3K80C

Structure of essential protein from trypanosoma brucei
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
103
Chain Sequence
SVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQHFYFPYIQVQPPHGQVAVIHGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, rna binding protein
molecule keywords Antibody
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Lama glama
total genus 15
structure length 103
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k80C00
4JI3L 1WI5A 4HIOA 1PH4A 4X64Q 1NTGA 4JYAL 3CCRA 4P75A 4TVAB 1TWFH 3BZCA 4GLVB 3KJPA 2IY5B 2A1AA 1OXVA 3H3VI 3WWVA 2UUAL 3U58A 3J7A5 1VQNA 1WCMH 1L1OB 1KC8C 4JV5L 1VQJA 3S24A 2CCZA 3PF5A 1VQOA 4DV2L 2JA5G 4JI2L 3CQZH 4DR7L 2JA9A 4TQUS 1IBLQ 2WB1G 4QY7A 4RMFA 3CXCA 2F4VQ 4JI7L 4AIMA 1N36Q 2YV5A 4LF6L 4JBJA 4DR2Q 3HOVG 1QVFA 3S17H 3VDYA 1HNXL 1N33L 4DR3L 3NENA 2A8VA 2NVTH 2E8GA 5K36G 2K50A 1I5FA 2RCNA 4IJLA 4X62L 4A3JG 3I4NH 2GVBA 4DV1Q 1VQ4A 3CCSA 2B63H 3I4MH 2GVAA 1SR3A 2C35B 1A0IA 4IJHA 5M3MH 3TREA 1K8GA 3TQYA 2K4KA 1J6QA 2LSSA 2JA8H 4UPAA 3A0JA 3HFZB 4JI0Q 2HIXA 3RZDH 2HHHQ 5JJIA 4LF5L 4AQYL 1FVIA 5IP7H 1LTLA 3PUYA 5C3EG 1I6HH 4H02A 1EFWA 1VS0A 4Y7NH 2WB1E 4BY7H 5C4XH 4DV3L 2I5MX 2Q2UA 3EBEA 4A3FH 1V1QA 3A74A 4NXML 2I5LX 2UXDQ 1O7IA 4DKAC 4A3LH 4DAMA 3PIOA 4QQBX 5GAHC 2EXDA 1N9WA 3H15A 1AH9A 3PIPA 3DM3A 4DV5L 2QEXA 1XNQL 2CFMA 4JCVE 2AMCB 2VQEL 2UU9L 1ASYA 3RLOA 2ZJQA 1VQLA 4X65Q 1YHBA 1MJCA 4MTNA 1N32Q 3OW2A 4JI4L 3JAMi 4DR6L 4IFDJ 4P72A 5IT9c 2I5HA 2ZM6Q 3NBHB 1UE6A 4DR1L 2HT1A 1E7ZA 3FHWA 4DV7Q 5LMUQ 1I94Q 4ME3A 4GNXC 4IFDI 2IHFA 4A3KH 2BA1A 3IRBA 2UXBQ 2B63G 1CUKA 4BXXH 1S3OA 2ZTEA 4A93H 3HOXG 5M3MG 4DR4Q 1TWGH 1CKOA 1M90C 1YZ6A 2WFWA 1IBKL 1HNZL 3OTOQ 2OTJA 2JA8G 4JI1Q 2NZOA 3PF4A 2ATWA 1FGUA 4LFAL 3GTOH 1X54A 1C9OA 2K5NA 2K5VA 1VQCA 3CCEA 1G291 5JJKA 3E0EA 4LW1A 1GM5A 1KIXA 4BY7G 1LM0A 1YEZA 4P74A 1JJCB 2OQ0A 3HOWG 3S1QH 4UP9A 4LF4L 2WAQG 3M85A 4JC0A 4A3LG 4Y52H 1Z9FA 1E22A 1B8AA 1UE1A 2L15A 3GDEA 4MZ9A 3M4OH 2IX1A 2Q2HA 5IYCH 4AYBG 3BJUA 5LMNQ 5GAEC 1UWVA 1S40A 2PNHA 4P71A 2F52A 1L0WA 3GTJH 3D0FA 3J81i 2N49A 3I56A 1K8AC 5M3FH 1SMXA 3ULLA 1UE5A 3H0GH 4YHHL 4EX5A 1TXYA 3MEFA 4JYAQ 2MNAA 4PZ6A 4DAYB 2QGQA 2KCTA 2UUAQ 3CC2A 4IPGA 4C2MH 1MJEA 2R92G 4A3GG 1HJPA 3G4SA 4JV5Q 1B70B 1XJVA 1NMGA 1Z47A 2PI2E 3PV0A 3U50C 1N34L 1E1TA 4DV2Q 4JI2Q 4IFDG 1HZAA 2WAQE 2YYZA 3UDIA 3CMEA 2CWAA 5AJ3L 2CKZB 2I0QA 1PVOA 3J80i 3BU2A 3RLNA 4DNIA 4KHPQ 1YVCA 1VQ8A 1VQKA 2VNUD 1HZ9A 1XMQL 4JI7Q 4AYBE 3PSIA 3S1MH 4FDBA 4LF6Q 4BBRH 1D7QA 3I7FA 2EIFA 4XIGS 4IO9A 1WYDA 1HNXQ 1N33Q 1PH2A 2AHOB 2LXKA 4DR3Q 2R93G 4B3SL 1XPRA 1NMFA 2WP8J 4YY3L 4PZ8A 5FLMG 2UXCL 4HJ8A 2E2JH 1IZ6A 4LUZA 2BA0A 3MXNB 1XMOQ 3TRZA 1G51A 4LF7L 3S2DH 3HOYG 3H0GG 1HH2P 4GS3A 1P16A 1W3SA 4LWCA 3TS2A 4IOAA 1QVGA 1K83H 5FJ8H 1P8LA 4BBSG 2PQAB 3U4ZA 5IWAL 1T9HA 1MKHA 3F8TA 4R4IA 4UP8A 4R4QA 1PH9A 1VQ5A 4LF5Q 1FJGQ 4AQYQ 1PHJA 3RR5A 1RIPA 3SGIA 1VQEA 1X3FA 1PV4A 4HJ7A 1IBML 1VCIA 2D0PA 2YU9H 3E9IA 2HIVA 3W1BA 1X3EA 4L5RC 3HOZH 3S16H 1EQQA 4JBKA 3T1YL 4DV5Q 4ALPA 5JJLA 1XNQQ 4DV6L 1BBWA 3RZOH 2VQEQ 4OONA 2OWOA 4KI0A 5IYBH 1XTDA 3NELA 4JI4Q 4DR6Q 4DR1Q 1EUJA 5GADC 1U5KA 4L5QA 4PMWA 1YIJA 1PH8A 1Q86C 1EIYB 3AQQA 4JI5Q 3KDFA 4JI8L 3M7NA 1X55A 2D62A 4X66Q 1YJWA 2B3GA 5FLXc 4BA2I 4B3ML 1PYSB 4GOPB 2RHQB 1IBKQ 3U4VA 3CC7A 1OTCA 1HNZQ 1WCMG 5BR8L 5FJ8G 1X9NA 1X56A 3L0OA 4YCWA 4LFAQ 1Q82C 4K0KL 4X64L 3CMAA 1W2BA 2NVXH 1H95A 2IX0A 1YBYA 2CWPA 4NXNL 3F2CA 2R7ZH 4C3JH 3STBD 3S1RH 4GKKL 3TS0A 2HQLA 2K5HA 2VS1A 3E9HA 1PH1A 1JT8A 2YTYA 4R4TA 1VQGA 1PH7A 1LYLA 1BBUA 4DUYL 2YTVA 2V1CC 1J5EL 2R6GA 1A63A 2ES2A 1GKHA 1IBLL 1PFSA 1VQMA 4OX9L 2ALYB 3J7ZC 4HJ9A 3JAMc 3I4NG 3PCOB 2F4VL 1N36L 1L1OC 3I4MG 1CKMA 1V43A 3UDXA 1VQBA 3A5ZB 1JJ2A 1X65A 1HR0Q 3KF8B 3A5UA 4LF8L 1EWIA 4LUVA 4YHHQ 4A3BH 5M5YH 4GKJL 1ASZA 1L2FA 1CKNB 5LMNW 2JEAI 4YCUA 5IP7G 1TWCH 4A4IA 4DV1L 3CC4A 3T1HQ 3KF6B 3PUZA 1QUQA 3CPWA 5C4XG 4BY1H 4GN5A 4DV4Q 4DR5L 2K14A 4A3FG 1XNRL 2BH2A 2JA7H 2ID0A 1KRSA 2XTIA 1QVCA 3LGJA 3CCUA 1E3PA 1BVSA 3FKIH 3L2PA 1QZGA 2NVQH 2R7ZG 1KHIA 2R7FA 2B29A 2HHHL 4LUOA 4DK3C 2RF4A 3PUVA 2CQOA 1I3QH 3K8AA 2VQFL 2RHSB 3PO3H 2VUMH 3ZJYC 1XMQQ 1PA6A 3I2ZA 1JMCA 4GN3B 4HJAA 2JQOA 2IHEA 2N8NA 2UXDL 4DK6C 1HNWQ 4B3SQ 2UXCQ 4HIDA 4YY3Q 3J81c 4A3KG 4JI3Q 5M5XH 2KHJA 4JOIC 3GO5A 5C44H 4BXXG 4A93G 2JK8A 4XTCS 1G6PA 4LF7Q 1YHQA 4NPSA 2NN6I 3G48A 3OYYA 4B3RL 3KFUA 4WJ3M 1U0LA 1I50H 2Z6KC 1EQRA 4IPHA 4HIKA 1TWAH 4NB3A 2KCMA 2LXJA 1E24A 1Y1VH 4LFBL 3GTMH 1SRUA 4OWTB 4PG3A 4LFCL 5IWAQ 4DR7Q 1IL2A 4IPDA 4A3CH 3ULJA 4BY1G 2AWOA 4DR4L 3CCLA 3ICEA 5ELOA 3EIVA 2Q2TA 2UUCL 2Y0SG 4GN4B 3FKIG 1UE7A 1IBMQ 3AEVA 3J80c 5GROA 1L1OA 3F2DA 1GVPA 4POGA 2PQAA 5IYCG 4KLKA 1Q8KA 3PO3G 1RL2A 1NE3A 1KAWA 4O2DA 2JA5H 1MIUA 4X6AH 2EQSA 3T1YQ 1JE5A 4A75A 3M4QA 4DV6Q 4X62Q 1PYBA 2VY3A 5GAGC 5M3FG 4A3IH 1Q81C 3F1ZA 3UDGA 3I55A 4LF9L 2XGTA 5GQOA 2R7DA 3GTKH 4KHZA 1R9TH 1JB7A 3FP9A 4JI8Q 2MO1A 3EN2A 1PH5A 4APVA 4JBMA 4JG2A 4B3MQ 1GO3E 1WOCA 5C4JH 2OTLA 1VQHA 4YCVA 1CSQA 4GLAC 5J3BA 3G71A 1Y1VG 4R4CA 3H3VH 3RNUA 1WFQA 4DV3Q 1VQ9A 1YHAA 2AWNA 1B7YB 4K0KQ 3K0XA 4NXMQ 4A3CG 1K3RA 2K52A 2Y0SE 2DGYA 4B3TL 2Q2IA 2PI2A 4DV0L 1JJGA 1Q12A 4NXNQ 2NN6G 4GNXB 3J81j 4GOPA 3S14H 4GKKQ 2F3IA 4BBRG 1OXSC 2JA6H 5C3EH 3RLFA 5HY6A 2UU9Q 4JOIA 4L5SA 4OO1I 4DUYQ 4PZ7A 1J5EQ 1WJJA 1EYGA 2VW9A 2Z6KA 1M1KC 4O0AA 3S15H 4JI6L 4DUZL 4OX9Q 4YWLA 4YWKA 3UE1A 1X6OA 2NZHA 3HOUH 2BH8A 2MFIA 4KHPL 1A62A 4A3IG 2QA4A 4J15A 1VQFA 3L7ZC 2UUBL 1VQAA 1EOVA 1YJ9A 2E5LL 2JEBI 3K80C 4LF8Q 4GKJQ 4UY8C 2MQHA 3D31A 1VQDA 4POFA 2VL6A 1XMOL 4UP7A 1QZHA 4WJ4A 3CCJA 1N8RC 4AH6A 3GTLH 4C3HH 3K81C 4JBWA 1IXRA 2KHIA 3HOXH 4DR5Q 1YNXA 4QGUA 4YWMA 1HR0W 2D0OA 1XNRQ 3GTPH 4LF4Q 2ZJPA 1YJNA 3DLLA 3PO2H 3CCVA 1Q46A 5IY0A 3HOZG 1K9MC 1CKNA 2KBNA 1FJGL 2ASBA 2VQFQ 4IOCA 3CCMA 2JA6G 1Q7YC 2A19A 2N3SA 3KF6A 3K7AH 5IYBG 3GTGH 5IYDH 3HOWH 4DR2L 3HKZG 3CPFA 3HOUG 3KDFB 3AFQA 3F2BA 1DGSA 1BKBA 3RN2A 1Y14B 5IP9H 4HIMA 1NY4A 2DUDA 1KQSA 1Y1WH 4B3RQ 3CP0A 3PGZA 5ELNA 5C0XJ 4OWWB 1XPUA 1K73C 1OXXK 4OO1G 1Q1BA 3PUWA 4QJFA 5EAYA 4OWXB 2GN5A 1CSPA 2N78A 4JI5L 5C0XI 4LFBQ 4BA1I 3BZKA 3RN5A 2VZAA 3ULPA 1N34Q 4JI0L 4X66L 2ZJRA 2JJQA 3KJOA 4LFCQ 2E2IH 3AYHB 3S1NH 1SFOH 5AJ3Q 5JEAJ 1Q1EA 3M3YH 3PUXA 4L5TA 5H1SE 2UUCQ 3STBC 1EIFA 3PO2G 1AE2A 2OCEA 4A76A 3ER0A 4OXPA 2KENA 2R92H 1KXLA 1AE3A 3W1GA 4A3GH 1PH6A 1TWHH 3ERSX 1OXTA 5HGQA 3HKZE 3KYHC 2ZTDA 4GOPC 3CW2C 4R4OA 4A3DH 5M5WH 1D8LA 5IYDG 3GD7A 3B6YA 4EQ5A 2OQKA 1IYJB 2NVYH 1YITA 1V9PA 4X65L 4A3MH 4DPGA 1XPOA 1HZBA 4LF9Q 4A3EH 1C7YA 3KOJA 1N32L 2Z0SA 2PMZE 4MNOA 2ZM6L 3CF5A 1KD1C 4A3BG 4P73A 5IP9G 4DV7L 2JE6I 5LMUL 1S72A 1I94L 2R93H 1KL9A 4GLXA 1Y1WG 5FLMH 2UXBL 1UEBA 2YTXA 1PH3A 3K7UC 1VQ7A 3JC66 4IPCA 1QUQB 3S2HH 3AFPA 4LNQA 2JA7G 1HR0L 3OTOL 3HOYH 4JI1L 1SE8A 1VQ6A 1NBWA 4R1JA 4QIWE 4C3IH 4B3TQ 4BBSH 4DV0Q 3NEMA 2E2HH 4HJ5A 2VUMG 1E1OA 3UE0A 1X3GA 3T1HL 1C0AA 2IT1A 5E7NA 3CD6A 1A8VA 4DV4L 1SROA 1SLJA 2ZTCA 3CCQA 2H5XA 3G6EA 1NJIC 5C0XG 3CAMA 4A3DG 2MO0A 1HZCA 2AKWB 3W5OA 3HOVH 4JI6Q 3M9BA 1SN8A 1KRTA 3TEHB 5C44G 4DUZQ 1FL0A 3KLWA 5LMNL 4QL5A 5DLQE 1LUZA 3GTQH 4GNXA 3M4PA 4A3MG 1YI2A 1GD7A 1OXUA 2FXQA 3HKSA 4A3EG 1VQPA 2UUBQ 2E5LQ 4A3JH 5IE8A 5JEAG 1VQIA 3I4OA 5BR8Q 3UDFA 4RG1A 1HNWL 1K0RA 2K75A 3Q8DA
chains in the Genus database with same CATH superfamily
4JI3L 1PH4A 2JA6B 2HDLA 4JYAL 3CCRA 4P75A 3BZCA 3KJPA 2B2TC 2J0TD 3HKZB 2UUAL 3HOUB 3J7A5 1WCMH 1VQJA 5ELCA 2NB0A 3PF5A 3CQZH 3QG1A 2WB1G 4JVZA 3Q24A 4TRDA 1GOZA 1BDOA 3P20A 2F03A 5EKKA 1HNXL 4C3HB 4HMIA 3HOXB 5BN5A 5KGUA 2BOSA 2ENBA 4K8JA 4DV1Q 2NTTA 2GVAA 2L9HA 4NDXA 1QILA 3OWEB 1SNMA 1K8GA 3KF8A 2K4KA 2TSSA 1IL8A 2JA8H 3A0JA 3HFZB 1CA6A 1KABA 2CVRA 4DK0A 1RODA 4HEDA 5IP7H 3QOLA 3PUYA 4JPBW 5C3EG 1I6HH 1VS0A 4H44C 5I2YA 3VYRA 5C4XH 2K33A 4A3FH 2I5LX 2EPBA 3PIOA 2L11A 5GAHC 2EXDA 1N9WA 1F2ZA 3H15A 4DV5L 2ICIA 2NBFA 2VQEL 1KDBA 2UU9L 1HFNA 4X65Q 2B2TA 4EQNA 5KEEA 4DR6L 5IT9c 1TIID 2XSCA 1E7ZA 1I94Q 4OIJA 4A3GB 1S3OA 1ICFB 2WFWA 2JA8G 1EIGA 1C9OA 1VQCA 4IUVA 1DJRD 4FYDA 1SYDA 3C2PA 4P74A 2OQ0A 3HOWG 1TY0A 2KHSA 3QR8A 4N9PA 2JXMB 1B8AA 3BVGA 4MZ9A 4HR7B 4CJ0B 1V1PB 5LHY1 1STNA 2SEBD 1STGA 5LMNQ 3PIP3 2F52A 2E76C 3P7JA 3Q23A 4QMGA 1K8AC 4RCNA 4ZQ3A 3ULLA 1UE5A 4B9WA 4NW2A 1TXYA 2QGQA 2XWJB 3M4YA 1PRTF 5J22A 3CC2A 4C2MH 5IIFA 3GTQB 1NMGA 1Z47A 4HAEA 1PRTC 2IJ0A 1E1TA 4JI2Q 2WV6D 5AJ3L 1PVOA 4DN4M 1CTMA 1Y69U 1XTCD 3MZ5A 2A6HD 1TWFB 3PSIA 4QUCA 1PFNA 1KNAA 3I7FA 2EIFA 2Z4IA 2F0HA 2F0EA 5I6WA 2QF7A 1NMFA 1LT5D 4HJ8A 2E2JH 4NMZA 1B9MA 2BA0A 3TRZA 4HCSA 5JVG3 1ZYRC 1HRJA 1W3SA 1F77A 4QB4A 2R61A 3SK6A 4BBSG 4UP8A 4R4IA 4K6DA 2AQ3B 1BOSA 4AQYQ 1RKNA 1JQYD 1X3FA 1CT1D 5EBCA 3SGIA 3VR3A 2JN4A 3NTIA 2KQ3A 4HJ7A 4RKLA 4S3SA 1DD2A 2D0PA 2LFNA 1M4VA 4N8X1 2HIVA 3DXJC 1EFID 3QJYA 3A56A 5EKIA 5M3MB 1HQRD 3HG9A 2F0MA 3K59A 2HCIA 5D14A 4ALPA 4DV6L 1XNQQ 2OWOA 1TS2A 3I3CA 1DZ1A 3ND9A 2BE5D 1YIJA 1PTOF 3AQQA 4JI5Q 4Y7NB 1X55A 2D62A 4Q5VA 1SE3A 5IGEA 5C5MA 1WTPA 3U4VA 1IW7C 1HNZQ 1GHJA 1X9NA 4YCWA 3WOFA 5E4XA 3K57A 3CMAA 4K0KL 1TQOA 3D4DA 1W2BA 1YBYA 2CWPA 4ULLA 4NXNL 3F2CA 2F4IA 3MWYW 3T4AC 2IX3A 1PH1A 1PH7A 4K2KA 1TWGB 2ES2A 1IBLL 3BDCA 4HJ9A 3SK5A 3JAMc 1RTOA 3CRKC 3I4NG 2F4VL 3NUCA 1L1OC 1N36L 1CKMA 2RQXA 3UDXA 1VQBA 3J80L 2VB2X 1PZID 3A5UA 4KY5A 4LF8L 2M00A 4YHHQ 4GKJL 3BYTB 4XQJA 1B3AA 2QEJC 2DNCA 4BY1H 4GN5A 4DV4Q 2WIIB 2XTIA 3T51B 2D9UA 1BVSA 3FKIH 3L2PA 1QZGA 1LABA 5M3FB 3RMHA 1SMYD 2NWGA 2XNAC 3DUZA 1BCPB 1E2ZA 2RHSB 3PO3H 1BXTA 1XMQQ 3I2ZA 4PV1C 3J81E 1XWEA 3OOCA 2UXDL 1SJHD 1KTKA 3DM1A 4B3SQ 1NSNS 1HTLD 3J81c 4JI3Q 2OF1A 3I73A 5C44H 2KHJA 1G6PA 4A93G 2G5DA 4XTCS 4LF7Q 1SYCA 3OYYA 3TP7A 2PPBC 3NTKA 1SNPA 2KCMA 1MBYA 4LFBL 1FNVA 3S1MB 2LMCB 4BBRB 3MXNA 4BY1G 4K8IA 1TS3A 3EIVA 1IBMQ 3FKIG 2EY6A 1L1OA 3S2DB 3PO3G 1EY0A 1I4QA 3KLSA 4K5WA 3T1YQ 1WD0A 2EYHA 4KJNA 4KD4A 1PYBA 5FKAC 2R7DA 3FMCA 4KHZA 1R9TH 1EY9A 5ELFA 1A3VA 3FP9A 3EN2A 4JG2A 1WOCA 2OTLA 1LTTD 1CSQA 3N6RA 4GLAC 3S16B 3G71A 4IZ8A 3RZOB 2K52A 4F8MA 1JJGA 2PI2A 1Q12A 3NK9A 2K1BA 1BF4A 3S14H 1EZ8A 2F3IA 4H0LC 2JA6H 4L5SA 5HY6A 2UU9Q 1CFMA 1HQMC 1JOKA 4PZ7A 1J5EQ 1EYGA 2N55A 4JI6L 2F0LA 1SAPA 1TT2A 1AP0A 4OX9Q 2EYOA 3HOUH 4YWKA 3UE1A 4RGOS 1K3BC 1A62A 1EU3A 3HGBA 2UUBL 5IGCA 1YJ9A 2R7ZB 1U4PA 3K80C 1F2LA 3S1RB 3F2UA 2PW5A 2EDGA 1VQDA 3TSSA 1RTNA 5EKLA 1XMOL 4UP7A 3VYSA 1NUCA 3CCJA 4C3HH 3K81C 1C48A 1SNQA 4JBWA 3HOXH 4QGUA 2D0OA 3DLLA 4RGNA 4XYOA 1CKNA 2JA6G 1Q7YC 4A3BB 3KF6A 1TWCB 3HKZG 3HS0C 3HOUG 3J7YW 5IOCA 1EEFD 1DGSA 1BKBA 4EGVA 2JA7B 5IP9H 4DXFA 2Y0SB 3C1EA 5D3IB 1O7LA 5C0XJ 1G91A 4K5XA 1K73C 1Q1BA 3NQTA 2VUMB 4C1NI 1CSPA 1ET6A 2N78A 3TDQA 2FINB 3BZKA 4FF3A 4LFCQ 4X66L 2ZJRA 1DXMA 4C3HG 3KJOA 5AJ3Q 1ESFA 4L5TA 1Z6HA 2G9HD 3STBC 2OCEA 5C4ZA 1KXLA 3W1GA 4A3GH 1PH6A 3ERSX 1TWAB 5HGQA 3KYHC 2ZTDA 1SNOA 1D8LA 3O13A 3GD7A 3E5SA 3B6YA 1O7YA 1V9PA 4X65L 4BS9A 4DPGA 1XPOA 1C4QA 1HZBA 3CF5A 1NR2A 5IP9G 4HCEA 2JE6I 1I94L 3H09A 1GUOA 2EY1A 1PH3A 4IPCA 1QUQB 1CI3M 1EEID 2ZXPA 1A6XA 1SNDA 1U4MA 1EY4A 4G7OC 4NP5A 2RBMA 4IUQA 2A6EC 4ID6A 3U9OA 4DV0Q 4HJ5A 1E1OA 3UE0A 1WD1A 2LY7A 2ZTCA 3CCQA 3RD4A 5C0XG 3GV3A 4DFAA 2MO0A 2AKWB 3W5OA 1PYWD 3TEHB 1W6JA 1KRTA 2X69A 3KLWA 3MFYA 5LMNL 1FNWA 1LTBD 4QL5A 3HRZC 3T16A 3GTQH 4GNXA 5G3LF 5K36H 1GD7A 2E5LQ 5IE8A 1HA6A 1S5CD 3UDFA 1HNWL 1NTGA 3MAQA 1TWFH 4GLVB 4ABNA 2CH4W 2IY5B 1PTOD 1OXVA 2F1MA 1Q90A 5CORA 1TR5A 3WWVA 1YNJD 3QIAA 4Z9CB 5CV4A 3SEBA 1VQNA 1KC8C 3K5MA 1VQOA 2JA5G 4JI2L 4DR7L 2PMZB 1IBLQ 4QY7A 4HN7A 3CXCA 1GXDC 2F4VQ 5LL6S 4HSPA 2DY7A 4AIMA 1N36Q 1SBBB 2YV5A 2FMMA 4JBJA 3ITPA 3GTLB 4RFBA 2Z9HA 3D4RA 2E8GA 1Y8OB 2PCFB 5K36G 2RCNA 3R2TA 1SXTA 2GVBA 2HUGA 4B9XA 1VQ4A 1A3TA 1SYEA 1SR3A 1A0IA 1TS5A 5M3MH 3DWAA 3TREA 3TQYA 2LSSA 4RHSA 3MHBA 4TKOB 2WAQB 1ICWA 4AQYL 1FVIA 3I91A 1LTLA 4Y7NH 1ZEQX 2I5MX 4AYBB 5I9PA 3A74A 2UXDQ 4DKAC 2CW0D 2D5DA 4DAMA 1EIHA 1X3QA 1EU4A 3DM3A 4DF7A 1XNQL 3M7GA 4RCOA 2ZJQA 3RLOA 4KTAA 2E2IB 1YHBA 3S1NB 3OW2A 1SFOB 1E2VA 2K5DA 4P72A 4KD3A 3P1HA 4ME3A 3I8ZA 2R92B 3IRBA 4BWGB 3EJIA 2ZTEA 4ZK9B 3T56B 5M3MG 1TWGH 1HNZL 4JI1Q 5M5WB 2X6LA 4RKBA 4XQQA 5JJKA 3DMUA 3E0JA 4PMCA 1KIXA 1LM0A 3LX0A 4OELB 4KKTA 5LL6X 3M85A 5DNFA 5NUCA 2L15A 2OXPA 4CGYB 1KLUD 3HOYB 3BJUA 1UWVA 2PNHA 1ML0D 2N49A 1BO0A 3I56A 3N52A 5M3FH 1SMXA 1ESRA 4YHHL 2MNAA 2XVSA 4PZ6A 4CBVA 4DAYB 4O1NA 3OPOA 3HOVB 2D2CC 5C3WA 4C56C 5JOBA 3G4SA 4JV5Q 3PV0A 3WDNA 3U50C 1QWYA 2WAQE 2F3WA 3BDLA 5FLXL 2AQ2B 2I0QA 4DNIA 5I2XA 4WFN3 2VNUD 4JI7Q 1XMQL 2NN6H 4AYBE 3S1MH 1HXYD 4BBRH 1D7QA 1I4GA 1N33Q 4IUTA 1PH2A 2LXKA 2R93G 2FMCA 4B3SL 1XPRA 2B2YC 2WP8J 1DYQA 4PZ8A 4EVOA 3DHQA 1IZ6A 3G6JB 3DWPA 1TKWB 1G51A 2CH4A 1XMOQ 4LF7L 3FEWX 3S2DH 3NPPA 4DNRB 4FNFA 2AUKA 1HH2P 4G7ZC 3TS2A 5FJ8H 1X3PA 2PQAB 4V0BA 3F8TA 5C4HA 1VQ5A 4R4QA 1PHJA 1RIPA 1FNUA 1IBML 3HP3A 3E9IA 2JYOA 2B63B 3I4MB 3W1BA 1HUMA 3S16H 4JBKA 4G4KA 4KN4C 3T1YL 3TP5A 4KJOA 5JJLA 3IFDA 3RZOH 1CQFA 5IYBH 2ZT9C 4JI4Q 1D2BA 3KDFA 1H9RA 4X66Q 2B3GA 3PMFA 1PYSB 4GOPB 2RHQB 4X3KA 1IBKQ 3CC7A 1WCMG 5TSSA 5FJ8G 4J1MA 4LFAQ 1Q82C 3DEPA 5KNBA 4Q0FA 1I4PA 3R2IA 2IX0A 2IWHA 3EROA 3BYYB 3Q22A 2R7ZH 2Z1CA 4QF4A 1SEBD 3BDOA 1TY2A 2F0TA 4ODGA 2B2YA 3STBD 4R8IA 3TS0A 1MSGA 2HQLA 3S1RH 1MSHA 4A3KB 3H91A 2MP1A 1IKLA 1LYLA 2V1CC 1J5EL 4KN7C 1K8OA 2R6GA 1GKHA 1QNUA 1VQMA 4OX9L 4DGZA 3T13A 3GTOB 3TZDA 1E0BA 5C3XA 2PZTA 1JJ2A 1J8IA 1X65A 2CQAA 3OIQA 3KF8B 2MUYA 1V1PA 4LUVA 4A3BH 1FR3A 3S1QB 4DK1A 2DJGC 5LMNW 4XT1B 4ZRZA 4CJ1B 5IP7G 1TWCH 3M4OB 4CKBA 3PUZA 2KJXA 5C4XG 2A73B 4I65A 3OWFA 4A3FG 2JA7H 3LGJA 1QVCA 3D8GA 1WTVA 1E3PA 2A6ED 5CC4A 2R7ZG 1KHIA 2R7FA 2HHHL 5ELBA 2CQOA 3H0GB 2VUMH 2X6GA 4CDDC 3L9AX 2QCPX 1I4HA 1JMCA 2SOBA 2JQOA 2IHEA 2K6AA 4RWSC 1HNWQ 3VYUA 2UXCQ 4HIDA 3Q6SA 4GZYC 2JK8A 2NN6I 5EGTA 3NE5B 4WJ3M 3ZYYX 1U0LA 2Z6KC 1EQRA 1TWAH 4NB3A 5G3LD 3FVQA 2B2WC 2KEEA 1R4PB 4OWTB 4LFCL 5IWAQ 2L4NA 4DR7Q 4A3CH 3ULJA 3J80E 5T1IA 1GUSA 2AWOA 4K14A 2Y0SG 4GN4B 3AEVA 1K28A 1O78A 1UUPA 1Y8NB 3J80c 4A3IB 4P2CB 4KLKA 1Q8KA 5DM63 1RL2A 3P75A 1R4QB 1MIUA 2EQSA 1K8MA 1LTRD 3VA5A 3MFGA 1K83B 5IGGA 4A75A 1S5ED 3VR6A 3H3VI 4KK7A 2Z4HA 3I55A 1GHKA 5GQOA 1JR0D 5IGBA 1AN8A 4RGMA 1PH5A 4APVA 2ZXOA 1GO3E 3DEOA 4YCVA 3HOZB 5J3BA 2QDLA 5L37A 5EJWA 2PZWA 3SDZA 1RDPD 1NNXA 1YHAA 2AWNA 1B7YB 2EXZA 3K0XA 4A3CG 3A7AB 3MXPA 2HD3A 2Q2IA 4DV0L 1EY7A 4L63B 4L6TB 4CDFC 3EQLC 3J7AV 1WJJA 2Z6KA 5FOBB 4O0AA 1M1KC 3X3NA 4ZAIA 1G2TA 4YWLA 2G9DA 1LACA 2M9VA 2BH8A 2B2WA 1MI2A 4LK1C 1VQAA 2E5LL 2PO4A 2JEBI 4B08A 1PXUA 1X32A 4UY8C 2MQHA 3D31A 4ZLTF 4J6HA 2VL6A 1QZHA 3GTLH 2HCCA 2CCZA 1IXRA 4DR5Q 1YNXA 4YWMA 3JAME 3CCVA 4G57A 1NCVA 3K58A 2HQEA 1FJGL 4IALA 2VQFQ 2A19A 2KUMA 5M5YB 3FPUB 4DNTB 5IYDH 3OHXC 2EZVA 2MGSA 3AFQA 1Y14B 1NY4A 2NVQB 1H9SB 4B3RQ 3PGZA 5ELNA 4OWWB 1OXXK 1I3QB 3MTSA 3S9WA 4OWXB 2L5TA 3RN5A 4FP5D 2VZAA 2E2IH 3S1NH 1SFOH 3C1FA 2F3VA 1TVXA 5H1SE 2UUCQ 2R92H 2KOLA 3VR5A 1I50B 5EPJA 3SXHA 3C46A 1JOQA 1F9SA 4IFDH 3CW2C 4R4OA 3D3RA 5M5WH 5IYDG 3GTMB 2E74C 2M2LA 1IYJB 1YITA 4LF9Q 1C7YA 3KOJA 4MNOA 1KD1C 1W6KA 1S72A 1CZGA 3SE0A 5JJZA 3MVVA 1ZKOA 3AMUA 5FLMH 3JC66 2E2HB 1HR0L 3HOYH 4JI1L 2RDHA 1JORA 2WB1B 2WACA 1SE8A 1NBWA 4R1JA 3I4LA 4QIWE 4B3TQ 4N8FA 4WRDA 3NEMA 1C8CA 1HFGA 2F0DA 5KNDA 3GTKB 1X3GA 3URYA 2IT1A 1SLJA 2H5XA 1PTOB 3G6EA 3HZXA 5C4JB 3HOVH 5CV8A 1DOKA 2GA4B 5C44G 1SE4A 5DLQE 2F0NA 3M4PA 2FXQA 3HKSA 4MTKA 5CV9A 1VQIA 4N9TA 2BDNA 1K0RA 1EZ6A 2K75A 1WI5A 2KA7A 4HIOA 5C3EB 2A5HA 2A1AA 3U58A 1L1OB 4JV5L 3S24A 2RVLA 2FJ2A 1KDAA 3VR2A 4JI7L 3W3AA 2F0PA 2JP1A 3HOVG 1QVFA 1WTHA 5E1FA 1N33L 5EPKA 4HMJA 1VDZA 5A35A 2A8VA 2WKCA 4DXGA 2K50A 4IUNA 1I5FA 1LT3D 4XDXA 4X62L 1ENFA 2B63H 3I4MH 4IJHA 2C35B 4ZUJA 2EE1A 3K7AB 4FXKC 1STAA 3K5NA 2L0CA 3HOWB 2HIXA 3R93A 1B2TA 2HHHQ 2K7VA 2OEOA 4ZCKA 2WB1E 2Q2UA 1V1QA 1Y1WB 4NXML 1F9QA 1O7IA 4CHTB 4A3LH 4QQBX 4PQXA 1AH9A 3PIPA 2QEXA 2CFMA 4JCVE 2AMCB 1ASYA 1VQLA 1MJCA 4RGTA 3JAMi 2O4XA 4JI4L 1BBXC 2I5HA 3OSOA 3NBHB 2HT1A 3M3YB 3FHWA 1KNEA 3C3LA 4WORA 4GNXC 4IFDI 2MJ8A 4A3KH 2UXBQ 2B63G 4BXXH 5M9OA 4DA2A 1IYVA 3HOXG 5CR3A 1CKOA 1IBKL 1YZ6A 3OTOQ 3IL8A 5IT9E 3KLSX 2NZOA 1FGUA 1PRTD 4LFAL 3GTOH 2K5VA 2LS01 1NAPA 3NSWA 3CCEA 5JPMC 4A3MB 2K28A 3ERQA 2F0WA 4K2LA 1Z7TA 1YEZA 5HURA 1VMCA 3S1QH 1D5MC 4LF4L 2C5CA 2EYLA 2K5QA 3BZDB 5A2QL 4Y52H 4A3LG 1Z9FA 1E22A 2FHTA 3GDEA 3S2HB 3M4OH 1CZWA 1HHVA 5F2DA 3PIO3 2IX1A 2Q8TA 5IYCH 3H6MA 1L0WA 4C3IB 3D0FA 4BBSB 2RSOA 2XRSD 3J81i 1B44D 1ZYRD 4KY7A 3H0GH 5D3DA 1LV9A 2NYZD 2IPKD 2Q8IB 5JAVA 3SR1A 3W2DA 3NQIA 3GP7A 1V8QA 1MJEA 3LWUA 4A3GG 3TP6A 4FXGC 1XJVA 2PI2E 1N34L 2PQEA 4DV2Q 1EY8A 4A3JB 3UDIA 4OGQC 1UNSA 1YVCA 1VQ8A 2RKSA 1HZ9A 1SJED 4FDBA 3VR4A 4LF6Q 1ENCA 4IO9A 2EYPA 4UDUC 2AHOB 2EOTA 4DR3Q 1SSOA 4MHEA 2UXCL 4OL7A 5IODA 4ZKCB 2O2LD 3DWQA 1PDQA 4MIUA 1IW7D 2Z6BA 3H0GG 4GS3A 1ONLA 4LWCA 3NBIA 4U68A 1QVGA 1K83H 1QE6A 3D4WA 3U4ZA 5IWAL 1MKHA 3S17B 1PH9A 4LF5Q 1IKMA 4UHVA 1FJGQ 3RR5A 2NVTB 4RAUC 1PV4A 2ZXRA 1KDCA 2A74C 1HPCA 1STHA 1B9NA 1VCIA 3I4NB 2RSNA 3A8KE 1X3EA 2EVBA 4ZYSA 3HOZH 1T5XD 5KYLA 1EQQA 2EYMA 2AQ1B 3NP8A 1D1IA 2NZ1D 4KI0A 3RZDB 1XTDA 4RH6A 3NELA 4DR1Q 5FLXE 3EFXD 4V190 5GADC 1U5KA 4L5QA 4PMWA 3U9SA 1EIYB 1Q86C 5I6YA 4BY7B 3M7NA 1D1KA 1YJWA 5FLXc 4BA2I 2ICEC 3NWSA 3UI2A 5BR8L 3V2TA 1X56A 2B39A 3L0OA 4OO1H 2K04A 4X64L 4LMQD 3D6CA 4CKCA 1CQVA 4XYQA 1G6ZA 1II3A 3A8IE 3E9HA 2K5HA 2F0FA 4KV6A 1UAPA 1VQGA 5D65A 3AB9A 4A93B 1H9JA 1PLFA 1RCVD 3J7ZC 4UAIA 3PCOB 5KYIA 4CDEC 3A5ZB 2SDFA 1HR0Q 2BE5C 1EWIA 5M5YH 1ASZA 2JEAI 1Q3LA 3CC4A 4DR5L 3GV6A 4M8AA 4FF4A 2BH2A 1U4LA 3GTJB 3CCUA 2MPMA 2NVQH 3EA6A 1WTXA 2KCCA 1QCBD 2NTSA 4LUOA 4DAYA 1B1ZA 1I3QH 2VQFL 4RHRA 4GN3B 3TMEA 1JWMD 4KHVA 4KMUC 4DK6C 4YY3Q 1D6EC 1RD9D 5CYUA 5E3FA 1H95A 3GO5A 4NPSA 3G48A 4B3RL 1I50H 4IPHA 4HIKA 2TMPA 1E24A 1A15A 2RA4A 3GTMH 1ET9A 3PQIA 1IL2A 4IPDA 1GJXA 2K32A 4DR4L 3CCLA 3ICEA 2B2UC 3QWNA 5ELOA 2UUCL 2I07B 1UE7A 1CK1A 4EQOA 1EYDA 3F2DA 4POGA 1QJOA 2PQAA 1IHZA 1TS4A 1NE3A 5EQ0A 3OMCA 3BS1A 1WVLA 4X6AH 2C9OA 5ISRA 3M4QA 4X62Q 2V4DA 2VY3A 5GAGC 5M3FG 1Q81C 3F1ZA 4LF9L 2XGTA 3WOEA 4FF1A 3FRPB 3GTKH 4JI8Q 2MO1A 2YU9B 3A54A 3A55A 4JBMA 4B3MQ 4H13C 1PTOH 1XXGA 5C4JH 1RJTA 2H1EA 1VQHA 4FF2A 1O7ZA 1QOHA 2XWBB 3H3VH 3I90A 1WFQA 1VQ9A 4NXMQ 3SVMA 1K3RA 1AFPA 1LT6D 4B3TL 3OW7A 2NN6G 3TBIB 2KCNA 5BN3A 4GKKQ 5FO7B 4GOPA 4BBRG 1YNNC 5C3EH 1HCZA 2DNEA 4OO1I 4DUYQ 3IAYA 2VW9A 2DJFC 4HTHA 4I7ZC 2RDFA 2NZHA 4KHPL 1AEXA 2MFIA 2SNMA 3MA2B 2QA4A 2NVXB 4J15A 1VQFA 1Q8IA 3LNNA 1EOVA 2Z8LA 3QOJA 4C3JB 4X3UA 2A69C 4HSVA 2B2UA 2FFKB 3EVQA 1AW7A 4POFA 3A7LA 4WJ4A 1N8RC 3ONAB 3MXUA 1EWCA 1BR9A 1G8ZD 4AH6A 1PZJD 1KAAA 2KHIA 3CU7A 2N88A 1XNRQ 2XIWA 4LF4Q 1YJNA 1Q46A 2E2DC 2QKIC 5IY0A 2ASBA 1DOMA 3CCMA 3K7AH 4QUFA 1EWHA 5IYBG 2F0VA 4JW0A 3HOWH 1CHPD 3CPFA 1WTQA 3KDFB 1EYCA 3F2BA 3MEHA 3RN2A 5COYA 1BUVT 1Y1WH 1AZQA 1JB3A 1PFMA 3K5LA 3PUWA 4QJFA 2GN5A 2H4OA 3AU7A 4BA1I 4RA8A 1N34Q 2Q8RE 2K03A 1Q1EA 5ELDA 3M3YH 1XX8A 3FDTA 2PW7A 5M5XB 4A76A 3ER0A 1B53A 4OXPA 2KENA 1AE3A 4XQNA 3HKZE 1QG7A 1F2MA 3OMGA 1Y1VB 4R8NA 1D5XC 4ME5A 4A3MH 2Z0SA 1IYUA 4A3BG 4P73A 4YIJA 2BCOA 1Y1WG 2UXBL 2YTXA 4JK1C 3S2HH 1JC7A 2XN9C 4LNQA 2O5IC 2JA5B 2JA7G 3OTOL 1ILQA 1VQ6A 4C3IH 4BBSH 1DCZA 2RCFA 2VUMG 1LO5D 3T1HL 4XT3B 5E7NA 3CD6A 1A8VA 5CV6A 3TZUA 4ILWA 2J7ZA 5J1ZA 5DEHA 4U673 4F7XA 1NJIC 1CA5A 5I4DA 3CAMA 3R8BA 1HZCA 4DUZQ 1VF7A 1FL0A 1LTAD 5KNCA 1F9PA 4A3MG 1EQVA 1BCPF 1VQPA 3R3OA 2EY2A 4A3JH 1SDFA 5BR8Q 3QB3A 5FO8B 2A68C 1G2SA 1BCPC 2VXWA 4X64Q 1MHWC 4TVAB 1A2TA 5CMDA 3S15B 1FGBD 2HDMA 2F0KA 3SK8A 5IT9L 4C3IG 3L3OC 4DV2L 2JA9A 4TQUS 2I46A 4ZUIA 1WTOA 4RMFA 1SYBA 1H9KA 3K5OA 4LF6L 4DR2Q 1QNKA 3S17H 3VDYA 1STBA 4DR3L 3NENA 2L12A 2NVTH 3GTPB 2IW3A 3IFTA 4IJLA 4QIWB 4A3JG 3E3XA 4DU9A 3PO2B 3I4NH 3CCSA 3T53B 2LKVA 1J6QA 1LTSD 3GTGB 1JE4A 4UPAA 1STEA 1MGSA 4JI0Q 3RZDH 5JJIA 4LF5L 1PTOC 2F0SA 1H9SA 3VA7A 4H02A 1EFWA 4BY7H 1YNJC 3H3VC 4DV3L 1SE2A 3EBEA 1J9OA 4FVMA 1GUNA 5EBDA 3K0YA 2KEDA 4IQZA 1PRTB 5CV5A 1XYIA 1N32Q 4MTNA 1WTWA 2JSOA 4IFDJ 4DR1L 2ZM6Q 2EJMA 1UE6A 4DV7Q 5LMUQ 2BDOA 5J39A 2IHFA 4EQPA 2BA1A 1PMRA 4XXEA 5FO9B 2KECA 1CUKA 2CHBD 1TWHB 2F0QA 4A93H 1AZPA 4DR4Q 1I6VC 1M90C 2OTJA 4A3DB 4OIKA 3PF4A 2ATWA 1X54A 2K5NA 2NVYB 4R9WA 1G291 3E0EA 4LW1A 2PZUA 4A3EB 1GM5A 4BY7G 2B8GA 2R93B 1JJCB 1EY5A 4UP9A 3SHLA 5CBEE 2WAQG 1TU2B 4JC0A 1UE1A 3MXGA 3OIPA 2Q2HA 2CW0C 4AYBG 4I7AA 5GAEC 1S40A 4P71A 3GTJH 2IL8A 3KBXA 3V05A 3NWTA 1V1OA 2QW7A 4EX5A 3MEFA 4C1NK 4JYAQ 2KCTA 3I70A 4PMBA 2UUAQ 4IPGA 1Y8PB 4OHJA 2R92G 1HJPA 1B70B 5DAUA 4X3SA 1D5ZC 1BQQT 4F87A 4IFDG 1HZAA 1ENAA 2YYZA 3CMEA 2CWAA 2CKZB 1LLRD 3J80i 3BU2A 3RLNA 4KHPQ 4E6IA 1VQKA 1YNND 2PNRC 1SYFA 2K5WA 5KIXA 4XIGS 1WYDA 1HNXQ 2P5ZX 1F9RA 4CJ2C 5IGDA 5K5PA 4NKLA 4YY3L 4DAPA 5FLMG 1JCKB 1WCMB 3E6ZX 5IGFA 4LUZA 3MXNB 5A2QE 1SYGA 3CQZB 3HOYG 2A69D 1P16A 1SNCA 3FPPA 4IOAA 1P8LA 4F88A 5I9OA 3JAML 1T9HA 2F0JA 1I4RA 1VQEA 1GUTA 4K5VA 2YU9H 2OT2A 2EYFA 3CRLC 5JPNC 4L5RC 1B4OA 1ILPA 1PZKD 1U4RA 4DV5Q 2JA8B 5AFWA 1BBWA 2VQEQ 1H9MA 4OONA 1K0SA 2DY8A 4DR6Q 1ZXTA 1EUJA 1S5FD 1PH8A 1I6HB 4JI8L 2NUCA 5C4XB 4A3FB 4L8JA 4MN3A 1OO9B 4X3TA 5CGKA 4B3ML 4IUPA 3NXWA 3Q0AA 3VYTA 1OTCA 2WINB 2RDGA 3NBHA 1S4ZA 3ND8A 3J81L 2NVXH 2VB3X 2EJGC 1LTID 1S5BD 2K01A 5FK9C 4C3JH 1T5EA 4GKKL 2VS1A 1JT8A 2YTYA 4R4TA 1HUNA 1BBUA 4DUYL 2YTVA 1A63A 1PFSA 2ALYB 1EOTA 5T1GA 2PYKA 3I4MG 1V43A 5C5LA 2AUJD 1U9RA 1DM0B 2EJFC 4K6LA 1L2FA 1CKNB 1BNZA 4YCUA 1STYA 2EYJA 2F0UA 1NR4A 4A4IA 4DV1L 1QB5D 3T1HQ 3KF6B 1UEAB 1QUQA 3CPWA 2K14A 3KUPA 1XNRL 2ID0A 1KRSA 2O5JC 1RF2D 4C3JG 2B29A 5ELEA 2RF4A 3PUVA 2F0OA 3H94A 3K8AA 5E4WC 4DK3C 3ZJYC 1PA6A 1LT4D 5CBAE 1JOOA 4HJAA 1S5DD 1M8AA 2N8NA 5C6AA 4DAVA 5CV7A 4C2MB 5C0XH 1JWSD 4A3KG 2SNSA 3I72A 5M5XH 4BXXG 4JOIC 1YHQA 5BN4A 3KFUA 4CDCC 3IKJA 2R3ZA 2A68D 4OEMB 1BCPD 2LXJA 5JVH3 1Y1VH 2KVMA 1SRUA 4PG3A 2L1BA 4KKSA 1I4XA 2Q2TA 2E2JB 2XRQD 5GROA 4ZKBB 1GVPA 5IYCG 1EYAA 1KAWA 4O2DA 2JA5H 4LAAA 1JE5A 1EQTA 4FXDA 4DV6Q 2EY5A 1MD2D 4A3IH 3UDGA 2QILA 1CM9A 1A2UA 1JB7A 4TSSA 5HGTA 3SK4A 1RHPA 1Y1VG 4R4CA 1L0YB 3RNUA 4DV3Q 1JWUD 4IUUA 4K0KQ 1KLGD 2Y0SE 2DGYA 4IN3A 4J8QA 3KBGA 4NXNQ 3X3MA 4GNXB 3J81j 2QDBA 3BVZA 4PNYA 1OXSC 3RLFA 1DONA 4JOIA 2A6HC 4G7HC 3S15H 4DUZL 1X6OA 4A3IG 3D6WA 2K05A 3L7ZC 5DM73 4LJZC 1GUWA 1EY6A 4LF8Q 4GKJQ 2DN8A 3BG3A 4O42A 3RUZA 1HR0W 3LWEA 3GTPH 2WKDA 2ZJPA 3PO2H 3TP8A 3HOZG 1K9MC 1FD7D 1FYCA 1GUGA 2KBNA 5EPLA 1VMPA 3GQBA 4IOCA 4QCLA 2N3SA 3GTGH 3CKIB 4H7BA 4DR2L 3KK7A 4BY1B 4CKEA 2B8FA 1HTPA 4M1UB 5KRUA 2B2VC 3TN2A 4HIMA 2DUDA 3FKIB 1KQSA 3CP0A 1XPUA 4OO1G 3PO3B 5EAYA 4JI5L 5C0XI 4LFBQ 3ULPA 4JI0L 2JJQA 1VF5C 3AYHB 3QO2A 1PFBA 4KKUA 5JEAJ 1LTGD 3PUXA 4KY6A 1EIFA 5C44B 1AE2A 3PO2G 3CHBD 1JICA 1TWHH 1OXTA 3KLRA 1F2YA 4GOPC 4A3DH 4WJWA 2J4XA 1EL0A 4EQ5A 2OQKA 2NVYH 3NHHA 1N32L 4A3EH 2F0IA 2PMZE 2ZM6L 1B3QA 5JEAH 4DV7L 3NTHA 5LMUL 3J7AF 2R93H 1L0XB 1KL9A 4GLXA 1HA5A 1UEBA 3V96A 3K7UC 1VQ7A 3BVMA 3AFPA 2E75C 1DOLA 1CHQD 2MHVA 3HEJA 2F0GA 2E2HH 3MC0B 1R9TB 1C0AA 1SMYC 3A8JE 4DV4L 1SROA 2B2VA 4IURA 1B50A 1E2WA 4A3DG 4JI6Q 3M9BA 1SN8A 3K6OA 3G7LA 1LUZA 1WTRA 1YI2A 1A3UA 1OXUA 4A3EG 2UUBQ 1O80A 5JEAG 3I4OA 2L55A 4RG1A 3S14B 4FO2A 3Q8DA
chains in the Genus database with same CATH topology
4JI3L 1WI5A 4HIOA 1PH4A 4X64Q 1NTGA 4JYAL 3CCRA 4P75A 4TVAB 1TWFH 3BZCA 4GLVB 3KJPA 2IY5B 2A1AA 1OXVA 3H3VI 3WWVA 2UUAL 3U58A 3J7A5 1VQNA 1WCMH 1L1OB 1KC8C 4JV5L 1VQJA 3S24A 2CCZA 3PF5A 1VQOA 4DV2L 2JA5G 4JI2L 3CQZH 4DR7L 2JA9A 4TQUS 1IBLQ 2WB1G 4QY7A 4RMFA 3CXCA 2F4VQ 4JI7L 4AIMA 1N36Q 2YV5A 4LF6L 4JBJA 4DR2Q 3HOVG 1QVFA 3S17H 3VDYA 1HNXL 1N33L 4DR3L 3NENA 2A8VA 2NVTH 2E8GA 5K36G 2K50A 1I5FA 2RCNA 4IJLA 4X62L 4A3JG 3I4NH 2GVBA 4DV1Q 1VQ4A 3CCSA 2B63H 3I4MH 2GVAA 1SR3A 2C35B 1A0IA 4IJHA 5M3MH 3TREA 1K8GA 3TQYA 2K4KA 1J6QA 2LSSA 2JA8H 4UPAA 3A0JA 3HFZB 4JI0Q 2HIXA 3RZDH 2HHHQ 5JJIA 4LF5L 4AQYL 1FVIA 5IP7H 1LTLA 3PUYA 5C3EG 1I6HH 4H02A 1EFWA 1VS0A 4Y7NH 2WB1E 4BY7H 5C4XH 4DV3L 2I5MX 2Q2UA 3EBEA 4A3FH 1V1QA 3A74A 4NXML 2I5LX 2UXDQ 1O7IA 4DKAC 4A3LH 4DAMA 3PIOA 4QQBX 5GAHC 2EXDA 1N9WA 3H15A 1AH9A 3PIPA 3DM3A 4DV5L 2QEXA 1XNQL 2CFMA 4JCVE 2AMCB 2VQEL 2UU9L 1ASYA 3RLOA 2ZJQA 1VQLA 4X65Q 1YHBA 1MJCA 4MTNA 1N32Q 3OW2A 4JI4L 3JAMi 4DR6L 4IFDJ 4P72A 5IT9c 2I5HA 2ZM6Q 3NBHB 1UE6A 4DR1L 2HT1A 1E7ZA 3FHWA 4DV7Q 5LMUQ 1I94Q 4ME3A 4GNXC 4IFDI 2IHFA 4A3KH 2BA1A 3IRBA 2UXBQ 2B63G 1CUKA 4BXXH 1S3OA 2ZTEA 4A93H 3HOXG 5M3MG 4DR4Q 1TWGH 1CKOA 1M90C 1YZ6A 2WFWA 1IBKL 1HNZL 3OTOQ 2OTJA 2JA8G 4JI1Q 2NZOA 3PF4A 2ATWA 1FGUA 4LFAL 3GTOH 1X54A 1C9OA 2K5NA 2K5VA 1VQCA 3CCEA 1G291 5JJKA 3E0EA 4LW1A 1GM5A 1KIXA 4BY7G 1LM0A 1YEZA 4P74A 1JJCB 2OQ0A 3HOWG 3S1QH 4UP9A 4LF4L 2WAQG 3M85A 4JC0A 4A3LG 4Y52H 1Z9FA 1E22A 1B8AA 1UE1A 2L15A 3GDEA 4MZ9A 3M4OH 2IX1A 2Q2HA 5IYCH 4AYBG 3BJUA 5LMNQ 5GAEC 1UWVA 1S40A 2PNHA 4P71A 2F52A 1L0WA 3GTJH 3D0FA 3J81i 2N49A 3I56A 1K8AC 5M3FH 1SMXA 3ULLA 1UE5A 3H0GH 4YHHL 4EX5A 1TXYA 3MEFA 4JYAQ 2MNAA 4PZ6A 4DAYB 2QGQA 2KCTA 2UUAQ 3CC2A 4IPGA 4C2MH 1MJEA 2R92G 4A3GG 1HJPA 3G4SA 4JV5Q 1B70B 1XJVA 1NMGA 1Z47A 2PI2E 3PV0A 3U50C 1N34L 1E1TA 4DV2Q 4JI2Q 4IFDG 1HZAA 2WAQE 2YYZA 3UDIA 3CMEA 2CWAA 5AJ3L 2CKZB 2I0QA 1PVOA 3J80i 3BU2A 3RLNA 4DNIA 4KHPQ 1YVCA 1VQ8A 1VQKA 2VNUD 1HZ9A 1XMQL 4JI7Q 4AYBE 3PSIA 3S1MH 4FDBA 4LF6Q 4BBRH 1D7QA 3I7FA 2EIFA 4XIGS 4IO9A 1WYDA 1HNXQ 1N33Q 1PH2A 2AHOB 2LXKA 4DR3Q 2R93G 4B3SL 1XPRA 1NMFA 2WP8J 4YY3L 4PZ8A 5FLMG 2UXCL 4HJ8A 2E2JH 1IZ6A 4LUZA 2BA0A 3MXNB 1XMOQ 3TRZA 1G51A 4LF7L 3S2DH 3HOYG 3H0GG 1HH2P 4GS3A 1P16A 1W3SA 4LWCA 3TS2A 4IOAA 1QVGA 1K83H 5FJ8H 1P8LA 4BBSG 2PQAB 3U4ZA 5IWAL 1T9HA 1MKHA 3F8TA 4R4IA 4UP8A 4R4QA 1PH9A 1VQ5A 4LF5Q 1FJGQ 4AQYQ 1PHJA 3RR5A 1RIPA 3SGIA 1VQEA 1X3FA 1PV4A 4HJ7A 1IBML 1VCIA 2D0PA 2YU9H 3E9IA 2HIVA 3W1BA 1X3EA 4L5RC 3HOZH 3S16H 1EQQA 4JBKA 3T1YL 4DV5Q 4ALPA 5JJLA 1XNQQ 4DV6L 1BBWA 3RZOH 2VQEQ 4OONA 2OWOA 4KI0A 5IYBH 1XTDA 3NELA 4JI4Q 4DR6Q 4DR1Q 1EUJA 5GADC 1U5KA 4L5QA 4PMWA 1YIJA 1PH8A 1Q86C 1EIYB 3AQQA 4JI5Q 3KDFA 4JI8L 3M7NA 1X55A 2D62A 4X66Q 1YJWA 2B3GA 5FLXc 4BA2I 4B3ML 1PYSB 4GOPB 2RHQB 1IBKQ 3U4VA 3CC7A 1OTCA 1HNZQ 1WCMG 5BR8L 5FJ8G 1X9NA 1X56A 3L0OA 4YCWA 4LFAQ 1Q82C 4K0KL 4X64L 3CMAA 1W2BA 2NVXH 1H95A 2IX0A 1YBYA 2CWPA 4NXNL 3F2CA 2R7ZH 4C3JH 3STBD 3S1RH 4GKKL 3TS0A 2HQLA 2K5HA 2VS1A 3E9HA 1PH1A 1JT8A 2YTYA 4R4TA 1VQGA 1PH7A 1LYLA 1BBUA 4DUYL 2YTVA 2V1CC 1J5EL 2R6GA 1A63A 2ES2A 1GKHA 1IBLL 1PFSA 1VQMA 4OX9L 2ALYB 3J7ZC 4HJ9A 3JAMc 3I4NG 3PCOB 2F4VL 1N36L 1L1OC 3I4MG 1CKMA 1V43A 3UDXA 1VQBA 3A5ZB 1JJ2A 1X65A 1HR0Q 3KF8B 3A5UA 4LF8L 1EWIA 4LUVA 4YHHQ 4A3BH 5M5YH 4GKJL 1ASZA 1L2FA 1CKNB 5LMNW 2JEAI 4YCUA 5IP7G 1TWCH 4A4IA 4DV1L 3CC4A 3T1HQ 3KF6B 3PUZA 1QUQA 3CPWA 5C4XG 4BY1H 4GN5A 4DV4Q 4DR5L 2K14A 4A3FG 1XNRL 2BH2A 2JA7H 2ID0A 1KRSA 2XTIA 1QVCA 3LGJA 3CCUA 1E3PA 1BVSA 3FKIH 3L2PA 1QZGA 2NVQH 2R7ZG 1KHIA 2R7FA 2B29A 2HHHL 4LUOA 4DK3C 2RF4A 3PUVA 2CQOA 1I3QH 3K8AA 2VQFL 2RHSB 3PO3H 2VUMH 3ZJYC 1XMQQ 1PA6A 3I2ZA 1JMCA 4GN3B 4HJAA 2JQOA 2IHEA 2N8NA 2UXDL 4DK6C 1HNWQ 4B3SQ 2UXCQ 4HIDA 4YY3Q 3J81c 4A3KG 4JI3Q 5M5XH 2KHJA 4JOIC 3GO5A 5C44H 4BXXG 4A93G 2JK8A 4XTCS 1G6PA 4LF7Q 1YHQA 4NPSA 2NN6I 3G48A 3OYYA 4B3RL 3KFUA 4WJ3M 1U0LA 1I50H 2Z6KC 1EQRA 4IPHA 4HIKA 1TWAH 4NB3A 2KCMA 2LXJA 1E24A 1Y1VH 4LFBL 3GTMH 1SRUA 4OWTB 4PG3A 4LFCL 5IWAQ 4DR7Q 1IL2A 4IPDA 4A3CH 3ULJA 4BY1G 2AWOA 4DR4L 3CCLA 3ICEA 5ELOA 3EIVA 2Q2TA 2UUCL 2Y0SG 4GN4B 3FKIG 1UE7A 1IBMQ 3AEVA 3J80c 5GROA 1L1OA 3F2DA 1GVPA 4POGA 2PQAA 5IYCG 4KLKA 1Q8KA 3PO3G 1RL2A 1NE3A 1KAWA 4O2DA 2JA5H 1MIUA 4X6AH 2EQSA 3T1YQ 1JE5A 4A75A 3M4QA 4DV6Q 4X62Q 1PYBA 2VY3A 5GAGC 5M3FG 4A3IH 1Q81C 3F1ZA 3UDGA 3I55A 4LF9L 2XGTA 5GQOA 2R7DA 3GTKH 4KHZA 1R9TH 1JB7A 3FP9A 4JI8Q 2MO1A 3EN2A 1PH5A 4APVA 4JBMA 4JG2A 4B3MQ 1GO3E 1WOCA 5C4JH 2OTLA 1VQHA 4YCVA 1CSQA 4GLAC 5J3BA 3G71A 1Y1VG 4R4CA 3H3VH 3RNUA 1WFQA 4DV3Q 1VQ9A 1YHAA 2AWNA 1B7YB 4K0KQ 3K0XA 4NXMQ 4A3CG 1K3RA 2K52A 2Y0SE 2DGYA 4B3TL 2Q2IA 2PI2A 4DV0L 1JJGA 1Q12A 4NXNQ 2NN6G 4GNXB 3J81j 4GOPA 3S14H 4GKKQ 2F3IA 4BBRG 1OXSC 2JA6H 5C3EH 3RLFA 5HY6A 2UU9Q 4JOIA 4L5SA 4OO1I 4DUYQ 4PZ7A 1J5EQ 1WJJA 1EYGA 2VW9A 2Z6KA 1M1KC 4O0AA 3S15H 4JI6L 4DUZL 4OX9Q 4YWLA 4YWKA 3UE1A 1X6OA 2NZHA 3HOUH 2BH8A 2MFIA 4KHPL 1A62A 4A3IG 2QA4A 4J15A 1VQFA 3L7ZC 2UUBL 1VQAA 1EOVA 1YJ9A 2E5LL 2JEBI 3K80C 4LF8Q 4GKJQ 4UY8C 2MQHA 3D31A 1VQDA 4POFA 2VL6A 1XMOL 4UP7A 1QZHA 4WJ4A 3CCJA 1N8RC 4AH6A 3GTLH 4C3HH 3K81C 4JBWA 1IXRA 2KHIA 3HOXH 4DR5Q 1YNXA 4QGUA 4YWMA 1HR0W 2D0OA 1XNRQ 3GTPH 4LF4Q 2ZJPA 1YJNA 3DLLA 3PO2H 3CCVA 1Q46A 5IY0A 3HOZG 1K9MC 1CKNA 2KBNA 1FJGL 2ASBA 2VQFQ 4IOCA 3CCMA 2JA6G 1Q7YC 2A19A 2N3SA 3KF6A 3K7AH 5IYBG 3GTGH 5IYDH 3HOWH 4DR2L 3HKZG 3CPFA 3HOUG 3KDFB 3AFQA 3F2BA 1DGSA 1BKBA 3RN2A 1Y14B 5IP9H 4HIMA 1NY4A 2DUDA 1KQSA 1Y1WH 4B3RQ 3CP0A 3PGZA 5ELNA 5C0XJ 4OWWB 1XPUA 1K73C 1OXXK 4OO1G 1Q1BA 3PUWA 4QJFA 5EAYA 4OWXB 2GN5A 1CSPA 2N78A 4JI5L 5C0XI 4LFBQ 4BA1I 3BZKA 3RN5A 2VZAA 3ULPA 1N34Q 4JI0L 4X66L 2ZJRA 2JJQA 3KJOA 4LFCQ 2E2IH 3AYHB 3S1NH 1SFOH 5AJ3Q 5JEAJ 1Q1EA 3M3YH 3PUXA 4L5TA 5H1SE 2UUCQ 3STBC 1EIFA 3PO2G 1AE2A 2OCEA 4A76A 3ER0A 4OXPA 2KENA 2R92H 1KXLA 1AE3A 3W1GA 4A3GH 1PH6A 1TWHH 3ERSX 1OXTA 5HGQA 3HKZE 3KYHC 2ZTDA 4GOPC 3CW2C 4R4OA 4A3DH 5M5WH 1D8LA 5IYDG 3GD7A 3B6YA 4EQ5A 2OQKA 1IYJB 2NVYH 1YITA 1V9PA 4X65L 4A3MH 4DPGA 1XPOA 1HZBA 4LF9Q 4A3EH 1C7YA 3KOJA 1N32L 2Z0SA 2PMZE 4MNOA 2ZM6L 3CF5A 1KD1C 4A3BG 4P73A 5IP9G 4DV7L 2JE6I 5LMUL 1S72A 1I94L 2R93H 1KL9A 4GLXA 1Y1WG 5FLMH 2UXBL 1UEBA 2YTXA 1PH3A 3K7UC 1VQ7A 3JC66 4IPCA 1QUQB 3S2HH 3AFPA 4LNQA 2JA7G 1HR0L 3OTOL 3HOYH 4JI1L 1SE8A 1VQ6A 1NBWA 4R1JA 4QIWE 4C3IH 4B3TQ 4BBSH 4DV0Q 3NEMA 2E2HH 4HJ5A 2VUMG 1E1OA 3UE0A 1X3GA 3T1HL 1C0AA 2IT1A 5E7NA 3CD6A 1A8VA 4DV4L 1SROA 1SLJA 2ZTCA 3CCQA 2H5XA 3G6EA 1NJIC 5C0XG 3CAMA 4A3DG 2MO0A 1HZCA 2AKWB 3W5OA 3HOVH 4JI6Q 3M9BA 1SN8A 1KRTA 3TEHB 5C44G 4DUZQ 1FL0A 3KLWA 5LMNL 4QL5A 5DLQE 1LUZA 3GTQH 4GNXA 3M4PA 4A3MG 1YI2A 1GD7A 1OXUA 2FXQA 3HKSA 4A3EG 1VQPA 2UUBQ 2E5LQ 4A3JH 5IE8A 5JEAG 1VQIA 3I4OA 5BR8Q 3UDFA 4RG1A 1HNWL 1K0RA 2K75A 3Q8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 L;  1WI5 A;  4HIO A;  1PH4 A;  4X64 Q;  1NTG A;  4JYA L;  3CCR A;  4P75 A;  4TVA B;  1TWF H;  3BZC A;  4GLV B;  3KJP A;  2IY5 B;  2A1A A;  1OXV A;  3H3V I;  3WWV A;  2UUA L;  3U58 A;  3J7A 5;  1VQN A;  1WCM H;  1L1O B;  1KC8 C;  4JV5 L;  1VQJ A;  3S24 A;  2CCZ A;  3PF5 A;  1VQO A;  4DV2 L;  2JA5 G;  4JI2 L;  3CQZ H;  4DR7 L;  2JA9 A;  4TQU S;  1IBL Q;  2WB1 G;  4QY7 A;  4RMF A;  3CXC A;  2F4V Q;  4JI7 L;  4AIM A;  1N36 Q;  2YV5 A;  4LF6 L;  4JBJ A;  4DR2 Q;  3HOV G;  1QVF A;  3S17 H;  3VDY A;  1HNX L;  1N33 L;  4DR3 L;  3NEN A;  2A8V A;  2NVT H;  2E8G A;  5K36 G;  2K50 A;  1I5F A;  2RCN A;  4IJL A;  4X62 L;  4A3J G;  3I4N H;  2GVB A;  4DV1 Q;  1VQ4 A;  3CCS A;  2B63 H;  3I4M H;  2GVA A;  1SR3 A;  2C35 B;  1A0I A;  4IJH A;  5M3M H;  3TRE A;  1K8G A;  3TQY A;  2K4K A;  1J6Q A;  2LSS A;  2JA8 H;  4UPA A;  3A0J A;  3HFZ B;  4JI0 Q;  2HIX A;  3RZD H;  2HHH Q;  5JJI A;  4LF5 L;  4AQY L;  1FVI A;  5IP7 H;  1LTL A;  3PUY A;  5C3E G;  1I6H H;  4H02 A;  1EFW A;  1VS0 A;  4Y7N H;  2WB1 E;  4BY7 H;  5C4X H;  4DV3 L;  2I5M X;  2Q2U A;  3EBE A;  4A3F H;  1V1Q A;  3A74 A;  4NXM L;  2I5L X;  2UXD Q;  1O7I A;  4DKA C;  4A3L H;  4DAM A;  3PIO A;  4QQB X;  5GAH C;  2EXD A;  1N9W A;  3H15 A;  1AH9 A;  3PIP A;  3DM3 A;  4DV5 L;  2QEX A;  1XNQ L;  2CFM A;  4JCV E;  2AMC B;  2VQE L;  2UU9 L;  1ASY A;  3RLO A;  2ZJQ A;  1VQL A;  4X65 Q;  1YHB A;  1MJC A;  4MTN A;  1N32 Q;  3OW2 A;  4JI4 L;  3JAM i;  4DR6 L;  4IFD J;  4P72 A;  5IT9 c;  2I5H A;  2ZM6 Q;  3NBH B;  1UE6 A;  4DR1 L;  2HT1 A;  1E7Z A;  3FHW A;  4DV7 Q;  5LMU Q;  1I94 Q;  4ME3 A;  4GNX C;  4IFD I;  2IHF A;  4A3K H;  2BA1 A;  3IRB A;  2UXB Q;  2B63 G;  1CUK A;  4BXX H;  1S3O A;  2ZTE A;  4A93 H;  3HOX G;  5M3M G;  4DR4 Q;  1TWG H;  1CKO A;  1M90 C;  1YZ6 A;  2WFW A;  1IBK L;  1HNZ L;  3OTO Q;  2OTJ A;  2JA8 G;  4JI1 Q;  2NZO A;  3PF4 A;  2ATW A;  1FGU A;  4LFA L;  3GTO H;  1X54 A;  1C9O A;  2K5N A;  2K5V A;  1VQC A;  3CCE A;  1G29 1;  5JJK A;  3E0E A;  4LW1 A;  1GM5 A;  1KIX A;  4BY7 G;  1LM0 A;  1YEZ A;  4P74 A;  1JJC B;  2OQ0 A;  3HOW G;  3S1Q H;  4UP9 A;  4LF4 L;  2WAQ G;  3M85 A;  4JC0 A;  4A3L G;  4Y52 H;  1Z9F A;  1E22 A;  1B8A A;  1UE1 A;  2L15 A;  3GDE A;  4MZ9 A;  3M4O H;  2IX1 A;  2Q2H A;  5IYC H;  4AYB G;  3BJU A;  5LMN Q;  5GAE C;  1UWV A;  1S40 A;  2PNH A;  4P71 A;  2F52 A;  1L0W A;  3GTJ H;  3D0F A;  3J81 i;  2N49 A;  3I56 A;  1K8A C;  5M3F H;  1SMX A;  3ULL A;  1UE5 A;  3H0G H;  4YHH L;  4EX5 A;  1TXY A;  3MEF A;  4JYA Q;  2MNA A;  4PZ6 A;  4DAY B;  2QGQ A;  2KCT A;  2UUA Q;  3CC2 A;  4IPG A;  4C2M H;  1MJE A;  2R92 G;  4A3G G;  1HJP A;  3G4S A;  4JV5 Q;  1B70 B;  1XJV A;  1NMG A;  1Z47 A;  2PI2 E;  3PV0 A;  3U50 C;  1N34 L;  1E1T A;  4DV2 Q;  4JI2 Q;  4IFD G;  1HZA A;  2WAQ E;  2YYZ A;  3UDI A;  3CME A;  2CWA A;  5AJ3 L;  2CKZ B;  2I0Q A;  1PVO A;  3J80 i;  3BU2 A;  3RLN A;  4DNI A;  4KHP Q;  1YVC A;  1VQ8 A;  1VQK A;  2VNU D;  1HZ9 A;  1XMQ L;  4JI7 Q;  4AYB E;  3PSI A;  3S1M H;  4FDB A;  4LF6 Q;  4BBR H;  1D7Q A;  3I7F A;  2EIF A;  4XIG S;  4IO9 A;  1WYD A;  1HNX Q;  1N33 Q;  1PH2 A;  2AHO B;  2LXK A;  4DR3 Q;  2R93 G;  4B3S L;  1XPR A;  1NMF A;  2WP8 J;  4YY3 L;  4PZ8 A;  5FLM G;  2UXC L;  4HJ8 A;  2E2J H;  1IZ6 A;  4LUZ A;  2BA0 A;  3MXN B;  1XMO Q;  3TRZ A;  1G51 A;  4LF7 L;  3S2D H;  3HOY G;  3H0G G;  1HH2 P;  4GS3 A;  1P16 A;  1W3S A;  4LWC A;  3TS2 A;  4IOA A;  1QVG A;  1K83 H;  5FJ8 H;  1P8L A;  4BBS G;  2PQA B;  3U4Z A;  5IWA L;  1T9H A;  1MKH A;  3F8T A;  4R4I A;  4UP8 A;  4R4Q A;  1PH9 A;  1VQ5 A;  4LF5 Q;  1FJG Q;  4AQY Q;  1PHJ A;  3RR5 A;  1RIP A;  3SGI A;  1VQE A;  1X3F A;  1PV4 A;  4HJ7 A;  1IBM L;  1VCI A;  2D0P A;  2YU9 H;  3E9I A;  2HIV A;  3W1B A;  1X3E A;  4L5R C;  3HOZ H;  3S16 H;  1EQQ A;  4JBK A;  3T1Y L;  4DV5 Q;  4ALP A;  5JJL A;  1XNQ Q;  4DV6 L;  1BBW A;  3RZO H;  2VQE Q;  4OON A;  2OWO A;  4KI0 A;  5IYB H;  1XTD A;  3NEL A;  4JI4 Q;  4DR6 Q;  4DR1 Q;  1EUJ A;  5GAD C;  1U5K A;  4L5Q A;  4PMW A;  1YIJ A;  1PH8 A;  1Q86 C;  1EIY B;  3AQQ A;  4JI5 Q;  3KDF A;  4JI8 L;  3M7N A;  1X55 A;  2D62 A;  4X66 Q;  1YJW A;  2B3G A;  5FLX c;  4BA2 I;  4B3M L;  1PYS B;  4GOP B;  2RHQ B;  1IBK Q;  3U4V A;  3CC7 A;  1OTC A;  1HNZ Q;  1WCM G;  5BR8 L;  5FJ8 G;  1X9N A;  1X56 A;  3L0O A;  4YCW A;  4LFA Q;  1Q82 C;  4K0K L;  4X64 L;  3CMA A;  1W2B A;  2NVX H;  1H95 A;  2IX0 A;  1YBY A;  2CWP A;  4NXN L;  3F2C A;  2R7Z H;  4C3J H;  3STB D;  3S1R H;  4GKK L;  3TS0 A;  2HQL A;  2K5H A;  2VS1 A;  3E9H A;  1PH1 A;  1JT8 A;  2YTY A;  4R4T A;  1VQG A;  1PH7 A;  1LYL A;  1BBU A;  4DUY L;  2YTV A;  2V1C C;  1J5E L;  2R6G A;  1A63 A;  2ES2 A;  1GKH A;  1IBL L;  1PFS A;  1VQM A;  4OX9 L;  2ALY B;  3J7Z C;  4HJ9 A;  3JAM c;  3I4N G;  3PCO B;  2F4V L;  1N36 L;  1L1O C;  3I4M G;  1CKM A;  1V43 A;  3UDX A;  1VQB A;  3A5Z B;  1JJ2 A;  1X65 A;  1HR0 Q;  3KF8 B;  3A5U A;  4LF8 L;  1EWI A;  4LUV A;  4YHH Q;  4A3B H;  5M5Y H;  4GKJ L;  1ASZ A;  1L2F A;  1CKN B;  5LMN W;  2JEA I;  4YCU A;  5IP7 G;  1TWC H;  4A4I A;  4DV1 L;  3CC4 A;  3T1H Q;  3KF6 B;  3PUZ A;  1QUQ A;  3CPW A;  5C4X G;  4BY1 H;  4GN5 A;  4DV4 Q;  4DR5 L;  2K14 A;  4A3F G;  1XNR L;  2BH2 A;  2JA7 H;  2ID0 A;  1KRS A;  2XTI A;  1QVC A;  3LGJ A;  3CCU A;  1E3P A;  1BVS A;  3FKI H;  3L2P A;  1QZG A;  2NVQ H;  2R7Z G;  1KHI A;  2R7F A;  2B29 A;  2HHH L;  4LUO A;  4DK3 C;  2RF4 A;  3PUV A;  2CQO A;  1I3Q H;  3K8A A;  2VQF L;  2RHS B;  3PO3 H;  2VUM H;  3ZJY C;  1XMQ Q;  1PA6 A;  3I2Z A;  1JMC A;  4GN3 B;  4HJA A;  2JQO A;  2IHE A;  2N8N A;  2UXD L;  4DK6 C;  1HNW Q;  4B3S Q;  2UXC Q;  4HID A;  4YY3 Q;  3J81 c;  4A3K G;  4JI3 Q;  5M5X H;  2KHJ A;  4JOI C;  3GO5 A;  5C44 H;  4BXX G;  4A93 G;  2JK8 A;  4XTC S;  1G6P A;  4LF7 Q;  1YHQ A;  4NPS A;  2NN6 I;  3G48 A;  3OYY A;  4B3R L;  3KFU A;  4WJ3 M;  1U0L A;  1I50 H;  2Z6K C;  1EQR A;  4IPH A;  4HIK A;  1TWA H;  4NB3 A;  2KCM A;  2LXJ A;  1E24 A;  1Y1V H;  4LFB L;  3GTM H;  1SRU A;  4OWT B;  4PG3 A;  4LFC L;  5IWA Q;  4DR7 Q;  1IL2 A;  4IPD A;  4A3C H;  3ULJ A;  4BY1 G;  2AWO A;  4DR4 L;  3CCL A;  3ICE A;  5ELO A;  3EIV A;  2Q2T A;  2UUC L;  2Y0S G;  4GN4 B;  3FKI G;  1UE7 A;  1IBM Q;  3AEV A;  3J80 c;  5GRO A;  1L1O A;  3F2D A;  1GVP A;  4POG A;  2PQA A;  5IYC G;  4KLK A;  1Q8K A;  3PO3 G;  1RL2 A;  1NE3 A;  1KAW A;  4O2D A;  2JA5 H;  1MIU A;  4X6A H;  2EQS A;  3T1Y Q;  1JE5 A;  4A75 A;  3M4Q A;  4DV6 Q;  4X62 Q;  1PYB A;  2VY3 A;  5GAG C;  5M3F G;  4A3I H;  1Q81 C;  3F1Z A;  3UDG A;  3I55 A;  4LF9 L;  2XGT A;  5GQO A;  2R7D A;  3GTK H;  4KHZ A;  1R9T H;  1JB7 A;  3FP9 A;  4JI8 Q;  2MO1 A;  3EN2 A;  1PH5 A;  4APV A;  4JBM A;  4JG2 A;  4B3M Q;  1GO3 E;  1WOC A;  5C4J H;  2OTL A;  1VQH A;  4YCV A;  1CSQ A;  4GLA C;  5J3B A;  3G71 A;  1Y1V G;  4R4C A;  3H3V H;  3RNU A;  1WFQ A;  4DV3 Q;  1VQ9 A;  1YHA A;  2AWN A;  1B7Y B;  4K0K Q;  3K0X A;  4NXM Q;  4A3C G;  1K3R A;  2K52 A;  2Y0S E;  2DGY A;  4B3T L;  2Q2I A;  2PI2 A;  4DV0 L;  1JJG A;  1Q12 A;  4NXN Q;  2NN6 G;  4GNX B;  3J81 j;  4GOP A;  3S14 H;  4GKK Q;  2F3I A;  4BBR G;  1OXS C;  2JA6 H;  5C3E H;  3RLF A;  5HY6 A;  2UU9 Q;  4JOI A;  4L5S A;  4OO1 I;  4DUY Q;  4PZ7 A;  1J5E Q;  1WJJ A;  1EYG A;  2VW9 A;  2Z6K A;  1M1K C;  4O0A A;  3S15 H;  4JI6 L;  4DUZ L;  4OX9 Q;  4YWL A;  4YWK A;  3UE1 A;  1X6O A;  2NZH A;  3HOU H;  2BH8 A;  2MFI A;  4KHP L;  1A62 A;  4A3I G;  2QA4 A;  4J15 A;  1VQF A;  3L7Z C;  2UUB L;  1VQA A;  1EOV A;  1YJ9 A;  2E5L L;  2JEB I;  3K80 C;  4LF8 Q;  4GKJ Q;  4UY8 C;  2MQH A;  3D31 A;  1VQD A;  4POF A;  2VL6 A;  1XMO L;  4UP7 A;  1QZH A;  4WJ4 A;  3CCJ A;  1N8R C;  4AH6 A;  3GTL H;  4C3H H;  3K81 C;  4JBW A;  1IXR A;  2KHI A;  3HOX H;  4DR5 Q;  1YNX A;  4QGU A;  4YWM A;  1HR0 W;  2D0O A;  1XNR Q;  3GTP H;  4LF4 Q;  2ZJP A;  1YJN A;  3DLL A;  3PO2 H;  3CCV A;  1Q46 A;  5IY0 A;  3HOZ G;  1K9M C;  1CKN A;  2KBN A;  1FJG L;  2ASB A;  2VQF Q;  4IOC A;  3CCM A;  2JA6 G;  1Q7Y C;  2A19 A;  2N3S A;  3KF6 A;  3K7A H;  5IYB G;  3GTG H;  5IYD H;  3HOW H;  4DR2 L;  3HKZ G;  3CPF A;  3HOU G;  3KDF B;  3AFQ A;  3F2B A;  1DGS A;  1BKB A;  3RN2 A;  1Y14 B;  5IP9 H;  4HIM A;  1NY4 A;  2DUD A;  1KQS A;  1Y1W H;  4B3R Q;  3CP0 A;  3PGZ A;  5ELN A;  5C0X J;  4OWW B;  1XPU A;  1K73 C;  1OXX K;  4OO1 G;  1Q1B A;  3PUW A;  4QJF A;  5EAY A;  4OWX B;  2GN5 A;  1CSP A;  2N78 A;  4JI5 L;  5C0X I;  4LFB Q;  4BA1 I;  3BZK A;  3RN5 A;  2VZA A;  3ULP A;  1N34 Q;  4JI0 L;  4X66 L;  2ZJR A;  2JJQ A;  3KJO A;  4LFC Q;  2E2I H;  3AYH B;  3S1N H;  1SFO H;  5AJ3 Q;  5JEA J;  1Q1E A;  3M3Y H;  3PUX A;  4L5T A;  5H1S E;  2UUC Q;  3STB C;  1EIF A;  3PO2 G;  1AE2 A;  2OCE A;  4A76 A;  3ER0 A;  4OXP A;  2KEN A;  2R92 H;  1KXL A;  1AE3 A;  3W1G A;  4A3G H;  1PH6 A;  1TWH H;  3ERS X;  1OXT A;  5HGQ A;  3HKZ E;  3KYH C;  2ZTD A;  4GOP C;  3CW2 C;  4R4O A;  4A3D H;  5M5W H;  1D8L A;  5IYD G;  3GD7 A;  3B6Y A;  4EQ5 A;  2OQK A;  1IYJ B;  2NVY H;  1YIT A;  1V9P A;  4X65 L;  4A3M H;  4DPG A;  1XPO A;  1HZB A;  4LF9 Q;  4A3E H;  1C7Y A;  3KOJ A;  1N32 L;  2Z0S A;  2PMZ E;  4MNO A;  2ZM6 L;  3CF5 A;  1KD1 C;  4A3B G;  4P73 A;  5IP9 G;  4DV7 L;  2JE6 I;  5LMU L;  1S72 A;  1I94 L;  2R93 H;  1KL9 A;  4GLX A;  1Y1W G;  5FLM H;  2UXB L;  1UEB A;  2YTX A;  1PH3 A;  3K7U C;  1VQ7 A;  3JC6 6;  4IPC A;  1QUQ B;  3S2H H;  3AFP A;  4LNQ A;  2JA7 G;  1HR0 L;  3OTO L;  3HOY H;  4JI1 L;  1SE8 A;  1VQ6 A;  1NBW A;  4R1J A;  4QIW E;  4C3I H;  4B3T Q;  4BBS H;  4DV0 Q;  3NEM A;  2E2H H;  4HJ5 A;  2VUM G;  1E1O A;  3UE0 A;  1X3G A;  3T1H L;  1C0A A;  2IT1 A;  5E7N A;  3CD6 A;  1A8V A;  4DV4 L;  1SRO A;  1SLJ A;  2ZTC A;  3CCQ A;  2H5X A;  3G6E A;  1NJI C;  5C0X G;  3CAM A;  4A3D G;  2MO0 A;  1HZC A;  2AKW B;  3W5O A;  3HOV H;  4JI6 Q;  3M9B A;  1SN8 A;  1KRT A;  3TEH B;  5C44 G;  4DUZ Q;  1FL0 A;  3KLW A;  5LMN L;  4QL5 A;  5DLQ E;  1LUZ A;  3GTQ H;  4GNX A;  3M4P A;  4A3M G;  1YI2 A;  1GD7 A;  1OXU A;  2FXQ A;  3HKS A;  4A3E G;  1VQP A;  2UUB Q;  2E5L Q;  4A3J H;  5IE8 A;  5JEA G;  1VQI A;  3I4O A;  5BR8 Q;  3UDF A;  4RG1 A;  1HNW L;  1K0R A;  2K75 A;  3Q8D A; 
#chains in the Genus database with same CATH topology
 4JI3 L;  1PH4 A;  2JA6 B;  2HDL A;  4JYA L;  3CCR A;  4P75 A;  3BZC A;  3KJP A;  2B2T C;  2J0T D;  3HKZ B;  2UUA L;  3HOU B;  3J7A 5;  1WCM H;  1VQJ A;  5ELC A;  2NB0 A;  3PF5 A;  3CQZ H;  3QG1 A;  2WB1 G;  4JVZ A;  3Q24 A;  4TRD A;  1GOZ A;  1BDO A;  3P20 A;  2F03 A;  5EKK A;  1HNX L;  4C3H B;  4HMI A;  3HOX B;  5BN5 A;  5KGU A;  2BOS A;  2ENB A;  4K8J A;  4DV1 Q;  2NTT A;  2GVA A;  2L9H A;  4NDX A;  1QIL A;  3OWE B;  1SNM A;  1K8G A;  3KF8 A;  2K4K A;  2TSS A;  1IL8 A;  2JA8 H;  3A0J A;  3HFZ B;  1CA6 A;  1KAB A;  2CVR A;  4DK0 A;  1ROD A;  4HED A;  5IP7 H;  3QOL A;  3PUY A;  4JPB W;  5C3E G;  1I6H H;  1VS0 A;  4H44 C;  5I2Y A;  3VYR A;  5C4X H;  2K33 A;  4A3F H;  2I5L X;  2EPB A;  3PIO A;  2L11 A;  5GAH C;  2EXD A;  1N9W A;  1F2Z A;  3H15 A;  4DV5 L;  2ICI A;  2NBF A;  2VQE L;  1KDB A;  2UU9 L;  1HFN A;  4X65 Q;  2B2T A;  4EQN A;  5KEE A;  4DR6 L;  5IT9 c;  1TII D;  2XSC A;  1E7Z A;  1I94 Q;  4OIJ A;  4A3G B;  1S3O A;  1ICF B;  2WFW A;  2JA8 G;  1EIG A;  1C9O A;  1VQC A;  4IUV A;  1DJR D;  4FYD A;  1SYD A;  3C2P A;  4P74 A;  2OQ0 A;  3HOW G;  1TY0 A;  2KHS A;  3QR8 A;  4N9P A;  2JXM B;  1B8A A;  3BVG A;  4MZ9 A;  4HR7 B;  4CJ0 B;  1V1P B;  5LHY 1;  1STN A;  2SEB D;  1STG A;  5LMN Q;  3PIP 3;  2F52 A;  2E76 C;  3P7J A;  3Q23 A;  4QMG A;  1K8A C;  4RCN A;  4ZQ3 A;  3ULL A;  1UE5 A;  4B9W A;  4NW2 A;  1TXY A;  2QGQ A;  2XWJ B;  3M4Y A;  1PRT F;  5J22 A;  3CC2 A;  4C2M H;  5IIF A;  3GTQ B;  1NMG A;  1Z47 A;  4HAE A;  1PRT C;  2IJ0 A;  1E1T A;  4JI2 Q;  2WV6 D;  5AJ3 L;  1PVO A;  4DN4 M;  1CTM A;  1Y69 U;  1XTC D;  3MZ5 A;  2A6H D;  1TWF B;  3PSI A;  4QUC A;  1PFN A;  1KNA A;  3I7F A;  2EIF A;  2Z4I A;  2F0H A;  2F0E A;  5I6W A;  2QF7 A;  1NMF A;  1LT5 D;  4HJ8 A;  2E2J H;  4NMZ A;  1B9M A;  2BA0 A;  3TRZ A;  4HCS A;  5JVG 3;  1ZYR C;  1HRJ A;  1W3S A;  1F77 A;  4QB4 A;  2R61 A;  3SK6 A;  4BBS G;  4UP8 A;  4R4I A;  4K6D A;  2AQ3 B;  1BOS A;  4AQY Q;  1RKN A;  1JQY D;  1X3F A;  1CT1 D;  5EBC A;  3SGI A;  3VR3 A;  2JN4 A;  3NTI A;  2KQ3 A;  4HJ7 A;  4RKL A;  4S3S A;  1DD2 A;  2D0P A;  2LFN A;  1M4V A;  4N8X 1;  2HIV A;  3DXJ C;  1EFI D;  3QJY A;  3A56 A;  5EKI A;  5M3M B;  1HQR D;  3HG9 A;  2F0M A;  3K59 A;  2HCI A;  5D14 A;  4ALP A;  4DV6 L;  1XNQ Q;  2OWO A;  1TS2 A;  3I3C A;  1DZ1 A;  3ND9 A;  2BE5 D;  1YIJ A;  1PTO F;  3AQQ A;  4JI5 Q;  4Y7N B;  1X55 A;  2D62 A;  4Q5V A;  1SE3 A;  5IGE A;  5C5M A;  1WTP A;  3U4V A;  1IW7 C;  1HNZ Q;  1GHJ A;  1X9N A;  4YCW A;  3WOF A;  5E4X A;  3K57 A;  3CMA A;  4K0K L;  1TQO A;  3D4D A;  1W2B A;  1YBY A;  2CWP A;  4ULL A;  4NXN L;  3F2C A;  2F4I A;  3MWY W;  3T4A C;  2IX3 A;  1PH1 A;  1PH7 A;  4K2K A;  1TWG B;  2ES2 A;  1IBL L;  3BDC A;  4HJ9 A;  3SK5 A;  3JAM c;  1RTO A;  3CRK C;  3I4N G;  2F4V L;  3NUC A;  1L1O C;  1N36 L;  1CKM A;  2RQX A;  3UDX A;  1VQB A;  3J80 L;  2VB2 X;  1PZI D;  3A5U A;  4KY5 A;  4LF8 L;  2M00 A;  4YHH Q;  4GKJ L;  3BYT B;  4XQJ A;  1B3A A;  2QEJ C;  2DNC A;  4BY1 H;  4GN5 A;  4DV4 Q;  2WII B;  2XTI A;  3T51 B;  2D9U A;  1BVS A;  3FKI H;  3L2P A;  1QZG A;  1LAB A;  5M3F B;  3RMH A;  1SMY D;  2NWG A;  2XNA C;  3DUZ A;  1BCP B;  1E2Z A;  2RHS B;  3PO3 H;  1BXT A;  1XMQ Q;  3I2Z A;  4PV1 C;  3J81 E;  1XWE A;  3OOC A;  2UXD L;  1SJH D;  1KTK A;  3DM1 A;  4B3S Q;  1NSN S;  1HTL D;  3J81 c;  4JI3 Q;  2OF1 A;  3I73 A;  5C44 H;  2KHJ A;  1G6P A;  4A93 G;  2G5D A;  4XTC S;  4LF7 Q;  1SYC A;  3OYY A;  3TP7 A;  2PPB C;  3NTK A;  1SNP A;  2KCM A;  1MBY A;  4LFB L;  1FNV A;  3S1M B;  2LMC B;  4BBR B;  3MXN A;  4BY1 G;  4K8I A;  1TS3 A;  3EIV A;  1IBM Q;  3FKI G;  2EY6 A;  1L1O A;  3S2D B;  3PO3 G;  1EY0 A;  1I4Q A;  3KLS A;  4K5W A;  3T1Y Q;  1WD0 A;  2EYH A;  4KJN A;  4KD4 A;  1PYB A;  5FKA C;  2R7D A;  3FMC A;  4KHZ A;  1R9T H;  1EY9 A;  5ELF A;  1A3V A;  3FP9 A;  3EN2 A;  4JG2 A;  1WOC A;  2OTL A;  1LTT D;  1CSQ A;  3N6R A;  4GLA C;  3S16 B;  3G71 A;  4IZ8 A;  3RZO B;  2K52 A;  4F8M A;  1JJG A;  2PI2 A;  1Q12 A;  3NK9 A;  2K1B A;  1BF4 A;  3S14 H;  1EZ8 A;  2F3I A;  4H0L C;  2JA6 H;  4L5S A;  5HY6 A;  2UU9 Q;  1CFM A;  1HQM C;  1JOK A;  4PZ7 A;  1J5E Q;  1EYG A;  2N55 A;  4JI6 L;  2F0L A;  1SAP A;  1TT2 A;  1AP0 A;  4OX9 Q;  2EYO A;  3HOU H;  4YWK A;  3UE1 A;  4RGO S;  1K3B C;  1A62 A;  1EU3 A;  3HGB A;  2UUB L;  5IGC A;  1YJ9 A;  2R7Z B;  1U4P A;  3K80 C;  1F2L A;  3S1R B;  3F2U A;  2PW5 A;  2EDG A;  1VQD A;  3TSS A;  1RTN A;  5EKL A;  1XMO L;  4UP7 A;  3VYS A;  1NUC A;  3CCJ A;  4C3H H;  3K81 C;  1C48 A;  1SNQ A;  4JBW A;  3HOX H;  4QGU A;  2D0O A;  3DLL A;  4RGN A;  4XYO A;  1CKN A;  2JA6 G;  1Q7Y C;  4A3B B;  3KF6 A;  1TWC B;  3HKZ G;  3HS0 C;  3HOU G;  3J7Y W;  5IOC A;  1EEF D;  1DGS A;  1BKB A;  4EGV A;  2JA7 B;  5IP9 H;  4DXF A;  2Y0S B;  3C1E A;  5D3I B;  1O7L A;  5C0X J;  1G91 A;  4K5X A;  1K73 C;  1Q1B A;  3NQT A;  2VUM B;  4C1N I;  1CSP A;  1ET6 A;  2N78 A;  3TDQ A;  2FIN B;  3BZK A;  4FF3 A;  4LFC Q;  4X66 L;  2ZJR A;  1DXM A;  4C3H G;  3KJO A;  5AJ3 Q;  1ESF A;  4L5T A;  1Z6H A;  2G9H D;  3STB C;  2OCE A;  5C4Z A;  1KXL A;  3W1G A;  4A3G H;  1PH6 A;  3ERS X;  1TWA B;  5HGQ A;  3KYH C;  2ZTD A;  1SNO A;  1D8L A;  3O13 A;  3GD7 A;  3E5S A;  3B6Y A;  1O7Y A;  1V9P A;  4X65 L;  4BS9 A;  4DPG A;  1XPO A;  1C4Q A;  1HZB A;  3CF5 A;  1NR2 A;  5IP9 G;  4HCE A;  2JE6 I;  1I94 L;  3H09 A;  1GUO A;  2EY1 A;  1PH3 A;  4IPC A;  1QUQ B;  1CI3 M;  1EEI D;  2ZXP A;  1A6X A;  1SND A;  1U4M A;  1EY4 A;  4G7O C;  4NP5 A;  2RBM A;  4IUQ A;  2A6E C;  4ID6 A;  3U9O A;  4DV0 Q;  4HJ5 A;  1E1O A;  3UE0 A;  1WD1 A;  2LY7 A;  2ZTC A;  3CCQ A;  3RD4 A;  5C0X G;  3GV3 A;  4DFA A;  2MO0 A;  2AKW B;  3W5O A;  1PYW D;  3TEH B;  1W6J A;  1KRT A;  2X69 A;  3KLW A;  3MFY A;  5LMN L;  1FNW A;  1LTB D;  4QL5 A;  3HRZ C;  3T16 A;  3GTQ H;  4GNX A;  5G3L F;  5K36 H;  1GD7 A;  2E5L Q;  5IE8 A;  1HA6 A;  1S5C D;  3UDF A;  1HNW L;  1NTG A;  3MAQ A;  1TWF H;  4GLV B;  4ABN A;  2CH4 W;  2IY5 B;  1PTO D;  1OXV A;  2F1M A;  1Q90 A;  5COR A;  1TR5 A;  3WWV A;  1YNJ D;  3QIA A;  4Z9C B;  5CV4 A;  3SEB A;  1VQN A;  1KC8 C;  3K5M A;  1VQO A;  2JA5 G;  4JI2 L;  4DR7 L;  2PMZ B;  1IBL Q;  4QY7 A;  4HN7 A;  3CXC A;  1GXD C;  2F4V Q;  5LL6 S;  4HSP A;  2DY7 A;  4AIM A;  1N36 Q;  1SBB B;  2YV5 A;  2FMM A;  4JBJ A;  3ITP A;  3GTL B;  4RFB A;  2Z9H A;  3D4R A;  2E8G A;  1Y8O B;  2PCF B;  5K36 G;  2RCN A;  3R2T A;  1SXT A;  2GVB A;  2HUG A;  4B9X A;  1VQ4 A;  1A3T A;  1SYE A;  1SR3 A;  1A0I A;  1TS5 A;  5M3M H;  3DWA A;  3TRE A;  3TQY A;  2LSS A;  4RHS A;  3MHB A;  4TKO B;  2WAQ B;  1ICW A;  4AQY L;  1FVI A;  3I91 A;  1LTL A;  4Y7N H;  1ZEQ X;  2I5M X;  4AYB B;  5I9P A;  3A74 A;  2UXD Q;  4DKA C;  2CW0 D;  2D5D A;  4DAM A;  1EIH A;  1X3Q A;  1EU4 A;  3DM3 A;  4DF7 A;  1XNQ L;  3M7G A;  4RCO A;  2ZJQ A;  3RLO A;  4KTA A;  2E2I B;  1YHB A;  3S1N B;  3OW2 A;  1SFO B;  1E2V A;  2K5D A;  4P72 A;  4KD3 A;  3P1H A;  4ME3 A;  3I8Z A;  2R92 B;  3IRB A;  4BWG B;  3EJI A;  2ZTE A;  4ZK9 B;  3T56 B;  5M3M G;  1TWG H;  1HNZ L;  4JI1 Q;  5M5W B;  2X6L A;  4RKB A;  4XQQ A;  5JJK A;  3DMU A;  3E0J A;  4PMC A;  1KIX A;  1LM0 A;  3LX0 A;  4OEL B;  4KKT A;  5LL6 X;  3M85 A;  5DNF A;  5NUC A;  2L15 A;  2OXP A;  4CGY B;  1KLU D;  3HOY B;  3BJU A;  1UWV A;  2PNH A;  1ML0 D;  2N49 A;  1BO0 A;  3I56 A;  3N52 A;  5M3F H;  1SMX A;  1ESR A;  4YHH L;  2MNA A;  2XVS A;  4PZ6 A;  4CBV A;  4DAY B;  4O1N A;  3OPO A;  3HOV B;  2D2C C;  5C3W A;  4C56 C;  5JOB A;  3G4S A;  4JV5 Q;  3PV0 A;  3WDN A;  3U50 C;  1QWY A;  2WAQ E;  2F3W A;  3BDL A;  5FLX L;  2AQ2 B;  2I0Q A;  4DNI A;  5I2X A;  4WFN 3;  2VNU D;  4JI7 Q;  1XMQ L;  2NN6 H;  4AYB E;  3S1M H;  1HXY D;  4BBR H;  1D7Q A;  1I4G A;  1N33 Q;  4IUT A;  1PH2 A;  2LXK A;  2R93 G;  2FMC A;  4B3S L;  1XPR A;  2B2Y C;  2WP8 J;  1DYQ A;  4PZ8 A;  4EVO A;  3DHQ A;  1IZ6 A;  3G6J B;  3DWP A;  1TKW B;  1G51 A;  2CH4 A;  1XMO Q;  4LF7 L;  3FEW X;  3S2D H;  3NPP A;  4DNR B;  4FNF A;  2AUK A;  1HH2 P;  4G7Z C;  3TS2 A;  5FJ8 H;  1X3P A;  2PQA B;  4V0B A;  3F8T A;  5C4H A;  1VQ5 A;  4R4Q A;  1PHJ A;  1RIP A;  1FNU A;  1IBM L;  3HP3 A;  3E9I A;  2JYO A;  2B63 B;  3I4M B;  3W1B A;  1HUM A;  3S16 H;  4JBK A;  4G4K A;  4KN4 C;  3T1Y L;  3TP5 A;  4KJO A;  5JJL A;  3IFD A;  3RZO H;  1CQF A;  5IYB H;  2ZT9 C;  4JI4 Q;  1D2B A;  3KDF A;  1H9R A;  4X66 Q;  2B3G A;  3PMF A;  1PYS B;  4GOP B;  2RHQ B;  4X3K A;  1IBK Q;  3CC7 A;  1WCM G;  5TSS A;  5FJ8 G;  4J1M A;  4LFA Q;  1Q82 C;  3DEP A;  5KNB A;  4Q0F A;  1I4P A;  3R2I A;  2IX0 A;  2IWH A;  3ERO A;  3BYY B;  3Q22 A;  2R7Z H;  2Z1C A;  4QF4 A;  1SEB D;  3BDO A;  1TY2 A;  2F0T A;  4ODG A;  2B2Y A;  3STB D;  4R8I A;  3TS0 A;  1MSG A;  2HQL A;  3S1R H;  1MSH A;  4A3K B;  3H91 A;  2MP1 A;  1IKL A;  1LYL A;  2V1C C;  1J5E L;  4KN7 C;  1K8O A;  2R6G A;  1GKH A;  1QNU A;  1VQM A;  4OX9 L;  4DGZ A;  3T13 A;  3GTO B;  3TZD A;  1E0B A;  5C3X A;  2PZT A;  1JJ2 A;  1J8I A;  1X65 A;  2CQA A;  3OIQ A;  3KF8 B;  2MUY A;  1V1P A;  4LUV A;  4A3B H;  1FR3 A;  3S1Q B;  4DK1 A;  2DJG C;  5LMN W;  4XT1 B;  4ZRZ A;  4CJ1 B;  5IP7 G;  1TWC H;  3M4O B;  4CKB A;  3PUZ A;  2KJX A;  5C4X G;  2A73 B;  4I65 A;  3OWF A;  4A3F G;  2JA7 H;  3LGJ A;  1QVC A;  3D8G A;  1WTV A;  1E3P A;  2A6E D;  5CC4 A;  2R7Z G;  1KHI A;  2R7F A;  2HHH L;  5ELB A;  2CQO A;  3H0G B;  2VUM H;  2X6G A;  4CDD C;  3L9A X;  2QCP X;  1I4H A;  1JMC A;  2SOB A;  2JQO A;  2IHE A;  2K6A A;  4RWS C;  1HNW Q;  3VYU A;  2UXC Q;  4HID A;  3Q6S A;  4GZY C;  2JK8 A;  2NN6 I;  5EGT A;  3NE5 B;  4WJ3 M;  3ZYY X;  1U0L A;  2Z6K C;  1EQR A;  1TWA H;  4NB3 A;  5G3L D;  3FVQ A;  2B2W C;  2KEE A;  1R4P B;  4OWT B;  4LFC L;  5IWA Q;  2L4N A;  4DR7 Q;  4A3C H;  3ULJ A;  3J80 E;  5T1I A;  1GUS A;  2AWO A;  4K14 A;  2Y0S G;  4GN4 B;  3AEV A;  1K28 A;  1O78 A;  1UUP A;  1Y8N B;  3J80 c;  4A3I B;  4P2C B;  4KLK A;  1Q8K A;  5DM6 3;  1RL2 A;  3P75 A;  1R4Q B;  1MIU A;  2EQS A;  1K8M A;  1LTR D;  3VA5 A;  3MFG A;  1K83 B;  5IGG A;  4A75 A;  1S5E D;  3VR6 A;  3H3V I;  4KK7 A;  2Z4H A;  3I55 A;  1GHK A;  5GQO A;  1JR0 D;  5IGB A;  1AN8 A;  4RGM A;  1PH5 A;  4APV A;  2ZXO A;  1GO3 E;  3DEO A;  4YCV A;  3HOZ B;  5J3B A;  2QDL A;  5L37 A;  5EJW A;  2PZW A;  3SDZ A;  1RDP D;  1NNX A;  1YHA A;  2AWN A;  1B7Y B;  2EXZ A;  3K0X A;  4A3C G;  3A7A B;  3MXP A;  2HD3 A;  2Q2I A;  4DV0 L;  1EY7 A;  4L63 B;  4L6T B;  4CDF C;  3EQL C;  3J7A V;  1WJJ A;  2Z6K A;  5FOB B;  4O0A A;  1M1K C;  3X3N A;  4ZAI A;  1G2T A;  4YWL A;  2G9D A;  1LAC A;  2M9V A;  2BH8 A;  2B2W A;  1MI2 A;  4LK1 C;  1VQA A;  2E5L L;  2PO4 A;  2JEB I;  4B08 A;  1PXU A;  1X32 A;  4UY8 C;  2MQH A;  3D31 A;  4ZLT F;  4J6H A;  2VL6 A;  1QZH A;  3GTL H;  2HCC A;  2CCZ A;  1IXR A;  4DR5 Q;  1YNX A;  4YWM A;  3JAM E;  3CCV A;  4G57 A;  1NCV A;  3K58 A;  2HQE A;  1FJG L;  4IAL A;  2VQF Q;  2A19 A;  2KUM A;  5M5Y B;  3FPU B;  4DNT B;  5IYD H;  3OHX C;  2EZV A;  2MGS A;  3AFQ A;  1Y14 B;  1NY4 A;  2NVQ B;  1H9S B;  4B3R Q;  3PGZ A;  5ELN A;  4OWW B;  1OXX K;  1I3Q B;  3MTS A;  3S9W A;  4OWX B;  2L5T A;  3RN5 A;  4FP5 D;  2VZA A;  2E2I H;  3S1N H;  1SFO H;  3C1F A;  2F3V A;  1TVX A;  5H1S E;  2UUC Q;  2R92 H;  2KOL A;  3VR5 A;  1I50 B;  5EPJ A;  3SXH A;  3C46 A;  1JOQ A;  1F9S A;  4IFD H;  3CW2 C;  4R4O A;  3D3R A;  5M5W H;  5IYD G;  3GTM B;  2E74 C;  2M2L A;  1IYJ B;  1YIT A;  4LF9 Q;  1C7Y A;  3KOJ A;  4MNO A;  1KD1 C;  1W6K A;  1S72 A;  1CZG A;  3SE0 A;  5JJZ A;  3MVV A;  1ZKO A;  3AMU A;  5FLM H;  3JC6 6;  2E2H B;  1HR0 L;  3HOY H;  4JI1 L;  2RDH A;  1JOR A;  2WB1 B;  2WAC A;  1SE8 A;  1NBW A;  4R1J A;  3I4L A;  4QIW E;  4B3T Q;  4N8F A;  4WRD A;  3NEM A;  1C8C A;  1HFG A;  2F0D A;  5KND A;  3GTK B;  1X3G A;  3URY A;  2IT1 A;  1SLJ A;  2H5X A;  1PTO B;  3G6E A;  3HZX A;  5C4J B;  3HOV H;  5CV8 A;  1DOK A;  2GA4 B;  5C44 G;  1SE4 A;  5DLQ E;  2F0N A;  3M4P A;  2FXQ A;  3HKS A;  4MTK A;  5CV9 A;  1VQI A;  4N9T A;  2BDN A;  1K0R A;  1EZ6 A;  2K75 A;  1WI5 A;  2KA7 A;  4HIO A;  5C3E B;  2A5H A;  2A1A A;  3U58 A;  1L1O B;  4JV5 L;  3S24 A;  2RVL A;  2FJ2 A;  1KDA A;  3VR2 A;  4JI7 L;  3W3A A;  2F0P A;  2JP1 A;  3HOV G;  1QVF A;  1WTH A;  5E1F A;  1N33 L;  5EPK A;  4HMJ A;  1VDZ A;  5A35 A;  2A8V A;  2WKC A;  4DXG A;  2K50 A;  4IUN A;  1I5F A;  1LT3 D;  4XDX A;  4X62 L;  1ENF A;  2B63 H;  3I4M H;  4IJH A;  2C35 B;  4ZUJ A;  2EE1 A;  3K7A B;  4FXK C;  1STA A;  3K5N A;  2L0C A;  3HOW B;  2HIX A;  3R93 A;  1B2T A;  2HHH Q;  2K7V A;  2OEO A;  4ZCK A;  2WB1 E;  2Q2U A;  1V1Q A;  1Y1W B;  4NXM L;  1F9Q A;  1O7I A;  4CHT B;  4A3L H;  4QQB X;  4PQX A;  1AH9 A;  3PIP A;  2QEX A;  2CFM A;  4JCV E;  2AMC B;  1ASY A;  1VQL A;  1MJC A;  4RGT A;  3JAM i;  2O4X A;  4JI4 L;  1BBX C;  2I5H A;  3OSO A;  3NBH B;  2HT1 A;  3M3Y B;  3FHW A;  1KNE A;  3C3L A;  4WOR A;  4GNX C;  4IFD I;  2MJ8 A;  4A3K H;  2UXB Q;  2B63 G;  4BXX H;  5M9O A;  4DA2 A;  1IYV A;  3HOX G;  5CR3 A;  1CKO A;  1IBK L;  1YZ6 A;  3OTO Q;  3IL8 A;  5IT9 E;  3KLS X;  2NZO A;  1FGU A;  1PRT D;  4LFA L;  3GTO H;  2K5V A;  2LS0 1;  1NAP A;  3NSW A;  3CCE A;  5JPM C;  4A3M B;  2K28 A;  3ERQ A;  2F0W A;  4K2L A;  1Z7T A;  1YEZ A;  5HUR A;  1VMC A;  3S1Q H;  1D5M C;  4LF4 L;  2C5C A;  2EYL A;  2K5Q A;  3BZD B;  5A2Q L;  4Y52 H;  4A3L G;  1Z9F A;  1E22 A;  2FHT A;  3GDE A;  3S2H B;  3M4O H;  1CZW A;  1HHV A;  5F2D A;  3PIO 3;  2IX1 A;  2Q8T A;  5IYC H;  3H6M A;  1L0W A;  4C3I B;  3D0F A;  4BBS B;  2RSO A;  2XRS D;  3J81 i;  1B44 D;  1ZYR D;  4KY7 A;  3H0G H;  5D3D A;  1LV9 A;  2NYZ D;  2IPK D;  2Q8I B;  5JAV A;  3SR1 A;  3W2D A;  3NQI A;  3GP7 A;  1V8Q A;  1MJE A;  3LWU A;  4A3G G;  3TP6 A;  4FXG C;  1XJV A;  2PI2 E;  1N34 L;  2PQE A;  4DV2 Q;  1EY8 A;  4A3J B;  3UDI A;  4OGQ C;  1UNS A;  1YVC A;  1VQ8 A;  2RKS A;  1HZ9 A;  1SJE D;  4FDB A;  3VR4 A;  4LF6 Q;  1ENC A;  4IO9 A;  2EYP A;  4UDU C;  2AHO B;  2EOT A;  4DR3 Q;  1SSO A;  4MHE A;  2UXC L;  4OL7 A;  5IOD A;  4ZKC B;  2O2L D;  3DWQ A;  1PDQ A;  4MIU A;  1IW7 D;  2Z6B A;  3H0G G;  4GS3 A;  1ONL A;  4LWC A;  3NBI A;  4U68 A;  1QVG A;  1K83 H;  1QE6 A;  3D4W A;  3U4Z A;  5IWA L;  1MKH A;  3S17 B;  1PH9 A;  4LF5 Q;  1IKM A;  4UHV A;  1FJG Q;  3RR5 A;  2NVT B;  4RAU C;  1PV4 A;  2ZXR A;  1KDC A;  2A74 C;  1HPC A;  1STH A;  1B9N A;  1VCI A;  3I4N B;  2RSN A;  3A8K E;  1X3E A;  2EVB A;  4ZYS A;  3HOZ H;  1T5X D;  5KYL A;  1EQQ A;  2EYM A;  2AQ1 B;  3NP8 A;  1D1I A;  2NZ1 D;  4KI0 A;  3RZD B;  1XTD A;  4RH6 A;  3NEL A;  4DR1 Q;  5FLX E;  3EFX D;  4V19 0;  5GAD C;  1U5K A;  4L5Q A;  4PMW A;  3U9S A;  1EIY B;  1Q86 C;  5I6Y A;  4BY7 B;  3M7N A;  1D1K A;  1YJW A;  5FLX c;  4BA2 I;  2ICE C;  3NWS A;  3UI2 A;  5BR8 L;  3V2T A;  1X56 A;  2B39 A;  3L0O A;  4OO1 H;  2K04 A;  4X64 L;  4LMQ D;  3D6C A;  4CKC A;  1CQV A;  4XYQ A;  1G6Z A;  1II3 A;  3A8I E;  3E9H A;  2K5H A;  2F0F A;  4KV6 A;  1UAP A;  1VQG A;  5D65 A;  3AB9 A;  4A93 B;  1H9J A;  1PLF A;  1RCV D;  3J7Z C;  4UAI A;  3PCO B;  5KYI A;  4CDE C;  3A5Z B;  2SDF A;  1HR0 Q;  2BE5 C;  1EWI A;  5M5Y H;  1ASZ A;  2JEA I;  1Q3L A;  3CC4 A;  4DR5 L;  3GV6 A;  4M8A A;  4FF4 A;  2BH2 A;  1U4L A;  3GTJ B;  3CCU A;  2MPM A;  2NVQ H;  3EA6 A;  1WTX A;  2KCC A;  1QCB D;  2NTS A;  4LUO A;  4DAY A;  1B1Z A;  1I3Q H;  2VQF L;  4RHR A;  4GN3 B;  3TME A;  1JWM D;  4KHV A;  4KMU C;  4DK6 C;  4YY3 Q;  1D6E C;  1RD9 D;  5CYU A;  5E3F A;  1H95 A;  3GO5 A;  4NPS A;  3G48 A;  4B3R L;  1I50 H;  4IPH A;  4HIK A;  2TMP A;  1E24 A;  1A15 A;  2RA4 A;  3GTM H;  1ET9 A;  3PQI A;  1IL2 A;  4IPD A;  1GJX A;  2K32 A;  4DR4 L;  3CCL A;  3ICE A;  2B2U C;  3QWN A;  5ELO A;  2UUC L;  2I07 B;  1UE7 A;  1CK1 A;  4EQO A;  1EYD A;  3F2D A;  4POG A;  1QJO A;  2PQA A;  1IHZ A;  1TS4 A;  1NE3 A;  5EQ0 A;  3OMC A;  3BS1 A;  1WVL A;  4X6A H;  2C9O A;  5ISR A;  3M4Q A;  4X62 Q;  2V4D A;  2VY3 A;  5GAG C;  5M3F G;  1Q81 C;  3F1Z A;  4LF9 L;  2XGT A;  3WOE A;  4FF1 A;  3FRP B;  3GTK H;  4JI8 Q;  2MO1 A;  2YU9 B;  3A54 A;  3A55 A;  4JBM A;  4B3M Q;  4H13 C;  1PTO H;  1XXG A;  5C4J H;  1RJT A;  2H1E A;  1VQH A;  4FF2 A;  1O7Z A;  1QOH A;  2XWB B;  3H3V H;  3I90 A;  1WFQ A;  1VQ9 A;  4NXM Q;  3SVM A;  1K3R A;  1AFP A;  1LT6 D;  4B3T L;  3OW7 A;  2NN6 G;  3TBI B;  2KCN A;  5BN3 A;  4GKK Q;  5FO7 B;  4GOP A;  4BBR G;  1YNN C;  5C3E H;  1HCZ A;  2DNE A;  4OO1 I;  4DUY Q;  3IAY A;  2VW9 A;  2DJF C;  4HTH A;  4I7Z C;  2RDF A;  2NZH A;  4KHP L;  1AEX A;  2MFI A;  2SNM A;  3MA2 B;  2QA4 A;  2NVX B;  4J15 A;  1VQF A;  1Q8I A;  3LNN A;  1EOV A;  2Z8L A;  3QOJ A;  4C3J B;  4X3U A;  2A69 C;  4HSV A;  2B2U A;  2FFK B;  3EVQ A;  1AW7 A;  4POF A;  3A7L A;  4WJ4 A;  1N8R C;  3ONA B;  3MXU A;  1EWC A;  1BR9 A;  1G8Z D;  4AH6 A;  1PZJ D;  1KAA A;  2KHI A;  3CU7 A;  2N88 A;  1XNR Q;  2XIW A;  4LF4 Q;  1YJN A;  1Q46 A;  2E2D C;  2QKI C;  5IY0 A;  2ASB A;  1DOM A;  3CCM A;  3K7A H;  4QUF A;  1EWH A;  5IYB G;  2F0V A;  4JW0 A;  3HOW H;  1CHP D;  3CPF A;  1WTQ A;  3KDF B;  1EYC A;  3F2B A;  3MEH A;  3RN2 A;  5COY A;  1BUV T;  1Y1W H;  1AZQ A;  1JB3 A;  1PFM A;  3K5L A;  3PUW A;  4QJF A;  2GN5 A;  2H4O A;  3AU7 A;  4BA1 I;  4RA8 A;  1N34 Q;  2Q8R E;  2K03 A;  1Q1E A;  5ELD A;  3M3Y H;  1XX8 A;  3FDT A;  2PW7 A;  5M5X B;  4A76 A;  3ER0 A;  1B53 A;  4OXP A;  2KEN A;  1AE3 A;  4XQN A;  3HKZ E;  1QG7 A;  1F2M A;  3OMG A;  1Y1V B;  4R8N A;  1D5X C;  4ME5 A;  4A3M H;  2Z0S A;  1IYU A;  4A3B G;  4P73 A;  4YIJ A;  2BCO A;  1Y1W G;  2UXB L;  2YTX A;  4JK1 C;  3S2H H;  1JC7 A;  2XN9 C;  4LNQ A;  2O5I C;  2JA5 B;  2JA7 G;  3OTO L;  1ILQ A;  1VQ6 A;  4C3I H;  4BBS H;  1DCZ A;  2RCF A;  2VUM G;  1LO5 D;  3T1H L;  4XT3 B;  5E7N A;  3CD6 A;  1A8V A;  5CV6 A;  3TZU A;  4ILW A;  2J7Z A;  5J1Z A;  5DEH A;  4U67 3;  4F7X A;  1NJI C;  1CA5 A;  5I4D A;  3CAM A;  3R8B A;  1HZC A;  4DUZ Q;  1VF7 A;  1FL0 A;  1LTA D;  5KNC A;  1F9P A;  4A3M G;  1EQV A;  1BCP F;  1VQP A;  3R3O A;  2EY2 A;  4A3J H;  1SDF A;  5BR8 Q;  3QB3 A;  5FO8 B;  2A68 C;  1G2S A;  1BCP C;  2VXW A;  4X64 Q;  1MHW C;  4TVA B;  1A2T A;  5CMD A;  3S15 B;  1FGB D;  2HDM A;  2F0K A;  3SK8 A;  5IT9 L;  4C3I G;  3L3O C;  4DV2 L;  2JA9 A;  4TQU S;  2I46 A;  4ZUI A;  1WTO A;  4RMF A;  1SYB A;  1H9K A;  3K5O A;  4LF6 L;  4DR2 Q;  1QNK A;  3S17 H;  3VDY A;  1STB A;  4DR3 L;  3NEN A;  2L12 A;  2NVT H;  3GTP B;  2IW3 A;  3IFT A;  4IJL A;  4QIW B;  4A3J G;  3E3X A;  4DU9 A;  3PO2 B;  3I4N H;  3CCS A;  3T53 B;  2LKV A;  1J6Q A;  1LTS D;  3GTG B;  1JE4 A;  4UPA A;  1STE A;  1MGS A;  4JI0 Q;  3RZD H;  5JJI A;  4LF5 L;  1PTO C;  2F0S A;  1H9S A;  3VA7 A;  4H02 A;  1EFW A;  4BY7 H;  1YNJ C;  3H3V C;  4DV3 L;  1SE2 A;  3EBE A;  1J9O A;  4FVM A;  1GUN A;  5EBD A;  3K0Y A;  2KED A;  4IQZ A;  1PRT B;  5CV5 A;  1XYI A;  1N32 Q;  4MTN A;  1WTW A;  2JSO A;  4IFD J;  4DR1 L;  2ZM6 Q;  2EJM A;  1UE6 A;  4DV7 Q;  5LMU Q;  2BDO A;  5J39 A;  2IHF A;  4EQP A;  2BA1 A;  1PMR A;  4XXE A;  5FO9 B;  2KEC A;  1CUK A;  2CHB D;  1TWH B;  2F0Q A;  4A93 H;  1AZP A;  4DR4 Q;  1I6V C;  1M90 C;  2OTJ A;  4A3D B;  4OIK A;  3PF4 A;  2ATW A;  1X54 A;  2K5N A;  2NVY B;  4R9W A;  1G29 1;  3E0E A;  4LW1 A;  2PZU A;  4A3E B;  1GM5 A;  4BY7 G;  2B8G A;  2R93 B;  1JJC B;  1EY5 A;  4UP9 A;  3SHL A;  5CBE E;  2WAQ G;  1TU2 B;  4JC0 A;  1UE1 A;  3MXG A;  3OIP A;  2Q2H A;  2CW0 C;  4AYB G;  4I7A A;  5GAE C;  1S40 A;  4P71 A;  3GTJ H;  2IL8 A;  3KBX A;  3V05 A;  3NWT A;  1V1O A;  2QW7 A;  4EX5 A;  3MEF A;  4C1N K;  4JYA Q;  2KCT A;  3I70 A;  4PMB A;  2UUA Q;  4IPG A;  1Y8P B;  4OHJ A;  2R92 G;  1HJP A;  1B70 B;  5DAU A;  4X3S A;  1D5Z C;  1BQQ T;  4F87 A;  4IFD G;  1HZA A;  1ENA A;  2YYZ A;  3CME A;  2CWA A;  2CKZ B;  1LLR D;  3J80 i;  3BU2 A;  3RLN A;  4KHP Q;  4E6I A;  1VQK A;  1YNN D;  2PNR C;  1SYF A;  2K5W A;  5KIX A;  4XIG S;  1WYD A;  1HNX Q;  2P5Z X;  1F9R A;  4CJ2 C;  5IGD A;  5K5P A;  4NKL A;  4YY3 L;  4DAP A;  5FLM G;  1JCK B;  1WCM B;  3E6Z X;  5IGF A;  4LUZ A;  3MXN B;  5A2Q E;  1SYG A;  3CQZ B;  3HOY G;  2A69 D;  1P16 A;  1SNC A;  3FPP A;  4IOA A;  1P8L A;  4F88 A;  5I9O A;  3JAM L;  1T9H A;  2F0J A;  1I4R A;  1VQE A;  1GUT A;  4K5V A;  2YU9 H;  2OT2 A;  2EYF A;  3CRL C;  5JPN C;  4L5R C;  1B4O A;  1ILP A;  1PZK D;  1U4R A;  4DV5 Q;  2JA8 B;  5AFW A;  1BBW A;  2VQE Q;  1H9M A;  4OON A;  1K0S A;  2DY8 A;  4DR6 Q;  1ZXT A;  1EUJ A;  1S5F D;  1PH8 A;  1I6H B;  4JI8 L;  2NUC A;  5C4X B;  4A3F B;  4L8J A;  4MN3 A;  1OO9 B;  4X3T A;  5CGK A;  4B3M L;  4IUP A;  3NXW A;  3Q0A A;  3VYT A;  1OTC A;  2WIN B;  2RDG A;  3NBH A;  1S4Z A;  3ND8 A;  3J81 L;  2NVX H;  2VB3 X;  2EJG C;  1LTI D;  1S5B D;  2K01 A;  5FK9 C;  4C3J H;  1T5E A;  4GKK L;  2VS1 A;  1JT8 A;  2YTY A;  4R4T A;  1HUN A;  1BBU A;  4DUY L;  2YTV A;  1A63 A;  1PFS A;  2ALY B;  1EOT A;  5T1G A;  2PYK A;  3I4M G;  1V43 A;  5C5L A;  2AUJ D;  1U9R A;  1DM0 B;  2EJF C;  4K6L A;  1L2F A;  1CKN B;  1BNZ A;  4YCU A;  1STY A;  2EYJ A;  2F0U A;  1NR4 A;  4A4I A;  4DV1 L;  1QB5 D;  3T1H Q;  3KF6 B;  1UEA B;  1QUQ A;  3CPW A;  2K14 A;  3KUP A;  1XNR L;  2ID0 A;  1KRS A;  2O5J C;  1RF2 D;  4C3J G;  2B29 A;  5ELE A;  2RF4 A;  3PUV A;  2F0O A;  3H94 A;  3K8A A;  5E4W C;  4DK3 C;  3ZJY C;  1PA6 A;  1LT4 D;  5CBA E;  1JOO A;  4HJA A;  1S5D D;  1M8A A;  2N8N A;  5C6A A;  4DAV A;  5CV7 A;  4C2M B;  5C0X H;  1JWS D;  4A3K G;  2SNS A;  3I72 A;  5M5X H;  4BXX G;  4JOI C;  1YHQ A;  5BN4 A;  3KFU A;  4CDC C;  3IKJ A;  2R3Z A;  2A68 D;  4OEM B;  1BCP D;  2LXJ A;  5JVH 3;  1Y1V H;  2KVM A;  1SRU A;  4PG3 A;  2L1B A;  4KKS A;  1I4X A;  2Q2T A;  2E2J B;  2XRQ D;  5GRO A;  4ZKB B;  1GVP A;  5IYC G;  1EYA A;  1KAW A;  4O2D A;  2JA5 H;  4LAA A;  1JE5 A;  1EQT A;  4FXD A;  4DV6 Q;  2EY5 A;  1MD2 D;  4A3I H;  3UDG A;  2QIL A;  1CM9 A;  1A2U A;  1JB7 A;  4TSS A;  5HGT A;  3SK4 A;  1RHP A;  1Y1V G;  4R4C A;  1L0Y B;  3RNU A;  4DV3 Q;  1JWU D;  4IUU A;  4K0K Q;  1KLG D;  2Y0S E;  2DGY A;  4IN3 A;  4J8Q A;  3KBG A;  4NXN Q;  3X3M A;  4GNX B;  3J81 j;  2QDB A;  3BVZ A;  4PNY A;  1OXS C;  3RLF A;  1DON A;  4JOI A;  2A6H C;  4G7H C;  3S15 H;  4DUZ L;  1X6O A;  4A3I G;  3D6W A;  2K05 A;  3L7Z C;  5DM7 3;  4LJZ C;  1GUW A;  1EY6 A;  4LF8 Q;  4GKJ Q;  2DN8 A;  3BG3 A;  4O42 A;  3RUZ A;  1HR0 W;  3LWE A;  3GTP H;  2WKD A;  2ZJP A;  3PO2 H;  3TP8 A;  3HOZ G;  1K9M C;  1FD7 D;  1FYC A;  1GUG A;  2KBN A;  5EPL A;  1VMP A;  3GQB A;  4IOC A;  4QCL A;  2N3S A;  3GTG H;  3CKI B;  4H7B A;  4DR2 L;  3KK7 A;  4BY1 B;  4CKE A;  2B8F A;  1HTP A;  4M1U B;  5KRU A;  2B2V C;  3TN2 A;  4HIM A;  2DUD A;  3FKI B;  1KQS A;  3CP0 A;  1XPU A;  4OO1 G;  3PO3 B;  5EAY A;  4JI5 L;  5C0X I;  4LFB Q;  3ULP A;  4JI0 L;  2JJQ A;  1VF5 C;  3AYH B;  3QO2 A;  1PFB A;  4KKU A;  5JEA J;  1LTG D;  3PUX A;  4KY6 A;  1EIF A;  5C44 B;  1AE2 A;  3PO2 G;  3CHB D;  1JIC A;  1TWH H;  1OXT A;  3KLR A;  1F2Y A;  4GOP C;  4A3D H;  4WJW A;  2J4X A;  1EL0 A;  4EQ5 A;  2OQK A;  2NVY H;  3NHH A;  1N32 L;  4A3E H;  2F0I A;  2PMZ E;  2ZM6 L;  1B3Q A;  5JEA H;  4DV7 L;  3NTH A;  5LMU L;  3J7A F;  2R93 H;  1L0X B;  1KL9 A;  4GLX A;  1HA5 A;  1UEB A;  3V96 A;  3K7U C;  1VQ7 A;  3BVM A;  3AFP A;  2E75 C;  1DOL A;  1CHQ D;  2MHV A;  3HEJ A;  2F0G A;  2E2H H;  3MC0 B;  1R9T B;  1C0A A;  1SMY C;  3A8J E;  4DV4 L;  1SRO A;  2B2V A;  4IUR A;  1B50 A;  1E2W A;  4A3D G;  4JI6 Q;  3M9B A;  1SN8 A;  3K6O A;  3G7L A;  1LUZ A;  1WTR A;  1YI2 A;  1A3U A;  1OXU A;  4A3E G;  2UUB Q;  1O80 A;  5JEA G;  3I4O A;  2L55 A;  4RG1 A;  3S14 B;  4FO2 A;  3Q8D A; 
#chains in the Genus database with same CATH homology
 4JI3 L;  1WI5 A;  4HIO A;  1PH4 A;  4X64 Q;  1NTG A;  4JYA L;  3CCR A;  4P75 A;  4TVA B;  1TWF H;  3BZC A;  4GLV B;  3KJP A;  2IY5 B;  2A1A A;  1OXV A;  3H3V I;  3WWV A;  2UUA L;  3U58 A;  3J7A 5;  1VQN A;  1WCM H;  1L1O B;  1KC8 C;  4JV5 L;  1VQJ A;  3S24 A;  2CCZ A;  3PF5 A;  1VQO A;  4DV2 L;  2JA5 G;  4JI2 L;  3CQZ H;  4DR7 L;  2JA9 A;  4TQU S;  1IBL Q;  2WB1 G;  4QY7 A;  4RMF A;  3CXC A;  2F4V Q;  4JI7 L;  4AIM A;  1N36 Q;  2YV5 A;  4LF6 L;  4JBJ A;  4DR2 Q;  3HOV G;  1QVF A;  3S17 H;  3VDY A;  1HNX L;  1N33 L;  4DR3 L;  3NEN A;  2A8V A;  2NVT H;  2E8G A;  5K36 G;  2K50 A;  1I5F A;  2RCN A;  4IJL A;  4X62 L;  4A3J G;  3I4N H;  2GVB A;  4DV1 Q;  1VQ4 A;  3CCS A;  2B63 H;  3I4M H;  2GVA A;  1SR3 A;  2C35 B;  1A0I A;  4IJH A;  5M3M H;  3TRE A;  1K8G A;  3TQY A;  2K4K A;  1J6Q A;  2LSS A;  2JA8 H;  4UPA A;  3A0J A;  3HFZ B;  4JI0 Q;  2HIX A;  3RZD H;  2HHH Q;  5JJI A;  4LF5 L;  4AQY L;  1FVI A;  5IP7 H;  1LTL A;  3PUY A;  5C3E G;  1I6H H;  4H02 A;  1EFW A;  1VS0 A;  4Y7N H;  2WB1 E;  4BY7 H;  5C4X H;  4DV3 L;  2I5M X;  2Q2U A;  3EBE A;  4A3F H;  1V1Q A;  3A74 A;  4NXM L;  2I5L X;  2UXD Q;  1O7I A;  4DKA C;  4A3L H;  4DAM A;  3PIO A;  4QQB X;  5GAH C;  2EXD A;  1N9W A;  3H15 A;  1AH9 A;  3PIP A;  3DM3 A;  4DV5 L;  2QEX A;  1XNQ L;  2CFM A;  4JCV E;  2AMC B;  2VQE L;  2UU9 L;  1ASY A;  3RLO A;  2ZJQ A;  1VQL A;  4X65 Q;  1YHB A;  1MJC A;  4MTN A;  1N32 Q;  3OW2 A;  4JI4 L;  3JAM i;  4DR6 L;  4IFD J;  4P72 A;  5IT9 c;  2I5H A;  2ZM6 Q;  3NBH B;  1UE6 A;  4DR1 L;  2HT1 A;  1E7Z A;  3FHW A;  4DV7 Q;  5LMU Q;  1I94 Q;  4ME3 A;  4GNX C;  4IFD I;  2IHF A;  4A3K H;  2BA1 A;  3IRB A;  2UXB Q;  2B63 G;  1CUK A;  4BXX H;  1S3O A;  2ZTE A;  4A93 H;  3HOX G;  5M3M G;  4DR4 Q;  1TWG H;  1CKO A;  1M90 C;  1YZ6 A;  2WFW A;  1IBK L;  1HNZ L;  3OTO Q;  2OTJ A;  2JA8 G;  4JI1 Q;  2NZO A;  3PF4 A;  2ATW A;  1FGU A;  4LFA L;  3GTO H;  1X54 A;  1C9O A;  2K5N A;  2K5V A;  1VQC A;  3CCE A;  1G29 1;  5JJK A;  3E0E A;  4LW1 A;  1GM5 A;  1KIX A;  4BY7 G;  1LM0 A;  1YEZ A;  4P74 A;  1JJC B;  2OQ0 A;  3HOW G;  3S1Q H;  4UP9 A;  4LF4 L;  2WAQ G;  3M85 A;  4JC0 A;  4A3L G;  4Y52 H;  1Z9F A;  1E22 A;  1B8A A;  1UE1 A;  2L15 A;  3GDE A;  4MZ9 A;  3M4O H;  2IX1 A;  2Q2H A;  5IYC H;  4AYB G;  3BJU A;  5LMN Q;  5GAE C;  1UWV A;  1S40 A;  2PNH A;  4P71 A;  2F52 A;  1L0W A;  3GTJ H;  3D0F A;  3J81 i;  2N49 A;  3I56 A;  1K8A C;  5M3F H;  1SMX A;  3ULL A;  1UE5 A;  3H0G H;  4YHH L;  4EX5 A;  1TXY A;  3MEF A;  4JYA Q;  2MNA A;  4PZ6 A;  4DAY B;  2QGQ A;  2KCT A;  2UUA Q;  3CC2 A;  4IPG A;  4C2M H;  1MJE A;  2R92 G;  4A3G G;  1HJP A;  3G4S A;  4JV5 Q;  1B70 B;  1XJV A;  1NMG A;  1Z47 A;  2PI2 E;  3PV0 A;  3U50 C;  1N34 L;  1E1T A;  4DV2 Q;  4JI2 Q;  4IFD G;  1HZA A;  2WAQ E;  2YYZ A;  3UDI A;  3CME A;  2CWA A;  5AJ3 L;  2CKZ B;  2I0Q A;  1PVO A;  3J80 i;  3BU2 A;  3RLN A;  4DNI A;  4KHP Q;  1YVC A;  1VQ8 A;  1VQK A;  2VNU D;  1HZ9 A;  1XMQ L;  4JI7 Q;  4AYB E;  3PSI A;  3S1M H;  4FDB A;  4LF6 Q;  4BBR H;  1D7Q A;  3I7F A;  2EIF A;  4XIG S;  4IO9 A;  1WYD A;  1HNX Q;  1N33 Q;  1PH2 A;  2AHO B;  2LXK A;  4DR3 Q;  2R93 G;  4B3S L;  1XPR A;  1NMF A;  2WP8 J;  4YY3 L;  4PZ8 A;  5FLM G;  2UXC L;  4HJ8 A;  2E2J H;  1IZ6 A;  4LUZ A;  2BA0 A;  3MXN B;  1XMO Q;  3TRZ A;  1G51 A;  4LF7 L;  3S2D H;  3HOY G;  3H0G G;  1HH2 P;  4GS3 A;  1P16 A;  1W3S A;  4LWC A;  3TS2 A;  4IOA A;  1QVG A;  1K83 H;  5FJ8 H;  1P8L A;  4BBS G;  2PQA B;  3U4Z A;  5IWA L;  1T9H A;  1MKH A;  3F8T A;  4R4I A;  4UP8 A;  4R4Q A;  1PH9 A;  1VQ5 A;  4LF5 Q;  1FJG Q;  4AQY Q;  1PHJ A;  3RR5 A;  1RIP A;  3SGI A;  1VQE A;  1X3F A;  1PV4 A;  4HJ7 A;  1IBM L;  1VCI A;  2D0P A;  2YU9 H;  3E9I A;  2HIV A;  3W1B A;  1X3E A;  4L5R C;  3HOZ H;  3S16 H;  1EQQ A;  4JBK A;  3T1Y L;  4DV5 Q;  4ALP A;  5JJL A;  1XNQ Q;  4DV6 L;  1BBW A;  3RZO H;  2VQE Q;  4OON A;  2OWO A;  4KI0 A;  5IYB H;  1XTD A;  3NEL A;  4JI4 Q;  4DR6 Q;  4DR1 Q;  1EUJ A;  5GAD C;  1U5K A;  4L5Q A;  4PMW A;  1YIJ A;  1PH8 A;  1Q86 C;  1EIY B;  3AQQ A;  4JI5 Q;  3KDF A;  4JI8 L;  3M7N A;  1X55 A;  2D62 A;  4X66 Q;  1YJW A;  2B3G A;  5FLX c;  4BA2 I;  4B3M L;  1PYS B;  4GOP B;  2RHQ B;  1IBK Q;  3U4V A;  3CC7 A;  1OTC A;  1HNZ Q;  1WCM G;  5BR8 L;  5FJ8 G;  1X9N A;  1X56 A;  3L0O A;  4YCW A;  4LFA Q;  1Q82 C;  4K0K L;  4X64 L;  3CMA A;  1W2B A;  2NVX H;  1H95 A;  2IX0 A;  1YBY A;  2CWP A;  4NXN L;  3F2C A;  2R7Z H;  4C3J H;  3STB D;  3S1R H;  4GKK L;  3TS0 A;  2HQL A;  2K5H A;  2VS1 A;  3E9H A;  1PH1 A;  1JT8 A;  2YTY A;  4R4T A;  1VQG A;  1PH7 A;  1LYL A;  1BBU A;  4DUY L;  2YTV A;  2V1C C;  1J5E L;  2R6G A;  1A63 A;  2ES2 A;  1GKH A;  1IBL L;  1PFS A;  1VQM A;  4OX9 L;  2ALY B;  3J7Z C;  4HJ9 A;  3JAM c;  3I4N G;  3PCO B;  2F4V L;  1N36 L;  1L1O C;  3I4M G;  1CKM A;  1V43 A;  3UDX A;  1VQB A;  3A5Z B;  1JJ2 A;  1X65 A;  1HR0 Q;  3KF8 B;  3A5U A;  4LF8 L;  1EWI A;  4LUV A;  4YHH Q;  4A3B H;  5M5Y H;  4GKJ L;  1ASZ A;  1L2F A;  1CKN B;  5LMN W;  2JEA I;  4YCU A;  5IP7 G;  1TWC H;  4A4I A;  4DV1 L;  3CC4 A;  3T1H Q;  3KF6 B;  3PUZ A;  1QUQ A;  3CPW A;  5C4X G;  4BY1 H;  4GN5 A;  4DV4 Q;  4DR5 L;  2K14 A;  4A3F G;  1XNR L;  2BH2 A;  2JA7 H;  2ID0 A;  1KRS A;  2XTI A;  1QVC A;  3LGJ A;  3CCU A;  1E3P A;  1BVS A;  3FKI H;  3L2P A;  1QZG A;  2NVQ H;  2R7Z G;  1KHI A;  2R7F A;  2B29 A;  2HHH L;  4LUO A;  4DK3 C;  2RF4 A;  3PUV A;  2CQO A;  1I3Q H;  3K8A A;  2VQF L;  2RHS B;  3PO3 H;  2VUM H;  3ZJY C;  1XMQ Q;  1PA6 A;  3I2Z A;  1JMC A;  4GN3 B;  4HJA A;  2JQO A;  2IHE A;  2N8N A;  2UXD L;  4DK6 C;  1HNW Q;  4B3S Q;  2UXC Q;  4HID A;  4YY3 Q;  3J81 c;  4A3K G;  4JI3 Q;  5M5X H;  2KHJ A;  4JOI C;  3GO5 A;  5C44 H;  4BXX G;  4A93 G;  2JK8 A;  4XTC S;  1G6P A;  4LF7 Q;  1YHQ A;  4NPS A;  2NN6 I;  3G48 A;  3OYY A;  4B3R L;  3KFU A;  4WJ3 M;  1U0L A;  1I50 H;  2Z6K C;  1EQR A;  4IPH A;  4HIK A;  1TWA H;  4NB3 A;  2KCM A;  2LXJ A;  1E24 A;  1Y1V H;  4LFB L;  3GTM H;  1SRU A;  4OWT B;  4PG3 A;  4LFC L;  5IWA Q;  4DR7 Q;  1IL2 A;  4IPD A;  4A3C H;  3ULJ A;  4BY1 G;  2AWO A;  4DR4 L;  3CCL A;  3ICE A;  5ELO A;  3EIV A;  2Q2T A;  2UUC L;  2Y0S G;  4GN4 B;  3FKI G;  1UE7 A;  1IBM Q;  3AEV A;  3J80 c;  5GRO A;  1L1O A;  3F2D A;  1GVP A;  4POG A;  2PQA A;  5IYC G;  4KLK A;  1Q8K A;  3PO3 G;  1RL2 A;  1NE3 A;  1KAW A;  4O2D A;  2JA5 H;  1MIU A;  4X6A H;  2EQS A;  3T1Y Q;  1JE5 A;  4A75 A;  3M4Q A;  4DV6 Q;  4X62 Q;  1PYB A;  2VY3 A;  5GAG C;  5M3F G;  4A3I H;  1Q81 C;  3F1Z A;  3UDG A;  3I55 A;  4LF9 L;  2XGT A;  5GQO A;  2R7D A;  3GTK H;  4KHZ A;  1R9T H;  1JB7 A;  3FP9 A;  4JI8 Q;  2MO1 A;  3EN2 A;  1PH5 A;  4APV A;  4JBM A;  4JG2 A;  4B3M Q;  1GO3 E;  1WOC A;  5C4J H;  2OTL A;  1VQH A;  4YCV A;  1CSQ A;  4GLA C;  5J3B A;  3G71 A;  1Y1V G;  4R4C A;  3H3V H;  3RNU A;  1WFQ A;  4DV3 Q;  1VQ9 A;  1YHA A;  2AWN A;  1B7Y B;  4K0K Q;  3K0X A;  4NXM Q;  4A3C G;  1K3R A;  2K52 A;  2Y0S E;  2DGY A;  4B3T L;  2Q2I A;  2PI2 A;  4DV0 L;  1JJG A;  1Q12 A;  4NXN Q;  2NN6 G;  4GNX B;  3J81 j;  4GOP A;  3S14 H;  4GKK Q;  2F3I A;  4BBR G;  1OXS C;  2JA6 H;  5C3E H;  3RLF A;  5HY6 A;  2UU9 Q;  4JOI A;  4L5S A;  4OO1 I;  4DUY Q;  4PZ7 A;  1J5E Q;  1WJJ A;  1EYG A;  2VW9 A;  2Z6K A;  1M1K C;  4O0A A;  3S15 H;  4JI6 L;  4DUZ L;  4OX9 Q;  4YWL A;  4YWK A;  3UE1 A;  1X6O A;  2NZH A;  3HOU H;  2BH8 A;  2MFI A;  4KHP L;  1A62 A;  4A3I G;  2QA4 A;  4J15 A;  1VQF A;  3L7Z C;  2UUB L;  1VQA A;  1EOV A;  1YJ9 A;  2E5L L;  2JEB I;  3K80 C;  4LF8 Q;  4GKJ Q;  4UY8 C;  2MQH A;  3D31 A;  1VQD A;  4POF A;  2VL6 A;  1XMO L;  4UP7 A;  1QZH A;  4WJ4 A;  3CCJ A;  1N8R C;  4AH6 A;  3GTL H;  4C3H H;  3K81 C;  4JBW A;  1IXR A;  2KHI A;  3HOX H;  4DR5 Q;  1YNX A;  4QGU A;  4YWM A;  1HR0 W;  2D0O A;  1XNR Q;  3GTP H;  4LF4 Q;  2ZJP A;  1YJN A;  3DLL A;  3PO2 H;  3CCV A;  1Q46 A;  5IY0 A;  3HOZ G;  1K9M C;  1CKN A;  2KBN A;  1FJG L;  2ASB A;  2VQF Q;  4IOC A;  3CCM A;  2JA6 G;  1Q7Y C;  2A19 A;  2N3S A;  3KF6 A;  3K7A H;  5IYB G;  3GTG H;  5IYD H;  3HOW H;  4DR2 L;  3HKZ G;  3CPF A;  3HOU G;  3KDF B;  3AFQ A;  3F2B A;  1DGS A;  1BKB A;  3RN2 A;  1Y14 B;  5IP9 H;  4HIM A;  1NY4 A;  2DUD A;  1KQS A;  1Y1W H;  4B3R Q;  3CP0 A;  3PGZ A;  5ELN A;  5C0X J;  4OWW B;  1XPU A;  1K73 C;  1OXX K;  4OO1 G;  1Q1B A;  3PUW A;  4QJF A;  5EAY A;  4OWX B;  2GN5 A;  1CSP A;  2N78 A;  4JI5 L;  5C0X I;  4LFB Q;  4BA1 I;  3BZK A;  3RN5 A;  2VZA A;  3ULP A;  1N34 Q;  4JI0 L;  4X66 L;  2ZJR A;  2JJQ A;  3KJO A;  4LFC Q;  2E2I H;  3AYH B;  3S1N H;  1SFO H;  5AJ3 Q;  5JEA J;  1Q1E A;  3M3Y H;  3PUX A;  4L5T A;  5H1S E;  2UUC Q;  3STB C;  1EIF A;  3PO2 G;  1AE2 A;  2OCE A;  4A76 A;  3ER0 A;  4OXP A;  2KEN A;  2R92 H;  1KXL A;  1AE3 A;  3W1G A;  4A3G H;  1PH6 A;  1TWH H;  3ERS X;  1OXT A;  5HGQ A;  3HKZ E;  3KYH C;  2ZTD A;  4GOP C;  3CW2 C;  4R4O A;  4A3D H;  5M5W H;  1D8L A;  5IYD G;  3GD7 A;  3B6Y A;  4EQ5 A;  2OQK A;  1IYJ B;  2NVY H;  1YIT A;  1V9P A;  4X65 L;  4A3M H;  4DPG A;  1XPO A;  1HZB A;  4LF9 Q;  4A3E H;  1C7Y A;  3KOJ A;  1N32 L;  2Z0S A;  2PMZ E;  4MNO A;  2ZM6 L;  3CF5 A;  1KD1 C;  4A3B G;  4P73 A;  5IP9 G;  4DV7 L;  2JE6 I;  5LMU L;  1S72 A;  1I94 L;  2R93 H;  1KL9 A;  4GLX A;  1Y1W G;  5FLM H;  2UXB L;  1UEB A;  2YTX A;  1PH3 A;  3K7U C;  1VQ7 A;  3JC6 6;  4IPC A;  1QUQ B;  3S2H H;  3AFP A;  4LNQ A;  2JA7 G;  1HR0 L;  3OTO L;  3HOY H;  4JI1 L;  1SE8 A;  1VQ6 A;  1NBW A;  4R1J A;  4QIW E;  4C3I H;  4B3T Q;  4BBS H;  4DV0 Q;  3NEM A;  2E2H H;  4HJ5 A;  2VUM G;  1E1O A;  3UE0 A;  1X3G A;  3T1H L;  1C0A A;  2IT1 A;  5E7N A;  3CD6 A;  1A8V A;  4DV4 L;  1SRO A;  1SLJ A;  2ZTC A;  3CCQ A;  2H5X A;  3G6E A;  1NJI C;  5C0X G;  3CAM A;  4A3D G;  2MO0 A;  1HZC A;  2AKW B;  3W5O A;  3HOV H;  4JI6 Q;  3M9B A;  1SN8 A;  1KRT A;  3TEH B;  5C44 G;  4DUZ Q;  1FL0 A;  3KLW A;  5LMN L;  4QL5 A;  5DLQ E;  1LUZ A;  3GTQ H;  4GNX A;  3M4P A;  4A3M G;  1YI2 A;  1GD7 A;  1OXU A;  2FXQ A;  3HKS A;  4A3E G;  1VQP A;  2UUB Q;  2E5L Q;  4A3J H;  5IE8 A;  5JEA G;  1VQI A;  3I4O A;  5BR8 Q;  3UDF A;  4RG1 A;  1HNW L;  1K0R A;  2K75 A;  3Q8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...