3CP0A

Crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SPRALVGHRAEVLEDVGATSGQVRLDGSIWSARSMDPTHTFAEGEIVSVIDIQGTTAIVWKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane protein implicated in regulation of membrane protea
publication title The crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from Corynebacterium glutamicum.
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Membrane protein
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cp0A00
2PI2A 2HQLA 4JV5Q 3KF6A 5GADC 3GTOH 4DR7Q 2LXJA 1AE2A 1IYJB 1CSPA 2OCEA 3PUVA 4H02A 3CMEA 4HJAA 2BA0A 1I94Q 5HY6A 3GTQH 3S14H 1PH6A 2K50A 1VQLA 3HOYH 5JJKA 2A19A 4R4QA 2VW9A 2MO1A 4LW1A 4GNXB 4O2DA 1TXYA 1FJGQ 2PQAA 4GKJQ 1XMOL 4BXXH 2B3GA 1NMGA 1UWVA 5ELNA 3E9IA 4DV1L 4DUZQ 1YIJA 3Q8DA 4OX9L 4A3EG 1Q1BA 3TS2A 1K73C 3AQQA 1K8AC 3PV0A 3ERSX 1HNXQ 1OXUA 1OXTA 1Q82C 4BY7H 1PV4A 3UDFA 3K7AH 2I0QA 2HT1A 1I3QH 4DV5L 4LF5Q 1E24A 3RR5A 2EXDA 4B3ML 3HOYG 4OO1I 2VY3A 1SN8A 4IPHA 1H95A 1GO3E 4KHPL 3NBHB 4OX9Q 2UXBL 4P74A 4JI0Q 4BBSH 1KXLA 3CP0A 4B3SQ 3K0XA 4BXXG 1O7IA 4Y52H 1MIUA 4DR1L 4GS3A 4DR5Q 2RF4A 1CKMA 3AYHB 5M3MH 4LFCQ 1WI5A 3H0GH 3NENA 3I4OA 2UUCL 3LGJA 3T1YQ 5C4XG 1VQCA 2N49A 2YU9H 3CCMA 4LFAQ 2RHSB 4BY7G 2JEBI 2YV5A 4DV2Q 4GLAC 4JI1Q 2E2HH 1QUQA 3HKZE 1GVPA 1LTLA 1J5EQ 2JA7H 2VQEL 1A0IA 1Y1VG 2I5HA 4JI6Q 1IBML 1Y14B 2UXCQ 1U5KA 4DR1Q 3S1NH 4EQ5A 2KHJA 1W3SA 1VQ7A 1K9MC 3S24A 4ME3A 3F2CA 3HOUH 4DAMA 4A3LG 5ELOA 2GN5A 1VQIA 3S15H 1E7ZA 4L5TA 3F2BA 2B29A 3HOXH 1E3PA 2E2IH 3J7A5 1HJPA 1S40A 3JAMc 1HZ9A 1WJJA 2PI2E 3BJUA 1V43A 3JAMi 2UUAQ 3ULLA 1ASZA 1IBMQ 4DR3Q 1HNWQ 4JYAL 1VQBA 4OXPA 1XPOA 2MQHA 3ULPA 4HIDA 4A3DH 1D7QA 3G71A 1EQRA 3CCJA 4NXNQ 1VCIA 4JI5L 4LUVA 4JI2Q 4DR2Q 3PO2G 3UE0A 4NXML 4R4CA 1PH2A 4JI4L 3HOUG 1N9WA 1VQ6A 1WFQA 1Q81C 4J15A 3KF8B 4DV7L 4A3KG 2E8GA 5GAEC 1AE3A 4GKKQ 3HOXG 4JI7Q 5JEAG 1PH4A 4A3IH 1XNRL 1PFSA 3GDEA 4KI0A 2R6GA 5H1SE 3A5UA 4A3CH 2FXQA 4K0KQ 4DV4Q 1YEZA 3K81C 4IJLA 4BBRG 3CCQA 1MJEA 5JJIA 4LFBQ 4UP9A 1TWAH 5DLQE 2B63H 3F2DA 4IOCA 1EIYB 4NXMQ 3M4PA 1FL0A 3S1MH 4DV6Q 2JE6I 1Z9FA 1N34L 1PH1A 1IBLL 2KHIA 2ZM6L 4X6AH 3W5OA 3AFQA 2ZJRA 4JI3Q 3I2ZA 4LF8L 4DNIA 2K5HA 4YWLA 2F52A 4AYBE 3DM3A 4C3HH 3HOVH 3J81j 4R4IA 4LF6Q 2E5LL 2NN6G 3RZDH 4LF6L 2NZHA 3GTLH 1UE1A 4DUYL 2VS1A 2NZOA 4JV5L 3GTJH 1SFOH 2JA8H 4DR7L 4P72A 1VQOA 1Y1WG 2V1CC 1X6OA 3KJPA 1IXRA 1WYDA 2Y0SE 3PUYA 2EQSA 2WB1E 3CC4A 3HKSA 1XNQQ 2IY5B 1X3GA 2ZM6Q 1FJGL 5M5YH 1KD1C 3SGIA 4YHHQ 2B63G 3KLWA 4A3GG 3EBEA 2PMZE 4YWKA 4GKJL 4TVAB 2OQ0A 4DV3Q 2R93H 2KENA 4LWCA 3A0JA 3BU2A 3CCSA 2AMCB 3UE1A 4HIOA 4DUZL 2JA9A 2DGYA 2UUBQ 4DUYQ 3HOVG 1MJCA 4POGA 1PA6A 1HR0Q 1HNXL 4B3TQ 1CKOA 3KF6B 1KRTA 4L5QA 4A75A 4OWWB 5FLXc 2JA8G 3CW2C 2ES2A 2ZTCA 1N8RC 2R7ZH 2CCZA 4LF5L 4A3MH 3F1ZA 3G6EA 1GD7A 4OONA 2PQAB 2WFWA 3GO5A 3RNUA 1Z47A 3H15A 4YCVA 3CCEA 4HIMA 2H5XA 4JI0L 3M3YH 5IWAL 2VQFQ 4B3SL 1VS0A 1LM0A 4A3BH 2R93G 4C3JH 1EOVA 3T1HQ 4DR5L 3OYYA 5JJLA 4LFCL 1TWFH 3U50C 1GM5A 1VQNA 3PGZA 4GLXA 4A93G 1A62A 3T1YL 1BBWA 2JA6H 1VQMA 3KFUA 4LFAL 1X3FA 3H3VI 4QY7A 2ID0A 1G291 1X3EA 4DV2L 4JI1L 3ULJA 1J5EL 2WAQE 2R7ZG 1YBYA 4JI6L 3CCRA 4HJ9A 2AWNA 5IWAQ 1VQAA 1EIFA 2D0PA 4KLKA 2UXCL 3K7UC 1CSQA 4GN3B 2CWAA 2MO0A 4GN5A 4X64Q 4QGUA 1PH7A 4A3BG 4DKAC 2HIXA 2D62A 1MKHA 3CPFA 2UXDQ 4AQYL 4IPDA 3RN5A 1V1QA 5GAGC 3PUWA 1KIXA 3TEHB 2OTLA 2JA6G 3PCOB 2K5VA 2UUAL 1N33Q 4QIWE 1TWGH 2VUMH 4JBJA 4JI8Q 1E22A 3FKIH 3U4VA 4DR3L 1QUQB 1PH9A 1HNWL 1IBKQ 2UU9Q 1YHBA 3DLLA 2OTJA 1OTCA 4X65Q 4UPAA 3D31A 1L1OA 4R4OA 2IT1A 5IP9H 4NXNL 4BBSG 1YHAA 5EAYA 4AQYQ 3PO3H 5E7NA 2D0OA 1L1OB 1VQHA 5M3MG 3J7ZC 4DR2L 4JI2L 3H0GG 1G51A 1JJGA 1NE3A 4YY3L 1UE5A 5GROA 3CF5A 2NVTH 1B8AA 1NTGA 4BA1I 5AJ3Q 5JEAJ 4JBKA 1YI2A 3S2HH 4GKKL 1QZGA 4JI7L 3UDIA 4LF7Q 3ZJYC 4AYBG 1T9HA 3D0FA 1U0LA 2YTXA 4P71A 2JA7G 3PIOA 2VUMG 4K0KL 4WJ4A 1NMFA 2OQKA 5C4JH 4DV4L 3FKIG 1PYBA 1IL2A 3PSIA 4OO1G 1SLJA 1P16A 4KHZA 1VQ5A 4LFBL 1EWIA 4A4IA 2F3IA 4QQBX 5C3EH 5LMNQ 2JA5H 2F4VQ 2Y0SG 4QJFA 4YY3Q 5IP9G 3KJOA 1KQSA 2Q2UA 4DV6L 2NN6I 2QEXA 3PO3G 2N8NA 3FHWA 2R7DA 5M3FH 1NJIC 5IYDH 4O0AA 5C0XG 1KAWA 4OWTB 3M9BA 4JI3L 1W2BA 1KL9A 1HR0W 4L5RC 1LYLA 3A5ZB 4DR6Q 2ALYB 1WCMH 2IX0A 2ATWA 3L2PA 1VQGA 1YNXA 2R92H 2CKZB 1VQDA 1C7YA 2BA1A 4LF9Q 3PUZA 4NB3A 3HOZH 1X55A 1VQEA 2NVXH 4BY1H 3CCVA 4BA2I 3A74A 1G6PA 4A3DG 4HJ5A 3GTMH 2AHOB 4GOPA 1B70B 2HHHQ 3S1QH 2QGQA 4HJ7A 1XPUA 3CAMA 1XNQL 4RG1A 4X66Q 3S17H 3B6YA 4YHHL 2JA5G 1UE6A 5FJ8H 3PUXA 3TREA 2XTIA 2IHEA 4DV3L 1BKBA 3VDYA 4LF4Q 4GLVB 2JJQA 4A3FH 2XGTA 2CQOA 4XIGS 4AH6A 2NVYH 4A3JH 1JE5A 2UUBL 4YCWA 1N36Q 4JBWA 1XMQQ 4C2MH 4A3IG 1I50H 3K80C 3RLOA 1WCMG 3RN2A 4A3CG 2I5MX 3RLNA 1J6QA 4DAYB 1HR0L 2R92G 4DK6C 1S72A 4B3TL 3MXNB 3EN2A 3OTOQ 4NPSA 4FDBA 2ZJPA 4PZ8A 4LUZA 1BBUA 1SE8A 4LUOA 4P73A 5IP7H 5FJ8G 4YCUA 1QVGA 2L15A 3ER0A 4X62Q 2VQFL 1X9NA 1PH5A 5M5WH 3I55A 3F8TA 1S3OA 4A3FG 4DR4L 3T1HL 4R1JA 2R7FA 4JOIA 1N32Q 4JC0A 2AWOA 1NY4A 5LMUQ 1VQ4A 1JT8A 3L7ZC 4TQUS 3CC2A 1IZ6A 4UP8A 1SR3A 2Z0SA 1TWCH 3NEMA 3W1BA 3BZKA 1EYGA 3M85A 1A63A 3U4ZA 2I5LX 1SRUA 2CWPA 1X56A 5IYCH 1XPRA 1JJ2A 1CKNA 3HKZG 4UY8C 3G4SA 4A3EH 4YWMA 4DK3C 4B3RL 4P75A 4QL5A 4DPGA 1CUKA 4WJ3M 3RZOH 2K4KA 2YYZA 2LSSA 4DR4Q 4APVA 3CQZH 5IE8A 1K83H 2BH8A 5IP7G 4X64L 2YTVA 4IFDG 5GAHC 3HFZB 3I56A 2UXDL 1X65A 2A1AA 4GNXA 1YHQA 1C0AA 1L1OC 2JK8A 2K52A 2KBNA 3BZCA 1BVSA 1VQKA 1N33L 3HOWH 4B3RQ 1Q46A 4JI8L 1LUZA 4JG2A 5IYCG 3AFPA 4A3MG 2HIVA 5IYBH 5LMNW 4GN4B 3AEVA 1IBKL 2UU9L 4ALPA 3CC7A 2RHQB 5C4XH 4X65L 4MNOA 1PH8A 1VQPA 1Q12A 4XTCS 3U58A 1VQ8A 3CMAA 2VZAA 1RIPA 1QVFA 2LXKA 1UEBA 1YJ9A 2Z6KA 4HIKA 4LNQA 1Y1VH 2N78A 5AJ3L 1HZAA 1P8LA 2K75A 1XMOQ 2JEAI 3H3VH 4LF7L 1Q8KA 4PG3A 2MNAA 2K14A 4DV1Q 2KCMA 3L0OA 5K36G 3HOWG 1NBWA 1E1OA 5IY0A 3W1GA 1KC8C 1YJWA 1VQ9A 4A3LH 1AH9A 5FLMH 4IO9A 4UP7A 5IYBG 3PIPA 1OXVA 3CPWA 3GTKH 2N3SA 1TWHH 2EIFA 5C0XI 3CXCA 5LMNL 2F4VL 3M4OH 1KRSA 1YJNA 3I4NH 1V9PA 4DV5Q 5C0XJ 4GOPC 1RL2A 4B3MQ 1B7YB 1PHJA 3KYHC 1M1KC 4DR6L 4KHPQ 5M5XH 2UXBQ 2JQOA 4R4TA 2E2JH 2Q2HA 1HNZL 4LF9L 3OW2A 3M7NA 4A76A 3E0EA 3ICEA 3PO2H 2UUCQ 4RMFA 1JJCB 5FLMG 2WB1G 3IRBA 2HHHL 1KHIA 1DGSA 4A3KH 1PVOA 2VNUD 2QA4A 2Q2IA 2CFMA 4X66L 1VQJA 1EQQA 1HZBA 1SROA 4LF4L 3I4NG 2VQEQ 1OXXK 3KDFA 4BBRH 1K0RA 1HNZQ 5J3BA 1XMQL 1N36L 1PH3A 5IT9c 2BH2A 4AIMA 3KDFB 4IPCA 2VL6A 2ZJQA 1Q7YC 4DV0L 4JOIC 3OTOL 3CCUA 1JB7A 5BR8L 4GOPB 5C3EG 4IPGA 5C44H 1WOCA 3CD6A 1SMXA 4L5SA 1JMCA 3S16H 5M3FG 3WWVA 5IYDG 1Q86C 1K3RA 2ASBA 4PZ7A 5GQOA 4JYAQ 3MEFA 4X62L 1Y1WH 4POFA 3I4MH 2OWOA 4PMWA 4IJHA 3K8AA 1YVCA 1C9OA 3PF5A 1N32L 1VQFA 3NELA 1D8LA 4JI5Q 3M4QA 5LMUL 3S1RH 2WP8J 1HH2P 4DV0Q 3J80c 3HOZG 3EIVA 1M90C 2RCNA 2AKWB 3J80i 4BY1G 5BR8Q 1XJVA 5HGQA 4A3GH 1X54A 4JI4Q 3GD7A 3TRZA 2ZTDA 4JBMA 1EUJA 4DV7Q 4GNXC 2NVQH 1L2FA 3UDGA 3PF4A 1K8GA 2GVAA 2WAQG 3STBC 3J81c 1I5FA 2MFIA 3J81i 4IFDI 5C44G 4EX5A 2DUDA 1FGUA 3RLFA 2K5NA 4MTNA 1XNRQ 4PZ6A 4HJ8A 3GTPH 1FVIA 1E1TA 4MZ9A 1QZHA 3S2DH 1PYSB 2PNHA 1L0WA 3TS0A 4IFDJ 2Q2TA 3TQYA 4A3JG 2IX1A 4IOAA 2C35B 3UDXA 3CCLA 3G48A 2YTYA 4Y7NH 3I4MG 3FP9A 2KCTA 1I94L 4C3IH 1Q1EA 4OWXB 1N34Q 1EFWA 3GTGH 1IBLQ 1OXSC 1XTDA 2A8VA 3STBD 1QVCA 1YZ6A 2Z6KC 3E9HA 4LF8Q 2GVBA 3JC66 3I7FA 1ASYA 1HZCA 1CKNB 1UE7A 1I6HH 2ZTEA 1YITA 3KOJA 4JCVE 2E5LQ 1R9TH 1GKHA 1A8VA 2IHFA 4A93H
chains in the Genus database with same CATH superfamily
5J22A 5KNDA 2CW0D 2IPKD 1D5ZC 3AU7A 3GTOH 1PXUA 1CSPA 2OCEA 3PUVA 1I94Q 5I2YA 5T1IA 4OL7A 2VW9A 4GNXB 4O2DA 1TXYA 2F0MA 3EA6A 4RGOS 1O7ZA 4BXXH 2B3GA 3RUZA 3HP3A 2IL8A 1YIJA 3Q8DA 2WIIB 3JAML 5ELFA 1K73C 1ONLA 3ERQA 3K7AB 5IGEA 1PV4A 1L0YB 2X69A 5FO9B 3K7AH 2I0QA 1SXTA 1S5ED 2JSOA 1K3BC 3HOYG 2RDFA 2E76C 4IPHA 4U673 1GO3E 2L1BA 4JI0Q 3SK8A 3CP0A 2JYOA 1STYA 2F0KA 3L9AX 4LFCQ 1AEXA 2UUCL 3T1YQ 2H1EA 4OELB 4BY7G 2JEBI 4GLAC 3HKZE 2I5HA 4DNRB 3NP8A 1IBML 2UXCQ 1SYCA 5FK9C 3HOUB 3BZDB 2CH4W 1K9MC 3S15B 4IURA 3HOUH 5EPJA 4DAMA 3HOXB 4A3LG 5EJWA 3S15H 1E7ZA 1PMRA 3HOXH 1D5MC 1DOKA 5JOBA 1SE4A 1ENFA 1IBMQ 1VMCA 4L8JA 1D6EC 1XPOA 2IWHA 3ULPA 1HA5A 4HIDA 3DWQA 1T5EA 1EQRA 3CCJA 1PFBA 4FNFA 4DR2Q 3NWTA 3SR1A 3UE0A 4R4CA 1PH2A 1WFQA 3R2IA 1Q81C 4GKKQ 4A3KG 1SYEA 1PH4A 1EY9A 3GDEA 4KI0A 5H1SE 1BCPC 3QB3A 4DV4Q 4DA2A 1YEZA 3K81C 4IJLA 4BBRG 4HEDA 1ILPA 2QF7A 2B2VC 5ELEA 1LT3D 1QILA 4IOCA 4IUVA 2PW5A 4DV6Q 3NE5B 1Z9FA 3A8KE 1PH1A 1IBLL 3WOEA 1ZEQX 4C3HB 3W5OA 2AQ3B 1TS3A 1QG7A 1U4RA 1X32A 2RDGA 3A7AB 3DM3A 4C3HH 3J81j 4DAPA 2D2CC 2DN8A 5FO7B 5C3XA 2VS1A 1W6JA 2J0TD 4DR7L 1Y1WG 1X6OA 2Z8LA 5BN3A 1XNQQ 2IY5B 1X3GA 5LL6X 4FXKC 4A3GG 2B63G 4EGVA 4GKJL 2PMZE 1EWCA 3MXPA 1CHPD 1QJOA 2OQ0A 4DV3Q 3BU2A 1FNVA 4DUZL 3U9SA 1DCZA 4IFDH 3HOVG 1D5XC 4POGA 1HR0Q 1HNXL 3X3MA 2R7ZB 2G9HD 1V1PA 1EEID 1N8RC 2R7ZH 2CCZA 3G7LA 4C3IG 3G6EA 5IGCA 1SYBA 3RNUA 2A5HA 5JPMC 4ZRZA 1NUCA 4B3SL 2R93G 2B2WA 3FRPB 4DR5L 3VR5A 5JJLA 2MP1A 1NSNS 2K5DA 2J4XA 1JOQA 1Y8NB 4F7XA 4O1NA 4LFAL 1X3FA 3H3VI 1PFMA 1G291 4DV2L 3T53B 4JI6L 4F88A 3CCRA 4HN7A 4HJ9A 1VQAA 4GN3B 2KVMA 2CWAA 3FDTA 4CHTB 3R93A 1PH7A 1AZPA 4A3BG 2HIXA 3CPFA 1Y8OB 3PUWA 1KIXA 1DYQA 4QUFA 2JA6G 2IW3A 5C5MA 2F0PA 3OIPA 1EZ6A 1E22A 4JI8Q 2NWGA 5C4ZA 5EGTA 1WD1A 1QUQB 1YHBA 3TZDA 1OTCA 3VA7A 1CA6A 4R4OA 2KEDA 3X3NA 4JI2L 3S2HB 2F0QA 5GROA 4P2CB 2X6LA 1B8AA 1IYUA 4BA1I 4JBKA 3S2HH 3UDIA 5CBEE 3NTKA 3Q0AA 3ZJYC 4LF7Q 1DD2A 1I4RA 1U0LA 5C4JB 2VUMG 1MI2A 3FPUB 1LT4D 1NMFA 5C4JH 1IL2A 3PSIA 1VQ5A 4QQBX 4LFBL 4A4IA 2F3IA 4KY5A 3F2UA 1TVXA 2Y0SG 1VDZA 4QF4A 2NUCA 2Q2UA 2QEXA 3UI2A 2R7DA 3Q22A 4CJ0B 2PZTA 1KAWA 1SSOA 3MTSA 1CQVA 2R92B 3A5ZB 5ELCA 3HOZB 3OHXC 2NVXB 2R92H 2B2TC 1VQDA 3HOZH 2BA1A 2NVXH 1VQEA 3K0YA 4RGMA 1G6PA 4HJ5A 2WAQB 3S17B 1HXYD 5KGUA 1XPUA 3CAMA 4RG1A 1C8CA 4X66Q 3S17H 2F0JA 1U4MA 5EPLA 1BKBA 4LF4Q 4F87A 4GLVB 3C3LA 4C2MB 2XGTA 2CQOA 3H94A 1ZXTA 4XIGS 1JE5A 3SK6A 1PTOC 1SMYD 4JBWA 4C2MH 1XMQQ 2Z9HA 3A56A 1O80A 1SJED 1WCMG 3RLOA 4A3CG 2I5MX 1YNNC 3K58A 3MXNB 4KN4C 1EFID 2A74C 2HCIA 2L55A 5I9OA 4NPSA 5HGTA 1Y69U 1E0BA 2G9DA 4FDBA 1BBUA 4R8NA 5IP7H 5FJ8G 4YCUA 2L15A 1PDQA 5I6WA 3HEJA 1S3OA 4DR4L 4R1JA 1CHQD 2R7FA 1CM9A 1N32Q 4G57A 2AWOA 1JT8A 4TQUS 1JWMD 3LWUA 4PNYA 4A3MB 3W1BA 3MFGA 3M85A 1EY6A 5E4WC 3U4ZA 5DNFA 1ET6A 4ULLA 2CWPA 2KOLA 3HKZG 3G4SA 5EPKA 4B3RL 1BQQT 3PIO3 4WJ3M 1B53A 1TKWB 2YYZA 1CFMA 5KYIA 4HTHA 4DR4Q 5IE8A 5GAHC 3HFZB 3J80E 3EJIA 2FHTA 1YHQA 2EXZA 1PZKD 2K52A 2VXWA 1BVSA 4B3RQ 4BS9A 1Q46A 5IYCG 5IYBH 1EY4A 4GN4B 2UU9L 5IOCA 4ALPA 2PZWA 3I70A 4X3UA 2HD3A 1WTWA 4EVOA 1EZ8A 2LXKA 1H9KA 3BG3A 1UEBA 3DM1A 1IW7C 1YJ9A 4HIKA 1HA6A 4C56C 4LNQA 2N78A 3A8IE 3H3VH 3OSOA 1Q8KA 3L0OA 1U4LA 1FNUA 5D3DA 3HOWG 3W1GA 4A3LH 2NYZD 1AH9A 4UP7A 3FVQA 4XT1B 1SE3A 2EPBA 2EIFA 2F4VL 1CT1D 3P20A 1S5CD 4DV5Q 1TR5A 3OWFA 3J7YW 1PHJA 1SNOA 3J80L 3EFXD 3VYRA 1PRTB 2BOSA 1HNZL 2ZXRA 3BDOA 3VYTA 4A76A 1FR3A 1JOKA 4A3KB 2F1MA 4A3KH 1DGSA 4FVMA 1VQJA 1RDPD 4I7ZC 1HZBA 4BBRB 3NQIA 3I4NG 3W3AA 2EYMA 1EIHA 1SNPA 3VYSA 3KDFA 2PCFB 4BBRH 2X6GA 1HNZQ 3OW7A 5J3BA 1N36L 4FF3A 3KDFB 4G7OC 3OIQA 4CDEC 2A6HD 1Q7YC 4JOIC 4DFAA 4ZYSA 4IPGA 3CD6A 2JN4A 1JC7A 1Y1WB 3I4MB 5JPNC 4JYAQ 2PO4A 1LABA 1Y1WH 4POFA 3I4MH 2OWOA 4IJHA 2O2LD 3NWSA 4EQPA 3PF5A 4A3GB 1H9SB 4A3GH 1HTLD 2AKWB 5HGQA 2DJFC 2A68D 4JI4Q 2ZTDA 4ZKBB 3UDGA 2GVAA 3J81c 1ICFB 1S5DD 3J81i 3S2DB 3RLFA 4PZ6A 4MZ9A 3S2DH 2PNHA 4Y7NB 4IFDJ 3TS0A 1F9QA 2F3VA 5DM73 2IX1A 2PPBC 4Y7NH 3FP9A 4C3IH 1E2ZA 1A2UA 1EFWA 1I6HB 1ASYA 1YNJD 1CKNB 1I6HH 2MUYA 4PQXA 1YITA 3KOJA 4QJFA 4LF6Q 2B2VA 2NB0A 2PI2A 4JV5Q 3FPPA 3KF6A 3GTQB 4H02A 3I4LA 4I7AA 5ELBA 5HY6A 3GTQH 1B3QA 4MTKA 5E4XA 4RGTA 2MO1A 1F9SA 1STHA 3GV6A 4DV1L 4PV1C 1LTBD 1K8AC 3ERSX 1OXUA 1AN8A 1I3QB 1U9RA 2NBFA 1EQTA 1I3QH 4LF5Q 3RR5A 1A3VA 2EXDA 4MHEA 4B3ML 4OO1I 1ILQA 1I4XA 2F4IA 1H95A 2KCCA 2UXBL 1QE6A 2F0TA 2F0IA 4P74A 3NTHA 1WTVA 4XQQA 2EY2A 4DR1L 4I65A 1LACA 3BDLA 1CKMA 1QWYA 3ND9A 1V1OA 3NENA 3DXJC 5C4XG 3MEHA 1GUSA 2N49A 1LTTD 3N52A 3QJYA 2ENBA 4QMGA 5DAUA 2F0OA 2E2HB 4KKSA 2E2HH 1GVPA 1LTLA 2VQEL 3S1NB 4ZK9B 1BO0A 1ENAA 1Y14B 4OIJA 3HG9A 5G3LF 1U5KA 4DR1Q 3S1NH 1W3SA 3VA5A 1DZ1A 1B9MA 4ME3A 4L5TA 4CGYB 3BYYB 1HQMC 3J7A5 1GUWA 2UUAQ 1HZ9A 1WJJA 2PI2E 1CQFA 1V43A 4CDCC 4ILWA 4DR3Q 3H09A 3AB9A 2M9VA 4J6HA 1D7QA 4KHVA 2K5QA 2ZXPA 3QOLA 4KKTA 5ISRA 1CTMA 2RSOA 1H9MA 1N9WA 1VQ6A 3ITPA 4J15A 4DV7L 2E8GA 5GAEC 1KLGD 4JI7Q 1QCBD 1R4PB 5FLXL 1XNRL 3OOCA 2K03A 4A3CH 3A5UA 4K0KQ 4R9WA 2K04A 2FXQA 3NQTA 1TWAB 3LNNA 4IQZA 1MJEA 4LJZC 5JJIA 3NPPA 4UP9A 5EKLA 1TWAH 1BF4A 2BE5D 1EIYB 4N8X1 1MBYA 1N34L 4FXGC 2KHIA 2ZM6L 5EBDA 1LTGD 4X6AH 3AFQA 4JI3Q 3RZDB 4H13C 4N9PA 2WINB 5F2DA 3KLSA 3RZDH 3GTJB 2JA8B 1UE1A 2NZOA 4UHVA 3URYA 3GTJH 2JA8H 3HKZB 2V1CC 1WYDA 1HCZA 2Y0SE 4KY6A 5T1GA 2EQSA 4G4KA 3CC4A 2MGSA 3J7AF 2ZM6Q 1JCKB 2LKVA 4YHHQ 4YWKA 1ESRA 2B2TA 2EOTA 4TVAB 3GP7A 3TP7A 2UUBQ 5BN4A 2F0VA 3OPOA 1DXMA 2KUMA 4NDXA 4L5QA 4A75A 5JAVA 1LT5D 2FFKB 1JR0D 4X3KA 3HGBA 2XWBB 1E2WA 2ZT9C 2WV6D 2WFWA 3GO5A 3P1HA 1Z47A 1FNWA 5IGDA 3H15A 4YCVA 3FMCA 1O78A 4HIMA 2H5XA 4JI0L 5IWAL 1JWSD 1A2TA 1VF5C 1VS0A 1EOVA 3T1HQ 1AZQA 3OYYA 4LFCL 3I73A 1GM5A 3PGZA 4WRDA 1RKNA 1VQNA 3T1YL 1VQMA 5EQ0A 2ID0A 5G3LD 4CBVA 4CKBA 1K8OA 3TDQA 3EVQA 4NKLA 1DM0B 1Z6HA 2XSCA 1EY8A 5IWAQ 2UXCL 4KLKA 1G2SA 2EYFA 1SEBD 3DWPA 1CSQA 2CHBD 1XWEA 2F0WA 4QGUA 3C46A 4KKUA 1F77A 2UXDQ 1MKHA 1V1QA 1UAPA 1TWGB 2SDFA 1HPCA 2OTLA 3PCOB 4K6DA 4QIWE 1TWGH 2NTSA 3L3OC 4PMBA 4OO1H 3CRLC 1PH9A 1IBKQ 4RCNA 4X65Q 4KV6A 3D31A 5IP9H 2IT1A 2PMZB 5I2XA 2F0HA 5EAYA 3QG1A 5E7NA 1VQHA 5M3MG 3J7ZC 4DR2L 3H0GG 1NR4A 3BVMA 2LS01 5AJ3Q 4GKKL 2NZ1D 1YI2A 4RHSA 1QZGA 1ICWA 4AYBG 1T9HA 4H44C 4ZCKA 2K6AA 2JA7G 3PIOA 1I6VC 4DV4L 3FKIG 1PYBA 2JA5B 1P16A 4KHZA 1EWIA 5LMNQ 2JA5H 5KNCA 3A7LA 4DV6L 2L12A 3PO3G 5L37A 2K01A 1NJIC 2Q8IB 5C0XG 5BN5A 4OWTB 4XQJA 1W2BA 1HR0W 3FEWX 2ALYB 1YNXA 4LF9Q 1X55A 2G5DA 3ZYYX 3A74A 2BDOA 3CCVA 1F9RA 3VR3A 5CGKA 2AHOB 3H91A 1B70B 3Q6SA 1XNQL 5J1ZA 3B6YA 4A3FB 3PUXA 4DV3L 2JJQA 4A3FH 2EY6A 4AH6A 4YCWA 2FMCA 1HR0L 1J6QA 3MXGA 5CV6A 3M4YA 1KDCA 1WTRA 3QIAA 2ZJPA 3BYTB 4RFBA 1RCVD 4LUOA 5M5WB 1YNJC 4MIUA 1H9RA 2F0SA 4X62Q 1HUNA 4TKOB 1F9PA 5M5WH 3I55A 1F2MA 4JOIA 4JC0A 1NY4A 1VQ4A 1S5BD 3WDNA 3QO2A 4M8AA 5A2QE 3CC2A 1SR3A 1TWCH 1TU2B 1V1PB 2VB3X 3ONAB 1C48A 1PFNA 1K0SA 5IODA 2BDNA 4LAAA 4RCOA 4DPGA 1CUKA 1K83B 4C1NI 1V8QA 1K83H 3I56A 4QB4A 1EU3A 3BZCA 4HMJA 1L0XB 4B08A 1NCVA 4JI8L 2KQ3A 4JG2A 2QILA 3AFPA 2HIVA 5C4XB 3AEVA 3CC7A 5IGBA 5C4XH 3C1EA 1VQPA 1Q12A 1VQ8A 3J7AV 1HQRD 3E5SA 3HRZC 4JW0A 1QOHA 4KJNA 1HZAA 1P8LA 2K75A 3NBHA 2Q8RE 4H7BA 1XMOQ 4LF7L 5A2QL 2MNAA 5LHY1 3IFTA 1DJRD 2D9UA 1RD9D 2WB1B 5K36G 1NBWA 2OEOA 1KC8C 2QDLA 1I4QA 1OXVA 5C0XI 3MWYW 2MHVA 1STAA 1B3AA 4GOPC 3ND8A 1LV9A 4KHPQ 3VYUA 4LK1C 4R4TA 1D1KA 1WTOA 3KLSX 4RA8A 1T5XD 1MD2D 1PRTF 4RMFA 5FLMG 1KHIA 2A6ED 5D14A 1H9JA 4X66L 1E2VA 4QCLA 1SROA 4LF4L 3IL8A 1SNQA 2D5DA 3RD4A 1XMQL 4IPCA 2EYOA 2VL6A 3BDCA 5CMDA 5C44B 3NTIA 1JB7A 3KF8A 2BE5C 5C44H 5CV5A 2AQ2B 5CV4A 1D1IA 2I07B 5M3FG 1Q86C 1EL0A 1K3RA 5GQOA 1RJTA 1JOOA 2E2DC 2IX3A 1D2BA 4JK1C 1M4VA 4PMWA 1RF2D 1YVCA 1C9OA 4B9WA 1N32L 3NELA 4JI5Q 3M4QA 4ME5A 3EIVA 2RCNA 1Q8IA 4BY1G 2NVQB 3GD7A 1EWHA 1EUJA 2B8GA 4IUTA 4GNXC 3NSWA 2NVQH 3PQIA 2SOBA 2WKDA 2MFIA 3V2TA 3DWAA 4JVZA 1Q90A 4RKLA 2M00A 4KTAA 3SE0A 1FGUA 4EX5A 4MTNA 3GTPH 1QZHA 2Q2TA 2CW0C 4A3JG 3K57A 2YTYA 4DGZA 2KCTA 3D4WA 1Q1EA 5KEEA 1BXTA 5I4DA 2A8VA 3STBD 3E9HA 4LF8Q 3JC66 4M1UB 2C5CA 1WVLA 1XXGA 2VB2X 2E5LQ 1A8VA 2H4OA 2HQLA 1GUNA 3D8GA 1QB5D 5GADC 3HOYB 1AE2A 4HJAA 2B39A 3CMEA 2BA0A 2K50A 3HOYH 2A19A 4R4QA 4LW1A 1FJGQ 5COYA 4NW2A 2PQAA 2K5WA 1NMGA 5ELNA 3E9IA 4L63B 4EQOA 4KD4A 2EDGA 2Z4IA 1NNXA 3TS2A 2O5JC 4BY7B 2DJGC 4FYDA 1KABA 3BS1A 4BY7H 3UDFA 2F0FA 2HT1A 4DV5L 3KUPA 3DHQA 1PRTD 5M3MB 3MZ5A 4BXXG 3T4AC 1EYCA 1ENCA 3M7GA 5M3MH 2YU9B 1WI5A 3H0GH 1VQCA 1SYGA 2YU9H 3OWEB 3GTOB 3SVMA 2RHSB 4X3SA 3IFDA 2JA7B 5FO8B 4JI1Q 1J5EQ 2JA7H 1Y1VG 4HCSA 2EE1A 2PQEA 1S4ZA 1CZWA 1VQ7A 2XIWA 3KLRA 3S24A 1TQOA 5ELOA 2GN5A 1VQIA 3F2BA 2B29A 1E3PA 5C0XH 3S9WA 1HJPA 5JVG3 3K59A 1KDBA 3JAMc 3JAMi 3K6OA 3ULLA 1MSHA 5C6AA 1HNWQ 4JYAL 1LTRD 1VQBA 4FF2A 5DM63 5NUCA 2L0CA 3N6RA 3G71A 2TSSA 3T13A 4NXNQ 1VCIA 4LUVA 2DNEA 5C4HA 4YIJA 3PO2G 1JQYD 4ZAIA 4NXML 4JI4L 3HOUG 1KDAA 1AE3A 3HOXG 5JEAG 2JXMB 2R6GA 3CHBD 1EYAA 2B63B 1EU4A 5DLQE 2B63H 3F2DA 4NXMQ 3M4PA 3NBIA 2JE6I 3NHHA 3HOVB 4DAVA 1SBBB 2EJGC 3HOVH 2K5HA 4YWLA 4AYBE 3GTLB 3EQLC 4R4IA 4RAUC 1BCPD 4LF6L 2NZHA 3GTLH 4DUYL 4JV5L 4V190 4C3IB 2OF1A 4P72A 2PW7A 1ESFA 3HKSA 2R93B 2V4DA 4IUNA 1KD1C 3SGIA 3KLWA 3EBEA 2SEBD 2R93H 2SNMA 2KENA 3A0JA 3CCSA 3UE1A 1BCPB 4FP5D 2JA9A 4DUYQ 2KECA 4CKCA 1MJCA 2XVSA 4C3HG 2IJ0A 1A3TA 4B3TQ 3KF6B 1UUPA 3CW2C 2C9OA 5EKKA 2ZTCA 2ES2A 4IALA 4LF5L 2O4XA 3F1ZA 4OONA 4A3BB 3M3YB 1R4QB 1RTNA 3CCEA 1EEFD 4A3BH 3M3YH 1TWFB 5IGFA 2VQFQ 1AFPA 2JA6B 1TWFH 4RKBA 4A93G 4GLXA 1BBWA 1PTOF 2JA6H 1C4QA 5TSSA 3KFUA 1WD0A 4O42A 2PYKA 3DEPA 1VF7A 3ULJA 5HURA 2R7ZG 2RSNA 1CI3M 2AWNA 1GHJA 2K33A 2MO0A 4X64Q 5DEHA 3GQBA 4KY7A 2RA4A 4Q0FA 4DKAC 1HUMA 3RN5A 2VUMB 1UNSA 3OMCA 2K5VA 2UUAL 3BVGA 1N33Q 2VUMH 3TN2A 1LT6D 1KNAA 1EY7A 4DR3L 1TT2A 1EYDA 2Y0SB 3DLLA 2DNCA 3MVVA 4U68A 4BBSG 2N55A 1PYWD 1NE3A 4YY3L 1UE5A 2EJMA 3CF5A 1EIGA 4B9XA 2A6EC 2XNAC 1SJHD 2GA4B 1A15A 3W2DA 4JI7L 4NP5A 3D0FA 1LO5D 1II3A 3BVZA 4K0KL 2OQKA 5FOBB 1FD7D 1SLJA 3E0JA 4ZUIA 1TS2A 4YY3Q 2EYPA 5D3IB 2N8NA 5M3FH 1GOZA 2F0DA 3PMFA 1WCMB 4JI3L 2EJFC 2F0EA 3M9BA 1KL9A 3V05A 1LYLA 4DR6Q 1DONA 1WCMH 2IX0A 1IHZA 3L2PA 2CKZB 4BY1B 1J8IA 4TSSA 1SMYC 3PUZA 3D4DA 4BY1H 4BA2I 4A3DG 1A6XA 2ICIA 3GTMH 3MAQA 4GOPA 3CU7A 2HHHQ 2F3WA 1BR9A 5EKIA 4YHHL 5FJ8H 5JJZA 2IHEA 4CKEA 3VDYA 4FF1A 4A3JB 4UDUC 4XDXA 1HTPA 3IAYA 4A3JH 2UUBL 5CV8A 1I4GA 4A3IG 5CBAE 2L9HA 3K80C 3RN2A 1EY0A 3RLNA 2R92G 4DK6C 3TP5A 2RQXA 3OTOQ 4EQNA 4ZUJA 1XX8A 4RHRA 2B2UC 4LUZA 4P73A 1QVGA 1PTOD 3DEOA 3ER0A 1AW7A 1X9NA 1PH5A 2SNSA 1HRJA 3F8TA 3T1HL 1YNND 5LMUQ 1IZ6A 4UP8A 1EYGA 3BZKA 1XTCD 1A63A 2I5LX 5IYCH 1JJ2A 1X56A 3H3VC 4UY8C 4FXDA 3RZOB 4YWMA 4DK3C 4P75A 4DK1A 4QL5A 3I8ZA 1PTOB 3RZOH 3SXHA 1PTOH 3QWNA 4APVA 5IP7G 2YTVA 4K2LA 2UXDL 4RH6A 1X65A 2A1AA 4GNXA 4NMZA 1L1OC 3NXWA 3HOWB 3TMEA 1GXDC 2HDLA 4HR7B 1VQKA 3HOWH 3J81E 1FYCA 5KNBA 4A3MG 5LMNW 4WORA 1IBKL 1PRTC 2RHQB 4X65L 1PH8A 5IIFA 2RDHA 1BUVT 3CMAA 2VZAA 3VR6A 4C3JG 1KAAA 1QVFA 3SK5A 1Y1VB 2L11A 3T56B 1JB3A 1Y1VH 5AJ3L 3I91A 2WKCA 4J8QA 1STNA 4PG3A 1GUTA 2KCMA 1TY2A 5I9PA 1E1OA 1TS5A 3VR4A 1YJWA 5IYBG 3SK4A 3QR8A 2KEEA 3M4OB 3I4NB 1B1ZA 3CKIB 1QNUA 3CXCA 5LMNL 3M4OH 1IW7D 1YJNA 3I4NH 1O7LA 1V9PA 4KD3A 5C0XJ 3K5NA 1BNZA 5M5XB 3KYHC 1SDFA 3CRKC 3AMUA 1JORA 5M5XH 1WTPA 2Q8TA 3PO2B 1OO9B 3KBGA 1EOTA 4LF9L 1CK1A 3M7NA 5ELDA 3J81L 3E0EA 3K5LA 3PO2H 2UUCQ 1KTKA 4XYOA 1JJCB 2A6HC 2O5IC 1B4OA 4ABNA 3IRBA 5FKAC 2VNUD 2Q2IA 5JEAH 1ET9A 3E3XA 2EYLA 2RKSA 4K8IA 4QUCA 1DOLA 2DY8A 2M2LA 2BH2A 1PH3A 5IT9c 4IUUA 4ODGA 1SYDA 1JWUD 2FMMA 2K7VA 2A68C 4MN3A 5C3EG 2EYJA 1SMXA 5I6YA 3R2TA 1Z7TA 5CORA 5IYDG 2ASBA 5AFWA 4PZ7A 5IGGA 2N88A 3MEFA 4X62L 1G6ZA 3S1RB 5A35A 1U4PA 4CDDC 1VQFA 5E3FA 2E75C 3S1RH 4OHJA 2WP8J 1HH2P 5C5LA 3J80c 3J80i 3A55A 2E74C 4DK0A 3R3OA 3TRZA 2ICEC 1I5FA 1KNEA 2B2YC 1RTOA 2K5NA 4HCEA 4HJ8A 1FVIA 1E1TA 3PIP3 4OIKA 1PYSB 2RVLA 1L0WA 1TWCB 3TQYA 1CZGA 4IOAA 2C35B 4HSVA 3UDXA 5M9OA 1EY5A 3CCLA 2KJXA 2LMCB 3G48A 3I4MG 3GTGB 1SNCA 3MFYA 4OWXB 3GTGH 1IBLQ 1OXSC 1YZ6A 2Z6KC 4A93B 2ZTEA 4JCVE 5CV7A 1SAPA 2MPMA 4A93H 1MHWC 3P7JA 3S14B 3MA2B 4DR7Q 2LXJA 1IYJB 4L6TB 3S14H 2F0NA 4LMQD 1PH6A 1VQLA 5JJKA 1WTHA 4OGQC 1RHPA 4GKJQ 1XMOL 5JVH3 1UWVA 3Q24A 3EROA 4IUQA 3VR2A 3D4RA 4DUZQ 5KYLA 1STGA 4OX9L 4A3EG 4HMIA 1Q1BA 1TS4A 3AQQA 3PV0A 2RCFA 1HNXQ 1OXTA 1SE2A 1Q82C 1BBXC 4Q5VA 1STBA 1E24A 2VY3A 1SN8A 2B8FA 4BBSB 2Z4HA 3NBHB 4KHPL 4OX9Q 1KXLA 4BBSH 4B3SQ 3K0XA 1O7IA 4Y52H 1MIUA 4GS3A 4K5WA 4DR5Q 2RF4A 3AYHB 2XRQD 3I4OA 4DXGA 3LGJA 1SNMA 1DOMA 3CCMA 4LFAQ 2FINB 3QOJA 4RWSC 4K2KA 2YV5A 4DV2Q 1QUQA 2PNRC 1A0IA 2A69D 4JI6Q 4Z9CB 4EQ5A 2KHJA 2K28A 3F2CA 2CVRA 4XYQA 2E2IB 4H0LC 2E2IH 3KBXA 5KRUA 1S40A 3D6CA 3BJUA 2AQ1B 2HDMA 5D65A 2F0UA 1ASZA 2K1BA 4A3DB 4OXPA 1MGSA 1TIID 2MQHA 3U9OA 4GZYC 4A3DH 4G7HC 4JI5L 4JI2Q 4TRDA 2F03A 3KF8B 4A3IB 1HFNA 3IKJA 1Y8PB 3D6WA 4A3IH 4F8MA 1PFSA 1K8MA 4ID6A 1HHVA 3CCQA 4LFBQ 3S1MB 3C2PA 3NK9A 1FL0A 3S1MH 4HSPA 2BCOA 1AP0A 1IKLA 2Z1CA 2ZJRA 3GTPB 3I2ZA 4LF8L 4DNIA 2F52A 3HS0C 3OMGA 2E5LL 2NN6G 4IUPA 4BWGB 1SFOB 5KIXA 3MXNA 2DY7A 1SFOH 1VQOA 1LTSD 3KJPA 1IXRA 3PUYA 1ZYRD 5M5YB 1HFGA 1S5FD 2WB1E 2K05A 1FJGL 5M5YH 4K14A 4LWCA 4HIOA 2AMCB 2Z6BA 2DGYA 2EVBA 4K5VA 5IT9E 1ML0D 3I3CA 1B44D 2QW7A 3TP6A 1PA6A 1BCPF 1CKOA 4KMUC 1KRTA 2KHSA 2QKIC 4KK7A 4OWWB 5FLXc 2JA8G 4K8JA 2EY1A 1F2ZA 4A3MH 4K6LA 1GD7A 2PQAB 4C3JB 4DF7A 5LL6S 4WFN3 1LM0A 1W6KA 5CR3A 4C3JH 4OEMB 2QCPX 4UAIA 3U50C 1A62A 2XWJB 2B2UA 4QY7A 3KK7A 4PMCA 1X3EA 3T51B 4JI1L 4ZKCB 2J7ZA 1J5EL 2NTTA 2WAQE 1BOSA 1YBYA 1JICA 1EIFA 2D0PA 2FJ2A 3H0GB 3NUCA 3K7UC 2EYHA 1PZID 4C1NK 3MXUA 2AUKA 4GN5A 2LFNA 2D62A 4AYBB 4AQYL 4IPDA 5GAGC 3TEHB 5IT9L 3HZXA 5J39A 2TMPA 1LLRD 3FKIB 2HCCA 1QNKA 2P5ZX 4JBJA 2LY7A 3FKIH 3U4VA 1HNWL 2UU9Q 4X3TA 3TSSA 2PZUA 4XQNA 2OTJA 1EQVA 4KJOA 4UPAA 3PO3B 1L1OA 4NXNL 1YHAA 4AQYQ 3PO3H 2D0OA 1L1OB 1JJGA 2NVTB 1G51A 2NVTH 1NTGA 5JEAJ 1KLUD 2OXPA 1GUOA 2YTXA 4P71A 1Q3LA 4WJ4A 1A3UA 4OO1G 5C3EB 2QEJC 1X3QA 1X3PA 1F2LA 5C3EH 2F4VQ 5IP9G 1IL8A 3KJOA 1KQSA 2ZXOA 2NN6I 2XRSD 3FHWA 5IYDH 1UEAB 3C1FA 4O0AA 4S3SA 1VMPA 4L5RC 3DUZA 2OT2A 5CV9A 2ATWA 2I46A 1VQGA 1J9OA 1C7YA 3I90A 4XT3B 4NB3A 1GHKA 1JE4A 3S1QB 1STEA 3S1QH 2QGQA 4DN4M 1K28A 4HJ7A 2JA5G 3I72A 1UE6A 1IYVA 3TREA 2XTIA 2NVYB 1FGBD 1CA5A 1PZJD 1I50B 3E6ZX 2NVYH 3A54A 4DAYA 1N36Q 1H9SA 1I50H 1B50A 4DAYB 4B3TL 1S72A 2B2WC 3SDZA 3EN2A 1G91A 2HQEA 1XYIA 3V96A 5EBCA 2KA7A 4PZ8A 3P75A 1SE8A 2VQFL 4A3FG 4IN3A 1MSGA 2EY5A 3MHBA 3L7ZC 2AUJD 2Z0SA 3NEMA 4N8FA 2QDBA 5E1FA 4A3EB 1SRUA 1XPRA 3Q23A 1CKNA 4A3EH 1TY0A 3CQZB 2K4KA 3TZUA 2LSSA 3CQZH 2BH8A 4X64L 5CYUA 4IFDG 5K5PA 3GV3A 1ZKOA 1C0AA 2JK8A 4J1MA 2B2YA 2KBNA 4CDFC 5K36H 4CJ2C 1N33L 1LUZA 1B2TA 4KN7C 3D3RA 1GJXA 4MNOA 1GUGA 3H6MA 3MC0B 4XTCS 3U58A 1RIPA 4DNTB 4JPBW 2Z6KA 2KCNA 3K5OA 2XN9C 3T16A 2JEAI 2K14A 4DV1Q 2A69C 5IY0A 3GTKB 4V0BA 1I4PA 1TWHB 1VQ9A 5FLMH 4IO9A 3PIPA 3CPWA 4N9TA 3DMUA 3GTKH 2N3SA 1TWHH 4DXFA 5C3WA 1NAPA 1KRSA 5FLXE 2L4NA 1O7YA 3LX0A 1RL2A 4B3MQ 1F2YA 3SEBA 1B7YB 3O13A 1WTXA 1M1KC 2F0GA 2E2JB 3K5MA 1G2TA 4DR6L 2UXBQ 2JQOA 4IZ8A 2E2JH 2Q2HA 3OW2A 3ICEA 1M8AA 2WACA 4WJWA 2WB1G 5M3FB 2HHHL 1PVOA 4K5XA 3A8JE 2QA4A 2CFMA 1BDOA 1EQQA 3RMHA 2VQEQ 1OXXK 1RODA 3TBIB 1K0RA 4DU9A 3GTMB 3SHLA 4ZQ3A 4AIMA 1WTQA 3LWEA 2ZJQA 3G6JB 5CC4A 4XXEA 4DV0L 3OTOL 3CCUA 5BR8L 4GOPB 2RBMA 3S16B 1WOCA 2R3ZA 2K32A 4RGNA 2R61A 1JMCA 2NN6H 4L5SA 3R8BA 1IKMA 3S16H 1NR2A 3WWVA 1PLFA 1LTID 2L5TA 1G8ZD 3K8AA 4QIWB 1D8LA 1LTAD 5LMUL 3HOZG 4DV0Q 1M90C 5BR8Q 1XJVA 2CH4A 1X54A 1ZYRC 1SNDA 4E6IA 4JBMA 3JAME 4DV7Q 3PF4A 1L2FA 1K8GA 2WAQG 3STBC 4IFDI 5C44G 2DUDA 4FF4A 1XNRQ 4FO2A 4HAEA 4R8IA 4ZLTF 3TP8A 1SYFA 2CQAA 2HUGA 4G7ZC 1I94L 4CJ1B 2MJ8A 2JP1A 1N34Q 2EZVA 1I4HA 1XTDA 3WOFA 1QVCA 1R9TB 2A73B 2GVBA 3I7FA 1HZCA 2F0LA 1UE7A 1R9TH 1B9NA 1GKHA 2IHFA
chains in the Genus database with same CATH topology
2PI2A 2HQLA 4JV5Q 3KF6A 5GADC 3GTOH 4DR7Q 2LXJA 1AE2A 1IYJB 1CSPA 2OCEA 3PUVA 4H02A 3CMEA 4HJAA 2BA0A 1I94Q 5HY6A 3GTQH 3S14H 1PH6A 2K50A 1VQLA 3HOYH 5JJKA 2A19A 4R4QA 2VW9A 2MO1A 4LW1A 4GNXB 4O2DA 1TXYA 1FJGQ 2PQAA 4GKJQ 1XMOL 4BXXH 2B3GA 1NMGA 1UWVA 5ELNA 3E9IA 4DV1L 4DUZQ 1YIJA 3Q8DA 4OX9L 4A3EG 1Q1BA 3TS2A 1K73C 3AQQA 1K8AC 3PV0A 3ERSX 1HNXQ 1OXUA 1OXTA 1Q82C 4BY7H 1PV4A 3UDFA 3K7AH 2I0QA 2HT1A 1I3QH 4DV5L 4LF5Q 1E24A 3RR5A 2EXDA 4B3ML 3HOYG 4OO1I 2VY3A 1SN8A 4IPHA 1H95A 1GO3E 4KHPL 3NBHB 4OX9Q 2UXBL 4P74A 4JI0Q 4BBSH 1KXLA 3CP0A 4B3SQ 3K0XA 4BXXG 1O7IA 4Y52H 1MIUA 4DR1L 4GS3A 4DR5Q 2RF4A 1CKMA 3AYHB 5M3MH 4LFCQ 1WI5A 3H0GH 3NENA 3I4OA 2UUCL 3LGJA 3T1YQ 5C4XG 1VQCA 2N49A 2YU9H 3CCMA 4LFAQ 2RHSB 4BY7G 2JEBI 2YV5A 4DV2Q 4GLAC 4JI1Q 2E2HH 1QUQA 3HKZE 1GVPA 1LTLA 1J5EQ 2JA7H 2VQEL 1A0IA 1Y1VG 2I5HA 4JI6Q 1IBML 1Y14B 2UXCQ 1U5KA 4DR1Q 3S1NH 4EQ5A 2KHJA 1W3SA 1VQ7A 1K9MC 3S24A 4ME3A 3F2CA 3HOUH 4DAMA 4A3LG 5ELOA 2GN5A 1VQIA 3S15H 1E7ZA 4L5TA 3F2BA 2B29A 3HOXH 1E3PA 2E2IH 3J7A5 1HJPA 1S40A 3JAMc 1HZ9A 1WJJA 2PI2E 3BJUA 1V43A 3JAMi 2UUAQ 3ULLA 1ASZA 1IBMQ 4DR3Q 1HNWQ 4JYAL 1VQBA 4OXPA 1XPOA 2MQHA 3ULPA 4HIDA 4A3DH 1D7QA 3G71A 1EQRA 3CCJA 4NXNQ 1VCIA 4JI5L 4LUVA 4JI2Q 4DR2Q 3PO2G 3UE0A 4NXML 4R4CA 1PH2A 4JI4L 3HOUG 1N9WA 1VQ6A 1WFQA 1Q81C 4J15A 3KF8B 4DV7L 4A3KG 2E8GA 5GAEC 1AE3A 4GKKQ 3HOXG 4JI7Q 5JEAG 1PH4A 4A3IH 1XNRL 1PFSA 3GDEA 4KI0A 2R6GA 5H1SE 3A5UA 4A3CH 2FXQA 4K0KQ 4DV4Q 1YEZA 3K81C 4IJLA 4BBRG 3CCQA 1MJEA 5JJIA 4LFBQ 4UP9A 1TWAH 5DLQE 2B63H 3F2DA 4IOCA 1EIYB 4NXMQ 3M4PA 1FL0A 3S1MH 4DV6Q 2JE6I 1Z9FA 1N34L 1PH1A 1IBLL 2KHIA 2ZM6L 4X6AH 3W5OA 3AFQA 2ZJRA 4JI3Q 3I2ZA 4LF8L 4DNIA 2K5HA 4YWLA 2F52A 4AYBE 3DM3A 4C3HH 3HOVH 3J81j 4R4IA 4LF6Q 2E5LL 2NN6G 3RZDH 4LF6L 2NZHA 3GTLH 1UE1A 4DUYL 2VS1A 2NZOA 4JV5L 3GTJH 1SFOH 2JA8H 4DR7L 4P72A 1VQOA 1Y1WG 2V1CC 1X6OA 3KJPA 1IXRA 1WYDA 2Y0SE 3PUYA 2EQSA 2WB1E 3CC4A 3HKSA 1XNQQ 2IY5B 1X3GA 2ZM6Q 1FJGL 5M5YH 1KD1C 3SGIA 4YHHQ 2B63G 3KLWA 4A3GG 3EBEA 2PMZE 4YWKA 4GKJL 4TVAB 2OQ0A 4DV3Q 2R93H 2KENA 4LWCA 3A0JA 3BU2A 3CCSA 2AMCB 3UE1A 4HIOA 4DUZL 2JA9A 2DGYA 2UUBQ 4DUYQ 3HOVG 1MJCA 4POGA 1PA6A 1HR0Q 1HNXL 4B3TQ 1CKOA 3KF6B 1KRTA 4L5QA 4A75A 4OWWB 5FLXc 2JA8G 3CW2C 2ES2A 2ZTCA 1N8RC 2R7ZH 2CCZA 4LF5L 4A3MH 3F1ZA 3G6EA 1GD7A 4OONA 2PQAB 2WFWA 3GO5A 3RNUA 1Z47A 3H15A 4YCVA 3CCEA 4HIMA 2H5XA 4JI0L 3M3YH 5IWAL 2VQFQ 4B3SL 1VS0A 1LM0A 4A3BH 2R93G 4C3JH 1EOVA 3T1HQ 4DR5L 3OYYA 5JJLA 4LFCL 1TWFH 3U50C 1GM5A 1VQNA 3PGZA 4GLXA 4A93G 1A62A 3T1YL 1BBWA 2JA6H 1VQMA 3KFUA 4LFAL 1X3FA 3H3VI 4QY7A 2ID0A 1G291 1X3EA 4DV2L 4JI1L 3ULJA 1J5EL 2WAQE 2R7ZG 1YBYA 4JI6L 3CCRA 4HJ9A 2AWNA 5IWAQ 1VQAA 1EIFA 2D0PA 4KLKA 2UXCL 3K7UC 1CSQA 4GN3B 2CWAA 2MO0A 4GN5A 4X64Q 4QGUA 1PH7A 4A3BG 4DKAC 2HIXA 2D62A 1MKHA 3CPFA 2UXDQ 4AQYL 4IPDA 3RN5A 1V1QA 5GAGC 3PUWA 1KIXA 3TEHB 2OTLA 2JA6G 3PCOB 2K5VA 2UUAL 1N33Q 4QIWE 1TWGH 2VUMH 4JBJA 4JI8Q 1E22A 3FKIH 3U4VA 4DR3L 1QUQB 1PH9A 1HNWL 1IBKQ 2UU9Q 1YHBA 3DLLA 2OTJA 1OTCA 4X65Q 4UPAA 3D31A 1L1OA 4R4OA 2IT1A 5IP9H 4NXNL 4BBSG 1YHAA 5EAYA 4AQYQ 3PO3H 5E7NA 2D0OA 1L1OB 1VQHA 5M3MG 3J7ZC 4DR2L 4JI2L 3H0GG 1G51A 1JJGA 1NE3A 4YY3L 1UE5A 5GROA 3CF5A 2NVTH 1B8AA 1NTGA 4BA1I 5AJ3Q 5JEAJ 4JBKA 1YI2A 3S2HH 4GKKL 1QZGA 4JI7L 3UDIA 4LF7Q 3ZJYC 4AYBG 1T9HA 3D0FA 1U0LA 2YTXA 4P71A 2JA7G 3PIOA 2VUMG 4K0KL 4WJ4A 1NMFA 2OQKA 5C4JH 4DV4L 3FKIG 1PYBA 1IL2A 3PSIA 4OO1G 1SLJA 1P16A 4KHZA 1VQ5A 4LFBL 1EWIA 4A4IA 2F3IA 4QQBX 5C3EH 5LMNQ 2JA5H 2F4VQ 2Y0SG 4QJFA 4YY3Q 5IP9G 3KJOA 1KQSA 2Q2UA 4DV6L 2NN6I 2QEXA 3PO3G 2N8NA 3FHWA 2R7DA 5M3FH 1NJIC 5IYDH 4O0AA 5C0XG 1KAWA 4OWTB 3M9BA 4JI3L 1W2BA 1KL9A 1HR0W 4L5RC 1LYLA 3A5ZB 4DR6Q 2ALYB 1WCMH 2IX0A 2ATWA 3L2PA 1VQGA 1YNXA 2R92H 2CKZB 1VQDA 1C7YA 2BA1A 4LF9Q 3PUZA 4NB3A 3HOZH 1X55A 1VQEA 2NVXH 4BY1H 3CCVA 4BA2I 3A74A 1G6PA 4A3DG 4HJ5A 3GTMH 2AHOB 4GOPA 1B70B 2HHHQ 3S1QH 2QGQA 4HJ7A 1XPUA 3CAMA 1XNQL 4RG1A 4X66Q 3S17H 3B6YA 4YHHL 2JA5G 1UE6A 5FJ8H 3PUXA 3TREA 2XTIA 2IHEA 4DV3L 1BKBA 3VDYA 4LF4Q 4GLVB 2JJQA 4A3FH 2XGTA 2CQOA 4XIGS 4AH6A 2NVYH 4A3JH 1JE5A 2UUBL 4YCWA 1N36Q 4JBWA 1XMQQ 4C2MH 4A3IG 1I50H 3K80C 3RLOA 1WCMG 3RN2A 4A3CG 2I5MX 3RLNA 1J6QA 4DAYB 1HR0L 2R92G 4DK6C 1S72A 4B3TL 3MXNB 3EN2A 3OTOQ 4NPSA 4FDBA 2ZJPA 4PZ8A 4LUZA 1BBUA 1SE8A 4LUOA 4P73A 5IP7H 5FJ8G 4YCUA 1QVGA 2L15A 3ER0A 4X62Q 2VQFL 1X9NA 1PH5A 5M5WH 3I55A 3F8TA 1S3OA 4A3FG 4DR4L 3T1HL 4R1JA 2R7FA 4JOIA 1N32Q 4JC0A 2AWOA 1NY4A 5LMUQ 1VQ4A 1JT8A 3L7ZC 4TQUS 3CC2A 1IZ6A 4UP8A 1SR3A 2Z0SA 1TWCH 3NEMA 3W1BA 3BZKA 1EYGA 3M85A 1A63A 3U4ZA 2I5LX 1SRUA 2CWPA 1X56A 5IYCH 1XPRA 1JJ2A 1CKNA 3HKZG 4UY8C 3G4SA 4A3EH 4YWMA 4DK3C 4B3RL 4P75A 4QL5A 4DPGA 1CUKA 4WJ3M 3RZOH 2K4KA 2YYZA 2LSSA 4DR4Q 4APVA 3CQZH 5IE8A 1K83H 2BH8A 5IP7G 4X64L 2YTVA 4IFDG 5GAHC 3HFZB 3I56A 2UXDL 1X65A 2A1AA 4GNXA 1YHQA 1C0AA 1L1OC 2JK8A 2K52A 2KBNA 3BZCA 1BVSA 1VQKA 1N33L 3HOWH 4B3RQ 1Q46A 4JI8L 1LUZA 4JG2A 5IYCG 3AFPA 4A3MG 2HIVA 5IYBH 5LMNW 4GN4B 3AEVA 1IBKL 2UU9L 4ALPA 3CC7A 2RHQB 5C4XH 4X65L 4MNOA 1PH8A 1VQPA 1Q12A 4XTCS 3U58A 1VQ8A 3CMAA 2VZAA 1RIPA 1QVFA 2LXKA 1UEBA 1YJ9A 2Z6KA 4HIKA 4LNQA 1Y1VH 2N78A 5AJ3L 1HZAA 1P8LA 2K75A 1XMOQ 2JEAI 3H3VH 4LF7L 1Q8KA 4PG3A 2MNAA 2K14A 4DV1Q 2KCMA 3L0OA 5K36G 3HOWG 1NBWA 1E1OA 5IY0A 3W1GA 1KC8C 1YJWA 1VQ9A 4A3LH 1AH9A 5FLMH 4IO9A 4UP7A 5IYBG 3PIPA 1OXVA 3CPWA 3GTKH 2N3SA 1TWHH 2EIFA 5C0XI 3CXCA 5LMNL 2F4VL 3M4OH 1KRSA 1YJNA 3I4NH 1V9PA 4DV5Q 5C0XJ 4GOPC 1RL2A 4B3MQ 1B7YB 1PHJA 3KYHC 1M1KC 4DR6L 4KHPQ 5M5XH 2UXBQ 2JQOA 4R4TA 2E2JH 2Q2HA 1HNZL 4LF9L 3OW2A 3M7NA 4A76A 3E0EA 3ICEA 3PO2H 2UUCQ 4RMFA 1JJCB 5FLMG 2WB1G 3IRBA 2HHHL 1KHIA 1DGSA 4A3KH 1PVOA 2VNUD 2QA4A 2Q2IA 2CFMA 4X66L 1VQJA 1EQQA 1HZBA 1SROA 4LF4L 3I4NG 2VQEQ 1OXXK 3KDFA 4BBRH 1K0RA 1HNZQ 5J3BA 1XMQL 1N36L 1PH3A 5IT9c 2BH2A 4AIMA 3KDFB 4IPCA 2VL6A 2ZJQA 1Q7YC 4DV0L 4JOIC 3OTOL 3CCUA 1JB7A 5BR8L 4GOPB 5C3EG 4IPGA 5C44H 1WOCA 3CD6A 1SMXA 4L5SA 1JMCA 3S16H 5M3FG 3WWVA 5IYDG 1Q86C 1K3RA 2ASBA 4PZ7A 5GQOA 4JYAQ 3MEFA 4X62L 1Y1WH 4POFA 3I4MH 2OWOA 4PMWA 4IJHA 3K8AA 1YVCA 1C9OA 3PF5A 1N32L 1VQFA 3NELA 1D8LA 4JI5Q 3M4QA 5LMUL 3S1RH 2WP8J 1HH2P 4DV0Q 3J80c 3HOZG 3EIVA 1M90C 2RCNA 2AKWB 3J80i 4BY1G 5BR8Q 1XJVA 5HGQA 4A3GH 1X54A 4JI4Q 3GD7A 3TRZA 2ZTDA 4JBMA 1EUJA 4DV7Q 4GNXC 2NVQH 1L2FA 3UDGA 3PF4A 1K8GA 2GVAA 2WAQG 3STBC 3J81c 1I5FA 2MFIA 3J81i 4IFDI 5C44G 4EX5A 2DUDA 1FGUA 3RLFA 2K5NA 4MTNA 1XNRQ 4PZ6A 4HJ8A 3GTPH 1FVIA 1E1TA 4MZ9A 1QZHA 3S2DH 1PYSB 2PNHA 1L0WA 3TS0A 4IFDJ 2Q2TA 3TQYA 4A3JG 2IX1A 4IOAA 2C35B 3UDXA 3CCLA 3G48A 2YTYA 4Y7NH 3I4MG 3FP9A 2KCTA 1I94L 4C3IH 1Q1EA 4OWXB 1N34Q 1EFWA 3GTGH 1IBLQ 1OXSC 1XTDA 2A8VA 3STBD 1QVCA 1YZ6A 2Z6KC 3E9HA 4LF8Q 2GVBA 3JC66 3I7FA 1ASYA 1HZCA 1CKNB 1UE7A 1I6HH 2ZTEA 1YITA 3KOJA 4JCVE 2E5LQ 1R9TH 1GKHA 1A8VA 2IHFA 4A93H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI2 A;  2HQL A;  4JV5 Q;  3KF6 A;  5GAD C;  3GTO H;  4DR7 Q;  2LXJ A;  1AE2 A;  1IYJ B;  1CSP A;  2OCE A;  3PUV A;  4H02 A;  3CME A;  4HJA A;  2BA0 A;  1I94 Q;  5HY6 A;  3GTQ H;  3S14 H;  1PH6 A;  2K50 A;  1VQL A;  3HOY H;  5JJK A;  2A19 A;  4R4Q A;  2VW9 A;  2MO1 A;  4LW1 A;  4GNX B;  4O2D A;  1TXY A;  1FJG Q;  2PQA A;  4GKJ Q;  1XMO L;  4BXX H;  2B3G A;  1NMG A;  1UWV A;  5ELN A;  3E9I A;  4DV1 L;  4DUZ Q;  1YIJ A;  3Q8D A;  4OX9 L;  4A3E G;  1Q1B A;  3TS2 A;  1K73 C;  3AQQ A;  1K8A C;  3PV0 A;  3ERS X;  1HNX Q;  1OXU A;  1OXT A;  1Q82 C;  4BY7 H;  1PV4 A;  3UDF A;  3K7A H;  2I0Q A;  2HT1 A;  1I3Q H;  4DV5 L;  4LF5 Q;  1E24 A;  3RR5 A;  2EXD A;  4B3M L;  3HOY G;  4OO1 I;  2VY3 A;  1SN8 A;  4IPH A;  1H95 A;  1GO3 E;  4KHP L;  3NBH B;  4OX9 Q;  2UXB L;  4P74 A;  4JI0 Q;  4BBS H;  1KXL A;  3CP0 A;  4B3S Q;  3K0X A;  4BXX G;  1O7I A;  4Y52 H;  1MIU A;  4DR1 L;  4GS3 A;  4DR5 Q;  2RF4 A;  1CKM A;  3AYH B;  5M3M H;  4LFC Q;  1WI5 A;  3H0G H;  3NEN A;  3I4O A;  2UUC L;  3LGJ A;  3T1Y Q;  5C4X G;  1VQC A;  2N49 A;  2YU9 H;  3CCM A;  4LFA Q;  2RHS B;  4BY7 G;  2JEB I;  2YV5 A;  4DV2 Q;  4GLA C;  4JI1 Q;  2E2H H;  1QUQ A;  3HKZ E;  1GVP A;  1LTL A;  1J5E Q;  2JA7 H;  2VQE L;  1A0I A;  1Y1V G;  2I5H A;  4JI6 Q;  1IBM L;  1Y14 B;  2UXC Q;  1U5K A;  4DR1 Q;  3S1N H;  4EQ5 A;  2KHJ A;  1W3S A;  1VQ7 A;  1K9M C;  3S24 A;  4ME3 A;  3F2C A;  3HOU H;  4DAM A;  4A3L G;  5ELO A;  2GN5 A;  1VQI A;  3S15 H;  1E7Z A;  4L5T A;  3F2B A;  2B29 A;  3HOX H;  1E3P A;  2E2I H;  3J7A 5;  1HJP A;  1S40 A;  3JAM c;  1HZ9 A;  1WJJ A;  2PI2 E;  3BJU A;  1V43 A;  3JAM i;  2UUA Q;  3ULL A;  1ASZ A;  1IBM Q;  4DR3 Q;  1HNW Q;  4JYA L;  1VQB A;  4OXP A;  1XPO A;  2MQH A;  3ULP A;  4HID A;  4A3D H;  1D7Q A;  3G71 A;  1EQR A;  3CCJ A;  4NXN Q;  1VCI A;  4JI5 L;  4LUV A;  4JI2 Q;  4DR2 Q;  3PO2 G;  3UE0 A;  4NXM L;  4R4C A;  1PH2 A;  4JI4 L;  3HOU G;  1N9W A;  1VQ6 A;  1WFQ A;  1Q81 C;  4J15 A;  3KF8 B;  4DV7 L;  4A3K G;  2E8G A;  5GAE C;  1AE3 A;  4GKK Q;  3HOX G;  4JI7 Q;  5JEA G;  1PH4 A;  4A3I H;  1XNR L;  1PFS A;  3GDE A;  4KI0 A;  2R6G A;  5H1S E;  3A5U A;  4A3C H;  2FXQ A;  4K0K Q;  4DV4 Q;  1YEZ A;  3K81 C;  4IJL A;  4BBR G;  3CCQ A;  1MJE A;  5JJI A;  4LFB Q;  4UP9 A;  1TWA H;  5DLQ E;  2B63 H;  3F2D A;  4IOC A;  1EIY B;  4NXM Q;  3M4P A;  1FL0 A;  3S1M H;  4DV6 Q;  2JE6 I;  1Z9F A;  1N34 L;  1PH1 A;  1IBL L;  2KHI A;  2ZM6 L;  4X6A H;  3W5O A;  3AFQ A;  2ZJR A;  4JI3 Q;  3I2Z A;  4LF8 L;  4DNI A;  2K5H A;  4YWL A;  2F52 A;  4AYB E;  3DM3 A;  4C3H H;  3HOV H;  3J81 j;  4R4I A;  4LF6 Q;  2E5L L;  2NN6 G;  3RZD H;  4LF6 L;  2NZH A;  3GTL H;  1UE1 A;  4DUY L;  2VS1 A;  2NZO A;  4JV5 L;  3GTJ H;  1SFO H;  2JA8 H;  4DR7 L;  4P72 A;  1VQO A;  1Y1W G;  2V1C C;  1X6O A;  3KJP A;  1IXR A;  1WYD A;  2Y0S E;  3PUY A;  2EQS A;  2WB1 E;  3CC4 A;  3HKS A;  1XNQ Q;  2IY5 B;  1X3G A;  2ZM6 Q;  1FJG L;  5M5Y H;  1KD1 C;  3SGI A;  4YHH Q;  2B63 G;  3KLW A;  4A3G G;  3EBE A;  2PMZ E;  4YWK A;  4GKJ L;  4TVA B;  2OQ0 A;  4DV3 Q;  2R93 H;  2KEN A;  4LWC A;  3A0J A;  3BU2 A;  3CCS A;  2AMC B;  3UE1 A;  4HIO A;  4DUZ L;  2JA9 A;  2DGY A;  2UUB Q;  4DUY Q;  3HOV G;  1MJC A;  4POG A;  1PA6 A;  1HR0 Q;  1HNX L;  4B3T Q;  1CKO A;  3KF6 B;  1KRT A;  4L5Q A;  4A75 A;  4OWW B;  5FLX c;  2JA8 G;  3CW2 C;  2ES2 A;  2ZTC A;  1N8R C;  2R7Z H;  2CCZ A;  4LF5 L;  4A3M H;  3F1Z A;  3G6E A;  1GD7 A;  4OON A;  2PQA B;  2WFW A;  3GO5 A;  3RNU A;  1Z47 A;  3H15 A;  4YCV A;  3CCE A;  4HIM A;  2H5X A;  4JI0 L;  3M3Y H;  5IWA L;  2VQF Q;  4B3S L;  1VS0 A;  1LM0 A;  4A3B H;  2R93 G;  4C3J H;  1EOV A;  3T1H Q;  4DR5 L;  3OYY A;  5JJL A;  4LFC L;  1TWF H;  3U50 C;  1GM5 A;  1VQN A;  3PGZ A;  4GLX A;  4A93 G;  1A62 A;  3T1Y L;  1BBW A;  2JA6 H;  1VQM A;  3KFU A;  4LFA L;  1X3F A;  3H3V I;  4QY7 A;  2ID0 A;  1G29 1;  1X3E A;  4DV2 L;  4JI1 L;  3ULJ A;  1J5E L;  2WAQ E;  2R7Z G;  1YBY A;  4JI6 L;  3CCR A;  4HJ9 A;  2AWN A;  5IWA Q;  1VQA A;  1EIF A;  2D0P A;  4KLK A;  2UXC L;  3K7U C;  1CSQ A;  4GN3 B;  2CWA A;  2MO0 A;  4GN5 A;  4X64 Q;  4QGU A;  1PH7 A;  4A3B G;  4DKA C;  2HIX A;  2D62 A;  1MKH A;  3CPF A;  2UXD Q;  4AQY L;  4IPD A;  3RN5 A;  1V1Q A;  5GAG C;  3PUW A;  1KIX A;  3TEH B;  2OTL A;  2JA6 G;  3PCO B;  2K5V A;  2UUA L;  1N33 Q;  4QIW E;  1TWG H;  2VUM H;  4JBJ A;  4JI8 Q;  1E22 A;  3FKI H;  3U4V A;  4DR3 L;  1QUQ B;  1PH9 A;  1HNW L;  1IBK Q;  2UU9 Q;  1YHB A;  3DLL A;  2OTJ A;  1OTC A;  4X65 Q;  4UPA A;  3D31 A;  1L1O A;  4R4O A;  2IT1 A;  5IP9 H;  4NXN L;  4BBS G;  1YHA A;  5EAY A;  4AQY Q;  3PO3 H;  5E7N A;  2D0O A;  1L1O B;  1VQH A;  5M3M G;  3J7Z C;  4DR2 L;  4JI2 L;  3H0G G;  1G51 A;  1JJG A;  1NE3 A;  4YY3 L;  1UE5 A;  5GRO A;  3CF5 A;  2NVT H;  1B8A A;  1NTG A;  4BA1 I;  5AJ3 Q;  5JEA J;  4JBK A;  1YI2 A;  3S2H H;  4GKK L;  1QZG A;  4JI7 L;  3UDI A;  4LF7 Q;  3ZJY C;  4AYB G;  1T9H A;  3D0F A;  1U0L A;  2YTX A;  4P71 A;  2JA7 G;  3PIO A;  2VUM G;  4K0K L;  4WJ4 A;  1NMF A;  2OQK A;  5C4J H;  4DV4 L;  3FKI G;  1PYB A;  1IL2 A;  3PSI A;  4OO1 G;  1SLJ A;  1P16 A;  4KHZ A;  1VQ5 A;  4LFB L;  1EWI A;  4A4I A;  2F3I A;  4QQB X;  5C3E H;  5LMN Q;  2JA5 H;  2F4V Q;  2Y0S G;  4QJF A;  4YY3 Q;  5IP9 G;  3KJO A;  1KQS A;  2Q2U A;  4DV6 L;  2NN6 I;  2QEX A;  3PO3 G;  2N8N A;  3FHW A;  2R7D A;  5M3F H;  1NJI C;  5IYD H;  4O0A A;  5C0X G;  1KAW A;  4OWT B;  3M9B A;  4JI3 L;  1W2B A;  1KL9 A;  1HR0 W;  4L5R C;  1LYL A;  3A5Z B;  4DR6 Q;  2ALY B;  1WCM H;  2IX0 A;  2ATW A;  3L2P A;  1VQG A;  1YNX A;  2R92 H;  2CKZ B;  1VQD A;  1C7Y A;  2BA1 A;  4LF9 Q;  3PUZ A;  4NB3 A;  3HOZ H;  1X55 A;  1VQE A;  2NVX H;  4BY1 H;  3CCV A;  4BA2 I;  3A74 A;  1G6P A;  4A3D G;  4HJ5 A;  3GTM H;  2AHO B;  4GOP A;  1B70 B;  2HHH Q;  3S1Q H;  2QGQ A;  4HJ7 A;  1XPU A;  3CAM A;  1XNQ L;  4RG1 A;  4X66 Q;  3S17 H;  3B6Y A;  4YHH L;  2JA5 G;  1UE6 A;  5FJ8 H;  3PUX A;  3TRE A;  2XTI A;  2IHE A;  4DV3 L;  1BKB A;  3VDY A;  4LF4 Q;  4GLV B;  2JJQ A;  4A3F H;  2XGT A;  2CQO A;  4XIG S;  4AH6 A;  2NVY H;  4A3J H;  1JE5 A;  2UUB L;  4YCW A;  1N36 Q;  4JBW A;  1XMQ Q;  4C2M H;  4A3I G;  1I50 H;  3K80 C;  3RLO A;  1WCM G;  3RN2 A;  4A3C G;  2I5M X;  3RLN A;  1J6Q A;  4DAY B;  1HR0 L;  2R92 G;  4DK6 C;  1S72 A;  4B3T L;  3MXN B;  3EN2 A;  3OTO Q;  4NPS A;  4FDB A;  2ZJP A;  4PZ8 A;  4LUZ A;  1BBU A;  1SE8 A;  4LUO A;  4P73 A;  5IP7 H;  5FJ8 G;  4YCU A;  1QVG A;  2L15 A;  3ER0 A;  4X62 Q;  2VQF L;  1X9N A;  1PH5 A;  5M5W H;  3I55 A;  3F8T A;  1S3O A;  4A3F G;  4DR4 L;  3T1H L;  4R1J A;  2R7F A;  4JOI A;  1N32 Q;  4JC0 A;  2AWO A;  1NY4 A;  5LMU Q;  1VQ4 A;  1JT8 A;  3L7Z C;  4TQU S;  3CC2 A;  1IZ6 A;  4UP8 A;  1SR3 A;  2Z0S A;  1TWC H;  3NEM A;  3W1B A;  3BZK A;  1EYG A;  3M85 A;  1A63 A;  3U4Z A;  2I5L X;  1SRU A;  2CWP A;  1X56 A;  5IYC H;  1XPR A;  1JJ2 A;  1CKN A;  3HKZ G;  4UY8 C;  3G4S A;  4A3E H;  4YWM A;  4DK3 C;  4B3R L;  4P75 A;  4QL5 A;  4DPG A;  1CUK A;  4WJ3 M;  3RZO H;  2K4K A;  2YYZ A;  2LSS A;  4DR4 Q;  4APV A;  3CQZ H;  5IE8 A;  1K83 H;  2BH8 A;  5IP7 G;  4X64 L;  2YTV A;  4IFD G;  5GAH C;  3HFZ B;  3I56 A;  2UXD L;  1X65 A;  2A1A A;  4GNX A;  1YHQ A;  1C0A A;  1L1O C;  2JK8 A;  2K52 A;  2KBN A;  3BZC A;  1BVS A;  1VQK A;  1N33 L;  3HOW H;  4B3R Q;  1Q46 A;  4JI8 L;  1LUZ A;  4JG2 A;  5IYC G;  3AFP A;  4A3M G;  2HIV A;  5IYB H;  5LMN W;  4GN4 B;  3AEV A;  1IBK L;  2UU9 L;  4ALP A;  3CC7 A;  2RHQ B;  5C4X H;  4X65 L;  4MNO A;  1PH8 A;  1VQP A;  1Q12 A;  4XTC S;  3U58 A;  1VQ8 A;  3CMA A;  2VZA A;  1RIP A;  1QVF A;  2LXK A;  1UEB A;  1YJ9 A;  2Z6K A;  4HIK A;  4LNQ A;  1Y1V H;  2N78 A;  5AJ3 L;  1HZA A;  1P8L A;  2K75 A;  1XMO Q;  2JEA I;  3H3V H;  4LF7 L;  1Q8K A;  4PG3 A;  2MNA A;  2K14 A;  4DV1 Q;  2KCM A;  3L0O A;  5K36 G;  3HOW G;  1NBW A;  1E1O A;  5IY0 A;  3W1G A;  1KC8 C;  1YJW A;  1VQ9 A;  4A3L H;  1AH9 A;  5FLM H;  4IO9 A;  4UP7 A;  5IYB G;  3PIP A;  1OXV A;  3CPW A;  3GTK H;  2N3S A;  1TWH H;  2EIF A;  5C0X I;  3CXC A;  5LMN L;  2F4V L;  3M4O H;  1KRS A;  1YJN A;  3I4N H;  1V9P A;  4DV5 Q;  5C0X J;  4GOP C;  1RL2 A;  4B3M Q;  1B7Y B;  1PHJ A;  3KYH C;  1M1K C;  4DR6 L;  4KHP Q;  5M5X H;  2UXB Q;  2JQO A;  4R4T A;  2E2J H;  2Q2H A;  1HNZ L;  4LF9 L;  3OW2 A;  3M7N A;  4A76 A;  3E0E A;  3ICE A;  3PO2 H;  2UUC Q;  4RMF A;  1JJC B;  5FLM G;  2WB1 G;  3IRB A;  2HHH L;  1KHI A;  1DGS A;  4A3K H;  1PVO A;  2VNU D;  2QA4 A;  2Q2I A;  2CFM A;  4X66 L;  1VQJ A;  1EQQ A;  1HZB A;  1SRO A;  4LF4 L;  3I4N G;  2VQE Q;  1OXX K;  3KDF A;  4BBR H;  1K0R A;  1HNZ Q;  5J3B A;  1XMQ L;  1N36 L;  1PH3 A;  5IT9 c;  2BH2 A;  4AIM A;  3KDF B;  4IPC A;  2VL6 A;  2ZJQ A;  1Q7Y C;  4DV0 L;  4JOI C;  3OTO L;  3CCU A;  1JB7 A;  5BR8 L;  4GOP B;  5C3E G;  4IPG A;  5C44 H;  1WOC A;  3CD6 A;  1SMX A;  4L5S A;  1JMC A;  3S16 H;  5M3F G;  3WWV A;  5IYD G;  1Q86 C;  1K3R A;  2ASB A;  4PZ7 A;  5GQO A;  4JYA Q;  3MEF A;  4X62 L;  1Y1W H;  4POF A;  3I4M H;  2OWO A;  4PMW A;  4IJH A;  3K8A A;  1YVC A;  1C9O A;  3PF5 A;  1N32 L;  1VQF A;  3NEL A;  1D8L A;  4JI5 Q;  3M4Q A;  5LMU L;  3S1R H;  2WP8 J;  1HH2 P;  4DV0 Q;  3J80 c;  3HOZ G;  3EIV A;  1M90 C;  2RCN A;  2AKW B;  3J80 i;  4BY1 G;  5BR8 Q;  1XJV A;  5HGQ A;  4A3G H;  1X54 A;  4JI4 Q;  3GD7 A;  3TRZ A;  2ZTD A;  4JBM A;  1EUJ A;  4DV7 Q;  4GNX C;  2NVQ H;  1L2F A;  3UDG A;  3PF4 A;  1K8G A;  2GVA A;  2WAQ G;  3STB C;  3J81 c;  1I5F A;  2MFI A;  3J81 i;  4IFD I;  5C44 G;  4EX5 A;  2DUD A;  1FGU A;  3RLF A;  2K5N A;  4MTN A;  1XNR Q;  4PZ6 A;  4HJ8 A;  3GTP H;  1FVI A;  1E1T A;  4MZ9 A;  1QZH A;  3S2D H;  1PYS B;  2PNH A;  1L0W A;  3TS0 A;  4IFD J;  2Q2T A;  3TQY A;  4A3J G;  2IX1 A;  4IOA A;  2C35 B;  3UDX A;  3CCL A;  3G48 A;  2YTY A;  4Y7N H;  3I4M G;  3FP9 A;  2KCT A;  1I94 L;  4C3I H;  1Q1E A;  4OWX B;  1N34 Q;  1EFW A;  3GTG H;  1IBL Q;  1OXS C;  1XTD A;  2A8V A;  3STB D;  1QVC A;  1YZ6 A;  2Z6K C;  3E9H A;  4LF8 Q;  2GVB A;  3JC6 6;  3I7F A;  1ASY A;  1HZC A;  1CKN B;  1UE7 A;  1I6H H;  2ZTE A;  1YIT A;  3KOJ A;  4JCV E;  2E5L Q;  1R9T H;  1GKH A;  1A8V A;  2IHF A;  4A93 H; 
#chains in the Genus database with same CATH topology
 5J22 A;  5KND A;  2CW0 D;  2IPK D;  1D5Z C;  3AU7 A;  3GTO H;  1PXU A;  1CSP A;  2OCE A;  3PUV A;  1I94 Q;  5I2Y A;  5T1I A;  4OL7 A;  2VW9 A;  4GNX B;  4O2D A;  1TXY A;  2F0M A;  3EA6 A;  4RGO S;  1O7Z A;  4BXX H;  2B3G A;  3RUZ A;  3HP3 A;  2IL8 A;  1YIJ A;  3Q8D A;  2WII B;  3JAM L;  5ELF A;  1K73 C;  1ONL A;  3ERQ A;  3K7A B;  5IGE A;  1PV4 A;  1L0Y B;  2X69 A;  5FO9 B;  3K7A H;  2I0Q A;  1SXT A;  1S5E D;  2JSO A;  1K3B C;  3HOY G;  2RDF A;  2E76 C;  4IPH A;  4U67 3;  1GO3 E;  2L1B A;  4JI0 Q;  3SK8 A;  3CP0 A;  2JYO A;  1STY A;  2F0K A;  3L9A X;  4LFC Q;  1AEX A;  2UUC L;  3T1Y Q;  2H1E A;  4OEL B;  4BY7 G;  2JEB I;  4GLA C;  3HKZ E;  2I5H A;  4DNR B;  3NP8 A;  1IBM L;  2UXC Q;  1SYC A;  5FK9 C;  3HOU B;  3BZD B;  2CH4 W;  1K9M C;  3S15 B;  4IUR A;  3HOU H;  5EPJ A;  4DAM A;  3HOX B;  4A3L G;  5EJW A;  3S15 H;  1E7Z A;  1PMR A;  3HOX H;  1D5M C;  1DOK A;  5JOB A;  1SE4 A;  1ENF A;  1IBM Q;  1VMC A;  4L8J A;  1D6E C;  1XPO A;  2IWH A;  3ULP A;  1HA5 A;  4HID A;  3DWQ A;  1T5E A;  1EQR A;  3CCJ A;  1PFB A;  4FNF A;  4DR2 Q;  3NWT A;  3SR1 A;  3UE0 A;  4R4C A;  1PH2 A;  1WFQ A;  3R2I A;  1Q81 C;  4GKK Q;  4A3K G;  1SYE A;  1PH4 A;  1EY9 A;  3GDE A;  4KI0 A;  5H1S E;  1BCP C;  3QB3 A;  4DV4 Q;  4DA2 A;  1YEZ A;  3K81 C;  4IJL A;  4BBR G;  4HED A;  1ILP A;  2QF7 A;  2B2V C;  5ELE A;  1LT3 D;  1QIL A;  4IOC A;  4IUV A;  2PW5 A;  4DV6 Q;  3NE5 B;  1Z9F A;  3A8K E;  1PH1 A;  1IBL L;  3WOE A;  1ZEQ X;  4C3H B;  3W5O A;  2AQ3 B;  1TS3 A;  1QG7 A;  1U4R A;  1X32 A;  2RDG A;  3A7A B;  3DM3 A;  4C3H H;  3J81 j;  4DAP A;  2D2C C;  2DN8 A;  5FO7 B;  5C3X A;  2VS1 A;  1W6J A;  2J0T D;  4DR7 L;  1Y1W G;  1X6O A;  2Z8L A;  5BN3 A;  1XNQ Q;  2IY5 B;  1X3G A;  5LL6 X;  4FXK C;  4A3G G;  2B63 G;  4EGV A;  4GKJ L;  2PMZ E;  1EWC A;  3MXP A;  1CHP D;  1QJO A;  2OQ0 A;  4DV3 Q;  3BU2 A;  1FNV A;  4DUZ L;  3U9S A;  1DCZ A;  4IFD H;  3HOV G;  1D5X C;  4POG A;  1HR0 Q;  1HNX L;  3X3M A;  2R7Z B;  2G9H D;  1V1P A;  1EEI D;  1N8R C;  2R7Z H;  2CCZ A;  3G7L A;  4C3I G;  3G6E A;  5IGC A;  1SYB A;  3RNU A;  2A5H A;  5JPM C;  4ZRZ A;  1NUC A;  4B3S L;  2R93 G;  2B2W A;  3FRP B;  4DR5 L;  3VR5 A;  5JJL A;  2MP1 A;  1NSN S;  2K5D A;  2J4X A;  1JOQ A;  1Y8N B;  4F7X A;  4O1N A;  4LFA L;  1X3F A;  3H3V I;  1PFM A;  1G29 1;  4DV2 L;  3T53 B;  4JI6 L;  4F88 A;  3CCR A;  4HN7 A;  4HJ9 A;  1VQA A;  4GN3 B;  2KVM A;  2CWA A;  3FDT A;  4CHT B;  3R93 A;  1PH7 A;  1AZP A;  4A3B G;  2HIX A;  3CPF A;  1Y8O B;  3PUW A;  1KIX A;  1DYQ A;  4QUF A;  2JA6 G;  2IW3 A;  5C5M A;  2F0P A;  3OIP A;  1EZ6 A;  1E22 A;  4JI8 Q;  2NWG A;  5C4Z A;  5EGT A;  1WD1 A;  1QUQ B;  1YHB A;  3TZD A;  1OTC A;  3VA7 A;  1CA6 A;  4R4O A;  2KED A;  3X3N A;  4JI2 L;  3S2H B;  2F0Q A;  5GRO A;  4P2C B;  2X6L A;  1B8A A;  1IYU A;  4BA1 I;  4JBK A;  3S2H H;  3UDI A;  5CBE E;  3NTK A;  3Q0A A;  3ZJY C;  4LF7 Q;  1DD2 A;  1I4R A;  1U0L A;  5C4J B;  2VUM G;  1MI2 A;  3FPU B;  1LT4 D;  1NMF A;  5C4J H;  1IL2 A;  3PSI A;  1VQ5 A;  4QQB X;  4LFB L;  4A4I A;  2F3I A;  4KY5 A;  3F2U A;  1TVX A;  2Y0S G;  1VDZ A;  4QF4 A;  2NUC A;  2Q2U A;  2QEX A;  3UI2 A;  2R7D A;  3Q22 A;  4CJ0 B;  2PZT A;  1KAW A;  1SSO A;  3MTS A;  1CQV A;  2R92 B;  3A5Z B;  5ELC A;  3HOZ B;  3OHX C;  2NVX B;  2R92 H;  2B2T C;  1VQD A;  3HOZ H;  2BA1 A;  2NVX H;  1VQE A;  3K0Y A;  4RGM A;  1G6P A;  4HJ5 A;  2WAQ B;  3S17 B;  1HXY D;  5KGU A;  1XPU A;  3CAM A;  4RG1 A;  1C8C A;  4X66 Q;  3S17 H;  2F0J A;  1U4M A;  5EPL A;  1BKB A;  4LF4 Q;  4F87 A;  4GLV B;  3C3L A;  4C2M B;  2XGT A;  2CQO A;  3H94 A;  1ZXT A;  4XIG S;  1JE5 A;  3SK6 A;  1PTO C;  1SMY D;  4JBW A;  4C2M H;  1XMQ Q;  2Z9H A;  3A56 A;  1O80 A;  1SJE D;  1WCM G;  3RLO A;  4A3C G;  2I5M X;  1YNN C;  3K58 A;  3MXN B;  4KN4 C;  1EFI D;  2A74 C;  2HCI A;  2L55 A;  5I9O A;  4NPS A;  5HGT A;  1Y69 U;  1E0B A;  2G9D A;  4FDB A;  1BBU A;  4R8N A;  5IP7 H;  5FJ8 G;  4YCU A;  2L15 A;  1PDQ A;  5I6W A;  3HEJ A;  1S3O A;  4DR4 L;  4R1J A;  1CHQ D;  2R7F A;  1CM9 A;  1N32 Q;  4G57 A;  2AWO A;  1JT8 A;  4TQU S;  1JWM D;  3LWU A;  4PNY A;  4A3M B;  3W1B A;  3MFG A;  3M85 A;  1EY6 A;  5E4W C;  3U4Z A;  5DNF A;  1ET6 A;  4ULL A;  2CWP A;  2KOL A;  3HKZ G;  3G4S A;  5EPK A;  4B3R L;  1BQQ T;  3PIO 3;  4WJ3 M;  1B53 A;  1TKW B;  2YYZ A;  1CFM A;  5KYI A;  4HTH A;  4DR4 Q;  5IE8 A;  5GAH C;  3HFZ B;  3J80 E;  3EJI A;  2FHT A;  1YHQ A;  2EXZ A;  1PZK D;  2K52 A;  2VXW A;  1BVS A;  4B3R Q;  4BS9 A;  1Q46 A;  5IYC G;  5IYB H;  1EY4 A;  4GN4 B;  2UU9 L;  5IOC A;  4ALP A;  2PZW A;  3I70 A;  4X3U A;  2HD3 A;  1WTW A;  4EVO A;  1EZ8 A;  2LXK A;  1H9K A;  3BG3 A;  1UEB A;  3DM1 A;  1IW7 C;  1YJ9 A;  4HIK A;  1HA6 A;  4C56 C;  4LNQ A;  2N78 A;  3A8I E;  3H3V H;  3OSO A;  1Q8K A;  3L0O A;  1U4L A;  1FNU A;  5D3D A;  3HOW G;  3W1G A;  4A3L H;  2NYZ D;  1AH9 A;  4UP7 A;  3FVQ A;  4XT1 B;  1SE3 A;  2EPB A;  2EIF A;  2F4V L;  1CT1 D;  3P20 A;  1S5C D;  4DV5 Q;  1TR5 A;  3OWF A;  3J7Y W;  1PHJ A;  1SNO A;  3J80 L;  3EFX D;  3VYR A;  1PRT B;  2BOS A;  1HNZ L;  2ZXR A;  3BDO A;  3VYT A;  4A76 A;  1FR3 A;  1JOK A;  4A3K B;  2F1M A;  4A3K H;  1DGS A;  4FVM A;  1VQJ A;  1RDP D;  4I7Z C;  1HZB A;  4BBR B;  3NQI A;  3I4N G;  3W3A A;  2EYM A;  1EIH A;  1SNP A;  3VYS A;  3KDF A;  2PCF B;  4BBR H;  2X6G A;  1HNZ Q;  3OW7 A;  5J3B A;  1N36 L;  4FF3 A;  3KDF B;  4G7O C;  3OIQ A;  4CDE C;  2A6H D;  1Q7Y C;  4JOI C;  4DFA A;  4ZYS A;  4IPG A;  3CD6 A;  2JN4 A;  1JC7 A;  1Y1W B;  3I4M B;  5JPN C;  4JYA Q;  2PO4 A;  1LAB A;  1Y1W H;  4POF A;  3I4M H;  2OWO A;  4IJH A;  2O2L D;  3NWS A;  4EQP A;  3PF5 A;  4A3G B;  1H9S B;  4A3G H;  1HTL D;  2AKW B;  5HGQ A;  2DJF C;  2A68 D;  4JI4 Q;  2ZTD A;  4ZKB B;  3UDG A;  2GVA A;  3J81 c;  1ICF B;  1S5D D;  3J81 i;  3S2D B;  3RLF A;  4PZ6 A;  4MZ9 A;  3S2D H;  2PNH A;  4Y7N B;  4IFD J;  3TS0 A;  1F9Q A;  2F3V A;  5DM7 3;  2IX1 A;  2PPB C;  4Y7N H;  3FP9 A;  4C3I H;  1E2Z A;  1A2U A;  1EFW A;  1I6H B;  1ASY A;  1YNJ D;  1CKN B;  1I6H H;  2MUY A;  4PQX A;  1YIT A;  3KOJ A;  4QJF A;  4LF6 Q;  2B2V A;  2NB0 A;  2PI2 A;  4JV5 Q;  3FPP A;  3KF6 A;  3GTQ B;  4H02 A;  3I4L A;  4I7A A;  5ELB A;  5HY6 A;  3GTQ H;  1B3Q A;  4MTK A;  5E4X A;  4RGT A;  2MO1 A;  1F9S A;  1STH A;  3GV6 A;  4DV1 L;  4PV1 C;  1LTB D;  1K8A C;  3ERS X;  1OXU A;  1AN8 A;  1I3Q B;  1U9R A;  2NBF A;  1EQT A;  1I3Q H;  4LF5 Q;  3RR5 A;  1A3V A;  2EXD A;  4MHE A;  4B3M L;  4OO1 I;  1ILQ A;  1I4X A;  2F4I A;  1H95 A;  2KCC A;  2UXB L;  1QE6 A;  2F0T A;  2F0I A;  4P74 A;  3NTH A;  1WTV A;  4XQQ A;  2EY2 A;  4DR1 L;  4I65 A;  1LAC A;  3BDL A;  1CKM A;  1QWY A;  3ND9 A;  1V1O A;  3NEN A;  3DXJ C;  5C4X G;  3MEH A;  1GUS A;  2N49 A;  1LTT D;  3N52 A;  3QJY A;  2ENB A;  4QMG A;  5DAU A;  2F0O A;  2E2H B;  4KKS A;  2E2H H;  1GVP A;  1LTL A;  2VQE L;  3S1N B;  4ZK9 B;  1BO0 A;  1ENA A;  1Y14 B;  4OIJ A;  3HG9 A;  5G3L F;  1U5K A;  4DR1 Q;  3S1N H;  1W3S A;  3VA5 A;  1DZ1 A;  1B9M A;  4ME3 A;  4L5T A;  4CGY B;  3BYY B;  1HQM C;  3J7A 5;  1GUW A;  2UUA Q;  1HZ9 A;  1WJJ A;  2PI2 E;  1CQF A;  1V43 A;  4CDC C;  4ILW A;  4DR3 Q;  3H09 A;  3AB9 A;  2M9V A;  4J6H A;  1D7Q A;  4KHV A;  2K5Q A;  2ZXP A;  3QOL A;  4KKT A;  5ISR A;  1CTM A;  2RSO A;  1H9M A;  1N9W A;  1VQ6 A;  3ITP A;  4J15 A;  4DV7 L;  2E8G A;  5GAE C;  1KLG D;  4JI7 Q;  1QCB D;  1R4P B;  5FLX L;  1XNR L;  3OOC A;  2K03 A;  4A3C H;  3A5U A;  4K0K Q;  4R9W A;  2K04 A;  2FXQ A;  3NQT A;  1TWA B;  3LNN A;  4IQZ A;  1MJE A;  4LJZ C;  5JJI A;  3NPP A;  4UP9 A;  5EKL A;  1TWA H;  1BF4 A;  2BE5 D;  1EIY B;  4N8X 1;  1MBY A;  1N34 L;  4FXG C;  2KHI A;  2ZM6 L;  5EBD A;  1LTG D;  4X6A H;  3AFQ A;  4JI3 Q;  3RZD B;  4H13 C;  4N9P A;  2WIN B;  5F2D A;  3KLS A;  3RZD H;  3GTJ B;  2JA8 B;  1UE1 A;  2NZO A;  4UHV A;  3URY A;  3GTJ H;  2JA8 H;  3HKZ B;  2V1C C;  1WYD A;  1HCZ A;  2Y0S E;  4KY6 A;  5T1G A;  2EQS A;  4G4K A;  3CC4 A;  2MGS A;  3J7A F;  2ZM6 Q;  1JCK B;  2LKV A;  4YHH Q;  4YWK A;  1ESR A;  2B2T A;  2EOT A;  4TVA B;  3GP7 A;  3TP7 A;  2UUB Q;  5BN4 A;  2F0V A;  3OPO A;  1DXM A;  2KUM A;  4NDX A;  4L5Q A;  4A75 A;  5JAV A;  1LT5 D;  2FFK B;  1JR0 D;  4X3K A;  3HGB A;  2XWB B;  1E2W A;  2ZT9 C;  2WV6 D;  2WFW A;  3GO5 A;  3P1H A;  1Z47 A;  1FNW A;  5IGD A;  3H15 A;  4YCV A;  3FMC A;  1O78 A;  4HIM A;  2H5X A;  4JI0 L;  5IWA L;  1JWS D;  1A2T A;  1VF5 C;  1VS0 A;  1EOV A;  3T1H Q;  1AZQ A;  3OYY A;  4LFC L;  3I73 A;  1GM5 A;  3PGZ A;  4WRD A;  1RKN A;  1VQN A;  3T1Y L;  1VQM A;  5EQ0 A;  2ID0 A;  5G3L D;  4CBV A;  4CKB A;  1K8O A;  3TDQ A;  3EVQ A;  4NKL A;  1DM0 B;  1Z6H A;  2XSC A;  1EY8 A;  5IWA Q;  2UXC L;  4KLK A;  1G2S A;  2EYF A;  1SEB D;  3DWP A;  1CSQ A;  2CHB D;  1XWE A;  2F0W A;  4QGU A;  3C46 A;  4KKU A;  1F77 A;  2UXD Q;  1MKH A;  1V1Q A;  1UAP A;  1TWG B;  2SDF A;  1HPC A;  2OTL A;  3PCO B;  4K6D A;  4QIW E;  1TWG H;  2NTS A;  3L3O C;  4PMB A;  4OO1 H;  3CRL C;  1PH9 A;  1IBK Q;  4RCN A;  4X65 Q;  4KV6 A;  3D31 A;  5IP9 H;  2IT1 A;  2PMZ B;  5I2X A;  2F0H A;  5EAY A;  3QG1 A;  5E7N A;  1VQH A;  5M3M G;  3J7Z C;  4DR2 L;  3H0G G;  1NR4 A;  3BVM A;  2LS0 1;  5AJ3 Q;  4GKK L;  2NZ1 D;  1YI2 A;  4RHS A;  1QZG A;  1ICW A;  4AYB G;  1T9H A;  4H44 C;  4ZCK A;  2K6A A;  2JA7 G;  3PIO A;  1I6V C;  4DV4 L;  3FKI G;  1PYB A;  2JA5 B;  1P16 A;  4KHZ A;  1EWI A;  5LMN Q;  2JA5 H;  5KNC A;  3A7L A;  4DV6 L;  2L12 A;  3PO3 G;  5L37 A;  2K01 A;  1NJI C;  2Q8I B;  5C0X G;  5BN5 A;  4OWT B;  4XQJ A;  1W2B A;  1HR0 W;  3FEW X;  2ALY B;  1YNX A;  4LF9 Q;  1X55 A;  2G5D A;  3ZYY X;  3A74 A;  2BDO A;  3CCV A;  1F9R A;  3VR3 A;  5CGK A;  2AHO B;  3H91 A;  1B70 B;  3Q6S A;  1XNQ L;  5J1Z A;  3B6Y A;  4A3F B;  3PUX A;  4DV3 L;  2JJQ A;  4A3F H;  2EY6 A;  4AH6 A;  4YCW A;  2FMC A;  1HR0 L;  1J6Q A;  3MXG A;  5CV6 A;  3M4Y A;  1KDC A;  1WTR A;  3QIA A;  2ZJP A;  3BYT B;  4RFB A;  1RCV D;  4LUO A;  5M5W B;  1YNJ C;  4MIU A;  1H9R A;  2F0S A;  4X62 Q;  1HUN A;  4TKO B;  1F9P A;  5M5W H;  3I55 A;  1F2M A;  4JOI A;  4JC0 A;  1NY4 A;  1VQ4 A;  1S5B D;  3WDN A;  3QO2 A;  4M8A A;  5A2Q E;  3CC2 A;  1SR3 A;  1TWC H;  1TU2 B;  1V1P B;  2VB3 X;  3ONA B;  1C48 A;  1PFN A;  1K0S A;  5IOD A;  2BDN A;  4LAA A;  4RCO A;  4DPG A;  1CUK A;  1K83 B;  4C1N I;  1V8Q A;  1K83 H;  3I56 A;  4QB4 A;  1EU3 A;  3BZC A;  4HMJ A;  1L0X B;  4B08 A;  1NCV A;  4JI8 L;  2KQ3 A;  4JG2 A;  2QIL A;  3AFP A;  2HIV A;  5C4X B;  3AEV A;  3CC7 A;  5IGB A;  5C4X H;  3C1E A;  1VQP A;  1Q12 A;  1VQ8 A;  3J7A V;  1HQR D;  3E5S A;  3HRZ C;  4JW0 A;  1QOH A;  4KJN A;  1HZA A;  1P8L A;  2K75 A;  3NBH A;  2Q8R E;  4H7B A;  1XMO Q;  4LF7 L;  5A2Q L;  2MNA A;  5LHY 1;  3IFT A;  1DJR D;  2D9U A;  1RD9 D;  2WB1 B;  5K36 G;  1NBW A;  2OEO A;  1KC8 C;  2QDL A;  1I4Q A;  1OXV A;  5C0X I;  3MWY W;  2MHV A;  1STA A;  1B3A A;  4GOP C;  3ND8 A;  1LV9 A;  4KHP Q;  3VYU A;  4LK1 C;  4R4T A;  1D1K A;  1WTO A;  3KLS X;  4RA8 A;  1T5X D;  1MD2 D;  1PRT F;  4RMF A;  5FLM G;  1KHI A;  2A6E D;  5D14 A;  1H9J A;  4X66 L;  1E2V A;  4QCL A;  1SRO A;  4LF4 L;  3IL8 A;  1SNQ A;  2D5D A;  3RD4 A;  1XMQ L;  4IPC A;  2EYO A;  2VL6 A;  3BDC A;  5CMD A;  5C44 B;  3NTI A;  1JB7 A;  3KF8 A;  2BE5 C;  5C44 H;  5CV5 A;  2AQ2 B;  5CV4 A;  1D1I A;  2I07 B;  5M3F G;  1Q86 C;  1EL0 A;  1K3R A;  5GQO A;  1RJT A;  1JOO A;  2E2D C;  2IX3 A;  1D2B A;  4JK1 C;  1M4V A;  4PMW A;  1RF2 D;  1YVC A;  1C9O A;  4B9W A;  1N32 L;  3NEL A;  4JI5 Q;  3M4Q A;  4ME5 A;  3EIV A;  2RCN A;  1Q8I A;  4BY1 G;  2NVQ B;  3GD7 A;  1EWH A;  1EUJ A;  2B8G A;  4IUT A;  4GNX C;  3NSW A;  2NVQ H;  3PQI A;  2SOB A;  2WKD A;  2MFI A;  3V2T A;  3DWA A;  4JVZ A;  1Q90 A;  4RKL A;  2M00 A;  4KTA A;  3SE0 A;  1FGU A;  4EX5 A;  4MTN A;  3GTP H;  1QZH A;  2Q2T A;  2CW0 C;  4A3J G;  3K57 A;  2YTY A;  4DGZ A;  2KCT A;  3D4W A;  1Q1E A;  5KEE A;  1BXT A;  5I4D A;  2A8V A;  3STB D;  3E9H A;  4LF8 Q;  3JC6 6;  4M1U B;  2C5C A;  1WVL A;  1XXG A;  2VB2 X;  2E5L Q;  1A8V A;  2H4O A;  2HQL A;  1GUN A;  3D8G A;  1QB5 D;  5GAD C;  3HOY B;  1AE2 A;  4HJA A;  2B39 A;  3CME A;  2BA0 A;  2K50 A;  3HOY H;  2A19 A;  4R4Q A;  4LW1 A;  1FJG Q;  5COY A;  4NW2 A;  2PQA A;  2K5W A;  1NMG A;  5ELN A;  3E9I A;  4L63 B;  4EQO A;  4KD4 A;  2EDG A;  2Z4I A;  1NNX A;  3TS2 A;  2O5J C;  4BY7 B;  2DJG C;  4FYD A;  1KAB A;  3BS1 A;  4BY7 H;  3UDF A;  2F0F A;  2HT1 A;  4DV5 L;  3KUP A;  3DHQ A;  1PRT D;  5M3M B;  3MZ5 A;  4BXX G;  3T4A C;  1EYC A;  1ENC A;  3M7G A;  5M3M H;  2YU9 B;  1WI5 A;  3H0G H;  1VQC A;  1SYG A;  2YU9 H;  3OWE B;  3GTO B;  3SVM A;  2RHS B;  4X3S A;  3IFD A;  2JA7 B;  5FO8 B;  4JI1 Q;  1J5E Q;  2JA7 H;  1Y1V G;  4HCS A;  2EE1 A;  2PQE A;  1S4Z A;  1CZW A;  1VQ7 A;  2XIW A;  3KLR A;  3S24 A;  1TQO A;  5ELO A;  2GN5 A;  1VQI A;  3F2B A;  2B29 A;  1E3P A;  5C0X H;  3S9W A;  1HJP A;  5JVG 3;  3K59 A;  1KDB A;  3JAM c;  3JAM i;  3K6O A;  3ULL A;  1MSH A;  5C6A A;  1HNW Q;  4JYA L;  1LTR D;  1VQB A;  4FF2 A;  5DM6 3;  5NUC A;  2L0C A;  3N6R A;  3G71 A;  2TSS A;  3T13 A;  4NXN Q;  1VCI A;  4LUV A;  2DNE A;  5C4H A;  4YIJ A;  3PO2 G;  1JQY D;  4ZAI A;  4NXM L;  4JI4 L;  3HOU G;  1KDA A;  1AE3 A;  3HOX G;  5JEA G;  2JXM B;  2R6G A;  3CHB D;  1EYA A;  2B63 B;  1EU4 A;  5DLQ E;  2B63 H;  3F2D A;  4NXM Q;  3M4P A;  3NBI A;  2JE6 I;  3NHH A;  3HOV B;  4DAV A;  1SBB B;  2EJG C;  3HOV H;  2K5H A;  4YWL A;  4AYB E;  3GTL B;  3EQL C;  4R4I A;  4RAU C;  1BCP D;  4LF6 L;  2NZH A;  3GTL H;  4DUY L;  4JV5 L;  4V19 0;  4C3I B;  2OF1 A;  4P72 A;  2PW7 A;  1ESF A;  3HKS A;  2R93 B;  2V4D A;  4IUN A;  1KD1 C;  3SGI A;  3KLW A;  3EBE A;  2SEB D;  2R93 H;  2SNM A;  2KEN A;  3A0J A;  3CCS A;  3UE1 A;  1BCP B;  4FP5 D;  2JA9 A;  4DUY Q;  2KEC A;  4CKC A;  1MJC A;  2XVS A;  4C3H G;  2IJ0 A;  1A3T A;  4B3T Q;  3KF6 B;  1UUP A;  3CW2 C;  2C9O A;  5EKK A;  2ZTC A;  2ES2 A;  4IAL A;  4LF5 L;  2O4X A;  3F1Z A;  4OON A;  4A3B B;  3M3Y B;  1R4Q B;  1RTN A;  3CCE A;  1EEF D;  4A3B H;  3M3Y H;  1TWF B;  5IGF A;  2VQF Q;  1AFP A;  2JA6 B;  1TWF H;  4RKB A;  4A93 G;  4GLX A;  1BBW A;  1PTO F;  2JA6 H;  1C4Q A;  5TSS A;  3KFU A;  1WD0 A;  4O42 A;  2PYK A;  3DEP A;  1VF7 A;  3ULJ A;  5HUR A;  2R7Z G;  2RSN A;  1CI3 M;  2AWN A;  1GHJ A;  2K33 A;  2MO0 A;  4X64 Q;  5DEH A;  3GQB A;  4KY7 A;  2RA4 A;  4Q0F A;  4DKA C;  1HUM A;  3RN5 A;  2VUM B;  1UNS A;  3OMC A;  2K5V A;  2UUA L;  3BVG A;  1N33 Q;  2VUM H;  3TN2 A;  1LT6 D;  1KNA A;  1EY7 A;  4DR3 L;  1TT2 A;  1EYD A;  2Y0S B;  3DLL A;  2DNC A;  3MVV A;  4U68 A;  4BBS G;  2N55 A;  1PYW D;  1NE3 A;  4YY3 L;  1UE5 A;  2EJM A;  3CF5 A;  1EIG A;  4B9X A;  2A6E C;  2XNA C;  1SJH D;  2GA4 B;  1A15 A;  3W2D A;  4JI7 L;  4NP5 A;  3D0F A;  1LO5 D;  1II3 A;  3BVZ A;  4K0K L;  2OQK A;  5FOB B;  1FD7 D;  1SLJ A;  3E0J A;  4ZUI A;  1TS2 A;  4YY3 Q;  2EYP A;  5D3I B;  2N8N A;  5M3F H;  1GOZ A;  2F0D A;  3PMF A;  1WCM B;  4JI3 L;  2EJF C;  2F0E A;  3M9B A;  1KL9 A;  3V05 A;  1LYL A;  4DR6 Q;  1DON A;  1WCM H;  2IX0 A;  1IHZ A;  3L2P A;  2CKZ B;  4BY1 B;  1J8I A;  4TSS A;  1SMY C;  3PUZ A;  3D4D A;  4BY1 H;  4BA2 I;  4A3D G;  1A6X A;  2ICI A;  3GTM H;  3MAQ A;  4GOP A;  3CU7 A;  2HHH Q;  2F3W A;  1BR9 A;  5EKI A;  4YHH L;  5FJ8 H;  5JJZ A;  2IHE A;  4CKE A;  3VDY A;  4FF1 A;  4A3J B;  4UDU C;  4XDX A;  1HTP A;  3IAY A;  4A3J H;  2UUB L;  5CV8 A;  1I4G A;  4A3I G;  5CBA E;  2L9H A;  3K80 C;  3RN2 A;  1EY0 A;  3RLN A;  2R92 G;  4DK6 C;  3TP5 A;  2RQX A;  3OTO Q;  4EQN A;  4ZUJ A;  1XX8 A;  4RHR A;  2B2U C;  4LUZ A;  4P73 A;  1QVG A;  1PTO D;  3DEO A;  3ER0 A;  1AW7 A;  1X9N A;  1PH5 A;  2SNS A;  1HRJ A;  3F8T A;  3T1H L;  1YNN D;  5LMU Q;  1IZ6 A;  4UP8 A;  1EYG A;  3BZK A;  1XTC D;  1A63 A;  2I5L X;  5IYC H;  1JJ2 A;  1X56 A;  3H3V C;  4UY8 C;  4FXD A;  3RZO B;  4YWM A;  4DK3 C;  4P75 A;  4DK1 A;  4QL5 A;  3I8Z A;  1PTO B;  3RZO H;  3SXH A;  1PTO H;  3QWN A;  4APV A;  5IP7 G;  2YTV A;  4K2L A;  2UXD L;  4RH6 A;  1X65 A;  2A1A A;  4GNX A;  4NMZ A;  1L1O C;  3NXW A;  3HOW B;  3TME A;  1GXD C;  2HDL A;  4HR7 B;  1VQK A;  3HOW H;  3J81 E;  1FYC A;  5KNB A;  4A3M G;  5LMN W;  4WOR A;  1IBK L;  1PRT C;  2RHQ B;  4X65 L;  1PH8 A;  5IIF A;  2RDH A;  1BUV T;  3CMA A;  2VZA A;  3VR6 A;  4C3J G;  1KAA A;  1QVF A;  3SK5 A;  1Y1V B;  2L11 A;  3T56 B;  1JB3 A;  1Y1V H;  5AJ3 L;  3I91 A;  2WKC A;  4J8Q A;  1STN A;  4PG3 A;  1GUT A;  2KCM A;  1TY2 A;  5I9P A;  1E1O A;  1TS5 A;  3VR4 A;  1YJW A;  5IYB G;  3SK4 A;  3QR8 A;  2KEE A;  3M4O B;  3I4N B;  1B1Z A;  3CKI B;  1QNU A;  3CXC A;  5LMN L;  3M4O H;  1IW7 D;  1YJN A;  3I4N H;  1O7L A;  1V9P A;  4KD3 A;  5C0X J;  3K5N A;  1BNZ A;  5M5X B;  3KYH C;  1SDF A;  3CRK C;  3AMU A;  1JOR A;  5M5X H;  1WTP A;  2Q8T A;  3PO2 B;  1OO9 B;  3KBG A;  1EOT A;  4LF9 L;  1CK1 A;  3M7N A;  5ELD A;  3J81 L;  3E0E A;  3K5L A;  3PO2 H;  2UUC Q;  1KTK A;  4XYO A;  1JJC B;  2A6H C;  2O5I C;  1B4O A;  4ABN A;  3IRB A;  5FKA C;  2VNU D;  2Q2I A;  5JEA H;  1ET9 A;  3E3X A;  2EYL A;  2RKS A;  4K8I A;  4QUC A;  1DOL A;  2DY8 A;  2M2L A;  2BH2 A;  1PH3 A;  5IT9 c;  4IUU A;  4ODG A;  1SYD A;  1JWU D;  2FMM A;  2K7V A;  2A68 C;  4MN3 A;  5C3E G;  2EYJ A;  1SMX A;  5I6Y A;  3R2T A;  1Z7T A;  5COR A;  5IYD G;  2ASB A;  5AFW A;  4PZ7 A;  5IGG A;  2N88 A;  3MEF A;  4X62 L;  1G6Z A;  3S1R B;  5A35 A;  1U4P A;  4CDD C;  1VQF A;  5E3F A;  2E75 C;  3S1R H;  4OHJ A;  2WP8 J;  1HH2 P;  5C5L A;  3J80 c;  3J80 i;  3A55 A;  2E74 C;  4DK0 A;  3R3O A;  3TRZ A;  2ICE C;  1I5F A;  1KNE A;  2B2Y C;  1RTO A;  2K5N A;  4HCE A;  4HJ8 A;  1FVI A;  1E1T A;  3PIP 3;  4OIK A;  1PYS B;  2RVL A;  1L0W A;  1TWC B;  3TQY A;  1CZG A;  4IOA A;  2C35 B;  4HSV A;  3UDX A;  5M9O A;  1EY5 A;  3CCL A;  2KJX A;  2LMC B;  3G48 A;  3I4M G;  3GTG B;  1SNC A;  3MFY A;  4OWX B;  3GTG H;  1IBL Q;  1OXS C;  1YZ6 A;  2Z6K C;  4A93 B;  2ZTE A;  4JCV E;  5CV7 A;  1SAP A;  2MPM A;  4A93 H;  1MHW C;  3P7J A;  3S14 B;  3MA2 B;  4DR7 Q;  2LXJ A;  1IYJ B;  4L6T B;  3S14 H;  2F0N A;  4LMQ D;  1PH6 A;  1VQL A;  5JJK A;  1WTH A;  4OGQ C;  1RHP A;  4GKJ Q;  1XMO L;  5JVH 3;  1UWV A;  3Q24 A;  3ERO A;  4IUQ A;  3VR2 A;  3D4R A;  4DUZ Q;  5KYL A;  1STG A;  4OX9 L;  4A3E G;  4HMI A;  1Q1B A;  1TS4 A;  3AQQ A;  3PV0 A;  2RCF A;  1HNX Q;  1OXT A;  1SE2 A;  1Q82 C;  1BBX C;  4Q5V A;  1STB A;  1E24 A;  2VY3 A;  1SN8 A;  2B8F A;  4BBS B;  2Z4H A;  3NBH B;  4KHP L;  4OX9 Q;  1KXL A;  4BBS H;  4B3S Q;  3K0X A;  1O7I A;  4Y52 H;  1MIU A;  4GS3 A;  4K5W A;  4DR5 Q;  2RF4 A;  3AYH B;  2XRQ D;  3I4O A;  4DXG A;  3LGJ A;  1SNM A;  1DOM A;  3CCM A;  4LFA Q;  2FIN B;  3QOJ A;  4RWS C;  4K2K A;  2YV5 A;  4DV2 Q;  1QUQ A;  2PNR C;  1A0I A;  2A69 D;  4JI6 Q;  4Z9C B;  4EQ5 A;  2KHJ A;  2K28 A;  3F2C A;  2CVR A;  4XYQ A;  2E2I B;  4H0L C;  2E2I H;  3KBX A;  5KRU A;  1S40 A;  3D6C A;  3BJU A;  2AQ1 B;  2HDM A;  5D65 A;  2F0U A;  1ASZ A;  2K1B A;  4A3D B;  4OXP A;  1MGS A;  1TII D;  2MQH A;  3U9O A;  4GZY C;  4A3D H;  4G7H C;  4JI5 L;  4JI2 Q;  4TRD A;  2F03 A;  3KF8 B;  4A3I B;  1HFN A;  3IKJ A;  1Y8P B;  3D6W A;  4A3I H;  4F8M A;  1PFS A;  1K8M A;  4ID6 A;  1HHV A;  3CCQ A;  4LFB Q;  3S1M B;  3C2P A;  3NK9 A;  1FL0 A;  3S1M H;  4HSP A;  2BCO A;  1AP0 A;  1IKL A;  2Z1C A;  2ZJR A;  3GTP B;  3I2Z A;  4LF8 L;  4DNI A;  2F52 A;  3HS0 C;  3OMG A;  2E5L L;  2NN6 G;  4IUP A;  4BWG B;  1SFO B;  5KIX A;  3MXN A;  2DY7 A;  1SFO H;  1VQO A;  1LTS D;  3KJP A;  1IXR A;  3PUY A;  1ZYR D;  5M5Y B;  1HFG A;  1S5F D;  2WB1 E;  2K05 A;  1FJG L;  5M5Y H;  4K14 A;  4LWC A;  4HIO A;  2AMC B;  2Z6B A;  2DGY A;  2EVB A;  4K5V A;  5IT9 E;  1ML0 D;  3I3C A;  1B44 D;  2QW7 A;  3TP6 A;  1PA6 A;  1BCP F;  1CKO A;  4KMU C;  1KRT A;  2KHS A;  2QKI C;  4KK7 A;  4OWW B;  5FLX c;  2JA8 G;  4K8J A;  2EY1 A;  1F2Z A;  4A3M H;  4K6L A;  1GD7 A;  2PQA B;  4C3J B;  4DF7 A;  5LL6 S;  4WFN 3;  1LM0 A;  1W6K A;  5CR3 A;  4C3J H;  4OEM B;  2QCP X;  4UAI A;  3U50 C;  1A62 A;  2XWJ B;  2B2U A;  4QY7 A;  3KK7 A;  4PMC A;  1X3E A;  3T51 B;  4JI1 L;  4ZKC B;  2J7Z A;  1J5E L;  2NTT A;  2WAQ E;  1BOS A;  1YBY A;  1JIC A;  1EIF A;  2D0P A;  2FJ2 A;  3H0G B;  3NUC A;  3K7U C;  2EYH A;  1PZI D;  4C1N K;  3MXU A;  2AUK A;  4GN5 A;  2LFN A;  2D62 A;  4AYB B;  4AQY L;  4IPD A;  5GAG C;  3TEH B;  5IT9 L;  3HZX A;  5J39 A;  2TMP A;  1LLR D;  3FKI B;  2HCC A;  1QNK A;  2P5Z X;  4JBJ A;  2LY7 A;  3FKI H;  3U4V A;  1HNW L;  2UU9 Q;  4X3T A;  3TSS A;  2PZU A;  4XQN A;  2OTJ A;  1EQV A;  4KJO A;  4UPA A;  3PO3 B;  1L1O A;  4NXN L;  1YHA A;  4AQY Q;  3PO3 H;  2D0O A;  1L1O B;  1JJG A;  2NVT B;  1G51 A;  2NVT H;  1NTG A;  5JEA J;  1KLU D;  2OXP A;  1GUO A;  2YTX A;  4P71 A;  1Q3L A;  4WJ4 A;  1A3U A;  4OO1 G;  5C3E B;  2QEJ C;  1X3Q A;  1X3P A;  1F2L A;  5C3E H;  2F4V Q;  5IP9 G;  1IL8 A;  3KJO A;  1KQS A;  2ZXO A;  2NN6 I;  2XRS D;  3FHW A;  5IYD H;  1UEA B;  3C1F A;  4O0A A;  4S3S A;  1VMP A;  4L5R C;  3DUZ A;  2OT2 A;  5CV9 A;  2ATW A;  2I46 A;  1VQG A;  1J9O A;  1C7Y A;  3I90 A;  4XT3 B;  4NB3 A;  1GHK A;  1JE4 A;  3S1Q B;  1STE A;  3S1Q H;  2QGQ A;  4DN4 M;  1K28 A;  4HJ7 A;  2JA5 G;  3I72 A;  1UE6 A;  1IYV A;  3TRE A;  2XTI A;  2NVY B;  1FGB D;  1CA5 A;  1PZJ D;  1I50 B;  3E6Z X;  2NVY H;  3A54 A;  4DAY A;  1N36 Q;  1H9S A;  1I50 H;  1B50 A;  4DAY B;  4B3T L;  1S72 A;  2B2W C;  3SDZ A;  3EN2 A;  1G91 A;  2HQE A;  1XYI A;  3V96 A;  5EBC A;  2KA7 A;  4PZ8 A;  3P75 A;  1SE8 A;  2VQF L;  4A3F G;  4IN3 A;  1MSG A;  2EY5 A;  3MHB A;  3L7Z C;  2AUJ D;  2Z0S A;  3NEM A;  4N8F A;  2QDB A;  5E1F A;  4A3E B;  1SRU A;  1XPR A;  3Q23 A;  1CKN A;  4A3E H;  1TY0 A;  3CQZ B;  2K4K A;  3TZU A;  2LSS A;  3CQZ H;  2BH8 A;  4X64 L;  5CYU A;  4IFD G;  5K5P A;  3GV3 A;  1ZKO A;  1C0A A;  2JK8 A;  4J1M A;  2B2Y A;  2KBN A;  4CDF C;  5K36 H;  4CJ2 C;  1N33 L;  1LUZ A;  1B2T A;  4KN7 C;  3D3R A;  1GJX A;  4MNO A;  1GUG A;  3H6M A;  3MC0 B;  4XTC S;  3U58 A;  1RIP A;  4DNT B;  4JPB W;  2Z6K A;  2KCN A;  3K5O A;  2XN9 C;  3T16 A;  2JEA I;  2K14 A;  4DV1 Q;  2A69 C;  5IY0 A;  3GTK B;  4V0B A;  1I4P A;  1TWH B;  1VQ9 A;  5FLM H;  4IO9 A;  3PIP A;  3CPW A;  4N9T A;  3DMU A;  3GTK H;  2N3S A;  1TWH H;  4DXF A;  5C3W A;  1NAP A;  1KRS A;  5FLX E;  2L4N A;  1O7Y A;  3LX0 A;  1RL2 A;  4B3M Q;  1F2Y A;  3SEB A;  1B7Y B;  3O13 A;  1WTX A;  1M1K C;  2F0G A;  2E2J B;  3K5M A;  1G2T A;  4DR6 L;  2UXB Q;  2JQO A;  4IZ8 A;  2E2J H;  2Q2H A;  3OW2 A;  3ICE A;  1M8A A;  2WAC A;  4WJW A;  2WB1 G;  5M3F B;  2HHH L;  1PVO A;  4K5X A;  3A8J E;  2QA4 A;  2CFM A;  1BDO A;  1EQQ A;  3RMH A;  2VQE Q;  1OXX K;  1ROD A;  3TBI B;  1K0R A;  4DU9 A;  3GTM B;  3SHL A;  4ZQ3 A;  4AIM A;  1WTQ A;  3LWE A;  2ZJQ A;  3G6J B;  5CC4 A;  4XXE A;  4DV0 L;  3OTO L;  3CCU A;  5BR8 L;  4GOP B;  2RBM A;  3S16 B;  1WOC A;  2R3Z A;  2K32 A;  4RGN A;  2R61 A;  1JMC A;  2NN6 H;  4L5S A;  3R8B A;  1IKM A;  3S16 H;  1NR2 A;  3WWV A;  1PLF A;  1LTI D;  2L5T A;  1G8Z D;  3K8A A;  4QIW B;  1D8L A;  1LTA D;  5LMU L;  3HOZ G;  4DV0 Q;  1M90 C;  5BR8 Q;  1XJV A;  2CH4 A;  1X54 A;  1ZYR C;  1SND A;  4E6I A;  4JBM A;  3JAM E;  4DV7 Q;  3PF4 A;  1L2F A;  1K8G A;  2WAQ G;  3STB C;  4IFD I;  5C44 G;  2DUD A;  4FF4 A;  1XNR Q;  4FO2 A;  4HAE A;  4R8I A;  4ZLT F;  3TP8 A;  1SYF A;  2CQA A;  2HUG A;  4G7Z C;  1I94 L;  4CJ1 B;  2MJ8 A;  2JP1 A;  1N34 Q;  2EZV A;  1I4H A;  1XTD A;  3WOF A;  1QVC A;  1R9T B;  2A73 B;  2GVB A;  3I7F A;  1HZC A;  2F0L A;  1UE7 A;  1R9T H;  1B9N A;  1GKH A;  2IHF A; 
#chains in the Genus database with same CATH homology
 2PI2 A;  2HQL A;  4JV5 Q;  3KF6 A;  5GAD C;  3GTO H;  4DR7 Q;  2LXJ A;  1AE2 A;  1IYJ B;  1CSP A;  2OCE A;  3PUV A;  4H02 A;  3CME A;  4HJA A;  2BA0 A;  1I94 Q;  5HY6 A;  3GTQ H;  3S14 H;  1PH6 A;  2K50 A;  1VQL A;  3HOY H;  5JJK A;  2A19 A;  4R4Q A;  2VW9 A;  2MO1 A;  4LW1 A;  4GNX B;  4O2D A;  1TXY A;  1FJG Q;  2PQA A;  4GKJ Q;  1XMO L;  4BXX H;  2B3G A;  1NMG A;  1UWV A;  5ELN A;  3E9I A;  4DV1 L;  4DUZ Q;  1YIJ A;  3Q8D A;  4OX9 L;  4A3E G;  1Q1B A;  3TS2 A;  1K73 C;  3AQQ A;  1K8A C;  3PV0 A;  3ERS X;  1HNX Q;  1OXU A;  1OXT A;  1Q82 C;  4BY7 H;  1PV4 A;  3UDF A;  3K7A H;  2I0Q A;  2HT1 A;  1I3Q H;  4DV5 L;  4LF5 Q;  1E24 A;  3RR5 A;  2EXD A;  4B3M L;  3HOY G;  4OO1 I;  2VY3 A;  1SN8 A;  4IPH A;  1H95 A;  1GO3 E;  4KHP L;  3NBH B;  4OX9 Q;  2UXB L;  4P74 A;  4JI0 Q;  4BBS H;  1KXL A;  3CP0 A;  4B3S Q;  3K0X A;  4BXX G;  1O7I A;  4Y52 H;  1MIU A;  4DR1 L;  4GS3 A;  4DR5 Q;  2RF4 A;  1CKM A;  3AYH B;  5M3M H;  4LFC Q;  1WI5 A;  3H0G H;  3NEN A;  3I4O A;  2UUC L;  3LGJ A;  3T1Y Q;  5C4X G;  1VQC A;  2N49 A;  2YU9 H;  3CCM A;  4LFA Q;  2RHS B;  4BY7 G;  2JEB I;  2YV5 A;  4DV2 Q;  4GLA C;  4JI1 Q;  2E2H H;  1QUQ A;  3HKZ E;  1GVP A;  1LTL A;  1J5E Q;  2JA7 H;  2VQE L;  1A0I A;  1Y1V G;  2I5H A;  4JI6 Q;  1IBM L;  1Y14 B;  2UXC Q;  1U5K A;  4DR1 Q;  3S1N H;  4EQ5 A;  2KHJ A;  1W3S A;  1VQ7 A;  1K9M C;  3S24 A;  4ME3 A;  3F2C A;  3HOU H;  4DAM A;  4A3L G;  5ELO A;  2GN5 A;  1VQI A;  3S15 H;  1E7Z A;  4L5T A;  3F2B A;  2B29 A;  3HOX H;  1E3P A;  2E2I H;  3J7A 5;  1HJP A;  1S40 A;  3JAM c;  1HZ9 A;  1WJJ A;  2PI2 E;  3BJU A;  1V43 A;  3JAM i;  2UUA Q;  3ULL A;  1ASZ A;  1IBM Q;  4DR3 Q;  1HNW Q;  4JYA L;  1VQB A;  4OXP A;  1XPO A;  2MQH A;  3ULP A;  4HID A;  4A3D H;  1D7Q A;  3G71 A;  1EQR A;  3CCJ A;  4NXN Q;  1VCI A;  4JI5 L;  4LUV A;  4JI2 Q;  4DR2 Q;  3PO2 G;  3UE0 A;  4NXM L;  4R4C A;  1PH2 A;  4JI4 L;  3HOU G;  1N9W A;  1VQ6 A;  1WFQ A;  1Q81 C;  4J15 A;  3KF8 B;  4DV7 L;  4A3K G;  2E8G A;  5GAE C;  1AE3 A;  4GKK Q;  3HOX G;  4JI7 Q;  5JEA G;  1PH4 A;  4A3I H;  1XNR L;  1PFS A;  3GDE A;  4KI0 A;  2R6G A;  5H1S E;  3A5U A;  4A3C H;  2FXQ A;  4K0K Q;  4DV4 Q;  1YEZ A;  3K81 C;  4IJL A;  4BBR G;  3CCQ A;  1MJE A;  5JJI A;  4LFB Q;  4UP9 A;  1TWA H;  5DLQ E;  2B63 H;  3F2D A;  4IOC A;  1EIY B;  4NXM Q;  3M4P A;  1FL0 A;  3S1M H;  4DV6 Q;  2JE6 I;  1Z9F A;  1N34 L;  1PH1 A;  1IBL L;  2KHI A;  2ZM6 L;  4X6A H;  3W5O A;  3AFQ A;  2ZJR A;  4JI3 Q;  3I2Z A;  4LF8 L;  4DNI A;  2K5H A;  4YWL A;  2F52 A;  4AYB E;  3DM3 A;  4C3H H;  3HOV H;  3J81 j;  4R4I A;  4LF6 Q;  2E5L L;  2NN6 G;  3RZD H;  4LF6 L;  2NZH A;  3GTL H;  1UE1 A;  4DUY L;  2VS1 A;  2NZO A;  4JV5 L;  3GTJ H;  1SFO H;  2JA8 H;  4DR7 L;  4P72 A;  1VQO A;  1Y1W G;  2V1C C;  1X6O A;  3KJP A;  1IXR A;  1WYD A;  2Y0S E;  3PUY A;  2EQS A;  2WB1 E;  3CC4 A;  3HKS A;  1XNQ Q;  2IY5 B;  1X3G A;  2ZM6 Q;  1FJG L;  5M5Y H;  1KD1 C;  3SGI A;  4YHH Q;  2B63 G;  3KLW A;  4A3G G;  3EBE A;  2PMZ E;  4YWK A;  4GKJ L;  4TVA B;  2OQ0 A;  4DV3 Q;  2R93 H;  2KEN A;  4LWC A;  3A0J A;  3BU2 A;  3CCS A;  2AMC B;  3UE1 A;  4HIO A;  4DUZ L;  2JA9 A;  2DGY A;  2UUB Q;  4DUY Q;  3HOV G;  1MJC A;  4POG A;  1PA6 A;  1HR0 Q;  1HNX L;  4B3T Q;  1CKO A;  3KF6 B;  1KRT A;  4L5Q A;  4A75 A;  4OWW B;  5FLX c;  2JA8 G;  3CW2 C;  2ES2 A;  2ZTC A;  1N8R C;  2R7Z H;  2CCZ A;  4LF5 L;  4A3M H;  3F1Z A;  3G6E A;  1GD7 A;  4OON A;  2PQA B;  2WFW A;  3GO5 A;  3RNU A;  1Z47 A;  3H15 A;  4YCV A;  3CCE A;  4HIM A;  2H5X A;  4JI0 L;  3M3Y H;  5IWA L;  2VQF Q;  4B3S L;  1VS0 A;  1LM0 A;  4A3B H;  2R93 G;  4C3J H;  1EOV A;  3T1H Q;  4DR5 L;  3OYY A;  5JJL A;  4LFC L;  1TWF H;  3U50 C;  1GM5 A;  1VQN A;  3PGZ A;  4GLX A;  4A93 G;  1A62 A;  3T1Y L;  1BBW A;  2JA6 H;  1VQM A;  3KFU A;  4LFA L;  1X3F A;  3H3V I;  4QY7 A;  2ID0 A;  1G29 1;  1X3E A;  4DV2 L;  4JI1 L;  3ULJ A;  1J5E L;  2WAQ E;  2R7Z G;  1YBY A;  4JI6 L;  3CCR A;  4HJ9 A;  2AWN A;  5IWA Q;  1VQA A;  1EIF A;  2D0P A;  4KLK A;  2UXC L;  3K7U C;  1CSQ A;  4GN3 B;  2CWA A;  2MO0 A;  4GN5 A;  4X64 Q;  4QGU A;  1PH7 A;  4A3B G;  4DKA C;  2HIX A;  2D62 A;  1MKH A;  3CPF A;  2UXD Q;  4AQY L;  4IPD A;  3RN5 A;  1V1Q A;  5GAG C;  3PUW A;  1KIX A;  3TEH B;  2OTL A;  2JA6 G;  3PCO B;  2K5V A;  2UUA L;  1N33 Q;  4QIW E;  1TWG H;  2VUM H;  4JBJ A;  4JI8 Q;  1E22 A;  3FKI H;  3U4V A;  4DR3 L;  1QUQ B;  1PH9 A;  1HNW L;  1IBK Q;  2UU9 Q;  1YHB A;  3DLL A;  2OTJ A;  1OTC A;  4X65 Q;  4UPA A;  3D31 A;  1L1O A;  4R4O A;  2IT1 A;  5IP9 H;  4NXN L;  4BBS G;  1YHA A;  5EAY A;  4AQY Q;  3PO3 H;  5E7N A;  2D0O A;  1L1O B;  1VQH A;  5M3M G;  3J7Z C;  4DR2 L;  4JI2 L;  3H0G G;  1G51 A;  1JJG A;  1NE3 A;  4YY3 L;  1UE5 A;  5GRO A;  3CF5 A;  2NVT H;  1B8A A;  1NTG A;  4BA1 I;  5AJ3 Q;  5JEA J;  4JBK A;  1YI2 A;  3S2H H;  4GKK L;  1QZG A;  4JI7 L;  3UDI A;  4LF7 Q;  3ZJY C;  4AYB G;  1T9H A;  3D0F A;  1U0L A;  2YTX A;  4P71 A;  2JA7 G;  3PIO A;  2VUM G;  4K0K L;  4WJ4 A;  1NMF A;  2OQK A;  5C4J H;  4DV4 L;  3FKI G;  1PYB A;  1IL2 A;  3PSI A;  4OO1 G;  1SLJ A;  1P16 A;  4KHZ A;  1VQ5 A;  4LFB L;  1EWI A;  4A4I A;  2F3I A;  4QQB X;  5C3E H;  5LMN Q;  2JA5 H;  2F4V Q;  2Y0S G;  4QJF A;  4YY3 Q;  5IP9 G;  3KJO A;  1KQS A;  2Q2U A;  4DV6 L;  2NN6 I;  2QEX A;  3PO3 G;  2N8N A;  3FHW A;  2R7D A;  5M3F H;  1NJI C;  5IYD H;  4O0A A;  5C0X G;  1KAW A;  4OWT B;  3M9B A;  4JI3 L;  1W2B A;  1KL9 A;  1HR0 W;  4L5R C;  1LYL A;  3A5Z B;  4DR6 Q;  2ALY B;  1WCM H;  2IX0 A;  2ATW A;  3L2P A;  1VQG A;  1YNX A;  2R92 H;  2CKZ B;  1VQD A;  1C7Y A;  2BA1 A;  4LF9 Q;  3PUZ A;  4NB3 A;  3HOZ H;  1X55 A;  1VQE A;  2NVX H;  4BY1 H;  3CCV A;  4BA2 I;  3A74 A;  1G6P A;  4A3D G;  4HJ5 A;  3GTM H;  2AHO B;  4GOP A;  1B70 B;  2HHH Q;  3S1Q H;  2QGQ A;  4HJ7 A;  1XPU A;  3CAM A;  1XNQ L;  4RG1 A;  4X66 Q;  3S17 H;  3B6Y A;  4YHH L;  2JA5 G;  1UE6 A;  5FJ8 H;  3PUX A;  3TRE A;  2XTI A;  2IHE A;  4DV3 L;  1BKB A;  3VDY A;  4LF4 Q;  4GLV B;  2JJQ A;  4A3F H;  2XGT A;  2CQO A;  4XIG S;  4AH6 A;  2NVY H;  4A3J H;  1JE5 A;  2UUB L;  4YCW A;  1N36 Q;  4JBW A;  1XMQ Q;  4C2M H;  4A3I G;  1I50 H;  3K80 C;  3RLO A;  1WCM G;  3RN2 A;  4A3C G;  2I5M X;  3RLN A;  1J6Q A;  4DAY B;  1HR0 L;  2R92 G;  4DK6 C;  1S72 A;  4B3T L;  3MXN B;  3EN2 A;  3OTO Q;  4NPS A;  4FDB A;  2ZJP A;  4PZ8 A;  4LUZ A;  1BBU A;  1SE8 A;  4LUO A;  4P73 A;  5IP7 H;  5FJ8 G;  4YCU A;  1QVG A;  2L15 A;  3ER0 A;  4X62 Q;  2VQF L;  1X9N A;  1PH5 A;  5M5W H;  3I55 A;  3F8T A;  1S3O A;  4A3F G;  4DR4 L;  3T1H L;  4R1J A;  2R7F A;  4JOI A;  1N32 Q;  4JC0 A;  2AWO A;  1NY4 A;  5LMU Q;  1VQ4 A;  1JT8 A;  3L7Z C;  4TQU S;  3CC2 A;  1IZ6 A;  4UP8 A;  1SR3 A;  2Z0S A;  1TWC H;  3NEM A;  3W1B A;  3BZK A;  1EYG A;  3M85 A;  1A63 A;  3U4Z A;  2I5L X;  1SRU A;  2CWP A;  1X56 A;  5IYC H;  1XPR A;  1JJ2 A;  1CKN A;  3HKZ G;  4UY8 C;  3G4S A;  4A3E H;  4YWM A;  4DK3 C;  4B3R L;  4P75 A;  4QL5 A;  4DPG A;  1CUK A;  4WJ3 M;  3RZO H;  2K4K A;  2YYZ A;  2LSS A;  4DR4 Q;  4APV A;  3CQZ H;  5IE8 A;  1K83 H;  2BH8 A;  5IP7 G;  4X64 L;  2YTV A;  4IFD G;  5GAH C;  3HFZ B;  3I56 A;  2UXD L;  1X65 A;  2A1A A;  4GNX A;  1YHQ A;  1C0A A;  1L1O C;  2JK8 A;  2K52 A;  2KBN A;  3BZC A;  1BVS A;  1VQK A;  1N33 L;  3HOW H;  4B3R Q;  1Q46 A;  4JI8 L;  1LUZ A;  4JG2 A;  5IYC G;  3AFP A;  4A3M G;  2HIV A;  5IYB H;  5LMN W;  4GN4 B;  3AEV A;  1IBK L;  2UU9 L;  4ALP A;  3CC7 A;  2RHQ B;  5C4X H;  4X65 L;  4MNO A;  1PH8 A;  1VQP A;  1Q12 A;  4XTC S;  3U58 A;  1VQ8 A;  3CMA A;  2VZA A;  1RIP A;  1QVF A;  2LXK A;  1UEB A;  1YJ9 A;  2Z6K A;  4HIK A;  4LNQ A;  1Y1V H;  2N78 A;  5AJ3 L;  1HZA A;  1P8L A;  2K75 A;  1XMO Q;  2JEA I;  3H3V H;  4LF7 L;  1Q8K A;  4PG3 A;  2MNA A;  2K14 A;  4DV1 Q;  2KCM A;  3L0O A;  5K36 G;  3HOW G;  1NBW A;  1E1O A;  5IY0 A;  3W1G A;  1KC8 C;  1YJW A;  1VQ9 A;  4A3L H;  1AH9 A;  5FLM H;  4IO9 A;  4UP7 A;  5IYB G;  3PIP A;  1OXV A;  3CPW A;  3GTK H;  2N3S A;  1TWH H;  2EIF A;  5C0X I;  3CXC A;  5LMN L;  2F4V L;  3M4O H;  1KRS A;  1YJN A;  3I4N H;  1V9P A;  4DV5 Q;  5C0X J;  4GOP C;  1RL2 A;  4B3M Q;  1B7Y B;  1PHJ A;  3KYH C;  1M1K C;  4DR6 L;  4KHP Q;  5M5X H;  2UXB Q;  2JQO A;  4R4T A;  2E2J H;  2Q2H A;  1HNZ L;  4LF9 L;  3OW2 A;  3M7N A;  4A76 A;  3E0E A;  3ICE A;  3PO2 H;  2UUC Q;  4RMF A;  1JJC B;  5FLM G;  2WB1 G;  3IRB A;  2HHH L;  1KHI A;  1DGS A;  4A3K H;  1PVO A;  2VNU D;  2QA4 A;  2Q2I A;  2CFM A;  4X66 L;  1VQJ A;  1EQQ A;  1HZB A;  1SRO A;  4LF4 L;  3I4N G;  2VQE Q;  1OXX K;  3KDF A;  4BBR H;  1K0R A;  1HNZ Q;  5J3B A;  1XMQ L;  1N36 L;  1PH3 A;  5IT9 c;  2BH2 A;  4AIM A;  3KDF B;  4IPC A;  2VL6 A;  2ZJQ A;  1Q7Y C;  4DV0 L;  4JOI C;  3OTO L;  3CCU A;  1JB7 A;  5BR8 L;  4GOP B;  5C3E G;  4IPG A;  5C44 H;  1WOC A;  3CD6 A;  1SMX A;  4L5S A;  1JMC A;  3S16 H;  5M3F G;  3WWV A;  5IYD G;  1Q86 C;  1K3R A;  2ASB A;  4PZ7 A;  5GQO A;  4JYA Q;  3MEF A;  4X62 L;  1Y1W H;  4POF A;  3I4M H;  2OWO A;  4PMW A;  4IJH A;  3K8A A;  1YVC A;  1C9O A;  3PF5 A;  1N32 L;  1VQF A;  3NEL A;  1D8L A;  4JI5 Q;  3M4Q A;  5LMU L;  3S1R H;  2WP8 J;  1HH2 P;  4DV0 Q;  3J80 c;  3HOZ G;  3EIV A;  1M90 C;  2RCN A;  2AKW B;  3J80 i;  4BY1 G;  5BR8 Q;  1XJV A;  5HGQ A;  4A3G H;  1X54 A;  4JI4 Q;  3GD7 A;  3TRZ A;  2ZTD A;  4JBM A;  1EUJ A;  4DV7 Q;  4GNX C;  2NVQ H;  1L2F A;  3UDG A;  3PF4 A;  1K8G A;  2GVA A;  2WAQ G;  3STB C;  3J81 c;  1I5F A;  2MFI A;  3J81 i;  4IFD I;  5C44 G;  4EX5 A;  2DUD A;  1FGU A;  3RLF A;  2K5N A;  4MTN A;  1XNR Q;  4PZ6 A;  4HJ8 A;  3GTP H;  1FVI A;  1E1T A;  4MZ9 A;  1QZH A;  3S2D H;  1PYS B;  2PNH A;  1L0W A;  3TS0 A;  4IFD J;  2Q2T A;  3TQY A;  4A3J G;  2IX1 A;  4IOA A;  2C35 B;  3UDX A;  3CCL A;  3G48 A;  2YTY A;  4Y7N H;  3I4M G;  3FP9 A;  2KCT A;  1I94 L;  4C3I H;  1Q1E A;  4OWX B;  1N34 Q;  1EFW A;  3GTG H;  1IBL Q;  1OXS C;  1XTD A;  2A8V A;  3STB D;  1QVC A;  1YZ6 A;  2Z6K C;  3E9H A;  4LF8 Q;  2GVB A;  3JC6 6;  3I7F A;  1ASY A;  1HZC A;  1CKN B;  1UE7 A;  1I6H H;  2ZTE A;  1YIT A;  3KOJ A;  4JCV E;  2E5L Q;  1R9T H;  1GKH A;  1A8V A;  2IHF A;  4A93 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...