1PFSA

Solution nmr structure of the single-stranded dna binding protein of the filamentous pseudomonas phage pf3, minimized average structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF3 SINGLE-STRANDED DNA BINDING PROTEIN
publication title Solution structure of the single-stranded DNA binding protein of the filamentous Pseudomonas phage Pf3: similarity to other proteins binding to single-stranded nucleic acids.
pubmed rcsb
source organism Pseudomonas phage pf3
molecule tags Dna binding protein
total genus 9
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pfsA00
1K8AC 3H3VH 2ZJRA 1CKNB 3CPWA 3HOUG 1BBUA 3FP9A 3NENA 3HOXH 4B3MQ 1UE1A 3PV0A 5GAEC 4A76A 4A3CH 2LXJA 1HNWL 1Q12A 3J7A5 2OCEA 5C0XG 4A3JG 1FVIA 4A3IG 1YHAA 3CCRA 1VQCA 1PH9A 1MJCA 4DKAC 4B3SQ 3S1RH 2UUCL 3L7ZC 3S1MH 4HIKA 1NJIC 3G48A 4DR5Q 4QIWE 1QZHA 1EIFA 1B70B 3FKIG 2NZHA 1BKBA 3IRBA 1KC8C 1YITA 4IPDA 1I3QH 2VQEL 1VQEA 1CKNA 1KHIA 1O7IA 4OWWB 4DR1L 2Y0SG 2NVYH 1HR0Q 1N33Q 2YU9H 2JA7G 1HZ9A 3EIVA 4BBRG 2KCTA 1Q1EA 4DV7L 1SR3A 4GLVB 4A3KG 1GKHA 2VQFL 5M5YH 2EIFA 4DR7Q 4UP9A 4LWCA 2K5VA 5LMNL 4YWKA 1NY4A 4A3IH 3J80c 4DUZQ 3E0EA 2F3IA 1SE8A 2F4VQ 1Y14B 1YI2A 1VCIA 3E9IA 4A3BH 3I4OA 1AE2A 3BZCA 4YCWA 4RMFA 3SGIA 5M3FH 1HNZL 2VL6A 3L0OA 3S1NH 5HGQA 1PYBA 1V1QA 4K0KL 3TEHB 2RCNA 1IBLL 5FLMH 1KAWA 4X64L 2D0OA 5J3BA 4JI6Q 3PUZA 2K5HA 5JEAJ 5C4XG 4JI7L 3HOWG 1QZGA 4DV3L 4BXXH 4X65L 3PF5A 2D62A 1VQOA 2UUBQ 2PQAA 4JBMA 4JI4Q 4OX9Q 3CCUA 1YVCA 2CWPA 4C3JH 4B3RQ 3RLOA 4BBRH 3WWVA 2ZTCA 4A3FG 4X66L 4A3KH 1OXXK 2NN6G 4UPAA 1QVFA 1YNXA 4IFDI 4GKJQ 1E22A 4X6AH 3E9HA 1E24A 4NXMQ 2K4KA 1QUQA 4TVAB 4Y7NH 3T1YL 2JE6I 2JQOA 3BU2A 2CKZB 3F8TA 3TREA 4JI5Q 4JI3L 2VUMG 5IYCG 2JA5G 3RN2A 1CKOA 3GTMH 1C9OA 1HNXQ 4JI8Q 3G4SA 5IWAL 4OONA 4POFA 2B63G 3PO2H 1A62A 1Q82C 2E5LQ 1FJGQ 5IYBG 2E2IH 3GTJH 3CCMA 5AJ3Q 2R7ZG 2JJQA 4JCVE 1JE5A 2RHQB 5C4XH 4FDBA 2ZJPA 5GROA 2IY5B 4A4IA 4YY3Q 5C0XI 4DV0Q 4ME3A 1Z9FA 3F2BA 1K8GA 2MQHA 3CXCA 2ATWA 3K7AH 2PMZE 4IJHA 1VS0A 2N78A 4A3FH 3S2HH 3UE1A 4P72A 4OWXB 2LSSA 4PZ8A 2VZAA 3KYHC 1R9TH 4BA1I 3RR5A 3OTOL 1I50H 2ZTEA 2BH8A 1V9PA 5IP7H 3HOXG 1AE3A 4R4QA 3J81c 1XNQQ 1V43A 1IBKL 5M5WH 4IOAA 3CW2C 2B29A 2PI2A 3UDFA 5GAGC 3CC7A 2VUMH 5IYCH 3H15A 2JA5H 1XMQQ 4DV5Q 4GKKL 4DAMA 1K9MC 4QJFA 3F2CA 1KD1C 4IOCA 2B63H 1K3RA 4DUYL 1PHJA 4TQUS 4UP8A 2ASBA 1PH3A 1PFSA 4IPCA 1PH1A 4JI0L 4C3IH 4DR2L 2R7ZH 2UXDQ 3KDFB 3BZKA 1JMCA 2KENA 1TWCH 2I5HA 1VQ9A 2Q2UA 4DNIA 3A74A 1PA6A 1GD7A 3ER0A 4DV6L 2UXBL 4MZ9A 1HNWQ 1SMXA 2NVXH 4AQYL 4GLXA 1RIPA 1U5KA 2FXQA 4NXNL 1SFOH 2BA1A 3RLFA 4NB3A 3I2ZA 1HR0W 4A3LG 3UDXA 2AHOB 1N8RC 1YHBA 4PZ7A 2MNAA 1VQMA 1MJEA 2UUCQ 1WJJA 1Q8KA 4O0AA 2QGQA 4B3TQ 1YEZA 4PG3A 1D7QA 1RL2A 5GAHC 1L2FA 3PIPA 3HOYG 5C44H 1J5EL 2UXCQ 2CQOA 5H1SE 4LUOA 3TS2A 2KHJA 1L1OB 1NBWA 5EAYA 4JBKA 4HIMA 4C2MH 2CCZA 3A5ZB 3KDFA 3PUXA 1VQ4A 4A3BG 1WI5A 2NN6I 5M3FG 2PI2E 1B7YB 5GADC 1XMOL 2OQ0A 3D0FA 3S1QH 4AH6A 1YZ6A 3CF5A 3GDEA 2K75A 3S24A 1VQLA 1IBML 1HZBA 1CSPA 1PV4A 1WCMG 5FLMG 3T1HL 4YCVA 4A3EG 5JJIA 1FGUA 2JEBI 1EQRA 1NE3A 4BXXG 4JI1L 3MXNB 5C3EG 1XNRL 4A3LH 2AMCB 4UP7A 4DV1L 3JAMi 2QA4A 1X65A 5E7NA 2RHSB 2E2JH 2NVQH 1KQSA 2GVBA 1HNZQ 1VQDA 1Q7YC 3U50C 3HOYH 1VQJA 4K0KQ 1Y1WG 2IX1A 4LNQA 1L1OC 1NMGA 4PZ6A 4QL5A 1IBLQ 4LF5Q 3CCJA 4LF7Q 3I4NH 1VQ8A 1GVPA 1EUJA 2PNHA 4QQBX 4B3SL 4JOIA 4BY7G 4IJLA 4KHPL 3TRZA 2JA6H 1X54A 4KLKA 3PO2G 4EQ5A 4YHHQ 3H3VI 1EOVA 4L5TA 3UE0A 4DR5L 2K5NA 2WB1E 3L2PA 1WCMH 4X62L 4JOIC 2VNUD 4HJ8A 3EBEA 1WOCA 2B3GA 4LFAQ 4A3EH 2YV5A 3PGZA 3PUVA 3U4VA 2RF4A 5C4JH 2K52A 5C3EH 3CMEA 1T9HA 4GOPB 3T1YQ 1UEBA 3D31A 1HR0L 4DK6C 1AH9A 4APVA 4A3MG 1N33L 3U58A 2AKWB 4AYBE 4JI3Q 3KLWA 3GTKH 2N8NA 3PUYA 1W3SA 3PSIA 4JV5L 2IHEA 2OTLA 3PIOA 2JA9A 1Y1WH 2JA8G 2ZM6L 3RZOH 5IP7G 1UE5A 4DR6Q 1VQPA 1VQAA 1SRUA 4DUZL 4IPGA 1XPRA 4POGA 2QEXA 1PH8A 5ELNA 1KRTA 1N36L 2F4VL 3KF6B 4BY7H 1H95A 4JG2A 1CKMA 2HQLA 4DV4Q 1YBYA 5JEAG 1N34L 2UU9Q 2ZJQA 3J81j 4PMWA 1Q81C 1P8LA 4A93G 1GO3E 3K8AA 3HKSA 4JC0A 5IY0A 2ES2A 4KHZA 4GOPA 3RZDH 4LF4Q 2UUAQ 3OTOQ 3CCLA 5DLQE 4GLAC 1I94L 2KCMA 3STBD 4JI6L 2IX0A 5IYDH 4LF6L 1PH7A 3GO5A 4GOPC 2Z0SA 1IBKQ 2UUBL 4A3MH 3GTPH 2E2HH 4JI2L 1E1TA 4GKKQ 3K7UC 3M7NA 5GQOA 1QVGA 3AEVA 4R4OA 2JA8H 4LFCQ 3S2DH 3CC2A 1U0LA 5HY6A 4R4TA 3CCSA 4GKJL 1N32L 1NTGA 4DR2Q 2WB1G 1Z47A 1VQKA 1QVCA 2KBNA 3B6YA 4GN5A 4C3HH 1IL2A 3UDIA 1K0RA 3PCOB 4JI5L 4GN4B 5C44G 3DLLA 1XJVA 1PYSB 2HIXA 3U4ZA 1VQ6A 1S3OA 2H5XA 2AWNA 2NZOA 2ALYB 4JI8L 1HNXL 2UXBQ 1PH5A 4A93H 2R7DA 3AFQA 2E5LL 2F52A 2IHFA 1W2BA 1FJGL 3STBC 4AYBG 4DV2L 1YIJA 4NXNQ 4IFDJ 1G6PA 2I5MX 4LF9L 2R93G 2MO0A 1KIXA 2I0QA 2E8GA 1XPOA 1Y1VG 3DM3A 4MNOA 3PUWA 4YY3L 2IT1A 2YTXA 2DGYA 2OTJA 1TXYA 4GS3A 2A19A 2JK8A 3G71A 1EYGA 4P75A 2WAQE 1X55A 2GVAA 2N49A 1X3FA 1TWAH 3NEMA 3A0JA 4J15A 4A3DG 1PVOA 4DR3L 2Q2HA 3FHWA 1VQIA 5M5XH 4LUZA 3CP0A 4LF8L 5C0XJ 1PH4A 4WJ3M 3GD7A 4HJ5A 1IBMQ 1X6OA 3I4NG 2D0PA 1XMQL 1XTDA 3NELA 5BR8L 3HFZB 3CCQA 4JYAL 4DPGA 1KXLA 4DK3C 2VQEQ 2GN5A 3W5OA 3K80C 3PO3H 1I6HH 2BH2A 3ERSX 2WFWA 1TWGH 4JI1Q 4DR1Q 1VQGA 2HHHL 1BBWA 1XNRQ 1L0WA 2JA6G 3I4MG 3W1GA 2UXDL 2R93H 3CCVA 4DV1Q 4DV7Q 1Y1VH 4H02A 1X9NA 1LYLA 3CQZH 4LUVA 1YJNA 2VQFQ 3GTGH 1X3EA 3KF8B 5LMUL 4WJ4A 2A1AA 3M9BA 3G6EA 1E3PA 3NBHB 1OXSC 5LMNQ 3MEFA 3CMAA 3F2DA 2HT1A 1IXRA 1J6QA 1MIUA 3I55A 4R1JA 4UY8C 4XIGS 1BVSA 1Q46A 2C35B 3AYHB 3S14H 3S16H 4DR4L 4A3DH 1L1OA 1E1OA 3TS0A 4OO1G 3UDGA 4KHPQ 4GN3B 3RLNA 4B3ML 4B3TL 2R92G 4IPHA 3J80i 1EIYB 5IP9H 2VS1A 3S15H 1EFWA 2UXCL 1X3GA 1Q1BA 3BJUA 4X62Q 2I5LX 1SN8A 4X64Q 2Q2IA 1HZAA 1TWFH 4JI7Q 1YJ9A 4DV3Q 4X65Q 2L15A 3H0GG 2R7FA 1A0IA 1LM0A 2ID0A 1D8LA 3TQYA 2WAQG 3I4MH 2YYZA 2VW9A 4HJAA 3KFUA 3M4PA 4YWMA 4A75A 4X66Q 3CCEA 3RN5A 1GM5A 3HOUH 2BA0A 2XGTA 3JC66 4JV5Q 1UE6A 2PQAB 4OWTB 2HIVA 3JAMc 1VQ5A 1HH2P 2ZM6Q 3F1ZA 1S40A 3AFPA 1DGSA 1PH2A 5IYDG 2A8VA 4A3JH 1VQNA 1TWHH 3CD6A 1A8VA 3W1BA 3KJPA 4LW1A 1B8AA 3A5UA 3ICEA 5JJKA 4P71A 1N36Q 1C7YA 1I5FA 4P74A 1NMFA 1QUQB 5IT9c 5IWAQ 4BY1G 1N34Q 4JBJA 1K73C 2R92H 3I7FA 1CUKA 1LUZA 1VQFA 1VQHA 1KRSA 1EWIA 1X56A 2XTIA 2YTVA 4R4IA 2CFMA 4DR7L 1VQBA 1LTLA 2EXDA 4KI0A 4L5SA 1WFQA 2JEAI 3FKIH 1YJWA 4LF5L 3GTOH 2OWOA 3I56A 4LF7L 4LFBQ 1G51A 2NVTH 4Y52H 1I94Q 2Z6KA 3H0GH 4L5QA 3GTQH 4LF6Q 4JBWA 3HKZE 4HJ7A 4O2DA 3ULLA 2JA7H 4JI2Q 4HIOA 2OQKA 2Z6KC 2R6GA 4YHHL 5M3MG 1OTCA 1ASYA 4L5RC 4GNXB 1C0AA 2AWOA 1JT8A 4YWLA 4LFAL 3ZJYC 3M85A 5FLXc 3Q8DA 1Q86C 2CWAA 4YCUA 5FJ8G 3HOVG 3CPFA 1N32Q 4JI4L 4OX9L 4LFBL 4DAYB 4B3RL 5ELOA 3ULJA 3LGJA 1FL0A 1PH6A 3ULPA 1JB7A 4BY1H 4RG1A 4DUYQ 1M1KC 1OXUA 3J81i 3HOZG 1JJGA 4ALPA 3KF6A 2MFIA 2MO1A 4DV2Q 1HZCA 1KL9A 3M4QA 4QGUA 4JI0Q 4NXML 4EX5A 1G291 1EQQA 4DR6L 1HJPA 3OW2A 2Q2TA 4LF9Q 1UE7A 1ASZA 1S72A 2EQSA 3HOWH 4GNXA 4DV6Q 4P73A 4BBSG 4DV4L 2V1CC 2UU9L 1JJ2A 3K0XA 3PO3G 4AQYQ 2K14A 5M3MH 1N9WA 1MKHA 4OO1I 1IZ6A 3AQQA 3VDYA 4GNXC 5AJ3L 4A3GG 1SLJA 3S17H 3M3YH 2VY3A 3CAMA 5IE8A 2UUAL 4LF4L 3KJOA 5FJ8H 1UWVA 4DR3Q 4MTNA 1M90C 3HOVH 3K81C 4DV0L 2ZTDA 4LF8Q 1J5EQ 2N3SA 1OXTA 5LMNW 1K83H 4IO9A 4A3CG 2Y0SE 3RNUA 4JYAQ 5BR8Q 1YHQA 4XTCS 3HOZH 1SROA 1CSQA 3HKZG 4OXPA 2K50A 1WYDA 4LFCL 1XPUA 3GTLH 2HHHQ 1JJCB 5IYBH 5K36G 2DUDA 3J7ZC 2YTYA 1XMOQ 3PF4A 4HJ9A 3OYYA 1XNQL 1E7ZA 1VQ7A 4BA2I 3EN2A 5JJLA 1IYJB 1A63A 5IP9G 4IFDG 1P16A 1OXVA 3KOJA 4DV5L 2KHIA 4NPSA 3T1HQ 4BBSH 4HIDA 5LMUQ 4R4CA 2WP8J 4A3GH 3CC4A 3M4OH 4AIMA 4DR4Q 4QY7A 2LXKA
chains in the Genus database with same CATH superfamily
1SEBD 2ZJRA 3HOUG 1I4RA 1BBUA 3HOXH 2L5TA 5GAEC 3PV0A 5D3IB 3A8JE 5I2XA 1EY6A 1EL0A 4Q0FA 3Q24A 4A3JG 5KYLA 4OHJA 2YU9B 5M9OA 1MJCA 5K36H 2EJFC 2X69A 2E2JB 3EA6A 4RCOA 4DNTB 4HIKA 2F0FA 1L0XB 1LTGD 2BE5D 2OT2A 1EIFA 1QZHA 3TSSA 1S5ED 1BKBA 2LKVA 5I2YA 3IRBA 2VQEL 1VQEA 2HDLA 2PO4A 5FOBB 3MXUA 4N9TA 3EIVA 4BBRG 2KCTA 3MVVA 1SR3A 1CA5A 5DEHA 1GKHA 1FR3A 5M5YH 2NZ1D 3SE0A 4WJWA 5C3EB 3J80c 1Y14B 4ZAIA 3VYRA 4YCWA 1QNUA 3S1NH 5HGQA 5G3LD 5CBEE 3TEHB 3NPPA 2RCNA 2KEDA 5FLMH 1KAWA 1QG7A 4X64L 2WKDA 2F4IA 3PUZA 2K5HA 1MI2A 1B50A 5LL6S 1QZGA 4DV3L 2KCNA 3MEHA 1VQOA 2UUBQ 4JI4Q 4JBMA 1YVCA 1F9RA 2QCPX 2SNMA 2ZTCA 5CBAE 3VR5A 1GUGA 4UPAA 1IKLA 1YNXA 1BOSA 4GKJQ 2JN4A 2K28A 3F8TA 1K3BC 4JI5Q 2CKZB 1SNPA 2RA4A 3H6MA 1PTOC 4JI3L 2FHTA 3RN2A 1CKOA 3GP7A 4DGZA 1RD9D 1J8IA 4FVMA 4POFA 1A62A 2E5LQ 3S2DB 3CCMA 1S4ZA 1Z6HA 3NXWA 1ZYRD 1JE5A 4OIKA 2F03A 2VUMB 4A4IA 5C0XI 1CI3M 4ME3A 2CW0C 1DOMA 4IJHA 2N78A 2IW3A 3LWEA 4A3FH 3FMCA 4N8X1 4PZ8A 2R7ZB 4BA1I 3OTOL 1I50H 3QG1A 1TWCB 1G91A 1E2WA 2A69D 1V43A 1DM0B 1JB3A 3CC7A 4RAUC 1QCBD 2XRSD 1EFID 4GKKL 1A6XA 1K9MC 1EY0A 2B63H 4IOCA 4QB4A 4DUYL 1ENCA 1PH3A 2L4NA 4JI0L 4KHVA 2OEOA 5C44B 4DNIA 3A74A 1PA6A 1GD7A 3ER0A 4DV6L 1HNWQ 4H44C 4KN4C 4AYBB 1U5KA 4NXNL 3I2ZA 3QOLA 4FF3A 1YHBA 4PZ7A 1YEZA 4PG3A 1SYCA 4J1MA 1L2FA 3H91A 2UXCQ 2CQOA 4KY5A 1K8MA 3TS2A 2KHJA 4HIMA 4C2MH 1ONLA 1E2VA 1EOTA 1HQRD 2A73B 3PUXA 1WI5A 3I8ZA 2PI2E 1XMOL 5GADC 5T1IA 3HOYB 1FYCA 2K75A 1DOKA 4M8AA 2J7ZA 2PZUA 1EQRA 4UHVA 1WVLA 5C3EG 5FO8B 4FF1A 3J81L 3JAMi 2QA4A 2A6ED 1HUNA 1WCMB 4XYQA 1HNZQ 1A2TA 1B9MA 1L1OC 1NMGA 3CKIB 1GVPA 2MJ8A 2PNHA 2RSOA 5E1FA 2R3ZA 1HTLD 3OPOA 2K01A 3C1FA 4KHPL 1AFPA 2JA6H 2R92B 1ILQA 2ICIA 4EQ5A 4L5TA 4DXFA 2SDFA 5CYUA 4X62L 1NAPA 4A3EH 2YV5A 3J7AF 3PGZA 3U4VA 2RF4A 2K52A 3H0GB 3D31A 5COYA 4APVA 2AKWB 4AYBE 1K28A 4X3KA 1KDAA 4G7ZC 5IP7G 5DM63 1UE5A 1VQPA 3D4DA 1XPRA 1XTCD 2B2TC 4POGA 2E74C 1KRTA 2DJGC 2QEJC 4HTHA 1N36L 4JG2A 5C5MA 2Z9HA 1EEFD 5ELEA 4E6IA 3HKSA 2F0GA 2UUAQ 4LF4Q 1VF7A 1SE4A 1I94L 3I3CA 3STBD 4LF6L 5CV9A 3GO5A 1PH7A 4GOPC 2UUBL 3K0YA 2E2HH 3VA5A 3N6RA 1AN8A 3M7NA 5EKIA 1QVGA 2JA8H 1F2MA 1U0LA 5HY6A 4GKJL 1YNJD 2NTTA 4C3HH 1H9SA 3B6YA 1IL2A 5C44G 4JI5L 3DLLA 4GN4B 1LV9A 2PCFB 5JEAH 2H5XA 1B4OA 2AWNA 2NZOA 2UXBQ 3DM1A 1PH5A 2R7DA 2E5LL 3WOEA 1W2BA 4AYBG 4DV2L 2I5MX 5M5XB 4LF9L 1IYVA 4BWGB 1KIXA 2CH4A 1Q90A 2LMCB 3PUWA 4GS3A 3MAQA 1X3FA 1TWAH 4S3SA 3FHWA 3GTGB 1VQIA 3HG9A 4WJ3M 1V1OA 3E5SA 2TSSA 1X6OA 4F8MA 4JYAL 5BR8L 3CCQA 3TP5A 4DK3C 4A3DB 3CRKC 3PQIA 1VQGA 1BBWA 4RH6A 1L0WA 5EPLA 5KGUA 4DV7Q 2KECA 1EQVA 1Y1VH 4XYOA 1PLFA 4ZLTF 1KNEA 1TY0A 3KF8B 5I4DA 4WJ4A 1SBBB 3G6EA 5LMNQ 1GHKA 1X32A 1IXRA 1MIUA 3NWSA 4R1JA 1ET6A 3H94A 4XIGS 1Q46A 2EPBA 1L1OA 1E1OA 2A74C 4GN3B 3A7LA 2R92G 1NSNS 5ELCA 4IPHA 1EIYB 5IP9H 2VS1A 2UXCL 3GV3A 3W2DA 1TWFH 4JI7Q 4X65Q 3H0GG 1ZKOA 2R7FA 1LM0A 3TQYA 1D8LA 3M4PA 3SXHA 4YWMA 3S1NB 3FPUB 4LAAA 4NMZA 2WKCA 3MXNA 1JQYD 2BA0A 1PRTB 4IUTA 2HIVA 2RDFA 1S40A 2KA7A 1PH2A 2PZTA 4HN7A 1UEAB 1A2UA 3OIPA 3KJPA 4LW1A 1F2YA 1IHZA 3A8KE 1D5XC 2RDHA 2EYHA 1N34Q 2HD3A 1K73C 1PH1A 1VQFA 1X56A 4PV1C 3FKIH 2OWOA 3I56A 1G51A 2Z6KA 1A3TA 3JAME 4L8JA 4JBWA 3ULLA 2JA7H 3DXJC 1OTCA 2F0IA 4L5RC 1ASYA 1Y8PB 4GNXB 4TSSA 2I46A 2CWAA 4LFBL 5EPKA 4DAYB 1ICWA 5FO9B 3ULJA 1RTNA 5JVH3 1FL0A 3TMEA 4A3FB 3ULPA 1Q3LA 5FO7B 3V05A 3J81i 1JJGA 1JORA 4ID6A 3T4AC 1I50B 3KF6A 1HZCA 1X3QA 4NXML 2XWBB 4ME5A 2EYJA 3OW2A 1CTMA 1BCPF 3HOWH 4O1NA 5FLXE 2B63B 1MSHA 1MKHA 4OO1I 1QJOA 3VDYA 2M2LA 3TP6A 3M3YH 4IALA 2UUAL 4LF4L 1K8OA 3QR8A 3HOVH 4ULLA 2HUGA 4X3SA 1BR9A 5IT9L 3Q0AA 2B39A 1K83H 4IO9A 3M7GA 4XTCS 2EY1A 3N52A 2O4XA 5EGTA 1JJCB 1B53A 5IYBH 5K36G 1LO5D 1JWMD 1STHA 3EN2A 4HCEA 1CQVA 1OXVA 1EIGA 2KHIA 3MA2B 4XQQA 1YNND 4C2MB 3VYUA 3DWAA 4DU9A 1NR4A 2WP8J 3K6OA 3ITPA 2FMCA 4HJ5A 1WTPA 4L63B 4MHEA 1I3QB 1IW7C 4A3CH 2LXJA 2OCEA 5F2DA 5I6YA 3CCRA 1PH9A 4DKAC 2UUCL 3DMUA 2EYLA 1QB5D 1Y8NB 4IFDH 4C56C 2E75C 3G48A 4DR5Q 2KUMA 1B70B 2F0VA 1YITA 2PMZB 4EQPA 4A3BB 1CKNA 1KHIA 1O7IA 5M3FB 4B9XA 4MN3A 4U68A 1N33Q 3NBHA 1HZ9A 1FNUA 4DV7L 3SK5A 4GLVB 2JYOA 1KTKA 2XRQD 1VMCA 3Q6SA 2NB0A 4A3EB 4DR7Q 1WTRA 2P5ZX 4LWCA 5LMNL 4A3IH 4CHTB 3TDQA 5C4HA 3J7YW 4BBRB 2F3IA 2ZXOA 1SE8A 1PTOB 4K2LA 1YI2A 5FKAC 1AE2A 1A3UA 3L0OA 1DOLA 1CT1D 1PYBA 1V1QA 2XSCA 3D6CA 1HA5A 3WDNA 2K6AA 1DONA 4FO2A 4HAEA 5J3BA 5JEAJ 4JI7L 2PPBC 3AU7A 2BDNA 4X65L 4BXXH 2D62A 5C4ZA 3GTMB 4C3JH 3WWVA 2PQEA 4A3FG 4A3KH 3GTJB 4F88A 2NN6G 1HA6A 1GOZA 1I4QA 3IAYA 4TVAB 4Y7NH 3URYA 3T1YL 2JE6I 2JQOA 2TMPA 3G4SA 2B63G 4OONA 1TKWB 1H9SB 3PO2H 1Q82C 2JA8B 3OMCA 4PMBA 2E2IH 5AJ3Q 3FEWX 4JCVE 4CBVA 4C3HB 5C4XH 3MXGA 4DV0Q 3F2BA 1K8GA 2MQHA 3CXCA 1ZEQX 2PMZE 1BUVT 3SR1A 3C2PA 4C3IB 1SNCA 2O5IC 1R9TH 2ZTEA 3QIAA 2PW5A 1VDZA 4JW0A 1SYGA 2JA5H 4DV5Q 1SFOB 3F2CA 1KD1C 1K3RA 4TQUS 3D4WA 4UP8A 4RGTA 4RCNA 3FVQA 4IZ8A 5E3FA 1A15A 5DM73 3E0JA 2DY7A 1STEA 1HFNA 2KENA 1VQ9A 4ILWA 2Z4HA 4MZ9A 3J81E 4CGYB 1FGBD 2NVXH 1HR0W 2BA1A 1MBYA 1Q8IA 4NB3A 3FPPA 2AHOB 1MJEA 2F0LA 4B3TQ 2FINB 2IWHA 1L1OB 2F0KA 2F0EA 1CA6A 4HMIA 3I73A 4JBKA 5ELBA 3A5ZB 3KDFA 2EXZA 1VQ4A 4A3BG 5IGEA 5M3FG 1STNA 1NUCA 2B2VA 2OQ0A 3S1QH 1YZ6A 2DNEA 3CF5A 3GDEA 2X6LA 4DN4M 1VQLA 3I4NB 1CSPA 5BN4A 4A3EG 5JJIA 1WTHA 4BS9A 1TWFB 1O80A 4H0LC 3MXNB 4B9WA 1TS3A 4NW2A 4A3LH 4FYDA 2AMCB 2CQAA 2F1MA 2NVQH 2ZT9C 1VQDA 4K0KQ 5C4JB 4LNQA 1IBLQ 1TU2B 3EFXD 2E76C 3GTKB 4IJLA 3TRZA 3H3VI 4K8IA 5KYIA 3DWQA 1MSGA 3S9WA 2WB1E 1B9NA 4NP5A 4DR5L 2VNUD 4HJ8A 4LFAQ 2A68C 2O5JC 4GOPB 1AH9A 1N33L 5C3WA 3U58A 1SNDA 2F3WA 1JC7A 3DUZA 2N8NA 3PUYA 2IPKD 2IHEA 2OTLA 2JA8G 2JA9A 4J8QA 1Y1WH 3RZOH 4DAPA 1VQAA 4C3HG 1R4PB 3NTIA 5ELNA 3UI2A 3KF6B 4BY7H 4DV4Q 1CKMA 4FXDA 5JEAG 2UU9Q 2ZJQA 3J81j 4PMWA 1NR2A 5G3LF 1P8LA 1D5MC 5C6AA 4DAVA 4JC0A 2ES2A 4C3IG 4KHZA 3RZDH 3CCLA 5DLQE 2IX0A 5IYDH 1EEID 1GUTA 1IBKQ 1SYDA 2NTSA 4FF2A 4A3MH 3GTPH 1CHQD 4JI2L 2O2LD 3BVMA 5GQOA 2PZWA 3WOFA 2HCCA 4RGOS 3M3YB 3CC2A 1BCPC 3LNNA 5EBCA 1DCZA 3HOVB 1N32L 1NTGA 2MPMA 4DR2Q 2WB1G 1QVCA 1U4MA 5KNCA 2HIXA 1VQ6A 1KLUD 4WFN3 1M8AA 2A5HA 1U4PA 3IFDA 3SK4A 2MHVA 2IHFA 4CKBA 1G6PA 4IFDJ 2HQEA 2QKIC 3OWFA 2AQ3B 4CJ1B 2MO0A 5J39A 1BO0A 4K5WA 3E3XA 1XPOA 1Y1VG 4MNOA 3VR4A 2YTXA 1S5FD 4QCLA 1AW7A 4XXEA 1D1KA 2JSOA 1X55A 1EYDA 2N49A 3K5LA 1TY2A 2D9UA 3NEMA 3NK9A 5DNFA 4CJ2C 3K5NA 2RCFA 4HSVA 1T5XD 4LF8L 2EYPA 3IKJA 3QWNA 1STBA 3KBGA 4KTAA 4QUFA 1IBMQ 1RODA 4B08A 1I4GA 3I4NG 2EOTA 1XTDA 1KXLA 1RDPD 5I6WA 3K80C 3PO3H 1I6HH 2JP1A 2WFWA 1TWGH 4JI1Q 3TZUA 3R8BA 1XNRQ 3CCVA 4DV1Q 3S15B 1Y8OB 1X9NA 3CQZH 4LUVA 2OF1A 2VQFQ 1X3EA 4H7BA 3M9BA 1E3PA 3NBHB 3F2DA 3I55A 1J6QA 2ZXRA 3S14H 1F2LA 1GHJA 3S16H 4DR4L 3QOJA 4DXGA 4B3TL 2G9DA 1CM9A 3SK6A 1V1PA 1PZID 1Q1BA 3BJUA 4KKSA 4GZYC 4A3IB 2BOSA 1I4XA 2L15A 2XNAC 5D65A 1O7YA 1A0IA 2WV6D 2ID0A 1KDCA 1EQTA 5C5LA 2VW9A 3KFUA 4C1NK 2M9VA 1L0YB 5IGBA 4X66Q 4ZK9B 3HOUH 3JC66 4JV5Q 1SJED 1UE6A 4OWTB 3JAMc 1HH2P 2ZM6Q 3TP7A 3GV6A 3MFYA 5CV8A 4A3JH 1PRTD 3BVGA 2B2YA 3W1BA 2CVRA 4C3JB 1UNSA 5JJKA 4P71A 1B1ZA 1I5FA 4A3KB 1NMFA 1II3A 1LUZA 1VQBA 1LTLA 2EXDA 1WFQA 2K1BA 4RA8A 4DF7A 1DZ1A 1Y69U 3GTQH 1SMYC 4DNRB 2FFKB 3DHQA 2Z6KC 4FP5D 4PNYA 1E2ZA 2EJGC 4ABNA 3K5MA 2NYZD 2PNRC 3A7AB 4LFAL 3M85A 5FLXc 5IT9E 5C4XB 1TS2A 3HOVG 4JI4L 1F2ZA 1RF2D 3LGJA 3RUZA 5D3DA 1JB7A 1LT5D 2RSNA 4RG1A 1I4PA 3S17B 4QGUA 1G291 1S72A 4ZUIA 2JA5B 3QO2A 4DV4L 2M00A 2UU9L 3GTLB 1JJ2A 2K14A 5M3MH 1D1IA 2K7VA 5FJ8H 4DR3Q 1M90C 2NBFA 2ZTDA 3T51B 5JJZA 4A3CG 1RTOA 2BCOA 2Y0SE 2NVXB 2L9HA 4IUPA 2N55A 1CSQA 3OOCA 4OXPA 1H9JA 1WYDA 1XPUA 2HHHQ 1C4QA 3PF4A 2F0NA 3HOXB 1WTQA 5JJLA 1IYJB 4IFDG 5EQ0A 5IIFA 1P16A 2A6HC 1WD1A 2FMMA 4NPSA 2J4XA 3T1HQ 4BBSH 4HIDA 5LMUQ 2K5DA 4Z9CB 1CFMA 1EY5A 5HURA 3M4OH 3S1QB 2QDBA 3OWEB 3H3VH 2XWJB 2J0TD 4ZKBB 3NENA 1BNZA 4B3MQ 1HNWL 1Q12A 1BQQT 2VB3X 4A3IG 3I72A 3I4LA 1VQCA 4B3SQ 2K05A 3L7ZC 3S1MH 5M5YB 4N9PA 4QIWE 2HDMA 1MGSA 4DK1A 3HEJA 1HPCA 1KC8C 4IPDA 3D3RA 2LS01 3CHBD 2MGSA 3X3MA 1EYCA 1KAAA 2Y0SG 2NVYH 2YU9H 2I07B 1SYFA 4C3JG 2AUKA 3IL8A 4A3KG 1JWUD 2VQFL 2EIFA 2RDGA 1PFBA 4UP9A 2LY7A 3DEOA 2K5VA 5C0XH 1X3PA 1NY4A 4CJ0B 2Z6BA 5T1GA 4KD4A 2H4OA 2F4VQ 4HSPA 4XDXA 4RMFA 5JOBA 1HNZL 2VL6A 5CORA 3T53B 1PTOD 3AMUA 1JICA 3RZOB 3KK7A 1GUSA 1PZKD 4QMGA 3L3OC 2D0OA 5C4XG 1IYUA 3CU7A 3PF5A 4OX9Q 3G6JB 4BY7B 2PQAA 3SHLA 4B3RQ 3RLOA 4RHRA 1K0SA 2K32A 2H1EA 1M4VA 2CW0D 4X66L 4C1NI 5KEEA 1H9MA 3NSWA 1QILA 1E22A 3P75A 4X6AH 1DD2A 3E9HA 1SDFA 1E24A 4ODGA 2SOBA 3BU2A 3TREA 1BCPD 5LL6X 2JA5G 5DAUA 2KQ3A 1HNXQ 2AUJD 5NUCA 2IJ0A 4K5VA 3J7AV 4OIJA 4WRDA 3MZ5A 2JJQA 2SEBD 1R4QB 4FDBA 5GROA 2IY5B 4YY3Q 3A54A 3P1HA 4NDXA 2ATWA 1SYEA 1VS0A 1ESFA 3SVMA 1EIHA 3NQTA 1U9RA 4OWXB 2LSSA 1EWCA 3RR5A 3J80L 5LHY1 4V190 1BDOA 1GXDC 2BH8A 2C9OA 1V9PA 5IP7H 3HOXG 1AE3A 4R4QA 3J81c 1XNQQ 1ESRA 4HMJA 5M5WH 4IOAA 1XX8A 2PI2A 2VUMH 5IYCH 1EYAA 1XMQQ 2L1BA 4XT3B 4X3UA 2EDGA 4K6DA 1JCKB 1ZYRC 4CDDC 1PHJA 2Q8RE 3VYSA 4U673 1WTXA 3BVZA 2UXDQ 2R7ZH 4CKCA 3BZKA 3HP3A 1GUNA 4K6LA 1TWCH 2I5HA 2Q2UA 4JK1C 3PIO3 4OELB 5EPJA 2UXBL 1CZWA 1SMXA 1I6HB 4GLXA 2FXQA 3NWTA 4A3LG 3TP8A 1VQMA 2MNAA 1ET9A 1O78A 1NNXA 1WJJA 2L55A 2WINB 1MD2D 4O0AA 1D7QA 1RL2A 5C44H 3EQLC 1SNOA 5H1SE 3BDOA 1HQMC 5EAYA 1TQOA 5IGCA 2CCZA 1GUWA 2EY2A 3S16B 5JVG3 1ENFA 2NN6I 3BS1A 1PFMA 4AH6A 3S24A 1LT3D 3LX0A 2KCCA 1G6ZA 1PV4A 3C3LA 5FLMG 2B2VC 2RBMA 3T1HL 1WD0A 2JEBI 2JA6B 1DYQA 5CV6A 1X65A 2RHSB 4PQXA 3FDTA 2ZXPA 5TSSA 1CQFA 3I90A 4MTKA 4R9WA 4G57A 3U50C 3HOYH 4HEDA 1Y1WG 2IX1A 3FRPB 4PZ6A 4LF5Q 5ISRA 4LF7Q 1VQ8A 3AB9A 4R8NA 3GQBA 4QQBX 4B3SL 4KN7C 4JOIA 4BY7G 2V4DA 4P2CB 2SNSA 1X54A 1EOVA 3A55A 5J1ZA 1O7LA 3L2PA 1TR5A 1WCMH 1SYBA 3ND9A 1SMYD 3M4YA 3PUVA 1T9HA 1UEBA 2AQ2B 1JE4A 4A3MG 4X3TA 4JI3Q 2EJMA 1T5EA 2F0HA 3NHHA 3PIOA 1BCPB 2RVLA 5E4WC 4RGNA 1CHPD 4I65A 4IPGA 2E2HB 3BDLA 2IX3A 2QEXA 2F4VL 1H95A 2NUCA 1YBYA 1N34L 1JOOA 2G5DA 1LTRD 3R3OA 1Q81C 1GO3E 3OTOQ 3R93A 4GLAC 3A56A 1Z7TA 2Z0SA 2VXWA 2K5QA 1E1TA 1F9QA 4GKKQ 3K7UC 5HGTA 3AEVA 4J6HA 1QE6A 1S5CD 2Z8LA 3ZYYX 1ZXTA 2D2CC 1VQKA 2KBNA 1SNQA 1PFNA 5L37A 3PCOB 1XJVA 4FNFA 1PYSB 2F0TA 2K04A 3U4ZA 4EQOA 3OSOA 1PDQA 1HNXL 1TWAB 1HXYD 4IUVA 3K57A 2EY5A 4A93H 2F52A 3STBC 1YIJA 1STYA 2WB1B 2F0QA 4NXNQ 2C5CA 2I0QA 2E8GA 2BDOA 2GA4B 2IT1A 2DGYA 4YY3L 4BBSB 2OTJA 1TXYA 3D6WA 2JK8A 3G71A 1PYWD 1EYGA 3ND8A 3EROA 1JWSD 1EU3A 1YNJC 2HCIA 1KLGD 1RJTA 3A0JA 3G7LA 4J15A 1Y1VB 3LWUA 5IGDA 3BG3A 3CP0A 5M5XH 5C0XJ 1PH4A 4FXGC 3GD7A 1XMQL 1LLRD 1QOHA 4CDFC 3NELA 3HFZB 1F77A 2GN5A 3HKZB 1EU4A 2IL8A 4DR1Q 4CDEC 2JA6G 3W1GA 2UXDL 2R93H 4H02A 3OMGA 3GTGH 2K5WA 3NUCA 1SAPA 5IODA 1OXSC 3CMAA 3BZDB 4ZUJA 1V8QA 4UY8C 2NVYB 2RQXA 5CV4A 1BVSA 4A3DH 2QF7A 2F0JA 1WTOA 5BN3A 4KHPQ 2VB2X 3J80i 4LK1C 1LACA 1OO9B 1X3GA 4X62Q 4K8JA 1ENAA 1SN8A 2I5LX 2Q2IA 2XVSA 4UDUC 1YJ9A 4RFBA 1LABA 3I4MH 4KV6A 2YYZA 3KF8A 4HJAA 4A75A 3CCEA 3RN5A 1GM5A 4DK0A 2XGTA 2F0WA 3FKIB 2ENBA 2PQAB 1STAA 3O13A 3F1ZA 3AFPA 3OW7A 1TWHH 1A8VA 3MXPA 3BDCA 1AZPA 2JA7B 4G7OC 1PZJD 1B8AA 3A5UA 3ICEA 1N36Q 4OO1H 5IWAQ 5IT9c 4JBJA 2B2YC 2YTVA 3VA7A 2XTIA 4R4IA 4DR7L 3D8GA 4QF4A 4LF5L 3SDZA 3GTOH 4LF7L 2NVTH 2WACA 1I94Q 4LF6Q 4ZKCB 3HKZE 4HJ7A 3VYTA 4O2DA 1BXTA 5KIXA 4KY7A 5M3MG 2FJ2A 4JVZA 5EBDA 1F9SA 3I91A 2AWOA 2F0SA 1C0AA 2F3VA 1JT8A 3ZJYC 3Q8DA 1Q86C 3HOWB 1EY7A 5FJ8G 1B3QA 4OEMB 4KD3A 4RGMA 4ZQ3A 4BY1H 1OXUA 1S5BD 3OHXC 4ALPA 2MFIA 2MO1A 3ONAB 3C1EA 3M4QA 3T56B 4DV2Q 1XWEA 3F2UA 1EQQA 1HJPA 2Q2TA 2F0PA 4LF9Q 2MUYA 1ASZA 5M5WB 2F0MA 1K83B 2EQSA 4GNXA 1EZ6A 4BBSG 1SJHD 2V1CC 1TVXA 4AQYQ 1G8ZD 1N9WA 1IZ6A 3AQQA 5CMDA 5A2QL 4DAYA 5AJ3L 1SLJA 2NN6H 3NE5B 5IE8A 1S5DD 4Q5VA 4FF4A 2QW7A 3KJOA 2G9HD 4MTNA 4DV0L 3TN2A 1J5EQ 2EYFA 2N3SA 1JR0D 5LMNW 5K5PA 4G4KA 2PW7A 4JYAQ 5ELDA 3D4RA 2F0UA 5BR8Q 1QNKA 1W6JA 1YHQA 3HOZH 3HKZG 4EGVA 1IW7D 2K50A 4V0BA 2OXPA 4K2KA 3J7ZC 2YTYA 2K33A 1PXUA 1E7ZA 2B2UA 1A63A 5IP9G 1WTWA 3KOJA 4DV5L 1BBXC 4RKLA 4UAIA 4A3GH 3CC4A 1D6EC 4WORA 4KKTA 4AIMA 4QY7A 1CK1A 1K8AC 3OIQA 1CKNB 3CPWA 3FP9A 4IURA 3C46A 1UE1A 4A76A 3J7A5 2EVBA 5C0XG 1FVIA 1HRJA 4KJNA 1YHAA 3S1RH 3H3VC 1NCVA 1SSOA 4YIJA 1NJIC 1YNNC 3R2IA 2B8GA 3SEBA 1G2TA 5KNDA 3FKIG 2NZHA 2F0OA 4IUUA 3K5OA 3VR2A 1I3QH 1RKNA 1B3AA 3TBIB 4OWWB 4DR1L 2Q8TA 1HR0Q 3MHBA 2JA7G 5IOCA 1KNAA 1Q1EA 2PYKA 5E4XA 4YWKA 2Y0SB 1KDBA 4DUZQ 3E0EA 1VCIA 3E9IA 4A3BH 3I4OA 5C3XA 3BZCA 3SGIA 5M3FH 1LT6D 2L12A 4EQNA 4K0KL 1IBLL 4Y7NB 4ZCKA 3W3AA 4JI6Q 3TZDA 3HOWG 1ICFB 3MTSA 4LFBQ 3PIP3 3CCUA 2CWPA 1DJRD 4BBRH 3PO2B 1PTOH 2ICEC 3J80E 3K58A 2E2IB 1OXXK 1VMPA 3HRZC 1QVFA 4IFDI 4NXMQ 2K4KA 1QUQA 3ERQA 4O42A 1PRTF 4IQZA 1STGA 5IYCG 2VUMG 3GTMH 1C9OA 1A3VA 4JI8Q 3KLRA 5IWAL 4H13C 4HCSA 4IUNA 4CDCC 1WTVA 1R9TB 1FJGQ 5IYBG 4QIWB 2WIIB 3GTJH 2R7ZG 2RHQB 1SE3A 2ZJPA 5J22A 1Z9FA 3R2TA 3K7AH 3DWPA 3IFTA 4A93B 3S2HH 2D5DA 4I7AA 4P72A 3UE1A 5CC4A 2VZAA 3KYHC 1FD7D 4MIUA 2EZVA 1IBKL 1PMRA 3CW2C 2B29A 3UDFA 5GAGC 3H15A 1EY8A 4DAMA 4QJFA 2DJFC 4DFAA 3RD4A 5BN5A 4RKBA 2ASBA 2AQ1B 1SXTA 1PFSA 2XN9C 4LJZC 4IPCA 4C3IH 4DR2L 1LT4D 1EWHA 4K14A 3KDFB 1JMCA 5FK9C 1HHVA 3KUPA 2K03A 4AQYL 1RIPA 1ML0D 1SFOH 3RLFA 2R93B 3UDXA 1N8RC 1F9PA 2UUCQ 1Q8KA 5JPNC 4RHSA 2QGQA 2B8FA 4K5XA 3RMHA 5GAHC 3PIPA 3HOYG 1J5EL 4LUOA 1NBWA 3KBXA 2NVQB 1B7YB 1QWYA 1VF5C 3D0FA 5CR3A 1ILPA 4F7XA 4R8IA 1IBML 1HZBA 3CRLC 1WCMG 4YCVA 1FGUA 3I70A 4L6TB 1NE3A 4BXXG 4JI1L 4TKOB 2A68D 1XNRL 3I4MB 4UP7A 4DV1L 3MC0B 5E7NA 2E2JH 2EYOA 1KQSA 2GVBA 1Q7YC 1KABA 3KLSA 1VQJA 4QUCA 5ELFA 2X6GA 2Q8IB 3MWYW 3I4NH 4QL5A 4HR7B 3CCJA 1TWHB 1EUJA 2BE5C 2JXMB 2N88A 5KNBA 1IL8A 4KLKA 3PO2G 2QILA 4YHHQ 3VR3A 1XYIA 1Y1WB 3UE0A 2K5NA 4JOIC 3EBEA 1WOCA 2B3GA 1AP0A 1JOQA 2B2WC 3GTOB 1EY9A 2NVTB 5C4JH 5C3EH 3CMEA 2WAQB 3T1YQ 1HR0L 4DK6C 3BYYB 3H09A 1LTTD 5IGGA 3KLWA 3GTKH 3PSIA 3RZDB 1W3SA 4JV5L 4OGQC 3NBIA 1CZGA 2B2TA 4N8FA 5D14A 2ZM6L 2QDLA 4KKUA 4M1UB 4DR6Q 1E0BA 1SRUA 3EJIA 4A3MB 3GTPB 4DUZL 1PH8A 5I9OA 2HQLA 4BY1B 2KVMA 4RWSC 1PTOF 4A93G 4OL7A 3K8AA 5IY0A 4KMUC 4GOPA 1UAPA 5CV5A 3L9AX 4JPBW 5AFWA 4JI6L 2KCMA 1H9RA 1B2TA 1LTID 2LFNA 4ZRZA 2R61A 4R4OA 3Q23A 4LFCQ 3S2DH 1AZQA 3CCSA 4R4TA 5A35A 1TS5A 1Z47A 4GN5A 1DXMA 3UDIA 1K0RA 5JAVA 1GUOA 3VR6A 1S3OA 2F0DA 2ALYB 4JI8L 3HOZB 1HCZA 3AFQA 4KK7A 1FJGL 5JPMC 3V2TA 2R93G 2NWGA 3DM3A 2Z4IA 2EY6A 3PO3B 2A19A 1TWGB 4P75A 2WAQE 2DNCA 2GVAA 2A69C 2KJXA 4A3GB 4A3DG 1PVOA 3CQZB 2CH4W 2Q2HA 4DR3L 1XXGA 4KJOA 4LUZA 2KHSA 3A8IE 1AEXA 2RKSA 3PMFA 1U4RA 2D0PA 3K59A 5EKKA 4DPGA 5KRUA 2VQEQ 3S14B 1O7ZA 3W5OA 2BH2A 3ERSX 1V1PB 2HHHL 1SNMA 3SK8A 3S1RB 3I4MG 3U9SA 1LYLA 5EJWA 1YJNA 2EE1A 1RCVD 5LMUL 2L0CA 1RHPA 2A1AA 2DN8A 3MEFA 1I6VC 1EY4A 3T13A 2HT1A 4PMCA 3AYHB 2C35B 2CHBD 5CV7A 3TS0A 4OO1G 3HOUB 3UDGA 1U4LA 3RLNA 4B3ML 3MFGA 1G2SA 3EVQA 3BYTB 3DEPA 3S15H 1EFWA 3Q22A 4X64Q 4A3JB 1HZAA 4F87A 4DV3Q 2Z1CA 3E6ZX 4I7ZC 2B2WA 2WAQG 1FNVA 3QJYA 1MHWC 3QB3A 4XT1B 1VQ5A 1SE2A 2A6EC 2DY8A 3GTQB 1DGSA 4CKEA 5IYDG 2A8VA 4G7HC 3CD6A 1VQNA 2L11A 3NTHA 1C7YA 4P74A 1QUQB 2R92H 4BY1G 2KEEA 3I7FA 1CUKA 1VQHA 1KRSA 1EWIA 2XIWA 2EYMA 3U9OA 1BF4A 2CFMA 4L5SA 2JEAI 4KI0A 1YJWA 3V96A 4Y52H 3H0GH 4L5QA 1HTPA 4XQJA 1HUMA 1LTAD 5A2QE 4LMQD 4JI2Q 4HIOA 2OQKA 2R6GA 4YHHL 1PRTC 4YWLA 3P20A 4NKLA 3HZXA 3X3NA 3T16A 4IUQA 4YCUA 1N32Q 3CPFA 4OX9L 4DA2A 1FNWA 4B3RL 2KOLA 5ELOA 3K7AB 1D5ZC 4ZYSA 5M3MB 3HS0C 1PH6A 3S2HB 4DUYQ 1M1KC 3HOZG 3KLSX 4JI0Q 1IKMA 1KL9A 4FXKC 4EX5A 4DR6L 1TT2A 1UE7A 1TIID 4DV6Q 4P73A 5IGFA 4TRDA 3K0XA 3PO3G 3JAML 3NP8A 1TS4A 2A6HD 5CGKA 1C8CA 1LTSD 4GNXC 4XQNA 4EVOA 4A3GG 3S17H 3HGBA 2VY3A 3CAMA 3NQIA 1UWVA 3K81C 4LF8Q 1OXTA 4IN3A 1I4HA 2MP1A 3RNUA 1JOKA 3M4OB 1J9OA 1SROA 3GTLH 3NTKA 4LFCL 2DUDA 1XMOQ 1D2BA 1LTBD 4HJ9A 3OYYA 1XNQL 4BA2I 1VQ7A 2E2DC 1UUPA 3P7JA 5I9PA 4KY6A 1B44D 1EZ8A 2B2UC 4R4CA 1HFGA 1GJXA 5EKLA 1W6KA 1C48A 1H9KA 5FLXL 3S1MB 4DR4Q 2LXKA
chains in the Genus database with same CATH topology
1K8AC 3H3VH 2ZJRA 1CKNB 3CPWA 3HOUG 1BBUA 3FP9A 3NENA 3HOXH 4B3MQ 1UE1A 3PV0A 5GAEC 4A76A 4A3CH 2LXJA 1HNWL 1Q12A 3J7A5 2OCEA 5C0XG 4A3JG 1FVIA 4A3IG 1YHAA 3CCRA 1VQCA 1PH9A 1MJCA 4DKAC 4B3SQ 3S1RH 2UUCL 3L7ZC 3S1MH 4HIKA 1NJIC 3G48A 4DR5Q 4QIWE 1QZHA 1EIFA 1B70B 3FKIG 2NZHA 1BKBA 3IRBA 1KC8C 1YITA 4IPDA 1I3QH 2VQEL 1VQEA 1CKNA 1KHIA 1O7IA 4OWWB 4DR1L 2Y0SG 2NVYH 1HR0Q 1N33Q 2YU9H 2JA7G 1HZ9A 3EIVA 4BBRG 2KCTA 1Q1EA 4DV7L 1SR3A 4GLVB 4A3KG 1GKHA 2VQFL 5M5YH 2EIFA 4DR7Q 4UP9A 4LWCA 2K5VA 5LMNL 4YWKA 1NY4A 4A3IH 3J80c 4DUZQ 3E0EA 2F3IA 1SE8A 2F4VQ 1Y14B 1YI2A 1VCIA 3E9IA 4A3BH 3I4OA 1AE2A 3BZCA 4YCWA 4RMFA 3SGIA 5M3FH 1HNZL 2VL6A 3L0OA 3S1NH 5HGQA 1PYBA 1V1QA 4K0KL 3TEHB 2RCNA 1IBLL 5FLMH 1KAWA 4X64L 2D0OA 5J3BA 4JI6Q 3PUZA 2K5HA 5JEAJ 5C4XG 4JI7L 3HOWG 1QZGA 4DV3L 4BXXH 4X65L 3PF5A 2D62A 1VQOA 2UUBQ 2PQAA 4JBMA 4JI4Q 4OX9Q 3CCUA 1YVCA 2CWPA 4C3JH 4B3RQ 3RLOA 4BBRH 3WWVA 2ZTCA 4A3FG 4X66L 4A3KH 1OXXK 2NN6G 4UPAA 1QVFA 1YNXA 4IFDI 4GKJQ 1E22A 4X6AH 3E9HA 1E24A 4NXMQ 2K4KA 1QUQA 4TVAB 4Y7NH 3T1YL 2JE6I 2JQOA 3BU2A 2CKZB 3F8TA 3TREA 4JI5Q 4JI3L 2VUMG 5IYCG 2JA5G 3RN2A 1CKOA 3GTMH 1C9OA 1HNXQ 4JI8Q 3G4SA 5IWAL 4OONA 4POFA 2B63G 3PO2H 1A62A 1Q82C 2E5LQ 1FJGQ 5IYBG 2E2IH 3GTJH 3CCMA 5AJ3Q 2R7ZG 2JJQA 4JCVE 1JE5A 2RHQB 5C4XH 4FDBA 2ZJPA 5GROA 2IY5B 4A4IA 4YY3Q 5C0XI 4DV0Q 4ME3A 1Z9FA 3F2BA 1K8GA 2MQHA 3CXCA 2ATWA 3K7AH 2PMZE 4IJHA 1VS0A 2N78A 4A3FH 3S2HH 3UE1A 4P72A 4OWXB 2LSSA 4PZ8A 2VZAA 3KYHC 1R9TH 4BA1I 3RR5A 3OTOL 1I50H 2ZTEA 2BH8A 1V9PA 5IP7H 3HOXG 1AE3A 4R4QA 3J81c 1XNQQ 1V43A 1IBKL 5M5WH 4IOAA 3CW2C 2B29A 2PI2A 3UDFA 5GAGC 3CC7A 2VUMH 5IYCH 3H15A 2JA5H 1XMQQ 4DV5Q 4GKKL 4DAMA 1K9MC 4QJFA 3F2CA 1KD1C 4IOCA 2B63H 1K3RA 4DUYL 1PHJA 4TQUS 4UP8A 2ASBA 1PH3A 1PFSA 4IPCA 1PH1A 4JI0L 4C3IH 4DR2L 2R7ZH 2UXDQ 3KDFB 3BZKA 1JMCA 2KENA 1TWCH 2I5HA 1VQ9A 2Q2UA 4DNIA 3A74A 1PA6A 1GD7A 3ER0A 4DV6L 2UXBL 4MZ9A 1HNWQ 1SMXA 2NVXH 4AQYL 4GLXA 1RIPA 1U5KA 2FXQA 4NXNL 1SFOH 2BA1A 3RLFA 4NB3A 3I2ZA 1HR0W 4A3LG 3UDXA 2AHOB 1N8RC 1YHBA 4PZ7A 2MNAA 1VQMA 1MJEA 2UUCQ 1WJJA 1Q8KA 4O0AA 2QGQA 4B3TQ 1YEZA 4PG3A 1D7QA 1RL2A 5GAHC 1L2FA 3PIPA 3HOYG 5C44H 1J5EL 2UXCQ 2CQOA 5H1SE 4LUOA 3TS2A 2KHJA 1L1OB 1NBWA 5EAYA 4JBKA 4HIMA 4C2MH 2CCZA 3A5ZB 3KDFA 3PUXA 1VQ4A 4A3BG 1WI5A 2NN6I 5M3FG 2PI2E 1B7YB 5GADC 1XMOL 2OQ0A 3D0FA 3S1QH 4AH6A 1YZ6A 3CF5A 3GDEA 2K75A 3S24A 1VQLA 1IBML 1HZBA 1CSPA 1PV4A 1WCMG 5FLMG 3T1HL 4YCVA 4A3EG 5JJIA 1FGUA 2JEBI 1EQRA 1NE3A 4BXXG 4JI1L 3MXNB 5C3EG 1XNRL 4A3LH 2AMCB 4UP7A 4DV1L 3JAMi 2QA4A 1X65A 5E7NA 2RHSB 2E2JH 2NVQH 1KQSA 2GVBA 1HNZQ 1VQDA 1Q7YC 3U50C 3HOYH 1VQJA 4K0KQ 1Y1WG 2IX1A 4LNQA 1L1OC 1NMGA 4PZ6A 4QL5A 1IBLQ 4LF5Q 3CCJA 4LF7Q 3I4NH 1VQ8A 1GVPA 1EUJA 2PNHA 4QQBX 4B3SL 4JOIA 4BY7G 4IJLA 4KHPL 3TRZA 2JA6H 1X54A 4KLKA 3PO2G 4EQ5A 4YHHQ 3H3VI 1EOVA 4L5TA 3UE0A 4DR5L 2K5NA 2WB1E 3L2PA 1WCMH 4X62L 4JOIC 2VNUD 4HJ8A 3EBEA 1WOCA 2B3GA 4LFAQ 4A3EH 2YV5A 3PGZA 3PUVA 3U4VA 2RF4A 5C4JH 2K52A 5C3EH 3CMEA 1T9HA 4GOPB 3T1YQ 1UEBA 3D31A 1HR0L 4DK6C 1AH9A 4APVA 4A3MG 1N33L 3U58A 2AKWB 4AYBE 4JI3Q 3KLWA 3GTKH 2N8NA 3PUYA 1W3SA 3PSIA 4JV5L 2IHEA 2OTLA 3PIOA 2JA9A 1Y1WH 2JA8G 2ZM6L 3RZOH 5IP7G 1UE5A 4DR6Q 1VQPA 1VQAA 1SRUA 4DUZL 4IPGA 1XPRA 4POGA 2QEXA 1PH8A 5ELNA 1KRTA 1N36L 2F4VL 3KF6B 4BY7H 1H95A 4JG2A 1CKMA 2HQLA 4DV4Q 1YBYA 5JEAG 1N34L 2UU9Q 2ZJQA 3J81j 4PMWA 1Q81C 1P8LA 4A93G 1GO3E 3K8AA 3HKSA 4JC0A 5IY0A 2ES2A 4KHZA 4GOPA 3RZDH 4LF4Q 2UUAQ 3OTOQ 3CCLA 5DLQE 4GLAC 1I94L 2KCMA 3STBD 4JI6L 2IX0A 5IYDH 4LF6L 1PH7A 3GO5A 4GOPC 2Z0SA 1IBKQ 2UUBL 4A3MH 3GTPH 2E2HH 4JI2L 1E1TA 4GKKQ 3K7UC 3M7NA 5GQOA 1QVGA 3AEVA 4R4OA 2JA8H 4LFCQ 3S2DH 3CC2A 1U0LA 5HY6A 4R4TA 3CCSA 4GKJL 1N32L 1NTGA 4DR2Q 2WB1G 1Z47A 1VQKA 1QVCA 2KBNA 3B6YA 4GN5A 4C3HH 1IL2A 3UDIA 1K0RA 3PCOB 4JI5L 4GN4B 5C44G 3DLLA 1XJVA 1PYSB 2HIXA 3U4ZA 1VQ6A 1S3OA 2H5XA 2AWNA 2NZOA 2ALYB 4JI8L 1HNXL 2UXBQ 1PH5A 4A93H 2R7DA 3AFQA 2E5LL 2F52A 2IHFA 1W2BA 1FJGL 3STBC 4AYBG 4DV2L 1YIJA 4NXNQ 4IFDJ 1G6PA 2I5MX 4LF9L 2R93G 2MO0A 1KIXA 2I0QA 2E8GA 1XPOA 1Y1VG 3DM3A 4MNOA 3PUWA 4YY3L 2IT1A 2YTXA 2DGYA 2OTJA 1TXYA 4GS3A 2A19A 2JK8A 3G71A 1EYGA 4P75A 2WAQE 1X55A 2GVAA 2N49A 1X3FA 1TWAH 3NEMA 3A0JA 4J15A 4A3DG 1PVOA 4DR3L 2Q2HA 3FHWA 1VQIA 5M5XH 4LUZA 3CP0A 4LF8L 5C0XJ 1PH4A 4WJ3M 3GD7A 4HJ5A 1IBMQ 1X6OA 3I4NG 2D0PA 1XMQL 1XTDA 3NELA 5BR8L 3HFZB 3CCQA 4JYAL 4DPGA 1KXLA 4DK3C 2VQEQ 2GN5A 3W5OA 3K80C 3PO3H 1I6HH 2BH2A 3ERSX 2WFWA 1TWGH 4JI1Q 4DR1Q 1VQGA 2HHHL 1BBWA 1XNRQ 1L0WA 2JA6G 3I4MG 3W1GA 2UXDL 2R93H 3CCVA 4DV1Q 4DV7Q 1Y1VH 4H02A 1X9NA 1LYLA 3CQZH 4LUVA 1YJNA 2VQFQ 3GTGH 1X3EA 3KF8B 5LMUL 4WJ4A 2A1AA 3M9BA 3G6EA 1E3PA 3NBHB 1OXSC 5LMNQ 3MEFA 3CMAA 3F2DA 2HT1A 1IXRA 1J6QA 1MIUA 3I55A 4R1JA 4UY8C 4XIGS 1BVSA 1Q46A 2C35B 3AYHB 3S14H 3S16H 4DR4L 4A3DH 1L1OA 1E1OA 3TS0A 4OO1G 3UDGA 4KHPQ 4GN3B 3RLNA 4B3ML 4B3TL 2R92G 4IPHA 3J80i 1EIYB 5IP9H 2VS1A 3S15H 1EFWA 2UXCL 1X3GA 1Q1BA 3BJUA 4X62Q 2I5LX 1SN8A 4X64Q 2Q2IA 1HZAA 1TWFH 4JI7Q 1YJ9A 4DV3Q 4X65Q 2L15A 3H0GG 2R7FA 1A0IA 1LM0A 2ID0A 1D8LA 3TQYA 2WAQG 3I4MH 2YYZA 2VW9A 4HJAA 3KFUA 3M4PA 4YWMA 4A75A 4X66Q 3CCEA 3RN5A 1GM5A 3HOUH 2BA0A 2XGTA 3JC66 4JV5Q 1UE6A 2PQAB 4OWTB 2HIVA 3JAMc 1VQ5A 1HH2P 2ZM6Q 3F1ZA 1S40A 3AFPA 1DGSA 1PH2A 5IYDG 2A8VA 4A3JH 1VQNA 1TWHH 3CD6A 1A8VA 3W1BA 3KJPA 4LW1A 1B8AA 3A5UA 3ICEA 5JJKA 4P71A 1N36Q 1C7YA 1I5FA 4P74A 1NMFA 1QUQB 5IT9c 5IWAQ 4BY1G 1N34Q 4JBJA 1K73C 2R92H 3I7FA 1CUKA 1LUZA 1VQFA 1VQHA 1KRSA 1EWIA 1X56A 2XTIA 2YTVA 4R4IA 2CFMA 4DR7L 1VQBA 1LTLA 2EXDA 4KI0A 4L5SA 1WFQA 2JEAI 3FKIH 1YJWA 4LF5L 3GTOH 2OWOA 3I56A 4LF7L 4LFBQ 1G51A 2NVTH 4Y52H 1I94Q 2Z6KA 3H0GH 4L5QA 3GTQH 4LF6Q 4JBWA 3HKZE 4HJ7A 4O2DA 3ULLA 2JA7H 4JI2Q 4HIOA 2OQKA 2Z6KC 2R6GA 4YHHL 5M3MG 1OTCA 1ASYA 4L5RC 4GNXB 1C0AA 2AWOA 1JT8A 4YWLA 4LFAL 3ZJYC 3M85A 5FLXc 3Q8DA 1Q86C 2CWAA 4YCUA 5FJ8G 3HOVG 3CPFA 1N32Q 4JI4L 4OX9L 4LFBL 4DAYB 4B3RL 5ELOA 3ULJA 3LGJA 1FL0A 1PH6A 3ULPA 1JB7A 4BY1H 4RG1A 4DUYQ 1M1KC 1OXUA 3J81i 3HOZG 1JJGA 4ALPA 3KF6A 2MFIA 2MO1A 4DV2Q 1HZCA 1KL9A 3M4QA 4QGUA 4JI0Q 4NXML 4EX5A 1G291 1EQQA 4DR6L 1HJPA 3OW2A 2Q2TA 4LF9Q 1UE7A 1ASZA 1S72A 2EQSA 3HOWH 4GNXA 4DV6Q 4P73A 4BBSG 4DV4L 2V1CC 2UU9L 1JJ2A 3K0XA 3PO3G 4AQYQ 2K14A 5M3MH 1N9WA 1MKHA 4OO1I 1IZ6A 3AQQA 3VDYA 4GNXC 5AJ3L 4A3GG 1SLJA 3S17H 3M3YH 2VY3A 3CAMA 5IE8A 2UUAL 4LF4L 3KJOA 5FJ8H 1UWVA 4DR3Q 4MTNA 1M90C 3HOVH 3K81C 4DV0L 2ZTDA 4LF8Q 1J5EQ 2N3SA 1OXTA 5LMNW 1K83H 4IO9A 4A3CG 2Y0SE 3RNUA 4JYAQ 5BR8Q 1YHQA 4XTCS 3HOZH 1SROA 1CSQA 3HKZG 4OXPA 2K50A 1WYDA 4LFCL 1XPUA 3GTLH 2HHHQ 1JJCB 5IYBH 5K36G 2DUDA 3J7ZC 2YTYA 1XMOQ 3PF4A 4HJ9A 3OYYA 1XNQL 1E7ZA 1VQ7A 4BA2I 3EN2A 5JJLA 1IYJB 1A63A 5IP9G 4IFDG 1P16A 1OXVA 3KOJA 4DV5L 2KHIA 4NPSA 3T1HQ 4BBSH 4HIDA 5LMUQ 4R4CA 2WP8J 4A3GH 3CC4A 3M4OH 4AIMA 4DR4Q 4QY7A 2LXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A C;  3H3V H;  2ZJR A;  1CKN B;  3CPW A;  3HOU G;  1BBU A;  3FP9 A;  3NEN A;  3HOX H;  4B3M Q;  1UE1 A;  3PV0 A;  5GAE C;  4A76 A;  4A3C H;  2LXJ A;  1HNW L;  1Q12 A;  3J7A 5;  2OCE A;  5C0X G;  4A3J G;  1FVI A;  4A3I G;  1YHA A;  3CCR A;  1VQC A;  1PH9 A;  1MJC A;  4DKA C;  4B3S Q;  3S1R H;  2UUC L;  3L7Z C;  3S1M H;  4HIK A;  1NJI C;  3G48 A;  4DR5 Q;  4QIW E;  1QZH A;  1EIF A;  1B70 B;  3FKI G;  2NZH A;  1BKB A;  3IRB A;  1KC8 C;  1YIT A;  4IPD A;  1I3Q H;  2VQE L;  1VQE A;  1CKN A;  1KHI A;  1O7I A;  4OWW B;  4DR1 L;  2Y0S G;  2NVY H;  1HR0 Q;  1N33 Q;  2YU9 H;  2JA7 G;  1HZ9 A;  3EIV A;  4BBR G;  2KCT A;  1Q1E A;  4DV7 L;  1SR3 A;  4GLV B;  4A3K G;  1GKH A;  2VQF L;  5M5Y H;  2EIF A;  4DR7 Q;  4UP9 A;  4LWC A;  2K5V A;  5LMN L;  4YWK A;  1NY4 A;  4A3I H;  3J80 c;  4DUZ Q;  3E0E A;  2F3I A;  1SE8 A;  2F4V Q;  1Y14 B;  1YI2 A;  1VCI A;  3E9I A;  4A3B H;  3I4O A;  1AE2 A;  3BZC A;  4YCW A;  4RMF A;  3SGI A;  5M3F H;  1HNZ L;  2VL6 A;  3L0O A;  3S1N H;  5HGQ A;  1PYB A;  1V1Q A;  4K0K L;  3TEH B;  2RCN A;  1IBL L;  5FLM H;  1KAW A;  4X64 L;  2D0O A;  5J3B A;  4JI6 Q;  3PUZ A;  2K5H A;  5JEA J;  5C4X G;  4JI7 L;  3HOW G;  1QZG A;  4DV3 L;  4BXX H;  4X65 L;  3PF5 A;  2D62 A;  1VQO A;  2UUB Q;  2PQA A;  4JBM A;  4JI4 Q;  4OX9 Q;  3CCU A;  1YVC A;  2CWP A;  4C3J H;  4B3R Q;  3RLO A;  4BBR H;  3WWV A;  2ZTC A;  4A3F G;  4X66 L;  4A3K H;  1OXX K;  2NN6 G;  4UPA A;  1QVF A;  1YNX A;  4IFD I;  4GKJ Q;  1E22 A;  4X6A H;  3E9H A;  1E24 A;  4NXM Q;  2K4K A;  1QUQ A;  4TVA B;  4Y7N H;  3T1Y L;  2JE6 I;  2JQO A;  3BU2 A;  2CKZ B;  3F8T A;  3TRE A;  4JI5 Q;  4JI3 L;  2VUM G;  5IYC G;  2JA5 G;  3RN2 A;  1CKO A;  3GTM H;  1C9O A;  1HNX Q;  4JI8 Q;  3G4S A;  5IWA L;  4OON A;  4POF A;  2B63 G;  3PO2 H;  1A62 A;  1Q82 C;  2E5L Q;  1FJG Q;  5IYB G;  2E2I H;  3GTJ H;  3CCM A;  5AJ3 Q;  2R7Z G;  2JJQ A;  4JCV E;  1JE5 A;  2RHQ B;  5C4X H;  4FDB A;  2ZJP A;  5GRO A;  2IY5 B;  4A4I A;  4YY3 Q;  5C0X I;  4DV0 Q;  4ME3 A;  1Z9F A;  3F2B A;  1K8G A;  2MQH A;  3CXC A;  2ATW A;  3K7A H;  2PMZ E;  4IJH A;  1VS0 A;  2N78 A;  4A3F H;  3S2H H;  3UE1 A;  4P72 A;  4OWX B;  2LSS A;  4PZ8 A;  2VZA A;  3KYH C;  1R9T H;  4BA1 I;  3RR5 A;  3OTO L;  1I50 H;  2ZTE A;  2BH8 A;  1V9P A;  5IP7 H;  3HOX G;  1AE3 A;  4R4Q A;  3J81 c;  1XNQ Q;  1V43 A;  1IBK L;  5M5W H;  4IOA A;  3CW2 C;  2B29 A;  2PI2 A;  3UDF A;  5GAG C;  3CC7 A;  2VUM H;  5IYC H;  3H15 A;  2JA5 H;  1XMQ Q;  4DV5 Q;  4GKK L;  4DAM A;  1K9M C;  4QJF A;  3F2C A;  1KD1 C;  4IOC A;  2B63 H;  1K3R A;  4DUY L;  1PHJ A;  4TQU S;  4UP8 A;  2ASB A;  1PH3 A;  1PFS A;  4IPC A;  1PH1 A;  4JI0 L;  4C3I H;  4DR2 L;  2R7Z H;  2UXD Q;  3KDF B;  3BZK A;  1JMC A;  2KEN A;  1TWC H;  2I5H A;  1VQ9 A;  2Q2U A;  4DNI A;  3A74 A;  1PA6 A;  1GD7 A;  3ER0 A;  4DV6 L;  2UXB L;  4MZ9 A;  1HNW Q;  1SMX A;  2NVX H;  4AQY L;  4GLX A;  1RIP A;  1U5K A;  2FXQ A;  4NXN L;  1SFO H;  2BA1 A;  3RLF A;  4NB3 A;  3I2Z A;  1HR0 W;  4A3L G;  3UDX A;  2AHO B;  1N8R C;  1YHB A;  4PZ7 A;  2MNA A;  1VQM A;  1MJE A;  2UUC Q;  1WJJ A;  1Q8K A;  4O0A A;  2QGQ A;  4B3T Q;  1YEZ A;  4PG3 A;  1D7Q A;  1RL2 A;  5GAH C;  1L2F A;  3PIP A;  3HOY G;  5C44 H;  1J5E L;  2UXC Q;  2CQO A;  5H1S E;  4LUO A;  3TS2 A;  2KHJ A;  1L1O B;  1NBW A;  5EAY A;  4JBK A;  4HIM A;  4C2M H;  2CCZ A;  3A5Z B;  3KDF A;  3PUX A;  1VQ4 A;  4A3B G;  1WI5 A;  2NN6 I;  5M3F G;  2PI2 E;  1B7Y B;  5GAD C;  1XMO L;  2OQ0 A;  3D0F A;  3S1Q H;  4AH6 A;  1YZ6 A;  3CF5 A;  3GDE A;  2K75 A;  3S24 A;  1VQL A;  1IBM L;  1HZB A;  1CSP A;  1PV4 A;  1WCM G;  5FLM G;  3T1H L;  4YCV A;  4A3E G;  5JJI A;  1FGU A;  2JEB I;  1EQR A;  1NE3 A;  4BXX G;  4JI1 L;  3MXN B;  5C3E G;  1XNR L;  4A3L H;  2AMC B;  4UP7 A;  4DV1 L;  3JAM i;  2QA4 A;  1X65 A;  5E7N A;  2RHS B;  2E2J H;  2NVQ H;  1KQS A;  2GVB A;  1HNZ Q;  1VQD A;  1Q7Y C;  3U50 C;  3HOY H;  1VQJ A;  4K0K Q;  1Y1W G;  2IX1 A;  4LNQ A;  1L1O C;  1NMG A;  4PZ6 A;  4QL5 A;  1IBL Q;  4LF5 Q;  3CCJ A;  4LF7 Q;  3I4N H;  1VQ8 A;  1GVP A;  1EUJ A;  2PNH A;  4QQB X;  4B3S L;  4JOI A;  4BY7 G;  4IJL A;  4KHP L;  3TRZ A;  2JA6 H;  1X54 A;  4KLK A;  3PO2 G;  4EQ5 A;  4YHH Q;  3H3V I;  1EOV A;  4L5T A;  3UE0 A;  4DR5 L;  2K5N A;  2WB1 E;  3L2P A;  1WCM H;  4X62 L;  4JOI C;  2VNU D;  4HJ8 A;  3EBE A;  1WOC A;  2B3G A;  4LFA Q;  4A3E H;  2YV5 A;  3PGZ A;  3PUV A;  3U4V A;  2RF4 A;  5C4J H;  2K52 A;  5C3E H;  3CME A;  1T9H A;  4GOP B;  3T1Y Q;  1UEB A;  3D31 A;  1HR0 L;  4DK6 C;  1AH9 A;  4APV A;  4A3M G;  1N33 L;  3U58 A;  2AKW B;  4AYB E;  4JI3 Q;  3KLW A;  3GTK H;  2N8N A;  3PUY A;  1W3S A;  3PSI A;  4JV5 L;  2IHE A;  2OTL A;  3PIO A;  2JA9 A;  1Y1W H;  2JA8 G;  2ZM6 L;  3RZO H;  5IP7 G;  1UE5 A;  4DR6 Q;  1VQP A;  1VQA A;  1SRU A;  4DUZ L;  4IPG A;  1XPR A;  4POG A;  2QEX A;  1PH8 A;  5ELN A;  1KRT A;  1N36 L;  2F4V L;  3KF6 B;  4BY7 H;  1H95 A;  4JG2 A;  1CKM A;  2HQL A;  4DV4 Q;  1YBY A;  5JEA G;  1N34 L;  2UU9 Q;  2ZJQ A;  3J81 j;  4PMW A;  1Q81 C;  1P8L A;  4A93 G;  1GO3 E;  3K8A A;  3HKS A;  4JC0 A;  5IY0 A;  2ES2 A;  4KHZ A;  4GOP A;  3RZD H;  4LF4 Q;  2UUA Q;  3OTO Q;  3CCL A;  5DLQ E;  4GLA C;  1I94 L;  2KCM A;  3STB D;  4JI6 L;  2IX0 A;  5IYD H;  4LF6 L;  1PH7 A;  3GO5 A;  4GOP C;  2Z0S A;  1IBK Q;  2UUB L;  4A3M H;  3GTP H;  2E2H H;  4JI2 L;  1E1T A;  4GKK Q;  3K7U C;  3M7N A;  5GQO A;  1QVG A;  3AEV A;  4R4O A;  2JA8 H;  4LFC Q;  3S2D H;  3CC2 A;  1U0L A;  5HY6 A;  4R4T A;  3CCS A;  4GKJ L;  1N32 L;  1NTG A;  4DR2 Q;  2WB1 G;  1Z47 A;  1VQK A;  1QVC A;  2KBN A;  3B6Y A;  4GN5 A;  4C3H H;  1IL2 A;  3UDI A;  1K0R A;  3PCO B;  4JI5 L;  4GN4 B;  5C44 G;  3DLL A;  1XJV A;  1PYS B;  2HIX A;  3U4Z A;  1VQ6 A;  1S3O A;  2H5X A;  2AWN A;  2NZO A;  2ALY B;  4JI8 L;  1HNX L;  2UXB Q;  1PH5 A;  4A93 H;  2R7D A;  3AFQ A;  2E5L L;  2F52 A;  2IHF A;  1W2B A;  1FJG L;  3STB C;  4AYB G;  4DV2 L;  1YIJ A;  4NXN Q;  4IFD J;  1G6P A;  2I5M X;  4LF9 L;  2R93 G;  2MO0 A;  1KIX A;  2I0Q A;  2E8G A;  1XPO A;  1Y1V G;  3DM3 A;  4MNO A;  3PUW A;  4YY3 L;  2IT1 A;  2YTX A;  2DGY A;  2OTJ A;  1TXY A;  4GS3 A;  2A19 A;  2JK8 A;  3G71 A;  1EYG A;  4P75 A;  2WAQ E;  1X55 A;  2GVA A;  2N49 A;  1X3F A;  1TWA H;  3NEM A;  3A0J A;  4J15 A;  4A3D G;  1PVO A;  4DR3 L;  2Q2H A;  3FHW A;  1VQI A;  5M5X H;  4LUZ A;  3CP0 A;  4LF8 L;  5C0X J;  1PH4 A;  4WJ3 M;  3GD7 A;  4HJ5 A;  1IBM Q;  1X6O A;  3I4N G;  2D0P A;  1XMQ L;  1XTD A;  3NEL A;  5BR8 L;  3HFZ B;  3CCQ A;  4JYA L;  4DPG A;  1KXL A;  4DK3 C;  2VQE Q;  2GN5 A;  3W5O A;  3K80 C;  3PO3 H;  1I6H H;  2BH2 A;  3ERS X;  2WFW A;  1TWG H;  4JI1 Q;  4DR1 Q;  1VQG A;  2HHH L;  1BBW A;  1XNR Q;  1L0W A;  2JA6 G;  3I4M G;  3W1G A;  2UXD L;  2R93 H;  3CCV A;  4DV1 Q;  4DV7 Q;  1Y1V H;  4H02 A;  1X9N A;  1LYL A;  3CQZ H;  4LUV A;  1YJN A;  2VQF Q;  3GTG H;  1X3E A;  3KF8 B;  5LMU L;  4WJ4 A;  2A1A A;  3M9B A;  3G6E A;  1E3P A;  3NBH B;  1OXS C;  5LMN Q;  3MEF A;  3CMA A;  3F2D A;  2HT1 A;  1IXR A;  1J6Q A;  1MIU A;  3I55 A;  4R1J A;  4UY8 C;  4XIG S;  1BVS A;  1Q46 A;  2C35 B;  3AYH B;  3S14 H;  3S16 H;  4DR4 L;  4A3D H;  1L1O A;  1E1O A;  3TS0 A;  4OO1 G;  3UDG A;  4KHP Q;  4GN3 B;  3RLN A;  4B3M L;  4B3T L;  2R92 G;  4IPH A;  3J80 i;  1EIY B;  5IP9 H;  2VS1 A;  3S15 H;  1EFW A;  2UXC L;  1X3G A;  1Q1B A;  3BJU A;  4X62 Q;  2I5L X;  1SN8 A;  4X64 Q;  2Q2I A;  1HZA A;  1TWF H;  4JI7 Q;  1YJ9 A;  4DV3 Q;  4X65 Q;  2L15 A;  3H0G G;  2R7F A;  1A0I A;  1LM0 A;  2ID0 A;  1D8L A;  3TQY A;  2WAQ G;  3I4M H;  2YYZ A;  2VW9 A;  4HJA A;  3KFU A;  3M4P A;  4YWM A;  4A75 A;  4X66 Q;  3CCE A;  3RN5 A;  1GM5 A;  3HOU H;  2BA0 A;  2XGT A;  3JC6 6;  4JV5 Q;  1UE6 A;  2PQA B;  4OWT B;  2HIV A;  3JAM c;  1VQ5 A;  1HH2 P;  2ZM6 Q;  3F1Z A;  1S40 A;  3AFP A;  1DGS A;  1PH2 A;  5IYD G;  2A8V A;  4A3J H;  1VQN A;  1TWH H;  3CD6 A;  1A8V A;  3W1B A;  3KJP A;  4LW1 A;  1B8A A;  3A5U A;  3ICE A;  5JJK A;  4P71 A;  1N36 Q;  1C7Y A;  1I5F A;  4P74 A;  1NMF A;  1QUQ B;  5IT9 c;  5IWA Q;  4BY1 G;  1N34 Q;  4JBJ A;  1K73 C;  2R92 H;  3I7F A;  1CUK A;  1LUZ A;  1VQF A;  1VQH A;  1KRS A;  1EWI A;  1X56 A;  2XTI A;  2YTV A;  4R4I A;  2CFM A;  4DR7 L;  1VQB A;  1LTL A;  2EXD A;  4KI0 A;  4L5S A;  1WFQ A;  2JEA I;  3FKI H;  1YJW A;  4LF5 L;  3GTO H;  2OWO A;  3I56 A;  4LF7 L;  4LFB Q;  1G51 A;  2NVT H;  4Y52 H;  1I94 Q;  2Z6K A;  3H0G H;  4L5Q A;  3GTQ H;  4LF6 Q;  4JBW A;  3HKZ E;  4HJ7 A;  4O2D A;  3ULL A;  2JA7 H;  4JI2 Q;  4HIO A;  2OQK A;  2Z6K C;  2R6G A;  4YHH L;  5M3M G;  1OTC A;  1ASY A;  4L5R C;  4GNX B;  1C0A A;  2AWO A;  1JT8 A;  4YWL A;  4LFA L;  3ZJY C;  3M85 A;  5FLX c;  3Q8D A;  1Q86 C;  2CWA A;  4YCU A;  5FJ8 G;  3HOV G;  3CPF A;  1N32 Q;  4JI4 L;  4OX9 L;  4LFB L;  4DAY B;  4B3R L;  5ELO A;  3ULJ A;  3LGJ A;  1FL0 A;  1PH6 A;  3ULP A;  1JB7 A;  4BY1 H;  4RG1 A;  4DUY Q;  1M1K C;  1OXU A;  3J81 i;  3HOZ G;  1JJG A;  4ALP A;  3KF6 A;  2MFI A;  2MO1 A;  4DV2 Q;  1HZC A;  1KL9 A;  3M4Q A;  4QGU A;  4JI0 Q;  4NXM L;  4EX5 A;  1G29 1;  1EQQ A;  4DR6 L;  1HJP A;  3OW2 A;  2Q2T A;  4LF9 Q;  1UE7 A;  1ASZ A;  1S72 A;  2EQS A;  3HOW H;  4GNX A;  4DV6 Q;  4P73 A;  4BBS G;  4DV4 L;  2V1C C;  2UU9 L;  1JJ2 A;  3K0X A;  3PO3 G;  4AQY Q;  2K14 A;  5M3M H;  1N9W A;  1MKH A;  4OO1 I;  1IZ6 A;  3AQQ A;  3VDY A;  4GNX C;  5AJ3 L;  4A3G G;  1SLJ A;  3S17 H;  3M3Y H;  2VY3 A;  3CAM A;  5IE8 A;  2UUA L;  4LF4 L;  3KJO A;  5FJ8 H;  1UWV A;  4DR3 Q;  4MTN A;  1M90 C;  3HOV H;  3K81 C;  4DV0 L;  2ZTD A;  4LF8 Q;  1J5E Q;  2N3S A;  1OXT A;  5LMN W;  1K83 H;  4IO9 A;  4A3C G;  2Y0S E;  3RNU A;  4JYA Q;  5BR8 Q;  1YHQ A;  4XTC S;  3HOZ H;  1SRO A;  1CSQ A;  3HKZ G;  4OXP A;  2K50 A;  1WYD A;  4LFC L;  1XPU A;  3GTL H;  2HHH Q;  1JJC B;  5IYB H;  5K36 G;  2DUD A;  3J7Z C;  2YTY A;  1XMO Q;  3PF4 A;  4HJ9 A;  3OYY A;  1XNQ L;  1E7Z A;  1VQ7 A;  4BA2 I;  3EN2 A;  5JJL A;  1IYJ B;  1A63 A;  5IP9 G;  4IFD G;  1P16 A;  1OXV A;  3KOJ A;  4DV5 L;  2KHI A;  4NPS A;  3T1H Q;  4BBS H;  4HID A;  5LMU Q;  4R4C A;  2WP8 J;  4A3G H;  3CC4 A;  3M4O H;  4AIM A;  4DR4 Q;  4QY7 A;  2LXK A; 
#chains in the Genus database with same CATH topology
 1SEB D;  2ZJR A;  3HOU G;  1I4R A;  1BBU A;  3HOX H;  2L5T A;  5GAE C;  3PV0 A;  5D3I B;  3A8J E;  5I2X A;  1EY6 A;  1EL0 A;  4Q0F A;  3Q24 A;  4A3J G;  5KYL A;  4OHJ A;  2YU9 B;  5M9O A;  1MJC A;  5K36 H;  2EJF C;  2X69 A;  2E2J B;  3EA6 A;  4RCO A;  4DNT B;  4HIK A;  2F0F A;  1L0X B;  1LTG D;  2BE5 D;  2OT2 A;  1EIF A;  1QZH A;  3TSS A;  1S5E D;  1BKB A;  2LKV A;  5I2Y A;  3IRB A;  2VQE L;  1VQE A;  2HDL A;  2PO4 A;  5FOB B;  3MXU A;  4N9T A;  3EIV A;  4BBR G;  2KCT A;  3MVV A;  1SR3 A;  1CA5 A;  5DEH A;  1GKH A;  1FR3 A;  5M5Y H;  2NZ1 D;  3SE0 A;  4WJW A;  5C3E B;  3J80 c;  1Y14 B;  4ZAI A;  3VYR A;  4YCW A;  1QNU A;  3S1N H;  5HGQ A;  5G3L D;  5CBE E;  3TEH B;  3NPP A;  2RCN A;  2KED A;  5FLM H;  1KAW A;  1QG7 A;  4X64 L;  2WKD A;  2F4I A;  3PUZ A;  2K5H A;  1MI2 A;  1B50 A;  5LL6 S;  1QZG A;  4DV3 L;  2KCN A;  3MEH A;  1VQO A;  2UUB Q;  4JI4 Q;  4JBM A;  1YVC A;  1F9R A;  2QCP X;  2SNM A;  2ZTC A;  5CBA E;  3VR5 A;  1GUG A;  4UPA A;  1IKL A;  1YNX A;  1BOS A;  4GKJ Q;  2JN4 A;  2K28 A;  3F8T A;  1K3B C;  4JI5 Q;  2CKZ B;  1SNP A;  2RA4 A;  3H6M A;  1PTO C;  4JI3 L;  2FHT A;  3RN2 A;  1CKO A;  3GP7 A;  4DGZ A;  1RD9 D;  1J8I A;  4FVM A;  4POF A;  1A62 A;  2E5L Q;  3S2D B;  3CCM A;  1S4Z A;  1Z6H A;  3NXW A;  1ZYR D;  1JE5 A;  4OIK A;  2F03 A;  2VUM B;  4A4I A;  5C0X I;  1CI3 M;  4ME3 A;  2CW0 C;  1DOM A;  4IJH A;  2N78 A;  2IW3 A;  3LWE A;  4A3F H;  3FMC A;  4N8X 1;  4PZ8 A;  2R7Z B;  4BA1 I;  3OTO L;  1I50 H;  3QG1 A;  1TWC B;  1G91 A;  1E2W A;  2A69 D;  1V43 A;  1DM0 B;  1JB3 A;  3CC7 A;  4RAU C;  1QCB D;  2XRS D;  1EFI D;  4GKK L;  1A6X A;  1K9M C;  1EY0 A;  2B63 H;  4IOC A;  4QB4 A;  4DUY L;  1ENC A;  1PH3 A;  2L4N A;  4JI0 L;  4KHV A;  2OEO A;  5C44 B;  4DNI A;  3A74 A;  1PA6 A;  1GD7 A;  3ER0 A;  4DV6 L;  1HNW Q;  4H44 C;  4KN4 C;  4AYB B;  1U5K A;  4NXN L;  3I2Z A;  3QOL A;  4FF3 A;  1YHB A;  4PZ7 A;  1YEZ A;  4PG3 A;  1SYC A;  4J1M A;  1L2F A;  3H91 A;  2UXC Q;  2CQO A;  4KY5 A;  1K8M A;  3TS2 A;  2KHJ A;  4HIM A;  4C2M H;  1ONL A;  1E2V A;  1EOT A;  1HQR D;  2A73 B;  3PUX A;  1WI5 A;  3I8Z A;  2PI2 E;  1XMO L;  5GAD C;  5T1I A;  3HOY B;  1FYC A;  2K75 A;  1DOK A;  4M8A A;  2J7Z A;  2PZU A;  1EQR A;  4UHV A;  1WVL A;  5C3E G;  5FO8 B;  4FF1 A;  3J81 L;  3JAM i;  2QA4 A;  2A6E D;  1HUN A;  1WCM B;  4XYQ A;  1HNZ Q;  1A2T A;  1B9M A;  1L1O C;  1NMG A;  3CKI B;  1GVP A;  2MJ8 A;  2PNH A;  2RSO A;  5E1F A;  2R3Z A;  1HTL D;  3OPO A;  2K01 A;  3C1F A;  4KHP L;  1AFP A;  2JA6 H;  2R92 B;  1ILQ A;  2ICI A;  4EQ5 A;  4L5T A;  4DXF A;  2SDF A;  5CYU A;  4X62 L;  1NAP A;  4A3E H;  2YV5 A;  3J7A F;  3PGZ A;  3U4V A;  2RF4 A;  2K52 A;  3H0G B;  3D31 A;  5COY A;  4APV A;  2AKW B;  4AYB E;  1K28 A;  4X3K A;  1KDA A;  4G7Z C;  5IP7 G;  5DM6 3;  1UE5 A;  1VQP A;  3D4D A;  1XPR A;  1XTC D;  2B2T C;  4POG A;  2E74 C;  1KRT A;  2DJG C;  2QEJ C;  4HTH A;  1N36 L;  4JG2 A;  5C5M A;  2Z9H A;  1EEF D;  5ELE A;  4E6I A;  3HKS A;  2F0G A;  2UUA Q;  4LF4 Q;  1VF7 A;  1SE4 A;  1I94 L;  3I3C A;  3STB D;  4LF6 L;  5CV9 A;  3GO5 A;  1PH7 A;  4GOP C;  2UUB L;  3K0Y A;  2E2H H;  3VA5 A;  3N6R A;  1AN8 A;  3M7N A;  5EKI A;  1QVG A;  2JA8 H;  1F2M A;  1U0L A;  5HY6 A;  4GKJ L;  1YNJ D;  2NTT A;  4C3H H;  1H9S A;  3B6Y A;  1IL2 A;  5C44 G;  4JI5 L;  3DLL A;  4GN4 B;  1LV9 A;  2PCF B;  5JEA H;  2H5X A;  1B4O A;  2AWN A;  2NZO A;  2UXB Q;  3DM1 A;  1PH5 A;  2R7D A;  2E5L L;  3WOE A;  1W2B A;  4AYB G;  4DV2 L;  2I5M X;  5M5X B;  4LF9 L;  1IYV A;  4BWG B;  1KIX A;  2CH4 A;  1Q90 A;  2LMC B;  3PUW A;  4GS3 A;  3MAQ A;  1X3F A;  1TWA H;  4S3S A;  3FHW A;  3GTG B;  1VQI A;  3HG9 A;  4WJ3 M;  1V1O A;  3E5S A;  2TSS A;  1X6O A;  4F8M A;  4JYA L;  5BR8 L;  3CCQ A;  3TP5 A;  4DK3 C;  4A3D B;  3CRK C;  3PQI A;  1VQG A;  1BBW A;  4RH6 A;  1L0W A;  5EPL A;  5KGU A;  4DV7 Q;  2KEC A;  1EQV A;  1Y1V H;  4XYO A;  1PLF A;  4ZLT F;  1KNE A;  1TY0 A;  3KF8 B;  5I4D A;  4WJ4 A;  1SBB B;  3G6E A;  5LMN Q;  1GHK A;  1X32 A;  1IXR A;  1MIU A;  3NWS A;  4R1J A;  1ET6 A;  3H94 A;  4XIG S;  1Q46 A;  2EPB A;  1L1O A;  1E1O A;  2A74 C;  4GN3 B;  3A7L A;  2R92 G;  1NSN S;  5ELC A;  4IPH A;  1EIY B;  5IP9 H;  2VS1 A;  2UXC L;  3GV3 A;  3W2D A;  1TWF H;  4JI7 Q;  4X65 Q;  3H0G G;  1ZKO A;  2R7F A;  1LM0 A;  3TQY A;  1D8L A;  3M4P A;  3SXH A;  4YWM A;  3S1N B;  3FPU B;  4LAA A;  4NMZ A;  2WKC A;  3MXN A;  1JQY D;  2BA0 A;  1PRT B;  4IUT A;  2HIV A;  2RDF A;  1S40 A;  2KA7 A;  1PH2 A;  2PZT A;  4HN7 A;  1UEA B;  1A2U A;  3OIP A;  3KJP A;  4LW1 A;  1F2Y A;  1IHZ A;  3A8K E;  1D5X C;  2RDH A;  2EYH A;  1N34 Q;  2HD3 A;  1K73 C;  1PH1 A;  1VQF A;  1X56 A;  4PV1 C;  3FKI H;  2OWO A;  3I56 A;  1G51 A;  2Z6K A;  1A3T A;  3JAM E;  4L8J A;  4JBW A;  3ULL A;  2JA7 H;  3DXJ C;  1OTC A;  2F0I A;  4L5R C;  1ASY A;  1Y8P B;  4GNX B;  4TSS A;  2I46 A;  2CWA A;  4LFB L;  5EPK A;  4DAY B;  1ICW A;  5FO9 B;  3ULJ A;  1RTN A;  5JVH 3;  1FL0 A;  3TME A;  4A3F B;  3ULP A;  1Q3L A;  5FO7 B;  3V05 A;  3J81 i;  1JJG A;  1JOR A;  4ID6 A;  3T4A C;  1I50 B;  3KF6 A;  1HZC A;  1X3Q A;  4NXM L;  2XWB B;  4ME5 A;  2EYJ A;  3OW2 A;  1CTM A;  1BCP F;  3HOW H;  4O1N A;  5FLX E;  2B63 B;  1MSH A;  1MKH A;  4OO1 I;  1QJO A;  3VDY A;  2M2L A;  3TP6 A;  3M3Y H;  4IAL A;  2UUA L;  4LF4 L;  1K8O A;  3QR8 A;  3HOV H;  4ULL A;  2HUG A;  4X3S A;  1BR9 A;  5IT9 L;  3Q0A A;  2B39 A;  1K83 H;  4IO9 A;  3M7G A;  4XTC S;  2EY1 A;  3N52 A;  2O4X A;  5EGT A;  1JJC B;  1B53 A;  5IYB H;  5K36 G;  1LO5 D;  1JWM D;  1STH A;  3EN2 A;  4HCE A;  1CQV A;  1OXV A;  1EIG A;  2KHI A;  3MA2 B;  4XQQ A;  1YNN D;  4C2M B;  3VYU A;  3DWA A;  4DU9 A;  1NR4 A;  2WP8 J;  3K6O A;  3ITP A;  2FMC A;  4HJ5 A;  1WTP A;  4L63 B;  4MHE A;  1I3Q B;  1IW7 C;  4A3C H;  2LXJ A;  2OCE A;  5F2D A;  5I6Y A;  3CCR A;  1PH9 A;  4DKA C;  2UUC L;  3DMU A;  2EYL A;  1QB5 D;  1Y8N B;  4IFD H;  4C56 C;  2E75 C;  3G48 A;  4DR5 Q;  2KUM A;  1B70 B;  2F0V A;  1YIT A;  2PMZ B;  4EQP A;  4A3B B;  1CKN A;  1KHI A;  1O7I A;  5M3F B;  4B9X A;  4MN3 A;  4U68 A;  1N33 Q;  3NBH A;  1HZ9 A;  1FNU A;  4DV7 L;  3SK5 A;  4GLV B;  2JYO A;  1KTK A;  2XRQ D;  1VMC A;  3Q6S A;  2NB0 A;  4A3E B;  4DR7 Q;  1WTR A;  2P5Z X;  4LWC A;  5LMN L;  4A3I H;  4CHT B;  3TDQ A;  5C4H A;  3J7Y W;  4BBR B;  2F3I A;  2ZXO A;  1SE8 A;  1PTO B;  4K2L A;  1YI2 A;  5FKA C;  1AE2 A;  1A3U A;  3L0O A;  1DOL A;  1CT1 D;  1PYB A;  1V1Q A;  2XSC A;  3D6C A;  1HA5 A;  3WDN A;  2K6A A;  1DON A;  4FO2 A;  4HAE A;  5J3B A;  5JEA J;  4JI7 L;  2PPB C;  3AU7 A;  2BDN A;  4X65 L;  4BXX H;  2D62 A;  5C4Z A;  3GTM B;  4C3J H;  3WWV A;  2PQE A;  4A3F G;  4A3K H;  3GTJ B;  4F88 A;  2NN6 G;  1HA6 A;  1GOZ A;  1I4Q A;  3IAY A;  4TVA B;  4Y7N H;  3URY A;  3T1Y L;  2JE6 I;  2JQO A;  2TMP A;  3G4S A;  2B63 G;  4OON A;  1TKW B;  1H9S B;  3PO2 H;  1Q82 C;  2JA8 B;  3OMC A;  4PMB A;  2E2I H;  5AJ3 Q;  3FEW X;  4JCV E;  4CBV A;  4C3H B;  5C4X H;  3MXG A;  4DV0 Q;  3F2B A;  1K8G A;  2MQH A;  3CXC A;  1ZEQ X;  2PMZ E;  1BUV T;  3SR1 A;  3C2P A;  4C3I B;  1SNC A;  2O5I C;  1R9T H;  2ZTE A;  3QIA A;  2PW5 A;  1VDZ A;  4JW0 A;  1SYG A;  2JA5 H;  4DV5 Q;  1SFO B;  3F2C A;  1KD1 C;  1K3R A;  4TQU S;  3D4W A;  4UP8 A;  4RGT A;  4RCN A;  3FVQ A;  4IZ8 A;  5E3F A;  1A15 A;  5DM7 3;  3E0J A;  2DY7 A;  1STE A;  1HFN A;  2KEN A;  1VQ9 A;  4ILW A;  2Z4H A;  4MZ9 A;  3J81 E;  4CGY B;  1FGB D;  2NVX H;  1HR0 W;  2BA1 A;  1MBY A;  1Q8I A;  4NB3 A;  3FPP A;  2AHO B;  1MJE A;  2F0L A;  4B3T Q;  2FIN B;  2IWH A;  1L1O B;  2F0K A;  2F0E A;  1CA6 A;  4HMI A;  3I73 A;  4JBK A;  5ELB A;  3A5Z B;  3KDF A;  2EXZ A;  1VQ4 A;  4A3B G;  5IGE A;  5M3F G;  1STN A;  1NUC A;  2B2V A;  2OQ0 A;  3S1Q H;  1YZ6 A;  2DNE A;  3CF5 A;  3GDE A;  2X6L A;  4DN4 M;  1VQL A;  3I4N B;  1CSP A;  5BN4 A;  4A3E G;  5JJI A;  1WTH A;  4BS9 A;  1TWF B;  1O80 A;  4H0L C;  3MXN B;  4B9W A;  1TS3 A;  4NW2 A;  4A3L H;  4FYD A;  2AMC B;  2CQA A;  2F1M A;  2NVQ H;  2ZT9 C;  1VQD A;  4K0K Q;  5C4J B;  4LNQ A;  1IBL Q;  1TU2 B;  3EFX D;  2E76 C;  3GTK B;  4IJL A;  3TRZ A;  3H3V I;  4K8I A;  5KYI A;  3DWQ A;  1MSG A;  3S9W A;  2WB1 E;  1B9N A;  4NP5 A;  4DR5 L;  2VNU D;  4HJ8 A;  4LFA Q;  2A68 C;  2O5J C;  4GOP B;  1AH9 A;  1N33 L;  5C3W A;  3U58 A;  1SND A;  2F3W A;  1JC7 A;  3DUZ A;  2N8N A;  3PUY A;  2IPK D;  2IHE A;  2OTL A;  2JA8 G;  2JA9 A;  4J8Q A;  1Y1W H;  3RZO H;  4DAP A;  1VQA A;  4C3H G;  1R4P B;  3NTI A;  5ELN A;  3UI2 A;  3KF6 B;  4BY7 H;  4DV4 Q;  1CKM A;  4FXD A;  5JEA G;  2UU9 Q;  2ZJQ A;  3J81 j;  4PMW A;  1NR2 A;  5G3L F;  1P8L A;  1D5M C;  5C6A A;  4DAV A;  4JC0 A;  2ES2 A;  4C3I G;  4KHZ A;  3RZD H;  3CCL A;  5DLQ E;  2IX0 A;  5IYD H;  1EEI D;  1GUT A;  1IBK Q;  1SYD A;  2NTS A;  4FF2 A;  4A3M H;  3GTP H;  1CHQ D;  4JI2 L;  2O2L D;  3BVM A;  5GQO A;  2PZW A;  3WOF A;  2HCC A;  4RGO S;  3M3Y B;  3CC2 A;  1BCP C;  3LNN A;  5EBC A;  1DCZ A;  3HOV B;  1N32 L;  1NTG A;  2MPM A;  4DR2 Q;  2WB1 G;  1QVC A;  1U4M A;  5KNC A;  2HIX A;  1VQ6 A;  1KLU D;  4WFN 3;  1M8A A;  2A5H A;  1U4P A;  3IFD A;  3SK4 A;  2MHV A;  2IHF A;  4CKB A;  1G6P A;  4IFD J;  2HQE A;  2QKI C;  3OWF A;  2AQ3 B;  4CJ1 B;  2MO0 A;  5J39 A;  1BO0 A;  4K5W A;  3E3X A;  1XPO A;  1Y1V G;  4MNO A;  3VR4 A;  2YTX A;  1S5F D;  4QCL A;  1AW7 A;  4XXE A;  1D1K A;  2JSO A;  1X55 A;  1EYD A;  2N49 A;  3K5L A;  1TY2 A;  2D9U A;  3NEM A;  3NK9 A;  5DNF A;  4CJ2 C;  3K5N A;  2RCF A;  4HSV A;  1T5X D;  4LF8 L;  2EYP A;  3IKJ A;  3QWN A;  1STB A;  3KBG A;  4KTA A;  4QUF A;  1IBM Q;  1ROD A;  4B08 A;  1I4G A;  3I4N G;  2EOT A;  1XTD A;  1KXL A;  1RDP D;  5I6W A;  3K80 C;  3PO3 H;  1I6H H;  2JP1 A;  2WFW A;  1TWG H;  4JI1 Q;  3TZU A;  3R8B A;  1XNR Q;  3CCV A;  4DV1 Q;  3S15 B;  1Y8O B;  1X9N A;  3CQZ H;  4LUV A;  2OF1 A;  2VQF Q;  1X3E A;  4H7B A;  3M9B A;  1E3P A;  3NBH B;  3F2D A;  3I55 A;  1J6Q A;  2ZXR A;  3S14 H;  1F2L A;  1GHJ A;  3S16 H;  4DR4 L;  3QOJ A;  4DXG A;  4B3T L;  2G9D A;  1CM9 A;  3SK6 A;  1V1P A;  1PZI D;  1Q1B A;  3BJU A;  4KKS A;  4GZY C;  4A3I B;  2BOS A;  1I4X A;  2L15 A;  2XNA C;  5D65 A;  1O7Y A;  1A0I A;  2WV6 D;  2ID0 A;  1KDC A;  1EQT A;  5C5L A;  2VW9 A;  3KFU A;  4C1N K;  2M9V A;  1L0Y B;  5IGB A;  4X66 Q;  4ZK9 B;  3HOU H;  3JC6 6;  4JV5 Q;  1SJE D;  1UE6 A;  4OWT B;  3JAM c;  1HH2 P;  2ZM6 Q;  3TP7 A;  3GV6 A;  3MFY A;  5CV8 A;  4A3J H;  1PRT D;  3BVG A;  2B2Y A;  3W1B A;  2CVR A;  4C3J B;  1UNS A;  5JJK A;  4P71 A;  1B1Z A;  1I5F A;  4A3K B;  1NMF A;  1II3 A;  1LUZ A;  1VQB A;  1LTL A;  2EXD A;  1WFQ A;  2K1B A;  4RA8 A;  4DF7 A;  1DZ1 A;  1Y69 U;  3GTQ H;  1SMY C;  4DNR B;  2FFK B;  3DHQ A;  2Z6K C;  4FP5 D;  4PNY A;  1E2Z A;  2EJG C;  4ABN A;  3K5M A;  2NYZ D;  2PNR C;  3A7A B;  4LFA L;  3M85 A;  5FLX c;  5IT9 E;  5C4X B;  1TS2 A;  3HOV G;  4JI4 L;  1F2Z A;  1RF2 D;  3LGJ A;  3RUZ A;  5D3D A;  1JB7 A;  1LT5 D;  2RSN A;  4RG1 A;  1I4P A;  3S17 B;  4QGU A;  1G29 1;  1S72 A;  4ZUI A;  2JA5 B;  3QO2 A;  4DV4 L;  2M00 A;  2UU9 L;  3GTL B;  1JJ2 A;  2K14 A;  5M3M H;  1D1I A;  2K7V A;  5FJ8 H;  4DR3 Q;  1M90 C;  2NBF A;  2ZTD A;  3T51 B;  5JJZ A;  4A3C G;  1RTO A;  2BCO A;  2Y0S E;  2NVX B;  2L9H A;  4IUP A;  2N55 A;  1CSQ A;  3OOC A;  4OXP A;  1H9J A;  1WYD A;  1XPU A;  2HHH Q;  1C4Q A;  3PF4 A;  2F0N A;  3HOX B;  1WTQ A;  5JJL A;  1IYJ B;  4IFD G;  5EQ0 A;  5IIF A;  1P16 A;  2A6H C;  1WD1 A;  2FMM A;  4NPS A;  2J4X A;  3T1H Q;  4BBS H;  4HID A;  5LMU Q;  2K5D A;  4Z9C B;  1CFM A;  1EY5 A;  5HUR A;  3M4O H;  3S1Q B;  2QDB A;  3OWE B;  3H3V H;  2XWJ B;  2J0T D;  4ZKB B;  3NEN A;  1BNZ A;  4B3M Q;  1HNW L;  1Q12 A;  1BQQ T;  2VB3 X;  4A3I G;  3I72 A;  3I4L A;  1VQC A;  4B3S Q;  2K05 A;  3L7Z C;  3S1M H;  5M5Y B;  4N9P A;  4QIW E;  2HDM A;  1MGS A;  4DK1 A;  3HEJ A;  1HPC A;  1KC8 C;  4IPD A;  3D3R A;  2LS0 1;  3CHB D;  2MGS A;  3X3M A;  1EYC A;  1KAA A;  2Y0S G;  2NVY H;  2YU9 H;  2I07 B;  1SYF A;  4C3J G;  2AUK A;  3IL8 A;  4A3K G;  1JWU D;  2VQF L;  2EIF A;  2RDG A;  1PFB A;  4UP9 A;  2LY7 A;  3DEO A;  2K5V A;  5C0X H;  1X3P A;  1NY4 A;  4CJ0 B;  2Z6B A;  5T1G A;  4KD4 A;  2H4O A;  2F4V Q;  4HSP A;  4XDX A;  4RMF A;  5JOB A;  1HNZ L;  2VL6 A;  5COR A;  3T53 B;  1PTO D;  3AMU A;  1JIC A;  3RZO B;  3KK7 A;  1GUS A;  1PZK D;  4QMG A;  3L3O C;  2D0O A;  5C4X G;  1IYU A;  3CU7 A;  3PF5 A;  4OX9 Q;  3G6J B;  4BY7 B;  2PQA A;  3SHL A;  4B3R Q;  3RLO A;  4RHR A;  1K0S A;  2K32 A;  2H1E A;  1M4V A;  2CW0 D;  4X66 L;  4C1N I;  5KEE A;  1H9M A;  3NSW A;  1QIL A;  1E22 A;  3P75 A;  4X6A H;  1DD2 A;  3E9H A;  1SDF A;  1E24 A;  4ODG A;  2SOB A;  3BU2 A;  3TRE A;  1BCP D;  5LL6 X;  2JA5 G;  5DAU A;  2KQ3 A;  1HNX Q;  2AUJ D;  5NUC A;  2IJ0 A;  4K5V A;  3J7A V;  4OIJ A;  4WRD A;  3MZ5 A;  2JJQ A;  2SEB D;  1R4Q B;  4FDB A;  5GRO A;  2IY5 B;  4YY3 Q;  3A54 A;  3P1H A;  4NDX A;  2ATW A;  1SYE A;  1VS0 A;  1ESF A;  3SVM A;  1EIH A;  3NQT A;  1U9R A;  4OWX B;  2LSS A;  1EWC A;  3RR5 A;  3J80 L;  5LHY 1;  4V19 0;  1BDO A;  1GXD C;  2BH8 A;  2C9O A;  1V9P A;  5IP7 H;  3HOX G;  1AE3 A;  4R4Q A;  3J81 c;  1XNQ Q;  1ESR A;  4HMJ A;  5M5W H;  4IOA A;  1XX8 A;  2PI2 A;  2VUM H;  5IYC H;  1EYA A;  1XMQ Q;  2L1B A;  4XT3 B;  4X3U A;  2EDG A;  4K6D A;  1JCK B;  1ZYR C;  4CDD C;  1PHJ A;  2Q8R E;  3VYS A;  4U67 3;  1WTX A;  3BVZ A;  2UXD Q;  2R7Z H;  4CKC A;  3BZK A;  3HP3 A;  1GUN A;  4K6L A;  1TWC H;  2I5H A;  2Q2U A;  4JK1 C;  3PIO 3;  4OEL B;  5EPJ A;  2UXB L;  1CZW A;  1SMX A;  1I6H B;  4GLX A;  2FXQ A;  3NWT A;  4A3L G;  3TP8 A;  1VQM A;  2MNA A;  1ET9 A;  1O78 A;  1NNX A;  1WJJ A;  2L55 A;  2WIN B;  1MD2 D;  4O0A A;  1D7Q A;  1RL2 A;  5C44 H;  3EQL C;  1SNO A;  5H1S E;  3BDO A;  1HQM C;  5EAY A;  1TQO A;  5IGC A;  2CCZ A;  1GUW A;  2EY2 A;  3S16 B;  5JVG 3;  1ENF A;  2NN6 I;  3BS1 A;  1PFM A;  4AH6 A;  3S24 A;  1LT3 D;  3LX0 A;  2KCC A;  1G6Z A;  1PV4 A;  3C3L A;  5FLM G;  2B2V C;  2RBM A;  3T1H L;  1WD0 A;  2JEB I;  2JA6 B;  1DYQ A;  5CV6 A;  1X65 A;  2RHS B;  4PQX A;  3FDT A;  2ZXP A;  5TSS A;  1CQF A;  3I90 A;  4MTK A;  4R9W A;  4G57 A;  3U50 C;  3HOY H;  4HED A;  1Y1W G;  2IX1 A;  3FRP B;  4PZ6 A;  4LF5 Q;  5ISR A;  4LF7 Q;  1VQ8 A;  3AB9 A;  4R8N A;  3GQB A;  4QQB X;  4B3S L;  4KN7 C;  4JOI A;  4BY7 G;  2V4D A;  4P2C B;  2SNS A;  1X54 A;  1EOV A;  3A55 A;  5J1Z A;  1O7L A;  3L2P A;  1TR5 A;  1WCM H;  1SYB A;  3ND9 A;  1SMY D;  3M4Y A;  3PUV A;  1T9H A;  1UEB A;  2AQ2 B;  1JE4 A;  4A3M G;  4X3T A;  4JI3 Q;  2EJM A;  1T5E A;  2F0H A;  3NHH A;  3PIO A;  1BCP B;  2RVL A;  5E4W C;  4RGN A;  1CHP D;  4I65 A;  4IPG A;  2E2H B;  3BDL A;  2IX3 A;  2QEX A;  2F4V L;  1H95 A;  2NUC A;  1YBY A;  1N34 L;  1JOO A;  2G5D A;  1LTR D;  3R3O A;  1Q81 C;  1GO3 E;  3OTO Q;  3R93 A;  4GLA C;  3A56 A;  1Z7T A;  2Z0S A;  2VXW A;  2K5Q A;  1E1T A;  1F9Q A;  4GKK Q;  3K7U C;  5HGT A;  3AEV A;  4J6H A;  1QE6 A;  1S5C D;  2Z8L A;  3ZYY X;  1ZXT A;  2D2C C;  1VQK A;  2KBN A;  1SNQ A;  1PFN A;  5L37 A;  3PCO B;  1XJV A;  4FNF A;  1PYS B;  2F0T A;  2K04 A;  3U4Z A;  4EQO A;  3OSO A;  1PDQ A;  1HNX L;  1TWA B;  1HXY D;  4IUV A;  3K57 A;  2EY5 A;  4A93 H;  2F52 A;  3STB C;  1YIJ A;  1STY A;  2WB1 B;  2F0Q A;  4NXN Q;  2C5C A;  2I0Q A;  2E8G A;  2BDO A;  2GA4 B;  2IT1 A;  2DGY A;  4YY3 L;  4BBS B;  2OTJ A;  1TXY A;  3D6W A;  2JK8 A;  3G71 A;  1PYW D;  1EYG A;  3ND8 A;  3ERO A;  1JWS D;  1EU3 A;  1YNJ C;  2HCI A;  1KLG D;  1RJT A;  3A0J A;  3G7L A;  4J15 A;  1Y1V B;  3LWU A;  5IGD A;  3BG3 A;  3CP0 A;  5M5X H;  5C0X J;  1PH4 A;  4FXG C;  3GD7 A;  1XMQ L;  1LLR D;  1QOH A;  4CDF C;  3NEL A;  3HFZ B;  1F77 A;  2GN5 A;  3HKZ B;  1EU4 A;  2IL8 A;  4DR1 Q;  4CDE C;  2JA6 G;  3W1G A;  2UXD L;  2R93 H;  4H02 A;  3OMG A;  3GTG H;  2K5W A;  3NUC A;  1SAP A;  5IOD A;  1OXS C;  3CMA A;  3BZD B;  4ZUJ A;  1V8Q A;  4UY8 C;  2NVY B;  2RQX A;  5CV4 A;  1BVS A;  4A3D H;  2QF7 A;  2F0J A;  1WTO A;  5BN3 A;  4KHP Q;  2VB2 X;  3J80 i;  4LK1 C;  1LAC A;  1OO9 B;  1X3G A;  4X62 Q;  4K8J A;  1ENA A;  1SN8 A;  2I5L X;  2Q2I A;  2XVS A;  4UDU C;  1YJ9 A;  4RFB A;  1LAB A;  3I4M H;  4KV6 A;  2YYZ A;  3KF8 A;  4HJA A;  4A75 A;  3CCE A;  3RN5 A;  1GM5 A;  4DK0 A;  2XGT A;  2F0W A;  3FKI B;  2ENB A;  2PQA B;  1STA A;  3O13 A;  3F1Z A;  3AFP A;  3OW7 A;  1TWH H;  1A8V A;  3MXP A;  3BDC A;  1AZP A;  2JA7 B;  4G7O C;  1PZJ D;  1B8A A;  3A5U A;  3ICE A;  1N36 Q;  4OO1 H;  5IWA Q;  5IT9 c;  4JBJ A;  2B2Y C;  2YTV A;  3VA7 A;  2XTI A;  4R4I A;  4DR7 L;  3D8G A;  4QF4 A;  4LF5 L;  3SDZ A;  3GTO H;  4LF7 L;  2NVT H;  2WAC A;  1I94 Q;  4LF6 Q;  4ZKC B;  3HKZ E;  4HJ7 A;  3VYT A;  4O2D A;  1BXT A;  5KIX A;  4KY7 A;  5M3M G;  2FJ2 A;  4JVZ A;  5EBD A;  1F9S A;  3I91 A;  2AWO A;  2F0S A;  1C0A A;  2F3V A;  1JT8 A;  3ZJY C;  3Q8D A;  1Q86 C;  3HOW B;  1EY7 A;  5FJ8 G;  1B3Q A;  4OEM B;  4KD3 A;  4RGM A;  4ZQ3 A;  4BY1 H;  1OXU A;  1S5B D;  3OHX C;  4ALP A;  2MFI A;  2MO1 A;  3ONA B;  3C1E A;  3M4Q A;  3T56 B;  4DV2 Q;  1XWE A;  3F2U A;  1EQQ A;  1HJP A;  2Q2T A;  2F0P A;  4LF9 Q;  2MUY A;  1ASZ A;  5M5W B;  2F0M A;  1K83 B;  2EQS A;  4GNX A;  1EZ6 A;  4BBS G;  1SJH D;  2V1C C;  1TVX A;  4AQY Q;  1G8Z D;  1N9W A;  1IZ6 A;  3AQQ A;  5CMD A;  5A2Q L;  4DAY A;  5AJ3 L;  1SLJ A;  2NN6 H;  3NE5 B;  5IE8 A;  1S5D D;  4Q5V A;  4FF4 A;  2QW7 A;  3KJO A;  2G9H D;  4MTN A;  4DV0 L;  3TN2 A;  1J5E Q;  2EYF A;  2N3S A;  1JR0 D;  5LMN W;  5K5P A;  4G4K A;  2PW7 A;  4JYA Q;  5ELD A;  3D4R A;  2F0U A;  5BR8 Q;  1QNK A;  1W6J A;  1YHQ A;  3HOZ H;  3HKZ G;  4EGV A;  1IW7 D;  2K50 A;  4V0B A;  2OXP A;  4K2K A;  3J7Z C;  2YTY A;  2K33 A;  1PXU A;  1E7Z A;  2B2U A;  1A63 A;  5IP9 G;  1WTW A;  3KOJ A;  4DV5 L;  1BBX C;  4RKL A;  4UAI A;  4A3G H;  3CC4 A;  1D6E C;  4WOR A;  4KKT A;  4AIM A;  4QY7 A;  1CK1 A;  1K8A C;  3OIQ A;  1CKN B;  3CPW A;  3FP9 A;  4IUR A;  3C46 A;  1UE1 A;  4A76 A;  3J7A 5;  2EVB A;  5C0X G;  1FVI A;  1HRJ A;  4KJN A;  1YHA A;  3S1R H;  3H3V C;  1NCV A;  1SSO A;  4YIJ A;  1NJI C;  1YNN C;  3R2I A;  2B8G A;  3SEB A;  1G2T A;  5KND A;  3FKI G;  2NZH A;  2F0O A;  4IUU A;  3K5O A;  3VR2 A;  1I3Q H;  1RKN A;  1B3A A;  3TBI B;  4OWW B;  4DR1 L;  2Q8T A;  1HR0 Q;  3MHB A;  2JA7 G;  5IOC A;  1KNA A;  1Q1E A;  2PYK A;  5E4X A;  4YWK A;  2Y0S B;  1KDB A;  4DUZ Q;  3E0E A;  1VCI A;  3E9I A;  4A3B H;  3I4O A;  5C3X A;  3BZC A;  3SGI A;  5M3F H;  1LT6 D;  2L12 A;  4EQN A;  4K0K L;  1IBL L;  4Y7N B;  4ZCK A;  3W3A A;  4JI6 Q;  3TZD A;  3HOW G;  1ICF B;  3MTS A;  4LFB Q;  3PIP 3;  3CCU A;  2CWP A;  1DJR D;  4BBR H;  3PO2 B;  1PTO H;  2ICE C;  3J80 E;  3K58 A;  2E2I B;  1OXX K;  1VMP A;  3HRZ C;  1QVF A;  4IFD I;  4NXM Q;  2K4K A;  1QUQ A;  3ERQ A;  4O42 A;  1PRT F;  4IQZ A;  1STG A;  5IYC G;  2VUM G;  3GTM H;  1C9O A;  1A3V A;  4JI8 Q;  3KLR A;  5IWA L;  4H13 C;  4HCS A;  4IUN A;  4CDC C;  1WTV A;  1R9T B;  1FJG Q;  5IYB G;  4QIW B;  2WII B;  3GTJ H;  2R7Z G;  2RHQ B;  1SE3 A;  2ZJP A;  5J22 A;  1Z9F A;  3R2T A;  3K7A H;  3DWP A;  3IFT A;  4A93 B;  3S2H H;  2D5D A;  4I7A A;  4P72 A;  3UE1 A;  5CC4 A;  2VZA A;  3KYH C;  1FD7 D;  4MIU A;  2EZV A;  1IBK L;  1PMR A;  3CW2 C;  2B29 A;  3UDF A;  5GAG C;  3H15 A;  1EY8 A;  4DAM A;  4QJF A;  2DJF C;  4DFA A;  3RD4 A;  5BN5 A;  4RKB A;  2ASB A;  2AQ1 B;  1SXT A;  1PFS A;  2XN9 C;  4LJZ C;  4IPC A;  4C3I H;  4DR2 L;  1LT4 D;  1EWH A;  4K14 A;  3KDF B;  1JMC A;  5FK9 C;  1HHV A;  3KUP A;  2K03 A;  4AQY L;  1RIP A;  1ML0 D;  1SFO H;  3RLF A;  2R93 B;  3UDX A;  1N8R C;  1F9P A;  2UUC Q;  1Q8K A;  5JPN C;  4RHS A;  2QGQ A;  2B8F A;  4K5X A;  3RMH A;  5GAH C;  3PIP A;  3HOY G;  1J5E L;  4LUO A;  1NBW A;  3KBX A;  2NVQ B;  1B7Y B;  1QWY A;  1VF5 C;  3D0F A;  5CR3 A;  1ILP A;  4F7X A;  4R8I A;  1IBM L;  1HZB A;  3CRL C;  1WCM G;  4YCV A;  1FGU A;  3I70 A;  4L6T B;  1NE3 A;  4BXX G;  4JI1 L;  4TKO B;  2A68 D;  1XNR L;  3I4M B;  4UP7 A;  4DV1 L;  3MC0 B;  5E7N A;  2E2J H;  2EYO A;  1KQS A;  2GVB A;  1Q7Y C;  1KAB A;  3KLS A;  1VQJ A;  4QUC A;  5ELF A;  2X6G A;  2Q8I B;  3MWY W;  3I4N H;  4QL5 A;  4HR7 B;  3CCJ A;  1TWH B;  1EUJ A;  2BE5 C;  2JXM B;  2N88 A;  5KNB A;  1IL8 A;  4KLK A;  3PO2 G;  2QIL A;  4YHH Q;  3VR3 A;  1XYI A;  1Y1W B;  3UE0 A;  2K5N A;  4JOI C;  3EBE A;  1WOC A;  2B3G A;  1AP0 A;  1JOQ A;  2B2W C;  3GTO B;  1EY9 A;  2NVT B;  5C4J H;  5C3E H;  3CME A;  2WAQ B;  3T1Y Q;  1HR0 L;  4DK6 C;  3BYY B;  3H09 A;  1LTT D;  5IGG A;  3KLW A;  3GTK H;  3PSI A;  3RZD B;  1W3S A;  4JV5 L;  4OGQ C;  3NBI A;  1CZG A;  2B2T A;  4N8F A;  5D14 A;  2ZM6 L;  2QDL A;  4KKU A;  4M1U B;  4DR6 Q;  1E0B A;  1SRU A;  3EJI A;  4A3M B;  3GTP B;  4DUZ L;  1PH8 A;  5I9O A;  2HQL A;  4BY1 B;  2KVM A;  4RWS C;  1PTO F;  4A93 G;  4OL7 A;  3K8A A;  5IY0 A;  4KMU C;  4GOP A;  1UAP A;  5CV5 A;  3L9A X;  4JPB W;  5AFW A;  4JI6 L;  2KCM A;  1H9R A;  1B2T A;  1LTI D;  2LFN A;  4ZRZ A;  2R61 A;  4R4O A;  3Q23 A;  4LFC Q;  3S2D H;  1AZQ A;  3CCS A;  4R4T A;  5A35 A;  1TS5 A;  1Z47 A;  4GN5 A;  1DXM A;  3UDI A;  1K0R A;  5JAV A;  1GUO A;  3VR6 A;  1S3O A;  2F0D A;  2ALY B;  4JI8 L;  3HOZ B;  1HCZ A;  3AFQ A;  4KK7 A;  1FJG L;  5JPM C;  3V2T A;  2R93 G;  2NWG A;  3DM3 A;  2Z4I A;  2EY6 A;  3PO3 B;  2A19 A;  1TWG B;  4P75 A;  2WAQ E;  2DNC A;  2GVA A;  2A69 C;  2KJX A;  4A3G B;  4A3D G;  1PVO A;  3CQZ B;  2CH4 W;  2Q2H A;  4DR3 L;  1XXG A;  4KJO A;  4LUZ A;  2KHS A;  3A8I E;  1AEX A;  2RKS A;  3PMF A;  1U4R A;  2D0P A;  3K59 A;  5EKK A;  4DPG A;  5KRU A;  2VQE Q;  3S14 B;  1O7Z A;  3W5O A;  2BH2 A;  3ERS X;  1V1P B;  2HHH L;  1SNM A;  3SK8 A;  3S1R B;  3I4M G;  3U9S A;  1LYL A;  5EJW A;  1YJN A;  2EE1 A;  1RCV D;  5LMU L;  2L0C A;  1RHP A;  2A1A A;  2DN8 A;  3MEF A;  1I6V C;  1EY4 A;  3T13 A;  2HT1 A;  4PMC A;  3AYH B;  2C35 B;  2CHB D;  5CV7 A;  3TS0 A;  4OO1 G;  3HOU B;  3UDG A;  1U4L A;  3RLN A;  4B3M L;  3MFG A;  1G2S A;  3EVQ A;  3BYT B;  3DEP A;  3S15 H;  1EFW A;  3Q22 A;  4X64 Q;  4A3J B;  1HZA A;  4F87 A;  4DV3 Q;  2Z1C A;  3E6Z X;  4I7Z C;  2B2W A;  2WAQ G;  1FNV A;  3QJY A;  1MHW C;  3QB3 A;  4XT1 B;  1VQ5 A;  1SE2 A;  2A6E C;  2DY8 A;  3GTQ B;  1DGS A;  4CKE A;  5IYD G;  2A8V A;  4G7H C;  3CD6 A;  1VQN A;  2L11 A;  3NTH A;  1C7Y A;  4P74 A;  1QUQ B;  2R92 H;  4BY1 G;  2KEE A;  3I7F A;  1CUK A;  1VQH A;  1KRS A;  1EWI A;  2XIW A;  2EYM A;  3U9O A;  1BF4 A;  2CFM A;  4L5S A;  2JEA I;  4KI0 A;  1YJW A;  3V96 A;  4Y52 H;  3H0G H;  4L5Q A;  1HTP A;  4XQJ A;  1HUM A;  1LTA D;  5A2Q E;  4LMQ D;  4JI2 Q;  4HIO A;  2OQK A;  2R6G A;  4YHH L;  1PRT C;  4YWL A;  3P20 A;  4NKL A;  3HZX A;  3X3N A;  3T16 A;  4IUQ A;  4YCU A;  1N32 Q;  3CPF A;  4OX9 L;  4DA2 A;  1FNW A;  4B3R L;  2KOL A;  5ELO A;  3K7A B;  1D5Z C;  4ZYS A;  5M3M B;  3HS0 C;  1PH6 A;  3S2H B;  4DUY Q;  1M1K C;  3HOZ G;  3KLS X;  4JI0 Q;  1IKM A;  1KL9 A;  4FXK C;  4EX5 A;  4DR6 L;  1TT2 A;  1UE7 A;  1TII D;  4DV6 Q;  4P73 A;  5IGF A;  4TRD A;  3K0X A;  3PO3 G;  3JAM L;  3NP8 A;  1TS4 A;  2A6H D;  5CGK A;  1C8C A;  1LTS D;  4GNX C;  4XQN A;  4EVO A;  4A3G G;  3S17 H;  3HGB A;  2VY3 A;  3CAM A;  3NQI A;  1UWV A;  3K81 C;  4LF8 Q;  1OXT A;  4IN3 A;  1I4H A;  2MP1 A;  3RNU A;  1JOK A;  3M4O B;  1J9O A;  1SRO A;  3GTL H;  3NTK A;  4LFC L;  2DUD A;  1XMO Q;  1D2B A;  1LTB D;  4HJ9 A;  3OYY A;  1XNQ L;  4BA2 I;  1VQ7 A;  2E2D C;  1UUP A;  3P7J A;  5I9P A;  4KY6 A;  1B44 D;  1EZ8 A;  2B2U C;  4R4C A;  1HFG A;  1GJX A;  5EKL A;  1W6K A;  1C48 A;  1H9K A;  5FLX L;  3S1M B;  4DR4 Q;  2LXK A; 
#chains in the Genus database with same CATH homology
 1K8A C;  3H3V H;  2ZJR A;  1CKN B;  3CPW A;  3HOU G;  1BBU A;  3FP9 A;  3NEN A;  3HOX H;  4B3M Q;  1UE1 A;  3PV0 A;  5GAE C;  4A76 A;  4A3C H;  2LXJ A;  1HNW L;  1Q12 A;  3J7A 5;  2OCE A;  5C0X G;  4A3J G;  1FVI A;  4A3I G;  1YHA A;  3CCR A;  1VQC A;  1PH9 A;  1MJC A;  4DKA C;  4B3S Q;  3S1R H;  2UUC L;  3L7Z C;  3S1M H;  4HIK A;  1NJI C;  3G48 A;  4DR5 Q;  4QIW E;  1QZH A;  1EIF A;  1B70 B;  3FKI G;  2NZH A;  1BKB A;  3IRB A;  1KC8 C;  1YIT A;  4IPD A;  1I3Q H;  2VQE L;  1VQE A;  1CKN A;  1KHI A;  1O7I A;  4OWW B;  4DR1 L;  2Y0S G;  2NVY H;  1HR0 Q;  1N33 Q;  2YU9 H;  2JA7 G;  1HZ9 A;  3EIV A;  4BBR G;  2KCT A;  1Q1E A;  4DV7 L;  1SR3 A;  4GLV B;  4A3K G;  1GKH A;  2VQF L;  5M5Y H;  2EIF A;  4DR7 Q;  4UP9 A;  4LWC A;  2K5V A;  5LMN L;  4YWK A;  1NY4 A;  4A3I H;  3J80 c;  4DUZ Q;  3E0E A;  2F3I A;  1SE8 A;  2F4V Q;  1Y14 B;  1YI2 A;  1VCI A;  3E9I A;  4A3B H;  3I4O A;  1AE2 A;  3BZC A;  4YCW A;  4RMF A;  3SGI A;  5M3F H;  1HNZ L;  2VL6 A;  3L0O A;  3S1N H;  5HGQ A;  1PYB A;  1V1Q A;  4K0K L;  3TEH B;  2RCN A;  1IBL L;  5FLM H;  1KAW A;  4X64 L;  2D0O A;  5J3B A;  4JI6 Q;  3PUZ A;  2K5H A;  5JEA J;  5C4X G;  4JI7 L;  3HOW G;  1QZG A;  4DV3 L;  4BXX H;  4X65 L;  3PF5 A;  2D62 A;  1VQO A;  2UUB Q;  2PQA A;  4JBM A;  4JI4 Q;  4OX9 Q;  3CCU A;  1YVC A;  2CWP A;  4C3J H;  4B3R Q;  3RLO A;  4BBR H;  3WWV A;  2ZTC A;  4A3F G;  4X66 L;  4A3K H;  1OXX K;  2NN6 G;  4UPA A;  1QVF A;  1YNX A;  4IFD I;  4GKJ Q;  1E22 A;  4X6A H;  3E9H A;  1E24 A;  4NXM Q;  2K4K A;  1QUQ A;  4TVA B;  4Y7N H;  3T1Y L;  2JE6 I;  2JQO A;  3BU2 A;  2CKZ B;  3F8T A;  3TRE A;  4JI5 Q;  4JI3 L;  2VUM G;  5IYC G;  2JA5 G;  3RN2 A;  1CKO A;  3GTM H;  1C9O A;  1HNX Q;  4JI8 Q;  3G4S A;  5IWA L;  4OON A;  4POF A;  2B63 G;  3PO2 H;  1A62 A;  1Q82 C;  2E5L Q;  1FJG Q;  5IYB G;  2E2I H;  3GTJ H;  3CCM A;  5AJ3 Q;  2R7Z G;  2JJQ A;  4JCV E;  1JE5 A;  2RHQ B;  5C4X H;  4FDB A;  2ZJP A;  5GRO A;  2IY5 B;  4A4I A;  4YY3 Q;  5C0X I;  4DV0 Q;  4ME3 A;  1Z9F A;  3F2B A;  1K8G A;  2MQH A;  3CXC A;  2ATW A;  3K7A H;  2PMZ E;  4IJH A;  1VS0 A;  2N78 A;  4A3F H;  3S2H H;  3UE1 A;  4P72 A;  4OWX B;  2LSS A;  4PZ8 A;  2VZA A;  3KYH C;  1R9T H;  4BA1 I;  3RR5 A;  3OTO L;  1I50 H;  2ZTE A;  2BH8 A;  1V9P A;  5IP7 H;  3HOX G;  1AE3 A;  4R4Q A;  3J81 c;  1XNQ Q;  1V43 A;  1IBK L;  5M5W H;  4IOA A;  3CW2 C;  2B29 A;  2PI2 A;  3UDF A;  5GAG C;  3CC7 A;  2VUM H;  5IYC H;  3H15 A;  2JA5 H;  1XMQ Q;  4DV5 Q;  4GKK L;  4DAM A;  1K9M C;  4QJF A;  3F2C A;  1KD1 C;  4IOC A;  2B63 H;  1K3R A;  4DUY L;  1PHJ A;  4TQU S;  4UP8 A;  2ASB A;  1PH3 A;  1PFS A;  4IPC A;  1PH1 A;  4JI0 L;  4C3I H;  4DR2 L;  2R7Z H;  2UXD Q;  3KDF B;  3BZK A;  1JMC A;  2KEN A;  1TWC H;  2I5H A;  1VQ9 A;  2Q2U A;  4DNI A;  3A74 A;  1PA6 A;  1GD7 A;  3ER0 A;  4DV6 L;  2UXB L;  4MZ9 A;  1HNW Q;  1SMX A;  2NVX H;  4AQY L;  4GLX A;  1RIP A;  1U5K A;  2FXQ A;  4NXN L;  1SFO H;  2BA1 A;  3RLF A;  4NB3 A;  3I2Z A;  1HR0 W;  4A3L G;  3UDX A;  2AHO B;  1N8R C;  1YHB A;  4PZ7 A;  2MNA A;  1VQM A;  1MJE A;  2UUC Q;  1WJJ A;  1Q8K A;  4O0A A;  2QGQ A;  4B3T Q;  1YEZ A;  4PG3 A;  1D7Q A;  1RL2 A;  5GAH C;  1L2F A;  3PIP A;  3HOY G;  5C44 H;  1J5E L;  2UXC Q;  2CQO A;  5H1S E;  4LUO A;  3TS2 A;  2KHJ A;  1L1O B;  1NBW A;  5EAY A;  4JBK A;  4HIM A;  4C2M H;  2CCZ A;  3A5Z B;  3KDF A;  3PUX A;  1VQ4 A;  4A3B G;  1WI5 A;  2NN6 I;  5M3F G;  2PI2 E;  1B7Y B;  5GAD C;  1XMO L;  2OQ0 A;  3D0F A;  3S1Q H;  4AH6 A;  1YZ6 A;  3CF5 A;  3GDE A;  2K75 A;  3S24 A;  1VQL A;  1IBM L;  1HZB A;  1CSP A;  1PV4 A;  1WCM G;  5FLM G;  3T1H L;  4YCV A;  4A3E G;  5JJI A;  1FGU A;  2JEB I;  1EQR A;  1NE3 A;  4BXX G;  4JI1 L;  3MXN B;  5C3E G;  1XNR L;  4A3L H;  2AMC B;  4UP7 A;  4DV1 L;  3JAM i;  2QA4 A;  1X65 A;  5E7N A;  2RHS B;  2E2J H;  2NVQ H;  1KQS A;  2GVB A;  1HNZ Q;  1VQD A;  1Q7Y C;  3U50 C;  3HOY H;  1VQJ A;  4K0K Q;  1Y1W G;  2IX1 A;  4LNQ A;  1L1O C;  1NMG A;  4PZ6 A;  4QL5 A;  1IBL Q;  4LF5 Q;  3CCJ A;  4LF7 Q;  3I4N H;  1VQ8 A;  1GVP A;  1EUJ A;  2PNH A;  4QQB X;  4B3S L;  4JOI A;  4BY7 G;  4IJL A;  4KHP L;  3TRZ A;  2JA6 H;  1X54 A;  4KLK A;  3PO2 G;  4EQ5 A;  4YHH Q;  3H3V I;  1EOV A;  4L5T A;  3UE0 A;  4DR5 L;  2K5N A;  2WB1 E;  3L2P A;  1WCM H;  4X62 L;  4JOI C;  2VNU D;  4HJ8 A;  3EBE A;  1WOC A;  2B3G A;  4LFA Q;  4A3E H;  2YV5 A;  3PGZ A;  3PUV A;  3U4V A;  2RF4 A;  5C4J H;  2K52 A;  5C3E H;  3CME A;  1T9H A;  4GOP B;  3T1Y Q;  1UEB A;  3D31 A;  1HR0 L;  4DK6 C;  1AH9 A;  4APV A;  4A3M G;  1N33 L;  3U58 A;  2AKW B;  4AYB E;  4JI3 Q;  3KLW A;  3GTK H;  2N8N A;  3PUY A;  1W3S A;  3PSI A;  4JV5 L;  2IHE A;  2OTL A;  3PIO A;  2JA9 A;  1Y1W H;  2JA8 G;  2ZM6 L;  3RZO H;  5IP7 G;  1UE5 A;  4DR6 Q;  1VQP A;  1VQA A;  1SRU A;  4DUZ L;  4IPG A;  1XPR A;  4POG A;  2QEX A;  1PH8 A;  5ELN A;  1KRT A;  1N36 L;  2F4V L;  3KF6 B;  4BY7 H;  1H95 A;  4JG2 A;  1CKM A;  2HQL A;  4DV4 Q;  1YBY A;  5JEA G;  1N34 L;  2UU9 Q;  2ZJQ A;  3J81 j;  4PMW A;  1Q81 C;  1P8L A;  4A93 G;  1GO3 E;  3K8A A;  3HKS A;  4JC0 A;  5IY0 A;  2ES2 A;  4KHZ A;  4GOP A;  3RZD H;  4LF4 Q;  2UUA Q;  3OTO Q;  3CCL A;  5DLQ E;  4GLA C;  1I94 L;  2KCM A;  3STB D;  4JI6 L;  2IX0 A;  5IYD H;  4LF6 L;  1PH7 A;  3GO5 A;  4GOP C;  2Z0S A;  1IBK Q;  2UUB L;  4A3M H;  3GTP H;  2E2H H;  4JI2 L;  1E1T A;  4GKK Q;  3K7U C;  3M7N A;  5GQO A;  1QVG A;  3AEV A;  4R4O A;  2JA8 H;  4LFC Q;  3S2D H;  3CC2 A;  1U0L A;  5HY6 A;  4R4T A;  3CCS A;  4GKJ L;  1N32 L;  1NTG A;  4DR2 Q;  2WB1 G;  1Z47 A;  1VQK A;  1QVC A;  2KBN A;  3B6Y A;  4GN5 A;  4C3H H;  1IL2 A;  3UDI A;  1K0R A;  3PCO B;  4JI5 L;  4GN4 B;  5C44 G;  3DLL A;  1XJV A;  1PYS B;  2HIX A;  3U4Z A;  1VQ6 A;  1S3O A;  2H5X A;  2AWN A;  2NZO A;  2ALY B;  4JI8 L;  1HNX L;  2UXB Q;  1PH5 A;  4A93 H;  2R7D A;  3AFQ A;  2E5L L;  2F52 A;  2IHF A;  1W2B A;  1FJG L;  3STB C;  4AYB G;  4DV2 L;  1YIJ A;  4NXN Q;  4IFD J;  1G6P A;  2I5M X;  4LF9 L;  2R93 G;  2MO0 A;  1KIX A;  2I0Q A;  2E8G A;  1XPO A;  1Y1V G;  3DM3 A;  4MNO A;  3PUW A;  4YY3 L;  2IT1 A;  2YTX A;  2DGY A;  2OTJ A;  1TXY A;  4GS3 A;  2A19 A;  2JK8 A;  3G71 A;  1EYG A;  4P75 A;  2WAQ E;  1X55 A;  2GVA A;  2N49 A;  1X3F A;  1TWA H;  3NEM A;  3A0J A;  4J15 A;  4A3D G;  1PVO A;  4DR3 L;  2Q2H A;  3FHW A;  1VQI A;  5M5X H;  4LUZ A;  3CP0 A;  4LF8 L;  5C0X J;  1PH4 A;  4WJ3 M;  3GD7 A;  4HJ5 A;  1IBM Q;  1X6O A;  3I4N G;  2D0P A;  1XMQ L;  1XTD A;  3NEL A;  5BR8 L;  3HFZ B;  3CCQ A;  4JYA L;  4DPG A;  1KXL A;  4DK3 C;  2VQE Q;  2GN5 A;  3W5O A;  3K80 C;  3PO3 H;  1I6H H;  2BH2 A;  3ERS X;  2WFW A;  1TWG H;  4JI1 Q;  4DR1 Q;  1VQG A;  2HHH L;  1BBW A;  1XNR Q;  1L0W A;  2JA6 G;  3I4M G;  3W1G A;  2UXD L;  2R93 H;  3CCV A;  4DV1 Q;  4DV7 Q;  1Y1V H;  4H02 A;  1X9N A;  1LYL A;  3CQZ H;  4LUV A;  1YJN A;  2VQF Q;  3GTG H;  1X3E A;  3KF8 B;  5LMU L;  4WJ4 A;  2A1A A;  3M9B A;  3G6E A;  1E3P A;  3NBH B;  1OXS C;  5LMN Q;  3MEF A;  3CMA A;  3F2D A;  2HT1 A;  1IXR A;  1J6Q A;  1MIU A;  3I55 A;  4R1J A;  4UY8 C;  4XIG S;  1BVS A;  1Q46 A;  2C35 B;  3AYH B;  3S14 H;  3S16 H;  4DR4 L;  4A3D H;  1L1O A;  1E1O A;  3TS0 A;  4OO1 G;  3UDG A;  4KHP Q;  4GN3 B;  3RLN A;  4B3M L;  4B3T L;  2R92 G;  4IPH A;  3J80 i;  1EIY B;  5IP9 H;  2VS1 A;  3S15 H;  1EFW A;  2UXC L;  1X3G A;  1Q1B A;  3BJU A;  4X62 Q;  2I5L X;  1SN8 A;  4X64 Q;  2Q2I A;  1HZA A;  1TWF H;  4JI7 Q;  1YJ9 A;  4DV3 Q;  4X65 Q;  2L15 A;  3H0G G;  2R7F A;  1A0I A;  1LM0 A;  2ID0 A;  1D8L A;  3TQY A;  2WAQ G;  3I4M H;  2YYZ A;  2VW9 A;  4HJA A;  3KFU A;  3M4P A;  4YWM A;  4A75 A;  4X66 Q;  3CCE A;  3RN5 A;  1GM5 A;  3HOU H;  2BA0 A;  2XGT A;  3JC6 6;  4JV5 Q;  1UE6 A;  2PQA B;  4OWT B;  2HIV A;  3JAM c;  1VQ5 A;  1HH2 P;  2ZM6 Q;  3F1Z A;  1S40 A;  3AFP A;  1DGS A;  1PH2 A;  5IYD G;  2A8V A;  4A3J H;  1VQN A;  1TWH H;  3CD6 A;  1A8V A;  3W1B A;  3KJP A;  4LW1 A;  1B8A A;  3A5U A;  3ICE A;  5JJK A;  4P71 A;  1N36 Q;  1C7Y A;  1I5F A;  4P74 A;  1NMF A;  1QUQ B;  5IT9 c;  5IWA Q;  4BY1 G;  1N34 Q;  4JBJ A;  1K73 C;  2R92 H;  3I7F A;  1CUK A;  1LUZ A;  1VQF A;  1VQH A;  1KRS A;  1EWI A;  1X56 A;  2XTI A;  2YTV A;  4R4I A;  2CFM A;  4DR7 L;  1VQB A;  1LTL A;  2EXD A;  4KI0 A;  4L5S A;  1WFQ A;  2JEA I;  3FKI H;  1YJW A;  4LF5 L;  3GTO H;  2OWO A;  3I56 A;  4LF7 L;  4LFB Q;  1G51 A;  2NVT H;  4Y52 H;  1I94 Q;  2Z6K A;  3H0G H;  4L5Q A;  3GTQ H;  4LF6 Q;  4JBW A;  3HKZ E;  4HJ7 A;  4O2D A;  3ULL A;  2JA7 H;  4JI2 Q;  4HIO A;  2OQK A;  2Z6K C;  2R6G A;  4YHH L;  5M3M G;  1OTC A;  1ASY A;  4L5R C;  4GNX B;  1C0A A;  2AWO A;  1JT8 A;  4YWL A;  4LFA L;  3ZJY C;  3M85 A;  5FLX c;  3Q8D A;  1Q86 C;  2CWA A;  4YCU A;  5FJ8 G;  3HOV G;  3CPF A;  1N32 Q;  4JI4 L;  4OX9 L;  4LFB L;  4DAY B;  4B3R L;  5ELO A;  3ULJ A;  3LGJ A;  1FL0 A;  1PH6 A;  3ULP A;  1JB7 A;  4BY1 H;  4RG1 A;  4DUY Q;  1M1K C;  1OXU A;  3J81 i;  3HOZ G;  1JJG A;  4ALP A;  3KF6 A;  2MFI A;  2MO1 A;  4DV2 Q;  1HZC A;  1KL9 A;  3M4Q A;  4QGU A;  4JI0 Q;  4NXM L;  4EX5 A;  1G29 1;  1EQQ A;  4DR6 L;  1HJP A;  3OW2 A;  2Q2T A;  4LF9 Q;  1UE7 A;  1ASZ A;  1S72 A;  2EQS A;  3HOW H;  4GNX A;  4DV6 Q;  4P73 A;  4BBS G;  4DV4 L;  2V1C C;  2UU9 L;  1JJ2 A;  3K0X A;  3PO3 G;  4AQY Q;  2K14 A;  5M3M H;  1N9W A;  1MKH A;  4OO1 I;  1IZ6 A;  3AQQ A;  3VDY A;  4GNX C;  5AJ3 L;  4A3G G;  1SLJ A;  3S17 H;  3M3Y H;  2VY3 A;  3CAM A;  5IE8 A;  2UUA L;  4LF4 L;  3KJO A;  5FJ8 H;  1UWV A;  4DR3 Q;  4MTN A;  1M90 C;  3HOV H;  3K81 C;  4DV0 L;  2ZTD A;  4LF8 Q;  1J5E Q;  2N3S A;  1OXT A;  5LMN W;  1K83 H;  4IO9 A;  4A3C G;  2Y0S E;  3RNU A;  4JYA Q;  5BR8 Q;  1YHQ A;  4XTC S;  3HOZ H;  1SRO A;  1CSQ A;  3HKZ G;  4OXP A;  2K50 A;  1WYD A;  4LFC L;  1XPU A;  3GTL H;  2HHH Q;  1JJC B;  5IYB H;  5K36 G;  2DUD A;  3J7Z C;  2YTY A;  1XMO Q;  3PF4 A;  4HJ9 A;  3OYY A;  1XNQ L;  1E7Z A;  1VQ7 A;  4BA2 I;  3EN2 A;  5JJL A;  1IYJ B;  1A63 A;  5IP9 G;  4IFD G;  1P16 A;  1OXV A;  3KOJ A;  4DV5 L;  2KHI A;  4NPS A;  3T1H Q;  4BBS H;  4HID A;  5LMU Q;  4R4C A;  2WP8 J;  4A3G H;  3CC4 A;  3M4O H;  4AIM A;  4DR4 Q;  4QY7 A;  2LXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...