1PFSA

Solution nmr structure of the single-stranded dna binding protein of the filamentous pseudomonas phage pf3, minimized average structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PF3 SINGLE-STRANDED DNA BINDING PROTEIN
publication title Solution structure of the single-stranded DNA binding protein of the filamentous Pseudomonas phage Pf3: similarity to other proteins binding to single-stranded nucleic acids.
pubmed rcsb
source organism Pseudomonas phage pf3
total genus 9
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pfsA00
1IBMQ 1AH9A 3PV0A 3S2HH 1JMCA 1L1OB 4DR4Q 1E3PA 4KHPL 1YJ9A 2PI2A 4DR1Q 4NXMQ 2R92H 4J15A 4YHHL 4A3DG 2Q2IA 1I3QH 2LXKA 3SGIA 1HNZQ 3ICEA 3M3YH 4R4OA 3U50C 1X9NA 1QUQA 1Z9FA 4UP9A 4X62L 1PH7A 1XNRQ 1OXVA 5E7NA 3HOWG 2Z0SA 1KXLA 4DR5Q 1N34Q 3ZJYC 1XJVA 4BBRH 4LF5Q 2NVQH 2N8NA 3CAMA 4P75A 4GOPB 4LFAL 1X6OA 4P74A 5C3EH 1LUZA 2JA8H 3CPFA 1M1KC 3GTLH 1A63A 5IYDG 4DV3L 5M5WH 4PZ8A 2EIFA 1SR3A 4UP7A 1OXUA 4ME3A 3T1YL 1S40A 4LF7L 4L5TA 4AQYQ 1PH4A 1J6QA 3CCJA 3E9IA 2HT1A 4JI2Q 2ZM6Q 1PH8A 1TWAH 3KYHC 3NELA 1XNQL 3HOUG 3EIVA 1VQ5A 1EIFA 2WB1E 4A3FG 4PZ6A 1XPRA 2HHHL 4OX9Q 3CC7A 4A75A 4LWCA 1KIXA 4R4IA 3M4PA 1NMFA 3A74A 4IFDJ 5IYCH 1K9MC 1VQ9A 2CKZB 3K81C 1V9PA 1LM0A 1C9OA 5C44H 1VQ4A 3KDFA 4P72A 4JI0Q 4LFCQ 1Q8KA 4JI7L 2VL6A 1PA6A 4X64Q 1Y1WH 1NJIC 3PF4A 2BH8A 1L0WA 3CXCA 1I50H 2JA5H 2V1CC 1N33L 3FKIH 2VUMG 4Y7NH 1HR0Q 2AWOA 2ID0A 2JA9A 2Y0SG 3PUYA 1GKHA 3BU2A 2IHEA 5IWAQ 3CCEA 3OW2A 1IBML 3CD6A 3KLWA 1QZGA 3I4NG 4JI5Q 3M4OH 2E8GA 2BA0A 2BA1A 2DGYA 4NXML 4L5QA 3RZOH 3EBEA 2E2IH 5BR8Q 3HFZB 2UUCQ 1N32Q 2JA6G 1B8AA 1YEZA 4B3TL 1VQ7A 2VQFL 2WAQE 1N36Q 1U0LA 1YBYA 5LMUL 1VS0A 5GQOA 5JEAG 2UXDQ 2N3SA 2R93H 1VCIA 2Q2UA 1MJEA 2LSSA 5M3FH 4DR5L 4JI4L 4KHPQ 1JJCB 4MZ9A 2QEXA 4LF5L 4DR2L 4YHHQ 3GTMH 1YHBA 4A4IA 3T1HQ 3HOYH 1FVIA 2XGTA 1KHIA 4OO1G 3AFQA 3ERSX 1MIUA 2AWNA 3GD7A 2NVXH 3PGZA 4X62Q 1X3EA 1Y1VH 5J3BA 2OCEA 1TWCH 3IRBA 1WCMG 2F52A 1K0RA 1KRSA 2WP8J 1I5FA 2IHFA 3KF6B 4R1JA 4B3ML 1HNXL 2UUBQ 1HH2P 1WI5A 1E7ZA 3HOZH 2NVTH 3CW2C 4R4QA 3CCMA 2I5HA 4H02A 4XIGS 4POFA 4DV3Q 3DLLA 4AIMA 1K8AC 3K0XA 3T1YQ 1SRUA 2OQKA 1YI2A 1GM5A 1DGSA 1CKMA 3CCVA 4BY1H 4LF7Q 4LFCL 1Q1EA 2PI2E 4X64L 2CCZA 2CWPA 3KJOA 1XNQQ 2A8VA 3PUVA 2HHHQ 4NXNL 2ZTCA 2RHQB 3PO3H 1YVCA 1L2FA 2YYZA 1UE6A 2B63H 3CC4A 2YTYA 2JA7H 4A3BH 3FHWA 4DR7L 4HIDA 3S15H 4A3GH 4KLKA 3AYHB 4LUOA 1QVFA 2R7ZG 1Q12A 1VQ8A 4DV0L 4JI7Q 4IPDA 4AYBE 5BR8L 1LYLA 1QUQB 3H0GH 4DV6L 1C0AA 1N32L 1ASYA 4WJ3M 5JJKA 1FJGL 1N33Q 4A3IG 3CCLA 2B29A 2RF4A 5M3MG 3J81c 4HIMA 1UEBA 1VQMA 4LF6Q 2IY5B 5JJLA 1Y14B 4A3KG 1A62A 2MQHA 2A19A 5IYBH 1GO3E 2HIVA 2I5MX 2IX0A 4A3EH 2UXDL 4GS3A 5IP7H 1N36L 2OQ0A 3HKZG 1CSPA 3S1RH 1XMOL 2ZJRA 2E5LL 1XMQL 4YY3L 3T1HL 1CSQA 4BBSH 2I5LX 3K8AA 4B3TQ 2ATWA 2B3GA 2VQFQ 4QQBX 2K5HA 2K5NA 4DV4L 4XTCS 5LMUQ 2JEAI 1IBKL 3TREA 2VY3A 1CKOA 4JI4Q 1I94L 3ER0A 4A3MH 1TWHH 4PG3A 3AEVA 2AMCB 4DV5L 1XPOA 3J81i 4DR2Q 4BBRG 2UUBL 4NB3A 4JI6L 1SN8A 1WFQA 1HZAA 2K50A 5GAEC 2N49A 4JI1L 5C3EG 2PNHA 5FJ8H 3KDFB 2MNAA 1YITA 2PMZE 4DAMA 3RN5A 3M7NA 1U5KA 2F4VQ 1CKNA 1VQFA 1Q82C 4DAYB 4A3JH 3UDXA 4BA1I 4B3MQ 3K7UC 3S14H 1HNXQ 1JT8A 3G4SA 5IT9c 3LGJA 4HJ7A 1Z47A 2EQSA 3KF8B 2K52A 4GN3B 1PH2A 3CP0A 4C3JH 5K36G 1Q86C 1D8LA 4X66Q 1S3OA 2WB1G 3A0JA 5IYDH 4GN4B 1Q1BA 2Q2TA 2Z6KA 5C44G 2YTXA 1K3RA 3UE1A 1I6HH 4IJHA 3I4OA 4JI8L 4DNIA 2ZJQA 1W3SA 2I0QA 4NXNQ 3S1MH 2HIXA 3FKIG 1N9WA 3H3VI 3K7AH 3UE0A 3JAMc 4QY7A 4LF6L 1E22A 2GN5A 3PSIA 3F2DA 3PUXA 4A3FH 5JEAJ 1X3GA 3HOUH 4DR7Q 4WJ4A 4YCUA 1P16A 1T9HA 5FLMH 2H5XA 2K5VA 5IY0A 1VQNA 1SFOH 3M4QA 1X3FA 3RLNA 2WFWA 5FLXc 1PV4A 1G6PA 1BBWA 1X56A 3NBHB 3J81j 1G291 3I7FA 4DV0Q 1YHQA 1UE7A 4DV6Q 5JJIA 3HOVH 1FJGQ 4DK6C 1KC8C 4X6AH 4EX5A 1WOCA 2BH2A 1X55A 3GTQH 1YJWA 4R4CA 2ZJPA 2R7DA 5LMNW 2VUMH 4A3CG 1WYDA 3PCOB 4C2MH 1EIYB 3JC66 1B70B 1G51A 3GDEA 1HNWQ 3JAMi 1YJNA 3PIOA 3TQYA 3CF5A 1XMOQ 1EFWA 3M85A 4GLXA 4YY3Q 1XMQQ 2E5LQ 2VQEL 3I4NH 5IP9H 4OWWB 2NZHA 2D62A 2E2JH 2YU9H 4IPGA 3PO2H 4C3IH 4BY7H 4LF4L 4HJ5A 3I55A 2C35B 1TWFH 4L5SA 1VQEA 1JB7A 4OO1I 4DV4Q 4JBJA 1X54A 2JA6H 1NY4A 2VNUD 5H1SE 1IBKQ 1H95A 1YZ6A 1Y1VG 1I94Q 2F4VL 1EUJA 1VQHA 1ASZA 2CQOA 4IO9A 4DV5Q 3OTOL 1NMGA 4MTNA 1IYJB 3BJUA 4IJLA 2N78A 4TQUS 1NBWA 3F2CA 1LTLA 1JJ2A 1VQKA 4JI6Q 2UXCQ 1UE1A 4A3LH 4O2DA 3STBD 3E0EA 4JI1Q 3ULJA 1XPUA 2K14A 3HOXH 1PYBA 1FL0A 3FP9A 3NEMA 4X66L 4HIOA 3RZDH 1W2BA 1HR0W 4JCVE 4YWLA 3K80C 3W1BA 4BY1G 3GTOH 4IOAA 3DM3A 1QZHA 1UE5A 4DV1Q 1PVOA 3PF5A 4OONA 1PH9A 1SE8A 3J7A5 4DUZL 1WCMH 4GNXA 4QL5A 3G6EA 1E1OA 3PO3G 4AH6A 2OTJA 2XTIA 1IXRA 2B63G 4A3BG 3A5ZB 2RCNA 4TVAB 4QGUA 4DUYL 2MO1A 2LXJA 2MFIA 3J80i 3TEHB 1QVCA 4O0AA 4K0KL 2R7FA 5DLQE 4BXXH 3CCQA 5C4XH 2NN6G 1PYSB 5AJ3L 1AE3A 4JI8Q 3J7ZC 1X65A 3CMEA 3U58A 1EQQA 4A93G 2PQAA 4JBWA 4A76A 4EQ5A 4GKJL 4LFBQ 3RLOA 5C4JH 1SROA 1NE3A 1VQIA 2CFMA 4LUZA 2K75A 4OXPA 2NVYH 1IL2A 4AYBG 4GNXC 5IYBG 4HJAA 3E9HA 1M90C 1HNWL 1Q81C 5IP7G 2R92G 4OWXB 4DR3L 2FXQA 1B7YB 2R7ZH 1GVPA 4PZ7A 3UDGA 4GKKL 4PMWA 1K8GA 1OTCA 4DPGA 5GAGC 1CKNB 3BZKA 4X65L 1P8LA 4GKKQ 3I4MH 1BBUA 5C0XG 4A3IH 2IT1A 3NENA 2KENA 3KOJA 3ULPA 1PH3A 1KAWA 2DUDA 3S1NH 4A3MG 3L7ZC 4IPHA 4DV2L 2L15A 4OWTB 4ALPA 2E2HH 1V43A 2VQEQ 4JC0A 3S24A 4DK3C 2UXCL 1UWVA 2YV5A 4GN5A 3CC2A 4JOIA 2HQLA 4DR6L 4A3DH 1FGUA 1VQAA 1EYGA 1HZ9A 2JK8A 1GD7A 5ELNA 5FJ8G 1QVGA 2D0PA 2JA8G 4LF9Q 2UXBL 1RL2A 1TWGH 3D31A 4IPCA 4APVA 2IX1A 1SLJA 3KFUA 2UU9L 2CWAA 2RHSB 1K73C 3OTOQ 4A3JG 4KI0A 3G48A 4DV1L 4POGA 1EQRA 3HOWH 1J5EQ 3G71A 4JBMA 1D7QA 3AFPA 2EXDA 2D0OA 2JEBI 3F1ZA 3UDIA 1YHAA 2JJQA 1L1OA 1E1TA 3F2BA 2F3IA 5LMNQ 3RLFA 1BKBA 5IYCG 2ZTEA 3HKSA 1R9TH 1PFSA 1IBLQ 4JOIC 4JI3Q 1RIPA 1Q46A 5HY6A 3WWVA 4NPSA 4YCVA 1TXYA 1Y1WG 5ELOA 3H15A 2A1AA 4B3RL 4DV7Q 2JA5G 3CMAA 4DUZQ 3BZCA 3KJPA 4LF8Q 4LFBL 1OXTA 2JE6I 1PH6A 3S1QH 4IOCA 2QGQA 5FLMG 4DUYQ 4HJ9A 1Q7YC 3CQZH 1VQCA 1VQJA 4GOPA 3STBC 4K0KQ 1L1OC 2GVBA 2VW9A 5M5XH 5AJ3Q 1IZ6A 4HJ8A 2YTVA 3VDYA 3HOVG 4P73A 2Y0SE 4GKJQ 3CPWA 3CCRA 2Z6KC 3H3VH 3PIPA 4JV5L 3GTGH 3U4ZA 3AQQA 4FDBA 1EWIA 1MKHA 4LUVA 2R93G 4JYAL 5M3FG 3Q8DA 4DR3Q 2K4KA 2WAQG 1CUKA 4P71A 1KQSA 4IFDG 1WJJA 2AHOB 3HOYG 4DR4L 5GROA 5IP9G 2NZOA 3I56A 3CCUA 4DR1L 4GOPC 3PO2G 4BA2I 2UUAQ 4BY7G 4RG1A 4YWMA 3GTKH 4IFDI 2KCTA 1BVSA 1HNZL 2VS1A 3ULLA 4X65Q 3CCSA 1PHJA 4LF9L 1VQ6A 4MNOA 1JJGA 3TS0A 3RN2A 4GNXB 3L0OA 1VQOA 4LF4Q 4DV2Q 4A3CH 1HZBA 3S2DH 1J5EL 1XNRL 1HZCA 1MJCA 2KCMA 1PH1A 3J80c 1N34L 3I2ZA 1OXSC 4A3LG 1C7YA 4DR6Q 2AKWB 3HOZG 4C3HH 2ES2A 3MXNB 1OXXK 1E24A 2ALYB 4QJFA 1NTGA 3OYYA 3L2PA 1V1QA 2GVAA 5LMNL 1IBLL 4UPAA 3S16H 3TRZA 2UXBQ 3HOXG 4JI3L 5IE8A 4LW1A 2PQAB 2UU9Q 3S17H 3UDFA 3PUWA 1YNXA 2ZTDA 4DV7L 4RMFA 4AQYL 1VQLA 1XTDA 4LF8L 2ZM6L 4JI2L 1VQDA 4JBKA 2JQOA 2MO0A 4LFAQ 2OWOA 4B3SQ 3U4VA 1O7IA 3W5OA 5EAYA 4OX9L 2JA7G 3GTPH 4UP8A 4A3GG 4DKAC 3GTJH 5GADC 1KRTA 1AE2A 1KD1C 2KHIA 1KL9A 4B3SL 1VQBA 3PUZA 4BXXG 1A0IA 4JG2A 3H0GG 1PH5A 2R6GA 4B3RQ 5C4XG 1SMXA 2VZAA 2NN6I 3EN2A 4JI0L 2QA4A 4GLAC 5C0XJ 4L5RC 3A5UA 3MEFA 1VQPA 3B6YA 5GAHC 4HIKA 1A8VA 1HR0L 4A3EG 3KF6A 3F8TA 5IWAL 4R4TA 1EOVA 1JE5A 1S72A 4JI5L 4LNQA 2ASBA 4YCWA 1VQGA 4BBSG 2KHJA 4UY8C 3TS2A 2UUAL 1N8RC 4GLVB 3M9BA 1K83H 1HJPA 4QIWE 4A93H 4Y52H 2Q2HA 2UUCL 5HGQA 4YWKA 4JV5Q 3RNUA 3HKZE 3I4MG 3RR5A 5M3MH 2KBNA 3W1GA 4KHZA 3D0FA 5C0XI 2OTLA 3GO5A 4A3KH 1YIJA 4JYAQ 5M5YH
chains in the Genus database with same CATH superfamily
4QIWB 1IBMQ 2EYMA 3T56B 4DR4Q 1S5ED 4KHPL 4DR1Q 1F2MA 2DJGC 4RHRA 1I3QH 5JAVA 1DD2A 2F1MA 4R4OA 3NUCA 3K5NA 2TSSA 1XNRQ 1OXVA 5E7NA 4ZKBB 3TDQA 4DR5Q 3ZJYC 3FVQA 4P75A 4GOPB 1EEFD 2F0MA 3I70A 5C3EH 1SYEA 2JSOA 2JA8H 5IYDG 4DV3L 2EJFC 1STAA 1FGBD 1S5BD 2EYPA 1R4PB 2EY1A 3E9IA 2ZM6Q 3MA2B 3KYHC 1SE2A 3HOUG 3EIVA 4OX9Q 4PZ6A 1SAPA 3NTKA 4A75A 4LWCA 4R4IA 5C6AA 3Q24A 4IFDJ 1VQ9A 5M5XB 2WB1B 4KY5A 2WIIB 4XYQA 1WTHA 2XWJB 2VL6A 3PF4A 1Y1WH 1L0WA 1E0BA 2V1CC 2Q8IB 1N33L 5IGGA 3GTGB 4Y7NH 2Y0SG 1GKHA 3CD6A 1IKLA 4CJ0B 4Q5VA 3M4OB 5D14A 4EQNA 1TS2A 2BA0A 4NXML 1SSOA 3EBEA 4LAAA 2JA6G 1ESRA 4B3TL 2K5QA 1VQ7A 5C3XA 1U0LA 1YBYA 3MXUA 2PCFB 1ENAA 1VS0A 1PFMA 2R93H 1VCIA 4JI4L 5M3FH 3VR4A 3GTMB 4DR2L 4YHHQ 4A4IA 1V8QA 2PZUA 2QW7A 4OO1G 2Z4HA 3NBHA 1U4MA 3AFQA 2AWNA 1Y1VH 5J3BA 3TMEA 2OCEA 1TWCH 5CYUA 3KLRA 1WCMG 2SNMA 3L9AX 1K0RA 1KRSA 1I5FA 2IHFA 1HTPA 4B3ML 1TVXA 2UUBQ 1RCVD 1WI5A 2NVTH 3CCMA 1K8AC 3K0XA 3T1YQ 1GM5A 2OQKA 2LY7A 3TP7A 4BY1H 5E3FA 4LFCL 2FINB 4X64L 2CWPA 1XNQQ 3PUVA 2HHHQ 2ZTCA 3PO3H 2F0SA 2NTSA 3FHWA 2L5TA 3AYHB 4LUOA 1QVFA 1Q12A 4JI7Q 2NN6H 3NQTA 4A93B 3H0GH 4DV6L 1N32L 1FJGL 3CCLA 2KCNA 4LMQD 2B29A 5M3MG 1VQMA 1UEBA 2IY5B 5M5YB 2A69D 2ZXOA 2FHTA 2A19A 4ZRZA 2I5MX 2UXDL 4XT3B 4HN7A 2IPKD 3R3OA 1BCPF 3S1RH 1D1IA 1XMOL 2E5LL 1O7ZA 4YY3L 3RMHA 1FNWA 1GUNA 2I5LX 3K8AA 3NWSA 2K5HA 1WTXA 4XTCS 5LMUQ 3TREA 3EVQA 3P1HA 3H94A 4A3MH 1A3TA 2XVSA 1XPOA 2RQXA 3QR8A 1ZXTA 1STNA 4B08A 1FYCA 2K32A 2XNAC 4JI6L 1HZAA 3UI2A 2K50A 1B44D 1ZYRD 2JA8B 2N49A 2MNAA 2F4IA 2EY5A 2PMZE 2IX3A 2G5DA 3RN5A 2KOLA 1U5KA 1CKNA 3Q0AA 1HXYD 4ZYSA 4BA1I 4DXFA 3G4SA 5IT9c 2ZT9C 2K52A 3K6OA 5K36G 1S3OA 2F3WA 5IYDH 5C44G 1Y1WB 1K3RA 4IJHA 4JI8L 4IURA 4Y7NB 2HIXA 1A3UA 1N9WA 4LF6L 3HOUH 4CKCA 1T9HA 2H5XA 3M4QA 5FLXc 4ABNA 4DV0Q 1G291 3URYA 5JJIA 3HOVB 4DK6C 1JICA 3NXWA 3T4AC 2ZJPA 5LMNW 1BXTA 3W2DA 4A3CG 1WYDA 1D5MC 1NAPA 2R93B 4MIUA 1STGA 5M3FB 1HNWQ 1A2TA 1PFNA 1PRTC 3M85A 3K58A 3TZUA 1QWYA 1XMQQ 1EFWA 4OWWB 3PO2H 2D62A 2YU9H 1TS5A 4IALA 1NUCA 1KDAA 4OO1I 1JB7A 2VNUD 4DV4Q 4JBJA 2JA6H 4RFBA 5H1SE 2B2TA 1TWCB 2X6GA 1EUJA 4DV5Q 4DA2A 3JAML 4IJLA 2N78A 2PZWA 4TQUS 1JJ2A 1VQKA 1H9SA 2NVTB 4R9WA 4JI1Q 4ME5A 3ULJA 1JR0D 1A2UA 3GV3A 3NEMA 4X66L 3ZYYX 1W2BA 4UAIA 3BZDB 3GTOH 2XIWA 2K28A 4FXKC 4M1UB 4Z9CB 1PVOA 2RSNA 2K04A 1WCMH 2XTIA 5F2DA 4A3BG 3A5ZB 4QMGA 1X3QA 2EJGC 4TRDA 4DF7A 2B2VA 4DGZA 2LXJA 4RAUC 3E5SA 4J6HA 3CCQA 3H0GB 2FFKB 1AE3A 2KEDA 3EFXD 4A76A 1F2ZA 4EQ5A 1JQYD 2X69A 4KHVA 1ET9A 1GUGA 1SROA 5I9OA 2K75A 1IL2A 1JOKA 3S1RB 4OWXB 1DOMA 1HFGA 1GVPA 2F0VA 4PZ7A 3UDGA 4GKKL 1K8GA 3SDZA 4DPGA 5GAGC 1RODA 3BZKA 4X65L 1TT2A 3I4MH 5C0XG 1IL8A 1O78A 2MP1A 4MN3A 4ALPA 2BE5C 1V43A 2VQEQ 1GUSA 3S24A 1UWVA 2YV5A 3NP8A 2SDFA 4KN4C 1GD7A 5ELNA 2ENBA 5FJ8G 1QVGA 1EOTA 1ENFA 1K3BC 3OIPA 4IPCA 1X3PA 3KFUA 3DEOA 1K73C 2RHSB 4RCOA 4A3JG 4POGA 3G48A 4DV1L 1EQRA 4X3UA 4JBMA 1YNNC 2OF1A 2F03A 1D7QA 3BVZA 3UDIA 1YHAA 3OWFA 1HPCA 1STYA 2JJQA 1XYIA 3FRPB 2ICEC 3HKSA 4JOIC 1Q46A 5HY6A 1BQQT 3PMFA 5ELOA 2A1AA 1NR2A 4DV7Q 4DUZQ 2SNSA 2JA5G 1LT6D 1J8IA 2XRSD 3HOUB 3S1QH 1TQOA 2H4OA 2QGQA 2HD3A 4HTHA 4N9TA 5FLMG 4DUYQ 4H13C 5K36H 1ZKOA 2A6EC 2LKVA 1QOHA 3VDYA 4P73A 4WFN3 4OL7A 3K59A 4GKJQ 2J4XA 3BVMA 5HGTA 2F0PA 1QJOA 5K5PA 5ELBA 5ELFA 1EWIA 2Y0SB 4PMBA 4HCSA 5LHY1 1SXTA 1V1PB 3D6WA 4DR4L 3HOYG 4BA2I 4DR1L 1MBYA 4GOPC 2PQEA 3P7JA 4BY7G 4C3IG 5JOBA 2VS1A 3WOEA 2F0GA 2JA6B 3A8IE 2WV6D 4HEDA 5J22A 3L0OA 1A3VA 4KV6A 4A3CH 1PRTF 5LL6S 3S2DB 1XNRL 2KCMA 4F7XA 3J80c 3I2ZA 1OXSC 4RWSC 3HOZG 4C1NI 2ES2A 4QJFA 5IODA 3L2PA 1W6KA 1V1QA 2GVAA 3S16H 2UXBQ 4UPAA 1WVLA 3HG9A 5ELEA 1H9KA 4JI3L 5IE8A 1B50A 3GTOB 1B3AA 1CZGA 1PYWD 4WORA 3S17H 3KUPA 1HA5A 2ZTDA 4RMFA 3H3VC 1WCMB 1VQLA 3MZ5A 2ZM6L 1WD0A 1VQDA 5EGTA 4JBKA 4OX9L 2JA7G 1O7IA 1O7LA 1LO5D 2KVMA 3R2IA 4U68A 5GADC 2KEEA 1PMRA 1KL9A 4JG2A 4B3RQ 3TN2A 1CM9A 1A8VA 4A3EG 2A68D 3KF6A 4LNQA 3R2TA 1VQGA 4UY8C 1WTWA 3TS2A 1D6EC 1HJPA 4QIWE 3RNUA 5M3MB 4XDXA 5C0XI 4OELB 4JYAQ 4LF4L 2B2WC 1LTBD 2EYJA 4DK0A 1JMCA 1L1OB 1E3PA 4YHHL 4A3DG 2Q2IA 1VMCA 3ICEA 1SMYC 5A2QE 5DM73 3M3YB 1WTVA 3U50C 1X9NA 2BCOA 1EU3A 2NBFA 5ELCA 4ZUJA 1EY8A 1N34Q 4F8MA 2QKIC 4LF5Q 2N8NA 4K5WA 1ICFB 4L8JA 1LUZA 4R8IA 5DM63 3QIAA 5M5WH 4PZ8A 3FDTA 4FNFA 3VR3A 4ME3A 3T1YL 4L5TA 3AB9A 1BNZA 2XRQD 1XNQL 3NELA 1B1ZA 5FKAC 2M9VA 2HHHL 2WB1E 4A3FG 3S1QB 3DMUA 1SEBD 3PIP3 3NPPA 4KD3A 1AW7A 3QOJA 1F77A 1V9PA 4KN7C 5C44B 2L0CA 5I6WA 1CA5A 4JI0Q 4JI7L 1JB3A 4CJ2C 1I50B 1ET6A 2JA5H 2VUMG 1HA6A 1LTSD 3LNNA 3CCEA 2IHEA 2Z6BA 2CQAA 3KLWA 4I65A 3KF8A 1C8CA 1VMPA 2E8GA 3M4OH 5KNDA 2DGYA 3EROA 4DNTB 4DN4M 4CJ1B 5LMUL 3AU7A 4KKTA 1MJEA 2LSSA 1JJCB 4MZ9A 1F2YA 3GTMH 1CQVA 3C3LA 3HOYH 3S16B 2VXWA 2XGTA 2DNEA 2AQ2B 3M4YA 5EPLA 1MIUA 3S17B 1SE3A 3PGZA 3IRBA 1LV9A 3HEJA 3I3CA 2WP8J 3I90A 1IW7D 2F0WA 1E7ZA 2I07B 4K2KA 4N9PA 3HOZH 4POFA 3MFGA 1TKWB 3DLLA 4AIMA 2MGSA 3DHQA 1YI2A 3VA5A 1IYVA 3NBIA 5CV7A 1Q1EA 1PLFA 2PI2E 2CCZA 3KJOA 4ODGA 5JJZA 4U673 1EY6A 1UE6A 2HDMA 2JA7H 3SVMA 1GOZA 2D2CC 4KLKA 1S5FD 5LL6X 1VQ8A 1BCPC 4DV0L 3I4LA 4WRDA 5BR8L 1ASYA 1PZJD 1EY7A 2A6HD 3R93A 1A62A 4A3EH 3HKZG 1G2SA 3CHBD 1HRJA 2CW0D 2L12A 1B2TA 1RD9D 2A74C 1XMQL 1EZ8A 3T1HL 5CORA 5C4HA 2WACA 2ATWA 3FEWX 2B3GA 2VQFQ 4QQBX 1F9PA 2E74C 1DXMA 2K5NA 4DV4L 1I4HA 1GHJA 3ER0A 1TWHB 2AMCB 4DV5L 3D6CA 5T1IA 4BBRG 4K5XA 2Q8RE 2AUKA 5GAEC 5EKKA 3OMCA 4JI1L 5M5WB 1LTRD 1D2BA 4S3SA 1I4RA 2F4VQ 1Y8NB 4A3JB 4NW2A 4F87A 1JT8A 2MJ8A 1HNXQ 1LABA 4HJ7A 2MHVA 1IYUA 4H0LC 4GN3B 3CP0A 1U9RA 2F0DA 3A0JA 2EY6A 1JE4A 5I2XA 4FO2A 3NHHA 1I6HH 4X3KA 3I4OA 2JA5B 2ZJQA 1V1OA 1W3SA 2I0QA 4NXNQ 3FKIG 2VB3X 1E22A 3PSIA 3F2DA 4H44C 4A3FH 4WJ4A 1EIGA 1P16A 1VQNA 2AQ1B 3SEBA 1SFOH 1IW7C 1HUNA 3RLNA 1PV4A 4ULLA 3W3AA 3NBHB 2JXMB 1R4QB 1BO0A 2PW5A 3HOVH 2QEJC 1G2TA 4X6AH 4EX5A 2BH2A 4QF4A 1YJWA 1Y8OB 2R7DA 2VUMH 1TS4A 1SYBA 3PCOB 3MFYA 4C2MB 3JC66 1JCKB 4KTAA 5ELDA 3PIOA 2N88A 4C3HG 2C9OA 5IP9H 2VQEL 3HOYB 4C1NK 2NZHA 3A8KE 4BY7B 4IPGA 4C3IB 1DOLA 2HQEA 4L5SA 1VQEA 4F88A 3BYTB 1B9NA 1I94Q 2CQOA 4HMJA 4IUQA 5HURA 3BJUA 2D9UA 2KCCA 1RDPD 4XYOA 3HOZB 2EDGA 5ISRA 5FLXL 1FL0A 4HIOA 4JCVE 1KLUD 1E2ZA 3DM3A 1UE5A 2EZVA 3WOFA 1SE8A 3J7A5 4DUZL 4GNXA 4XXEA 4QL5A 1NNXA 3TP5A 2K5DA 5IGBA 2JA7B 2B63G 4DK1A 4TVAB 4DUYL 2MO1A 2MFIA 5KNBA 3TEHB 4TKOB 3QJYA 3SXHA 4BXXH 2PQAA 1SE4A 2F0IA 4GKJL 1PFBA 3C2PA 4LFBQ 1NE3A 4JPBW 4OXPA 2B2WA 2NVYH 4AYBG 3WDNA 1Q8IA 4A3EB 5IYBG 1M90C 4UHVA 5IP7G 2F0JA 2CH4W 1G8ZD 3E6ZX 3T13A 2FXQA 5C5LA 1B7YB 1OTCA 1CKNB 5C3WA 3ITPA 4DAVA 3NENA 2KENA 3L7ZC 4IPHA 1LTGD 2E2HH 4ZLTF 4DK3C 2UXCL 3ND8A 2K01A 3CC2A 2HQLA 4A3DB 4L6TB 1VQAA 1HZ9A 4LF9Q 2UXBL 3CRKC 2EXZA 1TWGB 2VB2X 3BS1A 3MAQA 1IHZA 2CWAA 1CZWA 2EYHA 3OTOQ 1EYCA 3J81L 1J5EQ 2O5JC 3VR6A 3G71A 1NSNS 4MHEA 2EJMA 2EXDA 2JEBI 3F2BA 2F3IA 3RLFA 3V96A 5IYCG 1R9TH 2X6LA 1CQFA 5L37A 3BDOA 1PTOH 1O7YA 1XTCD 4YCVA 1I6HB 5JVG3 1TXYA 3Q23A 1SYDA 4G7HC 2AUJD 4B3RL 3U9SA 1QNKA 4A3FB 1OXTA 1F9SA 1SFOB 4IUNA 1VQCA 1CI3M 1L1OC 2GVBA 2VW9A 5AJ3Q 1IZ6A 4KKUA 3VYRA 1G91A 2Y0SE 2VUMB 2K03A 3VYUA 2ZXRA 1SNDA 1MKHA 4LUVA 2L11A 4JYAL 1H9SB 4CBVA 4DR3Q 2WAQG 1F2LA 2AHOB 1FD7D 3EQLC 3VYSA 3CCUA 4IFDI 2UUAQ 4RG1A 4YWMA 2KCTA 1TY2A 1EFID 3PQIA 1CHQD 3TP8A 1JJGA 3TS0A 3RN2A 2KQ3A 2CH4A 4ZAIA 3N52A 1B4OA 1HZBA 3KK7A 3S2DH 2A69C 3OSOA 1HZCA 1MJCA 5CV8A 1N34L 3C1FA 4A3LG 4C3HH 3E0JA 1SJHD 1KAAA 1LT3D 3OYYA 5A35A 2NTTA 1Q90A 1H9MA 5LMNL 1IBLL 4OO1H 3DUZA 4JK1C 3HOXG 4L63B 4LW1A 1HQMC 2UU9Q 3PUWA 1YNXA 5KYIA 1LTAD 1QCBD 3A56A 4I7ZC 1XTDA 4LF8L 2MO0A 3U4VA 3W5OA 4A3GG 4DKAC 3GTJH 1KRTA 1ZYRC 1AE2A 5IGDA 1VQBA 1SJED 3PUZA 5C4XG 4OGQC 5G3LD 4IN3A 3EN2A 4JI0L 1RKNA 1F9RA 4IUUA 5C0XJ 4L5RC 3MEFA 1VQPA 3K5OA 3A55A 2NVYB 3NWTA 4RGMA 1KNEA 3L3OC 3MC0B 3F8TA 3J80L 2WINB 4YCWA 5I6YA 1EYAA 4BBSG 4RH6A 5FO8B 1K83H 2Q2HA 5HGQA 4YWKA 4BS9A 3RR5A 5BN3A 2KBNA 5M3MH 4KHZA 1BF4A 2OTLA 2E2HB 1EY5A 1AH9A 1UUPA 4LJZC 3S2HH 3HKZB 4HR7B 1YJ9A 4NXMQ 4J15A 1LACA 1D5ZC 2B39A 4FF3A 1HNZQ 3A7AB 2D5DA 3M3YH 1JWMD 5CBAE 3T51B 1QUQA 4OEMB 3ND9A 1Z9FA 4UP9A 2V4DA 3HOWG 2Z0SA 4MTKA 1XJVA 3OHXC 4BBRB 2NVQH 1K8MA 5NUCA 4K8IA 1KDBA 2EY2A 4LFAL 5TSSA 2HDLA 1R9TB 4P74A 1EQVA 1K28A 3GTLH 1M1KC 1PTOB 1D5XC 1SR3A 1S40A 1PH4A 1J6QA 2LMCB 3CCJA 1XWEA 1PH8A 1TWAB 5E1FA 2F0HA 1VQ5A 1EIFA 4HSVA 5FOBB 1XPRA 4C56C 3N6RA 4CDFC 3CC7A 3NQIA 1BBXC 3M4PA 3A74A 5IYCH 4DFAA 4QUFA 3K81C 3J7AF 1LM0A 2J7ZA 2I46A 1SYCA 5C44H 3KDFA 4P72A 4LFCQ 1Q8KA 2RA4A 1PA6A 4X64Q 1NJIC 3CXCA 1I50H 2SEBD 3FKIB 4DAYA 3IFTA 2ICIA 2Z8LA 5EPKA 2AWOA 2QDBA 4RHSA 2LS01 1DM0B 2ID0A 2JA9A 3PUYA 5IWAQ 1IBML 2RBMA 1QZGA 4JI5Q 3D3RA 2BA1A 4L5QA 2B8FA 3RZOH 2E2IH 2UUCQ 1N32Q 1YEZA 2VQFL 1G6ZA 2IL8A 2WAQE 1N36Q 3MEHA 5GQOA 5JEAG 2UXDQ 2N3SA 4DR5L 1Z6HA 4C3HB 1YHBA 2F0NA 4CKEA 1W6JA 1B53A 4NMZA 3ERSX 1DYQA 3GD7A 4X62Q 4EQPA 2Q8TA 2NVXH 5I9PA 1X3EA 3I73A 2BOSA 4O1NA 3KF6B 1HNXL 1HH2P 2EVBA 3FMCA 4R4QA 3GTJB 2F0TA 4H02A 2C5CA 4RGTA 4B9WA 4NKLA 4LF7Q 1SRUA 2EPBA 5JPNC 1DGSA 1CKMA 3CCVA 5D3DA 4FXGC 4NXNL 5IGEA 4QUCA 4G7OC 1YVCA 2B63B 4A3BH 4HIDA 4A3GH 5D3IB 5EBCA 5CV9A 2R7ZG 1GUOA 4IPDA 3D4DA 1K83B 1LYLA 3K0YA 3X3NA 2RDHA 4WJ3M 1PXUA 4HIMA 4LF6Q 2IW3A 2NUCA 4FF2A 4AYBB 4A3KG 2RCFA 2RKSA 4CHTB 2MQHA 1I6VC 1GO3E 3S2HB 2R61A 3QOLA 1CSPA 4EGVA 2ZJRA 1CSQA 4FP5D 5IGCA 4BBSH 4CGYB 2L4NA 2JN4A 1H9RA 3QO2A 5C0XH 3HZXA 4BWGB 2JEAI 2VY3A 1CKOA 1WTOA 1I94L 4FYDA 1TWHH 4PG3A 1HCZA 2NVQB 1RJTA 3D4WA 3LX0A 3J81i 2UUBL 4NB3A 1SN8A 1FNUA 1L0XB 3GTLB 5C3EG 5FJ8H 3K5MA 1YITA 1LLRD 3C46A 4DAMA 5KGUA 3M7NA 1VQFA 3OOCA 4A3JH 3UDXA 3S14H 1QB5D 3LGJA 1Z47A 4CDDC 2F0UA 3KF8B 1HUMA 1Q86C 4X66Q 1BUVT 2FMCA 2AQ3B 1CFMA 1Q1BA 5FO7B 2Q2TA 4X3SA 1I4QA 2YTXA 3S1MH 4N8FA 3BG3A 1QNUA 1BOSA 3H3VI 4CDEC 4QY7A 4J1MA 4DU9A 4DR7Q 4YCUA 3MTSA 5FLMH 1FNVA 2K5VA 4IZ8A 2OXPA 1G6PA 2WFWA 1E2VA 1CA6A 1X56A 3RZOB 2DN8A 2E2IB 3C1EA 3PIO3 1WOCA 4KMUC 4XQNA 3BDLA 4R4CA 5E4WC 2Z4IA 3K5LA 4C2MH 3G6JB 1B70B 1G51A 3GDEA 2DJFC 3JAMi 2WAQB 3TQYA 3CF5A 4RCNA 2A68C 4R8NA 4BY7H 2F0QA 4C3IH 3I55A 4QB4A 2KHSA 2NVXB 1IBKQ 1H95A 1Y1VG 3EA6A 1VQHA 1ASZA 5C4ZA 4IO9A 3OTOL 1S5CD 1NMGA 4MTNA 4ZUIA 2N55A 3STBD 1DONA 4PMCA 1A6XA 1UEAB 2XSCA 3HOXB 1HR0W 2CVRA 4ILWA 1JOQA 3K80C 4BY1G 1O80A 1QZHA 1QG7A 2K6AA 4J8QA 4B9XA 4DV1Q 2B2TC 3DWPA 3I8ZA 3PF5A 1PH9A 5J1ZA 1AZQA 3NE5B 3G6EA 1E1OA 1TR5A 3PO3G 4AH6A 5KRUA 4A3BB 1IXRA 1IKMA 4A3GB 4QGUA 1B3QA 1PZKD 4IUVA 3MXNA 3J80i 4O0AA 2R7FA 1PTOD 1HQRD 3CRLC 2NN6G 1PYSB 5AJ3L 3J7ZC 5C4XB 1EQQA 3V05A 2P5ZX 3RLOA 2L9HA 2CFMA 4LUZA 4G57A 1CTMA 5A2QL 1QILA 2BDOA 5CGKA 3E9HA 1HNWL 5I2YA 2R92G 4DR3L 4BBSB 2R7ZH 1HFNA 2B2VC 4H7BA 1J9OA 5KYLA 4PMWA 2B2UC 1BBUA 1EY9A 2IT1A 3DXJC 2IJ0A 2K5WA 1KAWA 2DUDA 3S1NH 4A3MG 2L15A 3DWQA 2B2YC 4JOIA 4A3DH 1FGUA 2MPMA 1EYGA 2JK8A 2RDFA 2D0PA 1TU2B 3GV6A 4NP5A 1JWUD 1TWGH 3D31A 2IX1A 2K33A 4TSSA 2UU9L 4HMIA 2PPBC 3HOWB 3S14B 5EKIA 2L55A 4IUTA 3DWAA 4P2CB 2D0OA 3OMGA 1UAPA 2ZTEA 4JI3Q 1TIID 3WWVA 4NPSA 5DAUA 3S1MB 3M7GA 3OPOA 4OIKA 3CMAA 3BZCA 3KJPA 4RKLA 4HCEA 1HTLD 1U4RA 4IOCA 1S4ZA 2EYOA 2K7VA 2IWHA 5DEHA 1Q7YC 3CQZB 4GOPA 1VQJA 3STBC 4K0KQ 3IKJA 3J81E 4KK7A 4HJ8A 2YTVA 3Q22A 2A73B 3E3XA 4K8JA 4FF1A 2Z6KC 1ESFA 3PIPA 1HHVA 3SK4A 5IGFA 3U4ZA 5EBDA 2HUGA 4K5VA 5EPJA 5IT9L 1CUKA 4IFDG 5GROA 2NZOA 3PO2G 3IAYA 3GTKB 2L1BA 5CMDA 1BVSA 3G7LA 3ULLA 3CCSA 1HNZL 1PHJA 3SR1A 2PYKA 1PTOC 1RHPA 1VQ6A 1LT5D 4MNOA 2CHBD 4GNXB 4LF4Q 4DV2Q 4V190 2A6HC 1SNPA 2NWGA 3GP7A 5CV6A 4RKBA 1JC7A 3J7AV 4DR6Q 2AKWB 1K8OA 1AFPA 1OXXK 1MSHA 3BDCA 2CW0C 1SYGA 3TRZA 2TMPA 4FVMA 2PQAB 3VR5A 4DV7L 5JVH3 3HRZC 1CT1D 4KY6A 3QG1A 2JQOA 5AFWA 2OWOA 2BDNA 4B3SQ 3GTPB 1MD2D 3S9WA 2PNRC 3H09A 2DY7A 2XN9C 5EJWA 1KD1C 2KHIA 4HAEA 3JAME 3KLSA 1SMXA 3U9OA 2VZAA 2NN6I 2XWBB 5CV5A 4KJNA 1FR3A 1C4QA 2QA4A 1EYDA 4KY7A 1EWCA 3KBXA 2F3VA 1PRTD 3EJIA 4V0BA 5IWAL 4R4TA 1EOVA 1JE5A 1S72A 4JI5L 2ASBA 2R7ZB 2KUMA 2KHJA 1N8RC 4X3TA 2KJXA 2ZXPA 4Y52H 2UUCL 4JV5Q 3HKZE 3DM1A 3I4MG 1GUTA 3D0FA 3S1NB 3GO5A 4A3KB 1YIJA 1N36L 3R8BA 1XX8A 1M4VA 3PV0A 3SE0A 4IQZA 2PI2A 4CKBA 2R92H 1I3QB 2LXKA 3SGIA 3NSWA 2QILA 1EEID 4X62L 3J80E 1TS3A 2F0LA 3KLSX 1PH7A 1KXLA 3P75A 1SBBB 4BBRH 4IUPA 3KBGA 3CAMA 3MHBA 4C3JG 1PZID 1X6OA 4LK1C 1SNOA 5C3EB 2QDLA 3CPFA 5KIXA 1A63A 2EIFA 4UP7A 3ERQA 1OXUA 4LF7L 1LT4D 4AQYQ 1F9QA 2HT1A 4JI2Q 1TWAH 1X32A 1D1KA 2G9HD 1KIXA 2F0EA 3HGBA 3F2UA 1NMFA 2G9DA 1K9MC 2CKZB 3I72A 1C9OA 1EWHA 1VQ4A 2FJ2A 3IFDA 2BH8A 1K0SA 3FKIH 3MXGA 4RA8A 5I4DA 2RSOA 3A7LA 1HR0Q 2BE5D 2K05A 1WD1A 2GA4B 3BU2A 3OW2A 3RD4A 1II3A 2NZ1D 1PDQA 3I4NG 2QF7A 3I91A 1SDFA 4DXGA 1SYFA 2E2DC 5BR8Q 3HFZB 1SNQA 3SK6A 1B8AA 3OWEB 3IL8A 1YNND 4ZKCB 2EOTA 2Q2UA 1WTQA 2HCIA 4KHPQ 5KEEA 2QEXA 4LF5L 4IFDH 1ILPA 3T1HQ 1BCPB 1FVIA 1I4PA 1PTOF 1KHIA 5EQ0A 3CU7A 3V2TA 5EKLA 1Y1VB 3O13A 1RF2D 2WKDA 2PZTA 2F52A 3AMUA 2OEOA 1NR4A 4R1JA 3QB3A 1M8AA 1AP0A 5BN5A 5IOCA 4HSPA 4OIJA 1WTPA 2A6ED 3CW2C 1T5XD 2I5HA 4XIGS 5FO9B 1LTID 4DV3Q 4G7ZC 3DEPA 4BY1B 1VF7A 2A8VA 1EQTA 3VYTA 2JYOA 1LTTD 2RHQB 3PO3B 1STEA 1YNJD 1L2FA 2YYZA 2B63H 4KD4A 3CC4A 2YTYA 4DR7L 1DOKA 3S15H 4YIJA 1ML0D 4ZK9B 5COYA 3SK8A 2HCCA 3T16A 2B2UA 4AYBE 1QUQB 4DNRB 1C0AA 4KKSA 1EY0A 1N33Q 5JJKA 1GXDC 4A3IG 1AEXA 2RF4A 3J81c 5JJLA 1Y14B 4PQXA 5IIFA 5IYBH 1I4XA 2HIVA 2B2YA 2IX0A 4GS3A 5IP7H 2R92B 2OQ0A 4XT1B 2A5HA 1DZ1A 3TBIB 1DCZA 4B3TQ 2LFNA 4FXDA 1KLGD 1IBKL 2EYFA 3AEVA 4JI4Q 4A3MB 4UDUC 4DR2Q 1WFQA 1Y69U 1SNMA 2PNHA 2R3ZA 4ZCKA 5C5MA 3KDFB 1MI2A 2B8GA 1Q82C 4DAYB 1CHPD 3HS0C 1RTNA 1KTKA 4XQQA 4B3MQ 3K7UC 2WKCA 3X3MA 2PMZB 2M00A 4EVOA 2O4XA 2KECA 2EQSA 1PH2A 4K14A 4C3JH 4O42A 1D8LA 2WB1G 4GN4B 2F0OA 2Z6KA 3UE1A 1KDCA 4DNIA 1XXGA 5T1GA 2FMMA 2J0TD 3K7AH 3UE0A 2NB0A 3JAMc 3MVVA 2GN5A 3OIQA 3PUXA 5JEAJ 1X3GA 1B9MA 5IY0A 3NK9A 1X3FA 1BBWA 2H1EA 3J81j 3I7FA 1SMYD 1YHQA 1UE7A 5J39A 4DV6Q 1FJGQ 2Z1CA 1KC8C 1X55A 3GTQH 1ZEQX 5CBEE 1MHWC 1EIYB 4FF4A 3OW7A 1YJNA 1XMOQ 2E5LQ 3I4NH 4GLXA 1YNJC 4YY3Q 2E2JH 3PO2B 4KJOA 2YU9B 4G4KA 4HJ5A 2C35B 4NDXA 3T53B 1TWFH 2EYLA 4M8AA 1X54A 4RGOS 1NY4A 4JW0A 1YZ6A 2F4VL 4CDCC 4N8X1 1IYJB 1STHA 3F2CA 1NBWA 4JI6Q 1LTLA 3TZDA 2UXCQ 1UE1A 4A3LH 4O2DA 3E0EA 5D65A 1JORA 2EE1A 1V1PA 1XPUA 2K14A 5FK9C 1PYBA 3HOXH 3FP9A 3RZDH 1UNSA 4E6IA 3QWNA 4YWLA 3W1BA 4IOAA 2NYZD 4OONA 2M2LA 5CC4A 3LWUA 3RUZA 2OTJA 2KA7A 3BYYB 3ONAB 4ID6A 3S15B 2RCNA 1QVCA 1U4LA 4K0KL 5DLQE 5C4XH 1ENCA 4JI8Q 4A93G 1X65A 3CMEA 3U58A 4JBWA 1QE6A 1EL0A 5C4JH 1VQIA 3CKIB 4GNXC 2DNCA 4DAPA 4HJAA 1Q81C 1TY0A 3HP3A 3SHLA 2F0KA 3FPPA 3H91A 4JVZA 1VDZA 1U4PA 2O2LD 1JWSD 1P8LA 3I4MB 4A3IH 2RVLA 1STBA 3KOJA 1Z7TA 3ULPA 1PH3A 4DV2L 4OWTB 1Q3LA 3Q6SA 3MWYW 5KNCA 4JC0A 4GN5A 3K57A 1BR9A 1A15A 4DR6L 5DNFA 3D8GA 2JA8G 1MGSA 4K6DA 3J7YW 1RL2A 1EU4A 3SK5A 4APVA 5CR3A 1SLJA 4KI0A 3HOWH 3MXPA 1PRTB 1C48A 3BVGA 2Z9HA 3AFPA 5BN4A 3F1ZA 4C3JB 4B3SL 1L1OA 1E1TA 5LMNQ 1IBLQ 1BKBA 2MUYA 1H9JA 1PFSA 1BCPD 1WTRA 3D4RA 1RIPA 1DJRD 1AN8A 2DY8A 1Y1WG 3H15A 3H6MA 2QCPX 5CV4A 4I7AA 1T5EA 3K7AB 4LF8Q 1EZ6A 4LFBL 3A8JE 2JE6I 2F0FA 4OHJA 1PH6A 4PV1C 4PNYA 4HJ9A 1KNAA 1ILQA 3CQZH 3TP6A 1RTOA 1ICWA 5M5XH 1L0YB 3VA7A 3HOVG 1EY4A 3CPWA 3CCRA 3GTQB 3H3VH 5E4XA 4JV5L 3GTGH 1AZPA 3AQQA 1GHKA 1KABA 4FDBA 2R93G 3NTIA 5JPMC 5M3FG 3I4NB 3Q8DA 2K4KA 4P71A 1KQSA 4QCLA 1SNCA 1WJJA 2E2JB 5IP9G 3I56A 4GKKQ 1I4GA 3GTKH 1TWFB 1Y8PB 5G3LF 4X65Q 1GJXA 1JOOA 4LF9L 4RGNA 3LWEA 2JP1A 3P20A 1VQOA 2RDGA 5JEAH 3GQBA 1J5EL 1ONLA 1S5DD 1PH1A 1BDOA 3VR2A 1C7YA 3MXNB 1E24A 2ALYB 1NTGA 2E76C 1GUWA 3RZDB 4K6LA 5IT9E 3UDFA 4AQYL 4JI2L 3A54A 4Q0FA 1OO9B 4LFAQ 5M9OA 3GTPH 2E75C 5EAYA 4UP8A 1NCVA 4ZQ3A 1E2WA 4BXXG 2O5IC 1A0IA 3H0GG 1PH5A 2R6GA 2K1BA 4EQOA 2OT2A 4GLAC 5C4JB 3A5UA 3B6YA 5FLXE 1VF5C 5GAHC 4WJWA 4GZYC 4HIKA 3FPUB 1HR0L 3NTHA 1MSGA 2UUAL 4GLVB 3M9BA 4A93H 4K2LA 2SOBA 2PW7A 1CK1A 3TSSA 4A3IB 1EIHA 3W1GA 4XQJA 2PO4A 4A3KH 5M5YH
chains in the Genus database with same CATH topology
1IBMQ 1AH9A 3PV0A 3S2HH 1JMCA 1L1OB 4DR4Q 1E3PA 4KHPL 1YJ9A 2PI2A 4DR1Q 4NXMQ 2R92H 4J15A 4YHHL 4A3DG 2Q2IA 1I3QH 2LXKA 3SGIA 1HNZQ 3ICEA 3M3YH 4R4OA 3U50C 1X9NA 1QUQA 1Z9FA 4UP9A 4X62L 1PH7A 1XNRQ 1OXVA 5E7NA 3HOWG 2Z0SA 1KXLA 4DR5Q 1N34Q 3ZJYC 1XJVA 4BBRH 4LF5Q 2NVQH 2N8NA 3CAMA 4P75A 4GOPB 4LFAL 1X6OA 4P74A 5C3EH 1LUZA 2JA8H 3CPFA 1M1KC 3GTLH 1A63A 5IYDG 4DV3L 5M5WH 4PZ8A 2EIFA 1SR3A 4UP7A 1OXUA 4ME3A 3T1YL 1S40A 4LF7L 4L5TA 4AQYQ 1PH4A 1J6QA 3CCJA 3E9IA 2HT1A 4JI2Q 2ZM6Q 1PH8A 1TWAH 3KYHC 3NELA 1XNQL 3HOUG 3EIVA 1VQ5A 1EIFA 2WB1E 4A3FG 4PZ6A 1XPRA 2HHHL 4OX9Q 3CC7A 4A75A 4LWCA 1KIXA 4R4IA 3M4PA 1NMFA 3A74A 4IFDJ 5IYCH 1K9MC 1VQ9A 2CKZB 3K81C 1V9PA 1LM0A 1C9OA 5C44H 1VQ4A 3KDFA 4P72A 4JI0Q 4LFCQ 1Q8KA 4JI7L 2VL6A 1PA6A 4X64Q 1Y1WH 1NJIC 3PF4A 2BH8A 1L0WA 3CXCA 1I50H 2JA5H 2V1CC 1N33L 3FKIH 2VUMG 4Y7NH 1HR0Q 2AWOA 2ID0A 2JA9A 2Y0SG 3PUYA 1GKHA 3BU2A 2IHEA 5IWAQ 3CCEA 3OW2A 1IBML 3CD6A 3KLWA 1QZGA 3I4NG 4JI5Q 3M4OH 2E8GA 2BA0A 2BA1A 2DGYA 4NXML 4L5QA 3RZOH 3EBEA 2E2IH 5BR8Q 3HFZB 2UUCQ 1N32Q 2JA6G 1B8AA 1YEZA 4B3TL 1VQ7A 2VQFL 2WAQE 1N36Q 1U0LA 1YBYA 5LMUL 1VS0A 5GQOA 5JEAG 2UXDQ 2N3SA 2R93H 1VCIA 2Q2UA 1MJEA 2LSSA 5M3FH 4DR5L 4JI4L 4KHPQ 1JJCB 4MZ9A 2QEXA 4LF5L 4DR2L 4YHHQ 3GTMH 1YHBA 4A4IA 3T1HQ 3HOYH 1FVIA 2XGTA 1KHIA 4OO1G 3AFQA 3ERSX 1MIUA 2AWNA 3GD7A 2NVXH 3PGZA 4X62Q 1X3EA 1Y1VH 5J3BA 2OCEA 1TWCH 3IRBA 1WCMG 2F52A 1K0RA 1KRSA 2WP8J 1I5FA 2IHFA 3KF6B 4R1JA 4B3ML 1HNXL 2UUBQ 1HH2P 1WI5A 1E7ZA 3HOZH 2NVTH 3CW2C 4R4QA 3CCMA 2I5HA 4H02A 4XIGS 4POFA 4DV3Q 3DLLA 4AIMA 1K8AC 3K0XA 3T1YQ 1SRUA 2OQKA 1YI2A 1GM5A 1DGSA 1CKMA 3CCVA 4BY1H 4LF7Q 4LFCL 1Q1EA 2PI2E 4X64L 2CCZA 2CWPA 3KJOA 1XNQQ 2A8VA 3PUVA 2HHHQ 4NXNL 2ZTCA 2RHQB 3PO3H 1YVCA 1L2FA 2YYZA 1UE6A 2B63H 3CC4A 2YTYA 2JA7H 4A3BH 3FHWA 4DR7L 4HIDA 3S15H 4A3GH 4KLKA 3AYHB 4LUOA 1QVFA 2R7ZG 1Q12A 1VQ8A 4DV0L 4JI7Q 4IPDA 4AYBE 5BR8L 1LYLA 1QUQB 3H0GH 4DV6L 1C0AA 1N32L 1ASYA 4WJ3M 5JJKA 1FJGL 1N33Q 4A3IG 3CCLA 2B29A 2RF4A 5M3MG 3J81c 4HIMA 1UEBA 1VQMA 4LF6Q 2IY5B 5JJLA 1Y14B 4A3KG 1A62A 2MQHA 2A19A 5IYBH 1GO3E 2HIVA 2I5MX 2IX0A 4A3EH 2UXDL 4GS3A 5IP7H 1N36L 2OQ0A 3HKZG 1CSPA 3S1RH 1XMOL 2ZJRA 2E5LL 1XMQL 4YY3L 3T1HL 1CSQA 4BBSH 2I5LX 3K8AA 4B3TQ 2ATWA 2B3GA 2VQFQ 4QQBX 2K5HA 2K5NA 4DV4L 4XTCS 5LMUQ 2JEAI 1IBKL 3TREA 2VY3A 1CKOA 4JI4Q 1I94L 3ER0A 4A3MH 1TWHH 4PG3A 3AEVA 2AMCB 4DV5L 1XPOA 3J81i 4DR2Q 4BBRG 2UUBL 4NB3A 4JI6L 1SN8A 1WFQA 1HZAA 2K50A 5GAEC 2N49A 4JI1L 5C3EG 2PNHA 5FJ8H 3KDFB 2MNAA 1YITA 2PMZE 4DAMA 3RN5A 3M7NA 1U5KA 2F4VQ 1CKNA 1VQFA 1Q82C 4DAYB 4A3JH 3UDXA 4BA1I 4B3MQ 3K7UC 3S14H 1HNXQ 1JT8A 3G4SA 5IT9c 3LGJA 4HJ7A 1Z47A 2EQSA 3KF8B 2K52A 4GN3B 1PH2A 3CP0A 4C3JH 5K36G 1Q86C 1D8LA 4X66Q 1S3OA 2WB1G 3A0JA 5IYDH 4GN4B 1Q1BA 2Q2TA 2Z6KA 5C44G 2YTXA 1K3RA 3UE1A 1I6HH 4IJHA 3I4OA 4JI8L 4DNIA 2ZJQA 1W3SA 2I0QA 4NXNQ 3S1MH 2HIXA 3FKIG 1N9WA 3H3VI 3K7AH 3UE0A 3JAMc 4QY7A 4LF6L 1E22A 2GN5A 3PSIA 3F2DA 3PUXA 4A3FH 5JEAJ 1X3GA 3HOUH 4DR7Q 4WJ4A 4YCUA 1P16A 1T9HA 5FLMH 2H5XA 2K5VA 5IY0A 1VQNA 1SFOH 3M4QA 1X3FA 3RLNA 2WFWA 5FLXc 1PV4A 1G6PA 1BBWA 1X56A 3NBHB 3J81j 1G291 3I7FA 4DV0Q 1YHQA 1UE7A 4DV6Q 5JJIA 3HOVH 1FJGQ 4DK6C 1KC8C 4X6AH 4EX5A 1WOCA 2BH2A 1X55A 3GTQH 1YJWA 4R4CA 2ZJPA 2R7DA 5LMNW 2VUMH 4A3CG 1WYDA 3PCOB 4C2MH 1EIYB 3JC66 1B70B 1G51A 3GDEA 1HNWQ 3JAMi 1YJNA 3PIOA 3TQYA 3CF5A 1XMOQ 1EFWA 3M85A 4GLXA 4YY3Q 1XMQQ 2E5LQ 2VQEL 3I4NH 5IP9H 4OWWB 2NZHA 2D62A 2E2JH 2YU9H 4IPGA 3PO2H 4C3IH 4BY7H 4LF4L 4HJ5A 3I55A 2C35B 1TWFH 4L5SA 1VQEA 1JB7A 4OO1I 4DV4Q 4JBJA 1X54A 2JA6H 1NY4A 2VNUD 5H1SE 1IBKQ 1H95A 1YZ6A 1Y1VG 1I94Q 2F4VL 1EUJA 1VQHA 1ASZA 2CQOA 4IO9A 4DV5Q 3OTOL 1NMGA 4MTNA 1IYJB 3BJUA 4IJLA 2N78A 4TQUS 1NBWA 3F2CA 1LTLA 1JJ2A 1VQKA 4JI6Q 2UXCQ 1UE1A 4A3LH 4O2DA 3STBD 3E0EA 4JI1Q 3ULJA 1XPUA 2K14A 3HOXH 1PYBA 1FL0A 3FP9A 3NEMA 4X66L 4HIOA 3RZDH 1W2BA 1HR0W 4JCVE 4YWLA 3K80C 3W1BA 4BY1G 3GTOH 4IOAA 3DM3A 1QZHA 1UE5A 4DV1Q 1PVOA 3PF5A 4OONA 1PH9A 1SE8A 3J7A5 4DUZL 1WCMH 4GNXA 4QL5A 3G6EA 1E1OA 3PO3G 4AH6A 2OTJA 2XTIA 1IXRA 2B63G 4A3BG 3A5ZB 2RCNA 4TVAB 4QGUA 4DUYL 2MO1A 2LXJA 2MFIA 3J80i 3TEHB 1QVCA 4O0AA 4K0KL 2R7FA 5DLQE 4BXXH 3CCQA 5C4XH 2NN6G 1PYSB 5AJ3L 1AE3A 4JI8Q 3J7ZC 1X65A 3CMEA 3U58A 1EQQA 4A93G 2PQAA 4JBWA 4A76A 4EQ5A 4GKJL 4LFBQ 3RLOA 5C4JH 1SROA 1NE3A 1VQIA 2CFMA 4LUZA 2K75A 4OXPA 2NVYH 1IL2A 4AYBG 4GNXC 5IYBG 4HJAA 3E9HA 1M90C 1HNWL 1Q81C 5IP7G 2R92G 4OWXB 4DR3L 2FXQA 1B7YB 2R7ZH 1GVPA 4PZ7A 3UDGA 4GKKL 4PMWA 1K8GA 1OTCA 4DPGA 5GAGC 1CKNB 3BZKA 4X65L 1P8LA 4GKKQ 3I4MH 1BBUA 5C0XG 4A3IH 2IT1A 3NENA 2KENA 3KOJA 3ULPA 1PH3A 1KAWA 2DUDA 3S1NH 4A3MG 3L7ZC 4IPHA 4DV2L 2L15A 4OWTB 4ALPA 2E2HH 1V43A 2VQEQ 4JC0A 3S24A 4DK3C 2UXCL 1UWVA 2YV5A 4GN5A 3CC2A 4JOIA 2HQLA 4DR6L 4A3DH 1FGUA 1VQAA 1EYGA 1HZ9A 2JK8A 1GD7A 5ELNA 5FJ8G 1QVGA 2D0PA 2JA8G 4LF9Q 2UXBL 1RL2A 1TWGH 3D31A 4IPCA 4APVA 2IX1A 1SLJA 3KFUA 2UU9L 2CWAA 2RHSB 1K73C 3OTOQ 4A3JG 4KI0A 3G48A 4DV1L 4POGA 1EQRA 3HOWH 1J5EQ 3G71A 4JBMA 1D7QA 3AFPA 2EXDA 2D0OA 2JEBI 3F1ZA 3UDIA 1YHAA 2JJQA 1L1OA 1E1TA 3F2BA 2F3IA 5LMNQ 3RLFA 1BKBA 5IYCG 2ZTEA 3HKSA 1R9TH 1PFSA 1IBLQ 4JOIC 4JI3Q 1RIPA 1Q46A 5HY6A 3WWVA 4NPSA 4YCVA 1TXYA 1Y1WG 5ELOA 3H15A 2A1AA 4B3RL 4DV7Q 2JA5G 3CMAA 4DUZQ 3BZCA 3KJPA 4LF8Q 4LFBL 1OXTA 2JE6I 1PH6A 3S1QH 4IOCA 2QGQA 5FLMG 4DUYQ 4HJ9A 1Q7YC 3CQZH 1VQCA 1VQJA 4GOPA 3STBC 4K0KQ 1L1OC 2GVBA 2VW9A 5M5XH 5AJ3Q 1IZ6A 4HJ8A 2YTVA 3VDYA 3HOVG 4P73A 2Y0SE 4GKJQ 3CPWA 3CCRA 2Z6KC 3H3VH 3PIPA 4JV5L 3GTGH 3U4ZA 3AQQA 4FDBA 1EWIA 1MKHA 4LUVA 2R93G 4JYAL 5M3FG 3Q8DA 4DR3Q 2K4KA 2WAQG 1CUKA 4P71A 1KQSA 4IFDG 1WJJA 2AHOB 3HOYG 4DR4L 5GROA 5IP9G 2NZOA 3I56A 3CCUA 4DR1L 4GOPC 3PO2G 4BA2I 2UUAQ 4BY7G 4RG1A 4YWMA 3GTKH 4IFDI 2KCTA 1BVSA 1HNZL 2VS1A 3ULLA 4X65Q 3CCSA 1PHJA 4LF9L 1VQ6A 4MNOA 1JJGA 3TS0A 3RN2A 4GNXB 3L0OA 1VQOA 4LF4Q 4DV2Q 4A3CH 1HZBA 3S2DH 1J5EL 1XNRL 1HZCA 1MJCA 2KCMA 1PH1A 3J80c 1N34L 3I2ZA 1OXSC 4A3LG 1C7YA 4DR6Q 2AKWB 3HOZG 4C3HH 2ES2A 3MXNB 1OXXK 1E24A 2ALYB 4QJFA 1NTGA 3OYYA 3L2PA 1V1QA 2GVAA 5LMNL 1IBLL 4UPAA 3S16H 3TRZA 2UXBQ 3HOXG 4JI3L 5IE8A 4LW1A 2PQAB 2UU9Q 3S17H 3UDFA 3PUWA 1YNXA 2ZTDA 4DV7L 4RMFA 4AQYL 1VQLA 1XTDA 4LF8L 2ZM6L 4JI2L 1VQDA 4JBKA 2JQOA 2MO0A 4LFAQ 2OWOA 4B3SQ 3U4VA 1O7IA 3W5OA 5EAYA 4OX9L 2JA7G 3GTPH 4UP8A 4A3GG 4DKAC 3GTJH 5GADC 1KRTA 1AE2A 1KD1C 2KHIA 1KL9A 4B3SL 1VQBA 3PUZA 4BXXG 1A0IA 4JG2A 3H0GG 1PH5A 2R6GA 4B3RQ 5C4XG 1SMXA 2VZAA 2NN6I 3EN2A 4JI0L 2QA4A 4GLAC 5C0XJ 4L5RC 3A5UA 3MEFA 1VQPA 3B6YA 5GAHC 4HIKA 1A8VA 1HR0L 4A3EG 3KF6A 3F8TA 5IWAL 4R4TA 1EOVA 1JE5A 1S72A 4JI5L 4LNQA 2ASBA 4YCWA 1VQGA 4BBSG 2KHJA 4UY8C 3TS2A 2UUAL 1N8RC 4GLVB 3M9BA 1K83H 1HJPA 4QIWE 4A93H 4Y52H 2Q2HA 2UUCL 5HGQA 4YWKA 4JV5Q 3RNUA 3HKZE 3I4MG 3RR5A 5M3MH 2KBNA 3W1GA 4KHZA 3D0FA 5C0XI 2OTLA 3GO5A 4A3KH 1YIJA 4JYAQ 5M5YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM Q;  1AH9 A;  3PV0 A;  3S2H H;  1JMC A;  1L1O B;  4DR4 Q;  1E3P A;  4KHP L;  1YJ9 A;  2PI2 A;  4DR1 Q;  4NXM Q;  2R92 H;  4J15 A;  4YHH L;  4A3D G;  2Q2I A;  1I3Q H;  2LXK A;  3SGI A;  1HNZ Q;  3ICE A;  3M3Y H;  4R4O A;  3U50 C;  1X9N A;  1QUQ A;  1Z9F A;  4UP9 A;  4X62 L;  1PH7 A;  1XNR Q;  1OXV A;  5E7N A;  3HOW G;  2Z0S A;  1KXL A;  4DR5 Q;  1N34 Q;  3ZJY C;  1XJV A;  4BBR H;  4LF5 Q;  2NVQ H;  2N8N A;  3CAM A;  4P75 A;  4GOP B;  4LFA L;  1X6O A;  4P74 A;  5C3E H;  1LUZ A;  2JA8 H;  3CPF A;  1M1K C;  3GTL H;  1A63 A;  5IYD G;  4DV3 L;  5M5W H;  4PZ8 A;  2EIF A;  1SR3 A;  4UP7 A;  1OXU A;  4ME3 A;  3T1Y L;  1S40 A;  4LF7 L;  4L5T A;  4AQY Q;  1PH4 A;  1J6Q A;  3CCJ A;  3E9I A;  2HT1 A;  4JI2 Q;  2ZM6 Q;  1PH8 A;  1TWA H;  3KYH C;  3NEL A;  1XNQ L;  3HOU G;  3EIV A;  1VQ5 A;  1EIF A;  2WB1 E;  4A3F G;  4PZ6 A;  1XPR A;  2HHH L;  4OX9 Q;  3CC7 A;  4A75 A;  4LWC A;  1KIX A;  4R4I A;  3M4P A;  1NMF A;  3A74 A;  4IFD J;  5IYC H;  1K9M C;  1VQ9 A;  2CKZ B;  3K81 C;  1V9P A;  1LM0 A;  1C9O A;  5C44 H;  1VQ4 A;  3KDF A;  4P72 A;  4JI0 Q;  4LFC Q;  1Q8K A;  4JI7 L;  2VL6 A;  1PA6 A;  4X64 Q;  1Y1W H;  1NJI C;  3PF4 A;  2BH8 A;  1L0W A;  3CXC A;  1I50 H;  2JA5 H;  2V1C C;  1N33 L;  3FKI H;  2VUM G;  4Y7N H;  1HR0 Q;  2AWO A;  2ID0 A;  2JA9 A;  2Y0S G;  3PUY A;  1GKH A;  3BU2 A;  2IHE A;  5IWA Q;  3CCE A;  3OW2 A;  1IBM L;  3CD6 A;  3KLW A;  1QZG A;  3I4N G;  4JI5 Q;  3M4O H;  2E8G A;  2BA0 A;  2BA1 A;  2DGY A;  4NXM L;  4L5Q A;  3RZO H;  3EBE A;  2E2I H;  5BR8 Q;  3HFZ B;  2UUC Q;  1N32 Q;  2JA6 G;  1B8A A;  1YEZ A;  4B3T L;  1VQ7 A;  2VQF L;  2WAQ E;  1N36 Q;  1U0L A;  1YBY A;  5LMU L;  1VS0 A;  5GQO A;  5JEA G;  2UXD Q;  2N3S A;  2R93 H;  1VCI A;  2Q2U A;  1MJE A;  2LSS A;  5M3F H;  4DR5 L;  4JI4 L;  4KHP Q;  1JJC B;  4MZ9 A;  2QEX A;  4LF5 L;  4DR2 L;  4YHH Q;  3GTM H;  1YHB A;  4A4I A;  3T1H Q;  3HOY H;  1FVI A;  2XGT A;  1KHI A;  4OO1 G;  3AFQ A;  3ERS X;  1MIU A;  2AWN A;  3GD7 A;  2NVX H;  3PGZ A;  4X62 Q;  1X3E A;  1Y1V H;  5J3B A;  2OCE A;  1TWC H;  3IRB A;  1WCM G;  2F52 A;  1K0R A;  1KRS A;  2WP8 J;  1I5F A;  2IHF A;  3KF6 B;  4R1J A;  4B3M L;  1HNX L;  2UUB Q;  1HH2 P;  1WI5 A;  1E7Z A;  3HOZ H;  2NVT H;  3CW2 C;  4R4Q A;  3CCM A;  2I5H A;  4H02 A;  4XIG S;  4POF A;  4DV3 Q;  3DLL A;  4AIM A;  1K8A C;  3K0X A;  3T1Y Q;  1SRU A;  2OQK A;  1YI2 A;  1GM5 A;  1DGS A;  1CKM A;  3CCV A;  4BY1 H;  4LF7 Q;  4LFC L;  1Q1E A;  2PI2 E;  4X64 L;  2CCZ A;  2CWP A;  3KJO A;  1XNQ Q;  2A8V A;  3PUV A;  2HHH Q;  4NXN L;  2ZTC A;  2RHQ B;  3PO3 H;  1YVC A;  1L2F A;  2YYZ A;  1UE6 A;  2B63 H;  3CC4 A;  2YTY A;  2JA7 H;  4A3B H;  3FHW A;  4DR7 L;  4HID A;  3S15 H;  4A3G H;  4KLK A;  3AYH B;  4LUO A;  1QVF A;  2R7Z G;  1Q12 A;  1VQ8 A;  4DV0 L;  4JI7 Q;  4IPD A;  4AYB E;  5BR8 L;  1LYL A;  1QUQ B;  3H0G H;  4DV6 L;  1C0A A;  1N32 L;  1ASY A;  4WJ3 M;  5JJK A;  1FJG L;  1N33 Q;  4A3I G;  3CCL A;  2B29 A;  2RF4 A;  5M3M G;  3J81 c;  4HIM A;  1UEB A;  1VQM A;  4LF6 Q;  2IY5 B;  5JJL A;  1Y14 B;  4A3K G;  1A62 A;  2MQH A;  2A19 A;  5IYB H;  1GO3 E;  2HIV A;  2I5M X;  2IX0 A;  4A3E H;  2UXD L;  4GS3 A;  5IP7 H;  1N36 L;  2OQ0 A;  3HKZ G;  1CSP A;  3S1R H;  1XMO L;  2ZJR A;  2E5L L;  1XMQ L;  4YY3 L;  3T1H L;  1CSQ A;  4BBS H;  2I5L X;  3K8A A;  4B3T Q;  2ATW A;  2B3G A;  2VQF Q;  4QQB X;  2K5H A;  2K5N A;  4DV4 L;  4XTC S;  5LMU Q;  2JEA I;  1IBK L;  3TRE A;  2VY3 A;  1CKO A;  4JI4 Q;  1I94 L;  3ER0 A;  4A3M H;  1TWH H;  4PG3 A;  3AEV A;  2AMC B;  4DV5 L;  1XPO A;  3J81 i;  4DR2 Q;  4BBR G;  2UUB L;  4NB3 A;  4JI6 L;  1SN8 A;  1WFQ A;  1HZA A;  2K50 A;  5GAE C;  2N49 A;  4JI1 L;  5C3E G;  2PNH A;  5FJ8 H;  3KDF B;  2MNA A;  1YIT A;  2PMZ E;  4DAM A;  3RN5 A;  3M7N A;  1U5K A;  2F4V Q;  1CKN A;  1VQF A;  1Q82 C;  4DAY B;  4A3J H;  3UDX A;  4BA1 I;  4B3M Q;  3K7U C;  3S14 H;  1HNX Q;  1JT8 A;  3G4S A;  5IT9 c;  3LGJ A;  4HJ7 A;  1Z47 A;  2EQS A;  3KF8 B;  2K52 A;  4GN3 B;  1PH2 A;  3CP0 A;  4C3J H;  5K36 G;  1Q86 C;  1D8L A;  4X66 Q;  1S3O A;  2WB1 G;  3A0J A;  5IYD H;  4GN4 B;  1Q1B A;  2Q2T A;  2Z6K A;  5C44 G;  2YTX A;  1K3R A;  3UE1 A;  1I6H H;  4IJH A;  3I4O A;  4JI8 L;  4DNI A;  2ZJQ A;  1W3S A;  2I0Q A;  4NXN Q;  3S1M H;  2HIX A;  3FKI G;  1N9W A;  3H3V I;  3K7A H;  3UE0 A;  3JAM c;  4QY7 A;  4LF6 L;  1E22 A;  2GN5 A;  3PSI A;  3F2D A;  3PUX A;  4A3F H;  5JEA J;  1X3G A;  3HOU H;  4DR7 Q;  4WJ4 A;  4YCU A;  1P16 A;  1T9H A;  5FLM H;  2H5X A;  2K5V A;  5IY0 A;  1VQN A;  1SFO H;  3M4Q A;  1X3F A;  3RLN A;  2WFW A;  5FLX c;  1PV4 A;  1G6P A;  1BBW A;  1X56 A;  3NBH B;  3J81 j;  1G29 1;  3I7F A;  4DV0 Q;  1YHQ A;  1UE7 A;  4DV6 Q;  5JJI A;  3HOV H;  1FJG Q;  4DK6 C;  1KC8 C;  4X6A H;  4EX5 A;  1WOC A;  2BH2 A;  1X55 A;  3GTQ H;  1YJW A;  4R4C A;  2ZJP A;  2R7D A;  5LMN W;  2VUM H;  4A3C G;  1WYD A;  3PCO B;  4C2M H;  1EIY B;  3JC6 6;  1B70 B;  1G51 A;  3GDE A;  1HNW Q;  3JAM i;  1YJN A;  3PIO A;  3TQY A;  3CF5 A;  1XMO Q;  1EFW A;  3M85 A;  4GLX A;  4YY3 Q;  1XMQ Q;  2E5L Q;  2VQE L;  3I4N H;  5IP9 H;  4OWW B;  2NZH A;  2D62 A;  2E2J H;  2YU9 H;  4IPG A;  3PO2 H;  4C3I H;  4BY7 H;  4LF4 L;  4HJ5 A;  3I55 A;  2C35 B;  1TWF H;  4L5S A;  1VQE A;  1JB7 A;  4OO1 I;  4DV4 Q;  4JBJ A;  1X54 A;  2JA6 H;  1NY4 A;  2VNU D;  5H1S E;  1IBK Q;  1H95 A;  1YZ6 A;  1Y1V G;  1I94 Q;  2F4V L;  1EUJ A;  1VQH A;  1ASZ A;  2CQO A;  4IO9 A;  4DV5 Q;  3OTO L;  1NMG A;  4MTN A;  1IYJ B;  3BJU A;  4IJL A;  2N78 A;  4TQU S;  1NBW A;  3F2C A;  1LTL A;  1JJ2 A;  1VQK A;  4JI6 Q;  2UXC Q;  1UE1 A;  4A3L H;  4O2D A;  3STB D;  3E0E A;  4JI1 Q;  3ULJ A;  1XPU A;  2K14 A;  3HOX H;  1PYB A;  1FL0 A;  3FP9 A;  3NEM A;  4X66 L;  4HIO A;  3RZD H;  1W2B A;  1HR0 W;  4JCV E;  4YWL A;  3K80 C;  3W1B A;  4BY1 G;  3GTO H;  4IOA A;  3DM3 A;  1QZH A;  1UE5 A;  4DV1 Q;  1PVO A;  3PF5 A;  4OON A;  1PH9 A;  1SE8 A;  3J7A 5;  4DUZ L;  1WCM H;  4GNX A;  4QL5 A;  3G6E A;  1E1O A;  3PO3 G;  4AH6 A;  2OTJ A;  2XTI A;  1IXR A;  2B63 G;  4A3B G;  3A5Z B;  2RCN A;  4TVA B;  4QGU A;  4DUY L;  2MO1 A;  2LXJ A;  2MFI A;  3J80 i;  3TEH B;  1QVC A;  4O0A A;  4K0K L;  2R7F A;  5DLQ E;  4BXX H;  3CCQ A;  5C4X H;  2NN6 G;  1PYS B;  5AJ3 L;  1AE3 A;  4JI8 Q;  3J7Z C;  1X65 A;  3CME A;  3U58 A;  1EQQ A;  4A93 G;  2PQA A;  4JBW A;  4A76 A;  4EQ5 A;  4GKJ L;  4LFB Q;  3RLO A;  5C4J H;  1SRO A;  1NE3 A;  1VQI A;  2CFM A;  4LUZ A;  2K75 A;  4OXP A;  2NVY H;  1IL2 A;  4AYB G;  4GNX C;  5IYB G;  4HJA A;  3E9H A;  1M90 C;  1HNW L;  1Q81 C;  5IP7 G;  2R92 G;  4OWX B;  4DR3 L;  2FXQ A;  1B7Y B;  2R7Z H;  1GVP A;  4PZ7 A;  3UDG A;  4GKK L;  4PMW A;  1K8G A;  1OTC A;  4DPG A;  5GAG C;  1CKN B;  3BZK A;  4X65 L;  1P8L A;  4GKK Q;  3I4M H;  1BBU A;  5C0X G;  4A3I H;  2IT1 A;  3NEN A;  2KEN A;  3KOJ A;  3ULP A;  1PH3 A;  1KAW A;  2DUD A;  3S1N H;  4A3M G;  3L7Z C;  4IPH A;  4DV2 L;  2L15 A;  4OWT B;  4ALP A;  2E2H H;  1V43 A;  2VQE Q;  4JC0 A;  3S24 A;  4DK3 C;  2UXC L;  1UWV A;  2YV5 A;  4GN5 A;  3CC2 A;  4JOI A;  2HQL A;  4DR6 L;  4A3D H;  1FGU A;  1VQA A;  1EYG A;  1HZ9 A;  2JK8 A;  1GD7 A;  5ELN A;  5FJ8 G;  1QVG A;  2D0P A;  2JA8 G;  4LF9 Q;  2UXB L;  1RL2 A;  1TWG H;  3D31 A;  4IPC A;  4APV A;  2IX1 A;  1SLJ A;  3KFU A;  2UU9 L;  2CWA A;  2RHS B;  1K73 C;  3OTO Q;  4A3J G;  4KI0 A;  3G48 A;  4DV1 L;  4POG A;  1EQR A;  3HOW H;  1J5E Q;  3G71 A;  4JBM A;  1D7Q A;  3AFP A;  2EXD A;  2D0O A;  2JEB I;  3F1Z A;  3UDI A;  1YHA A;  2JJQ A;  1L1O A;  1E1T A;  3F2B A;  2F3I A;  5LMN Q;  3RLF A;  1BKB A;  5IYC G;  2ZTE A;  3HKS A;  1R9T H;  1PFS A;  1IBL Q;  4JOI C;  4JI3 Q;  1RIP A;  1Q46 A;  5HY6 A;  3WWV A;  4NPS A;  4YCV A;  1TXY A;  1Y1W G;  5ELO A;  3H15 A;  2A1A A;  4B3R L;  4DV7 Q;  2JA5 G;  3CMA A;  4DUZ Q;  3BZC A;  3KJP A;  4LF8 Q;  4LFB L;  1OXT A;  2JE6 I;  1PH6 A;  3S1Q H;  4IOC A;  2QGQ A;  5FLM G;  4DUY Q;  4HJ9 A;  1Q7Y C;  3CQZ H;  1VQC A;  1VQJ A;  4GOP A;  3STB C;  4K0K Q;  1L1O C;  2GVB A;  2VW9 A;  5M5X H;  5AJ3 Q;  1IZ6 A;  4HJ8 A;  2YTV A;  3VDY A;  3HOV G;  4P73 A;  2Y0S E;  4GKJ Q;  3CPW A;  3CCR A;  2Z6K C;  3H3V H;  3PIP A;  4JV5 L;  3GTG H;  3U4Z A;  3AQQ A;  4FDB A;  1EWI A;  1MKH A;  4LUV A;  2R93 G;  4JYA L;  5M3F G;  3Q8D A;  4DR3 Q;  2K4K A;  2WAQ G;  1CUK A;  4P71 A;  1KQS A;  4IFD G;  1WJJ A;  2AHO B;  3HOY G;  4DR4 L;  5GRO A;  5IP9 G;  2NZO A;  3I56 A;  3CCU A;  4DR1 L;  4GOP C;  3PO2 G;  4BA2 I;  2UUA Q;  4BY7 G;  4RG1 A;  4YWM A;  3GTK H;  4IFD I;  2KCT A;  1BVS A;  1HNZ L;  2VS1 A;  3ULL A;  4X65 Q;  3CCS A;  1PHJ A;  4LF9 L;  1VQ6 A;  4MNO A;  1JJG A;  3TS0 A;  3RN2 A;  4GNX B;  3L0O A;  1VQO A;  4LF4 Q;  4DV2 Q;  4A3C H;  1HZB A;  3S2D H;  1J5E L;  1XNR L;  1HZC A;  1MJC A;  2KCM A;  1PH1 A;  3J80 c;  1N34 L;  3I2Z A;  1OXS C;  4A3L G;  1C7Y A;  4DR6 Q;  2AKW B;  3HOZ G;  4C3H H;  2ES2 A;  3MXN B;  1OXX K;  1E24 A;  2ALY B;  4QJF A;  1NTG A;  3OYY A;  3L2P A;  1V1Q A;  2GVA A;  5LMN L;  1IBL L;  4UPA A;  3S16 H;  3TRZ A;  2UXB Q;  3HOX G;  4JI3 L;  5IE8 A;  4LW1 A;  2PQA B;  2UU9 Q;  3S17 H;  3UDF A;  3PUW A;  1YNX A;  2ZTD A;  4DV7 L;  4RMF A;  4AQY L;  1VQL A;  1XTD A;  4LF8 L;  2ZM6 L;  4JI2 L;  1VQD A;  4JBK A;  2JQO A;  2MO0 A;  4LFA Q;  2OWO A;  4B3S Q;  3U4V A;  1O7I A;  3W5O A;  5EAY A;  4OX9 L;  2JA7 G;  3GTP H;  4UP8 A;  4A3G G;  4DKA C;  3GTJ H;  5GAD C;  1KRT A;  1AE2 A;  1KD1 C;  2KHI A;  1KL9 A;  4B3S L;  1VQB A;  3PUZ A;  4BXX G;  1A0I A;  4JG2 A;  3H0G G;  1PH5 A;  2R6G A;  4B3R Q;  5C4X G;  1SMX A;  2VZA A;  2NN6 I;  3EN2 A;  4JI0 L;  2QA4 A;  4GLA C;  5C0X J;  4L5R C;  3A5U A;  3MEF A;  1VQP A;  3B6Y A;  5GAH C;  4HIK A;  1A8V A;  1HR0 L;  4A3E G;  3KF6 A;  3F8T A;  5IWA L;  4R4T A;  1EOV A;  1JE5 A;  1S72 A;  4JI5 L;  4LNQ A;  2ASB A;  4YCW A;  1VQG A;  4BBS G;  2KHJ A;  4UY8 C;  3TS2 A;  2UUA L;  1N8R C;  4GLV B;  3M9B A;  1K83 H;  1HJP A;  4QIW E;  4A93 H;  4Y52 H;  2Q2H A;  2UUC L;  5HGQ A;  4YWK A;  4JV5 Q;  3RNU A;  3HKZ E;  3I4M G;  3RR5 A;  5M3M H;  2KBN A;  3W1G A;  4KHZ A;  3D0F A;  5C0X I;  2OTL A;  3GO5 A;  4A3K H;  1YIJ A;  4JYA Q;  5M5Y H; 
#chains in the Genus database with same CATH topology
 4QIW B;  1IBM Q;  2EYM A;  3T56 B;  4DR4 Q;  1S5E D;  4KHP L;  4DR1 Q;  1F2M A;  2DJG C;  4RHR A;  1I3Q H;  5JAV A;  1DD2 A;  2F1M A;  4R4O A;  3NUC A;  3K5N A;  2TSS A;  1XNR Q;  1OXV A;  5E7N A;  4ZKB B;  3TDQ A;  4DR5 Q;  3ZJY C;  3FVQ A;  4P75 A;  4GOP B;  1EEF D;  2F0M A;  3I70 A;  5C3E H;  1SYE A;  2JSO A;  2JA8 H;  5IYD G;  4DV3 L;  2EJF C;  1STA A;  1FGB D;  1S5B D;  2EYP A;  1R4P B;  2EY1 A;  3E9I A;  2ZM6 Q;  3MA2 B;  3KYH C;  1SE2 A;  3HOU G;  3EIV A;  4OX9 Q;  4PZ6 A;  1SAP A;  3NTK A;  4A75 A;  4LWC A;  4R4I A;  5C6A A;  3Q24 A;  4IFD J;  1VQ9 A;  5M5X B;  2WB1 B;  4KY5 A;  2WII B;  4XYQ A;  1WTH A;  2XWJ B;  2VL6 A;  3PF4 A;  1Y1W H;  1L0W A;  1E0B A;  2V1C C;  2Q8I B;  1N33 L;  5IGG A;  3GTG B;  4Y7N H;  2Y0S G;  1GKH A;  3CD6 A;  1IKL A;  4CJ0 B;  4Q5V A;  3M4O B;  5D14 A;  4EQN A;  1TS2 A;  2BA0 A;  4NXM L;  1SSO A;  3EBE A;  4LAA A;  2JA6 G;  1ESR A;  4B3T L;  2K5Q A;  1VQ7 A;  5C3X A;  1U0L A;  1YBY A;  3MXU A;  2PCF B;  1ENA A;  1VS0 A;  1PFM A;  2R93 H;  1VCI A;  4JI4 L;  5M3F H;  3VR4 A;  3GTM B;  4DR2 L;  4YHH Q;  4A4I A;  1V8Q A;  2PZU A;  2QW7 A;  4OO1 G;  2Z4H A;  3NBH A;  1U4M A;  3AFQ A;  2AWN A;  1Y1V H;  5J3B A;  3TME A;  2OCE A;  1TWC H;  5CYU A;  3KLR A;  1WCM G;  2SNM A;  3L9A X;  1K0R A;  1KRS A;  1I5F A;  2IHF A;  1HTP A;  4B3M L;  1TVX A;  2UUB Q;  1RCV D;  1WI5 A;  2NVT H;  3CCM A;  1K8A C;  3K0X A;  3T1Y Q;  1GM5 A;  2OQK A;  2LY7 A;  3TP7 A;  4BY1 H;  5E3F A;  4LFC L;  2FIN B;  4X64 L;  2CWP A;  1XNQ Q;  3PUV A;  2HHH Q;  2ZTC A;  3PO3 H;  2F0S A;  2NTS A;  3FHW A;  2L5T A;  3AYH B;  4LUO A;  1QVF A;  1Q12 A;  4JI7 Q;  2NN6 H;  3NQT A;  4A93 B;  3H0G H;  4DV6 L;  1N32 L;  1FJG L;  3CCL A;  2KCN A;  4LMQ D;  2B29 A;  5M3M G;  1VQM A;  1UEB A;  2IY5 B;  5M5Y B;  2A69 D;  2ZXO A;  2FHT A;  2A19 A;  4ZRZ A;  2I5M X;  2UXD L;  4XT3 B;  4HN7 A;  2IPK D;  3R3O A;  1BCP F;  3S1R H;  1D1I A;  1XMO L;  2E5L L;  1O7Z A;  4YY3 L;  3RMH A;  1FNW A;  1GUN A;  2I5L X;  3K8A A;  3NWS A;  2K5H A;  1WTX A;  4XTC S;  5LMU Q;  3TRE A;  3EVQ A;  3P1H A;  3H94 A;  4A3M H;  1A3T A;  2XVS A;  1XPO A;  2RQX A;  3QR8 A;  1ZXT A;  1STN A;  4B08 A;  1FYC A;  2K32 A;  2XNA C;  4JI6 L;  1HZA A;  3UI2 A;  2K50 A;  1B44 D;  1ZYR D;  2JA8 B;  2N49 A;  2MNA A;  2F4I A;  2EY5 A;  2PMZ E;  2IX3 A;  2G5D A;  3RN5 A;  2KOL A;  1U5K A;  1CKN A;  3Q0A A;  1HXY D;  4ZYS A;  4BA1 I;  4DXF A;  3G4S A;  5IT9 c;  2ZT9 C;  2K52 A;  3K6O A;  5K36 G;  1S3O A;  2F3W A;  5IYD H;  5C44 G;  1Y1W B;  1K3R A;  4IJH A;  4JI8 L;  4IUR A;  4Y7N B;  2HIX A;  1A3U A;  1N9W A;  4LF6 L;  3HOU H;  4CKC A;  1T9H A;  2H5X A;  3M4Q A;  5FLX c;  4ABN A;  4DV0 Q;  1G29 1;  3URY A;  5JJI A;  3HOV B;  4DK6 C;  1JIC A;  3NXW A;  3T4A C;  2ZJP A;  5LMN W;  1BXT A;  3W2D A;  4A3C G;  1WYD A;  1D5M C;  1NAP A;  2R93 B;  4MIU A;  1STG A;  5M3F B;  1HNW Q;  1A2T A;  1PFN A;  1PRT C;  3M85 A;  3K58 A;  3TZU A;  1QWY A;  1XMQ Q;  1EFW A;  4OWW B;  3PO2 H;  2D62 A;  2YU9 H;  1TS5 A;  4IAL A;  1NUC A;  1KDA A;  4OO1 I;  1JB7 A;  2VNU D;  4DV4 Q;  4JBJ A;  2JA6 H;  4RFB A;  5H1S E;  2B2T A;  1TWC B;  2X6G A;  1EUJ A;  4DV5 Q;  4DA2 A;  3JAM L;  4IJL A;  2N78 A;  2PZW A;  4TQU S;  1JJ2 A;  1VQK A;  1H9S A;  2NVT B;  4R9W A;  4JI1 Q;  4ME5 A;  3ULJ A;  1JR0 D;  1A2U A;  3GV3 A;  3NEM A;  4X66 L;  3ZYY X;  1W2B A;  4UAI A;  3BZD B;  3GTO H;  2XIW A;  2K28 A;  4FXK C;  4M1U B;  4Z9C B;  1PVO A;  2RSN A;  2K04 A;  1WCM H;  2XTI A;  5F2D A;  4A3B G;  3A5Z B;  4QMG A;  1X3Q A;  2EJG C;  4TRD A;  4DF7 A;  2B2V A;  4DGZ A;  2LXJ A;  4RAU C;  3E5S A;  4J6H A;  3CCQ A;  3H0G B;  2FFK B;  1AE3 A;  2KED A;  3EFX D;  4A76 A;  1F2Z A;  4EQ5 A;  1JQY D;  2X69 A;  4KHV A;  1ET9 A;  1GUG A;  1SRO A;  5I9O A;  2K75 A;  1IL2 A;  1JOK A;  3S1R B;  4OWX B;  1DOM A;  1HFG A;  1GVP A;  2F0V A;  4PZ7 A;  3UDG A;  4GKK L;  1K8G A;  3SDZ A;  4DPG A;  5GAG C;  1ROD A;  3BZK A;  4X65 L;  1TT2 A;  3I4M H;  5C0X G;  1IL8 A;  1O78 A;  2MP1 A;  4MN3 A;  4ALP A;  2BE5 C;  1V43 A;  2VQE Q;  1GUS A;  3S24 A;  1UWV A;  2YV5 A;  3NP8 A;  2SDF A;  4KN4 C;  1GD7 A;  5ELN A;  2ENB A;  5FJ8 G;  1QVG A;  1EOT A;  1ENF A;  1K3B C;  3OIP A;  4IPC A;  1X3P A;  3KFU A;  3DEO A;  1K73 C;  2RHS B;  4RCO A;  4A3J G;  4POG A;  3G48 A;  4DV1 L;  1EQR A;  4X3U A;  4JBM A;  1YNN C;  2OF1 A;  2F03 A;  1D7Q A;  3BVZ A;  3UDI A;  1YHA A;  3OWF A;  1HPC A;  1STY A;  2JJQ A;  1XYI A;  3FRP B;  2ICE C;  3HKS A;  4JOI C;  1Q46 A;  5HY6 A;  1BQQ T;  3PMF A;  5ELO A;  2A1A A;  1NR2 A;  4DV7 Q;  4DUZ Q;  2SNS A;  2JA5 G;  1LT6 D;  1J8I A;  2XRS D;  3HOU B;  3S1Q H;  1TQO A;  2H4O A;  2QGQ A;  2HD3 A;  4HTH A;  4N9T A;  5FLM G;  4DUY Q;  4H13 C;  5K36 H;  1ZKO A;  2A6E C;  2LKV A;  1QOH A;  3VDY A;  4P73 A;  4WFN 3;  4OL7 A;  3K59 A;  4GKJ Q;  2J4X A;  3BVM A;  5HGT A;  2F0P A;  1QJO A;  5K5P A;  5ELB A;  5ELF A;  1EWI A;  2Y0S B;  4PMB A;  4HCS A;  5LHY 1;  1SXT A;  1V1P B;  3D6W A;  4DR4 L;  3HOY G;  4BA2 I;  4DR1 L;  1MBY A;  4GOP C;  2PQE A;  3P7J A;  4BY7 G;  4C3I G;  5JOB A;  2VS1 A;  3WOE A;  2F0G A;  2JA6 B;  3A8I E;  2WV6 D;  4HED A;  5J22 A;  3L0O A;  1A3V A;  4KV6 A;  4A3C H;  1PRT F;  5LL6 S;  3S2D B;  1XNR L;  2KCM A;  4F7X A;  3J80 c;  3I2Z A;  1OXS C;  4RWS C;  3HOZ G;  4C1N I;  2ES2 A;  4QJF A;  5IOD A;  3L2P A;  1W6K A;  1V1Q A;  2GVA A;  3S16 H;  2UXB Q;  4UPA A;  1WVL A;  3HG9 A;  5ELE A;  1H9K A;  4JI3 L;  5IE8 A;  1B50 A;  3GTO B;  1B3A A;  1CZG A;  1PYW D;  4WOR A;  3S17 H;  3KUP A;  1HA5 A;  2ZTD A;  4RMF A;  3H3V C;  1WCM B;  1VQL A;  3MZ5 A;  2ZM6 L;  1WD0 A;  1VQD A;  5EGT A;  4JBK A;  4OX9 L;  2JA7 G;  1O7I A;  1O7L A;  1LO5 D;  2KVM A;  3R2I A;  4U68 A;  5GAD C;  2KEE A;  1PMR A;  1KL9 A;  4JG2 A;  4B3R Q;  3TN2 A;  1CM9 A;  1A8V A;  4A3E G;  2A68 D;  3KF6 A;  4LNQ A;  3R2T A;  1VQG A;  4UY8 C;  1WTW A;  3TS2 A;  1D6E C;  1HJP A;  4QIW E;  3RNU A;  5M3M B;  4XDX A;  5C0X I;  4OEL B;  4JYA Q;  4LF4 L;  2B2W C;  1LTB D;  2EYJ A;  4DK0 A;  1JMC A;  1L1O B;  1E3P A;  4YHH L;  4A3D G;  2Q2I A;  1VMC A;  3ICE A;  1SMY C;  5A2Q E;  5DM7 3;  3M3Y B;  1WTV A;  3U50 C;  1X9N A;  2BCO A;  1EU3 A;  2NBF A;  5ELC A;  4ZUJ A;  1EY8 A;  1N34 Q;  4F8M A;  2QKI C;  4LF5 Q;  2N8N A;  4K5W A;  1ICF B;  4L8J A;  1LUZ A;  4R8I A;  5DM6 3;  3QIA A;  5M5W H;  4PZ8 A;  3FDT A;  4FNF A;  3VR3 A;  4ME3 A;  3T1Y L;  4L5T A;  3AB9 A;  1BNZ A;  2XRQ D;  1XNQ L;  3NEL A;  1B1Z A;  5FKA C;  2M9V A;  2HHH L;  2WB1 E;  4A3F G;  3S1Q B;  3DMU A;  1SEB D;  3PIP 3;  3NPP A;  4KD3 A;  1AW7 A;  3QOJ A;  1F77 A;  1V9P A;  4KN7 C;  5C44 B;  2L0C A;  5I6W A;  1CA5 A;  4JI0 Q;  4JI7 L;  1JB3 A;  4CJ2 C;  1I50 B;  1ET6 A;  2JA5 H;  2VUM G;  1HA6 A;  1LTS D;  3LNN A;  3CCE A;  2IHE A;  2Z6B A;  2CQA A;  3KLW A;  4I65 A;  3KF8 A;  1C8C A;  1VMP A;  2E8G A;  3M4O H;  5KND A;  2DGY A;  3ERO A;  4DNT B;  4DN4 M;  4CJ1 B;  5LMU L;  3AU7 A;  4KKT A;  1MJE A;  2LSS A;  1JJC B;  4MZ9 A;  1F2Y A;  3GTM H;  1CQV A;  3C3L A;  3HOY H;  3S16 B;  2VXW A;  2XGT A;  2DNE A;  2AQ2 B;  3M4Y A;  5EPL A;  1MIU A;  3S17 B;  1SE3 A;  3PGZ A;  3IRB A;  1LV9 A;  3HEJ A;  3I3C A;  2WP8 J;  3I90 A;  1IW7 D;  2F0W A;  1E7Z A;  2I07 B;  4K2K A;  4N9P A;  3HOZ H;  4POF A;  3MFG A;  1TKW B;  3DLL A;  4AIM A;  2MGS A;  3DHQ A;  1YI2 A;  3VA5 A;  1IYV A;  3NBI A;  5CV7 A;  1Q1E A;  1PLF A;  2PI2 E;  2CCZ A;  3KJO A;  4ODG A;  5JJZ A;  4U67 3;  1EY6 A;  1UE6 A;  2HDM A;  2JA7 H;  3SVM A;  1GOZ A;  2D2C C;  4KLK A;  1S5F D;  5LL6 X;  1VQ8 A;  1BCP C;  4DV0 L;  3I4L A;  4WRD A;  5BR8 L;  1ASY A;  1PZJ D;  1EY7 A;  2A6H D;  3R93 A;  1A62 A;  4A3E H;  3HKZ G;  1G2S A;  3CHB D;  1HRJ A;  2CW0 D;  2L12 A;  1B2T A;  1RD9 D;  2A74 C;  1XMQ L;  1EZ8 A;  3T1H L;  5COR A;  5C4H A;  2WAC A;  2ATW A;  3FEW X;  2B3G A;  2VQF Q;  4QQB X;  1F9P A;  2E74 C;  1DXM A;  2K5N A;  4DV4 L;  1I4H A;  1GHJ A;  3ER0 A;  1TWH B;  2AMC B;  4DV5 L;  3D6C A;  5T1I A;  4BBR G;  4K5X A;  2Q8R E;  2AUK A;  5GAE C;  5EKK A;  3OMC A;  4JI1 L;  5M5W B;  1LTR D;  1D2B A;  4S3S A;  1I4R A;  2F4V Q;  1Y8N B;  4A3J B;  4NW2 A;  4F87 A;  1JT8 A;  2MJ8 A;  1HNX Q;  1LAB A;  4HJ7 A;  2MHV A;  1IYU A;  4H0L C;  4GN3 B;  3CP0 A;  1U9R A;  2F0D A;  3A0J A;  2EY6 A;  1JE4 A;  5I2X A;  4FO2 A;  3NHH A;  1I6H H;  4X3K A;  3I4O A;  2JA5 B;  2ZJQ A;  1V1O A;  1W3S A;  2I0Q A;  4NXN Q;  3FKI G;  2VB3 X;  1E22 A;  3PSI A;  3F2D A;  4H44 C;  4A3F H;  4WJ4 A;  1EIG A;  1P16 A;  1VQN A;  2AQ1 B;  3SEB A;  1SFO H;  1IW7 C;  1HUN A;  3RLN A;  1PV4 A;  4ULL A;  3W3A A;  3NBH B;  2JXM B;  1R4Q B;  1BO0 A;  2PW5 A;  3HOV H;  2QEJ C;  1G2T A;  4X6A H;  4EX5 A;  2BH2 A;  4QF4 A;  1YJW A;  1Y8O B;  2R7D A;  2VUM H;  1TS4 A;  1SYB A;  3PCO B;  3MFY A;  4C2M B;  3JC6 6;  1JCK B;  4KTA A;  5ELD A;  3PIO A;  2N88 A;  4C3H G;  2C9O A;  5IP9 H;  2VQE L;  3HOY B;  4C1N K;  2NZH A;  3A8K E;  4BY7 B;  4IPG A;  4C3I B;  1DOL A;  2HQE A;  4L5S A;  1VQE A;  4F88 A;  3BYT B;  1B9N A;  1I94 Q;  2CQO A;  4HMJ A;  4IUQ A;  5HUR A;  3BJU A;  2D9U A;  2KCC A;  1RDP D;  4XYO A;  3HOZ B;  2EDG A;  5ISR A;  5FLX L;  1FL0 A;  4HIO A;  4JCV E;  1KLU D;  1E2Z A;  3DM3 A;  1UE5 A;  2EZV A;  3WOF A;  1SE8 A;  3J7A 5;  4DUZ L;  4GNX A;  4XXE A;  4QL5 A;  1NNX A;  3TP5 A;  2K5D A;  5IGB A;  2JA7 B;  2B63 G;  4DK1 A;  4TVA B;  4DUY L;  2MO1 A;  2MFI A;  5KNB A;  3TEH B;  4TKO B;  3QJY A;  3SXH A;  4BXX H;  2PQA A;  1SE4 A;  2F0I A;  4GKJ L;  1PFB A;  3C2P A;  4LFB Q;  1NE3 A;  4JPB W;  4OXP A;  2B2W A;  2NVY H;  4AYB G;  3WDN A;  1Q8I A;  4A3E B;  5IYB G;  1M90 C;  4UHV A;  5IP7 G;  2F0J A;  2CH4 W;  1G8Z D;  3E6Z X;  3T13 A;  2FXQ A;  5C5L A;  1B7Y B;  1OTC A;  1CKN B;  5C3W A;  3ITP A;  4DAV A;  3NEN A;  2KEN A;  3L7Z C;  4IPH A;  1LTG D;  2E2H H;  4ZLT F;  4DK3 C;  2UXC L;  3ND8 A;  2K01 A;  3CC2 A;  2HQL A;  4A3D B;  4L6T B;  1VQA A;  1HZ9 A;  4LF9 Q;  2UXB L;  3CRK C;  2EXZ A;  1TWG B;  2VB2 X;  3BS1 A;  3MAQ A;  1IHZ A;  2CWA A;  1CZW A;  2EYH A;  3OTO Q;  1EYC A;  3J81 L;  1J5E Q;  2O5J C;  3VR6 A;  3G71 A;  1NSN S;  4MHE A;  2EJM A;  2EXD A;  2JEB I;  3F2B A;  2F3I A;  3RLF A;  3V96 A;  5IYC G;  1R9T H;  2X6L A;  1CQF A;  5L37 A;  3BDO A;  1PTO H;  1O7Y A;  1XTC D;  4YCV A;  1I6H B;  5JVG 3;  1TXY A;  3Q23 A;  1SYD A;  4G7H C;  2AUJ D;  4B3R L;  3U9S A;  1QNK A;  4A3F B;  1OXT A;  1F9S A;  1SFO B;  4IUN A;  1VQC A;  1CI3 M;  1L1O C;  2GVB A;  2VW9 A;  5AJ3 Q;  1IZ6 A;  4KKU A;  3VYR A;  1G91 A;  2Y0S E;  2VUM B;  2K03 A;  3VYU A;  2ZXR A;  1SND A;  1MKH A;  4LUV A;  2L11 A;  4JYA L;  1H9S B;  4CBV A;  4DR3 Q;  2WAQ G;  1F2L A;  2AHO B;  1FD7 D;  3EQL C;  3VYS A;  3CCU A;  4IFD I;  2UUA Q;  4RG1 A;  4YWM A;  2KCT A;  1TY2 A;  1EFI D;  3PQI A;  1CHQ D;  3TP8 A;  1JJG A;  3TS0 A;  3RN2 A;  2KQ3 A;  2CH4 A;  4ZAI A;  3N52 A;  1B4O A;  1HZB A;  3KK7 A;  3S2D H;  2A69 C;  3OSO A;  1HZC A;  1MJC A;  5CV8 A;  1N34 L;  3C1F A;  4A3L G;  4C3H H;  3E0J A;  1SJH D;  1KAA A;  1LT3 D;  3OYY A;  5A35 A;  2NTT A;  1Q90 A;  1H9M A;  5LMN L;  1IBL L;  4OO1 H;  3DUZ A;  4JK1 C;  3HOX G;  4L63 B;  4LW1 A;  1HQM C;  2UU9 Q;  3PUW A;  1YNX A;  5KYI A;  1LTA D;  1QCB D;  3A56 A;  4I7Z C;  1XTD A;  4LF8 L;  2MO0 A;  3U4V A;  3W5O A;  4A3G G;  4DKA C;  3GTJ H;  1KRT A;  1ZYR C;  1AE2 A;  5IGD A;  1VQB A;  1SJE D;  3PUZ A;  5C4X G;  4OGQ C;  5G3L D;  4IN3 A;  3EN2 A;  4JI0 L;  1RKN A;  1F9R A;  4IUU A;  5C0X J;  4L5R C;  3MEF A;  1VQP A;  3K5O A;  3A55 A;  2NVY B;  3NWT A;  4RGM A;  1KNE A;  3L3O C;  3MC0 B;  3F8T A;  3J80 L;  2WIN B;  4YCW A;  5I6Y A;  1EYA A;  4BBS G;  4RH6 A;  5FO8 B;  1K83 H;  2Q2H A;  5HGQ A;  4YWK A;  4BS9 A;  3RR5 A;  5BN3 A;  2KBN A;  5M3M H;  4KHZ A;  1BF4 A;  2OTL A;  2E2H B;  1EY5 A;  1AH9 A;  1UUP A;  4LJZ C;  3S2H H;  3HKZ B;  4HR7 B;  1YJ9 A;  4NXM Q;  4J15 A;  1LAC A;  1D5Z C;  2B39 A;  4FF3 A;  1HNZ Q;  3A7A B;  2D5D A;  3M3Y H;  1JWM D;  5CBA E;  3T51 B;  1QUQ A;  4OEM B;  3ND9 A;  1Z9F A;  4UP9 A;  2V4D A;  3HOW G;  2Z0S A;  4MTK A;  1XJV A;  3OHX C;  4BBR B;  2NVQ H;  1K8M A;  5NUC A;  4K8I A;  1KDB A;  2EY2 A;  4LFA L;  5TSS A;  2HDL A;  1R9T B;  4P74 A;  1EQV A;  1K28 A;  3GTL H;  1M1K C;  1PTO B;  1D5X C;  1SR3 A;  1S40 A;  1PH4 A;  1J6Q A;  2LMC B;  3CCJ A;  1XWE A;  1PH8 A;  1TWA B;  5E1F A;  2F0H A;  1VQ5 A;  1EIF A;  4HSV A;  5FOB B;  1XPR A;  4C56 C;  3N6R A;  4CDF C;  3CC7 A;  3NQI A;  1BBX C;  3M4P A;  3A74 A;  5IYC H;  4DFA A;  4QUF A;  3K81 C;  3J7A F;  1LM0 A;  2J7Z A;  2I46 A;  1SYC A;  5C44 H;  3KDF A;  4P72 A;  4LFC Q;  1Q8K A;  2RA4 A;  1PA6 A;  4X64 Q;  1NJI C;  3CXC A;  1I50 H;  2SEB D;  3FKI B;  4DAY A;  3IFT A;  2ICI A;  2Z8L A;  5EPK A;  2AWO A;  2QDB A;  4RHS A;  2LS0 1;  1DM0 B;  2ID0 A;  2JA9 A;  3PUY A;  5IWA Q;  1IBM L;  2RBM A;  1QZG A;  4JI5 Q;  3D3R A;  2BA1 A;  4L5Q A;  2B8F A;  3RZO H;  2E2I H;  2UUC Q;  1N32 Q;  1YEZ A;  2VQF L;  1G6Z A;  2IL8 A;  2WAQ E;  1N36 Q;  3MEH A;  5GQO A;  5JEA G;  2UXD Q;  2N3S A;  4DR5 L;  1Z6H A;  4C3H B;  1YHB A;  2F0N A;  4CKE A;  1W6J A;  1B53 A;  4NMZ A;  3ERS X;  1DYQ A;  3GD7 A;  4X62 Q;  4EQP A;  2Q8T A;  2NVX H;  5I9P A;  1X3E A;  3I73 A;  2BOS A;  4O1N A;  3KF6 B;  1HNX L;  1HH2 P;  2EVB A;  3FMC A;  4R4Q A;  3GTJ B;  2F0T A;  4H02 A;  2C5C A;  4RGT A;  4B9W A;  4NKL A;  4LF7 Q;  1SRU A;  2EPB A;  5JPN C;  1DGS A;  1CKM A;  3CCV A;  5D3D A;  4FXG C;  4NXN L;  5IGE A;  4QUC A;  4G7O C;  1YVC A;  2B63 B;  4A3B H;  4HID A;  4A3G H;  5D3I B;  5EBC A;  5CV9 A;  2R7Z G;  1GUO A;  4IPD A;  3D4D A;  1K83 B;  1LYL A;  3K0Y A;  3X3N A;  2RDH A;  4WJ3 M;  1PXU A;  4HIM A;  4LF6 Q;  2IW3 A;  2NUC A;  4FF2 A;  4AYB B;  4A3K G;  2RCF A;  2RKS A;  4CHT B;  2MQH A;  1I6V C;  1GO3 E;  3S2H B;  2R61 A;  3QOL A;  1CSP A;  4EGV A;  2ZJR A;  1CSQ A;  4FP5 D;  5IGC A;  4BBS H;  4CGY B;  2L4N A;  2JN4 A;  1H9R A;  3QO2 A;  5C0X H;  3HZX A;  4BWG B;  2JEA I;  2VY3 A;  1CKO A;  1WTO A;  1I94 L;  4FYD A;  1TWH H;  4PG3 A;  1HCZ A;  2NVQ B;  1RJT A;  3D4W A;  3LX0 A;  3J81 i;  2UUB L;  4NB3 A;  1SN8 A;  1FNU A;  1L0X B;  3GTL B;  5C3E G;  5FJ8 H;  3K5M A;  1YIT A;  1LLR D;  3C46 A;  4DAM A;  5KGU A;  3M7N A;  1VQF A;  3OOC A;  4A3J H;  3UDX A;  3S14 H;  1QB5 D;  3LGJ A;  1Z47 A;  4CDD C;  2F0U A;  3KF8 B;  1HUM A;  1Q86 C;  4X66 Q;  1BUV T;  2FMC A;  2AQ3 B;  1CFM A;  1Q1B A;  5FO7 B;  2Q2T A;  4X3S A;  1I4Q A;  2YTX A;  3S1M H;  4N8F A;  3BG3 A;  1QNU A;  1BOS A;  3H3V I;  4CDE C;  4QY7 A;  4J1M A;  4DU9 A;  4DR7 Q;  4YCU A;  3MTS A;  5FLM H;  1FNV A;  2K5V A;  4IZ8 A;  2OXP A;  1G6P A;  2WFW A;  1E2V A;  1CA6 A;  1X56 A;  3RZO B;  2DN8 A;  2E2I B;  3C1E A;  3PIO 3;  1WOC A;  4KMU C;  4XQN A;  3BDL A;  4R4C A;  5E4W C;  2Z4I A;  3K5L A;  4C2M H;  3G6J B;  1B70 B;  1G51 A;  3GDE A;  2DJF C;  3JAM i;  2WAQ B;  3TQY A;  3CF5 A;  4RCN A;  2A68 C;  4R8N A;  4BY7 H;  2F0Q A;  4C3I H;  3I55 A;  4QB4 A;  2KHS A;  2NVX B;  1IBK Q;  1H95 A;  1Y1V G;  3EA6 A;  1VQH A;  1ASZ A;  5C4Z A;  4IO9 A;  3OTO L;  1S5C D;  1NMG A;  4MTN A;  4ZUI A;  2N55 A;  3STB D;  1DON A;  4PMC A;  1A6X A;  1UEA B;  2XSC A;  3HOX B;  1HR0 W;  2CVR A;  4ILW A;  1JOQ A;  3K80 C;  4BY1 G;  1O80 A;  1QZH A;  1QG7 A;  2K6A A;  4J8Q A;  4B9X A;  4DV1 Q;  2B2T C;  3DWP A;  3I8Z A;  3PF5 A;  1PH9 A;  5J1Z A;  1AZQ A;  3NE5 B;  3G6E A;  1E1O A;  1TR5 A;  3PO3 G;  4AH6 A;  5KRU A;  4A3B B;  1IXR A;  1IKM A;  4A3G B;  4QGU A;  1B3Q A;  1PZK D;  4IUV A;  3MXN A;  3J80 i;  4O0A A;  2R7F A;  1PTO D;  1HQR D;  3CRL C;  2NN6 G;  1PYS B;  5AJ3 L;  3J7Z C;  5C4X B;  1EQQ A;  3V05 A;  2P5Z X;  3RLO A;  2L9H A;  2CFM A;  4LUZ A;  4G57 A;  1CTM A;  5A2Q L;  1QIL A;  2BDO A;  5CGK A;  3E9H A;  1HNW L;  5I2Y A;  2R92 G;  4DR3 L;  4BBS B;  2R7Z H;  1HFN A;  2B2V C;  4H7B A;  1J9O A;  5KYL A;  4PMW A;  2B2U C;  1BBU A;  1EY9 A;  2IT1 A;  3DXJ C;  2IJ0 A;  2K5W A;  1KAW A;  2DUD A;  3S1N H;  4A3M G;  2L15 A;  3DWQ A;  2B2Y C;  4JOI A;  4A3D H;  1FGU A;  2MPM A;  1EYG A;  2JK8 A;  2RDF A;  2D0P A;  1TU2 B;  3GV6 A;  4NP5 A;  1JWU D;  1TWG H;  3D31 A;  2IX1 A;  2K33 A;  4TSS A;  2UU9 L;  4HMI A;  2PPB C;  3HOW B;  3S14 B;  5EKI A;  2L55 A;  4IUT A;  3DWA A;  4P2C B;  2D0O A;  3OMG A;  1UAP A;  2ZTE A;  4JI3 Q;  1TII D;  3WWV A;  4NPS A;  5DAU A;  3S1M B;  3M7G A;  3OPO A;  4OIK A;  3CMA A;  3BZC A;  3KJP A;  4RKL A;  4HCE A;  1HTL D;  1U4R A;  4IOC A;  1S4Z A;  2EYO A;  2K7V A;  2IWH A;  5DEH A;  1Q7Y C;  3CQZ B;  4GOP A;  1VQJ A;  3STB C;  4K0K Q;  3IKJ A;  3J81 E;  4KK7 A;  4HJ8 A;  2YTV A;  3Q22 A;  2A73 B;  3E3X A;  4K8J A;  4FF1 A;  2Z6K C;  1ESF A;  3PIP A;  1HHV A;  3SK4 A;  5IGF A;  3U4Z A;  5EBD A;  2HUG A;  4K5V A;  5EPJ A;  5IT9 L;  1CUK A;  4IFD G;  5GRO A;  2NZO A;  3PO2 G;  3IAY A;  3GTK B;  2L1B A;  5CMD A;  1BVS A;  3G7L A;  3ULL A;  3CCS A;  1HNZ L;  1PHJ A;  3SR1 A;  2PYK A;  1PTO C;  1RHP A;  1VQ6 A;  1LT5 D;  4MNO A;  2CHB D;  4GNX B;  4LF4 Q;  4DV2 Q;  4V19 0;  2A6H C;  1SNP A;  2NWG A;  3GP7 A;  5CV6 A;  4RKB A;  1JC7 A;  3J7A V;  4DR6 Q;  2AKW B;  1K8O A;  1AFP A;  1OXX K;  1MSH A;  3BDC A;  2CW0 C;  1SYG A;  3TRZ A;  2TMP A;  4FVM A;  2PQA B;  3VR5 A;  4DV7 L;  5JVH 3;  3HRZ C;  1CT1 D;  4KY6 A;  3QG1 A;  2JQO A;  5AFW A;  2OWO A;  2BDN A;  4B3S Q;  3GTP B;  1MD2 D;  3S9W A;  2PNR C;  3H09 A;  2DY7 A;  2XN9 C;  5EJW A;  1KD1 C;  2KHI A;  4HAE A;  3JAM E;  3KLS A;  1SMX A;  3U9O A;  2VZA A;  2NN6 I;  2XWB B;  5CV5 A;  4KJN A;  1FR3 A;  1C4Q A;  2QA4 A;  1EYD A;  4KY7 A;  1EWC A;  3KBX A;  2F3V A;  1PRT D;  3EJI A;  4V0B A;  5IWA L;  4R4T A;  1EOV A;  1JE5 A;  1S72 A;  4JI5 L;  2ASB A;  2R7Z B;  2KUM A;  2KHJ A;  1N8R C;  4X3T A;  2KJX A;  2ZXP A;  4Y52 H;  2UUC L;  4JV5 Q;  3HKZ E;  3DM1 A;  3I4M G;  1GUT A;  3D0F A;  3S1N B;  3GO5 A;  4A3K B;  1YIJ A;  1N36 L;  3R8B A;  1XX8 A;  1M4V A;  3PV0 A;  3SE0 A;  4IQZ A;  2PI2 A;  4CKB A;  2R92 H;  1I3Q B;  2LXK A;  3SGI A;  3NSW A;  2QIL A;  1EEI D;  4X62 L;  3J80 E;  1TS3 A;  2F0L A;  3KLS X;  1PH7 A;  1KXL A;  3P75 A;  1SBB B;  4BBR H;  4IUP A;  3KBG A;  3CAM A;  3MHB A;  4C3J G;  1PZI D;  1X6O A;  4LK1 C;  1SNO A;  5C3E B;  2QDL A;  3CPF A;  5KIX A;  1A63 A;  2EIF A;  4UP7 A;  3ERQ A;  1OXU A;  4LF7 L;  1LT4 D;  4AQY Q;  1F9Q A;  2HT1 A;  4JI2 Q;  1TWA H;  1X32 A;  1D1K A;  2G9H D;  1KIX A;  2F0E A;  3HGB A;  3F2U A;  1NMF A;  2G9D A;  1K9M C;  2CKZ B;  3I72 A;  1C9O A;  1EWH A;  1VQ4 A;  2FJ2 A;  3IFD A;  2BH8 A;  1K0S A;  3FKI H;  3MXG A;  4RA8 A;  5I4D A;  2RSO A;  3A7L A;  1HR0 Q;  2BE5 D;  2K05 A;  1WD1 A;  2GA4 B;  3BU2 A;  3OW2 A;  3RD4 A;  1II3 A;  2NZ1 D;  1PDQ A;  3I4N G;  2QF7 A;  3I91 A;  1SDF A;  4DXG A;  1SYF A;  2E2D C;  5BR8 Q;  3HFZ B;  1SNQ A;  3SK6 A;  1B8A A;  3OWE B;  3IL8 A;  1YNN D;  4ZKC B;  2EOT A;  2Q2U A;  1WTQ A;  2HCI A;  4KHP Q;  5KEE A;  2QEX A;  4LF5 L;  4IFD H;  1ILP A;  3T1H Q;  1BCP B;  1FVI A;  1I4P A;  1PTO F;  1KHI A;  5EQ0 A;  3CU7 A;  3V2T A;  5EKL A;  1Y1V B;  3O13 A;  1RF2 D;  2WKD A;  2PZT A;  2F52 A;  3AMU A;  2OEO A;  1NR4 A;  4R1J A;  3QB3 A;  1M8A A;  1AP0 A;  5BN5 A;  5IOC A;  4HSP A;  4OIJ A;  1WTP A;  2A6E D;  3CW2 C;  1T5X D;  2I5H A;  4XIG S;  5FO9 B;  1LTI D;  4DV3 Q;  4G7Z C;  3DEP A;  4BY1 B;  1VF7 A;  2A8V A;  1EQT A;  3VYT A;  2JYO A;  1LTT D;  2RHQ B;  3PO3 B;  1STE A;  1YNJ D;  1L2F A;  2YYZ A;  2B63 H;  4KD4 A;  3CC4 A;  2YTY A;  4DR7 L;  1DOK A;  3S15 H;  4YIJ A;  1ML0 D;  4ZK9 B;  5COY A;  3SK8 A;  2HCC A;  3T16 A;  2B2U A;  4AYB E;  1QUQ B;  4DNR B;  1C0A A;  4KKS A;  1EY0 A;  1N33 Q;  5JJK A;  1GXD C;  4A3I G;  1AEX A;  2RF4 A;  3J81 c;  5JJL A;  1Y14 B;  4PQX A;  5IIF A;  5IYB H;  1I4X A;  2HIV A;  2B2Y A;  2IX0 A;  4GS3 A;  5IP7 H;  2R92 B;  2OQ0 A;  4XT1 B;  2A5H A;  1DZ1 A;  3TBI B;  1DCZ A;  4B3T Q;  2LFN A;  4FXD A;  1KLG D;  1IBK L;  2EYF A;  3AEV A;  4JI4 Q;  4A3M B;  4UDU C;  4DR2 Q;  1WFQ A;  1Y69 U;  1SNM A;  2PNH A;  2R3Z A;  4ZCK A;  5C5M A;  3KDF B;  1MI2 A;  2B8G A;  1Q82 C;  4DAY B;  1CHP D;  3HS0 C;  1RTN A;  1KTK A;  4XQQ A;  4B3M Q;  3K7U C;  2WKC A;  3X3M A;  2PMZ B;  2M00 A;  4EVO A;  2O4X A;  2KEC A;  2EQS A;  1PH2 A;  4K14 A;  4C3J H;  4O42 A;  1D8L A;  2WB1 G;  4GN4 B;  2F0O A;  2Z6K A;  3UE1 A;  1KDC A;  4DNI A;  1XXG A;  5T1G A;  2FMM A;  2J0T D;  3K7A H;  3UE0 A;  2NB0 A;  3JAM c;  3MVV A;  2GN5 A;  3OIQ A;  3PUX A;  5JEA J;  1X3G A;  1B9M A;  5IY0 A;  3NK9 A;  1X3F A;  1BBW A;  2H1E A;  3J81 j;  3I7F A;  1SMY D;  1YHQ A;  1UE7 A;  5J39 A;  4DV6 Q;  1FJG Q;  2Z1C A;  1KC8 C;  1X55 A;  3GTQ H;  1ZEQ X;  5CBE E;  1MHW C;  1EIY B;  4FF4 A;  3OW7 A;  1YJN A;  1XMO Q;  2E5L Q;  3I4N H;  4GLX A;  1YNJ C;  4YY3 Q;  2E2J H;  3PO2 B;  4KJO A;  2YU9 B;  4G4K A;  4HJ5 A;  2C35 B;  4NDX A;  3T53 B;  1TWF H;  2EYL A;  4M8A A;  1X54 A;  4RGO S;  1NY4 A;  4JW0 A;  1YZ6 A;  2F4V L;  4CDC C;  4N8X 1;  1IYJ B;  1STH A;  3F2C A;  1NBW A;  4JI6 Q;  1LTL A;  3TZD A;  2UXC Q;  1UE1 A;  4A3L H;  4O2D A;  3E0E A;  5D65 A;  1JOR A;  2EE1 A;  1V1P A;  1XPU A;  2K14 A;  5FK9 C;  1PYB A;  3HOX H;  3FP9 A;  3RZD H;  1UNS A;  4E6I A;  3QWN A;  4YWL A;  3W1B A;  4IOA A;  2NYZ D;  4OON A;  2M2L A;  5CC4 A;  3LWU A;  3RUZ A;  2OTJ A;  2KA7 A;  3BYY B;  3ONA B;  4ID6 A;  3S15 B;  2RCN A;  1QVC A;  1U4L A;  4K0K L;  5DLQ E;  5C4X H;  1ENC A;  4JI8 Q;  4A93 G;  1X65 A;  3CME A;  3U58 A;  4JBW A;  1QE6 A;  1EL0 A;  5C4J H;  1VQI A;  3CKI B;  4GNX C;  2DNC A;  4DAP A;  4HJA A;  1Q81 C;  1TY0 A;  3HP3 A;  3SHL A;  2F0K A;  3FPP A;  3H91 A;  4JVZ A;  1VDZ A;  1U4P A;  2O2L D;  1JWS D;  1P8L A;  3I4M B;  4A3I H;  2RVL A;  1STB A;  3KOJ A;  1Z7T A;  3ULP A;  1PH3 A;  4DV2 L;  4OWT B;  1Q3L A;  3Q6S A;  3MWY W;  5KNC A;  4JC0 A;  4GN5 A;  3K57 A;  1BR9 A;  1A15 A;  4DR6 L;  5DNF A;  3D8G A;  2JA8 G;  1MGS A;  4K6D A;  3J7Y W;  1RL2 A;  1EU4 A;  3SK5 A;  4APV A;  5CR3 A;  1SLJ A;  4KI0 A;  3HOW H;  3MXP A;  1PRT B;  1C48 A;  3BVG A;  2Z9H A;  3AFP A;  5BN4 A;  3F1Z A;  4C3J B;  4B3S L;  1L1O A;  1E1T A;  5LMN Q;  1IBL Q;  1BKB A;  2MUY A;  1H9J A;  1PFS A;  1BCP D;  1WTR A;  3D4R A;  1RIP A;  1DJR D;  1AN8 A;  2DY8 A;  1Y1W G;  3H15 A;  3H6M A;  2QCP X;  5CV4 A;  4I7A A;  1T5E A;  3K7A B;  4LF8 Q;  1EZ6 A;  4LFB L;  3A8J E;  2JE6 I;  2F0F A;  4OHJ A;  1PH6 A;  4PV1 C;  4PNY A;  4HJ9 A;  1KNA A;  1ILQ A;  3CQZ H;  3TP6 A;  1RTO A;  1ICW A;  5M5X H;  1L0Y B;  3VA7 A;  3HOV G;  1EY4 A;  3CPW A;  3CCR A;  3GTQ B;  3H3V H;  5E4X A;  4JV5 L;  3GTG H;  1AZP A;  3AQQ A;  1GHK A;  1KAB A;  4FDB A;  2R93 G;  3NTI A;  5JPM C;  5M3F G;  3I4N B;  3Q8D A;  2K4K A;  4P71 A;  1KQS A;  4QCL A;  1SNC A;  1WJJ A;  2E2J B;  5IP9 G;  3I56 A;  4GKK Q;  1I4G A;  3GTK H;  1TWF B;  1Y8P B;  5G3L F;  4X65 Q;  1GJX A;  1JOO A;  4LF9 L;  4RGN A;  3LWE A;  2JP1 A;  3P20 A;  1VQO A;  2RDG A;  5JEA H;  3GQB A;  1J5E L;  1ONL A;  1S5D D;  1PH1 A;  1BDO A;  3VR2 A;  1C7Y A;  3MXN B;  1E24 A;  2ALY B;  1NTG A;  2E76 C;  1GUW A;  3RZD B;  4K6L A;  5IT9 E;  3UDF A;  4AQY L;  4JI2 L;  3A54 A;  4Q0F A;  1OO9 B;  4LFA Q;  5M9O A;  3GTP H;  2E75 C;  5EAY A;  4UP8 A;  1NCV A;  4ZQ3 A;  1E2W A;  4BXX G;  2O5I C;  1A0I A;  3H0G G;  1PH5 A;  2R6G A;  2K1B A;  4EQO A;  2OT2 A;  4GLA C;  5C4J B;  3A5U A;  3B6Y A;  5FLX E;  1VF5 C;  5GAH C;  4WJW A;  4GZY C;  4HIK A;  3FPU B;  1HR0 L;  3NTH A;  1MSG A;  2UUA L;  4GLV B;  3M9B A;  4A93 H;  4K2L A;  2SOB A;  2PW7 A;  1CK1 A;  3TSS A;  4A3I B;  1EIH A;  3W1G A;  4XQJ A;  2PO4 A;  4A3K H;  5M5Y H; 
#chains in the Genus database with same CATH homology
 1IBM Q;  1AH9 A;  3PV0 A;  3S2H H;  1JMC A;  1L1O B;  4DR4 Q;  1E3P A;  4KHP L;  1YJ9 A;  2PI2 A;  4DR1 Q;  4NXM Q;  2R92 H;  4J15 A;  4YHH L;  4A3D G;  2Q2I A;  1I3Q H;  2LXK A;  3SGI A;  1HNZ Q;  3ICE A;  3M3Y H;  4R4O A;  3U50 C;  1X9N A;  1QUQ A;  1Z9F A;  4UP9 A;  4X62 L;  1PH7 A;  1XNR Q;  1OXV A;  5E7N A;  3HOW G;  2Z0S A;  1KXL A;  4DR5 Q;  1N34 Q;  3ZJY C;  1XJV A;  4BBR H;  4LF5 Q;  2NVQ H;  2N8N A;  3CAM A;  4P75 A;  4GOP B;  4LFA L;  1X6O A;  4P74 A;  5C3E H;  1LUZ A;  2JA8 H;  3CPF A;  1M1K C;  3GTL H;  1A63 A;  5IYD G;  4DV3 L;  5M5W H;  4PZ8 A;  2EIF A;  1SR3 A;  4UP7 A;  1OXU A;  4ME3 A;  3T1Y L;  1S40 A;  4LF7 L;  4L5T A;  4AQY Q;  1PH4 A;  1J6Q A;  3CCJ A;  3E9I A;  2HT1 A;  4JI2 Q;  2ZM6 Q;  1PH8 A;  1TWA H;  3KYH C;  3NEL A;  1XNQ L;  3HOU G;  3EIV A;  1VQ5 A;  1EIF A;  2WB1 E;  4A3F G;  4PZ6 A;  1XPR A;  2HHH L;  4OX9 Q;  3CC7 A;  4A75 A;  4LWC A;  1KIX A;  4R4I A;  3M4P A;  1NMF A;  3A74 A;  4IFD J;  5IYC H;  1K9M C;  1VQ9 A;  2CKZ B;  3K81 C;  1V9P A;  1LM0 A;  1C9O A;  5C44 H;  1VQ4 A;  3KDF A;  4P72 A;  4JI0 Q;  4LFC Q;  1Q8K A;  4JI7 L;  2VL6 A;  1PA6 A;  4X64 Q;  1Y1W H;  1NJI C;  3PF4 A;  2BH8 A;  1L0W A;  3CXC A;  1I50 H;  2JA5 H;  2V1C C;  1N33 L;  3FKI H;  2VUM G;  4Y7N H;  1HR0 Q;  2AWO A;  2ID0 A;  2JA9 A;  2Y0S G;  3PUY A;  1GKH A;  3BU2 A;  2IHE A;  5IWA Q;  3CCE A;  3OW2 A;  1IBM L;  3CD6 A;  3KLW A;  1QZG A;  3I4N G;  4JI5 Q;  3M4O H;  2E8G A;  2BA0 A;  2BA1 A;  2DGY A;  4NXM L;  4L5Q A;  3RZO H;  3EBE A;  2E2I H;  5BR8 Q;  3HFZ B;  2UUC Q;  1N32 Q;  2JA6 G;  1B8A A;  1YEZ A;  4B3T L;  1VQ7 A;  2VQF L;  2WAQ E;  1N36 Q;  1U0L A;  1YBY A;  5LMU L;  1VS0 A;  5GQO A;  5JEA G;  2UXD Q;  2N3S A;  2R93 H;  1VCI A;  2Q2U A;  1MJE A;  2LSS A;  5M3F H;  4DR5 L;  4JI4 L;  4KHP Q;  1JJC B;  4MZ9 A;  2QEX A;  4LF5 L;  4DR2 L;  4YHH Q;  3GTM H;  1YHB A;  4A4I A;  3T1H Q;  3HOY H;  1FVI A;  2XGT A;  1KHI A;  4OO1 G;  3AFQ A;  3ERS X;  1MIU A;  2AWN A;  3GD7 A;  2NVX H;  3PGZ A;  4X62 Q;  1X3E A;  1Y1V H;  5J3B A;  2OCE A;  1TWC H;  3IRB A;  1WCM G;  2F52 A;  1K0R A;  1KRS A;  2WP8 J;  1I5F A;  2IHF A;  3KF6 B;  4R1J A;  4B3M L;  1HNX L;  2UUB Q;  1HH2 P;  1WI5 A;  1E7Z A;  3HOZ H;  2NVT H;  3CW2 C;  4R4Q A;  3CCM A;  2I5H A;  4H02 A;  4XIG S;  4POF A;  4DV3 Q;  3DLL A;  4AIM A;  1K8A C;  3K0X A;  3T1Y Q;  1SRU A;  2OQK A;  1YI2 A;  1GM5 A;  1DGS A;  1CKM A;  3CCV A;  4BY1 H;  4LF7 Q;  4LFC L;  1Q1E A;  2PI2 E;  4X64 L;  2CCZ A;  2CWP A;  3KJO A;  1XNQ Q;  2A8V A;  3PUV A;  2HHH Q;  4NXN L;  2ZTC A;  2RHQ B;  3PO3 H;  1YVC A;  1L2F A;  2YYZ A;  1UE6 A;  2B63 H;  3CC4 A;  2YTY A;  2JA7 H;  4A3B H;  3FHW A;  4DR7 L;  4HID A;  3S15 H;  4A3G H;  4KLK A;  3AYH B;  4LUO A;  1QVF A;  2R7Z G;  1Q12 A;  1VQ8 A;  4DV0 L;  4JI7 Q;  4IPD A;  4AYB E;  5BR8 L;  1LYL A;  1QUQ B;  3H0G H;  4DV6 L;  1C0A A;  1N32 L;  1ASY A;  4WJ3 M;  5JJK A;  1FJG L;  1N33 Q;  4A3I G;  3CCL A;  2B29 A;  2RF4 A;  5M3M G;  3J81 c;  4HIM A;  1UEB A;  1VQM A;  4LF6 Q;  2IY5 B;  5JJL A;  1Y14 B;  4A3K G;  1A62 A;  2MQH A;  2A19 A;  5IYB H;  1GO3 E;  2HIV A;  2I5M X;  2IX0 A;  4A3E H;  2UXD L;  4GS3 A;  5IP7 H;  1N36 L;  2OQ0 A;  3HKZ G;  1CSP A;  3S1R H;  1XMO L;  2ZJR A;  2E5L L;  1XMQ L;  4YY3 L;  3T1H L;  1CSQ A;  4BBS H;  2I5L X;  3K8A A;  4B3T Q;  2ATW A;  2B3G A;  2VQF Q;  4QQB X;  2K5H A;  2K5N A;  4DV4 L;  4XTC S;  5LMU Q;  2JEA I;  1IBK L;  3TRE A;  2VY3 A;  1CKO A;  4JI4 Q;  1I94 L;  3ER0 A;  4A3M H;  1TWH H;  4PG3 A;  3AEV A;  2AMC B;  4DV5 L;  1XPO A;  3J81 i;  4DR2 Q;  4BBR G;  2UUB L;  4NB3 A;  4JI6 L;  1SN8 A;  1WFQ A;  1HZA A;  2K50 A;  5GAE C;  2N49 A;  4JI1 L;  5C3E G;  2PNH A;  5FJ8 H;  3KDF B;  2MNA A;  1YIT A;  2PMZ E;  4DAM A;  3RN5 A;  3M7N A;  1U5K A;  2F4V Q;  1CKN A;  1VQF A;  1Q82 C;  4DAY B;  4A3J H;  3UDX A;  4BA1 I;  4B3M Q;  3K7U C;  3S14 H;  1HNX Q;  1JT8 A;  3G4S A;  5IT9 c;  3LGJ A;  4HJ7 A;  1Z47 A;  2EQS A;  3KF8 B;  2K52 A;  4GN3 B;  1PH2 A;  3CP0 A;  4C3J H;  5K36 G;  1Q86 C;  1D8L A;  4X66 Q;  1S3O A;  2WB1 G;  3A0J A;  5IYD H;  4GN4 B;  1Q1B A;  2Q2T A;  2Z6K A;  5C44 G;  2YTX A;  1K3R A;  3UE1 A;  1I6H H;  4IJH A;  3I4O A;  4JI8 L;  4DNI A;  2ZJQ A;  1W3S A;  2I0Q A;  4NXN Q;  3S1M H;  2HIX A;  3FKI G;  1N9W A;  3H3V I;  3K7A H;  3UE0 A;  3JAM c;  4QY7 A;  4LF6 L;  1E22 A;  2GN5 A;  3PSI A;  3F2D A;  3PUX A;  4A3F H;  5JEA J;  1X3G A;  3HOU H;  4DR7 Q;  4WJ4 A;  4YCU A;  1P16 A;  1T9H A;  5FLM H;  2H5X A;  2K5V A;  5IY0 A;  1VQN A;  1SFO H;  3M4Q A;  1X3F A;  3RLN A;  2WFW A;  5FLX c;  1PV4 A;  1G6P A;  1BBW A;  1X56 A;  3NBH B;  3J81 j;  1G29 1;  3I7F A;  4DV0 Q;  1YHQ A;  1UE7 A;  4DV6 Q;  5JJI A;  3HOV H;  1FJG Q;  4DK6 C;  1KC8 C;  4X6A H;  4EX5 A;  1WOC A;  2BH2 A;  1X55 A;  3GTQ H;  1YJW A;  4R4C A;  2ZJP A;  2R7D A;  5LMN W;  2VUM H;  4A3C G;  1WYD A;  3PCO B;  4C2M H;  1EIY B;  3JC6 6;  1B70 B;  1G51 A;  3GDE A;  1HNW Q;  3JAM i;  1YJN A;  3PIO A;  3TQY A;  3CF5 A;  1XMO Q;  1EFW A;  3M85 A;  4GLX A;  4YY3 Q;  1XMQ Q;  2E5L Q;  2VQE L;  3I4N H;  5IP9 H;  4OWW B;  2NZH A;  2D62 A;  2E2J H;  2YU9 H;  4IPG A;  3PO2 H;  4C3I H;  4BY7 H;  4LF4 L;  4HJ5 A;  3I55 A;  2C35 B;  1TWF H;  4L5S A;  1VQE A;  1JB7 A;  4OO1 I;  4DV4 Q;  4JBJ A;  1X54 A;  2JA6 H;  1NY4 A;  2VNU D;  5H1S E;  1IBK Q;  1H95 A;  1YZ6 A;  1Y1V G;  1I94 Q;  2F4V L;  1EUJ A;  1VQH A;  1ASZ A;  2CQO A;  4IO9 A;  4DV5 Q;  3OTO L;  1NMG A;  4MTN A;  1IYJ B;  3BJU A;  4IJL A;  2N78 A;  4TQU S;  1NBW A;  3F2C A;  1LTL A;  1JJ2 A;  1VQK A;  4JI6 Q;  2UXC Q;  1UE1 A;  4A3L H;  4O2D A;  3STB D;  3E0E A;  4JI1 Q;  3ULJ A;  1XPU A;  2K14 A;  3HOX H;  1PYB A;  1FL0 A;  3FP9 A;  3NEM A;  4X66 L;  4HIO A;  3RZD H;  1W2B A;  1HR0 W;  4JCV E;  4YWL A;  3K80 C;  3W1B A;  4BY1 G;  3GTO H;  4IOA A;  3DM3 A;  1QZH A;  1UE5 A;  4DV1 Q;  1PVO A;  3PF5 A;  4OON A;  1PH9 A;  1SE8 A;  3J7A 5;  4DUZ L;  1WCM H;  4GNX A;  4QL5 A;  3G6E A;  1E1O A;  3PO3 G;  4AH6 A;  2OTJ A;  2XTI A;  1IXR A;  2B63 G;  4A3B G;  3A5Z B;  2RCN A;  4TVA B;  4QGU A;  4DUY L;  2MO1 A;  2LXJ A;  2MFI A;  3J80 i;  3TEH B;  1QVC A;  4O0A A;  4K0K L;  2R7F A;  5DLQ E;  4BXX H;  3CCQ A;  5C4X H;  2NN6 G;  1PYS B;  5AJ3 L;  1AE3 A;  4JI8 Q;  3J7Z C;  1X65 A;  3CME A;  3U58 A;  1EQQ A;  4A93 G;  2PQA A;  4JBW A;  4A76 A;  4EQ5 A;  4GKJ L;  4LFB Q;  3RLO A;  5C4J H;  1SRO A;  1NE3 A;  1VQI A;  2CFM A;  4LUZ A;  2K75 A;  4OXP A;  2NVY H;  1IL2 A;  4AYB G;  4GNX C;  5IYB G;  4HJA A;  3E9H A;  1M90 C;  1HNW L;  1Q81 C;  5IP7 G;  2R92 G;  4OWX B;  4DR3 L;  2FXQ A;  1B7Y B;  2R7Z H;  1GVP A;  4PZ7 A;  3UDG A;  4GKK L;  4PMW A;  1K8G A;  1OTC A;  4DPG A;  5GAG C;  1CKN B;  3BZK A;  4X65 L;  1P8L A;  4GKK Q;  3I4M H;  1BBU A;  5C0X G;  4A3I H;  2IT1 A;  3NEN A;  2KEN A;  3KOJ A;  3ULP A;  1PH3 A;  1KAW A;  2DUD A;  3S1N H;  4A3M G;  3L7Z C;  4IPH A;  4DV2 L;  2L15 A;  4OWT B;  4ALP A;  2E2H H;  1V43 A;  2VQE Q;  4JC0 A;  3S24 A;  4DK3 C;  2UXC L;  1UWV A;  2YV5 A;  4GN5 A;  3CC2 A;  4JOI A;  2HQL A;  4DR6 L;  4A3D H;  1FGU A;  1VQA A;  1EYG A;  1HZ9 A;  2JK8 A;  1GD7 A;  5ELN A;  5FJ8 G;  1QVG A;  2D0P A;  2JA8 G;  4LF9 Q;  2UXB L;  1RL2 A;  1TWG H;  3D31 A;  4IPC A;  4APV A;  2IX1 A;  1SLJ A;  3KFU A;  2UU9 L;  2CWA A;  2RHS B;  1K73 C;  3OTO Q;  4A3J G;  4KI0 A;  3G48 A;  4DV1 L;  4POG A;  1EQR A;  3HOW H;  1J5E Q;  3G71 A;  4JBM A;  1D7Q A;  3AFP A;  2EXD A;  2D0O A;  2JEB I;  3F1Z A;  3UDI A;  1YHA A;  2JJQ A;  1L1O A;  1E1T A;  3F2B A;  2F3I A;  5LMN Q;  3RLF A;  1BKB A;  5IYC G;  2ZTE A;  3HKS A;  1R9T H;  1PFS A;  1IBL Q;  4JOI C;  4JI3 Q;  1RIP A;  1Q46 A;  5HY6 A;  3WWV A;  4NPS A;  4YCV A;  1TXY A;  1Y1W G;  5ELO A;  3H15 A;  2A1A A;  4B3R L;  4DV7 Q;  2JA5 G;  3CMA A;  4DUZ Q;  3BZC A;  3KJP A;  4LF8 Q;  4LFB L;  1OXT A;  2JE6 I;  1PH6 A;  3S1Q H;  4IOC A;  2QGQ A;  5FLM G;  4DUY Q;  4HJ9 A;  1Q7Y C;  3CQZ H;  1VQC A;  1VQJ A;  4GOP A;  3STB C;  4K0K Q;  1L1O C;  2GVB A;  2VW9 A;  5M5X H;  5AJ3 Q;  1IZ6 A;  4HJ8 A;  2YTV A;  3VDY A;  3HOV G;  4P73 A;  2Y0S E;  4GKJ Q;  3CPW A;  3CCR A;  2Z6K C;  3H3V H;  3PIP A;  4JV5 L;  3GTG H;  3U4Z A;  3AQQ A;  4FDB A;  1EWI A;  1MKH A;  4LUV A;  2R93 G;  4JYA L;  5M3F G;  3Q8D A;  4DR3 Q;  2K4K A;  2WAQ G;  1CUK A;  4P71 A;  1KQS A;  4IFD G;  1WJJ A;  2AHO B;  3HOY G;  4DR4 L;  5GRO A;  5IP9 G;  2NZO A;  3I56 A;  3CCU A;  4DR1 L;  4GOP C;  3PO2 G;  4BA2 I;  2UUA Q;  4BY7 G;  4RG1 A;  4YWM A;  3GTK H;  4IFD I;  2KCT A;  1BVS A;  1HNZ L;  2VS1 A;  3ULL A;  4X65 Q;  3CCS A;  1PHJ A;  4LF9 L;  1VQ6 A;  4MNO A;  1JJG A;  3TS0 A;  3RN2 A;  4GNX B;  3L0O A;  1VQO A;  4LF4 Q;  4DV2 Q;  4A3C H;  1HZB A;  3S2D H;  1J5E L;  1XNR L;  1HZC A;  1MJC A;  2KCM A;  1PH1 A;  3J80 c;  1N34 L;  3I2Z A;  1OXS C;  4A3L G;  1C7Y A;  4DR6 Q;  2AKW B;  3HOZ G;  4C3H H;  2ES2 A;  3MXN B;  1OXX K;  1E24 A;  2ALY B;  4QJF A;  1NTG A;  3OYY A;  3L2P A;  1V1Q A;  2GVA A;  5LMN L;  1IBL L;  4UPA A;  3S16 H;  3TRZ A;  2UXB Q;  3HOX G;  4JI3 L;  5IE8 A;  4LW1 A;  2PQA B;  2UU9 Q;  3S17 H;  3UDF A;  3PUW A;  1YNX A;  2ZTD A;  4DV7 L;  4RMF A;  4AQY L;  1VQL A;  1XTD A;  4LF8 L;  2ZM6 L;  4JI2 L;  1VQD A;  4JBK A;  2JQO A;  2MO0 A;  4LFA Q;  2OWO A;  4B3S Q;  3U4V A;  1O7I A;  3W5O A;  5EAY A;  4OX9 L;  2JA7 G;  3GTP H;  4UP8 A;  4A3G G;  4DKA C;  3GTJ H;  5GAD C;  1KRT A;  1AE2 A;  1KD1 C;  2KHI A;  1KL9 A;  4B3S L;  1VQB A;  3PUZ A;  4BXX G;  1A0I A;  4JG2 A;  3H0G G;  1PH5 A;  2R6G A;  4B3R Q;  5C4X G;  1SMX A;  2VZA A;  2NN6 I;  3EN2 A;  4JI0 L;  2QA4 A;  4GLA C;  5C0X J;  4L5R C;  3A5U A;  3MEF A;  1VQP A;  3B6Y A;  5GAH C;  4HIK A;  1A8V A;  1HR0 L;  4A3E G;  3KF6 A;  3F8T A;  5IWA L;  4R4T A;  1EOV A;  1JE5 A;  1S72 A;  4JI5 L;  4LNQ A;  2ASB A;  4YCW A;  1VQG A;  4BBS G;  2KHJ A;  4UY8 C;  3TS2 A;  2UUA L;  1N8R C;  4GLV B;  3M9B A;  1K83 H;  1HJP A;  4QIW E;  4A93 H;  4Y52 H;  2Q2H A;  2UUC L;  5HGQ A;  4YWK A;  4JV5 Q;  3RNU A;  3HKZ E;  3I4M G;  3RR5 A;  5M3M H;  2KBN A;  3W1G A;  4KHZ A;  3D0F A;  5C0X I;  2OTL A;  3GO5 A;  4A3K H;  1YIJ A;  4JYA Q;  5M5Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...