3CP0A

Crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
SPRALVGHRAEVLEDVGATSGQVRLDGSIWSARSMDPTHTFAEGEIVSVIDIQGTTAIVWKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from Corynebacterium glutamicum.
rcsb
source organism Corynebacterium glutamicum atcc 13032
molecule tags Membrane protein
molecule keywords Membrane protein implicated in regulation of membrane protea
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2008-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3cp0A00
1O7IA 3CCJA 4AYBG 1HNXQ 1OXVA 3ICEA 1XMQQ 4LFBQ 2HIXA 4B3SQ 2R93H 1I6HH 1E1TA 4DV7Q 5HY6A 4DR6L 3E9IA 2XGTA 4JI7L 1VQ6A 5FJ8G 4DAYB 1I94Q 4JI3L 3U4VA 2VS1A 3GTMH 3KJOA 3DLLA 4BBSH 4GKKL 4JOIC 2XTIA 4YHHQ 1HZ9A 1Z47A 3CCRA 4GOPB 3CCQA 1X3FA 4DV7L 4NXML 3A0JA 4JBJA 4A3MH 2OCEA 4PZ8A 1JE5A 2DGYA 3HOWH 4DV2Q 5LMNL 3Q8DA 5IYBG 4KLKA 2KCMA 4LUOA 3NBHB 1LM0A 1I94L 4B3SL 3RN5A 2R7DA 3K81C 3PIPA 1UE1A 3JAMi 4LFAL 3S2DH 3ULJA 1Y1VH 1L1OC 3FHWA 4R4IA 3T1HL 2GVAA 2VUMH 3CC7A 1HZAA 4X65L 1XMOL 3PUZA 2F4VQ 4YCWA 2RF4A 2ZTCA 2Y0SE 5M5WH 5IYDG 2Z6KC 1E3PA 4GLXA 1QUQB 4JI0Q 3GTJH 4NXNQ 1PH7A 4A93H 3T1YQ 1PYSB 1S40A 2JA9A 1Q12A 5IWAL 5LMNQ 4DV3Q 1KD1C 1J5EL 2NVXH 4OX9L 3RZDH 2NVYH 4A3JH 1PV4A 3GD7A 4X62Q 5HGQA 4R4TA 1S72A 1NBWA 3J7A5 4LNQA 1JT8A 3L0OA 2KENA 5ELOA 3PF4A 2K5NA 3E9HA 4PMWA 3I7FA 3HOZH 1V1QA 2JQOA 2WP8J 1VQEA 2ZJQA 3M7NA 2EIFA 1TWHH 4Y52H 1IBKL 1SMXA 4GLVB 4A3BH 1GKHA 4XTCS 5FLMH 3H15A 1WFQA 4GKKQ 4A3GH 1IBML 4X62L 4HIKA 4GOPC 4A3LG 2PQAA 4DUYL 1AH9A 4BBSG 5IP7G 1VQ8A 2KHIA 4JI5L 3OTOQ 3I4MH 1VQMA 1MJCA 3CAMA 3AEVA 2N3SA 1UE5A 2IHFA 4AQYQ 1YZ6A 2OQKA 1LUZA 4R4OA 4BY7G 1QUQA 5GADC 1N33L 3RR5A 3EN2A 3KFUA 4B3TL 3HOVG 5GROA 2WAQE 1N36Q 4POGA 1IL2A 3I55A 5JJKA 5C0XJ 2NN6I 3LGJA 1X6OA 4IPGA 4JI1L 3J81i 4DR3L 3ULLA 3ER0A 1HZCA 3U4ZA 2CQOA 1K9MC 2E2JH 1IBMQ 4K0KL 1YJ9A 1B8AA 3FKIH 3VDYA 2JEBI 1CKMA 1YNXA 4JG2A 4RG1A 3ULPA 1HNZL 4B3RQ 1VQGA 1HH2P 1X65A 1VQAA 2E8GA 5BR8L 4A3CH 2V1CC 2CFMA 2JA7H 4LF7Q 4GN3B 2K52A 3HOXG 4A3JG 1H95A 4QY7A 2A1AA 3FP9A 4IPDA 1R9TH 4LW1A 2N8NA 4PZ6A 1OXSC 4JOIA 1Q86C 1EQQA 3S1QH 2VZAA 4IPCA 4NPSA 3SGIA 1QZHA 1PVOA 1VQFA 4DK3C 4B3TQ 1UWVA 1ASZA 1IBLL 4X66Q 1EIYB 4L5TA 3CC2A 1WI5A 1EYGA 3L7ZC 1DGSA 1GD7A 2PI2E 2AMCB 4O0AA 1YHBA 4QL5A 1Y1WH 1VQ9A 1KHIA 1E1OA 1VQPA 1OXUA 2CKZB 2CWAA 4X6AH 1NY4A 1V43A 2K5HA 4LFAQ 3TRZA 5IYCG 1I3QH 3RLOA 2AKWB 1M90C 1X54A 4EQ5A 1Y1VG 4IFDG 4YCVA 1OXXK 2JE6I 1AE2A 4OWTB 4BY1G 4A3KG 4L5RC 5C44H 2UU9Q 4QQBX 1KAWA 1B70B 3A5ZB 4DV6L 4JI7Q 3S1RH 4JI4Q 1Q7YC 4R1JA 1HZBA 4GLAC 5C4JH 3M9BA 1HNZQ 3FKIG 1PH6A 4B3RL 1KRSA 1PH2A 4HJ5A 4C2MH 2ZM6Q 1IYJB 1EFWA 1QVFA 4P75A 4DV2L 4YY3Q 2OTLA 4A75A 3BU2A 3UE1A 3KF6A 3GTKH 3HOXH 1PHJA 2D62A 5M3FG 5M3MG 2B63G 4LUZA 1XNQQ 4BBRG 3HKSA 4P71A 1VQDA 1HNXL 4PG3A 2JA5G 3KDFB 2UU9L 2YU9H 2JA6H 1PH5A 1FL0A 4J15A 1YITA 4A3BG 1XJVA 4A3GG 4A3FG 3UDXA 1HR0W 4X65Q 1IXRA 4KHPQ 4GN4B 4KI0A 4UP7A 4LF8L 2QEXA 1XPOA 2R6GA 1VQOA 1Q1BA 3S24A 2NVQH 1JJGA 4A76A 4DR1Q 2OWOA 3GO5A 4DR2Q 1FVIA 2K50A 3W5OA 3M3YH 4YWMA 4Y7NH 3W1BA 1EWIA 2WB1G 3CCVA 3HOUH 4KHPL 3CD6A 5ELNA 4EX5A 4APVA 4KHZA 1XTDA 1PH9A 4BA2I 4ALPA 2Z0SA 4B3MQ 3JAMc 1C7YA 5JJIA 1CKOA 1XNRQ 3PO3G 4WJ4A 2PQAB 2IY5B 3OYYA 4UPAA 1VS0A 1X3GA 4POFA 1QVCA 2LSSA 2ZM6L 3TEHB 4A3DH 4DUZL 1XMOQ 1W2BA 4JI2L 3WWVA 4DV4L 4DK6C 3G6EA 1YIJA 2F4VL 1CSPA 3I56A 3CMEA 2VQEL 2EXDA 4B3ML 2ATWA 4WJ3M 3UE0A 3PUYA 4C3HH 1K8AC 2LXJA 1CUKA 3U50C 5J3BA 4BXXH 3KF8B 3CQZH 3CP0A 1VQCA 1TWAH 1PH4A 2VY3A 4A3IG 1WCMH 1YI2A 2E2HH 3BJUA 3BZKA 5GAHC 1WYDA 3HOYG 4UY8C 3J80c 2BH8A 3CPFA 2FXQA 1NE3A 2NZHA 2VW9A 3ERSX 2Q2UA 4JCVE 1UE7A 2K5VA 2YTXA 1N32Q 4GN5A 2HIVA 4OO1G 4JI6L 1I50H 5AJ3Q 4YCUA 4LF4Q 2BH2A 1A8VA 3F2DA 2HQLA 4A3MG 5IWAQ 4DR1L 1J5EQ 1P8LA 3CPWA 4DV1L 4GS3A 1Y14B 5GAEC 4GKJQ 2C35B 1FJGL 4A3EH 3NENA 4DNIA 4BY1H 4QGUA 5C3EH 1NTGA 3CCUA 2ID0A 1MJEA 2UUBQ 2UXCQ 3HKZG 2WFWA 2RHQB 2VUMG 1E7ZA 1VQHA 4LF9Q 1JMCA 2E2IH 1SFOH 3PUVA 1VQBA 2IHEA 2R93G 3OTOL 4JI5Q 5JJLA 2F52A 3CMAA 4A93G 4QIWE 3J81c 4LF4L 1EIFA 2UXBL 4JI8L 4DUYQ 4DUZQ 1X3EA 1KXLA 2Z6KA 2CCZA 4BA1I 4JYAQ 1G51A 3PUXA 1N9WA 3STBC 2PI2A 4LFCL 3A74A 1SLJA 5FJ8H 2A19A 2JA5H 2UXDL 3I4OA 1K8GA 2UUBL 1VQNA 2N49A 4JI1Q 4GNXA 2ASBA 5EAYA 1C9OA 1W3SA 3K7UC 5FLXc 3J7ZC 3OW2A 4A3IH 1VQKA 4IO9A 4DV0Q 4MZ9A 3KDFA 3L2PA 3BZCA 1M1KC 1MIUA 1X9NA 2I5MX 3UDIA 1L0WA 4JI4L 3RZOH 2MO0A 4UP8A 1XNRL 2JK8A 3J80i 3PIOA 3D31A 1FGUA 1N8RC 1C0AA 2KBNA 1SN8A 3RNUA 4DR4Q 4DR7L 1D8LA 4JI0L 3S1NH 1U5KA 1CSQA 2AHOB 4JC0A 4DV1Q 1JJCB 4ME3A 4FDBA 2Y0SG 1Q1EA 3STBD 3KJPA 1PYBA 3PO2G 5K36G 2NN6G 3PGZA 2UUCL 2A8VA 2VQFL 4OWWB 3F2BA 4LF8Q 3M4QA 2JEAI 4R4CA 3H3VI 1K83H 5LMUL 3S2HH 2JA7G 3AFPA 2DUDA 4JBWA 1Q82C 3CXCA 1LTLA 2JA8G 3AYHB 4IJHA 5IP9H 3HOZG 5IE8A 4DR7Q 4DR4L 1I5FA 2AWNA 1IBKQ 4HIMA 4JV5Q 3HOWG 2Q2HA 3JC66 1VQJA 3K80C 3I4MG 1L2FA 2F3IA 1KC8C 5GAGC 1KQSA 1NMFA 4GOPA 2D0PA 2UUAQ 3M4PA 5E7NA 5AJ3L 5C4XH 2VQFQ 5JEAG 3RLNA 3F1ZA 2QGQA 1HR0L 2R92G 1S3OA 4L5SA 4IFDJ 3S14H 4NXNL 3TQYA 4YHHL 1NMGA 3H3VH 2HHHL 4JV5L 4DR6Q 2OTJA 3HOVH 1PH8A 1G291 2MFIA 3NEMA 3KOJA 3CF5A 2I5LX 1ASYA 2R7FA 1XNQL 2RCNA 3NELA 2VQEQ 4HIOA 1YHQA 3I4NG 3TS2A 2KCTA 2ES2A 5GQOA 3MEFA 1TWGH 2UUCQ 3PO2H 2L15A 3A5UA 4LUVA 4DR5Q 2Q2IA 1WJJA 1XPRA 1PH1A 1N34Q 4A3CG 1YJWA 1U0LA 1VCIA 4NXMQ 2GN5A 3D0FA 1TWCH 1YEZA 4GNXB 2LXKA 5FLMG 1IZ6A 5H1SE 2JJQA 4QJFA 4GNXC 2HHHQ 2BA0A 2AWOA 3AQQA 3H0GG 4LF5Q 5JEAJ 5IP9G 4X66L 2HT1A 3S16H 4MNOA 3UDFA 2KHJA 1BBWA 2E5LL 1OXTA 2I5HA 4OONA 1HNWQ 3F8TA 4AQYL 4AYBE 3CW2C 4XIGS 1EOVA 3CC4A 1FJGQ 1XMQL 4GKJL 3TREA 1K3RA 3T1HQ 1Y1WG 1EQRA 1P16A 4HJ7A 3KF6B 4LF9L 2MO1A 3CCSA 1N34L 5IYCH 1SE8A 1YHAA 5IT9c 1UE6A 3K0XA 2K14A 3UDGA 1HR0Q 5C4XG 2E5LQ 1E24A 3T1YL 3S17H 3I2ZA 4IJLA 2R7ZH 1VQ4A 4IPHA 4PZ7A 5C44G 2MNAA 3M85A 4RMFA 1VQLA 1RL2A 3IRBA 3GTPH 1VQIA 4LWCA 4OO1I 4DV5L 1D7QA 3J81j 3GTQH 3HOUG 4DR2L 4A3KH 3PCOB 1BVSA 4P72A 3KLWA 3GTGH 4JBMA 4R4QA 1TWFH 4P74A 1N32L 4YWLA 2UXDQ 2OQ0A 2IX0A 4O2DA 4JI6Q 5LMUQ 2N78A 2YV5A 1NJIC 4MTNA 1SR3A 4DR3Q 1HJPA 3CCMA 3W1GA 1X55A 5LMNW 1K0RA 4IFDI 5C0XG 5DLQE 5IY0A 1VQ5A 1AE3A 1N36L 3CCLA 2JA8H 3M4OH 4IOAA 4DV3L 4OX9Q 4LFBL 2QA4A 5M3MH 4C3IH 4DV5Q 1OTCA 2B63H 4BBRH 4K0KQ 1E22A 2ZJPA 4JI2Q 3U58A 4P73A 2MQHA 1HNWL 2B3GA 1Q8KA 4A3FH 4JYAL 3G71A 3PV0A 1KRTA 2ALYB 1EUJA 4H02A 3G4SA 2CWPA 1J6QA 5IYBH 2K75A 4DAMA 1B7YB 1MKHA 1JB7A 2UXBQ 2D0OA 3S1MH 1VQ7A 1YJNA 1CKNA 1A62A 1PA6A 1GM5A 2WB1E 3S15H 1SRUA 2R92H 2VNUD 1CKNB 1X56A 1GO3E 3CCEA 2IX1A 1L1OA 3DM3A 5BR8Q 2RHSB 4LFCQ 3GDEA 3EBEA 4OWXB 4L5QA 3ZJYC 5M5YH 4YWKA 2ZJRA 1IBLQ 1A63A 1BKBA 1G6PA 2NZOA 5M5XH 3PO3H 3PF5A 2Q2TA 3PSIA 4HJ8A 1KIXA 4NB3A 3E0EA 4X64Q 3I4NH 1N33Q 1PH3A 4IOCA 3GTOH 1TXYA 4YY3L 3EIVA 1QVGA 1YBYA 4LF6L 5M3FH 4A4IA 2BA1A 1K73C 1LYLA 4DV4Q 2JA6G 1KL9A 1PFSA 4JI8Q 3HFZB 2WAQG 2K4KA 4JBKA 3G48A 4HJAA 1SROA 2YYZA 3PUWA 4AIMA 3TS0A 4BXXG 1Z9FA 4HIDA 2ZTDA 2UUAL 1RIPA 3H0GH 1WCMG 2VL6A 2I0QA 1WOCA 4HJ9A 3HOYH 4X64L 4TVAB 2IT1A 4DPGA 3F2CA 4A3LH 4LF7L 5IP7H 1L1OB 2NVTH 2PMZE 3MXNB 3RN2A 3GTLH 4DV0L 1Q81C 4LF6Q 1YVCA 1BBUA 1T9HA 3AFQA 4DV6Q 1V9PA 2ZTEA 5C0XI 4BY7H 4DR5L 4TQUS 4A3EG 4AH6A 4C3JH 2PNHA 3B6YA 1Q46A 1A0IA 1GVPA 3K7AH 2R7ZG 2H5XA 2B29A 5C3EG 4OXPA 3RLFA 1JJ2A 3KYHC 3HKZE 4UP9A 1QZGA 2UXCL 3K8AA 5IYDH 2YTYA 1UEBA 2GVBA 4LF5L 2EQSA 4DKAC 4JI3Q 4A3DG 1XPUA 2YTVA
chains in the Genus database with same CATH superfamily
4OIKA 1HNXQ 1OXVA 4LJZC 3ICEA 4LFBQ 3FPUB 2IWHA 4B3SQ 2K32A 2R93H 4K5XA 2PZUA 1TWFB 4H0LC 1E1TA 1ESRA 2B2WC 2XGTA 4K2LA 1VQ6A 4KN7C 4DAYB 4JPBW 3U4VA 2VS1A 1R4PB 2EJFC 5CR3A 4BBSH 2XTIA 2KHSA 4DA2A 1TQOA 4EQNA 3CCQA 3A0JA 1JE5A 5E3FA 3Q8DA 3D4DA 3J81E 5G3LD 3K81C 3PIPA 5BN3A 4LFAL 2X6LA 3ULJA 1Y1VH 2KA7A 1L1OC 3IFTA 2A5HA 4YCWA 5M5WH 5IYDG 2Z6KC 4HCSA 5JOBA 2LFNA 1PH7A 3T1YQ 1JWSD 3RZDH 2PQEA 2NBFA 4JW0A 1U4LA 1CQVA 5HGQA 2D9UA 3J7A5 4LNQA 1NR2A 3PF4A 4IZ8A 1BR9A 4PMWA 1LTBD 3I73A 1V1QA 2JQOA 4KY5A 2IL8A 1Y1VB 2ZJQA 5FKAC 4GLVB 1GKHA 4QF4A 4XTCS 1EQTA 1WFQA 5FLMH 5EPJA 4A3LG 2PQAA 4BBSG 2F0NA 1JE4A 1H9KA 3P20A 4JI5L 3I4MH 1MJCA 3QIAA 2IHFA 4K8JA 1XX8A 1LUZA 5GADC 3RR5A 1DCZA 3EN2A 3KFUA 1IL2A 4H7BA 3I55A 1EOTA 4JI1L 3LGJA 2HUGA 1IW7C 3J81i 2E2JH 2IW3A 1HZCA 3ER0A 2CQOA 3U4ZA 1F2ZA 2OT2A 3GP7A 1B8AA 3FKIH 3VDYA 1CKMA 1HH2P 2E8GA 3K57A 1ILPA 4GN3B 3HOXG 2VUMB 1H95A 2VB3X 2FINB 1Y8OB 3G6JB 1EQQA 1PVOA 2VZAA 1VQFA 1SE4A 2A73B 2EY6A 3NSWA 1IBLL 4X66Q 1ASZA 4L5TA 2DY7A 3CC2A 3L7ZC 1YHBA 4A3MB 1ILQA 1SNQA 1Y1WH 4B9XA 2XRQD 5FO8B 4ABNA 1LT5D 4LAAA 1VQPA 1YNJC 4NDXA 3TRZA 2DY8A 4EQ5A 4IFDG 2PO4A 2R61A 5EKKA 1OXXK 1AEXA 5C44H 4QQBX 1B70B 3A5ZB 4A3GB 4A3BB 3R3OA 5FLXE 4JI7Q 2OF1A 4JI4Q 4KD4A 1Q7YC 1HZBA 4GLAC 3M9BA 3DM1A 1H9MA 1RKNA 2F0UA 1HFGA 2XSCA 2Z4HA 5CORA 3HOXH 5FLXL 4DK1A 5M3FG 4KV6A 5M3MG 4FF2A 4PV1C 4P71A 1VQDA 2JA5G 1EYAA 1TY0A 5DM73 4J15A 4A3BG 4A3GG 4A3FG 1IXRA 4A3KB 4F8MA 1GUNA 1ICFB 5IGEA 2QEXA 1VQOA 4XQQA 2PYKA 2PZWA 1SJHD 1FVIA 5DEHA 3VR3A 1I4RA 1EWIA 2TSSA 2JA5B 3CD6A 5M9OA 4N8X1 4KHZA 4BA2I 2B2YA 4B3MQ 1LTRD 5JJIA 4WJ4A 2FJ2A 2ZM6L 3TEHB 1LO5D 5C4HA 1XMOQ 1W2BA 3WWVA 2F4VL 1YIJA 3I56A 3CMEA 3JAME 2I07B 4B3ML 1VQCA 1PH4A 1SYCA 1WCMH 3BJUA 1WYDA 2K03A 3HOYG 1DOKA 4R8NA 2A6HC 2BH8A 2FXQA 3CPFA 2NZHA 4Y52H 5C4ZA 4JCVE 2K5VA 3K7AB 1CZGA 4OO1G 4QUFA 4YCUA 1A8VA 3F2DA 1J5EQ 4DR1L 1P8LA 1F2MA 1Y14B 1TWAB 3K0YA 3V96A 5GAEC 2C35B 2IX3A 2B8GA 2RSOA 4A3EH 4DNIA 4XQNA 3H09A 3CCUA 2UUBQ 2RHQB 1Z6HA 3HOXB 2VUMG 1E7ZA 5FOBB 2E2IH 3PUVA 5ELCA 1VQBA 4JI5Q 5EPLA 1V8QA 1BUVT 2F52A 3MFGA 4N9PA 1K28A 3M4YA 2L5TA 5JVH3 1CT1D 4J8QA 1TU2B 4ZUIA 2CCZA 4JYAQ 5E4XA 1QILA 2PI2A 1BNZA 5FJ8H 2A19A 4JI1Q 5M5XB 2B2UC 4B3TQ 1W3SA 3Q22A 3K7UC 3J7ZC 4DV0Q 3VA7A 1PRTC 3T13A 3VYTA 1MIUA 3A55A 4N9TA 3GTLB 1TR5A 4IUNA 4UP8A 1BDOA 1PLFA 2JK8A 3J80i 3A56A 3V05A 1FGUA 4IUVA 3NHHA 1WTXA 4DR7L 1WD0A 1D8LA 1PXUA 2HD3A 2QDBA 2R3ZA 4C3IB 4DV1Q 4ME3A 3FEWX 1Q1EA 2QILA 3I4LA 3SK8A 1PYBA 2F0TA 4XT3B 5K36G 5KGUA 2EYFA 2A8VA 4LF8Q 1MSHA 3S2HH 2EY2A 2JA7G 2E2JB 3HOWG 2Q2HA 3JC66 1CQFA 1VQJA 3GTPB 4RHSA 1A6XA 2F03A 1CK1A 5E7NA 2UUAQ 4A3EB 1FGBD 3S1MB 3F1ZA 3CHBD 1HR0L 3NWSA 3VA5A 1S3OA 3ERQA 4IFDJ 4NXNL 3TQYA 2QW7A 4KY6A 1IKLA 1H9SB 2CH4W 4JV5L 3MA2B 1ASYA 2NTTA 4CJ1B 3DMUA 4HIOA 1S5DD 4J1MA 3TS2A 2N55A 5I4DA 4MHEA 1SFOB 1Y8PB 4P2CB 2I46A 4IUPA 3RZDB 2L15A 1XPRA 4LUVA 1WJJA 1U0LA 2GN5A 4GNXB 2HHHQ 4GNXC 2BA0A 1GXDC 3H0GG 4LF5Q 4X66L 3S16H 1PYWD 5C4JB 4AQYL 4XIGS 1E2VA 1EQRA 3SR1A 2MO1A 3CCSA 1UE6A 5IT9L 4QIWB 3K58A 5C4XG 4CDDC 1GUWA 3T1YL 3S17H 1H9RA 4IPHA 1HPCA 3GTPH 5CV4A 1XTCD 4A3KH 1BVSA 2K7VA 3MEHA 1TWFH 4P74A 3VYSA 3CU7A 1O7ZA 2EXZA 2IX0A 5LL6X 5F2DA 1CTMA 5LMUQ 2FMMA 3W1GA 1X55A 4IFDI 5DLQE 4LFBL 4IOAA 5TSSA 2QA4A 4C3IH 4K0KQ 2DNCA 2B2WA 4JI2Q 1HNWL 5C6AA 3G71A 3PV0A 1KDAA 1J8IA 2CWPA 3WDNA 1JB7A 3NBHA 3A8IE 1A62A 1FD7D 4C3JG 1CKNB 1BCPF 1GO3E 4CKEA 2F0MA 3DM3A 2XVSA 2RHSB 1FNVA 2FHTA 1G6PA 1G2TA 5M5XH 4X64Q 1I6HB 4RHRA 1TXYA 1WTHA 4YY3L 1TWHB 3EIVA 1QVGA 3MXPA 2F0LA 3KBXA 2H1EA 3OIPA 3G48A 2HCCA 3PUWA 3KLSX 4HR7B 4BXXG 1F2LA 1Z9FA 4HIDA 3HG9A 1I3QB 2VL6A 1WOCA 4HJ9A 3NE5B 2NVXB 4OL7A 4TVAB 2IT1A 4A3LH 4H44C 3MVVA 4ZCKA 2QKIC 4CDFC 4DV0L 1Q81C 4LF6Q 1BBUA 1KDCA 3AFQA 3D6CA 5D3IB 2EYJA 4C3JH 4MIUA 3K7AH 1GVPA 2B29A 3RLFA 1IYVA 3KYHC 5IYDH 4JI3Q 1I6VC 5AFWA 3QWNA 2B2VC 3R2TA 3CCJA 2K6AA 2CW0D 1EYDA 1RD9D 3R8BA 4JI7L 4ID6A 4JI3L 4XYOA 2RA4A 1RTOA 3LWUA 3CRLC 3SK4A 4YHHQ 1Z47A 3K5MA 3CCRA 1AP0A 1X3FA 1PRTB 4PZ8A 2B39A 1JOKA 3TP6A 4B3SL 4LUOA 2KCMA 1B50A 1LABA 1HRJA 1I4GA 1SBBB 1GHJA 2R7DA 4C3JB 5CV9A 2B63B 2F0EA 5FO9B 1ET9A 4R4IA 4DK0A 2JA8B 3U9OA 1XMOL 2F4VQ 2JA7B 2RF4A 2ZTCA 4DNRB 1QUQB 4A93H 2JA9A 2NVXH 2ICIA 5LMNQ 4DV3Q 1SDFA 4OX9L 4L8JA 1SNPA 3GD7A 4X62Q 1JT8A 1NBWA 1BCPB 3L0OA 2KENA 2K5NA 3E9HA 3HOZH 1STYA 3NP8A 3TN2A 3VR6A 2EIFA 1TWHH 1IBKL 4A3BH 4A3GH 5LL6S 4GKKQ 3OW7A 4X62L 4HIKA 1MI2A 1AH9A 3OIQA 4FXGC 5IP7G 3K5NA 1VQ8A 3OTOQ 1AZPA 1IHZA 4XDXA 2N3SA 1UE5A 3FPPA 1YZ6A 2OQKA 5JEAH 1QUQA 1FR3A 5I6YA 3TP5A 3VR2A 3HOVG 3H6MA 4POGA 2NWGA 4XYQA 3D4WA 4K0KL 1NNXA 3OWEB 3W2DA 5CGKA 3BVZA 4WRDA 1JR0D 3KUPA 2O5IC 4OGQC 4RG1A 2FMCA 1F77A 4ILWA 4A3CH 2CFMA 5KEEA 4K2KA 1DD2A 4QY7A 3ND9A 4IPDA 4PZ6A 3HOVB 4JOIA 3S1RB 1Q86C 3S1QH 1HA6A 1U4MA 1UWVA 2EJGC 3E0JA 1U9RA 1WI5A 3G7LA 4ULLA 4RCNA 1EY6A 1VQ9A 1KHIA 2CWAA 1AFPA 4YIJA 4LFAQ 3BZDB 2WKDA 4A3IB 3S15B 1M90C 3QO2A 1PFNA 4M8AA 4OWTB 4RGMA 2UU9Q 1KAWA 4X3SA 4ZRZA 3FDTA 4R1JA 5C4JH 5DM63 4ZQ3A 1HNZQ 4B3RL 1TY2A 5IT9E 4HJ5A 4C2MH 1LV9A 3HP3A 4P75A 4YY3Q 4A75A 3BU2A 3KF6A 3GTKH 2D62A 1H9JA 4C3HG 5K5PA 2B63G 1XNQQ 2TMPA 1W6JA 4BBRG 4PG3A 2JA6H 3KDFB 1PH5A 1ENAA 1F9QA 1XJVA 3X3MA 2PNRC 3OOCA 4TRDA 4LK1C 5IGDA 2MJ8A 2QDLA 3EVQA 3D4RA 1LTGD 3A7LA 3TDQA 1XPOA 2R6GA 3S24A 4DF7A 4FXDA 2OWOA 4DR2Q 2N88A 5I2XA 3CCVA 3HOUH 2P5ZX 5M3FB 5ELNA 3E6ZX 1XTDA 2XRSD 1Y69U 4ALPA 1PH9A 1C7YA 1STEA 3WOFA 2A74C 2PQAB 4UPAA 2NN6H 2F0QA 1PTOD 4EQOA 4POFA 4A3DH 1PRTD 4A3JB 4DUZL 4DV4L 4DK6C 3BDCA 1CSPA 3QG1A 2EXDA 3UE0A 2R7ZB 4C3HH 2B2YC 2LXJA 3CQZH 4I7AA 1YI2A 4HN7A 3BZKA 3M3YB 4UY8C 3J80c 3SHLA 1NE3A 4KK7A 2EZVA 5LHY1 2F0JA 5BN5A 4MTKA 4FF1A 4BY7B 5AJ3Q 4A3MG 2HQLA 1BOSA 5IWAQ 1LT6D 4UDUC 3NPPA 4DV1L 4RWSC 4GKJQ 1B1ZA 4BY1H 4QGUA 1STNA 1VF7A 3GTMB 3MC0B 1C4QA 4M1UB 1STGA 1VQHA 1EEID 3PIP3 3GQBA 2IHEA 3IAYA 3OTOL 4QIWE 4LF4L 1V1OA 4JI8L 4DU9A 4DUYQ 2JP1A 1KXLA 2NUCA 1G51A 1N9WA 2UXDL 3I4OA 2UUBL 3MAQA 5EAYA 1C9OA 3OW2A 1O7LA 1STHA 4MZ9A 3HZXA 4FF4A 3KDFA 4KJNA 5EGTA 4DN4M 3A54A 3J81L 4FYDA 2I5MX 1NAPA 3UDIA 2NVTB 3RZOH 2MO0A 4TKOB 1XNRL 1F9SA 2KBNA 3NWTA 5T1IA 1CSQA 2AHOB 1JJCB 1S5ED 4FDBA 3STBD 3KJPA 2K5WA 3PO2G 3LNNA 5CV8A 1O80A 2UUCL 2Z9HA 2EYOA 5IGBA 5E1FA 3AFPA 5I9OA 4DGZA 3AYHB 2LY7A 3HOZG 1X3QA 1I5FA 2AWNA 1C8CA 1IBKQ 5C4XB 1WD1A 4CDEC 4IUQA 2F3IA 5GAGC 2DNEA 5C3EB 1NMFA 4GOPA 3UI2A 5C4XH 1TS4A 3RLNA 2QGQA 3I91A 3J80L 4L5SA 3DWAA 3S14H 4RGOS 4XQJA 3LX0A 3Q0AA 2OTJA 1LACA 1G291 2RDFA 3MXGA 1YHQA 3D3RA 1D5ZC 4EVOA 1NSNS 1I4QA 3MEFA 1HUNA 3PO2H 4A3CG 2Q2IA 2HQEA 1YJWA 2K28A 2M9VA 1VCIA 3D0FA 2SOBA 4KD3A 4RKBA 1EY0A 5FLMG 5H1SE 2JJQA 4KY7A 5JEAJ 4HMJA 2E5LL 2E76C 1BBWA 2L12A 4OONA 3J80E 3FMCA 1EOVA 1FJGQ 1XMQL 5FO7B 2QEJC 5CBAE 1Y1WG 1P16A 4DAPA 3KF6B 1MSGA 3DWQA 4G57A 3DEPA 3N6RA 1YHAA 1Y8NB 3HOWB 2E5LQ 1E24A 4Q5VA 3I2ZA 1CHPD 2WKCA 4PZ7A 3IRBA 3NTHA 1VQIA 4DV5L 2DN8A 2PPBC 3PCOB 5KNDA 1STBA 3GTGH 1PZID 5EBCA 2BDOA 1KAAA 4O1NA 5KYLA 3NQIA 4O2DA 1EY5A 1NJIC 2QF7A 1EY7A 5C0XG 3M4OH 4DV3L 4OX9Q 5M3MH 1OTCA 1IL8A 3E5SA 2NTSA 1KLGD 1F9PA 4A3FH 2ZXRA 1KRTA 1J6QA 5CMDA 1SE3A 1B7YB 4OEMB 4ZUJA 1VQ7A 3RUZA 1PA6A 2R92H 1ET6A 4RAUC 1SYBA 3OHXC 2KOLA 3EBEA 3GDEA 4OWXB 4ZKCB 5M5YH 4YWKA 2ZJRA 1GUGA 1EIHA 1BKBA 3PO3H 3VYUA 3PF5A 1A15A 3PSIA 1KIXA 2ZXOA 5D3DA 1PH3A 3R2IA 1EL0A 5IGGA 2B2TA 1F9RA 5M3FH 2BA1A 1LYLA 4DV4Q 1R9TB 1PFSA 4JI8Q 2OEOA 2K4KA 4IQZA 1SROA 3EJIA 3BDOA 1RIPA 3KK7A 3CRKC 2O5JC 1SAPA 3DWPA 5CV5A 1TKWB 4LF7L 1TT2A 4K6LA 4N8FA 3SXHA 5IP7H 4G7HC 3RN2A 1G6ZA 4ZLTF 4KN4C 1GOZA 2WACA 2HDMA 1PRTF 1BF4A 4RA8A 4OO1H 3MTSA 1I4HA 1Q46A 1A0IA 3B6YA 2R7ZG 1JWMD 2H5XA 3SEBA 5C3EG 3GTKB 1JJ2A 1S5CD 1QZGA 1UEBA 4LF5L 4U68A 1B9NA 3VR4A 3AMUA 2A68C 4AYBG 4OHJA 1AZQA 2J4XA 2G5DA 2WAQB 3A7AB 4KJOA 5HY6A 3A8KE 3J7YW 3C1EA 1EZ6A 3DLLA 2R92B 4DXGA 5D65A 2B2VA 3URYA 3PIO3 4NXML 4CJ2C 2OCEA 1V1PB 2DGYA 2O2LD 4DV2Q 4ZK9B 1U4PA 1LM0A 2KQ3A 3P75A 4S3SA 3RN5A 4A3FB 5EKIA 3S2DB 1D6EC 5C3WA 1UE1A 3S1QB 5IGFA 1PTOH 4RH6A 5M3MB 3T1HL 2KCCA 2GVAA 1JOQA 2EE1A 4X65L 2QCPX 3PUZA 1B9MA 3C3LA 2C5CA 2Y0SE 4GLXA 2NVYB 4K6DA 3TSSA 2JN4A 1S40A 1J5EL 1Q12A 1ENCA 3MZ5A 4R9WA 5KYIA 1JICA 2NVYH 3ITPA 3NTIA 3KF8A 4R4TA 1HHVA 3TZUA 3I7FA 4U673 3OWFA 2CH4A 1SMXA 5EKLA 1IBML 5D14A 1K8MA 2D5DA 4EQPA 4PQXA 4KTAA 1K8OA 2L1BA 2SNMA 3ONAB 3AEVA 1KNEA 2WINB 4R4OA 4BY7G 5KRUA 1N33L 1MHWC 4B3TL 3HEJA 5GROA 2WAQE 4C56C 4DR3L 5JPNC 1II3A 4OIJA 2LKVA 3T4AC 1KDBA 2JEBI 4JG2A 1YNXA 3ULPA 1C0AA 3I72A 3TZDA 1X65A 3H0GB 4CGYB 2JA7H 2K52A 5J22A 2A1AA 3FP9A 4LW1A 4X3UA 2L11A 2IPKD 1OXSC 4K5WA 4IPCA 1KLUD 4DK3C 1UNSA 1EIYB 3GTOB 4OELB 3OPOA 1HQMC 1DGSA 1GD7A 2PMZB 3DUZA 3I4NB 2WV6D 4QL5A 2AUJD 1R4QB 5IGCA 1E1OA 3SK6A 3RLOA 2AKWB 1Y1VG 2RSNA 4BY1G 4H13C 4FF3A 1JWUD 1BO0A 4DV6L 2Z1CA 3DHQA 1SNCA 4RCOA 4BBRB 1PH6A 1M8AA 2FFKB 1PH2A 1SSOA 2ZM6Q 1QVFA 5L37A 3PO3B 3UE1A 1QG7A 4HSVA 4MN3A 4L6TB 1EU3A 1PHJA 4DNTB 2AQ1B 4LUZA 1QB5D 4G4KA 4X3KA 2M00A 2UU9L 3GTJB 4GZYC 2IJ0A 4KHVA 3UDXA 3GV3A 4GN4B 3T51B 5BN4A 3NBIA 5C5LA 2NVQH 1Q1BA 5COYA 4A76A 4KKSA 4DR1Q 3GO5A 4O42A 1XXGA 2K50A 3W5OA 1WTPA 4Y7NH 2E2HB 2WB1G 1QOHA 1AN8A 3OMGA 1SEBD 4EX5A 4APVA 1UEAB 2BDNA 3HGBA 2Z0SA 3JAMc 1CKOA 1XNRQ 4QUCA 1LT4D 4FXKC 1LTSD 3OYYA 2A6ED 5FK9C 1QVCA 4BWGB 4JI2L 4UAIA 4XXEA 3V2TA 2ATWA 4BY1B 4WJ3M 4R8IA 1B3AA 2LMCB 3U50C 3A8JE 4BXXH 3CP0A 1PMRA 4Y7NB 1WTVA 2E2HH 5GAHC 1EYCA 3RMHA 2VW9A 1UE7A 4WFN3 2YTXA 1WTRA 2F0KA 4GN5A 2HIVA 4JI6L 5CV6A 5HURA 1X32A 1HUMA 2JXMB 1DJRD 1FJGL 4RGNA 1WTQA 3L9AX 2EJMA 1BQQT 1LLRD 1NTGA 1MJEA 2ID0A 4I65A 3HOYB 4KMUC 3OSOA 1EWCA 4WJWA 1SNMA 4LF9Q 1B44D 1JMCA 1BCPD 2CW0C 3E3XA 2R93G 2B2UA 2J7ZA 4A93G 2UXBL 1EIFA 1X3EA 2Z6KA 5EPKA 3R93A 3KLRA 3STBC 1UAPA 1G91A 3J7AF 2EPBA 3S14B 1ZKOA 1SLJA 1VQNA 1HTPA 3JAML 2ASBA 3K5OA 3Q24A 3PQIA 4V190 1A2UA 4IO9A 1JB3A 1HFNA 4IUUA 3L2PA 3BZCA 3I70A 2NZ1D 3S16B 3AB9A 4DXFA 1VMPA 2EYLA 1QCBD 3DEOA 4JI4L 3I90A 3VYRA 1N8RC 1PTOF 3BYYB 3D31A 1I50B 3M7GA 1SN8A 3RNUA 4DR4Q 3S1NH 4HSPA 1SXTA 4JC0A 4L63B 4C2MB 5JVG3 1ZXTA 3BYTB 3PGZA 5ELDA 2MP1A 2VQFL 4OWWB 1SNOA 2JEAI 4R4CA 1K83H 2DUDA 2SNSA 1Q82C 5C0XH 3CXCA 1SYEA 4AYBB 5IP9H 1U4RA 4DR7Q 3W3AA 3H91A 4HIMA 2XWBB 2MUYA 1I4PA 5M5YB 1ML0D 1PZJD 2A69C 3D6WA 3I4MG 1IKMA 5G3LF 5ELBA 3MXNA 3M4PA 5AJ3L 2L9HA 1QNKA 1YNND 4HMIA 2R92G 4JK1C 3S2HB 1H9SA 4YHHL 3H3VH 4IN3A 5HGTA 3HOVH 2B8FA 2MFIA 3NEMA 3KOJA 3CF5A 2R7FA 3T53B 2X69A 2VQEQ 1GUSA 5GQOA 1TWCB 1TWGH 3IKJA 4DR5Q 1N34Q 2YU9B 1EZ8A 1PTOC 1TWGB 3NK9A 3QOJA 4NXMQ 1ZEQX 1TWCH 1YEZA 1IZ6A 3AQQA 3H3VC 5IP9G 2HT1A 3UDFA 2KHJA 1EY9A 1OXTA 5I2YA 1PTOB 1HNWQ 3F8TA 2K5QA 3CW2C 3CC4A 1SE2A 3O13A 2K05A 1K3RA 3T1HQ 2F0OA 1LTID 5JPMC 3SK5A 1HA5A 1TS5A 5IYCH 1HR0Q 2EYPA 1NR4A 1V1PA 4IJLA 2R7ZH 1VQ4A 2F3WA 4RMFA 1EEFD 4HTHA 2AQ2B 1RL2A 4OO1I 4LWCA 1D7QA 1E2WA 1WTOA 3GTQH 3HOUG 1SYGA 4P72A 1RODA 3X3NA 2F3VA 4JBMA 4R4QA 3IL8A 5K36H 1HQRD 2A6EC 1A3UA 2ICEC 1IYUA 1GUOA 4JI6Q 2N78A 4MTNA 4RKLA 3CCMA 2K1BA 5LMNW 1VQ5A 5IY0A 1N36L 2JA8H 1BXTA 3BG3A 1ONLA 5JAVA 2M2LA 3IFDA 4DV5Q 4BBRH 2B63H 1I4XA 1E22A 2ZJPA 3P7JA 2B3GA 2F0DA 2L55A 5EBDA 2K75A 4DAMA 1MKHA 1O78A 2UXBQ 2D0OA 1CKNA 1GM5A 2WB1E 4CDCC 1KTKA 1SRUA 2VNUD 1A3VA 3D8GA 3CCEA 4QB4A 3ZJYC 4L5QA 2Z8LA 1K0SA 2F4IA 4FO2A 4HJ8A 3EFXD 1QNUA 3E0EA 4CJ0B 3I4NH 1EQVA 3BDLA 3GTOH 1S4ZA 3NXWA 1RJTA 2XNAC 4G7OC 4LF6L 3HKZB 5CYUA 2Z4IA 4A4IA 1C48A 1JC7A 2K04A 1KL9A 2JA6G 3J7AV 3HFZB 2EYHA 2VB2X 4HJAA 2YYZA 3TS0A 1CA6A 2UUAL 2ZTDA 1CFMA 2MHVA 3H0GH 5NUCA 3C46A 2I0QA 1G2SA 3T16A 4CKCA 4X64L 3HOYH 4DPGA 1A3TA 1DOLA 5IIFA 1L1OB 1RF2D 2NVTH 3MXNB 2KVMA 3CKIB 1T9HA 4DV6Q 1V9PA 2ZTEA 1CA5A 1ENFA 1DZ1A 4TQUS 5C5MA 1BBXC 4AH6A 3BS1A 2PNHA 1MBYA 4K5VA 4OXPA 2RDGA 2E75C 1Q8IA 3M4OB 1PDQA 2RDHA 4DKAC 4NW2A 4JVZA 3WOEA 1XPUA 2YTVA 1O7IA 1XMQQ 2HIXA 1I6HH 4DV7Q 1E2ZA 2RQXA 3E9IA 5FJ8G 1MGSA 1I94Q 1S5BD 5IODA 3GTMH 1F2YA 4C3IG 1GJXA 3KJOA 4GKKL 4JOIC 3F2UA 1PFMA 1HZ9A 4GOPB 4DV7L 4X3TA 4JBJA 4A3MH 3HOWH 2D2CC 1T5EA 5LMNL 4K14A 5IYBG 4KLKA 1I94L 3NBHB 2Q8IB 2A6HD 2NVQB 3PMFA 3JAMi 3S2DH 3SVMA 3BVGA 4HEDA 3FHWA 1LTAD 3HOZB 2VUMH 3CC7A 1HZAA 4JI0Q 2PCFB 1E3PA 1MD2D 3GTJH 4NXNQ 2KJXA 1PYSB 3I8ZA 3FKIB 4KKUA 5IWAL 4UHVA 1KD1C 1B3QA 3PO2B 2F0SA 3TBIB 4A3JH 1PV4A 1S72A 4DFAA 1NUCA 5ELOA 1YNJD 3EA6A 1DONA 1CI3M 1D1KA 1EY4A 3Q23A 2WP8J 1VQEA 3HRZC 3M7NA 3S17B 4CHTB 3H15A 4GOPC 2CVRA 4DUYL 3HOUB 1HTLD 4FP5D 2KHIA 1RHPA 1VQMA 3CAMA 2XN9C 3SE0A 2AUKA 4AQYQ 1T5XD 2DJFC 1N36Q 1PFBA 5JJKA 5C0XJ 2NN6I 4DR6L 1X6OA 3OMCA 4IPGA 3S9WA 3ULLA 1K9MC 1NCVA 4F87A 1IBMQ 3GV6A 3Q6SA 1YJ9A 2EYMA 4NKLA 1Q3LA 2DJGC 3FRPB 1RTNA 1HNZL 4B3RQ 1VQGA 2PW7A 1VQAA 5BR8L 2V1CC 4LF7Q 2E2DC 3NQTA 4A3JG 2F0GA 2F0PA 2BE5D 1R9TH 2N8NA 1TS3A 3SGIA 1QZHA 4NPSA 1K3BC 2F0WA 3MXUA 1EYGA 5CBEE 2PI2E 2AMCB 4O0AA 1KNAA 2MPMA 3GTQB 4BBSB 2ZXPA 1OXUA 2CKZB 4X6AH 1NY4A 1V43A 2K5HA 5IYCG 1I3QH 1LTTD 2MGSA 1DM0B 1X54A 5ELEA 2K01A 1SYDA 4YCVA 2JE6I 2KECA 1AE2A 5ELFA 4Z9CB 4A3KG 4L5RC 2XIWA 2L4NA 4CBVA 4NMZA 1FYCA 3S1RH 3VR5A 4EGVA 3FKIG 1YNNC 2LS01 1KRSA 4KKTA 1IYJB 1EFWA 3TP7A 4DV2L 2OTLA 1VF5C 2A69D 4TSSA 1D5XC 1IW7D 1PZKD 1D5MC 2AQ3B 3HKSA 1HNXL 5C3XA 2YU9H 4FVMA 3ZYYX 1FL0A 1YITA 2PZTA 4G7ZC 1HR0W 5I9PA 4X65Q 4KHPQ 1JCKB 2EY5A 3T56B 4KI0A 4UP7A 4LF8L 2BE5C 1JJGA 3U9SA 2HDLA 3M3YH 4YWMA 3W1BA 5IOCA 4KHPL 4DAVA 3CQZB 4C3HB 5E4WC 3PO3G 2L0CA 1XYIA 3I3CA 2IY5B 4HAEA 4A3DB 1VS0A 1HXYD 1X3GA 2E2IB 2LSSA 2ZT9C 3AU7A 2CQAA 2NYZD 3G6EA 4RFBA 2VQEL 1K83B 2EY1A 4IALA 3PUYA 1K8AC 4A93B 2K5DA 2F0VA 1CUKA 1AW7A 5J3BA 3KF8B 1TWAH 2VY3A 5T1GA 1SMYC 4A3IG 3C1FA 4PMBA 3TMEA 3MHBA 4NP5A 1N32Q 2Q2UA 3ERSX 3S1NB 1I50H 4LF4Q 1BCPC 2BH2A 1WCMB 3CPWA 4GS3A 4K8IA 1A2TA 3LWEA 2XWJB 5CC4A 3NENA 1SNDA 2B2TC 2BOSA 2JA6B 5C3EH 2UXCQ 1GHKA 2GA4B 1RCVD 3HKZG 2SDFA 2WFWA 5ISRA 4ME5A 1SFOH 1FNUA 5JJLA 3NUCA 3CMAA 2K33A 1CZWA 3J81c 1CHQD 3EROA 4DUZQ 2RBMA 4BA1I 3QR8A 4DAYA 3PUXA 2V4DA 4LFCL 3A74A 2JA5H 1K8GA 2Q8TA 2N49A 4GNXA 1W6KA 1D2BA 1EY8A 2HCIA 2OXPA 5FLXc 4PMCA 4A3IH 1VQKA 1TIID 2WB1B 4IURA 1M1KC 1X9NA 3RZOB 3HS0C 1L0WA 3PIOA 4JI0L 2ENBA 1VDZA 1JOOA 1U5KA 3QJYA 5I6WA 2Y0SG 2NN6G 1S5FD 1STAA 3F2BA 3K59A 3M4QA 2EVBA 3H3VI 5LMUL 1TS2A 4JBWA 5C44B 1LTLA 2JA8G 1Q90A 1TVXA 1X3PA 4IJHA 3GTGB 5IE8A 4DR4L 4JV5Q 3K6OA 1JQYD 3KLSA 1CM9A 2EOTA 3K80C 1L2FA 4B08A 1KC8C 3P1HA 4FNFA 1KQSA 3C2PA 2D0PA 2JYOA 1EIGA 2VQFQ 5JEAG 2E74C 1M4VA 5KNCA 1LT3D 1DOMA 3RD4A 1NMGA 2VXWA 2HHHL 4BS9A 5KIXA 4DR6Q 1HCZA 1SYFA 1PH8A 2G9HD 5A2QL 5A2QE 2I5LX 1XNQL 2RCNA 3NELA 4J6HA 3I4NG 4C1NI 2KCTA 1UUPA 2ES2A 3BVMA 2Z6BA 1EWHA 4Q0FA 2UUCQ 2WIIB 3A5UA 2X6GA 1PH1A 2Q8RE 2NB0A 2PW5A 4E6IA 1XWEA 2LXKA 1QWYA 4QJFA 2AWOA 1ZYRD 2H4OA 5KNBA 4MNOA 2BCOA 3MFYA 2I5HA 3N52A 5J1ZA 3MWYW 4AYBE 1KABA 1JORA 4GKJL 3TREA 2KCNA 3H94A 5CV7A 1EU4A 4HJ7A 3I4MB 4LF9L 4HCEA 4V0BA 1WVLA 1N34L 1SE8A 1B2TA 5IT9c 3K0XA 2K14A 3UDGA 1ESFA 4IFDH 3QOLA 1D1IA 4IUTA 3M85A 5C44G 2MNAA 1VQLA 1ZYRC 5DAUA 4QMGA 3J81j 4DR2L 5EQ0A 4C1NK 1L0YB 1WTWA 2RKSA 3KLWA 4I7ZC 5EJWA 1OO9B 4B9WA 2Y0SB 1N32L 4YWLA 2UXDQ 2F0HA 2OQ0A 1ICWA 2YV5A 2SEBD 1SR3A 5M5WB 4DR3Q 1HJPA 5J39A 1K0RA 1B53A 1AE3A 3CCLA 2A68D 1RDPD 3U58A 4P73A 2MQHA 2JSOA 1Q8KA 4JYAL 1DYQA 2RVLA 3FVQA 2ALYB 4ZKBB 1EUJA 4H02A 3G4SA 2J0TD 5IYBH 3S1MH 1YJNA 2O4XA 3KBGA 3S15H 1O7YA 1X56A 4CKBA 2IX1A 1L1OA 5BR8Q 4LFCQ 1B4OA 1A63A 4LMQD 1IBLQ 1J9OA 2NZOA 2C9OA 2F0IA 2Q2TA 4NB3A 1N33Q 4IOCA 2R93B 1GUTA 5JJZA 4F7XA 3L3OC 1SJED 2F0FA 1YBYA 1G8ZD 1K73C 3TP8A 4ZYSA 4JBKA 2WAQG 3QB3A 2F1MA 3DXJC 4RGTA 4AIMA 4F88A 1SMYD 1WCMG 2EDGA 4ODGA 3EQLC 1QJOA 3F2CA 2KUMA 1E0BA 4WORA 4ZAIA 2CHBD 1Z7TA 2PMZE 3GTLH 1Y1WB 1YVCA 4XT1B 2G9DA 5DNFA 1QE6A 1FNWA 3K5LA 1L0XB 5C0XI 4BY7H 2RCFA 4DR5L 4A3EG 3SDZA 2KEEA 3ND8A 4PNYA 1DXMA 3NTKA 3HKZE 4UP9A 2UXCL 3K8AA 4QCLA 2YTYA 5A35A 2GVBA 1VMCA 2EQSA 1EFID 2KEDA 4A3DG
chains in the Genus database with same CATH topology
1O7IA 3CCJA 4AYBG 1HNXQ 1OXVA 3ICEA 1XMQQ 4LFBQ 2HIXA 4B3SQ 2R93H 1I6HH 1E1TA 4DV7Q 5HY6A 4DR6L 3E9IA 2XGTA 4JI7L 1VQ6A 5FJ8G 4DAYB 1I94Q 4JI3L 3U4VA 2VS1A 3GTMH 3KJOA 3DLLA 4BBSH 4GKKL 4JOIC 2XTIA 4YHHQ 1HZ9A 1Z47A 3CCRA 4GOPB 3CCQA 1X3FA 4DV7L 4NXML 3A0JA 4JBJA 4A3MH 2OCEA 4PZ8A 1JE5A 2DGYA 3HOWH 4DV2Q 5LMNL 3Q8DA 5IYBG 4KLKA 2KCMA 4LUOA 3NBHB 1LM0A 1I94L 4B3SL 3RN5A 2R7DA 3K81C 3PIPA 1UE1A 3JAMi 4LFAL 3S2DH 3ULJA 1Y1VH 1L1OC 3FHWA 4R4IA 3T1HL 2GVAA 2VUMH 3CC7A 1HZAA 4X65L 1XMOL 3PUZA 2F4VQ 4YCWA 2RF4A 2ZTCA 2Y0SE 5M5WH 5IYDG 2Z6KC 1E3PA 4GLXA 1QUQB 4JI0Q 3GTJH 4NXNQ 1PH7A 4A93H 3T1YQ 1PYSB 1S40A 2JA9A 1Q12A 5IWAL 5LMNQ 4DV3Q 1KD1C 1J5EL 2NVXH 4OX9L 3RZDH 2NVYH 4A3JH 1PV4A 3GD7A 4X62Q 5HGQA 4R4TA 1S72A 1NBWA 3J7A5 4LNQA 1JT8A 3L0OA 2KENA 5ELOA 3PF4A 2K5NA 3E9HA 4PMWA 3I7FA 3HOZH 1V1QA 2JQOA 2WP8J 1VQEA 2ZJQA 3M7NA 2EIFA 1TWHH 4Y52H 1IBKL 1SMXA 4GLVB 4A3BH 1GKHA 4XTCS 5FLMH 3H15A 1WFQA 4GKKQ 4A3GH 1IBML 4X62L 4HIKA 4GOPC 4A3LG 2PQAA 4DUYL 1AH9A 4BBSG 5IP7G 1VQ8A 2KHIA 4JI5L 3OTOQ 3I4MH 1VQMA 1MJCA 3CAMA 3AEVA 2N3SA 1UE5A 2IHFA 4AQYQ 1YZ6A 2OQKA 1LUZA 4R4OA 4BY7G 1QUQA 5GADC 1N33L 3RR5A 3EN2A 3KFUA 4B3TL 3HOVG 5GROA 2WAQE 1N36Q 4POGA 1IL2A 3I55A 5JJKA 5C0XJ 2NN6I 3LGJA 1X6OA 4IPGA 4JI1L 3J81i 4DR3L 3ULLA 3ER0A 1HZCA 3U4ZA 2CQOA 1K9MC 2E2JH 1IBMQ 4K0KL 1YJ9A 1B8AA 3FKIH 3VDYA 2JEBI 1CKMA 1YNXA 4JG2A 4RG1A 3ULPA 1HNZL 4B3RQ 1VQGA 1HH2P 1X65A 1VQAA 2E8GA 5BR8L 4A3CH 2V1CC 2CFMA 2JA7H 4LF7Q 4GN3B 2K52A 3HOXG 4A3JG 1H95A 4QY7A 2A1AA 3FP9A 4IPDA 1R9TH 4LW1A 2N8NA 4PZ6A 1OXSC 4JOIA 1Q86C 1EQQA 3S1QH 2VZAA 4IPCA 4NPSA 3SGIA 1QZHA 1PVOA 1VQFA 4DK3C 4B3TQ 1UWVA 1ASZA 1IBLL 4X66Q 1EIYB 4L5TA 3CC2A 1WI5A 1EYGA 3L7ZC 1DGSA 1GD7A 2PI2E 2AMCB 4O0AA 1YHBA 4QL5A 1Y1WH 1VQ9A 1KHIA 1E1OA 1VQPA 1OXUA 2CKZB 2CWAA 4X6AH 1NY4A 1V43A 2K5HA 4LFAQ 3TRZA 5IYCG 1I3QH 3RLOA 2AKWB 1M90C 1X54A 4EQ5A 1Y1VG 4IFDG 4YCVA 1OXXK 2JE6I 1AE2A 4OWTB 4BY1G 4A3KG 4L5RC 5C44H 2UU9Q 4QQBX 1KAWA 1B70B 3A5ZB 4DV6L 4JI7Q 3S1RH 4JI4Q 1Q7YC 4R1JA 1HZBA 4GLAC 5C4JH 3M9BA 1HNZQ 3FKIG 1PH6A 4B3RL 1KRSA 1PH2A 4HJ5A 4C2MH 2ZM6Q 1IYJB 1EFWA 1QVFA 4P75A 4DV2L 4YY3Q 2OTLA 4A75A 3BU2A 3UE1A 3KF6A 3GTKH 3HOXH 1PHJA 2D62A 5M3FG 5M3MG 2B63G 4LUZA 1XNQQ 4BBRG 3HKSA 4P71A 1VQDA 1HNXL 4PG3A 2JA5G 3KDFB 2UU9L 2YU9H 2JA6H 1PH5A 1FL0A 4J15A 1YITA 4A3BG 1XJVA 4A3GG 4A3FG 3UDXA 1HR0W 4X65Q 1IXRA 4KHPQ 4GN4B 4KI0A 4UP7A 4LF8L 2QEXA 1XPOA 2R6GA 1VQOA 1Q1BA 3S24A 2NVQH 1JJGA 4A76A 4DR1Q 2OWOA 3GO5A 4DR2Q 1FVIA 2K50A 3W5OA 3M3YH 4YWMA 4Y7NH 3W1BA 1EWIA 2WB1G 3CCVA 3HOUH 4KHPL 3CD6A 5ELNA 4EX5A 4APVA 4KHZA 1XTDA 1PH9A 4BA2I 4ALPA 2Z0SA 4B3MQ 3JAMc 1C7YA 5JJIA 1CKOA 1XNRQ 3PO3G 4WJ4A 2PQAB 2IY5B 3OYYA 4UPAA 1VS0A 1X3GA 4POFA 1QVCA 2LSSA 2ZM6L 3TEHB 4A3DH 4DUZL 1XMOQ 1W2BA 4JI2L 3WWVA 4DV4L 4DK6C 3G6EA 1YIJA 2F4VL 1CSPA 3I56A 3CMEA 2VQEL 2EXDA 4B3ML 2ATWA 4WJ3M 3UE0A 3PUYA 4C3HH 1K8AC 2LXJA 1CUKA 3U50C 5J3BA 4BXXH 3KF8B 3CQZH 3CP0A 1VQCA 1TWAH 1PH4A 2VY3A 4A3IG 1WCMH 1YI2A 2E2HH 3BJUA 3BZKA 5GAHC 1WYDA 3HOYG 4UY8C 3J80c 2BH8A 3CPFA 2FXQA 1NE3A 2NZHA 2VW9A 3ERSX 2Q2UA 4JCVE 1UE7A 2K5VA 2YTXA 1N32Q 4GN5A 2HIVA 4OO1G 4JI6L 1I50H 5AJ3Q 4YCUA 4LF4Q 2BH2A 1A8VA 3F2DA 2HQLA 4A3MG 5IWAQ 4DR1L 1J5EQ 1P8LA 3CPWA 4DV1L 4GS3A 1Y14B 5GAEC 4GKJQ 2C35B 1FJGL 4A3EH 3NENA 4DNIA 4BY1H 4QGUA 5C3EH 1NTGA 3CCUA 2ID0A 1MJEA 2UUBQ 2UXCQ 3HKZG 2WFWA 2RHQB 2VUMG 1E7ZA 1VQHA 4LF9Q 1JMCA 2E2IH 1SFOH 3PUVA 1VQBA 2IHEA 2R93G 3OTOL 4JI5Q 5JJLA 2F52A 3CMAA 4A93G 4QIWE 3J81c 4LF4L 1EIFA 2UXBL 4JI8L 4DUYQ 4DUZQ 1X3EA 1KXLA 2Z6KA 2CCZA 4BA1I 4JYAQ 1G51A 3PUXA 1N9WA 3STBC 2PI2A 4LFCL 3A74A 1SLJA 5FJ8H 2A19A 2JA5H 2UXDL 3I4OA 1K8GA 2UUBL 1VQNA 2N49A 4JI1Q 4GNXA 2ASBA 5EAYA 1C9OA 1W3SA 3K7UC 5FLXc 3J7ZC 3OW2A 4A3IH 1VQKA 4IO9A 4DV0Q 4MZ9A 3KDFA 3L2PA 3BZCA 1M1KC 1MIUA 1X9NA 2I5MX 3UDIA 1L0WA 4JI4L 3RZOH 2MO0A 4UP8A 1XNRL 2JK8A 3J80i 3PIOA 3D31A 1FGUA 1N8RC 1C0AA 2KBNA 1SN8A 3RNUA 4DR4Q 4DR7L 1D8LA 4JI0L 3S1NH 1U5KA 1CSQA 2AHOB 4JC0A 4DV1Q 1JJCB 4ME3A 4FDBA 2Y0SG 1Q1EA 3STBD 3KJPA 1PYBA 3PO2G 5K36G 2NN6G 3PGZA 2UUCL 2A8VA 2VQFL 4OWWB 3F2BA 4LF8Q 3M4QA 2JEAI 4R4CA 3H3VI 1K83H 5LMUL 3S2HH 2JA7G 3AFPA 2DUDA 4JBWA 1Q82C 3CXCA 1LTLA 2JA8G 3AYHB 4IJHA 5IP9H 3HOZG 5IE8A 4DR7Q 4DR4L 1I5FA 2AWNA 1IBKQ 4HIMA 4JV5Q 3HOWG 2Q2HA 3JC66 1VQJA 3K80C 3I4MG 1L2FA 2F3IA 1KC8C 5GAGC 1KQSA 1NMFA 4GOPA 2D0PA 2UUAQ 3M4PA 5E7NA 5AJ3L 5C4XH 2VQFQ 5JEAG 3RLNA 3F1ZA 2QGQA 1HR0L 2R92G 1S3OA 4L5SA 4IFDJ 3S14H 4NXNL 3TQYA 4YHHL 1NMGA 3H3VH 2HHHL 4JV5L 4DR6Q 2OTJA 3HOVH 1PH8A 1G291 2MFIA 3NEMA 3KOJA 3CF5A 2I5LX 1ASYA 2R7FA 1XNQL 2RCNA 3NELA 2VQEQ 4HIOA 1YHQA 3I4NG 3TS2A 2KCTA 2ES2A 5GQOA 3MEFA 1TWGH 2UUCQ 3PO2H 2L15A 3A5UA 4LUVA 4DR5Q 2Q2IA 1WJJA 1XPRA 1PH1A 1N34Q 4A3CG 1YJWA 1U0LA 1VCIA 4NXMQ 2GN5A 3D0FA 1TWCH 1YEZA 4GNXB 2LXKA 5FLMG 1IZ6A 5H1SE 2JJQA 4QJFA 4GNXC 2HHHQ 2BA0A 2AWOA 3AQQA 3H0GG 4LF5Q 5JEAJ 5IP9G 4X66L 2HT1A 3S16H 4MNOA 3UDFA 2KHJA 1BBWA 2E5LL 1OXTA 2I5HA 4OONA 1HNWQ 3F8TA 4AQYL 4AYBE 3CW2C 4XIGS 1EOVA 3CC4A 1FJGQ 1XMQL 4GKJL 3TREA 1K3RA 3T1HQ 1Y1WG 1EQRA 1P16A 4HJ7A 3KF6B 4LF9L 2MO1A 3CCSA 1N34L 5IYCH 1SE8A 1YHAA 5IT9c 1UE6A 3K0XA 2K14A 3UDGA 1HR0Q 5C4XG 2E5LQ 1E24A 3T1YL 3S17H 3I2ZA 4IJLA 2R7ZH 1VQ4A 4IPHA 4PZ7A 5C44G 2MNAA 3M85A 4RMFA 1VQLA 1RL2A 3IRBA 3GTPH 1VQIA 4LWCA 4OO1I 4DV5L 1D7QA 3J81j 3GTQH 3HOUG 4DR2L 4A3KH 3PCOB 1BVSA 4P72A 3KLWA 3GTGH 4JBMA 4R4QA 1TWFH 4P74A 1N32L 4YWLA 2UXDQ 2OQ0A 2IX0A 4O2DA 4JI6Q 5LMUQ 2N78A 2YV5A 1NJIC 4MTNA 1SR3A 4DR3Q 1HJPA 3CCMA 3W1GA 1X55A 5LMNW 1K0RA 4IFDI 5C0XG 5DLQE 5IY0A 1VQ5A 1AE3A 1N36L 3CCLA 2JA8H 3M4OH 4IOAA 4DV3L 4OX9Q 4LFBL 2QA4A 5M3MH 4C3IH 4DV5Q 1OTCA 2B63H 4BBRH 4K0KQ 1E22A 2ZJPA 4JI2Q 3U58A 4P73A 2MQHA 1HNWL 2B3GA 1Q8KA 4A3FH 4JYAL 3G71A 3PV0A 1KRTA 2ALYB 1EUJA 4H02A 3G4SA 2CWPA 1J6QA 5IYBH 2K75A 4DAMA 1B7YB 1MKHA 1JB7A 2UXBQ 2D0OA 3S1MH 1VQ7A 1YJNA 1CKNA 1A62A 1PA6A 1GM5A 2WB1E 3S15H 1SRUA 2R92H 2VNUD 1CKNB 1X56A 1GO3E 3CCEA 2IX1A 1L1OA 3DM3A 5BR8Q 2RHSB 4LFCQ 3GDEA 3EBEA 4OWXB 4L5QA 3ZJYC 5M5YH 4YWKA 2ZJRA 1IBLQ 1A63A 1BKBA 1G6PA 2NZOA 5M5XH 3PO3H 3PF5A 2Q2TA 3PSIA 4HJ8A 1KIXA 4NB3A 3E0EA 4X64Q 3I4NH 1N33Q 1PH3A 4IOCA 3GTOH 1TXYA 4YY3L 3EIVA 1QVGA 1YBYA 4LF6L 5M3FH 4A4IA 2BA1A 1K73C 1LYLA 4DV4Q 2JA6G 1KL9A 1PFSA 4JI8Q 3HFZB 2WAQG 2K4KA 4JBKA 3G48A 4HJAA 1SROA 2YYZA 3PUWA 4AIMA 3TS0A 4BXXG 1Z9FA 4HIDA 2ZTDA 2UUAL 1RIPA 3H0GH 1WCMG 2VL6A 2I0QA 1WOCA 4HJ9A 3HOYH 4X64L 4TVAB 2IT1A 4DPGA 3F2CA 4A3LH 4LF7L 5IP7H 1L1OB 2NVTH 2PMZE 3MXNB 3RN2A 3GTLH 4DV0L 1Q81C 4LF6Q 1YVCA 1BBUA 1T9HA 3AFQA 4DV6Q 1V9PA 2ZTEA 5C0XI 4BY7H 4DR5L 4TQUS 4A3EG 4AH6A 4C3JH 2PNHA 3B6YA 1Q46A 1A0IA 1GVPA 3K7AH 2R7ZG 2H5XA 2B29A 5C3EG 4OXPA 3RLFA 1JJ2A 3KYHC 3HKZE 4UP9A 1QZGA 2UXCL 3K8AA 5IYDH 2YTYA 1UEBA 2GVBA 4LF5L 2EQSA 4DKAC 4JI3Q 4A3DG 1XPUA 2YTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7I A;  3CCJ A;  4AYB G;  1HNX Q;  1OXV A;  3ICE A;  1XMQ Q;  4LFB Q;  2HIX A;  4B3S Q;  2R93 H;  1I6H H;  1E1T A;  4DV7 Q;  5HY6 A;  4DR6 L;  3E9I A;  2XGT A;  4JI7 L;  1VQ6 A;  5FJ8 G;  4DAY B;  1I94 Q;  4JI3 L;  3U4V A;  2VS1 A;  3GTM H;  3KJO A;  3DLL A;  4BBS H;  4GKK L;  4JOI C;  2XTI A;  4YHH Q;  1HZ9 A;  1Z47 A;  3CCR A;  4GOP B;  3CCQ A;  1X3F A;  4DV7 L;  4NXM L;  3A0J A;  4JBJ A;  4A3M H;  2OCE A;  4PZ8 A;  1JE5 A;  2DGY A;  3HOW H;  4DV2 Q;  5LMN L;  3Q8D A;  5IYB G;  4KLK A;  2KCM A;  4LUO A;  3NBH B;  1LM0 A;  1I94 L;  4B3S L;  3RN5 A;  2R7D A;  3K81 C;  3PIP A;  1UE1 A;  3JAM i;  4LFA L;  3S2D H;  3ULJ A;  1Y1V H;  1L1O C;  3FHW A;  4R4I A;  3T1H L;  2GVA A;  2VUM H;  3CC7 A;  1HZA A;  4X65 L;  1XMO L;  3PUZ A;  2F4V Q;  4YCW A;  2RF4 A;  2ZTC A;  2Y0S E;  5M5W H;  5IYD G;  2Z6K C;  1E3P A;  4GLX A;  1QUQ B;  4JI0 Q;  3GTJ H;  4NXN Q;  1PH7 A;  4A93 H;  3T1Y Q;  1PYS B;  1S40 A;  2JA9 A;  1Q12 A;  5IWA L;  5LMN Q;  4DV3 Q;  1KD1 C;  1J5E L;  2NVX H;  4OX9 L;  3RZD H;  2NVY H;  4A3J H;  1PV4 A;  3GD7 A;  4X62 Q;  5HGQ A;  4R4T A;  1S72 A;  1NBW A;  3J7A 5;  4LNQ A;  1JT8 A;  3L0O A;  2KEN A;  5ELO A;  3PF4 A;  2K5N A;  3E9H A;  4PMW A;  3I7F A;  3HOZ H;  1V1Q A;  2JQO A;  2WP8 J;  1VQE A;  2ZJQ A;  3M7N A;  2EIF A;  1TWH H;  4Y52 H;  1IBK L;  1SMX A;  4GLV B;  4A3B H;  1GKH A;  4XTC S;  5FLM H;  3H15 A;  1WFQ A;  4GKK Q;  4A3G H;  1IBM L;  4X62 L;  4HIK A;  4GOP C;  4A3L G;  2PQA A;  4DUY L;  1AH9 A;  4BBS G;  5IP7 G;  1VQ8 A;  2KHI A;  4JI5 L;  3OTO Q;  3I4M H;  1VQM A;  1MJC A;  3CAM A;  3AEV A;  2N3S A;  1UE5 A;  2IHF A;  4AQY Q;  1YZ6 A;  2OQK A;  1LUZ A;  4R4O A;  4BY7 G;  1QUQ A;  5GAD C;  1N33 L;  3RR5 A;  3EN2 A;  3KFU A;  4B3T L;  3HOV G;  5GRO A;  2WAQ E;  1N36 Q;  4POG A;  1IL2 A;  3I55 A;  5JJK A;  5C0X J;  2NN6 I;  3LGJ A;  1X6O A;  4IPG A;  4JI1 L;  3J81 i;  4DR3 L;  3ULL A;  3ER0 A;  1HZC A;  3U4Z A;  2CQO A;  1K9M C;  2E2J H;  1IBM Q;  4K0K L;  1YJ9 A;  1B8A A;  3FKI H;  3VDY A;  2JEB I;  1CKM A;  1YNX A;  4JG2 A;  4RG1 A;  3ULP A;  1HNZ L;  4B3R Q;  1VQG A;  1HH2 P;  1X65 A;  1VQA A;  2E8G A;  5BR8 L;  4A3C H;  2V1C C;  2CFM A;  2JA7 H;  4LF7 Q;  4GN3 B;  2K52 A;  3HOX G;  4A3J G;  1H95 A;  4QY7 A;  2A1A A;  3FP9 A;  4IPD A;  1R9T H;  4LW1 A;  2N8N A;  4PZ6 A;  1OXS C;  4JOI A;  1Q86 C;  1EQQ A;  3S1Q H;  2VZA A;  4IPC A;  4NPS A;  3SGI A;  1QZH A;  1PVO A;  1VQF A;  4DK3 C;  4B3T Q;  1UWV A;  1ASZ A;  1IBL L;  4X66 Q;  1EIY B;  4L5T A;  3CC2 A;  1WI5 A;  1EYG A;  3L7Z C;  1DGS A;  1GD7 A;  2PI2 E;  2AMC B;  4O0A A;  1YHB A;  4QL5 A;  1Y1W H;  1VQ9 A;  1KHI A;  1E1O A;  1VQP A;  1OXU A;  2CKZ B;  2CWA A;  4X6A H;  1NY4 A;  1V43 A;  2K5H A;  4LFA Q;  3TRZ A;  5IYC G;  1I3Q H;  3RLO A;  2AKW B;  1M90 C;  1X54 A;  4EQ5 A;  1Y1V G;  4IFD G;  4YCV A;  1OXX K;  2JE6 I;  1AE2 A;  4OWT B;  4BY1 G;  4A3K G;  4L5R C;  5C44 H;  2UU9 Q;  4QQB X;  1KAW A;  1B70 B;  3A5Z B;  4DV6 L;  4JI7 Q;  3S1R H;  4JI4 Q;  1Q7Y C;  4R1J A;  1HZB A;  4GLA C;  5C4J H;  3M9B A;  1HNZ Q;  3FKI G;  1PH6 A;  4B3R L;  1KRS A;  1PH2 A;  4HJ5 A;  4C2M H;  2ZM6 Q;  1IYJ B;  1EFW A;  1QVF A;  4P75 A;  4DV2 L;  4YY3 Q;  2OTL A;  4A75 A;  3BU2 A;  3UE1 A;  3KF6 A;  3GTK H;  3HOX H;  1PHJ A;  2D62 A;  5M3F G;  5M3M G;  2B63 G;  4LUZ A;  1XNQ Q;  4BBR G;  3HKS A;  4P71 A;  1VQD A;  1HNX L;  4PG3 A;  2JA5 G;  3KDF B;  2UU9 L;  2YU9 H;  2JA6 H;  1PH5 A;  1FL0 A;  4J15 A;  1YIT A;  4A3B G;  1XJV A;  4A3G G;  4A3F G;  3UDX A;  1HR0 W;  4X65 Q;  1IXR A;  4KHP Q;  4GN4 B;  4KI0 A;  4UP7 A;  4LF8 L;  2QEX A;  1XPO A;  2R6G A;  1VQO A;  1Q1B A;  3S24 A;  2NVQ H;  1JJG A;  4A76 A;  4DR1 Q;  2OWO A;  3GO5 A;  4DR2 Q;  1FVI A;  2K50 A;  3W5O A;  3M3Y H;  4YWM A;  4Y7N H;  3W1B A;  1EWI A;  2WB1 G;  3CCV A;  3HOU H;  4KHP L;  3CD6 A;  5ELN A;  4EX5 A;  4APV A;  4KHZ A;  1XTD A;  1PH9 A;  4BA2 I;  4ALP A;  2Z0S A;  4B3M Q;  3JAM c;  1C7Y A;  5JJI A;  1CKO A;  1XNR Q;  3PO3 G;  4WJ4 A;  2PQA B;  2IY5 B;  3OYY A;  4UPA A;  1VS0 A;  1X3G A;  4POF A;  1QVC A;  2LSS A;  2ZM6 L;  3TEH B;  4A3D H;  4DUZ L;  1XMO Q;  1W2B A;  4JI2 L;  3WWV A;  4DV4 L;  4DK6 C;  3G6E A;  1YIJ A;  2F4V L;  1CSP A;  3I56 A;  3CME A;  2VQE L;  2EXD A;  4B3M L;  2ATW A;  4WJ3 M;  3UE0 A;  3PUY A;  4C3H H;  1K8A C;  2LXJ A;  1CUK A;  3U50 C;  5J3B A;  4BXX H;  3KF8 B;  3CQZ H;  3CP0 A;  1VQC A;  1TWA H;  1PH4 A;  2VY3 A;  4A3I G;  1WCM H;  1YI2 A;  2E2H H;  3BJU A;  3BZK A;  5GAH C;  1WYD A;  3HOY G;  4UY8 C;  3J80 c;  2BH8 A;  3CPF A;  2FXQ A;  1NE3 A;  2NZH A;  2VW9 A;  3ERS X;  2Q2U A;  4JCV E;  1UE7 A;  2K5V A;  2YTX A;  1N32 Q;  4GN5 A;  2HIV A;  4OO1 G;  4JI6 L;  1I50 H;  5AJ3 Q;  4YCU A;  4LF4 Q;  2BH2 A;  1A8V A;  3F2D A;  2HQL A;  4A3M G;  5IWA Q;  4DR1 L;  1J5E Q;  1P8L A;  3CPW A;  4DV1 L;  4GS3 A;  1Y14 B;  5GAE C;  4GKJ Q;  2C35 B;  1FJG L;  4A3E H;  3NEN A;  4DNI A;  4BY1 H;  4QGU A;  5C3E H;  1NTG A;  3CCU A;  2ID0 A;  1MJE A;  2UUB Q;  2UXC Q;  3HKZ G;  2WFW A;  2RHQ B;  2VUM G;  1E7Z A;  1VQH A;  4LF9 Q;  1JMC A;  2E2I H;  1SFO H;  3PUV A;  1VQB A;  2IHE A;  2R93 G;  3OTO L;  4JI5 Q;  5JJL A;  2F52 A;  3CMA A;  4A93 G;  4QIW E;  3J81 c;  4LF4 L;  1EIF A;  2UXB L;  4JI8 L;  4DUY Q;  4DUZ Q;  1X3E A;  1KXL A;  2Z6K A;  2CCZ A;  4BA1 I;  4JYA Q;  1G51 A;  3PUX A;  1N9W A;  3STB C;  2PI2 A;  4LFC L;  3A74 A;  1SLJ A;  5FJ8 H;  2A19 A;  2JA5 H;  2UXD L;  3I4O A;  1K8G A;  2UUB L;  1VQN A;  2N49 A;  4JI1 Q;  4GNX A;  2ASB A;  5EAY A;  1C9O A;  1W3S A;  3K7U C;  5FLX c;  3J7Z C;  3OW2 A;  4A3I H;  1VQK A;  4IO9 A;  4DV0 Q;  4MZ9 A;  3KDF A;  3L2P A;  3BZC A;  1M1K C;  1MIU A;  1X9N A;  2I5M X;  3UDI A;  1L0W A;  4JI4 L;  3RZO H;  2MO0 A;  4UP8 A;  1XNR L;  2JK8 A;  3J80 i;  3PIO A;  3D31 A;  1FGU A;  1N8R C;  1C0A A;  2KBN A;  1SN8 A;  3RNU A;  4DR4 Q;  4DR7 L;  1D8L A;  4JI0 L;  3S1N H;  1U5K A;  1CSQ A;  2AHO B;  4JC0 A;  4DV1 Q;  1JJC B;  4ME3 A;  4FDB A;  2Y0S G;  1Q1E A;  3STB D;  3KJP A;  1PYB A;  3PO2 G;  5K36 G;  2NN6 G;  3PGZ A;  2UUC L;  2A8V A;  2VQF L;  4OWW B;  3F2B A;  4LF8 Q;  3M4Q A;  2JEA I;  4R4C A;  3H3V I;  1K83 H;  5LMU L;  3S2H H;  2JA7 G;  3AFP A;  2DUD A;  4JBW A;  1Q82 C;  3CXC A;  1LTL A;  2JA8 G;  3AYH B;  4IJH A;  5IP9 H;  3HOZ G;  5IE8 A;  4DR7 Q;  4DR4 L;  1I5F A;  2AWN A;  1IBK Q;  4HIM A;  4JV5 Q;  3HOW G;  2Q2H A;  3JC6 6;  1VQJ A;  3K80 C;  3I4M G;  1L2F A;  2F3I A;  1KC8 C;  5GAG C;  1KQS A;  1NMF A;  4GOP A;  2D0P A;  2UUA Q;  3M4P A;  5E7N A;  5AJ3 L;  5C4X H;  2VQF Q;  5JEA G;  3RLN A;  3F1Z A;  2QGQ A;  1HR0 L;  2R92 G;  1S3O A;  4L5S A;  4IFD J;  3S14 H;  4NXN L;  3TQY A;  4YHH L;  1NMG A;  3H3V H;  2HHH L;  4JV5 L;  4DR6 Q;  2OTJ A;  3HOV H;  1PH8 A;  1G29 1;  2MFI A;  3NEM A;  3KOJ A;  3CF5 A;  2I5L X;  1ASY A;  2R7F A;  1XNQ L;  2RCN A;  3NEL A;  2VQE Q;  4HIO A;  1YHQ A;  3I4N G;  3TS2 A;  2KCT A;  2ES2 A;  5GQO A;  3MEF A;  1TWG H;  2UUC Q;  3PO2 H;  2L15 A;  3A5U A;  4LUV A;  4DR5 Q;  2Q2I A;  1WJJ A;  1XPR A;  1PH1 A;  1N34 Q;  4A3C G;  1YJW A;  1U0L A;  1VCI A;  4NXM Q;  2GN5 A;  3D0F A;  1TWC H;  1YEZ A;  4GNX B;  2LXK A;  5FLM G;  1IZ6 A;  5H1S E;  2JJQ A;  4QJF A;  4GNX C;  2HHH Q;  2BA0 A;  2AWO A;  3AQQ A;  3H0G G;  4LF5 Q;  5JEA J;  5IP9 G;  4X66 L;  2HT1 A;  3S16 H;  4MNO A;  3UDF A;  2KHJ A;  1BBW A;  2E5L L;  1OXT A;  2I5H A;  4OON A;  1HNW Q;  3F8T A;  4AQY L;  4AYB E;  3CW2 C;  4XIG S;  1EOV A;  3CC4 A;  1FJG Q;  1XMQ L;  4GKJ L;  3TRE A;  1K3R A;  3T1H Q;  1Y1W G;  1EQR A;  1P16 A;  4HJ7 A;  3KF6 B;  4LF9 L;  2MO1 A;  3CCS A;  1N34 L;  5IYC H;  1SE8 A;  1YHA A;  5IT9 c;  1UE6 A;  3K0X A;  2K14 A;  3UDG A;  1HR0 Q;  5C4X G;  2E5L Q;  1E24 A;  3T1Y L;  3S17 H;  3I2Z A;  4IJL A;  2R7Z H;  1VQ4 A;  4IPH A;  4PZ7 A;  5C44 G;  2MNA A;  3M85 A;  4RMF A;  1VQL A;  1RL2 A;  3IRB A;  3GTP H;  1VQI A;  4LWC A;  4OO1 I;  4DV5 L;  1D7Q A;  3J81 j;  3GTQ H;  3HOU G;  4DR2 L;  4A3K H;  3PCO B;  1BVS A;  4P72 A;  3KLW A;  3GTG H;  4JBM A;  4R4Q A;  1TWF H;  4P74 A;  1N32 L;  4YWL A;  2UXD Q;  2OQ0 A;  2IX0 A;  4O2D A;  4JI6 Q;  5LMU Q;  2N78 A;  2YV5 A;  1NJI C;  4MTN A;  1SR3 A;  4DR3 Q;  1HJP A;  3CCM A;  3W1G A;  1X55 A;  5LMN W;  1K0R A;  4IFD I;  5C0X G;  5DLQ E;  5IY0 A;  1VQ5 A;  1AE3 A;  1N36 L;  3CCL A;  2JA8 H;  3M4O H;  4IOA A;  4DV3 L;  4OX9 Q;  4LFB L;  2QA4 A;  5M3M H;  4C3I H;  4DV5 Q;  1OTC A;  2B63 H;  4BBR H;  4K0K Q;  1E22 A;  2ZJP A;  4JI2 Q;  3U58 A;  4P73 A;  2MQH A;  1HNW L;  2B3G A;  1Q8K A;  4A3F H;  4JYA L;  3G71 A;  3PV0 A;  1KRT A;  2ALY B;  1EUJ A;  4H02 A;  3G4S A;  2CWP A;  1J6Q A;  5IYB H;  2K75 A;  4DAM A;  1B7Y B;  1MKH A;  1JB7 A;  2UXB Q;  2D0O A;  3S1M H;  1VQ7 A;  1YJN A;  1CKN A;  1A62 A;  1PA6 A;  1GM5 A;  2WB1 E;  3S15 H;  1SRU A;  2R92 H;  2VNU D;  1CKN B;  1X56 A;  1GO3 E;  3CCE A;  2IX1 A;  1L1O A;  3DM3 A;  5BR8 Q;  2RHS B;  4LFC Q;  3GDE A;  3EBE A;  4OWX B;  4L5Q A;  3ZJY C;  5M5Y H;  4YWK A;  2ZJR A;  1IBL Q;  1A63 A;  1BKB A;  1G6P A;  2NZO A;  5M5X H;  3PO3 H;  3PF5 A;  2Q2T A;  3PSI A;  4HJ8 A;  1KIX A;  4NB3 A;  3E0E A;  4X64 Q;  3I4N H;  1N33 Q;  1PH3 A;  4IOC A;  3GTO H;  1TXY A;  4YY3 L;  3EIV A;  1QVG A;  1YBY A;  4LF6 L;  5M3F H;  4A4I A;  2BA1 A;  1K73 C;  1LYL A;  4DV4 Q;  2JA6 G;  1KL9 A;  1PFS A;  4JI8 Q;  3HFZ B;  2WAQ G;  2K4K A;  4JBK A;  3G48 A;  4HJA A;  1SRO A;  2YYZ A;  3PUW A;  4AIM A;  3TS0 A;  4BXX G;  1Z9F A;  4HID A;  2ZTD A;  2UUA L;  1RIP A;  3H0G H;  1WCM G;  2VL6 A;  2I0Q A;  1WOC A;  4HJ9 A;  3HOY H;  4X64 L;  4TVA B;  2IT1 A;  4DPG A;  3F2C A;  4A3L H;  4LF7 L;  5IP7 H;  1L1O B;  2NVT H;  2PMZ E;  3MXN B;  3RN2 A;  3GTL H;  4DV0 L;  1Q81 C;  4LF6 Q;  1YVC A;  1BBU A;  1T9H A;  3AFQ A;  4DV6 Q;  1V9P A;  2ZTE A;  5C0X I;  4BY7 H;  4DR5 L;  4TQU S;  4A3E G;  4AH6 A;  4C3J H;  2PNH A;  3B6Y A;  1Q46 A;  1A0I A;  1GVP A;  3K7A H;  2R7Z G;  2H5X A;  2B29 A;  5C3E G;  4OXP A;  3RLF A;  1JJ2 A;  3KYH C;  3HKZ E;  4UP9 A;  1QZG A;  2UXC L;  3K8A A;  5IYD H;  2YTY A;  1UEB A;  2GVB A;  4LF5 L;  2EQS A;  4DKA C;  4JI3 Q;  4A3D G;  1XPU A;  2YTV A; 
#chains in the Genus database with same CATH topology
 4OIK A;  1HNX Q;  1OXV A;  4LJZ C;  3ICE A;  4LFB Q;  3FPU B;  2IWH A;  4B3S Q;  2K32 A;  2R93 H;  4K5X A;  2PZU A;  1TWF B;  4H0L C;  1E1T A;  1ESR A;  2B2W C;  2XGT A;  4K2L A;  1VQ6 A;  4KN7 C;  4DAY B;  4JPB W;  3U4V A;  2VS1 A;  1R4P B;  2EJF C;  5CR3 A;  4BBS H;  2XTI A;  2KHS A;  4DA2 A;  1TQO A;  4EQN A;  3CCQ A;  3A0J A;  1JE5 A;  5E3F A;  3Q8D A;  3D4D A;  3J81 E;  5G3L D;  3K81 C;  3PIP A;  5BN3 A;  4LFA L;  2X6L A;  3ULJ A;  1Y1V H;  2KA7 A;  1L1O C;  3IFT A;  2A5H A;  4YCW A;  5M5W H;  5IYD G;  2Z6K C;  4HCS A;  5JOB A;  2LFN A;  1PH7 A;  3T1Y Q;  1JWS D;  3RZD H;  2PQE A;  2NBF A;  4JW0 A;  1U4L A;  1CQV A;  5HGQ A;  2D9U A;  3J7A 5;  4LNQ A;  1NR2 A;  3PF4 A;  4IZ8 A;  1BR9 A;  4PMW A;  1LTB D;  3I73 A;  1V1Q A;  2JQO A;  4KY5 A;  2IL8 A;  1Y1V B;  2ZJQ A;  5FKA C;  4GLV B;  1GKH A;  4QF4 A;  4XTC S;  1EQT A;  1WFQ A;  5FLM H;  5EPJ A;  4A3L G;  2PQA A;  4BBS G;  2F0N A;  1JE4 A;  1H9K A;  3P20 A;  4JI5 L;  3I4M H;  1MJC A;  3QIA A;  2IHF A;  4K8J A;  1XX8 A;  1LUZ A;  5GAD C;  3RR5 A;  1DCZ A;  3EN2 A;  3KFU A;  1IL2 A;  4H7B A;  3I55 A;  1EOT A;  4JI1 L;  3LGJ A;  2HUG A;  1IW7 C;  3J81 i;  2E2J H;  2IW3 A;  1HZC A;  3ER0 A;  2CQO A;  3U4Z A;  1F2Z A;  2OT2 A;  3GP7 A;  1B8A A;  3FKI H;  3VDY A;  1CKM A;  1HH2 P;  2E8G A;  3K57 A;  1ILP A;  4GN3 B;  3HOX G;  2VUM B;  1H95 A;  2VB3 X;  2FIN B;  1Y8O B;  3G6J B;  1EQQ A;  1PVO A;  2VZA A;  1VQF A;  1SE4 A;  2A73 B;  2EY6 A;  3NSW A;  1IBL L;  4X66 Q;  1ASZ A;  4L5T A;  2DY7 A;  3CC2 A;  3L7Z C;  1YHB A;  4A3M B;  1ILQ A;  1SNQ A;  1Y1W H;  4B9X A;  2XRQ D;  5FO8 B;  4ABN A;  1LT5 D;  4LAA A;  1VQP A;  1YNJ C;  4NDX A;  3TRZ A;  2DY8 A;  4EQ5 A;  4IFD G;  2PO4 A;  2R61 A;  5EKK A;  1OXX K;  1AEX A;  5C44 H;  4QQB X;  1B70 B;  3A5Z B;  4A3G B;  4A3B B;  3R3O A;  5FLX E;  4JI7 Q;  2OF1 A;  4JI4 Q;  4KD4 A;  1Q7Y C;  1HZB A;  4GLA C;  3M9B A;  3DM1 A;  1H9M A;  1RKN A;  2F0U A;  1HFG A;  2XSC A;  2Z4H A;  5COR A;  3HOX H;  5FLX L;  4DK1 A;  5M3F G;  4KV6 A;  5M3M G;  4FF2 A;  4PV1 C;  4P71 A;  1VQD A;  2JA5 G;  1EYA A;  1TY0 A;  5DM7 3;  4J15 A;  4A3B G;  4A3G G;  4A3F G;  1IXR A;  4A3K B;  4F8M A;  1GUN A;  1ICF B;  5IGE A;  2QEX A;  1VQO A;  4XQQ A;  2PYK A;  2PZW A;  1SJH D;  1FVI A;  5DEH A;  3VR3 A;  1I4R A;  1EWI A;  2TSS A;  2JA5 B;  3CD6 A;  5M9O A;  4N8X 1;  4KHZ A;  4BA2 I;  2B2Y A;  4B3M Q;  1LTR D;  5JJI A;  4WJ4 A;  2FJ2 A;  2ZM6 L;  3TEH B;  1LO5 D;  5C4H A;  1XMO Q;  1W2B A;  3WWV A;  2F4V L;  1YIJ A;  3I56 A;  3CME A;  3JAM E;  2I07 B;  4B3M L;  1VQC A;  1PH4 A;  1SYC A;  1WCM H;  3BJU A;  1WYD A;  2K03 A;  3HOY G;  1DOK A;  4R8N A;  2A6H C;  2BH8 A;  2FXQ A;  3CPF A;  2NZH A;  4Y52 H;  5C4Z A;  4JCV E;  2K5V A;  3K7A B;  1CZG A;  4OO1 G;  4QUF A;  4YCU A;  1A8V A;  3F2D A;  1J5E Q;  4DR1 L;  1P8L A;  1F2M A;  1Y14 B;  1TWA B;  3K0Y A;  3V96 A;  5GAE C;  2C35 B;  2IX3 A;  2B8G A;  2RSO A;  4A3E H;  4DNI A;  4XQN A;  3H09 A;  3CCU A;  2UUB Q;  2RHQ B;  1Z6H A;  3HOX B;  2VUM G;  1E7Z A;  5FOB B;  2E2I H;  3PUV A;  5ELC A;  1VQB A;  4JI5 Q;  5EPL A;  1V8Q A;  1BUV T;  2F52 A;  3MFG A;  4N9P A;  1K28 A;  3M4Y A;  2L5T A;  5JVH 3;  1CT1 D;  4J8Q A;  1TU2 B;  4ZUI A;  2CCZ A;  4JYA Q;  5E4X A;  1QIL A;  2PI2 A;  1BNZ A;  5FJ8 H;  2A19 A;  4JI1 Q;  5M5X B;  2B2U C;  4B3T Q;  1W3S A;  3Q22 A;  3K7U C;  3J7Z C;  4DV0 Q;  3VA7 A;  1PRT C;  3T13 A;  3VYT A;  1MIU A;  3A55 A;  4N9T A;  3GTL B;  1TR5 A;  4IUN A;  4UP8 A;  1BDO A;  1PLF A;  2JK8 A;  3J80 i;  3A56 A;  3V05 A;  1FGU A;  4IUV A;  3NHH A;  1WTX A;  4DR7 L;  1WD0 A;  1D8L A;  1PXU A;  2HD3 A;  2QDB A;  2R3Z A;  4C3I B;  4DV1 Q;  4ME3 A;  3FEW X;  1Q1E A;  2QIL A;  3I4L A;  3SK8 A;  1PYB A;  2F0T A;  4XT3 B;  5K36 G;  5KGU A;  2EYF A;  2A8V A;  4LF8 Q;  1MSH A;  3S2H H;  2EY2 A;  2JA7 G;  2E2J B;  3HOW G;  2Q2H A;  3JC6 6;  1CQF A;  1VQJ A;  3GTP B;  4RHS A;  1A6X A;  2F03 A;  1CK1 A;  5E7N A;  2UUA Q;  4A3E B;  1FGB D;  3S1M B;  3F1Z A;  3CHB D;  1HR0 L;  3NWS A;  3VA5 A;  1S3O A;  3ERQ A;  4IFD J;  4NXN L;  3TQY A;  2QW7 A;  4KY6 A;  1IKL A;  1H9S B;  2CH4 W;  4JV5 L;  3MA2 B;  1ASY A;  2NTT A;  4CJ1 B;  3DMU A;  4HIO A;  1S5D D;  4J1M A;  3TS2 A;  2N55 A;  5I4D A;  4MHE A;  1SFO B;  1Y8P B;  4P2C B;  2I46 A;  4IUP A;  3RZD B;  2L15 A;  1XPR A;  4LUV A;  1WJJ A;  1U0L A;  2GN5 A;  4GNX B;  2HHH Q;  4GNX C;  2BA0 A;  1GXD C;  3H0G G;  4LF5 Q;  4X66 L;  3S16 H;  1PYW D;  5C4J B;  4AQY L;  4XIG S;  1E2V A;  1EQR A;  3SR1 A;  2MO1 A;  3CCS A;  1UE6 A;  5IT9 L;  4QIW B;  3K58 A;  5C4X G;  4CDD C;  1GUW A;  3T1Y L;  3S17 H;  1H9R A;  4IPH A;  1HPC A;  3GTP H;  5CV4 A;  1XTC D;  4A3K H;  1BVS A;  2K7V A;  3MEH A;  1TWF H;  4P74 A;  3VYS A;  3CU7 A;  1O7Z A;  2EXZ A;  2IX0 A;  5LL6 X;  5F2D A;  1CTM A;  5LMU Q;  2FMM A;  3W1G A;  1X55 A;  4IFD I;  5DLQ E;  4LFB L;  4IOA A;  5TSS A;  2QA4 A;  4C3I H;  4K0K Q;  2DNC A;  2B2W A;  4JI2 Q;  1HNW L;  5C6A A;  3G71 A;  3PV0 A;  1KDA A;  1J8I A;  2CWP A;  3WDN A;  1JB7 A;  3NBH A;  3A8I E;  1A62 A;  1FD7 D;  4C3J G;  1CKN B;  1BCP F;  1GO3 E;  4CKE A;  2F0M A;  3DM3 A;  2XVS A;  2RHS B;  1FNV A;  2FHT A;  1G6P A;  1G2T A;  5M5X H;  4X64 Q;  1I6H B;  4RHR A;  1TXY A;  1WTH A;  4YY3 L;  1TWH B;  3EIV A;  1QVG A;  3MXP A;  2F0L A;  3KBX A;  2H1E A;  3OIP A;  3G48 A;  2HCC A;  3PUW A;  3KLS X;  4HR7 B;  4BXX G;  1F2L A;  1Z9F A;  4HID A;  3HG9 A;  1I3Q B;  2VL6 A;  1WOC A;  4HJ9 A;  3NE5 B;  2NVX B;  4OL7 A;  4TVA B;  2IT1 A;  4A3L H;  4H44 C;  3MVV A;  4ZCK A;  2QKI C;  4CDF C;  4DV0 L;  1Q81 C;  4LF6 Q;  1BBU A;  1KDC A;  3AFQ A;  3D6C A;  5D3I B;  2EYJ A;  4C3J H;  4MIU A;  3K7A H;  1GVP A;  2B29 A;  3RLF A;  1IYV A;  3KYH C;  5IYD H;  4JI3 Q;  1I6V C;  5AFW A;  3QWN A;  2B2V C;  3R2T A;  3CCJ A;  2K6A A;  2CW0 D;  1EYD A;  1RD9 D;  3R8B A;  4JI7 L;  4ID6 A;  4JI3 L;  4XYO A;  2RA4 A;  1RTO A;  3LWU A;  3CRL C;  3SK4 A;  4YHH Q;  1Z47 A;  3K5M A;  3CCR A;  1AP0 A;  1X3F A;  1PRT B;  4PZ8 A;  2B39 A;  1JOK A;  3TP6 A;  4B3S L;  4LUO A;  2KCM A;  1B50 A;  1LAB A;  1HRJ A;  1I4G A;  1SBB B;  1GHJ A;  2R7D A;  4C3J B;  5CV9 A;  2B63 B;  2F0E A;  5FO9 B;  1ET9 A;  4R4I A;  4DK0 A;  2JA8 B;  3U9O A;  1XMO L;  2F4V Q;  2JA7 B;  2RF4 A;  2ZTC A;  4DNR B;  1QUQ B;  4A93 H;  2JA9 A;  2NVX H;  2ICI A;  5LMN Q;  4DV3 Q;  1SDF A;  4OX9 L;  4L8J A;  1SNP A;  3GD7 A;  4X62 Q;  1JT8 A;  1NBW A;  1BCP B;  3L0O A;  2KEN A;  2K5N A;  3E9H A;  3HOZ H;  1STY A;  3NP8 A;  3TN2 A;  3VR6 A;  2EIF A;  1TWH H;  1IBK L;  4A3B H;  4A3G H;  5LL6 S;  4GKK Q;  3OW7 A;  4X62 L;  4HIK A;  1MI2 A;  1AH9 A;  3OIQ A;  4FXG C;  5IP7 G;  3K5N A;  1VQ8 A;  3OTO Q;  1AZP A;  1IHZ A;  4XDX A;  2N3S A;  1UE5 A;  3FPP A;  1YZ6 A;  2OQK A;  5JEA H;  1QUQ A;  1FR3 A;  5I6Y A;  3TP5 A;  3VR2 A;  3HOV G;  3H6M A;  4POG A;  2NWG A;  4XYQ A;  3D4W A;  4K0K L;  1NNX A;  3OWE B;  3W2D A;  5CGK A;  3BVZ A;  4WRD A;  1JR0 D;  3KUP A;  2O5I C;  4OGQ C;  4RG1 A;  2FMC A;  1F77 A;  4ILW A;  4A3C H;  2CFM A;  5KEE A;  4K2K A;  1DD2 A;  4QY7 A;  3ND9 A;  4IPD A;  4PZ6 A;  3HOV B;  4JOI A;  3S1R B;  1Q86 C;  3S1Q H;  1HA6 A;  1U4M A;  1UWV A;  2EJG C;  3E0J A;  1U9R A;  1WI5 A;  3G7L A;  4ULL A;  4RCN A;  1EY6 A;  1VQ9 A;  1KHI A;  2CWA A;  1AFP A;  4YIJ A;  4LFA Q;  3BZD B;  2WKD A;  4A3I B;  3S15 B;  1M90 C;  3QO2 A;  1PFN A;  4M8A A;  4OWT B;  4RGM A;  2UU9 Q;  1KAW A;  4X3S A;  4ZRZ A;  3FDT A;  4R1J A;  5C4J H;  5DM6 3;  4ZQ3 A;  1HNZ Q;  4B3R L;  1TY2 A;  5IT9 E;  4HJ5 A;  4C2M H;  1LV9 A;  3HP3 A;  4P75 A;  4YY3 Q;  4A75 A;  3BU2 A;  3KF6 A;  3GTK H;  2D62 A;  1H9J A;  4C3H G;  5K5P A;  2B63 G;  1XNQ Q;  2TMP A;  1W6J A;  4BBR G;  4PG3 A;  2JA6 H;  3KDF B;  1PH5 A;  1ENA A;  1F9Q A;  1XJV A;  3X3M A;  2PNR C;  3OOC A;  4TRD A;  4LK1 C;  5IGD A;  2MJ8 A;  2QDL A;  3EVQ A;  3D4R A;  1LTG D;  3A7L A;  3TDQ A;  1XPO A;  2R6G A;  3S24 A;  4DF7 A;  4FXD A;  2OWO A;  4DR2 Q;  2N88 A;  5I2X A;  3CCV A;  3HOU H;  2P5Z X;  5M3F B;  5ELN A;  3E6Z X;  1XTD A;  2XRS D;  1Y69 U;  4ALP A;  1PH9 A;  1C7Y A;  1STE A;  3WOF A;  2A74 C;  2PQA B;  4UPA A;  2NN6 H;  2F0Q A;  1PTO D;  4EQO A;  4POF A;  4A3D H;  1PRT D;  4A3J B;  4DUZ L;  4DV4 L;  4DK6 C;  3BDC A;  1CSP A;  3QG1 A;  2EXD A;  3UE0 A;  2R7Z B;  4C3H H;  2B2Y C;  2LXJ A;  3CQZ H;  4I7A A;  1YI2 A;  4HN7 A;  3BZK A;  3M3Y B;  4UY8 C;  3J80 c;  3SHL A;  1NE3 A;  4KK7 A;  2EZV A;  5LHY 1;  2F0J A;  5BN5 A;  4MTK A;  4FF1 A;  4BY7 B;  5AJ3 Q;  4A3M G;  2HQL A;  1BOS A;  5IWA Q;  1LT6 D;  4UDU C;  3NPP A;  4DV1 L;  4RWS C;  4GKJ Q;  1B1Z A;  4BY1 H;  4QGU A;  1STN A;  1VF7 A;  3GTM B;  3MC0 B;  1C4Q A;  4M1U B;  1STG A;  1VQH A;  1EEI D;  3PIP 3;  3GQB A;  2IHE A;  3IAY A;  3OTO L;  4QIW E;  4LF4 L;  1V1O A;  4JI8 L;  4DU9 A;  4DUY Q;  2JP1 A;  1KXL A;  2NUC A;  1G51 A;  1N9W A;  2UXD L;  3I4O A;  2UUB L;  3MAQ A;  5EAY A;  1C9O A;  3OW2 A;  1O7L A;  1STH A;  4MZ9 A;  3HZX A;  4FF4 A;  3KDF A;  4KJN A;  5EGT A;  4DN4 M;  3A54 A;  3J81 L;  4FYD A;  2I5M X;  1NAP A;  3UDI A;  2NVT B;  3RZO H;  2MO0 A;  4TKO B;  1XNR L;  1F9S A;  2KBN A;  3NWT A;  5T1I A;  1CSQ A;  2AHO B;  1JJC B;  1S5E D;  4FDB A;  3STB D;  3KJP A;  2K5W A;  3PO2 G;  3LNN A;  5CV8 A;  1O80 A;  2UUC L;  2Z9H A;  2EYO A;  5IGB A;  5E1F A;  3AFP A;  5I9O A;  4DGZ A;  3AYH B;  2LY7 A;  3HOZ G;  1X3Q A;  1I5F A;  2AWN A;  1C8C A;  1IBK Q;  5C4X B;  1WD1 A;  4CDE C;  4IUQ A;  2F3I A;  5GAG C;  2DNE A;  5C3E B;  1NMF A;  4GOP A;  3UI2 A;  5C4X H;  1TS4 A;  3RLN A;  2QGQ A;  3I91 A;  3J80 L;  4L5S A;  3DWA A;  3S14 H;  4RGO S;  4XQJ A;  3LX0 A;  3Q0A A;  2OTJ A;  1LAC A;  1G29 1;  2RDF A;  3MXG A;  1YHQ A;  3D3R A;  1D5Z C;  4EVO A;  1NSN S;  1I4Q A;  3MEF A;  1HUN A;  3PO2 H;  4A3C G;  2Q2I A;  2HQE A;  1YJW A;  2K28 A;  2M9V A;  1VCI A;  3D0F A;  2SOB A;  4KD3 A;  4RKB A;  1EY0 A;  5FLM G;  5H1S E;  2JJQ A;  4KY7 A;  5JEA J;  4HMJ A;  2E5L L;  2E76 C;  1BBW A;  2L12 A;  4OON A;  3J80 E;  3FMC A;  1EOV A;  1FJG Q;  1XMQ L;  5FO7 B;  2QEJ C;  5CBA E;  1Y1W G;  1P16 A;  4DAP A;  3KF6 B;  1MSG A;  3DWQ A;  4G57 A;  3DEP A;  3N6R A;  1YHA A;  1Y8N B;  3HOW B;  2E5L Q;  1E24 A;  4Q5V A;  3I2Z A;  1CHP D;  2WKC A;  4PZ7 A;  3IRB A;  3NTH A;  1VQI A;  4DV5 L;  2DN8 A;  2PPB C;  3PCO B;  5KND A;  1STB A;  3GTG H;  1PZI D;  5EBC A;  2BDO A;  1KAA A;  4O1N A;  5KYL A;  3NQI A;  4O2D A;  1EY5 A;  1NJI C;  2QF7 A;  1EY7 A;  5C0X G;  3M4O H;  4DV3 L;  4OX9 Q;  5M3M H;  1OTC A;  1IL8 A;  3E5S A;  2NTS A;  1KLG D;  1F9P A;  4A3F H;  2ZXR A;  1KRT A;  1J6Q A;  5CMD A;  1SE3 A;  1B7Y B;  4OEM B;  4ZUJ A;  1VQ7 A;  3RUZ A;  1PA6 A;  2R92 H;  1ET6 A;  4RAU C;  1SYB A;  3OHX C;  2KOL A;  3EBE A;  3GDE A;  4OWX B;  4ZKC B;  5M5Y H;  4YWK A;  2ZJR A;  1GUG A;  1EIH A;  1BKB A;  3PO3 H;  3VYU A;  3PF5 A;  1A15 A;  3PSI A;  1KIX A;  2ZXO A;  5D3D A;  1PH3 A;  3R2I A;  1EL0 A;  5IGG A;  2B2T A;  1F9R A;  5M3F H;  2BA1 A;  1LYL A;  4DV4 Q;  1R9T B;  1PFS A;  4JI8 Q;  2OEO A;  2K4K A;  4IQZ A;  1SRO A;  3EJI A;  3BDO A;  1RIP A;  3KK7 A;  3CRK C;  2O5J C;  1SAP A;  3DWP A;  5CV5 A;  1TKW B;  4LF7 L;  1TT2 A;  4K6L A;  4N8F A;  3SXH A;  5IP7 H;  4G7H C;  3RN2 A;  1G6Z A;  4ZLT F;  4KN4 C;  1GOZ A;  2WAC A;  2HDM A;  1PRT F;  1BF4 A;  4RA8 A;  4OO1 H;  3MTS A;  1I4H A;  1Q46 A;  1A0I A;  3B6Y A;  2R7Z G;  1JWM D;  2H5X A;  3SEB A;  5C3E G;  3GTK B;  1JJ2 A;  1S5C D;  1QZG A;  1UEB A;  4LF5 L;  4U68 A;  1B9N A;  3VR4 A;  3AMU A;  2A68 C;  4AYB G;  4OHJ A;  1AZQ A;  2J4X A;  2G5D A;  2WAQ B;  3A7A B;  4KJO A;  5HY6 A;  3A8K E;  3J7Y W;  3C1E A;  1EZ6 A;  3DLL A;  2R92 B;  4DXG A;  5D65 A;  2B2V A;  3URY A;  3PIO 3;  4NXM L;  4CJ2 C;  2OCE A;  1V1P B;  2DGY A;  2O2L D;  4DV2 Q;  4ZK9 B;  1U4P A;  1LM0 A;  2KQ3 A;  3P75 A;  4S3S A;  3RN5 A;  4A3F B;  5EKI A;  3S2D B;  1D6E C;  5C3W A;  1UE1 A;  3S1Q B;  5IGF A;  1PTO H;  4RH6 A;  5M3M B;  3T1H L;  2KCC A;  2GVA A;  1JOQ A;  2EE1 A;  4X65 L;  2QCP X;  3PUZ A;  1B9M A;  3C3L A;  2C5C A;  2Y0S E;  4GLX A;  2NVY B;  4K6D A;  3TSS A;  2JN4 A;  1S40 A;  1J5E L;  1Q12 A;  1ENC A;  3MZ5 A;  4R9W A;  5KYI A;  1JIC A;  2NVY H;  3ITP A;  3NTI A;  3KF8 A;  4R4T A;  1HHV A;  3TZU A;  3I7F A;  4U67 3;  3OWF A;  2CH4 A;  1SMX A;  5EKL A;  1IBM L;  5D14 A;  1K8M A;  2D5D A;  4EQP A;  4PQX A;  4KTA A;  1K8O A;  2L1B A;  2SNM A;  3ONA B;  3AEV A;  1KNE A;  2WIN B;  4R4O A;  4BY7 G;  5KRU A;  1N33 L;  1MHW C;  4B3T L;  3HEJ A;  5GRO A;  2WAQ E;  4C56 C;  4DR3 L;  5JPN C;  1II3 A;  4OIJ A;  2LKV A;  3T4A C;  1KDB A;  2JEB I;  4JG2 A;  1YNX A;  3ULP A;  1C0A A;  3I72 A;  3TZD A;  1X65 A;  3H0G B;  4CGY B;  2JA7 H;  2K52 A;  5J22 A;  2A1A A;  3FP9 A;  4LW1 A;  4X3U A;  2L11 A;  2IPK D;  1OXS C;  4K5W A;  4IPC A;  1KLU D;  4DK3 C;  1UNS A;  1EIY B;  3GTO B;  4OEL B;  3OPO A;  1HQM C;  1DGS A;  1GD7 A;  2PMZ B;  3DUZ A;  3I4N B;  2WV6 D;  4QL5 A;  2AUJ D;  1R4Q B;  5IGC A;  1E1O A;  3SK6 A;  3RLO A;  2AKW B;  1Y1V G;  2RSN A;  4BY1 G;  4H13 C;  4FF3 A;  1JWU D;  1BO0 A;  4DV6 L;  2Z1C A;  3DHQ A;  1SNC A;  4RCO A;  4BBR B;  1PH6 A;  1M8A A;  2FFK B;  1PH2 A;  1SSO A;  2ZM6 Q;  1QVF A;  5L37 A;  3PO3 B;  3UE1 A;  1QG7 A;  4HSV A;  4MN3 A;  4L6T B;  1EU3 A;  1PHJ A;  4DNT B;  2AQ1 B;  4LUZ A;  1QB5 D;  4G4K A;  4X3K A;  2M00 A;  2UU9 L;  3GTJ B;  4GZY C;  2IJ0 A;  4KHV A;  3UDX A;  3GV3 A;  4GN4 B;  3T51 B;  5BN4 A;  3NBI A;  5C5L A;  2NVQ H;  1Q1B A;  5COY A;  4A76 A;  4KKS A;  4DR1 Q;  3GO5 A;  4O42 A;  1XXG A;  2K50 A;  3W5O A;  1WTP A;  4Y7N H;  2E2H B;  2WB1 G;  1QOH A;  1AN8 A;  3OMG A;  1SEB D;  4EX5 A;  4APV A;  1UEA B;  2BDN A;  3HGB A;  2Z0S A;  3JAM c;  1CKO A;  1XNR Q;  4QUC A;  1LT4 D;  4FXK C;  1LTS D;  3OYY A;  2A6E D;  5FK9 C;  1QVC A;  4BWG B;  4JI2 L;  4UAI A;  4XXE A;  3V2T A;  2ATW A;  4BY1 B;  4WJ3 M;  4R8I A;  1B3A A;  2LMC B;  3U50 C;  3A8J E;  4BXX H;  3CP0 A;  1PMR A;  4Y7N B;  1WTV A;  2E2H H;  5GAH C;  1EYC A;  3RMH A;  2VW9 A;  1UE7 A;  4WFN 3;  2YTX A;  1WTR A;  2F0K A;  4GN5 A;  2HIV A;  4JI6 L;  5CV6 A;  5HUR A;  1X32 A;  1HUM A;  2JXM B;  1DJR D;  1FJG L;  4RGN A;  1WTQ A;  3L9A X;  2EJM A;  1BQQ T;  1LLR D;  1NTG A;  1MJE A;  2ID0 A;  4I65 A;  3HOY B;  4KMU C;  3OSO A;  1EWC A;  4WJW A;  1SNM A;  4LF9 Q;  1B44 D;  1JMC A;  1BCP D;  2CW0 C;  3E3X A;  2R93 G;  2B2U A;  2J7Z A;  4A93 G;  2UXB L;  1EIF A;  1X3E A;  2Z6K A;  5EPK A;  3R93 A;  3KLR A;  3STB C;  1UAP A;  1G91 A;  3J7A F;  2EPB A;  3S14 B;  1ZKO A;  1SLJ A;  1VQN A;  1HTP A;  3JAM L;  2ASB A;  3K5O A;  3Q24 A;  3PQI A;  4V19 0;  1A2U A;  4IO9 A;  1JB3 A;  1HFN A;  4IUU A;  3L2P A;  3BZC A;  3I70 A;  2NZ1 D;  3S16 B;  3AB9 A;  4DXF A;  1VMP A;  2EYL A;  1QCB D;  3DEO A;  4JI4 L;  3I90 A;  3VYR A;  1N8R C;  1PTO F;  3BYY B;  3D31 A;  1I50 B;  3M7G A;  1SN8 A;  3RNU A;  4DR4 Q;  3S1N H;  4HSP A;  1SXT A;  4JC0 A;  4L63 B;  4C2M B;  5JVG 3;  1ZXT A;  3BYT B;  3PGZ A;  5ELD A;  2MP1 A;  2VQF L;  4OWW B;  1SNO A;  2JEA I;  4R4C A;  1K83 H;  2DUD A;  2SNS A;  1Q82 C;  5C0X H;  3CXC A;  1SYE A;  4AYB B;  5IP9 H;  1U4R A;  4DR7 Q;  3W3A A;  3H91 A;  4HIM A;  2XWB B;  2MUY A;  1I4P A;  5M5Y B;  1ML0 D;  1PZJ D;  2A69 C;  3D6W A;  3I4M G;  1IKM A;  5G3L F;  5ELB A;  3MXN A;  3M4P A;  5AJ3 L;  2L9H A;  1QNK A;  1YNN D;  4HMI A;  2R92 G;  4JK1 C;  3S2H B;  1H9S A;  4YHH L;  3H3V H;  4IN3 A;  5HGT A;  3HOV H;  2B8F A;  2MFI A;  3NEM A;  3KOJ A;  3CF5 A;  2R7F A;  3T53 B;  2X69 A;  2VQE Q;  1GUS A;  5GQO A;  1TWC B;  1TWG H;  3IKJ A;  4DR5 Q;  1N34 Q;  2YU9 B;  1EZ8 A;  1PTO C;  1TWG B;  3NK9 A;  3QOJ A;  4NXM Q;  1ZEQ X;  1TWC H;  1YEZ A;  1IZ6 A;  3AQQ A;  3H3V C;  5IP9 G;  2HT1 A;  3UDF A;  2KHJ A;  1EY9 A;  1OXT A;  5I2Y A;  1PTO B;  1HNW Q;  3F8T A;  2K5Q A;  3CW2 C;  3CC4 A;  1SE2 A;  3O13 A;  2K05 A;  1K3R A;  3T1H Q;  2F0O A;  1LTI D;  5JPM C;  3SK5 A;  1HA5 A;  1TS5 A;  5IYC H;  1HR0 Q;  2EYP A;  1NR4 A;  1V1P A;  4IJL A;  2R7Z H;  1VQ4 A;  2F3W A;  4RMF A;  1EEF D;  4HTH A;  2AQ2 B;  1RL2 A;  4OO1 I;  4LWC A;  1D7Q A;  1E2W A;  1WTO A;  3GTQ H;  3HOU G;  1SYG A;  4P72 A;  1ROD A;  3X3N A;  2F3V A;  4JBM A;  4R4Q A;  3IL8 A;  5K36 H;  1HQR D;  2A6E C;  1A3U A;  2ICE C;  1IYU A;  1GUO A;  4JI6 Q;  2N78 A;  4MTN A;  4RKL A;  3CCM A;  2K1B A;  5LMN W;  1VQ5 A;  5IY0 A;  1N36 L;  2JA8 H;  1BXT A;  3BG3 A;  1ONL A;  5JAV A;  2M2L A;  3IFD A;  4DV5 Q;  4BBR H;  2B63 H;  1I4X A;  1E22 A;  2ZJP A;  3P7J A;  2B3G A;  2F0D A;  2L55 A;  5EBD A;  2K75 A;  4DAM A;  1MKH A;  1O78 A;  2UXB Q;  2D0O A;  1CKN A;  1GM5 A;  2WB1 E;  4CDC C;  1KTK A;  1SRU A;  2VNU D;  1A3V A;  3D8G A;  3CCE A;  4QB4 A;  3ZJY C;  4L5Q A;  2Z8L A;  1K0S A;  2F4I A;  4FO2 A;  4HJ8 A;  3EFX D;  1QNU A;  3E0E A;  4CJ0 B;  3I4N H;  1EQV A;  3BDL A;  3GTO H;  1S4Z A;  3NXW A;  1RJT A;  2XNA C;  4G7O C;  4LF6 L;  3HKZ B;  5CYU A;  2Z4I A;  4A4I A;  1C48 A;  1JC7 A;  2K04 A;  1KL9 A;  2JA6 G;  3J7A V;  3HFZ B;  2EYH A;  2VB2 X;  4HJA A;  2YYZ A;  3TS0 A;  1CA6 A;  2UUA L;  2ZTD A;  1CFM A;  2MHV A;  3H0G H;  5NUC A;  3C46 A;  2I0Q A;  1G2S A;  3T16 A;  4CKC A;  4X64 L;  3HOY H;  4DPG A;  1A3T A;  1DOL A;  5IIF A;  1L1O B;  1RF2 D;  2NVT H;  3MXN B;  2KVM A;  3CKI B;  1T9H A;  4DV6 Q;  1V9P A;  2ZTE A;  1CA5 A;  1ENF A;  1DZ1 A;  4TQU S;  5C5M A;  1BBX C;  4AH6 A;  3BS1 A;  2PNH A;  1MBY A;  4K5V A;  4OXP A;  2RDG A;  2E75 C;  1Q8I A;  3M4O B;  1PDQ A;  2RDH A;  4DKA C;  4NW2 A;  4JVZ A;  3WOE A;  1XPU A;  2YTV A;  1O7I A;  1XMQ Q;  2HIX A;  1I6H H;  4DV7 Q;  1E2Z A;  2RQX A;  3E9I A;  5FJ8 G;  1MGS A;  1I94 Q;  1S5B D;  5IOD A;  3GTM H;  1F2Y A;  4C3I G;  1GJX A;  3KJO A;  4GKK L;  4JOI C;  3F2U A;  1PFM A;  1HZ9 A;  4GOP B;  4DV7 L;  4X3T A;  4JBJ A;  4A3M H;  3HOW H;  2D2C C;  1T5E A;  5LMN L;  4K14 A;  5IYB G;  4KLK A;  1I94 L;  3NBH B;  2Q8I B;  2A6H D;  2NVQ B;  3PMF A;  3JAM i;  3S2D H;  3SVM A;  3BVG A;  4HED A;  3FHW A;  1LTA D;  3HOZ B;  2VUM H;  3CC7 A;  1HZA A;  4JI0 Q;  2PCF B;  1E3P A;  1MD2 D;  3GTJ H;  4NXN Q;  2KJX A;  1PYS B;  3I8Z A;  3FKI B;  4KKU A;  5IWA L;  4UHV A;  1KD1 C;  1B3Q A;  3PO2 B;  2F0S A;  3TBI B;  4A3J H;  1PV4 A;  1S72 A;  4DFA A;  1NUC A;  5ELO A;  1YNJ D;  3EA6 A;  1DON A;  1CI3 M;  1D1K A;  1EY4 A;  3Q23 A;  2WP8 J;  1VQE A;  3HRZ C;  3M7N A;  3S17 B;  4CHT B;  3H15 A;  4GOP C;  2CVR A;  4DUY L;  3HOU B;  1HTL D;  4FP5 D;  2KHI A;  1RHP A;  1VQM A;  3CAM A;  2XN9 C;  3SE0 A;  2AUK A;  4AQY Q;  1T5X D;  2DJF C;  1N36 Q;  1PFB A;  5JJK A;  5C0X J;  2NN6 I;  4DR6 L;  1X6O A;  3OMC A;  4IPG A;  3S9W A;  3ULL A;  1K9M C;  1NCV A;  4F87 A;  1IBM Q;  3GV6 A;  3Q6S A;  1YJ9 A;  2EYM A;  4NKL A;  1Q3L A;  2DJG C;  3FRP B;  1RTN A;  1HNZ L;  4B3R Q;  1VQG A;  2PW7 A;  1VQA A;  5BR8 L;  2V1C C;  4LF7 Q;  2E2D C;  3NQT A;  4A3J G;  2F0G A;  2F0P A;  2BE5 D;  1R9T H;  2N8N A;  1TS3 A;  3SGI A;  1QZH A;  4NPS A;  1K3B C;  2F0W A;  3MXU A;  1EYG A;  5CBE E;  2PI2 E;  2AMC B;  4O0A A;  1KNA A;  2MPM A;  3GTQ B;  4BBS B;  2ZXP A;  1OXU A;  2CKZ B;  4X6A H;  1NY4 A;  1V43 A;  2K5H A;  5IYC G;  1I3Q H;  1LTT D;  2MGS A;  1DM0 B;  1X54 A;  5ELE A;  2K01 A;  1SYD A;  4YCV A;  2JE6 I;  2KEC A;  1AE2 A;  5ELF A;  4Z9C B;  4A3K G;  4L5R C;  2XIW A;  2L4N A;  4CBV A;  4NMZ A;  1FYC A;  3S1R H;  3VR5 A;  4EGV A;  3FKI G;  1YNN C;  2LS0 1;  1KRS A;  4KKT A;  1IYJ B;  1EFW A;  3TP7 A;  4DV2 L;  2OTL A;  1VF5 C;  2A69 D;  4TSS A;  1D5X C;  1IW7 D;  1PZK D;  1D5M C;  2AQ3 B;  3HKS A;  1HNX L;  5C3X A;  2YU9 H;  4FVM A;  3ZYY X;  1FL0 A;  1YIT A;  2PZT A;  4G7Z C;  1HR0 W;  5I9P A;  4X65 Q;  4KHP Q;  1JCK B;  2EY5 A;  3T56 B;  4KI0 A;  4UP7 A;  4LF8 L;  2BE5 C;  1JJG A;  3U9S A;  2HDL A;  3M3Y H;  4YWM A;  3W1B A;  5IOC A;  4KHP L;  4DAV A;  3CQZ B;  4C3H B;  5E4W C;  3PO3 G;  2L0C A;  1XYI A;  3I3C A;  2IY5 B;  4HAE A;  4A3D B;  1VS0 A;  1HXY D;  1X3G A;  2E2I B;  2LSS A;  2ZT9 C;  3AU7 A;  2CQA A;  2NYZ D;  3G6E A;  4RFB A;  2VQE L;  1K83 B;  2EY1 A;  4IAL A;  3PUY A;  1K8A C;  4A93 B;  2K5D A;  2F0V A;  1CUK A;  1AW7 A;  5J3B A;  3KF8 B;  1TWA H;  2VY3 A;  5T1G A;  1SMY C;  4A3I G;  3C1F A;  4PMB A;  3TME A;  3MHB A;  4NP5 A;  1N32 Q;  2Q2U A;  3ERS X;  3S1N B;  1I50 H;  4LF4 Q;  1BCP C;  2BH2 A;  1WCM B;  3CPW A;  4GS3 A;  4K8I A;  1A2T A;  3LWE A;  2XWJ B;  5CC4 A;  3NEN A;  1SND A;  2B2T C;  2BOS A;  2JA6 B;  5C3E H;  2UXC Q;  1GHK A;  2GA4 B;  1RCV D;  3HKZ G;  2SDF A;  2WFW A;  5ISR A;  4ME5 A;  1SFO H;  1FNU A;  5JJL A;  3NUC A;  3CMA A;  2K33 A;  1CZW A;  3J81 c;  1CHQ D;  3ERO A;  4DUZ Q;  2RBM A;  4BA1 I;  3QR8 A;  4DAY A;  3PUX A;  2V4D A;  4LFC L;  3A74 A;  2JA5 H;  1K8G A;  2Q8T A;  2N49 A;  4GNX A;  1W6K A;  1D2B A;  1EY8 A;  2HCI A;  2OXP A;  5FLX c;  4PMC A;  4A3I H;  1VQK A;  1TII D;  2WB1 B;  4IUR A;  1M1K C;  1X9N A;  3RZO B;  3HS0 C;  1L0W A;  3PIO A;  4JI0 L;  2ENB A;  1VDZ A;  1JOO A;  1U5K A;  3QJY A;  5I6W A;  2Y0S G;  2NN6 G;  1S5F D;  1STA A;  3F2B A;  3K59 A;  3M4Q A;  2EVB A;  3H3V I;  5LMU L;  1TS2 A;  4JBW A;  5C44 B;  1LTL A;  2JA8 G;  1Q90 A;  1TVX A;  1X3P A;  4IJH A;  3GTG B;  5IE8 A;  4DR4 L;  4JV5 Q;  3K6O A;  1JQY D;  3KLS A;  1CM9 A;  2EOT A;  3K80 C;  1L2F A;  4B08 A;  1KC8 C;  3P1H A;  4FNF A;  1KQS A;  3C2P A;  2D0P A;  2JYO A;  1EIG A;  2VQF Q;  5JEA G;  2E74 C;  1M4V A;  5KNC A;  1LT3 D;  1DOM A;  3RD4 A;  1NMG A;  2VXW A;  2HHH L;  4BS9 A;  5KIX A;  4DR6 Q;  1HCZ A;  1SYF A;  1PH8 A;  2G9H D;  5A2Q L;  5A2Q E;  2I5L X;  1XNQ L;  2RCN A;  3NEL A;  4J6H A;  3I4N G;  4C1N I;  2KCT A;  1UUP A;  2ES2 A;  3BVM A;  2Z6B A;  1EWH A;  4Q0F A;  2UUC Q;  2WII B;  3A5U A;  2X6G A;  1PH1 A;  2Q8R E;  2NB0 A;  2PW5 A;  4E6I A;  1XWE A;  2LXK A;  1QWY A;  4QJF A;  2AWO A;  1ZYR D;  2H4O A;  5KNB A;  4MNO A;  2BCO A;  3MFY A;  2I5H A;  3N52 A;  5J1Z A;  3MWY W;  4AYB E;  1KAB A;  1JOR A;  4GKJ L;  3TRE A;  2KCN A;  3H94 A;  5CV7 A;  1EU4 A;  4HJ7 A;  3I4M B;  4LF9 L;  4HCE A;  4V0B A;  1WVL A;  1N34 L;  1SE8 A;  1B2T A;  5IT9 c;  3K0X A;  2K14 A;  3UDG A;  1ESF A;  4IFD H;  3QOL A;  1D1I A;  4IUT A;  3M85 A;  5C44 G;  2MNA A;  1VQL A;  1ZYR C;  5DAU A;  4QMG A;  3J81 j;  4DR2 L;  5EQ0 A;  4C1N K;  1L0Y B;  1WTW A;  2RKS A;  3KLW A;  4I7Z C;  5EJW A;  1OO9 B;  4B9W A;  2Y0S B;  1N32 L;  4YWL A;  2UXD Q;  2F0H A;  2OQ0 A;  1ICW A;  2YV5 A;  2SEB D;  1SR3 A;  5M5W B;  4DR3 Q;  1HJP A;  5J39 A;  1K0R A;  1B53 A;  1AE3 A;  3CCL A;  2A68 D;  1RDP D;  3U58 A;  4P73 A;  2MQH A;  2JSO A;  1Q8K A;  4JYA L;  1DYQ A;  2RVL A;  3FVQ A;  2ALY B;  4ZKB B;  1EUJ A;  4H02 A;  3G4S A;  2J0T D;  5IYB H;  3S1M H;  1YJN A;  2O4X A;  3KBG A;  3S15 H;  1O7Y A;  1X56 A;  4CKB A;  2IX1 A;  1L1O A;  5BR8 Q;  4LFC Q;  1B4O A;  1A63 A;  4LMQ D;  1IBL Q;  1J9O A;  2NZO A;  2C9O A;  2F0I A;  2Q2T A;  4NB3 A;  1N33 Q;  4IOC A;  2R93 B;  1GUT A;  5JJZ A;  4F7X A;  3L3O C;  1SJE D;  2F0F A;  1YBY A;  1G8Z D;  1K73 C;  3TP8 A;  4ZYS A;  4JBK A;  2WAQ G;  3QB3 A;  2F1M A;  3DXJ C;  4RGT A;  4AIM A;  4F88 A;  1SMY D;  1WCM G;  2EDG A;  4ODG A;  3EQL C;  1QJO A;  3F2C A;  2KUM A;  1E0B A;  4WOR A;  4ZAI A;  2CHB D;  1Z7T A;  2PMZ E;  3GTL H;  1Y1W B;  1YVC A;  4XT1 B;  2G9D A;  5DNF A;  1QE6 A;  1FNW A;  3K5L A;  1L0X B;  5C0X I;  4BY7 H;  2RCF A;  4DR5 L;  4A3E G;  3SDZ A;  2KEE A;  3ND8 A;  4PNY A;  1DXM A;  3NTK A;  3HKZ E;  4UP9 A;  2UXC L;  3K8A A;  4QCL A;  2YTY A;  5A35 A;  2GVB A;  1VMC A;  2EQS A;  1EFI D;  2KED A;  4A3D G; 
#chains in the Genus database with same CATH homology
 1O7I A;  3CCJ A;  4AYB G;  1HNX Q;  1OXV A;  3ICE A;  1XMQ Q;  4LFB Q;  2HIX A;  4B3S Q;  2R93 H;  1I6H H;  1E1T A;  4DV7 Q;  5HY6 A;  4DR6 L;  3E9I A;  2XGT A;  4JI7 L;  1VQ6 A;  5FJ8 G;  4DAY B;  1I94 Q;  4JI3 L;  3U4V A;  2VS1 A;  3GTM H;  3KJO A;  3DLL A;  4BBS H;  4GKK L;  4JOI C;  2XTI A;  4YHH Q;  1HZ9 A;  1Z47 A;  3CCR A;  4GOP B;  3CCQ A;  1X3F A;  4DV7 L;  4NXM L;  3A0J A;  4JBJ A;  4A3M H;  2OCE A;  4PZ8 A;  1JE5 A;  2DGY A;  3HOW H;  4DV2 Q;  5LMN L;  3Q8D A;  5IYB G;  4KLK A;  2KCM A;  4LUO A;  3NBH B;  1LM0 A;  1I94 L;  4B3S L;  3RN5 A;  2R7D A;  3K81 C;  3PIP A;  1UE1 A;  3JAM i;  4LFA L;  3S2D H;  3ULJ A;  1Y1V H;  1L1O C;  3FHW A;  4R4I A;  3T1H L;  2GVA A;  2VUM H;  3CC7 A;  1HZA A;  4X65 L;  1XMO L;  3PUZ A;  2F4V Q;  4YCW A;  2RF4 A;  2ZTC A;  2Y0S E;  5M5W H;  5IYD G;  2Z6K C;  1E3P A;  4GLX A;  1QUQ B;  4JI0 Q;  3GTJ H;  4NXN Q;  1PH7 A;  4A93 H;  3T1Y Q;  1PYS B;  1S40 A;  2JA9 A;  1Q12 A;  5IWA L;  5LMN Q;  4DV3 Q;  1KD1 C;  1J5E L;  2NVX H;  4OX9 L;  3RZD H;  2NVY H;  4A3J H;  1PV4 A;  3GD7 A;  4X62 Q;  5HGQ A;  4R4T A;  1S72 A;  1NBW A;  3J7A 5;  4LNQ A;  1JT8 A;  3L0O A;  2KEN A;  5ELO A;  3PF4 A;  2K5N A;  3E9H A;  4PMW A;  3I7F A;  3HOZ H;  1V1Q A;  2JQO A;  2WP8 J;  1VQE A;  2ZJQ A;  3M7N A;  2EIF A;  1TWH H;  4Y52 H;  1IBK L;  1SMX A;  4GLV B;  4A3B H;  1GKH A;  4XTC S;  5FLM H;  3H15 A;  1WFQ A;  4GKK Q;  4A3G H;  1IBM L;  4X62 L;  4HIK A;  4GOP C;  4A3L G;  2PQA A;  4DUY L;  1AH9 A;  4BBS G;  5IP7 G;  1VQ8 A;  2KHI A;  4JI5 L;  3OTO Q;  3I4M H;  1VQM A;  1MJC A;  3CAM A;  3AEV A;  2N3S A;  1UE5 A;  2IHF A;  4AQY Q;  1YZ6 A;  2OQK A;  1LUZ A;  4R4O A;  4BY7 G;  1QUQ A;  5GAD C;  1N33 L;  3RR5 A;  3EN2 A;  3KFU A;  4B3T L;  3HOV G;  5GRO A;  2WAQ E;  1N36 Q;  4POG A;  1IL2 A;  3I55 A;  5JJK A;  5C0X J;  2NN6 I;  3LGJ A;  1X6O A;  4IPG A;  4JI1 L;  3J81 i;  4DR3 L;  3ULL A;  3ER0 A;  1HZC A;  3U4Z A;  2CQO A;  1K9M C;  2E2J H;  1IBM Q;  4K0K L;  1YJ9 A;  1B8A A;  3FKI H;  3VDY A;  2JEB I;  1CKM A;  1YNX A;  4JG2 A;  4RG1 A;  3ULP A;  1HNZ L;  4B3R Q;  1VQG A;  1HH2 P;  1X65 A;  1VQA A;  2E8G A;  5BR8 L;  4A3C H;  2V1C C;  2CFM A;  2JA7 H;  4LF7 Q;  4GN3 B;  2K52 A;  3HOX G;  4A3J G;  1H95 A;  4QY7 A;  2A1A A;  3FP9 A;  4IPD A;  1R9T H;  4LW1 A;  2N8N A;  4PZ6 A;  1OXS C;  4JOI A;  1Q86 C;  1EQQ A;  3S1Q H;  2VZA A;  4IPC A;  4NPS A;  3SGI A;  1QZH A;  1PVO A;  1VQF A;  4DK3 C;  4B3T Q;  1UWV A;  1ASZ A;  1IBL L;  4X66 Q;  1EIY B;  4L5T A;  3CC2 A;  1WI5 A;  1EYG A;  3L7Z C;  1DGS A;  1GD7 A;  2PI2 E;  2AMC B;  4O0A A;  1YHB A;  4QL5 A;  1Y1W H;  1VQ9 A;  1KHI A;  1E1O A;  1VQP A;  1OXU A;  2CKZ B;  2CWA A;  4X6A H;  1NY4 A;  1V43 A;  2K5H A;  4LFA Q;  3TRZ A;  5IYC G;  1I3Q H;  3RLO A;  2AKW B;  1M90 C;  1X54 A;  4EQ5 A;  1Y1V G;  4IFD G;  4YCV A;  1OXX K;  2JE6 I;  1AE2 A;  4OWT B;  4BY1 G;  4A3K G;  4L5R C;  5C44 H;  2UU9 Q;  4QQB X;  1KAW A;  1B70 B;  3A5Z B;  4DV6 L;  4JI7 Q;  3S1R H;  4JI4 Q;  1Q7Y C;  4R1J A;  1HZB A;  4GLA C;  5C4J H;  3M9B A;  1HNZ Q;  3FKI G;  1PH6 A;  4B3R L;  1KRS A;  1PH2 A;  4HJ5 A;  4C2M H;  2ZM6 Q;  1IYJ B;  1EFW A;  1QVF A;  4P75 A;  4DV2 L;  4YY3 Q;  2OTL A;  4A75 A;  3BU2 A;  3UE1 A;  3KF6 A;  3GTK H;  3HOX H;  1PHJ A;  2D62 A;  5M3F G;  5M3M G;  2B63 G;  4LUZ A;  1XNQ Q;  4BBR G;  3HKS A;  4P71 A;  1VQD A;  1HNX L;  4PG3 A;  2JA5 G;  3KDF B;  2UU9 L;  2YU9 H;  2JA6 H;  1PH5 A;  1FL0 A;  4J15 A;  1YIT A;  4A3B G;  1XJV A;  4A3G G;  4A3F G;  3UDX A;  1HR0 W;  4X65 Q;  1IXR A;  4KHP Q;  4GN4 B;  4KI0 A;  4UP7 A;  4LF8 L;  2QEX A;  1XPO A;  2R6G A;  1VQO A;  1Q1B A;  3S24 A;  2NVQ H;  1JJG A;  4A76 A;  4DR1 Q;  2OWO A;  3GO5 A;  4DR2 Q;  1FVI A;  2K50 A;  3W5O A;  3M3Y H;  4YWM A;  4Y7N H;  3W1B A;  1EWI A;  2WB1 G;  3CCV A;  3HOU H;  4KHP L;  3CD6 A;  5ELN A;  4EX5 A;  4APV A;  4KHZ A;  1XTD A;  1PH9 A;  4BA2 I;  4ALP A;  2Z0S A;  4B3M Q;  3JAM c;  1C7Y A;  5JJI A;  1CKO A;  1XNR Q;  3PO3 G;  4WJ4 A;  2PQA B;  2IY5 B;  3OYY A;  4UPA A;  1VS0 A;  1X3G A;  4POF A;  1QVC A;  2LSS A;  2ZM6 L;  3TEH B;  4A3D H;  4DUZ L;  1XMO Q;  1W2B A;  4JI2 L;  3WWV A;  4DV4 L;  4DK6 C;  3G6E A;  1YIJ A;  2F4V L;  1CSP A;  3I56 A;  3CME A;  2VQE L;  2EXD A;  4B3M L;  2ATW A;  4WJ3 M;  3UE0 A;  3PUY A;  4C3H H;  1K8A C;  2LXJ A;  1CUK A;  3U50 C;  5J3B A;  4BXX H;  3KF8 B;  3CQZ H;  3CP0 A;  1VQC A;  1TWA H;  1PH4 A;  2VY3 A;  4A3I G;  1WCM H;  1YI2 A;  2E2H H;  3BJU A;  3BZK A;  5GAH C;  1WYD A;  3HOY G;  4UY8 C;  3J80 c;  2BH8 A;  3CPF A;  2FXQ A;  1NE3 A;  2NZH A;  2VW9 A;  3ERS X;  2Q2U A;  4JCV E;  1UE7 A;  2K5V A;  2YTX A;  1N32 Q;  4GN5 A;  2HIV A;  4OO1 G;  4JI6 L;  1I50 H;  5AJ3 Q;  4YCU A;  4LF4 Q;  2BH2 A;  1A8V A;  3F2D A;  2HQL A;  4A3M G;  5IWA Q;  4DR1 L;  1J5E Q;  1P8L A;  3CPW A;  4DV1 L;  4GS3 A;  1Y14 B;  5GAE C;  4GKJ Q;  2C35 B;  1FJG L;  4A3E H;  3NEN A;  4DNI A;  4BY1 H;  4QGU A;  5C3E H;  1NTG A;  3CCU A;  2ID0 A;  1MJE A;  2UUB Q;  2UXC Q;  3HKZ G;  2WFW A;  2RHQ B;  2VUM G;  1E7Z A;  1VQH A;  4LF9 Q;  1JMC A;  2E2I H;  1SFO H;  3PUV A;  1VQB A;  2IHE A;  2R93 G;  3OTO L;  4JI5 Q;  5JJL A;  2F52 A;  3CMA A;  4A93 G;  4QIW E;  3J81 c;  4LF4 L;  1EIF A;  2UXB L;  4JI8 L;  4DUY Q;  4DUZ Q;  1X3E A;  1KXL A;  2Z6K A;  2CCZ A;  4BA1 I;  4JYA Q;  1G51 A;  3PUX A;  1N9W A;  3STB C;  2PI2 A;  4LFC L;  3A74 A;  1SLJ A;  5FJ8 H;  2A19 A;  2JA5 H;  2UXD L;  3I4O A;  1K8G A;  2UUB L;  1VQN A;  2N49 A;  4JI1 Q;  4GNX A;  2ASB A;  5EAY A;  1C9O A;  1W3S A;  3K7U C;  5FLX c;  3J7Z C;  3OW2 A;  4A3I H;  1VQK A;  4IO9 A;  4DV0 Q;  4MZ9 A;  3KDF A;  3L2P A;  3BZC A;  1M1K C;  1MIU A;  1X9N A;  2I5M X;  3UDI A;  1L0W A;  4JI4 L;  3RZO H;  2MO0 A;  4UP8 A;  1XNR L;  2JK8 A;  3J80 i;  3PIO A;  3D31 A;  1FGU A;  1N8R C;  1C0A A;  2KBN A;  1SN8 A;  3RNU A;  4DR4 Q;  4DR7 L;  1D8L A;  4JI0 L;  3S1N H;  1U5K A;  1CSQ A;  2AHO B;  4JC0 A;  4DV1 Q;  1JJC B;  4ME3 A;  4FDB A;  2Y0S G;  1Q1E A;  3STB D;  3KJP A;  1PYB A;  3PO2 G;  5K36 G;  2NN6 G;  3PGZ A;  2UUC L;  2A8V A;  2VQF L;  4OWW B;  3F2B A;  4LF8 Q;  3M4Q A;  2JEA I;  4R4C A;  3H3V I;  1K83 H;  5LMU L;  3S2H H;  2JA7 G;  3AFP A;  2DUD A;  4JBW A;  1Q82 C;  3CXC A;  1LTL A;  2JA8 G;  3AYH B;  4IJH A;  5IP9 H;  3HOZ G;  5IE8 A;  4DR7 Q;  4DR4 L;  1I5F A;  2AWN A;  1IBK Q;  4HIM A;  4JV5 Q;  3HOW G;  2Q2H A;  3JC6 6;  1VQJ A;  3K80 C;  3I4M G;  1L2F A;  2F3I A;  1KC8 C;  5GAG C;  1KQS A;  1NMF A;  4GOP A;  2D0P A;  2UUA Q;  3M4P A;  5E7N A;  5AJ3 L;  5C4X H;  2VQF Q;  5JEA G;  3RLN A;  3F1Z A;  2QGQ A;  1HR0 L;  2R92 G;  1S3O A;  4L5S A;  4IFD J;  3S14 H;  4NXN L;  3TQY A;  4YHH L;  1NMG A;  3H3V H;  2HHH L;  4JV5 L;  4DR6 Q;  2OTJ A;  3HOV H;  1PH8 A;  1G29 1;  2MFI A;  3NEM A;  3KOJ A;  3CF5 A;  2I5L X;  1ASY A;  2R7F A;  1XNQ L;  2RCN A;  3NEL A;  2VQE Q;  4HIO A;  1YHQ A;  3I4N G;  3TS2 A;  2KCT A;  2ES2 A;  5GQO A;  3MEF A;  1TWG H;  2UUC Q;  3PO2 H;  2L15 A;  3A5U A;  4LUV A;  4DR5 Q;  2Q2I A;  1WJJ A;  1XPR A;  1PH1 A;  1N34 Q;  4A3C G;  1YJW A;  1U0L A;  1VCI A;  4NXM Q;  2GN5 A;  3D0F A;  1TWC H;  1YEZ A;  4GNX B;  2LXK A;  5FLM G;  1IZ6 A;  5H1S E;  2JJQ A;  4QJF A;  4GNX C;  2HHH Q;  2BA0 A;  2AWO A;  3AQQ A;  3H0G G;  4LF5 Q;  5JEA J;  5IP9 G;  4X66 L;  2HT1 A;  3S16 H;  4MNO A;  3UDF A;  2KHJ A;  1BBW A;  2E5L L;  1OXT A;  2I5H A;  4OON A;  1HNW Q;  3F8T A;  4AQY L;  4AYB E;  3CW2 C;  4XIG S;  1EOV A;  3CC4 A;  1FJG Q;  1XMQ L;  4GKJ L;  3TRE A;  1K3R A;  3T1H Q;  1Y1W G;  1EQR A;  1P16 A;  4HJ7 A;  3KF6 B;  4LF9 L;  2MO1 A;  3CCS A;  1N34 L;  5IYC H;  1SE8 A;  1YHA A;  5IT9 c;  1UE6 A;  3K0X A;  2K14 A;  3UDG A;  1HR0 Q;  5C4X G;  2E5L Q;  1E24 A;  3T1Y L;  3S17 H;  3I2Z A;  4IJL A;  2R7Z H;  1VQ4 A;  4IPH A;  4PZ7 A;  5C44 G;  2MNA A;  3M85 A;  4RMF A;  1VQL A;  1RL2 A;  3IRB A;  3GTP H;  1VQI A;  4LWC A;  4OO1 I;  4DV5 L;  1D7Q A;  3J81 j;  3GTQ H;  3HOU G;  4DR2 L;  4A3K H;  3PCO B;  1BVS A;  4P72 A;  3KLW A;  3GTG H;  4JBM A;  4R4Q A;  1TWF H;  4P74 A;  1N32 L;  4YWL A;  2UXD Q;  2OQ0 A;  2IX0 A;  4O2D A;  4JI6 Q;  5LMU Q;  2N78 A;  2YV5 A;  1NJI C;  4MTN A;  1SR3 A;  4DR3 Q;  1HJP A;  3CCM A;  3W1G A;  1X55 A;  5LMN W;  1K0R A;  4IFD I;  5C0X G;  5DLQ E;  5IY0 A;  1VQ5 A;  1AE3 A;  1N36 L;  3CCL A;  2JA8 H;  3M4O H;  4IOA A;  4DV3 L;  4OX9 Q;  4LFB L;  2QA4 A;  5M3M H;  4C3I H;  4DV5 Q;  1OTC A;  2B63 H;  4BBR H;  4K0K Q;  1E22 A;  2ZJP A;  4JI2 Q;  3U58 A;  4P73 A;  2MQH A;  1HNW L;  2B3G A;  1Q8K A;  4A3F H;  4JYA L;  3G71 A;  3PV0 A;  1KRT A;  2ALY B;  1EUJ A;  4H02 A;  3G4S A;  2CWP A;  1J6Q A;  5IYB H;  2K75 A;  4DAM A;  1B7Y B;  1MKH A;  1JB7 A;  2UXB Q;  2D0O A;  3S1M H;  1VQ7 A;  1YJN A;  1CKN A;  1A62 A;  1PA6 A;  1GM5 A;  2WB1 E;  3S15 H;  1SRU A;  2R92 H;  2VNU D;  1CKN B;  1X56 A;  1GO3 E;  3CCE A;  2IX1 A;  1L1O A;  3DM3 A;  5BR8 Q;  2RHS B;  4LFC Q;  3GDE A;  3EBE A;  4OWX B;  4L5Q A;  3ZJY C;  5M5Y H;  4YWK A;  2ZJR A;  1IBL Q;  1A63 A;  1BKB A;  1G6P A;  2NZO A;  5M5X H;  3PO3 H;  3PF5 A;  2Q2T A;  3PSI A;  4HJ8 A;  1KIX A;  4NB3 A;  3E0E A;  4X64 Q;  3I4N H;  1N33 Q;  1PH3 A;  4IOC A;  3GTO H;  1TXY A;  4YY3 L;  3EIV A;  1QVG A;  1YBY A;  4LF6 L;  5M3F H;  4A4I A;  2BA1 A;  1K73 C;  1LYL A;  4DV4 Q;  2JA6 G;  1KL9 A;  1PFS A;  4JI8 Q;  3HFZ B;  2WAQ G;  2K4K A;  4JBK A;  3G48 A;  4HJA A;  1SRO A;  2YYZ A;  3PUW A;  4AIM A;  3TS0 A;  4BXX G;  1Z9F A;  4HID A;  2ZTD A;  2UUA L;  1RIP A;  3H0G H;  1WCM G;  2VL6 A;  2I0Q A;  1WOC A;  4HJ9 A;  3HOY H;  4X64 L;  4TVA B;  2IT1 A;  4DPG A;  3F2C A;  4A3L H;  4LF7 L;  5IP7 H;  1L1O B;  2NVT H;  2PMZ E;  3MXN B;  3RN2 A;  3GTL H;  4DV0 L;  1Q81 C;  4LF6 Q;  1YVC A;  1BBU A;  1T9H A;  3AFQ A;  4DV6 Q;  1V9P A;  2ZTE A;  5C0X I;  4BY7 H;  4DR5 L;  4TQU S;  4A3E G;  4AH6 A;  4C3J H;  2PNH A;  3B6Y A;  1Q46 A;  1A0I A;  1GVP A;  3K7A H;  2R7Z G;  2H5X A;  2B29 A;  5C3E G;  4OXP A;  3RLF A;  1JJ2 A;  3KYH C;  3HKZ E;  4UP9 A;  1QZG A;  2UXC L;  3K8A A;  5IYD H;  2YTY A;  1UEB A;  2GVB A;  4LF5 L;  2EQS A;  4DKA C;  4JI3 Q;  4A3D G;  1XPU A;  2YTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...