3I4MH

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
137
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLETRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 137
sequence length 146
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mH00
3D31A 4R4QA 1J5EL 3GTKH 3J80c 1Z9FA 1GM5A 4DV1L 1NTGA 4GNXC 4BBRG 5AJ3L 1K8GA 4DV3L 1AE3A 4UP8A 2YU9H 1OTCA 1S3OA 2I5MX 4A4IA 3OW2A 4OX9Q 3HOUG 1HH2P 4A3JH 1VQ5A 3U50C 3NELA 2VUMG 1Q12A 2HT1A 1K73C 3ZJYC 2UUCQ 3HOZH 4A3LG 2RCNA 1IBKQ 1HNZQ 1J5EQ 1UE7A 4B3SL 1VS0A 3TQYA 5HGQA 2UU9L 4B3RL 1AE2A 4L5SA 2K5NA 1PV4A 1TWFH 1EFWA 1XMOL 4JC0A 2OQ0A 4GLVB 1IZ6A 1IXRA 4B3ML 4IJLA 4DR6Q 2AMCB 1VQOA 3HKZG 4HIOA 3IRBA 1N8RC 2D62A 5BR8L 4IPHA 4AIMA 4HJ5A 1XPRA 3CCJA 1L1OC 2QEXA 4JBKA 1EUJA 1L0WA 3K8AA 2NN6G 5H1SE 3BZCA 1P8LA 1HZCA 4P74A 3STBC 4P75A 1JJ2A 2L15A 1N33Q 4X6AH 1NBWA 5IYCG 2ZM6Q 5LMUQ 1TWHH 4YHHQ 1QVGA 1KRSA 4JI0L 4JYAL 1XNQQ 1HNWQ 4PZ8A 4LF4L 4NB3A 4OO1G 4GS3A 1Q1EA 5IYDG 1L1OB 2NVTH 3KFUA 2AHOB 2E8GA 1VQGA 3KOJA 2PI2E 2K14A 3DM3A 2OTLA 3RZOH 4L5RC 1PYBA 1PH7A 3HOUH 4DR5L 4LUOA 2KCTA 1J6QA 1SR3A 2R6GA 2R7ZG 4BY7H 3M9BA 4GOPB 5C4JH 4R4OA 3T1HL 1XNQL 3HOYH 2OQKA 1JJCB 3UE0A 3CCQA 1RL2A 1JJGA 1HJPA 2YTVA 3TS2A 3PO2G 3M85A 4DV3Q 3KJPA 1JMCA 1DGSA 3M7NA 2GN5A 2KHIA 5IT9c 1E1OA 2KENA 2UUAL 4POFA 2C35B 2K5VA 1SLJA 3RLOA 1RIPA 1M1KC 1I94Q 4LF7L 4BXXH 2RHSB 1C0AA 4PZ7A 4LF5Q 5ELNA 2E2JH 4ALPA 1G291 4WJ3M 2VL6A 4POGA 3EIVA 4BXXG 2HQLA 2Q2HA 2WAQE 4B3RQ 4YY3Q 1YJWA 4GN4B 4LF8L 4NPSA 4JI4Q 3I4OA 4KHPQ 4A3BH 2MQHA 2YV5A 1N32L 2XGTA 1X9NA 3K81C 2CCZA 1MJEA 4JV5Q 4JOIA 2UXCL 1OXVA 4UP9A 1XJVA 2BH2A 1H95A 1VQMA 1Q86C 5C0XI 4DV6Q 2VZAA 2VQEQ 5GADC 3S1MH 4DV5L 4A75A 4GKKQ 5C44G 2Q2TA 3CPFA 3PSIA 3L7ZC 2ZTEA 3F1ZA 2NVYH 1QVCA 3S17H 1A8VA 1BBUA 3NENA 3PUVA 3T1YL 3CMAA 5FLMH 3AQQA 3KF8B 3CCMA 3CC4A 3TS0A 2YTXA 3PIPA 1E22A 1Q46A 1ASYA 2R92G 4OXPA 1UE6A 1W3SA 1VCIA 3F2BA 4OWWB 3GTPH 1HR0L 3JC66 1HNXL 1X3FA 1I5FA 1VQ4A 2BA0A 2R7ZH 1E1TA 1CSQA 3M4QA 2VQFL 2ZJPA 4JI8L 2A8VA 4DAYB 5JJLA 2Q2IA 2ASBA 4MNOA 3A74A 3KF6A 1QVFA 2MFIA 2EIFA 1Q82C 2K50A 4DV4L 2CFMA 2NZOA 4JBWA 4DK3C 1N33L 3F2CA 1IYJB 1NJIC 4GN5A 4O2DA 2B63G 1VQKA 2JA6H 1PH9A 1Y1VH 4AQYQ 3UDFA 1XNRL 3J80i 4DV1Q 3J81c 3OYYA 1EYGA 4DUZQ 1I6HH 3RNUA 3EBEA 1KL9A 1LTLA 2JA5G 3PF4A 2Q2UA 1HZBA 3PGZA 3U4VA 4OWTB 4IJHA 1Y1VG 4TQUS 2JA7H 2UU9Q 1FGUA 1CKMA 2YTYA 3UE1A 3PIOA 3W5OA 4AYBG 2UUCL 3PF5A 2NZHA 5C4XH 3HFZB 4OWXB 4DNIA 2MNAA 4DV2Q 3S15H 2Z6KA 3H3VH 4X62Q 4HJ9A 3A5ZB 4B3TL 2WAQG 4YCUA 3G48A 1M90C 4DV7Q 4DAMA 4X66L 2VQEL 1Q7YC 2NVQH 3OTOL 4A3IG 4K0KQ 4JI3L 1BBWA 1TWGH 2ZTCA 3FKIH 5LMNQ 4DV0Q 4A3EH 4A3CH 1Y14B 1KIXA 2BH8A 3K7AH 3H0GG 4IPDA 5IP7G 4LF6L 4A3LH 3S14H 1FJGQ 1QZGA 2I0QA 1Z47A 3CAMA 1C7YA 2OTJA 3S24A 2LXKA 4A3KG 3G71A 1PH2A 2MO0A 3B6YA 4A3DH 4A3CG 1X54A 3CCUA 2LSSA 1X6OA 4UP7A 4IFDJ 4K0KL 3EN2A 3AFPA 3S1RH 4LF4Q 2PMZE 1YNXA 3CMEA 4NXMQ 2Z0SA 3DLLA 3G4SA 1UWVA 3CPWA 1EQQA 4DV4Q 4BBSH 4EQ5A 1WCMH 1XPUA 3NEMA 1A63A 3A5UA 4LFBL 1QUQB 3T1HQ 3J7ZC 1P16A 2HHHL 1MIUA 2R7FA 4NXNQ 1G51A 2VS1A 4P71A 1MJCA 4AH6A 3CCSA 2F52A 2JE6I 2E5LL 2UUBL 2PQAA 4X65L 1YI2A 3PO2H 4KLKA 3GO5A 4DKAC 4KI0A 4A76A 2IX0A 1PH8A 1OXTA 4LF5L 3PUYA 2V1CC 1IBLQ 3PO3H 4A3JG 3S2HH 4IFDI 3J7A5 2Y0SG 2DUDA 2F3IA 2GVAA 4GN3B 4KHZA 3G6EA 1VQBA 4A3BG 3J81j 3RLNA 3PUZA 4HIDA 4DR4Q 4C3IH 1YHQA 4A3EG 1L2FA 4X62L 4DR7L 3I55A 1YJNA 2N78A 4DR1Q 2UXCQ 1VQFA 2JA5H 4EX5A 3CQZH 3GTJH 4DV6L 4JBMA 2B29A 1YITA 1S72A 1CKNA 2IHFA 3S1NH 1N32Q 2JJQA 1SN8A 3E9HA 5J3BA 4JCVE 5BR8Q 3STBD 4IO9A 1WCMG 4DUYL 5C0XG 3GTOH 1LM0A 1U0LA 4LW1A 2UXDL 1X3GA 3ER0A 4C2MH 4A3KH 5FLXc 1Y1WG 4PMWA 1EQRA 4PZ6A 3S1QH 3GTLH 4JI0Q 3HOVH 3PO3G 1BVSA 3M4PA 4X64Q 3U58A 3HOYG 5C0XJ 1HNWL 4QGUA 5GAEC 3AEVA 4R4CA 1PH3A 4PG3A 3GTMH 4QY7A 1S40A 4L5QA 3CP0A 1V1QA 4QQBX 2ID0A 4X66Q 3LGJA 2K4KA 2PI2A 3UDXA 4HIMA 4A3MH 2JA7G 4YWLA 4JI2L 2EXDA 2F4VQ 3JAMc 2B63H 1L1OA 5DLQE 2JA6G 4DR2Q 2JA9A 2GVBA 4B3MQ 1AH9A 1GD7A 4OO1I 1NMFA 5C3EG 4A3GH 1GVPA 4X65Q 1PH6A 3CD6A 2VUMH 3AFQA 5EAYA 1X65A 2JEBI 3I7FA 5GROA 1G6PA 2Z6KC 2ZJQA 1WJJA 1VQAA 4JI2Q 3WWVA 2IY5B 2I5LX 1IL2A 1D7QA 5JEAJ 1B70B 1JB7A 2XTIA 2RF4A 2FXQA 4XIGS 1E7ZA 4DR4L 4R4TA 4DV2L 4LNQA 4DR7Q 3I56A 1VQHA 1PVOA 5JJIA 4B3TQ 1EIFA 1EWIA 1NY4A 3F8TA 5M3MG 1QUQA 4A3FH 1VQPA 1PH5A 2KCMA 1HR0Q 4DPGA 1I3QH 3RR5A 4APVA 5JEAG 1PH1A 2ES2A 4MZ9A 2RHQB 4JI8Q 1N36Q 2AWNA 3I2ZA 2ALYB 2E5LQ 2UUBQ 1GKHA 3HOWG 4RMFA 4HJAA 2A19A 5K36G 3W1GA 1XMQQ 4YCWA 3KDFA 3HOWH 2PNHA 2OCEA 1LYLA 2UXBQ 3A0JA 3RZDH 5GAHC 3T1YQ 3I4MG 4J15A 1Q81C 4AQYL 1XNRQ 1UE1A 1OXSC 2R7DA 1Q1BA 1VQEA 3L2PA 4DR3L 3D0FA 4IOCA 4Y52H 4WJ4A 3NBHB 2VW9A 3VDYA 1FL0A 3KJOA 4A3MG 5JJKA 3BU2A 4JOIC 5IYDH 3ERSX 4A3FG 2VQFQ 1SMXA 4YY3L 4IPGA 5IYBG 4LF8Q 4HJ8A 2JEAI 1CSPA 5FJ8G 4DUYQ 4LUVA 3CCEA 1HNZL 4NXNL 1TXYA 2QA4A 2JK8A 5LMNW 2R93G 4IOAA 1K9MC 4JI7Q 1WYDA 2B3GA 3GTGH 3Q8DA 1OXXK 2AWOA 4GOPC 4LFBQ 4AYBE 2YYZA 1VQNA 3M3YH 1TWCH 4R1JA 3ULLA 2HHHQ 4DV5Q 4JBJA 5LMNL 3KF6B 5M5YH 3S16H 2CQOA 2D0PA 4JI5Q 4DK6C 3CXCA 3ULPA 1IBMQ 4GLAC 4GKJL 1HZ9A 1V43A 1IBLL 3J81i 2WP8J 1VQIA 5M3MH 4JI7L 2ZTDA 5AJ3Q 3PV0A 3ULJA 3K80C 4BY1H 4Y7NH 2HIXA 2D0OA 1YHBA 4GLXA 1JE5A 1LUZA 1YJ9A 1A62A 1N36L 1VQLA 3TRZA 4LF9Q 2QGQA 3RLFA 2K52A 1N9WA 4A3DG 1V9PA 1VQDA 4H02A 3JAMi 1N34L 1UE5A 4BBRH 1IBKL 3OTOQ 1E3PA 3K7UC 4B3SQ 2A1AA 4JI3Q 2H5XA 1UEBA 1OXUA 1B8AA 4DV0L 1CUKA 3HKZE 1EOVA 1XPOA 4JI6Q 4IPCA 3SGIA 4XTCS 1NMGA 1VQCA 1WFQA 4BA1I 5IWAQ 5M3FG 4GNXA 1GO3E 1YZ6A 1VQ9A 3I4NG 5IYBH 4A3IH 2N8NA 3U4ZA 1D8LA 1KAWA 1SE8A 1U5KA 3K0XA 1NE3A 1KRTA 2I5HA 4YWKA 1N34Q 4LFAL 2K75A 4LUZA 4YWMA 5ELOA 4X64L 1VQ6A 1VQ8A 3E0EA 1YEZA 3I4NH 3HKSA 1TWAH 2NN6I 4QL5A 5IYCH 1KC8C 4DR2L 3MEFA 1CKOA 1I94L 3HOZG 4LFCQ 4BA2I 3KDFB 2IHEA 1O7IA 1X56A 1R9TH 3AYHB 1W2BA 3HOXG 1Y1WH 4UY8C 5M5XH 1Q8KA 4DV7L 4LFAQ 4YHHL 2CWPA 3RN2A 2DGYA 1PH4A 1JT8A 3PUXA 2R92H 3E9IA 1XTDA 2NVXH 3H3VI 2N49A 3M4OH 3GDEA 4O0AA 4DR3Q 2WB1G 4FDBA 5C3EH 1KQSA 4OX9L 5M5WH 1PA6A 4A3GG 5FJ8H 4C3JH 1IBML 3GTQH 2EQSA 4GKJQ 4C3HH 2E2IH 4L5TA 4LFCL 1T9HA 1B7YB 1PYSB 1EIYB 2UXDQ 3S2DH 1K83H 4OONA 3CCRA 4A93G 5GQOA 5E7NA 4IFDG 1YIJA 1FJGL 3RN5A 4DR6L 4YCVA 4QJFA 5M3FH 3FKIG 4MTNA 1YVCA 1SFOH 4DUZL 2CKZB 2Y0SE 3W1BA 4JI1Q 3HOVG 1KHIA 4LF7Q 2IT1A 3KLWA 5GAGC 3CC7A 2UUAQ 3CF5A 4JI6L 4BY7G 2ZM6L 3CW2C 4TVAB 3TREA 5LMUL 3H15A 4NXML 2WFWA 1MKHA 2LXJA 3PCOB 1BKBA 2CWAA 5IP9G 1KD1C 1FVIA 3FP9A 1XMQL 2R93H 2KHJA 3KYHC 2UXBL 4JV5L 1CKNB 2ZJRA 3H0GH 1SRUA 3L0OA 5IP7H 5IP9H 4HIKA 1SROA 3ICEA 4JI1L 1VQJA 4JI4L 1XMOQ 1E24A 4KHPL 2MO1A 2JA8G 5C44H 2E2HH 5IY0A 1VQ7A 3BJUA 4LF9L 2HIVA 4GOPA 3CC2A 1I50H 1KXLA 3CCLA 1WOCA 1X55A 4P73A 2OWOA 2JA8H 4ME3A 4HJ7A 2KBNA 4RG1A 5C4XG 1C9OA 1WI5A 3HOXH 4GKKL 2N3SA 4DR1L 4R4IA 2F4VL 1HR0W 2BA1A 3I4MH 2IX1A 4GNXB 5IWAL 3MXNB 4BY1G 1QZHA 1YBYA 3TEHB 4JYAQ 1ASZA 2VNUD 2K5HA 5IE8A 3F2DA 5FLMG 1X3EA 4LWCA 1K3RA 4JI5L 1PHJA 1K0RA 3UDGA 2ATWA 1A0IA 4P72A 3UDIA 1HNXQ 3PUWA 4DR5Q 3CCVA 1K8AC 4A93H 3FHWA 2JQOA 2PQAB 2WB1E 2AKWB 1PFSA 3GD7A 1YHAA 4JG2A 4QIWE 4BBSG 4UPAA 2VY3A 3BZKA 4LF6Q 1HZAA 5HY6A
chains in the Genus database with same CATH superfamily
1EU3A 3D31A 4NW2A 4R4QA 4QIWB 1GM5A 1Z9FA 4GNXC 2HCCA 4XQQA 2YU9H 3NQIA 2A68C 4OX9Q 2A6ED 4A3JH 1HXYD 3DWQA 3WOEA 3NELA 1T5EA 1Q12A 2R7ZB 4A3LG 1HNZQ 1IBKQ 1J5EQ 4B3RL 2KQ3A 1TWFH 1EFWA 1XMOL 2F0TA 4DR6Q 2A69C 4KY5A 4AIMA 1XPRA 2HDMA 1HA5A 1L0WA 3K8AA 2NN6G 2QDBA 1JJ2A 2L15A 1N33Q 2QF7A 1NBWA 5LMUQ 1TWHH 4YHHQ 4I7ZC 1QVGA 1AW7A 4KY7A 4OO1G 4GS3A 2E8GA 1VQGA 2BOSA 1SYDA 2PI2E 2OTLA 3RZOH 1JWUD 5LHY1 4IN3A 2KCTA 4G57A 4HTHA 4C3HG 4KJOA 1SYBA 2K04A 3BYYB 3TP8A 1XNQL 5KNCA 1JJCB 1JJGA 5FLXL 3TS2A 3PO2G 3VYSA 1V1PB 2QW7A 1DGSA 3S15B 1RTNA 3FPPA 2VB3X 2KENA 4POFA 3J80E 4N9PA 1BO0A 1M1KC 4BXXH 1EYAA 1VMCA 2RHSB 2IX3A 2AQ1B 1PYWD 5ELNA 4WJ3M 3EIVA 2Q2HA 4B3RQ 2F0DA 1PTOF 1YJWA 1IKLA 3I4OA 4KHPQ 2MQHA 2YV5A 1X9NA 4DK0A 5LL6X 1I3QB 4X3UA 1QE6A 5C0XI 3C1FA 2VZAA 5GADC 2EOTA 1I6VC 3CPFA 3PSIA 3L7ZC 3NBHA 2CHBD 3S17H 1B44D 3AQQA 2SEBD 5CORA 1E22A 2F0QA 2X6LA 3F2BA 4H44C 4OWWB 3AU7A 3GTQB 2BA0A 3CRLC 2ZJPA 2N88A 4M1UB 2Q2IA 5JJLA 1TS3A 4DNRB 3Q23A 5DAUA 2EIFA 3GV3A 4DV4L 4JBWA 1N33L 3F2CA 2B63G 4A3KB 1VQKA 4IUUA 3UDFA 4I65A 1DYQA 4H7BA 3OYYA 1ILQA 5EGTA 3RNUA 2F0SA 1KL9A 3EBEA 3PF4A 2Q2UA 3PGZA 4FF2A 2AUKA 3PIOA 4AYBG 4A3EB 3NK9A 5C4XH 4DV2Q 3J80L 2JP1A 4X62Q 2WAQG 4DV7Q 2ZTCA 5LMNQ 2KHSA 3W3AA 3H0GG 3K0YA 4DA2A 1FJGQ 1QILA 3KLSX 3C3LA 1B50A 3OW7A 1STNA 2F0MA 3NHHA 3DXJC 4B9WA 4A3CG 1K8MA 1X54A 1X6OA 4IFDJ 3EN2A 3VYRA 1AZQA 1M4VA 2PMZE 3T13A 1PTOH 3DLLA 1LV9A 1UWVA 1EQQA 4EQ5A 1WCMH 1O7YA 1E2WA 1ML0D 3A55A 3T1HQ 1G6ZA 1WCMB 3J7ZC 1MIUA 5KEEA 4NXNQ 2VS1A 3CCSA 4P71A 4A3FB 4X65L 4KLKA 4A76A 1OXTA 5A35A 4EQPA 3PUYA 3S2HH 3QOLA 2Y0SG 1KDBA 4GN3B 1DCZA 2A6HD 3PUZA 4N9TA 3NWTA 1E2ZA 3RLNA 2F4IA 4A3EG 1YJNA 2JA5H 4OIKA 2MPMA 3I70A 3IKJA 4ILWA 4CJ0B 1N32Q 2FINB 2JJQA 1F77A 1A3VA 1SN8A 3STBD 4XYOA 1H9KA 1K28A 4F88A 3S1QH 4O42A 4JI0Q 1BVSA 3M4PA 1HNWL 2KCCA 4QGUA 3AEVA 4Z9CB 4PG3A 3GTMH 5D3IB 4QY7A 4BWGB 3N6RA 4BS9A 1V1QA 3UDXA 4HIMA 2JA6G 3Q22A 4B3MQ 4HSPA 3M3YB 5C3EG 3QWNA 2AQ2B 5D14A 1PH6A 4A3IB 1E0BA 3AFQA 2V4DA 3A56A 1DXMA 3I7FA 1Q90A 4YIJA 4JI2Q 3WWVA 3SK8A 1H9SB 3PO3B 5JEAJ 1ZYRD 2D5DA 5CV6A 1E7ZA 3X3NA 5IOCA 4DV2L 1BOSA 4PV1C 1QWYA 1QUQA 4RAUC 5JAVA 2KCMA 3BYTB 4DPGA 3RR5A 5DM63 4ZRZA 2RHQB 2AWNA 2EJMA 2E5LQ 3HOWG 1T5XD 4FXKC 1XYIA 3W1GA 1LT5D 3KDFA 2PNHA 4JVZA 3LWEA 1YNNC 4J15A 1XNRQ 1VQEA 3GTLB 4DFAA 4WJ4A 4DXGA 3NTHA 2VW9A 2DN8A 1G8ZD 5M5WB 5JJKA 4JOIC 1RODA 2VQFQ 1SMXA 4YY3L 5AFWA 1U4RA 1CSPA 2I46A 5M5XB 3SDZA 3CCEA 1HNZL 2PZWA 3RMHA 5E1FA 3M4OB 2B3GA 2F0IA 4DAYA 4GOPC 1VQNA 3S16H 2CQOA 2HD3A 4JI5Q 1S5CD 4DK6C 3V96A 1IBMQ 3AB9A 3R2TA 4NMZA 3MFGA 1ICWA 4BY1B 2XWBB 1NCVA 1TS4A 3PV0A 3TSSA 3L3OC 4BY1H 4GLXA 1JE5A 1LUZA 4ABNA 3TRZA 1BUVT 3K58A 3RUZA 4KK7A 2FMCA 2K52A 4KD3A 3S9WA 3NBIA 1VQDA 2QKIC 4H02A 5C44B 1N34L 1UE5A 4BBRH 3PQIA 1IBKL 2NB0A 4B3SQ 1UEBA 4DV0L 4OELB 2K32A 1XPOA 4JI6Q 1O80A 1NMGA 5ISRA 1WFQA 4IUVA 1BXTA 1SE8A 4PNYA 1NE3A 2RSOA 2K75A 2O5IC 2CH4W 4LUZA 4YWMA 5ELOA 1VQ8A 3E0EA 3I4NH 1PFBA 2OF1A 1KC8C 1ET9A 3MEFA 1CKOA 2IHEA 1O7IA 4FF3A 3QIAA 3L9AX 1JT8A 1R9TB 3ZYYX 2KA7A 1XTDA 3GDEA 4DR3Q 4FDBA 5C3EH 2EZVA 5FJ8H 1YNJC 3GTQH 2EQSA 1WD1A 3DMUA 1PYSB 1I4QA 1K0SA 5EPKA 1K83H 4KY6A 3H3VC 5DNFA 5E7NA 4IFDG 4MN3A 1EY4A 3KK7A 1TQOA 3GTGB 4L6TB 4YCVA 1K3BC 4V190 1YVCA 4TRDA 4CDFC 2CKZB 2Y0SE 3E5SA 1B4OA 5KRUA 1CZWA 1PRTB 1S5DD 1F2ZA 2ZM6L 3CW2C 4H0LC 4TVAB 3TREA 3H15A 3KYHC 2TSSA 5IP7H 3ICEA 4HIKA 1SROA 4RA8A 3R2IA 1E24A 1J8IA 3HS0C 2EYFA 2MHVA 3DWPA 2J7ZA 2HIVA 4GOPA 1I50H 1STGA 4P73A 1ENFA 4CKEA 4ULLA 2BA1A 3I4MH 4HAEA 2VNUD 2OEOA 4P2CB 3VR2A 3F2DA 1X3PA 5FLMG 1X3EA 4JI5L 1W6JA 4JW0A 5E3FA 1VF7A 4ZKBB 1HNXQ 3PUWA 1IKMA 1PRTD 1K8AC 4A93H 2JQOA 4A3EH 3I4LA 3K5LA 4G4KA 2BDNA 2NN6H 2M00A 3BZKA 4QB4A 3J7YW 4MHEA 1CQVA 3HRZC 1NTGA 1EYDA 4BBRG 1CA5A 3A8KE 4RFBA 1S3OA 2F3VA 5ELFA 4A4IA 4DXFA 3OW2A 3HOUG 3IFDA 3MAQA 1VQ5A 1I4PA 1S5BD 3HOZH 4CJ1B 1TKWB 1UE7A 4ZUIA 3KF8A 1VS0A 4CDEC 5HGQA 1VDZA 4B3ML 1IXRA 4IJLA 1SJHD 3HKZG 3Q6SA 1FR3A 2D62A 5BR8L 4KN4C 3RZDB 4IALA 3STBC 4X6AH 4AYBB 5IYCG 2Z6BA 1KRSA 1HNWQ 4V0BA 1Q1EA 2NVTH 1L1OB 1LACA 3DM3A 3CRKC 3D6CA 1EZ6A 1PH7A 3HOUH 1CI3M 4Q5VA 2R7ZG 2KJXA 2R61A 5I9OA 4HCSA 5I4DA 1XX8A 3HOYH 4WORA 2JA5B 3E3XA 3UE0A 1GOZA 1TS2A 3HEJA 4XXEA 4S3SA 2GN5A 1I4GA 1L0YB 1E1OA 2C35B 1SLJA 5CR3A 4LF7L 1C0AA 4PZ7A 4ALPA 3S1QB 2VL6A 4TSSA 2HQLA 2EYOA 4JI4Q 3DEOA 1SE2A 1CA6A 2EY1A 5COYA 2BH2A 5ELEA 1XJVA 1H95A 3A8IE 2VQEQ 2Q8RE 2Q2TA 1SE4A 4C3HB 4DN4M 2SNSA 2ZTEA 3F1ZA 1QVCA 4OEMB 1TT2A 2DJFC 2Z9HA 3PUVA 2BCOA 3HOWB 4BBSB 1H9JA 3TS0A 2YTXA 3PIPA 2H1EA 2R92G 1FNVA 1UE6A 4OXPA 2HQEA 5I2YA 1I4XA 1X3QA 3JC66 3GTPH 1VQ4A 1U4PA 1EEID 5HGTA 1IW7C 3M4QA 5T1GA 2VQFL 4JI8L 2ASBA 4MNOA 1DD2A 3KF6A 4FVMA 4CKCA 4C1NK 2EYMA 3J81L 1Q82C 2NZOA 4DK3C 4JK1C 3EROA 3EQLC 4RGNA 2E2DC 3D3RA 2JA6H 3E6ZX 1V8QA 1UEAB 1CK1A 1JC7A 3VR3A 5D3DA 4DUZQ 1I6HH 1WTHA 2JA5G 1SDFA 1GUGA 1TWHB 4IJHA 1Y1VG 2JA7H 1CKMA 2A5HA 3UE1A 1HUMA 1S5ED 1EY9A 4IURA 1ILPA 5EKIA 5K5PA 4OWXB 2K7VA 1S5FD 3H94A 4B3TL 1D1IA 4DAMA 4X66L 2VQEL 5KYLA 3FKIH 2I07B 1KIXA 4QCLA 4IPDA 4ME5A 4LF6L 5IT9L 4A3LH 4FYDA 3BDLA 3BDOA 2OTJA 3S24A 1Y8PB 3S1RB 3G71A 3NUCA 3HKZB 4A3GB 1R4PB 1PTOB 3S1RH 1LT4D 4LF4Q 3JAME 1KNEA 1YNXA 2PPBC 2DNCA 1SAPA 2Z0SA 4K6LA 3DWAA 3CPWA 3A5UA 3VR4A 1P16A 3NSWA 2MJ8A 1DOKA 1TR5A 1D5MC 3KLSA 2B2TC 2PQAA 1YI2A 3U9OA 4DKAC 1PZJD 1A15A 4KI0A 2IX0A 1MHWC 1CHQD 4LJZC 3S17B 3VR6A 2VXWA 2DUDA 2F3IA 2GVAA 1BR9A 3G6EA 4A3BG 4C56C 2OT2A 3E0JA 2UXCQ 4KTAA 3CHBD 4B08A 2F03A 4DV6L 2B29A 1YITA 2CVRA 4PMBA 1S72A 1CKNA 3KLRA 3K5MA 1ZYRC 1D5ZC 4J1MA 4IO9A 5C0XG 3GTOH 4FO2A 1U0LA 1X3GA 2K03A 4C2MH 2WINB 3HOVH 4CDCC 3PO3G 4C3JB 4KD4A 1HTLD 2EYLA 5E4WC 4RHRA 5CV5A 3MXNA 4L5QA 4A3MB 2BDOA 1RTOA 4X66Q 2B63B 2K4KA 5BN5A 1II3A 4A3MH 4YWLA 3NTKA 3JAMc 2B63H 2MUYA 1AH9A 1NR2A 1GVPA 3KBGA 4C3IG 3FMCA 5EAYA 5GROA 2RKSA 4IUPA 2Z6KC 1G6PA 1QB5D 1LO5D 1VQAA 5FLXE 3GTPB 1LTAD 1DJRD 1JB7A 2XTIA 4RGOS 2EPBA 1SYEA 5EPJA 1KDCA 3HOZB 3I56A 1VQHA 5JJIA 1K8OA 4XT3B 4B3TQ 5M3MG 1NY4A 4H13C 5JEAG 1PFNA 1N36Q 1F9RA 2JA6B 2NUCA 3A8JE 5F2DA 2NWGA 3K6OA 2A19A 1LT6D 3HOWH 3QJYA 5C4ZA 2RQXA 1EFID 1LYLA 2OCEA 4KN7C 2UXBQ 2E2IB 3RZDH 5GAHC 4FXGC 2XRSD 4AQYL 1UE1A 5CYUA 5CBEE 3L2PA 5IGDA 4Y52H 1LTID 3NBHB 2MP1A 2XNAC 5KNBA 1O78A 4A3MG 3BU2A 4RCOA 2JYOA 4A3FG 2JSOA 3GTKB 4C3JG 1EY5A 3K7AB 4WJWA 1TXYA 5LMNW 1KABA 2B2UC 3GTJB 2EE1A 3GTGH 5BN4A 3Q8DA 1XXGA 4LFBQ 2YYZA 3M3YH 3ULLA 4DV5Q 2LMCB 5M5YH 3Q24A 3ULPA 4GKJL 4CJ2C 4KKSA 2KEEA 1HZ9A 1V43A 4K14A 3R3OA 2ICIA 1VQIA 1SBBB 2PW7A 3K80C 2K5WA 4Y7NH 1YHBA 1A62A 2L1BA 3LWUA 3G7LA 1N9WA 2IL8A 3K5OA 4OGQC 1E3PA 3K7UC 4JI3Q 2H5XA 1OXUA 1B8AA 1JWMD 1CUKA 3FDTA 5G3LD 1EQTA 3SGIA 1VQCA 3SK6A 1QG7A 1VQ9A 1R4QB 5T1IA 3D8GA 2Q8IB 4A3IH 1KAWA 1JORA 2M2LA 2ENBA 3HOUB 3VA5A 1GUWA 1L0XB 1PFMA 3IFTA 1I4HA 4XQJA 2F0GA 4X64L 3HKSA 3CQZB 2FFKB 2A73B 2NN6I 2XN9C 4QL5A 4DR2L 1I94L 4LFCQ 3T53B 1R9TH 3HOXG 1Y1WH 2QEJC 4DV7L 4LFAQ 4YHHL 5D65A 1PH4A 3PUXA 3M4OH 3H3VI 2WB1G 4A3GG 1KQSA 4C3JH 4GKJQ 1Q8IA 3BZDB 4C3HH 4L5TA 3WOFA 2UXDQ 3CCRA 3T56B 2RBMA 4QJFA 5M3FH 2WIIB 1BBXC 4DUZL 2F0PA 1BCPC 1GUTA 5JPNC 2IT1A 3MTSA 1GUOA 3UI2A 2O4XA 2K5DA 5GAGC 1I6HB 3CF5A 4BY7G 1FGBD 2RA4A 2WFWA 1MKHA 4ZK9B 4OL7A 2LXJA 3OOCA 3FP9A 2R93H 1TWFB 1HCZA 3D4WA 4JV5L 3GQBA 1HFGA 5IP9H 3BVGA 1A3TA 1VQJA 1XMOQ 3G6JB 4KHPL 3LNNA 4ID6A 2RVLA 3SK4A 3CC2A 1H9MA 1AEXA 1F9SA 3P7JA 1WTQA 2GA4B 2KBNA 1FNUA 5EQ0A 1B9NA 1ENCA 1EOTA 3HOYB 1V1PA 1QNKA 4GNXB 5L37A 2E75C 4QUCA 4A3DB 3KBXA 2QCPX 4LWCA 4R9WA 1PHJA 1A0IA 1LABA 3OMCA 1DOLA 3UDIA 2LKVA 4X3KA 2AKWB 3FHWA 1TY2A 1YHAA 3GD7A 4BBSG 2VY3A 1K83B 1HZAA 4OO1I 1AFPA 4OHJA 1WD0A 3GTKH 2R92B 3ND9A 5AJ3L 1K8GA 5JPMC 1H9SA 4UP8A 1OTCA 3ERQA 4DAPA 1YNJD 5ELCA 2SOBA 4K5XA 3U50C 2VUMG 5CC4A 1K73C 2UUCQ 1STBA 3MVVA 4K8IA 4B3SL 3TMEA 3TQYA 4R8NA 2UU9L 3BDCA 1AE2A 4L5SA 1SE3A 2OXPA 1PV4A 1G2TA 4K2KA 5M3MB 2AMCB 4ZLTF 1VQOA 3IRBA 1ZKOA 1Z6HA 2H4OA 1IYUA 4HJ5A 3F2UA 1C4QA 2QEXA 4JBKA 1EUJA 5H1SE 2DY7A 3BZCA 1JCKB 1P8LA 1HZCA 4FF1A 3TZDA 2PZUA 5DM73 4JYAL 2NVTB 1SFOB 4LF4L 1F2LA 5IYDG 2AHOB 2F0HA 5IT9E 4L5RC 5C5MA 4OIJA 4DR5L 4LUOA 2QILA 1M8AA 2R6GA 3M9BA 3P20A 5C4JH 2NVQB 4LK1C 3H91A 1LLRD 4HN7A 4CBVA 1BCPD 1RKNA 3CCQA 1HJPA 4UDUC 4KV6A 3KJPA 3S1NB 2K05A 1I50B 4HSVA 3M7NA 1STYA 3TP5A 1JB3A 3I3CA 2X69A 2UUAL 1QOHA 3ONAB 4XDXA 2A69D 2K5VA 2A74C 2E2JB 2IW3A 2WAQB 1RIPA 3NXWA 4RWSC 4GZYC 4G7OC 5IGBA 1TWAB 4RH6A 1BCPB 2E2JH 1G291 4POGA 4BXXG 1LTBD 1KTKA 3OHXC 2YU9B 3K81C 1OXVA 2NVXB 5FO9B 4A3BB 1Q86C 1X32A 2F3WA 1KLUD 4DV5L 4A75A 2ZXOA 3S14B 1C48A 1Z7TA 3CMAA 5FLMH 1D2BA 3CCMA 3OPOA 3CC4A 1A3UA 1Q46A 1ASYA 1W3SA 1X3FA 1I5FA 2R7ZH 1E1TA 1TIID 5C4HA 3H6MA 4K5WA 3NP8A 2HCIA 5M5YB 2E2HB 1QVFA 2K50A 2NTTA 3BG3A 3KUPA 2CFMA 2XIWA 2G9DA 3QR8A 1IYJB 1NJIC 1MGSA 2RDHA 3EFXD 4GN5A 3M7GA 4AQYQ 1LTTD 4EQOA 1PDQA 4DV1Q 1E2VA 3J81c 1EYGA 1LTLA 1HZBA 2PCFB 3DHQA 2UU9Q 1FGUA 2YTYA 4C3IB 1IW7D 3W5OA 1PTOD 1MSGA 4DNIA 2MNAA 3SEBA 3S15H 2L5TA 3H3VH 3HOVB 3A5ZB 3G48A 3CKIB 1M90C 1AZPA 2Z4HA 1Q7YC 2CW0D 3M4YA 4JI3L 1TWGH 4A3CH 1Y14B 3K7AH 2K1BA 2K01A 5NUCA 1A6XA 1QZGA 2I0QA 1Z47A 1GUNA 2DJGC 3CAMA 3H09A 3TZUA 4EVOA 1EU4A 2EYPA 2L4NA 2LXKA 1B2TA 4A3DH 2MO0A 3B6YA 4NP5A 5FOBB 4UP7A 2KVMA 4K0KL 5TSSA 2G5DA 3CMEA 4NXMQ 3MWYW 2EXZA 2NVYB 5KGUA 4DV4Q 5G3LF 2F0NA 3FRPB 3NEMA 1XPUA 4Y7NB 4LFBL 1QUQB 2R7FA 2IWHA 2B8GA 4FXDA 3VYUA 1MJCA 1EY0A 2F52A 2JE6I 2E5LL 1NNXA 1PH8A 1KNAA 3P1HA 2V1CC 5J22A 3PO3H 1NR4A 3J7A5 4HIDA 1YHQA 1L2FA 3OWEB 4X62L 2WV6D 1MI2A 2N78A 5CV7A 3I55A 1VQFA 4DR7L 4F8MA 2CH4A 3QG1A 4TKOB 3P75A 2N55A 3CQZH 3T16A 4EX5A 5CV8A 4U68A 3S1NH 3VR5A 3E9HA 5J3BA 4JCVE 5BR8Q 5CMDA 3DUZA 3W2DA 1JOOA 2UXDL 1HPCA 2WACA 1F2MA 2AUJD 3ER0A 4A3KH 5FLXc 2Z4IA 1TY0A 5CBAE 1EQRA 1Y1WG 2K6AA 1SYFA 4PZ6A 4RGTA 3GTLH 4X64Q 3U58A 5C0XJ 1PH3A 3N52A 2ZT9C 3NE5B 1S40A 1VMPA 3S2DB 1ESRA 4JPBW 2JA7B 2TMPA 3LGJA 2PI2A 2JA7G 2Z8LA 4L8JA 1L1OA 4KKUA 1JICA 2JA9A 4A93B 1GD7A 2B39A 1B1ZA 1NMFA 2MGSA 2JXMB 2NTSA 2NZ1D 3D6WA 4X65Q 1XWEA 3CD6A 3FKIB 2VUMH 1JOKA 5BN3A 1X65A 2JEBI 2XWJB 1LT3D 3ND8A 2ZJQA 1HRJA 1WJJA 1PLFA 2I5LX 4R8IA 1IL2A 5ELBA 1D7QA 1B70B 3IAYA 2RF4A 2FXQA 4XIGS 4R4TA 1KLGD 5CV9A 4LNQA 1S4ZA 4DR7Q 1PVOA 4DNTB 1EIFA 1EWIA 4A3FH 3K59A 1PH5A 1HR0Q 3PO2B 4APVA 2PZTA 4MZ9A 4JI8Q 4IZ8A 1RD9D 1GKHA 1NUCA 4HJAA 4IFDH 2E76C 1B53A 1ET6A 1TVXA 3BVZA 1W6KA 4WRDA 5FKAC 3A0JA 2HDLA 3T1YQ 1OXSC 2R7DA 1Q1BA 4DR3L 4IOCA 4DK1A 5JVH3 1RHPA 3VDYA 2JN4A 1FL0A 3KJOA 1ESFA 1Y8NB 3ERSX 4G7ZC 2BE5D 1CFMA 5IYBG 4IPGA 4LF8Q 4HJ8A 1UUPA 5FJ8G 5EBDA 3MXPA 4NXNL 2B8FA 2JK8A 2R93G 4IOAA 1LTGD 1Y1VB 4JI7Q 2SNMA 5C5LA 2AWOA 3NQTA 5C3EB 2K5QA 1Q3LA 2HHHQ 4JBJA 3KF6B 3HG9A 2D0PA 1TWCB 4FNFA 3V05A 3WDNA 1IBLL 3J81i 1CT1D 2WP8J 5M3MH 2EY5A 2ZTDA 5AJ3Q 4K6DA 2DNEA 5KNDA 3R93A 2D0OA 2ZXRA 2Y0SB 4LF9Q 2QGQA 5EPLA 5A2QL 2AQ3B 4A3DG 1CZGA 1V9PA 3JAMi 3OTOQ 2A1AA 4FF4A 1HA6A 3URYA 4QMGA 1MD2D 1EOVA 1FNWA 3HKZE 4IPCA 4XTCS 5M3FG 5IWAQ 1GO3E 1YZ6A 3I4NG 1BCPF 5IYBH 5J39A 4X3TA 2N8NA 3SXHA 1D8LA 3A7AB 2I5HA 3D4RA 4YWKA 4LFAL 1EWHA 1PTOC 1YEZA 2ICEC 5IYCH 4B9XA 1JQYD 3HOZG 4BA2I 1EY6A 3MA2B 3DM1A 1ENAA 3KDFB 3AYHB 4O1NA 5M5XH 1Q8KA 2CWPA 2J4XA 2N49A 2CQAA 4O0AA 3PIP3 3T4AC 5M5WH 1PA6A 1SMYC 1IBML 1EY7A 2E2IH 2QDLA 4LFCL 1T9HA 3S2DH 4OONA 5C6AA 4A93G 1YIJA 1FJGL 2C9OA 1MSHA 2FJ2A 3FKIG 4MTNA 1SNDA 1SNPA 1KHIA 1CHPD 1RF2D 1B3AA 2IJ0A 5ELDA 3D4DA 5JOBA 3KLWA 4RCNA 3CC7A 4JI6L 5HURA 2Z1CA 4NXML 3PCOB 2CWAA 1FVIA 2M9VA 1EWCA 1XMQL 2UXBL 1CKNB 2L0CA 1SRUA 3I72A 3L0OA 1EQVA 4JI1L 1JWSD 4JI4L 1KDAA 1A2TA 1SNQA 4I7AA 2JA8G 5C44H 1G91A 2E2HH 5IY0A 1SXTA 3I73A 4LF9L 1KXLA 3CCLA 2EYJA 1WOCA 2JA8H 3O13A 4DU9A 3I4NB 4ME3A 5C4JB 2K33A 4GKKL 4KJNA 4DR1L 4R4IA 2F4VL 1GHKA 1HR0W 2KCNA 1PZKD 2IX1A 5IWAL 3MXNB 1TS5A 1YBYA 1EZ8A 3TEHB 1Y1WB 1ASZA 2K5HA 2F0LA 1K3RA 4NDXA 3UDGA 2ATWA 2F0OA 5CGKA 4QIWE 2WB1E 1CM9A 1PFSA 5IODA 4JG2A 5EKLA 2PMZB 4UPAA 4OO1H 2LY7A 5LL6S 2B2VC 2PW5A 2FHTA 1J5EL 1UNSA 5E4XA 3J80c 4DV1L 2PNRC 2RSNA 4DV3L 1AE3A 1HQMC 2I5MX 4PQXA 2B2WC 4IUNA 4ZUJA 1HH2P 2HT1A 3ZJYC 4EQNA 1WTPA 2RCNA 2O2LD 2XSCA 4IUTA 2WKCA 4ZAIA 2K5NA 3MXUA 1Y8OB 1SJED 4JC0A 2OQ0A 4GLVB 1IZ6A 3NWSA 2KECA 3TP7A 4HIOA 1N8RC 4IPHA 4LAAA 1L1OC 3CCJA 5FO7B 2F0UA 4P74A 4P75A 5FO8B 2A6EC 2ZM6Q 4CHTB 4ZCKA 4JI0L 4UAIA 1XNQQ 4PZ8A 4NB3A 3KFUA 2L11A 3KOJA 3BS1A 1F2YA 2K14A 1PYBA 3RZOB 1J6QA 1SR3A 2VUMB 4BY7H 4GOPB 1PRTF 4R4OA 4DGZA 3T1HL 4BY7B 2HUGA 4EGVA 1QJOA 2OQKA 5JEAH 5EKKA 1RL2A 3PIO3 4XYQA 3HP3A 2YTVA 3M85A 4DV3Q 5DEHA 1JMCA 4K8JA 2L12A 2KHIA 5IT9c 5FK9C 4E6IA 2A6HC 3RLOA 1I94Q 1FD7D 4K5VA 4LF5Q 5C4XB 2F0FA 2WAQE 3TP6A 1Y69U 4YY3Q 1IYVA 4GN4B 4LF8L 4NPSA 2B2TA 3OSOA 4RKLA 4A3BH 1AN8A 2IPKD 3SHLA 2XGTA 1N32L 2CCZA 4JV5Q 1MJEA 4JOIA 2UXCL 4UP9A 1VQMA 4PMCA 5C0XH 4DV6Q 1D1KA 2L9HA 3S1MH 4GKKQ 4L63B 5C44G 4KHVA 1I4RA 2NVYH 3MZ5A 1A8VA 1B9MA 1BBUA 2KOLA 3NENA 3T1YL 3RD4A 3SVMA 3KF8B 2LFNA 2D9UA 1BF4A 1PRTC 3LX0A 2B2VA 4IFDI 1PMRA 1VCIA 1HR0L 1HNXL 1J9OA 1G2SA 5IGEA 1CSQA 2ZXPA 2A8VA 4DAYB 5IIFA 2B2WA 3A74A 2MFIA 4X3SA 5I2XA 3VA7A 4HR7B 2VB2X 1WTXA 2X6GA 3I8ZA 4O2DA 4C2MB 1EEFD 1PH9A 1Y1VH 1XNRL 1JR0D 3A7LA 3R8BA 4DAVA 3J80i 2B2YC 3S2HB 3BVMA 2EJGC 4N8FA 1U4MA 1DM0B 3U4VA 1CQFA 1ZXTA 4OWTB 4TQUS 2O5JC 4DF7A 2EDGA 2UUCL 1WTOA 3PF5A 2NZHA 3HFZB 3I4MB 1QCBD 2Z6KA 4HJ9A 1U4LA 4YCUA 2J0TD 2NVQH 3OTOL 4A3IG 4K0KQ 1BBWA 4DV0Q 2WKDA 2BH8A 5IP7G 3T51B 1WTWA 3QOJA 3S14H 2F0WA 1C7YA 5K36H 4A3KG 1EIHA 3J7AV 1PH2A 3CCUA 2LSSA 2XVSA 3AFPA 3K57A 1YNND 3SR1A 1C8CA 2F0VA 3U9SA 2RDFA 1WTRA 3C2PA 3G4SA 4HCEA 2FMMA 3TBIB 4BBSH 1A63A 1F9QA 4ZQ3A 1NAPA 2E74C 2HHHL 1BQQT 1G51A 4AH6A 4M8AA 3QO2A 1GHJA 1FYCA 3A54A 2UUBL 3PO2H 3GO5A 1B3QA 4A3JB 1ONLA 1HUNA 4LF5L 1IBLQ 4A3JG 2KEDA 2R3ZA 1ICFB 4KHZA 5KIXA 1VQBA 1OO9B 3J81j 2F0KA 3EA6A 4C3IH 4DR4Q 1PXUA 1GJXA 4DR1Q 3PMFA 2R93B 3GTJH 4JBMA 5EJWA 4KKTA 1XTCD 2IHFA 4NKLA 3V2TA 1DOMA 3MHBA 1WCMG 3MC0B 4DUYL 1LM0A 3NTIA 2C5CA 4LW1A 4MIUA 4ODGA 3I91A 4PMWA 1DZ1A 3HZXA 3HOYG 1SNMA 5GAEC 4R4CA 3IL8A 5M9OA 3CP0A 2EYHA 3VYTA 4QQBX 2ID0A 3J7AF 3NPPA 1SNCA 5JJZA 4RHSA 2B2YA 2JA8B 5KYIA 2EXDA 2PQEA 1HTPA 5JVG3 4XQNA 4JI2L 5DLQE 2F4VQ 4DR2Q 4F87A 2GVBA 4A3GH 1H9RA 2EY6A 1JE4A 1TWGB 2F1MA 1SYCA 1SYGA 2IY5B 1HHVA 1U9RA 3QB3A 3H0GB 4DR4L 4C1NI 1JOQA 1PZID 5I9PA 3K5NA 3SE0A 4RKBA 1VQPA 3F8TA 2G9HD 1I3QH 1PH1A 2ES2A 1CTMA 4ZYSA 2RCFA 3I2ZA 2ALYB 4QUFA 3EVQA 2UUBQ 4RMFA 3C1EA 3MFYA 4N8X1 3OMGA 5K36G 1XMQQ 4YCWA 5A2QE 1RDPD 1TU2B 2Q8TA 3OIPA 3CU7A 3I4MG 1Q81C 5IGCA 4WFN3 1STAA 1V1OA 3D0FA 1EL0A 4U673 4RGMA 4QF4A 5IYDH 1EIGA 2JEAI 2CW0C 4LUVA 4DUYQ 4F7XA 3AMUA 5IGGA 2P5ZX 4HMIA 2QA4A 1K9MC 1WYDA 1OXXK 4LMQD 4AYBE 5M3FB 1STEA 4IQZA 1TWCH 4R1JA 2LS01 5LMNL 1GUSA 3CXCA 4GLAC 3SK5A 3J81E 3JAML 3MEHA 4CKBA 1O7ZA 4K2LA 4JI7L 1SNOA 1BDOA 1F9PA 1VF5C 3ULJA 1HQRD 2HIXA 1YJ9A 1VQLA 4J6HA 3FPUB 1N36L 3FEWX 2A68D 3RLFA 3I90A 5CV4A 1WVLA 1DONA 4BBRB 2L55A 4BA1I 1KAAA 4GNXA 1NSNS 3GV6A 3U4ZA 1WTVA 2NBFA 1LTSD 1U5KA 3K0XA 5EBCA 2KUMA 1KRTA 3TN2A 1HFNA 1N34Q 1VQ6A 3C46A 1TWAH 1D6EC 2EY2A 2BE5C 4J8QA 1X56A 1W2BA 1SEBD 4UY8C 2XRQD 4HMJA 3RN2A 2DGYA 2R92H 3E9IA 2F0EA 2NVXH 3DEPA 2SDFA 1RJTA 3MXGA 1EY8A 2EVBA 4UHVA 4G7HC 4OX9L 2PO4A 3GP7A 2F0JA 2DY8A 1ZEQX 1B7YB 4XT1B 1GXDC 1RCVD 1EIYB 1IHZA 5I6YA 5GQOA 3GTOB 1LTRD 5J1ZA 4FP5D 3RN5A 3TDQA 4DR6L 1EYCA 4HEDA 3S1MB 1SFOH 3W1BA 4JI1Q 3S16B 3HOVG 4LF7Q 1O7LA 3GTMB 4CGYB 1STHA 2PYKA 4ZKCB 2UUAQ 5IGFA 5LMUL 5C3WA 5IP9G 1BKBA 1KD1C 2KHJA 1AP0A 1D5XC 3Q0AA 2ZJRA 3H0GH 3OIQA 2RDGA 1QNUA 4Q0FA 2B2UA 2MO1A 3FVQA 1VQ7A 3BJUA 1BNZA 1X55A 2OWOA 1A2UA 4HJ7A 3ITPA 4RG1A 5C4XG 1C9OA 1WI5A 3HOXH 5C3XA 5I6WA 3EJIA 2N3SA 1UAPA 1MBYA 2D2CC 3HOXB 4BY1G 3HGBA 1QZHA 4JYAQ 5IE8A 4CDDC 1K0RA 2WB1B 3OWFA 2NYZD 1SMYD 4MTKA 4P72A 4KMUC 2K28A 4DR5Q 1IL8A 2EJFC 3CCVA 2PQAB 1SSOA 3X3MA 4LF6Q 4IUQA 5HY6A
chains in the Genus database with same CATH topology
3D31A 4R4QA 1J5EL 3GTKH 3J80c 1Z9FA 1GM5A 4DV1L 1NTGA 4GNXC 4BBRG 5AJ3L 1K8GA 4DV3L 1AE3A 4UP8A 2YU9H 1OTCA 1S3OA 2I5MX 4A4IA 3OW2A 4OX9Q 3HOUG 1HH2P 4A3JH 1VQ5A 3U50C 3NELA 2VUMG 1Q12A 2HT1A 1K73C 3ZJYC 2UUCQ 3HOZH 4A3LG 2RCNA 1IBKQ 1HNZQ 1J5EQ 1UE7A 4B3SL 1VS0A 3TQYA 5HGQA 2UU9L 4B3RL 1AE2A 4L5SA 2K5NA 1PV4A 1TWFH 1EFWA 1XMOL 4JC0A 2OQ0A 4GLVB 1IZ6A 1IXRA 4B3ML 4IJLA 4DR6Q 2AMCB 1VQOA 3HKZG 4HIOA 3IRBA 1N8RC 2D62A 5BR8L 4IPHA 4AIMA 4HJ5A 1XPRA 3CCJA 1L1OC 2QEXA 4JBKA 1EUJA 1L0WA 3K8AA 2NN6G 5H1SE 3BZCA 1P8LA 1HZCA 4P74A 3STBC 4P75A 1JJ2A 2L15A 1N33Q 4X6AH 1NBWA 5IYCG 2ZM6Q 5LMUQ 1TWHH 4YHHQ 1QVGA 1KRSA 4JI0L 4JYAL 1XNQQ 1HNWQ 4PZ8A 4LF4L 4NB3A 4OO1G 4GS3A 1Q1EA 5IYDG 1L1OB 2NVTH 3KFUA 2AHOB 2E8GA 1VQGA 3KOJA 2PI2E 2K14A 3DM3A 2OTLA 3RZOH 4L5RC 1PYBA 1PH7A 3HOUH 4DR5L 4LUOA 2KCTA 1J6QA 1SR3A 2R6GA 2R7ZG 4BY7H 3M9BA 4GOPB 5C4JH 4R4OA 3T1HL 1XNQL 3HOYH 2OQKA 1JJCB 3UE0A 3CCQA 1RL2A 1JJGA 1HJPA 2YTVA 3TS2A 3PO2G 3M85A 4DV3Q 3KJPA 1JMCA 1DGSA 3M7NA 2GN5A 2KHIA 5IT9c 1E1OA 2KENA 2UUAL 4POFA 2C35B 2K5VA 1SLJA 3RLOA 1RIPA 1M1KC 1I94Q 4LF7L 4BXXH 2RHSB 1C0AA 4PZ7A 4LF5Q 5ELNA 2E2JH 4ALPA 1G291 4WJ3M 2VL6A 4POGA 3EIVA 4BXXG 2HQLA 2Q2HA 2WAQE 4B3RQ 4YY3Q 1YJWA 4GN4B 4LF8L 4NPSA 4JI4Q 3I4OA 4KHPQ 4A3BH 2MQHA 2YV5A 1N32L 2XGTA 1X9NA 3K81C 2CCZA 1MJEA 4JV5Q 4JOIA 2UXCL 1OXVA 4UP9A 1XJVA 2BH2A 1H95A 1VQMA 1Q86C 5C0XI 4DV6Q 2VZAA 2VQEQ 5GADC 3S1MH 4DV5L 4A75A 4GKKQ 5C44G 2Q2TA 3CPFA 3PSIA 3L7ZC 2ZTEA 3F1ZA 2NVYH 1QVCA 3S17H 1A8VA 1BBUA 3NENA 3PUVA 3T1YL 3CMAA 5FLMH 3AQQA 3KF8B 3CCMA 3CC4A 3TS0A 2YTXA 3PIPA 1E22A 1Q46A 1ASYA 2R92G 4OXPA 1UE6A 1W3SA 1VCIA 3F2BA 4OWWB 3GTPH 1HR0L 3JC66 1HNXL 1X3FA 1I5FA 1VQ4A 2BA0A 2R7ZH 1E1TA 1CSQA 3M4QA 2VQFL 2ZJPA 4JI8L 2A8VA 4DAYB 5JJLA 2Q2IA 2ASBA 4MNOA 3A74A 3KF6A 1QVFA 2MFIA 2EIFA 1Q82C 2K50A 4DV4L 2CFMA 2NZOA 4JBWA 4DK3C 1N33L 3F2CA 1IYJB 1NJIC 4GN5A 4O2DA 2B63G 1VQKA 2JA6H 1PH9A 1Y1VH 4AQYQ 3UDFA 1XNRL 3J80i 4DV1Q 3J81c 3OYYA 1EYGA 4DUZQ 1I6HH 3RNUA 3EBEA 1KL9A 1LTLA 2JA5G 3PF4A 2Q2UA 1HZBA 3PGZA 3U4VA 4OWTB 4IJHA 1Y1VG 4TQUS 2JA7H 2UU9Q 1FGUA 1CKMA 2YTYA 3UE1A 3PIOA 3W5OA 4AYBG 2UUCL 3PF5A 2NZHA 5C4XH 3HFZB 4OWXB 4DNIA 2MNAA 4DV2Q 3S15H 2Z6KA 3H3VH 4X62Q 4HJ9A 3A5ZB 4B3TL 2WAQG 4YCUA 3G48A 1M90C 4DV7Q 4DAMA 4X66L 2VQEL 1Q7YC 2NVQH 3OTOL 4A3IG 4K0KQ 4JI3L 1BBWA 1TWGH 2ZTCA 3FKIH 5LMNQ 4DV0Q 4A3EH 4A3CH 1Y14B 1KIXA 2BH8A 3K7AH 3H0GG 4IPDA 5IP7G 4LF6L 4A3LH 3S14H 1FJGQ 1QZGA 2I0QA 1Z47A 3CAMA 1C7YA 2OTJA 3S24A 2LXKA 4A3KG 3G71A 1PH2A 2MO0A 3B6YA 4A3DH 4A3CG 1X54A 3CCUA 2LSSA 1X6OA 4UP7A 4IFDJ 4K0KL 3EN2A 3AFPA 3S1RH 4LF4Q 2PMZE 1YNXA 3CMEA 4NXMQ 2Z0SA 3DLLA 3G4SA 1UWVA 3CPWA 1EQQA 4DV4Q 4BBSH 4EQ5A 1WCMH 1XPUA 3NEMA 1A63A 3A5UA 4LFBL 1QUQB 3T1HQ 3J7ZC 1P16A 2HHHL 1MIUA 2R7FA 4NXNQ 1G51A 2VS1A 4P71A 1MJCA 4AH6A 3CCSA 2F52A 2JE6I 2E5LL 2UUBL 2PQAA 4X65L 1YI2A 3PO2H 4KLKA 3GO5A 4DKAC 4KI0A 4A76A 2IX0A 1PH8A 1OXTA 4LF5L 3PUYA 2V1CC 1IBLQ 3PO3H 4A3JG 3S2HH 4IFDI 3J7A5 2Y0SG 2DUDA 2F3IA 2GVAA 4GN3B 4KHZA 3G6EA 1VQBA 4A3BG 3J81j 3RLNA 3PUZA 4HIDA 4DR4Q 4C3IH 1YHQA 4A3EG 1L2FA 4X62L 4DR7L 3I55A 1YJNA 2N78A 4DR1Q 2UXCQ 1VQFA 2JA5H 4EX5A 3CQZH 3GTJH 4DV6L 4JBMA 2B29A 1YITA 1S72A 1CKNA 2IHFA 3S1NH 1N32Q 2JJQA 1SN8A 3E9HA 5J3BA 4JCVE 5BR8Q 3STBD 4IO9A 1WCMG 4DUYL 5C0XG 3GTOH 1LM0A 1U0LA 4LW1A 2UXDL 1X3GA 3ER0A 4C2MH 4A3KH 5FLXc 1Y1WG 4PMWA 1EQRA 4PZ6A 3S1QH 3GTLH 4JI0Q 3HOVH 3PO3G 1BVSA 3M4PA 4X64Q 3U58A 3HOYG 5C0XJ 1HNWL 4QGUA 5GAEC 3AEVA 4R4CA 1PH3A 4PG3A 3GTMH 4QY7A 1S40A 4L5QA 3CP0A 1V1QA 4QQBX 2ID0A 4X66Q 3LGJA 2K4KA 2PI2A 3UDXA 4HIMA 4A3MH 2JA7G 4YWLA 4JI2L 2EXDA 2F4VQ 3JAMc 2B63H 1L1OA 5DLQE 2JA6G 4DR2Q 2JA9A 2GVBA 4B3MQ 1AH9A 1GD7A 4OO1I 1NMFA 5C3EG 4A3GH 1GVPA 4X65Q 1PH6A 3CD6A 2VUMH 3AFQA 5EAYA 1X65A 2JEBI 3I7FA 5GROA 1G6PA 2Z6KC 2ZJQA 1WJJA 1VQAA 4JI2Q 3WWVA 2IY5B 2I5LX 1IL2A 1D7QA 5JEAJ 1B70B 1JB7A 2XTIA 2RF4A 2FXQA 4XIGS 1E7ZA 4DR4L 4R4TA 4DV2L 4LNQA 4DR7Q 3I56A 1VQHA 1PVOA 5JJIA 4B3TQ 1EIFA 1EWIA 1NY4A 3F8TA 5M3MG 1QUQA 4A3FH 1VQPA 1PH5A 2KCMA 1HR0Q 4DPGA 1I3QH 3RR5A 4APVA 5JEAG 1PH1A 2ES2A 4MZ9A 2RHQB 4JI8Q 1N36Q 2AWNA 3I2ZA 2ALYB 2E5LQ 2UUBQ 1GKHA 3HOWG 4RMFA 4HJAA 2A19A 5K36G 3W1GA 1XMQQ 4YCWA 3KDFA 3HOWH 2PNHA 2OCEA 1LYLA 2UXBQ 3A0JA 3RZDH 5GAHC 3T1YQ 3I4MG 4J15A 1Q81C 4AQYL 1XNRQ 1UE1A 1OXSC 2R7DA 1Q1BA 1VQEA 3L2PA 4DR3L 3D0FA 4IOCA 4Y52H 4WJ4A 3NBHB 2VW9A 3VDYA 1FL0A 3KJOA 4A3MG 5JJKA 3BU2A 4JOIC 5IYDH 3ERSX 4A3FG 2VQFQ 1SMXA 4YY3L 4IPGA 5IYBG 4LF8Q 4HJ8A 2JEAI 1CSPA 5FJ8G 4DUYQ 4LUVA 3CCEA 1HNZL 4NXNL 1TXYA 2QA4A 2JK8A 5LMNW 2R93G 4IOAA 1K9MC 4JI7Q 1WYDA 2B3GA 3GTGH 3Q8DA 1OXXK 2AWOA 4GOPC 4LFBQ 4AYBE 2YYZA 1VQNA 3M3YH 1TWCH 4R1JA 3ULLA 2HHHQ 4DV5Q 4JBJA 5LMNL 3KF6B 5M5YH 3S16H 2CQOA 2D0PA 4JI5Q 4DK6C 3CXCA 3ULPA 1IBMQ 4GLAC 4GKJL 1HZ9A 1V43A 1IBLL 3J81i 2WP8J 1VQIA 5M3MH 4JI7L 2ZTDA 5AJ3Q 3PV0A 3ULJA 3K80C 4BY1H 4Y7NH 2HIXA 2D0OA 1YHBA 4GLXA 1JE5A 1LUZA 1YJ9A 1A62A 1N36L 1VQLA 3TRZA 4LF9Q 2QGQA 3RLFA 2K52A 1N9WA 4A3DG 1V9PA 1VQDA 4H02A 3JAMi 1N34L 1UE5A 4BBRH 1IBKL 3OTOQ 1E3PA 3K7UC 4B3SQ 2A1AA 4JI3Q 2H5XA 1UEBA 1OXUA 1B8AA 4DV0L 1CUKA 3HKZE 1EOVA 1XPOA 4JI6Q 4IPCA 3SGIA 4XTCS 1NMGA 1VQCA 1WFQA 4BA1I 5IWAQ 5M3FG 4GNXA 1GO3E 1YZ6A 1VQ9A 3I4NG 5IYBH 4A3IH 2N8NA 3U4ZA 1D8LA 1KAWA 1SE8A 1U5KA 3K0XA 1NE3A 1KRTA 2I5HA 4YWKA 1N34Q 4LFAL 2K75A 4LUZA 4YWMA 5ELOA 4X64L 1VQ6A 1VQ8A 3E0EA 1YEZA 3I4NH 3HKSA 1TWAH 2NN6I 4QL5A 5IYCH 1KC8C 4DR2L 3MEFA 1CKOA 1I94L 3HOZG 4LFCQ 4BA2I 3KDFB 2IHEA 1O7IA 1X56A 1R9TH 3AYHB 1W2BA 3HOXG 1Y1WH 4UY8C 5M5XH 1Q8KA 4DV7L 4LFAQ 4YHHL 2CWPA 3RN2A 2DGYA 1PH4A 1JT8A 3PUXA 2R92H 3E9IA 1XTDA 2NVXH 3H3VI 2N49A 3M4OH 3GDEA 4O0AA 4DR3Q 2WB1G 4FDBA 5C3EH 1KQSA 4OX9L 5M5WH 1PA6A 4A3GG 5FJ8H 4C3JH 1IBML 3GTQH 2EQSA 4GKJQ 4C3HH 2E2IH 4L5TA 4LFCL 1T9HA 1B7YB 1PYSB 1EIYB 2UXDQ 3S2DH 1K83H 4OONA 3CCRA 4A93G 5GQOA 5E7NA 4IFDG 1YIJA 1FJGL 3RN5A 4DR6L 4YCVA 4QJFA 5M3FH 3FKIG 4MTNA 1YVCA 1SFOH 4DUZL 2CKZB 2Y0SE 3W1BA 4JI1Q 3HOVG 1KHIA 4LF7Q 2IT1A 3KLWA 5GAGC 3CC7A 2UUAQ 3CF5A 4JI6L 4BY7G 2ZM6L 3CW2C 4TVAB 3TREA 5LMUL 3H15A 4NXML 2WFWA 1MKHA 2LXJA 3PCOB 1BKBA 2CWAA 5IP9G 1KD1C 1FVIA 3FP9A 1XMQL 2R93H 2KHJA 3KYHC 2UXBL 4JV5L 1CKNB 2ZJRA 3H0GH 1SRUA 3L0OA 5IP7H 5IP9H 4HIKA 1SROA 3ICEA 4JI1L 1VQJA 4JI4L 1XMOQ 1E24A 4KHPL 2MO1A 2JA8G 5C44H 2E2HH 5IY0A 1VQ7A 3BJUA 4LF9L 2HIVA 4GOPA 3CC2A 1I50H 1KXLA 3CCLA 1WOCA 1X55A 4P73A 2OWOA 2JA8H 4ME3A 4HJ7A 2KBNA 4RG1A 5C4XG 1C9OA 1WI5A 3HOXH 4GKKL 2N3SA 4DR1L 4R4IA 2F4VL 1HR0W 2BA1A 3I4MH 2IX1A 4GNXB 5IWAL 3MXNB 4BY1G 1QZHA 1YBYA 3TEHB 4JYAQ 1ASZA 2VNUD 2K5HA 5IE8A 3F2DA 5FLMG 1X3EA 4LWCA 1K3RA 4JI5L 1PHJA 1K0RA 3UDGA 2ATWA 1A0IA 4P72A 3UDIA 1HNXQ 3PUWA 4DR5Q 3CCVA 1K8AC 4A93H 3FHWA 2JQOA 2PQAB 2WB1E 2AKWB 1PFSA 3GD7A 1YHAA 4JG2A 4QIWE 4BBSG 4UPAA 2VY3A 3BZKA 4LF6Q 1HZAA 5HY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D31 A;  4R4Q A;  1J5E L;  3GTK H;  3J80 c;  1Z9F A;  1GM5 A;  4DV1 L;  1NTG A;  4GNX C;  4BBR G;  5AJ3 L;  1K8G A;  4DV3 L;  1AE3 A;  4UP8 A;  2YU9 H;  1OTC A;  1S3O A;  2I5M X;  4A4I A;  3OW2 A;  4OX9 Q;  3HOU G;  1HH2 P;  4A3J H;  1VQ5 A;  3U50 C;  3NEL A;  2VUM G;  1Q12 A;  2HT1 A;  1K73 C;  3ZJY C;  2UUC Q;  3HOZ H;  4A3L G;  2RCN A;  1IBK Q;  1HNZ Q;  1J5E Q;  1UE7 A;  4B3S L;  1VS0 A;  3TQY A;  5HGQ A;  2UU9 L;  4B3R L;  1AE2 A;  4L5S A;  2K5N A;  1PV4 A;  1TWF H;  1EFW A;  1XMO L;  4JC0 A;  2OQ0 A;  4GLV B;  1IZ6 A;  1IXR A;  4B3M L;  4IJL A;  4DR6 Q;  2AMC B;  1VQO A;  3HKZ G;  4HIO A;  3IRB A;  1N8R C;  2D62 A;  5BR8 L;  4IPH A;  4AIM A;  4HJ5 A;  1XPR A;  3CCJ A;  1L1O C;  2QEX A;  4JBK A;  1EUJ A;  1L0W A;  3K8A A;  2NN6 G;  5H1S E;  3BZC A;  1P8L A;  1HZC A;  4P74 A;  3STB C;  4P75 A;  1JJ2 A;  2L15 A;  1N33 Q;  4X6A H;  1NBW A;  5IYC G;  2ZM6 Q;  5LMU Q;  1TWH H;  4YHH Q;  1QVG A;  1KRS A;  4JI0 L;  4JYA L;  1XNQ Q;  1HNW Q;  4PZ8 A;  4LF4 L;  4NB3 A;  4OO1 G;  4GS3 A;  1Q1E A;  5IYD G;  1L1O B;  2NVT H;  3KFU A;  2AHO B;  2E8G A;  1VQG A;  3KOJ A;  2PI2 E;  2K14 A;  3DM3 A;  2OTL A;  3RZO H;  4L5R C;  1PYB A;  1PH7 A;  3HOU H;  4DR5 L;  4LUO A;  2KCT A;  1J6Q A;  1SR3 A;  2R6G A;  2R7Z G;  4BY7 H;  3M9B A;  4GOP B;  5C4J H;  4R4O A;  3T1H L;  1XNQ L;  3HOY H;  2OQK A;  1JJC B;  3UE0 A;  3CCQ A;  1RL2 A;  1JJG A;  1HJP A;  2YTV A;  3TS2 A;  3PO2 G;  3M85 A;  4DV3 Q;  3KJP A;  1JMC A;  1DGS A;  3M7N A;  2GN5 A;  2KHI A;  5IT9 c;  1E1O A;  2KEN A;  2UUA L;  4POF A;  2C35 B;  2K5V A;  1SLJ A;  3RLO A;  1RIP A;  1M1K C;  1I94 Q;  4LF7 L;  4BXX H;  2RHS B;  1C0A A;  4PZ7 A;  4LF5 Q;  5ELN A;  2E2J H;  4ALP A;  1G29 1;  4WJ3 M;  2VL6 A;  4POG A;  3EIV A;  4BXX G;  2HQL A;  2Q2H A;  2WAQ E;  4B3R Q;  4YY3 Q;  1YJW A;  4GN4 B;  4LF8 L;  4NPS A;  4JI4 Q;  3I4O A;  4KHP Q;  4A3B H;  2MQH A;  2YV5 A;  1N32 L;  2XGT A;  1X9N A;  3K81 C;  2CCZ A;  1MJE A;  4JV5 Q;  4JOI A;  2UXC L;  1OXV A;  4UP9 A;  1XJV A;  2BH2 A;  1H95 A;  1VQM A;  1Q86 C;  5C0X I;  4DV6 Q;  2VZA A;  2VQE Q;  5GAD C;  3S1M H;  4DV5 L;  4A75 A;  4GKK Q;  5C44 G;  2Q2T A;  3CPF A;  3PSI A;  3L7Z C;  2ZTE A;  3F1Z A;  2NVY H;  1QVC A;  3S17 H;  1A8V A;  1BBU A;  3NEN A;  3PUV A;  3T1Y L;  3CMA A;  5FLM H;  3AQQ A;  3KF8 B;  3CCM A;  3CC4 A;  3TS0 A;  2YTX A;  3PIP A;  1E22 A;  1Q46 A;  1ASY A;  2R92 G;  4OXP A;  1UE6 A;  1W3S A;  1VCI A;  3F2B A;  4OWW B;  3GTP H;  1HR0 L;  3JC6 6;  1HNX L;  1X3F A;  1I5F A;  1VQ4 A;  2BA0 A;  2R7Z H;  1E1T A;  1CSQ A;  3M4Q A;  2VQF L;  2ZJP A;  4JI8 L;  2A8V A;  4DAY B;  5JJL A;  2Q2I A;  2ASB A;  4MNO A;  3A74 A;  3KF6 A;  1QVF A;  2MFI A;  2EIF A;  1Q82 C;  2K50 A;  4DV4 L;  2CFM A;  2NZO A;  4JBW A;  4DK3 C;  1N33 L;  3F2C A;  1IYJ B;  1NJI C;  4GN5 A;  4O2D A;  2B63 G;  1VQK A;  2JA6 H;  1PH9 A;  1Y1V H;  4AQY Q;  3UDF A;  1XNR L;  3J80 i;  4DV1 Q;  3J81 c;  3OYY A;  1EYG A;  4DUZ Q;  1I6H H;  3RNU A;  3EBE A;  1KL9 A;  1LTL A;  2JA5 G;  3PF4 A;  2Q2U A;  1HZB A;  3PGZ A;  3U4V A;  4OWT B;  4IJH A;  1Y1V G;  4TQU S;  2JA7 H;  2UU9 Q;  1FGU A;  1CKM A;  2YTY A;  3UE1 A;  3PIO A;  3W5O A;  4AYB G;  2UUC L;  3PF5 A;  2NZH A;  5C4X H;  3HFZ B;  4OWX B;  4DNI A;  2MNA A;  4DV2 Q;  3S15 H;  2Z6K A;  3H3V H;  4X62 Q;  4HJ9 A;  3A5Z B;  4B3T L;  2WAQ G;  4YCU A;  3G48 A;  1M90 C;  4DV7 Q;  4DAM A;  4X66 L;  2VQE L;  1Q7Y C;  2NVQ H;  3OTO L;  4A3I G;  4K0K Q;  4JI3 L;  1BBW A;  1TWG H;  2ZTC A;  3FKI H;  5LMN Q;  4DV0 Q;  4A3E H;  4A3C H;  1Y14 B;  1KIX A;  2BH8 A;  3K7A H;  3H0G G;  4IPD A;  5IP7 G;  4LF6 L;  4A3L H;  3S14 H;  1FJG Q;  1QZG A;  2I0Q A;  1Z47 A;  3CAM A;  1C7Y A;  2OTJ A;  3S24 A;  2LXK A;  4A3K G;  3G71 A;  1PH2 A;  2MO0 A;  3B6Y A;  4A3D H;  4A3C G;  1X54 A;  3CCU A;  2LSS A;  1X6O A;  4UP7 A;  4IFD J;  4K0K L;  3EN2 A;  3AFP A;  3S1R H;  4LF4 Q;  2PMZ E;  1YNX A;  3CME A;  4NXM Q;  2Z0S A;  3DLL A;  3G4S A;  1UWV A;  3CPW A;  1EQQ A;  4DV4 Q;  4BBS H;  4EQ5 A;  1WCM H;  1XPU A;  3NEM A;  1A63 A;  3A5U A;  4LFB L;  1QUQ B;  3T1H Q;  3J7Z C;  1P16 A;  2HHH L;  1MIU A;  2R7F A;  4NXN Q;  1G51 A;  2VS1 A;  4P71 A;  1MJC A;  4AH6 A;  3CCS A;  2F52 A;  2JE6 I;  2E5L L;  2UUB L;  2PQA A;  4X65 L;  1YI2 A;  3PO2 H;  4KLK A;  3GO5 A;  4DKA C;  4KI0 A;  4A76 A;  2IX0 A;  1PH8 A;  1OXT A;  4LF5 L;  3PUY A;  2V1C C;  1IBL Q;  3PO3 H;  4A3J G;  3S2H H;  4IFD I;  3J7A 5;  2Y0S G;  2DUD A;  2F3I A;  2GVA A;  4GN3 B;  4KHZ A;  3G6E A;  1VQB A;  4A3B G;  3J81 j;  3RLN A;  3PUZ A;  4HID A;  4DR4 Q;  4C3I H;  1YHQ A;  4A3E G;  1L2F A;  4X62 L;  4DR7 L;  3I55 A;  1YJN A;  2N78 A;  4DR1 Q;  2UXC Q;  1VQF A;  2JA5 H;  4EX5 A;  3CQZ H;  3GTJ H;  4DV6 L;  4JBM A;  2B29 A;  1YIT A;  1S72 A;  1CKN A;  2IHF A;  3S1N H;  1N32 Q;  2JJQ A;  1SN8 A;  3E9H A;  5J3B A;  4JCV E;  5BR8 Q;  3STB D;  4IO9 A;  1WCM G;  4DUY L;  5C0X G;  3GTO H;  1LM0 A;  1U0L A;  4LW1 A;  2UXD L;  1X3G A;  3ER0 A;  4C2M H;  4A3K H;  5FLX c;  1Y1W G;  4PMW A;  1EQR A;  4PZ6 A;  3S1Q H;  3GTL H;  4JI0 Q;  3HOV H;  3PO3 G;  1BVS A;  3M4P A;  4X64 Q;  3U58 A;  3HOY G;  5C0X J;  1HNW L;  4QGU A;  5GAE C;  3AEV A;  4R4C A;  1PH3 A;  4PG3 A;  3GTM H;  4QY7 A;  1S40 A;  4L5Q A;  3CP0 A;  1V1Q A;  4QQB X;  2ID0 A;  4X66 Q;  3LGJ A;  2K4K A;  2PI2 A;  3UDX A;  4HIM A;  4A3M H;  2JA7 G;  4YWL A;  4JI2 L;  2EXD A;  2F4V Q;  3JAM c;  2B63 H;  1L1O A;  5DLQ E;  2JA6 G;  4DR2 Q;  2JA9 A;  2GVB A;  4B3M Q;  1AH9 A;  1GD7 A;  4OO1 I;  1NMF A;  5C3E G;  4A3G H;  1GVP A;  4X65 Q;  1PH6 A;  3CD6 A;  2VUM H;  3AFQ A;  5EAY A;  1X65 A;  2JEB I;  3I7F A;  5GRO A;  1G6P A;  2Z6K C;  2ZJQ A;  1WJJ A;  1VQA A;  4JI2 Q;  3WWV A;  2IY5 B;  2I5L X;  1IL2 A;  1D7Q A;  5JEA J;  1B70 B;  1JB7 A;  2XTI A;  2RF4 A;  2FXQ A;  4XIG S;  1E7Z A;  4DR4 L;  4R4T A;  4DV2 L;  4LNQ A;  4DR7 Q;  3I56 A;  1VQH A;  1PVO A;  5JJI A;  4B3T Q;  1EIF A;  1EWI A;  1NY4 A;  3F8T A;  5M3M G;  1QUQ A;  4A3F H;  1VQP A;  1PH5 A;  2KCM A;  1HR0 Q;  4DPG A;  1I3Q H;  3RR5 A;  4APV A;  5JEA G;  1PH1 A;  2ES2 A;  4MZ9 A;  2RHQ B;  4JI8 Q;  1N36 Q;  2AWN A;  3I2Z A;  2ALY B;  2E5L Q;  2UUB Q;  1GKH A;  3HOW G;  4RMF A;  4HJA A;  2A19 A;  5K36 G;  3W1G A;  1XMQ Q;  4YCW A;  3KDF A;  3HOW H;  2PNH A;  2OCE A;  1LYL A;  2UXB Q;  3A0J A;  3RZD H;  5GAH C;  3T1Y Q;  3I4M G;  4J15 A;  1Q81 C;  4AQY L;  1XNR Q;  1UE1 A;  1OXS C;  2R7D A;  1Q1B A;  1VQE A;  3L2P A;  4DR3 L;  3D0F A;  4IOC A;  4Y52 H;  4WJ4 A;  3NBH B;  2VW9 A;  3VDY A;  1FL0 A;  3KJO A;  4A3M G;  5JJK A;  3BU2 A;  4JOI C;  5IYD H;  3ERS X;  4A3F G;  2VQF Q;  1SMX A;  4YY3 L;  4IPG A;  5IYB G;  4LF8 Q;  4HJ8 A;  2JEA I;  1CSP A;  5FJ8 G;  4DUY Q;  4LUV A;  3CCE A;  1HNZ L;  4NXN L;  1TXY A;  2QA4 A;  2JK8 A;  5LMN W;  2R93 G;  4IOA A;  1K9M C;  4JI7 Q;  1WYD A;  2B3G A;  3GTG H;  3Q8D A;  1OXX K;  2AWO A;  4GOP C;  4LFB Q;  4AYB E;  2YYZ A;  1VQN A;  3M3Y H;  1TWC H;  4R1J A;  3ULL A;  2HHH Q;  4DV5 Q;  4JBJ A;  5LMN L;  3KF6 B;  5M5Y H;  3S16 H;  2CQO A;  2D0P A;  4JI5 Q;  4DK6 C;  3CXC A;  3ULP A;  1IBM Q;  4GLA C;  4GKJ L;  1HZ9 A;  1V43 A;  1IBL L;  3J81 i;  2WP8 J;  1VQI A;  5M3M H;  4JI7 L;  2ZTD A;  5AJ3 Q;  3PV0 A;  3ULJ A;  3K80 C;  4BY1 H;  4Y7N H;  2HIX A;  2D0O A;  1YHB A;  4GLX A;  1JE5 A;  1LUZ A;  1YJ9 A;  1A62 A;  1N36 L;  1VQL A;  3TRZ A;  4LF9 Q;  2QGQ A;  3RLF A;  2K52 A;  1N9W A;  4A3D G;  1V9P A;  1VQD A;  4H02 A;  3JAM i;  1N34 L;  1UE5 A;  4BBR H;  1IBK L;  3OTO Q;  1E3P A;  3K7U C;  4B3S Q;  2A1A A;  4JI3 Q;  2H5X A;  1UEB A;  1OXU A;  1B8A A;  4DV0 L;  1CUK A;  3HKZ E;  1EOV A;  1XPO A;  4JI6 Q;  4IPC A;  3SGI A;  4XTC S;  1NMG A;  1VQC A;  1WFQ A;  4BA1 I;  5IWA Q;  5M3F G;  4GNX A;  1GO3 E;  1YZ6 A;  1VQ9 A;  3I4N G;  5IYB H;  4A3I H;  2N8N A;  3U4Z A;  1D8L A;  1KAW A;  1SE8 A;  1U5K A;  3K0X A;  1NE3 A;  1KRT A;  2I5H A;  4YWK A;  1N34 Q;  4LFA L;  2K75 A;  4LUZ A;  4YWM A;  5ELO A;  4X64 L;  1VQ6 A;  1VQ8 A;  3E0E A;  1YEZ A;  3I4N H;  3HKS A;  1TWA H;  2NN6 I;  4QL5 A;  5IYC H;  1KC8 C;  4DR2 L;  3MEF A;  1CKO A;  1I94 L;  3HOZ G;  4LFC Q;  4BA2 I;  3KDF B;  2IHE A;  1O7I A;  1X56 A;  1R9T H;  3AYH B;  1W2B A;  3HOX G;  1Y1W H;  4UY8 C;  5M5X H;  1Q8K A;  4DV7 L;  4LFA Q;  4YHH L;  2CWP A;  3RN2 A;  2DGY A;  1PH4 A;  1JT8 A;  3PUX A;  2R92 H;  3E9I A;  1XTD A;  2NVX H;  3H3V I;  2N49 A;  3M4O H;  3GDE A;  4O0A A;  4DR3 Q;  2WB1 G;  4FDB A;  5C3E H;  1KQS A;  4OX9 L;  5M5W H;  1PA6 A;  4A3G G;  5FJ8 H;  4C3J H;  1IBM L;  3GTQ H;  2EQS A;  4GKJ Q;  4C3H H;  2E2I H;  4L5T A;  4LFC L;  1T9H A;  1B7Y B;  1PYS B;  1EIY B;  2UXD Q;  3S2D H;  1K83 H;  4OON A;  3CCR A;  4A93 G;  5GQO A;  5E7N A;  4IFD G;  1YIJ A;  1FJG L;  3RN5 A;  4DR6 L;  4YCV A;  4QJF A;  5M3F H;  3FKI G;  4MTN A;  1YVC A;  1SFO H;  4DUZ L;  2CKZ B;  2Y0S E;  3W1B A;  4JI1 Q;  3HOV G;  1KHI A;  4LF7 Q;  2IT1 A;  3KLW A;  5GAG C;  3CC7 A;  2UUA Q;  3CF5 A;  4JI6 L;  4BY7 G;  2ZM6 L;  3CW2 C;  4TVA B;  3TRE A;  5LMU L;  3H15 A;  4NXM L;  2WFW A;  1MKH A;  2LXJ A;  3PCO B;  1BKB A;  2CWA A;  5IP9 G;  1KD1 C;  1FVI A;  3FP9 A;  1XMQ L;  2R93 H;  2KHJ A;  3KYH C;  2UXB L;  4JV5 L;  1CKN B;  2ZJR A;  3H0G H;  1SRU A;  3L0O A;  5IP7 H;  5IP9 H;  4HIK A;  1SRO A;  3ICE A;  4JI1 L;  1VQJ A;  4JI4 L;  1XMO Q;  1E24 A;  4KHP L;  2MO1 A;  2JA8 G;  5C44 H;  2E2H H;  5IY0 A;  1VQ7 A;  3BJU A;  4LF9 L;  2HIV A;  4GOP A;  3CC2 A;  1I50 H;  1KXL A;  3CCL A;  1WOC A;  1X55 A;  4P73 A;  2OWO A;  2JA8 H;  4ME3 A;  4HJ7 A;  2KBN A;  4RG1 A;  5C4X G;  1C9O A;  1WI5 A;  3HOX H;  4GKK L;  2N3S A;  4DR1 L;  4R4I A;  2F4V L;  1HR0 W;  2BA1 A;  3I4M H;  2IX1 A;  4GNX B;  5IWA L;  3MXN B;  4BY1 G;  1QZH A;  1YBY A;  3TEH B;  4JYA Q;  1ASZ A;  2VNU D;  2K5H A;  5IE8 A;  3F2D A;  5FLM G;  1X3E A;  4LWC A;  1K3R A;  4JI5 L;  1PHJ A;  1K0R A;  3UDG A;  2ATW A;  1A0I A;  4P72 A;  3UDI A;  1HNX Q;  3PUW A;  4DR5 Q;  3CCV A;  1K8A C;  4A93 H;  3FHW A;  2JQO A;  2PQA B;  2WB1 E;  2AKW B;  1PFS A;  3GD7 A;  1YHA A;  4JG2 A;  4QIW E;  4BBS G;  4UPA A;  2VY3 A;  3BZK A;  4LF6 Q;  1HZA A;  5HY6 A; 
#chains in the Genus database with same CATH topology
 1EU3 A;  3D31 A;  4NW2 A;  4R4Q A;  4QIW B;  1GM5 A;  1Z9F A;  4GNX C;  2HCC A;  4XQQ A;  2YU9 H;  3NQI A;  2A68 C;  4OX9 Q;  2A6E D;  4A3J H;  1HXY D;  3DWQ A;  3WOE A;  3NEL A;  1T5E A;  1Q12 A;  2R7Z B;  4A3L G;  1HNZ Q;  1IBK Q;  1J5E Q;  4B3R L;  2KQ3 A;  1TWF H;  1EFW A;  1XMO L;  2F0T A;  4DR6 Q;  2A69 C;  4KY5 A;  4AIM A;  1XPR A;  2HDM A;  1HA5 A;  1L0W A;  3K8A A;  2NN6 G;  2QDB A;  1JJ2 A;  2L15 A;  1N33 Q;  2QF7 A;  1NBW A;  5LMU Q;  1TWH H;  4YHH Q;  4I7Z C;  1QVG A;  1AW7 A;  4KY7 A;  4OO1 G;  4GS3 A;  2E8G A;  1VQG A;  2BOS A;  1SYD A;  2PI2 E;  2OTL A;  3RZO H;  1JWU D;  5LHY 1;  4IN3 A;  2KCT A;  4G57 A;  4HTH A;  4C3H G;  4KJO A;  1SYB A;  2K04 A;  3BYY B;  3TP8 A;  1XNQ L;  5KNC A;  1JJC B;  1JJG A;  5FLX L;  3TS2 A;  3PO2 G;  3VYS A;  1V1P B;  2QW7 A;  1DGS A;  3S15 B;  1RTN A;  3FPP A;  2VB3 X;  2KEN A;  4POF A;  3J80 E;  4N9P A;  1BO0 A;  1M1K C;  4BXX H;  1EYA A;  1VMC A;  2RHS B;  2IX3 A;  2AQ1 B;  1PYW D;  5ELN A;  4WJ3 M;  3EIV A;  2Q2H A;  4B3R Q;  2F0D A;  1PTO F;  1YJW A;  1IKL A;  3I4O A;  4KHP Q;  2MQH A;  2YV5 A;  1X9N A;  4DK0 A;  5LL6 X;  1I3Q B;  4X3U A;  1QE6 A;  5C0X I;  3C1F A;  2VZA A;  5GAD C;  2EOT A;  1I6V C;  3CPF A;  3PSI A;  3L7Z C;  3NBH A;  2CHB D;  3S17 H;  1B44 D;  3AQQ A;  2SEB D;  5COR A;  1E22 A;  2F0Q A;  2X6L A;  3F2B A;  4H44 C;  4OWW B;  3AU7 A;  3GTQ B;  2BA0 A;  3CRL C;  2ZJP A;  2N88 A;  4M1U B;  2Q2I A;  5JJL A;  1TS3 A;  4DNR B;  3Q23 A;  5DAU A;  2EIF A;  3GV3 A;  4DV4 L;  4JBW A;  1N33 L;  3F2C A;  2B63 G;  4A3K B;  1VQK A;  4IUU A;  3UDF A;  4I65 A;  1DYQ A;  4H7B A;  3OYY A;  1ILQ A;  5EGT A;  3RNU A;  2F0S A;  1KL9 A;  3EBE A;  3PF4 A;  2Q2U A;  3PGZ A;  4FF2 A;  2AUK A;  3PIO A;  4AYB G;  4A3E B;  3NK9 A;  5C4X H;  4DV2 Q;  3J80 L;  2JP1 A;  4X62 Q;  2WAQ G;  4DV7 Q;  2ZTC A;  5LMN Q;  2KHS A;  3W3A A;  3H0G G;  3K0Y A;  4DA2 A;  1FJG Q;  1QIL A;  3KLS X;  3C3L A;  1B50 A;  3OW7 A;  1STN A;  2F0M A;  3NHH A;  3DXJ C;  4B9W A;  4A3C G;  1K8M A;  1X54 A;  1X6O A;  4IFD J;  3EN2 A;  3VYR A;  1AZQ A;  1M4V A;  2PMZ E;  3T13 A;  1PTO H;  3DLL A;  1LV9 A;  1UWV A;  1EQQ A;  4EQ5 A;  1WCM H;  1O7Y A;  1E2W A;  1ML0 D;  3A55 A;  3T1H Q;  1G6Z A;  1WCM B;  3J7Z C;  1MIU A;  5KEE A;  4NXN Q;  2VS1 A;  3CCS A;  4P71 A;  4A3F B;  4X65 L;  4KLK A;  4A76 A;  1OXT A;  5A35 A;  4EQP A;  3PUY A;  3S2H H;  3QOL A;  2Y0S G;  1KDB A;  4GN3 B;  1DCZ A;  2A6H D;  3PUZ A;  4N9T A;  3NWT A;  1E2Z A;  3RLN A;  2F4I A;  4A3E G;  1YJN A;  2JA5 H;  4OIK A;  2MPM A;  3I70 A;  3IKJ A;  4ILW A;  4CJ0 B;  1N32 Q;  2FIN B;  2JJQ A;  1F77 A;  1A3V A;  1SN8 A;  3STB D;  4XYO A;  1H9K A;  1K28 A;  4F88 A;  3S1Q H;  4O42 A;  4JI0 Q;  1BVS A;  3M4P A;  1HNW L;  2KCC A;  4QGU A;  3AEV A;  4Z9C B;  4PG3 A;  3GTM H;  5D3I B;  4QY7 A;  4BWG B;  3N6R A;  4BS9 A;  1V1Q A;  3UDX A;  4HIM A;  2JA6 G;  3Q22 A;  4B3M Q;  4HSP A;  3M3Y B;  5C3E G;  3QWN A;  2AQ2 B;  5D14 A;  1PH6 A;  4A3I B;  1E0B A;  3AFQ A;  2V4D A;  3A56 A;  1DXM A;  3I7F A;  1Q90 A;  4YIJ A;  4JI2 Q;  3WWV A;  3SK8 A;  1H9S B;  3PO3 B;  5JEA J;  1ZYR D;  2D5D A;  5CV6 A;  1E7Z A;  3X3N A;  5IOC A;  4DV2 L;  1BOS A;  4PV1 C;  1QWY A;  1QUQ A;  4RAU C;  5JAV A;  2KCM A;  3BYT B;  4DPG A;  3RR5 A;  5DM6 3;  4ZRZ A;  2RHQ B;  2AWN A;  2EJM A;  2E5L Q;  3HOW G;  1T5X D;  4FXK C;  1XYI A;  3W1G A;  1LT5 D;  3KDF A;  2PNH A;  4JVZ A;  3LWE A;  1YNN C;  4J15 A;  1XNR Q;  1VQE A;  3GTL B;  4DFA A;  4WJ4 A;  4DXG A;  3NTH A;  2VW9 A;  2DN8 A;  1G8Z D;  5M5W B;  5JJK A;  4JOI C;  1ROD A;  2VQF Q;  1SMX A;  4YY3 L;  5AFW A;  1U4R A;  1CSP A;  2I46 A;  5M5X B;  3SDZ A;  3CCE A;  1HNZ L;  2PZW A;  3RMH A;  5E1F A;  3M4O B;  2B3G A;  2F0I A;  4DAY A;  4GOP C;  1VQN A;  3S16 H;  2CQO A;  2HD3 A;  4JI5 Q;  1S5C D;  4DK6 C;  3V96 A;  1IBM Q;  3AB9 A;  3R2T A;  4NMZ A;  3MFG A;  1ICW A;  4BY1 B;  2XWB B;  1NCV A;  1TS4 A;  3PV0 A;  3TSS A;  3L3O C;  4BY1 H;  4GLX A;  1JE5 A;  1LUZ A;  4ABN A;  3TRZ A;  1BUV T;  3K58 A;  3RUZ A;  4KK7 A;  2FMC A;  2K52 A;  4KD3 A;  3S9W A;  3NBI A;  1VQD A;  2QKI C;  4H02 A;  5C44 B;  1N34 L;  1UE5 A;  4BBR H;  3PQI A;  1IBK L;  2NB0 A;  4B3S Q;  1UEB A;  4DV0 L;  4OEL B;  2K32 A;  1XPO A;  4JI6 Q;  1O80 A;  1NMG A;  5ISR A;  1WFQ A;  4IUV A;  1BXT A;  1SE8 A;  4PNY A;  1NE3 A;  2RSO A;  2K75 A;  2O5I C;  2CH4 W;  4LUZ A;  4YWM A;  5ELO A;  1VQ8 A;  3E0E A;  3I4N H;  1PFB A;  2OF1 A;  1KC8 C;  1ET9 A;  3MEF A;  1CKO A;  2IHE A;  1O7I A;  4FF3 A;  3QIA A;  3L9A X;  1JT8 A;  1R9T B;  3ZYY X;  2KA7 A;  1XTD A;  3GDE A;  4DR3 Q;  4FDB A;  5C3E H;  2EZV A;  5FJ8 H;  1YNJ C;  3GTQ H;  2EQS A;  1WD1 A;  3DMU A;  1PYS B;  1I4Q A;  1K0S A;  5EPK A;  1K83 H;  4KY6 A;  3H3V C;  5DNF A;  5E7N A;  4IFD G;  4MN3 A;  1EY4 A;  3KK7 A;  1TQO A;  3GTG B;  4L6T B;  4YCV A;  1K3B C;  4V19 0;  1YVC A;  4TRD A;  4CDF C;  2CKZ B;  2Y0S E;  3E5S A;  1B4O A;  5KRU A;  1CZW A;  1PRT B;  1S5D D;  1F2Z A;  2ZM6 L;  3CW2 C;  4H0L C;  4TVA B;  3TRE A;  3H15 A;  3KYH C;  2TSS A;  5IP7 H;  3ICE A;  4HIK A;  1SRO A;  4RA8 A;  3R2I A;  1E24 A;  1J8I A;  3HS0 C;  2EYF A;  2MHV A;  3DWP A;  2J7Z A;  2HIV A;  4GOP A;  1I50 H;  1STG A;  4P73 A;  1ENF A;  4CKE A;  4ULL A;  2BA1 A;  3I4M H;  4HAE A;  2VNU D;  2OEO A;  4P2C B;  3VR2 A;  3F2D A;  1X3P A;  5FLM G;  1X3E A;  4JI5 L;  1W6J A;  4JW0 A;  5E3F A;  1VF7 A;  4ZKB B;  1HNX Q;  3PUW A;  1IKM A;  1PRT D;  1K8A C;  4A93 H;  2JQO A;  4A3E H;  3I4L A;  3K5L A;  4G4K A;  2BDN A;  2NN6 H;  2M00 A;  3BZK A;  4QB4 A;  3J7Y W;  4MHE A;  1CQV A;  3HRZ C;  1NTG A;  1EYD A;  4BBR G;  1CA5 A;  3A8K E;  4RFB A;  1S3O A;  2F3V A;  5ELF A;  4A4I A;  4DXF A;  3OW2 A;  3HOU G;  3IFD A;  3MAQ A;  1VQ5 A;  1I4P A;  1S5B D;  3HOZ H;  4CJ1 B;  1TKW B;  1UE7 A;  4ZUI A;  3KF8 A;  1VS0 A;  4CDE C;  5HGQ A;  1VDZ A;  4B3M L;  1IXR A;  4IJL A;  1SJH D;  3HKZ G;  3Q6S A;  1FR3 A;  2D62 A;  5BR8 L;  4KN4 C;  3RZD B;  4IAL A;  3STB C;  4X6A H;  4AYB B;  5IYC G;  2Z6B A;  1KRS A;  1HNW Q;  4V0B A;  1Q1E A;  2NVT H;  1L1O B;  1LAC A;  3DM3 A;  3CRK C;  3D6C A;  1EZ6 A;  1PH7 A;  3HOU H;  1CI3 M;  4Q5V A;  2R7Z G;  2KJX A;  2R61 A;  5I9O A;  4HCS A;  5I4D A;  1XX8 A;  3HOY H;  4WOR A;  2JA5 B;  3E3X A;  3UE0 A;  1GOZ A;  1TS2 A;  3HEJ A;  4XXE A;  4S3S A;  2GN5 A;  1I4G A;  1L0Y B;  1E1O A;  2C35 B;  1SLJ A;  5CR3 A;  4LF7 L;  1C0A A;  4PZ7 A;  4ALP A;  3S1Q B;  2VL6 A;  4TSS A;  2HQL A;  2EYO A;  4JI4 Q;  3DEO A;  1SE2 A;  1CA6 A;  2EY1 A;  5COY A;  2BH2 A;  5ELE A;  1XJV A;  1H95 A;  3A8I E;  2VQE Q;  2Q8R E;  2Q2T A;  1SE4 A;  4C3H B;  4DN4 M;  2SNS A;  2ZTE A;  3F1Z A;  1QVC A;  4OEM B;  1TT2 A;  2DJF C;  2Z9H A;  3PUV A;  2BCO A;  3HOW B;  4BBS B;  1H9J A;  3TS0 A;  2YTX A;  3PIP A;  2H1E A;  2R92 G;  1FNV A;  1UE6 A;  4OXP A;  2HQE A;  5I2Y A;  1I4X A;  1X3Q A;  3JC6 6;  3GTP H;  1VQ4 A;  1U4P A;  1EEI D;  5HGT A;  1IW7 C;  3M4Q A;  5T1G A;  2VQF L;  4JI8 L;  2ASB A;  4MNO A;  1DD2 A;  3KF6 A;  4FVM A;  4CKC A;  4C1N K;  2EYM A;  3J81 L;  1Q82 C;  2NZO A;  4DK3 C;  4JK1 C;  3ERO A;  3EQL C;  4RGN A;  2E2D C;  3D3R A;  2JA6 H;  3E6Z X;  1V8Q A;  1UEA B;  1CK1 A;  1JC7 A;  3VR3 A;  5D3D A;  4DUZ Q;  1I6H H;  1WTH A;  2JA5 G;  1SDF A;  1GUG A;  1TWH B;  4IJH A;  1Y1V G;  2JA7 H;  1CKM A;  2A5H A;  3UE1 A;  1HUM A;  1S5E D;  1EY9 A;  4IUR A;  1ILP A;  5EKI A;  5K5P A;  4OWX B;  2K7V A;  1S5F D;  3H94 A;  4B3T L;  1D1I A;  4DAM A;  4X66 L;  2VQE L;  5KYL A;  3FKI H;  2I07 B;  1KIX A;  4QCL A;  4IPD A;  4ME5 A;  4LF6 L;  5IT9 L;  4A3L H;  4FYD A;  3BDL A;  3BDO A;  2OTJ A;  3S24 A;  1Y8P B;  3S1R B;  3G71 A;  3NUC A;  3HKZ B;  4A3G B;  1R4P B;  1PTO B;  3S1R H;  1LT4 D;  4LF4 Q;  3JAM E;  1KNE A;  1YNX A;  2PPB C;  2DNC A;  1SAP A;  2Z0S A;  4K6L A;  3DWA A;  3CPW A;  3A5U A;  3VR4 A;  1P16 A;  3NSW A;  2MJ8 A;  1DOK A;  1TR5 A;  1D5M C;  3KLS A;  2B2T C;  2PQA A;  1YI2 A;  3U9O A;  4DKA C;  1PZJ D;  1A15 A;  4KI0 A;  2IX0 A;  1MHW C;  1CHQ D;  4LJZ C;  3S17 B;  3VR6 A;  2VXW A;  2DUD A;  2F3I A;  2GVA A;  1BR9 A;  3G6E A;  4A3B G;  4C56 C;  2OT2 A;  3E0J A;  2UXC Q;  4KTA A;  3CHB D;  4B08 A;  2F03 A;  4DV6 L;  2B29 A;  1YIT A;  2CVR A;  4PMB A;  1S72 A;  1CKN A;  3KLR A;  3K5M A;  1ZYR C;  1D5Z C;  4J1M A;  4IO9 A;  5C0X G;  3GTO H;  4FO2 A;  1U0L A;  1X3G A;  2K03 A;  4C2M H;  2WIN B;  3HOV H;  4CDC C;  3PO3 G;  4C3J B;  4KD4 A;  1HTL D;  2EYL A;  5E4W C;  4RHR A;  5CV5 A;  3MXN A;  4L5Q A;  4A3M B;  2BDO A;  1RTO A;  4X66 Q;  2B63 B;  2K4K A;  5BN5 A;  1II3 A;  4A3M H;  4YWL A;  3NTK A;  3JAM c;  2B63 H;  2MUY A;  1AH9 A;  1NR2 A;  1GVP A;  3KBG A;  4C3I G;  3FMC A;  5EAY A;  5GRO A;  2RKS A;  4IUP A;  2Z6K C;  1G6P A;  1QB5 D;  1LO5 D;  1VQA A;  5FLX E;  3GTP B;  1LTA D;  1DJR D;  1JB7 A;  2XTI A;  4RGO S;  2EPB A;  1SYE A;  5EPJ A;  1KDC A;  3HOZ B;  3I56 A;  1VQH A;  5JJI A;  1K8O A;  4XT3 B;  4B3T Q;  5M3M G;  1NY4 A;  4H13 C;  5JEA G;  1PFN A;  1N36 Q;  1F9R A;  2JA6 B;  2NUC A;  3A8J E;  5F2D A;  2NWG A;  3K6O A;  2A19 A;  1LT6 D;  3HOW H;  3QJY A;  5C4Z A;  2RQX A;  1EFI D;  1LYL A;  2OCE A;  4KN7 C;  2UXB Q;  2E2I B;  3RZD H;  5GAH C;  4FXG C;  2XRS D;  4AQY L;  1UE1 A;  5CYU A;  5CBE E;  3L2P A;  5IGD A;  4Y52 H;  1LTI D;  3NBH B;  2MP1 A;  2XNA C;  5KNB A;  1O78 A;  4A3M G;  3BU2 A;  4RCO A;  2JYO A;  4A3F G;  2JSO A;  3GTK B;  4C3J G;  1EY5 A;  3K7A B;  4WJW A;  1TXY A;  5LMN W;  1KAB A;  2B2U C;  3GTJ B;  2EE1 A;  3GTG H;  5BN4 A;  3Q8D A;  1XXG A;  4LFB Q;  2YYZ A;  3M3Y H;  3ULL A;  4DV5 Q;  2LMC B;  5M5Y H;  3Q24 A;  3ULP A;  4GKJ L;  4CJ2 C;  4KKS A;  2KEE A;  1HZ9 A;  1V43 A;  4K14 A;  3R3O A;  2ICI A;  1VQI A;  1SBB B;  2PW7 A;  3K80 C;  2K5W A;  4Y7N H;  1YHB A;  1A62 A;  2L1B A;  3LWU A;  3G7L A;  1N9W A;  2IL8 A;  3K5O A;  4OGQ C;  1E3P A;  3K7U C;  4JI3 Q;  2H5X A;  1OXU A;  1B8A A;  1JWM D;  1CUK A;  3FDT A;  5G3L D;  1EQT A;  3SGI A;  1VQC A;  3SK6 A;  1QG7 A;  1VQ9 A;  1R4Q B;  5T1I A;  3D8G A;  2Q8I B;  4A3I H;  1KAW A;  1JOR A;  2M2L A;  2ENB A;  3HOU B;  3VA5 A;  1GUW A;  1L0X B;  1PFM A;  3IFT A;  1I4H A;  4XQJ A;  2F0G A;  4X64 L;  3HKS A;  3CQZ B;  2FFK B;  2A73 B;  2NN6 I;  2XN9 C;  4QL5 A;  4DR2 L;  1I94 L;  4LFC Q;  3T53 B;  1R9T H;  3HOX G;  1Y1W H;  2QEJ C;  4DV7 L;  4LFA Q;  4YHH L;  5D65 A;  1PH4 A;  3PUX A;  3M4O H;  3H3V I;  2WB1 G;  4A3G G;  1KQS A;  4C3J H;  4GKJ Q;  1Q8I A;  3BZD B;  4C3H H;  4L5T A;  3WOF A;  2UXD Q;  3CCR A;  3T56 B;  2RBM A;  4QJF A;  5M3F H;  2WII B;  1BBX C;  4DUZ L;  2F0P A;  1BCP C;  1GUT A;  5JPN C;  2IT1 A;  3MTS A;  1GUO A;  3UI2 A;  2O4X A;  2K5D A;  5GAG C;  1I6H B;  3CF5 A;  4BY7 G;  1FGB D;  2RA4 A;  2WFW A;  1MKH A;  4ZK9 B;  4OL7 A;  2LXJ A;  3OOC A;  3FP9 A;  2R93 H;  1TWF B;  1HCZ A;  3D4W A;  4JV5 L;  3GQB A;  1HFG A;  5IP9 H;  3BVG A;  1A3T A;  1VQJ A;  1XMO Q;  3G6J B;  4KHP L;  3LNN A;  4ID6 A;  2RVL A;  3SK4 A;  3CC2 A;  1H9M A;  1AEX A;  1F9S A;  3P7J A;  1WTQ A;  2GA4 B;  2KBN A;  1FNU A;  5EQ0 A;  1B9N A;  1ENC A;  1EOT A;  3HOY B;  1V1P A;  1QNK A;  4GNX B;  5L37 A;  2E75 C;  4QUC A;  4A3D B;  3KBX A;  2QCP X;  4LWC A;  4R9W A;  1PHJ A;  1A0I A;  1LAB A;  3OMC A;  1DOL A;  3UDI A;  2LKV A;  4X3K A;  2AKW B;  3FHW A;  1TY2 A;  1YHA A;  3GD7 A;  4BBS G;  2VY3 A;  1K83 B;  1HZA A;  4OO1 I;  1AFP A;  4OHJ A;  1WD0 A;  3GTK H;  2R92 B;  3ND9 A;  5AJ3 L;  1K8G A;  5JPM C;  1H9S A;  4UP8 A;  1OTC A;  3ERQ A;  4DAP A;  1YNJ D;  5ELC A;  2SOB A;  4K5X A;  3U50 C;  2VUM G;  5CC4 A;  1K73 C;  2UUC Q;  1STB A;  3MVV A;  4K8I A;  4B3S L;  3TME A;  3TQY A;  4R8N A;  2UU9 L;  3BDC A;  1AE2 A;  4L5S A;  1SE3 A;  2OXP A;  1PV4 A;  1G2T A;  4K2K A;  5M3M B;  2AMC B;  4ZLT F;  1VQO A;  3IRB A;  1ZKO A;  1Z6H A;  2H4O A;  1IYU A;  4HJ5 A;  3F2U A;  1C4Q A;  2QEX A;  4JBK A;  1EUJ A;  5H1S E;  2DY7 A;  3BZC A;  1JCK B;  1P8L A;  1HZC A;  4FF1 A;  3TZD A;  2PZU A;  5DM7 3;  4JYA L;  2NVT B;  1SFO B;  4LF4 L;  1F2L A;  5IYD G;  2AHO B;  2F0H A;  5IT9 E;  4L5R C;  5C5M A;  4OIJ A;  4DR5 L;  4LUO A;  2QIL A;  1M8A A;  2R6G A;  3M9B A;  3P20 A;  5C4J H;  2NVQ B;  4LK1 C;  3H91 A;  1LLR D;  4HN7 A;  4CBV A;  1BCP D;  1RKN A;  3CCQ A;  1HJP A;  4UDU C;  4KV6 A;  3KJP A;  3S1N B;  2K05 A;  1I50 B;  4HSV A;  3M7N A;  1STY A;  3TP5 A;  1JB3 A;  3I3C A;  2X69 A;  2UUA L;  1QOH A;  3ONA B;  4XDX A;  2A69 D;  2K5V A;  2A74 C;  2E2J B;  2IW3 A;  2WAQ B;  1RIP A;  3NXW A;  4RWS C;  4GZY C;  4G7O C;  5IGB A;  1TWA B;  4RH6 A;  1BCP B;  2E2J H;  1G29 1;  4POG A;  4BXX G;  1LTB D;  1KTK A;  3OHX C;  2YU9 B;  3K81 C;  1OXV A;  2NVX B;  5FO9 B;  4A3B B;  1Q86 C;  1X32 A;  2F3W A;  1KLU D;  4DV5 L;  4A75 A;  2ZXO A;  3S14 B;  1C48 A;  1Z7T A;  3CMA A;  5FLM H;  1D2B A;  3CCM A;  3OPO A;  3CC4 A;  1A3U A;  1Q46 A;  1ASY A;  1W3S A;  1X3F A;  1I5F A;  2R7Z H;  1E1T A;  1TII D;  5C4H A;  3H6M A;  4K5W A;  3NP8 A;  2HCI A;  5M5Y B;  2E2H B;  1QVF A;  2K50 A;  2NTT A;  3BG3 A;  3KUP A;  2CFM A;  2XIW A;  2G9D A;  3QR8 A;  1IYJ B;  1NJI C;  1MGS A;  2RDH A;  3EFX D;  4GN5 A;  3M7G A;  4AQY Q;  1LTT D;  4EQO A;  1PDQ A;  4DV1 Q;  1E2V A;  3J81 c;  1EYG A;  1LTL A;  1HZB A;  2PCF B;  3DHQ A;  2UU9 Q;  1FGU A;  2YTY A;  4C3I B;  1IW7 D;  3W5O A;  1PTO D;  1MSG A;  4DNI A;  2MNA A;  3SEB A;  3S15 H;  2L5T A;  3H3V H;  3HOV B;  3A5Z B;  3G48 A;  3CKI B;  1M90 C;  1AZP A;  2Z4H A;  1Q7Y C;  2CW0 D;  3M4Y A;  4JI3 L;  1TWG H;  4A3C H;  1Y14 B;  3K7A H;  2K1B A;  2K01 A;  5NUC A;  1A6X A;  1QZG A;  2I0Q A;  1Z47 A;  1GUN A;  2DJG C;  3CAM A;  3H09 A;  3TZU A;  4EVO A;  1EU4 A;  2EYP A;  2L4N A;  2LXK A;  1B2T A;  4A3D H;  2MO0 A;  3B6Y A;  4NP5 A;  5FOB B;  4UP7 A;  2KVM A;  4K0K L;  5TSS A;  2G5D A;  3CME A;  4NXM Q;  3MWY W;  2EXZ A;  2NVY B;  5KGU A;  4DV4 Q;  5G3L F;  2F0N A;  3FRP B;  3NEM A;  1XPU A;  4Y7N B;  4LFB L;  1QUQ B;  2R7F A;  2IWH A;  2B8G A;  4FXD A;  3VYU A;  1MJC A;  1EY0 A;  2F52 A;  2JE6 I;  2E5L L;  1NNX A;  1PH8 A;  1KNA A;  3P1H A;  2V1C C;  5J22 A;  3PO3 H;  1NR4 A;  3J7A 5;  4HID A;  1YHQ A;  1L2F A;  3OWE B;  4X62 L;  2WV6 D;  1MI2 A;  2N78 A;  5CV7 A;  3I55 A;  1VQF A;  4DR7 L;  4F8M A;  2CH4 A;  3QG1 A;  4TKO B;  3P75 A;  2N55 A;  3CQZ H;  3T16 A;  4EX5 A;  5CV8 A;  4U68 A;  3S1N H;  3VR5 A;  3E9H A;  5J3B A;  4JCV E;  5BR8 Q;  5CMD A;  3DUZ A;  3W2D A;  1JOO A;  2UXD L;  1HPC A;  2WAC A;  1F2M A;  2AUJ D;  3ER0 A;  4A3K H;  5FLX c;  2Z4I A;  1TY0 A;  5CBA E;  1EQR A;  1Y1W G;  2K6A A;  1SYF A;  4PZ6 A;  4RGT A;  3GTL H;  4X64 Q;  3U58 A;  5C0X J;  1PH3 A;  3N52 A;  2ZT9 C;  3NE5 B;  1S40 A;  1VMP A;  3S2D B;  1ESR A;  4JPB W;  2JA7 B;  2TMP A;  3LGJ A;  2PI2 A;  2JA7 G;  2Z8L A;  4L8J A;  1L1O A;  4KKU A;  1JIC A;  2JA9 A;  4A93 B;  1GD7 A;  2B39 A;  1B1Z A;  1NMF A;  2MGS A;  2JXM B;  2NTS A;  2NZ1 D;  3D6W A;  4X65 Q;  1XWE A;  3CD6 A;  3FKI B;  2VUM H;  1JOK A;  5BN3 A;  1X65 A;  2JEB I;  2XWJ B;  1LT3 D;  3ND8 A;  2ZJQ A;  1HRJ A;  1WJJ A;  1PLF A;  2I5L X;  4R8I A;  1IL2 A;  5ELB A;  1D7Q A;  1B70 B;  3IAY A;  2RF4 A;  2FXQ A;  4XIG S;  4R4T A;  1KLG D;  5CV9 A;  4LNQ A;  1S4Z A;  4DR7 Q;  1PVO A;  4DNT B;  1EIF A;  1EWI A;  4A3F H;  3K59 A;  1PH5 A;  1HR0 Q;  3PO2 B;  4APV A;  2PZT A;  4MZ9 A;  4JI8 Q;  4IZ8 A;  1RD9 D;  1GKH A;  1NUC A;  4HJA A;  4IFD H;  2E76 C;  1B53 A;  1ET6 A;  1TVX A;  3BVZ A;  1W6K A;  4WRD A;  5FKA C;  3A0J A;  2HDL A;  3T1Y Q;  1OXS C;  2R7D A;  1Q1B A;  4DR3 L;  4IOC A;  4DK1 A;  5JVH 3;  1RHP A;  3VDY A;  2JN4 A;  1FL0 A;  3KJO A;  1ESF A;  1Y8N B;  3ERS X;  4G7Z C;  2BE5 D;  1CFM A;  5IYB G;  4IPG A;  4LF8 Q;  4HJ8 A;  1UUP A;  5FJ8 G;  5EBD A;  3MXP A;  4NXN L;  2B8F A;  2JK8 A;  2R93 G;  4IOA A;  1LTG D;  1Y1V B;  4JI7 Q;  2SNM A;  5C5L A;  2AWO A;  3NQT A;  5C3E B;  2K5Q A;  1Q3L A;  2HHH Q;  4JBJ A;  3KF6 B;  3HG9 A;  2D0P A;  1TWC B;  4FNF A;  3V05 A;  3WDN A;  1IBL L;  3J81 i;  1CT1 D;  2WP8 J;  5M3M H;  2EY5 A;  2ZTD A;  5AJ3 Q;  4K6D A;  2DNE A;  5KND A;  3R93 A;  2D0O A;  2ZXR A;  2Y0S B;  4LF9 Q;  2QGQ A;  5EPL A;  5A2Q L;  2AQ3 B;  4A3D G;  1CZG A;  1V9P A;  3JAM i;  3OTO Q;  2A1A A;  4FF4 A;  1HA6 A;  3URY A;  4QMG A;  1MD2 D;  1EOV A;  1FNW A;  3HKZ E;  4IPC A;  4XTC S;  5M3F G;  5IWA Q;  1GO3 E;  1YZ6 A;  3I4N G;  1BCP F;  5IYB H;  5J39 A;  4X3T A;  2N8N A;  3SXH A;  1D8L A;  3A7A B;  2I5H A;  3D4R A;  4YWK A;  4LFA L;  1EWH A;  1PTO C;  1YEZ A;  2ICE C;  5IYC H;  4B9X A;  1JQY D;  3HOZ G;  4BA2 I;  1EY6 A;  3MA2 B;  3DM1 A;  1ENA A;  3KDF B;  3AYH B;  4O1N A;  5M5X H;  1Q8K A;  2CWP A;  2J4X A;  2N49 A;  2CQA A;  4O0A A;  3PIP 3;  3T4A C;  5M5W H;  1PA6 A;  1SMY C;  1IBM L;  1EY7 A;  2E2I H;  2QDL A;  4LFC L;  1T9H A;  3S2D H;  4OON A;  5C6A A;  4A93 G;  1YIJ A;  1FJG L;  2C9O A;  1MSH A;  2FJ2 A;  3FKI G;  4MTN A;  1SND A;  1SNP A;  1KHI A;  1CHP D;  1RF2 D;  1B3A A;  2IJ0 A;  5ELD A;  3D4D A;  5JOB A;  3KLW A;  4RCN A;  3CC7 A;  4JI6 L;  5HUR A;  2Z1C A;  4NXM L;  3PCO B;  2CWA A;  1FVI A;  2M9V A;  1EWC A;  1XMQ L;  2UXB L;  1CKN B;  2L0C A;  1SRU A;  3I72 A;  3L0O A;  1EQV A;  4JI1 L;  1JWS D;  4JI4 L;  1KDA A;  1A2T A;  1SNQ A;  4I7A A;  2JA8 G;  5C44 H;  1G91 A;  2E2H H;  5IY0 A;  1SXT A;  3I73 A;  4LF9 L;  1KXL A;  3CCL A;  2EYJ A;  1WOC A;  2JA8 H;  3O13 A;  4DU9 A;  3I4N B;  4ME3 A;  5C4J B;  2K33 A;  4GKK L;  4KJN A;  4DR1 L;  4R4I A;  2F4V L;  1GHK A;  1HR0 W;  2KCN A;  1PZK D;  2IX1 A;  5IWA L;  3MXN B;  1TS5 A;  1YBY A;  1EZ8 A;  3TEH B;  1Y1W B;  1ASZ A;  2K5H A;  2F0L A;  1K3R A;  4NDX A;  3UDG A;  2ATW A;  2F0O A;  5CGK A;  4QIW E;  2WB1 E;  1CM9 A;  1PFS A;  5IOD A;  4JG2 A;  5EKL A;  2PMZ B;  4UPA A;  4OO1 H;  2LY7 A;  5LL6 S;  2B2V C;  2PW5 A;  2FHT A;  1J5E L;  1UNS A;  5E4X A;  3J80 c;  4DV1 L;  2PNR C;  2RSN A;  4DV3 L;  1AE3 A;  1HQM C;  2I5M X;  4PQX A;  2B2W C;  4IUN A;  4ZUJ A;  1HH2 P;  2HT1 A;  3ZJY C;  4EQN A;  1WTP A;  2RCN A;  2O2L D;  2XSC A;  4IUT A;  2WKC A;  4ZAI A;  2K5N A;  3MXU A;  1Y8O B;  1SJE D;  4JC0 A;  2OQ0 A;  4GLV B;  1IZ6 A;  3NWS A;  2KEC A;  3TP7 A;  4HIO A;  1N8R C;  4IPH A;  4LAA A;  1L1O C;  3CCJ A;  5FO7 B;  2F0U A;  4P74 A;  4P75 A;  5FO8 B;  2A6E C;  2ZM6 Q;  4CHT B;  4ZCK A;  4JI0 L;  4UAI A;  1XNQ Q;  4PZ8 A;  4NB3 A;  3KFU A;  2L11 A;  3KOJ A;  3BS1 A;  1F2Y A;  2K14 A;  1PYB A;  3RZO B;  1J6Q A;  1SR3 A;  2VUM B;  4BY7 H;  4GOP B;  1PRT F;  4R4O A;  4DGZ A;  3T1H L;  4BY7 B;  2HUG A;  4EGV A;  1QJO A;  2OQK A;  5JEA H;  5EKK A;  1RL2 A;  3PIO 3;  4XYQ A;  3HP3 A;  2YTV A;  3M85 A;  4DV3 Q;  5DEH A;  1JMC A;  4K8J A;  2L12 A;  2KHI A;  5IT9 c;  5FK9 C;  4E6I A;  2A6H C;  3RLO A;  1I94 Q;  1FD7 D;  4K5V A;  4LF5 Q;  5C4X B;  2F0F A;  2WAQ E;  3TP6 A;  1Y69 U;  4YY3 Q;  1IYV A;  4GN4 B;  4LF8 L;  4NPS A;  2B2T A;  3OSO A;  4RKL A;  4A3B H;  1AN8 A;  2IPK D;  3SHL A;  2XGT A;  1N32 L;  2CCZ A;  4JV5 Q;  1MJE A;  4JOI A;  2UXC L;  4UP9 A;  1VQM A;  4PMC A;  5C0X H;  4DV6 Q;  1D1K A;  2L9H A;  3S1M H;  4GKK Q;  4L63 B;  5C44 G;  4KHV A;  1I4R A;  2NVY H;  3MZ5 A;  1A8V A;  1B9M A;  1BBU A;  2KOL A;  3NEN A;  3T1Y L;  3RD4 A;  3SVM A;  3KF8 B;  2LFN A;  2D9U A;  1BF4 A;  1PRT C;  3LX0 A;  2B2V A;  4IFD I;  1PMR A;  1VCI A;  1HR0 L;  1HNX L;  1J9O A;  1G2S A;  5IGE A;  1CSQ A;  2ZXP A;  2A8V A;  4DAY B;  5IIF A;  2B2W A;  3A74 A;  2MFI A;  4X3S A;  5I2X A;  3VA7 A;  4HR7 B;  2VB2 X;  1WTX A;  2X6G A;  3I8Z A;  4O2D A;  4C2M B;  1EEF D;  1PH9 A;  1Y1V H;  1XNR L;  1JR0 D;  3A7L A;  3R8B A;  4DAV A;  3J80 i;  2B2Y C;  3S2H B;  3BVM A;  2EJG C;  4N8F A;  1U4M A;  1DM0 B;  3U4V A;  1CQF A;  1ZXT A;  4OWT B;  4TQU S;  2O5J C;  4DF7 A;  2EDG A;  2UUC L;  1WTO A;  3PF5 A;  2NZH A;  3HFZ B;  3I4M B;  1QCB D;  2Z6K A;  4HJ9 A;  1U4L A;  4YCU A;  2J0T D;  2NVQ H;  3OTO L;  4A3I G;  4K0K Q;  1BBW A;  4DV0 Q;  2WKD A;  2BH8 A;  5IP7 G;  3T51 B;  1WTW A;  3QOJ A;  3S14 H;  2F0W A;  1C7Y A;  5K36 H;  4A3K G;  1EIH A;  3J7A V;  1PH2 A;  3CCU A;  2LSS A;  2XVS A;  3AFP A;  3K57 A;  1YNN D;  3SR1 A;  1C8C A;  2F0V A;  3U9S A;  2RDF A;  1WTR A;  3C2P A;  3G4S A;  4HCE A;  2FMM A;  3TBI B;  4BBS H;  1A63 A;  1F9Q A;  4ZQ3 A;  1NAP A;  2E74 C;  2HHH L;  1BQQ T;  1G51 A;  4AH6 A;  4M8A A;  3QO2 A;  1GHJ A;  1FYC A;  3A54 A;  2UUB L;  3PO2 H;  3GO5 A;  1B3Q A;  4A3J B;  1ONL A;  1HUN A;  4LF5 L;  1IBL Q;  4A3J G;  2KED A;  2R3Z A;  1ICF B;  4KHZ A;  5KIX A;  1VQB A;  1OO9 B;  3J81 j;  2F0K A;  3EA6 A;  4C3I H;  4DR4 Q;  1PXU A;  1GJX A;  4DR1 Q;  3PMF A;  2R93 B;  3GTJ H;  4JBM A;  5EJW A;  4KKT A;  1XTC D;  2IHF A;  4NKL A;  3V2T A;  1DOM A;  3MHB A;  1WCM G;  3MC0 B;  4DUY L;  1LM0 A;  3NTI A;  2C5C A;  4LW1 A;  4MIU A;  4ODG A;  3I91 A;  4PMW A;  1DZ1 A;  3HZX A;  3HOY G;  1SNM A;  5GAE C;  4R4C A;  3IL8 A;  5M9O A;  3CP0 A;  2EYH A;  3VYT A;  4QQB X;  2ID0 A;  3J7A F;  3NPP A;  1SNC A;  5JJZ A;  4RHS A;  2B2Y A;  2JA8 B;  5KYI A;  2EXD A;  2PQE A;  1HTP A;  5JVG 3;  4XQN A;  4JI2 L;  5DLQ E;  2F4V Q;  4DR2 Q;  4F87 A;  2GVB A;  4A3G H;  1H9R A;  2EY6 A;  1JE4 A;  1TWG B;  2F1M A;  1SYC A;  1SYG A;  2IY5 B;  1HHV A;  1U9R A;  3QB3 A;  3H0G B;  4DR4 L;  4C1N I;  1JOQ A;  1PZI D;  5I9P A;  3K5N A;  3SE0 A;  4RKB A;  1VQP A;  3F8T A;  2G9H D;  1I3Q H;  1PH1 A;  2ES2 A;  1CTM A;  4ZYS A;  2RCF A;  3I2Z A;  2ALY B;  4QUF A;  3EVQ A;  2UUB Q;  4RMF A;  3C1E A;  3MFY A;  4N8X 1;  3OMG A;  5K36 G;  1XMQ Q;  4YCW A;  5A2Q E;  1RDP D;  1TU2 B;  2Q8T A;  3OIP A;  3CU7 A;  3I4M G;  1Q81 C;  5IGC A;  4WFN 3;  1STA A;  1V1O A;  3D0F A;  1EL0 A;  4U67 3;  4RGM A;  4QF4 A;  5IYD H;  1EIG A;  2JEA I;  2CW0 C;  4LUV A;  4DUY Q;  4F7X A;  3AMU A;  5IGG A;  2P5Z X;  4HMI A;  2QA4 A;  1K9M C;  1WYD A;  1OXX K;  4LMQ D;  4AYB E;  5M3F B;  1STE A;  4IQZ A;  1TWC H;  4R1J A;  2LS0 1;  5LMN L;  1GUS A;  3CXC A;  4GLA C;  3SK5 A;  3J81 E;  3JAM L;  3MEH A;  4CKB A;  1O7Z A;  4K2L A;  4JI7 L;  1SNO A;  1BDO A;  1F9P A;  1VF5 C;  3ULJ A;  1HQR D;  2HIX A;  1YJ9 A;  1VQL A;  4J6H A;  3FPU B;  1N36 L;  3FEW X;  2A68 D;  3RLF A;  3I90 A;  5CV4 A;  1WVL A;  1DON A;  4BBR B;  2L55 A;  4BA1 I;  1KAA A;  4GNX A;  1NSN S;  3GV6 A;  3U4Z A;  1WTV A;  2NBF A;  1LTS D;  1U5K A;  3K0X A;  5EBC A;  2KUM A;  1KRT A;  3TN2 A;  1HFN A;  1N34 Q;  1VQ6 A;  3C46 A;  1TWA H;  1D6E C;  2EY2 A;  2BE5 C;  4J8Q A;  1X56 A;  1W2B A;  1SEB D;  4UY8 C;  2XRQ D;  4HMJ A;  3RN2 A;  2DGY A;  2R92 H;  3E9I A;  2F0E A;  2NVX H;  3DEP A;  2SDF A;  1RJT A;  3MXG A;  1EY8 A;  2EVB A;  4UHV A;  4G7H C;  4OX9 L;  2PO4 A;  3GP7 A;  2F0J A;  2DY8 A;  1ZEQ X;  1B7Y B;  4XT1 B;  1GXD C;  1RCV D;  1EIY B;  1IHZ A;  5I6Y A;  5GQO A;  3GTO B;  1LTR D;  5J1Z A;  4FP5 D;  3RN5 A;  3TDQ A;  4DR6 L;  1EYC A;  4HED A;  3S1M B;  1SFO H;  3W1B A;  4JI1 Q;  3S16 B;  3HOV G;  4LF7 Q;  1O7L A;  3GTM B;  4CGY B;  1STH A;  2PYK A;  4ZKC B;  2UUA Q;  5IGF A;  5LMU L;  5C3W A;  5IP9 G;  1BKB A;  1KD1 C;  2KHJ A;  1AP0 A;  1D5X C;  3Q0A A;  2ZJR A;  3H0G H;  3OIQ A;  2RDG A;  1QNU A;  4Q0F A;  2B2U A;  2MO1 A;  3FVQ A;  1VQ7 A;  3BJU A;  1BNZ A;  1X55 A;  2OWO A;  1A2U A;  4HJ7 A;  3ITP A;  4RG1 A;  5C4X G;  1C9O A;  1WI5 A;  3HOX H;  5C3X A;  5I6W A;  3EJI A;  2N3S A;  1UAP A;  1MBY A;  2D2C C;  3HOX B;  4BY1 G;  3HGB A;  1QZH A;  4JYA Q;  5IE8 A;  4CDD C;  1K0R A;  2WB1 B;  3OWF A;  2NYZ D;  1SMY D;  4MTK A;  4P72 A;  4KMU C;  2K28 A;  4DR5 Q;  1IL8 A;  2EJF C;  3CCV A;  2PQA B;  1SSO A;  3X3M A;  4LF6 Q;  4IUQ A;  5HY6 A; 
#chains in the Genus database with same CATH homology
 3D31 A;  4R4Q A;  1J5E L;  3GTK H;  3J80 c;  1Z9F A;  1GM5 A;  4DV1 L;  1NTG A;  4GNX C;  4BBR G;  5AJ3 L;  1K8G A;  4DV3 L;  1AE3 A;  4UP8 A;  2YU9 H;  1OTC A;  1S3O A;  2I5M X;  4A4I A;  3OW2 A;  4OX9 Q;  3HOU G;  1HH2 P;  4A3J H;  1VQ5 A;  3U50 C;  3NEL A;  2VUM G;  1Q12 A;  2HT1 A;  1K73 C;  3ZJY C;  2UUC Q;  3HOZ H;  4A3L G;  2RCN A;  1IBK Q;  1HNZ Q;  1J5E Q;  1UE7 A;  4B3S L;  1VS0 A;  3TQY A;  5HGQ A;  2UU9 L;  4B3R L;  1AE2 A;  4L5S A;  2K5N A;  1PV4 A;  1TWF H;  1EFW A;  1XMO L;  4JC0 A;  2OQ0 A;  4GLV B;  1IZ6 A;  1IXR A;  4B3M L;  4IJL A;  4DR6 Q;  2AMC B;  1VQO A;  3HKZ G;  4HIO A;  3IRB A;  1N8R C;  2D62 A;  5BR8 L;  4IPH A;  4AIM A;  4HJ5 A;  1XPR A;  3CCJ A;  1L1O C;  2QEX A;  4JBK A;  1EUJ A;  1L0W A;  3K8A A;  2NN6 G;  5H1S E;  3BZC A;  1P8L A;  1HZC A;  4P74 A;  3STB C;  4P75 A;  1JJ2 A;  2L15 A;  1N33 Q;  4X6A H;  1NBW A;  5IYC G;  2ZM6 Q;  5LMU Q;  1TWH H;  4YHH Q;  1QVG A;  1KRS A;  4JI0 L;  4JYA L;  1XNQ Q;  1HNW Q;  4PZ8 A;  4LF4 L;  4NB3 A;  4OO1 G;  4GS3 A;  1Q1E A;  5IYD G;  1L1O B;  2NVT H;  3KFU A;  2AHO B;  2E8G A;  1VQG A;  3KOJ A;  2PI2 E;  2K14 A;  3DM3 A;  2OTL A;  3RZO H;  4L5R C;  1PYB A;  1PH7 A;  3HOU H;  4DR5 L;  4LUO A;  2KCT A;  1J6Q A;  1SR3 A;  2R6G A;  2R7Z G;  4BY7 H;  3M9B A;  4GOP B;  5C4J H;  4R4O A;  3T1H L;  1XNQ L;  3HOY H;  2OQK A;  1JJC B;  3UE0 A;  3CCQ A;  1RL2 A;  1JJG A;  1HJP A;  2YTV A;  3TS2 A;  3PO2 G;  3M85 A;  4DV3 Q;  3KJP A;  1JMC A;  1DGS A;  3M7N A;  2GN5 A;  2KHI A;  5IT9 c;  1E1O A;  2KEN A;  2UUA L;  4POF A;  2C35 B;  2K5V A;  1SLJ A;  3RLO A;  1RIP A;  1M1K C;  1I94 Q;  4LF7 L;  4BXX H;  2RHS B;  1C0A A;  4PZ7 A;  4LF5 Q;  5ELN A;  2E2J H;  4ALP A;  1G29 1;  4WJ3 M;  2VL6 A;  4POG A;  3EIV A;  4BXX G;  2HQL A;  2Q2H A;  2WAQ E;  4B3R Q;  4YY3 Q;  1YJW A;  4GN4 B;  4LF8 L;  4NPS A;  4JI4 Q;  3I4O A;  4KHP Q;  4A3B H;  2MQH A;  2YV5 A;  1N32 L;  2XGT A;  1X9N A;  3K81 C;  2CCZ A;  1MJE A;  4JV5 Q;  4JOI A;  2UXC L;  1OXV A;  4UP9 A;  1XJV A;  2BH2 A;  1H95 A;  1VQM A;  1Q86 C;  5C0X I;  4DV6 Q;  2VZA A;  2VQE Q;  5GAD C;  3S1M H;  4DV5 L;  4A75 A;  4GKK Q;  5C44 G;  2Q2T A;  3CPF A;  3PSI A;  3L7Z C;  2ZTE A;  3F1Z A;  2NVY H;  1QVC A;  3S17 H;  1A8V A;  1BBU A;  3NEN A;  3PUV A;  3T1Y L;  3CMA A;  5FLM H;  3AQQ A;  3KF8 B;  3CCM A;  3CC4 A;  3TS0 A;  2YTX A;  3PIP A;  1E22 A;  1Q46 A;  1ASY A;  2R92 G;  4OXP A;  1UE6 A;  1W3S A;  1VCI A;  3F2B A;  4OWW B;  3GTP H;  1HR0 L;  3JC6 6;  1HNX L;  1X3F A;  1I5F A;  1VQ4 A;  2BA0 A;  2R7Z H;  1E1T A;  1CSQ A;  3M4Q A;  2VQF L;  2ZJP A;  4JI8 L;  2A8V A;  4DAY B;  5JJL A;  2Q2I A;  2ASB A;  4MNO A;  3A74 A;  3KF6 A;  1QVF A;  2MFI A;  2EIF A;  1Q82 C;  2K50 A;  4DV4 L;  2CFM A;  2NZO A;  4JBW A;  4DK3 C;  1N33 L;  3F2C A;  1IYJ B;  1NJI C;  4GN5 A;  4O2D A;  2B63 G;  1VQK A;  2JA6 H;  1PH9 A;  1Y1V H;  4AQY Q;  3UDF A;  1XNR L;  3J80 i;  4DV1 Q;  3J81 c;  3OYY A;  1EYG A;  4DUZ Q;  1I6H H;  3RNU A;  3EBE A;  1KL9 A;  1LTL A;  2JA5 G;  3PF4 A;  2Q2U A;  1HZB A;  3PGZ A;  3U4V A;  4OWT B;  4IJH A;  1Y1V G;  4TQU S;  2JA7 H;  2UU9 Q;  1FGU A;  1CKM A;  2YTY A;  3UE1 A;  3PIO A;  3W5O A;  4AYB G;  2UUC L;  3PF5 A;  2NZH A;  5C4X H;  3HFZ B;  4OWX B;  4DNI A;  2MNA A;  4DV2 Q;  3S15 H;  2Z6K A;  3H3V H;  4X62 Q;  4HJ9 A;  3A5Z B;  4B3T L;  2WAQ G;  4YCU A;  3G48 A;  1M90 C;  4DV7 Q;  4DAM A;  4X66 L;  2VQE L;  1Q7Y C;  2NVQ H;  3OTO L;  4A3I G;  4K0K Q;  4JI3 L;  1BBW A;  1TWG H;  2ZTC A;  3FKI H;  5LMN Q;  4DV0 Q;  4A3E H;  4A3C H;  1Y14 B;  1KIX A;  2BH8 A;  3K7A H;  3H0G G;  4IPD A;  5IP7 G;  4LF6 L;  4A3L H;  3S14 H;  1FJG Q;  1QZG A;  2I0Q A;  1Z47 A;  3CAM A;  1C7Y A;  2OTJ A;  3S24 A;  2LXK A;  4A3K G;  3G71 A;  1PH2 A;  2MO0 A;  3B6Y A;  4A3D H;  4A3C G;  1X54 A;  3CCU A;  2LSS A;  1X6O A;  4UP7 A;  4IFD J;  4K0K L;  3EN2 A;  3AFP A;  3S1R H;  4LF4 Q;  2PMZ E;  1YNX A;  3CME A;  4NXM Q;  2Z0S A;  3DLL A;  3G4S A;  1UWV A;  3CPW A;  1EQQ A;  4DV4 Q;  4BBS H;  4EQ5 A;  1WCM H;  1XPU A;  3NEM A;  1A63 A;  3A5U A;  4LFB L;  1QUQ B;  3T1H Q;  3J7Z C;  1P16 A;  2HHH L;  1MIU A;  2R7F A;  4NXN Q;  1G51 A;  2VS1 A;  4P71 A;  1MJC A;  4AH6 A;  3CCS A;  2F52 A;  2JE6 I;  2E5L L;  2UUB L;  2PQA A;  4X65 L;  1YI2 A;  3PO2 H;  4KLK A;  3GO5 A;  4DKA C;  4KI0 A;  4A76 A;  2IX0 A;  1PH8 A;  1OXT A;  4LF5 L;  3PUY A;  2V1C C;  1IBL Q;  3PO3 H;  4A3J G;  3S2H H;  4IFD I;  3J7A 5;  2Y0S G;  2DUD A;  2F3I A;  2GVA A;  4GN3 B;  4KHZ A;  3G6E A;  1VQB A;  4A3B G;  3J81 j;  3RLN A;  3PUZ A;  4HID A;  4DR4 Q;  4C3I H;  1YHQ A;  4A3E G;  1L2F A;  4X62 L;  4DR7 L;  3I55 A;  1YJN A;  2N78 A;  4DR1 Q;  2UXC Q;  1VQF A;  2JA5 H;  4EX5 A;  3CQZ H;  3GTJ H;  4DV6 L;  4JBM A;  2B29 A;  1YIT A;  1S72 A;  1CKN A;  2IHF A;  3S1N H;  1N32 Q;  2JJQ A;  1SN8 A;  3E9H A;  5J3B A;  4JCV E;  5BR8 Q;  3STB D;  4IO9 A;  1WCM G;  4DUY L;  5C0X G;  3GTO H;  1LM0 A;  1U0L A;  4LW1 A;  2UXD L;  1X3G A;  3ER0 A;  4C2M H;  4A3K H;  5FLX c;  1Y1W G;  4PMW A;  1EQR A;  4PZ6 A;  3S1Q H;  3GTL H;  4JI0 Q;  3HOV H;  3PO3 G;  1BVS A;  3M4P A;  4X64 Q;  3U58 A;  3HOY G;  5C0X J;  1HNW L;  4QGU A;  5GAE C;  3AEV A;  4R4C A;  1PH3 A;  4PG3 A;  3GTM H;  4QY7 A;  1S40 A;  4L5Q A;  3CP0 A;  1V1Q A;  4QQB X;  2ID0 A;  4X66 Q;  3LGJ A;  2K4K A;  2PI2 A;  3UDX A;  4HIM A;  4A3M H;  2JA7 G;  4YWL A;  4JI2 L;  2EXD A;  2F4V Q;  3JAM c;  2B63 H;  1L1O A;  5DLQ E;  2JA6 G;  4DR2 Q;  2JA9 A;  2GVB A;  4B3M Q;  1AH9 A;  1GD7 A;  4OO1 I;  1NMF A;  5C3E G;  4A3G H;  1GVP A;  4X65 Q;  1PH6 A;  3CD6 A;  2VUM H;  3AFQ A;  5EAY A;  1X65 A;  2JEB I;  3I7F A;  5GRO A;  1G6P A;  2Z6K C;  2ZJQ A;  1WJJ A;  1VQA A;  4JI2 Q;  3WWV A;  2IY5 B;  2I5L X;  1IL2 A;  1D7Q A;  5JEA J;  1B70 B;  1JB7 A;  2XTI A;  2RF4 A;  2FXQ A;  4XIG S;  1E7Z A;  4DR4 L;  4R4T A;  4DV2 L;  4LNQ A;  4DR7 Q;  3I56 A;  1VQH A;  1PVO A;  5JJI A;  4B3T Q;  1EIF A;  1EWI A;  1NY4 A;  3F8T A;  5M3M G;  1QUQ A;  4A3F H;  1VQP A;  1PH5 A;  2KCM A;  1HR0 Q;  4DPG A;  1I3Q H;  3RR5 A;  4APV A;  5JEA G;  1PH1 A;  2ES2 A;  4MZ9 A;  2RHQ B;  4JI8 Q;  1N36 Q;  2AWN A;  3I2Z A;  2ALY B;  2E5L Q;  2UUB Q;  1GKH A;  3HOW G;  4RMF A;  4HJA A;  2A19 A;  5K36 G;  3W1G A;  1XMQ Q;  4YCW A;  3KDF A;  3HOW H;  2PNH A;  2OCE A;  1LYL A;  2UXB Q;  3A0J A;  3RZD H;  5GAH C;  3T1Y Q;  3I4M G;  4J15 A;  1Q81 C;  4AQY L;  1XNR Q;  1UE1 A;  1OXS C;  2R7D A;  1Q1B A;  1VQE A;  3L2P A;  4DR3 L;  3D0F A;  4IOC A;  4Y52 H;  4WJ4 A;  3NBH B;  2VW9 A;  3VDY A;  1FL0 A;  3KJO A;  4A3M G;  5JJK A;  3BU2 A;  4JOI C;  5IYD H;  3ERS X;  4A3F G;  2VQF Q;  1SMX A;  4YY3 L;  4IPG A;  5IYB G;  4LF8 Q;  4HJ8 A;  2JEA I;  1CSP A;  5FJ8 G;  4DUY Q;  4LUV A;  3CCE A;  1HNZ L;  4NXN L;  1TXY A;  2QA4 A;  2JK8 A;  5LMN W;  2R93 G;  4IOA A;  1K9M C;  4JI7 Q;  1WYD A;  2B3G A;  3GTG H;  3Q8D A;  1OXX K;  2AWO A;  4GOP C;  4LFB Q;  4AYB E;  2YYZ A;  1VQN A;  3M3Y H;  1TWC H;  4R1J A;  3ULL A;  2HHH Q;  4DV5 Q;  4JBJ A;  5LMN L;  3KF6 B;  5M5Y H;  3S16 H;  2CQO A;  2D0P A;  4JI5 Q;  4DK6 C;  3CXC A;  3ULP A;  1IBM Q;  4GLA C;  4GKJ L;  1HZ9 A;  1V43 A;  1IBL L;  3J81 i;  2WP8 J;  1VQI A;  5M3M H;  4JI7 L;  2ZTD A;  5AJ3 Q;  3PV0 A;  3ULJ A;  3K80 C;  4BY1 H;  4Y7N H;  2HIX A;  2D0O A;  1YHB A;  4GLX A;  1JE5 A;  1LUZ A;  1YJ9 A;  1A62 A;  1N36 L;  1VQL A;  3TRZ A;  4LF9 Q;  2QGQ A;  3RLF A;  2K52 A;  1N9W A;  4A3D G;  1V9P A;  1VQD A;  4H02 A;  3JAM i;  1N34 L;  1UE5 A;  4BBR H;  1IBK L;  3OTO Q;  1E3P A;  3K7U C;  4B3S Q;  2A1A A;  4JI3 Q;  2H5X A;  1UEB A;  1OXU A;  1B8A A;  4DV0 L;  1CUK A;  3HKZ E;  1EOV A;  1XPO A;  4JI6 Q;  4IPC A;  3SGI A;  4XTC S;  1NMG A;  1VQC A;  1WFQ A;  4BA1 I;  5IWA Q;  5M3F G;  4GNX A;  1GO3 E;  1YZ6 A;  1VQ9 A;  3I4N G;  5IYB H;  4A3I H;  2N8N A;  3U4Z A;  1D8L A;  1KAW A;  1SE8 A;  1U5K A;  3K0X A;  1NE3 A;  1KRT A;  2I5H A;  4YWK A;  1N34 Q;  4LFA L;  2K75 A;  4LUZ A;  4YWM A;  5ELO A;  4X64 L;  1VQ6 A;  1VQ8 A;  3E0E A;  1YEZ A;  3I4N H;  3HKS A;  1TWA H;  2NN6 I;  4QL5 A;  5IYC H;  1KC8 C;  4DR2 L;  3MEF A;  1CKO A;  1I94 L;  3HOZ G;  4LFC Q;  4BA2 I;  3KDF B;  2IHE A;  1O7I A;  1X56 A;  1R9T H;  3AYH B;  1W2B A;  3HOX G;  1Y1W H;  4UY8 C;  5M5X H;  1Q8K A;  4DV7 L;  4LFA Q;  4YHH L;  2CWP A;  3RN2 A;  2DGY A;  1PH4 A;  1JT8 A;  3PUX A;  2R92 H;  3E9I A;  1XTD A;  2NVX H;  3H3V I;  2N49 A;  3M4O H;  3GDE A;  4O0A A;  4DR3 Q;  2WB1 G;  4FDB A;  5C3E H;  1KQS A;  4OX9 L;  5M5W H;  1PA6 A;  4A3G G;  5FJ8 H;  4C3J H;  1IBM L;  3GTQ H;  2EQS A;  4GKJ Q;  4C3H H;  2E2I H;  4L5T A;  4LFC L;  1T9H A;  1B7Y B;  1PYS B;  1EIY B;  2UXD Q;  3S2D H;  1K83 H;  4OON A;  3CCR A;  4A93 G;  5GQO A;  5E7N A;  4IFD G;  1YIJ A;  1FJG L;  3RN5 A;  4DR6 L;  4YCV A;  4QJF A;  5M3F H;  3FKI G;  4MTN A;  1YVC A;  1SFO H;  4DUZ L;  2CKZ B;  2Y0S E;  3W1B A;  4JI1 Q;  3HOV G;  1KHI A;  4LF7 Q;  2IT1 A;  3KLW A;  5GAG C;  3CC7 A;  2UUA Q;  3CF5 A;  4JI6 L;  4BY7 G;  2ZM6 L;  3CW2 C;  4TVA B;  3TRE A;  5LMU L;  3H15 A;  4NXM L;  2WFW A;  1MKH A;  2LXJ A;  3PCO B;  1BKB A;  2CWA A;  5IP9 G;  1KD1 C;  1FVI A;  3FP9 A;  1XMQ L;  2R93 H;  2KHJ A;  3KYH C;  2UXB L;  4JV5 L;  1CKN B;  2ZJR A;  3H0G H;  1SRU A;  3L0O A;  5IP7 H;  5IP9 H;  4HIK A;  1SRO A;  3ICE A;  4JI1 L;  1VQJ A;  4JI4 L;  1XMO Q;  1E24 A;  4KHP L;  2MO1 A;  2JA8 G;  5C44 H;  2E2H H;  5IY0 A;  1VQ7 A;  3BJU A;  4LF9 L;  2HIV A;  4GOP A;  3CC2 A;  1I50 H;  1KXL A;  3CCL A;  1WOC A;  1X55 A;  4P73 A;  2OWO A;  2JA8 H;  4ME3 A;  4HJ7 A;  2KBN A;  4RG1 A;  5C4X G;  1C9O A;  1WI5 A;  3HOX H;  4GKK L;  2N3S A;  4DR1 L;  4R4I A;  2F4V L;  1HR0 W;  2BA1 A;  3I4M H;  2IX1 A;  4GNX B;  5IWA L;  3MXN B;  4BY1 G;  1QZH A;  1YBY A;  3TEH B;  4JYA Q;  1ASZ A;  2VNU D;  2K5H A;  5IE8 A;  3F2D A;  5FLM G;  1X3E A;  4LWC A;  1K3R A;  4JI5 L;  1PHJ A;  1K0R A;  3UDG A;  2ATW A;  1A0I A;  4P72 A;  3UDI A;  1HNX Q;  3PUW A;  4DR5 Q;  3CCV A;  1K8A C;  4A93 H;  3FHW A;  2JQO A;  2PQA B;  2WB1 E;  2AKW B;  1PFS A;  3GD7 A;  1YHA A;  4JG2 A;  4QIW E;  4BBS G;  4UPA A;  2VY3 A;  3BZK A;  4LF6 Q;  1HZA A;  5HY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...