3I4MH

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
137
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLETRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
total genus 18
structure length 137
sequence length 146
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mH00
1Z47A 4YWMA 3S1MH 2VUMG 5HGQA 3I2ZA 2UXBQ 1YJ9A 2FXQA 4AYBG 3W1GA 2MO1A 2GN5A 2L15A 3D0FA 4GNXC 2EXDA 2RHQB 1UE6A 1NMGA 2UXBL 3K0XA 3I56A 4A3EG 4GN5A 5DLQE 1YHQA 4XIGS 2UXCQ 3RR5A 4AIMA 4EX5A 1SN8A 3M9BA 1K8GA 4MZ9A 5FLMH 4DV1Q 3M4OH 2HHHQ 4QJFA 4A3KG 3HKZG 1I94Q 2UXCL 1WJJA 3TQYA 3J80i 3UDIA 3S1NH 2A1AA 2CWAA 3KDFB 4DV1L 2HHHL 3AQQA 3ZJYC 1I94L 3H0GG 4YWKA 4A3FG 3S16H 5GROA 2KBNA 4C3HH 4DR6Q 1N33Q 2PI2E 3HOVG 1OXVA 4IOAA 2NN6G 3I55A 3TREA 4DV7Q 1W3SA 2YV5A 1VQCA 3PUXA 1N33L 3CMEA 4DR6L 1ASYA 1JJGA 1W2BA 1X65A 2Y0SE 1PHJA 1R9TH 3G4SA 1VQ6A 4DV7L 3PUYA 1KXLA 1Z9FA 3BJUA 1MJEA 2JA5G 3MXNB 1U0LA 3GTPH 2A8VA 4X64Q 4BA1I 3CCVA 1LYLA 1K83H 3CCMA 5C0XJ 4R4CA 1VQOA 2WAQG 2MNAA 4X64L 1HR0Q 4X6AH 4A3GG 4LF6Q 4LF7L 4UP8A 4YCUA 1HZAA 3J81i 1YVCA 3CMAA 1PVOA 2YTVA 2PNHA 1HR0L 3FP9A 4UPAA 4HIMA 3U58A 4OX9Q 1EQQA 4LF6L 4LF4Q 5IP9H 4JOIA 1L1OC 1JE5A 4DV2Q 3RLNA 1PA6A 4YY3Q 1NY4A 2QEXA 3L0OA 1K8AC 4A3BG 3T1HQ 2JJQA 4BBRG 1HNXL 4OX9L 4A93H 1FVIA 1PH7A 4LF4L 2K75A 1NTGA 3NELA 4PZ6A 4OWXB 3AYHB 2VS1A 4YY3L 4DV2L 3PF5A 3HFZB 2I5MX 3T1HL 1CKOA 3KYHC 1X55A 1WCMH 2C35B 3GTKH 2Q2UA 3KF8B 3HOZG 3RZOH 4JBWA 4TVAB 4IFDJ 1JMCA 3I4NH 3M4QA 3CP0A 4WJ4A 3K80C 3PSIA 2JA6G 1X3FA 2A19A 4BBSH 5GQOA 1ASZA 2JA7G 1UEBA 2ZTEA 1VQ5A 3RN2A 3CCSA 4O2DA 3U4VA 2JEBI 1VQPA 3CQZH 4KHPQ 3HOYH 4GN3B 5LMNQ 2ZJRA 2KHJA 4HJ7A 1Q86C 1HR0W 4JBKA 3M4PA 1Q7YC 2ZJQA 1UE1A 2VUMH 4JC0A 3W5OA 4KHPL 2F3IA 2N78A 5LMNL 4JV5Q 1YZ6A 3L7ZC 4UP9A 1X3EA 3PO2H 1CUKA 1VQNA 2YTYA 1YHBA 3J81j 1DGSA 1RIPA 2YTXA 5C0XG 3K7AH 3GTMH 3K7UC 3CXCA 1S40A 1Y1WG 2GVAA 5FLXc 3ULPA 4POFA 2Q2IA 4A3EH 4JV5L 1K0RA 1KRTA 4JI7Q 5ELOA 4IOCA 2NZHA 4LFBQ 2OCEA 1A62A 2DUDA 2MO0A 1XMQQ 4OO1I 2UUAQ 4A3KH 3KDFA 1K9MC 4JI7L 1I6HH 1WCMG 1VQ4A 4LFBL 3KF6A 1XMQL 2UUAL 4JI6Q 3H3VH 5AJ3Q 2R92H 3HOUG 2VY3A 2WB1E 1K3RA 2PMZE 5FJ8H 2H5XA 3B6YA 3HKSA 3ULJA 4DK6C 2VQEQ 4HIOA 5JEAJ 1XPRA 2Z6KA 3OYYA 1G291 2IT1A 4JBJA 3W1BA 4A3MG 1IBKQ 1XTDA 3MEFA 2D0OA 5AJ3L 3UDXA 1EIYB 2QGQA 4JI6L 4LF5Q 3HOVH 2D0PA 4BBSG 4LFAQ 2VQEL 4IJHA 2OQ0A 4R4OA 4IFDG 1B8AA 1PYSB 4B3RQ 4DUYQ 1IBKL 4LF5L 2E8GA 4ALPA 1KQSA 2VL6A 2UU9Q 4LFAL 5LMNW 2HIVA 2I0QA 4AYBE 1EOVA 1AE2A 3SGIA 4B3RL 5C44H 1Q82C 4DUYL 2UUCQ 3GTGH 4MNOA 2JA5H 5M5YH 1VQKA 2UU9L 4A3DH 1OXSC 2JK8A 4DV4Q 1LTLA 4GS3A 2B29A 3CW2C 2UUCL 3PO2G 1C0AA 3CPFA 3JC66 1PV4A 4WJ3M 1XPOA 3CAMA 2UUBQ 1V1QA 3HKZE 3RLOA 1J6QA 4DV4L 3CC4A 2N8NA 1J5EQ 3PV0A 4A3GH 2K5NA 2UUBL 2GVBA 1X9NA 3HOWG 2AKWB 4Y7NH 3KJPA 3H15A 4QQBX 5IY0A 4A3BH 1J5EL 1TWFH 1VQEA 1JJ2A 4LW1A 4JOIC 2CQOA 1X56A 1HJPA 3PGZA 1WOCA 5ELNA 2R92G 4BBRH 4GKJQ 3PUWA 5FJ8G 1EQRA 4A75A 1Q46A 2CCZA 2IY5B 5JJKA 3F2CA 4IPHA 1PH3A 4JI3Q 4GKJL 1V43A 3S1QH 4GOPB 4OWTB 2YU9H 1VQMA 3S17H 4R4TA 3HOZH 4DR7Q 1NBWA 1L1OB 3G48A 4JI3L 1SRUA 5M3MH 5JEAG 2AMCB 2PQAA 5C4XH 2NVYH 4JI5Q 2JA6H 5IWAQ 4Y52H 4TQUS 4DR7L 1VCIA 5C44G 2KENA 1M90C 2JA7H 2KHIA 5GAGC 2BA1A 1BKBA 2CKZB 5C3EG 2ZTDA 3CCUA 1FJGQ 4A3DG 4JI5L 1U5KA 1HZBA 1E3PA 1L2FA 4MTNA 3M7NA 5IYDH 2WAQE 5IWAL 4A3CG 1FL0A 1M1KC 1PH4A 4LF7Q 3U50C 1FJGL 3AFPA 4IPCA 3STBC 1CSQA 1TWAH 4IPGA 3A5UA 2QA4A 4JCVE 4DR2Q 1QZHA 1N8RC 4L5TA 4C2MH 3M3YH 2KCMA 4LF9Q 3G71A 2VQFQ 3PUVA 5GAEC 1VQ8A 1IXRA 3TS0A 2XGTA 2LXJA 4DR2L 1N36Q 2E2JH 3AFQA 3NENA 3UE0A 1HNXQ 2Q2TA 4LF8Q 1YI2A 4POGA 1JT8A 1QUQB 4LF9L 4KLKA 4FDBA 5C4JH 1CKMA 4P75A 2VQFL 1Y1WH 2IX1A 2HT1A 1VQHA 1MIUA 1N36L 4K0KQ 4LWCA 2R7FA 4LF8L 1Q1BA 3CC7A 4A3LG 1HNWQ 4QGUA 4HJ8A 1IBLQ 3LGJA 3S15H 1S3OA 1TXYA 1X54A 4JI8Q 1IBMQ 4K0KL 4HJAA 3I4OA 1JJCB 1HNWL 3I4MH 1IBLL 1Q12A 3I4NG 2ID0A 3D31A 1XNRQ 3HOUH 4JI8L 4NXMQ 4BXXH 1IBML 5M3MG 5IYBH 4R4IA 5C4XG 2JA9A 2EQSA 2Z6KC 5M3FH 4A3MH 2F4VQ 1X6OA 1XNRL 1L0WA 4NXML 4P72A 4NXNQ 1VQJA 1P16A 1PH1A 2R7ZG 4IJLA 1EUJA 5IYDG 1PH2A 1EYGA 3NEMA 3PIOA 3S24A 2F4VL 3EBEA 2MFIA 4DR3Q 3DM3A 1VQGA 1VQAA 3E9HA 4DK3C 4GKKL 4NXNL 1AH9A 1S72A 2K4KA 4DR5Q 2I5LX 1OXUA 4DR3L 2MQHA 2D62A 1YJNA 5IT9c 4UP7A 1TWCH 2OQKA 1C9OA 1E24A 4C3IH 2NN6I 4X62Q 4DR5L 3GTJH 1EFWA 4APVA 4YCWA 4BY7G 2OTLA 2B63G 4A76A 2BH8A 1GVPA 4X62L 1HH2P 3E0EA 3U4ZA 3F8TA 4DPGA 4HIKA 1NJIC 1GO3E 3ERSX 5IE8A 1JB7A 3HOWH 5M5XH 3OW2A 2K5VA 4A4IA 5IYCH 1E1TA 3CCRA 4P71A 2JA8H 2KCTA 1WFQA 4BY1G 1N34Q 2AWOA 1E22A 3WWVA 3UDGA 4GNXB 3I4MG 4BA2I 3EIVA 4HJ5A 4LUOA 4BXXG 4QIWE 4OONA 5IYBG 3M85A 1N34L 1UE5A 4AH6A 5M3FG 4JBMA 2Q2HA 1KRSA 1TWGH 1SMXA 4DV3Q 2IHEA 2ZJPA 5LMUQ 2R93G 3T1YQ 2RF4A 1YEZA 2AHOB 5M5WH 4DV3L 5JJIA 1RL2A 4GLXA 1IYJB 5IP7H 5LMUL 2N49A 4A3IH 1D7QA 3PCOB 1Y14B 3CCEA 3T1YL 3GO5A 5C3EH 3GTLH 1NMFA 3CCQA 1D8LA 4A3CH 4JI0L 1T9HA 1Y1VG 1SE8A 2B3GA 1YJWA 1HZ9A 3FKIH 4R4QA 2BA0A 3NBHB 1VQFA 3PUZA 4B3SQ 1EWIA 5E7NA 1VQBA 1AE3A 2HIXA 3J80c 4DUZL 1K73C 3STBD 4HJ9A 1SR3A 2AWNA 2DGYA 2E5LQ 4DAYB 3KLWA 3GDEA 1QUQA 1PH6A 4DAMA 4B3SL 3RZDH 3KFUA 1N32Q 4QY7A 5IYCG 2CWPA 1VQLA 1IL2A 2JA8G 1VS0A 2JEAI 3A5ZB 5BR8L 1O7IA 2E5LL 4O0AA 2RCNA 4GLVB 1N32L 1MJCA 4HIDA 4JYAQ 3OTOQ 1PH9A 1UWVA 4A3LH 4X66Q 3ER0A 4P73A 2ZM6L 3CPWA 4DV6Q 1Q8KA 4AQYQ 1N9WA 3J7ZC 4LFCQ 3PF4A 1A63A 2YYZA 4YCVA 1OTCA 3I7FA 4JYAL 4GLAC 2VW9A 3OTOL 4DV0Q 2NVQH 4X66L 4DV6L 1QZGA 4OXPA 5GAHC 4AQYL 5HY6A 4LFCL 1UE7A 5C0XI 4RMFA 4XTCS 1GM5A 3KOJA 1QVFA 3RN5A 2CFMA 4DV0L 4KI0A 3S14H 3HOXG 1BBWA 3TS2A 5IP7G 4A3IG 2Z0SA 4C3JH 4GN4B 2R7ZH 4L5RC 2HQLA 1YNXA 1CKNB 3GD7A 3TRZA 3S2DH 3AEVA 3KF6B 1NE3A 4A3JH 1YIJA 1C7YA 3FKIG 1XJVA 2ASBA 3J81c 1VQDA 3RLFA 4PZ7A 1KD1C 3GTQH 3CCLA 3J7A5 3EN2A 1VQ9A 1E1OA 2WP8J 3DLLA 4ME3A 3UDFA 4IFDI 4X65Q 1XPUA 1SROA 2B63H 3CC2A 4JI2Q 4BY7H 3ICEA 4OO1G 2LSSA 1HZCA 4DR1Q 3IRBA 2IHFA 3K81C 1SFOH 3A74A 3K8AA 4J15A 2Y0SG 1PFSA 3BZKA 2R6GA 4X65L 4OWWB 1I50H 4IPDA 4JI2L 1PH5A 1KAWA 2IX0A 4B3MQ 4GNXA 4DR1L 2ALYB 4NB3A 4BY1H 2XTIA 2ATWA 2JQOA 1LM0A 3E9IA 4IO9A 1XMOQ 4B3ML 2WFWA 2K5HA 1G51A 4LUVA 5H1SE 5FLMG 1A0IA 1WI5A 2EIFA 4LUZA 2ZTCA 4DNIA 1B70B 2F52A 4PZ8A 4GOPC 4PG3A 1XMOL 2NVTH 4GKKQ 1YITA 1GKHA 2V1CC 1EIFA 3CF5A 3RNUA 3CD6A 2R93H 3GTOH 4A3JG 1VQ7A 3S2HH 1G6PA 3UE1A 2K50A 3F2BA 1KHIA 1IZ6A 1PH8A 3H3VI 3JAMc 3L2PA 4EQ5A 1FGUA 3PO3H 5GADC 3A0JA 1KIXA 4JG2A 5J3BA 2UXDQ 1Q81C 2OWOA 4LNQA 1Y1VH 1KC8C 4DR4Q 4PMWA 1B7YB 4P74A 1P8LA 2PQAB 4R1JA 4RG1A 3ULLA 2UXDL 4L5QA 4DR4L 1E7ZA 2JE6I 1Q1EA 1QVGA 1XNQQ 2E2HH 2R7DA 3VDYA 3F2DA 1BBUA 4DKAC 1GD7A 2NZOA 1KL9A 2RHSB 3F1ZA 3BZCA 1YHAA 1XNQL 3PIPA 2N3SA 1OXXK 3KJOA 4QL5A 1QVCA 1YBYA 4B3TQ 4GOPA 1PYBA 3FHWA 3JAMi 4YHHQ 1L1OA 4KHZA 5IP9G 4B3TL 2K14A 1CSPA 2VNUD 4A93G 4YHHL 5JJLA 2PI2A 5EAYA 3HOXH 2LXKA 1VQIA 4DV5Q 1MKHA 4JI0Q 1CKNA 2I5HA 3PO3G 3CCJA 2E2IH 1I3QH 4DV5L 4NPSA 1BVSA 4DUZQ 4JI4Q 3H0GH 4A3FH 3S1RH 2BH2A 1OXTA 2VZAA 1TWHH 1V9PA 3BU2A 4YWLA 4L5SA 1I5FA 4JI4L 3G6EA 1SLJA 2WB1G 1HNZQ 2NVXH 1H95A 1A8VA 2ES2A 5BR8Q 2K52A 4JI1Q 3TEHB 2OTJA 1LUZA 3Q8DA 1HNZL 1X3GA 4H02A 3HOYG 1WYDA 4JI1L 2ZM6Q 5K36G 4UY8C
chains in the Genus database with same CATH superfamily
3S1MH 1I6HB 1ENAA 4AYBG 5ISRA 2MO1A 3TSSA 2I46A 3N52A 4GNXC 2JXMB 3LNNA 4A3EG 1TVXA 5DLQE 4XIGS 2LFNA 3A7AB 4AIMA 3M9BA 1WD0A 4DV1Q 3M4OH 3HKZG 5JVG3 2F0MA 1WJJA 3TQYA 3J80i 3UDIA 3S1NH 1E2VA 2A1AA 3K57A 3ZJYC 1I94L 3H0GG 3K5NA 2WIIB 1U4MA 1N33Q 3BDOA 3TREA 2KUMA 2YV5A 4DR6L 3PUXA 1LV9A 3KLSA 4P2CB 1ASYA 4A3GB 3G4SA 1VQ6A 4CBVA 3D3RA 2B2YA 1A2TA 3QOLA 3JAME 4X64Q 3C3LA 2L4NA 1ICFB 2OEOA 1ILPA 1TR5A 4R4CA 1VQOA 2WAQG 3M4YA 4YCUA 1PVOA 1U4LA 3FP9A 5CORA 4HIMA 1V1PA 2PQEA 1F77A 4RHRA 5EJWA 1JE5A 3RD4A 3RLNA 4HAEA 1EY0A 1SJED 1K8AC 2JA6B 4OX9L 3PF5A 4PZ6A 3AYHB 2VS1A 4L63B 2I5MX 3GTKH 1CKOA 1F9RA 5LL6S 2Q2UA 3KF8B 2F3WA 5CYUA 3RZOH 4TVAB 2MHVA 4KV6A 1X3FA 4DNRB 5GQOA 1W6KA 1LT6D 3RN2A 3U4VA 1WTVA 3EA6A 1EY5A 2ZJRA 3T56B 2VXWA 3MXPA 1HR0W 3M4PA 1Q7YC 4KHPL 1YZ6A 1CUKA 2YTYA 3I73A 1DGSA 2YTXA 1SNMA 5JPNC 1S5DD 2A5HA 4A3EH 5C4HA 2A73B 2NZHA 3OMCA 3KDFA 3ZYYX 4JI7L 1WCMG 2DJFC 1VQ4A 4LFBL 5KNBA 2F0EA 1EWCA 1XMQL 2UUAL 4JI6Q 4E6IA 1U4PA 5AJ3Q 1MGSA 2ENBA 2WB1E 3B6YA 3HKSA 3ULJA 4DK6C 4JBJA 4KD3A 3TP8A 1IBKQ 2NBFA 4LF5Q 2F0DA 3MFYA 5EBCA 1I4RA 4IJHA 4R4OA 1ET6A 4B3RQ 4DUYQ 3R3OA 3A8IE 1BDOA 1KQSA 1LACA 2UU9Q 4FNFA 2HIVA 4AYBE 3HOWB 1AE2A 2KEEA 4MNOA 4IZ8A 2B2YC 3MXUA 3CW2C 2UUCL 3PO2G 1PV4A 2UUBQ 2N55A 3HKZE 1K3BC 2F0TA 1NCVA 1CI3M 5KRUA 2GVBA 1TWGB 2AKWB 4MIUA 4Y7NH 2M9VA 1MBYA 5KGUA 3H09A 5M5WB 1LTSD 2I07B 1QE6A 1WOCA 5ELNA 5C44B 2R92G 4GKJQ 2Z9HA 1EQRA 3NUCA 4M1UB 3GTLB 3F2CA 4XT1B 2DY7A 3D4RA 2LY7A 3S1QH 4OWTB 4DR7Q 4JI3L 1SRUA 2K7VA 2AMCB 5C4XH 4WORA 3EFXD 1PZJD 1VCIA 1ZXTA 3RZDB 5GAGC 1BKBA 1TWFB 1E2WA 1E3PA 1L2FA 3NBIA 4MTNA 2WAQE 4RKLA 2KHSA 2PO4A 1PH4A 3C1EA 2EPBA 2AUKA 4IPCA 3STBC 1C8CA 3T4AC 4QCLA 1TWAH 1N8RC 3H94A 5I9PA 4C2MH 4LF9Q 3G71A 3H3VC 1VQ8A 1IXRA 3TS0A 4TSSA 1S4ZA 2NTTA 2XGTA 3OPOA 2RBMA 3V96A 1N36Q 4A3BG 4G7OC 1JT8A 4KLKA 4FDBA 2NVYB 1CKMA 4P75A 5K5PA 2HT1A 1SNCA 4J1MA 4LWCA 5NUCA 4C3JB 1Q1BA 4A3LG 2XRQD 4HJ8A 3IL8A 2HDLA 4JI8Q 3S2DB 4K0KL 4A3JB 1FNVA 3I4MH 2A6ED 1MSHA 3L9AX 2ID0A 4BXXH 5A2QE 3GTQB 1FNUA 5M3MG 2MP1A 3LWUA 5IYBH 2L9HA 1XTCD 2E2JB 1L0WA 2BDNA 1PH1A 4DF7A 1PH2A 4RA8A 3NEMA 3PIOA 2F4VL 4DK3C 1D5MC 4IURA 1I50B 2D5DA 1S5CD 2ICEC 2K4KA 4DR5Q 3QR8A 1WTXA 4DR3L 3I91A 2MQHA 2D62A 5IT9c 4UP7A 3BVGA 1TWCH 1E0BA 4IUVA 3GQBA 4YCWA 5BN5A 4FXGC 2RCFA 4DPGA 5AFWA 3I4LA 1BCPD 1STYA 2K5VA 3NTKA 1Q8IA 4CKEA 3NTHA 2R93B 1WFQA 4BY1G 2AWOA 5I4DA 3UDGA 4BA2I 4GNXB 2EDGA 3R2IA 1SNQA 4TRDA 5KYLA 1H9SB 1EY9A 1UE5A 5M3FG 1KLGD 3SHLA 4C3IB 1EL0A 1Y1VB 1FD7D 4B9XA 1SMXA 4DV3Q 2HQEA 1S5BD 3R8BA 3J7YW 3V2TA 2F0SA 2IPKD 3T1YQ 2AHOB 4V190 5JJIA 3MHBA 2LS01 2B2WC 4A3IH 1PMRA 2EVBA 1Y14B 3SK8A 3CCEA 2JA8B 1D8LA 1HCZA 3BVMA 1V8QA 4JI0L 2DNCA 4KJNA 2BA0A 3J80c 2AWNA 2E5LQ 4DAYB 1QUQA 4MN3A 5D14A 1VQLA 4IUNA 5BR8L 3M7GA 1ESRA 3BDLA 3HKZB 2EOTA 5HURA 3SR1A 4A3LH 4X66Q 3CPWA 1I3QB 3J7ZC 3WOEA 2KCCA 1SNDA 4GLAC 3S1RB 4JYAL 2NVQH 3FKIB 1QZGA 1TWHB 4OXPA 5GAHC 4AQYL 4XTCS 2D9UA 1EOTA 4KI0A 3TP6A 4RKBA 2Q8IB 1LTRD 3DWQA 2HQLA 1CKNB 1F2MA 1K0SA 3I70A 1QOHA 1NE3A 3KF6B 1VQDA 4PZ7A 2OF1A 1EZ6A 2MPMA 5BN4A 1CZGA 3EN2A 3VA7A 1E1OA 5G3LF 4IFDI 4X65Q 3CC2A 3S14B 3F2UA 3AU7A 3IRBA 3K8AA 2Y0SG 1PFSA 3BZKA 2R6GA 5EKKA 3X3MA 5F2DA 1PH5A 1I4QA 1TS4A 3CHBD 5LHY1 2ALYB 4BY1H 2M00A 1PRTD 1BBXC 1RDPD 4QB4A 2CH4A 1XMOQ 2WFWA 4N9PA 2SDFA 5FLXE 4LUZA 2ZTCA 4DNIA 2Z6BA 1DD2A 4B9WA 1EIFA 2K50A 2X6GA 2CQAA 4C3HG 2B2VA 3HS0C 4OGQC 3GTPB 3L2PA 5EPKA 3U9OA 3VR6A 1EYAA 3A0JA 1KIXA 4JG2A 5J3BA 2NYZD 1KC8C 4DU9A 5T1GA 4C1NK 4R1JA 4J8QA 4R9WA 1CHPD 1Q1EA 2R7DA 3VDYA 3F2DA 1BBUA 3GTOB 4DXGA 4ABNA 2H4OA 2N3SA 1OXXK 1B2TA 4QL5A 4KMUC 1QVCA 1WCMB 3A54A 4CDFC 2BDOA 3FHWA 1L0YB 3J80E 2CVRA 4B3TL 1V1PB 1CSPA 4A93G 4KHVA 1SYCA 1MD2D 2LXKA 3E0JA 3SK4A 5CBAE 2PCFB 4ILWA 5JOBA 3CQZB 1O7YA 3CCJA 1BNZA 2E2IH 1PFMA 3TN2A 1KNAA 2Q8RE 1ZYRD 4K8JA 1EU3A 4L5SA 1I5FA 3G6EA 2EZVA 2A68D 4JVZA 2K52A 3TEHB 2OTJA 3QG1A 2RKSA 5CV6A 3Q8DA 4CDCC 5KEEA 1MSGA 2SOBA 5K36G 4A3KB 3SXHA 4YWMA 4XDXA 2UXBQ 3D0FA 2L15A 2R92B 4A3FB 1UE6A 4HR7B 1NMGA 2TSSA 5FO9B 3I56A 2UXCQ 3RR5A 4EX5A 2AQ2B 1K8GA 2NVXB 4MZ9A 2HHHQ 4OEMB 1BR9A 4K14A 3A55A 4ULLA 2ZXOA 2CWAA 3KDFB 2WACA 1BQQT 4KKSA 5GROA 3S16H 3MC0B 4C3HH 1SXTA 2B2VC 3OMGA 3HOVG 2NN6G 1EZ8A 3K0YA 3CMEA 1C48A 2Y0SE 3V05A 4DV7L 3PUYA 5E1FA 3BJUA 1SYDA 1D5XC 2JA5G 1NAPA 4ME5A 4ZCKA 5C6AA 3BS1A 1QWYA 3BYYB 5EGTA 4BA1I 2E76C 1LYLA 4BBRB 4DAPA 1K83H 1SDFA 1A6XA 2MNAA 3E5SA 2YU9B 3S17B 4UP8A 1HZAA 4IUPA 2YTVA 4NP5A 4C1NI 1HR0L 4I7ZC 5M3MB 5C0XH 4LF6L 3KLRA 4GZYC 5FK9C 4CKCA 4YY3Q 1NY4A 2OT2A 2QEXA 1SYBA 3T1HQ 2JA7B 4A93H 1FVIA 4LF4L 1STEA 4DV2L 4OWXB 3BYTB 1W6JA 3KYHC 1X55A 4C56C 2C35B 5I6WA 3HOZG 1KDAA 1A3UA 3P1HA 4KN4C 4RH6A 2EYFA 3M4QA 3M3YB 4WJ4A 1DONA 1O7ZA 4IUTA 4K2KA 2A19A 1IKMA 4DAYA 1I4PA 2ZTEA 3CCSA 4O2DA 3OOCA 2JEBI 4H0LC 4H13C 5LMNQ 4DFAA 2KHJA 4HJ7A 5K36H 4JBKA 2CHBD 3S15B 1F9SA 2N78A 3I8ZA 4RHSA 1OO9B 3L7ZC 4UP9A 1X3EA 1VQNA 4XYOA 3KBGA 3I4NB 5DEHA 3K7UC 1Y1WG 4JV5L 4BBSB 2GA4B 5ELOA 4IOCA 1X32A 2OCEA 4OO1I 4FYDA 2BOSA 2R61A 1D1IA 2A6EC 3KF6A 1AFPA 3HOUG 2VY3A 1K3RA 2PMZE 3W1BA 2EE1A 4A3MG 3MEFA 2NUCA 2D0OA 3HOVH 2D0PA 4LFAQ 2VQEL 2OQ0A 1ONLA 5JEAH 4K6DA 5CR3A 3ITPA 4XYQA 1EY6A 3MXNA 1A15A 4N8X1 3SGIA 5C44H 1Q82C 4HMIA 2JA5H 5M5YH 1GUGA 4A3DH 3J81E 1OXSC 2JK8A 4CKBA 4GS3A 2B29A 1C0AA 5JPMC 3CPFA 4DN4M 4O1NA 4X3KA 3CAMA 2RDGA 1V1QA 1XPOA 2G9HD 3HEJA 3U9SA 3RLOA 1J6QA 1BCPC 4DV4L 1J5EQ 2HD3A 3PV0A 1AEXA 5IY0A 1HFNA 1TWFH 1SMYD 4G7HC 1JJ2A 4LW1A 1HJPA 5KYIA 1RKNA 3GTGB 4A75A 1KDCA 1PTOD 5JJKA 1Y8OB 1PH3A 2G9DA 4DK1A 2EYLA 5ELEA 3HOZH 2AQ3B 1NBWA 1L1OB 3G7LA 4KKUA 2A6HD 3FEWX 2NVYH 4JI5Q 1Z6HA 3C46A 2KENA 3UI2A 4CJ2C 5C3EG 3MVVA 1U5KA 5CGKA 5IWAL 1FL0A 4JK1C 3ONAB 5C3XA 1JQYD 1TY0A 3DHQA 1FJGL 3AFPA 4PNYA 3GV6A 5IODA 1STNA 1E2ZA 4LK1C 4HCSA 5GAEC 2LXJA 4DR2L 2E2JH 3AFQA 3UE0A 4LF8Q 1YI2A 1QUQB 2VQFL 5C4JH 4LAAA 2C5CA 1Y1WH 1VQHA 1SEBD 3X3NA 2VB2X 1IBLQ 3LGJA 1IBMQ 4HJAA 3I4OA 2F0IA 4CJ1B 4DAVA 1HNWL 5I2XA 3D4DA 1Q12A 3HOUH 5ELFA 3NXWA 4TKOB 1RODA 5C4XG 2L1BA 3GV3A 1T5XD 1X6OA 4A3MH 1XNRL 4QUFA 4NXML 2R7ZG 4NXNQ 1P16A 1SE4A 3MWYW 4BY7B 2B63B 1WTHA 4R8NA 1VQAA 3E9HA 1AH9A 1S72A 2I5LX 4PQXA 1OXUA 1HXYD 3DEOA 1RHPA 4C3IH 3P7JA 3AB9A 2OTLA 4A76A 4X62L 1EY8A 4F7XA 1NJIC 5IE8A 1JB7A 5M5XH 3OW2A 1SAPA 1PRTC 2B8FA 2JA8H 2KCTA 1N34Q 3I4MG 2K05A 1DOLA 3VYUA 4BXXG 4QIWE 5IYBG 3M85A 4HSVA 1SE3A 2PW5A 2WKDA 3HP3A 4JBMA 1KRSA 1D5ZC 3FRPB 2Q8TA 3OHXC 2L0CA 2RF4A 1YEZA 3Q23A 4FP5D 4ODGA 5LMUL 3PCOB 5C3EH 2F0VA 2HDMA 1CM9A 1T9HA 1NNXA 1VMCA 2B3GA 3FKIH 3BZDB 3WOFA 3PUZA 3IAYA 3SE0A 1TS5A 3Q6SA 4HJ9A 4B3SL 1C4QA 1N32Q 3URYA 4K8IA 1IL2A 1VS0A 1STHA 4O0AA 3HOXB 1ENFA 3OTOQ 4DV6Q 3ER0A 4P73A 2KA7A 1NSNS 3PF4A 2FJ2A 2ZT9C 3H6MA 1DM0B 1LT5D 4F88A 3QJYA 4DV0Q 1GUSA 4LFCL 1QVFA 2K04A 3G6JB 3S14H 2B2WA 1RD9D 4IUUA 4OL7A 4A3IG 1F2LA 1HTLD 5ELCA 2Z0SA 2CH4W 2R7ZH 4L5RC 1YNXA 1ZYRC 5J22A 4ZKBB 2HUGA 3TRZA 2K5DA 3S1MB 1XJVA 3RLFA 2A68C 4ZKCB 2M2LA 1MI2A 1JC7A 1Y69U 2CW0D 1WVLA 2WP8J 4EVOA 3FMCA 3UDFA 1WTRA 4CDDC 1L0XB 1O78A 3M4OB 2IHFA 3K81C 3S1NB 5CC4A 4OWWB 4JI2L 2K1BA 1KAWA 2F0KA 4DR1L 3HRZC 2JQOA 3NQIA 4B3ML 5H1SE 2EY1A 1TT2A 2EIFA 1B70B 5IGDA 2A69D 3NWTA 4GKKQ 5KNDA 2V1CC 3RNUA 3GTOH 3S2HH 1VMPA 3UE1A 3NQTA 1SYGA 3H3VI 2EJMA 1PH8A 4EQ5A 3IFTA 1FGUA 3PO3H 4V0BA 3P20A 2UXDQ 2XWJB 1Q81C 3TZUA 4DR4Q 4PMWA 4ZYSA 1P8LA 1AW7A 5IIFA 2NVTB 1QVGA 1XNQQ 2E2HH 1XYIA 5A2QL 2F0QA 2ZXRA 1GD7A 1HPCA 2NZOA 1HRJA 3GTKB 3KJOA 1BCPB 1Y8NB 4X3UA 3T53B 3MXGA 3JAMi 3D6WA 4YHHQ 1L1OA 1GJXA 2K14A 2K01A 2SNMA 2VNUD 5EKLA 2WB1B 4QIWB 5JJLA 4ZUJA 4DV5Q 4KN7C 4Q5VA 4J6HA 2DY8A 2I5HA 4FO2A 4N8FA 3SDZA 1UAPA 3RUZA 4OELB 1BVSA 4DUZQ 4NW2A 4ZUIA 4A3FH 5I6YA 2NWGA 1STGA 3BU2A 3VYSA 1JWSD 4AYBB 1H9KA 4H44C 4JI4L 2NVXH 1A8VA 4JI1Q 1S5FD 1ICWA 4A3EB 1ZKOA 1HNZL 1X3GA 3DUZA 3OWEB 3HOYG 2P5ZX 2ZM6Q 3O13A 3DMUA 1KTKA 1FR3A 1Z47A 2X6LA 2VUMG 2R3ZA 1BF4A 1YJ9A 2FXQA 3H0GB 2F03A 1G8ZD 2RHQB 2F0NA 4DGZA 3K0XA 4GN5A 1SN8A 2VB3X 1IKLA 1I94Q 3VR4A 2J7ZA 2KVMA 4N9TA 1VF5C 4DV1L 2RQXA 1PLFA 2PYKA 2D2CC 4YWKA 1UUPA 1DZ1A 1HTPA 4DR6Q 1DYQA 2PNRC 2JSOA 1OXVA 3D6CA 3I55A 3CKIB 1W3SA 1VQCA 5CV9A 1N33L 2WAQB 4OIKA 1W2BA 2F0PA 3EQLC 4Y7NB 1KXLA 1ML0D 4U673 3MXNB 3NE5B 1U0LA 2QCPX 5E3FA 5IT9E 3PMFA 1STAA 4PV1C 5C0XJ 1SE2A 4X64L 1GHJA 4A3GG 3S1QB 2L12A 3CU7A 3CRLC 4I7AA 1SMYC 1YVCA 1JWMD 2IY5B 3U58A 4OX9Q 3K59A 1L1OC 1PRTB 1PA6A 1R9TB 2F0OA 1D2BA 1PTOC 1EU4A 2JJQA 4KTAA 4ZAIA 5IGGA 1PH7A 2K75A 2RSNA 5J1ZA 4XQJA 4X3SA 5G3LD 1IW7D 2A6HC 4JBWA 1TWAB 2J4XA 2C9OA 1JMCA 3TMEA 3I4NH 3CP0A 3K80C 4FF3A 1QILA 3PSIA 2JA6G 4BBSH 1ASZA 1B53A 1VQ5A 2F0WA 4IFDH 2FFKB 1QNUA 1VQPA 3CRKC 1F9QA 4KHPQ 5CV8A 4HN7A 4GN3B 3TZDA 3HOYH 5FLXL 4ID6A 1GXDC 2PZUA 4LJZC 3IKJA 5CV5A 2VUMH 1TKWB 3W5OA 3I4MB 1YHBA 3J81j 1ET9A 1RIPA 5C0XG 3K7AH 3CXCA 1S40A 3ULPA 2MGSA 4POFA 2Q2IA 1F2YA 5D65A 1K0RA 2XVSA 1KRTA 4JI7Q 4LFBQ 4DA2A 2DUDA 2MO0A 1XMQQ 2UUAQ 2O2LD 1K9MC 3FPUB 1I6HH 1GOZA 3NWSA 1CFMA 5I2YA 1BOSA 1ZEQX 1R4QB 5FJ8H 2H5XA 2F3VA 4OIJA 1XPRA 5JEAJ 3OYYA 1G291 1TWCB 4RCOA 4JI6L 3QOJA 3D8GA 5AJ3L 3PO2B 3A8JE 3KLSX 3GTMB 2IW3A 5C3WA 1IBKL 4LF5L 4ALPA 1K28A 3C1FA 4NKLA 5LMNW 4K2LA 4B3RL 4G4KA 4FXDA 2UUCQ 2KEDA 4DUYL 3GTGH 5CV4A 2UU9L 1LTLA 1X3QA 2LMCB 4WJ3M 1NR2A 1IYVA 3CC4A 1I6VC 2N8NA 4A3GH 2K5NA 4ZQ3A 2UUBL 1X9NA 1JOKA 3HOWG 3OSOA 3KJPA 3H15A 4QQBX 1VQEA 1XX8A 2CQOA 1X56A 1V1OA 1H9MA 1EEID 3SEBA 3PUWA 1LTGD 2CCZA 1U9RA 3GP7A 2B8GA 1A3TA 4IPHA 5COYA 4JI3Q 1G91A 4RGOS 4GKJL 1V43A 5T1IA 5D3IB 3K5LA 3MFGA 3G48A 5JEAG 1LTAD 2JA6H 2AUJD 4TQUS 4DR7L 5C44G 4RCNA 2QDBA 4A3BB 2EYPA 4A3DG 5IYDH 1HZBA 3M7NA 4A3CG 2KECA 4EQNA 4LF7Q 3U50C 4JPBW 3K58A 2QA4A 1QZHA 4JCVE 1I4GA 2KCMA 2B2TA 2K03A 3PUVA 2NVQB 1HNXQ 2Q2TA 2KJXA 4POGA 2G5DA 4LF9L 2IX1A 3HZXA 2FHTA 3NP8A 5I9OA 1JWUD 1N36L 4K0KQ 2R7FA 3CC7A 1ENCA 4QGUA 4NMZA 1DJRD 2F0HA 2RDHA 1S3OA 1X54A 2QF7A 4KK7A 2RVLA 4JI8L 1EYDA 4R4IA 3W3AA 1LT3D 2EQSA 2F4VQ 4C3JG 1EY7A 4P72A 1O7LA 1STBA 1EUJA 1ILQA 1CTMA 3EBEA 4DR3Q 3DM3A 1VQGA 4GKKL 5J39A 1NUCA 2CW0C 3T51B 2QILA 2XWBB 1PYWD 2FMMA 1RF2D 4UHVA 4BY1B 5DNFA 1E24A 1CA5A 3DEPA 2NN6I 4DR5L 1EY4A 1RTNA 2JN4A 3IFDA 4ZLTF 4XQNA 5ELDA 5M3FB 3E0EA 3U4ZA 4HIKA 1JB3A 2B2UA 1J8IA 3HOWH 1S5ED 5IYCH 2F0UA 1E22A 1DXMA 3WWVA 2X69A 4HJ5A 5JVH3 1XXGA 2EY2A 2A69C 1G2TA 3TP5A 3PIP3 2DJGC 5E4XA 3GTJB 1TWGH 2IHEA 3VR5A 2ZJPA 2R93G 5M9OA 5M5WH 4KJOA 4DV3L 1RL2A 4GLXA 5IP7H 3T1YL 3GO5A 3GTLH 3QB3A 2EXZA 1NMFA 2F0FA 4IALA 3CCQA 4A3CH 4C3IG 1Y1VG 1HZ9A 3I72A 4R4QA 4R8IA 3NBHB 3K5OA 1EWIA 1PTOF 2HIXA 1AE3A 5E7NA 4DUZL 1K73C 1SR3A 2DGYA 2XRSD 3KLWA 1ESFA 2B2TC 4DAMA 5L37A 3RZDH 4G57A 2JA8G 1QNKA 1I4HA 3H91A 3NHHA 2E5LL 4OO1H 5LL6X 4GLVB 1PXUA 4JYAQ 4HIDA 1QCBD 1UWVA 2ZM6L 4AQYQ 1DOMA 2E2IB 2YYZA 4NDXA 3I7FA 4BWGB 1M4VA 1MHWC 1IYUA 2VW9A 1JOQA 4X66L 1HA6A 5HGTA 1UE7A 1PTOB 3J81L 2L11A 2XN9C 5FKAC 1SNOA 3TS2A 4C3JH 4GN4B 2XIWA 1PZKD 3EROA 4K5WA 3GD7A 3S2DH 4A3JH 2RA4A 1C7YA 2ASBA 2Y0SB 3FKIG 4G7ZC 3GTQH 2EYJA 1PFNA 1CA6A 2NZ1D 1VQ9A 2JYOA 4I65A 3DLLA 4ME3A 4EQPA 1XPUA 1SROA 1SYFA 1HZCA 2HCIA 2B2UC 4EQOA 1JCKB 4X65L 1I50H 4IPDA 1AN8A 2IX0A 1H9JA 4NB3A 3S16B 2XTIA 1SBBB 2ATWA 1LM0A 3E9IA 4C3HB 4IO9A 4IN3A 2K5HA 1G51A 1VDZA 4LUVA 5FLMG 3I90A 3JAML 4GOPC 2F52A 1PDQA 4PG3A 1XMOL 3DM1A 2NVTH 1YITA 1GKHA 4IUQA 3CD6A 2R93H 1EIGA 1SFOB 1VQ7A 1IL8A 4HCEA 1WTQA 2K33A 3F2BA 1KHIA 3BDCA 1EEFD 1K83B 4JW0A 1TU2B 3K5MA 3SK6A 5IGCA 2OWOA 4LNQA 1Y1VH 4DNTB 2ICIA 5CBEE 2PW7A 2PQAB 4RG1A 3LX0A 4FF2A 4L5QA 2Z8LA 4K5VA 1RCVD 1B9NA 2JE6I 2RSOA 2NTSA 1RTOA 4A93B 1KL9A 2XNAC 1YHAA 4DK0A 1CZWA 5IGEA 3I3CA 1B4OA 1YBYA 4B3TQ 1K8OA 3E6ZX 1PYBA 2RDFA 1EQTA 5IP9G 1F9PA 3MZ5A 1O80A 2PMZB 2KQ3A 1AZPA 1A2UA 5EAYA 3EVQA 1IW7C 1HA5A 2WINB 2E75C 2V4DA 3PO3G 1I3QH 4NPSA 3KBXA 1EIHA 3H0GH 4YIJA 3S1RH 2BH2A 2VZAA 4XXEA 1TWHH 1V9PA 4OHJA 4KY6A 3HG9A 4Q0FA 2ES2A 2BE5D 2HCCA 4H02A 1F2ZA 3AMUA 4UY8C 2EJGC 1Q90A 1YNJD 5HGQA 3I2ZA 4U68A 3W1GA 2AQ1B 2GN5A 4RAUC 2B39A 2EXDA 4HEDA 2UXBL 2NB0A 1LTID 1YHQA 1B1ZA 2JP1A 3DXJC 3HOVB 5FLMH 4QJFA 4A3KG 2UXCL 5CMDA 4S3SA 2HHHL 2EYOA 3AQQA 1XWEA 1WD1A 4A3FG 2JA5B 5M5YB 4A3DB 4XQQA 2KBNA 2PI2E 3NPPA 5IGFA 5DM63 4IOAA 1HHVA 2IX3A 1II3A 4DV7Q 3T13A 1CHQD 1JJGA 1SYEA 2OXPA 1X65A 1PHJA 1KABA 1R9TH 2O5IC 1KNEA 4F87A 1Z9FA 1MJEA 5C5MA 2EYMA 3E3XA 3GTPH 5KNCA 2A8VA 3CCVA 1YNND 3MAQA 3CCMA 4X6AH 1HQMC 1HR0Q 4LF6Q 4LF7L 1K8MA 3J81i 3HOZB 3CMAA 2PNHA 4UPAA 1EQQA 4LF4Q 5IP9H 4JOIA 4DV2Q 2WKCA 3L0OA 4BBRG 2BCOA 1HNXL 1GUNA 1SNPA 1NTGA 3NELA 2F0GA 4YY3L 1TS3A 3HFZB 3S9WA 1B44D 1BCPF 1WTOA 3T1HL 1B3AA 4Z9CB 1WCMH 1TQOA 3OIPA 5D3DA 5EPJA 4B08A 2E2DC 4K6LA 3NBHA 2PZWA 4IFDJ 2IL8A 2PZTA 4IQZA 2JA7G 1UEBA 2Z4HA 1BUVT 2WV6D 3Q0AA 5C4JB 1Y1WB 5C4ZA 3CQZH 2FINB 1LABA 3PIO3 1Q86C 2ZJQA 1UE1A 2K5QA 2J0TD 4JC0A 2F3IA 3VR3A 5LMNL 4JV5Q 3RZOB 3PO2H 3HOUB 2K5WA 4QUCA 1HFGA 3GTMH 2GVAA 5IOCA 5FLXc 4A3MB 2QKIC 4X3TA 1B3QA 1A62A 2TMPA 1DOKA 4A3KH 2EY5A 3QIAA 3J7AV 1HUMA 1WTWA 1UNSA 4MTKA 3H3VH 2R92H 2EJFC 1EYCA 4FXKC 2VQEQ 3I4NG 4HIOA 2Z1CA 3NSWA 2Z6KA 2IT1A 1LTTD 1XTDA 4BBSG 3UDXA 4KD4A 2QGQA 1EIYB 3P75A 4IFDG 1B8AA 1PYSB 1CK1A 2E8GA 3ND8A 2VL6A 1FNWA 4LFAL 2I0QA 1EOVA 3VYTA 5M5XB 1VQKA 4CHTB 3D4WA 4HMJA 4DV4Q 3QWNA 3JC66 1TIID 4EGVA 5C5LA 1Q3LA 1EFID 1T5EA 2KOLA 3N6RA 1AP0A 1KLUD 4A3BH 1J5EL 4ZRZA 4JOIC 4M8AA 3FPPA 3PGZA 4BBRH 5FJ8G 1IHZA 1Q46A 5C3EB 3K6OA 3KF8A 4GOPB 3A56A 5A35A 1VQMA 4QF4A 2YU9H 3S17H 4R4TA 2F0JA 3SK5A 5EBDA 1PRTF 5M3MH 2PQAA 3Q22A 2L5TA 3VA5A 3VYRA 4Y52H 5IWAQ 2E74C 2QEJC 1M90C 2JA7H 2KHIA 2BA1A 1Z7TA 2CKZB 2EYHA 4WRDA 2ZTDA 5FOBB 3CCUA 1FJGQ 4JI5L 4KY7A 5FO8B 5TSSA 4DXFA 1J9OA 1M1KC 4UAIA 5EQ0A 2A74C 2QW7A 1SSOA 1CSQA 4IPGA 4DR2Q 3A5UA 4HSPA 1CQVA 4L5TA 3M3YH 2VQFQ 1VF7A 3NENA 3WDNA 5C4XB 2K6AA 1MIUA 4LF8L 3KK7A 2R7ZB 1HNWQ 1M8AA 3S15H 1JR0D 1NR4A 1TXYA 1JORA 3W2DA 5DAUA 3TBIB 1JJCB 1D6EC 1FYCA 3A7LA 1IBLL 4CJ0B 3KUPA 3D31A 1XNRQ 4NXMQ 1IBML 4C2MB 4FF4A 2JA9A 5M3FH 2Z6KC 1CT1D 3FDTA 1VQJA 5IT9L 3C2PA 4IJLA 3QO2A 5IYDG 1EYGA 3S24A 2MFIA 4NXNL 1LT4D 1SJHD 2LKVA 3ERQA 1YJNA 2H1EA 2OQKA 5CV7A 1C9OA 4X62Q 3DWAA 2F4IA 3GTJH 1EFWA 5FO7B 4APVA 3R2TA 4BY7G 2B63G 4FVMA 2BH8A 1GVPA 1HH2P 3F8TA 1GO3E 1R4PB 3ERSX 3T16A 4CDEC 3OWFA 4A4IA 1B9MA 1E1TA 4WJWA 4P71A 3CCRA 3S2HB 2KCNA 2Z4IA 2K28A 3EIVA 4LUOA 1HUNA 4OONA 4BS9A 1N34L 3PO3B 4AH6A 1RJTA 1PFBA 3MA2B 2Q2HA 1D1KA 3NTIA 3LWEA 4RWSC 4L6TB 1EWHA 5LMUQ 1IYJB 3J80L 2E2HB 2N49A 1D7QA 2SNSA 3NK9A 1GUWA 3J7AF 1LLRD 1SE8A 4O42A 1YJWA 1GHKA 5ELBA 1VQFA 2MUYA 3RMHA 4B3SQ 1VQBA 1PTOH 4H7BA 3STBD 1FGBD 3PQIA 1GUOA 3GDEA 4RGTA 1PH6A 3KFUA 4QY7A 5IYCG 2CWPA 2JEAI 1BO0A 3A5ZB 3VR2A 1O7IA 3TP7A 2RCNA 1N32L 4A3IB 1I4XA 1MJCA 1PH9A 2FMCA 1JOOA 2F1MA 2SEBD 2XSCA 3DWPA 1Q8KA 5EPLA 1N9WA 4LFCQ 3TDQA 5KIXA 1A63A 4YCVA 1OTCA 3OTOL 4MHEA 4DV6L 2K32A 3Q24A 1Y8PB 5HY6A 2EY6A 4RMFA 5C0XI 1GM5A 1KAAA 3KOJA 1H9RA 3RN5A 2CFMA 4DV0L 3HOXG 1BBWA 3ND9A 5IP7G 3OIQA 2F0LA 1QB5D 1GUTA 2DNEA 3AEVA 5E4WC 1YIJA 3J81c 2IJ0A 2BE5C 1KD1C 3A8KE 4K5XA 2IWHA 3CCLA 1BXTA 4KY5A 3J7A5 2N88A 1EQVA 4PMCA 2PPBC 1LTBD 4BY7H 2B63H 4OO1G 4JI2Q 5JAVA 3ICEA 1U4RA 1YNJC 1TY2A 2LSSA 1WTPA 4DR1Q 1SFOH 3A74A 4J15A 5BN3A 3FVQA 4B3MQ 4GNXA 1QJOA 3HGBA 5DM73 1G2SA 1H9SA 1A0IA 1WI5A 3BVZA 1A3VA 1QG7A 4PZ8A 3MTSA 4F8MA 4PMBA 1DCZA 3CF5A 4RFBA 2MJ8A 2ZXPA 1JICA 4A3JG 1G6PA 5JJZA 1X3PA 1IZ6A 4XT3B 5IGBA 4FF1A 3JAMc 2DN8A 2L55A 5GADC 1G6ZA 2QDLA 1B7YB 4P74A 1CQFA 2UXDL 4KKTA 4L8JA 3ULLA 4HTHA 1AZQA 1PZID 4DR4L 1E7ZA 1YNNC 4WFN3 1LO5D 3L3OC 4DKAC 2RHSB 2O5JC 3F1ZA 3BZCA 4RGNA 1TS2A 1XNQL 3PIPA 4GOPA 1KDBA 2O4XA 4KHZA 4UDUC 1JE4A 1HQRD 3R93A 3OW7A 4YHHL 4CGYB 2PI2A 1UEAB 3HOXH 1VQIA 5EKIA 4QMGA 1MKHA 4JI0Q 1CKNA 4LMQD 3HOYB 3EJIA 4DV5L 4JI4Q 3MEHA 3BG3A 1OXTA 4RGMA 2VUMB 4YWLA 1SLJA 2WB1G 1HNZQ 1H95A 2NN6H 3SVMA 5BR8Q 1B50A 3K7AB 4ZK9B 1LUZA 1WYDA 4JI1L
chains in the Genus database with same CATH topology
1Z47A 4YWMA 3S1MH 2VUMG 5HGQA 3I2ZA 2UXBQ 1YJ9A 2FXQA 4AYBG 3W1GA 2MO1A 2GN5A 2L15A 3D0FA 4GNXC 2EXDA 2RHQB 1UE6A 1NMGA 2UXBL 3K0XA 3I56A 4A3EG 4GN5A 5DLQE 1YHQA 4XIGS 2UXCQ 3RR5A 4AIMA 4EX5A 1SN8A 3M9BA 1K8GA 4MZ9A 5FLMH 4DV1Q 3M4OH 2HHHQ 4QJFA 4A3KG 3HKZG 1I94Q 2UXCL 1WJJA 3TQYA 3J80i 3UDIA 3S1NH 2A1AA 2CWAA 3KDFB 4DV1L 2HHHL 3AQQA 3ZJYC 1I94L 3H0GG 4YWKA 4A3FG 3S16H 5GROA 2KBNA 4C3HH 4DR6Q 1N33Q 2PI2E 3HOVG 1OXVA 4IOAA 2NN6G 3I55A 3TREA 4DV7Q 1W3SA 2YV5A 1VQCA 3PUXA 1N33L 3CMEA 4DR6L 1ASYA 1JJGA 1W2BA 1X65A 2Y0SE 1PHJA 1R9TH 3G4SA 1VQ6A 4DV7L 3PUYA 1KXLA 1Z9FA 3BJUA 1MJEA 2JA5G 3MXNB 1U0LA 3GTPH 2A8VA 4X64Q 4BA1I 3CCVA 1LYLA 1K83H 3CCMA 5C0XJ 4R4CA 1VQOA 2WAQG 2MNAA 4X64L 1HR0Q 4X6AH 4A3GG 4LF6Q 4LF7L 4UP8A 4YCUA 1HZAA 3J81i 1YVCA 3CMAA 1PVOA 2YTVA 2PNHA 1HR0L 3FP9A 4UPAA 4HIMA 3U58A 4OX9Q 1EQQA 4LF6L 4LF4Q 5IP9H 4JOIA 1L1OC 1JE5A 4DV2Q 3RLNA 1PA6A 4YY3Q 1NY4A 2QEXA 3L0OA 1K8AC 4A3BG 3T1HQ 2JJQA 4BBRG 1HNXL 4OX9L 4A93H 1FVIA 1PH7A 4LF4L 2K75A 1NTGA 3NELA 4PZ6A 4OWXB 3AYHB 2VS1A 4YY3L 4DV2L 3PF5A 3HFZB 2I5MX 3T1HL 1CKOA 3KYHC 1X55A 1WCMH 2C35B 3GTKH 2Q2UA 3KF8B 3HOZG 3RZOH 4JBWA 4TVAB 4IFDJ 1JMCA 3I4NH 3M4QA 3CP0A 4WJ4A 3K80C 3PSIA 2JA6G 1X3FA 2A19A 4BBSH 5GQOA 1ASZA 2JA7G 1UEBA 2ZTEA 1VQ5A 3RN2A 3CCSA 4O2DA 3U4VA 2JEBI 1VQPA 3CQZH 4KHPQ 3HOYH 4GN3B 5LMNQ 2ZJRA 2KHJA 4HJ7A 1Q86C 1HR0W 4JBKA 3M4PA 1Q7YC 2ZJQA 1UE1A 2VUMH 4JC0A 3W5OA 4KHPL 2F3IA 2N78A 5LMNL 4JV5Q 1YZ6A 3L7ZC 4UP9A 1X3EA 3PO2H 1CUKA 1VQNA 2YTYA 1YHBA 3J81j 1DGSA 1RIPA 2YTXA 5C0XG 3K7AH 3GTMH 3K7UC 3CXCA 1S40A 1Y1WG 2GVAA 5FLXc 3ULPA 4POFA 2Q2IA 4A3EH 4JV5L 1K0RA 1KRTA 4JI7Q 5ELOA 4IOCA 2NZHA 4LFBQ 2OCEA 1A62A 2DUDA 2MO0A 1XMQQ 4OO1I 2UUAQ 4A3KH 3KDFA 1K9MC 4JI7L 1I6HH 1WCMG 1VQ4A 4LFBL 3KF6A 1XMQL 2UUAL 4JI6Q 3H3VH 5AJ3Q 2R92H 3HOUG 2VY3A 2WB1E 1K3RA 2PMZE 5FJ8H 2H5XA 3B6YA 3HKSA 3ULJA 4DK6C 2VQEQ 4HIOA 5JEAJ 1XPRA 2Z6KA 3OYYA 1G291 2IT1A 4JBJA 3W1BA 4A3MG 1IBKQ 1XTDA 3MEFA 2D0OA 5AJ3L 3UDXA 1EIYB 2QGQA 4JI6L 4LF5Q 3HOVH 2D0PA 4BBSG 4LFAQ 2VQEL 4IJHA 2OQ0A 4R4OA 4IFDG 1B8AA 1PYSB 4B3RQ 4DUYQ 1IBKL 4LF5L 2E8GA 4ALPA 1KQSA 2VL6A 2UU9Q 4LFAL 5LMNW 2HIVA 2I0QA 4AYBE 1EOVA 1AE2A 3SGIA 4B3RL 5C44H 1Q82C 4DUYL 2UUCQ 3GTGH 4MNOA 2JA5H 5M5YH 1VQKA 2UU9L 4A3DH 1OXSC 2JK8A 4DV4Q 1LTLA 4GS3A 2B29A 3CW2C 2UUCL 3PO2G 1C0AA 3CPFA 3JC66 1PV4A 4WJ3M 1XPOA 3CAMA 2UUBQ 1V1QA 3HKZE 3RLOA 1J6QA 4DV4L 3CC4A 2N8NA 1J5EQ 3PV0A 4A3GH 2K5NA 2UUBL 2GVBA 1X9NA 3HOWG 2AKWB 4Y7NH 3KJPA 3H15A 4QQBX 5IY0A 4A3BH 1J5EL 1TWFH 1VQEA 1JJ2A 4LW1A 4JOIC 2CQOA 1X56A 1HJPA 3PGZA 1WOCA 5ELNA 2R92G 4BBRH 4GKJQ 3PUWA 5FJ8G 1EQRA 4A75A 1Q46A 2CCZA 2IY5B 5JJKA 3F2CA 4IPHA 1PH3A 4JI3Q 4GKJL 1V43A 3S1QH 4GOPB 4OWTB 2YU9H 1VQMA 3S17H 4R4TA 3HOZH 4DR7Q 1NBWA 1L1OB 3G48A 4JI3L 1SRUA 5M3MH 5JEAG 2AMCB 2PQAA 5C4XH 2NVYH 4JI5Q 2JA6H 5IWAQ 4Y52H 4TQUS 4DR7L 1VCIA 5C44G 2KENA 1M90C 2JA7H 2KHIA 5GAGC 2BA1A 1BKBA 2CKZB 5C3EG 2ZTDA 3CCUA 1FJGQ 4A3DG 4JI5L 1U5KA 1HZBA 1E3PA 1L2FA 4MTNA 3M7NA 5IYDH 2WAQE 5IWAL 4A3CG 1FL0A 1M1KC 1PH4A 4LF7Q 3U50C 1FJGL 3AFPA 4IPCA 3STBC 1CSQA 1TWAH 4IPGA 3A5UA 2QA4A 4JCVE 4DR2Q 1QZHA 1N8RC 4L5TA 4C2MH 3M3YH 2KCMA 4LF9Q 3G71A 2VQFQ 3PUVA 5GAEC 1VQ8A 1IXRA 3TS0A 2XGTA 2LXJA 4DR2L 1N36Q 2E2JH 3AFQA 3NENA 3UE0A 1HNXQ 2Q2TA 4LF8Q 1YI2A 4POGA 1JT8A 1QUQB 4LF9L 4KLKA 4FDBA 5C4JH 1CKMA 4P75A 2VQFL 1Y1WH 2IX1A 2HT1A 1VQHA 1MIUA 1N36L 4K0KQ 4LWCA 2R7FA 4LF8L 1Q1BA 3CC7A 4A3LG 1HNWQ 4QGUA 4HJ8A 1IBLQ 3LGJA 3S15H 1S3OA 1TXYA 1X54A 4JI8Q 1IBMQ 4K0KL 4HJAA 3I4OA 1JJCB 1HNWL 3I4MH 1IBLL 1Q12A 3I4NG 2ID0A 3D31A 1XNRQ 3HOUH 4JI8L 4NXMQ 4BXXH 1IBML 5M3MG 5IYBH 4R4IA 5C4XG 2JA9A 2EQSA 2Z6KC 5M3FH 4A3MH 2F4VQ 1X6OA 1XNRL 1L0WA 4NXML 4P72A 4NXNQ 1VQJA 1P16A 1PH1A 2R7ZG 4IJLA 1EUJA 5IYDG 1PH2A 1EYGA 3NEMA 3PIOA 3S24A 2F4VL 3EBEA 2MFIA 4DR3Q 3DM3A 1VQGA 1VQAA 3E9HA 4DK3C 4GKKL 4NXNL 1AH9A 1S72A 2K4KA 4DR5Q 2I5LX 1OXUA 4DR3L 2MQHA 2D62A 1YJNA 5IT9c 4UP7A 1TWCH 2OQKA 1C9OA 1E24A 4C3IH 2NN6I 4X62Q 4DR5L 3GTJH 1EFWA 4APVA 4YCWA 4BY7G 2OTLA 2B63G 4A76A 2BH8A 1GVPA 4X62L 1HH2P 3E0EA 3U4ZA 3F8TA 4DPGA 4HIKA 1NJIC 1GO3E 3ERSX 5IE8A 1JB7A 3HOWH 5M5XH 3OW2A 2K5VA 4A4IA 5IYCH 1E1TA 3CCRA 4P71A 2JA8H 2KCTA 1WFQA 4BY1G 1N34Q 2AWOA 1E22A 3WWVA 3UDGA 4GNXB 3I4MG 4BA2I 3EIVA 4HJ5A 4LUOA 4BXXG 4QIWE 4OONA 5IYBG 3M85A 1N34L 1UE5A 4AH6A 5M3FG 4JBMA 2Q2HA 1KRSA 1TWGH 1SMXA 4DV3Q 2IHEA 2ZJPA 5LMUQ 2R93G 3T1YQ 2RF4A 1YEZA 2AHOB 5M5WH 4DV3L 5JJIA 1RL2A 4GLXA 1IYJB 5IP7H 5LMUL 2N49A 4A3IH 1D7QA 3PCOB 1Y14B 3CCEA 3T1YL 3GO5A 5C3EH 3GTLH 1NMFA 3CCQA 1D8LA 4A3CH 4JI0L 1T9HA 1Y1VG 1SE8A 2B3GA 1YJWA 1HZ9A 3FKIH 4R4QA 2BA0A 3NBHB 1VQFA 3PUZA 4B3SQ 1EWIA 5E7NA 1VQBA 1AE3A 2HIXA 3J80c 4DUZL 1K73C 3STBD 4HJ9A 1SR3A 2AWNA 2DGYA 2E5LQ 4DAYB 3KLWA 3GDEA 1QUQA 1PH6A 4DAMA 4B3SL 3RZDH 3KFUA 1N32Q 4QY7A 5IYCG 2CWPA 1VQLA 1IL2A 2JA8G 1VS0A 2JEAI 3A5ZB 5BR8L 1O7IA 2E5LL 4O0AA 2RCNA 4GLVB 1N32L 1MJCA 4HIDA 4JYAQ 3OTOQ 1PH9A 1UWVA 4A3LH 4X66Q 3ER0A 4P73A 2ZM6L 3CPWA 4DV6Q 1Q8KA 4AQYQ 1N9WA 3J7ZC 4LFCQ 3PF4A 1A63A 2YYZA 4YCVA 1OTCA 3I7FA 4JYAL 4GLAC 2VW9A 3OTOL 4DV0Q 2NVQH 4X66L 4DV6L 1QZGA 4OXPA 5GAHC 4AQYL 5HY6A 4LFCL 1UE7A 5C0XI 4RMFA 4XTCS 1GM5A 3KOJA 1QVFA 3RN5A 2CFMA 4DV0L 4KI0A 3S14H 3HOXG 1BBWA 3TS2A 5IP7G 4A3IG 2Z0SA 4C3JH 4GN4B 2R7ZH 4L5RC 2HQLA 1YNXA 1CKNB 3GD7A 3TRZA 3S2DH 3AEVA 3KF6B 1NE3A 4A3JH 1YIJA 1C7YA 3FKIG 1XJVA 2ASBA 3J81c 1VQDA 3RLFA 4PZ7A 1KD1C 3GTQH 3CCLA 3J7A5 3EN2A 1VQ9A 1E1OA 2WP8J 3DLLA 4ME3A 3UDFA 4IFDI 4X65Q 1XPUA 1SROA 2B63H 3CC2A 4JI2Q 4BY7H 3ICEA 4OO1G 2LSSA 1HZCA 4DR1Q 3IRBA 2IHFA 3K81C 1SFOH 3A74A 3K8AA 4J15A 2Y0SG 1PFSA 3BZKA 2R6GA 4X65L 4OWWB 1I50H 4IPDA 4JI2L 1PH5A 1KAWA 2IX0A 4B3MQ 4GNXA 4DR1L 2ALYB 4NB3A 4BY1H 2XTIA 2ATWA 2JQOA 1LM0A 3E9IA 4IO9A 1XMOQ 4B3ML 2WFWA 2K5HA 1G51A 4LUVA 5H1SE 5FLMG 1A0IA 1WI5A 2EIFA 4LUZA 2ZTCA 4DNIA 1B70B 2F52A 4PZ8A 4GOPC 4PG3A 1XMOL 2NVTH 4GKKQ 1YITA 1GKHA 2V1CC 1EIFA 3CF5A 3RNUA 3CD6A 2R93H 3GTOH 4A3JG 1VQ7A 3S2HH 1G6PA 3UE1A 2K50A 3F2BA 1KHIA 1IZ6A 1PH8A 3H3VI 3JAMc 3L2PA 4EQ5A 1FGUA 3PO3H 5GADC 3A0JA 1KIXA 4JG2A 5J3BA 2UXDQ 1Q81C 2OWOA 4LNQA 1Y1VH 1KC8C 4DR4Q 4PMWA 1B7YB 4P74A 1P8LA 2PQAB 4R1JA 4RG1A 3ULLA 2UXDL 4L5QA 4DR4L 1E7ZA 2JE6I 1Q1EA 1QVGA 1XNQQ 2E2HH 2R7DA 3VDYA 3F2DA 1BBUA 4DKAC 1GD7A 2NZOA 1KL9A 2RHSB 3F1ZA 3BZCA 1YHAA 1XNQL 3PIPA 2N3SA 1OXXK 3KJOA 4QL5A 1QVCA 1YBYA 4B3TQ 4GOPA 1PYBA 3FHWA 3JAMi 4YHHQ 1L1OA 4KHZA 5IP9G 4B3TL 2K14A 1CSPA 2VNUD 4A93G 4YHHL 5JJLA 2PI2A 5EAYA 3HOXH 2LXKA 1VQIA 4DV5Q 1MKHA 4JI0Q 1CKNA 2I5HA 3PO3G 3CCJA 2E2IH 1I3QH 4DV5L 4NPSA 1BVSA 4DUZQ 4JI4Q 3H0GH 4A3FH 3S1RH 2BH2A 1OXTA 2VZAA 1TWHH 1V9PA 3BU2A 4YWLA 4L5SA 1I5FA 4JI4L 3G6EA 1SLJA 2WB1G 1HNZQ 2NVXH 1H95A 1A8VA 2ES2A 5BR8Q 2K52A 4JI1Q 3TEHB 2OTJA 1LUZA 3Q8DA 1HNZL 1X3GA 4H02A 3HOYG 1WYDA 4JI1L 2ZM6Q 5K36G 4UY8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z47 A;  4YWM A;  3S1M H;  2VUM G;  5HGQ A;  3I2Z A;  2UXB Q;  1YJ9 A;  2FXQ A;  4AYB G;  3W1G A;  2MO1 A;  2GN5 A;  2L15 A;  3D0F A;  4GNX C;  2EXD A;  2RHQ B;  1UE6 A;  1NMG A;  2UXB L;  3K0X A;  3I56 A;  4A3E G;  4GN5 A;  5DLQ E;  1YHQ A;  4XIG S;  2UXC Q;  3RR5 A;  4AIM A;  4EX5 A;  1SN8 A;  3M9B A;  1K8G A;  4MZ9 A;  5FLM H;  4DV1 Q;  3M4O H;  2HHH Q;  4QJF A;  4A3K G;  3HKZ G;  1I94 Q;  2UXC L;  1WJJ A;  3TQY A;  3J80 i;  3UDI A;  3S1N H;  2A1A A;  2CWA A;  3KDF B;  4DV1 L;  2HHH L;  3AQQ A;  3ZJY C;  1I94 L;  3H0G G;  4YWK A;  4A3F G;  3S16 H;  5GRO A;  2KBN A;  4C3H H;  4DR6 Q;  1N33 Q;  2PI2 E;  3HOV G;  1OXV A;  4IOA A;  2NN6 G;  3I55 A;  3TRE A;  4DV7 Q;  1W3S A;  2YV5 A;  1VQC A;  3PUX A;  1N33 L;  3CME A;  4DR6 L;  1ASY A;  1JJG A;  1W2B A;  1X65 A;  2Y0S E;  1PHJ A;  1R9T H;  3G4S A;  1VQ6 A;  4DV7 L;  3PUY A;  1KXL A;  1Z9F A;  3BJU A;  1MJE A;  2JA5 G;  3MXN B;  1U0L A;  3GTP H;  2A8V A;  4X64 Q;  4BA1 I;  3CCV A;  1LYL A;  1K83 H;  3CCM A;  5C0X J;  4R4C A;  1VQO A;  2WAQ G;  2MNA A;  4X64 L;  1HR0 Q;  4X6A H;  4A3G G;  4LF6 Q;  4LF7 L;  4UP8 A;  4YCU A;  1HZA A;  3J81 i;  1YVC A;  3CMA A;  1PVO A;  2YTV A;  2PNH A;  1HR0 L;  3FP9 A;  4UPA A;  4HIM A;  3U58 A;  4OX9 Q;  1EQQ A;  4LF6 L;  4LF4 Q;  5IP9 H;  4JOI A;  1L1O C;  1JE5 A;  4DV2 Q;  3RLN A;  1PA6 A;  4YY3 Q;  1NY4 A;  2QEX A;  3L0O A;  1K8A C;  4A3B G;  3T1H Q;  2JJQ A;  4BBR G;  1HNX L;  4OX9 L;  4A93 H;  1FVI A;  1PH7 A;  4LF4 L;  2K75 A;  1NTG A;  3NEL A;  4PZ6 A;  4OWX B;  3AYH B;  2VS1 A;  4YY3 L;  4DV2 L;  3PF5 A;  3HFZ B;  2I5M X;  3T1H L;  1CKO A;  3KYH C;  1X55 A;  1WCM H;  2C35 B;  3GTK H;  2Q2U A;  3KF8 B;  3HOZ G;  3RZO H;  4JBW A;  4TVA B;  4IFD J;  1JMC A;  3I4N H;  3M4Q A;  3CP0 A;  4WJ4 A;  3K80 C;  3PSI A;  2JA6 G;  1X3F A;  2A19 A;  4BBS H;  5GQO A;  1ASZ A;  2JA7 G;  1UEB A;  2ZTE A;  1VQ5 A;  3RN2 A;  3CCS A;  4O2D A;  3U4V A;  2JEB I;  1VQP A;  3CQZ H;  4KHP Q;  3HOY H;  4GN3 B;  5LMN Q;  2ZJR A;  2KHJ A;  4HJ7 A;  1Q86 C;  1HR0 W;  4JBK A;  3M4P A;  1Q7Y C;  2ZJQ A;  1UE1 A;  2VUM H;  4JC0 A;  3W5O A;  4KHP L;  2F3I A;  2N78 A;  5LMN L;  4JV5 Q;  1YZ6 A;  3L7Z C;  4UP9 A;  1X3E A;  3PO2 H;  1CUK A;  1VQN A;  2YTY A;  1YHB A;  3J81 j;  1DGS A;  1RIP A;  2YTX A;  5C0X G;  3K7A H;  3GTM H;  3K7U C;  3CXC A;  1S40 A;  1Y1W G;  2GVA A;  5FLX c;  3ULP A;  4POF A;  2Q2I A;  4A3E H;  4JV5 L;  1K0R A;  1KRT A;  4JI7 Q;  5ELO A;  4IOC A;  2NZH A;  4LFB Q;  2OCE A;  1A62 A;  2DUD A;  2MO0 A;  1XMQ Q;  4OO1 I;  2UUA Q;  4A3K H;  3KDF A;  1K9M C;  4JI7 L;  1I6H H;  1WCM G;  1VQ4 A;  4LFB L;  3KF6 A;  1XMQ L;  2UUA L;  4JI6 Q;  3H3V H;  5AJ3 Q;  2R92 H;  3HOU G;  2VY3 A;  2WB1 E;  1K3R A;  2PMZ E;  5FJ8 H;  2H5X A;  3B6Y A;  3HKS A;  3ULJ A;  4DK6 C;  2VQE Q;  4HIO A;  5JEA J;  1XPR A;  2Z6K A;  3OYY A;  1G29 1;  2IT1 A;  4JBJ A;  3W1B A;  4A3M G;  1IBK Q;  1XTD A;  3MEF A;  2D0O A;  5AJ3 L;  3UDX A;  1EIY B;  2QGQ A;  4JI6 L;  4LF5 Q;  3HOV H;  2D0P A;  4BBS G;  4LFA Q;  2VQE L;  4IJH A;  2OQ0 A;  4R4O A;  4IFD G;  1B8A A;  1PYS B;  4B3R Q;  4DUY Q;  1IBK L;  4LF5 L;  2E8G A;  4ALP A;  1KQS A;  2VL6 A;  2UU9 Q;  4LFA L;  5LMN W;  2HIV A;  2I0Q A;  4AYB E;  1EOV A;  1AE2 A;  3SGI A;  4B3R L;  5C44 H;  1Q82 C;  4DUY L;  2UUC Q;  3GTG H;  4MNO A;  2JA5 H;  5M5Y H;  1VQK A;  2UU9 L;  4A3D H;  1OXS C;  2JK8 A;  4DV4 Q;  1LTL A;  4GS3 A;  2B29 A;  3CW2 C;  2UUC L;  3PO2 G;  1C0A A;  3CPF A;  3JC6 6;  1PV4 A;  4WJ3 M;  1XPO A;  3CAM A;  2UUB Q;  1V1Q A;  3HKZ E;  3RLO A;  1J6Q A;  4DV4 L;  3CC4 A;  2N8N A;  1J5E Q;  3PV0 A;  4A3G H;  2K5N A;  2UUB L;  2GVB A;  1X9N A;  3HOW G;  2AKW B;  4Y7N H;  3KJP A;  3H15 A;  4QQB X;  5IY0 A;  4A3B H;  1J5E L;  1TWF H;  1VQE A;  1JJ2 A;  4LW1 A;  4JOI C;  2CQO A;  1X56 A;  1HJP A;  3PGZ A;  1WOC A;  5ELN A;  2R92 G;  4BBR H;  4GKJ Q;  3PUW A;  5FJ8 G;  1EQR A;  4A75 A;  1Q46 A;  2CCZ A;  2IY5 B;  5JJK A;  3F2C A;  4IPH A;  1PH3 A;  4JI3 Q;  4GKJ L;  1V43 A;  3S1Q H;  4GOP B;  4OWT B;  2YU9 H;  1VQM A;  3S17 H;  4R4T A;  3HOZ H;  4DR7 Q;  1NBW A;  1L1O B;  3G48 A;  4JI3 L;  1SRU A;  5M3M H;  5JEA G;  2AMC B;  2PQA A;  5C4X H;  2NVY H;  4JI5 Q;  2JA6 H;  5IWA Q;  4Y52 H;  4TQU S;  4DR7 L;  1VCI A;  5C44 G;  2KEN A;  1M90 C;  2JA7 H;  2KHI A;  5GAG C;  2BA1 A;  1BKB A;  2CKZ B;  5C3E G;  2ZTD A;  3CCU A;  1FJG Q;  4A3D G;  4JI5 L;  1U5K A;  1HZB A;  1E3P A;  1L2F A;  4MTN A;  3M7N A;  5IYD H;  2WAQ E;  5IWA L;  4A3C G;  1FL0 A;  1M1K C;  1PH4 A;  4LF7 Q;  3U50 C;  1FJG L;  3AFP A;  4IPC A;  3STB C;  1CSQ A;  1TWA H;  4IPG A;  3A5U A;  2QA4 A;  4JCV E;  4DR2 Q;  1QZH A;  1N8R C;  4L5T A;  4C2M H;  3M3Y H;  2KCM A;  4LF9 Q;  3G71 A;  2VQF Q;  3PUV A;  5GAE C;  1VQ8 A;  1IXR A;  3TS0 A;  2XGT A;  2LXJ A;  4DR2 L;  1N36 Q;  2E2J H;  3AFQ A;  3NEN A;  3UE0 A;  1HNX Q;  2Q2T A;  4LF8 Q;  1YI2 A;  4POG A;  1JT8 A;  1QUQ B;  4LF9 L;  4KLK A;  4FDB A;  5C4J H;  1CKM A;  4P75 A;  2VQF L;  1Y1W H;  2IX1 A;  2HT1 A;  1VQH A;  1MIU A;  1N36 L;  4K0K Q;  4LWC A;  2R7F A;  4LF8 L;  1Q1B A;  3CC7 A;  4A3L G;  1HNW Q;  4QGU A;  4HJ8 A;  1IBL Q;  3LGJ A;  3S15 H;  1S3O A;  1TXY A;  1X54 A;  4JI8 Q;  1IBM Q;  4K0K L;  4HJA A;  3I4O A;  1JJC B;  1HNW L;  3I4M H;  1IBL L;  1Q12 A;  3I4N G;  2ID0 A;  3D31 A;  1XNR Q;  3HOU H;  4JI8 L;  4NXM Q;  4BXX H;  1IBM L;  5M3M G;  5IYB H;  4R4I A;  5C4X G;  2JA9 A;  2EQS A;  2Z6K C;  5M3F H;  4A3M H;  2F4V Q;  1X6O A;  1XNR L;  1L0W A;  4NXM L;  4P72 A;  4NXN Q;  1VQJ A;  1P16 A;  1PH1 A;  2R7Z G;  4IJL A;  1EUJ A;  5IYD G;  1PH2 A;  1EYG A;  3NEM A;  3PIO A;  3S24 A;  2F4V L;  3EBE A;  2MFI A;  4DR3 Q;  3DM3 A;  1VQG A;  1VQA A;  3E9H A;  4DK3 C;  4GKK L;  4NXN L;  1AH9 A;  1S72 A;  2K4K A;  4DR5 Q;  2I5L X;  1OXU A;  4DR3 L;  2MQH A;  2D62 A;  1YJN A;  5IT9 c;  4UP7 A;  1TWC H;  2OQK A;  1C9O A;  1E24 A;  4C3I H;  2NN6 I;  4X62 Q;  4DR5 L;  3GTJ H;  1EFW A;  4APV A;  4YCW A;  4BY7 G;  2OTL A;  2B63 G;  4A76 A;  2BH8 A;  1GVP A;  4X62 L;  1HH2 P;  3E0E A;  3U4Z A;  3F8T A;  4DPG A;  4HIK A;  1NJI C;  1GO3 E;  3ERS X;  5IE8 A;  1JB7 A;  3HOW H;  5M5X H;  3OW2 A;  2K5V A;  4A4I A;  5IYC H;  1E1T A;  3CCR A;  4P71 A;  2JA8 H;  2KCT A;  1WFQ A;  4BY1 G;  1N34 Q;  2AWO A;  1E22 A;  3WWV A;  3UDG A;  4GNX B;  3I4M G;  4BA2 I;  3EIV A;  4HJ5 A;  4LUO A;  4BXX G;  4QIW E;  4OON A;  5IYB G;  3M85 A;  1N34 L;  1UE5 A;  4AH6 A;  5M3F G;  4JBM A;  2Q2H A;  1KRS A;  1TWG H;  1SMX A;  4DV3 Q;  2IHE A;  2ZJP A;  5LMU Q;  2R93 G;  3T1Y Q;  2RF4 A;  1YEZ A;  2AHO B;  5M5W H;  4DV3 L;  5JJI A;  1RL2 A;  4GLX A;  1IYJ B;  5IP7 H;  5LMU L;  2N49 A;  4A3I H;  1D7Q A;  3PCO B;  1Y14 B;  3CCE A;  3T1Y L;  3GO5 A;  5C3E H;  3GTL H;  1NMF A;  3CCQ A;  1D8L A;  4A3C H;  4JI0 L;  1T9H A;  1Y1V G;  1SE8 A;  2B3G A;  1YJW A;  1HZ9 A;  3FKI H;  4R4Q A;  2BA0 A;  3NBH B;  1VQF A;  3PUZ A;  4B3S Q;  1EWI A;  5E7N A;  1VQB A;  1AE3 A;  2HIX A;  3J80 c;  4DUZ L;  1K73 C;  3STB D;  4HJ9 A;  1SR3 A;  2AWN A;  2DGY A;  2E5L Q;  4DAY B;  3KLW A;  3GDE A;  1QUQ A;  1PH6 A;  4DAM A;  4B3S L;  3RZD H;  3KFU A;  1N32 Q;  4QY7 A;  5IYC G;  2CWP A;  1VQL A;  1IL2 A;  2JA8 G;  1VS0 A;  2JEA I;  3A5Z B;  5BR8 L;  1O7I A;  2E5L L;  4O0A A;  2RCN A;  4GLV B;  1N32 L;  1MJC A;  4HID A;  4JYA Q;  3OTO Q;  1PH9 A;  1UWV A;  4A3L H;  4X66 Q;  3ER0 A;  4P73 A;  2ZM6 L;  3CPW A;  4DV6 Q;  1Q8K A;  4AQY Q;  1N9W A;  3J7Z C;  4LFC Q;  3PF4 A;  1A63 A;  2YYZ A;  4YCV A;  1OTC A;  3I7F A;  4JYA L;  4GLA C;  2VW9 A;  3OTO L;  4DV0 Q;  2NVQ H;  4X66 L;  4DV6 L;  1QZG A;  4OXP A;  5GAH C;  4AQY L;  5HY6 A;  4LFC L;  1UE7 A;  5C0X I;  4RMF A;  4XTC S;  1GM5 A;  3KOJ A;  1QVF A;  3RN5 A;  2CFM A;  4DV0 L;  4KI0 A;  3S14 H;  3HOX G;  1BBW A;  3TS2 A;  5IP7 G;  4A3I G;  2Z0S A;  4C3J H;  4GN4 B;  2R7Z H;  4L5R C;  2HQL A;  1YNX A;  1CKN B;  3GD7 A;  3TRZ A;  3S2D H;  3AEV A;  3KF6 B;  1NE3 A;  4A3J H;  1YIJ A;  1C7Y A;  3FKI G;  1XJV A;  2ASB A;  3J81 c;  1VQD A;  3RLF A;  4PZ7 A;  1KD1 C;  3GTQ H;  3CCL A;  3J7A 5;  3EN2 A;  1VQ9 A;  1E1O A;  2WP8 J;  3DLL A;  4ME3 A;  3UDF A;  4IFD I;  4X65 Q;  1XPU A;  1SRO A;  2B63 H;  3CC2 A;  4JI2 Q;  4BY7 H;  3ICE A;  4OO1 G;  2LSS A;  1HZC A;  4DR1 Q;  3IRB A;  2IHF A;  3K81 C;  1SFO H;  3A74 A;  3K8A A;  4J15 A;  2Y0S G;  1PFS A;  3BZK A;  2R6G A;  4X65 L;  4OWW B;  1I50 H;  4IPD A;  4JI2 L;  1PH5 A;  1KAW A;  2IX0 A;  4B3M Q;  4GNX A;  4DR1 L;  2ALY B;  4NB3 A;  4BY1 H;  2XTI A;  2ATW A;  2JQO A;  1LM0 A;  3E9I A;  4IO9 A;  1XMO Q;  4B3M L;  2WFW A;  2K5H A;  1G51 A;  4LUV A;  5H1S E;  5FLM G;  1A0I A;  1WI5 A;  2EIF A;  4LUZ A;  2ZTC A;  4DNI A;  1B70 B;  2F52 A;  4PZ8 A;  4GOP C;  4PG3 A;  1XMO L;  2NVT H;  4GKK Q;  1YIT A;  1GKH A;  2V1C C;  1EIF A;  3CF5 A;  3RNU A;  3CD6 A;  2R93 H;  3GTO H;  4A3J G;  1VQ7 A;  3S2H H;  1G6P A;  3UE1 A;  2K50 A;  3F2B A;  1KHI A;  1IZ6 A;  1PH8 A;  3H3V I;  3JAM c;  3L2P A;  4EQ5 A;  1FGU A;  3PO3 H;  5GAD C;  3A0J A;  1KIX A;  4JG2 A;  5J3B A;  2UXD Q;  1Q81 C;  2OWO A;  4LNQ A;  1Y1V H;  1KC8 C;  4DR4 Q;  4PMW A;  1B7Y B;  4P74 A;  1P8L A;  2PQA B;  4R1J A;  4RG1 A;  3ULL A;  2UXD L;  4L5Q A;  4DR4 L;  1E7Z A;  2JE6 I;  1Q1E A;  1QVG A;  1XNQ Q;  2E2H H;  2R7D A;  3VDY A;  3F2D A;  1BBU A;  4DKA C;  1GD7 A;  2NZO A;  1KL9 A;  2RHS B;  3F1Z A;  3BZC A;  1YHA A;  1XNQ L;  3PIP A;  2N3S A;  1OXX K;  3KJO A;  4QL5 A;  1QVC A;  1YBY A;  4B3T Q;  4GOP A;  1PYB A;  3FHW A;  3JAM i;  4YHH Q;  1L1O A;  4KHZ A;  5IP9 G;  4B3T L;  2K14 A;  1CSP A;  2VNU D;  4A93 G;  4YHH L;  5JJL A;  2PI2 A;  5EAY A;  3HOX H;  2LXK A;  1VQI A;  4DV5 Q;  1MKH A;  4JI0 Q;  1CKN A;  2I5H A;  3PO3 G;  3CCJ A;  2E2I H;  1I3Q H;  4DV5 L;  4NPS A;  1BVS A;  4DUZ Q;  4JI4 Q;  3H0G H;  4A3F H;  3S1R H;  2BH2 A;  1OXT A;  2VZA A;  1TWH H;  1V9P A;  3BU2 A;  4YWL A;  4L5S A;  1I5F A;  4JI4 L;  3G6E A;  1SLJ A;  2WB1 G;  1HNZ Q;  2NVX H;  1H95 A;  1A8V A;  2ES2 A;  5BR8 Q;  2K52 A;  4JI1 Q;  3TEH B;  2OTJ A;  1LUZ A;  3Q8D A;  1HNZ L;  1X3G A;  4H02 A;  3HOY G;  1WYD A;  4JI1 L;  2ZM6 Q;  5K36 G;  4UY8 C; 
#chains in the Genus database with same CATH topology
 3S1M H;  1I6H B;  1ENA A;  4AYB G;  5ISR A;  2MO1 A;  3TSS A;  2I46 A;  3N52 A;  4GNX C;  2JXM B;  3LNN A;  4A3E G;  1TVX A;  5DLQ E;  4XIG S;  2LFN A;  3A7A B;  4AIM A;  3M9B A;  1WD0 A;  4DV1 Q;  3M4O H;  3HKZ G;  5JVG 3;  2F0M A;  1WJJ A;  3TQY A;  3J80 i;  3UDI A;  3S1N H;  1E2V A;  2A1A A;  3K57 A;  3ZJY C;  1I94 L;  3H0G G;  3K5N A;  2WII B;  1U4M A;  1N33 Q;  3BDO A;  3TRE A;  2KUM A;  2YV5 A;  4DR6 L;  3PUX A;  1LV9 A;  3KLS A;  4P2C B;  1ASY A;  4A3G B;  3G4S A;  1VQ6 A;  4CBV A;  3D3R A;  2B2Y A;  1A2T A;  3QOL A;  3JAM E;  4X64 Q;  3C3L A;  2L4N A;  1ICF B;  2OEO A;  1ILP A;  1TR5 A;  4R4C A;  1VQO A;  2WAQ G;  3M4Y A;  4YCU A;  1PVO A;  1U4L A;  3FP9 A;  5COR A;  4HIM A;  1V1P A;  2PQE A;  1F77 A;  4RHR A;  5EJW A;  1JE5 A;  3RD4 A;  3RLN A;  4HAE A;  1EY0 A;  1SJE D;  1K8A C;  2JA6 B;  4OX9 L;  3PF5 A;  4PZ6 A;  3AYH B;  2VS1 A;  4L63 B;  2I5M X;  3GTK H;  1CKO A;  1F9R A;  5LL6 S;  2Q2U A;  3KF8 B;  2F3W A;  5CYU A;  3RZO H;  4TVA B;  2MHV A;  4KV6 A;  1X3F A;  4DNR B;  5GQO A;  1W6K A;  1LT6 D;  3RN2 A;  3U4V A;  1WTV A;  3EA6 A;  1EY5 A;  2ZJR A;  3T56 B;  2VXW A;  3MXP A;  1HR0 W;  3M4P A;  1Q7Y C;  4KHP L;  1YZ6 A;  1CUK A;  2YTY A;  3I73 A;  1DGS A;  2YTX A;  1SNM A;  5JPN C;  1S5D D;  2A5H A;  4A3E H;  5C4H A;  2A73 B;  2NZH A;  3OMC A;  3KDF A;  3ZYY X;  4JI7 L;  1WCM G;  2DJF C;  1VQ4 A;  4LFB L;  5KNB A;  2F0E A;  1EWC A;  1XMQ L;  2UUA L;  4JI6 Q;  4E6I A;  1U4P A;  5AJ3 Q;  1MGS A;  2ENB A;  2WB1 E;  3B6Y A;  3HKS A;  3ULJ A;  4DK6 C;  4JBJ A;  4KD3 A;  3TP8 A;  1IBK Q;  2NBF A;  4LF5 Q;  2F0D A;  3MFY A;  5EBC A;  1I4R A;  4IJH A;  4R4O A;  1ET6 A;  4B3R Q;  4DUY Q;  3R3O A;  3A8I E;  1BDO A;  1KQS A;  1LAC A;  2UU9 Q;  4FNF A;  2HIV A;  4AYB E;  3HOW B;  1AE2 A;  2KEE A;  4MNO A;  4IZ8 A;  2B2Y C;  3MXU A;  3CW2 C;  2UUC L;  3PO2 G;  1PV4 A;  2UUB Q;  2N55 A;  3HKZ E;  1K3B C;  2F0T A;  1NCV A;  1CI3 M;  5KRU A;  2GVB A;  1TWG B;  2AKW B;  4MIU A;  4Y7N H;  2M9V A;  1MBY A;  5KGU A;  3H09 A;  5M5W B;  1LTS D;  2I07 B;  1QE6 A;  1WOC A;  5ELN A;  5C44 B;  2R92 G;  4GKJ Q;  2Z9H A;  1EQR A;  3NUC A;  4M1U B;  3GTL B;  3F2C A;  4XT1 B;  2DY7 A;  3D4R A;  2LY7 A;  3S1Q H;  4OWT B;  4DR7 Q;  4JI3 L;  1SRU A;  2K7V A;  2AMC B;  5C4X H;  4WOR A;  3EFX D;  1PZJ D;  1VCI A;  1ZXT A;  3RZD B;  5GAG C;  1BKB A;  1TWF B;  1E2W A;  1E3P A;  1L2F A;  3NBI A;  4MTN A;  2WAQ E;  4RKL A;  2KHS A;  2PO4 A;  1PH4 A;  3C1E A;  2EPB A;  2AUK A;  4IPC A;  3STB C;  1C8C A;  3T4A C;  4QCL A;  1TWA H;  1N8R C;  3H94 A;  5I9P A;  4C2M H;  4LF9 Q;  3G71 A;  3H3V C;  1VQ8 A;  1IXR A;  3TS0 A;  4TSS A;  1S4Z A;  2NTT A;  2XGT A;  3OPO A;  2RBM A;  3V96 A;  1N36 Q;  4A3B G;  4G7O C;  1JT8 A;  4KLK A;  4FDB A;  2NVY B;  1CKM A;  4P75 A;  5K5P A;  2HT1 A;  1SNC A;  4J1M A;  4LWC A;  5NUC A;  4C3J B;  1Q1B A;  4A3L G;  2XRQ D;  4HJ8 A;  3IL8 A;  2HDL A;  4JI8 Q;  3S2D B;  4K0K L;  4A3J B;  1FNV A;  3I4M H;  2A6E D;  1MSH A;  3L9A X;  2ID0 A;  4BXX H;  5A2Q E;  3GTQ B;  1FNU A;  5M3M G;  2MP1 A;  3LWU A;  5IYB H;  2L9H A;  1XTC D;  2E2J B;  1L0W A;  2BDN A;  1PH1 A;  4DF7 A;  1PH2 A;  4RA8 A;  3NEM A;  3PIO A;  2F4V L;  4DK3 C;  1D5M C;  4IUR A;  1I50 B;  2D5D A;  1S5C D;  2ICE C;  2K4K A;  4DR5 Q;  3QR8 A;  1WTX A;  4DR3 L;  3I91 A;  2MQH A;  2D62 A;  5IT9 c;  4UP7 A;  3BVG A;  1TWC H;  1E0B A;  4IUV A;  3GQB A;  4YCW A;  5BN5 A;  4FXG C;  2RCF A;  4DPG A;  5AFW A;  3I4L A;  1BCP D;  1STY A;  2K5V A;  3NTK A;  1Q8I A;  4CKE A;  3NTH A;  2R93 B;  1WFQ A;  4BY1 G;  2AWO A;  5I4D A;  3UDG A;  4BA2 I;  4GNX B;  2EDG A;  3R2I A;  1SNQ A;  4TRD A;  5KYL A;  1H9S B;  1EY9 A;  1UE5 A;  5M3F G;  1KLG D;  3SHL A;  4C3I B;  1EL0 A;  1Y1V B;  1FD7 D;  4B9X A;  1SMX A;  4DV3 Q;  2HQE A;  1S5B D;  3R8B A;  3J7Y W;  3V2T A;  2F0S A;  2IPK D;  3T1Y Q;  2AHO B;  4V19 0;  5JJI A;  3MHB A;  2LS0 1;  2B2W C;  4A3I H;  1PMR A;  2EVB A;  1Y14 B;  3SK8 A;  3CCE A;  2JA8 B;  1D8L A;  1HCZ A;  3BVM A;  1V8Q A;  4JI0 L;  2DNC A;  4KJN A;  2BA0 A;  3J80 c;  2AWN A;  2E5L Q;  4DAY B;  1QUQ A;  4MN3 A;  5D14 A;  1VQL A;  4IUN A;  5BR8 L;  3M7G A;  1ESR A;  3BDL A;  3HKZ B;  2EOT A;  5HUR A;  3SR1 A;  4A3L H;  4X66 Q;  3CPW A;  1I3Q B;  3J7Z C;  3WOE A;  2KCC A;  1SND A;  4GLA C;  3S1R B;  4JYA L;  2NVQ H;  3FKI B;  1QZG A;  1TWH B;  4OXP A;  5GAH C;  4AQY L;  4XTC S;  2D9U A;  1EOT A;  4KI0 A;  3TP6 A;  4RKB A;  2Q8I B;  1LTR D;  3DWQ A;  2HQL A;  1CKN B;  1F2M A;  1K0S A;  3I70 A;  1QOH A;  1NE3 A;  3KF6 B;  1VQD A;  4PZ7 A;  2OF1 A;  1EZ6 A;  2MPM A;  5BN4 A;  1CZG A;  3EN2 A;  3VA7 A;  1E1O A;  5G3L F;  4IFD I;  4X65 Q;  3CC2 A;  3S14 B;  3F2U A;  3AU7 A;  3IRB A;  3K8A A;  2Y0S G;  1PFS A;  3BZK A;  2R6G A;  5EKK A;  3X3M A;  5F2D A;  1PH5 A;  1I4Q A;  1TS4 A;  3CHB D;  5LHY 1;  2ALY B;  4BY1 H;  2M00 A;  1PRT D;  1BBX C;  1RDP D;  4QB4 A;  2CH4 A;  1XMO Q;  2WFW A;  4N9P A;  2SDF A;  5FLX E;  4LUZ A;  2ZTC A;  4DNI A;  2Z6B A;  1DD2 A;  4B9W A;  1EIF A;  2K50 A;  2X6G A;  2CQA A;  4C3H G;  2B2V A;  3HS0 C;  4OGQ C;  3GTP B;  3L2P A;  5EPK A;  3U9O A;  3VR6 A;  1EYA A;  3A0J A;  1KIX A;  4JG2 A;  5J3B A;  2NYZ D;  1KC8 C;  4DU9 A;  5T1G A;  4C1N K;  4R1J A;  4J8Q A;  4R9W A;  1CHP D;  1Q1E A;  2R7D A;  3VDY A;  3F2D A;  1BBU A;  3GTO B;  4DXG A;  4ABN A;  2H4O A;  2N3S A;  1OXX K;  1B2T A;  4QL5 A;  4KMU C;  1QVC A;  1WCM B;  3A54 A;  4CDF C;  2BDO A;  3FHW A;  1L0Y B;  3J80 E;  2CVR A;  4B3T L;  1V1P B;  1CSP A;  4A93 G;  4KHV A;  1SYC A;  1MD2 D;  2LXK A;  3E0J A;  3SK4 A;  5CBA E;  2PCF B;  4ILW A;  5JOB A;  3CQZ B;  1O7Y A;  3CCJ A;  1BNZ A;  2E2I H;  1PFM A;  3TN2 A;  1KNA A;  2Q8R E;  1ZYR D;  4K8J A;  1EU3 A;  4L5S A;  1I5F A;  3G6E A;  2EZV A;  2A68 D;  4JVZ A;  2K52 A;  3TEH B;  2OTJ A;  3QG1 A;  2RKS A;  5CV6 A;  3Q8D A;  4CDC C;  5KEE A;  1MSG A;  2SOB A;  5K36 G;  4A3K B;  3SXH A;  4YWM A;  4XDX A;  2UXB Q;  3D0F A;  2L15 A;  2R92 B;  4A3F B;  1UE6 A;  4HR7 B;  1NMG A;  2TSS A;  5FO9 B;  3I56 A;  2UXC Q;  3RR5 A;  4EX5 A;  2AQ2 B;  1K8G A;  2NVX B;  4MZ9 A;  2HHH Q;  4OEM B;  1BR9 A;  4K14 A;  3A55 A;  4ULL A;  2ZXO A;  2CWA A;  3KDF B;  2WAC A;  1BQQ T;  4KKS A;  5GRO A;  3S16 H;  3MC0 B;  4C3H H;  1SXT A;  2B2V C;  3OMG A;  3HOV G;  2NN6 G;  1EZ8 A;  3K0Y A;  3CME A;  1C48 A;  2Y0S E;  3V05 A;  4DV7 L;  3PUY A;  5E1F A;  3BJU A;  1SYD A;  1D5X C;  2JA5 G;  1NAP A;  4ME5 A;  4ZCK A;  5C6A A;  3BS1 A;  1QWY A;  3BYY B;  5EGT A;  4BA1 I;  2E76 C;  1LYL A;  4BBR B;  4DAP A;  1K83 H;  1SDF A;  1A6X A;  2MNA A;  3E5S A;  2YU9 B;  3S17 B;  4UP8 A;  1HZA A;  4IUP A;  2YTV A;  4NP5 A;  4C1N I;  1HR0 L;  4I7Z C;  5M3M B;  5C0X H;  4LF6 L;  3KLR A;  4GZY C;  5FK9 C;  4CKC A;  4YY3 Q;  1NY4 A;  2OT2 A;  2QEX A;  1SYB A;  3T1H Q;  2JA7 B;  4A93 H;  1FVI A;  4LF4 L;  1STE A;  4DV2 L;  4OWX B;  3BYT B;  1W6J A;  3KYH C;  1X55 A;  4C56 C;  2C35 B;  5I6W A;  3HOZ G;  1KDA A;  1A3U A;  3P1H A;  4KN4 C;  4RH6 A;  2EYF A;  3M4Q A;  3M3Y B;  4WJ4 A;  1DON A;  1O7Z A;  4IUT A;  4K2K A;  2A19 A;  1IKM A;  4DAY A;  1I4P A;  2ZTE A;  3CCS A;  4O2D A;  3OOC A;  2JEB I;  4H0L C;  4H13 C;  5LMN Q;  4DFA A;  2KHJ A;  4HJ7 A;  5K36 H;  4JBK A;  2CHB D;  3S15 B;  1F9S A;  2N78 A;  3I8Z A;  4RHS A;  1OO9 B;  3L7Z C;  4UP9 A;  1X3E A;  1VQN A;  4XYO A;  3KBG A;  3I4N B;  5DEH A;  3K7U C;  1Y1W G;  4JV5 L;  4BBS B;  2GA4 B;  5ELO A;  4IOC A;  1X32 A;  2OCE A;  4OO1 I;  4FYD A;  2BOS A;  2R61 A;  1D1I A;  2A6E C;  3KF6 A;  1AFP A;  3HOU G;  2VY3 A;  1K3R A;  2PMZ E;  3W1B A;  2EE1 A;  4A3M G;  3MEF A;  2NUC A;  2D0O A;  3HOV H;  2D0P A;  4LFA Q;  2VQE L;  2OQ0 A;  1ONL A;  5JEA H;  4K6D A;  5CR3 A;  3ITP A;  4XYQ A;  1EY6 A;  3MXN A;  1A15 A;  4N8X 1;  3SGI A;  5C44 H;  1Q82 C;  4HMI A;  2JA5 H;  5M5Y H;  1GUG A;  4A3D H;  3J81 E;  1OXS C;  2JK8 A;  4CKB A;  4GS3 A;  2B29 A;  1C0A A;  5JPM C;  3CPF A;  4DN4 M;  4O1N A;  4X3K A;  3CAM A;  2RDG A;  1V1Q A;  1XPO A;  2G9H D;  3HEJ A;  3U9S A;  3RLO A;  1J6Q A;  1BCP C;  4DV4 L;  1J5E Q;  2HD3 A;  3PV0 A;  1AEX A;  5IY0 A;  1HFN A;  1TWF H;  1SMY D;  4G7H C;  1JJ2 A;  4LW1 A;  1HJP A;  5KYI A;  1RKN A;  3GTG B;  4A75 A;  1KDC A;  1PTO D;  5JJK A;  1Y8O B;  1PH3 A;  2G9D A;  4DK1 A;  2EYL A;  5ELE A;  3HOZ H;  2AQ3 B;  1NBW A;  1L1O B;  3G7L A;  4KKU A;  2A6H D;  3FEW X;  2NVY H;  4JI5 Q;  1Z6H A;  3C46 A;  2KEN A;  3UI2 A;  4CJ2 C;  5C3E G;  3MVV A;  1U5K A;  5CGK A;  5IWA L;  1FL0 A;  4JK1 C;  3ONA B;  5C3X A;  1JQY D;  1TY0 A;  3DHQ A;  1FJG L;  3AFP A;  4PNY A;  3GV6 A;  5IOD A;  1STN A;  1E2Z A;  4LK1 C;  4HCS A;  5GAE C;  2LXJ A;  4DR2 L;  2E2J H;  3AFQ A;  3UE0 A;  4LF8 Q;  1YI2 A;  1QUQ B;  2VQF L;  5C4J H;  4LAA A;  2C5C A;  1Y1W H;  1VQH A;  1SEB D;  3X3N A;  2VB2 X;  1IBL Q;  3LGJ A;  1IBM Q;  4HJA A;  3I4O A;  2F0I A;  4CJ1 B;  4DAV A;  1HNW L;  5I2X A;  3D4D A;  1Q12 A;  3HOU H;  5ELF A;  3NXW A;  4TKO B;  1ROD A;  5C4X G;  2L1B A;  3GV3 A;  1T5X D;  1X6O A;  4A3M H;  1XNR L;  4QUF A;  4NXM L;  2R7Z G;  4NXN Q;  1P16 A;  1SE4 A;  3MWY W;  4BY7 B;  2B63 B;  1WTH A;  4R8N A;  1VQA A;  3E9H A;  1AH9 A;  1S72 A;  2I5L X;  4PQX A;  1OXU A;  1HXY D;  3DEO A;  1RHP A;  4C3I H;  3P7J A;  3AB9 A;  2OTL A;  4A76 A;  4X62 L;  1EY8 A;  4F7X A;  1NJI C;  5IE8 A;  1JB7 A;  5M5X H;  3OW2 A;  1SAP A;  1PRT C;  2B8F A;  2JA8 H;  2KCT A;  1N34 Q;  3I4M G;  2K05 A;  1DOL A;  3VYU A;  4BXX G;  4QIW E;  5IYB G;  3M85 A;  4HSV A;  1SE3 A;  2PW5 A;  2WKD A;  3HP3 A;  4JBM A;  1KRS A;  1D5Z C;  3FRP B;  2Q8T A;  3OHX C;  2L0C A;  2RF4 A;  1YEZ A;  3Q23 A;  4FP5 D;  4ODG A;  5LMU L;  3PCO B;  5C3E H;  2F0V A;  2HDM A;  1CM9 A;  1T9H A;  1NNX A;  1VMC A;  2B3G A;  3FKI H;  3BZD B;  3WOF A;  3PUZ A;  3IAY A;  3SE0 A;  1TS5 A;  3Q6S A;  4HJ9 A;  4B3S L;  1C4Q A;  1N32 Q;  3URY A;  4K8I A;  1IL2 A;  1VS0 A;  1STH A;  4O0A A;  3HOX B;  1ENF A;  3OTO Q;  4DV6 Q;  3ER0 A;  4P73 A;  2KA7 A;  1NSN S;  3PF4 A;  2FJ2 A;  2ZT9 C;  3H6M A;  1DM0 B;  1LT5 D;  4F88 A;  3QJY A;  4DV0 Q;  1GUS A;  4LFC L;  1QVF A;  2K04 A;  3G6J B;  3S14 H;  2B2W A;  1RD9 D;  4IUU A;  4OL7 A;  4A3I G;  1F2L A;  1HTL D;  5ELC A;  2Z0S A;  2CH4 W;  2R7Z H;  4L5R C;  1YNX A;  1ZYR C;  5J22 A;  4ZKB B;  2HUG A;  3TRZ A;  2K5D A;  3S1M B;  1XJV A;  3RLF A;  2A68 C;  4ZKC B;  2M2L A;  1MI2 A;  1JC7 A;  1Y69 U;  2CW0 D;  1WVL A;  2WP8 J;  4EVO A;  3FMC A;  3UDF A;  1WTR A;  4CDD C;  1L0X B;  1O78 A;  3M4O B;  2IHF A;  3K81 C;  3S1N B;  5CC4 A;  4OWW B;  4JI2 L;  2K1B A;  1KAW A;  2F0K A;  4DR1 L;  3HRZ C;  2JQO A;  3NQI A;  4B3M L;  5H1S E;  2EY1 A;  1TT2 A;  2EIF A;  1B70 B;  5IGD A;  2A69 D;  3NWT A;  4GKK Q;  5KND A;  2V1C C;  3RNU A;  3GTO H;  3S2H H;  1VMP A;  3UE1 A;  3NQT A;  1SYG A;  3H3V I;  2EJM A;  1PH8 A;  4EQ5 A;  3IFT A;  1FGU A;  3PO3 H;  4V0B A;  3P20 A;  2UXD Q;  2XWJ B;  1Q81 C;  3TZU A;  4DR4 Q;  4PMW A;  4ZYS A;  1P8L A;  1AW7 A;  5IIF A;  2NVT B;  1QVG A;  1XNQ Q;  2E2H H;  1XYI A;  5A2Q L;  2F0Q A;  2ZXR A;  1GD7 A;  1HPC A;  2NZO A;  1HRJ A;  3GTK B;  3KJO A;  1BCP B;  1Y8N B;  4X3U A;  3T53 B;  3MXG A;  3JAM i;  3D6W A;  4YHH Q;  1L1O A;  1GJX A;  2K14 A;  2K01 A;  2SNM A;  2VNU D;  5EKL A;  2WB1 B;  4QIW B;  5JJL A;  4ZUJ A;  4DV5 Q;  4KN7 C;  4Q5V A;  4J6H A;  2DY8 A;  2I5H A;  4FO2 A;  4N8F A;  3SDZ A;  1UAP A;  3RUZ A;  4OEL B;  1BVS A;  4DUZ Q;  4NW2 A;  4ZUI A;  4A3F H;  5I6Y A;  2NWG A;  1STG A;  3BU2 A;  3VYS A;  1JWS D;  4AYB B;  1H9K A;  4H44 C;  4JI4 L;  2NVX H;  1A8V A;  4JI1 Q;  1S5F D;  1ICW A;  4A3E B;  1ZKO A;  1HNZ L;  1X3G A;  3DUZ A;  3OWE B;  3HOY G;  2P5Z X;  2ZM6 Q;  3O13 A;  3DMU A;  1KTK A;  1FR3 A;  1Z47 A;  2X6L A;  2VUM G;  2R3Z A;  1BF4 A;  1YJ9 A;  2FXQ A;  3H0G B;  2F03 A;  1G8Z D;  2RHQ B;  2F0N A;  4DGZ A;  3K0X A;  4GN5 A;  1SN8 A;  2VB3 X;  1IKL A;  1I94 Q;  3VR4 A;  2J7Z A;  2KVM A;  4N9T A;  1VF5 C;  4DV1 L;  2RQX A;  1PLF A;  2PYK A;  2D2C C;  4YWK A;  1UUP A;  1DZ1 A;  1HTP A;  4DR6 Q;  1DYQ A;  2PNR C;  2JSO A;  1OXV A;  3D6C A;  3I55 A;  3CKI B;  1W3S A;  1VQC A;  5CV9 A;  1N33 L;  2WAQ B;  4OIK A;  1W2B A;  2F0P A;  3EQL C;  4Y7N B;  1KXL A;  1ML0 D;  4U67 3;  3MXN B;  3NE5 B;  1U0L A;  2QCP X;  5E3F A;  5IT9 E;  3PMF A;  1STA A;  4PV1 C;  5C0X J;  1SE2 A;  4X64 L;  1GHJ A;  4A3G G;  3S1Q B;  2L12 A;  3CU7 A;  3CRL C;  4I7A A;  1SMY C;  1YVC A;  1JWM D;  2IY5 B;  3U58 A;  4OX9 Q;  3K59 A;  1L1O C;  1PRT B;  1PA6 A;  1R9T B;  2F0O A;  1D2B A;  1PTO C;  1EU4 A;  2JJQ A;  4KTA A;  4ZAI A;  5IGG A;  1PH7 A;  2K75 A;  2RSN A;  5J1Z A;  4XQJ A;  4X3S A;  5G3L D;  1IW7 D;  2A6H C;  4JBW A;  1TWA B;  2J4X A;  2C9O A;  1JMC A;  3TME A;  3I4N H;  3CP0 A;  3K80 C;  4FF3 A;  1QIL A;  3PSI A;  2JA6 G;  4BBS H;  1ASZ A;  1B53 A;  1VQ5 A;  2F0W A;  4IFD H;  2FFK B;  1QNU A;  1VQP A;  3CRK C;  1F9Q A;  4KHP Q;  5CV8 A;  4HN7 A;  4GN3 B;  3TZD A;  3HOY H;  5FLX L;  4ID6 A;  1GXD C;  2PZU A;  4LJZ C;  3IKJ A;  5CV5 A;  2VUM H;  1TKW B;  3W5O A;  3I4M B;  1YHB A;  3J81 j;  1ET9 A;  1RIP A;  5C0X G;  3K7A H;  3CXC A;  1S40 A;  3ULP A;  2MGS A;  4POF A;  2Q2I A;  1F2Y A;  5D65 A;  1K0R A;  2XVS A;  1KRT A;  4JI7 Q;  4LFB Q;  4DA2 A;  2DUD A;  2MO0 A;  1XMQ Q;  2UUA Q;  2O2L D;  1K9M C;  3FPU B;  1I6H H;  1GOZ A;  3NWS A;  1CFM A;  5I2Y A;  1BOS A;  1ZEQ X;  1R4Q B;  5FJ8 H;  2H5X A;  2F3V A;  4OIJ A;  1XPR A;  5JEA J;  3OYY A;  1G29 1;  1TWC B;  4RCO A;  4JI6 L;  3QOJ A;  3D8G A;  5AJ3 L;  3PO2 B;  3A8J E;  3KLS X;  3GTM B;  2IW3 A;  5C3W A;  1IBK L;  4LF5 L;  4ALP A;  1K28 A;  3C1F A;  4NKL A;  5LMN W;  4K2L A;  4B3R L;  4G4K A;  4FXD A;  2UUC Q;  2KED A;  4DUY L;  3GTG H;  5CV4 A;  2UU9 L;  1LTL A;  1X3Q A;  2LMC B;  4WJ3 M;  1NR2 A;  1IYV A;  3CC4 A;  1I6V C;  2N8N A;  4A3G H;  2K5N A;  4ZQ3 A;  2UUB L;  1X9N A;  1JOK A;  3HOW G;  3OSO A;  3KJP A;  3H15 A;  4QQB X;  1VQE A;  1XX8 A;  2CQO A;  1X56 A;  1V1O A;  1H9M A;  1EEI D;  3SEB A;  3PUW A;  1LTG D;  2CCZ A;  1U9R A;  3GP7 A;  2B8G A;  1A3T A;  4IPH A;  5COY A;  4JI3 Q;  1G91 A;  4RGO S;  4GKJ L;  1V43 A;  5T1I A;  5D3I B;  3K5L A;  3MFG A;  3G48 A;  5JEA G;  1LTA D;  2JA6 H;  2AUJ D;  4TQU S;  4DR7 L;  5C44 G;  4RCN A;  2QDB A;  4A3B B;  2EYP A;  4A3D G;  5IYD H;  1HZB A;  3M7N A;  4A3C G;  2KEC A;  4EQN A;  4LF7 Q;  3U50 C;  4JPB W;  3K58 A;  2QA4 A;  1QZH A;  4JCV E;  1I4G A;  2KCM A;  2B2T A;  2K03 A;  3PUV A;  2NVQ B;  1HNX Q;  2Q2T A;  2KJX A;  4POG A;  2G5D A;  4LF9 L;  2IX1 A;  3HZX A;  2FHT A;  3NP8 A;  5I9O A;  1JWU D;  1N36 L;  4K0K Q;  2R7F A;  3CC7 A;  1ENC A;  4QGU A;  4NMZ A;  1DJR D;  2F0H A;  2RDH A;  1S3O A;  1X54 A;  2QF7 A;  4KK7 A;  2RVL A;  4JI8 L;  1EYD A;  4R4I A;  3W3A A;  1LT3 D;  2EQS A;  2F4V Q;  4C3J G;  1EY7 A;  4P72 A;  1O7L A;  1STB A;  1EUJ A;  1ILQ A;  1CTM A;  3EBE A;  4DR3 Q;  3DM3 A;  1VQG A;  4GKK L;  5J39 A;  1NUC A;  2CW0 C;  3T51 B;  2QIL A;  2XWB B;  1PYW D;  2FMM A;  1RF2 D;  4UHV A;  4BY1 B;  5DNF A;  1E24 A;  1CA5 A;  3DEP A;  2NN6 I;  4DR5 L;  1EY4 A;  1RTN A;  2JN4 A;  3IFD A;  4ZLT F;  4XQN A;  5ELD A;  5M3F B;  3E0E A;  3U4Z A;  4HIK A;  1JB3 A;  2B2U A;  1J8I A;  3HOW H;  1S5E D;  5IYC H;  2F0U A;  1E22 A;  1DXM A;  3WWV A;  2X69 A;  4HJ5 A;  5JVH 3;  1XXG A;  2EY2 A;  2A69 C;  1G2T A;  3TP5 A;  3PIP 3;  2DJG C;  5E4X A;  3GTJ B;  1TWG H;  2IHE A;  3VR5 A;  2ZJP A;  2R93 G;  5M9O A;  5M5W H;  4KJO A;  4DV3 L;  1RL2 A;  4GLX A;  5IP7 H;  3T1Y L;  3GO5 A;  3GTL H;  3QB3 A;  2EXZ A;  1NMF A;  2F0F A;  4IAL A;  3CCQ A;  4A3C H;  4C3I G;  1Y1V G;  1HZ9 A;  3I72 A;  4R4Q A;  4R8I A;  3NBH B;  3K5O A;  1EWI A;  1PTO F;  2HIX A;  1AE3 A;  5E7N A;  4DUZ L;  1K73 C;  1SR3 A;  2DGY A;  2XRS D;  3KLW A;  1ESF A;  2B2T C;  4DAM A;  5L37 A;  3RZD H;  4G57 A;  2JA8 G;  1QNK A;  1I4H A;  3H91 A;  3NHH A;  2E5L L;  4OO1 H;  5LL6 X;  4GLV B;  1PXU A;  4JYA Q;  4HID A;  1QCB D;  1UWV A;  2ZM6 L;  4AQY Q;  1DOM A;  2E2I B;  2YYZ A;  4NDX A;  3I7F A;  4BWG B;  1M4V A;  1MHW C;  1IYU A;  2VW9 A;  1JOQ A;  4X66 L;  1HA6 A;  5HGT A;  1UE7 A;  1PTO B;  3J81 L;  2L11 A;  2XN9 C;  5FKA C;  1SNO A;  3TS2 A;  4C3J H;  4GN4 B;  2XIW A;  1PZK D;  3ERO A;  4K5W A;  3GD7 A;  3S2D H;  4A3J H;  2RA4 A;  1C7Y A;  2ASB A;  2Y0S B;  3FKI G;  4G7Z C;  3GTQ H;  2EYJ A;  1PFN A;  1CA6 A;  2NZ1 D;  1VQ9 A;  2JYO A;  4I65 A;  3DLL A;  4ME3 A;  4EQP A;  1XPU A;  1SRO A;  1SYF A;  1HZC A;  2HCI A;  2B2U C;  4EQO A;  1JCK B;  4X65 L;  1I50 H;  4IPD A;  1AN8 A;  2IX0 A;  1H9J A;  4NB3 A;  3S16 B;  2XTI A;  1SBB B;  2ATW A;  1LM0 A;  3E9I A;  4C3H B;  4IO9 A;  4IN3 A;  2K5H A;  1G51 A;  1VDZ A;  4LUV A;  5FLM G;  3I90 A;  3JAM L;  4GOP C;  2F52 A;  1PDQ A;  4PG3 A;  1XMO L;  3DM1 A;  2NVT H;  1YIT A;  1GKH A;  4IUQ A;  3CD6 A;  2R93 H;  1EIG A;  1SFO B;  1VQ7 A;  1IL8 A;  4HCE A;  1WTQ A;  2K33 A;  3F2B A;  1KHI A;  3BDC A;  1EEF D;  1K83 B;  4JW0 A;  1TU2 B;  3K5M A;  3SK6 A;  5IGC A;  2OWO A;  4LNQ A;  1Y1V H;  4DNT B;  2ICI A;  5CBE E;  2PW7 A;  2PQA B;  4RG1 A;  3LX0 A;  4FF2 A;  4L5Q A;  2Z8L A;  4K5V A;  1RCV D;  1B9N A;  2JE6 I;  2RSO A;  2NTS A;  1RTO A;  4A93 B;  1KL9 A;  2XNA C;  1YHA A;  4DK0 A;  1CZW A;  5IGE A;  3I3C A;  1B4O A;  1YBY A;  4B3T Q;  1K8O A;  3E6Z X;  1PYB A;  2RDF A;  1EQT A;  5IP9 G;  1F9P A;  3MZ5 A;  1O80 A;  2PMZ B;  2KQ3 A;  1AZP A;  1A2U A;  5EAY A;  3EVQ A;  1IW7 C;  1HA5 A;  2WIN B;  2E75 C;  2V4D A;  3PO3 G;  1I3Q H;  4NPS A;  3KBX A;  1EIH A;  3H0G H;  4YIJ A;  3S1R H;  2BH2 A;  2VZA A;  4XXE A;  1TWH H;  1V9P A;  4OHJ A;  4KY6 A;  3HG9 A;  4Q0F A;  2ES2 A;  2BE5 D;  2HCC A;  4H02 A;  1F2Z A;  3AMU A;  4UY8 C;  2EJG C;  1Q90 A;  1YNJ D;  5HGQ A;  3I2Z A;  4U68 A;  3W1G A;  2AQ1 B;  2GN5 A;  4RAU C;  2B39 A;  2EXD A;  4HED A;  2UXB L;  2NB0 A;  1LTI D;  1YHQ A;  1B1Z A;  2JP1 A;  3DXJ C;  3HOV B;  5FLM H;  4QJF A;  4A3K G;  2UXC L;  5CMD A;  4S3S A;  2HHH L;  2EYO A;  3AQQ A;  1XWE A;  1WD1 A;  4A3F G;  2JA5 B;  5M5Y B;  4A3D B;  4XQQ A;  2KBN A;  2PI2 E;  3NPP A;  5IGF A;  5DM6 3;  4IOA A;  1HHV A;  2IX3 A;  1II3 A;  4DV7 Q;  3T13 A;  1CHQ D;  1JJG A;  1SYE A;  2OXP A;  1X65 A;  1PHJ A;  1KAB A;  1R9T H;  2O5I C;  1KNE A;  4F87 A;  1Z9F A;  1MJE A;  5C5M A;  2EYM A;  3E3X A;  3GTP H;  5KNC A;  2A8V A;  3CCV A;  1YNN D;  3MAQ A;  3CCM A;  4X6A H;  1HQM C;  1HR0 Q;  4LF6 Q;  4LF7 L;  1K8M A;  3J81 i;  3HOZ B;  3CMA A;  2PNH A;  4UPA A;  1EQQ A;  4LF4 Q;  5IP9 H;  4JOI A;  4DV2 Q;  2WKC A;  3L0O A;  4BBR G;  2BCO A;  1HNX L;  1GUN A;  1SNP A;  1NTG A;  3NEL A;  2F0G A;  4YY3 L;  1TS3 A;  3HFZ B;  3S9W A;  1B44 D;  1BCP F;  1WTO A;  3T1H L;  1B3A A;  4Z9C B;  1WCM H;  1TQO A;  3OIP A;  5D3D A;  5EPJ A;  4B08 A;  2E2D C;  4K6L A;  3NBH A;  2PZW A;  4IFD J;  2IL8 A;  2PZT A;  4IQZ A;  2JA7 G;  1UEB A;  2Z4H A;  1BUV T;  2WV6 D;  3Q0A A;  5C4J B;  1Y1W B;  5C4Z A;  3CQZ H;  2FIN B;  1LAB A;  3PIO 3;  1Q86 C;  2ZJQ A;  1UE1 A;  2K5Q A;  2J0T D;  4JC0 A;  2F3I A;  3VR3 A;  5LMN L;  4JV5 Q;  3RZO B;  3PO2 H;  3HOU B;  2K5W A;  4QUC A;  1HFG A;  3GTM H;  2GVA A;  5IOC A;  5FLX c;  4A3M B;  2QKI C;  4X3T A;  1B3Q A;  1A62 A;  2TMP A;  1DOK A;  4A3K H;  2EY5 A;  3QIA A;  3J7A V;  1HUM A;  1WTW A;  1UNS A;  4MTK A;  3H3V H;  2R92 H;  2EJF C;  1EYC A;  4FXK C;  2VQE Q;  3I4N G;  4HIO A;  2Z1C A;  3NSW A;  2Z6K A;  2IT1 A;  1LTT D;  1XTD A;  4BBS G;  3UDX A;  4KD4 A;  2QGQ A;  1EIY B;  3P75 A;  4IFD G;  1B8A A;  1PYS B;  1CK1 A;  2E8G A;  3ND8 A;  2VL6 A;  1FNW A;  4LFA L;  2I0Q A;  1EOV A;  3VYT A;  5M5X B;  1VQK A;  4CHT B;  3D4W A;  4HMJ A;  4DV4 Q;  3QWN A;  3JC6 6;  1TII D;  4EGV A;  5C5L A;  1Q3L A;  1EFI D;  1T5E A;  2KOL A;  3N6R A;  1AP0 A;  1KLU D;  4A3B H;  1J5E L;  4ZRZ A;  4JOI C;  4M8A A;  3FPP A;  3PGZ A;  4BBR H;  5FJ8 G;  1IHZ A;  1Q46 A;  5C3E B;  3K6O A;  3KF8 A;  4GOP B;  3A56 A;  5A35 A;  1VQM A;  4QF4 A;  2YU9 H;  3S17 H;  4R4T A;  2F0J A;  3SK5 A;  5EBD A;  1PRT F;  5M3M H;  2PQA A;  3Q22 A;  2L5T A;  3VA5 A;  3VYR A;  4Y52 H;  5IWA Q;  2E74 C;  2QEJ C;  1M90 C;  2JA7 H;  2KHI A;  2BA1 A;  1Z7T A;  2CKZ B;  2EYH A;  4WRD A;  2ZTD A;  5FOB B;  3CCU A;  1FJG Q;  4JI5 L;  4KY7 A;  5FO8 B;  5TSS A;  4DXF A;  1J9O A;  1M1K C;  4UAI A;  5EQ0 A;  2A74 C;  2QW7 A;  1SSO A;  1CSQ A;  4IPG A;  4DR2 Q;  3A5U A;  4HSP A;  1CQV A;  4L5T A;  3M3Y H;  2VQF Q;  1VF7 A;  3NEN A;  3WDN A;  5C4X B;  2K6A A;  1MIU A;  4LF8 L;  3KK7 A;  2R7Z B;  1HNW Q;  1M8A A;  3S15 H;  1JR0 D;  1NR4 A;  1TXY A;  1JOR A;  3W2D A;  5DAU A;  3TBI B;  1JJC B;  1D6E C;  1FYC A;  3A7L A;  1IBL L;  4CJ0 B;  3KUP A;  3D31 A;  1XNR Q;  4NXM Q;  1IBM L;  4C2M B;  4FF4 A;  2JA9 A;  5M3F H;  2Z6K C;  1CT1 D;  3FDT A;  1VQJ A;  5IT9 L;  3C2P A;  4IJL A;  3QO2 A;  5IYD G;  1EYG A;  3S24 A;  2MFI A;  4NXN L;  1LT4 D;  1SJH D;  2LKV A;  3ERQ A;  1YJN A;  2H1E A;  2OQK A;  5CV7 A;  1C9O A;  4X62 Q;  3DWA A;  2F4I A;  3GTJ H;  1EFW A;  5FO7 B;  4APV A;  3R2T A;  4BY7 G;  2B63 G;  4FVM A;  2BH8 A;  1GVP A;  1HH2 P;  3F8T A;  1GO3 E;  1R4P B;  3ERS X;  3T16 A;  4CDE C;  3OWF A;  4A4I A;  1B9M A;  1E1T A;  4WJW A;  4P71 A;  3CCR A;  3S2H B;  2KCN A;  2Z4I A;  2K28 A;  3EIV A;  4LUO A;  1HUN A;  4OON A;  4BS9 A;  1N34 L;  3PO3 B;  4AH6 A;  1RJT A;  1PFB A;  3MA2 B;  2Q2H A;  1D1K A;  3NTI A;  3LWE A;  4RWS C;  4L6T B;  1EWH A;  5LMU Q;  1IYJ B;  3J80 L;  2E2H B;  2N49 A;  1D7Q A;  2SNS A;  3NK9 A;  1GUW A;  3J7A F;  1LLR D;  1SE8 A;  4O42 A;  1YJW A;  1GHK A;  5ELB A;  1VQF A;  2MUY A;  3RMH A;  4B3S Q;  1VQB A;  1PTO H;  4H7B A;  3STB D;  1FGB D;  3PQI A;  1GUO A;  3GDE A;  4RGT A;  1PH6 A;  3KFU A;  4QY7 A;  5IYC G;  2CWP A;  2JEA I;  1BO0 A;  3A5Z B;  3VR2 A;  1O7I A;  3TP7 A;  2RCN A;  1N32 L;  4A3I B;  1I4X A;  1MJC A;  1PH9 A;  2FMC A;  1JOO A;  2F1M A;  2SEB D;  2XSC A;  3DWP A;  1Q8K A;  5EPL A;  1N9W A;  4LFC Q;  3TDQ A;  5KIX A;  1A63 A;  4YCV A;  1OTC A;  3OTO L;  4MHE A;  4DV6 L;  2K32 A;  3Q24 A;  1Y8P B;  5HY6 A;  2EY6 A;  4RMF A;  5C0X I;  1GM5 A;  1KAA A;  3KOJ A;  1H9R A;  3RN5 A;  2CFM A;  4DV0 L;  3HOX G;  1BBW A;  3ND9 A;  5IP7 G;  3OIQ A;  2F0L A;  1QB5 D;  1GUT A;  2DNE A;  3AEV A;  5E4W C;  1YIJ A;  3J81 c;  2IJ0 A;  2BE5 C;  1KD1 C;  3A8K E;  4K5X A;  2IWH A;  3CCL A;  1BXT A;  4KY5 A;  3J7A 5;  2N88 A;  1EQV A;  4PMC A;  2PPB C;  1LTB D;  4BY7 H;  2B63 H;  4OO1 G;  4JI2 Q;  5JAV A;  3ICE A;  1U4R A;  1YNJ C;  1TY2 A;  2LSS A;  1WTP A;  4DR1 Q;  1SFO H;  3A74 A;  4J15 A;  5BN3 A;  3FVQ A;  4B3M Q;  4GNX A;  1QJO A;  3HGB A;  5DM7 3;  1G2S A;  1H9S A;  1A0I A;  1WI5 A;  3BVZ A;  1A3V A;  1QG7 A;  4PZ8 A;  3MTS A;  4F8M A;  4PMB A;  1DCZ A;  3CF5 A;  4RFB A;  2MJ8 A;  2ZXP A;  1JIC A;  4A3J G;  1G6P A;  5JJZ A;  1X3P A;  1IZ6 A;  4XT3 B;  5IGB A;  4FF1 A;  3JAM c;  2DN8 A;  2L55 A;  5GAD C;  1G6Z A;  2QDL A;  1B7Y B;  4P74 A;  1CQF A;  2UXD L;  4KKT A;  4L8J A;  3ULL A;  4HTH A;  1AZQ A;  1PZI D;  4DR4 L;  1E7Z A;  1YNN C;  4WFN 3;  1LO5 D;  3L3O C;  4DKA C;  2RHS B;  2O5J C;  3F1Z A;  3BZC A;  4RGN A;  1TS2 A;  1XNQ L;  3PIP A;  4GOP A;  1KDB A;  2O4X A;  4KHZ A;  4UDU C;  1JE4 A;  1HQR D;  3R93 A;  3OW7 A;  4YHH L;  4CGY B;  2PI2 A;  1UEA B;  3HOX H;  1VQI A;  5EKI A;  4QMG A;  1MKH A;  4JI0 Q;  1CKN A;  4LMQ D;  3HOY B;  3EJI A;  4DV5 L;  4JI4 Q;  3MEH A;  3BG3 A;  1OXT A;  4RGM A;  2VUM B;  4YWL A;  1SLJ A;  2WB1 G;  1HNZ Q;  1H95 A;  2NN6 H;  3SVM A;  5BR8 Q;  1B50 A;  3K7A B;  4ZK9 B;  1LUZ A;  1WYD A;  4JI1 L; 
#chains in the Genus database with same CATH homology
 1Z47 A;  4YWM A;  3S1M H;  2VUM G;  5HGQ A;  3I2Z A;  2UXB Q;  1YJ9 A;  2FXQ A;  4AYB G;  3W1G A;  2MO1 A;  2GN5 A;  2L15 A;  3D0F A;  4GNX C;  2EXD A;  2RHQ B;  1UE6 A;  1NMG A;  2UXB L;  3K0X A;  3I56 A;  4A3E G;  4GN5 A;  5DLQ E;  1YHQ A;  4XIG S;  2UXC Q;  3RR5 A;  4AIM A;  4EX5 A;  1SN8 A;  3M9B A;  1K8G A;  4MZ9 A;  5FLM H;  4DV1 Q;  3M4O H;  2HHH Q;  4QJF A;  4A3K G;  3HKZ G;  1I94 Q;  2UXC L;  1WJJ A;  3TQY A;  3J80 i;  3UDI A;  3S1N H;  2A1A A;  2CWA A;  3KDF B;  4DV1 L;  2HHH L;  3AQQ A;  3ZJY C;  1I94 L;  3H0G G;  4YWK A;  4A3F G;  3S16 H;  5GRO A;  2KBN A;  4C3H H;  4DR6 Q;  1N33 Q;  2PI2 E;  3HOV G;  1OXV A;  4IOA A;  2NN6 G;  3I55 A;  3TRE A;  4DV7 Q;  1W3S A;  2YV5 A;  1VQC A;  3PUX A;  1N33 L;  3CME A;  4DR6 L;  1ASY A;  1JJG A;  1W2B A;  1X65 A;  2Y0S E;  1PHJ A;  1R9T H;  3G4S A;  1VQ6 A;  4DV7 L;  3PUY A;  1KXL A;  1Z9F A;  3BJU A;  1MJE A;  2JA5 G;  3MXN B;  1U0L A;  3GTP H;  2A8V A;  4X64 Q;  4BA1 I;  3CCV A;  1LYL A;  1K83 H;  3CCM A;  5C0X J;  4R4C A;  1VQO A;  2WAQ G;  2MNA A;  4X64 L;  1HR0 Q;  4X6A H;  4A3G G;  4LF6 Q;  4LF7 L;  4UP8 A;  4YCU A;  1HZA A;  3J81 i;  1YVC A;  3CMA A;  1PVO A;  2YTV A;  2PNH A;  1HR0 L;  3FP9 A;  4UPA A;  4HIM A;  3U58 A;  4OX9 Q;  1EQQ A;  4LF6 L;  4LF4 Q;  5IP9 H;  4JOI A;  1L1O C;  1JE5 A;  4DV2 Q;  3RLN A;  1PA6 A;  4YY3 Q;  1NY4 A;  2QEX A;  3L0O A;  1K8A C;  4A3B G;  3T1H Q;  2JJQ A;  4BBR G;  1HNX L;  4OX9 L;  4A93 H;  1FVI A;  1PH7 A;  4LF4 L;  2K75 A;  1NTG A;  3NEL A;  4PZ6 A;  4OWX B;  3AYH B;  2VS1 A;  4YY3 L;  4DV2 L;  3PF5 A;  3HFZ B;  2I5M X;  3T1H L;  1CKO A;  3KYH C;  1X55 A;  1WCM H;  2C35 B;  3GTK H;  2Q2U A;  3KF8 B;  3HOZ G;  3RZO H;  4JBW A;  4TVA B;  4IFD J;  1JMC A;  3I4N H;  3M4Q A;  3CP0 A;  4WJ4 A;  3K80 C;  3PSI A;  2JA6 G;  1X3F A;  2A19 A;  4BBS H;  5GQO A;  1ASZ A;  2JA7 G;  1UEB A;  2ZTE A;  1VQ5 A;  3RN2 A;  3CCS A;  4O2D A;  3U4V A;  2JEB I;  1VQP A;  3CQZ H;  4KHP Q;  3HOY H;  4GN3 B;  5LMN Q;  2ZJR A;  2KHJ A;  4HJ7 A;  1Q86 C;  1HR0 W;  4JBK A;  3M4P A;  1Q7Y C;  2ZJQ A;  1UE1 A;  2VUM H;  4JC0 A;  3W5O A;  4KHP L;  2F3I A;  2N78 A;  5LMN L;  4JV5 Q;  1YZ6 A;  3L7Z C;  4UP9 A;  1X3E A;  3PO2 H;  1CUK A;  1VQN A;  2YTY A;  1YHB A;  3J81 j;  1DGS A;  1RIP A;  2YTX A;  5C0X G;  3K7A H;  3GTM H;  3K7U C;  3CXC A;  1S40 A;  1Y1W G;  2GVA A;  5FLX c;  3ULP A;  4POF A;  2Q2I A;  4A3E H;  4JV5 L;  1K0R A;  1KRT A;  4JI7 Q;  5ELO A;  4IOC A;  2NZH A;  4LFB Q;  2OCE A;  1A62 A;  2DUD A;  2MO0 A;  1XMQ Q;  4OO1 I;  2UUA Q;  4A3K H;  3KDF A;  1K9M C;  4JI7 L;  1I6H H;  1WCM G;  1VQ4 A;  4LFB L;  3KF6 A;  1XMQ L;  2UUA L;  4JI6 Q;  3H3V H;  5AJ3 Q;  2R92 H;  3HOU G;  2VY3 A;  2WB1 E;  1K3R A;  2PMZ E;  5FJ8 H;  2H5X A;  3B6Y A;  3HKS A;  3ULJ A;  4DK6 C;  2VQE Q;  4HIO A;  5JEA J;  1XPR A;  2Z6K A;  3OYY A;  1G29 1;  2IT1 A;  4JBJ A;  3W1B A;  4A3M G;  1IBK Q;  1XTD A;  3MEF A;  2D0O A;  5AJ3 L;  3UDX A;  1EIY B;  2QGQ A;  4JI6 L;  4LF5 Q;  3HOV H;  2D0P A;  4BBS G;  4LFA Q;  2VQE L;  4IJH A;  2OQ0 A;  4R4O A;  4IFD G;  1B8A A;  1PYS B;  4B3R Q;  4DUY Q;  1IBK L;  4LF5 L;  2E8G A;  4ALP A;  1KQS A;  2VL6 A;  2UU9 Q;  4LFA L;  5LMN W;  2HIV A;  2I0Q A;  4AYB E;  1EOV A;  1AE2 A;  3SGI A;  4B3R L;  5C44 H;  1Q82 C;  4DUY L;  2UUC Q;  3GTG H;  4MNO A;  2JA5 H;  5M5Y H;  1VQK A;  2UU9 L;  4A3D H;  1OXS C;  2JK8 A;  4DV4 Q;  1LTL A;  4GS3 A;  2B29 A;  3CW2 C;  2UUC L;  3PO2 G;  1C0A A;  3CPF A;  3JC6 6;  1PV4 A;  4WJ3 M;  1XPO A;  3CAM A;  2UUB Q;  1V1Q A;  3HKZ E;  3RLO A;  1J6Q A;  4DV4 L;  3CC4 A;  2N8N A;  1J5E Q;  3PV0 A;  4A3G H;  2K5N A;  2UUB L;  2GVB A;  1X9N A;  3HOW G;  2AKW B;  4Y7N H;  3KJP A;  3H15 A;  4QQB X;  5IY0 A;  4A3B H;  1J5E L;  1TWF H;  1VQE A;  1JJ2 A;  4LW1 A;  4JOI C;  2CQO A;  1X56 A;  1HJP A;  3PGZ A;  1WOC A;  5ELN A;  2R92 G;  4BBR H;  4GKJ Q;  3PUW A;  5FJ8 G;  1EQR A;  4A75 A;  1Q46 A;  2CCZ A;  2IY5 B;  5JJK A;  3F2C A;  4IPH A;  1PH3 A;  4JI3 Q;  4GKJ L;  1V43 A;  3S1Q H;  4GOP B;  4OWT B;  2YU9 H;  1VQM A;  3S17 H;  4R4T A;  3HOZ H;  4DR7 Q;  1NBW A;  1L1O B;  3G48 A;  4JI3 L;  1SRU A;  5M3M H;  5JEA G;  2AMC B;  2PQA A;  5C4X H;  2NVY H;  4JI5 Q;  2JA6 H;  5IWA Q;  4Y52 H;  4TQU S;  4DR7 L;  1VCI A;  5C44 G;  2KEN A;  1M90 C;  2JA7 H;  2KHI A;  5GAG C;  2BA1 A;  1BKB A;  2CKZ B;  5C3E G;  2ZTD A;  3CCU A;  1FJG Q;  4A3D G;  4JI5 L;  1U5K A;  1HZB A;  1E3P A;  1L2F A;  4MTN A;  3M7N A;  5IYD H;  2WAQ E;  5IWA L;  4A3C G;  1FL0 A;  1M1K C;  1PH4 A;  4LF7 Q;  3U50 C;  1FJG L;  3AFP A;  4IPC A;  3STB C;  1CSQ A;  1TWA H;  4IPG A;  3A5U A;  2QA4 A;  4JCV E;  4DR2 Q;  1QZH A;  1N8R C;  4L5T A;  4C2M H;  3M3Y H;  2KCM A;  4LF9 Q;  3G71 A;  2VQF Q;  3PUV A;  5GAE C;  1VQ8 A;  1IXR A;  3TS0 A;  2XGT A;  2LXJ A;  4DR2 L;  1N36 Q;  2E2J H;  3AFQ A;  3NEN A;  3UE0 A;  1HNX Q;  2Q2T A;  4LF8 Q;  1YI2 A;  4POG A;  1JT8 A;  1QUQ B;  4LF9 L;  4KLK A;  4FDB A;  5C4J H;  1CKM A;  4P75 A;  2VQF L;  1Y1W H;  2IX1 A;  2HT1 A;  1VQH A;  1MIU A;  1N36 L;  4K0K Q;  4LWC A;  2R7F A;  4LF8 L;  1Q1B A;  3CC7 A;  4A3L G;  1HNW Q;  4QGU A;  4HJ8 A;  1IBL Q;  3LGJ A;  3S15 H;  1S3O A;  1TXY A;  1X54 A;  4JI8 Q;  1IBM Q;  4K0K L;  4HJA A;  3I4O A;  1JJC B;  1HNW L;  3I4M H;  1IBL L;  1Q12 A;  3I4N G;  2ID0 A;  3D31 A;  1XNR Q;  3HOU H;  4JI8 L;  4NXM Q;  4BXX H;  1IBM L;  5M3M G;  5IYB H;  4R4I A;  5C4X G;  2JA9 A;  2EQS A;  2Z6K C;  5M3F H;  4A3M H;  2F4V Q;  1X6O A;  1XNR L;  1L0W A;  4NXM L;  4P72 A;  4NXN Q;  1VQJ A;  1P16 A;  1PH1 A;  2R7Z G;  4IJL A;  1EUJ A;  5IYD G;  1PH2 A;  1EYG A;  3NEM A;  3PIO A;  3S24 A;  2F4V L;  3EBE A;  2MFI A;  4DR3 Q;  3DM3 A;  1VQG A;  1VQA A;  3E9H A;  4DK3 C;  4GKK L;  4NXN L;  1AH9 A;  1S72 A;  2K4K A;  4DR5 Q;  2I5L X;  1OXU A;  4DR3 L;  2MQH A;  2D62 A;  1YJN A;  5IT9 c;  4UP7 A;  1TWC H;  2OQK A;  1C9O A;  1E24 A;  4C3I H;  2NN6 I;  4X62 Q;  4DR5 L;  3GTJ H;  1EFW A;  4APV A;  4YCW A;  4BY7 G;  2OTL A;  2B63 G;  4A76 A;  2BH8 A;  1GVP A;  4X62 L;  1HH2 P;  3E0E A;  3U4Z A;  3F8T A;  4DPG A;  4HIK A;  1NJI C;  1GO3 E;  3ERS X;  5IE8 A;  1JB7 A;  3HOW H;  5M5X H;  3OW2 A;  2K5V A;  4A4I A;  5IYC H;  1E1T A;  3CCR A;  4P71 A;  2JA8 H;  2KCT A;  1WFQ A;  4BY1 G;  1N34 Q;  2AWO A;  1E22 A;  3WWV A;  3UDG A;  4GNX B;  3I4M G;  4BA2 I;  3EIV A;  4HJ5 A;  4LUO A;  4BXX G;  4QIW E;  4OON A;  5IYB G;  3M85 A;  1N34 L;  1UE5 A;  4AH6 A;  5M3F G;  4JBM A;  2Q2H A;  1KRS A;  1TWG H;  1SMX A;  4DV3 Q;  2IHE A;  2ZJP A;  5LMU Q;  2R93 G;  3T1Y Q;  2RF4 A;  1YEZ A;  2AHO B;  5M5W H;  4DV3 L;  5JJI A;  1RL2 A;  4GLX A;  1IYJ B;  5IP7 H;  5LMU L;  2N49 A;  4A3I H;  1D7Q A;  3PCO B;  1Y14 B;  3CCE A;  3T1Y L;  3GO5 A;  5C3E H;  3GTL H;  1NMF A;  3CCQ A;  1D8L A;  4A3C H;  4JI0 L;  1T9H A;  1Y1V G;  1SE8 A;  2B3G A;  1YJW A;  1HZ9 A;  3FKI H;  4R4Q A;  2BA0 A;  3NBH B;  1VQF A;  3PUZ A;  4B3S Q;  1EWI A;  5E7N A;  1VQB A;  1AE3 A;  2HIX A;  3J80 c;  4DUZ L;  1K73 C;  3STB D;  4HJ9 A;  1SR3 A;  2AWN A;  2DGY A;  2E5L Q;  4DAY B;  3KLW A;  3GDE A;  1QUQ A;  1PH6 A;  4DAM A;  4B3S L;  3RZD H;  3KFU A;  1N32 Q;  4QY7 A;  5IYC G;  2CWP A;  1VQL A;  1IL2 A;  2JA8 G;  1VS0 A;  2JEA I;  3A5Z B;  5BR8 L;  1O7I A;  2E5L L;  4O0A A;  2RCN A;  4GLV B;  1N32 L;  1MJC A;  4HID A;  4JYA Q;  3OTO Q;  1PH9 A;  1UWV A;  4A3L H;  4X66 Q;  3ER0 A;  4P73 A;  2ZM6 L;  3CPW A;  4DV6 Q;  1Q8K A;  4AQY Q;  1N9W A;  3J7Z C;  4LFC Q;  3PF4 A;  1A63 A;  2YYZ A;  4YCV A;  1OTC A;  3I7F A;  4JYA L;  4GLA C;  2VW9 A;  3OTO L;  4DV0 Q;  2NVQ H;  4X66 L;  4DV6 L;  1QZG A;  4OXP A;  5GAH C;  4AQY L;  5HY6 A;  4LFC L;  1UE7 A;  5C0X I;  4RMF A;  4XTC S;  1GM5 A;  3KOJ A;  1QVF A;  3RN5 A;  2CFM A;  4DV0 L;  4KI0 A;  3S14 H;  3HOX G;  1BBW A;  3TS2 A;  5IP7 G;  4A3I G;  2Z0S A;  4C3J H;  4GN4 B;  2R7Z H;  4L5R C;  2HQL A;  1YNX A;  1CKN B;  3GD7 A;  3TRZ A;  3S2D H;  3AEV A;  3KF6 B;  1NE3 A;  4A3J H;  1YIJ A;  1C7Y A;  3FKI G;  1XJV A;  2ASB A;  3J81 c;  1VQD A;  3RLF A;  4PZ7 A;  1KD1 C;  3GTQ H;  3CCL A;  3J7A 5;  3EN2 A;  1VQ9 A;  1E1O A;  2WP8 J;  3DLL A;  4ME3 A;  3UDF A;  4IFD I;  4X65 Q;  1XPU A;  1SRO A;  2B63 H;  3CC2 A;  4JI2 Q;  4BY7 H;  3ICE A;  4OO1 G;  2LSS A;  1HZC A;  4DR1 Q;  3IRB A;  2IHF A;  3K81 C;  1SFO H;  3A74 A;  3K8A A;  4J15 A;  2Y0S G;  1PFS A;  3BZK A;  2R6G A;  4X65 L;  4OWW B;  1I50 H;  4IPD A;  4JI2 L;  1PH5 A;  1KAW A;  2IX0 A;  4B3M Q;  4GNX A;  4DR1 L;  2ALY B;  4NB3 A;  4BY1 H;  2XTI A;  2ATW A;  2JQO A;  1LM0 A;  3E9I A;  4IO9 A;  1XMO Q;  4B3M L;  2WFW A;  2K5H A;  1G51 A;  4LUV A;  5H1S E;  5FLM G;  1A0I A;  1WI5 A;  2EIF A;  4LUZ A;  2ZTC A;  4DNI A;  1B70 B;  2F52 A;  4PZ8 A;  4GOP C;  4PG3 A;  1XMO L;  2NVT H;  4GKK Q;  1YIT A;  1GKH A;  2V1C C;  1EIF A;  3CF5 A;  3RNU A;  3CD6 A;  2R93 H;  3GTO H;  4A3J G;  1VQ7 A;  3S2H H;  1G6P A;  3UE1 A;  2K50 A;  3F2B A;  1KHI A;  1IZ6 A;  1PH8 A;  3H3V I;  3JAM c;  3L2P A;  4EQ5 A;  1FGU A;  3PO3 H;  5GAD C;  3A0J A;  1KIX A;  4JG2 A;  5J3B A;  2UXD Q;  1Q81 C;  2OWO A;  4LNQ A;  1Y1V H;  1KC8 C;  4DR4 Q;  4PMW A;  1B7Y B;  4P74 A;  1P8L A;  2PQA B;  4R1J A;  4RG1 A;  3ULL A;  2UXD L;  4L5Q A;  4DR4 L;  1E7Z A;  2JE6 I;  1Q1E A;  1QVG A;  1XNQ Q;  2E2H H;  2R7D A;  3VDY A;  3F2D A;  1BBU A;  4DKA C;  1GD7 A;  2NZO A;  1KL9 A;  2RHS B;  3F1Z A;  3BZC A;  1YHA A;  1XNQ L;  3PIP A;  2N3S A;  1OXX K;  3KJO A;  4QL5 A;  1QVC A;  1YBY A;  4B3T Q;  4GOP A;  1PYB A;  3FHW A;  3JAM i;  4YHH Q;  1L1O A;  4KHZ A;  5IP9 G;  4B3T L;  2K14 A;  1CSP A;  2VNU D;  4A93 G;  4YHH L;  5JJL A;  2PI2 A;  5EAY A;  3HOX H;  2LXK A;  1VQI A;  4DV5 Q;  1MKH A;  4JI0 Q;  1CKN A;  2I5H A;  3PO3 G;  3CCJ A;  2E2I H;  1I3Q H;  4DV5 L;  4NPS A;  1BVS A;  4DUZ Q;  4JI4 Q;  3H0G H;  4A3F H;  3S1R H;  2BH2 A;  1OXT A;  2VZA A;  1TWH H;  1V9P A;  3BU2 A;  4YWL A;  4L5S A;  1I5F A;  4JI4 L;  3G6E A;  1SLJ A;  2WB1 G;  1HNZ Q;  2NVX H;  1H95 A;  1A8V A;  2ES2 A;  5BR8 Q;  2K52 A;  4JI1 Q;  3TEH B;  2OTJ A;  1LUZ A;  3Q8D A;  1HNZ L;  1X3G A;  4H02 A;  3HOY G;  1WYD A;  4JI1 L;  2ZM6 Q;  5K36 G;  4UY8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...