3I4MH

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
137
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLETRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 18
structure length 137
sequence length 146
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mH00
5M3MG 4DR4L 2CFMA 4JV5Q 4HJ9A 4A3JG 2NVYH 3PIOA 4A3MH 1I3QH 4JV5L 3W1BA 2AKWB 3BZCA 4OX9Q 2PNHA 2VS1A 1NMFA 4DR7Q 5K36G 1VQKA 2IX1A 2UXCL 4OX9L 3ULLA 4POFA 1N34Q 3HOWH 1Y1WG 4R1JA 1JB7A 3GTKH 3J7ZC 4QJFA 2YTXA 2UXDQ 4JG2A 1K9MC 3GTJH 1TXYA 4IJHA 4A75A 3S14H 1T9HA 4JI7L 1VQOA 1YZ6A 4YY3L 3PF4A 3CF5A 2C35B 1WI5A 1E3PA 3GD7A 1SLJA 2VQEQ 1Q12A 1ASZA 1EUJA 1QUQB 1R9TH 4HJ7A 3U50C 1OXVA 4DR2Q 2XTIA 3CCSA 2R92H 5M3FG 2K75A 4IO9A 1PH9A 4DR2L 3G71A 3S15H 1HNXQ 1X55A 3HOZG 1E24A 4A3EH 4P71A 3T1HL 1M1KC 4JI4Q 1VS0A 2LXJA 4YCVA 2KHJA 1SR3A 5C4XH 1S40A 5GROA 3FKIG 4LFBL 1QVCA 1BKBA 3W5OA 1L1OB 3HKZG 2K5HA 2F52A 3I56A 1VQMA 1LUZA 3IRBA 4ME3A 3PGZA 3ULPA 4JI2L 5LMNW 1KL9A 2VNUD 2I0QA 3CCLA 1YJ9A 1HR0Q 4BA1I 1KC8C 2JA6H 4DV5Q 1X3GA 3CC7A 5C4JH 3M4QA 1BBWA 2ZM6Q 1OXUA 3B6YA 1N32Q 2Z6KA 3S1MH 2WFWA 3JAMc 1VQ4A 2ZM6L 1Q82C 1I5FA 1Q81C 1KIXA 5IYCH 1UE7A 1EIYB 5FLMH 2H5XA 1GVPA 4DK3C 4KHZA 3CMAA 5IYDG 4A3KG 1PH1A 2E2IH 4K0KL 3CCEA 1A62A 5ELOA 1IXRA 2F4VQ 4JI8L 1I94Q 1XMQL 1VQGA 3UDFA 2ATWA 1U0LA 3DLLA 1Q1EA 2PMZE 3HOYG 3KJPA 3Q8DA 4NXML 3DM3A 4L5SA 4BY1G 4JI1Q 4B3MQ 3LGJA 5LMUL 4X6AH 4A76A 1JJCB 2KHIA 1VQBA 5GQOA 3PO2G 2ZJQA 4DUZQ 4IPDA 1CKNB 2EQSA 3NENA 4DV4Q 3CC4A 3RN5A 2B63G 5JJKA 4P72A 2L15A 1YI2A 4LUOA 1MKHA 2F3IA 2N49A 3S24A 4LF8Q 3GO5A 2MNAA 3PV0A 1YNXA 3G6EA 1I6HH 1CSQA 3KF6A 1TWHH 1IZ6A 4AQYQ 4HJ8A 5M3MH 1YHAA 2ES2A 1L1OC 3UDXA 3H3VH 2I5LX 1XPRA 1SROA 4A3JH 4B3TQ 4DPGA 1HZCA 4UY8C 1W2BA 2PQAB 4AYBE 5BR8L 3J81i 1PHJA 1L0WA 4AIMA 3EN2A 4X64Q 3S2DH 1Y1WH 4LW1A 3UDGA 4A3BG 2YTYA 1YHBA 1OXTA 1VQCA 3CP0A 2UUBQ 4X62Q 2Q2UA 2UUBL 1OXSC 1MIUA 4YWLA 1KD1C 3EIVA 3S1RH 4NPSA 4DV1L 1VQ8A 4JI6Q 2EXDA 4R4CA 4RMFA 1PA6A 4JOIA 1HZBA 4IFDG 3U4VA 3F1ZA 1N36L 3D31A 2R6GA 1S72A 4DV0Q 1HH2P 2Q2IA 3F2BA 3TS0A 2AMCB 2VQFL 4GS3A 3PUYA 2VUMG 4A3FG 3CC2A 4DV0L 2UUAQ 1WYDA 1YIJA 3CD6A 5M3FH 1K8AC 1G51A 2UUAL 1LYLA 3HOZH 1VQ5A 2I5MX 1XMOQ 4PZ7A 3WWVA 4LFCQ 5JJLA 2BH8A 5DLQE 2UU9L 1XMOL 3FKIH 4LFAQ 2NVTH 4GKJQ 2IX0A 5GADC 1FGUA 2PI2A 4GKKQ 1HZAA 3L2PA 5IWAQ 5AJ3L 2YYZA 3HKSA 2HIXA 4QL5A 1ASYA 5IWAL 5LMNQ 1KHIA 2D0OA 1YITA 2NVQH 1U5KA 1PYSB 3NELA 1WCMG 2JE6I 1Y14B 3CMEA 5H1SE 2Q2TA 4BBRG 3KF8B 4AYBG 3KF6B 4P74A 1N8RC 1Q86C 1FL0A 3RLFA 4A3LH 3CCMA 3M4PA 4GNXC 4DR7L 4A3KH 1N33Q 2R7FA 5IYDH 4MNOA 3U58A 3MXNB 2YU9H 3TRZA 3KJOA 4YHHQ 1N34L 1Y1VG 3S2HH 4FDBA 4LF6Q 4LF5Q 1N33L 3J81j 3RLOA 2Q2HA 3KLWA 3HOVG 3RNUA 3AYHB 1VQ6A 4LF9Q 5C0XI 2UXDL 2LXKA 4LWCA 4L5QA 2BA0A 1QZGA 4JI0Q 4JI5Q 4PZ6A 4BY1H 4IFDI 3NEMA 4HJAA 1YJWA 4BY7H 2CQOA 2E2JH 4JI5L 3PO2H 4IFDJ 2MO0A 1E1OA 3KDFA 3PSIA 3PO3G 1B8AA 1TWFH 2CWPA 2QGQA 2VQEL 4C3HH 1VQNA 2B63H 2YTVA 3PUZA 1UE6A 1EWIA 5M5XH 4GLXA 2A1AA 4IPCA 1NMGA 1BVSA 4IPGA 4AH6A 5FLXc 4DNIA 2KENA 3OW2A 4JBKA 1HNXL 4GOPB 3TREA 3EBEA 4JI4L 1H95A 3HOXH 2JA9A 3HOUG 2JEBI 2A8VA 3KOJA 1YEZA 5C44G 3AQQA 3T1YQ 1PH4A 5ELNA 2UUCQ 3I55A 2R7ZG 1PH5A 4HIKA 1J5EQ 4DAMA 5M5YH 3CCQA 1B70B 4APVA 1FJGQ 4YCUA 1PFSA 1HR0L 1JMCA 1X3FA 3CPWA 1IBMQ 3STBC 2QA4A 4DV5L 4HIDA 4A3BH 3F2CA 2IT1A 1EYGA 1IBML 1GKHA 2XGTA 4A3IG 4TVAB 1N32L 1Z47A 1VQJA 1W3SA 1Q8KA 3PUXA 4IJLA 2EIFA 4A93H 4P73A 4JYAQ 1EQQA 2ID0A 2E5LQ 3GTLH 3CCRA 4GNXA 3CQZH 2VL6A 4R4IA 1EIFA 2JA7G 2F4VL 1I94L 3JAMi 2KCTA 5HY6A 1X9NA 4B3SQ 3M9BA 2HQLA 1SN8A 2E8GA 1IBKQ 4EX5A 4PZ8A 2ZTDA 4IOCA 2VUMH 4JBWA 3SGIA 4A3FH 1PH8A 4A3CG 2IY5B 4B3ML 4JI1L 2ZTCA 1LTLA 4RG1A 3GDEA 3FP9A 2VW9A 1HZ9A 4GLVB 4DUZL 1I50H 1D7QA 1VQAA 5IYBG 1M90C 4XIGS 1SFOH 4DV4L 1GO3E 4ALPA 2GVAA 4A3DG 4LUZA 3KYHC 3UE0A 1YBYA 1Q1BA 4GOPC 2MO1A 4LF8L 2NVXH 5C3EG 1E1TA 2Y0SE 1WJJA 4R4TA 5IE8A 3K81C 1CUKA 4AQYL 2KCMA 4UP9A 1KRTA 1O7IA 1K0RA 5IP9G 4BXXG 1WCMH 1VQ9A 1KQSA 2JEAI 1VQFA 4Y7NH 2OTJA 4BBRH 5FJ8G 1LM0A 3CPFA 4B3TL 5IT9c 3I4MH 4OXPA 1SRUA 1A0IA 1P16A 1XTDA 1XNQQ 3KFUA 2OTLA 3BJUA 4X64L 1Y1VH 1NE3A 1K8GA 4YWKA 4C3JH 3HOVH 2WP8J 4JI3Q 1X6OA 4KI0A 2ZJPA 1FVIA 1G291 5JJIA 3OTOQ 1IYJB 1NTGA 2R7DA 1IL2A 4A3GG 4R4QA 4X62L 5C0XG 3G48A 1UWVA 2E2HH 1WFQA 2HIVA 4JI6L 5HGQA 4OWTB 3J80c 4HIOA 4DR1Q 1L2FA 4LF7Q 1XNRQ 1A63A 1AE3A 3RR5A 4DV6Q 1HNZQ 4BBSG 4DR1L 2NN6I 1XNRL 3I2ZA 5GAGC 1JJ2A 1X3EA 1HNZL 4DR5Q 3AEVA 4DAYB 3H15A 4WJ4A 1IBLQ 2K14A 1QUQA 2WAQE 3RLNA 4X65Q 3TQYA 4QIWE 4LFCL 1XPOA 3HOUH 4GKJL 3E9IA 4LFAL 5C44H 3ERSX 3A5UA 2N8NA 2JA5G 3I4NG 2Y0SG 3UE1A 2R7ZH 3HFZB 1TWAH 4DV2Q 3MEFA 1B7YB 5LMNL 3NBHB 3PCOB 1VQEA 3F2DA 1JJGA 4NXNQ 4H02A 1L1OA 1YVCA 1VCIA 1E7ZA 3BU2A 4NXNL 3CCUA 1BBUA 2OWOA 1E22A 1X54A 2DGYA 5IP7G 4L5RC 1XPUA 2HHHQ 1AH9A 2ALYB 2BA1A 3M4OH 1GD7A 4JBJA 4UPAA 1AE2A 1HNWQ 1XJVA 1CSPA 3H0GG 1PH7A 4YHHL 3GTMH 5EAYA 4LF6L 2K5VA 4LF5L 2MQHA 2JA7H 3HOYH 3PF5A 1WOCA 1N9WA 4KHPQ 4O0AA 4JC0A 4OONA 4GN4B 1K3RA 4LF9L 2Z6KC 1Z9FA 5E7NA 5C0XJ 3PUVA 4JI0L 4A3CH 4KHPL 1GM5A 4A4IA 2UXCQ 1TWCH 2N3SA 4JCVE 5IYBH 2OQKA 3STBD 4YCWA 2GVBA 2MFIA 3E0EA 3JC66 4O2DA 3ULJA 1C0AA 4A3DH 3ZJYC 2YV5A 3K7UC 4DR3Q 4LUVA 5GAHC 4PMWA 4C2MH 1VQLA 1OXXK 2QEXA 1PVOA 4DR3L 5C3EH 1CKNA 4JI7Q 2R93G 1JT8A 1NY4A 3A5ZB 1K73C 2WAQG 4YY3Q 2JA8G 1A8VA 2KBNA 4GLAC 2WB1E 3BZKA 4PG3A 5IP9H 1PH2A 4BXXH 2ZJRA 3K80C 5FJ8H 3T1YL 1EQRA 4NB3A 2UUCL 2IHFA 1D8LA 1EOVA 2K52A 4R4OA 1J5EL 3ICEA 1SMXA 2AHOB 1FJGL 1K83H 2RF4A 3T1HQ 3CXCA 1PV4A 3TS2A 4GKKL 1CKOA 1YHQA 2PQAA 1V1QA 4LFBQ 3TEHB 1X56A 4HIMA 2CWAA 4MZ9A 5J3BA 4OWWB 1VQPA 2RHSB 3I4OA 1MJEA 1G6PA 4OWXB 2GN5A 3GTPH 4A3GH 3FHWA 5JEAG 4JI2Q 4JYAL 2OCEA 2E5LL 3I4MG 1PYBA 2K50A 3H3VI 1QZHA 1KAWA 2AWNA 2N78A 1TWGH 4B3SL 3CW2C 4Y52H 3A74A 4BBSH 4OO1G 2CKZB 1J6QA 3CCJA 4A3MG 1IBKL 4DKAC 3S1QH 1RL2A 2NN6G 3J7A5 1VQDA 4A3LG 4HJ5A 2NZOA 4K0KQ 2ASBA 3HOWG 2D62A 4JOIC 4JI8Q 1XMQQ 4WJ3M 2A19A 3KDFB 2RHQB 4BA2I 2JA5H 4NXMQ 3I4NH 3GTGH 1CKMA 4EQ5A 1JE5A 4XTCS 3S1NH 2LSSA 5LMUQ 3RZOH 4IOAA 1VQHA 3AFQA 2B29A 3K0XA 2WB1G 3PUWA 2ZTEA 4BY7G 2JJQA 4QY7A 2UXBQ 4DUYQ 4B3RQ 2UXBL 4DV7Q 1C9OA 5IP7H 4DUYL 4DK6C 2R92G 3L0OA 4B3RL 1VQIA 3D0FA 1KXLA 4DV7L 1XNQL 1VQ7A 4A3EG 4YWMA 3H0GH 5C4XG 3J81c 4JBMA 3CCVA 3G4SA 3F8TA 4JI3L 4GN5A 3HOXG 1UEBA 2HT1A 1X65A 3OTOL 2K4KA 5JEAJ 1V43A 3U4ZA 2JK8A 4IPHA 4J15A 3K8AA 5BR8Q 5M5WH 4DV3Q 1YJNA 3W1GA 1Q7YC 1EFWA 5GAEC 3PO3H 4OO1I 2FXQA 1MJCA 4LF7L 4DV3L 1HR0W 2JA6G 2K5NA 1DGSA 3S17H 1NBWA 4DV6L 2RCNA 3PIPA 4GNXB 2D0PA 2I5HA 1P8LA 3OYYA 4UP8A 4L5TA 3S16H 4DR5L 3M85A 1OTCA 3GTOH 3J80i 5IYCG 4MTNA 1Q46A 2VZAA 5FLMG 1UE1A 1IBLL 2BH2A 2R93H 2NZHA 4DV1Q 2B3GA 4UP7A 4A93G 1KRSA 2JA8H 3RN2A 5IY0A 2VY3A 4X66Q 4LF4Q 4X65L 1QVFA 1QVGA 1N36Q 1UE5A 3I7FA 4POGA 3GTQH 3M3YH 4LF4L 4X66L 4DR6Q 2VQFQ 3K7AH 4GOPA 4DR6L 1S3OA 1SE8A 4C3IH 3AFPA 3CAMA 4DV2L 3A0JA 4QGUA 2AWOA 2IHEA 3E9HA 3L7ZC 3RZDH 1NJIC 4A3IH 2UU9Q 4QQBX 2CCZA 2DUDA 1RIPA 4TQUS 1HJPA 1V9PA 2V1CC 5AJ3Q 2HHHL 1C7YA 2JQOA 3M7NA 2OQ0A 3HKZE 1PH3A 4GN3B 4KLKA 4P75A 1PH6A 4DR4Q 2PI2E 1HNWL 3ER0A 3UDIA 2Z0SA 3VDYA 4LNQA
chains in the Genus database with same CATH superfamily
4DR4L 4JV5Q 1H9MA 4C3JB 1TKWB 3CRLC 4A3MH 3W1BA 4OX9Q 1Q90A 5FLXE 1FYCA 2QDBA 4ODGA 1Y1WG 4FP5D 3J7ZC 4QJFA 4JG2A 3GTJH 1TXYA 3SEBA 2M9VA 4YY3L 4V0BA 5EBDA 2C35B 2NVTB 1R4QB 1E3PA 4XQNA 1SLJA 2VQEQ 1ASZA 4OIJA 1QUQB 5C44B 1R9TH 3U50C 2LS01 4NMZA 1BCPD 2R92H 1IHZA 3IFTA 3H3VC 2K75A 4IO9A 4L6TB 1D2BA 4DR2L 2NVQB 1HFGA 1X55A 2O2LD 3HOZG 1LT6D 4P71A 1S40A 5C4HA 5GROA 3K6OA 2PPBC 1EFID 3HKZG 2K5HA 1A3TA 5EKKA 4ME3A 3IRBA 3PGZA 3QWNA 1A3UA 3RUZA 4JI2L 2L12A 2I0QA 1DXMA 1YJ9A 1PRTF 5C4JH 3HOYB 1BBWA 1OXUA 3MWYW 2EY2A 2Z6KA 3S1MH 4RCOA 1Q81C 5FLMH 1GVPA 3CCEA 3CHBD 2K28A 5ELOA 1D6EC 4JI8L 4KN4C 1VQGA 3GP7A 1U0LA 3DLLA 1Q1EA 2NB0A 4KMUC 1EYCA 2TMPA 4L5SA 2FMCA 3LGJA 2I07B 5GQOA 2B2WC 4IPDA 3KLSX 4DV4Q 3CC4A 4C3HG 3RN5A 4TRDA 5JJKA 1ZYRD 4P72A 2P5ZX 2J0TD 1F2MA 1I4GA 2K5QA 2N49A 3KBXA 4TSSA 3PV0A 3G6EA 3F2UA 1I6HH 3DEPA 1D5XC 1NR4A 2I5LX 4DPGA 3I72A 2PQAB 4AYBE 5L37A 3LX0A 5BR8L 3DWPA 3V05A 2F0FA 1PHJA 1PDQA 1U4LA 4AIMA 2EY5A 4X64Q 3S2DH 3N6RA 4LW1A 2YTYA 1YHBA 1DOMA 1OXTA 1VQCA 3QR8A 3MXGA 2Z1CA 5JJZA 3VR5A 4EQPA 1EY8A 3MXUA 5AFWA 4X62Q 2UUBL 1KD1C 3ITPA 1HPCA 4NPSA 1VF7A 4JVZA 1PA6A 4JOIA 2FHTA 2G9HD 2R6GA 3F2BA 2VQFL 3PUYA 2WKDA 2VUMG 4A3FG 4KK7A 3CD6A 3G6JB 4Z9CB 1VQ5A 2MP1A 1D5ZC 1UUPA 5JAVA 4PQXA 5KNCA 2BH8A 1XMOL 4LFAQ 2IX0A 5GADC 5AJ3L 4K6LA 4PV1C 1DD2A 1XXGA 2WINB 3TN2A 4QL5A 2E74C 5J22A 1YITA 1U5KA 1PYSB 1WCMG 1I4RA 5H1SE 4DU9A 1CT1D 1N8RC 4R8NA 2RVLA 5CMDA 1H9JA 3MXNB 1Y1VG 2L1BA 4LF5Q 3U9SA 3J81j 2TSSA 2X69A 4HMIA 2Q2HA 4C3JG 1TS5A 4LF9Q 5CGKA 2KQ3A 3S16B 2BOSA 3SHLA 3T16A 4BY7H 4QMGA 2E2JH 4IFDJ 1WTPA 2VB2X 4QIWB 3PO3G 1B8AA 1GXDC 3GTQB 1VQNA 1H9SB 2PQEA 2B63H 3PUZA 2R7ZB 1EWIA 2EDGA 5M5XH 4X3SA 2KVMA 4DNIA 3HGBA 5IGGA 4K5WA 1HNXL 1EY5A 3A8IE 3EBEA 3RZDB 4CHTB 1O78A 3RD4A 4A3IB 2JEBI 1VDZA 5C44G 5E4XA 3AQQA 3T1YQ 1PH4A 4ID6A 4KHVA 3I55A 3FDTA 4HIKA 1J5EQ 5M5YH 1F2YA 3CCQA 1A2UA 2D2CC 3P75A 1JMCA 1X3FA 3CPWA 1IBMQ 4DV5L 4HIDA 3H94A 1SNOA 5I6WA 2IT1A 1EYGA 1GKHA 2XGTA 4A3MB 4TVAB 4I7AA 1ML0D 2V4DA 1O7LA 3GTLH 4RWSC 3P20A 2VL6A 1I94L 4C2MB 2EJGC 2HQLA 3TZDA 1IBKQ 4PZ8A 1PH8A 4B3ML 1STYA 3WDNA 4MIUA 2VW9A 4GLVB 4DUZL 1SFOH 1TU2B 4ALPA 3Q24A 3I4LA 5IGBA 4MHEA 4LF8L 2F0EA 2ICIA 5C3EG 1AFPA 2Y0SE 1ICFB 5IE8A 3BS1A 1II3A 4UP9A 1KRTA 1O7IA 1QG7A 1KQSA 1VQ9A 2OTJA 4BBRH 1LM0A 1TS3A 1CZGA 1PFBA 1XNQQ 1NE3A 1K8GA 3AB9A 4X3KA 3HOVH 1K8OA 1X6OA 1FVIA 1G291 1DOKA 3S1MB 1S5CD 2R7DA 1IL2A 4EVOA 1EEFD 4FYDA 3G48A 4JI6L 5HGQA 1XNRQ 1U4RA 3LWEA 1JJ2A 1V1PB 3S1NB 3RZOB 1HNZL 3AEVA 1B53A 4DAYB 4WJ4A 1IBLQ 1CZWA 5ELDA 2WAQE 3RLNA 4X65Q 4LFCL 4GKJL 4ZYSA 1SNPA 2JA5G 4JW0A 3UE1A 1JORA 5NUCA 1LTRD 1TWAH 3H0GB 1I6HB 5DAUA 2K05A 4S3SA 1L1OA 1EOTA 2OWOA 1E22A 2DY8A 4RGTA 2H1EA 2ALYB 4CKEA 1AE2A 2QKIC 1CSPA 3S17B 1PH7A 5EKLA 2EPBA 1SJED 5EAYA 2K5VA 4LF6L 3GTMH 1WOCA 1K3RA 2Z6KC 1Z9FA 4A3CH 2MPMA 5I9PA 1GM5A 2F0GA 1BCPB 4ZAIA 4LJZC 4FXKC 4IALA 3JC66 3ULJA 1CFMA 3ZJYC 4C3IB 1TS4A 1VQLA 1O80A 2EOTA 2QEXA 1PVOA 1JT8A 1G2SA 2VB3X 4YY3Q 2CH4W 3A8KE 4HN7A 4Q0FA 1A8VA 3SR1A 1F77A 2IX3A 3JAME 2XWJB 4F87A 3ICEA 1PTOF 4ABNA 1I6VC 4KD4A 1FJGL 2RQXA 1K83H 3TS2A 1YHQA 5K5PA 5KRUA 2HCCA 3MA2B 1U4PA 2CWAA 4OWWB 2HQEA 4QUFA 1PZKD 4OWXB 4JYAL 4JI2Q 5E3FA 3H3VI 2PCFB 4H44C 5IIFA 5IGEA 1KNAA 2SDFA 4A3MG 4DKAC 3MXPA 2ENBA 1JICA 4O1NA 3QOLA 1B1ZA 5CV4A 4BY7B 4HJ5A 3J7YW 4JOIC 4JI8Q 2A19A 3KDFB 4BA2I 3BDCA 3GTGH 1MGSA 4N9PA 2F0WA 3ND9A 4XTCS 4DAVA 4IOAA 4MTKA 2WB1G 3R2TA 4C1NI 3GV3A 4IUUA 3EVQA 3H6MA 1WTQA 1TS2A 2JSOA 3PMFA 2E75C 5FLXL 4DK6C 2R92G 1VQIA 3IAYA 1VQ7A 2HT1A 1GUTA 1RHPA 2K4KA 3U4ZA 2E2IB 2WV6D 5BR8Q 4OO1I 3PO3H 4H13C 5GAEC 3GTLB 3KK7A 4DV3L 2K5NA 2ZXPA 1ENCA 1AZQA 3OYYA 4RA8A 3GTOH 1SSOA 4MTNA 5FLMG 2NWGA 2BH2A 2R93H 3OMCA 2B3GA 1HUMA 1WTRA 2JA8H 1K8MA 1HQMC 1QVFA 1L0XB 3CRKC 2KA7A 1QVGA 2PZWA 1SFOB 4LF4L 2F0KA 2VQFQ 4K8IA 4BS9A 4GOPA 1TWHB 2B2TA 4DV2L 1WTHA 2JP1A 2IHEA 5KNDA 1BBXC 1SYFA 1DCZA 2EYMA 4ZUJA 4CKCA 2DUDA 3Q23A 1RIPA 4AYBB 4TQUS 1V9PA 5AJ3Q 2HHHL 3M7NA 2MGSA 1IKMA 5ELFA 1UEAB 5JEAH 3UI2A 4ZUIA 5LL6S 1PXUA 3UDIA 4LNQA 1SNQA 3A7LA 3HOVB 2NVYH 4DXFA 2A6EC 2NN6H 1PTOD 2AKWB 2NZ1D 2UXCL 3NHHA 4HCSA 3ULLA 4POFA 1JCKB 3K5LA 3HOWH 3GTKH 1JB7A 3D4WA 2WIIB 3C2PA 3FPUB 1RDPD 3EA6A 5BN3A 1T9HA 2EY1A 3S14H 1YZ6A 3PF4A 3OPOA 2L11A 2F0UA 3GD7A 1SYEA 2HDLA 3A8JE 3TP7A 4XYOA 3T4AC 5IGDA 4HJ7A 1TWAB 3S15H 1HNXQ 1E24A 1M1KC 4YCVA 5C4XH 1HCZA 1SR3A 1KAAA 4CGYB 3OHXC 1BKBA 3NQTA 2F52A 3MAQA 4G57A 1B9NA 5BN4A 2Z9HA 3ULPA 1KL9A 4KJOA 3VR4A 2OXPA 3GTMB 3NWSA 4DV5Q 1EY4A 4X3UA 1WD1A 3I70A 1BCPC 2WFWA 1EY7A 1VQ4A 2JXMB 1SAPA 2ZM6L 1KIXA 1UE7A 3VA5A 1DONA 4KHZA 5A35A 1PH1A 1A62A 2EYFA 1I94Q 3UDFA 2VXWA 1M4VA 3Q8DA 4NXML 5IT9E 4FXDA 4B3MQ 3K0YA 3OOCA 1SE3A 4DUZQ 1CKNB 3GV6A 3NENA 1NUCA 2DJGC 1A15A 3K57A 2B63G 1HHVA 1BDOA 1AN8A 1YI2A 2F3IA 4LF8Q 3S24A 4P2CB 2MNAA 1YNXA 1PTOH 1IZ6A 3SE0A 1K83B 3J80E 5DM73 4HJ8A 5M3MH 1YHAA 1L1OC 3UDXA 3W2DA 2RSOA 1NR2A 1W2BA 1SYGA 4HTHA 2EE1A 4JK1C 4N8X1 3FPPA 5JOBA 4K2LA 3K5OA 1ZYRC 3AU7A 1STGA 2VUMB 4A3FB 3CP0A 3MZ5A 2O5IC 2B2UA 2Q2UA 1MIUA 1X3QA 4YWLA 3EIVA 4JI6Q 2EXDA 3T13A 1HZBA 3D31A 2HCIA 1E2ZA 4DV0Q 4K8JA 2AMCB 2NTTA 2UUAQ 5M3FH 1DZ1A 5D14A 4Y7NB 4LFCQ 4GKJQ 2UU9L 3FKIH 4J8QA 5J39A 1A3VA 1FGUA 5TSSA 5IWAQ 1QCBD 2OT2A 3GQBA 2HIXA 1Y1VB 4F88A 1KHIA 2D0OA 1IYVA 3CMEA 4BBRG 1QOHA 3KF8B 4AYBG 5DM63 4P74A 2XWBB 3RLFA 1ZKOA 1HXYD 3HRZC 3M4PA 4J6HA 4DR7L 1SYDA 2EY6A 1N33Q 3PO3B 4K5VA 2YU9H 3KJOA 1N34L 4LF6Q 3HOVG 3KLWA 3RNUA 1VQ6A 1PZJD 2UXDL 1LTAD 1QZGA 4IFDI 4PZ6A 4BY1H 3NEMA 4HJAA 1G2TA 1YJWA 3DHQA 2R93B 4PNYA 2XIWA 4JI5L 2WAQB 1E1OA 1UNSA 3PSIA 1R4PB 2CHBD 5ELCA 4ZK9B 1TWFH 2QGQA 2E2DC 4GLXA 1V1OA 3I91A 1NMGA 4IPGA 5FLXc 3BVZA 2KENA 3MVVA 3OW2A 5HURA 3TREA 4LMQD 2CW0D 1QNUA 4H7BA 3NP8A 2XNAC 1SE4A 1J9OA 3HG9A 1PH5A 1KNEA 1PRTC 4XT1B 2MUYA 4APVA 1QE6A 1FJGQ 1M8AA 2RSNA 3IL8A 4K14A 5EGTA 4A3BH 3NWTA 2NVYB 3DMUA 3PUXA 4IJLA 2NBFA 1LTGD 4JYAQ 1EQQA 2ID0A 4GNXA 3HOWB 1EIFA 2F4VL 3GTKB 5CV8A 3SK6A 1X9NA 1LT5D 2O5JC 2IPKD 5C3EB 2IY5B 4JBWA 3SGIA 4A3CG 3NE5B 4RG1A 2Q8IB 1I50H 1JOQA 1TY0A 3J81E 1LTTD 1STEA 2GVAA 3ZYYX 1HTPA 4GOPC 4IUVA 1LTID 4R4TA 3S15B 3L9AX 5C4XB 2JEAI 1ILPA 1CA6A 1XYIA 4OXPA 1A0IA 1P16A 1RKNA 1YNND 5ELBA 3KFUA 4KKTA 2OTLA 4ZQ3A 4CDEC 1I4XA 4YWKA 4Q5VA 3V2TA 2WP8J 4DFAA 5EKIA 2QDLA 1TIID 1FNWA 1UWVA 2E2HH 1TR5A 4DR1Q 2JA5B 1BUVT 2ZXOA 3BYYB 3H15A 4CJ0B 2BCOA 3M7GA 2QF7A 1XPOA 3HZXA 3A5UA 2LY7A 2Y0SG 1L0YB 5FO7B 4DV2Q 3MEFA 1B7YB 5LMNL 1PTOB 3NK9A 1VQEA 3PCOB 1PYWD 1WTOA 4NXNQ 1VCIA 2L9HA 4IURA 1BBUA 1X54A 3QOJA 2HHHQ 3M4OH 2QW7A 4RKLA 4UPAA 4U68A 1XJVA 2JA7H 2MQHA 1B3QA 1Z6HA 3E0JA 1N9WA 4KHPQ 4OONA 4JC0A 3TSSA 1U9RA 4RGOS 4OHJA 2SNMA 5F2DA 4JI0L 2EJMA 3VYSA 1PRTD 2UXCQ 4DK1A 2N3SA 5T1GA 3PIP3 4JCVE 1EQVA 5IYBH 4R9WA 2IWHA 3RMHA 1CHPD 1C0AA 4A3DH 4DR3Q 3K7UC 4LUVA 1OXXK 3E3XA 1S5FD 1LTSD 2R93G 3A5ZB 2WAQG 2JA8G 3KBGA 2KBNA 2X6GA 3BZKA 1G91A 2PYKA 2NTSA 3K80C 3LNNA 1CA5A 5FJ8H 3DWAA 2UUCL 3AMUA 1EOVA 2K52A 4R4OA 1SMXA 4CBVA 2O4XA 2RF4A 2SNSA 3R3OA 5KIXA 1EY0A 1BR9A 2X6LA 4C56C 3R2IA 1V1QA 1ICWA 4HSPA 4HIMA 5C5MA 5J3BA 1WTVA 2L4NA 1MJEA 3I4OA 3SDZA 2GN5A 1XX8A 3GTPH 3FHWA 5JEAG 5C0XH 1VMCA 2E5LL 3SVMA 2YU9B 4UDUC 1EZ6A 1KAWA 1EQTA 1HTLD 2N78A 1JWSD 1TWGH 3CW2C 5D3DA 1RF2D 4BBSH 3GTJB 1KDCA 2F0NA 2RDFA 2L5TA 4IUTA 4E6IA 1RL2A 2NN6G 4DGZA 3J7A5 4KKUA 2WB1B 4A3LG 1TY2A 1W6KA 2NZOA 3K5MA 3HOWG 3D6WA 2H4OA 1R9TB 4WJ3M 4NW2A 2R92B 1JWUD 4NXMQ 3I4NH 4EQ5A 1PFMA 5C3XA 2K1BA 3QB3A 1VQHA 1F9PA 4CDFC 3K0XA 1JE4A 3NTKA 4KN7C 3TMEA 2MHVA 1VF5C 5DNFA 1BNZA 2UXBL 4PMCA 4DUYL 1SNDA 3FRPB 4B3RL 5FKAC 2RA4A 3D0FA 4DV7L 4RGMA 4KV6A 1E2WA 5C4JB 4RFBA 4KY7A 5C4XG 3CCVA 3VYTA 4JI3L 5E4WC 2KEEA 4RHRA 3OTOL 1V43A 2JK8A 4IPHA 1YNJD 3W1GA 2F4IA 5JVG3 3EQLC 1MJCA 4EQOA 1AW7A 4DV6L 3BZDB 3FVQA 1P8LA 5EPLA 5KNBA 3N52A 5FOBB 1UE1A 4A93G 2RCFA 5IY0A 2VY3A 4DN4M 1EZ8A 3I7FA 5CR3A 4X66L 5BN5A 4DR6Q 2WACA 4GZYC 1SE8A 2K6AA 3NUCA 1B4OA 3E9HA 3L7ZC 2B2YA 4LK1C 1E2VA 1NJIC 2UU9Q 1F9SA 3J7AF 2V1CC 2PW5A 5M9OA 4GN3B 1PH6A 1S5ED 3S2DB 4DR4Q 3I4MH 4A75A 3M85A 5M3MG 2F1MA 1WVLA 1BO0A 4OEMB 4HJ9A 4OO1H 1FNVA 5IT9L 3PIOA 4JV5L 4DR7Q 5I6YA 1LT3D 4OX9L 1N34Q 4YIJA 2YTXA 2UXDQ 1K9MC 4IJHA 2G5DA 1T5EA 4JI7L 1VQOA 3CKIB 1LT4D 4X3TA 1LO5D 3VR2A 4DA2A 1PTOC 4FO2A 1Y69U 1OXVA 4DR2Q 3BVMA 4WFN3 2RDGA 1GUGA 1GOZA 3OSOA 5M3FG 3CU7A 4U673 2D9UA 1EWHA 2NUCA 1PH9A 1MI2A 4B08A 4A3EH 2KHJA 3TZUA 3FKIG 1QVCA 2PZUA 3PQIA 4IQZA 2K5WA 1KDBA 3W5OA 4L63B 1L1OB 1VQMA 1LUZA 3M4OB 5LMNW 2QEJC 3CCLA 4XYQA 1KC8C 2JA6H 3NTIA 3M4QA 3B6YA 4ILWA 3OWFA 4M8AA 3JAMc 3S9WA 2E2JB 1EIYB 2H5XA 4DK3C 1RD9D 5A2QL 3Q0AA 2B63B 2F4VQ 5M5XB 1XMQL 4A3DB 2PMZE 2A68D 5CC4A 4BY1G 3VYUA 4A76A 1JJCB 3C3LA 3I8ZA 1KDAA 2KHSA 1B9MA 1GHKA 2L15A 5M5YB 3NBHA 5EPKA 4BWGB 3P7JA 1CSQA 3KF6A 5CBEE 2WKCA 3I90A 3BDOA 2ES2A 1ESRA 2F0VA 4A3JH 1TT2A 3T53B 1HZCA 3IKJA 4N8FA 1IW7D 3MHBA 3GTPB 4QF4A 1L0WA 2JYOA 2Q8TA 3SK8A 3EN2A 3W3AA 4MN3A 4A3BG 4BBSB 1JOKA 2UUBQ 1QNKA 1OXSC 1FD7D 3S1RH 1G6ZA 4R4CA 4RMFA 5J1ZA 3U4VA 3F1ZA 1S72A 1HH2P 5D65A 4WRDA 1IYUA 4M1UB 3KLRA 1G51A 1JR0D 3A54A 1LYLA 1AP0A 4IN3A 1XMOQ 2EJFC 4PZ7A 3X3NA 4BBRB 5CV7A 5DLQE 2NVTH 5DEHA 3L2PA 2YYZA 1ENAA 1ASYA 5LMNQ 5I4DA 3G7LA 1PRTB 2NVQH 4FF1A 1WD0A 2JE6I 3OIPA 2Q2TA 3KF6B 2F0MA 1FL0A 4A3LH 2IJ0A 2F0SA 4ZCKA 1I4QA 4OGQC 1O7YA 4A3KH 1DJRD 2R7FA 5IYDH 4MNOA 4ZLTF 3U58A 5D3IB 3TRZA 3OMGA 3S2HH 1D1KA 5T1IA 4L5QA 4JI0Q 5I2YA 3C46A 1JQYD 1JC7A 3D6CA 3FEWX 2CQOA 3PO2H 1CQFA 2EYLA 1C8CA 4RAUC 2K01A 2YTVA 4FNFA 5FK9C 1MBYA 2R61A 3R93A 1VMPA 2K04A 3O13A 4JBKA 4GOPB 4JI4L 2XVSA 2JA9A 4TKOB 1KLGD 3ND8A 3KOJA 4HEDA 4IUNA 1T5XD 4B9WA 2UUCQ 2D5DA 1KLUD 2F0HA 4DAMA 5IOCA 3I4MB 4YCUA 1PFSA 1HR0L 2ICEC 1JJGA 3STBC 4ZRZA 1FR3A 3F2CA 3TDQA 4DK0A 1IBML 1N32L 1ZEQX 1Z47A 1VQJA 1W3SA 4RKBA 1RTOA 2EIFA 4A93H 2EVBA 2CW0C 2E5LQ 2LMCB 3CCRA 1ENFA 2EYJA 3CQZH 4R4IA 2JA7G 5C5LA 4IFDH 5LL6X 3JAMi 2KCTA 4K6DA 2FJ2A 2E8GA 2JN4A 5JPMC 1GUNA 2ZTDA 4IOCA 4RHSA 1RCVD 4JI1L 1A2TA 3ERQA 2ZTCA 3FP9A 2F0IA 4JPBW 3E5SA 5IYBG 1M90C 1SEBD 4A3DG 4LUZA 3UE0A 1I4PA 1YBYA 4FXGC 2NVXH 1IKLA 1E1TA 1WJJA 1SE2A 4AQYL 2B2YC 4RCNA 4QB4A 4CDCC 1K0RA 4FVMA 2K5DA 4DAPA 5FJ8G 4B3TL 5IT9c 5G3LF 1SBBB 1XTDA 1XWEA 1EY6A 4F7XA 5LHY1 3BJUA 1KTKA 2GA4B 1S5DD 1S5BD 2KCCA 4JI3Q 3BDLA 2ZJPA 3OTOQ 1IYJB 1NTGA 1C48A 4R4QA 1SXTA 5C0XG 1O7ZA 1K28A 2HUGA 2KCNA 2HIVA 3J80c 4HIOA 4HSVA 1AE3A 4DV6Q 1HNZQ 4BBSG 3P1HA 2NN6I 2Y0SB 1XNRL 3GTGB 3I2ZA 1YNNC 3A7AB 3SK5A 5GAGC 1X3EA 1B44D 4WORA 2QCPX 2F3VA 1SMYD 3R8BA 4CJ1B 4G7OC 2K14A 1QUQA 3BYTB 1HUNA 3HOUH 3ERSX 3EJIA 3I4NG 2R7ZH 3HFZB 1BF4A 1BQQT 2B2VA 2K7VA 3QJYA 4QCLA 2A5HA 1YVCA 5EPJA 1E7ZA 1HRJA 2Z6BA 3CCUA 1XPUA 2F0TA 4KD3A 3KLSA 2PW7A 4YHHL 1XTCD 4GN4B 3GTOB 3PUVA 1KABA 1Z7TA 4A4IA 2JA8B 1TWCH 3S1RB 2BE5D 1MHWC 2KEDA 3STBD 2GVBA 2MFIA 3E6ZX 3Q6SA 2N88A 5GAHC 4PMWA 4C2MH 4ME5A 2CH4A 2FMMA 1ONLA 4JI7Q 2AQ1B 1PFNA 1NY4A 1K73C 1STNA 1BOSA 1PH2A 5IP9H 2ZT9C 4BXXH 2R3ZA 1FNUA 2F0JA 5COYA 3VA7A 3OWEB 2FFKB 1PZID 1PV4A 4GKKL 1CKOA 2PQAA 2RBMA 3K5NA 3I73A 2C9OA 4MZ9A 4H0LC 1X32A 4A3GH 2A73B 3H91A 4A3KB 3QIAA 4LAAA 3I4MG 1QZHA 1ESFA 2AWNA 3S2HB 2RDHA 1STHA 4B3SL 3A74A 4OO1G 2CKZB 3CCJA 5G3LD 3S1QH 3S14B 2F0QA 1VQDA 3PO2B 3OW7A 2XRQD 2D62A 4IUQA 1XMQQ 2B2TC 2Z4IA 3X3MA 1CKMA 1JE5A 3S1NH 2LSSA 3RZOH 3AFQA 3PUWA 2FINB 2KOLA 3L3OC 1C9OA 1Y8PB 5KGUA 4K2KA 5IP7H 2XRSD 3D8GA 4R8IA 2PO4A 2RKSA 4A3EG 3H0GH 5KEEA 1HFNA 1RODA 2IW3A 3J81c 3G4SA 3F8TA 3HOXG 4GN5A 1UEBA 1X65A 5JEAJ 2QILA 3MXNA 4A93B 5M5WH 1YJNA 1EFWA 4DV3Q 1AZPA 4LF7L 1HR0W 2JA6G 3CQZB 5CV5A 3JAML 3S17H 1NBWA 5E1FA 2PMZB 4GNXB 2D0PA 2I5HA 4L5TA 5ISRA 4DR5L 1OTCA 2HDMA 3J80i 3QO2A 2NYZD 1H9SA 1KRSA 4LF4Q 1B50A 4POGA 1UE5A 3M3YH 2AQ3B 1YNJC 3K7AH 1S3OA 2NVXB 4C3IH 3AFPA 3CAMA 4QGUA 5M3MB 1LLRD 1CK1A 1EIGA 2AQ2B 2SOBA 1SJHD 5IODA 2OQ0A 3HKZE 1RTNA 4P75A 5CV6A 1HNWL 2KECA 3VDYA 2CFMA 4A3JG 4IZ8A 1I3QH 3BZCA 2KUMA 2PNHA 2VS1A 4PMBA 1NMFA 5K36G 1VQKA 2IX1A 4XQQA 4B9XA 2G9DA 2LFNA 4R1JA 2DN8A 2IL8A 5M3FB 2KJXA 1A6XA 3VR3A 2Z4HA 3CF5A 1WI5A 1V8QA 3FKIB 1RJTA 3TBIB 1Q12A 3HOUB 1EUJA 1LACA 1ILQA 3FMCA 2XTIA 3CCSA 3Q22A 3G71A 1Y8NB 2J4XA 2L0CA 4JI4Q 3T1HL 4C1NK 3WOEA 1VS0A 2LXJA 1EIHA 4LFBL 4IUPA 1EEID 3URYA 1NSNS 1DYQA 3I56A 5CORA 2PNRC 4HAEA 2VNUD 1STBA 5EJWA 1HR0Q 4BA1I 4ULLA 1GUSA 1X3GA 3CC7A 1HA5A 2ZM6Q 2B2UC 1N32Q 4BY1B 1Q82C 1I5FA 5IYCH 4A3KG 3CMAA 2E2IH 5IYDG 1G8ZD 1TWCB 3DXJC 1TWFB 4K0KL 5I2XA 2EYOA 1IXRA 1V1PA 1E0BA 4DAYA 2ATWA 3HOYG 3KJPA 2F0LA 3DM3A 1CM9A 2F3WA 4RGNA 4JI1Q 5LMUL 4X6AH 4HMJA 2KHIA 1VQBA 3PO2G 2ZJQA 4ZKBB 2LKVA 2EQSA 1GUWA 5IGCA 4KY6A 4LUOA 3T56B 1MKHA 1Q8IA 2DNCA 3GO5A 5JVH3 1JB3A 1TWHH 4ZKCB 4AQYQ 4A3BB 5IGFA 2B2VC 1W6JA 2A68C 3H3VH 1XPRA 1SROA 5EBCA 4B3TQ 4UY8C 3TP8A 4G7ZC 2EYHA 4CJ2C 4A3GB 1EU3A 3J81i 3DEOA 3NXWA 1MSGA 1Y1WH 3EROA 1X3PA 2Z8LA 3UDGA 4OELB 5JPNC 3S1QB 5KYIA 1MSHA 1I50B 2SEBD 1VQ8A 2F0OA 2K33A 4DV1L 2K03A 4IFDG 2XSCA 1N36L 1LTBD 1IW7C 2Q2IA 3TS0A 3D4DA 4GS3A 1EU4A 3CC2A 4DV0L 1WYDA 1YIJA 1K8AC 5ELEA 4G4KA 2UUAL 1STAA 3HOZH 2I5MX 3WWVA 5JJLA 1BXTA 2PI2A 1HZAA 3HKSA 3OIQA 5IWAL 2ZXRA 3NELA 4G7HC 2XN9C 1Y14B 1LABA 1Q86C 1SYCA 3CCMA 1S4ZA 2E2HB 4GNXC 5CBAE 2F0PA 5M5WB 3VR6A 4YHHQ 1K3BC 4FDBA 1N33L 4O42A 3RLOA 1CI3M 3AYHB 4EGVA 1ZXTA 4KKSA 5C0XI 2LXKA 4LWCA 2BA0A 3NBIA 5KYLA 4JI5Q 3J80L 1JWMD 2MO0A 3KDFA 5EQ0A 3T51B 2CWPA 3M3YB 2VQEL 4C3HH 3D3RA 5C4ZA 1UE6A 2A1AA 4IPCA 3K7AB 1BVSA 4AH6A 3NSWA 4J1MA 4NDXA 1F2ZA 4DF7A 2CQAA 1H95A 2A69C 3H09A 4K5XA 3HOXH 5CYUA 3HOUG 2A8VA 1YEZA 3IFDA 5ELNA 3ONAB 2R7ZG 3LWUA 1B70B 3MEHA 2JA7B 5FO8B 4GKKQ 1EYDA 1PLFA 1CTMA 2QA4A 2A6HC 3TP5A 3C1FA 1C4QA 1ET9A 4A3IG 1I3QB 1Q8KA 4P73A 2B8FA 1SNMA 3NQIA 4NP5A 1EL0A 1Q3LA 4B3SQ 5HY6A 3M9BA 1OO9B 1SN8A 4EX5A 3HS0C 4FF2A 2EXZA 2VUMH 4A3FH 1K0SA 1F9QA 1LTLA 4NKLA 3GDEA 3A55A 1D7QA 1HZ9A 1VQAA 1SDFA 1NNXA 4XIGS 4DV4L 1GO3E 1LV9A 3KYHC 2E76C 1Q1BA 2MO1A 1QB5D 3K81C 1CUKA 2KCMA 1WTWA 1I4HA 3KUPA 5IP9G 4BXXG 1WCMH 1EY9A 1VQFA 1JOOA 4Y7NH 3CPFA 3NTHA 5K36H 4KJNA 1SRUA 4HR7B 2L55A 1PMRA 1TWGB 3J7AV 4X64L 1Y1VH 4UAIA 3MTSA 4C3JH 1H9RA 4KI0A 4XQJA 1DOLA 5JJIA 1B3AA 4A3GG 1H9KA 4X62L 4XDXA 3QG1A 3D4RA 1WFQA 1G6PA 4OWTB 1A63A 4LF7Q 1L2FA 1GUOA 3RR5A 1FGBD 3I4NB 4DR1L 3HP3A 3K59A 4DR5Q 2BDNA 2DJFC 5FO9B 3MFGA 4QUCA 2B2WA 3EFXD 4WJWA 4DNTB 1TQOA 2CVRA 3TQYA 3C1EA 1DM0B 1F9RA 4QIWE 3E9IA 4LFAL 5C44H 2B8GA 2HD3A 4FF4A 2N8NA 1CQVA 2A74C 4V190 4CKBA 1ET6A 4FF3A 1EWCA 3NBHB 3A56A 3V96A 3F2DA 4H02A 4OIKA 3HEJA 4UHVA 3BU2A 4NXNL 4L5RC 1SMYC 1SNCA 2DGYA 3MC0B 5IP7G 1AH9A 2Q8RE 4RH6A 2BA1A 3VYRA 1GD7A 4JBJA 3J81L 1HNWQ 3H0GG 2EYPA 3MFYA 3SXHA 4LF5L 1UAPA 1Y1WB 2A69D 3M4YA 3PF5A 3HOYH 1J8IA 2N55A 4O0AA 4LF9L 1HA6A 5E7NA 5C0XJ 4KHPL 4HCEA 2BDOA 4KY5A 2K32A 2OQKA 3DUZA 4YCWA 2A6HD 3E0EA 4O2DA 2YV5A 4DR3L 5C3EH 1CKNA 1QJOA 3TP6A 4XXEA 3HOZB 4GLAC 2WB1E 4PG3A 2ZJRA 1TVXA 3T1YL 1EQRA 4NB3A 2IHFA 1D8LA 1IL8A 2F03A 3HKZB 2BE5C 1J5EL 4C3IG 1F2LA 2AHOB 2DY7A 3T1HQ 3CXCA 1AEXA 1NCVA 4LFBQ 3TEHB 1X56A 2M2LA 1GJXA 1VQPA 2RHSB 2OF1A 2OCEA 1PYBA 2K50A 3PIO3 4Y52H 1Y8OB 3WOFA 1J6QA 4EQNA 2I46A 1IBKL 1B2TA 1BCPF 4K0KQ 4OL7A 2ASBA 4F8MA 3I3CA 4C3HB 2RHQB 2JA5H 3U9OA 4DXGA 1EYAA 5LMUQ 4A3EB 1D1IA 2B29A 5I9OA 2ZTEA 4BY7G 4N9TA 2JJQA 4QY7A 1D5MC 3HOXB 2UXBQ 4DUYQ 4B3RQ 2F0DA 4DV7Q 3L0OA 1KXLA 1XNQL 2JA6B 4YWMA 3DM1A 3KF8A 4JBMA 3BG3A 2AUJD 3DWQA 1GHJA 1SYBA 1CHQD 4J15A 1Q7YC 3K8AA 2C5CA 2FXQA 1DGSA 2RCNA 3PIPA 1MD2D 4UP8A 3S16H 1QWYA 1NAPA 2M00A 5IYCG 1Q46A 1WTXA 2VZAA 1IBLL 5C6AA 4I65A 3K58A 2NZHA 4DV1Q 4UP7A 5HGTA 4X66Q 3RN2A 4X65L 1N36Q 3GTQH 1QILA 4I7ZC 2DNEA 4DNRB 2AUKA 4DR6L 2PZTA 2B39A 3SK4A 4KTAA 3A0JA 2MJ8A 2A6ED 2AWOA 4CDDC 3NPPA 3RZDH 4L8JA 4A3JB 1HQRD 4XT3B 4A3IH 1WCMB 5A2QE 4QQBX 2CCZA 2OEOA 2EZVA 1HJPA 5CV9A 1C7YA 2JQOA 2J7ZA 1PH3A 4KLKA 2PI2E 5C3WA 3ER0A 3BVGA 2Z0SA 1U4MA
chains in the Genus database with same CATH topology
5M3MG 4DR4L 2CFMA 4JV5Q 4HJ9A 4A3JG 2NVYH 3PIOA 4A3MH 1I3QH 4JV5L 3W1BA 2AKWB 3BZCA 4OX9Q 2PNHA 2VS1A 1NMFA 4DR7Q 5K36G 1VQKA 2IX1A 2UXCL 4OX9L 3ULLA 4POFA 1N34Q 3HOWH 1Y1WG 4R1JA 1JB7A 3GTKH 3J7ZC 4QJFA 2YTXA 2UXDQ 4JG2A 1K9MC 3GTJH 1TXYA 4IJHA 4A75A 3S14H 1T9HA 4JI7L 1VQOA 1YZ6A 4YY3L 3PF4A 3CF5A 2C35B 1WI5A 1E3PA 3GD7A 1SLJA 2VQEQ 1Q12A 1ASZA 1EUJA 1QUQB 1R9TH 4HJ7A 3U50C 1OXVA 4DR2Q 2XTIA 3CCSA 2R92H 5M3FG 2K75A 4IO9A 1PH9A 4DR2L 3G71A 3S15H 1HNXQ 1X55A 3HOZG 1E24A 4A3EH 4P71A 3T1HL 1M1KC 4JI4Q 1VS0A 2LXJA 4YCVA 2KHJA 1SR3A 5C4XH 1S40A 5GROA 3FKIG 4LFBL 1QVCA 1BKBA 3W5OA 1L1OB 3HKZG 2K5HA 2F52A 3I56A 1VQMA 1LUZA 3IRBA 4ME3A 3PGZA 3ULPA 4JI2L 5LMNW 1KL9A 2VNUD 2I0QA 3CCLA 1YJ9A 1HR0Q 4BA1I 1KC8C 2JA6H 4DV5Q 1X3GA 3CC7A 5C4JH 3M4QA 1BBWA 2ZM6Q 1OXUA 3B6YA 1N32Q 2Z6KA 3S1MH 2WFWA 3JAMc 1VQ4A 2ZM6L 1Q82C 1I5FA 1Q81C 1KIXA 5IYCH 1UE7A 1EIYB 5FLMH 2H5XA 1GVPA 4DK3C 4KHZA 3CMAA 5IYDG 4A3KG 1PH1A 2E2IH 4K0KL 3CCEA 1A62A 5ELOA 1IXRA 2F4VQ 4JI8L 1I94Q 1XMQL 1VQGA 3UDFA 2ATWA 1U0LA 3DLLA 1Q1EA 2PMZE 3HOYG 3KJPA 3Q8DA 4NXML 3DM3A 4L5SA 4BY1G 4JI1Q 4B3MQ 3LGJA 5LMUL 4X6AH 4A76A 1JJCB 2KHIA 1VQBA 5GQOA 3PO2G 2ZJQA 4DUZQ 4IPDA 1CKNB 2EQSA 3NENA 4DV4Q 3CC4A 3RN5A 2B63G 5JJKA 4P72A 2L15A 1YI2A 4LUOA 1MKHA 2F3IA 2N49A 3S24A 4LF8Q 3GO5A 2MNAA 3PV0A 1YNXA 3G6EA 1I6HH 1CSQA 3KF6A 1TWHH 1IZ6A 4AQYQ 4HJ8A 5M3MH 1YHAA 2ES2A 1L1OC 3UDXA 3H3VH 2I5LX 1XPRA 1SROA 4A3JH 4B3TQ 4DPGA 1HZCA 4UY8C 1W2BA 2PQAB 4AYBE 5BR8L 3J81i 1PHJA 1L0WA 4AIMA 3EN2A 4X64Q 3S2DH 1Y1WH 4LW1A 3UDGA 4A3BG 2YTYA 1YHBA 1OXTA 1VQCA 3CP0A 2UUBQ 4X62Q 2Q2UA 2UUBL 1OXSC 1MIUA 4YWLA 1KD1C 3EIVA 3S1RH 4NPSA 4DV1L 1VQ8A 4JI6Q 2EXDA 4R4CA 4RMFA 1PA6A 4JOIA 1HZBA 4IFDG 3U4VA 3F1ZA 1N36L 3D31A 2R6GA 1S72A 4DV0Q 1HH2P 2Q2IA 3F2BA 3TS0A 2AMCB 2VQFL 4GS3A 3PUYA 2VUMG 4A3FG 3CC2A 4DV0L 2UUAQ 1WYDA 1YIJA 3CD6A 5M3FH 1K8AC 1G51A 2UUAL 1LYLA 3HOZH 1VQ5A 2I5MX 1XMOQ 4PZ7A 3WWVA 4LFCQ 5JJLA 2BH8A 5DLQE 2UU9L 1XMOL 3FKIH 4LFAQ 2NVTH 4GKJQ 2IX0A 5GADC 1FGUA 2PI2A 4GKKQ 1HZAA 3L2PA 5IWAQ 5AJ3L 2YYZA 3HKSA 2HIXA 4QL5A 1ASYA 5IWAL 5LMNQ 1KHIA 2D0OA 1YITA 2NVQH 1U5KA 1PYSB 3NELA 1WCMG 2JE6I 1Y14B 3CMEA 5H1SE 2Q2TA 4BBRG 3KF8B 4AYBG 3KF6B 4P74A 1N8RC 1Q86C 1FL0A 3RLFA 4A3LH 3CCMA 3M4PA 4GNXC 4DR7L 4A3KH 1N33Q 2R7FA 5IYDH 4MNOA 3U58A 3MXNB 2YU9H 3TRZA 3KJOA 4YHHQ 1N34L 1Y1VG 3S2HH 4FDBA 4LF6Q 4LF5Q 1N33L 3J81j 3RLOA 2Q2HA 3KLWA 3HOVG 3RNUA 3AYHB 1VQ6A 4LF9Q 5C0XI 2UXDL 2LXKA 4LWCA 4L5QA 2BA0A 1QZGA 4JI0Q 4JI5Q 4PZ6A 4BY1H 4IFDI 3NEMA 4HJAA 1YJWA 4BY7H 2CQOA 2E2JH 4JI5L 3PO2H 4IFDJ 2MO0A 1E1OA 3KDFA 3PSIA 3PO3G 1B8AA 1TWFH 2CWPA 2QGQA 2VQEL 4C3HH 1VQNA 2B63H 2YTVA 3PUZA 1UE6A 1EWIA 5M5XH 4GLXA 2A1AA 4IPCA 1NMGA 1BVSA 4IPGA 4AH6A 5FLXc 4DNIA 2KENA 3OW2A 4JBKA 1HNXL 4GOPB 3TREA 3EBEA 4JI4L 1H95A 3HOXH 2JA9A 3HOUG 2JEBI 2A8VA 3KOJA 1YEZA 5C44G 3AQQA 3T1YQ 1PH4A 5ELNA 2UUCQ 3I55A 2R7ZG 1PH5A 4HIKA 1J5EQ 4DAMA 5M5YH 3CCQA 1B70B 4APVA 1FJGQ 4YCUA 1PFSA 1HR0L 1JMCA 1X3FA 3CPWA 1IBMQ 3STBC 2QA4A 4DV5L 4HIDA 4A3BH 3F2CA 2IT1A 1EYGA 1IBML 1GKHA 2XGTA 4A3IG 4TVAB 1N32L 1Z47A 1VQJA 1W3SA 1Q8KA 3PUXA 4IJLA 2EIFA 4A93H 4P73A 4JYAQ 1EQQA 2ID0A 2E5LQ 3GTLH 3CCRA 4GNXA 3CQZH 2VL6A 4R4IA 1EIFA 2JA7G 2F4VL 1I94L 3JAMi 2KCTA 5HY6A 1X9NA 4B3SQ 3M9BA 2HQLA 1SN8A 2E8GA 1IBKQ 4EX5A 4PZ8A 2ZTDA 4IOCA 2VUMH 4JBWA 3SGIA 4A3FH 1PH8A 4A3CG 2IY5B 4B3ML 4JI1L 2ZTCA 1LTLA 4RG1A 3GDEA 3FP9A 2VW9A 1HZ9A 4GLVB 4DUZL 1I50H 1D7QA 1VQAA 5IYBG 1M90C 4XIGS 1SFOH 4DV4L 1GO3E 4ALPA 2GVAA 4A3DG 4LUZA 3KYHC 3UE0A 1YBYA 1Q1BA 4GOPC 2MO1A 4LF8L 2NVXH 5C3EG 1E1TA 2Y0SE 1WJJA 4R4TA 5IE8A 3K81C 1CUKA 4AQYL 2KCMA 4UP9A 1KRTA 1O7IA 1K0RA 5IP9G 4BXXG 1WCMH 1VQ9A 1KQSA 2JEAI 1VQFA 4Y7NH 2OTJA 4BBRH 5FJ8G 1LM0A 3CPFA 4B3TL 5IT9c 3I4MH 4OXPA 1SRUA 1A0IA 1P16A 1XTDA 1XNQQ 3KFUA 2OTLA 3BJUA 4X64L 1Y1VH 1NE3A 1K8GA 4YWKA 4C3JH 3HOVH 2WP8J 4JI3Q 1X6OA 4KI0A 2ZJPA 1FVIA 1G291 5JJIA 3OTOQ 1IYJB 1NTGA 2R7DA 1IL2A 4A3GG 4R4QA 4X62L 5C0XG 3G48A 1UWVA 2E2HH 1WFQA 2HIVA 4JI6L 5HGQA 4OWTB 3J80c 4HIOA 4DR1Q 1L2FA 4LF7Q 1XNRQ 1A63A 1AE3A 3RR5A 4DV6Q 1HNZQ 4BBSG 4DR1L 2NN6I 1XNRL 3I2ZA 5GAGC 1JJ2A 1X3EA 1HNZL 4DR5Q 3AEVA 4DAYB 3H15A 4WJ4A 1IBLQ 2K14A 1QUQA 2WAQE 3RLNA 4X65Q 3TQYA 4QIWE 4LFCL 1XPOA 3HOUH 4GKJL 3E9IA 4LFAL 5C44H 3ERSX 3A5UA 2N8NA 2JA5G 3I4NG 2Y0SG 3UE1A 2R7ZH 3HFZB 1TWAH 4DV2Q 3MEFA 1B7YB 5LMNL 3NBHB 3PCOB 1VQEA 3F2DA 1JJGA 4NXNQ 4H02A 1L1OA 1YVCA 1VCIA 1E7ZA 3BU2A 4NXNL 3CCUA 1BBUA 2OWOA 1E22A 1X54A 2DGYA 5IP7G 4L5RC 1XPUA 2HHHQ 1AH9A 2ALYB 2BA1A 3M4OH 1GD7A 4JBJA 4UPAA 1AE2A 1HNWQ 1XJVA 1CSPA 3H0GG 1PH7A 4YHHL 3GTMH 5EAYA 4LF6L 2K5VA 4LF5L 2MQHA 2JA7H 3HOYH 3PF5A 1WOCA 1N9WA 4KHPQ 4O0AA 4JC0A 4OONA 4GN4B 1K3RA 4LF9L 2Z6KC 1Z9FA 5E7NA 5C0XJ 3PUVA 4JI0L 4A3CH 4KHPL 1GM5A 4A4IA 2UXCQ 1TWCH 2N3SA 4JCVE 5IYBH 2OQKA 3STBD 4YCWA 2GVBA 2MFIA 3E0EA 3JC66 4O2DA 3ULJA 1C0AA 4A3DH 3ZJYC 2YV5A 3K7UC 4DR3Q 4LUVA 5GAHC 4PMWA 4C2MH 1VQLA 1OXXK 2QEXA 1PVOA 4DR3L 5C3EH 1CKNA 4JI7Q 2R93G 1JT8A 1NY4A 3A5ZB 1K73C 2WAQG 4YY3Q 2JA8G 1A8VA 2KBNA 4GLAC 2WB1E 3BZKA 4PG3A 5IP9H 1PH2A 4BXXH 2ZJRA 3K80C 5FJ8H 3T1YL 1EQRA 4NB3A 2UUCL 2IHFA 1D8LA 1EOVA 2K52A 4R4OA 1J5EL 3ICEA 1SMXA 2AHOB 1FJGL 1K83H 2RF4A 3T1HQ 3CXCA 1PV4A 3TS2A 4GKKL 1CKOA 1YHQA 2PQAA 1V1QA 4LFBQ 3TEHB 1X56A 4HIMA 2CWAA 4MZ9A 5J3BA 4OWWB 1VQPA 2RHSB 3I4OA 1MJEA 1G6PA 4OWXB 2GN5A 3GTPH 4A3GH 3FHWA 5JEAG 4JI2Q 4JYAL 2OCEA 2E5LL 3I4MG 1PYBA 2K50A 3H3VI 1QZHA 1KAWA 2AWNA 2N78A 1TWGH 4B3SL 3CW2C 4Y52H 3A74A 4BBSH 4OO1G 2CKZB 1J6QA 3CCJA 4A3MG 1IBKL 4DKAC 3S1QH 1RL2A 2NN6G 3J7A5 1VQDA 4A3LG 4HJ5A 2NZOA 4K0KQ 2ASBA 3HOWG 2D62A 4JOIC 4JI8Q 1XMQQ 4WJ3M 2A19A 3KDFB 2RHQB 4BA2I 2JA5H 4NXMQ 3I4NH 3GTGH 1CKMA 4EQ5A 1JE5A 4XTCS 3S1NH 2LSSA 5LMUQ 3RZOH 4IOAA 1VQHA 3AFQA 2B29A 3K0XA 2WB1G 3PUWA 2ZTEA 4BY7G 2JJQA 4QY7A 2UXBQ 4DUYQ 4B3RQ 2UXBL 4DV7Q 1C9OA 5IP7H 4DUYL 4DK6C 2R92G 3L0OA 4B3RL 1VQIA 3D0FA 1KXLA 4DV7L 1XNQL 1VQ7A 4A3EG 4YWMA 3H0GH 5C4XG 3J81c 4JBMA 3CCVA 3G4SA 3F8TA 4JI3L 4GN5A 3HOXG 1UEBA 2HT1A 1X65A 3OTOL 2K4KA 5JEAJ 1V43A 3U4ZA 2JK8A 4IPHA 4J15A 3K8AA 5BR8Q 5M5WH 4DV3Q 1YJNA 3W1GA 1Q7YC 1EFWA 5GAEC 3PO3H 4OO1I 2FXQA 1MJCA 4LF7L 4DV3L 1HR0W 2JA6G 2K5NA 1DGSA 3S17H 1NBWA 4DV6L 2RCNA 3PIPA 4GNXB 2D0PA 2I5HA 1P8LA 3OYYA 4UP8A 4L5TA 3S16H 4DR5L 3M85A 1OTCA 3GTOH 3J80i 5IYCG 4MTNA 1Q46A 2VZAA 5FLMG 1UE1A 1IBLL 2BH2A 2R93H 2NZHA 4DV1Q 2B3GA 4UP7A 4A93G 1KRSA 2JA8H 3RN2A 5IY0A 2VY3A 4X66Q 4LF4Q 4X65L 1QVFA 1QVGA 1N36Q 1UE5A 3I7FA 4POGA 3GTQH 3M3YH 4LF4L 4X66L 4DR6Q 2VQFQ 3K7AH 4GOPA 4DR6L 1S3OA 1SE8A 4C3IH 3AFPA 3CAMA 4DV2L 3A0JA 4QGUA 2AWOA 2IHEA 3E9HA 3L7ZC 3RZDH 1NJIC 4A3IH 2UU9Q 4QQBX 2CCZA 2DUDA 1RIPA 4TQUS 1HJPA 1V9PA 2V1CC 5AJ3Q 2HHHL 1C7YA 2JQOA 3M7NA 2OQ0A 3HKZE 1PH3A 4GN3B 4KLKA 4P75A 1PH6A 4DR4Q 2PI2E 1HNWL 3ER0A 3UDIA 2Z0SA 3VDYA 4LNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M G;  4DR4 L;  2CFM A;  4JV5 Q;  4HJ9 A;  4A3J G;  2NVY H;  3PIO A;  4A3M H;  1I3Q H;  4JV5 L;  3W1B A;  2AKW B;  3BZC A;  4OX9 Q;  2PNH A;  2VS1 A;  1NMF A;  4DR7 Q;  5K36 G;  1VQK A;  2IX1 A;  2UXC L;  4OX9 L;  3ULL A;  4POF A;  1N34 Q;  3HOW H;  1Y1W G;  4R1J A;  1JB7 A;  3GTK H;  3J7Z C;  4QJF A;  2YTX A;  2UXD Q;  4JG2 A;  1K9M C;  3GTJ H;  1TXY A;  4IJH A;  4A75 A;  3S14 H;  1T9H A;  4JI7 L;  1VQO A;  1YZ6 A;  4YY3 L;  3PF4 A;  3CF5 A;  2C35 B;  1WI5 A;  1E3P A;  3GD7 A;  1SLJ A;  2VQE Q;  1Q12 A;  1ASZ A;  1EUJ A;  1QUQ B;  1R9T H;  4HJ7 A;  3U50 C;  1OXV A;  4DR2 Q;  2XTI A;  3CCS A;  2R92 H;  5M3F G;  2K75 A;  4IO9 A;  1PH9 A;  4DR2 L;  3G71 A;  3S15 H;  1HNX Q;  1X55 A;  3HOZ G;  1E24 A;  4A3E H;  4P71 A;  3T1H L;  1M1K C;  4JI4 Q;  1VS0 A;  2LXJ A;  4YCV A;  2KHJ A;  1SR3 A;  5C4X H;  1S40 A;  5GRO A;  3FKI G;  4LFB L;  1QVC A;  1BKB A;  3W5O A;  1L1O B;  3HKZ G;  2K5H A;  2F52 A;  3I56 A;  1VQM A;  1LUZ A;  3IRB A;  4ME3 A;  3PGZ A;  3ULP A;  4JI2 L;  5LMN W;  1KL9 A;  2VNU D;  2I0Q A;  3CCL A;  1YJ9 A;  1HR0 Q;  4BA1 I;  1KC8 C;  2JA6 H;  4DV5 Q;  1X3G A;  3CC7 A;  5C4J H;  3M4Q A;  1BBW A;  2ZM6 Q;  1OXU A;  3B6Y A;  1N32 Q;  2Z6K A;  3S1M H;  2WFW A;  3JAM c;  1VQ4 A;  2ZM6 L;  1Q82 C;  1I5F A;  1Q81 C;  1KIX A;  5IYC H;  1UE7 A;  1EIY B;  5FLM H;  2H5X A;  1GVP A;  4DK3 C;  4KHZ A;  3CMA A;  5IYD G;  4A3K G;  1PH1 A;  2E2I H;  4K0K L;  3CCE A;  1A62 A;  5ELO A;  1IXR A;  2F4V Q;  4JI8 L;  1I94 Q;  1XMQ L;  1VQG A;  3UDF A;  2ATW A;  1U0L A;  3DLL A;  1Q1E A;  2PMZ E;  3HOY G;  3KJP A;  3Q8D A;  4NXM L;  3DM3 A;  4L5S A;  4BY1 G;  4JI1 Q;  4B3M Q;  3LGJ A;  5LMU L;  4X6A H;  4A76 A;  1JJC B;  2KHI A;  1VQB A;  5GQO A;  3PO2 G;  2ZJQ A;  4DUZ Q;  4IPD A;  1CKN B;  2EQS A;  3NEN A;  4DV4 Q;  3CC4 A;  3RN5 A;  2B63 G;  5JJK A;  4P72 A;  2L15 A;  1YI2 A;  4LUO A;  1MKH A;  2F3I A;  2N49 A;  3S24 A;  4LF8 Q;  3GO5 A;  2MNA A;  3PV0 A;  1YNX A;  3G6E A;  1I6H H;  1CSQ A;  3KF6 A;  1TWH H;  1IZ6 A;  4AQY Q;  4HJ8 A;  5M3M H;  1YHA A;  2ES2 A;  1L1O C;  3UDX A;  3H3V H;  2I5L X;  1XPR A;  1SRO A;  4A3J H;  4B3T Q;  4DPG A;  1HZC A;  4UY8 C;  1W2B A;  2PQA B;  4AYB E;  5BR8 L;  3J81 i;  1PHJ A;  1L0W A;  4AIM A;  3EN2 A;  4X64 Q;  3S2D H;  1Y1W H;  4LW1 A;  3UDG A;  4A3B G;  2YTY A;  1YHB A;  1OXT A;  1VQC A;  3CP0 A;  2UUB Q;  4X62 Q;  2Q2U A;  2UUB L;  1OXS C;  1MIU A;  4YWL A;  1KD1 C;  3EIV A;  3S1R H;  4NPS A;  4DV1 L;  1VQ8 A;  4JI6 Q;  2EXD A;  4R4C A;  4RMF A;  1PA6 A;  4JOI A;  1HZB A;  4IFD G;  3U4V A;  3F1Z A;  1N36 L;  3D31 A;  2R6G A;  1S72 A;  4DV0 Q;  1HH2 P;  2Q2I A;  3F2B A;  3TS0 A;  2AMC B;  2VQF L;  4GS3 A;  3PUY A;  2VUM G;  4A3F G;  3CC2 A;  4DV0 L;  2UUA Q;  1WYD A;  1YIJ A;  3CD6 A;  5M3F H;  1K8A C;  1G51 A;  2UUA L;  1LYL A;  3HOZ H;  1VQ5 A;  2I5M X;  1XMO Q;  4PZ7 A;  3WWV A;  4LFC Q;  5JJL A;  2BH8 A;  5DLQ E;  2UU9 L;  1XMO L;  3FKI H;  4LFA Q;  2NVT H;  4GKJ Q;  2IX0 A;  5GAD C;  1FGU A;  2PI2 A;  4GKK Q;  1HZA A;  3L2P A;  5IWA Q;  5AJ3 L;  2YYZ A;  3HKS A;  2HIX A;  4QL5 A;  1ASY A;  5IWA L;  5LMN Q;  1KHI A;  2D0O A;  1YIT A;  2NVQ H;  1U5K A;  1PYS B;  3NEL A;  1WCM G;  2JE6 I;  1Y14 B;  3CME A;  5H1S E;  2Q2T A;  4BBR G;  3KF8 B;  4AYB G;  3KF6 B;  4P74 A;  1N8R C;  1Q86 C;  1FL0 A;  3RLF A;  4A3L H;  3CCM A;  3M4P A;  4GNX C;  4DR7 L;  4A3K H;  1N33 Q;  2R7F A;  5IYD H;  4MNO A;  3U58 A;  3MXN B;  2YU9 H;  3TRZ A;  3KJO A;  4YHH Q;  1N34 L;  1Y1V G;  3S2H H;  4FDB A;  4LF6 Q;  4LF5 Q;  1N33 L;  3J81 j;  3RLO A;  2Q2H A;  3KLW A;  3HOV G;  3RNU A;  3AYH B;  1VQ6 A;  4LF9 Q;  5C0X I;  2UXD L;  2LXK A;  4LWC A;  4L5Q A;  2BA0 A;  1QZG A;  4JI0 Q;  4JI5 Q;  4PZ6 A;  4BY1 H;  4IFD I;  3NEM A;  4HJA A;  1YJW A;  4BY7 H;  2CQO A;  2E2J H;  4JI5 L;  3PO2 H;  4IFD J;  2MO0 A;  1E1O A;  3KDF A;  3PSI A;  3PO3 G;  1B8A A;  1TWF H;  2CWP A;  2QGQ A;  2VQE L;  4C3H H;  1VQN A;  2B63 H;  2YTV A;  3PUZ A;  1UE6 A;  1EWI A;  5M5X H;  4GLX A;  2A1A A;  4IPC A;  1NMG A;  1BVS A;  4IPG A;  4AH6 A;  5FLX c;  4DNI A;  2KEN A;  3OW2 A;  4JBK A;  1HNX L;  4GOP B;  3TRE A;  3EBE A;  4JI4 L;  1H95 A;  3HOX H;  2JA9 A;  3HOU G;  2JEB I;  2A8V A;  3KOJ A;  1YEZ A;  5C44 G;  3AQQ A;  3T1Y Q;  1PH4 A;  5ELN A;  2UUC Q;  3I55 A;  2R7Z G;  1PH5 A;  4HIK A;  1J5E Q;  4DAM A;  5M5Y H;  3CCQ A;  1B70 B;  4APV A;  1FJG Q;  4YCU A;  1PFS A;  1HR0 L;  1JMC A;  1X3F A;  3CPW A;  1IBM Q;  3STB C;  2QA4 A;  4DV5 L;  4HID A;  4A3B H;  3F2C A;  2IT1 A;  1EYG A;  1IBM L;  1GKH A;  2XGT A;  4A3I G;  4TVA B;  1N32 L;  1Z47 A;  1VQJ A;  1W3S A;  1Q8K A;  3PUX A;  4IJL A;  2EIF A;  4A93 H;  4P73 A;  4JYA Q;  1EQQ A;  2ID0 A;  2E5L Q;  3GTL H;  3CCR A;  4GNX A;  3CQZ H;  2VL6 A;  4R4I A;  1EIF A;  2JA7 G;  2F4V L;  1I94 L;  3JAM i;  2KCT A;  5HY6 A;  1X9N A;  4B3S Q;  3M9B A;  2HQL A;  1SN8 A;  2E8G A;  1IBK Q;  4EX5 A;  4PZ8 A;  2ZTD A;  4IOC A;  2VUM H;  4JBW A;  3SGI A;  4A3F H;  1PH8 A;  4A3C G;  2IY5 B;  4B3M L;  4JI1 L;  2ZTC A;  1LTL A;  4RG1 A;  3GDE A;  3FP9 A;  2VW9 A;  1HZ9 A;  4GLV B;  4DUZ L;  1I50 H;  1D7Q A;  1VQA A;  5IYB G;  1M90 C;  4XIG S;  1SFO H;  4DV4 L;  1GO3 E;  4ALP A;  2GVA A;  4A3D G;  4LUZ A;  3KYH C;  3UE0 A;  1YBY A;  1Q1B A;  4GOP C;  2MO1 A;  4LF8 L;  2NVX H;  5C3E G;  1E1T A;  2Y0S E;  1WJJ A;  4R4T A;  5IE8 A;  3K81 C;  1CUK A;  4AQY L;  2KCM A;  4UP9 A;  1KRT A;  1O7I A;  1K0R A;  5IP9 G;  4BXX G;  1WCM H;  1VQ9 A;  1KQS A;  2JEA I;  1VQF A;  4Y7N H;  2OTJ A;  4BBR H;  5FJ8 G;  1LM0 A;  3CPF A;  4B3T L;  5IT9 c;  3I4M H;  4OXP A;  1SRU A;  1A0I A;  1P16 A;  1XTD A;  1XNQ Q;  3KFU A;  2OTL A;  3BJU A;  4X64 L;  1Y1V H;  1NE3 A;  1K8G A;  4YWK A;  4C3J H;  3HOV H;  2WP8 J;  4JI3 Q;  1X6O A;  4KI0 A;  2ZJP A;  1FVI A;  1G29 1;  5JJI A;  3OTO Q;  1IYJ B;  1NTG A;  2R7D A;  1IL2 A;  4A3G G;  4R4Q A;  4X62 L;  5C0X G;  3G48 A;  1UWV A;  2E2H H;  1WFQ A;  2HIV A;  4JI6 L;  5HGQ A;  4OWT B;  3J80 c;  4HIO A;  4DR1 Q;  1L2F A;  4LF7 Q;  1XNR Q;  1A63 A;  1AE3 A;  3RR5 A;  4DV6 Q;  1HNZ Q;  4BBS G;  4DR1 L;  2NN6 I;  1XNR L;  3I2Z A;  5GAG C;  1JJ2 A;  1X3E A;  1HNZ L;  4DR5 Q;  3AEV A;  4DAY B;  3H15 A;  4WJ4 A;  1IBL Q;  2K14 A;  1QUQ A;  2WAQ E;  3RLN A;  4X65 Q;  3TQY A;  4QIW E;  4LFC L;  1XPO A;  3HOU H;  4GKJ L;  3E9I A;  4LFA L;  5C44 H;  3ERS X;  3A5U A;  2N8N A;  2JA5 G;  3I4N G;  2Y0S G;  3UE1 A;  2R7Z H;  3HFZ B;  1TWA H;  4DV2 Q;  3MEF A;  1B7Y B;  5LMN L;  3NBH B;  3PCO B;  1VQE A;  3F2D A;  1JJG A;  4NXN Q;  4H02 A;  1L1O A;  1YVC A;  1VCI A;  1E7Z A;  3BU2 A;  4NXN L;  3CCU A;  1BBU A;  2OWO A;  1E22 A;  1X54 A;  2DGY A;  5IP7 G;  4L5R C;  1XPU A;  2HHH Q;  1AH9 A;  2ALY B;  2BA1 A;  3M4O H;  1GD7 A;  4JBJ A;  4UPA A;  1AE2 A;  1HNW Q;  1XJV A;  1CSP A;  3H0G G;  1PH7 A;  4YHH L;  3GTM H;  5EAY A;  4LF6 L;  2K5V A;  4LF5 L;  2MQH A;  2JA7 H;  3HOY H;  3PF5 A;  1WOC A;  1N9W A;  4KHP Q;  4O0A A;  4JC0 A;  4OON A;  4GN4 B;  1K3R A;  4LF9 L;  2Z6K C;  1Z9F A;  5E7N A;  5C0X J;  3PUV A;  4JI0 L;  4A3C H;  4KHP L;  1GM5 A;  4A4I A;  2UXC Q;  1TWC H;  2N3S A;  4JCV E;  5IYB H;  2OQK A;  3STB D;  4YCW A;  2GVB A;  2MFI A;  3E0E A;  3JC6 6;  4O2D A;  3ULJ A;  1C0A A;  4A3D H;  3ZJY C;  2YV5 A;  3K7U C;  4DR3 Q;  4LUV A;  5GAH C;  4PMW A;  4C2M H;  1VQL A;  1OXX K;  2QEX A;  1PVO A;  4DR3 L;  5C3E H;  1CKN A;  4JI7 Q;  2R93 G;  1JT8 A;  1NY4 A;  3A5Z B;  1K73 C;  2WAQ G;  4YY3 Q;  2JA8 G;  1A8V A;  2KBN A;  4GLA C;  2WB1 E;  3BZK A;  4PG3 A;  5IP9 H;  1PH2 A;  4BXX H;  2ZJR A;  3K80 C;  5FJ8 H;  3T1Y L;  1EQR A;  4NB3 A;  2UUC L;  2IHF A;  1D8L A;  1EOV A;  2K52 A;  4R4O A;  1J5E L;  3ICE A;  1SMX A;  2AHO B;  1FJG L;  1K83 H;  2RF4 A;  3T1H Q;  3CXC A;  1PV4 A;  3TS2 A;  4GKK L;  1CKO A;  1YHQ A;  2PQA A;  1V1Q A;  4LFB Q;  3TEH B;  1X56 A;  4HIM A;  2CWA A;  4MZ9 A;  5J3B A;  4OWW B;  1VQP A;  2RHS B;  3I4O A;  1MJE A;  1G6P A;  4OWX B;  2GN5 A;  3GTP H;  4A3G H;  3FHW A;  5JEA G;  4JI2 Q;  4JYA L;  2OCE A;  2E5L L;  3I4M G;  1PYB A;  2K50 A;  3H3V I;  1QZH A;  1KAW A;  2AWN A;  2N78 A;  1TWG H;  4B3S L;  3CW2 C;  4Y52 H;  3A74 A;  4BBS H;  4OO1 G;  2CKZ B;  1J6Q A;  3CCJ A;  4A3M G;  1IBK L;  4DKA C;  3S1Q H;  1RL2 A;  2NN6 G;  3J7A 5;  1VQD A;  4A3L G;  4HJ5 A;  2NZO A;  4K0K Q;  2ASB A;  3HOW G;  2D62 A;  4JOI C;  4JI8 Q;  1XMQ Q;  4WJ3 M;  2A19 A;  3KDF B;  2RHQ B;  4BA2 I;  2JA5 H;  4NXM Q;  3I4N H;  3GTG H;  1CKM A;  4EQ5 A;  1JE5 A;  4XTC S;  3S1N H;  2LSS A;  5LMU Q;  3RZO H;  4IOA A;  1VQH A;  3AFQ A;  2B29 A;  3K0X A;  2WB1 G;  3PUW A;  2ZTE A;  4BY7 G;  2JJQ A;  4QY7 A;  2UXB Q;  4DUY Q;  4B3R Q;  2UXB L;  4DV7 Q;  1C9O A;  5IP7 H;  4DUY L;  4DK6 C;  2R92 G;  3L0O A;  4B3R L;  1VQI A;  3D0F A;  1KXL A;  4DV7 L;  1XNQ L;  1VQ7 A;  4A3E G;  4YWM A;  3H0G H;  5C4X G;  3J81 c;  4JBM A;  3CCV A;  3G4S A;  3F8T A;  4JI3 L;  4GN5 A;  3HOX G;  1UEB A;  2HT1 A;  1X65 A;  3OTO L;  2K4K A;  5JEA J;  1V43 A;  3U4Z A;  2JK8 A;  4IPH A;  4J15 A;  3K8A A;  5BR8 Q;  5M5W H;  4DV3 Q;  1YJN A;  3W1G A;  1Q7Y C;  1EFW A;  5GAE C;  3PO3 H;  4OO1 I;  2FXQ A;  1MJC A;  4LF7 L;  4DV3 L;  1HR0 W;  2JA6 G;  2K5N A;  1DGS A;  3S17 H;  1NBW A;  4DV6 L;  2RCN A;  3PIP A;  4GNX B;  2D0P A;  2I5H A;  1P8L A;  3OYY A;  4UP8 A;  4L5T A;  3S16 H;  4DR5 L;  3M85 A;  1OTC A;  3GTO H;  3J80 i;  5IYC G;  4MTN A;  1Q46 A;  2VZA A;  5FLM G;  1UE1 A;  1IBL L;  2BH2 A;  2R93 H;  2NZH A;  4DV1 Q;  2B3G A;  4UP7 A;  4A93 G;  1KRS A;  2JA8 H;  3RN2 A;  5IY0 A;  2VY3 A;  4X66 Q;  4LF4 Q;  4X65 L;  1QVF A;  1QVG A;  1N36 Q;  1UE5 A;  3I7F A;  4POG A;  3GTQ H;  3M3Y H;  4LF4 L;  4X66 L;  4DR6 Q;  2VQF Q;  3K7A H;  4GOP A;  4DR6 L;  1S3O A;  1SE8 A;  4C3I H;  3AFP A;  3CAM A;  4DV2 L;  3A0J A;  4QGU A;  2AWO A;  2IHE A;  3E9H A;  3L7Z C;  3RZD H;  1NJI C;  4A3I H;  2UU9 Q;  4QQB X;  2CCZ A;  2DUD A;  1RIP A;  4TQU S;  1HJP A;  1V9P A;  2V1C C;  5AJ3 Q;  2HHH L;  1C7Y A;  2JQO A;  3M7N A;  2OQ0 A;  3HKZ E;  1PH3 A;  4GN3 B;  4KLK A;  4P75 A;  1PH6 A;  4DR4 Q;  2PI2 E;  1HNW L;  3ER0 A;  3UDI A;  2Z0S A;  3VDY A;  4LNQ A; 
#chains in the Genus database with same CATH topology
 4DR4 L;  4JV5 Q;  1H9M A;  4C3J B;  1TKW B;  3CRL C;  4A3M H;  3W1B A;  4OX9 Q;  1Q90 A;  5FLX E;  1FYC A;  2QDB A;  4ODG A;  1Y1W G;  4FP5 D;  3J7Z C;  4QJF A;  4JG2 A;  3GTJ H;  1TXY A;  3SEB A;  2M9V A;  4YY3 L;  4V0B A;  5EBD A;  2C35 B;  2NVT B;  1R4Q B;  1E3P A;  4XQN A;  1SLJ A;  2VQE Q;  1ASZ A;  4OIJ A;  1QUQ B;  5C44 B;  1R9T H;  3U50 C;  2LS0 1;  4NMZ A;  1BCP D;  2R92 H;  1IHZ A;  3IFT A;  3H3V C;  2K75 A;  4IO9 A;  4L6T B;  1D2B A;  4DR2 L;  2NVQ B;  1HFG A;  1X55 A;  2O2L D;  3HOZ G;  1LT6 D;  4P71 A;  1S40 A;  5C4H A;  5GRO A;  3K6O A;  2PPB C;  1EFI D;  3HKZ G;  2K5H A;  1A3T A;  5EKK A;  4ME3 A;  3IRB A;  3PGZ A;  3QWN A;  1A3U A;  3RUZ A;  4JI2 L;  2L12 A;  2I0Q A;  1DXM A;  1YJ9 A;  1PRT F;  5C4J H;  3HOY B;  1BBW A;  1OXU A;  3MWY W;  2EY2 A;  2Z6K A;  3S1M H;  4RCO A;  1Q81 C;  5FLM H;  1GVP A;  3CCE A;  3CHB D;  2K28 A;  5ELO A;  1D6E C;  4JI8 L;  4KN4 C;  1VQG A;  3GP7 A;  1U0L A;  3DLL A;  1Q1E A;  2NB0 A;  4KMU C;  1EYC A;  2TMP A;  4L5S A;  2FMC A;  3LGJ A;  2I07 B;  5GQO A;  2B2W C;  4IPD A;  3KLS X;  4DV4 Q;  3CC4 A;  4C3H G;  3RN5 A;  4TRD A;  5JJK A;  1ZYR D;  4P72 A;  2P5Z X;  2J0T D;  1F2M A;  1I4G A;  2K5Q A;  2N49 A;  3KBX A;  4TSS A;  3PV0 A;  3G6E A;  3F2U A;  1I6H H;  3DEP A;  1D5X C;  1NR4 A;  2I5L X;  4DPG A;  3I72 A;  2PQA B;  4AYB E;  5L37 A;  3LX0 A;  5BR8 L;  3DWP A;  3V05 A;  2F0F A;  1PHJ A;  1PDQ A;  1U4L A;  4AIM A;  2EY5 A;  4X64 Q;  3S2D H;  3N6R A;  4LW1 A;  2YTY A;  1YHB A;  1DOM A;  1OXT A;  1VQC A;  3QR8 A;  3MXG A;  2Z1C A;  5JJZ A;  3VR5 A;  4EQP A;  1EY8 A;  3MXU A;  5AFW A;  4X62 Q;  2UUB L;  1KD1 C;  3ITP A;  1HPC A;  4NPS A;  1VF7 A;  4JVZ A;  1PA6 A;  4JOI A;  2FHT A;  2G9H D;  2R6G A;  3F2B A;  2VQF L;  3PUY A;  2WKD A;  2VUM G;  4A3F G;  4KK7 A;  3CD6 A;  3G6J B;  4Z9C B;  1VQ5 A;  2MP1 A;  1D5Z C;  1UUP A;  5JAV A;  4PQX A;  5KNC A;  2BH8 A;  1XMO L;  4LFA Q;  2IX0 A;  5GAD C;  5AJ3 L;  4K6L A;  4PV1 C;  1DD2 A;  1XXG A;  2WIN B;  3TN2 A;  4QL5 A;  2E74 C;  5J22 A;  1YIT A;  1U5K A;  1PYS B;  1WCM G;  1I4R A;  5H1S E;  4DU9 A;  1CT1 D;  1N8R C;  4R8N A;  2RVL A;  5CMD A;  1H9J A;  3MXN B;  1Y1V G;  2L1B A;  4LF5 Q;  3U9S A;  3J81 j;  2TSS A;  2X69 A;  4HMI A;  2Q2H A;  4C3J G;  1TS5 A;  4LF9 Q;  5CGK A;  2KQ3 A;  3S16 B;  2BOS A;  3SHL A;  3T16 A;  4BY7 H;  4QMG A;  2E2J H;  4IFD J;  1WTP A;  2VB2 X;  4QIW B;  3PO3 G;  1B8A A;  1GXD C;  3GTQ B;  1VQN A;  1H9S B;  2PQE A;  2B63 H;  3PUZ A;  2R7Z B;  1EWI A;  2EDG A;  5M5X H;  4X3S A;  2KVM A;  4DNI A;  3HGB A;  5IGG A;  4K5W A;  1HNX L;  1EY5 A;  3A8I E;  3EBE A;  3RZD B;  4CHT B;  1O78 A;  3RD4 A;  4A3I B;  2JEB I;  1VDZ A;  5C44 G;  5E4X A;  3AQQ A;  3T1Y Q;  1PH4 A;  4ID6 A;  4KHV A;  3I55 A;  3FDT A;  4HIK A;  1J5E Q;  5M5Y H;  1F2Y A;  3CCQ A;  1A2U A;  2D2C C;  3P75 A;  1JMC A;  1X3F A;  3CPW A;  1IBM Q;  4DV5 L;  4HID A;  3H94 A;  1SNO A;  5I6W A;  2IT1 A;  1EYG A;  1GKH A;  2XGT A;  4A3M B;  4TVA B;  4I7A A;  1ML0 D;  2V4D A;  1O7L A;  3GTL H;  4RWS C;  3P20 A;  2VL6 A;  1I94 L;  4C2M B;  2EJG C;  2HQL A;  3TZD A;  1IBK Q;  4PZ8 A;  1PH8 A;  4B3M L;  1STY A;  3WDN A;  4MIU A;  2VW9 A;  4GLV B;  4DUZ L;  1SFO H;  1TU2 B;  4ALP A;  3Q24 A;  3I4L A;  5IGB A;  4MHE A;  4LF8 L;  2F0E A;  2ICI A;  5C3E G;  1AFP A;  2Y0S E;  1ICF B;  5IE8 A;  3BS1 A;  1II3 A;  4UP9 A;  1KRT A;  1O7I A;  1QG7 A;  1KQS A;  1VQ9 A;  2OTJ A;  4BBR H;  1LM0 A;  1TS3 A;  1CZG A;  1PFB A;  1XNQ Q;  1NE3 A;  1K8G A;  3AB9 A;  4X3K A;  3HOV H;  1K8O A;  1X6O A;  1FVI A;  1G29 1;  1DOK A;  3S1M B;  1S5C D;  2R7D A;  1IL2 A;  4EVO A;  1EEF D;  4FYD A;  3G48 A;  4JI6 L;  5HGQ A;  1XNR Q;  1U4R A;  3LWE A;  1JJ2 A;  1V1P B;  3S1N B;  3RZO B;  1HNZ L;  3AEV A;  1B53 A;  4DAY B;  4WJ4 A;  1IBL Q;  1CZW A;  5ELD A;  2WAQ E;  3RLN A;  4X65 Q;  4LFC L;  4GKJ L;  4ZYS A;  1SNP A;  2JA5 G;  4JW0 A;  3UE1 A;  1JOR A;  5NUC A;  1LTR D;  1TWA H;  3H0G B;  1I6H B;  5DAU A;  2K05 A;  4S3S A;  1L1O A;  1EOT A;  2OWO A;  1E22 A;  2DY8 A;  4RGT A;  2H1E A;  2ALY B;  4CKE A;  1AE2 A;  2QKI C;  1CSP A;  3S17 B;  1PH7 A;  5EKL A;  2EPB A;  1SJE D;  5EAY A;  2K5V A;  4LF6 L;  3GTM H;  1WOC A;  1K3R A;  2Z6K C;  1Z9F A;  4A3C H;  2MPM A;  5I9P A;  1GM5 A;  2F0G A;  1BCP B;  4ZAI A;  4LJZ C;  4FXK C;  4IAL A;  3JC6 6;  3ULJ A;  1CFM A;  3ZJY C;  4C3I B;  1TS4 A;  1VQL A;  1O80 A;  2EOT A;  2QEX A;  1PVO A;  1JT8 A;  1G2S A;  2VB3 X;  4YY3 Q;  2CH4 W;  3A8K E;  4HN7 A;  4Q0F A;  1A8V A;  3SR1 A;  1F77 A;  2IX3 A;  3JAM E;  2XWJ B;  4F87 A;  3ICE A;  1PTO F;  4ABN A;  1I6V C;  4KD4 A;  1FJG L;  2RQX A;  1K83 H;  3TS2 A;  1YHQ A;  5K5P A;  5KRU A;  2HCC A;  3MA2 B;  1U4P A;  2CWA A;  4OWW B;  2HQE A;  4QUF A;  1PZK D;  4OWX B;  4JYA L;  4JI2 Q;  5E3F A;  3H3V I;  2PCF B;  4H44 C;  5IIF A;  5IGE A;  1KNA A;  2SDF A;  4A3M G;  4DKA C;  3MXP A;  2ENB A;  1JIC A;  4O1N A;  3QOL A;  1B1Z A;  5CV4 A;  4BY7 B;  4HJ5 A;  3J7Y W;  4JOI C;  4JI8 Q;  2A19 A;  3KDF B;  4BA2 I;  3BDC A;  3GTG H;  1MGS A;  4N9P A;  2F0W A;  3ND9 A;  4XTC S;  4DAV A;  4IOA A;  4MTK A;  2WB1 G;  3R2T A;  4C1N I;  3GV3 A;  4IUU A;  3EVQ A;  3H6M A;  1WTQ A;  1TS2 A;  2JSO A;  3PMF A;  2E75 C;  5FLX L;  4DK6 C;  2R92 G;  1VQI A;  3IAY A;  1VQ7 A;  2HT1 A;  1GUT A;  1RHP A;  2K4K A;  3U4Z A;  2E2I B;  2WV6 D;  5BR8 Q;  4OO1 I;  3PO3 H;  4H13 C;  5GAE C;  3GTL B;  3KK7 A;  4DV3 L;  2K5N A;  2ZXP A;  1ENC A;  1AZQ A;  3OYY A;  4RA8 A;  3GTO H;  1SSO A;  4MTN A;  5FLM G;  2NWG A;  2BH2 A;  2R93 H;  3OMC A;  2B3G A;  1HUM A;  1WTR A;  2JA8 H;  1K8M A;  1HQM C;  1QVF A;  1L0X B;  3CRK C;  2KA7 A;  1QVG A;  2PZW A;  1SFO B;  4LF4 L;  2F0K A;  2VQF Q;  4K8I A;  4BS9 A;  4GOP A;  1TWH B;  2B2T A;  4DV2 L;  1WTH A;  2JP1 A;  2IHE A;  5KND A;  1BBX C;  1SYF A;  1DCZ A;  2EYM A;  4ZUJ A;  4CKC A;  2DUD A;  3Q23 A;  1RIP A;  4AYB B;  4TQU S;  1V9P A;  5AJ3 Q;  2HHH L;  3M7N A;  2MGS A;  1IKM A;  5ELF A;  1UEA B;  5JEA H;  3UI2 A;  4ZUI A;  5LL6 S;  1PXU A;  3UDI A;  4LNQ A;  1SNQ A;  3A7L A;  3HOV B;  2NVY H;  4DXF A;  2A6E C;  2NN6 H;  1PTO D;  2AKW B;  2NZ1 D;  2UXC L;  3NHH A;  4HCS A;  3ULL A;  4POF A;  1JCK B;  3K5L A;  3HOW H;  3GTK H;  1JB7 A;  3D4W A;  2WII B;  3C2P A;  3FPU B;  1RDP D;  3EA6 A;  5BN3 A;  1T9H A;  2EY1 A;  3S14 H;  1YZ6 A;  3PF4 A;  3OPO A;  2L11 A;  2F0U A;  3GD7 A;  1SYE A;  2HDL A;  3A8J E;  3TP7 A;  4XYO A;  3T4A C;  5IGD A;  4HJ7 A;  1TWA B;  3S15 H;  1HNX Q;  1E24 A;  1M1K C;  4YCV A;  5C4X H;  1HCZ A;  1SR3 A;  1KAA A;  4CGY B;  3OHX C;  1BKB A;  3NQT A;  2F52 A;  3MAQ A;  4G57 A;  1B9N A;  5BN4 A;  2Z9H A;  3ULP A;  1KL9 A;  4KJO A;  3VR4 A;  2OXP A;  3GTM B;  3NWS A;  4DV5 Q;  1EY4 A;  4X3U A;  1WD1 A;  3I70 A;  1BCP C;  2WFW A;  1EY7 A;  1VQ4 A;  2JXM B;  1SAP A;  2ZM6 L;  1KIX A;  1UE7 A;  3VA5 A;  1DON A;  4KHZ A;  5A35 A;  1PH1 A;  1A62 A;  2EYF A;  1I94 Q;  3UDF A;  2VXW A;  1M4V A;  3Q8D A;  4NXM L;  5IT9 E;  4FXD A;  4B3M Q;  3K0Y A;  3OOC A;  1SE3 A;  4DUZ Q;  1CKN B;  3GV6 A;  3NEN A;  1NUC A;  2DJG C;  1A15 A;  3K57 A;  2B63 G;  1HHV A;  1BDO A;  1AN8 A;  1YI2 A;  2F3I A;  4LF8 Q;  3S24 A;  4P2C B;  2MNA A;  1YNX A;  1PTO H;  1IZ6 A;  3SE0 A;  1K83 B;  3J80 E;  5DM7 3;  4HJ8 A;  5M3M H;  1YHA A;  1L1O C;  3UDX A;  3W2D A;  2RSO A;  1NR2 A;  1W2B A;  1SYG A;  4HTH A;  2EE1 A;  4JK1 C;  4N8X 1;  3FPP A;  5JOB A;  4K2L A;  3K5O A;  1ZYR C;  3AU7 A;  1STG A;  2VUM B;  4A3F B;  3CP0 A;  3MZ5 A;  2O5I C;  2B2U A;  2Q2U A;  1MIU A;  1X3Q A;  4YWL A;  3EIV A;  4JI6 Q;  2EXD A;  3T13 A;  1HZB A;  3D31 A;  2HCI A;  1E2Z A;  4DV0 Q;  4K8J A;  2AMC B;  2NTT A;  2UUA Q;  5M3F H;  1DZ1 A;  5D14 A;  4Y7N B;  4LFC Q;  4GKJ Q;  2UU9 L;  3FKI H;  4J8Q A;  5J39 A;  1A3V A;  1FGU A;  5TSS A;  5IWA Q;  1QCB D;  2OT2 A;  3GQB A;  2HIX A;  1Y1V B;  4F88 A;  1KHI A;  2D0O A;  1IYV A;  3CME A;  4BBR G;  1QOH A;  3KF8 B;  4AYB G;  5DM6 3;  4P74 A;  2XWB B;  3RLF A;  1ZKO A;  1HXY D;  3HRZ C;  3M4P A;  4J6H A;  4DR7 L;  1SYD A;  2EY6 A;  1N33 Q;  3PO3 B;  4K5V A;  2YU9 H;  3KJO A;  1N34 L;  4LF6 Q;  3HOV G;  3KLW A;  3RNU A;  1VQ6 A;  1PZJ D;  2UXD L;  1LTA D;  1QZG A;  4IFD I;  4PZ6 A;  4BY1 H;  3NEM A;  4HJA A;  1G2T A;  1YJW A;  3DHQ A;  2R93 B;  4PNY A;  2XIW A;  4JI5 L;  2WAQ B;  1E1O A;  1UNS A;  3PSI A;  1R4P B;  2CHB D;  5ELC A;  4ZK9 B;  1TWF H;  2QGQ A;  2E2D C;  4GLX A;  1V1O A;  3I91 A;  1NMG A;  4IPG A;  5FLX c;  3BVZ A;  2KEN A;  3MVV A;  3OW2 A;  5HUR A;  3TRE A;  4LMQ D;  2CW0 D;  1QNU A;  4H7B A;  3NP8 A;  2XNA C;  1SE4 A;  1J9O A;  3HG9 A;  1PH5 A;  1KNE A;  1PRT C;  4XT1 B;  2MUY A;  4APV A;  1QE6 A;  1FJG Q;  1M8A A;  2RSN A;  3IL8 A;  4K14 A;  5EGT A;  4A3B H;  3NWT A;  2NVY B;  3DMU A;  3PUX A;  4IJL A;  2NBF A;  1LTG D;  4JYA Q;  1EQQ A;  2ID0 A;  4GNX A;  3HOW B;  1EIF A;  2F4V L;  3GTK B;  5CV8 A;  3SK6 A;  1X9N A;  1LT5 D;  2O5J C;  2IPK D;  5C3E B;  2IY5 B;  4JBW A;  3SGI A;  4A3C G;  3NE5 B;  4RG1 A;  2Q8I B;  1I50 H;  1JOQ A;  1TY0 A;  3J81 E;  1LTT D;  1STE A;  2GVA A;  3ZYY X;  1HTP A;  4GOP C;  4IUV A;  1LTI D;  4R4T A;  3S15 B;  3L9A X;  5C4X B;  2JEA I;  1ILP A;  1CA6 A;  1XYI A;  4OXP A;  1A0I A;  1P16 A;  1RKN A;  1YNN D;  5ELB A;  3KFU A;  4KKT A;  2OTL A;  4ZQ3 A;  4CDE C;  1I4X A;  4YWK A;  4Q5V A;  3V2T A;  2WP8 J;  4DFA A;  5EKI A;  2QDL A;  1TII D;  1FNW A;  1UWV A;  2E2H H;  1TR5 A;  4DR1 Q;  2JA5 B;  1BUV T;  2ZXO A;  3BYY B;  3H15 A;  4CJ0 B;  2BCO A;  3M7G A;  2QF7 A;  1XPO A;  3HZX A;  3A5U A;  2LY7 A;  2Y0S G;  1L0Y B;  5FO7 B;  4DV2 Q;  3MEF A;  1B7Y B;  5LMN L;  1PTO B;  3NK9 A;  1VQE A;  3PCO B;  1PYW D;  1WTO A;  4NXN Q;  1VCI A;  2L9H A;  4IUR A;  1BBU A;  1X54 A;  3QOJ A;  2HHH Q;  3M4O H;  2QW7 A;  4RKL A;  4UPA A;  4U68 A;  1XJV A;  2JA7 H;  2MQH A;  1B3Q A;  1Z6H A;  3E0J A;  1N9W A;  4KHP Q;  4OON A;  4JC0 A;  3TSS A;  1U9R A;  4RGO S;  4OHJ A;  2SNM A;  5F2D A;  4JI0 L;  2EJM A;  3VYS A;  1PRT D;  2UXC Q;  4DK1 A;  2N3S A;  5T1G A;  3PIP 3;  4JCV E;  1EQV A;  5IYB H;  4R9W A;  2IWH A;  3RMH A;  1CHP D;  1C0A A;  4A3D H;  4DR3 Q;  3K7U C;  4LUV A;  1OXX K;  3E3X A;  1S5F D;  1LTS D;  2R93 G;  3A5Z B;  2WAQ G;  2JA8 G;  3KBG A;  2KBN A;  2X6G A;  3BZK A;  1G91 A;  2PYK A;  2NTS A;  3K80 C;  3LNN A;  1CA5 A;  5FJ8 H;  3DWA A;  2UUC L;  3AMU A;  1EOV A;  2K52 A;  4R4O A;  1SMX A;  4CBV A;  2O4X A;  2RF4 A;  2SNS A;  3R3O A;  5KIX A;  1EY0 A;  1BR9 A;  2X6L A;  4C56 C;  3R2I A;  1V1Q A;  1ICW A;  4HSP A;  4HIM A;  5C5M A;  5J3B A;  1WTV A;  2L4N A;  1MJE A;  3I4O A;  3SDZ A;  2GN5 A;  1XX8 A;  3GTP H;  3FHW A;  5JEA G;  5C0X H;  1VMC A;  2E5L L;  3SVM A;  2YU9 B;  4UDU C;  1EZ6 A;  1KAW A;  1EQT A;  1HTL D;  2N78 A;  1JWS D;  1TWG H;  3CW2 C;  5D3D A;  1RF2 D;  4BBS H;  3GTJ B;  1KDC A;  2F0N A;  2RDF A;  2L5T A;  4IUT A;  4E6I A;  1RL2 A;  2NN6 G;  4DGZ A;  3J7A 5;  4KKU A;  2WB1 B;  4A3L G;  1TY2 A;  1W6K A;  2NZO A;  3K5M A;  3HOW G;  3D6W A;  2H4O A;  1R9T B;  4WJ3 M;  4NW2 A;  2R92 B;  1JWU D;  4NXM Q;  3I4N H;  4EQ5 A;  1PFM A;  5C3X A;  2K1B A;  3QB3 A;  1VQH A;  1F9P A;  4CDF C;  3K0X A;  1JE4 A;  3NTK A;  4KN7 C;  3TME A;  2MHV A;  1VF5 C;  5DNF A;  1BNZ A;  2UXB L;  4PMC A;  4DUY L;  1SND A;  3FRP B;  4B3R L;  5FKA C;  2RA4 A;  3D0F A;  4DV7 L;  4RGM A;  4KV6 A;  1E2W A;  5C4J B;  4RFB A;  4KY7 A;  5C4X G;  3CCV A;  3VYT A;  4JI3 L;  5E4W C;  2KEE A;  4RHR A;  3OTO L;  1V43 A;  2JK8 A;  4IPH A;  1YNJ D;  3W1G A;  2F4I A;  5JVG 3;  3EQL C;  1MJC A;  4EQO A;  1AW7 A;  4DV6 L;  3BZD B;  3FVQ A;  1P8L A;  5EPL A;  5KNB A;  3N52 A;  5FOB B;  1UE1 A;  4A93 G;  2RCF A;  5IY0 A;  2VY3 A;  4DN4 M;  1EZ8 A;  3I7F A;  5CR3 A;  4X66 L;  5BN5 A;  4DR6 Q;  2WAC A;  4GZY C;  1SE8 A;  2K6A A;  3NUC A;  1B4O A;  3E9H A;  3L7Z C;  2B2Y A;  4LK1 C;  1E2V A;  1NJI C;  2UU9 Q;  1F9S A;  3J7A F;  2V1C C;  2PW5 A;  5M9O A;  4GN3 B;  1PH6 A;  1S5E D;  3S2D B;  4DR4 Q;  3I4M H;  4A75 A;  3M85 A;  5M3M G;  2F1M A;  1WVL A;  1BO0 A;  4OEM B;  4HJ9 A;  4OO1 H;  1FNV A;  5IT9 L;  3PIO A;  4JV5 L;  4DR7 Q;  5I6Y A;  1LT3 D;  4OX9 L;  1N34 Q;  4YIJ A;  2YTX A;  2UXD Q;  1K9M C;  4IJH A;  2G5D A;  1T5E A;  4JI7 L;  1VQO A;  3CKI B;  1LT4 D;  4X3T A;  1LO5 D;  3VR2 A;  4DA2 A;  1PTO C;  4FO2 A;  1Y69 U;  1OXV A;  4DR2 Q;  3BVM A;  4WFN 3;  2RDG A;  1GUG A;  1GOZ A;  3OSO A;  5M3F G;  3CU7 A;  4U67 3;  2D9U A;  1EWH A;  2NUC A;  1PH9 A;  1MI2 A;  4B08 A;  4A3E H;  2KHJ A;  3TZU A;  3FKI G;  1QVC A;  2PZU A;  3PQI A;  4IQZ A;  2K5W A;  1KDB A;  3W5O A;  4L63 B;  1L1O B;  1VQM A;  1LUZ A;  3M4O B;  5LMN W;  2QEJ C;  3CCL A;  4XYQ A;  1KC8 C;  2JA6 H;  3NTI A;  3M4Q A;  3B6Y A;  4ILW A;  3OWF A;  4M8A A;  3JAM c;  3S9W A;  2E2J B;  1EIY B;  2H5X A;  4DK3 C;  1RD9 D;  5A2Q L;  3Q0A A;  2B63 B;  2F4V Q;  5M5X B;  1XMQ L;  4A3D B;  2PMZ E;  2A68 D;  5CC4 A;  4BY1 G;  3VYU A;  4A76 A;  1JJC B;  3C3L A;  3I8Z A;  1KDA A;  2KHS A;  1B9M A;  1GHK A;  2L15 A;  5M5Y B;  3NBH A;  5EPK A;  4BWG B;  3P7J A;  1CSQ A;  3KF6 A;  5CBE E;  2WKC A;  3I90 A;  3BDO A;  2ES2 A;  1ESR A;  2F0V A;  4A3J H;  1TT2 A;  3T53 B;  1HZC A;  3IKJ A;  4N8F A;  1IW7 D;  3MHB A;  3GTP B;  4QF4 A;  1L0W A;  2JYO A;  2Q8T A;  3SK8 A;  3EN2 A;  3W3A A;  4MN3 A;  4A3B G;  4BBS B;  1JOK A;  2UUB Q;  1QNK A;  1OXS C;  1FD7 D;  3S1R H;  1G6Z A;  4R4C A;  4RMF A;  5J1Z A;  3U4V A;  3F1Z A;  1S72 A;  1HH2 P;  5D65 A;  4WRD A;  1IYU A;  4M1U B;  3KLR A;  1G51 A;  1JR0 D;  3A54 A;  1LYL A;  1AP0 A;  4IN3 A;  1XMO Q;  2EJF C;  4PZ7 A;  3X3N A;  4BBR B;  5CV7 A;  5DLQ E;  2NVT H;  5DEH A;  3L2P A;  2YYZ A;  1ENA A;  1ASY A;  5LMN Q;  5I4D A;  3G7L A;  1PRT B;  2NVQ H;  4FF1 A;  1WD0 A;  2JE6 I;  3OIP A;  2Q2T A;  3KF6 B;  2F0M A;  1FL0 A;  4A3L H;  2IJ0 A;  2F0S A;  4ZCK A;  1I4Q A;  4OGQ C;  1O7Y A;  4A3K H;  1DJR D;  2R7F A;  5IYD H;  4MNO A;  4ZLT F;  3U58 A;  5D3I B;  3TRZ A;  3OMG A;  3S2H H;  1D1K A;  5T1I A;  4L5Q A;  4JI0 Q;  5I2Y A;  3C46 A;  1JQY D;  1JC7 A;  3D6C A;  3FEW X;  2CQO A;  3PO2 H;  1CQF A;  2EYL A;  1C8C A;  4RAU C;  2K01 A;  2YTV A;  4FNF A;  5FK9 C;  1MBY A;  2R61 A;  3R93 A;  1VMP A;  2K04 A;  3O13 A;  4JBK A;  4GOP B;  4JI4 L;  2XVS A;  2JA9 A;  4TKO B;  1KLG D;  3ND8 A;  3KOJ A;  4HED A;  4IUN A;  1T5X D;  4B9W A;  2UUC Q;  2D5D A;  1KLU D;  2F0H A;  4DAM A;  5IOC A;  3I4M B;  4YCU A;  1PFS A;  1HR0 L;  2ICE C;  1JJG A;  3STB C;  4ZRZ A;  1FR3 A;  3F2C A;  3TDQ A;  4DK0 A;  1IBM L;  1N32 L;  1ZEQ X;  1Z47 A;  1VQJ A;  1W3S A;  4RKB A;  1RTO A;  2EIF A;  4A93 H;  2EVB A;  2CW0 C;  2E5L Q;  2LMC B;  3CCR A;  1ENF A;  2EYJ A;  3CQZ H;  4R4I A;  2JA7 G;  5C5L A;  4IFD H;  5LL6 X;  3JAM i;  2KCT A;  4K6D A;  2FJ2 A;  2E8G A;  2JN4 A;  5JPM C;  1GUN A;  2ZTD A;  4IOC A;  4RHS A;  1RCV D;  4JI1 L;  1A2T A;  3ERQ A;  2ZTC A;  3FP9 A;  2F0I A;  4JPB W;  3E5S A;  5IYB G;  1M90 C;  1SEB D;  4A3D G;  4LUZ A;  3UE0 A;  1I4P A;  1YBY A;  4FXG C;  2NVX H;  1IKL A;  1E1T A;  1WJJ A;  1SE2 A;  4AQY L;  2B2Y C;  4RCN A;  4QB4 A;  4CDC C;  1K0R A;  4FVM A;  2K5D A;  4DAP A;  5FJ8 G;  4B3T L;  5IT9 c;  5G3L F;  1SBB B;  1XTD A;  1XWE A;  1EY6 A;  4F7X A;  5LHY 1;  3BJU A;  1KTK A;  2GA4 B;  1S5D D;  1S5B D;  2KCC A;  4JI3 Q;  3BDL A;  2ZJP A;  3OTO Q;  1IYJ B;  1NTG A;  1C48 A;  4R4Q A;  1SXT A;  5C0X G;  1O7Z A;  1K28 A;  2HUG A;  2KCN A;  2HIV A;  3J80 c;  4HIO A;  4HSV A;  1AE3 A;  4DV6 Q;  1HNZ Q;  4BBS G;  3P1H A;  2NN6 I;  2Y0S B;  1XNR L;  3GTG B;  3I2Z A;  1YNN C;  3A7A B;  3SK5 A;  5GAG C;  1X3E A;  1B44 D;  4WOR A;  2QCP X;  2F3V A;  1SMY D;  3R8B A;  4CJ1 B;  4G7O C;  2K14 A;  1QUQ A;  3BYT B;  1HUN A;  3HOU H;  3ERS X;  3EJI A;  3I4N G;  2R7Z H;  3HFZ B;  1BF4 A;  1BQQ T;  2B2V A;  2K7V A;  3QJY A;  4QCL A;  2A5H A;  1YVC A;  5EPJ A;  1E7Z A;  1HRJ A;  2Z6B A;  3CCU A;  1XPU A;  2F0T A;  4KD3 A;  3KLS A;  2PW7 A;  4YHH L;  1XTC D;  4GN4 B;  3GTO B;  3PUV A;  1KAB A;  1Z7T A;  4A4I A;  2JA8 B;  1TWC H;  3S1R B;  2BE5 D;  1MHW C;  2KED A;  3STB D;  2GVB A;  2MFI A;  3E6Z X;  3Q6S A;  2N88 A;  5GAH C;  4PMW A;  4C2M H;  4ME5 A;  2CH4 A;  2FMM A;  1ONL A;  4JI7 Q;  2AQ1 B;  1PFN A;  1NY4 A;  1K73 C;  1STN A;  1BOS A;  1PH2 A;  5IP9 H;  2ZT9 C;  4BXX H;  2R3Z A;  1FNU A;  2F0J A;  5COY A;  3VA7 A;  3OWE B;  2FFK B;  1PZI D;  1PV4 A;  4GKK L;  1CKO A;  2PQA A;  2RBM A;  3K5N A;  3I73 A;  2C9O A;  4MZ9 A;  4H0L C;  1X32 A;  4A3G H;  2A73 B;  3H91 A;  4A3K B;  3QIA A;  4LAA A;  3I4M G;  1QZH A;  1ESF A;  2AWN A;  3S2H B;  2RDH A;  1STH A;  4B3S L;  3A74 A;  4OO1 G;  2CKZ B;  3CCJ A;  5G3L D;  3S1Q H;  3S14 B;  2F0Q A;  1VQD A;  3PO2 B;  3OW7 A;  2XRQ D;  2D62 A;  4IUQ A;  1XMQ Q;  2B2T C;  2Z4I A;  3X3M A;  1CKM A;  1JE5 A;  3S1N H;  2LSS A;  3RZO H;  3AFQ A;  3PUW A;  2FIN B;  2KOL A;  3L3O C;  1C9O A;  1Y8P B;  5KGU A;  4K2K A;  5IP7 H;  2XRS D;  3D8G A;  4R8I A;  2PO4 A;  2RKS A;  4A3E G;  3H0G H;  5KEE A;  1HFN A;  1ROD A;  2IW3 A;  3J81 c;  3G4S A;  3F8T A;  3HOX G;  4GN5 A;  1UEB A;  1X65 A;  5JEA J;  2QIL A;  3MXN A;  4A93 B;  5M5W H;  1YJN A;  1EFW A;  4DV3 Q;  1AZP A;  4LF7 L;  1HR0 W;  2JA6 G;  3CQZ B;  5CV5 A;  3JAM L;  3S17 H;  1NBW A;  5E1F A;  2PMZ B;  4GNX B;  2D0P A;  2I5H A;  4L5T A;  5ISR A;  4DR5 L;  1OTC A;  2HDM A;  3J80 i;  3QO2 A;  2NYZ D;  1H9S A;  1KRS A;  4LF4 Q;  1B50 A;  4POG A;  1UE5 A;  3M3Y H;  2AQ3 B;  1YNJ C;  3K7A H;  1S3O A;  2NVX B;  4C3I H;  3AFP A;  3CAM A;  4QGU A;  5M3M B;  1LLR D;  1CK1 A;  1EIG A;  2AQ2 B;  2SOB A;  1SJH D;  5IOD A;  2OQ0 A;  3HKZ E;  1RTN A;  4P75 A;  5CV6 A;  1HNW L;  2KEC A;  3VDY A;  2CFM A;  4A3J G;  4IZ8 A;  1I3Q H;  3BZC A;  2KUM A;  2PNH A;  2VS1 A;  4PMB A;  1NMF A;  5K36 G;  1VQK A;  2IX1 A;  4XQQ A;  4B9X A;  2G9D A;  2LFN A;  4R1J A;  2DN8 A;  2IL8 A;  5M3F B;  2KJX A;  1A6X A;  3VR3 A;  2Z4H A;  3CF5 A;  1WI5 A;  1V8Q A;  3FKI B;  1RJT A;  3TBI B;  1Q12 A;  3HOU B;  1EUJ A;  1LAC A;  1ILQ A;  3FMC A;  2XTI A;  3CCS A;  3Q22 A;  3G71 A;  1Y8N B;  2J4X A;  2L0C A;  4JI4 Q;  3T1H L;  4C1N K;  3WOE A;  1VS0 A;  2LXJ A;  1EIH A;  4LFB L;  4IUP A;  1EEI D;  3URY A;  1NSN S;  1DYQ A;  3I56 A;  5COR A;  2PNR C;  4HAE A;  2VNU D;  1STB A;  5EJW A;  1HR0 Q;  4BA1 I;  4ULL A;  1GUS A;  1X3G A;  3CC7 A;  1HA5 A;  2ZM6 Q;  2B2U C;  1N32 Q;  4BY1 B;  1Q82 C;  1I5F A;  5IYC H;  4A3K G;  3CMA A;  2E2I H;  5IYD G;  1G8Z D;  1TWC B;  3DXJ C;  1TWF B;  4K0K L;  5I2X A;  2EYO A;  1IXR A;  1V1P A;  1E0B A;  4DAY A;  2ATW A;  3HOY G;  3KJP A;  2F0L A;  3DM3 A;  1CM9 A;  2F3W A;  4RGN A;  4JI1 Q;  5LMU L;  4X6A H;  4HMJ A;  2KHI A;  1VQB A;  3PO2 G;  2ZJQ A;  4ZKB B;  2LKV A;  2EQS A;  1GUW A;  5IGC A;  4KY6 A;  4LUO A;  3T56 B;  1MKH A;  1Q8I A;  2DNC A;  3GO5 A;  5JVH 3;  1JB3 A;  1TWH H;  4ZKC B;  4AQY Q;  4A3B B;  5IGF A;  2B2V C;  1W6J A;  2A68 C;  3H3V H;  1XPR A;  1SRO A;  5EBC A;  4B3T Q;  4UY8 C;  3TP8 A;  4G7Z C;  2EYH A;  4CJ2 C;  4A3G B;  1EU3 A;  3J81 i;  3DEO A;  3NXW A;  1MSG A;  1Y1W H;  3ERO A;  1X3P A;  2Z8L A;  3UDG A;  4OEL B;  5JPN C;  3S1Q B;  5KYI A;  1MSH A;  1I50 B;  2SEB D;  1VQ8 A;  2F0O A;  2K33 A;  4DV1 L;  2K03 A;  4IFD G;  2XSC A;  1N36 L;  1LTB D;  1IW7 C;  2Q2I A;  3TS0 A;  3D4D A;  4GS3 A;  1EU4 A;  3CC2 A;  4DV0 L;  1WYD A;  1YIJ A;  1K8A C;  5ELE A;  4G4K A;  2UUA L;  1STA A;  3HOZ H;  2I5M X;  3WWV A;  5JJL A;  1BXT A;  2PI2 A;  1HZA A;  3HKS A;  3OIQ A;  5IWA L;  2ZXR A;  3NEL A;  4G7H C;  2XN9 C;  1Y14 B;  1LAB A;  1Q86 C;  1SYC A;  3CCM A;  1S4Z A;  2E2H B;  4GNX C;  5CBA E;  2F0P A;  5M5W B;  3VR6 A;  4YHH Q;  1K3B C;  4FDB A;  1N33 L;  4O42 A;  3RLO A;  1CI3 M;  3AYH B;  4EGV A;  1ZXT A;  4KKS A;  5C0X I;  2LXK A;  4LWC A;  2BA0 A;  3NBI A;  5KYL A;  4JI5 Q;  3J80 L;  1JWM D;  2MO0 A;  3KDF A;  5EQ0 A;  3T51 B;  2CWP A;  3M3Y B;  2VQE L;  4C3H H;  3D3R A;  5C4Z A;  1UE6 A;  2A1A A;  4IPC A;  3K7A B;  1BVS A;  4AH6 A;  3NSW A;  4J1M A;  4NDX A;  1F2Z A;  4DF7 A;  2CQA A;  1H95 A;  2A69 C;  3H09 A;  4K5X A;  3HOX H;  5CYU A;  3HOU G;  2A8V A;  1YEZ A;  3IFD A;  5ELN A;  3ONA B;  2R7Z G;  3LWU A;  1B70 B;  3MEH A;  2JA7 B;  5FO8 B;  4GKK Q;  1EYD A;  1PLF A;  1CTM A;  2QA4 A;  2A6H C;  3TP5 A;  3C1F A;  1C4Q A;  1ET9 A;  4A3I G;  1I3Q B;  1Q8K A;  4P73 A;  2B8F A;  1SNM A;  3NQI A;  4NP5 A;  1EL0 A;  1Q3L A;  4B3S Q;  5HY6 A;  3M9B A;  1OO9 B;  1SN8 A;  4EX5 A;  3HS0 C;  4FF2 A;  2EXZ A;  2VUM H;  4A3F H;  1K0S A;  1F9Q A;  1LTL A;  4NKL A;  3GDE A;  3A55 A;  1D7Q A;  1HZ9 A;  1VQA A;  1SDF A;  1NNX A;  4XIG S;  4DV4 L;  1GO3 E;  1LV9 A;  3KYH C;  2E76 C;  1Q1B A;  2MO1 A;  1QB5 D;  3K81 C;  1CUK A;  2KCM A;  1WTW A;  1I4H A;  3KUP A;  5IP9 G;  4BXX G;  1WCM H;  1EY9 A;  1VQF A;  1JOO A;  4Y7N H;  3CPF A;  3NTH A;  5K36 H;  4KJN A;  1SRU A;  4HR7 B;  2L55 A;  1PMR A;  1TWG B;  3J7A V;  4X64 L;  1Y1V H;  4UAI A;  3MTS A;  4C3J H;  1H9R A;  4KI0 A;  4XQJ A;  1DOL A;  5JJI A;  1B3A A;  4A3G G;  1H9K A;  4X62 L;  4XDX A;  3QG1 A;  3D4R A;  1WFQ A;  1G6P A;  4OWT B;  1A63 A;  4LF7 Q;  1L2F A;  1GUO A;  3RR5 A;  1FGB D;  3I4N B;  4DR1 L;  3HP3 A;  3K59 A;  4DR5 Q;  2BDN A;  2DJF C;  5FO9 B;  3MFG A;  4QUC A;  2B2W A;  3EFX D;  4WJW A;  4DNT B;  1TQO A;  2CVR A;  3TQY A;  3C1E A;  1DM0 B;  1F9R A;  4QIW E;  3E9I A;  4LFA L;  5C44 H;  2B8G A;  2HD3 A;  4FF4 A;  2N8N A;  1CQV A;  2A74 C;  4V19 0;  4CKB A;  1ET6 A;  4FF3 A;  1EWC A;  3NBH B;  3A56 A;  3V96 A;  3F2D A;  4H02 A;  4OIK A;  3HEJ A;  4UHV A;  3BU2 A;  4NXN L;  4L5R C;  1SMY C;  1SNC A;  2DGY A;  3MC0 B;  5IP7 G;  1AH9 A;  2Q8R E;  4RH6 A;  2BA1 A;  3VYR A;  1GD7 A;  4JBJ A;  3J81 L;  1HNW Q;  3H0G G;  2EYP A;  3MFY A;  3SXH A;  4LF5 L;  1UAP A;  1Y1W B;  2A69 D;  3M4Y A;  3PF5 A;  3HOY H;  1J8I A;  2N55 A;  4O0A A;  4LF9 L;  1HA6 A;  5E7N A;  5C0X J;  4KHP L;  4HCE A;  2BDO A;  4KY5 A;  2K32 A;  2OQK A;  3DUZ A;  4YCW A;  2A6H D;  3E0E A;  4O2D A;  2YV5 A;  4DR3 L;  5C3E H;  1CKN A;  1QJO A;  3TP6 A;  4XXE A;  3HOZ B;  4GLA C;  2WB1 E;  4PG3 A;  2ZJR A;  1TVX A;  3T1Y L;  1EQR A;  4NB3 A;  2IHF A;  1D8L A;  1IL8 A;  2F03 A;  3HKZ B;  2BE5 C;  1J5E L;  4C3I G;  1F2L A;  2AHO B;  2DY7 A;  3T1H Q;  3CXC A;  1AEX A;  1NCV A;  4LFB Q;  3TEH B;  1X56 A;  2M2L A;  1GJX A;  1VQP A;  2RHS B;  2OF1 A;  2OCE A;  1PYB A;  2K50 A;  3PIO 3;  4Y52 H;  1Y8O B;  3WOF A;  1J6Q A;  4EQN A;  2I46 A;  1IBK L;  1B2T A;  1BCP F;  4K0K Q;  4OL7 A;  2ASB A;  4F8M A;  3I3C A;  4C3H B;  2RHQ B;  2JA5 H;  3U9O A;  4DXG A;  1EYA A;  5LMU Q;  4A3E B;  1D1I A;  2B29 A;  5I9O A;  2ZTE A;  4BY7 G;  4N9T A;  2JJQ A;  4QY7 A;  1D5M C;  3HOX B;  2UXB Q;  4DUY Q;  4B3R Q;  2F0D A;  4DV7 Q;  3L0O A;  1KXL A;  1XNQ L;  2JA6 B;  4YWM A;  3DM1 A;  3KF8 A;  4JBM A;  3BG3 A;  2AUJ D;  3DWQ A;  1GHJ A;  1SYB A;  1CHQ D;  4J15 A;  1Q7Y C;  3K8A A;  2C5C A;  2FXQ A;  1DGS A;  2RCN A;  3PIP A;  1MD2 D;  4UP8 A;  3S16 H;  1QWY A;  1NAP A;  2M00 A;  5IYC G;  1Q46 A;  1WTX A;  2VZA A;  1IBL L;  5C6A A;  4I65 A;  3K58 A;  2NZH A;  4DV1 Q;  4UP7 A;  5HGT A;  4X66 Q;  3RN2 A;  4X65 L;  1N36 Q;  3GTQ H;  1QIL A;  4I7Z C;  2DNE A;  4DNR B;  2AUK A;  4DR6 L;  2PZT A;  2B39 A;  3SK4 A;  4KTA A;  3A0J A;  2MJ8 A;  2A6E D;  2AWO A;  4CDD C;  3NPP A;  3RZD H;  4L8J A;  4A3J B;  1HQR D;  4XT3 B;  4A3I H;  1WCM B;  5A2Q E;  4QQB X;  2CCZ A;  2OEO A;  2EZV A;  1HJP A;  5CV9 A;  1C7Y A;  2JQO A;  2J7Z A;  1PH3 A;  4KLK A;  2PI2 E;  5C3W A;  3ER0 A;  3BVG A;  2Z0S A;  1U4M A; 
#chains in the Genus database with same CATH homology
 5M3M G;  4DR4 L;  2CFM A;  4JV5 Q;  4HJ9 A;  4A3J G;  2NVY H;  3PIO A;  4A3M H;  1I3Q H;  4JV5 L;  3W1B A;  2AKW B;  3BZC A;  4OX9 Q;  2PNH A;  2VS1 A;  1NMF A;  4DR7 Q;  5K36 G;  1VQK A;  2IX1 A;  2UXC L;  4OX9 L;  3ULL A;  4POF A;  1N34 Q;  3HOW H;  1Y1W G;  4R1J A;  1JB7 A;  3GTK H;  3J7Z C;  4QJF A;  2YTX A;  2UXD Q;  4JG2 A;  1K9M C;  3GTJ H;  1TXY A;  4IJH A;  4A75 A;  3S14 H;  1T9H A;  4JI7 L;  1VQO A;  1YZ6 A;  4YY3 L;  3PF4 A;  3CF5 A;  2C35 B;  1WI5 A;  1E3P A;  3GD7 A;  1SLJ A;  2VQE Q;  1Q12 A;  1ASZ A;  1EUJ A;  1QUQ B;  1R9T H;  4HJ7 A;  3U50 C;  1OXV A;  4DR2 Q;  2XTI A;  3CCS A;  2R92 H;  5M3F G;  2K75 A;  4IO9 A;  1PH9 A;  4DR2 L;  3G71 A;  3S15 H;  1HNX Q;  1X55 A;  3HOZ G;  1E24 A;  4A3E H;  4P71 A;  3T1H L;  1M1K C;  4JI4 Q;  1VS0 A;  2LXJ A;  4YCV A;  2KHJ A;  1SR3 A;  5C4X H;  1S40 A;  5GRO A;  3FKI G;  4LFB L;  1QVC A;  1BKB A;  3W5O A;  1L1O B;  3HKZ G;  2K5H A;  2F52 A;  3I56 A;  1VQM A;  1LUZ A;  3IRB A;  4ME3 A;  3PGZ A;  3ULP A;  4JI2 L;  5LMN W;  1KL9 A;  2VNU D;  2I0Q A;  3CCL A;  1YJ9 A;  1HR0 Q;  4BA1 I;  1KC8 C;  2JA6 H;  4DV5 Q;  1X3G A;  3CC7 A;  5C4J H;  3M4Q A;  1BBW A;  2ZM6 Q;  1OXU A;  3B6Y A;  1N32 Q;  2Z6K A;  3S1M H;  2WFW A;  3JAM c;  1VQ4 A;  2ZM6 L;  1Q82 C;  1I5F A;  1Q81 C;  1KIX A;  5IYC H;  1UE7 A;  1EIY B;  5FLM H;  2H5X A;  1GVP A;  4DK3 C;  4KHZ A;  3CMA A;  5IYD G;  4A3K G;  1PH1 A;  2E2I H;  4K0K L;  3CCE A;  1A62 A;  5ELO A;  1IXR A;  2F4V Q;  4JI8 L;  1I94 Q;  1XMQ L;  1VQG A;  3UDF A;  2ATW A;  1U0L A;  3DLL A;  1Q1E A;  2PMZ E;  3HOY G;  3KJP A;  3Q8D A;  4NXM L;  3DM3 A;  4L5S A;  4BY1 G;  4JI1 Q;  4B3M Q;  3LGJ A;  5LMU L;  4X6A H;  4A76 A;  1JJC B;  2KHI A;  1VQB A;  5GQO A;  3PO2 G;  2ZJQ A;  4DUZ Q;  4IPD A;  1CKN B;  2EQS A;  3NEN A;  4DV4 Q;  3CC4 A;  3RN5 A;  2B63 G;  5JJK A;  4P72 A;  2L15 A;  1YI2 A;  4LUO A;  1MKH A;  2F3I A;  2N49 A;  3S24 A;  4LF8 Q;  3GO5 A;  2MNA A;  3PV0 A;  1YNX A;  3G6E A;  1I6H H;  1CSQ A;  3KF6 A;  1TWH H;  1IZ6 A;  4AQY Q;  4HJ8 A;  5M3M H;  1YHA A;  2ES2 A;  1L1O C;  3UDX A;  3H3V H;  2I5L X;  1XPR A;  1SRO A;  4A3J H;  4B3T Q;  4DPG A;  1HZC A;  4UY8 C;  1W2B A;  2PQA B;  4AYB E;  5BR8 L;  3J81 i;  1PHJ A;  1L0W A;  4AIM A;  3EN2 A;  4X64 Q;  3S2D H;  1Y1W H;  4LW1 A;  3UDG A;  4A3B G;  2YTY A;  1YHB A;  1OXT A;  1VQC A;  3CP0 A;  2UUB Q;  4X62 Q;  2Q2U A;  2UUB L;  1OXS C;  1MIU A;  4YWL A;  1KD1 C;  3EIV A;  3S1R H;  4NPS A;  4DV1 L;  1VQ8 A;  4JI6 Q;  2EXD A;  4R4C A;  4RMF A;  1PA6 A;  4JOI A;  1HZB A;  4IFD G;  3U4V A;  3F1Z A;  1N36 L;  3D31 A;  2R6G A;  1S72 A;  4DV0 Q;  1HH2 P;  2Q2I A;  3F2B A;  3TS0 A;  2AMC B;  2VQF L;  4GS3 A;  3PUY A;  2VUM G;  4A3F G;  3CC2 A;  4DV0 L;  2UUA Q;  1WYD A;  1YIJ A;  3CD6 A;  5M3F H;  1K8A C;  1G51 A;  2UUA L;  1LYL A;  3HOZ H;  1VQ5 A;  2I5M X;  1XMO Q;  4PZ7 A;  3WWV A;  4LFC Q;  5JJL A;  2BH8 A;  5DLQ E;  2UU9 L;  1XMO L;  3FKI H;  4LFA Q;  2NVT H;  4GKJ Q;  2IX0 A;  5GAD C;  1FGU A;  2PI2 A;  4GKK Q;  1HZA A;  3L2P A;  5IWA Q;  5AJ3 L;  2YYZ A;  3HKS A;  2HIX A;  4QL5 A;  1ASY A;  5IWA L;  5LMN Q;  1KHI A;  2D0O A;  1YIT A;  2NVQ H;  1U5K A;  1PYS B;  3NEL A;  1WCM G;  2JE6 I;  1Y14 B;  3CME A;  5H1S E;  2Q2T A;  4BBR G;  3KF8 B;  4AYB G;  3KF6 B;  4P74 A;  1N8R C;  1Q86 C;  1FL0 A;  3RLF A;  4A3L H;  3CCM A;  3M4P A;  4GNX C;  4DR7 L;  4A3K H;  1N33 Q;  2R7F A;  5IYD H;  4MNO A;  3U58 A;  3MXN B;  2YU9 H;  3TRZ A;  3KJO A;  4YHH Q;  1N34 L;  1Y1V G;  3S2H H;  4FDB A;  4LF6 Q;  4LF5 Q;  1N33 L;  3J81 j;  3RLO A;  2Q2H A;  3KLW A;  3HOV G;  3RNU A;  3AYH B;  1VQ6 A;  4LF9 Q;  5C0X I;  2UXD L;  2LXK A;  4LWC A;  4L5Q A;  2BA0 A;  1QZG A;  4JI0 Q;  4JI5 Q;  4PZ6 A;  4BY1 H;  4IFD I;  3NEM A;  4HJA A;  1YJW A;  4BY7 H;  2CQO A;  2E2J H;  4JI5 L;  3PO2 H;  4IFD J;  2MO0 A;  1E1O A;  3KDF A;  3PSI A;  3PO3 G;  1B8A A;  1TWF H;  2CWP A;  2QGQ A;  2VQE L;  4C3H H;  1VQN A;  2B63 H;  2YTV A;  3PUZ A;  1UE6 A;  1EWI A;  5M5X H;  4GLX A;  2A1A A;  4IPC A;  1NMG A;  1BVS A;  4IPG A;  4AH6 A;  5FLX c;  4DNI A;  2KEN A;  3OW2 A;  4JBK A;  1HNX L;  4GOP B;  3TRE A;  3EBE A;  4JI4 L;  1H95 A;  3HOX H;  2JA9 A;  3HOU G;  2JEB I;  2A8V A;  3KOJ A;  1YEZ A;  5C44 G;  3AQQ A;  3T1Y Q;  1PH4 A;  5ELN A;  2UUC Q;  3I55 A;  2R7Z G;  1PH5 A;  4HIK A;  1J5E Q;  4DAM A;  5M5Y H;  3CCQ A;  1B70 B;  4APV A;  1FJG Q;  4YCU A;  1PFS A;  1HR0 L;  1JMC A;  1X3F A;  3CPW A;  1IBM Q;  3STB C;  2QA4 A;  4DV5 L;  4HID A;  4A3B H;  3F2C A;  2IT1 A;  1EYG A;  1IBM L;  1GKH A;  2XGT A;  4A3I G;  4TVA B;  1N32 L;  1Z47 A;  1VQJ A;  1W3S A;  1Q8K A;  3PUX A;  4IJL A;  2EIF A;  4A93 H;  4P73 A;  4JYA Q;  1EQQ A;  2ID0 A;  2E5L Q;  3GTL H;  3CCR A;  4GNX A;  3CQZ H;  2VL6 A;  4R4I A;  1EIF A;  2JA7 G;  2F4V L;  1I94 L;  3JAM i;  2KCT A;  5HY6 A;  1X9N A;  4B3S Q;  3M9B A;  2HQL A;  1SN8 A;  2E8G A;  1IBK Q;  4EX5 A;  4PZ8 A;  2ZTD A;  4IOC A;  2VUM H;  4JBW A;  3SGI A;  4A3F H;  1PH8 A;  4A3C G;  2IY5 B;  4B3M L;  4JI1 L;  2ZTC A;  1LTL A;  4RG1 A;  3GDE A;  3FP9 A;  2VW9 A;  1HZ9 A;  4GLV B;  4DUZ L;  1I50 H;  1D7Q A;  1VQA A;  5IYB G;  1M90 C;  4XIG S;  1SFO H;  4DV4 L;  1GO3 E;  4ALP A;  2GVA A;  4A3D G;  4LUZ A;  3KYH C;  3UE0 A;  1YBY A;  1Q1B A;  4GOP C;  2MO1 A;  4LF8 L;  2NVX H;  5C3E G;  1E1T A;  2Y0S E;  1WJJ A;  4R4T A;  5IE8 A;  3K81 C;  1CUK A;  4AQY L;  2KCM A;  4UP9 A;  1KRT A;  1O7I A;  1K0R A;  5IP9 G;  4BXX G;  1WCM H;  1VQ9 A;  1KQS A;  2JEA I;  1VQF A;  4Y7N H;  2OTJ A;  4BBR H;  5FJ8 G;  1LM0 A;  3CPF A;  4B3T L;  5IT9 c;  3I4M H;  4OXP A;  1SRU A;  1A0I A;  1P16 A;  1XTD A;  1XNQ Q;  3KFU A;  2OTL A;  3BJU A;  4X64 L;  1Y1V H;  1NE3 A;  1K8G A;  4YWK A;  4C3J H;  3HOV H;  2WP8 J;  4JI3 Q;  1X6O A;  4KI0 A;  2ZJP A;  1FVI A;  1G29 1;  5JJI A;  3OTO Q;  1IYJ B;  1NTG A;  2R7D A;  1IL2 A;  4A3G G;  4R4Q A;  4X62 L;  5C0X G;  3G48 A;  1UWV A;  2E2H H;  1WFQ A;  2HIV A;  4JI6 L;  5HGQ A;  4OWT B;  3J80 c;  4HIO A;  4DR1 Q;  1L2F A;  4LF7 Q;  1XNR Q;  1A63 A;  1AE3 A;  3RR5 A;  4DV6 Q;  1HNZ Q;  4BBS G;  4DR1 L;  2NN6 I;  1XNR L;  3I2Z A;  5GAG C;  1JJ2 A;  1X3E A;  1HNZ L;  4DR5 Q;  3AEV A;  4DAY B;  3H15 A;  4WJ4 A;  1IBL Q;  2K14 A;  1QUQ A;  2WAQ E;  3RLN A;  4X65 Q;  3TQY A;  4QIW E;  4LFC L;  1XPO A;  3HOU H;  4GKJ L;  3E9I A;  4LFA L;  5C44 H;  3ERS X;  3A5U A;  2N8N A;  2JA5 G;  3I4N G;  2Y0S G;  3UE1 A;  2R7Z H;  3HFZ B;  1TWA H;  4DV2 Q;  3MEF A;  1B7Y B;  5LMN L;  3NBH B;  3PCO B;  1VQE A;  3F2D A;  1JJG A;  4NXN Q;  4H02 A;  1L1O A;  1YVC A;  1VCI A;  1E7Z A;  3BU2 A;  4NXN L;  3CCU A;  1BBU A;  2OWO A;  1E22 A;  1X54 A;  2DGY A;  5IP7 G;  4L5R C;  1XPU A;  2HHH Q;  1AH9 A;  2ALY B;  2BA1 A;  3M4O H;  1GD7 A;  4JBJ A;  4UPA A;  1AE2 A;  1HNW Q;  1XJV A;  1CSP A;  3H0G G;  1PH7 A;  4YHH L;  3GTM H;  5EAY A;  4LF6 L;  2K5V A;  4LF5 L;  2MQH A;  2JA7 H;  3HOY H;  3PF5 A;  1WOC A;  1N9W A;  4KHP Q;  4O0A A;  4JC0 A;  4OON A;  4GN4 B;  1K3R A;  4LF9 L;  2Z6K C;  1Z9F A;  5E7N A;  5C0X J;  3PUV A;  4JI0 L;  4A3C H;  4KHP L;  1GM5 A;  4A4I A;  2UXC Q;  1TWC H;  2N3S A;  4JCV E;  5IYB H;  2OQK A;  3STB D;  4YCW A;  2GVB A;  2MFI A;  3E0E A;  3JC6 6;  4O2D A;  3ULJ A;  1C0A A;  4A3D H;  3ZJY C;  2YV5 A;  3K7U C;  4DR3 Q;  4LUV A;  5GAH C;  4PMW A;  4C2M H;  1VQL A;  1OXX K;  2QEX A;  1PVO A;  4DR3 L;  5C3E H;  1CKN A;  4JI7 Q;  2R93 G;  1JT8 A;  1NY4 A;  3A5Z B;  1K73 C;  2WAQ G;  4YY3 Q;  2JA8 G;  1A8V A;  2KBN A;  4GLA C;  2WB1 E;  3BZK A;  4PG3 A;  5IP9 H;  1PH2 A;  4BXX H;  2ZJR A;  3K80 C;  5FJ8 H;  3T1Y L;  1EQR A;  4NB3 A;  2UUC L;  2IHF A;  1D8L A;  1EOV A;  2K52 A;  4R4O A;  1J5E L;  3ICE A;  1SMX A;  2AHO B;  1FJG L;  1K83 H;  2RF4 A;  3T1H Q;  3CXC A;  1PV4 A;  3TS2 A;  4GKK L;  1CKO A;  1YHQ A;  2PQA A;  1V1Q A;  4LFB Q;  3TEH B;  1X56 A;  4HIM A;  2CWA A;  4MZ9 A;  5J3B A;  4OWW B;  1VQP A;  2RHS B;  3I4O A;  1MJE A;  1G6P A;  4OWX B;  2GN5 A;  3GTP H;  4A3G H;  3FHW A;  5JEA G;  4JI2 Q;  4JYA L;  2OCE A;  2E5L L;  3I4M G;  1PYB A;  2K50 A;  3H3V I;  1QZH A;  1KAW A;  2AWN A;  2N78 A;  1TWG H;  4B3S L;  3CW2 C;  4Y52 H;  3A74 A;  4BBS H;  4OO1 G;  2CKZ B;  1J6Q A;  3CCJ A;  4A3M G;  1IBK L;  4DKA C;  3S1Q H;  1RL2 A;  2NN6 G;  3J7A 5;  1VQD A;  4A3L G;  4HJ5 A;  2NZO A;  4K0K Q;  2ASB A;  3HOW G;  2D62 A;  4JOI C;  4JI8 Q;  1XMQ Q;  4WJ3 M;  2A19 A;  3KDF B;  2RHQ B;  4BA2 I;  2JA5 H;  4NXM Q;  3I4N H;  3GTG H;  1CKM A;  4EQ5 A;  1JE5 A;  4XTC S;  3S1N H;  2LSS A;  5LMU Q;  3RZO H;  4IOA A;  1VQH A;  3AFQ A;  2B29 A;  3K0X A;  2WB1 G;  3PUW A;  2ZTE A;  4BY7 G;  2JJQ A;  4QY7 A;  2UXB Q;  4DUY Q;  4B3R Q;  2UXB L;  4DV7 Q;  1C9O A;  5IP7 H;  4DUY L;  4DK6 C;  2R92 G;  3L0O A;  4B3R L;  1VQI A;  3D0F A;  1KXL A;  4DV7 L;  1XNQ L;  1VQ7 A;  4A3E G;  4YWM A;  3H0G H;  5C4X G;  3J81 c;  4JBM A;  3CCV A;  3G4S A;  3F8T A;  4JI3 L;  4GN5 A;  3HOX G;  1UEB A;  2HT1 A;  1X65 A;  3OTO L;  2K4K A;  5JEA J;  1V43 A;  3U4Z A;  2JK8 A;  4IPH A;  4J15 A;  3K8A A;  5BR8 Q;  5M5W H;  4DV3 Q;  1YJN A;  3W1G A;  1Q7Y C;  1EFW A;  5GAE C;  3PO3 H;  4OO1 I;  2FXQ A;  1MJC A;  4LF7 L;  4DV3 L;  1HR0 W;  2JA6 G;  2K5N A;  1DGS A;  3S17 H;  1NBW A;  4DV6 L;  2RCN A;  3PIP A;  4GNX B;  2D0P A;  2I5H A;  1P8L A;  3OYY A;  4UP8 A;  4L5T A;  3S16 H;  4DR5 L;  3M85 A;  1OTC A;  3GTO H;  3J80 i;  5IYC G;  4MTN A;  1Q46 A;  2VZA A;  5FLM G;  1UE1 A;  1IBL L;  2BH2 A;  2R93 H;  2NZH A;  4DV1 Q;  2B3G A;  4UP7 A;  4A93 G;  1KRS A;  2JA8 H;  3RN2 A;  5IY0 A;  2VY3 A;  4X66 Q;  4LF4 Q;  4X65 L;  1QVF A;  1QVG A;  1N36 Q;  1UE5 A;  3I7F A;  4POG A;  3GTQ H;  3M3Y H;  4LF4 L;  4X66 L;  4DR6 Q;  2VQF Q;  3K7A H;  4GOP A;  4DR6 L;  1S3O A;  1SE8 A;  4C3I H;  3AFP A;  3CAM A;  4DV2 L;  3A0J A;  4QGU A;  2AWO A;  2IHE A;  3E9H A;  3L7Z C;  3RZD H;  1NJI C;  4A3I H;  2UU9 Q;  4QQB X;  2CCZ A;  2DUD A;  1RIP A;  4TQU S;  1HJP A;  1V9P A;  2V1C C;  5AJ3 Q;  2HHH L;  1C7Y A;  2JQO A;  3M7N A;  2OQ0 A;  3HKZ E;  1PH3 A;  4GN3 B;  4KLK A;  4P75 A;  1PH6 A;  4DR4 Q;  2PI2 E;  1HNW L;  3ER0 A;  3UDI A;  2Z0S A;  3VDY A;  4LNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...