3CP0A

Crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SPRALVGHRAEVLEDVGATSGQVRLDGSIWSARSMDPTHTFAEGEIVSVIDIQGTTAIVWKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from Corynebacterium glutamicum.
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Membrane protein
molecule keywords Membrane protein implicated in regulation of membrane protea
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cp0A00
3HOWG 2XTIA 1VQJA 3UE0A 1VQKA 4L5RC 1Q7YC 5LMNL 4KHPQ 5C0XJ 2UUBL 1XNRQ 2K5NA 2UUAQ 3STBC 4RMFA 1LYLA 3L7ZC 3HOUG 1UEBA 5LMNW 1Q8KA 2NVTH 2LSSA 1W3SA 5JJLA 5FLMH 4OO1G 1I94Q 1I50H 4K0KL 2JA7H 2Z6KA 2R93G 1S3OA 4YWMA 2XGTA 4LFCQ 2KHIA 4AQYQ 4B3RQ 4B3TQ 4B3SQ 4A3GG 4DR5Q 4DV5Q 2D62A 5C44G 5HY6A 4OX9Q 1QVFA 2MFIA 1XTDA 1S40A 2RHQB 1A0IA 3G71A 1NJIC 1VQLA 3KDFA 5M3FG 4BA2I 4A3FH 3PV0A 3CCJA 4HIDA 5C0XI 1IBLL 1KRTA 1L0WA 3Q8DA 1QZGA 2VQFQ 1PH7A 1IBML 3AFPA 4GLAC 2BH8A 2N78A 1XMQL 5ELNA 2KHJA 3F2DA 1NTGA 3W1BA 4DUYL 3GTPH 2JEBI 1NY4A 1UWVA 3E0EA 1JJCB 1NBWA 1LM0A 1Z9FA 4JBWA 4IO9A 4LFAQ 5IT9c 4JI1L 1KC8C 4LF4L 1XNQQ 1Q1EA 1GM5A 2F4VL 2AMCB 4LF7Q 4LF6Q 4P73A 3K80C 4A3LG 3CPFA 4DUZL 1WYDA 5JJKA 4UP8A 4GLXA 3K0XA 4R4TA 2DUDA 1QZHA 1PH6A 4OWWB 1E7ZA 1OXUA 3PSIA 1GO3E 3ULJA 2K14A 3U58A 2R7ZH 1IXRA 1HNXQ 3H3VH 4LF7L 4L5QA 1Q12A 1EFWA 1SLJA 4JI3Q 2UU9L 3KYHC 4DR2L 1Q46A 4XIGS 2UXBL 4GOPC 1OXSC 2Z0SA 1PH4A 4ME3A 3CW2C 1L1OC 1XPUA 3TREA 1KRSA 2ZTEA 1GVPA 4KI0A 3G6EA 1MJEA 5DLQE 2VZAA 5IP9H 4HIOA 4NXML 1EQRA 4JI2Q 1X3GA 1D8LA 1OXTA 3RN2A 2ES2A 2JA6H 1D7QA 1RIPA 1KAWA 3IRBA 3RLOA 3PO2H 1N8RC 3PUZA 4B3ML 2KCTA 1JE5A 1CUKA 1N36Q 4QJFA 1JB7A 2MO0A 1TWGH 4AYBG 2K52A 3KOJA 2ZM6L 4DR1Q 1R9TH 4JV5L 2R93H 4YCVA 2JEAI 3GDEA 3PCOB 4QY7A 3CXCA 2I5LX 3W1GA 4DK3C 1YNXA 3ZJYC 1Q86C 4AQYL 1SE8A 3J80i 1PA6A 4B3TL 3S1QH 4BBSH 3F1ZA 4GN5A 1M1KC 4JBMA 1A63A 4OWXB 2UXCL 1ASZA 3HFZB 2NN6G 4JI5L 1HZBA 1I5FA 1TWHH 1PHJA 1HNWQ 1TXYA 2VY3A 4IJHA 3NEMA 4R4IA 1J5EQ 4HJ9A 4JI6L 3KJOA 1K3RA 1SROA 2K5VA 1UE7A 2PI2A 4FDBA 2CWAA 5LMUL 2VQEL 2HHHL 1Y1WG 4LF5Q 1B7YB 3BU2A 4DV2L 2KENA 4YHHL 4AYBE 2YTXA 2K50A 3GTOH 4QGUA 3CCSA 1KQSA 4LFAL 1EQQA 2VQEQ 4QL5A 5FLMG 1N34L 1HH2P 4A3CG 4BA1I 1KXLA 3I56A 4XTCS 2JA5H 4A93H 4IPHA 1Z47A 3EN2A 5IP7G 4JI8Q 3U4ZA 3HOYH 4PZ6A 1AH9A 3I2ZA 2RHSB 1L1OA 4P74A 1K83H 4DV7Q 2IHFA 4X65L 2VQFL 2WP8J 2E5LQ 4DR4L 4IOAA 1I6HH 3HOZG 1VQEA 3G4SA 2VL6A 1U5KA 1K73C 1E1TA 1CKNA 1VCIA 1X6OA 3UE1A 2WAQE 1N9WA 1SMXA 5K36G 2R7ZG 3S24A 3NENA 4NB3A 4P75A 1KD1C 1YHBA 5M3MH 4AH6A 1MIUA 1UE6A 1FL0A 3GTMH 2JK8A 3FKIH 5GAGC 4O0AA 2VS1A 1SFOH 4B3SL 2JA6G 3TS2A 4Y7NH 1CKMA 5IP7H 4DV6Q 3D31A 3S2DH 3K7AH 2OTJA 1YI2A 3M9BA 1X65A 4LF8Q 2R6GA 1I94L 2EXDA 2EIFA 1CSPA 5C3EG 4JI2L 3GD7A 2GVAA 4P71A 4MNOA 3AEVA 1L1OB 4OXPA 1UE1A 4UP9A 4BY1G 5AJ3Q 1EIFA 2UUAL 5IYCG 4JI4L 3K7UC 4R4QA 2WB1G 1HZCA 1IZ6A 1CSQA 1HNZL 4GN4B 1T9HA 4X6AH 1I3QH 2PQAA 2N49A 5GROA 4J15A 1VQFA 4JI3L 3UDGA 2R92G 1HNXL 3MEFA 4DPGA 5IYCH 4GOPA 3VDYA 3KF6A 4JC0A 1VQIA 2K75A 1V1QA 4YWKA 4WJ4A 4YCWA 3I7FA 3BZCA 4LUVA 4DV3Q 3CP0A 1QUQB 4JI6Q 2Q2IA 1J5EL 1A8VA 3S1NH 3J7A5 1HR0Q 2A8VA 4LF4Q 1VQ5A 1AE3A 3NBHB 1YHAA 4DNIA 3I4OA 1WJJA 1JT8A 2Y0SE 1YITA 3KLWA 1XMQQ 1PV4A 5IWAL 4A75A 4HIKA 1PVOA 1N32L 4GN3B 3S1RH 3GTJH 1P8LA 2JA5G 4A3EG 1X3EA 2VNUD 2NVQH 5IYBG 2ALYB 4LF8L 4GKJQ 4A3MG 4IOCA 1VQDA 4X66L 1VQAA 2R92H 1O7IA 4EQ5A 2CQOA 4JG2A 4DV6L 1IBLQ 1WOCA 3CCMA 5ELOA 4LNQA 4APVA 3CCRA 3CQZH 3S16H 4A3DH 1G291 5C3EH 2BA0A 2PI2E 4HIMA 4B3MQ 1QUQA 4GKJL 3CCQA 5E7NA 3CCUA 4DR7Q 4OX9L 4A3GH 2GN5A 4DR5L 4NXMQ 3E9IA 4DK6C 1EIYB 3PUWA 4R4CA 3BJUA 1YHQA 2AKWB 3UDIA 1WCMG 3UDXA 3EIVA 5FJ8G 3AFQA 2QA4A 2K5HA 4A3JH 3HOXG 4DR3Q 4YY3L 4L5SA 4A93G 5C0XG 1GKHA 1G6PA 2IT1A 4OO1I 4WJ3M 4BBSG 1FGUA 4GNXA 4IFDG 2E8GA 4IFDJ 1VQ7A 1WI5A 3CF5A 1N34Q 5IE8A 3L2PA 1QVGA 2LXJA 1XPOA 3M4OH 2D0PA 5IYDG 2VUMG 2GVBA 4UP7A 4TVAB 4HJ8A 3BZKA 3RZDH 4JI1Q 2UUCQ 2Q2HA 1OXXK 2MO1A 3RLNA 3G48A 4YCUA 2Z6KC 3T1YQ 1HNZQ 4JOIC 1HR0W 3S2HH 2JA8G 2E2JH 2AWOA 2N8NA 3HOVG 5IP9G 2JE6I 1C9OA 3NELA 4DV4Q 2OQKA 4JI5Q 2I0QA 5M5YH 1FJGL 2I5MX 5C44H 4IJLA 2UXCQ 1E24A 3T1HQ 1K8AC 1VS0A 1E1OA 2OQ0A 1VQNA 1VQ6A 4A3FG 2HQLA 3CMEA 4IPCA 4C3HH 2B29A 1M90C 1E3PA 4LFBL 1C7YA 4KLKA 4LFBQ 4HJ5A 2E2IH 2C35B 4DV5L 1X56A 4B3RL 4GS3A 3RLFA 4POFA 3HOUH 1N36L 4PG3A 3H0GH 4AIMA 3HOXH 2JJQA 4X66Q 3T1HL 1VQPA 4JI0Q 5M3MG 1TWFH 4DV7L 1PYBA 4LWCA 3JAMc 3J80c 3CPWA 4K0KQ 1FJGQ 3GTKH 1MKHA 4DR6Q 3CD6A 3CAMA 5C4XG 2R7FA 1PFSA 4BBRH 3EBEA 1Y1WH 5M5XH 1RL2A 4DV1L 3PF4A 5LMNQ 4C3JH 3MXNB 1X55A 1XPRA 2H5XA 4KHZA 3CMAA 1WFQA 4YHHQ 2VW9A 3HOWH 1YVCA 1HR0L 3ULLA 1VQ8A 3AQQA 2YV5A 3AYHB 4A3EH 3K81C 4DV3L 3A5UA 5LMUQ 3RR5A 3B6YA 2CFMA 1IYJB 1EOVA 1FVIA 1IL2A 3CC7A 1QVCA 3OTOL 1SRUA 3DLLA 1X9NA 4A3DG 1XNQL 4PZ8A 3I55A 3I4MH 1BBUA 1KHIA 2ZTCA 3F8TA 4DR3L 3PUXA 1PH2A 2NZHA 3GTGH 3HOZH 4JBKA 5JEAG 2JQOA 3TS0A 1YEZA 5BR8Q 3H0GG 4DV1Q 4A3BG 4QQBX 1N32Q 4OONA 4DUYQ 2ASBA 1LUZA 3KDFB 4DR6L 3ICEA 2IX0A 1G51A 3PUYA 3KF8B 4DR7L 1IBMQ 2RCNA 3J81j 3S15H 4NXNL 1TWCH 1Y1VG 2ZM6Q 4JI0L 2UXDL 1VQ9A 1XMOQ 1UE5A 1K8GA 1YJWA 3A74A 3HOVH 2FXQA 3I4MG 1V43A 2HIXA 1NE3A 2UXDQ 2K4KA 5JEAJ 4NXNQ 1BKBA 3M7NA 4BY1H 4A3JG 1DGSA 1GD7A 4DAYB 1CKNB 5JJIA 3CC2A 4BY7G 4A76A 5GADC 3H15A 4A3IG 4DV0Q 4UPAA 5BR8L 1TWAH 3TEHB 3A5ZB 2ZJPA 3PIPA 1KIXA 3OYYA 2NZOA 4UY8C 4A3LH 1SR3A 1VQGA 1Q81C 4DKAC 1NMGA 1JJGA 2AHOB 4MTNA 2NVYH 1PYSB 2AWNA 1XNRL 2I5HA 4GOPB 1WCMH 4DAMA 5J3BA 5C4XH 1B70B 3M4PA 1IBKL 2NVXH 1YJ9A 2ZJQA 1BVSA 4X64Q 2B63G 1EUJA 1YBYA 1L2FA 1HZ9A 1YZ6A 4DUZQ 3U4VA 2MQHA 1JJ2A 4C2MH 4GLVB 3PUVA 3HKZG 3JC66 1VQ4A 4R4OA 3FHWA 1OTCA 2QGQA 4GNXC 2HHHQ 2EQSA 4X64L 5C4JH 3J7ZC 2B63H 4EX5A 1IBKQ 1VQBA 4JCVE 2DGYA 2WFWA 4H02A 3RNUA 1VQCA 1HNWL 2RF4A 1AE2A 5EAYA 4OWTB 3KFUA 1K0RA 1XJVA 4A3CH 1J6QA 2YYZA 2YTVA 3PGZA 2N3SA 4DV0L 3ER0A 1PH1A 4IFDI 3RZOH 1YJNA 2A19A 4JI7L 5IYDH 1LTLA 1VQHA 2YTYA 3PO3H 2BA1A 4ALPA 1HJPA 1C0AA 4LF9L 2OTLA 2CCZA 2JA8H 3JAMi 3KF6B 3FP9A 4O2DA 3K8AA 4A3KG 2QEXA 4A3IH 3I4NH 1H95A 4RG1A 4LUZA 3TQYA 3PO3G 4TQUS 4A3BH 4MZ9A 4LW1A 2Q2UA 2VUMH 1A62A 1CKOA 2JA7G 3OW2A 1YIJA 2KBNA 5HGQA 3STBD 5M5WH 4BXXG 1BBWA 2A1AA 4JI8L 1X54A 5IWAQ 4DV4L 1EYGA 4L5TA 4A4IA 5IY0A 1Q82C 4X62Q 2LXKA 1EWIA 3U50C 1W2BA 1Y14B 3E9HA 4IPDA 2ATWA 4KHPL 2L15A 3CCEA 5FLXc 2IHEA 1HZAA 3S17H 2UXBQ 4DR2Q 2UU9Q 5GAEC 1PH9A 1P16A 2CKZB 4NPSA 4POGA 2OCEA 1SN8A 2R7DA 5M3FH 3J81c 2HIVA 4DV2Q 4HJAA 2OWOA 4R1JA 4GKKL 4JYAL 4LF5L 4QIWE 1U0LA 3WWVA 3DM3A 2JA9A 2NN6I 5IYBH 1S72A 2PMZE 4BXXH 4JOIA 3M85A 1VQOA 1ASYA 4JYAQ 2Q2TA 3M3YH 3PIOA 3CCVA 3SGIA 3D0FA 1OXVA 4GNXB 4YY3Q 3GTQH 2HT1A 3S14H 3GTLH 3PO2G 4IPGA 3W5OA 4A3MH 2YU9H 4X62L 3PF5A 2BH2A 5AJ3L 4JI4Q 3RN5A 3CC4A 4LF9Q 3F2CA 3FKIG 1N33Q 1K9MC 5GQOA 2PQAB 5FJ8H 3GO5A 1KL9A 2WAQG 3HOYG 4PZ7A 4DR1L 2PNHA 4JV5Q 2ZTDA 3LGJA 3A0JA 1PH3A 4C3IH 1XMOL 2IX1A 1MJCA 3HKZE 4P72A 1PH5A 1Y1VH 3HKSA 1VQMA 2WB1E 2V1CC 5GAHC 3M4QA 1N33L 4LUOA 4LFCL 4JBJA 2ID0A 3UDFA 3ULPA 4JI7Q 4A3KH 4YWLA 2D0OA 1Q1BA 1X3FA 3I4NG 4DR4Q 5H1SE 4X65Q 2E5LL 4PMWA 2B3GA 3KJPA 1V9PA 3CCLA 2IY5B 3TRZA 2KCMA 3ERSX 3J81i 3OTOQ 1NMFA 4BY7H 2F52A 3F2BA 2UUBQ 4HJ7A 2CWPA 1B8AA 4Y52H 2MNAA 2ZJRA 3S1MH 2Y0SG 4BBRG 3H3VI 3T1YL 1PH8A 2UUCL 2F3IA 4LF6L 3L0OA 4GKKQ 2F4VQ 1E22A 1JMCA 2E2HH
chains in the Genus database with same CATH superfamily
4ZKCB 1QCBD 3KUPA 4QF4A 1VQKA 4L5RC 4EQPA 4DN4M 2UUAQ 2ZXPA 2O4XA 3K57A 1CTMA 3VYUA 3NQTA 1TWAB 4J8QA 4OO1G 4K0KL 3A55A 2F0KA 1G2SA 1C48A 1S3OA 1JOKA 2KHIA 4OIJA 5KYIA 1FD7D 4B3RQ 4A3GG 1E2ZA 5C44G 5HY6A 1QVFA 4K8JA 5E4WC 1R4QB 1SXTA 5BN3A 3QJYA 4A3FH 3PV0A 4HSVA 1IBLL 3KF8A 1QZGA 1S5DD 4GLAC 4BWGB 1F9QA 5ELNA 3F2DA 3GTPH 2JEBI 4ZK9B 4C3HG 5A2QL 1U9RA 4DNRB 3MZ5A 1JJCB 4IUUA 4JBWA 1KC8C 1Q1EA 3RMHA 1GM5A 2F4VL 4LF7Q 1H9MA 4P73A 4A3LG 5JJKA 1XYIA 4ZUJA 4GLXA 1IYUA 4R4TA 2DUDA 1ZXTA 1QZHA 2QF7A 3ULJA 2K14A 2ENBA 3HKZB 1VDZA 3OMGA 4XIGS 1QJOA 1PH4A 2F4IA 4F88A 5M3MB 1XPUA 4N9TA 5KRUA 2PCFB 4H44C 2E2DC 4NXML 2GA4B 1UAPA 1X3GA 2ES2A 1H9SA 4EQNA 3RLOA 1KAWA 4DGZA 3PUZA 1JE5A 1LACA 2MO0A 3D8GA 4AYBG 2K52A 4DR1Q 3MXNA 2HQEA 3I90A 4QY7A 2Q8RE 1EY7A 3W1GA 1YNXA 4C3IG 4BBSH 1SNPA 1M1KC 1D5ZC 2D2CC 1ASZA 4JI5L 5CV7A 4LMQD 1TWHH 1NAPA 2VY3A 5BN5A 4HJ9A 4RFBA 1YNJC 3NHHA 1Y8PB 4FDBA 4HMJA 5IOCA 4CGYB 2VQEL 3EJIA 3BU2A 1DZ1A 1ONLA 2KENA 3VR4A 5CV8A 2K50A 2BE5D 4QGUA 4LFAL 3GTOH 3OIQA 4A3CG 1CK1A 1KXLA 4XQNA 2WKCA 3SK8A 1J9OA 4PZ6A 3I2ZA 3I91A 1HRJA 4DV7Q 2E5LQ 2WP8J 4V190 1EYDA 2XIWA 3G4SA 4WFN3 2X6GA 1N9WA 1SMXA 1AP0A 1KD1C 5C0XH 4R8NA 1MIUA 1FL0A 4WORA 4O0AA 1SFOH 3MFGA 2E75C 1CKMA 4RKBA 3S2DH 4CDDC 3H09A 1F2ZA 4KN7C 4XDXA 4H0LC 2NVQB 4IURA 2EXDA 1BF4A 1CSPA 4JI2L 3E0JA 4L6TB 4MNOA 1UE1A 4M1UB 1EOTA 4UP9A 2UUAL 4R4QA 2FINB 3ERQA 4TSSA 2L55A 1E2WA 3HZXA 5GROA 1I4GA 1VQFA 2A6EC 3A56A 4JI3L 3EA6A 4DPGA 4JC0A 2K75A 4WJ4A 1LT3D 2R7ZB 4LUVA 5FO7B 3BDOA 1WTXA 2XWBB 4JI6Q 5E3FA 1IYVA 3J7A5 2K5WA 3K5MA 1YHAA 1VF5C 3I4OA 1WJJA 3VR5A 2Y0SE 2RCFA 1YITA 4IUQA 2YU9B 4A75A 2XRSD 1PVOA 1I4PA 2VNUD 5IGBA 4DA2A 3A7LA 2ALYB 3MEHA 4LF8L 4GKJQ 1O7IA 3OIPA 4JG2A 3DUZA 4G4KA 5ELOA 1ENFA 3SR1A 1G291 2BA0A 1TR5A 4B3MQ 3GP7A 4GKJL 1YNNC 1NR4A 4DR5L 4DK6C 5ELCA 1NR2A 3PUWA 1EIYB 1H9SB 1B44D 3BJUA 4OHJA 5EBCA 3OMCA 4ME5A 4XT1B 4DFAA 1ZYRC 1WCMG 3UDXA 3UDIA 4A3JH 1HXYD 4FXDA 4L5SA 4A93G 1G6PA 1FGUA 4IFDG 4IFDJ 1XTCD 4LAAA 1SNOA 4IUTA 1CA6A 5IE8A 4KD3A 1QVGA 2LXJA 1F9PA 2A68D 2GVBA 2JN4A 5KNCA 2Z6BA 4HJ8A 3NTHA 2Q2HA 2UUCQ 2QCPX 1C8CA 3G48A 3T1YQ 4JOIC 3S2HH 2AWOA 3HOVG 5IP9G 1CZWA 1A3VA 1ICFB 5CV5A 4DV4Q 3VR6A 5FO9B 4HMIA 1FJGL 1JC7A 5COYA 2XWJB 2UXCQ 1I4HA 3T1HQ 3S15B 1VQNA 3S1RB 3CMEA 1EY4A 1E3PA 5FLXL 4HTHA 2K05A 4GS3A 1S4ZA 4ID6A 5M3MG 1PYBA 1LTSD 1TS5A 2B39A 3J80c 3HS0C 2A6ED 4A93B 3CD6A 1JWSD 4IALA 2KHSA 5BN4A 1Y1WH 4DV1L 1RL2A 3Q24A 3V96A 3I70A 2Z9HA 4FXGC 1I3QB 1X55A 5ISRA 4KHZA 3S2HB 2BDNA 5HGTA 1WTPA 2X69A 1YVCA 4V0BA 5FO8B 3ULLA 1VQ8A 3CHBD 2PZUA 4A3EH 4RGOS 5CBEE 3A5UA 2EY5A 3HOVB 3T56B 1EYAA 1IL2A 1NCVA 1QVCA 3RD4A 1X9NA 4A3DG 1BBUA 3HOZH 1ENAA 3GTGH 2NZHA 3N52A 2G9DA 4DV1Q 1N32Q 4OONA 1STAA 1LUZA 3KDFB 2F3VA 2X6LA 5IGGA 2IX0A 5DM63 3KF8B 5IGDA 1TU2B 2RCNA 2ZM6Q 1VQ9A 4HAEA 1PTOC 1SYDA 2HIXA 1NE3A 2UXDQ 5JEAJ 4OIKA 1ZKOA 1SFOB 1NNXA 3QWNA 4DXFA 1GD7A 4DAYB 3PO3B 5C6AA 5GADC 2ZT9C 2JP1A 4UPAA 5BR8L 1TWAH 1KIXA 1LT6D 2NZOA 1Q81C 2CQAA 1JJGA 1DJRD 4H13C 4NDXA 4K14A 1DM0B 1TVXA 2B63G 1CQFA 2NVXH 1BVSA 1YZ6A 4MTKA 1JJ2A 2F0NA 2DJFC 4X64L 2KJXA 2A6HD 1EFID 2DGYA 3S14B 3NPPA 1VQCA 3N6RA 1HNWL 2RF4A 4JK1C 4A3JB 5EAYA 4OWTB 4WJWA 1HA5A 3KFUA 1K0RA 1G2TA 4A3CH 1J6QA 2YTVA 1ENCA 2F0UA 4JI7L 5JJZA 1QWYA 1VQHA 1SYEA 2RBMA 1C0AA 5J22A 2JA5B 2JA8H 3T51B 3IKJA 1H95A 5E1FA 2K28A 4O42A 1XX8A 4CKEA 3PO3G 5M9OA 2FMCA 4A3BH 5CORA 2XSCA 2FHTA 1A62A 1GUNA 1Q8IA 2EYJA 1YIJA 2KBNA 4UHVA 5HGQA 2IX3A 1BBWA 4JI8L 1X54A 1JWUD 2F0FA 3GTMB 2E74C 4L5TA 1Q82C 4X62Q 3U50C 1Y14B 4KN4C 3FVQA 3CCEA 1PRTF 2E2HB 5FLXc 2IHEA 3S17H 2F0MA 1LV9A 2OCEA 4B9XA 1ML0D 4DV2Q 2OWOA 3U9SA 1U0LA 4I65A 1WTHA 3WWVA 1JE4A 4CDFC 1S72A 4JOIA 1MSGA 3M85A 2L12A 3SEBA 3CCVA 3SGIA 1LTRD 2EYOA 3GTQH 3HOWB 2HT1A 1STHA 4A3MH 2KEEA 1PYWD 5AJ3L 4JI4Q 3BYTB 4TKOB 1SNQA 1EY5A 2SNSA 3CC4A 2D5DA 3FKIG 2B2VC 1K9MC 1HFGA 2P5ZX 2JYOA 2IJ0A 1DOMA 4PZ7A 2PNHA 4G7HC 1A15A 2EYMA 4JVZA 1PH5A 3NTIA 2WB1E 2KUMA 3M4QA 1RHPA 2ID0A 4K5WA 3UDFA 4YWLA 2MGSA 1TQOA 1Q1BA 1W6JA 1X3FA 5H1SE 4X65Q 1K28A 4N8FA 5DNFA 3NBIA 3AB9A 1DYQA 3CCLA 4PNYA 1Y1WB 3DEOA 4BY7H 4EVOA 1O7ZA 5C3WA 4HJ7A 4Y52H 3ND9A 3RUZA 3SHLA 3H3VI 2R3ZA 4R9WA 2RSNA 4KV6A 3OWFA 2F3IA 4LF6L 3L0OA 2F4VQ 1E22A 3I4LA 3HOWG 2FFKB 1SSOA 1VQJA 4PMCA 4R8IA 5LMNL 4B9WA 1JWMD 2UUBL 4C3HB 1XNRQ 3STBC 3HOZB 1UEBA 3W3AA 4X3KA 1IW7C 1EZ6A 4HN7A 5LMNW 2NVTH 1PRTB 5JJLA 2IPKD 5FLMH 1I94Q 1WD1A 1IKLA 1BQQT 3K0YA 2XGTA 4B3SQ 4FF3A 4DV5Q 2NTSA 1BCPC 1S40A 2RHQB 1NJIC 3VA5A 4G7ZC 1EEFD 1MGSA 2K5QA 5M3FG 2HCCA 3PMFA 5C0XI 3J80L 1KRTA 4PQXA 3FPUB 1IBML 2D9UA 2N78A 4DUYL 3DHQA 1UWVA 5C4JB 5EBDA 5M5XB 2XNAC 4IO9A 4F8MA 4JI1L 3GV6A 5I2YA 2AMCB 5K5PA 3K80C 2NVXB 1PFNA 3D4RA 3K0XA 2KECA 1TWGB 4A3FB 1RKNA 2L4NA 3PSIA 2R7ZH 1GO3E 1EWCA 1S5BD 5KYLA 4L5QA 3GTJB 4LF7L 1EY6A 4DR2L 1OXSC 4C3JG 4ME3A 4NP5A 1PFBA 1L1OC 4XYOA 3P7JA 2K01A 1GVPA 3TZDA 4OGQC 3FMCA 1MJEA 1T5XD 4HIOA 1G91A 3RN2A 5C4XB 3QG1A 1RIPA 3IRBA 3PO2H 1N36Q 1AZQA 3NE5B 2F0PA 1S5ED 3JAME 3C1FA 4JV5L 5FKAC 2ZM6L 1JCKB 3L3OC 4IUVA 3GDEA 4HCSA 5JAVA 1SE8A 3J80i 3S1QH 2EE1A 4GN5A 4JBMA 1A63A 4Q0FA 4OWXB 3HFZB 2F0JA 1I5FA 1RTOA 2F0TA 3HG9A 1PHJA 1HNWQ 4QIWB 4IJHA 3NEMA 4R4IA 1STGA 2Q8IB 4NMZA 3KJOA 1SROA 1UE7A 4Z9CB 4ZYSA 2F0VA 1RF2D 2Z1CA 3I8ZA 4AYBE 2YTXA 3TSSA 1EQQA 3WDNA 4OO1H 1HH2P 1V1PA 3OW7A 4CHTB 1QB5D 2K7VA 4A93H 1Z47A 5IP7G 3HOYH 1AH9A 3JAML 1BXTA 2RHSB 3CRLC 2IHFA 4BY7B 4DR4L 5KNDA 3TN2A 3NTKA 1V1OA 1K73C 1VCIA 3UE1A 2QEJC 3S1QB 3NENA 4P75A 1RTNA 3D4WA 3LWUA 1UE6A 3ONAB 1RD9D 2JK8A 1F9SA 5GAGC 2N88A 2K04A 3MWYW 2JSOA 4A3GB 3URYA 1SAPA 5IP7H 4DV6Q 3DWAA 3M9BA 3EFXD 1X65A 2L0CA 2R6GA 1TWCB 2H1EA 3GD7A 3HGBA 4BY1G 5IYCG 2O5IC 1SNCA 1HUNA 5KIXA 1PTOF 3I4NB 1CSQA 2F03A 2SNMA 4N8X1 4J6HA 1Y8OB 1I3QH 2PQAA 3RZOB 1LO5D 1HNXL 5KEEA 3O13A 4YCWA 3I7FA 2RDGA 3BZCA 3S16B 3S2DB 3CP0A 3M3YB 2VB3X 1WTOA 3NXWA 1A8VA 3S1NH 2EY1A 4LF4Q 1AE3A 4DAVA 1L0XB 3I72A 1JT8A 1PLFA 2SEBD 1MD2D 1XMQQ 5IWAL 1CA5A 4FF4A 3GTJH 4A3EG 3PIP3 5IYBG 1HTLD 2L1BA 5C3XA 2PQEA 1EU4A 1TT2A 4A3MG 3H6MA 1VQDA 1VQAA 4EQ5A 1WOCA 4RKLA 4A3DH 2H4OA 1A3UA 3EROA 5C3EH 3SE0A 1AZPA 1TKWB 1YNND 3J81L 4NXMQ 1FNVA 2A68C 3J7YW 1HQRD 5FJ8G 5IGEA 4K6DA 1SNDA 5C0XG 1GKHA 5IODA 3SDZA 1E0BA 4BBSG 3PO2B 4GNXA 2KQ3A 3K59A 1N34Q 4U673 2CW0C 1XPOA 4XT3B 3DWQA 2SDFA 4UP7A 4TVAB 3MXUA 5IIFA 4JI1Q 3RLNA 1BDOA 4IN3A 1R9TB 2JA8G 2JE6I 1BCPD 3NELA 1R4PB 2OQKA 1WTWA 1HQMC 2NYZD 4CJ2C 1PFMA 2PNRC 1K8AC 1PDQA 2OQ0A 2MPMA 2HQLA 2EZVA 1M90C 2B29A 2ZXOA 3EVQA 5T1GA 4C1NK 1C7YA 4HJ5A 4DV5L 3VYRA 1JB3A 1X56A 2DY8A 3RLFA 1M8AA 2XRQD 1N36L 4PG3A 2A6HC 3LNNA 1SE3A 3H0GH 1AEXA 2JJQA 4X66Q 4JI0Q 4TRDA 4DV7L 4A3BB 4K0KQ 1B1ZA 5EKIA 4KK7A 2F0WA 3R93A 1I4RA 4DR6Q 3CAMA 1PFSA 3RZDB 3EBEA 2F3WA 5LMNQ 5IT9L 3MXNB 1PZID 1X3QA 3OHXC 2PO4A 1GHKA 4XXEA 4M8AA 1SYFA 4DV3L 3K5OA 2F0GA 1LTAD 3F2UA 3I4MH 2ZTCA 3GQBA 3PUXA 5CC4A 1SE2A 5JEAG 1YEZA 3KLSA 4IFDH 2E2IB 3MC0B 2DNCA 3BVMA 3R2IA 4IUPA 3ICEA 1G51A 2CVRA 4DR7L 1IBMQ 3S15H 1Y1VG 1SE4A 1DOLA 1XMOQ 1UE5A 2QKIC 1K8GA 3D6WA 2B2UC 5M5YB 3VR2A 3HOVH 2FXQA 3I4MG 4EGVA 3A8KE 2K4KA 4NW2A 4NXNQ 1BKBA 1J8IA 4A3JG 1DGSA 2ZXRA 2LKVA 2A74C 1FNUA 1XWEA 3TEHB 3Q0AA 3CQZB 4A3LH 1SR3A 1WTQA 1PYSB 2KEDA 2AWNA 1XNRL 1TWHB 1ILPA 4DU9A 3IFTA 2Z8LA 1WCMH 4GOPB 1A2TA 1IBKL 2ZJQA 1YJ9A 1EUJA 1YBYA 1L2FA 5C5MA 4DUZQ 1EL0A 1H9RA 4RH6A 4GLVB 3EQLC 4R4OA 3S9WA 2HHHQ 2EQSA 1VQBA 1FR3A 2WFWA 2WB1B 3MVVA 1AE2A 4RCOA 3DEPA 3DWPA 4DF7A 1XJVA 2NVTB 2BCOA 1SYBA 2N3SA 1PH1A 4F7XA 4IFDI 1D5MC 2A19A 2YTYA 2BA1A 4ALPA 4RCNA 2RDFA 1ILQA 4ZLTF 3V05A 1PRTD 3JAMi 3FP9A 3GTPB 2WIIB 3K8AA 4NKLA 2PW5A 2QEXA 4A3IH 4LUZA 4KHVA 4FYDA 3J80E 4TQUS 2NBFA 4ILWA 1CKOA 4L63B 4BXXG 4FF2A 2TMPA 2F0LA 1LABA 1U4PA 5IY0A 2LXKA 5C4HA 1X32A 2B2YC 4POGA 1P16A 1M4VA 1SN8A 2R7DA 3J81c 5M3FH 4HJAA 3BVGA 2LMCB 2NN6I 3DM3A 2PMZE 1KTKA 4BXXH 2NWGA 1ASYA 1OXVA 3K7AB 4YY3Q 1Q90A 3S14H 3GTLH 4MHEA 5EPJA 2BH2A 3RN5A 4G7OC 1O80A 4I7AA 3F2CA 3ITPA 3QOJA 2O5JC 2ZTDA 3LGJA 4QMGA 4E6IA 1PH3A 4ABNA 2NZ1D 2JA8B 1MJCA 3HKZE 2QDBA 2HCIA 2FJ2A 3NUCA 3T53B 2O2LD 1N33L 1B53A 1TS4A 1WTVA 4JI7Q 1KAAA 3G6JB 1STEA 1TS2A 2D0OA 5FLXE 4PMWA 2NVYB 1SYCA 3TRZA 3J81i 3F2BA 2NTTA 2ZJRA 2Y0SG 4BBRG 5A35A 4GKKQ 5LL6S 1TS3A 2B63B 3E5SA 1STBA 3P75A 3WOFA 3UE0A 2EY6A 1Q7YC 4KHPQ 1HA6A 2K5NA 1JORA 4RMFA 1LYLA 3L7ZC 3HOUG 1Q8KA 2K6AA 1Z7TA 1B3AA 1LTTD 1W3SA 2A73B 4C1NI 2R93G 1QG7A 3H94A 2KVMA 4LFCQ 5IT9E 4B3TQ 2D62A 2E76C 3M4YA 4OX9Q 2MFIA 1VQLA 2B8FA 4C3JB 3KDFA 3E6ZX 3C3LA 3CCJA 4KJNA 2VQFQ 2R61A 3AFPA 1VMCA 4KY7A 3Q6SA 1NTGA 1NY4A 1ESRA 3BDCA 3E0EA 1Z9FA 1G8ZD 3KBGA 4DAYA 5IT9c 3OSOA 3SK4A 1WYDA 5JOBA 1EU3A 4UP8A 5I6WA 3MXPA 1PH6A 1FNWA 3U58A 2ICIA 1HNXQ 3H3VH 4HR7B 1EFWA 1SLJA 4FXKC 1HPCA 2UXBL 4GOPC 3CW2C 3BVZA 4IQZA 3G6EA 4K6LA 5DLQE 1ZEQX 1RCVD 2VZAA 5IP9H 2CH4A 2JA6H 1D8LA 1OXTA 3OPOA 1CI3M 1N8RC 4B3ML 3A7AB 1CUKA 1EEID 5EKKA 1GHJA 1JB7A 1TWGH 4Y7NB 3KOJA 3KLRA 4C56C 2R93H 1R9TH 2EY2A 2JEAI 1EIGA 1TY0A 3VA7A 3PCOB 4LF9Q 4DK3C 1BOSA 3K5NA 1PA6A 3ZJYC 4AQYL 1BUVT 3FDTA 4CJ0B 2UXCL 4HSPA 3MTSA 2NN6G 1HZBA 1TXYA 3IFDA 1J5EQ 4JI6L 1K3RA 2K5VA 2PI2A 3K58A 5LMUL 1Y1WG 4LF5Q 1B7YB 4ZRZA 1UUPA 1F2YA 3PIO3 3BYYB 4QL5A 4PV1C 5FLMG 1N34L 4BA1I 4BY1B 3I56A 2K32A 1A6XA 1QILA 3EN2A 1I50B 1S5CD 1MBYA 1L1OA 4P74A 1K83H 5KGUA 2VQFL 2M9VA 4A3IB 2NUCA 4IOAA 1PZKD 3HOZG 4QB4A 2VL6A 1U5KA 1ET9A 1E1TA 1IW7D 4QUFA 3S24A 2R7ZG 4NB3A 3TP8A 4K5VA 2OT2A 1YHBA 3BG3A 4AH6A 3K5LA 2JA6G 1I4QA 2K33A 4IZ8A 5I9OA 3D31A 2OTJA 1YI2A 4MN3A 1I94L 2EIFA 5C3EG 2F0EA 3HP3A 4P71A 4A3EB 3AEVA 4CBVA 1IZ6A 4HEDA 4GN4B 3VYTA 4X6AH 2N49A 1KABA 2DJGC 1IKMA 3UDGA 4IUNA 1QOHA 3MEFA 1KDBA 4GOPA 3KF6A 1V1QA 3C46A 3TP7A 3CRKC 2Q2IA 1HR0Q 3S17B 2A8VA 2WINB 1VQ5A 1SMYD 1SMYC 4DNIA 1MHWC 1D1IA 3KLWA 3CKIB 3MAQA 3C2PA 4HIKA 1JOQA 1GOZA 2NVQH 5TSSA 2G9HD 1QNUA 3X3MA 2J4XA 4FVMA 2R92H 4K2KA 2CQOA 4DV6L 4DXGA 3CCMA 4LNQA 3D6CA 3S16H 3T4AC 4HIMA 1QUQA 3CCQA 1B9MA 5E7NA 3CCUA 4DR7Q 4OX9L 2PYKA 4A3GH 5D3IB 2GN5A 2F0QA 4R4CA 1WVLA 1YHQA 5ELBA 3BZDB 2IL8A 1BNZA 4KMUC 2G5DA 2AKWB 3DM1A 3AFQA 2QA4A 4DR3Q 1KDAA 4YY3L 5C44B 2IT1A 4OO1I 2K1BA 1FGBD 5CR3A 1VQ7A 3CF5A 3AU7A 2VUMG 1H9JA 1OXXK 2MO1A 1K8MA 1HNZQ 2E2JH 4KTAA 4ULLA 4Q5VA 4JI5Q 3NWTA 5M5YH 2I5MX 2IW3A 1E24A 1VS0A 1E1OA 5CV4A 2F0SA 1EQTA 2JA6B 2I07B 2NN6H 3D4DA 2F0HA 4C3HH 2B2UA 4LFBL 3MHBA 2Q8TA 4LFBQ 4KLKA 2K03A 2C35B 1D2BA 2JA7B 4B3RL 1HCZA 2I46A 5C3EB 4POFA 5JVH3 2LS01 1O7YA 2N55A 4AIMA 3HOXH 1VQPA 1EIHA 4LJZC 1JICA 4J1MA 3CPWA 1KLGD 3GTKH 3NSWA 1MKHA 4FO2A 3I3CA 3IAYA 2R7FA 5EJWA 1IL8A 2DNEA 3FRPB 3MFYA 2AQ3B 2B2TA 5HURA 1XPRA 2H5XA 2KOLA 4YHHQ 3HOWH 3GTQB 3Q22A 1BCPB 2YV5A 5CGKA 5LMUQ 1EOVA 2AQ1B 1QNKA 2HD3A 5JVG3 1SRUA 2M2LA 1EQVA 1V8QA 4DR3L 1KHIA 2CH4W 1PH2A 1CQVA 4XQJA 2JQOA 3TS0A 1HTPA 5BR8Q 3H0GG 3GTLB 4DK1A 4QQBX 1Y8NB 4DUYQ 3R8BA 2ASBA 2KCCA 1C4QA 4RHSA 3J81j 5C4ZA 4NXNL 1TWCH 4FNFA 4JI0L 4RWSC 2UXDL 2TSSA 2F1MA 3GTKB 1YJWA 3A74A 2WACA 1PRTC 3C1EA 3M7NA 2HDLA 1CKNB 5JJIA 1EYCA 3CC2A 4A76A 2Z4IA 4A3IG 1CHQD 3NK9A 4GZYC 1LTID 1PTOD 5I2XA 1LLRD 3OYYA 2VXWA 5LHY1 4MTNA 1JR0D 2NVYH 1TWFB 2I5HA 1K8OA 2JXMB 5A2QE 2EJMA 1HZ9A 3U4VA 2MQHA 3PUVA 3HKZG 3IL8A 3SXHA 3FHWA 1OTCA 2QGQA 4GNXC 3J7ZC 2B63H 4EX5A 1IBKQ 4JCVE 4H02A 3WOEA 3RNUA 1PXUA 2DN8A 3LX0A 3ZYYX 1WTRA 1I4XA 4DAPA 3A8JE 3L9AX 3PGZA 3ER0A 3RZOH 1YJNA 5IYDH 3PO3H 4FF1A 4LF9L 3GV3A 4HCEA 2OTLA 2CCZA 4F87A 4A3MB 4A3KG 2XVSA 1QE6A 3M4OB 4RG1A 5JPMC 2EOTA 1STNA 4MZ9A 2VUMH 2Q2UA 3OW2A 3STBD 2A1AA 2B2WC 3FKIB 5IWAQ 2CW0D 4DV4L 1EYGA 1RJTA 1F2LA 1N32L 2ATWA 3VR3A 4KHPL 2L15A 3H3VC 2UXBQ 4CKCA 4KKSA 1U4RA 2UU9Q 2CKZB 4NPSA 5EPLA 4CJ1B 2Z4HA 2M00A 4BBSB 2HIVA 4R1JA 4LF5L 1D5XC 2JA9A 2B2YA 1VQOA 3M3YH 3PIOA 4GNXB 2EJFC 1BCPF 1VMPA 2E2JB 1CT1D 2OXPA 1K3BC 3QR8A 2YU9H 4X62L 3PF5A 1F9RA 1I6HB 4BBRB 3SVMA 1N33Q 5GQOA 2EJGC 2F0IA 2WAQG 3HOYG 4JV5Q 5KNBA 2OF1A 5IGCA 3A0JA 1EY0A 5D65A 4C3IH 4K8IA 1KNAA 4L8JA 4P72A 5NUCA 1NUCA 1Y1VH 4KJOA 4KKTA 4LFCL 4A3KH 4DR4Q 2MP1A 3G7LA 1DXMA 2IY5B 3OTOQ 1NMFA 2ICEC 2F52A 1SYGA 1GJXA 3OWEB 1B8AA 2EYLA 2BDOA 2MJ8A 5M3FB 4C2MB 1HHVA 4CDEC 1D1KA 1U4LA 4B08A 1JMCA 4KKUA 2XTIA 4FP5D 2PZWA 5C0XJ 5LL6X 2RDHA 2LSSA 1I50H 4ZCKA 2JA7H 2Z6KA 1MSHA 5CYUA 4ZQ3A 4YWMA 5I4DA 3HOXB 5CV6A 4AQYQ 4DR5Q 1XTDA 4ZUIA 1A0IA 3G71A 1UEAB 1B4OA 1I6VC 4BA2I 4DNTB 4HIDA 3I4MB 1WCMB 1L0WA 3Q8DA 3H0GB 4OELB 2KCNA 1PH7A 3X3NA 2BH8A 4S3SA 1XMQL 2RQXA 2B2WA 2KHJA 4N9PA 3W1BA 5IGFA 4G57A 1LM0A 1NBWA 4LFAQ 3U9OA 4LF4L 1XNQQ 4H7BA 1RODA 4LF6Q 3CPFA 4DUZL 1PTOB 1EZ8A 2LFNA 1Z6HA 4OWWB 1E7ZA 1OXUA 3J7AF 1IXRA 4PMBA 1Q12A 4JI3Q 3R3OA 2UU9L 3KYHC 5I9PA 1Q46A 2Z0SA 1H9KA 1AN8A 3TREA 1KRSA 2ZTEA 1ZYRD 1KNEA 2PW7A 4KI0A 3QO2A 1EQRA 4JI2Q 1D7QA 3T16A 1F2MA 3ND8A 1U4MA 2KCTA 5FOBB 2J7ZA 4QJFA 2C5CA 2VB2X 4YCVA 2J0TD 3CXCA 1Q86C 4RAUC 2I5LX 4B3TL 1BR9A 3F1ZA 2A5HA 4LK1C 1BO0A 1UNSA 3GTGB 3Q23A 4X3TA 3NQIA 2C9OA 4XQQA 2DY7A 2BOSA 1DCZA 4A3KB 2CWAA 3P20A 2HHHL 4DV2L 4OL7A 4RGMA 3SK5A 1Y1VB 4YHHL 3CCSA 1KQSA 2VQEQ 2EYFA 5G3LF 2SOBA 4KY6A 4XTCS 5ELDA 2JA5H 4IPHA 3M7GA 3TP5A 4JI8Q 3U4ZA 2PZTA 4X65L 5G3LD 2V4DA 4BS9A 5CBAE 3KBXA 3HOUB 1VQEA 1I6HH 1CKNA 1X6OA 2EYPA 2WAQE 5K36G 2AUJD 3NBHA 5M3MH 3BS1A 5J1ZA 3GTMH 1IHZA 3FKIH 2VS1A 4B3SL 3TS2A 4Y7NH 1B50A 3K7AH 3D3RA 4LF8Q 2PMZB 2GVAA 1XXGA 1L1OB 4OXPA 3V2TA 2NB0A 1EIFA 5AJ3Q 4JI4L 3K7UC 3TZUA 2WB1G 1HZCA 1ICWA 1YNJD 1FYCA 5ELFA 1HNZL 1T9HA 5D3DA 4UDUC 4J15A 4U68A 5M5WB 4RGNA 5DM73 3P1HA 5IYCH 1CM9A 3VDYA 1VQIA 4YWKA 3TBIB 3FPPA 2Y0SB 4RGTA 4DV3Q 1QUQB 1J5EL 2F0OA 1EWHA 3NBHB 1F77A 1PV4A 2AUKA 3GTOB 4GN3B 3S1RH 1P8LA 2JA5G 1X3EA 4O1NA 4IOCA 4X66L 1OO9B 1RDPD 4DK0A 1IBLQ 2AQ2B 1X3PA 4APVA 1EY8A 2EYHA 3CQZH 3CCRA 2PI2E 1A2UA 3QIAA 3VYSA 5K36H 1SBBB 3E9IA 4ODGA 4JW0A 2QW7A 4K5XA 5JPNC 3EIVA 1DD2A 5CMDA 2K5HA 1DONA 3HOXG 5J39A 4WJ3M 2E8GA 1EY9A 1WI5A 1MI2A 3L2PA 3M4OH 3PQIA 2D0PA 4XYQA 5IYDG 1PZJD 3A8IE 3HRZC 1LTBD 3BZKA 3RZDH 2R92G 4YCUA 2Z6KC 1HR0W 2N8NA 3J81E 3K6OA 1II3A 1HFNA 1C9OA 5I6YA 2IWHA 1SJED 3DXJC 1KLUD 2I0QA 2RKSA 5C44H 1G6ZA 4IJLA 4OEMB 1CZGA 1B9NA 1VQ6A 4A3FG 3NWSA 2L11A 4IPCA 4WRDA 2XN9C 2E2IH 1LTGD 4ZAIA 3HOUH 2QILA 3T1HL 4RHRA 3W2DA 1Q3LA 1TWFH 2K5DA 2EXZA 5T1IA 4LWCA 3JAMc 1FJGQ 1ESFA 2EVBA 2WKDA 5C4XG 1PTOH 1LT4D 4BBRH 5M5XH 5F2DA 2WV6D 3PF4A 4C3JH 5D14A 3I73A 1GUOA 1O7LA 3CMAA 1WFQA 2VW9A 1HR0L 1ET6A 2RVLA 3AQQA 3AYHB 3K81C 3AMUA 2R93B 3BDLA 3RR5A 1GUGA 2CFMA 3B6YA 3UI2A 1IYJB 3J7AV 1FVIA 5L37A 3CC7A 3OTOL 3DLLA 1XNQL 4PZ8A 3I55A 3F8TA 4RA8A 3MXGA 1GXDC 4JBKA 1A3TA 4A3BG 1SNMA 3E3XA 4DR6L 2EPBA 1GUSA 3PUYA 5JEAH 1K0SA 1DOKA 1SJHD 2HUGA 1V43A 4BY1H 4P2CB 3KLSX 5C5LA 1WD0A 1O78A 4BY7G 1AFPA 3S1MB 3H15A 4DV0Q 4I7ZC 2ZJPA 1SEBD 3A5ZB 4QCLA 3PIPA 4A3DB 1SDFA 3HEJA 2RA4A 4UY8C 4ZKBB 1VQGA 2B2TC 4DKAC 1NMGA 2AHOB 4K2LA 3KK7A 5DEHA 4DAMA 1AW7A 1CHPD 5J3BA 1B70B 3M4PA 5C4XH 2KA7A 4X64Q 4C2MH 1JOOA 1S5FD 3JC66 1VQ4A 3TMEA 1B3QA 4CDCC 5C4JH 3CU7A 1D6EC 3OOCA 4C3IB 4EQOA 2OEOA 1B2TA 2YYZA 2RSOA 4DV0L 1LTLA 2F0DA 1HJPA 1NSNS 5EPKA 1KDCA 2QDLA 3KF6B 4O2DA 1GUWA 1HUMA 3I4NH 1K83B 2B2VA 3TQYA 1V1PB 3LWEA 4LW1A 2A69C 3NP8A 2JA7G 4X3SA 5M5WH 3TP6A 2WAQB 3HOYB 4A4IA 4JPBW 1CFMA 3H91A 1EWIA 1W2BA 1W6KA 3E9HA 4IPDA 5EGTA 5FK9C 2LY7A 5EQ0A 1HZAA 4DR2Q 1Y69U 5GAEC 1PH9A 4GKKL 1STYA 1PMRA 4JYAL 4QIWE 5IYBH 3R2TA 3A54A 5E4XA 3TDQA 5AFWA 3S1NB 4YIJA 4KY5A 4JYAQ 2VUMB 2Q2TA 3D0FA 5EKLA 2MUYA 1BBXC 1T5EA 4MIUA 3PO2G 4IPGA 3W5OA 2B8GA 4UAIA 2EDGA 4X3UA 1LT5D 1VF7A 1TIID 2PQAB 5FJ8H 3GO5A 1KL9A 4DR1L 3QOLA 1E2VA 2MHVA 2L9HA 4KD4A 2R92B 1XMOL 2IX1A 1L0YB 1GUTA 2HDMA 2BE5C 2CHBD 3DMUA 3HKSA 1VQMA 2A69D 1JQYD 2V1CC 5GAHC 4LUOA 5ELEA 4AYBB 4JBJA 2L5TA 3ULPA 3FEWX 3I4NG 3SK6A 2E5LL 3T13A 2B3GA 3KJPA 1V9PA 4CKBA 3QB3A 2KCMA 3ERSX 5CV9A 2PPBC 5DAUA 2UUBQ 3MA2B 4QUCA 2CWPA 2MNAA 3S1MH 2FMMA 3T1YL 1PH8A 2UUCL 1TY2A 2E2HH
chains in the Genus database with same CATH topology
3HOWG 2XTIA 1VQJA 3UE0A 1VQKA 4L5RC 1Q7YC 5LMNL 4KHPQ 5C0XJ 2UUBL 1XNRQ 2K5NA 2UUAQ 3STBC 4RMFA 1LYLA 3L7ZC 3HOUG 1UEBA 5LMNW 1Q8KA 2NVTH 2LSSA 1W3SA 5JJLA 5FLMH 4OO1G 1I94Q 1I50H 4K0KL 2JA7H 2Z6KA 2R93G 1S3OA 4YWMA 2XGTA 4LFCQ 2KHIA 4AQYQ 4B3RQ 4B3TQ 4B3SQ 4A3GG 4DR5Q 4DV5Q 2D62A 5C44G 5HY6A 4OX9Q 1QVFA 2MFIA 1XTDA 1S40A 2RHQB 1A0IA 3G71A 1NJIC 1VQLA 3KDFA 5M3FG 4BA2I 4A3FH 3PV0A 3CCJA 4HIDA 5C0XI 1IBLL 1KRTA 1L0WA 3Q8DA 1QZGA 2VQFQ 1PH7A 1IBML 3AFPA 4GLAC 2BH8A 2N78A 1XMQL 5ELNA 2KHJA 3F2DA 1NTGA 3W1BA 4DUYL 3GTPH 2JEBI 1NY4A 1UWVA 3E0EA 1JJCB 1NBWA 1LM0A 1Z9FA 4JBWA 4IO9A 4LFAQ 5IT9c 4JI1L 1KC8C 4LF4L 1XNQQ 1Q1EA 1GM5A 2F4VL 2AMCB 4LF7Q 4LF6Q 4P73A 3K80C 4A3LG 3CPFA 4DUZL 1WYDA 5JJKA 4UP8A 4GLXA 3K0XA 4R4TA 2DUDA 1QZHA 1PH6A 4OWWB 1E7ZA 1OXUA 3PSIA 1GO3E 3ULJA 2K14A 3U58A 2R7ZH 1IXRA 1HNXQ 3H3VH 4LF7L 4L5QA 1Q12A 1EFWA 1SLJA 4JI3Q 2UU9L 3KYHC 4DR2L 1Q46A 4XIGS 2UXBL 4GOPC 1OXSC 2Z0SA 1PH4A 4ME3A 3CW2C 1L1OC 1XPUA 3TREA 1KRSA 2ZTEA 1GVPA 4KI0A 3G6EA 1MJEA 5DLQE 2VZAA 5IP9H 4HIOA 4NXML 1EQRA 4JI2Q 1X3GA 1D8LA 1OXTA 3RN2A 2ES2A 2JA6H 1D7QA 1RIPA 1KAWA 3IRBA 3RLOA 3PO2H 1N8RC 3PUZA 4B3ML 2KCTA 1JE5A 1CUKA 1N36Q 4QJFA 1JB7A 2MO0A 1TWGH 4AYBG 2K52A 3KOJA 2ZM6L 4DR1Q 1R9TH 4JV5L 2R93H 4YCVA 2JEAI 3GDEA 3PCOB 4QY7A 3CXCA 2I5LX 3W1GA 4DK3C 1YNXA 3ZJYC 1Q86C 4AQYL 1SE8A 3J80i 1PA6A 4B3TL 3S1QH 4BBSH 3F1ZA 4GN5A 1M1KC 4JBMA 1A63A 4OWXB 2UXCL 1ASZA 3HFZB 2NN6G 4JI5L 1HZBA 1I5FA 1TWHH 1PHJA 1HNWQ 1TXYA 2VY3A 4IJHA 3NEMA 4R4IA 1J5EQ 4HJ9A 4JI6L 3KJOA 1K3RA 1SROA 2K5VA 1UE7A 2PI2A 4FDBA 2CWAA 5LMUL 2VQEL 2HHHL 1Y1WG 4LF5Q 1B7YB 3BU2A 4DV2L 2KENA 4YHHL 4AYBE 2YTXA 2K50A 3GTOH 4QGUA 3CCSA 1KQSA 4LFAL 1EQQA 2VQEQ 4QL5A 5FLMG 1N34L 1HH2P 4A3CG 4BA1I 1KXLA 3I56A 4XTCS 2JA5H 4A93H 4IPHA 1Z47A 3EN2A 5IP7G 4JI8Q 3U4ZA 3HOYH 4PZ6A 1AH9A 3I2ZA 2RHSB 1L1OA 4P74A 1K83H 4DV7Q 2IHFA 4X65L 2VQFL 2WP8J 2E5LQ 4DR4L 4IOAA 1I6HH 3HOZG 1VQEA 3G4SA 2VL6A 1U5KA 1K73C 1E1TA 1CKNA 1VCIA 1X6OA 3UE1A 2WAQE 1N9WA 1SMXA 5K36G 2R7ZG 3S24A 3NENA 4NB3A 4P75A 1KD1C 1YHBA 5M3MH 4AH6A 1MIUA 1UE6A 1FL0A 3GTMH 2JK8A 3FKIH 5GAGC 4O0AA 2VS1A 1SFOH 4B3SL 2JA6G 3TS2A 4Y7NH 1CKMA 5IP7H 4DV6Q 3D31A 3S2DH 3K7AH 2OTJA 1YI2A 3M9BA 1X65A 4LF8Q 2R6GA 1I94L 2EXDA 2EIFA 1CSPA 5C3EG 4JI2L 3GD7A 2GVAA 4P71A 4MNOA 3AEVA 1L1OB 4OXPA 1UE1A 4UP9A 4BY1G 5AJ3Q 1EIFA 2UUAL 5IYCG 4JI4L 3K7UC 4R4QA 2WB1G 1HZCA 1IZ6A 1CSQA 1HNZL 4GN4B 1T9HA 4X6AH 1I3QH 2PQAA 2N49A 5GROA 4J15A 1VQFA 4JI3L 3UDGA 2R92G 1HNXL 3MEFA 4DPGA 5IYCH 4GOPA 3VDYA 3KF6A 4JC0A 1VQIA 2K75A 1V1QA 4YWKA 4WJ4A 4YCWA 3I7FA 3BZCA 4LUVA 4DV3Q 3CP0A 1QUQB 4JI6Q 2Q2IA 1J5EL 1A8VA 3S1NH 3J7A5 1HR0Q 2A8VA 4LF4Q 1VQ5A 1AE3A 3NBHB 1YHAA 4DNIA 3I4OA 1WJJA 1JT8A 2Y0SE 1YITA 3KLWA 1XMQQ 1PV4A 5IWAL 4A75A 4HIKA 1PVOA 1N32L 4GN3B 3S1RH 3GTJH 1P8LA 2JA5G 4A3EG 1X3EA 2VNUD 2NVQH 5IYBG 2ALYB 4LF8L 4GKJQ 4A3MG 4IOCA 1VQDA 4X66L 1VQAA 2R92H 1O7IA 4EQ5A 2CQOA 4JG2A 4DV6L 1IBLQ 1WOCA 3CCMA 5ELOA 4LNQA 4APVA 3CCRA 3CQZH 3S16H 4A3DH 1G291 5C3EH 2BA0A 2PI2E 4HIMA 4B3MQ 1QUQA 4GKJL 3CCQA 5E7NA 3CCUA 4DR7Q 4OX9L 4A3GH 2GN5A 4DR5L 4NXMQ 3E9IA 4DK6C 1EIYB 3PUWA 4R4CA 3BJUA 1YHQA 2AKWB 3UDIA 1WCMG 3UDXA 3EIVA 5FJ8G 3AFQA 2QA4A 2K5HA 4A3JH 3HOXG 4DR3Q 4YY3L 4L5SA 4A93G 5C0XG 1GKHA 1G6PA 2IT1A 4OO1I 4WJ3M 4BBSG 1FGUA 4GNXA 4IFDG 2E8GA 4IFDJ 1VQ7A 1WI5A 3CF5A 1N34Q 5IE8A 3L2PA 1QVGA 2LXJA 1XPOA 3M4OH 2D0PA 5IYDG 2VUMG 2GVBA 4UP7A 4TVAB 4HJ8A 3BZKA 3RZDH 4JI1Q 2UUCQ 2Q2HA 1OXXK 2MO1A 3RLNA 3G48A 4YCUA 2Z6KC 3T1YQ 1HNZQ 4JOIC 1HR0W 3S2HH 2JA8G 2E2JH 2AWOA 2N8NA 3HOVG 5IP9G 2JE6I 1C9OA 3NELA 4DV4Q 2OQKA 4JI5Q 2I0QA 5M5YH 1FJGL 2I5MX 5C44H 4IJLA 2UXCQ 1E24A 3T1HQ 1K8AC 1VS0A 1E1OA 2OQ0A 1VQNA 1VQ6A 4A3FG 2HQLA 3CMEA 4IPCA 4C3HH 2B29A 1M90C 1E3PA 4LFBL 1C7YA 4KLKA 4LFBQ 4HJ5A 2E2IH 2C35B 4DV5L 1X56A 4B3RL 4GS3A 3RLFA 4POFA 3HOUH 1N36L 4PG3A 3H0GH 4AIMA 3HOXH 2JJQA 4X66Q 3T1HL 1VQPA 4JI0Q 5M3MG 1TWFH 4DV7L 1PYBA 4LWCA 3JAMc 3J80c 3CPWA 4K0KQ 1FJGQ 3GTKH 1MKHA 4DR6Q 3CD6A 3CAMA 5C4XG 2R7FA 1PFSA 4BBRH 3EBEA 1Y1WH 5M5XH 1RL2A 4DV1L 3PF4A 5LMNQ 4C3JH 3MXNB 1X55A 1XPRA 2H5XA 4KHZA 3CMAA 1WFQA 4YHHQ 2VW9A 3HOWH 1YVCA 1HR0L 3ULLA 1VQ8A 3AQQA 2YV5A 3AYHB 4A3EH 3K81C 4DV3L 3A5UA 5LMUQ 3RR5A 3B6YA 2CFMA 1IYJB 1EOVA 1FVIA 1IL2A 3CC7A 1QVCA 3OTOL 1SRUA 3DLLA 1X9NA 4A3DG 1XNQL 4PZ8A 3I55A 3I4MH 1BBUA 1KHIA 2ZTCA 3F8TA 4DR3L 3PUXA 1PH2A 2NZHA 3GTGH 3HOZH 4JBKA 5JEAG 2JQOA 3TS0A 1YEZA 5BR8Q 3H0GG 4DV1Q 4A3BG 4QQBX 1N32Q 4OONA 4DUYQ 2ASBA 1LUZA 3KDFB 4DR6L 3ICEA 2IX0A 1G51A 3PUYA 3KF8B 4DR7L 1IBMQ 2RCNA 3J81j 3S15H 4NXNL 1TWCH 1Y1VG 2ZM6Q 4JI0L 2UXDL 1VQ9A 1XMOQ 1UE5A 1K8GA 1YJWA 3A74A 3HOVH 2FXQA 3I4MG 1V43A 2HIXA 1NE3A 2UXDQ 2K4KA 5JEAJ 4NXNQ 1BKBA 3M7NA 4BY1H 4A3JG 1DGSA 1GD7A 4DAYB 1CKNB 5JJIA 3CC2A 4BY7G 4A76A 5GADC 3H15A 4A3IG 4DV0Q 4UPAA 5BR8L 1TWAH 3TEHB 3A5ZB 2ZJPA 3PIPA 1KIXA 3OYYA 2NZOA 4UY8C 4A3LH 1SR3A 1VQGA 1Q81C 4DKAC 1NMGA 1JJGA 2AHOB 4MTNA 2NVYH 1PYSB 2AWNA 1XNRL 2I5HA 4GOPB 1WCMH 4DAMA 5J3BA 5C4XH 1B70B 3M4PA 1IBKL 2NVXH 1YJ9A 2ZJQA 1BVSA 4X64Q 2B63G 1EUJA 1YBYA 1L2FA 1HZ9A 1YZ6A 4DUZQ 3U4VA 2MQHA 1JJ2A 4C2MH 4GLVB 3PUVA 3HKZG 3JC66 1VQ4A 4R4OA 3FHWA 1OTCA 2QGQA 4GNXC 2HHHQ 2EQSA 4X64L 5C4JH 3J7ZC 2B63H 4EX5A 1IBKQ 1VQBA 4JCVE 2DGYA 2WFWA 4H02A 3RNUA 1VQCA 1HNWL 2RF4A 1AE2A 5EAYA 4OWTB 3KFUA 1K0RA 1XJVA 4A3CH 1J6QA 2YYZA 2YTVA 3PGZA 2N3SA 4DV0L 3ER0A 1PH1A 4IFDI 3RZOH 1YJNA 2A19A 4JI7L 5IYDH 1LTLA 1VQHA 2YTYA 3PO3H 2BA1A 4ALPA 1HJPA 1C0AA 4LF9L 2OTLA 2CCZA 2JA8H 3JAMi 3KF6B 3FP9A 4O2DA 3K8AA 4A3KG 2QEXA 4A3IH 3I4NH 1H95A 4RG1A 4LUZA 3TQYA 3PO3G 4TQUS 4A3BH 4MZ9A 4LW1A 2Q2UA 2VUMH 1A62A 1CKOA 2JA7G 3OW2A 1YIJA 2KBNA 5HGQA 3STBD 5M5WH 4BXXG 1BBWA 2A1AA 4JI8L 1X54A 5IWAQ 4DV4L 1EYGA 4L5TA 4A4IA 5IY0A 1Q82C 4X62Q 2LXKA 1EWIA 3U50C 1W2BA 1Y14B 3E9HA 4IPDA 2ATWA 4KHPL 2L15A 3CCEA 5FLXc 2IHEA 1HZAA 3S17H 2UXBQ 4DR2Q 2UU9Q 5GAEC 1PH9A 1P16A 2CKZB 4NPSA 4POGA 2OCEA 1SN8A 2R7DA 5M3FH 3J81c 2HIVA 4DV2Q 4HJAA 2OWOA 4R1JA 4GKKL 4JYAL 4LF5L 4QIWE 1U0LA 3WWVA 3DM3A 2JA9A 2NN6I 5IYBH 1S72A 2PMZE 4BXXH 4JOIA 3M85A 1VQOA 1ASYA 4JYAQ 2Q2TA 3M3YH 3PIOA 3CCVA 3SGIA 3D0FA 1OXVA 4GNXB 4YY3Q 3GTQH 2HT1A 3S14H 3GTLH 3PO2G 4IPGA 3W5OA 4A3MH 2YU9H 4X62L 3PF5A 2BH2A 5AJ3L 4JI4Q 3RN5A 3CC4A 4LF9Q 3F2CA 3FKIG 1N33Q 1K9MC 5GQOA 2PQAB 5FJ8H 3GO5A 1KL9A 2WAQG 3HOYG 4PZ7A 4DR1L 2PNHA 4JV5Q 2ZTDA 3LGJA 3A0JA 1PH3A 4C3IH 1XMOL 2IX1A 1MJCA 3HKZE 4P72A 1PH5A 1Y1VH 3HKSA 1VQMA 2WB1E 2V1CC 5GAHC 3M4QA 1N33L 4LUOA 4LFCL 4JBJA 2ID0A 3UDFA 3ULPA 4JI7Q 4A3KH 4YWLA 2D0OA 1Q1BA 1X3FA 3I4NG 4DR4Q 5H1SE 4X65Q 2E5LL 4PMWA 2B3GA 3KJPA 1V9PA 3CCLA 2IY5B 3TRZA 2KCMA 3ERSX 3J81i 3OTOQ 1NMFA 4BY7H 2F52A 3F2BA 2UUBQ 4HJ7A 2CWPA 1B8AA 4Y52H 2MNAA 2ZJRA 3S1MH 2Y0SG 4BBRG 3H3VI 3T1YL 1PH8A 2UUCL 2F3IA 4LF6L 3L0OA 4GKKQ 2F4VQ 1E22A 1JMCA 2E2HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW G;  2XTI A;  1VQJ A;  3UE0 A;  1VQK A;  4L5R C;  1Q7Y C;  5LMN L;  4KHP Q;  5C0X J;  2UUB L;  1XNR Q;  2K5N A;  2UUA Q;  3STB C;  4RMF A;  1LYL A;  3L7Z C;  3HOU G;  1UEB A;  5LMN W;  1Q8K A;  2NVT H;  2LSS A;  1W3S A;  5JJL A;  5FLM H;  4OO1 G;  1I94 Q;  1I50 H;  4K0K L;  2JA7 H;  2Z6K A;  2R93 G;  1S3O A;  4YWM A;  2XGT A;  4LFC Q;  2KHI A;  4AQY Q;  4B3R Q;  4B3T Q;  4B3S Q;  4A3G G;  4DR5 Q;  4DV5 Q;  2D62 A;  5C44 G;  5HY6 A;  4OX9 Q;  1QVF A;  2MFI A;  1XTD A;  1S40 A;  2RHQ B;  1A0I A;  3G71 A;  1NJI C;  1VQL A;  3KDF A;  5M3F G;  4BA2 I;  4A3F H;  3PV0 A;  3CCJ A;  4HID A;  5C0X I;  1IBL L;  1KRT A;  1L0W A;  3Q8D A;  1QZG A;  2VQF Q;  1PH7 A;  1IBM L;  3AFP A;  4GLA C;  2BH8 A;  2N78 A;  1XMQ L;  5ELN A;  2KHJ A;  3F2D A;  1NTG A;  3W1B A;  4DUY L;  3GTP H;  2JEB I;  1NY4 A;  1UWV A;  3E0E A;  1JJC B;  1NBW A;  1LM0 A;  1Z9F A;  4JBW A;  4IO9 A;  4LFA Q;  5IT9 c;  4JI1 L;  1KC8 C;  4LF4 L;  1XNQ Q;  1Q1E A;  1GM5 A;  2F4V L;  2AMC B;  4LF7 Q;  4LF6 Q;  4P73 A;  3K80 C;  4A3L G;  3CPF A;  4DUZ L;  1WYD A;  5JJK A;  4UP8 A;  4GLX A;  3K0X A;  4R4T A;  2DUD A;  1QZH A;  1PH6 A;  4OWW B;  1E7Z A;  1OXU A;  3PSI A;  1GO3 E;  3ULJ A;  2K14 A;  3U58 A;  2R7Z H;  1IXR A;  1HNX Q;  3H3V H;  4LF7 L;  4L5Q A;  1Q12 A;  1EFW A;  1SLJ A;  4JI3 Q;  2UU9 L;  3KYH C;  4DR2 L;  1Q46 A;  4XIG S;  2UXB L;  4GOP C;  1OXS C;  2Z0S A;  1PH4 A;  4ME3 A;  3CW2 C;  1L1O C;  1XPU A;  3TRE A;  1KRS A;  2ZTE A;  1GVP A;  4KI0 A;  3G6E A;  1MJE A;  5DLQ E;  2VZA A;  5IP9 H;  4HIO A;  4NXM L;  1EQR A;  4JI2 Q;  1X3G A;  1D8L A;  1OXT A;  3RN2 A;  2ES2 A;  2JA6 H;  1D7Q A;  1RIP A;  1KAW A;  3IRB A;  3RLO A;  3PO2 H;  1N8R C;  3PUZ A;  4B3M L;  2KCT A;  1JE5 A;  1CUK A;  1N36 Q;  4QJF A;  1JB7 A;  2MO0 A;  1TWG H;  4AYB G;  2K52 A;  3KOJ A;  2ZM6 L;  4DR1 Q;  1R9T H;  4JV5 L;  2R93 H;  4YCV A;  2JEA I;  3GDE A;  3PCO B;  4QY7 A;  3CXC A;  2I5L X;  3W1G A;  4DK3 C;  1YNX A;  3ZJY C;  1Q86 C;  4AQY L;  1SE8 A;  3J80 i;  1PA6 A;  4B3T L;  3S1Q H;  4BBS H;  3F1Z A;  4GN5 A;  1M1K C;  4JBM A;  1A63 A;  4OWX B;  2UXC L;  1ASZ A;  3HFZ B;  2NN6 G;  4JI5 L;  1HZB A;  1I5F A;  1TWH H;  1PHJ A;  1HNW Q;  1TXY A;  2VY3 A;  4IJH A;  3NEM A;  4R4I A;  1J5E Q;  4HJ9 A;  4JI6 L;  3KJO A;  1K3R A;  1SRO A;  2K5V A;  1UE7 A;  2PI2 A;  4FDB A;  2CWA A;  5LMU L;  2VQE L;  2HHH L;  1Y1W G;  4LF5 Q;  1B7Y B;  3BU2 A;  4DV2 L;  2KEN A;  4YHH L;  4AYB E;  2YTX A;  2K50 A;  3GTO H;  4QGU A;  3CCS A;  1KQS A;  4LFA L;  1EQQ A;  2VQE Q;  4QL5 A;  5FLM G;  1N34 L;  1HH2 P;  4A3C G;  4BA1 I;  1KXL A;  3I56 A;  4XTC S;  2JA5 H;  4A93 H;  4IPH A;  1Z47 A;  3EN2 A;  5IP7 G;  4JI8 Q;  3U4Z A;  3HOY H;  4PZ6 A;  1AH9 A;  3I2Z A;  2RHS B;  1L1O A;  4P74 A;  1K83 H;  4DV7 Q;  2IHF A;  4X65 L;  2VQF L;  2WP8 J;  2E5L Q;  4DR4 L;  4IOA A;  1I6H H;  3HOZ G;  1VQE A;  3G4S A;  2VL6 A;  1U5K A;  1K73 C;  1E1T A;  1CKN A;  1VCI A;  1X6O A;  3UE1 A;  2WAQ E;  1N9W A;  1SMX A;  5K36 G;  2R7Z G;  3S24 A;  3NEN A;  4NB3 A;  4P75 A;  1KD1 C;  1YHB A;  5M3M H;  4AH6 A;  1MIU A;  1UE6 A;  1FL0 A;  3GTM H;  2JK8 A;  3FKI H;  5GAG C;  4O0A A;  2VS1 A;  1SFO H;  4B3S L;  2JA6 G;  3TS2 A;  4Y7N H;  1CKM A;  5IP7 H;  4DV6 Q;  3D31 A;  3S2D H;  3K7A H;  2OTJ A;  1YI2 A;  3M9B A;  1X65 A;  4LF8 Q;  2R6G A;  1I94 L;  2EXD A;  2EIF A;  1CSP A;  5C3E G;  4JI2 L;  3GD7 A;  2GVA A;  4P71 A;  4MNO A;  3AEV A;  1L1O B;  4OXP A;  1UE1 A;  4UP9 A;  4BY1 G;  5AJ3 Q;  1EIF A;  2UUA L;  5IYC G;  4JI4 L;  3K7U C;  4R4Q A;  2WB1 G;  1HZC A;  1IZ6 A;  1CSQ A;  1HNZ L;  4GN4 B;  1T9H A;  4X6A H;  1I3Q H;  2PQA A;  2N49 A;  5GRO A;  4J15 A;  1VQF A;  4JI3 L;  3UDG A;  2R92 G;  1HNX L;  3MEF A;  4DPG A;  5IYC H;  4GOP A;  3VDY A;  3KF6 A;  4JC0 A;  1VQI A;  2K75 A;  1V1Q A;  4YWK A;  4WJ4 A;  4YCW A;  3I7F A;  3BZC A;  4LUV A;  4DV3 Q;  3CP0 A;  1QUQ B;  4JI6 Q;  2Q2I A;  1J5E L;  1A8V A;  3S1N H;  3J7A 5;  1HR0 Q;  2A8V A;  4LF4 Q;  1VQ5 A;  1AE3 A;  3NBH B;  1YHA A;  4DNI A;  3I4O A;  1WJJ A;  1JT8 A;  2Y0S E;  1YIT A;  3KLW A;  1XMQ Q;  1PV4 A;  5IWA L;  4A75 A;  4HIK A;  1PVO A;  1N32 L;  4GN3 B;  3S1R H;  3GTJ H;  1P8L A;  2JA5 G;  4A3E G;  1X3E A;  2VNU D;  2NVQ H;  5IYB G;  2ALY B;  4LF8 L;  4GKJ Q;  4A3M G;  4IOC A;  1VQD A;  4X66 L;  1VQA A;  2R92 H;  1O7I A;  4EQ5 A;  2CQO A;  4JG2 A;  4DV6 L;  1IBL Q;  1WOC A;  3CCM A;  5ELO A;  4LNQ A;  4APV A;  3CCR A;  3CQZ H;  3S16 H;  4A3D H;  1G29 1;  5C3E H;  2BA0 A;  2PI2 E;  4HIM A;  4B3M Q;  1QUQ A;  4GKJ L;  3CCQ A;  5E7N A;  3CCU A;  4DR7 Q;  4OX9 L;  4A3G H;  2GN5 A;  4DR5 L;  4NXM Q;  3E9I A;  4DK6 C;  1EIY B;  3PUW A;  4R4C A;  3BJU A;  1YHQ A;  2AKW B;  3UDI A;  1WCM G;  3UDX A;  3EIV A;  5FJ8 G;  3AFQ A;  2QA4 A;  2K5H A;  4A3J H;  3HOX G;  4DR3 Q;  4YY3 L;  4L5S A;  4A93 G;  5C0X G;  1GKH A;  1G6P A;  2IT1 A;  4OO1 I;  4WJ3 M;  4BBS G;  1FGU A;  4GNX A;  4IFD G;  2E8G A;  4IFD J;  1VQ7 A;  1WI5 A;  3CF5 A;  1N34 Q;  5IE8 A;  3L2P A;  1QVG A;  2LXJ A;  1XPO A;  3M4O H;  2D0P A;  5IYD G;  2VUM G;  2GVB A;  4UP7 A;  4TVA B;  4HJ8 A;  3BZK A;  3RZD H;  4JI1 Q;  2UUC Q;  2Q2H A;  1OXX K;  2MO1 A;  3RLN A;  3G48 A;  4YCU A;  2Z6K C;  3T1Y Q;  1HNZ Q;  4JOI C;  1HR0 W;  3S2H H;  2JA8 G;  2E2J H;  2AWO A;  2N8N A;  3HOV G;  5IP9 G;  2JE6 I;  1C9O A;  3NEL A;  4DV4 Q;  2OQK A;  4JI5 Q;  2I0Q A;  5M5Y H;  1FJG L;  2I5M X;  5C44 H;  4IJL A;  2UXC Q;  1E24 A;  3T1H Q;  1K8A C;  1VS0 A;  1E1O A;  2OQ0 A;  1VQN A;  1VQ6 A;  4A3F G;  2HQL A;  3CME A;  4IPC A;  4C3H H;  2B29 A;  1M90 C;  1E3P A;  4LFB L;  1C7Y A;  4KLK A;  4LFB Q;  4HJ5 A;  2E2I H;  2C35 B;  4DV5 L;  1X56 A;  4B3R L;  4GS3 A;  3RLF A;  4POF A;  3HOU H;  1N36 L;  4PG3 A;  3H0G H;  4AIM A;  3HOX H;  2JJQ A;  4X66 Q;  3T1H L;  1VQP A;  4JI0 Q;  5M3M G;  1TWF H;  4DV7 L;  1PYB A;  4LWC A;  3JAM c;  3J80 c;  3CPW A;  4K0K Q;  1FJG Q;  3GTK H;  1MKH A;  4DR6 Q;  3CD6 A;  3CAM A;  5C4X G;  2R7F A;  1PFS A;  4BBR H;  3EBE A;  1Y1W H;  5M5X H;  1RL2 A;  4DV1 L;  3PF4 A;  5LMN Q;  4C3J H;  3MXN B;  1X55 A;  1XPR A;  2H5X A;  4KHZ A;  3CMA A;  1WFQ A;  4YHH Q;  2VW9 A;  3HOW H;  1YVC A;  1HR0 L;  3ULL A;  1VQ8 A;  3AQQ A;  2YV5 A;  3AYH B;  4A3E H;  3K81 C;  4DV3 L;  3A5U A;  5LMU Q;  3RR5 A;  3B6Y A;  2CFM A;  1IYJ B;  1EOV A;  1FVI A;  1IL2 A;  3CC7 A;  1QVC A;  3OTO L;  1SRU A;  3DLL A;  1X9N A;  4A3D G;  1XNQ L;  4PZ8 A;  3I55 A;  3I4M H;  1BBU A;  1KHI A;  2ZTC A;  3F8T A;  4DR3 L;  3PUX A;  1PH2 A;  2NZH A;  3GTG H;  3HOZ H;  4JBK A;  5JEA G;  2JQO A;  3TS0 A;  1YEZ A;  5BR8 Q;  3H0G G;  4DV1 Q;  4A3B G;  4QQB X;  1N32 Q;  4OON A;  4DUY Q;  2ASB A;  1LUZ A;  3KDF B;  4DR6 L;  3ICE A;  2IX0 A;  1G51 A;  3PUY A;  3KF8 B;  4DR7 L;  1IBM Q;  2RCN A;  3J81 j;  3S15 H;  4NXN L;  1TWC H;  1Y1V G;  2ZM6 Q;  4JI0 L;  2UXD L;  1VQ9 A;  1XMO Q;  1UE5 A;  1K8G A;  1YJW A;  3A74 A;  3HOV H;  2FXQ A;  3I4M G;  1V43 A;  2HIX A;  1NE3 A;  2UXD Q;  2K4K A;  5JEA J;  4NXN Q;  1BKB A;  3M7N A;  4BY1 H;  4A3J G;  1DGS A;  1GD7 A;  4DAY B;  1CKN B;  5JJI A;  3CC2 A;  4BY7 G;  4A76 A;  5GAD C;  3H15 A;  4A3I G;  4DV0 Q;  4UPA A;  5BR8 L;  1TWA H;  3TEH B;  3A5Z B;  2ZJP A;  3PIP A;  1KIX A;  3OYY A;  2NZO A;  4UY8 C;  4A3L H;  1SR3 A;  1VQG A;  1Q81 C;  4DKA C;  1NMG A;  1JJG A;  2AHO B;  4MTN A;  2NVY H;  1PYS B;  2AWN A;  1XNR L;  2I5H A;  4GOP B;  1WCM H;  4DAM A;  5J3B A;  5C4X H;  1B70 B;  3M4P A;  1IBK L;  2NVX H;  1YJ9 A;  2ZJQ A;  1BVS A;  4X64 Q;  2B63 G;  1EUJ A;  1YBY A;  1L2F A;  1HZ9 A;  1YZ6 A;  4DUZ Q;  3U4V A;  2MQH A;  1JJ2 A;  4C2M H;  4GLV B;  3PUV A;  3HKZ G;  3JC6 6;  1VQ4 A;  4R4O A;  3FHW A;  1OTC A;  2QGQ A;  4GNX C;  2HHH Q;  2EQS A;  4X64 L;  5C4J H;  3J7Z C;  2B63 H;  4EX5 A;  1IBK Q;  1VQB A;  4JCV E;  2DGY A;  2WFW A;  4H02 A;  3RNU A;  1VQC A;  1HNW L;  2RF4 A;  1AE2 A;  5EAY A;  4OWT B;  3KFU A;  1K0R A;  1XJV A;  4A3C H;  1J6Q A;  2YYZ A;  2YTV A;  3PGZ A;  2N3S A;  4DV0 L;  3ER0 A;  1PH1 A;  4IFD I;  3RZO H;  1YJN A;  2A19 A;  4JI7 L;  5IYD H;  1LTL A;  1VQH A;  2YTY A;  3PO3 H;  2BA1 A;  4ALP A;  1HJP A;  1C0A A;  4LF9 L;  2OTL A;  2CCZ A;  2JA8 H;  3JAM i;  3KF6 B;  3FP9 A;  4O2D A;  3K8A A;  4A3K G;  2QEX A;  4A3I H;  3I4N H;  1H95 A;  4RG1 A;  4LUZ A;  3TQY A;  3PO3 G;  4TQU S;  4A3B H;  4MZ9 A;  4LW1 A;  2Q2U A;  2VUM H;  1A62 A;  1CKO A;  2JA7 G;  3OW2 A;  1YIJ A;  2KBN A;  5HGQ A;  3STB D;  5M5W H;  4BXX G;  1BBW A;  2A1A A;  4JI8 L;  1X54 A;  5IWA Q;  4DV4 L;  1EYG A;  4L5T A;  4A4I A;  5IY0 A;  1Q82 C;  4X62 Q;  2LXK A;  1EWI A;  3U50 C;  1W2B A;  1Y14 B;  3E9H A;  4IPD A;  2ATW A;  4KHP L;  2L15 A;  3CCE A;  5FLX c;  2IHE A;  1HZA A;  3S17 H;  2UXB Q;  4DR2 Q;  2UU9 Q;  5GAE C;  1PH9 A;  1P16 A;  2CKZ B;  4NPS A;  4POG A;  2OCE A;  1SN8 A;  2R7D A;  5M3F H;  3J81 c;  2HIV A;  4DV2 Q;  4HJA A;  2OWO A;  4R1J A;  4GKK L;  4JYA L;  4LF5 L;  4QIW E;  1U0L A;  3WWV A;  3DM3 A;  2JA9 A;  2NN6 I;  5IYB H;  1S72 A;  2PMZ E;  4BXX H;  4JOI A;  3M85 A;  1VQO A;  1ASY A;  4JYA Q;  2Q2T A;  3M3Y H;  3PIO A;  3CCV A;  3SGI A;  3D0F A;  1OXV A;  4GNX B;  4YY3 Q;  3GTQ H;  2HT1 A;  3S14 H;  3GTL H;  3PO2 G;  4IPG A;  3W5O A;  4A3M H;  2YU9 H;  4X62 L;  3PF5 A;  2BH2 A;  5AJ3 L;  4JI4 Q;  3RN5 A;  3CC4 A;  4LF9 Q;  3F2C A;  3FKI G;  1N33 Q;  1K9M C;  5GQO A;  2PQA B;  5FJ8 H;  3GO5 A;  1KL9 A;  2WAQ G;  3HOY G;  4PZ7 A;  4DR1 L;  2PNH A;  4JV5 Q;  2ZTD A;  3LGJ A;  3A0J A;  1PH3 A;  4C3I H;  1XMO L;  2IX1 A;  1MJC A;  3HKZ E;  4P72 A;  1PH5 A;  1Y1V H;  3HKS A;  1VQM A;  2WB1 E;  2V1C C;  5GAH C;  3M4Q A;  1N33 L;  4LUO A;  4LFC L;  4JBJ A;  2ID0 A;  3UDF A;  3ULP A;  4JI7 Q;  4A3K H;  4YWL A;  2D0O A;  1Q1B A;  1X3F A;  3I4N G;  4DR4 Q;  5H1S E;  4X65 Q;  2E5L L;  4PMW A;  2B3G A;  3KJP A;  1V9P A;  3CCL A;  2IY5 B;  3TRZ A;  2KCM A;  3ERS X;  3J81 i;  3OTO Q;  1NMF A;  4BY7 H;  2F52 A;  3F2B A;  2UUB Q;  4HJ7 A;  2CWP A;  1B8A A;  4Y52 H;  2MNA A;  2ZJR A;  3S1M H;  2Y0S G;  4BBR G;  3H3V I;  3T1Y L;  1PH8 A;  2UUC L;  2F3I A;  4LF6 L;  3L0O A;  4GKK Q;  2F4V Q;  1E22 A;  1JMC A;  2E2H H; 
#chains in the Genus database with same CATH topology
 4ZKC B;  1QCB D;  3KUP A;  4QF4 A;  1VQK A;  4L5R C;  4EQP A;  4DN4 M;  2UUA Q;  2ZXP A;  2O4X A;  3K57 A;  1CTM A;  3VYU A;  3NQT A;  1TWA B;  4J8Q A;  4OO1 G;  4K0K L;  3A55 A;  2F0K A;  1G2S A;  1C48 A;  1S3O A;  1JOK A;  2KHI A;  4OIJ A;  5KYI A;  1FD7 D;  4B3R Q;  4A3G G;  1E2Z A;  5C44 G;  5HY6 A;  1QVF A;  4K8J A;  5E4W C;  1R4Q B;  1SXT A;  5BN3 A;  3QJY A;  4A3F H;  3PV0 A;  4HSV A;  1IBL L;  3KF8 A;  1QZG A;  1S5D D;  4GLA C;  4BWG B;  1F9Q A;  5ELN A;  3F2D A;  3GTP H;  2JEB I;  4ZK9 B;  4C3H G;  5A2Q L;  1U9R A;  4DNR B;  3MZ5 A;  1JJC B;  4IUU A;  4JBW A;  1KC8 C;  1Q1E A;  3RMH A;  1GM5 A;  2F4V L;  4LF7 Q;  1H9M A;  4P73 A;  4A3L G;  5JJK A;  1XYI A;  4ZUJ A;  4GLX A;  1IYU A;  4R4T A;  2DUD A;  1ZXT A;  1QZH A;  2QF7 A;  3ULJ A;  2K14 A;  2ENB A;  3HKZ B;  1VDZ A;  3OMG A;  4XIG S;  1QJO A;  1PH4 A;  2F4I A;  4F88 A;  5M3M B;  1XPU A;  4N9T A;  5KRU A;  2PCF B;  4H44 C;  2E2D C;  4NXM L;  2GA4 B;  1UAP A;  1X3G A;  2ES2 A;  1H9S A;  4EQN A;  3RLO A;  1KAW A;  4DGZ A;  3PUZ A;  1JE5 A;  1LAC A;  2MO0 A;  3D8G A;  4AYB G;  2K52 A;  4DR1 Q;  3MXN A;  2HQE A;  3I90 A;  4QY7 A;  2Q8R E;  1EY7 A;  3W1G A;  1YNX A;  4C3I G;  4BBS H;  1SNP A;  1M1K C;  1D5Z C;  2D2C C;  1ASZ A;  4JI5 L;  5CV7 A;  4LMQ D;  1TWH H;  1NAP A;  2VY3 A;  5BN5 A;  4HJ9 A;  4RFB A;  1YNJ C;  3NHH A;  1Y8P B;  4FDB A;  4HMJ A;  5IOC A;  4CGY B;  2VQE L;  3EJI A;  3BU2 A;  1DZ1 A;  1ONL A;  2KEN A;  3VR4 A;  5CV8 A;  2K50 A;  2BE5 D;  4QGU A;  4LFA L;  3GTO H;  3OIQ A;  4A3C G;  1CK1 A;  1KXL A;  4XQN A;  2WKC A;  3SK8 A;  1J9O A;  4PZ6 A;  3I2Z A;  3I91 A;  1HRJ A;  4DV7 Q;  2E5L Q;  2WP8 J;  4V19 0;  1EYD A;  2XIW A;  3G4S A;  4WFN 3;  2X6G A;  1N9W A;  1SMX A;  1AP0 A;  1KD1 C;  5C0X H;  4R8N A;  1MIU A;  1FL0 A;  4WOR A;  4O0A A;  1SFO H;  3MFG A;  2E75 C;  1CKM A;  4RKB A;  3S2D H;  4CDD C;  3H09 A;  1F2Z A;  4KN7 C;  4XDX A;  4H0L C;  2NVQ B;  4IUR A;  2EXD A;  1BF4 A;  1CSP A;  4JI2 L;  3E0J A;  4L6T B;  4MNO A;  1UE1 A;  4M1U B;  1EOT A;  4UP9 A;  2UUA L;  4R4Q A;  2FIN B;  3ERQ A;  4TSS A;  2L55 A;  1E2W A;  3HZX A;  5GRO A;  1I4G A;  1VQF A;  2A6E C;  3A56 A;  4JI3 L;  3EA6 A;  4DPG A;  4JC0 A;  2K75 A;  4WJ4 A;  1LT3 D;  2R7Z B;  4LUV A;  5FO7 B;  3BDO A;  1WTX A;  2XWB B;  4JI6 Q;  5E3F A;  1IYV A;  3J7A 5;  2K5W A;  3K5M A;  1YHA A;  1VF5 C;  3I4O A;  1WJJ A;  3VR5 A;  2Y0S E;  2RCF A;  1YIT A;  4IUQ A;  2YU9 B;  4A75 A;  2XRS D;  1PVO A;  1I4P A;  2VNU D;  5IGB A;  4DA2 A;  3A7L A;  2ALY B;  3MEH A;  4LF8 L;  4GKJ Q;  1O7I A;  3OIP A;  4JG2 A;  3DUZ A;  4G4K A;  5ELO A;  1ENF A;  3SR1 A;  1G29 1;  2BA0 A;  1TR5 A;  4B3M Q;  3GP7 A;  4GKJ L;  1YNN C;  1NR4 A;  4DR5 L;  4DK6 C;  5ELC A;  1NR2 A;  3PUW A;  1EIY B;  1H9S B;  1B44 D;  3BJU A;  4OHJ A;  5EBC A;  3OMC A;  4ME5 A;  4XT1 B;  4DFA A;  1ZYR C;  1WCM G;  3UDX A;  3UDI A;  4A3J H;  1HXY D;  4FXD A;  4L5S A;  4A93 G;  1G6P A;  1FGU A;  4IFD G;  4IFD J;  1XTC D;  4LAA A;  1SNO A;  4IUT A;  1CA6 A;  5IE8 A;  4KD3 A;  1QVG A;  2LXJ A;  1F9P A;  2A68 D;  2GVB A;  2JN4 A;  5KNC A;  2Z6B A;  4HJ8 A;  3NTH A;  2Q2H A;  2UUC Q;  2QCP X;  1C8C A;  3G48 A;  3T1Y Q;  4JOI C;  3S2H H;  2AWO A;  3HOV G;  5IP9 G;  1CZW A;  1A3V A;  1ICF B;  5CV5 A;  4DV4 Q;  3VR6 A;  5FO9 B;  4HMI A;  1FJG L;  1JC7 A;  5COY A;  2XWJ B;  2UXC Q;  1I4H A;  3T1H Q;  3S15 B;  1VQN A;  3S1R B;  3CME A;  1EY4 A;  1E3P A;  5FLX L;  4HTH A;  2K05 A;  4GS3 A;  1S4Z A;  4ID6 A;  5M3M G;  1PYB A;  1LTS D;  1TS5 A;  2B39 A;  3J80 c;  3HS0 C;  2A6E D;  4A93 B;  3CD6 A;  1JWS D;  4IAL A;  2KHS A;  5BN4 A;  1Y1W H;  4DV1 L;  1RL2 A;  3Q24 A;  3V96 A;  3I70 A;  2Z9H A;  4FXG C;  1I3Q B;  1X55 A;  5ISR A;  4KHZ A;  3S2H B;  2BDN A;  5HGT A;  1WTP A;  2X69 A;  1YVC A;  4V0B A;  5FO8 B;  3ULL A;  1VQ8 A;  3CHB D;  2PZU A;  4A3E H;  4RGO S;  5CBE E;  3A5U A;  2EY5 A;  3HOV B;  3T56 B;  1EYA A;  1IL2 A;  1NCV A;  1QVC A;  3RD4 A;  1X9N A;  4A3D G;  1BBU A;  3HOZ H;  1ENA A;  3GTG H;  2NZH A;  3N52 A;  2G9D A;  4DV1 Q;  1N32 Q;  4OON A;  1STA A;  1LUZ A;  3KDF B;  2F3V A;  2X6L A;  5IGG A;  2IX0 A;  5DM6 3;  3KF8 B;  5IGD A;  1TU2 B;  2RCN A;  2ZM6 Q;  1VQ9 A;  4HAE A;  1PTO C;  1SYD A;  2HIX A;  1NE3 A;  2UXD Q;  5JEA J;  4OIK A;  1ZKO A;  1SFO B;  1NNX A;  3QWN A;  4DXF A;  1GD7 A;  4DAY B;  3PO3 B;  5C6A A;  5GAD C;  2ZT9 C;  2JP1 A;  4UPA A;  5BR8 L;  1TWA H;  1KIX A;  1LT6 D;  2NZO A;  1Q81 C;  2CQA A;  1JJG A;  1DJR D;  4H13 C;  4NDX A;  4K14 A;  1DM0 B;  1TVX A;  2B63 G;  1CQF A;  2NVX H;  1BVS A;  1YZ6 A;  4MTK A;  1JJ2 A;  2F0N A;  2DJF C;  4X64 L;  2KJX A;  2A6H D;  1EFI D;  2DGY A;  3S14 B;  3NPP A;  1VQC A;  3N6R A;  1HNW L;  2RF4 A;  4JK1 C;  4A3J B;  5EAY A;  4OWT B;  4WJW A;  1HA5 A;  3KFU A;  1K0R A;  1G2T A;  4A3C H;  1J6Q A;  2YTV A;  1ENC A;  2F0U A;  4JI7 L;  5JJZ A;  1QWY A;  1VQH A;  1SYE A;  2RBM A;  1C0A A;  5J22 A;  2JA5 B;  2JA8 H;  3T51 B;  3IKJ A;  1H95 A;  5E1F A;  2K28 A;  4O42 A;  1XX8 A;  4CKE A;  3PO3 G;  5M9O A;  2FMC A;  4A3B H;  5COR A;  2XSC A;  2FHT A;  1A62 A;  1GUN A;  1Q8I A;  2EYJ A;  1YIJ A;  2KBN A;  4UHV A;  5HGQ A;  2IX3 A;  1BBW A;  4JI8 L;  1X54 A;  1JWU D;  2F0F A;  3GTM B;  2E74 C;  4L5T A;  1Q82 C;  4X62 Q;  3U50 C;  1Y14 B;  4KN4 C;  3FVQ A;  3CCE A;  1PRT F;  2E2H B;  5FLX c;  2IHE A;  3S17 H;  2F0M A;  1LV9 A;  2OCE A;  4B9X A;  1ML0 D;  4DV2 Q;  2OWO A;  3U9S A;  1U0L A;  4I65 A;  1WTH A;  3WWV A;  1JE4 A;  4CDF C;  1S72 A;  4JOI A;  1MSG A;  3M85 A;  2L12 A;  3SEB A;  3CCV A;  3SGI A;  1LTR D;  2EYO A;  3GTQ H;  3HOW B;  2HT1 A;  1STH A;  4A3M H;  2KEE A;  1PYW D;  5AJ3 L;  4JI4 Q;  3BYT B;  4TKO B;  1SNQ A;  1EY5 A;  2SNS A;  3CC4 A;  2D5D A;  3FKI G;  2B2V C;  1K9M C;  1HFG A;  2P5Z X;  2JYO A;  2IJ0 A;  1DOM A;  4PZ7 A;  2PNH A;  4G7H C;  1A15 A;  2EYM A;  4JVZ A;  1PH5 A;  3NTI A;  2WB1 E;  2KUM A;  3M4Q A;  1RHP A;  2ID0 A;  4K5W A;  3UDF A;  4YWL A;  2MGS A;  1TQO A;  1Q1B A;  1W6J A;  1X3F A;  5H1S E;  4X65 Q;  1K28 A;  4N8F A;  5DNF A;  3NBI A;  3AB9 A;  1DYQ A;  3CCL A;  4PNY A;  1Y1W B;  3DEO A;  4BY7 H;  4EVO A;  1O7Z A;  5C3W A;  4HJ7 A;  4Y52 H;  3ND9 A;  3RUZ A;  3SHL A;  3H3V I;  2R3Z A;  4R9W A;  2RSN A;  4KV6 A;  3OWF A;  2F3I A;  4LF6 L;  3L0O A;  2F4V Q;  1E22 A;  3I4L A;  3HOW G;  2FFK B;  1SSO A;  1VQJ A;  4PMC A;  4R8I A;  5LMN L;  4B9W A;  1JWM D;  2UUB L;  4C3H B;  1XNR Q;  3STB C;  3HOZ B;  1UEB A;  3W3A A;  4X3K A;  1IW7 C;  1EZ6 A;  4HN7 A;  5LMN W;  2NVT H;  1PRT B;  5JJL A;  2IPK D;  5FLM H;  1I94 Q;  1WD1 A;  1IKL A;  1BQQ T;  3K0Y A;  2XGT A;  4B3S Q;  4FF3 A;  4DV5 Q;  2NTS A;  1BCP C;  1S40 A;  2RHQ B;  1NJI C;  3VA5 A;  4G7Z C;  1EEF D;  1MGS A;  2K5Q A;  5M3F G;  2HCC A;  3PMF A;  5C0X I;  3J80 L;  1KRT A;  4PQX A;  3FPU B;  1IBM L;  2D9U A;  2N78 A;  4DUY L;  3DHQ A;  1UWV A;  5C4J B;  5EBD A;  5M5X B;  2XNA C;  4IO9 A;  4F8M A;  4JI1 L;  3GV6 A;  5I2Y A;  2AMC B;  5K5P A;  3K80 C;  2NVX B;  1PFN A;  3D4R A;  3K0X A;  2KEC A;  1TWG B;  4A3F B;  1RKN A;  2L4N A;  3PSI A;  2R7Z H;  1GO3 E;  1EWC A;  1S5B D;  5KYL A;  4L5Q A;  3GTJ B;  4LF7 L;  1EY6 A;  4DR2 L;  1OXS C;  4C3J G;  4ME3 A;  4NP5 A;  1PFB A;  1L1O C;  4XYO A;  3P7J A;  2K01 A;  1GVP A;  3TZD A;  4OGQ C;  3FMC A;  1MJE A;  1T5X D;  4HIO A;  1G91 A;  3RN2 A;  5C4X B;  3QG1 A;  1RIP A;  3IRB A;  3PO2 H;  1N36 Q;  1AZQ A;  3NE5 B;  2F0P A;  1S5E D;  3JAM E;  3C1F A;  4JV5 L;  5FKA C;  2ZM6 L;  1JCK B;  3L3O C;  4IUV A;  3GDE A;  4HCS A;  5JAV A;  1SE8 A;  3J80 i;  3S1Q H;  2EE1 A;  4GN5 A;  4JBM A;  1A63 A;  4Q0F A;  4OWX B;  3HFZ B;  2F0J A;  1I5F A;  1RTO A;  2F0T A;  3HG9 A;  1PHJ A;  1HNW Q;  4QIW B;  4IJH A;  3NEM A;  4R4I A;  1STG A;  2Q8I B;  4NMZ A;  3KJO A;  1SRO A;  1UE7 A;  4Z9C B;  4ZYS A;  2F0V A;  1RF2 D;  2Z1C A;  3I8Z A;  4AYB E;  2YTX A;  3TSS A;  1EQQ A;  3WDN A;  4OO1 H;  1HH2 P;  1V1P A;  3OW7 A;  4CHT B;  1QB5 D;  2K7V A;  4A93 H;  1Z47 A;  5IP7 G;  3HOY H;  1AH9 A;  3JAM L;  1BXT A;  2RHS B;  3CRL C;  2IHF A;  4BY7 B;  4DR4 L;  5KND A;  3TN2 A;  3NTK A;  1V1O A;  1K73 C;  1VCI A;  3UE1 A;  2QEJ C;  3S1Q B;  3NEN A;  4P75 A;  1RTN A;  3D4W A;  3LWU A;  1UE6 A;  3ONA B;  1RD9 D;  2JK8 A;  1F9S A;  5GAG C;  2N88 A;  2K04 A;  3MWY W;  2JSO A;  4A3G B;  3URY A;  1SAP A;  5IP7 H;  4DV6 Q;  3DWA A;  3M9B A;  3EFX D;  1X65 A;  2L0C A;  2R6G A;  1TWC B;  2H1E A;  3GD7 A;  3HGB A;  4BY1 G;  5IYC G;  2O5I C;  1SNC A;  1HUN A;  5KIX A;  1PTO F;  3I4N B;  1CSQ A;  2F03 A;  2SNM A;  4N8X 1;  4J6H A;  1Y8O B;  1I3Q H;  2PQA A;  3RZO B;  1LO5 D;  1HNX L;  5KEE A;  3O13 A;  4YCW A;  3I7F A;  2RDG A;  3BZC A;  3S16 B;  3S2D B;  3CP0 A;  3M3Y B;  2VB3 X;  1WTO A;  3NXW A;  1A8V A;  3S1N H;  2EY1 A;  4LF4 Q;  1AE3 A;  4DAV A;  1L0X B;  3I72 A;  1JT8 A;  1PLF A;  2SEB D;  1MD2 D;  1XMQ Q;  5IWA L;  1CA5 A;  4FF4 A;  3GTJ H;  4A3E G;  3PIP 3;  5IYB G;  1HTL D;  2L1B A;  5C3X A;  2PQE A;  1EU4 A;  1TT2 A;  4A3M G;  3H6M A;  1VQD A;  1VQA A;  4EQ5 A;  1WOC A;  4RKL A;  4A3D H;  2H4O A;  1A3U A;  3ERO A;  5C3E H;  3SE0 A;  1AZP A;  1TKW B;  1YNN D;  3J81 L;  4NXM Q;  1FNV A;  2A68 C;  3J7Y W;  1HQR D;  5FJ8 G;  5IGE A;  4K6D A;  1SND A;  5C0X G;  1GKH A;  5IOD A;  3SDZ A;  1E0B A;  4BBS G;  3PO2 B;  4GNX A;  2KQ3 A;  3K59 A;  1N34 Q;  4U67 3;  2CW0 C;  1XPO A;  4XT3 B;  3DWQ A;  2SDF A;  4UP7 A;  4TVA B;  3MXU A;  5IIF A;  4JI1 Q;  3RLN A;  1BDO A;  4IN3 A;  1R9T B;  2JA8 G;  2JE6 I;  1BCP D;  3NEL A;  1R4P B;  2OQK A;  1WTW A;  1HQM C;  2NYZ D;  4CJ2 C;  1PFM A;  2PNR C;  1K8A C;  1PDQ A;  2OQ0 A;  2MPM A;  2HQL A;  2EZV A;  1M90 C;  2B29 A;  2ZXO A;  3EVQ A;  5T1G A;  4C1N K;  1C7Y A;  4HJ5 A;  4DV5 L;  3VYR A;  1JB3 A;  1X56 A;  2DY8 A;  3RLF A;  1M8A A;  2XRQ D;  1N36 L;  4PG3 A;  2A6H C;  3LNN A;  1SE3 A;  3H0G H;  1AEX A;  2JJQ A;  4X66 Q;  4JI0 Q;  4TRD A;  4DV7 L;  4A3B B;  4K0K Q;  1B1Z A;  5EKI A;  4KK7 A;  2F0W A;  3R93 A;  1I4R A;  4DR6 Q;  3CAM A;  1PFS A;  3RZD B;  3EBE A;  2F3W A;  5LMN Q;  5IT9 L;  3MXN B;  1PZI D;  1X3Q A;  3OHX C;  2PO4 A;  1GHK A;  4XXE A;  4M8A A;  1SYF A;  4DV3 L;  3K5O A;  2F0G A;  1LTA D;  3F2U A;  3I4M H;  2ZTC A;  3GQB A;  3PUX A;  5CC4 A;  1SE2 A;  5JEA G;  1YEZ A;  3KLS A;  4IFD H;  2E2I B;  3MC0 B;  2DNC A;  3BVM A;  3R2I A;  4IUP A;  3ICE A;  1G51 A;  2CVR A;  4DR7 L;  1IBM Q;  3S15 H;  1Y1V G;  1SE4 A;  1DOL A;  1XMO Q;  1UE5 A;  2QKI C;  1K8G A;  3D6W A;  2B2U C;  5M5Y B;  3VR2 A;  3HOV H;  2FXQ A;  3I4M G;  4EGV A;  3A8K E;  2K4K A;  4NW2 A;  4NXN Q;  1BKB A;  1J8I A;  4A3J G;  1DGS A;  2ZXR A;  2LKV A;  2A74 C;  1FNU A;  1XWE A;  3TEH B;  3Q0A A;  3CQZ B;  4A3L H;  1SR3 A;  1WTQ A;  1PYS B;  2KED A;  2AWN A;  1XNR L;  1TWH B;  1ILP A;  4DU9 A;  3IFT A;  2Z8L A;  1WCM H;  4GOP B;  1A2T A;  1IBK L;  2ZJQ A;  1YJ9 A;  1EUJ A;  1YBY A;  1L2F A;  5C5M A;  4DUZ Q;  1EL0 A;  1H9R A;  4RH6 A;  4GLV B;  3EQL C;  4R4O A;  3S9W A;  2HHH Q;  2EQS A;  1VQB A;  1FR3 A;  2WFW A;  2WB1 B;  3MVV A;  1AE2 A;  4RCO A;  3DEP A;  3DWP A;  4DF7 A;  1XJV A;  2NVT B;  2BCO A;  1SYB A;  2N3S A;  1PH1 A;  4F7X A;  4IFD I;  1D5M C;  2A19 A;  2YTY A;  2BA1 A;  4ALP A;  4RCN A;  2RDF A;  1ILQ A;  4ZLT F;  3V05 A;  1PRT D;  3JAM i;  3FP9 A;  3GTP B;  2WII B;  3K8A A;  4NKL A;  2PW5 A;  2QEX A;  4A3I H;  4LUZ A;  4KHV A;  4FYD A;  3J80 E;  4TQU S;  2NBF A;  4ILW A;  1CKO A;  4L63 B;  4BXX G;  4FF2 A;  2TMP A;  2F0L A;  1LAB A;  1U4P A;  5IY0 A;  2LXK A;  5C4H A;  1X32 A;  2B2Y C;  4POG A;  1P16 A;  1M4V A;  1SN8 A;  2R7D A;  3J81 c;  5M3F H;  4HJA A;  3BVG A;  2LMC B;  2NN6 I;  3DM3 A;  2PMZ E;  1KTK A;  4BXX H;  2NWG A;  1ASY A;  1OXV A;  3K7A B;  4YY3 Q;  1Q90 A;  3S14 H;  3GTL H;  4MHE A;  5EPJ A;  2BH2 A;  3RN5 A;  4G7O C;  1O80 A;  4I7A A;  3F2C A;  3ITP A;  3QOJ A;  2O5J C;  2ZTD A;  3LGJ A;  4QMG A;  4E6I A;  1PH3 A;  4ABN A;  2NZ1 D;  2JA8 B;  1MJC A;  3HKZ E;  2QDB A;  2HCI A;  2FJ2 A;  3NUC A;  3T53 B;  2O2L D;  1N33 L;  1B53 A;  1TS4 A;  1WTV A;  4JI7 Q;  1KAA A;  3G6J B;  1STE A;  1TS2 A;  2D0O A;  5FLX E;  4PMW A;  2NVY B;  1SYC A;  3TRZ A;  3J81 i;  3F2B A;  2NTT A;  2ZJR A;  2Y0S G;  4BBR G;  5A35 A;  4GKK Q;  5LL6 S;  1TS3 A;  2B63 B;  3E5S A;  1STB A;  3P75 A;  3WOF A;  3UE0 A;  2EY6 A;  1Q7Y C;  4KHP Q;  1HA6 A;  2K5N A;  1JOR A;  4RMF A;  1LYL A;  3L7Z C;  3HOU G;  1Q8K A;  2K6A A;  1Z7T A;  1B3A A;  1LTT D;  1W3S A;  2A73 B;  4C1N I;  2R93 G;  1QG7 A;  3H94 A;  2KVM A;  4LFC Q;  5IT9 E;  4B3T Q;  2D62 A;  2E76 C;  3M4Y A;  4OX9 Q;  2MFI A;  1VQL A;  2B8F A;  4C3J B;  3KDF A;  3E6Z X;  3C3L A;  3CCJ A;  4KJN A;  2VQF Q;  2R61 A;  3AFP A;  1VMC A;  4KY7 A;  3Q6S A;  1NTG A;  1NY4 A;  1ESR A;  3BDC A;  3E0E A;  1Z9F A;  1G8Z D;  3KBG A;  4DAY A;  5IT9 c;  3OSO A;  3SK4 A;  1WYD A;  5JOB A;  1EU3 A;  4UP8 A;  5I6W A;  3MXP A;  1PH6 A;  1FNW A;  3U58 A;  2ICI A;  1HNX Q;  3H3V H;  4HR7 B;  1EFW A;  1SLJ A;  4FXK C;  1HPC A;  2UXB L;  4GOP C;  3CW2 C;  3BVZ A;  4IQZ A;  3G6E A;  4K6L A;  5DLQ E;  1ZEQ X;  1RCV D;  2VZA A;  5IP9 H;  2CH4 A;  2JA6 H;  1D8L A;  1OXT A;  3OPO A;  1CI3 M;  1N8R C;  4B3M L;  3A7A B;  1CUK A;  1EEI D;  5EKK A;  1GHJ A;  1JB7 A;  1TWG H;  4Y7N B;  3KOJ A;  3KLR A;  4C56 C;  2R93 H;  1R9T H;  2EY2 A;  2JEA I;  1EIG A;  1TY0 A;  3VA7 A;  3PCO B;  4LF9 Q;  4DK3 C;  1BOS A;  3K5N A;  1PA6 A;  3ZJY C;  4AQY L;  1BUV T;  3FDT A;  4CJ0 B;  2UXC L;  4HSP A;  3MTS A;  2NN6 G;  1HZB A;  1TXY A;  3IFD A;  1J5E Q;  4JI6 L;  1K3R A;  2K5V A;  2PI2 A;  3K58 A;  5LMU L;  1Y1W G;  4LF5 Q;  1B7Y B;  4ZRZ A;  1UUP A;  1F2Y A;  3PIO 3;  3BYY B;  4QL5 A;  4PV1 C;  5FLM G;  1N34 L;  4BA1 I;  4BY1 B;  3I56 A;  2K32 A;  1A6X A;  1QIL A;  3EN2 A;  1I50 B;  1S5C D;  1MBY A;  1L1O A;  4P74 A;  1K83 H;  5KGU A;  2VQF L;  2M9V A;  4A3I B;  2NUC A;  4IOA A;  1PZK D;  3HOZ G;  4QB4 A;  2VL6 A;  1U5K A;  1ET9 A;  1E1T A;  1IW7 D;  4QUF A;  3S24 A;  2R7Z G;  4NB3 A;  3TP8 A;  4K5V A;  2OT2 A;  1YHB A;  3BG3 A;  4AH6 A;  3K5L A;  2JA6 G;  1I4Q A;  2K33 A;  4IZ8 A;  5I9O A;  3D31 A;  2OTJ A;  1YI2 A;  4MN3 A;  1I94 L;  2EIF A;  5C3E G;  2F0E A;  3HP3 A;  4P71 A;  4A3E B;  3AEV A;  4CBV A;  1IZ6 A;  4HED A;  4GN4 B;  3VYT A;  4X6A H;  2N49 A;  1KAB A;  2DJG C;  1IKM A;  3UDG A;  4IUN A;  1QOH A;  3MEF A;  1KDB A;  4GOP A;  3KF6 A;  1V1Q A;  3C46 A;  3TP7 A;  3CRK C;  2Q2I A;  1HR0 Q;  3S17 B;  2A8V A;  2WIN B;  1VQ5 A;  1SMY D;  1SMY C;  4DNI A;  1MHW C;  1D1I A;  3KLW A;  3CKI B;  3MAQ A;  3C2P A;  4HIK A;  1JOQ A;  1GOZ A;  2NVQ H;  5TSS A;  2G9H D;  1QNU A;  3X3M A;  2J4X A;  4FVM A;  2R92 H;  4K2K A;  2CQO A;  4DV6 L;  4DXG A;  3CCM A;  4LNQ A;  3D6C A;  3S16 H;  3T4A C;  4HIM A;  1QUQ A;  3CCQ A;  1B9M A;  5E7N A;  3CCU A;  4DR7 Q;  4OX9 L;  2PYK A;  4A3G H;  5D3I B;  2GN5 A;  2F0Q A;  4R4C A;  1WVL A;  1YHQ A;  5ELB A;  3BZD B;  2IL8 A;  1BNZ A;  4KMU C;  2G5D A;  2AKW B;  3DM1 A;  3AFQ A;  2QA4 A;  4DR3 Q;  1KDA A;  4YY3 L;  5C44 B;  2IT1 A;  4OO1 I;  2K1B A;  1FGB D;  5CR3 A;  1VQ7 A;  3CF5 A;  3AU7 A;  2VUM G;  1H9J A;  1OXX K;  2MO1 A;  1K8M A;  1HNZ Q;  2E2J H;  4KTA A;  4ULL A;  4Q5V A;  4JI5 Q;  3NWT A;  5M5Y H;  2I5M X;  2IW3 A;  1E24 A;  1VS0 A;  1E1O A;  5CV4 A;  2F0S A;  1EQT A;  2JA6 B;  2I07 B;  2NN6 H;  3D4D A;  2F0H A;  4C3H H;  2B2U A;  4LFB L;  3MHB A;  2Q8T A;  4LFB Q;  4KLK A;  2K03 A;  2C35 B;  1D2B A;  2JA7 B;  4B3R L;  1HCZ A;  2I46 A;  5C3E B;  4POF A;  5JVH 3;  2LS0 1;  1O7Y A;  2N55 A;  4AIM A;  3HOX H;  1VQP A;  1EIH A;  4LJZ C;  1JIC A;  4J1M A;  3CPW A;  1KLG D;  3GTK H;  3NSW A;  1MKH A;  4FO2 A;  3I3C A;  3IAY A;  2R7F A;  5EJW A;  1IL8 A;  2DNE A;  3FRP B;  3MFY A;  2AQ3 B;  2B2T A;  5HUR A;  1XPR A;  2H5X A;  2KOL A;  4YHH Q;  3HOW H;  3GTQ B;  3Q22 A;  1BCP B;  2YV5 A;  5CGK A;  5LMU Q;  1EOV A;  2AQ1 B;  1QNK A;  2HD3 A;  5JVG 3;  1SRU A;  2M2L A;  1EQV A;  1V8Q A;  4DR3 L;  1KHI A;  2CH4 W;  1PH2 A;  1CQV A;  4XQJ A;  2JQO A;  3TS0 A;  1HTP A;  5BR8 Q;  3H0G G;  3GTL B;  4DK1 A;  4QQB X;  1Y8N B;  4DUY Q;  3R8B A;  2ASB A;  2KCC A;  1C4Q A;  4RHS A;  3J81 j;  5C4Z A;  4NXN L;  1TWC H;  4FNF A;  4JI0 L;  4RWS C;  2UXD L;  2TSS A;  2F1M A;  3GTK B;  1YJW A;  3A74 A;  2WAC A;  1PRT C;  3C1E A;  3M7N A;  2HDL A;  1CKN B;  5JJI A;  1EYC A;  3CC2 A;  4A76 A;  2Z4I A;  4A3I G;  1CHQ D;  3NK9 A;  4GZY C;  1LTI D;  1PTO D;  5I2X A;  1LLR D;  3OYY A;  2VXW A;  5LHY 1;  4MTN A;  1JR0 D;  2NVY H;  1TWF B;  2I5H A;  1K8O A;  2JXM B;  5A2Q E;  2EJM A;  1HZ9 A;  3U4V A;  2MQH A;  3PUV A;  3HKZ G;  3IL8 A;  3SXH A;  3FHW A;  1OTC A;  2QGQ A;  4GNX C;  3J7Z C;  2B63 H;  4EX5 A;  1IBK Q;  4JCV E;  4H02 A;  3WOE A;  3RNU A;  1PXU A;  2DN8 A;  3LX0 A;  3ZYY X;  1WTR A;  1I4X A;  4DAP A;  3A8J E;  3L9A X;  3PGZ A;  3ER0 A;  3RZO H;  1YJN A;  5IYD H;  3PO3 H;  4FF1 A;  4LF9 L;  3GV3 A;  4HCE A;  2OTL A;  2CCZ A;  4F87 A;  4A3M B;  4A3K G;  2XVS A;  1QE6 A;  3M4O B;  4RG1 A;  5JPM C;  2EOT A;  1STN A;  4MZ9 A;  2VUM H;  2Q2U A;  3OW2 A;  3STB D;  2A1A A;  2B2W C;  3FKI B;  5IWA Q;  2CW0 D;  4DV4 L;  1EYG A;  1RJT A;  1F2L A;  1N32 L;  2ATW A;  3VR3 A;  4KHP L;  2L15 A;  3H3V C;  2UXB Q;  4CKC A;  4KKS A;  1U4R A;  2UU9 Q;  2CKZ B;  4NPS A;  5EPL A;  4CJ1 B;  2Z4H A;  2M00 A;  4BBS B;  2HIV A;  4R1J A;  4LF5 L;  1D5X C;  2JA9 A;  2B2Y A;  1VQO A;  3M3Y H;  3PIO A;  4GNX B;  2EJF C;  1BCP F;  1VMP A;  2E2J B;  1CT1 D;  2OXP A;  1K3B C;  3QR8 A;  2YU9 H;  4X62 L;  3PF5 A;  1F9R A;  1I6H B;  4BBR B;  3SVM A;  1N33 Q;  5GQO A;  2EJG C;  2F0I A;  2WAQ G;  3HOY G;  4JV5 Q;  5KNB A;  2OF1 A;  5IGC A;  3A0J A;  1EY0 A;  5D65 A;  4C3I H;  4K8I A;  1KNA A;  4L8J A;  4P72 A;  5NUC A;  1NUC A;  1Y1V H;  4KJO A;  4KKT A;  4LFC L;  4A3K H;  4DR4 Q;  2MP1 A;  3G7L A;  1DXM A;  2IY5 B;  3OTO Q;  1NMF A;  2ICE C;  2F52 A;  1SYG A;  1GJX A;  3OWE B;  1B8A A;  2EYL A;  2BDO A;  2MJ8 A;  5M3F B;  4C2M B;  1HHV A;  4CDE C;  1D1K A;  1U4L A;  4B08 A;  1JMC A;  4KKU A;  2XTI A;  4FP5 D;  2PZW A;  5C0X J;  5LL6 X;  2RDH A;  2LSS A;  1I50 H;  4ZCK A;  2JA7 H;  2Z6K A;  1MSH A;  5CYU A;  4ZQ3 A;  4YWM A;  5I4D A;  3HOX B;  5CV6 A;  4AQY Q;  4DR5 Q;  1XTD A;  4ZUI A;  1A0I A;  3G71 A;  1UEA B;  1B4O A;  1I6V C;  4BA2 I;  4DNT B;  4HID A;  3I4M B;  1WCM B;  1L0W A;  3Q8D A;  3H0G B;  4OEL B;  2KCN A;  1PH7 A;  3X3N A;  2BH8 A;  4S3S A;  1XMQ L;  2RQX A;  2B2W A;  2KHJ A;  4N9P A;  3W1B A;  5IGF A;  4G57 A;  1LM0 A;  1NBW A;  4LFA Q;  3U9O A;  4LF4 L;  1XNQ Q;  4H7B A;  1ROD A;  4LF6 Q;  3CPF A;  4DUZ L;  1PTO B;  1EZ8 A;  2LFN A;  1Z6H A;  4OWW B;  1E7Z A;  1OXU A;  3J7A F;  1IXR A;  4PMB A;  1Q12 A;  4JI3 Q;  3R3O A;  2UU9 L;  3KYH C;  5I9P A;  1Q46 A;  2Z0S A;  1H9K A;  1AN8 A;  3TRE A;  1KRS A;  2ZTE A;  1ZYR D;  1KNE A;  2PW7 A;  4KI0 A;  3QO2 A;  1EQR A;  4JI2 Q;  1D7Q A;  3T16 A;  1F2M A;  3ND8 A;  1U4M A;  2KCT A;  5FOB B;  2J7Z A;  4QJF A;  2C5C A;  2VB2 X;  4YCV A;  2J0T D;  3CXC A;  1Q86 C;  4RAU C;  2I5L X;  4B3T L;  1BR9 A;  3F1Z A;  2A5H A;  4LK1 C;  1BO0 A;  1UNS A;  3GTG B;  3Q23 A;  4X3T A;  3NQI A;  2C9O A;  4XQQ A;  2DY7 A;  2BOS A;  1DCZ A;  4A3K B;  2CWA A;  3P20 A;  2HHH L;  4DV2 L;  4OL7 A;  4RGM A;  3SK5 A;  1Y1V B;  4YHH L;  3CCS A;  1KQS A;  2VQE Q;  2EYF A;  5G3L F;  2SOB A;  4KY6 A;  4XTC S;  5ELD A;  2JA5 H;  4IPH A;  3M7G A;  3TP5 A;  4JI8 Q;  3U4Z A;  2PZT A;  4X65 L;  5G3L D;  2V4D A;  4BS9 A;  5CBA E;  3KBX A;  3HOU B;  1VQE A;  1I6H H;  1CKN A;  1X6O A;  2EYP A;  2WAQ E;  5K36 G;  2AUJ D;  3NBH A;  5M3M H;  3BS1 A;  5J1Z A;  3GTM H;  1IHZ A;  3FKI H;  2VS1 A;  4B3S L;  3TS2 A;  4Y7N H;  1B50 A;  3K7A H;  3D3R A;  4LF8 Q;  2PMZ B;  2GVA A;  1XXG A;  1L1O B;  4OXP A;  3V2T A;  2NB0 A;  1EIF A;  5AJ3 Q;  4JI4 L;  3K7U C;  3TZU A;  2WB1 G;  1HZC A;  1ICW A;  1YNJ D;  1FYC A;  5ELF A;  1HNZ L;  1T9H A;  5D3D A;  4UDU C;  4J15 A;  4U68 A;  5M5W B;  4RGN A;  5DM7 3;  3P1H A;  5IYC H;  1CM9 A;  3VDY A;  1VQI A;  4YWK A;  3TBI B;  3FPP A;  2Y0S B;  4RGT A;  4DV3 Q;  1QUQ B;  1J5E L;  2F0O A;  1EWH A;  3NBH B;  1F77 A;  1PV4 A;  2AUK A;  3GTO B;  4GN3 B;  3S1R H;  1P8L A;  2JA5 G;  1X3E A;  4O1N A;  4IOC A;  4X66 L;  1OO9 B;  1RDP D;  4DK0 A;  1IBL Q;  2AQ2 B;  1X3P A;  4APV A;  1EY8 A;  2EYH A;  3CQZ H;  3CCR A;  2PI2 E;  1A2U A;  3QIA A;  3VYS A;  5K36 H;  1SBB B;  3E9I A;  4ODG A;  4JW0 A;  2QW7 A;  4K5X A;  5JPN C;  3EIV A;  1DD2 A;  5CMD A;  2K5H A;  1DON A;  3HOX G;  5J39 A;  4WJ3 M;  2E8G A;  1EY9 A;  1WI5 A;  1MI2 A;  3L2P A;  3M4O H;  3PQI A;  2D0P A;  4XYQ A;  5IYD G;  1PZJ D;  3A8I E;  3HRZ C;  1LTB D;  3BZK A;  3RZD H;  2R92 G;  4YCU A;  2Z6K C;  1HR0 W;  2N8N A;  3J81 E;  3K6O A;  1II3 A;  1HFN A;  1C9O A;  5I6Y A;  2IWH A;  1SJE D;  3DXJ C;  1KLU D;  2I0Q A;  2RKS A;  5C44 H;  1G6Z A;  4IJL A;  4OEM B;  1CZG A;  1B9N A;  1VQ6 A;  4A3F G;  3NWS A;  2L11 A;  4IPC A;  4WRD A;  2XN9 C;  2E2I H;  1LTG D;  4ZAI A;  3HOU H;  2QIL A;  3T1H L;  4RHR A;  3W2D A;  1Q3L A;  1TWF H;  2K5D A;  2EXZ A;  5T1I A;  4LWC A;  3JAM c;  1FJG Q;  1ESF A;  2EVB A;  2WKD A;  5C4X G;  1PTO H;  1LT4 D;  4BBR H;  5M5X H;  5F2D A;  2WV6 D;  3PF4 A;  4C3J H;  5D14 A;  3I73 A;  1GUO A;  1O7L A;  3CMA A;  1WFQ A;  2VW9 A;  1HR0 L;  1ET6 A;  2RVL A;  3AQQ A;  3AYH B;  3K81 C;  3AMU A;  2R93 B;  3BDL A;  3RR5 A;  1GUG A;  2CFM A;  3B6Y A;  3UI2 A;  1IYJ B;  3J7A V;  1FVI A;  5L37 A;  3CC7 A;  3OTO L;  3DLL A;  1XNQ L;  4PZ8 A;  3I55 A;  3F8T A;  4RA8 A;  3MXG A;  1GXD C;  4JBK A;  1A3T A;  4A3B G;  1SNM A;  3E3X A;  4DR6 L;  2EPB A;  1GUS A;  3PUY A;  5JEA H;  1K0S A;  1DOK A;  1SJH D;  2HUG A;  1V43 A;  4BY1 H;  4P2C B;  3KLS X;  5C5L A;  1WD0 A;  1O78 A;  4BY7 G;  1AFP A;  3S1M B;  3H15 A;  4DV0 Q;  4I7Z C;  2ZJP A;  1SEB D;  3A5Z B;  4QCL A;  3PIP A;  4A3D B;  1SDF A;  3HEJ A;  2RA4 A;  4UY8 C;  4ZKB B;  1VQG A;  2B2T C;  4DKA C;  1NMG A;  2AHO B;  4K2L A;  3KK7 A;  5DEH A;  4DAM A;  1AW7 A;  1CHP D;  5J3B A;  1B70 B;  3M4P A;  5C4X H;  2KA7 A;  4X64 Q;  4C2M H;  1JOO A;  1S5F D;  3JC6 6;  1VQ4 A;  3TME A;  1B3Q A;  4CDC C;  5C4J H;  3CU7 A;  1D6E C;  3OOC A;  4C3I B;  4EQO A;  2OEO A;  1B2T A;  2YYZ A;  2RSO A;  4DV0 L;  1LTL A;  2F0D A;  1HJP A;  1NSN S;  5EPK A;  1KDC A;  2QDL A;  3KF6 B;  4O2D A;  1GUW A;  1HUM A;  3I4N H;  1K83 B;  2B2V A;  3TQY A;  1V1P B;  3LWE A;  4LW1 A;  2A69 C;  3NP8 A;  2JA7 G;  4X3S A;  5M5W H;  3TP6 A;  2WAQ B;  3HOY B;  4A4I A;  4JPB W;  1CFM A;  3H91 A;  1EWI A;  1W2B A;  1W6K A;  3E9H A;  4IPD A;  5EGT A;  5FK9 C;  2LY7 A;  5EQ0 A;  1HZA A;  4DR2 Q;  1Y69 U;  5GAE C;  1PH9 A;  4GKK L;  1STY A;  1PMR A;  4JYA L;  4QIW E;  5IYB H;  3R2T A;  3A54 A;  5E4X A;  3TDQ A;  5AFW A;  3S1N B;  4YIJ A;  4KY5 A;  4JYA Q;  2VUM B;  2Q2T A;  3D0F A;  5EKL A;  2MUY A;  1BBX C;  1T5E A;  4MIU A;  3PO2 G;  4IPG A;  3W5O A;  2B8G A;  4UAI A;  2EDG A;  4X3U A;  1LT5 D;  1VF7 A;  1TII D;  2PQA B;  5FJ8 H;  3GO5 A;  1KL9 A;  4DR1 L;  3QOL A;  1E2V A;  2MHV A;  2L9H A;  4KD4 A;  2R92 B;  1XMO L;  2IX1 A;  1L0Y B;  1GUT A;  2HDM A;  2BE5 C;  2CHB D;  3DMU A;  3HKS A;  1VQM A;  2A69 D;  1JQY D;  2V1C C;  5GAH C;  4LUO A;  5ELE A;  4AYB B;  4JBJ A;  2L5T A;  3ULP A;  3FEW X;  3I4N G;  3SK6 A;  2E5L L;  3T13 A;  2B3G A;  3KJP A;  1V9P A;  4CKB A;  3QB3 A;  2KCM A;  3ERS X;  5CV9 A;  2PPB C;  5DAU A;  2UUB Q;  3MA2 B;  4QUC A;  2CWP A;  2MNA A;  3S1M H;  2FMM A;  3T1Y L;  1PH8 A;  2UUC L;  1TY2 A;  2E2H H; 
#chains in the Genus database with same CATH homology
 3HOW G;  2XTI A;  1VQJ A;  3UE0 A;  1VQK A;  4L5R C;  1Q7Y C;  5LMN L;  4KHP Q;  5C0X J;  2UUB L;  1XNR Q;  2K5N A;  2UUA Q;  3STB C;  4RMF A;  1LYL A;  3L7Z C;  3HOU G;  1UEB A;  5LMN W;  1Q8K A;  2NVT H;  2LSS A;  1W3S A;  5JJL A;  5FLM H;  4OO1 G;  1I94 Q;  1I50 H;  4K0K L;  2JA7 H;  2Z6K A;  2R93 G;  1S3O A;  4YWM A;  2XGT A;  4LFC Q;  2KHI A;  4AQY Q;  4B3R Q;  4B3T Q;  4B3S Q;  4A3G G;  4DR5 Q;  4DV5 Q;  2D62 A;  5C44 G;  5HY6 A;  4OX9 Q;  1QVF A;  2MFI A;  1XTD A;  1S40 A;  2RHQ B;  1A0I A;  3G71 A;  1NJI C;  1VQL A;  3KDF A;  5M3F G;  4BA2 I;  4A3F H;  3PV0 A;  3CCJ A;  4HID A;  5C0X I;  1IBL L;  1KRT A;  1L0W A;  3Q8D A;  1QZG A;  2VQF Q;  1PH7 A;  1IBM L;  3AFP A;  4GLA C;  2BH8 A;  2N78 A;  1XMQ L;  5ELN A;  2KHJ A;  3F2D A;  1NTG A;  3W1B A;  4DUY L;  3GTP H;  2JEB I;  1NY4 A;  1UWV A;  3E0E A;  1JJC B;  1NBW A;  1LM0 A;  1Z9F A;  4JBW A;  4IO9 A;  4LFA Q;  5IT9 c;  4JI1 L;  1KC8 C;  4LF4 L;  1XNQ Q;  1Q1E A;  1GM5 A;  2F4V L;  2AMC B;  4LF7 Q;  4LF6 Q;  4P73 A;  3K80 C;  4A3L G;  3CPF A;  4DUZ L;  1WYD A;  5JJK A;  4UP8 A;  4GLX A;  3K0X A;  4R4T A;  2DUD A;  1QZH A;  1PH6 A;  4OWW B;  1E7Z A;  1OXU A;  3PSI A;  1GO3 E;  3ULJ A;  2K14 A;  3U58 A;  2R7Z H;  1IXR A;  1HNX Q;  3H3V H;  4LF7 L;  4L5Q A;  1Q12 A;  1EFW A;  1SLJ A;  4JI3 Q;  2UU9 L;  3KYH C;  4DR2 L;  1Q46 A;  4XIG S;  2UXB L;  4GOP C;  1OXS C;  2Z0S A;  1PH4 A;  4ME3 A;  3CW2 C;  1L1O C;  1XPU A;  3TRE A;  1KRS A;  2ZTE A;  1GVP A;  4KI0 A;  3G6E A;  1MJE A;  5DLQ E;  2VZA A;  5IP9 H;  4HIO A;  4NXM L;  1EQR A;  4JI2 Q;  1X3G A;  1D8L A;  1OXT A;  3RN2 A;  2ES2 A;  2JA6 H;  1D7Q A;  1RIP A;  1KAW A;  3IRB A;  3RLO A;  3PO2 H;  1N8R C;  3PUZ A;  4B3M L;  2KCT A;  1JE5 A;  1CUK A;  1N36 Q;  4QJF A;  1JB7 A;  2MO0 A;  1TWG H;  4AYB G;  2K52 A;  3KOJ A;  2ZM6 L;  4DR1 Q;  1R9T H;  4JV5 L;  2R93 H;  4YCV A;  2JEA I;  3GDE A;  3PCO B;  4QY7 A;  3CXC A;  2I5L X;  3W1G A;  4DK3 C;  1YNX A;  3ZJY C;  1Q86 C;  4AQY L;  1SE8 A;  3J80 i;  1PA6 A;  4B3T L;  3S1Q H;  4BBS H;  3F1Z A;  4GN5 A;  1M1K C;  4JBM A;  1A63 A;  4OWX B;  2UXC L;  1ASZ A;  3HFZ B;  2NN6 G;  4JI5 L;  1HZB A;  1I5F A;  1TWH H;  1PHJ A;  1HNW Q;  1TXY A;  2VY3 A;  4IJH A;  3NEM A;  4R4I A;  1J5E Q;  4HJ9 A;  4JI6 L;  3KJO A;  1K3R A;  1SRO A;  2K5V A;  1UE7 A;  2PI2 A;  4FDB A;  2CWA A;  5LMU L;  2VQE L;  2HHH L;  1Y1W G;  4LF5 Q;  1B7Y B;  3BU2 A;  4DV2 L;  2KEN A;  4YHH L;  4AYB E;  2YTX A;  2K50 A;  3GTO H;  4QGU A;  3CCS A;  1KQS A;  4LFA L;  1EQQ A;  2VQE Q;  4QL5 A;  5FLM G;  1N34 L;  1HH2 P;  4A3C G;  4BA1 I;  1KXL A;  3I56 A;  4XTC S;  2JA5 H;  4A93 H;  4IPH A;  1Z47 A;  3EN2 A;  5IP7 G;  4JI8 Q;  3U4Z A;  3HOY H;  4PZ6 A;  1AH9 A;  3I2Z A;  2RHS B;  1L1O A;  4P74 A;  1K83 H;  4DV7 Q;  2IHF A;  4X65 L;  2VQF L;  2WP8 J;  2E5L Q;  4DR4 L;  4IOA A;  1I6H H;  3HOZ G;  1VQE A;  3G4S A;  2VL6 A;  1U5K A;  1K73 C;  1E1T A;  1CKN A;  1VCI A;  1X6O A;  3UE1 A;  2WAQ E;  1N9W A;  1SMX A;  5K36 G;  2R7Z G;  3S24 A;  3NEN A;  4NB3 A;  4P75 A;  1KD1 C;  1YHB A;  5M3M H;  4AH6 A;  1MIU A;  1UE6 A;  1FL0 A;  3GTM H;  2JK8 A;  3FKI H;  5GAG C;  4O0A A;  2VS1 A;  1SFO H;  4B3S L;  2JA6 G;  3TS2 A;  4Y7N H;  1CKM A;  5IP7 H;  4DV6 Q;  3D31 A;  3S2D H;  3K7A H;  2OTJ A;  1YI2 A;  3M9B A;  1X65 A;  4LF8 Q;  2R6G A;  1I94 L;  2EXD A;  2EIF A;  1CSP A;  5C3E G;  4JI2 L;  3GD7 A;  2GVA A;  4P71 A;  4MNO A;  3AEV A;  1L1O B;  4OXP A;  1UE1 A;  4UP9 A;  4BY1 G;  5AJ3 Q;  1EIF A;  2UUA L;  5IYC G;  4JI4 L;  3K7U C;  4R4Q A;  2WB1 G;  1HZC A;  1IZ6 A;  1CSQ A;  1HNZ L;  4GN4 B;  1T9H A;  4X6A H;  1I3Q H;  2PQA A;  2N49 A;  5GRO A;  4J15 A;  1VQF A;  4JI3 L;  3UDG A;  2R92 G;  1HNX L;  3MEF A;  4DPG A;  5IYC H;  4GOP A;  3VDY A;  3KF6 A;  4JC0 A;  1VQI A;  2K75 A;  1V1Q A;  4YWK A;  4WJ4 A;  4YCW A;  3I7F A;  3BZC A;  4LUV A;  4DV3 Q;  3CP0 A;  1QUQ B;  4JI6 Q;  2Q2I A;  1J5E L;  1A8V A;  3S1N H;  3J7A 5;  1HR0 Q;  2A8V A;  4LF4 Q;  1VQ5 A;  1AE3 A;  3NBH B;  1YHA A;  4DNI A;  3I4O A;  1WJJ A;  1JT8 A;  2Y0S E;  1YIT A;  3KLW A;  1XMQ Q;  1PV4 A;  5IWA L;  4A75 A;  4HIK A;  1PVO A;  1N32 L;  4GN3 B;  3S1R H;  3GTJ H;  1P8L A;  2JA5 G;  4A3E G;  1X3E A;  2VNU D;  2NVQ H;  5IYB G;  2ALY B;  4LF8 L;  4GKJ Q;  4A3M G;  4IOC A;  1VQD A;  4X66 L;  1VQA A;  2R92 H;  1O7I A;  4EQ5 A;  2CQO A;  4JG2 A;  4DV6 L;  1IBL Q;  1WOC A;  3CCM A;  5ELO A;  4LNQ A;  4APV A;  3CCR A;  3CQZ H;  3S16 H;  4A3D H;  1G29 1;  5C3E H;  2BA0 A;  2PI2 E;  4HIM A;  4B3M Q;  1QUQ A;  4GKJ L;  3CCQ A;  5E7N A;  3CCU A;  4DR7 Q;  4OX9 L;  4A3G H;  2GN5 A;  4DR5 L;  4NXM Q;  3E9I A;  4DK6 C;  1EIY B;  3PUW A;  4R4C A;  3BJU A;  1YHQ A;  2AKW B;  3UDI A;  1WCM G;  3UDX A;  3EIV A;  5FJ8 G;  3AFQ A;  2QA4 A;  2K5H A;  4A3J H;  3HOX G;  4DR3 Q;  4YY3 L;  4L5S A;  4A93 G;  5C0X G;  1GKH A;  1G6P A;  2IT1 A;  4OO1 I;  4WJ3 M;  4BBS G;  1FGU A;  4GNX A;  4IFD G;  2E8G A;  4IFD J;  1VQ7 A;  1WI5 A;  3CF5 A;  1N34 Q;  5IE8 A;  3L2P A;  1QVG A;  2LXJ A;  1XPO A;  3M4O H;  2D0P A;  5IYD G;  2VUM G;  2GVB A;  4UP7 A;  4TVA B;  4HJ8 A;  3BZK A;  3RZD H;  4JI1 Q;  2UUC Q;  2Q2H A;  1OXX K;  2MO1 A;  3RLN A;  3G48 A;  4YCU A;  2Z6K C;  3T1Y Q;  1HNZ Q;  4JOI C;  1HR0 W;  3S2H H;  2JA8 G;  2E2J H;  2AWO A;  2N8N A;  3HOV G;  5IP9 G;  2JE6 I;  1C9O A;  3NEL A;  4DV4 Q;  2OQK A;  4JI5 Q;  2I0Q A;  5M5Y H;  1FJG L;  2I5M X;  5C44 H;  4IJL A;  2UXC Q;  1E24 A;  3T1H Q;  1K8A C;  1VS0 A;  1E1O A;  2OQ0 A;  1VQN A;  1VQ6 A;  4A3F G;  2HQL A;  3CME A;  4IPC A;  4C3H H;  2B29 A;  1M90 C;  1E3P A;  4LFB L;  1C7Y A;  4KLK A;  4LFB Q;  4HJ5 A;  2E2I H;  2C35 B;  4DV5 L;  1X56 A;  4B3R L;  4GS3 A;  3RLF A;  4POF A;  3HOU H;  1N36 L;  4PG3 A;  3H0G H;  4AIM A;  3HOX H;  2JJQ A;  4X66 Q;  3T1H L;  1VQP A;  4JI0 Q;  5M3M G;  1TWF H;  4DV7 L;  1PYB A;  4LWC A;  3JAM c;  3J80 c;  3CPW A;  4K0K Q;  1FJG Q;  3GTK H;  1MKH A;  4DR6 Q;  3CD6 A;  3CAM A;  5C4X G;  2R7F A;  1PFS A;  4BBR H;  3EBE A;  1Y1W H;  5M5X H;  1RL2 A;  4DV1 L;  3PF4 A;  5LMN Q;  4C3J H;  3MXN B;  1X55 A;  1XPR A;  2H5X A;  4KHZ A;  3CMA A;  1WFQ A;  4YHH Q;  2VW9 A;  3HOW H;  1YVC A;  1HR0 L;  3ULL A;  1VQ8 A;  3AQQ A;  2YV5 A;  3AYH B;  4A3E H;  3K81 C;  4DV3 L;  3A5U A;  5LMU Q;  3RR5 A;  3B6Y A;  2CFM A;  1IYJ B;  1EOV A;  1FVI A;  1IL2 A;  3CC7 A;  1QVC A;  3OTO L;  1SRU A;  3DLL A;  1X9N A;  4A3D G;  1XNQ L;  4PZ8 A;  3I55 A;  3I4M H;  1BBU A;  1KHI A;  2ZTC A;  3F8T A;  4DR3 L;  3PUX A;  1PH2 A;  2NZH A;  3GTG H;  3HOZ H;  4JBK A;  5JEA G;  2JQO A;  3TS0 A;  1YEZ A;  5BR8 Q;  3H0G G;  4DV1 Q;  4A3B G;  4QQB X;  1N32 Q;  4OON A;  4DUY Q;  2ASB A;  1LUZ A;  3KDF B;  4DR6 L;  3ICE A;  2IX0 A;  1G51 A;  3PUY A;  3KF8 B;  4DR7 L;  1IBM Q;  2RCN A;  3J81 j;  3S15 H;  4NXN L;  1TWC H;  1Y1V G;  2ZM6 Q;  4JI0 L;  2UXD L;  1VQ9 A;  1XMO Q;  1UE5 A;  1K8G A;  1YJW A;  3A74 A;  3HOV H;  2FXQ A;  3I4M G;  1V43 A;  2HIX A;  1NE3 A;  2UXD Q;  2K4K A;  5JEA J;  4NXN Q;  1BKB A;  3M7N A;  4BY1 H;  4A3J G;  1DGS A;  1GD7 A;  4DAY B;  1CKN B;  5JJI A;  3CC2 A;  4BY7 G;  4A76 A;  5GAD C;  3H15 A;  4A3I G;  4DV0 Q;  4UPA A;  5BR8 L;  1TWA H;  3TEH B;  3A5Z B;  2ZJP A;  3PIP A;  1KIX A;  3OYY A;  2NZO A;  4UY8 C;  4A3L H;  1SR3 A;  1VQG A;  1Q81 C;  4DKA C;  1NMG A;  1JJG A;  2AHO B;  4MTN A;  2NVY H;  1PYS B;  2AWN A;  1XNR L;  2I5H A;  4GOP B;  1WCM H;  4DAM A;  5J3B A;  5C4X H;  1B70 B;  3M4P A;  1IBK L;  2NVX H;  1YJ9 A;  2ZJQ A;  1BVS A;  4X64 Q;  2B63 G;  1EUJ A;  1YBY A;  1L2F A;  1HZ9 A;  1YZ6 A;  4DUZ Q;  3U4V A;  2MQH A;  1JJ2 A;  4C2M H;  4GLV B;  3PUV A;  3HKZ G;  3JC6 6;  1VQ4 A;  4R4O A;  3FHW A;  1OTC A;  2QGQ A;  4GNX C;  2HHH Q;  2EQS A;  4X64 L;  5C4J H;  3J7Z C;  2B63 H;  4EX5 A;  1IBK Q;  1VQB A;  4JCV E;  2DGY A;  2WFW A;  4H02 A;  3RNU A;  1VQC A;  1HNW L;  2RF4 A;  1AE2 A;  5EAY A;  4OWT B;  3KFU A;  1K0R A;  1XJV A;  4A3C H;  1J6Q A;  2YYZ A;  2YTV A;  3PGZ A;  2N3S A;  4DV0 L;  3ER0 A;  1PH1 A;  4IFD I;  3RZO H;  1YJN A;  2A19 A;  4JI7 L;  5IYD H;  1LTL A;  1VQH A;  2YTY A;  3PO3 H;  2BA1 A;  4ALP A;  1HJP A;  1C0A A;  4LF9 L;  2OTL A;  2CCZ A;  2JA8 H;  3JAM i;  3KF6 B;  3FP9 A;  4O2D A;  3K8A A;  4A3K G;  2QEX A;  4A3I H;  3I4N H;  1H95 A;  4RG1 A;  4LUZ A;  3TQY A;  3PO3 G;  4TQU S;  4A3B H;  4MZ9 A;  4LW1 A;  2Q2U A;  2VUM H;  1A62 A;  1CKO A;  2JA7 G;  3OW2 A;  1YIJ A;  2KBN A;  5HGQ A;  3STB D;  5M5W H;  4BXX G;  1BBW A;  2A1A A;  4JI8 L;  1X54 A;  5IWA Q;  4DV4 L;  1EYG A;  4L5T A;  4A4I A;  5IY0 A;  1Q82 C;  4X62 Q;  2LXK A;  1EWI A;  3U50 C;  1W2B A;  1Y14 B;  3E9H A;  4IPD A;  2ATW A;  4KHP L;  2L15 A;  3CCE A;  5FLX c;  2IHE A;  1HZA A;  3S17 H;  2UXB Q;  4DR2 Q;  2UU9 Q;  5GAE C;  1PH9 A;  1P16 A;  2CKZ B;  4NPS A;  4POG A;  2OCE A;  1SN8 A;  2R7D A;  5M3F H;  3J81 c;  2HIV A;  4DV2 Q;  4HJA A;  2OWO A;  4R1J A;  4GKK L;  4JYA L;  4LF5 L;  4QIW E;  1U0L A;  3WWV A;  3DM3 A;  2JA9 A;  2NN6 I;  5IYB H;  1S72 A;  2PMZ E;  4BXX H;  4JOI A;  3M85 A;  1VQO A;  1ASY A;  4JYA Q;  2Q2T A;  3M3Y H;  3PIO A;  3CCV A;  3SGI A;  3D0F A;  1OXV A;  4GNX B;  4YY3 Q;  3GTQ H;  2HT1 A;  3S14 H;  3GTL H;  3PO2 G;  4IPG A;  3W5O A;  4A3M H;  2YU9 H;  4X62 L;  3PF5 A;  2BH2 A;  5AJ3 L;  4JI4 Q;  3RN5 A;  3CC4 A;  4LF9 Q;  3F2C A;  3FKI G;  1N33 Q;  1K9M C;  5GQO A;  2PQA B;  5FJ8 H;  3GO5 A;  1KL9 A;  2WAQ G;  3HOY G;  4PZ7 A;  4DR1 L;  2PNH A;  4JV5 Q;  2ZTD A;  3LGJ A;  3A0J A;  1PH3 A;  4C3I H;  1XMO L;  2IX1 A;  1MJC A;  3HKZ E;  4P72 A;  1PH5 A;  1Y1V H;  3HKS A;  1VQM A;  2WB1 E;  2V1C C;  5GAH C;  3M4Q A;  1N33 L;  4LUO A;  4LFC L;  4JBJ A;  2ID0 A;  3UDF A;  3ULP A;  4JI7 Q;  4A3K H;  4YWL A;  2D0O A;  1Q1B A;  1X3F A;  3I4N G;  4DR4 Q;  5H1S E;  4X65 Q;  2E5L L;  4PMW A;  2B3G A;  3KJP A;  1V9P A;  3CCL A;  2IY5 B;  3TRZ A;  2KCM A;  3ERS X;  3J81 i;  3OTO Q;  1NMF A;  4BY7 H;  2F52 A;  3F2B A;  2UUB Q;  4HJ7 A;  2CWP A;  1B8A A;  4Y52 H;  2MNA A;  2ZJR A;  3S1M H;  2Y0S G;  4BBR G;  3H3V I;  3T1Y L;  1PH8 A;  2UUC L;  2F3I A;  4LF6 L;  3L0O A;  4GKK Q;  2F4V Q;  1E22 A;  1JMC A;  2E2H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...