3K80C

Structure of essential protein from trypanosoma brucei
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
103
Chain Sequence
SVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQHFYFPYIQVQPPHGQVAVIHGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system, rna binding protein
total genus 15
structure length 103
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k80C00
1TWCH 1N32Q 1EWIA 5C3EH 3NBHB 3BZKA 2RHQB 3W5OA 4APVA 1JT8A 2H5XA 1XPUA 4GNXA 1SN8A 2JA6G 3RN5A 1K8GA 1L1OA 1YIJA 4QGUA 3KOJA 2MO0A 4LFCQ 4A4IA 3CPWA 2V1CC 1Q1EA 3E9IA 3K0XA 1Z9FA 3TS0A 1S40A 5M3FH 1EIYB 2ZJPA 4DR7L 5C4XG 1A0IA 4A3KH 1E1TA 3UDIA 1Q1BA 1M1KC 3S15H 4LUZA 3Q8DA 2XGTA 3UDFA 2NVYH 3TREA 2LXKA 4C2MH 4HIDA 1XMQQ 1J5EL 2F4VQ 1Y1WH 4B3TQ 1Q12A 1C7YA 1IBML 4GNXC 1QUQA 1PH4A 4DV3L 1I94L 4X66L 1IBKL 4JI8L 2UU9L 1YI2A 1FJGQ 2IY5B 3PV0A 4DV0Q 3CCJA 1NMFA 3KFUA 5C0XJ 1OXVA 2KENA 3PUZA 3KLWA 1JJ2A 4DR1Q 4DNIA 4DKAC 3F2CA 3G48A 4DV5Q 2HHHQ 3M7NA 3AFQA 4POGA 3FKIH 4Y7NH 3K7UC 3KDFA 3HKSA 4JI3Q 2Q2HA 2A1AA 4HJ7A 1QZHA 3PF4A 3HOVH 5LMNL 2UUCQ 3GDEA 4A3EG 1K83H 4OXPA 4PZ7A 2JK8A 4X65Q 4A3MG 1SRUA 4KLKA 4HJ9A 4BXXG 1HR0W 5IWAQ 2VUMG 1U0LA 2UXCL 5FLMG 4HJ8A 3K81C 4X62L 4DR5Q 2BH2A 4DR4L 4AYBG 4GKKL 4RG1A 2HQLA 4LF5Q 4A3CH 1VQIA 3RLOA 3W1GA 2K5NA 2K14A 4A3GH 3HOWG 2Q2IA 5LMNW 1IBLL 1JMCA 3TEHB 1TWGH 1SLJA 1PYSB 3H0GH 3HKZE 4BY1G 1CSPA 1SMXA 4EX5A 2KHIA 3KJPA 4HIOA 4OO1G 4JI7Q 4LF4Q 3TS2A 1AH9A 4A3FH 4DV1Q 1UWVA 4LFBQ 1UEBA 4Y52H 3GTLH 2VW9A 4DV7L 1N8RC 2VL6A 3I4NG 4GNXB 1VQ4A 5GADC 3CC7A 2E2IH 3PUYA 3H15A 1KC8C 2ZM6L 5C0XG 3T1HQ 2E5LL 3S2HH 2DUDA 2CWPA 1EFWA 4LFAL 2VNUD 4YWMA 2OTJA 5ELOA 1K9MC 4PZ8A 5M5WH 5JEAJ 1YJWA 1WFQA 1WCMG 5DLQE 1H95A 4NXMQ 1BKBA 3J81j 3FHWA 4B3SQ 1KL9A 3AEVA 3F1ZA 3J81i 2JEBI 3UE0A 1YJ9A 1PH5A 4DUYQ 3F8TA 2YTYA 1QUQB 1LUZA 2CCZA 1X3GA 2VZAA 3PUXA 3HOXG 3U4VA 1P8LA 1X6OA 3U4ZA 3T1YQ 1EUJA 1N9WA 3M4OH 1VQ7A 4B3ML 4LFCL 3STBC 2VS1A 3OW2A 2JA8G 2ES2A 3CQZH 1VQ8A 1SR3A 3A0JA 2JA6H 2N3SA 4R4QA 4DV4L 3CCSA 2IX0A 2PMZE 3BJUA 2IX1A 3GTKH 2K75A 1XMQL 1RL2A 1X54A 5C4XH 2ID0A 3GTMH 4WJ4A 1Y1VG 3CF5A 4B3TL 1OXXK 1P16A 4X6AH 5JEAG 3CCMA 3S1RH 1PH7A 5FLXc 2AKWB 3CD6A 4B3RQ 1K73C 1UE1A 4IPGA 4DV0L 4GKJQ 1X55A 5IYDG 4YHHL 1PH3A 3I2ZA 4DR1L 3W1BA 1NBWA 3CCQA 1PFSA 3S2DH 4RMFA 4ME3A 1AE2A 2D0PA 2F52A 2L15A 2LSSA 1UE7A 2Z6KA 3S14H 1G6PA 2K52A 1WYDA 2HT1A 4BBSG 3H3VI 4X65L 4JI5L 2UUAQ 2OQKA 2RHSB 3TQYA 3TRZA 1OXTA 2NZHA 5BR8L 3CCUA 3HKZG 2VQEQ 4P73A 4O2DA 4DR5L 3LGJA 4A3MH 4BXXH 4LF5L 4A3JH 1CKOA 2VUMH 4JI2Q 4MTNA 5FLMH 1HNWQ 3J81c 1E22A 1C0AA 2IHFA 2I5LX 2MQHA 3G6EA 1XNQQ 4KHPQ 4BY7G 2UUBQ 2D0OA 4LF4L 4DR3L 4DV1L 2ZTEA 2WFWA 4BY1H 4LFBL 2YYZA 1HNZL 1EQRA 1HZAA 2I5HA 3ER0A 3I4OA 2BH8A 4DR2L 2LXJA 3T1HL 1PH9A 4PG3A 4JBWA 2CQOA 4GN5A 4R4CA 4A3DG 3I4NH 4P71A 2R7ZG 5C4JH 4LWCA 1V9PA 1XTDA 2CWAA 5IY0A 3JC66 4DV6L 5J3BA 1WCMH 1C9OA 1GD7A 1PH6A 5GAHC 1KQSA 4DUYL 2Y0SE 1V43A 3S16H 1CKNA 1L1OC 4YWKA 2GVBA 1G51A 5EAYA 2B3GA 3UDXA 3RZOH 2KHJA 4JI1Q 1GKHA 4AH6A 3T1YL 1XMOL 3A74A 3RR5A 3NELA 1DGSA 1QZGA 4LF7Q 2R92G 3OTOQ 4IPCA 1VQCA 5LMUQ 3PO2G 1N36Q 4GOPA 1A62A 2PNHA 2QA4A 3A5UA 1PA6A 4GS3A 5IP9G 3GTJH 3HFZB 4JI0Q 1JJGA 2JA8H 3DM3A 2BA1A 2EIFA 5M3MH 1IXRA 4O0AA 1N33L 4P74A 2PQAB 3PGZA 4TQUS 1ASYA 1PV4A 3CMAA 2JQOA 2D62A 3HOZG 1PH1A 4NPSA 1RIPA 1VQBA 4GOPC 2UXDL 2WAQE 1CUKA 2UXBQ 2AHOB 4A3BH 1NMGA 4DUZQ 1Q81C 4JI4L 5IYDH 4DV2Q 3MEFA 2UUAL 1L1OB 1BBWA 4IFDI 2JA7G 1YHQA 3OYYA 1XNRL 1VQPA 4OX9L 3S1MH 1VQJA 5AJ3Q 2F3IA 2ATWA 3I7FA 4LW1A 3ERSX 4BBSH 4DR6L 2VQFQ 1I50H 2ZJRA 4DPGA 2QGQA 5C3EG 4IOAA 2NN6I 4JI2L 1HNWL 4P75A 1Q82C 3VDYA 4JI6L 1KAWA 4X64L 1A8VA 1VQGA 2JA5G 1N32L 4GLAC 4OWWB 1K0RA 4H02A 1YJNA 3UDGA 3I55A 1X56A 1X65A 2OCEA 4R1JA 1KRTA 4A3IG 1Q86C 3PO3G 1SROA 5IE8A 3CAMA 2GN5A 2NVTH 1I3QH 1KXLA 2R7DA 3KDFB 4MZ9A 2ZTDA 2A8VA 2VY3A 4P72A 4DR7Q 4LF9Q 1Y1WG 3S1NH 4HJAA 1BVSA 4BA2I 4EQ5A 2YU9H 2Y0SG 3J80c 4GOPB 4L5RC 2JEAI 2I5MX 3GTOH 3ULLA 5GQOA 5IYBG 4JV5Q 2F4VL 4YCWA 1IBMQ 2R93G 1VQAA 4JBKA 3G4SA 4DV3Q 4X66Q 1VQFA 4JI8Q 1YNXA 2N78A 1OXUA 2UU9Q 2BA0A 1HR0Q 3CW2C 1TXYA 1MIUA 5IYCG 3CCVA 3EBEA 2ZTCA 1FJGL 3HOVG 4QY7A 4JI1L 1AE3A 2DGYA 1HNXQ 4AQYQ 4DV5L 2PI2E 2HHHL 5IP7G 3S17H 5LMNQ 3RZDH 1Z47A 1VCIA 4JI3L 3PF5A 5FJ8G 4A93G 1UE6A 2WP8J 3S24A 1YZ6A 5LMUL 1MJCA 4HIKA 2UUCL 4WJ3M 1L2FA 2NZOA 4R4OA 3M85A 1N36L 2UXCQ 2R92H 4X62Q 1MKHA 5IWAL 5JJIA 4JI0L 2B29A 1E24A 5C44G 4A3EH 1TWFH 2HIVA 2MO1A 2A19A 3GTGH 3PO2H 2XTIA 4J15A 1OXSC 4IPDA 1J6QA 4BBRG 1FVIA 5IP9H 1IBLQ 3CCLA 1D7QA 3J7A5 1NY4A 2JJQA 2WB1E 3GD7A 3RNUA 1JJCB 1K3RA 4XIGS 3PCOB 3J7ZC 2E2JH 3D0FA 2Z6KC 1IYJB 1KHIA 3PUWA 3HOWH 4OWXB 4MNOA 4GLXA 4JI7L 3AQQA 4DK6C 1B7YB 1VQEA 2HIXA 4DV7Q 3ULJA 1SFOH 3CC4A 3HOUG 3HOZH 5M5YH 2ZM6Q 1VQHA 2NVQH 1YITA 3E0EA 2E5LQ 4QQBX 4LFAQ 4DV2L 2KCTA 1TWHH 4UP7A 1VS0A 4R4TA 1X3EA 3K8AA 2N49A 4OONA 3AYHB 5AJ3L 1CSQA 2Z0SA 3F2DA 4BA1I 1X9NA 1PVOA 5GROA 4NXML 2JA7H 4UPAA 1Y14B 2B63G 1O7IA 4JCVE 4B3SL 4JYAQ 4LNQA 1A63A 4JBJA 1IL2A 2MNAA 4UY8C 2RF4A 1OTCA 4IJHA 1HH2P 1NTGA 3I4MG 1YHBA 3KYHC 1I6HH 2JA5H 4B3MQ 1EYGA 1PYBA 5JJLA 1YBYA 4LUVA 4UP9A 4LF6Q 1VQNA 2OQ0A 3HOXH 4IO9A 1KIXA 2AWNA 3MXNB 3U58A 4A3LG 4LF9L 4DV4Q 4OWTB 4PZ6A 4A3IH 3PO3H 3PUVA 3EIVA 5GAEC 3F2BA 1VQOA 1JB7A 4NB3A 3J80i 3JAMi 2JA9A 4LF8Q 4HJ5A 4JV5L 2MFIA 1LTLA 1B70B 1Q7YC 1QVFA 1HR0L 5IYBH 2ASBA 2GVAA 3HOYG 4B3RL 2R93H 4IFDJ 4YHHQ 1HZBA 1Y1VH 3A5ZB 2CKZB 4GN3B 4GKJL 1G291 4IPHA 2AMCB 3CCEA 1YEZA 4OO1I 4QJFA 1HNXL 4AQYL 3KF8B 4XTCS 1HJPA 4UP8A 5IYCH 1XPRA 2KCMA 2E8GA 1M90C 4HIMA 1FL0A 1PHJA 4JI5Q 3AFPA 3D31A 4A3JG 2K50A 2ALYB 4AIMA 1HZ9A 3GTQH 5BR8Q 2C35B 1E1OA 1TWAH 5IP7H 5C0XI 3CC2A 2R6GA 4TVAB 2ZJQA 2WB1G 2YTXA 1VQ9A 5FJ8H 4A93H 1N34Q 3M4PA 1T9HA 4YY3Q 3CXCA 3KF6A 4DAYB 1Q8KA 1YHAA 3G71A 2VQEL 1EQQA 2OTLA 4NXNQ 4GN4B 1PH8A 3WWVA 3GTPH 1GO3E 1K8AC 2K4KA 5ELNA 5C44H 3B6YA 3BU2A 1VQKA 3CP0A 3M3YH 4K0KL 3DLLA 2YV5A 2I0QA 4KHPL 1XNQL 2RCNA 4BBRH 3K80C 4DR3Q 2UUBL 1JE5A 3SGIA 3RLFA 5IT9c 2E2HH 1D8LA 2R7FA 1CKNB 1HNZQ 3CPFA 1WOCA 5M3FG 4BY7H 3UE1A 4C3HH 3STBD 4A3KG 1GM5A 4DR2Q 3GO5A 1LM0A 2YTVA 3CCRA 4IFDG 1SE8A 3M9BA 1KD1C 3HOUH 4K0KQ 2EQSA 5HY6A 4L5TA 4L5QA 1CKMA 3H3VH 3KJOA 4JC0A 1HZCA 2NN6G 3E9HA 3JAMc 1XJVA 4R4IA 4IOCA 1J5EQ 4YCVA 1E3PA 4JOIA 4DV6Q 4A76A 4A3DH 3L2PA 3K7AH 1I5FA 3U50C 4L5SA 2AWOA 4DAMA 1IBKQ 2QEXA 1I94Q 3L7ZC 1VQ5A 2R7ZH 4JYAL 3FKIG 3PSIA 2K5HA 3CMEA 4PMWA 2OWOA 4POFA 2B63H 3EN2A 1V1QA 4C3JH 1EIFA 4C3IH 1XMOQ 1L0WA 1B8AA 4KHZA 1WI5A 3IRBA 1XPOA 3ZJYC 1FGUA 2JE6I 2EXDA 1PH2A 1VQLA 4LF6L 1VQ6A 3ICEA 4QIWE 4LF7L 4YCUA 3OTOL 4JOIC 3I4MH 1LYLA 3RLNA 5M3MG 1E7ZA 1KRSA 4LUOA 4A3CG 3PIPA 1QVCA 1U5KA 4YWLA 1W3SA 4A3GG 4DR4Q 3FP9A 3NEMA 4GKKQ 4A3LH 1UE5A 4LF8L 3H0GG 1N33Q 4JBMA 3KF6B 5M5XH 3RN2A 2IHEA 1VQMA 1VQDA 5JJKA 2KBNA 4A3FG 1BBUA 2WAQG 3PIOA 1WJJA 1NE3A 4DK3C 1IZ6A 4AYBE 4KI0A 3BZCA 1S3OA 2FXQA 1R9TH 4A3BG 1NJIC 1X3FA 2UXDQ 2Q2TA 2K5VA 4GLVB 5K36G 1QVGA 4ALPA 1MJEA 3HOYH 1ASZA 5GAGC 2PI2A 1S72A 4JI4Q 4A75A 2UXBL 5H1SE 1W2BA 3S1QH 2NVXH 3NENA 4DUZL 2Q2UA 4FDBA 5HGQA 1XNRQ 4OX9Q 2N8NA 5E7NA 4DR6Q 4IJLA 3L0OA 1N34L 4JG2A 4YY3L 2PQAA 2VQFL 1Q46A 1EOVA 4NXNL 1YVCA 3ULPA 2CFMA 3M4QA 4QL5A 4JI6Q 2IT1A 4X64Q 1GVPA 3I56A
chains in the Genus database with same CATH superfamily
1ENFA 1PTOC 3NBHB 4A3DB 3BZKA 3MXGA 4KY6A 1EY5A 1H9JA 1DM0B 1SN8A 2F0NA 1K8GA 3DHQA 3KOJA 4XT1B 4C56C 3CPWA 5C4XG 2RCFA 1A0IA 1HTLD 1ZXTA 1JWSD 3UDIA 4HMIA 3S15H 2PQEA 3Q8DA 2NTTA 2XGTA 3W2DA 1Y8PB 4HIDA 1J5EL 1EY7A 2PW5A 1IKMA 3BVMA 2R92B 1I94L 4X3TA 1YI2A 1EZ8A 5KEEA 3PO2B 4ZAIA 4DV0Q 3KFUA 1CHPD 5C0XJ 1OXVA 3PUZA 4DV5Q 3AFQA 1SNQA 3FKIH 3I72A 3K7UC 3VR5A 2FMMA 2KECA 2A1AA 1EY8A 4K2KA 2UUCQ 4X65Q 2N55A 4RGOS 1LTBD 4X3KA 2UXCL 3HOZB 1S5CD 1TS4A 5M5YB 4GKKL 2NVXB 4F8MA 4LF5Q 1DOLA 3HOWG 3W3AA 3E3XA 5LMNW 1QJOA 5ISRA 4EX5A 3TS2A 3BDCA 5KYIA 1CA5A 4LFBQ 3K5MA 1J9OA 4Y52H 4DV7L 2VL6A 4GNXB 1SYBA 3H15A 2ZM6L 4XYQA 2VNUD 5CV7A 4YWMA 2OTJA 3BDLA 3UI2A 1YJWA 2QKIC 1Q8IA 1WFQA 1X32A 1JICA 3DWQA 2B2WC 1PZKD 3J81j 3BG3A 3MAQA 4CBVA 3H91A 3PO3B 1Y1WB 1BO0A 2Y0SB 1X6OA 2A6HD 2VS1A 2WKDA 2OT2A 5F2DA 1H9SB 3CQZH 2OEOA 2JA6H 3VYRA 2EYLA 2G5DA 3L3OC 4L6TB 2IX0A 2H4OA 2K75A 1CI3M 1PFMA 1Y1VG 2AUKA 3T53B 1OXXK 1TWAB 3J7AF 5CBAE 3VA7A 3CCMA 4KY7A 4BS9A 1XYIA 4IUQA 2ICEC 4DV0L 4GKJQ 3FMCA 5IYDG 1WTRA 3TBIB 1EY4A 4RAUC 1PFSA 2F0VA 2L15A 4BBRB 3LX0A 1WYDA 4X65L 2WAQB 5A2QE 2OQKA 2RHSB 3TQYA 5BR8L 2V4DA 3HKZG 2VQEQ 4P73A 4C3HB 4I7AA 3LGJA 4LF5L 3BVGA 3OOCA 1CKOA 4JI2Q 1PRTF 3K6OA 2I5LX 2EDGA 1IKLA 4OIJA 3EVQA 1D1KA 3K58A 2ZXOA 5IIFA 2O5JC 4LFBL 2YYZA 3FVQA 2I5HA 4EQPA 2LXJA 1ESRA 1F2ZA 4IN3A 4PG3A 4MN3A 1ZYRC 3QG1A 2RDFA 4DAYA 2R7ZG 1PYWD 5C4JH 3WDNA 1SE2A 1I4PA 3JC66 2X6GA 4C3JG 5EGTA 1WCMH 1C9OA 1GD7A 2M2LA 1CKNA 1L1OC 1CT1D 2KHJA 4JI1Q 3RR5A 5CV4A 3OTOQ 3VR6A 1R9TB 3J7AV 2L11A 1K28A 1VQCA 1BCPD 1EEID 1N36Q 4GOPA 1ESFA 2F3VA 1WTPA 2JA8H 2BOSA 5M3MH 3OWEB 2Z9HA 3DWAA 2PQAB 2L1BA 3SK8A 1X3QA 1HCZA 3CMAA 4A3JB 3I91A 5J22A 4NPSA 1RF2D 1D6EC 3GV6A 4R8IA 1Q81C 3MEFA 4IFDI 2JA7G 3S1MH 2M00A 2F3IA 2FFKB 4ULLA 5T1IA 4BBSH 1TIID 2VQFQ 1I50H 2BE5D 2ZJRA 4HSVA 4J8QA 4IOAA 4JI2L 4KJOA 2TMPA 4P75A 4A3KB 3R8BA 2KCCA 4JI6L 1O7LA 5BN5A 4GLAC 1N32L 4H02A 1YJNA 3UDGA 3I55A 3OIQA 4FYDA 2OCEA 4R1JA 1Q86C 3S16B 1SROA 2GN5A 1I3QH 1WTQA 3KDFB 5ELCA 5FLXL 4B9WA 4LF9Q 1BVSA 4BA2I 4XYOA 2JEAI 3D4DA 3ULLA 5GQOA 3X3MA 2RQXA 1EU4A 4X66Q 1MHWC 4JI8Q 3GTJB 2N78A 2BA0A 3MXUA 1HR0Q 3ZYYX 3D4WA 4JI1L 4U68A 1G8ZD 4RHSA 2K5QA 3H09A 1L0YB 4AQYQ 1KTKA 1Z47A 4JI3L 3PF5A 3Q23A 1V1PA 2CHBD 5JJZA 3S24A 4WJ3M 2NZOA 1N36L 2R92H 1MKHA 3S2DB 3SK6A 2E2IB 3PO2H 2HIVA 2MO1A 4J15A 1WD0A 1B9MA 2K1BA 4JK1C 3OMGA 2WB1E 1PTOD 2LY7A 3GD7A 3RNUA 4XIGS 3PIO3 4G7ZC 4QUCA 1LABA 3PUWA 4JI7L 5CV6A 3HOUG 2SNSA 2HIXA 1CFMA 1ML0D 1HHVA 1G6ZA 1B9NA 3HOZH 5M5YH 4R8NA 3E0EA 4QQBX 1EYCA 4LFAQ 2KCTA 4H7BA 2N49A 1JR0D 4OONA 3AYHB 4RWSC 1CSQA 2EOTA 4BA1I 1X9NA 1PVOA 1RHPA 4UPAA 1Y14B 3GV3A 2B63G 2F0WA 2YU9B 4C3IG 4JBJA 3A7LA 3K59A 5EBDA 2MNAA 4UY8C 1CK1A 5CMDA 4MTKA 2DN8A 1O7YA 3KYHC 3K0YA 5KNBA 3S1RB 5JJLA 1AEXA 4XQQA 4EGVA 2AWNA 1TQOA 5BN3A 3U58A 4LF9L 4DV4Q 1SNMA 3PO3H 4F87A 5GAEC 3F2BA 3S14B 3J80i 1R4QB 4HJ5A 3G6JB 1LTLA 4H0LC 1CZWA 2F0JA 4A3EB 1HR0L 2GVAA 4YHHQ 2CKZB 1G291 4IPHA 3PMFA 4AYBB 5TSSA 1UNSA 3KF8B 4AQYL 1FNVA 3KLSX 2E8GA 5EJWA 1LO5D 2PZWA 4P2CB 3N52A 4NW2A 3GTQH 5C0XI 1TWAH 4BY1B 2R6GA 2E75C 4A93H 1SNCA 4DU9A 3KF6A 1Q8KA 1LT4D 1EQQA 4GN4B 1PH8A 3HZXA 1AN8A 4RKBA 3I4NB 3B6YA 3BU2A 4RGNA 1U4LA 3URYA 3M3YH 2B2WA 2MP1A 3K5OA 1XNQL 5C4ZA 4KHPL 4BBRH 1EY9A 2UUBL 1JE5A 1PLFA 5IT9c 1WOCA 4C3HH 1JWUD 2EYOA 2YTVA 3CCRA 4IFDG 3M9BA 4K0KQ 4X3SA 3HOXB 2SEBD 1X3PA 4DV6Q 4A76A 4KTAA 3NHHA 1EU3A 2QDLA 4DAMA 2QEXA 3BYTB 4ZUIA 1ICWA 5IGGA 3CMEA 1PFBA 4PMWA 2OWOA 1V1QA 4CDFC 1EIFA 1L0WA 1XPOA 1WI5A 1VQ6A 4QIWE 2QILA 4ZKCB 4JOIC 2Z4IA 5M3MG 4KKUA 1E7ZA 4LUOA 3M7GA 1KNEA 4A3GG 1DXMA 1W3SA 3R93A 4NKLA 1I4RA 3H0GG 1N33Q 4IALA 1VQMA 2Z4HA 4A3FG 1NE3A 4DK3C 1IZ6A 1NR4A 1R9TH 1SNOA 2F0GA 4C1NI 2OXPA 1TVXA 4A75A 1W2BA 4KK7A 3A56A 1ZYRD 5HGQA 2NUCA 2N8NA 3NQIA 5JOBA 1D5XC 2X6LA 4JG2A 3HOUB 2K03A 4M1UB 2IT1A 3I56A 1TWCH 1STHA 2L0CA 3R3OA 3Q24A 1EWIA 3U9OA 5C3EH 3MVVA 2RHQB 3K7AB 4APVA 1JT8A 4ME5A 1XPUA 1L1OA 4LFCQ 2B63B 2E2DC 2XRSD 1D5ZC 5CR3A 4A4IA 2V1CC 1Q1EA 1S40A 4K0KL 1EFID 3OPOA 2ZJPA 4DR7L 1WD1A 4A3KH 4LUZA 3UDFA 5BN4A 2NVYH 2LXKA 4DAVA 1VMPA 1Q12A 4GNXC 1MSGA 2NN6H 4DV3L 2EYJA 2F0IA 3I90A 3CCJA 1RDPD 3KLWA 4DNIA 3HGBA 4DKAC 1K3BC 1QZHA 4FXDA 5LMNL 1K83H 1JE4A 2QEJC 2JK8A 4OXPA 3SR1A 4A3MG 1EZ6A 1HR0W 5IWAQ 1SFOB 2VUMG 3QWNA 4HJ8A 2BH2A 4HSPA 4TRDA 4X62L 1JWMD 3NTIA 1F9SA 2HQLA 2EYFA 4A3CH 2H1EA 1TWHB 1JMCA 2Q8TA 2QF7A 4OL7A 1SMXA 4KMUC 2KHIA 4ILWA 4HIOA 2F0LA 4LF4Q 5KNCA 5E4WC 1UWVA 3JAML 4PMCA 3GTLH 2VW9A 3S2DH 2AQ2B 2HCCA 2E74C 5GADC 3CC7A 2E2IH 4F7XA 5C0XG 3T1HQ 1II3A 1K9MC 4PZ8A 5DLQE 1H95A 2I07B 4OIKA 5J1ZA 1KL9A 3TP8A 5IOCA 3F1ZA 4A3IB 1YJ9A 3D8GA 1PH5A 3F8TA 2YTYA 4RKLA 1LUZA 1S4ZA 2CCZA 1QOHA 4K14A 1O80A 3U4VA 3T1YQ 1EUJA 1N9WA 4LFCL 3STBC 3OW2A 3KLRA 2G9DA 2R3ZA 5FLXE 1DD2A 3HOVB 2IX1A 2KVMA 4WORA 1LV9A 1RL2A 3X3NA 3J7YW 4WJ4A 3GTMH 3C2PA 3S1RH 1PH7A 2JN4A 3WOEA 5J39A 1WTWA 1SEBD 1UE1A 3W1BA 3CCQA 1DZ1A 2FHTA 3H0GB 4RMFA 3MXNA 1TT2A 2LSSA 3MHBA 4CJ0B 1UE7A 3S14H 1G6PA 2O5IC 2HT1A 2EJMA 4JI5L 1G2SA 1QNKA 2NZHA 3QJYA 1KNAA 4JVZA 3S2HB 4BXXH 4MTNA 4ODGA 5FLMH 3J81c 5M5WB 1E22A 2J4XA 2IHFA 2ZT9C 2QDBA 4LF4L 1I4QA 1JOQA 3VR2A 2I46A 2ZTEA 4BY1H 1HNZL 1EQRA 1HZAA 2DNEA 4OO1H 3ER0A 3T1HL 2CQOA 3M4OB 5ELEA 4QMGA 3I4NH 4P71A 2L12A 3OW7A 3SXHA 4LWCA 4EVOA 1SDFA 5ELFA 3FPPA 4LMQD 5J3BA 3GP7A 5GAHC 2VXWA 2Y0SE 4YWKA 2KCNA 1NAPA 1GKHA 3T1YL 1XMOL 2A68C 3TZDA 3NELA 1QZGA 1SE4A 4LF7Q 2O4XA 5LMUQ 2EYMA 3MTSA 1A62A 5IP9G 3I4LA 1JJGA 1UUPA 5JAVA 1KDCA 2ICIA 1I4GA 1LT5D 3T16A 1I6VC 4OGQC 4NDXA 5T1GA 3C3LA 2VUMB 5JEAH 5I4DA 4L8JA 4RGTA 2WAQE 3NTKA 3V96A 4DUZQ 4JI4L 1WVLA 2SOBA 2LKVA 3IL8A 1YHQA 1XNRL 4OX9L 1ZEQX 4FNFA 4LW1A 1QE6A 4FF1A 4DPGA 4DK0A 5C3EG 1AFPA 5JVH3 5M3FB 4I65A 3FDTA 1BCPF 4G7HC 2IL8A 4C2MB 1VQGA 2JA5G 1SJHD 2MGSA 1HA6A 4HCSA 1DOMA 2Z1CA 5IE8A 5CYUA 3F2UA 1KXLA 2VY3A 3P1HA 2ENBA 3S1NH 4HJAA 4OHJA 3NK9A 4K5XA 4EQ5A 3J80c 4GOPB 1HQRD 2HUGA 1IBMQ 3M4YA 1VQAA 2EVBA 2R93G 3G4SA 1VQFA 2UU9Q 3NBHA 3KLSA 2F0DA 1BOSA 4IUNA 5IYCG 3CCVA 3EBEA 2LFNA 4NMZA 3DM1A 3VR4A 1TWGB 4DV5L 5FJ8G 1ET9A 2UUCL 1YZ6A 5LMUL 2F0HA 2A5HA 4HIKA 1BNZA 1L2FA 4R4OA 1EL0A 5JJIA 4A3BB 3TMEA 1F77A 1E24A 1MBYA 5C44G 3EQLC 1OXSC 1K8MA 1B2TA 1IBLQ 3CCLA 1NY4A 1GOZA 1JJCB 3PCOB 3J7ZC 1EYDA 2Z6KC 1IYJB 3KUPA 1KHIA 1H9RA 1B1ZA 3AQQA 1EOTA 4X3UA 1SFOH 1SAPA 3QOJA 3CC4A 2EY5A 1ENCA 2MHVA 2E5LQ 3DEOA 1TWHH 3BZDB 4UP7A 1X3EA 3K8AA 4FXKC 1DONA 3F2DA 2Z8LA 3GTOB 1BUVT 3GQBA 1PRTB 3BYYB 3NBIA 5C4XB 1JOOA 2RF4A 2R61A 1NTGA 3IAYA 3I4MG 2J7ZA 4B3MQ 1EIHA 1EYGA 1TU2B 4LUVA 4UP9A 1PTOF 4IO9A 1ET6A 1KIXA 4A3LG 3C1FA 5C3WA 3RUZA 4A3IH 3PUVA 1HXYD 4NB3A 3JAMi 2JA9A 1HTPA 4CHTB 1F2LA 1EWCA 1JC7A 5IYBH 3HOYG 3ND9A 5FO7B 4GKJL 2B2TC 4QJFA 4XTCS 1XPRA 2WV6D 2KCMA 2ZXPA 1QCBD 4HIMA 1FL0A 3HOWB 4KJNA 3D31A 4WRDA 4AIMA 5IP7H 1E1OA 1WTHA 2BDOA 2WB1G 4IQZA 2CH4W 1VQ9A 2NVQB 1N34Q 3D3RA 1FR3A 3M4PA 2VQEL 3GTPH 4HTHA 4HN7A 4RCOA 2PZTA 2RCNA 1V8QA 3K80C 4DR3Q 3SGIA 2A6EC 2F1MA 1D8LA 2R7FA 1GUGA 3CPFA 2FJ2A 4BY7H 3UE1A 1E2WA 3JAME 3STBD 4DR2Q 1EY6A 1KD1C 3RZOB 1I6HB 3A55A 4L5QA 3H3VH 3E9HA 3AU7A 4IOCA 1AW7A 4TSSA 1E3PA 1K0SA 4A3DH 3L2PA 3U50C 1I5FA 5IGFA 3OWFA 3OMCA 4K5WA 1IBKQ 3L7ZC 4O1NA 5DM73 3ERQA 2WACA 3FKIG 2O2LD 1NR2A 2K5HA 1XX8A 1B8AA 4PNYA 2HDLA 1HFGA 2JE6I 1ZKOA 3A8IE 1PH2A 1B4OA 1Y1VB 4YCUA 2XVSA 3OTOL 3QIAA 1LTTD 3PIPA 1KDBA 2IPKD 1G91A 3FP9A 3NEMA 1STNA 3KF6B 3RN2A 2XRQD 4PMBA 5JJKA 2WIIB 2B2VC 2EY2A 4AYBE 2ZXRA 2FXQA 1VDZA 4CKEA 2UXDQ 3HKZB 4DXFA 1QVGA 1ASZA 3ONAB 5H1SE 2NVXH 2E2HB 3NENA 4FDBA 3VYUA 1J8IA 4DR6Q 4IJLA 3L0OA 1N34L 2PQAA 1U9RA 2VQFL 1EOVA 2XIWA 4LK1C 3M4QA 5KRUA 2KOLA 1HRJA 4X64Q 5CV9A 4KV6A 4CDCC 1OO9B 3W5OA 2PYKA 1DCZA 3P75A 2R7ZB 2A68D 1BQQT 3P7JA 2JA6G 3VYTA 1YIJA 2P5ZX 2MO0A 1IYUA 4C3JB 3K0XA 3E9IA 1Z9FA 5M3FH 4UDUC 2Z6BA 1E1TA 1D2BA 5I2YA 3FPUB 1Q1BA 4C2MH 3RZDB 3C46A 1XMQQ 4RA8A 2F4VQ 1GUOA 2NBFA 5FKAC 1Y1WH 2WINB 1AZPA 2PMZB 4B3TQ 5FO8B 3CU7A 1IBKL 1QUQA 4MIUA 4X66L 4JI8L 4J1MA 1FJGQ 3GTGB 5M5XB 3PV0A 1Z7TA 2KENA 1JJ2A 3F2CA 2RSNA 3G48A 2HHHQ 3KDFA 3HKSA 1E2ZA 2E2JB 3GDEA 3KK7A 1PZID 4QUFA 3I3CA 1SRUA 4KLKA 4HJ9A 2L5TA 3HOYB 2KHSA 4DR5Q 5IT9L 4XXEA 4RG1A 3SHLA 2L4NA 1VQIA 3A7AB 3W1GA 2D2CC 2K14A 4RHRA 1TWGH 2F0MA 3NP8A 3KJPA 2JA7B 1F9RA 1FNWA 4NP5A 5JPNC 4DV1Q 1LT3D 1UEBA 3Q6SA 1K8OA 1N8RC 2F3WA 1KC8C 4DNRB 2DUDA 2CWPA 2B2UC 4LFAL 5K36H 2K7VA 2FMCA 5JEAJ 1WCMG 3CRKC 4NXMQ 2F0KA 2RSOA 5LL6S 3FHWA 4WFN3 4B3SQ 3AEVA 2JEBI 2J0TD 4DGZA 4V0BA 4TKOB 1X3GA 1NCVA 4RGMA 1ONLA 1YNJC 5IGBA 1P8LA 3U4ZA 1GUSA 2XNAC 1PFNA 4ID6A 1G2TA 2G9HD 2JA8G 3H3VC 1MI2A 5EBCA 4ABNA 4ZCKA 1DJRD 2N3SA 4R4QA 2RA4A 4DV4L 1XMQL 3LWUA 1X54A 4DNTB 5C4XH 2ID0A 3EROA 2KA7A 5CV8A 3CF5A 4B3TL 3P20A 2NVTB 2IWHA 1P16A 2AKWB 3SVMA 4B3RQ 4KKSA 4IPGA 2X69A 1X55A 4YHHL 4J6HA 1NBWA 1WTXA 2D0PA 1KAAA 5A2QL 2F52A 2Z6KA 5EQ0A 2E76C 2N88A 4BBSG 1A2TA 1JQYD 2F0OA 2UUAQ 1YNNC 3DEPA 3TRZA 3PIP3 3CCUA 4DR5L 4O2DA 3LNNA 4S3SA 4A3JH 2NB0A 1HNWQ 1RCVD 5COYA 5HURA 4BY7G 1PDQA 4RCNA 1Q3LA 3KF8A 5AFWA 1XXGA 4U673 4CDDC 4DV1L 1EIGA 2WFWA 4WJWA 1STAA 5I2XA 2D5DA 3I4OA 2A74C 4FP5D 2B39A 4JBWA 3A8JE 4C3IB 4A3DG 5I6YA 4K2LA 1V9PA 1XTDA 3VR3A 1QB5D 3CQZB 1EYAA 2EXZA 5IY0A 4DV6L 1A6XA 5CBEE 1PH6A 3FEWX 3A54A 5NUCA 3S16H 2NTSA 3TN2A 1G51A 3NWSA 3RZOH 3IFDA 3R2IA 4IUUA 2R92G 2RDHA 2F0EA 2B2TA 1LTAD 3L9AX 5IGEA 3PO2G 2F0SA 1GXDC 2PNHA 4CJ1B 2QA4A 5E1FA 4JPBW 3GTJH 2F0UA 2BA1A 2EIFA 4O0AA 2EE1A 1N33L 1C4QA 4TQUS 1PV4A 5JVG3 5EKLA 2JQOA 5JPMC 3HOZG 2A6ED 1RIPA 1VQBA 3IKJA 4GOPC 1B3AA 2UXBQ 2AHOB 4CDEC 4ZK9B 5IYDH 2RKSA 1S5BD 4DV2Q 2UUAL 3OYYA 1VQPA 1VQJA 5AJ3Q 3I7FA 3ERSX 2Q8RE 4KN7C 1SYCA 1HPCA 4IUVA 2NN6I 1SYGA 2B8FA 1HNWL 1Q82C 3VDYA 1A8VA 2Q8IB 3H6MA 2MUYA 1CQFA 4OWWB 1K0RA 3OHXC 5LHY1 1WCMB 1X65A 1BXTA 3DUZA 5G3LD 3PO3G 2KEEA 5FOBB 2VB2X 1M8AA 2R7DA 2A8VA 2EYHA 3NUCA 4MZ9A 4CKCA 4P72A 3OSOA 1S5DD 1TR5A 1Y1WG 3MZ5A 4Y7NB 1EY0A 2YU9H 2Y0SG 4JV5Q 4YCWA 4R9WA 2RDGA 1OXUA 1PZJD 1SYDA 2AUJD 1TXYA 1MIUA 3SK5A 3I70A 5M3MB 1TS2A 4IUPA 4A3GB 3HRZC 3MA2B 1HNXQ 3RZDH 3J81L 4A93G 2WP8J 4A3FB 1PRTC 1UEAB 4ZRZA 2UXCQ 2FINB 5IWAL 1TS3A 4A3EH 3GTGH 1R4PB 5C5LA 1J6QA 4BBRG 1FVIA 4BBSB 2JJQA 3SDZA 3MEHA 2E2JH 4C3HG 3ND8A 4KN4C 2HCIA 4DK6C 1B7YB 1VQEA 2EY6A 2K6AA 3ULJA 4DV7Q 1Q90A 1STBA 5EPJA 2ZM6Q 1VQHA 1F9PA 4DV2L 1VS0A 4R4TA 3BDOA 4B9XA 5AJ3L 3NTHA 2A73B 4G4KA 3TSSA 4F88A 2XN9C 2JA7H 1IYVA 2GA4B 1U4RA 3E6ZX 2CW0C 1Y8NB 4KD4A 5DM63 1CZGA 2PZUA 4LNQA 1QG7A 3GTKB 1IL2A 3TP7A 4IJHA 1HH2P 1YHBA 1PYBA 1YBYA 1VQNA 1CQVA 1SE3A 1NNXA 2OQ0A 3HOXH 1AP0A 3T56B 4PZ6A 2HD3A 3BS1A 3EIVA 1VMCA 1VQOA 3U9SA 3RMHA 5EKIA 2B8GA 4JV5L 2MFIA 2IW3A 5CC4A 3Q0AA 1QVFA 4LJZC 2ASBA 2L9HA 4A3MB 5CGKA 2HDMA 5IGDA 2AMCB 5C4HA 1YEZA 4OO1I 1HNXL 4QB4A 1HJPA 4UP8A 1M90C 1VF5C 4H44C 3MFGA 3O13A 3AFPA 4A3JG 5BR8Q 2C35B 2ZJQA 2NVTH 1ENAA 2CVRA 2YTXA 5D3IB 1T9HA 4YY3Q 4DAYB 3G71A 5IT9E 2B2UA 1GO3E 1JB3A 2YV5A 4G57A 2C9OA 1YNJD 3J80L 1CKNB 4KKTA 1XWEA 4Z9CB 1TY0A 4A3KG 1GM5A 2QW7A 3GO5A 3HOUH 1E2VA 2EQSA 3G7LA 5HY6A 3VYSA 1IHZA 4L5TA 3SK4A 2NN6G 2IJ0A 4R4IA 4JOIA 2B2YC 2K5DA 4QCLA 3K7AH 4K6DA 4L5SA 2DY7A 4FF2A 1VQ5A 1BCPB 1CM9A 4HAEA 4K8IA 1LTGD 3PSIA 2M9VA 2B63H 4H13C 3EN2A 4C3IH 1KLGD 4KHZA 3IRBA 2EXDA 3CHBD 1VQLA 2EJFC 4LF7L 1YNND 1KRSA 5K5PA 4A3CG 2NWGA 2JP1A 1QVCA 2K5WA 4DR4Q 2PCFB 1FGBD 4UHVA 4JBMA 3GTQB 1SBBB 3KBGA 1VQDA 5I9OA 4FF3A 2A69C 4A93B 1JORA 3R2TA 1Z6HA 3PIOA 2BCOA 4IURA 4ZYSA 1D5MC 4KI0A 1S3OA 1NJIC 1X3FA 3T4AC 2OF1A 2F0FA 1Y8OB 4GLVB 3M3YB 4ALPA 2XWBB 4GZYC 3I73A 2Q2UA 4DUZL 3QR8A 4EQOA 5E7NA 1WTOA 4K5VA 4KD3A 4YY3L 1Q46A 2LS01 2K05A 2CFMA 4K6LA 4QL5A 4BWGB 1IL8A 1PH1A 4JI6Q 2TSSA 1GVPA 1D1IA 5CV5A 2DY8A 2JXMB 1N32Q 1I4XA 1F2MA 4CKBA 1B50A 4E6IA 2H5XA 4GNXA 1H9KA 5KGUA 1RTOA 1SMYC 3RN5A 4QGUA 1A3VA 1EQTA 1LTID 5C5MA 4CJ2C 4RFBA 1LTRD 3TS0A 1EIYB 1V1PB 4IFDH 3S17B 1UAPA 3S9WA 1M1KC 3TREA 5ELDA 3K5NA 1A3UA 1C7YA 4PV1C 1IBML 1PH4A 2UU9L 2KEDA 1TWFB 3CKIB 1NMFA 2AQ1B 4DR1Q 1GUTA 3M7NA 5C6AA 4POGA 4Y7NH 2AQ3B 2Q2HA 4JI3Q 4HJ7A 3PF4A 3HOVH 1H9SA 2C5CA 4A3EG 4PZ7A 1PTOB 4BXXG 1U0LA 3QB3A 5FLMG 3K81C 4DR4L 2XSCA 4C1NK 4AYBG 3RLOA 1QWYA 2K5NA 1IW7C 5M9OA 4A3GH 2Q2IA 1IBLL 3TEHB 1SLJA 1PYSB 3H0GH 3HKZE 3MWYW 4BY1G 1CSPA 1MSHA 4OO1G 4JI7Q 1NUCA 1AH9A 4A3FH 3EA6A 1TWCB 5C3EB 4DF7A 3I4NG 4K8JA 1VQ4A 1M4VA 3PUYA 3S2HH 2E5LL 1EFWA 1WTVA 5ELOA 3T51B 1VF7A 1LTSD 4I7ZC 5M5WH 2JA5B 4O42A 1BKBA 3PQIA 1C8CA 1HUMA 1S5FD 3J81i 5I6WA 3UE0A 4QF4A 1DOKA 2NVYB 4DUYQ 1QUQB 4MHEA 4DN4M 1O78A 2VZAA 2HQEA 3PUXA 3HOXG 3M4OH 1VQ7A 4B3ML 1BR9A 3QOLA 2R93B 2ES2A 1PRTD 1VQ8A 1SR3A 3A0JA 1KABA 1GUWA 1HQMC 3CCSA 2PMZE 3BJUA 3GTKH 1K83B 3D6CA 4KY5A 1TKWB 1STEA 4X6AH 5JEAG 5C3XA 1FYCA 5FLXc 3CD6A 1K73C 3CRLC 4FF4A 3E5SA 1PH3A 3I2ZA 4DR1L 2VB3X 1ILQA 2KUMA 5C44B 1TY2A 1L0XB 4ME3A 1AE2A 3AMUA 2K52A 3H3VI 1T5EA 3J81E 1HFNA 1OXTA 3GTLB 3MFYA 1SYEA 4OEMB 4KHVA 5KYLA 4A3MH 1AZQA 1SNDA 3NE5B 2CW0D 2VUMH 3OIPA 1CTMA 1C0AA 2MQHA 3TDQA 3G6EA 1XNQQ 4KHPQ 2UUBQ 2D0OA 2RVLA 2EZVA 5D65A 4DR3L 1Y69U 1O7ZA 2MJ8A 2JYOA 2BH8A 4DR2L 1PH9A 4GN5A 4R4CA 3HP3A 2K32A 1W6KA 4N9PA 2XWJB 4ZQ3A 1S5ED 2LMCB 5C0XH 5FO9B 2CWAA 1BF4A 3I4MB 2K04A 4DK1A 4HEDA 4Q5VA 4DFAA 1KQSA 4DUYL 2L55A 1V43A 3GTMB 2GVBA 5EAYA 2B3GA 3UDXA 4ZLTF 4AH6A 3A74A 2F4IA 3NWTA 1DGSA 4HCEA 4IUTA 4IPCA 1HA5A 4FXGC 3NXWA 3NPPA 2DJFC 1E0BA 4XQNA 3A5UA 3K57A 4GS3A 1PA6A 2PPBC 1W6JA 3HFZB 4JI0Q 4G7OC 3HEJA 3DM3A 3RD4A 3S1QB 3DMUA 1IXRA 1NSNS 5E3FA 1KLUD 1XTCD 4P74A 5HGTA 3PGZA 1ASYA 3I8ZA 3EJIA 5EKKA 3K5LA 2MPMA 5KNDA 1LT6D 2D62A 3NQTA 2WB1B 2UXDL 1CUKA 4XDXA 2WKCA 4A3BH 1NMGA 4HR7B 1L1OB 1BBWA 1A2UA 4XQJA 4DR6L 3ITPA 3KBXA 4L63B 2QGQA 3MXPA 1BDOA 1GJXA 1RODA 2F03A 3E0JA 1KAWA 4X64L 4V190 3S15B 2B2YA 1SJED 5DEHA 1X56A 3DXJC 3J80E 1KRTA 4A3IG 2D9UA 3CAMA 1STGA 2ZTDA 4DR7Q 1JCKB 4IZ8A 3FKIB 3GTOH 1U4MA 4L5RC 4RH6A 1RJTA 2I5MX 5IYBG 3D6WA 2F4VL 5I9PA 2A69D 2NYZD 4FO2A 5E4XA 4DV3Q 3TP5A 4JBKA 1YNXA 3TP6A 3CW2C 4B08A 1GHKA 2ZTCA 1FJGL 3HOVG 4QY7A 1AE3A 1FNUA 2DGYA 2NZ1D 5FK9C 4N8X1 2PI2E 1LLRD 5IP7G 2HHHL 3S17H 2A6HC 5KIXA 5LMNQ 1VCIA 5EPLA 1UE6A 4EQNA 1MJCA 1KDAA 3M85A 4XT3B 4Q0FA 4CGYB 1TS5A 1RTNA 4X62Q 3IFTA 1BBXC 4DXGA 4JI0L 2B29A 1TWFH 5G3LF 2A19A 2XTIA 4IPDA 1B53A 5IP9H 2DJGC 4UAIA 1D7QA 1DYQA 3J7A5 2EPBA 5D14A 1K3RA 3D0FA 4N8FA 1PTOH 3HOWH 4OWXB 1FD7D 4MNOA 4GLXA 4DAPA 2IY5B 1SMYD 2RBMA 1SNPA 2NVQH 1EEFD 1YITA 4ZKBB 1PXUA 4FVMA 5DAUA 2PO4A 1ILPA 2EYPA 4OELB 2Z0SA 3N6RA 5GROA 2F0TA 4NXML 1I4HA 3S1NB 2JA6B 4PQXA 3SEBA 1O7IA 4JCVE 4B3SL 4JYAQ 4JW0A 1A63A 1U4PA 1HUNA 2BDNA 3V2TA 1OTCA 1I6HH 3DWPA 2JA5H 1A15A 1A3TA 4LF6Q 2PW7A 1QILA 1SXTA 5A35A 3MXNB 4OWTB 4YIJA 2EJGC 4QIWB 2KJXA 1JB7A 4HMJA 1CHQD 4LF8Q 5EPKA 2KQ3A 1T5XD 3HG9A 3EFXD 1IW7D 3TZUA 4ZUJA 1B70B 1Q7YC 4B3RL 2R93H 4IFDJ 1HZBA 1Y1VH 3A5ZB 1SSOA 4GN3B 3CCEA 1EQVA 4LAAA 5IYCH 5CORA 1MGSA 1PHJA 4JI5Q 1B44D 3MC0B 2K50A 2ALYB 1HZ9A 1BCPC 2K28A 1JOKA 3CC2A 4TVAB 5FJ8H 3FRPB 3CXCA 2OTLA 1YHAA 2SDFA 4NXNQ 3WWVA 1K8AC 2K4KA 5ELNA 2DNCA 5C44H 3WOFA 1VQKA 3CP0A 5C4JB 3DLLA 2I0QA 3SE0A 3RLFA 2E2HH 1HNZQ 2CH4A 5M3FG 1ICFB 4DA2A 2SNMA 1LM0A 1SE8A 3A8KE 3LWEA 1CKMA 3KJOA 4JC0A 1HZCA 2CQAA 1LACA 3JAMc 1XJVA 2K01A 1J5EQ 2BE5C 4YCVA 2F0QA 1GHJA 4N9TA 2AWOA 1I94Q 2R7ZH 2F0PA 3NSWA 4M8AA 4JYAL 5LL6X 2JA8B 4POFA 2K33A 4C3JH 3T13A 5IGCA 1XMOQ 1SYFA 3ZJYC 1FGUA 2B2VA 4LF6L 2JSOA 3ICEA 3I4MH 1LYLA 3BVZA 3RLNA 5IODA 1RKNA 1U5KA 4YWLA 1MD2D 5D3DA 4GKKQ 4A3LH 1UE5A 4LF8L 2IX3A 1F2YA 5M5XH 2IHEA 1CA6A 2PNRC 3S1MB 1RD9D 2KBNA 2QCPX 1H9MA 1BBUA 1B3QA 1GUNA 2WAQG 1WJJA 1PMRA 1STYA 1V1OA 3C1EA 1I50B 3VA5A 3BZCA 4A3BG 3GTPB 3Q22A 3H94A 2Q2TA 2K5VA 1C48A 3V05A 5K36G 1MJEA 3HOYH 2EY1A 5GAGC 2PI2A 1S72A 4JI4Q 2UXBL 5L37A 3S1QH 5ELBA 1XNRQ 3QO2A 4OX9Q 3HS0C 5DNFA 4BY7B 1EWHA 3D4RA 1I3QB 4NXNL 1QNUA 1YVCA 1F9QA 3AB9A 3ULPA 2ATWA
chains in the Genus database with same CATH topology
1TWCH 1N32Q 1EWIA 5C3EH 3NBHB 3BZKA 2RHQB 3W5OA 4APVA 1JT8A 2H5XA 1XPUA 4GNXA 1SN8A 2JA6G 3RN5A 1K8GA 1L1OA 1YIJA 4QGUA 3KOJA 2MO0A 4LFCQ 4A4IA 3CPWA 2V1CC 1Q1EA 3E9IA 3K0XA 1Z9FA 3TS0A 1S40A 5M3FH 1EIYB 2ZJPA 4DR7L 5C4XG 1A0IA 4A3KH 1E1TA 3UDIA 1Q1BA 1M1KC 3S15H 4LUZA 3Q8DA 2XGTA 3UDFA 2NVYH 3TREA 2LXKA 4C2MH 4HIDA 1XMQQ 1J5EL 2F4VQ 1Y1WH 4B3TQ 1Q12A 1C7YA 1IBML 4GNXC 1QUQA 1PH4A 4DV3L 1I94L 4X66L 1IBKL 4JI8L 2UU9L 1YI2A 1FJGQ 2IY5B 3PV0A 4DV0Q 3CCJA 1NMFA 3KFUA 5C0XJ 1OXVA 2KENA 3PUZA 3KLWA 1JJ2A 4DR1Q 4DNIA 4DKAC 3F2CA 3G48A 4DV5Q 2HHHQ 3M7NA 3AFQA 4POGA 3FKIH 4Y7NH 3K7UC 3KDFA 3HKSA 4JI3Q 2Q2HA 2A1AA 4HJ7A 1QZHA 3PF4A 3HOVH 5LMNL 2UUCQ 3GDEA 4A3EG 1K83H 4OXPA 4PZ7A 2JK8A 4X65Q 4A3MG 1SRUA 4KLKA 4HJ9A 4BXXG 1HR0W 5IWAQ 2VUMG 1U0LA 2UXCL 5FLMG 4HJ8A 3K81C 4X62L 4DR5Q 2BH2A 4DR4L 4AYBG 4GKKL 4RG1A 2HQLA 4LF5Q 4A3CH 1VQIA 3RLOA 3W1GA 2K5NA 2K14A 4A3GH 3HOWG 2Q2IA 5LMNW 1IBLL 1JMCA 3TEHB 1TWGH 1SLJA 1PYSB 3H0GH 3HKZE 4BY1G 1CSPA 1SMXA 4EX5A 2KHIA 3KJPA 4HIOA 4OO1G 4JI7Q 4LF4Q 3TS2A 1AH9A 4A3FH 4DV1Q 1UWVA 4LFBQ 1UEBA 4Y52H 3GTLH 2VW9A 4DV7L 1N8RC 2VL6A 3I4NG 4GNXB 1VQ4A 5GADC 3CC7A 2E2IH 3PUYA 3H15A 1KC8C 2ZM6L 5C0XG 3T1HQ 2E5LL 3S2HH 2DUDA 2CWPA 1EFWA 4LFAL 2VNUD 4YWMA 2OTJA 5ELOA 1K9MC 4PZ8A 5M5WH 5JEAJ 1YJWA 1WFQA 1WCMG 5DLQE 1H95A 4NXMQ 1BKBA 3J81j 3FHWA 4B3SQ 1KL9A 3AEVA 3F1ZA 3J81i 2JEBI 3UE0A 1YJ9A 1PH5A 4DUYQ 3F8TA 2YTYA 1QUQB 1LUZA 2CCZA 1X3GA 2VZAA 3PUXA 3HOXG 3U4VA 1P8LA 1X6OA 3U4ZA 3T1YQ 1EUJA 1N9WA 3M4OH 1VQ7A 4B3ML 4LFCL 3STBC 2VS1A 3OW2A 2JA8G 2ES2A 3CQZH 1VQ8A 1SR3A 3A0JA 2JA6H 2N3SA 4R4QA 4DV4L 3CCSA 2IX0A 2PMZE 3BJUA 2IX1A 3GTKH 2K75A 1XMQL 1RL2A 1X54A 5C4XH 2ID0A 3GTMH 4WJ4A 1Y1VG 3CF5A 4B3TL 1OXXK 1P16A 4X6AH 5JEAG 3CCMA 3S1RH 1PH7A 5FLXc 2AKWB 3CD6A 4B3RQ 1K73C 1UE1A 4IPGA 4DV0L 4GKJQ 1X55A 5IYDG 4YHHL 1PH3A 3I2ZA 4DR1L 3W1BA 1NBWA 3CCQA 1PFSA 3S2DH 4RMFA 4ME3A 1AE2A 2D0PA 2F52A 2L15A 2LSSA 1UE7A 2Z6KA 3S14H 1G6PA 2K52A 1WYDA 2HT1A 4BBSG 3H3VI 4X65L 4JI5L 2UUAQ 2OQKA 2RHSB 3TQYA 3TRZA 1OXTA 2NZHA 5BR8L 3CCUA 3HKZG 2VQEQ 4P73A 4O2DA 4DR5L 3LGJA 4A3MH 4BXXH 4LF5L 4A3JH 1CKOA 2VUMH 4JI2Q 4MTNA 5FLMH 1HNWQ 3J81c 1E22A 1C0AA 2IHFA 2I5LX 2MQHA 3G6EA 1XNQQ 4KHPQ 4BY7G 2UUBQ 2D0OA 4LF4L 4DR3L 4DV1L 2ZTEA 2WFWA 4BY1H 4LFBL 2YYZA 1HNZL 1EQRA 1HZAA 2I5HA 3ER0A 3I4OA 2BH8A 4DR2L 2LXJA 3T1HL 1PH9A 4PG3A 4JBWA 2CQOA 4GN5A 4R4CA 4A3DG 3I4NH 4P71A 2R7ZG 5C4JH 4LWCA 1V9PA 1XTDA 2CWAA 5IY0A 3JC66 4DV6L 5J3BA 1WCMH 1C9OA 1GD7A 1PH6A 5GAHC 1KQSA 4DUYL 2Y0SE 1V43A 3S16H 1CKNA 1L1OC 4YWKA 2GVBA 1G51A 5EAYA 2B3GA 3UDXA 3RZOH 2KHJA 4JI1Q 1GKHA 4AH6A 3T1YL 1XMOL 3A74A 3RR5A 3NELA 1DGSA 1QZGA 4LF7Q 2R92G 3OTOQ 4IPCA 1VQCA 5LMUQ 3PO2G 1N36Q 4GOPA 1A62A 2PNHA 2QA4A 3A5UA 1PA6A 4GS3A 5IP9G 3GTJH 3HFZB 4JI0Q 1JJGA 2JA8H 3DM3A 2BA1A 2EIFA 5M3MH 1IXRA 4O0AA 1N33L 4P74A 2PQAB 3PGZA 4TQUS 1ASYA 1PV4A 3CMAA 2JQOA 2D62A 3HOZG 1PH1A 4NPSA 1RIPA 1VQBA 4GOPC 2UXDL 2WAQE 1CUKA 2UXBQ 2AHOB 4A3BH 1NMGA 4DUZQ 1Q81C 4JI4L 5IYDH 4DV2Q 3MEFA 2UUAL 1L1OB 1BBWA 4IFDI 2JA7G 1YHQA 3OYYA 1XNRL 1VQPA 4OX9L 3S1MH 1VQJA 5AJ3Q 2F3IA 2ATWA 3I7FA 4LW1A 3ERSX 4BBSH 4DR6L 2VQFQ 1I50H 2ZJRA 4DPGA 2QGQA 5C3EG 4IOAA 2NN6I 4JI2L 1HNWL 4P75A 1Q82C 3VDYA 4JI6L 1KAWA 4X64L 1A8VA 1VQGA 2JA5G 1N32L 4GLAC 4OWWB 1K0RA 4H02A 1YJNA 3UDGA 3I55A 1X56A 1X65A 2OCEA 4R1JA 1KRTA 4A3IG 1Q86C 3PO3G 1SROA 5IE8A 3CAMA 2GN5A 2NVTH 1I3QH 1KXLA 2R7DA 3KDFB 4MZ9A 2ZTDA 2A8VA 2VY3A 4P72A 4DR7Q 4LF9Q 1Y1WG 3S1NH 4HJAA 1BVSA 4BA2I 4EQ5A 2YU9H 2Y0SG 3J80c 4GOPB 4L5RC 2JEAI 2I5MX 3GTOH 3ULLA 5GQOA 5IYBG 4JV5Q 2F4VL 4YCWA 1IBMQ 2R93G 1VQAA 4JBKA 3G4SA 4DV3Q 4X66Q 1VQFA 4JI8Q 1YNXA 2N78A 1OXUA 2UU9Q 2BA0A 1HR0Q 3CW2C 1TXYA 1MIUA 5IYCG 3CCVA 3EBEA 2ZTCA 1FJGL 3HOVG 4QY7A 4JI1L 1AE3A 2DGYA 1HNXQ 4AQYQ 4DV5L 2PI2E 2HHHL 5IP7G 3S17H 5LMNQ 3RZDH 1Z47A 1VCIA 4JI3L 3PF5A 5FJ8G 4A93G 1UE6A 2WP8J 3S24A 1YZ6A 5LMUL 1MJCA 4HIKA 2UUCL 4WJ3M 1L2FA 2NZOA 4R4OA 3M85A 1N36L 2UXCQ 2R92H 4X62Q 1MKHA 5IWAL 5JJIA 4JI0L 2B29A 1E24A 5C44G 4A3EH 1TWFH 2HIVA 2MO1A 2A19A 3GTGH 3PO2H 2XTIA 4J15A 1OXSC 4IPDA 1J6QA 4BBRG 1FVIA 5IP9H 1IBLQ 3CCLA 1D7QA 3J7A5 1NY4A 2JJQA 2WB1E 3GD7A 3RNUA 1JJCB 1K3RA 4XIGS 3PCOB 3J7ZC 2E2JH 3D0FA 2Z6KC 1IYJB 1KHIA 3PUWA 3HOWH 4OWXB 4MNOA 4GLXA 4JI7L 3AQQA 4DK6C 1B7YB 1VQEA 2HIXA 4DV7Q 3ULJA 1SFOH 3CC4A 3HOUG 3HOZH 5M5YH 2ZM6Q 1VQHA 2NVQH 1YITA 3E0EA 2E5LQ 4QQBX 4LFAQ 4DV2L 2KCTA 1TWHH 4UP7A 1VS0A 4R4TA 1X3EA 3K8AA 2N49A 4OONA 3AYHB 5AJ3L 1CSQA 2Z0SA 3F2DA 4BA1I 1X9NA 1PVOA 5GROA 4NXML 2JA7H 4UPAA 1Y14B 2B63G 1O7IA 4JCVE 4B3SL 4JYAQ 4LNQA 1A63A 4JBJA 1IL2A 2MNAA 4UY8C 2RF4A 1OTCA 4IJHA 1HH2P 1NTGA 3I4MG 1YHBA 3KYHC 1I6HH 2JA5H 4B3MQ 1EYGA 1PYBA 5JJLA 1YBYA 4LUVA 4UP9A 4LF6Q 1VQNA 2OQ0A 3HOXH 4IO9A 1KIXA 2AWNA 3MXNB 3U58A 4A3LG 4LF9L 4DV4Q 4OWTB 4PZ6A 4A3IH 3PO3H 3PUVA 3EIVA 5GAEC 3F2BA 1VQOA 1JB7A 4NB3A 3J80i 3JAMi 2JA9A 4LF8Q 4HJ5A 4JV5L 2MFIA 1LTLA 1B70B 1Q7YC 1QVFA 1HR0L 5IYBH 2ASBA 2GVAA 3HOYG 4B3RL 2R93H 4IFDJ 4YHHQ 1HZBA 1Y1VH 3A5ZB 2CKZB 4GN3B 4GKJL 1G291 4IPHA 2AMCB 3CCEA 1YEZA 4OO1I 4QJFA 1HNXL 4AQYL 3KF8B 4XTCS 1HJPA 4UP8A 5IYCH 1XPRA 2KCMA 2E8GA 1M90C 4HIMA 1FL0A 1PHJA 4JI5Q 3AFPA 3D31A 4A3JG 2K50A 2ALYB 4AIMA 1HZ9A 3GTQH 5BR8Q 2C35B 1E1OA 1TWAH 5IP7H 5C0XI 3CC2A 2R6GA 4TVAB 2ZJQA 2WB1G 2YTXA 1VQ9A 5FJ8H 4A93H 1N34Q 3M4PA 1T9HA 4YY3Q 3CXCA 3KF6A 4DAYB 1Q8KA 1YHAA 3G71A 2VQEL 1EQQA 2OTLA 4NXNQ 4GN4B 1PH8A 3WWVA 3GTPH 1GO3E 1K8AC 2K4KA 5ELNA 5C44H 3B6YA 3BU2A 1VQKA 3CP0A 3M3YH 4K0KL 3DLLA 2YV5A 2I0QA 4KHPL 1XNQL 2RCNA 4BBRH 3K80C 4DR3Q 2UUBL 1JE5A 3SGIA 3RLFA 5IT9c 2E2HH 1D8LA 2R7FA 1CKNB 1HNZQ 3CPFA 1WOCA 5M3FG 4BY7H 3UE1A 4C3HH 3STBD 4A3KG 1GM5A 4DR2Q 3GO5A 1LM0A 2YTVA 3CCRA 4IFDG 1SE8A 3M9BA 1KD1C 3HOUH 4K0KQ 2EQSA 5HY6A 4L5TA 4L5QA 1CKMA 3H3VH 3KJOA 4JC0A 1HZCA 2NN6G 3E9HA 3JAMc 1XJVA 4R4IA 4IOCA 1J5EQ 4YCVA 1E3PA 4JOIA 4DV6Q 4A76A 4A3DH 3L2PA 3K7AH 1I5FA 3U50C 4L5SA 2AWOA 4DAMA 1IBKQ 2QEXA 1I94Q 3L7ZC 1VQ5A 2R7ZH 4JYAL 3FKIG 3PSIA 2K5HA 3CMEA 4PMWA 2OWOA 4POFA 2B63H 3EN2A 1V1QA 4C3JH 1EIFA 4C3IH 1XMOQ 1L0WA 1B8AA 4KHZA 1WI5A 3IRBA 1XPOA 3ZJYC 1FGUA 2JE6I 2EXDA 1PH2A 1VQLA 4LF6L 1VQ6A 3ICEA 4QIWE 4LF7L 4YCUA 3OTOL 4JOIC 3I4MH 1LYLA 3RLNA 5M3MG 1E7ZA 1KRSA 4LUOA 4A3CG 3PIPA 1QVCA 1U5KA 4YWLA 1W3SA 4A3GG 4DR4Q 3FP9A 3NEMA 4GKKQ 4A3LH 1UE5A 4LF8L 3H0GG 1N33Q 4JBMA 3KF6B 5M5XH 3RN2A 2IHEA 1VQMA 1VQDA 5JJKA 2KBNA 4A3FG 1BBUA 2WAQG 3PIOA 1WJJA 1NE3A 4DK3C 1IZ6A 4AYBE 4KI0A 3BZCA 1S3OA 2FXQA 1R9TH 4A3BG 1NJIC 1X3FA 2UXDQ 2Q2TA 2K5VA 4GLVB 5K36G 1QVGA 4ALPA 1MJEA 3HOYH 1ASZA 5GAGC 2PI2A 1S72A 4JI4Q 4A75A 2UXBL 5H1SE 1W2BA 3S1QH 2NVXH 3NENA 4DUZL 2Q2UA 4FDBA 5HGQA 1XNRQ 4OX9Q 2N8NA 5E7NA 4DR6Q 4IJLA 3L0OA 1N34L 4JG2A 4YY3L 2PQAA 2VQFL 1Q46A 1EOVA 4NXNL 1YVCA 3ULPA 2CFMA 3M4QA 4QL5A 4JI6Q 2IT1A 4X64Q 1GVPA 3I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC H;  1N32 Q;  1EWI A;  5C3E H;  3NBH B;  3BZK A;  2RHQ B;  3W5O A;  4APV A;  1JT8 A;  2H5X A;  1XPU A;  4GNX A;  1SN8 A;  2JA6 G;  3RN5 A;  1K8G A;  1L1O A;  1YIJ A;  4QGU A;  3KOJ A;  2MO0 A;  4LFC Q;  4A4I A;  3CPW A;  2V1C C;  1Q1E A;  3E9I A;  3K0X A;  1Z9F A;  3TS0 A;  1S40 A;  5M3F H;  1EIY B;  2ZJP A;  4DR7 L;  5C4X G;  1A0I A;  4A3K H;  1E1T A;  3UDI A;  1Q1B A;  1M1K C;  3S15 H;  4LUZ A;  3Q8D A;  2XGT A;  3UDF A;  2NVY H;  3TRE A;  2LXK A;  4C2M H;  4HID A;  1XMQ Q;  1J5E L;  2F4V Q;  1Y1W H;  4B3T Q;  1Q12 A;  1C7Y A;  1IBM L;  4GNX C;  1QUQ A;  1PH4 A;  4DV3 L;  1I94 L;  4X66 L;  1IBK L;  4JI8 L;  2UU9 L;  1YI2 A;  1FJG Q;  2IY5 B;  3PV0 A;  4DV0 Q;  3CCJ A;  1NMF A;  3KFU A;  5C0X J;  1OXV A;  2KEN A;  3PUZ A;  3KLW A;  1JJ2 A;  4DR1 Q;  4DNI A;  4DKA C;  3F2C A;  3G48 A;  4DV5 Q;  2HHH Q;  3M7N A;  3AFQ A;  4POG A;  3FKI H;  4Y7N H;  3K7U C;  3KDF A;  3HKS A;  4JI3 Q;  2Q2H A;  2A1A A;  4HJ7 A;  1QZH A;  3PF4 A;  3HOV H;  5LMN L;  2UUC Q;  3GDE A;  4A3E G;  1K83 H;  4OXP A;  4PZ7 A;  2JK8 A;  4X65 Q;  4A3M G;  1SRU A;  4KLK A;  4HJ9 A;  4BXX G;  1HR0 W;  5IWA Q;  2VUM G;  1U0L A;  2UXC L;  5FLM G;  4HJ8 A;  3K81 C;  4X62 L;  4DR5 Q;  2BH2 A;  4DR4 L;  4AYB G;  4GKK L;  4RG1 A;  2HQL A;  4LF5 Q;  4A3C H;  1VQI A;  3RLO A;  3W1G A;  2K5N A;  2K14 A;  4A3G H;  3HOW G;  2Q2I A;  5LMN W;  1IBL L;  1JMC A;  3TEH B;  1TWG H;  1SLJ A;  1PYS B;  3H0G H;  3HKZ E;  4BY1 G;  1CSP A;  1SMX A;  4EX5 A;  2KHI A;  3KJP A;  4HIO A;  4OO1 G;  4JI7 Q;  4LF4 Q;  3TS2 A;  1AH9 A;  4A3F H;  4DV1 Q;  1UWV A;  4LFB Q;  1UEB A;  4Y52 H;  3GTL H;  2VW9 A;  4DV7 L;  1N8R C;  2VL6 A;  3I4N G;  4GNX B;  1VQ4 A;  5GAD C;  3CC7 A;  2E2I H;  3PUY A;  3H15 A;  1KC8 C;  2ZM6 L;  5C0X G;  3T1H Q;  2E5L L;  3S2H H;  2DUD A;  2CWP A;  1EFW A;  4LFA L;  2VNU D;  4YWM A;  2OTJ A;  5ELO A;  1K9M C;  4PZ8 A;  5M5W H;  5JEA J;  1YJW A;  1WFQ A;  1WCM G;  5DLQ E;  1H95 A;  4NXM Q;  1BKB A;  3J81 j;  3FHW A;  4B3S Q;  1KL9 A;  3AEV A;  3F1Z A;  3J81 i;  2JEB I;  3UE0 A;  1YJ9 A;  1PH5 A;  4DUY Q;  3F8T A;  2YTY A;  1QUQ B;  1LUZ A;  2CCZ A;  1X3G A;  2VZA A;  3PUX A;  3HOX G;  3U4V A;  1P8L A;  1X6O A;  3U4Z A;  3T1Y Q;  1EUJ A;  1N9W A;  3M4O H;  1VQ7 A;  4B3M L;  4LFC L;  3STB C;  2VS1 A;  3OW2 A;  2JA8 G;  2ES2 A;  3CQZ H;  1VQ8 A;  1SR3 A;  3A0J A;  2JA6 H;  2N3S A;  4R4Q A;  4DV4 L;  3CCS A;  2IX0 A;  2PMZ E;  3BJU A;  2IX1 A;  3GTK H;  2K75 A;  1XMQ L;  1RL2 A;  1X54 A;  5C4X H;  2ID0 A;  3GTM H;  4WJ4 A;  1Y1V G;  3CF5 A;  4B3T L;  1OXX K;  1P16 A;  4X6A H;  5JEA G;  3CCM A;  3S1R H;  1PH7 A;  5FLX c;  2AKW B;  3CD6 A;  4B3R Q;  1K73 C;  1UE1 A;  4IPG A;  4DV0 L;  4GKJ Q;  1X55 A;  5IYD G;  4YHH L;  1PH3 A;  3I2Z A;  4DR1 L;  3W1B A;  1NBW A;  3CCQ A;  1PFS A;  3S2D H;  4RMF A;  4ME3 A;  1AE2 A;  2D0P A;  2F52 A;  2L15 A;  2LSS A;  1UE7 A;  2Z6K A;  3S14 H;  1G6P A;  2K52 A;  1WYD A;  2HT1 A;  4BBS G;  3H3V I;  4X65 L;  4JI5 L;  2UUA Q;  2OQK A;  2RHS B;  3TQY A;  3TRZ A;  1OXT A;  2NZH A;  5BR8 L;  3CCU A;  3HKZ G;  2VQE Q;  4P73 A;  4O2D A;  4DR5 L;  3LGJ A;  4A3M H;  4BXX H;  4LF5 L;  4A3J H;  1CKO A;  2VUM H;  4JI2 Q;  4MTN A;  5FLM H;  1HNW Q;  3J81 c;  1E22 A;  1C0A A;  2IHF A;  2I5L X;  2MQH A;  3G6E A;  1XNQ Q;  4KHP Q;  4BY7 G;  2UUB Q;  2D0O A;  4LF4 L;  4DR3 L;  4DV1 L;  2ZTE A;  2WFW A;  4BY1 H;  4LFB L;  2YYZ A;  1HNZ L;  1EQR A;  1HZA A;  2I5H A;  3ER0 A;  3I4O A;  2BH8 A;  4DR2 L;  2LXJ A;  3T1H L;  1PH9 A;  4PG3 A;  4JBW A;  2CQO A;  4GN5 A;  4R4C A;  4A3D G;  3I4N H;  4P71 A;  2R7Z G;  5C4J H;  4LWC A;  1V9P A;  1XTD A;  2CWA A;  5IY0 A;  3JC6 6;  4DV6 L;  5J3B A;  1WCM H;  1C9O A;  1GD7 A;  1PH6 A;  5GAH C;  1KQS A;  4DUY L;  2Y0S E;  1V43 A;  3S16 H;  1CKN A;  1L1O C;  4YWK A;  2GVB A;  1G51 A;  5EAY A;  2B3G A;  3UDX A;  3RZO H;  2KHJ A;  4JI1 Q;  1GKH A;  4AH6 A;  3T1Y L;  1XMO L;  3A74 A;  3RR5 A;  3NEL A;  1DGS A;  1QZG A;  4LF7 Q;  2R92 G;  3OTO Q;  4IPC A;  1VQC A;  5LMU Q;  3PO2 G;  1N36 Q;  4GOP A;  1A62 A;  2PNH A;  2QA4 A;  3A5U A;  1PA6 A;  4GS3 A;  5IP9 G;  3GTJ H;  3HFZ B;  4JI0 Q;  1JJG A;  2JA8 H;  3DM3 A;  2BA1 A;  2EIF A;  5M3M H;  1IXR A;  4O0A A;  1N33 L;  4P74 A;  2PQA B;  3PGZ A;  4TQU S;  1ASY A;  1PV4 A;  3CMA A;  2JQO A;  2D62 A;  3HOZ G;  1PH1 A;  4NPS A;  1RIP A;  1VQB A;  4GOP C;  2UXD L;  2WAQ E;  1CUK A;  2UXB Q;  2AHO B;  4A3B H;  1NMG A;  4DUZ Q;  1Q81 C;  4JI4 L;  5IYD H;  4DV2 Q;  3MEF A;  2UUA L;  1L1O B;  1BBW A;  4IFD I;  2JA7 G;  1YHQ A;  3OYY A;  1XNR L;  1VQP A;  4OX9 L;  3S1M H;  1VQJ A;  5AJ3 Q;  2F3I A;  2ATW A;  3I7F A;  4LW1 A;  3ERS X;  4BBS H;  4DR6 L;  2VQF Q;  1I50 H;  2ZJR A;  4DPG A;  2QGQ A;  5C3E G;  4IOA A;  2NN6 I;  4JI2 L;  1HNW L;  4P75 A;  1Q82 C;  3VDY A;  4JI6 L;  1KAW A;  4X64 L;  1A8V A;  1VQG A;  2JA5 G;  1N32 L;  4GLA C;  4OWW B;  1K0R A;  4H02 A;  1YJN A;  3UDG A;  3I55 A;  1X56 A;  1X65 A;  2OCE A;  4R1J A;  1KRT A;  4A3I G;  1Q86 C;  3PO3 G;  1SRO A;  5IE8 A;  3CAM A;  2GN5 A;  2NVT H;  1I3Q H;  1KXL A;  2R7D A;  3KDF B;  4MZ9 A;  2ZTD A;  2A8V A;  2VY3 A;  4P72 A;  4DR7 Q;  4LF9 Q;  1Y1W G;  3S1N H;  4HJA A;  1BVS A;  4BA2 I;  4EQ5 A;  2YU9 H;  2Y0S G;  3J80 c;  4GOP B;  4L5R C;  2JEA I;  2I5M X;  3GTO H;  3ULL A;  5GQO A;  5IYB G;  4JV5 Q;  2F4V L;  4YCW A;  1IBM Q;  2R93 G;  1VQA A;  4JBK A;  3G4S A;  4DV3 Q;  4X66 Q;  1VQF A;  4JI8 Q;  1YNX A;  2N78 A;  1OXU A;  2UU9 Q;  2BA0 A;  1HR0 Q;  3CW2 C;  1TXY A;  1MIU A;  5IYC G;  3CCV A;  3EBE A;  2ZTC A;  1FJG L;  3HOV G;  4QY7 A;  4JI1 L;  1AE3 A;  2DGY A;  1HNX Q;  4AQY Q;  4DV5 L;  2PI2 E;  2HHH L;  5IP7 G;  3S17 H;  5LMN Q;  3RZD H;  1Z47 A;  1VCI A;  4JI3 L;  3PF5 A;  5FJ8 G;  4A93 G;  1UE6 A;  2WP8 J;  3S24 A;  1YZ6 A;  5LMU L;  1MJC A;  4HIK A;  2UUC L;  4WJ3 M;  1L2F A;  2NZO A;  4R4O A;  3M85 A;  1N36 L;  2UXC Q;  2R92 H;  4X62 Q;  1MKH A;  5IWA L;  5JJI A;  4JI0 L;  2B29 A;  1E24 A;  5C44 G;  4A3E H;  1TWF H;  2HIV A;  2MO1 A;  2A19 A;  3GTG H;  3PO2 H;  2XTI A;  4J15 A;  1OXS C;  4IPD A;  1J6Q A;  4BBR G;  1FVI A;  5IP9 H;  1IBL Q;  3CCL A;  1D7Q A;  3J7A 5;  1NY4 A;  2JJQ A;  2WB1 E;  3GD7 A;  3RNU A;  1JJC B;  1K3R A;  4XIG S;  3PCO B;  3J7Z C;  2E2J H;  3D0F A;  2Z6K C;  1IYJ B;  1KHI A;  3PUW A;  3HOW H;  4OWX B;  4MNO A;  4GLX A;  4JI7 L;  3AQQ A;  4DK6 C;  1B7Y B;  1VQE A;  2HIX A;  4DV7 Q;  3ULJ A;  1SFO H;  3CC4 A;  3HOU G;  3HOZ H;  5M5Y H;  2ZM6 Q;  1VQH A;  2NVQ H;  1YIT A;  3E0E A;  2E5L Q;  4QQB X;  4LFA Q;  4DV2 L;  2KCT A;  1TWH H;  4UP7 A;  1VS0 A;  4R4T A;  1X3E A;  3K8A A;  2N49 A;  4OON A;  3AYH B;  5AJ3 L;  1CSQ A;  2Z0S A;  3F2D A;  4BA1 I;  1X9N A;  1PVO A;  5GRO A;  4NXM L;  2JA7 H;  4UPA A;  1Y14 B;  2B63 G;  1O7I A;  4JCV E;  4B3S L;  4JYA Q;  4LNQ A;  1A63 A;  4JBJ A;  1IL2 A;  2MNA A;  4UY8 C;  2RF4 A;  1OTC A;  4IJH A;  1HH2 P;  1NTG A;  3I4M G;  1YHB A;  3KYH C;  1I6H H;  2JA5 H;  4B3M Q;  1EYG A;  1PYB A;  5JJL A;  1YBY A;  4LUV A;  4UP9 A;  4LF6 Q;  1VQN A;  2OQ0 A;  3HOX H;  4IO9 A;  1KIX A;  2AWN A;  3MXN B;  3U58 A;  4A3L G;  4LF9 L;  4DV4 Q;  4OWT B;  4PZ6 A;  4A3I H;  3PO3 H;  3PUV A;  3EIV A;  5GAE C;  3F2B A;  1VQO A;  1JB7 A;  4NB3 A;  3J80 i;  3JAM i;  2JA9 A;  4LF8 Q;  4HJ5 A;  4JV5 L;  2MFI A;  1LTL A;  1B70 B;  1Q7Y C;  1QVF A;  1HR0 L;  5IYB H;  2ASB A;  2GVA A;  3HOY G;  4B3R L;  2R93 H;  4IFD J;  4YHH Q;  1HZB A;  1Y1V H;  3A5Z B;  2CKZ B;  4GN3 B;  4GKJ L;  1G29 1;  4IPH A;  2AMC B;  3CCE A;  1YEZ A;  4OO1 I;  4QJF A;  1HNX L;  4AQY L;  3KF8 B;  4XTC S;  1HJP A;  4UP8 A;  5IYC H;  1XPR A;  2KCM A;  2E8G A;  1M90 C;  4HIM A;  1FL0 A;  1PHJ A;  4JI5 Q;  3AFP A;  3D31 A;  4A3J G;  2K50 A;  2ALY B;  4AIM A;  1HZ9 A;  3GTQ H;  5BR8 Q;  2C35 B;  1E1O A;  1TWA H;  5IP7 H;  5C0X I;  3CC2 A;  2R6G A;  4TVA B;  2ZJQ A;  2WB1 G;  2YTX A;  1VQ9 A;  5FJ8 H;  4A93 H;  1N34 Q;  3M4P A;  1T9H A;  4YY3 Q;  3CXC A;  3KF6 A;  4DAY B;  1Q8K A;  1YHA A;  3G71 A;  2VQE L;  1EQQ A;  2OTL A;  4NXN Q;  4GN4 B;  1PH8 A;  3WWV A;  3GTP H;  1GO3 E;  1K8A C;  2K4K A;  5ELN A;  5C44 H;  3B6Y A;  3BU2 A;  1VQK A;  3CP0 A;  3M3Y H;  4K0K L;  3DLL A;  2YV5 A;  2I0Q A;  4KHP L;  1XNQ L;  2RCN A;  4BBR H;  3K80 C;  4DR3 Q;  2UUB L;  1JE5 A;  3SGI A;  3RLF A;  5IT9 c;  2E2H H;  1D8L A;  2R7F A;  1CKN B;  1HNZ Q;  3CPF A;  1WOC A;  5M3F G;  4BY7 H;  3UE1 A;  4C3H H;  3STB D;  4A3K G;  1GM5 A;  4DR2 Q;  3GO5 A;  1LM0 A;  2YTV A;  3CCR A;  4IFD G;  1SE8 A;  3M9B A;  1KD1 C;  3HOU H;  4K0K Q;  2EQS A;  5HY6 A;  4L5T A;  4L5Q A;  1CKM A;  3H3V H;  3KJO A;  4JC0 A;  1HZC A;  2NN6 G;  3E9H A;  3JAM c;  1XJV A;  4R4I A;  4IOC A;  1J5E Q;  4YCV A;  1E3P A;  4JOI A;  4DV6 Q;  4A76 A;  4A3D H;  3L2P A;  3K7A H;  1I5F A;  3U50 C;  4L5S A;  2AWO A;  4DAM A;  1IBK Q;  2QEX A;  1I94 Q;  3L7Z C;  1VQ5 A;  2R7Z H;  4JYA L;  3FKI G;  3PSI A;  2K5H A;  3CME A;  4PMW A;  2OWO A;  4POF A;  2B63 H;  3EN2 A;  1V1Q A;  4C3J H;  1EIF A;  4C3I H;  1XMO Q;  1L0W A;  1B8A A;  4KHZ A;  1WI5 A;  3IRB A;  1XPO A;  3ZJY C;  1FGU A;  2JE6 I;  2EXD A;  1PH2 A;  1VQL A;  4LF6 L;  1VQ6 A;  3ICE A;  4QIW E;  4LF7 L;  4YCU A;  3OTO L;  4JOI C;  3I4M H;  1LYL A;  3RLN A;  5M3M G;  1E7Z A;  1KRS A;  4LUO A;  4A3C G;  3PIP A;  1QVC A;  1U5K A;  4YWL A;  1W3S A;  4A3G G;  4DR4 Q;  3FP9 A;  3NEM A;  4GKK Q;  4A3L H;  1UE5 A;  4LF8 L;  3H0G G;  1N33 Q;  4JBM A;  3KF6 B;  5M5X H;  3RN2 A;  2IHE A;  1VQM A;  1VQD A;  5JJK A;  2KBN A;  4A3F G;  1BBU A;  2WAQ G;  3PIO A;  1WJJ A;  1NE3 A;  4DK3 C;  1IZ6 A;  4AYB E;  4KI0 A;  3BZC A;  1S3O A;  2FXQ A;  1R9T H;  4A3B G;  1NJI C;  1X3F A;  2UXD Q;  2Q2T A;  2K5V A;  4GLV B;  5K36 G;  1QVG A;  4ALP A;  1MJE A;  3HOY H;  1ASZ A;  5GAG C;  2PI2 A;  1S72 A;  4JI4 Q;  4A75 A;  2UXB L;  5H1S E;  1W2B A;  3S1Q H;  2NVX H;  3NEN A;  4DUZ L;  2Q2U A;  4FDB A;  5HGQ A;  1XNR Q;  4OX9 Q;  2N8N A;  5E7N A;  4DR6 Q;  4IJL A;  3L0O A;  1N34 L;  4JG2 A;  4YY3 L;  2PQA A;  2VQF L;  1Q46 A;  1EOV A;  4NXN L;  1YVC A;  3ULP A;  2CFM A;  3M4Q A;  4QL5 A;  4JI6 Q;  2IT1 A;  4X64 Q;  1GVP A;  3I56 A; 
#chains in the Genus database with same CATH topology
 1ENF A;  1PTO C;  3NBH B;  4A3D B;  3BZK A;  3MXG A;  4KY6 A;  1EY5 A;  1H9J A;  1DM0 B;  1SN8 A;  2F0N A;  1K8G A;  3DHQ A;  3KOJ A;  4XT1 B;  4C56 C;  3CPW A;  5C4X G;  2RCF A;  1A0I A;  1HTL D;  1ZXT A;  1JWS D;  3UDI A;  4HMI A;  3S15 H;  2PQE A;  3Q8D A;  2NTT A;  2XGT A;  3W2D A;  1Y8P B;  4HID A;  1J5E L;  1EY7 A;  2PW5 A;  1IKM A;  3BVM A;  2R92 B;  1I94 L;  4X3T A;  1YI2 A;  1EZ8 A;  5KEE A;  3PO2 B;  4ZAI A;  4DV0 Q;  3KFU A;  1CHP D;  5C0X J;  1OXV A;  3PUZ A;  4DV5 Q;  3AFQ A;  1SNQ A;  3FKI H;  3I72 A;  3K7U C;  3VR5 A;  2FMM A;  2KEC A;  2A1A A;  1EY8 A;  4K2K A;  2UUC Q;  4X65 Q;  2N55 A;  4RGO S;  1LTB D;  4X3K A;  2UXC L;  3HOZ B;  1S5C D;  1TS4 A;  5M5Y B;  4GKK L;  2NVX B;  4F8M A;  4LF5 Q;  1DOL A;  3HOW G;  3W3A A;  3E3X A;  5LMN W;  1QJO A;  5ISR A;  4EX5 A;  3TS2 A;  3BDC A;  5KYI A;  1CA5 A;  4LFB Q;  3K5M A;  1J9O A;  4Y52 H;  4DV7 L;  2VL6 A;  4GNX B;  1SYB A;  3H15 A;  2ZM6 L;  4XYQ A;  2VNU D;  5CV7 A;  4YWM A;  2OTJ A;  3BDL A;  3UI2 A;  1YJW A;  2QKI C;  1Q8I A;  1WFQ A;  1X32 A;  1JIC A;  3DWQ A;  2B2W C;  1PZK D;  3J81 j;  3BG3 A;  3MAQ A;  4CBV A;  3H91 A;  3PO3 B;  1Y1W B;  1BO0 A;  2Y0S B;  1X6O A;  2A6H D;  2VS1 A;  2WKD A;  2OT2 A;  5F2D A;  1H9S B;  3CQZ H;  2OEO A;  2JA6 H;  3VYR A;  2EYL A;  2G5D A;  3L3O C;  4L6T B;  2IX0 A;  2H4O A;  2K75 A;  1CI3 M;  1PFM A;  1Y1V G;  2AUK A;  3T53 B;  1OXX K;  1TWA B;  3J7A F;  5CBA E;  3VA7 A;  3CCM A;  4KY7 A;  4BS9 A;  1XYI A;  4IUQ A;  2ICE C;  4DV0 L;  4GKJ Q;  3FMC A;  5IYD G;  1WTR A;  3TBI B;  1EY4 A;  4RAU C;  1PFS A;  2F0V A;  2L15 A;  4BBR B;  3LX0 A;  1WYD A;  4X65 L;  2WAQ B;  5A2Q E;  2OQK A;  2RHS B;  3TQY A;  5BR8 L;  2V4D A;  3HKZ G;  2VQE Q;  4P73 A;  4C3H B;  4I7A A;  3LGJ A;  4LF5 L;  3BVG A;  3OOC A;  1CKO A;  4JI2 Q;  1PRT F;  3K6O A;  2I5L X;  2EDG A;  1IKL A;  4OIJ A;  3EVQ A;  1D1K A;  3K58 A;  2ZXO A;  5IIF A;  2O5J C;  4LFB L;  2YYZ A;  3FVQ A;  2I5H A;  4EQP A;  2LXJ A;  1ESR A;  1F2Z A;  4IN3 A;  4PG3 A;  4MN3 A;  1ZYR C;  3QG1 A;  2RDF A;  4DAY A;  2R7Z G;  1PYW D;  5C4J H;  3WDN A;  1SE2 A;  1I4P A;  3JC6 6;  2X6G A;  4C3J G;  5EGT A;  1WCM H;  1C9O A;  1GD7 A;  2M2L A;  1CKN A;  1L1O C;  1CT1 D;  2KHJ A;  4JI1 Q;  3RR5 A;  5CV4 A;  3OTO Q;  3VR6 A;  1R9T B;  3J7A V;  2L11 A;  1K28 A;  1VQC A;  1BCP D;  1EEI D;  1N36 Q;  4GOP A;  1ESF A;  2F3V A;  1WTP A;  2JA8 H;  2BOS A;  5M3M H;  3OWE B;  2Z9H A;  3DWA A;  2PQA B;  2L1B A;  3SK8 A;  1X3Q A;  1HCZ A;  3CMA A;  4A3J B;  3I91 A;  5J22 A;  4NPS A;  1RF2 D;  1D6E C;  3GV6 A;  4R8I A;  1Q81 C;  3MEF A;  4IFD I;  2JA7 G;  3S1M H;  2M00 A;  2F3I A;  2FFK B;  4ULL A;  5T1I A;  4BBS H;  1TII D;  2VQF Q;  1I50 H;  2BE5 D;  2ZJR A;  4HSV A;  4J8Q A;  4IOA A;  4JI2 L;  4KJO A;  2TMP A;  4P75 A;  4A3K B;  3R8B A;  2KCC A;  4JI6 L;  1O7L A;  5BN5 A;  4GLA C;  1N32 L;  4H02 A;  1YJN A;  3UDG A;  3I55 A;  3OIQ A;  4FYD A;  2OCE A;  4R1J A;  1Q86 C;  3S16 B;  1SRO A;  2GN5 A;  1I3Q H;  1WTQ A;  3KDF B;  5ELC A;  5FLX L;  4B9W A;  4LF9 Q;  1BVS A;  4BA2 I;  4XYO A;  2JEA I;  3D4D A;  3ULL A;  5GQO A;  3X3M A;  2RQX A;  1EU4 A;  4X66 Q;  1MHW C;  4JI8 Q;  3GTJ B;  2N78 A;  2BA0 A;  3MXU A;  1HR0 Q;  3ZYY X;  3D4W A;  4JI1 L;  4U68 A;  1G8Z D;  4RHS A;  2K5Q A;  3H09 A;  1L0Y B;  4AQY Q;  1KTK A;  1Z47 A;  4JI3 L;  3PF5 A;  3Q23 A;  1V1P A;  2CHB D;  5JJZ A;  3S24 A;  4WJ3 M;  2NZO A;  1N36 L;  2R92 H;  1MKH A;  3S2D B;  3SK6 A;  2E2I B;  3PO2 H;  2HIV A;  2MO1 A;  4J15 A;  1WD0 A;  1B9M A;  2K1B A;  4JK1 C;  3OMG A;  2WB1 E;  1PTO D;  2LY7 A;  3GD7 A;  3RNU A;  4XIG S;  3PIO 3;  4G7Z C;  4QUC A;  1LAB A;  3PUW A;  4JI7 L;  5CV6 A;  3HOU G;  2SNS A;  2HIX A;  1CFM A;  1ML0 D;  1HHV A;  1G6Z A;  1B9N A;  3HOZ H;  5M5Y H;  4R8N A;  3E0E A;  4QQB X;  1EYC A;  4LFA Q;  2KCT A;  4H7B A;  2N49 A;  1JR0 D;  4OON A;  3AYH B;  4RWS C;  1CSQ A;  2EOT A;  4BA1 I;  1X9N A;  1PVO A;  1RHP A;  4UPA A;  1Y14 B;  3GV3 A;  2B63 G;  2F0W A;  2YU9 B;  4C3I G;  4JBJ A;  3A7L A;  3K59 A;  5EBD A;  2MNA A;  4UY8 C;  1CK1 A;  5CMD A;  4MTK A;  2DN8 A;  1O7Y A;  3KYH C;  3K0Y A;  5KNB A;  3S1R B;  5JJL A;  1AEX A;  4XQQ A;  4EGV A;  2AWN A;  1TQO A;  5BN3 A;  3U58 A;  4LF9 L;  4DV4 Q;  1SNM A;  3PO3 H;  4F87 A;  5GAE C;  3F2B A;  3S14 B;  3J80 i;  1R4Q B;  4HJ5 A;  3G6J B;  1LTL A;  4H0L C;  1CZW A;  2F0J A;  4A3E B;  1HR0 L;  2GVA A;  4YHH Q;  2CKZ B;  1G29 1;  4IPH A;  3PMF A;  4AYB B;  5TSS A;  1UNS A;  3KF8 B;  4AQY L;  1FNV A;  3KLS X;  2E8G A;  5EJW A;  1LO5 D;  2PZW A;  4P2C B;  3N52 A;  4NW2 A;  3GTQ H;  5C0X I;  1TWA H;  4BY1 B;  2R6G A;  2E75 C;  4A93 H;  1SNC A;  4DU9 A;  3KF6 A;  1Q8K A;  1LT4 D;  1EQQ A;  4GN4 B;  1PH8 A;  3HZX A;  1AN8 A;  4RKB A;  3I4N B;  3B6Y A;  3BU2 A;  4RGN A;  1U4L A;  3URY A;  3M3Y H;  2B2W A;  2MP1 A;  3K5O A;  1XNQ L;  5C4Z A;  4KHP L;  4BBR H;  1EY9 A;  2UUB L;  1JE5 A;  1PLF A;  5IT9 c;  1WOC A;  4C3H H;  1JWU D;  2EYO A;  2YTV A;  3CCR A;  4IFD G;  3M9B A;  4K0K Q;  4X3S A;  3HOX B;  2SEB D;  1X3P A;  4DV6 Q;  4A76 A;  4KTA A;  3NHH A;  1EU3 A;  2QDL A;  4DAM A;  2QEX A;  3BYT B;  4ZUI A;  1ICW A;  5IGG A;  3CME A;  1PFB A;  4PMW A;  2OWO A;  1V1Q A;  4CDF C;  1EIF A;  1L0W A;  1XPO A;  1WI5 A;  1VQ6 A;  4QIW E;  2QIL A;  4ZKC B;  4JOI C;  2Z4I A;  5M3M G;  4KKU A;  1E7Z A;  4LUO A;  3M7G A;  1KNE A;  4A3G G;  1DXM A;  1W3S A;  3R93 A;  4NKL A;  1I4R A;  3H0G G;  1N33 Q;  4IAL A;  1VQM A;  2Z4H A;  4A3F G;  1NE3 A;  4DK3 C;  1IZ6 A;  1NR4 A;  1R9T H;  1SNO A;  2F0G A;  4C1N I;  2OXP A;  1TVX A;  4A75 A;  1W2B A;  4KK7 A;  3A56 A;  1ZYR D;  5HGQ A;  2NUC A;  2N8N A;  3NQI A;  5JOB A;  1D5X C;  2X6L A;  4JG2 A;  3HOU B;  2K03 A;  4M1U B;  2IT1 A;  3I56 A;  1TWC H;  1STH A;  2L0C A;  3R3O A;  3Q24 A;  1EWI A;  3U9O A;  5C3E H;  3MVV A;  2RHQ B;  3K7A B;  4APV A;  1JT8 A;  4ME5 A;  1XPU A;  1L1O A;  4LFC Q;  2B63 B;  2E2D C;  2XRS D;  1D5Z C;  5CR3 A;  4A4I A;  2V1C C;  1Q1E A;  1S40 A;  4K0K L;  1EFI D;  3OPO A;  2ZJP A;  4DR7 L;  1WD1 A;  4A3K H;  4LUZ A;  3UDF A;  5BN4 A;  2NVY H;  2LXK A;  4DAV A;  1VMP A;  1Q12 A;  4GNX C;  1MSG A;  2NN6 H;  4DV3 L;  2EYJ A;  2F0I A;  3I90 A;  3CCJ A;  1RDP D;  3KLW A;  4DNI A;  3HGB A;  4DKA C;  1K3B C;  1QZH A;  4FXD A;  5LMN L;  1K83 H;  1JE4 A;  2QEJ C;  2JK8 A;  4OXP A;  3SR1 A;  4A3M G;  1EZ6 A;  1HR0 W;  5IWA Q;  1SFO B;  2VUM G;  3QWN A;  4HJ8 A;  2BH2 A;  4HSP A;  4TRD A;  4X62 L;  1JWM D;  3NTI A;  1F9S A;  2HQL A;  2EYF A;  4A3C H;  2H1E A;  1TWH B;  1JMC A;  2Q8T A;  2QF7 A;  4OL7 A;  1SMX A;  4KMU C;  2KHI A;  4ILW A;  4HIO A;  2F0L A;  4LF4 Q;  5KNC A;  5E4W C;  1UWV A;  3JAM L;  4PMC A;  3GTL H;  2VW9 A;  3S2D H;  2AQ2 B;  2HCC A;  2E74 C;  5GAD C;  3CC7 A;  2E2I H;  4F7X A;  5C0X G;  3T1H Q;  1II3 A;  1K9M C;  4PZ8 A;  5DLQ E;  1H95 A;  2I07 B;  4OIK A;  5J1Z A;  1KL9 A;  3TP8 A;  5IOC A;  3F1Z A;  4A3I B;  1YJ9 A;  3D8G A;  1PH5 A;  3F8T A;  2YTY A;  4RKL A;  1LUZ A;  1S4Z A;  2CCZ A;  1QOH A;  4K14 A;  1O80 A;  3U4V A;  3T1Y Q;  1EUJ A;  1N9W A;  4LFC L;  3STB C;  3OW2 A;  3KLR A;  2G9D A;  2R3Z A;  5FLX E;  1DD2 A;  3HOV B;  2IX1 A;  2KVM A;  4WOR A;  1LV9 A;  1RL2 A;  3X3N A;  3J7Y W;  4WJ4 A;  3GTM H;  3C2P A;  3S1R H;  1PH7 A;  2JN4 A;  3WOE A;  5J39 A;  1WTW A;  1SEB D;  1UE1 A;  3W1B A;  3CCQ A;  1DZ1 A;  2FHT A;  3H0G B;  4RMF A;  3MXN A;  1TT2 A;  2LSS A;  3MHB A;  4CJ0 B;  1UE7 A;  3S14 H;  1G6P A;  2O5I C;  2HT1 A;  2EJM A;  4JI5 L;  1G2S A;  1QNK A;  2NZH A;  3QJY A;  1KNA A;  4JVZ A;  3S2H B;  4BXX H;  4MTN A;  4ODG A;  5FLM H;  3J81 c;  5M5W B;  1E22 A;  2J4X A;  2IHF A;  2ZT9 C;  2QDB A;  4LF4 L;  1I4Q A;  1JOQ A;  3VR2 A;  2I46 A;  2ZTE A;  4BY1 H;  1HNZ L;  1EQR A;  1HZA A;  2DNE A;  4OO1 H;  3ER0 A;  3T1H L;  2CQO A;  3M4O B;  5ELE A;  4QMG A;  3I4N H;  4P71 A;  2L12 A;  3OW7 A;  3SXH A;  4LWC A;  4EVO A;  1SDF A;  5ELF A;  3FPP A;  4LMQ D;  5J3B A;  3GP7 A;  5GAH C;  2VXW A;  2Y0S E;  4YWK A;  2KCN A;  1NAP A;  1GKH A;  3T1Y L;  1XMO L;  2A68 C;  3TZD A;  3NEL A;  1QZG A;  1SE4 A;  4LF7 Q;  2O4X A;  5LMU Q;  2EYM A;  3MTS A;  1A62 A;  5IP9 G;  3I4L A;  1JJG A;  1UUP A;  5JAV A;  1KDC A;  2ICI A;  1I4G A;  1LT5 D;  3T16 A;  1I6V C;  4OGQ C;  4NDX A;  5T1G A;  3C3L A;  2VUM B;  5JEA H;  5I4D A;  4L8J A;  4RGT A;  2WAQ E;  3NTK A;  3V96 A;  4DUZ Q;  4JI4 L;  1WVL A;  2SOB A;  2LKV A;  3IL8 A;  1YHQ A;  1XNR L;  4OX9 L;  1ZEQ X;  4FNF A;  4LW1 A;  1QE6 A;  4FF1 A;  4DPG A;  4DK0 A;  5C3E G;  1AFP A;  5JVH 3;  5M3F B;  4I65 A;  3FDT A;  1BCP F;  4G7H C;  2IL8 A;  4C2M B;  1VQG A;  2JA5 G;  1SJH D;  2MGS A;  1HA6 A;  4HCS A;  1DOM A;  2Z1C A;  5IE8 A;  5CYU A;  3F2U A;  1KXL A;  2VY3 A;  3P1H A;  2ENB A;  3S1N H;  4HJA A;  4OHJ A;  3NK9 A;  4K5X A;  4EQ5 A;  3J80 c;  4GOP B;  1HQR D;  2HUG A;  1IBM Q;  3M4Y A;  1VQA A;  2EVB A;  2R93 G;  3G4S A;  1VQF A;  2UU9 Q;  3NBH A;  3KLS A;  2F0D A;  1BOS A;  4IUN A;  5IYC G;  3CCV A;  3EBE A;  2LFN A;  4NMZ A;  3DM1 A;  3VR4 A;  1TWG B;  4DV5 L;  5FJ8 G;  1ET9 A;  2UUC L;  1YZ6 A;  5LMU L;  2F0H A;  2A5H A;  4HIK A;  1BNZ A;  1L2F A;  4R4O A;  1EL0 A;  5JJI A;  4A3B B;  3TME A;  1F77 A;  1E24 A;  1MBY A;  5C44 G;  3EQL C;  1OXS C;  1K8M A;  1B2T A;  1IBL Q;  3CCL A;  1NY4 A;  1GOZ A;  1JJC B;  3PCO B;  3J7Z C;  1EYD A;  2Z6K C;  1IYJ B;  3KUP A;  1KHI A;  1H9R A;  1B1Z A;  3AQQ A;  1EOT A;  4X3U A;  1SFO H;  1SAP A;  3QOJ A;  3CC4 A;  2EY5 A;  1ENC A;  2MHV A;  2E5L Q;  3DEO A;  1TWH H;  3BZD B;  4UP7 A;  1X3E A;  3K8A A;  4FXK C;  1DON A;  3F2D A;  2Z8L A;  3GTO B;  1BUV T;  3GQB A;  1PRT B;  3BYY B;  3NBI A;  5C4X B;  1JOO A;  2RF4 A;  2R61 A;  1NTG A;  3IAY A;  3I4M G;  2J7Z A;  4B3M Q;  1EIH A;  1EYG A;  1TU2 B;  4LUV A;  4UP9 A;  1PTO F;  4IO9 A;  1ET6 A;  1KIX A;  4A3L G;  3C1F A;  5C3W A;  3RUZ A;  4A3I H;  3PUV A;  1HXY D;  4NB3 A;  3JAM i;  2JA9 A;  1HTP A;  4CHT B;  1F2L A;  1EWC A;  1JC7 A;  5IYB H;  3HOY G;  3ND9 A;  5FO7 B;  4GKJ L;  2B2T C;  4QJF A;  4XTC S;  1XPR A;  2WV6 D;  2KCM A;  2ZXP A;  1QCB D;  4HIM A;  1FL0 A;  3HOW B;  4KJN A;  3D31 A;  4WRD A;  4AIM A;  5IP7 H;  1E1O A;  1WTH A;  2BDO A;  2WB1 G;  4IQZ A;  2CH4 W;  1VQ9 A;  2NVQ B;  1N34 Q;  3D3R A;  1FR3 A;  3M4P A;  2VQE L;  3GTP H;  4HTH A;  4HN7 A;  4RCO A;  2PZT A;  2RCN A;  1V8Q A;  3K80 C;  4DR3 Q;  3SGI A;  2A6E C;  2F1M A;  1D8L A;  2R7F A;  1GUG A;  3CPF A;  2FJ2 A;  4BY7 H;  3UE1 A;  1E2W A;  3JAM E;  3STB D;  4DR2 Q;  1EY6 A;  1KD1 C;  3RZO B;  1I6H B;  3A55 A;  4L5Q A;  3H3V H;  3E9H A;  3AU7 A;  4IOC A;  1AW7 A;  4TSS A;  1E3P A;  1K0S A;  4A3D H;  3L2P A;  3U50 C;  1I5F A;  5IGF A;  3OWF A;  3OMC A;  4K5W A;  1IBK Q;  3L7Z C;  4O1N A;  5DM7 3;  3ERQ A;  2WAC A;  3FKI G;  2O2L D;  1NR2 A;  2K5H A;  1XX8 A;  1B8A A;  4PNY A;  2HDL A;  1HFG A;  2JE6 I;  1ZKO A;  3A8I E;  1PH2 A;  1B4O A;  1Y1V B;  4YCU A;  2XVS A;  3OTO L;  3QIA A;  1LTT D;  3PIP A;  1KDB A;  2IPK D;  1G91 A;  3FP9 A;  3NEM A;  1STN A;  3KF6 B;  3RN2 A;  2XRQ D;  4PMB A;  5JJK A;  2WII B;  2B2V C;  2EY2 A;  4AYB E;  2ZXR A;  2FXQ A;  1VDZ A;  4CKE A;  2UXD Q;  3HKZ B;  4DXF A;  1QVG A;  1ASZ A;  3ONA B;  5H1S E;  2NVX H;  2E2H B;  3NEN A;  4FDB A;  3VYU A;  1J8I A;  4DR6 Q;  4IJL A;  3L0O A;  1N34 L;  2PQA A;  1U9R A;  2VQF L;  1EOV A;  2XIW A;  4LK1 C;  3M4Q A;  5KRU A;  2KOL A;  1HRJ A;  4X64 Q;  5CV9 A;  4KV6 A;  4CDC C;  1OO9 B;  3W5O A;  2PYK A;  1DCZ A;  3P75 A;  2R7Z B;  2A68 D;  1BQQ T;  3P7J A;  2JA6 G;  3VYT A;  1YIJ A;  2P5Z X;  2MO0 A;  1IYU A;  4C3J B;  3K0X A;  3E9I A;  1Z9F A;  5M3F H;  4UDU C;  2Z6B A;  1E1T A;  1D2B A;  5I2Y A;  3FPU B;  1Q1B A;  4C2M H;  3RZD B;  3C46 A;  1XMQ Q;  4RA8 A;  2F4V Q;  1GUO A;  2NBF A;  5FKA C;  1Y1W H;  2WIN B;  1AZP A;  2PMZ B;  4B3T Q;  5FO8 B;  3CU7 A;  1IBK L;  1QUQ A;  4MIU A;  4X66 L;  4JI8 L;  4J1M A;  1FJG Q;  3GTG B;  5M5X B;  3PV0 A;  1Z7T A;  2KEN A;  1JJ2 A;  3F2C A;  2RSN A;  3G48 A;  2HHH Q;  3KDF A;  3HKS A;  1E2Z A;  2E2J B;  3GDE A;  3KK7 A;  1PZI D;  4QUF A;  3I3C A;  1SRU A;  4KLK A;  4HJ9 A;  2L5T A;  3HOY B;  2KHS A;  4DR5 Q;  5IT9 L;  4XXE A;  4RG1 A;  3SHL A;  2L4N A;  1VQI A;  3A7A B;  3W1G A;  2D2C C;  2K14 A;  4RHR A;  1TWG H;  2F0M A;  3NP8 A;  3KJP A;  2JA7 B;  1F9R A;  1FNW A;  4NP5 A;  5JPN C;  4DV1 Q;  1LT3 D;  1UEB A;  3Q6S A;  1K8O A;  1N8R C;  2F3W A;  1KC8 C;  4DNR B;  2DUD A;  2CWP A;  2B2U C;  4LFA L;  5K36 H;  2K7V A;  2FMC A;  5JEA J;  1WCM G;  3CRK C;  4NXM Q;  2F0K A;  2RSO A;  5LL6 S;  3FHW A;  4WFN 3;  4B3S Q;  3AEV A;  2JEB I;  2J0T D;  4DGZ A;  4V0B A;  4TKO B;  1X3G A;  1NCV A;  4RGM A;  1ONL A;  1YNJ C;  5IGB A;  1P8L A;  3U4Z A;  1GUS A;  2XNA C;  1PFN A;  4ID6 A;  1G2T A;  2G9H D;  2JA8 G;  3H3V C;  1MI2 A;  5EBC A;  4ABN A;  4ZCK A;  1DJR D;  2N3S A;  4R4Q A;  2RA4 A;  4DV4 L;  1XMQ L;  3LWU A;  1X54 A;  4DNT B;  5C4X H;  2ID0 A;  3ERO A;  2KA7 A;  5CV8 A;  3CF5 A;  4B3T L;  3P20 A;  2NVT B;  2IWH A;  1P16 A;  2AKW B;  3SVM A;  4B3R Q;  4KKS A;  4IPG A;  2X69 A;  1X55 A;  4YHH L;  4J6H A;  1NBW A;  1WTX A;  2D0P A;  1KAA A;  5A2Q L;  2F52 A;  2Z6K A;  5EQ0 A;  2E76 C;  2N88 A;  4BBS G;  1A2T A;  1JQY D;  2F0O A;  2UUA Q;  1YNN C;  3DEP A;  3TRZ A;  3PIP 3;  3CCU A;  4DR5 L;  4O2D A;  3LNN A;  4S3S A;  4A3J H;  2NB0 A;  1HNW Q;  1RCV D;  5COY A;  5HUR A;  4BY7 G;  1PDQ A;  4RCN A;  1Q3L A;  3KF8 A;  5AFW A;  1XXG A;  4U67 3;  4CDD C;  4DV1 L;  1EIG A;  2WFW A;  4WJW A;  1STA A;  5I2X A;  2D5D A;  3I4O A;  2A74 C;  4FP5 D;  2B39 A;  4JBW A;  3A8J E;  4C3I B;  4A3D G;  5I6Y A;  4K2L A;  1V9P A;  1XTD A;  3VR3 A;  1QB5 D;  3CQZ B;  1EYA A;  2EXZ A;  5IY0 A;  4DV6 L;  1A6X A;  5CBE E;  1PH6 A;  3FEW X;  3A54 A;  5NUC A;  3S16 H;  2NTS A;  3TN2 A;  1G51 A;  3NWS A;  3RZO H;  3IFD A;  3R2I A;  4IUU A;  2R92 G;  2RDH A;  2F0E A;  2B2T A;  1LTA D;  3L9A X;  5IGE A;  3PO2 G;  2F0S A;  1GXD C;  2PNH A;  4CJ1 B;  2QA4 A;  5E1F A;  4JPB W;  3GTJ H;  2F0U A;  2BA1 A;  2EIF A;  4O0A A;  2EE1 A;  1N33 L;  1C4Q A;  4TQU S;  1PV4 A;  5JVG 3;  5EKL A;  2JQO A;  5JPM C;  3HOZ G;  2A6E D;  1RIP A;  1VQB A;  3IKJ A;  4GOP C;  1B3A A;  2UXB Q;  2AHO B;  4CDE C;  4ZK9 B;  5IYD H;  2RKS A;  1S5B D;  4DV2 Q;  2UUA L;  3OYY A;  1VQP A;  1VQJ A;  5AJ3 Q;  3I7F A;  3ERS X;  2Q8R E;  4KN7 C;  1SYC A;  1HPC A;  4IUV A;  2NN6 I;  1SYG A;  2B8F A;  1HNW L;  1Q82 C;  3VDY A;  1A8V A;  2Q8I B;  3H6M A;  2MUY A;  1CQF A;  4OWW B;  1K0R A;  3OHX C;  5LHY 1;  1WCM B;  1X65 A;  1BXT A;  3DUZ A;  5G3L D;  3PO3 G;  2KEE A;  5FOB B;  2VB2 X;  1M8A A;  2R7D A;  2A8V A;  2EYH A;  3NUC A;  4MZ9 A;  4CKC A;  4P72 A;  3OSO A;  1S5D D;  1TR5 A;  1Y1W G;  3MZ5 A;  4Y7N B;  1EY0 A;  2YU9 H;  2Y0S G;  4JV5 Q;  4YCW A;  4R9W A;  2RDG A;  1OXU A;  1PZJ D;  1SYD A;  2AUJ D;  1TXY A;  1MIU A;  3SK5 A;  3I70 A;  5M3M B;  1TS2 A;  4IUP A;  4A3G B;  3HRZ C;  3MA2 B;  1HNX Q;  3RZD H;  3J81 L;  4A93 G;  2WP8 J;  4A3F B;  1PRT C;  1UEA B;  4ZRZ A;  2UXC Q;  2FIN B;  5IWA L;  1TS3 A;  4A3E H;  3GTG H;  1R4P B;  5C5L A;  1J6Q A;  4BBR G;  1FVI A;  4BBS B;  2JJQ A;  3SDZ A;  3MEH A;  2E2J H;  4C3H G;  3ND8 A;  4KN4 C;  2HCI A;  4DK6 C;  1B7Y B;  1VQE A;  2EY6 A;  2K6A A;  3ULJ A;  4DV7 Q;  1Q90 A;  1STB A;  5EPJ A;  2ZM6 Q;  1VQH A;  1F9P A;  4DV2 L;  1VS0 A;  4R4T A;  3BDO A;  4B9X A;  5AJ3 L;  3NTH A;  2A73 B;  4G4K A;  3TSS A;  4F88 A;  2XN9 C;  2JA7 H;  1IYV A;  2GA4 B;  1U4R A;  3E6Z X;  2CW0 C;  1Y8N B;  4KD4 A;  5DM6 3;  1CZG A;  2PZU A;  4LNQ A;  1QG7 A;  3GTK B;  1IL2 A;  3TP7 A;  4IJH A;  1HH2 P;  1YHB A;  1PYB A;  1YBY A;  1VQN A;  1CQV A;  1SE3 A;  1NNX A;  2OQ0 A;  3HOX H;  1AP0 A;  3T56 B;  4PZ6 A;  2HD3 A;  3BS1 A;  3EIV A;  1VMC A;  1VQO A;  3U9S A;  3RMH A;  5EKI A;  2B8G A;  4JV5 L;  2MFI A;  2IW3 A;  5CC4 A;  3Q0A A;  1QVF A;  4LJZ C;  2ASB A;  2L9H A;  4A3M B;  5CGK A;  2HDM A;  5IGD A;  2AMC B;  5C4H A;  1YEZ A;  4OO1 I;  1HNX L;  4QB4 A;  1HJP A;  4UP8 A;  1M90 C;  1VF5 C;  4H44 C;  3MFG A;  3O13 A;  3AFP A;  4A3J G;  5BR8 Q;  2C35 B;  2ZJQ A;  2NVT H;  1ENA A;  2CVR A;  2YTX A;  5D3I B;  1T9H A;  4YY3 Q;  4DAY B;  3G71 A;  5IT9 E;  2B2U A;  1GO3 E;  1JB3 A;  2YV5 A;  4G57 A;  2C9O A;  1YNJ D;  3J80 L;  1CKN B;  4KKT A;  1XWE A;  4Z9C B;  1TY0 A;  4A3K G;  1GM5 A;  2QW7 A;  3GO5 A;  3HOU H;  1E2V A;  2EQS A;  3G7L A;  5HY6 A;  3VYS A;  1IHZ A;  4L5T A;  3SK4 A;  2NN6 G;  2IJ0 A;  4R4I A;  4JOI A;  2B2Y C;  2K5D A;  4QCL A;  3K7A H;  4K6D A;  4L5S A;  2DY7 A;  4FF2 A;  1VQ5 A;  1BCP B;  1CM9 A;  4HAE A;  4K8I A;  1LTG D;  3PSI A;  2M9V A;  2B63 H;  4H13 C;  3EN2 A;  4C3I H;  1KLG D;  4KHZ A;  3IRB A;  2EXD A;  3CHB D;  1VQL A;  2EJF C;  4LF7 L;  1YNN D;  1KRS A;  5K5P A;  4A3C G;  2NWG A;  2JP1 A;  1QVC A;  2K5W A;  4DR4 Q;  2PCF B;  1FGB D;  4UHV A;  4JBM A;  3GTQ B;  1SBB B;  3KBG A;  1VQD A;  5I9O A;  4FF3 A;  2A69 C;  4A93 B;  1JOR A;  3R2T A;  1Z6H A;  3PIO A;  2BCO A;  4IUR A;  4ZYS A;  1D5M C;  4KI0 A;  1S3O A;  1NJI C;  1X3F A;  3T4A C;  2OF1 A;  2F0F A;  1Y8O B;  4GLV B;  3M3Y B;  4ALP A;  2XWB B;  4GZY C;  3I73 A;  2Q2U A;  4DUZ L;  3QR8 A;  4EQO A;  5E7N A;  1WTO A;  4K5V A;  4KD3 A;  4YY3 L;  1Q46 A;  2LS0 1;  2K05 A;  2CFM A;  4K6L A;  4QL5 A;  4BWG B;  1IL8 A;  1PH1 A;  4JI6 Q;  2TSS A;  1GVP A;  1D1I A;  5CV5 A;  2DY8 A;  2JXM B;  1N32 Q;  1I4X A;  1F2M A;  4CKB A;  1B50 A;  4E6I A;  2H5X A;  4GNX A;  1H9K A;  5KGU A;  1RTO A;  1SMY C;  3RN5 A;  4QGU A;  1A3V A;  1EQT A;  1LTI D;  5C5M A;  4CJ2 C;  4RFB A;  1LTR D;  3TS0 A;  1EIY B;  1V1P B;  4IFD H;  3S17 B;  1UAP A;  3S9W A;  1M1K C;  3TRE A;  5ELD A;  3K5N A;  1A3U A;  1C7Y A;  4PV1 C;  1IBM L;  1PH4 A;  2UU9 L;  2KED A;  1TWF B;  3CKI B;  1NMF A;  2AQ1 B;  4DR1 Q;  1GUT A;  3M7N A;  5C6A A;  4POG A;  4Y7N H;  2AQ3 B;  2Q2H A;  4JI3 Q;  4HJ7 A;  3PF4 A;  3HOV H;  1H9S A;  2C5C A;  4A3E G;  4PZ7 A;  1PTO B;  4BXX G;  1U0L A;  3QB3 A;  5FLM G;  3K81 C;  4DR4 L;  2XSC A;  4C1N K;  4AYB G;  3RLO A;  1QWY A;  2K5N A;  1IW7 C;  5M9O A;  4A3G H;  2Q2I A;  1IBL L;  3TEH B;  1SLJ A;  1PYS B;  3H0G H;  3HKZ E;  3MWY W;  4BY1 G;  1CSP A;  1MSH A;  4OO1 G;  4JI7 Q;  1NUC A;  1AH9 A;  4A3F H;  3EA6 A;  1TWC B;  5C3E B;  4DF7 A;  3I4N G;  4K8J A;  1VQ4 A;  1M4V A;  3PUY A;  3S2H H;  2E5L L;  1EFW A;  1WTV A;  5ELO A;  3T51 B;  1VF7 A;  1LTS D;  4I7Z C;  5M5W H;  2JA5 B;  4O42 A;  1BKB A;  3PQI A;  1C8C A;  1HUM A;  1S5F D;  3J81 i;  5I6W A;  3UE0 A;  4QF4 A;  1DOK A;  2NVY B;  4DUY Q;  1QUQ B;  4MHE A;  4DN4 M;  1O78 A;  2VZA A;  2HQE A;  3PUX A;  3HOX G;  3M4O H;  1VQ7 A;  4B3M L;  1BR9 A;  3QOL A;  2R93 B;  2ES2 A;  1PRT D;  1VQ8 A;  1SR3 A;  3A0J A;  1KAB A;  1GUW A;  1HQM C;  3CCS A;  2PMZ E;  3BJU A;  3GTK H;  1K83 B;  3D6C A;  4KY5 A;  1TKW B;  1STE A;  4X6A H;  5JEA G;  5C3X A;  1FYC A;  5FLX c;  3CD6 A;  1K73 C;  3CRL C;  4FF4 A;  3E5S A;  1PH3 A;  3I2Z A;  4DR1 L;  2VB3 X;  1ILQ A;  2KUM A;  5C44 B;  1TY2 A;  1L0X B;  4ME3 A;  1AE2 A;  3AMU A;  2K52 A;  3H3V I;  1T5E A;  3J81 E;  1HFN A;  1OXT A;  3GTL B;  3MFY A;  1SYE A;  4OEM B;  4KHV A;  5KYL A;  4A3M H;  1AZQ A;  1SND A;  3NE5 B;  2CW0 D;  2VUM H;  3OIP A;  1CTM A;  1C0A A;  2MQH A;  3TDQ A;  3G6E A;  1XNQ Q;  4KHP Q;  2UUB Q;  2D0O A;  2RVL A;  2EZV A;  5D65 A;  4DR3 L;  1Y69 U;  1O7Z A;  2MJ8 A;  2JYO A;  2BH8 A;  4DR2 L;  1PH9 A;  4GN5 A;  4R4C A;  3HP3 A;  2K32 A;  1W6K A;  4N9P A;  2XWJ B;  4ZQ3 A;  1S5E D;  2LMC B;  5C0X H;  5FO9 B;  2CWA A;  1BF4 A;  3I4M B;  2K04 A;  4DK1 A;  4HED A;  4Q5V A;  4DFA A;  1KQS A;  4DUY L;  2L55 A;  1V43 A;  3GTM B;  2GVB A;  5EAY A;  2B3G A;  3UDX A;  4ZLT F;  4AH6 A;  3A74 A;  2F4I A;  3NWT A;  1DGS A;  4HCE A;  4IUT A;  4IPC A;  1HA5 A;  4FXG C;  3NXW A;  3NPP A;  2DJF C;  1E0B A;  4XQN A;  3A5U A;  3K57 A;  4GS3 A;  1PA6 A;  2PPB C;  1W6J A;  3HFZ B;  4JI0 Q;  4G7O C;  3HEJ A;  3DM3 A;  3RD4 A;  3S1Q B;  3DMU A;  1IXR A;  1NSN S;  5E3F A;  1KLU D;  1XTC D;  4P74 A;  5HGT A;  3PGZ A;  1ASY A;  3I8Z A;  3EJI A;  5EKK A;  3K5L A;  2MPM A;  5KND A;  1LT6 D;  2D62 A;  3NQT A;  2WB1 B;  2UXD L;  1CUK A;  4XDX A;  2WKC A;  4A3B H;  1NMG A;  4HR7 B;  1L1O B;  1BBW A;  1A2U A;  4XQJ A;  4DR6 L;  3ITP A;  3KBX A;  4L63 B;  2QGQ A;  3MXP A;  1BDO A;  1GJX A;  1ROD A;  2F03 A;  3E0J A;  1KAW A;  4X64 L;  4V19 0;  3S15 B;  2B2Y A;  1SJE D;  5DEH A;  1X56 A;  3DXJ C;  3J80 E;  1KRT A;  4A3I G;  2D9U A;  3CAM A;  1STG A;  2ZTD A;  4DR7 Q;  1JCK B;  4IZ8 A;  3FKI B;  3GTO H;  1U4M A;  4L5R C;  4RH6 A;  1RJT A;  2I5M X;  5IYB G;  3D6W A;  2F4V L;  5I9P A;  2A69 D;  2NYZ D;  4FO2 A;  5E4X A;  4DV3 Q;  3TP5 A;  4JBK A;  1YNX A;  3TP6 A;  3CW2 C;  4B08 A;  1GHK A;  2ZTC A;  1FJG L;  3HOV G;  4QY7 A;  1AE3 A;  1FNU A;  2DGY A;  2NZ1 D;  5FK9 C;  4N8X 1;  2PI2 E;  1LLR D;  5IP7 G;  2HHH L;  3S17 H;  2A6H C;  5KIX A;  5LMN Q;  1VCI A;  5EPL A;  1UE6 A;  4EQN A;  1MJC A;  1KDA A;  3M85 A;  4XT3 B;  4Q0F A;  4CGY B;  1TS5 A;  1RTN A;  4X62 Q;  3IFT A;  1BBX C;  4DXG A;  4JI0 L;  2B29 A;  1TWF H;  5G3L F;  2A19 A;  2XTI A;  4IPD A;  1B53 A;  5IP9 H;  2DJG C;  4UAI A;  1D7Q A;  1DYQ A;  3J7A 5;  2EPB A;  5D14 A;  1K3R A;  3D0F A;  4N8F A;  1PTO H;  3HOW H;  4OWX B;  1FD7 D;  4MNO A;  4GLX A;  4DAP A;  2IY5 B;  1SMY D;  2RBM A;  1SNP A;  2NVQ H;  1EEF D;  1YIT A;  4ZKB B;  1PXU A;  4FVM A;  5DAU A;  2PO4 A;  1ILP A;  2EYP A;  4OEL B;  2Z0S A;  3N6R A;  5GRO A;  2F0T A;  4NXM L;  1I4H A;  3S1N B;  2JA6 B;  4PQX A;  3SEB A;  1O7I A;  4JCV E;  4B3S L;  4JYA Q;  4JW0 A;  1A63 A;  1U4P A;  1HUN A;  2BDN A;  3V2T A;  1OTC A;  1I6H H;  3DWP A;  2JA5 H;  1A15 A;  1A3T A;  4LF6 Q;  2PW7 A;  1QIL A;  1SXT A;  5A35 A;  3MXN B;  4OWT B;  4YIJ A;  2EJG C;  4QIW B;  2KJX A;  1JB7 A;  4HMJ A;  1CHQ D;  4LF8 Q;  5EPK A;  2KQ3 A;  1T5X D;  3HG9 A;  3EFX D;  1IW7 D;  3TZU A;  4ZUJ A;  1B70 B;  1Q7Y C;  4B3R L;  2R93 H;  4IFD J;  1HZB A;  1Y1V H;  3A5Z B;  1SSO A;  4GN3 B;  3CCE A;  1EQV A;  4LAA A;  5IYC H;  5COR A;  1MGS A;  1PHJ A;  4JI5 Q;  1B44 D;  3MC0 B;  2K50 A;  2ALY B;  1HZ9 A;  1BCP C;  2K28 A;  1JOK A;  3CC2 A;  4TVA B;  5FJ8 H;  3FRP B;  3CXC A;  2OTL A;  1YHA A;  2SDF A;  4NXN Q;  3WWV A;  1K8A C;  2K4K A;  5ELN A;  2DNC A;  5C44 H;  3WOF A;  1VQK A;  3CP0 A;  5C4J B;  3DLL A;  2I0Q A;  3SE0 A;  3RLF A;  2E2H H;  1HNZ Q;  2CH4 A;  5M3F G;  1ICF B;  4DA2 A;  2SNM A;  1LM0 A;  1SE8 A;  3A8K E;  3LWE A;  1CKM A;  3KJO A;  4JC0 A;  1HZC A;  2CQA A;  1LAC A;  3JAM c;  1XJV A;  2K01 A;  1J5E Q;  2BE5 C;  4YCV A;  2F0Q A;  1GHJ A;  4N9T A;  2AWO A;  1I94 Q;  2R7Z H;  2F0P A;  3NSW A;  4M8A A;  4JYA L;  5LL6 X;  2JA8 B;  4POF A;  2K33 A;  4C3J H;  3T13 A;  5IGC A;  1XMO Q;  1SYF A;  3ZJY C;  1FGU A;  2B2V A;  4LF6 L;  2JSO A;  3ICE A;  3I4M H;  1LYL A;  3BVZ A;  3RLN A;  5IOD A;  1RKN A;  1U5K A;  4YWL A;  1MD2 D;  5D3D A;  4GKK Q;  4A3L H;  1UE5 A;  4LF8 L;  2IX3 A;  1F2Y A;  5M5X H;  2IHE A;  1CA6 A;  2PNR C;  3S1M B;  1RD9 D;  2KBN A;  2QCP X;  1H9M A;  1BBU A;  1B3Q A;  1GUN A;  2WAQ G;  1WJJ A;  1PMR A;  1STY A;  1V1O A;  3C1E A;  1I50 B;  3VA5 A;  3BZC A;  4A3B G;  3GTP B;  3Q22 A;  3H94 A;  2Q2T A;  2K5V A;  1C48 A;  3V05 A;  5K36 G;  1MJE A;  3HOY H;  2EY1 A;  5GAG C;  2PI2 A;  1S72 A;  4JI4 Q;  2UXB L;  5L37 A;  3S1Q H;  5ELB A;  1XNR Q;  3QO2 A;  4OX9 Q;  3HS0 C;  5DNF A;  4BY7 B;  1EWH A;  3D4R A;  1I3Q B;  4NXN L;  1QNU A;  1YVC A;  1F9Q A;  3AB9 A;  3ULP A;  2ATW A; 
#chains in the Genus database with same CATH homology
 1TWC H;  1N32 Q;  1EWI A;  5C3E H;  3NBH B;  3BZK A;  2RHQ B;  3W5O A;  4APV A;  1JT8 A;  2H5X A;  1XPU A;  4GNX A;  1SN8 A;  2JA6 G;  3RN5 A;  1K8G A;  1L1O A;  1YIJ A;  4QGU A;  3KOJ A;  2MO0 A;  4LFC Q;  4A4I A;  3CPW A;  2V1C C;  1Q1E A;  3E9I A;  3K0X A;  1Z9F A;  3TS0 A;  1S40 A;  5M3F H;  1EIY B;  2ZJP A;  4DR7 L;  5C4X G;  1A0I A;  4A3K H;  1E1T A;  3UDI A;  1Q1B A;  1M1K C;  3S15 H;  4LUZ A;  3Q8D A;  2XGT A;  3UDF A;  2NVY H;  3TRE A;  2LXK A;  4C2M H;  4HID A;  1XMQ Q;  1J5E L;  2F4V Q;  1Y1W H;  4B3T Q;  1Q12 A;  1C7Y A;  1IBM L;  4GNX C;  1QUQ A;  1PH4 A;  4DV3 L;  1I94 L;  4X66 L;  1IBK L;  4JI8 L;  2UU9 L;  1YI2 A;  1FJG Q;  2IY5 B;  3PV0 A;  4DV0 Q;  3CCJ A;  1NMF A;  3KFU A;  5C0X J;  1OXV A;  2KEN A;  3PUZ A;  3KLW A;  1JJ2 A;  4DR1 Q;  4DNI A;  4DKA C;  3F2C A;  3G48 A;  4DV5 Q;  2HHH Q;  3M7N A;  3AFQ A;  4POG A;  3FKI H;  4Y7N H;  3K7U C;  3KDF A;  3HKS A;  4JI3 Q;  2Q2H A;  2A1A A;  4HJ7 A;  1QZH A;  3PF4 A;  3HOV H;  5LMN L;  2UUC Q;  3GDE A;  4A3E G;  1K83 H;  4OXP A;  4PZ7 A;  2JK8 A;  4X65 Q;  4A3M G;  1SRU A;  4KLK A;  4HJ9 A;  4BXX G;  1HR0 W;  5IWA Q;  2VUM G;  1U0L A;  2UXC L;  5FLM G;  4HJ8 A;  3K81 C;  4X62 L;  4DR5 Q;  2BH2 A;  4DR4 L;  4AYB G;  4GKK L;  4RG1 A;  2HQL A;  4LF5 Q;  4A3C H;  1VQI A;  3RLO A;  3W1G A;  2K5N A;  2K14 A;  4A3G H;  3HOW G;  2Q2I A;  5LMN W;  1IBL L;  1JMC A;  3TEH B;  1TWG H;  1SLJ A;  1PYS B;  3H0G H;  3HKZ E;  4BY1 G;  1CSP A;  1SMX A;  4EX5 A;  2KHI A;  3KJP A;  4HIO A;  4OO1 G;  4JI7 Q;  4LF4 Q;  3TS2 A;  1AH9 A;  4A3F H;  4DV1 Q;  1UWV A;  4LFB Q;  1UEB A;  4Y52 H;  3GTL H;  2VW9 A;  4DV7 L;  1N8R C;  2VL6 A;  3I4N G;  4GNX B;  1VQ4 A;  5GAD C;  3CC7 A;  2E2I H;  3PUY A;  3H15 A;  1KC8 C;  2ZM6 L;  5C0X G;  3T1H Q;  2E5L L;  3S2H H;  2DUD A;  2CWP A;  1EFW A;  4LFA L;  2VNU D;  4YWM A;  2OTJ A;  5ELO A;  1K9M C;  4PZ8 A;  5M5W H;  5JEA J;  1YJW A;  1WFQ A;  1WCM G;  5DLQ E;  1H95 A;  4NXM Q;  1BKB A;  3J81 j;  3FHW A;  4B3S Q;  1KL9 A;  3AEV A;  3F1Z A;  3J81 i;  2JEB I;  3UE0 A;  1YJ9 A;  1PH5 A;  4DUY Q;  3F8T A;  2YTY A;  1QUQ B;  1LUZ A;  2CCZ A;  1X3G A;  2VZA A;  3PUX A;  3HOX G;  3U4V A;  1P8L A;  1X6O A;  3U4Z A;  3T1Y Q;  1EUJ A;  1N9W A;  3M4O H;  1VQ7 A;  4B3M L;  4LFC L;  3STB C;  2VS1 A;  3OW2 A;  2JA8 G;  2ES2 A;  3CQZ H;  1VQ8 A;  1SR3 A;  3A0J A;  2JA6 H;  2N3S A;  4R4Q A;  4DV4 L;  3CCS A;  2IX0 A;  2PMZ E;  3BJU A;  2IX1 A;  3GTK H;  2K75 A;  1XMQ L;  1RL2 A;  1X54 A;  5C4X H;  2ID0 A;  3GTM H;  4WJ4 A;  1Y1V G;  3CF5 A;  4B3T L;  1OXX K;  1P16 A;  4X6A H;  5JEA G;  3CCM A;  3S1R H;  1PH7 A;  5FLX c;  2AKW B;  3CD6 A;  4B3R Q;  1K73 C;  1UE1 A;  4IPG A;  4DV0 L;  4GKJ Q;  1X55 A;  5IYD G;  4YHH L;  1PH3 A;  3I2Z A;  4DR1 L;  3W1B A;  1NBW A;  3CCQ A;  1PFS A;  3S2D H;  4RMF A;  4ME3 A;  1AE2 A;  2D0P A;  2F52 A;  2L15 A;  2LSS A;  1UE7 A;  2Z6K A;  3S14 H;  1G6P A;  2K52 A;  1WYD A;  2HT1 A;  4BBS G;  3H3V I;  4X65 L;  4JI5 L;  2UUA Q;  2OQK A;  2RHS B;  3TQY A;  3TRZ A;  1OXT A;  2NZH A;  5BR8 L;  3CCU A;  3HKZ G;  2VQE Q;  4P73 A;  4O2D A;  4DR5 L;  3LGJ A;  4A3M H;  4BXX H;  4LF5 L;  4A3J H;  1CKO A;  2VUM H;  4JI2 Q;  4MTN A;  5FLM H;  1HNW Q;  3J81 c;  1E22 A;  1C0A A;  2IHF A;  2I5L X;  2MQH A;  3G6E A;  1XNQ Q;  4KHP Q;  4BY7 G;  2UUB Q;  2D0O A;  4LF4 L;  4DR3 L;  4DV1 L;  2ZTE A;  2WFW A;  4BY1 H;  4LFB L;  2YYZ A;  1HNZ L;  1EQR A;  1HZA A;  2I5H A;  3ER0 A;  3I4O A;  2BH8 A;  4DR2 L;  2LXJ A;  3T1H L;  1PH9 A;  4PG3 A;  4JBW A;  2CQO A;  4GN5 A;  4R4C A;  4A3D G;  3I4N H;  4P71 A;  2R7Z G;  5C4J H;  4LWC A;  1V9P A;  1XTD A;  2CWA A;  5IY0 A;  3JC6 6;  4DV6 L;  5J3B A;  1WCM H;  1C9O A;  1GD7 A;  1PH6 A;  5GAH C;  1KQS A;  4DUY L;  2Y0S E;  1V43 A;  3S16 H;  1CKN A;  1L1O C;  4YWK A;  2GVB A;  1G51 A;  5EAY A;  2B3G A;  3UDX A;  3RZO H;  2KHJ A;  4JI1 Q;  1GKH A;  4AH6 A;  3T1Y L;  1XMO L;  3A74 A;  3RR5 A;  3NEL A;  1DGS A;  1QZG A;  4LF7 Q;  2R92 G;  3OTO Q;  4IPC A;  1VQC A;  5LMU Q;  3PO2 G;  1N36 Q;  4GOP A;  1A62 A;  2PNH A;  2QA4 A;  3A5U A;  1PA6 A;  4GS3 A;  5IP9 G;  3GTJ H;  3HFZ B;  4JI0 Q;  1JJG A;  2JA8 H;  3DM3 A;  2BA1 A;  2EIF A;  5M3M H;  1IXR A;  4O0A A;  1N33 L;  4P74 A;  2PQA B;  3PGZ A;  4TQU S;  1ASY A;  1PV4 A;  3CMA A;  2JQO A;  2D62 A;  3HOZ G;  1PH1 A;  4NPS A;  1RIP A;  1VQB A;  4GOP C;  2UXD L;  2WAQ E;  1CUK A;  2UXB Q;  2AHO B;  4A3B H;  1NMG A;  4DUZ Q;  1Q81 C;  4JI4 L;  5IYD H;  4DV2 Q;  3MEF A;  2UUA L;  1L1O B;  1BBW A;  4IFD I;  2JA7 G;  1YHQ A;  3OYY A;  1XNR L;  1VQP A;  4OX9 L;  3S1M H;  1VQJ A;  5AJ3 Q;  2F3I A;  2ATW A;  3I7F A;  4LW1 A;  3ERS X;  4BBS H;  4DR6 L;  2VQF Q;  1I50 H;  2ZJR A;  4DPG A;  2QGQ A;  5C3E G;  4IOA A;  2NN6 I;  4JI2 L;  1HNW L;  4P75 A;  1Q82 C;  3VDY A;  4JI6 L;  1KAW A;  4X64 L;  1A8V A;  1VQG A;  2JA5 G;  1N32 L;  4GLA C;  4OWW B;  1K0R A;  4H02 A;  1YJN A;  3UDG A;  3I55 A;  1X56 A;  1X65 A;  2OCE A;  4R1J A;  1KRT A;  4A3I G;  1Q86 C;  3PO3 G;  1SRO A;  5IE8 A;  3CAM A;  2GN5 A;  2NVT H;  1I3Q H;  1KXL A;  2R7D A;  3KDF B;  4MZ9 A;  2ZTD A;  2A8V A;  2VY3 A;  4P72 A;  4DR7 Q;  4LF9 Q;  1Y1W G;  3S1N H;  4HJA A;  1BVS A;  4BA2 I;  4EQ5 A;  2YU9 H;  2Y0S G;  3J80 c;  4GOP B;  4L5R C;  2JEA I;  2I5M X;  3GTO H;  3ULL A;  5GQO A;  5IYB G;  4JV5 Q;  2F4V L;  4YCW A;  1IBM Q;  2R93 G;  1VQA A;  4JBK A;  3G4S A;  4DV3 Q;  4X66 Q;  1VQF A;  4JI8 Q;  1YNX A;  2N78 A;  1OXU A;  2UU9 Q;  2BA0 A;  1HR0 Q;  3CW2 C;  1TXY A;  1MIU A;  5IYC G;  3CCV A;  3EBE A;  2ZTC A;  1FJG L;  3HOV G;  4QY7 A;  4JI1 L;  1AE3 A;  2DGY A;  1HNX Q;  4AQY Q;  4DV5 L;  2PI2 E;  2HHH L;  5IP7 G;  3S17 H;  5LMN Q;  3RZD H;  1Z47 A;  1VCI A;  4JI3 L;  3PF5 A;  5FJ8 G;  4A93 G;  1UE6 A;  2WP8 J;  3S24 A;  1YZ6 A;  5LMU L;  1MJC A;  4HIK A;  2UUC L;  4WJ3 M;  1L2F A;  2NZO A;  4R4O A;  3M85 A;  1N36 L;  2UXC Q;  2R92 H;  4X62 Q;  1MKH A;  5IWA L;  5JJI A;  4JI0 L;  2B29 A;  1E24 A;  5C44 G;  4A3E H;  1TWF H;  2HIV A;  2MO1 A;  2A19 A;  3GTG H;  3PO2 H;  2XTI A;  4J15 A;  1OXS C;  4IPD A;  1J6Q A;  4BBR G;  1FVI A;  5IP9 H;  1IBL Q;  3CCL A;  1D7Q A;  3J7A 5;  1NY4 A;  2JJQ A;  2WB1 E;  3GD7 A;  3RNU A;  1JJC B;  1K3R A;  4XIG S;  3PCO B;  3J7Z C;  2E2J H;  3D0F A;  2Z6K C;  1IYJ B;  1KHI A;  3PUW A;  3HOW H;  4OWX B;  4MNO A;  4GLX A;  4JI7 L;  3AQQ A;  4DK6 C;  1B7Y B;  1VQE A;  2HIX A;  4DV7 Q;  3ULJ A;  1SFO H;  3CC4 A;  3HOU G;  3HOZ H;  5M5Y H;  2ZM6 Q;  1VQH A;  2NVQ H;  1YIT A;  3E0E A;  2E5L Q;  4QQB X;  4LFA Q;  4DV2 L;  2KCT A;  1TWH H;  4UP7 A;  1VS0 A;  4R4T A;  1X3E A;  3K8A A;  2N49 A;  4OON A;  3AYH B;  5AJ3 L;  1CSQ A;  2Z0S A;  3F2D A;  4BA1 I;  1X9N A;  1PVO A;  5GRO A;  4NXM L;  2JA7 H;  4UPA A;  1Y14 B;  2B63 G;  1O7I A;  4JCV E;  4B3S L;  4JYA Q;  4LNQ A;  1A63 A;  4JBJ A;  1IL2 A;  2MNA A;  4UY8 C;  2RF4 A;  1OTC A;  4IJH A;  1HH2 P;  1NTG A;  3I4M G;  1YHB A;  3KYH C;  1I6H H;  2JA5 H;  4B3M Q;  1EYG A;  1PYB A;  5JJL A;  1YBY A;  4LUV A;  4UP9 A;  4LF6 Q;  1VQN A;  2OQ0 A;  3HOX H;  4IO9 A;  1KIX A;  2AWN A;  3MXN B;  3U58 A;  4A3L G;  4LF9 L;  4DV4 Q;  4OWT B;  4PZ6 A;  4A3I H;  3PO3 H;  3PUV A;  3EIV A;  5GAE C;  3F2B A;  1VQO A;  1JB7 A;  4NB3 A;  3J80 i;  3JAM i;  2JA9 A;  4LF8 Q;  4HJ5 A;  4JV5 L;  2MFI A;  1LTL A;  1B70 B;  1Q7Y C;  1QVF A;  1HR0 L;  5IYB H;  2ASB A;  2GVA A;  3HOY G;  4B3R L;  2R93 H;  4IFD J;  4YHH Q;  1HZB A;  1Y1V H;  3A5Z B;  2CKZ B;  4GN3 B;  4GKJ L;  1G29 1;  4IPH A;  2AMC B;  3CCE A;  1YEZ A;  4OO1 I;  4QJF A;  1HNX L;  4AQY L;  3KF8 B;  4XTC S;  1HJP A;  4UP8 A;  5IYC H;  1XPR A;  2KCM A;  2E8G A;  1M90 C;  4HIM A;  1FL0 A;  1PHJ A;  4JI5 Q;  3AFP A;  3D31 A;  4A3J G;  2K50 A;  2ALY B;  4AIM A;  1HZ9 A;  3GTQ H;  5BR8 Q;  2C35 B;  1E1O A;  1TWA H;  5IP7 H;  5C0X I;  3CC2 A;  2R6G A;  4TVA B;  2ZJQ A;  2WB1 G;  2YTX A;  1VQ9 A;  5FJ8 H;  4A93 H;  1N34 Q;  3M4P A;  1T9H A;  4YY3 Q;  3CXC A;  3KF6 A;  4DAY B;  1Q8K A;  1YHA A;  3G71 A;  2VQE L;  1EQQ A;  2OTL A;  4NXN Q;  4GN4 B;  1PH8 A;  3WWV A;  3GTP H;  1GO3 E;  1K8A C;  2K4K A;  5ELN A;  5C44 H;  3B6Y A;  3BU2 A;  1VQK A;  3CP0 A;  3M3Y H;  4K0K L;  3DLL A;  2YV5 A;  2I0Q A;  4KHP L;  1XNQ L;  2RCN A;  4BBR H;  3K80 C;  4DR3 Q;  2UUB L;  1JE5 A;  3SGI A;  3RLF A;  5IT9 c;  2E2H H;  1D8L A;  2R7F A;  1CKN B;  1HNZ Q;  3CPF A;  1WOC A;  5M3F G;  4BY7 H;  3UE1 A;  4C3H H;  3STB D;  4A3K G;  1GM5 A;  4DR2 Q;  3GO5 A;  1LM0 A;  2YTV A;  3CCR A;  4IFD G;  1SE8 A;  3M9B A;  1KD1 C;  3HOU H;  4K0K Q;  2EQS A;  5HY6 A;  4L5T A;  4L5Q A;  1CKM A;  3H3V H;  3KJO A;  4JC0 A;  1HZC A;  2NN6 G;  3E9H A;  3JAM c;  1XJV A;  4R4I A;  4IOC A;  1J5E Q;  4YCV A;  1E3P A;  4JOI A;  4DV6 Q;  4A76 A;  4A3D H;  3L2P A;  3K7A H;  1I5F A;  3U50 C;  4L5S A;  2AWO A;  4DAM A;  1IBK Q;  2QEX A;  1I94 Q;  3L7Z C;  1VQ5 A;  2R7Z H;  4JYA L;  3FKI G;  3PSI A;  2K5H A;  3CME A;  4PMW A;  2OWO A;  4POF A;  2B63 H;  3EN2 A;  1V1Q A;  4C3J H;  1EIF A;  4C3I H;  1XMO Q;  1L0W A;  1B8A A;  4KHZ A;  1WI5 A;  3IRB A;  1XPO A;  3ZJY C;  1FGU A;  2JE6 I;  2EXD A;  1PH2 A;  1VQL A;  4LF6 L;  1VQ6 A;  3ICE A;  4QIW E;  4LF7 L;  4YCU A;  3OTO L;  4JOI C;  3I4M H;  1LYL A;  3RLN A;  5M3M G;  1E7Z A;  1KRS A;  4LUO A;  4A3C G;  3PIP A;  1QVC A;  1U5K A;  4YWL A;  1W3S A;  4A3G G;  4DR4 Q;  3FP9 A;  3NEM A;  4GKK Q;  4A3L H;  1UE5 A;  4LF8 L;  3H0G G;  1N33 Q;  4JBM A;  3KF6 B;  5M5X H;  3RN2 A;  2IHE A;  1VQM A;  1VQD A;  5JJK A;  2KBN A;  4A3F G;  1BBU A;  2WAQ G;  3PIO A;  1WJJ A;  1NE3 A;  4DK3 C;  1IZ6 A;  4AYB E;  4KI0 A;  3BZC A;  1S3O A;  2FXQ A;  1R9T H;  4A3B G;  1NJI C;  1X3F A;  2UXD Q;  2Q2T A;  2K5V A;  4GLV B;  5K36 G;  1QVG A;  4ALP A;  1MJE A;  3HOY H;  1ASZ A;  5GAG C;  2PI2 A;  1S72 A;  4JI4 Q;  4A75 A;  2UXB L;  5H1S E;  1W2B A;  3S1Q H;  2NVX H;  3NEN A;  4DUZ L;  2Q2U A;  4FDB A;  5HGQ A;  1XNR Q;  4OX9 Q;  2N8N A;  5E7N A;  4DR6 Q;  4IJL A;  3L0O A;  1N34 L;  4JG2 A;  4YY3 L;  2PQA A;  2VQF L;  1Q46 A;  1EOV A;  4NXN L;  1YVC A;  3ULP A;  2CFM A;  3M4Q A;  4QL5 A;  4JI6 Q;  2IT1 A;  4X64 Q;  1GVP A;  3I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...