1Q3LA

Chromodomain of hp1 complexed with histone h3 tail containing monomethyllysine 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Heterochromatin protein 1
publication title Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9
rcsb
source organism Drosophila melanogaster
total genus 11
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2003-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q3lA00
1MSGA 3Q6SA 4R8IA 2L1BA 4IUPA 1HFGA 2B2VA 2FMMA 2JP1A 1HA6A 1IL8A 4HCSA 4OIKA 4CJ2C 1ILPA 1B50A 2RA4A 1BBXC 1PDQA 1WTXA 2K05A 2B2UA 1EOTA 1JE4A 1EIGA 1G91A 3DEOA 3DEPA 1DONA 1XYIA 5T1IA 1DOMA 2J7ZA 2RSNA 1IKLA 1DOLA 1X3PA 1DOKA 1PFBA 1Q3LA 1BF4A 2CVRA 4QUFA 2K03A 2M2LA 3F2UA 3N52A 4X3KA 1KNAA 1RTOA 5COYA 4MN3A 1AP0A 3GV3A 1WTPA 2EPBA 4ZK9B 1MGSA 3KUPA 1NAPA 3ONAB 5CORA 1RJTA 3SVMA 4R9WA 2KEEA 5EPKA 2B2UC 2H1EA 1WTWA 1MI2A 2NYZD 4IUVA 1EIHA 2KEDA 2MP1A 1QE6A 2FHTA 4ZAIA 1ICWA 2K1BA 3R93A 3TN2A 4ZKBB 3H91A 1QNKA 1O80A 1PFNA 2X6GA 5D14A 1PLFA 1NCVA 1SAPA 2X6LA 5EPJA 3LWEA 5CMDA 2B2YC 4CJ0B 1AZQA 1M8AA 2HCIA 1F9RA 1SSOA 1CM9A 4XDXA 5E4WC 2FJ2A 1XX8A 1U4PA 2HCCA 3FPUB 3D6WA 5D65A 1G6ZA 2RVLA 5EKIA 5JJZA 1JICA 4IUTA 1F9PA 5EJWA 2BDNA 2RSOA 1GUWA 2B2VC 3DM1A 4XT3B 2EOTA 2Q8TA 1A15A 4IUUA 1G2TA 2VXWA 2K28A 1B4OA 2KOLA 2MPMA 2SDFA 3P7JA 5EPLA 5T1GA 1CA6A 4OIJA 1O7YA 1HUMA 5EQ0A 1NR2A 1X32A 4QUCA 4HAEA 4RAUC 3TZDA 1HUNA 3MTSA 4LMQD 2HUGA 3G7LA 1J8IA 1O7ZA 2EE1A 1IKMA 1WD0A 2N88A 4IURA 2K01A 1ILQA 1ESRA 1VMCA 2KVMA 2HDLA 2B2TA 1DZ1A 1B2TA 4X3SA 1B3AA 4DN4M 4MHEA 1U4MA 1EQTA 1EL0A 3I3CA 3QO2A 4U68A 1WVLA 1F2LA 2R3ZA 1WD1A 4NW2A 1PFMA 3UI2A 2L9HA 3IFDA 2KECA 1TVXA 1AZPA 1J9OA 1ML0D 3I8ZA 1WTVA 1BO0A 1NR4A 2L4NA 1LV9A 2N55A 2NZ1D 4UAIA 4O42A 1E0BA 4RWSC 1HHVA 4X3TA 1WTQA 3KBXA 3I90A 2XIWA 1MSHA 1VMPA 1RHPA 5CBEE 2MJ8A 3GV6A 3I91A 4HEDA 2B2TC 4HSVA 4XT1B 1B53A 2B2WA 1F9SA 1ZXTA 5CBAE 5DNFA 5AFWA 4X3UA 2DY7A 1WTOA 1U4LA 3FDTA 1C8CA 1KNEA 1RODA 1RTNA 1U4RA 2DY8A 4ZLTF 1BNZA 1CA5A 2IL8A 2L12A 4RA8A 4ZKCB 2K04A 1G2SA 2Q8RE 2FINB 1X3QA 2X69A 3IL8A 3MWYW 1HFNA 5E4XA 2HDMA 1QG7A 2D9UA 4IUQA 2KUMA 2B2YA 1SDFA 2MGSA 4CJ1B 2B2WC 3HP3A 2NWGA 2L11A 1F9QA 1S4ZA 2FFKB 2JYOA 1HRJA 1WTRA
chains in the Genus database with same CATH superfamily
4ALPA 2K6AA 1GHJA 2AHOB 4OO1G 3IFTA 4JI8L 3ER0A 2QILA 1KTKA 4FDBA 3UE0A 4TRDA 1QUQB 2AQ3B 1N8RC 3S15H 1XPRA 1HXYD 1EFWA 4OX9Q 1K8GA 3NQTA 1K73C 1BBWA 3BJUA 4OWWB 4DGZA 4O1NA 4NKLA 3ULLA 4JI4Q 4FXKC 4AQYQ 2C35B 5IGCA 3GO5A 1S5BD 5CORA 4QF4A 5EPKA 1VQJA 2H4OA 2R92G 2H1EA 1NE3A 3FP9A 2K5DA 2R7DA 2F0UA 4LF5Q 3H91A 1R9TB 4A3CH 5D14A 4TKOB 1PMRA 1W6KA 4CJ0B 3D4RA 1TS4A 3VR2A 1II3A 4HJAA 4YWKA 1D2BA 1J5EQ 4QQBX 1I94Q 2JE6I 2JJQA 4DR5L 3BYTB 4DR7L 1HNXQ 3C3LA 5IYCH 3EROA 4DV2L 5I6WA 4RHRA 1IYUA 4GNXC 2I0QA 3CCRA 3EBEA 1SNDA 3JAML 1SNMA 3I73A 1A0IA 1BUVT 3CRKC 3TDQA 1JWMD 1OXXK 4JBWA 4DK6C 4XXEA 3GTOH 4DR2Q 1PXUA 2A68C 2F4VL 4U68A 1MJEA 1LTID 5FLXL 5IGDA 1N34Q 1XTCD 1LABA 3TEHB 3HOWG 1I50B 2GA4B 2R93G 1XWEA 3GD7A 2UUAL 4TVAB 3BZKA 3H09A 5M5WH 1WTHA 3HKZE 4QB4A 1HA5A 3I91A 1VQ4A 2LKVA 1R4QB 4UPAA 4KJOA 1PTOF 1PZID 1UUPA 3CMAA 3W5OA 1L0WA 4RCNA 3I4NG 4JW0A 4RCOA 5A2QE 1Y1VH 5M5YB 2VUMG 2VNUD 4KN4C 3CKIB 2ASBA 1D1KA 3KOJA 1H9MA 3BYYB 4KMUC 4Y7NB 1SYEA 1F2ZA 2LS01 5FK9C 1CFMA 1K0RA 1SR3A 5FJ8H 4IJLA 3VYSA 4JI3Q 1EQRA 3TP7A 1QOHA 1Y1WH 2UXBL 1EWCA 1BBXC 3VA7A 2K05A 2KBNA 5JPMC 4A3EB 2WAQE 2A1AA 4OELB 3F8TA 2VQEL 4YWLA 4HJ9A 1YNJC 1DOMA 2WV6D 3WDNA 1L1OA 2UU9L 4B3ML 3W2DA 1SRUA 1VQ6A 3BZCA 3OWFA 1I4RA 3ZYYX 3AFQA 4R1JA 4R4QA 4X66Q 4MNOA 3NPPA 4P73A 5M3MG 3NWTA 2HIVA 3NENA 1MGSA 1TS5A 2KEEA 5IT9c 2O5IC 2B2UC 3F2BA 2JA7H 1WJJA 1B9NA 4TQUS 1QNKA 4GOPA 1B9MA 3H0GB 1BBUA 4RGMA 1CM9A 5IGGA 2XNAC 1YJNA 1SE4A 1PTOC 3DM1A 4GKKQ 1LT6D 2OTLA 3PIPA 1OXVA 4JYAL 1Q86C 2NVQH 1K8OA 2CWAA 3QR8A 3CC7A 3G7LA 2JA5B 2EE1A 5ISRA 2K01A 4HCEA 4ABNA 5IE8A 1NJIC 2Z6KA 3F2DA 1CK1A 5CV8A 4DR6L 1YI2A 3HFZB 3I4MB 3OMGA 1ZYRC 1ML0D 3CPWA 1E2ZA 3K5MA 3MXNB 1MSHA 2CHBD 1H9SA 5FKAC 3K7AB 1RODA 4DAPA 1SMYC 1JJGA 3V96A 3TBIB 4HMIA 3PF5A 5JEAG 3OWEB 5ELNA 2K52A 4NXNL 4A3IH 1YITA 2X69A 1GVPA 1IYVA 4JCVE 4P2CB 5C0XG 4O2DA 5C3XA 1OTCA 1IHZA 1TWGH 3VR4A 2FFKB 5DM63 3K0XA 1Z9FA 5C44G 2L1BA 1BCPD 1HFGA 1QNUA 5LHY1 5J39A 3K59A 3GP7A 1VQCA 2I5LX 4OIKA 2VY3A 4C3IH 3STBD 2BE5C 4X64Q 4BBSB 3GTLH 3KLSA 3EVQA 3R2IA 4M8AA 3SK6A 2DGYA 2NVYB 1G91A 4K6DA 4J15A 5C3EG 2KCMA 2M2LA 3KBGA 2WP8J 4A3LG 3UDGA 1G51A 1NNXA 1VQDA 4KY6A 4KHPQ 4IUNA 1N33Q 2EYJA 3SE0A 3CCSA 5KGUA 2NYZD 1XXGA 3CCLA 3FHWA 3EQLC 1O7IA 3LWEA 3J80c 4JI6Q 1CT1D 4HIMA 2HCIA 1SYGA 1V1QA 4XDXA 3S1RB 1U4PA 1N36L 3S2DB 3NWSA 4AH6A 1JICA 3S2HB 4WJWA 2E2HH 5L37A 3K7UC 3E5SA 2JA9A 5A35A 1CA6A 3FKIB 1HUNA 3QG1A 2F1MA 1CTMA 3AQQA 5EBCA 1NTGA 3KYHC 4BS9A 1PV4A 4OO1H 1G8ZD 4A3KB 4RG1A 1PRTD 2UUCL 1VMCA 2K5HA 1EYCA 2EVBA 2JK8A 3MFYA 5CYUA 3QO2A 1V1OA 1BCPB 4EQ5A 1QZHA 3VA5A 1ENCA 1LV9A 4G57A 4B08A 1HHVA 2PQAB 2XIWA 1VQ8A 1JOQA 4K5VA 4CBVA 1WCMB 3GTMH 5JAVA 4LF6Q 3DWPA 1A63A 4A75A 1LYLA 1WTOA 2A6ED 3M4OB 3HZXA 3RN5A 2R92H 2EIFA 4LFBQ 1FGBD 4C3HG 2FINB 1HZAA 2BCOA 1Q46A 2RDHA 2ATWA 4JBKA 5IODA 4FO2A 1EEID 1D5MC 3PUWA 3U9OA 2F3WA 4RKLA 3RZOB 1TIID 1HNWL 3MXPA 2EY6A 1EQVA 3PF4A 2VB3X 3OHXC 4NMZA 1TWFH 1VQEA 2JEAI 3JAME 4B3SQ 3A7LA 5ELFA 3QOLA 3P20A 4AYBB 2J7ZA 1UWVA 1X3PA 4KLKA 1YHAA 5CR3A 1SE3A 2F0GA 3F2UA 3HS0C 1HZ9A 4NB3A 4MN3A 1YBYA 1WTPA 4PV1C 4BA1I 3HOWH 3RMHA 2R93H 5FLXE 5BN5A 3PUXA 1MHWC 2D5DA 2GVAA 4CKCA 1O80A 4V190 3M3YB 1YVCA 2OTJA 2JXMB 4K14A 5IIFA 3VR6A 5M9OA 3T1HL 1IBLL 1SSOA 4JI2Q 3I4NH 2QCPX 2FJ2A 3G6EA 5G3LF 3FPUB 2VUMH 1VQNA 3RUZA 3SK8A 3W3AA 4F8MA 5I9PA 1V1PA 3T56B 2VL6A 2ZJRA 3HOVB 2D62A 2VXWA 2UXDL 5BR8Q 5IP7G 2Y0SG 4DUZQ 4DV0L 1JC7A 5A2QL 2LSSA 1Q90A 2Q8IB 3Q22A 4JI0Q 4YHHL 4CKEA 2E2JB 1ILQA 1Y8NB 3I7FA 1AEXA 1Q8KA 5FO7B 5KEEA 1F2LA 2CH4A 2PW7A 5M3FB 1TU2B 4JI1L 2NVXB 4IZ8A 3PUVA 4OL7A 1A2TA 4XQNA 4X3TA 3KBXA 4OWXB 1SBBB 2B2WA 4NDXA 5M3MH 3HOYB 1ESFA 1M90C 3GTGH 2Q8RE 1EU4A 1F2MA 3A5UA 1VCIA 1QG7A 3Q24A 3AYHB 5GAEC 4GLXA 2F0EA 1FNWA 4A3BB 2MGSA 3HP3A 4OXPA 5ELOA 2KJXA 1YNXA 1D1IA 3M4QA 1LTGD 1SNOA 4L6TB 3EIVA 4IFDG 1JCKB 1MSGA 1UE5A 4MTNA 4A3JG 3HOZB 4CJ2C 3K57A 4DR3L 1SNCA 2L15A 3CAMA 2RA4A 4GNXA 1FL0A 1FR3A 5T1IA 4YWMA 4KD3A 1DOKA 2PNRC 4DNRB 4ILWA 2F0IA 3I56A 1PA6A 4ULLA 3PIOA 5NUCA 2K5VA 2EY5A 1JJCB 1GOZA 1PH6A 2DNCA 5FOBB 3IKJA 3J7A5 5FLMG 3GTKB 5IGFA 2FHTA 1L1OB 1K9MC 1Y8PB 1PZKD 1PFNA 2NZHA 4K8IA 2X6LA 5CMDA 4LNQA 1GUNA 1V9PA 4FP5D 4EGVA 3KLWA 5IWAQ 1L0XB 5JEAH 5DAUA 2RCNA 5EKIA 2CFMA 3MZ5A 2F0LA 1CSPA 2V1CC 3KK7A 1ASZA 4GOPB 2AMCB 5C0XH 3HOXB 1Q8IA 2MPMA 3P7JA 5T1GA 5C44H 5IOCA 5E7NA 3I55A 4RAUC 4QUCA 3I4LA 1U9RA 2Z0SA 1CQFA 1W6JA 4DUYQ 1DZ1A 3WOEA 4JI7Q 1FJGQ 1IBMQ 4B3RQ 1S72A 1VQLA 5C3EH 4RMFA 1BR9A 3OMCA 4YY3L 1NUCA 3DUZA 3I90A 4IO9A 4A3LH 1WYDA 4YCWA 2KHIA 2IX3A 2F0SA 4X3UA 4FYDA 3CCEA 1S5ED 1R4PB 2MQHA 2KENA 5DLQE 2EJMA 2OQ0A 3D3RA 1KAWA 5ELEA 1P16A 3S1MB 4P74A 1VF5C 5HURA 4RGOS 2EYHA 2IHEA 3E9HA 3L3OC 1H9SB 4CJ1B 2E76C 3ULPA 5C4ZA 2G9DA 2Z8LA 4MIUA 2QA4A 1XJVA 3T13A 3ND8A 4R4TA 4R8IA 4L5QA 1HQRD 1XTDA 2B8FA 4X6AH 1IXRA 2CQOA 2Y0SE 2XRSD 1EY4A 1VQ9A 3AEVA 4A93B 4PNYA 1XNRL 4A3DB 1JE4A 2NN6G 1EIGA 1UAPA 3DEOA 2A69C 2K33A 2CVRA 4K0KL 3X3MA 1KNAA 1EYAA 4WJ4A 3TMEA 1I3QB 2WKCA 2XGTA 4DXFA 4ZK9B 2ZM6L 2MNAA 1LTBD 1I50H 3J81c 2NUCA 3S14H 1A2UA 2KEDA 2AQ2B 4GN4B 1HH2P 4LF7L 3TN2A 3PO3B 2A5HA 3GTPB 1PLFA 3BG3A 3T1YL 3I70A 5KIXA 4LF4Q 3NTIA 4DNTB 1XNQL 1E2VA 1K28A 5D3DA 5AJ3L 1KRSA 1JE5A 4C3HH 1OO9B 2IY5B 5BN4A 1OXSC 1ICFB 2V4DA 2Q8TA 1H95A 1A3TA 4IOAA 2KOLA 1IBKQ 2JA8B 1YNNC 5C4XB 3TZUA 1O7YA 2EDGA 3PUYA 3MXUA 1TQOA 2UXCQ 4OEMB 1Z47A 3UE1A 1VQKA 2R7ZB 4BA2I 2JA6G 3PO2G 4KY5A 4IQZA 1U5KA 5F2DA 1DXMA 1D7QA 2F0NA 4LFCL 3K0YA 1WVLA 2F03A 1H9JA 4NXMQ 1WD1A 2L9HA 2KECA 1TVXA 2E5LQ 3HOUB 1JOOA 1NR4A 2KHSA 5KNBA 1B3QA 3P75A 2MJ8A 4XT1B 3MEHA 4BBRB 3I4OA 1VS0A 1DD2A 1CKOA 3J80i 2HHHL 4H44C 1U4LA 4I65A 1U4RA 4BY7B 2IL8A 4M1UB 2EXDA 4CHTB 2PYKA 2D9UA 3QB3A 1CKNA 4B3TL 3VYTA 2A69D 4A3BG 1YJ9A 2F0VA 3CQZB 2JYOA 3OTOQ 2Q2TA 2FXQA 1B2TA 3O13A 4B9WA 1EQQA 1BCPF 2CW0D 1GO3E 2VQFL 4UP7A 5IP7H 1PH4A 5JJLA 4A3FG 1AN8A 4C2MH 2BH8A 1AFPA 4IN3A 4J1MA 3DEPA 2BDOA 5GAHC 2Z6BA 1N32Q 5DEHA 2K50A 1HQMC 4DAYA 2F0JA 1W2BA 4POGA 2ZXRA 4JV5L 4LUOA 1NAPA 3A5ZB 1JWSD 1LO5D 2XRQD 3Q0AA 1X54A 4DV7Q 1HR0Q 2B8GA 4ZAIA 2LMCB 1MJCA 4JOIA 1HNZL 3J7AF 2CQAA 4YCVA 1YNND 3D8GA 2SNSA 3VR5A 3C1FA 4TSSA 2PI2A 1QVCA 1F9RA 5C0XJ 1QVGA 1HJPA 1XMOL 3JAMc 1QZGA 4DFAA 2D0OA 3Q23A 1YZ6A 1PYWD 1KLGD 1Q12A 1UE7A 1CHQD 1STAA 2C9OA 5FO9B 1L2FA 4DV3Q 1Z7TA 2A19A 2QDLA 4QIWB 4OIJA 4IFDH 3TZDA 5K5PA 1KQSA 1B1ZA 2QEXA 1EY8A 1IW7C 4DV5Q 4A3JH 3CCVA 1PRTF 1WI5A 3CU7A 4GKJL 1QWYA 4X3SA 2A6HC 1V1PB 4JPBW 5CC4A 1W3SA 2QEJC 1K3BC 1LTRD 2P5ZX 1AW7A 3UI2A 3L0OA 4OGQC 2ZJQA 2NVYH 1LTSD 2A68D 1AE2A 1XMQQ 3CW2C 4C3JG 3CRLC 3A8KE 1KDAA 3GTOB 1C9OA 3CHBD 2B3GA 5LMNQ 1LUZA 1UNSA 3SEBA 3LX0A 3MFGA 2ZXOA 5FLMH 4LF8L 4X65Q 4H02A 1X3QA 3CXCA 1DJRD 4XYOA 5M5WB 3PUZA 1BKBA 2LXKA 4DA2A 4JG2A 1PZJD 3S1RH 1WTRA 1XPOA 2NVTB 3M4YA 1UEBA 1JB7A 4QMGA 3UDXA 1KD1C 1KDBA 1QVFA 4DR4Q 2TMPA 4BY1G 2E74C 1BQQT 4KKSA 1PHJA 2J4XA 5HY6A 1SYFA 3RZDH 3GTJH 4A3DG 2ALYB 1VQFA 1XYIA 1EYDA 4DV1L 1RL2A 4FF3A 5JJKA 1GD7A 3J80L 5KRUA 3U58A 5GAGC 1Y1WB 2DJGC 1YNJD 4GNXB 1LTLA 1RIPA 1PTOH 1WTWA 1E1OA 3AFPA 1MI2A 4DV6L 2YU9H 1QILA 3KFUA 3MC0B 3K80C 3K5NA 1TY2A 4LW1A 1JR0D 1MKHA 2RVLA 1FD7D 4DV4L 2JA7B 1SJHD 4PZ6A 4X62L 2L55A 4A76A 1TWHB 5JVG3 2WB1B 3NTHA 4LK1C 1PTOD 2ZT9C 2PMZE 1S5DD 3SHLA 4N8FA 1WD0A 3RZOH 2R7ZG 3HG9A 4JI5Q 1B3AA 3BU2A 3W1BA 3R8BA 1ASYA 1LT4D 1Y69U 3NSWA 5KNDA 2NN6H 4L5RC 4A3MB 1VQMA 2NVQB 4IALA 5CV4A 3H3VI 3HKSA 2OWOA 2N78A 2KHJA 3P1HA 5J3BA 1VMPA 1RHPA 3GV6A 4PMBA 1ZYRD 2CKZB 3CC2A 3OIPA 4A3GB 4JI8Q 4KN7C 4ZKCB 3VR3A 4QL5A 5IYDG 2HDMA 1SMYD 1BOSA 1C4QA 2E2IH 1EIFA 4Y52H 3HKZB 1L0YB 2KCNA 1BXTA 4WFN3 5CV7A 1HCZA 4DKAC 1SFOB 4EX5A 1OXTA 4LF9L 4CDCC 2UUBL 1K8MA 3LWUA 3PV0A 3G48A 1EFID 3NE5B 2R6GA 3NP8A 4DR1L 1F2YA 2JA6H 2BE5D 1PH2A 3PO2H 3BDOA 2B63B 1DONA 1IKLA 1TS2A 2YTYA 1PFBA 3S1NB 4DR5Q 1JOKA 2Z4HA 2XWJB 5DM73 3CCUA 4DR7Q 2HT1A 2K14A 3S16H 4C3IB 3GV3A 1JORA 3GTLB 4DV2Q 3ONAB 4R4OA 2NVXH 4R9WA 1ZEQX 1T5XD 3WOFA 2WAQB 2XN9C 4U673 3E3XA 3MXGA 4N9PA 1L1OC 5GADC 4FF4A 4OX9L 4A3EG 2F4VQ 5I2XA 4IUTA 4JI4L 4DPGA 3TRZA 2BDNA 2PW5A 2RSOA 3I2ZA 4AQYL 1KLUD 2NZOA 3CP0A 3PMFA 4FNFA 4GOPC 2UUAQ 1PRTB 1STGA 4A3BH 4WJ3M 4I7ZC 2QW7A 5EQ0A 3G6JB 4LF5L 4PZ7A 3UDIA 4LMQD 1LTTD 4IJHA 2KVMA 2B2TA 2E2HB 2F52A 4A3FH 3T53B 1J5EL 3H0GG 3MVVA 1K83H 2F0KA 1I94L 4DF7A 2HQEA 2K7VA 5TSSA 2B29A 1HNXL 1SYBA 1G6PA 3OOCA 1LM0A 5EGTA 4A4IA 1E0BA 4EQOA 2NB0A 3J81i 3GTQB 4E6IA 1GUSA 4FXGC 1PH3A 1PH1A 1FGUA 5DNFA 4DK0A 4ID6A 3DXJC 3LNNA 2UXBQ 3CCJA 3KLRA 1YHBA 2JA5G 1G2SA 1RF2D 4DR2L 3R3OA 4GLAC 3GTKH 1QJOA 2ICIA 5E4XA 3M85A 2VQEQ 3J7AV 3S17H 2M00A 1CQVA 1N34L 1D6EC 2UU9Q 4B3MQ 4DNIA 1I6HH 3I4MG 2N49A 2K32A 4UP9A 3DLLA 3Q6SA 4QCLA 3U4ZA 4IUPA 1XPUA 4PMCA 3A54A 3A55A 2PNHA 4O0AA 1CKNB 2Z9HA 5HGTA 3QOJA 4K5XA 2VW9A 3MAQA 4K2LA 1HPCA 1N9WA 4XQJA 4QGUA 1DOLA 5GROA 4IPGA 5COYA 3NBHA 3H6MA 3CF5A 3GDEA 3TP8A 1SMXA 5M5XB 1TWFB 1EY9A 4JI3L 4JYAQ 5IYBG 1GUTA 4UY8C 2OT2A 3K58A 3FMCA 1NBWA 5LL6X 4C3JH 4DU9A 1X3EA 1NCVA 1RKNA 1SAPA 3U4VA 1DCZA 1UE6A 4DAYB 5ELCA 4BBSG 2O5JC 1G291 1B8AA 4DR6Q 4PQXA 3N6RA 3HOWB 2F4IA 1YEZA 5EJWA 4P75A 3CCQA 1VQOA 4X66L 2B2VC 3S1MH 3KLSX 3K5OA 4XT3B 3HRZC 4I7AA 4APVA 1B4OA 3IAYA 2WB1G 4L63B 1TWCB 2RKSA 3PGZA 2XVSA 1STYA 1S40A 2O2LD 3KJPA 3C2PA 4P71A 2IW3A 1ESRA 4BY1H 3PIP3 4NXNQ 2OXPA 1X65A 1EQTA 1IZ6A 1M1KC 4G7ZC 2YTXA 3KF8A 1TWAH 2L5TA 3ICEA 4A3DH 1CSQA 5EKLA 4A3MG 2L4NA 4GKKL 2NZ1D 1TT2A 4HMJA 3SK5A 2F0TA 1I4HA 3FRPB 3FVQA 1I4PA 2KCCA 2NTTA 3J80E 3V05A 1Q82C 3U9SA 3FKIG 1PH9A 1P8LA 2PZWA 4RA8A 4A3GG 3JAMi 1IYJB 4A3KG 1HFNA 1E22A 3BVZA 2KCTA 1SDFA 1Q7YC 3SDZA 2A73B 5M3MB 3TREA 1S4ZA 4RGNA 3ITPA 4AIMA 4EQNA 5JJIA 3RLOA 3D4DA 1SE8A 2IT1A 4FF1A 5CV5A 4BXXG 1NY4A 1WCMG 2IJ0A 3R2TA 1S3OA 1JB3A 1EY0A 3G71A 4WORA 1WTXA 1C7YA 3DMUA 1TKWB 2B2UA 3NQIA 3EA6A 5EAYA 1WFQA 5G3LD 2BA0A 3J81L 2R7ZH 1R9TH 1N36Q 1AE3A 3M7GA 2B63G 4X3KA 3UDFA 4DAVA 4GLVB 4P72A 3OSOA 5C4JB 2XWBB 5IGBA 4DK1A 2DN8A 2PQEA 3E6ZX 4X64L 4HIKA 2KA7A 1EU3A 3A74A 5EPJA 1WOCA 3Q8DA 1VDZA 3C1EA 2UUCQ 1M8AA 2K75A 3TP5A 5I2YA 1GUOA 1CI3M 2KQ3A 2PZUA 4AYBG 2ZTCA 5IYDH 3FPPA 1H9KA 4KKUA 1GUWA 3PSIA 4OO1I 3D31A 1A15A 4KHPL 2F0FA 4YCUA 1N33L 3LGJA 1PH7A 2CH4W 2PCFB 2MHVA 1VQBA 1H9RA 2J0TD 2RDGA 4CKBA 4JI6L 4QJFA 2E75C 1D5XC 4R4CA 2WIIB 2EJGC 4ZQ3A 2HDLA 4IPCA 4R4IA 1EWIA 1YHQA 4LFAL 3OW2A 4NW2A 5C44B 1AZPA 2EYPA 1EY5A 5M5YH 1J9OA 1WTVA 3A8IE 2QDBA 1WTQA 3MHBA 1KL9A 4K2KA 3T16A 3HOVG 1B53A 1CZWA 4Y7NH 1HNWQ 1NSNS 2DY8A 2F0QA 1KC8C 4EQPA 1T5EA 2RCFA 3BDCA 5C3EB 3IL8A 1SN8A 5LMUL 5HGQA 3RLNA 1YIJA 2K5WA 3A0JA 1C0AA 1X9NA 4L5SA 2B2WC 1EYGA 5M3FG 4A3EH 3G4SA 2F0DA 4FXDA 4KY7A 3TP6A 1O78A 5K36G 4JBMA 1ET9A 4LF6L 2ZTDA 4RGTA 2I5MX 5I6YA 4LFBL 2WB1E 1B50A 1PDQA 3H94A 4HN7A 3HOYG 3D4WA 2QGQA 2WFWA 3T1HQ 2RHQB 1IBLQ 2MO0A 2OCEA 4OHJA 1CZGA 2ZJPA 2RSNA 4H7BA 1PYSB 1VQPA 1SJED 2JN4A 3F1ZA 3H0GH 2AUJD 4QUFA 1UE1A 1B70B 1GJXA 1TXYA 1RJTA 1SYCA 2UXDQ 1X56A 4LUZA 3D0FA 4DV0Q 2NTSA 1LT3D 2AUKA 3BDLA 2MP1A 3QIAA 2C5CA 3S1QB 1ICWA 2HQLA 3X3NA 3ND9A 3HOZG 4YHHQ 4IOCA 2B2YC 2A74C 4IPDA 4B3SL 3E0JA 5IT9L 2I07B 2JA5H 3D6WA 5D65A 1G6ZA 2EYFA 1FNVA 1E24A 4JI1Q 4BWGB 1A6XA 3S14B 2G5DA 4KJNA 3I4MH 3FEWX 1MD2D 5BN3A 1HUMA 3S15B 4C3HB 2NVTH 5JEAJ 1IKMA 3W1GA 3WWVA 4RHSA 4JI2L 2A8VA 1SXTA 2IX0A 2L0CA 3I3CA 3K7AH 2R3ZA 2MFIA 1E1TA 5C5LA 3I8ZA 3J81j 2WINB 2BH2A 5BR8L 4DUZL 3HOXG 4HEDA 5D3IB 2F3IA 2MO1A 4IPHA 5AFWA 4JBJA 4JI0L 5FLXc 5H1SE 4PG3A 5IYBH 4DR3Q 1I4GA 5ELBA 1VQ5A 2PZTA 4BBSH 4C1NK 1LLRD 4NP5A 4GZYC 1BCPC 5C5MA 4LUVA 4AYBE 3ULJA 3STBC 4J8QA 1HR0W 5IGEA 1Q1EA 4G7HC 1HA6A 3ERSX 1TWHH 5CGKA 2CWPA 2IPKD 2R7FA 1PFSA 3CMEA 1QB5D 1LTAD 4L8JA 5KYIA 1EOTA 2YV5A 3NK9A 3L2PA 5IP9G 4GN5A 4XQQA 2K03A 5EKKA 3N52A 4UHVA 2Y0SB 1B44D 2JQOA 1DM0B 3OYYA 4C2MB 1KAAA 3S2DH 2IX1A 4A3MH 1Y1VB 4J6HA 3S2HH 1STBA 3RD4A 1X6OA 4QY7A 1EIHA 2OEOA 3A56A 2GN5A 2EY2A 2JSOA 2ID0A 3MEFA 3S24A 4YIJA 3NBHB 3PIO3 3BS1A 5C0XI 3K6OA 3FKIH 4A93G 3SGIA 3DWAA 4A3GH 1A3UA 2Z1CA 4G7OC 1TY0A 4A3KH 2ICEC 3AU7A 2SNMA 4HSPA 3SK4A 4K8JA 1KHIA 3IRBA 4YY3Q 4KI0A 3JC66 1PRTC 3OW7A 5LMNW 3KDFA 3L7ZC 3KF6A 2OQKA 4HAEA 5E1FA 1O7ZA 2N3SA 4BXXH 1BDOA 1VQAA 2N88A 4LJZC 2CCZA 2VB2X 1SFOH 3PO3G 1WCMH 1U0LA 3BZDB 5IWAL 4GN3B 3U50C 3M4OH 1SYDA 1IW7D 1VQHA 2D0PA 2K5NA 4NPSA 3NHHA 1D5ZC 2A6HD 3CCMA 2B63H 2A6EC 4O42A 4RWSC 2BA1A 3J81E 4A3JB 3S1NH 5CBEE 5C6AA 1F9SA 1HTPA 3EJIA 1QCBD 3FDTA 2JA8G 3KF8B 4RH6A 5C4XG 1RTNA 1JQYD 3F2CA 1CA5A 1RD9D 3BVMA 2IWHA 4KV6A 1X55A 4DUYL 2WKDA 4HIOA 1SLJA 1XNRQ 1EZ8A 4JI7L 1GHKA 3E0EA 1FJGL 1IBML 4LWCA 4R8NA 4B3RL 4S3SA 4RKBA 1FNUA 1K8AC 1A3VA 4K0KQ 2NWGA 2L11A 4GS3A 1EY6A 1QUQA 2VS1A 3HOUG 4FF2A 2PPBC 1Q1BA 2ZM6Q 4ZCKA 2B2VA 2JP1A 4JK1C 4DAMA 1I5FA 4N8X1 3RLFA 1CHPD 4BBRG 3NXWA 2PI2E 4LF7Q 2EYOA 4CDFC 2RHSB 3T1YQ 1FYCA 2E8GA 4BY7G 2E2DC 1XNQQ 5AJ3Q 2DJFC 4EVOA 3MA2B 4LFAQ 2K4KA 3M3YH 4DXGA 1HTLD 1MIUA 2DNEA 1AP0A 5FO8B 2EPBA 3A8JE 3SVMA 2LFNA 3DHQA 1DYQA 3RZDB 4A3IB 1D8LA 3A7AB 3GTJB 4IUVA 1AH9A 3DM3A 4MTKA 1E2WA 1M4VA 1QE6A 4ZKBB 3GTQH 2I5HA 4HR7B 2QF7A 2AQ1B 3HOVH 3B6YA 1AZQA 1LT5D 1TWGB 5LMUQ 3K5LA 1TR5A 5E4WC 4LFCQ 2RBMA 4CDDC 2E2JH 5JJZA 1PTOB 1F9PA 1MBYA 1EEFD 2EOTA 4JOIC 2YU9B 2D2CC 1B7YB 4IUUA 1G2TA 2HD3A 5M3FH 2K28A 2SDFA 3T4AC 1VQIA 2HHHQ 5K36H 1J8IA 4JVZA 4LF4L 1JT8A 1VQ7A 1EWHA 1EUJA 1O7LA 2JEBI 1S5CD 3RNUA 4HTHA 2IHFA 3K8AA 1PH5A 3EN2A 4B9XA 1X3FA 3HOYH 1J6QA 4ODGA 3URYA 2DUDA 4B3TQ 1I6VC 1BO0A 2N55A 4IFDJ 2WACA 4JC0A 4UDUC 3PQIA 1IBKL 3GQBA 4WRDA 4XIGS 4A3CG 1ONLA 2RDFA 2F0HA 4KD4A 3S9WA 1ZXTA 2Q2HA 3QWNA 2UXCL 4ZRZA 3VYRA 5M5XH 2VQFQ 3NUCA 2L12A 2PO4A 4RFBA 3OPOA 4C56C 3HOZH 2F0OA 5IYCG 2F3VA 4NXML 2OF1A 1X3GA 1E3PA 2O4XA 2ZTEA 2E5LL 1YJWA 1JWUD 2RF4A 2EZVA 1VQGA 1RDPD 5IT9E 4JV5Q 3TQYA 3PCOB 1KDCA 2FMMA 2Z6KC 4CDEC 2XSCA 1NMGA 5EBDA 1DGSA 4HJ7A 1HNZQ 1ENFA 2E2IB 1JMCA 1FVIA 1E7ZA 1C48A 1TWCH 1SE2A 1Y8OB 2K5QA 2EYLA 3V2TA 2H5XA 3TS2A 1XMOQ 2I46A 1I4XA 3GTMB 2EJFC 3OTOL 5J22A 3TSSA 4F88A 4N9TA 4ME5A 3KUPA 2R92B 3DWQA 2Z4IA 3HGBA 1V8QA 4ME3A 1Y1VG 2JA6B 3R93A 3KJOA 3PO2B 3TS0A 2K1BA 1HZCA 3HOXH 1K0SA 4KKTA 4K5WA 4POFA 2N8NA 4GKJQ 3S16B 4DK3C 1EY7A 1SROA 2HCCA 4PMWA 3EFXD 3SXHA 2FMCA 3RN2A 1N32L 4IFDI 3J7ZC 5FJ8G 5JOBA 1OXUA 2LXJA 1STNA 1Z6HA 2NBFA 1Y1WG 5GQOA 3NEMA 4DV7L 5J1ZA 1HR0L 4V0BA 1STHA 1X32A 4H13C 3I72A 1ET6A 2HUGA 2F0MA 3MXNA 2RQXA 4IURA 2F0WA 3OIQA 3T51B 4UP8A 4LF8Q 2B39A 5I9OA 2EY1A 4MHEA 1U4MA 1EL0A 1EOVA 3ERQA 1PFMA 3IFDA 2R93B 1LACA 4F87A 5ELDA 5IP9H 4UAIA 2PMZB 1EZ6A 2JA7G 1Y14B 5KYLA 3H15A 4DV3L 3ZJYC 2F0PA 4HJ8A 1C8CA 1F77A 4HSVA 5CBAE 4A3FB 2G9HD 1K83B 2DY7A 3M9BA 3I4NB 1BNZA 4DV5L 4XTCS 3NTKA 5C4JH 4L5TA 3E9IA 2VUMB 3RR5A 5C3WA 1CUKA 1SNPA 3CC4A 4K6LA 3QJYA 2ZXPA 2AWOA 1A8VA 4DV1Q 1KRTA 1ENAA 2B2YA 2KUMA 4A93H 1F9QA 4HJ5A 5I4DA 1XMQL 3C46A 1HRJA 3L9AX 5KNCA 5JPNC 5LMNL 1EIYB 1IL8A 4HCSA 1HZBA 1SEBD 1I3QH 4OONA 1ILPA 1KIXA 1NMFA 4C1NI 4DV6Q 3S17B 1K3RA 2AWNA 1JJ2A 4HIDA 4X65L 1I6HB 1GXDC 2EXZA 3D6CA 3HEJA 2QKIC 1TS3A 3PO3H 2EYMA 1GUGA 1KABA 3GTPH 1Q3LA 2SOBA 1BF4A 4DV4Q 1VF7A 2M9VA 5CV6A 4CGYB 1RTOA 2AKWB 3HKZG 4X62Q 1UEAB 2ENBA 1BVSA 1IL2A 3M4PA 1V43A 4ZYSA 2MUYA 3H3VC 3M7NA 1GKHA 3GTGB 4DR4L 4A3IG 1CKMA 2Q2UA 1I4QA 2X6GA 3CD6A 4H0LC 4QIWE 2JA8H 5C4XH 1A62A 1PH8A 3AB9A 2Q2IA 1STEA 1XX8A 4ZUIA 5IY0A 2EQSA 5C4HA 3CPFA 3AMUA 4C3JB 5E3FA 3VYUA 2GVBA 4C3IG 4G4KA 2ES2A 4KHZA 5EPLA 2BOSA 3HOUH 1Q81C 1NR2A 3SR1A 2NN6I 3MTSA 4ZUJA 2WAQG 1GM5A 2PQAA 4MZ9A 1KXLA 4BBRH 4Q0FA 4DN4M 1S5FD 4BY7H 4KHVA 3KDFB 4KTAA 3KF6B 2HIXA 4XYQA 5LL6S 3NELA 2YTVA 1PVOA 1RCVD 3J7YW 4Z9CB 3NBIA 2B2TC 3BVGA 4BY1B 2YYZA 3CQZH 4OWTB 4LF9Q 2VZAA 1T9HA 2TSSA 1KNEA 2UUBQ 1SNQA 4ZLTF 1TWAB 3H3VH 4JI5L 2K04A 4KK7A 3VDYA 3MWYW 4Q5VA 3S1QH 2R61A 4LAAA 5JVH3 4DR1Q 2LY7A 4IUQA 2XTIA 5CV9A 1ZKOA 3K81C 4PZ8A 2SEBD 4FVMA 2CW0C 1PYBA 4F7XA
chains in the Genus database with same CATH topology
2K6AA 1GHJA 4OO1G 3IFTA 2QILA 1KTKA 4TRDA 2AQ3B 1HXYD 3NQTA 4DGZA 4O1NA 4NKLA 4FXKC 5IGCA 3GO5A 1S5BD 5CORA 4QF4A 5EPKA 2H4OA 2H1EA 2K5DA 2F0UA 3H91A 1R9TB 5D14A 4TKOB 1PMRA 1W6KA 4CJ0B 3D4RA 1TS4A 3VR2A 1II3A 1D2BA 2JE6I 3BYTB 3C3LA 3EROA 5I6WA 4RHRA 1IYUA 3JAML 1SNDA 1SNMA 3I73A 1BUVT 3CRKC 3TDQA 1JWMD 1OXXK 4JBWA 4XXEA 1PXUA 2A68C 4U68A 1LTID 5FLXL 5IGDA 1XTCD 1LABA 1I50B 2GA4B 1XWEA 3GD7A 3H09A 4QB4A 1HA5A 3I91A 2LKVA 1R4QB 4KJOA 1PTOF 1PZID 1UUPA 4RCNA 4RCOA 5A2QE 5M5YB 2VNUD 4KN4C 3CKIB 1D1KA 1H9MA 3BYYB 4KMUC 4Y7NB 1SYEA 1F2ZA 2LS01 5FK9C 1CFMA 3VYSA 3TP7A 1QOHA 1EWCA 1BBXC 3VA7A 2K05A 5JPMC 4A3EB 1YNJC 1DOMA 2WV6D 3WDNA 3W2DA 3OWFA 1I4RA 3ZYYX 3NPPA 3NWTA 1MGSA 1TS5A 2KEEA 2O5IC 2B2UC 1B9NA 4TQUS 1QNKA 1B9MA 3H0GB 4RGMA 1CM9A 5IGGA 2XNAC 1SE4A 1PTOC 3DM1A 1LT6D 1OXVA 1K8OA 3G7LA 2JA5B 2EE1A 5ISRA 2K01A 4HCEA 4ABNA 1CK1A 5CV8A 3I4MB 3OMGA 1ZYRC 1ML0D 1E2ZA 3K5MA 1MSHA 2CHBD 1H9SA 5FKAC 3K7AB 1RODA 4DAPA 1SMYC 3V96A 3TBIB 4HMIA 5JEAG 3OWEB 2X69A 1IYVA 4P2CB 5C0XG 5C3XA 1IHZA 3VR4A 2FFKB 5DM63 2L1BA 1BCPD 1HFGA 1QNUA 5LHY1 5J39A 3K59A 3GP7A 4OIKA 4BBSB 2BE5C 3KLSA 3EVQA 3R2IA 4M8AA 3SK6A 2NVYB 1G91A 4K6DA 2M2LA 3KBGA 2WP8J 4KY6A 4IUNA 2EYJA 3SE0A 5KGUA 2NYZD 1XXGA 3EQLC 3LWEA 1CT1D 2HCIA 1SYGA 4XDXA 3S1RB 1U4PA 3S2DB 3NWSA 1JICA 3S2HB 4WJWA 3E5SA 5A35A 1CA6A 3FKIB 1HUNA 3QG1A 2F1MA 1CTMA 5EBCA 4OO1H 4BS9A 1G8ZD 4A3KB 1PRTD 1VMCA 1EYCA 2EVBA 3MFYA 5CYUA 3QO2A 1V1OA 1BCPB 3VA5A 1ENCA 1LV9A 4G57A 4B08A 1HHVA 2XIWA 1JOQA 4K5VA 4CBVA 1WCMB 5JAVA 3DWPA 1WTOA 2A6ED 3M4OB 3HZXA 1FGBD 4C3HG 2FINB 2BCOA 2RDHA 5IODA 4FO2A 1EEID 1D5MC 3PUWA 3U9OA 2F3WA 4RKLA 3RZOB 1TIID 3MXPA 2EY6A 1EQVA 2VB3X 3OHXC 4NMZA 2JEAI 3JAME 3A7LA 5ELFA 3QOLA 3P20A 4AYBB 2J7ZA 1X3PA 5CR3A 1SE3A 2F0GA 3F2UA 3HS0C 4MN3A 1WTPA 4PV1C 4BA1I 3RMHA 5FLXE 5BN5A 3PUXA 2D5DA 4CKCA 1O80A 4V190 3M3YB 2JXMB 4K14A 5IIFA 3VR6A 5M9OA 1SSOA 2QCPX 2FJ2A 5G3LF 3FPUB 3RUZA 3SK8A 3W3AA 4F8MA 5I9PA 1V1PA 3T56B 3HOVB 2D62A 2VXWA 1JC7A 5A2QL 1Q90A 2Q8IB 3Q22A 4CKEA 2E2JB 1ILQA 1Y8NB 1AEXA 5FO7B 5KEEA 1F2LA 2PW7A 5M3FB 1TU2B 2NVXB 4IZ8A 3PUVA 4OL7A 1A2TA 4XQNA 4X3TA 3KBXA 1SBBB 2B2WA 4NDXA 3HOYB 1ESFA 2Q8RE 1EU4A 1F2MA 1VCIA 1QG7A 3Q24A 2F0EA 1FNWA 4A3BB 2MGSA 3HP3A 2KJXA 1D1IA 1LTGD 1SNOA 4L6TB 4IFDG 1JCKB 1MSGA 3HOZB 4CJ2C 3K57A 1SNCA 2RA4A 1FR3A 5T1IA 4KD3A 1DOKA 2PNRC 4DNRB 4ILWA 2F0IA 4ULLA 5NUCA 2EY5A 1GOZA 2DNCA 5FOBB 3IKJA 3GTKB 5IGFA 2FHTA 1Y8PB 1PZKD 1PFNA 4K8IA 2X6LA 5CMDA 1GUNA 4FP5D 4EGVA 1L0XB 5JEAH 5DAUA 5EKIA 3MZ5A 2F0LA 3KK7A 5C0XH 3HOXB 1Q8IA 2MPMA 3P7JA 5T1GA 5IOCA 4RAUC 4QUCA 3I4LA 1U9RA 1CQFA 1W6JA 1DZ1A 3WOEA 1BR9A 3OMCA 1NUCA 3DUZA 3I90A 2IX3A 2F0SA 4X3UA 4FYDA 1S5ED 1R4PB 2EJMA 3D3RA 5ELEA 3S1MB 1VF5C 5HURA 4RGOS 2EYHA 3L3OC 1H9SB 4CJ1B 2E76C 5C4ZA 2G9DA 2Z8LA 4MIUA 3T13A 3ND8A 4R8IA 1HQRD 2B8FA 2XRSD 1EY4A 4A93B 4PNYA 4A3DB 1JE4A 2NN6G 1EIGA 1UAPA 3DEOA 2A69C 2K33A 2CVRA 3X3MA 1KNAA 1EYAA 3TMEA 1I3QB 2WKCA 4DXFA 4ZK9B 1LTBD 2NUCA 1A2UA 2KEDA 2AQ2B 3TN2A 3PO3B 2A5HA 3GTPB 1PLFA 3BG3A 3I70A 5KIXA 3NTIA 4DNTB 1E2VA 5D3DA 1OO9B 5BN4A 1OXSC 2V4DA 2Q8TA 1A3TA 2KOLA 2JA8B 1YNNC 5C4XB 3TZUA 1O7YA 2EDGA 3PUYA 3MXUA 1TQOA 1Z47A 2R7ZB 4BA2I 4KY5A 4IQZA 5F2DA 1DXMA 2F0NA 3K0YA 1WVLA 2F03A 1H9JA 1WD1A 2L9HA 2KECA 1TVXA 3HOUB 1JOOA 1NR4A 2KHSA 5KNBA 3P75A 2MJ8A 4XT1B 3MEHA 4BBRB 1DD2A 4H44C 1U4LA 4I65A 1U4RA 4BY7B 2IL8A 4M1UB 4CHTB 2PYKA 2D9UA 3QB3A 3VYTA 2A69D 2F0VA 3CQZB 2JYOA 1B2TA 3O13A 4B9WA 1BCPF 2CW0D 1AN8A 1AFPA 4IN3A 4J1MA 3DEPA 2BDOA 5DEHA 1HQMC 4DAYA 2F0JA 2ZXRA 1NAPA 1JWSD 1LO5D 2XRQD 3Q0AA 2B8GA 4ZAIA 2LMCB 3J7AF 2CQAA 1YNND 3D8GA 2SNSA 3VR5A 3C1FA 4TSSA 1F9RA 5C0XJ 4DFAA 3Q23A 1PYWD 1KLGD 1Q12A 1CHQD 1STAA 2C9OA 5FO9B 1Z7TA 4QIWB 4OIJA 4IFDH 3TZDA 5K5PA 1B1ZA 1EY8A 1IW7C 1PRTF 3CU7A 1QWYA 4X3SA 2A6HC 1V1PB 5CC4A 2QEJC 1LTRD 1AW7A 3UI2A 4OGQC 1LTSD 2A68D 4C3JG 3CRLC 3A8KE 1KDAA 3GTOB 3CHBD 1UNSA 3SEBA 3LX0A 3MFGA 2ZXOA 1X3QA 1DJRD 4XYOA 5M5WB 3PUZA 4DA2A 1PZJD 1WTRA 2NVTB 3M4YA 4QMGA 1KDBA 2TMPA 2E74C 1BQQT 4KKSA 2J4XA 1SYFA 1XYIA 1EYDA 4FF3A 3J80L 5KRUA 1Y1WB 1YNJD 1PTOH 1WTWA 1MI2A 1QILA 3MC0B 3K5NA 1TY2A 1JR0D 2RVLA 1FD7D 2JA7B 1SJHD 2L55A 1TWHB 5JVG3 2WB1B 3NTHA 4LK1C 1PTOD 2ZT9C 1S5DD 3SHLA 1WD0A 3HG9A 1B3AA 3R8BA 1LT4D 1Y69U 3NSWA 5KNDA 2NN6H 4A3MB 2NVQB 4IALA 5CV4A 3P1HA 1VMPA 1RHPA 3GV6A 4PMBA 1ZYRD 3OIPA 4A3GB 4KN7C 4ZKCB 3VR3A 2HDMA 1SMYD 1BOSA 1C4QA 3HKZB 1L0YB 2KCNA 1BXTA 4WFN3 5CV7A 1HCZA 1SFOB 1OXTA 1K8MA 3LWUA 3PV0A 1EFID 3NE5B 2R6GA 3NP8A 1F2YA 2BE5D 1DONA 3BDOA 2B63B 1IKLA 1TS2A 1PFBA 3S1NB 1JOKA 2Z4HA 2XWJB 5DM73 4C3IB 3GV3A 1JORA 3GTLB 3ONAB 4R9WA 1ZEQX 1T5XD 3WOFA 2WAQB 2XN9C 4U673 3MXGA 4N9PA 4FF4A 5I2XA 4IUTA 2BDNA 2PW5A 2RSOA 1KLUD 3PMFA 4FNFA 1PRTB 1STGA 4I7ZC 5EQ0A 3G6JB 4LMQD 1LTTD 2KVMA 2B2TA 2E2HB 3T53B 3MVVA 2F0KA 4DF7A 2HQEA 2K7VA 5TSSA 1SYBA 3OOCA 5EGTA 1E0BA 4EQOA 2NB0A 3GTQB 4E6IA 1GUSA 4FXGC 5DNFA 4DK0A 4ID6A 3DXJC 3LNNA 3KLRA 1G2SA 1RF2D 3R3OA 1QJOA 2ICIA 5E4XA 3M85A 3J7AV 2M00A 1CQVA 1D6EC 2K32A 3Q6SA 4QCLA 4IUPA 4PMCA 3A54A 3A55A 5HGTA 3QOJA 4K5XA 3MAQA 4K2LA 1HPCA 4XQJA 1DOLA 5COYA 3NBHA 3H6MA 3TP8A 5M5XB 1TWFB 1EY9A 1GUTA 2OT2A 3K58A 3FMCA 5LL6X 4DU9A 1NCVA 1RKNA 1SAPA 1DCZA 5ELCA 2O5JC 1G291 4PQXA 3N6RA 3HOWB 2F4IA 5EJWA 2B2VC 3KLSX 3K5OA 4XT3B 3HRZC 1B4OA 3IAYA 4L63B 1TWCB 2RKSA 2XVSA 1STYA 2O2LD 3C2PA 2IW3A 1ESRA 3PIP3 2OXPA 1EQTA 4G7ZC 3KF8A 2L5TA 5EKLA 2L4NA 2NZ1D 1TT2A 4HMJA 3SK5A 2F0TA 1I4HA 3FRPB 3FVQA 1I4PA 2KCCA 2NTTA 3J80E 3V05A 3U9SA 2PZWA 4RA8A 1HFNA 3BVZA 1SDFA 3SDZA 2A73B 5M3MB 1S4ZA 4RGNA 3ITPA 4EQNA 3D4DA 2IT1A 4FF1A 5CV5A 2IJ0A 3R2TA 1JB3A 1EY0A 4WORA 1WTXA 3DMUA 1TKWB 2B2UA 3NQIA 3EA6A 5G3LD 2BA0A 3J81L 3M7GA 4X3KA 4DAVA 3OSOA 5C4JB 2XWBB 5IGBA 4DK1A 2DN8A 2PQEA 3E6ZX 2KA7A 1EU3A 5EPJA 1VDZA 3C1EA 1M8AA 3TP5A 5I2YA 1GUOA 1CI3M 2KQ3A 2PZUA 3FPPA 1H9KA 4KKUA 1GUWA 4OO1I 3D31A 1A15A 2F0FA 2PCFB 2MHVA 1H9RA 2J0TD 4CKBA 2RDGA 2E75C 1D5XC 2WIIB 2EJGC 4ZQ3A 2HDLA 4NW2A 5C44B 1AZPA 2EYPA 1EY5A 1J9OA 1WTVA 3A8IE 2QDBA 1WTQA 3MHBA 4K2KA 3T16A 1B53A 1CZWA 1NSNS 2DY8A 2F0QA 4EQPA 1T5EA 3BDCA 5C3EB 3IL8A 2K5WA 2B2WC 2F0DA 4FXDA 4KY7A 3TP6A 1O78A 5K36G 1ET9A 4RGTA 5I6YA 1B50A 1PDQA 3H94A 4HN7A 3D4WA 4OHJA 1CZGA 2RSNA 4H7BA 4QUFA 1SJED 2AUJD 1GJXA 1RJTA 1SYCA 2NTSA 1LT3D 2AUKA 3BDLA 2MP1A 3QIAA 2C5CA 3S1QB 1ICWA 3X3NA 3ND9A 2B2YC 2A74C 3E0JA 5IT9L 2I07B 3D6WA 5D65A 1G6ZA 2EYFA 1FNVA 4BWGB 1A6XA 3S14B 4KJNA 3FEWX 1MD2D 5BN3A 1HUMA 3S15B 4C3HB 5JEAJ 1IKMA 4RHSA 1SXTA 2IX0A 2L0CA 3I3CA 2R3ZA 5C5LA 3I8ZA 2WINB 4HEDA 5D3IB 5AFWA 1I4GA 5ELBA 2PZTA 4C1NK 1LLRD 4NP5A 4GZYC 1BCPC 5C5MA 4J8QA 5IGEA 1Q1EA 4G7HC 1HA6A 5CGKA 2IPKD 1QB5D 1LTAD 4L8JA 5KYIA 1EOTA 3NK9A 4XQQA 2K03A 5EKKA 3N52A 2Y0SB 1B44D 1DM0B 4C2MB 1KAAA 2IX1A 1Y1VB 4J6HA 1STBA 3RD4A 1EIHA 2OEOA 3A56A 2EY2A 2JSOA 2ID0A 3PIO3 4YIJA 3BS1A 5C0XI 3K6OA 3DWAA 1A3UA 2Z1CA 4G7OC 1TY0A 2ICEC 3AU7A 2SNMA 4HSPA 3SK4A 4K8JA 4KI0A 3OW7A 1PRTC 3L7ZC 4HAEA 5E1FA 1O7ZA 1BDOA 2N88A 4LJZC 2VB2X 3BZDB 1SYDA 1IW7D 3NHHA 1D5ZC 2A6HD 2A6EC 4O42A 4RWSC 2BA1A 3J81E 4A3JB 5CBEE 5C6AA 1F9SA 1HTPA 3EJIA 1QCBD 3FDTA 4RH6A 1RTNA 1JQYD 1CA5A 1RD9D 3BVMA 2IWHA 4KV6A 2WKDA 1EZ8A 1GHKA 4R8NA 4S3SA 4RKBA 1FNUA 1A3VA 2NWGA 2L11A 1EY6A 4FF2A 2PPBC 1Q1BA 2B2VA 2JP1A 4JK1C 3RLFA 1CHPD 3NXWA 2EYOA 1FYCA 2E2DC 4EVOA 3MA2B 4DXGA 1HTLD 2DNEA 1AP0A 5FO8B 2EPBA 3A8JE 3SVMA 2LFNA 3DHQA 1DYQA 3RZDB 4A3IB 3A7AB 3GTJB 4IUVA 1E2WA 1M4VA 1QE6A 4ZKBB 4HR7B 2QF7A 2AQ1B 1AZQA 1LT5D 1TWGB 3K5LA 1TR5A 5E4WC 2RBMA 5JJZA 1PTOB 1F9PA 1MBYA 1EEFD 2EOTA 2YU9B 2D2CC 4IUUA 1G2TA 2K28A 2SDFA 3T4AC 5K36H 1J8IA 1EWHA 1O7LA 2JEBI 1S5CD 4HTHA 4B9XA 4ODGA 3URYA 1I6VC 1BO0A 2N55A 4IFDJ 2WACA 4UDUC 4WRDA 3GQBA 4XIGS 1ONLA 2RDFA 2F0HA 4KD4A 3S9WA 1ZXTA 3QWNA 4ZRZA 3VYRA 3NUCA 2L12A 2PO4A 4RFBA 3OPOA 4C56C 2F0OA 2F3VA 2OF1A 2O4XA 1JWUD 2EZVA 1RDPD 5IT9E 1KDCA 2FMMA 2XSCA 5EBDA 1ENFA 2E2IB 1C48A 1SE2A 1Y8OB 2K5QA 2EYLA 3V2TA 2I46A 1I4XA 3GTMB 2EJFC 5J22A 3TSSA 4F88A 4N9TA 4ME5A 3KUPA 2R92B 3DWQA 2Z4IA 3HGBA 1V8QA 2JA6B 3R93A 3PO2B 2K1BA 4KKTA 4K5WA 3S16B 1EY7A 2HCCA 4PMWA 3EFXD 3SXHA 2FMCA 4IFDI 5JOBA 1OXUA 1STNA 1Z6HA 2NBFA 5J1ZA 4V0BA 1STHA 1X32A 4H13C 3I72A 1ET6A 2HUGA 2F0MA 3MXNA 2RQXA 4IURA 2F0WA 3OIQA 3T51B 2B39A 5I9OA 2EY1A 4MHEA 1U4MA 1EL0A 3ERQA 1PFMA 3IFDA 2R93B 1LACA 4F87A 5ELDA 4UAIA 2PMZB 1EZ6A 5KYLA 2F0PA 1C8CA 1F77A 4HSVA 5CBAE 4A3FB 2G9HD 1K83B 2DY7A 3I4NB 1BNZA 4XTCS 3NTKA 2VUMB 5C3WA 1SNPA 4K6LA 3QJYA 2ZXPA 2AWOA 1ENAA 2B2YA 2KUMA 1F9QA 5I4DA 3C46A 1HRJA 3L9AX 5KNCA 5JPNC 1IL8A 4HCSA 1SEBD 1ILPA 4C1NI 3S17B 2AWNA 1I6HB 1GXDC 2EXZA 3D6CA 3HEJA 2QKIC 1TS3A 2EYMA 1GUGA 1KABA 1Q3LA 2SOBA 1BF4A 1VF7A 2M9VA 5CV6A 4CGYB 1RTOA 1UEAB 2ENBA 1V43A 4ZYSA 2MUYA 3H3VC 3M7NA 3GTGB 1I4QA 2X6GA 4H0LC 3AB9A 1STEA 1XX8A 4ZUIA 5C4HA 3AMUA 4C3JB 5E3FA 3VYUA 4C3IG 4G4KA 4KHZA 5EPLA 2BOSA 1NR2A 3SR1A 2NN6I 3MTSA 4ZUJA 4Q0FA 4DN4M 1S5FD 4KHVA 4KTAA 4XYQA 5LL6S 1RCVD 3J7YW 4Z9CB 3NBIA 2B2TC 3BVGA 4BY1B 2YYZA 2TSSA 1KNEA 1SNQA 4ZLTF 1TWAB 2K04A 4KK7A 3MWYW 4Q5VA 2R61A 4LAAA 5JVH3 2LY7A 4IUQA 5CV9A 1ZKOA 2SEBD 4FVMA 2CW0C 4F7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  3Q6S A;  4R8I A;  2L1B A;  4IUP A;  1HFG A;  2B2V A;  2FMM A;  2JP1 A;  1HA6 A;  1IL8 A;  4HCS A;  4OIK A;  4CJ2 C;  1ILP A;  1B50 A;  2RA4 A;  1BBX C;  1PDQ A;  1WTX A;  2K05 A;  2B2U A;  1EOT A;  1JE4 A;  1EIG A;  1G91 A;  3DEO A;  3DEP A;  1DON A;  1XYI A;  5T1I A;  1DOM A;  2J7Z A;  2RSN A;  1IKL A;  1DOL A;  1X3P A;  1DOK A;  1PFB A;  1Q3L A;  1BF4 A;  2CVR A;  4QUF A;  2K03 A;  2M2L A;  3F2U A;  3N52 A;  4X3K A;  1KNA A;  1RTO A;  5COY A;  4MN3 A;  1AP0 A;  3GV3 A;  1WTP A;  2EPB A;  4ZK9 B;  1MGS A;  3KUP A;  1NAP A;  3ONA B;  5COR A;  1RJT A;  3SVM A;  4R9W A;  2KEE A;  5EPK A;  2B2U C;  2H1E A;  1WTW A;  1MI2 A;  2NYZ D;  4IUV A;  1EIH A;  2KED A;  2MP1 A;  1QE6 A;  2FHT A;  4ZAI A;  1ICW A;  2K1B A;  3R93 A;  3TN2 A;  4ZKB B;  3H91 A;  1QNK A;  1O80 A;  1PFN A;  2X6G A;  5D14 A;  1PLF A;  1NCV A;  1SAP A;  2X6L A;  5EPJ A;  3LWE A;  5CMD A;  2B2Y C;  4CJ0 B;  1AZQ A;  1M8A A;  2HCI A;  1F9R A;  1SSO A;  1CM9 A;  4XDX A;  5E4W C;  2FJ2 A;  1XX8 A;  1U4P A;  2HCC A;  3FPU B;  3D6W A;  5D65 A;  1G6Z A;  2RVL A;  5EKI A;  5JJZ A;  1JIC A;  4IUT A;  1F9P A;  5EJW A;  2BDN A;  2RSO A;  1GUW A;  2B2V C;  3DM1 A;  4XT3 B;  2EOT A;  2Q8T A;  1A15 A;  4IUU A;  1G2T A;  2VXW A;  2K28 A;  1B4O A;  2KOL A;  2MPM A;  2SDF A;  3P7J A;  5EPL A;  5T1G A;  1CA6 A;  4OIJ A;  1O7Y A;  1HUM A;  5EQ0 A;  1NR2 A;  1X32 A;  4QUC A;  4HAE A;  4RAU C;  3TZD A;  1HUN A;  3MTS A;  4LMQ D;  2HUG A;  3G7L A;  1J8I A;  1O7Z A;  2EE1 A;  1IKM A;  1WD0 A;  2N88 A;  4IUR A;  2K01 A;  1ILQ A;  1ESR A;  1VMC A;  2KVM A;  2HDL A;  2B2T A;  1DZ1 A;  1B2T A;  4X3S A;  1B3A A;  4DN4 M;  4MHE A;  1U4M A;  1EQT A;  1EL0 A;  3I3C A;  3QO2 A;  4U68 A;  1WVL A;  1F2L A;  2R3Z A;  1WD1 A;  4NW2 A;  1PFM A;  3UI2 A;  2L9H A;  3IFD A;  2KEC A;  1TVX A;  1AZP A;  1J9O A;  1ML0 D;  3I8Z A;  1WTV A;  1BO0 A;  1NR4 A;  2L4N A;  1LV9 A;  2N55 A;  2NZ1 D;  4UAI A;  4O42 A;  1E0B A;  4RWS C;  1HHV A;  4X3T A;  1WTQ A;  3KBX A;  3I90 A;  2XIW A;  1MSH A;  1VMP A;  1RHP A;  5CBE E;  2MJ8 A;  3GV6 A;  3I91 A;  4HED A;  2B2T C;  4HSV A;  4XT1 B;  1B53 A;  2B2W A;  1F9S A;  1ZXT A;  5CBA E;  5DNF A;  5AFW A;  4X3U A;  2DY7 A;  1WTO A;  1U4L A;  3FDT A;  1C8C A;  1KNE A;  1ROD A;  1RTN A;  1U4R A;  2DY8 A;  4ZLT F;  1BNZ A;  1CA5 A;  2IL8 A;  2L12 A;  4RA8 A;  4ZKC B;  2K04 A;  1G2S A;  2Q8R E;  2FIN B;  1X3Q A;  2X69 A;  3IL8 A;  3MWY W;  1HFN A;  5E4X A;  2HDM A;  1QG7 A;  2D9U A;  4IUQ A;  2KUM A;  2B2Y A;  1SDF A;  2MGS A;  4CJ1 B;  2B2W C;  3HP3 A;  2NWG A;  2L11 A;  1F9Q A;  1S4Z A;  2FFK B;  2JYO A;  1HRJ A;  1WTR A; 
#chains in the Genus database with same CATH topology
 4ALP A;  2K6A A;  1GHJ A;  2AHO B;  4OO1 G;  3IFT A;  4JI8 L;  3ER0 A;  2QIL A;  1KTK A;  4FDB A;  3UE0 A;  4TRD A;  1QUQ B;  2AQ3 B;  1N8R C;  3S15 H;  1XPR A;  1HXY D;  1EFW A;  4OX9 Q;  1K8G A;  3NQT A;  1K73 C;  1BBW A;  3BJU A;  4OWW B;  4DGZ A;  4O1N A;  4NKL A;  3ULL A;  4JI4 Q;  4FXK C;  4AQY Q;  2C35 B;  5IGC A;  3GO5 A;  1S5B D;  5COR A;  4QF4 A;  5EPK A;  1VQJ A;  2H4O A;  2R92 G;  2H1E A;  1NE3 A;  3FP9 A;  2K5D A;  2R7D A;  2F0U A;  4LF5 Q;  3H91 A;  1R9T B;  4A3C H;  5D14 A;  4TKO B;  1PMR A;  1W6K A;  4CJ0 B;  3D4R A;  1TS4 A;  3VR2 A;  1II3 A;  4HJA A;  4YWK A;  1D2B A;  1J5E Q;  4QQB X;  1I94 Q;  2JE6 I;  2JJQ A;  4DR5 L;  3BYT B;  4DR7 L;  1HNX Q;  3C3L A;  5IYC H;  3ERO A;  4DV2 L;  5I6W A;  4RHR A;  1IYU A;  4GNX C;  2I0Q A;  3CCR A;  3EBE A;  1SND A;  3JAM L;  1SNM A;  3I73 A;  1A0I A;  1BUV T;  3CRK C;  3TDQ A;  1JWM D;  1OXX K;  4JBW A;  4DK6 C;  4XXE A;  3GTO H;  4DR2 Q;  1PXU A;  2A68 C;  2F4V L;  4U68 A;  1MJE A;  1LTI D;  5FLX L;  5IGD A;  1N34 Q;  1XTC D;  1LAB A;  3TEH B;  3HOW G;  1I50 B;  2GA4 B;  2R93 G;  1XWE A;  3GD7 A;  2UUA L;  4TVA B;  3BZK A;  3H09 A;  5M5W H;  1WTH A;  3HKZ E;  4QB4 A;  1HA5 A;  3I91 A;  1VQ4 A;  2LKV A;  1R4Q B;  4UPA A;  4KJO A;  1PTO F;  1PZI D;  1UUP A;  3CMA A;  3W5O A;  1L0W A;  4RCN A;  3I4N G;  4JW0 A;  4RCO A;  5A2Q E;  1Y1V H;  5M5Y B;  2VUM G;  2VNU D;  4KN4 C;  3CKI B;  2ASB A;  1D1K A;  3KOJ A;  1H9M A;  3BYY B;  4KMU C;  4Y7N B;  1SYE A;  1F2Z A;  2LS0 1;  5FK9 C;  1CFM A;  1K0R A;  1SR3 A;  5FJ8 H;  4IJL A;  3VYS A;  4JI3 Q;  1EQR A;  3TP7 A;  1QOH A;  1Y1W H;  2UXB L;  1EWC A;  1BBX C;  3VA7 A;  2K05 A;  2KBN A;  5JPM C;  4A3E B;  2WAQ E;  2A1A A;  4OEL B;  3F8T A;  2VQE L;  4YWL A;  4HJ9 A;  1YNJ C;  1DOM A;  2WV6 D;  3WDN A;  1L1O A;  2UU9 L;  4B3M L;  3W2D A;  1SRU A;  1VQ6 A;  3BZC A;  3OWF A;  1I4R A;  3ZYY X;  3AFQ A;  4R1J A;  4R4Q A;  4X66 Q;  4MNO A;  3NPP A;  4P73 A;  5M3M G;  3NWT A;  2HIV A;  3NEN A;  1MGS A;  1TS5 A;  2KEE A;  5IT9 c;  2O5I C;  2B2U C;  3F2B A;  2JA7 H;  1WJJ A;  1B9N A;  4TQU S;  1QNK A;  4GOP A;  1B9M A;  3H0G B;  1BBU A;  4RGM A;  1CM9 A;  5IGG A;  2XNA C;  1YJN A;  1SE4 A;  1PTO C;  3DM1 A;  4GKK Q;  1LT6 D;  2OTL A;  3PIP A;  1OXV A;  4JYA L;  1Q86 C;  2NVQ H;  1K8O A;  2CWA A;  3QR8 A;  3CC7 A;  3G7L A;  2JA5 B;  2EE1 A;  5ISR A;  2K01 A;  4HCE A;  4ABN A;  5IE8 A;  1NJI C;  2Z6K A;  3F2D A;  1CK1 A;  5CV8 A;  4DR6 L;  1YI2 A;  3HFZ B;  3I4M B;  3OMG A;  1ZYR C;  1ML0 D;  3CPW A;  1E2Z A;  3K5M A;  3MXN B;  1MSH A;  2CHB D;  1H9S A;  5FKA C;  3K7A B;  1ROD A;  4DAP A;  1SMY C;  1JJG A;  3V96 A;  3TBI B;  4HMI A;  3PF5 A;  5JEA G;  3OWE B;  5ELN A;  2K52 A;  4NXN L;  4A3I H;  1YIT A;  2X69 A;  1GVP A;  1IYV A;  4JCV E;  4P2C B;  5C0X G;  4O2D A;  5C3X A;  1OTC A;  1IHZ A;  1TWG H;  3VR4 A;  2FFK B;  5DM6 3;  3K0X A;  1Z9F A;  5C44 G;  2L1B A;  1BCP D;  1HFG A;  1QNU A;  5LHY 1;  5J39 A;  3K59 A;  3GP7 A;  1VQC A;  2I5L X;  4OIK A;  2VY3 A;  4C3I H;  3STB D;  2BE5 C;  4X64 Q;  4BBS B;  3GTL H;  3KLS A;  3EVQ A;  3R2I A;  4M8A A;  3SK6 A;  2DGY A;  2NVY B;  1G91 A;  4K6D A;  4J15 A;  5C3E G;  2KCM A;  2M2L A;  3KBG A;  2WP8 J;  4A3L G;  3UDG A;  1G51 A;  1NNX A;  1VQD A;  4KY6 A;  4KHP Q;  4IUN A;  1N33 Q;  2EYJ A;  3SE0 A;  3CCS A;  5KGU A;  2NYZ D;  1XXG A;  3CCL A;  3FHW A;  3EQL C;  1O7I A;  3LWE A;  3J80 c;  4JI6 Q;  1CT1 D;  4HIM A;  2HCI A;  1SYG A;  1V1Q A;  4XDX A;  3S1R B;  1U4P A;  1N36 L;  3S2D B;  3NWS A;  4AH6 A;  1JIC A;  3S2H B;  4WJW A;  2E2H H;  5L37 A;  3K7U C;  3E5S A;  2JA9 A;  5A35 A;  1CA6 A;  3FKI B;  1HUN A;  3QG1 A;  2F1M A;  1CTM A;  3AQQ A;  5EBC A;  1NTG A;  3KYH C;  4BS9 A;  1PV4 A;  4OO1 H;  1G8Z D;  4A3K B;  4RG1 A;  1PRT D;  2UUC L;  1VMC A;  2K5H A;  1EYC A;  2EVB A;  2JK8 A;  3MFY A;  5CYU A;  3QO2 A;  1V1O A;  1BCP B;  4EQ5 A;  1QZH A;  3VA5 A;  1ENC A;  1LV9 A;  4G57 A;  4B08 A;  1HHV A;  2PQA B;  2XIW A;  1VQ8 A;  1JOQ A;  4K5V A;  4CBV A;  1WCM B;  3GTM H;  5JAV A;  4LF6 Q;  3DWP A;  1A63 A;  4A75 A;  1LYL A;  1WTO A;  2A6E D;  3M4O B;  3HZX A;  3RN5 A;  2R92 H;  2EIF A;  4LFB Q;  1FGB D;  4C3H G;  2FIN B;  1HZA A;  2BCO A;  1Q46 A;  2RDH A;  2ATW A;  4JBK A;  5IOD A;  4FO2 A;  1EEI D;  1D5M C;  3PUW A;  3U9O A;  2F3W A;  4RKL A;  3RZO B;  1TII D;  1HNW L;  3MXP A;  2EY6 A;  1EQV A;  3PF4 A;  2VB3 X;  3OHX C;  4NMZ A;  1TWF H;  1VQE A;  2JEA I;  3JAM E;  4B3S Q;  3A7L A;  5ELF A;  3QOL A;  3P20 A;  4AYB B;  2J7Z A;  1UWV A;  1X3P A;  4KLK A;  1YHA A;  5CR3 A;  1SE3 A;  2F0G A;  3F2U A;  3HS0 C;  1HZ9 A;  4NB3 A;  4MN3 A;  1YBY A;  1WTP A;  4PV1 C;  4BA1 I;  3HOW H;  3RMH A;  2R93 H;  5FLX E;  5BN5 A;  3PUX A;  1MHW C;  2D5D A;  2GVA A;  4CKC A;  1O80 A;  4V19 0;  3M3Y B;  1YVC A;  2OTJ A;  2JXM B;  4K14 A;  5IIF A;  3VR6 A;  5M9O A;  3T1H L;  1IBL L;  1SSO A;  4JI2 Q;  3I4N H;  2QCP X;  2FJ2 A;  3G6E A;  5G3L F;  3FPU B;  2VUM H;  1VQN A;  3RUZ A;  3SK8 A;  3W3A A;  4F8M A;  5I9P A;  1V1P A;  3T56 B;  2VL6 A;  2ZJR A;  3HOV B;  2D62 A;  2VXW A;  2UXD L;  5BR8 Q;  5IP7 G;  2Y0S G;  4DUZ Q;  4DV0 L;  1JC7 A;  5A2Q L;  2LSS A;  1Q90 A;  2Q8I B;  3Q22 A;  4JI0 Q;  4YHH L;  4CKE A;  2E2J B;  1ILQ A;  1Y8N B;  3I7F A;  1AEX A;  1Q8K A;  5FO7 B;  5KEE A;  1F2L A;  2CH4 A;  2PW7 A;  5M3F B;  1TU2 B;  4JI1 L;  2NVX B;  4IZ8 A;  3PUV A;  4OL7 A;  1A2T A;  4XQN A;  4X3T A;  3KBX A;  4OWX B;  1SBB B;  2B2W A;  4NDX A;  5M3M H;  3HOY B;  1ESF A;  1M90 C;  3GTG H;  2Q8R E;  1EU4 A;  1F2M A;  3A5U A;  1VCI A;  1QG7 A;  3Q24 A;  3AYH B;  5GAE C;  4GLX A;  2F0E A;  1FNW A;  4A3B B;  2MGS A;  3HP3 A;  4OXP A;  5ELO A;  2KJX A;  1YNX A;  1D1I A;  3M4Q A;  1LTG D;  1SNO A;  4L6T B;  3EIV A;  4IFD G;  1JCK B;  1MSG A;  1UE5 A;  4MTN A;  4A3J G;  3HOZ B;  4CJ2 C;  3K57 A;  4DR3 L;  1SNC A;  2L15 A;  3CAM A;  2RA4 A;  4GNX A;  1FL0 A;  1FR3 A;  5T1I A;  4YWM A;  4KD3 A;  1DOK A;  2PNR C;  4DNR B;  4ILW A;  2F0I A;  3I56 A;  1PA6 A;  4ULL A;  3PIO A;  5NUC A;  2K5V A;  2EY5 A;  1JJC B;  1GOZ A;  1PH6 A;  2DNC A;  5FOB B;  3IKJ A;  3J7A 5;  5FLM G;  3GTK B;  5IGF A;  2FHT A;  1L1O B;  1K9M C;  1Y8P B;  1PZK D;  1PFN A;  2NZH A;  4K8I A;  2X6L A;  5CMD A;  4LNQ A;  1GUN A;  1V9P A;  4FP5 D;  4EGV A;  3KLW A;  5IWA Q;  1L0X B;  5JEA H;  5DAU A;  2RCN A;  5EKI A;  2CFM A;  3MZ5 A;  2F0L A;  1CSP A;  2V1C C;  3KK7 A;  1ASZ A;  4GOP B;  2AMC B;  5C0X H;  3HOX B;  1Q8I A;  2MPM A;  3P7J A;  5T1G A;  5C44 H;  5IOC A;  5E7N A;  3I55 A;  4RAU C;  4QUC A;  3I4L A;  1U9R A;  2Z0S A;  1CQF A;  1W6J A;  4DUY Q;  1DZ1 A;  3WOE A;  4JI7 Q;  1FJG Q;  1IBM Q;  4B3R Q;  1S72 A;  1VQL A;  5C3E H;  4RMF A;  1BR9 A;  3OMC A;  4YY3 L;  1NUC A;  3DUZ A;  3I90 A;  4IO9 A;  4A3L H;  1WYD A;  4YCW A;  2KHI A;  2IX3 A;  2F0S A;  4X3U A;  4FYD A;  3CCE A;  1S5E D;  1R4P B;  2MQH A;  2KEN A;  5DLQ E;  2EJM A;  2OQ0 A;  3D3R A;  1KAW A;  5ELE A;  1P16 A;  3S1M B;  4P74 A;  1VF5 C;  5HUR A;  4RGO S;  2EYH A;  2IHE A;  3E9H A;  3L3O C;  1H9S B;  4CJ1 B;  2E76 C;  3ULP A;  5C4Z A;  2G9D A;  2Z8L A;  4MIU A;  2QA4 A;  1XJV A;  3T13 A;  3ND8 A;  4R4T A;  4R8I A;  4L5Q A;  1HQR D;  1XTD A;  2B8F A;  4X6A H;  1IXR A;  2CQO A;  2Y0S E;  2XRS D;  1EY4 A;  1VQ9 A;  3AEV A;  4A93 B;  4PNY A;  1XNR L;  4A3D B;  1JE4 A;  2NN6 G;  1EIG A;  1UAP A;  3DEO A;  2A69 C;  2K33 A;  2CVR A;  4K0K L;  3X3M A;  1KNA A;  1EYA A;  4WJ4 A;  3TME A;  1I3Q B;  2WKC A;  2XGT A;  4DXF A;  4ZK9 B;  2ZM6 L;  2MNA A;  1LTB D;  1I50 H;  3J81 c;  2NUC A;  3S14 H;  1A2U A;  2KED A;  2AQ2 B;  4GN4 B;  1HH2 P;  4LF7 L;  3TN2 A;  3PO3 B;  2A5H A;  3GTP B;  1PLF A;  3BG3 A;  3T1Y L;  3I70 A;  5KIX A;  4LF4 Q;  3NTI A;  4DNT B;  1XNQ L;  1E2V A;  1K28 A;  5D3D A;  5AJ3 L;  1KRS A;  1JE5 A;  4C3H H;  1OO9 B;  2IY5 B;  5BN4 A;  1OXS C;  1ICF B;  2V4D A;  2Q8T A;  1H95 A;  1A3T A;  4IOA A;  2KOL A;  1IBK Q;  2JA8 B;  1YNN C;  5C4X B;  3TZU A;  1O7Y A;  2EDG A;  3PUY A;  3MXU A;  1TQO A;  2UXC Q;  4OEM B;  1Z47 A;  3UE1 A;  1VQK A;  2R7Z B;  4BA2 I;  2JA6 G;  3PO2 G;  4KY5 A;  4IQZ A;  1U5K A;  5F2D A;  1DXM A;  1D7Q A;  2F0N A;  4LFC L;  3K0Y A;  1WVL A;  2F03 A;  1H9J A;  4NXM Q;  1WD1 A;  2L9H A;  2KEC A;  1TVX A;  2E5L Q;  3HOU B;  1JOO A;  1NR4 A;  2KHS A;  5KNB A;  1B3Q A;  3P75 A;  2MJ8 A;  4XT1 B;  3MEH A;  4BBR B;  3I4O A;  1VS0 A;  1DD2 A;  1CKO A;  3J80 i;  2HHH L;  4H44 C;  1U4L A;  4I65 A;  1U4R A;  4BY7 B;  2IL8 A;  4M1U B;  2EXD A;  4CHT B;  2PYK A;  2D9U A;  3QB3 A;  1CKN A;  4B3T L;  3VYT A;  2A69 D;  4A3B G;  1YJ9 A;  2F0V A;  3CQZ B;  2JYO A;  3OTO Q;  2Q2T A;  2FXQ A;  1B2T A;  3O13 A;  4B9W A;  1EQQ A;  1BCP F;  2CW0 D;  1GO3 E;  2VQF L;  4UP7 A;  5IP7 H;  1PH4 A;  5JJL A;  4A3F G;  1AN8 A;  4C2M H;  2BH8 A;  1AFP A;  4IN3 A;  4J1M A;  3DEP A;  2BDO A;  5GAH C;  2Z6B A;  1N32 Q;  5DEH A;  2K50 A;  1HQM C;  4DAY A;  2F0J A;  1W2B A;  4POG A;  2ZXR A;  4JV5 L;  4LUO A;  1NAP A;  3A5Z B;  1JWS D;  1LO5 D;  2XRQ D;  3Q0A A;  1X54 A;  4DV7 Q;  1HR0 Q;  2B8G A;  4ZAI A;  2LMC B;  1MJC A;  4JOI A;  1HNZ L;  3J7A F;  2CQA A;  4YCV A;  1YNN D;  3D8G A;  2SNS A;  3VR5 A;  3C1F A;  4TSS A;  2PI2 A;  1QVC A;  1F9R A;  5C0X J;  1QVG A;  1HJP A;  1XMO L;  3JAM c;  1QZG A;  4DFA A;  2D0O A;  3Q23 A;  1YZ6 A;  1PYW D;  1KLG D;  1Q12 A;  1UE7 A;  1CHQ D;  1STA A;  2C9O A;  5FO9 B;  1L2F A;  4DV3 Q;  1Z7T A;  2A19 A;  2QDL A;  4QIW B;  4OIJ A;  4IFD H;  3TZD A;  5K5P A;  1KQS A;  1B1Z A;  2QEX A;  1EY8 A;  1IW7 C;  4DV5 Q;  4A3J H;  3CCV A;  1PRT F;  1WI5 A;  3CU7 A;  4GKJ L;  1QWY A;  4X3S A;  2A6H C;  1V1P B;  4JPB W;  5CC4 A;  1W3S A;  2QEJ C;  1K3B C;  1LTR D;  2P5Z X;  1AW7 A;  3UI2 A;  3L0O A;  4OGQ C;  2ZJQ A;  2NVY H;  1LTS D;  2A68 D;  1AE2 A;  1XMQ Q;  3CW2 C;  4C3J G;  3CRL C;  3A8K E;  1KDA A;  3GTO B;  1C9O A;  3CHB D;  2B3G A;  5LMN Q;  1LUZ A;  1UNS A;  3SEB A;  3LX0 A;  3MFG A;  2ZXO A;  5FLM H;  4LF8 L;  4X65 Q;  4H02 A;  1X3Q A;  3CXC A;  1DJR D;  4XYO A;  5M5W B;  3PUZ A;  1BKB A;  2LXK A;  4DA2 A;  4JG2 A;  1PZJ D;  3S1R H;  1WTR A;  1XPO A;  2NVT B;  3M4Y A;  1UEB A;  1JB7 A;  4QMG A;  3UDX A;  1KD1 C;  1KDB A;  1QVF A;  4DR4 Q;  2TMP A;  4BY1 G;  2E74 C;  1BQQ T;  4KKS A;  1PHJ A;  2J4X A;  5HY6 A;  1SYF A;  3RZD H;  3GTJ H;  4A3D G;  2ALY B;  1VQF A;  1XYI A;  1EYD A;  4DV1 L;  1RL2 A;  4FF3 A;  5JJK A;  1GD7 A;  3J80 L;  5KRU A;  3U58 A;  5GAG C;  1Y1W B;  2DJG C;  1YNJ D;  4GNX B;  1LTL A;  1RIP A;  1PTO H;  1WTW A;  1E1O A;  3AFP A;  1MI2 A;  4DV6 L;  2YU9 H;  1QIL A;  3KFU A;  3MC0 B;  3K80 C;  3K5N A;  1TY2 A;  4LW1 A;  1JR0 D;  1MKH A;  2RVL A;  1FD7 D;  4DV4 L;  2JA7 B;  1SJH D;  4PZ6 A;  4X62 L;  2L55 A;  4A76 A;  1TWH B;  5JVG 3;  2WB1 B;  3NTH A;  4LK1 C;  1PTO D;  2ZT9 C;  2PMZ E;  1S5D D;  3SHL A;  4N8F A;  1WD0 A;  3RZO H;  2R7Z G;  3HG9 A;  4JI5 Q;  1B3A A;  3BU2 A;  3W1B A;  3R8B A;  1ASY A;  1LT4 D;  1Y69 U;  3NSW A;  5KND A;  2NN6 H;  4L5R C;  4A3M B;  1VQM A;  2NVQ B;  4IAL A;  5CV4 A;  3H3V I;  3HKS A;  2OWO A;  2N78 A;  2KHJ A;  3P1H A;  5J3B A;  1VMP A;  1RHP A;  3GV6 A;  4PMB A;  1ZYR D;  2CKZ B;  3CC2 A;  3OIP A;  4A3G B;  4JI8 Q;  4KN7 C;  4ZKC B;  3VR3 A;  4QL5 A;  5IYD G;  2HDM A;  1SMY D;  1BOS A;  1C4Q A;  2E2I H;  1EIF A;  4Y52 H;  3HKZ B;  1L0Y B;  2KCN A;  1BXT A;  4WFN 3;  5CV7 A;  1HCZ A;  4DKA C;  1SFO B;  4EX5 A;  1OXT A;  4LF9 L;  4CDC C;  2UUB L;  1K8M A;  3LWU A;  3PV0 A;  3G48 A;  1EFI D;  3NE5 B;  2R6G A;  3NP8 A;  4DR1 L;  1F2Y A;  2JA6 H;  2BE5 D;  1PH2 A;  3PO2 H;  3BDO A;  2B63 B;  1DON A;  1IKL A;  1TS2 A;  2YTY A;  1PFB A;  3S1N B;  4DR5 Q;  1JOK A;  2Z4H A;  2XWJ B;  5DM7 3;  3CCU A;  4DR7 Q;  2HT1 A;  2K14 A;  3S16 H;  4C3I B;  3GV3 A;  1JOR A;  3GTL B;  4DV2 Q;  3ONA B;  4R4O A;  2NVX H;  4R9W A;  1ZEQ X;  1T5X D;  3WOF A;  2WAQ B;  2XN9 C;  4U67 3;  3E3X A;  3MXG A;  4N9P A;  1L1O C;  5GAD C;  4FF4 A;  4OX9 L;  4A3E G;  2F4V Q;  5I2X A;  4IUT A;  4JI4 L;  4DPG A;  3TRZ A;  2BDN A;  2PW5 A;  2RSO A;  3I2Z A;  4AQY L;  1KLU D;  2NZO A;  3CP0 A;  3PMF A;  4FNF A;  4GOP C;  2UUA Q;  1PRT B;  1STG A;  4A3B H;  4WJ3 M;  4I7Z C;  2QW7 A;  5EQ0 A;  3G6J B;  4LF5 L;  4PZ7 A;  3UDI A;  4LMQ D;  1LTT D;  4IJH A;  2KVM A;  2B2T A;  2E2H B;  2F52 A;  4A3F H;  3T53 B;  1J5E L;  3H0G G;  3MVV A;  1K83 H;  2F0K A;  1I94 L;  4DF7 A;  2HQE A;  2K7V A;  5TSS A;  2B29 A;  1HNX L;  1SYB A;  1G6P A;  3OOC A;  1LM0 A;  5EGT A;  4A4I A;  1E0B A;  4EQO A;  2NB0 A;  3J81 i;  3GTQ B;  4E6I A;  1GUS A;  4FXG C;  1PH3 A;  1PH1 A;  1FGU A;  5DNF A;  4DK0 A;  4ID6 A;  3DXJ C;  3LNN A;  2UXB Q;  3CCJ A;  3KLR A;  1YHB A;  2JA5 G;  1G2S A;  1RF2 D;  4DR2 L;  3R3O A;  4GLA C;  3GTK H;  1QJO A;  2ICI A;  5E4X A;  3M85 A;  2VQE Q;  3J7A V;  3S17 H;  2M00 A;  1CQV A;  1N34 L;  1D6E C;  2UU9 Q;  4B3M Q;  4DNI A;  1I6H H;  3I4M G;  2N49 A;  2K32 A;  4UP9 A;  3DLL A;  3Q6S A;  4QCL A;  3U4Z A;  4IUP A;  1XPU A;  4PMC A;  3A54 A;  3A55 A;  2PNH A;  4O0A A;  1CKN B;  2Z9H A;  5HGT A;  3QOJ A;  4K5X A;  2VW9 A;  3MAQ A;  4K2L A;  1HPC A;  1N9W A;  4XQJ A;  4QGU A;  1DOL A;  5GRO A;  4IPG A;  5COY A;  3NBH A;  3H6M A;  3CF5 A;  3GDE A;  3TP8 A;  1SMX A;  5M5X B;  1TWF B;  1EY9 A;  4JI3 L;  4JYA Q;  5IYB G;  1GUT A;  4UY8 C;  2OT2 A;  3K58 A;  3FMC A;  1NBW A;  5LL6 X;  4C3J H;  4DU9 A;  1X3E A;  1NCV A;  1RKN A;  1SAP A;  3U4V A;  1DCZ A;  1UE6 A;  4DAY B;  5ELC A;  4BBS G;  2O5J C;  1G29 1;  1B8A A;  4DR6 Q;  4PQX A;  3N6R A;  3HOW B;  2F4I A;  1YEZ A;  5EJW A;  4P75 A;  3CCQ A;  1VQO A;  4X66 L;  2B2V C;  3S1M H;  3KLS X;  3K5O A;  4XT3 B;  3HRZ C;  4I7A A;  4APV A;  1B4O A;  3IAY A;  2WB1 G;  4L63 B;  1TWC B;  2RKS A;  3PGZ A;  2XVS A;  1STY A;  1S40 A;  2O2L D;  3KJP A;  3C2P A;  4P71 A;  2IW3 A;  1ESR A;  4BY1 H;  3PIP 3;  4NXN Q;  2OXP A;  1X65 A;  1EQT A;  1IZ6 A;  1M1K C;  4G7Z C;  2YTX A;  3KF8 A;  1TWA H;  2L5T A;  3ICE A;  4A3D H;  1CSQ A;  5EKL A;  4A3M G;  2L4N A;  4GKK L;  2NZ1 D;  1TT2 A;  4HMJ A;  3SK5 A;  2F0T A;  1I4H A;  3FRP B;  3FVQ A;  1I4P A;  2KCC A;  2NTT A;  3J80 E;  3V05 A;  1Q82 C;  3U9S A;  3FKI G;  1PH9 A;  1P8L A;  2PZW A;  4RA8 A;  4A3G G;  3JAM i;  1IYJ B;  4A3K G;  1HFN A;  1E22 A;  3BVZ A;  2KCT A;  1SDF A;  1Q7Y C;  3SDZ A;  2A73 B;  5M3M B;  3TRE A;  1S4Z A;  4RGN A;  3ITP A;  4AIM A;  4EQN A;  5JJI A;  3RLO A;  3D4D A;  1SE8 A;  2IT1 A;  4FF1 A;  5CV5 A;  4BXX G;  1NY4 A;  1WCM G;  2IJ0 A;  3R2T A;  1S3O A;  1JB3 A;  1EY0 A;  3G71 A;  4WOR A;  1WTX A;  1C7Y A;  3DMU A;  1TKW B;  2B2U A;  3NQI A;  3EA6 A;  5EAY A;  1WFQ A;  5G3L D;  2BA0 A;  3J81 L;  2R7Z H;  1R9T H;  1N36 Q;  1AE3 A;  3M7G A;  2B63 G;  4X3K A;  3UDF A;  4DAV A;  4GLV B;  4P72 A;  3OSO A;  5C4J B;  2XWB B;  5IGB A;  4DK1 A;  2DN8 A;  2PQE A;  3E6Z X;  4X64 L;  4HIK A;  2KA7 A;  1EU3 A;  3A74 A;  5EPJ A;  1WOC A;  3Q8D A;  1VDZ A;  3C1E A;  2UUC Q;  1M8A A;  2K75 A;  3TP5 A;  5I2Y A;  1GUO A;  1CI3 M;  2KQ3 A;  2PZU A;  4AYB G;  2ZTC A;  5IYD H;  3FPP A;  1H9K A;  4KKU A;  1GUW A;  3PSI A;  4OO1 I;  3D31 A;  1A15 A;  4KHP L;  2F0F A;  4YCU A;  1N33 L;  3LGJ A;  1PH7 A;  2CH4 W;  2PCF B;  2MHV A;  1VQB A;  1H9R A;  2J0T D;  2RDG A;  4CKB A;  4JI6 L;  4QJF A;  2E75 C;  1D5X C;  4R4C A;  2WII B;  2EJG C;  4ZQ3 A;  2HDL A;  4IPC A;  4R4I A;  1EWI A;  1YHQ A;  4LFA L;  3OW2 A;  4NW2 A;  5C44 B;  1AZP A;  2EYP A;  1EY5 A;  5M5Y H;  1J9O A;  1WTV A;  3A8I E;  2QDB A;  1WTQ A;  3MHB A;  1KL9 A;  4K2K A;  3T16 A;  3HOV G;  1B53 A;  1CZW A;  4Y7N H;  1HNW Q;  1NSN S;  2DY8 A;  2F0Q A;  1KC8 C;  4EQP A;  1T5E A;  2RCF A;  3BDC A;  5C3E B;  3IL8 A;  1SN8 A;  5LMU L;  5HGQ A;  3RLN A;  1YIJ A;  2K5W A;  3A0J A;  1C0A A;  1X9N A;  4L5S A;  2B2W C;  1EYG A;  5M3F G;  4A3E H;  3G4S A;  2F0D A;  4FXD A;  4KY7 A;  3TP6 A;  1O78 A;  5K36 G;  4JBM A;  1ET9 A;  4LF6 L;  2ZTD A;  4RGT A;  2I5M X;  5I6Y A;  4LFB L;  2WB1 E;  1B50 A;  1PDQ A;  3H94 A;  4HN7 A;  3HOY G;  3D4W A;  2QGQ A;  2WFW A;  3T1H Q;  2RHQ B;  1IBL Q;  2MO0 A;  2OCE A;  4OHJ A;  1CZG A;  2ZJP A;  2RSN A;  4H7B A;  1PYS B;  1VQP A;  1SJE D;  2JN4 A;  3F1Z A;  3H0G H;  2AUJ D;  4QUF A;  1UE1 A;  1B70 B;  1GJX A;  1TXY A;  1RJT A;  1SYC A;  2UXD Q;  1X56 A;  4LUZ A;  3D0F A;  4DV0 Q;  2NTS A;  1LT3 D;  2AUK A;  3BDL A;  2MP1 A;  3QIA A;  2C5C A;  3S1Q B;  1ICW A;  2HQL A;  3X3N A;  3ND9 A;  3HOZ G;  4YHH Q;  4IOC A;  2B2Y C;  2A74 C;  4IPD A;  4B3S L;  3E0J A;  5IT9 L;  2I07 B;  2JA5 H;  3D6W A;  5D65 A;  1G6Z A;  2EYF A;  1FNV A;  1E24 A;  4JI1 Q;  4BWG B;  1A6X A;  3S14 B;  2G5D A;  4KJN A;  3I4M H;  3FEW X;  1MD2 D;  5BN3 A;  1HUM A;  3S15 B;  4C3H B;  2NVT H;  5JEA J;  1IKM A;  3W1G A;  3WWV A;  4RHS A;  4JI2 L;  2A8V A;  1SXT A;  2IX0 A;  2L0C A;  3I3C A;  3K7A H;  2R3Z A;  2MFI A;  1E1T A;  5C5L A;  3I8Z A;  3J81 j;  2WIN B;  2BH2 A;  5BR8 L;  4DUZ L;  3HOX G;  4HED A;  5D3I B;  2F3I A;  2MO1 A;  4IPH A;  5AFW A;  4JBJ A;  4JI0 L;  5FLX c;  5H1S E;  4PG3 A;  5IYB H;  4DR3 Q;  1I4G A;  5ELB A;  1VQ5 A;  2PZT A;  4BBS H;  4C1N K;  1LLR D;  4NP5 A;  4GZY C;  1BCP C;  5C5M A;  4LUV A;  4AYB E;  3ULJ A;  3STB C;  4J8Q A;  1HR0 W;  5IGE A;  1Q1E A;  4G7H C;  1HA6 A;  3ERS X;  1TWH H;  5CGK A;  2CWP A;  2IPK D;  2R7F A;  1PFS A;  3CME A;  1QB5 D;  1LTA D;  4L8J A;  5KYI A;  1EOT A;  2YV5 A;  3NK9 A;  3L2P A;  5IP9 G;  4GN5 A;  4XQQ A;  2K03 A;  5EKK A;  3N52 A;  4UHV A;  2Y0S B;  1B44 D;  2JQO A;  1DM0 B;  3OYY A;  4C2M B;  1KAA A;  3S2D H;  2IX1 A;  4A3M H;  1Y1V B;  4J6H A;  3S2H H;  1STB A;  3RD4 A;  1X6O A;  4QY7 A;  1EIH A;  2OEO A;  3A56 A;  2GN5 A;  2EY2 A;  2JSO A;  2ID0 A;  3MEF A;  3S24 A;  4YIJ A;  3NBH B;  3PIO 3;  3BS1 A;  5C0X I;  3K6O A;  3FKI H;  4A93 G;  3SGI A;  3DWA A;  4A3G H;  1A3U A;  2Z1C A;  4G7O C;  1TY0 A;  4A3K H;  2ICE C;  3AU7 A;  2SNM A;  4HSP A;  3SK4 A;  4K8J A;  1KHI A;  3IRB A;  4YY3 Q;  4KI0 A;  3JC6 6;  1PRT C;  3OW7 A;  5LMN W;  3KDF A;  3L7Z C;  3KF6 A;  2OQK A;  4HAE A;  5E1F A;  1O7Z A;  2N3S A;  4BXX H;  1BDO A;  1VQA A;  2N88 A;  4LJZ C;  2CCZ A;  2VB2 X;  1SFO H;  3PO3 G;  1WCM H;  1U0L A;  3BZD B;  5IWA L;  4GN3 B;  3U50 C;  3M4O H;  1SYD A;  1IW7 D;  1VQH A;  2D0P A;  2K5N A;  4NPS A;  3NHH A;  1D5Z C;  2A6H D;  3CCM A;  2B63 H;  2A6E C;  4O42 A;  4RWS C;  2BA1 A;  3J81 E;  4A3J B;  3S1N H;  5CBE E;  5C6A A;  1F9S A;  1HTP A;  3EJI A;  1QCB D;  3FDT A;  2JA8 G;  3KF8 B;  4RH6 A;  5C4X G;  1RTN A;  1JQY D;  3F2C A;  1CA5 A;  1RD9 D;  3BVM A;  2IWH A;  4KV6 A;  1X55 A;  4DUY L;  2WKD A;  4HIO A;  1SLJ A;  1XNR Q;  1EZ8 A;  4JI7 L;  1GHK A;  3E0E A;  1FJG L;  1IBM L;  4LWC A;  4R8N A;  4B3R L;  4S3S A;  4RKB A;  1FNU A;  1K8A C;  1A3V A;  4K0K Q;  2NWG A;  2L11 A;  4GS3 A;  1EY6 A;  1QUQ A;  2VS1 A;  3HOU G;  4FF2 A;  2PPB C;  1Q1B A;  2ZM6 Q;  4ZCK A;  2B2V A;  2JP1 A;  4JK1 C;  4DAM A;  1I5F A;  4N8X 1;  3RLF A;  1CHP D;  4BBR G;  3NXW A;  2PI2 E;  4LF7 Q;  2EYO A;  4CDF C;  2RHS B;  3T1Y Q;  1FYC A;  2E8G A;  4BY7 G;  2E2D C;  1XNQ Q;  5AJ3 Q;  2DJF C;  4EVO A;  3MA2 B;  4LFA Q;  2K4K A;  3M3Y H;  4DXG A;  1HTL D;  1MIU A;  2DNE A;  1AP0 A;  5FO8 B;  2EPB A;  3A8J E;  3SVM A;  2LFN A;  3DHQ A;  1DYQ A;  3RZD B;  4A3I B;  1D8L A;  3A7A B;  3GTJ B;  4IUV A;  1AH9 A;  3DM3 A;  4MTK A;  1E2W A;  1M4V A;  1QE6 A;  4ZKB B;  3GTQ H;  2I5H A;  4HR7 B;  2QF7 A;  2AQ1 B;  3HOV H;  3B6Y A;  1AZQ A;  1LT5 D;  1TWG B;  5LMU Q;  3K5L A;  1TR5 A;  5E4W C;  4LFC Q;  2RBM A;  4CDD C;  2E2J H;  5JJZ A;  1PTO B;  1F9P A;  1MBY A;  1EEF D;  2EOT A;  4JOI C;  2YU9 B;  2D2C C;  1B7Y B;  4IUU A;  1G2T A;  2HD3 A;  5M3F H;  2K28 A;  2SDF A;  3T4A C;  1VQI A;  2HHH Q;  5K36 H;  1J8I A;  4JVZ A;  4LF4 L;  1JT8 A;  1VQ7 A;  1EWH A;  1EUJ A;  1O7L A;  2JEB I;  1S5C D;  3RNU A;  4HTH A;  2IHF A;  3K8A A;  1PH5 A;  3EN2 A;  4B9X A;  1X3F A;  3HOY H;  1J6Q A;  4ODG A;  3URY A;  2DUD A;  4B3T Q;  1I6V C;  1BO0 A;  2N55 A;  4IFD J;  2WAC A;  4JC0 A;  4UDU C;  3PQI A;  1IBK L;  3GQB A;  4WRD A;  4XIG S;  4A3C G;  1ONL A;  2RDF A;  2F0H A;  4KD4 A;  3S9W A;  1ZXT A;  2Q2H A;  3QWN A;  2UXC L;  4ZRZ A;  3VYR A;  5M5X H;  2VQF Q;  3NUC A;  2L12 A;  2PO4 A;  4RFB A;  3OPO A;  4C56 C;  3HOZ H;  2F0O A;  5IYC G;  2F3V A;  4NXM L;  2OF1 A;  1X3G A;  1E3P A;  2O4X A;  2ZTE A;  2E5L L;  1YJW A;  1JWU D;  2RF4 A;  2EZV A;  1VQG A;  1RDP D;  5IT9 E;  4JV5 Q;  3TQY A;  3PCO B;  1KDC A;  2FMM A;  2Z6K C;  4CDE C;  2XSC A;  1NMG A;  5EBD A;  1DGS A;  4HJ7 A;  1HNZ Q;  1ENF A;  2E2I B;  1JMC A;  1FVI A;  1E7Z A;  1C48 A;  1TWC H;  1SE2 A;  1Y8O B;  2K5Q A;  2EYL A;  3V2T A;  2H5X A;  3TS2 A;  1XMO Q;  2I46 A;  1I4X A;  3GTM B;  2EJF C;  3OTO L;  5J22 A;  3TSS A;  4F88 A;  4N9T A;  4ME5 A;  3KUP A;  2R92 B;  3DWQ A;  2Z4I A;  3HGB A;  1V8Q A;  4ME3 A;  1Y1V G;  2JA6 B;  3R93 A;  3KJO A;  3PO2 B;  3TS0 A;  2K1B A;  1HZC A;  3HOX H;  1K0S A;  4KKT A;  4K5W A;  4POF A;  2N8N A;  4GKJ Q;  3S16 B;  4DK3 C;  1EY7 A;  1SRO A;  2HCC A;  4PMW A;  3EFX D;  3SXH A;  2FMC A;  3RN2 A;  1N32 L;  4IFD I;  3J7Z C;  5FJ8 G;  5JOB A;  1OXU A;  2LXJ A;  1STN A;  1Z6H A;  2NBF A;  1Y1W G;  5GQO A;  3NEM A;  4DV7 L;  5J1Z A;  1HR0 L;  4V0B A;  1STH A;  1X32 A;  4H13 C;  3I72 A;  1ET6 A;  2HUG A;  2F0M A;  3MXN A;  2RQX A;  4IUR A;  2F0W A;  3OIQ A;  3T51 B;  4UP8 A;  4LF8 Q;  2B39 A;  5I9O A;  2EY1 A;  4MHE A;  1U4M A;  1EL0 A;  1EOV A;  3ERQ A;  1PFM A;  3IFD A;  2R93 B;  1LAC A;  4F87 A;  5ELD A;  5IP9 H;  4UAI A;  2PMZ B;  1EZ6 A;  2JA7 G;  1Y14 B;  5KYL A;  3H15 A;  4DV3 L;  3ZJY C;  2F0P A;  4HJ8 A;  1C8C A;  1F77 A;  4HSV A;  5CBA E;  4A3F B;  2G9H D;  1K83 B;  2DY7 A;  3M9B A;  3I4N B;  1BNZ A;  4DV5 L;  4XTC S;  3NTK A;  5C4J H;  4L5T A;  3E9I A;  2VUM B;  3RR5 A;  5C3W A;  1CUK A;  1SNP A;  3CC4 A;  4K6L A;  3QJY A;  2ZXP A;  2AWO A;  1A8V A;  4DV1 Q;  1KRT A;  1ENA A;  2B2Y A;  2KUM A;  4A93 H;  1F9Q A;  4HJ5 A;  5I4D A;  1XMQ L;  3C46 A;  1HRJ A;  3L9A X;  5KNC A;  5JPN C;  5LMN L;  1EIY B;  1IL8 A;  4HCS A;  1HZB A;  1SEB D;  1I3Q H;  4OON A;  1ILP A;  1KIX A;  1NMF A;  4C1N I;  4DV6 Q;  3S17 B;  1K3R A;  2AWN A;  1JJ2 A;  4HID A;  4X65 L;  1I6H B;  1GXD C;  2EXZ A;  3D6C A;  3HEJ A;  2QKI C;  1TS3 A;  3PO3 H;  2EYM A;  1GUG A;  1KAB A;  3GTP H;  1Q3L A;  2SOB A;  1BF4 A;  4DV4 Q;  1VF7 A;  2M9V A;  5CV6 A;  4CGY B;  1RTO A;  2AKW B;  3HKZ G;  4X62 Q;  1UEA B;  2ENB A;  1BVS A;  1IL2 A;  3M4P A;  1V43 A;  4ZYS A;  2MUY A;  3H3V C;  3M7N A;  1GKH A;  3GTG B;  4DR4 L;  4A3I G;  1CKM A;  2Q2U A;  1I4Q A;  2X6G A;  3CD6 A;  4H0L C;  4QIW E;  2JA8 H;  5C4X H;  1A62 A;  1PH8 A;  3AB9 A;  2Q2I A;  1STE A;  1XX8 A;  4ZUI A;  5IY0 A;  2EQS A;  5C4H A;  3CPF A;  3AMU A;  4C3J B;  5E3F A;  3VYU A;  2GVB A;  4C3I G;  4G4K A;  2ES2 A;  4KHZ A;  5EPL A;  2BOS A;  3HOU H;  1Q81 C;  1NR2 A;  3SR1 A;  2NN6 I;  3MTS A;  4ZUJ A;  2WAQ G;  1GM5 A;  2PQA A;  4MZ9 A;  1KXL A;  4BBR H;  4Q0F A;  4DN4 M;  1S5F D;  4BY7 H;  4KHV A;  3KDF B;  4KTA A;  3KF6 B;  2HIX A;  4XYQ A;  5LL6 S;  3NEL A;  2YTV A;  1PVO A;  1RCV D;  3J7Y W;  4Z9C B;  3NBI A;  2B2T C;  3BVG A;  4BY1 B;  2YYZ A;  3CQZ H;  4OWT B;  4LF9 Q;  2VZA A;  1T9H A;  2TSS A;  1KNE A;  2UUB Q;  1SNQ A;  4ZLT F;  1TWA B;  3H3V H;  4JI5 L;  2K04 A;  4KK7 A;  3VDY A;  3MWY W;  4Q5V A;  3S1Q H;  2R61 A;  4LAA A;  5JVH 3;  4DR1 Q;  2LY7 A;  4IUQ A;  2XTI A;  5CV9 A;  1ZKO A;  3K81 C;  4PZ8 A;  2SEB D;  4FVM A;  2CW0 C;  1PYB A;  4F7X A; 
#chains in the Genus database with same CATH homology
 2K6A A;  1GHJ A;  4OO1 G;  3IFT A;  2QIL A;  1KTK A;  4TRD A;  2AQ3 B;  1HXY D;  3NQT A;  4DGZ A;  4O1N A;  4NKL A;  4FXK C;  5IGC A;  3GO5 A;  1S5B D;  5COR A;  4QF4 A;  5EPK A;  2H4O A;  2H1E A;  2K5D A;  2F0U A;  3H91 A;  1R9T B;  5D14 A;  4TKO B;  1PMR A;  1W6K A;  4CJ0 B;  3D4R A;  1TS4 A;  3VR2 A;  1II3 A;  1D2B A;  2JE6 I;  3BYT B;  3C3L A;  3ERO A;  5I6W A;  4RHR A;  1IYU A;  3JAM L;  1SND A;  1SNM A;  3I73 A;  1BUV T;  3CRK C;  3TDQ A;  1JWM D;  1OXX K;  4JBW A;  4XXE A;  1PXU A;  2A68 C;  4U68 A;  1LTI D;  5FLX L;  5IGD A;  1XTC D;  1LAB A;  1I50 B;  2GA4 B;  1XWE A;  3GD7 A;  3H09 A;  4QB4 A;  1HA5 A;  3I91 A;  2LKV A;  1R4Q B;  4KJO A;  1PTO F;  1PZI D;  1UUP A;  4RCN A;  4RCO A;  5A2Q E;  5M5Y B;  2VNU D;  4KN4 C;  3CKI B;  1D1K A;  1H9M A;  3BYY B;  4KMU C;  4Y7N B;  1SYE A;  1F2Z A;  2LS0 1;  5FK9 C;  1CFM A;  3VYS A;  3TP7 A;  1QOH A;  1EWC A;  1BBX C;  3VA7 A;  2K05 A;  5JPM C;  4A3E B;  1YNJ C;  1DOM A;  2WV6 D;  3WDN A;  3W2D A;  3OWF A;  1I4R A;  3ZYY X;  3NPP A;  3NWT A;  1MGS A;  1TS5 A;  2KEE A;  2O5I C;  2B2U C;  1B9N A;  4TQU S;  1QNK A;  1B9M A;  3H0G B;  4RGM A;  1CM9 A;  5IGG A;  2XNA C;  1SE4 A;  1PTO C;  3DM1 A;  1LT6 D;  1OXV A;  1K8O A;  3G7L A;  2JA5 B;  2EE1 A;  5ISR A;  2K01 A;  4HCE A;  4ABN A;  1CK1 A;  5CV8 A;  3I4M B;  3OMG A;  1ZYR C;  1ML0 D;  1E2Z A;  3K5M A;  1MSH A;  2CHB D;  1H9S A;  5FKA C;  3K7A B;  1ROD A;  4DAP A;  1SMY C;  3V96 A;  3TBI B;  4HMI A;  5JEA G;  3OWE B;  2X69 A;  1IYV A;  4P2C B;  5C0X G;  5C3X A;  1IHZ A;  3VR4 A;  2FFK B;  5DM6 3;  2L1B A;  1BCP D;  1HFG A;  1QNU A;  5LHY 1;  5J39 A;  3K59 A;  3GP7 A;  4OIK A;  4BBS B;  2BE5 C;  3KLS A;  3EVQ A;  3R2I A;  4M8A A;  3SK6 A;  2NVY B;  1G91 A;  4K6D A;  2M2L A;  3KBG A;  2WP8 J;  4KY6 A;  4IUN A;  2EYJ A;  3SE0 A;  5KGU A;  2NYZ D;  1XXG A;  3EQL C;  3LWE A;  1CT1 D;  2HCI A;  1SYG A;  4XDX A;  3S1R B;  1U4P A;  3S2D B;  3NWS A;  1JIC A;  3S2H B;  4WJW A;  3E5S A;  5A35 A;  1CA6 A;  3FKI B;  1HUN A;  3QG1 A;  2F1M A;  1CTM A;  5EBC A;  4OO1 H;  4BS9 A;  1G8Z D;  4A3K B;  1PRT D;  1VMC A;  1EYC A;  2EVB A;  3MFY A;  5CYU A;  3QO2 A;  1V1O A;  1BCP B;  3VA5 A;  1ENC A;  1LV9 A;  4G57 A;  4B08 A;  1HHV A;  2XIW A;  1JOQ A;  4K5V A;  4CBV A;  1WCM B;  5JAV A;  3DWP A;  1WTO A;  2A6E D;  3M4O B;  3HZX A;  1FGB D;  4C3H G;  2FIN B;  2BCO A;  2RDH A;  5IOD A;  4FO2 A;  1EEI D;  1D5M C;  3PUW A;  3U9O A;  2F3W A;  4RKL A;  3RZO B;  1TII D;  3MXP A;  2EY6 A;  1EQV A;  2VB3 X;  3OHX C;  4NMZ A;  2JEA I;  3JAM E;  3A7L A;  5ELF A;  3QOL A;  3P20 A;  4AYB B;  2J7Z A;  1X3P A;  5CR3 A;  1SE3 A;  2F0G A;  3F2U A;  3HS0 C;  4MN3 A;  1WTP A;  4PV1 C;  4BA1 I;  3RMH A;  5FLX E;  5BN5 A;  3PUX A;  2D5D A;  4CKC A;  1O80 A;  4V19 0;  3M3Y B;  2JXM B;  4K14 A;  5IIF A;  3VR6 A;  5M9O A;  1SSO A;  2QCP X;  2FJ2 A;  5G3L F;  3FPU B;  3RUZ A;  3SK8 A;  3W3A A;  4F8M A;  5I9P A;  1V1P A;  3T56 B;  3HOV B;  2D62 A;  2VXW A;  1JC7 A;  5A2Q L;  1Q90 A;  2Q8I B;  3Q22 A;  4CKE A;  2E2J B;  1ILQ A;  1Y8N B;  1AEX A;  5FO7 B;  5KEE A;  1F2L A;  2PW7 A;  5M3F B;  1TU2 B;  2NVX B;  4IZ8 A;  3PUV A;  4OL7 A;  1A2T A;  4XQN A;  4X3T A;  3KBX A;  1SBB B;  2B2W A;  4NDX A;  3HOY B;  1ESF A;  2Q8R E;  1EU4 A;  1F2M A;  1VCI A;  1QG7 A;  3Q24 A;  2F0E A;  1FNW A;  4A3B B;  2MGS A;  3HP3 A;  2KJX A;  1D1I A;  1LTG D;  1SNO A;  4L6T B;  4IFD G;  1JCK B;  1MSG A;  3HOZ B;  4CJ2 C;  3K57 A;  1SNC A;  2RA4 A;  1FR3 A;  5T1I A;  4KD3 A;  1DOK A;  2PNR C;  4DNR B;  4ILW A;  2F0I A;  4ULL A;  5NUC A;  2EY5 A;  1GOZ A;  2DNC A;  5FOB B;  3IKJ A;  3GTK B;  5IGF A;  2FHT A;  1Y8P B;  1PZK D;  1PFN A;  4K8I A;  2X6L A;  5CMD A;  1GUN A;  4FP5 D;  4EGV A;  1L0X B;  5JEA H;  5DAU A;  5EKI A;  3MZ5 A;  2F0L A;  3KK7 A;  5C0X H;  3HOX B;  1Q8I A;  2MPM A;  3P7J A;  5T1G A;  5IOC A;  4RAU C;  4QUC A;  3I4L A;  1U9R A;  1CQF A;  1W6J A;  1DZ1 A;  3WOE A;  1BR9 A;  3OMC A;  1NUC A;  3DUZ A;  3I90 A;  2IX3 A;  2F0S A;  4X3U A;  4FYD A;  1S5E D;  1R4P B;  2EJM A;  3D3R A;  5ELE A;  3S1M B;  1VF5 C;  5HUR A;  4RGO S;  2EYH A;  3L3O C;  1H9S B;  4CJ1 B;  2E76 C;  5C4Z A;  2G9D A;  2Z8L A;  4MIU A;  3T13 A;  3ND8 A;  4R8I A;  1HQR D;  2B8F A;  2XRS D;  1EY4 A;  4A93 B;  4PNY A;  4A3D B;  1JE4 A;  2NN6 G;  1EIG A;  1UAP A;  3DEO A;  2A69 C;  2K33 A;  2CVR A;  3X3M A;  1KNA A;  1EYA A;  3TME A;  1I3Q B;  2WKC A;  4DXF A;  4ZK9 B;  1LTB D;  2NUC A;  1A2U A;  2KED A;  2AQ2 B;  3TN2 A;  3PO3 B;  2A5H A;  3GTP B;  1PLF A;  3BG3 A;  3I70 A;  5KIX A;  3NTI A;  4DNT B;  1E2V A;  5D3D A;  1OO9 B;  5BN4 A;  1OXS C;  2V4D A;  2Q8T A;  1A3T A;  2KOL A;  2JA8 B;  1YNN C;  5C4X B;  3TZU A;  1O7Y A;  2EDG A;  3PUY A;  3MXU A;  1TQO A;  1Z47 A;  2R7Z B;  4BA2 I;  4KY5 A;  4IQZ A;  5F2D A;  1DXM A;  2F0N A;  3K0Y A;  1WVL A;  2F03 A;  1H9J A;  1WD1 A;  2L9H A;  2KEC A;  1TVX A;  3HOU B;  1JOO A;  1NR4 A;  2KHS A;  5KNB A;  3P75 A;  2MJ8 A;  4XT1 B;  3MEH A;  4BBR B;  1DD2 A;  4H44 C;  1U4L A;  4I65 A;  1U4R A;  4BY7 B;  2IL8 A;  4M1U B;  4CHT B;  2PYK A;  2D9U A;  3QB3 A;  3VYT A;  2A69 D;  2F0V A;  3CQZ B;  2JYO A;  1B2T A;  3O13 A;  4B9W A;  1BCP F;  2CW0 D;  1AN8 A;  1AFP A;  4IN3 A;  4J1M A;  3DEP A;  2BDO A;  5DEH A;  1HQM C;  4DAY A;  2F0J A;  2ZXR A;  1NAP A;  1JWS D;  1LO5 D;  2XRQ D;  3Q0A A;  2B8G A;  4ZAI A;  2LMC B;  3J7A F;  2CQA A;  1YNN D;  3D8G A;  2SNS A;  3VR5 A;  3C1F A;  4TSS A;  1F9R A;  5C0X J;  4DFA A;  3Q23 A;  1PYW D;  1KLG D;  1Q12 A;  1CHQ D;  1STA A;  2C9O A;  5FO9 B;  1Z7T A;  4QIW B;  4OIJ A;  4IFD H;  3TZD A;  5K5P A;  1B1Z A;  1EY8 A;  1IW7 C;  1PRT F;  3CU7 A;  1QWY A;  4X3S A;  2A6H C;  1V1P B;  5CC4 A;  2QEJ C;  1LTR D;  1AW7 A;  3UI2 A;  4OGQ C;  1LTS D;  2A68 D;  4C3J G;  3CRL C;  3A8K E;  1KDA A;  3GTO B;  3CHB D;  1UNS A;  3SEB A;  3LX0 A;  3MFG A;  2ZXO A;  1X3Q A;  1DJR D;  4XYO A;  5M5W B;  3PUZ A;  4DA2 A;  1PZJ D;  1WTR A;  2NVT B;  3M4Y A;  4QMG A;  1KDB A;  2TMP A;  2E74 C;  1BQQ T;  4KKS A;  2J4X A;  1SYF A;  1XYI A;  1EYD A;  4FF3 A;  3J80 L;  5KRU A;  1Y1W B;  1YNJ D;  1PTO H;  1WTW A;  1MI2 A;  1QIL A;  3MC0 B;  3K5N A;  1TY2 A;  1JR0 D;  2RVL A;  1FD7 D;  2JA7 B;  1SJH D;  2L55 A;  1TWH B;  5JVG 3;  2WB1 B;  3NTH A;  4LK1 C;  1PTO D;  2ZT9 C;  1S5D D;  3SHL A;  1WD0 A;  3HG9 A;  1B3A A;  3R8B A;  1LT4 D;  1Y69 U;  3NSW A;  5KND A;  2NN6 H;  4A3M B;  2NVQ B;  4IAL A;  5CV4 A;  3P1H A;  1VMP A;  1RHP A;  3GV6 A;  4PMB A;  1ZYR D;  3OIP A;  4A3G B;  4KN7 C;  4ZKC B;  3VR3 A;  2HDM A;  1SMY D;  1BOS A;  1C4Q A;  3HKZ B;  1L0Y B;  2KCN A;  1BXT A;  4WFN 3;  5CV7 A;  1HCZ A;  1SFO B;  1OXT A;  1K8M A;  3LWU A;  3PV0 A;  1EFI D;  3NE5 B;  2R6G A;  3NP8 A;  1F2Y A;  2BE5 D;  1DON A;  3BDO A;  2B63 B;  1IKL A;  1TS2 A;  1PFB A;  3S1N B;  1JOK A;  2Z4H A;  2XWJ B;  5DM7 3;  4C3I B;  3GV3 A;  1JOR A;  3GTL B;  3ONA B;  4R9W A;  1ZEQ X;  1T5X D;  3WOF A;  2WAQ B;  2XN9 C;  4U67 3;  3MXG A;  4N9P A;  4FF4 A;  5I2X A;  4IUT A;  2BDN A;  2PW5 A;  2RSO A;  1KLU D;  3PMF A;  4FNF A;  1PRT B;  1STG A;  4I7Z C;  5EQ0 A;  3G6J B;  4LMQ D;  1LTT D;  2KVM A;  2B2T A;  2E2H B;  3T53 B;  3MVV A;  2F0K A;  4DF7 A;  2HQE A;  2K7V A;  5TSS A;  1SYB A;  3OOC A;  5EGT A;  1E0B A;  4EQO A;  2NB0 A;  3GTQ B;  4E6I A;  1GUS A;  4FXG C;  5DNF A;  4DK0 A;  4ID6 A;  3DXJ C;  3LNN A;  3KLR A;  1G2S A;  1RF2 D;  3R3O A;  1QJO A;  2ICI A;  5E4X A;  3M85 A;  3J7A V;  2M00 A;  1CQV A;  1D6E C;  2K32 A;  3Q6S A;  4QCL A;  4IUP A;  4PMC A;  3A54 A;  3A55 A;  5HGT A;  3QOJ A;  4K5X A;  3MAQ A;  4K2L A;  1HPC A;  4XQJ A;  1DOL A;  5COY A;  3NBH A;  3H6M A;  3TP8 A;  5M5X B;  1TWF B;  1EY9 A;  1GUT A;  2OT2 A;  3K58 A;  3FMC A;  5LL6 X;  4DU9 A;  1NCV A;  1RKN A;  1SAP A;  1DCZ A;  5ELC A;  2O5J C;  1G29 1;  4PQX A;  3N6R A;  3HOW B;  2F4I A;  5EJW A;  2B2V C;  3KLS X;  3K5O A;  4XT3 B;  3HRZ C;  1B4O A;  3IAY A;  4L63 B;  1TWC B;  2RKS A;  2XVS A;  1STY A;  2O2L D;  3C2P A;  2IW3 A;  1ESR A;  3PIP 3;  2OXP A;  1EQT A;  4G7Z C;  3KF8 A;  2L5T A;  5EKL A;  2L4N A;  2NZ1 D;  1TT2 A;  4HMJ A;  3SK5 A;  2F0T A;  1I4H A;  3FRP B;  3FVQ A;  1I4P A;  2KCC A;  2NTT A;  3J80 E;  3V05 A;  3U9S A;  2PZW A;  4RA8 A;  1HFN A;  3BVZ A;  1SDF A;  3SDZ A;  2A73 B;  5M3M B;  1S4Z A;  4RGN A;  3ITP A;  4EQN A;  3D4D A;  2IT1 A;  4FF1 A;  5CV5 A;  2IJ0 A;  3R2T A;  1JB3 A;  1EY0 A;  4WOR A;  1WTX A;  3DMU A;  1TKW B;  2B2U A;  3NQI A;  3EA6 A;  5G3L D;  2BA0 A;  3J81 L;  3M7G A;  4X3K A;  4DAV A;  3OSO A;  5C4J B;  2XWB B;  5IGB A;  4DK1 A;  2DN8 A;  2PQE A;  3E6Z X;  2KA7 A;  1EU3 A;  5EPJ A;  1VDZ A;  3C1E A;  1M8A A;  3TP5 A;  5I2Y A;  1GUO A;  1CI3 M;  2KQ3 A;  2PZU A;  3FPP A;  1H9K A;  4KKU A;  1GUW A;  4OO1 I;  3D31 A;  1A15 A;  2F0F A;  2PCF B;  2MHV A;  1H9R A;  2J0T D;  4CKB A;  2RDG A;  2E75 C;  1D5X C;  2WII B;  2EJG C;  4ZQ3 A;  2HDL A;  4NW2 A;  5C44 B;  1AZP A;  2EYP A;  1EY5 A;  1J9O A;  1WTV A;  3A8I E;  2QDB A;  1WTQ A;  3MHB A;  4K2K A;  3T16 A;  1B53 A;  1CZW A;  1NSN S;  2DY8 A;  2F0Q A;  4EQP A;  1T5E A;  3BDC A;  5C3E B;  3IL8 A;  2K5W A;  2B2W C;  2F0D A;  4FXD A;  4KY7 A;  3TP6 A;  1O78 A;  5K36 G;  1ET9 A;  4RGT A;  5I6Y A;  1B50 A;  1PDQ A;  3H94 A;  4HN7 A;  3D4W A;  4OHJ A;  1CZG A;  2RSN A;  4H7B A;  4QUF A;  1SJE D;  2AUJ D;  1GJX A;  1RJT A;  1SYC A;  2NTS A;  1LT3 D;  2AUK A;  3BDL A;  2MP1 A;  3QIA A;  2C5C A;  3S1Q B;  1ICW A;  3X3N A;  3ND9 A;  2B2Y C;  2A74 C;  3E0J A;  5IT9 L;  2I07 B;  3D6W A;  5D65 A;  1G6Z A;  2EYF A;  1FNV A;  4BWG B;  1A6X A;  3S14 B;  4KJN A;  3FEW X;  1MD2 D;  5BN3 A;  1HUM A;  3S15 B;  4C3H B;  5JEA J;  1IKM A;  4RHS A;  1SXT A;  2IX0 A;  2L0C A;  3I3C A;  2R3Z A;  5C5L A;  3I8Z A;  2WIN B;  4HED A;  5D3I B;  5AFW A;  1I4G A;  5ELB A;  2PZT A;  4C1N K;  1LLR D;  4NP5 A;  4GZY C;  1BCP C;  5C5M A;  4J8Q A;  5IGE A;  1Q1E A;  4G7H C;  1HA6 A;  5CGK A;  2IPK D;  1QB5 D;  1LTA D;  4L8J A;  5KYI A;  1EOT A;  3NK9 A;  4XQQ A;  2K03 A;  5EKK A;  3N52 A;  2Y0S B;  1B44 D;  1DM0 B;  4C2M B;  1KAA A;  2IX1 A;  1Y1V B;  4J6H A;  1STB A;  3RD4 A;  1EIH A;  2OEO A;  3A56 A;  2EY2 A;  2JSO A;  2ID0 A;  3PIO 3;  4YIJ A;  3BS1 A;  5C0X I;  3K6O A;  3DWA A;  1A3U A;  2Z1C A;  4G7O C;  1TY0 A;  2ICE C;  3AU7 A;  2SNM A;  4HSP A;  3SK4 A;  4K8J A;  4KI0 A;  3OW7 A;  1PRT C;  3L7Z C;  4HAE A;  5E1F A;  1O7Z A;  1BDO A;  2N88 A;  4LJZ C;  2VB2 X;  3BZD B;  1SYD A;  1IW7 D;  3NHH A;  1D5Z C;  2A6H D;  2A6E C;  4O42 A;  4RWS C;  2BA1 A;  3J81 E;  4A3J B;  5CBE E;  5C6A A;  1F9S A;  1HTP A;  3EJI A;  1QCB D;  3FDT A;  4RH6 A;  1RTN A;  1JQY D;  1CA5 A;  1RD9 D;  3BVM A;  2IWH A;  4KV6 A;  2WKD A;  1EZ8 A;  1GHK A;  4R8N A;  4S3S A;  4RKB A;  1FNU A;  1A3V A;  2NWG A;  2L11 A;  1EY6 A;  4FF2 A;  2PPB C;  1Q1B A;  2B2V A;  2JP1 A;  4JK1 C;  3RLF A;  1CHP D;  3NXW A;  2EYO A;  1FYC A;  2E2D C;  4EVO A;  3MA2 B;  4DXG A;  1HTL D;  2DNE A;  1AP0 A;  5FO8 B;  2EPB A;  3A8J E;  3SVM A;  2LFN A;  3DHQ A;  1DYQ A;  3RZD B;  4A3I B;  3A7A B;  3GTJ B;  4IUV A;  1E2W A;  1M4V A;  1QE6 A;  4ZKB B;  4HR7 B;  2QF7 A;  2AQ1 B;  1AZQ A;  1LT5 D;  1TWG B;  3K5L A;  1TR5 A;  5E4W C;  2RBM A;  5JJZ A;  1PTO B;  1F9P A;  1MBY A;  1EEF D;  2EOT A;  2YU9 B;  2D2C C;  4IUU A;  1G2T A;  2K28 A;  2SDF A;  3T4A C;  5K36 H;  1J8I A;  1EWH A;  1O7L A;  2JEB I;  1S5C D;  4HTH A;  4B9X A;  4ODG A;  3URY A;  1I6V C;  1BO0 A;  2N55 A;  4IFD J;  2WAC A;  4UDU C;  4WRD A;  3GQB A;  4XIG S;  1ONL A;  2RDF A;  2F0H A;  4KD4 A;  3S9W A;  1ZXT A;  3QWN A;  4ZRZ A;  3VYR A;  3NUC A;  2L12 A;  2PO4 A;  4RFB A;  3OPO A;  4C56 C;  2F0O A;  2F3V A;  2OF1 A;  2O4X A;  1JWU D;  2EZV A;  1RDP D;  5IT9 E;  1KDC A;  2FMM A;  2XSC A;  5EBD A;  1ENF A;  2E2I B;  1C48 A;  1SE2 A;  1Y8O B;  2K5Q A;  2EYL A;  3V2T A;  2I46 A;  1I4X A;  3GTM B;  2EJF C;  5J22 A;  3TSS A;  4F88 A;  4N9T A;  4ME5 A;  3KUP A;  2R92 B;  3DWQ A;  2Z4I A;  3HGB A;  1V8Q A;  2JA6 B;  3R93 A;  3PO2 B;  2K1B A;  4KKT A;  4K5W A;  3S16 B;  1EY7 A;  2HCC A;  4PMW A;  3EFX D;  3SXH A;  2FMC A;  4IFD I;  5JOB A;  1OXU A;  1STN A;  1Z6H A;  2NBF A;  5J1Z A;  4V0B A;  1STH A;  1X32 A;  4H13 C;  3I72 A;  1ET6 A;  2HUG A;  2F0M A;  3MXN A;  2RQX A;  4IUR A;  2F0W A;  3OIQ A;  3T51 B;  2B39 A;  5I9O A;  2EY1 A;  4MHE A;  1U4M A;  1EL0 A;  3ERQ A;  1PFM A;  3IFD A;  2R93 B;  1LAC A;  4F87 A;  5ELD A;  4UAI A;  2PMZ B;  1EZ6 A;  5KYL A;  2F0P A;  1C8C A;  1F77 A;  4HSV A;  5CBA E;  4A3F B;  2G9H D;  1K83 B;  2DY7 A;  3I4N B;  1BNZ A;  4XTC S;  3NTK A;  2VUM B;  5C3W A;  1SNP A;  4K6L A;  3QJY A;  2ZXP A;  2AWO A;  1ENA A;  2B2Y A;  2KUM A;  1F9Q A;  5I4D A;  3C46 A;  1HRJ A;  3L9A X;  5KNC A;  5JPN C;  1IL8 A;  4HCS A;  1SEB D;  1ILP A;  4C1N I;  3S17 B;  2AWN A;  1I6H B;  1GXD C;  2EXZ A;  3D6C A;  3HEJ A;  2QKI C;  1TS3 A;  2EYM A;  1GUG A;  1KAB A;  1Q3L A;  2SOB A;  1BF4 A;  1VF7 A;  2M9V A;  5CV6 A;  4CGY B;  1RTO A;  1UEA B;  2ENB A;  1V43 A;  4ZYS A;  2MUY A;  3H3V C;  3M7N A;  3GTG B;  1I4Q A;  2X6G A;  4H0L C;  3AB9 A;  1STE A;  1XX8 A;  4ZUI A;  5C4H A;  3AMU A;  4C3J B;  5E3F A;  3VYU A;  4C3I G;  4G4K A;  4KHZ A;  5EPL A;  2BOS A;  1NR2 A;  3SR1 A;  2NN6 I;  3MTS A;  4ZUJ A;  4Q0F A;  4DN4 M;  1S5F D;  4KHV A;  4KTA A;  4XYQ A;  5LL6 S;  1RCV D;  3J7Y W;  4Z9C B;  3NBI A;  2B2T C;  3BVG A;  4BY1 B;  2YYZ A;  2TSS A;  1KNE A;  1SNQ A;  4ZLT F;  1TWA B;  2K04 A;  4KK7 A;  3MWY W;  4Q5V A;  2R61 A;  4LAA A;  5JVH 3;  2LY7 A;  4IUQ A;  5CV9 A;  1ZKO A;  2SEB D;  4FVM A;  2CW0 C;  4F7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...