1PFSA

Solution nmr structure of the single-stranded dna binding protein of the filamentous pseudomonas phage pf3, minimized average structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the single-stranded DNA binding protein of the filamentous Pseudomonas phage Pf3: similarity to other proteins binding to single-stranded nucleic acids.
pubmed rcsb
source organism Pseudomonas phage pf3
molecule tags Dna binding protein
molecule keywords PF3 SINGLE-STRANDED DNA BINDING PROTEIN
total genus 9
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pfsA00
3ZJYC 3M4OH 3AEVA 1L1OB 1H95A 3UDGA 4L5SA 2KHJA 4DAMA 4Y52H 2ALYB 4JI7Q 2L15A 4K0KQ 4DR1L 4A3KH 4DR4Q 4NB3A 3HOXH 2ASBA 1I94Q 1N32Q 1VQPA 1BBWA 4YWMA 2R7DA 4MNOA 2ID0A 1Q86C 5H1SE 1VQLA 4YWLA 3S1QH 3KF6B 1PH9A 3CCJA 5IYBH 2XGTA 4UP8A 2R7FA 4DR3L 1N36Q 2E5LQ 1MKHA 1AE3A 4DV7L 4A3EG 2UUAL 2VUMG 4B3RQ 1HNWL 4NXNL 3PUZA 2QEXA 5JEAG 4X65Q 4A3JG 2VNUD 1NMGA 2JJQA 3NEMA 4A3KG 4DK6C 2KHIA 5C44H 5GROA 1S40A 1NJIC 3T1HL 3K8AA 1IBLL 1M1KC 5C0XJ 1YNXA 1JB7A 3GTLH 1K9MC 3CCEA 4LF4Q 1VQJA 4GNXA 4A3FH 4LWCA 1PH2A 2R93H 1JJGA 3HFZB 3PCOB 1KRTA 3CMAA 4DV3Q 1GO3E 3T1YL 5IYDH 5M3FG 1Q81C 3FP9A 4YY3Q 4DV0Q 4C3JH 3ULPA 2PI2A 1BVSA 3BU2A 1Q1EA 2UUCL 1YHQA 1O7IA 2YTVA 1FJGL 3J81j 2NZHA 1N9WA 3UE1A 2NN6I 1G51A 4TQUS 4JI5L 3KDFA 3S17H 5M5YH 2PI2E 4LF9L 1VQHA 2F52A 3RLFA 4JI2L 4JI8Q 3JAMi 1EWIA 2E2HH 5IT9c 4X62L 2F4VQ 4QL5A 4LFCL 4A3FG 2UU9Q 1E7ZA 1XMQL 4OWXB 3I4MH 3NELA 1AE2A 1UE1A 4JC0A 3HKZG 1PH6A 4B3ML 3UDIA 1PV4A 4JI0Q 3W5OA 4K0KL 3H0GH 4DUZL 4P73A 4YCVA 2YV5A 4EQ5A 3ULLA 1I94L 2HT1A 2CKZB 3VDYA 1I6HH 4R4IA 3KYHC 3AFQA 3I4NH 5C3EH 1KAWA 4PZ6A 2UUAQ 3HOVH 5C0XG 4DV7Q 2JEBI 4GLXA 2Q2UA 1HNWQ 3RLOA 2JA7H 2V1CC 1D8LA 1WI5A 1VQAA 1C9OA 1X3FA 3FKIH 3RZOH 4X65L 3U4ZA 1HZBA 3J80i 2RCNA 1IBLQ 3T1HQ 1K0RA 1S72A 4NXML 3CC7A 2ZJQA 4LF4L 2QGQA 4QJFA 5EAYA 4BBSH 3WWVA 5FJ8G 3I56A 4HJAA 2GVAA 4JG2A 1CKOA 4DV3L 3HOWG 5GAGC 5GAEC 3I7FA 4OWWB 1BKBA 4UP9A 1OXSC 4YY3L 4GNXC 4LF7L 4GKKQ 1BBUA 3CF5A 2UUCQ 1M90C 1YHAA 4R4OA 1VQNA 1TWHH 3FHWA 3BZCA 4XTCS 4DNIA 4A3CH 2UUBQ 1QVCA 4JI3Q 4DR6Q 3EN2A 4IOCA 4JI5Q 1EQQA 4JBKA 3S2DH 4WJ4A 2LXJA 3GD7A 3CMEA 2E2IH 3CCSA 2EQSA 4X62Q 4LFCQ 4LUOA 1IL2A 4A3LH 4RMFA 2Y0SE 1CSQA 4GN5A 3GTJH 3DM3A 5LMNW 1XMQQ 4IJLA 1SRUA 1EQRA 2WAQE 4B3MQ 4KHZA 1VQEA 3STBC 2KCTA 3F2BA 2Z0SA 4DUZQ 2JA5G 4JI0L 1N33L 2YYZA 3J7A5 1NE3A 4KHPQ 3HOYG 3KFUA 4GOPA 2VL6A 3HOXG 2HHHQ 3CCMA 3RN5A 1UE5A 2RF4A 3G4SA 3ERSX 2CWAA 1L1OC 2D62A 1VQMA 1LTLA 1X65A 4JBMA 1WCMH 3J7ZC 1X54A 2B63H 4JOIC 1L1OA 3OYYA 4A93G 3RZDH 4DKAC 4LF5Q 5C44G 4NXMQ 5JJLA 1SMXA 1RIPA 2C35B 2LSSA 3F2DA 1XJVA 1Y1WG 2AWOA 5DLQE 3E9HA 3KF6A 4LF7Q 3TS2A 4GKKL 5FLXc 3D31A 5ELOA 2K5VA 3S16H 1CKNA 3A5UA 1UE7A 2Y0SG 2UUBL 2NVQH 1GD7A 4BBSG 5K36G 4JI3L 1PH5A 4DR6L 1Z47A 1XNQL 5E7NA 1UEBA 1VCIA 1X3EA 2PNHA 4OX9Q 5IYCG 3L7ZC 4R4QA 3RR5A 4HJ8A 3U4VA 4GOPC 5IWAL 4AQYQ 1EUJA 1XPUA 5GAHC 1HZ9A 1XNRL 2I5MX 3AQQA 4KHPL 1I50H 1PYSB 4UY8C 1N33Q 4P75A 1D7QA 4UPAA 4LUVA 4B3TL 1Q8KA 1OXXK 1YJNA 2JEAI 5LMUL 2PMZE 1YIJA 1YEZA 2HHHL 2JQOA 4OWTB 2KBNA 3RLNA 3J81i 3KDFB 2ZTEA 1KD1C 2UXDQ 3KOJA 4GLVB 2A19A 1GM5A 2NVTH 4A3IH 4RG1A 1T9HA 2VS1A 1V1QA 3K80C 4HJ9A 4A75A 1MJEA 4LNQA 4HJ5A 1B70B 3PUWA 4P71A 3HOYH 4DR7L 4R4TA 2K52A 4IPCA 2N78A 4J15A 4X64L 3RN2A 4L5RC 4DK3C 2WB1E 1KIXA 5C4XH 2VQEQ 2HQLA 2ZTCA 2I0QA 3F8TA 5GQOA 4LF5L 1Y14B 5IP7G 1E22A 4A3GH 2BA1A 3BZKA 1CUKA 3F1ZA 3PF4A 4X66Q 2MO1A 3E9IA 1P8LA 4A3MG 4JBJA 2NN6G 4PMWA 2D0OA 3GO5A 2RHQB 1VQ4A 1V43A 3GTMH 5GADC 4QY7A 3CC4A 3I4NG 1XNQQ 4DV5L 1KL9A 1IXRA 4OX9L 1WFQA 2R92H 1GVPA 1VQFA 3I55A 1Q7YC 3PV0A 4GS3A 4BY1G 3PO3G 3J80c 4AYBG 3JAMc 4HIDA 1Q1BA 3FKIG 5IWAQ 1PH3A 5M3MH 4L5TA 4AQYL 2OQ0A 1N34L 2R7ZH 5IYBG 5IE8A 5M3FH 1Q82C 3CAMA 1UE6A 4JI4Q 1KHIA 1XNRQ 4DV4Q 3PO2G 1YZ6A 1EIYB 2Z6KA 3U50C 2IT1A 4R4CA 1YJ9A 4B3TQ 4P74A 1KC8C 2WAQG 5LMUQ 1QVGA 2JA6H 4WJ3M 2PQAB 3S15H 1JMCA 2R92G 2CFMA 3CC2A 5FLMH 4JOIA 4IFDJ 1E3PA 2Q2HA 2UXDL 4HIOA 1CKNB 4IFDG 1J6QA 3GTQH 4DR7Q 3M4PA 2KCMA 5IP9G 1MJCA 3G48A 2CWPA 1JE5A 4X64Q 1W2BA 3W1GA 4POGA 3TREA 3PO2H 2VQEL 1E24A 3H3VI 3GTOH 4BBRG 1Y1VG 4GN4B 2YU9H 2B29A 4GOPB 2IX1A 4BY7G 4DR5L 2JA8H 3CCVA 1IBML 2HIXA 3EBEA 4X66L 1TWFH 4HJ7A 2IX0A 4PG3A 3TRZA 3HOVG 4A3BG 1HJPA 1VQOA 4OXPA 1JJ2A 3W1BA 2JA7G 4P72A 1SLJA 4DV1Q 2R93G 3K81C 4YCWA 2BH2A 4DV5Q 2GVBA 2MFIA 3M4QA 1VQGA 3PGZA 4LUZA 5LMNQ 3HOUG 1Y1VH 3OTOL 3GTGH 3CP0A 2ES2A 1FGUA 2WFWA 3CCQA 4GKJQ 1N34Q 2XTIA 5C4JH 1X55A 3LGJA 4JI4L 1S3OA 3H3VH 4DV4L 1X56A 3M85A 4A3DG 1HZCA 3TEHB 4AYBE 2VQFL 4C2MH 1QZGA 1B8AA 4OO1I 2K50A 4OONA 4POFA 2I5LX 1J5EQ 1XTDA 3HOUH 1IBKQ 2KENA 2B63G 4DUYL 3U58A 1PH7A 2AMCB 2ZM6Q 1EYGA 2E2JH 1KXLA 3PF5A 3M7NA 2OWOA 2UXBQ 2VUMH 3G71A 3Q8DA 3NENA 2K4KA 2Q2TA 4YHHQ 1VQ5A 3KJPA 4IJHA 3ER0A 2VW9A 1C0AA 1SR3A 2OTJA 1Q12A 1W3SA 1OTCA 2A1AA 3OW2A 1OXUA 1VQ9A 4H02A 1JJCB 4XIGS 2EIFA 1FVIA 1NY4A 3J81c 3ULJA 4DR5Q 3TS0A 5HGQA 1IBMQ 2AWNA 3IRBA 3UE0A 3K7UC 3KJOA 3I4OA 4DV2L 5IYDG 3RNUA 1SE8A 3JC66 1XMOQ 2RHSB 4BBRH 3DLLA 3CPWA 1PH1A 2K5NA 2YTXA 2JA8G 4DV1L 2PQAA 2DUDA 3CCLA 1WYDA 3A74A 1QVFA 5LMNL 4A3BH 4C3HH 4UP7A 1HNXL 1C7YA 1VQ6A 2NVYH 3OTOQ 3CXCA 3PO3H 1RL2A 3H15A 1IYJB 4O0AA 3A5ZB 1AH9A 2VZAA 2WB1G 1K73C 4GKJL 2MO0A 3I4MG 2ZJPA 4O2DA 3CCRA 2HIVA 1ASYA 3NBHB 3KLWA 1VQ8A 2VQFQ 4A76A 4GNXB 2JA6G 1J5EL 3A0JA 1IBKL 5JJIA 4IPGA 4PZ7A 4DPGA 5IYCH 5FLMG 4DUYQ 2OTLA 4IFDI 2ZM6L 1QUQB 2IHFA 4DR2Q 4FDBA 2UXBL 2AHOB 4A3CG 1E1OA 1I5FA 4JBWA 4MZ9A 4JYAQ 4YHHL 2B3GA 2IY5B 1PFSA 4IPHA 1OXVA 1I3QH 1MIUA 4LFAQ 1PHJA 1KQSA 2UU9L 4HIKA 1PH8A 4KLKA 2ATWA 4BXXH 4JV5Q 4A3LG 3F2CA 1X9NA 4R1JA 3STBD 2E8GA 5HY6A 3HKSA 4TVAB 3CW2C 3PUVA 4DV2Q 2JA5H 1XMOL 5M5XH 2QA4A 4A3JH 2UXCQ 1X3GA 4IPDA 2K5HA 4YCUA 3PIOA 1HNZQ 1B7YB 2Q2IA 3I2ZA 1KRSA 2NVXH 2IHEA 1HR0W 1XPRA 1NTGA 1HNXQ 1OXTA 1DGSA 2OCEA 3GDEA 2JK8A 4YWKA 1EIFA 4IO9A 5IP7H 4APVA 4EX5A 4NPSA 1XPOA 3PSIA 4A3GG 2Z6KC 4GLAC 4JI1Q 1U0LA 3S14H 1TWGH 2N8NA 1YJWA 4A4IA 1YI2A 1N8RC 1VQ7A 1EOVA 3HOWH 2YTYA 3M3YH 4QGUA 1PH4A 1K8GA 3K7AH 4A3EH 4A3DH 1GKHA 4MTNA 3S24A 1Q46A 3L0OA 1X6OA 1VQBA 1SN8A 1LUZA 2GN5A 4ME3A 5JEAJ 5IP9H 1Y1WH 1FL0A 4LFBQ 1A63A 1YHBA 1VS0A 2DGYA 3UDFA 1R9TH 4LF8L 5C0XI 1HZAA 1V9PA 4DR2L 4JI6L 3S2HH 2FXQA 3D0FA 1G6PA 2OQKA 5AJ3L 4JYAL 1PA6A 4B3SQ 1L0WA 3M9BA 4LF6Q 4AIMA 4X6AH 2R7ZG 4DAYB 5M5WH 4A3MH 2VY3A 4QIWE 4Y7NH 5BR8Q 1P16A 1HR0Q 1VQIA 4LFAL 2F3IA 5C3EG 4IOAA 3UDXA 4JV5L 3CD6A 1Z9FA 2A8VA 1K8AC 3CQZH 1QZHA 3S1NH 3HOZH 2N49A 3MXNB 1NBWA 1SFOH 5IY0A 5C4XG 2UXCL 1HNZL 1YBYA 4BXXG 3HKZE 1WCMG 4DV6L 3GTPH 1HH2P 4QQBX 1CKMA 3KF8B 5FJ8H 2H5XA 1QUQA 4A3IG 4JI7L 4BA2I 5ELNA 1WOCA 3AYHB 4DR1Q 2EXDA 1YITA 5JJKA 1WJJA 4ALPA 4BY7H 1LM0A 3HOZG 4JI1L 4DR4L 1N32L 3TQYA 2CQOA 2MNAA 3S1MH 2K14A 2LXKA 1PVOA 2D0PA 1A0IA 1N36L 2E5LL 3E0EA 4BA1I 1L2FA 4DR3Q 3GTKH 1IZ6A 4BY1H 4B3RL 3AFPA 4L5QA 4AH6A 3S1RH 1VQDA 4NXNQ 2BH8A 4KI0A 3ICEA 2JE6I 1G291 4GN3B 4JCVE 1E1TA 5M3MG 4LFBL 2JA9A 4C3IH 4LF8Q 1K3RA 1EFWA 1CSPA 4JI6Q 1YVCA 1A62A 3EIVA 2N3SA 5AJ3Q 4B3SL 2BA0A 1UWVA 2R6GA 3B6YA 4PZ8A 3L2PA 3G6EA 4LF6L 1JT8A 1TXYA 1U5KA 3T1YQ 3CPFA 3PUXA 5BR8L 1HR0L 5J3BA 4DV0L 1PYBA 3K0XA 1TWCH 2WP8J 2ZTDA 2ZJRA 1FJGQ 2MQHA 1A8VA 1ASZA 2NZOA 4LW1A 3BJUA 3MEFA 2CCZA 4OO1G 1NMFA 3PUYA 1VQCA 4LF9Q 3CCUA 3PIPA 2AKWB 1SROA 4JI2Q 4HIMA 3H0GG 4JI8L 1K83H 4A93H 3SGIA 2K75A 1VQKA 2F4VL 4DV6Q 1TWAH 2I5HA 1LYLA
chains in the Genus database with same CATH superfamily
2K05A 3AEVA 5EPJA 3UDGA 4L5SA 1NAPA 2KHJA 4Y52H 1SE3A 1PDQA 1EOTA 3HOXH 2ASBA 1RJTA 1JB3A 2R7DA 4MNOA 1VQLA 5H1SE 5K36H 3S1QH 2E5LQ 2UUAL 3K5MA 4A3GB 4NXNL 1H9SA 3HOZB 4G57A 5JEAG 5KYIA 4A3JG 1NMGA 3VR3A 2KHIA 5C44H 1S40A 1OO9B 3I72A 3K8AA 5KGUA 3T1HL 4LF4Q 5COYA 2F0QA 1ET6A 3GV6A 1KRTA 2PNRC 1Q81C 2PI2A 1A6XA 3C1FA 2DJGC 3UE1A 2K32A 2B8GA 1VQHA 1PTOF 2F52A 3A8JE 2E2HH 1EWIA 1EU4A 4X62L 4QL5A 2JXMB 4A3FG 5T1IA 1E7ZA 3S15B 3DM1A 4K6LA 1XMQL 3EFXD 2L11A 4DAYA 1TQOA 4C3IB 4JC0A 1BCPB 4HSVA 3W5OA 4DUZL 5JVG3 4EQ5A 2I07B 2HT1A 1U9RA 3KYHC 3OW7A 1HFGA 1SNPA 1DZ1A 1NR4A 5IIFA 3HOVH 4DV7Q 4JPBW 2Q2UA 1HNWQ 1EZ8A 2V1CC 1D8LA 3NWSA 3KBXA 5CYUA 1EEID 1TVXA 4X65L 1DD2A 1PZID 3BDOA 1K83B 3MTSA 1S72A 2WB1B 4MN3A 2EYHA 5FJ8G 4OIKA 1C48A 4UP9A 3GTGB 3CF5A 1IYUA 5CV7A 1TWHH 3FHWA 4XTCS 4A3CH 1I4RA 2UUBQ 1EIHA 1QVCA 4DR6Q 4IOCA 1SSOA 2KVMA 1EQQA 2PW5A 4JBKA 4WJ4A 2PZTA 2CH4W 5LL6S 3CMEA 3CCSA 2QKIC 4QCLA 1FR3A 1Q3LA 2N55A 2Y0SE 3GTJH 3DM3A 1XMQQ 4MIUA 3U9SA 2EZVA 5HGTA 5IGFA 4RAUC 2YYZA 3LWUA 1B4OA 3NTIA 1X3QA 4R8NA 3ERSX 3G4SA 1L1OC 1SYDA 1LTLA 2F0VA 4B9WA 3QG1A 1F77A 2B63H 4OL7A 4CKCA 3RZDH 1LO5D 2F0UA 1LT3D 5JAVA 4QB4A 2C35B 2LSSA 5CV6A 2G9HD 2EXZA 3EQLC 1EEFD 3FEWX 5FLXc 3D31A 5ELOA 3PO3B 2QEJC 2Y0SG 1JWMD 4XQQA 2NVQH 5K36G 4DR6L 1PH5A 1F2MA 1X3EA 2PNHA 4OX9Q 1QILA 3RR5A 2B2UA 2PPBC 4GOPC 5IWAL 1RF2D 3FKIB 1EY6A 3BZDB 5GAHC 5CV9A 5EBCA 2SNSA 1N33Q 1F9SA 3IFDA 2Y0SB 4B3TL 1SYGA 4YIJA 2PMZE 1YIJA 1STYA 2A19A 1B70B 1GUSA 4OIJA 5KNDA 2XSCA 4X64L 4L5RC 5LL6X 4IUVA 1STEA 2OEOA 1LTBD 2I0QA 4DNRB 5IP7G 4A3GH 1XX8A 3BZKA 4KJOA 1CUKA 2MO1A 1P8LA 4EQPA 3NBHA 4JBJA 5C44B 4K6DA 3GO5A 3GTMH 5GADC 3CC4A 3I4NG 2I46A 1KL9A 4DV5L 1IXRA 4OX9L 1S5FD 2KEEA 1WFQA 1I4HA 3J80c 2L9HA 2JSOA 2K33A 4L5TA 5IYBG 1SE2A 1R9TB 1Q82C 1XNRQ 1UE6A 1PYWD 2AQ2B 3G6JB 3HP3A 2RKSA 1QVGA 2JA6H 2F0NA 5C4HA 4Y7NB 1JMCA 3CC2A 5FLMH 4JOIA 5FO8B 3WDNA 2EY6A 1D5XC 4IFDG 3GQBA 1J6QA 2KCCA 4DR7Q 4AYBB 5JJZA 4L8JA 5IT9E 3G48A 1QB5D 1W2BA 3BVGA 4OHJA 2A74C 3H3VI 1PFNA 4BBRG 2RDFA 4GN4B 5G3LF 5EBDA 2LKVA 1STHA 1TWFH 2F1MA 4RGTA 3Q22A 1VQOA 2MGSA 2IX3A 2BE5D 4YCWA 1UAPA 3HOUG 1Y1VH 3OTOL 3GTGH 3CP0A 2WFWA 2ZT9C 3OOCA 3CCQA 3ZYYX 4GKJQ 3D8GA 5JPNC 1WTRA 2FJ2A 5CBEE 1SDFA 4JI4L 1S3OA 1X56A 2EYFA 4RGMA 5D14A 4A3DG 4AYBE 1CTMA 2L5TA 2VQFL 1SNCA 3HZXA 3MXNA 4CJ1B 3GTJB 2LFNA 2MP1A 3DHQA 4PMCA 2KENA 4U673 2B63G 4FNFA 1KXLA 3FPUB 2VUMH 2CW0D 2Q2TA 1GUOA 3ER0A 2OTJA 1Q12A 2R92B 1FNWA 2L0CA 1HUNA 1VQ9A 4X3SA 3K7AB 3EJIA 4U68A 3VYUA 2RBMA 3N52A 3ULJA 1STBA 1PRTF 2R7ZB 1TU2B 3K7UC 2WKDA 2B63B 3KJOA 3I4OA 5IYDG 3P1HA 4BBRH 3IFTA 3DEOA 4XXEA 3A74A 5JEAH 4A3MB 1HNXL 4CGYB 1PLFA 1Y8PB 3OTOQ 3CXCA 1E2ZA 3PO3H 4O0AA 1IKLA 4M1UB 4GKJL 3PQIA 3I4MG 2ZJPA 2BOSA 3VR5A 3CCRA 1ASYA 3NBHB 2A6HD 4EVOA 2VQFQ 4R8IA 2L12A 2EOTA 3A0JA 4PZ7A 5IYCH 2IL8A 3TZUA 1RCVD 2IHFA 2UXBL 1DONA 1E1OA 1I5FA 3OIPA 4IPHA 1MIUA 1X32A 4ID6A 2E2HB 1KQSA 3A55A 4V0BA 1PH8A 4KLKA 3GTKB 4JV5Q 1O7ZA 4WFN3 3E3XA 2VXWA 1S5ED 2FMCA 2E8GA 3CRLC 5HY6A 4TVAB 3CW2C 1LLRD 2JA5H 1XMOL 1Z7TA 2QA4A 1X3GA 1HNZQ 1LT6D 1B7YB 2KOLA 2Q2IA 1JORA 1KRSA 2F0LA 2IHEA 4DAVA 1HNXQ 3OHXC 1DGSA 2FINB 3GDEA 2TSSA 4YWKA 1EIFA 5BN4A 4APVA 3V96A 3C2PA 4K2LA 1N8RC 3DEPA 1BDOA 1EOVA 3KLSX 3M3YH 3SHLA 1K8GA 4HEDA 5F2DA 3K58A 3L0OA 2A69D 1SN8A 1Y1WH 1KNEA 4LFBQ 1FL0A 4LF8L 1R9TH 3RUZA 1EYAA 3D4DA 2H4OA 2QILA 3S2HH 4KJNA 2OQKA 3VR2A 3M9BA 4ULLA 4LF6Q 4AIMA 4E6IA 5M5WH 4Y7NH 4LFAL 5C3EG 1J8IA 2LY7A 1Z9FA 1BCPC 4IUTA 5EPLA 4DGZA 1Z6HA 4F7XA 3HKZE 1WCMG 4DV6L 1EY8A 1CKMA 3QIAA 1MI2A 1QUQA 5J39A 5NUCA 2G5DA 1V1PA 3MFGA 5JJKA 4FYDA 4KHVA 4JI1L 1YNJD 4IALA 3RZDB 1N36L 3E0EA 3AFPA 4L5QA 4JCVE 1U4PA 1EY7A 4N9PA 3L9AX 3D3RA 1CSPA 2RDGA 4C3JG 5AJ3Q 2Z8LA 2R6GA 4PZ8A 2D5DA 3G6EA 5DEHA 5CBAE 1JT8A 3T1YQ 3PUXA 2RCFA 1TWCH 2ZJRA 1ET9A 2MQHA 1ASZA 2NZOA 3BJUA 4NKLA 4LF9Q 2A6HC 1SROA 4A93H 3H0GG 4ZUJA 3I73A 3R8BA 3M4OH 1L1OB 2ALYB 3K0YA 3TZDA 4K0KQ 4DR1L 1N32Q 1I94Q 1BBWA 4YWMA 1Q86C 2ID0A 2QW7A 1N36Q 2R7FA 1MKHA 4EQOA 4DV7L 2E2IB 2M9VA 1HNWL 4RKBA 3X3NA 4FF1A 3PUZA 3IL8A 3T4AC 1CHQD 2JJQA 3GTLH 2K5WA 1RTOA 2KCNA 1YNXA 5E3FA 1M1KC 4G7OC 2WV6D 1K9MC 5D3IB 3T1YL 1GO3E 1TY0A 5ELEA 4C3JH 2UUCL 1CZGA 1O7IA 2YTVA 3J81j 2NZHA 1N9WA 1G51A 4TQUS 5M5YH 2C5CA 4LF9L 3SVMA 3I4LA 3OWFA 4J8QA 4XDXA 3RD4A 3MWYW 3HEJA 1W6KA 4JI2L 3CKIB 1QNUA 1IW7C 2F0IA 4BY1B 2QDBA 2F4VQ 4IUQA 2UU9Q 1ILPA 1X3PA 1UE1A 4K0KL 3H0GH 2YV5A 1EY0A 2CKZB 2O2LD 5C3EH 2E76C 1VMCA 1LT5D 1JE4A 1AEXA 3BVMA 5C0XG 2JEBI 4GLXA 1GUTA 4OEMB 3RLOA 1EQVA 1Q90A 3S14B 1VQAA 2A6EC 3BDCA 1CHPD 1BF4A 3U4ZA 1HZBA 2EDGA 1ZYRD 2RCNA 2F03A 3M3YB 5CV4A 2F0OA 4NXML 3CC7A 3MC0B 1FNUA 3OWEB 4HJAA 3BVZA 2GVAA 4JG2A 4DV3L 1Y1WB 5GAGC 5GAEC 4OWWB 1BKBA 2CVRA 1OXSC 3HGBA 4YY3L 1M90C 3HOYB 2WINB 2B2UC 4DNIA 2CQAA 3EN2A 5KRUA 3Q23A 3NQTA 1ILQA 1R4PB 3S2DH 3NXWA 1LV9A 4X62Q 4LFCQ 4RMFA 3J80L 4GN5A 1HTPA 4B3MQ 1PTOD 4JI0L 1VQEA 3STBC 2JA5G 1N33L 3VYSA 1TS3A 2VL6A 3HOXG 4A3FB 3CCMA 1UE5A 2RF4A 1DM0B 1VQMA 1AP0A 5D3DA 4GZYC 3GV3A 2XIWA 2EYPA 1IW7D 1V8QA 3LWEA 4XT1B 5M3MB 1S5DD 4DKAC 3W3AA 4LF5Q 3SK5A 4ZQ3A 5JJLA 5CR3A 4FP5D 1XJVA 3DWPA 1Y1WG 2AWOA 1UEAB 4C3HB 5DLQE 3QJYA 3FPPA 4WORA 4P2CB 4K2KA 4IUPA 5IOCA 4KKSA 4CKEA 3P20A 3PIP3 1UE7A 1H9SB 1Z47A 1DOMA 2G9DA 3HOVB 1EWCA 3L7ZC 4HJ8A 1STGA 2HUGA 3A8IE 3U4VA 2L4NA 3GTOB 1B9NA 1TS2A 5I6YA 4HSPA 1EUJA 3Q0AA 1BCPD 1XNRL 4ME5A 4H7BA 2EJMA 4OWTB 1EY4A 3SK8A 3M4OB 1A2UA 3LNNA 4RG1A 1V1QA 2OF1A 1JWSD 5C6AA 5DM73 4M8AA 4P71A 3KK7A 2N78A 2RVLA 4G7ZC 3RN2A 4NMZA 4DK3C 2DNCA 2SOBA 4A3JB 1IYVA 3F8TA 4LF5L 2F3VA 1E22A 2BA1A 2K1BA 3QB3A 4Z9CB 4LK1C 1SBBB 3MHBA 3P75A 5I4DA 1MSHA 4QY7A 1XNQQ 2R93B 4FXDA 5C3WA 1GVPA 1D1KA 3PV0A 4C3JB 4AYBG 4CDCC 3FKIG 3SK6A 1PH3A 2OQ0A 4RHSA 1JICA 4K5VA 3A8KE 3S2HB 1F2ZA 1F2YA 5IGCA 1YJ9A 1KC8C 5LMUQ 1NSNS 1KABA 4Q0FA 1QWYA 1E3PA 4HIOA 3VYRA 3H0GB 3GTQH 3M4PA 2KCMA 1MJCA 2CWPA 3TP5A 3W1GA 3H3VC 4ZYSA 2MJ8A 1E24A 5C3EB 4RHRA 1K8MA 4K8IA 1Y1VG 2B29A 4BY7G 1O7LA 2HIXA 1MGSA 3EBEA 1IBML 4X66L 1CT1D 4PG3A 3HOVG 1I50B 2OT2A 3K81C 2BH2A 4DU9A 2AQ3B 5E4WC 2MFIA 3M4QA 1VQGA 1RTNA 3TMEA 1D6EC 1E2WA 2ES2A 1FGUA 3VA7A 1N34Q 2B8FA 4PV1C 3LGJA 4DV4L 3S2DB 3M85A 1HZCA 5IODA 3TEHB 2IPKD 4OO1I 1GJXA 2K50A 3OMGA 4OGQC 4OONA 1J5EQ 1IBKQ 1WTPA 1PH7A 2AMCB 2E2JH 1HUMA 3M7NA 2UXBQ 2EY5A 4FXGC 3NENA 2CH4A 1C0AA 1A15A 1OTCA 2A1AA 4K8JA 1RKNA 4XIGS 5EKKA 5A2QE 4DR5Q 3TS0A 5HGQA 4ZKBB 3UE0A 4ODGA 2IWHA 4DV2L 5T1GA 3JC66 4ZUIA 2RHSB 2NN6H 2VB3X 1NUCA 2K5NA 5LHY1 4DV1L 2PQAA 3BS1A 4C3HH 1E0BA 3I70A 1QJOA 2NB0A 3C1EA 4TRDA 1WTXA 1G2TA 1BQQT 1JQYD 1B50A 2VZAA 1K73C 1ZKOA 2D2CC 5J1ZA 2MO0A 3EROA 1GHKA 2HIVA 5KYLA 1TY2A 1VQ8A 4A76A 1B3QA 2JA8B 1J5EL 2XRSD 3CU7A 4DPGA 1SAPA 3K6OA 4IFDI 1H9RA 4FDBA 5I2XA 3Q6SA 4A3CG 3W2DA 4MZ9A 4FF2A 3VR6A 2Z6BA 3NTKA 2NTSA 3BYYB 3X3MA 2IY5B 1ML0D 5HURA 1I3QH 3VYTA 1PHJA 4HIKA 4KTAA 1K8OA 1WTQA 4XT3B 4FO2A 5CGKA 5BN3A 1FNVA 5M5XH 4A3JH 3PIOA 2K5HA 2F0GA 2K01A 3ND8A 3I2ZA 4ZKCB 3GP7A 1MSGA 2NVXH 1HR0W 1SJED 3D6CA 1KTKA 3HG9A 4ABNA 2OCEA 5IP7H 1XPOA 3E6ZX 3NQIA 4GLAC 3A54A 1U0LA 3S14H 2M00A 5FLXE 4JW0A 1SEBD 1STNA 3EA6A 1YI2A 1WD0A 3TP6A 3HOWH 3AB9A 4A3EH 1ONLA 4A3DH 1CM9A 4MTNA 5ELDA 1EZ6A 2QF7A 4BBSB 4HN7A 1TWAB 4ME3A 5JEAJ 1A63A 3UDFA 1LTRD 1QE6A 4JI6L 4I7ZC 3JAML 1G6PA 4JK1C 1PA6A 1H9JA 4OO1H 3H94A 1NNXA 2R7ZG 4A3MH 2F0FA 2VY3A 4QIWE 1HR0Q 1VQIA 5A35A 4JV5L 1VF5C 1T5XD 1HFNA 1MBYA 3CQZH 1D2BA 3HOZH 3NHHA 3MXNB 1SFOH 1G6ZA 2BDNA 1YBYA 1B9MA 2WAQB 2C9OA 4ZCKA 1A3VA 2JN4A 1I4PA 2H5XA 4A3IG 2EYLA 1AW7A 5KEEA 3AYHB 4DR1Q 4ALPA 4DR4L 1LM0A 4HAEA 4F87A 2GA4B 2K14A 2DY7A 2E5LL 3GTKH 2KJXA 1IZ6A 2O4XA 4Q5VA 4B3RL 1BUVT 1O7YA 2BH8A 1SNMA 4KI0A 2JE6I 3FDTA 2HQEA 4KKUA 2CW0C 4PMBA 2F0WA 1UNSA 3V05A 2BA0A 3B6YA 3L2PA 1TXYA 3MXGA 3CHBD 5J3BA 3A7AB 2ZTDA 2WP8J 3KF8A 1TWGB 2CCZA 2Z1CA 3PUYA 2B2WC 4DK1A 1MHWC 4HIMA 4JI8L 4K5XA 3SGIA 2F4VL 1LYLA 2SNMA 2A5HA 1H95A 4DAMA 4JI7Q 3HKZB 4C56C 4A3KH 1D5MC 4DR4Q 4NB3A 2KA7A 1EWHA 2Q8IB 3V2TA 1PH9A 3CCJA 5IYBH 3D6WA 4UP8A 4DR3L 1AE3A 4B3RQ 3DWAA 1W6JA 4QUFA 3D4WA 3NBIA 1EYCA 2QEXA 4X65Q 2VNUD 3NEMA 1D1IA 1XPUA 2X6GA 5GROA 1IBLL 3BYTB 1JB7A 4QUCA 3CCEA 2R93H 1PH2A 3F2UA 3PCOB 3CMAA 4DV3Q 5FKAC 5M3FG 3FP9A 4YY3Q 1V1PB 3NSWA 4RCNA 1BVSA 1Q1EA 1A2TA 3S17H 3FMCA 3KDFA 1CQFA 1K3BC 2PI2E 5DAUA 3DWQA 3RLFA 4JI8Q 5D65A 4LFCL 1J9OA 1GOZA 2LMCB 3SR1A 4MTKA 1AE2A 3HKZG 3R3OA 4JI0Q 2ENBA 3ITPA 3S16B 1HA6A 1HPCA 4YCVA 3ULLA 1I94L 3VDYA 1I6HH 4XYQA 2NVQB 3AFQA 3I4NH 4PZ6A 2UUAQ 1TWCB 1TS5A 4RH6A 2NYZD 4FF4A 3S9WA 5DM63 2EJFC 1SNDA 2PZWA 4A93B 1K0RA 4H13C 2A6ED 2ZJQA 4LF4L 5IT9L 4BBSH 1YNND 2F0KA 2DNEA 3T53B 4LF7L 4GKKQ 4GNXC 4G7HC 1BBUA 1YHAA 1ZEQX 4R4OA 5E4XA 1LT4D 3OSOA 1S5CD 1BBXC 4JI3Q 5FLXL 4JI5Q 3SK4A 1GXDC 1VMPA 2LXJA 3NPPA 4FVMA 2E2IH 4C2MB 3T51B 2J7ZA 4LUOA 1IL2A 1CSQA 5LMNW 5ELBA 1SRUA 1EQRA 3ND9A 2WAQE 3F2BA 1JR0D 4DUZQ 2F0SA 1EL0A 3HOYG 3NK9A 2WACA 4GOPA 3RN5A 3J7AF 2CWAA 1X65A 2HD3A 4DXGA 3FVQA 3MVVA 1WCMH 4J1MA 4O1NA 1X54A 2KUMA 4JOIC 1L1OA 2K28A 5M3FB 3TDQA 3BDLA 4K14A 1RIPA 3EVQA 3F2DA 2XNAC 2QDLA 5BN5A 3E9HA 3TS2A 4GKKL 4RWSC 2K5VA 1CKNA 1SXTA 3A5UA 4HMJA 3M7GA 1HXYD 1GD7A 4BBSG 4JI3L 1XNQL 5IGBA 2B2WA 1VCIA 4EQNA 3PO2B 3L3OC 3UI2A 2BE5C 2RSNA 3URYA 4DXFA 4AQYQ 2F0HA 1JOKA 1EQTA 1HZ9A 3AQQA 4FXKC 1D7QA 4P75A 4LUVA 1Q8KA 1YJNA 2JEAI 1TKWB 2JQOA 3K59A 3J81i 2XWJB 2ZTEA 3KDFB 1KD1C 3KOJA 4GLVB 2NVTH 1GM5A 2UXDQ 4A3IH 1HHVA 1T9HA 2VS1A 1Y1VB 3K80C 1MJEA 1ESRA 1MD2D 2MHVA 3PUWA 4HJ5A 3HOYH 1TIID 4R4TA 1JWUD 4IPCA 4J15A 3J7AV 3QR8A 2WB1E 4WJWA 3VR4A 1KIXA 3MXPA 1Y14B 5J22A 3MAQA 1WTWA 4DA2A 3Q24A 3F1ZA 3PF4A 4X66Q 3I91A 2QCPX 4KV6A 3NUCA 4DAPA 2EVBA 2NN6G 4PMWA 2D0OA 2RHQB 1VQ4A 3G7LA 1AZPA 4ILWA 3NE5B 1G8ZD 1SYCA 2R61A 2R92H 1VQFA 3I55A 4A3DB 1Q7YC 3H09A 4C1NI 1KNAA 1Q1BA 5IWAQ 4HIDA 2AQ1B 4AQYL 3O13A 3K57A 1N34L 2R7ZH 5IE8A 1SNQA 4JI4Q 1KHIA 2F0PA 3PO2G 1YZ6A 1EIYB 1T5EA 2Z6KA 1JC7A 3U50C 4R4CA 3I90A 4DNTB 2J0TD 2CFMA 3I4MB 1R4QB 4A3BB 3R2IA 2R3ZA 2Z4IA 2O5JC 3CQZB 1O78A 3R2TA 4X64Q 1JE5A 5E1FA 1SFOB 1QNKA 3ERQA 5I6WA 2XWBB 1II3A 2DY8A 4TSSA 2YU9H 4GOPB 2IX1A 5AFWA 1B2TA 1JOOA 3TRZA 2IX0A 3RZOB 1BO0A 2JYOA 2JA7G 3W1BA 3J80E 4HR7B 4DV1Q 2R93G 4DV5Q 1RODA 1XXGA 2ZXOA 3H91A 3MEHA 2XTIA 1X55A 2E75C 3H3VH 4KMUC 2JA5B 1A3UA 3M4YA 4C2MH 1B8AA 1SMYC 4POFA 2B2VA 1XTDA 5KNBA 4DUYL 2PO4A 3TP7A 3G71A 3Q8DA 3GTMB 2ICEC 4YHHQ 4CJ2C 4IZ8A 3KJPA 4IJHA 2VW9A 3QOLA 1SR3A 2JP1A 4DFAA 1OXUA 5I9PA 1JJCB 4BWGB 1FVIA 2J4XA 1NY4A 3J81c 1WCMB 1IBMQ 2AWNA 3IRBA 2IJ0A 2E2DC 1DJRD 2WKCA 3RNUA 1XMOQ 4A3KB 1QG7A 2XVSA 1PH1A 3JAME 4NP5A 3J81L 2YTXA 3CRKC 3MFYA 2DUDA 3CCLA 1WYDA 4I7AA 5LMNL 1C7YA 2NVYH 1HTLD 3I8ZA 1Q8IA 1PTOC 1IYJB 1AFPA 3A5ZB 1AH9A 2WB1G 2MPMA 1M4VA 4ZK9B 1IBKL 4IPGA 2OTLA 2ZM6L 1QUQB 4JBWA 5A2QL 1CQVA 3RMHA 1BXTA 4YHHL 3S17B 4JYAQ 1I6VC 2ICIA 1PFSA 3S1MB 4K5WA 3WOFA 2ATWA 4BXXH 1YNJC 4A3LG 4IN3A 4H0LC 3F2CA 2K5DA 4ZLTF 3SEBA 3STBD 5IGGA 3PUVA 1SMYD 2UXCQ 4IPDA 4YCUA 2B2YA 1I6HB 1XWEA 4RKLA 1XPRA 3MXUA 2HDMA 3N6RA 3IAYA 4X3KA 4IFDH 1QCBD 2RDHA 2JK8A 2RSOA 2VUMB 2JA7B 2Z6KC 2N8NA 4A4IA 2YTYA 1PH4A 2BDOA 3K7AH 1GKHA 2GN5A 3MZ5A 4NW2A 2DGYA 2NTTA 1V9PA 4DR2L 4G4KA 5IGDA 3D0FA 3HOXB 2RA4A 2FHTA 4H44C 4ZRZA 4X6AH 4HMIA 1DYQA 3S1QB 3OMCA 5BR8Q 1LACA 4MHEA 5C5LA 5FO9B 4IOAA 4J6HA 4HCEA 4N8FA 3CD6A 2A8VA 1B44D 2EYJA 4RGOS 2P5ZX 2UXCL 2H1EA 2B39A 4BXXG 1WTOA 1CK1A 1S4ZA 4UAIA 3KF8B 1EY5A 1GUGA 3SDZA 1L0YB 1F2LA 4X3TA 1IHZA 4BA2I 5ELNA 2XRQD 1U4MA 1PTOH 4BY7H 1N32L 3HOZG 3J7YW 4B08A 2F0DA 3TQYA 2MNAA 1I3QB 1LTTD 5M5YB 1PVOA 1A0IA 1LTSD 4DR3Q 1HRJA 1L2FA 2N88A 1ENAA 3DUZA 4NXNQ 1VQDA 5KIXA 1JOQA 3ICEA 1G291 4LFBL 4QF4A 2JA9A 4C3IH 2B2VC 1DXMA 5C4JB 3K5NA 1K3RA 1CA5A 4LF8Q 3P7JA 1ICFB 1A62A 1YVCA 1DCZA 2N3SA 3EIVA 3C3LA 2LS01 1ZYRC 2SDFA 2AUKA 5ELCA 1U5KA 3CPFA 3HOUB 4R9WA 4CKBA 5BR8L 4DV0L 3K0XA 4F8MA 3C46A 1FJGQ 4TKOB 1A8VA 4LW1A 1VQCA 3HOWB 1L0XB 2AKWB 4X3UA 4JI2Q 1M8AA 1K83H 2K75A 1VQKA 1XTCD 1TWAH 5JVH3 3ZJYC 4KD3A 2AUJD 2NVTB 2M2LA 5FK9C 2L15A 3NP8A 4BS9A 1TWHB 4RGNA 1VQPA 1PMRA 4CHTB 4YWLA 2O5IC 3KF6B 2XGTA 4HCSA 4B9XA 2VUMG 1B3AA 1ICWA 4A3EG 1G2SA 2F0JA 2XN9C 1V1OA 2EPBA 4KN7C 5C4ZA 4A3KG 4DK6C 1NJIC 5C0XJ 3DXJC 1ENFA 1VQJA 4GNXA 4LWCA 4LAAA 4PNYA 4A3FH 1JJGA 3HFZB 5IYDH 2L55A 4WRDA 4DV0Q 3ULPA 1U4LA 3BU2A 2BCOA 1YHQA 1FJGL 1LTAD 3QWNA 2NN6I 2EJGC 4JI5L 3I3CA 3KUPA 3KBGA 2F0MA 3JAMi 5ELFA 5IT9c 5CV8A 2F4IA 4IURA 4OWXB 3I4MH 3NELA 1WTHA 2NBFA 1PH6A 2E74C 4B3ML 3UDIA 1PV4A 1YNNC 1FYCA 4IQZA 2VB2X 4P73A 5FOBB 2A68D 2PYKA 4R4IA 5C5MA 1KAWA 2K6AA 4XYOA 2K5QA 2JA7H 1WI5A 1BNZA 1C9OA 1X3FA 3FKIH 3RZOH 4CDDC 1HQRD 3J80i 1IBLQ 3T1HQ 5C3XA 1E2VA 2B2TC 2HDLA 2QGQA 4QJFA 5EAYA 1GUNA 3WWVA 3I56A 5CV5A 1CKOA 3HOWG 1AZQA 3I7FA 4RA8A 1I4GA 2HCCA 2UUCQ 1VQNA 3BZCA 5EKLA 1SYBA 1G91A 3GD7A 1PRTC 4L6TB 1WVLA 2EQSA 2V4DA 4A3LH 5K5PA 4IJLA 4QIWB 2PCFB 2WIIB 3S1NB 5I2YA 4KHZA 3J7A5 2KCTA 2Z0SA 4KHPQ 1NE3A 3KFUA 5EPKA 2HHHQ 3GTPB 2PW7A 2D62A 3A56A 4IUUA 2F3WA 4KKTA 4JBMA 4XQNA 2FMMA 3J7ZC 1PTOB 4BY7B 2SEBD 4EGVA 3OYYA 1WD1A 4A93G 5C44G 4NXMQ 2K7VA 1SMXA 1CFMA 4KY5A 1KLGD 3S1RB 1KDCA 2A68C 3MA2B 1I4XA 4CBVA 2NVYB 1KLUD 3KF6A 4LF7Q 1QOHA 3S16H 1Y8OB 5L37A 1LTGD 2UUBL 1KDAA 4DF7A 1K0SA 5E7NA 1UEBA 3VA5A 3I4NB 3NWTA 3SXHA 1F9RA 5CC4A 5IYCG 5CMDA 4R4QA 5IGEA 1LTID 1UUPA 2I5MX 5EKIA 4KHPL 1I50H 1PYSB 1KDBA 4UY8C 4UPAA 1OXXK 5LMUL 2HHHL 1YEZA 1H9MA 1FD7D 1NR2A 2KBNA 2EYOA 3RLNA 2EYMA 4CDEC 4HJ9A 4A75A 4LNQA 1FGBD 4DR7L 4F88A 2KQ3A 2K52A 5C4XH 2Z9HA 2HQLA 2ZTCA 2VQEQ 5GQOA 3TN2A 2L1BA 1HQMC 4PQXA 3T16A 1WTVA 2NUCA 4FF3A 2F0TA 2KEDA 3E9IA 4A3MG 2E2JB 1BOSA 1CI3M 1F9QA 1V43A 1C8CA 3DMUA 2TMPA 1HA5A 1BCPF 3LX0A 3QO2A 4ZAIA 4GS3A 4BY1G 3PO3G 4N8X1 1GHJA 3JAMc 1Y8NB 4LMQD 5M3MH 5M3FH 3CAMA 4DV4Q 1DOKA 4BBRB 3T56B 3J81E 1RHPA 2IT1A 4B3TQ 4P74A 2WAQG 4WJ3M 2PQAB 3S15H 3K5LA 2ZXPA 2R92G 4IFDJ 5CORA 2UXDL 2Q2HA 1CKNB 3BG3A 5IP9G 1ZXTA 4POGA 3TREA 3PO2H 5TSSA 3ONAB 2VQEL 3T13A 1SE4A 3GTOH 3HS0C 1DOLA 1PXUA 4DR5L 3CCVA 2JA8H 2PQEA 2Q8RE 4HJ7A 4A3BG 1O80A 5KNCA 1HJPA 4OXPA 1JJ2A 4P72A 1SLJA 2EE1A 3U9OA 5EQ0A 2GVBA 3PGZA 4LUZA 3WOEA 3OIQA 5LMNQ 4A3IB 1PZJD 1RDPD 1EY9A 4L63B 1CA6A 1A3TA 4CDFC 1LABA 4IUNA 4OELB 5C4JH 3AMUA 5C0XH 4KD4A 2B2TA 1NCVA 2OXPA 1QZGA 2Q8TA 3PIO3 2I5LX 2NVXB 2ZXRA 3HOUH 1AN8A 3TSSA 3U58A 5JPMC 2ZM6Q 1EYGA 3PF5A 2OWOA 2PZUA 2X6LA 3AU7A 1STAA 2K4KA 4NDXA 1VQ5A 3H6MA 1W3SA 2X69A 1H9KA 3OW2A 4H02A 4A3EB 2EIFA 1SYEA 3TP8A 2PMZB 3A7LA 1PRTB 1SE8A 4RFBA 4I65A 3DLLA 3CPWA 1D5ZC 4N9TA 2JA8G 5G3LD 5EGTA 1U4RA 4DN4M 1QVFA 4A3BH 4UP7A 5M5WB 1EU3A 1VQ6A 5M9OA 5EJWA 3GTQB 1TR5A 1RL2A 4RCOA 3H15A 3E0JA 1S5BD 1EYDA 1JCKB 4O2DA 4KY7A 3KLWA 4DK0A 2YU9B 2K03A 4LJZC 1PZKD 4GNXB 2JA6G 1K28A 5JJIA 4C3IG 4DUYQ 5FLMG 3KLSA 4C1NK 4DR2Q 2AHOB 4XQJA 3PMFA 2B3GA 1OXVA 2CHBD 4LFAQ 2UU9L 3NTHA 1XYIA 1X9NA 4R1JA 3KLRA 1BR9A 2DJFC 3HKSA 2KHSA 4DV2Q 5C4XB 2NWGA 4HTHA 1CZWA 1Y69U 1PFBA 1PRTD 1NTGA 3E5SA 1OXTA 2NZ1D 1TS4A 2FFKB 4JVZA 5ISRA 4IO9A 1RD9D 4EX5A 4NPSA 3SE0A 3PSIA 4A3GG 4JI1Q 1F9PA 1PFMA 1TWGH 4KK7A 1HCZA 1YJWA 1VQ7A 4CJ0B 4QGUA 1TT2A 2RQXA 1VF7A 3S24A 1Q46A 1X6OA 1ESFA 1VQBA 1LUZA 4UDUC 5IP9H 1IKMA 1I4QA 3QOJA 2KECA 1YHBA 1VS0A 4UHVA 5C0XI 1HZAA 2A69C 2FXQA 5AJ3L 4JYAL 4B3SQ 1L0WA 2JA6B 4DAYB 1IL8A 1SJHD 2DN8A 1P16A 2HCIA 2F3IA 1GUWA 1EFID 3UDXA 1ENCA 1K8AC 1QZHA 2K04A 5JOBA 3S1NH 2N49A 2IW3A 1NBWA 3R93A 5IY0A 1VDZA 5C4XG 3GTLB 1HNZL 4KN4C 3GTPH 1HH2P 1B1ZA 3K5OA 4QQBX 3TBIB 5I9OA 5FJ8H 1TWFB 4JI7L 1WOCA 2EXDA 1YITA 1WJJA 2D9UA 2CQOA 3FRPB 4V190 1EIGA 5FO7B 3S1MH 1SNOA 1B53A 1KAAA 2LXKA 2D0PA 3IKJA 3HRZC 4BA1I 3OPOA 4BY1H 4AH6A 3S1RH 4GN3B 2A73B 1E1TA 5M3MG 2F0EA 4KY6A 5M5XB 1EFWA 4JI6Q 4S3SA 2EY2A 4B3SL 1UWVA 4LF6L 4C3HG 5DNFA 1HR0L 1C4QA 1PYBA 3D4RA 1SYFA 4O42A 4OO1G 3MEFA 2MUYA 1NMFA 2EY1A 3CCUA 3PIPA 4QMGA 2Z4HA 2B2YC 4DV6Q 2I5HA
chains in the Genus database with same CATH topology
3ZJYC 3M4OH 3AEVA 1L1OB 1H95A 3UDGA 4L5SA 2KHJA 4DAMA 4Y52H 2ALYB 4JI7Q 2L15A 4K0KQ 4DR1L 4A3KH 4DR4Q 4NB3A 3HOXH 2ASBA 1I94Q 1N32Q 1VQPA 1BBWA 4YWMA 2R7DA 4MNOA 2ID0A 1Q86C 5H1SE 1VQLA 4YWLA 3S1QH 3KF6B 1PH9A 3CCJA 5IYBH 2XGTA 4UP8A 2R7FA 4DR3L 1N36Q 2E5LQ 1MKHA 1AE3A 4DV7L 4A3EG 2UUAL 2VUMG 4B3RQ 1HNWL 4NXNL 3PUZA 2QEXA 5JEAG 4X65Q 4A3JG 2VNUD 1NMGA 2JJQA 3NEMA 4A3KG 4DK6C 2KHIA 5C44H 5GROA 1S40A 1NJIC 3T1HL 3K8AA 1IBLL 1M1KC 5C0XJ 1YNXA 1JB7A 3GTLH 1K9MC 3CCEA 4LF4Q 1VQJA 4GNXA 4A3FH 4LWCA 1PH2A 2R93H 1JJGA 3HFZB 3PCOB 1KRTA 3CMAA 4DV3Q 1GO3E 3T1YL 5IYDH 5M3FG 1Q81C 3FP9A 4YY3Q 4DV0Q 4C3JH 3ULPA 2PI2A 1BVSA 3BU2A 1Q1EA 2UUCL 1YHQA 1O7IA 2YTVA 1FJGL 3J81j 2NZHA 1N9WA 3UE1A 2NN6I 1G51A 4TQUS 4JI5L 3KDFA 3S17H 5M5YH 2PI2E 4LF9L 1VQHA 2F52A 3RLFA 4JI2L 4JI8Q 3JAMi 1EWIA 2E2HH 5IT9c 4X62L 2F4VQ 4QL5A 4LFCL 4A3FG 2UU9Q 1E7ZA 1XMQL 4OWXB 3I4MH 3NELA 1AE2A 1UE1A 4JC0A 3HKZG 1PH6A 4B3ML 3UDIA 1PV4A 4JI0Q 3W5OA 4K0KL 3H0GH 4DUZL 4P73A 4YCVA 2YV5A 4EQ5A 3ULLA 1I94L 2HT1A 2CKZB 3VDYA 1I6HH 4R4IA 3KYHC 3AFQA 3I4NH 5C3EH 1KAWA 4PZ6A 2UUAQ 3HOVH 5C0XG 4DV7Q 2JEBI 4GLXA 2Q2UA 1HNWQ 3RLOA 2JA7H 2V1CC 1D8LA 1WI5A 1VQAA 1C9OA 1X3FA 3FKIH 3RZOH 4X65L 3U4ZA 1HZBA 3J80i 2RCNA 1IBLQ 3T1HQ 1K0RA 1S72A 4NXML 3CC7A 2ZJQA 4LF4L 2QGQA 4QJFA 5EAYA 4BBSH 3WWVA 5FJ8G 3I56A 4HJAA 2GVAA 4JG2A 1CKOA 4DV3L 3HOWG 5GAGC 5GAEC 3I7FA 4OWWB 1BKBA 4UP9A 1OXSC 4YY3L 4GNXC 4LF7L 4GKKQ 1BBUA 3CF5A 2UUCQ 1M90C 1YHAA 4R4OA 1VQNA 1TWHH 3FHWA 3BZCA 4XTCS 4DNIA 4A3CH 2UUBQ 1QVCA 4JI3Q 4DR6Q 3EN2A 4IOCA 4JI5Q 1EQQA 4JBKA 3S2DH 4WJ4A 2LXJA 3GD7A 3CMEA 2E2IH 3CCSA 2EQSA 4X62Q 4LFCQ 4LUOA 1IL2A 4A3LH 4RMFA 2Y0SE 1CSQA 4GN5A 3GTJH 3DM3A 5LMNW 1XMQQ 4IJLA 1SRUA 1EQRA 2WAQE 4B3MQ 4KHZA 1VQEA 3STBC 2KCTA 3F2BA 2Z0SA 4DUZQ 2JA5G 4JI0L 1N33L 2YYZA 3J7A5 1NE3A 4KHPQ 3HOYG 3KFUA 4GOPA 2VL6A 3HOXG 2HHHQ 3CCMA 3RN5A 1UE5A 2RF4A 3G4SA 3ERSX 2CWAA 1L1OC 2D62A 1VQMA 1LTLA 1X65A 4JBMA 1WCMH 3J7ZC 1X54A 2B63H 4JOIC 1L1OA 3OYYA 4A93G 3RZDH 4DKAC 4LF5Q 5C44G 4NXMQ 5JJLA 1SMXA 1RIPA 2C35B 2LSSA 3F2DA 1XJVA 1Y1WG 2AWOA 5DLQE 3E9HA 3KF6A 4LF7Q 3TS2A 4GKKL 5FLXc 3D31A 5ELOA 2K5VA 3S16H 1CKNA 3A5UA 1UE7A 2Y0SG 2UUBL 2NVQH 1GD7A 4BBSG 5K36G 4JI3L 1PH5A 4DR6L 1Z47A 1XNQL 5E7NA 1UEBA 1VCIA 1X3EA 2PNHA 4OX9Q 5IYCG 3L7ZC 4R4QA 3RR5A 4HJ8A 3U4VA 4GOPC 5IWAL 4AQYQ 1EUJA 1XPUA 5GAHC 1HZ9A 1XNRL 2I5MX 3AQQA 4KHPL 1I50H 1PYSB 4UY8C 1N33Q 4P75A 1D7QA 4UPAA 4LUVA 4B3TL 1Q8KA 1OXXK 1YJNA 2JEAI 5LMUL 2PMZE 1YIJA 1YEZA 2HHHL 2JQOA 4OWTB 2KBNA 3RLNA 3J81i 3KDFB 2ZTEA 1KD1C 2UXDQ 3KOJA 4GLVB 2A19A 1GM5A 2NVTH 4A3IH 4RG1A 1T9HA 2VS1A 1V1QA 3K80C 4HJ9A 4A75A 1MJEA 4LNQA 4HJ5A 1B70B 3PUWA 4P71A 3HOYH 4DR7L 4R4TA 2K52A 4IPCA 2N78A 4J15A 4X64L 3RN2A 4L5RC 4DK3C 2WB1E 1KIXA 5C4XH 2VQEQ 2HQLA 2ZTCA 2I0QA 3F8TA 5GQOA 4LF5L 1Y14B 5IP7G 1E22A 4A3GH 2BA1A 3BZKA 1CUKA 3F1ZA 3PF4A 4X66Q 2MO1A 3E9IA 1P8LA 4A3MG 4JBJA 2NN6G 4PMWA 2D0OA 3GO5A 2RHQB 1VQ4A 1V43A 3GTMH 5GADC 4QY7A 3CC4A 3I4NG 1XNQQ 4DV5L 1KL9A 1IXRA 4OX9L 1WFQA 2R92H 1GVPA 1VQFA 3I55A 1Q7YC 3PV0A 4GS3A 4BY1G 3PO3G 3J80c 4AYBG 3JAMc 4HIDA 1Q1BA 3FKIG 5IWAQ 1PH3A 5M3MH 4L5TA 4AQYL 2OQ0A 1N34L 2R7ZH 5IYBG 5IE8A 5M3FH 1Q82C 3CAMA 1UE6A 4JI4Q 1KHIA 1XNRQ 4DV4Q 3PO2G 1YZ6A 1EIYB 2Z6KA 3U50C 2IT1A 4R4CA 1YJ9A 4B3TQ 4P74A 1KC8C 2WAQG 5LMUQ 1QVGA 2JA6H 4WJ3M 2PQAB 3S15H 1JMCA 2R92G 2CFMA 3CC2A 5FLMH 4JOIA 4IFDJ 1E3PA 2Q2HA 2UXDL 4HIOA 1CKNB 4IFDG 1J6QA 3GTQH 4DR7Q 3M4PA 2KCMA 5IP9G 1MJCA 3G48A 2CWPA 1JE5A 4X64Q 1W2BA 3W1GA 4POGA 3TREA 3PO2H 2VQEL 1E24A 3H3VI 3GTOH 4BBRG 1Y1VG 4GN4B 2YU9H 2B29A 4GOPB 2IX1A 4BY7G 4DR5L 2JA8H 3CCVA 1IBML 2HIXA 3EBEA 4X66L 1TWFH 4HJ7A 2IX0A 4PG3A 3TRZA 3HOVG 4A3BG 1HJPA 1VQOA 4OXPA 1JJ2A 3W1BA 2JA7G 4P72A 1SLJA 4DV1Q 2R93G 3K81C 4YCWA 2BH2A 4DV5Q 2GVBA 2MFIA 3M4QA 1VQGA 3PGZA 4LUZA 5LMNQ 3HOUG 1Y1VH 3OTOL 3GTGH 3CP0A 2ES2A 1FGUA 2WFWA 3CCQA 4GKJQ 1N34Q 2XTIA 5C4JH 1X55A 3LGJA 4JI4L 1S3OA 3H3VH 4DV4L 1X56A 3M85A 4A3DG 1HZCA 3TEHB 4AYBE 2VQFL 4C2MH 1QZGA 1B8AA 4OO1I 2K50A 4OONA 4POFA 2I5LX 1J5EQ 1XTDA 3HOUH 1IBKQ 2KENA 2B63G 4DUYL 3U58A 1PH7A 2AMCB 2ZM6Q 1EYGA 2E2JH 1KXLA 3PF5A 3M7NA 2OWOA 2UXBQ 2VUMH 3G71A 3Q8DA 3NENA 2K4KA 2Q2TA 4YHHQ 1VQ5A 3KJPA 4IJHA 3ER0A 2VW9A 1C0AA 1SR3A 2OTJA 1Q12A 1W3SA 1OTCA 2A1AA 3OW2A 1OXUA 1VQ9A 4H02A 1JJCB 4XIGS 2EIFA 1FVIA 1NY4A 3J81c 3ULJA 4DR5Q 3TS0A 5HGQA 1IBMQ 2AWNA 3IRBA 3UE0A 3K7UC 3KJOA 3I4OA 4DV2L 5IYDG 3RNUA 1SE8A 3JC66 1XMOQ 2RHSB 4BBRH 3DLLA 3CPWA 1PH1A 2K5NA 2YTXA 2JA8G 4DV1L 2PQAA 2DUDA 3CCLA 1WYDA 3A74A 1QVFA 5LMNL 4A3BH 4C3HH 4UP7A 1HNXL 1C7YA 1VQ6A 2NVYH 3OTOQ 3CXCA 3PO3H 1RL2A 3H15A 1IYJB 4O0AA 3A5ZB 1AH9A 2VZAA 2WB1G 1K73C 4GKJL 2MO0A 3I4MG 2ZJPA 4O2DA 3CCRA 2HIVA 1ASYA 3NBHB 3KLWA 1VQ8A 2VQFQ 4A76A 4GNXB 2JA6G 1J5EL 3A0JA 1IBKL 5JJIA 4IPGA 4PZ7A 4DPGA 5IYCH 5FLMG 4DUYQ 2OTLA 4IFDI 2ZM6L 1QUQB 2IHFA 4DR2Q 4FDBA 2UXBL 2AHOB 4A3CG 1E1OA 1I5FA 4JBWA 4MZ9A 4JYAQ 4YHHL 2B3GA 2IY5B 1PFSA 4IPHA 1OXVA 1I3QH 1MIUA 4LFAQ 1PHJA 1KQSA 2UU9L 4HIKA 1PH8A 4KLKA 2ATWA 4BXXH 4JV5Q 4A3LG 3F2CA 1X9NA 4R1JA 3STBD 2E8GA 5HY6A 3HKSA 4TVAB 3CW2C 3PUVA 4DV2Q 2JA5H 1XMOL 5M5XH 2QA4A 4A3JH 2UXCQ 1X3GA 4IPDA 2K5HA 4YCUA 3PIOA 1HNZQ 1B7YB 2Q2IA 3I2ZA 1KRSA 2NVXH 2IHEA 1HR0W 1XPRA 1NTGA 1HNXQ 1OXTA 1DGSA 2OCEA 3GDEA 2JK8A 4YWKA 1EIFA 4IO9A 5IP7H 4APVA 4EX5A 4NPSA 1XPOA 3PSIA 4A3GG 2Z6KC 4GLAC 4JI1Q 1U0LA 3S14H 1TWGH 2N8NA 1YJWA 4A4IA 1YI2A 1N8RC 1VQ7A 1EOVA 3HOWH 2YTYA 3M3YH 4QGUA 1PH4A 1K8GA 3K7AH 4A3EH 4A3DH 1GKHA 4MTNA 3S24A 1Q46A 3L0OA 1X6OA 1VQBA 1SN8A 1LUZA 2GN5A 4ME3A 5JEAJ 5IP9H 1Y1WH 1FL0A 4LFBQ 1A63A 1YHBA 1VS0A 2DGYA 3UDFA 1R9TH 4LF8L 5C0XI 1HZAA 1V9PA 4DR2L 4JI6L 3S2HH 2FXQA 3D0FA 1G6PA 2OQKA 5AJ3L 4JYAL 1PA6A 4B3SQ 1L0WA 3M9BA 4LF6Q 4AIMA 4X6AH 2R7ZG 4DAYB 5M5WH 4A3MH 2VY3A 4QIWE 4Y7NH 5BR8Q 1P16A 1HR0Q 1VQIA 4LFAL 2F3IA 5C3EG 4IOAA 3UDXA 4JV5L 3CD6A 1Z9FA 2A8VA 1K8AC 3CQZH 1QZHA 3S1NH 3HOZH 2N49A 3MXNB 1NBWA 1SFOH 5IY0A 5C4XG 2UXCL 1HNZL 1YBYA 4BXXG 3HKZE 1WCMG 4DV6L 3GTPH 1HH2P 4QQBX 1CKMA 3KF8B 5FJ8H 2H5XA 1QUQA 4A3IG 4JI7L 4BA2I 5ELNA 1WOCA 3AYHB 4DR1Q 2EXDA 1YITA 5JJKA 1WJJA 4ALPA 4BY7H 1LM0A 3HOZG 4JI1L 4DR4L 1N32L 3TQYA 2CQOA 2MNAA 3S1MH 2K14A 2LXKA 1PVOA 2D0PA 1A0IA 1N36L 2E5LL 3E0EA 4BA1I 1L2FA 4DR3Q 3GTKH 1IZ6A 4BY1H 4B3RL 3AFPA 4L5QA 4AH6A 3S1RH 1VQDA 4NXNQ 2BH8A 4KI0A 3ICEA 2JE6I 1G291 4GN3B 4JCVE 1E1TA 5M3MG 4LFBL 2JA9A 4C3IH 4LF8Q 1K3RA 1EFWA 1CSPA 4JI6Q 1YVCA 1A62A 3EIVA 2N3SA 5AJ3Q 4B3SL 2BA0A 1UWVA 2R6GA 3B6YA 4PZ8A 3L2PA 3G6EA 4LF6L 1JT8A 1TXYA 1U5KA 3T1YQ 3CPFA 3PUXA 5BR8L 1HR0L 5J3BA 4DV0L 1PYBA 3K0XA 1TWCH 2WP8J 2ZTDA 2ZJRA 1FJGQ 2MQHA 1A8VA 1ASZA 2NZOA 4LW1A 3BJUA 3MEFA 2CCZA 4OO1G 1NMFA 3PUYA 1VQCA 4LF9Q 3CCUA 3PIPA 2AKWB 1SROA 4JI2Q 4HIMA 3H0GG 4JI8L 1K83H 4A93H 3SGIA 2K75A 1VQKA 2F4VL 4DV6Q 1TWAH 2I5HA 1LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJY C;  3M4O H;  3AEV A;  1L1O B;  1H95 A;  3UDG A;  4L5S A;  2KHJ A;  4DAM A;  4Y52 H;  2ALY B;  4JI7 Q;  2L15 A;  4K0K Q;  4DR1 L;  4A3K H;  4DR4 Q;  4NB3 A;  3HOX H;  2ASB A;  1I94 Q;  1N32 Q;  1VQP A;  1BBW A;  4YWM A;  2R7D A;  4MNO A;  2ID0 A;  1Q86 C;  5H1S E;  1VQL A;  4YWL A;  3S1Q H;  3KF6 B;  1PH9 A;  3CCJ A;  5IYB H;  2XGT A;  4UP8 A;  2R7F A;  4DR3 L;  1N36 Q;  2E5L Q;  1MKH A;  1AE3 A;  4DV7 L;  4A3E G;  2UUA L;  2VUM G;  4B3R Q;  1HNW L;  4NXN L;  3PUZ A;  2QEX A;  5JEA G;  4X65 Q;  4A3J G;  2VNU D;  1NMG A;  2JJQ A;  3NEM A;  4A3K G;  4DK6 C;  2KHI A;  5C44 H;  5GRO A;  1S40 A;  1NJI C;  3T1H L;  3K8A A;  1IBL L;  1M1K C;  5C0X J;  1YNX A;  1JB7 A;  3GTL H;  1K9M C;  3CCE A;  4LF4 Q;  1VQJ A;  4GNX A;  4A3F H;  4LWC A;  1PH2 A;  2R93 H;  1JJG A;  3HFZ B;  3PCO B;  1KRT A;  3CMA A;  4DV3 Q;  1GO3 E;  3T1Y L;  5IYD H;  5M3F G;  1Q81 C;  3FP9 A;  4YY3 Q;  4DV0 Q;  4C3J H;  3ULP A;  2PI2 A;  1BVS A;  3BU2 A;  1Q1E A;  2UUC L;  1YHQ A;  1O7I A;  2YTV A;  1FJG L;  3J81 j;  2NZH A;  1N9W A;  3UE1 A;  2NN6 I;  1G51 A;  4TQU S;  4JI5 L;  3KDF A;  3S17 H;  5M5Y H;  2PI2 E;  4LF9 L;  1VQH A;  2F52 A;  3RLF A;  4JI2 L;  4JI8 Q;  3JAM i;  1EWI A;  2E2H H;  5IT9 c;  4X62 L;  2F4V Q;  4QL5 A;  4LFC L;  4A3F G;  2UU9 Q;  1E7Z A;  1XMQ L;  4OWX B;  3I4M H;  3NEL A;  1AE2 A;  1UE1 A;  4JC0 A;  3HKZ G;  1PH6 A;  4B3M L;  3UDI A;  1PV4 A;  4JI0 Q;  3W5O A;  4K0K L;  3H0G H;  4DUZ L;  4P73 A;  4YCV A;  2YV5 A;  4EQ5 A;  3ULL A;  1I94 L;  2HT1 A;  2CKZ B;  3VDY A;  1I6H H;  4R4I A;  3KYH C;  3AFQ A;  3I4N H;  5C3E H;  1KAW A;  4PZ6 A;  2UUA Q;  3HOV H;  5C0X G;  4DV7 Q;  2JEB I;  4GLX A;  2Q2U A;  1HNW Q;  3RLO A;  2JA7 H;  2V1C C;  1D8L A;  1WI5 A;  1VQA A;  1C9O A;  1X3F A;  3FKI H;  3RZO H;  4X65 L;  3U4Z A;  1HZB A;  3J80 i;  2RCN A;  1IBL Q;  3T1H Q;  1K0R A;  1S72 A;  4NXM L;  3CC7 A;  2ZJQ A;  4LF4 L;  2QGQ A;  4QJF A;  5EAY A;  4BBS H;  3WWV A;  5FJ8 G;  3I56 A;  4HJA A;  2GVA A;  4JG2 A;  1CKO A;  4DV3 L;  3HOW G;  5GAG C;  5GAE C;  3I7F A;  4OWW B;  1BKB A;  4UP9 A;  1OXS C;  4YY3 L;  4GNX C;  4LF7 L;  4GKK Q;  1BBU A;  3CF5 A;  2UUC Q;  1M90 C;  1YHA A;  4R4O A;  1VQN A;  1TWH H;  3FHW A;  3BZC A;  4XTC S;  4DNI A;  4A3C H;  2UUB Q;  1QVC A;  4JI3 Q;  4DR6 Q;  3EN2 A;  4IOC A;  4JI5 Q;  1EQQ A;  4JBK A;  3S2D H;  4WJ4 A;  2LXJ A;  3GD7 A;  3CME A;  2E2I H;  3CCS A;  2EQS A;  4X62 Q;  4LFC Q;  4LUO A;  1IL2 A;  4A3L H;  4RMF A;  2Y0S E;  1CSQ A;  4GN5 A;  3GTJ H;  3DM3 A;  5LMN W;  1XMQ Q;  4IJL A;  1SRU A;  1EQR A;  2WAQ E;  4B3M Q;  4KHZ A;  1VQE A;  3STB C;  2KCT A;  3F2B A;  2Z0S A;  4DUZ Q;  2JA5 G;  4JI0 L;  1N33 L;  2YYZ A;  3J7A 5;  1NE3 A;  4KHP Q;  3HOY G;  3KFU A;  4GOP A;  2VL6 A;  3HOX G;  2HHH Q;  3CCM A;  3RN5 A;  1UE5 A;  2RF4 A;  3G4S A;  3ERS X;  2CWA A;  1L1O C;  2D62 A;  1VQM A;  1LTL A;  1X65 A;  4JBM A;  1WCM H;  3J7Z C;  1X54 A;  2B63 H;  4JOI C;  1L1O A;  3OYY A;  4A93 G;  3RZD H;  4DKA C;  4LF5 Q;  5C44 G;  4NXM Q;  5JJL A;  1SMX A;  1RIP A;  2C35 B;  2LSS A;  3F2D A;  1XJV A;  1Y1W G;  2AWO A;  5DLQ E;  3E9H A;  3KF6 A;  4LF7 Q;  3TS2 A;  4GKK L;  5FLX c;  3D31 A;  5ELO A;  2K5V A;  3S16 H;  1CKN A;  3A5U A;  1UE7 A;  2Y0S G;  2UUB L;  2NVQ H;  1GD7 A;  4BBS G;  5K36 G;  4JI3 L;  1PH5 A;  4DR6 L;  1Z47 A;  1XNQ L;  5E7N A;  1UEB A;  1VCI A;  1X3E A;  2PNH A;  4OX9 Q;  5IYC G;  3L7Z C;  4R4Q A;  3RR5 A;  4HJ8 A;  3U4V A;  4GOP C;  5IWA L;  4AQY Q;  1EUJ A;  1XPU A;  5GAH C;  1HZ9 A;  1XNR L;  2I5M X;  3AQQ A;  4KHP L;  1I50 H;  1PYS B;  4UY8 C;  1N33 Q;  4P75 A;  1D7Q A;  4UPA A;  4LUV A;  4B3T L;  1Q8K A;  1OXX K;  1YJN A;  2JEA I;  5LMU L;  2PMZ E;  1YIJ A;  1YEZ A;  2HHH L;  2JQO A;  4OWT B;  2KBN A;  3RLN A;  3J81 i;  3KDF B;  2ZTE A;  1KD1 C;  2UXD Q;  3KOJ A;  4GLV B;  2A19 A;  1GM5 A;  2NVT H;  4A3I H;  4RG1 A;  1T9H A;  2VS1 A;  1V1Q A;  3K80 C;  4HJ9 A;  4A75 A;  1MJE A;  4LNQ A;  4HJ5 A;  1B70 B;  3PUW A;  4P71 A;  3HOY H;  4DR7 L;  4R4T A;  2K52 A;  4IPC A;  2N78 A;  4J15 A;  4X64 L;  3RN2 A;  4L5R C;  4DK3 C;  2WB1 E;  1KIX A;  5C4X H;  2VQE Q;  2HQL A;  2ZTC A;  2I0Q A;  3F8T A;  5GQO A;  4LF5 L;  1Y14 B;  5IP7 G;  1E22 A;  4A3G H;  2BA1 A;  3BZK A;  1CUK A;  3F1Z A;  3PF4 A;  4X66 Q;  2MO1 A;  3E9I A;  1P8L A;  4A3M G;  4JBJ A;  2NN6 G;  4PMW A;  2D0O A;  3GO5 A;  2RHQ B;  1VQ4 A;  1V43 A;  3GTM H;  5GAD C;  4QY7 A;  3CC4 A;  3I4N G;  1XNQ Q;  4DV5 L;  1KL9 A;  1IXR A;  4OX9 L;  1WFQ A;  2R92 H;  1GVP A;  1VQF A;  3I55 A;  1Q7Y C;  3PV0 A;  4GS3 A;  4BY1 G;  3PO3 G;  3J80 c;  4AYB G;  3JAM c;  4HID A;  1Q1B A;  3FKI G;  5IWA Q;  1PH3 A;  5M3M H;  4L5T A;  4AQY L;  2OQ0 A;  1N34 L;  2R7Z H;  5IYB G;  5IE8 A;  5M3F H;  1Q82 C;  3CAM A;  1UE6 A;  4JI4 Q;  1KHI A;  1XNR Q;  4DV4 Q;  3PO2 G;  1YZ6 A;  1EIY B;  2Z6K A;  3U50 C;  2IT1 A;  4R4C A;  1YJ9 A;  4B3T Q;  4P74 A;  1KC8 C;  2WAQ G;  5LMU Q;  1QVG A;  2JA6 H;  4WJ3 M;  2PQA B;  3S15 H;  1JMC A;  2R92 G;  2CFM A;  3CC2 A;  5FLM H;  4JOI A;  4IFD J;  1E3P A;  2Q2H A;  2UXD L;  4HIO A;  1CKN B;  4IFD G;  1J6Q A;  3GTQ H;  4DR7 Q;  3M4P A;  2KCM A;  5IP9 G;  1MJC A;  3G48 A;  2CWP A;  1JE5 A;  4X64 Q;  1W2B A;  3W1G A;  4POG A;  3TRE A;  3PO2 H;  2VQE L;  1E24 A;  3H3V I;  3GTO H;  4BBR G;  1Y1V G;  4GN4 B;  2YU9 H;  2B29 A;  4GOP B;  2IX1 A;  4BY7 G;  4DR5 L;  2JA8 H;  3CCV A;  1IBM L;  2HIX A;  3EBE A;  4X66 L;  1TWF H;  4HJ7 A;  2IX0 A;  4PG3 A;  3TRZ A;  3HOV G;  4A3B G;  1HJP A;  1VQO A;  4OXP A;  1JJ2 A;  3W1B A;  2JA7 G;  4P72 A;  1SLJ A;  4DV1 Q;  2R93 G;  3K81 C;  4YCW A;  2BH2 A;  4DV5 Q;  2GVB A;  2MFI A;  3M4Q A;  1VQG A;  3PGZ A;  4LUZ A;  5LMN Q;  3HOU G;  1Y1V H;  3OTO L;  3GTG H;  3CP0 A;  2ES2 A;  1FGU A;  2WFW A;  3CCQ A;  4GKJ Q;  1N34 Q;  2XTI A;  5C4J H;  1X55 A;  3LGJ A;  4JI4 L;  1S3O A;  3H3V H;  4DV4 L;  1X56 A;  3M85 A;  4A3D G;  1HZC A;  3TEH B;  4AYB E;  2VQF L;  4C2M H;  1QZG A;  1B8A A;  4OO1 I;  2K50 A;  4OON A;  4POF A;  2I5L X;  1J5E Q;  1XTD A;  3HOU H;  1IBK Q;  2KEN A;  2B63 G;  4DUY L;  3U58 A;  1PH7 A;  2AMC B;  2ZM6 Q;  1EYG A;  2E2J H;  1KXL A;  3PF5 A;  3M7N A;  2OWO A;  2UXB Q;  2VUM H;  3G71 A;  3Q8D A;  3NEN A;  2K4K A;  2Q2T A;  4YHH Q;  1VQ5 A;  3KJP A;  4IJH A;  3ER0 A;  2VW9 A;  1C0A A;  1SR3 A;  2OTJ A;  1Q12 A;  1W3S A;  1OTC A;  2A1A A;  3OW2 A;  1OXU A;  1VQ9 A;  4H02 A;  1JJC B;  4XIG S;  2EIF A;  1FVI A;  1NY4 A;  3J81 c;  3ULJ A;  4DR5 Q;  3TS0 A;  5HGQ A;  1IBM Q;  2AWN A;  3IRB A;  3UE0 A;  3K7U C;  3KJO A;  3I4O A;  4DV2 L;  5IYD G;  3RNU A;  1SE8 A;  3JC6 6;  1XMO Q;  2RHS B;  4BBR H;  3DLL A;  3CPW A;  1PH1 A;  2K5N A;  2YTX A;  2JA8 G;  4DV1 L;  2PQA A;  2DUD A;  3CCL A;  1WYD A;  3A74 A;  1QVF A;  5LMN L;  4A3B H;  4C3H H;  4UP7 A;  1HNX L;  1C7Y A;  1VQ6 A;  2NVY H;  3OTO Q;  3CXC A;  3PO3 H;  1RL2 A;  3H15 A;  1IYJ B;  4O0A A;  3A5Z B;  1AH9 A;  2VZA A;  2WB1 G;  1K73 C;  4GKJ L;  2MO0 A;  3I4M G;  2ZJP A;  4O2D A;  3CCR A;  2HIV A;  1ASY A;  3NBH B;  3KLW A;  1VQ8 A;  2VQF Q;  4A76 A;  4GNX B;  2JA6 G;  1J5E L;  3A0J A;  1IBK L;  5JJI A;  4IPG A;  4PZ7 A;  4DPG A;  5IYC H;  5FLM G;  4DUY Q;  2OTL A;  4IFD I;  2ZM6 L;  1QUQ B;  2IHF A;  4DR2 Q;  4FDB A;  2UXB L;  2AHO B;  4A3C G;  1E1O A;  1I5F A;  4JBW A;  4MZ9 A;  4JYA Q;  4YHH L;  2B3G A;  2IY5 B;  1PFS A;  4IPH A;  1OXV A;  1I3Q H;  1MIU A;  4LFA Q;  1PHJ A;  1KQS A;  2UU9 L;  4HIK A;  1PH8 A;  4KLK A;  2ATW A;  4BXX H;  4JV5 Q;  4A3L G;  3F2C A;  1X9N A;  4R1J A;  3STB D;  2E8G A;  5HY6 A;  3HKS A;  4TVA B;  3CW2 C;  3PUV A;  4DV2 Q;  2JA5 H;  1XMO L;  5M5X H;  2QA4 A;  4A3J H;  2UXC Q;  1X3G A;  4IPD A;  2K5H A;  4YCU A;  3PIO A;  1HNZ Q;  1B7Y B;  2Q2I A;  3I2Z A;  1KRS A;  2NVX H;  2IHE A;  1HR0 W;  1XPR A;  1NTG A;  1HNX Q;  1OXT A;  1DGS A;  2OCE A;  3GDE A;  2JK8 A;  4YWK A;  1EIF A;  4IO9 A;  5IP7 H;  4APV A;  4EX5 A;  4NPS A;  1XPO A;  3PSI A;  4A3G G;  2Z6K C;  4GLA C;  4JI1 Q;  1U0L A;  3S14 H;  1TWG H;  2N8N A;  1YJW A;  4A4I A;  1YI2 A;  1N8R C;  1VQ7 A;  1EOV A;  3HOW H;  2YTY A;  3M3Y H;  4QGU A;  1PH4 A;  1K8G A;  3K7A H;  4A3E H;  4A3D H;  1GKH A;  4MTN A;  3S24 A;  1Q46 A;  3L0O A;  1X6O A;  1VQB A;  1SN8 A;  1LUZ A;  2GN5 A;  4ME3 A;  5JEA J;  5IP9 H;  1Y1W H;  1FL0 A;  4LFB Q;  1A63 A;  1YHB A;  1VS0 A;  2DGY A;  3UDF A;  1R9T H;  4LF8 L;  5C0X I;  1HZA A;  1V9P A;  4DR2 L;  4JI6 L;  3S2H H;  2FXQ A;  3D0F A;  1G6P A;  2OQK A;  5AJ3 L;  4JYA L;  1PA6 A;  4B3S Q;  1L0W A;  3M9B A;  4LF6 Q;  4AIM A;  4X6A H;  2R7Z G;  4DAY B;  5M5W H;  4A3M H;  2VY3 A;  4QIW E;  4Y7N H;  5BR8 Q;  1P16 A;  1HR0 Q;  1VQI A;  4LFA L;  2F3I A;  5C3E G;  4IOA A;  3UDX A;  4JV5 L;  3CD6 A;  1Z9F A;  2A8V A;  1K8A C;  3CQZ H;  1QZH A;  3S1N H;  3HOZ H;  2N49 A;  3MXN B;  1NBW A;  1SFO H;  5IY0 A;  5C4X G;  2UXC L;  1HNZ L;  1YBY A;  4BXX G;  3HKZ E;  1WCM G;  4DV6 L;  3GTP H;  1HH2 P;  4QQB X;  1CKM A;  3KF8 B;  5FJ8 H;  2H5X A;  1QUQ A;  4A3I G;  4JI7 L;  4BA2 I;  5ELN A;  1WOC A;  3AYH B;  4DR1 Q;  2EXD A;  1YIT A;  5JJK A;  1WJJ A;  4ALP A;  4BY7 H;  1LM0 A;  3HOZ G;  4JI1 L;  4DR4 L;  1N32 L;  3TQY A;  2CQO A;  2MNA A;  3S1M H;  2K14 A;  2LXK A;  1PVO A;  2D0P A;  1A0I A;  1N36 L;  2E5L L;  3E0E A;  4BA1 I;  1L2F A;  4DR3 Q;  3GTK H;  1IZ6 A;  4BY1 H;  4B3R L;  3AFP A;  4L5Q A;  4AH6 A;  3S1R H;  1VQD A;  4NXN Q;  2BH8 A;  4KI0 A;  3ICE A;  2JE6 I;  1G29 1;  4GN3 B;  4JCV E;  1E1T A;  5M3M G;  4LFB L;  2JA9 A;  4C3I H;  4LF8 Q;  1K3R A;  1EFW A;  1CSP A;  4JI6 Q;  1YVC A;  1A62 A;  3EIV A;  2N3S A;  5AJ3 Q;  4B3S L;  2BA0 A;  1UWV A;  2R6G A;  3B6Y A;  4PZ8 A;  3L2P A;  3G6E A;  4LF6 L;  1JT8 A;  1TXY A;  1U5K A;  3T1Y Q;  3CPF A;  3PUX A;  5BR8 L;  1HR0 L;  5J3B A;  4DV0 L;  1PYB A;  3K0X A;  1TWC H;  2WP8 J;  2ZTD A;  2ZJR A;  1FJG Q;  2MQH A;  1A8V A;  1ASZ A;  2NZO A;  4LW1 A;  3BJU A;  3MEF A;  2CCZ A;  4OO1 G;  1NMF A;  3PUY A;  1VQC A;  4LF9 Q;  3CCU A;  3PIP A;  2AKW B;  1SRO A;  4JI2 Q;  4HIM A;  3H0G G;  4JI8 L;  1K83 H;  4A93 H;  3SGI A;  2K75 A;  1VQK A;  2F4V L;  4DV6 Q;  1TWA H;  2I5H A;  1LYL A; 
#chains in the Genus database with same CATH topology
 2K05 A;  3AEV A;  5EPJ A;  3UDG A;  4L5S A;  1NAP A;  2KHJ A;  4Y52 H;  1SE3 A;  1PDQ A;  1EOT A;  3HOX H;  2ASB A;  1RJT A;  1JB3 A;  2R7D A;  4MNO A;  1VQL A;  5H1S E;  5K36 H;  3S1Q H;  2E5L Q;  2UUA L;  3K5M A;  4A3G B;  4NXN L;  1H9S A;  3HOZ B;  4G57 A;  5JEA G;  5KYI A;  4A3J G;  1NMG A;  3VR3 A;  2KHI A;  5C44 H;  1S40 A;  1OO9 B;  3I72 A;  3K8A A;  5KGU A;  3T1H L;  4LF4 Q;  5COY A;  2F0Q A;  1ET6 A;  3GV6 A;  1KRT A;  2PNR C;  1Q81 C;  2PI2 A;  1A6X A;  3C1F A;  2DJG C;  3UE1 A;  2K32 A;  2B8G A;  1VQH A;  1PTO F;  2F52 A;  3A8J E;  2E2H H;  1EWI A;  1EU4 A;  4X62 L;  4QL5 A;  2JXM B;  4A3F G;  5T1I A;  1E7Z A;  3S15 B;  3DM1 A;  4K6L A;  1XMQ L;  3EFX D;  2L11 A;  4DAY A;  1TQO A;  4C3I B;  4JC0 A;  1BCP B;  4HSV A;  3W5O A;  4DUZ L;  5JVG 3;  4EQ5 A;  2I07 B;  2HT1 A;  1U9R A;  3KYH C;  3OW7 A;  1HFG A;  1SNP A;  1DZ1 A;  1NR4 A;  5IIF A;  3HOV H;  4DV7 Q;  4JPB W;  2Q2U A;  1HNW Q;  1EZ8 A;  2V1C C;  1D8L A;  3NWS A;  3KBX A;  5CYU A;  1EEI D;  1TVX A;  4X65 L;  1DD2 A;  1PZI D;  3BDO A;  1K83 B;  3MTS A;  1S72 A;  2WB1 B;  4MN3 A;  2EYH A;  5FJ8 G;  4OIK A;  1C48 A;  4UP9 A;  3GTG B;  3CF5 A;  1IYU A;  5CV7 A;  1TWH H;  3FHW A;  4XTC S;  4A3C H;  1I4R A;  2UUB Q;  1EIH A;  1QVC A;  4DR6 Q;  4IOC A;  1SSO A;  2KVM A;  1EQQ A;  2PW5 A;  4JBK A;  4WJ4 A;  2PZT A;  2CH4 W;  5LL6 S;  3CME A;  3CCS A;  2QKI C;  4QCL A;  1FR3 A;  1Q3L A;  2N55 A;  2Y0S E;  3GTJ H;  3DM3 A;  1XMQ Q;  4MIU A;  3U9S A;  2EZV A;  5HGT A;  5IGF A;  4RAU C;  2YYZ A;  3LWU A;  1B4O A;  3NTI A;  1X3Q A;  4R8N A;  3ERS X;  3G4S A;  1L1O C;  1SYD A;  1LTL A;  2F0V A;  4B9W A;  3QG1 A;  1F77 A;  2B63 H;  4OL7 A;  4CKC A;  3RZD H;  1LO5 D;  2F0U A;  1LT3 D;  5JAV A;  4QB4 A;  2C35 B;  2LSS A;  5CV6 A;  2G9H D;  2EXZ A;  3EQL C;  1EEF D;  3FEW X;  5FLX c;  3D31 A;  5ELO A;  3PO3 B;  2QEJ C;  2Y0S G;  1JWM D;  4XQQ A;  2NVQ H;  5K36 G;  4DR6 L;  1PH5 A;  1F2M A;  1X3E A;  2PNH A;  4OX9 Q;  1QIL A;  3RR5 A;  2B2U A;  2PPB C;  4GOP C;  5IWA L;  1RF2 D;  3FKI B;  1EY6 A;  3BZD B;  5GAH C;  5CV9 A;  5EBC A;  2SNS A;  1N33 Q;  1F9S A;  3IFD A;  2Y0S B;  4B3T L;  1SYG A;  4YIJ A;  2PMZ E;  1YIJ A;  1STY A;  2A19 A;  1B70 B;  1GUS A;  4OIJ A;  5KND A;  2XSC A;  4X64 L;  4L5R C;  5LL6 X;  4IUV A;  1STE A;  2OEO A;  1LTB D;  2I0Q A;  4DNR B;  5IP7 G;  4A3G H;  1XX8 A;  3BZK A;  4KJO A;  1CUK A;  2MO1 A;  1P8L A;  4EQP A;  3NBH A;  4JBJ A;  5C44 B;  4K6D A;  3GO5 A;  3GTM H;  5GAD C;  3CC4 A;  3I4N G;  2I46 A;  1KL9 A;  4DV5 L;  1IXR A;  4OX9 L;  1S5F D;  2KEE A;  1WFQ A;  1I4H A;  3J80 c;  2L9H A;  2JSO A;  2K33 A;  4L5T A;  5IYB G;  1SE2 A;  1R9T B;  1Q82 C;  1XNR Q;  1UE6 A;  1PYW D;  2AQ2 B;  3G6J B;  3HP3 A;  2RKS A;  1QVG A;  2JA6 H;  2F0N A;  5C4H A;  4Y7N B;  1JMC A;  3CC2 A;  5FLM H;  4JOI A;  5FO8 B;  3WDN A;  2EY6 A;  1D5X C;  4IFD G;  3GQB A;  1J6Q A;  2KCC A;  4DR7 Q;  4AYB B;  5JJZ A;  4L8J A;  5IT9 E;  3G48 A;  1QB5 D;  1W2B A;  3BVG A;  4OHJ A;  2A74 C;  3H3V I;  1PFN A;  4BBR G;  2RDF A;  4GN4 B;  5G3L F;  5EBD A;  2LKV A;  1STH A;  1TWF H;  2F1M A;  4RGT A;  3Q22 A;  1VQO A;  2MGS A;  2IX3 A;  2BE5 D;  4YCW A;  1UAP A;  3HOU G;  1Y1V H;  3OTO L;  3GTG H;  3CP0 A;  2WFW A;  2ZT9 C;  3OOC A;  3CCQ A;  3ZYY X;  4GKJ Q;  3D8G A;  5JPN C;  1WTR A;  2FJ2 A;  5CBE E;  1SDF A;  4JI4 L;  1S3O A;  1X56 A;  2EYF A;  4RGM A;  5D14 A;  4A3D G;  4AYB E;  1CTM A;  2L5T A;  2VQF L;  1SNC A;  3HZX A;  3MXN A;  4CJ1 B;  3GTJ B;  2LFN A;  2MP1 A;  3DHQ A;  4PMC A;  2KEN A;  4U67 3;  2B63 G;  4FNF A;  1KXL A;  3FPU B;  2VUM H;  2CW0 D;  2Q2T A;  1GUO A;  3ER0 A;  2OTJ A;  1Q12 A;  2R92 B;  1FNW A;  2L0C A;  1HUN A;  1VQ9 A;  4X3S A;  3K7A B;  3EJI A;  4U68 A;  3VYU A;  2RBM A;  3N52 A;  3ULJ A;  1STB A;  1PRT F;  2R7Z B;  1TU2 B;  3K7U C;  2WKD A;  2B63 B;  3KJO A;  3I4O A;  5IYD G;  3P1H A;  4BBR H;  3IFT A;  3DEO A;  4XXE A;  3A74 A;  5JEA H;  4A3M B;  1HNX L;  4CGY B;  1PLF A;  1Y8P B;  3OTO Q;  3CXC A;  1E2Z A;  3PO3 H;  4O0A A;  1IKL A;  4M1U B;  4GKJ L;  3PQI A;  3I4M G;  2ZJP A;  2BOS A;  3VR5 A;  3CCR A;  1ASY A;  3NBH B;  2A6H D;  4EVO A;  2VQF Q;  4R8I A;  2L12 A;  2EOT A;  3A0J A;  4PZ7 A;  5IYC H;  2IL8 A;  3TZU A;  1RCV D;  2IHF A;  2UXB L;  1DON A;  1E1O A;  1I5F A;  3OIP A;  4IPH A;  1MIU A;  1X32 A;  4ID6 A;  2E2H B;  1KQS A;  3A55 A;  4V0B A;  1PH8 A;  4KLK A;  3GTK B;  4JV5 Q;  1O7Z A;  4WFN 3;  3E3X A;  2VXW A;  1S5E D;  2FMC A;  2E8G A;  3CRL C;  5HY6 A;  4TVA B;  3CW2 C;  1LLR D;  2JA5 H;  1XMO L;  1Z7T A;  2QA4 A;  1X3G A;  1HNZ Q;  1LT6 D;  1B7Y B;  2KOL A;  2Q2I A;  1JOR A;  1KRS A;  2F0L A;  2IHE A;  4DAV A;  1HNX Q;  3OHX C;  1DGS A;  2FIN B;  3GDE A;  2TSS A;  4YWK A;  1EIF A;  5BN4 A;  4APV A;  3V96 A;  3C2P A;  4K2L A;  1N8R C;  3DEP A;  1BDO A;  1EOV A;  3KLS X;  3M3Y H;  3SHL A;  1K8G A;  4HED A;  5F2D A;  3K58 A;  3L0O A;  2A69 D;  1SN8 A;  1Y1W H;  1KNE A;  4LFB Q;  1FL0 A;  4LF8 L;  1R9T H;  3RUZ A;  1EYA A;  3D4D A;  2H4O A;  2QIL A;  3S2H H;  4KJN A;  2OQK A;  3VR2 A;  3M9B A;  4ULL A;  4LF6 Q;  4AIM A;  4E6I A;  5M5W H;  4Y7N H;  4LFA L;  5C3E G;  1J8I A;  2LY7 A;  1Z9F A;  1BCP C;  4IUT A;  5EPL A;  4DGZ A;  1Z6H A;  4F7X A;  3HKZ E;  1WCM G;  4DV6 L;  1EY8 A;  1CKM A;  3QIA A;  1MI2 A;  1QUQ A;  5J39 A;  5NUC A;  2G5D A;  1V1P A;  3MFG A;  5JJK A;  4FYD A;  4KHV A;  4JI1 L;  1YNJ D;  4IAL A;  3RZD B;  1N36 L;  3E0E A;  3AFP A;  4L5Q A;  4JCV E;  1U4P A;  1EY7 A;  4N9P A;  3L9A X;  3D3R A;  1CSP A;  2RDG A;  4C3J G;  5AJ3 Q;  2Z8L A;  2R6G A;  4PZ8 A;  2D5D A;  3G6E A;  5DEH A;  5CBA E;  1JT8 A;  3T1Y Q;  3PUX A;  2RCF A;  1TWC H;  2ZJR A;  1ET9 A;  2MQH A;  1ASZ A;  2NZO A;  3BJU A;  4NKL A;  4LF9 Q;  2A6H C;  1SRO A;  4A93 H;  3H0G G;  4ZUJ A;  3I73 A;  3R8B A;  3M4O H;  1L1O B;  2ALY B;  3K0Y A;  3TZD A;  4K0K Q;  4DR1 L;  1N32 Q;  1I94 Q;  1BBW A;  4YWM A;  1Q86 C;  2ID0 A;  2QW7 A;  1N36 Q;  2R7F A;  1MKH A;  4EQO A;  4DV7 L;  2E2I B;  2M9V A;  1HNW L;  4RKB A;  3X3N A;  4FF1 A;  3PUZ A;  3IL8 A;  3T4A C;  1CHQ D;  2JJQ A;  3GTL H;  2K5W A;  1RTO A;  2KCN A;  1YNX A;  5E3F A;  1M1K C;  4G7O C;  2WV6 D;  1K9M C;  5D3I B;  3T1Y L;  1GO3 E;  1TY0 A;  5ELE A;  4C3J H;  2UUC L;  1CZG A;  1O7I A;  2YTV A;  3J81 j;  2NZH A;  1N9W A;  1G51 A;  4TQU S;  5M5Y H;  2C5C A;  4LF9 L;  3SVM A;  3I4L A;  3OWF A;  4J8Q A;  4XDX A;  3RD4 A;  3MWY W;  3HEJ A;  1W6K A;  4JI2 L;  3CKI B;  1QNU A;  1IW7 C;  2F0I A;  4BY1 B;  2QDB A;  2F4V Q;  4IUQ A;  2UU9 Q;  1ILP A;  1X3P A;  1UE1 A;  4K0K L;  3H0G H;  2YV5 A;  1EY0 A;  2CKZ B;  2O2L D;  5C3E H;  2E76 C;  1VMC A;  1LT5 D;  1JE4 A;  1AEX A;  3BVM A;  5C0X G;  2JEB I;  4GLX A;  1GUT A;  4OEM B;  3RLO A;  1EQV A;  1Q90 A;  3S14 B;  1VQA A;  2A6E C;  3BDC A;  1CHP D;  1BF4 A;  3U4Z A;  1HZB A;  2EDG A;  1ZYR D;  2RCN A;  2F03 A;  3M3Y B;  5CV4 A;  2F0O A;  4NXM L;  3CC7 A;  3MC0 B;  1FNU A;  3OWE B;  4HJA A;  3BVZ A;  2GVA A;  4JG2 A;  4DV3 L;  1Y1W B;  5GAG C;  5GAE C;  4OWW B;  1BKB A;  2CVR A;  1OXS C;  3HGB A;  4YY3 L;  1M90 C;  3HOY B;  2WIN B;  2B2U C;  4DNI A;  2CQA A;  3EN2 A;  5KRU A;  3Q23 A;  3NQT A;  1ILQ A;  1R4P B;  3S2D H;  3NXW A;  1LV9 A;  4X62 Q;  4LFC Q;  4RMF A;  3J80 L;  4GN5 A;  1HTP A;  4B3M Q;  1PTO D;  4JI0 L;  1VQE A;  3STB C;  2JA5 G;  1N33 L;  3VYS A;  1TS3 A;  2VL6 A;  3HOX G;  4A3F B;  3CCM A;  1UE5 A;  2RF4 A;  1DM0 B;  1VQM A;  1AP0 A;  5D3D A;  4GZY C;  3GV3 A;  2XIW A;  2EYP A;  1IW7 D;  1V8Q A;  3LWE A;  4XT1 B;  5M3M B;  1S5D D;  4DKA C;  3W3A A;  4LF5 Q;  3SK5 A;  4ZQ3 A;  5JJL A;  5CR3 A;  4FP5 D;  1XJV A;  3DWP A;  1Y1W G;  2AWO A;  1UEA B;  4C3H B;  5DLQ E;  3QJY A;  3FPP A;  4WOR A;  4P2C B;  4K2K A;  4IUP A;  5IOC A;  4KKS A;  4CKE A;  3P20 A;  3PIP 3;  1UE7 A;  1H9S B;  1Z47 A;  1DOM A;  2G9D A;  3HOV B;  1EWC A;  3L7Z C;  4HJ8 A;  1STG A;  2HUG A;  3A8I E;  3U4V A;  2L4N A;  3GTO B;  1B9N A;  1TS2 A;  5I6Y A;  4HSP A;  1EUJ A;  3Q0A A;  1BCP D;  1XNR L;  4ME5 A;  4H7B A;  2EJM A;  4OWT B;  1EY4 A;  3SK8 A;  3M4O B;  1A2U A;  3LNN A;  4RG1 A;  1V1Q A;  2OF1 A;  1JWS D;  5C6A A;  5DM7 3;  4M8A A;  4P71 A;  3KK7 A;  2N78 A;  2RVL A;  4G7Z C;  3RN2 A;  4NMZ A;  4DK3 C;  2DNC A;  2SOB A;  4A3J B;  1IYV A;  3F8T A;  4LF5 L;  2F3V A;  1E22 A;  2BA1 A;  2K1B A;  3QB3 A;  4Z9C B;  4LK1 C;  1SBB B;  3MHB A;  3P75 A;  5I4D A;  1MSH A;  4QY7 A;  1XNQ Q;  2R93 B;  4FXD A;  5C3W A;  1GVP A;  1D1K A;  3PV0 A;  4C3J B;  4AYB G;  4CDC C;  3FKI G;  3SK6 A;  1PH3 A;  2OQ0 A;  4RHS A;  1JIC A;  4K5V A;  3A8K E;  3S2H B;  1F2Z A;  1F2Y A;  5IGC A;  1YJ9 A;  1KC8 C;  5LMU Q;  1NSN S;  1KAB A;  4Q0F A;  1QWY A;  1E3P A;  4HIO A;  3VYR A;  3H0G B;  3GTQ H;  3M4P A;  2KCM A;  1MJC A;  2CWP A;  3TP5 A;  3W1G A;  3H3V C;  4ZYS A;  2MJ8 A;  1E24 A;  5C3E B;  4RHR A;  1K8M A;  4K8I A;  1Y1V G;  2B29 A;  4BY7 G;  1O7L A;  2HIX A;  1MGS A;  3EBE A;  1IBM L;  4X66 L;  1CT1 D;  4PG3 A;  3HOV G;  1I50 B;  2OT2 A;  3K81 C;  2BH2 A;  4DU9 A;  2AQ3 B;  5E4W C;  2MFI A;  3M4Q A;  1VQG A;  1RTN A;  3TME A;  1D6E C;  1E2W A;  2ES2 A;  1FGU A;  3VA7 A;  1N34 Q;  2B8F A;  4PV1 C;  3LGJ A;  4DV4 L;  3S2D B;  3M85 A;  1HZC A;  5IOD A;  3TEH B;  2IPK D;  4OO1 I;  1GJX A;  2K50 A;  3OMG A;  4OGQ C;  4OON A;  1J5E Q;  1IBK Q;  1WTP A;  1PH7 A;  2AMC B;  2E2J H;  1HUM A;  3M7N A;  2UXB Q;  2EY5 A;  4FXG C;  3NEN A;  2CH4 A;  1C0A A;  1A15 A;  1OTC A;  2A1A A;  4K8J A;  1RKN A;  4XIG S;  5EKK A;  5A2Q E;  4DR5 Q;  3TS0 A;  5HGQ A;  4ZKB B;  3UE0 A;  4ODG A;  2IWH A;  4DV2 L;  5T1G A;  3JC6 6;  4ZUI A;  2RHS B;  2NN6 H;  2VB3 X;  1NUC A;  2K5N A;  5LHY 1;  4DV1 L;  2PQA A;  3BS1 A;  4C3H H;  1E0B A;  3I70 A;  1QJO A;  2NB0 A;  3C1E A;  4TRD A;  1WTX A;  1G2T A;  1BQQ T;  1JQY D;  1B50 A;  2VZA A;  1K73 C;  1ZKO A;  2D2C C;  5J1Z A;  2MO0 A;  3ERO A;  1GHK A;  2HIV A;  5KYL A;  1TY2 A;  1VQ8 A;  4A76 A;  1B3Q A;  2JA8 B;  1J5E L;  2XRS D;  3CU7 A;  4DPG A;  1SAP A;  3K6O A;  4IFD I;  1H9R A;  4FDB A;  5I2X A;  3Q6S A;  4A3C G;  3W2D A;  4MZ9 A;  4FF2 A;  3VR6 A;  2Z6B A;  3NTK A;  2NTS A;  3BYY B;  3X3M A;  2IY5 B;  1ML0 D;  5HUR A;  1I3Q H;  3VYT A;  1PHJ A;  4HIK A;  4KTA A;  1K8O A;  1WTQ A;  4XT3 B;  4FO2 A;  5CGK A;  5BN3 A;  1FNV A;  5M5X H;  4A3J H;  3PIO A;  2K5H A;  2F0G A;  2K01 A;  3ND8 A;  3I2Z A;  4ZKC B;  3GP7 A;  1MSG A;  2NVX H;  1HR0 W;  1SJE D;  3D6C A;  1KTK A;  3HG9 A;  4ABN A;  2OCE A;  5IP7 H;  1XPO A;  3E6Z X;  3NQI A;  4GLA C;  3A54 A;  1U0L A;  3S14 H;  2M00 A;  5FLX E;  4JW0 A;  1SEB D;  1STN A;  3EA6 A;  1YI2 A;  1WD0 A;  3TP6 A;  3HOW H;  3AB9 A;  4A3E H;  1ONL A;  4A3D H;  1CM9 A;  4MTN A;  5ELD A;  1EZ6 A;  2QF7 A;  4BBS B;  4HN7 A;  1TWA B;  4ME3 A;  5JEA J;  1A63 A;  3UDF A;  1LTR D;  1QE6 A;  4JI6 L;  4I7Z C;  3JAM L;  1G6P A;  4JK1 C;  1PA6 A;  1H9J A;  4OO1 H;  3H94 A;  1NNX A;  2R7Z G;  4A3M H;  2F0F A;  2VY3 A;  4QIW E;  1HR0 Q;  1VQI A;  5A35 A;  4JV5 L;  1VF5 C;  1T5X D;  1HFN A;  1MBY A;  3CQZ H;  1D2B A;  3HOZ H;  3NHH A;  3MXN B;  1SFO H;  1G6Z A;  2BDN A;  1YBY A;  1B9M A;  2WAQ B;  2C9O A;  4ZCK A;  1A3V A;  2JN4 A;  1I4P A;  2H5X A;  4A3I G;  2EYL A;  1AW7 A;  5KEE A;  3AYH B;  4DR1 Q;  4ALP A;  4DR4 L;  1LM0 A;  4HAE A;  4F87 A;  2GA4 B;  2K14 A;  2DY7 A;  2E5L L;  3GTK H;  2KJX A;  1IZ6 A;  2O4X A;  4Q5V A;  4B3R L;  1BUV T;  1O7Y A;  2BH8 A;  1SNM A;  4KI0 A;  2JE6 I;  3FDT A;  2HQE A;  4KKU A;  2CW0 C;  4PMB A;  2F0W A;  1UNS A;  3V05 A;  2BA0 A;  3B6Y A;  3L2P A;  1TXY A;  3MXG A;  3CHB D;  5J3B A;  3A7A B;  2ZTD A;  2WP8 J;  3KF8 A;  1TWG B;  2CCZ A;  2Z1C A;  3PUY A;  2B2W C;  4DK1 A;  1MHW C;  4HIM A;  4JI8 L;  4K5X A;  3SGI A;  2F4V L;  1LYL A;  2SNM A;  2A5H A;  1H95 A;  4DAM A;  4JI7 Q;  3HKZ B;  4C56 C;  4A3K H;  1D5M C;  4DR4 Q;  4NB3 A;  2KA7 A;  1EWH A;  2Q8I B;  3V2T A;  1PH9 A;  3CCJ A;  5IYB H;  3D6W A;  4UP8 A;  4DR3 L;  1AE3 A;  4B3R Q;  3DWA A;  1W6J A;  4QUF A;  3D4W A;  3NBI A;  1EYC A;  2QEX A;  4X65 Q;  2VNU D;  3NEM A;  1D1I A;  1XPU A;  2X6G A;  5GRO A;  1IBL L;  3BYT B;  1JB7 A;  4QUC A;  3CCE A;  2R93 H;  1PH2 A;  3F2U A;  3PCO B;  3CMA A;  4DV3 Q;  5FKA C;  5M3F G;  3FP9 A;  4YY3 Q;  1V1P B;  3NSW A;  4RCN A;  1BVS A;  1Q1E A;  1A2T A;  3S17 H;  3FMC A;  3KDF A;  1CQF A;  1K3B C;  2PI2 E;  5DAU A;  3DWQ A;  3RLF A;  4JI8 Q;  5D65 A;  4LFC L;  1J9O A;  1GOZ A;  2LMC B;  3SR1 A;  4MTK A;  1AE2 A;  3HKZ G;  3R3O A;  4JI0 Q;  2ENB A;  3ITP A;  3S16 B;  1HA6 A;  1HPC A;  4YCV A;  3ULL A;  1I94 L;  3VDY A;  1I6H H;  4XYQ A;  2NVQ B;  3AFQ A;  3I4N H;  4PZ6 A;  2UUA Q;  1TWC B;  1TS5 A;  4RH6 A;  2NYZ D;  4FF4 A;  3S9W A;  5DM6 3;  2EJF C;  1SND A;  2PZW A;  4A93 B;  1K0R A;  4H13 C;  2A6E D;  2ZJQ A;  4LF4 L;  5IT9 L;  4BBS H;  1YNN D;  2F0K A;  2DNE A;  3T53 B;  4LF7 L;  4GKK Q;  4GNX C;  4G7H C;  1BBU A;  1YHA A;  1ZEQ X;  4R4O A;  5E4X A;  1LT4 D;  3OSO A;  1S5C D;  1BBX C;  4JI3 Q;  5FLX L;  4JI5 Q;  3SK4 A;  1GXD C;  1VMP A;  2LXJ A;  3NPP A;  4FVM A;  2E2I H;  4C2M B;  3T51 B;  2J7Z A;  4LUO A;  1IL2 A;  1CSQ A;  5LMN W;  5ELB A;  1SRU A;  1EQR A;  3ND9 A;  2WAQ E;  3F2B A;  1JR0 D;  4DUZ Q;  2F0S A;  1EL0 A;  3HOY G;  3NK9 A;  2WAC A;  4GOP A;  3RN5 A;  3J7A F;  2CWA A;  1X65 A;  2HD3 A;  4DXG A;  3FVQ A;  3MVV A;  1WCM H;  4J1M A;  4O1N A;  1X54 A;  2KUM A;  4JOI C;  1L1O A;  2K28 A;  5M3F B;  3TDQ A;  3BDL A;  4K14 A;  1RIP A;  3EVQ A;  3F2D A;  2XNA C;  2QDL A;  5BN5 A;  3E9H A;  3TS2 A;  4GKK L;  4RWS C;  2K5V A;  1CKN A;  1SXT A;  3A5U A;  4HMJ A;  3M7G A;  1HXY D;  1GD7 A;  4BBS G;  4JI3 L;  1XNQ L;  5IGB A;  2B2W A;  1VCI A;  4EQN A;  3PO2 B;  3L3O C;  3UI2 A;  2BE5 C;  2RSN A;  3URY A;  4DXF A;  4AQY Q;  2F0H A;  1JOK A;  1EQT A;  1HZ9 A;  3AQQ A;  4FXK C;  1D7Q A;  4P75 A;  4LUV A;  1Q8K A;  1YJN A;  2JEA I;  1TKW B;  2JQO A;  3K59 A;  3J81 i;  2XWJ B;  2ZTE A;  3KDF B;  1KD1 C;  3KOJ A;  4GLV B;  2NVT H;  1GM5 A;  2UXD Q;  4A3I H;  1HHV A;  1T9H A;  2VS1 A;  1Y1V B;  3K80 C;  1MJE A;  1ESR A;  1MD2 D;  2MHV A;  3PUW A;  4HJ5 A;  3HOY H;  1TII D;  4R4T A;  1JWU D;  4IPC A;  4J15 A;  3J7A V;  3QR8 A;  2WB1 E;  4WJW A;  3VR4 A;  1KIX A;  3MXP A;  1Y14 B;  5J22 A;  3MAQ A;  1WTW A;  4DA2 A;  3Q24 A;  3F1Z A;  3PF4 A;  4X66 Q;  3I91 A;  2QCP X;  4KV6 A;  3NUC A;  4DAP A;  2EVB A;  2NN6 G;  4PMW A;  2D0O A;  2RHQ B;  1VQ4 A;  3G7L A;  1AZP A;  4ILW A;  3NE5 B;  1G8Z D;  1SYC A;  2R61 A;  2R92 H;  1VQF A;  3I55 A;  4A3D B;  1Q7Y C;  3H09 A;  4C1N I;  1KNA A;  1Q1B A;  5IWA Q;  4HID A;  2AQ1 B;  4AQY L;  3O13 A;  3K57 A;  1N34 L;  2R7Z H;  5IE8 A;  1SNQ A;  4JI4 Q;  1KHI A;  2F0P A;  3PO2 G;  1YZ6 A;  1EIY B;  1T5E A;  2Z6K A;  1JC7 A;  3U50 C;  4R4C A;  3I90 A;  4DNT B;  2J0T D;  2CFM A;  3I4M B;  1R4Q B;  4A3B B;  3R2I A;  2R3Z A;  2Z4I A;  2O5J C;  3CQZ B;  1O78 A;  3R2T A;  4X64 Q;  1JE5 A;  5E1F A;  1SFO B;  1QNK A;  3ERQ A;  5I6W A;  2XWB B;  1II3 A;  2DY8 A;  4TSS A;  2YU9 H;  4GOP B;  2IX1 A;  5AFW A;  1B2T A;  1JOO A;  3TRZ A;  2IX0 A;  3RZO B;  1BO0 A;  2JYO A;  2JA7 G;  3W1B A;  3J80 E;  4HR7 B;  4DV1 Q;  2R93 G;  4DV5 Q;  1ROD A;  1XXG A;  2ZXO A;  3H91 A;  3MEH A;  2XTI A;  1X55 A;  2E75 C;  3H3V H;  4KMU C;  2JA5 B;  1A3U A;  3M4Y A;  4C2M H;  1B8A A;  1SMY C;  4POF A;  2B2V A;  1XTD A;  5KNB A;  4DUY L;  2PO4 A;  3TP7 A;  3G71 A;  3Q8D A;  3GTM B;  2ICE C;  4YHH Q;  4CJ2 C;  4IZ8 A;  3KJP A;  4IJH A;  2VW9 A;  3QOL A;  1SR3 A;  2JP1 A;  4DFA A;  1OXU A;  5I9P A;  1JJC B;  4BWG B;  1FVI A;  2J4X A;  1NY4 A;  3J81 c;  1WCM B;  1IBM Q;  2AWN A;  3IRB A;  2IJ0 A;  2E2D C;  1DJR D;  2WKC A;  3RNU A;  1XMO Q;  4A3K B;  1QG7 A;  2XVS A;  1PH1 A;  3JAM E;  4NP5 A;  3J81 L;  2YTX A;  3CRK C;  3MFY A;  2DUD A;  3CCL A;  1WYD A;  4I7A A;  5LMN L;  1C7Y A;  2NVY H;  1HTL D;  3I8Z A;  1Q8I A;  1PTO C;  1IYJ B;  1AFP A;  3A5Z B;  1AH9 A;  2WB1 G;  2MPM A;  1M4V A;  4ZK9 B;  1IBK L;  4IPG A;  2OTL A;  2ZM6 L;  1QUQ B;  4JBW A;  5A2Q L;  1CQV A;  3RMH A;  1BXT A;  4YHH L;  3S17 B;  4JYA Q;  1I6V C;  2ICI A;  1PFS A;  3S1M B;  4K5W A;  3WOF A;  2ATW A;  4BXX H;  1YNJ C;  4A3L G;  4IN3 A;  4H0L C;  3F2C A;  2K5D A;  4ZLT F;  3SEB A;  3STB D;  5IGG A;  3PUV A;  1SMY D;  2UXC Q;  4IPD A;  4YCU A;  2B2Y A;  1I6H B;  1XWE A;  4RKL A;  1XPR A;  3MXU A;  2HDM A;  3N6R A;  3IAY A;  4X3K A;  4IFD H;  1QCB D;  2RDH A;  2JK8 A;  2RSO A;  2VUM B;  2JA7 B;  2Z6K C;  2N8N A;  4A4I A;  2YTY A;  1PH4 A;  2BDO A;  3K7A H;  1GKH A;  2GN5 A;  3MZ5 A;  4NW2 A;  2DGY A;  2NTT A;  1V9P A;  4DR2 L;  4G4K A;  5IGD A;  3D0F A;  3HOX B;  2RA4 A;  2FHT A;  4H44 C;  4ZRZ A;  4X6A H;  4HMI A;  1DYQ A;  3S1Q B;  3OMC A;  5BR8 Q;  1LAC A;  4MHE A;  5C5L A;  5FO9 B;  4IOA A;  4J6H A;  4HCE A;  4N8F A;  3CD6 A;  2A8V A;  1B44 D;  2EYJ A;  4RGO S;  2P5Z X;  2UXC L;  2H1E A;  2B39 A;  4BXX G;  1WTO A;  1CK1 A;  1S4Z A;  4UAI A;  3KF8 B;  1EY5 A;  1GUG A;  3SDZ A;  1L0Y B;  1F2L A;  4X3T A;  1IHZ A;  4BA2 I;  5ELN A;  2XRQ D;  1U4M A;  1PTO H;  4BY7 H;  1N32 L;  3HOZ G;  3J7Y W;  4B08 A;  2F0D A;  3TQY A;  2MNA A;  1I3Q B;  1LTT D;  5M5Y B;  1PVO A;  1A0I A;  1LTS D;  4DR3 Q;  1HRJ A;  1L2F A;  2N88 A;  1ENA A;  3DUZ A;  4NXN Q;  1VQD A;  5KIX A;  1JOQ A;  3ICE A;  1G29 1;  4LFB L;  4QF4 A;  2JA9 A;  4C3I H;  2B2V C;  1DXM A;  5C4J B;  3K5N A;  1K3R A;  1CA5 A;  4LF8 Q;  3P7J A;  1ICF B;  1A62 A;  1YVC A;  1DCZ A;  2N3S A;  3EIV A;  3C3L A;  2LS0 1;  1ZYR C;  2SDF A;  2AUK A;  5ELC A;  1U5K A;  3CPF A;  3HOU B;  4R9W A;  4CKB A;  5BR8 L;  4DV0 L;  3K0X A;  4F8M A;  3C46 A;  1FJG Q;  4TKO B;  1A8V A;  4LW1 A;  1VQC A;  3HOW B;  1L0X B;  2AKW B;  4X3U A;  4JI2 Q;  1M8A A;  1K83 H;  2K75 A;  1VQK A;  1XTC D;  1TWA H;  5JVH 3;  3ZJY C;  4KD3 A;  2AUJ D;  2NVT B;  2M2L A;  5FK9 C;  2L15 A;  3NP8 A;  4BS9 A;  1TWH B;  4RGN A;  1VQP A;  1PMR A;  4CHT B;  4YWL A;  2O5I C;  3KF6 B;  2XGT A;  4HCS A;  4B9X A;  2VUM G;  1B3A A;  1ICW A;  4A3E G;  1G2S A;  2F0J A;  2XN9 C;  1V1O A;  2EPB A;  4KN7 C;  5C4Z A;  4A3K G;  4DK6 C;  1NJI C;  5C0X J;  3DXJ C;  1ENF A;  1VQJ A;  4GNX A;  4LWC A;  4LAA A;  4PNY A;  4A3F H;  1JJG A;  3HFZ B;  5IYD H;  2L55 A;  4WRD A;  4DV0 Q;  3ULP A;  1U4L A;  3BU2 A;  2BCO A;  1YHQ A;  1FJG L;  1LTA D;  3QWN A;  2NN6 I;  2EJG C;  4JI5 L;  3I3C A;  3KUP A;  3KBG A;  2F0M A;  3JAM i;  5ELF A;  5IT9 c;  5CV8 A;  2F4I A;  4IUR A;  4OWX B;  3I4M H;  3NEL A;  1WTH A;  2NBF A;  1PH6 A;  2E74 C;  4B3M L;  3UDI A;  1PV4 A;  1YNN C;  1FYC A;  4IQZ A;  2VB2 X;  4P73 A;  5FOB B;  2A68 D;  2PYK A;  4R4I A;  5C5M A;  1KAW A;  2K6A A;  4XYO A;  2K5Q A;  2JA7 H;  1WI5 A;  1BNZ A;  1C9O A;  1X3F A;  3FKI H;  3RZO H;  4CDD C;  1HQR D;  3J80 i;  1IBL Q;  3T1H Q;  5C3X A;  1E2V A;  2B2T C;  2HDL A;  2QGQ A;  4QJF A;  5EAY A;  1GUN A;  3WWV A;  3I56 A;  5CV5 A;  1CKO A;  3HOW G;  1AZQ A;  3I7F A;  4RA8 A;  1I4G A;  2HCC A;  2UUC Q;  1VQN A;  3BZC A;  5EKL A;  1SYB A;  1G91 A;  3GD7 A;  1PRT C;  4L6T B;  1WVL A;  2EQS A;  2V4D A;  4A3L H;  5K5P A;  4IJL A;  4QIW B;  2PCF B;  2WII B;  3S1N B;  5I2Y A;  4KHZ A;  3J7A 5;  2KCT A;  2Z0S A;  4KHP Q;  1NE3 A;  3KFU A;  5EPK A;  2HHH Q;  3GTP B;  2PW7 A;  2D62 A;  3A56 A;  4IUU A;  2F3W A;  4KKT A;  4JBM A;  4XQN A;  2FMM A;  3J7Z C;  1PTO B;  4BY7 B;  2SEB D;  4EGV A;  3OYY A;  1WD1 A;  4A93 G;  5C44 G;  4NXM Q;  2K7V A;  1SMX A;  1CFM A;  4KY5 A;  1KLG D;  3S1R B;  1KDC A;  2A68 C;  3MA2 B;  1I4X A;  4CBV A;  2NVY B;  1KLU D;  3KF6 A;  4LF7 Q;  1QOH A;  3S16 H;  1Y8O B;  5L37 A;  1LTG D;  2UUB L;  1KDA A;  4DF7 A;  1K0S A;  5E7N A;  1UEB A;  3VA5 A;  3I4N B;  3NWT A;  3SXH A;  1F9R A;  5CC4 A;  5IYC G;  5CMD A;  4R4Q A;  5IGE A;  1LTI D;  1UUP A;  2I5M X;  5EKI A;  4KHP L;  1I50 H;  1PYS B;  1KDB A;  4UY8 C;  4UPA A;  1OXX K;  5LMU L;  2HHH L;  1YEZ A;  1H9M A;  1FD7 D;  1NR2 A;  2KBN A;  2EYO A;  3RLN A;  2EYM A;  4CDE C;  4HJ9 A;  4A75 A;  4LNQ A;  1FGB D;  4DR7 L;  4F88 A;  2KQ3 A;  2K52 A;  5C4X H;  2Z9H A;  2HQL A;  2ZTC A;  2VQE Q;  5GQO A;  3TN2 A;  2L1B A;  1HQM C;  4PQX A;  3T16 A;  1WTV A;  2NUC A;  4FF3 A;  2F0T A;  2KED A;  3E9I A;  4A3M G;  2E2J B;  1BOS A;  1CI3 M;  1F9Q A;  1V43 A;  1C8C A;  3DMU A;  2TMP A;  1HA5 A;  1BCP F;  3LX0 A;  3QO2 A;  4ZAI A;  4GS3 A;  4BY1 G;  3PO3 G;  4N8X 1;  1GHJ A;  3JAM c;  1Y8N B;  4LMQ D;  5M3M H;  5M3F H;  3CAM A;  4DV4 Q;  1DOK A;  4BBR B;  3T56 B;  3J81 E;  1RHP A;  2IT1 A;  4B3T Q;  4P74 A;  2WAQ G;  4WJ3 M;  2PQA B;  3S15 H;  3K5L A;  2ZXP A;  2R92 G;  4IFD J;  5COR A;  2UXD L;  2Q2H A;  1CKN B;  3BG3 A;  5IP9 G;  1ZXT A;  4POG A;  3TRE A;  3PO2 H;  5TSS A;  3ONA B;  2VQE L;  3T13 A;  1SE4 A;  3GTO H;  3HS0 C;  1DOL A;  1PXU A;  4DR5 L;  3CCV A;  2JA8 H;  2PQE A;  2Q8R E;  4HJ7 A;  4A3B G;  1O80 A;  5KNC A;  1HJP A;  4OXP A;  1JJ2 A;  4P72 A;  1SLJ A;  2EE1 A;  3U9O A;  5EQ0 A;  2GVB A;  3PGZ A;  4LUZ A;  3WOE A;  3OIQ A;  5LMN Q;  4A3I B;  1PZJ D;  1RDP D;  1EY9 A;  4L63 B;  1CA6 A;  1A3T A;  4CDF C;  1LAB A;  4IUN A;  4OEL B;  5C4J H;  3AMU A;  5C0X H;  4KD4 A;  2B2T A;  1NCV A;  2OXP A;  1QZG A;  2Q8T A;  3PIO 3;  2I5L X;  2NVX B;  2ZXR A;  3HOU H;  1AN8 A;  3TSS A;  3U58 A;  5JPM C;  2ZM6 Q;  1EYG A;  3PF5 A;  2OWO A;  2PZU A;  2X6L A;  3AU7 A;  1STA A;  2K4K A;  4NDX A;  1VQ5 A;  3H6M A;  1W3S A;  2X69 A;  1H9K A;  3OW2 A;  4H02 A;  4A3E B;  2EIF A;  1SYE A;  3TP8 A;  2PMZ B;  3A7L A;  1PRT B;  1SE8 A;  4RFB A;  4I65 A;  3DLL A;  3CPW A;  1D5Z C;  4N9T A;  2JA8 G;  5G3L D;  5EGT A;  1U4R A;  4DN4 M;  1QVF A;  4A3B H;  4UP7 A;  5M5W B;  1EU3 A;  1VQ6 A;  5M9O A;  5EJW A;  3GTQ B;  1TR5 A;  1RL2 A;  4RCO A;  3H15 A;  3E0J A;  1S5B D;  1EYD A;  1JCK B;  4O2D A;  4KY7 A;  3KLW A;  4DK0 A;  2YU9 B;  2K03 A;  4LJZ C;  1PZK D;  4GNX B;  2JA6 G;  1K28 A;  5JJI A;  4C3I G;  4DUY Q;  5FLM G;  3KLS A;  4C1N K;  4DR2 Q;  2AHO B;  4XQJ A;  3PMF A;  2B3G A;  1OXV A;  2CHB D;  4LFA Q;  2UU9 L;  3NTH A;  1XYI A;  1X9N A;  4R1J A;  3KLR A;  1BR9 A;  2DJF C;  3HKS A;  2KHS A;  4DV2 Q;  5C4X B;  2NWG A;  4HTH A;  1CZW A;  1Y69 U;  1PFB A;  1PRT D;  1NTG A;  3E5S A;  1OXT A;  2NZ1 D;  1TS4 A;  2FFK B;  4JVZ A;  5ISR A;  4IO9 A;  1RD9 D;  4EX5 A;  4NPS A;  3SE0 A;  3PSI A;  4A3G G;  4JI1 Q;  1F9P A;  1PFM A;  1TWG H;  4KK7 A;  1HCZ A;  1YJW A;  1VQ7 A;  4CJ0 B;  4QGU A;  1TT2 A;  2RQX A;  1VF7 A;  3S24 A;  1Q46 A;  1X6O A;  1ESF A;  1VQB A;  1LUZ A;  4UDU C;  5IP9 H;  1IKM A;  1I4Q A;  3QOJ A;  2KEC A;  1YHB A;  1VS0 A;  4UHV A;  5C0X I;  1HZA A;  2A69 C;  2FXQ A;  5AJ3 L;  4JYA L;  4B3S Q;  1L0W A;  2JA6 B;  4DAY B;  1IL8 A;  1SJH D;  2DN8 A;  1P16 A;  2HCI A;  2F3I A;  1GUW A;  1EFI D;  3UDX A;  1ENC A;  1K8A C;  1QZH A;  2K04 A;  5JOB A;  3S1N H;  2N49 A;  2IW3 A;  1NBW A;  3R93 A;  5IY0 A;  1VDZ A;  5C4X G;  3GTL B;  1HNZ L;  4KN4 C;  3GTP H;  1HH2 P;  1B1Z A;  3K5O A;  4QQB X;  3TBI B;  5I9O A;  5FJ8 H;  1TWF B;  4JI7 L;  1WOC A;  2EXD A;  1YIT A;  1WJJ A;  2D9U A;  2CQO A;  3FRP B;  4V19 0;  1EIG A;  5FO7 B;  3S1M H;  1SNO A;  1B53 A;  1KAA A;  2LXK A;  2D0P A;  3IKJ A;  3HRZ C;  4BA1 I;  3OPO A;  4BY1 H;  4AH6 A;  3S1R H;  4GN3 B;  2A73 B;  1E1T A;  5M3M G;  2F0E A;  4KY6 A;  5M5X B;  1EFW A;  4JI6 Q;  4S3S A;  2EY2 A;  4B3S L;  1UWV A;  4LF6 L;  4C3H G;  5DNF A;  1HR0 L;  1C4Q A;  1PYB A;  3D4R A;  1SYF A;  4O42 A;  4OO1 G;  3MEF A;  2MUY A;  1NMF A;  2EY1 A;  3CCU A;  3PIP A;  4QMG A;  2Z4H A;  2B2Y C;  4DV6 Q;  2I5H A; 
#chains in the Genus database with same CATH homology
 3ZJY C;  3M4O H;  3AEV A;  1L1O B;  1H95 A;  3UDG A;  4L5S A;  2KHJ A;  4DAM A;  4Y52 H;  2ALY B;  4JI7 Q;  2L15 A;  4K0K Q;  4DR1 L;  4A3K H;  4DR4 Q;  4NB3 A;  3HOX H;  2ASB A;  1I94 Q;  1N32 Q;  1VQP A;  1BBW A;  4YWM A;  2R7D A;  4MNO A;  2ID0 A;  1Q86 C;  5H1S E;  1VQL A;  4YWL A;  3S1Q H;  3KF6 B;  1PH9 A;  3CCJ A;  5IYB H;  2XGT A;  4UP8 A;  2R7F A;  4DR3 L;  1N36 Q;  2E5L Q;  1MKH A;  1AE3 A;  4DV7 L;  4A3E G;  2UUA L;  2VUM G;  4B3R Q;  1HNW L;  4NXN L;  3PUZ A;  2QEX A;  5JEA G;  4X65 Q;  4A3J G;  2VNU D;  1NMG A;  2JJQ A;  3NEM A;  4A3K G;  4DK6 C;  2KHI A;  5C44 H;  5GRO A;  1S40 A;  1NJI C;  3T1H L;  3K8A A;  1IBL L;  1M1K C;  5C0X J;  1YNX A;  1JB7 A;  3GTL H;  1K9M C;  3CCE A;  4LF4 Q;  1VQJ A;  4GNX A;  4A3F H;  4LWC A;  1PH2 A;  2R93 H;  1JJG A;  3HFZ B;  3PCO B;  1KRT A;  3CMA A;  4DV3 Q;  1GO3 E;  3T1Y L;  5IYD H;  5M3F G;  1Q81 C;  3FP9 A;  4YY3 Q;  4DV0 Q;  4C3J H;  3ULP A;  2PI2 A;  1BVS A;  3BU2 A;  1Q1E A;  2UUC L;  1YHQ A;  1O7I A;  2YTV A;  1FJG L;  3J81 j;  2NZH A;  1N9W A;  3UE1 A;  2NN6 I;  1G51 A;  4TQU S;  4JI5 L;  3KDF A;  3S17 H;  5M5Y H;  2PI2 E;  4LF9 L;  1VQH A;  2F52 A;  3RLF A;  4JI2 L;  4JI8 Q;  3JAM i;  1EWI A;  2E2H H;  5IT9 c;  4X62 L;  2F4V Q;  4QL5 A;  4LFC L;  4A3F G;  2UU9 Q;  1E7Z A;  1XMQ L;  4OWX B;  3I4M H;  3NEL A;  1AE2 A;  1UE1 A;  4JC0 A;  3HKZ G;  1PH6 A;  4B3M L;  3UDI A;  1PV4 A;  4JI0 Q;  3W5O A;  4K0K L;  3H0G H;  4DUZ L;  4P73 A;  4YCV A;  2YV5 A;  4EQ5 A;  3ULL A;  1I94 L;  2HT1 A;  2CKZ B;  3VDY A;  1I6H H;  4R4I A;  3KYH C;  3AFQ A;  3I4N H;  5C3E H;  1KAW A;  4PZ6 A;  2UUA Q;  3HOV H;  5C0X G;  4DV7 Q;  2JEB I;  4GLX A;  2Q2U A;  1HNW Q;  3RLO A;  2JA7 H;  2V1C C;  1D8L A;  1WI5 A;  1VQA A;  1C9O A;  1X3F A;  3FKI H;  3RZO H;  4X65 L;  3U4Z A;  1HZB A;  3J80 i;  2RCN A;  1IBL Q;  3T1H Q;  1K0R A;  1S72 A;  4NXM L;  3CC7 A;  2ZJQ A;  4LF4 L;  2QGQ A;  4QJF A;  5EAY A;  4BBS H;  3WWV A;  5FJ8 G;  3I56 A;  4HJA A;  2GVA A;  4JG2 A;  1CKO A;  4DV3 L;  3HOW G;  5GAG C;  5GAE C;  3I7F A;  4OWW B;  1BKB A;  4UP9 A;  1OXS C;  4YY3 L;  4GNX C;  4LF7 L;  4GKK Q;  1BBU A;  3CF5 A;  2UUC Q;  1M90 C;  1YHA A;  4R4O A;  1VQN A;  1TWH H;  3FHW A;  3BZC A;  4XTC S;  4DNI A;  4A3C H;  2UUB Q;  1QVC A;  4JI3 Q;  4DR6 Q;  3EN2 A;  4IOC A;  4JI5 Q;  1EQQ A;  4JBK A;  3S2D H;  4WJ4 A;  2LXJ A;  3GD7 A;  3CME A;  2E2I H;  3CCS A;  2EQS A;  4X62 Q;  4LFC Q;  4LUO A;  1IL2 A;  4A3L H;  4RMF A;  2Y0S E;  1CSQ A;  4GN5 A;  3GTJ H;  3DM3 A;  5LMN W;  1XMQ Q;  4IJL A;  1SRU A;  1EQR A;  2WAQ E;  4B3M Q;  4KHZ A;  1VQE A;  3STB C;  2KCT A;  3F2B A;  2Z0S A;  4DUZ Q;  2JA5 G;  4JI0 L;  1N33 L;  2YYZ A;  3J7A 5;  1NE3 A;  4KHP Q;  3HOY G;  3KFU A;  4GOP A;  2VL6 A;  3HOX G;  2HHH Q;  3CCM A;  3RN5 A;  1UE5 A;  2RF4 A;  3G4S A;  3ERS X;  2CWA A;  1L1O C;  2D62 A;  1VQM A;  1LTL A;  1X65 A;  4JBM A;  1WCM H;  3J7Z C;  1X54 A;  2B63 H;  4JOI C;  1L1O A;  3OYY A;  4A93 G;  3RZD H;  4DKA C;  4LF5 Q;  5C44 G;  4NXM Q;  5JJL A;  1SMX A;  1RIP A;  2C35 B;  2LSS A;  3F2D A;  1XJV A;  1Y1W G;  2AWO A;  5DLQ E;  3E9H A;  3KF6 A;  4LF7 Q;  3TS2 A;  4GKK L;  5FLX c;  3D31 A;  5ELO A;  2K5V A;  3S16 H;  1CKN A;  3A5U A;  1UE7 A;  2Y0S G;  2UUB L;  2NVQ H;  1GD7 A;  4BBS G;  5K36 G;  4JI3 L;  1PH5 A;  4DR6 L;  1Z47 A;  1XNQ L;  5E7N A;  1UEB A;  1VCI A;  1X3E A;  2PNH A;  4OX9 Q;  5IYC G;  3L7Z C;  4R4Q A;  3RR5 A;  4HJ8 A;  3U4V A;  4GOP C;  5IWA L;  4AQY Q;  1EUJ A;  1XPU A;  5GAH C;  1HZ9 A;  1XNR L;  2I5M X;  3AQQ A;  4KHP L;  1I50 H;  1PYS B;  4UY8 C;  1N33 Q;  4P75 A;  1D7Q A;  4UPA A;  4LUV A;  4B3T L;  1Q8K A;  1OXX K;  1YJN A;  2JEA I;  5LMU L;  2PMZ E;  1YIJ A;  1YEZ A;  2HHH L;  2JQO A;  4OWT B;  2KBN A;  3RLN A;  3J81 i;  3KDF B;  2ZTE A;  1KD1 C;  2UXD Q;  3KOJ A;  4GLV B;  2A19 A;  1GM5 A;  2NVT H;  4A3I H;  4RG1 A;  1T9H A;  2VS1 A;  1V1Q A;  3K80 C;  4HJ9 A;  4A75 A;  1MJE A;  4LNQ A;  4HJ5 A;  1B70 B;  3PUW A;  4P71 A;  3HOY H;  4DR7 L;  4R4T A;  2K52 A;  4IPC A;  2N78 A;  4J15 A;  4X64 L;  3RN2 A;  4L5R C;  4DK3 C;  2WB1 E;  1KIX A;  5C4X H;  2VQE Q;  2HQL A;  2ZTC A;  2I0Q A;  3F8T A;  5GQO A;  4LF5 L;  1Y14 B;  5IP7 G;  1E22 A;  4A3G H;  2BA1 A;  3BZK A;  1CUK A;  3F1Z A;  3PF4 A;  4X66 Q;  2MO1 A;  3E9I A;  1P8L A;  4A3M G;  4JBJ A;  2NN6 G;  4PMW A;  2D0O A;  3GO5 A;  2RHQ B;  1VQ4 A;  1V43 A;  3GTM H;  5GAD C;  4QY7 A;  3CC4 A;  3I4N G;  1XNQ Q;  4DV5 L;  1KL9 A;  1IXR A;  4OX9 L;  1WFQ A;  2R92 H;  1GVP A;  1VQF A;  3I55 A;  1Q7Y C;  3PV0 A;  4GS3 A;  4BY1 G;  3PO3 G;  3J80 c;  4AYB G;  3JAM c;  4HID A;  1Q1B A;  3FKI G;  5IWA Q;  1PH3 A;  5M3M H;  4L5T A;  4AQY L;  2OQ0 A;  1N34 L;  2R7Z H;  5IYB G;  5IE8 A;  5M3F H;  1Q82 C;  3CAM A;  1UE6 A;  4JI4 Q;  1KHI A;  1XNR Q;  4DV4 Q;  3PO2 G;  1YZ6 A;  1EIY B;  2Z6K A;  3U50 C;  2IT1 A;  4R4C A;  1YJ9 A;  4B3T Q;  4P74 A;  1KC8 C;  2WAQ G;  5LMU Q;  1QVG A;  2JA6 H;  4WJ3 M;  2PQA B;  3S15 H;  1JMC A;  2R92 G;  2CFM A;  3CC2 A;  5FLM H;  4JOI A;  4IFD J;  1E3P A;  2Q2H A;  2UXD L;  4HIO A;  1CKN B;  4IFD G;  1J6Q A;  3GTQ H;  4DR7 Q;  3M4P A;  2KCM A;  5IP9 G;  1MJC A;  3G48 A;  2CWP A;  1JE5 A;  4X64 Q;  1W2B A;  3W1G A;  4POG A;  3TRE A;  3PO2 H;  2VQE L;  1E24 A;  3H3V I;  3GTO H;  4BBR G;  1Y1V G;  4GN4 B;  2YU9 H;  2B29 A;  4GOP B;  2IX1 A;  4BY7 G;  4DR5 L;  2JA8 H;  3CCV A;  1IBM L;  2HIX A;  3EBE A;  4X66 L;  1TWF H;  4HJ7 A;  2IX0 A;  4PG3 A;  3TRZ A;  3HOV G;  4A3B G;  1HJP A;  1VQO A;  4OXP A;  1JJ2 A;  3W1B A;  2JA7 G;  4P72 A;  1SLJ A;  4DV1 Q;  2R93 G;  3K81 C;  4YCW A;  2BH2 A;  4DV5 Q;  2GVB A;  2MFI A;  3M4Q A;  1VQG A;  3PGZ A;  4LUZ A;  5LMN Q;  3HOU G;  1Y1V H;  3OTO L;  3GTG H;  3CP0 A;  2ES2 A;  1FGU A;  2WFW A;  3CCQ A;  4GKJ Q;  1N34 Q;  2XTI A;  5C4J H;  1X55 A;  3LGJ A;  4JI4 L;  1S3O A;  3H3V H;  4DV4 L;  1X56 A;  3M85 A;  4A3D G;  1HZC A;  3TEH B;  4AYB E;  2VQF L;  4C2M H;  1QZG A;  1B8A A;  4OO1 I;  2K50 A;  4OON A;  4POF A;  2I5L X;  1J5E Q;  1XTD A;  3HOU H;  1IBK Q;  2KEN A;  2B63 G;  4DUY L;  3U58 A;  1PH7 A;  2AMC B;  2ZM6 Q;  1EYG A;  2E2J H;  1KXL A;  3PF5 A;  3M7N A;  2OWO A;  2UXB Q;  2VUM H;  3G71 A;  3Q8D A;  3NEN A;  2K4K A;  2Q2T A;  4YHH Q;  1VQ5 A;  3KJP A;  4IJH A;  3ER0 A;  2VW9 A;  1C0A A;  1SR3 A;  2OTJ A;  1Q12 A;  1W3S A;  1OTC A;  2A1A A;  3OW2 A;  1OXU A;  1VQ9 A;  4H02 A;  1JJC B;  4XIG S;  2EIF A;  1FVI A;  1NY4 A;  3J81 c;  3ULJ A;  4DR5 Q;  3TS0 A;  5HGQ A;  1IBM Q;  2AWN A;  3IRB A;  3UE0 A;  3K7U C;  3KJO A;  3I4O A;  4DV2 L;  5IYD G;  3RNU A;  1SE8 A;  3JC6 6;  1XMO Q;  2RHS B;  4BBR H;  3DLL A;  3CPW A;  1PH1 A;  2K5N A;  2YTX A;  2JA8 G;  4DV1 L;  2PQA A;  2DUD A;  3CCL A;  1WYD A;  3A74 A;  1QVF A;  5LMN L;  4A3B H;  4C3H H;  4UP7 A;  1HNX L;  1C7Y A;  1VQ6 A;  2NVY H;  3OTO Q;  3CXC A;  3PO3 H;  1RL2 A;  3H15 A;  1IYJ B;  4O0A A;  3A5Z B;  1AH9 A;  2VZA A;  2WB1 G;  1K73 C;  4GKJ L;  2MO0 A;  3I4M G;  2ZJP A;  4O2D A;  3CCR A;  2HIV A;  1ASY A;  3NBH B;  3KLW A;  1VQ8 A;  2VQF Q;  4A76 A;  4GNX B;  2JA6 G;  1J5E L;  3A0J A;  1IBK L;  5JJI A;  4IPG A;  4PZ7 A;  4DPG A;  5IYC H;  5FLM G;  4DUY Q;  2OTL A;  4IFD I;  2ZM6 L;  1QUQ B;  2IHF A;  4DR2 Q;  4FDB A;  2UXB L;  2AHO B;  4A3C G;  1E1O A;  1I5F A;  4JBW A;  4MZ9 A;  4JYA Q;  4YHH L;  2B3G A;  2IY5 B;  1PFS A;  4IPH A;  1OXV A;  1I3Q H;  1MIU A;  4LFA Q;  1PHJ A;  1KQS A;  2UU9 L;  4HIK A;  1PH8 A;  4KLK A;  2ATW A;  4BXX H;  4JV5 Q;  4A3L G;  3F2C A;  1X9N A;  4R1J A;  3STB D;  2E8G A;  5HY6 A;  3HKS A;  4TVA B;  3CW2 C;  3PUV A;  4DV2 Q;  2JA5 H;  1XMO L;  5M5X H;  2QA4 A;  4A3J H;  2UXC Q;  1X3G A;  4IPD A;  2K5H A;  4YCU A;  3PIO A;  1HNZ Q;  1B7Y B;  2Q2I A;  3I2Z A;  1KRS A;  2NVX H;  2IHE A;  1HR0 W;  1XPR A;  1NTG A;  1HNX Q;  1OXT A;  1DGS A;  2OCE A;  3GDE A;  2JK8 A;  4YWK A;  1EIF A;  4IO9 A;  5IP7 H;  4APV A;  4EX5 A;  4NPS A;  1XPO A;  3PSI A;  4A3G G;  2Z6K C;  4GLA C;  4JI1 Q;  1U0L A;  3S14 H;  1TWG H;  2N8N A;  1YJW A;  4A4I A;  1YI2 A;  1N8R C;  1VQ7 A;  1EOV A;  3HOW H;  2YTY A;  3M3Y H;  4QGU A;  1PH4 A;  1K8G A;  3K7A H;  4A3E H;  4A3D H;  1GKH A;  4MTN A;  3S24 A;  1Q46 A;  3L0O A;  1X6O A;  1VQB A;  1SN8 A;  1LUZ A;  2GN5 A;  4ME3 A;  5JEA J;  5IP9 H;  1Y1W H;  1FL0 A;  4LFB Q;  1A63 A;  1YHB A;  1VS0 A;  2DGY A;  3UDF A;  1R9T H;  4LF8 L;  5C0X I;  1HZA A;  1V9P A;  4DR2 L;  4JI6 L;  3S2H H;  2FXQ A;  3D0F A;  1G6P A;  2OQK A;  5AJ3 L;  4JYA L;  1PA6 A;  4B3S Q;  1L0W A;  3M9B A;  4LF6 Q;  4AIM A;  4X6A H;  2R7Z G;  4DAY B;  5M5W H;  4A3M H;  2VY3 A;  4QIW E;  4Y7N H;  5BR8 Q;  1P16 A;  1HR0 Q;  1VQI A;  4LFA L;  2F3I A;  5C3E G;  4IOA A;  3UDX A;  4JV5 L;  3CD6 A;  1Z9F A;  2A8V A;  1K8A C;  3CQZ H;  1QZH A;  3S1N H;  3HOZ H;  2N49 A;  3MXN B;  1NBW A;  1SFO H;  5IY0 A;  5C4X G;  2UXC L;  1HNZ L;  1YBY A;  4BXX G;  3HKZ E;  1WCM G;  4DV6 L;  3GTP H;  1HH2 P;  4QQB X;  1CKM A;  3KF8 B;  5FJ8 H;  2H5X A;  1QUQ A;  4A3I G;  4JI7 L;  4BA2 I;  5ELN A;  1WOC A;  3AYH B;  4DR1 Q;  2EXD A;  1YIT A;  5JJK A;  1WJJ A;  4ALP A;  4BY7 H;  1LM0 A;  3HOZ G;  4JI1 L;  4DR4 L;  1N32 L;  3TQY A;  2CQO A;  2MNA A;  3S1M H;  2K14 A;  2LXK A;  1PVO A;  2D0P A;  1A0I A;  1N36 L;  2E5L L;  3E0E A;  4BA1 I;  1L2F A;  4DR3 Q;  3GTK H;  1IZ6 A;  4BY1 H;  4B3R L;  3AFP A;  4L5Q A;  4AH6 A;  3S1R H;  1VQD A;  4NXN Q;  2BH8 A;  4KI0 A;  3ICE A;  2JE6 I;  1G29 1;  4GN3 B;  4JCV E;  1E1T A;  5M3M G;  4LFB L;  2JA9 A;  4C3I H;  4LF8 Q;  1K3R A;  1EFW A;  1CSP A;  4JI6 Q;  1YVC A;  1A62 A;  3EIV A;  2N3S A;  5AJ3 Q;  4B3S L;  2BA0 A;  1UWV A;  2R6G A;  3B6Y A;  4PZ8 A;  3L2P A;  3G6E A;  4LF6 L;  1JT8 A;  1TXY A;  1U5K A;  3T1Y Q;  3CPF A;  3PUX A;  5BR8 L;  1HR0 L;  5J3B A;  4DV0 L;  1PYB A;  3K0X A;  1TWC H;  2WP8 J;  2ZTD A;  2ZJR A;  1FJG Q;  2MQH A;  1A8V A;  1ASZ A;  2NZO A;  4LW1 A;  3BJU A;  3MEF A;  2CCZ A;  4OO1 G;  1NMF A;  3PUY A;  1VQC A;  4LF9 Q;  3CCU A;  3PIP A;  2AKW B;  1SRO A;  4JI2 Q;  4HIM A;  3H0G G;  4JI8 L;  1K83 H;  4A93 H;  3SGI A;  2K75 A;  1VQK A;  2F4V L;  4DV6 Q;  1TWA H;  2I5H A;  1LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...