1PFSA

Solution nmr structure of the single-stranded dna binding protein of the filamentous pseudomonas phage pf3, minimized average structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the single-stranded DNA binding protein of the filamentous Pseudomonas phage Pf3: similarity to other proteins binding to single-stranded nucleic acids.
pubmed rcsb
source organism Pseudomonas phage pf3
molecule tags Dna binding protein
molecule keywords PF3 SINGLE-STRANDED DNA BINDING PROTEIN
total genus 9
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pfsA00
1XMQQ 1IBML 1PH5A 4IPGA 3ICEA 3PO2G 3ER0A 2YYZA 1X6OA 1W3SA 4B3TL 1HJPA 1I94Q 2JA8H 3H3VH 2RCNA 4IOCA 3STBD 2DGYA 1QZGA 1VQCA 4DV3Q 4LF8Q 1JJGA 4Y52H 1VQMA 5C0XG 3MXNB 1FJGL 4DR4Q 4DUYL 5LMNL 1KC8C 1Y1VH 3U50C 4EX5A 2HIVA 4DK6C 1WCMH 1VQIA 1WI5A 2PMZE 1HZ9A 1N34Q 4UY8C 4DAYB 3S1NH 1HNWQ 1C9OA 3M7NA 1HZCA 3RN5A 3A5ZB 3KF6A 1AE3A 2OQ0A 3NEMA 5H1SE 4YHHQ 3CCLA 4GKKQ 3J7A5 2D0PA 1V1QA 4DR7Q 3RNUA 2E2JH 2BH8A 3RLOA 1OXUA 4JI1L 1PH4A 1KXLA 4XTCS 4YWKA 1PVOA 5C4JH 3I4MG 4J15A 1TWAH 3ULLA 2MNAA 4GOPB 1BVSA 1SR3A 4DV4Q 3AEVA 3CD6A 4DNIA 4X62L 3L2PA 2UUBL 4A3DH 4DR4L 4A3LH 2OTJA 2K75A 3GO5A 3RLFA 5C3EH 3ERSX 4FDBA 5C0XI 1Q82C 1FJGQ 2JEAI 2B3GA 4HIOA 1HR0Q 1VQHA 1X55A 1S40A 4LUOA 4JI7Q 3GTQH 5IP9G 4IPCA 1XPUA 2BA1A 4UP8A 1UEBA 1PH3A 2LSSA 1JJCB 2IT1A 1PH8A 4BA2I 2Y0SE 4HJ9A 1L0WA 1YVCA 3G48A 4DR3L 3OTOL 1G6PA 1X3FA 3H0GG 3JC66 1C7YA 1TWFH 3A5UA 1A8VA 1Q86C 4HIMA 5JEAG 2IX0A 1SMXA 3GTKH 4DR5L 1D8LA 1WJJA 2CWPA 2IHFA 3K8AA 1CKMA 2NVYH 3HOUG 4LFAL 3HFZB 1XNQQ 3H0GH 4JI0Q 4BXXH 3CP0A 3NELA 2ZM6L 4JBKA 1GVPA 1PFSA 1YBYA 1OXTA 1UE6A 5IE8A 4JI3L 2Z6KC 5M5WH 3J81c 2A19A 4LF6L 5HY6A 3TS0A 5C44H 1KHIA 1NMFA 2Z6KA 5IP9H 2MFIA 3H3VI 4DAMA 4HJ5A 3UE1A 4DR1L 3PF5A 1IBKL 3S17H 4L5TA 1PH9A 4OO1G 1MJCA 1YJWA 4JCVE 4A3IH 1VQKA 3S16H 2UXBL 1K9MC 4JI4L 3K80C 4DR5Q 4BY7H 2VQFL 1MKHA 1K8GA 1XNQL 1GO3E 2E2IH 1K0RA 1TWHH 1NTGA 4IFDG 2Q2IA 3ZJYC 1IBLL 4A3GG 4BY7G 3KOJA 3I4MH 4JI5L 5JJIA 3UDGA 3PSIA 1HH2P 3U58A 1IL2A 4A3MH 1JMCA 1Z47A 5C44G 3I4NG 4POGA 2K52A 1J5EL 2PI2A 2AWOA 3CCEA 1VQLA 3GDEA 3E9IA 2UUAQ 1EWIA 1V43A 4GN4B 4JI8L 4JI7L 4BXXG 4GKJL 2IY5B 2UUBQ 1IBKQ 3CW2C 1J5EQ 5GROA 2ES2A 2OWOA 1M1KC 4AYBG 1XNRQ 5IY0A 4R1JA 4DR7L 3PUYA 3U4ZA 3RZDH 3HOZH 1K83H 1YHQA 3FP9A 2ZJPA 4K0KQ 4LNQA 1K3RA 3D0FA 4HJ7A 4IOAA 1LM0A 3CMAA 1YHBA 1TXYA 2HIXA 4OX9Q 2UXBQ 3MEFA 1YZ6A 4A75A 3E9HA 2AWNA 1VQBA 4DV6L 4A3JH 5JJLA 2D0OA 2AKWB 2NVXH 4NPSA 2UUCQ 1EIYB 5HGQA 3I7FA 1YI2A 5IYCH 1Z9FA 2GVBA 1J6QA 2JA9A 1PYBA 1HR0L 3GTPH 3KJOA 2HT1A 3HOYG 4BA1I 4LFBL 3HOXH 1VS0A 2N3SA 3BJUA 1Y1WH 3CC7A 5JJKA 2IHEA 3I4OA 2JA6G 3PO3G 1PH1A 4A3KH 4OXPA 2OQKA 5M3MG 4POFA 3I55A 4B3ML 3CXCA 1K73C 3F2CA 1EYGA 4JC0A 1ASZA 1WCMG 2LXJA 4R4TA 4P75A 3S1QH 4IFDI 4TQUS 3TQYA 1BBWA 1L1OC 4LFBQ 1PH6A 1VCIA 3AQQA 4DUZL 1HZBA 5AJ3L 1YNXA 5FJ8H 2XGTA 4DV2L 3OW2A 2EXDA 4NB3A 4DV1Q 4LF5Q 4OWWB 3FHWA 4DPGA 5GAEC 5GAHC 4OO1I 4JI3Q 4LF6Q 3S2HH 3PGZA 2R7DA 3UE0A 2JA8G 4DR6Q 1JE5A 1GKHA 2JJQA 3Q8DA 2ZM6Q 2JA7H 1D7QA 1V9PA 4H02A 1BKBA 2R92G 2YTVA 3PO2H 5C0XJ 1IYJB 1PH2A 1Q8KA 1VQJA 2HQLA 2I5LX 4K0KL 1HNZL 4PZ7A 4B3SQ 3B6YA 4C3HH 2QGQA 2GN5A 3BU2A 1NY4A 3KFUA 2JA5H 2VY3A 3W1GA 3CCUA 4JBMA 1G51A 4DR3Q 1N34L 3S1RH 2K14A 3CCSA 3M4OH 3KF6B 3S24A 1NJIC 5IP7G 3CC2A 3HOVG 3K7AH 3HOWG 1A0IA 5M5XH 1Q12A 4A3CH 5M3FG 4JI6L 2N78A 4MZ9A 1YEZA 4JI8Q 4P72A 4A3BH 4EQ5A 1P8LA 1N33L 4YY3Q 3AYHB 2YTYA 4JI6Q 4LF4Q 4R4IA 2N49A 4A93G 4WJ4A 4GN3B 4KLKA 1X3GA 3M4QA 2VUMG 1LTLA 1E7ZA 4JI5Q 4GNXA 4JI1Q 2VNUD 2Y0SG 4QGUA 4A3FG 4L5SA 3T1HL 2RHSB 4P74A 3A74A 3JAMi 1NBWA 3LGJA 2PQAB 5IYBH 3PV0A 1UE1A 4R4CA 3NENA 5GAGC 2R7ZH 3GTMH 1T9HA 3TRZA 4DR6L 1HNWL 3DM3A 5IYDH 1Q1EA 1VQ7A 4X65Q 1KQSA 2NVTH 4X64Q 3CCMA 4LW1A 4A3EH 4JI0L 3H15A 3HKSA 4MNOA 5M5YH 5J3BA 2ZTDA 3M4PA 4BY1G 3M9BA 2V1CC 3G71A 4PG3A 2VS1A 3WWVA 2EQSA 5IYDG 3GTJH 3S1MH 1ASYA 1CSPA 1I94L 4B3TQ 2R6GA 1S3OA 4OONA 4P71A 2PQAA 2D62A 1EQQA 1E1OA 1OXSC 2ALYB 4YWLA 1XMQL 4ME3A 1E22A 1I50H 3I2ZA 3F2BA 2CWAA 4A3FH 4ALPA 3PUVA 1TWGH 1K8AC 2WB1E 2R93G 4X65L 1KD1C 3AFPA 4AYBE 1VQFA 2VUMH 1L1OA 5BR8Q 2B63H 1XPOA 4A93H 2VQEL 3E0EA 4Y7NH 1X9NA 2XTIA 4OWTB 2UUCL 4DV1L 3IRBA 2KCTA 3J81j 3K0XA 4HIKA 4KHPQ 1E24A 4BBSH 4NXNQ 2JK8A 4LWCA 2CQOA 3T1HQ 4DR2Q 1W2BA 4B3RL 4X6AH 1VQ4A 3HOWH 4BBRG 1CUKA 3J7ZC 5FLMG 2NN6I 3K81C 1LYLA 2YU9H 4JYAQ 3RR5A 2JEBI 4B3MQ 4O0AA 1Y14B 2NZHA 2R7FA 2EIFA 1XMOL 4LF7L 4PZ8A 3BZCA 2VW9A 2UXCQ 2WAQG 2FXQA 4YY3L 1N36Q 1EIFA 4QL5A 3PIPA 4AQYQ 4KI0A 1G291 1NMGA 5DLQE 3AFQA 5LMNW 1YIJA 1N33Q 2E2HH 3G4SA 4DV0Q 1PA6A 4AIMA 1AE2A 4IJHA 4LF5L 3BZKA 3T1YL 2ATWA 3OYYA 3CC4A 4AQYL 4KHZA 3RN2A 2WP8J 4UP7A 1I5FA 3PUXA 5K36G 4YCWA 5C4XG 2H5XA 1HNXL 2RF4A 5GQOA 1CKOA 5FLXc 4LF7Q 4QIWE 1VQDA 3J81i 3CF5A 4LF9L 1WFQA 4YWMA 1A62A 2KHJA 5FJ8G 3CCRA 3D31A 2HHHL 1XPRA 3CPFA 4GKKL 4GLXA 2NN6G 3F8TA 4UP9A 1HR0W 4B3SL 3PUWA 4GS3A 3UDIA 4P73A 1HNZQ 2UU9Q 1MJEA 2KCMA 4DV7L 4IJLA 4DR1Q 2QA4A 4GLVB 2E5LQ 2A1AA 1N8RC 5M3FH 5C4XH 1XNRL 2CKZB 2KENA 2F4VQ 4A3KG 2VQEQ 2Z0SA 4QQBX 1OTCA 2JA6H 3KJPA 1Y1WG 1PYSB 4JI2Q 2LXKA 4JOIA 4DK3C 1PH7A 1L1OB 1FL0A 1RIPA 1U5KA 4C2MH 1GD7A 1I3QH 4O2DA 2OTLA 4L5RC 2F4VL 1TWCH 4OX9L 2MQHA 2ZTCA 3PCOB 3GTOH 2UU9L 4L5QA 4OWXB 2HHHQ 5JEAJ 3KLWA 4GLAC 1N9WA 2QEXA 1KRTA 2ZTEA 3S14H 4RG1A 1CSQA 1SROA 2R92H 3NBHB 1UE7A 2MO0A 1KAWA 3PIOA 1AH9A 3EN2A 4R4OA 4LF4L 2JA7G 1I6HH 1EFWA 1H95A 4YCVA 2Q2UA 4LUVA 2UXDQ 4GN5A 4DV0L 1JJ2A 1SLJA 1VQ9A 4BBSG 3T1YQ 4XIGS 2UXDL 2B63G 2AHOB 3GTGH 4RMFA 4PMWA 3ULPA 2KBNA 3ULJA 4C3IH 3KDFA 4X62Q 4HJAA 1QUQB 1VQ8A 2F3IA 4GOPC 2I5HA 2BH2A 3RZOH 1DGSA 3DLLA 5M3MH 1QVCA 1KIXA 1JT8A 1VQAA 3PO3H 4JV5Q 3I4NH 2YTXA 3HOXG 2VQFQ 2NVQH 3HOYH 4A3MG 3OTOQ 1Q46A 1X3EA 2K50A 2K5VA 4DR2L 3M85A 1X65A 5IYCG 1SN8A 2B29A 1JB7A 3F2DA 4JI2L 1OXVA 3PF4A 4A3GH 4BY1H 1HZAA 1X56A 1B7YB 4QJFA 3CPWA 2UUAL 4A4IA 4NXML 1Q1BA 4GKJQ 3HKZE 2WB1G 1PV4A 4APVA 2E5LL 4X66Q 2Q2TA 1PHJA 3U4VA 5FLMH 1KRSA 1LUZA 3CQZH 3KYHC 4BBRH 1YITA 3S15H 1UWVA 1FVIA 1E1TA 2BA0A 4JBJA 3TREA 3M3YH 1N32Q 3EBEA 5IT9c 4UPAA 2R7ZG 3HOZG 3L0OA 5IYBG 1VQNA 1IBMQ 2L15A 5E7NA 4LF9Q 2WFWA 4JYAL 4JBWA 4IPDA 3VDYA 2PNHA 5ELOA 2CFMA 1N32L 2Q2HA 4PZ6A 1Q7YC 3F1ZA 2K5HA 1IBLQ 1WOCA 2F52A 3SGIA 4JI4Q 3HOUH 1VQGA 4B3RQ 4GNXC 2E8GA 3A0JA 2VL6A 4LUZA 4NXNL 4X66L 2R93H 2ZJQA 3GTLH 1CKNB 1EUJA 2A8VA 3CMEA 4GOPA 1QVGA 2KHIA 4DUYQ 4DV6Q 3STBC 4DV7Q 4AH6A 1KL9A 2JE6I 1BBUA 1OXXK 3UDFA 4C3JH 1SFOH 4GNXB 2ID0A 3I56A 1RL2A 2GVAA 3PUZA 3KDFB 4LFAQ 4JOIC 3J80i 5IP7H 1YJNA 1EOVA 1SRUA 2ASBA 3HOVH 3S2DH 4A3LG 1CKNA 1XJVA 4A3EG 1B8AA 4QY7A 4A3IG 5GADC 1HNXQ 2JA5G 1QVFA 2CCZA 3W1BA 4KHPL 5LMUQ 1L2FA 4JG2A 4DV5L 1P16A 1VQ6A 3KF8B 5LMNQ 3W5OA 1IZ6A 1U0LA 2JQOA 1VQEA 2I0QA 1NE3A 4A76A 5IWAQ 2C35B 1R9TH 3CAMA 4DV4L 4IPHA 1VQOA 1QZHA 1Q81C 1VQ5A 4NXMQ 1O7IA 2PI2E 2K4KA 1A63A 1MIUA 5LMUL 4HIDA 1Y1VG 3CCVA 1N36L 4DV5Q 2NZOA 1SE8A 5ELNA 1FGUA 4R4QA 3CCJA 1XMOQ 2UXCL 1C0AA 2MO1A 3TS2A 1X54A 3GD7A 1YJ9A 2YV5A 2ZJRA 3TEHB 3JAMc 4JV5L 1M90C 3L7ZC 4YCUA 1XTDA 2I5MX 1WYDA 2RHQB 4YHHL 2OCEA 4DKAC 1UE5A 4LFCL 4A3BG 2AMCB 4A3CG 5EAYA 4X64L 5BR8L 1EQRA 5C3EG 1VQPA 2IX1A 3CCQA 2K5NA 3FKIG 4A3DG 1GM5A 3EIVA 5IWAL 1E3PA 4DV2Q 2WAQE 1B70B 3RLNA 4IFDJ 1QUQA 3HKZG 2VZAA 4MTNA 4HJ8A 3G6EA 2N8NA 1S72A 4LFCQ 1IXRA 3K7UC 4TVAB 1YHAA 4DV3L 4LF8L 4WJ3M 5AJ3Q 4IO9A 4DUZQ 3UDXA 2DUDA 3FKIH 4A3JG 3J80c
chains in the Genus database with same CATH superfamily
3Q6SA 1IBML 1SAPA 2YYZA 1X6OA 2CH4W 4KD4A 1VQCA 1PFMA 5C0XG 4M1UB 3PIO3 1CI3M 4DR4Q 4B9XA 5LMNL 4HSVA 4EX5A 1CM9A 2HIVA 4XQNA 2IPKD 3S17B 1VQIA 1D5MC 1O80A 2DY7A 1Y8PB 5I9OA 1X3PA 3KF6A 2QF7A 4NW2A 4GKKQ 2F0OA 2D0PA 2KVMA 3P20A 4DR7Q 3RNUA 2E2JH 2ICIA 2BH8A 2EYPA 1KXLA 1OXUA 5KIXA 3OPOA 1PRTB 2XRSD 1PVOA 1MHWC 2MNAA 3GTJB 4DV4Q 3CD6A 4X62L 4A3DH 4A3LH 4HMJA 1SYBA 2OTJA 1BCPD 3RLFA 1FJGQ 2K03A 1IYVA 2B3GA 2B8GA 4V0BA 3OW7A 5E4XA 3HOUB 2EDGA 1TS3A 3NXWA 1PRTC 3I72A 4UP8A 3HGBA 1PH8A 1BBXC 4PMCA 1L0WA 4M8AA 1TWFH 1Q86C 1A8VA 3K5OA 3GTKH 1TU2B 4WFN3 3CP0A 3U9OA 1YBYA 5M5WH 1UE6A 4IURA 4JI3L 5IE8A 1KDCA 2HUGA 5HY6A 3TS0A 5DM73 1KHIA 5IP9H 1STHA 2F4IA 4HJ5A 1CQVA 4JCVE 3S16H 4J1MA 1K8GA 3GTLB 1NTGA 3D3RA 3ZJYC 4A3FB 4RAUC 3P7JA 3I4MH 4ZYSA 3PSIA 3KLRA 2F0KA 3KBGA 1Z47A 3I4NG 4CDFC 2F0HA 1TIID 4X3UA 1JWSD 4JI7L 1EWIA 1EWHA 4GN4B 4KJNA 4JI8L 1IL8A 2UUBQ 1IBKQ 1S4ZA 3DHQA 2WACA 1J5EQ 4QIWB 3RD4A 3M7GA 1D5XC 3PUYA 2EJMA 3RZDH 4A3JB 3BVGA 5FLXL 1KDAA 2ZJPA 3HG9A 2K7VA 4HCEA 3I4NB 1EU4A 2UXBQ 4A75A 3HOZB 4QMGA 1LTTD 2NVXH 4JVZA 2RSNA 3I7FA 1YI2A 1B50A 1Z9FA 1ZKOA 1IKLA 2F0LA 3HOXH 3BJUA 1ESRA 2N3SA 2IHEA 1LT3D 3ERQA 2E75C 4POFA 3DMUA 3F2CA 3MA2B 5EJWA 1CTMA 4K8JA 1ASZA 1WCMG 4P75A 1IKMA 3CKIB 1L1OC 2C5CA 3IFDA 4HCSA 4LF5Q 2CHBD 4DPGA 1EIGA 5DM63 4OO1I 4LF6Q 3UE0A 5K36H 1IHZA 1JE5A 2JA7H 2ZM6Q 1V9PA 2YTVA 4GZYC 3TZDA 1PH2A 2B2UA 4BY1B 4Z9CB 1EY6A 2HQLA 3Q0AA 1EFID 1LTGD 1NY4A 1G51A 3KF6B 3CC2A 1ICFB 3K7AH 2F0FA 2ZXRA 1Q12A 5C4XB 2SDFA 3K5LA 2N78A 4JI8Q 4P72A 1N33L 4YY3Q 4JI6Q 2NN6H 1FNWA 2VUMB 2ZT9C 1X3GA 1JWUD 1K0SA 1E7ZA 2ENBA 4JI5Q 4J8QA 3MHBA 4QGUA 1QNKA 3T1HL 3J81E 2RHSB 2EJFC 3V05A 2EY6A 4P74A 1V1OA 4ZUIA 3PV0A 4N9PA 3HOVB 5GAGC 1ZXTA 1T9HA 3N52A 1II3A 2KQ3A 2V4DA 1LABA 1KQSA 4JI0L 3GTKB 3H15A 1JICA 3M4PA 5EKLA 2V1CC 2EY5A 3BG3A 1B3QA 1EQTA 1UAPA 4B9WA 4C3JG 1I94L 3H0GB 4G4KA 5HGTA 3S1QB 2ALYB 4YWLA 2HDLA 2A68D 3TSSA 4A3FH 3PUVA 2WB1E 4RWSC 2LMCB 3LWEA 1ZEQX 3VYTA 1KD1C 1DCZA 1F9SA 4C3IB 3QWNA 2I46A 2Z8LA 5CC4A 1FNVA 1Z6HA 1RTNA 2XTIA 4K2LA 2KECA 3IRBA 5ELEA 4KHPQ 1B1ZA 3T1HQ 2M00A 4TRDA 2KEEA 1SE2A 1Y14B 3J7AF 2NZHA 4CKEA 2OT2A 1N36Q 1EIFA 4KI0A 2L1BA 1HTPA 3AFQA 5COYA 1V1PB 1RD9D 2PNRC 1HA5A 4DV0Q 1JQYD 2RCFA 4AIMA 4F87A 1PA6A 1I4XA 4RGMA 1HPCA 2YU9B 2WP8J 4UP7A 2L9HA 3BVZA 2RF4A 1VF5C 3PQIA 4LF7Q 4QIWE 4LF9L 1WFQA 1CZWA 2KHJA 2DN8A 2HHHL 1EY0A 2QEJC 4B3SL 1SYDA 4P73A 5I2YA 2KCMA 3D4RA 2AQ2B 5IGBA 3IKJA 4GLVB 4A3KB 4OIJA 2F4VQ 2CKZB 1RDPD 3KJPA 2IJ0A 2JA8B 2PZTA 5DEHA 1L1OB 1FL0A 1H9MA 1PH7A 2OTLA 4O2DA 4OX9L 2MQHA 2ZTCA 3I70A 3I90A 2B2VC 4L5QA 3ZYYX 4GLAC 2F0WA 3S14H 3T51B 4RG1A 1Y8OB 2EYMA 3PO2B 3NBHB 2MO0A 1KAWA 1EFWA 2E2HB 1B53A 2Q2UA 5BN5A 4HN7A 1SLJA 1PDQA 2FMMA 4DN4M 4JK1C 1BCPC 4XIGS 3MXPA 3D8GA 5LL6S 2AHOB 4RMFA 3ULPA 1QUQB 1JR0D 2BH2A 5M5XB 3KLSA 2JYOA 3PO3H 3M4OB 1B44D 2K5WA 3I4NH 2NVQH 3T53B 1WCMB 3K5NA 1X3EA 2K5VA 4DR2L 2ICEC 1A3VA 3S2DB 1X65A 1SN8A 1M8AA 3PF4A 1PLFA 3OIQA 3TBIB 1HZAA 4ID6A 5KEEA 5FO8B 2UUAL 4GKJQ 4HR7B 2E5LL 2Z4IA 4G57A 1GUTA 5FLMH 1KLUD 1EOTA 1LUZA 5IIFA 3S15H 1FVIA 2BA0A 3QB3A 4DU9A 1VQNA 5IYBG 5CMDA 2L15A 4JYAL 2WFWA 4JBWA 5M5YB 3H94A 4JI4Q 2K5HA 4B3RQ 3D4WA 3MTSA 5JEAH 1QG7A 4LUZA 2L5TA 3GTLH 1EUJA 2QILA 1UNSA 1I4HA 1PXUA 2DNCA 4YIJA 4DUYQ 4DV6Q 3STBC 4DV7Q 2JE6I 4G7OC 4OHJA 1OXXK 3TZUA 1SYCA 4C1NI 1RL2A 1CFMA 3KDFB 4JOIC 2ASBA 1EOVA 3BS1A 2PZWA 4DNTB 5GADC 1HNXQ 1QVFA 1DOKA 2TMPA 1WD0A 1BCPF 3FPUB 5LMNQ 2B2YC 4DAYA 3EQLC 2WB1B 4A76A 4ZRZA 3SK6A 1Q81C 3CAMA 3I73A 4DV4L 1VQOA 5JAVA 2K4KA 4FF2A 3A8IE 1B9MA 2NZOA 5ELNA 4MHEA 1FGUA 3CCJA 1DM0B 1C0AA 2XWJB 3TS2A 1X54A 1MI2A 3NPPA 1X32A 1XTDA 1WYDA 4UHVA 4YHHL 4RCNA 2OCEA 4LFCL 4A3BG 3ONAB 5BR8L 3L9AX 2RQXA 3GTMB 5CV9A 1SNOA 4C3JB 1GM5A 3EIVA 5IWAL 5KYLA 4IFDJ 3HKZG 4MTNA 3G7LA 4HJ8A 2N8NA 4LFCQ 1YHAA 4DV3L 4LF8L 4WJ3M 2EE1A 4IO9A 1EYAA 4DUZQ 3CMAA 2F0VA 4I7ZC 1I4RA 3PO2G 1EWCA 1HJPA 1PYWD 1I94Q 2DJFC 2JA8H 2GA4B 2A6EC 3STBD 4CJ0B 4DV3Q 4LF8Q 4KY5A 4EVOA 1FJGL 4E6IA 1KC8C 3HKZB 5D14A 3U50C 4KJOA 1CQFA 2PMZE 3H91A 2MUYA 1N34Q 1S5CD 1HZCA 1KLGD 4FF4A 1AE3A 3NEMA 2Z1CA 4YHHQ 2ZXOA 3CCLA 5LL6X 3J7A5 1AZPA 1PMRA 4U68A 4YWKA 2BOSA 5C4JH 4J15A 1TWAH 4GOPB 4CKCA 3EA6A 5T1GA 4DNIA 3E0JA 2UUBL 2NVXB 2K75A 3GO5A 1EYDA 3HOXB 1X55A 1S40A 3MXGA 2E76C 5IP9G 1B2TA 2BA1A 2LSSA 3T4AC 4HAEA 1G6PA 3JC66 3A5UA 4NP5A 4HIMA 4BBRB 3HZXA 4B08A 1D8LA 1WJJA 2CWPA 2JN4A 2ZM6L 4RA8A 5CV7A 4CKBA 3J81c 4XXEA 2FHTA 3NP8A 5IGDA 1HHVA 4FP5D 3S1NB 3G6JB 1EIHA 4XDXA 1IBKL 4OO1G 4DR1L 4L5TA 1PH9A 5I9PA 2CQAA 1YJWA 3J81L 5IT9L 2NBFA 4CDEC 4JI4L 4IALA 2VQFL 1CA6A 5C4HA 1K0RA 1AW7A 1QE6A 2HQEA 4ODGA 2QCPX 4JI5L 3DEPA 3IL8A 3UDGA 1NCVA 5CBAE 2K52A 4KHVA 1BO0A 2PI2A 2UUAQ 4GKJL 3K6OA 1B4OA 2PW7A 3CW2C 5ISRA 5GROA 3OMCA 4AYBG 4FF3A 4DK1A 4R1JA 4PV1C 2E2DC 4IQZA 1U4LA 2PYKA 3RUZA 1YHQA 4HJ7A 4IOAA 1YHBA 4NKLA 1JCKB 3E9HA 2AWNA 1VQBA 2J4XA 2D0OA 3FKIB 2UUCQ 1SMYC 1EIYB 5HGQA 4IUTA 1ILQA 2GVBA 1PYBA 3GTPH 5G3LD 1S5ED 1RODA 2HT1A 3HOYG 4LFBL 1Y1WH 3I4OA 2SEBD 3PO3G 1K83B 2OQKA 1ET6A 3CU7A 4R9WA 4F8MA 1EYGA 1QJOA 4JC0A 1YNJD 4TQUS 3QIAA 1GUSA 2F0EA 4K6LA 1PH6A 3AQQA 1AZQA 1HZBA 4LFBQ 5AJ3L 1YNXA 2Z9HA 2EXDA 1SNDA 4IUUA 3FHWA 3NUCA 1SJHD 4JI3Q 3S2HH 1TVXA 2R7DA 2JA8G 4DR6Q 3Q8DA 5I6YA 1A3TA 1BXTA 3TP5A 5C3WA 1ZYRD 4OGQC 4H02A 1BKBA 2F1MA 3HS0C 4KY6A 4BWGB 1CA5A 3PO2H 1Q8KA 1VQJA 2A5HA 2I5LX 2A69D 3K7AB 1HNZL 3W3AA 2BCOA 3K59A 3M3YB 2NWGA 1CHQD 3A8JE 3W1GA 3CCUA 3NBIA 4DR3Q 1YNNC 1STYA 4KKTA 3M4OH 3PO3B 1NJIC 5IP7G 2CW0C 3HOWG 1A0IA 5M5XH 4DAVA 4A3CH 2WINB 4MZ9A 4L6TB 1FD7D 1RF2D 2CW0D 5C4JB 1PFBA 5JVG3 2KEDA 2H1EA 3KBXA 3AYHB 2YTYA 1SBBB 1ONLA 4R4IA 1HTLD 5C44B 3S14B 5F2DA 4GN3B 4WJ4A 4KLKA 3DUZA 2R7ZB 3DEOA 2VNUD 1SNMA 2Y0SG 1CHPD 4L5SA 4PQXA 2B8FA 2XVSA 1B9NA 4K5VA 3A74A 1A2UA 3TRZA 2R7ZH 3NENA 3GTMH 1HNWL 1H9KA 4DR6L 1D6EC 1LACA 1MGSA 5IGGA 3DWAA 1LO5D 4IUQA 2NVTH 4X64Q 5TSSA 3CCMA 5LHY1 4HTHA 4MNOA 2ZTDA 3QJYA 2L11A 3M9BA 4ULLA 3G71A 4PG3A 3X3NA 4OELB 1GHJA 4B3TQ 4KKSA 4P71A 2PQAA 2D62A 4KMUC 2VB2X 1E22A 1I50H 3I2ZA 4ALPA 1K8AC 3S9WA 5HURA 2R93G 4X65L 4JW0A 4X3TA 3AU7A 1AEXA 3V2TA 1L1OA 1CK1A 1XPOA 2VQEL 3E0EA 3GTPB 4PMBA 1GUNA 4OWTB 3T16A 5D3IB 3S2HB 2KCTA 4HIKA 1F9PA 4LWCA 4DR2Q 3RZOB 3HOWH 4BBRG 5L37A 3K81C 1LYLA 3TDQA 3LWUA 1K8MA 2B2TC 3RR5A 4JYAQ 4B3MQ 1FGBD 1XMOL 2UXCQ 2B2VA 1BDOA 3TP6A 4L8JA 1M4VA 4AQYQ 5KGUA 5LMNW 5DLQE 1ILPA 1N33Q 3VA5A 3GTQB 1AE2A 4EQPA 3CC4A 4KHZA 3PUXA 1XX8A 5JOBA 5C4XG 3VYSA 2F0QA 1SJED 1VQDA 4YWMA 5FJ8G 5JPNC 1XPRA 1AN8A 4GLXA 3F8TA 4UP9A 1I4GA 3PUWA 4GS3A 5KYIA 1PTOB 2UU9Q 1S5DD 4DV7L 4IJLA 5KNDA 2E5LQ 5M3FH 5C4XH 1XNRL 4A3KG 3HEJA 2VQEQ 1ET9A 2RBMA 1BF4A 4JI2Q 1I6HB 2LXKA 4JOIA 3NQIA 4ABNA 4C2MH 1U5KA 1GD7A 1I3QH 4L5RC 1TWCH 4A3BB 2R61A 2UU9L 1BOSA 4OWXB 2QEXA 5C5LA 3S15B 1CSQA 1ENFA 3VYUA 1UE7A 1XXGA 2F0JA 3EJIA 1QNUA 3UI2A 4GN5A 4DV0L 1JJ2A 3D4DA 3VR5A 2UXDL 2B63G 2EXZA 3GTGH 4RGOS 2NVQB 2RA4A 3KDFA 3MC0B 5CV8A 5EBDA 2I5HA 4RGNA 2J7ZA 1SYFA 1DGSA 4H0LC 1FNUA 5M3MH 1TWAB 4BBSB 1BUVT 3CQZB 3C3LA 3FEWX 2EY2A 4A3MG 4CDCC 5IYCG 4XYOA 3R3OA 1A15A 1SNCA 4BY1H 4QJFA 3CPWA 2R93B 1VDZA 2WB1G 1HCZA 2Z6BA 4I7AA 4X66Q 1KRSA 3A8KE 4C1NK 4ZKBB 3CQZH 1PZJD 2K33A 3E6ZX 2F0GA 3QOJA 2F0PA 1E1TA 2D9UA 3M3YH 1N32Q 5CYUA 4UPAA 1DOLA 1A3UA 3HOZG 2R7ZG 4XYQA 1SEBD 5E7NA 4LF9Q 1L0XB 1UUPA 4K5XA 2HCCA 4X66L 4NXNL 1Y69U 1JWMD 4CDDC 1H9JA 3CMEA 1SE3A 2Q8TA 3FDTA 4IUPA 1BNZA 2SNSA 1QCBD 1DXMA 4DA2A 4ME5A 1KL9A 4UAIA 1BBUA 4KK7A 3UDFA 3K58A 4C3JH 4GNXB 1EEFD 3I56A 3PUZA 5K5PA 4LFAQ 5IP7H 5ELDA 2Z4HA 4A3EG 1B8AA 1EZ8A 4QY7A 5CBEE 3W2DA 2JA5G 5KNCA 2PMZB 5LMUQ 3TN2A 2A69C 5E1FA 3R8BA 1VQ6A 3KF8B 2EYLA 3QO2A 1VQEA 2I0QA 2K1BA 1TR5A 5IWAQ 1VQ5A 4MTKA 3GTGB 1O7YA 1O7IA 1NR4A 4NXMQ 5LMUL 4R4QA 1XMOQ 2UXCL 3NE5B 1YJ9A 2YV5A 5JVH3 4PNYA 3J80E 3TEHB 3JAMc 3HOYB 2AUJD 2HDMA 3BVMA 1WVLA 1MSHA 2PW5A 4N8FA 3JAML 2K5NA 4ZKCB 3VR6A 3S16B 1SNPA 1E3PA 2WAQE 1B70B 3RLNA 5FLXE 1QUQA 3R93A 3G6EA 1S72A 1EY8A 1IXRA 3NQTA 5CV5A 3UDXA 3FKIH 3J80c 1XMQQ 2QDLA 1PH5A 1K28A 1EQVA 1KDBA 1W3SA 4AYBB 5KNBA 1SXTA 4DGZA 3EFXD 5IOCA 1D5ZC 2F3VA 4IOCA 4Y52H 1VQMA 3Q22A 3N6RA 3MXNB 2OXPA 2F3WA 1WTOA 4DUYL 1Y1VH 2XN9C 3SR1A 1WCMH 2E2JB 2QW7A 2EVBA 4Q0FA 3S1NH 1C9OA 2L12A 3M7NA 1TS2A 1PRTD 2X6GA 3A5ZB 2OQ0A 1ZYRC 1WTPA 1V1QA 3RLOA 1V1PA 4JI1L 5FOBB 1EEID 4XTCS 1DJRD 5E4WC 1SR3A 3A56A 1WTXA 4DR4L 3TMEA 1L0YB 5C0XI 4FDBA 2JEAI 1K3BC 1YNJC 3I91A 4OO1H 4LUOA 1VF7A 4QUFA 4IPCA 1UEBA 1EYCA 1SNQA 2IT1A 1QB5D 1F2MA 3G48A 1EY5A 1X3FA 3H0GG 3KK7A 2L55A 4DF7A 5JEAG 3EVQA 2IX0A 1SMXA 3NK9A 4DR5L 1JB3A 2IHFA 1CKMA 2NVYH 3HFZB 1XNQQ 4JI0Q 2M9VA 4BXXH 1QILA 4JBKA 1GVPA 1PFSA 4H7BA 2Z6KC 5C44H 1NMFA 2Z6KA 1EY9A 3H3VI 4UDUC 2NVYB 1MJCA 4RCOA 2HD3A 2ZXPA 4A3IH 5EBCA 2UXBL 1O7ZA 1K9MC 3K80C 1STGA 4DR5Q 1XNQL 2E2IH 1JT8A 1TWHH 4IFDG 3KOJA 3OSOA 1ML0D 1E0BA 1IL2A 1WTQA 1JMCA 5C44G 1J5EL 2AWOA 1VQLA 2RVLA 2D2CC 2A73B 3E9IA 1U4MA 1V43A 4BXXG 4TKOB 4FXDA 2IY5B 4ZK9B 2ES2A 1PZKD 3J7AV 4DNRB 1SE4A 1I4QA 1PRTF 1STAA 2K32A 3NHHA 3R2TA 3HOZH 1K83H 1VMCA 3FP9A 3WOFA 1XWEA 5G3LF 5I4DA 5CGKA 1LM0A 4MN3A 1TXYA 4OX9Q 1YZ6A 4A3JH 3RZDB 5JJLA 4BY7B 5IYCH 1XTCD 3ND8A 4XQJA 1J6QA 2JA9A 2OF1A 5CV6A 4IZ8A 3KJOA 4BA1I 1VS0A 3CC7A 2JA6G 2BE5D 2KJXA 2FJ2A 2FFKB 4OXPA 5M3MG 2NZ1D 2OEOA 3OOCA 2LXJA 2I07B 3S1QH 2K04A 2O2LD 2F0TA 1VCIA 2XGTA 3OW2A 4OWWB 4A3DB 4FXKC 5GAEC 3FPPA 4HMIA 5GAHC 1MD2D 3PGZA 1LLRD 3DWPA 2O5JC 2PQEA 1GKHA 3VR3A 1D7QA 2JA5B 2R92G 5C0XJ 1IYJB 4FO2A 2PCFB 3OIPA 2KCNA 2B2UC 3B6YA 2GN5A 1STNA 3BU2A 3KFUA 2VY3A 4JBMA 3TP7A 4I65A 2KUMA 1N34L 3S1RH 1TQOA 3CCSA 1LTRD 2BE5C 2H4OA 5M3FG 4JI6L 5C3XA 4ZLTF 4EQ5A 1P8LA 1QOHA 2N55A 4DXGA 3V96A 3K57A 3VA7A 3FRPB 4MIUA 1C48A 4GNXA 2EYFA 2X69A 4JI1Q 4A3FG 3LGJA 2PQAB 1LT6D 3MAQA 5IYBH 1UE1A 1JOQA 5IYDH 3DM3A 5J39A 1Q1EA 2A74C 1SYEA 3KF8A 3KUPA 1F2YA 3NTHA 4LW1A 4A3EH 1LTID 3HKSA 1G2TA 1H9RA 5J3BA 1D2BA 1G8ZD 5EPJA 1TWGB 5IYDG 1ASYA 1CSPA 4IN3A 2R6GA 2L0CA 1EQQA 5D3DA 3CRLC 3ITPA 1Q8IA 4IUVA 2B63B 3SHLA 2CWAA 5ELCA 3CRKC 2VB3X 1TWGH 4JPBW 1AFPA 3OWEB 4ILWA 4K6DA 1IW7C 3LX0A 4AYBE 5BR8Q 4IUNA 2MP1A 3WOEA 4Y7NH 3NTIA 2UUCL 4DV1L 3K0XA 5C6AA 4BBSH 4NXNQ 2EYJA 2JK8A 2CQOA 1CT1D 1VMPA 4B3RL 4X6AH 1LTBD 1CUKA 3J7ZC 2DJGC 1V8QA 2YU9H 2JEBI 1FR3A 4KV6A 2WKCA 4G7HC 4O0AA 2VW9A 3BZCA 1J8IA 1KNEA 4XQQA 1HFNA 4FXGC 4LK1C 2MJ8A 4RHSA 3G4SA 3MXNA 4LF5L 3BZKA 1H9SA 2ATWA 3OYYA 4CHTB 3F2UA 2CVRA 3RN2A 5IGEA 5K36G 4EQNA 1D1KA 2F0UA 3I4MB 5GQOA 1CKOA 5IGCA 1G6ZA 3CCRA 1T5EA 1A62A 5J1ZA 4R8IA 1I3QB 3IAYA 3DWQA 3UDIA 4EGVA 1XYIA 1HNZQ 4CJ1B 1MJEA 1CZGA 1H9SB 2R3ZA 5FO9B 1N8RC 1IYUA 4QQBX 1OTCA 2JA6H 3K5MA 2EY1A 2XWBB 5D65A 4DK3C 1RIPA 2F4VL 4FNFA 5CORA 3PCOB 5M3FB 4ZCKA 2HHHQ 1BCPB 1NUCA 3KLWA 3JAME 1KRTA 1PTOH 4NDXA 2EJGC 3PIOA 2QKIC 3EN2A 4LF4L 3MZ5A 2WIIB 1VQ9A 4WJWA 4BBSG 3VR2A 4LAAA 3EROA 4PMWA 3DXJC 2KBNA 4C3IH 4C3HB 2F3IA 3PMFA 4GOPC 2JP1A 3RZOH 3DLLA 1STEA 2B39A 1KIXA 1VQAA 1C8CA 1F9QA 4JV5Q 5T1IA 4EQOA 2VQFQ 3HOYH 3I4LA 3OTOQ 3C2PA 1Q46A 2K50A 2L4NA 1TWFB 4S3SA 3M85A 2D5DA 2B29A 3T56B 3F2DA 4JI2L 1HA6A 1X56A 1B7YB 2XSCA 4NXML 1Q1BA 2B2WA 2E74C 3HKZE 1PV4A 2Q2TA 1X3QA 1RJTA 3URYA 1DONA 4BBRH 1YITA 1UWVA 2A6HC 2NUCA 3TREA 3EBEA 4N8X1 4F88A 1IBMQ 3OWFA 4IPDA 3VDYA 4Y7NB 2KCCA 3F1ZA 1Q7YC 1IBLQ 1WOCA 2VXWA 3SGIA 1VQGA 1I6VC 2VL6A 4WRDA 4G7ZC 2R93H 2ZJQA 2E2IB 1CKNB 1WTHA 5FO7B 4LMQD 2EZVA 4AH6A 3D6CA 3NWSA 5M9OA 1SFOH 2EYOA 2GVAA 4O1NA 2G9DA 4A3LG 1SRUA 2RSOA 3S2DH 3SK8A 1CKNA 1XJVA 3BDLA 2C9OA 2LY7A 3KLSX 4RKBA 2CCZA 4KHPL 4A93B 1GHKA 1IW7D 2AUKA 4JG2A 4DV5L 1FYCA 4CGYB 1WTWA 1U0LA 2G5DA 3H09A 1R9TH 2C35B 4IPHA 3A7LA 1QZHA 2PI2E 2NTTA 1A63A 4H44C 4HIDA 1Y1VG 3CCVA 1N36L 4DV5Q 1SE8A 4RH6A 1EY4A 4TSSA 2ZJRA 4JV5L 4K5WA 2QDBA 2RHQB 1F2ZA 2KOLA 4A3CG 5EAYA 3AMUA 1EQRA 5C3EG 3CCQA 3FKIG 4DV2Q 4A3EB 1J9OA 2HCIA 3K7UC 1GUGA 2PO4A 2IL8A 4J6HA 3S1MB 2DUDA 4R4OA 1EU3A 4A3JG 1NAPA 2AQ1B 3HRZC 3SK4A 4IPGA 3ICEA 3ER0A 3H3VC 4B3TL 2MGSA 1R4QB 2F0DA 4DFAA 3H3VH 5CR3A 2RCNA 1WTRA 1QZGA 2DGYA 4O42A 4KKUA 1JJGA 1E2WA 2PPBC 2Y0SB 4DXFA 4C56C 1Y1WB 3SK5A 2G9HD 3K0YA 2NTSA 4DK6C 1MSGA 1WI5A 1HRJA 1HZ9A 4UY8C 4DAYB 1HNWQ 1F9RA 5C3EB 3RN5A 1G91A 1JOKA 2Q8RE 5A35A 5H1SE 1STBA 1U4RA 4LJZC 1PH4A 1EZ6A 3I4MG 3ULLA 3AEVA 3GV3A 4IFDH 1BVSA 3L2PA 1BQQT 4OIKA 1Q82C 3SVMA 5C3EH 3ERSX 3NSWA 5A2QE 4KN7C 4HIOA 1HR0Q 3MFYA 1VQHA 2M2LA 1LV9A 2EPBA 4JI7Q 3GTQH 2WAQB 3HP3A 3MEHA 1XPUA 4P2CB 1TY0A 1S5FD 3OHXC 1PH3A 1JJCB 4BA2I 2Y0SE 4A3GB 4HJ9A 1YVCA 4DR3L 3OTOL 1EY7A 1C7YA 2K6AA 1SYGA 3K8AA 3AB9A 3HOUG 4LFAL 3H0GH 1LTSD 1GJXA 2XNAC 3NELA 1OXTA 4LF6L 1Q90A 2A19A 1PFNA 2MFIA 4RGTA 4DAMA 3UE1A 3S17H 3PF5A 4ZUJA 2PZUA 1VQKA 1KNAA 4BY7H 4K14A 5J22A 1MKHA 2DY8A 1HUMA 1GO3E 2Q2IA 1IBLL 4BY7G 4A3GG 1TKWB 4FF1A 2F0NA 5JJIA 1NNXA 1U4PA 4KD3A 1HH2P 1S5BD 3U58A 4A3MH 1DOMA 1GXDC 4POGA 2NB0A 3M4YA 3CCEA 4U673 2NYZD 3GDEA 1LT5D 4DAPA 3A55A 2OWOA 1M1KC 2FMCA 3VR4A 1XNRQ 1D1IA 3GQBA 5IY0A 1ICWA 5C0XH 4DR7L 3U4ZA 1JE4A 1PZID 3GP7A 3TP8A 4LNQA 4K0KQ 1K3RA 3D0FA 2Q8IB 2HIXA 3MEFA 2AQ3B 4NMZA 4DV6L 3WDNA 1HQRD 1RKNA 2AKWB 4NPSA 5ELFA 2XIWA 1HR0L 5I2XA 2LFNA 3I8ZA 5JJKA 3A7AB 3BYYB 1PH1A 2LS01 4A3KH 1NR2A 5NUCA 4B3ML 3I55A 3CXCA 1K73C 5DNFA 2P5ZX 4QF4A 4A3MB 3QR8A 1HFGA 4R4TA 4X3KA 4C3IG 1ENCA 4IFDI 1E2ZA 3TQYA 5BN3A 1BBWA 3Q24A 1LTAD 3SE0A 4DUZL 4XT3B 5FJ8H 4DV2L 4NB3A 4DV1Q 1JORA 1TY2A 2WV6D 1SMYD 3P1HA 4FVMA 4KY7A 3GV6A 5EGTA 3S1RB 2JJQA 2F0SA 4K0KL 4PZ7A 5EKKA 4B3SQ 2MHVA 4C3HH 2QGQA 5IGFA 1WD1A 2WKDA 1Q3LA 2JA5H 5FK9C 4ZAIA 4DK0A 3C46A 1DZ1A 2TSSA 1HUNA 2K14A 2JA6B 3S24A 3HOVG 1F77A 1TS4A 1YEZA 1TWCB 4A3BH 2BDNA 1T5XD 2FINB 2LKVA 4A93G 1DYQA 4OL7A 2N49A 4LF4Q 2VUMG 3M4QA 5M5WB 1LTLA 1NSNS 4QUCA 3FVQA 4CBVA 1G2SA 1R4PB 3D6WA 1SSOA 1KAAA 5IT9E 2CH4A 3C1FA 3JAMi 1NBWA 3NBHA 3HOWB 4R4CA 2F0IA 3ND9A 5FKAC 1VQ7A 4X65Q 5JPMC 1MBYA 3FMCA 2JXMB 5C5MA 1SDFA 5M5YH 3PIP3 3E5SA 1GUOA 4BY1G 1RTOA 2A6ED 4OEMB 2VS1A 3WWVA 2EQSA 3GTJH 3S1MH 1O78A 3H6MA 3I3CA 1S3OA 1Z7TA 4OONA 3BYTB 1E1OA 1OXSC 1XMQL 1U9RA 2NVTB 4ME3A 3F2BA 5I6WA 4RKLA 3AFPA 2VUMH 1VQFA 3BDOA 2B63H 4A93H 1C4QA 2A68C 1X9NA 2K5DA 3J81j 2RDGA 1E24A 2IWHA 4L63B 5BN4A 1W2BA 3BZDB 2XRQD 1VQ4A 1GUWA 2B2TA 5FLMG 2NN6I 2EYHA 1DD2A 1B3AA 2B2WC 1R9TB 2R7FA 2EIFA 4LF7L 4PZ8A 5ELBA 2WAQG 2FXQA 4YY3L 1A2TA 4QL5A 3PIPA 1G291 1NMGA 5AFWA 3MVVA 1YIJA 3X3MA 2E2HH 4IJHA 4XT1B 1KTKA 3T1YL 2JA7B 2KHSA 1RCVD 4AQYL 1I5FA 2O5IC 4YCWA 2H5XA 1HNXL 5FLXc 3CF5A 3J81i 2KA7A 3P75A 3D31A 5C4ZA 3J7YW 3CPFA 4GKKL 2NN6G 4RHRA 2J0TD 1HR0W 3LNNA 5DAUA 4ZQ3A 2QA4A 4DR1Q 4Q5VA 2A1AA 2RDHA 1ENAA 2KENA 2IW3A 3BDCA 1O7LA 2Z0SA 1Y1WG 1PYSB 2BDOA 5IODA 2F0MA 5EKIA 2RKSA 3J80L 1F2LA 3GTOH 4CJ2C 5JEAJ 1N9WA 2ZTEA 3A54A 1SROA 4C2MB 2R92H 1AH9A 2SOBA 1WTVA 2JA7G 4KN4C 1Y1VB 1I6HH 1H95A 4YCVA 4LUVA 5M3MB 2UXDQ 2A6HD 3VYRA 2DNEA 1KABA 3T1YQ 3Q23A 1UEAB 5E3FA 2K28A 2N88A 4K2KA 3OMGA 3ULJA 4HJAA 4X62Q 1VQ8A 3RMHA 1QVCA 3CHBD 3DM1A 3R2IA 2YTXA 3HOXG 2IX3A 2MPMA 1W6JA 4A3GH 1JB7A 3U9SA 1I4PA 1OXVA 1EL0A 4A4IA 4APVA 1K8OA 5EQ0A 1PHJA 3U4VA 4QCLA 1RHPA 3KYHC 2F03A 4JBJA 4H13C 3E3XA 5IT9c 3L0OA 2EOTA 1OO9B 2PNHA 2SNMA 2CFMA 1GOZA 5ELOA 5A2QL 1ESFA 2Q2HA 4PZ6A 3HOUH 1N32L 2F52A 4GNXC 1BR9A 2E8GA 3A0JA 1JC7A 3MWYW 3C1EA 1HQMC 4R8NA 3QG1A 2A8VA 3NWTA 4GOPA 1QVGA 2KHIA 4X3SA 1I50B 1PTOF 3T13A 3SXHA 2K05A 1JOOA 2ID0A 2X6LA 3SEBA 4K8IA 3HOVH 3J80i 1YJNA 1YNND 1TS5A 4A3IG 5CV4A 3IFTA 5EPLA 3W1BA 1A6XA 4C3HG 3MXUA 1L2FA 1PTOD 1HXYD 1P16A 3NTKA 3W5OA 3QOLA 1IZ6A 2JQOA 2O4XA 4WORA 1NE3A 5EPKA 4KTAA 1E2VA 1MIUA 3O13A 2K5QA 3MFGA 2JSOA 4BS9A 4F7XA 1TWHB 2MO1A 3GD7A 3SDZA 3L3OC 1M90C 3L7ZC 4N9TA 4YCUA 1W6KA 2I5MX 2R92B 4DKAC 1UE5A 5JJZA 4HSPA 2AMCB 5KRUA 1TT2A 1Y8NB 2RDFA 4X64L 3GTOB 1VQPA 2IX1A 1AP0A 4A3DG 4RFBA 1SFOB 4FYDA 4A3IB 1LT4D 4V190 2K01A 2VZAA 1PTOC 1QWYA 4TVAB 2B2YA 5AJ3Q 4HEDA 4QB4A
chains in the Genus database with same CATH topology
1XMQQ 1IBML 1PH5A 4IPGA 3ICEA 3PO2G 3ER0A 2YYZA 1X6OA 1W3SA 4B3TL 1HJPA 1I94Q 2JA8H 3H3VH 2RCNA 4IOCA 3STBD 2DGYA 1QZGA 1VQCA 4DV3Q 4LF8Q 1JJGA 4Y52H 1VQMA 5C0XG 3MXNB 1FJGL 4DR4Q 4DUYL 5LMNL 1KC8C 1Y1VH 3U50C 4EX5A 2HIVA 4DK6C 1WCMH 1VQIA 1WI5A 2PMZE 1HZ9A 1N34Q 4UY8C 4DAYB 3S1NH 1HNWQ 1C9OA 3M7NA 1HZCA 3RN5A 3A5ZB 3KF6A 1AE3A 2OQ0A 3NEMA 5H1SE 4YHHQ 3CCLA 4GKKQ 3J7A5 2D0PA 1V1QA 4DR7Q 3RNUA 2E2JH 2BH8A 3RLOA 1OXUA 4JI1L 1PH4A 1KXLA 4XTCS 4YWKA 1PVOA 5C4JH 3I4MG 4J15A 1TWAH 3ULLA 2MNAA 4GOPB 1BVSA 1SR3A 4DV4Q 3AEVA 3CD6A 4DNIA 4X62L 3L2PA 2UUBL 4A3DH 4DR4L 4A3LH 2OTJA 2K75A 3GO5A 3RLFA 5C3EH 3ERSX 4FDBA 5C0XI 1Q82C 1FJGQ 2JEAI 2B3GA 4HIOA 1HR0Q 1VQHA 1X55A 1S40A 4LUOA 4JI7Q 3GTQH 5IP9G 4IPCA 1XPUA 2BA1A 4UP8A 1UEBA 1PH3A 2LSSA 1JJCB 2IT1A 1PH8A 4BA2I 2Y0SE 4HJ9A 1L0WA 1YVCA 3G48A 4DR3L 3OTOL 1G6PA 1X3FA 3H0GG 3JC66 1C7YA 1TWFH 3A5UA 1A8VA 1Q86C 4HIMA 5JEAG 2IX0A 1SMXA 3GTKH 4DR5L 1D8LA 1WJJA 2CWPA 2IHFA 3K8AA 1CKMA 2NVYH 3HOUG 4LFAL 3HFZB 1XNQQ 3H0GH 4JI0Q 4BXXH 3CP0A 3NELA 2ZM6L 4JBKA 1GVPA 1PFSA 1YBYA 1OXTA 1UE6A 5IE8A 4JI3L 2Z6KC 5M5WH 3J81c 2A19A 4LF6L 5HY6A 3TS0A 5C44H 1KHIA 1NMFA 2Z6KA 5IP9H 2MFIA 3H3VI 4DAMA 4HJ5A 3UE1A 4DR1L 3PF5A 1IBKL 3S17H 4L5TA 1PH9A 4OO1G 1MJCA 1YJWA 4JCVE 4A3IH 1VQKA 3S16H 2UXBL 1K9MC 4JI4L 3K80C 4DR5Q 4BY7H 2VQFL 1MKHA 1K8GA 1XNQL 1GO3E 2E2IH 1K0RA 1TWHH 1NTGA 4IFDG 2Q2IA 3ZJYC 1IBLL 4A3GG 4BY7G 3KOJA 3I4MH 4JI5L 5JJIA 3UDGA 3PSIA 1HH2P 3U58A 1IL2A 4A3MH 1JMCA 1Z47A 5C44G 3I4NG 4POGA 2K52A 1J5EL 2PI2A 2AWOA 3CCEA 1VQLA 3GDEA 3E9IA 2UUAQ 1EWIA 1V43A 4GN4B 4JI8L 4JI7L 4BXXG 4GKJL 2IY5B 2UUBQ 1IBKQ 3CW2C 1J5EQ 5GROA 2ES2A 2OWOA 1M1KC 4AYBG 1XNRQ 5IY0A 4R1JA 4DR7L 3PUYA 3U4ZA 3RZDH 3HOZH 1K83H 1YHQA 3FP9A 2ZJPA 4K0KQ 4LNQA 1K3RA 3D0FA 4HJ7A 4IOAA 1LM0A 3CMAA 1YHBA 1TXYA 2HIXA 4OX9Q 2UXBQ 3MEFA 1YZ6A 4A75A 3E9HA 2AWNA 1VQBA 4DV6L 4A3JH 5JJLA 2D0OA 2AKWB 2NVXH 4NPSA 2UUCQ 1EIYB 5HGQA 3I7FA 1YI2A 5IYCH 1Z9FA 2GVBA 1J6QA 2JA9A 1PYBA 1HR0L 3GTPH 3KJOA 2HT1A 3HOYG 4BA1I 4LFBL 3HOXH 1VS0A 2N3SA 3BJUA 1Y1WH 3CC7A 5JJKA 2IHEA 3I4OA 2JA6G 3PO3G 1PH1A 4A3KH 4OXPA 2OQKA 5M3MG 4POFA 3I55A 4B3ML 3CXCA 1K73C 3F2CA 1EYGA 4JC0A 1ASZA 1WCMG 2LXJA 4R4TA 4P75A 3S1QH 4IFDI 4TQUS 3TQYA 1BBWA 1L1OC 4LFBQ 1PH6A 1VCIA 3AQQA 4DUZL 1HZBA 5AJ3L 1YNXA 5FJ8H 2XGTA 4DV2L 3OW2A 2EXDA 4NB3A 4DV1Q 4LF5Q 4OWWB 3FHWA 4DPGA 5GAEC 5GAHC 4OO1I 4JI3Q 4LF6Q 3S2HH 3PGZA 2R7DA 3UE0A 2JA8G 4DR6Q 1JE5A 1GKHA 2JJQA 3Q8DA 2ZM6Q 2JA7H 1D7QA 1V9PA 4H02A 1BKBA 2R92G 2YTVA 3PO2H 5C0XJ 1IYJB 1PH2A 1Q8KA 1VQJA 2HQLA 2I5LX 4K0KL 1HNZL 4PZ7A 4B3SQ 3B6YA 4C3HH 2QGQA 2GN5A 3BU2A 1NY4A 3KFUA 2JA5H 2VY3A 3W1GA 3CCUA 4JBMA 1G51A 4DR3Q 1N34L 3S1RH 2K14A 3CCSA 3M4OH 3KF6B 3S24A 1NJIC 5IP7G 3CC2A 3HOVG 3K7AH 3HOWG 1A0IA 5M5XH 1Q12A 4A3CH 5M3FG 4JI6L 2N78A 4MZ9A 1YEZA 4JI8Q 4P72A 4A3BH 4EQ5A 1P8LA 1N33L 4YY3Q 3AYHB 2YTYA 4JI6Q 4LF4Q 4R4IA 2N49A 4A93G 4WJ4A 4GN3B 4KLKA 1X3GA 3M4QA 2VUMG 1LTLA 1E7ZA 4JI5Q 4GNXA 4JI1Q 2VNUD 2Y0SG 4QGUA 4A3FG 4L5SA 3T1HL 2RHSB 4P74A 3A74A 3JAMi 1NBWA 3LGJA 2PQAB 5IYBH 3PV0A 1UE1A 4R4CA 3NENA 5GAGC 2R7ZH 3GTMH 1T9HA 3TRZA 4DR6L 1HNWL 3DM3A 5IYDH 1Q1EA 1VQ7A 4X65Q 1KQSA 2NVTH 4X64Q 3CCMA 4LW1A 4A3EH 4JI0L 3H15A 3HKSA 4MNOA 5M5YH 5J3BA 2ZTDA 3M4PA 4BY1G 3M9BA 2V1CC 3G71A 4PG3A 2VS1A 3WWVA 2EQSA 5IYDG 3GTJH 3S1MH 1ASYA 1CSPA 1I94L 4B3TQ 2R6GA 1S3OA 4OONA 4P71A 2PQAA 2D62A 1EQQA 1E1OA 1OXSC 2ALYB 4YWLA 1XMQL 4ME3A 1E22A 1I50H 3I2ZA 3F2BA 2CWAA 4A3FH 4ALPA 3PUVA 1TWGH 1K8AC 2WB1E 2R93G 4X65L 1KD1C 3AFPA 4AYBE 1VQFA 2VUMH 1L1OA 5BR8Q 2B63H 1XPOA 4A93H 2VQEL 3E0EA 4Y7NH 1X9NA 2XTIA 4OWTB 2UUCL 4DV1L 3IRBA 2KCTA 3J81j 3K0XA 4HIKA 4KHPQ 1E24A 4BBSH 4NXNQ 2JK8A 4LWCA 2CQOA 3T1HQ 4DR2Q 1W2BA 4B3RL 4X6AH 1VQ4A 3HOWH 4BBRG 1CUKA 3J7ZC 5FLMG 2NN6I 3K81C 1LYLA 2YU9H 4JYAQ 3RR5A 2JEBI 4B3MQ 4O0AA 1Y14B 2NZHA 2R7FA 2EIFA 1XMOL 4LF7L 4PZ8A 3BZCA 2VW9A 2UXCQ 2WAQG 2FXQA 4YY3L 1N36Q 1EIFA 4QL5A 3PIPA 4AQYQ 4KI0A 1G291 1NMGA 5DLQE 3AFQA 5LMNW 1YIJA 1N33Q 2E2HH 3G4SA 4DV0Q 1PA6A 4AIMA 1AE2A 4IJHA 4LF5L 3BZKA 3T1YL 2ATWA 3OYYA 3CC4A 4AQYL 4KHZA 3RN2A 2WP8J 4UP7A 1I5FA 3PUXA 5K36G 4YCWA 5C4XG 2H5XA 1HNXL 2RF4A 5GQOA 1CKOA 5FLXc 4LF7Q 4QIWE 1VQDA 3J81i 3CF5A 4LF9L 1WFQA 4YWMA 1A62A 2KHJA 5FJ8G 3CCRA 3D31A 2HHHL 1XPRA 3CPFA 4GKKL 4GLXA 2NN6G 3F8TA 4UP9A 1HR0W 4B3SL 3PUWA 4GS3A 3UDIA 4P73A 1HNZQ 2UU9Q 1MJEA 2KCMA 4DV7L 4IJLA 4DR1Q 2QA4A 4GLVB 2E5LQ 2A1AA 1N8RC 5M3FH 5C4XH 1XNRL 2CKZB 2KENA 2F4VQ 4A3KG 2VQEQ 2Z0SA 4QQBX 1OTCA 2JA6H 3KJPA 1Y1WG 1PYSB 4JI2Q 2LXKA 4JOIA 4DK3C 1PH7A 1L1OB 1FL0A 1RIPA 1U5KA 4C2MH 1GD7A 1I3QH 4O2DA 2OTLA 4L5RC 2F4VL 1TWCH 4OX9L 2MQHA 2ZTCA 3PCOB 3GTOH 2UU9L 4L5QA 4OWXB 2HHHQ 5JEAJ 3KLWA 4GLAC 1N9WA 2QEXA 1KRTA 2ZTEA 3S14H 4RG1A 1CSQA 1SROA 2R92H 3NBHB 1UE7A 2MO0A 1KAWA 3PIOA 1AH9A 3EN2A 4R4OA 4LF4L 2JA7G 1I6HH 1EFWA 1H95A 4YCVA 2Q2UA 4LUVA 2UXDQ 4GN5A 4DV0L 1JJ2A 1SLJA 1VQ9A 4BBSG 3T1YQ 4XIGS 2UXDL 2B63G 2AHOB 3GTGH 4RMFA 4PMWA 3ULPA 2KBNA 3ULJA 4C3IH 3KDFA 4X62Q 4HJAA 1QUQB 1VQ8A 2F3IA 4GOPC 2I5HA 2BH2A 3RZOH 1DGSA 3DLLA 5M3MH 1QVCA 1KIXA 1JT8A 1VQAA 3PO3H 4JV5Q 3I4NH 2YTXA 3HOXG 2VQFQ 2NVQH 3HOYH 4A3MG 3OTOQ 1Q46A 1X3EA 2K50A 2K5VA 4DR2L 3M85A 1X65A 5IYCG 1SN8A 2B29A 1JB7A 3F2DA 4JI2L 1OXVA 3PF4A 4A3GH 4BY1H 1HZAA 1X56A 1B7YB 4QJFA 3CPWA 2UUAL 4A4IA 4NXML 1Q1BA 4GKJQ 3HKZE 2WB1G 1PV4A 4APVA 2E5LL 4X66Q 2Q2TA 1PHJA 3U4VA 5FLMH 1KRSA 1LUZA 3CQZH 3KYHC 4BBRH 1YITA 3S15H 1UWVA 1FVIA 1E1TA 2BA0A 4JBJA 3TREA 3M3YH 1N32Q 3EBEA 5IT9c 4UPAA 2R7ZG 3HOZG 3L0OA 5IYBG 1VQNA 1IBMQ 2L15A 5E7NA 4LF9Q 2WFWA 4JYAL 4JBWA 4IPDA 3VDYA 2PNHA 5ELOA 2CFMA 1N32L 2Q2HA 4PZ6A 1Q7YC 3F1ZA 2K5HA 1IBLQ 1WOCA 2F52A 3SGIA 4JI4Q 3HOUH 1VQGA 4B3RQ 4GNXC 2E8GA 3A0JA 2VL6A 4LUZA 4NXNL 4X66L 2R93H 2ZJQA 3GTLH 1CKNB 1EUJA 2A8VA 3CMEA 4GOPA 1QVGA 2KHIA 4DUYQ 4DV6Q 3STBC 4DV7Q 4AH6A 1KL9A 2JE6I 1BBUA 1OXXK 3UDFA 4C3JH 1SFOH 4GNXB 2ID0A 3I56A 1RL2A 2GVAA 3PUZA 3KDFB 4LFAQ 4JOIC 3J80i 5IP7H 1YJNA 1EOVA 1SRUA 2ASBA 3HOVH 3S2DH 4A3LG 1CKNA 1XJVA 4A3EG 1B8AA 4QY7A 4A3IG 5GADC 1HNXQ 2JA5G 1QVFA 2CCZA 3W1BA 4KHPL 5LMUQ 1L2FA 4JG2A 4DV5L 1P16A 1VQ6A 3KF8B 5LMNQ 3W5OA 1IZ6A 1U0LA 2JQOA 1VQEA 2I0QA 1NE3A 4A76A 5IWAQ 2C35B 1R9TH 3CAMA 4DV4L 4IPHA 1VQOA 1QZHA 1Q81C 1VQ5A 4NXMQ 1O7IA 2PI2E 2K4KA 1A63A 1MIUA 5LMUL 4HIDA 1Y1VG 3CCVA 1N36L 4DV5Q 2NZOA 1SE8A 5ELNA 1FGUA 4R4QA 3CCJA 1XMOQ 2UXCL 1C0AA 2MO1A 3TS2A 1X54A 3GD7A 1YJ9A 2YV5A 2ZJRA 3TEHB 3JAMc 4JV5L 1M90C 3L7ZC 4YCUA 1XTDA 2I5MX 1WYDA 2RHQB 4YHHL 2OCEA 4DKAC 1UE5A 4LFCL 4A3BG 2AMCB 4A3CG 5EAYA 4X64L 5BR8L 1EQRA 5C3EG 1VQPA 2IX1A 3CCQA 2K5NA 3FKIG 4A3DG 1GM5A 3EIVA 5IWAL 1E3PA 4DV2Q 2WAQE 1B70B 3RLNA 4IFDJ 1QUQA 3HKZG 2VZAA 4MTNA 4HJ8A 3G6EA 2N8NA 1S72A 4LFCQ 1IXRA 3K7UC 4TVAB 1YHAA 4DV3L 4LF8L 4WJ3M 5AJ3Q 4IO9A 4DUZQ 3UDXA 2DUDA 3FKIH 4A3JG 3J80c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ Q;  1IBM L;  1PH5 A;  4IPG A;  3ICE A;  3PO2 G;  3ER0 A;  2YYZ A;  1X6O A;  1W3S A;  4B3T L;  1HJP A;  1I94 Q;  2JA8 H;  3H3V H;  2RCN A;  4IOC A;  3STB D;  2DGY A;  1QZG A;  1VQC A;  4DV3 Q;  4LF8 Q;  1JJG A;  4Y52 H;  1VQM A;  5C0X G;  3MXN B;  1FJG L;  4DR4 Q;  4DUY L;  5LMN L;  1KC8 C;  1Y1V H;  3U50 C;  4EX5 A;  2HIV A;  4DK6 C;  1WCM H;  1VQI A;  1WI5 A;  2PMZ E;  1HZ9 A;  1N34 Q;  4UY8 C;  4DAY B;  3S1N H;  1HNW Q;  1C9O A;  3M7N A;  1HZC A;  3RN5 A;  3A5Z B;  3KF6 A;  1AE3 A;  2OQ0 A;  3NEM A;  5H1S E;  4YHH Q;  3CCL A;  4GKK Q;  3J7A 5;  2D0P A;  1V1Q A;  4DR7 Q;  3RNU A;  2E2J H;  2BH8 A;  3RLO A;  1OXU A;  4JI1 L;  1PH4 A;  1KXL A;  4XTC S;  4YWK A;  1PVO A;  5C4J H;  3I4M G;  4J15 A;  1TWA H;  3ULL A;  2MNA A;  4GOP B;  1BVS A;  1SR3 A;  4DV4 Q;  3AEV A;  3CD6 A;  4DNI A;  4X62 L;  3L2P A;  2UUB L;  4A3D H;  4DR4 L;  4A3L H;  2OTJ A;  2K75 A;  3GO5 A;  3RLF A;  5C3E H;  3ERS X;  4FDB A;  5C0X I;  1Q82 C;  1FJG Q;  2JEA I;  2B3G A;  4HIO A;  1HR0 Q;  1VQH A;  1X55 A;  1S40 A;  4LUO A;  4JI7 Q;  3GTQ H;  5IP9 G;  4IPC A;  1XPU A;  2BA1 A;  4UP8 A;  1UEB A;  1PH3 A;  2LSS A;  1JJC B;  2IT1 A;  1PH8 A;  4BA2 I;  2Y0S E;  4HJ9 A;  1L0W A;  1YVC A;  3G48 A;  4DR3 L;  3OTO L;  1G6P A;  1X3F A;  3H0G G;  3JC6 6;  1C7Y A;  1TWF H;  3A5U A;  1A8V A;  1Q86 C;  4HIM A;  5JEA G;  2IX0 A;  1SMX A;  3GTK H;  4DR5 L;  1D8L A;  1WJJ A;  2CWP A;  2IHF A;  3K8A A;  1CKM A;  2NVY H;  3HOU G;  4LFA L;  3HFZ B;  1XNQ Q;  3H0G H;  4JI0 Q;  4BXX H;  3CP0 A;  3NEL A;  2ZM6 L;  4JBK A;  1GVP A;  1PFS A;  1YBY A;  1OXT A;  1UE6 A;  5IE8 A;  4JI3 L;  2Z6K C;  5M5W H;  3J81 c;  2A19 A;  4LF6 L;  5HY6 A;  3TS0 A;  5C44 H;  1KHI A;  1NMF A;  2Z6K A;  5IP9 H;  2MFI A;  3H3V I;  4DAM A;  4HJ5 A;  3UE1 A;  4DR1 L;  3PF5 A;  1IBK L;  3S17 H;  4L5T A;  1PH9 A;  4OO1 G;  1MJC A;  1YJW A;  4JCV E;  4A3I H;  1VQK A;  3S16 H;  2UXB L;  1K9M C;  4JI4 L;  3K80 C;  4DR5 Q;  4BY7 H;  2VQF L;  1MKH A;  1K8G A;  1XNQ L;  1GO3 E;  2E2I H;  1K0R A;  1TWH H;  1NTG A;  4IFD G;  2Q2I A;  3ZJY C;  1IBL L;  4A3G G;  4BY7 G;  3KOJ A;  3I4M H;  4JI5 L;  5JJI A;  3UDG A;  3PSI A;  1HH2 P;  3U58 A;  1IL2 A;  4A3M H;  1JMC A;  1Z47 A;  5C44 G;  3I4N G;  4POG A;  2K52 A;  1J5E L;  2PI2 A;  2AWO A;  3CCE A;  1VQL A;  3GDE A;  3E9I A;  2UUA Q;  1EWI A;  1V43 A;  4GN4 B;  4JI8 L;  4JI7 L;  4BXX G;  4GKJ L;  2IY5 B;  2UUB Q;  1IBK Q;  3CW2 C;  1J5E Q;  5GRO A;  2ES2 A;  2OWO A;  1M1K C;  4AYB G;  1XNR Q;  5IY0 A;  4R1J A;  4DR7 L;  3PUY A;  3U4Z A;  3RZD H;  3HOZ H;  1K83 H;  1YHQ A;  3FP9 A;  2ZJP A;  4K0K Q;  4LNQ A;  1K3R A;  3D0F A;  4HJ7 A;  4IOA A;  1LM0 A;  3CMA A;  1YHB A;  1TXY A;  2HIX A;  4OX9 Q;  2UXB Q;  3MEF A;  1YZ6 A;  4A75 A;  3E9H A;  2AWN A;  1VQB A;  4DV6 L;  4A3J H;  5JJL A;  2D0O A;  2AKW B;  2NVX H;  4NPS A;  2UUC Q;  1EIY B;  5HGQ A;  3I7F A;  1YI2 A;  5IYC H;  1Z9F A;  2GVB A;  1J6Q A;  2JA9 A;  1PYB A;  1HR0 L;  3GTP H;  3KJO A;  2HT1 A;  3HOY G;  4BA1 I;  4LFB L;  3HOX H;  1VS0 A;  2N3S A;  3BJU A;  1Y1W H;  3CC7 A;  5JJK A;  2IHE A;  3I4O A;  2JA6 G;  3PO3 G;  1PH1 A;  4A3K H;  4OXP A;  2OQK A;  5M3M G;  4POF A;  3I55 A;  4B3M L;  3CXC A;  1K73 C;  3F2C A;  1EYG A;  4JC0 A;  1ASZ A;  1WCM G;  2LXJ A;  4R4T A;  4P75 A;  3S1Q H;  4IFD I;  4TQU S;  3TQY A;  1BBW A;  1L1O C;  4LFB Q;  1PH6 A;  1VCI A;  3AQQ A;  4DUZ L;  1HZB A;  5AJ3 L;  1YNX A;  5FJ8 H;  2XGT A;  4DV2 L;  3OW2 A;  2EXD A;  4NB3 A;  4DV1 Q;  4LF5 Q;  4OWW B;  3FHW A;  4DPG A;  5GAE C;  5GAH C;  4OO1 I;  4JI3 Q;  4LF6 Q;  3S2H H;  3PGZ A;  2R7D A;  3UE0 A;  2JA8 G;  4DR6 Q;  1JE5 A;  1GKH A;  2JJQ A;  3Q8D A;  2ZM6 Q;  2JA7 H;  1D7Q A;  1V9P A;  4H02 A;  1BKB A;  2R92 G;  2YTV A;  3PO2 H;  5C0X J;  1IYJ B;  1PH2 A;  1Q8K A;  1VQJ A;  2HQL A;  2I5L X;  4K0K L;  1HNZ L;  4PZ7 A;  4B3S Q;  3B6Y A;  4C3H H;  2QGQ A;  2GN5 A;  3BU2 A;  1NY4 A;  3KFU A;  2JA5 H;  2VY3 A;  3W1G A;  3CCU A;  4JBM A;  1G51 A;  4DR3 Q;  1N34 L;  3S1R H;  2K14 A;  3CCS A;  3M4O H;  3KF6 B;  3S24 A;  1NJI C;  5IP7 G;  3CC2 A;  3HOV G;  3K7A H;  3HOW G;  1A0I A;  5M5X H;  1Q12 A;  4A3C H;  5M3F G;  4JI6 L;  2N78 A;  4MZ9 A;  1YEZ A;  4JI8 Q;  4P72 A;  4A3B H;  4EQ5 A;  1P8L A;  1N33 L;  4YY3 Q;  3AYH B;  2YTY A;  4JI6 Q;  4LF4 Q;  4R4I A;  2N49 A;  4A93 G;  4WJ4 A;  4GN3 B;  4KLK A;  1X3G A;  3M4Q A;  2VUM G;  1LTL A;  1E7Z A;  4JI5 Q;  4GNX A;  4JI1 Q;  2VNU D;  2Y0S G;  4QGU A;  4A3F G;  4L5S A;  3T1H L;  2RHS B;  4P74 A;  3A74 A;  3JAM i;  1NBW A;  3LGJ A;  2PQA B;  5IYB H;  3PV0 A;  1UE1 A;  4R4C A;  3NEN A;  5GAG C;  2R7Z H;  3GTM H;  1T9H A;  3TRZ A;  4DR6 L;  1HNW L;  3DM3 A;  5IYD H;  1Q1E A;  1VQ7 A;  4X65 Q;  1KQS A;  2NVT H;  4X64 Q;  3CCM A;  4LW1 A;  4A3E H;  4JI0 L;  3H15 A;  3HKS A;  4MNO A;  5M5Y H;  5J3B A;  2ZTD A;  3M4P A;  4BY1 G;  3M9B A;  2V1C C;  3G71 A;  4PG3 A;  2VS1 A;  3WWV A;  2EQS A;  5IYD G;  3GTJ H;  3S1M H;  1ASY A;  1CSP A;  1I94 L;  4B3T Q;  2R6G A;  1S3O A;  4OON A;  4P71 A;  2PQA A;  2D62 A;  1EQQ A;  1E1O A;  1OXS C;  2ALY B;  4YWL A;  1XMQ L;  4ME3 A;  1E22 A;  1I50 H;  3I2Z A;  3F2B A;  2CWA A;  4A3F H;  4ALP A;  3PUV A;  1TWG H;  1K8A C;  2WB1 E;  2R93 G;  4X65 L;  1KD1 C;  3AFP A;  4AYB E;  1VQF A;  2VUM H;  1L1O A;  5BR8 Q;  2B63 H;  1XPO A;  4A93 H;  2VQE L;  3E0E A;  4Y7N H;  1X9N A;  2XTI A;  4OWT B;  2UUC L;  4DV1 L;  3IRB A;  2KCT A;  3J81 j;  3K0X A;  4HIK A;  4KHP Q;  1E24 A;  4BBS H;  4NXN Q;  2JK8 A;  4LWC A;  2CQO A;  3T1H Q;  4DR2 Q;  1W2B A;  4B3R L;  4X6A H;  1VQ4 A;  3HOW H;  4BBR G;  1CUK A;  3J7Z C;  5FLM G;  2NN6 I;  3K81 C;  1LYL A;  2YU9 H;  4JYA Q;  3RR5 A;  2JEB I;  4B3M Q;  4O0A A;  1Y14 B;  2NZH A;  2R7F A;  2EIF A;  1XMO L;  4LF7 L;  4PZ8 A;  3BZC A;  2VW9 A;  2UXC Q;  2WAQ G;  2FXQ A;  4YY3 L;  1N36 Q;  1EIF A;  4QL5 A;  3PIP A;  4AQY Q;  4KI0 A;  1G29 1;  1NMG A;  5DLQ E;  3AFQ A;  5LMN W;  1YIJ A;  1N33 Q;  2E2H H;  3G4S A;  4DV0 Q;  1PA6 A;  4AIM A;  1AE2 A;  4IJH A;  4LF5 L;  3BZK A;  3T1Y L;  2ATW A;  3OYY A;  3CC4 A;  4AQY L;  4KHZ A;  3RN2 A;  2WP8 J;  4UP7 A;  1I5F A;  3PUX A;  5K36 G;  4YCW A;  5C4X G;  2H5X A;  1HNX L;  2RF4 A;  5GQO A;  1CKO A;  5FLX c;  4LF7 Q;  4QIW E;  1VQD A;  3J81 i;  3CF5 A;  4LF9 L;  1WFQ A;  4YWM A;  1A62 A;  2KHJ A;  5FJ8 G;  3CCR A;  3D31 A;  2HHH L;  1XPR A;  3CPF A;  4GKK L;  4GLX A;  2NN6 G;  3F8T A;  4UP9 A;  1HR0 W;  4B3S L;  3PUW A;  4GS3 A;  3UDI A;  4P73 A;  1HNZ Q;  2UU9 Q;  1MJE A;  2KCM A;  4DV7 L;  4IJL A;  4DR1 Q;  2QA4 A;  4GLV B;  2E5L Q;  2A1A A;  1N8R C;  5M3F H;  5C4X H;  1XNR L;  2CKZ B;  2KEN A;  2F4V Q;  4A3K G;  2VQE Q;  2Z0S A;  4QQB X;  1OTC A;  2JA6 H;  3KJP A;  1Y1W G;  1PYS B;  4JI2 Q;  2LXK A;  4JOI A;  4DK3 C;  1PH7 A;  1L1O B;  1FL0 A;  1RIP A;  1U5K A;  4C2M H;  1GD7 A;  1I3Q H;  4O2D A;  2OTL A;  4L5R C;  2F4V L;  1TWC H;  4OX9 L;  2MQH A;  2ZTC A;  3PCO B;  3GTO H;  2UU9 L;  4L5Q A;  4OWX B;  2HHH Q;  5JEA J;  3KLW A;  4GLA C;  1N9W A;  2QEX A;  1KRT A;  2ZTE A;  3S14 H;  4RG1 A;  1CSQ A;  1SRO A;  2R92 H;  3NBH B;  1UE7 A;  2MO0 A;  1KAW A;  3PIO A;  1AH9 A;  3EN2 A;  4R4O A;  4LF4 L;  2JA7 G;  1I6H H;  1EFW A;  1H95 A;  4YCV A;  2Q2U A;  4LUV A;  2UXD Q;  4GN5 A;  4DV0 L;  1JJ2 A;  1SLJ A;  1VQ9 A;  4BBS G;  3T1Y Q;  4XIG S;  2UXD L;  2B63 G;  2AHO B;  3GTG H;  4RMF A;  4PMW A;  3ULP A;  2KBN A;  3ULJ A;  4C3I H;  3KDF A;  4X62 Q;  4HJA A;  1QUQ B;  1VQ8 A;  2F3I A;  4GOP C;  2I5H A;  2BH2 A;  3RZO H;  1DGS A;  3DLL A;  5M3M H;  1QVC A;  1KIX A;  1JT8 A;  1VQA A;  3PO3 H;  4JV5 Q;  3I4N H;  2YTX A;  3HOX G;  2VQF Q;  2NVQ H;  3HOY H;  4A3M G;  3OTO Q;  1Q46 A;  1X3E A;  2K50 A;  2K5V A;  4DR2 L;  3M85 A;  1X65 A;  5IYC G;  1SN8 A;  2B29 A;  1JB7 A;  3F2D A;  4JI2 L;  1OXV A;  3PF4 A;  4A3G H;  4BY1 H;  1HZA A;  1X56 A;  1B7Y B;  4QJF A;  3CPW A;  2UUA L;  4A4I A;  4NXM L;  1Q1B A;  4GKJ Q;  3HKZ E;  2WB1 G;  1PV4 A;  4APV A;  2E5L L;  4X66 Q;  2Q2T A;  1PHJ A;  3U4V A;  5FLM H;  1KRS A;  1LUZ A;  3CQZ H;  3KYH C;  4BBR H;  1YIT A;  3S15 H;  1UWV A;  1FVI A;  1E1T A;  2BA0 A;  4JBJ A;  3TRE A;  3M3Y H;  1N32 Q;  3EBE A;  5IT9 c;  4UPA A;  2R7Z G;  3HOZ G;  3L0O A;  5IYB G;  1VQN A;  1IBM Q;  2L15 A;  5E7N A;  4LF9 Q;  2WFW A;  4JYA L;  4JBW A;  4IPD A;  3VDY A;  2PNH A;  5ELO A;  2CFM A;  1N32 L;  2Q2H A;  4PZ6 A;  1Q7Y C;  3F1Z A;  2K5H A;  1IBL Q;  1WOC A;  2F52 A;  3SGI A;  4JI4 Q;  3HOU H;  1VQG A;  4B3R Q;  4GNX C;  2E8G A;  3A0J A;  2VL6 A;  4LUZ A;  4NXN L;  4X66 L;  2R93 H;  2ZJQ A;  3GTL H;  1CKN B;  1EUJ A;  2A8V A;  3CME A;  4GOP A;  1QVG A;  2KHI A;  4DUY Q;  4DV6 Q;  3STB C;  4DV7 Q;  4AH6 A;  1KL9 A;  2JE6 I;  1BBU A;  1OXX K;  3UDF A;  4C3J H;  1SFO H;  4GNX B;  2ID0 A;  3I56 A;  1RL2 A;  2GVA A;  3PUZ A;  3KDF B;  4LFA Q;  4JOI C;  3J80 i;  5IP7 H;  1YJN A;  1EOV A;  1SRU A;  2ASB A;  3HOV H;  3S2D H;  4A3L G;  1CKN A;  1XJV A;  4A3E G;  1B8A A;  4QY7 A;  4A3I G;  5GAD C;  1HNX Q;  2JA5 G;  1QVF A;  2CCZ A;  3W1B A;  4KHP L;  5LMU Q;  1L2F A;  4JG2 A;  4DV5 L;  1P16 A;  1VQ6 A;  3KF8 B;  5LMN Q;  3W5O A;  1IZ6 A;  1U0L A;  2JQO A;  1VQE A;  2I0Q A;  1NE3 A;  4A76 A;  5IWA Q;  2C35 B;  1R9T H;  3CAM A;  4DV4 L;  4IPH A;  1VQO A;  1QZH A;  1Q81 C;  1VQ5 A;  4NXM Q;  1O7I A;  2PI2 E;  2K4K A;  1A63 A;  1MIU A;  5LMU L;  4HID A;  1Y1V G;  3CCV A;  1N36 L;  4DV5 Q;  2NZO A;  1SE8 A;  5ELN A;  1FGU A;  4R4Q A;  3CCJ A;  1XMO Q;  2UXC L;  1C0A A;  2MO1 A;  3TS2 A;  1X54 A;  3GD7 A;  1YJ9 A;  2YV5 A;  2ZJR A;  3TEH B;  3JAM c;  4JV5 L;  1M90 C;  3L7Z C;  4YCU A;  1XTD A;  2I5M X;  1WYD A;  2RHQ B;  4YHH L;  2OCE A;  4DKA C;  1UE5 A;  4LFC L;  4A3B G;  2AMC B;  4A3C G;  5EAY A;  4X64 L;  5BR8 L;  1EQR A;  5C3E G;  1VQP A;  2IX1 A;  3CCQ A;  2K5N A;  3FKI G;  4A3D G;  1GM5 A;  3EIV A;  5IWA L;  1E3P A;  4DV2 Q;  2WAQ E;  1B70 B;  3RLN A;  4IFD J;  1QUQ A;  3HKZ G;  2VZA A;  4MTN A;  4HJ8 A;  3G6E A;  2N8N A;  1S72 A;  4LFC Q;  1IXR A;  3K7U C;  4TVA B;  1YHA A;  4DV3 L;  4LF8 L;  4WJ3 M;  5AJ3 Q;  4IO9 A;  4DUZ Q;  3UDX A;  2DUD A;  3FKI H;  4A3J G;  3J80 c; 
#chains in the Genus database with same CATH topology
 3Q6S A;  1IBM L;  1SAP A;  2YYZ A;  1X6O A;  2CH4 W;  4KD4 A;  1VQC A;  1PFM A;  5C0X G;  4M1U B;  3PIO 3;  1CI3 M;  4DR4 Q;  4B9X A;  5LMN L;  4HSV A;  4EX5 A;  1CM9 A;  2HIV A;  4XQN A;  2IPK D;  3S17 B;  1VQI A;  1D5M C;  1O80 A;  2DY7 A;  1Y8P B;  5I9O A;  1X3P A;  3KF6 A;  2QF7 A;  4NW2 A;  4GKK Q;  2F0O A;  2D0P A;  2KVM A;  3P20 A;  4DR7 Q;  3RNU A;  2E2J H;  2ICI A;  2BH8 A;  2EYP A;  1KXL A;  1OXU A;  5KIX A;  3OPO A;  1PRT B;  2XRS D;  1PVO A;  1MHW C;  2MNA A;  3GTJ B;  4DV4 Q;  3CD6 A;  4X62 L;  4A3D H;  4A3L H;  4HMJ A;  1SYB A;  2OTJ A;  1BCP D;  3RLF A;  1FJG Q;  2K03 A;  1IYV A;  2B3G A;  2B8G A;  4V0B A;  3OW7 A;  5E4X A;  3HOU B;  2EDG A;  1TS3 A;  3NXW A;  1PRT C;  3I72 A;  4UP8 A;  3HGB A;  1PH8 A;  1BBX C;  4PMC A;  1L0W A;  4M8A A;  1TWF H;  1Q86 C;  1A8V A;  3K5O A;  3GTK H;  1TU2 B;  4WFN 3;  3CP0 A;  3U9O A;  1YBY A;  5M5W H;  1UE6 A;  4IUR A;  4JI3 L;  5IE8 A;  1KDC A;  2HUG A;  5HY6 A;  3TS0 A;  5DM7 3;  1KHI A;  5IP9 H;  1STH A;  2F4I A;  4HJ5 A;  1CQV A;  4JCV E;  3S16 H;  4J1M A;  1K8G A;  3GTL B;  1NTG A;  3D3R A;  3ZJY C;  4A3F B;  4RAU C;  3P7J A;  3I4M H;  4ZYS A;  3PSI A;  3KLR A;  2F0K A;  3KBG A;  1Z47 A;  3I4N G;  4CDF C;  2F0H A;  1TII D;  4X3U A;  1JWS D;  4JI7 L;  1EWI A;  1EWH A;  4GN4 B;  4KJN A;  4JI8 L;  1IL8 A;  2UUB Q;  1IBK Q;  1S4Z A;  3DHQ A;  2WAC A;  1J5E Q;  4QIW B;  3RD4 A;  3M7G A;  1D5X C;  3PUY A;  2EJM A;  3RZD H;  4A3J B;  3BVG A;  5FLX L;  1KDA A;  2ZJP A;  3HG9 A;  2K7V A;  4HCE A;  3I4N B;  1EU4 A;  2UXB Q;  4A75 A;  3HOZ B;  4QMG A;  1LTT D;  2NVX H;  4JVZ A;  2RSN A;  3I7F A;  1YI2 A;  1B50 A;  1Z9F A;  1ZKO A;  1IKL A;  2F0L A;  3HOX H;  3BJU A;  1ESR A;  2N3S A;  2IHE A;  1LT3 D;  3ERQ A;  2E75 C;  4POF A;  3DMU A;  3F2C A;  3MA2 B;  5EJW A;  1CTM A;  4K8J A;  1ASZ A;  1WCM G;  4P75 A;  1IKM A;  3CKI B;  1L1O C;  2C5C A;  3IFD A;  4HCS A;  4LF5 Q;  2CHB D;  4DPG A;  1EIG A;  5DM6 3;  4OO1 I;  4LF6 Q;  3UE0 A;  5K36 H;  1IHZ A;  1JE5 A;  2JA7 H;  2ZM6 Q;  1V9P A;  2YTV A;  4GZY C;  3TZD A;  1PH2 A;  2B2U A;  4BY1 B;  4Z9C B;  1EY6 A;  2HQL A;  3Q0A A;  1EFI D;  1LTG D;  1NY4 A;  1G51 A;  3KF6 B;  3CC2 A;  1ICF B;  3K7A H;  2F0F A;  2ZXR A;  1Q12 A;  5C4X B;  2SDF A;  3K5L A;  2N78 A;  4JI8 Q;  4P72 A;  1N33 L;  4YY3 Q;  4JI6 Q;  2NN6 H;  1FNW A;  2VUM B;  2ZT9 C;  1X3G A;  1JWU D;  1K0S A;  1E7Z A;  2ENB A;  4JI5 Q;  4J8Q A;  3MHB A;  4QGU A;  1QNK A;  3T1H L;  3J81 E;  2RHS B;  2EJF C;  3V05 A;  2EY6 A;  4P74 A;  1V1O A;  4ZUI A;  3PV0 A;  4N9P A;  3HOV B;  5GAG C;  1ZXT A;  1T9H A;  3N52 A;  1II3 A;  2KQ3 A;  2V4D A;  1LAB A;  1KQS A;  4JI0 L;  3GTK B;  3H15 A;  1JIC A;  3M4P A;  5EKL A;  2V1C C;  2EY5 A;  3BG3 A;  1B3Q A;  1EQT A;  1UAP A;  4B9W A;  4C3J G;  1I94 L;  3H0G B;  4G4K A;  5HGT A;  3S1Q B;  2ALY B;  4YWL A;  2HDL A;  2A68 D;  3TSS A;  4A3F H;  3PUV A;  2WB1 E;  4RWS C;  2LMC B;  3LWE A;  1ZEQ X;  3VYT A;  1KD1 C;  1DCZ A;  1F9S A;  4C3I B;  3QWN A;  2I46 A;  2Z8L A;  5CC4 A;  1FNV A;  1Z6H A;  1RTN A;  2XTI A;  4K2L A;  2KEC A;  3IRB A;  5ELE A;  4KHP Q;  1B1Z A;  3T1H Q;  2M00 A;  4TRD A;  2KEE A;  1SE2 A;  1Y14 B;  3J7A F;  2NZH A;  4CKE A;  2OT2 A;  1N36 Q;  1EIF A;  4KI0 A;  2L1B A;  1HTP A;  3AFQ A;  5COY A;  1V1P B;  1RD9 D;  2PNR C;  1HA5 A;  4DV0 Q;  1JQY D;  2RCF A;  4AIM A;  4F87 A;  1PA6 A;  1I4X A;  4RGM A;  1HPC A;  2YU9 B;  2WP8 J;  4UP7 A;  2L9H A;  3BVZ A;  2RF4 A;  1VF5 C;  3PQI A;  4LF7 Q;  4QIW E;  4LF9 L;  1WFQ A;  1CZW A;  2KHJ A;  2DN8 A;  2HHH L;  1EY0 A;  2QEJ C;  4B3S L;  1SYD A;  4P73 A;  5I2Y A;  2KCM A;  3D4R A;  2AQ2 B;  5IGB A;  3IKJ A;  4GLV B;  4A3K B;  4OIJ A;  2F4V Q;  2CKZ B;  1RDP D;  3KJP A;  2IJ0 A;  2JA8 B;  2PZT A;  5DEH A;  1L1O B;  1FL0 A;  1H9M A;  1PH7 A;  2OTL A;  4O2D A;  4OX9 L;  2MQH A;  2ZTC A;  3I70 A;  3I90 A;  2B2V C;  4L5Q A;  3ZYY X;  4GLA C;  2F0W A;  3S14 H;  3T51 B;  4RG1 A;  1Y8O B;  2EYM A;  3PO2 B;  3NBH B;  2MO0 A;  1KAW A;  1EFW A;  2E2H B;  1B53 A;  2Q2U A;  5BN5 A;  4HN7 A;  1SLJ A;  1PDQ A;  2FMM A;  4DN4 M;  4JK1 C;  1BCP C;  4XIG S;  3MXP A;  3D8G A;  5LL6 S;  2AHO B;  4RMF A;  3ULP A;  1QUQ B;  1JR0 D;  2BH2 A;  5M5X B;  3KLS A;  2JYO A;  3PO3 H;  3M4O B;  1B44 D;  2K5W A;  3I4N H;  2NVQ H;  3T53 B;  1WCM B;  3K5N A;  1X3E A;  2K5V A;  4DR2 L;  2ICE C;  1A3V A;  3S2D B;  1X65 A;  1SN8 A;  1M8A A;  3PF4 A;  1PLF A;  3OIQ A;  3TBI B;  1HZA A;  4ID6 A;  5KEE A;  5FO8 B;  2UUA L;  4GKJ Q;  4HR7 B;  2E5L L;  2Z4I A;  4G57 A;  1GUT A;  5FLM H;  1KLU D;  1EOT A;  1LUZ A;  5IIF A;  3S15 H;  1FVI A;  2BA0 A;  3QB3 A;  4DU9 A;  1VQN A;  5IYB G;  5CMD A;  2L15 A;  4JYA L;  2WFW A;  4JBW A;  5M5Y B;  3H94 A;  4JI4 Q;  2K5H A;  4B3R Q;  3D4W A;  3MTS A;  5JEA H;  1QG7 A;  4LUZ A;  2L5T A;  3GTL H;  1EUJ A;  2QIL A;  1UNS A;  1I4H A;  1PXU A;  2DNC A;  4YIJ A;  4DUY Q;  4DV6 Q;  3STB C;  4DV7 Q;  2JE6 I;  4G7O C;  4OHJ A;  1OXX K;  3TZU A;  1SYC A;  4C1N I;  1RL2 A;  1CFM A;  3KDF B;  4JOI C;  2ASB A;  1EOV A;  3BS1 A;  2PZW A;  4DNT B;  5GAD C;  1HNX Q;  1QVF A;  1DOK A;  2TMP A;  1WD0 A;  1BCP F;  3FPU B;  5LMN Q;  2B2Y C;  4DAY A;  3EQL C;  2WB1 B;  4A76 A;  4ZRZ A;  3SK6 A;  1Q81 C;  3CAM A;  3I73 A;  4DV4 L;  1VQO A;  5JAV A;  2K4K A;  4FF2 A;  3A8I E;  1B9M A;  2NZO A;  5ELN A;  4MHE A;  1FGU A;  3CCJ A;  1DM0 B;  1C0A A;  2XWJ B;  3TS2 A;  1X54 A;  1MI2 A;  3NPP A;  1X32 A;  1XTD A;  1WYD A;  4UHV A;  4YHH L;  4RCN A;  2OCE A;  4LFC L;  4A3B G;  3ONA B;  5BR8 L;  3L9A X;  2RQX A;  3GTM B;  5CV9 A;  1SNO A;  4C3J B;  1GM5 A;  3EIV A;  5IWA L;  5KYL A;  4IFD J;  3HKZ G;  4MTN A;  3G7L A;  4HJ8 A;  2N8N A;  4LFC Q;  1YHA A;  4DV3 L;  4LF8 L;  4WJ3 M;  2EE1 A;  4IO9 A;  1EYA A;  4DUZ Q;  3CMA A;  2F0V A;  4I7Z C;  1I4R A;  3PO2 G;  1EWC A;  1HJP A;  1PYW D;  1I94 Q;  2DJF C;  2JA8 H;  2GA4 B;  2A6E C;  3STB D;  4CJ0 B;  4DV3 Q;  4LF8 Q;  4KY5 A;  4EVO A;  1FJG L;  4E6I A;  1KC8 C;  3HKZ B;  5D14 A;  3U50 C;  4KJO A;  1CQF A;  2PMZ E;  3H91 A;  2MUY A;  1N34 Q;  1S5C D;  1HZC A;  1KLG D;  4FF4 A;  1AE3 A;  3NEM A;  2Z1C A;  4YHH Q;  2ZXO A;  3CCL A;  5LL6 X;  3J7A 5;  1AZP A;  1PMR A;  4U68 A;  4YWK A;  2BOS A;  5C4J H;  4J15 A;  1TWA H;  4GOP B;  4CKC A;  3EA6 A;  5T1G A;  4DNI A;  3E0J A;  2UUB L;  2NVX B;  2K75 A;  3GO5 A;  1EYD A;  3HOX B;  1X55 A;  1S40 A;  3MXG A;  2E76 C;  5IP9 G;  1B2T A;  2BA1 A;  2LSS A;  3T4A C;  4HAE A;  1G6P A;  3JC6 6;  3A5U A;  4NP5 A;  4HIM A;  4BBR B;  3HZX A;  4B08 A;  1D8L A;  1WJJ A;  2CWP A;  2JN4 A;  2ZM6 L;  4RA8 A;  5CV7 A;  4CKB A;  3J81 c;  4XXE A;  2FHT A;  3NP8 A;  5IGD A;  1HHV A;  4FP5 D;  3S1N B;  3G6J B;  1EIH A;  4XDX A;  1IBK L;  4OO1 G;  4DR1 L;  4L5T A;  1PH9 A;  5I9P A;  2CQA A;  1YJW A;  3J81 L;  5IT9 L;  2NBF A;  4CDE C;  4JI4 L;  4IAL A;  2VQF L;  1CA6 A;  5C4H A;  1K0R A;  1AW7 A;  1QE6 A;  2HQE A;  4ODG A;  2QCP X;  4JI5 L;  3DEP A;  3IL8 A;  3UDG A;  1NCV A;  5CBA E;  2K52 A;  4KHV A;  1BO0 A;  2PI2 A;  2UUA Q;  4GKJ L;  3K6O A;  1B4O A;  2PW7 A;  3CW2 C;  5ISR A;  5GRO A;  3OMC A;  4AYB G;  4FF3 A;  4DK1 A;  4R1J A;  4PV1 C;  2E2D C;  4IQZ A;  1U4L A;  2PYK A;  3RUZ A;  1YHQ A;  4HJ7 A;  4IOA A;  1YHB A;  4NKL A;  1JCK B;  3E9H A;  2AWN A;  1VQB A;  2J4X A;  2D0O A;  3FKI B;  2UUC Q;  1SMY C;  1EIY B;  5HGQ A;  4IUT A;  1ILQ A;  2GVB A;  1PYB A;  3GTP H;  5G3L D;  1S5E D;  1ROD A;  2HT1 A;  3HOY G;  4LFB L;  1Y1W H;  3I4O A;  2SEB D;  3PO3 G;  1K83 B;  2OQK A;  1ET6 A;  3CU7 A;  4R9W A;  4F8M A;  1EYG A;  1QJO A;  4JC0 A;  1YNJ D;  4TQU S;  3QIA A;  1GUS A;  2F0E A;  4K6L A;  1PH6 A;  3AQQ A;  1AZQ A;  1HZB A;  4LFB Q;  5AJ3 L;  1YNX A;  2Z9H A;  2EXD A;  1SND A;  4IUU A;  3FHW A;  3NUC A;  1SJH D;  4JI3 Q;  3S2H H;  1TVX A;  2R7D A;  2JA8 G;  4DR6 Q;  3Q8D A;  5I6Y A;  1A3T A;  1BXT A;  3TP5 A;  5C3W A;  1ZYR D;  4OGQ C;  4H02 A;  1BKB A;  2F1M A;  3HS0 C;  4KY6 A;  4BWG B;  1CA5 A;  3PO2 H;  1Q8K A;  1VQJ A;  2A5H A;  2I5L X;  2A69 D;  3K7A B;  1HNZ L;  3W3A A;  2BCO A;  3K59 A;  3M3Y B;  2NWG A;  1CHQ D;  3A8J E;  3W1G A;  3CCU A;  3NBI A;  4DR3 Q;  1YNN C;  1STY A;  4KKT A;  3M4O H;  3PO3 B;  1NJI C;  5IP7 G;  2CW0 C;  3HOW G;  1A0I A;  5M5X H;  4DAV A;  4A3C H;  2WIN B;  4MZ9 A;  4L6T B;  1FD7 D;  1RF2 D;  2CW0 D;  5C4J B;  1PFB A;  5JVG 3;  2KED A;  2H1E A;  3KBX A;  3AYH B;  2YTY A;  1SBB B;  1ONL A;  4R4I A;  1HTL D;  5C44 B;  3S14 B;  5F2D A;  4GN3 B;  4WJ4 A;  4KLK A;  3DUZ A;  2R7Z B;  3DEO A;  2VNU D;  1SNM A;  2Y0S G;  1CHP D;  4L5S A;  4PQX A;  2B8F A;  2XVS A;  1B9N A;  4K5V A;  3A74 A;  1A2U A;  3TRZ A;  2R7Z H;  3NEN A;  3GTM H;  1HNW L;  1H9K A;  4DR6 L;  1D6E C;  1LAC A;  1MGS A;  5IGG A;  3DWA A;  1LO5 D;  4IUQ A;  2NVT H;  4X64 Q;  5TSS A;  3CCM A;  5LHY 1;  4HTH A;  4MNO A;  2ZTD A;  3QJY A;  2L11 A;  3M9B A;  4ULL A;  3G71 A;  4PG3 A;  3X3N A;  4OEL B;  1GHJ A;  4B3T Q;  4KKS A;  4P71 A;  2PQA A;  2D62 A;  4KMU C;  2VB2 X;  1E22 A;  1I50 H;  3I2Z A;  4ALP A;  1K8A C;  3S9W A;  5HUR A;  2R93 G;  4X65 L;  4JW0 A;  4X3T A;  3AU7 A;  1AEX A;  3V2T A;  1L1O A;  1CK1 A;  1XPO A;  2VQE L;  3E0E A;  3GTP B;  4PMB A;  1GUN A;  4OWT B;  3T16 A;  5D3I B;  3S2H B;  2KCT A;  4HIK A;  1F9P A;  4LWC A;  4DR2 Q;  3RZO B;  3HOW H;  4BBR G;  5L37 A;  3K81 C;  1LYL A;  3TDQ A;  3LWU A;  1K8M A;  2B2T C;  3RR5 A;  4JYA Q;  4B3M Q;  1FGB D;  1XMO L;  2UXC Q;  2B2V A;  1BDO A;  3TP6 A;  4L8J A;  1M4V A;  4AQY Q;  5KGU A;  5LMN W;  5DLQ E;  1ILP A;  1N33 Q;  3VA5 A;  3GTQ B;  1AE2 A;  4EQP A;  3CC4 A;  4KHZ A;  3PUX A;  1XX8 A;  5JOB A;  5C4X G;  3VYS A;  2F0Q A;  1SJE D;  1VQD A;  4YWM A;  5FJ8 G;  5JPN C;  1XPR A;  1AN8 A;  4GLX A;  3F8T A;  4UP9 A;  1I4G A;  3PUW A;  4GS3 A;  5KYI A;  1PTO B;  2UU9 Q;  1S5D D;  4DV7 L;  4IJL A;  5KND A;  2E5L Q;  5M3F H;  5C4X H;  1XNR L;  4A3K G;  3HEJ A;  2VQE Q;  1ET9 A;  2RBM A;  1BF4 A;  4JI2 Q;  1I6H B;  2LXK A;  4JOI A;  3NQI A;  4ABN A;  4C2M H;  1U5K A;  1GD7 A;  1I3Q H;  4L5R C;  1TWC H;  4A3B B;  2R61 A;  2UU9 L;  1BOS A;  4OWX B;  2QEX A;  5C5L A;  3S15 B;  1CSQ A;  1ENF A;  3VYU A;  1UE7 A;  1XXG A;  2F0J A;  3EJI A;  1QNU A;  3UI2 A;  4GN5 A;  4DV0 L;  1JJ2 A;  3D4D A;  3VR5 A;  2UXD L;  2B63 G;  2EXZ A;  3GTG H;  4RGO S;  2NVQ B;  2RA4 A;  3KDF A;  3MC0 B;  5CV8 A;  5EBD A;  2I5H A;  4RGN A;  2J7Z A;  1SYF A;  1DGS A;  4H0L C;  1FNU A;  5M3M H;  1TWA B;  4BBS B;  1BUV T;  3CQZ B;  3C3L A;  3FEW X;  2EY2 A;  4A3M G;  4CDC C;  5IYC G;  4XYO A;  3R3O A;  1A15 A;  1SNC A;  4BY1 H;  4QJF A;  3CPW A;  2R93 B;  1VDZ A;  2WB1 G;  1HCZ A;  2Z6B A;  4I7A A;  4X66 Q;  1KRS A;  3A8K E;  4C1N K;  4ZKB B;  3CQZ H;  1PZJ D;  2K33 A;  3E6Z X;  2F0G A;  3QOJ A;  2F0P A;  1E1T A;  2D9U A;  3M3Y H;  1N32 Q;  5CYU A;  4UPA A;  1DOL A;  1A3U A;  3HOZ G;  2R7Z G;  4XYQ A;  1SEB D;  5E7N A;  4LF9 Q;  1L0X B;  1UUP A;  4K5X A;  2HCC A;  4X66 L;  4NXN L;  1Y69 U;  1JWM D;  4CDD C;  1H9J A;  3CME A;  1SE3 A;  2Q8T A;  3FDT A;  4IUP A;  1BNZ A;  2SNS A;  1QCB D;  1DXM A;  4DA2 A;  4ME5 A;  1KL9 A;  4UAI A;  1BBU A;  4KK7 A;  3UDF A;  3K58 A;  4C3J H;  4GNX B;  1EEF D;  3I56 A;  3PUZ A;  5K5P A;  4LFA Q;  5IP7 H;  5ELD A;  2Z4H A;  4A3E G;  1B8A A;  1EZ8 A;  4QY7 A;  5CBE E;  3W2D A;  2JA5 G;  5KNC A;  2PMZ B;  5LMU Q;  3TN2 A;  2A69 C;  5E1F A;  3R8B A;  1VQ6 A;  3KF8 B;  2EYL A;  3QO2 A;  1VQE A;  2I0Q A;  2K1B A;  1TR5 A;  5IWA Q;  1VQ5 A;  4MTK A;  3GTG B;  1O7Y A;  1O7I A;  1NR4 A;  4NXM Q;  5LMU L;  4R4Q A;  1XMO Q;  2UXC L;  3NE5 B;  1YJ9 A;  2YV5 A;  5JVH 3;  4PNY A;  3J80 E;  3TEH B;  3JAM c;  3HOY B;  2AUJ D;  2HDM A;  3BVM A;  1WVL A;  1MSH A;  2PW5 A;  4N8F A;  3JAM L;  2K5N A;  4ZKC B;  3VR6 A;  3S16 B;  1SNP A;  1E3P A;  2WAQ E;  1B70 B;  3RLN A;  5FLX E;  1QUQ A;  3R93 A;  3G6E A;  1S72 A;  1EY8 A;  1IXR A;  3NQT A;  5CV5 A;  3UDX A;  3FKI H;  3J80 c;  1XMQ Q;  2QDL A;  1PH5 A;  1K28 A;  1EQV A;  1KDB A;  1W3S A;  4AYB B;  5KNB A;  1SXT A;  4DGZ A;  3EFX D;  5IOC A;  1D5Z C;  2F3V A;  4IOC A;  4Y52 H;  1VQM A;  3Q22 A;  3N6R A;  3MXN B;  2OXP A;  2F3W A;  1WTO A;  4DUY L;  1Y1V H;  2XN9 C;  3SR1 A;  1WCM H;  2E2J B;  2QW7 A;  2EVB A;  4Q0F A;  3S1N H;  1C9O A;  2L12 A;  3M7N A;  1TS2 A;  1PRT D;  2X6G A;  3A5Z B;  2OQ0 A;  1ZYR C;  1WTP A;  1V1Q A;  3RLO A;  1V1P A;  4JI1 L;  5FOB B;  1EEI D;  4XTC S;  1DJR D;  5E4W C;  1SR3 A;  3A56 A;  1WTX A;  4DR4 L;  3TME A;  1L0Y B;  5C0X I;  4FDB A;  2JEA I;  1K3B C;  1YNJ C;  3I91 A;  4OO1 H;  4LUO A;  1VF7 A;  4QUF A;  4IPC A;  1UEB A;  1EYC A;  1SNQ A;  2IT1 A;  1QB5 D;  1F2M A;  3G48 A;  1EY5 A;  1X3F A;  3H0G G;  3KK7 A;  2L55 A;  4DF7 A;  5JEA G;  3EVQ A;  2IX0 A;  1SMX A;  3NK9 A;  4DR5 L;  1JB3 A;  2IHF A;  1CKM A;  2NVY H;  3HFZ B;  1XNQ Q;  4JI0 Q;  2M9V A;  4BXX H;  1QIL A;  4JBK A;  1GVP A;  1PFS A;  4H7B A;  2Z6K C;  5C44 H;  1NMF A;  2Z6K A;  1EY9 A;  3H3V I;  4UDU C;  2NVY B;  1MJC A;  4RCO A;  2HD3 A;  2ZXP A;  4A3I H;  5EBC A;  2UXB L;  1O7Z A;  1K9M C;  3K80 C;  1STG A;  4DR5 Q;  1XNQ L;  2E2I H;  1JT8 A;  1TWH H;  4IFD G;  3KOJ A;  3OSO A;  1ML0 D;  1E0B A;  1IL2 A;  1WTQ A;  1JMC A;  5C44 G;  1J5E L;  2AWO A;  1VQL A;  2RVL A;  2D2C C;  2A73 B;  3E9I A;  1U4M A;  1V43 A;  4BXX G;  4TKO B;  4FXD A;  2IY5 B;  4ZK9 B;  2ES2 A;  1PZK D;  3J7A V;  4DNR B;  1SE4 A;  1I4Q A;  1PRT F;  1STA A;  2K32 A;  3NHH A;  3R2T A;  3HOZ H;  1K83 H;  1VMC A;  3FP9 A;  3WOF A;  1XWE A;  5G3L F;  5I4D A;  5CGK A;  1LM0 A;  4MN3 A;  1TXY A;  4OX9 Q;  1YZ6 A;  4A3J H;  3RZD B;  5JJL A;  4BY7 B;  5IYC H;  1XTC D;  3ND8 A;  4XQJ A;  1J6Q A;  2JA9 A;  2OF1 A;  5CV6 A;  4IZ8 A;  3KJO A;  4BA1 I;  1VS0 A;  3CC7 A;  2JA6 G;  2BE5 D;  2KJX A;  2FJ2 A;  2FFK B;  4OXP A;  5M3M G;  2NZ1 D;  2OEO A;  3OOC A;  2LXJ A;  2I07 B;  3S1Q H;  2K04 A;  2O2L D;  2F0T A;  1VCI A;  2XGT A;  3OW2 A;  4OWW B;  4A3D B;  4FXK C;  5GAE C;  3FPP A;  4HMI A;  5GAH C;  1MD2 D;  3PGZ A;  1LLR D;  3DWP A;  2O5J C;  2PQE A;  1GKH A;  3VR3 A;  1D7Q A;  2JA5 B;  2R92 G;  5C0X J;  1IYJ B;  4FO2 A;  2PCF B;  3OIP A;  2KCN A;  2B2U C;  3B6Y A;  2GN5 A;  1STN A;  3BU2 A;  3KFU A;  2VY3 A;  4JBM A;  3TP7 A;  4I65 A;  2KUM A;  1N34 L;  3S1R H;  1TQO A;  3CCS A;  1LTR D;  2BE5 C;  2H4O A;  5M3F G;  4JI6 L;  5C3X A;  4ZLT F;  4EQ5 A;  1P8L A;  1QOH A;  2N55 A;  4DXG A;  3V96 A;  3K57 A;  3VA7 A;  3FRP B;  4MIU A;  1C48 A;  4GNX A;  2EYF A;  2X69 A;  4JI1 Q;  4A3F G;  3LGJ A;  2PQA B;  1LT6 D;  3MAQ A;  5IYB H;  1UE1 A;  1JOQ A;  5IYD H;  3DM3 A;  5J39 A;  1Q1E A;  2A74 C;  1SYE A;  3KF8 A;  3KUP A;  1F2Y A;  3NTH A;  4LW1 A;  4A3E H;  1LTI D;  3HKS A;  1G2T A;  1H9R A;  5J3B A;  1D2B A;  1G8Z D;  5EPJ A;  1TWG B;  5IYD G;  1ASY A;  1CSP A;  4IN3 A;  2R6G A;  2L0C A;  1EQQ A;  5D3D A;  3CRL C;  3ITP A;  1Q8I A;  4IUV A;  2B63 B;  3SHL A;  2CWA A;  5ELC A;  3CRK C;  2VB3 X;  1TWG H;  4JPB W;  1AFP A;  3OWE B;  4ILW A;  4K6D A;  1IW7 C;  3LX0 A;  4AYB E;  5BR8 Q;  4IUN A;  2MP1 A;  3WOE A;  4Y7N H;  3NTI A;  2UUC L;  4DV1 L;  3K0X A;  5C6A A;  4BBS H;  4NXN Q;  2EYJ A;  2JK8 A;  2CQO A;  1CT1 D;  1VMP A;  4B3R L;  4X6A H;  1LTB D;  1CUK A;  3J7Z C;  2DJG C;  1V8Q A;  2YU9 H;  2JEB I;  1FR3 A;  4KV6 A;  2WKC A;  4G7H C;  4O0A A;  2VW9 A;  3BZC A;  1J8I A;  1KNE A;  4XQQ A;  1HFN A;  4FXG C;  4LK1 C;  2MJ8 A;  4RHS A;  3G4S A;  3MXN A;  4LF5 L;  3BZK A;  1H9S A;  2ATW A;  3OYY A;  4CHT B;  3F2U A;  2CVR A;  3RN2 A;  5IGE A;  5K36 G;  4EQN A;  1D1K A;  2F0U A;  3I4M B;  5GQO A;  1CKO A;  5IGC A;  1G6Z A;  3CCR A;  1T5E A;  1A62 A;  5J1Z A;  4R8I A;  1I3Q B;  3IAY A;  3DWQ A;  3UDI A;  4EGV A;  1XYI A;  1HNZ Q;  4CJ1 B;  1MJE A;  1CZG A;  1H9S B;  2R3Z A;  5FO9 B;  1N8R C;  1IYU A;  4QQB X;  1OTC A;  2JA6 H;  3K5M A;  2EY1 A;  2XWB B;  5D65 A;  4DK3 C;  1RIP A;  2F4V L;  4FNF A;  5COR A;  3PCO B;  5M3F B;  4ZCK A;  2HHH Q;  1BCP B;  1NUC A;  3KLW A;  3JAM E;  1KRT A;  1PTO H;  4NDX A;  2EJG C;  3PIO A;  2QKI C;  3EN2 A;  4LF4 L;  3MZ5 A;  2WII B;  1VQ9 A;  4WJW A;  4BBS G;  3VR2 A;  4LAA A;  3ERO A;  4PMW A;  3DXJ C;  2KBN A;  4C3I H;  4C3H B;  2F3I A;  3PMF A;  4GOP C;  2JP1 A;  3RZO H;  3DLL A;  1STE A;  2B39 A;  1KIX A;  1VQA A;  1C8C A;  1F9Q A;  4JV5 Q;  5T1I A;  4EQO A;  2VQF Q;  3HOY H;  3I4L A;  3OTO Q;  3C2P A;  1Q46 A;  2K50 A;  2L4N A;  1TWF B;  4S3S A;  3M85 A;  2D5D A;  2B29 A;  3T56 B;  3F2D A;  4JI2 L;  1HA6 A;  1X56 A;  1B7Y B;  2XSC A;  4NXM L;  1Q1B A;  2B2W A;  2E74 C;  3HKZ E;  1PV4 A;  2Q2T A;  1X3Q A;  1RJT A;  3URY A;  1DON A;  4BBR H;  1YIT A;  1UWV A;  2A6H C;  2NUC A;  3TRE A;  3EBE A;  4N8X 1;  4F88 A;  1IBM Q;  3OWF A;  4IPD A;  3VDY A;  4Y7N B;  2KCC A;  3F1Z A;  1Q7Y C;  1IBL Q;  1WOC A;  2VXW A;  3SGI A;  1VQG A;  1I6V C;  2VL6 A;  4WRD A;  4G7Z C;  2R93 H;  2ZJQ A;  2E2I B;  1CKN B;  1WTH A;  5FO7 B;  4LMQ D;  2EZV A;  4AH6 A;  3D6C A;  3NWS A;  5M9O A;  1SFO H;  2EYO A;  2GVA A;  4O1N A;  2G9D A;  4A3L G;  1SRU A;  2RSO A;  3S2D H;  3SK8 A;  1CKN A;  1XJV A;  3BDL A;  2C9O A;  2LY7 A;  3KLS X;  4RKB A;  2CCZ A;  4KHP L;  4A93 B;  1GHK A;  1IW7 D;  2AUK A;  4JG2 A;  4DV5 L;  1FYC A;  4CGY B;  1WTW A;  1U0L A;  2G5D A;  3H09 A;  1R9T H;  2C35 B;  4IPH A;  3A7L A;  1QZH A;  2PI2 E;  2NTT A;  1A63 A;  4H44 C;  4HID A;  1Y1V G;  3CCV A;  1N36 L;  4DV5 Q;  1SE8 A;  4RH6 A;  1EY4 A;  4TSS A;  2ZJR A;  4JV5 L;  4K5W A;  2QDB A;  2RHQ B;  1F2Z A;  2KOL A;  4A3C G;  5EAY A;  3AMU A;  1EQR A;  5C3E G;  3CCQ A;  3FKI G;  4DV2 Q;  4A3E B;  1J9O A;  2HCI A;  3K7U C;  1GUG A;  2PO4 A;  2IL8 A;  4J6H A;  3S1M B;  2DUD A;  4R4O A;  1EU3 A;  4A3J G;  1NAP A;  2AQ1 B;  3HRZ C;  3SK4 A;  4IPG A;  3ICE A;  3ER0 A;  3H3V C;  4B3T L;  2MGS A;  1R4Q B;  2F0D A;  4DFA A;  3H3V H;  5CR3 A;  2RCN A;  1WTR A;  1QZG A;  2DGY A;  4O42 A;  4KKU A;  1JJG A;  1E2W A;  2PPB C;  2Y0S B;  4DXF A;  4C56 C;  1Y1W B;  3SK5 A;  2G9H D;  3K0Y A;  2NTS A;  4DK6 C;  1MSG A;  1WI5 A;  1HRJ A;  1HZ9 A;  4UY8 C;  4DAY B;  1HNW Q;  1F9R A;  5C3E B;  3RN5 A;  1G91 A;  1JOK A;  2Q8R E;  5A35 A;  5H1S E;  1STB A;  1U4R A;  4LJZ C;  1PH4 A;  1EZ6 A;  3I4M G;  3ULL A;  3AEV A;  3GV3 A;  4IFD H;  1BVS A;  3L2P A;  1BQQ T;  4OIK A;  1Q82 C;  3SVM A;  5C3E H;  3ERS X;  3NSW A;  5A2Q E;  4KN7 C;  4HIO A;  1HR0 Q;  3MFY A;  1VQH A;  2M2L A;  1LV9 A;  2EPB A;  4JI7 Q;  3GTQ H;  2WAQ B;  3HP3 A;  3MEH A;  1XPU A;  4P2C B;  1TY0 A;  1S5F D;  3OHX C;  1PH3 A;  1JJC B;  4BA2 I;  2Y0S E;  4A3G B;  4HJ9 A;  1YVC A;  4DR3 L;  3OTO L;  1EY7 A;  1C7Y A;  2K6A A;  1SYG A;  3K8A A;  3AB9 A;  3HOU G;  4LFA L;  3H0G H;  1LTS D;  1GJX A;  2XNA C;  3NEL A;  1OXT A;  4LF6 L;  1Q90 A;  2A19 A;  1PFN A;  2MFI A;  4RGT A;  4DAM A;  3UE1 A;  3S17 H;  3PF5 A;  4ZUJ A;  2PZU A;  1VQK A;  1KNA A;  4BY7 H;  4K14 A;  5J22 A;  1MKH A;  2DY8 A;  1HUM A;  1GO3 E;  2Q2I A;  1IBL L;  4BY7 G;  4A3G G;  1TKW B;  4FF1 A;  2F0N A;  5JJI A;  1NNX A;  1U4P A;  4KD3 A;  1HH2 P;  1S5B D;  3U58 A;  4A3M H;  1DOM A;  1GXD C;  4POG A;  2NB0 A;  3M4Y A;  3CCE A;  4U67 3;  2NYZ D;  3GDE A;  1LT5 D;  4DAP A;  3A55 A;  2OWO A;  1M1K C;  2FMC A;  3VR4 A;  1XNR Q;  1D1I A;  3GQB A;  5IY0 A;  1ICW A;  5C0X H;  4DR7 L;  3U4Z A;  1JE4 A;  1PZI D;  3GP7 A;  3TP8 A;  4LNQ A;  4K0K Q;  1K3R A;  3D0F A;  2Q8I B;  2HIX A;  3MEF A;  2AQ3 B;  4NMZ A;  4DV6 L;  3WDN A;  1HQR D;  1RKN A;  2AKW B;  4NPS A;  5ELF A;  2XIW A;  1HR0 L;  5I2X A;  2LFN A;  3I8Z A;  5JJK A;  3A7A B;  3BYY B;  1PH1 A;  2LS0 1;  4A3K H;  1NR2 A;  5NUC A;  4B3M L;  3I55 A;  3CXC A;  1K73 C;  5DNF A;  2P5Z X;  4QF4 A;  4A3M B;  3QR8 A;  1HFG A;  4R4T A;  4X3K A;  4C3I G;  1ENC A;  4IFD I;  1E2Z A;  3TQY A;  5BN3 A;  1BBW A;  3Q24 A;  1LTA D;  3SE0 A;  4DUZ L;  4XT3 B;  5FJ8 H;  4DV2 L;  4NB3 A;  4DV1 Q;  1JOR A;  1TY2 A;  2WV6 D;  1SMY D;  3P1H A;  4FVM A;  4KY7 A;  3GV6 A;  5EGT A;  3S1R B;  2JJQ A;  2F0S A;  4K0K L;  4PZ7 A;  5EKK A;  4B3S Q;  2MHV A;  4C3H H;  2QGQ A;  5IGF A;  1WD1 A;  2WKD A;  1Q3L A;  2JA5 H;  5FK9 C;  4ZAI A;  4DK0 A;  3C46 A;  1DZ1 A;  2TSS A;  1HUN A;  2K14 A;  2JA6 B;  3S24 A;  3HOV G;  1F77 A;  1TS4 A;  1YEZ A;  1TWC B;  4A3B H;  2BDN A;  1T5X D;  2FIN B;  2LKV A;  4A93 G;  1DYQ A;  4OL7 A;  2N49 A;  4LF4 Q;  2VUM G;  3M4Q A;  5M5W B;  1LTL A;  1NSN S;  4QUC A;  3FVQ A;  4CBV A;  1G2S A;  1R4P B;  3D6W A;  1SSO A;  1KAA A;  5IT9 E;  2CH4 A;  3C1F A;  3JAM i;  1NBW A;  3NBH A;  3HOW B;  4R4C A;  2F0I A;  3ND9 A;  5FKA C;  1VQ7 A;  4X65 Q;  5JPM C;  1MBY A;  3FMC A;  2JXM B;  5C5M A;  1SDF A;  5M5Y H;  3PIP 3;  3E5S A;  1GUO A;  4BY1 G;  1RTO A;  2A6E D;  4OEM B;  2VS1 A;  3WWV A;  2EQS A;  3GTJ H;  3S1M H;  1O78 A;  3H6M A;  3I3C A;  1S3O A;  1Z7T A;  4OON A;  3BYT B;  1E1O A;  1OXS C;  1XMQ L;  1U9R A;  2NVT B;  4ME3 A;  3F2B A;  5I6W A;  4RKL A;  3AFP A;  2VUM H;  1VQF A;  3BDO A;  2B63 H;  4A93 H;  1C4Q A;  2A68 C;  1X9N A;  2K5D A;  3J81 j;  2RDG A;  1E24 A;  2IWH A;  4L63 B;  5BN4 A;  1W2B A;  3BZD B;  2XRQ D;  1VQ4 A;  1GUW A;  2B2T A;  5FLM G;  2NN6 I;  2EYH A;  1DD2 A;  1B3A A;  2B2W C;  1R9T B;  2R7F A;  2EIF A;  4LF7 L;  4PZ8 A;  5ELB A;  2WAQ G;  2FXQ A;  4YY3 L;  1A2T A;  4QL5 A;  3PIP A;  1G29 1;  1NMG A;  5AFW A;  3MVV A;  1YIJ A;  3X3M A;  2E2H H;  4IJH A;  4XT1 B;  1KTK A;  3T1Y L;  2JA7 B;  2KHS A;  1RCV D;  4AQY L;  1I5F A;  2O5I C;  4YCW A;  2H5X A;  1HNX L;  5FLX c;  3CF5 A;  3J81 i;  2KA7 A;  3P75 A;  3D31 A;  5C4Z A;  3J7Y W;  3CPF A;  4GKK L;  2NN6 G;  4RHR A;  2J0T D;  1HR0 W;  3LNN A;  5DAU A;  4ZQ3 A;  2QA4 A;  4DR1 Q;  4Q5V A;  2A1A A;  2RDH A;  1ENA A;  2KEN A;  2IW3 A;  3BDC A;  1O7L A;  2Z0S A;  1Y1W G;  1PYS B;  2BDO A;  5IOD A;  2F0M A;  5EKI A;  2RKS A;  3J80 L;  1F2L A;  3GTO H;  4CJ2 C;  5JEA J;  1N9W A;  2ZTE A;  3A54 A;  1SRO A;  4C2M B;  2R92 H;  1AH9 A;  2SOB A;  1WTV A;  2JA7 G;  4KN4 C;  1Y1V B;  1I6H H;  1H95 A;  4YCV A;  4LUV A;  5M3M B;  2UXD Q;  2A6H D;  3VYR A;  2DNE A;  1KAB A;  3T1Y Q;  3Q23 A;  1UEA B;  5E3F A;  2K28 A;  2N88 A;  4K2K A;  3OMG A;  3ULJ A;  4HJA A;  4X62 Q;  1VQ8 A;  3RMH A;  1QVC A;  3CHB D;  3DM1 A;  3R2I A;  2YTX A;  3HOX G;  2IX3 A;  2MPM A;  1W6J A;  4A3G H;  1JB7 A;  3U9S A;  1I4P A;  1OXV A;  1EL0 A;  4A4I A;  4APV A;  1K8O A;  5EQ0 A;  1PHJ A;  3U4V A;  4QCL A;  1RHP A;  3KYH C;  2F03 A;  4JBJ A;  4H13 C;  3E3X A;  5IT9 c;  3L0O A;  2EOT A;  1OO9 B;  2PNH A;  2SNM A;  2CFM A;  1GOZ A;  5ELO A;  5A2Q L;  1ESF A;  2Q2H A;  4PZ6 A;  3HOU H;  1N32 L;  2F52 A;  4GNX C;  1BR9 A;  2E8G A;  3A0J A;  1JC7 A;  3MWY W;  3C1E A;  1HQM C;  4R8N A;  3QG1 A;  2A8V A;  3NWT A;  4GOP A;  1QVG A;  2KHI A;  4X3S A;  1I50 B;  1PTO F;  3T13 A;  3SXH A;  2K05 A;  1JOO A;  2ID0 A;  2X6L A;  3SEB A;  4K8I A;  3HOV H;  3J80 i;  1YJN A;  1YNN D;  1TS5 A;  4A3I G;  5CV4 A;  3IFT A;  5EPL A;  3W1B A;  1A6X A;  4C3H G;  3MXU A;  1L2F A;  1PTO D;  1HXY D;  1P16 A;  3NTK A;  3W5O A;  3QOL A;  1IZ6 A;  2JQO A;  2O4X A;  4WOR A;  1NE3 A;  5EPK A;  4KTA A;  1E2V A;  1MIU A;  3O13 A;  2K5Q A;  3MFG A;  2JSO A;  4BS9 A;  4F7X A;  1TWH B;  2MO1 A;  3GD7 A;  3SDZ A;  3L3O C;  1M90 C;  3L7Z C;  4N9T A;  4YCU A;  1W6K A;  2I5M X;  2R92 B;  4DKA C;  1UE5 A;  5JJZ A;  4HSP A;  2AMC B;  5KRU A;  1TT2 A;  1Y8N B;  2RDF A;  4X64 L;  3GTO B;  1VQP A;  2IX1 A;  1AP0 A;  4A3D G;  4RFB A;  1SFO B;  4FYD A;  4A3I B;  1LT4 D;  4V19 0;  2K01 A;  2VZA A;  1PTO C;  1QWY A;  4TVA B;  2B2Y A;  5AJ3 Q;  4HED A;  4QB4 A; 
#chains in the Genus database with same CATH homology
 1XMQ Q;  1IBM L;  1PH5 A;  4IPG A;  3ICE A;  3PO2 G;  3ER0 A;  2YYZ A;  1X6O A;  1W3S A;  4B3T L;  1HJP A;  1I94 Q;  2JA8 H;  3H3V H;  2RCN A;  4IOC A;  3STB D;  2DGY A;  1QZG A;  1VQC A;  4DV3 Q;  4LF8 Q;  1JJG A;  4Y52 H;  1VQM A;  5C0X G;  3MXN B;  1FJG L;  4DR4 Q;  4DUY L;  5LMN L;  1KC8 C;  1Y1V H;  3U50 C;  4EX5 A;  2HIV A;  4DK6 C;  1WCM H;  1VQI A;  1WI5 A;  2PMZ E;  1HZ9 A;  1N34 Q;  4UY8 C;  4DAY B;  3S1N H;  1HNW Q;  1C9O A;  3M7N A;  1HZC A;  3RN5 A;  3A5Z B;  3KF6 A;  1AE3 A;  2OQ0 A;  3NEM A;  5H1S E;  4YHH Q;  3CCL A;  4GKK Q;  3J7A 5;  2D0P A;  1V1Q A;  4DR7 Q;  3RNU A;  2E2J H;  2BH8 A;  3RLO A;  1OXU A;  4JI1 L;  1PH4 A;  1KXL A;  4XTC S;  4YWK A;  1PVO A;  5C4J H;  3I4M G;  4J15 A;  1TWA H;  3ULL A;  2MNA A;  4GOP B;  1BVS A;  1SR3 A;  4DV4 Q;  3AEV A;  3CD6 A;  4DNI A;  4X62 L;  3L2P A;  2UUB L;  4A3D H;  4DR4 L;  4A3L H;  2OTJ A;  2K75 A;  3GO5 A;  3RLF A;  5C3E H;  3ERS X;  4FDB A;  5C0X I;  1Q82 C;  1FJG Q;  2JEA I;  2B3G A;  4HIO A;  1HR0 Q;  1VQH A;  1X55 A;  1S40 A;  4LUO A;  4JI7 Q;  3GTQ H;  5IP9 G;  4IPC A;  1XPU A;  2BA1 A;  4UP8 A;  1UEB A;  1PH3 A;  2LSS A;  1JJC B;  2IT1 A;  1PH8 A;  4BA2 I;  2Y0S E;  4HJ9 A;  1L0W A;  1YVC A;  3G48 A;  4DR3 L;  3OTO L;  1G6P A;  1X3F A;  3H0G G;  3JC6 6;  1C7Y A;  1TWF H;  3A5U A;  1A8V A;  1Q86 C;  4HIM A;  5JEA G;  2IX0 A;  1SMX A;  3GTK H;  4DR5 L;  1D8L A;  1WJJ A;  2CWP A;  2IHF A;  3K8A A;  1CKM A;  2NVY H;  3HOU G;  4LFA L;  3HFZ B;  1XNQ Q;  3H0G H;  4JI0 Q;  4BXX H;  3CP0 A;  3NEL A;  2ZM6 L;  4JBK A;  1GVP A;  1PFS A;  1YBY A;  1OXT A;  1UE6 A;  5IE8 A;  4JI3 L;  2Z6K C;  5M5W H;  3J81 c;  2A19 A;  4LF6 L;  5HY6 A;  3TS0 A;  5C44 H;  1KHI A;  1NMF A;  2Z6K A;  5IP9 H;  2MFI A;  3H3V I;  4DAM A;  4HJ5 A;  3UE1 A;  4DR1 L;  3PF5 A;  1IBK L;  3S17 H;  4L5T A;  1PH9 A;  4OO1 G;  1MJC A;  1YJW A;  4JCV E;  4A3I H;  1VQK A;  3S16 H;  2UXB L;  1K9M C;  4JI4 L;  3K80 C;  4DR5 Q;  4BY7 H;  2VQF L;  1MKH A;  1K8G A;  1XNQ L;  1GO3 E;  2E2I H;  1K0R A;  1TWH H;  1NTG A;  4IFD G;  2Q2I A;  3ZJY C;  1IBL L;  4A3G G;  4BY7 G;  3KOJ A;  3I4M H;  4JI5 L;  5JJI A;  3UDG A;  3PSI A;  1HH2 P;  3U58 A;  1IL2 A;  4A3M H;  1JMC A;  1Z47 A;  5C44 G;  3I4N G;  4POG A;  2K52 A;  1J5E L;  2PI2 A;  2AWO A;  3CCE A;  1VQL A;  3GDE A;  3E9I A;  2UUA Q;  1EWI A;  1V43 A;  4GN4 B;  4JI8 L;  4JI7 L;  4BXX G;  4GKJ L;  2IY5 B;  2UUB Q;  1IBK Q;  3CW2 C;  1J5E Q;  5GRO A;  2ES2 A;  2OWO A;  1M1K C;  4AYB G;  1XNR Q;  5IY0 A;  4R1J A;  4DR7 L;  3PUY A;  3U4Z A;  3RZD H;  3HOZ H;  1K83 H;  1YHQ A;  3FP9 A;  2ZJP A;  4K0K Q;  4LNQ A;  1K3R A;  3D0F A;  4HJ7 A;  4IOA A;  1LM0 A;  3CMA A;  1YHB A;  1TXY A;  2HIX A;  4OX9 Q;  2UXB Q;  3MEF A;  1YZ6 A;  4A75 A;  3E9H A;  2AWN A;  1VQB A;  4DV6 L;  4A3J H;  5JJL A;  2D0O A;  2AKW B;  2NVX H;  4NPS A;  2UUC Q;  1EIY B;  5HGQ A;  3I7F A;  1YI2 A;  5IYC H;  1Z9F A;  2GVB A;  1J6Q A;  2JA9 A;  1PYB A;  1HR0 L;  3GTP H;  3KJO A;  2HT1 A;  3HOY G;  4BA1 I;  4LFB L;  3HOX H;  1VS0 A;  2N3S A;  3BJU A;  1Y1W H;  3CC7 A;  5JJK A;  2IHE A;  3I4O A;  2JA6 G;  3PO3 G;  1PH1 A;  4A3K H;  4OXP A;  2OQK A;  5M3M G;  4POF A;  3I55 A;  4B3M L;  3CXC A;  1K73 C;  3F2C A;  1EYG A;  4JC0 A;  1ASZ A;  1WCM G;  2LXJ A;  4R4T A;  4P75 A;  3S1Q H;  4IFD I;  4TQU S;  3TQY A;  1BBW A;  1L1O C;  4LFB Q;  1PH6 A;  1VCI A;  3AQQ A;  4DUZ L;  1HZB A;  5AJ3 L;  1YNX A;  5FJ8 H;  2XGT A;  4DV2 L;  3OW2 A;  2EXD A;  4NB3 A;  4DV1 Q;  4LF5 Q;  4OWW B;  3FHW A;  4DPG A;  5GAE C;  5GAH C;  4OO1 I;  4JI3 Q;  4LF6 Q;  3S2H H;  3PGZ A;  2R7D A;  3UE0 A;  2JA8 G;  4DR6 Q;  1JE5 A;  1GKH A;  2JJQ A;  3Q8D A;  2ZM6 Q;  2JA7 H;  1D7Q A;  1V9P A;  4H02 A;  1BKB A;  2R92 G;  2YTV A;  3PO2 H;  5C0X J;  1IYJ B;  1PH2 A;  1Q8K A;  1VQJ A;  2HQL A;  2I5L X;  4K0K L;  1HNZ L;  4PZ7 A;  4B3S Q;  3B6Y A;  4C3H H;  2QGQ A;  2GN5 A;  3BU2 A;  1NY4 A;  3KFU A;  2JA5 H;  2VY3 A;  3W1G A;  3CCU A;  4JBM A;  1G51 A;  4DR3 Q;  1N34 L;  3S1R H;  2K14 A;  3CCS A;  3M4O H;  3KF6 B;  3S24 A;  1NJI C;  5IP7 G;  3CC2 A;  3HOV G;  3K7A H;  3HOW G;  1A0I A;  5M5X H;  1Q12 A;  4A3C H;  5M3F G;  4JI6 L;  2N78 A;  4MZ9 A;  1YEZ A;  4JI8 Q;  4P72 A;  4A3B H;  4EQ5 A;  1P8L A;  1N33 L;  4YY3 Q;  3AYH B;  2YTY A;  4JI6 Q;  4LF4 Q;  4R4I A;  2N49 A;  4A93 G;  4WJ4 A;  4GN3 B;  4KLK A;  1X3G A;  3M4Q A;  2VUM G;  1LTL A;  1E7Z A;  4JI5 Q;  4GNX A;  4JI1 Q;  2VNU D;  2Y0S G;  4QGU A;  4A3F G;  4L5S A;  3T1H L;  2RHS B;  4P74 A;  3A74 A;  3JAM i;  1NBW A;  3LGJ A;  2PQA B;  5IYB H;  3PV0 A;  1UE1 A;  4R4C A;  3NEN A;  5GAG C;  2R7Z H;  3GTM H;  1T9H A;  3TRZ A;  4DR6 L;  1HNW L;  3DM3 A;  5IYD H;  1Q1E A;  1VQ7 A;  4X65 Q;  1KQS A;  2NVT H;  4X64 Q;  3CCM A;  4LW1 A;  4A3E H;  4JI0 L;  3H15 A;  3HKS A;  4MNO A;  5M5Y H;  5J3B A;  2ZTD A;  3M4P A;  4BY1 G;  3M9B A;  2V1C C;  3G71 A;  4PG3 A;  2VS1 A;  3WWV A;  2EQS A;  5IYD G;  3GTJ H;  3S1M H;  1ASY A;  1CSP A;  1I94 L;  4B3T Q;  2R6G A;  1S3O A;  4OON A;  4P71 A;  2PQA A;  2D62 A;  1EQQ A;  1E1O A;  1OXS C;  2ALY B;  4YWL A;  1XMQ L;  4ME3 A;  1E22 A;  1I50 H;  3I2Z A;  3F2B A;  2CWA A;  4A3F H;  4ALP A;  3PUV A;  1TWG H;  1K8A C;  2WB1 E;  2R93 G;  4X65 L;  1KD1 C;  3AFP A;  4AYB E;  1VQF A;  2VUM H;  1L1O A;  5BR8 Q;  2B63 H;  1XPO A;  4A93 H;  2VQE L;  3E0E A;  4Y7N H;  1X9N A;  2XTI A;  4OWT B;  2UUC L;  4DV1 L;  3IRB A;  2KCT A;  3J81 j;  3K0X A;  4HIK A;  4KHP Q;  1E24 A;  4BBS H;  4NXN Q;  2JK8 A;  4LWC A;  2CQO A;  3T1H Q;  4DR2 Q;  1W2B A;  4B3R L;  4X6A H;  1VQ4 A;  3HOW H;  4BBR G;  1CUK A;  3J7Z C;  5FLM G;  2NN6 I;  3K81 C;  1LYL A;  2YU9 H;  4JYA Q;  3RR5 A;  2JEB I;  4B3M Q;  4O0A A;  1Y14 B;  2NZH A;  2R7F A;  2EIF A;  1XMO L;  4LF7 L;  4PZ8 A;  3BZC A;  2VW9 A;  2UXC Q;  2WAQ G;  2FXQ A;  4YY3 L;  1N36 Q;  1EIF A;  4QL5 A;  3PIP A;  4AQY Q;  4KI0 A;  1G29 1;  1NMG A;  5DLQ E;  3AFQ A;  5LMN W;  1YIJ A;  1N33 Q;  2E2H H;  3G4S A;  4DV0 Q;  1PA6 A;  4AIM A;  1AE2 A;  4IJH A;  4LF5 L;  3BZK A;  3T1Y L;  2ATW A;  3OYY A;  3CC4 A;  4AQY L;  4KHZ A;  3RN2 A;  2WP8 J;  4UP7 A;  1I5F A;  3PUX A;  5K36 G;  4YCW A;  5C4X G;  2H5X A;  1HNX L;  2RF4 A;  5GQO A;  1CKO A;  5FLX c;  4LF7 Q;  4QIW E;  1VQD A;  3J81 i;  3CF5 A;  4LF9 L;  1WFQ A;  4YWM A;  1A62 A;  2KHJ A;  5FJ8 G;  3CCR A;  3D31 A;  2HHH L;  1XPR A;  3CPF A;  4GKK L;  4GLX A;  2NN6 G;  3F8T A;  4UP9 A;  1HR0 W;  4B3S L;  3PUW A;  4GS3 A;  3UDI A;  4P73 A;  1HNZ Q;  2UU9 Q;  1MJE A;  2KCM A;  4DV7 L;  4IJL A;  4DR1 Q;  2QA4 A;  4GLV B;  2E5L Q;  2A1A A;  1N8R C;  5M3F H;  5C4X H;  1XNR L;  2CKZ B;  2KEN A;  2F4V Q;  4A3K G;  2VQE Q;  2Z0S A;  4QQB X;  1OTC A;  2JA6 H;  3KJP A;  1Y1W G;  1PYS B;  4JI2 Q;  2LXK A;  4JOI A;  4DK3 C;  1PH7 A;  1L1O B;  1FL0 A;  1RIP A;  1U5K A;  4C2M H;  1GD7 A;  1I3Q H;  4O2D A;  2OTL A;  4L5R C;  2F4V L;  1TWC H;  4OX9 L;  2MQH A;  2ZTC A;  3PCO B;  3GTO H;  2UU9 L;  4L5Q A;  4OWX B;  2HHH Q;  5JEA J;  3KLW A;  4GLA C;  1N9W A;  2QEX A;  1KRT A;  2ZTE A;  3S14 H;  4RG1 A;  1CSQ A;  1SRO A;  2R92 H;  3NBH B;  1UE7 A;  2MO0 A;  1KAW A;  3PIO A;  1AH9 A;  3EN2 A;  4R4O A;  4LF4 L;  2JA7 G;  1I6H H;  1EFW A;  1H95 A;  4YCV A;  2Q2U A;  4LUV A;  2UXD Q;  4GN5 A;  4DV0 L;  1JJ2 A;  1SLJ A;  1VQ9 A;  4BBS G;  3T1Y Q;  4XIG S;  2UXD L;  2B63 G;  2AHO B;  3GTG H;  4RMF A;  4PMW A;  3ULP A;  2KBN A;  3ULJ A;  4C3I H;  3KDF A;  4X62 Q;  4HJA A;  1QUQ B;  1VQ8 A;  2F3I A;  4GOP C;  2I5H A;  2BH2 A;  3RZO H;  1DGS A;  3DLL A;  5M3M H;  1QVC A;  1KIX A;  1JT8 A;  1VQA A;  3PO3 H;  4JV5 Q;  3I4N H;  2YTX A;  3HOX G;  2VQF Q;  2NVQ H;  3HOY H;  4A3M G;  3OTO Q;  1Q46 A;  1X3E A;  2K50 A;  2K5V A;  4DR2 L;  3M85 A;  1X65 A;  5IYC G;  1SN8 A;  2B29 A;  1JB7 A;  3F2D A;  4JI2 L;  1OXV A;  3PF4 A;  4A3G H;  4BY1 H;  1HZA A;  1X56 A;  1B7Y B;  4QJF A;  3CPW A;  2UUA L;  4A4I A;  4NXM L;  1Q1B A;  4GKJ Q;  3HKZ E;  2WB1 G;  1PV4 A;  4APV A;  2E5L L;  4X66 Q;  2Q2T A;  1PHJ A;  3U4V A;  5FLM H;  1KRS A;  1LUZ A;  3CQZ H;  3KYH C;  4BBR H;  1YIT A;  3S15 H;  1UWV A;  1FVI A;  1E1T A;  2BA0 A;  4JBJ A;  3TRE A;  3M3Y H;  1N32 Q;  3EBE A;  5IT9 c;  4UPA A;  2R7Z G;  3HOZ G;  3L0O A;  5IYB G;  1VQN A;  1IBM Q;  2L15 A;  5E7N A;  4LF9 Q;  2WFW A;  4JYA L;  4JBW A;  4IPD A;  3VDY A;  2PNH A;  5ELO A;  2CFM A;  1N32 L;  2Q2H A;  4PZ6 A;  1Q7Y C;  3F1Z A;  2K5H A;  1IBL Q;  1WOC A;  2F52 A;  3SGI A;  4JI4 Q;  3HOU H;  1VQG A;  4B3R Q;  4GNX C;  2E8G A;  3A0J A;  2VL6 A;  4LUZ A;  4NXN L;  4X66 L;  2R93 H;  2ZJQ A;  3GTL H;  1CKN B;  1EUJ A;  2A8V A;  3CME A;  4GOP A;  1QVG A;  2KHI A;  4DUY Q;  4DV6 Q;  3STB C;  4DV7 Q;  4AH6 A;  1KL9 A;  2JE6 I;  1BBU A;  1OXX K;  3UDF A;  4C3J H;  1SFO H;  4GNX B;  2ID0 A;  3I56 A;  1RL2 A;  2GVA A;  3PUZ A;  3KDF B;  4LFA Q;  4JOI C;  3J80 i;  5IP7 H;  1YJN A;  1EOV A;  1SRU A;  2ASB A;  3HOV H;  3S2D H;  4A3L G;  1CKN A;  1XJV A;  4A3E G;  1B8A A;  4QY7 A;  4A3I G;  5GAD C;  1HNX Q;  2JA5 G;  1QVF A;  2CCZ A;  3W1B A;  4KHP L;  5LMU Q;  1L2F A;  4JG2 A;  4DV5 L;  1P16 A;  1VQ6 A;  3KF8 B;  5LMN Q;  3W5O A;  1IZ6 A;  1U0L A;  2JQO A;  1VQE A;  2I0Q A;  1NE3 A;  4A76 A;  5IWA Q;  2C35 B;  1R9T H;  3CAM A;  4DV4 L;  4IPH A;  1VQO A;  1QZH A;  1Q81 C;  1VQ5 A;  4NXM Q;  1O7I A;  2PI2 E;  2K4K A;  1A63 A;  1MIU A;  5LMU L;  4HID A;  1Y1V G;  3CCV A;  1N36 L;  4DV5 Q;  2NZO A;  1SE8 A;  5ELN A;  1FGU A;  4R4Q A;  3CCJ A;  1XMO Q;  2UXC L;  1C0A A;  2MO1 A;  3TS2 A;  1X54 A;  3GD7 A;  1YJ9 A;  2YV5 A;  2ZJR A;  3TEH B;  3JAM c;  4JV5 L;  1M90 C;  3L7Z C;  4YCU A;  1XTD A;  2I5M X;  1WYD A;  2RHQ B;  4YHH L;  2OCE A;  4DKA C;  1UE5 A;  4LFC L;  4A3B G;  2AMC B;  4A3C G;  5EAY A;  4X64 L;  5BR8 L;  1EQR A;  5C3E G;  1VQP A;  2IX1 A;  3CCQ A;  2K5N A;  3FKI G;  4A3D G;  1GM5 A;  3EIV A;  5IWA L;  1E3P A;  4DV2 Q;  2WAQ E;  1B70 B;  3RLN A;  4IFD J;  1QUQ A;  3HKZ G;  2VZA A;  4MTN A;  4HJ8 A;  3G6E A;  2N8N A;  1S72 A;  4LFC Q;  1IXR A;  3K7U C;  4TVA B;  1YHA A;  4DV3 L;  4LF8 L;  4WJ3 M;  5AJ3 Q;  4IO9 A;  4DUZ Q;  3UDX A;  2DUD A;  3FKI H;  4A3J G;  3J80 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...