2VUMH

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumH00
3FHWA 4UP7A 4X62L 1WJJA 2VY3A 5ELOA 2N3SA 2JA7G 2GN5A 2IHEA 2JA5G 1K3RA 1QZGA 1VS0A 4A3CH 4QQBX 3I4NG 3T1YQ 5JJLA 3G48A 2UXBQ 5IYDH 4R1JA 1YJNA 2Q2TA 3PF5A 2ZTDA 4LUZA 4A3EG 4NXNL 4LNQA 1VQKA 2R93G 1YHQA 3CP0A 4LWCA 4DR2Q 2UUAQ 1L2FA 3CXCA 4AQYL 2D0OA 4TQUS 3ULJA 1YJ9A 4LF6L 1WCMH 4HIDA 4A3JG 4X62Q 1FJGL 5FJ8H 1VQCA 4JI4Q 3KF6B 4OO1G 3M4OH 3A5ZB 3G4SA 1TXYA 4JOIA 4NB3A 1UE6A 2AMCB 4A3FG 5IP7H 2UU9L 3E9HA 2BA1A 4Y7NH 1YHAA 3CCRA 1X3GA 1YBYA 2VQEL 3D31A 4IPCA 1VQ4A 3CCVA 2NVXH 4B3SL 3K0XA 2Y0SE 1Q8KA 1JJCB 3K81C 3F2BA 3ICEA 3CQZH 3TRZA 1BVSA 2K14A 3I55A 3GO5A 1J5EQ 3JC66 4LF7Q 4GKKL 2HQLA 4EX5A 4DR6L 2I0QA 1YIJA 2KCTA 3A74A 3NEMA 3UDFA 3U4VA 1PH4A 2OTJA 4IO9A 1FL0A 3GTOH 1LUZA 3H3VI 2PMZE 4QY7A 2I5MX 4MTNA 3I56A 4DR5L 3I7FA 4RMFA 5IWAL 3KYHC 1QVGA 4BXXH 1X3FA 2K5VA 1QUQA 3CMAA 3J7ZC 3D0FA 2VW9A 4DV3L 2CKZB 1PFSA 2CFMA 4IOCA 3JAMi 2F3IA 1EIYB 4JI6Q 4LF4L 4A3GH 4LF7L 4A3LG 1WI5A 5IYCG 1TWCH 3S1RH 1I3QH 1VQEA 2PQAB 3GD7A 1XPRA 4JI7Q 4KHPQ 3H0GH 4FDBA 1UWVA 2LXKA 2B29A 4AIMA 2VQEQ 4A75A 2UUAL 1KXLA 1H95A 2NZHA 4X66L 5H1SE 4B3RL 1PV4A 2Z0SA 4K0KQ 2IY5B 3KJOA 4NPSA 2YTYA 3S24A 2MNAA 1PH2A 4LF9L 1OXSC 2HT1A 1OXTA 4YWKA 5GAEC 3KJPA 3EN2A 3WWVA 4DK3C 5HGQA 4UPAA 2FXQA 2EXDA 4DV3Q 4A3IH 4B3MQ 2R92G 1T9HA 1YHBA 4LFCL 1Q12A 1HNXQ 3HOXH 4WJ4A 1JE5A 2OQ0A 3F8TA 1PH3A 1I50H 4GOPA 4QL5A 4BBSG 3OTOQ 2PQAA 1VQFA 2UUCL 4C2MH 1MJEA 4JV5L 1XMOQ 4X66Q 3KOJA 3FKIG 3GTJH 5K36G 2JEAI 1Z47A 1VQBA 4B3TL 2B63G 4DV7L 4HJ9A 3RZDH 2B63H 2WFWA 4JI2L 3OYYA 4JI8L 1XMQQ 1I94Q 3H3VH 1E3PA 2D0PA 3T1HL 3H15A 1HR0L 1TWGH 3MXNB 4DR7L 1VQDA 4QJFA 2GVAA 4B3RQ 4DV4L 1A63A 3J81i 4LF4Q 4BBSH 1VQ9A 4DNIA 2JA6H 4DUYQ 3CMEA 1L0WA 1XMOL 4KI0A 2D62A 2R6GA 5ELNA 3KLWA 3L0OA 3RR5A 5LMNW 4DUZQ 3J80c 2R7ZG 3ULPA 4KHPL 4HJ7A 2Z6KA 4YWMA 2B3GA 5EAYA 4A3IG 3I4MG 1OTCA 1Y14B 4IPHA 1ASZA 3K80C 1NMGA 1V1QA 4YCUA 1EYGA 3T1HQ 1QVCA 3PUVA 3AFQA 1L1OC 4DV5Q 1Y1WG 2KCMA 4JI0Q 4DV0Q 3LGJA 4B3ML 4IFDI 2VNUD 5GROA 1N8RC 2IT1A 1OXUA 4DKAC 2AWNA 1HNWQ 4JBJA 4A3LH 4DR4L 1E7ZA 1QZHA 4JI2Q 1W2BA 1OXXK 4PZ6A 3VDYA 4LFBL 1UE1A 3ER0A 4TVAB 1VQPA 4GS3A 1VQNA 2UXCQ 4YCVA 1HR0Q 4A3DH 3CCSA 4HIMA 4AQYQ 1UE5A 1GM5A 2I5HA 4LF6Q 2R93H 4X65Q 3ERSX 2JJQA 1Y1VH 1R9TH 4C3JH 1NJIC 1X65A 4A4IA 4DV7Q 4X64L 4DR1Q 1Z9FA 3PGZA 3IRBA 4DV1L 2XGTA 2IX1A 4JYAL 1IBML 1LM0A 1VQ5A 1ASYA 3M4QA 3CCJA 3KF8B 4QGUA 5JJKA 2DGYA 1PH8A 1AH9A 2A19A 2Y0SG 4DV4Q 4PG3A 1MKHA 4P71A 3F2DA 4LUVA 1QVFA 1S3OA 4L5TA 4IFDJ 1J5EL 1XNRQ 4GKKQ 1VQ7A 2V1CC 3HOYG 3RLOA 1SLJA 3ZJYC 1RIPA 1M1KC 3S14H 1RL2A 4R4TA 1CUKA 3EIVA 2LSSA 1KL9A 3AFPA 4AYBG 1PHJA 3E9IA 5FJ8G 1V9PA 4IFDG 5IE8A 2MO1A 1U5KA 1K0RA 1WCMG 1O7IA 1P16A 1CKMA 3TS2A 4UY8C 1CKNB 1HJPA 4H02A 1YITA 4UP9A 3A0JA 1X9NA 2RHSB 1N9WA 2XTIA 4PMWA 3AYHB 3PIOA 4JI6L 4GNXC 4L5SA 1TWAH 2IHFA 1SE8A 2ATWA 2JA8H 1BBUA 3FP9A 3I4NH 2PNHA 1PYSB 1WYDA 5HY6A 4LF5Q 1UE7A 3U4ZA 3S1MH 4AH6A 3HOUH 1NBWA 4LUOA 3I4OA 2VQFL 1NMFA 2EIFA 4UP8A 1PH6A 4OX9Q 1UEBA 3CAMA 4OONA 1KAWA 3S17H 2ZM6L 3PUYA 3PSIA 1BKBA 5BR8Q 1KD1C 1B70B 4NXMQ 3S1NH 4KHZA 1K9MC 4B3TQ 5J3BA 3NBHB 1IL2A 1PA6A 4JI5Q 1JJ2A 4OO1I 1YJWA 3ULLA 5JEAJ 2RF4A 1VQGA 1XNRL 4B3SQ 4DR7Q 2JK8A 2L15A 2HIXA 3CC7A 4QIWE 1Q46A 5M3FH 5C4XH 1HZAA 4JBMA 4JI4L 3PO2G 3W1BA 4DV2L 2ZTCA 4OX9L 4P72A 1N32L 2PI2E 1K8AC 4JBKA 3I2ZA 3CD6A 3DM3A 1G6PA 3UE0A 2VUMH 4DR2L 2RHQB 4OWXB 3G71A 4BY7H 2K5HA 4GLXA 3STBD 1VQJA 1I5FA 1K83H 2BH8A 4R4CA 1XTDA 4DAYB 4YHHL 4DUYL 3HOUG 3HOZH 4LFAL 4DR6Q 1Q81C 1QUQB 4KLKA 4DK6C 4HJ5A 1G51A 5M3MG 1IBLL 5JEAG 4GN4B 2JA8G 3GTGH 3CC4A 3M9BA 1N36L 4JI1Q 2Q2UA 4DR4Q 3OW2A 4IJLA 4GOPB 4JI5L 1KHIA 3F1ZA 1X6OA 2WAQE 2K50A 3NELA 4PZ8A 2LXJA 4A3MG 3U58A 3JAMc 1PH1A 3PO3G 2CWPA 3BZKA 5IWAQ 1EQQA 3RN2A 1HR0W 2WB1E 2ZJRA 3MEFA 4DV5L 4DV0L 3K7UC 3SGIA 2Z6KC 1VQLA 5M5WH 3CCEA 3GTLH 3S2HH 1KRSA 4C3IH 4LFAQ 4JI7L 1D7QA 3T1YL 4A3BH 1VQ8A 4PZ7A 3HOVH 4A76A 3CC2A 3HOYH 2UXBL 2N49A 1DGSA 1W3SA 4L5QA 2KHJA 4GKJQ 1CSPA 2AKWB 1AE2A 4POFA 3L2PA 4K0KL 1VQIA 4BA1I 3AEVA 3KF6A 1A8VA 4DV2Q 4A93G 3CW2C 3PUXA 1B8AA 3RNUA 1S72A 1N32Q 3J81c 1S40A 4X64Q 1GO3E 1TWFH 2OTLA 3BZCA 4DV1Q 1EFWA 4XIGS 1CSQA 1IYJB 3J81j 2UUBQ 4IPDA 1WOCA 1YVCA 1A0IA 2H5XA 5M5XH 1X55A 1HZCA 2KHIA 1Y1VG 3HKZE 4IPGA 2ZJPA 4EQ5A 1MJCA 1N34L 1KIXA 3BU2A 3GTPH 2OQKA 2CCZA 4GKJL 4A3DG 4HJ8A 1E1TA 3UDIA 1HZBA 5C3EG 1BBWA 4BBRG 5IYBH 3TS0A 5C0XJ 4P73A 4OWWB 1FJGQ 4P75A 1NTGA 2YTXA 1PH9A 2Q2IA 1CKNA 1I94L 1P8LA 1Q1EA 4GOPC 1U0LA 2YYZA 1CKOA 4GN3B 5GAGC 4HJAA 4NXNQ 4JC0A 1X3EA 1Y1WH 1EOVA 1Q7YC 2I5LX 4LF5L 5IP9H 4A3KG 3UDGA 1TWHH 2MFIA 1PVOA 3HOWG 2R7DA 2E2JH 3M3YH 2HHHL 1GD7A 4L5RC 4C3HH 3I4MH 1JT8A 5FLMH 2ALYB 5LMUQ 3CCQA 5M5YH 2R7ZH 4POGA 2GVBA 2VZAA 1NY4A 3B6YA 2K75A 4LF8Q 4DPGA 4BA2I 3BJUA 2JA6G 1YZ6A 3CF5A 4HIOA 3W5OA 1GKHA 3AQQA 1N34Q 1HNZQ 1J6QA 5IY0A 1PH5A 4JI0L 3M85A 3PF4A 5AJ3L 4JI3Q 2JEBI 3E0EA 3PCOB 2E5LQ 2R7FA 5DLQE 5BR8L 5LMNQ 2UUBL 4NXML 1VQ6A 4J15A 1VQAA 3J7A5 1WFQA 3GTQH 3K8AA 2E8GA 3PV0A 4O2DA 4APVA 4JYAQ 2UXDL 4LFCQ 3A5UA 3CCLA 3TEHB 4DR5Q 1EUJA 3FKIH 1L1OA 3KDFB 1Q86C 2ZJQA 1N33Q 3GTMH 4XTCS 2DUDA 3K7AH 2ES2A 4R4OA 1PYBA 4GLAC 1LTLA 1NE3A 1X56A 2NN6I 5IT9c 3DLLA 1GVPA 1SFOH 4LW1A 1JJGA 1EWIA 3HOXG 2AHOB 4OWTB 3UDXA 1IBLQ 1SR3A 1C7YA 2YTVA 3STBC 2R92H 5FLMG 4JOIC 1OXVA 4LF8L 1MIUA 1V43A 3L7ZC 4JI8Q 1XMQL 1XNQQ 2K5NA 3HOWH 2A1AA 2JQOA 4A3KH 2UUCQ 5GADC 2YV5A 5IP9G 1HNZL 2JA9A 1VQHA 2NVYH 4OXPA 4P74A 1XPUA 3S15H 1B7YB 4DR3L 3PUZA 3H0GG 1A62A 2HIVA 1HNXL 2CWAA 5IYCH 4GNXB 1YI2A 1IXRA 3S16H 4AYBE 2UU9Q 3F2CA 1C0AA 4A3GG 1D8LA 1VQOA 2UXDQ 1LYLA 2WAQG 4BBRH 5IYBG 1Q82C 5C3EH 2A8VA 1E22A 3HFZB 4JV5Q 4WJ3M 1N33L 2NZOA 2YU9H 4BXXG 5AJ3Q 4ALPA 4YCWA 2WB1G 4YWLA 3M4PA 2E5LL 2QA4A 5LMNL 4X6AH 3GTKH 4MZ9A 1IBKQ 3EBEA 1SRUA 2QGQA 5C4JH 1JMCA 2F4VL 4DR3Q 4HIKA 4YY3Q 2MO0A 4JCVE 2OCEA 3CCUA 2BA0A 3TREA 5C0XG 2N78A 2JE6I 2NN6G 5JJIA 4A93H 3HKSA 3NENA 1IZ6A 4GNXA 5E7NA 2VL6A 1FVIA 1VQMA 4DAMA 3S2DH 1VCIA 4ME3A 5FLXc 2ZM6Q 1I6HH 3HOVG 2KENA 4GLVB 4IJHA 2AWOA 3CCMA 3RZOH 4A3BG 5IP7G 1HZ9A 2MQHA 4A3FH 4DR1L 2NVTH 1C9OA 1HNWL 1XJVA 1K8GA 4DV6L 1IBMQ 2ZTEA 3M7NA 2OWOA 4JBWA 4A3JH 3HKZG 2VQFQ 3PIPA 2NVQH 1Q1BA 2UXCL 3PO3H 4A3EH 1PH7A 4X65L 1YEZA 2N8NA 4A3MH 3UE1A 2WP8J 4LF9Q 1KQSA 5IYDG 1SROA 4R4QA 2VS1A 5LMUL 4LFBQ 4Y52H 5M3MH 2K4KA 1EQRA 3KDFA 4A3CG 2JA5H 4O0AA 1EIFA 4JI1L 2JA7H 3HOZG 3RN5A 1G291 2IX0A 2Q2HA 4RG1A 3GDEA 4YHHQ 1IBKL 2F4VQ 1SMXA 2E2IH 4BY7G 1K73C 2CQOA 2K52A 4YY3L 2QEXA 5C0XI 2HHHQ 4BY1H 1XPOA 2VUMG 1KRTA 1JB7A 1N36Q 5C44G 4JG2A 3W1GA 3U50C 2F52A 3TQYA 2EQSA 2PI2A 2BH2A 4DV6Q 1E1OA 3CPWA 3PO2H 5C4XG 5M3FG 4R4IA 3Q8DA 3OTOL 3RLNA 2RCNA 2ID0A 5GAHC 4GN5A 1AE3A 3CPFA 5GQOA 3PUWA 4JI3L 4MNOA 3S1QH 3J80i 3RLFA 5C44H 4DUZL 3KFUA 1KC8C 2KBNA 1SN8A 1E24A 1L1OB 4BY1G 1X54A 1YNXA 1FGUA 4IOAA 2C35B 1XNQL 1HH2P 1M90C 2E2HH 2ASBA 3G6EA
chains in the Genus database with same CATH superfamily
3FHWA 2E2DC 4CJ1B 5ELOA 1EY6A 5C3EB 4QQBX 3BVMA 3V96A 5JJLA 5I6YA 3G48A 2A6HC 1I4GA 1PFBA 4QUCA 4DXGA 2ZTDA 1PRTB 4LNQA 1TR5A 4DR2Q 1Y8PB 5C4XB 2UUAQ 1L2FA 5K5PA 2I46A 1LTID 4A3JG 3HOXB 1SAPA 4JI4Q 3A5ZB 1RKNA 3G4SA 1UE6A 4A3FG 2UU9L 3E9HA 1YBYA 3D31A 2JA8B 1ML0D 3CCVA 4B3SL 3ICEA 3TRZA 1JJCB 4DA2A 1D1KA 4BS9A 1B9NA 4LF7Q 3JC66 3A7AB 4GKKL 3TP7A 2TSSA 2KCTA 3FMCA 4H7BA 4RH6A 1PH4A 2K33A 4FNFA 2R7ZB 1GUTA 4C3JG 2HCCA 5KYLA 2F0GA 4OL7A 3H3VI 4B9XA 2AUJD 3I56A 1ZYRC 1QVGA 3J7AF 1X3FA 1QUQA 1F2ZA 2VW9A 2CFMA 2F3IA 1E0BA 1Z7TA 3VR3A 1TWCH 3KBXA 1I3QH 2PQAB 3BZDB 4TRDA 3H0GH 5AFWA 1UWVA 5JPMC 2LXKA 4KV6A 4A75A 1FNWA 1CI3M 5H1SE 2E2JB 2RDGA 2J7ZA 1D5ZC 4K0KQ 1OXTA 3WWVA 4A3IH 2R92G 4UPAA 1TY0A 3ITPA 2F0IA 1SBBB 2B2VA 2OQ0A 4DK1A 1I50H 3V05A 2AQ2B 4QL5A 4GOPA 2L5TA 4K8IA 2KUMA 4BWGB 3VYRA 1MJEA 5D14A 5BN5A 1BUVT 3GTPB 1A2UA 2JEAI 5KNCA 3BVZA 1VQBA 2B63G 1U4MA 3OYYA 2F03A 1E3PA 3DWAA 3T1HL 4HR7B 5C4HA 4DR7L 3S2HB 3M3YB 1M4VA 1V8QA 2J0TD 4FF4A 3JAME 4XT3B 3CMEA 1A3UA 1C8CA 2EYPA 1TWGB 4PQXA 1H9JA 4A3IG 2VXWA 1NR2A 3WOFA 4IPHA 5EQ0A 1NMGA 3T1HQ 1QVCA 3AFQA 4DV5Q 1SNDA 4QF4A 3LGJA 4IFDI 1MBYA 1ET9A 1VF5C 2DN8A 2IT1A 3ZYYX 1X32A 2AWNA 4JBJA 4DR4L 1QZHA 1OXXK 1UE1A 2BDNA 4IUUA 1VQPA 4GS3A 1VQNA 2UXCQ 3VR4A 3CCSA 1A15A 1IKMA 4X65Q 1FNVA 1NJIC 1X65A 2EJFC 4HMJA 2KECA 4X64L 1ET6A 1Z9FA 1JC7A 1ASYA 2Z1CA 2O5IC 3CCJA 4QGUA 1QNKA 2DGYA 1H9SA 2Y0SG 4PG3A 3I91A 1QVFA 1II3A 1S3OA 3HZXA 5EJWA 4G7ZC 1LT4D 1XNRQ 2PPBC 1KLUD 5CV5A 3KLRA 4R4TA 5EPKA 2LSSA 1KL9A 3AFPA 5IGGA 4C3IG 2A68D 4RGNA 1EL0A 1H9SB 4LMQD 1CT1D 1O7IA 3TS2A 4UY8C 1CKNB 3PO2B 1S4ZA 2ZXPA 4UP9A 3VA5A 1KDCA 2XTIA 3PIOA 3IAYA 4JI6L 1HRJA 4KMUC 3EVQA 1XXGA 2IHFA 4FXKC 1SE8A 2JA5B 2ZXOA 2ATWA 3FP9A 3I4NH 1TWHB 3MAQA 3JAML 5HY6A 1I4RA 1UE7A 1SNMA 1NBWA 3DMUA 3TMEA 2B39A 1Y8NB 1I4HA 4OONA 4DNTB 3PUYA 1CA6A 4NXMQ 1SDFA 3S1NH 1TQOA 3NQIA 4J6HA 2PYKA 2FFKB 1JJ2A 5C5MA 1YJWA 3S17B 5JEAJ 2RF4A 1XNRL 4B3SQ 4H0LC 5D3DA 5JAVA 3PO2G 2GA4B 4JI4L 1JCKB 2ZTCA 2NZ1D 1BCPB 1N32L 2PI2E 3ND9A 4JBKA 3MXNA 1DD2A 2DNEA 1JORA 4LK1C 1ZEQX 4DR2L 3FVQA 2BH8A 1LABA 1XTDA 5M3FB 5CYUA 1PDQA 4DAYA 1IBLL 2Q8TA 2Q2UA 4DR4Q 1KHIA 4PZ8A 2K50A 4AYBB 3JAMc 1RTOA 2CWPA 1EQQA 3RN2A 4DV5L 1IYUA 4XQNA 3IL8A 3GTLH 3CCEA 1WD1A 4QUFA 4C3IH 4LFAQ 4JI7L 1D7QA 1SE3A 4CDCC 5ELDA 4F88A 3HOVH 3S1RB 2O4XA 4L5QA 2XSCA 4A3JB 1CSPA 1NCVA 4PMBA 2A69D 4DV2Q 1GOZA 1RODA 2NN6H 3J81c 1F9RA 3GTMB 4DV1Q 1LTAD 1IYJB 3J81j 1YVCA 4XQQA 2H5XA 3MEHA 1HZCA 1BCPD 3HKZE 5CBAE 2F0WA 1MJCA 3BU2A 3GTPH 1KAAA 1F9QA 1PLFA 1QOHA 2M2LA 3TS0A 4P73A 3C3LA 1PMRA 4P75A 1PH9A 4I7ZC 2K05A 4HAEA 4GOPC 3J7YW 3VYUA 4LF5L 4ULLA 2MFIA 1WTXA 5BN4A 1PVOA 4IQZA 2BCOA 4IUQA 2E2JH 3A54A 2HHHL 3I4MH 2EYMA 1JT8A 5FLMH 2NTSA 4POGA 1YNNC 2GVBA 2Q8RE 1NY4A 3B6YA 3KF8A 2JA6G 1YZ6A 1TY2A 4TKOB 1J6QA 2R92B 5AJ3L 1UEAB 4MN3A 1ICWA 4C3HB 3BS1A 2UUBL 4NXML 4ID6A 2MHVA 2E8GA 1KTKA 4CJ2C 2UXDL 2PZTA 3CCLA 3TEHB 1L1OA 1PXUA 1VMCA 3TDQA 1EY0A 3D6WA 4J1MA 2HUGA 4R4OA 1PYBA 1B2TA 3HEJA 5IT9c 3DLLA 1JJGA 1SFOH 3HOXG 4R9WA 1MGSA 3UDXA 1SR3A 1HFNA 1GUGA 1NR4A 1OXVA 5I9PA 1V43A 4JI8Q 1XNQQ 4BBRB 3E5SA 3HOWH 2AQ1B 2YV5A 3K7AB 4WRDA 5IP9G 1JQYD 1CFMA 2NVYH 3PUZA 5EKKA 1YI2A 4AYBE 2UU9Q 1ESRA 4BBRH 1Q82C 5C3EH 4WJ3M 1E22A 2RDFA 2YU9H 2ZT9C 5KRUA 2WB1G 4ALPA 4YWLA 2F4IA 2FMCA 1I4QA 1QB5D 5LMNL 4X6AH 3K5OA 3GTKH 2FMMA 1TIID 1H9RA 1JMCA 2KQ3A 1RHPA 2BE5C 1PTOB 4IN3A 3CCUA 2BA0A 2N78A 2EJGC 3GQBA 4A93H 4B08A 1FD7D 1RJTA 1PYWD 3S2DH 1VCIA 2K5WA 1DXMA 4KY7A 4ME3A 3VA7A 4DXFA 1I6HH 4UDUC 4GLVB 4A3BG 4C1NI 2RSOA 2IJ0A 4DR1L 4A3FH 2NVTH 4LAAA 2LY7A 2ZXRA 3Q24A 1ILQA 4DV6L 1IBMQ 5T1IA 3RZDB 2OWOA 3NTIA 3NXWA 4JBWA 1K0SA 4F8MA 1Q1BA 4C56C 3PO3H 2L4NA 4A3MH 4K5VA 4I65A 2N55A 4NDXA 5M5XB 3QOJA 3FRPB 2B63B 1EIFA 1AZQA 1BXTA 1G291 3GDEA 4BY7G 4FF3A 3A8KE 2K52A 2QEXA 2VUMG 1DJRD 1JB7A 5C44G 3UI2A 4N9TA 2EQSA 2PI2A 2KVMA 1HQMC 4R4IA 3PIO3 2K01A 4ZUJA 5FK9C 3RLNA 1SJHD 2ID0A 2RCNA 5GAHC 3K0YA 1QJOA 4JI3L 4MNOA 3S1QH 2DJGC 5KNBA 5HGTA 3J80i 4DUZL 3NHHA 2IW3A 1KC8C 1A3TA 1E24A 1L1OB 1FGUA 1XNQL 1M90C 3MXPA 4UP7A 3IFTA 1BO0A 2JA7G 2GN5A 2IHEA 1QZGA 1K8MA 2UXBQ 1JB3A 5IYDH 2PZUA 3MHBA 2QDLA 1VQKA 3CP0A 1SNCA 4AQYL 3CXCA 1EY7A 1YJ9A 4LF6L 3ULJA 2XWBB 1GUNA 4IFDH 2H1EA 4RCNA 4QMGA 1PRTD 4OO1G 4JOIA 2BOSA 1EOTA 1DZ1A 1HCZA 2AMCB 2NWGA 3AU7A 3HRZC 1JWSD 1X3GA 1LT6D 5A2QE 4NW2A 1EYAA 5JVG3 1AW7A 2E2IB 1IL8A 2XRSD 5FO7B 5C0XH 4EX5A 1I4PA 3S9WA 3NEMA 3HKZB 5I9OA 1ENAA 4IURA 2PMZE 4A3IB 4QY7A 5C3WA 4MTNA 3S1MB 1DOMA 2Z4IA 4RMFA 5IWAL 3KYHC 1CA5A 4HSPA 2K1BA 3J7ZC 3P7JA 1PFSA 3OMCA 4IOCA 2NYZD 1EIYB 4A3GH 4OIJA 4A3LG 5IYCG 1XPRA 1VQEA 3GD7A 4X3UA 4FDBA 4KJNA 2K7VA 3OMGA 2VQEQ 1W6KA 2NZHA 2WKDA 2Z0SA 3KJOA 4NPSA 2YTYA 2MNAA 1PH2A 4LF9L 1OXSC 4YWKA 5GAEC 1STHA 3VR5A 3EN2A 1JOQA 1CK1A 1O7ZA 1X3QA 4DV3Q 3SXHA 4KKTA 2TMPA 2FHTA 1HNXQ 2D2CC 3NK9A 3HP3A 1VQFA 2UUCL 2PZWA 4C2MH 2Z9HA 4X66Q 3GTJH 1K8OA 2B8FA 1JOOA 4XYQA 5LL6S 3RZDH 4JI2L 1XMQQ 3H3VH 5HURA 3RD4A 2A74C 2LFNA 4F87A 1TWGH 3MXNB 4G4KA 3D4WA 3I70A 5ELCA 4QJFA 3KUPA 4BBSH 2BE5D 4RGTA 4DUYQ 4V190 3AB9A 4A3GB 2D62A 5ELNA 4DUZQ 3RR5A 4KHPL 4MTKA 1EIGA 3ULPA 1QE6A 5EAYA 1ASZA 1ZYRD 1YNND 4BBSB 3C46A 4JI0Q 2F0KA 2IWHA 4B3ML 4CGYB 2YU9B 1EZ8A 3H09A 1MD2D 1HNWQ 4RHSA 2CHBD 4JI2Q 2E75C 4PZ6A 1Q3LA 2F0VA 4A3DH 3P75A 2R93H 1GJXA 3ERSX 1CZWA 3C1FA 3I73A 1PZKD 5CV9A 4DV7Q 4DR1Q 2OEOA 2IX1A 3PGZA 3IRBA 2XGTA 4XYOA 1VQ5A 3RUZA 3M4QA 4JW0A 1AH9A 3F2DA 1MKHA 1PFMA 1WTQA 4KN4C 4X3SA 3BYYB 1VQ7A 1B9MA 1Y8OB 2V1CC 3S14H 2K03A 4AYBG 1OO9B 4DGZA 1WTOA 3R8BA 4EGVA 1HJPA 1YITA 2F0HA 1AEXA 4DFAA 4GNXC 1LTGD 5JEAH 4CDEC 1DM0B 2JA8H 1IYVA 1WYDA 1TS4A 2XN9C 4AH6A 4MIUA 4LUOA 2VQFL 4FYDA 1PH6A 4OX9Q 1UEBA 3K58A 1KAWA 3S17H 3R2TA 1BKBA 1KD1C 1LTTD 3CRKC 3NQTA 3KLSA 3NBHB 2JP1A 4G57A 4JI5Q 1M8AA 4L8JA 2K32A 2F0DA 2JK8A 3CC7A 2CH4A 2JXMB 2K5QA 1HZAA 1RF2D 1WVLA 5J39A 3S14B 4JVZA 4DAPA 1B4OA 2QCPX 1K8AC 5IGBA 3DM3A 3V2TA 4BY7H 4OWXB 3G71A 2K5HA 1G91A 1VQJA 4R4CA 1K83H 3HOUG 1WTVA 1O7LA 1SXTA 2BDOA 5M3MG 1T5XD 3FEWX 4GN4B 5JEAG 4BY1B 3CC4A 1N36L 2A68C 1LLRD 3OW2A 4GOPB 1KDAA 4JI5L 4CDDC 2WAQE 3U58A 4OIKA 3PO3G 1JR0D 5IWAQ 4QCLA 2C9OA 2ZJRA 5C5LA 1JWMD 4K2LA 2EJMA 3SGIA 2Z6KC 2FINB 5M5WH 1TWFB 1KRSA 2NUCA 4A3BH 1VQ8A 1JWUD 4A76A 2N49A 1KDBA 2A5HA 3N6RA 3NTHA 5E1FA 1W3SA 2DJFC 2KHJA 3R2IA 4XQJA 5CV7A 2AKWB 3I90A 3GV6A 3CW2C 3RNUA 4U673 1S40A 4IUTA 3S1NB 3HS0C 2P5ZX 3DM1A 3BZCA 2AQ3B 2E76C 3W2DA 3MTSA 1EFWA 1CSQA 1WOCA 5M5XH 1A0IA 2B8GA 4PNYA 4CDFC 4ODGA 1Y1VG 4IPGA 4EQ5A 2EZVA 1TS5A 1N34L 1KIXA 2OQKA 1H9MA 1K83B 4HJ8A 3UDIA 5C3EG 4BBRG 3DUZA 2KCNA 3BDOA 1SFOB 1FJGQ 1NTGA 2YTXA 4HMIA 3MA2B 1Q1EA 3SK5A 1Q7YC 2I5LX 3J81L 3UDGA 3HOWG 2WIIB 3T53B 3M3YH 1GD7A 4C3HH 5M9OA 4C3IB 1PTOF 1EEID 3CCQA 2QEJC 5M5YH 2VZAA 4LF8Q 2V4DA 4BA2I 4KY6A 2EDGA 1SYEA 3W5OA 1N34Q 1ZKOA 3NPPA 4JI0L 1DCZA 3M85A 3PF4A 1EFID 4M1UB 4UAIA 3I4MB 2R7FA 5DLQE 2JA7B 2C5CA 1VQ6A 1VQAA 3J7A5 5LL6X 3SE0A 3HGBA 1EUJA 3KDFB 5IGFA 3VYTA 4XTCS 2DUDA 1PTOD 3C1EA 3K7AH 1NE3A 1X56A 2NN6I 1VMPA 3NUCA 1EWIA 1D5MC 4LJZC 1WTPA 3STBC 1TU2B 5FLMG 1LTSD 3PO3B 4JOIC 1MIUA 1SYBA 3L7ZC 1XMQL 2K5NA 4FVMA 3OWEB 2EY1A 4IALA 2L9HA 3S15H 1XPUA 1B7YB 2HIVA 2CWAA 5IYCH 4GNXB 1SYDA 1LT5D 1C0AA 4DU9A 1VQOA 3SDZA 2UXDQ 4ZQ3A 1LYLA 1EY9A 3EFXD 4QB4A 5IYBG 4OELB 4A93B 1N33L 4BXXG 5AJ3Q 3QG1A 5KNDA 2J4XA 3M4PA 3S15B 1W6JA 1IBKQ 3EBEA 4DR3Q 2JE6I 5FKAC 1BDOA 5JJIA 4GNXA 4DAMA 4K6DA 3PQIA 3HOVG 2AWOA 3MC0B 2QW7A 3CCMA 5IP7G 1HTPA 1C9OA 1HNWL 1XJVA 4JK1C 3W3AA 4OO1H 2K28A 3L9AX 1RTNA 2VQFQ 2FJ2A 2UXCL 4C3JB 2KJXA 3H94A 2F0LA 1S5FD 4OGQC 2A73B 3UE1A 2B2UC 2WP8J 3TBIB 5IYDG 1VF7A 3LWUA 4FF1A 1TKWB 5LMUL 4LFBQ 4Y52H 1EQRA 3KDFA 2QKIC 4JI1L 1TS2A 2A6HD 1IBKL 1K73C 5FOBB 4YY3L 5C0XI 4BY1H 1B50A 2PW5A 4O42A 1CQVA 4RAUC 2Y0SB 2BH2A 3CPWA 5C4XG 5KYIA 3Q8DA 1S5DD 3SK8A 4GN5A 5E4WC 5IGCA 3G7LA 1AE3A 1ONLA 2KOLA 2HQEA 1SNQA 3RLFA 4XXEA 1JICA 1LO5D 1EYCA 3QR8A 4I7AA 3VR6A 5C3XA 2O5JC 2G9HD 2LKVA 4IOAA 5EBCA 2ASBA 4EQPA 3G6EA 1WJJA 3S1QB 2N3SA 1O78A 1K3RA 1NNXA 1VS0A 2JA5G 3I4NG 3T1YQ 1IHZA 4C1NK 1QNUA 4R1JA 1YJNA 2EVBA 3PF5A 3P1HA 4A3EG 4NXNL 1YHQA 4LWCA 1XTCD 5FJ8H 2K6AA 3KF6B 4DAVA 3T4AC 4ZUIA 3HOYB 1STGA 2JN4A 1YHAA 3CCRA 4IPCA 1VQ4A 2NVXH 3K81C 2Y0SE 1Q8KA 2VUMB 4P2CB 1BVSA 4ME5A 2B2WA 2K14A 3I55A 3H0GB 3GO5A 4DR6L 5NUCA 4EVOA 1YIJA 1SMYD 1DOLA 3U4VA 3GTGB 3TP6A 4IO9A 2EYLA 1C48A 5C44B 2L55A 1JE4A 3I7FA 2IL8A 1JOKA 1IKLA 3CMAA 5C4ZA 1SYFA 4DV3L 4JI6Q 3JAMi 2R3ZA 4LF7L 2B2WC 1EEFD 1WI5A 3S1RH 4JI7Q 5EPLA 1DYQA 4AIMA 2E2HB 2UUAL 1KXLA 5J1ZA 1H95A 4B3RL 2NTTA 1PV4A 4K2KA 2IY5B 3VYSA 1S5ED 3D4DA 3KBGA 4A3BB 3KJPA 2QILA 4DK3C 5HGQA 2EXDA 3M4YA 4B3MQ 3KK7A 1CM9A 1T9HA 1Q12A 2XVSA 3HOXH 4WJ4A 1JE5A 1LV9A 3K59A 3F8TA 1V1PA 3OPOA 4J8QA 2PQAA 3OTOQ 4JV5L 1MHWC 1A2TA 1XMOQ 3FKIG 4FXDA 5K36G 1AFPA 4DF7A 1Z47A 1WD0A 1FR3A 3DEPA 4KTAA 4HJ9A 2WFWA 2B63H 4JI8L 1I94Q 4ZCKA 2D0PA 3S16B 5K36H 1HR0L 5M5WB 1VQDA 2GVAA 2L1BA 4KKUA 4DV4L 3J81i 4B3RQ 4DNIA 2JA6H 4CHTB 1L0WA 1O80A 3D6CA 4KI0A 2R6GA 3KLWA 1HFGA 4N8X1 3L0OA 5LMNW 3J80c 3BYTB 4HJ7A 2Z6KA 2B3GA 3T56B 3I4MG 3MFYA 1TVXA 2VB2X 4CKEA 1EYGA 5CV8A 4MHEA 4FO2A 4DNRB 2Q8IB 1Y1WG 4DV0Q 5GROA 1N8RC 5IT9E 4DKAC 3J81E 2JA6B 1W2BA 4LFBL 1BNZA 4TVAB 2IPKD 4WORA 4YCVA 1HR0Q 3SK4A 3K5NA 4HIMA 1UE5A 2I5HA 2JJQA 2ENBA 1R9TH 4C3JH 3NP8A 4A4IA 4X3TA 2F0FA 1LM0A 4KKSA 3E6ZX 1SNOA 3MXUA 5EKLA 3KF8B 2A6ED 1LACA 1R4PB 4P71A 2B2UA 4LUVA 1U9RA 1J5EL 2CQAA 1GHKA 1SLJA 3EA6A 1M1KC 3EIVA 4ZKBB 3J80L 1U4RA 5FJ8G 1V9PA 5JJZA 2F0MA 4BY7B 1U5KA 1K0RA 1P16A 1CKMA 2HDMA 5E4XA 2F0EA 3A0JA 2RHSB 1CHQD 4RWSC 4PMWA 2NVTB 3C2PA 4DN4M 2KCCA 1BF4A 2Z8LA 3BVGA 2PNHA 1PYSB 2N88A 1XWEA 2XRQD 3DWQA 3GV3A 5COYA 3FKIB 4OHJA 1EU4A 2RSNA 1NMFA 2EIFA 3BDCA 5ISRA 4FF2A 3CAMA 5BR8Q 3NTKA 4U68A 1K9MC 5J3BA 1IL2A 5ELBA 1F2MA 2JSOA 4DR7Q 2HIXA 4QIWE 3SVMA 1VDZA 5M3FH 2XIWA 5C4XH 4JBMA 4RGOS 1Q90A 1UAPA 4OX9L 4P72A 3OSOA 3TSSA 3CD6A 3U9OA 4E6IA 3CQZB 1LT3D 3FPPA 1MSHA 1Y1WB 3R93A 3CKIB 3STBD 4YHHL 4ZK9B 3HOZH 4DUYL 1BQQT 1G8ZD 2EYJA 1K3BC 2EY5A 4KLKA 1F77A 3TZUA 1WCMB 1CHPD 1J9OA 2PO4A 3M9BA 5IGDA 4IJLA 2EYFA 1GXDC 1V1PB 1X6OA 3CHBD 1PH1A 2LXJA 5CORA 3BZKA 1HR0W 2WB1E 1EQVA 4DV0L 3VR2A 1D6EC 4TSSA 3DWPA 3AMUA 3QJYA 5JVH3 1NUCA 3CC2A 4ZKCB 2UXBL 5T1GA 1CTMA 5KIXA 1DGSA 5DAUA 4GKJQ 3L2PA 4POFA 1F2YA 1VQIA 3AEVA 3KF6A 4O1NA 1GUOA 1RD9D 1YNJC 3MXGA 4A3EB 1GO3E 4IUVA 5C6AA 4G7HC 1SMYC 2UUBQ 1PZID 2MPMA 1HXYD 2ICIA 2KHIA 1WTWA 2OXPA 2CCZA 2PMZB 1HZBA 5IYBH 1EY4A 5C0XJ 3I8ZA 3MVVA 5FO8B 1I94L 1R9TB 3TP8A 1P8LA 1HTLD 2YYZA 5GAGC 4HJAA 1Y69U 4NXNQ 2Z4HA 3BG3A 5CV6A 1B44D 1Y1WH 1EOVA 3CRLC 3OHXC 1ILPA 1STNA 5IOCA 4L5RC 1CQFA 1HPCA 2K75A 1BR9A 3BJUA 3D3RA 4HSVA 3F2UA 1GKHA 3AQQA 1HNZQ 5IY0A 1HQRD 5BR8L 1G6ZA 4J15A 4WJWA 2PQEA 1HUMA 3I4NB 3GTQH 3K8AA 4JYAQ 4N8FA 4LFCQ 4EQNA 3A5UA 3GTMH 3FKIH 1N33Q 1F2LA 4CKBA 2ES2A 1STYA 4L6TB 5A2QL 2AHOB 2NVXB 4OWTB 1EU3A 1IBLQ 1SYGA 2YTVA 2R92H 2EE1A 4H44C 4WFN3 1R4QB 2A1AA 2EYOA 3SHLA 4A3KH 1HNZL 1VQHA 3CU7A 2CVRA 2F0UA 5DNFA 4N9PA 3H0GG 3GTOB 3S16H 1J8IA 1HA6A 3F2CA 3L3OC 2RKSA 2DY7A 4EQOA 2VB3X 2A8VA 4JV5Q 5IT9L 1QCBD 2E5LL 2QA4A 4IUNA 1SRUA 2QGQA 5C4JH 2F4VL 3LNNA 3ERQA 3HOWB 4HIKA 2MO0A 4K5WA 4JCVE 1FGBD 1BOSA 4ILWA 2QDBA 4A3MB 2L12A 4KN7C 3TREA 4RA8A 4ZLTF 4PV1C 2EY6A 3NENA 3OW7A 1IZ6A 5E7NA 2VL6A 1EIHA 1FVIA 1VQMA 1D5XC 1CZGA 5FLXc 1T5EA 3A56A 2KENA 1O7YA 4IJHA 3RZOH 1HZ9A 4UHVA 4C2MB 3I3CA 3E3XA 3M7NA 5IGEA 4A3JH 3HKZG 5IIFA 3PIPA 2NVQH 1HA5A 1STEA 4A3EH 1PTOC 1YEZA 2N8NA 2R93B 4LF9Q 2M00A 1KQSA 3RZOB 1K28A 4JPBW 3K5MA 2Z6BA 3A55A 5M3MH 2K4KA 1AP0A 3OIPA 2JA5H 4O0AA 2MP1A 3RN5A 2IX0A 4YHHQ 2F4VQ 2HHHQ 2HD3A 1XPOA 1KRTA 1B1ZA 3W1GA 4ZYSA 1LTRD 1E1OA 1HUNA 3E0JA 3OTOL 3T13A 4S3SA 3QOLA 4Q0FA 2KEEA 3IKJA 3PUWA 5ELEA 2F0JA 4CKCA 3Q0AA 2KBNA 3LWEA 4BY1G 1YNXA 1HH2P 2RQXA 2E2HH 4X62L 1UNSA 2VY3A 2F0TA 2G9DA 4A3CH 2NVQB 3HG9A 3KLSX 1RCVD 2KEDA 3GP7A 4Y7NB 1B53A 2EYHA 1C4QA 4CBVA 2Q2TA 1EQTA 1AN8A 4LUZA 4ABNA 3NWTA 3NWSA 2D0OA 4TQUS 1WCMH 4HIDA 2CW0C 4X62Q 1FJGL 1VQCA 3M4OH 2B2YA 2L11A 1TXYA 2MGSA 4NB3A 4KJOA 3G6JB 4K6LA 5IP7H 2BA1A 4Y7NH 2VQEL 3K0XA 3F2BA 3CQZH 2SOBA 2HDLA 4K14A 5E3FA 1J5EQ 2HQLA 4RCOA 2I0QA 4Q5VA 2NVYB 3A74A 3OWFA 3I4LA 3UDFA 5BN3A 1E2WA 5EBDA 2OTJA 1FL0A 3GTOH 1LUZA 2WINB 2I5MX 2R93G 3A8JE 3X3MA 4DR5L 4BXXH 2K5VA 3D0FA 3SR1A 2CKZB 4LF4L 4HEDA 2X6LA 4RFBA 4FXGC 4OEMB 4KHPQ 4KK7A 2B29A 2SEBD 1PRTC 1E2ZA 4X66L 3J80E 2PCFB 1QG7A 3S24A 2HT1A 1L0YB 3WDNA 2FXQA 1SE2A 1YHBA 1SNPA 1GUSA 4LFCL 2OF1A 2F3WA 2EPBA 5I2XA 1PH3A 4BBSG 5CR3A 1HHVA 3OOCA 1MI2A 3H91A 3BDLA 3KOJA 4R8IA 3OIQA 4XDXA 2QF7A 4ZAIA 1ENCA 4B3TL 4DV7L 3P20A 4DK0A 5LHY1 1G2SA 3H15A 2JYOA 2PW7A 4XT1B 3GTLB 1A63A 4LF4Q 1VQ9A 2SNSA 1XMOL 1PFNA 2A6EC 2RVLA 1TWAB 2R7ZG 3GTKB 4YWMA 3H3VC 4C3HG 4Z9CB 1OTCA 1Y14B 2MJ8A 4A3KB 3K80C 1V1QA 3NBHA 4YCUA 2R61A 2WAQB 3PUVA 1D1IA 1L1OC 5F2DA 3EJIA 2KCMA 3T51B 5M5YB 1A6XA 1ESFA 1IW7C 2VNUD 1WTHA 3IFDA 2G5DA 3MFGA 1OXUA 3ND8A 4RGMA 4A3LH 1E7ZA 4YIJA 3R3OA 1SE4A 3VDYA 3ER0A 4AQYQ 4LF6Q 1GM5A 1Y1VH 4RKLA 3K6OA 5FO9B 5DEHA 2IX3A 4JYAL 4DV1L 1IBML 1SYCA 2EY2A 1YNJD 5JJKA 3U9SA 2XWJB 5ELFA 2HCIA 1PH8A 2A19A 4DV4Q 3A8IE 3K5LA 1EY5A 2X6GA 4L5TA 4IFDJ 4GKKQ 1KNAA 1STBA 5D65A 3RLOA 3HOYG 4QIWB 1RIPA 2I07B 3ZJYC 1RL2A 1CUKA 1DOKA 4M8AA 1PHJA 3NBIA 3NE5B 3E9IA 1EWCA 2X69A 5DM73 4IFDG 5IE8A 2MO1A 1WCMG 2SNMA 1XX8A 1X9NA 4H02A 1AZPA 5IODA 1N9WA 3AYHB 4L5SA 1TWAH 5CBEE 1DONA 2RA4A 1MSGA 5C4JB 1BBUA 1S5BD 1GUWA 4LF5Q 3S1MH 3U4ZA 3HOUH 1QILA 4RKBA 3I4OA 4UP8A 4NP5A 4GZYC 1E2VA 5G3LF 2ZM6L 3PSIA 1B70B 4KHZA 2K04A 4B3TQ 3FPUB 1PA6A 1SEBD 4X3KA 3NSWA 4OO1I 3ULLA 1VQGA 4HCSA 2L15A 1SJED 1EY8A 3LX0A 1STAA 1Q46A 4RHRA 1ICFB 3D4RA 3DEOA 3W1BA 5KGUA 4DV2L 1G2TA 3I2ZA 2F0OA 3UE0A 1G6PA 2VUMH 2RHQB 1TT2A 5A35A 4GLXA 4B9WA 1I5FA 3N52A 4DAYB 1I4XA 1U4LA 2B2YC 4LFAL 1I6VC 4DR6Q 1Q81C 1D2BA 1QUQB 4CJ0B 4DK6C 4HJ5A 1G51A 1F9SA 2JA8G 3GTGH 4JI1Q 1Y1VB 1KLGD 3HOZB 4A3FB 3F1ZA 1IW7D 3NELA 5CGKA 4A3MG 1I6HB 3EQLC 3M7GA 5EGTA 4IZ8A 3MEFA 1B3AA 1BCPF 3S2DB 3K7UC 1VQLA 3S2HH 3Q23A 3T1YL 5CC4A 3K57A 4PZ7A 1F9PA 3HOYH 1SSOA 3TZDA 5JPNC 1AE2A 4K0KL 4BA1I 3EROA 1A8VA 4A93G 3PUXA 4NMZA 1B8AA 1S72A 1N32Q 4X64Q 5DM63 1TWFH 2OTLA 2KA7A 4XIGS 3J7AV 3SEBA 3Q6SA 4IPDA 2RDHA 5M3MB 1RDPD 2AUKA 1X55A 2ZJPA 2NBFA 3GTJB 4GKJL 3A7LA 4A3DG 1E1TA 1BBWA 4HN7A 1GHJA 3RMHA 4HCEA 4OWWB 1XYIA 2Q2IA 3DXJC 2LMCB 2RCFA 1CKNA 3QO2A 1U0LA 4GN3B 1CKOA 2WKCA 5JOBA 4G7OC 4JC0A 3FDTA 1TWCB 1X3EA 5EPJA 5IP9H 4A3KG 3PMFA 1TWHH 3D8GA 3GTQB 1NAPA 2R7DA 2F0NA 2E74C 2SDFA 5I6WA 1A3VA 1LTBD 2WB1B 2ALYB 5LMUQ 3URYA 5EKIA 3MZ5A 2R7ZH 2EXZA 1U4PA 4DPGA 2EOTA 5TSSA 3CF5A 5KEEA 4HIOA 4F7XA 4HTHA 4KY5A 2MUYA 3I72A 2XNAC 1Z6HA 1PH5A 1PTOH 4JI3Q 2JEBI 3E0EA 4A3DB 3PCOB 5CMDA 2E5LQ 5LMNQ 2B2TA 2ICEC 1WFQA 1FNUA 3PV0A 4K5XA 4O2DA 4APVA 3PIP3 3X3NA 2F1MA 2O2LD 4DR5Q 1EYDA 1Q86C 2ZJQA 2B2VC 3QIAA 4GLAC 1LTLA 1B3QA 4V0BA 1GVPA 4LW1A 2OT2A 1C7YA 1L0XB 2B2TC 4LF8L 3WOEA 1S5CD 1FYCA 3TP5A 2JQOA 5J22A 2UUCQ 5GADC 5L37A 3HOVB 2JA9A 4OXPA 4P74A 4DR3L 1A62A 1HNXL 2CH4W 5I2YA 1IXRA 1EZ6A 2CW0D 4A3GG 1D8LA 2WAQG 5D3IB 3HFZB 2NZOA 4YCWA 1ZXTA 2WV6D 4MZ9A 4YY3Q 1BBXC 4K8JA 2OCEA 2A69C 1NSNS 5C0XG 2NN6G 3ONAB 1UUPA 4PMCA 2WACA 2K5DA 2NB0A 3HKSA 1V1OA 2F0PA 1QWYA 1BCPC 2ZM6Q 4ZRZA 4KD3A 3O13A 2MQHA 1K8GA 2ZTEA 3DHQA 5G3LD 3Q22A 2DY8A 2D9UA 1I50B 1ENFA 2D5DA 2KHSA 1PH7A 4X65L 3HOUB 4R8NA 5I4DA 1SROA 4R4QA 3H6MA 2VS1A 5CV4A 3QWNA 4NKLA 2M9VA 4A3CG 2JA7H 3HOZG 4RG1A 2Q2HA 4IUPA 3M4OB 5FLXL 1Q8IA 1PZJD 1I3QB 1SMXA 2E2IH 3MWYW 2CQOA 3T16A 3TN2A 1WTRA 1EWHA 2F0SA 2F3VA 4FP5D 1N36Q 4JG2A 4L63B 2RBMA 2F52A 2L0CA 3TQYA 3U50C 5FLXE 4DV6Q 2F0QA 3PO2H 5M3FG 1KABA 4H13C 3QB3A 4KHVA 3CPFA 5GQOA 1H9KA 2DNCA 5C44H 2H4OA 3KFUA 1TS3A 1SN8A 1KNEA 1X3PA 1PRTF 1X54A 4KD4A 2LS01 2C35B 2PNRC 3SK6A
chains in the Genus database with same CATH topology
3FHWA 4UP7A 4X62L 1WJJA 2VY3A 5ELOA 2N3SA 2JA7G 2GN5A 2IHEA 2JA5G 1K3RA 1QZGA 1VS0A 4A3CH 4QQBX 3I4NG 3T1YQ 5JJLA 3G48A 2UXBQ 5IYDH 4R1JA 1YJNA 2Q2TA 3PF5A 2ZTDA 4LUZA 4A3EG 4NXNL 4LNQA 1VQKA 2R93G 1YHQA 3CP0A 4LWCA 4DR2Q 2UUAQ 1L2FA 3CXCA 4AQYL 2D0OA 4TQUS 3ULJA 1YJ9A 4LF6L 1WCMH 4HIDA 4A3JG 4X62Q 1FJGL 5FJ8H 1VQCA 4JI4Q 3KF6B 4OO1G 3M4OH 3A5ZB 3G4SA 1TXYA 4JOIA 4NB3A 1UE6A 2AMCB 4A3FG 5IP7H 2UU9L 3E9HA 2BA1A 4Y7NH 1YHAA 3CCRA 1X3GA 1YBYA 2VQEL 3D31A 4IPCA 1VQ4A 3CCVA 2NVXH 4B3SL 3K0XA 2Y0SE 1Q8KA 1JJCB 3K81C 3F2BA 3ICEA 3CQZH 3TRZA 1BVSA 2K14A 3I55A 3GO5A 1J5EQ 3JC66 4LF7Q 4GKKL 2HQLA 4EX5A 4DR6L 2I0QA 1YIJA 2KCTA 3A74A 3NEMA 3UDFA 3U4VA 1PH4A 2OTJA 4IO9A 1FL0A 3GTOH 1LUZA 3H3VI 2PMZE 4QY7A 2I5MX 4MTNA 3I56A 4DR5L 3I7FA 4RMFA 5IWAL 3KYHC 1QVGA 4BXXH 1X3FA 2K5VA 1QUQA 3CMAA 3J7ZC 3D0FA 2VW9A 4DV3L 2CKZB 1PFSA 2CFMA 4IOCA 3JAMi 2F3IA 1EIYB 4JI6Q 4LF4L 4A3GH 4LF7L 4A3LG 1WI5A 5IYCG 1TWCH 3S1RH 1I3QH 1VQEA 2PQAB 3GD7A 1XPRA 4JI7Q 4KHPQ 3H0GH 4FDBA 1UWVA 2LXKA 2B29A 4AIMA 2VQEQ 4A75A 2UUAL 1KXLA 1H95A 2NZHA 4X66L 5H1SE 4B3RL 1PV4A 2Z0SA 4K0KQ 2IY5B 3KJOA 4NPSA 2YTYA 3S24A 2MNAA 1PH2A 4LF9L 1OXSC 2HT1A 1OXTA 4YWKA 5GAEC 3KJPA 3EN2A 3WWVA 4DK3C 5HGQA 4UPAA 2FXQA 2EXDA 4DV3Q 4A3IH 4B3MQ 2R92G 1T9HA 1YHBA 4LFCL 1Q12A 1HNXQ 3HOXH 4WJ4A 1JE5A 2OQ0A 3F8TA 1PH3A 1I50H 4GOPA 4QL5A 4BBSG 3OTOQ 2PQAA 1VQFA 2UUCL 4C2MH 1MJEA 4JV5L 1XMOQ 4X66Q 3KOJA 3FKIG 3GTJH 5K36G 2JEAI 1Z47A 1VQBA 4B3TL 2B63G 4DV7L 4HJ9A 3RZDH 2B63H 2WFWA 4JI2L 3OYYA 4JI8L 1XMQQ 1I94Q 3H3VH 1E3PA 2D0PA 3T1HL 3H15A 1HR0L 1TWGH 3MXNB 4DR7L 1VQDA 4QJFA 2GVAA 4B3RQ 4DV4L 1A63A 3J81i 4LF4Q 4BBSH 1VQ9A 4DNIA 2JA6H 4DUYQ 3CMEA 1L0WA 1XMOL 4KI0A 2D62A 2R6GA 5ELNA 3KLWA 3L0OA 3RR5A 5LMNW 4DUZQ 3J80c 2R7ZG 3ULPA 4KHPL 4HJ7A 2Z6KA 4YWMA 2B3GA 5EAYA 4A3IG 3I4MG 1OTCA 1Y14B 4IPHA 1ASZA 3K80C 1NMGA 1V1QA 4YCUA 1EYGA 3T1HQ 1QVCA 3PUVA 3AFQA 1L1OC 4DV5Q 1Y1WG 2KCMA 4JI0Q 4DV0Q 3LGJA 4B3ML 4IFDI 2VNUD 5GROA 1N8RC 2IT1A 1OXUA 4DKAC 2AWNA 1HNWQ 4JBJA 4A3LH 4DR4L 1E7ZA 1QZHA 4JI2Q 1W2BA 1OXXK 4PZ6A 3VDYA 4LFBL 1UE1A 3ER0A 4TVAB 1VQPA 4GS3A 1VQNA 2UXCQ 4YCVA 1HR0Q 4A3DH 3CCSA 4HIMA 4AQYQ 1UE5A 1GM5A 2I5HA 4LF6Q 2R93H 4X65Q 3ERSX 2JJQA 1Y1VH 1R9TH 4C3JH 1NJIC 1X65A 4A4IA 4DV7Q 4X64L 4DR1Q 1Z9FA 3PGZA 3IRBA 4DV1L 2XGTA 2IX1A 4JYAL 1IBML 1LM0A 1VQ5A 1ASYA 3M4QA 3CCJA 3KF8B 4QGUA 5JJKA 2DGYA 1PH8A 1AH9A 2A19A 2Y0SG 4DV4Q 4PG3A 1MKHA 4P71A 3F2DA 4LUVA 1QVFA 1S3OA 4L5TA 4IFDJ 1J5EL 1XNRQ 4GKKQ 1VQ7A 2V1CC 3HOYG 3RLOA 1SLJA 3ZJYC 1RIPA 1M1KC 3S14H 1RL2A 4R4TA 1CUKA 3EIVA 2LSSA 1KL9A 3AFPA 4AYBG 1PHJA 3E9IA 5FJ8G 1V9PA 4IFDG 5IE8A 2MO1A 1U5KA 1K0RA 1WCMG 1O7IA 1P16A 1CKMA 3TS2A 4UY8C 1CKNB 1HJPA 4H02A 1YITA 4UP9A 3A0JA 1X9NA 2RHSB 1N9WA 2XTIA 4PMWA 3AYHB 3PIOA 4JI6L 4GNXC 4L5SA 1TWAH 2IHFA 1SE8A 2ATWA 2JA8H 1BBUA 3FP9A 3I4NH 2PNHA 1PYSB 1WYDA 5HY6A 4LF5Q 1UE7A 3U4ZA 3S1MH 4AH6A 3HOUH 1NBWA 4LUOA 3I4OA 2VQFL 1NMFA 2EIFA 4UP8A 1PH6A 4OX9Q 1UEBA 3CAMA 4OONA 1KAWA 3S17H 2ZM6L 3PUYA 3PSIA 1BKBA 5BR8Q 1KD1C 1B70B 4NXMQ 3S1NH 4KHZA 1K9MC 4B3TQ 5J3BA 3NBHB 1IL2A 1PA6A 4JI5Q 1JJ2A 4OO1I 1YJWA 3ULLA 5JEAJ 2RF4A 1VQGA 1XNRL 4B3SQ 4DR7Q 2JK8A 2L15A 2HIXA 3CC7A 4QIWE 1Q46A 5M3FH 5C4XH 1HZAA 4JBMA 4JI4L 3PO2G 3W1BA 4DV2L 2ZTCA 4OX9L 4P72A 1N32L 2PI2E 1K8AC 4JBKA 3I2ZA 3CD6A 3DM3A 1G6PA 3UE0A 2VUMH 4DR2L 2RHQB 4OWXB 3G71A 4BY7H 2K5HA 4GLXA 3STBD 1VQJA 1I5FA 1K83H 2BH8A 4R4CA 1XTDA 4DAYB 4YHHL 4DUYL 3HOUG 3HOZH 4LFAL 4DR6Q 1Q81C 1QUQB 4KLKA 4DK6C 4HJ5A 1G51A 5M3MG 1IBLL 5JEAG 4GN4B 2JA8G 3GTGH 3CC4A 3M9BA 1N36L 4JI1Q 2Q2UA 4DR4Q 3OW2A 4IJLA 4GOPB 4JI5L 1KHIA 3F1ZA 1X6OA 2WAQE 2K50A 3NELA 4PZ8A 2LXJA 4A3MG 3U58A 3JAMc 1PH1A 3PO3G 2CWPA 3BZKA 5IWAQ 1EQQA 3RN2A 1HR0W 2WB1E 2ZJRA 3MEFA 4DV5L 4DV0L 3K7UC 3SGIA 2Z6KC 1VQLA 5M5WH 3CCEA 3GTLH 3S2HH 1KRSA 4C3IH 4LFAQ 4JI7L 1D7QA 3T1YL 4A3BH 1VQ8A 4PZ7A 3HOVH 4A76A 3CC2A 3HOYH 2UXBL 2N49A 1DGSA 1W3SA 4L5QA 2KHJA 4GKJQ 1CSPA 2AKWB 1AE2A 4POFA 3L2PA 4K0KL 1VQIA 4BA1I 3AEVA 3KF6A 1A8VA 4DV2Q 4A93G 3CW2C 3PUXA 1B8AA 3RNUA 1S72A 1N32Q 3J81c 1S40A 4X64Q 1GO3E 1TWFH 2OTLA 3BZCA 4DV1Q 1EFWA 4XIGS 1CSQA 1IYJB 3J81j 2UUBQ 4IPDA 1WOCA 1YVCA 1A0IA 2H5XA 5M5XH 1X55A 1HZCA 2KHIA 1Y1VG 3HKZE 4IPGA 2ZJPA 4EQ5A 1MJCA 1N34L 1KIXA 3BU2A 3GTPH 2OQKA 2CCZA 4GKJL 4A3DG 4HJ8A 1E1TA 3UDIA 1HZBA 5C3EG 1BBWA 4BBRG 5IYBH 3TS0A 5C0XJ 4P73A 4OWWB 1FJGQ 4P75A 1NTGA 2YTXA 1PH9A 2Q2IA 1CKNA 1I94L 1P8LA 1Q1EA 4GOPC 1U0LA 2YYZA 1CKOA 4GN3B 5GAGC 4HJAA 4NXNQ 4JC0A 1X3EA 1Y1WH 1EOVA 1Q7YC 2I5LX 4LF5L 5IP9H 4A3KG 3UDGA 1TWHH 2MFIA 1PVOA 3HOWG 2R7DA 2E2JH 3M3YH 2HHHL 1GD7A 4L5RC 4C3HH 3I4MH 1JT8A 5FLMH 2ALYB 5LMUQ 3CCQA 5M5YH 2R7ZH 4POGA 2GVBA 2VZAA 1NY4A 3B6YA 2K75A 4LF8Q 4DPGA 4BA2I 3BJUA 2JA6G 1YZ6A 3CF5A 4HIOA 3W5OA 1GKHA 3AQQA 1N34Q 1HNZQ 1J6QA 5IY0A 1PH5A 4JI0L 3M85A 3PF4A 5AJ3L 4JI3Q 2JEBI 3E0EA 3PCOB 2E5LQ 2R7FA 5DLQE 5BR8L 5LMNQ 2UUBL 4NXML 1VQ6A 4J15A 1VQAA 3J7A5 1WFQA 3GTQH 3K8AA 2E8GA 3PV0A 4O2DA 4APVA 4JYAQ 2UXDL 4LFCQ 3A5UA 3CCLA 3TEHB 4DR5Q 1EUJA 3FKIH 1L1OA 3KDFB 1Q86C 2ZJQA 1N33Q 3GTMH 4XTCS 2DUDA 3K7AH 2ES2A 4R4OA 1PYBA 4GLAC 1LTLA 1NE3A 1X56A 2NN6I 5IT9c 3DLLA 1GVPA 1SFOH 4LW1A 1JJGA 1EWIA 3HOXG 2AHOB 4OWTB 3UDXA 1IBLQ 1SR3A 1C7YA 2YTVA 3STBC 2R92H 5FLMG 4JOIC 1OXVA 4LF8L 1MIUA 1V43A 3L7ZC 4JI8Q 1XMQL 1XNQQ 2K5NA 3HOWH 2A1AA 2JQOA 4A3KH 2UUCQ 5GADC 2YV5A 5IP9G 1HNZL 2JA9A 1VQHA 2NVYH 4OXPA 4P74A 1XPUA 3S15H 1B7YB 4DR3L 3PUZA 3H0GG 1A62A 2HIVA 1HNXL 2CWAA 5IYCH 4GNXB 1YI2A 1IXRA 3S16H 4AYBE 2UU9Q 3F2CA 1C0AA 4A3GG 1D8LA 1VQOA 2UXDQ 1LYLA 2WAQG 4BBRH 5IYBG 1Q82C 5C3EH 2A8VA 1E22A 3HFZB 4JV5Q 4WJ3M 1N33L 2NZOA 2YU9H 4BXXG 5AJ3Q 4ALPA 4YCWA 2WB1G 4YWLA 3M4PA 2E5LL 2QA4A 5LMNL 4X6AH 3GTKH 4MZ9A 1IBKQ 3EBEA 1SRUA 2QGQA 5C4JH 1JMCA 2F4VL 4DR3Q 4HIKA 4YY3Q 2MO0A 4JCVE 2OCEA 3CCUA 2BA0A 3TREA 5C0XG 2N78A 2JE6I 2NN6G 5JJIA 4A93H 3HKSA 3NENA 1IZ6A 4GNXA 5E7NA 2VL6A 1FVIA 1VQMA 4DAMA 3S2DH 1VCIA 4ME3A 5FLXc 2ZM6Q 1I6HH 3HOVG 2KENA 4GLVB 4IJHA 2AWOA 3CCMA 3RZOH 4A3BG 5IP7G 1HZ9A 2MQHA 4A3FH 4DR1L 2NVTH 1C9OA 1HNWL 1XJVA 1K8GA 4DV6L 1IBMQ 2ZTEA 3M7NA 2OWOA 4JBWA 4A3JH 3HKZG 2VQFQ 3PIPA 2NVQH 1Q1BA 2UXCL 3PO3H 4A3EH 1PH7A 4X65L 1YEZA 2N8NA 4A3MH 3UE1A 2WP8J 4LF9Q 1KQSA 5IYDG 1SROA 4R4QA 2VS1A 5LMUL 4LFBQ 4Y52H 5M3MH 2K4KA 1EQRA 3KDFA 4A3CG 2JA5H 4O0AA 1EIFA 4JI1L 2JA7H 3HOZG 3RN5A 1G291 2IX0A 2Q2HA 4RG1A 3GDEA 4YHHQ 1IBKL 2F4VQ 1SMXA 2E2IH 4BY7G 1K73C 2CQOA 2K52A 4YY3L 2QEXA 5C0XI 2HHHQ 4BY1H 1XPOA 2VUMG 1KRTA 1JB7A 1N36Q 5C44G 4JG2A 3W1GA 3U50C 2F52A 3TQYA 2EQSA 2PI2A 2BH2A 4DV6Q 1E1OA 3CPWA 3PO2H 5C4XG 5M3FG 4R4IA 3Q8DA 3OTOL 3RLNA 2RCNA 2ID0A 5GAHC 4GN5A 1AE3A 3CPFA 5GQOA 3PUWA 4JI3L 4MNOA 3S1QH 3J80i 3RLFA 5C44H 4DUZL 3KFUA 1KC8C 2KBNA 1SN8A 1E24A 1L1OB 4BY1G 1X54A 1YNXA 1FGUA 4IOAA 2C35B 1XNQL 1HH2P 1M90C 2E2HH 2ASBA 3G6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHW A;  4UP7 A;  4X62 L;  1WJJ A;  2VY3 A;  5ELO A;  2N3S A;  2JA7 G;  2GN5 A;  2IHE A;  2JA5 G;  1K3R A;  1QZG A;  1VS0 A;  4A3C H;  4QQB X;  3I4N G;  3T1Y Q;  5JJL A;  3G48 A;  2UXB Q;  5IYD H;  4R1J A;  1YJN A;  2Q2T A;  3PF5 A;  2ZTD A;  4LUZ A;  4A3E G;  4NXN L;  4LNQ A;  1VQK A;  2R93 G;  1YHQ A;  3CP0 A;  4LWC A;  4DR2 Q;  2UUA Q;  1L2F A;  3CXC A;  4AQY L;  2D0O A;  4TQU S;  3ULJ A;  1YJ9 A;  4LF6 L;  1WCM H;  4HID A;  4A3J G;  4X62 Q;  1FJG L;  5FJ8 H;  1VQC A;  4JI4 Q;  3KF6 B;  4OO1 G;  3M4O H;  3A5Z B;  3G4S A;  1TXY A;  4JOI A;  4NB3 A;  1UE6 A;  2AMC B;  4A3F G;  5IP7 H;  2UU9 L;  3E9H A;  2BA1 A;  4Y7N H;  1YHA A;  3CCR A;  1X3G A;  1YBY A;  2VQE L;  3D31 A;  4IPC A;  1VQ4 A;  3CCV A;  2NVX H;  4B3S L;  3K0X A;  2Y0S E;  1Q8K A;  1JJC B;  3K81 C;  3F2B A;  3ICE A;  3CQZ H;  3TRZ A;  1BVS A;  2K14 A;  3I55 A;  3GO5 A;  1J5E Q;  3JC6 6;  4LF7 Q;  4GKK L;  2HQL A;  4EX5 A;  4DR6 L;  2I0Q A;  1YIJ A;  2KCT A;  3A74 A;  3NEM A;  3UDF A;  3U4V A;  1PH4 A;  2OTJ A;  4IO9 A;  1FL0 A;  3GTO H;  1LUZ A;  3H3V I;  2PMZ E;  4QY7 A;  2I5M X;  4MTN A;  3I56 A;  4DR5 L;  3I7F A;  4RMF A;  5IWA L;  3KYH C;  1QVG A;  4BXX H;  1X3F A;  2K5V A;  1QUQ A;  3CMA A;  3J7Z C;  3D0F A;  2VW9 A;  4DV3 L;  2CKZ B;  1PFS A;  2CFM A;  4IOC A;  3JAM i;  2F3I A;  1EIY B;  4JI6 Q;  4LF4 L;  4A3G H;  4LF7 L;  4A3L G;  1WI5 A;  5IYC G;  1TWC H;  3S1R H;  1I3Q H;  1VQE A;  2PQA B;  3GD7 A;  1XPR A;  4JI7 Q;  4KHP Q;  3H0G H;  4FDB A;  1UWV A;  2LXK A;  2B29 A;  4AIM A;  2VQE Q;  4A75 A;  2UUA L;  1KXL A;  1H95 A;  2NZH A;  4X66 L;  5H1S E;  4B3R L;  1PV4 A;  2Z0S A;  4K0K Q;  2IY5 B;  3KJO A;  4NPS A;  2YTY A;  3S24 A;  2MNA A;  1PH2 A;  4LF9 L;  1OXS C;  2HT1 A;  1OXT A;  4YWK A;  5GAE C;  3KJP A;  3EN2 A;  3WWV A;  4DK3 C;  5HGQ A;  4UPA A;  2FXQ A;  2EXD A;  4DV3 Q;  4A3I H;  4B3M Q;  2R92 G;  1T9H A;  1YHB A;  4LFC L;  1Q12 A;  1HNX Q;  3HOX H;  4WJ4 A;  1JE5 A;  2OQ0 A;  3F8T A;  1PH3 A;  1I50 H;  4GOP A;  4QL5 A;  4BBS G;  3OTO Q;  2PQA A;  1VQF A;  2UUC L;  4C2M H;  1MJE A;  4JV5 L;  1XMO Q;  4X66 Q;  3KOJ A;  3FKI G;  3GTJ H;  5K36 G;  2JEA I;  1Z47 A;  1VQB A;  4B3T L;  2B63 G;  4DV7 L;  4HJ9 A;  3RZD H;  2B63 H;  2WFW A;  4JI2 L;  3OYY A;  4JI8 L;  1XMQ Q;  1I94 Q;  3H3V H;  1E3P A;  2D0P A;  3T1H L;  3H15 A;  1HR0 L;  1TWG H;  3MXN B;  4DR7 L;  1VQD A;  4QJF A;  2GVA A;  4B3R Q;  4DV4 L;  1A63 A;  3J81 i;  4LF4 Q;  4BBS H;  1VQ9 A;  4DNI A;  2JA6 H;  4DUY Q;  3CME A;  1L0W A;  1XMO L;  4KI0 A;  2D62 A;  2R6G A;  5ELN A;  3KLW A;  3L0O A;  3RR5 A;  5LMN W;  4DUZ Q;  3J80 c;  2R7Z G;  3ULP A;  4KHP L;  4HJ7 A;  2Z6K A;  4YWM A;  2B3G A;  5EAY A;  4A3I G;  3I4M G;  1OTC A;  1Y14 B;  4IPH A;  1ASZ A;  3K80 C;  1NMG A;  1V1Q A;  4YCU A;  1EYG A;  3T1H Q;  1QVC A;  3PUV A;  3AFQ A;  1L1O C;  4DV5 Q;  1Y1W G;  2KCM A;  4JI0 Q;  4DV0 Q;  3LGJ A;  4B3M L;  4IFD I;  2VNU D;  5GRO A;  1N8R C;  2IT1 A;  1OXU A;  4DKA C;  2AWN A;  1HNW Q;  4JBJ A;  4A3L H;  4DR4 L;  1E7Z A;  1QZH A;  4JI2 Q;  1W2B A;  1OXX K;  4PZ6 A;  3VDY A;  4LFB L;  1UE1 A;  3ER0 A;  4TVA B;  1VQP A;  4GS3 A;  1VQN A;  2UXC Q;  4YCV A;  1HR0 Q;  4A3D H;  3CCS A;  4HIM A;  4AQY Q;  1UE5 A;  1GM5 A;  2I5H A;  4LF6 Q;  2R93 H;  4X65 Q;  3ERS X;  2JJQ A;  1Y1V H;  1R9T H;  4C3J H;  1NJI C;  1X65 A;  4A4I A;  4DV7 Q;  4X64 L;  4DR1 Q;  1Z9F A;  3PGZ A;  3IRB A;  4DV1 L;  2XGT A;  2IX1 A;  4JYA L;  1IBM L;  1LM0 A;  1VQ5 A;  1ASY A;  3M4Q A;  3CCJ A;  3KF8 B;  4QGU A;  5JJK A;  2DGY A;  1PH8 A;  1AH9 A;  2A19 A;  2Y0S G;  4DV4 Q;  4PG3 A;  1MKH A;  4P71 A;  3F2D A;  4LUV A;  1QVF A;  1S3O A;  4L5T A;  4IFD J;  1J5E L;  1XNR Q;  4GKK Q;  1VQ7 A;  2V1C C;  3HOY G;  3RLO A;  1SLJ A;  3ZJY C;  1RIP A;  1M1K C;  3S14 H;  1RL2 A;  4R4T A;  1CUK A;  3EIV A;  2LSS A;  1KL9 A;  3AFP A;  4AYB G;  1PHJ A;  3E9I A;  5FJ8 G;  1V9P A;  4IFD G;  5IE8 A;  2MO1 A;  1U5K A;  1K0R A;  1WCM G;  1O7I A;  1P16 A;  1CKM A;  3TS2 A;  4UY8 C;  1CKN B;  1HJP A;  4H02 A;  1YIT A;  4UP9 A;  3A0J A;  1X9N A;  2RHS B;  1N9W A;  2XTI A;  4PMW A;  3AYH B;  3PIO A;  4JI6 L;  4GNX C;  4L5S A;  1TWA H;  2IHF A;  1SE8 A;  2ATW A;  2JA8 H;  1BBU A;  3FP9 A;  3I4N H;  2PNH A;  1PYS B;  1WYD A;  5HY6 A;  4LF5 Q;  1UE7 A;  3U4Z A;  3S1M H;  4AH6 A;  3HOU H;  1NBW A;  4LUO A;  3I4O A;  2VQF L;  1NMF A;  2EIF A;  4UP8 A;  1PH6 A;  4OX9 Q;  1UEB A;  3CAM A;  4OON A;  1KAW A;  3S17 H;  2ZM6 L;  3PUY A;  3PSI A;  1BKB A;  5BR8 Q;  1KD1 C;  1B70 B;  4NXM Q;  3S1N H;  4KHZ A;  1K9M C;  4B3T Q;  5J3B A;  3NBH B;  1IL2 A;  1PA6 A;  4JI5 Q;  1JJ2 A;  4OO1 I;  1YJW A;  3ULL A;  5JEA J;  2RF4 A;  1VQG A;  1XNR L;  4B3S Q;  4DR7 Q;  2JK8 A;  2L15 A;  2HIX A;  3CC7 A;  4QIW E;  1Q46 A;  5M3F H;  5C4X H;  1HZA A;  4JBM A;  4JI4 L;  3PO2 G;  3W1B A;  4DV2 L;  2ZTC A;  4OX9 L;  4P72 A;  1N32 L;  2PI2 E;  1K8A C;  4JBK A;  3I2Z A;  3CD6 A;  3DM3 A;  1G6P A;  3UE0 A;  2VUM H;  4DR2 L;  2RHQ B;  4OWX B;  3G71 A;  4BY7 H;  2K5H A;  4GLX A;  3STB D;  1VQJ A;  1I5F A;  1K83 H;  2BH8 A;  4R4C A;  1XTD A;  4DAY B;  4YHH L;  4DUY L;  3HOU G;  3HOZ H;  4LFA L;  4DR6 Q;  1Q81 C;  1QUQ B;  4KLK A;  4DK6 C;  4HJ5 A;  1G51 A;  5M3M G;  1IBL L;  5JEA G;  4GN4 B;  2JA8 G;  3GTG H;  3CC4 A;  3M9B A;  1N36 L;  4JI1 Q;  2Q2U A;  4DR4 Q;  3OW2 A;  4IJL A;  4GOP B;  4JI5 L;  1KHI A;  3F1Z A;  1X6O A;  2WAQ E;  2K50 A;  3NEL A;  4PZ8 A;  2LXJ A;  4A3M G;  3U58 A;  3JAM c;  1PH1 A;  3PO3 G;  2CWP A;  3BZK A;  5IWA Q;  1EQQ A;  3RN2 A;  1HR0 W;  2WB1 E;  2ZJR A;  3MEF A;  4DV5 L;  4DV0 L;  3K7U C;  3SGI A;  2Z6K C;  1VQL A;  5M5W H;  3CCE A;  3GTL H;  3S2H H;  1KRS A;  4C3I H;  4LFA Q;  4JI7 L;  1D7Q A;  3T1Y L;  4A3B H;  1VQ8 A;  4PZ7 A;  3HOV H;  4A76 A;  3CC2 A;  3HOY H;  2UXB L;  2N49 A;  1DGS A;  1W3S A;  4L5Q A;  2KHJ A;  4GKJ Q;  1CSP A;  2AKW B;  1AE2 A;  4POF A;  3L2P A;  4K0K L;  1VQI A;  4BA1 I;  3AEV A;  3KF6 A;  1A8V A;  4DV2 Q;  4A93 G;  3CW2 C;  3PUX A;  1B8A A;  3RNU A;  1S72 A;  1N32 Q;  3J81 c;  1S40 A;  4X64 Q;  1GO3 E;  1TWF H;  2OTL A;  3BZC A;  4DV1 Q;  1EFW A;  4XIG S;  1CSQ A;  1IYJ B;  3J81 j;  2UUB Q;  4IPD A;  1WOC A;  1YVC A;  1A0I A;  2H5X A;  5M5X H;  1X55 A;  1HZC A;  2KHI A;  1Y1V G;  3HKZ E;  4IPG A;  2ZJP A;  4EQ5 A;  1MJC A;  1N34 L;  1KIX A;  3BU2 A;  3GTP H;  2OQK A;  2CCZ A;  4GKJ L;  4A3D G;  4HJ8 A;  1E1T A;  3UDI A;  1HZB A;  5C3E G;  1BBW A;  4BBR G;  5IYB H;  3TS0 A;  5C0X J;  4P73 A;  4OWW B;  1FJG Q;  4P75 A;  1NTG A;  2YTX A;  1PH9 A;  2Q2I A;  1CKN A;  1I94 L;  1P8L A;  1Q1E A;  4GOP C;  1U0L A;  2YYZ A;  1CKO A;  4GN3 B;  5GAG C;  4HJA A;  4NXN Q;  4JC0 A;  1X3E A;  1Y1W H;  1EOV A;  1Q7Y C;  2I5L X;  4LF5 L;  5IP9 H;  4A3K G;  3UDG A;  1TWH H;  2MFI A;  1PVO A;  3HOW G;  2R7D A;  2E2J H;  3M3Y H;  2HHH L;  1GD7 A;  4L5R C;  4C3H H;  3I4M H;  1JT8 A;  5FLM H;  2ALY B;  5LMU Q;  3CCQ A;  5M5Y H;  2R7Z H;  4POG A;  2GVB A;  2VZA A;  1NY4 A;  3B6Y A;  2K75 A;  4LF8 Q;  4DPG A;  4BA2 I;  3BJU A;  2JA6 G;  1YZ6 A;  3CF5 A;  4HIO A;  3W5O A;  1GKH A;  3AQQ A;  1N34 Q;  1HNZ Q;  1J6Q A;  5IY0 A;  1PH5 A;  4JI0 L;  3M85 A;  3PF4 A;  5AJ3 L;  4JI3 Q;  2JEB I;  3E0E A;  3PCO B;  2E5L Q;  2R7F A;  5DLQ E;  5BR8 L;  5LMN Q;  2UUB L;  4NXM L;  1VQ6 A;  4J15 A;  1VQA A;  3J7A 5;  1WFQ A;  3GTQ H;  3K8A A;  2E8G A;  3PV0 A;  4O2D A;  4APV A;  4JYA Q;  2UXD L;  4LFC Q;  3A5U A;  3CCL A;  3TEH B;  4DR5 Q;  1EUJ A;  3FKI H;  1L1O A;  3KDF B;  1Q86 C;  2ZJQ A;  1N33 Q;  3GTM H;  4XTC S;  2DUD A;  3K7A H;  2ES2 A;  4R4O A;  1PYB A;  4GLA C;  1LTL A;  1NE3 A;  1X56 A;  2NN6 I;  5IT9 c;  3DLL A;  1GVP A;  1SFO H;  4LW1 A;  1JJG A;  1EWI A;  3HOX G;  2AHO B;  4OWT B;  3UDX A;  1IBL Q;  1SR3 A;  1C7Y A;  2YTV A;  3STB C;  2R92 H;  5FLM G;  4JOI C;  1OXV A;  4LF8 L;  1MIU A;  1V43 A;  3L7Z C;  4JI8 Q;  1XMQ L;  1XNQ Q;  2K5N A;  3HOW H;  2A1A A;  2JQO A;  4A3K H;  2UUC Q;  5GAD C;  2YV5 A;  5IP9 G;  1HNZ L;  2JA9 A;  1VQH A;  2NVY H;  4OXP A;  4P74 A;  1XPU A;  3S15 H;  1B7Y B;  4DR3 L;  3PUZ A;  3H0G G;  1A62 A;  2HIV A;  1HNX L;  2CWA A;  5IYC H;  4GNX B;  1YI2 A;  1IXR A;  3S16 H;  4AYB E;  2UU9 Q;  3F2C A;  1C0A A;  4A3G G;  1D8L A;  1VQO A;  2UXD Q;  1LYL A;  2WAQ G;  4BBR H;  5IYB G;  1Q82 C;  5C3E H;  2A8V A;  1E22 A;  3HFZ B;  4JV5 Q;  4WJ3 M;  1N33 L;  2NZO A;  2YU9 H;  4BXX G;  5AJ3 Q;  4ALP A;  4YCW A;  2WB1 G;  4YWL A;  3M4P A;  2E5L L;  2QA4 A;  5LMN L;  4X6A H;  3GTK H;  4MZ9 A;  1IBK Q;  3EBE A;  1SRU A;  2QGQ A;  5C4J H;  1JMC A;  2F4V L;  4DR3 Q;  4HIK A;  4YY3 Q;  2MO0 A;  4JCV E;  2OCE A;  3CCU A;  2BA0 A;  3TRE A;  5C0X G;  2N78 A;  2JE6 I;  2NN6 G;  5JJI A;  4A93 H;  3HKS A;  3NEN A;  1IZ6 A;  4GNX A;  5E7N A;  2VL6 A;  1FVI A;  1VQM A;  4DAM A;  3S2D H;  1VCI A;  4ME3 A;  5FLX c;  2ZM6 Q;  1I6H H;  3HOV G;  2KEN A;  4GLV B;  4IJH A;  2AWO A;  3CCM A;  3RZO H;  4A3B G;  5IP7 G;  1HZ9 A;  2MQH A;  4A3F H;  4DR1 L;  2NVT H;  1C9O A;  1HNW L;  1XJV A;  1K8G A;  4DV6 L;  1IBM Q;  2ZTE A;  3M7N A;  2OWO A;  4JBW A;  4A3J H;  3HKZ G;  2VQF Q;  3PIP A;  2NVQ H;  1Q1B A;  2UXC L;  3PO3 H;  4A3E H;  1PH7 A;  4X65 L;  1YEZ A;  2N8N A;  4A3M H;  3UE1 A;  2WP8 J;  4LF9 Q;  1KQS A;  5IYD G;  1SRO A;  4R4Q A;  2VS1 A;  5LMU L;  4LFB Q;  4Y52 H;  5M3M H;  2K4K A;  1EQR A;  3KDF A;  4A3C G;  2JA5 H;  4O0A A;  1EIF A;  4JI1 L;  2JA7 H;  3HOZ G;  3RN5 A;  1G29 1;  2IX0 A;  2Q2H A;  4RG1 A;  3GDE A;  4YHH Q;  1IBK L;  2F4V Q;  1SMX A;  2E2I H;  4BY7 G;  1K73 C;  2CQO A;  2K52 A;  4YY3 L;  2QEX A;  5C0X I;  2HHH Q;  4BY1 H;  1XPO A;  2VUM G;  1KRT A;  1JB7 A;  1N36 Q;  5C44 G;  4JG2 A;  3W1G A;  3U50 C;  2F52 A;  3TQY A;  2EQS A;  2PI2 A;  2BH2 A;  4DV6 Q;  1E1O A;  3CPW A;  3PO2 H;  5C4X G;  5M3F G;  4R4I A;  3Q8D A;  3OTO L;  3RLN A;  2RCN A;  2ID0 A;  5GAH C;  4GN5 A;  1AE3 A;  3CPF A;  5GQO A;  3PUW A;  4JI3 L;  4MNO A;  3S1Q H;  3J80 i;  3RLF A;  5C44 H;  4DUZ L;  3KFU A;  1KC8 C;  2KBN A;  1SN8 A;  1E24 A;  1L1O B;  4BY1 G;  1X54 A;  1YNX A;  1FGU A;  4IOA A;  2C35 B;  1XNQ L;  1HH2 P;  1M90 C;  2E2H H;  2ASB A;  3G6E A; 
#chains in the Genus database with same CATH topology
 3FHW A;  2E2D C;  4CJ1 B;  5ELO A;  1EY6 A;  5C3E B;  4QQB X;  3BVM A;  3V96 A;  5JJL A;  5I6Y A;  3G48 A;  2A6H C;  1I4G A;  1PFB A;  4QUC A;  4DXG A;  2ZTD A;  1PRT B;  4LNQ A;  1TR5 A;  4DR2 Q;  1Y8P B;  5C4X B;  2UUA Q;  1L2F A;  5K5P A;  2I46 A;  1LTI D;  4A3J G;  3HOX B;  1SAP A;  4JI4 Q;  3A5Z B;  1RKN A;  3G4S A;  1UE6 A;  4A3F G;  2UU9 L;  3E9H A;  1YBY A;  3D31 A;  2JA8 B;  1ML0 D;  3CCV A;  4B3S L;  3ICE A;  3TRZ A;  1JJC B;  4DA2 A;  1D1K A;  4BS9 A;  1B9N A;  4LF7 Q;  3JC6 6;  3A7A B;  4GKK L;  3TP7 A;  2TSS A;  2KCT A;  3FMC A;  4H7B A;  4RH6 A;  1PH4 A;  2K33 A;  4FNF A;  2R7Z B;  1GUT A;  4C3J G;  2HCC A;  5KYL A;  2F0G A;  4OL7 A;  3H3V I;  4B9X A;  2AUJ D;  3I56 A;  1ZYR C;  1QVG A;  3J7A F;  1X3F A;  1QUQ A;  1F2Z A;  2VW9 A;  2CFM A;  2F3I A;  1E0B A;  1Z7T A;  3VR3 A;  1TWC H;  3KBX A;  1I3Q H;  2PQA B;  3BZD B;  4TRD A;  3H0G H;  5AFW A;  1UWV A;  5JPM C;  2LXK A;  4KV6 A;  4A75 A;  1FNW A;  1CI3 M;  5H1S E;  2E2J B;  2RDG A;  2J7Z A;  1D5Z C;  4K0K Q;  1OXT A;  3WWV A;  4A3I H;  2R92 G;  4UPA A;  1TY0 A;  3ITP A;  2F0I A;  1SBB B;  2B2V A;  2OQ0 A;  4DK1 A;  1I50 H;  3V05 A;  2AQ2 B;  4QL5 A;  4GOP A;  2L5T A;  4K8I A;  2KUM A;  4BWG B;  3VYR A;  1MJE A;  5D14 A;  5BN5 A;  1BUV T;  3GTP B;  1A2U A;  2JEA I;  5KNC A;  3BVZ A;  1VQB A;  2B63 G;  1U4M A;  3OYY A;  2F03 A;  1E3P A;  3DWA A;  3T1H L;  4HR7 B;  5C4H A;  4DR7 L;  3S2H B;  3M3Y B;  1M4V A;  1V8Q A;  2J0T D;  4FF4 A;  3JAM E;  4XT3 B;  3CME A;  1A3U A;  1C8C A;  2EYP A;  1TWG B;  4PQX A;  1H9J A;  4A3I G;  2VXW A;  1NR2 A;  3WOF A;  4IPH A;  5EQ0 A;  1NMG A;  3T1H Q;  1QVC A;  3AFQ A;  4DV5 Q;  1SND A;  4QF4 A;  3LGJ A;  4IFD I;  1MBY A;  1ET9 A;  1VF5 C;  2DN8 A;  2IT1 A;  3ZYY X;  1X32 A;  2AWN A;  4JBJ A;  4DR4 L;  1QZH A;  1OXX K;  1UE1 A;  2BDN A;  4IUU A;  1VQP A;  4GS3 A;  1VQN A;  2UXC Q;  3VR4 A;  3CCS A;  1A15 A;  1IKM A;  4X65 Q;  1FNV A;  1NJI C;  1X65 A;  2EJF C;  4HMJ A;  2KEC A;  4X64 L;  1ET6 A;  1Z9F A;  1JC7 A;  1ASY A;  2Z1C A;  2O5I C;  3CCJ A;  4QGU A;  1QNK A;  2DGY A;  1H9S A;  2Y0S G;  4PG3 A;  3I91 A;  1QVF A;  1II3 A;  1S3O A;  3HZX A;  5EJW A;  4G7Z C;  1LT4 D;  1XNR Q;  2PPB C;  1KLU D;  5CV5 A;  3KLR A;  4R4T A;  5EPK A;  2LSS A;  1KL9 A;  3AFP A;  5IGG A;  4C3I G;  2A68 D;  4RGN A;  1EL0 A;  1H9S B;  4LMQ D;  1CT1 D;  1O7I A;  3TS2 A;  4UY8 C;  1CKN B;  3PO2 B;  1S4Z A;  2ZXP A;  4UP9 A;  3VA5 A;  1KDC A;  2XTI A;  3PIO A;  3IAY A;  4JI6 L;  1HRJ A;  4KMU C;  3EVQ A;  1XXG A;  2IHF A;  4FXK C;  1SE8 A;  2JA5 B;  2ZXO A;  2ATW A;  3FP9 A;  3I4N H;  1TWH B;  3MAQ A;  3JAM L;  5HY6 A;  1I4R A;  1UE7 A;  1SNM A;  1NBW A;  3DMU A;  3TME A;  2B39 A;  1Y8N B;  1I4H A;  4OON A;  4DNT B;  3PUY A;  1CA6 A;  4NXM Q;  1SDF A;  3S1N H;  1TQO A;  3NQI A;  4J6H A;  2PYK A;  2FFK B;  1JJ2 A;  5C5M A;  1YJW A;  3S17 B;  5JEA J;  2RF4 A;  1XNR L;  4B3S Q;  4H0L C;  5D3D A;  5JAV A;  3PO2 G;  2GA4 B;  4JI4 L;  1JCK B;  2ZTC A;  2NZ1 D;  1BCP B;  1N32 L;  2PI2 E;  3ND9 A;  4JBK A;  3MXN A;  1DD2 A;  2DNE A;  1JOR A;  4LK1 C;  1ZEQ X;  4DR2 L;  3FVQ A;  2BH8 A;  1LAB A;  1XTD A;  5M3F B;  5CYU A;  1PDQ A;  4DAY A;  1IBL L;  2Q8T A;  2Q2U A;  4DR4 Q;  1KHI A;  4PZ8 A;  2K50 A;  4AYB B;  3JAM c;  1RTO A;  2CWP A;  1EQQ A;  3RN2 A;  4DV5 L;  1IYU A;  4XQN A;  3IL8 A;  3GTL H;  3CCE A;  1WD1 A;  4QUF A;  4C3I H;  4LFA Q;  4JI7 L;  1D7Q A;  1SE3 A;  4CDC C;  5ELD A;  4F88 A;  3HOV H;  3S1R B;  2O4X A;  4L5Q A;  2XSC A;  4A3J B;  1CSP A;  1NCV A;  4PMB A;  2A69 D;  4DV2 Q;  1GOZ A;  1ROD A;  2NN6 H;  3J81 c;  1F9R A;  3GTM B;  4DV1 Q;  1LTA D;  1IYJ B;  3J81 j;  1YVC A;  4XQQ A;  2H5X A;  3MEH A;  1HZC A;  1BCP D;  3HKZ E;  5CBA E;  2F0W A;  1MJC A;  3BU2 A;  3GTP H;  1KAA A;  1F9Q A;  1PLF A;  1QOH A;  2M2L A;  3TS0 A;  4P73 A;  3C3L A;  1PMR A;  4P75 A;  1PH9 A;  4I7Z C;  2K05 A;  4HAE A;  4GOP C;  3J7Y W;  3VYU A;  4LF5 L;  4ULL A;  2MFI A;  1WTX A;  5BN4 A;  1PVO A;  4IQZ A;  2BCO A;  4IUQ A;  2E2J H;  3A54 A;  2HHH L;  3I4M H;  2EYM A;  1JT8 A;  5FLM H;  2NTS A;  4POG A;  1YNN C;  2GVB A;  2Q8R E;  1NY4 A;  3B6Y A;  3KF8 A;  2JA6 G;  1YZ6 A;  1TY2 A;  4TKO B;  1J6Q A;  2R92 B;  5AJ3 L;  1UEA B;  4MN3 A;  1ICW A;  4C3H B;  3BS1 A;  2UUB L;  4NXM L;  4ID6 A;  2MHV A;  2E8G A;  1KTK A;  4CJ2 C;  2UXD L;  2PZT A;  3CCL A;  3TEH B;  1L1O A;  1PXU A;  1VMC A;  3TDQ A;  1EY0 A;  3D6W A;  4J1M A;  2HUG A;  4R4O A;  1PYB A;  1B2T A;  3HEJ A;  5IT9 c;  3DLL A;  1JJG A;  1SFO H;  3HOX G;  4R9W A;  1MGS A;  3UDX A;  1SR3 A;  1HFN A;  1GUG A;  1NR4 A;  1OXV A;  5I9P A;  1V43 A;  4JI8 Q;  1XNQ Q;  4BBR B;  3E5S A;  3HOW H;  2AQ1 B;  2YV5 A;  3K7A B;  4WRD A;  5IP9 G;  1JQY D;  1CFM A;  2NVY H;  3PUZ A;  5EKK A;  1YI2 A;  4AYB E;  2UU9 Q;  1ESR A;  4BBR H;  1Q82 C;  5C3E H;  4WJ3 M;  1E22 A;  2RDF A;  2YU9 H;  2ZT9 C;  5KRU A;  2WB1 G;  4ALP A;  4YWL A;  2F4I A;  2FMC A;  1I4Q A;  1QB5 D;  5LMN L;  4X6A H;  3K5O A;  3GTK H;  2FMM A;  1TII D;  1H9R A;  1JMC A;  2KQ3 A;  1RHP A;  2BE5 C;  1PTO B;  4IN3 A;  3CCU A;  2BA0 A;  2N78 A;  2EJG C;  3GQB A;  4A93 H;  4B08 A;  1FD7 D;  1RJT A;  1PYW D;  3S2D H;  1VCI A;  2K5W A;  1DXM A;  4KY7 A;  4ME3 A;  3VA7 A;  4DXF A;  1I6H H;  4UDU C;  4GLV B;  4A3B G;  4C1N I;  2RSO A;  2IJ0 A;  4DR1 L;  4A3F H;  2NVT H;  4LAA A;  2LY7 A;  2ZXR A;  3Q24 A;  1ILQ A;  4DV6 L;  1IBM Q;  5T1I A;  3RZD B;  2OWO A;  3NTI A;  3NXW A;  4JBW A;  1K0S A;  4F8M A;  1Q1B A;  4C56 C;  3PO3 H;  2L4N A;  4A3M H;  4K5V A;  4I65 A;  2N55 A;  4NDX A;  5M5X B;  3QOJ A;  3FRP B;  2B63 B;  1EIF A;  1AZQ A;  1BXT A;  1G29 1;  3GDE A;  4BY7 G;  4FF3 A;  3A8K E;  2K52 A;  2QEX A;  2VUM G;  1DJR D;  1JB7 A;  5C44 G;  3UI2 A;  4N9T A;  2EQS A;  2PI2 A;  2KVM A;  1HQM C;  4R4I A;  3PIO 3;  2K01 A;  4ZUJ A;  5FK9 C;  3RLN A;  1SJH D;  2ID0 A;  2RCN A;  5GAH C;  3K0Y A;  1QJO A;  4JI3 L;  4MNO A;  3S1Q H;  2DJG C;  5KNB A;  5HGT A;  3J80 i;  4DUZ L;  3NHH A;  2IW3 A;  1KC8 C;  1A3T A;  1E24 A;  1L1O B;  1FGU A;  1XNQ L;  1M90 C;  3MXP A;  4UP7 A;  3IFT A;  1BO0 A;  2JA7 G;  2GN5 A;  2IHE A;  1QZG A;  1K8M A;  2UXB Q;  1JB3 A;  5IYD H;  2PZU A;  3MHB A;  2QDL A;  1VQK A;  3CP0 A;  1SNC A;  4AQY L;  3CXC A;  1EY7 A;  1YJ9 A;  4LF6 L;  3ULJ A;  2XWB B;  1GUN A;  4IFD H;  2H1E A;  4RCN A;  4QMG A;  1PRT D;  4OO1 G;  4JOI A;  2BOS A;  1EOT A;  1DZ1 A;  1HCZ A;  2AMC B;  2NWG A;  3AU7 A;  3HRZ C;  1JWS D;  1X3G A;  1LT6 D;  5A2Q E;  4NW2 A;  1EYA A;  5JVG 3;  1AW7 A;  2E2I B;  1IL8 A;  2XRS D;  5FO7 B;  5C0X H;  4EX5 A;  1I4P A;  3S9W A;  3NEM A;  3HKZ B;  5I9O A;  1ENA A;  4IUR A;  2PMZ E;  4A3I B;  4QY7 A;  5C3W A;  4MTN A;  3S1M B;  1DOM A;  2Z4I A;  4RMF A;  5IWA L;  3KYH C;  1CA5 A;  4HSP A;  2K1B A;  3J7Z C;  3P7J A;  1PFS A;  3OMC A;  4IOC A;  2NYZ D;  1EIY B;  4A3G H;  4OIJ A;  4A3L G;  5IYC G;  1XPR A;  1VQE A;  3GD7 A;  4X3U A;  4FDB A;  4KJN A;  2K7V A;  3OMG A;  2VQE Q;  1W6K A;  2NZH A;  2WKD A;  2Z0S A;  3KJO A;  4NPS A;  2YTY A;  2MNA A;  1PH2 A;  4LF9 L;  1OXS C;  4YWK A;  5GAE C;  1STH A;  3VR5 A;  3EN2 A;  1JOQ A;  1CK1 A;  1O7Z A;  1X3Q A;  4DV3 Q;  3SXH A;  4KKT A;  2TMP A;  2FHT A;  1HNX Q;  2D2C C;  3NK9 A;  3HP3 A;  1VQF A;  2UUC L;  2PZW A;  4C2M H;  2Z9H A;  4X66 Q;  3GTJ H;  1K8O A;  2B8F A;  1JOO A;  4XYQ A;  5LL6 S;  3RZD H;  4JI2 L;  1XMQ Q;  3H3V H;  5HUR A;  3RD4 A;  2A74 C;  2LFN A;  4F87 A;  1TWG H;  3MXN B;  4G4K A;  3D4W A;  3I70 A;  5ELC A;  4QJF A;  3KUP A;  4BBS H;  2BE5 D;  4RGT A;  4DUY Q;  4V19 0;  3AB9 A;  4A3G B;  2D62 A;  5ELN A;  4DUZ Q;  3RR5 A;  4KHP L;  4MTK A;  1EIG A;  3ULP A;  1QE6 A;  5EAY A;  1ASZ A;  1ZYR D;  1YNN D;  4BBS B;  3C46 A;  4JI0 Q;  2F0K A;  2IWH A;  4B3M L;  4CGY B;  2YU9 B;  1EZ8 A;  3H09 A;  1MD2 D;  1HNW Q;  4RHS A;  2CHB D;  4JI2 Q;  2E75 C;  4PZ6 A;  1Q3L A;  2F0V A;  4A3D H;  3P75 A;  2R93 H;  1GJX A;  3ERS X;  1CZW A;  3C1F A;  3I73 A;  1PZK D;  5CV9 A;  4DV7 Q;  4DR1 Q;  2OEO A;  2IX1 A;  3PGZ A;  3IRB A;  2XGT A;  4XYO A;  1VQ5 A;  3RUZ A;  3M4Q A;  4JW0 A;  1AH9 A;  3F2D A;  1MKH A;  1PFM A;  1WTQ A;  4KN4 C;  4X3S A;  3BYY B;  1VQ7 A;  1B9M A;  1Y8O B;  2V1C C;  3S14 H;  2K03 A;  4AYB G;  1OO9 B;  4DGZ A;  1WTO A;  3R8B A;  4EGV A;  1HJP A;  1YIT A;  2F0H A;  1AEX A;  4DFA A;  4GNX C;  1LTG D;  5JEA H;  4CDE C;  1DM0 B;  2JA8 H;  1IYV A;  1WYD A;  1TS4 A;  2XN9 C;  4AH6 A;  4MIU A;  4LUO A;  2VQF L;  4FYD A;  1PH6 A;  4OX9 Q;  1UEB A;  3K58 A;  1KAW A;  3S17 H;  3R2T A;  1BKB A;  1KD1 C;  1LTT D;  3CRK C;  3NQT A;  3KLS A;  3NBH B;  2JP1 A;  4G57 A;  4JI5 Q;  1M8A A;  4L8J A;  2K32 A;  2F0D A;  2JK8 A;  3CC7 A;  2CH4 A;  2JXM B;  2K5Q A;  1HZA A;  1RF2 D;  1WVL A;  5J39 A;  3S14 B;  4JVZ A;  4DAP A;  1B4O A;  2QCP X;  1K8A C;  5IGB A;  3DM3 A;  3V2T A;  4BY7 H;  4OWX B;  3G71 A;  2K5H A;  1G91 A;  1VQJ A;  4R4C A;  1K83 H;  3HOU G;  1WTV A;  1O7L A;  1SXT A;  2BDO A;  5M3M G;  1T5X D;  3FEW X;  4GN4 B;  5JEA G;  4BY1 B;  3CC4 A;  1N36 L;  2A68 C;  1LLR D;  3OW2 A;  4GOP B;  1KDA A;  4JI5 L;  4CDD C;  2WAQ E;  3U58 A;  4OIK A;  3PO3 G;  1JR0 D;  5IWA Q;  4QCL A;  2C9O A;  2ZJR A;  5C5L A;  1JWM D;  4K2L A;  2EJM A;  3SGI A;  2Z6K C;  2FIN B;  5M5W H;  1TWF B;  1KRS A;  2NUC A;  4A3B H;  1VQ8 A;  1JWU D;  4A76 A;  2N49 A;  1KDB A;  2A5H A;  3N6R A;  3NTH A;  5E1F A;  1W3S A;  2DJF C;  2KHJ A;  3R2I A;  4XQJ A;  5CV7 A;  2AKW B;  3I90 A;  3GV6 A;  3CW2 C;  3RNU A;  4U67 3;  1S40 A;  4IUT A;  3S1N B;  3HS0 C;  2P5Z X;  3DM1 A;  3BZC A;  2AQ3 B;  2E76 C;  3W2D A;  3MTS A;  1EFW A;  1CSQ A;  1WOC A;  5M5X H;  1A0I A;  2B8G A;  4PNY A;  4CDF C;  4ODG A;  1Y1V G;  4IPG A;  4EQ5 A;  2EZV A;  1TS5 A;  1N34 L;  1KIX A;  2OQK A;  1H9M A;  1K83 B;  4HJ8 A;  3UDI A;  5C3E G;  4BBR G;  3DUZ A;  2KCN A;  3BDO A;  1SFO B;  1FJG Q;  1NTG A;  2YTX A;  4HMI A;  3MA2 B;  1Q1E A;  3SK5 A;  1Q7Y C;  2I5L X;  3J81 L;  3UDG A;  3HOW G;  2WII B;  3T53 B;  3M3Y H;  1GD7 A;  4C3H H;  5M9O A;  4C3I B;  1PTO F;  1EEI D;  3CCQ A;  2QEJ C;  5M5Y H;  2VZA A;  4LF8 Q;  2V4D A;  4BA2 I;  4KY6 A;  2EDG A;  1SYE A;  3W5O A;  1N34 Q;  1ZKO A;  3NPP A;  4JI0 L;  1DCZ A;  3M85 A;  3PF4 A;  1EFI D;  4M1U B;  4UAI A;  3I4M B;  2R7F A;  5DLQ E;  2JA7 B;  2C5C A;  1VQ6 A;  1VQA A;  3J7A 5;  5LL6 X;  3SE0 A;  3HGB A;  1EUJ A;  3KDF B;  5IGF A;  3VYT A;  4XTC S;  2DUD A;  1PTO D;  3C1E A;  3K7A H;  1NE3 A;  1X56 A;  2NN6 I;  1VMP A;  3NUC A;  1EWI A;  1D5M C;  4LJZ C;  1WTP A;  3STB C;  1TU2 B;  5FLM G;  1LTS D;  3PO3 B;  4JOI C;  1MIU A;  1SYB A;  3L7Z C;  1XMQ L;  2K5N A;  4FVM A;  3OWE B;  2EY1 A;  4IAL A;  2L9H A;  3S15 H;  1XPU A;  1B7Y B;  2HIV A;  2CWA A;  5IYC H;  4GNX B;  1SYD A;  1LT5 D;  1C0A A;  4DU9 A;  1VQO A;  3SDZ A;  2UXD Q;  4ZQ3 A;  1LYL A;  1EY9 A;  3EFX D;  4QB4 A;  5IYB G;  4OEL B;  4A93 B;  1N33 L;  4BXX G;  5AJ3 Q;  3QG1 A;  5KND A;  2J4X A;  3M4P A;  3S15 B;  1W6J A;  1IBK Q;  3EBE A;  4DR3 Q;  2JE6 I;  5FKA C;  1BDO A;  5JJI A;  4GNX A;  4DAM A;  4K6D A;  3PQI A;  3HOV G;  2AWO A;  3MC0 B;  2QW7 A;  3CCM A;  5IP7 G;  1HTP A;  1C9O A;  1HNW L;  1XJV A;  4JK1 C;  3W3A A;  4OO1 H;  2K28 A;  3L9A X;  1RTN A;  2VQF Q;  2FJ2 A;  2UXC L;  4C3J B;  2KJX A;  3H94 A;  2F0L A;  1S5F D;  4OGQ C;  2A73 B;  3UE1 A;  2B2U C;  2WP8 J;  3TBI B;  5IYD G;  1VF7 A;  3LWU A;  4FF1 A;  1TKW B;  5LMU L;  4LFB Q;  4Y52 H;  1EQR A;  3KDF A;  2QKI C;  4JI1 L;  1TS2 A;  2A6H D;  1IBK L;  1K73 C;  5FOB B;  4YY3 L;  5C0X I;  4BY1 H;  1B50 A;  2PW5 A;  4O42 A;  1CQV A;  4RAU C;  2Y0S B;  2BH2 A;  3CPW A;  5C4X G;  5KYI A;  3Q8D A;  1S5D D;  3SK8 A;  4GN5 A;  5E4W C;  5IGC A;  3G7L A;  1AE3 A;  1ONL A;  2KOL A;  2HQE A;  1SNQ A;  3RLF A;  4XXE A;  1JIC A;  1LO5 D;  1EYC A;  3QR8 A;  4I7A A;  3VR6 A;  5C3X A;  2O5J C;  2G9H D;  2LKV A;  4IOA A;  5EBC A;  2ASB A;  4EQP A;  3G6E A;  1WJJ A;  3S1Q B;  2N3S A;  1O78 A;  1K3R A;  1NNX A;  1VS0 A;  2JA5 G;  3I4N G;  3T1Y Q;  1IHZ A;  4C1N K;  1QNU A;  4R1J A;  1YJN A;  2EVB A;  3PF5 A;  3P1H A;  4A3E G;  4NXN L;  1YHQ A;  4LWC A;  1XTC D;  5FJ8 H;  2K6A A;  3KF6 B;  4DAV A;  3T4A C;  4ZUI A;  3HOY B;  1STG A;  2JN4 A;  1YHA A;  3CCR A;  4IPC A;  1VQ4 A;  2NVX H;  3K81 C;  2Y0S E;  1Q8K A;  2VUM B;  4P2C B;  1BVS A;  4ME5 A;  2B2W A;  2K14 A;  3I55 A;  3H0G B;  3GO5 A;  4DR6 L;  5NUC A;  4EVO A;  1YIJ A;  1SMY D;  1DOL A;  3U4V A;  3GTG B;  3TP6 A;  4IO9 A;  2EYL A;  1C48 A;  5C44 B;  2L55 A;  1JE4 A;  3I7F A;  2IL8 A;  1JOK A;  1IKL A;  3CMA A;  5C4Z A;  1SYF A;  4DV3 L;  4JI6 Q;  3JAM i;  2R3Z A;  4LF7 L;  2B2W C;  1EEF D;  1WI5 A;  3S1R H;  4JI7 Q;  5EPL A;  1DYQ A;  4AIM A;  2E2H B;  2UUA L;  1KXL A;  5J1Z A;  1H95 A;  4B3R L;  2NTT A;  1PV4 A;  4K2K A;  2IY5 B;  3VYS A;  1S5E D;  3D4D A;  3KBG A;  4A3B B;  3KJP A;  2QIL A;  4DK3 C;  5HGQ A;  2EXD A;  3M4Y A;  4B3M Q;  3KK7 A;  1CM9 A;  1T9H A;  1Q12 A;  2XVS A;  3HOX H;  4WJ4 A;  1JE5 A;  1LV9 A;  3K59 A;  3F8T A;  1V1P A;  3OPO A;  4J8Q A;  2PQA A;  3OTO Q;  4JV5 L;  1MHW C;  1A2T A;  1XMO Q;  3FKI G;  4FXD A;  5K36 G;  1AFP A;  4DF7 A;  1Z47 A;  1WD0 A;  1FR3 A;  3DEP A;  4KTA A;  4HJ9 A;  2WFW A;  2B63 H;  4JI8 L;  1I94 Q;  4ZCK A;  2D0P A;  3S16 B;  5K36 H;  1HR0 L;  5M5W B;  1VQD A;  2GVA A;  2L1B A;  4KKU A;  4DV4 L;  3J81 i;  4B3R Q;  4DNI A;  2JA6 H;  4CHT B;  1L0W A;  1O80 A;  3D6C A;  4KI0 A;  2R6G A;  3KLW A;  1HFG A;  4N8X 1;  3L0O A;  5LMN W;  3J80 c;  3BYT B;  4HJ7 A;  2Z6K A;  2B3G A;  3T56 B;  3I4M G;  3MFY A;  1TVX A;  2VB2 X;  4CKE A;  1EYG A;  5CV8 A;  4MHE A;  4FO2 A;  4DNR B;  2Q8I B;  1Y1W G;  4DV0 Q;  5GRO A;  1N8R C;  5IT9 E;  4DKA C;  3J81 E;  2JA6 B;  1W2B A;  4LFB L;  1BNZ A;  4TVA B;  2IPK D;  4WOR A;  4YCV A;  1HR0 Q;  3SK4 A;  3K5N A;  4HIM A;  1UE5 A;  2I5H A;  2JJQ A;  2ENB A;  1R9T H;  4C3J H;  3NP8 A;  4A4I A;  4X3T A;  2F0F A;  1LM0 A;  4KKS A;  3E6Z X;  1SNO A;  3MXU A;  5EKL A;  3KF8 B;  2A6E D;  1LAC A;  1R4P B;  4P71 A;  2B2U A;  4LUV A;  1U9R A;  1J5E L;  2CQA A;  1GHK A;  1SLJ A;  3EA6 A;  1M1K C;  3EIV A;  4ZKB B;  3J80 L;  1U4R A;  5FJ8 G;  1V9P A;  5JJZ A;  2F0M A;  4BY7 B;  1U5K A;  1K0R A;  1P16 A;  1CKM A;  2HDM A;  5E4X A;  2F0E A;  3A0J A;  2RHS B;  1CHQ D;  4RWS C;  4PMW A;  2NVT B;  3C2P A;  4DN4 M;  2KCC A;  1BF4 A;  2Z8L A;  3BVG A;  2PNH A;  1PYS B;  2N88 A;  1XWE A;  2XRQ D;  3DWQ A;  3GV3 A;  5COY A;  3FKI B;  4OHJ A;  1EU4 A;  2RSN A;  1NMF A;  2EIF A;  3BDC A;  5ISR A;  4FF2 A;  3CAM A;  5BR8 Q;  3NTK A;  4U68 A;  1K9M C;  5J3B A;  1IL2 A;  5ELB A;  1F2M A;  2JSO A;  4DR7 Q;  2HIX A;  4QIW E;  3SVM A;  1VDZ A;  5M3F H;  2XIW A;  5C4X H;  4JBM A;  4RGO S;  1Q90 A;  1UAP A;  4OX9 L;  4P72 A;  3OSO A;  3TSS A;  3CD6 A;  3U9O A;  4E6I A;  3CQZ B;  1LT3 D;  3FPP A;  1MSH A;  1Y1W B;  3R93 A;  3CKI B;  3STB D;  4YHH L;  4ZK9 B;  3HOZ H;  4DUY L;  1BQQ T;  1G8Z D;  2EYJ A;  1K3B C;  2EY5 A;  4KLK A;  1F77 A;  3TZU A;  1WCM B;  1CHP D;  1J9O A;  2PO4 A;  3M9B A;  5IGD A;  4IJL A;  2EYF A;  1GXD C;  1V1P B;  1X6O A;  3CHB D;  1PH1 A;  2LXJ A;  5COR A;  3BZK A;  1HR0 W;  2WB1 E;  1EQV A;  4DV0 L;  3VR2 A;  1D6E C;  4TSS A;  3DWP A;  3AMU A;  3QJY A;  5JVH 3;  1NUC A;  3CC2 A;  4ZKC B;  2UXB L;  5T1G A;  1CTM A;  5KIX A;  1DGS A;  5DAU A;  4GKJ Q;  3L2P A;  4POF A;  1F2Y A;  1VQI A;  3AEV A;  3KF6 A;  4O1N A;  1GUO A;  1RD9 D;  1YNJ C;  3MXG A;  4A3E B;  1GO3 E;  4IUV A;  5C6A A;  4G7H C;  1SMY C;  2UUB Q;  1PZI D;  2MPM A;  1HXY D;  2ICI A;  2KHI A;  1WTW A;  2OXP A;  2CCZ A;  2PMZ B;  1HZB A;  5IYB H;  1EY4 A;  5C0X J;  3I8Z A;  3MVV A;  5FO8 B;  1I94 L;  1R9T B;  3TP8 A;  1P8L A;  1HTL D;  2YYZ A;  5GAG C;  4HJA A;  1Y69 U;  4NXN Q;  2Z4H A;  3BG3 A;  5CV6 A;  1B44 D;  1Y1W H;  1EOV A;  3CRL C;  3OHX C;  1ILP A;  1STN A;  5IOC A;  4L5R C;  1CQF A;  1HPC A;  2K75 A;  1BR9 A;  3BJU A;  3D3R A;  4HSV A;  3F2U A;  1GKH A;  3AQQ A;  1HNZ Q;  5IY0 A;  1HQR D;  5BR8 L;  1G6Z A;  4J15 A;  4WJW A;  2PQE A;  1HUM A;  3I4N B;  3GTQ H;  3K8A A;  4JYA Q;  4N8F A;  4LFC Q;  4EQN A;  3A5U A;  3GTM H;  3FKI H;  1N33 Q;  1F2L A;  4CKB A;  2ES2 A;  1STY A;  4L6T B;  5A2Q L;  2AHO B;  2NVX B;  4OWT B;  1EU3 A;  1IBL Q;  1SYG A;  2YTV A;  2R92 H;  2EE1 A;  4H44 C;  4WFN 3;  1R4Q B;  2A1A A;  2EYO A;  3SHL A;  4A3K H;  1HNZ L;  1VQH A;  3CU7 A;  2CVR A;  2F0U A;  5DNF A;  4N9P A;  3H0G G;  3GTO B;  3S16 H;  1J8I A;  1HA6 A;  3F2C A;  3L3O C;  2RKS A;  2DY7 A;  4EQO A;  2VB3 X;  2A8V A;  4JV5 Q;  5IT9 L;  1QCB D;  2E5L L;  2QA4 A;  4IUN A;  1SRU A;  2QGQ A;  5C4J H;  2F4V L;  3LNN A;  3ERQ A;  3HOW B;  4HIK A;  2MO0 A;  4K5W A;  4JCV E;  1FGB D;  1BOS A;  4ILW A;  2QDB A;  4A3M B;  2L12 A;  4KN7 C;  3TRE A;  4RA8 A;  4ZLT F;  4PV1 C;  2EY6 A;  3NEN A;  3OW7 A;  1IZ6 A;  5E7N A;  2VL6 A;  1EIH A;  1FVI A;  1VQM A;  1D5X C;  1CZG A;  5FLX c;  1T5E A;  3A56 A;  2KEN A;  1O7Y A;  4IJH A;  3RZO H;  1HZ9 A;  4UHV A;  4C2M B;  3I3C A;  3E3X A;  3M7N A;  5IGE A;  4A3J H;  3HKZ G;  5IIF A;  3PIP A;  2NVQ H;  1HA5 A;  1STE A;  4A3E H;  1PTO C;  1YEZ A;  2N8N A;  2R93 B;  4LF9 Q;  2M00 A;  1KQS A;  3RZO B;  1K28 A;  4JPB W;  3K5M A;  2Z6B A;  3A55 A;  5M3M H;  2K4K A;  1AP0 A;  3OIP A;  2JA5 H;  4O0A A;  2MP1 A;  3RN5 A;  2IX0 A;  4YHH Q;  2F4V Q;  2HHH Q;  2HD3 A;  1XPO A;  1KRT A;  1B1Z A;  3W1G A;  4ZYS A;  1LTR D;  1E1O A;  1HUN A;  3E0J A;  3OTO L;  3T13 A;  4S3S A;  3QOL A;  4Q0F A;  2KEE A;  3IKJ A;  3PUW A;  5ELE A;  2F0J A;  4CKC A;  3Q0A A;  2KBN A;  3LWE A;  4BY1 G;  1YNX A;  1HH2 P;  2RQX A;  2E2H H;  4X62 L;  1UNS A;  2VY3 A;  2F0T A;  2G9D A;  4A3C H;  2NVQ B;  3HG9 A;  3KLS X;  1RCV D;  2KED A;  3GP7 A;  4Y7N B;  1B53 A;  2EYH A;  1C4Q A;  4CBV A;  2Q2T A;  1EQT A;  1AN8 A;  4LUZ A;  4ABN A;  3NWT A;  3NWS A;  2D0O A;  4TQU S;  1WCM H;  4HID A;  2CW0 C;  4X62 Q;  1FJG L;  1VQC A;  3M4O H;  2B2Y A;  2L11 A;  1TXY A;  2MGS A;  4NB3 A;  4KJO A;  3G6J B;  4K6L A;  5IP7 H;  2BA1 A;  4Y7N H;  2VQE L;  3K0X A;  3F2B A;  3CQZ H;  2SOB A;  2HDL A;  4K14 A;  5E3F A;  1J5E Q;  2HQL A;  4RCO A;  2I0Q A;  4Q5V A;  2NVY B;  3A74 A;  3OWF A;  3I4L A;  3UDF A;  5BN3 A;  1E2W A;  5EBD A;  2OTJ A;  1FL0 A;  3GTO H;  1LUZ A;  2WIN B;  2I5M X;  2R93 G;  3A8J E;  3X3M A;  4DR5 L;  4BXX H;  2K5V A;  3D0F A;  3SR1 A;  2CKZ B;  4LF4 L;  4HED A;  2X6L A;  4RFB A;  4FXG C;  4OEM B;  4KHP Q;  4KK7 A;  2B29 A;  2SEB D;  1PRT C;  1E2Z A;  4X66 L;  3J80 E;  2PCF B;  1QG7 A;  3S24 A;  2HT1 A;  1L0Y B;  3WDN A;  2FXQ A;  1SE2 A;  1YHB A;  1SNP A;  1GUS A;  4LFC L;  2OF1 A;  2F3W A;  2EPB A;  5I2X A;  1PH3 A;  4BBS G;  5CR3 A;  1HHV A;  3OOC A;  1MI2 A;  3H91 A;  3BDL A;  3KOJ A;  4R8I A;  3OIQ A;  4XDX A;  2QF7 A;  4ZAI A;  1ENC A;  4B3T L;  4DV7 L;  3P20 A;  4DK0 A;  5LHY 1;  1G2S A;  3H15 A;  2JYO A;  2PW7 A;  4XT1 B;  3GTL B;  1A63 A;  4LF4 Q;  1VQ9 A;  2SNS A;  1XMO L;  1PFN A;  2A6E C;  2RVL A;  1TWA B;  2R7Z G;  3GTK B;  4YWM A;  3H3V C;  4C3H G;  4Z9C B;  1OTC A;  1Y14 B;  2MJ8 A;  4A3K B;  3K80 C;  1V1Q A;  3NBH A;  4YCU A;  2R61 A;  2WAQ B;  3PUV A;  1D1I A;  1L1O C;  5F2D A;  3EJI A;  2KCM A;  3T51 B;  5M5Y B;  1A6X A;  1ESF A;  1IW7 C;  2VNU D;  1WTH A;  3IFD A;  2G5D A;  3MFG A;  1OXU A;  3ND8 A;  4RGM A;  4A3L H;  1E7Z A;  4YIJ A;  3R3O A;  1SE4 A;  3VDY A;  3ER0 A;  4AQY Q;  4LF6 Q;  1GM5 A;  1Y1V H;  4RKL A;  3K6O A;  5FO9 B;  5DEH A;  2IX3 A;  4JYA L;  4DV1 L;  1IBM L;  1SYC A;  2EY2 A;  1YNJ D;  5JJK A;  3U9S A;  2XWJ B;  5ELF A;  2HCI A;  1PH8 A;  2A19 A;  4DV4 Q;  3A8I E;  3K5L A;  1EY5 A;  2X6G A;  4L5T A;  4IFD J;  4GKK Q;  1KNA A;  1STB A;  5D65 A;  3RLO A;  3HOY G;  4QIW B;  1RIP A;  2I07 B;  3ZJY C;  1RL2 A;  1CUK A;  1DOK A;  4M8A A;  1PHJ A;  3NBI A;  3NE5 B;  3E9I A;  1EWC A;  2X69 A;  5DM7 3;  4IFD G;  5IE8 A;  2MO1 A;  1WCM G;  2SNM A;  1XX8 A;  1X9N A;  4H02 A;  1AZP A;  5IOD A;  1N9W A;  3AYH B;  4L5S A;  1TWA H;  5CBE E;  1DON A;  2RA4 A;  1MSG A;  5C4J B;  1BBU A;  1S5B D;  1GUW A;  4LF5 Q;  3S1M H;  3U4Z A;  3HOU H;  1QIL A;  4RKB A;  3I4O A;  4UP8 A;  4NP5 A;  4GZY C;  1E2V A;  5G3L F;  2ZM6 L;  3PSI A;  1B70 B;  4KHZ A;  2K04 A;  4B3T Q;  3FPU B;  1PA6 A;  1SEB D;  4X3K A;  3NSW A;  4OO1 I;  3ULL A;  1VQG A;  4HCS A;  2L15 A;  1SJE D;  1EY8 A;  3LX0 A;  1STA A;  1Q46 A;  4RHR A;  1ICF B;  3D4R A;  3DEO A;  3W1B A;  5KGU A;  4DV2 L;  1G2T A;  3I2Z A;  2F0O A;  3UE0 A;  1G6P A;  2VUM H;  2RHQ B;  1TT2 A;  5A35 A;  4GLX A;  4B9W A;  1I5F A;  3N52 A;  4DAY B;  1I4X A;  1U4L A;  2B2Y C;  4LFA L;  1I6V C;  4DR6 Q;  1Q81 C;  1D2B A;  1QUQ B;  4CJ0 B;  4DK6 C;  4HJ5 A;  1G51 A;  1F9S A;  2JA8 G;  3GTG H;  4JI1 Q;  1Y1V B;  1KLG D;  3HOZ B;  4A3F B;  3F1Z A;  1IW7 D;  3NEL A;  5CGK A;  4A3M G;  1I6H B;  3EQL C;  3M7G A;  5EGT A;  4IZ8 A;  3MEF A;  1B3A A;  1BCP F;  3S2D B;  3K7U C;  1VQL A;  3S2H H;  3Q23 A;  3T1Y L;  5CC4 A;  3K57 A;  4PZ7 A;  1F9P A;  3HOY H;  1SSO A;  3TZD A;  5JPN C;  1AE2 A;  4K0K L;  4BA1 I;  3ERO A;  1A8V A;  4A93 G;  3PUX A;  4NMZ A;  1B8A A;  1S72 A;  1N32 Q;  4X64 Q;  5DM6 3;  1TWF H;  2OTL A;  2KA7 A;  4XIG S;  3J7A V;  3SEB A;  3Q6S A;  4IPD A;  2RDH A;  5M3M B;  1RDP D;  2AUK A;  1X55 A;  2ZJP A;  2NBF A;  3GTJ B;  4GKJ L;  3A7L A;  4A3D G;  1E1T A;  1BBW A;  4HN7 A;  1GHJ A;  3RMH A;  4HCE A;  4OWW B;  1XYI A;  2Q2I A;  3DXJ C;  2LMC B;  2RCF A;  1CKN A;  3QO2 A;  1U0L A;  4GN3 B;  1CKO A;  2WKC A;  5JOB A;  4G7O C;  4JC0 A;  3FDT A;  1TWC B;  1X3E A;  5EPJ A;  5IP9 H;  4A3K G;  3PMF A;  1TWH H;  3D8G A;  3GTQ B;  1NAP A;  2R7D A;  2F0N A;  2E74 C;  2SDF A;  5I6W A;  1A3V A;  1LTB D;  2WB1 B;  2ALY B;  5LMU Q;  3URY A;  5EKI A;  3MZ5 A;  2R7Z H;  2EXZ A;  1U4P A;  4DPG A;  2EOT A;  5TSS A;  3CF5 A;  5KEE A;  4HIO A;  4F7X A;  4HTH A;  4KY5 A;  2MUY A;  3I72 A;  2XNA C;  1Z6H A;  1PH5 A;  1PTO H;  4JI3 Q;  2JEB I;  3E0E A;  4A3D B;  3PCO B;  5CMD A;  2E5L Q;  5LMN Q;  2B2T A;  2ICE C;  1WFQ A;  1FNU A;  3PV0 A;  4K5X A;  4O2D A;  4APV A;  3PIP 3;  3X3N A;  2F1M A;  2O2L D;  4DR5 Q;  1EYD A;  1Q86 C;  2ZJQ A;  2B2V C;  3QIA A;  4GLA C;  1LTL A;  1B3Q A;  4V0B A;  1GVP A;  4LW1 A;  2OT2 A;  1C7Y A;  1L0X B;  2B2T C;  4LF8 L;  3WOE A;  1S5C D;  1FYC A;  3TP5 A;  2JQO A;  5J22 A;  2UUC Q;  5GAD C;  5L37 A;  3HOV B;  2JA9 A;  4OXP A;  4P74 A;  4DR3 L;  1A62 A;  1HNX L;  2CH4 W;  5I2Y A;  1IXR A;  1EZ6 A;  2CW0 D;  4A3G G;  1D8L A;  2WAQ G;  5D3I B;  3HFZ B;  2NZO A;  4YCW A;  1ZXT A;  2WV6 D;  4MZ9 A;  4YY3 Q;  1BBX C;  4K8J A;  2OCE A;  2A69 C;  1NSN S;  5C0X G;  2NN6 G;  3ONA B;  1UUP A;  4PMC A;  2WAC A;  2K5D A;  2NB0 A;  3HKS A;  1V1O A;  2F0P A;  1QWY A;  1BCP C;  2ZM6 Q;  4ZRZ A;  4KD3 A;  3O13 A;  2MQH A;  1K8G A;  2ZTE A;  3DHQ A;  5G3L D;  3Q22 A;  2DY8 A;  2D9U A;  1I50 B;  1ENF A;  2D5D A;  2KHS A;  1PH7 A;  4X65 L;  3HOU B;  4R8N A;  5I4D A;  1SRO A;  4R4Q A;  3H6M A;  2VS1 A;  5CV4 A;  3QWN A;  4NKL A;  2M9V A;  4A3C G;  2JA7 H;  3HOZ G;  4RG1 A;  2Q2H A;  4IUP A;  3M4O B;  5FLX L;  1Q8I A;  1PZJ D;  1I3Q B;  1SMX A;  2E2I H;  3MWY W;  2CQO A;  3T16 A;  3TN2 A;  1WTR A;  1EWH A;  2F0S A;  2F3V A;  4FP5 D;  1N36 Q;  4JG2 A;  4L63 B;  2RBM A;  2F52 A;  2L0C A;  3TQY A;  3U50 C;  5FLX E;  4DV6 Q;  2F0Q A;  3PO2 H;  5M3F G;  1KAB A;  4H13 C;  3QB3 A;  4KHV A;  3CPF A;  5GQO A;  1H9K A;  2DNC A;  5C44 H;  2H4O A;  3KFU A;  1TS3 A;  1SN8 A;  1KNE A;  1X3P A;  1PRT F;  1X54 A;  4KD4 A;  2LS0 1;  2C35 B;  2PNR C;  3SK6 A; 
#chains in the Genus database with same CATH homology
 3FHW A;  4UP7 A;  4X62 L;  1WJJ A;  2VY3 A;  5ELO A;  2N3S A;  2JA7 G;  2GN5 A;  2IHE A;  2JA5 G;  1K3R A;  1QZG A;  1VS0 A;  4A3C H;  4QQB X;  3I4N G;  3T1Y Q;  5JJL A;  3G48 A;  2UXB Q;  5IYD H;  4R1J A;  1YJN A;  2Q2T A;  3PF5 A;  2ZTD A;  4LUZ A;  4A3E G;  4NXN L;  4LNQ A;  1VQK A;  2R93 G;  1YHQ A;  3CP0 A;  4LWC A;  4DR2 Q;  2UUA Q;  1L2F A;  3CXC A;  4AQY L;  2D0O A;  4TQU S;  3ULJ A;  1YJ9 A;  4LF6 L;  1WCM H;  4HID A;  4A3J G;  4X62 Q;  1FJG L;  5FJ8 H;  1VQC A;  4JI4 Q;  3KF6 B;  4OO1 G;  3M4O H;  3A5Z B;  3G4S A;  1TXY A;  4JOI A;  4NB3 A;  1UE6 A;  2AMC B;  4A3F G;  5IP7 H;  2UU9 L;  3E9H A;  2BA1 A;  4Y7N H;  1YHA A;  3CCR A;  1X3G A;  1YBY A;  2VQE L;  3D31 A;  4IPC A;  1VQ4 A;  3CCV A;  2NVX H;  4B3S L;  3K0X A;  2Y0S E;  1Q8K A;  1JJC B;  3K81 C;  3F2B A;  3ICE A;  3CQZ H;  3TRZ A;  1BVS A;  2K14 A;  3I55 A;  3GO5 A;  1J5E Q;  3JC6 6;  4LF7 Q;  4GKK L;  2HQL A;  4EX5 A;  4DR6 L;  2I0Q A;  1YIJ A;  2KCT A;  3A74 A;  3NEM A;  3UDF A;  3U4V A;  1PH4 A;  2OTJ A;  4IO9 A;  1FL0 A;  3GTO H;  1LUZ A;  3H3V I;  2PMZ E;  4QY7 A;  2I5M X;  4MTN A;  3I56 A;  4DR5 L;  3I7F A;  4RMF A;  5IWA L;  3KYH C;  1QVG A;  4BXX H;  1X3F A;  2K5V A;  1QUQ A;  3CMA A;  3J7Z C;  3D0F A;  2VW9 A;  4DV3 L;  2CKZ B;  1PFS A;  2CFM A;  4IOC A;  3JAM i;  2F3I A;  1EIY B;  4JI6 Q;  4LF4 L;  4A3G H;  4LF7 L;  4A3L G;  1WI5 A;  5IYC G;  1TWC H;  3S1R H;  1I3Q H;  1VQE A;  2PQA B;  3GD7 A;  1XPR A;  4JI7 Q;  4KHP Q;  3H0G H;  4FDB A;  1UWV A;  2LXK A;  2B29 A;  4AIM A;  2VQE Q;  4A75 A;  2UUA L;  1KXL A;  1H95 A;  2NZH A;  4X66 L;  5H1S E;  4B3R L;  1PV4 A;  2Z0S A;  4K0K Q;  2IY5 B;  3KJO A;  4NPS A;  2YTY A;  3S24 A;  2MNA A;  1PH2 A;  4LF9 L;  1OXS C;  2HT1 A;  1OXT A;  4YWK A;  5GAE C;  3KJP A;  3EN2 A;  3WWV A;  4DK3 C;  5HGQ A;  4UPA A;  2FXQ A;  2EXD A;  4DV3 Q;  4A3I H;  4B3M Q;  2R92 G;  1T9H A;  1YHB A;  4LFC L;  1Q12 A;  1HNX Q;  3HOX H;  4WJ4 A;  1JE5 A;  2OQ0 A;  3F8T A;  1PH3 A;  1I50 H;  4GOP A;  4QL5 A;  4BBS G;  3OTO Q;  2PQA A;  1VQF A;  2UUC L;  4C2M H;  1MJE A;  4JV5 L;  1XMO Q;  4X66 Q;  3KOJ A;  3FKI G;  3GTJ H;  5K36 G;  2JEA I;  1Z47 A;  1VQB A;  4B3T L;  2B63 G;  4DV7 L;  4HJ9 A;  3RZD H;  2B63 H;  2WFW A;  4JI2 L;  3OYY A;  4JI8 L;  1XMQ Q;  1I94 Q;  3H3V H;  1E3P A;  2D0P A;  3T1H L;  3H15 A;  1HR0 L;  1TWG H;  3MXN B;  4DR7 L;  1VQD A;  4QJF A;  2GVA A;  4B3R Q;  4DV4 L;  1A63 A;  3J81 i;  4LF4 Q;  4BBS H;  1VQ9 A;  4DNI A;  2JA6 H;  4DUY Q;  3CME A;  1L0W A;  1XMO L;  4KI0 A;  2D62 A;  2R6G A;  5ELN A;  3KLW A;  3L0O A;  3RR5 A;  5LMN W;  4DUZ Q;  3J80 c;  2R7Z G;  3ULP A;  4KHP L;  4HJ7 A;  2Z6K A;  4YWM A;  2B3G A;  5EAY A;  4A3I G;  3I4M G;  1OTC A;  1Y14 B;  4IPH A;  1ASZ A;  3K80 C;  1NMG A;  1V1Q A;  4YCU A;  1EYG A;  3T1H Q;  1QVC A;  3PUV A;  3AFQ A;  1L1O C;  4DV5 Q;  1Y1W G;  2KCM A;  4JI0 Q;  4DV0 Q;  3LGJ A;  4B3M L;  4IFD I;  2VNU D;  5GRO A;  1N8R C;  2IT1 A;  1OXU A;  4DKA C;  2AWN A;  1HNW Q;  4JBJ A;  4A3L H;  4DR4 L;  1E7Z A;  1QZH A;  4JI2 Q;  1W2B A;  1OXX K;  4PZ6 A;  3VDY A;  4LFB L;  1UE1 A;  3ER0 A;  4TVA B;  1VQP A;  4GS3 A;  1VQN A;  2UXC Q;  4YCV A;  1HR0 Q;  4A3D H;  3CCS A;  4HIM A;  4AQY Q;  1UE5 A;  1GM5 A;  2I5H A;  4LF6 Q;  2R93 H;  4X65 Q;  3ERS X;  2JJQ A;  1Y1V H;  1R9T H;  4C3J H;  1NJI C;  1X65 A;  4A4I A;  4DV7 Q;  4X64 L;  4DR1 Q;  1Z9F A;  3PGZ A;  3IRB A;  4DV1 L;  2XGT A;  2IX1 A;  4JYA L;  1IBM L;  1LM0 A;  1VQ5 A;  1ASY A;  3M4Q A;  3CCJ A;  3KF8 B;  4QGU A;  5JJK A;  2DGY A;  1PH8 A;  1AH9 A;  2A19 A;  2Y0S G;  4DV4 Q;  4PG3 A;  1MKH A;  4P71 A;  3F2D A;  4LUV A;  1QVF A;  1S3O A;  4L5T A;  4IFD J;  1J5E L;  1XNR Q;  4GKK Q;  1VQ7 A;  2V1C C;  3HOY G;  3RLO A;  1SLJ A;  3ZJY C;  1RIP A;  1M1K C;  3S14 H;  1RL2 A;  4R4T A;  1CUK A;  3EIV A;  2LSS A;  1KL9 A;  3AFP A;  4AYB G;  1PHJ A;  3E9I A;  5FJ8 G;  1V9P A;  4IFD G;  5IE8 A;  2MO1 A;  1U5K A;  1K0R A;  1WCM G;  1O7I A;  1P16 A;  1CKM A;  3TS2 A;  4UY8 C;  1CKN B;  1HJP A;  4H02 A;  1YIT A;  4UP9 A;  3A0J A;  1X9N A;  2RHS B;  1N9W A;  2XTI A;  4PMW A;  3AYH B;  3PIO A;  4JI6 L;  4GNX C;  4L5S A;  1TWA H;  2IHF A;  1SE8 A;  2ATW A;  2JA8 H;  1BBU A;  3FP9 A;  3I4N H;  2PNH A;  1PYS B;  1WYD A;  5HY6 A;  4LF5 Q;  1UE7 A;  3U4Z A;  3S1M H;  4AH6 A;  3HOU H;  1NBW A;  4LUO A;  3I4O A;  2VQF L;  1NMF A;  2EIF A;  4UP8 A;  1PH6 A;  4OX9 Q;  1UEB A;  3CAM A;  4OON A;  1KAW A;  3S17 H;  2ZM6 L;  3PUY A;  3PSI A;  1BKB A;  5BR8 Q;  1KD1 C;  1B70 B;  4NXM Q;  3S1N H;  4KHZ A;  1K9M C;  4B3T Q;  5J3B A;  3NBH B;  1IL2 A;  1PA6 A;  4JI5 Q;  1JJ2 A;  4OO1 I;  1YJW A;  3ULL A;  5JEA J;  2RF4 A;  1VQG A;  1XNR L;  4B3S Q;  4DR7 Q;  2JK8 A;  2L15 A;  2HIX A;  3CC7 A;  4QIW E;  1Q46 A;  5M3F H;  5C4X H;  1HZA A;  4JBM A;  4JI4 L;  3PO2 G;  3W1B A;  4DV2 L;  2ZTC A;  4OX9 L;  4P72 A;  1N32 L;  2PI2 E;  1K8A C;  4JBK A;  3I2Z A;  3CD6 A;  3DM3 A;  1G6P A;  3UE0 A;  2VUM H;  4DR2 L;  2RHQ B;  4OWX B;  3G71 A;  4BY7 H;  2K5H A;  4GLX A;  3STB D;  1VQJ A;  1I5F A;  1K83 H;  2BH8 A;  4R4C A;  1XTD A;  4DAY B;  4YHH L;  4DUY L;  3HOU G;  3HOZ H;  4LFA L;  4DR6 Q;  1Q81 C;  1QUQ B;  4KLK A;  4DK6 C;  4HJ5 A;  1G51 A;  5M3M G;  1IBL L;  5JEA G;  4GN4 B;  2JA8 G;  3GTG H;  3CC4 A;  3M9B A;  1N36 L;  4JI1 Q;  2Q2U A;  4DR4 Q;  3OW2 A;  4IJL A;  4GOP B;  4JI5 L;  1KHI A;  3F1Z A;  1X6O A;  2WAQ E;  2K50 A;  3NEL A;  4PZ8 A;  2LXJ A;  4A3M G;  3U58 A;  3JAM c;  1PH1 A;  3PO3 G;  2CWP A;  3BZK A;  5IWA Q;  1EQQ A;  3RN2 A;  1HR0 W;  2WB1 E;  2ZJR A;  3MEF A;  4DV5 L;  4DV0 L;  3K7U C;  3SGI A;  2Z6K C;  1VQL A;  5M5W H;  3CCE A;  3GTL H;  3S2H H;  1KRS A;  4C3I H;  4LFA Q;  4JI7 L;  1D7Q A;  3T1Y L;  4A3B H;  1VQ8 A;  4PZ7 A;  3HOV H;  4A76 A;  3CC2 A;  3HOY H;  2UXB L;  2N49 A;  1DGS A;  1W3S A;  4L5Q A;  2KHJ A;  4GKJ Q;  1CSP A;  2AKW B;  1AE2 A;  4POF A;  3L2P A;  4K0K L;  1VQI A;  4BA1 I;  3AEV A;  3KF6 A;  1A8V A;  4DV2 Q;  4A93 G;  3CW2 C;  3PUX A;  1B8A A;  3RNU A;  1S72 A;  1N32 Q;  3J81 c;  1S40 A;  4X64 Q;  1GO3 E;  1TWF H;  2OTL A;  3BZC A;  4DV1 Q;  1EFW A;  4XIG S;  1CSQ A;  1IYJ B;  3J81 j;  2UUB Q;  4IPD A;  1WOC A;  1YVC A;  1A0I A;  2H5X A;  5M5X H;  1X55 A;  1HZC A;  2KHI A;  1Y1V G;  3HKZ E;  4IPG A;  2ZJP A;  4EQ5 A;  1MJC A;  1N34 L;  1KIX A;  3BU2 A;  3GTP H;  2OQK A;  2CCZ A;  4GKJ L;  4A3D G;  4HJ8 A;  1E1T A;  3UDI A;  1HZB A;  5C3E G;  1BBW A;  4BBR G;  5IYB H;  3TS0 A;  5C0X J;  4P73 A;  4OWW B;  1FJG Q;  4P75 A;  1NTG A;  2YTX A;  1PH9 A;  2Q2I A;  1CKN A;  1I94 L;  1P8L A;  1Q1E A;  4GOP C;  1U0L A;  2YYZ A;  1CKO A;  4GN3 B;  5GAG C;  4HJA A;  4NXN Q;  4JC0 A;  1X3E A;  1Y1W H;  1EOV A;  1Q7Y C;  2I5L X;  4LF5 L;  5IP9 H;  4A3K G;  3UDG A;  1TWH H;  2MFI A;  1PVO A;  3HOW G;  2R7D A;  2E2J H;  3M3Y H;  2HHH L;  1GD7 A;  4L5R C;  4C3H H;  3I4M H;  1JT8 A;  5FLM H;  2ALY B;  5LMU Q;  3CCQ A;  5M5Y H;  2R7Z H;  4POG A;  2GVB A;  2VZA A;  1NY4 A;  3B6Y A;  2K75 A;  4LF8 Q;  4DPG A;  4BA2 I;  3BJU A;  2JA6 G;  1YZ6 A;  3CF5 A;  4HIO A;  3W5O A;  1GKH A;  3AQQ A;  1N34 Q;  1HNZ Q;  1J6Q A;  5IY0 A;  1PH5 A;  4JI0 L;  3M85 A;  3PF4 A;  5AJ3 L;  4JI3 Q;  2JEB I;  3E0E A;  3PCO B;  2E5L Q;  2R7F A;  5DLQ E;  5BR8 L;  5LMN Q;  2UUB L;  4NXM L;  1VQ6 A;  4J15 A;  1VQA A;  3J7A 5;  1WFQ A;  3GTQ H;  3K8A A;  2E8G A;  3PV0 A;  4O2D A;  4APV A;  4JYA Q;  2UXD L;  4LFC Q;  3A5U A;  3CCL A;  3TEH B;  4DR5 Q;  1EUJ A;  3FKI H;  1L1O A;  3KDF B;  1Q86 C;  2ZJQ A;  1N33 Q;  3GTM H;  4XTC S;  2DUD A;  3K7A H;  2ES2 A;  4R4O A;  1PYB A;  4GLA C;  1LTL A;  1NE3 A;  1X56 A;  2NN6 I;  5IT9 c;  3DLL A;  1GVP A;  1SFO H;  4LW1 A;  1JJG A;  1EWI A;  3HOX G;  2AHO B;  4OWT B;  3UDX A;  1IBL Q;  1SR3 A;  1C7Y A;  2YTV A;  3STB C;  2R92 H;  5FLM G;  4JOI C;  1OXV A;  4LF8 L;  1MIU A;  1V43 A;  3L7Z C;  4JI8 Q;  1XMQ L;  1XNQ Q;  2K5N A;  3HOW H;  2A1A A;  2JQO A;  4A3K H;  2UUC Q;  5GAD C;  2YV5 A;  5IP9 G;  1HNZ L;  2JA9 A;  1VQH A;  2NVY H;  4OXP A;  4P74 A;  1XPU A;  3S15 H;  1B7Y B;  4DR3 L;  3PUZ A;  3H0G G;  1A62 A;  2HIV A;  1HNX L;  2CWA A;  5IYC H;  4GNX B;  1YI2 A;  1IXR A;  3S16 H;  4AYB E;  2UU9 Q;  3F2C A;  1C0A A;  4A3G G;  1D8L A;  1VQO A;  2UXD Q;  1LYL A;  2WAQ G;  4BBR H;  5IYB G;  1Q82 C;  5C3E H;  2A8V A;  1E22 A;  3HFZ B;  4JV5 Q;  4WJ3 M;  1N33 L;  2NZO A;  2YU9 H;  4BXX G;  5AJ3 Q;  4ALP A;  4YCW A;  2WB1 G;  4YWL A;  3M4P A;  2E5L L;  2QA4 A;  5LMN L;  4X6A H;  3GTK H;  4MZ9 A;  1IBK Q;  3EBE A;  1SRU A;  2QGQ A;  5C4J H;  1JMC A;  2F4V L;  4DR3 Q;  4HIK A;  4YY3 Q;  2MO0 A;  4JCV E;  2OCE A;  3CCU A;  2BA0 A;  3TRE A;  5C0X G;  2N78 A;  2JE6 I;  2NN6 G;  5JJI A;  4A93 H;  3HKS A;  3NEN A;  1IZ6 A;  4GNX A;  5E7N A;  2VL6 A;  1FVI A;  1VQM A;  4DAM A;  3S2D H;  1VCI A;  4ME3 A;  5FLX c;  2ZM6 Q;  1I6H H;  3HOV G;  2KEN A;  4GLV B;  4IJH A;  2AWO A;  3CCM A;  3RZO H;  4A3B G;  5IP7 G;  1HZ9 A;  2MQH A;  4A3F H;  4DR1 L;  2NVT H;  1C9O A;  1HNW L;  1XJV A;  1K8G A;  4DV6 L;  1IBM Q;  2ZTE A;  3M7N A;  2OWO A;  4JBW A;  4A3J H;  3HKZ G;  2VQF Q;  3PIP A;  2NVQ H;  1Q1B A;  2UXC L;  3PO3 H;  4A3E H;  1PH7 A;  4X65 L;  1YEZ A;  2N8N A;  4A3M H;  3UE1 A;  2WP8 J;  4LF9 Q;  1KQS A;  5IYD G;  1SRO A;  4R4Q A;  2VS1 A;  5LMU L;  4LFB Q;  4Y52 H;  5M3M H;  2K4K A;  1EQR A;  3KDF A;  4A3C G;  2JA5 H;  4O0A A;  1EIF A;  4JI1 L;  2JA7 H;  3HOZ G;  3RN5 A;  1G29 1;  2IX0 A;  2Q2H A;  4RG1 A;  3GDE A;  4YHH Q;  1IBK L;  2F4V Q;  1SMX A;  2E2I H;  4BY7 G;  1K73 C;  2CQO A;  2K52 A;  4YY3 L;  2QEX A;  5C0X I;  2HHH Q;  4BY1 H;  1XPO A;  2VUM G;  1KRT A;  1JB7 A;  1N36 Q;  5C44 G;  4JG2 A;  3W1G A;  3U50 C;  2F52 A;  3TQY A;  2EQS A;  2PI2 A;  2BH2 A;  4DV6 Q;  1E1O A;  3CPW A;  3PO2 H;  5C4X G;  5M3F G;  4R4I A;  3Q8D A;  3OTO L;  3RLN A;  2RCN A;  2ID0 A;  5GAH C;  4GN5 A;  1AE3 A;  3CPF A;  5GQO A;  3PUW A;  4JI3 L;  4MNO A;  3S1Q H;  3J80 i;  3RLF A;  5C44 H;  4DUZ L;  3KFU A;  1KC8 C;  2KBN A;  1SN8 A;  1E24 A;  1L1O B;  4BY1 G;  1X54 A;  1YNX A;  1FGU A;  4IOA A;  2C35 B;  1XNQ L;  1HH2 P;  1M90 C;  2E2H H;  2ASB A;  3G6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...