3CP0A

Crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SPRALVGHRAEVLEDVGATSGQVRLDGSIWSARSMDPTHTFAEGEIVSVIDIQGTTAIVWKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane protein implicated in regulation of membrane protea
publication title The crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from Corynebacterium glutamicum.
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Membrane protein
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cp0A00
5M3MG 1RL2A 1X6OA 1GVPA 3CCSA 1AH9A 3E9IA 1X65A 5C44G 3K7UC 5BR8Q 3EIVA 3CQZH 1A62A 3PIPA 1TXYA 4GKKQ 3GTMH 4OWTB 4XTCS 1X55A 3HKSA 4DR6Q 2KBNA 4JI5L 1L2FA 1EOVA 2N8NA 2VY3A 4NB3A 4DV0L 3CMAA 4AYBE 4A93G 2NZHA 4LF5Q 2UXBL 1NTGA 1UE1A 3MEFA 3D31A 4P74A 1VQIA 3F8TA 3ULJA 4A3MH 4BBRG 1N32L 1QUQA 3G48A 3JAMc 1CSQA 1WJJA 4TQUS 1RIPA 5FLXc 2PMZE 4A3KH 4HIDA 4KHPL 3S1RH 1VQ4A 2YV5A 4JI1Q 1Z9FA 1CKNA 5M5YH 1PYSB 4X62Q 1QVCA 1VQEA 1VQ6A 4AH6A 1ASYA 2JA6H 3EBEA 5IYDH 2N3SA 3DM3A 1PH1A 1PH7A 1BBWA 3H0GG 3GD7A 4QGUA 2E5LL 2R6GA 1K9MC 4LFCQ 4MZ9A 1BVSA 4A3MG 1EFWA 2AWOA 2F4VL 4JYAQ 2UUAQ 4JV5L 1H95A 1UE5A 1BKBA 4JI2Q 3RZDH 5LMUQ 4DR3L 4JI7L 2NVXH 1GM5A 1X54A 3FKIH 4JOIC 4POGA 4A3LH 1WI5A 2NN6G 4K0KQ 4DV6L 2JJQA 2MO1A 2L15A 3RR5A 3KJPA 4DK6C 4DR4Q 2AKWB 2K5VA 5IP7G 2A19A 2AMCB 4DK3C 5M5WH 4X65Q 2OQKA 2RF4A 3U4ZA 1FVIA 4HJ5A 1HNZQ 2CCZA 1HZ9A 1QVFA 2IT1A 5IYDG 2JA6G 1FL0A 1PH3A 2VZAA 3RLOA 4DUZL 4JI6L 1KIXA 3BZKA 1L1OC 4A3FH 1NE3A 3KF8B 2EQSA 2YYZA 4GNXB 4B3RL 4JI4L 3K80C 4O0AA 1VQMA 1N34Q 4NXML 1X3FA 2MQHA 2JA8G 4PMWA 3G4SA 4P72A 2B3GA 2JA7H 3S2HH 2K14A 4A4IA 3GTKH 4A3JG 3PIOA 2ZM6L 1JJ2A 3M9BA 1N9WA 2Z0SA 1J6QA 1C7YA 2R7ZH 3T1YL 1GD7A 1OXSC 1YEZA 2XTIA 1VCIA 4LF6L 4DV0Q 3HFZB 5JJLA 4OXPA 2Q2IA 5DLQE 3CCMA 3L2PA 5C0XI 2ALYB 1Q86C 5ELNA 1D7QA 4O2DA 1EQRA 2WAQG 4LF4Q 4IPGA 3CCVA 4A76A 2XGTA 5M5XH 1Q7YC 3B6YA 1OXVA 2LXJA 3I4MG 1PH2A 2NN6I 1N33L 2JA7G 4KHPQ 3G6EA 3CXCA 4OONA 3W1GA 2IHEA 3S15H 1WCMG 2JQOA 4DR2Q 1VQLA 4B3TL 4B3SL 2VUMH 3RLFA 2VS1A 3CD6A 2UXCL 1WFQA 2ZTDA 4YWKA 2K50A 1G291 4NXNL 4DR5L 2I0QA 1GO3E 3M85A 3TQYA 3RN5A 3PUWA 2HIXA 3RZOH 2B63H 4A3GH 3I55A 3S1NH 3F1ZA 3TEHB 1EIYB 1I94L 3J80i 2PQAB 4GNXC 4HJ7A 1L1OB 3TRZA 5JEAG 2F4VQ 4Y52H 4YY3L 3J81i 1SMXA 4LUZA 5GROA 1MIUA 2GVAA 4GN5A 4DR3Q 4AQYQ 1S72A 1IL2A 1JT8A 3HOUH 4QY7A 4POFA 1IBLQ 4A3BH 2HQLA 3NELA 4DV6Q 1M1KC 1HNXL 3PO3G 4LFBQ 1OXTA 4R4IA 1B7YB 2JE6I 2K4KA 2MO0A 4JC0A 4JG2A 3LGJA 2R93G 1X9NA 1HR0L 5C4XH 3KF6B 2GN5A 3I7FA 2VUMG 2CFMA 2PQAA 1L1OA 2JEAI 4ALPA 2JA9A 5HY6A 1J5EQ 1YJ9A 2Z6KC 4A3GG 5IWAL 4WJ4A 2FXQA 4LF9Q 2EIFA 1HZBA 4LFAL 1V9PA 3L7ZC 1U5KA 2JK8A 2KENA 4HIOA 2DGYA 4DV4Q 4BY7G 3FHWA 2BA1A 3KF6A 3KOJA 4UP9A 3DLLA 3M7NA 1PYBA 3CCQA 2UXDQ 2H5XA 1X3GA 4DR7L 1UE7A 2E2IH 1EYGA 3PF5A 1SRUA 4IJHA 1O7IA 2Y0SE 2ZM6Q 1HR0W 2HHHQ 3VDYA 3T1YQ 3J80c 4IOAA 3TS2A 4OO1G 4GN3B 4LW1A 2YTVA 3J81c 4LF6Q 1UEBA 4TVAB 3U4VA 3GTPH 1E24A 3GO5A 1XNRL 3SGIA 1VS0A 5GAHC 4A3CG 1T9HA 1UWVA 4DV7Q 1KHIA 1VQ8A 4LNQA 2IX1A 1UE6A 2Y0SG 1XJVA 3OTOQ 5FJ8H 3ICEA 1VQCA 5GAGC 3OW2A 4OX9L 1NJIC 1N33Q 4IPHA 3CCJA 2A8VA 3GTQH 3HOYH 4GLAC 1KD1C 1IBML 2A1AA 4X66L 4DV5L 4B3SQ 3I56A 1KRTA 5M3FH 2UXCQ 5C3EH 3S1QH 4UY8C 2N49A 5C0XG 5AJ3L 4LF7L 4NXNQ 3ULLA 4DR5Q 3EN2A 4DNIA 4JI8Q 5ELOA 4BA1I 3RNUA 2LSSA 1XNQL 1L0WA 1I94Q 1VQNA 1A8VA 1VQFA 3M4QA 1G6PA 4A3KG 4BXXH 1IBKL 5FJ8G 4X64L 3A74A 2UUBL 1TWAH 2K5HA 5LMNW 2ZTCA 1DGSA 2JA5H 4IFDJ 4EQ5A 4DV2L 2OTJA 1TWFH 3UDIA 1JB7A 3JC66 1PHJA 1X56A 4EX5A 3HOYG 1SE8A 3L0OA 3UDGA 1GKHA 5EAYA 4OO1I 1I3QH 1VQAA 5E7NA 3U58A 4LF8L 2VQEQ 3S16H 3J7ZC 4DV1L 1XTDA 4NPSA 4R4QA 4PZ6A 5IE8A 1I6HH 1XMQL 2UUCL 3FKIG 4A3LG 1K0RA 4A3EH 2I5LX 2I5MX 3E0EA 1E1TA 4JI0L 1ASZA 2WAQE 1KL9A 5JJKA 5GQOA 4FDBA 1Y1VH 1Q1EA 2KCMA 4DAYB 2AWNA 2BH2A 2JA5G 4QL5A 4DR7Q 4A75A 3I4NH 2QEXA 4JI5Q 5IP9H 3M3YH 1N36L 1FJGL 4JBWA 1HZCA 2UXBQ 3HOVH 1PH4A 1MJCA 4GOPC 2CKZB 3GTJH 4A3FG 2UU9L 3KFUA 2CWAA 3PF4A 1N32Q 3STBD 3PO2H 3TREA 3F2CA 4HJ8A 1G51A 3PUYA 4JCVE 4P75A 3BZCA 1Z47A 2KHJA 2ZTEA 1QVGA 4X6AH 2B29A 1TWHH 4PG3A 4OX9Q 4UP7A 1W3SA 1QZGA 2R7ZG 1XMOL 2CWPA 3NBHB 1K8GA 4DUYL 1OXUA 4DV3L 1AE3A 2IHFA 4L5TA 4P71A 1IBMQ 4X66Q 3G71A 1YJWA 4DR1L 4R1JA 4JOIA 3HOVG 3KLWA 3CCRA 4B3ML 1TWGH 2E5LQ 2VQFL 3HOZH 4JV5Q 4A3DH 4XIGS 1KAWA 1SR3A 4L5QA 2D62A 4JI1L 1PH8A 4JI7Q 3HKZG 5IT9c 2Q2HA 3PUVA 1P8LA 4X62L 4LUOA 5H1SE 2K52A 3KDFB 1I50H 4X64Q 1IBKQ 2NVQH 2UUBQ 1VQ9A 3H3VH 1XPUA 2AHOB 4DV2Q 4R4OA 1VQDA 1Q46A 5FLMH 1CKMA 4DAMA 1A0IA 1YNXA 1JMCA 3KYHC 2UUAL 1JJGA 3CC7A 2HIVA 1X3EA 4JI2L 1WOCA 2KHIA 5IYBH 4LF8Q 2B63G 2R92H 4GOPB 1B70B 2NZOA 1I5FA 4OWXB 4A3IH 4DUZQ 3KDFA 1Q82C 4JI6Q 3M4OH 3W5OA 1BBUA 4DV1Q 3OYYA 4YWLA 5C44H 1PH5A 4K0KL 1E22A 2QGQA 5J3BA 4B3RQ 1PH9A 4JI4Q 2OQ0A 3HOUG 4X65L 1XMQQ 4NXMQ 3S2DH 4A3BG 3CW2C 1W2BA 4GKJL 2PI2E 3K81C 1LYLA 1R9TH 1HNZL 1HNWL 3NEMA 1U0LA 1OXXK 4C3IH 2YTXA 2WFWA 2JEBI 4RMFA 2E2HH 1E7ZA 4A93H 5JJIA 1VQHA 5C4XG 4YHHL 1V1QA 4IOCA 3CP0A 1NY4A 3UDFA 3UDXA 2MNAA 1PVOA 1VQBA 1LM0A 3PV0A 1KXLA 1KQSA 2EXDA 4LUVA 1PH6A 4BBSH 1TWCH 1HH2P 4PZ7A 4GS3A 3CAMA 3GTLH 4A3IG 3BJUA 2F3IA 2PI2A 1YHBA 2N78A 1CSPA 2WB1G 3I4OA 3K8AA 4C3HH 2V1CC 3Q8DA 1LTLA 1MKHA 2UU9Q 3A5ZB 2Q2TA 3CC2A 1NMFA 2BA0A 1QUQB 4JBMA 3A0JA 3AEVA 3T1HL 5HGQA 5LMNL 3S1MH 2I5HA 1VQJA 3K7AH 3TS0A 1VQOA 1HJPA 4B3TQ 3UE1A 4R4CA 2VW9A 4HJAA 3STBC 2LXKA 1CKNB 3H0GH 3PSIA 4ME3A 4GNXA 1XMOQ 4DUYQ 1YJNA 4DV3Q 4BBSG 1SLJA 2YTYA 4LF4L 2D0PA 4DR1Q 2WP8J 5JEAJ 4B3MQ 3ULPA 1NMGA 3PCOB 3A5UA 2VQFQ 1LUZA 4IO9A 1KC8C 4YY3Q 1Y1WH 3FP9A 2MFIA 1OTCA 4L5SA 4AYBG 1MJEA 3HOWH 1VQ5A 4WJ3M 3J7A5 5IP7H 1YHQA 2ZJPA 2HT1A 1JJCB 1HNXQ 4IPCA 1E1OA 2Z6KA 4LWCA 5GAEC 1V43A 3BU2A 1VQGA 4IFDI 3H3VI 1PA6A 2OTLA 2ASBA 1HR0Q 4KI0A 1XPOA 3J81j 3I2ZA 5M3FG 5C3EG 2QA4A 1IXRA 1SFOH 4QQBX 1VQPA 1YZ6A 2ID0A 4AQYL 3GTGH 5IWAQ 1IBLL 2JA8H 4APVA 1Q81C 4LFAQ 1YBYA 4GN4B 1Y1WG 4BXXG 4LFBL 3UE0A 3HOWG 4A3JH 1C0AA 4HIKA 4QJFA 1HNWQ 3ER0A 2RHSB 4AIMA 4GKJQ 2PNHA 1J5EL 1VQKA 1Y14B 4J15A 1SROA 4JBJA 4JI3L 4YHHQ 1KRSA 2OCEA 1K3RA 3RLNA 1EQQA 5K36G 1EIFA 4HJ9A 3AFQA 4P73A 4DR2L 2F52A 4LF9L 3AYHB 2YU9H 5IYCH 1Q1BA 1CUKA 3CC4A 1SN8A 4GLVB 3ZJYC 4DV4L 5IY0A 5BR8L 3M4PA 5GADC 2DUDA 2K5NA 1S3OA 4GKKL 1Q12A 1XNRQ 2UXDL 4H02A 2VL6A 3U50C 4A3EG 1QZHA 2OWOA 3I4MH 1PFSA 2D0OA 2IX0A 4DR6L 1YIJA 2HHHL 4C2MH 3F2DA 1Y1VG 1WCMH 4R4TA 3T1HQ 1PV4A 5LMNQ 3HKZE 3CF5A 1E3PA 4LF5L 3I4NG 1P16A 3F2BA 1XPRA 2K75A 5IP9G 1YI2A 2R7FA 2VNUD 4OWWB 3AQQA 5C4JH 3GDEA 5C0XJ 4DV5Q 1NBWA 4MTNA 1CKOA 4BY1H 2E8GA 3RN2A 3S14H 4DV7L 5AJ3Q 4LF7Q 3NENA 4PZ8A 1Q8KA 5IYCG 1YITA 1B8AA 3OTOL 2ZJRA 1XNQQ 3S24A 3PO2G 2NVYH 4BA2I 4UPAA 4L5RC 3PUXA 2ES2A 3H15A 3HOXH 2ZJQA 1S40A 4YCWA 3PO3H 1IYJB 4QIWE 1WYDA 3GTOH 2E2JH 2R93H 3PUZA 2IY5B 1AE2A 1JE5A 4MNOA 4KLKA 1YVCA 1EUJA 3MXNB 1A63A 1IZ6A 3ERSX 1C9OA 4LFCL 2NVTH 4Y7NH 3S17H 4C3JH 4IPDA 4JI8L 4JYAL 2C35B 3D0FA 4BY1G 1FGUA 3CPFA 5LMUL 3W1BA 1YHAA 1M90C 5M3MH 3HOZG 1K8AC 4A3DG 3AFPA 2RHQB 4YWMA 1HZAA 3K0XA 4DKAC 1EWIA 4BY7H 4IJLA 2BH8A 4DR4L 2GVBA 2RCNA 3JAMi 4YCUA 4UP8A 2UUCQ 3CCUA 3HOXG 3CCEA 4JI0Q 2KCTA 3E9HA 2WB1E 3CCLA 3IRBA 3CPWA 4JBKA 4IFDG 3PGZA 3KJOA 4GOPA 1VQ7A 4YCVA 2Q2UA 2VQEL 5FLMG 4RG1A 4HIMA 1D8LA 4JI3Q 2R7DA 4KHZA 3WWVA 4BBRH 4GLXA 1N8RC 1N36Q 1FJGQ 1K83H 4DPGA 2ATWA 5IYBG 2R92G 2CQOA 4A3CH 3CMEA 1K73C 1N34L
chains in the Genus database with same CATH superfamily
1HFNA 3TN2A 5BR8Q 1PZJD 4BBSB 3PIPA 1TWCB 4ZKCB 4OWTB 3HKSA 4FF3A 4A93G 1J8IA 1CZGA 3CMAA 2NZHA 5JPMC 4H44C 3MEFA 1F2LA 1CK1A 3R2TA 3F8TA 4HMIA 2HDLA 3KBGA 1CSQA 4IUVA 3DM1A 2PMZE 5M3FB 5C3EB 3R93A 1HTPA 4KHPL 2NN6H 1CKNA 2SNSA 4X62Q 1QWYA 4K6DA 5IYDH 1JWMD 3LX0A 2N3SA 1PH7A 4EQNA 1IW7C 2R6GA 2IPKD 4MZ9A 1NAPA 1BVSA 3DEOA 4JV5L 2AWOA 2F4VL 1H95A 1EYCA 2K04A 3DWPA 3QB3A 1JICA 5ELDA 2NVXH 1X54A 1JCKB 3L3OC 1WI5A 2NN6G 4K0KQ 2SDFA 2MO1A 3KJPA 1SFOB 1Q90A 4DK6C 2K5VA 2A19A 4X65Q 1BDOA 3U4ZA 5A2QL 1HZ9A 3TMEA 2IT1A 5IYDG 1QVFA 1K8MA 3JAML 5JJZA 4NW2A 3HG9A 3KLRA 2EJGC 3RLOA 3IFTA 2BDOA 5EPKA 1ICFB 1S4ZA 3I4NB 1VQMA 1N34Q 2JA8G 1STGA 1G91A 4PMWA 3G4SA 3KUPA 4P72A 2B3GA 2K14A 4RGMA 4A3JG 3A8KE 2R7ZH 3T1YL 2A69D 2NTSA 2XTIA 4UAIA 3CRLC 4B08A 3AB9A 3U9SA 1S5ED 3OPOA 3MVVA 1Q86C 1D7QA 4O2DA 3CCVA 1MGSA 5M5XH 3BZDB 1H9KA 3B6YA 1OXVA 4FNFA 2NN6I 1TWGB 3DMUA 4CKCA 3G6EA 4OONA 2IHEA 4QIWB 4Q5VA 1PDQA 1WCMG 2B2VA 4A3DB 1DYQA 2VUMH 1PFMA 3RLFA 5IGEA 2ZTDA 2ZXOA 1WTXA 2XVSA 1G291 1AZQA 3M85A 3ITPA 3RZOH 2HIXA 2B63H 5KNDA 2E2JB 3TEHB 1I94L 3J80i 2PQAB 3HGBA 5JEAG 3FEWX 3QJYA 3J81i 1SMXA 4LUZA 4AQYQ 1MIUA 2NVTB 1BQQT 3HOUH 4POFA 3A7LA 1IBLQ 4FO2A 3K5OA 4CHTB 1PTOH 1EQTA 2MO0A 2R93G 5LL6S 2M00A 2VUMG 2PQAA 2JA9A 1FYCA 3EVQA 1YJ9A 4N9TA 4C3IB 3WOEA 5IWAL 2EIFA 1STAA 3VA7A 1V9PA 3L7ZC 2JK8A 2KENA 3FHWA 3I91A 1PTOD 3DLLA 2HDMA 1PYBA 3CCQA 2AUJD 1K83B 4F88A 1BCPF 1U4MA 2G9DA 4IJHA 1B4OA 4I7AA 1W6KA 1T5EA 2MHVA 1L0YB 3IFDA 1Z6HA 3CU7A 5KYIA 2F0QA 3MA2B 4J6HA 4TVAB 5C3XA 1VS0A 4QUFA 3IKJA 2F0NA 1EZ6A 1EIGA 1XJVA 4V0BA 1A2TA 4QB4A 1HTLD 4TRDA 1IKMA 5GAGC 1NJIC 1O7ZA 1I4GA 3HOYH 3VR5A 4GLAC 1HA6A 2A1AA 4X66L 4CDFC 3S1QH 2DN8A 4NXNQ 1PMRA 2EPBA 2WKCA 1C48A 2JA6B 4RWSC 2LSSA 1L0WA 5CV5A 4KJOA 1VQNA 1ZXTA 4BXXH 3J7AF 1TWAH 1H9RA 3K5NA 2ZTCA 3TP7A 2Z6BA 3J81L 2F0SA 1ENAA 1XX8A 1DM0B 4EQ5A 4DV2L 2F0DA 2OTJA 3UDIA 3JC66 3FKIB 3OHXC 1X56A 2KA7A 4EX5A 3HOYG 1SE8A 3L0OA 5EAYA 2RSOA 1EQVA 2QDLA 4LF8L 2O4XA 2VQEQ 3S16H 5M5WB 1JQYD 1TY0A 2BDNA 4HSVA 2EOTA 4RKBA 3FKIG 3A56A 3T53B 1ASZA 2WAQE 3ZYYX 3D4WA 1Y1VH 4DAYB 3MHBA 4DR7Q 4QL5A 2QEXA 4LAAA 1TS5A 5IP9H 3KF8A 1CHPD 1N36L 1HZCA 2K7VA 3N52A 2QEJC 3MXGA 1KTKA 3KK7A 4C56C 2Z1CA 5KNBA 1D1IA 2WV6D 3GTJH 4DAYA 2B2WC 3PO2H 3TREA 1G51A 4R8NA 3NBIA 3OOCA 1WTOA 1Z47A 4N8FA 2KHJA 5NUCA 4X6AH 1TWHH 2VB3X 4UP7A 4DF7A 3J80E 1K8GA 3J81E 4DV3L 4P71A 3H09A 1IBMQ 1C8CA 4R1JA 3KLWA 3CCRA 4B3ML 2E5LQ 4OHJA 1U4RA 2VQFL 1KAWA 2D62A 4WRDA 1SSOA 4A3GB 1P8LA 2EE1A 5EBCA 5T1IA 1F9SA 4X62L 2K52A 4DAVA 1I50H 2NVQH 2EY5A 3EFXD 2UUBQ 4FXKC 1QNKA 3ND8A 5D65A 1Q46A 5FLMH 4DAMA 1A0IA 1VMPA 1JJGA 2F0LA 3CC7A 5DAUA 1WOCA 4DXFA 1KDBA 1F9PA 3IAYA 4IUPA 2NZOA 3U9OA 3W5OA 4JW0A 4YWLA 5C44H 4J8QA 3Q24A 4K0KL 5G3LD 5E1FA 4X65L 1NR4A 4A3BG 3CW2C 1W2BA 3QIAA 1LYLA 1R9TH 3I8ZA 1V8QA 1U0LA 1OXXK 2JEBI 2XRSD 1R4QB 1V1QA 1LLRD 3UDXA 1PVOA 2Z4HA 3PV0A 3SXHA 1STHA 5IGCA 2EXDA 2PW7A 4LUVA 1VF5C 1PRTB 4PZ7A 1S5BD 4DK1A 3Q6SA 3K8AA 1IHZA 1YHBA 2N78A 4C3HH 4QUCA 1STYA 1MKHA 4RGTA 2Q2TA 2BA0A 2K33A 4JVZA 1QUQB 1LTID 5EQ0A 3VR6A 5LMNL 1EWHA 2LY7A 2D2CC 4KY5A 4B3TQ 3UE1A 4HJAA 3S1RB 1TIID 2A68D 4DR1Q 5JEAJ 3ULPA 3PCOB 1LUZA 2LMCB 3HOWH 3J7A5 1QB5D 4FXDA 5EKKA 2WKDA 2ZJPA 1HNXQ 2O2LD 5IGBA 3NQIA 3QR8A 1PA6A 2RDHA 3I2ZA 4XYQA 1CHQD 5FOBB 4QQBX 1MI2A 3VYRA 2L55A 4AQYL 2ZXPA 1IBLL 1Q81C 4LFAQ 3C3LA 2RBMA 4ZUJA 1WVLA 4GN4B 3UE0A 3HOWG 4A3FB 1HNWQ 4GKJQ 1I6HB 4JK1C 5EGTA 1VQKA 1HFGA 4JBJA 4JI3L 1K3RA 1E2VA 1EQQA 3AYHB 5IYCH 4RHSA 4I65A 3SVMA 2DUDA 1S3OA 4GKKL 3U50C 1QZHA 1PFSA 4DAPA 2IX0A 3TP5A 1YIJA 2B8GA 4R4TA 2HQEA 1Y8OB 2PYKA 2K75A 2VNUD 3HZXA 3AQQA 1NBWA 4MTNA 2N55A 1CKOA 3RN2A 3S15B 5IYCG 1AP0A 4L5RC 1KNAA 3PUXA 3H15A 3D4DA 3HOXH 2ZJQA 4YCWA 4QIWE 1WYDA 2D5DA 3GTOH 3HOZB 1RTNA 3PUZA 1AE2A 4MTKA 3MXNB 5LL6X 4Y7NH 3S17H 4LK1C 4IPDA 4GZYC 4KK7A 5M3MH 3HOZG 3ERQA 4YWMA 4BY7H 2NYZD 4CBVA 2RCNA 3HOXG 4JI0Q 3E9HA 2WB1E 1EEFD 4EGVA 1I4PA 1TKWB 2VQEL 1F9QA 2B2WA 1D8LA 1FGBD 3WWVA 4DPGA 5J1ZA 1SE4A 2CQOA 4BS9A 2EJMA 5M3MG 1RL2A 1X6OA 1X65A 2A73B 2L9HA 2RA4A 3EIVA 3CQZH 1A62A 2RDGA 1TXYA 3GTPB 2ZXRA 4U68A 4XTCS 1YNNC 4NB3A 3A8IE 4AYBE 5CV9A 1SYFA 1NTGA 1UE1A 1K0SA 5CR3A 2DNEA 4P74A 4A3MH 1Z7TA 1HA5A 3JAMc 2K05A 3W3AA 2NTTA 4TQUS 1RIPA 3H0GB 1ENFA 4HIDA 3PMFA 1FR3A 4HAEA 1VQ4A 5I9OA 3X3MA 1BO0A 5M5YH 3MAQA 1AN8A 5CV6A 2NUCA 3EBEA 2F0UA 1Y1WB 3SK8A 1PH1A 1BBWA 3H0GG 3GD7A 2E5LL 4LFCQ 2JSOA 4CDDC 1EFWA 4A3MG 2UUAQ 4JI2Q 3RZDH 4POGA 1H9JA 4A3LH 2JJQA 1RJTA 2HUGA 5IP7G 3T51B 3K57A 2RF4A 1FVIA 3P75A 4P2CB 2QCPX 2PW5A 2I46A 1JC7A 4RGNA 5I2YA 4KN7C 1HXYD 1KIXA 3K58A 1NE3A 2EQSA 2YYZA 1V1PB 4K8IA 3M3YB 3VR3A 1X3FA 1D1KA 2SOBA 5CBEE 2JA7H 1EY6A 2O5IC 3GTKH 5FKAC 2YU9B 2ZM6L 3M9BA 1C7YA 4I7ZC 4KMUC 1OXSC 1YEZA 3M7GA 1VCIA 4LF6L 4DV0Q 1EQRA 2WAQG 4LF4Q 2OEOA 4A76A 2XGTA 3WOFA 1HUMA 3UI2A 5ELFA 4OEMB 2LXJA 4BY1B 1BBXC 2JA7G 3W1GA 2A6HD 1DD2A 2EYLA 1VQLA 4B3TL 2PPBC 4B3SL 4KD3A 3SR1A 2UXCL 2VS1A 2BE5D 1WFQA 1DOMA 2NVYB 3V96A 3NQTA 3TQYA 2AUKA 2F0FA 3FDTA 3RN5A 2CH4W 3S1NH 1EYAA 1RCVD 3E5SA 4KY6A 4ZLTF 2JN4A 2NZ1D 5FLXE 1L1OB 2OXPA 5GROA 4OELB 4GN5A 4DR3Q 1S72A 4QY7A 4K2LA 2HQLA 4DV6Q 1HNXL 4LFBQ 3PO3G 4KY7A 2IJ0A 2JE6I 2K4KA 3BVGA 1L1OA 2JEAI 4ALPA 3QG1A 5HY6A 2JXMB 1J5EQ 2A6EC 3MC0B 2Z6KC 1ILQA 5CBAE 4LFAL 2KOLA 1HHVA 4HIOA 4DV4Q 2UXDQ 5KNCA 1SDFA 1UE7A 3GTLB 1EYGA 3PF5A 1SRUA 5ELEA 1O7IA 3TBIB 3VYTA 2Y0SB 3GV6A 3VDYA 3J80c 4GN3B 2YTVA 3J81c 5IT9L 3GO5A 1ESRA 4O1NA 4IURA 4A3CG 1T9HA 1VQ8A 5ELBA 1FNUA 1UE6A 2Y0SG 2JYOA 1TVXA 1JORA 1DOLA 1OO9B 1M4VA 1VQCA 3OW2A 2E76C 1N33Q 4IPHA 3A7AB 4KTAA 2A8VA 2KEEA 1PTOF 4C1NI 1M8AA 3I56A 5M3FH 5C3EH 1SNCA 3ULLA 4DR5Q 1EY8A 1T5XD 3EROA 4BA1I 4RA8A 2OT2A 1A8VA 1VQFA 3URYA 1V1OA 1IBKL 4X64L 3A74A 4XQNA 1DGSA 3GTGB 1B44D 1BR9A 3I90A 3R8BA 1BOSA 1TWFH 1JB7A 2JA8B 1BCPC 2SEBD 1SMYC 4F7XA 4A3JB 3J7ZC 4DV1L 2B8FA 4WJWA 1XMQL 1E0BA 2I5LX 3E0EA 2F0MA 2R61A 4JI0L 4PV1C 5GQOA 1EL0A 1Q1EA 4KKTA 5DM73 4A75A 3I4NH 2JP1A 2B2UA 4JI5Q 1MHWC 5CORA 4JBWA 2UXBQ 2XRQD 1WCMB 2MP1A 2R7ZB 2UU9L 3KFUA 5C4HA 1N32Q 3STBD 4HJ8A 1ET6A 1YNJD 2MPMA 3OWFA 3SK4A 2HCCA 1A3TA 4OX9Q 5IGGA 1QZGA 2R7ZG 1X3PA 3NBHB 4DUYL 3BYYB 2M9VA 2IHFA 1PXUA 5A2QE 1D5ZC 3G71A 1GOZA 1D5XC 1PRTC 1TQOA 3JAME 1TWGH 2R93B 1LTBD 4MIUA 5D3DA 1K8OA 4L6TB 2VUMB 4A3DH 4YIJA 1PH8A 4L5QA 2RKSA 4JI7Q 1CT1D 2Q2HA 3NBHA 3PUVA 5JAVA 3RZOB 2K5DA 3KDFB 5A35A 3QO2A 5JPNC 4IFDH 1SYEA 3H3VH 4R4OA 3HOUB 1SXTA 2AQ3B 3SEBA 1YNXA 1LT5D 3KYHC 2UUAL 3FPPA 1X3EA 4JI2L 2AQ1B 1ESFA 2B63G 4OWXB 1Q82C 3M4OH 3KDFA 4HR7B 3OYYA 5AFWA 5EPLA 5J3BA 4B3RQ 4JI4Q 3HOUG 4ME5A 3S2DH 2PI2E 4Q0FA 4C3IH 4RMFA 2WFWA 1E7ZA 2EVBA 2J7ZA 1VQHA 1KDCA 4YHHL 4IOCA 2O5JC 3CP0A 1NY4A 3UDFA 2MNAA 1F77A 4MHEA 1E2WA 3GTMB 2CH4A 5CMDA 4GS3A 2QDBA 2H1EA 1B1ZA 2WB1G 1RD9D 1XNRL 2BOSA 2CW0D 3LWEA 5HGQA 3SE0A 4XQJA 1U4LA 3T1HL 3S1MH 4NDXA 2I5HA 4IUTA 4CGYB 1VQJA 3K7AH 1VQOA 1HJPA 4E6IA 5G3LF 1XMOQ 5IGFA 3O13A 1DONA 4LF4L 3NSWA 2WP8J 3HOYB 3BYTB 4H7BA 4IO9A 3S1QB 4YY3Q 4CDEC 4AYBG 1MJEA 4WJ3M 2G9HD 1HUNA 1SYCA 5EPJA 1VF7A 3AU7A 1JJCB 2X69A 2PCFB 2Z6KA 4LWCA 1V43A 2IW3A 3I70A 1VQGA 4X3KA 4IFDI 3H3VI 5JVH3 1PFBA 3J81j 1TWAB 1CM9A 4EQPA 1EYDA 2QA4A 1YZ6A 2ID0A 2D9UA 2PO4A 3IL8A 3D3RA 1A3VA 4BXXG 3S16B 4LFBL 5LHY1 4FYDA 4J1MA 4QJFA 3NTKA 4XT3B 1J5EL 1G6ZA 1Y14B 2PZTA 3SK5A 3VYUA 1DXMA 1KRSA 3S2HB 1PLFA 4DR2L 2DNCA 3BDCA 1CUKA 1B9NA 1SN8A 3CC4A 4DV4L 5BR8L 2UXDL 4V190 4H02A 4LMQD 3I4MH 2D0OA 4A93B 4C2MH 3GTJB 1Y1VG 3D4RA 1PV4A 3K5LA 3HKZE 3CF5A 1P16A 1F2ZA 3RD4A 1BCPB 5FO8B 5IP9G 1YI2A 2R7FA 2R3ZA 5C4JH 4K5XA 3NTHA 4FVMA 4XDXA 4DV5Q 1HCZA 2E74C 4B9XA 5AJ3Q 1D6EC 1Q8KA 1B8AA 3I73A 1IW7D 2ZJRA 3PO2G 2L5TA 3I4LA 3EA6A 1S40A 1IYJB 3C1FA 3VYSA 1JE5A 1HQMC 1LTTD 4A3BB 4C3JH 2NVQB 3PIO3 3CPFA 3W1BA 1K3BC 2ENBA 4DNRB 1K8AC 1HZAA 3K0XA 4CKEA 4YCUA 2UUCQ 3CCUA 1DZ1A 4OGQC 2H4OA 2F0TA 3I3CA 3IRBA 3PGZA 4PMCA 3KJOA 3J7AV 5C44B 2F3WA 2VXWA 5FLMG 1EFID 4ZRZA 4BBRH 5I6WA 4B9WA 3CMEA 5FO7B 1K73C 1N34L 1K28A 1GVPA 5DEHA 5C44G 3K7UC 2XIWA 1SNPA 1CQFA 5JVG3 4DR6Q 4JI5L 1IYVA 1SNMA 2VY3A 3SHLA 1EOTA 4R9WA 5CGKA 3BVMA 4LF5Q 2UXBL 3ND9A 3TDQA 5C0XH 1VQIA 3ULJA 4BBRG 1N32L 1QUQA 5E3FA 3KLSA 4RH6A 3GTQB 1RHPA 3ONAB 5IIFA 4C3HG 5FLXc 4A3KH 2PMZB 3S1RH 1EZ8A 1F2YA 2YV5A 4JI1Q 1Z9FA 4DNTB 3OIQA 4ZAIA 1QVCA 1VQ6A 3DUZA 2K1BA 2K5WA 3OMGA 4N9PA 4K14A 4K5VA 2XWJB 1JWSD 3DM3A 4HEDA 1CQVA 3HOWB 1HQRD 1QOHA 1K9MC 3P20A 4JYAQ 1UE5A 4JI7L 1IL8A 5LMUQ 1GM5A 2B2TA 1SNQA 4JOIC 2RCFA 3P1HA 1I3QB 2L15A 4DR4Q 2AKWB 1UUPA 2AMCB 2IWHA 4DK3C 3TSSA 1HNZQ 4F87A 2IX3A 1TS2A 4K8JA 1FL0A 5KIXA 4KD4A 2Z8LA 4IZ8A 1WD1A 1L1OC 2EYJA 4A3FH 1SE2A 5KGUA 4B3RL 4JI4L 1ZYRC 3K80C 4O0AA 4ZQ3A 1CTMA 2MQHA 3RUZA 1ZEQX 3VA5A 3PIOA 2MJ8A 1N9WA 1J6QA 4G7OC 4HCEA 3T16A 4OXPA 1PZKD 3CCMA 3L2PA 5C0XI 3D6CA 1F9RA 4IPGA 1KDAA 1BF4A 2N88A 4KHPQ 3CXCA 4DFAA 3S15H 4PQXA 4YWKA 2FMMA 4NXNL 2I0QA 3V2TA 3HOXB 3PUWA 3GTOB 3KBXA 1EIYB 3TRZA 2P5ZX 4HJ7A 1STEA 2F4VQ 4YY3L 2GVAA 4Y7NB 4HN7A 2TMPA 4ODGA 3MXNA 1M1KC 2X6LA 2RDFA 4HMJA 1B7YB 4K5WA 5M3MB 4JC0A 3K5MA 3LGJA 2EY2A 1X9NA 1PFNA 5C4XH 2EYHA 2K5QA 4OO1H 3NTIA 2F0OA 4ILWA 4FF1A 4WJ4A 4Z9CB 4XT1B 1I4RA 2FXQA 4ZUIA 1STBA 4LF9Q 1HZBA 2FHTA 1U5KA 4BY7G 4UP9A 2E75C 1RTOA 4RAUC 2H5XA 4DR7L 2E2IH 2DY8A 1HR0W 2HHHQ 1EY0A 2E2DC 1UNSA 3T1YQ 4OO1G 3TS2A 4IQZA 4EQOA 2EYPA 1UEBA 3GTPH 1E24A 2B2UC 2F0HA 5GAHC 3QOJA 4DV7Q 1GUTA 1KAAA 1KHIA 4LNQA 1O7YA 2IX1A 1JOQA 3OWEB 2A69C 1LT3D 5FJ8H 4A3MB 3ICEA 1SAPA 4PMBA 4HSPA 3C2PA 1KD1C 1IBML 3BDLA 4HCSA 4DV5L 4CJ1B 4UY8C 5AJ3L 1HRJA 2DY7A 3EN2A 4DNIA 1A2UA 5ELOA 4X3TA 1H9MA 3A54A 2QF7A 2B39A 1I94Q 1SYBA 1G6PA 3M4QA 5FJ8G 5CC4A 2UUBL 2K5HA 5LMNW 1IKLA 1B3QA 2C9OA 3RZDB 2JA5H 3Q23A 1PHJA 5CV4A 2FMCA 3UDGA 1GKHA 2KVMA 4OO1I 3T4AC 5K36H 5E7NA 3U58A 2L0CA 1XTDA 2F4IA 5M9OA 3NWTA 2E2HB 5IE8A 2EJFC 2UUCL 4A3LG 1K0RA 4A3CH 4A3EH 2I5MX 4JPBW 1FNWA 1KL9A 2WAQB 4FDBA 2KCMA 2BH2A 2JA5G 2F0GA 3MXUA 1JOKA 2F0JA 2ICEC 1KABA 3M3YH 4KJNA 1V1PA 3CHBD 1UAPA 2JA7B 3HOVH 1PTOC 1PH4A 1MJCA 2A5HA 1JB3A 1O80A 2CWAA 1BUVT 1TT2A 2K01A 3F2CA 3FMCA 3PUYA 4JCVE 4P75A 3BZCA 3S14B 2KCNA 5E4WC 2HD3A 1QVGA 4PG3A 1SNOA 1W3SA 1ET9A 1U9RA 3GV3A 2CWPA 1OXUA 4L5TA 4X66Q 1YJWA 4DR1L 1ZKOA 2SNMA 4JOIA 3HOVG 3PO3B 2EYFA 1ICWA 1SE3A 2OF1A 1QJOA 4XIGS 5D3IB 1SR3A 5COYA 4JI1L 3HKZG 3S1NB 4LUOA 5H1SE 1LTAD 4R8IA 2BCOA 1VQ9A 1XPUA 2AHOB 3MTSA 4DV2Q 1CKMA 1LTGD 1JMCA 4IUNA 1Q3LA 5DNFA 2HIVA 2R92H 2KHIA 5IYBH 4LF8Q 4GOPB 1I5FA 4A3IH 2PQEA 4DUZQ 4JI6Q 4FP5D 4X3UA 1BBUA 5J22A 4F8MA 1RODA 2F0PA 1PH9A 4NXMQ 4FF4A 1HNWL 2V4DA 4GKJL 3K81C 1S5CD 1HNZL 3NEMA 2YTXA 3FVQA 2E2HH 5JJIA 4A93H 1SJHD 1B9MA 4DN4M 5CYUA 1VQBA 1LM0A 1LTSD 3DWAA 1KQSA 4BBSH 1PH6A 1TWCH 1HH2P 4FXGC 3CAMA 3GTLH 4A3IG 1I4HA 3I4OA 1S5DD 1LV9A 1CI3M 1CSPA 2V1CC 1LTLA 3A5ZB 1NMFA 3NXWA 3DWQA 3LNNA 3A55A 2I07B 4JBMA 3A0JA 1GUGA 4HTHA 3HS0C 3TS0A 2PZWA 4FF2A 4R4CA 2VW9A 2LXKA 1CKNB 2HCIA 3PSIA 1YJNA 4DV3Q 2RVLA 4BBSG 1SLJA 2YTYA 2D0PA 5I4DA 4B3MQ 2VQFQ 1KC8C 1LTRD 3FP9A 4L5SA 1OTCA 2WACA 5C4ZA 5KRUA 2F0WA 2HT1A 2NVXB 5GAEC 1WTWA 3VR2A 1UEAB 5C6AA 1HR0Q 2ZT9C 5M3FG 2Z9HA 5C3EG 2J4XA 1SFOH 3K0YA 1VQPA 1DJRD 1TWFB 1CA5A 3GTGH 1NCVA 1AEXA 3G7LA 4NP5A 1G2TA 5IT9E 2EZVA 4APVA 2JA8H 1YBYA 4A3JH 4WORA 1C0AA 4HIKA 2RHSB 2PNHA 5KEEA 1QG7A 3I72A 3E0JA 1R4PB 4J15A 3NHHA 1SROA 1AZPA 2K6AA 5BN4A 1EIFA 2FINB 4HJ9A 4P73A 2WINB 4LF9L 1YNND 3MFYA 1Q1BA 5DM63 4GLVB 3ZJYC 1EU4A 5IY0A 1SBBB 5GADC 1Q12A 3T13A 4LJZC 2LS01 2XNAC 3D8GA 5HURA 2HHHL 3QWNA 1NNXA 1TS3A 1WCMH 5D14A 3TZDA 1JR0D 5LMNQ 5M5XB 1E3PA 3I4NG 3F2BA 5EJWA 4OWWB 3GDEA 3CRKC 3TP8A 3VR4A 4KKSA 4DV7L 4LF7Q 3N6RA 5JEAH 1YITA 4H13C 3OIPA 1XNQQ 3S24A 4BA2I 1E2ZA 2B63B 2A68C 5CV8A 3C1EA 2E2JH 2R93H 2IY5B 4MNOA 2KJXA 1FD7D 2TSSA 1GUWA 4LFCL 2NVTH 4ZKBB 1CA6A 3QOLA 2EDGA 2C35B 1PTOB 4BWGB 1EY9A 1YHAA 4ZCKA 5EKIA 4A3DG 1MD2D 3AFPA 4QF4A 4IJLA 4ZYSA 3CCEA 3K59A 2IL8A 2B2TC 3M4OB 3CPWA 2WB1B 1EY4A 3X3NA 4JBKA 4IFDG 4QCLA 5F2DA 4YCVA 4ID6A 4U673 3S2DB 4RG1A 4HIMA 4JI3Q 2R7DA 4GLXA 1FJGQ 1K83H 3H94A 5TSSA 4RKLA 3CCSA 1AH9A 3E9IA 2AQ2B 2F1MA 1SYDA 4GKKQ 3DHQA 3GTMH 1X55A 1GUSA 1CFMA 2KBNA 3E6ZX 1L2FA 4C3IG 1EOVA 2N8NA 4DV0L 4WFN3 4KN4C 2EY6A 3NK9A 4AYBB 1II3A 3S1MB 3D31A 1GUNA 3FPUB 3G48A 1WTRA 3K7AB 1A15A 1WJJA 2NB0A 1GJXA 2L11A 3A8JE 1XTCD 1WTVA 5IOCA 1D2BA 1PYSB 1VQEA 4AH6A 1ASYA 2JA6H 1CZWA 1TR5A 4NMZA 4QGUA 4DK0A 3HP3A 1WTQA 1BKBA 2EY1A 4DR3L 1JE4A 5J39A 3FKIH 1X3QA 5E4XA 2A6ED 3EQLC 4DV6L 3RR5A 2C5CA 4DXGA 3J80L 2KCCA 5M5WH 4M1UB 2OQKA 3BS1A 2CCZA 4HJ5A 2JA6G 4L63B 1PRTF 1PH3A 1STNA 2VZAA 5K5PA 4DU9A 1Y1VB 1B2TA 4DUZL 4JI6L 3BZKA 5BN3A 3KF8B 3GP7A 4G4KA 2PNRC 4NXML 3NPPA 2L4NA 3KLSX 3S2HH 1EY5A 2F3VA 4A4IA 1JJ2A 5T1GA 2Z0SA 2PZUA 3PO2B 1GD7A 2FFKB 3HFZB 3I4MB 5JJLA 2Q2IA 5DLQE 4C2MB 2ALYB 1TWHB 5ELNA 2B2YC 1LO5D 1SNDA 1Q7YC 5C4JB 2CQAA 1A3UA 3Q0AA 1PH2A 1N33L 3I4MG 3DXJC 4DGZA 3TZUA 2JQOA 3CD6A 3NP8A 3CKIB 2K50A 4OIKA 1G8ZD 1O78A 4DR5L 1GO3E 1I50B 4A3GH 3I55A 3F1ZA 4GNXC 1BCPD 4Y52H 1SYGA 4X3SA 4NKLA 1SMYD 2KECA 5EKLA 5C3WA 1JT8A 1QILA 1IL2A 1SEBD 4C3JB 4A3BH 3BDOA 1EIHA 3NELA 1OXTA 4R4IA 4JG2A 2XWBB 3BG3A 3H6MA 1HR0L 1XXGA 3KF6B 2GN5A 3I7FA 1SJED 2CFMA 5BN5A 4C3JG 1R9TB 4A3GG 1AW7A 2ICIA 2J0TD 2DGYA 2F0IA 3D6WA 2BA1A 3KF6A 3KOJA 3M7NA 4BBRB 2X6GA 1X3GA 5C5LA 4C3HB 1JWUD 2Y0SE 2ZM6Q 1QNUA 3E3XA 1ENCA 4ABNA 4IOAA 4XYOA 4LW1A 4LF6Q 3U4VA 1RDPD 2QILA 3SGIA 1UWVA 1ONLA 5I9PA 1WTHA 3OTOQ 1PRTD 2Z4IA 4OX9L 3CCJA 3GTQH 4A3KB 1B3AA 3NUCA 4B3SQ 5ISRA 1KRTA 3T56B 2UXCQ 2QKIC 2N49A 1LACA 4UDUC 4PNYA 5C0XG 4LF7L 4JI8Q 2F0VA 3RNUA 1XNQL 2A6HC 2K28A 1RKNA 4A3KG 2BE5C 2Q8RE 3AMUA 3SK6A 4IFDJ 2NBFA 1GHJA 1GUOA 3F2UA 3SDZA 5C5MA 2F0EA 1I3QH 1VQAA 4CJ0B 4NPSA 4R4QA 1G2SA 3HEJA 4PZ6A 3Q22A 1I6HH 1EY7A 1XWEA 1E1TA 1MSHA 5JJKA 2AWNA 4IUQA 3OW7A 5I6YA 1HPCA 3C46A 1MBYA 2RSNA 1FJGL 2K32A 2EYOA 4S3SA 3MXPA 4GOPC 1RF2D 2CKZB 4TKOB 3PF4A 4A3FG 4IALA 2L1BA 1NR2A 3MFGA 2EYMA 3J7YW 2ZTEA 2B29A 2EXZA 2NWGA 1XMOL 1D5MC 1AE3A 2LKVA 2MGSA 5EBDA 4UHVA 4K6LA 5IODA 3HOZH 4JV5Q 2QW7A 1ML0D 1WD0A 4IN3A 5L37A 3S17B 5IT9c 3OMCA 1IBKQ 4X64Q 1Y69U 3BVZA 1QCBD 4BY7B 2FJ2A 1VQDA 4CDCC 3P7JA 1B70B 5C4XB 2MUYA 3WDNA 4DV1Q 4KKUA 1O7LA 1PH5A 4L8JA 1E22A 2QGQA 3M4YA 5ELCA 4DA2A 4G7HC 4N8X1 2OQ0A 5FK9C 1XMQQ 1EU3A 3R2IA 3PQIA 2CVRA 4G7ZC 3S9WA 5C4XG 2B2YA 3CQZB 1X32A 2DJGC 2CHBD 1KXLA 2E2IB 3R3OA 1EWCA 3BJUA 2F3IA 2PI2A 4GNXB 4ZK9B 2UU9Q 3Q8DA 3CC2A 2KUMA 3AEVA 2F0KA 3TP6A 2Q8TA 1XYIA 3LWUA 1AFPA 1NSNS 4XXEA 3STBC 3H0GH 4GNXA 4ME3A 1PZID 1L0XB 3NWSA 3HRZC 4DUYQ 4CKBA 5M5YB 1Y8PB 1YNJC 1ILPA 3NE5B 1W6JA 5IGDA 3RMHA 1C4QA 1PYWD 3MZ5A 1NMGA 3A5UA 1I4XA 4K2KA 1Y1WH 3G6JB 2MFIA 1F2MA 3MEHA 2RQXA 1VQ5A 1S5FD 1LT4D 1KNEA 5IP7H 1IYUA 1YHQA 4MN3A 1BXTA 4IPCA 1E1OA 3K6OA 1DOKA 3OSOA 3BU2A 5KYLA 4RCNA 2OTLA 2ASBA 2KEDA 4KI0A 5FO9B 1XPOA 3L9AX 3PIP3 1QE6A 1GXDC 2B2VC 4KHVA 1IXRA 4RHRA 2JA5B 5IWAQ 1H9SB 5JOBA 2KQ3A 1KLUD 1Y1WG 4OL7A 4TSSA 1U4PA 3ER0A 1Q8IA 4RFBA 5CV7A 4AIMA 4A3EB 1H9SA 4EVOA 2OCEA 1I6VC 5FLXL 3RLNA 4YHHQ 3GTKB 5K36G 1GHKA 3AFQA 2F52A 4ULLA 1DCZA 3H3VC 4IUUA 2YU9H 2A74C 3W2DA 1BNZA 4G57A 3M4PA 2K5NA 1I4QA 1XNRQ 2VL6A 4A3EG 2OWOA 2Q8IB 3HOVB 1B50A 4CJ2C 4DR6L 2XSCA 3F2DA 1VMCA 2KHSA 2L12A 3T1HQ 4H0LC 1FNVA 4LF5L 3HKZB 1XPRA 2DJFC 5C0XJ 3EJIA 1VDZA 4BY1H 2E8GA 3S14H 2VB2X 2CW0C 1A6XA 3DEPA 1J9OA 2LFNA 1MSGA 3NENA 1TU2B 4PZ8A 5I2XA 4QMGA 3OTOL 1TS4A 1Y8NB 2NVYH 4RCOA 4UPAA 2G5DA 4C1NK 3GQBA 1NUCA 1JOOA 2ES2A 3PO3H 1EEID 4KLKA 1YVCA 1EUJA 2M2LA 1A63A 4RGOS 1IZ6A 3ERSX 1C9OA 1LT6D 4JI8L 4JYAL 3D0FA 4BY1G 1FGUA 5LMUL 2K03A 1M90C 3H91A 2RHQB 4DKAC 4M8AA 1EWIA 2BH8A 4DR4L 2GVBA 3FRPB 3JAMi 4UP8A 5HGTA 2XN9C 2R92B 3V05A 2KCTA 4A3IB 4O42A 3CCLA 1LABA 3MWYW 4KV6A 1ZYRD 4GOPA 1VQ7A 4XQQA 1TY2A 2Q2UA 4OIJA 2F03A 1N8RC 4KHZA 2WIIB 1N36Q 2ATWA 1B53A 1KLGD 5IYBG 2R92G 2GA4B 1WTPA 4DR2Q
chains in the Genus database with same CATH topology
5M3MG 1RL2A 1X6OA 1GVPA 3CCSA 1AH9A 3E9IA 1X65A 5C44G 3K7UC 5BR8Q 3EIVA 3CQZH 1A62A 3PIPA 1TXYA 4GKKQ 3GTMH 4OWTB 4XTCS 1X55A 3HKSA 4DR6Q 2KBNA 4JI5L 1L2FA 1EOVA 2N8NA 2VY3A 4NB3A 4DV0L 3CMAA 4AYBE 4A93G 2NZHA 4LF5Q 2UXBL 1NTGA 1UE1A 3MEFA 3D31A 4P74A 1VQIA 3F8TA 3ULJA 4A3MH 4BBRG 1N32L 1QUQA 3G48A 3JAMc 1CSQA 1WJJA 4TQUS 1RIPA 5FLXc 2PMZE 4A3KH 4HIDA 4KHPL 3S1RH 1VQ4A 2YV5A 4JI1Q 1Z9FA 1CKNA 5M5YH 1PYSB 4X62Q 1QVCA 1VQEA 1VQ6A 4AH6A 1ASYA 2JA6H 3EBEA 5IYDH 2N3SA 3DM3A 1PH1A 1PH7A 1BBWA 3H0GG 3GD7A 4QGUA 2E5LL 2R6GA 1K9MC 4LFCQ 4MZ9A 1BVSA 4A3MG 1EFWA 2AWOA 2F4VL 4JYAQ 2UUAQ 4JV5L 1H95A 1UE5A 1BKBA 4JI2Q 3RZDH 5LMUQ 4DR3L 4JI7L 2NVXH 1GM5A 1X54A 3FKIH 4JOIC 4POGA 4A3LH 1WI5A 2NN6G 4K0KQ 4DV6L 2JJQA 2MO1A 2L15A 3RR5A 3KJPA 4DK6C 4DR4Q 2AKWB 2K5VA 5IP7G 2A19A 2AMCB 4DK3C 5M5WH 4X65Q 2OQKA 2RF4A 3U4ZA 1FVIA 4HJ5A 1HNZQ 2CCZA 1HZ9A 1QVFA 2IT1A 5IYDG 2JA6G 1FL0A 1PH3A 2VZAA 3RLOA 4DUZL 4JI6L 1KIXA 3BZKA 1L1OC 4A3FH 1NE3A 3KF8B 2EQSA 2YYZA 4GNXB 4B3RL 4JI4L 3K80C 4O0AA 1VQMA 1N34Q 4NXML 1X3FA 2MQHA 2JA8G 4PMWA 3G4SA 4P72A 2B3GA 2JA7H 3S2HH 2K14A 4A4IA 3GTKH 4A3JG 3PIOA 2ZM6L 1JJ2A 3M9BA 1N9WA 2Z0SA 1J6QA 1C7YA 2R7ZH 3T1YL 1GD7A 1OXSC 1YEZA 2XTIA 1VCIA 4LF6L 4DV0Q 3HFZB 5JJLA 4OXPA 2Q2IA 5DLQE 3CCMA 3L2PA 5C0XI 2ALYB 1Q86C 5ELNA 1D7QA 4O2DA 1EQRA 2WAQG 4LF4Q 4IPGA 3CCVA 4A76A 2XGTA 5M5XH 1Q7YC 3B6YA 1OXVA 2LXJA 3I4MG 1PH2A 2NN6I 1N33L 2JA7G 4KHPQ 3G6EA 3CXCA 4OONA 3W1GA 2IHEA 3S15H 1WCMG 2JQOA 4DR2Q 1VQLA 4B3TL 4B3SL 2VUMH 3RLFA 2VS1A 3CD6A 2UXCL 1WFQA 2ZTDA 4YWKA 2K50A 1G291 4NXNL 4DR5L 2I0QA 1GO3E 3M85A 3TQYA 3RN5A 3PUWA 2HIXA 3RZOH 2B63H 4A3GH 3I55A 3S1NH 3F1ZA 3TEHB 1EIYB 1I94L 3J80i 2PQAB 4GNXC 4HJ7A 1L1OB 3TRZA 5JEAG 2F4VQ 4Y52H 4YY3L 3J81i 1SMXA 4LUZA 5GROA 1MIUA 2GVAA 4GN5A 4DR3Q 4AQYQ 1S72A 1IL2A 1JT8A 3HOUH 4QY7A 4POFA 1IBLQ 4A3BH 2HQLA 3NELA 4DV6Q 1M1KC 1HNXL 3PO3G 4LFBQ 1OXTA 4R4IA 1B7YB 2JE6I 2K4KA 2MO0A 4JC0A 4JG2A 3LGJA 2R93G 1X9NA 1HR0L 5C4XH 3KF6B 2GN5A 3I7FA 2VUMG 2CFMA 2PQAA 1L1OA 2JEAI 4ALPA 2JA9A 5HY6A 1J5EQ 1YJ9A 2Z6KC 4A3GG 5IWAL 4WJ4A 2FXQA 4LF9Q 2EIFA 1HZBA 4LFAL 1V9PA 3L7ZC 1U5KA 2JK8A 2KENA 4HIOA 2DGYA 4DV4Q 4BY7G 3FHWA 2BA1A 3KF6A 3KOJA 4UP9A 3DLLA 3M7NA 1PYBA 3CCQA 2UXDQ 2H5XA 1X3GA 4DR7L 1UE7A 2E2IH 1EYGA 3PF5A 1SRUA 4IJHA 1O7IA 2Y0SE 2ZM6Q 1HR0W 2HHHQ 3VDYA 3T1YQ 3J80c 4IOAA 3TS2A 4OO1G 4GN3B 4LW1A 2YTVA 3J81c 4LF6Q 1UEBA 4TVAB 3U4VA 3GTPH 1E24A 3GO5A 1XNRL 3SGIA 1VS0A 5GAHC 4A3CG 1T9HA 1UWVA 4DV7Q 1KHIA 1VQ8A 4LNQA 2IX1A 1UE6A 2Y0SG 1XJVA 3OTOQ 5FJ8H 3ICEA 1VQCA 5GAGC 3OW2A 4OX9L 1NJIC 1N33Q 4IPHA 3CCJA 2A8VA 3GTQH 3HOYH 4GLAC 1KD1C 1IBML 2A1AA 4X66L 4DV5L 4B3SQ 3I56A 1KRTA 5M3FH 2UXCQ 5C3EH 3S1QH 4UY8C 2N49A 5C0XG 5AJ3L 4LF7L 4NXNQ 3ULLA 4DR5Q 3EN2A 4DNIA 4JI8Q 5ELOA 4BA1I 3RNUA 2LSSA 1XNQL 1L0WA 1I94Q 1VQNA 1A8VA 1VQFA 3M4QA 1G6PA 4A3KG 4BXXH 1IBKL 5FJ8G 4X64L 3A74A 2UUBL 1TWAH 2K5HA 5LMNW 2ZTCA 1DGSA 2JA5H 4IFDJ 4EQ5A 4DV2L 2OTJA 1TWFH 3UDIA 1JB7A 3JC66 1PHJA 1X56A 4EX5A 3HOYG 1SE8A 3L0OA 3UDGA 1GKHA 5EAYA 4OO1I 1I3QH 1VQAA 5E7NA 3U58A 4LF8L 2VQEQ 3S16H 3J7ZC 4DV1L 1XTDA 4NPSA 4R4QA 4PZ6A 5IE8A 1I6HH 1XMQL 2UUCL 3FKIG 4A3LG 1K0RA 4A3EH 2I5LX 2I5MX 3E0EA 1E1TA 4JI0L 1ASZA 2WAQE 1KL9A 5JJKA 5GQOA 4FDBA 1Y1VH 1Q1EA 2KCMA 4DAYB 2AWNA 2BH2A 2JA5G 4QL5A 4DR7Q 4A75A 3I4NH 2QEXA 4JI5Q 5IP9H 3M3YH 1N36L 1FJGL 4JBWA 1HZCA 2UXBQ 3HOVH 1PH4A 1MJCA 4GOPC 2CKZB 3GTJH 4A3FG 2UU9L 3KFUA 2CWAA 3PF4A 1N32Q 3STBD 3PO2H 3TREA 3F2CA 4HJ8A 1G51A 3PUYA 4JCVE 4P75A 3BZCA 1Z47A 2KHJA 2ZTEA 1QVGA 4X6AH 2B29A 1TWHH 4PG3A 4OX9Q 4UP7A 1W3SA 1QZGA 2R7ZG 1XMOL 2CWPA 3NBHB 1K8GA 4DUYL 1OXUA 4DV3L 1AE3A 2IHFA 4L5TA 4P71A 1IBMQ 4X66Q 3G71A 1YJWA 4DR1L 4R1JA 4JOIA 3HOVG 3KLWA 3CCRA 4B3ML 1TWGH 2E5LQ 2VQFL 3HOZH 4JV5Q 4A3DH 4XIGS 1KAWA 1SR3A 4L5QA 2D62A 4JI1L 1PH8A 4JI7Q 3HKZG 5IT9c 2Q2HA 3PUVA 1P8LA 4X62L 4LUOA 5H1SE 2K52A 3KDFB 1I50H 4X64Q 1IBKQ 2NVQH 2UUBQ 1VQ9A 3H3VH 1XPUA 2AHOB 4DV2Q 4R4OA 1VQDA 1Q46A 5FLMH 1CKMA 4DAMA 1A0IA 1YNXA 1JMCA 3KYHC 2UUAL 1JJGA 3CC7A 2HIVA 1X3EA 4JI2L 1WOCA 2KHIA 5IYBH 4LF8Q 2B63G 2R92H 4GOPB 1B70B 2NZOA 1I5FA 4OWXB 4A3IH 4DUZQ 3KDFA 1Q82C 4JI6Q 3M4OH 3W5OA 1BBUA 4DV1Q 3OYYA 4YWLA 5C44H 1PH5A 4K0KL 1E22A 2QGQA 5J3BA 4B3RQ 1PH9A 4JI4Q 2OQ0A 3HOUG 4X65L 1XMQQ 4NXMQ 3S2DH 4A3BG 3CW2C 1W2BA 4GKJL 2PI2E 3K81C 1LYLA 1R9TH 1HNZL 1HNWL 3NEMA 1U0LA 1OXXK 4C3IH 2YTXA 2WFWA 2JEBI 4RMFA 2E2HH 1E7ZA 4A93H 5JJIA 1VQHA 5C4XG 4YHHL 1V1QA 4IOCA 3CP0A 1NY4A 3UDFA 3UDXA 2MNAA 1PVOA 1VQBA 1LM0A 3PV0A 1KXLA 1KQSA 2EXDA 4LUVA 1PH6A 4BBSH 1TWCH 1HH2P 4PZ7A 4GS3A 3CAMA 3GTLH 4A3IG 3BJUA 2F3IA 2PI2A 1YHBA 2N78A 1CSPA 2WB1G 3I4OA 3K8AA 4C3HH 2V1CC 3Q8DA 1LTLA 1MKHA 2UU9Q 3A5ZB 2Q2TA 3CC2A 1NMFA 2BA0A 1QUQB 4JBMA 3A0JA 3AEVA 3T1HL 5HGQA 5LMNL 3S1MH 2I5HA 1VQJA 3K7AH 3TS0A 1VQOA 1HJPA 4B3TQ 3UE1A 4R4CA 2VW9A 4HJAA 3STBC 2LXKA 1CKNB 3H0GH 3PSIA 4ME3A 4GNXA 1XMOQ 4DUYQ 1YJNA 4DV3Q 4BBSG 1SLJA 2YTYA 4LF4L 2D0PA 4DR1Q 2WP8J 5JEAJ 4B3MQ 3ULPA 1NMGA 3PCOB 3A5UA 2VQFQ 1LUZA 4IO9A 1KC8C 4YY3Q 1Y1WH 3FP9A 2MFIA 1OTCA 4L5SA 4AYBG 1MJEA 3HOWH 1VQ5A 4WJ3M 3J7A5 5IP7H 1YHQA 2ZJPA 2HT1A 1JJCB 1HNXQ 4IPCA 1E1OA 2Z6KA 4LWCA 5GAEC 1V43A 3BU2A 1VQGA 4IFDI 3H3VI 1PA6A 2OTLA 2ASBA 1HR0Q 4KI0A 1XPOA 3J81j 3I2ZA 5M3FG 5C3EG 2QA4A 1IXRA 1SFOH 4QQBX 1VQPA 1YZ6A 2ID0A 4AQYL 3GTGH 5IWAQ 1IBLL 2JA8H 4APVA 1Q81C 4LFAQ 1YBYA 4GN4B 1Y1WG 4BXXG 4LFBL 3UE0A 3HOWG 4A3JH 1C0AA 4HIKA 4QJFA 1HNWQ 3ER0A 2RHSB 4AIMA 4GKJQ 2PNHA 1J5EL 1VQKA 1Y14B 4J15A 1SROA 4JBJA 4JI3L 4YHHQ 1KRSA 2OCEA 1K3RA 3RLNA 1EQQA 5K36G 1EIFA 4HJ9A 3AFQA 4P73A 4DR2L 2F52A 4LF9L 3AYHB 2YU9H 5IYCH 1Q1BA 1CUKA 3CC4A 1SN8A 4GLVB 3ZJYC 4DV4L 5IY0A 5BR8L 3M4PA 5GADC 2DUDA 2K5NA 1S3OA 4GKKL 1Q12A 1XNRQ 2UXDL 4H02A 2VL6A 3U50C 4A3EG 1QZHA 2OWOA 3I4MH 1PFSA 2D0OA 2IX0A 4DR6L 1YIJA 2HHHL 4C2MH 3F2DA 1Y1VG 1WCMH 4R4TA 3T1HQ 1PV4A 5LMNQ 3HKZE 3CF5A 1E3PA 4LF5L 3I4NG 1P16A 3F2BA 1XPRA 2K75A 5IP9G 1YI2A 2R7FA 2VNUD 4OWWB 3AQQA 5C4JH 3GDEA 5C0XJ 4DV5Q 1NBWA 4MTNA 1CKOA 4BY1H 2E8GA 3RN2A 3S14H 4DV7L 5AJ3Q 4LF7Q 3NENA 4PZ8A 1Q8KA 5IYCG 1YITA 1B8AA 3OTOL 2ZJRA 1XNQQ 3S24A 3PO2G 2NVYH 4BA2I 4UPAA 4L5RC 3PUXA 2ES2A 3H15A 3HOXH 2ZJQA 1S40A 4YCWA 3PO3H 1IYJB 4QIWE 1WYDA 3GTOH 2E2JH 2R93H 3PUZA 2IY5B 1AE2A 1JE5A 4MNOA 4KLKA 1YVCA 1EUJA 3MXNB 1A63A 1IZ6A 3ERSX 1C9OA 4LFCL 2NVTH 4Y7NH 3S17H 4C3JH 4IPDA 4JI8L 4JYAL 2C35B 3D0FA 4BY1G 1FGUA 3CPFA 5LMUL 3W1BA 1YHAA 1M90C 5M3MH 3HOZG 1K8AC 4A3DG 3AFPA 2RHQB 4YWMA 1HZAA 3K0XA 4DKAC 1EWIA 4BY7H 4IJLA 2BH8A 4DR4L 2GVBA 2RCNA 3JAMi 4YCUA 4UP8A 2UUCQ 3CCUA 3HOXG 3CCEA 4JI0Q 2KCTA 3E9HA 2WB1E 3CCLA 3IRBA 3CPWA 4JBKA 4IFDG 3PGZA 3KJOA 4GOPA 1VQ7A 4YCVA 2Q2UA 2VQEL 5FLMG 4RG1A 4HIMA 1D8LA 4JI3Q 2R7DA 4KHZA 3WWVA 4BBRH 4GLXA 1N8RC 1N36Q 1FJGQ 1K83H 4DPGA 2ATWA 5IYBG 2R92G 2CQOA 4A3CH 3CMEA 1K73C 1N34L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M G;  1RL2 A;  1X6O A;  1GVP A;  3CCS A;  1AH9 A;  3E9I A;  1X65 A;  5C44 G;  3K7U C;  5BR8 Q;  3EIV A;  3CQZ H;  1A62 A;  3PIP A;  1TXY A;  4GKK Q;  3GTM H;  4OWT B;  4XTC S;  1X55 A;  3HKS A;  4DR6 Q;  2KBN A;  4JI5 L;  1L2F A;  1EOV A;  2N8N A;  2VY3 A;  4NB3 A;  4DV0 L;  3CMA A;  4AYB E;  4A93 G;  2NZH A;  4LF5 Q;  2UXB L;  1NTG A;  1UE1 A;  3MEF A;  3D31 A;  4P74 A;  1VQI A;  3F8T A;  3ULJ A;  4A3M H;  4BBR G;  1N32 L;  1QUQ A;  3G48 A;  3JAM c;  1CSQ A;  1WJJ A;  4TQU S;  1RIP A;  5FLX c;  2PMZ E;  4A3K H;  4HID A;  4KHP L;  3S1R H;  1VQ4 A;  2YV5 A;  4JI1 Q;  1Z9F A;  1CKN A;  5M5Y H;  1PYS B;  4X62 Q;  1QVC A;  1VQE A;  1VQ6 A;  4AH6 A;  1ASY A;  2JA6 H;  3EBE A;  5IYD H;  2N3S A;  3DM3 A;  1PH1 A;  1PH7 A;  1BBW A;  3H0G G;  3GD7 A;  4QGU A;  2E5L L;  2R6G A;  1K9M C;  4LFC Q;  4MZ9 A;  1BVS A;  4A3M G;  1EFW A;  2AWO A;  2F4V L;  4JYA Q;  2UUA Q;  4JV5 L;  1H95 A;  1UE5 A;  1BKB A;  4JI2 Q;  3RZD H;  5LMU Q;  4DR3 L;  4JI7 L;  2NVX H;  1GM5 A;  1X54 A;  3FKI H;  4JOI C;  4POG A;  4A3L H;  1WI5 A;  2NN6 G;  4K0K Q;  4DV6 L;  2JJQ A;  2MO1 A;  2L15 A;  3RR5 A;  3KJP A;  4DK6 C;  4DR4 Q;  2AKW B;  2K5V A;  5IP7 G;  2A19 A;  2AMC B;  4DK3 C;  5M5W H;  4X65 Q;  2OQK A;  2RF4 A;  3U4Z A;  1FVI A;  4HJ5 A;  1HNZ Q;  2CCZ A;  1HZ9 A;  1QVF A;  2IT1 A;  5IYD G;  2JA6 G;  1FL0 A;  1PH3 A;  2VZA A;  3RLO A;  4DUZ L;  4JI6 L;  1KIX A;  3BZK A;  1L1O C;  4A3F H;  1NE3 A;  3KF8 B;  2EQS A;  2YYZ A;  4GNX B;  4B3R L;  4JI4 L;  3K80 C;  4O0A A;  1VQM A;  1N34 Q;  4NXM L;  1X3F A;  2MQH A;  2JA8 G;  4PMW A;  3G4S A;  4P72 A;  2B3G A;  2JA7 H;  3S2H H;  2K14 A;  4A4I A;  3GTK H;  4A3J G;  3PIO A;  2ZM6 L;  1JJ2 A;  3M9B A;  1N9W A;  2Z0S A;  1J6Q A;  1C7Y A;  2R7Z H;  3T1Y L;  1GD7 A;  1OXS C;  1YEZ A;  2XTI A;  1VCI A;  4LF6 L;  4DV0 Q;  3HFZ B;  5JJL A;  4OXP A;  2Q2I A;  5DLQ E;  3CCM A;  3L2P A;  5C0X I;  2ALY B;  1Q86 C;  5ELN A;  1D7Q A;  4O2D A;  1EQR A;  2WAQ G;  4LF4 Q;  4IPG A;  3CCV A;  4A76 A;  2XGT A;  5M5X H;  1Q7Y C;  3B6Y A;  1OXV A;  2LXJ A;  3I4M G;  1PH2 A;  2NN6 I;  1N33 L;  2JA7 G;  4KHP Q;  3G6E A;  3CXC A;  4OON A;  3W1G A;  2IHE A;  3S15 H;  1WCM G;  2JQO A;  4DR2 Q;  1VQL A;  4B3T L;  4B3S L;  2VUM H;  3RLF A;  2VS1 A;  3CD6 A;  2UXC L;  1WFQ A;  2ZTD A;  4YWK A;  2K50 A;  1G29 1;  4NXN L;  4DR5 L;  2I0Q A;  1GO3 E;  3M85 A;  3TQY A;  3RN5 A;  3PUW A;  2HIX A;  3RZO H;  2B63 H;  4A3G H;  3I55 A;  3S1N H;  3F1Z A;  3TEH B;  1EIY B;  1I94 L;  3J80 i;  2PQA B;  4GNX C;  4HJ7 A;  1L1O B;  3TRZ A;  5JEA G;  2F4V Q;  4Y52 H;  4YY3 L;  3J81 i;  1SMX A;  4LUZ A;  5GRO A;  1MIU A;  2GVA A;  4GN5 A;  4DR3 Q;  4AQY Q;  1S72 A;  1IL2 A;  1JT8 A;  3HOU H;  4QY7 A;  4POF A;  1IBL Q;  4A3B H;  2HQL A;  3NEL A;  4DV6 Q;  1M1K C;  1HNX L;  3PO3 G;  4LFB Q;  1OXT A;  4R4I A;  1B7Y B;  2JE6 I;  2K4K A;  2MO0 A;  4JC0 A;  4JG2 A;  3LGJ A;  2R93 G;  1X9N A;  1HR0 L;  5C4X H;  3KF6 B;  2GN5 A;  3I7F A;  2VUM G;  2CFM A;  2PQA A;  1L1O A;  2JEA I;  4ALP A;  2JA9 A;  5HY6 A;  1J5E Q;  1YJ9 A;  2Z6K C;  4A3G G;  5IWA L;  4WJ4 A;  2FXQ A;  4LF9 Q;  2EIF A;  1HZB A;  4LFA L;  1V9P A;  3L7Z C;  1U5K A;  2JK8 A;  2KEN A;  4HIO A;  2DGY A;  4DV4 Q;  4BY7 G;  3FHW A;  2BA1 A;  3KF6 A;  3KOJ A;  4UP9 A;  3DLL A;  3M7N A;  1PYB A;  3CCQ A;  2UXD Q;  2H5X A;  1X3G A;  4DR7 L;  1UE7 A;  2E2I H;  1EYG A;  3PF5 A;  1SRU A;  4IJH A;  1O7I A;  2Y0S E;  2ZM6 Q;  1HR0 W;  2HHH Q;  3VDY A;  3T1Y Q;  3J80 c;  4IOA A;  3TS2 A;  4OO1 G;  4GN3 B;  4LW1 A;  2YTV A;  3J81 c;  4LF6 Q;  1UEB A;  4TVA B;  3U4V A;  3GTP H;  1E24 A;  3GO5 A;  1XNR L;  3SGI A;  1VS0 A;  5GAH C;  4A3C G;  1T9H A;  1UWV A;  4DV7 Q;  1KHI A;  1VQ8 A;  4LNQ A;  2IX1 A;  1UE6 A;  2Y0S G;  1XJV A;  3OTO Q;  5FJ8 H;  3ICE A;  1VQC A;  5GAG C;  3OW2 A;  4OX9 L;  1NJI C;  1N33 Q;  4IPH A;  3CCJ A;  2A8V A;  3GTQ H;  3HOY H;  4GLA C;  1KD1 C;  1IBM L;  2A1A A;  4X66 L;  4DV5 L;  4B3S Q;  3I56 A;  1KRT A;  5M3F H;  2UXC Q;  5C3E H;  3S1Q H;  4UY8 C;  2N49 A;  5C0X G;  5AJ3 L;  4LF7 L;  4NXN Q;  3ULL A;  4DR5 Q;  3EN2 A;  4DNI A;  4JI8 Q;  5ELO A;  4BA1 I;  3RNU A;  2LSS A;  1XNQ L;  1L0W A;  1I94 Q;  1VQN A;  1A8V A;  1VQF A;  3M4Q A;  1G6P A;  4A3K G;  4BXX H;  1IBK L;  5FJ8 G;  4X64 L;  3A74 A;  2UUB L;  1TWA H;  2K5H A;  5LMN W;  2ZTC A;  1DGS A;  2JA5 H;  4IFD J;  4EQ5 A;  4DV2 L;  2OTJ A;  1TWF H;  3UDI A;  1JB7 A;  3JC6 6;  1PHJ A;  1X56 A;  4EX5 A;  3HOY G;  1SE8 A;  3L0O A;  3UDG A;  1GKH A;  5EAY A;  4OO1 I;  1I3Q H;  1VQA A;  5E7N A;  3U58 A;  4LF8 L;  2VQE Q;  3S16 H;  3J7Z C;  4DV1 L;  1XTD A;  4NPS A;  4R4Q A;  4PZ6 A;  5IE8 A;  1I6H H;  1XMQ L;  2UUC L;  3FKI G;  4A3L G;  1K0R A;  4A3E H;  2I5L X;  2I5M X;  3E0E A;  1E1T A;  4JI0 L;  1ASZ A;  2WAQ E;  1KL9 A;  5JJK A;  5GQO A;  4FDB A;  1Y1V H;  1Q1E A;  2KCM A;  4DAY B;  2AWN A;  2BH2 A;  2JA5 G;  4QL5 A;  4DR7 Q;  4A75 A;  3I4N H;  2QEX A;  4JI5 Q;  5IP9 H;  3M3Y H;  1N36 L;  1FJG L;  4JBW A;  1HZC A;  2UXB Q;  3HOV H;  1PH4 A;  1MJC A;  4GOP C;  2CKZ B;  3GTJ H;  4A3F G;  2UU9 L;  3KFU A;  2CWA A;  3PF4 A;  1N32 Q;  3STB D;  3PO2 H;  3TRE A;  3F2C A;  4HJ8 A;  1G51 A;  3PUY A;  4JCV E;  4P75 A;  3BZC A;  1Z47 A;  2KHJ A;  2ZTE A;  1QVG A;  4X6A H;  2B29 A;  1TWH H;  4PG3 A;  4OX9 Q;  4UP7 A;  1W3S A;  1QZG A;  2R7Z G;  1XMO L;  2CWP A;  3NBH B;  1K8G A;  4DUY L;  1OXU A;  4DV3 L;  1AE3 A;  2IHF A;  4L5T A;  4P71 A;  1IBM Q;  4X66 Q;  3G71 A;  1YJW A;  4DR1 L;  4R1J A;  4JOI A;  3HOV G;  3KLW A;  3CCR A;  4B3M L;  1TWG H;  2E5L Q;  2VQF L;  3HOZ H;  4JV5 Q;  4A3D H;  4XIG S;  1KAW A;  1SR3 A;  4L5Q A;  2D62 A;  4JI1 L;  1PH8 A;  4JI7 Q;  3HKZ G;  5IT9 c;  2Q2H A;  3PUV A;  1P8L A;  4X62 L;  4LUO A;  5H1S E;  2K52 A;  3KDF B;  1I50 H;  4X64 Q;  1IBK Q;  2NVQ H;  2UUB Q;  1VQ9 A;  3H3V H;  1XPU A;  2AHO B;  4DV2 Q;  4R4O A;  1VQD A;  1Q46 A;  5FLM H;  1CKM A;  4DAM A;  1A0I A;  1YNX A;  1JMC A;  3KYH C;  2UUA L;  1JJG A;  3CC7 A;  2HIV A;  1X3E A;  4JI2 L;  1WOC A;  2KHI A;  5IYB H;  4LF8 Q;  2B63 G;  2R92 H;  4GOP B;  1B70 B;  2NZO A;  1I5F A;  4OWX B;  4A3I H;  4DUZ Q;  3KDF A;  1Q82 C;  4JI6 Q;  3M4O H;  3W5O A;  1BBU A;  4DV1 Q;  3OYY A;  4YWL A;  5C44 H;  1PH5 A;  4K0K L;  1E22 A;  2QGQ A;  5J3B A;  4B3R Q;  1PH9 A;  4JI4 Q;  2OQ0 A;  3HOU G;  4X65 L;  1XMQ Q;  4NXM Q;  3S2D H;  4A3B G;  3CW2 C;  1W2B A;  4GKJ L;  2PI2 E;  3K81 C;  1LYL A;  1R9T H;  1HNZ L;  1HNW L;  3NEM A;  1U0L A;  1OXX K;  4C3I H;  2YTX A;  2WFW A;  2JEB I;  4RMF A;  2E2H H;  1E7Z A;  4A93 H;  5JJI A;  1VQH A;  5C4X G;  4YHH L;  1V1Q A;  4IOC A;  3CP0 A;  1NY4 A;  3UDF A;  3UDX A;  2MNA A;  1PVO A;  1VQB A;  1LM0 A;  3PV0 A;  1KXL A;  1KQS A;  2EXD A;  4LUV A;  1PH6 A;  4BBS H;  1TWC H;  1HH2 P;  4PZ7 A;  4GS3 A;  3CAM A;  3GTL H;  4A3I G;  3BJU A;  2F3I A;  2PI2 A;  1YHB A;  2N78 A;  1CSP A;  2WB1 G;  3I4O A;  3K8A A;  4C3H H;  2V1C C;  3Q8D A;  1LTL A;  1MKH A;  2UU9 Q;  3A5Z B;  2Q2T A;  3CC2 A;  1NMF A;  2BA0 A;  1QUQ B;  4JBM A;  3A0J A;  3AEV A;  3T1H L;  5HGQ A;  5LMN L;  3S1M H;  2I5H A;  1VQJ A;  3K7A H;  3TS0 A;  1VQO A;  1HJP A;  4B3T Q;  3UE1 A;  4R4C A;  2VW9 A;  4HJA A;  3STB C;  2LXK A;  1CKN B;  3H0G H;  3PSI A;  4ME3 A;  4GNX A;  1XMO Q;  4DUY Q;  1YJN A;  4DV3 Q;  4BBS G;  1SLJ A;  2YTY A;  4LF4 L;  2D0P A;  4DR1 Q;  2WP8 J;  5JEA J;  4B3M Q;  3ULP A;  1NMG A;  3PCO B;  3A5U A;  2VQF Q;  1LUZ A;  4IO9 A;  1KC8 C;  4YY3 Q;  1Y1W H;  3FP9 A;  2MFI A;  1OTC A;  4L5S A;  4AYB G;  1MJE A;  3HOW H;  1VQ5 A;  4WJ3 M;  3J7A 5;  5IP7 H;  1YHQ A;  2ZJP A;  2HT1 A;  1JJC B;  1HNX Q;  4IPC A;  1E1O A;  2Z6K A;  4LWC A;  5GAE C;  1V43 A;  3BU2 A;  1VQG A;  4IFD I;  3H3V I;  1PA6 A;  2OTL A;  2ASB A;  1HR0 Q;  4KI0 A;  1XPO A;  3J81 j;  3I2Z A;  5M3F G;  5C3E G;  2QA4 A;  1IXR A;  1SFO H;  4QQB X;  1VQP A;  1YZ6 A;  2ID0 A;  4AQY L;  3GTG H;  5IWA Q;  1IBL L;  2JA8 H;  4APV A;  1Q81 C;  4LFA Q;  1YBY A;  4GN4 B;  1Y1W G;  4BXX G;  4LFB L;  3UE0 A;  3HOW G;  4A3J H;  1C0A A;  4HIK A;  4QJF A;  1HNW Q;  3ER0 A;  2RHS B;  4AIM A;  4GKJ Q;  2PNH A;  1J5E L;  1VQK A;  1Y14 B;  4J15 A;  1SRO A;  4JBJ A;  4JI3 L;  4YHH Q;  1KRS A;  2OCE A;  1K3R A;  3RLN A;  1EQQ A;  5K36 G;  1EIF A;  4HJ9 A;  3AFQ A;  4P73 A;  4DR2 L;  2F52 A;  4LF9 L;  3AYH B;  2YU9 H;  5IYC H;  1Q1B A;  1CUK A;  3CC4 A;  1SN8 A;  4GLV B;  3ZJY C;  4DV4 L;  5IY0 A;  5BR8 L;  3M4P A;  5GAD C;  2DUD A;  2K5N A;  1S3O A;  4GKK L;  1Q12 A;  1XNR Q;  2UXD L;  4H02 A;  2VL6 A;  3U50 C;  4A3E G;  1QZH A;  2OWO A;  3I4M H;  1PFS A;  2D0O A;  2IX0 A;  4DR6 L;  1YIJ A;  2HHH L;  4C2M H;  3F2D A;  1Y1V G;  1WCM H;  4R4T A;  3T1H Q;  1PV4 A;  5LMN Q;  3HKZ E;  3CF5 A;  1E3P A;  4LF5 L;  3I4N G;  1P16 A;  3F2B A;  1XPR A;  2K75 A;  5IP9 G;  1YI2 A;  2R7F A;  2VNU D;  4OWW B;  3AQQ A;  5C4J H;  3GDE A;  5C0X J;  4DV5 Q;  1NBW A;  4MTN A;  1CKO A;  4BY1 H;  2E8G A;  3RN2 A;  3S14 H;  4DV7 L;  5AJ3 Q;  4LF7 Q;  3NEN A;  4PZ8 A;  1Q8K A;  5IYC G;  1YIT A;  1B8A A;  3OTO L;  2ZJR A;  1XNQ Q;  3S24 A;  3PO2 G;  2NVY H;  4BA2 I;  4UPA A;  4L5R C;  3PUX A;  2ES2 A;  3H15 A;  3HOX H;  2ZJQ A;  1S40 A;  4YCW A;  3PO3 H;  1IYJ B;  4QIW E;  1WYD A;  3GTO H;  2E2J H;  2R93 H;  3PUZ A;  2IY5 B;  1AE2 A;  1JE5 A;  4MNO A;  4KLK A;  1YVC A;  1EUJ A;  3MXN B;  1A63 A;  1IZ6 A;  3ERS X;  1C9O A;  4LFC L;  2NVT H;  4Y7N H;  3S17 H;  4C3J H;  4IPD A;  4JI8 L;  4JYA L;  2C35 B;  3D0F A;  4BY1 G;  1FGU A;  3CPF A;  5LMU L;  3W1B A;  1YHA A;  1M90 C;  5M3M H;  3HOZ G;  1K8A C;  4A3D G;  3AFP A;  2RHQ B;  4YWM A;  1HZA A;  3K0X A;  4DKA C;  1EWI A;  4BY7 H;  4IJL A;  2BH8 A;  4DR4 L;  2GVB A;  2RCN A;  3JAM i;  4YCU A;  4UP8 A;  2UUC Q;  3CCU A;  3HOX G;  3CCE A;  4JI0 Q;  2KCT A;  3E9H A;  2WB1 E;  3CCL A;  3IRB A;  3CPW A;  4JBK A;  4IFD G;  3PGZ A;  3KJO A;  4GOP A;  1VQ7 A;  4YCV A;  2Q2U A;  2VQE L;  5FLM G;  4RG1 A;  4HIM A;  1D8L A;  4JI3 Q;  2R7D A;  4KHZ A;  3WWV A;  4BBR H;  4GLX A;  1N8R C;  1N36 Q;  1FJG Q;  1K83 H;  4DPG A;  2ATW A;  5IYB G;  2R92 G;  2CQO A;  4A3C H;  3CME A;  1K73 C;  1N34 L; 
#chains in the Genus database with same CATH topology
 1HFN A;  3TN2 A;  5BR8 Q;  1PZJ D;  4BBS B;  3PIP A;  1TWC B;  4ZKC B;  4OWT B;  3HKS A;  4FF3 A;  4A93 G;  1J8I A;  1CZG A;  3CMA A;  2NZH A;  5JPM C;  4H44 C;  3MEF A;  1F2L A;  1CK1 A;  3R2T A;  3F8T A;  4HMI A;  2HDL A;  3KBG A;  1CSQ A;  4IUV A;  3DM1 A;  2PMZ E;  5M3F B;  5C3E B;  3R93 A;  1HTP A;  4KHP L;  2NN6 H;  1CKN A;  2SNS A;  4X62 Q;  1QWY A;  4K6D A;  5IYD H;  1JWM D;  3LX0 A;  2N3S A;  1PH7 A;  4EQN A;  1IW7 C;  2R6G A;  2IPK D;  4MZ9 A;  1NAP A;  1BVS A;  3DEO A;  4JV5 L;  2AWO A;  2F4V L;  1H95 A;  1EYC A;  2K04 A;  3DWP A;  3QB3 A;  1JIC A;  5ELD A;  2NVX H;  1X54 A;  1JCK B;  3L3O C;  1WI5 A;  2NN6 G;  4K0K Q;  2SDF A;  2MO1 A;  3KJP A;  1SFO B;  1Q90 A;  4DK6 C;  2K5V A;  2A19 A;  4X65 Q;  1BDO A;  3U4Z A;  5A2Q L;  1HZ9 A;  3TME A;  2IT1 A;  5IYD G;  1QVF A;  1K8M A;  3JAM L;  5JJZ A;  4NW2 A;  3HG9 A;  3KLR A;  2EJG C;  3RLO A;  3IFT A;  2BDO A;  5EPK A;  1ICF B;  1S4Z A;  3I4N B;  1VQM A;  1N34 Q;  2JA8 G;  1STG A;  1G91 A;  4PMW A;  3G4S A;  3KUP A;  4P72 A;  2B3G A;  2K14 A;  4RGM A;  4A3J G;  3A8K E;  2R7Z H;  3T1Y L;  2A69 D;  2NTS A;  2XTI A;  4UAI A;  3CRL C;  4B08 A;  3AB9 A;  3U9S A;  1S5E D;  3OPO A;  3MVV A;  1Q86 C;  1D7Q A;  4O2D A;  3CCV A;  1MGS A;  5M5X H;  3BZD B;  1H9K A;  3B6Y A;  1OXV A;  4FNF A;  2NN6 I;  1TWG B;  3DMU A;  4CKC A;  3G6E A;  4OON A;  2IHE A;  4QIW B;  4Q5V A;  1PDQ A;  1WCM G;  2B2V A;  4A3D B;  1DYQ A;  2VUM H;  1PFM A;  3RLF A;  5IGE A;  2ZTD A;  2ZXO A;  1WTX A;  2XVS A;  1G29 1;  1AZQ A;  3M85 A;  3ITP A;  3RZO H;  2HIX A;  2B63 H;  5KND A;  2E2J B;  3TEH B;  1I94 L;  3J80 i;  2PQA B;  3HGB A;  5JEA G;  3FEW X;  3QJY A;  3J81 i;  1SMX A;  4LUZ A;  4AQY Q;  1MIU A;  2NVT B;  1BQQ T;  3HOU H;  4POF A;  3A7L A;  1IBL Q;  4FO2 A;  3K5O A;  4CHT B;  1PTO H;  1EQT A;  2MO0 A;  2R93 G;  5LL6 S;  2M00 A;  2VUM G;  2PQA A;  2JA9 A;  1FYC A;  3EVQ A;  1YJ9 A;  4N9T A;  4C3I B;  3WOE A;  5IWA L;  2EIF A;  1STA A;  3VA7 A;  1V9P A;  3L7Z C;  2JK8 A;  2KEN A;  3FHW A;  3I91 A;  1PTO D;  3DLL A;  2HDM A;  1PYB A;  3CCQ A;  2AUJ D;  1K83 B;  4F88 A;  1BCP F;  1U4M A;  2G9D A;  4IJH A;  1B4O A;  4I7A A;  1W6K A;  1T5E A;  2MHV A;  1L0Y B;  3IFD A;  1Z6H A;  3CU7 A;  5KYI A;  2F0Q A;  3MA2 B;  4J6H A;  4TVA B;  5C3X A;  1VS0 A;  4QUF A;  3IKJ A;  2F0N A;  1EZ6 A;  1EIG A;  1XJV A;  4V0B A;  1A2T A;  4QB4 A;  1HTL D;  4TRD A;  1IKM A;  5GAG C;  1NJI C;  1O7Z A;  1I4G A;  3HOY H;  3VR5 A;  4GLA C;  1HA6 A;  2A1A A;  4X66 L;  4CDF C;  3S1Q H;  2DN8 A;  4NXN Q;  1PMR A;  2EPB A;  2WKC A;  1C48 A;  2JA6 B;  4RWS C;  2LSS A;  1L0W A;  5CV5 A;  4KJO A;  1VQN A;  1ZXT A;  4BXX H;  3J7A F;  1TWA H;  1H9R A;  3K5N A;  2ZTC A;  3TP7 A;  2Z6B A;  3J81 L;  2F0S A;  1ENA A;  1XX8 A;  1DM0 B;  4EQ5 A;  4DV2 L;  2F0D A;  2OTJ A;  3UDI A;  3JC6 6;  3FKI B;  3OHX C;  1X56 A;  2KA7 A;  4EX5 A;  3HOY G;  1SE8 A;  3L0O A;  5EAY A;  2RSO A;  1EQV A;  2QDL A;  4LF8 L;  2O4X A;  2VQE Q;  3S16 H;  5M5W B;  1JQY D;  1TY0 A;  2BDN A;  4HSV A;  2EOT A;  4RKB A;  3FKI G;  3A56 A;  3T53 B;  1ASZ A;  2WAQ E;  3ZYY X;  3D4W A;  1Y1V H;  4DAY B;  3MHB A;  4DR7 Q;  4QL5 A;  2QEX A;  4LAA A;  1TS5 A;  5IP9 H;  3KF8 A;  1CHP D;  1N36 L;  1HZC A;  2K7V A;  3N52 A;  2QEJ C;  3MXG A;  1KTK A;  3KK7 A;  4C56 C;  2Z1C A;  5KNB A;  1D1I A;  2WV6 D;  3GTJ H;  4DAY A;  2B2W C;  3PO2 H;  3TRE A;  1G51 A;  4R8N A;  3NBI A;  3OOC A;  1WTO A;  1Z47 A;  4N8F A;  2KHJ A;  5NUC A;  4X6A H;  1TWH H;  2VB3 X;  4UP7 A;  4DF7 A;  3J80 E;  1K8G A;  3J81 E;  4DV3 L;  4P71 A;  3H09 A;  1IBM Q;  1C8C A;  4R1J A;  3KLW A;  3CCR A;  4B3M L;  2E5L Q;  4OHJ A;  1U4R A;  2VQF L;  1KAW A;  2D62 A;  4WRD A;  1SSO A;  4A3G B;  1P8L A;  2EE1 A;  5EBC A;  5T1I A;  1F9S A;  4X62 L;  2K52 A;  4DAV A;  1I50 H;  2NVQ H;  2EY5 A;  3EFX D;  2UUB Q;  4FXK C;  1QNK A;  3ND8 A;  5D65 A;  1Q46 A;  5FLM H;  4DAM A;  1A0I A;  1VMP A;  1JJG A;  2F0L A;  3CC7 A;  5DAU A;  1WOC A;  4DXF A;  1KDB A;  1F9P A;  3IAY A;  4IUP A;  2NZO A;  3U9O A;  3W5O A;  4JW0 A;  4YWL A;  5C44 H;  4J8Q A;  3Q24 A;  4K0K L;  5G3L D;  5E1F A;  4X65 L;  1NR4 A;  4A3B G;  3CW2 C;  1W2B A;  3QIA A;  1LYL A;  1R9T H;  3I8Z A;  1V8Q A;  1U0L A;  1OXX K;  2JEB I;  2XRS D;  1R4Q B;  1V1Q A;  1LLR D;  3UDX A;  1PVO A;  2Z4H A;  3PV0 A;  3SXH A;  1STH A;  5IGC A;  2EXD A;  2PW7 A;  4LUV A;  1VF5 C;  1PRT B;  4PZ7 A;  1S5B D;  4DK1 A;  3Q6S A;  3K8A A;  1IHZ A;  1YHB A;  2N78 A;  4C3H H;  4QUC A;  1STY A;  1MKH A;  4RGT A;  2Q2T A;  2BA0 A;  2K33 A;  4JVZ A;  1QUQ B;  1LTI D;  5EQ0 A;  3VR6 A;  5LMN L;  1EWH A;  2LY7 A;  2D2C C;  4KY5 A;  4B3T Q;  3UE1 A;  4HJA A;  3S1R B;  1TII D;  2A68 D;  4DR1 Q;  5JEA J;  3ULP A;  3PCO B;  1LUZ A;  2LMC B;  3HOW H;  3J7A 5;  1QB5 D;  4FXD A;  5EKK A;  2WKD A;  2ZJP A;  1HNX Q;  2O2L D;  5IGB A;  3NQI A;  3QR8 A;  1PA6 A;  2RDH A;  3I2Z A;  4XYQ A;  1CHQ D;  5FOB B;  4QQB X;  1MI2 A;  3VYR A;  2L55 A;  4AQY L;  2ZXP A;  1IBL L;  1Q81 C;  4LFA Q;  3C3L A;  2RBM A;  4ZUJ A;  1WVL A;  4GN4 B;  3UE0 A;  3HOW G;  4A3F B;  1HNW Q;  4GKJ Q;  1I6H B;  4JK1 C;  5EGT A;  1VQK A;  1HFG A;  4JBJ A;  4JI3 L;  1K3R A;  1E2V A;  1EQQ A;  3AYH B;  5IYC H;  4RHS A;  4I65 A;  3SVM A;  2DUD A;  1S3O A;  4GKK L;  3U50 C;  1QZH A;  1PFS A;  4DAP A;  2IX0 A;  3TP5 A;  1YIJ A;  2B8G A;  4R4T A;  2HQE A;  1Y8O B;  2PYK A;  2K75 A;  2VNU D;  3HZX A;  3AQQ A;  1NBW A;  4MTN A;  2N55 A;  1CKO A;  3RN2 A;  3S15 B;  5IYC G;  1AP0 A;  4L5R C;  1KNA A;  3PUX A;  3H15 A;  3D4D A;  3HOX H;  2ZJQ A;  4YCW A;  4QIW E;  1WYD A;  2D5D A;  3GTO H;  3HOZ B;  1RTN A;  3PUZ A;  1AE2 A;  4MTK A;  3MXN B;  5LL6 X;  4Y7N H;  3S17 H;  4LK1 C;  4IPD A;  4GZY C;  4KK7 A;  5M3M H;  3HOZ G;  3ERQ A;  4YWM A;  4BY7 H;  2NYZ D;  4CBV A;  2RCN A;  3HOX G;  4JI0 Q;  3E9H A;  2WB1 E;  1EEF D;  4EGV A;  1I4P A;  1TKW B;  2VQE L;  1F9Q A;  2B2W A;  1D8L A;  1FGB D;  3WWV A;  4DPG A;  5J1Z A;  1SE4 A;  2CQO A;  4BS9 A;  2EJM A;  5M3M G;  1RL2 A;  1X6O A;  1X65 A;  2A73 B;  2L9H A;  2RA4 A;  3EIV A;  3CQZ H;  1A62 A;  2RDG A;  1TXY A;  3GTP B;  2ZXR A;  4U68 A;  4XTC S;  1YNN C;  4NB3 A;  3A8I E;  4AYB E;  5CV9 A;  1SYF A;  1NTG A;  1UE1 A;  1K0S A;  5CR3 A;  2DNE A;  4P74 A;  4A3M H;  1Z7T A;  1HA5 A;  3JAM c;  2K05 A;  3W3A A;  2NTT A;  4TQU S;  1RIP A;  3H0G B;  1ENF A;  4HID A;  3PMF A;  1FR3 A;  4HAE A;  1VQ4 A;  5I9O A;  3X3M A;  1BO0 A;  5M5Y H;  3MAQ A;  1AN8 A;  5CV6 A;  2NUC A;  3EBE A;  2F0U A;  1Y1W B;  3SK8 A;  1PH1 A;  1BBW A;  3H0G G;  3GD7 A;  2E5L L;  4LFC Q;  2JSO A;  4CDD C;  1EFW A;  4A3M G;  2UUA Q;  4JI2 Q;  3RZD H;  4POG A;  1H9J A;  4A3L H;  2JJQ A;  1RJT A;  2HUG A;  5IP7 G;  3T51 B;  3K57 A;  2RF4 A;  1FVI A;  3P75 A;  4P2C B;  2QCP X;  2PW5 A;  2I46 A;  1JC7 A;  4RGN A;  5I2Y A;  4KN7 C;  1HXY D;  1KIX A;  3K58 A;  1NE3 A;  2EQS A;  2YYZ A;  1V1P B;  4K8I A;  3M3Y B;  3VR3 A;  1X3F A;  1D1K A;  2SOB A;  5CBE E;  2JA7 H;  1EY6 A;  2O5I C;  3GTK H;  5FKA C;  2YU9 B;  2ZM6 L;  3M9B A;  1C7Y A;  4I7Z C;  4KMU C;  1OXS C;  1YEZ A;  3M7G A;  1VCI A;  4LF6 L;  4DV0 Q;  1EQR A;  2WAQ G;  4LF4 Q;  2OEO A;  4A76 A;  2XGT A;  3WOF A;  1HUM A;  3UI2 A;  5ELF A;  4OEM B;  2LXJ A;  4BY1 B;  1BBX C;  2JA7 G;  3W1G A;  2A6H D;  1DD2 A;  2EYL A;  1VQL A;  4B3T L;  2PPB C;  4B3S L;  4KD3 A;  3SR1 A;  2UXC L;  2VS1 A;  2BE5 D;  1WFQ A;  1DOM A;  2NVY B;  3V96 A;  3NQT A;  3TQY A;  2AUK A;  2F0F A;  3FDT A;  3RN5 A;  2CH4 W;  3S1N H;  1EYA A;  1RCV D;  3E5S A;  4KY6 A;  4ZLT F;  2JN4 A;  2NZ1 D;  5FLX E;  1L1O B;  2OXP A;  5GRO A;  4OEL B;  4GN5 A;  4DR3 Q;  1S72 A;  4QY7 A;  4K2L A;  2HQL A;  4DV6 Q;  1HNX L;  4LFB Q;  3PO3 G;  4KY7 A;  2IJ0 A;  2JE6 I;  2K4K A;  3BVG A;  1L1O A;  2JEA I;  4ALP A;  3QG1 A;  5HY6 A;  2JXM B;  1J5E Q;  2A6E C;  3MC0 B;  2Z6K C;  1ILQ A;  5CBA E;  4LFA L;  2KOL A;  1HHV A;  4HIO A;  4DV4 Q;  2UXD Q;  5KNC A;  1SDF A;  1UE7 A;  3GTL B;  1EYG A;  3PF5 A;  1SRU A;  5ELE A;  1O7I A;  3TBI B;  3VYT A;  2Y0S B;  3GV6 A;  3VDY A;  3J80 c;  4GN3 B;  2YTV A;  3J81 c;  5IT9 L;  3GO5 A;  1ESR A;  4O1N A;  4IUR A;  4A3C G;  1T9H A;  1VQ8 A;  5ELB A;  1FNU A;  1UE6 A;  2Y0S G;  2JYO A;  1TVX A;  1JOR A;  1DOL A;  1OO9 B;  1M4V A;  1VQC A;  3OW2 A;  2E76 C;  1N33 Q;  4IPH A;  3A7A B;  4KTA A;  2A8V A;  2KEE A;  1PTO F;  4C1N I;  1M8A A;  3I56 A;  5M3F H;  5C3E H;  1SNC A;  3ULL A;  4DR5 Q;  1EY8 A;  1T5X D;  3ERO A;  4BA1 I;  4RA8 A;  2OT2 A;  1A8V A;  1VQF A;  3URY A;  1V1O A;  1IBK L;  4X64 L;  3A74 A;  4XQN A;  1DGS A;  3GTG B;  1B44 D;  1BR9 A;  3I90 A;  3R8B A;  1BOS A;  1TWF H;  1JB7 A;  2JA8 B;  1BCP C;  2SEB D;  1SMY C;  4F7X A;  4A3J B;  3J7Z C;  4DV1 L;  2B8F A;  4WJW A;  1XMQ L;  1E0B A;  2I5L X;  3E0E A;  2F0M A;  2R61 A;  4JI0 L;  4PV1 C;  5GQO A;  1EL0 A;  1Q1E A;  4KKT A;  5DM7 3;  4A75 A;  3I4N H;  2JP1 A;  2B2U A;  4JI5 Q;  1MHW C;  5COR A;  4JBW A;  2UXB Q;  2XRQ D;  1WCM B;  2MP1 A;  2R7Z B;  2UU9 L;  3KFU A;  5C4H A;  1N32 Q;  3STB D;  4HJ8 A;  1ET6 A;  1YNJ D;  2MPM A;  3OWF A;  3SK4 A;  2HCC A;  1A3T A;  4OX9 Q;  5IGG A;  1QZG A;  2R7Z G;  1X3P A;  3NBH B;  4DUY L;  3BYY B;  2M9V A;  2IHF A;  1PXU A;  5A2Q E;  1D5Z C;  3G71 A;  1GOZ A;  1D5X C;  1PRT C;  1TQO A;  3JAM E;  1TWG H;  2R93 B;  1LTB D;  4MIU A;  5D3D A;  1K8O A;  4L6T B;  2VUM B;  4A3D H;  4YIJ A;  1PH8 A;  4L5Q A;  2RKS A;  4JI7 Q;  1CT1 D;  2Q2H A;  3NBH A;  3PUV A;  5JAV A;  3RZO B;  2K5D A;  3KDF B;  5A35 A;  3QO2 A;  5JPN C;  4IFD H;  1SYE A;  3H3V H;  4R4O A;  3HOU B;  1SXT A;  2AQ3 B;  3SEB A;  1YNX A;  1LT5 D;  3KYH C;  2UUA L;  3FPP A;  1X3E A;  4JI2 L;  2AQ1 B;  1ESF A;  2B63 G;  4OWX B;  1Q82 C;  3M4O H;  3KDF A;  4HR7 B;  3OYY A;  5AFW A;  5EPL A;  5J3B A;  4B3R Q;  4JI4 Q;  3HOU G;  4ME5 A;  3S2D H;  2PI2 E;  4Q0F A;  4C3I H;  4RMF A;  2WFW A;  1E7Z A;  2EVB A;  2J7Z A;  1VQH A;  1KDC A;  4YHH L;  4IOC A;  2O5J C;  3CP0 A;  1NY4 A;  3UDF A;  2MNA A;  1F77 A;  4MHE A;  1E2W A;  3GTM B;  2CH4 A;  5CMD A;  4GS3 A;  2QDB A;  2H1E A;  1B1Z A;  2WB1 G;  1RD9 D;  1XNR L;  2BOS A;  2CW0 D;  3LWE A;  5HGQ A;  3SE0 A;  4XQJ A;  1U4L A;  3T1H L;  3S1M H;  4NDX A;  2I5H A;  4IUT A;  4CGY B;  1VQJ A;  3K7A H;  1VQO A;  1HJP A;  4E6I A;  5G3L F;  1XMO Q;  5IGF A;  3O13 A;  1DON A;  4LF4 L;  3NSW A;  2WP8 J;  3HOY B;  3BYT B;  4H7B A;  4IO9 A;  3S1Q B;  4YY3 Q;  4CDE C;  4AYB G;  1MJE A;  4WJ3 M;  2G9H D;  1HUN A;  1SYC A;  5EPJ A;  1VF7 A;  3AU7 A;  1JJC B;  2X69 A;  2PCF B;  2Z6K A;  4LWC A;  1V43 A;  2IW3 A;  3I70 A;  1VQG A;  4X3K A;  4IFD I;  3H3V I;  5JVH 3;  1PFB A;  3J81 j;  1TWA B;  1CM9 A;  4EQP A;  1EYD A;  2QA4 A;  1YZ6 A;  2ID0 A;  2D9U A;  2PO4 A;  3IL8 A;  3D3R A;  1A3V A;  4BXX G;  3S16 B;  4LFB L;  5LHY 1;  4FYD A;  4J1M A;  4QJF A;  3NTK A;  4XT3 B;  1J5E L;  1G6Z A;  1Y14 B;  2PZT A;  3SK5 A;  3VYU A;  1DXM A;  1KRS A;  3S2H B;  1PLF A;  4DR2 L;  2DNC A;  3BDC A;  1CUK A;  1B9N A;  1SN8 A;  3CC4 A;  4DV4 L;  5BR8 L;  2UXD L;  4V19 0;  4H02 A;  4LMQ D;  3I4M H;  2D0O A;  4A93 B;  4C2M H;  3GTJ B;  1Y1V G;  3D4R A;  1PV4 A;  3K5L A;  3HKZ E;  3CF5 A;  1P16 A;  1F2Z A;  3RD4 A;  1BCP B;  5FO8 B;  5IP9 G;  1YI2 A;  2R7F A;  2R3Z A;  5C4J H;  4K5X A;  3NTH A;  4FVM A;  4XDX A;  4DV5 Q;  1HCZ A;  2E74 C;  4B9X A;  5AJ3 Q;  1D6E C;  1Q8K A;  1B8A A;  3I73 A;  1IW7 D;  2ZJR A;  3PO2 G;  2L5T A;  3I4L A;  3EA6 A;  1S40 A;  1IYJ B;  3C1F A;  3VYS A;  1JE5 A;  1HQM C;  1LTT D;  4A3B B;  4C3J H;  2NVQ B;  3PIO 3;  3CPF A;  3W1B A;  1K3B C;  2ENB A;  4DNR B;  1K8A C;  1HZA A;  3K0X A;  4CKE A;  4YCU A;  2UUC Q;  3CCU A;  1DZ1 A;  4OGQ C;  2H4O A;  2F0T A;  3I3C A;  3IRB A;  3PGZ A;  4PMC A;  3KJO A;  3J7A V;  5C44 B;  2F3W A;  2VXW A;  5FLM G;  1EFI D;  4ZRZ A;  4BBR H;  5I6W A;  4B9W A;  3CME A;  5FO7 B;  1K73 C;  1N34 L;  1K28 A;  1GVP A;  5DEH A;  5C44 G;  3K7U C;  2XIW A;  1SNP A;  1CQF A;  5JVG 3;  4DR6 Q;  4JI5 L;  1IYV A;  1SNM A;  2VY3 A;  3SHL A;  1EOT A;  4R9W A;  5CGK A;  3BVM A;  4LF5 Q;  2UXB L;  3ND9 A;  3TDQ A;  5C0X H;  1VQI A;  3ULJ A;  4BBR G;  1N32 L;  1QUQ A;  5E3F A;  3KLS A;  4RH6 A;  3GTQ B;  1RHP A;  3ONA B;  5IIF A;  4C3H G;  5FLX c;  4A3K H;  2PMZ B;  3S1R H;  1EZ8 A;  1F2Y A;  2YV5 A;  4JI1 Q;  1Z9F A;  4DNT B;  3OIQ A;  4ZAI A;  1QVC A;  1VQ6 A;  3DUZ A;  2K1B A;  2K5W A;  3OMG A;  4N9P A;  4K14 A;  4K5V A;  2XWJ B;  1JWS D;  3DM3 A;  4HED A;  1CQV A;  3HOW B;  1HQR D;  1QOH A;  1K9M C;  3P20 A;  4JYA Q;  1UE5 A;  4JI7 L;  1IL8 A;  5LMU Q;  1GM5 A;  2B2T A;  1SNQ A;  4JOI C;  2RCF A;  3P1H A;  1I3Q B;  2L15 A;  4DR4 Q;  2AKW B;  1UUP A;  2AMC B;  2IWH A;  4DK3 C;  3TSS A;  1HNZ Q;  4F87 A;  2IX3 A;  1TS2 A;  4K8J A;  1FL0 A;  5KIX A;  4KD4 A;  2Z8L A;  4IZ8 A;  1WD1 A;  1L1O C;  2EYJ A;  4A3F H;  1SE2 A;  5KGU A;  4B3R L;  4JI4 L;  1ZYR C;  3K80 C;  4O0A A;  4ZQ3 A;  1CTM A;  2MQH A;  3RUZ A;  1ZEQ X;  3VA5 A;  3PIO A;  2MJ8 A;  1N9W A;  1J6Q A;  4G7O C;  4HCE A;  3T16 A;  4OXP A;  1PZK D;  3CCM A;  3L2P A;  5C0X I;  3D6C A;  1F9R A;  4IPG A;  1KDA A;  1BF4 A;  2N88 A;  4KHP Q;  3CXC A;  4DFA A;  3S15 H;  4PQX A;  4YWK A;  2FMM A;  4NXN L;  2I0Q A;  3V2T A;  3HOX B;  3PUW A;  3GTO B;  3KBX A;  1EIY B;  3TRZ A;  2P5Z X;  4HJ7 A;  1STE A;  2F4V Q;  4YY3 L;  2GVA A;  4Y7N B;  4HN7 A;  2TMP A;  4ODG A;  3MXN A;  1M1K C;  2X6L A;  2RDF A;  4HMJ A;  1B7Y B;  4K5W A;  5M3M B;  4JC0 A;  3K5M A;  3LGJ A;  2EY2 A;  1X9N A;  1PFN A;  5C4X H;  2EYH A;  2K5Q A;  4OO1 H;  3NTI A;  2F0O A;  4ILW A;  4FF1 A;  4WJ4 A;  4Z9C B;  4XT1 B;  1I4R A;  2FXQ A;  4ZUI A;  1STB A;  4LF9 Q;  1HZB A;  2FHT A;  1U5K A;  4BY7 G;  4UP9 A;  2E75 C;  1RTO A;  4RAU C;  2H5X A;  4DR7 L;  2E2I H;  2DY8 A;  1HR0 W;  2HHH Q;  1EY0 A;  2E2D C;  1UNS A;  3T1Y Q;  4OO1 G;  3TS2 A;  4IQZ A;  4EQO A;  2EYP A;  1UEB A;  3GTP H;  1E24 A;  2B2U C;  2F0H A;  5GAH C;  3QOJ A;  4DV7 Q;  1GUT A;  1KAA A;  1KHI A;  4LNQ A;  1O7Y A;  2IX1 A;  1JOQ A;  3OWE B;  2A69 C;  1LT3 D;  5FJ8 H;  4A3M B;  3ICE A;  1SAP A;  4PMB A;  4HSP A;  3C2P A;  1KD1 C;  1IBM L;  3BDL A;  4HCS A;  4DV5 L;  4CJ1 B;  4UY8 C;  5AJ3 L;  1HRJ A;  2DY7 A;  3EN2 A;  4DNI A;  1A2U A;  5ELO A;  4X3T A;  1H9M A;  3A54 A;  2QF7 A;  2B39 A;  1I94 Q;  1SYB A;  1G6P A;  3M4Q A;  5FJ8 G;  5CC4 A;  2UUB L;  2K5H A;  5LMN W;  1IKL A;  1B3Q A;  2C9O A;  3RZD B;  2JA5 H;  3Q23 A;  1PHJ A;  5CV4 A;  2FMC A;  3UDG A;  1GKH A;  2KVM A;  4OO1 I;  3T4A C;  5K36 H;  5E7N A;  3U58 A;  2L0C A;  1XTD A;  2F4I A;  5M9O A;  3NWT A;  2E2H B;  5IE8 A;  2EJF C;  2UUC L;  4A3L G;  1K0R A;  4A3C H;  4A3E H;  2I5M X;  4JPB W;  1FNW A;  1KL9 A;  2WAQ B;  4FDB A;  2KCM A;  2BH2 A;  2JA5 G;  2F0G A;  3MXU A;  1JOK A;  2F0J A;  2ICE C;  1KAB A;  3M3Y H;  4KJN A;  1V1P A;  3CHB D;  1UAP A;  2JA7 B;  3HOV H;  1PTO C;  1PH4 A;  1MJC A;  2A5H A;  1JB3 A;  1O80 A;  2CWA A;  1BUV T;  1TT2 A;  2K01 A;  3F2C A;  3FMC A;  3PUY A;  4JCV E;  4P75 A;  3BZC A;  3S14 B;  2KCN A;  5E4W C;  2HD3 A;  1QVG A;  4PG3 A;  1SNO A;  1W3S A;  1ET9 A;  1U9R A;  3GV3 A;  2CWP A;  1OXU A;  4L5T A;  4X66 Q;  1YJW A;  4DR1 L;  1ZKO A;  2SNM A;  4JOI A;  3HOV G;  3PO3 B;  2EYF A;  1ICW A;  1SE3 A;  2OF1 A;  1QJO A;  4XIG S;  5D3I B;  1SR3 A;  5COY A;  4JI1 L;  3HKZ G;  3S1N B;  4LUO A;  5H1S E;  1LTA D;  4R8I A;  2BCO A;  1VQ9 A;  1XPU A;  2AHO B;  3MTS A;  4DV2 Q;  1CKM A;  1LTG D;  1JMC A;  4IUN A;  1Q3L A;  5DNF A;  2HIV A;  2R92 H;  2KHI A;  5IYB H;  4LF8 Q;  4GOP B;  1I5F A;  4A3I H;  2PQE A;  4DUZ Q;  4JI6 Q;  4FP5 D;  4X3U A;  1BBU A;  5J22 A;  4F8M A;  1ROD A;  2F0P A;  1PH9 A;  4NXM Q;  4FF4 A;  1HNW L;  2V4D A;  4GKJ L;  3K81 C;  1S5C D;  1HNZ L;  3NEM A;  2YTX A;  3FVQ A;  2E2H H;  5JJI A;  4A93 H;  1SJH D;  1B9M A;  4DN4 M;  5CYU A;  1VQB A;  1LM0 A;  1LTS D;  3DWA A;  1KQS A;  4BBS H;  1PH6 A;  1TWC H;  1HH2 P;  4FXG C;  3CAM A;  3GTL H;  4A3I G;  1I4H A;  3I4O A;  1S5D D;  1LV9 A;  1CI3 M;  1CSP A;  2V1C C;  1LTL A;  3A5Z B;  1NMF A;  3NXW A;  3DWQ A;  3LNN A;  3A55 A;  2I07 B;  4JBM A;  3A0J A;  1GUG A;  4HTH A;  3HS0 C;  3TS0 A;  2PZW A;  4FF2 A;  4R4C A;  2VW9 A;  2LXK A;  1CKN B;  2HCI A;  3PSI A;  1YJN A;  4DV3 Q;  2RVL A;  4BBS G;  1SLJ A;  2YTY A;  2D0P A;  5I4D A;  4B3M Q;  2VQF Q;  1KC8 C;  1LTR D;  3FP9 A;  4L5S A;  1OTC A;  2WAC A;  5C4Z A;  5KRU A;  2F0W A;  2HT1 A;  2NVX B;  5GAE C;  1WTW A;  3VR2 A;  1UEA B;  5C6A A;  1HR0 Q;  2ZT9 C;  5M3F G;  2Z9H A;  5C3E G;  2J4X A;  1SFO H;  3K0Y A;  1VQP A;  1DJR D;  1TWF B;  1CA5 A;  3GTG H;  1NCV A;  1AEX A;  3G7L A;  4NP5 A;  1G2T A;  5IT9 E;  2EZV A;  4APV A;  2JA8 H;  1YBY A;  4A3J H;  4WOR A;  1C0A A;  4HIK A;  2RHS B;  2PNH A;  5KEE A;  1QG7 A;  3I72 A;  3E0J A;  1R4P B;  4J15 A;  3NHH A;  1SRO A;  1AZP A;  2K6A A;  5BN4 A;  1EIF A;  2FIN B;  4HJ9 A;  4P73 A;  2WIN B;  4LF9 L;  1YNN D;  3MFY A;  1Q1B A;  5DM6 3;  4GLV B;  3ZJY C;  1EU4 A;  5IY0 A;  1SBB B;  5GAD C;  1Q12 A;  3T13 A;  4LJZ C;  2LS0 1;  2XNA C;  3D8G A;  5HUR A;  2HHH L;  3QWN A;  1NNX A;  1TS3 A;  1WCM H;  5D14 A;  3TZD A;  1JR0 D;  5LMN Q;  5M5X B;  1E3P A;  3I4N G;  3F2B A;  5EJW A;  4OWW B;  3GDE A;  3CRK C;  3TP8 A;  3VR4 A;  4KKS A;  4DV7 L;  4LF7 Q;  3N6R A;  5JEA H;  1YIT A;  4H13 C;  3OIP A;  1XNQ Q;  3S24 A;  4BA2 I;  1E2Z A;  2B63 B;  2A68 C;  5CV8 A;  3C1E A;  2E2J H;  2R93 H;  2IY5 B;  4MNO A;  2KJX A;  1FD7 D;  2TSS A;  1GUW A;  4LFC L;  2NVT H;  4ZKB B;  1CA6 A;  3QOL A;  2EDG A;  2C35 B;  1PTO B;  4BWG B;  1EY9 A;  1YHA A;  4ZCK A;  5EKI A;  4A3D G;  1MD2 D;  3AFP A;  4QF4 A;  4IJL A;  4ZYS A;  3CCE A;  3K59 A;  2IL8 A;  2B2T C;  3M4O B;  3CPW A;  2WB1 B;  1EY4 A;  3X3N A;  4JBK A;  4IFD G;  4QCL A;  5F2D A;  4YCV A;  4ID6 A;  4U67 3;  3S2D B;  4RG1 A;  4HIM A;  4JI3 Q;  2R7D A;  4GLX A;  1FJG Q;  1K83 H;  3H94 A;  5TSS A;  4RKL A;  3CCS A;  1AH9 A;  3E9I A;  2AQ2 B;  2F1M A;  1SYD A;  4GKK Q;  3DHQ A;  3GTM H;  1X55 A;  1GUS A;  1CFM A;  2KBN A;  3E6Z X;  1L2F A;  4C3I G;  1EOV A;  2N8N A;  4DV0 L;  4WFN 3;  4KN4 C;  2EY6 A;  3NK9 A;  4AYB B;  1II3 A;  3S1M B;  3D31 A;  1GUN A;  3FPU B;  3G48 A;  1WTR A;  3K7A B;  1A15 A;  1WJJ A;  2NB0 A;  1GJX A;  2L11 A;  3A8J E;  1XTC D;  1WTV A;  5IOC A;  1D2B A;  1PYS B;  1VQE A;  4AH6 A;  1ASY A;  2JA6 H;  1CZW A;  1TR5 A;  4NMZ A;  4QGU A;  4DK0 A;  3HP3 A;  1WTQ A;  1BKB A;  2EY1 A;  4DR3 L;  1JE4 A;  5J39 A;  3FKI H;  1X3Q A;  5E4X A;  2A6E D;  3EQL C;  4DV6 L;  3RR5 A;  2C5C A;  4DXG A;  3J80 L;  2KCC A;  5M5W H;  4M1U B;  2OQK A;  3BS1 A;  2CCZ A;  4HJ5 A;  2JA6 G;  4L63 B;  1PRT F;  1PH3 A;  1STN A;  2VZA A;  5K5P A;  4DU9 A;  1Y1V B;  1B2T A;  4DUZ L;  4JI6 L;  3BZK A;  5BN3 A;  3KF8 B;  3GP7 A;  4G4K A;  2PNR C;  4NXM L;  3NPP A;  2L4N A;  3KLS X;  3S2H H;  1EY5 A;  2F3V A;  4A4I A;  1JJ2 A;  5T1G A;  2Z0S A;  2PZU A;  3PO2 B;  1GD7 A;  2FFK B;  3HFZ B;  3I4M B;  5JJL A;  2Q2I A;  5DLQ E;  4C2M B;  2ALY B;  1TWH B;  5ELN A;  2B2Y C;  1LO5 D;  1SND A;  1Q7Y C;  5C4J B;  2CQA A;  1A3U A;  3Q0A A;  1PH2 A;  1N33 L;  3I4M G;  3DXJ C;  4DGZ A;  3TZU A;  2JQO A;  3CD6 A;  3NP8 A;  3CKI B;  2K50 A;  4OIK A;  1G8Z D;  1O78 A;  4DR5 L;  1GO3 E;  1I50 B;  4A3G H;  3I55 A;  3F1Z A;  4GNX C;  1BCP D;  4Y52 H;  1SYG A;  4X3S A;  4NKL A;  1SMY D;  2KEC A;  5EKL A;  5C3W A;  1JT8 A;  1QIL A;  1IL2 A;  1SEB D;  4C3J B;  4A3B H;  3BDO A;  1EIH A;  3NEL A;  1OXT A;  4R4I A;  4JG2 A;  2XWB B;  3BG3 A;  3H6M A;  1HR0 L;  1XXG A;  3KF6 B;  2GN5 A;  3I7F A;  1SJE D;  2CFM A;  5BN5 A;  4C3J G;  1R9T B;  4A3G G;  1AW7 A;  2ICI A;  2J0T D;  2DGY A;  2F0I A;  3D6W A;  2BA1 A;  3KF6 A;  3KOJ A;  3M7N A;  4BBR B;  2X6G A;  1X3G A;  5C5L A;  4C3H B;  1JWU D;  2Y0S E;  2ZM6 Q;  1QNU A;  3E3X A;  1ENC A;  4ABN A;  4IOA A;  4XYO A;  4LW1 A;  4LF6 Q;  3U4V A;  1RDP D;  2QIL A;  3SGI A;  1UWV A;  1ONL A;  5I9P A;  1WTH A;  3OTO Q;  1PRT D;  2Z4I A;  4OX9 L;  3CCJ A;  3GTQ H;  4A3K B;  1B3A A;  3NUC A;  4B3S Q;  5ISR A;  1KRT A;  3T56 B;  2UXC Q;  2QKI C;  2N49 A;  1LAC A;  4UDU C;  4PNY A;  5C0X G;  4LF7 L;  4JI8 Q;  2F0V A;  3RNU A;  1XNQ L;  2A6H C;  2K28 A;  1RKN A;  4A3K G;  2BE5 C;  2Q8R E;  3AMU A;  3SK6 A;  4IFD J;  2NBF A;  1GHJ A;  1GUO A;  3F2U A;  3SDZ A;  5C5M A;  2F0E A;  1I3Q H;  1VQA A;  4CJ0 B;  4NPS A;  4R4Q A;  1G2S A;  3HEJ A;  4PZ6 A;  3Q22 A;  1I6H H;  1EY7 A;  1XWE A;  1E1T A;  1MSH A;  5JJK A;  2AWN A;  4IUQ A;  3OW7 A;  5I6Y A;  1HPC A;  3C46 A;  1MBY A;  2RSN A;  1FJG L;  2K32 A;  2EYO A;  4S3S A;  3MXP A;  4GOP C;  1RF2 D;  2CKZ B;  4TKO B;  3PF4 A;  4A3F G;  4IAL A;  2L1B A;  1NR2 A;  3MFG A;  2EYM A;  3J7Y W;  2ZTE A;  2B29 A;  2EXZ A;  2NWG A;  1XMO L;  1D5M C;  1AE3 A;  2LKV A;  2MGS A;  5EBD A;  4UHV A;  4K6L A;  5IOD A;  3HOZ H;  4JV5 Q;  2QW7 A;  1ML0 D;  1WD0 A;  4IN3 A;  5L37 A;  3S17 B;  5IT9 c;  3OMC A;  1IBK Q;  4X64 Q;  1Y69 U;  3BVZ A;  1QCB D;  4BY7 B;  2FJ2 A;  1VQD A;  4CDC C;  3P7J A;  1B70 B;  5C4X B;  2MUY A;  3WDN A;  4DV1 Q;  4KKU A;  1O7L A;  1PH5 A;  4L8J A;  1E22 A;  2QGQ A;  3M4Y A;  5ELC A;  4DA2 A;  4G7H C;  4N8X 1;  2OQ0 A;  5FK9 C;  1XMQ Q;  1EU3 A;  3R2I A;  3PQI A;  2CVR A;  4G7Z C;  3S9W A;  5C4X G;  2B2Y A;  3CQZ B;  1X32 A;  2DJG C;  2CHB D;  1KXL A;  2E2I B;  3R3O A;  1EWC A;  3BJU A;  2F3I A;  2PI2 A;  4GNX B;  4ZK9 B;  2UU9 Q;  3Q8D A;  3CC2 A;  2KUM A;  3AEV A;  2F0K A;  3TP6 A;  2Q8T A;  1XYI A;  3LWU A;  1AFP A;  1NSN S;  4XXE A;  3STB C;  3H0G H;  4GNX A;  4ME3 A;  1PZI D;  1L0X B;  3NWS A;  3HRZ C;  4DUY Q;  4CKB A;  5M5Y B;  1Y8P B;  1YNJ C;  1ILP A;  3NE5 B;  1W6J A;  5IGD A;  3RMH A;  1C4Q A;  1PYW D;  3MZ5 A;  1NMG A;  3A5U A;  1I4X A;  4K2K A;  1Y1W H;  3G6J B;  2MFI A;  1F2M A;  3MEH A;  2RQX A;  1VQ5 A;  1S5F D;  1LT4 D;  1KNE A;  5IP7 H;  1IYU A;  1YHQ A;  4MN3 A;  1BXT A;  4IPC A;  1E1O A;  3K6O A;  1DOK A;  3OSO A;  3BU2 A;  5KYL A;  4RCN A;  2OTL A;  2ASB A;  2KED A;  4KI0 A;  5FO9 B;  1XPO A;  3L9A X;  3PIP 3;  1QE6 A;  1GXD C;  2B2V C;  4KHV A;  1IXR A;  4RHR A;  2JA5 B;  5IWA Q;  1H9S B;  5JOB A;  2KQ3 A;  1KLU D;  1Y1W G;  4OL7 A;  4TSS A;  1U4P A;  3ER0 A;  1Q8I A;  4RFB A;  5CV7 A;  4AIM A;  4A3E B;  1H9S A;  4EVO A;  2OCE A;  1I6V C;  5FLX L;  3RLN A;  4YHH Q;  3GTK B;  5K36 G;  1GHK A;  3AFQ A;  2F52 A;  4ULL A;  1DCZ A;  3H3V C;  4IUU A;  2YU9 H;  2A74 C;  3W2D A;  1BNZ A;  4G57 A;  3M4P A;  2K5N A;  1I4Q A;  1XNR Q;  2VL6 A;  4A3E G;  2OWO A;  2Q8I B;  3HOV B;  1B50 A;  4CJ2 C;  4DR6 L;  2XSC A;  3F2D A;  1VMC A;  2KHS A;  2L12 A;  3T1H Q;  4H0L C;  1FNV A;  4LF5 L;  3HKZ B;  1XPR A;  2DJF C;  5C0X J;  3EJI A;  1VDZ A;  4BY1 H;  2E8G A;  3S14 H;  2VB2 X;  2CW0 C;  1A6X A;  3DEP A;  1J9O A;  2LFN A;  1MSG A;  3NEN A;  1TU2 B;  4PZ8 A;  5I2X A;  4QMG A;  3OTO L;  1TS4 A;  1Y8N B;  2NVY H;  4RCO A;  4UPA A;  2G5D A;  4C1N K;  3GQB A;  1NUC A;  1JOO A;  2ES2 A;  3PO3 H;  1EEI D;  4KLK A;  1YVC A;  1EUJ A;  2M2L A;  1A63 A;  4RGO S;  1IZ6 A;  3ERS X;  1C9O A;  1LT6 D;  4JI8 L;  4JYA L;  3D0F A;  4BY1 G;  1FGU A;  5LMU L;  2K03 A;  1M90 C;  3H91 A;  2RHQ B;  4DKA C;  4M8A A;  1EWI A;  2BH8 A;  4DR4 L;  2GVB A;  3FRP B;  3JAM i;  4UP8 A;  5HGT A;  2XN9 C;  2R92 B;  3V05 A;  2KCT A;  4A3I B;  4O42 A;  3CCL A;  1LAB A;  3MWY W;  4KV6 A;  1ZYR D;  4GOP A;  1VQ7 A;  4XQQ A;  1TY2 A;  2Q2U A;  4OIJ A;  2F03 A;  1N8R C;  4KHZ A;  2WII B;  1N36 Q;  2ATW A;  1B53 A;  1KLG D;  5IYB G;  2R92 G;  2GA4 B;  1WTP A;  4DR2 Q; 
#chains in the Genus database with same CATH homology
 5M3M G;  1RL2 A;  1X6O A;  1GVP A;  3CCS A;  1AH9 A;  3E9I A;  1X65 A;  5C44 G;  3K7U C;  5BR8 Q;  3EIV A;  3CQZ H;  1A62 A;  3PIP A;  1TXY A;  4GKK Q;  3GTM H;  4OWT B;  4XTC S;  1X55 A;  3HKS A;  4DR6 Q;  2KBN A;  4JI5 L;  1L2F A;  1EOV A;  2N8N A;  2VY3 A;  4NB3 A;  4DV0 L;  3CMA A;  4AYB E;  4A93 G;  2NZH A;  4LF5 Q;  2UXB L;  1NTG A;  1UE1 A;  3MEF A;  3D31 A;  4P74 A;  1VQI A;  3F8T A;  3ULJ A;  4A3M H;  4BBR G;  1N32 L;  1QUQ A;  3G48 A;  3JAM c;  1CSQ A;  1WJJ A;  4TQU S;  1RIP A;  5FLX c;  2PMZ E;  4A3K H;  4HID A;  4KHP L;  3S1R H;  1VQ4 A;  2YV5 A;  4JI1 Q;  1Z9F A;  1CKN A;  5M5Y H;  1PYS B;  4X62 Q;  1QVC A;  1VQE A;  1VQ6 A;  4AH6 A;  1ASY A;  2JA6 H;  3EBE A;  5IYD H;  2N3S A;  3DM3 A;  1PH1 A;  1PH7 A;  1BBW A;  3H0G G;  3GD7 A;  4QGU A;  2E5L L;  2R6G A;  1K9M C;  4LFC Q;  4MZ9 A;  1BVS A;  4A3M G;  1EFW A;  2AWO A;  2F4V L;  4JYA Q;  2UUA Q;  4JV5 L;  1H95 A;  1UE5 A;  1BKB A;  4JI2 Q;  3RZD H;  5LMU Q;  4DR3 L;  4JI7 L;  2NVX H;  1GM5 A;  1X54 A;  3FKI H;  4JOI C;  4POG A;  4A3L H;  1WI5 A;  2NN6 G;  4K0K Q;  4DV6 L;  2JJQ A;  2MO1 A;  2L15 A;  3RR5 A;  3KJP A;  4DK6 C;  4DR4 Q;  2AKW B;  2K5V A;  5IP7 G;  2A19 A;  2AMC B;  4DK3 C;  5M5W H;  4X65 Q;  2OQK A;  2RF4 A;  3U4Z A;  1FVI A;  4HJ5 A;  1HNZ Q;  2CCZ A;  1HZ9 A;  1QVF A;  2IT1 A;  5IYD G;  2JA6 G;  1FL0 A;  1PH3 A;  2VZA A;  3RLO A;  4DUZ L;  4JI6 L;  1KIX A;  3BZK A;  1L1O C;  4A3F H;  1NE3 A;  3KF8 B;  2EQS A;  2YYZ A;  4GNX B;  4B3R L;  4JI4 L;  3K80 C;  4O0A A;  1VQM A;  1N34 Q;  4NXM L;  1X3F A;  2MQH A;  2JA8 G;  4PMW A;  3G4S A;  4P72 A;  2B3G A;  2JA7 H;  3S2H H;  2K14 A;  4A4I A;  3GTK H;  4A3J G;  3PIO A;  2ZM6 L;  1JJ2 A;  3M9B A;  1N9W A;  2Z0S A;  1J6Q A;  1C7Y A;  2R7Z H;  3T1Y L;  1GD7 A;  1OXS C;  1YEZ A;  2XTI A;  1VCI A;  4LF6 L;  4DV0 Q;  3HFZ B;  5JJL A;  4OXP A;  2Q2I A;  5DLQ E;  3CCM A;  3L2P A;  5C0X I;  2ALY B;  1Q86 C;  5ELN A;  1D7Q A;  4O2D A;  1EQR A;  2WAQ G;  4LF4 Q;  4IPG A;  3CCV A;  4A76 A;  2XGT A;  5M5X H;  1Q7Y C;  3B6Y A;  1OXV A;  2LXJ A;  3I4M G;  1PH2 A;  2NN6 I;  1N33 L;  2JA7 G;  4KHP Q;  3G6E A;  3CXC A;  4OON A;  3W1G A;  2IHE A;  3S15 H;  1WCM G;  2JQO A;  4DR2 Q;  1VQL A;  4B3T L;  4B3S L;  2VUM H;  3RLF A;  2VS1 A;  3CD6 A;  2UXC L;  1WFQ A;  2ZTD A;  4YWK A;  2K50 A;  1G29 1;  4NXN L;  4DR5 L;  2I0Q A;  1GO3 E;  3M85 A;  3TQY A;  3RN5 A;  3PUW A;  2HIX A;  3RZO H;  2B63 H;  4A3G H;  3I55 A;  3S1N H;  3F1Z A;  3TEH B;  1EIY B;  1I94 L;  3J80 i;  2PQA B;  4GNX C;  4HJ7 A;  1L1O B;  3TRZ A;  5JEA G;  2F4V Q;  4Y52 H;  4YY3 L;  3J81 i;  1SMX A;  4LUZ A;  5GRO A;  1MIU A;  2GVA A;  4GN5 A;  4DR3 Q;  4AQY Q;  1S72 A;  1IL2 A;  1JT8 A;  3HOU H;  4QY7 A;  4POF A;  1IBL Q;  4A3B H;  2HQL A;  3NEL A;  4DV6 Q;  1M1K C;  1HNX L;  3PO3 G;  4LFB Q;  1OXT A;  4R4I A;  1B7Y B;  2JE6 I;  2K4K A;  2MO0 A;  4JC0 A;  4JG2 A;  3LGJ A;  2R93 G;  1X9N A;  1HR0 L;  5C4X H;  3KF6 B;  2GN5 A;  3I7F A;  2VUM G;  2CFM A;  2PQA A;  1L1O A;  2JEA I;  4ALP A;  2JA9 A;  5HY6 A;  1J5E Q;  1YJ9 A;  2Z6K C;  4A3G G;  5IWA L;  4WJ4 A;  2FXQ A;  4LF9 Q;  2EIF A;  1HZB A;  4LFA L;  1V9P A;  3L7Z C;  1U5K A;  2JK8 A;  2KEN A;  4HIO A;  2DGY A;  4DV4 Q;  4BY7 G;  3FHW A;  2BA1 A;  3KF6 A;  3KOJ A;  4UP9 A;  3DLL A;  3M7N A;  1PYB A;  3CCQ A;  2UXD Q;  2H5X A;  1X3G A;  4DR7 L;  1UE7 A;  2E2I H;  1EYG A;  3PF5 A;  1SRU A;  4IJH A;  1O7I A;  2Y0S E;  2ZM6 Q;  1HR0 W;  2HHH Q;  3VDY A;  3T1Y Q;  3J80 c;  4IOA A;  3TS2 A;  4OO1 G;  4GN3 B;  4LW1 A;  2YTV A;  3J81 c;  4LF6 Q;  1UEB A;  4TVA B;  3U4V A;  3GTP H;  1E24 A;  3GO5 A;  1XNR L;  3SGI A;  1VS0 A;  5GAH C;  4A3C G;  1T9H A;  1UWV A;  4DV7 Q;  1KHI A;  1VQ8 A;  4LNQ A;  2IX1 A;  1UE6 A;  2Y0S G;  1XJV A;  3OTO Q;  5FJ8 H;  3ICE A;  1VQC A;  5GAG C;  3OW2 A;  4OX9 L;  1NJI C;  1N33 Q;  4IPH A;  3CCJ A;  2A8V A;  3GTQ H;  3HOY H;  4GLA C;  1KD1 C;  1IBM L;  2A1A A;  4X66 L;  4DV5 L;  4B3S Q;  3I56 A;  1KRT A;  5M3F H;  2UXC Q;  5C3E H;  3S1Q H;  4UY8 C;  2N49 A;  5C0X G;  5AJ3 L;  4LF7 L;  4NXN Q;  3ULL A;  4DR5 Q;  3EN2 A;  4DNI A;  4JI8 Q;  5ELO A;  4BA1 I;  3RNU A;  2LSS A;  1XNQ L;  1L0W A;  1I94 Q;  1VQN A;  1A8V A;  1VQF A;  3M4Q A;  1G6P A;  4A3K G;  4BXX H;  1IBK L;  5FJ8 G;  4X64 L;  3A74 A;  2UUB L;  1TWA H;  2K5H A;  5LMN W;  2ZTC A;  1DGS A;  2JA5 H;  4IFD J;  4EQ5 A;  4DV2 L;  2OTJ A;  1TWF H;  3UDI A;  1JB7 A;  3JC6 6;  1PHJ A;  1X56 A;  4EX5 A;  3HOY G;  1SE8 A;  3L0O A;  3UDG A;  1GKH A;  5EAY A;  4OO1 I;  1I3Q H;  1VQA A;  5E7N A;  3U58 A;  4LF8 L;  2VQE Q;  3S16 H;  3J7Z C;  4DV1 L;  1XTD A;  4NPS A;  4R4Q A;  4PZ6 A;  5IE8 A;  1I6H H;  1XMQ L;  2UUC L;  3FKI G;  4A3L G;  1K0R A;  4A3E H;  2I5L X;  2I5M X;  3E0E A;  1E1T A;  4JI0 L;  1ASZ A;  2WAQ E;  1KL9 A;  5JJK A;  5GQO A;  4FDB A;  1Y1V H;  1Q1E A;  2KCM A;  4DAY B;  2AWN A;  2BH2 A;  2JA5 G;  4QL5 A;  4DR7 Q;  4A75 A;  3I4N H;  2QEX A;  4JI5 Q;  5IP9 H;  3M3Y H;  1N36 L;  1FJG L;  4JBW A;  1HZC A;  2UXB Q;  3HOV H;  1PH4 A;  1MJC A;  4GOP C;  2CKZ B;  3GTJ H;  4A3F G;  2UU9 L;  3KFU A;  2CWA A;  3PF4 A;  1N32 Q;  3STB D;  3PO2 H;  3TRE A;  3F2C A;  4HJ8 A;  1G51 A;  3PUY A;  4JCV E;  4P75 A;  3BZC A;  1Z47 A;  2KHJ A;  2ZTE A;  1QVG A;  4X6A H;  2B29 A;  1TWH H;  4PG3 A;  4OX9 Q;  4UP7 A;  1W3S A;  1QZG A;  2R7Z G;  1XMO L;  2CWP A;  3NBH B;  1K8G A;  4DUY L;  1OXU A;  4DV3 L;  1AE3 A;  2IHF A;  4L5T A;  4P71 A;  1IBM Q;  4X66 Q;  3G71 A;  1YJW A;  4DR1 L;  4R1J A;  4JOI A;  3HOV G;  3KLW A;  3CCR A;  4B3M L;  1TWG H;  2E5L Q;  2VQF L;  3HOZ H;  4JV5 Q;  4A3D H;  4XIG S;  1KAW A;  1SR3 A;  4L5Q A;  2D62 A;  4JI1 L;  1PH8 A;  4JI7 Q;  3HKZ G;  5IT9 c;  2Q2H A;  3PUV A;  1P8L A;  4X62 L;  4LUO A;  5H1S E;  2K52 A;  3KDF B;  1I50 H;  4X64 Q;  1IBK Q;  2NVQ H;  2UUB Q;  1VQ9 A;  3H3V H;  1XPU A;  2AHO B;  4DV2 Q;  4R4O A;  1VQD A;  1Q46 A;  5FLM H;  1CKM A;  4DAM A;  1A0I A;  1YNX A;  1JMC A;  3KYH C;  2UUA L;  1JJG A;  3CC7 A;  2HIV A;  1X3E A;  4JI2 L;  1WOC A;  2KHI A;  5IYB H;  4LF8 Q;  2B63 G;  2R92 H;  4GOP B;  1B70 B;  2NZO A;  1I5F A;  4OWX B;  4A3I H;  4DUZ Q;  3KDF A;  1Q82 C;  4JI6 Q;  3M4O H;  3W5O A;  1BBU A;  4DV1 Q;  3OYY A;  4YWL A;  5C44 H;  1PH5 A;  4K0K L;  1E22 A;  2QGQ A;  5J3B A;  4B3R Q;  1PH9 A;  4JI4 Q;  2OQ0 A;  3HOU G;  4X65 L;  1XMQ Q;  4NXM Q;  3S2D H;  4A3B G;  3CW2 C;  1W2B A;  4GKJ L;  2PI2 E;  3K81 C;  1LYL A;  1R9T H;  1HNZ L;  1HNW L;  3NEM A;  1U0L A;  1OXX K;  4C3I H;  2YTX A;  2WFW A;  2JEB I;  4RMF A;  2E2H H;  1E7Z A;  4A93 H;  5JJI A;  1VQH A;  5C4X G;  4YHH L;  1V1Q A;  4IOC A;  3CP0 A;  1NY4 A;  3UDF A;  3UDX A;  2MNA A;  1PVO A;  1VQB A;  1LM0 A;  3PV0 A;  1KXL A;  1KQS A;  2EXD A;  4LUV A;  1PH6 A;  4BBS H;  1TWC H;  1HH2 P;  4PZ7 A;  4GS3 A;  3CAM A;  3GTL H;  4A3I G;  3BJU A;  2F3I A;  2PI2 A;  1YHB A;  2N78 A;  1CSP A;  2WB1 G;  3I4O A;  3K8A A;  4C3H H;  2V1C C;  3Q8D A;  1LTL A;  1MKH A;  2UU9 Q;  3A5Z B;  2Q2T A;  3CC2 A;  1NMF A;  2BA0 A;  1QUQ B;  4JBM A;  3A0J A;  3AEV A;  3T1H L;  5HGQ A;  5LMN L;  3S1M H;  2I5H A;  1VQJ A;  3K7A H;  3TS0 A;  1VQO A;  1HJP A;  4B3T Q;  3UE1 A;  4R4C A;  2VW9 A;  4HJA A;  3STB C;  2LXK A;  1CKN B;  3H0G H;  3PSI A;  4ME3 A;  4GNX A;  1XMO Q;  4DUY Q;  1YJN A;  4DV3 Q;  4BBS G;  1SLJ A;  2YTY A;  4LF4 L;  2D0P A;  4DR1 Q;  2WP8 J;  5JEA J;  4B3M Q;  3ULP A;  1NMG A;  3PCO B;  3A5U A;  2VQF Q;  1LUZ A;  4IO9 A;  1KC8 C;  4YY3 Q;  1Y1W H;  3FP9 A;  2MFI A;  1OTC A;  4L5S A;  4AYB G;  1MJE A;  3HOW H;  1VQ5 A;  4WJ3 M;  3J7A 5;  5IP7 H;  1YHQ A;  2ZJP A;  2HT1 A;  1JJC B;  1HNX Q;  4IPC A;  1E1O A;  2Z6K A;  4LWC A;  5GAE C;  1V43 A;  3BU2 A;  1VQG A;  4IFD I;  3H3V I;  1PA6 A;  2OTL A;  2ASB A;  1HR0 Q;  4KI0 A;  1XPO A;  3J81 j;  3I2Z A;  5M3F G;  5C3E G;  2QA4 A;  1IXR A;  1SFO H;  4QQB X;  1VQP A;  1YZ6 A;  2ID0 A;  4AQY L;  3GTG H;  5IWA Q;  1IBL L;  2JA8 H;  4APV A;  1Q81 C;  4LFA Q;  1YBY A;  4GN4 B;  1Y1W G;  4BXX G;  4LFB L;  3UE0 A;  3HOW G;  4A3J H;  1C0A A;  4HIK A;  4QJF A;  1HNW Q;  3ER0 A;  2RHS B;  4AIM A;  4GKJ Q;  2PNH A;  1J5E L;  1VQK A;  1Y14 B;  4J15 A;  1SRO A;  4JBJ A;  4JI3 L;  4YHH Q;  1KRS A;  2OCE A;  1K3R A;  3RLN A;  1EQQ A;  5K36 G;  1EIF A;  4HJ9 A;  3AFQ A;  4P73 A;  4DR2 L;  2F52 A;  4LF9 L;  3AYH B;  2YU9 H;  5IYC H;  1Q1B A;  1CUK A;  3CC4 A;  1SN8 A;  4GLV B;  3ZJY C;  4DV4 L;  5IY0 A;  5BR8 L;  3M4P A;  5GAD C;  2DUD A;  2K5N A;  1S3O A;  4GKK L;  1Q12 A;  1XNR Q;  2UXD L;  4H02 A;  2VL6 A;  3U50 C;  4A3E G;  1QZH A;  2OWO A;  3I4M H;  1PFS A;  2D0O A;  2IX0 A;  4DR6 L;  1YIJ A;  2HHH L;  4C2M H;  3F2D A;  1Y1V G;  1WCM H;  4R4T A;  3T1H Q;  1PV4 A;  5LMN Q;  3HKZ E;  3CF5 A;  1E3P A;  4LF5 L;  3I4N G;  1P16 A;  3F2B A;  1XPR A;  2K75 A;  5IP9 G;  1YI2 A;  2R7F A;  2VNU D;  4OWW B;  3AQQ A;  5C4J H;  3GDE A;  5C0X J;  4DV5 Q;  1NBW A;  4MTN A;  1CKO A;  4BY1 H;  2E8G A;  3RN2 A;  3S14 H;  4DV7 L;  5AJ3 Q;  4LF7 Q;  3NEN A;  4PZ8 A;  1Q8K A;  5IYC G;  1YIT A;  1B8A A;  3OTO L;  2ZJR A;  1XNQ Q;  3S24 A;  3PO2 G;  2NVY H;  4BA2 I;  4UPA A;  4L5R C;  3PUX A;  2ES2 A;  3H15 A;  3HOX H;  2ZJQ A;  1S40 A;  4YCW A;  3PO3 H;  1IYJ B;  4QIW E;  1WYD A;  3GTO H;  2E2J H;  2R93 H;  3PUZ A;  2IY5 B;  1AE2 A;  1JE5 A;  4MNO A;  4KLK A;  1YVC A;  1EUJ A;  3MXN B;  1A63 A;  1IZ6 A;  3ERS X;  1C9O A;  4LFC L;  2NVT H;  4Y7N H;  3S17 H;  4C3J H;  4IPD A;  4JI8 L;  4JYA L;  2C35 B;  3D0F A;  4BY1 G;  1FGU A;  3CPF A;  5LMU L;  3W1B A;  1YHA A;  1M90 C;  5M3M H;  3HOZ G;  1K8A C;  4A3D G;  3AFP A;  2RHQ B;  4YWM A;  1HZA A;  3K0X A;  4DKA C;  1EWI A;  4BY7 H;  4IJL A;  2BH8 A;  4DR4 L;  2GVB A;  2RCN A;  3JAM i;  4YCU A;  4UP8 A;  2UUC Q;  3CCU A;  3HOX G;  3CCE A;  4JI0 Q;  2KCT A;  3E9H A;  2WB1 E;  3CCL A;  3IRB A;  3CPW A;  4JBK A;  4IFD G;  3PGZ A;  3KJO A;  4GOP A;  1VQ7 A;  4YCV A;  2Q2U A;  2VQE L;  5FLM G;  4RG1 A;  4HIM A;  1D8L A;  4JI3 Q;  2R7D A;  4KHZ A;  3WWV A;  4BBR H;  4GLX A;  1N8R C;  1N36 Q;  1FJG Q;  1K83 H;  4DPG A;  2ATW A;  5IYB G;  2R92 G;  2CQO A;  4A3C H;  3CME A;  1K73 C;  1N34 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...