IALA 4V190 3CQZH 4OIJA 1IW7D 2A68D 3JC66 3OIPA 5CORA 3B6YA 4NB3A 4A3KG 4LF4L 1LM0A 3MC0B 4UY8C 4I7AA 1CUKA 1K8OA 3UDXA 2ID0A 3E9IA 2JXMB 4B9XA 3CCLA 3I70A 4DV5Q 1HR0W 4B3RL 3M4PA 1SNOA 1XMOL 1X3GA 1CSQA 1G2TA 1I94Q 1PZKD 3PGZA 4HMIA 1YHBA 4PZ8A 5C3WA 4IFDG 2RKSA 1A8VA 3QO2A 2L11A 1G2SA 1F2MA 5IGBA 5C0XH 5EAYA 3C46A 1PYWD 1PTOF 3HOWH 3TRZA 3IRBA 4Y7NH 2MGSA 1YJNA 4IFDJ 3H94A 1A63A 4A3DH 1JJ2A 5E4XA 3QG1A 4C3IG 4NW2A 3HKZE 1B3QA 4XDXA 2Z4HA 2QW7A 2ENBA 2L9HA 1BNZA 1SBBB 2F0WA 3G4SA 2NZOA 4ILWA 4HN7A 3CF5A 2JK8A 4P2CB 1ENCA 3DLLA 1VQEA 2J0TD 2NZ1D 2K32A 3P1HA 4DR1Q 4PNYA 1GO3E 1UEBA 1XWEA 3V96A 4ZAIA 4R4TA 2RVLA 1CA6A 3GV3A 4XQQA 3IAYA 5IWAQ 4BA2I 4A3BH 3LGJA 3TMEA 2PI2A 3EIVA 1EWCA 4LF6L 2AQ1B 2R7ZB 1RTOA 1Z7TA 2EOTA 5IGFA 3QOJA 4A3JH 1J8IA 2B2UA 2QKIC 1VF7A 3U50C 1X3EA 3EVQA 2B2WC 5C4HA 2WB1E 2A74C 4G7ZC 3SEBA 1CA5A 3PUVA 3H15A 2E2JH 1A3UA 2CKZB 5C0XG 4RGMA 4PV1C 1GUOA 3KF8A 3HOWG 5IGCA 1LACA 3S15B 2F52A 1QG7A 3HRZC 3I4LA 1N33L 1EQRA 1TKWB 2WINB 5C0XJ 3GTJH 4DV1L 1QVFA 3M4YA 1JOKA 4JBKA 1LLRD 4KMUC 4DF7A 2KVMA 1EIYB 2AQ3B 4DXGA 2Q2UA 4A3EH 1GUNA 4MIUA 1RF2D 4F7XA 2RDGA 1VQMA 1KL9A 5EKKA 4FF3A 1Y1WG 3RN5A 1PXUA 1JICA 2KCMA 3CRKC 2R92B 5GAEC 1WTOA 1XNRQ 3HEJA 4OXPA 2R7FA 3SK8A 1HZ9A 3MXNA 1WTXA 4AYBG 4DUZQ 1A0IA 3J81j 2F0VA 1KIXA 3OTOQ 1PRTD 3KBXA 2R3ZA 5CGKA 1SJED 3PCOB 1Q46A 4BBSB 2DNEA 2CH4A 4A3JG 1VQLA 1SR3A 5CV6A 2JA6B 3TDQA 3NTIA
chains in the Genus database with same CATH topology
1B70B 1X65A 3A5ZB 5LMNQ 1PHJA 2IX1A 1FVIA 1JJGA 2BH8A 1C7YA 1YHAA 3S16H 4BXXG 4J15A 1K73C 3DM3A 1I50H 4GOPB 4LF6Q 4X62L 3H3VI 1VQKA 3I4NH 2JJQA 2V1CC 2VZAA 2BA0A 3L7ZC 1EWIA 2OQ0A 2JA8G 3PO2G 2WB1G 4A4IA 2DUDA 3RLNA 2N3SA 5IP9G 3J7A5 4DR4L 3CMAA 1UE7A 4X66Q 1G291 4P71A 5JEAG 3CXCA 2IY5B 2ALYB 4NXNL 1X6OA 1YJWA 1UE5A 1CKMA 4GNXA 4A3FH 1NTGA 1QVGA 4LF8Q 1PH3A 5GAHC 1N9WA 2Q2HA 2WAQE 4A93G 1MIUA 4AQYQ 1XPRA 4LUVA 1VQPA 4EQ5A 4R4QA 1SRUA 5JEAJ 1BBUA 2Q2IA 1K9MC 4BY1G 4DV4L 4YCUA 3PUXA 1E3PA 2CWAA 4QY7A 4UP7A 1PH9A 4DV6L 4A3EG 1N33Q 1PFSA 1XMQQ 4LNQA 4KHPQ 1VQJA 1IBLQ 1HNWQ 4OX9Q 5AJ3Q 2I5HA 3WWVA 3J7ZC 4DV1Q 3U58A 1JT8A 1LTLA 3JAMi 2UXDL 4A3LH 3ER0A 3ULLA 4YWLA 2E2HH 1FGUA 5IYCG 4YWMA 1YNXA 3ICEA 4BBRG 1PH4A 2UUAL 5M3FG 1S72A 1Y1WH 2NN6I 3CPFA 5IE8A 3CAMA 2QGQA 4FDBA 3RLOA 3ZJYC 5IYDG 4MTNA 4DV7Q 2PQAB 4DUYL 3STBD 3AYHB 3K80C 5C44G 5ELNA 3GD7A 1PH6A 1IL2A 3CPWA 1OTCA 3M3YH 2N78A 2D0OA 2JA7H 1PYBA 2UUBL 4YWKA 3UE1A 3HOUG 4IPDA 3U4VA 2Z0SA 3PSIA 4YCWA 2D0PA 4BA1I 2C35B 4K0KL 2B3GA 4JI1L 4B3SQ 4JG2A 1NMGA 1OXSC 1HZCA 1XTDA 2WP8J 1L1OC 3TS0A 2LSSA 4DV0L 1E7ZA 1TWCH 1WOCA 1EFWA 3FKIG 4B3ML 1Q7YC 5FLXc 5GAGC 1QUQB 1C0AA 1GD7A 1XJVA 4OWXB 1E1OA 4OWWB 2JE6I 2VQFL 1KD1C 4BXXH 2XTIA 3CW2C 5HGQA 4DR2L 2D62A 2WFWA 4LF8L 4PZ6A 1MKHA 2HHHL 3KOJA 1KHIA 1N8RC 3GTGH 2YTVA 4X62Q 4RG1A 3ULPA 2OTLA 3OYYA 3D0FA 3RLFA 2OCEA 2IT1A 2OWOA 2GN5A 1AH9A 3ERSX 4DR4Q 4LWCA 4UP8A 1J5EL 3W5OA 4DUYQ 2F3IA 2HQLA 3CCUA 4HIDA 1TXYA 4DR3Q 3UDGA 1N36L 4NXNQ 4A93H 2KCTA 5IYBG 2I0QA 4A3LG 3TQYA 4DR5L 1X9NA 4POFA 4BY1H 2F4VL 3GTOH 1CKNB 4R4OA 2ATWA 2IHFA 3W1GA 4A3CH 5J3BA 1WI5A 1D8LA 4MZ9A 4DV4Q 2UXCL 2JA5G 5FJ8G 3KF6B 4DV6Q 1SN8A 5LMUL 4DK3C 4P73A 3TS2A 4A3GG 4GOPA 1I3QH 4JC0A 1GKHA 1K83H 1PA6A 2UXDQ 2QEXA 4NPSA 5IYCH 4YHHL 2N49A 4BBRH 1Q1EA 4X6AH 2Y0SG 3I55A 4O2DA 2N8NA 2IHEA 2RHQB 2UUAQ 4JI4L 3A0JA 3OW2A 2MO0A 4L5TA 1L1OB 1Q1BA 4UP9A 4A3MH 5BR8L 1ASZA 2B63G 4JOIC 5C44H 4H02A 4JCVE 2CCZA 4DV3L 2NVQH 4DV2L 3BZKA 1L2FA 3FHWA 1N34L 2PMZE 4XIGS 3BU2A 3HOUH 2KENA 4AH6A 2UUBQ 4JI7L 4DK6C 2E2IH 3M7NA 4JI8L 2K75A 3BJUA 1G51A 4POGA 4GLXA 1EYGA 3I4MH 4IOAA 1GM5A 1V43A 3KF8B 3VDYA 3CC2A 4HJAA 4K0KQ 3T1HL 2ZTCA 4JI1Q 5IP7G 2PI2E 1VQCA 3FKIH 4P72A 1HNZL 1VQ6A 4DV0Q 5FLMH 4B3MQ 2A19A 2VW9A 3KYHC 1E24A 2PQAA 3E0EA 3GDEA 2KHJA 2ZTEA 3KLWA 1SE8A 2NN6G 3GO5A 3PUWA 4MNOA 4TVAB 4DR3L 1EUJA 2VQFQ 3CCSA 2UU9L 5K36G 4DR2Q 4GS3A 1YJ9A 4ME3A 2R6GA 4OO1I 2HHHQ 2HIXA 4GN5A 4GN4B 1PYSB 4GNXC 2R7ZG 3GTMH 4QGUA 4KLKA 2AWOA 4BBSH 5IY0A 1NMFA 2EXDA 3A74A 2JA6H 3KFUA 5GADC 4A3CG 2ZJQA 1J5EQ 4JBJA 3S17H 3S2DH 1WFQA 2K5NA 4GKJL 1N36Q 5IYBH 3GTKH 2K5HA 5JJKA 4OWTB 1HZBA 4DR5Q 3HFZB 2F4VQ 3MXNB 2OTJA 1PH8A 1Z9FA 2JA5H 5FJ8H 2Z6KA 2EQSA 4GLAC 4JI6L 2UXCQ 4A3GH 1HZAA 3NELA 1XPOA 4JYAL 4C3JH 4A3MG 2IX0A 2NVXH 5LMUQ 3KDFB 1Q82C 5M5XH 1WYDA 2ZJRA 1X55A 3S1RH 2YYZA 3GTPH 3H3VH 1SMXA 5GROA 1U5KA 3M4OH 1NBWA 3L2PA 4APVA 3M4QA 1WJJA 2CQOA 4YHHQ 1UE6A 4NXML 1T9HA 4JBMA 3AEVA 4JI0L 2B63H 2K52A 1R9TH 4JI3L 4JI4Q 1V9PA 2OQKA 1K8GA 5BR8Q 3T1YL 1VQ9A 3CCRA 3W1BA 3I4MG 1MJEA 1YZ6A 4LFBL 1CKNA 2JQOA 1I5FA 2AKWB 4DV3Q 1JE5A 4DV2Q 2VUMG 4IFDI 5GQOA 1N34Q 2I5LX 1HJPA 4JI7Q 5FLMG 1YIJA 1Q81C 4JI8Q 4GNXB 3HOZG 4KHZA 1TWAH 2VS1A 1IZ6A 5IP7H 4A3IH 1AE2A 1K8AC 4IOCA 3F2DA 1Q8KA 2RCNA 4R1JA 4YY3L 3T1HQ 4LUZA 1G6PA 4HJ5A 1HNZQ 1W2BA 4DR6L 4C2MH 1Y14B 3EBEA 3CCJA 4DV5L 4BBSG 3J80i 4P74A 4LFCL 3RR5A 3L0OA 3UE0A 4C3HH 2JA9A 2JA6G 3PF5A 3M85A 2YV5A 4X65L 3TREA 4IJHA 1YVCA 1WCMH 2WAQG 1I94L 1LYLA 4EX5A 2UU9Q 3HKSA 3UDFA 3S1QH 5M5WH 1M90C 4ALPA 3GTLH 2E8GA 2R7ZH 3MEFA 3HOYG 2BA1A 3CMEA 3S2HH 1VQIA 2MQHA 3U4ZA 2UUCL 3S14H 3FP9A 4IPCA 1OXXK 1M1KC 1XPUA 2LXKA 3CP0A 1V1QA 4GKKL 3JAMc 3BZCA 3PUYA 1TWFH 3CCEA 3K81C 1PH5A 1VQ8A 2MNAA 5C4JH 4X64L 4A3DG 4GKJQ 3PO3H 1VQGA 2I5MX 4GOPC 3K7UC 1HR0L 3CC4A 5M3MG 4LFAL 1XNQL 2R93H 5IT9c 3G48A 1CKOA 3HOVG 3S15H 4JI6Q 1IBKL 2AMCB 2MFIA 3ULJA 1AE3A 5HY6A 4DR7L 1X54A 1FL0A 3A5UA 4JYAQ 2HIVA 1VQHA 1KRTA 5DLQE 4C3IH 5M5YH 1PH7A 4IJLA 1VQAA 3PF4A 1IBMQ 4GN3B 3GTQH 4OO1G 4HJ7A 2K50A 1E1TA 4HIKA 3RN2A 1S40A 3H0GG 2ES2A 2YTXA 3F8TA 4NXMQ 3I2ZA 2ZM6L 4DR1L 1EQQA 5LMNW 2CWPA 2E5LL 5C0XI 3UDIA 1KRSA 4JI0Q 3F2CA 3Q8DA 4IO9A 1KC8C 4JI3Q 1L0WA 2ASBA 4AIMA 3G6EA 1VQOA 3T1YQ 2VUMH 5IWAL 1LUZA 2MO1A 1ASYA 4L5RC 2K5VA 4LFBQ 2R92H 4PG3A 4DNIA 2BH2A 2ZTDA 4A3IG 2JEAI 4A3BG 2FXQA 1BVSA 3CQZH 1GVPA 1DGSA 4IPHA 4QJFA 2A1AA 3HOZH 1Y1VG 4LF7L 1Z47A 2Q2TA 2NVTH 1H95A 3JC66 2YTYA 1J6QA 4LF5L 3B6YA 4NB3A 4A3KG 2UXBL 4DKAC 4LF4L 1LM0A 1WCMG 2VQEL 4HIOA 4QL5A 3KJPA 3HOXH 1N32L 4UY8C 1OXUA 1Q12A 1CUKA 4YY3Q 3AFPA 1D7QA 3PUZA 3UDXA 1E22A 3J81i 2ID0A 1X3FA 3E9IA 4DR6Q 3CCLA 3RNUA 3J80c 4DV5Q 3SGIA 1YHQA 1HR0W 4LFCQ 1IXRA 2K14A 3M4PA 3STBC 1XMOL 4B3RL 2ZJPA 4WJ4A 1B7YB 4X65Q 1X3GA 3RZDH 1CSQA 1P8LA 3G71A 1P16A 3F2BA 1I94Q 2AWNA 3PGZA 3I7FA 3HOYH 3D31A 3PIOA 1YHBA 5JJIA 4PZ8A 4DPGA 4IFDG 1MJCA 1QUQA 1A8VA 1TWHH 4JI5Q 1FJGL 2VL6A 2QA4A 2A8VA 3PO3G 5ELOA 1KQSA 1VQDA 1IYJB 5EAYA 2UUCQ 2RHSB 1JB7A 4JI2L 4LF9Q 3HOWH 2R93G 3TRZA 1OXVA 3IRBA 4Y7NH 1YJNA 4IFDJ 1A63A 1VQ7A 4A3DH 1JJ2A 2Z6KC 5C3EH 3AQQA 4XTCS 3S1NH 4GKKQ 2VY3A 4DAYB 1IBML 1A62A 3M9BA 4X64Q 5M3MH 2CFMA 1PH1A 1UWVA 2YU9H 3CCMA 2VNUD 3HKZE 4LFAQ 1HR0Q 1CSPA 1TWGH 1XNQQ 3HOVH 4P75A 1XNRL 2GVAA 3NENA 1YI2A 1IBKQ 5C4XG 1B8AA 4DR7Q 3G4SA 2NZOA 2Y0SE 3H0GH 5H1SE 1HNXL 3AFQA 3CF5A 2JK8A 4DUZL 3PIPA 4IPGA 2R92G 3DLLA 1VQEA 3S24A 3KF6A 1PV4A 2RF4A 2ZM6Q 4BY7H 4AYBE 3OTOL 4DR1Q 2AHOB 4B3TL 3EN2A 2E5LQ 1GO3E 4PMWA 1UEBA 4R4IA 4JV5L 1S3OA 4R4TA 4JBWA 3NEMA 5IWAQ 5LMNL 2KBNA 4BA2I 4A3BH 3LGJA 3F1ZA 3HOXG 4L5SA 2GVBA 3K8AA 4KI0A 4OONA 4WJ3M 1VQ4A 1VQNA 1L1OA 1Y1VH 2PI2A 3EIVA 1HH2P 3CCQA 1EIFA 4UPAA 4LF6L 1UE1A 4LF7Q 2L15A 1K3RA 2JEBI 1VS0A 4A3JH 4A3KH 1QZGA 2PNHA 2NVYH 3I56A 4LF5Q 3I4NG 3K7AH 2UXBQ 1QZHA 4LF4Q 2VQEQ 3U50C 1X3EA 4X66L 2WB1E 1N32Q 1QVCA 4JI5L 1OXTA 3J81c 1YITA 5E7NA 1NJIC 1BBWA 3PUVA 4PZ7A 3H15A 4LF9L 2E2JH 3E9HA 2CKZB 5C0XG 4AQYL 4A3FG 4YCVA 3RZOH 4Y52H 2LXJA 2JA8H 1YBYA 3HOWG 3PO2H 4B3RQ 1XMOQ 1X56A 5IP9H 3K0XA 2F52A 1K0RA 1VCIA 2XGTA 1N33L 2K4KA 1EQRA 5C3EG 1XMQL 4KHPL 1HNWL 1IBLL 3GTJH 5C0XJ 2B29A 5AJ3L 4OX9L 4DV1L 1QVFA 1FJGQ 2NZHA 3CD6A 4QQBX 1JJCB 4JBKA 4QIWE 1O7IA 1PVOA 4A76A 1EIYB 1W3SA 3I4OA 4JI2Q 4HJ8A 1SROA 4R4CA 4L5QA 2Q2UA 1PH2A 4A3EH 3S1MH 3NBHB 4A75A 4O0AA 3HKZG 1VQMA 1KL9A 4DV7L 1Y1WG 3RN5A 3CC7A 2R7DA 2KCMA 3KJOA 5JJLA 2H5XA 3PV0A 4TQUS 4DAMA 2KHIA 4RMFA 5C4XH 5GAEC 4BY7G 1KXLA 1XNRQ 4OXPA 1NE3A 3CCVA 1SFOH 2R7FA 5M3FH 1Q86C 4HIMA 2JA7G 1NY4A 1HZ9A 4JOIA 3TEHB 4HJ9A 5IYDH 4GLVB 1C9OA 4LW1A 1HNXQ 1I6HH 1EOVA 4AYBG 1VQ5A 4DUZQ 2HT1A 1VQBA 1BKBA 1A0IA 3J81j 4B3SL 1U0LA 1KIXA 3KDFA 3OTOQ 1RIPA 1SLJA 4B3TQ 2EIFA 3PCOB 1JMCA 4JV5Q 1Q46A 4LUOA 1VQFA 4A3JG 1KAWA 1SR3A 1VQLA 2DGYA 1RL2A 1YEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B70 B;  1X65 A;  3A5Z B;  5LMN Q;  1PHJ A;  2IX1 A;  1FVI A;  1JJG A;  2BH8 A;  1C7Y A;  1YHA A;  3S16 H;  4BXX G;  4J15 A;  1K73 C;  3DM3 A;  1I50 H;  4GOP B;  4LF6 Q;  4X62 L;  3H3V I;  1VQK A;  3I4N H;  2JJQ A;  2V1C C;  2VZA A;  2BA0 A;  3L7Z C;  1EWI A;  2OQ0 A;  2JA8 G;  3PO2 G;  2WB1 G;  4A4I A;  2DUD A;  3RLN A;  2N3S A;  5IP9 G;  3J7A 5;  4DR4 L;  3CMA A;  1UE7 A;  4X66 Q;  1G29 1;  4P71 A;  5JEA G;  3CXC A;  2IY5 B;  2ALY B;  4NXN L;  1X6O A;  1YJW A;  1UE5 A;  1CKM A;  4GNX A;  4A3F H;  1NTG A;  1QVG A;  4LF8 Q;  1PH3 A;  5GAH C;  1N9W A;  2Q2H A;  2WAQ E;  4A93 G;  1MIU A;  4AQY Q;  1XPR A;  4LUV A;  1VQP A;  4EQ5 A;  4R4Q A;  1SRU A;  5JEA J;  1BBU A;  2Q2I A;  1K9M C;  4BY1 G;  4DV4 L;  4YCU A;  3PUX A;  1E3P A;  2CWA A;  4QY7 A;  4UP7 A;  1PH9 A;  4DV6 L;  4A3E G;  1N33 Q;  1PFS A;  1XMQ Q;  4LNQ A;  4KHP Q;  1VQJ A;  1IBL Q;  1HNW Q;  4OX9 Q;  5AJ3 Q;  2I5H A;  3WWV A;  3J7Z C;  4DV1 Q;  3U58 A;  1JT8 A;  1LTL A;  3JAM i;  2UXD L;  4A3L H;  3ER0 A;  3ULL A;  4YWL A;  2E2H H;  1FGU A;  5IYC G;  4YWM A;  1YNX A;  3ICE A;  4BBR G;  1PH4 A;  2UUA L;  5M3F G;  1S72 A;  1Y1W H;  2NN6 I;  3CPF A;  5IE8 A;  3CAM A;  2QGQ A;  4FDB A;  3RLO A;  3ZJY C;  5IYD G;  4MTN A;  4DV7 Q;  2PQA B;  4DUY L;  3STB D;  3AYH B;  3K80 C;  5C44 G;  5ELN A;  3GD7 A;  1PH6 A;  1IL2 A;  3CPW A;  1OTC A;  3M3Y H;  2N78 A;  2D0O A;  2JA7 H;  1PYB A;  2UUB L;  4YWK A;  3UE1 A;  3HOU G;  4IPD A;  3U4V A;  2Z0S A;  3PSI A;  4YCW A;  2D0P A;  4BA1 I;  2C35 B;  4K0K L;  2B3G A;  4JI1 L;  4B3S Q;  4JG2 A;  1NMG A;  1OXS C;  1HZC A;  1XTD A;  2WP8 J;  1L1O C;  3TS0 A;  2LSS A;  4DV0 L;  1E7Z A;  1TWC H;  1WOC A;  1EFW A;  3FKI G;  4B3M L;  1Q7Y C;  5FLX c;  5GAG C;  1QUQ B;  1C0A A;  1GD7 A;  1XJV A;  4OWX B;  1E1O A;  4OWW B;  2JE6 I;  2VQF L;  1KD1 C;  4BXX H;  2XTI A;  3CW2 C;  5HGQ A;  4DR2 L;  2D62 A;  2WFW A;  4LF8 L;  4PZ6 A;  1MKH A;  2HHH L;  3KOJ A;  1KHI A;  1N8R C;  3GTG H;  2YTV A;  4X62 Q;  4RG1 A;  3ULP A;  2OTL A;  3OYY A;  3D0F A;  3RLF A;  2OCE A;  2IT1 A;  2OWO A;  2GN5 A;  1AH9 A;  3ERS X;  4DR4 Q;  4LWC A;  4UP8 A;  1J5E L;  3W5O A;  4DUY Q;  2F3I A;  2HQL A;  3CCU A;  4HID A;  1TXY A;  4DR3 Q;  3UDG A;  1N36 L;  4NXN Q;  4A93 H;  2KCT A;  5IYB G;  2I0Q A;  4A3L G;  3TQY A;  4DR5 L;  1X9N A;  4POF A;  4BY1 H;  2F4V L;  3GTO H;  1CKN B;  4R4O A;  2ATW A;  2IHF A;  3W1G A;  4A3C H;  5J3B A;  1WI5 A;  1D8L A;  4MZ9 A;  4DV4 Q;  2UXC L;  2JA5 G;  5FJ8 G;  3KF6 B;  4DV6 Q;  1SN8 A;  5LMU L;  4DK3 C;  4P73 A;  3TS2 A;  4A3G G;  4GOP A;  1I3Q H;  4JC0 A;  1GKH A;  1K83 H;  1PA6 A;  2UXD Q;  2QEX A;  4NPS A;  5IYC H;  4YHH L;  2N49 A;  4BBR H;  1Q1E A;  4X6A H;  2Y0S G;  3I55 A;  4O2D A;  2N8N A;  2IHE A;  2RHQ B;  2UUA Q;  4JI4 L;  3A0J A;  3OW2 A;  2MO0 A;  4L5T A;  1L1O B;  1Q1B A;  4UP9 A;  4A3M H;  5BR8 L;  1ASZ A;  2B63 G;  4JOI C;  5C44 H;  4H02 A;  4JCV E;  2CCZ A;  4DV3 L;  2NVQ H;  4DV2 L;  3BZK A;  1L2F A;  3FHW A;  1N34 L;  2PMZ E;  4XIG S;  3BU2 A;  3HOU H;  2KEN A;  4AH6 A;  2UUB Q;  4JI7 L;  4DK6 C;  2E2I H;  3M7N A;  4JI8 L;  2K75 A;  3BJU A;  1G51 A;  4POG A;  4GLX A;  1EYG A;  3I4M H;  4IOA A;  1GM5 A;  1V43 A;  3KF8 B;  3VDY A;  3CC2 A;  4HJA A;  4K0K Q;  3T1H L;  2ZTC A;  4JI1 Q;  5IP7 G;  2PI2 E;  1VQC A;  3FKI H;  4P72 A;  1HNZ L;  1VQ6 A;  4DV0 Q;  5FLM H;  4B3M Q;  2A19 A;  2VW9 A;  3KYH C;  1E24 A;  2PQA A;  3E0E A;  3GDE A;  2KHJ A;  2ZTE A;  3KLW A;  1SE8 A;  2NN6 G;  3GO5 A;  3PUW A;  4MNO A;  4TVA B;  4DR3 L;  1EUJ A;  2VQF Q;  3CCS A;  2UU9 L;  5K36 G;  4DR2 Q;  4GS3 A;  1YJ9 A;  4ME3 A;  2R6G A;  4OO1 I;  2HHH Q;  2HIX A;  4GN5 A;  4GN4 B;  1PYS B;  4GNX C;  2R7Z G;  3GTM H;  4QGU A;  4KLK A;  2AWO A;  4BBS H;  5IY0 A;  1NMF A;  2EXD A;  3A74 A;  2JA6 H;  3KFU A;  5GAD C;  4A3C G;  2ZJQ A;  1J5E Q;  4JBJ A;  3S17 H;  3S2D H;  1WFQ A;  2K5N A;  4GKJ L;  1N36 Q;  5IYB H;  3GTK H;  2K5H A;  5JJK A;  4OWT B;  1HZB A;  4DR5 Q;  3HFZ B;  2F4V Q;  3MXN B;  2OTJ A;  1PH8 A;  1Z9F A;  2JA5 H;  5FJ8 H;  2Z6K A;  2EQS A;  4GLA C;  4JI6 L;  2UXC Q;  4A3G H;  1HZA A;  3NEL A;  1XPO A;  4JYA L;  4C3J H;  4A3M G;  2IX0 A;  2NVX H;  5LMU Q;  3KDF B;  1Q82 C;  5M5X H;  1WYD A;  2ZJR A;  1X55 A;  3S1R H;  2YYZ A;  3GTP H;  3H3V H;  1SMX A;  5GRO A;  1U5K A;  3M4O H;  1NBW A;  3L2P A;  4APV A;  3M4Q A;  1WJJ A;  2CQO A;  4YHH Q;  1UE6 A;  4NXM L;  1T9H A;  4JBM A;  3AEV A;  4JI0 L;  2B63 H;  2K52 A;  1R9T H;  4JI3 L;  4JI4 Q;  1V9P A;  2OQK A;  1K8G A;  5BR8 Q;  3T1Y L;  1VQ9 A;  3CCR A;  3W1B A;  3I4M G;  1MJE A;  1YZ6 A;  4LFB L;  1CKN A;  2JQO A;  1I5F A;  2AKW B;  4DV3 Q;  1JE5 A;  4DV2 Q;  2VUM G;  4IFD I;  5GQO A;  1N34 Q;  2I5L X;  1HJP A;  4JI7 Q;  5FLM G;  1YIJ A;  1Q81 C;  4JI8 Q;  4GNX B;  3HOZ G;  4KHZ A;  1TWA H;  2VS1 A;  1IZ6 A;  5IP7 H;  4A3I H;  1AE2 A;  1K8A C;  4IOC A;  3F2D A;  1Q8K A;  2RCN A;  4R1J A;  4YY3 L;  3T1H Q;  4LUZ A;  1G6P A;  4HJ5 A;  1HNZ Q;  1W2B A;  4DR6 L;  4C2M H;  1Y14 B;  3EBE A;  3CCJ A;  4DV5 L;  4BBS G;  3J80 i;  4P74 A;  4LFC L;  3RR5 A;  3L0O A;  3UE0 A;  4C3H H;  2JA9 A;  2JA6 G;  3PF5 A;  3M85 A;  2YV5 A;  4X65 L;  3TRE A;  4IJH A;  1YVC A;  1WCM H;  2WAQ G;  1I94 L;  1LYL A;  4EX5 A;  2UU9 Q;  3HKS A;  3UDF A;  3S1Q H;  5M5W H;  1M90 C;  4ALP A;  3GTL H;  2E8G A;  2R7Z H;  3MEF A;  3HOY G;  2BA1 A;  3CME A;  3S2H H;  1VQI A;  2MQH A;  3U4Z A;  2UUC L;  3S14 H;  3FP9 A;  4IPC A;  1OXX K;  1M1K C;  1XPU A;  2LXK A;  3CP0 A;  1V1Q A;  4GKK L;  3JAM c;  3BZC A;  3PUY A;  1TWF H;  3CCE A;  3K81 C;  1PH5 A;  1VQ8 A;  2MNA A;  5C4J H;  4X64 L;  4A3D G;  4GKJ Q;  3PO3 H;  1VQG A;  2I5M X;  4GOP C;  3K7U C;  1HR0 L;  3CC4 A;  5M3M G;  4LFA L;  1XNQ L;  2R93 H;  5IT9 c;  3G48 A;  1CKO A;  3HOV G;  3S15 H;  4JI6 Q;  1IBK L;  2AMC B;  2MFI A;  3ULJ A;  1AE3 A;  5HY6 A;  4DR7 L;  1X54 A;  1FL0 A;  3A5U A;  4JYA Q;  2HIV A;  1VQH A;  1KRT A;  5DLQ E;  4C3I H;  5M5Y H;  1PH7 A;  4IJL A;  1VQA A;  3PF4 A;  1IBM Q;  4GN3 B;  3GTQ H;  4OO1 G;  4HJ7 A;  2K50 A;  1E1T A;  4HIK A;  3RN2 A;  1S40 A;  3H0G G;  2ES2 A;  2YTX A;  3F8T A;  4NXM Q;  3I2Z A;  2ZM6 L;  4DR1 L;  1EQQ A;  5LMN W;  2CWP A;  2E5L L;  5C0X I;  3UDI A;  1KRS A;  4JI0 Q;  3F2C A;  3Q8D A;  4IO9 A;  1KC8 C;  4JI3 Q;  1L0W A;  2ASB A;  4AIM A;  3G6E A;  1VQO A;  3T1Y Q;  2VUM H;  5IWA L;  1LUZ A;  2MO1 A;  1ASY A;  4L5R C;  2K5V A;  4LFB Q;  2R92 H;  4PG3 A;  4DNI A;  2BH2 A;  2ZTD A;  4A3I G;  2JEA I;  4A3B G;  2FXQ A;  1BVS A;  3CQZ H;  1GVP A;  1DGS A;  4IPH A;  4QJF A;  2A1A A;  3HOZ H;  1Y1V G;  4LF7 L;  1Z47 A;  2Q2T A;  2NVT H;  1H95 A;  3JC6 6;  2YTY A;  1J6Q A;  4LF5 L;  3B6Y A;  4NB3 A;  4A3K G;  2UXB L;  4DKA C;  4LF4 L;  1LM0 A;  1WCM G;  2VQE L;  4HIO A;  4QL5 A;  3KJP A;  3HOX H;  1N32 L;  4UY8 C;  1OXU A;  1Q12 A;  1CUK A;  4YY3 Q;  3AFP A;  1D7Q A;  3PUZ A;  3UDX A;  1E22 A;  3J81 i;  2ID0 A;  1X3F A;  3E9I A;  4DR6 Q;  3CCL A;  3RNU A;  3J80 c;  4DV5 Q;  3SGI A;  1YHQ A;  1HR0 W;  4LFC Q;  1IXR A;  2K14 A;  3M4P A;  3STB C;  1XMO L;  4B3R L;  2ZJP A;  4WJ4 A;  1B7Y B;  4X65 Q;  1X3G A;  3RZD H;  1CSQ A;  1P8L A;  3G71 A;  1P16 A;  3F2B A;  1I94 Q;  2AWN A;  3PGZ A;  3I7F A;  3HOY H;  3D31 A;  3PIO A;  1YHB A;  5JJI A;  4PZ8 A;  4DPG A;  4IFD G;  1MJC A;  1QUQ A;  1A8V A;  1TWH H;  4JI5 Q;  1FJG L;  2VL6 A;  2QA4 A;  2A8V A;  3PO3 G;  5ELO A;  1KQS A;  1VQD A;  1IYJ B;  5EAY A;  2UUC Q;  2RHS B;  1JB7 A;  4JI2 L;  4LF9 Q;  3HOW H;  2R93 G;  3TRZ A;  1OXV A;  3IRB A;  4Y7N H;  1YJN A;  4IFD J;  1A63 A;  1VQ7 A;  4A3D H;  1JJ2 A;  2Z6K C;  5C3E H;  3AQQ A;  4XTC S;  3S1N H;  4GKK Q;  2VY3 A;  4DAY B;  1IBM L;  1A62 A;  3M9B A;  4X64 Q;  5M3M H;  2CFM A;  1PH1 A;  1UWV A;  2YU9 H;  3CCM A;  2VNU D;  3HKZ E;  4LFA Q;  1HR0 Q;  1CSP A;  1TWG H;  1XNQ Q;  3HOV H;  4P75 A;  1XNR L;  2GVA A;  3NEN A;  1YI2 A;  1IBK Q;  5C4X G;  1B8A A;  4DR7 Q;  3G4S A;  2NZO A;  2Y0S E;  3H0G H;  5H1S E;  1HNX L;  3AFQ A;  3CF5 A;  2JK8 A;  4DUZ L;  3PIP A;  4IPG A;  2R92 G;  3DLL A;  1VQE A;  3S24 A;  3KF6 A;  1PV4 A;  2RF4 A;  2ZM6 Q;  4BY7 H;  4AYB E;  3OTO L;  4DR1 Q;  2AHO B;  4B3T L;  3EN2 A;  2E5L Q;  1GO3 E;  4PMW A;  1UEB A;  4R4I A;  4JV5 L;  1S3O A;  4R4T A;  4JBW A;  3NEM A;  5IWA Q;  5LMN L;  2KBN A;  4BA2 I;  4A3B H;  3LGJ A;  3F1Z A;  3HOX G;  4L5S A;  2GVB A;  3K8A A;  4KI0 A;  4OON A;  4WJ3 M;  1VQ4 A;  1VQN A;  1L1O A;  1Y1V H;  2PI2 A;  3EIV A;  1HH2 P;  3CCQ A;  1EIF A;  4UPA A;  4LF6 L;  1UE1 A;  4LF7 Q;  2L15 A;  1K3R A;  2JEB I;  1VS0 A;  4A3J H;  4A3K H;  1QZG A;  2PNH A;  2NVY H;  3I56 A;  4LF5 Q;  3I4N G;  3K7A H;  2UXB Q;  1QZH A;  4LF4 Q;  2VQE Q;  3U50 C;  1X3E A;  4X66 L;  2WB1 E;  1N32 Q;  1QVC A;  4JI5 L;  1OXT A;  3J81 c;  1YIT A;  5E7N A;  1NJI C;  1BBW A;  3PUV A;  4PZ7 A;  3H15 A;  4LF9 L;  2E2J H;  3E9H A;  2CKZ B;  5C0X G;  4AQY L;  4A3F G;  4YCV A;  3RZO H;  4Y52 H;  2LXJ A;  2JA8 H;  1YBY A;  3HOW G;  3PO2 H;  4B3R Q;  1XMO Q;  1X56 A;  5IP9 H;  3K0X A;  2F52 A;  1K0R A;  1VCI A;  2XGT A;  1N33 L;  2K4K A;  1EQR A;  5C3E G;  1XMQ L;  4KHP L;  1HNW L;  1IBL L;  3GTJ H;  5C0X J;  2B29 A;  5AJ3 L;  4OX9 L;  4DV1 L;  1QVF A;  1FJG Q;  2NZH A;  3CD6 A;  4QQB X;  1JJC B;  4JBK A;  4QIW E;  1O7I A;  1PVO A;  4A76 A;  1EIY B;  1W3S A;  3I4O A;  4JI2 Q;  4HJ8 A;  1SRO A;  4R4C A;  4L5Q A;  2Q2U A;  1PH2 A;  4A3E H;  3S1M H;  3NBH B;  4A75 A;  4O0A A;  3HKZ G;  1VQM A;  1KL9 A;  4DV7 L;  1Y1W G;  3RN5 A;  3CC7 A;  2R7D A;  2KCM A;  3KJO A;  5JJL A;  2H5X A;  3PV0 A;  4TQU S;  4DAM A;  2KHI A;  4RMF A;  5C4X H;  5GAE C;  4BY7 G;  1KXL A;  1XNR Q;  4OXP A;  1NE3 A;  3CCV A;  1SFO H;  2R7F A;  5M3F H;  1Q86 C;  4HIM A;  2JA7 G;  1NY4 A;  1HZ9 A;  4JOI A;  3TEH B;  4HJ9 A;  5IYD H;  4GLV B;  1C9O A;  4LW1 A;  1HNX Q;  1I6H H;  1EOV A;  4AYB G;  1VQ5 A;  4DUZ Q;  2HT1 A;  1VQB A;  1BKB A;  1A0I A;  3J81 j;  4B3S L;  1U0L A;  1KIX A;  3KDF A;  3OTO Q;  1RIP A;  1SLJ A;  4B3T Q;  2EIF A;  3PCO B;  1JMC A;  4JV5 Q;  1Q46 A;  4LUO A;  1VQF A;  4A3J G;  1KAW A;  1SR3 A;  1VQL A;  2DGY A;  1RL2 A;  1YEZ A; 
#chains in the Genus database with same CATH topology
 3A5Z B;  5LMN Q;  1PHJ A;  1J9O A;  3S17 B;  1A6X A;  2DN8 A;  2K6A A;  4IUT A;  3S16 H;  1K73 C;  3A7L A;  1TWH B;  4RCN A;  1GUT A;  1VQK A;  1Y8P B;  2BA0 A;  3K5N A;  3P7J A;  4A4I A;  4X66 Q;  1G29 1;  4P71 A;  5JEA G;  3CXC A;  5C6A A;  4J6H A;  2IY5 B;  2BOS A;  2K03 A;  4A3F H;  1KAB A;  4GNX A;  2Q2H A;  2WAQ E;  5M3M B;  1A3T A;  4LUV A;  2YU9 B;  1MI2 A;  1TWG B;  5JEA J;  1ZYR D;  2DJG C;  4QY7 A;  4UP7 A;  2RSN A;  4DV6 L;  4A3E G;  1HFG A;  1LTT D;  1XMQ Q;  1IBL Q;  2I5H A;  3U58 A;  1ESF A;  3JAM i;  2EJM A;  1FNV A;  4YWL A;  4FP5 D;  3QOL A;  5E1F A;  5IYC G;  4BBR G;  5KGU A;  2UUA L;  3CPF A;  5IE8 A;  3RLO A;  5M9O A;  4MTN A;  3P75 A;  3STB D;  3K80 C;  2QCP X;  5ELN A;  3IKJ A;  1WD0 A;  2D0O A;  4R8I A;  2F0O A;  3C1F A;  4A3K B;  3U4V A;  1CZG A;  3K7A B;  4YCW A;  4BA1 I;  1RTN A;  1SEB D;  4XYQ A;  3GTL B;  1XTD A;  2WP8 J;  3OSO A;  3TS0 A;  1E7Z A;  3VR3 A;  3S14 B;  3NBH A;  1HTL D;  1C0A A;  1YNN C;  2B2U C;  4RH6 A;  3C2P A;  1TWF B;  3CW2 C;  5HGQ A;  4DR2 L;  3TN2 A;  1XYI A;  1QCB D;  1JOQ A;  4X62 Q;  4RG1 A;  2F0N A;  5DM7 3;  1F2L A;  3D0F A;  3RLF A;  2OWO A;  4QCL A;  2NN6 H;  4DR4 Q;  2HQL A;  2D9U A;  5FOB B;  4LJZ C;  4C3I B;  4NXN Q;  3S1M B;  3OMG A;  5IYB G;  2I0Q A;  2XWB B;  1HUN A;  4ZUI A;  3GTO H;  2ATW A;  2IHF A;  1QIL A;  2E75 C;  4A3C H;  4XXE A;  4DV4 Q;  2JA5 G;  1BCP C;  5LMU L;  3T53 B;  2F0K A;  1BBX C;  3TS2 A;  3ND8 A;  4GOP A;  4CBV A;  4JC0 A;  3T56 B;  2RQX A;  3L3O C;  2PO4 A;  3TZD A;  1Q1E A;  2Y0S G;  3NBI A;  2N8N A;  2CW0 D;  3OW2 A;  4A3M H;  3NP8 A;  2PZW A;  2E76 C;  3TSS A;  4DAY A;  1N34 L;  1STA A;  1GXD C;  4JI8 L;  1AW7 A;  4ZCK A;  1EIH A;  1G51 A;  1GUW A;  2F4I A;  4IOA A;  1TQO A;  4DN4 M;  3KF8 B;  3T1H L;  5KYL A;  2F03 A;  4P72 A;  2F0H A;  3NHH A;  3ZYY X;  5LL6 X;  4B3M Q;  3HOW B;  1HXY D;  1LTG D;  2NN6 G;  3GO5 A;  3H91 A;  4C3H G;  3CCS A;  1EYA A;  4ME3 A;  4OO1 I;  1BCP B;  2HHH Q;  2F0T A;  4GN5 A;  1PYS B;  4GNX C;  5LHY 1;  4QGU A;  4KLK A;  2AWO A;  3KFU A;  4A3C G;  4CKC A;  3S2D H;  1WFQ A;  2K5N A;  1Y1W B;  1SE4 A;  3MXN B;  4HTH A;  1CQF A;  3VYU A;  1Z9F A;  4JI6 L;  2X6G A;  2KA7 A;  4N9P A;  1C4Q A;  1JWU D;  2F0L A;  2OEO A;  4JYA L;  1SMY C;  4A3M G;  5M5X H;  1WYD A;  1X55 A;  2B39 A;  3V2T A;  4AYB B;  3H3V H;  3RD4 A;  3M4Q A;  2CQO A;  4YHH Q;  1O7Y A;  4JBM A;  5CV5 A;  2FFK B;  2B8F A;  4A3J B;  3CU7 A;  1EOT A;  1TWC B;  3Q23 A;  2L55 A;  3T1Y L;  1U9R A;  2M9V A;  1S4Z A;  3W1B A;  3NTK A;  1NNX A;  1MJE A;  1YZ6 A;  2OF1 A;  1CKN A;  5JJZ A;  2AKW B;  2A69 D;  3K58 A;  5GQO A;  1DOK A;  5JPM C;  1S5B D;  2NTT A;  1YIJ A;  1QWY A;  1HUM A;  1EQV A;  4GNX B;  4KHZ A;  1B53 A;  1TWA H;  1SYG A;  5BN4 A;  5IP7 H;  1JWS D;  4KTA A;  4ODG A;  3F2D A;  2RCN A;  1NSN S;  1VMP A;  4YY3 L;  4LUZ A;  5CV4 A;  5ELB A;  4HJ5 A;  4DR6 L;  4C2M H;  1Y14 B;  2K33 A;  3RR5 A;  3UE0 A;  3PF5 A;  3E6Z X;  3A54 A;  4A3E B;  5EKL A;  3HP3 A;  3P20 A;  1BOS A;  2R7Z H;  3MEF A;  3CME A;  1I3Q B;  4EQP A;  1K83 B;  3U4Z A;  1QNK A;  2UUC L;  3FP9 A;  1FNU A;  3AMU A;  1OXX K;  1M1K C;  1DJR D;  1LAB A;  3PIP 3;  4BBR B;  4GKK L;  3TP8 A;  3BZC A;  1CFM A;  3PUY A;  1PH5 A;  1VQ8 A;  4Q5V A;  4X64 L;  1LTB D;  2Z1C A;  2I5M X;  4GOP C;  3LX0 A;  2R93 H;  2XN9 C;  1CKO A;  3RUZ A;  3S15 H;  5E4W C;  4DR7 L;  1O7L A;  2E2I B;  1KRT A;  3HS0 C;  4XT3 B;  1VQA A;  1S40 A;  1SYF A;  3F8T A;  4NXM Q;  4RHR A;  3MXP A;  4TSS A;  3KUP A;  1X3Q A;  4WJW A;  3KBG A;  2E5L L;  2F0I A;  5IGG A;  4N8F A;  3Q8D A;  3F2C A;  4IO9 A;  4TKO B;  4JI3 Q;  1R4P B;  3VR6 A;  4V0B A;  3G6E A;  2TMP A;  5KNB A;  1ASY A;  4LFB Q;  2R92 H;  4PG3 A;  2E74 C;  3FPU B;  1BVS A;  1GVP A;  4QJF A;  2Q2T A;  2YTY A;  4LF5 L;  1Y8O B;  1KDB A;  1JE4 A;  3KK7 A;  2UXB L;  4DKA C;  3KLR A;  2VQE L;  4HIO A;  4QL5 A;  4DU9 A;  1N32 L;  4K2L A;  1Q12 A;  1D7Q A;  1E22 A;  4OIK A;  3J81 i;  1X3F A;  3RNU A;  1PTO C;  4LFC Q;  3A7A B;  1SDF A;  3BVZ A;  5JPN C;  2BCO A;  1B7Y B;  2A6E D;  4X65 Q;  3EFX D;  2ZJP A;  1P8L A;  4KN4 C;  2JA5 B;  5CBA E;  3D31 A;  1QUQ A;  1TWH H;  1FJG L;  2A8V A;  1EIG A;  2VL6 A;  2MPM A;  2QA4 A;  1VQD A;  1IYJ B;  4Z9C B;  3RMH A;  3M4O B;  2Y0S B;  2RHS B;  3UI2 A;  1JB7 A;  2R93 G;  3FPP A;  2ZXO A;  1OXV A;  1V1P A;  1DON A;  4XTC S;  1R9T B;  2KCN A;  4DAY B;  1GUS A;  2B8G A;  3M9B A;  5M3M H;  4NP5 A;  2K5W A;  1PH1 A;  2YU9 H;  1RKN A;  4LFA Q;  4E6I A;  1TWG H;  4P75 A;  5COY A;  1H9J A;  3ERQ A;  1K8M A;  2VXW A;  1YI2 A;  5C4X G;  5FO7 B;  1B8A A;  1ESR A;  1EZ6 A;  1HNX L;  3AFQ A;  3DMU A;  2R92 G;  1PV4 A;  4A3I B;  2ZM6 Q;  3N52 A;  4OGQ C;  2BDN A;  2JN4 A;  4B3T L;  4PMW A;  1AZP A;  4JV5 L;  1S3O A;  1STE A;  5FLX L;  1PTO B;  4C3H B;  4L5S A;  2GVB A;  5G3L D;  4MTK A;  2SDF A;  3ONA B;  3CCQ A;  3BVM A;  4UPA A;  1UE1 A;  2EDG A;  2DY7 A;  3NWS A;  2L15 A;  4A3K H;  1QZG A;  3I56 A;  3K7A H;  4ZKB B;  4LF4 Q;  1D5X C;  4FO2 A;  1TS4 A;  1BBW A;  2A73 B;  2PYK A;  4PZ7 A;  5LL6 S;  2OT2 A;  4AQY L;  4Y52 H;  4K6L A;  5CMD A;  1YBY A;  4B3R Q;  5CV8 A;  1XMO Q;  1X56 A;  1WTW A;  3K0X A;  4ABN A;  4XT1 B;  2O4X A;  4A3M B;  1VCI A;  2K4K A;  4KHP L;  1WD1 A;  1FNW A;  4OX9 L;  4HMJ A;  4DGZ A;  4U68 A;  1BXT A;  5M5Y B;  4QIW E;  3GTQ B;  2PW7 A;  3OPO A;  1SRO A;  3VYT A;  2K05 A;  3S1M H;  4A75 A;  3HKZ G;  3CC7 A;  1G6Z A;  3K59 A;  2IWH A;  1UEA B;  5JJL A;  3PV0 A;  1BF4 A;  4DAM A;  4EVO A;  3MFY A;  1PFM A;  3CCV A;  2F0M A;  1SFO H;  4ZQ3 A;  3TEH B;  1H9S A;  2NWG A;  2A6H C;  1EOV A;  4CJ0 B;  2HT1 A;  4RA8 A;  4HAE A;  1WTH A;  3KDF A;  2EY1 A;  1SLJ A;  2HCI A;  1JMC A;  5J1Z A;  1KAW A;  1QE6 A;  3DWA A;  2DGY A;  1RL2 A;  1K0R A;  5CV7 A;  3Q24 A;  4RHS A;  3S2D B;  3NK9 A;  3RZD B;  2BH8 A;  1C7Y A;  1MGS A;  2EYH A;  4J15 A;  4BXX G;  3DM3 A;  1I4G A;  3EA6 A;  2EVB A;  4LF6 Q;  3BVG A;  4QMG A;  1KLG D;  2VZA A;  3L7Z C;  1EWI A;  4FF1 A;  3W3A A;  2WB1 G;  1GHJ A;  2NBF A;  3L9A X;  4KHV A;  3CMA A;  5M5X B;  1X6O A;  1YJW A;  1CKM A;  2JSO A;  1KDC A;  2PNR C;  1PH3 A;  3PMF A;  4A93 G;  1AP0 A;  2D2C C;  2OXP A;  1VQP A;  2VB3 X;  1S5C D;  5DAU A;  1KNA A;  2Q2I A;  5ELE A;  1LT3 D;  3PUX A;  1E3P A;  4F8M A;  2HUG A;  1PH9 A;  1N33 Q;  1PFS A;  4LNQ A;  5KEE A;  3WWV A;  4DV1 Q;  1JT8 A;  1LTL A;  2UXD L;  1HA5 A;  1VF5 C;  4CHT B;  3S9W A;  3ER0 A;  2PQE A;  1FGU A;  1FYC A;  4CGY B;  1K0S A;  1Y1W H;  2QGQ A;  4FDB A;  1TWA B;  4I65 A;  1EYC A;  5DEH A;  5F2D A;  4DA2 A;  1PMR A;  4IZ8 A;  3GD7 A;  1IL2 A;  1LTA D;  2N78 A;  4C2M B;  1PYB A;  2UUB L;  1IYV A;  3UE1 A;  3VYR A;  2G9D A;  1B44 D;  1ZXT A;  4IPD A;  3K0Y A;  1ET9 A;  4PMC A;  1HRJ A;  2WAC A;  4K0K L;  4X3K A;  1FR3 A;  2B3G A;  3R8B A;  1NMG A;  1HZC A;  4WFN 3;  1BO0 A;  1EFW A;  1TWC H;  1WOC A;  4EQN A;  1STH A;  5T1G A;  4ZKC B;  5FLX c;  1QUQ B;  2I07 B;  1TVX A;  4IUQ A;  2D62 A;  2WFW A;  3KOJ A;  3WOE A;  1V1P B;  2PW5 A;  5CYU A;  1N8R C;  2R93 B;  1DM0 B;  3DHQ A;  2OCE A;  5JEA H;  1F9R A;  4LWC A;  1TS3 A;  1J5E L;  4HID A;  1N36 L;  3UDG A;  1WTP A;  2QF7 A;  3J7Y W;  3NXW A;  3C3L A;  4DR5 L;  5IGE A;  2F4V L;  5IT9 L;  4R4O A;  1X32 A;  4O1N A;  3W1G A;  5C4X B;  1WI5 A;  4MZ9 A;  3W2D A;  5IOD A;  5FJ8 G;  4DV6 Q;  1DYQ A;  3LWE A;  2PMZ B;  4DK3 C;  4RKL A;  5I9O A;  4A3G G;  2LMC B;  1I3Q H;  1PRT C;  4NMZ A;  4TRD A;  4C3J G;  1K83 H;  1EY7 A;  1I6H B;  5IYC H;  3FRP B;  1EWH A;  4BBR H;  5IT9 E;  3I55 A;  3SE0 A;  4FF4 A;  2UUA Q;  4JI4 L;  2N55 A;  3A0J A;  4UP9 A;  1LT4 D;  2EY5 A;  1YNJ C;  4JCV E;  1PZJ D;  4DV3 L;  4WOR A;  3BZK A;  3HG9 A;  5EPL A;  2EYO A;  4G57 A;  1I50 B;  4JI7 L;  2E2I H;  3AU7 A;  4J8Q A;  1LV9 A;  3BJU A;  2DY8 A;  1NAP A;  4POG A;  4GLX A;  3I4M H;  5EKI A;  1MD2 D;  4HCE A;  1E2Z A;  1V43 A;  2Z8L A;  3VDY A;  2PI2 E;  4L8J A;  1HNZ L;  2EYM A;  3Q0A A;  2LFN A;  5IGD A;  2EYF A;  3CD6 A;  3KYH C;  1E24 A;  2PQA A;  4MNO A;  2KHJ A;  1EU3 A;  3PUW A;  1O78 A;  2UU9 L;  2A5H A;  4DR2 Q;  4GS3 A;  2QIL A;  2R6G A;  1CZW A;  1EQT A;  2HIX A;  3D8G A;  4LMQ D;  1I4P A;  3VA7 A;  1UAP A;  5IY0 A;  2E2H B;  2EXD A;  3A74 A;  1I4H A;  2HD3 A;  2ZJQ A;  1CTM A;  3E5S A;  1G91 A;  1QNU A;  3HKZ B;  5IYB H;  1IKM A;  4ZYS A;  3GV6 A;  1TII D;  1H9S B;  3HFZ B;  1I4Q A;  2JA5 H;  2O5J C;  5D3I B;  2Z6K A;  3OWE B;  1HZA A;  1XPO A;  3WOF A;  3SHL A;  3KDF B;  5LMU Q;  2QEJ C;  2YYZ A;  1SMX A;  3M4O H;  1NBW A;  3L2P A;  3MAQ A;  1UE6 A;  1T9H A;  3MEH A;  1ENA A;  4JI0 L;  1R9T H;  4C56 C;  3X3M A;  1V9P A;  3DWQ A;  1K8G A;  3CCR A;  4NKL A;  3I4M G;  1I5F A;  2RBM A;  4K5W A;  1JE5 A;  2VUM G;  2ZT9 C;  2NYZ D;  1O7Z A;  4N8X 1;  1N34 Q;  3QIA A;  1HJP A;  3H09 A;  1MHW C;  3GTG B;  1VMC A;  4JI8 Q;  2WB1 B;  3HOZ G;  2F0D A;  4A3I H;  1AE2 A;  1R4Q B;  3DXJ C;  4BS9 A;  3J81 L;  3T1H Q;  4A93 B;  3I91 A;  1W2B A;  4G4K A;  4RFB A;  1DXM A;  3J80 i;  1FGB D;  1PTO H;  1I4R A;  4C3H H;  1K3B C;  1LYL A;  3S1Q H;  3UDF A;  1Q8I A;  3J81 E;  3S2H H;  4MN3 A;  3HOY G;  2SEB D;  2NUC A;  4FVM A;  4PMB A;  4CKE A;  1SFO B;  1F2Y A;  1V1Q A;  3K81 C;  4OL7 A;  2MNA A;  1YNN D;  1OO9 B;  1HR0 L;  3CC4 A;  1XNQ L;  5IT9 c;  3HOV G;  1B50 A;  5ELC A;  4JI6 Q;  1IBK L;  2AMC B;  5I9P A;  1TS5 A;  4JYA Q;  1PRT F;  3TZU A;  5DLQ E;  1PZI D;  5M5Y H;  3GTQ H;  4OO1 G;  2K50 A;  1HFN A;  3H0G G;  5CR3 A;  1JOO A;  1MBY A;  2YTX A;  3VYS A;  1EQQ A;  1Z6H A;  2CWP A;  3Q22 A;  3OWF A;  4CJ1 B;  1KRS A;  3NSW A;  3IFD A;  1F77 A;  1VQO A;  3AB9 A;  3T1Y Q;  1XX8 A;  1IHZ A;  3J7A F;  4A3I G;  3VR5 A;  1TU2 B;  5FKA C;  1BCP D;  1U4P A;  2FXQ A;  3ND9 A;  1DGS A;  4IPH A;  2A1A A;  1Y1V G;  4LF7 L;  1D5M C;  3GTM B;  4RGO S;  3HOX H;  2C5C A;  4RKB A;  1OXU A;  1ILQ A;  4YY3 Q;  1CHQ D;  4FF2 A;  3NE5 B;  4FYD A;  4DR6 Q;  3T16 A;  1EYD A;  2K14 A;  3RZD H;  3G71 A;  3OOC A;  3F2B A;  4A3G B;  4OEM B;  4DPG A;  4C3J B;  3URY A;  1MJC A;  4JI5 Q;  5KYI A;  1SND A;  1KQS A;  3IL8 A;  2XSC A;  2UUC Q;  3A8K E;  4JI2 L;  4LF9 Q;  3A8I E;  1JOR A;  1S5F D;  1DCZ A;  2Z6K C;  1I6V C;  3S1N H;  4GKK Q;  2VY3 A;  1SXT A;  3HGB A;  4X64 Q;  3BZD B;  2CFM A;  2EZV A;  1EZ8 A;  1UWV A;  1CSP A;  1ONL A;  2MJ8 A;  4EGV A;  5T1I A;  4DR7 Q;  3MVV A;  2Y0S E;  5H1S E;  4IPG A;  3T51 B;  3S24 A;  1DOL A;  2V4D A;  2AHO B;  2E5L Q;  4F88 A;  4K6D A;  4GZY C;  2E2D C;  5FK9 C;  2XWJ B;  3K5L A;  4JBW A;  1AZQ A;  2RCF A;  3NEM A;  2KBN A;  1GOZ A;  3F1Z A;  3HOX G;  4KI0 A;  1STY A;  3X3N A;  4G7O C;  1SMY D;  2CVR A;  4ME5 A;  5BN5 A;  2ZXP A;  1K3R A;  2F3W A;  2PNH A;  4LF5 Q;  2L1B A;  3I4N G;  2RSO A;  2UXB Q;  3OHX C;  2FJ2 A;  2VQE Q;  3G6J B;  1N32 Q;  1QVC A;  4JI5 L;  1OXT A;  3J81 c;  1YIT A;  1NJI C;  1DZ1 A;  4LF9 L;  2D5D A;  4X3T A;  3RZO H;  2JA8 H;  3PO2 H;  5IP9 H;  2XGT A;  1HNW L;  2B29 A;  5AJ3 L;  1FJG Q;  2B2Y C;  1JJC B;  1UNS A;  1O7I A;  2F0S A;  4A76 A;  4KKT A;  1W3S A;  3I4O A;  4DAV A;  4HJ8 A;  5EJW A;  3NQT A;  3D6W A;  5KIX A;  3NBH B;  2NTS A;  3I4M B;  4DV7 L;  1KLU D;  2PZT A;  2VUM B;  4TQU S;  4DXF A;  2KHI A;  5C4X H;  1KXL A;  3KLS X;  2EJF C;  1EY9 A;  2KCC A;  4HIM A;  3HOZ B;  2JA7 G;  4DAP A;  5EBC A;  2NVT B;  4GLV B;  1HNX Q;  1I6H H;  4IUN A;  1M4V A;  2EY6 A;  4B3S L;  1RIP A;  2A6E C;  2EIF A;  4B3T Q;  3LNN A;  4JV5 Q;  4LUO A;  1HPC A;  1NR2 A;  1ILP A;  1VQF A;  3CRL C;  1YEZ A;  1IYU A;  1B70 B;  2F3V A;  2IX1 A;  1YHA A;  2Q8T A;  4XQJ A;  3HOY B;  3OMC A;  4KJO A;  1I50 H;  4GOP B;  3H3V I;  2L0C A;  2OQ0 A;  2JA8 G;  3PO2 G;  2DUD A;  1LTS D;  2N3S A;  3ITP A;  5IP9 G;  3J7A 5;  1UE7 A;  5EPK A;  5C3E B;  1B1Z A;  3R2T A;  1NTG A;  4LF8 Q;  4AQY Q;  4EQ5 A;  3HOV B;  1SRU A;  5I6W A;  4DFA A;  1BBU A;  1K9M C;  4BY1 G;  5IIF A;  4KHP Q;  3QJY A;  3FDT A;  1E2W A;  4OX9 Q;  3J7Z C;  3H0G B;  4A3L H;  1O80 A;  1L0Y B;  3ULL A;  2E2H H;  1JR0 D;  2HDM A;  1PH4 A;  2BE5 C;  1EY5 A;  2G9H D;  2X6L A;  5C3X A;  1S72 A;  4NDX A;  2FHT A;  3ZJY C;  1PTO D;  3NTH A;  3NQI A;  5C44 G;  1ENF A;  2Q8R E;  1PH6 A;  3E0J A;  3CPW A;  1OTC A;  3M3Y H;  1M8A A;  1Y1V B;  4H0L C;  4YWK A;  2F0E A;  3LWU A;  3QR8 A;  3HOU G;  2P5Z X;  2NVY B;  3PSI A;  3S1Q B;  3QWN A;  2O2L D;  5HGT A;  4JI1 L;  3MXG A;  3S2H B;  3BG3 A;  1OXS C;  1BDO A;  2H4O A;  3Q6S A;  2KJX A;  4K2K A;  5D3D A;  4DV0 L;  1KDA A;  5FLX E;  3FKI G;  2XNA C;  5GAG C;  4OWX B;  4J1M A;  4OWW B;  2VQF L;  1KD1 C;  2B2T A;  4BXX H;  5IOC A;  4LF8 L;  4PZ6 A;  1MKH A;  4X3S A;  3VR2 A;  3GTG H;  2AUK A;  2K5Q A;  1SAP A;  1SNP A;  2ZXR A;  3N6R A;  1AH9 A;  5L37 A;  3ERS X;  3BS1 A;  4S3S A;  2F1M A;  3MXU A;  3JAM L;  3CCU A;  4DR3 Q;  4A93 H;  1II3 A;  4A3L G;  1X9N A;  4O42 A;  2LS0 1;  4POF A;  1CKN B;  4QUF A;  3BDL A;  2K04 A;  5J3B A;  1D8L A;  2UXC L;  2IW3 A;  3JAM E;  3FMC A;  1SN8 A;  4P73 A;  1IW7 C;  1SNM A;  2A68 C;  3T4A C;  4JW0 A;  1PA6 A;  2UXD Q;  2QEX A;  4JK1 C;  2N49 A;  5JAV A;  4X6A H;  4H13 C;  3SXH A;  2IHE A;  4ZRZ A;  2RHQ B;  2EXZ A;  2MO0 A;  2B63 G;  1ASZ A;  5BR8 L;  4KKS A;  4H02 A;  4IUU A;  3HOX B;  1HHV A;  3H3V C;  4DV2 L;  2PMZ E;  3BU2 A;  2RDH A;  5KRU A;  1PLF A;  4AH6 A;  2UUB Q;  2AUJ D;  4DK6 C;  3GP7 A;  5EBD A;  3I4N B;  2K75 A;  3CC2 A;  4HJA A;  4K0K Q;  2F0U A;  2K1B A;  2ZTC A;  1F2Z A;  5NUC A;  5I2X A;  1C48 A;  3J80 L;  5ELD A;  2A19 A;  2VW9 A;  2AQ2 B;  3GDE A;  1Q86 C;  2ZTE A;  1SE8 A;  1XTC D;  1A3V A;  4TVA B;  5C5M A;  1EUJ A;  4DR3 L;  3S1N B;  5CC4 A;  1EY6 A;  1X3P A;  3I72 A;  4R9W A;  4K5V A;  2RDF A;  3J80 E;  4X3U A;  2A6H D;  3GTM H;  4HCS A;  3U9O A;  4CJ2 C;  5TSS A;  1LTI D;  2J4X A;  4KK7 A;  4JBJ A;  1J5E Q;  3C1E A;  3K6O A;  4GKJ L;  1N36 Q;  2G5D A;  3GTK H;  4OWT B;  4DR5 Q;  2F4V Q;  1PH8 A;  5FJ8 H;  1UUP A;  2B2V C;  2EQS A;  4GLA C;  2KED A;  4A3G H;  1V1O A;  2JA7 B;  3NEL A;  4C3J H;  2NVX H;  3BDO A;  1ROD A;  1Q82 C;  4DNR B;  1U5K A;  4APV A;  4RGN A;  3AEV A;  2R61 A;  5K5P A;  1SNQ A;  2K52 A;  4ZK9 B;  5CV9 A;  4JI4 Q;  1JC7 A;  2OQK A;  1LT6 D;  5G3L F;  4N9T A;  3SDZ A;  1VQ9 A;  1WTR A;  2JQO A;  4DV3 Q;  1CK1 A;  1H9K A;  2CHB D;  4IFD I;  1SE3 A;  1VDZ A;  2I5L X;  1SYD A;  4JI7 Q;  3RZO B;  1Q81 C;  2JA8 B;  2GA4 B;  3PO2 B;  2NB0 A;  1JCK B;  2B2T C;  1Q8K A;  1TY2 A;  1PFB A;  1HNZ Q;  4DV5 L;  4P74 A;  4BY1 B;  3L0O A;  2JA9 A;  3M85 A;  2YV5 A;  3TRE A;  1WCM H;  2WAQ G;  1I94 L;  1U4L A;  1EY0 A;  4FXG C;  2UU9 Q;  3HKS A;  4QIW B;  4ALP A;  2E8G A;  2BA1 A;  3K5O A;  2K01 A;  5I4D A;  4C1N I;  4IPC A;  5D65 A;  4RWS C;  2EJG C;  1ET6 A;  5FO9 B;  1KTK A;  3DUZ A;  4DK1 A;  3JAM c;  3BDC A;  3CCE A;  4A3D G;  5C4J H;  3PO3 H;  3R2I A;  5C44 B;  5JVG 3;  2NVQ B;  1EEF D;  3G48 A;  2TSS A;  2WKC A;  2MFI A;  1F9P A;  3HOU B;  1X54 A;  1FL0 A;  3A5U A;  1AFP A;  2HIV A;  1VQH A;  4XYO A;  1SYC A;  2HDL A;  1NCV A;  4IJL A;  4KKU A;  3VA5 A;  1IBM Q;  1E1T A;  4M1U B;  3SK4 A;  4ZUJ A;  2MUY A;  4M8A A;  4DR1 L;  4HSV A;  5C0X I;  3UDI A;  1JB3 A;  3FKI B;  4JI0 Q;  2H1E A;  2XIW A;  1KC8 C;  1W6J A;  2ASB A;  4MHE A;  4AIM A;  2VUM H;  5IWA L;  1H9R A;  1LUZ A;  1CM9 A;  2MO1 A;  4L5R C;  2K5V A;  2ZTD A;  1ZYR C;  1SE2 A;  4A3B G;  4KN7 C;  1HQM C;  2KOL A;  1TR5 A;  3HOZ H;  3I3C A;  1Z47 A;  1D5Z C;  2NVT H;  1H95 A;  1J6Q A;  4B9W A;  4I7Z C;  1WCM G;  3KJP A;  1TS2 A;  3AFP A;  1PRT B;  2F0J A;  3PUZ A;  2CQA A;  3J80 c;  1BR9 A;  1YNJ D;  3SGI A;  1YHQ A;  3DEP A;  1IXR A;  3STB C;  4XQN A;  4WJ4 A;  1P16 A;  2AWN A;  2Z6B A;  3I7F A;  3HOY H;  5JJI A;  3PIO A;  2FMM A;  3KLS A;  3PO3 G;  5CBE E;  3S1R B;  5ELO A;  3GTP B;  3H6M A;  1BQQ T;  3M3Y B;  1LO5 D;  3MFG A;  1SJH D;  5J39 A;  5KNC A;  1VQ7 A;  4K5X A;  5C3E H;  3AQQ A;  1EFI D;  5JOB A;  2B63 B;  2HQE A;  1IBM L;  1A62 A;  1EY8 A;  3TP7 A;  1CHP D;  3CCM A;  3HOV H;  1HR0 Q;  2VNU D;  1XNQ Q;  2SOB A;  1RD9 D;  3OIQ A;  1XNR L;  1F9S A;  2GVA A;  3NEN A;  1IBK Q;  2Z4I A;  4K8I A;  4OO1 H;  3A8J E;  3H0G H;  1QOH A;  2XRQ D;  4RCO A;  3PIP A;  4DUZ L;  1GUG A;  3KF6 A;  2RF4 A;  4BY7 H;  4AYB E;  3OTO L;  1E2V A;  1T5X D;  3EN2 A;  2KHS A;  4R4I A;  2I46 A;  2WKD A;  3MHB A;  1GJX A;  5LMN L;  1Y69 U;  3K8A A;  4OON A;  4WJ3 M;  1VQ4 A;  2F0Q A;  1L1O A;  1VQN A;  1Y1V H;  1EY4 A;  3GQB A;  1HH2 P;  5M5W B;  1EIF A;  1NUC A;  4LF7 Q;  4KY7 A;  4G7H C;  2JEB I;  1ICW A;  1VS0 A;  2MHV A;  2NVY H;  3NUC A;  2F0G A;  2QDB A;  1C8C A;  1QZH A;  4IUR A;  4X66 L;  5E7N A;  2CW0 C;  1F9Q A;  3K57 A;  2JP1 A;  3E9H A;  4A3F G;  4YCV A;  2LXJ A;  2VB2 X;  5DNF A;  3BYT B;  4IN3 A;  4HSP A;  2B2Y A;  1A2T A;  5C3E G;  4CDE C;  1XMQ L;  3MA2 B;  5J22 A;  1IBL L;  2EY2 A;  1SYB A;  1A15 A;  2IJ0 A;  2NZH A;  3ERO A;  4QQB X;  4ULL A;  4F87 A;  3T13 A;  1PVO A;  4ID6 A;  4JI2 Q;  1RDP D;  2X69 A;  4R4C A;  4L5Q A;  1PH2 A;  3OW7 A;  4O0A A;  4RGT A;  2ICE C;  2R7D A;  4FXK C;  3KJO A;  4QUC A;  5EPJ A;  2H5X A;  1D1K A;  4RMF A;  4QB4 A;  4BY7 G;  1SNC A;  1ML0 D;  1NE3 A;  3CQZ B;  5M3F H;  1NY4 A;  4JPB W;  4JOI A;  2KEC A;  3A56 A;  4B08 A;  1B4O A;  3CKI B;  4HJ9 A;  5IYD H;  1C9O A;  4LW1 A;  4QF4 A;  1VQ5 A;  1VQB A;  1BKB A;  3MZ5 A;  2SNM A;  5EGT A;  3D3R A;  1U0L A;  5D14 A;  2Z9H A;  1WTV A;  5HUR A;  2J7Z A;  4CDD C;  1WTQ A;  5EQ0 A;  1D2B A;  2WAQ B;  1X65 A;  5A35 A;  1ZEQ X;  1FVI A;  3SR1 A;  1JJG A;  3R3O A;  4K14 A;  3GTK B;  2KQ3 A;  1RCV D;  2QDL A;  4X62 L;  1STN A;  1S5D D;  3I4N H;  1IKL A;  2JJQ A;  2V1C C;  5BN3 A;  2PCF B;  1I4X A;  4DR4 L;  1V8Q A;  3RLN A;  4WRD A;  4Y7N B;  4KY5 A;  2NVX B;  4A3D B;  2ALY B;  4NXN L;  1STB A;  3CHB D;  1UE5 A;  4CDC C;  3FVQ A;  1QVG A;  5GAH C;  1N9W A;  1HQR D;  1MIU A;  4KD4 A;  1XPR A;  1EU4 A;  1RHP A;  4R4Q A;  1SSO A;  2A69 C;  4DV4 L;  4YCU A;  5A2Q L;  2CWA A;  1ZKO A;  1HNW Q;  2SNS A;  3BYY B;  5ISR A;  1VQJ A;  1E0B A;  5AJ3 Q;  4HR7 B;  3O13 A;  4FXD A;  4Q0F A;  4YWM A;  1YNX A;  3MWY W;  3ICE A;  5A2Q E;  5M3F G;  1Q3L A;  2NN6 I;  3CAM A;  5IYD G;  4DV7 Q;  3I73 A;  2PQA B;  2XRS D;  3AYH B;  1WVL A;  4A3B B;  3DEO A;  1B9M A;  1PDQ A;  4KJN A;  5KND A;  4C1N K;  2JA7 H;  3SK6 A;  4CKB A;  2Z0S A;  2O5I C;  1WCM B;  3E3X A;  2K5D A;  2D0P A;  2C35 B;  2RA4 A;  4B3S Q;  4JG2 A;  1Y8N B;  3NPP A;  1L1O C;  2LSS A;  2F0P A;  3SVM A;  3PIO 3;  4B3M L;  2E2J B;  1Q7Y C;  5DM6 3;  1GD7 A;  1XJV A;  1E1O A;  4JVZ A;  1QB5 D;  2JE6 I;  1JWM D;  2XTI A;  5C4J B;  1G8Z D;  1KAA A;  2HHH L;  3GTJ B;  3PO3 B;  1KHI A;  3D4W A;  2YTV A;  3ULP A;  4YIJ A;  2OTL A;  1NR4 A;  3OYY A;  5ELF A;  2IT1 A;  2GN5 A;  3J7A V;  4UP8 A;  2EYL A;  3W5O A;  4DUY Q;  5K36 H;  1D1I A;  2F3I A;  1TXY A;  4UHV A;  4KV6 A;  4CDF C;  2KCT A;  2K28 A;  1TT2 A;  2LKV A;  1XXG A;  3TQY A;  4BY1 H;  1HCZ A;  5E3F A;  2IPK D;  4OEL B;  3KF6 B;  1A2U A;  3K5M A;  3V05 A;  1SYE A;  2IL8 A;  1GKH A;  1Q90 A;  3HZX A;  3TP5 A;  1LT5 D;  4NPS A;  4YHH L;  4UAI A;  3A55 A;  4HED A;  4O2D A;  1EEI D;  5I2Y A;  1B3A A;  1D6E C;  4L5T A;  1FD7 D;  1L1O B;  1Q1B A;  2DJF C;  1BCP F;  4JOI C;  5C44 H;  3U9S A;  2CCZ A;  2NVQ H;  3I90 A;  3TBI B;  1QJO A;  1L2F A;  2JYO A;  2LY7 A;  3FHW A;  2M00 A;  3S16 B;  4XIG S;  4BWG B;  2DNC A;  3HOU H;  2KEN A;  3D4R A;  3M7N A;  4IUV A;  4DK0 A;  1HTP A;  1EYG A;  1GM5 A;  1B2T A;  2FMC A;  1MSH A;  4JI1 Q;  5IP7 G;  2N88 A;  1VQC A;  3FKI H;  1S5E D;  2MP1 A;  2PPB C;  4LAA A;  4A3F B;  1VQ6 A;  4DV0 Q;  2BDO A;  2PZU A;  5FLM H;  1KNE A;  5FO8 B;  3E0E A;  4DUY L;  3G7L A;  3KLW A;  2VQF Q;  1B9N A;  5K36 G;  3QB3 A;  1YJ9 A;  4UDU C;  4GN4 B;  4OHJ A;  1EL0 A;  2R7Z G;  4BBS H;  1NMF A;  1HA6 A;  2JA6 H;  2M2L A;  2L5T A;  5GAD C;  4ZLT F;  4RAU C;  3S17 H;  5C5L A;  3DM1 A;  2IX3 A;  2K5H A;  3TP6 A;  2B2V A;  5JVH 3;  5JJK A;  1HZB A;  4BY7 B;  3I8Z A;  2OTJ A;  4IQZ A;  2UXC Q;  2IX0 A;  3EJI A;  4IUP A;  2L12 A;  2ZJR A;  1LTR D;  2XVS A;  4H44 C;  3S1R H;  3GTP H;  1PFN A;  5GRO A;  4L63 B;  3MTS A;  1WJJ A;  1STG A;  4NXM L;  3VR4 A;  2F0F A;  1TY0 A;  1T5E A;  2B63 H;  4FNF A;  4JI3 L;  1H9M A;  1CT1 D;  5BR8 Q;  2HCC A;  2KEE A;  1U4R A;  4LFB L;  4KY6 A;  4DV2 Q;  1JQY D;  3D4D A;  4K8J A;  5FLM G;  2EE1 A;  1CI3 M;  3R93 A;  3FEW X;  1L0X B;  1BUV T;  2VS1 A;  3DWP A;  1IZ6 A;  1K8A C;  4IOC A;  2BE5 D;  2EYP A;  4R1J A;  3SK5 A;  1G6P A;  1AEX A;  1W6K A;  4L6T B;  4PQX A;  1GHK A;  3EBE A;  2L4N A;  3IFT A;  3CCJ A;  4BBS G;  4KD3 A;  4LFC L;  5I6Y A;  3GTO B;  2JA6 G;  3PQI A;  4X65 L;  2B2W A;  1MSG A;  1YVC A;  4IJH A;  2EYJ A;  4LK1 C;  4EX5 A;  2EPB A;  4R8N A;  5M5W H;  1M90 C;  2WII B;  3GTL H;  1ICF B;  1VQI A;  1AN8 A;  2MQH A;  3S14 H;  1XPU A;  2LXK A;  4U67 3;  5M3F B;  2KUM A;  3CP0 A;  1IL8 A;  1DOM A;  2WV6 D;  1TWF H;  4GKJ Q;  5AFW A;  4IFD H;  2CH4 W;  1VQG A;  3NWT A;  4EQO A;  3K7U C;  4LFA L;  5M3M G;  1U4M A;  4H7B A;  3ULJ A;  1AE3 A;  2ICI A;  5HY6 A;  1K28 A;  3F2U A;  1RJT A;  2C9O A;  3EQL C;  4C3I H;  1PH7 A;  2K7V A;  3PF4 A;  4GN3 B;  4HJ7 A;  4HIK A;  3RN2 A;  2ES2 A;  1DD2 A;  3I2Z A;  2ZM6 L;  3M7G A;  5LMN W;  1CQV A;  1L0W A;  5C4Z A;  3D6C A;  4DNI A;  2BH2 A;  2Q8I B;  2JEA I;  3WDN A;  4DNT B;  2FIN B;  4IAL A;  4V19 0;  3CQZ H;  4OIJ A;  1IW7 D;  2A68 D;  3JC6 6;  3OIP A;  5COR A;  3B6Y A;  4NB3 A;  4A3K G;  4LF4 L;  1LM0 A;  3MC0 B;  4UY8 C;  4I7A A;  1CUK A;  1K8O A;  3UDX A;  2ID0 A;  3E9I A;  2JXM B;  4B9X A;  3CCL A;  3I70 A;  4DV5 Q;  1HR0 W;  4B3R L;  3M4P A;  1SNO A;  1XMO L;  1X3G A;  1CSQ A;  1G2T A;  1I94 Q;  1PZK D;  3PGZ A;  4HMI A;  1YHB A;  4PZ8 A;  5C3W A;  4IFD G;  2RKS A;  1A8V A;  3QO2 A;  2L11 A;  1G2S A;  1F2M A;  5IGB A;  5C0X H;  5EAY A;  3C46 A;  1PYW D;  1PTO F;  3HOW H;  3TRZ A;  3IRB A;  4Y7N H;  2MGS A;  1YJN A;  4IFD J;  3H94 A;  1A63 A;  4A3D H;  1JJ2 A;  5E4X A;  3QG1 A;  4C3I G;  4NW2 A;  3HKZ E;  1B3Q A;  4XDX A;  2Z4H A;  2QW7 A;  2ENB A;  2L9H A;  1BNZ A;  1SBB B;  2F0W A;  3G4S A;  2NZO A;  4ILW A;  4HN7 A;  3CF5 A;  2JK8 A;  4P2C B;  1ENC A;  3DLL A;  1VQE A;  2J0T D;  2NZ1 D;  2K32 A;  3P1H A;  4DR1 Q;  4PNY A;  1GO3 E;  1UEB A;  1XWE A;  3V96 A;  4ZAI A;  4R4T A;  2RVL A;  1CA6 A;  3GV3 A;  4XQQ A;  3IAY A;  5IWA Q;  4BA2 I;  4A3B H;  3LGJ A;  3TME A;  2PI2 A;  3EIV A;  1EWC A;  4LF6 L;  2AQ1 B;  2R7Z B;  1RTO A;  1Z7T A;  2EOT A;  5IGF A;  3QOJ A;  4A3J H;  1J8I A;  2B2U A;  2QKI C;  1VF7 A;  3U50 C;  1X3E A;  3EVQ A;  2B2W C;  5C4H A;  2WB1 E;  2A74 C;  4G7Z C;  3SEB A;  1CA5 A;  3PUV A;  3H15 A;  2E2J H;  1A3U A;  2CKZ B;  5C0X G;  4RGM A;  4PV1 C;  1GUO A;  3KF8 A;  3HOW G;  5IGC A;  1LAC A;  3S15 B;  2F52 A;  1QG7 A;  3HRZ C;  3I4L A;  1N33 L;  1EQR A;  1TKW B;  2WIN B;  5C0X J;  3GTJ H;  4DV1 L;  1QVF A;  3M4Y A;  1JOK A;  4JBK A;  1LLR D;  4KMU C;  4DF7 A;  2KVM A;  1EIY B;  2AQ3 B;  4DXG A;  2Q2U A;  4A3E H;  1GUN A;  4MIU A;  1RF2 D;  4F7X A;  2RDG A;  1VQM A;  1KL9 A;  5EKK A;  4FF3 A;  1Y1W G;  3RN5 A;  1PXU A;  1JIC A;  2KCM A;  3CRK C;  2R92 B;  5GAE C;  1WTO A;  1XNR Q;  3HEJ A;  4OXP A;  2R7F A;  3SK8 A;  1HZ9 A;  3MXN A;  1WTX A;  4AYB G;  4DUZ Q;  1A0I A;  3J81 j;  2F0V A;  1KIX A;  3OTO Q;  1PRT D;  3KBX A;  2R3Z A;  5CGK A;  1SJE D;  3PCO B;  1Q46 A;  4BBS B;  2DNE A;  2CH4 A;  4A3J G;  1VQL A;  1SR3 A;  5CV6 A;  2JA6 B;  3TDQ A;  3NTI A; 
#chains in the Genus database with same CATH homology
 1B70 B;  1X65 A;  3A5Z B;  5LMN Q;  1PHJ A;  2IX1 A;  1FVI A;  1JJG A;  2BH8 A;  1C7Y A;  1YHA A;  3S16 H;  4BXX G;  4J15 A;  1K73 C;  3DM3 A;  1I50 H;  4GOP B;  4LF6 Q;  4X62 L;  3H3V I;  1VQK A;  3I4N H;  2JJQ A;  2V1C C;  2VZA A;  2BA0 A;  3L7Z C;  1EWI A;  2OQ0 A;  2JA8 G;  3PO2 G;  2WB1 G;  4A4I A;  2DUD A;  3RLN A;  2N3S A;  5IP9 G;  3J7A 5;  4DR4 L;  3CMA A;  1UE7 A;  4X66 Q;  1G29 1;  4P71 A;  5JEA G;  3CXC A;  2IY5 B;  2ALY B;  4NXN L;  1X6O A;  1YJW A;  1UE5 A;  1CKM A;  4GNX A;  4A3F H;  1NTG A;  1QVG A;  4LF8 Q;  1PH3 A;  5GAH C;  1N9W A;  2Q2H A;  2WAQ E;  4A93 G;  1MIU A;  4AQY Q;  1XPR A;  4LUV A;  1VQP A;  4EQ5 A;  4R4Q A;  1SRU A;  5JEA J;  1BBU A;  2Q2I A;  1K9M C;  4BY1 G;  4DV4 L;  4YCU A;  3PUX A;  1E3P A;  2CWA A;  4QY7 A;  4UP7 A;  1PH9 A;  4DV6 L;  4A3E G;  1N33 Q;  1PFS A;  1XMQ Q;  4LNQ A;  4KHP Q;  1VQJ A;  1IBL Q;  1HNW Q;  4OX9 Q;  5AJ3 Q;  2I5H A;  3WWV A;  3J7Z C;  4DV1 Q;  3U58 A;  1JT8 A;  1LTL A;  3JAM i;  2UXD L;  4A3L H;  3ER0 A;  3ULL A;  4YWL A;  2E2H H;  1FGU A;  5IYC G;  4YWM A;  1YNX A;  3ICE A;  4BBR G;  1PH4 A;  2UUA L;  5M3F G;  1S72 A;  1Y1W H;  2NN6 I;  3CPF A;  5IE8 A;  3CAM A;  2QGQ A;  4FDB A;  3RLO A;  3ZJY C;  5IYD G;  4MTN A;  4DV7 Q;  2PQA B;  4DUY L;  3STB D;  3AYH B;  3K80 C;  5C44 G;  5ELN A;  3GD7 A;  1PH6 A;  1IL2 A;  3CPW A;  1OTC A;  3M3Y H;  2N78 A;  2D0O A;  2JA7 H;  1PYB A;  2UUB L;  4YWK A;  3UE1 A;  3HOU G;  4IPD A;  3U4V A;  2Z0S A;  3PSI A;  4YCW A;  2D0P A;  4BA1 I;  2C35 B;  4K0K L;  2B3G A;  4JI1 L;  4B3S Q;  4JG2 A;  1NMG A;  1OXS C;  1HZC A;  1XTD A;  2WP8 J;  1L1O C;  3TS0 A;  2LSS A;  4DV0 L;  1E7Z A;  1TWC H;  1WOC A;  1EFW A;  3FKI G;  4B3M L;  1Q7Y C;  5FLX c;  5GAG C;  1QUQ B;  1C0A A;  1GD7 A;  1XJV A;  4OWX B;  1E1O A;  4OWW B;  2JE6 I;  2VQF L;  1KD1 C;  4BXX H;  2XTI A;  3CW2 C;  5HGQ A;  4DR2 L;  2D62 A;  2WFW A;  4LF8 L;  4PZ6 A;  1MKH A;  2HHH L;  3KOJ A;  1KHI A;  1N8R C;  3GTG H;  2YTV A;  4X62 Q;  4RG1 A;  3ULP A;  2OTL A;  3OYY A;  3D0F A;  3RLF A;  2OCE A;  2IT1 A;  2OWO A;  2GN5 A;  1AH9 A;  3ERS X;  4DR4 Q;  4LWC A;  4UP8 A;  1J5E L;  3W5O A;  4DUY Q;  2F3I A;  2HQL A;  3CCU A;  4HID A;  1TXY A;  4DR3 Q;  3UDG A;  1N36 L;  4NXN Q;  4A93 H;  2KCT A;  5IYB G;  2I0Q A;  4A3L G;  3TQY A;  4DR5 L;  1X9N A;  4POF A;  4BY1 H;  2F4V L;  3GTO H;  1CKN B;  4R4O A;  2ATW A;  2IHF A;  3W1G A;  4A3C H;  5J3B A;  1WI5 A;  1D8L A;  4MZ9 A;  4DV4 Q;  2UXC L;  2JA5 G;  5FJ8 G;  3KF6 B;  4DV6 Q;  1SN8 A;  5LMU L;  4DK3 C;  4P73 A;  3TS2 A;  4A3G G;  4GOP A;  1I3Q H;  4JC0 A;  1GKH A;  1K83 H;  1PA6 A;  2UXD Q;  2QEX A;  4NPS A;  5IYC H;  4YHH L;  2N49 A;  4BBR H;  1Q1E A;  4X6A H;  2Y0S G;  3I55 A;  4O2D A;  2N8N A;  2IHE A;  2RHQ B;  2UUA Q;  4JI4 L;  3A0J A;  3OW2 A;  2MO0 A;  4L5T A;  1L1O B;  1Q1B A;  4UP9 A;  4A3M H;  5BR8 L;  1ASZ A;  2B63 G;  4JOI C;  5C44 H;  4H02 A;  4JCV E;  2CCZ A;  4DV3 L;  2NVQ H;  4DV2 L;  3BZK A;  1L2F A;  3FHW A;  1N34 L;  2PMZ E;  4XIG S;  3BU2 A;  3HOU H;  2KEN A;  4AH6 A;  2UUB Q;  4JI7 L;  4DK6 C;  2E2I H;  3M7N A;  4JI8 L;  2K75 A;  3BJU A;  1G51 A;  4POG A;  4GLX A;  1EYG A;  3I4M H;  4IOA A;  1GM5 A;  1V43 A;  3KF8 B;  3VDY A;  3CC2 A;  4HJA A;  4K0K Q;  3T1H L;  2ZTC A;  4JI1 Q;  5IP7 G;  2PI2 E;  1VQC A;  3FKI H;  4P72 A;  1HNZ L;  1VQ6 A;  4DV0 Q;  5FLM H;  4B3M Q;  2A19 A;  2VW9 A;  3KYH C;  1E24 A;  2PQA A;  3E0E A;  3GDE A;  2KHJ A;  2ZTE A;  3KLW A;  1SE8 A;  2NN6 G;  3GO5 A;  3PUW A;  4MNO A;  4TVA B;  4DR3 L;  1EUJ A;  2VQF Q;  3CCS A;  2UU9 L;  5K36 G;  4DR2 Q;  4GS3 A;  1YJ9 A;  4ME3 A;  2R6G A;  4OO1 I;  2HHH Q;  2HIX A;  4GN5 A;  4GN4 B;  1PYS B;  4GNX C;  2R7Z G;  3GTM H;  4QGU A;  4KLK A;  2AWO A;  4BBS H;  5IY0 A;  1NMF A;  2EXD A;  3A74 A;  2JA6 H;  3KFU A;  5GAD C;  4A3C G;  2ZJQ A;  1J5E Q;  4JBJ A;  3S17 H;  3S2D H;  1WFQ A;  2K5N A;  4GKJ L;  1N36 Q;  5IYB H;  3GTK H;  2K5H A;  5JJK A;  4OWT B;  1HZB A;  4DR5 Q;  3HFZ B;  2F4V Q;  3MXN B;  2OTJ A;  1PH8 A;  1Z9F A;  2JA5 H;  5FJ8 H;  2Z6K A;  2EQS A;  4GLA C;  4JI6 L;  2UXC Q;  4A3G H;  1HZA A;  3NEL A;  1XPO A;  4JYA L;  4C3J H;  4A3M G;  2IX0 A;  2NVX H;  5LMU Q;  3KDF B;  1Q82 C;  5M5X H;  1WYD A;  2ZJR A;  1X55 A;  3S1R H;  2YYZ A;  3GTP H;  3H3V H;  1SMX A;  5GRO A;  1U5K A;  3M4O H;  1NBW A;  3L2P A;  4APV A;  3M4Q A;  1WJJ A;  2CQO A;  4YHH Q;  1UE6 A;  4NXM L;  1T9H A;  4JBM A;  3AEV A;  4JI0 L;  2B63 H;  2K52 A;  1R9T H;  4JI3 L;  4JI4 Q;  1V9P A;  2OQK A;  1K8G A;  5BR8 Q;  3T1Y L;  1VQ9 A;  3CCR A;  3W1B A;  3I4M G;  1MJE A;  1YZ6 A;  4LFB L;  1CKN A;  2JQO A;  1I5F A;  2AKW B;  4DV3 Q;  1JE5 A;  4DV2 Q;  2VUM G;  4IFD I;  5GQO A;  1N34 Q;  2I5L X;  1HJP A;  4JI7 Q;  5FLM G;  1YIJ A;  1Q81 C;  4JI8 Q;  4GNX B;  3HOZ G;  4KHZ A;  1TWA H;  2VS1 A;  1IZ6 A;  5IP7 H;  4A3I H;  1AE2 A;  1K8A C;  4IOC A;  3F2D A;  1Q8K A;  2RCN A;  4R1J A;  4YY3 L;  3T1H Q;  4LUZ A;  1G6P A;  4HJ5 A;  1HNZ Q;  1W2B A;  4DR6 L;  4C2M H;  1Y14 B;  3EBE A;  3CCJ A;  4DV5 L;  4BBS G;  3J80 i;  4P74 A;  4LFC L;  3RR5 A;  3L0O A;  3UE0 A;  4C3H H;  2JA9 A;  2JA6 G;  3PF5 A;  3M85 A;  2YV5 A;  4X65 L;  3TRE A;  4IJH A;  1YVC A;  1WCM H;  2WAQ G;  1I94 L;  1LYL A;  4EX5 A;  2UU9 Q;  3HKS A;  3UDF A;  3S1Q H;  5M5W H;  1M90 C;  4ALP A;  3GTL H;  2E8G A;  2R7Z H;  3MEF A;  3HOY G;  2BA1 A;  3CME A;  3S2H H;  1VQI A;  2MQH A;  3U4Z A;  2UUC L;  3S14 H;  3FP9 A;  4IPC A;  1OXX K;  1M1K C;  1XPU A;  2LXK A;  3CP0 A;  1V1Q A;  4GKK L;  3JAM c;  3BZC A;  3PUY A;  1TWF H;  3CCE A;  3K81 C;  1PH5 A;  1VQ8 A;  2MNA A;  5C4J H;  4X64 L;  4A3D G;  4GKJ Q;  3PO3 H;  1VQG A;  2I5M X;  4GOP C;  3K7U C;  1HR0 L;  3CC4 A;  5M3M G;  4LFA L;  1XNQ L;  2R93 H;  5IT9 c;  3G48 A;  1CKO A;  3HOV G;  3S15 H;  4JI6 Q;  1IBK L;  2AMC B;  2MFI A;  3ULJ A;  1AE3 A;  5HY6 A;  4DR7 L;  1X54 A;  1FL0 A;  3A5U A;  4JYA Q;  2HIV A;  1VQH A;  1KRT A;  5DLQ E;  4C3I H;  5M5Y H;  1PH7 A;  4IJL A;  1VQA A;  3PF4 A;  1IBM Q;  4GN3 B;  3GTQ H;  4OO1 G;  4HJ7 A;  2K50 A;  1E1T A;  4HIK A;  3RN2 A;  1S40 A;  3H0G G;  2ES2 A;  2YTX A;  3F8T A;  4NXM Q;  3I2Z A;  2ZM6 L;  4DR1 L;  1EQQ A;  5LMN W;  2CWP A;  2E5L L;  5C0X I;  3UDI A;  1KRS A;  4JI0 Q;  3F2C A;  3Q8D A;  4IO9 A;  1KC8 C;  4JI3 Q;  1L0W A;  2ASB A;  4AIM A;  3G6E A;  1VQO A;  3T1Y Q;  2VUM H;  5IWA L;  1LUZ A;  2MO1 A;  1ASY A;  4L5R C;  2K5V A;  4LFB Q;  2R92 H;  4PG3 A;  4DNI A;  2BH2 A;  2ZTD A;  4A3I G;  2JEA I;  4A3B G;  2FXQ A;  1BVS A;  3CQZ H;  1GVP A;  1DGS A;  4IPH A;  4QJF A;  2A1A A;  3HOZ H;  1Y1V G;  4LF7 L;  1Z47 A;  2Q2T A;  2NVT H;  1H95 A;  3JC6 6;  2YTY A;  1J6Q A;  4LF5 L;  3B6Y A;  4NB3 A;  4A3K G;  2UXB L;  4DKA C;  4LF4 L;  1LM0 A;  1WCM G;  2VQE L;  4HIO A;  4QL5 A;  3KJP A;  3HOX H;  1N32 L;  4UY8 C;  1OXU A;  1Q12 A;  1CUK A;  4YY3 Q;  3AFP A;  1D7Q A;  3PUZ A;  3UDX A;  1E22 A;  3J81 i;  2ID0 A;  1X3F A;  3E9I A;  4DR6 Q;  3CCL A;  3RNU A;  3J80 c;  4DV5 Q;  3SGI A;  1YHQ A;  1HR0 W;  4LFC Q;  1IXR A;  2K14 A;  3M4P A;  3STB C;  1XMO L;  4B3R L;  2ZJP A;  4WJ4 A;  1B7Y B;  4X65 Q;  1X3G A;  3RZD H;  1CSQ A;  1P8L A;  3G71 A;  1P16 A;  3F2B A;  1I94 Q;  2AWN A;  3PGZ A;  3I7F A;  3HOY H;  3D31 A;  3PIO A;  1YHB A;  5JJI A;  4PZ8 A;  4DPG A;  4IFD G;  1MJC A;  1QUQ A;  1A8V A;  1TWH H;  4JI5 Q;  1FJG L;  2VL6 A;  2QA4 A;  2A8V A;  3PO3 G;  5ELO A;  1KQS A;  1VQD A;  1IYJ B;  5EAY A;  2UUC Q;  2RHS B;  1JB7 A;  4JI2 L;  4LF9 Q;  3HOW H;  2R93 G;  3TRZ A;  1OXV A;  3IRB A;  4Y7N H;  1YJN A;  4IFD J;  1A63 A;  1VQ7 A;  4A3D H;  1JJ2 A;  2Z6K C;  5C3E H;  3AQQ A;  4XTC S;  3S1N H;  4GKK Q;  2VY3 A;  4DAY B;  1IBM L;  1A62 A;  3M9B A;  4X64 Q;  5M3M H;  2CFM A;  1PH1 A;  1UWV A;  2YU9 H;  3CCM A;  2VNU D;  3HKZ E;  4LFA Q;  1HR0 Q;  1CSP A;  1TWG H;  1XNQ Q;  3HOV H;  4P75 A;  1XNR L;  2GVA A;  3NEN A;  1YI2 A;  1IBK Q;  5C4X G;  1B8A A;  4DR7 Q;  3G4S A;  2NZO A;  2Y0S E;  3H0G H;  5H1S E;  1HNX L;  3AFQ A;  3CF5 A;  2JK8 A;  4DUZ L;  3PIP A;  4IPG A;  2R92 G;  3DLL A;  1VQE A;  3S24 A;  3KF6 A;  1PV4 A;  2RF4 A;  2ZM6 Q;  4BY7 H;  4AYB E;  3OTO L;  4DR1 Q;  2AHO B;  4B3T L;  3EN2 A;  2E5L Q;  1GO3 E;  4PMW A;  1UEB A;  4R4I A;  4JV5 L;  1S3O A;  4R4T A;  4JBW A;  3NEM A;  5IWA Q;  5LMN L;  2KBN A;  4BA2 I;  4A3B H;  3LGJ A;  3F1Z A;  3HOX G;  4L5S A;  2GVB A;  3K8A A;  4KI0 A;  4OON A;  4WJ3 M;  1VQ4 A;  1VQN A;  1L1O A;  1Y1V H;  2PI2 A;  3EIV A;  1HH2 P;  3CCQ A;  1EIF A;  4UPA A;  4LF6 L;  1UE1 A;  4LF7 Q;  2L15 A;  1K3R A;  2JEB I;  1VS0 A;  4A3J H;  4A3K H;  1QZG A;  2PNH A;  2NVY H;  3I56 A;  4LF5 Q;  3I4N G;  3K7A H;  2UXB Q;  1QZH A;  4LF4 Q;  2VQE Q;  3U50 C;  1X3E A;  4X66 L;  2WB1 E;  1N32 Q;  1QVC A;  4JI5 L;  1OXT A;  3J81 c;  1YIT A;  5E7N A;  1NJI C;  1BBW A;  3PUV A;  4PZ7 A;  3H15 A;  4LF9 L;  2E2J H;  3E9H A;  2CKZ B;  5C0X G;  4AQY L;  4A3F G;  4YCV A;  3RZO H;  4Y52 H;  2LXJ A;  2JA8 H;  1YBY A;  3HOW G;  3PO2 H;  4B3R Q;  1XMO Q;  1X56 A;  5IP9 H;  3K0X A;  2F52 A;  1K0R A;  1VCI A;  2XGT A;  1N33 L;  2K4K A;  1EQR A;  5C3E G;  1XMQ L;  4KHP L;  1HNW L;  1IBL L;  3GTJ H;  5C0X J;  2B29 A;  5AJ3 L;  4OX9 L;  4DV1 L;  1QVF A;  1FJG Q;  2NZH A;  3CD6 A;  4QQB X;  1JJC B;  4JBK A;  4QIW E;  1O7I A;  1PVO A;  4A76 A;  1EIY B;  1W3S A;  3I4O A;  4JI2 Q;  4HJ8 A;  1SRO A;  4R4C A;  4L5Q A;  2Q2U A;  1PH2 A;  4A3E H;  3S1M H;  3NBH B;  4A75 A;  4O0A A;  3HKZ G;  1VQM A;  1KL9 A;  4DV7 L;  1Y1W G;  3RN5 A;  3CC7 A;  2R7D A;  2KCM A;  3KJO A;  5JJL A;  2H5X A;  3PV0 A;  4TQU S;  4DAM A;  2KHI A;  4RMF A;  5C4X H;  5GAE C;  4BY7 G;  1KXL A;  1XNR Q;  4OXP A;  1NE3 A;  3CCV A;  1SFO H;  2R7F A;  5M3F H;  1Q86 C;  4HIM A;  2JA7 G;  1NY4 A;  1HZ9 A;  4JOI A;  3TEH B;  4HJ9 A;  5IYD H;  4GLV B;  1C9O A;  4LW1 A;  1HNX Q;  1I6H H;  1EOV A;  4AYB G;  1VQ5 A;  4DUZ Q;  2HT1 A;  1VQB A;  1BKB A;  1A0I A;  3J81 j;  4B3S L;  1U0L A;  1KIX A;  3KDF A;  3OTO Q;  1RIP A;  1SLJ A;  4B3T Q;  2EIF A;  3PCO B;  1JMC A;  4JV5 Q;  1Q46 A;  4LUO A;  1VQF A;  4A3J G;  1KAW A;  1SR3 A;  1VQL A;  2DGY A;  1RL2 A;  1YEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...