1PFSA

Solution nmr structure of the single-stranded dna binding protein of the filamentous pseudomonas phage pf3, minimized average structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF3 SINGLE-STRANDED DNA BINDING PROTEIN
publication title Solution structure of the single-stranded DNA binding protein of the filamentous Pseudomonas phage Pf3: similarity to other proteins binding to single-stranded nucleic acids.
pubmed rcsb
source organism Pseudomonas phage pf3
molecule tags Dna binding protein
total genus 9
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1pfsA00
4YHHQ 4LF4Q 2OTLA 3M7NA 3I4NG 1QVCA 1EFWA 1TWGH 2VL6A 4BA1I 1X3GA 2JA6H 3RN5A 3CW2C 3CCLA 3S16H 1KQSA 4LF5Q 4DR3L 1Y1VG 2QEXA 4A3DH 2Q2IA 3M4QA 3KOJA 3KFUA 3GTQH 1J6QA 4A4IA 2R92H 3H3VH 1HZBA 1XNQL 1HZAA 2AMCB 3AQQA 4JG2A 3CC7A 1K8AC 1A62A 3CMAA 3E9HA 2WAQG 1PH2A 1IBLL 4DKAC 2JA6G 1LYLA 3AYHB 4PZ8A 2JA7H 1KXLA 4JCVE 4C2MH 1L1OC 5GADC 4GNXA 1RL2A 2GN5A 1X55A 1IBMQ 2E5LQ 4IPDA 3K80C 2N3SA 2R92G 1OXSC 1N32L 5HY6A 3CCRA 4L5QA 3BJUA 4XIGS 3A74A 5M5YH 4OWXB 4JOIA 5IYCG 3HOZG 1C7YA 1VQNA 3GTOH 1Q46A 2VNUD 2K5HA 3TS0A 1QZHA 2WB1E 4QIWE 4YY3L 4KHPL 3PO2H 3U50C 4QJFA 3NENA 4JC0A 4X65Q 3NELA 3DLLA 3FP9A 2UUAL 4DV7Q 5FJ8G 1JJCB 3HOUH 1WI5A 1VQFA 1PH1A 1LTLA 4BY7G 1Q8KA 4A3MG 2VUMG 3I2ZA 1C0AA 1KRTA 3HFZB 1YJNA 2B63G 2PI2E 3K0XA 4LF7L 3JC66 4JI1L 4GNXC 3I7FA 1VQAA 1NE3A 4UP7A 5M3MH 4YWLA 4JI8L 4X66L 4R1JA 1E3PA 1UEBA 3HOXH 4EQ5A 1YIJA 4LUVA 4L5SA 1N36Q 4GOPA 4JOIC 4OO1I 1HZCA 4OWTB 3GTKH 1WYDA 3HKSA 3STBD 1HNWQ 1YNXA 1YJWA 2HT1A 1EOVA 3PIOA 1SLJA 4AIMA 3L2PA 4JI5Q 1VQGA 5IYDG 3BU2A 4DR5Q 1EIYB 4LF6L 2UXDL 4A3BH 2HIXA 5IYBH 4A3GG 3HOWH 4UP9A 3KYHC 5IY0A 1WOCA 4UPAA 3TS2A 2IX1A 1X65A 2N49A 1SR3A 3CPWA 4GS3A 1X56A 2QA4A 4PZ6A 4JI3L 1CSPA 1GVPA 4FDBA 2GVAA 4B3RQ 5JEAJ 3RLOA 2NN6I 4A3BG 4GKJL 2BA1A 5H1SE 2IX0A 1BVSA 3MEFA 1MKHA 1UE6A 3KDFA 5C44G 3W1BA 3S24A 1B7YB 4GOPB 4GOPC 3HOYG 3CAMA 4LF5L 1I94L 1G291 4C3IH 5C0XJ 3ULJA 3CC2A 4DK6C 2F4VQ 3CCVA 1I6HH 2UUCQ 1JT8A 4LWCA 1FJGL 1CKNB 1ASZA 2UXBL 2AKWB 2Q2TA 3PO3G 2K75A 2E2JH 2JQOA 5AJ3L 3L0OA 2E5LL 4A93G 3S1QH 2R7FA 3H0GG 5C0XG 1H95A 2WB1G 4JI2Q 3J80c 3J80i 1K0RA 2DUDA 5BR8Q 3CXCA 3G6EA 4A3JG 1BKBA 5FLMH 4A3KH 1X6OA 4JI0Q 4DR6Q 3PUXA 2VQFQ 2K5NA 1VQ8A 1PHJA 4TQUS 1XMQQ 4OONA 3EIVA 3KDFB 4WJ4A 1Q7YC 1Y1WG 4J15A 3GTGH 4A3IG 2Q2HA 2VY3A 4AH6A 1S40A 1PH6A 4GKKL 2VW9A 4DV7L 3G71A 3WWVA 3J7A5 1VQ4A 1IL2A 2YTYA 2RHQB 2OCEA 1J5EQ 2ASBA 2NVTH 4HIOA 4A3CG 4IPGA 1N34L 3S2DH 1IBKL 2NVXH 3G48A 1Z9FA 2YTXA 1DGSA 2EXDA 3TEHB 4AQYL 1FVIA 1A8VA 1GD7A 3TRZA 1UWVA 1LM0A 1VQIA 2VZAA 5HGQA 5M5WH 1YZ6A 5LMNL 3OW2A 4LW1A 4KHZA 1YHBA 2Q2UA 4TVAB 3I4MG 2HHHQ 3K7AH 4H02A 4C3HH 2K4KA 1I5FA 1V1QA 5C3EG 4OXPA 4NXNQ 3PIPA 1YVCA 4DV1Q 1IZ6A 4JBMA 4BXXH 3TQYA 2JJQA 4LUZA 1HNWL 5JJLA 3W5OA 3M3YH 3CCJA 4B3MQ 2UXBQ 1U5KA 1UE5A 2I5LX 4DR5L 1FL0A 1CKOA 4JI7Q 2HQLA 1E24A 3KJOA 3GTMH 4OO1G 1XNRL 1JJ2A 1UE7A 4GLXA 1X54A 4X64Q 4JYAQ 1YEZA 1UE1A 1CSQA 4EX5A 4IO9A 3S14H 4IJLA 5IT9c 3IRBA 5LMUQ 3RZDH 4IFDJ 1Q82C 4P72A 3OYYA 3CC4A 1FGUA 1HNZQ 1VQJA 1VQKA 3I4OA 3T1HL 2UUBL 3A5ZB 3HOVH 1L1OB 5IE8A 3S15H 2Z0SA 4A3DG 4QQBX 4LF9Q 2JEBI 1AE3A 3UDXA 3F2CA 2OTJA 3EBEA 4OWWB 4HIKA 1HR0W 4GLAC 2UUCL 1YHAA 2CWAA 2ID0A 3CPFA 4LFCL 4LNQA 3UDFA 4UY8C 4IFDG 1VQLA 3D0FA 2JA7G 1B70B 3K7UC 1RIPA 1N8RC 4DR4Q 1VQPA 2VQEL 4NB3A 5DLQE 1TWAH 2KCMA 4DUZQ 3K81C 4KI0A 5GAEC 4JI2L 1N33L 2Z6KA 4P75A 3PUVA 5BR8L 1HNXL 5C4JH 3G4SA 1N9WA 4JI0L 2AWNA 1I3QH 3AEVA 4JI4L 1XTDA 4B3TL 4DV2L 2JA8H 4R4QA 4IOCA 1W2BA 1VQ6A 3PO2G 4GNXB 2UXCQ 2F52A 1MIUA 4Y52H 3CQZH 3PSIA 3TREA 4JBKA 1XPUA 5C4XH 2LXJA 3HOUG 1OXXK 1D7QA 1BBWA 1NTGA 1XMOL 1YHQA 4DUYL 2PNHA 1PH7A 4BBSH 1J5EL 3FKIH 3CCEA 1K9MC 2F3IA 1GKHA 1HH2P 1PFSA 5LMNW 4K0KQ 5JJKA 5M3MG 3U4ZA 3PF4A 1E22A 4A3EH 3HOXG 1Q86C 4RMFA 3T1YQ 4DR4L 4P71A 1OTCA 3VDYA 2HHHL 2Z6KC 4NXNL 1YITA 4X6AH 2JEAI 1K83H 3ER0A 4DV1L 3B6YA 3FHWA 3OTOQ 2ES2A 2ZM6Q 4DR1Q 1EQQA 1PV4A 1PH9A 4ALPA 4X62Q 2LXKA 1A0IA 1JE5A 1PVOA 1PYBA 3A0JA 2NVYH 4YHHL 4LF4L 3KF8B 4QL5A 4QGUA 5IYBG 1NJIC 3HKZE 4POGA 3HOWG 1SN8A 3J81j 4OX9Q 2ALYB 3I55A 4DR7Q 5E7NA 4DR2Q 2HIVA 1G6PA 3CMEA 4X64L 2ZTCA 3M4OH 4HIMA 3GDEA 1VCIA 1XPOA 2B29A 2D62A 3PGZA 2UU9Q 1TXYA 4JI6Q 2IHFA 1WJJA 4RG1A 1VQ7A 1SE8A 3W1GA 1KRSA 4L5TA 2K5VA 1IBML 1WCMH 2PQAA 1X3EA 4LF9L 3MXNB 3PUZA 3CCQA 5IWAQ 4GN3B 3U4VA 4HJ8A 4PZ7A 1KC8C 5IP9H 4MZ9A 1CUKA 3M85A 1Q81C 4L5RC 2K14A 2JA5H 2DGYA 1X9NA 2ZTDA 1B8AA 3RN2A 3ULLA 3UE1A 1N32Q 4R4IA 1G51A 3BZKA 3S17H 5M3FH 1A63A 4DUZL 4X65L 2A19A 1NBWA 2D0OA 2KCTA 1KIXA 3S2HH 5FLMG 4A3KG 1KD1C 4AYBE 2EIFA 3PUYA 2CWPA 4P73A 4O2DA 1T9HA 2R93H 5K36G 2UUAQ 4DV5Q 2WP8J 2PQAB 2B3GA 3S1NH 1Q1BA 1TWFH 4KLKA 3U58A 1O7IA 2IT1A 2MNAA 4DNIA 1N36L 2YYZA 2ZTEA 3Q8DA 2C35B 3J7ZC 2H5XA 4HJ7A 2A1AA 1JMCA 1W3SA 4K0KL 1K73C 3K8AA 5EAYA 4JI5L 1VQHA 3AFQA 2R7ZH 2JK8A 4A3LH 5GAHC 2KBNA 4IOAA 4LF8Q 4HJ9A 1PYSB 1SFOH 1QVFA 2JA9A 4LUOA 4ME3A 4BXXG 1ASYA 3HKZG 2AHOB 1VQOA 4HIDA 4POFA 5IP7H 2ZM6L 4LF6Q 2UXDQ 2RHSB 4BY1H 2MQHA 3J81c 4YCWA 5FLXc 1K8GA 4B3RL 3J81i 2E2IH 3I4NH 1C9OA 1VQBA 3NEMA 4DAYB 5JJIA 2PI2A 2A8VA 3UE0A 2OQ0A 2BH2A 2R6GA 1Y1VH 1OXVA 1SROA 4OX9L 1E7ZA 3ICEA 1XJVA 3GO5A 4JV5Q 3M9BA 4DR7L 3ULPA 1JJGA 2QGQA 1XPRA 1LUZA 2F4VL 1EYGA 3ZJYC 2NN6G 2UU9L 2K52A 2RCNA 1GM5A 3EN2A 3PCOB 1X3FA 4JI6L 3GD7A 4XTCS 4BBSG 3A5UA 2ATWA 3HOVG 1I94Q 1MJCA 5C0XI 2YTVA 2VS1A 1FJGQ 2NZHA 1OXUA 3M4PA 2OQKA 4PG3A 2GVBA 4DK3C 3KJPA 5IWAL 1HZ9A 1U0LA 1HR0Q 5IYCH 5ELNA 1MJEA 3HOZH 4DR6L 1I50H 1PH3A 3BZCA 2IHEA 2VQFL 5AJ3Q 3RR5A 3RZOH 5GAGC 4AYBG 1XMQL 1PH4A 1VQEA 1AE2A 4JBWA 4P74A 4DV4Q 2E8GA 1KHIA 5ELOA 5FJ8H 1E1TA 4B3SQ 3GTJH 2V1CC 4BY7H 4IPHA 1P8LA 4A3MH 1SRUA 1BBUA 2KENA 4DV6Q 2I0QA 2JA8G 2B63H 3H15A 4IJHA 4UP8A 3GTPH 1PA6A 4MNOA 1M1KC 4IPCA 4GKKQ 4DV5L 3NBHB 5C4XG 1EUJA 1VS0A 4BBRH 4A76A 4LFAQ 2KHJA 2E2HH 1PH5A 2YU9H 1N34Q 2NVQH 3RLNA 1IBKQ 1R9TH 3FKIG 1VQCA 1Z47A 2XTIA 4AQYQ 2WFWA 2MO0A 2KHIA 1Q12A 1OXTA 5IYDH 5LMNQ 4B3ML 2N8NA 4JBJA 2D0PA 4LFBQ 3KLWA 4A3EG 1VQ5A 2JE6I 2L15A 2RF4A 4BBRG 4JI7L 4A3GH 4LF8L 3PF5A 4DV3Q 2ZJQA 2VUMH 2Y0SE 2IY5B 1CKNA 1JB7A 4NXMQ 2AWOA 1D8LA 1S3OA 3D31A 4YWKA 4DV0Q 3CP0A 4R4CA 4JYAL 1L2FA 4YCUA 1K3RA 2I5HA 4APVA 2PMZE 5LMUL 5C44H 1XNRQ 2MFIA 1QUQA 4MTNA 5GQOA 4DR3Q 1HNZL 1KL9A 3HOYH 4Y7NH 1EWIA 4NPSA 4O0AA 3LGJA 2CCZA 3GTLH 1KAWA 3H3VI 4JV5L 1XNQQ 1QVGA 2ZJRA 4A75A 1WFQA 1S72A 4IFDI 1IBLQ 2N78A 2UUBQ 5M5XH 3T1HQ 2CKZB 3PO3H 3F2BA 4A93H 3CCSA 2LSSA 1VQDA 1V43A 1WCMG 3E0EA 3H0GH 1PH8A 2OWOA 5JEAG 4C3JH 1NMGA 4LFCQ 2WAQE 4A3JH 2YV5A 4YCVA 3CF5A 1YI2A 1VQ9A 5IP9G 3S1MH 4WJ3M 1HR0L 2BA0A 3F8TA 5J3BA 2JA5G 1YBYA 4GLVB 2VQEQ 4YY3Q 4KHPQ 3E9IA 1L0WA 1Y1WH 4HJAA 1P16A 1QUQB 2BH8A 2CFMA 4R4OA 3DM3A 4YWMA 3KF6A 4DAMA 5M3FG 4DV4L 4A3IH 1N33Q 3CD6A 4GN5A 1HNXQ 3STBC 2UXCL 3ERSX 2EQSA 3PV0A 4JI4Q 2R7DA 1YJ9A 4B3SL 4B3TQ 2I5MX 3SGIA 1HJPA 1NMFA 4DV2Q 1M90C 4QY7A 1VQMA 1QZGA 4A3CH 3UDGA 4DV6L 4LF7Q 2NZOA 4BA2I 4JI1Q 2R93G 4A3FH 1AH9A 2FXQA 1IYJB 3L7ZC 3F1ZA 4JI8Q 4X66Q 3UDIA 4HJ5A 3I56A 1TWHH 1E1OA 2XGTA 1XMOQ 3I4MH 4DUYQ 3PUWA 5C3EH 3T1YL 2CQOA 1GO3E 4LFAL 4R4TA 3CCMA 4DPGA 4A3FG 1Q1EA 3F2DA 3OTOL 1TWCH 2K50A 4DR1L 3S1RH 2Y0SG 3CCUA 3RNUA 1SMXA 2MO1A 4X62L 2ZJPA 3KF6B 3AFPA 5GROA 4GN4B 2R7ZG 4A3LG 4LFBL 1L1OA 3RLFA 4PMWA 1EIFA 1IXRA 1NY4A 4DV3L 1EQRA 4JI3Q 1V9PA 3JAMc 1Y14B 1CKMA 5IP7G 4NXML 3JAMi 4DR2L 4BY1G 4DV0L 4GKJQ
chains in the Genus database with same CATH superfamily
5IGGA 1QVCA 1EFWA 3CCLA 4A3DH 1Y1VG 2QEXA 3M4QA 3KFUA 2DNEA 3GTQH 3OMGA 1J6QA 5K5PA 4FF3A 4FXDA 3T16A 3IFTA 5LL6X 3Q22A 3DWPA 4J1MA 3AQQA 4JG2A 3K58A 3CMAA 3V2TA 2JA6G 1LYLA 1L1OC 1O7LA 1ZYRC 2GN5A 4QUCA 5EPJA 5HY6A 4L5QA 2MHVA 4IUUA 5JOBA 4JOIA 1C7YA 4U673 1CI3M 2K5HA 3TS0A 3NUCA 4YY3L 4O42A 4X65Q 3DLLA 2SNSA 2UUAL 1JC7A 2E2DC 3DEOA 5KNBA 1JJCB 2F1MA 1F2ZA 1PH1A 1LTLA 1A2UA 4BS9A 4DAPA 3I2ZA 4R8IA 2EYFA 1SAPA 3C1FA 1KAAA 3K0XA 2OEOA 4LF7L 4JI1L 2RSOA 1VQAA 1NE3A 3HP3A 3KF8A 4UP7A 4KK7A 4HN7A 1E3PA 3HOXH 1SYEA 4EQ5A 3MC0B 4NKLA 4HCSA 1EOVA 3DWQA 3PIOA 1SLJA 3MXGA 4DR5Q 3ERQA 4LF6L 1S5FD 4L6TB 2HIXA 5FK9C 3HOWH 4UP9A 4UPAA 3S14B 1O78A 4N8FA 1X65A 2IX1A 1GVPA 4B3RQ 3RZDB 1E2ZA 1CZWA 5CV8A 2LFNA 3OIQA 1MKHA 2XVSA 1A6XA 5C44G 3S24A 5I6YA 4GOPC 1H9MA 5C0XJ 2UUCQ 4I65A 4Q5VA 2EYOA 1ASZA 4AYBB 2Q2TA 2JQOA 1I4RA 3J7AV 5AJ3L 3L0OA 3I4LA 1F2YA 1X3QA 5C0XG 3H0GG 4JI2Q 3J80c 3E5SA 1STGA 4C3JG 3J80i 2DUDA 4A3JG 3G6EA 4NP5A 1YNJD 2K5NA 1VQ8A 4OONA 2OXPA 4J15A 2F0QA 4K5XA 1TS5A 2Q2HA 2VY3A 1YNNC 2F0JA 2VW9A 2QCPX 2D9UA 3FKIB 1FNUA 4B08A 2ASBA 3MWYW 1N34L 4G7ZC 1IBKL 1DGSA 2EXDA 2YTXA 3FDTA 3EJIA 3TEHB 1GD7A 3A55A 3QIAA 5F2DA 3OW2A 2Q2UA 4TVAB 3I4MG 4H02A 3HRZC 2K4KA 3TN2A 3PIPA 1EY6A 1IZ6A 1RODA 2Z4HA 1WTXA 3W5OA 3CCJA 2G9DA 1X3PA 1UE5A 5C4ZA 2QW7A 2K33A 1EY9A 2WKCA 3K59A 1O7ZA 1FR3A 2F0NA 3HZXA 2A69C 1JOKA 1UE7A 4GLXA 2FJ2A 5T1IA 2JN4A 3S14H 4IJLA 3IRBA 3OWEB 5C5LA 3RZDH 3OYYA 3CC4A 3NE5B 1FGUA 1EU4A 1WCMB 3I8ZA 4RKBA 2IJ0A 3A5ZB 1PTOF 3NTHA 4A3DG 2JEBI 1AE3A 5I9PA 2K5QA 2CWAA 4RWSC 2PCFB 4UY8C 2F0EA 3S17B 5A2QL 3FMCA 1VQPA 4NB3A 2EY5A 5DLQE 5IGCA 1SNOA 3S2HB 3R93A 4DUZQ 3K81C 3C3LA 3IL8A 2PPBC 3Q0AA 3G4SA 2AWNA 4JI4L 1F9SA 1XTDA 2VB3X 1TR5A 1W2BA 4GZYC 3H94A 1TWFB 4G57A 4PMCA 2IW3A 3KK7A 1EEID 3PSIA 1KNAA 3TREA 1XPUA 2LXJA 1YHQA 3RD4A 1EZ6A 1PLFA 2KHSA 3FKIH 1K9MC 1UUPA 1U4LA 4K0KQ 3D4DA 2A68C 5LMNW 3PF4A 1E22A 4UHVA 1PDQA 3HOXG 2Z6KC 3G7LA 1Q8IA 1RJTA 3U9SA 2PW5A 1GXDC 1LT4D 2ES2A 3I4NB 3OHXC 1PV4A 3P75A 4ALPA 3VR5A 2QDBA 1TY2A 2ZT9C 1QILA 4QL5A 3I90A 3SK5A 3HOWG 4POGA 3LWEA 4OX9Q 1D1IA 4RH6A 2HIVA 4X64L 2ZTCA 1VCIA 2B29A 2A6EC 2UU9Q 2WACA 3D6WA 1BBXC 3E3XA 4DNTB 1DONA 1HQRD 1WCMH 1FD7D 1ESFA 3MEHA 3KLRA 5IWAQ 1I50B 1ET9A 5IT9E 3RZOB 2MUYA 5D3IB 1RKNA 1UEAB 1QJOA 5JAVA 4KKSA 4FP5D 1B8AA 1RTOA 3UE1A 4ULLA 3S17H 2SDFA 4BY7B 5CV9A 2KCTA 1KIXA 3S2HH 1X32A 1ICWA 1KD1C 2B63B 4AYBE 1D5ZC 3TMEA 1TT2A 3PUYA 3OPOA 3TP7A 2O5IC 4DV5Q 5HURA 5JPNC 3Q23A 1Q1BA 1TWFH 4KLKA 2MNAA 1N36L 4EGVA 2KCCA 3BDOA 4K6DA 2CW0C 4JI5L 3AFQA 1LTTD 1STHA 2EY2A 2JK8A 3NSWA 4A3LH 1QOHA 4LF8Q 2A5HA 2VUMB 1PYSB 5M9OA 1KDBA 4POFA 1AW7A 3FPPA 2EYHA 2ZM6L 1W6JA 1JE4A 2RHSB 2A6HC 3J81c 4YCWA 3J81i 3I4NH 1E0BA 3NEMA 3HOYB 3GTLB 2R6GA 2H4OA 4EQOA 2HQEA 2ZXRA 3GO5A 2MGSA 4DXGA 2CVRA 3EVQA 2RCNA 3EN2A 1H9KA 4JI6L 4XTCS 1JWUD 3A5UA 5FLXL 1HUNA 1NR2A 3M4PA 1HR0Q 3CU7A 5ELNA 1Y1WB 4DR6L 2XN9C 1I50H 2G9HD 3BZCA 2EYLA 3RZOH 1LV9A 4AYBG 1XMQL 1VQEA 4JBWA 3QG1A 5NUCA 1BR9A 1KHIA 3LWUA 4B3SQ 1LTGD 4BY7H 1P8LA 3C1EA 5EJWA 3OW7A 2I0QA 4MHEA 2B63H 2AUJD 1TWHB 1M1KC 4CKBA 1BXTA 4GKKQ 2N88A 4RGMA 5CYUA 1SYDA 2PMZB 4PNYA 1MSGA 2KHJA 3RLNA 1TWCB 3FKIG 1RHPA 2XTIA 4FNFA 5IYDH 1AZQA 4XT1B 1VQ5A 2KUMA 4ZKCB 5EKKA 3PF5A 2VUMH 4ID6A 4DV0Q 4YWKA 5FOBB 1SBBB 2JA6B 2DJFC 3WOFA 2KCNA 4EQPA 4YCUA 1WTRA 2CH4A 1XNRQ 4MTNA 5GQOA 1HNZL 3ND9A 3HOYH 3H3VC 1EWIA 4NPSA 2CCZA 3UI2A 3GTLH 3H3VI 2RA4A 2LY7A 5LL6S 4UAIA 1CHPD 1EOTA 4IFDI 1IBLQ 1DCZA 2X6LA 3E0EA 1VQDA 1WCMG 4K14A 1PH8A 4IUTA 3GTOB 2R3ZA 4YCVA 4WJ3M 2BA0A 4DA2A 1PRTB 2B2TC 3PO2B 1BUVT 1YBYA 2VQEQ 4KHPQ 3FEWX 1Y1WH 1I6VC 1U4MA 1P16A 4YWMA 1V8QA 2CFMA 3HOUB 3KF6A 3D4WA 3SK4A 2R7DA 1YJ9A 4B3TQ 2I5MX 1XTCD 3SGIA 4CBVA 1DYQA 1M90C 3DHQA 3OIPA 4K8JA 3OWFA 5CORA 3L7ZC 5EGTA 1R4QB 3GTKB 1TWHH 1E1OA 5HGTA 3PUWA 3J80L 3T1YL 2CQOA 3MAQA 2F0FA 1JORA 4QUFA 3OTOL 1TWCH 2K50A 4DR1L 3H91A 5FO9B 3RNUA 2MO1A 3KF6B 4LFBL 4A3LG 1NNXA 4DV3L 3SVMA 4JI3Q 1V9PA 4NXML 2IL8A 1DZ1A 1F2MA 4YHHQ 4LF4Q 3L9AX 3M7NA 3I4NG 4RHSA 4FYDA 1TWGH 2JA6H 4C3IB 1SYBA 4FVMA 1KQSA 4DR3L 1YNJC 5KGUA 3I70A 1HZBA 2AMCB 2E2JB 1A62A 1PH2A 4PZ8A 4JCVE 4GNXA 1IBMQ 2K1BA 2E5LQ 3K80C 4X3TA 2N3SA 2R92G 3A54A 1N32L 3BJUA 5C4HA 4QMGA 2TMPA 4TSSA 3OSOA 3GTOH 4IUQA 1C48A 4QB4A 3DM1A 3K6OA 3PO2H 2PNRC 4QJFA 4JC0A 3FP9A 4DV7Q 3HOUH 4BY7G 1F9RA 1Q8KA 1SNPA 1C0AA 3NWTA 1KRTA 2F0WA 2FFKB 5IOCA 4XQNA 1YJNA 1C4QA 5M5WB 2B63G 3S1QB 3S1NB 3I7FA 2RSNA 4JI8L 1UEBA 4F88A 1D5XC 1AFPA 4OO1I 3GTKH 2QF7A 1WYDA 3STBD 2HT1A 5JVG3 2L55A 5IYDG 1SYCA 3BU2A 2UXDL 5KNDA 3VYRA 3NP8A 3J7YW 1LT6D 2IWHA 4M1UB 3GTQB 1BCPD 1SR3A 2N49A 2QA4A 1X56A 2VUMG 5CC4A 1U4RA 2NN6I 4A3BG 4BBSB 3HOVB 3Q6SA 3KDFA 3W1BA 3HOYG 1I94L 2J0TD 2BCOA 4C3IH 3ULJA 3JAME 4DK6C 2F4VQ 4LMQD 3M7GA 1F9PA 2NWGA 4C56C 1Z6HA 1TWAB 2E2JH 3SEBA 4ZLTF 1H95A 1A3UA 4CJ1B 1I3QB 1L0YB 5BR8Q 2KECA 3CXCA 2B2VA 4JI0Q 2JA8B 3N52A 2VQFQ 1T5EA 1LLRD 1PHJA 3EIVA 3KDFB 3CQZB 1Y1WG 1JICA 3ONAB 1HPCA 1H9SA 1KTKA 2K01A 1PTOB 3WWVA 1JCKB 2EXZA 1VQ4A 1IL2A 2YTYA 2RHQB 2OCEA 1J5EQ 2F0OA 4IPGA 4AQYL 2Z1CA 4Z9CB 3TRZA 1UWVA 1LM0A 5HGQA 5M5WH 3S1QH 3S1NH 4HAEA 4KHZA 4KN4C 1K83B 2LS01 1I5FA 1V1QA 4DV1Q 3VR6A 1KLUD 2NVYB 1HXYD 1LTBD 1G8ZD 1A3TA 4DR5L 1CKOA 1H9SB 3M4YA 3GQBA 1E24A 3KJOA 4PMBA 3E6ZX 1JJ2A 3BDLA 1S5BD 1X54A 1YEZA 4MN3A 1UE1A 4IO9A 5IT9c 5ELBA 2B2YC 5LMUQ 2SOBA 5I2XA 3K57A 1JJGA 1PYWD 4BBSH 2UUBL 3HOVH 1ZXTA 3F2CA 2FMCA 1HR0W 4GLAC 2UUCL 3ZYYX 5KRUA 2JA5B 3CPFA 4LFCL 4LNQA 3J81L 2Z4IA 1TWAH 4WRDA 4KI0A 1GUNA 4JI2L 1N33L 5BN3A 1HCZA 2WINB 4J8QA 1EY0A 1WTPA 1HNXL 1I3QH 3BYYB 3CHBD 1WTVA 1ONLA 4DV2L 2JA8H 4R4QA 1VQ6A 3A8JE 3PO2G 1LO5D 5ELEA 3MXUA 3CQZH 3OMCA 3HOUG 4F7XA 1D7QA 1VMPA 1NTGA 2E76C 2JP1A 1XMOL 1PTOH 2PNHA 3CCEA 1HQMC 2F3IA 1GKHA 1HH2P 1G2TA 2R7ZB 4M8AA 2K7VA 3N6RA 1B1ZA 4RMFA 1OTCA 4MIUA 2MPMA 1YITA 4X6AH 2PZTA 1K83H 1FNWA 3ER0A 4BY1B 4V190 1PFMA 4NMZA 1EQQA 4ZK9B 1ET6A 1A0IA 1BNZA 1HFNA 2ICIA 2NVYH 1S4ZA 2EJGC 2FHTA 3KF8B 4QGUA 4WFN3 1NJIC 2O5JC 3HKZE 3AMUA 1UAPA 2ALYB 5E7NA 4DR2Q 3DUZA 3M4OH 2XNAC 4RGNA 3GDEA 2XRQD 2IHFA 5EQ0A 2B2UA 1SE8A 4X3KA 1VMCA 2XRSD 4C3IG 5IGBA 1Y8NB 5JEAH 4N9PA 3VR3A 3EFXD 3S9WA 5IP9H 1KC8C 3NXWA 3M85A 1Q81C 4Q0FA 2JA5H 3RN2A 4H44C 2D2CC 2N55A 4R4IA 1A63A 3GTJB 4DUZL 4A3MB 3I91A 3VR2A 1NBWA 1B44D 4ZKBB 3GV3A 2CWPA 4P73A 1T9HA 2UUAQ 3QJYA 1LT3D 2WKDA 2NVQB 3U58A 2F0GA 1O7IA 3T56B 2ZTEA 3Q8DA 2C35B 2EVBA 4HJ7A 1B50A 1W3SA 1F77A 4K0KL 3SK6A 2XWBB 2R7ZH 5GAHC 2SEBD 4IOAA 1WD1A 1QVFA 2QKIC 1PZJD 4ME3A 1IKLA 1B3QA 1EY7A 3HKZG 1VQOA 3SR1A 4LF6Q 3SE0A 4BY1H 2MQHA 1K8GA 1K8MA 3S2DB 3K0YA 3ND8A 3UE0A 4B9XA 2PO4A 2BH2A 3SDZA 1OXVA 1SROA 3NQTA 4OX9L 4JV5Q 3M9BA 3ULPA 5FO7B 1EYGA 3PO3B 2UU9L 1GM5A 3PCOB 2L5TA 3TDQA 4BBSG 1K8OA 3HOVG 2WB1B 4XXEA 1FGBD 3MZ5A 5C0XI 2YTVA 1M8AA 2L1BA 1DD2A 2VS1A 4B9WA 2NZHA 1OXUA 2J7ZA 5JVH3 3NTIA 4EQNA 5IWAL 3TP8A 1PH3A 3TBIB 5AJ3Q 3RR5A 1JOOA 1WVLA 3NK9A 4P74A 3TSSA 2C9OA 2Q8RE 5ELOA 5FJ8H 3GTJH 4TRDA 4A3MH 1SRUA 1GUSA 2KENA 4DV6Q 2JA8G 2OT2A 3I73A 4IJHA 4UP8A 3I72A 1PA6A 3T51B 4MNOA 1II3A 4DV5L 4FF2A 1EZ8A 5KNCA 4A76A 1VDZA 4LFAQ 1N34Q 2NVQH 1IBKQ 1VQCA 5FKAC 4B3ML 4JBJA 3QOLA 1LTSD 2F0LA 5G3LD 4JI7L 2PW7A 3CRKC 4LF8L 1M4VA 2HUGA 2JYOA 1CKNA 1EFID 4KTAA 1D8LA 3D31A 4JYAL 3BDCA 4FF1A 2I5HA 4APVA 1ZKOA 3LX0A 3S2DH 2R92B 4O0AA 3LGJA 1KAWA 1XNQQ 2ZJRA 2JA7B 5FLXE 1W6KA 4R9WA 1NR4A 5ELDA 1S72A 4G7HC 4C1NI 2CKZB 1Y8OB 1EU3A 3PO3H 3F2BA 2LSSA 5JEAG 4RKLA 4DK1A 2WAQE 3NHHA 2YV5A 3CF5A 1BDOA 3VYSA 5IP9G 1HR0L 1G2SA 1ILPA 5J3BA 2JA5G 1G6ZA 2P5ZX 1L0WA 4DAMA 4A3IH 3W3AA 2B8GA 1D1KA 4RGTA 3STBC 4NW2A 2UXCL 2CQAA 3QB3A 4JI4Q 3AU7A 4B3SL 4EVOA 1DXMA 4KMUC 2NZOA 2NTTA 3MXPA 1ML0D 4K5WA 2FXQA 4F8MA 1IYJB 1BQQT 3F1ZA 3K5OA 4X66Q 3UDIA 1HA6A 1BCPC 2AUKA 5L37A 4R4TA 3CCMA 4DPGA 1Q1EA 2B8FA 4A3BB 2NB0A 3CCUA 1TS2A 1DOLA 4X62L 2ZJPA 5GROA 2R7ZG 5IIFA 1L1OA 3RLFA 2VXWA 1LACA 1BF4A 2NYZD 3NTKA 3JAMc 1GUGA 1K28A 3T4AC 3JAMi 2OF1A 5IGDA 1UNSA 2F0KA 4BY1G 4DV0L 4GKJQ 2OTLA 4BA1I 1X3GA 2HDLA 3CW2C 3WDNA 4IN3A 4LF5Q 1ENFA 3VR4A 2Q2IA 3KOJA 3VA5A 4A4IA 2DNCA 1SMYD 2R92H 5IGEA 1K8AC 4I7AA 3E9HA 2WAQG 5ELCA 1IBLL 2JA7H 3E0JA 3DEPA 3OOCA 1RL2A 3J7AF 1X55A 4IPDA 1LTAD 1IKMA 4A3KB 1OXSC 5DM63 3CCRA 3A74A 4CDFC 1VQNA 2VNUD 3GTGB 1STNA 5IT9L 2WB1E 4KHPL 1JQYD 3U50C 3NPPA 4OELB 5FJ8G 3C2PA 2NVTB 2XWJB 1WI5A 1VQFA 1CA6A 2A74C 1QB5D 4A3MG 2EYJA 1BOSA 3R2TA 3HFZB 1MI2A 3JC66 5FO8B 1PRTD 5KEEA 3K7AB 4YWLA 4R1JA 4RA8A 1YIJA 1KDAA 1N36Q 4GOPA 4JOIC 4RCNA 1HZCA 1MGSA 1HNWQ 1YNXA 1YJWA 4DAVA 4JI5Q 4AIMA 3L2PA 1VQGA 2NTSA 5E4XA 4OIJA 1TWGB 1EIYB 3GTMB 5CV5A 4A3BH 2RVLA 5IYBH 4ZQ3A 5CR3A 4GS3A 4JI3L 1D5MC 1CSPA 1JR0D 4FDBA 5JPMC 2GVAA 3RLOA 1EEFD 1AN8A 5H1SE 3QWNA 3S15B 2IX0A 3MEFA 1ZEQX 2BDOA 4GOPB 4JK1C 2NUCA 1JT8A 4IQZA 3P20A 1FJGL 2UXBL 1G91A 3H09A 5C6AA 3A56A 3PO3G 2K75A 4OEMB 2E5LL 2R7FA 4CJ2C 2WB1G 1SYGA 2ICEC 5EPKA 1BKBA 4A3KH 4DR6Q 3PUXA 1XMQQ 2PZUA 1NUCA 5K36H 1B9NA 3GTGH 5C4XB 4A3IG 4AH6A 2IX3A 4DV7L 3J7A5 5DNFA 4HSVA 2NVTH 1E2WA 2HD3A 1Z9FA 2CH4W 1FVIA 4F87A 1VQIA 3PMFA 1YZ6A 5LMNL 4DR4Q 2HHHQ 3K7AH 5DEHA 4NXNQ 2K6AA 5CMDA 4JBMA 4BXXH 4LK1C 3TQYA 2R61A 2JJQA 5JJLA 2EE1A 3TP6A 1VF5C 1SSOA 1FL0A 2HQLA 5LHY1 1SE2A 1MD2D 3GTMH 4OO1G 1JOQA 4DGZA 1S5CD 2ZXPA 4EX5A 3DWAA 5D3DA 4H0LC 2EDGA 4P72A 4P2CB 1HNZQ 3I4OA 3T1HL 3MFYA 3S15H 5IE8A 1DOKA 2QEJC 1D6EC 4QQBX 4LF9Q 2RDFA 3T53B 1ICFB 1STYA 4G7OC 3IAYA 2ENBA 1VQLA 3D0FA 2JA7G 1B70B 1N8RC 1RIPA 3QO2A 1SNMA 4UDUC 4JPBW 2RBMA 2KCMA 4BWGB 2Z6KA 4P75A 1JWSD 1K0SA 2F03A 1HUMA 5BR8L 1N9WA 4HMJA 5EKLA 4JI0L 2A6ED 1MBYA 1TKWB 4GNXB 1CM9A 1AZPA 1DM0B 1MIUA 2F52A 4DFAA 5CBAE 4JBKA 5C4XH 4ZAIA 2LKVA 1OXXK 3DMUA 1BBWA 5EBCA 3HKZB 4DUYL 4K8IA 1J5EL 3TZDA 2Y0SB 1WTHA 1PFSA 3A7AB 5JJKA 5BN5A 3U4ZA 1RD9D 1LT5D 1SFOB 3T1YQ 4P71A 4K2LA 2NZ1D 3SHLA 4CDEC 4H7BA 1PTOD 4DV1L 3B6YA 3OTOQ 4DR1Q 4IURA 2PYKA 1CTMA 2LXKA 3PQIA 4KN7C 1SNDA 5IYBG 4FF4A 1SN8A 3J81j 3I55A 4U68A 4DR7Q 4R8NA 1G6PA 3CMEA 4HIMA 1O80A 1XPOA 2KOLA 3PGZA 1TXYA 5KYIA 1WJJA 2CHBD 4KJOA 3KBGA 1TY0A 3A8KE 5CV4A 1KRSA 4L5TA 4KHVA 2AQ1B 2PQAA 1X3EA 3PUZA 3CCQA 3HOZB 4HJ8A 3EA6A 4GN3B 3U4VA 4PZ7A 2BE5D 4L5RC 4CDDC 2DGYA 2B39A 2L9HA 4CHTB 2O4XA 4E6IA 3R3OA 4KY5A 1N32Q 1G51A 4ZUIA 1EY4A 4X65L 2A19A 1WD0A 2RCFA 2KVMA 2F0TA 4A3KG 1F9QA 2F0VA 5KYLA 4O2DA 1TU2B 3WOEA 5K36G 1HFGA 4KY6A 1CQVA 3V96A 5J22A 1XX8A 4L8JA 3K5MA 4ZYSA 2PQAB 4KD3A 2B3GA 2E2HB 2IT1A 1FNVA 2VB2X 2YYZA 1JMCA 1HRJA 3K8AA 1EL0A 4WJWA 1IL8A 5E3FA 1B9MA 2DY7A 1EY5A 2KBNA 1SFOH 2JA9A 4LUOA 4BXXG 3M4OB 1ASYA 2E75C 2AHOB 4HIDA 2UXDQ 2LMCB 5FLXc 4B3RL 1XXGA 1C9OA 4FXKC 5JJIA 4Y7NB 2PI2A 2A8VA 3BVZA 1IW7D 4DN4M 3ICEA 1SXTA 1TS3A 3TZUA 1A2TA 1U4PA 2QGQA 1LUZA 2WIIB 2EZVA 3ZJYC 2K32A 3BVMA 1ESRA 4A93B 3GD7A 2ATWA 4QIWB 1I94Q 1MJCA 2F0UA 3R8BA 5IGFA 3BS1A 5JJZA 4DK3C 3KJPA 2OQKA 1HZ9A 1NAPA 5IYCH 3HOZH 3JAML 1MJEA 2FINB 2IHEA 3K5LA 5GAGC 1PH4A 2JSOA 4HR7B 4DV4Q 4IPHA 5ISRA 1D2BA 1BBUA 2O2LD 1EY8A 2BDNA 4QF4A 2C5CA 3EQLC 4IPCA 5C3EB 1KDCA 1STBA 3MA2B 5C4XG 1EUJA 2EYMA 1TS4A 2E2HH 4AQYQ 2MO0A 2KHIA 1WTWA 1F2LA 2N8NA 1DOMA 1R4PB 1EIGA 3VYUA 4BBRG 2RF4A 4A3GH 1SMYC 1GUTA 1PXUA 4XYQA 2L11A 1IYVA 5D14A 2Y0SE 4PV1C 1JB7A 4S3SA 2K03A 3CP0A 2HCIA 2WAQB 1L2FA 2B2TA 3S16B 1K3RA 1CHQD 1J8IA 4KKTA 5T1GA 5AFWA 5TSSA 1V1PA 1KL9A 4Y7NH 2F0SA 2IPKD 2JXMB 4JV5L 1QNKA 1QVGA 2WV6D 4A75A 2XIWA 2TSSA 2EY1A 4C2MB 5A2QE 1RCVD 3C46A 4CJ0B 2PQEA 1SYFA 2UUBQ 4N8X1 5CBEE 4A93H 3CCSA 5M5YB 1ENCA 2OWOA 5COYA 1NMGA 4LFCQ 1VQ9A 1YI2A 1RDPD 1HA5A 1B53A 1PRTC 3F8TA 3KUPA 1EIHA 4XYOA 4YY3Q 2BOSA 4RHRA 1TIID 1V1PB 2SNMA 5EBDA 1PZID 1N33Q 4GN5A 1HNXQ 3GV6A 3ERSX 3PV0A 2RDGA 1EWHA 1NMFA 4DV2Q 4QY7A 1VQMA 5M3MB 1QZGA 4A3CH 4DV6L 4LF7Q 1I4QA 4HCEA 4JI1Q 4LJZC 2Z9HA 1AH9A 4YIJA 2Q8TA 1LABA 3I56A 2XGTA 1XMOQ 2L12A 5C3EH 4WORA 2Z6BA 1GO3E 4LFAL 4CDCC 4HMIA 1H9RA 4A3FG 3F2DA 2Y0SG 4GN4B 3DXJC 1EIFA 1IXRA 1K3BC 1NY4A 1EQRA 3D6CA 3K5NA 1CKMA 1BO0A 1GOZA 2VL6A 5BN4A 3RN5A 3S16H 1I4HA 4KV6A 1I6HB 3MHBA 1Q3LA 1SJED 1Q90A 5CV6A 3H3VH 3GP7A 1XNQL 4OL7A 1HZAA 2RKSA 3CC7A 5E4WC 4IFDH 5E1FA 1KXLA 4DKAC 3AYHB 4C2MH 5GADC 2AQ2B 4A3IB 1BCPF 1DJRD 1STAA 4XIGS 5M5YH 4OWXB 5IYCG 3HOZG 1Q46A 1Y8PB 1QZHA 1GJXA 1TVXA 3MVVA 4QIWE 1SE4A 3NENA 3NELA 2G5DA 2EYPA 3IKJA 1PZKD 2NVXB 2EJFC 1I4XA 2PI2E 4GNXC 5M3MH 4C3HB 2F0MA 4DR2L 3L3OC 4X66L 1XWEA 2M00A 4LUVA 4L5SA 2F3VA 3M3YB 2HCCA 4OWTB 3O13A 3QR8A 3HKSA 4JW0A 3T13A 3PIO3 2X6GA 4IZ8A 4N9TA 4A3GG 3KYHC 5IY0A 3V05A 1WOCA 3LNNA 2QILA 3TS2A 2K5DA 3CPWA 4QCLA 2AQ3B 4PZ6A 2DY8A 5JEAJ 4GKJL 2PZWA 2BA1A 2B2WA 1BVSA 3EROA 1UE6A 1CZGA 2KA7A 1B7YB 3CAMA 4LF5L 1G291 3CC2A 5C3WA 3NWSA 3CCVA 1I6HH 4LWCA 1OO9B 4OHJA 1CKNB 2AKWB 5C5MA 3P7JA 1S5ED 3HEJA 4A93G 5C4JB 5C3XA 1K0RA 1B3AA 4FXGC 1AP0A 1I4GA 5FLMH 1X6OA 4RFBA 3VA7A 4TQUS 1WTOA 3IFDA 4WJ4A 4RGOS 1Q7YC 4ILWA 5J1ZA 3H6MA 2EY6A 1S40A 1FYCA 1PH6A 1ZYRD 4GKKL 4O1NA 1PTOC 3G71A 4LAAA 4HIOA 4A3CG 1IYUA 2KEEA 2NVXH 3G48A 4A3EB 1A8VA 2VZAA 2B2YA 5EPLA 4LW1A 2Z8LA 1YHBA 4C3HH 5C3EG 3U9OA 4OXPA 2B2VC 4ME5A 2EPBA 1YVCA 4OO1H 3PIP3 4LUZA 1HNWL 3M3YH 4ZUJA 4B3MQ 1U5KA 1HTPA 2I5LX 4JI7Q 3CKIB 2H1EA 3Q24A 3F2UA 1GUOA 1XNRL 1CT1D 2BE5C 5ELFA 4X64Q 4KJNA 4JYAQ 1CSQA 3URYA 3BYTB 2M9VA 4ZCKA 1PMRA 2NN6H 4IFDJ 1Q82C 1VQKA 1VQJA 1L1OB 1IHZA 2Z0SA 3UDXA 4K2KA 2OTJA 2I46A 3EBEA 4OWWB 4HTHA 4HIKA 1YHAA 2ID0A 3UDFA 4IFDG 1AEXA 1L0XB 1JB3A 3K7UC 4OGQC 5M3FB 2VQEL 5GAEC 3R2IA 3PUVA 4IUVA 2D5DA 4ODGA 5C4JH 3AEVA 2R93B 1S5DD 4B3TL 4RAUC 4L63B 4IOCA 3CRLC 1V1OA 1QCBD 3J80E 2UXCQ 4Y52H 3HS0C 4FO2A 4DNRB 3BZDB 1QWYA 1PH7A 3KLSA 1B2TA 5M3MG 3BG3A 1IW7C 1Y69U 4A3EH 1Q86C 4DR4L 2L0CA 3VDYA 3SXHA 2HHHL 4NXNL 1YNND 4X3UA 2JEAI 3MXNA 3FHWA 4DXFA 5J39A 2ZM6Q 2E2IB 1PH9A 4X62Q 1JE5A 2I07B 1PVOA 1A15A 1PYBA 3A0JA 1ILQA 2XSCA 4YHHL 4LF4L 1Y1VB 1EYAA 1JWMD 3RMHA 5I9OA 4I7ZC 2D62A 1A3VA 5I6WA 1GHKA 1J9OA 4JI6Q 1XYIA 1SJHD 4RG1A 1T5XD 1VQ7A 3W1GA 1ENAA 1MHWC 1RF2D 2K5VA 3D8GA 1CA5A 1IBML 2M2LA 4LF9L 3MXNB 2RQXA 3W2DA 2E74C 2A69D 4MZ9A 1CUKA 2GA4B 2F0DA 2L4NA 2K14A 4MTKA 1X9NA 2ZTDA 3ULLA 5I2YA 3BZKA 5M3FH 4RCOA 2D0OA 2K04A 5FLMG 1GUWA 1NSNS 1SNCA 3GTPB 2EIFA 4ABNA 3HGBA 1TQOA 4IALA 1CK1A 2R93H 5EKIA 2B2UC 2WP8J 4BBRB 4DAYA 5I4DA 2YU9B 1R9TB 3TP5A 4DNIA 3J7ZC 4V0BA 2H5XA 2A1AA 5A35A 1K73C 5EAYA 1VQHA 1LTID 5IODA 4C3HG 4HJ9A 4JVZA 4KY7A 2Q8IB 1LTRD 5IP7H 1HTLD 3D3RA 2K5WA 5C44B 2DN8A 2E2IH 3SK8A 1VQBA 1EWCA 2A68D 4DAYB 3NBIA 2OQ0A 4C1NK 4IUNA 1Y1VH 2KJXA 1E7ZA 1XJVA 3A7LA 4DR7L 2EJMA 5CV7A 1XPRA 1RTNA 5M5XB 2F4VL 4NDXA 1O7YA 1QG7A 2A73B 2NN6G 2K52A 5G3LF 1X3FA 4XT3B 3H0GB 1VF7A 4KD4A 4C3JB 2J4XA 4A3JB 3S1MB 1CQFA 3NBHA 2DJGC 2EOTA 1FJGQ 4PG3A 2ZXOA 3HG9A 2GVBA 2UXBQ 1U0LA 2K05A 4PQXA 1NCVA 3I3CA 1SDFA 2VQFL 2F4IA 1AE2A 2E8GA 1KABA 4DU9A 1E1TA 2FMMA 2V1CC 1QE6A 2X69A 1SE3A 2F0PA 4A3FB 1SNQA 5D65A 3H15A 3GTPH 4DK0A 4TKOB 3I4MB 4IUPA 3NBHB 5DAUA 1VS0A 4BBRH 1PH5A 2YU9H 1R9TH 3S1RB 1Z47A 2NBFA 3FRPB 4X3SA 2WFWA 3KLSX 4CKEA 4XQJA 4HEDA 1Q12A 1I4PA 1OXTA 5LMNQ 3P1HA 3NQIA 2D0PA 4LFBQ 3KLWA 4A3EG 1HHVA 1EYDA 1EQVA 2JE6I 2L15A 4DV3Q 3QOJA 2ZJQA 2IY5B 4ZRZA 3D4RA 2AWOA 1H9JA 4NXMQ 1S3OA 3X3NA 3ITPA 1KLGD 3FVQA 4R4CA 3BVGA 1CFMA 2CW0D 2PMZE 4A3DB 5LMUL 5C44H 2MFIA 1QUQA 4DR3Q 1EYCA 3MFGA 3A8IE 3J81E 1WFQA 1PFBA 1KNEA 2N78A 5M5XH 3T1HQ 2A6HD 1SEBD 1QNUA 4OIKA 1PFNA 2F3WA 1EQTA 4CKCA 1V43A 3H0GH 4CGYB 5C0XH 2MJ8A 2RDHA 4C3JH 1C8CA 4A3JH 3S1MH 4GLVB 3FPUB 2KEDA 3E9IA 4K6LA 4HJAA 1QUQB 2BH8A 4R4OA 3AB9A 3DM3A 3KBXA 5M3FG 2F0HA 4DV4L 3CD6A 2V4DA 2EQSA 4K5VA 3G6JB 1HJPA 4KKUA 2B2WC 1GHJA 3UDGA 4BA2I 2R93G 4A3FH 3HOXB 1MSHA 4JI8Q 4A3GB 4XQQA 2HDMA 4HJ5A 3I4MH 1BCPB 4DUYQ 1STEA 2K28A 5KIXA 5DM73 4J6HA 1E2VA 4HSPA 3VYTA 3X3MA 1U9RA 3S1RH 1WTQA 4XDXA 3HOWB 1SMXA 4H13C 3AFPA 1B4OA 3MTSA 4PMWA 1Z7TA 2QDLA 4G4KA 4DF7A 2F0IA 1PRTF 1Y14B 3RUZA 5IP7G 5CGKA 2KQ3A 2MP1A
chains in the Genus database with same CATH topology
4YHHQ 4LF4Q 2OTLA 3M7NA 3I4NG 1QVCA 1EFWA 1TWGH 2VL6A 4BA1I 1X3GA 2JA6H 3RN5A 3CW2C 3CCLA 3S16H 1KQSA 4LF5Q 4DR3L 1Y1VG 2QEXA 4A3DH 2Q2IA 3M4QA 3KOJA 3KFUA 3GTQH 1J6QA 4A4IA 2R92H 3H3VH 1HZBA 1XNQL 1HZAA 2AMCB 3AQQA 4JG2A 3CC7A 1K8AC 1A62A 3CMAA 3E9HA 2WAQG 1PH2A 1IBLL 4DKAC 2JA6G 1LYLA 3AYHB 4PZ8A 2JA7H 1KXLA 4JCVE 4C2MH 1L1OC 5GADC 4GNXA 1RL2A 2GN5A 1X55A 1IBMQ 2E5LQ 4IPDA 3K80C 2N3SA 2R92G 1OXSC 1N32L 5HY6A 3CCRA 4L5QA 3BJUA 4XIGS 3A74A 5M5YH 4OWXB 4JOIA 5IYCG 3HOZG 1C7YA 1VQNA 3GTOH 1Q46A 2VNUD 2K5HA 3TS0A 1QZHA 2WB1E 4QIWE 4YY3L 4KHPL 3PO2H 3U50C 4QJFA 3NENA 4JC0A 4X65Q 3NELA 3DLLA 3FP9A 2UUAL 4DV7Q 5FJ8G 1JJCB 3HOUH 1WI5A 1VQFA 1PH1A 1LTLA 4BY7G 1Q8KA 4A3MG 2VUMG 3I2ZA 1C0AA 1KRTA 3HFZB 1YJNA 2B63G 2PI2E 3K0XA 4LF7L 3JC66 4JI1L 4GNXC 3I7FA 1VQAA 1NE3A 4UP7A 5M3MH 4YWLA 4JI8L 4X66L 4R1JA 1E3PA 1UEBA 3HOXH 4EQ5A 1YIJA 4LUVA 4L5SA 1N36Q 4GOPA 4JOIC 4OO1I 1HZCA 4OWTB 3GTKH 1WYDA 3HKSA 3STBD 1HNWQ 1YNXA 1YJWA 2HT1A 1EOVA 3PIOA 1SLJA 4AIMA 3L2PA 4JI5Q 1VQGA 5IYDG 3BU2A 4DR5Q 1EIYB 4LF6L 2UXDL 4A3BH 2HIXA 5IYBH 4A3GG 3HOWH 4UP9A 3KYHC 5IY0A 1WOCA 4UPAA 3TS2A 2IX1A 1X65A 2N49A 1SR3A 3CPWA 4GS3A 1X56A 2QA4A 4PZ6A 4JI3L 1CSPA 1GVPA 4FDBA 2GVAA 4B3RQ 5JEAJ 3RLOA 2NN6I 4A3BG 4GKJL 2BA1A 5H1SE 2IX0A 1BVSA 3MEFA 1MKHA 1UE6A 3KDFA 5C44G 3W1BA 3S24A 1B7YB 4GOPB 4GOPC 3HOYG 3CAMA 4LF5L 1I94L 1G291 4C3IH 5C0XJ 3ULJA 3CC2A 4DK6C 2F4VQ 3CCVA 1I6HH 2UUCQ 1JT8A 4LWCA 1FJGL 1CKNB 1ASZA 2UXBL 2AKWB 2Q2TA 3PO3G 2K75A 2E2JH 2JQOA 5AJ3L 3L0OA 2E5LL 4A93G 3S1QH 2R7FA 3H0GG 5C0XG 1H95A 2WB1G 4JI2Q 3J80c 3J80i 1K0RA 2DUDA 5BR8Q 3CXCA 3G6EA 4A3JG 1BKBA 5FLMH 4A3KH 1X6OA 4JI0Q 4DR6Q 3PUXA 2VQFQ 2K5NA 1VQ8A 1PHJA 4TQUS 1XMQQ 4OONA 3EIVA 3KDFB 4WJ4A 1Q7YC 1Y1WG 4J15A 3GTGH 4A3IG 2Q2HA 2VY3A 4AH6A 1S40A 1PH6A 4GKKL 2VW9A 4DV7L 3G71A 3WWVA 3J7A5 1VQ4A 1IL2A 2YTYA 2RHQB 2OCEA 1J5EQ 2ASBA 2NVTH 4HIOA 4A3CG 4IPGA 1N34L 3S2DH 1IBKL 2NVXH 3G48A 1Z9FA 2YTXA 1DGSA 2EXDA 3TEHB 4AQYL 1FVIA 1A8VA 1GD7A 3TRZA 1UWVA 1LM0A 1VQIA 2VZAA 5HGQA 5M5WH 1YZ6A 5LMNL 3OW2A 4LW1A 4KHZA 1YHBA 2Q2UA 4TVAB 3I4MG 2HHHQ 3K7AH 4H02A 4C3HH 2K4KA 1I5FA 1V1QA 5C3EG 4OXPA 4NXNQ 3PIPA 1YVCA 4DV1Q 1IZ6A 4JBMA 4BXXH 3TQYA 2JJQA 4LUZA 1HNWL 5JJLA 3W5OA 3M3YH 3CCJA 4B3MQ 2UXBQ 1U5KA 1UE5A 2I5LX 4DR5L 1FL0A 1CKOA 4JI7Q 2HQLA 1E24A 3KJOA 3GTMH 4OO1G 1XNRL 1JJ2A 1UE7A 4GLXA 1X54A 4X64Q 4JYAQ 1YEZA 1UE1A 1CSQA 4EX5A 4IO9A 3S14H 4IJLA 5IT9c 3IRBA 5LMUQ 3RZDH 4IFDJ 1Q82C 4P72A 3OYYA 3CC4A 1FGUA 1HNZQ 1VQJA 1VQKA 3I4OA 3T1HL 2UUBL 3A5ZB 3HOVH 1L1OB 5IE8A 3S15H 2Z0SA 4A3DG 4QQBX 4LF9Q 2JEBI 1AE3A 3UDXA 3F2CA 2OTJA 3EBEA 4OWWB 4HIKA 1HR0W 4GLAC 2UUCL 1YHAA 2CWAA 2ID0A 3CPFA 4LFCL 4LNQA 3UDFA 4UY8C 4IFDG 1VQLA 3D0FA 2JA7G 1B70B 3K7UC 1RIPA 1N8RC 4DR4Q 1VQPA 2VQEL 4NB3A 5DLQE 1TWAH 2KCMA 4DUZQ 3K81C 4KI0A 5GAEC 4JI2L 1N33L 2Z6KA 4P75A 3PUVA 5BR8L 1HNXL 5C4JH 3G4SA 1N9WA 4JI0L 2AWNA 1I3QH 3AEVA 4JI4L 1XTDA 4B3TL 4DV2L 2JA8H 4R4QA 4IOCA 1W2BA 1VQ6A 3PO2G 4GNXB 2UXCQ 2F52A 1MIUA 4Y52H 3CQZH 3PSIA 3TREA 4JBKA 1XPUA 5C4XH 2LXJA 3HOUG 1OXXK 1D7QA 1BBWA 1NTGA 1XMOL 1YHQA 4DUYL 2PNHA 1PH7A 4BBSH 1J5EL 3FKIH 3CCEA 1K9MC 2F3IA 1GKHA 1HH2P 1PFSA 5LMNW 4K0KQ 5JJKA 5M3MG 3U4ZA 3PF4A 1E22A 4A3EH 3HOXG 1Q86C 4RMFA 3T1YQ 4DR4L 4P71A 1OTCA 3VDYA 2HHHL 2Z6KC 4NXNL 1YITA 4X6AH 2JEAI 1K83H 3ER0A 4DV1L 3B6YA 3FHWA 3OTOQ 2ES2A 2ZM6Q 4DR1Q 1EQQA 1PV4A 1PH9A 4ALPA 4X62Q 2LXKA 1A0IA 1JE5A 1PVOA 1PYBA 3A0JA 2NVYH 4YHHL 4LF4L 3KF8B 4QL5A 4QGUA 5IYBG 1NJIC 3HKZE 4POGA 3HOWG 1SN8A 3J81j 4OX9Q 2ALYB 3I55A 4DR7Q 5E7NA 4DR2Q 2HIVA 1G6PA 3CMEA 4X64L 2ZTCA 3M4OH 4HIMA 3GDEA 1VCIA 1XPOA 2B29A 2D62A 3PGZA 2UU9Q 1TXYA 4JI6Q 2IHFA 1WJJA 4RG1A 1VQ7A 1SE8A 3W1GA 1KRSA 4L5TA 2K5VA 1IBML 1WCMH 2PQAA 1X3EA 4LF9L 3MXNB 3PUZA 3CCQA 5IWAQ 4GN3B 3U4VA 4HJ8A 4PZ7A 1KC8C 5IP9H 4MZ9A 1CUKA 3M85A 1Q81C 4L5RC 2K14A 2JA5H 2DGYA 1X9NA 2ZTDA 1B8AA 3RN2A 3ULLA 3UE1A 1N32Q 4R4IA 1G51A 3BZKA 3S17H 5M3FH 1A63A 4DUZL 4X65L 2A19A 1NBWA 2D0OA 2KCTA 1KIXA 3S2HH 5FLMG 4A3KG 1KD1C 4AYBE 2EIFA 3PUYA 2CWPA 4P73A 4O2DA 1T9HA 2R93H 5K36G 2UUAQ 4DV5Q 2WP8J 2PQAB 2B3GA 3S1NH 1Q1BA 1TWFH 4KLKA 3U58A 1O7IA 2IT1A 2MNAA 4DNIA 1N36L 2YYZA 2ZTEA 3Q8DA 2C35B 3J7ZC 2H5XA 4HJ7A 2A1AA 1JMCA 1W3SA 4K0KL 1K73C 3K8AA 5EAYA 4JI5L 1VQHA 3AFQA 2R7ZH 2JK8A 4A3LH 5GAHC 2KBNA 4IOAA 4LF8Q 4HJ9A 1PYSB 1SFOH 1QVFA 2JA9A 4LUOA 4ME3A 4BXXG 1ASYA 3HKZG 2AHOB 1VQOA 4HIDA 4POFA 5IP7H 2ZM6L 4LF6Q 2UXDQ 2RHSB 4BY1H 2MQHA 3J81c 4YCWA 5FLXc 1K8GA 4B3RL 3J81i 2E2IH 3I4NH 1C9OA 1VQBA 3NEMA 4DAYB 5JJIA 2PI2A 2A8VA 3UE0A 2OQ0A 2BH2A 2R6GA 1Y1VH 1OXVA 1SROA 4OX9L 1E7ZA 3ICEA 1XJVA 3GO5A 4JV5Q 3M9BA 4DR7L 3ULPA 1JJGA 2QGQA 1XPRA 1LUZA 2F4VL 1EYGA 3ZJYC 2NN6G 2UU9L 2K52A 2RCNA 1GM5A 3EN2A 3PCOB 1X3FA 4JI6L 3GD7A 4XTCS 4BBSG 3A5UA 2ATWA 3HOVG 1I94Q 1MJCA 5C0XI 2YTVA 2VS1A 1FJGQ 2NZHA 1OXUA 3M4PA 2OQKA 4PG3A 2GVBA 4DK3C 3KJPA 5IWAL 1HZ9A 1U0LA 1HR0Q 5IYCH 5ELNA 1MJEA 3HOZH 4DR6L 1I50H 1PH3A 3BZCA 2IHEA 2VQFL 5AJ3Q 3RR5A 3RZOH 5GAGC 4AYBG 1XMQL 1PH4A 1VQEA 1AE2A 4JBWA 4P74A 4DV4Q 2E8GA 1KHIA 5ELOA 5FJ8H 1E1TA 4B3SQ 3GTJH 2V1CC 4BY7H 4IPHA 1P8LA 4A3MH 1SRUA 1BBUA 2KENA 4DV6Q 2I0QA 2JA8G 2B63H 3H15A 4IJHA 4UP8A 3GTPH 1PA6A 4MNOA 1M1KC 4IPCA 4GKKQ 4DV5L 3NBHB 5C4XG 1EUJA 1VS0A 4BBRH 4A76A 4LFAQ 2KHJA 2E2HH 1PH5A 2YU9H 1N34Q 2NVQH 3RLNA 1IBKQ 1R9TH 3FKIG 1VQCA 1Z47A 2XTIA 4AQYQ 2WFWA 2MO0A 2KHIA 1Q12A 1OXTA 5IYDH 5LMNQ 4B3ML 2N8NA 4JBJA 2D0PA 4LFBQ 3KLWA 4A3EG 1VQ5A 2JE6I 2L15A 2RF4A 4BBRG 4JI7L 4A3GH 4LF8L 3PF5A 4DV3Q 2ZJQA 2VUMH 2Y0SE 2IY5B 1CKNA 1JB7A 4NXMQ 2AWOA 1D8LA 1S3OA 3D31A 4YWKA 4DV0Q 3CP0A 4R4CA 4JYAL 1L2FA 4YCUA 1K3RA 2I5HA 4APVA 2PMZE 5LMUL 5C44H 1XNRQ 2MFIA 1QUQA 4MTNA 5GQOA 4DR3Q 1HNZL 1KL9A 3HOYH 4Y7NH 1EWIA 4NPSA 4O0AA 3LGJA 2CCZA 3GTLH 1KAWA 3H3VI 4JV5L 1XNQQ 1QVGA 2ZJRA 4A75A 1WFQA 1S72A 4IFDI 1IBLQ 2N78A 2UUBQ 5M5XH 3T1HQ 2CKZB 3PO3H 3F2BA 4A93H 3CCSA 2LSSA 1VQDA 1V43A 1WCMG 3E0EA 3H0GH 1PH8A 2OWOA 5JEAG 4C3JH 1NMGA 4LFCQ 2WAQE 4A3JH 2YV5A 4YCVA 3CF5A 1YI2A 1VQ9A 5IP9G 3S1MH 4WJ3M 1HR0L 2BA0A 3F8TA 5J3BA 2JA5G 1YBYA 4GLVB 2VQEQ 4YY3Q 4KHPQ 3E9IA 1L0WA 1Y1WH 4HJAA 1P16A 1QUQB 2BH8A 2CFMA 4R4OA 3DM3A 4YWMA 3KF6A 4DAMA 5M3FG 4DV4L 4A3IH 1N33Q 3CD6A 4GN5A 1HNXQ 3STBC 2UXCL 3ERSX 2EQSA 3PV0A 4JI4Q 2R7DA 1YJ9A 4B3SL 4B3TQ 2I5MX 3SGIA 1HJPA 1NMFA 4DV2Q 1M90C 4QY7A 1VQMA 1QZGA 4A3CH 3UDGA 4DV6L 4LF7Q 2NZOA 4BA2I 4JI1Q 2R93G 4A3FH 1AH9A 2FXQA 1IYJB 3L7ZC 3F1ZA 4JI8Q 4X66Q 3UDIA 4HJ5A 3I56A 1TWHH 1E1OA 2XGTA 1XMOQ 3I4MH 4DUYQ 3PUWA 5C3EH 3T1YL 2CQOA 1GO3E 4LFAL 4R4TA 3CCMA 4DPGA 4A3FG 1Q1EA 3F2DA 3OTOL 1TWCH 2K50A 4DR1L 3S1RH 2Y0SG 3CCUA 3RNUA 1SMXA 2MO1A 4X62L 2ZJPA 3KF6B 3AFPA 5GROA 4GN4B 2R7ZG 4A3LG 4LFBL 1L1OA 3RLFA 4PMWA 1EIFA 1IXRA 1NY4A 4DV3L 1EQRA 4JI3Q 1V9PA 3JAMc 1Y14B 1CKMA 5IP7G 4NXML 3JAMi 4DR2L 4BY1G 4DV0L 4GKJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH Q;  4LF4 Q;  2OTL A;  3M7N A;  3I4N G;  1QVC A;  1EFW A;  1TWG H;  2VL6 A;  4BA1 I;  1X3G A;  2JA6 H;  3RN5 A;  3CW2 C;  3CCL A;  3S16 H;  1KQS A;  4LF5 Q;  4DR3 L;  1Y1V G;  2QEX A;  4A3D H;  2Q2I A;  3M4Q A;  3KOJ A;  3KFU A;  3GTQ H;  1J6Q A;  4A4I A;  2R92 H;  3H3V H;  1HZB A;  1XNQ L;  1HZA A;  2AMC B;  3AQQ A;  4JG2 A;  3CC7 A;  1K8A C;  1A62 A;  3CMA A;  3E9H A;  2WAQ G;  1PH2 A;  1IBL L;  4DKA C;  2JA6 G;  1LYL A;  3AYH B;  4PZ8 A;  2JA7 H;  1KXL A;  4JCV E;  4C2M H;  1L1O C;  5GAD C;  4GNX A;  1RL2 A;  2GN5 A;  1X55 A;  1IBM Q;  2E5L Q;  4IPD A;  3K80 C;  2N3S A;  2R92 G;  1OXS C;  1N32 L;  5HY6 A;  3CCR A;  4L5Q A;  3BJU A;  4XIG S;  3A74 A;  5M5Y H;  4OWX B;  4JOI A;  5IYC G;  3HOZ G;  1C7Y A;  1VQN A;  3GTO H;  1Q46 A;  2VNU D;  2K5H A;  3TS0 A;  1QZH A;  2WB1 E;  4QIW E;  4YY3 L;  4KHP L;  3PO2 H;  3U50 C;  4QJF A;  3NEN A;  4JC0 A;  4X65 Q;  3NEL A;  3DLL A;  3FP9 A;  2UUA L;  4DV7 Q;  5FJ8 G;  1JJC B;  3HOU H;  1WI5 A;  1VQF A;  1PH1 A;  1LTL A;  4BY7 G;  1Q8K A;  4A3M G;  2VUM G;  3I2Z A;  1C0A A;  1KRT A;  3HFZ B;  1YJN A;  2B63 G;  2PI2 E;  3K0X A;  4LF7 L;  3JC6 6;  4JI1 L;  4GNX C;  3I7F A;  1VQA A;  1NE3 A;  4UP7 A;  5M3M H;  4YWL A;  4JI8 L;  4X66 L;  4R1J A;  1E3P A;  1UEB A;  3HOX H;  4EQ5 A;  1YIJ A;  4LUV A;  4L5S A;  1N36 Q;  4GOP A;  4JOI C;  4OO1 I;  1HZC A;  4OWT B;  3GTK H;  1WYD A;  3HKS A;  3STB D;  1HNW Q;  1YNX A;  1YJW A;  2HT1 A;  1EOV A;  3PIO A;  1SLJ A;  4AIM A;  3L2P A;  4JI5 Q;  1VQG A;  5IYD G;  3BU2 A;  4DR5 Q;  1EIY B;  4LF6 L;  2UXD L;  4A3B H;  2HIX A;  5IYB H;  4A3G G;  3HOW H;  4UP9 A;  3KYH C;  5IY0 A;  1WOC A;  4UPA A;  3TS2 A;  2IX1 A;  1X65 A;  2N49 A;  1SR3 A;  3CPW A;  4GS3 A;  1X56 A;  2QA4 A;  4PZ6 A;  4JI3 L;  1CSP A;  1GVP A;  4FDB A;  2GVA A;  4B3R Q;  5JEA J;  3RLO A;  2NN6 I;  4A3B G;  4GKJ L;  2BA1 A;  5H1S E;  2IX0 A;  1BVS A;  3MEF A;  1MKH A;  1UE6 A;  3KDF A;  5C44 G;  3W1B A;  3S24 A;  1B7Y B;  4GOP B;  4GOP C;  3HOY G;  3CAM A;  4LF5 L;  1I94 L;  1G29 1;  4C3I H;  5C0X J;  3ULJ A;  3CC2 A;  4DK6 C;  2F4V Q;  3CCV A;  1I6H H;  2UUC Q;  1JT8 A;  4LWC A;  1FJG L;  1CKN B;  1ASZ A;  2UXB L;  2AKW B;  2Q2T A;  3PO3 G;  2K75 A;  2E2J H;  2JQO A;  5AJ3 L;  3L0O A;  2E5L L;  4A93 G;  3S1Q H;  2R7F A;  3H0G G;  5C0X G;  1H95 A;  2WB1 G;  4JI2 Q;  3J80 c;  3J80 i;  1K0R A;  2DUD A;  5BR8 Q;  3CXC A;  3G6E A;  4A3J G;  1BKB A;  5FLM H;  4A3K H;  1X6O A;  4JI0 Q;  4DR6 Q;  3PUX A;  2VQF Q;  2K5N A;  1VQ8 A;  1PHJ A;  4TQU S;  1XMQ Q;  4OON A;  3EIV A;  3KDF B;  4WJ4 A;  1Q7Y C;  1Y1W G;  4J15 A;  3GTG H;  4A3I G;  2Q2H A;  2VY3 A;  4AH6 A;  1S40 A;  1PH6 A;  4GKK L;  2VW9 A;  4DV7 L;  3G71 A;  3WWV A;  3J7A 5;  1VQ4 A;  1IL2 A;  2YTY A;  2RHQ B;  2OCE A;  1J5E Q;  2ASB A;  2NVT H;  4HIO A;  4A3C G;  4IPG A;  1N34 L;  3S2D H;  1IBK L;  2NVX H;  3G48 A;  1Z9F A;  2YTX A;  1DGS A;  2EXD A;  3TEH B;  4AQY L;  1FVI A;  1A8V A;  1GD7 A;  3TRZ A;  1UWV A;  1LM0 A;  1VQI A;  2VZA A;  5HGQ A;  5M5W H;  1YZ6 A;  5LMN L;  3OW2 A;  4LW1 A;  4KHZ A;  1YHB A;  2Q2U A;  4TVA B;  3I4M G;  2HHH Q;  3K7A H;  4H02 A;  4C3H H;  2K4K A;  1I5F A;  1V1Q A;  5C3E G;  4OXP A;  4NXN Q;  3PIP A;  1YVC A;  4DV1 Q;  1IZ6 A;  4JBM A;  4BXX H;  3TQY A;  2JJQ A;  4LUZ A;  1HNW L;  5JJL A;  3W5O A;  3M3Y H;  3CCJ A;  4B3M Q;  2UXB Q;  1U5K A;  1UE5 A;  2I5L X;  4DR5 L;  1FL0 A;  1CKO A;  4JI7 Q;  2HQL A;  1E24 A;  3KJO A;  3GTM H;  4OO1 G;  1XNR L;  1JJ2 A;  1UE7 A;  4GLX A;  1X54 A;  4X64 Q;  4JYA Q;  1YEZ A;  1UE1 A;  1CSQ A;  4EX5 A;  4IO9 A;  3S14 H;  4IJL A;  5IT9 c;  3IRB A;  5LMU Q;  3RZD H;  4IFD J;  1Q82 C;  4P72 A;  3OYY A;  3CC4 A;  1FGU A;  1HNZ Q;  1VQJ A;  1VQK A;  3I4O A;  3T1H L;  2UUB L;  3A5Z B;  3HOV H;  1L1O B;  5IE8 A;  3S15 H;  2Z0S A;  4A3D G;  4QQB X;  4LF9 Q;  2JEB I;  1AE3 A;  3UDX A;  3F2C A;  2OTJ A;  3EBE A;  4OWW B;  4HIK A;  1HR0 W;  4GLA C;  2UUC L;  1YHA A;  2CWA A;  2ID0 A;  3CPF A;  4LFC L;  4LNQ A;  3UDF A;  4UY8 C;  4IFD G;  1VQL A;  3D0F A;  2JA7 G;  1B70 B;  3K7U C;  1RIP A;  1N8R C;  4DR4 Q;  1VQP A;  2VQE L;  4NB3 A;  5DLQ E;  1TWA H;  2KCM A;  4DUZ Q;  3K81 C;  4KI0 A;  5GAE C;  4JI2 L;  1N33 L;  2Z6K A;  4P75 A;  3PUV A;  5BR8 L;  1HNX L;  5C4J H;  3G4S A;  1N9W A;  4JI0 L;  2AWN A;  1I3Q H;  3AEV A;  4JI4 L;  1XTD A;  4B3T L;  4DV2 L;  2JA8 H;  4R4Q A;  4IOC A;  1W2B A;  1VQ6 A;  3PO2 G;  4GNX B;  2UXC Q;  2F52 A;  1MIU A;  4Y52 H;  3CQZ H;  3PSI A;  3TRE A;  4JBK A;  1XPU A;  5C4X H;  2LXJ A;  3HOU G;  1OXX K;  1D7Q A;  1BBW A;  1NTG A;  1XMO L;  1YHQ A;  4DUY L;  2PNH A;  1PH7 A;  4BBS H;  1J5E L;  3FKI H;  3CCE A;  1K9M C;  2F3I A;  1GKH A;  1HH2 P;  1PFS A;  5LMN W;  4K0K Q;  5JJK A;  5M3M G;  3U4Z A;  3PF4 A;  1E22 A;  4A3E H;  3HOX G;  1Q86 C;  4RMF A;  3T1Y Q;  4DR4 L;  4P71 A;  1OTC A;  3VDY A;  2HHH L;  2Z6K C;  4NXN L;  1YIT A;  4X6A H;  2JEA I;  1K83 H;  3ER0 A;  4DV1 L;  3B6Y A;  3FHW A;  3OTO Q;  2ES2 A;  2ZM6 Q;  4DR1 Q;  1EQQ A;  1PV4 A;  1PH9 A;  4ALP A;  4X62 Q;  2LXK A;  1A0I A;  1JE5 A;  1PVO A;  1PYB A;  3A0J A;  2NVY H;  4YHH L;  4LF4 L;  3KF8 B;  4QL5 A;  4QGU A;  5IYB G;  1NJI C;  3HKZ E;  4POG A;  3HOW G;  1SN8 A;  3J81 j;  4OX9 Q;  2ALY B;  3I55 A;  4DR7 Q;  5E7N A;  4DR2 Q;  2HIV A;  1G6P A;  3CME A;  4X64 L;  2ZTC A;  3M4O H;  4HIM A;  3GDE A;  1VCI A;  1XPO A;  2B29 A;  2D62 A;  3PGZ A;  2UU9 Q;  1TXY A;  4JI6 Q;  2IHF A;  1WJJ A;  4RG1 A;  1VQ7 A;  1SE8 A;  3W1G A;  1KRS A;  4L5T A;  2K5V A;  1IBM L;  1WCM H;  2PQA A;  1X3E A;  4LF9 L;  3MXN B;  3PUZ A;  3CCQ A;  5IWA Q;  4GN3 B;  3U4V A;  4HJ8 A;  4PZ7 A;  1KC8 C;  5IP9 H;  4MZ9 A;  1CUK A;  3M85 A;  1Q81 C;  4L5R C;  2K14 A;  2JA5 H;  2DGY A;  1X9N A;  2ZTD A;  1B8A A;  3RN2 A;  3ULL A;  3UE1 A;  1N32 Q;  4R4I A;  1G51 A;  3BZK A;  3S17 H;  5M3F H;  1A63 A;  4DUZ L;  4X65 L;  2A19 A;  1NBW A;  2D0O A;  2KCT A;  1KIX A;  3S2H H;  5FLM G;  4A3K G;  1KD1 C;  4AYB E;  2EIF A;  3PUY A;  2CWP A;  4P73 A;  4O2D A;  1T9H A;  2R93 H;  5K36 G;  2UUA Q;  4DV5 Q;  2WP8 J;  2PQA B;  2B3G A;  3S1N H;  1Q1B A;  1TWF H;  4KLK A;  3U58 A;  1O7I A;  2IT1 A;  2MNA A;  4DNI A;  1N36 L;  2YYZ A;  2ZTE A;  3Q8D A;  2C35 B;  3J7Z C;  2H5X A;  4HJ7 A;  2A1A A;  1JMC A;  1W3S A;  4K0K L;  1K73 C;  3K8A A;  5EAY A;  4JI5 L;  1VQH A;  3AFQ A;  2R7Z H;  2JK8 A;  4A3L H;  5GAH C;  2KBN A;  4IOA A;  4LF8 Q;  4HJ9 A;  1PYS B;  1SFO H;  1QVF A;  2JA9 A;  4LUO A;  4ME3 A;  4BXX G;  1ASY A;  3HKZ G;  2AHO B;  1VQO A;  4HID A;  4POF A;  5IP7 H;  2ZM6 L;  4LF6 Q;  2UXD Q;  2RHS B;  4BY1 H;  2MQH A;  3J81 c;  4YCW A;  5FLX c;  1K8G A;  4B3R L;  3J81 i;  2E2I H;  3I4N H;  1C9O A;  1VQB A;  3NEM A;  4DAY B;  5JJI A;  2PI2 A;  2A8V A;  3UE0 A;  2OQ0 A;  2BH2 A;  2R6G A;  1Y1V H;  1OXV A;  1SRO A;  4OX9 L;  1E7Z A;  3ICE A;  1XJV A;  3GO5 A;  4JV5 Q;  3M9B A;  4DR7 L;  3ULP A;  1JJG A;  2QGQ A;  1XPR A;  1LUZ A;  2F4V L;  1EYG A;  3ZJY C;  2NN6 G;  2UU9 L;  2K52 A;  2RCN A;  1GM5 A;  3EN2 A;  3PCO B;  1X3F A;  4JI6 L;  3GD7 A;  4XTC S;  4BBS G;  3A5U A;  2ATW A;  3HOV G;  1I94 Q;  1MJC A;  5C0X I;  2YTV A;  2VS1 A;  1FJG Q;  2NZH A;  1OXU A;  3M4P A;  2OQK A;  4PG3 A;  2GVB A;  4DK3 C;  3KJP A;  5IWA L;  1HZ9 A;  1U0L A;  1HR0 Q;  5IYC H;  5ELN A;  1MJE A;  3HOZ H;  4DR6 L;  1I50 H;  1PH3 A;  3BZC A;  2IHE A;  2VQF L;  5AJ3 Q;  3RR5 A;  3RZO H;  5GAG C;  4AYB G;  1XMQ L;  1PH4 A;  1VQE A;  1AE2 A;  4JBW A;  4P74 A;  4DV4 Q;  2E8G A;  1KHI A;  5ELO A;  5FJ8 H;  1E1T A;  4B3S Q;  3GTJ H;  2V1C C;  4BY7 H;  4IPH A;  1P8L A;  4A3M H;  1SRU A;  1BBU A;  2KEN A;  4DV6 Q;  2I0Q A;  2JA8 G;  2B63 H;  3H15 A;  4IJH A;  4UP8 A;  3GTP H;  1PA6 A;  4MNO A;  1M1K C;  4IPC A;  4GKK Q;  4DV5 L;  3NBH B;  5C4X G;  1EUJ A;  1VS0 A;  4BBR H;  4A76 A;  4LFA Q;  2KHJ A;  2E2H H;  1PH5 A;  2YU9 H;  1N34 Q;  2NVQ H;  3RLN A;  1IBK Q;  1R9T H;  3FKI G;  1VQC A;  1Z47 A;  2XTI A;  4AQY Q;  2WFW A;  2MO0 A;  2KHI A;  1Q12 A;  1OXT A;  5IYD H;  5LMN Q;  4B3M L;  2N8N A;  4JBJ A;  2D0P A;  4LFB Q;  3KLW A;  4A3E G;  1VQ5 A;  2JE6 I;  2L15 A;  2RF4 A;  4BBR G;  4JI7 L;  4A3G H;  4LF8 L;  3PF5 A;  4DV3 Q;  2ZJQ A;  2VUM H;  2Y0S E;  2IY5 B;  1CKN A;  1JB7 A;  4NXM Q;  2AWO A;  1D8L A;  1S3O A;  3D31 A;  4YWK A;  4DV0 Q;  3CP0 A;  4R4C A;  4JYA L;  1L2F A;  4YCU A;  1K3R A;  2I5H A;  4APV A;  2PMZ E;  5LMU L;  5C44 H;  1XNR Q;  2MFI A;  1QUQ A;  4MTN A;  5GQO A;  4DR3 Q;  1HNZ L;  1KL9 A;  3HOY H;  4Y7N H;  1EWI A;  4NPS A;  4O0A A;  3LGJ A;  2CCZ A;  3GTL H;  1KAW A;  3H3V I;  4JV5 L;  1XNQ Q;  1QVG A;  2ZJR A;  4A75 A;  1WFQ A;  1S72 A;  4IFD I;  1IBL Q;  2N78 A;  2UUB Q;  5M5X H;  3T1H Q;  2CKZ B;  3PO3 H;  3F2B A;  4A93 H;  3CCS A;  2LSS A;  1VQD A;  1V43 A;  1WCM G;  3E0E A;  3H0G H;  1PH8 A;  2OWO A;  5JEA G;  4C3J H;  1NMG A;  4LFC Q;  2WAQ E;  4A3J H;  2YV5 A;  4YCV A;  3CF5 A;  1YI2 A;  1VQ9 A;  5IP9 G;  3S1M H;  4WJ3 M;  1HR0 L;  2BA0 A;  3F8T A;  5J3B A;  2JA5 G;  1YBY A;  4GLV B;  2VQE Q;  4YY3 Q;  4KHP Q;  3E9I A;  1L0W A;  1Y1W H;  4HJA A;  1P16 A;  1QUQ B;  2BH8 A;  2CFM A;  4R4O A;  3DM3 A;  4YWM A;  3KF6 A;  4DAM A;  5M3F G;  4DV4 L;  4A3I H;  1N33 Q;  3CD6 A;  4GN5 A;  1HNX Q;  3STB C;  2UXC L;  3ERS X;  2EQS A;  3PV0 A;  4JI4 Q;  2R7D A;  1YJ9 A;  4B3S L;  4B3T Q;  2I5M X;  3SGI A;  1HJP A;  1NMF A;  4DV2 Q;  1M90 C;  4QY7 A;  1VQM A;  1QZG A;  4A3C H;  3UDG A;  4DV6 L;  4LF7 Q;  2NZO A;  4BA2 I;  4JI1 Q;  2R93 G;  4A3F H;  1AH9 A;  2FXQ A;  1IYJ B;  3L7Z C;  3F1Z A;  4JI8 Q;  4X66 Q;  3UDI A;  4HJ5 A;  3I56 A;  1TWH H;  1E1O A;  2XGT A;  1XMO Q;  3I4M H;  4DUY Q;  3PUW A;  5C3E H;  3T1Y L;  2CQO A;  1GO3 E;  4LFA L;  4R4T A;  3CCM A;  4DPG A;  4A3F G;  1Q1E A;  3F2D A;  3OTO L;  1TWC H;  2K50 A;  4DR1 L;  3S1R H;  2Y0S G;  3CCU A;  3RNU A;  1SMX A;  2MO1 A;  4X62 L;  2ZJP A;  3KF6 B;  3AFP A;  5GRO A;  4GN4 B;  2R7Z G;  4A3L G;  4LFB L;  1L1O A;  3RLF A;  4PMW A;  1EIF A;  1IXR A;  1NY4 A;  4DV3 L;  1EQR A;  4JI3 Q;  1V9P A;  3JAM c;  1Y14 B;  1CKM A;  5IP7 G;  4NXM L;  3JAM i;  4DR2 L;  4BY1 G;  4DV0 L;  4GKJ Q; 
#chains in the Genus database with same CATH topology
 5IGG A;  1QVC A;  1EFW A;  3CCL A;  4A3D H;  1Y1V G;  2QEX A;  3M4Q A;  3KFU A;  2DNE A;  3GTQ H;  3OMG A;  1J6Q A;  5K5P A;  4FF3 A;  4FXD A;  3T16 A;  3IFT A;  5LL6 X;  3Q22 A;  3DWP A;  4J1M A;  3AQQ A;  4JG2 A;  3K58 A;  3CMA A;  3V2T A;  2JA6 G;  1LYL A;  1L1O C;  1O7L A;  1ZYR C;  2GN5 A;  4QUC A;  5EPJ A;  5HY6 A;  4L5Q A;  2MHV A;  4IUU A;  5JOB A;  4JOI A;  1C7Y A;  4U67 3;  1CI3 M;  2K5H A;  3TS0 A;  3NUC A;  4YY3 L;  4O42 A;  4X65 Q;  3DLL A;  2SNS A;  2UUA L;  1JC7 A;  2E2D C;  3DEO A;  5KNB A;  1JJC B;  2F1M A;  1F2Z A;  1PH1 A;  1LTL A;  1A2U A;  4BS9 A;  4DAP A;  3I2Z A;  4R8I A;  2EYF A;  1SAP A;  3C1F A;  1KAA A;  3K0X A;  2OEO A;  4LF7 L;  4JI1 L;  2RSO A;  1VQA A;  1NE3 A;  3HP3 A;  3KF8 A;  4UP7 A;  4KK7 A;  4HN7 A;  1E3P A;  3HOX H;  1SYE A;  4EQ5 A;  3MC0 B;  4NKL A;  4HCS A;  1EOV A;  3DWQ A;  3PIO A;  1SLJ A;  3MXG A;  4DR5 Q;  3ERQ A;  4LF6 L;  1S5F D;  4L6T B;  2HIX A;  5FK9 C;  3HOW H;  4UP9 A;  4UPA A;  3S14 B;  1O78 A;  4N8F A;  1X65 A;  2IX1 A;  1GVP A;  4B3R Q;  3RZD B;  1E2Z A;  1CZW A;  5CV8 A;  2LFN A;  3OIQ A;  1MKH A;  2XVS A;  1A6X A;  5C44 G;  3S24 A;  5I6Y A;  4GOP C;  1H9M A;  5C0X J;  2UUC Q;  4I65 A;  4Q5V A;  2EYO A;  1ASZ A;  4AYB B;  2Q2T A;  2JQO A;  1I4R A;  3J7A V;  5AJ3 L;  3L0O A;  3I4L A;  1F2Y A;  1X3Q A;  5C0X G;  3H0G G;  4JI2 Q;  3J80 c;  3E5S A;  1STG A;  4C3J G;  3J80 i;  2DUD A;  4A3J G;  3G6E A;  4NP5 A;  1YNJ D;  2K5N A;  1VQ8 A;  4OON A;  2OXP A;  4J15 A;  2F0Q A;  4K5X A;  1TS5 A;  2Q2H A;  2VY3 A;  1YNN C;  2F0J A;  2VW9 A;  2QCP X;  2D9U A;  3FKI B;  1FNU A;  4B08 A;  2ASB A;  3MWY W;  1N34 L;  4G7Z C;  1IBK L;  1DGS A;  2EXD A;  2YTX A;  3FDT A;  3EJI A;  3TEH B;  1GD7 A;  3A55 A;  3QIA A;  5F2D A;  3OW2 A;  2Q2U A;  4TVA B;  3I4M G;  4H02 A;  3HRZ C;  2K4K A;  3TN2 A;  3PIP A;  1EY6 A;  1IZ6 A;  1ROD A;  2Z4H A;  1WTX A;  3W5O A;  3CCJ A;  2G9D A;  1X3P A;  1UE5 A;  5C4Z A;  2QW7 A;  2K33 A;  1EY9 A;  2WKC A;  3K59 A;  1O7Z A;  1FR3 A;  2F0N A;  3HZX A;  2A69 C;  1JOK A;  1UE7 A;  4GLX A;  2FJ2 A;  5T1I A;  2JN4 A;  3S14 H;  4IJL A;  3IRB A;  3OWE B;  5C5L A;  3RZD H;  3OYY A;  3CC4 A;  3NE5 B;  1FGU A;  1EU4 A;  1WCM B;  3I8Z A;  4RKB A;  2IJ0 A;  3A5Z B;  1PTO F;  3NTH A;  4A3D G;  2JEB I;  1AE3 A;  5I9P A;  2K5Q A;  2CWA A;  4RWS C;  2PCF B;  4UY8 C;  2F0E A;  3S17 B;  5A2Q L;  3FMC A;  1VQP A;  4NB3 A;  2EY5 A;  5DLQ E;  5IGC A;  1SNO A;  3S2H B;  3R93 A;  4DUZ Q;  3K81 C;  3C3L A;  3IL8 A;  2PPB C;  3Q0A A;  3G4S A;  2AWN A;  4JI4 L;  1F9S A;  1XTD A;  2VB3 X;  1TR5 A;  1W2B A;  4GZY C;  3H94 A;  1TWF B;  4G57 A;  4PMC A;  2IW3 A;  3KK7 A;  1EEI D;  3PSI A;  1KNA A;  3TRE A;  1XPU A;  2LXJ A;  1YHQ A;  3RD4 A;  1EZ6 A;  1PLF A;  2KHS A;  3FKI H;  1K9M C;  1UUP A;  1U4L A;  4K0K Q;  3D4D A;  2A68 C;  5LMN W;  3PF4 A;  1E22 A;  4UHV A;  1PDQ A;  3HOX G;  2Z6K C;  3G7L A;  1Q8I A;  1RJT A;  3U9S A;  2PW5 A;  1GXD C;  1LT4 D;  2ES2 A;  3I4N B;  3OHX C;  1PV4 A;  3P75 A;  4ALP A;  3VR5 A;  2QDB A;  1TY2 A;  2ZT9 C;  1QIL A;  4QL5 A;  3I90 A;  3SK5 A;  3HOW G;  4POG A;  3LWE A;  4OX9 Q;  1D1I A;  4RH6 A;  2HIV A;  4X64 L;  2ZTC A;  1VCI A;  2B29 A;  2A6E C;  2UU9 Q;  2WAC A;  3D6W A;  1BBX C;  3E3X A;  4DNT B;  1DON A;  1HQR D;  1WCM H;  1FD7 D;  1ESF A;  3MEH A;  3KLR A;  5IWA Q;  1I50 B;  1ET9 A;  5IT9 E;  3RZO B;  2MUY A;  5D3I B;  1RKN A;  1UEA B;  1QJO A;  5JAV A;  4KKS A;  4FP5 D;  1B8A A;  1RTO A;  3UE1 A;  4ULL A;  3S17 H;  2SDF A;  4BY7 B;  5CV9 A;  2KCT A;  1KIX A;  3S2H H;  1X32 A;  1ICW A;  1KD1 C;  2B63 B;  4AYB E;  1D5Z C;  3TME A;  1TT2 A;  3PUY A;  3OPO A;  3TP7 A;  2O5I C;  4DV5 Q;  5HUR A;  5JPN C;  3Q23 A;  1Q1B A;  1TWF H;  4KLK A;  2MNA A;  1N36 L;  4EGV A;  2KCC A;  3BDO A;  4K6D A;  2CW0 C;  4JI5 L;  3AFQ A;  1LTT D;  1STH A;  2EY2 A;  2JK8 A;  3NSW A;  4A3L H;  1QOH A;  4LF8 Q;  2A5H A;  2VUM B;  1PYS B;  5M9O A;  1KDB A;  4POF A;  1AW7 A;  3FPP A;  2EYH A;  2ZM6 L;  1W6J A;  1JE4 A;  2RHS B;  2A6H C;  3J81 c;  4YCW A;  3J81 i;  3I4N H;  1E0B A;  3NEM A;  3HOY B;  3GTL B;  2R6G A;  2H4O A;  4EQO A;  2HQE A;  2ZXR A;  3GO5 A;  2MGS A;  4DXG A;  2CVR A;  3EVQ A;  2RCN A;  3EN2 A;  1H9K A;  4JI6 L;  4XTC S;  1JWU D;  3A5U A;  5FLX L;  1HUN A;  1NR2 A;  3M4P A;  1HR0 Q;  3CU7 A;  5ELN A;  1Y1W B;  4DR6 L;  2XN9 C;  1I50 H;  2G9H D;  3BZC A;  2EYL A;  3RZO H;  1LV9 A;  4AYB G;  1XMQ L;  1VQE A;  4JBW A;  3QG1 A;  5NUC A;  1BR9 A;  1KHI A;  3LWU A;  4B3S Q;  1LTG D;  4BY7 H;  1P8L A;  3C1E A;  5EJW A;  3OW7 A;  2I0Q A;  4MHE A;  2B63 H;  2AUJ D;  1TWH B;  1M1K C;  4CKB A;  1BXT A;  4GKK Q;  2N88 A;  4RGM A;  5CYU A;  1SYD A;  2PMZ B;  4PNY A;  1MSG A;  2KHJ A;  3RLN A;  1TWC B;  3FKI G;  1RHP A;  2XTI A;  4FNF A;  5IYD H;  1AZQ A;  4XT1 B;  1VQ5 A;  2KUM A;  4ZKC B;  5EKK A;  3PF5 A;  2VUM H;  4ID6 A;  4DV0 Q;  4YWK A;  5FOB B;  1SBB B;  2JA6 B;  2DJF C;  3WOF A;  2KCN A;  4EQP A;  4YCU A;  1WTR A;  2CH4 A;  1XNR Q;  4MTN A;  5GQO A;  1HNZ L;  3ND9 A;  3HOY H;  3H3V C;  1EWI A;  4NPS A;  2CCZ A;  3UI2 A;  3GTL H;  3H3V I;  2RA4 A;  2LY7 A;  5LL6 S;  4UAI A;  1CHP D;  1EOT A;  4IFD I;  1IBL Q;  1DCZ A;  2X6L A;  3E0E A;  1VQD A;  1WCM G;  4K14 A;  1PH8 A;  4IUT A;  3GTO B;  2R3Z A;  4YCV A;  4WJ3 M;  2BA0 A;  4DA2 A;  1PRT B;  2B2T C;  3PO2 B;  1BUV T;  1YBY A;  2VQE Q;  4KHP Q;  3FEW X;  1Y1W H;  1I6V C;  1U4M A;  1P16 A;  4YWM A;  1V8Q A;  2CFM A;  3HOU B;  3KF6 A;  3D4W A;  3SK4 A;  2R7D A;  1YJ9 A;  4B3T Q;  2I5M X;  1XTC D;  3SGI A;  4CBV A;  1DYQ A;  1M90 C;  3DHQ A;  3OIP A;  4K8J A;  3OWF A;  5COR A;  3L7Z C;  5EGT A;  1R4Q B;  3GTK B;  1TWH H;  1E1O A;  5HGT A;  3PUW A;  3J80 L;  3T1Y L;  2CQO A;  3MAQ A;  2F0F A;  1JOR A;  4QUF A;  3OTO L;  1TWC H;  2K50 A;  4DR1 L;  3H91 A;  5FO9 B;  3RNU A;  2MO1 A;  3KF6 B;  4LFB L;  4A3L G;  1NNX A;  4DV3 L;  3SVM A;  4JI3 Q;  1V9P A;  4NXM L;  2IL8 A;  1DZ1 A;  1F2M A;  4YHH Q;  4LF4 Q;  3L9A X;  3M7N A;  3I4N G;  4RHS A;  4FYD A;  1TWG H;  2JA6 H;  4C3I B;  1SYB A;  4FVM A;  1KQS A;  4DR3 L;  1YNJ C;  5KGU A;  3I70 A;  1HZB A;  2AMC B;  2E2J B;  1A62 A;  1PH2 A;  4PZ8 A;  4JCV E;  4GNX A;  1IBM Q;  2K1B A;  2E5L Q;  3K80 C;  4X3T A;  2N3S A;  2R92 G;  3A54 A;  1N32 L;  3BJU A;  5C4H A;  4QMG A;  2TMP A;  4TSS A;  3OSO A;  3GTO H;  4IUQ A;  1C48 A;  4QB4 A;  3DM1 A;  3K6O A;  3PO2 H;  2PNR C;  4QJF A;  4JC0 A;  3FP9 A;  4DV7 Q;  3HOU H;  4BY7 G;  1F9R A;  1Q8K A;  1SNP A;  1C0A A;  3NWT A;  1KRT A;  2F0W A;  2FFK B;  5IOC A;  4XQN A;  1YJN A;  1C4Q A;  5M5W B;  2B63 G;  3S1Q B;  3S1N B;  3I7F A;  2RSN A;  4JI8 L;  1UEB A;  4F88 A;  1D5X C;  1AFP A;  4OO1 I;  3GTK H;  2QF7 A;  1WYD A;  3STB D;  2HT1 A;  5JVG 3;  2L55 A;  5IYD G;  1SYC A;  3BU2 A;  2UXD L;  5KND A;  3VYR A;  3NP8 A;  3J7Y W;  1LT6 D;  2IWH A;  4M1U B;  3GTQ B;  1BCP D;  1SR3 A;  2N49 A;  2QA4 A;  1X56 A;  2VUM G;  5CC4 A;  1U4R A;  2NN6 I;  4A3B G;  4BBS B;  3HOV B;  3Q6S A;  3KDF A;  3W1B A;  3HOY G;  1I94 L;  2J0T D;  2BCO A;  4C3I H;  3ULJ A;  3JAM E;  4DK6 C;  2F4V Q;  4LMQ D;  3M7G A;  1F9P A;  2NWG A;  4C56 C;  1Z6H A;  1TWA B;  2E2J H;  3SEB A;  4ZLT F;  1H95 A;  1A3U A;  4CJ1 B;  1I3Q B;  1L0Y B;  5BR8 Q;  2KEC A;  3CXC A;  2B2V A;  4JI0 Q;  2JA8 B;  3N52 A;  2VQF Q;  1T5E A;  1LLR D;  1PHJ A;  3EIV A;  3KDF B;  3CQZ B;  1Y1W G;  1JIC A;  3ONA B;  1HPC A;  1H9S A;  1KTK A;  2K01 A;  1PTO B;  3WWV A;  1JCK B;  2EXZ A;  1VQ4 A;  1IL2 A;  2YTY A;  2RHQ B;  2OCE A;  1J5E Q;  2F0O A;  4IPG A;  4AQY L;  2Z1C A;  4Z9C B;  3TRZ A;  1UWV A;  1LM0 A;  5HGQ A;  5M5W H;  3S1Q H;  3S1N H;  4HAE A;  4KHZ A;  4KN4 C;  1K83 B;  2LS0 1;  1I5F A;  1V1Q A;  4DV1 Q;  3VR6 A;  1KLU D;  2NVY B;  1HXY D;  1LTB D;  1G8Z D;  1A3T A;  4DR5 L;  1CKO A;  1H9S B;  3M4Y A;  3GQB A;  1E24 A;  3KJO A;  4PMB A;  3E6Z X;  1JJ2 A;  3BDL A;  1S5B D;  1X54 A;  1YEZ A;  4MN3 A;  1UE1 A;  4IO9 A;  5IT9 c;  5ELB A;  2B2Y C;  5LMU Q;  2SOB A;  5I2X A;  3K57 A;  1JJG A;  1PYW D;  4BBS H;  2UUB L;  3HOV H;  1ZXT A;  3F2C A;  2FMC A;  1HR0 W;  4GLA C;  2UUC L;  3ZYY X;  5KRU A;  2JA5 B;  3CPF A;  4LFC L;  4LNQ A;  3J81 L;  2Z4I A;  1TWA H;  4WRD A;  4KI0 A;  1GUN A;  4JI2 L;  1N33 L;  5BN3 A;  1HCZ A;  2WIN B;  4J8Q A;  1EY0 A;  1WTP A;  1HNX L;  1I3Q H;  3BYY B;  3CHB D;  1WTV A;  1ONL A;  4DV2 L;  2JA8 H;  4R4Q A;  1VQ6 A;  3A8J E;  3PO2 G;  1LO5 D;  5ELE A;  3MXU A;  3CQZ H;  3OMC A;  3HOU G;  4F7X A;  1D7Q A;  1VMP A;  1NTG A;  2E76 C;  2JP1 A;  1XMO L;  1PTO H;  2PNH A;  3CCE A;  1HQM C;  2F3I A;  1GKH A;  1HH2 P;  1G2T A;  2R7Z B;  4M8A A;  2K7V A;  3N6R A;  1B1Z A;  4RMF A;  1OTC A;  4MIU A;  2MPM A;  1YIT A;  4X6A H;  2PZT A;  1K83 H;  1FNW A;  3ER0 A;  4BY1 B;  4V19 0;  1PFM A;  4NMZ A;  1EQQ A;  4ZK9 B;  1ET6 A;  1A0I A;  1BNZ A;  1HFN A;  2ICI A;  2NVY H;  1S4Z A;  2EJG C;  2FHT A;  3KF8 B;  4QGU A;  4WFN 3;  1NJI C;  2O5J C;  3HKZ E;  3AMU A;  1UAP A;  2ALY B;  5E7N A;  4DR2 Q;  3DUZ A;  3M4O H;  2XNA C;  4RGN A;  3GDE A;  2XRQ D;  2IHF A;  5EQ0 A;  2B2U A;  1SE8 A;  4X3K A;  1VMC A;  2XRS D;  4C3I G;  5IGB A;  1Y8N B;  5JEA H;  4N9P A;  3VR3 A;  3EFX D;  3S9W A;  5IP9 H;  1KC8 C;  3NXW A;  3M85 A;  1Q81 C;  4Q0F A;  2JA5 H;  3RN2 A;  4H44 C;  2D2C C;  2N55 A;  4R4I A;  1A63 A;  3GTJ B;  4DUZ L;  4A3M B;  3I91 A;  3VR2 A;  1NBW A;  1B44 D;  4ZKB B;  3GV3 A;  2CWP A;  4P73 A;  1T9H A;  2UUA Q;  3QJY A;  1LT3 D;  2WKD A;  2NVQ B;  3U58 A;  2F0G A;  1O7I A;  3T56 B;  2ZTE A;  3Q8D A;  2C35 B;  2EVB A;  4HJ7 A;  1B50 A;  1W3S A;  1F77 A;  4K0K L;  3SK6 A;  2XWB B;  2R7Z H;  5GAH C;  2SEB D;  4IOA A;  1WD1 A;  1QVF A;  2QKI C;  1PZJ D;  4ME3 A;  1IKL A;  1B3Q A;  1EY7 A;  3HKZ G;  1VQO A;  3SR1 A;  4LF6 Q;  3SE0 A;  4BY1 H;  2MQH A;  1K8G A;  1K8M A;  3S2D B;  3K0Y A;  3ND8 A;  3UE0 A;  4B9X A;  2PO4 A;  2BH2 A;  3SDZ A;  1OXV A;  1SRO A;  3NQT A;  4OX9 L;  4JV5 Q;  3M9B A;  3ULP A;  5FO7 B;  1EYG A;  3PO3 B;  2UU9 L;  1GM5 A;  3PCO B;  2L5T A;  3TDQ A;  4BBS G;  1K8O A;  3HOV G;  2WB1 B;  4XXE A;  1FGB D;  3MZ5 A;  5C0X I;  2YTV A;  1M8A A;  2L1B A;  1DD2 A;  2VS1 A;  4B9W A;  2NZH A;  1OXU A;  2J7Z A;  5JVH 3;  3NTI A;  4EQN A;  5IWA L;  3TP8 A;  1PH3 A;  3TBI B;  5AJ3 Q;  3RR5 A;  1JOO A;  1WVL A;  3NK9 A;  4P74 A;  3TSS A;  2C9O A;  2Q8R E;  5ELO A;  5FJ8 H;  3GTJ H;  4TRD A;  4A3M H;  1SRU A;  1GUS A;  2KEN A;  4DV6 Q;  2JA8 G;  2OT2 A;  3I73 A;  4IJH A;  4UP8 A;  3I72 A;  1PA6 A;  3T51 B;  4MNO A;  1II3 A;  4DV5 L;  4FF2 A;  1EZ8 A;  5KNC A;  4A76 A;  1VDZ A;  4LFA Q;  1N34 Q;  2NVQ H;  1IBK Q;  1VQC A;  5FKA C;  4B3M L;  4JBJ A;  3QOL A;  1LTS D;  2F0L A;  5G3L D;  4JI7 L;  2PW7 A;  3CRK C;  4LF8 L;  1M4V A;  2HUG A;  2JYO A;  1CKN A;  1EFI D;  4KTA A;  1D8L A;  3D31 A;  4JYA L;  3BDC A;  4FF1 A;  2I5H A;  4APV A;  1ZKO A;  3LX0 A;  3S2D H;  2R92 B;  4O0A A;  3LGJ A;  1KAW A;  1XNQ Q;  2ZJR A;  2JA7 B;  5FLX E;  1W6K A;  4R9W A;  1NR4 A;  5ELD A;  1S72 A;  4G7H C;  4C1N I;  2CKZ B;  1Y8O B;  1EU3 A;  3PO3 H;  3F2B A;  2LSS A;  5JEA G;  4RKL A;  4DK1 A;  2WAQ E;  3NHH A;  2YV5 A;  3CF5 A;  1BDO A;  3VYS A;  5IP9 G;  1HR0 L;  1G2S A;  1ILP A;  5J3B A;  2JA5 G;  1G6Z A;  2P5Z X;  1L0W A;  4DAM A;  4A3I H;  3W3A A;  2B8G A;  1D1K A;  4RGT A;  3STB C;  4NW2 A;  2UXC L;  2CQA A;  3QB3 A;  4JI4 Q;  3AU7 A;  4B3S L;  4EVO A;  1DXM A;  4KMU C;  2NZO A;  2NTT A;  3MXP A;  1ML0 D;  4K5W A;  2FXQ A;  4F8M A;  1IYJ B;  1BQQ T;  3F1Z A;  3K5O A;  4X66 Q;  3UDI A;  1HA6 A;  1BCP C;  2AUK A;  5L37 A;  4R4T A;  3CCM A;  4DPG A;  1Q1E A;  2B8F A;  4A3B B;  2NB0 A;  3CCU A;  1TS2 A;  1DOL A;  4X62 L;  2ZJP A;  5GRO A;  2R7Z G;  5IIF A;  1L1O A;  3RLF A;  2VXW A;  1LAC A;  1BF4 A;  2NYZ D;  3NTK A;  3JAM c;  1GUG A;  1K28 A;  3T4A C;  3JAM i;  2OF1 A;  5IGD A;  1UNS A;  2F0K A;  4BY1 G;  4DV0 L;  4GKJ Q;  2OTL A;  4BA1 I;  1X3G A;  2HDL A;  3CW2 C;  3WDN A;  4IN3 A;  4LF5 Q;  1ENF A;  3VR4 A;  2Q2I A;  3KOJ A;  3VA5 A;  4A4I A;  2DNC A;  1SMY D;  2R92 H;  5IGE A;  1K8A C;  4I7A A;  3E9H A;  2WAQ G;  5ELC A;  1IBL L;  2JA7 H;  3E0J A;  3DEP A;  3OOC A;  1RL2 A;  3J7A F;  1X55 A;  4IPD A;  1LTA D;  1IKM A;  4A3K B;  1OXS C;  5DM6 3;  3CCR A;  3A74 A;  4CDF C;  1VQN A;  2VNU D;  3GTG B;  1STN A;  5IT9 L;  2WB1 E;  4KHP L;  1JQY D;  3U50 C;  3NPP A;  4OEL B;  5FJ8 G;  3C2P A;  2NVT B;  2XWJ B;  1WI5 A;  1VQF A;  1CA6 A;  2A74 C;  1QB5 D;  4A3M G;  2EYJ A;  1BOS A;  3R2T A;  3HFZ B;  1MI2 A;  3JC6 6;  5FO8 B;  1PRT D;  5KEE A;  3K7A B;  4YWL A;  4R1J A;  4RA8 A;  1YIJ A;  1KDA A;  1N36 Q;  4GOP A;  4JOI C;  4RCN A;  1HZC A;  1MGS A;  1HNW Q;  1YNX A;  1YJW A;  4DAV A;  4JI5 Q;  4AIM A;  3L2P A;  1VQG A;  2NTS A;  5E4X A;  4OIJ A;  1TWG B;  1EIY B;  3GTM B;  5CV5 A;  4A3B H;  2RVL A;  5IYB H;  4ZQ3 A;  5CR3 A;  4GS3 A;  4JI3 L;  1D5M C;  1CSP A;  1JR0 D;  4FDB A;  5JPM C;  2GVA A;  3RLO A;  1EEF D;  1AN8 A;  5H1S E;  3QWN A;  3S15 B;  2IX0 A;  3MEF A;  1ZEQ X;  2BDO A;  4GOP B;  4JK1 C;  2NUC A;  1JT8 A;  4IQZ A;  3P20 A;  1FJG L;  2UXB L;  1G91 A;  3H09 A;  5C6A A;  3A56 A;  3PO3 G;  2K75 A;  4OEM B;  2E5L L;  2R7F A;  4CJ2 C;  2WB1 G;  1SYG A;  2ICE C;  5EPK A;  1BKB A;  4A3K H;  4DR6 Q;  3PUX A;  1XMQ Q;  2PZU A;  1NUC A;  5K36 H;  1B9N A;  3GTG H;  5C4X B;  4A3I G;  4AH6 A;  2IX3 A;  4DV7 L;  3J7A 5;  5DNF A;  4HSV A;  2NVT H;  1E2W A;  2HD3 A;  1Z9F A;  2CH4 W;  1FVI A;  4F87 A;  1VQI A;  3PMF A;  1YZ6 A;  5LMN L;  4DR4 Q;  2HHH Q;  3K7A H;  5DEH A;  4NXN Q;  2K6A A;  5CMD A;  4JBM A;  4BXX H;  4LK1 C;  3TQY A;  2R61 A;  2JJQ A;  5JJL A;  2EE1 A;  3TP6 A;  1VF5 C;  1SSO A;  1FL0 A;  2HQL A;  5LHY 1;  1SE2 A;  1MD2 D;  3GTM H;  4OO1 G;  1JOQ A;  4DGZ A;  1S5C D;  2ZXP A;  4EX5 A;  3DWA A;  5D3D A;  4H0L C;  2EDG A;  4P72 A;  4P2C B;  1HNZ Q;  3I4O A;  3T1H L;  3MFY A;  3S15 H;  5IE8 A;  1DOK A;  2QEJ C;  1D6E C;  4QQB X;  4LF9 Q;  2RDF A;  3T53 B;  1ICF B;  1STY A;  4G7O C;  3IAY A;  2ENB A;  1VQL A;  3D0F A;  2JA7 G;  1B70 B;  1N8R C;  1RIP A;  3QO2 A;  1SNM A;  4UDU C;  4JPB W;  2RBM A;  2KCM A;  4BWG B;  2Z6K A;  4P75 A;  1JWS D;  1K0S A;  2F03 A;  1HUM A;  5BR8 L;  1N9W A;  4HMJ A;  5EKL A;  4JI0 L;  2A6E D;  1MBY A;  1TKW B;  4GNX B;  1CM9 A;  1AZP A;  1DM0 B;  1MIU A;  2F52 A;  4DFA A;  5CBA E;  4JBK A;  5C4X H;  4ZAI A;  2LKV A;  1OXX K;  3DMU A;  1BBW A;  5EBC A;  3HKZ B;  4DUY L;  4K8I A;  1J5E L;  3TZD A;  2Y0S B;  1WTH A;  1PFS A;  3A7A B;  5JJK A;  5BN5 A;  3U4Z A;  1RD9 D;  1LT5 D;  1SFO B;  3T1Y Q;  4P71 A;  4K2L A;  2NZ1 D;  3SHL A;  4CDE C;  4H7B A;  1PTO D;  4DV1 L;  3B6Y A;  3OTO Q;  4DR1 Q;  4IUR A;  2PYK A;  1CTM A;  2LXK A;  3PQI A;  4KN7 C;  1SND A;  5IYB G;  4FF4 A;  1SN8 A;  3J81 j;  3I55 A;  4U68 A;  4DR7 Q;  4R8N A;  1G6P A;  3CME A;  4HIM A;  1O80 A;  1XPO A;  2KOL A;  3PGZ A;  1TXY A;  5KYI A;  1WJJ A;  2CHB D;  4KJO A;  3KBG A;  1TY0 A;  3A8K E;  5CV4 A;  1KRS A;  4L5T A;  4KHV A;  2AQ1 B;  2PQA A;  1X3E A;  3PUZ A;  3CCQ A;  3HOZ B;  4HJ8 A;  3EA6 A;  4GN3 B;  3U4V A;  4PZ7 A;  2BE5 D;  4L5R C;  4CDD C;  2DGY A;  2B39 A;  2L9H A;  4CHT B;  2O4X A;  4E6I A;  3R3O A;  4KY5 A;  1N32 Q;  1G51 A;  4ZUI A;  1EY4 A;  4X65 L;  2A19 A;  1WD0 A;  2RCF A;  2KVM A;  2F0T A;  4A3K G;  1F9Q A;  2F0V A;  5KYL A;  4O2D A;  1TU2 B;  3WOE A;  5K36 G;  1HFG A;  4KY6 A;  1CQV A;  3V96 A;  5J22 A;  1XX8 A;  4L8J A;  3K5M A;  4ZYS A;  2PQA B;  4KD3 A;  2B3G A;  2E2H B;  2IT1 A;  1FNV A;  2VB2 X;  2YYZ A;  1JMC A;  1HRJ A;  3K8A A;  1EL0 A;  4WJW A;  1IL8 A;  5E3F A;  1B9M A;  2DY7 A;  1EY5 A;  2KBN A;  1SFO H;  2JA9 A;  4LUO A;  4BXX G;  3M4O B;  1ASY A;  2E75 C;  2AHO B;  4HID A;  2UXD Q;  2LMC B;  5FLX c;  4B3R L;  1XXG A;  1C9O A;  4FXK C;  5JJI A;  4Y7N B;  2PI2 A;  2A8V A;  3BVZ A;  1IW7 D;  4DN4 M;  3ICE A;  1SXT A;  1TS3 A;  3TZU A;  1A2T A;  1U4P A;  2QGQ A;  1LUZ A;  2WII B;  2EZV A;  3ZJY C;  2K32 A;  3BVM A;  1ESR A;  4A93 B;  3GD7 A;  2ATW A;  4QIW B;  1I94 Q;  1MJC A;  2F0U A;  3R8B A;  5IGF A;  3BS1 A;  5JJZ A;  4DK3 C;  3KJP A;  2OQK A;  1HZ9 A;  1NAP A;  5IYC H;  3HOZ H;  3JAM L;  1MJE A;  2FIN B;  2IHE A;  3K5L A;  5GAG C;  1PH4 A;  2JSO A;  4HR7 B;  4DV4 Q;  4IPH A;  5ISR A;  1D2B A;  1BBU A;  2O2L D;  1EY8 A;  2BDN A;  4QF4 A;  2C5C A;  3EQL C;  4IPC A;  5C3E B;  1KDC A;  1STB A;  3MA2 B;  5C4X G;  1EUJ A;  2EYM A;  1TS4 A;  2E2H H;  4AQY Q;  2MO0 A;  2KHI A;  1WTW A;  1F2L A;  2N8N A;  1DOM A;  1R4P B;  1EIG A;  3VYU A;  4BBR G;  2RF4 A;  4A3G H;  1SMY C;  1GUT A;  1PXU A;  4XYQ A;  2L11 A;  1IYV A;  5D14 A;  2Y0S E;  4PV1 C;  1JB7 A;  4S3S A;  2K03 A;  3CP0 A;  2HCI A;  2WAQ B;  1L2F A;  2B2T A;  3S16 B;  1K3R A;  1CHQ D;  1J8I A;  4KKT A;  5T1G A;  5AFW A;  5TSS A;  1V1P A;  1KL9 A;  4Y7N H;  2F0S A;  2IPK D;  2JXM B;  4JV5 L;  1QNK A;  1QVG A;  2WV6 D;  4A75 A;  2XIW A;  2TSS A;  2EY1 A;  4C2M B;  5A2Q E;  1RCV D;  3C46 A;  4CJ0 B;  2PQE A;  1SYF A;  2UUB Q;  4N8X 1;  5CBE E;  4A93 H;  3CCS A;  5M5Y B;  1ENC A;  2OWO A;  5COY A;  1NMG A;  4LFC Q;  1VQ9 A;  1YI2 A;  1RDP D;  1HA5 A;  1B53 A;  1PRT C;  3F8T A;  3KUP A;  1EIH A;  4XYO A;  4YY3 Q;  2BOS A;  4RHR A;  1TII D;  1V1P B;  2SNM A;  5EBD A;  1PZI D;  1N33 Q;  4GN5 A;  1HNX Q;  3GV6 A;  3ERS X;  3PV0 A;  2RDG A;  1EWH A;  1NMF A;  4DV2 Q;  4QY7 A;  1VQM A;  5M3M B;  1QZG A;  4A3C H;  4DV6 L;  4LF7 Q;  1I4Q A;  4HCE A;  4JI1 Q;  4LJZ C;  2Z9H A;  1AH9 A;  4YIJ A;  2Q8T A;  1LAB A;  3I56 A;  2XGT A;  1XMO Q;  2L12 A;  5C3E H;  4WOR A;  2Z6B A;  1GO3 E;  4LFA L;  4CDC C;  4HMI A;  1H9R A;  4A3F G;  3F2D A;  2Y0S G;  4GN4 B;  3DXJ C;  1EIF A;  1IXR A;  1K3B C;  1NY4 A;  1EQR A;  3D6C A;  3K5N A;  1CKM A;  1BO0 A;  1GOZ A;  2VL6 A;  5BN4 A;  3RN5 A;  3S16 H;  1I4H A;  4KV6 A;  1I6H B;  3MHB A;  1Q3L A;  1SJE D;  1Q90 A;  5CV6 A;  3H3V H;  3GP7 A;  1XNQ L;  4OL7 A;  1HZA A;  2RKS A;  3CC7 A;  5E4W C;  4IFD H;  5E1F A;  1KXL A;  4DKA C;  3AYH B;  4C2M H;  5GAD C;  2AQ2 B;  4A3I B;  1BCP F;  1DJR D;  1STA A;  4XIG S;  5M5Y H;  4OWX B;  5IYC G;  3HOZ G;  1Q46 A;  1Y8P B;  1QZH A;  1GJX A;  1TVX A;  3MVV A;  4QIW E;  1SE4 A;  3NEN A;  3NEL A;  2G5D A;  2EYP A;  3IKJ A;  1PZK D;  2NVX B;  2EJF C;  1I4X A;  2PI2 E;  4GNX C;  5M3M H;  4C3H B;  2F0M A;  4DR2 L;  3L3O C;  4X66 L;  1XWE A;  2M00 A;  4LUV A;  4L5S A;  2F3V A;  3M3Y B;  2HCC A;  4OWT B;  3O13 A;  3QR8 A;  3HKS A;  4JW0 A;  3T13 A;  3PIO 3;  2X6G A;  4IZ8 A;  4N9T A;  4A3G G;  3KYH C;  5IY0 A;  3V05 A;  1WOC A;  3LNN A;  2QIL A;  3TS2 A;  2K5D A;  3CPW A;  4QCL A;  2AQ3 B;  4PZ6 A;  2DY8 A;  5JEA J;  4GKJ L;  2PZW A;  2BA1 A;  2B2W A;  1BVS A;  3ERO A;  1UE6 A;  1CZG A;  2KA7 A;  1B7Y B;  3CAM A;  4LF5 L;  1G29 1;  3CC2 A;  5C3W A;  3NWS A;  3CCV A;  1I6H H;  4LWC A;  1OO9 B;  4OHJ A;  1CKN B;  2AKW B;  5C5M A;  3P7J A;  1S5E D;  3HEJ A;  4A93 G;  5C4J B;  5C3X A;  1K0R A;  1B3A A;  4FXG C;  1AP0 A;  1I4G A;  5FLM H;  1X6O A;  4RFB A;  3VA7 A;  4TQU S;  1WTO A;  3IFD A;  4WJ4 A;  4RGO S;  1Q7Y C;  4ILW A;  5J1Z A;  3H6M A;  2EY6 A;  1S40 A;  1FYC A;  1PH6 A;  1ZYR D;  4GKK L;  4O1N A;  1PTO C;  3G71 A;  4LAA A;  4HIO A;  4A3C G;  1IYU A;  2KEE A;  2NVX H;  3G48 A;  4A3E B;  1A8V A;  2VZA A;  2B2Y A;  5EPL A;  4LW1 A;  2Z8L A;  1YHB A;  4C3H H;  5C3E G;  3U9O A;  4OXP A;  2B2V C;  4ME5 A;  2EPB A;  1YVC A;  4OO1 H;  3PIP 3;  4LUZ A;  1HNW L;  3M3Y H;  4ZUJ A;  4B3M Q;  1U5K A;  1HTP A;  2I5L X;  4JI7 Q;  3CKI B;  2H1E A;  3Q24 A;  3F2U A;  1GUO A;  1XNR L;  1CT1 D;  2BE5 C;  5ELF A;  4X64 Q;  4KJN A;  4JYA Q;  1CSQ A;  3URY A;  3BYT B;  2M9V A;  4ZCK A;  1PMR A;  2NN6 H;  4IFD J;  1Q82 C;  1VQK A;  1VQJ A;  1L1O B;  1IHZ A;  2Z0S A;  3UDX A;  4K2K A;  2OTJ A;  2I46 A;  3EBE A;  4OWW B;  4HTH A;  4HIK A;  1YHA A;  2ID0 A;  3UDF A;  4IFD G;  1AEX A;  1L0X B;  1JB3 A;  3K7U C;  4OGQ C;  5M3F B;  2VQE L;  5GAE C;  3R2I A;  3PUV A;  4IUV A;  2D5D A;  4ODG A;  5C4J H;  3AEV A;  2R93 B;  1S5D D;  4B3T L;  4RAU C;  4L63 B;  4IOC A;  3CRL C;  1V1O A;  1QCB D;  3J80 E;  2UXC Q;  4Y52 H;  3HS0 C;  4FO2 A;  4DNR B;  3BZD B;  1QWY A;  1PH7 A;  3KLS A;  1B2T A;  5M3M G;  3BG3 A;  1IW7 C;  1Y69 U;  4A3E H;  1Q86 C;  4DR4 L;  2L0C A;  3VDY A;  3SXH A;  2HHH L;  4NXN L;  1YNN D;  4X3U A;  2JEA I;  3MXN A;  3FHW A;  4DXF A;  5J39 A;  2ZM6 Q;  2E2I B;  1PH9 A;  4X62 Q;  1JE5 A;  2I07 B;  1PVO A;  1A15 A;  1PYB A;  3A0J A;  1ILQ A;  2XSC A;  4YHH L;  4LF4 L;  1Y1V B;  1EYA A;  1JWM D;  3RMH A;  5I9O A;  4I7Z C;  2D62 A;  1A3V A;  5I6W A;  1GHK A;  1J9O A;  4JI6 Q;  1XYI A;  1SJH D;  4RG1 A;  1T5X D;  1VQ7 A;  3W1G A;  1ENA A;  1MHW C;  1RF2 D;  2K5V A;  3D8G A;  1CA5 A;  1IBM L;  2M2L A;  4LF9 L;  3MXN B;  2RQX A;  3W2D A;  2E74 C;  2A69 D;  4MZ9 A;  1CUK A;  2GA4 B;  2F0D A;  2L4N A;  2K14 A;  4MTK A;  1X9N A;  2ZTD A;  3ULL A;  5I2Y A;  3BZK A;  5M3F H;  4RCO A;  2D0O A;  2K04 A;  5FLM G;  1GUW A;  1NSN S;  1SNC A;  3GTP B;  2EIF A;  4ABN A;  3HGB A;  1TQO A;  4IAL A;  1CK1 A;  2R93 H;  5EKI A;  2B2U C;  2WP8 J;  4BBR B;  4DAY A;  5I4D A;  2YU9 B;  1R9T B;  3TP5 A;  4DNI A;  3J7Z C;  4V0B A;  2H5X A;  2A1A A;  5A35 A;  1K73 C;  5EAY A;  1VQH A;  1LTI D;  5IOD A;  4C3H G;  4HJ9 A;  4JVZ A;  4KY7 A;  2Q8I B;  1LTR D;  5IP7 H;  1HTL D;  3D3R A;  2K5W A;  5C44 B;  2DN8 A;  2E2I H;  3SK8 A;  1VQB A;  1EWC A;  2A68 D;  4DAY B;  3NBI A;  2OQ0 A;  4C1N K;  4IUN A;  1Y1V H;  2KJX A;  1E7Z A;  1XJV A;  3A7L A;  4DR7 L;  2EJM A;  5CV7 A;  1XPR A;  1RTN A;  5M5X B;  2F4V L;  4NDX A;  1O7Y A;  1QG7 A;  2A73 B;  2NN6 G;  2K52 A;  5G3L F;  1X3F A;  4XT3 B;  3H0G B;  1VF7 A;  4KD4 A;  4C3J B;  2J4X A;  4A3J B;  3S1M B;  1CQF A;  3NBH A;  2DJG C;  2EOT A;  1FJG Q;  4PG3 A;  2ZXO A;  3HG9 A;  2GVB A;  2UXB Q;  1U0L A;  2K05 A;  4PQX A;  1NCV A;  3I3C A;  1SDF A;  2VQF L;  2F4I A;  1AE2 A;  2E8G A;  1KAB A;  4DU9 A;  1E1T A;  2FMM A;  2V1C C;  1QE6 A;  2X69 A;  1SE3 A;  2F0P A;  4A3F B;  1SNQ A;  5D65 A;  3H15 A;  3GTP H;  4DK0 A;  4TKO B;  3I4M B;  4IUP A;  3NBH B;  5DAU A;  1VS0 A;  4BBR H;  1PH5 A;  2YU9 H;  1R9T H;  3S1R B;  1Z47 A;  2NBF A;  3FRP B;  4X3S A;  2WFW A;  3KLS X;  4CKE A;  4XQJ A;  4HED A;  1Q12 A;  1I4P A;  1OXT A;  5LMN Q;  3P1H A;  3NQI A;  2D0P A;  4LFB Q;  3KLW A;  4A3E G;  1HHV A;  1EYD A;  1EQV A;  2JE6 I;  2L15 A;  4DV3 Q;  3QOJ A;  2ZJQ A;  2IY5 B;  4ZRZ A;  3D4R A;  2AWO A;  1H9J A;  4NXM Q;  1S3O A;  3X3N A;  3ITP A;  1KLG D;  3FVQ A;  4R4C A;  3BVG A;  1CFM A;  2CW0 D;  2PMZ E;  4A3D B;  5LMU L;  5C44 H;  2MFI A;  1QUQ A;  4DR3 Q;  1EYC A;  3MFG A;  3A8I E;  3J81 E;  1WFQ A;  1PFB A;  1KNE A;  2N78 A;  5M5X H;  3T1H Q;  2A6H D;  1SEB D;  1QNU A;  4OIK A;  1PFN A;  2F3W A;  1EQT A;  4CKC A;  1V43 A;  3H0G H;  4CGY B;  5C0X H;  2MJ8 A;  2RDH A;  4C3J H;  1C8C A;  4A3J H;  3S1M H;  4GLV B;  3FPU B;  2KED A;  3E9I A;  4K6L A;  4HJA A;  1QUQ B;  2BH8 A;  4R4O A;  3AB9 A;  3DM3 A;  3KBX A;  5M3F G;  2F0H A;  4DV4 L;  3CD6 A;  2V4D A;  2EQS A;  4K5V A;  3G6J B;  1HJP A;  4KKU A;  2B2W C;  1GHJ A;  3UDG A;  4BA2 I;  2R93 G;  4A3F H;  3HOX B;  1MSH A;  4JI8 Q;  4A3G B;  4XQQ A;  2HDM A;  4HJ5 A;  3I4M H;  1BCP B;  4DUY Q;  1STE A;  2K28 A;  5KIX A;  5DM7 3;  4J6H A;  1E2V A;  4HSP A;  3VYT A;  3X3M A;  1U9R A;  3S1R H;  1WTQ A;  4XDX A;  3HOW B;  1SMX A;  4H13 C;  3AFP A;  1B4O A;  3MTS A;  4PMW A;  1Z7T A;  2QDL A;  4G4K A;  4DF7 A;  2F0I A;  1PRT F;  1Y14 B;  3RUZ A;  5IP7 G;  5CGK A;  2KQ3 A;  2MP1 A; 
#chains in the Genus database with same CATH homology
 4YHH Q;  4LF4 Q;  2OTL A;  3M7N A;  3I4N G;  1QVC A;  1EFW A;  1TWG H;  2VL6 A;  4BA1 I;  1X3G A;  2JA6 H;  3RN5 A;  3CW2 C;  3CCL A;  3S16 H;  1KQS A;  4LF5 Q;  4DR3 L;  1Y1V G;  2QEX A;  4A3D H;  2Q2I A;  3M4Q A;  3KOJ A;  3KFU A;  3GTQ H;  1J6Q A;  4A4I A;  2R92 H;  3H3V H;  1HZB A;  1XNQ L;  1HZA A;  2AMC B;  3AQQ A;  4JG2 A;  3CC7 A;  1K8A C;  1A62 A;  3CMA A;  3E9H A;  2WAQ G;  1PH2 A;  1IBL L;  4DKA C;  2JA6 G;  1LYL A;  3AYH B;  4PZ8 A;  2JA7 H;  1KXL A;  4JCV E;  4C2M H;  1L1O C;  5GAD C;  4GNX A;  1RL2 A;  2GN5 A;  1X55 A;  1IBM Q;  2E5L Q;  4IPD A;  3K80 C;  2N3S A;  2R92 G;  1OXS C;  1N32 L;  5HY6 A;  3CCR A;  4L5Q A;  3BJU A;  4XIG S;  3A74 A;  5M5Y H;  4OWX B;  4JOI A;  5IYC G;  3HOZ G;  1C7Y A;  1VQN A;  3GTO H;  1Q46 A;  2VNU D;  2K5H A;  3TS0 A;  1QZH A;  2WB1 E;  4QIW E;  4YY3 L;  4KHP L;  3PO2 H;  3U50 C;  4QJF A;  3NEN A;  4JC0 A;  4X65 Q;  3NEL A;  3DLL A;  3FP9 A;  2UUA L;  4DV7 Q;  5FJ8 G;  1JJC B;  3HOU H;  1WI5 A;  1VQF A;  1PH1 A;  1LTL A;  4BY7 G;  1Q8K A;  4A3M G;  2VUM G;  3I2Z A;  1C0A A;  1KRT A;  3HFZ B;  1YJN A;  2B63 G;  2PI2 E;  3K0X A;  4LF7 L;  3JC6 6;  4JI1 L;  4GNX C;  3I7F A;  1VQA A;  1NE3 A;  4UP7 A;  5M3M H;  4YWL A;  4JI8 L;  4X66 L;  4R1J A;  1E3P A;  1UEB A;  3HOX H;  4EQ5 A;  1YIJ A;  4LUV A;  4L5S A;  1N36 Q;  4GOP A;  4JOI C;  4OO1 I;  1HZC A;  4OWT B;  3GTK H;  1WYD A;  3HKS A;  3STB D;  1HNW Q;  1YNX A;  1YJW A;  2HT1 A;  1EOV A;  3PIO A;  1SLJ A;  4AIM A;  3L2P A;  4JI5 Q;  1VQG A;  5IYD G;  3BU2 A;  4DR5 Q;  1EIY B;  4LF6 L;  2UXD L;  4A3B H;  2HIX A;  5IYB H;  4A3G G;  3HOW H;  4UP9 A;  3KYH C;  5IY0 A;  1WOC A;  4UPA A;  3TS2 A;  2IX1 A;  1X65 A;  2N49 A;  1SR3 A;  3CPW A;  4GS3 A;  1X56 A;  2QA4 A;  4PZ6 A;  4JI3 L;  1CSP A;  1GVP A;  4FDB A;  2GVA A;  4B3R Q;  5JEA J;  3RLO A;  2NN6 I;  4A3B G;  4GKJ L;  2BA1 A;  5H1S E;  2IX0 A;  1BVS A;  3MEF A;  1MKH A;  1UE6 A;  3KDF A;  5C44 G;  3W1B A;  3S24 A;  1B7Y B;  4GOP B;  4GOP C;  3HOY G;  3CAM A;  4LF5 L;  1I94 L;  1G29 1;  4C3I H;  5C0X J;  3ULJ A;  3CC2 A;  4DK6 C;  2F4V Q;  3CCV A;  1I6H H;  2UUC Q;  1JT8 A;  4LWC A;  1FJG L;  1CKN B;  1ASZ A;  2UXB L;  2AKW B;  2Q2T A;  3PO3 G;  2K75 A;  2E2J H;  2JQO A;  5AJ3 L;  3L0O A;  2E5L L;  4A93 G;  3S1Q H;  2R7F A;  3H0G G;  5C0X G;  1H95 A;  2WB1 G;  4JI2 Q;  3J80 c;  3J80 i;  1K0R A;  2DUD A;  5BR8 Q;  3CXC A;  3G6E A;  4A3J G;  1BKB A;  5FLM H;  4A3K H;  1X6O A;  4JI0 Q;  4DR6 Q;  3PUX A;  2VQF Q;  2K5N A;  1VQ8 A;  1PHJ A;  4TQU S;  1XMQ Q;  4OON A;  3EIV A;  3KDF B;  4WJ4 A;  1Q7Y C;  1Y1W G;  4J15 A;  3GTG H;  4A3I G;  2Q2H A;  2VY3 A;  4AH6 A;  1S40 A;  1PH6 A;  4GKK L;  2VW9 A;  4DV7 L;  3G71 A;  3WWV A;  3J7A 5;  1VQ4 A;  1IL2 A;  2YTY A;  2RHQ B;  2OCE A;  1J5E Q;  2ASB A;  2NVT H;  4HIO A;  4A3C G;  4IPG A;  1N34 L;  3S2D H;  1IBK L;  2NVX H;  3G48 A;  1Z9F A;  2YTX A;  1DGS A;  2EXD A;  3TEH B;  4AQY L;  1FVI A;  1A8V A;  1GD7 A;  3TRZ A;  1UWV A;  1LM0 A;  1VQI A;  2VZA A;  5HGQ A;  5M5W H;  1YZ6 A;  5LMN L;  3OW2 A;  4LW1 A;  4KHZ A;  1YHB A;  2Q2U A;  4TVA B;  3I4M G;  2HHH Q;  3K7A H;  4H02 A;  4C3H H;  2K4K A;  1I5F A;  1V1Q A;  5C3E G;  4OXP A;  4NXN Q;  3PIP A;  1YVC A;  4DV1 Q;  1IZ6 A;  4JBM A;  4BXX H;  3TQY A;  2JJQ A;  4LUZ A;  1HNW L;  5JJL A;  3W5O A;  3M3Y H;  3CCJ A;  4B3M Q;  2UXB Q;  1U5K A;  1UE5 A;  2I5L X;  4DR5 L;  1FL0 A;  1CKO A;  4JI7 Q;  2HQL A;  1E24 A;  3KJO A;  3GTM H;  4OO1 G;  1XNR L;  1JJ2 A;  1UE7 A;  4GLX A;  1X54 A;  4X64 Q;  4JYA Q;  1YEZ A;  1UE1 A;  1CSQ A;  4EX5 A;  4IO9 A;  3S14 H;  4IJL A;  5IT9 c;  3IRB A;  5LMU Q;  3RZD H;  4IFD J;  1Q82 C;  4P72 A;  3OYY A;  3CC4 A;  1FGU A;  1HNZ Q;  1VQJ A;  1VQK A;  3I4O A;  3T1H L;  2UUB L;  3A5Z B;  3HOV H;  1L1O B;  5IE8 A;  3S15 H;  2Z0S A;  4A3D G;  4QQB X;  4LF9 Q;  2JEB I;  1AE3 A;  3UDX A;  3F2C A;  2OTJ A;  3EBE A;  4OWW B;  4HIK A;  1HR0 W;  4GLA C;  2UUC L;  1YHA A;  2CWA A;  2ID0 A;  3CPF A;  4LFC L;  4LNQ A;  3UDF A;  4UY8 C;  4IFD G;  1VQL A;  3D0F A;  2JA7 G;  1B70 B;  3K7U C;  1RIP A;  1N8R C;  4DR4 Q;  1VQP A;  2VQE L;  4NB3 A;  5DLQ E;  1TWA H;  2KCM A;  4DUZ Q;  3K81 C;  4KI0 A;  5GAE C;  4JI2 L;  1N33 L;  2Z6K A;  4P75 A;  3PUV A;  5BR8 L;  1HNX L;  5C4J H;  3G4S A;  1N9W A;  4JI0 L;  2AWN A;  1I3Q H;  3AEV A;  4JI4 L;  1XTD A;  4B3T L;  4DV2 L;  2JA8 H;  4R4Q A;  4IOC A;  1W2B A;  1VQ6 A;  3PO2 G;  4GNX B;  2UXC Q;  2F52 A;  1MIU A;  4Y52 H;  3CQZ H;  3PSI A;  3TRE A;  4JBK A;  1XPU A;  5C4X H;  2LXJ A;  3HOU G;  1OXX K;  1D7Q A;  1BBW A;  1NTG A;  1XMO L;  1YHQ A;  4DUY L;  2PNH A;  1PH7 A;  4BBS H;  1J5E L;  3FKI H;  3CCE A;  1K9M C;  2F3I A;  1GKH A;  1HH2 P;  1PFS A;  5LMN W;  4K0K Q;  5JJK A;  5M3M G;  3U4Z A;  3PF4 A;  1E22 A;  4A3E H;  3HOX G;  1Q86 C;  4RMF A;  3T1Y Q;  4DR4 L;  4P71 A;  1OTC A;  3VDY A;  2HHH L;  2Z6K C;  4NXN L;  1YIT A;  4X6A H;  2JEA I;  1K83 H;  3ER0 A;  4DV1 L;  3B6Y A;  3FHW A;  3OTO Q;  2ES2 A;  2ZM6 Q;  4DR1 Q;  1EQQ A;  1PV4 A;  1PH9 A;  4ALP A;  4X62 Q;  2LXK A;  1A0I A;  1JE5 A;  1PVO A;  1PYB A;  3A0J A;  2NVY H;  4YHH L;  4LF4 L;  3KF8 B;  4QL5 A;  4QGU A;  5IYB G;  1NJI C;  3HKZ E;  4POG A;  3HOW G;  1SN8 A;  3J81 j;  4OX9 Q;  2ALY B;  3I55 A;  4DR7 Q;  5E7N A;  4DR2 Q;  2HIV A;  1G6P A;  3CME A;  4X64 L;  2ZTC A;  3M4O H;  4HIM A;  3GDE A;  1VCI A;  1XPO A;  2B29 A;  2D62 A;  3PGZ A;  2UU9 Q;  1TXY A;  4JI6 Q;  2IHF A;  1WJJ A;  4RG1 A;  1VQ7 A;  1SE8 A;  3W1G A;  1KRS A;  4L5T A;  2K5V A;  1IBM L;  1WCM H;  2PQA A;  1X3E A;  4LF9 L;  3MXN B;  3PUZ A;  3CCQ A;  5IWA Q;  4GN3 B;  3U4V A;  4HJ8 A;  4PZ7 A;  1KC8 C;  5IP9 H;  4MZ9 A;  1CUK A;  3M85 A;  1Q81 C;  4L5R C;  2K14 A;  2JA5 H;  2DGY A;  1X9N A;  2ZTD A;  1B8A A;  3RN2 A;  3ULL A;  3UE1 A;  1N32 Q;  4R4I A;  1G51 A;  3BZK A;  3S17 H;  5M3F H;  1A63 A;  4DUZ L;  4X65 L;  2A19 A;  1NBW A;  2D0O A;  2KCT A;  1KIX A;  3S2H H;  5FLM G;  4A3K G;  1KD1 C;  4AYB E;  2EIF A;  3PUY A;  2CWP A;  4P73 A;  4O2D A;  1T9H A;  2R93 H;  5K36 G;  2UUA Q;  4DV5 Q;  2WP8 J;  2PQA B;  2B3G A;  3S1N H;  1Q1B A;  1TWF H;  4KLK A;  3U58 A;  1O7I A;  2IT1 A;  2MNA A;  4DNI A;  1N36 L;  2YYZ A;  2ZTE A;  3Q8D A;  2C35 B;  3J7Z C;  2H5X A;  4HJ7 A;  2A1A A;  1JMC A;  1W3S A;  4K0K L;  1K73 C;  3K8A A;  5EAY A;  4JI5 L;  1VQH A;  3AFQ A;  2R7Z H;  2JK8 A;  4A3L H;  5GAH C;  2KBN A;  4IOA A;  4LF8 Q;  4HJ9 A;  1PYS B;  1SFO H;  1QVF A;  2JA9 A;  4LUO A;  4ME3 A;  4BXX G;  1ASY A;  3HKZ G;  2AHO B;  1VQO A;  4HID A;  4POF A;  5IP7 H;  2ZM6 L;  4LF6 Q;  2UXD Q;  2RHS B;  4BY1 H;  2MQH A;  3J81 c;  4YCW A;  5FLX c;  1K8G A;  4B3R L;  3J81 i;  2E2I H;  3I4N H;  1C9O A;  1VQB A;  3NEM A;  4DAY B;  5JJI A;  2PI2 A;  2A8V A;  3UE0 A;  2OQ0 A;  2BH2 A;  2R6G A;  1Y1V H;  1OXV A;  1SRO A;  4OX9 L;  1E7Z A;  3ICE A;  1XJV A;  3GO5 A;  4JV5 Q;  3M9B A;  4DR7 L;  3ULP A;  1JJG A;  2QGQ A;  1XPR A;  1LUZ A;  2F4V L;  1EYG A;  3ZJY C;  2NN6 G;  2UU9 L;  2K52 A;  2RCN A;  1GM5 A;  3EN2 A;  3PCO B;  1X3F A;  4JI6 L;  3GD7 A;  4XTC S;  4BBS G;  3A5U A;  2ATW A;  3HOV G;  1I94 Q;  1MJC A;  5C0X I;  2YTV A;  2VS1 A;  1FJG Q;  2NZH A;  1OXU A;  3M4P A;  2OQK A;  4PG3 A;  2GVB A;  4DK3 C;  3KJP A;  5IWA L;  1HZ9 A;  1U0L A;  1HR0 Q;  5IYC H;  5ELN A;  1MJE A;  3HOZ H;  4DR6 L;  1I50 H;  1PH3 A;  3BZC A;  2IHE A;  2VQF L;  5AJ3 Q;  3RR5 A;  3RZO H;  5GAG C;  4AYB G;  1XMQ L;  1PH4 A;  1VQE A;  1AE2 A;  4JBW A;  4P74 A;  4DV4 Q;  2E8G A;  1KHI A;  5ELO A;  5FJ8 H;  1E1T A;  4B3S Q;  3GTJ H;  2V1C C;  4BY7 H;  4IPH A;  1P8L A;  4A3M H;  1SRU A;  1BBU A;  2KEN A;  4DV6 Q;  2I0Q A;  2JA8 G;  2B63 H;  3H15 A;  4IJH A;  4UP8 A;  3GTP H;  1PA6 A;  4MNO A;  1M1K C;  4IPC A;  4GKK Q;  4DV5 L;  3NBH B;  5C4X G;  1EUJ A;  1VS0 A;  4BBR H;  4A76 A;  4LFA Q;  2KHJ A;  2E2H H;  1PH5 A;  2YU9 H;  1N34 Q;  2NVQ H;  3RLN A;  1IBK Q;  1R9T H;  3FKI G;  1VQC A;  1Z47 A;  2XTI A;  4AQY Q;  2WFW A;  2MO0 A;  2KHI A;  1Q12 A;  1OXT A;  5IYD H;  5LMN Q;  4B3M L;  2N8N A;  4JBJ A;  2D0P A;  4LFB Q;  3KLW A;  4A3E G;  1VQ5 A;  2JE6 I;  2L15 A;  2RF4 A;  4BBR G;  4JI7 L;  4A3G H;  4LF8 L;  3PF5 A;  4DV3 Q;  2ZJQ A;  2VUM H;  2Y0S E;  2IY5 B;  1CKN A;  1JB7 A;  4NXM Q;  2AWO A;  1D8L A;  1S3O A;  3D31 A;  4YWK A;  4DV0 Q;  3CP0 A;  4R4C A;  4JYA L;  1L2F A;  4YCU A;  1K3R A;  2I5H A;  4APV A;  2PMZ E;  5LMU L;  5C44 H;  1XNR Q;  2MFI A;  1QUQ A;  4MTN A;  5GQO A;  4DR3 Q;  1HNZ L;  1KL9 A;  3HOY H;  4Y7N H;  1EWI A;  4NPS A;  4O0A A;  3LGJ A;  2CCZ A;  3GTL H;  1KAW A;  3H3V I;  4JV5 L;  1XNQ Q;  1QVG A;  2ZJR A;  4A75 A;  1WFQ A;  1S72 A;  4IFD I;  1IBL Q;  2N78 A;  2UUB Q;  5M5X H;  3T1H Q;  2CKZ B;  3PO3 H;  3F2B A;  4A93 H;  3CCS A;  2LSS A;  1VQD A;  1V43 A;  1WCM G;  3E0E A;  3H0G H;  1PH8 A;  2OWO A;  5JEA G;  4C3J H;  1NMG A;  4LFC Q;  2WAQ E;  4A3J H;  2YV5 A;  4YCV A;  3CF5 A;  1YI2 A;  1VQ9 A;  5IP9 G;  3S1M H;  4WJ3 M;  1HR0 L;  2BA0 A;  3F8T A;  5J3B A;  2JA5 G;  1YBY A;  4GLV B;  2VQE Q;  4YY3 Q;  4KHP Q;  3E9I A;  1L0W A;  1Y1W H;  4HJA A;  1P16 A;  1QUQ B;  2BH8 A;  2CFM A;  4R4O A;  3DM3 A;  4YWM A;  3KF6 A;  4DAM A;  5M3F G;  4DV4 L;  4A3I H;  1N33 Q;  3CD6 A;  4GN5 A;  1HNX Q;  3STB C;  2UXC L;  3ERS X;  2EQS A;  3PV0 A;  4JI4 Q;  2R7D A;  1YJ9 A;  4B3S L;  4B3T Q;  2I5M X;  3SGI A;  1HJP A;  1NMF A;  4DV2 Q;  1M90 C;  4QY7 A;  1VQM A;  1QZG A;  4A3C H;  3UDG A;  4DV6 L;  4LF7 Q;  2NZO A;  4BA2 I;  4JI1 Q;  2R93 G;  4A3F H;  1AH9 A;  2FXQ A;  1IYJ B;  3L7Z C;  3F1Z A;  4JI8 Q;  4X66 Q;  3UDI A;  4HJ5 A;  3I56 A;  1TWH H;  1E1O A;  2XGT A;  1XMO Q;  3I4M H;  4DUY Q;  3PUW A;  5C3E H;  3T1Y L;  2CQO A;  1GO3 E;  4LFA L;  4R4T A;  3CCM A;  4DPG A;  4A3F G;  1Q1E A;  3F2D A;  3OTO L;  1TWC H;  2K50 A;  4DR1 L;  3S1R H;  2Y0S G;  3CCU A;  3RNU A;  1SMX A;  2MO1 A;  4X62 L;  2ZJP A;  3KF6 B;  3AFP A;  5GRO A;  4GN4 B;  2R7Z G;  4A3L G;  4LFB L;  1L1O A;  3RLF A;  4PMW A;  1EIF A;  1IXR A;  1NY4 A;  4DV3 L;  1EQR A;  4JI3 Q;  1V9P A;  3JAM c;  1Y14 B;  1CKM A;  5IP7 G;  4NXM L;  3JAM i;  4DR2 L;  4BY1 G;  4DV0 L;  4GKJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...