3CP0A

Crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
b'SPRALVGHRAEVLEDVGATSGQVRLDGSIWSARSMDPTHTFAEGEIVSVIDIQGTTAIVWKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane protein implicated in regulation of membrane protea
publication title The crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from Corynebacterium glutamicum.
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Membrane protein
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cp0A00
4X65L 1VQMA 4QL5A 1KRSA 2VL6A 4JOIA 1P16A 1YBYA 1VQPA 1M90C 3J80i 1YITA 1EQRA 1XNQQ 1IBLQ 1EIYB 1M1KC 1PH6A 2BH2A 2EXDA 1VQ4A 2K14A 4LF4Q 2KCTA 2PI2A 5C4XH 1IYJB 1NBWA 2I5MX 2WAQE 5ELNA 5M5WH 1HZAA 1K83H 4GLAC 3K7AH 2UU9L 4DV3Q 1Q1EA 1VQBA 3CQZH 3PIPA 2IHEA 1JJ2A 4JBKA 2PQAB 4BA2I 1JJGA 4UP7A 5DLQE 1A63A 5IP7H 4GN3B 4YWLA 4A4IA 3CMAA 3M4PA 3G48A 3T1HQ 5K36G 4HJ5A 5C44H 3UDFA 3S1QH 4LFCQ 1N33Q 4LF5Q 4GNXB 3CCVA 2JA5G 3RNUA 4A3JG 2VQFL 1N32Q 4B3ML 2K52A 4LF6L 1B8AA 3I4NG 5FLXc 4NXNQ 5C0XG 5FJ8H 5BR8L 1GVPA 1AE3A 1QVGA 1PVOA 2XGTA 4IJLA 1PYSB 3U4VA 4QGUA 3A5UA 4AH6A 5M3MG 4O0AA 1C7YA 3TS0A 1G6PA 2ES2A 3H15A 4AYBE 3S1MH 4POGA 1E1OA 4R4QA 3B6YA 3Q8DA 1XTDA 4GNXC 1BBUA 3F2CA 2OQKA 2UU9Q 2F4VL 2JE6I 4R1JA 1N8RC 3JC66 1FL0A 2K5NA 3I56A 2YTYA 1YIJA 3MXNB 1Q81C 3HKSA 4QY7A 1XPUA 3GDEA 1E22A 4X66Q 4DR3Q 2NVTH 4GOPA 4JBWA 4DK6C 3ULPA 1EOVA 1SLJA 4R4TA 3J81j 1Q7YC 3RZOH 3I4MG 5AJ3Q 1GM5A 4KHPL 2HQLA 4X6AH 1YJWA 1HZCA 3AQQA 1CKOA 2Q2IA 2VQFQ 4B3MQ 1N9WA 1KQSA 1X9NA 4IPGA 4LF6Q 4LF7L 1OXVA 4A3FH 5BR8Q 1PH3A 1WYDA 3L0OA 4A3EG 5HGQA 1X6OA 2GN5A 3KDFB 1KL9A 5GAHC 3GTPH 4IFDG 1HNZL 3S24A 1E3PA 1VQ9A 4LF8L 1UEBA 5JEAJ 1MJEA 2A19A 2ZM6Q 3GO5A 5M3FG 4Y7NH 1IL2A 4GKJL 3GTOH 1EIFA 2R7DA 2RF4A 3PUZA 3NENA 3J81c 1OTCA 2UUCL 3FP9A 1OXUA 5C3EG 1OXTA 3JAMi 3CF5A 4JCVE 1NJIC 2F4VQ 1S72A 4B3RL 2NN6G 1CKNA 3CW2C 1W3SA 3KLWA 1KC8C 4LNQA 1I94L 2PNHA 3CC2A 1AE2A 4MTNA 1VQ7A 3HKZG 4A93H 2I5LX 3E9IA 3OW2A 4JI4L 4K0KL 3U50C 4YCVA 3RN5A 4KHPQ 5IP9G 4A3BH 2NVQH 4A3JH 4DR5L 4KLKA 4LF7Q 3I4NH 5IWAL 2NZOA 4X64L 2CQOA 2B3GA 1S40A 1PH9A 4AQYL 1QVFA 4IOAA 2JJQA 4JV5L 1HNZQ 1EWIA 2EQSA 4PZ6A 4YHHL 2Q2HA 4A76A 2K4KA 4LF8Q 5M3MH 4YCUA 1TWCH 3ER0A 4L5QA 3STBD 3ICEA 2FXQA 1U5KA 4YWKA 4DR2L 2DUDA 2WAQG 2GVAA 3CCSA 4C2MH 4GKJQ 2IY5B 2UUCQ 2PQAA 3H3VH 4UY8C 2Y0SE 3PUXA 1BVSA 2L15A 2VUMG 1I94Q 1V9PA 2MNAA 5JJLA 1RIPA 3CCUA 4GNXA 3S17H 1BKBA 2YU9H 4K0KQ 4GS3A 1PH5A 2JQOA 1JB7A 4B3SL 4BY1H 4JI4Q 3K7UC 5IYCH 1HZBA 3I4MH 1JE5A 3KOJA 3G4SA 4DR5Q 3A5ZB 2JA6H 4A3GG 2R7FA 3FHWA 4BXXG 4UP9A 5IWAQ 1PFSA 1PYBA 1QVCA 4X64Q 4JI2L 4A3CH 1TWAH 4AQYQ 1VQHA 2WP8J 4IJHA 1MKHA 1JT8A 3EBEA 3FKIG 1K73C 3BZKA 2YTXA 4HIDA 3CP0A 4JYAL 2JEBI 1CKNB 1GKHA 1A0IA 1SFOH 1FJGL 1HNWQ 1SROA 4LF9L 2N49A 4DPGA 4XIGS 4DR2Q 4RG1A 2VW9A 2AWOA 2Z6KC 4OXPA 5M3FH 4XTCS 2WB1G 1VQOA 3STBC 4A3MH 1WCMG 5C3EH 4HJ7A 2QGQA 3K0XA 3CCQA 1ASYA 3ULLA 4KHZA 1KAWA 1OXXK 1AH9A 3AFPA 1Z47A 4DV2L 1VQEA 3GTMH 4B3SQ 2KHIA 2UXBQ 1VQ6A 1K3RA 3KJOA 4IFDI 5IP9H 1QZHA 2VQEL 2R93G 1VQAA 1VQJA 1Q82C 1A62A 4HJAA 2K75A 3PO3G 3KDFA 2XTIA 2QA4A 4JI2Q 3S2HH 2BH8A 4OWWB 1TWFH 2YV5A 3UE1A 4X66L 5JEAG 4DR3L 1YJ9A 4JYAQ 4A93G 1KHIA 1FJGQ 2ZTDA 4LF9Q 2E8GA 5AJ3L 3KF6B 4A3BG 2CFMA 1JMCA 1J5EL 4PG3A 4GN4B 1QUQB 3CCJA 4OWTB 3W1BA 3S16H 2NVYH 4JI8L 1PH2A 4TVAB 4P74A 4P72A 2VUMH 4C3IH 2BA0A 4DV2Q 2PMZE 2D0PA 3S15H 2ZM6L 1IXRA 3EIVA 4J15A 3F2BA 2VQEQ 1JJCB 1GD7A 2NVXH 1WI5A 3L7ZC 3GTGH 4P71A 4PZ8A 4A3GH 4GKKL 4BXXH 1SN8A 3PUYA 4QIWE 5C4JH 2E5LL 3J81i 4EQ5A 4BY7G 4IO9A 2A1AA 3FKIH 3UDGA 1LYLA 3IRBA 5IYCG 1PA6A 2AKWB 3RR5A 2BA1A 4OWXB 4NB3A 2JA6G 2JA7G 2B63G 1J5EQ 1X3FA 4DAMA 4WJ3M 4HIOA 5M5XH 3TREA 4IPDA 4HIMA 4Y52H 1FVIA 2EIFA 3HOVG 4BBSG 3DM3A 1WCMH 4JI8Q 5E7NA 1VQGA 2Z6KA 1EYGA 3TS2A 3ERSX 4APVA 3CC4A 1PH4A 4A3IH 1I6HH 4DUYL 3DLLA 2GVBA 2ATWA 4DV4L 4TQUS 2R93H 1HR0L 5H1SE 3CCMA 4A3MG 1KIXA 4GKKQ 3HOZH 3PO3H 1BBWA 1LM0A 1HZ9A 2E5LQ 4GLXA 3HOWG 2N78A 4DV1L 1GO3E 4BY1G 1KXLA 2UXCL 3PV0A 3I4OA 3KYHC 4IPCA 2LSSA 3E0EA 1UWVA 3W5OA 2DGYA 5GROA 3M85A 1MIUA 3CD6A 1UE5A 4DV0L 1J6QA 1X3EA 3BU2A 3J7ZC 2N8NA 1YVCA 1B7YB 3GTJH 1UE1A 2RHQB 3HFZB 1HNWL 2D62A 2VY3A 4LUOA 4DUYQ 4DV4Q 1PH7A 1Q1BA 1KRTA 1HR0Q 1NY4A 2CWPA 3PGZA 1IBKL 4JI0Q 3S1RH 3PSIA 3K8AA 2Q2TA 3I2ZA 4DV1Q 2OWOA 5C0XI 2Z0SA 4BY7H 3KF6A 4DR4L 1K8GA 2UXBL 2ZJQA 1IZ6A 4LFBL 1QUQA 5M5YH 4A75A 1Y1WH 4P75A 4DR7L 1HJPA 2K5HA 2JA7H 1PV4A 2B63H 3PUWA 1UE6A 1XJVA 3GTLH 1B70B 4DV0Q 5IT9c 4MZ9A 3M4QA 3ULJA 3OTOQ 3HOVH 4BBSH 1CSQA 4A3LH 2R6GA 3RN2A 5IYDH 3NELA 5IE8A 1I3QH 3KFUA 1A8VA 1CKMA 2IT1A 3NBHB 2K50A 1G291 3K80C 4AYBG 2HHHL 4B3TL 3PF4A 3AFQA 1PH1A 2E2HH 1VQ8A 1UE7A 2KCMA 3E9HA 1IBKQ 1YHAA 4DR1Q 1NMGA 2MFIA 4FDBA 4UPAA 5LMNL 2Q2UA 4O2DA 4PMWA 4IFDJ 3HOWH 1YEZA 3LGJA 4JG2A 3A0JA 4R4OA 4JI1L 5GAEC 1TWGH 3I7FA 1TXYA 3CPWA 4A3IG 3CCLA 4DR4Q 4OO1I 4YWMA 3NEMA 1Q46A 4A3DG 4LFBQ 4BA1I 3HOUG 3KJPA 4DR7Q 3D31A 3HKZE 3UDXA 3EN2A 2QEXA 4YY3Q 3M3YH 1V43A 3T1YQ 3HOZG 2JK8A 1SMXA 1Z9FA 4OX9Q 1VQ5A 2F3IA 3L2PA 1XPOA 1XMQL 2AHOB 2NN6I 3HOYH 2ZJPA 4LUVA 1N34L 4RMFA 4LWCA 2JEAI 1DGSA 1L2FA 2HHHQ 5LMUQ 1D7QA 4B3TQ 1V1QA 2MO0A 3UE0A 2A8VA 2OCEA 2YYZA 4P73A 1EQQA 3SGIA 2MO1A 1PHJA 1VQKA 1T9HA 1VS0A 4C3JH 5LMNQ 3KF8B 2D0OA 4JI1Q 4A3CG 2ASBA 2VNUD 1P8LA 3S14H 2RHSB 4NPSA 3W1GA 4HJ8A 1LUZA 1HR0W 2R7ZG 3H0GG 4JC0A 4BBRH 3J7A5 3S1NH 1L1OB 2UXDL 4R4IA 4LFAL 1VQDA 4ME3A 5GADC 1XNRQ 5HY6A 4JI6L 1R9TH 1XMQQ 3PUVA 3CCRA 1YHQA 2CCZA 4GLVB 3TEHB 2OTLA 3J80c 1NE3A 5EAYA 5JJIA 1N34Q 3OYYA 2H5XA 4DUZL 2K5VA 4X65Q 1Y1WG 4R4CA 3GTQH 1C9OA 2ID0A 2NZHA 5JJKA 1WFQA 2JA9A 1CUKA 3GTKH 1L1OC 1XMOL 4L5SA 4DKAC 4DAYB 2Y0SG 2WB1E 4A3LG 4X62L 1MJCA 2HIXA 4PZ7A 3TRZA 5IYDG 3CAMA 4AIMA 4WJ4A 2OTJA 2JA8G 2KENA 2B29A 2CWAA 3G6EA 3F2DA 2PI2E 2KHJA 4DNIA 4A3DH 1HH2P 1HNXL 3HOUH 3HOXG 4HJ9A 4IPHA 3PO2H 2UXDQ 3PF5A 4LFAQ 4HIKA 4JI0L 4NXML 5IY0A 1YZ6A 2IX0A 1VQCA 4JI6Q 1K9MC 3ZJYC 4EX5A 1D8LA 3M9BA 2ZTCA 1K8AC 2UXCQ 2E2JH 4DR6L 5IYBG 5J3BA 1SRUA 3M4OH 3AEVA 1X65A 4JI5L 3AYHB 2AWNA 1IBML 4DUZQ 3UDIA 1SR3A 5GQOA 3RZDH 1NTGA 4OO1G 1XPRA 5FLMG 1E7ZA 1Y1VG 3U4ZA 2IHFA 4H02A 5ELOA 1QZGA 1VQLA 1EUJA 1YJNA 2E2IH 2I0QA 2UUBL 2LXJA 2HT1A 4JOIC 4A3KG 1XMOQ 1X3GA 1VQIA 1N36L 1X54A 3OTOL 1W2BA 2IX1A 4JI3L 4X62Q 1CSPA 2R92G 4MNOA 1YI2A 2KBNA 2UUAL 4JBMA 4L5RC 3HOYG 3RLNA 4QJFA 2AMCB 1E1TA 3MEFA 5C0XJ 2I5HA 3BJUA 1Y14B 1TWHH 3H0GH 1HNXQ 4QQBX 1K0RA 1VQNA 4YCWA 4DV5L 5LMNW 5C4XG 1L0WA 4DR1L 4NXMQ 1WJJA 1X56A 2ZJRA 4GN5A 1I5FA 4C3HH 3VDYA 2JA5H 4LUZA 1G51A 4JBJA 4DR6Q 3K81C 1Q86C 3PIOA 3BZCA 3D0FA 1IBMQ 4JI5Q 2C35B 4OONA 3M7NA 3GD7A 5GAGC 1YNXA 1OXSC 4BBRG 3F1ZA 2OQ0A 5IP7G 3CPFA 1NMFA 4YY3L 4DV7L 5C44G 1YHBA 1VQFA 3T1YL 2VS1A 3RLOA 4DK3C 2UUBQ 4LW1A 1N36Q 4OX9L 4JI7L 4GOPB 3H3VI 1RL2A 3JAMc 4JI3Q 2R7ZH 1C0AA 2ZTEA 2UUAQ 2WFWA 5FJ8G 3CCEA 2YTVA 4DV6L 1I50H 1ASZA 4B3RQ 2ALYB 2JA8H 1L1OA 4IOCA 2RCNA 3RLFA 5LMUL 1XNQL 1IBLL 2VZAA 1VCIA 4L5TA 4POFA 3HOXH 1Q12A 4DV5Q 1KD1C 3CC7A 2CKZB 1SE8A 4LF4L 1H95A 2F52A 2V1CC 3WWVA 3CMEA 1O7IA 3S2DH 4GOPC 2LXKA 1S3OA 1U0LA 5IYBH 4DV3L 4A3EH 4JV5Q 2MQHA 1LTLA 3PO2G 4DV7Q 4YHHQ 5FLMH 3CXCA 1Y1VH 3T1HL 4ALPA 1EFWA 3PCOB 4UP8A 1X55A 4LFCL 3I55A 1PH8A 3F8TA 1FGUA 4LF5L 4JI7Q 4A3KH 1N33L 1XNRL 3A74A 1N32L 2HIVA 1WOCA 4KI0A 2N3SA 4DV6Q 1Q8KA 4NXNL 2R92H 4A3FG 3G71A 3U58A 3TQYA 1E24A
chains in the Genus database with same CATH superfamily
1EQTA 1VQMA 3HP3A 1P16A 3J7AF 2HD3A 1VQ4A 2K14A 1VF5C 3NSWA 1IYJB 5M5WH 5ELNA 4HAEA 1HZAA 1LT3D 1NNXA 3NP8A 4UP7A 1VDZA 1E2VA 5CMDA 5IP7H 4LAAA 4A4IA 5K36G 3M4PA 4L6TB 4ABNA 5E4WC 4A3JG 4KV6A 2VUMB 3JAML 2K52A 1B8AA 1STEA 2EYPA 4M8AA 1QVGA 1AE3A 1H9JA 3DWAA 2NVXB 1PYSB 3U4VA 5M3MG 4O0AA 3TS0A 4AYBE 4K6LA 3B6YA 3Q8DA 2EYFA 4GNXC 1BBUA 3F2CA 3FKIB 5KNDA 1HA6A 2JE6I 1CQFA 3JC66 3MXNB 1E22A 4Q5VA 1LTSD 3HRZC 3UI2A 1WCMB 4KHPL 1C4QA 1PRTB 1QE6A 4LF6Q 1X9NA 4IPGA 2F0EA 4CDDC 4CKBA 4A3IB 2K32A 5BR8Q 5KYIA 2F0UA 1U9RA 1X6OA 4G7OC 1HTLD 4ID6A 1E3PA 3GQBA 4KMUC 2K04A 1STBA 3S24A 2R93B 4X3SA 1UEBA 1QWYA 5JEAJ 2NTSA 2A19A 2ZM6Q 3GO5A 3OW7A 4Y7NH 4ODGA 1EIFA 4CHTB 2R7ZG 3NENA 5C3EG 2F4VQ 4N8X1 2NN6G 2IWHA 4LNQA 1DD2A 2CW0D 3VR3A 3K5NA 4A93H 4K0KL 4JI4L 4A3BH 1G91A 3FRPB 4DR5L 3GTJB 4LF7Q 1V1PA 4XXEA 3H94A 5C0XH 2CQOA 3FDTA 1MHWC 2JJQA 3HG9A 1HNZQ 4YHHL 1KLGD 4LF8Q 1B44D 3Q23A 4YCUA 3S1RB 1TWCH 2D9UA 4G4KA 3DHQA 4GKJQ 2IY5B 2EXZA 1PFBA 3SK4A 2BE5D 2PQAA 1B4OA 2QCPX 1VMCA 1I94Q 2MNAA 4ZK9B 2B63B 2KEDA 2VB2X 5JJLA 1BKBA 2QKIC 3GV3A 2UXCQ 1JB7A 4KY7A 5I9OA 5EKKA 5KEEA 3G4SA 4KN4C 2NTTA 4A3GG 2EY2A 3FHWA 5D3IB 1I3QB 5IWAQ 3TBIB 2WP8J 4IJHA 4N9PA 4HIDA 2YTXA 4DN4M 1SFOH 1B2TA 3G6JB 1DJRD 4IQZA 4RHSA 3ERQA 2F0FA 1LTID 4XQJA 4BY1B 3J81L 3SK8A 2QGQA 3K0XA 1ICFB 1JB3A 4OL7A 2B8FA 1VQEA 4B3SQ 1K3RA 5IP9H 1VQJA 1Q82C 2XRSD 3KDFA 2E2IB 1IW7C 1ESRA 4JI2Q 3S2HH 1RDPD 1Q8IA 1TWFH 5JEAG 3UE1A 1LT5D 3I73A 2K05A 5EBDA 1KHIA 2ZTDA 1AN8A 2E8GA 5AJ3L 3M7GA 3D4RA 2EJMA 1JMCA 2PCFB 4PG3A 1QOHA 2L55A 4OWTB 4ZUIA 3W1BA 2B2VC 4RGMA 4QB4A 2AQ1B 2L4NA 4DV2Q 1PRTD 4WORA 2D0PA 2VQEQ 1GD7A 4DF7A 1L0YB 3L7ZC 3KLSA 4PZ8A 2EVBA 3PUYA 2E5LL 2ICEC 2Z4HA 4BY7G 2BCOA 2DNEA 3E5SA 1BCPD 2AKWB 1M4VA 2B2TC 2BA1A 4NB3A 2JA6G 1J5EQ 4Y52H 3P1HA 4DNRB 4JI8Q 4B08A 5E7NA 1KDCA 1EYGA 2L1BA 1SYEA 4XYQA 2MPMA 1LABA 2KEEA 2E2JB 4DAPA 5JJZA 1BQQT 1HR0L 5H1SE 3CCMA 4A3MG 4GKKQ 3HOZH 2WINB 2N78A 2D5DA 1TKWB 2X6GA 3I4OA 2XSCA 4IPCA 1TS5A 2ZXPA 3E0EA 3TSSA 1IKMA 2G5DA 1BCPC 3M85A 5GROA 2AUJD 1TY2A 1UE5A 4K8JA 1J6QA 1F2YA 4R8NA 1TS2A 2F0VA 3H0GB 4IALA 4TSSA 5CV4A 5C4HA 2Q8TA 4C3HB 1JR0D 4DV4Q 4K5VA 1KRTA 2ZT9C 4JI0Q 1JORA 1H9SB 3PSIA 2Q2TA 5AFWA 4QUFA 5J22A 3KF6A 5M3MB 2KUMA 2K28A 4LFBL 3DWPA 1QUQA 1JOQA 4P75A 1LV9A 2K5HA 2JA7H 2RA4A 1E2WA 4DV0Q 3HOVH 3OTOQ 2H1EA 2HCIA 2R6GA 3RN2A 3KFUA 1F9SA 5F2DA 3K80C 4AYBG 2HHHL 5JOBA 4B3TL 1VQ8A 3NUCA 2FMCA 1XWEA 1TY0A 4KY5A 2Q2UA 2EYJA 1S5DD 2O4XA 3HOWH 3LGJA 4R4OA 4JI1L 3CPWA 3CCLA 2QW7A 3Q22A 3HOUG 4ZYSA 3D31A 3HKZE 3M3YH 4YY3Q 2R7ZB 3NWTA 2JK8A 4QUCA 2F3IA 5M9OA 5D3DA 3L2PA 5C6AA 2NN6I 3G7LA 3HOYH 5C4XB 1CHPD 2JEAI 1DGSA 3C1EA 1D7QA 1K83B 1V1QA 3UE0A 1BXTA 5C3XA 2WV6D 1HCZA 1QILA 2WKCA 3CQZB 5LHY1 2KQ3A 5C44B 3BDLA 4NPSA 1GOZA 1LTAD 1LUZA 1HR0W 4LJZC 5CYUA 3J7A5 1K28A 4OHJA 5HY6A 1IYUA 5CV9A 1AEXA 3A54A 3CCRA 3D6WA 4V0BA 1LACA 4MHEA 5EAYA 4UAIA 4DUZL 1Y1WG 4H0LC 2DNCA 3GTKH 1XMOL 4DAYB 1MJCA 1ZYRD 4PZ7A 3VYTA 4RGOS 5IYDG 3RZOB 2OTJA 4OELB 2JA8G 2KENA 2CWAA 1I4HA 5FKAC 4DNIA 4UHVA 1HNXL 4IPHA 3O13A 4B9WA 4HIKA 3BG3A 4K2KA 1B9MA 1YZ6A 5IY0A 4JI6Q 2B2WC 1DOLA 5D65A 2QDLA 4DR6L 2L0CA 3NBHA 1SRUA 3M4OH 3AYHB 2AWNA 1NTGA 3DM1A 4IUTA 4OO1G 1XPRA 1F9PA 1E7ZA 4KN7C 1QZGA 1EUJA 4A3CG 4C56C 2I0QA 2LXJA 4A3KG 1RTOA 1PRTF 3MZ5A 4JI3L 2IX1A 2PNRC 2R92G 3MEHA 3DXJC 1PZJD 4QJFA 3J7AV 5C0XJ 2NVQB 3BJUA 3Q6SA 1HHVA 1BR9A 3I4NB 1E2ZA 4DV5L 4DK1A 3LX0A 3OWEB 3A8JE 1IBMQ 3GD7A 1OXSC 4BBRG 3F1ZA 5IP7G 5IGGA 4IURA 1STHA 1K8MA 4OX9L 1RL2A 1C0AA 3S17B 1PTOH 2UUAQ 2F3VA 2YTVA 1I50H 5EJWA 3I4MB 2RSNA 4IOCA 3RLFA 1XNQL 2JA6B 3HOXH 5EGTA 3P20A 2CKZB 5EKIA 1F9QA 3S2DH 4QF4A 3FEWX 1S3OA 5IYBH 1JC7A 5M3FB 4IZ8A 2MQHA 3PO2G 4DV7Q 1XTCD 4YHHQ 4A3MB 1O80A 3PCOB 4LFCL 4LF5L 1UNSA 1PDQA 3FPUB 4IUUA 2E76C 2N3SA 1E0BA 2PYKA 3MXNA 3GTMB 4X65L 4QL5A 1M90C 1C8CA 3J80i 2I07B 3TP6A 1IBLQ 3L3OC 1SMYD 1NUCA 5CV5A 1PH6A 2F4IA 2KCTA 4PMBA 2RDFA 2EJGC 3M4YA 3WOFA 3MWYW 3K7AH 2UU9L 2EYMA 3K5MA 1Q1EA 4BA2I 1JJGA 5C5LA 3SHLA 2B8GA 3UDFA 3S1QH 1N33Q 2NVYB 2TSSA 4JK1C 4GNXB 2QEJC 3RNUA 3QB3A 1N32Q 5FLXc 4C3IB 5C0XG 2EDGA 3R2TA 4S3SA 4NP5A 4AH6A 3DUZA 1G6PA 3E6ZX 3S1MH 2HCCA 3OMGA 2RDHA 1XTDA 2F0QA 2NZ1D 2Z1CA 2WACA 2K5NA 1Q81C 1YIJA 5BN5A 3GDEA 2NVTH 5M5XB 3ULPA 1Q7YC 1ENFA 1SLJA 2EZVA 5AJ3Q 1HFGA 1GM5A 1YJWA 1SJHD 1HZCA 3AQQA 2VQFQ 1UEAB 2Q2IA 4B3MQ 1N9WA 4FO2A 1OXVA 4B9XA 4A3FH 1I6HB 4A3EG 5HGQA 2GN5A 4C1NK 1U4PA 2F0HA 4BWGB 2XRQD 4XYOA 1YNJD 2LFNA 1S4ZA 2F0DA 4YIJA 4KD3A 5JPNC 5CORA 1QB5D 3FMCA 3I3CA 3QO2A 2H4OA 2RF4A 2Q8RE 1OTCA 1GUOA 2FJ2A 3FP9A 4TRDA 4ZRZA 3CF5A 2UUCL 4JCVE 1H9RA 2QILA 3W2DA 1LTBD 3CW2C 3KLWA 2F1MA 2EJFC 1FYCA 3HKZG 1VQ7A 3DWQA 3FPPA 1B3QA 3E9IA 3OW2A 1RKNA 3U50C 4YCVA 3RN5A 5FOBB 1QG7A 5FO9B 5IP9G 2L5TA 1TT2A 4EVOA 4KLKA 4I7ZC 1EQVA 3I8ZA 4X64L 2PO4A 1PXUA 1PH9A 4AQYL 1LO5D 1TWHB 1AW7A 2EQSA 4IUQA 4KY6A 1EIGA 3ICEA 2X6LA 4YWKA 4GZYC 2WAQG 2GVAA 3CCSA 4C2MH 3H3VH 4UY8C 2F0KA 2P5ZX 2Y0SE 5I9PA 5M5YB 1Y1WB 3TP8A 1SJED 3GTLB 2YU9H 4GS3A 1PH5A 2JQOA 5IYCH 5HURA 1JE5A 1CA5A 3A5ZB 1EOTA 1QCBD 4UP9A 2R3ZA 2CH4W 4FF2A 2JA8B 1TWAH 4HCSA 3EBEA 2E2HB 4JYAL 1GKHA 1FJGL 3IFDA 1SROA 2N49A 1F2MA 4DR2Q 3R2IA 4RG1A 2ZXRA 5IT9E 4OXPA 2KVMA 1PTOC 3L9AX 4HJ7A 4DAVA 3QG1A 3K59A 1MD2D 3H6MA 3CCQA 3ULLA 3HGBA 1KDBA 3BDCA 1AH9A 1RJTA 3KUPA 5DM73 4NMZA 1HA5A 1WTHA 3KJOA 1VQAA 1A62A 2XTIA 5I2XA 3BYYB 4X66L 3AU7A 3TMEA 1L0XB 4P2CB 2WKDA 4LF9Q 3QIAA 4C3JB 5CV6A 1NR4A 4L8JA 1SYBA 4GN4B 2EYOA 3S14B 3RMHA 3VR5A 4BBRB 3AB9A 4K5XA 4TVAB 5LL6S 1D5ZC 3SK6A 3DEPA 2VUMH 2IX3A 3TDQA 3S1NB 2BA0A 3S15H 1IXRA 3EIVA 1R9TB 3F2BA 2NVXH 1WI5A 4P71A 1EL0A 1SN8A 4QIWE 4UDUC 4HTHA 1ESFA 2A1AA 3FKIH 2Q8IB 3UDGA 1LYLA 1V8QA 3IRBA 1PA6A 3X3NA 2PPBC 2JA7G 1X3FA 3CKIB 4HIOA 4HIMA 1FVIA 3HOVG 3DM3A 1WCMH 1EWCA 4A3DB 1I4QA 1W6KA 1VQGA 2Z6KA 4PNYA 3PO2B 4I7AA 3MAQA 1PH4A 4A3IH 2GVBA 1BCPB 2ATWA 2R93H 1JQYD 1KIXA 3PO3H 1ZKOA 1HZ9A 2J4XA 3BDOA 3NBIA 3BS1A 3HOWG 4DV1L 1GO3E 2N55A 3GTOB 1ZXTA 2PZTA 1UWVA 3URYA 1CI3M 2K5QA 2DGYA 4IUNA 3CD6A 1SNDA 2SNSA 1F9RA 3GTJH 1UE1A 3HFZB 4QMGA 3DMUA 2VY3A 4LUOA 4DUYQ 1ONLA 1B53A 3QOLA 4OGQC 3C46A 1PH7A 1Q1BA 2O5IC 3R8BA 1NY4A 5NUCA 1IBKL 3S1RH 3K8AA 1BDOA 5KGUA 1A2TA 1ML0D 2OWOA 5C0XI 4JPBW 4PV1C 1WTRA 4DR4L 1K8GA 2UXBL 1IW7D 1ET9A 2B63H 1XJVA 5CR3A 1S5FD 3CRLC 1EU4A 4EGVA 5BN4A 1SSOA 4BBSH 1CSQA 4J6HA 2A68C 5IE8A 1I3QH 2RQXA 2TMPA 4EQNA 2NB0A 3A7AB 1VF7A 3E9HA 2K1BA 4A3EB 3CRKC 1RODA 1Y1VB 5GAEC 4BY1H 4K8IA 2EY5A 2DJGC 4YWMA 3D6CA 5EPKA 1Q46A 4J8QA 1HQRD 4BA1I 4DR7Q 1W6JA 2QF7A 4HR7B 4RCNA 2F0TA 1Z9FA 1O7ZA 1VQ5A 4OX9Q 5ELEA 5CC4A 3I4LA 4CBVA 1X3PA 2ZJPA 1N34L 4LWCA 2A8VA 1RF2D 3QJYA 1PHJA 1CHQD 2VB3X 1QNKA 5LMNQ 3CHBD 1J8IA 2JP1A 1P8LA 2MHVA 1IHZA 3VYUA 2UXDL 1YNNC 1WTXA 2XNAC 1XMQQ 2OTLA 4GLVB 3TEHB 3J80c 2AUKA 3OYYA 2H5XA 3ND8A 4X65Q 4R4CA 1WTOA 4CKCA 2A69D 2NZHA 3WOEA 2A6HD 3TZDA 3E3XA 1WD1A 3J80E 4DKAC 2Y0SG 1EY7A 2WB1E 4A3LG 4X62L 2B29A 4U673 3VA7A 3T4AC 5EPLA 1HH2P 3HOXG 3PF5A 4LFAQ 2XWBB 1GUNA 3GTPB 1K9MC 5FK9C 2ZTCA 2E2JH 4RCOA 5IYBG 1BF4A 2EYLA 1SR3A 5ELCA 5JPMC 3RZDH 2EYHA 3EFXD 1STYA 3U4ZA 4H02A 1VQLA 4L5RC 2UUBL 1UUPA 1YJNA 1Q3LA 3MTSA 1M8AA 1X54A 1W2BA 2A69C 4KKTA 2A6HC 3E0JA 4XQNA 1CSPA 1YI2A 2RDGA 2SEBD 1HRJA 4A3JB 2K6AA 3EA6A 3H0GH 4QQBX 1STAA 4FXGC 1G2SA 1L0WA 1CM9A 4FVMA 4NXMQ 1X56A 1WTWA 4C3HH 1G51A 3V2TA 1Q86C 2Z8LA 4CDCC 4JI5Q 5D14A 3CU7A 5GAGC 1YNXA 5ELBA 1DCZA 5C5MA 3WDNA 1NMFA 2F0MA 1VQFA 1CFMA 1B1ZA 3EJIA 3KF8A 4LW1A 1N36Q 3KBXA 4E6IA 3OPOA 4OIJA 4DV6L 3CCEA 1PZKD 4TKOB 2ALYB 2XWJB 1L1OA 3S9WA 2HDLA 3ZYYX 5LMUL 1VCIA 1SE2A 4POFA 2PZWA 1KD1C 3OOCA 4KKSA 5KNBA 2F52A 3PIP3 1JCKB 4CDFC 5EPJA 4RGNA 5FLMH 5CBAE 5C3EB 4IFDH 4UP8A 1X55A 1PH8A 4K5WA 4IOAA 3F8TA 4JI7Q 3A55A 1EY5A 3HOWB 2HIVA 4Q0FA 2RVLA 1Q8KA 2RSOA 4A3FG 3QWNA 2R7ZH 1DZ1A 3U58A 2ENBA 1R4PB 5G3LD 4JOIA 2EE1A 1YBYA 1V1PB 1YITA 1EQRA 4ZUJA 1M1KC 2BH2A 2EXDA 4LF4Q 2PI2A 5C4XH 2I5MX 2WAQE 3SDZA 1KAAA 4CKEA 1SAPA 1JWSD 1K83H 2G9DA 4DV3Q 2O5JC 1VQBA 5KRUA 3CQZH 5I6WA 3PIPA 1JJ2A 4JBKA 2E2DC 2PQAB 5DLQE 5I2YA 1A63A 4YWLA 1KLUD 4MTKA 3CMAA 3G48A 3T1HQ 4HJ5A 5C44H 4KD4A 3S16B 3CCVA 2JA5G 4LF6L 1DYQA 2J7ZA 4NXNQ 5FJ8H 5BR8L 1PVOA 2XGTA 4IJLA 4QGUA 3GTGB 3A5UA 4DK0A 4A3GB 3H15A 1BNZA 5C4JB 1XXGA 1JWUD 3J7YW 2OQKA 2F4VL 1N8RC 4R1JA 4DFAA 3LWEA 4F8MA 4QY7A 4X66Q 4GOPA 4OEMB 1STGA 3OWFA 4JBWA 1EOVA 4DK6C 5C4ZA 3J81j 3RZOH 2HQLA 1CKOA 1EY4A 1KQSA 4LF7L 3Q24A 1DM0B 1F2ZA 1WYDA 1A15A 5GAHC 3KDFB 1KL9A 4IN3A 3TP7A 1HNZL 1VQ9A 4ME5A 1SEBD 1FD7D 4LF8L 1R4QB 1WD0A 1MJEA 4GKJL 3PUZA 4FYDA 3BVGA 3JAMi 1TS3A 3A8IE 1I94L 2PNHA 3CC2A 1AE2A 3EROA 3NK9A 2CHBD 1GJXA 1EZ8A 1U4MA 3GP7A 4KHPQ 1BCPF 2LS01 2KCNA 2NVQH 1F77A 5FLXL 3I4NH 5E1FA 2NZOA 4H13C 5IWAL 4X3KA 1D2BA 5DAUA 2B3GA 2FMMA 3NQTA 1K3BC 1EWIA 4PZ6A 1LT4D 1D6EC 5A2QE 4A76A 3EQLC 1CZGA 4KJNA 2FXQA 1U5KA 4ZCKA 1ET6A 4BY7B 1KDAA 3P75A 1BVSA 2L15A 1TIID 2VUMG 2PW7A 2VXWA 3S17H 1EY9A 2CQAA 4K0KQ 4JI4Q 4B3SL 3K7UC 3T53B 3I4MH 2Y0SB 3NXWA 4DR5Q 2JA6H 1PFSA 1PYBA 2EOTA 3NPPA 4JI2L 1EY6A 5CBEE 5I6YA 3FKIG 1K73C 3HOXB 1BOSA 2JEBI 1CKNB 1A0IA 4DPGA 4XIGS 1Y8OB 1EY0A 2VW9A 2AWOA 2Z6KC 5M3FH 2WB1G 1TWGB 1VQOA 4A3MH 1WCMG 1QJOA 4KHZA 1OXXK 1MBYA 2A6ED 1Z47A 4DV2L 3GTMH 2UXBQ 2M9VA 1MI2A 3K57A 2R93G 2VQEL 2M00A 4IUVA 4HJAA 2K75A 3PO3G 2KOLA 5IGFA 2IPKD 2QA4A 3X3MA 2BH8A 5L37A 4DR3L 5KYLA 2F03A 4A93G 1YJ9A 1JWMD 4A3BG 3KF6B 1EIHA 1J5EL 4RHRA 3K7AB 3T13A 1QUQB 1QNUA 1SYFA 3VYRA 2NVYH 3R3OA 4JI8L 5ELDA 4P74A 4DU9A 1HQMC 4C3IH 2PMZE 3N52A 1OO9B 4RA8A 2JYOA 3MXGA 4J15A 1JJCB 5JJIA 2A6EC 4GKKL 1A3TA 3GTQB 4BXXH 1GUSA 2D2CC 3GV6A 3J81i 3A7LA 4AYBB 4IO9A 5DM63 1ENCA 3PQIA 3F2UA 1FNUA 3RR5A 5G3LF 3D4DA 2B63G 4DAMA 1C48A 4WJ3M 3C1FA 5M5XH 2Z6BA 4BBSG 2DY7A 3HOUB 2KECA 3HEJA 1BBXC 3TS2A 3ERSX 3MHBA 3KLSX 4RGTA 1I6HH 3K58A 3Q0AA 4DV4L 5IOCA 4A3FB 1BBWA 1JE4A 4CDEC 2E5LQ 4RH6A 4GLXA 1CA6A 4BY1G 1T5EA 4FXDA 2OF1A 1KXLA 3PV0A 1PZID 1MGSA 2B39A 2C9OA 1HTPA 2FFKB 2IJ0A 3OMCA 4DV0L 2F0IA 3BVZA 3BU2A 1PFNA 4NDXA 4HSPA 3J7ZC 1YVCA 2HUGA 5CV8A 2RHQB 1PTOD 1HNWL 3H91A 2JA5B 1HPCA 1HR0Q 3FVQA 1GUWA 1JOKA 1STNA 2CWPA 1FGBD 3PGZA 3MFGA 1TQOA 1D5MC 1Z6HA 4CJ1B 2ZJQA 5M5YH 1Y1WH 1HJPA 1WTVA 1SBBB 4CJ2C 4KK7A 3PUWA 1UE6A 1WVLA 1K0SA 3GTLH 5IT9c 4MZ9A 3ULJA 4JVZA 1EY8A 4OIKA 5IYDH 3G71A 1A8VA 2IT1A 1RHPA 3NBHB 5C3WA 1V1OA 1SNMA 1PH1A 2E2HH 1UE7A 1YHAA 3AMUA 4IFDJ 4FDBA 4UPAA 5DNFA 5K5PA 1YEZA 1LTGD 2F0WA 3A0JA 4JG2A 1HUNA 1TXYA 4OO1I 3NEMA 4A3KB 4LFBQ 2B2YA 3KJPA 3UDXA 2JXMB 3EN2A 1V43A 3HOZG 2R92B 3RUZA 1SMXA 1T5XD 1ILQA 2A73B 1XPOA 3ITPA 2AHOB 3VR6A 1BO0A 4F7XA 4LUVA 5M5WB 1Y69U 1Z7TA 4WRDA 1L2FA 2HHHQ 5LMUQ 4B3TQ 2YYZA 4P73A 1EQQA 3SGIA 1VQKA 2PW5A 1T9HA 4C3JH 2F0PA 2K03A 4JI1Q 3K6OA 2ASBA 3S14H 2RHSB 3H0GG 4BBRH 3S1NH 1CQVA 5GADC 4C3HG 4JI6L 1R9TH 3PUVA 1RD9D 5LL6X 1AZQA 2O2LD 3S15B 1EU3A 5JJKA 1H9SA 1WFQA 2JA9A 4WJWA 4FF4A 1KNEA 1L1OC 3VR2A 2HIXA 4RAUC 2BDOA 3CAMA 1EYCA 3QOJA 4AIMA 4QCLA 3G6EA 2PI2E 2KHJA 4A3DH 3A56A 2FHTA 2WB1B 1GHKA 3PIO3 3PO2H 2PZUA 5J1ZA 4HSVA 5T1IA 2LY7A 1VQCA 1KNAA 2K5DA 1SYGA 1K8AC 1EEFD 3MVVA 5J3BA 1X65A 1IBML 4DUZQ 3UDIA 1GXDC 4Y7NB 4ZAIA 5FLMG 2IHFA 4LMQD 4IFDG 2A68D 3U9SA 3PO3B 3GTOH 4JOIC 1XMOQ 1X3GA 3NTKA 3D4WA 2UUAL 2KBNA 3HOYG 4A93B 2MP1A 5COYA 1EZ6A 4A3BB 1E1TA 5HGTA 3VYSA 3MEFA 2I5HA 1HNXQ 1TR5A 5FO8B 1ZEQX 4YCWA 5C4XG 4DR1L 2NUCA 1WJJA 2AQ3B 4GN5A 4LUZA 1A2UA 3NHHA 4DR6Q 3PIOA 4O42A 3D0FA 1TWCB 3J80L 2C35B 4OONA 3M7NA 3TP5A 5E4XA 2OQ0A 3H09A 4DV7L 5C44G 3T1YL 2VS1A 2F3WA 4FNFA 4DK3C 2KJXA 3JAMc 4JI3Q 4G7ZC 1AFPA 2F0GA 3I90A 5FJ8G 2RCNA 3NWSA 4IUPA 4KJOA 1IBLL 2VZAA 3JAME 1Q12A 4DV5Q 4R9WA 3H3VC 5TSSA 3MXPA 4X3UA 4BS9A 2KCCA 4BBSB 1H95A 1S5CD 3WWVA 3CMEA 1O7IA 2CW0C 1ICWA 4GOPC 2LXKA 4HN7A 2XVSA 1U0LA 1SFOB 5CGKA 1CT1D 1S5ED 1KABA 1YNND 4A3EH 4Z9CB 1SE3A 4DAYA 1Y1VH 3BVMA 4ALPA 1EFWA 3I55A 4X3TA 3ND9A 1FGUA 1N33L 1XNRL 4NW2A 1PTOF 3A74A 1N32L 3BZDB 1IYVA 1WOCA 1GUTA 1ENAA 3HKZB 2E2IH 1KRSA 2VL6A 4LK1C 1VQPA 4M1UB 3HZXA 1B9NA 1XNQQ 2BE5C 1EIYB 2B2UA 3KK7A 3S2HB 1NBWA 4K14A 1KTKA 1TWFB 4RWSC 4GLAC 1FNWA 4G57A 2IHEA 4H7BA 3U9OA 2WAQB 4GN3B 1I4PA 2EY6A 4LFCQ 4LF5Q 3TN2A 2V4DA 2JSOA 4NKLA 3OIQA 4MN3A 5DEHA 2VQFL 4B3ML 3I4NG 2G9HD 4H44C 3EVQA 3SXHA 1EEID 1GVPA 4HMIA 3NTIA 4RKBA 1C7YA 1HFNA 4J1MA 3R93A 2ES2A 4POGA 1E1OA 4R4QA 2SOBA 2UU9Q 4ZQ3A 4N9TA 2K01A 2K7VA 1FL0A 3W3AA 2F0JA 3VA5A 3I56A 2YTYA 1XPUA 3HKSA 4DR3Q 2MUYA 2A5HA 4R4TA 1PYWD 3I4MG 2NWGA 1SNOA 3K5OA 4HMJA 4X6AH 5BN3A 1B50A 1PH3A 3L0OA 3GTPH 3N6RA 4KHVA 1D1IA 1I6VC 1NR2A 2CH4A 3MFYA 1MSHA 5IGDA 3HOZB 4ULLA 2HDMA 3T16A 5M3FG 1CZWA 1IL2A 2R7DA 3SR1A 3J81c 1PRTC 1OXUA 4B3RL 1OXTA 1NJIC 1A3VA 1S72A 3RZDB 1UAPA 2R61A 1CKNA 3D3RA 1W3SA 3T56B 1KC8C 1SXTA 2XN9C 4MTNA 5K36H 2I5LX 3J81E 1SNPA 2WIIB 1D1KA 2F0LA 2SDFA 4A3JH 2ICIA 1IL8A 5CV7A 4HEDA 1S40A 3C3LA 1QVFA 1SYCA 5A35A 4JV5L 1BUVT 5EBCA 2Q2HA 3RD4A 2K4KA 5M3MH 3ER0A 4L5QA 3STBD 4DR2L 1H9MA 2DUDA 2Z9HA 2UUCQ 2JN4A 3PUXA 4XQQA 4ILWA 1V9PA 2JA7B 1RIPA 4C3IG 3CCUA 4GNXA 4DNTB 3HOVB 2RBMA 1HZBA 1HUMA 2NYZD 4HCEA 3KOJA 5J39A 2R7FA 1EYDA 4BXXG 4FP5D 1QVCA 4X64Q 1WTPA 4AQYQ 1VQHA 2E75C 1MKHA 1JT8A 3BZKA 5E3FA 3CP0A 2OEOA 1HNWQ 4LF9L 4FF3A 4XTCS 3STBC 5C3EH 4KKUA 1ASYA 4K6DA 2NN6H 1KAWA 1JICA 2IL8A 3M3YB 3OSOA 3AFPA 3NE5B 4MIUA 1U4RA 2KHIA 1O7LA 1VQ6A 4IFDI 1QZHA 5A2QL 1DXMA 3HOYB 2C5CA 4OWWB 2YV5A 4JYAQ 3DEOA 1EFID 1FJGQ 1MSGA 2CFMA 5FO7B 4PMCA 4R8IA 2XIWA 3CCJA 3HS0C 5IGBA 4EQOA 3S16H 3LWUA 1GUGA 3MXUA 1PH2A 2AQ2B 4RKLA 4P72A 5EKLA 2F0OA 1GHJA 2ZM6L 1K8OA 1SNCA 3GTGH 4A3GH 3P7JA 5C4JH 2PMZB 4EQ5A 3GTKB 5IYCG 1CK1A 3KBGA 4OWXB 1FR3A 1X32A 1Y8PB 3TREA 4IPDA 2EIFA 5T1GA 2GA4B 1TVXA 1G8ZD 4APVA 3CC4A 1AP0A 4ZLTF 4DUYL 3IAYA 1Y8NB 3DLLA 3I72A 4TQUS 3M4OB 5KIXA 1AZPA 1LM0A 2B2YC 3IKJA 3LNNA 4RFBA 3I91A 1RCVD 1S5BD 4K2LA 5ISRA 5JEAH 2UXCL 3KYHC 2LSSA 1II3A 3W5OA 1MIUA 2PQEA 2MGSA 1WTQA 2F0SA 1X3EA 1XYIA 2N8NA 1B7YB 5IODA 4PQXA 1A3UA 2D62A 1ZYRC 4C1NI 2LKVA 2L9HA 2B2VA 3K0YA 2SNMA 2RKSA 2DN8A 1CTMA 4C3JG 1SE4A 2HQEA 3I2ZA 2I46A 4DV1Q 2Z0SA 4BY7H 3SVMA 2A74C 4FXKC 1RTNA 1IZ6A 4A75A 3I70A 2RCFA 4DR7L 1PTOB 1HXYD 1PV4A 3KLRA 1I50B 1B70B 3IL8A 1ILPA 3M4QA 2B2TA 4A3LH 2QDBA 3IFTA 1NCVA 1Q90A 3MC0B 2K33A 3NELA 2N88A 4XT1B 1CKMA 3TZUA 4ZKBB 2K50A 1G291 3S2DB 3PF4A 1I4XA 3AFQA 2EY1A 1I4GA 4KTAA 4V190 2KCMA 1IBKQ 3VR4A 4DR1Q 2DJFC 3NTHA 1NMGA 2MFIA 5LMNL 4O2DA 4PMWA 2BDNA 1J9OA 4N8FA 4DR4Q 1TWGH 3I7FA 5JVG3 4A3IG 1DONA 4A3DG 4XDXA 2QEXA 4DGZA 3T1YQ 2KHSA 1EYAA 1LT6D 1XMQL 2K5WA 3C2PA 1SDFA 4RMFA 3SEBA 4DXFA 5KNCA 1DOKA 2MO0A 2OCEA 2MO1A 4U68A 3OHXC 5IGEA 1VS0A 3D8GA 5JAVA 3KF8B 2E74C 2D0OA 2DY8A 3S1QB 2VNUD 4XT3B 3W1GA 4HJ8A 2F0NA 4JC0A 4EQPA 2CVRA 1L1OB 1TU2B 5ELFA 4R4IA 4F87A 4LFAL 1VQDA 4ME3A 1XNRQ 4DXGA 5IT9L 4CGYB 2MJ8A 1YHQA 1IKLA 2CCZA 1NE3A 4I65A 1N34Q 3S1MB 3GTQH 2K5VA 5JVH3 1C9OA 2ID0A 4QIWB 2IW3A 1CUKA 1D5XC 3SK5A 5FLXE 2OXPA 4L5SA 1B3AA 1EWHA 1SMYC 3BYTB 1I4RA 3OIPA 3V05A 2NVTB 3TRZA 4WJ4A 3ONAB 1LLRD 5I4DA 1PFMA 3F2DA 2OT2A 3T51B 4G7HC 2FINB 3HOUH 1PMRA 4HJ9A 2UXDQ 2KA7A 4JI0L 4NXML 2IX0A 3ZJYC 4EX5A 1D8LA 3M9BA 3QR8A 1SYDA 3AEVA 4JI5L 4L63B 5GQOA 2EPBA 1O7YA 1PLFA 1Y1VG 3MA2B 1DOMA 4JW0A 4DA2A 5ELOA 2HT1A 1NSNS 5IGCA 1N36L 1XX8A 1VQIA 3OTOL 4X62Q 1H9KA 4F88A 1JOOA 2B2UC 1FNVA 4MNOA 4JBMA 1G2TA 3RLNA 2AMCB 2X69A 3K5LA 1Y14B 1TWHH 1K0RA 1SNQA 1VQNA 5LMNW 3NQIA 2ZJRA 1I5FA 3VDYA 2JA5H 2LMCB 4JBJA 3K81C 3BZCA 5EQ0A 2ZXOA 4C2MB 3CPFA 1VMPA 4YY3L 2L12A 1YHBA 2UUBQ 3RLOA 2Z4IA 4JI7L 4GOPB 1U4LA 3H3VI 1A6XA 1G6ZA 1NAPA 2ZTEA 2WFWA 1LTTD 1X3QA 1YNJC 5IIFA 4WFN3 3V96A 1ASZA 2YU9B 4FF1A 4B3RQ 2JA8H 1F2LA 4CJ0B 1TS4A 2M2LA 1O78A 4L5TA 1LTRD 3CC7A 4LF4L 1SE8A 1TWAB 2NBFA 2V1CC 3A8KE 4ZKCB 3PMFA 4DV3L 3SE0A 2B2WA 4JV5Q 4OO1H 2BOSA 1LTLA 2L11A 3CXCA 3T1HL 4A3CH 4A3KH 4KI0A 2J0TD 4DV6Q 4NXNL 2R92H 4O1NA 3TQYA 1E24A
chains in the Genus database with same CATH topology
4X65L 1VQMA 4QL5A 1KRSA 2VL6A 4JOIA 1P16A 1YBYA 1VQPA 1M90C 3J80i 1YITA 1EQRA 1XNQQ 1IBLQ 1EIYB 1M1KC 1PH6A 2BH2A 2EXDA 1VQ4A 2K14A 4LF4Q 2KCTA 2PI2A 5C4XH 1IYJB 1NBWA 2I5MX 2WAQE 5ELNA 5M5WH 1HZAA 1K83H 4GLAC 3K7AH 2UU9L 4DV3Q 1Q1EA 1VQBA 3CQZH 3PIPA 2IHEA 1JJ2A 4JBKA 2PQAB 4BA2I 1JJGA 4UP7A 5DLQE 1A63A 5IP7H 4GN3B 4YWLA 4A4IA 3CMAA 3M4PA 3G48A 3T1HQ 5K36G 4HJ5A 5C44H 3UDFA 3S1QH 4LFCQ 1N33Q 4LF5Q 4GNXB 3CCVA 2JA5G 3RNUA 4A3JG 2VQFL 1N32Q 4B3ML 2K52A 4LF6L 1B8AA 3I4NG 5FLXc 4NXNQ 5C0XG 5FJ8H 5BR8L 1GVPA 1AE3A 1QVGA 1PVOA 2XGTA 4IJLA 1PYSB 3U4VA 4QGUA 3A5UA 4AH6A 5M3MG 4O0AA 1C7YA 3TS0A 1G6PA 2ES2A 3H15A 4AYBE 3S1MH 4POGA 1E1OA 4R4QA 3B6YA 3Q8DA 1XTDA 4GNXC 1BBUA 3F2CA 2OQKA 2UU9Q 2F4VL 2JE6I 4R1JA 1N8RC 3JC66 1FL0A 2K5NA 3I56A 2YTYA 1YIJA 3MXNB 1Q81C 3HKSA 4QY7A 1XPUA 3GDEA 1E22A 4X66Q 4DR3Q 2NVTH 4GOPA 4JBWA 4DK6C 3ULPA 1EOVA 1SLJA 4R4TA 3J81j 1Q7YC 3RZOH 3I4MG 5AJ3Q 1GM5A 4KHPL 2HQLA 4X6AH 1YJWA 1HZCA 3AQQA 1CKOA 2Q2IA 2VQFQ 4B3MQ 1N9WA 1KQSA 1X9NA 4IPGA 4LF6Q 4LF7L 1OXVA 4A3FH 5BR8Q 1PH3A 1WYDA 3L0OA 4A3EG 5HGQA 1X6OA 2GN5A 3KDFB 1KL9A 5GAHC 3GTPH 4IFDG 1HNZL 3S24A 1E3PA 1VQ9A 4LF8L 1UEBA 5JEAJ 1MJEA 2A19A 2ZM6Q 3GO5A 5M3FG 4Y7NH 1IL2A 4GKJL 3GTOH 1EIFA 2R7DA 2RF4A 3PUZA 3NENA 3J81c 1OTCA 2UUCL 3FP9A 1OXUA 5C3EG 1OXTA 3JAMi 3CF5A 4JCVE 1NJIC 2F4VQ 1S72A 4B3RL 2NN6G 1CKNA 3CW2C 1W3SA 3KLWA 1KC8C 4LNQA 1I94L 2PNHA 3CC2A 1AE2A 4MTNA 1VQ7A 3HKZG 4A93H 2I5LX 3E9IA 3OW2A 4JI4L 4K0KL 3U50C 4YCVA 3RN5A 4KHPQ 5IP9G 4A3BH 2NVQH 4A3JH 4DR5L 4KLKA 4LF7Q 3I4NH 5IWAL 2NZOA 4X64L 2CQOA 2B3GA 1S40A 1PH9A 4AQYL 1QVFA 4IOAA 2JJQA 4JV5L 1HNZQ 1EWIA 2EQSA 4PZ6A 4YHHL 2Q2HA 4A76A 2K4KA 4LF8Q 5M3MH 4YCUA 1TWCH 3ER0A 4L5QA 3STBD 3ICEA 2FXQA 1U5KA 4YWKA 4DR2L 2DUDA 2WAQG 2GVAA 3CCSA 4C2MH 4GKJQ 2IY5B 2UUCQ 2PQAA 3H3VH 4UY8C 2Y0SE 3PUXA 1BVSA 2L15A 2VUMG 1I94Q 1V9PA 2MNAA 5JJLA 1RIPA 3CCUA 4GNXA 3S17H 1BKBA 2YU9H 4K0KQ 4GS3A 1PH5A 2JQOA 1JB7A 4B3SL 4BY1H 4JI4Q 3K7UC 5IYCH 1HZBA 3I4MH 1JE5A 3KOJA 3G4SA 4DR5Q 3A5ZB 2JA6H 4A3GG 2R7FA 3FHWA 4BXXG 4UP9A 5IWAQ 1PFSA 1PYBA 1QVCA 4X64Q 4JI2L 4A3CH 1TWAH 4AQYQ 1VQHA 2WP8J 4IJHA 1MKHA 1JT8A 3EBEA 3FKIG 1K73C 3BZKA 2YTXA 4HIDA 3CP0A 4JYAL 2JEBI 1CKNB 1GKHA 1A0IA 1SFOH 1FJGL 1HNWQ 1SROA 4LF9L 2N49A 4DPGA 4XIGS 4DR2Q 4RG1A 2VW9A 2AWOA 2Z6KC 4OXPA 5M3FH 4XTCS 2WB1G 1VQOA 3STBC 4A3MH 1WCMG 5C3EH 4HJ7A 2QGQA 3K0XA 3CCQA 1ASYA 3ULLA 4KHZA 1KAWA 1OXXK 1AH9A 3AFPA 1Z47A 4DV2L 1VQEA 3GTMH 4B3SQ 2KHIA 2UXBQ 1VQ6A 1K3RA 3KJOA 4IFDI 5IP9H 1QZHA 2VQEL 2R93G 1VQAA 1VQJA 1Q82C 1A62A 4HJAA 2K75A 3PO3G 3KDFA 2XTIA 2QA4A 4JI2Q 3S2HH 2BH8A 4OWWB 1TWFH 2YV5A 3UE1A 4X66L 5JEAG 4DR3L 1YJ9A 4JYAQ 4A93G 1KHIA 1FJGQ 2ZTDA 4LF9Q 2E8GA 5AJ3L 3KF6B 4A3BG 2CFMA 1JMCA 1J5EL 4PG3A 4GN4B 1QUQB 3CCJA 4OWTB 3W1BA 3S16H 2NVYH 4JI8L 1PH2A 4TVAB 4P74A 4P72A 2VUMH 4C3IH 2BA0A 4DV2Q 2PMZE 2D0PA 3S15H 2ZM6L 1IXRA 3EIVA 4J15A 3F2BA 2VQEQ 1JJCB 1GD7A 2NVXH 1WI5A 3L7ZC 3GTGH 4P71A 4PZ8A 4A3GH 4GKKL 4BXXH 1SN8A 3PUYA 4QIWE 5C4JH 2E5LL 3J81i 4EQ5A 4BY7G 4IO9A 2A1AA 3FKIH 3UDGA 1LYLA 3IRBA 5IYCG 1PA6A 2AKWB 3RR5A 2BA1A 4OWXB 4NB3A 2JA6G 2JA7G 2B63G 1J5EQ 1X3FA 4DAMA 4WJ3M 4HIOA 5M5XH 3TREA 4IPDA 4HIMA 4Y52H 1FVIA 2EIFA 3HOVG 4BBSG 3DM3A 1WCMH 4JI8Q 5E7NA 1VQGA 2Z6KA 1EYGA 3TS2A 3ERSX 4APVA 3CC4A 1PH4A 4A3IH 1I6HH 4DUYL 3DLLA 2GVBA 2ATWA 4DV4L 4TQUS 2R93H 1HR0L 5H1SE 3CCMA 4A3MG 1KIXA 4GKKQ 3HOZH 3PO3H 1BBWA 1LM0A 1HZ9A 2E5LQ 4GLXA 3HOWG 2N78A 4DV1L 1GO3E 4BY1G 1KXLA 2UXCL 3PV0A 3I4OA 3KYHC 4IPCA 2LSSA 3E0EA 1UWVA 3W5OA 2DGYA 5GROA 3M85A 1MIUA 3CD6A 1UE5A 4DV0L 1J6QA 1X3EA 3BU2A 3J7ZC 2N8NA 1YVCA 1B7YB 3GTJH 1UE1A 2RHQB 3HFZB 1HNWL 2D62A 2VY3A 4LUOA 4DUYQ 4DV4Q 1PH7A 1Q1BA 1KRTA 1HR0Q 1NY4A 2CWPA 3PGZA 1IBKL 4JI0Q 3S1RH 3PSIA 3K8AA 2Q2TA 3I2ZA 4DV1Q 2OWOA 5C0XI 2Z0SA 4BY7H 3KF6A 4DR4L 1K8GA 2UXBL 2ZJQA 1IZ6A 4LFBL 1QUQA 5M5YH 4A75A 1Y1WH 4P75A 4DR7L 1HJPA 2K5HA 2JA7H 1PV4A 2B63H 3PUWA 1UE6A 1XJVA 3GTLH 1B70B 4DV0Q 5IT9c 4MZ9A 3M4QA 3ULJA 3OTOQ 3HOVH 4BBSH 1CSQA 4A3LH 2R6GA 3RN2A 5IYDH 3NELA 5IE8A 1I3QH 3KFUA 1A8VA 1CKMA 2IT1A 3NBHB 2K50A 1G291 3K80C 4AYBG 2HHHL 4B3TL 3PF4A 3AFQA 1PH1A 2E2HH 1VQ8A 1UE7A 2KCMA 3E9HA 1IBKQ 1YHAA 4DR1Q 1NMGA 2MFIA 4FDBA 4UPAA 5LMNL 2Q2UA 4O2DA 4PMWA 4IFDJ 3HOWH 1YEZA 3LGJA 4JG2A 3A0JA 4R4OA 4JI1L 5GAEC 1TWGH 3I7FA 1TXYA 3CPWA 4A3IG 3CCLA 4DR4Q 4OO1I 4YWMA 3NEMA 1Q46A 4A3DG 4LFBQ 4BA1I 3HOUG 3KJPA 4DR7Q 3D31A 3HKZE 3UDXA 3EN2A 2QEXA 4YY3Q 3M3YH 1V43A 3T1YQ 3HOZG 2JK8A 1SMXA 1Z9FA 4OX9Q 1VQ5A 2F3IA 3L2PA 1XPOA 1XMQL 2AHOB 2NN6I 3HOYH 2ZJPA 4LUVA 1N34L 4RMFA 4LWCA 2JEAI 1DGSA 1L2FA 2HHHQ 5LMUQ 1D7QA 4B3TQ 1V1QA 2MO0A 3UE0A 2A8VA 2OCEA 2YYZA 4P73A 1EQQA 3SGIA 2MO1A 1PHJA 1VQKA 1T9HA 1VS0A 4C3JH 5LMNQ 3KF8B 2D0OA 4JI1Q 4A3CG 2ASBA 2VNUD 1P8LA 3S14H 2RHSB 4NPSA 3W1GA 4HJ8A 1LUZA 1HR0W 2R7ZG 3H0GG 4JC0A 4BBRH 3J7A5 3S1NH 1L1OB 2UXDL 4R4IA 4LFAL 1VQDA 4ME3A 5GADC 1XNRQ 5HY6A 4JI6L 1R9TH 1XMQQ 3PUVA 3CCRA 1YHQA 2CCZA 4GLVB 3TEHB 2OTLA 3J80c 1NE3A 5EAYA 5JJIA 1N34Q 3OYYA 2H5XA 4DUZL 2K5VA 4X65Q 1Y1WG 4R4CA 3GTQH 1C9OA 2ID0A 2NZHA 5JJKA 1WFQA 2JA9A 1CUKA 3GTKH 1L1OC 1XMOL 4L5SA 4DKAC 4DAYB 2Y0SG 2WB1E 4A3LG 4X62L 1MJCA 2HIXA 4PZ7A 3TRZA 5IYDG 3CAMA 4AIMA 4WJ4A 2OTJA 2JA8G 2KENA 2B29A 2CWAA 3G6EA 3F2DA 2PI2E 2KHJA 4DNIA 4A3DH 1HH2P 1HNXL 3HOUH 3HOXG 4HJ9A 4IPHA 3PO2H 2UXDQ 3PF5A 4LFAQ 4HIKA 4JI0L 4NXML 5IY0A 1YZ6A 2IX0A 1VQCA 4JI6Q 1K9MC 3ZJYC 4EX5A 1D8LA 3M9BA 2ZTCA 1K8AC 2UXCQ 2E2JH 4DR6L 5IYBG 5J3BA 1SRUA 3M4OH 3AEVA 1X65A 4JI5L 3AYHB 2AWNA 1IBML 4DUZQ 3UDIA 1SR3A 5GQOA 3RZDH 1NTGA 4OO1G 1XPRA 5FLMG 1E7ZA 1Y1VG 3U4ZA 2IHFA 4H02A 5ELOA 1QZGA 1VQLA 1EUJA 1YJNA 2E2IH 2I0QA 2UUBL 2LXJA 2HT1A 4JOIC 4A3KG 1XMOQ 1X3GA 1VQIA 1N36L 1X54A 3OTOL 1W2BA 2IX1A 4JI3L 4X62Q 1CSPA 2R92G 4MNOA 1YI2A 2KBNA 2UUAL 4JBMA 4L5RC 3HOYG 3RLNA 4QJFA 2AMCB 1E1TA 3MEFA 5C0XJ 2I5HA 3BJUA 1Y14B 1TWHH 3H0GH 1HNXQ 4QQBX 1K0RA 1VQNA 4YCWA 4DV5L 5LMNW 5C4XG 1L0WA 4DR1L 4NXMQ 1WJJA 1X56A 2ZJRA 4GN5A 1I5FA 4C3HH 3VDYA 2JA5H 4LUZA 1G51A 4JBJA 4DR6Q 3K81C 1Q86C 3PIOA 3BZCA 3D0FA 1IBMQ 4JI5Q 2C35B 4OONA 3M7NA 3GD7A 5GAGC 1YNXA 1OXSC 4BBRG 3F1ZA 2OQ0A 5IP7G 3CPFA 1NMFA 4YY3L 4DV7L 5C44G 1YHBA 1VQFA 3T1YL 2VS1A 3RLOA 4DK3C 2UUBQ 4LW1A 1N36Q 4OX9L 4JI7L 4GOPB 3H3VI 1RL2A 3JAMc 4JI3Q 2R7ZH 1C0AA 2ZTEA 2UUAQ 2WFWA 5FJ8G 3CCEA 2YTVA 4DV6L 1I50H 1ASZA 4B3RQ 2ALYB 2JA8H 1L1OA 4IOCA 2RCNA 3RLFA 5LMUL 1XNQL 1IBLL 2VZAA 1VCIA 4L5TA 4POFA 3HOXH 1Q12A 4DV5Q 1KD1C 3CC7A 2CKZB 1SE8A 4LF4L 1H95A 2F52A 2V1CC 3WWVA 3CMEA 1O7IA 3S2DH 4GOPC 2LXKA 1S3OA 1U0LA 5IYBH 4DV3L 4A3EH 4JV5Q 2MQHA 1LTLA 3PO2G 4DV7Q 4YHHQ 5FLMH 3CXCA 1Y1VH 3T1HL 4ALPA 1EFWA 3PCOB 4UP8A 1X55A 4LFCL 3I55A 1PH8A 3F8TA 1FGUA 4LF5L 4JI7Q 4A3KH 1N33L 1XNRL 3A74A 1N32L 2HIVA 1WOCA 4KI0A 2N3SA 4DV6Q 1Q8KA 4NXNL 2R92H 4A3FG 3G71A 3U58A 3TQYA 1E24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 L;  1VQM A;  4QL5 A;  1KRS A;  2VL6 A;  4JOI A;  1P16 A;  1YBY A;  1VQP A;  1M90 C;  3J80 i;  1YIT A;  1EQR A;  1XNQ Q;  1IBL Q;  1EIY B;  1M1K C;  1PH6 A;  2BH2 A;  2EXD A;  1VQ4 A;  2K14 A;  4LF4 Q;  2KCT A;  2PI2 A;  5C4X H;  1IYJ B;  1NBW A;  2I5M X;  2WAQ E;  5ELN A;  5M5W H;  1HZA A;  1K83 H;  4GLA C;  3K7A H;  2UU9 L;  4DV3 Q;  1Q1E A;  1VQB A;  3CQZ H;  3PIP A;  2IHE A;  1JJ2 A;  4JBK A;  2PQA B;  4BA2 I;  1JJG A;  4UP7 A;  5DLQ E;  1A63 A;  5IP7 H;  4GN3 B;  4YWL A;  4A4I A;  3CMA A;  3M4P A;  3G48 A;  3T1H Q;  5K36 G;  4HJ5 A;  5C44 H;  3UDF A;  3S1Q H;  4LFC Q;  1N33 Q;  4LF5 Q;  4GNX B;  3CCV A;  2JA5 G;  3RNU A;  4A3J G;  2VQF L;  1N32 Q;  4B3M L;  2K52 A;  4LF6 L;  1B8A A;  3I4N G;  5FLX c;  4NXN Q;  5C0X G;  5FJ8 H;  5BR8 L;  1GVP A;  1AE3 A;  1QVG A;  1PVO A;  2XGT A;  4IJL A;  1PYS B;  3U4V A;  4QGU A;  3A5U A;  4AH6 A;  5M3M G;  4O0A A;  1C7Y A;  3TS0 A;  1G6P A;  2ES2 A;  3H15 A;  4AYB E;  3S1M H;  4POG A;  1E1O A;  4R4Q A;  3B6Y A;  3Q8D A;  1XTD A;  4GNX C;  1BBU A;  3F2C A;  2OQK A;  2UU9 Q;  2F4V L;  2JE6 I;  4R1J A;  1N8R C;  3JC6 6;  1FL0 A;  2K5N A;  3I56 A;  2YTY A;  1YIJ A;  3MXN B;  1Q81 C;  3HKS A;  4QY7 A;  1XPU A;  3GDE A;  1E22 A;  4X66 Q;  4DR3 Q;  2NVT H;  4GOP A;  4JBW A;  4DK6 C;  3ULP A;  1EOV A;  1SLJ A;  4R4T A;  3J81 j;  1Q7Y C;  3RZO H;  3I4M G;  5AJ3 Q;  1GM5 A;  4KHP L;  2HQL A;  4X6A H;  1YJW A;  1HZC A;  3AQQ A;  1CKO A;  2Q2I A;  2VQF Q;  4B3M Q;  1N9W A;  1KQS A;  1X9N A;  4IPG A;  4LF6 Q;  4LF7 L;  1OXV A;  4A3F H;  5BR8 Q;  1PH3 A;  1WYD A;  3L0O A;  4A3E G;  5HGQ A;  1X6O A;  2GN5 A;  3KDF B;  1KL9 A;  5GAH C;  3GTP H;  4IFD G;  1HNZ L;  3S24 A;  1E3P A;  1VQ9 A;  4LF8 L;  1UEB A;  5JEA J;  1MJE A;  2A19 A;  2ZM6 Q;  3GO5 A;  5M3F G;  4Y7N H;  1IL2 A;  4GKJ L;  3GTO H;  1EIF A;  2R7D A;  2RF4 A;  3PUZ A;  3NEN A;  3J81 c;  1OTC A;  2UUC L;  3FP9 A;  1OXU A;  5C3E G;  1OXT A;  3JAM i;  3CF5 A;  4JCV E;  1NJI C;  2F4V Q;  1S72 A;  4B3R L;  2NN6 G;  1CKN A;  3CW2 C;  1W3S A;  3KLW A;  1KC8 C;  4LNQ A;  1I94 L;  2PNH A;  3CC2 A;  1AE2 A;  4MTN A;  1VQ7 A;  3HKZ G;  4A93 H;  2I5L X;  3E9I A;  3OW2 A;  4JI4 L;  4K0K L;  3U50 C;  4YCV A;  3RN5 A;  4KHP Q;  5IP9 G;  4A3B H;  2NVQ H;  4A3J H;  4DR5 L;  4KLK A;  4LF7 Q;  3I4N H;  5IWA L;  2NZO A;  4X64 L;  2CQO A;  2B3G A;  1S40 A;  1PH9 A;  4AQY L;  1QVF A;  4IOA A;  2JJQ A;  4JV5 L;  1HNZ Q;  1EWI A;  2EQS A;  4PZ6 A;  4YHH L;  2Q2H A;  4A76 A;  2K4K A;  4LF8 Q;  5M3M H;  4YCU A;  1TWC H;  3ER0 A;  4L5Q A;  3STB D;  3ICE A;  2FXQ A;  1U5K A;  4YWK A;  4DR2 L;  2DUD A;  2WAQ G;  2GVA A;  3CCS A;  4C2M H;  4GKJ Q;  2IY5 B;  2UUC Q;  2PQA A;  3H3V H;  4UY8 C;  2Y0S E;  3PUX A;  1BVS A;  2L15 A;  2VUM G;  1I94 Q;  1V9P A;  2MNA A;  5JJL A;  1RIP A;  3CCU A;  4GNX A;  3S17 H;  1BKB A;  2YU9 H;  4K0K Q;  4GS3 A;  1PH5 A;  2JQO A;  1JB7 A;  4B3S L;  4BY1 H;  4JI4 Q;  3K7U C;  5IYC H;  1HZB A;  3I4M H;  1JE5 A;  3KOJ A;  3G4S A;  4DR5 Q;  3A5Z B;  2JA6 H;  4A3G G;  2R7F A;  3FHW A;  4BXX G;  4UP9 A;  5IWA Q;  1PFS A;  1PYB A;  1QVC A;  4X64 Q;  4JI2 L;  4A3C H;  1TWA H;  4AQY Q;  1VQH A;  2WP8 J;  4IJH A;  1MKH A;  1JT8 A;  3EBE A;  3FKI G;  1K73 C;  3BZK A;  2YTX A;  4HID A;  3CP0 A;  4JYA L;  2JEB I;  1CKN B;  1GKH A;  1A0I A;  1SFO H;  1FJG L;  1HNW Q;  1SRO A;  4LF9 L;  2N49 A;  4DPG A;  4XIG S;  4DR2 Q;  4RG1 A;  2VW9 A;  2AWO A;  2Z6K C;  4OXP A;  5M3F H;  4XTC S;  2WB1 G;  1VQO A;  3STB C;  4A3M H;  1WCM G;  5C3E H;  4HJ7 A;  2QGQ A;  3K0X A;  3CCQ A;  1ASY A;  3ULL A;  4KHZ A;  1KAW A;  1OXX K;  1AH9 A;  3AFP A;  1Z47 A;  4DV2 L;  1VQE A;  3GTM H;  4B3S Q;  2KHI A;  2UXB Q;  1VQ6 A;  1K3R A;  3KJO A;  4IFD I;  5IP9 H;  1QZH A;  2VQE L;  2R93 G;  1VQA A;  1VQJ A;  1Q82 C;  1A62 A;  4HJA A;  2K75 A;  3PO3 G;  3KDF A;  2XTI A;  2QA4 A;  4JI2 Q;  3S2H H;  2BH8 A;  4OWW B;  1TWF H;  2YV5 A;  3UE1 A;  4X66 L;  5JEA G;  4DR3 L;  1YJ9 A;  4JYA Q;  4A93 G;  1KHI A;  1FJG Q;  2ZTD A;  4LF9 Q;  2E8G A;  5AJ3 L;  3KF6 B;  4A3B G;  2CFM A;  1JMC A;  1J5E L;  4PG3 A;  4GN4 B;  1QUQ B;  3CCJ A;  4OWT B;  3W1B A;  3S16 H;  2NVY H;  4JI8 L;  1PH2 A;  4TVA B;  4P74 A;  4P72 A;  2VUM H;  4C3I H;  2BA0 A;  4DV2 Q;  2PMZ E;  2D0P A;  3S15 H;  2ZM6 L;  1IXR A;  3EIV A;  4J15 A;  3F2B A;  2VQE Q;  1JJC B;  1GD7 A;  2NVX H;  1WI5 A;  3L7Z C;  3GTG H;  4P71 A;  4PZ8 A;  4A3G H;  4GKK L;  4BXX H;  1SN8 A;  3PUY A;  4QIW E;  5C4J H;  2E5L L;  3J81 i;  4EQ5 A;  4BY7 G;  4IO9 A;  2A1A A;  3FKI H;  3UDG A;  1LYL A;  3IRB A;  5IYC G;  1PA6 A;  2AKW B;  3RR5 A;  2BA1 A;  4OWX B;  4NB3 A;  2JA6 G;  2JA7 G;  2B63 G;  1J5E Q;  1X3F A;  4DAM A;  4WJ3 M;  4HIO A;  5M5X H;  3TRE A;  4IPD A;  4HIM A;  4Y52 H;  1FVI A;  2EIF A;  3HOV G;  4BBS G;  3DM3 A;  1WCM H;  4JI8 Q;  5E7N A;  1VQG A;  2Z6K A;  1EYG A;  3TS2 A;  3ERS X;  4APV A;  3CC4 A;  1PH4 A;  4A3I H;  1I6H H;  4DUY L;  3DLL A;  2GVB A;  2ATW A;  4DV4 L;  4TQU S;  2R93 H;  1HR0 L;  5H1S E;  3CCM A;  4A3M G;  1KIX A;  4GKK Q;  3HOZ H;  3PO3 H;  1BBW A;  1LM0 A;  1HZ9 A;  2E5L Q;  4GLX A;  3HOW G;  2N78 A;  4DV1 L;  1GO3 E;  4BY1 G;  1KXL A;  2UXC L;  3PV0 A;  3I4O A;  3KYH C;  4IPC A;  2LSS A;  3E0E A;  1UWV A;  3W5O A;  2DGY A;  5GRO A;  3M85 A;  1MIU A;  3CD6 A;  1UE5 A;  4DV0 L;  1J6Q A;  1X3E A;  3BU2 A;  3J7Z C;  2N8N A;  1YVC A;  1B7Y B;  3GTJ H;  1UE1 A;  2RHQ B;  3HFZ B;  1HNW L;  2D62 A;  2VY3 A;  4LUO A;  4DUY Q;  4DV4 Q;  1PH7 A;  1Q1B A;  1KRT A;  1HR0 Q;  1NY4 A;  2CWP A;  3PGZ A;  1IBK L;  4JI0 Q;  3S1R H;  3PSI A;  3K8A A;  2Q2T A;  3I2Z A;  4DV1 Q;  2OWO A;  5C0X I;  2Z0S A;  4BY7 H;  3KF6 A;  4DR4 L;  1K8G A;  2UXB L;  2ZJQ A;  1IZ6 A;  4LFB L;  1QUQ A;  5M5Y H;  4A75 A;  1Y1W H;  4P75 A;  4DR7 L;  1HJP A;  2K5H A;  2JA7 H;  1PV4 A;  2B63 H;  3PUW A;  1UE6 A;  1XJV A;  3GTL H;  1B70 B;  4DV0 Q;  5IT9 c;  4MZ9 A;  3M4Q A;  3ULJ A;  3OTO Q;  3HOV H;  4BBS H;  1CSQ A;  4A3L H;  2R6G A;  3RN2 A;  5IYD H;  3NEL A;  5IE8 A;  1I3Q H;  3KFU A;  1A8V A;  1CKM A;  2IT1 A;  3NBH B;  2K50 A;  1G29 1;  3K80 C;  4AYB G;  2HHH L;  4B3T L;  3PF4 A;  3AFQ A;  1PH1 A;  2E2H H;  1VQ8 A;  1UE7 A;  2KCM A;  3E9H A;  1IBK Q;  1YHA A;  4DR1 Q;  1NMG A;  2MFI A;  4FDB A;  4UPA A;  5LMN L;  2Q2U A;  4O2D A;  4PMW A;  4IFD J;  3HOW H;  1YEZ A;  3LGJ A;  4JG2 A;  3A0J A;  4R4O A;  4JI1 L;  5GAE C;  1TWG H;  3I7F A;  1TXY A;  3CPW A;  4A3I G;  3CCL A;  4DR4 Q;  4OO1 I;  4YWM A;  3NEM A;  1Q46 A;  4A3D G;  4LFB Q;  4BA1 I;  3HOU G;  3KJP A;  4DR7 Q;  3D31 A;  3HKZ E;  3UDX A;  3EN2 A;  2QEX A;  4YY3 Q;  3M3Y H;  1V43 A;  3T1Y Q;  3HOZ G;  2JK8 A;  1SMX A;  1Z9F A;  4OX9 Q;  1VQ5 A;  2F3I A;  3L2P A;  1XPO A;  1XMQ L;  2AHO B;  2NN6 I;  3HOY H;  2ZJP A;  4LUV A;  1N34 L;  4RMF A;  4LWC A;  2JEA I;  1DGS A;  1L2F A;  2HHH Q;  5LMU Q;  1D7Q A;  4B3T Q;  1V1Q A;  2MO0 A;  3UE0 A;  2A8V A;  2OCE A;  2YYZ A;  4P73 A;  1EQQ A;  3SGI A;  2MO1 A;  1PHJ A;  1VQK A;  1T9H A;  1VS0 A;  4C3J H;  5LMN Q;  3KF8 B;  2D0O A;  4JI1 Q;  4A3C G;  2ASB A;  2VNU D;  1P8L A;  3S14 H;  2RHS B;  4NPS A;  3W1G A;  4HJ8 A;  1LUZ A;  1HR0 W;  2R7Z G;  3H0G G;  4JC0 A;  4BBR H;  3J7A 5;  3S1N H;  1L1O B;  2UXD L;  4R4I A;  4LFA L;  1VQD A;  4ME3 A;  5GAD C;  1XNR Q;  5HY6 A;  4JI6 L;  1R9T H;  1XMQ Q;  3PUV A;  3CCR A;  1YHQ A;  2CCZ A;  4GLV B;  3TEH B;  2OTL A;  3J80 c;  1NE3 A;  5EAY A;  5JJI A;  1N34 Q;  3OYY A;  2H5X A;  4DUZ L;  2K5V A;  4X65 Q;  1Y1W G;  4R4C A;  3GTQ H;  1C9O A;  2ID0 A;  2NZH A;  5JJK A;  1WFQ A;  2JA9 A;  1CUK A;  3GTK H;  1L1O C;  1XMO L;  4L5S A;  4DKA C;  4DAY B;  2Y0S G;  2WB1 E;  4A3L G;  4X62 L;  1MJC A;  2HIX A;  4PZ7 A;  3TRZ A;  5IYD G;  3CAM A;  4AIM A;  4WJ4 A;  2OTJ A;  2JA8 G;  2KEN A;  2B29 A;  2CWA A;  3G6E A;  3F2D A;  2PI2 E;  2KHJ A;  4DNI A;  4A3D H;  1HH2 P;  1HNX L;  3HOU H;  3HOX G;  4HJ9 A;  4IPH A;  3PO2 H;  2UXD Q;  3PF5 A;  4LFA Q;  4HIK A;  4JI0 L;  4NXM L;  5IY0 A;  1YZ6 A;  2IX0 A;  1VQC A;  4JI6 Q;  1K9M C;  3ZJY C;  4EX5 A;  1D8L A;  3M9B A;  2ZTC A;  1K8A C;  2UXC Q;  2E2J H;  4DR6 L;  5IYB G;  5J3B A;  1SRU A;  3M4O H;  3AEV A;  1X65 A;  4JI5 L;  3AYH B;  2AWN A;  1IBM L;  4DUZ Q;  3UDI A;  1SR3 A;  5GQO A;  3RZD H;  1NTG A;  4OO1 G;  1XPR A;  5FLM G;  1E7Z A;  1Y1V G;  3U4Z A;  2IHF A;  4H02 A;  5ELO A;  1QZG A;  1VQL A;  1EUJ A;  1YJN A;  2E2I H;  2I0Q A;  2UUB L;  2LXJ A;  2HT1 A;  4JOI C;  4A3K G;  1XMO Q;  1X3G A;  1VQI A;  1N36 L;  1X54 A;  3OTO L;  1W2B A;  2IX1 A;  4JI3 L;  4X62 Q;  1CSP A;  2R92 G;  4MNO A;  1YI2 A;  2KBN A;  2UUA L;  4JBM A;  4L5R C;  3HOY G;  3RLN A;  4QJF A;  2AMC B;  1E1T A;  3MEF A;  5C0X J;  2I5H A;  3BJU A;  1Y14 B;  1TWH H;  3H0G H;  1HNX Q;  4QQB X;  1K0R A;  1VQN A;  4YCW A;  4DV5 L;  5LMN W;  5C4X G;  1L0W A;  4DR1 L;  4NXM Q;  1WJJ A;  1X56 A;  2ZJR A;  4GN5 A;  1I5F A;  4C3H H;  3VDY A;  2JA5 H;  4LUZ A;  1G51 A;  4JBJ A;  4DR6 Q;  3K81 C;  1Q86 C;  3PIO A;  3BZC A;  3D0F A;  1IBM Q;  4JI5 Q;  2C35 B;  4OON A;  3M7N A;  3GD7 A;  5GAG C;  1YNX A;  1OXS C;  4BBR G;  3F1Z A;  2OQ0 A;  5IP7 G;  3CPF A;  1NMF A;  4YY3 L;  4DV7 L;  5C44 G;  1YHB A;  1VQF A;  3T1Y L;  2VS1 A;  3RLO A;  4DK3 C;  2UUB Q;  4LW1 A;  1N36 Q;  4OX9 L;  4JI7 L;  4GOP B;  3H3V I;  1RL2 A;  3JAM c;  4JI3 Q;  2R7Z H;  1C0A A;  2ZTE A;  2UUA Q;  2WFW A;  5FJ8 G;  3CCE A;  2YTV A;  4DV6 L;  1I50 H;  1ASZ A;  4B3R Q;  2ALY B;  2JA8 H;  1L1O A;  4IOC A;  2RCN A;  3RLF A;  5LMU L;  1XNQ L;  1IBL L;  2VZA A;  1VCI A;  4L5T A;  4POF A;  3HOX H;  1Q12 A;  4DV5 Q;  1KD1 C;  3CC7 A;  2CKZ B;  1SE8 A;  4LF4 L;  1H95 A;  2F52 A;  2V1C C;  3WWV A;  3CME A;  1O7I A;  3S2D H;  4GOP C;  2LXK A;  1S3O A;  1U0L A;  5IYB H;  4DV3 L;  4A3E H;  4JV5 Q;  2MQH A;  1LTL A;  3PO2 G;  4DV7 Q;  4YHH Q;  5FLM H;  3CXC A;  1Y1V H;  3T1H L;  4ALP A;  1EFW A;  3PCO B;  4UP8 A;  1X55 A;  4LFC L;  3I55 A;  1PH8 A;  3F8T A;  1FGU A;  4LF5 L;  4JI7 Q;  4A3K H;  1N33 L;  1XNR L;  3A74 A;  1N32 L;  2HIV A;  1WOC A;  4KI0 A;  2N3S A;  4DV6 Q;  1Q8K A;  4NXN L;  2R92 H;  4A3F G;  3G71 A;  3U58 A;  3TQY A;  1E24 A; 
#chains in the Genus database with same CATH topology
 1EQT A;  1VQM A;  3HP3 A;  1P16 A;  3J7A F;  2HD3 A;  1VQ4 A;  2K14 A;  1VF5 C;  3NSW A;  1IYJ B;  5M5W H;  5ELN A;  4HAE A;  1HZA A;  1LT3 D;  1NNX A;  3NP8 A;  4UP7 A;  1VDZ A;  1E2V A;  5CMD A;  5IP7 H;  4LAA A;  4A4I A;  5K36 G;  3M4P A;  4L6T B;  4ABN A;  5E4W C;  4A3J G;  4KV6 A;  2VUM B;  3JAM L;  2K52 A;  1B8A A;  1STE A;  2EYP A;  4M8A A;  1QVG A;  1AE3 A;  1H9J A;  3DWA A;  2NVX B;  1PYS B;  3U4V A;  5M3M G;  4O0A A;  3TS0 A;  4AYB E;  4K6L A;  3B6Y A;  3Q8D A;  2EYF A;  4GNX C;  1BBU A;  3F2C A;  3FKI B;  5KND A;  1HA6 A;  2JE6 I;  1CQF A;  3JC6 6;  3MXN B;  1E22 A;  4Q5V A;  1LTS D;  3HRZ C;  3UI2 A;  1WCM B;  4KHP L;  1C4Q A;  1PRT B;  1QE6 A;  4LF6 Q;  1X9N A;  4IPG A;  2F0E A;  4CDD C;  4CKB A;  4A3I B;  2K32 A;  5BR8 Q;  5KYI A;  2F0U A;  1U9R A;  1X6O A;  4G7O C;  1HTL D;  4ID6 A;  1E3P A;  3GQB A;  4KMU C;  2K04 A;  1STB A;  3S24 A;  2R93 B;  4X3S A;  1UEB A;  1QWY A;  5JEA J;  2NTS A;  2A19 A;  2ZM6 Q;  3GO5 A;  3OW7 A;  4Y7N H;  4ODG A;  1EIF A;  4CHT B;  2R7Z G;  3NEN A;  5C3E G;  2F4V Q;  4N8X 1;  2NN6 G;  2IWH A;  4LNQ A;  1DD2 A;  2CW0 D;  3VR3 A;  3K5N A;  4A93 H;  4K0K L;  4JI4 L;  4A3B H;  1G91 A;  3FRP B;  4DR5 L;  3GTJ B;  4LF7 Q;  1V1P A;  4XXE A;  3H94 A;  5C0X H;  2CQO A;  3FDT A;  1MHW C;  2JJQ A;  3HG9 A;  1HNZ Q;  4YHH L;  1KLG D;  4LF8 Q;  1B44 D;  3Q23 A;  4YCU A;  3S1R B;  1TWC H;  2D9U A;  4G4K A;  3DHQ A;  4GKJ Q;  2IY5 B;  2EXZ A;  1PFB A;  3SK4 A;  2BE5 D;  2PQA A;  1B4O A;  2QCP X;  1VMC A;  1I94 Q;  2MNA A;  4ZK9 B;  2B63 B;  2KED A;  2VB2 X;  5JJL A;  1BKB A;  2QKI C;  3GV3 A;  2UXC Q;  1JB7 A;  4KY7 A;  5I9O A;  5EKK A;  5KEE A;  3G4S A;  4KN4 C;  2NTT A;  4A3G G;  2EY2 A;  3FHW A;  5D3I B;  1I3Q B;  5IWA Q;  3TBI B;  2WP8 J;  4IJH A;  4N9P A;  4HID A;  2YTX A;  4DN4 M;  1SFO H;  1B2T A;  3G6J B;  1DJR D;  4IQZ A;  4RHS A;  3ERQ A;  2F0F A;  1LTI D;  4XQJ A;  4BY1 B;  3J81 L;  3SK8 A;  2QGQ A;  3K0X A;  1ICF B;  1JB3 A;  4OL7 A;  2B8F A;  1VQE A;  4B3S Q;  1K3R A;  5IP9 H;  1VQJ A;  1Q82 C;  2XRS D;  3KDF A;  2E2I B;  1IW7 C;  1ESR A;  4JI2 Q;  3S2H H;  1RDP D;  1Q8I A;  1TWF H;  5JEA G;  3UE1 A;  1LT5 D;  3I73 A;  2K05 A;  5EBD A;  1KHI A;  2ZTD A;  1AN8 A;  2E8G A;  5AJ3 L;  3M7G A;  3D4R A;  2EJM A;  1JMC A;  2PCF B;  4PG3 A;  1QOH A;  2L55 A;  4OWT B;  4ZUI A;  3W1B A;  2B2V C;  4RGM A;  4QB4 A;  2AQ1 B;  2L4N A;  4DV2 Q;  1PRT D;  4WOR A;  2D0P A;  2VQE Q;  1GD7 A;  4DF7 A;  1L0Y B;  3L7Z C;  3KLS A;  4PZ8 A;  2EVB A;  3PUY A;  2E5L L;  2ICE C;  2Z4H A;  4BY7 G;  2BCO A;  2DNE A;  3E5S A;  1BCP D;  2AKW B;  1M4V A;  2B2T C;  2BA1 A;  4NB3 A;  2JA6 G;  1J5E Q;  4Y52 H;  3P1H A;  4DNR B;  4JI8 Q;  4B08 A;  5E7N A;  1KDC A;  1EYG A;  2L1B A;  1SYE A;  4XYQ A;  2MPM A;  1LAB A;  2KEE A;  2E2J B;  4DAP A;  5JJZ A;  1BQQ T;  1HR0 L;  5H1S E;  3CCM A;  4A3M G;  4GKK Q;  3HOZ H;  2WIN B;  2N78 A;  2D5D A;  1TKW B;  2X6G A;  3I4O A;  2XSC A;  4IPC A;  1TS5 A;  2ZXP A;  3E0E A;  3TSS A;  1IKM A;  2G5D A;  1BCP C;  3M85 A;  5GRO A;  2AUJ D;  1TY2 A;  1UE5 A;  4K8J A;  1J6Q A;  1F2Y A;  4R8N A;  1TS2 A;  2F0V A;  3H0G B;  4IAL A;  4TSS A;  5CV4 A;  5C4H A;  2Q8T A;  4C3H B;  1JR0 D;  4DV4 Q;  4K5V A;  1KRT A;  2ZT9 C;  4JI0 Q;  1JOR A;  1H9S B;  3PSI A;  2Q2T A;  5AFW A;  4QUF A;  5J22 A;  3KF6 A;  5M3M B;  2KUM A;  2K28 A;  4LFB L;  3DWP A;  1QUQ A;  1JOQ A;  4P75 A;  1LV9 A;  2K5H A;  2JA7 H;  2RA4 A;  1E2W A;  4DV0 Q;  3HOV H;  3OTO Q;  2H1E A;  2HCI A;  2R6G A;  3RN2 A;  3KFU A;  1F9S A;  5F2D A;  3K80 C;  4AYB G;  2HHH L;  5JOB A;  4B3T L;  1VQ8 A;  3NUC A;  2FMC A;  1XWE A;  1TY0 A;  4KY5 A;  2Q2U A;  2EYJ A;  1S5D D;  2O4X A;  3HOW H;  3LGJ A;  4R4O A;  4JI1 L;  3CPW A;  3CCL A;  2QW7 A;  3Q22 A;  3HOU G;  4ZYS A;  3D31 A;  3HKZ E;  3M3Y H;  4YY3 Q;  2R7Z B;  3NWT A;  2JK8 A;  4QUC A;  2F3I A;  5M9O A;  5D3D A;  3L2P A;  5C6A A;  2NN6 I;  3G7L A;  3HOY H;  5C4X B;  1CHP D;  2JEA I;  1DGS A;  3C1E A;  1D7Q A;  1K83 B;  1V1Q A;  3UE0 A;  1BXT A;  5C3X A;  2WV6 D;  1HCZ A;  1QIL A;  2WKC A;  3CQZ B;  5LHY 1;  2KQ3 A;  5C44 B;  3BDL A;  4NPS A;  1GOZ A;  1LTA D;  1LUZ A;  1HR0 W;  4LJZ C;  5CYU A;  3J7A 5;  1K28 A;  4OHJ A;  5HY6 A;  1IYU A;  5CV9 A;  1AEX A;  3A54 A;  3CCR A;  3D6W A;  4V0B A;  1LAC A;  4MHE A;  5EAY A;  4UAI A;  4DUZ L;  1Y1W G;  4H0L C;  2DNC A;  3GTK H;  1XMO L;  4DAY B;  1MJC A;  1ZYR D;  4PZ7 A;  3VYT A;  4RGO S;  5IYD G;  3RZO B;  2OTJ A;  4OEL B;  2JA8 G;  2KEN A;  2CWA A;  1I4H A;  5FKA C;  4DNI A;  4UHV A;  1HNX L;  4IPH A;  3O13 A;  4B9W A;  4HIK A;  3BG3 A;  4K2K A;  1B9M A;  1YZ6 A;  5IY0 A;  4JI6 Q;  2B2W C;  1DOL A;  5D65 A;  2QDL A;  4DR6 L;  2L0C A;  3NBH A;  1SRU A;  3M4O H;  3AYH B;  2AWN A;  1NTG A;  3DM1 A;  4IUT A;  4OO1 G;  1XPR A;  1F9P A;  1E7Z A;  4KN7 C;  1QZG A;  1EUJ A;  4A3C G;  4C56 C;  2I0Q A;  2LXJ A;  4A3K G;  1RTO A;  1PRT F;  3MZ5 A;  4JI3 L;  2IX1 A;  2PNR C;  2R92 G;  3MEH A;  3DXJ C;  1PZJ D;  4QJF A;  3J7A V;  5C0X J;  2NVQ B;  3BJU A;  3Q6S A;  1HHV A;  1BR9 A;  3I4N B;  1E2Z A;  4DV5 L;  4DK1 A;  3LX0 A;  3OWE B;  3A8J E;  1IBM Q;  3GD7 A;  1OXS C;  4BBR G;  3F1Z A;  5IP7 G;  5IGG A;  4IUR A;  1STH A;  1K8M A;  4OX9 L;  1RL2 A;  1C0A A;  3S17 B;  1PTO H;  2UUA Q;  2F3V A;  2YTV A;  1I50 H;  5EJW A;  3I4M B;  2RSN A;  4IOC A;  3RLF A;  1XNQ L;  2JA6 B;  3HOX H;  5EGT A;  3P20 A;  2CKZ B;  5EKI A;  1F9Q A;  3S2D H;  4QF4 A;  3FEW X;  1S3O A;  5IYB H;  1JC7 A;  5M3F B;  4IZ8 A;  2MQH A;  3PO2 G;  4DV7 Q;  1XTC D;  4YHH Q;  4A3M B;  1O80 A;  3PCO B;  4LFC L;  4LF5 L;  1UNS A;  1PDQ A;  3FPU B;  4IUU A;  2E76 C;  2N3S A;  1E0B A;  2PYK A;  3MXN A;  3GTM B;  4X65 L;  4QL5 A;  1M90 C;  1C8C A;  3J80 i;  2I07 B;  3TP6 A;  1IBL Q;  3L3O C;  1SMY D;  1NUC A;  5CV5 A;  1PH6 A;  2F4I A;  2KCT A;  4PMB A;  2RDF A;  2EJG C;  3M4Y A;  3WOF A;  3MWY W;  3K7A H;  2UU9 L;  2EYM A;  3K5M A;  1Q1E A;  4BA2 I;  1JJG A;  5C5L A;  3SHL A;  2B8G A;  3UDF A;  3S1Q H;  1N33 Q;  2NVY B;  2TSS A;  4JK1 C;  4GNX B;  2QEJ C;  3RNU A;  3QB3 A;  1N32 Q;  5FLX c;  4C3I B;  5C0X G;  2EDG A;  3R2T A;  4S3S A;  4NP5 A;  4AH6 A;  3DUZ A;  1G6P A;  3E6Z X;  3S1M H;  2HCC A;  3OMG A;  2RDH A;  1XTD A;  2F0Q A;  2NZ1 D;  2Z1C A;  2WAC A;  2K5N A;  1Q81 C;  1YIJ A;  5BN5 A;  3GDE A;  2NVT H;  5M5X B;  3ULP A;  1Q7Y C;  1ENF A;  1SLJ A;  2EZV A;  5AJ3 Q;  1HFG A;  1GM5 A;  1YJW A;  1SJH D;  1HZC A;  3AQQ A;  2VQF Q;  1UEA B;  2Q2I A;  4B3M Q;  1N9W A;  4FO2 A;  1OXV A;  4B9X A;  4A3F H;  1I6H B;  4A3E G;  5HGQ A;  2GN5 A;  4C1N K;  1U4P A;  2F0H A;  4BWG B;  2XRQ D;  4XYO A;  1YNJ D;  2LFN A;  1S4Z A;  2F0D A;  4YIJ A;  4KD3 A;  5JPN C;  5COR A;  1QB5 D;  3FMC A;  3I3C A;  3QO2 A;  2H4O A;  2RF4 A;  2Q8R E;  1OTC A;  1GUO A;  2FJ2 A;  3FP9 A;  4TRD A;  4ZRZ A;  3CF5 A;  2UUC L;  4JCV E;  1H9R A;  2QIL A;  3W2D A;  1LTB D;  3CW2 C;  3KLW A;  2F1M A;  2EJF C;  1FYC A;  3HKZ G;  1VQ7 A;  3DWQ A;  3FPP A;  1B3Q A;  3E9I A;  3OW2 A;  1RKN A;  3U50 C;  4YCV A;  3RN5 A;  5FOB B;  1QG7 A;  5FO9 B;  5IP9 G;  2L5T A;  1TT2 A;  4EVO A;  4KLK A;  4I7Z C;  1EQV A;  3I8Z A;  4X64 L;  2PO4 A;  1PXU A;  1PH9 A;  4AQY L;  1LO5 D;  1TWH B;  1AW7 A;  2EQS A;  4IUQ A;  4KY6 A;  1EIG A;  3ICE A;  2X6L A;  4YWK A;  4GZY C;  2WAQ G;  2GVA A;  3CCS A;  4C2M H;  3H3V H;  4UY8 C;  2F0K A;  2P5Z X;  2Y0S E;  5I9P A;  5M5Y B;  1Y1W B;  3TP8 A;  1SJE D;  3GTL B;  2YU9 H;  4GS3 A;  1PH5 A;  2JQO A;  5IYC H;  5HUR A;  1JE5 A;  1CA5 A;  3A5Z B;  1EOT A;  1QCB D;  4UP9 A;  2R3Z A;  2CH4 W;  4FF2 A;  2JA8 B;  1TWA H;  4HCS A;  3EBE A;  2E2H B;  4JYA L;  1GKH A;  1FJG L;  3IFD A;  1SRO A;  2N49 A;  1F2M A;  4DR2 Q;  3R2I A;  4RG1 A;  2ZXR A;  5IT9 E;  4OXP A;  2KVM A;  1PTO C;  3L9A X;  4HJ7 A;  4DAV A;  3QG1 A;  3K59 A;  1MD2 D;  3H6M A;  3CCQ A;  3ULL A;  3HGB A;  1KDB A;  3BDC A;  1AH9 A;  1RJT A;  3KUP A;  5DM7 3;  4NMZ A;  1HA5 A;  1WTH A;  3KJO A;  1VQA A;  1A62 A;  2XTI A;  5I2X A;  3BYY B;  4X66 L;  3AU7 A;  3TME A;  1L0X B;  4P2C B;  2WKD A;  4LF9 Q;  3QIA A;  4C3J B;  5CV6 A;  1NR4 A;  4L8J A;  1SYB A;  4GN4 B;  2EYO A;  3S14 B;  3RMH A;  3VR5 A;  4BBR B;  3AB9 A;  4K5X A;  4TVA B;  5LL6 S;  1D5Z C;  3SK6 A;  3DEP A;  2VUM H;  2IX3 A;  3TDQ A;  3S1N B;  2BA0 A;  3S15 H;  1IXR A;  3EIV A;  1R9T B;  3F2B A;  2NVX H;  1WI5 A;  4P71 A;  1EL0 A;  1SN8 A;  4QIW E;  4UDU C;  4HTH A;  1ESF A;  2A1A A;  3FKI H;  2Q8I B;  3UDG A;  1LYL A;  1V8Q A;  3IRB A;  1PA6 A;  3X3N A;  2PPB C;  2JA7 G;  1X3F A;  3CKI B;  4HIO A;  4HIM A;  1FVI A;  3HOV G;  3DM3 A;  1WCM H;  1EWC A;  4A3D B;  1I4Q A;  1W6K A;  1VQG A;  2Z6K A;  4PNY A;  3PO2 B;  4I7A A;  3MAQ A;  1PH4 A;  4A3I H;  2GVB A;  1BCP B;  2ATW A;  2R93 H;  1JQY D;  1KIX A;  3PO3 H;  1ZKO A;  1HZ9 A;  2J4X A;  3BDO A;  3NBI A;  3BS1 A;  3HOW G;  4DV1 L;  1GO3 E;  2N55 A;  3GTO B;  1ZXT A;  2PZT A;  1UWV A;  3URY A;  1CI3 M;  2K5Q A;  2DGY A;  4IUN A;  3CD6 A;  1SND A;  2SNS A;  1F9R A;  3GTJ H;  1UE1 A;  3HFZ B;  4QMG A;  3DMU A;  2VY3 A;  4LUO A;  4DUY Q;  1ONL A;  1B53 A;  3QOL A;  4OGQ C;  3C46 A;  1PH7 A;  1Q1B A;  2O5I C;  3R8B A;  1NY4 A;  5NUC A;  1IBK L;  3S1R H;  3K8A A;  1BDO A;  5KGU A;  1A2T A;  1ML0 D;  2OWO A;  5C0X I;  4JPB W;  4PV1 C;  1WTR A;  4DR4 L;  1K8G A;  2UXB L;  1IW7 D;  1ET9 A;  2B63 H;  1XJV A;  5CR3 A;  1S5F D;  3CRL C;  1EU4 A;  4EGV A;  5BN4 A;  1SSO A;  4BBS H;  1CSQ A;  4J6H A;  2A68 C;  5IE8 A;  1I3Q H;  2RQX A;  2TMP A;  4EQN A;  2NB0 A;  3A7A B;  1VF7 A;  3E9H A;  2K1B A;  4A3E B;  3CRK C;  1ROD A;  1Y1V B;  5GAE C;  4BY1 H;  4K8I A;  2EY5 A;  2DJG C;  4YWM A;  3D6C A;  5EPK A;  1Q46 A;  4J8Q A;  1HQR D;  4BA1 I;  4DR7 Q;  1W6J A;  2QF7 A;  4HR7 B;  4RCN A;  2F0T A;  1Z9F A;  1O7Z A;  1VQ5 A;  4OX9 Q;  5ELE A;  5CC4 A;  3I4L A;  4CBV A;  1X3P A;  2ZJP A;  1N34 L;  4LWC A;  2A8V A;  1RF2 D;  3QJY A;  1PHJ A;  1CHQ D;  2VB3 X;  1QNK A;  5LMN Q;  3CHB D;  1J8I A;  2JP1 A;  1P8L A;  2MHV A;  1IHZ A;  3VYU A;  2UXD L;  1YNN C;  1WTX A;  2XNA C;  1XMQ Q;  2OTL A;  4GLV B;  3TEH B;  3J80 c;  2AUK A;  3OYY A;  2H5X A;  3ND8 A;  4X65 Q;  4R4C A;  1WTO A;  4CKC A;  2A69 D;  2NZH A;  3WOE A;  2A6H D;  3TZD A;  3E3X A;  1WD1 A;  3J80 E;  4DKA C;  2Y0S G;  1EY7 A;  2WB1 E;  4A3L G;  4X62 L;  2B29 A;  4U67 3;  3VA7 A;  3T4A C;  5EPL A;  1HH2 P;  3HOX G;  3PF5 A;  4LFA Q;  2XWB B;  1GUN A;  3GTP B;  1K9M C;  5FK9 C;  2ZTC A;  2E2J H;  4RCO A;  5IYB G;  1BF4 A;  2EYL A;  1SR3 A;  5ELC A;  5JPM C;  3RZD H;  2EYH A;  3EFX D;  1STY A;  3U4Z A;  4H02 A;  1VQL A;  4L5R C;  2UUB L;  1UUP A;  1YJN A;  1Q3L A;  3MTS A;  1M8A A;  1X54 A;  1W2B A;  2A69 C;  4KKT A;  2A6H C;  3E0J A;  4XQN A;  1CSP A;  1YI2 A;  2RDG A;  2SEB D;  1HRJ A;  4A3J B;  2K6A A;  3EA6 A;  3H0G H;  4QQB X;  1STA A;  4FXG C;  1G2S A;  1L0W A;  1CM9 A;  4FVM A;  4NXM Q;  1X56 A;  1WTW A;  4C3H H;  1G51 A;  3V2T A;  1Q86 C;  2Z8L A;  4CDC C;  4JI5 Q;  5D14 A;  3CU7 A;  5GAG C;  1YNX A;  5ELB A;  1DCZ A;  5C5M A;  3WDN A;  1NMF A;  2F0M A;  1VQF A;  1CFM A;  1B1Z A;  3EJI A;  3KF8 A;  4LW1 A;  1N36 Q;  3KBX A;  4E6I A;  3OPO A;  4OIJ A;  4DV6 L;  3CCE A;  1PZK D;  4TKO B;  2ALY B;  2XWJ B;  1L1O A;  3S9W A;  2HDL A;  3ZYY X;  5LMU L;  1VCI A;  1SE2 A;  4POF A;  2PZW A;  1KD1 C;  3OOC A;  4KKS A;  5KNB A;  2F52 A;  3PIP 3;  1JCK B;  4CDF C;  5EPJ A;  4RGN A;  5FLM H;  5CBA E;  5C3E B;  4IFD H;  4UP8 A;  1X55 A;  1PH8 A;  4K5W A;  4IOA A;  3F8T A;  4JI7 Q;  3A55 A;  1EY5 A;  3HOW B;  2HIV A;  4Q0F A;  2RVL A;  1Q8K A;  2RSO A;  4A3F G;  3QWN A;  2R7Z H;  1DZ1 A;  3U58 A;  2ENB A;  1R4P B;  5G3L D;  4JOI A;  2EE1 A;  1YBY A;  1V1P B;  1YIT A;  1EQR A;  4ZUJ A;  1M1K C;  2BH2 A;  2EXD A;  4LF4 Q;  2PI2 A;  5C4X H;  2I5M X;  2WAQ E;  3SDZ A;  1KAA A;  4CKE A;  1SAP A;  1JWS D;  1K83 H;  2G9D A;  4DV3 Q;  2O5J C;  1VQB A;  5KRU A;  3CQZ H;  5I6W A;  3PIP A;  1JJ2 A;  4JBK A;  2E2D C;  2PQA B;  5DLQ E;  5I2Y A;  1A63 A;  4YWL A;  1KLU D;  4MTK A;  3CMA A;  3G48 A;  3T1H Q;  4HJ5 A;  5C44 H;  4KD4 A;  3S16 B;  3CCV A;  2JA5 G;  4LF6 L;  1DYQ A;  2J7Z A;  4NXN Q;  5FJ8 H;  5BR8 L;  1PVO A;  2XGT A;  4IJL A;  4QGU A;  3GTG B;  3A5U A;  4DK0 A;  4A3G B;  3H15 A;  1BNZ A;  5C4J B;  1XXG A;  1JWU D;  3J7Y W;  2OQK A;  2F4V L;  1N8R C;  4R1J A;  4DFA A;  3LWE A;  4F8M A;  4QY7 A;  4X66 Q;  4GOP A;  4OEM B;  1STG A;  3OWF A;  4JBW A;  1EOV A;  4DK6 C;  5C4Z A;  3J81 j;  3RZO H;  2HQL A;  1CKO A;  1EY4 A;  1KQS A;  4LF7 L;  3Q24 A;  1DM0 B;  1F2Z A;  1WYD A;  1A15 A;  5GAH C;  3KDF B;  1KL9 A;  4IN3 A;  3TP7 A;  1HNZ L;  1VQ9 A;  4ME5 A;  1SEB D;  1FD7 D;  4LF8 L;  1R4Q B;  1WD0 A;  1MJE A;  4GKJ L;  3PUZ A;  4FYD A;  3BVG A;  3JAM i;  1TS3 A;  3A8I E;  1I94 L;  2PNH A;  3CC2 A;  1AE2 A;  3ERO A;  3NK9 A;  2CHB D;  1GJX A;  1EZ8 A;  1U4M A;  3GP7 A;  4KHP Q;  1BCP F;  2LS0 1;  2KCN A;  2NVQ H;  1F77 A;  5FLX L;  3I4N H;  5E1F A;  2NZO A;  4H13 C;  5IWA L;  4X3K A;  1D2B A;  5DAU A;  2B3G A;  2FMM A;  3NQT A;  1K3B C;  1EWI A;  4PZ6 A;  1LT4 D;  1D6E C;  5A2Q E;  4A76 A;  3EQL C;  1CZG A;  4KJN A;  2FXQ A;  1U5K A;  4ZCK A;  1ET6 A;  4BY7 B;  1KDA A;  3P75 A;  1BVS A;  2L15 A;  1TII D;  2VUM G;  2PW7 A;  2VXW A;  3S17 H;  1EY9 A;  2CQA A;  4K0K Q;  4JI4 Q;  4B3S L;  3K7U C;  3T53 B;  3I4M H;  2Y0S B;  3NXW A;  4DR5 Q;  2JA6 H;  1PFS A;  1PYB A;  2EOT A;  3NPP A;  4JI2 L;  1EY6 A;  5CBE E;  5I6Y A;  3FKI G;  1K73 C;  3HOX B;  1BOS A;  2JEB I;  1CKN B;  1A0I A;  4DPG A;  4XIG S;  1Y8O B;  1EY0 A;  2VW9 A;  2AWO A;  2Z6K C;  5M3F H;  2WB1 G;  1TWG B;  1VQO A;  4A3M H;  1WCM G;  1QJO A;  4KHZ A;  1OXX K;  1MBY A;  2A6E D;  1Z47 A;  4DV2 L;  3GTM H;  2UXB Q;  2M9V A;  1MI2 A;  3K57 A;  2R93 G;  2VQE L;  2M00 A;  4IUV A;  4HJA A;  2K75 A;  3PO3 G;  2KOL A;  5IGF A;  2IPK D;  2QA4 A;  3X3M A;  2BH8 A;  5L37 A;  4DR3 L;  5KYL A;  2F03 A;  4A93 G;  1YJ9 A;  1JWM D;  4A3B G;  3KF6 B;  1EIH A;  1J5E L;  4RHR A;  3K7A B;  3T13 A;  1QUQ B;  1QNU A;  1SYF A;  3VYR A;  2NVY H;  3R3O A;  4JI8 L;  5ELD A;  4P74 A;  4DU9 A;  1HQM C;  4C3I H;  2PMZ E;  3N52 A;  1OO9 B;  4RA8 A;  2JYO A;  3MXG A;  4J15 A;  1JJC B;  5JJI A;  2A6E C;  4GKK L;  1A3T A;  3GTQ B;  4BXX H;  1GUS A;  2D2C C;  3GV6 A;  3J81 i;  3A7L A;  4AYB B;  4IO9 A;  5DM6 3;  1ENC A;  3PQI A;  3F2U A;  1FNU A;  3RR5 A;  5G3L F;  3D4D A;  2B63 G;  4DAM A;  1C48 A;  4WJ3 M;  3C1F A;  5M5X H;  2Z6B A;  4BBS G;  2DY7 A;  3HOU B;  2KEC A;  3HEJ A;  1BBX C;  3TS2 A;  3ERS X;  3MHB A;  3KLS X;  4RGT A;  1I6H H;  3K58 A;  3Q0A A;  4DV4 L;  5IOC A;  4A3F B;  1BBW A;  1JE4 A;  4CDE C;  2E5L Q;  4RH6 A;  4GLX A;  1CA6 A;  4BY1 G;  1T5E A;  4FXD A;  2OF1 A;  1KXL A;  3PV0 A;  1PZI D;  1MGS A;  2B39 A;  2C9O A;  1HTP A;  2FFK B;  2IJ0 A;  3OMC A;  4DV0 L;  2F0I A;  3BVZ A;  3BU2 A;  1PFN A;  4NDX A;  4HSP A;  3J7Z C;  1YVC A;  2HUG A;  5CV8 A;  2RHQ B;  1PTO D;  1HNW L;  3H91 A;  2JA5 B;  1HPC A;  1HR0 Q;  3FVQ A;  1GUW A;  1JOK A;  1STN A;  2CWP A;  1FGB D;  3PGZ A;  3MFG A;  1TQO A;  1D5M C;  1Z6H A;  4CJ1 B;  2ZJQ A;  5M5Y H;  1Y1W H;  1HJP A;  1WTV A;  1SBB B;  4CJ2 C;  4KK7 A;  3PUW A;  1UE6 A;  1WVL A;  1K0S A;  3GTL H;  5IT9 c;  4MZ9 A;  3ULJ A;  4JVZ A;  1EY8 A;  4OIK A;  5IYD H;  3G71 A;  1A8V A;  2IT1 A;  1RHP A;  3NBH B;  5C3W A;  1V1O A;  1SNM A;  1PH1 A;  2E2H H;  1UE7 A;  1YHA A;  3AMU A;  4IFD J;  4FDB A;  4UPA A;  5DNF A;  5K5P A;  1YEZ A;  1LTG D;  2F0W A;  3A0J A;  4JG2 A;  1HUN A;  1TXY A;  4OO1 I;  3NEM A;  4A3K B;  4LFB Q;  2B2Y A;  3KJP A;  3UDX A;  2JXM B;  3EN2 A;  1V43 A;  3HOZ G;  2R92 B;  3RUZ A;  1SMX A;  1T5X D;  1ILQ A;  2A73 B;  1XPO A;  3ITP A;  2AHO B;  3VR6 A;  1BO0 A;  4F7X A;  4LUV A;  5M5W B;  1Y69 U;  1Z7T A;  4WRD A;  1L2F A;  2HHH Q;  5LMU Q;  4B3T Q;  2YYZ A;  4P73 A;  1EQQ A;  3SGI A;  1VQK A;  2PW5 A;  1T9H A;  4C3J H;  2F0P A;  2K03 A;  4JI1 Q;  3K6O A;  2ASB A;  3S14 H;  2RHS B;  3H0G G;  4BBR H;  3S1N H;  1CQV A;  5GAD C;  4C3H G;  4JI6 L;  1R9T H;  3PUV A;  1RD9 D;  5LL6 X;  1AZQ A;  2O2L D;  3S15 B;  1EU3 A;  5JJK A;  1H9S A;  1WFQ A;  2JA9 A;  4WJW A;  4FF4 A;  1KNE A;  1L1O C;  3VR2 A;  2HIX A;  4RAU C;  2BDO A;  3CAM A;  1EYC A;  3QOJ A;  4AIM A;  4QCL A;  3G6E A;  2PI2 E;  2KHJ A;  4A3D H;  3A56 A;  2FHT A;  2WB1 B;  1GHK A;  3PIO 3;  3PO2 H;  2PZU A;  5J1Z A;  4HSV A;  5T1I A;  2LY7 A;  1VQC A;  1KNA A;  2K5D A;  1SYG A;  1K8A C;  1EEF D;  3MVV A;  5J3B A;  1X65 A;  1IBM L;  4DUZ Q;  3UDI A;  1GXD C;  4Y7N B;  4ZAI A;  5FLM G;  2IHF A;  4LMQ D;  4IFD G;  2A68 D;  3U9S A;  3PO3 B;  3GTO H;  4JOI C;  1XMO Q;  1X3G A;  3NTK A;  3D4W A;  2UUA L;  2KBN A;  3HOY G;  4A93 B;  2MP1 A;  5COY A;  1EZ6 A;  4A3B B;  1E1T A;  5HGT A;  3VYS A;  3MEF A;  2I5H A;  1HNX Q;  1TR5 A;  5FO8 B;  1ZEQ X;  4YCW A;  5C4X G;  4DR1 L;  2NUC A;  1WJJ A;  2AQ3 B;  4GN5 A;  4LUZ A;  1A2U A;  3NHH A;  4DR6 Q;  3PIO A;  4O42 A;  3D0F A;  1TWC B;  3J80 L;  2C35 B;  4OON A;  3M7N A;  3TP5 A;  5E4X A;  2OQ0 A;  3H09 A;  4DV7 L;  5C44 G;  3T1Y L;  2VS1 A;  2F3W A;  4FNF A;  4DK3 C;  2KJX A;  3JAM c;  4JI3 Q;  4G7Z C;  1AFP A;  2F0G A;  3I90 A;  5FJ8 G;  2RCN A;  3NWS A;  4IUP A;  4KJO A;  1IBL L;  2VZA A;  3JAM E;  1Q12 A;  4DV5 Q;  4R9W A;  3H3V C;  5TSS A;  3MXP A;  4X3U A;  4BS9 A;  2KCC A;  4BBS B;  1H95 A;  1S5C D;  3WWV A;  3CME A;  1O7I A;  2CW0 C;  1ICW A;  4GOP C;  2LXK A;  4HN7 A;  2XVS A;  1U0L A;  1SFO B;  5CGK A;  1CT1 D;  1S5E D;  1KAB A;  1YNN D;  4A3E H;  4Z9C B;  1SE3 A;  4DAY A;  1Y1V H;  3BVM A;  4ALP A;  1EFW A;  3I55 A;  4X3T A;  3ND9 A;  1FGU A;  1N33 L;  1XNR L;  4NW2 A;  1PTO F;  3A74 A;  1N32 L;  3BZD B;  1IYV A;  1WOC A;  1GUT A;  1ENA A;  3HKZ B;  2E2I H;  1KRS A;  2VL6 A;  4LK1 C;  1VQP A;  4M1U B;  3HZX A;  1B9N A;  1XNQ Q;  2BE5 C;  1EIY B;  2B2U A;  3KK7 A;  3S2H B;  1NBW A;  4K14 A;  1KTK A;  1TWF B;  4RWS C;  4GLA C;  1FNW A;  4G57 A;  2IHE A;  4H7B A;  3U9O A;  2WAQ B;  4GN3 B;  1I4P A;  2EY6 A;  4LFC Q;  4LF5 Q;  3TN2 A;  2V4D A;  2JSO A;  4NKL A;  3OIQ A;  4MN3 A;  5DEH A;  2VQF L;  4B3M L;  3I4N G;  2G9H D;  4H44 C;  3EVQ A;  3SXH A;  1EEI D;  1GVP A;  4HMI A;  3NTI A;  4RKB A;  1C7Y A;  1HFN A;  4J1M A;  3R93 A;  2ES2 A;  4POG A;  1E1O A;  4R4Q A;  2SOB A;  2UU9 Q;  4ZQ3 A;  4N9T A;  2K01 A;  2K7V A;  1FL0 A;  3W3A A;  2F0J A;  3VA5 A;  3I56 A;  2YTY A;  1XPU A;  3HKS A;  4DR3 Q;  2MUY A;  2A5H A;  4R4T A;  1PYW D;  3I4M G;  2NWG A;  1SNO A;  3K5O A;  4HMJ A;  4X6A H;  5BN3 A;  1B50 A;  1PH3 A;  3L0O A;  3GTP H;  3N6R A;  4KHV A;  1D1I A;  1I6V C;  1NR2 A;  2CH4 A;  3MFY A;  1MSH A;  5IGD A;  3HOZ B;  4ULL A;  2HDM A;  3T16 A;  5M3F G;  1CZW A;  1IL2 A;  2R7D A;  3SR1 A;  3J81 c;  1PRT C;  1OXU A;  4B3R L;  1OXT A;  1NJI C;  1A3V A;  1S72 A;  3RZD B;  1UAP A;  2R61 A;  1CKN A;  3D3R A;  1W3S A;  3T56 B;  1KC8 C;  1SXT A;  2XN9 C;  4MTN A;  5K36 H;  2I5L X;  3J81 E;  1SNP A;  2WII B;  1D1K A;  2F0L A;  2SDF A;  4A3J H;  2ICI A;  1IL8 A;  5CV7 A;  4HED A;  1S40 A;  3C3L A;  1QVF A;  1SYC A;  5A35 A;  4JV5 L;  1BUV T;  5EBC A;  2Q2H A;  3RD4 A;  2K4K A;  5M3M H;  3ER0 A;  4L5Q A;  3STB D;  4DR2 L;  1H9M A;  2DUD A;  2Z9H A;  2UUC Q;  2JN4 A;  3PUX A;  4XQQ A;  4ILW A;  1V9P A;  2JA7 B;  1RIP A;  4C3I G;  3CCU A;  4GNX A;  4DNT B;  3HOV B;  2RBM A;  1HZB A;  1HUM A;  2NYZ D;  4HCE A;  3KOJ A;  5J39 A;  2R7F A;  1EYD A;  4BXX G;  4FP5 D;  1QVC A;  4X64 Q;  1WTP A;  4AQY Q;  1VQH A;  2E75 C;  1MKH A;  1JT8 A;  3BZK A;  5E3F A;  3CP0 A;  2OEO A;  1HNW Q;  4LF9 L;  4FF3 A;  4XTC S;  3STB C;  5C3E H;  4KKU A;  1ASY A;  4K6D A;  2NN6 H;  1KAW A;  1JIC A;  2IL8 A;  3M3Y B;  3OSO A;  3AFP A;  3NE5 B;  4MIU A;  1U4R A;  2KHI A;  1O7L A;  1VQ6 A;  4IFD I;  1QZH A;  5A2Q L;  1DXM A;  3HOY B;  2C5C A;  4OWW B;  2YV5 A;  4JYA Q;  3DEO A;  1EFI D;  1FJG Q;  1MSG A;  2CFM A;  5FO7 B;  4PMC A;  4R8I A;  2XIW A;  3CCJ A;  3HS0 C;  5IGB A;  4EQO A;  3S16 H;  3LWU A;  1GUG A;  3MXU A;  1PH2 A;  2AQ2 B;  4RKL A;  4P72 A;  5EKL A;  2F0O A;  1GHJ A;  2ZM6 L;  1K8O A;  1SNC A;  3GTG H;  4A3G H;  3P7J A;  5C4J H;  2PMZ B;  4EQ5 A;  3GTK B;  5IYC G;  1CK1 A;  3KBG A;  4OWX B;  1FR3 A;  1X32 A;  1Y8P B;  3TRE A;  4IPD A;  2EIF A;  5T1G A;  2GA4 B;  1TVX A;  1G8Z D;  4APV A;  3CC4 A;  1AP0 A;  4ZLT F;  4DUY L;  3IAY A;  1Y8N B;  3DLL A;  3I72 A;  4TQU S;  3M4O B;  5KIX A;  1AZP A;  1LM0 A;  2B2Y C;  3IKJ A;  3LNN A;  4RFB A;  3I91 A;  1RCV D;  1S5B D;  4K2L A;  5ISR A;  5JEA H;  2UXC L;  3KYH C;  2LSS A;  1II3 A;  3W5O A;  1MIU A;  2PQE A;  2MGS A;  1WTQ A;  2F0S A;  1X3E A;  1XYI A;  2N8N A;  1B7Y B;  5IOD A;  4PQX A;  1A3U A;  2D62 A;  1ZYR C;  4C1N I;  2LKV A;  2L9H A;  2B2V A;  3K0Y A;  2SNM A;  2RKS A;  2DN8 A;  1CTM A;  4C3J G;  1SE4 A;  2HQE A;  3I2Z A;  2I46 A;  4DV1 Q;  2Z0S A;  4BY7 H;  3SVM A;  2A74 C;  4FXK C;  1RTN A;  1IZ6 A;  4A75 A;  3I70 A;  2RCF A;  4DR7 L;  1PTO B;  1HXY D;  1PV4 A;  3KLR A;  1I50 B;  1B70 B;  3IL8 A;  1ILP A;  3M4Q A;  2B2T A;  4A3L H;  2QDB A;  3IFT A;  1NCV A;  1Q90 A;  3MC0 B;  2K33 A;  3NEL A;  2N88 A;  4XT1 B;  1CKM A;  3TZU A;  4ZKB B;  2K50 A;  1G29 1;  3S2D B;  3PF4 A;  1I4X A;  3AFQ A;  2EY1 A;  1I4G A;  4KTA A;  4V19 0;  2KCM A;  1IBK Q;  3VR4 A;  4DR1 Q;  2DJF C;  3NTH A;  1NMG A;  2MFI A;  5LMN L;  4O2D A;  4PMW A;  2BDN A;  1J9O A;  4N8F A;  4DR4 Q;  1TWG H;  3I7F A;  5JVG 3;  4A3I G;  1DON A;  4A3D G;  4XDX A;  2QEX A;  4DGZ A;  3T1Y Q;  2KHS A;  1EYA A;  1LT6 D;  1XMQ L;  2K5W A;  3C2P A;  1SDF A;  4RMF A;  3SEB A;  4DXF A;  5KNC A;  1DOK A;  2MO0 A;  2OCE A;  2MO1 A;  4U68 A;  3OHX C;  5IGE A;  1VS0 A;  3D8G A;  5JAV A;  3KF8 B;  2E74 C;  2D0O A;  2DY8 A;  3S1Q B;  2VNU D;  4XT3 B;  3W1G A;  4HJ8 A;  2F0N A;  4JC0 A;  4EQP A;  2CVR A;  1L1O B;  1TU2 B;  5ELF A;  4R4I A;  4F87 A;  4LFA L;  1VQD A;  4ME3 A;  1XNR Q;  4DXG A;  5IT9 L;  4CGY B;  2MJ8 A;  1YHQ A;  1IKL A;  2CCZ A;  1NE3 A;  4I65 A;  1N34 Q;  3S1M B;  3GTQ H;  2K5V A;  5JVH 3;  1C9O A;  2ID0 A;  4QIW B;  2IW3 A;  1CUK A;  1D5X C;  3SK5 A;  5FLX E;  2OXP A;  4L5S A;  1B3A A;  1EWH A;  1SMY C;  3BYT B;  1I4R A;  3OIP A;  3V05 A;  2NVT B;  3TRZ A;  4WJ4 A;  3ONA B;  1LLR D;  5I4D A;  1PFM A;  3F2D A;  2OT2 A;  3T51 B;  4G7H C;  2FIN B;  3HOU H;  1PMR A;  4HJ9 A;  2UXD Q;  2KA7 A;  4JI0 L;  4NXM L;  2IX0 A;  3ZJY C;  4EX5 A;  1D8L A;  3M9B A;  3QR8 A;  1SYD A;  3AEV A;  4JI5 L;  4L63 B;  5GQO A;  2EPB A;  1O7Y A;  1PLF A;  1Y1V G;  3MA2 B;  1DOM A;  4JW0 A;  4DA2 A;  5ELO A;  2HT1 A;  1NSN S;  5IGC A;  1N36 L;  1XX8 A;  1VQI A;  3OTO L;  4X62 Q;  1H9K A;  4F88 A;  1JOO A;  2B2U C;  1FNV A;  4MNO A;  4JBM A;  1G2T A;  3RLN A;  2AMC B;  2X69 A;  3K5L A;  1Y14 B;  1TWH H;  1K0R A;  1SNQ A;  1VQN A;  5LMN W;  3NQI A;  2ZJR A;  1I5F A;  3VDY A;  2JA5 H;  2LMC B;  4JBJ A;  3K81 C;  3BZC A;  5EQ0 A;  2ZXO A;  4C2M B;  3CPF A;  1VMP A;  4YY3 L;  2L12 A;  1YHB A;  2UUB Q;  3RLO A;  2Z4I A;  4JI7 L;  4GOP B;  1U4L A;  3H3V I;  1A6X A;  1G6Z A;  1NAP A;  2ZTE A;  2WFW A;  1LTT D;  1X3Q A;  1YNJ C;  5IIF A;  4WFN 3;  3V96 A;  1ASZ A;  2YU9 B;  4FF1 A;  4B3R Q;  2JA8 H;  1F2L A;  4CJ0 B;  1TS4 A;  2M2L A;  1O78 A;  4L5T A;  1LTR D;  3CC7 A;  4LF4 L;  1SE8 A;  1TWA B;  2NBF A;  2V1C C;  3A8K E;  4ZKC B;  3PMF A;  4DV3 L;  3SE0 A;  2B2W A;  4JV5 Q;  4OO1 H;  2BOS A;  1LTL A;  2L11 A;  3CXC A;  3T1H L;  4A3C H;  4A3K H;  4KI0 A;  2J0T D;  4DV6 Q;  4NXN L;  2R92 H;  4O1N A;  3TQY A;  1E24 A; 
#chains in the Genus database with same CATH homology
 4X65 L;  1VQM A;  4QL5 A;  1KRS A;  2VL6 A;  4JOI A;  1P16 A;  1YBY A;  1VQP A;  1M90 C;  3J80 i;  1YIT A;  1EQR A;  1XNQ Q;  1IBL Q;  1EIY B;  1M1K C;  1PH6 A;  2BH2 A;  2EXD A;  1VQ4 A;  2K14 A;  4LF4 Q;  2KCT A;  2PI2 A;  5C4X H;  1IYJ B;  1NBW A;  2I5M X;  2WAQ E;  5ELN A;  5M5W H;  1HZA A;  1K83 H;  4GLA C;  3K7A H;  2UU9 L;  4DV3 Q;  1Q1E A;  1VQB A;  3CQZ H;  3PIP A;  2IHE A;  1JJ2 A;  4JBK A;  2PQA B;  4BA2 I;  1JJG A;  4UP7 A;  5DLQ E;  1A63 A;  5IP7 H;  4GN3 B;  4YWL A;  4A4I A;  3CMA A;  3M4P A;  3G48 A;  3T1H Q;  5K36 G;  4HJ5 A;  5C44 H;  3UDF A;  3S1Q H;  4LFC Q;  1N33 Q;  4LF5 Q;  4GNX B;  3CCV A;  2JA5 G;  3RNU A;  4A3J G;  2VQF L;  1N32 Q;  4B3M L;  2K52 A;  4LF6 L;  1B8A A;  3I4N G;  5FLX c;  4NXN Q;  5C0X G;  5FJ8 H;  5BR8 L;  1GVP A;  1AE3 A;  1QVG A;  1PVO A;  2XGT A;  4IJL A;  1PYS B;  3U4V A;  4QGU A;  3A5U A;  4AH6 A;  5M3M G;  4O0A A;  1C7Y A;  3TS0 A;  1G6P A;  2ES2 A;  3H15 A;  4AYB E;  3S1M H;  4POG A;  1E1O A;  4R4Q A;  3B6Y A;  3Q8D A;  1XTD A;  4GNX C;  1BBU A;  3F2C A;  2OQK A;  2UU9 Q;  2F4V L;  2JE6 I;  4R1J A;  1N8R C;  3JC6 6;  1FL0 A;  2K5N A;  3I56 A;  2YTY A;  1YIJ A;  3MXN B;  1Q81 C;  3HKS A;  4QY7 A;  1XPU A;  3GDE A;  1E22 A;  4X66 Q;  4DR3 Q;  2NVT H;  4GOP A;  4JBW A;  4DK6 C;  3ULP A;  1EOV A;  1SLJ A;  4R4T A;  3J81 j;  1Q7Y C;  3RZO H;  3I4M G;  5AJ3 Q;  1GM5 A;  4KHP L;  2HQL A;  4X6A H;  1YJW A;  1HZC A;  3AQQ A;  1CKO A;  2Q2I A;  2VQF Q;  4B3M Q;  1N9W A;  1KQS A;  1X9N A;  4IPG A;  4LF6 Q;  4LF7 L;  1OXV A;  4A3F H;  5BR8 Q;  1PH3 A;  1WYD A;  3L0O A;  4A3E G;  5HGQ A;  1X6O A;  2GN5 A;  3KDF B;  1KL9 A;  5GAH C;  3GTP H;  4IFD G;  1HNZ L;  3S24 A;  1E3P A;  1VQ9 A;  4LF8 L;  1UEB A;  5JEA J;  1MJE A;  2A19 A;  2ZM6 Q;  3GO5 A;  5M3F G;  4Y7N H;  1IL2 A;  4GKJ L;  3GTO H;  1EIF A;  2R7D A;  2RF4 A;  3PUZ A;  3NEN A;  3J81 c;  1OTC A;  2UUC L;  3FP9 A;  1OXU A;  5C3E G;  1OXT A;  3JAM i;  3CF5 A;  4JCV E;  1NJI C;  2F4V Q;  1S72 A;  4B3R L;  2NN6 G;  1CKN A;  3CW2 C;  1W3S A;  3KLW A;  1KC8 C;  4LNQ A;  1I94 L;  2PNH A;  3CC2 A;  1AE2 A;  4MTN A;  1VQ7 A;  3HKZ G;  4A93 H;  2I5L X;  3E9I A;  3OW2 A;  4JI4 L;  4K0K L;  3U50 C;  4YCV A;  3RN5 A;  4KHP Q;  5IP9 G;  4A3B H;  2NVQ H;  4A3J H;  4DR5 L;  4KLK A;  4LF7 Q;  3I4N H;  5IWA L;  2NZO A;  4X64 L;  2CQO A;  2B3G A;  1S40 A;  1PH9 A;  4AQY L;  1QVF A;  4IOA A;  2JJQ A;  4JV5 L;  1HNZ Q;  1EWI A;  2EQS A;  4PZ6 A;  4YHH L;  2Q2H A;  4A76 A;  2K4K A;  4LF8 Q;  5M3M H;  4YCU A;  1TWC H;  3ER0 A;  4L5Q A;  3STB D;  3ICE A;  2FXQ A;  1U5K A;  4YWK A;  4DR2 L;  2DUD A;  2WAQ G;  2GVA A;  3CCS A;  4C2M H;  4GKJ Q;  2IY5 B;  2UUC Q;  2PQA A;  3H3V H;  4UY8 C;  2Y0S E;  3PUX A;  1BVS A;  2L15 A;  2VUM G;  1I94 Q;  1V9P A;  2MNA A;  5JJL A;  1RIP A;  3CCU A;  4GNX A;  3S17 H;  1BKB A;  2YU9 H;  4K0K Q;  4GS3 A;  1PH5 A;  2JQO A;  1JB7 A;  4B3S L;  4BY1 H;  4JI4 Q;  3K7U C;  5IYC H;  1HZB A;  3I4M H;  1JE5 A;  3KOJ A;  3G4S A;  4DR5 Q;  3A5Z B;  2JA6 H;  4A3G G;  2R7F A;  3FHW A;  4BXX G;  4UP9 A;  5IWA Q;  1PFS A;  1PYB A;  1QVC A;  4X64 Q;  4JI2 L;  4A3C H;  1TWA H;  4AQY Q;  1VQH A;  2WP8 J;  4IJH A;  1MKH A;  1JT8 A;  3EBE A;  3FKI G;  1K73 C;  3BZK A;  2YTX A;  4HID A;  3CP0 A;  4JYA L;  2JEB I;  1CKN B;  1GKH A;  1A0I A;  1SFO H;  1FJG L;  1HNW Q;  1SRO A;  4LF9 L;  2N49 A;  4DPG A;  4XIG S;  4DR2 Q;  4RG1 A;  2VW9 A;  2AWO A;  2Z6K C;  4OXP A;  5M3F H;  4XTC S;  2WB1 G;  1VQO A;  3STB C;  4A3M H;  1WCM G;  5C3E H;  4HJ7 A;  2QGQ A;  3K0X A;  3CCQ A;  1ASY A;  3ULL A;  4KHZ A;  1KAW A;  1OXX K;  1AH9 A;  3AFP A;  1Z47 A;  4DV2 L;  1VQE A;  3GTM H;  4B3S Q;  2KHI A;  2UXB Q;  1VQ6 A;  1K3R A;  3KJO A;  4IFD I;  5IP9 H;  1QZH A;  2VQE L;  2R93 G;  1VQA A;  1VQJ A;  1Q82 C;  1A62 A;  4HJA A;  2K75 A;  3PO3 G;  3KDF A;  2XTI A;  2QA4 A;  4JI2 Q;  3S2H H;  2BH8 A;  4OWW B;  1TWF H;  2YV5 A;  3UE1 A;  4X66 L;  5JEA G;  4DR3 L;  1YJ9 A;  4JYA Q;  4A93 G;  1KHI A;  1FJG Q;  2ZTD A;  4LF9 Q;  2E8G A;  5AJ3 L;  3KF6 B;  4A3B G;  2CFM A;  1JMC A;  1J5E L;  4PG3 A;  4GN4 B;  1QUQ B;  3CCJ A;  4OWT B;  3W1B A;  3S16 H;  2NVY H;  4JI8 L;  1PH2 A;  4TVA B;  4P74 A;  4P72 A;  2VUM H;  4C3I H;  2BA0 A;  4DV2 Q;  2PMZ E;  2D0P A;  3S15 H;  2ZM6 L;  1IXR A;  3EIV A;  4J15 A;  3F2B A;  2VQE Q;  1JJC B;  1GD7 A;  2NVX H;  1WI5 A;  3L7Z C;  3GTG H;  4P71 A;  4PZ8 A;  4A3G H;  4GKK L;  4BXX H;  1SN8 A;  3PUY A;  4QIW E;  5C4J H;  2E5L L;  3J81 i;  4EQ5 A;  4BY7 G;  4IO9 A;  2A1A A;  3FKI H;  3UDG A;  1LYL A;  3IRB A;  5IYC G;  1PA6 A;  2AKW B;  3RR5 A;  2BA1 A;  4OWX B;  4NB3 A;  2JA6 G;  2JA7 G;  2B63 G;  1J5E Q;  1X3F A;  4DAM A;  4WJ3 M;  4HIO A;  5M5X H;  3TRE A;  4IPD A;  4HIM A;  4Y52 H;  1FVI A;  2EIF A;  3HOV G;  4BBS G;  3DM3 A;  1WCM H;  4JI8 Q;  5E7N A;  1VQG A;  2Z6K A;  1EYG A;  3TS2 A;  3ERS X;  4APV A;  3CC4 A;  1PH4 A;  4A3I H;  1I6H H;  4DUY L;  3DLL A;  2GVB A;  2ATW A;  4DV4 L;  4TQU S;  2R93 H;  1HR0 L;  5H1S E;  3CCM A;  4A3M G;  1KIX A;  4GKK Q;  3HOZ H;  3PO3 H;  1BBW A;  1LM0 A;  1HZ9 A;  2E5L Q;  4GLX A;  3HOW G;  2N78 A;  4DV1 L;  1GO3 E;  4BY1 G;  1KXL A;  2UXC L;  3PV0 A;  3I4O A;  3KYH C;  4IPC A;  2LSS A;  3E0E A;  1UWV A;  3W5O A;  2DGY A;  5GRO A;  3M85 A;  1MIU A;  3CD6 A;  1UE5 A;  4DV0 L;  1J6Q A;  1X3E A;  3BU2 A;  3J7Z C;  2N8N A;  1YVC A;  1B7Y B;  3GTJ H;  1UE1 A;  2RHQ B;  3HFZ B;  1HNW L;  2D62 A;  2VY3 A;  4LUO A;  4DUY Q;  4DV4 Q;  1PH7 A;  1Q1B A;  1KRT A;  1HR0 Q;  1NY4 A;  2CWP A;  3PGZ A;  1IBK L;  4JI0 Q;  3S1R H;  3PSI A;  3K8A A;  2Q2T A;  3I2Z A;  4DV1 Q;  2OWO A;  5C0X I;  2Z0S A;  4BY7 H;  3KF6 A;  4DR4 L;  1K8G A;  2UXB L;  2ZJQ A;  1IZ6 A;  4LFB L;  1QUQ A;  5M5Y H;  4A75 A;  1Y1W H;  4P75 A;  4DR7 L;  1HJP A;  2K5H A;  2JA7 H;  1PV4 A;  2B63 H;  3PUW A;  1UE6 A;  1XJV A;  3GTL H;  1B70 B;  4DV0 Q;  5IT9 c;  4MZ9 A;  3M4Q A;  3ULJ A;  3OTO Q;  3HOV H;  4BBS H;  1CSQ A;  4A3L H;  2R6G A;  3RN2 A;  5IYD H;  3NEL A;  5IE8 A;  1I3Q H;  3KFU A;  1A8V A;  1CKM A;  2IT1 A;  3NBH B;  2K50 A;  1G29 1;  3K80 C;  4AYB G;  2HHH L;  4B3T L;  3PF4 A;  3AFQ A;  1PH1 A;  2E2H H;  1VQ8 A;  1UE7 A;  2KCM A;  3E9H A;  1IBK Q;  1YHA A;  4DR1 Q;  1NMG A;  2MFI A;  4FDB A;  4UPA A;  5LMN L;  2Q2U A;  4O2D A;  4PMW A;  4IFD J;  3HOW H;  1YEZ A;  3LGJ A;  4JG2 A;  3A0J A;  4R4O A;  4JI1 L;  5GAE C;  1TWG H;  3I7F A;  1TXY A;  3CPW A;  4A3I G;  3CCL A;  4DR4 Q;  4OO1 I;  4YWM A;  3NEM A;  1Q46 A;  4A3D G;  4LFB Q;  4BA1 I;  3HOU G;  3KJP A;  4DR7 Q;  3D31 A;  3HKZ E;  3UDX A;  3EN2 A;  2QEX A;  4YY3 Q;  3M3Y H;  1V43 A;  3T1Y Q;  3HOZ G;  2JK8 A;  1SMX A;  1Z9F A;  4OX9 Q;  1VQ5 A;  2F3I A;  3L2P A;  1XPO A;  1XMQ L;  2AHO B;  2NN6 I;  3HOY H;  2ZJP A;  4LUV A;  1N34 L;  4RMF A;  4LWC A;  2JEA I;  1DGS A;  1L2F A;  2HHH Q;  5LMU Q;  1D7Q A;  4B3T Q;  1V1Q A;  2MO0 A;  3UE0 A;  2A8V A;  2OCE A;  2YYZ A;  4P73 A;  1EQQ A;  3SGI A;  2MO1 A;  1PHJ A;  1VQK A;  1T9H A;  1VS0 A;  4C3J H;  5LMN Q;  3KF8 B;  2D0O A;  4JI1 Q;  4A3C G;  2ASB A;  2VNU D;  1P8L A;  3S14 H;  2RHS B;  4NPS A;  3W1G A;  4HJ8 A;  1LUZ A;  1HR0 W;  2R7Z G;  3H0G G;  4JC0 A;  4BBR H;  3J7A 5;  3S1N H;  1L1O B;  2UXD L;  4R4I A;  4LFA L;  1VQD A;  4ME3 A;  5GAD C;  1XNR Q;  5HY6 A;  4JI6 L;  1R9T H;  1XMQ Q;  3PUV A;  3CCR A;  1YHQ A;  2CCZ A;  4GLV B;  3TEH B;  2OTL A;  3J80 c;  1NE3 A;  5EAY A;  5JJI A;  1N34 Q;  3OYY A;  2H5X A;  4DUZ L;  2K5V A;  4X65 Q;  1Y1W G;  4R4C A;  3GTQ H;  1C9O A;  2ID0 A;  2NZH A;  5JJK A;  1WFQ A;  2JA9 A;  1CUK A;  3GTK H;  1L1O C;  1XMO L;  4L5S A;  4DKA C;  4DAY B;  2Y0S G;  2WB1 E;  4A3L G;  4X62 L;  1MJC A;  2HIX A;  4PZ7 A;  3TRZ A;  5IYD G;  3CAM A;  4AIM A;  4WJ4 A;  2OTJ A;  2JA8 G;  2KEN A;  2B29 A;  2CWA A;  3G6E A;  3F2D A;  2PI2 E;  2KHJ A;  4DNI A;  4A3D H;  1HH2 P;  1HNX L;  3HOU H;  3HOX G;  4HJ9 A;  4IPH A;  3PO2 H;  2UXD Q;  3PF5 A;  4LFA Q;  4HIK A;  4JI0 L;  4NXM L;  5IY0 A;  1YZ6 A;  2IX0 A;  1VQC A;  4JI6 Q;  1K9M C;  3ZJY C;  4EX5 A;  1D8L A;  3M9B A;  2ZTC A;  1K8A C;  2UXC Q;  2E2J H;  4DR6 L;  5IYB G;  5J3B A;  1SRU A;  3M4O H;  3AEV A;  1X65 A;  4JI5 L;  3AYH B;  2AWN A;  1IBM L;  4DUZ Q;  3UDI A;  1SR3 A;  5GQO A;  3RZD H;  1NTG A;  4OO1 G;  1XPR A;  5FLM G;  1E7Z A;  1Y1V G;  3U4Z A;  2IHF A;  4H02 A;  5ELO A;  1QZG A;  1VQL A;  1EUJ A;  1YJN A;  2E2I H;  2I0Q A;  2UUB L;  2LXJ A;  2HT1 A;  4JOI C;  4A3K G;  1XMO Q;  1X3G A;  1VQI A;  1N36 L;  1X54 A;  3OTO L;  1W2B A;  2IX1 A;  4JI3 L;  4X62 Q;  1CSP A;  2R92 G;  4MNO A;  1YI2 A;  2KBN A;  2UUA L;  4JBM A;  4L5R C;  3HOY G;  3RLN A;  4QJF A;  2AMC B;  1E1T A;  3MEF A;  5C0X J;  2I5H A;  3BJU A;  1Y14 B;  1TWH H;  3H0G H;  1HNX Q;  4QQB X;  1K0R A;  1VQN A;  4YCW A;  4DV5 L;  5LMN W;  5C4X G;  1L0W A;  4DR1 L;  4NXM Q;  1WJJ A;  1X56 A;  2ZJR A;  4GN5 A;  1I5F A;  4C3H H;  3VDY A;  2JA5 H;  4LUZ A;  1G51 A;  4JBJ A;  4DR6 Q;  3K81 C;  1Q86 C;  3PIO A;  3BZC A;  3D0F A;  1IBM Q;  4JI5 Q;  2C35 B;  4OON A;  3M7N A;  3GD7 A;  5GAG C;  1YNX A;  1OXS C;  4BBR G;  3F1Z A;  2OQ0 A;  5IP7 G;  3CPF A;  1NMF A;  4YY3 L;  4DV7 L;  5C44 G;  1YHB A;  1VQF A;  3T1Y L;  2VS1 A;  3RLO A;  4DK3 C;  2UUB Q;  4LW1 A;  1N36 Q;  4OX9 L;  4JI7 L;  4GOP B;  3H3V I;  1RL2 A;  3JAM c;  4JI3 Q;  2R7Z H;  1C0A A;  2ZTE A;  2UUA Q;  2WFW A;  5FJ8 G;  3CCE A;  2YTV A;  4DV6 L;  1I50 H;  1ASZ A;  4B3R Q;  2ALY B;  2JA8 H;  1L1O A;  4IOC A;  2RCN A;  3RLF A;  5LMU L;  1XNQ L;  1IBL L;  2VZA A;  1VCI A;  4L5T A;  4POF A;  3HOX H;  1Q12 A;  4DV5 Q;  1KD1 C;  3CC7 A;  2CKZ B;  1SE8 A;  4LF4 L;  1H95 A;  2F52 A;  2V1C C;  3WWV A;  3CME A;  1O7I A;  3S2D H;  4GOP C;  2LXK A;  1S3O A;  1U0L A;  5IYB H;  4DV3 L;  4A3E H;  4JV5 Q;  2MQH A;  1LTL A;  3PO2 G;  4DV7 Q;  4YHH Q;  5FLM H;  3CXC A;  1Y1V H;  3T1H L;  4ALP A;  1EFW A;  3PCO B;  4UP8 A;  1X55 A;  4LFC L;  3I55 A;  1PH8 A;  3F8T A;  1FGU A;  4LF5 L;  4JI7 Q;  4A3K H;  1N33 L;  1XNR L;  3A74 A;  1N32 L;  2HIV A;  1WOC A;  4KI0 A;  2N3S A;  4DV6 Q;  1Q8K A;  4NXN L;  2R92 H;  4A3F G;  3G71 A;  3U58 A;  3TQY A;  1E24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...