3K80C

Structure of essential protein from trypanosoma brucei
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
113
structure length
103
Chain Sequence
SVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTHEVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQHFYFPYIQVQPPHGQVAVIHGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system, rna binding protein
total genus 15
structure length 103
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k80C00
3ULPA 3CCUA 1KIXA 2JK8A 1CKMA 2OQKA 5GQOA 1Y1VH 4DR1L 3H0GH 1Z47A 2EIFA 1X65A 4A4IA 3CP0A 4A3EG 1EIFA 4IPGA 1YZ6A 2K52A 4JI1Q 1HNZQ 1I94Q 2VNUD 2NZOA 1J6QA 1AE2A 1HH2P 5HY6A 2AWNA 5IWAL 4JI1L 4A3KH 1OXSC 4YY3Q 5IYCG 1EYGA 1HNZL 4IOAA 3GTOH 4KHPQ 1VQCA 4BXXH 1JB7A 1KHIA 1UEBA 3KF8B 1U5KA 1VQBA 3PUWA 4LUOA 5IP7H 3HOYH 1VQJA 3K81C 1K83H 5IYBH 1VQPA 4BA1I 1VQMA 4JBWA 4KHPL 1L0WA 5IT9c 2GVAA 2AWOA 4YCUA 2YTVA 1SROA 2VY3A 1X3FA 2JA7H 2PQAB 1MIUA 4GKJQ 2VS1A 2JEBI 2JA8H 2RCNA 4R4CA 1JJ2A 3WWVA 1YHQA 3AYHB 3GTQH 5M3MH 2B63G 3GTGH 2EXDA 1NBWA 3OYYA 1VQ5A 1HNWQ 2R93H 4OONA 1VQLA 4R1JA 5GADC 2UUCQ 2I5LX 3ULJA 4DR2Q 3S14H 1HNWL 2D62A 1P16A 4GN5A 4DV4Q 4DV5Q 1YBYA 4O0AA 2R7DA 2KCTA 3F1ZA 4YWMA 3I55A 4DR2L 1YEZA 2NN6I 1B8AA 2UUCL 4AYBG 5GROA 4OWXB 3ZJYC 4X6AH 2XGTA 3STBC 4DV2Q 2Q2TA 3PIPA 3U50C 4K0KQ 1TWFH 3GTMH 4A3LG 2K5HA 1YJ9A 1XNRQ 4DV2L 5C44G 4HJ9A 1Q86C 4JBJA 3NELA 1NE3A 3UDFA 4K0KL 3A0JA 4C3HH 4DAYB 4NXML 4IFDG 1CKOA 1XNRL 3HOUH 4IFDJ 3KOJA 2YV5A 4X66L 3PO2G 2JA6H 3DM3A 1QZHA 2UUBQ 1H95A 2CQOA 4UP9A 2CWAA 4LFAL 3PSIA 1V43A 1EUJA 3FHWA 4L5QA 4B3TQ 4DV1Q 3CC7A 3CCEA 1TXYA 1XJVA 3CD6A 5ELNA 2JA9A 1KQSA 4LF5Q 4OX9Q 3L0OA 4DV1L 1Q1EA 1Y1WG 1D8LA 2CCZA 4DR3Q 1EIYB 3I4NH 2IY5B 1AE3A 3CQZH 1PFSA 3I4OA 3HOVG 1CSPA 4LF5L 1KAWA 4DR3L 3T1HQ 2DUDA 3S2HH 2Y0SG 1IYJB 1YHBA 2KBNA 3GDEA 1KRTA 2E2HH 4HJ8A 4IOCA 1TWCH 4IO9A 3T1HL 1W2BA 1PH2A 3J7A5 4GLXA 4PMWA 5GAEC 4A3KG 3ICEA 2HIXA 4LF8Q 4B3RQ 4OWWB 1TWGH 3W1BA 4BBSH 4A3GH 4IPDA 4JBMA 4LF4L 1P8LA 3RN2A 5GAGC 2VQEQ 5IP7G 4LF8L 5IYBG 3J7ZC 1HNXQ 3F2BA 4A76A 1EQQA 4DUZQ 3PIOA 4GKJL 4B3MQ 2OQ0A 1L1OC 1G291 4ME3A 1X9NA 1K8AC 1HNXL 1K3RA 1OTCA 2JA7G 3I4MH 4DUZL 1VQNA 3AEVA 1E1TA 2K5VA 4B3ML 4LF7Q 2YU9H 4A3IG 3S16H 3M4OH 4JI8Q 2RF4A 4BY1H 1S40A 3J81j 1GKHA 1TWAH 3RZOH 5C0XG 5JJLA 1K73C 4QJFA 3PGZA 4TQUS 3Q8DA 3S1QH 4JI8L 4JBKA 5IYDH 1LTLA 1VQ6A 2R93G 2WB1E 1SR3A 2IT1A 3BU2A 1C0AA 4QIWE 2CWPA 5M5YH 4DR5Q 4RG1A 1IBMQ 3W1GA 4P75A 1NMGA 4DR5L 1OXVA 2RHSB 1JJCB 4POFA 4X65Q 1XPUA 1E22A 1IBML 1FJGL 1KD1C 2D0OA 3ER0A 4JI7L 3EN2A 1IZ6A 3S1NH 4BY7H 2K14A 2R7ZH 2MNAA 5HGQA 5FLMG 5FLXc 4A93H 3K8AA 1WJJA 4PZ6A 1NJIC 1J5EL 4DKAC 2MFIA 3M3YH 1OXTA 1UE7A 5H1SE 2JA5G 4JYAL 3HOUG 5IWAQ 2ALYB 3CCRA 4A3FH 1QVGA 4DV6Q 3G4SA 2JA6G 4LWCA 1EWIA 2QGQA 3KF6A 2WP8J 1YHAA 4Y52H 1N33L 4DV6L 1WCMG 4NPSA 2CFMA 2F3IA 1L1OB 2Q2IA 1N36L 4XIGS 4J15A 4MZ9A 4MTNA 2R92H 1EOVA 1PH4A 4UP8A 3I4NG 2Z6KC 3D0FA 2ZJRA 1VS0A 5ELOA 3I7FA 3UE0A 4P71A 4AIMA 4A3DH 2F4VQ 3GTLH 3U58A 2HHHL 1RIPA 1E3PA 4QY7A 3HOWH 3HFZB 1MJCA 3UDIA 5LMUQ 4GS3A 1XMQL 2F4VL 2VUMH 3UDGA 1A0IA 3RNUA 1QUQA 5LMUL 5M5WH 1YJNA 4A3GG 3CMEA 1EQRA 4LNQA 2OTJA 1N8RC 3CC2A 1GO3E 3JAMi 2VQFQ 2AHOB 4LF6Q 3CCLA 2UU9L 4A3BH 1VCIA 4B3RL 4HIDA 5C4XH 3K7AH 2IX0A 4Y7NH 3CMAA 2VQFL 5EAYA 3AFPA 4LF6L 3I2ZA 3BZCA 1VQKA 3OTOQ 1ASZA 5LMNW 3T1YQ 3BJUA 1WFQA 3HKSA 4DUYQ 1C7YA 3PO3H 2JE6I 4BY1G 3LGJA 2QA4A 1Q1BA 3OTOL 2I5HA 3GTJH 3T1YL 5E7NA 4DUYL 3S1MH 3BZKA 2N49A 2UXBL 5IYDG 4NXMQ 2AKWB 2ZJQA 1PV4A 4JV5Q 4GLAC 4X64Q 4X66Q 4OO1I 1CUKA 4EQ5A 4C3IH 1WYDA 1YNXA 2GN5A 3PCOB 2ZTEA 1CKNB 4JV5L 4X64L 4LFAQ 4IPCA 4A3MH 1PH7A 3PF4A 4A3JH 2Q2UA 4GKKQ 2K75A 3S17H 3SGIA 4LF9L 5FJ8H 4JOIA 1GD7A 3JAMc 4GNXA 2VL6A 4RMFA 3HOXG 4BY7G 3M4QA 4DAMA 1XNQQ 3GTPH 1PH5A 3E9IA 1W3SA 1N34L 4O2DA 1VQAA 1XNQL 2FXQA 5BR8Q 4AYBE 3HOZH 1Y1VG 3H0GG 3PUYA 2Z0SA 4A3EH 2UXCQ 1ASYA 3KLWA 4A3FG 4C3JH 1HZCA 2R6GA 5BR8L 1B70B 3KF6B 4H02A 2WAQE 3J80i 1SLJA 2UXCL 2QEXA 2NVTH 4JI2Q 4JI6Q 1YI2A 4BXXG 2A1AA 4JI2L 1IL2A 3ULLA 3HOYG 1IXRA 3TS2A 4JI6L 2PMZE 4EX5A 2N8NA 1VQOA 1PH6A 1KC8C 1VQEA 2R92G 1D7QA 3EBEA 2AMCB 4L5SA 4DR7L 2MO0A 1NMFA 4A75A 1MJEA 4A3DG 2YTXA 3FKIH 3S2DH 3M7NA 1X6OA 3CXCA 3HOWG 1V9PA 4PZ7A 3B6YA 3F2CA 1YIJA 1T9HA 2IHFA 3VDYA 3CAMA 1XMOQ 1TWHH 2JA8G 3JC66 3KYHC 1QUQB 1Y14B 5M3MG 4HJ7A 4DK3C 3ERSX 1XMOL 3RN5A 2B63H 2Y0SE 1SRUA 2UUAQ 3K7UC 1BBUA 1U0LA 3CPWA 4A3BG 2RHQB 4A3CH 3OW2A 2L15A 3J80c 1PYSB 1PH8A 5C4XG 1IBLL 2UUAL 1FJGQ 4DPGA 2NN6G 3F2DA 4DV0Q 1I50H 4JI7Q 1YJWA 4AH6A 3TEHB 3TRZA 1NTGA 3M85A 1IBKL 4DV0L 3KDFA 3NENA 1J5EQ 1E1OA 3W5OA 3KJPA 4JYAQ 4OO1G 3FP9A 3TS0A 5DLQE 5IY0A 2Q2HA 4GLVB 2I0QA 4QQBX 4IJLA 1BVSA 5C44H 5LMNQ 4P73A 4HIKA 1B7YB 4HIOA 1PVOA 2UXDQ 3CPFA 3KFUA 4R4IA 4UPAA 3UE1A 1N33Q 1HR0W 2ES2A 5LMNL 1R9TH 4YWKA 4AQYQ 1N36Q 2UXDL 1N9WA 4GN3B 4C2MH 3GO5A 3M9BA 3K80C 1HJPA 1VQDA 1PH1A 5JJKA 1SN8A 1AH9A 1VQ7A 1S72A 4AQYL 1YVCA 2HIVA 1SE8A 1VQ4A 1M1KC 4BA2I 4KHZA 2V1CC 1PHJA 2A19A 2LXKA 1QVCA 1Y1WH 2HHHQ 2OWOA 1FL0A 5M3FH 2IHEA 1JE5A 1SMXA 1GVPA 4GN4B 5C3EH 3CC4A 4APVA 1XMQQ 3HOVH 1E7ZA 1WOCA 2C35B 1LM0A 2N3SA 2ZTDA 3PF5A 1C9OA 1A62A 3MXNB 3S15H 5C4JH 3PUXA 4DV7Q 4JI5Q 2E2IH 2JEAI 2ZM6Q 3A5UA 3HKZE 1NY4A 4TVAB 4HIMA 4PG3A 2PI2A 4GOPA 3F8TA 4FDBA 4JI5L 1Q46A 4DV7L 1I94L 3STBD 2ZM6L 5AJ3Q 2UU9Q 4BBSG 2K4KA 1VQFA 4X62Q 4YY3L 4JCVE 4UP7A 5AJ3L 2K50A 3GD7A 1RL2A 5JEAG 5JEAJ 3EIVA 4X62L 1M90C 1X54A 2BA0A 3MEFA 4LW1A 3I4MG 3FKIG 4KI0A 1QZGA 3KJOA 5IP9H 2UXBQ 4A3IH 3H15A 2KHJA 4L5TA 4PZ8A 4DR7Q 3AQQA 1UWVA 3TREA 5C0XI 3TQYA 1JJGA 3K0XA 4BBRH 2MQHA 3A74A 4A3CG 4L5RC 4LF9Q 2KCMA 3J81i 1L2FA 2ID0A 1A8VA 2EQSA 1LYLA 4LUZA 4GOPC 2OTLA 2YTYA 4R4QA 3GTKH 4WJ4A 4R4OA 1Q7YC 4P74A 1I3QH 4DV4L 4DV5L 4JC0A 4NXNQ 4DR4Q 3KDFB 1N34Q 3AFQA 3CCMA 2R7ZG 5IE8A 2ATWA 3IRBA 4P72A 2PI2E 1YITA 4A93G 4YWLA 4NXNL 4DR4L 2MO1A 5FLMH 3S1RH 2WAQG 3G6EA 1Q12A 2IX1A 3E9HA 2JA5H 2A8VA 3U4VA 1Q8KA 3U4ZA 2HQLA 4LUVA 1OXUA 4JI3Q 1CSQA 3H3VH 4HJAA 4DR6Q 4OWTB 4DV3Q 3RZDH 1JMCA 3H3VI 1N32Q 4GKKL 2N78A 4JI3L 4WJ3M 4DR6L 4DNIA 2GVBA 4DV3L 5IYCH 1WCMH 1VQGA 1L1OA 1K9MC 1G6PA 3NEMA 1N32L 3RLFA 2UUBL 2LSSA 1JT8A 3CF5A 1V1QA 1O7IA 1X56A 1XTDA 1X3GA 2VZAA 3E0EA 4R4TA 3J81c 3CW2C 1PH3A 4B3TL 1HR0Q 4YCVA 5M3FG 4JOIC 5C3EG 1VQ8A 1A63A 4OX9L 1KXLA 3I56A 3PUVA 1I5FA 4GNXC 1HR0L 2DGYA 2PQAA 4IPHA 2R7FA 1BKBA 1UE5A 2WB1G 3L7ZC 3PV0A 4JI4Q 1WI5A 2VUMG 2ASBA 3RR5A 1KL9A 4YHHQ 2HT1A 4JI4L 2F52A 4POGA 1HZBA 1VQ9A 1PH9A 1VQIA 4GOPB 3A5ZB 4YHHL 4JG2A 2ZJPA 4IJHA 1IBLQ 1X55A 3D31A 2H5XA 1XPRA 1Q82C 1BBWA 1HZAA 1I6HH 1K8GA 5GAHC 4MNOA 3G48A 1HZ9A 1QVFA 1LUZA 2XTIA 5JJIA 2B3GA 2D0PA 2I5MX 1SFOH 2VQEL 2BH8A 4ALPA 2NVQH 1IBKQ 4LFBQ 2KENA 2K5NA 5IP9G 3CCJA 1VQHA 4XTCS 3PO3G 2E8GA 3CCSA 1EFWA 4LFBL 2WFWA 1UE1A 2E5LQ 3DLLA 3RLNA 3L2PA 2B29A 5C0XJ 4LF7L 2OCEA 1MKHA 3NBHB 5J3BA 2NZHA 4LFCQ 4A3LH 1KRSA 1OXXK 2KHIA 2BA1A 1FGUA 2E5LL 2NVYH 1DGSA 1PYBA 2YYZA 4JI0Q 2BH2A 4B3SQ 4YCWA 4BBRG 4QGUA 1K0RA 4LFCL 1FVIA 4JI0L 1CKNA 4A3MG 4DK6C 2PNHA 2NVXH 1Q81C 2E2JH 3CCQA 4B3SL 3HOZG 4A3JG 3PO2H 4IFDI 2CKZB 3G71A 2LXJA 3UDXA 2Z6KA 1GM5A 5M5XH 5FJ8G 4QL5A 1G51A 2VW9A 4OXPA 3RLOA 3S24A 1PA6A 1Z9FA 2JJQA 3PUZA 1S3OA 1X3EA 4KLKA 4NB3A 4GNXB 5K36G 3HOXH 4UY8C 1XPOA 4HJ5A 4X65L 4LF4Q 2ZTCA 2JQOA 4DR1Q 3CCVA 3M4PA 1UE6A 3HKZG 1E24A
chains in the Genus database with same CATH superfamily
5M5WB 2JK8A 1CKMA 1ZXTA 1Y1VH 3H0GH 1YZ6A 4QUFA 1XX8A 5IYCG 1HNZL 5KEEA 1JB7A 1KHIA 3PUWA 4Q0FA 3HOYH 4NMZA 3WDNA 3K81C 4BA1I 3Q0AA 2YTVA 1HCZA 4U673 2DNEA 3DWQA 1LTTD 2NZ1D 1I4QA 1ET6A 1JQYD 1BNZA 4XYQA 2EXDA 3GTKB 4RKLA 2R93H 2NTSA 1SNDA 2OT2A 4K2KA 1Q8IA 5GADC 3S14H 1HNWL 3R3OA 2A6HC 4GN5A 4DV4Q 1YBYA 1TT2A 2UUCL 5FO8B 2NN6I 4AYBG 4OWXB 4KV6A 3ONAB 4B08A 3U50C 5LL6X 1CHQD 2QILA 4DV2L 2JSOA 4NW2A 4K0KL 1B50A 3R2IA 4NXML 4IFDG 1JICA 1CKOA 2D5DA 2MGSA 2UUBQ 2CVRA 3U9SA 4HCEA 2CWAA 4LFAL 4B3TQ 1ICWA 2F0WA 3CCEA 3CD6A 1C4QA 4DV1L 2IW3A 1Q1EA 1D8LA 2IY5B 2FMCA 5EBDA 4DR3Q 1AE3A 1PFSA 4DGZA 2ZT9C 2FINB 3DEPA 2DUDA 3S2HH 3MXNA 2E2HH 2HDLA 2O4XA 3RUZA 3J7AF 1W2BA 1PH2A 4GLXA 1GUTA 4LF8Q 3SR1A 4OWWB 4A3GH 1RODA 4GKJL 1LTSD 3NP8A 2SEBD 1K3RA 1UNSA 1E1TA 4A3IG 4JI8Q 4IQZA 4BY1H 3Q24A 1GKHA 1K73C 4QJFA 3BDOA 1EYAA 1LTLA 3GV6A 1SR3A 1VF7A 5KIXA 1C48A 1W6JA 5COYA 3NTKA 1XPUA 1E22A 1KDCA 1PXUA 1SE3A 1KD1C 2AUKA 2D0OA 2F03A 2A68C 4BY7H 4RKBA 5FLXc 4EQPA 3M3YH 1LLRD 1SXTA 3QOLA 1SNMA 2RDHA 4F7XA 3CCRA 3G4SA 3EQLC 2WP8J 5E1FA 4Y52H 3P1HA 1WCMG 2CFMA 5ELDA 2PQEA 1N36L 5NUCA 3TZUA 4KK7A 2R92H 3I4NG 1STAA 2Z6KC 3W3AA 5C5LA 1HFNA 5IGEA 1EY9A 1PYWD 3EVQA 3QR8A 5KNDA 2Q8RE 1BO0A 1E3PA 3HFZB 1D6EC 2G9HD 2RBMA 4GS3A 1QUQA 1YJNA 2ZXPA 1M8AA 2F0SA 3NSWA 3MC0B 3CC2A 1TS5A 4IALA 1VCIA 4B3RL 1UEAB 3K7AH 4LF6L 5IIFA 5D65A 5I9OA 1VQKA 3OTOQ 4ZYSA 5LMNW 1ASZA 1OO9B 3HKSA 4KJOA 3DWPA 1Q1BA 2I5HA 1F9PA 3D6WA 3OPOA 4NXMQ 1SJED 4DNTB 4G7OC 1WCMB 4EQ5A 4DN4M 1D1IA 2ZTEA 5FLXL 2B8GA 4JV5L 3OMGA 4LFAQ 5J1ZA 3PF4A 4MTKA 4A3JH 2K75A 1GUWA 3I4NB 1IKLA 3CQZB 4K8JA 1ML0D 3K5OA 3HOXG 5EKLA 5AFWA 1PH5A 2PYKA 4IUQA 1N34L 4O2DA 2FXQA 2EY5A 3HOZH 3MZ5A 4BBSB 4C3JH 4CKBA 4HAEA 1B70B 1I6HB 3MFYA 3KF6B 4H02A 2WAQE 3J80i 2NVTH 1EIGA 3SK8A 1NUCA 3KF8A 4JI2L 4R9WA 4GKJQ 3M4OB 2K5WA 1VQOA 3EBEA 4UHVA 1CA6A 1JC7A 2MO0A 3K0YA 2RCFA 3MXGA 3M7NA 3HOWG 4QB4A 2KOLA 3F2CA 4IUPA 2OF1A 1FYCA 3CAMA 4K8IA 2FMMA 2JA8G 2NVXB 3MTSA 1HQRD 4KTAA 4CBVA 3ERSX 2TMPA 2B2TC 2XN9C 2JYOA 3E6ZX 3K7UC 1U0LA 1BCPC 4A3BG 2RHQB 1DOKA 2IPKD 3J80c 3HOXB 1PH8A 1U4PA 1PFMA 4DV0Q 3IFTA 2Z8LA 1O7LA 2AQ2B 1JWSD 3I72A 5CBAE 1V8QA 4OO1G 5IY0A 2Q2HA 5I2XA 2I0QA 1HXYD 1EU3A 1CTMA 4DAYA 2CH4A 3CPFA 3P75A 2WV6D 1WTWA 5JPMC 2ES2A 1N36Q 2UXDL 4GN3B 2L1BA 3I3CA 3K80C 3SK4A 1VQ7A 1SNQA 1AH9A 2SOBA 1LV9A 1NCVA 2K04A 3HOWB 3V2TA 3VYSA 2V1CC 1PHJA 1SYCA 1Y1WH 2JA8B 4QIWB 2OWOA 4I7AA 5M3FH 2EYLA 2IHEA 4GN4B 3HOVH 5C3EH 3CC4A 4APVA 2ENBA 1ILPA 5T1IA 2ZTDA 1KLGD 1BCPB 4DV7Q 3PUXA 4A3BB 2ZM6Q 1NY4A 2K6AA 5BN5A 3OHXC 4FDBA 4JI5L 5KNBA 3O13A 4B3RQ 3STBD 1NR4A 2EY6A 3E3XA 1LTBD 3GTJB 4CHTB 1RL2A 5JEAJ 5I6WA 1M90C 4LW1A 3V96A 3I4MG 2KQ3A 1EOTA 3KJOA 2PO4A 5KRUA 3J80L 1EY5A 3LNNA 3H15A 4L5TA 1X3PA 1B4OA 3J81E 2E74C 3NE5B 4ZQ3A 1A3UA 3S17B 3TQYA 2F0EA 4BBRH 1Y69U 4KN7C 5D14A 4DU9A 1A8VA 4GOPC 1O7ZA 1D2BA 2B8FA 1EZ8A 3QJYA 2Z9HA 4NXNQ 1W6KA 1N34Q 3AFQA 2HD3A 1QB5D 2E2DC 1PRTC 2ATWA 4CDFC 1YITA 4A93G 4YWLA 5FLMH 3S1RH 1Q12A 2IX1A 3U4VA 2D9UA 3HZXA 3E5SA 4LUVA 1OXUA 4OWTB 2F0UA 4ZLTF 2BDNA 3H3VI 1K8MA 2PPBC 4FXDA 1N32Q 2B2YA 3NWSA 3OSOA 2GVBA 1VQGA 1L1OA 1VMPA 1K9MC 4FYDA 1V1PB 4JPBW 1X56A 3E0EA 2VZAA 3K57A 3CW2C 3K58A 4CKCA 4O1NA 4GNXC 4OIJA 1HR0L 2DGYA 1BKBA 4JI4Q 5EJWA 1F2LA 4ZAIA 3RR5A 2F52A 2F0LA 3KLSA 4POGA 2IL8A 1I50B 1VQIA 4GOPB 4YHHL 2ZJPA 1I6VC 1X55A 1HZAA 3NK9A 5GAHC 3P7JA 3G48A 4MNOA 1QVFA 1STYA 1VMCA 5JJIA 1PRTB 2LY7A 3QG1A 5JPNC 2K5NA 1I4PA 5IGFA 3CCSA 1EFWA 2XWBB 3L2PA 2B29A 1A2TA 1MKHA 1HTPA 4IZ8A 2EYJA 1R9TB 4A3LH 4JI0Q 3VR5A 2E5LL 2NVYH 1PYBA 3GV3A 5CV8A 1K0RA 2F0MA 4XDXA 1HRJA 3CCQA 2HQEA 1SMYC 5M5XH 1JOKA 1RHPA 4GNXB 1S3OA 4FNFA 1WTOA 2EJFC 2L11A 1XPOA 4HJ5A 2JQOA 1QNKA 3RD4A 3DM1A 1E24A 3ULPA 1DZ1A 2OQKA 5GQOA 3HP3A 4NDXA 4DR1L 1RCVD 2EIFA 3BG3A 3DWAA 4IPGA 4JI1Q 2AQ1B 4KY5A 2VNUD 2EZVA 5HY6A 5IWAL 1AZPA 1OXSC 1CZGA 1EY4A 2OXPA 5IYBH 1ENFA 4JBWA 4RGOS 2AWOA 4YCUA 3U9OA 5C6AA 4WJWA 1ONLA 2VY3A 2JA7H 2VS1A 2RCNA 3S9WA 1IYUA 3WWVA 3GTQH 1RTOA 1MBYA 3C1FA 2B63G 1KNAA 1HFGA 4RHRA 1B44D 1J8IA 4HEDA 2I5LX 3ULJA 4FF2A 2D62A 4HMIA 4XT3B 1DJRD 2NN6H 4O0AA 2DN8A 3D4DA 1YEZA 3M7GA 1B8AA 3ZJYC 4X6AH 3C46A 1YJ9A 5C44G 1QNUA 3HOUH 3KOJA 3PO2G 1ESRA 3DM3A 4YIJA 3J7YW 1V43A 1EUJA 3R93A 4OHJA 1KQSA 2JA9A 4LF5Q 3L0OA 1S5DD 1EIYB 1QE6A 2X6GA 4IUUA 1KAWA 4DR3L 2B63B 3T1HQ 2ICEC 2SNSA 1B9NA 1YHBA 1G2SA 3GDEA 1KRTA 2PZTA 3J7A5 4XYOA 3K5NA 1H9SA 1XWEA 2A69C 4H0LC 1UUPA 1TWGH 3H09A 3RN2A 3KLRA 4LF8L 4OL7A 1HNXQ 4DUZQ 4B3MQ 4B9WA 1PFNA 1E2ZA 3H91A 5C44B 1VQNA 3AEVA 2B2VA 4N8FA 1E0BA 2BE5C 1F2ZA 3J81j 1L0XB 5C5MA 3PO2B 5JJLA 1LT3D 4JI8L 3DUZA 5IYDH 2R93G 2WB1E 2IT1A 1PTOB 1C0AA 4QIWE 2F0JA 2RA4A 2RHSB 1JJCB 1GHJA 2WKDA 3H0GB 5D3DA 3S1NH 1F2MA 2K14A 5IOCA 3PQIA 2R7ZH 1SAPA 4KMUC 4PZ6A 4DKAC 5A2QE 5JVG3 2JA5G 1LT5D 4R8IA 1SYBA 5IWAQ 1CA5A 1PDQA 4A3FH 2F0OA 4LWCA 5CGKA 1U4LA 3I8ZA 1KNEA 4NPSA 2F3IA 1BDOA 1S5BD 4J15A 2EYOA 4UP8A 5ELOA 2IX3A 3SEBA 2F4VQ 2HHHL 1RIPA 5C3WA 2R93B 3UDIA 5LMUQ 1S5CD 2VUMH 1A0IA 3VR3A 3RNUA 3S14B 1M4VA 5M5WH 2GA4B 4OIKA 3CMEA 4N8X1 4ZK9B 4A3GG 1PLFA 3JAMi 2VQFQ 1I3QB 5ELCA 1IW7C 4Q5VA 2L9HA 3VYRA 4HIDA 3HRZC 4DUYQ 1HUMA 2JA5B 4BY1G 3LGJA 3AU7A 3OTOL 2XIWA 1B3QA 2N49A 2AKWB 1BCPF 4GLAC 4X64Q 3BYYB 1WYDA 1CKNB 4RFBA 4IPCA 2QDLA 2K05A 3SGIA 5FJ8H 5KNCA 3JAMc 1G2TA 4BY7G 3S2HB 4G4KA 2O5IC 5K36H 1O80A 1WTQA 1G6ZA 4PNYA 2E2HB 1KABA 2F0IA 3HEJA 4K5XA 3C1EA 5BR8Q 3OWFA 4A3GB 4ID6A 1HZCA 3H6MA 5FOBB 1Y8OB 1SLJA 4O42A 1TIID 4QF4A 3NBIA 5I2YA 4BXXG 5BN3A 1VDZA 3IKJA 1IL2A 3TS2A 2R92G 1LTGD 2N8NA 1PH6A 4BY1B 1SJHD 1VQEA 3H94A 3HG9A 5CMDA 4DNRB 5JEAH 4ZCKA 2YTXA 3FKIH 3S2DH 3ZYYX 3CXCA 1V9PA 2CW0C 3B6YA 2EDGA 1T9HA 2IHFA 3VDYA 3T56B 1MGSA 1PZID 2X6LA 3JC66 3TP7A 1QUQB 1Y14B 5M3MG 4HJ7A 1ENCA 2Q8IB 2Y0SE 3KLSX 4RGMA 4BY7B 1PYSB 2NUCA 1I4XA 4DPGA 3F2DA 1G8ZD 1HTLD 3M3YB 3TRZA 5D3IB 1IBKL 4DV0L 3KJPA 3FP9A 4C1NK 5KYLA 1HA6A 2J0TD 3JAML 2IWHA 3M4YA 3NQIA 4C3HG 4G7HC 5LMNQ 4P73A 3GTOB 4HIOA 5JAVA 1FGBD 3KFUA 4UPAA 4N9TA 2R92B 4AQYQ 4C2MH 3GO5A 3M9BA 1PH1A 5JJKA 2RQXA 1PRTF 1S72A 3EJIA 5ELFA 1VQ4A 3CRLC 1M1KC 4BA2I 1DXMA 4KHZA 1QCBD 4MHEA 1SNPA 2HHHQ 5IODA 1LTRD 1BQQT 2M2LA 5M3MB 1QG7A 1E7ZA 3A7AB 3PF5A 4C3JG 1XTCD 4KY6A 5C4ZA 3IFDA 1C9OA 2IJ0A 2KCCA 2E2IH 3K7AB 4TVAB 4HIMA 2RVLA 1I94L 4KHVA 3F8TA 3HGBA 4DV7L 4BBSG 2ZM6L 2JXMB 5AJ3Q 1VQFA 2EE1A 2TSSA 4X62Q 4RWSC 3D3RA 2K50A 3EIVA 1TWFB 3J7AV 3Q6SA 4N9PA 1EY0A 5IP9H 4C3HB 1JORA 2DJGC 2WIIB 4A3IH 1F77A 3D8GA 4PZ8A 5JOBA 1UWVA 4NKLA 3DHQA 1TY2A 3QWNA 1UAPA 2AQ3B 3A74A 1DOLA 2VXWA 5EGTA 4X3SA 3WOEA 2EQSA 4LUZA 2OTLA 2YTYA 2KA7A 4F88A 1EY7A 1NNXA 4H13C 1EQTA 4J1MA 1SE4A 3HOZB 4DR4Q 4C3JB 1EIHA 5KGUA 4P72A 1TWCB 4NXNL 1YNNC 2NVTB 4K2LA 1MSGA 2PZUA 4HSPA 3MVVA 2A8VA 2HQLA 4DR6Q 1CSQA 3H3VH 3RZDH 1SDFA 4BS9A 3T4AC 2QW7A 2N78A 3OW7A 5K5PA 4KJNA 5DEHA 2E76C 1A6XA 2EJGC 1WCMH 4FP5D 1N32L 2LSSA 1V1QA 1XTDA 3D6CA 4IURA 4R4TA 1PH3A 1JMCA 1CQFA 5M3FG 4QMGA 4JOIC 5C3EG 1KXLA 1BCPD 4OX9L 3I56A 1I5FA 2PQAA 1CZWA 3MXPA 3NXWA 2WB1G 1UE5A 3PV0A 4X3KA 1WI5A 2ZXOA 4XT1B 2ASBA 1B2TA 2LMCB 1KL9A 4JI4L 1CM9A 2EPBA 2B2UA 4JG2A 4Z9CB 3SHLA 3D31A 2H5XA 1XPRA 4KY7A 1I6HH 4H44C 1ILQA 2F0PA 2CQAA 2B2YC 2B3GA 2I5MX 4ALPA 2BH8A 1Q90A 1IBKQ 1D5MC 5CV6A 3PO3G 3CCJA 2E8GA 2WFWA 2PZWA 3QO2A 1UE1A 3K5MA 1PZJD 3DLLA 1QJOA 3RLNA 3I90A 3NBHB 1WTVA 2KHIA 2K01A 4B3SQ 2MHVA 4BBRG 4JI0L 1S5ED 4A3MG 2NVXH 2PNHA 4C56C 4KN4C 4IFDI 1ZYRC 4DXFA 3G71A 2G5DA 2Z6KA 1GM5A 3D4WA 1JB3A 5M3FB 1ESFA 2VW9A 1EWCA 4OXPA 3S24A 5C3EB 1PA6A 2JJQA 1B3AA 4NB3A 3HOXH 2WB1B 4LF4Q 5EQ0A 5TSSA 2BCOA 5IGCA 4A3EG 2PW5A 4A4IA 3CP0A 1I94Q 2NZOA 1PTOF 1HH2P 2AWNA 2EYHA 1CQVA 4JI1L 4Y7NB 1RDPD 4A3KH 1EYGA 4NP5A 4IOAA 4DF7A 3FDTA 4KHPQ 3PO3B 4LUOA 5IP7H 1VQJA 1VQPA 1K83H 3TSSA 1Z6HA 1L0WA 3S1MB 2A74C 5IT9c 1XYIA 2GVAA 4XQJA 1SYEA 1IKMA 1SROA 2P5ZX 4P2CB 1X3FA 2KUMA 4BBRB 1EZ6A 1RD9D 4A3MB 2F0KA 3EROA 2JA8H 4R4CA 2KEDA 4FO2A 4UAIA 3CKIB 2J4XA 4U68A 1RKNA 3GTGH 1KLUD 3OYYA 1PRTD 2EYMA 4OONA 1IL8A 1K3BC 4R1JA 4DR2Q 2A5HA 1P16A 1E2VA 1GUSA 3S1RB 4CDCC 3F1ZA 2KCTA 3I55A 4YWMA 2NYZD 5GROA 2F0TA 4A3EB 1D5XC 2XGTA 3STBC 3Q23A 2Q2TA 5HURA 3GTMH 1X3QA 4DFAA 4A3LG 2O2LD 1U9RA 2K5HA 1XNRQ 3LX0A 3C2PA 1Q86C 3NELA 1EU4A 2C9OA 2K28A 3SK6A 4IFDJ 2JN4A 4X66L 4HCSA 2RDFA 4FF3A 2JA6H 2CQOA 5EKIA 3BDCA 4DA2A 3FHWA 4L5QA 3CC7A 1TXYA 5ELNA 4H7BA 1H9MA 2CHBD 4OX9Q 2L5TA 2CCZA 3I4OA 2J7ZA 4WORA 4IUNA 1A3TA 2RDGA 4ODGA 3TN2A 4LF5L 4TRDA 4KKTA 5A35A 3MEHA 2B2TA 1JWMD 2Y0SG 3FPPA 5IT9L 1IYJB 2KBNA 4HJ8A 1CHPD 4IO9A 3T1HL 5GAEC 3W2DA 2RSNA 3ICEA 2HIXA 4TSSA 5FLXE 1DM0B 4IPDA 1LTID 4JBMA 5GAGC 1STGA 5ELEA 5IYBG 1FNUA 3F2BA 4A76A 5DM63 2MUYA 1X9NA 3I4MH 1K8AC 1HNXL 2JA7G 4DUZL 4B3ML 1MD2D 5ISRA 2YU9H 3S16H 5A2QL 1S40A 1SMYD 1TWAH 3RZOH 5C0XG 4TQUS 3PGZA 3S1QH 3Q8DA 1QILA 5M5XB 3MWYW 3BU2A 1F9SA 2CWPA 2KJXA 5M5YH 4HR7B 3Q22A 4DR5Q 4RG1A 2K32A 3OOCA 2NBFA 3VR4A 1IBMQ 3W1GA 4P75A 1BF4A 2Z4IA 4POFA 3T53B 1FJGL 1TU2B 1GUNA 3EN2A 4DK0A 3I70A 4X3TA 1II3A 2R61A 2Y0SB 3TP5A 2MNAA 2F0FA 5HGQA 3TP6A 1F9RA 4A93H 1WJJA 1NJIC 5CC4A 2MFIA 5M9OA 1K8OA 4K14A 1UE7A 5H1SE 2B2VC 1LABA 1NSNS 3HOUG 2ALYB 2Z6BA 2LS01 4DV6Q 2A6EC 3V05A 2QGQA 1V1PA 4XIGS 2JA7B 4MZ9A 4MTNA 1TQOA 1PH4A 3D0FA 2ZJRA 2RSOA 3I7FA 1KDAA 5L37A 5IGGA 4P71A 1DCZA 4A3DH 3A8KE 3GTLH 3U58A 1ZEQX 4QY7A 1ENAA 1Y8NB 1MJCA 2HCCA 2PCFB 1XMQL 2F4VL 1LT4D 5LMUL 1AZQA 1EQRA 4LNQA 2OTJA 1N8RC 3FRPB 1GO3E 4OGQC 3CCLA 2UU9L 1JCKB 5C4XH 3DMUA 2VQFL 5DNFA 2BDOA 3BZCA 3T1YQ 1C7YA 2QA4A 2HDMA 3HOUB 5DM73 5E7NA 4DUYL 3ITPA 3BZKA 3VYTA 3PMFA 3NPPA 1PTOD 2CH4W 5IYDG 4LAAA 4X66Q 4OO1I 4C3IH 2GN5A 1JR0D 3PCOB 2B39A 3T13A 4X64L 3BYTB 1V1OA 4LF9L 1B9MA 3AB9A 4GNXA 4RMFA 1SYGA 4DAMA 1XNQQ 1H9KA 2A69D 3GTPH 3E9IA 1CK1A 1W3SA 3J80E 4RCNA 4LMQD 1Y1VG 3H0GG 3MFGA 1TWGB 2UXCQ 2Z1CA 1ASYA 4A3FG 3FEWX 5BR8L 2D2CC 5CYUA 3VA7A 5HGTA 3CRKC 2QEXA 1SFOB 4KD3A 2NVQB 4JI6Q 4JK1C 1YI2A 5FKAC 2BE5D 1STEA 5LL6S 3FVQA 3HOYG 4DR7Q 2PMZE 2EOTA 1D7QA 5E4XA 2AMCB 2FFKB 2LKVA 1K0SA 4V0BA 4PZ7A 3T16A 1YNJC 3NHHA 3P20A 1DD2A 1XMOQ 1TWHH 4K6DA 4CKEA 2E2JB 4DK3C 4OELB 3RN5A 5IGBA 2B63H 1SRUA 4S3SA 2K1BA 2UUAQ 4A3CH 1AP0A 2L15A 1IBLL 1FJGQ 4AH6A 1NTGA 1WTHA 2WKCA 3FMCA 3M85A 1Y1VB 2F0DA 3KDFA 3NENA 1A3VA 1CI3M 1E1OA 3GP7A 3W5OA 4A3FB 1STNA 2KVMA 1KTKA 2XNAC 3TS0A 5DLQE 4GLVB 1HUNA 1BVSA 1EEID 1GUGA 5C44H 4FXGC 1LT6D 4HIKA 1B7YB 1PVOA 1PZKD 3OIQA 3VYUA 3HOYB 1HR0W 5EPLA 5LMNL 3MAQA 4RH6A 4YWKA 3BVGA 5EPJA 1HJPA 1VQDA 1SN8A 3N6RA 4WRDA 4AQYL 1PTOH 1SE8A 2LXKA 1QVCA 3RMHA 3LWUA 5FO7B 5LHY1 1WD0A 1FL0A 1A15A 1R4PB 1XMQQ 3BVZA 4F8MA 1IW7D 1MSHA 1LO5D 1RF2D 1GOZA 2A6HD 3MXNB 2X69A 3S15H 5C4JH 2KCNA 2N55A 1I4HA 3A5UA 4FVMA 4PG3A 1VQ6A 2UU9Q 1AEXA 1Q46A 2K4KA 3WOFA 2QF7A 4UDUC 4YY3L 1H9JA 2EVBA 2R3ZA 4UP7A 5T1GA 5AJ3L 3GD7A 5JEAG 2B2WA 4X62L 1JWUD 5FK9C 3MEFA 3FKIG 3X3MA 4KI0A 1QZGA 4HSVA 4J8QA 4ILWA 1RJTA 2FJ2A 2KECA 3I73A 3NUCA 3AQQA 5C0XI 1HPCA 4PMBA 2V4DA 4LF9Q 2KCMA 3J81i 2ID0A 5F2DA 4QCLA 1LYLA 4R4QA 3GTKH 3IAYA 4R4OA 3SE0A 1Q7YC 4WJ4A 4P74A 1I3QH 4DV5L 4JC0A 5G3LF 1X32A 2NTTA 5IE8A 4ZKCB 4BWGB 3IRBA 2PI2E 5BN4A 5EKKA 1DOMA 4DR4L 3E9HA 2JA5H 5EPKA 5E3FA 1Q8KA 4GKKQ 3SXHA 4JI3Q 4DV3Q 2L4NA 4WJ3M 4MIUA 4DR6L 2CW0D 3TZDA 5IYCH 4XXEA 3TP8A 1G6PA 3FKIB 5CBEE 3RLFA 3S2DB 1JT8A 1O78A 1BOSA 4PMCA 3J81c 4YCVA 1VQ8A 4OEMB 3PUVA 4ULLA 4IPHA 3KUPA 2R7FA 3L7ZC 3MXUA 4CDDC 1ZKOA 1EQVA 1HZBA 1VQ9A 4M8AA 1GHKA 2A68D 1BR9A 4IJHA 1IBLQ 3D4RA 4AYBB 4LK1C 1CT1D 4ZRZA 2XTIA 2VQEL 2HUGA 2EJMA 4LFBQ 1AFPA 2M9VA 5IP9G 4XTCS 3N52A 2F1MA 2I07B 5EBCA 5C0XJ 2OCEA 1H9RA 4HN7A 4QUCA 2NZHA 2RKSA 4LF7L 1OXXK 4LFCQ 4C2MB 2BA1A 1FGUA 3QB3A 2BH2A 1DGSA 1TR5A 2ZXRA 4IFDH 2QEJC 1CKNA 4B3SL 4A3JG 2CKZB 1TY0A 2B2UC 3RLOA 4RGNA 5JJZA 1Z9FA 4KLKA 1X3EA 3MHBA 4UY8C 4X65L 5C4HA 3NQTA 2E2IB 3CCVA 1UE6A 2F0QA 3HKZG 3W1BA 4LF4L 3HOZG 1E2WA 2F0GA 3CCUA 1KIXA 3J81L 1Z47A 1X65A 3CHBD 1STHA 1EIFA 2KHSA 3H3VC 2K52A 3SK5A 1EL0A 1HNZQ 3K5LA 1DYQA 1EFID 1NAPA 1J6QA 5I6YA 1AE2A 3G6JB 4L8JA 4YY3Q 1S4ZA 1GXDC 3GTOH 1VQCA 4BXXH 1UEBA 2H4OA 1U5KA 1VQBA 3KF8B 4A3IB 1VQMA 4KHPL 4ZUIA 1BUVT 2F3WA 1Q3LA 2PQAB 1MIUA 1AN8A 2JEBI 4RGTA 5J39A 1JJ2A 4PV1C 4A3JB 1YHQA 3AYHB 5M3MH 2WINB 1NBWA 1SYDA 2QDBA 4G57A 1VQ5A 1HNWQ 2XWJB 3F2UA 1VQLA 1YNND 1EWHA 4L63B 5JVH3 4RA8A 2UUCQ 3TMEA 4HMJA 4DV5Q 4XQQA 2R7DA 2HCIA 4DR2L 3HKZB 2XSCA 4X3UA 1EYCA 2ICIA 4DV2Q 1QWYA 2DNCA 3PIPA 3RZDB 4K0KQ 1TWFH 1WTRA 3A54A 1XXGA 4HJ9A 2EY2A 4JBJA 1NE3A 3UDFA 3A0JA 1WVLA 4C3HH 4DAYB 1T5EA 2SNMA 4M1UB 1XNRL 2YV5A 3OIPA 1FNWA 1QZHA 1H95A 4UP9A 3L9AX 2AUJD 3PSIA 4DV1Q 1GJXA 1XJVA 1A2UA 3L3OC 1Y1WG 3I4NH 1K28A 3CQZH 3HOVG 1CSPA 3ND8A 4EQOA 2K03A 1SEBD 1Y8PB 1TWCH 4IOCA 4A3KG 4PMWA 5CORA 2XRSD 3ND9A 4L6TB 4BBSH 1EY8A 4F87A 2F0VA 1P8LA 2VQEQ 5IP7G 3EA6A 3KBXA 2KEEA 3OWEB 5G3LD 3J7ZC 1TS3A 1EQQA 2VB3X 3MA2B 3PIOA 4CJ1B 2OQ0A 1L1OC 1G291 4ME3A 1OTCA 1TVXA 2K5VA 5CV5A 2EXZA 2F0NA 4LF7Q 3M4OH 1ZYRD 2RF4A 2PMZB 4ZKBB 5IGDA 4JBKA 2L55A 1U4RA 3NTHA 3K6OA 2MJ8A 1LACA 1ET9A 1RTNA 1Z7TA 2VB2X 5CV9A 1PFBA 1Y1WB 1NMGA 4DR5L 2Q8TA 1OXVA 3PIP3 1PMRA 3HOVB 4X65Q 1IBML 1L0YB 2I46A 3ER0A 1F2YA 4JI7L 1IZ6A 4K5VA 4KKSA 1B53A 5FLMG 2DY8A 3K8AA 1J5EL 4A3KB 2O5JC 1SNCA 4CDEC 1OXTA 4JYAL 4K6LA 1QVGA 4CGYB 4CJ2C 2L12A 2JA6G 1JOQA 1EWIA 3KF6A 1K83B 1YHAA 4ZUJA 1N33L 1O7YA 4DV6L 1LTAD 2PNRC 1L1OB 2Q2IA 4EVOA 2F4IA 4KKUA 1EOVA 3NWTA 5I9PA 1VS0A 3UE0A 3HS0C 4AIMA 3A8IE 3G7LA 3GTGB 3HOWH 2Z4HA 3JAME 2PW7A 4DK1A 4RHSA 3UDGA 3I91A 1JOOA 2K33A 5DAUA 3PIO3 3T51B 4LF6Q 2AHOB 2DY7A 4A3BH 4V190 4Y7NH 2IX0A 1D1KA 1STBA 5EAYA 3AFPA 3CMAA 3QIAA 3GTMB 3I2ZA 4J6HA 3BS1A 1MHWC 3BJUA 1WFQA 3PO3H 1EY6A 2C5CA 2JE6I 1SE2A 3GTJH 3T1YL 3S1MH 2WACA 2JA6B 3NBHA 2UXBL 1F9QA 4OO1H 2ZJQA 1PV4A 4JV5Q 1CUKA 1YNXA 2QCPX 4A3MH 1PH7A 2MP1A 2Q2UA 3S17H 2K5QA 4G7ZC 4JOIA 1GD7A 3FPUB 2VL6A 1WD1A 3M4QA 1C8CA 4I65A 1HA5A 4C1NI 3BVMA 1VQAA 3C3LA 1XNQL 4AYBE 3PUYA 2Z0SA 4A3EH 2JP1A 3KLWA 3CU7A 2R6GA 3A8JE 1T5XD 3LWEA 2UXCL 4JI2Q 3A7LA 1G91A 3I4MB 2A1AA 3DEOA 3ULLA 1U4MA 1IXRA 1IHZA 2YU9B 4JI6L 4EX5A 3S16B 3BDLA 3R8BA 1KC8C 1TWAB 3RZOB 4L5SA 4DR7L 1SNOA 1NMFA 4A75A 3S1QB 1MJEA 5CV4A 4A3DG 2NVYB 3GQBA 1JE4A 1X6OA 1DONA 4FXKC 1FR3A 2XVSA 1YIJA 5C3XA 5M5YB 1NR2A 3NTIA 5I4DA 4RCOA 3R2TA 3KYHC 4JW0A 4E6IA 5J22A 1HQMC 4EQNA 1XMOL 5FO9B 1EYDA 1BBUA 4ME5A 3CPWA 2OEOA 3OW2A 4DXGA 5C4XG 2UUAL 2NN6G 1FNVA 1I50H 4JI7Q 4A93B 1YJWA 1FD7D 3TEHB 4FF4A 2EYPA 2A6ED 2EYFA 3IL8A 1J5EQ 4JYAQ 4QQBX 1VF5C 4IJLA 1KAAA 4C3IG 2F3VA 4K5WA 2UXDQ 2M00A 4R4IA 3UE1A 1N33Q 4R8NA 1R9TH 3KK7A 1N9WA 1SYFA 3UI2A 4A3DB 4FF1A 3GTLB 1YVCA 2HIVA 2QKIC 5ELBA 4GZYC 4MN3A 3KBGA 2A19A 3OMCA 4IUVA 1JE5A 5E4WC 1SMXA 1GVPA 3GTQB 3URYA 1TKWB 1WOCA 2C35B 1LM0A 2N3SA 1A62A 3VA5A 4JI5Q 2JEAI 3HKZE 5C4XB 3SVMA 1H9SB 2PI2A 4GOPA 3E0JA 4RAUC 1CFMA 4JCVE 1R4QB 3DXJC 3EFXD 5CV7A 1B1ZA 1MI2A 2FHTA 1X54A 2BA0A 2LFNA 1WTPA 3ERQA 2K5DA 2UXBQ 4C3IB 4B9XA 3VR6A 2KHJA 1GUOA 5C0XH 1I4RA 3TREA 4EGVA 1JJGA 3K0XA 2MQHA 4A3CG 4L5RC 3QOJA 4DAPA 4TKOB 1L2FA 3GTPB 2G9DA 4DV4L 4PQXA 3KDFB 3CCMA 2NB0A 3VR2A 4XQNA 2R7ZG 2B2WC 2XRQD 4LJZC 1KDBA 1EEFD 2MO1A 2WAQG 4ABNA 2K7VA 3G6EA 1J9OA 4CJ0B 4I7ZC 1BBXC 3U4ZA 4HJAA 1HHVA 4JVZA 1AW7A 4GKKL 4JI3L 4HTHA 4DNIA 1YNJD 4DV3L 1PTOC 2E75C 3NEMA 1TS2A 2UUBL 3CF5A 1O7IA 1X3GA 4B3TL 3TDQA 1TWHB 1HR0Q 3K59A 4IUTA 1A63A 2SDFA 1I4GA 1IYVA 2VUMG 4YHHQ 2HT1A 4WFN3 2N88A 1PH9A 3A5ZB 3I4LA 1Q82C 1ICFB 1BBWA 1SBBB 1K8GA 4DAVA 3S1NB 1HZ9A 2MPMA 1LUZA 1S5FD 2A73B 2D0PA 1SFOH 2R7ZB 2NVQH 2NWGA 2KENA 2WAQB 3X3NA 1VQHA 2DJFC 2EY1A 3A55A 4LFBL 2E5LQ 5J3BA 1WTXA 2H1EA 1KRSA 3A56A 5IT9E 2YYZA 2L0CA 2F0HA 3AMUA 4YCWA 4IN3A 4QGUA 4LFCL 1FVIA 4DK6C 1Q81C 2E2JH 3PO2H 3SDZA 2LXJA 4KD4A 3UDXA 5KYIA 1TS4A 4QL5A 5FJ8G 5CR3A 1G51A 2BOSA 1QOHA 3PUZA 3TBIB 5K36G 2ZTCA 1SSOA 3S15B 3BZDB 5C4JB 1D5ZC 4DR1Q 2VUMB 1BXTA 3M4PA
chains in the Genus database with same CATH topology
3ULPA 3CCUA 1KIXA 2JK8A 1CKMA 2OQKA 5GQOA 1Y1VH 4DR1L 3H0GH 1Z47A 2EIFA 1X65A 4A4IA 3CP0A 4A3EG 1EIFA 4IPGA 1YZ6A 2K52A 4JI1Q 1HNZQ 1I94Q 2VNUD 2NZOA 1J6QA 1AE2A 1HH2P 5HY6A 2AWNA 5IWAL 4JI1L 4A3KH 1OXSC 4YY3Q 5IYCG 1EYGA 1HNZL 4IOAA 3GTOH 4KHPQ 1VQCA 4BXXH 1JB7A 1KHIA 1UEBA 3KF8B 1U5KA 1VQBA 3PUWA 4LUOA 5IP7H 3HOYH 1VQJA 3K81C 1K83H 5IYBH 1VQPA 4BA1I 1VQMA 4JBWA 4KHPL 1L0WA 5IT9c 2GVAA 2AWOA 4YCUA 2YTVA 1SROA 2VY3A 1X3FA 2JA7H 2PQAB 1MIUA 4GKJQ 2VS1A 2JEBI 2JA8H 2RCNA 4R4CA 1JJ2A 3WWVA 1YHQA 3AYHB 3GTQH 5M3MH 2B63G 3GTGH 2EXDA 1NBWA 3OYYA 1VQ5A 1HNWQ 2R93H 4OONA 1VQLA 4R1JA 5GADC 2UUCQ 2I5LX 3ULJA 4DR2Q 3S14H 1HNWL 2D62A 1P16A 4GN5A 4DV4Q 4DV5Q 1YBYA 4O0AA 2R7DA 2KCTA 3F1ZA 4YWMA 3I55A 4DR2L 1YEZA 2NN6I 1B8AA 2UUCL 4AYBG 5GROA 4OWXB 3ZJYC 4X6AH 2XGTA 3STBC 4DV2Q 2Q2TA 3PIPA 3U50C 4K0KQ 1TWFH 3GTMH 4A3LG 2K5HA 1YJ9A 1XNRQ 4DV2L 5C44G 4HJ9A 1Q86C 4JBJA 3NELA 1NE3A 3UDFA 4K0KL 3A0JA 4C3HH 4DAYB 4NXML 4IFDG 1CKOA 1XNRL 3HOUH 4IFDJ 3KOJA 2YV5A 4X66L 3PO2G 2JA6H 3DM3A 1QZHA 2UUBQ 1H95A 2CQOA 4UP9A 2CWAA 4LFAL 3PSIA 1V43A 1EUJA 3FHWA 4L5QA 4B3TQ 4DV1Q 3CC7A 3CCEA 1TXYA 1XJVA 3CD6A 5ELNA 2JA9A 1KQSA 4LF5Q 4OX9Q 3L0OA 4DV1L 1Q1EA 1Y1WG 1D8LA 2CCZA 4DR3Q 1EIYB 3I4NH 2IY5B 1AE3A 3CQZH 1PFSA 3I4OA 3HOVG 1CSPA 4LF5L 1KAWA 4DR3L 3T1HQ 2DUDA 3S2HH 2Y0SG 1IYJB 1YHBA 2KBNA 3GDEA 1KRTA 2E2HH 4HJ8A 4IOCA 1TWCH 4IO9A 3T1HL 1W2BA 1PH2A 3J7A5 4GLXA 4PMWA 5GAEC 4A3KG 3ICEA 2HIXA 4LF8Q 4B3RQ 4OWWB 1TWGH 3W1BA 4BBSH 4A3GH 4IPDA 4JBMA 4LF4L 1P8LA 3RN2A 5GAGC 2VQEQ 5IP7G 4LF8L 5IYBG 3J7ZC 1HNXQ 3F2BA 4A76A 1EQQA 4DUZQ 3PIOA 4GKJL 4B3MQ 2OQ0A 1L1OC 1G291 4ME3A 1X9NA 1K8AC 1HNXL 1K3RA 1OTCA 2JA7G 3I4MH 4DUZL 1VQNA 3AEVA 1E1TA 2K5VA 4B3ML 4LF7Q 2YU9H 4A3IG 3S16H 3M4OH 4JI8Q 2RF4A 4BY1H 1S40A 3J81j 1GKHA 1TWAH 3RZOH 5C0XG 5JJLA 1K73C 4QJFA 3PGZA 4TQUS 3Q8DA 3S1QH 4JI8L 4JBKA 5IYDH 1LTLA 1VQ6A 2R93G 2WB1E 1SR3A 2IT1A 3BU2A 1C0AA 4QIWE 2CWPA 5M5YH 4DR5Q 4RG1A 1IBMQ 3W1GA 4P75A 1NMGA 4DR5L 1OXVA 2RHSB 1JJCB 4POFA 4X65Q 1XPUA 1E22A 1IBML 1FJGL 1KD1C 2D0OA 3ER0A 4JI7L 3EN2A 1IZ6A 3S1NH 4BY7H 2K14A 2R7ZH 2MNAA 5HGQA 5FLMG 5FLXc 4A93H 3K8AA 1WJJA 4PZ6A 1NJIC 1J5EL 4DKAC 2MFIA 3M3YH 1OXTA 1UE7A 5H1SE 2JA5G 4JYAL 3HOUG 5IWAQ 2ALYB 3CCRA 4A3FH 1QVGA 4DV6Q 3G4SA 2JA6G 4LWCA 1EWIA 2QGQA 3KF6A 2WP8J 1YHAA 4Y52H 1N33L 4DV6L 1WCMG 4NPSA 2CFMA 2F3IA 1L1OB 2Q2IA 1N36L 4XIGS 4J15A 4MZ9A 4MTNA 2R92H 1EOVA 1PH4A 4UP8A 3I4NG 2Z6KC 3D0FA 2ZJRA 1VS0A 5ELOA 3I7FA 3UE0A 4P71A 4AIMA 4A3DH 2F4VQ 3GTLH 3U58A 2HHHL 1RIPA 1E3PA 4QY7A 3HOWH 3HFZB 1MJCA 3UDIA 5LMUQ 4GS3A 1XMQL 2F4VL 2VUMH 3UDGA 1A0IA 3RNUA 1QUQA 5LMUL 5M5WH 1YJNA 4A3GG 3CMEA 1EQRA 4LNQA 2OTJA 1N8RC 3CC2A 1GO3E 3JAMi 2VQFQ 2AHOB 4LF6Q 3CCLA 2UU9L 4A3BH 1VCIA 4B3RL 4HIDA 5C4XH 3K7AH 2IX0A 4Y7NH 3CMAA 2VQFL 5EAYA 3AFPA 4LF6L 3I2ZA 3BZCA 1VQKA 3OTOQ 1ASZA 5LMNW 3T1YQ 3BJUA 1WFQA 3HKSA 4DUYQ 1C7YA 3PO3H 2JE6I 4BY1G 3LGJA 2QA4A 1Q1BA 3OTOL 2I5HA 3GTJH 3T1YL 5E7NA 4DUYL 3S1MH 3BZKA 2N49A 2UXBL 5IYDG 4NXMQ 2AKWB 2ZJQA 1PV4A 4JV5Q 4GLAC 4X64Q 4X66Q 4OO1I 1CUKA 4EQ5A 4C3IH 1WYDA 1YNXA 2GN5A 3PCOB 2ZTEA 1CKNB 4JV5L 4X64L 4LFAQ 4IPCA 4A3MH 1PH7A 3PF4A 4A3JH 2Q2UA 4GKKQ 2K75A 3S17H 3SGIA 4LF9L 5FJ8H 4JOIA 1GD7A 3JAMc 4GNXA 2VL6A 4RMFA 3HOXG 4BY7G 3M4QA 4DAMA 1XNQQ 3GTPH 1PH5A 3E9IA 1W3SA 1N34L 4O2DA 1VQAA 1XNQL 2FXQA 5BR8Q 4AYBE 3HOZH 1Y1VG 3H0GG 3PUYA 2Z0SA 4A3EH 2UXCQ 1ASYA 3KLWA 4A3FG 4C3JH 1HZCA 2R6GA 5BR8L 1B70B 3KF6B 4H02A 2WAQE 3J80i 1SLJA 2UXCL 2QEXA 2NVTH 4JI2Q 4JI6Q 1YI2A 4BXXG 2A1AA 4JI2L 1IL2A 3ULLA 3HOYG 1IXRA 3TS2A 4JI6L 2PMZE 4EX5A 2N8NA 1VQOA 1PH6A 1KC8C 1VQEA 2R92G 1D7QA 3EBEA 2AMCB 4L5SA 4DR7L 2MO0A 1NMFA 4A75A 1MJEA 4A3DG 2YTXA 3FKIH 3S2DH 3M7NA 1X6OA 3CXCA 3HOWG 1V9PA 4PZ7A 3B6YA 3F2CA 1YIJA 1T9HA 2IHFA 3VDYA 3CAMA 1XMOQ 1TWHH 2JA8G 3JC66 3KYHC 1QUQB 1Y14B 5M3MG 4HJ7A 4DK3C 3ERSX 1XMOL 3RN5A 2B63H 2Y0SE 1SRUA 2UUAQ 3K7UC 1BBUA 1U0LA 3CPWA 4A3BG 2RHQB 4A3CH 3OW2A 2L15A 3J80c 1PYSB 1PH8A 5C4XG 1IBLL 2UUAL 1FJGQ 4DPGA 2NN6G 3F2DA 4DV0Q 1I50H 4JI7Q 1YJWA 4AH6A 3TEHB 3TRZA 1NTGA 3M85A 1IBKL 4DV0L 3KDFA 3NENA 1J5EQ 1E1OA 3W5OA 3KJPA 4JYAQ 4OO1G 3FP9A 3TS0A 5DLQE 5IY0A 2Q2HA 4GLVB 2I0QA 4QQBX 4IJLA 1BVSA 5C44H 5LMNQ 4P73A 4HIKA 1B7YB 4HIOA 1PVOA 2UXDQ 3CPFA 3KFUA 4R4IA 4UPAA 3UE1A 1N33Q 1HR0W 2ES2A 5LMNL 1R9TH 4YWKA 4AQYQ 1N36Q 2UXDL 1N9WA 4GN3B 4C2MH 3GO5A 3M9BA 3K80C 1HJPA 1VQDA 1PH1A 5JJKA 1SN8A 1AH9A 1VQ7A 1S72A 4AQYL 1YVCA 2HIVA 1SE8A 1VQ4A 1M1KC 4BA2I 4KHZA 2V1CC 1PHJA 2A19A 2LXKA 1QVCA 1Y1WH 2HHHQ 2OWOA 1FL0A 5M3FH 2IHEA 1JE5A 1SMXA 1GVPA 4GN4B 5C3EH 3CC4A 4APVA 1XMQQ 3HOVH 1E7ZA 1WOCA 2C35B 1LM0A 2N3SA 2ZTDA 3PF5A 1C9OA 1A62A 3MXNB 3S15H 5C4JH 3PUXA 4DV7Q 4JI5Q 2E2IH 2JEAI 2ZM6Q 3A5UA 3HKZE 1NY4A 4TVAB 4HIMA 4PG3A 2PI2A 4GOPA 3F8TA 4FDBA 4JI5L 1Q46A 4DV7L 1I94L 3STBD 2ZM6L 5AJ3Q 2UU9Q 4BBSG 2K4KA 1VQFA 4X62Q 4YY3L 4JCVE 4UP7A 5AJ3L 2K50A 3GD7A 1RL2A 5JEAG 5JEAJ 3EIVA 4X62L 1M90C 1X54A 2BA0A 3MEFA 4LW1A 3I4MG 3FKIG 4KI0A 1QZGA 3KJOA 5IP9H 2UXBQ 4A3IH 3H15A 2KHJA 4L5TA 4PZ8A 4DR7Q 3AQQA 1UWVA 3TREA 5C0XI 3TQYA 1JJGA 3K0XA 4BBRH 2MQHA 3A74A 4A3CG 4L5RC 4LF9Q 2KCMA 3J81i 1L2FA 2ID0A 1A8VA 2EQSA 1LYLA 4LUZA 4GOPC 2OTLA 2YTYA 4R4QA 3GTKH 4WJ4A 4R4OA 1Q7YC 4P74A 1I3QH 4DV4L 4DV5L 4JC0A 4NXNQ 4DR4Q 3KDFB 1N34Q 3AFQA 3CCMA 2R7ZG 5IE8A 2ATWA 3IRBA 4P72A 2PI2E 1YITA 4A93G 4YWLA 4NXNL 4DR4L 2MO1A 5FLMH 3S1RH 2WAQG 3G6EA 1Q12A 2IX1A 3E9HA 2JA5H 2A8VA 3U4VA 1Q8KA 3U4ZA 2HQLA 4LUVA 1OXUA 4JI3Q 1CSQA 3H3VH 4HJAA 4DR6Q 4OWTB 4DV3Q 3RZDH 1JMCA 3H3VI 1N32Q 4GKKL 2N78A 4JI3L 4WJ3M 4DR6L 4DNIA 2GVBA 4DV3L 5IYCH 1WCMH 1VQGA 1L1OA 1K9MC 1G6PA 3NEMA 1N32L 3RLFA 2UUBL 2LSSA 1JT8A 3CF5A 1V1QA 1O7IA 1X56A 1XTDA 1X3GA 2VZAA 3E0EA 4R4TA 3J81c 3CW2C 1PH3A 4B3TL 1HR0Q 4YCVA 5M3FG 4JOIC 5C3EG 1VQ8A 1A63A 4OX9L 1KXLA 3I56A 3PUVA 1I5FA 4GNXC 1HR0L 2DGYA 2PQAA 4IPHA 2R7FA 1BKBA 1UE5A 2WB1G 3L7ZC 3PV0A 4JI4Q 1WI5A 2VUMG 2ASBA 3RR5A 1KL9A 4YHHQ 2HT1A 4JI4L 2F52A 4POGA 1HZBA 1VQ9A 1PH9A 1VQIA 4GOPB 3A5ZB 4YHHL 4JG2A 2ZJPA 4IJHA 1IBLQ 1X55A 3D31A 2H5XA 1XPRA 1Q82C 1BBWA 1HZAA 1I6HH 1K8GA 5GAHC 4MNOA 3G48A 1HZ9A 1QVFA 1LUZA 2XTIA 5JJIA 2B3GA 2D0PA 2I5MX 1SFOH 2VQEL 2BH8A 4ALPA 2NVQH 1IBKQ 4LFBQ 2KENA 2K5NA 5IP9G 3CCJA 1VQHA 4XTCS 3PO3G 2E8GA 3CCSA 1EFWA 4LFBL 2WFWA 1UE1A 2E5LQ 3DLLA 3RLNA 3L2PA 2B29A 5C0XJ 4LF7L 2OCEA 1MKHA 3NBHB 5J3BA 2NZHA 4LFCQ 4A3LH 1KRSA 1OXXK 2KHIA 2BA1A 1FGUA 2E5LL 2NVYH 1DGSA 1PYBA 2YYZA 4JI0Q 2BH2A 4B3SQ 4YCWA 4BBRG 4QGUA 1K0RA 4LFCL 1FVIA 4JI0L 1CKNA 4A3MG 4DK6C 2PNHA 2NVXH 1Q81C 2E2JH 3CCQA 4B3SL 3HOZG 4A3JG 3PO2H 4IFDI 2CKZB 3G71A 2LXJA 3UDXA 2Z6KA 1GM5A 5M5XH 5FJ8G 4QL5A 1G51A 2VW9A 4OXPA 3RLOA 3S24A 1PA6A 1Z9FA 2JJQA 3PUZA 1S3OA 1X3EA 4KLKA 4NB3A 4GNXB 5K36G 3HOXH 4UY8C 1XPOA 4HJ5A 4X65L 4LF4Q 2ZTCA 2JQOA 4DR1Q 3CCVA 3M4PA 1UE6A 3HKZG 1E24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULP A;  3CCU A;  1KIX A;  2JK8 A;  1CKM A;  2OQK A;  5GQO A;  1Y1V H;  4DR1 L;  3H0G H;  1Z47 A;  2EIF A;  1X65 A;  4A4I A;  3CP0 A;  4A3E G;  1EIF A;  4IPG A;  1YZ6 A;  2K52 A;  4JI1 Q;  1HNZ Q;  1I94 Q;  2VNU D;  2NZO A;  1J6Q A;  1AE2 A;  1HH2 P;  5HY6 A;  2AWN A;  5IWA L;  4JI1 L;  4A3K H;  1OXS C;  4YY3 Q;  5IYC G;  1EYG A;  1HNZ L;  4IOA A;  3GTO H;  4KHP Q;  1VQC A;  4BXX H;  1JB7 A;  1KHI A;  1UEB A;  3KF8 B;  1U5K A;  1VQB A;  3PUW A;  4LUO A;  5IP7 H;  3HOY H;  1VQJ A;  3K81 C;  1K83 H;  5IYB H;  1VQP A;  4BA1 I;  1VQM A;  4JBW A;  4KHP L;  1L0W A;  5IT9 c;  2GVA A;  2AWO A;  4YCU A;  2YTV A;  1SRO A;  2VY3 A;  1X3F A;  2JA7 H;  2PQA B;  1MIU A;  4GKJ Q;  2VS1 A;  2JEB I;  2JA8 H;  2RCN A;  4R4C A;  1JJ2 A;  3WWV A;  1YHQ A;  3AYH B;  3GTQ H;  5M3M H;  2B63 G;  3GTG H;  2EXD A;  1NBW A;  3OYY A;  1VQ5 A;  1HNW Q;  2R93 H;  4OON A;  1VQL A;  4R1J A;  5GAD C;  2UUC Q;  2I5L X;  3ULJ A;  4DR2 Q;  3S14 H;  1HNW L;  2D62 A;  1P16 A;  4GN5 A;  4DV4 Q;  4DV5 Q;  1YBY A;  4O0A A;  2R7D A;  2KCT A;  3F1Z A;  4YWM A;  3I55 A;  4DR2 L;  1YEZ A;  2NN6 I;  1B8A A;  2UUC L;  4AYB G;  5GRO A;  4OWX B;  3ZJY C;  4X6A H;  2XGT A;  3STB C;  4DV2 Q;  2Q2T A;  3PIP A;  3U50 C;  4K0K Q;  1TWF H;  3GTM H;  4A3L G;  2K5H A;  1YJ9 A;  1XNR Q;  4DV2 L;  5C44 G;  4HJ9 A;  1Q86 C;  4JBJ A;  3NEL A;  1NE3 A;  3UDF A;  4K0K L;  3A0J A;  4C3H H;  4DAY B;  4NXM L;  4IFD G;  1CKO A;  1XNR L;  3HOU H;  4IFD J;  3KOJ A;  2YV5 A;  4X66 L;  3PO2 G;  2JA6 H;  3DM3 A;  1QZH A;  2UUB Q;  1H95 A;  2CQO A;  4UP9 A;  2CWA A;  4LFA L;  3PSI A;  1V43 A;  1EUJ A;  3FHW A;  4L5Q A;  4B3T Q;  4DV1 Q;  3CC7 A;  3CCE A;  1TXY A;  1XJV A;  3CD6 A;  5ELN A;  2JA9 A;  1KQS A;  4LF5 Q;  4OX9 Q;  3L0O A;  4DV1 L;  1Q1E A;  1Y1W G;  1D8L A;  2CCZ A;  4DR3 Q;  1EIY B;  3I4N H;  2IY5 B;  1AE3 A;  3CQZ H;  1PFS A;  3I4O A;  3HOV G;  1CSP A;  4LF5 L;  1KAW A;  4DR3 L;  3T1H Q;  2DUD A;  3S2H H;  2Y0S G;  1IYJ B;  1YHB A;  2KBN A;  3GDE A;  1KRT A;  2E2H H;  4HJ8 A;  4IOC A;  1TWC H;  4IO9 A;  3T1H L;  1W2B A;  1PH2 A;  3J7A 5;  4GLX A;  4PMW A;  5GAE C;  4A3K G;  3ICE A;  2HIX A;  4LF8 Q;  4B3R Q;  4OWW B;  1TWG H;  3W1B A;  4BBS H;  4A3G H;  4IPD A;  4JBM A;  4LF4 L;  1P8L A;  3RN2 A;  5GAG C;  2VQE Q;  5IP7 G;  4LF8 L;  5IYB G;  3J7Z C;  1HNX Q;  3F2B A;  4A76 A;  1EQQ A;  4DUZ Q;  3PIO A;  4GKJ L;  4B3M Q;  2OQ0 A;  1L1O C;  1G29 1;  4ME3 A;  1X9N A;  1K8A C;  1HNX L;  1K3R A;  1OTC A;  2JA7 G;  3I4M H;  4DUZ L;  1VQN A;  3AEV A;  1E1T A;  2K5V A;  4B3M L;  4LF7 Q;  2YU9 H;  4A3I G;  3S16 H;  3M4O H;  4JI8 Q;  2RF4 A;  4BY1 H;  1S40 A;  3J81 j;  1GKH A;  1TWA H;  3RZO H;  5C0X G;  5JJL A;  1K73 C;  4QJF A;  3PGZ A;  4TQU S;  3Q8D A;  3S1Q H;  4JI8 L;  4JBK A;  5IYD H;  1LTL A;  1VQ6 A;  2R93 G;  2WB1 E;  1SR3 A;  2IT1 A;  3BU2 A;  1C0A A;  4QIW E;  2CWP A;  5M5Y H;  4DR5 Q;  4RG1 A;  1IBM Q;  3W1G A;  4P75 A;  1NMG A;  4DR5 L;  1OXV A;  2RHS B;  1JJC B;  4POF A;  4X65 Q;  1XPU A;  1E22 A;  1IBM L;  1FJG L;  1KD1 C;  2D0O A;  3ER0 A;  4JI7 L;  3EN2 A;  1IZ6 A;  3S1N H;  4BY7 H;  2K14 A;  2R7Z H;  2MNA A;  5HGQ A;  5FLM G;  5FLX c;  4A93 H;  3K8A A;  1WJJ A;  4PZ6 A;  1NJI C;  1J5E L;  4DKA C;  2MFI A;  3M3Y H;  1OXT A;  1UE7 A;  5H1S E;  2JA5 G;  4JYA L;  3HOU G;  5IWA Q;  2ALY B;  3CCR A;  4A3F H;  1QVG A;  4DV6 Q;  3G4S A;  2JA6 G;  4LWC A;  1EWI A;  2QGQ A;  3KF6 A;  2WP8 J;  1YHA A;  4Y52 H;  1N33 L;  4DV6 L;  1WCM G;  4NPS A;  2CFM A;  2F3I A;  1L1O B;  2Q2I A;  1N36 L;  4XIG S;  4J15 A;  4MZ9 A;  4MTN A;  2R92 H;  1EOV A;  1PH4 A;  4UP8 A;  3I4N G;  2Z6K C;  3D0F A;  2ZJR A;  1VS0 A;  5ELO A;  3I7F A;  3UE0 A;  4P71 A;  4AIM A;  4A3D H;  2F4V Q;  3GTL H;  3U58 A;  2HHH L;  1RIP A;  1E3P A;  4QY7 A;  3HOW H;  3HFZ B;  1MJC A;  3UDI A;  5LMU Q;  4GS3 A;  1XMQ L;  2F4V L;  2VUM H;  3UDG A;  1A0I A;  3RNU A;  1QUQ A;  5LMU L;  5M5W H;  1YJN A;  4A3G G;  3CME A;  1EQR A;  4LNQ A;  2OTJ A;  1N8R C;  3CC2 A;  1GO3 E;  3JAM i;  2VQF Q;  2AHO B;  4LF6 Q;  3CCL A;  2UU9 L;  4A3B H;  1VCI A;  4B3R L;  4HID A;  5C4X H;  3K7A H;  2IX0 A;  4Y7N H;  3CMA A;  2VQF L;  5EAY A;  3AFP A;  4LF6 L;  3I2Z A;  3BZC A;  1VQK A;  3OTO Q;  1ASZ A;  5LMN W;  3T1Y Q;  3BJU A;  1WFQ A;  3HKS A;  4DUY Q;  1C7Y A;  3PO3 H;  2JE6 I;  4BY1 G;  3LGJ A;  2QA4 A;  1Q1B A;  3OTO L;  2I5H A;  3GTJ H;  3T1Y L;  5E7N A;  4DUY L;  3S1M H;  3BZK A;  2N49 A;  2UXB L;  5IYD G;  4NXM Q;  2AKW B;  2ZJQ A;  1PV4 A;  4JV5 Q;  4GLA C;  4X64 Q;  4X66 Q;  4OO1 I;  1CUK A;  4EQ5 A;  4C3I H;  1WYD A;  1YNX A;  2GN5 A;  3PCO B;  2ZTE A;  1CKN B;  4JV5 L;  4X64 L;  4LFA Q;  4IPC A;  4A3M H;  1PH7 A;  3PF4 A;  4A3J H;  2Q2U A;  4GKK Q;  2K75 A;  3S17 H;  3SGI A;  4LF9 L;  5FJ8 H;  4JOI A;  1GD7 A;  3JAM c;  4GNX A;  2VL6 A;  4RMF A;  3HOX G;  4BY7 G;  3M4Q A;  4DAM A;  1XNQ Q;  3GTP H;  1PH5 A;  3E9I A;  1W3S A;  1N34 L;  4O2D A;  1VQA A;  1XNQ L;  2FXQ A;  5BR8 Q;  4AYB E;  3HOZ H;  1Y1V G;  3H0G G;  3PUY A;  2Z0S A;  4A3E H;  2UXC Q;  1ASY A;  3KLW A;  4A3F G;  4C3J H;  1HZC A;  2R6G A;  5BR8 L;  1B70 B;  3KF6 B;  4H02 A;  2WAQ E;  3J80 i;  1SLJ A;  2UXC L;  2QEX A;  2NVT H;  4JI2 Q;  4JI6 Q;  1YI2 A;  4BXX G;  2A1A A;  4JI2 L;  1IL2 A;  3ULL A;  3HOY G;  1IXR A;  3TS2 A;  4JI6 L;  2PMZ E;  4EX5 A;  2N8N A;  1VQO A;  1PH6 A;  1KC8 C;  1VQE A;  2R92 G;  1D7Q A;  3EBE A;  2AMC B;  4L5S A;  4DR7 L;  2MO0 A;  1NMF A;  4A75 A;  1MJE A;  4A3D G;  2YTX A;  3FKI H;  3S2D H;  3M7N A;  1X6O A;  3CXC A;  3HOW G;  1V9P A;  4PZ7 A;  3B6Y A;  3F2C A;  1YIJ A;  1T9H A;  2IHF A;  3VDY A;  3CAM A;  1XMO Q;  1TWH H;  2JA8 G;  3JC6 6;  3KYH C;  1QUQ B;  1Y14 B;  5M3M G;  4HJ7 A;  4DK3 C;  3ERS X;  1XMO L;  3RN5 A;  2B63 H;  2Y0S E;  1SRU A;  2UUA Q;  3K7U C;  1BBU A;  1U0L A;  3CPW A;  4A3B G;  2RHQ B;  4A3C H;  3OW2 A;  2L15 A;  3J80 c;  1PYS B;  1PH8 A;  5C4X G;  1IBL L;  2UUA L;  1FJG Q;  4DPG A;  2NN6 G;  3F2D A;  4DV0 Q;  1I50 H;  4JI7 Q;  1YJW A;  4AH6 A;  3TEH B;  3TRZ A;  1NTG A;  3M85 A;  1IBK L;  4DV0 L;  3KDF A;  3NEN A;  1J5E Q;  1E1O A;  3W5O A;  3KJP A;  4JYA Q;  4OO1 G;  3FP9 A;  3TS0 A;  5DLQ E;  5IY0 A;  2Q2H A;  4GLV B;  2I0Q A;  4QQB X;  4IJL A;  1BVS A;  5C44 H;  5LMN Q;  4P73 A;  4HIK A;  1B7Y B;  4HIO A;  1PVO A;  2UXD Q;  3CPF A;  3KFU A;  4R4I A;  4UPA A;  3UE1 A;  1N33 Q;  1HR0 W;  2ES2 A;  5LMN L;  1R9T H;  4YWK A;  4AQY Q;  1N36 Q;  2UXD L;  1N9W A;  4GN3 B;  4C2M H;  3GO5 A;  3M9B A;  3K80 C;  1HJP A;  1VQD A;  1PH1 A;  5JJK A;  1SN8 A;  1AH9 A;  1VQ7 A;  1S72 A;  4AQY L;  1YVC A;  2HIV A;  1SE8 A;  1VQ4 A;  1M1K C;  4BA2 I;  4KHZ A;  2V1C C;  1PHJ A;  2A19 A;  2LXK A;  1QVC A;  1Y1W H;  2HHH Q;  2OWO A;  1FL0 A;  5M3F H;  2IHE A;  1JE5 A;  1SMX A;  1GVP A;  4GN4 B;  5C3E H;  3CC4 A;  4APV A;  1XMQ Q;  3HOV H;  1E7Z A;  1WOC A;  2C35 B;  1LM0 A;  2N3S A;  2ZTD A;  3PF5 A;  1C9O A;  1A62 A;  3MXN B;  3S15 H;  5C4J H;  3PUX A;  4DV7 Q;  4JI5 Q;  2E2I H;  2JEA I;  2ZM6 Q;  3A5U A;  3HKZ E;  1NY4 A;  4TVA B;  4HIM A;  4PG3 A;  2PI2 A;  4GOP A;  3F8T A;  4FDB A;  4JI5 L;  1Q46 A;  4DV7 L;  1I94 L;  3STB D;  2ZM6 L;  5AJ3 Q;  2UU9 Q;  4BBS G;  2K4K A;  1VQF A;  4X62 Q;  4YY3 L;  4JCV E;  4UP7 A;  5AJ3 L;  2K50 A;  3GD7 A;  1RL2 A;  5JEA G;  5JEA J;  3EIV A;  4X62 L;  1M90 C;  1X54 A;  2BA0 A;  3MEF A;  4LW1 A;  3I4M G;  3FKI G;  4KI0 A;  1QZG A;  3KJO A;  5IP9 H;  2UXB Q;  4A3I H;  3H15 A;  2KHJ A;  4L5T A;  4PZ8 A;  4DR7 Q;  3AQQ A;  1UWV A;  3TRE A;  5C0X I;  3TQY A;  1JJG A;  3K0X A;  4BBR H;  2MQH A;  3A74 A;  4A3C G;  4L5R C;  4LF9 Q;  2KCM A;  3J81 i;  1L2F A;  2ID0 A;  1A8V A;  2EQS A;  1LYL A;  4LUZ A;  4GOP C;  2OTL A;  2YTY A;  4R4Q A;  3GTK H;  4WJ4 A;  4R4O A;  1Q7Y C;  4P74 A;  1I3Q H;  4DV4 L;  4DV5 L;  4JC0 A;  4NXN Q;  4DR4 Q;  3KDF B;  1N34 Q;  3AFQ A;  3CCM A;  2R7Z G;  5IE8 A;  2ATW A;  3IRB A;  4P72 A;  2PI2 E;  1YIT A;  4A93 G;  4YWL A;  4NXN L;  4DR4 L;  2MO1 A;  5FLM H;  3S1R H;  2WAQ G;  3G6E A;  1Q12 A;  2IX1 A;  3E9H A;  2JA5 H;  2A8V A;  3U4V A;  1Q8K A;  3U4Z A;  2HQL A;  4LUV A;  1OXU A;  4JI3 Q;  1CSQ A;  3H3V H;  4HJA A;  4DR6 Q;  4OWT B;  4DV3 Q;  3RZD H;  1JMC A;  3H3V I;  1N32 Q;  4GKK L;  2N78 A;  4JI3 L;  4WJ3 M;  4DR6 L;  4DNI A;  2GVB A;  4DV3 L;  5IYC H;  1WCM H;  1VQG A;  1L1O A;  1K9M C;  1G6P A;  3NEM A;  1N32 L;  3RLF A;  2UUB L;  2LSS A;  1JT8 A;  3CF5 A;  1V1Q A;  1O7I A;  1X56 A;  1XTD A;  1X3G A;  2VZA A;  3E0E A;  4R4T A;  3J81 c;  3CW2 C;  1PH3 A;  4B3T L;  1HR0 Q;  4YCV A;  5M3F G;  4JOI C;  5C3E G;  1VQ8 A;  1A63 A;  4OX9 L;  1KXL A;  3I56 A;  3PUV A;  1I5F A;  4GNX C;  1HR0 L;  2DGY A;  2PQA A;  4IPH A;  2R7F A;  1BKB A;  1UE5 A;  2WB1 G;  3L7Z C;  3PV0 A;  4JI4 Q;  1WI5 A;  2VUM G;  2ASB A;  3RR5 A;  1KL9 A;  4YHH Q;  2HT1 A;  4JI4 L;  2F52 A;  4POG A;  1HZB A;  1VQ9 A;  1PH9 A;  1VQI A;  4GOP B;  3A5Z B;  4YHH L;  4JG2 A;  2ZJP A;  4IJH A;  1IBL Q;  1X55 A;  3D31 A;  2H5X A;  1XPR A;  1Q82 C;  1BBW A;  1HZA A;  1I6H H;  1K8G A;  5GAH C;  4MNO A;  3G48 A;  1HZ9 A;  1QVF A;  1LUZ A;  2XTI A;  5JJI A;  2B3G A;  2D0P A;  2I5M X;  1SFO H;  2VQE L;  2BH8 A;  4ALP A;  2NVQ H;  1IBK Q;  4LFB Q;  2KEN A;  2K5N A;  5IP9 G;  3CCJ A;  1VQH A;  4XTC S;  3PO3 G;  2E8G A;  3CCS A;  1EFW A;  4LFB L;  2WFW A;  1UE1 A;  2E5L Q;  3DLL A;  3RLN A;  3L2P A;  2B29 A;  5C0X J;  4LF7 L;  2OCE A;  1MKH A;  3NBH B;  5J3B A;  2NZH A;  4LFC Q;  4A3L H;  1KRS A;  1OXX K;  2KHI A;  2BA1 A;  1FGU A;  2E5L L;  2NVY H;  1DGS A;  1PYB A;  2YYZ A;  4JI0 Q;  2BH2 A;  4B3S Q;  4YCW A;  4BBR G;  4QGU A;  1K0R A;  4LFC L;  1FVI A;  4JI0 L;  1CKN A;  4A3M G;  4DK6 C;  2PNH A;  2NVX H;  1Q81 C;  2E2J H;  3CCQ A;  4B3S L;  3HOZ G;  4A3J G;  3PO2 H;  4IFD I;  2CKZ B;  3G71 A;  2LXJ A;  3UDX A;  2Z6K A;  1GM5 A;  5M5X H;  5FJ8 G;  4QL5 A;  1G51 A;  2VW9 A;  4OXP A;  3RLO A;  3S24 A;  1PA6 A;  1Z9F A;  2JJQ A;  3PUZ A;  1S3O A;  1X3E A;  4KLK A;  4NB3 A;  4GNX B;  5K36 G;  3HOX H;  4UY8 C;  1XPO A;  4HJ5 A;  4X65 L;  4LF4 Q;  2ZTC A;  2JQO A;  4DR1 Q;  3CCV A;  3M4P A;  1UE6 A;  3HKZ G;  1E24 A; 
#chains in the Genus database with same CATH topology
 5M5W B;  2JK8 A;  1CKM A;  1ZXT A;  1Y1V H;  3H0G H;  1YZ6 A;  4QUF A;  1XX8 A;  5IYC G;  1HNZ L;  5KEE A;  1JB7 A;  1KHI A;  3PUW A;  4Q0F A;  3HOY H;  4NMZ A;  3WDN A;  3K81 C;  4BA1 I;  3Q0A A;  2YTV A;  1HCZ A;  4U67 3;  2DNE A;  3DWQ A;  1LTT D;  2NZ1 D;  1I4Q A;  1ET6 A;  1JQY D;  1BNZ A;  4XYQ A;  2EXD A;  3GTK B;  4RKL A;  2R93 H;  2NTS A;  1SND A;  2OT2 A;  4K2K A;  1Q8I A;  5GAD C;  3S14 H;  1HNW L;  3R3O A;  2A6H C;  4GN5 A;  4DV4 Q;  1YBY A;  1TT2 A;  2UUC L;  5FO8 B;  2NN6 I;  4AYB G;  4OWX B;  4KV6 A;  3ONA B;  4B08 A;  3U50 C;  5LL6 X;  1CHQ D;  2QIL A;  4DV2 L;  2JSO A;  4NW2 A;  4K0K L;  1B50 A;  3R2I A;  4NXM L;  4IFD G;  1JIC A;  1CKO A;  2D5D A;  2MGS A;  2UUB Q;  2CVR A;  3U9S A;  4HCE A;  2CWA A;  4LFA L;  4B3T Q;  1ICW A;  2F0W A;  3CCE A;  3CD6 A;  1C4Q A;  4DV1 L;  2IW3 A;  1Q1E A;  1D8L A;  2IY5 B;  2FMC A;  5EBD A;  4DR3 Q;  1AE3 A;  1PFS A;  4DGZ A;  2ZT9 C;  2FIN B;  3DEP A;  2DUD A;  3S2H H;  3MXN A;  2E2H H;  2HDL A;  2O4X A;  3RUZ A;  3J7A F;  1W2B A;  1PH2 A;  4GLX A;  1GUT A;  4LF8 Q;  3SR1 A;  4OWW B;  4A3G H;  1ROD A;  4GKJ L;  1LTS D;  3NP8 A;  2SEB D;  1K3R A;  1UNS A;  1E1T A;  4A3I G;  4JI8 Q;  4IQZ A;  4BY1 H;  3Q24 A;  1GKH A;  1K73 C;  4QJF A;  3BDO A;  1EYA A;  1LTL A;  3GV6 A;  1SR3 A;  1VF7 A;  5KIX A;  1C48 A;  1W6J A;  5COY A;  3NTK A;  1XPU A;  1E22 A;  1KDC A;  1PXU A;  1SE3 A;  1KD1 C;  2AUK A;  2D0O A;  2F03 A;  2A68 C;  4BY7 H;  4RKB A;  5FLX c;  4EQP A;  3M3Y H;  1LLR D;  1SXT A;  3QOL A;  1SNM A;  2RDH A;  4F7X A;  3CCR A;  3G4S A;  3EQL C;  2WP8 J;  5E1F A;  4Y52 H;  3P1H A;  1WCM G;  2CFM A;  5ELD A;  2PQE A;  1N36 L;  5NUC A;  3TZU A;  4KK7 A;  2R92 H;  3I4N G;  1STA A;  2Z6K C;  3W3A A;  5C5L A;  1HFN A;  5IGE A;  1EY9 A;  1PYW D;  3EVQ A;  3QR8 A;  5KND A;  2Q8R E;  1BO0 A;  1E3P A;  3HFZ B;  1D6E C;  2G9H D;  2RBM A;  4GS3 A;  1QUQ A;  1YJN A;  2ZXP A;  1M8A A;  2F0S A;  3NSW A;  3MC0 B;  3CC2 A;  1TS5 A;  4IAL A;  1VCI A;  4B3R L;  1UEA B;  3K7A H;  4LF6 L;  5IIF A;  5D65 A;  5I9O A;  1VQK A;  3OTO Q;  4ZYS A;  5LMN W;  1ASZ A;  1OO9 B;  3HKS A;  4KJO A;  3DWP A;  1Q1B A;  2I5H A;  1F9P A;  3D6W A;  3OPO A;  4NXM Q;  1SJE D;  4DNT B;  4G7O C;  1WCM B;  4EQ5 A;  4DN4 M;  1D1I A;  2ZTE A;  5FLX L;  2B8G A;  4JV5 L;  3OMG A;  4LFA Q;  5J1Z A;  3PF4 A;  4MTK A;  4A3J H;  2K75 A;  1GUW A;  3I4N B;  1IKL A;  3CQZ B;  4K8J A;  1ML0 D;  3K5O A;  3HOX G;  5EKL A;  5AFW A;  1PH5 A;  2PYK A;  4IUQ A;  1N34 L;  4O2D A;  2FXQ A;  2EY5 A;  3HOZ H;  3MZ5 A;  4BBS B;  4C3J H;  4CKB A;  4HAE A;  1B70 B;  1I6H B;  3MFY A;  3KF6 B;  4H02 A;  2WAQ E;  3J80 i;  2NVT H;  1EIG A;  3SK8 A;  1NUC A;  3KF8 A;  4JI2 L;  4R9W A;  4GKJ Q;  3M4O B;  2K5W A;  1VQO A;  3EBE A;  4UHV A;  1CA6 A;  1JC7 A;  2MO0 A;  3K0Y A;  2RCF A;  3MXG A;  3M7N A;  3HOW G;  4QB4 A;  2KOL A;  3F2C A;  4IUP A;  2OF1 A;  1FYC A;  3CAM A;  4K8I A;  2FMM A;  2JA8 G;  2NVX B;  3MTS A;  1HQR D;  4KTA A;  4CBV A;  3ERS X;  2TMP A;  2B2T C;  2XN9 C;  2JYO A;  3E6Z X;  3K7U C;  1U0L A;  1BCP C;  4A3B G;  2RHQ B;  1DOK A;  2IPK D;  3J80 c;  3HOX B;  1PH8 A;  1U4P A;  1PFM A;  4DV0 Q;  3IFT A;  2Z8L A;  1O7L A;  2AQ2 B;  1JWS D;  3I72 A;  5CBA E;  1V8Q A;  4OO1 G;  5IY0 A;  2Q2H A;  5I2X A;  2I0Q A;  1HXY D;  1EU3 A;  1CTM A;  4DAY A;  2CH4 A;  3CPF A;  3P75 A;  2WV6 D;  1WTW A;  5JPM C;  2ES2 A;  1N36 Q;  2UXD L;  4GN3 B;  2L1B A;  3I3C A;  3K80 C;  3SK4 A;  1VQ7 A;  1SNQ A;  1AH9 A;  2SOB A;  1LV9 A;  1NCV A;  2K04 A;  3HOW B;  3V2T A;  3VYS A;  2V1C C;  1PHJ A;  1SYC A;  1Y1W H;  2JA8 B;  4QIW B;  2OWO A;  4I7A A;  5M3F H;  2EYL A;  2IHE A;  4GN4 B;  3HOV H;  5C3E H;  3CC4 A;  4APV A;  2ENB A;  1ILP A;  5T1I A;  2ZTD A;  1KLG D;  1BCP B;  4DV7 Q;  3PUX A;  4A3B B;  2ZM6 Q;  1NY4 A;  2K6A A;  5BN5 A;  3OHX C;  4FDB A;  4JI5 L;  5KNB A;  3O13 A;  4B3R Q;  3STB D;  1NR4 A;  2EY6 A;  3E3X A;  1LTB D;  3GTJ B;  4CHT B;  1RL2 A;  5JEA J;  5I6W A;  1M90 C;  4LW1 A;  3V96 A;  3I4M G;  2KQ3 A;  1EOT A;  3KJO A;  2PO4 A;  5KRU A;  3J80 L;  1EY5 A;  3LNN A;  3H15 A;  4L5T A;  1X3P A;  1B4O A;  3J81 E;  2E74 C;  3NE5 B;  4ZQ3 A;  1A3U A;  3S17 B;  3TQY A;  2F0E A;  4BBR H;  1Y69 U;  4KN7 C;  5D14 A;  4DU9 A;  1A8V A;  4GOP C;  1O7Z A;  1D2B A;  2B8F A;  1EZ8 A;  3QJY A;  2Z9H A;  4NXN Q;  1W6K A;  1N34 Q;  3AFQ A;  2HD3 A;  1QB5 D;  2E2D C;  1PRT C;  2ATW A;  4CDF C;  1YIT A;  4A93 G;  4YWL A;  5FLM H;  3S1R H;  1Q12 A;  2IX1 A;  3U4V A;  2D9U A;  3HZX A;  3E5S A;  4LUV A;  1OXU A;  4OWT B;  2F0U A;  4ZLT F;  2BDN A;  3H3V I;  1K8M A;  2PPB C;  4FXD A;  1N32 Q;  2B2Y A;  3NWS A;  3OSO A;  2GVB A;  1VQG A;  1L1O A;  1VMP A;  1K9M C;  4FYD A;  1V1P B;  4JPB W;  1X56 A;  3E0E A;  2VZA A;  3K57 A;  3CW2 C;  3K58 A;  4CKC A;  4O1N A;  4GNX C;  4OIJ A;  1HR0 L;  2DGY A;  1BKB A;  4JI4 Q;  5EJW A;  1F2L A;  4ZAI A;  3RR5 A;  2F52 A;  2F0L A;  3KLS A;  4POG A;  2IL8 A;  1I50 B;  1VQI A;  4GOP B;  4YHH L;  2ZJP A;  1I6V C;  1X55 A;  1HZA A;  3NK9 A;  5GAH C;  3P7J A;  3G48 A;  4MNO A;  1QVF A;  1STY A;  1VMC A;  5JJI A;  1PRT B;  2LY7 A;  3QG1 A;  5JPN C;  2K5N A;  1I4P A;  5IGF A;  3CCS A;  1EFW A;  2XWB B;  3L2P A;  2B29 A;  1A2T A;  1MKH A;  1HTP A;  4IZ8 A;  2EYJ A;  1R9T B;  4A3L H;  4JI0 Q;  3VR5 A;  2E5L L;  2NVY H;  1PYB A;  3GV3 A;  5CV8 A;  1K0R A;  2F0M A;  4XDX A;  1HRJ A;  3CCQ A;  2HQE A;  1SMY C;  5M5X H;  1JOK A;  1RHP A;  4GNX B;  1S3O A;  4FNF A;  1WTO A;  2EJF C;  2L11 A;  1XPO A;  4HJ5 A;  2JQO A;  1QNK A;  3RD4 A;  3DM1 A;  1E24 A;  3ULP A;  1DZ1 A;  2OQK A;  5GQO A;  3HP3 A;  4NDX A;  4DR1 L;  1RCV D;  2EIF A;  3BG3 A;  3DWA A;  4IPG A;  4JI1 Q;  2AQ1 B;  4KY5 A;  2VNU D;  2EZV A;  5HY6 A;  5IWA L;  1AZP A;  1OXS C;  1CZG A;  1EY4 A;  2OXP A;  5IYB H;  1ENF A;  4JBW A;  4RGO S;  2AWO A;  4YCU A;  3U9O A;  5C6A A;  4WJW A;  1ONL A;  2VY3 A;  2JA7 H;  2VS1 A;  2RCN A;  3S9W A;  1IYU A;  3WWV A;  3GTQ H;  1RTO A;  1MBY A;  3C1F A;  2B63 G;  1KNA A;  1HFG A;  4RHR A;  1B44 D;  1J8I A;  4HED A;  2I5L X;  3ULJ A;  4FF2 A;  2D62 A;  4HMI A;  4XT3 B;  1DJR D;  2NN6 H;  4O0A A;  2DN8 A;  3D4D A;  1YEZ A;  3M7G A;  1B8A A;  3ZJY C;  4X6A H;  3C46 A;  1YJ9 A;  5C44 G;  1QNU A;  3HOU H;  3KOJ A;  3PO2 G;  1ESR A;  3DM3 A;  4YIJ A;  3J7Y W;  1V43 A;  1EUJ A;  3R93 A;  4OHJ A;  1KQS A;  2JA9 A;  4LF5 Q;  3L0O A;  1S5D D;  1EIY B;  1QE6 A;  2X6G A;  4IUU A;  1KAW A;  4DR3 L;  2B63 B;  3T1H Q;  2ICE C;  2SNS A;  1B9N A;  1YHB A;  1G2S A;  3GDE A;  1KRT A;  2PZT A;  3J7A 5;  4XYO A;  3K5N A;  1H9S A;  1XWE A;  2A69 C;  4H0L C;  1UUP A;  1TWG H;  3H09 A;  3RN2 A;  3KLR A;  4LF8 L;  4OL7 A;  1HNX Q;  4DUZ Q;  4B3M Q;  4B9W A;  1PFN A;  1E2Z A;  3H91 A;  5C44 B;  1VQN A;  3AEV A;  2B2V A;  4N8F A;  1E0B A;  2BE5 C;  1F2Z A;  3J81 j;  1L0X B;  5C5M A;  3PO2 B;  5JJL A;  1LT3 D;  4JI8 L;  3DUZ A;  5IYD H;  2R93 G;  2WB1 E;  2IT1 A;  1PTO B;  1C0A A;  4QIW E;  2F0J A;  2RA4 A;  2RHS B;  1JJC B;  1GHJ A;  2WKD A;  3H0G B;  5D3D A;  3S1N H;  1F2M A;  2K14 A;  5IOC A;  3PQI A;  2R7Z H;  1SAP A;  4KMU C;  4PZ6 A;  4DKA C;  5A2Q E;  5JVG 3;  2JA5 G;  1LT5 D;  4R8I A;  1SYB A;  5IWA Q;  1CA5 A;  1PDQ A;  4A3F H;  2F0O A;  4LWC A;  5CGK A;  1U4L A;  3I8Z A;  1KNE A;  4NPS A;  2F3I A;  1BDO A;  1S5B D;  4J15 A;  2EYO A;  4UP8 A;  5ELO A;  2IX3 A;  3SEB A;  2F4V Q;  2HHH L;  1RIP A;  5C3W A;  2R93 B;  3UDI A;  5LMU Q;  1S5C D;  2VUM H;  1A0I A;  3VR3 A;  3RNU A;  3S14 B;  1M4V A;  5M5W H;  2GA4 B;  4OIK A;  3CME A;  4N8X 1;  4ZK9 B;  4A3G G;  1PLF A;  3JAM i;  2VQF Q;  1I3Q B;  5ELC A;  1IW7 C;  4Q5V A;  2L9H A;  3VYR A;  4HID A;  3HRZ C;  4DUY Q;  1HUM A;  2JA5 B;  4BY1 G;  3LGJ A;  3AU7 A;  3OTO L;  2XIW A;  1B3Q A;  2N49 A;  2AKW B;  1BCP F;  4GLA C;  4X64 Q;  3BYY B;  1WYD A;  1CKN B;  4RFB A;  4IPC A;  2QDL A;  2K05 A;  3SGI A;  5FJ8 H;  5KNC A;  3JAM c;  1G2T A;  4BY7 G;  3S2H B;  4G4K A;  2O5I C;  5K36 H;  1O80 A;  1WTQ A;  1G6Z A;  4PNY A;  2E2H B;  1KAB A;  2F0I A;  3HEJ A;  4K5X A;  3C1E A;  5BR8 Q;  3OWF A;  4A3G B;  4ID6 A;  1HZC A;  3H6M A;  5FOB B;  1Y8O B;  1SLJ A;  4O42 A;  1TII D;  4QF4 A;  3NBI A;  5I2Y A;  4BXX G;  5BN3 A;  1VDZ A;  3IKJ A;  1IL2 A;  3TS2 A;  2R92 G;  1LTG D;  2N8N A;  1PH6 A;  4BY1 B;  1SJH D;  1VQE A;  3H94 A;  3HG9 A;  5CMD A;  4DNR B;  5JEA H;  4ZCK A;  2YTX A;  3FKI H;  3S2D H;  3ZYY X;  3CXC A;  1V9P A;  2CW0 C;  3B6Y A;  2EDG A;  1T9H A;  2IHF A;  3VDY A;  3T56 B;  1MGS A;  1PZI D;  2X6L A;  3JC6 6;  3TP7 A;  1QUQ B;  1Y14 B;  5M3M G;  4HJ7 A;  1ENC A;  2Q8I B;  2Y0S E;  3KLS X;  4RGM A;  4BY7 B;  1PYS B;  2NUC A;  1I4X A;  4DPG A;  3F2D A;  1G8Z D;  1HTL D;  3M3Y B;  3TRZ A;  5D3I B;  1IBK L;  4DV0 L;  3KJP A;  3FP9 A;  4C1N K;  5KYL A;  1HA6 A;  2J0T D;  3JAM L;  2IWH A;  3M4Y A;  3NQI A;  4C3H G;  4G7H C;  5LMN Q;  4P73 A;  3GTO B;  4HIO A;  5JAV A;  1FGB D;  3KFU A;  4UPA A;  4N9T A;  2R92 B;  4AQY Q;  4C2M H;  3GO5 A;  3M9B A;  1PH1 A;  5JJK A;  2RQX A;  1PRT F;  1S72 A;  3EJI A;  5ELF A;  1VQ4 A;  3CRL C;  1M1K C;  4BA2 I;  1DXM A;  4KHZ A;  1QCB D;  4MHE A;  1SNP A;  2HHH Q;  5IOD A;  1LTR D;  1BQQ T;  2M2L A;  5M3M B;  1QG7 A;  1E7Z A;  3A7A B;  3PF5 A;  4C3J G;  1XTC D;  4KY6 A;  5C4Z A;  3IFD A;  1C9O A;  2IJ0 A;  2KCC A;  2E2I H;  3K7A B;  4TVA B;  4HIM A;  2RVL A;  1I94 L;  4KHV A;  3F8T A;  3HGB A;  4DV7 L;  4BBS G;  2ZM6 L;  2JXM B;  5AJ3 Q;  1VQF A;  2EE1 A;  2TSS A;  4X62 Q;  4RWS C;  3D3R A;  2K50 A;  3EIV A;  1TWF B;  3J7A V;  3Q6S A;  4N9P A;  1EY0 A;  5IP9 H;  4C3H B;  1JOR A;  2DJG C;  2WII B;  4A3I H;  1F77 A;  3D8G A;  4PZ8 A;  5JOB A;  1UWV A;  4NKL A;  3DHQ A;  1TY2 A;  3QWN A;  1UAP A;  2AQ3 B;  3A74 A;  1DOL A;  2VXW A;  5EGT A;  4X3S A;  3WOE A;  2EQS A;  4LUZ A;  2OTL A;  2YTY A;  2KA7 A;  4F88 A;  1EY7 A;  1NNX A;  4H13 C;  1EQT A;  4J1M A;  1SE4 A;  3HOZ B;  4DR4 Q;  4C3J B;  1EIH A;  5KGU A;  4P72 A;  1TWC B;  4NXN L;  1YNN C;  2NVT B;  4K2L A;  1MSG A;  2PZU A;  4HSP A;  3MVV A;  2A8V A;  2HQL A;  4DR6 Q;  1CSQ A;  3H3V H;  3RZD H;  1SDF A;  4BS9 A;  3T4A C;  2QW7 A;  2N78 A;  3OW7 A;  5K5P A;  4KJN A;  5DEH A;  2E76 C;  1A6X A;  2EJG C;  1WCM H;  4FP5 D;  1N32 L;  2LSS A;  1V1Q A;  1XTD A;  3D6C A;  4IUR A;  4R4T A;  1PH3 A;  1JMC A;  1CQF A;  5M3F G;  4QMG A;  4JOI C;  5C3E G;  1KXL A;  1BCP D;  4OX9 L;  3I56 A;  1I5F A;  2PQA A;  1CZW A;  3MXP A;  3NXW A;  2WB1 G;  1UE5 A;  3PV0 A;  4X3K A;  1WI5 A;  2ZXO A;  4XT1 B;  2ASB A;  1B2T A;  2LMC B;  1KL9 A;  4JI4 L;  1CM9 A;  2EPB A;  2B2U A;  4JG2 A;  4Z9C B;  3SHL A;  3D31 A;  2H5X A;  1XPR A;  4KY7 A;  1I6H H;  4H44 C;  1ILQ A;  2F0P A;  2CQA A;  2B2Y C;  2B3G A;  2I5M X;  4ALP A;  2BH8 A;  1Q90 A;  1IBK Q;  1D5M C;  5CV6 A;  3PO3 G;  3CCJ A;  2E8G A;  2WFW A;  2PZW A;  3QO2 A;  1UE1 A;  3K5M A;  1PZJ D;  3DLL A;  1QJO A;  3RLN A;  3I90 A;  3NBH B;  1WTV A;  2KHI A;  2K01 A;  4B3S Q;  2MHV A;  4BBR G;  4JI0 L;  1S5E D;  4A3M G;  2NVX H;  2PNH A;  4C56 C;  4KN4 C;  4IFD I;  1ZYR C;  4DXF A;  3G71 A;  2G5D A;  2Z6K A;  1GM5 A;  3D4W A;  1JB3 A;  5M3F B;  1ESF A;  2VW9 A;  1EWC A;  4OXP A;  3S24 A;  5C3E B;  1PA6 A;  2JJQ A;  1B3A A;  4NB3 A;  3HOX H;  2WB1 B;  4LF4 Q;  5EQ0 A;  5TSS A;  2BCO A;  5IGC A;  4A3E G;  2PW5 A;  4A4I A;  3CP0 A;  1I94 Q;  2NZO A;  1PTO F;  1HH2 P;  2AWN A;  2EYH A;  1CQV A;  4JI1 L;  4Y7N B;  1RDP D;  4A3K H;  1EYG A;  4NP5 A;  4IOA A;  4DF7 A;  3FDT A;  4KHP Q;  3PO3 B;  4LUO A;  5IP7 H;  1VQJ A;  1VQP A;  1K83 H;  3TSS A;  1Z6H A;  1L0W A;  3S1M B;  2A74 C;  5IT9 c;  1XYI A;  2GVA A;  4XQJ A;  1SYE A;  1IKM A;  1SRO A;  2P5Z X;  4P2C B;  1X3F A;  2KUM A;  4BBR B;  1EZ6 A;  1RD9 D;  4A3M B;  2F0K A;  3ERO A;  2JA8 H;  4R4C A;  2KED A;  4FO2 A;  4UAI A;  3CKI B;  2J4X A;  4U68 A;  1RKN A;  3GTG H;  1KLU D;  3OYY A;  1PRT D;  2EYM A;  4OON A;  1IL8 A;  1K3B C;  4R1J A;  4DR2 Q;  2A5H A;  1P16 A;  1E2V A;  1GUS A;  3S1R B;  4CDC C;  3F1Z A;  2KCT A;  3I55 A;  4YWM A;  2NYZ D;  5GRO A;  2F0T A;  4A3E B;  1D5X C;  2XGT A;  3STB C;  3Q23 A;  2Q2T A;  5HUR A;  3GTM H;  1X3Q A;  4DFA A;  4A3L G;  2O2L D;  1U9R A;  2K5H A;  1XNR Q;  3LX0 A;  3C2P A;  1Q86 C;  3NEL A;  1EU4 A;  2C9O A;  2K28 A;  3SK6 A;  4IFD J;  2JN4 A;  4X66 L;  4HCS A;  2RDF A;  4FF3 A;  2JA6 H;  2CQO A;  5EKI A;  3BDC A;  4DA2 A;  3FHW A;  4L5Q A;  3CC7 A;  1TXY A;  5ELN A;  4H7B A;  1H9M A;  2CHB D;  4OX9 Q;  2L5T A;  2CCZ A;  3I4O A;  2J7Z A;  4WOR A;  4IUN A;  1A3T A;  2RDG A;  4ODG A;  3TN2 A;  4LF5 L;  4TRD A;  4KKT A;  5A35 A;  3MEH A;  2B2T A;  1JWM D;  2Y0S G;  3FPP A;  5IT9 L;  1IYJ B;  2KBN A;  4HJ8 A;  1CHP D;  4IO9 A;  3T1H L;  5GAE C;  3W2D A;  2RSN A;  3ICE A;  2HIX A;  4TSS A;  5FLX E;  1DM0 B;  4IPD A;  1LTI D;  4JBM A;  5GAG C;  1STG A;  5ELE A;  5IYB G;  1FNU A;  3F2B A;  4A76 A;  5DM6 3;  2MUY A;  1X9N A;  3I4M H;  1K8A C;  1HNX L;  2JA7 G;  4DUZ L;  4B3M L;  1MD2 D;  5ISR A;  2YU9 H;  3S16 H;  5A2Q L;  1S40 A;  1SMY D;  1TWA H;  3RZO H;  5C0X G;  4TQU S;  3PGZ A;  3S1Q H;  3Q8D A;  1QIL A;  5M5X B;  3MWY W;  3BU2 A;  1F9S A;  2CWP A;  2KJX A;  5M5Y H;  4HR7 B;  3Q22 A;  4DR5 Q;  4RG1 A;  2K32 A;  3OOC A;  2NBF A;  3VR4 A;  1IBM Q;  3W1G A;  4P75 A;  1BF4 A;  2Z4I A;  4POF A;  3T53 B;  1FJG L;  1TU2 B;  1GUN A;  3EN2 A;  4DK0 A;  3I70 A;  4X3T A;  1II3 A;  2R61 A;  2Y0S B;  3TP5 A;  2MNA A;  2F0F A;  5HGQ A;  3TP6 A;  1F9R A;  4A93 H;  1WJJ A;  1NJI C;  5CC4 A;  2MFI A;  5M9O A;  1K8O A;  4K14 A;  1UE7 A;  5H1S E;  2B2V C;  1LAB A;  1NSN S;  3HOU G;  2ALY B;  2Z6B A;  2LS0 1;  4DV6 Q;  2A6E C;  3V05 A;  2QGQ A;  1V1P A;  4XIG S;  2JA7 B;  4MZ9 A;  4MTN A;  1TQO A;  1PH4 A;  3D0F A;  2ZJR A;  2RSO A;  3I7F A;  1KDA A;  5L37 A;  5IGG A;  4P71 A;  1DCZ A;  4A3D H;  3A8K E;  3GTL H;  3U58 A;  1ZEQ X;  4QY7 A;  1ENA A;  1Y8N B;  1MJC A;  2HCC A;  2PCF B;  1XMQ L;  2F4V L;  1LT4 D;  5LMU L;  1AZQ A;  1EQR A;  4LNQ A;  2OTJ A;  1N8R C;  3FRP B;  1GO3 E;  4OGQ C;  3CCL A;  2UU9 L;  1JCK B;  5C4X H;  3DMU A;  2VQF L;  5DNF A;  2BDO A;  3BZC A;  3T1Y Q;  1C7Y A;  2QA4 A;  2HDM A;  3HOU B;  5DM7 3;  5E7N A;  4DUY L;  3ITP A;  3BZK A;  3VYT A;  3PMF A;  3NPP A;  1PTO D;  2CH4 W;  5IYD G;  4LAA A;  4X66 Q;  4OO1 I;  4C3I H;  2GN5 A;  1JR0 D;  3PCO B;  2B39 A;  3T13 A;  4X64 L;  3BYT B;  1V1O A;  4LF9 L;  1B9M A;  3AB9 A;  4GNX A;  4RMF A;  1SYG A;  4DAM A;  1XNQ Q;  1H9K A;  2A69 D;  3GTP H;  3E9I A;  1CK1 A;  1W3S A;  3J80 E;  4RCN A;  4LMQ D;  1Y1V G;  3H0G G;  3MFG A;  1TWG B;  2UXC Q;  2Z1C A;  1ASY A;  4A3F G;  3FEW X;  5BR8 L;  2D2C C;  5CYU A;  3VA7 A;  5HGT A;  3CRK C;  2QEX A;  1SFO B;  4KD3 A;  2NVQ B;  4JI6 Q;  4JK1 C;  1YI2 A;  5FKA C;  2BE5 D;  1STE A;  5LL6 S;  3FVQ A;  3HOY G;  4DR7 Q;  2PMZ E;  2EOT A;  1D7Q A;  5E4X A;  2AMC B;  2FFK B;  2LKV A;  1K0S A;  4V0B A;  4PZ7 A;  3T16 A;  1YNJ C;  3NHH A;  3P20 A;  1DD2 A;  1XMO Q;  1TWH H;  4K6D A;  4CKE A;  2E2J B;  4DK3 C;  4OEL B;  3RN5 A;  5IGB A;  2B63 H;  1SRU A;  4S3S A;  2K1B A;  2UUA Q;  4A3C H;  1AP0 A;  2L15 A;  1IBL L;  1FJG Q;  4AH6 A;  1NTG A;  1WTH A;  2WKC A;  3FMC A;  3M85 A;  1Y1V B;  2F0D A;  3KDF A;  3NEN A;  1A3V A;  1CI3 M;  1E1O A;  3GP7 A;  3W5O A;  4A3F B;  1STN A;  2KVM A;  1KTK A;  2XNA C;  3TS0 A;  5DLQ E;  4GLV B;  1HUN A;  1BVS A;  1EEI D;  1GUG A;  5C44 H;  4FXG C;  1LT6 D;  4HIK A;  1B7Y B;  1PVO A;  1PZK D;  3OIQ A;  3VYU A;  3HOY B;  1HR0 W;  5EPL A;  5LMN L;  3MAQ A;  4RH6 A;  4YWK A;  3BVG A;  5EPJ A;  1HJP A;  1VQD A;  1SN8 A;  3N6R A;  4WRD A;  4AQY L;  1PTO H;  1SE8 A;  2LXK A;  1QVC A;  3RMH A;  3LWU A;  5FO7 B;  5LHY 1;  1WD0 A;  1FL0 A;  1A15 A;  1R4P B;  1XMQ Q;  3BVZ A;  4F8M A;  1IW7 D;  1MSH A;  1LO5 D;  1RF2 D;  1GOZ A;  2A6H D;  3MXN B;  2X69 A;  3S15 H;  5C4J H;  2KCN A;  2N55 A;  1I4H A;  3A5U A;  4FVM A;  4PG3 A;  1VQ6 A;  2UU9 Q;  1AEX A;  1Q46 A;  2K4K A;  3WOF A;  2QF7 A;  4UDU C;  4YY3 L;  1H9J A;  2EVB A;  2R3Z A;  4UP7 A;  5T1G A;  5AJ3 L;  3GD7 A;  5JEA G;  2B2W A;  4X62 L;  1JWU D;  5FK9 C;  3MEF A;  3FKI G;  3X3M A;  4KI0 A;  1QZG A;  4HSV A;  4J8Q A;  4ILW A;  1RJT A;  2FJ2 A;  2KEC A;  3I73 A;  3NUC A;  3AQQ A;  5C0X I;  1HPC A;  4PMB A;  2V4D A;  4LF9 Q;  2KCM A;  3J81 i;  2ID0 A;  5F2D A;  4QCL A;  1LYL A;  4R4Q A;  3GTK H;  3IAY A;  4R4O A;  3SE0 A;  1Q7Y C;  4WJ4 A;  4P74 A;  1I3Q H;  4DV5 L;  4JC0 A;  5G3L F;  1X32 A;  2NTT A;  5IE8 A;  4ZKC B;  4BWG B;  3IRB A;  2PI2 E;  5BN4 A;  5EKK A;  1DOM A;  4DR4 L;  3E9H A;  2JA5 H;  5EPK A;  5E3F A;  1Q8K A;  4GKK Q;  3SXH A;  4JI3 Q;  4DV3 Q;  2L4N A;  4WJ3 M;  4MIU A;  4DR6 L;  2CW0 D;  3TZD A;  5IYC H;  4XXE A;  3TP8 A;  1G6P A;  3FKI B;  5CBE E;  3RLF A;  3S2D B;  1JT8 A;  1O78 A;  1BOS A;  4PMC A;  3J81 c;  4YCV A;  1VQ8 A;  4OEM B;  3PUV A;  4ULL A;  4IPH A;  3KUP A;  2R7F A;  3L7Z C;  3MXU A;  4CDD C;  1ZKO A;  1EQV A;  1HZB A;  1VQ9 A;  4M8A A;  1GHK A;  2A68 D;  1BR9 A;  4IJH A;  1IBL Q;  3D4R A;  4AYB B;  4LK1 C;  1CT1 D;  4ZRZ A;  2XTI A;  2VQE L;  2HUG A;  2EJM A;  4LFB Q;  1AFP A;  2M9V A;  5IP9 G;  4XTC S;  3N52 A;  2F1M A;  2I07 B;  5EBC A;  5C0X J;  2OCE A;  1H9R A;  4HN7 A;  4QUC A;  2NZH A;  2RKS A;  4LF7 L;  1OXX K;  4LFC Q;  4C2M B;  2BA1 A;  1FGU A;  3QB3 A;  2BH2 A;  1DGS A;  1TR5 A;  2ZXR A;  4IFD H;  2QEJ C;  1CKN A;  4B3S L;  4A3J G;  2CKZ B;  1TY0 A;  2B2U C;  3RLO A;  4RGN A;  5JJZ A;  1Z9F A;  4KLK A;  1X3E A;  3MHB A;  4UY8 C;  4X65 L;  5C4H A;  3NQT A;  2E2I B;  3CCV A;  1UE6 A;  2F0Q A;  3HKZ G;  3W1B A;  4LF4 L;  3HOZ G;  1E2W A;  2F0G A;  3CCU A;  1KIX A;  3J81 L;  1Z47 A;  1X65 A;  3CHB D;  1STH A;  1EIF A;  2KHS A;  3H3V C;  2K52 A;  3SK5 A;  1EL0 A;  1HNZ Q;  3K5L A;  1DYQ A;  1EFI D;  1NAP A;  1J6Q A;  5I6Y A;  1AE2 A;  3G6J B;  4L8J A;  4YY3 Q;  1S4Z A;  1GXD C;  3GTO H;  1VQC A;  4BXX H;  1UEB A;  2H4O A;  1U5K A;  1VQB A;  3KF8 B;  4A3I B;  1VQM A;  4KHP L;  4ZUI A;  1BUV T;  2F3W A;  1Q3L A;  2PQA B;  1MIU A;  1AN8 A;  2JEB I;  4RGT A;  5J39 A;  1JJ2 A;  4PV1 C;  4A3J B;  1YHQ A;  3AYH B;  5M3M H;  2WIN B;  1NBW A;  1SYD A;  2QDB A;  4G57 A;  1VQ5 A;  1HNW Q;  2XWJ B;  3F2U A;  1VQL A;  1YNN D;  1EWH A;  4L63 B;  5JVH 3;  4RA8 A;  2UUC Q;  3TME A;  4HMJ A;  4DV5 Q;  4XQQ A;  2R7D A;  2HCI A;  4DR2 L;  3HKZ B;  2XSC A;  4X3U A;  1EYC A;  2ICI A;  4DV2 Q;  1QWY A;  2DNC A;  3PIP A;  3RZD B;  4K0K Q;  1TWF H;  1WTR A;  3A54 A;  1XXG A;  4HJ9 A;  2EY2 A;  4JBJ A;  1NE3 A;  3UDF A;  3A0J A;  1WVL A;  4C3H H;  4DAY B;  1T5E A;  2SNM A;  4M1U B;  1XNR L;  2YV5 A;  3OIP A;  1FNW A;  1QZH A;  1H95 A;  4UP9 A;  3L9A X;  2AUJ D;  3PSI A;  4DV1 Q;  1GJX A;  1XJV A;  1A2U A;  3L3O C;  1Y1W G;  3I4N H;  1K28 A;  3CQZ H;  3HOV G;  1CSP A;  3ND8 A;  4EQO A;  2K03 A;  1SEB D;  1Y8P B;  1TWC H;  4IOC A;  4A3K G;  4PMW A;  5COR A;  2XRS D;  3ND9 A;  4L6T B;  4BBS H;  1EY8 A;  4F87 A;  2F0V A;  1P8L A;  2VQE Q;  5IP7 G;  3EA6 A;  3KBX A;  2KEE A;  3OWE B;  5G3L D;  3J7Z C;  1TS3 A;  1EQQ A;  2VB3 X;  3MA2 B;  3PIO A;  4CJ1 B;  2OQ0 A;  1L1O C;  1G29 1;  4ME3 A;  1OTC A;  1TVX A;  2K5V A;  5CV5 A;  2EXZ A;  2F0N A;  4LF7 Q;  3M4O H;  1ZYR D;  2RF4 A;  2PMZ B;  4ZKB B;  5IGD A;  4JBK A;  2L55 A;  1U4R A;  3NTH A;  3K6O A;  2MJ8 A;  1LAC A;  1ET9 A;  1RTN A;  1Z7T A;  2VB2 X;  5CV9 A;  1PFB A;  1Y1W B;  1NMG A;  4DR5 L;  2Q8T A;  1OXV A;  3PIP 3;  1PMR A;  3HOV B;  4X65 Q;  1IBM L;  1L0Y B;  2I46 A;  3ER0 A;  1F2Y A;  4JI7 L;  1IZ6 A;  4K5V A;  4KKS A;  1B53 A;  5FLM G;  2DY8 A;  3K8A A;  1J5E L;  4A3K B;  2O5J C;  1SNC A;  4CDE C;  1OXT A;  4JYA L;  4K6L A;  1QVG A;  4CGY B;  4CJ2 C;  2L12 A;  2JA6 G;  1JOQ A;  1EWI A;  3KF6 A;  1K83 B;  1YHA A;  4ZUJ A;  1N33 L;  1O7Y A;  4DV6 L;  1LTA D;  2PNR C;  1L1O B;  2Q2I A;  4EVO A;  2F4I A;  4KKU A;  1EOV A;  3NWT A;  5I9P A;  1VS0 A;  3UE0 A;  3HS0 C;  4AIM A;  3A8I E;  3G7L A;  3GTG B;  3HOW H;  2Z4H A;  3JAM E;  2PW7 A;  4DK1 A;  4RHS A;  3UDG A;  3I91 A;  1JOO A;  2K33 A;  5DAU A;  3PIO 3;  3T51 B;  4LF6 Q;  2AHO B;  2DY7 A;  4A3B H;  4V19 0;  4Y7N H;  2IX0 A;  1D1K A;  1STB A;  5EAY A;  3AFP A;  3CMA A;  3QIA A;  3GTM B;  3I2Z A;  4J6H A;  3BS1 A;  1MHW C;  3BJU A;  1WFQ A;  3PO3 H;  1EY6 A;  2C5C A;  2JE6 I;  1SE2 A;  3GTJ H;  3T1Y L;  3S1M H;  2WAC A;  2JA6 B;  3NBH A;  2UXB L;  1F9Q A;  4OO1 H;  2ZJQ A;  1PV4 A;  4JV5 Q;  1CUK A;  1YNX A;  2QCP X;  4A3M H;  1PH7 A;  2MP1 A;  2Q2U A;  3S17 H;  2K5Q A;  4G7Z C;  4JOI A;  1GD7 A;  3FPU B;  2VL6 A;  1WD1 A;  3M4Q A;  1C8C A;  4I65 A;  1HA5 A;  4C1N I;  3BVM A;  1VQA A;  3C3L A;  1XNQ L;  4AYB E;  3PUY A;  2Z0S A;  4A3E H;  2JP1 A;  3KLW A;  3CU7 A;  2R6G A;  3A8J E;  1T5X D;  3LWE A;  2UXC L;  4JI2 Q;  3A7L A;  1G91 A;  3I4M B;  2A1A A;  3DEO A;  3ULL A;  1U4M A;  1IXR A;  1IHZ A;  2YU9 B;  4JI6 L;  4EX5 A;  3S16 B;  3BDL A;  3R8B A;  1KC8 C;  1TWA B;  3RZO B;  4L5S A;  4DR7 L;  1SNO A;  1NMF A;  4A75 A;  3S1Q B;  1MJE A;  5CV4 A;  4A3D G;  2NVY B;  3GQB A;  1JE4 A;  1X6O A;  1DON A;  4FXK C;  1FR3 A;  2XVS A;  1YIJ A;  5C3X A;  5M5Y B;  1NR2 A;  3NTI A;  5I4D A;  4RCO A;  3R2T A;  3KYH C;  4JW0 A;  4E6I A;  5J22 A;  1HQM C;  4EQN A;  1XMO L;  5FO9 B;  1EYD A;  1BBU A;  4ME5 A;  3CPW A;  2OEO A;  3OW2 A;  4DXG A;  5C4X G;  2UUA L;  2NN6 G;  1FNV A;  1I50 H;  4JI7 Q;  4A93 B;  1YJW A;  1FD7 D;  3TEH B;  4FF4 A;  2EYP A;  2A6E D;  2EYF A;  3IL8 A;  1J5E Q;  4JYA Q;  4QQB X;  1VF5 C;  4IJL A;  1KAA A;  4C3I G;  2F3V A;  4K5W A;  2UXD Q;  2M00 A;  4R4I A;  3UE1 A;  1N33 Q;  4R8N A;  1R9T H;  3KK7 A;  1N9W A;  1SYF A;  3UI2 A;  4A3D B;  4FF1 A;  3GTL B;  1YVC A;  2HIV A;  2QKI C;  5ELB A;  4GZY C;  4MN3 A;  3KBG A;  2A19 A;  3OMC A;  4IUV A;  1JE5 A;  5E4W C;  1SMX A;  1GVP A;  3GTQ B;  3URY A;  1TKW B;  1WOC A;  2C35 B;  1LM0 A;  2N3S A;  1A62 A;  3VA5 A;  4JI5 Q;  2JEA I;  3HKZ E;  5C4X B;  3SVM A;  1H9S B;  2PI2 A;  4GOP A;  3E0J A;  4RAU C;  1CFM A;  4JCV E;  1R4Q B;  3DXJ C;  3EFX D;  5CV7 A;  1B1Z A;  1MI2 A;  2FHT A;  1X54 A;  2BA0 A;  2LFN A;  1WTP A;  3ERQ A;  2K5D A;  2UXB Q;  4C3I B;  4B9X A;  3VR6 A;  2KHJ A;  1GUO A;  5C0X H;  1I4R A;  3TRE A;  4EGV A;  1JJG A;  3K0X A;  2MQH A;  4A3C G;  4L5R C;  3QOJ A;  4DAP A;  4TKO B;  1L2F A;  3GTP B;  2G9D A;  4DV4 L;  4PQX A;  3KDF B;  3CCM A;  2NB0 A;  3VR2 A;  4XQN A;  2R7Z G;  2B2W C;  2XRQ D;  4LJZ C;  1KDB A;  1EEF D;  2MO1 A;  2WAQ G;  4ABN A;  2K7V A;  3G6E A;  1J9O A;  4CJ0 B;  4I7Z C;  1BBX C;  3U4Z A;  4HJA A;  1HHV A;  4JVZ A;  1AW7 A;  4GKK L;  4JI3 L;  4HTH A;  4DNI A;  1YNJ D;  4DV3 L;  1PTO C;  2E75 C;  3NEM A;  1TS2 A;  2UUB L;  3CF5 A;  1O7I A;  1X3G A;  4B3T L;  3TDQ A;  1TWH B;  1HR0 Q;  3K59 A;  4IUT A;  1A63 A;  2SDF A;  1I4G A;  1IYV A;  2VUM G;  4YHH Q;  2HT1 A;  4WFN 3;  2N88 A;  1PH9 A;  3A5Z B;  3I4L A;  1Q82 C;  1ICF B;  1BBW A;  1SBB B;  1K8G A;  4DAV A;  3S1N B;  1HZ9 A;  2MPM A;  1LUZ A;  1S5F D;  2A73 B;  2D0P A;  1SFO H;  2R7Z B;  2NVQ H;  2NWG A;  2KEN A;  2WAQ B;  3X3N A;  1VQH A;  2DJF C;  2EY1 A;  3A55 A;  4LFB L;  2E5L Q;  5J3B A;  1WTX A;  2H1E A;  1KRS A;  3A56 A;  5IT9 E;  2YYZ A;  2L0C A;  2F0H A;  3AMU A;  4YCW A;  4IN3 A;  4QGU A;  4LFC L;  1FVI A;  4DK6 C;  1Q81 C;  2E2J H;  3PO2 H;  3SDZ A;  2LXJ A;  4KD4 A;  3UDX A;  5KYI A;  1TS4 A;  4QL5 A;  5FJ8 G;  5CR3 A;  1G51 A;  2BOS A;  1QOH A;  3PUZ A;  3TBI B;  5K36 G;  2ZTC A;  1SSO A;  3S15 B;  3BZD B;  5C4J B;  1D5Z C;  4DR1 Q;  2VUM B;  1BXT A;  3M4P A; 
#chains in the Genus database with same CATH homology
 3ULP A;  3CCU A;  1KIX A;  2JK8 A;  1CKM A;  2OQK A;  5GQO A;  1Y1V H;  4DR1 L;  3H0G H;  1Z47 A;  2EIF A;  1X65 A;  4A4I A;  3CP0 A;  4A3E G;  1EIF A;  4IPG A;  1YZ6 A;  2K52 A;  4JI1 Q;  1HNZ Q;  1I94 Q;  2VNU D;  2NZO A;  1J6Q A;  1AE2 A;  1HH2 P;  5HY6 A;  2AWN A;  5IWA L;  4JI1 L;  4A3K H;  1OXS C;  4YY3 Q;  5IYC G;  1EYG A;  1HNZ L;  4IOA A;  3GTO H;  4KHP Q;  1VQC A;  4BXX H;  1JB7 A;  1KHI A;  1UEB A;  3KF8 B;  1U5K A;  1VQB A;  3PUW A;  4LUO A;  5IP7 H;  3HOY H;  1VQJ A;  3K81 C;  1K83 H;  5IYB H;  1VQP A;  4BA1 I;  1VQM A;  4JBW A;  4KHP L;  1L0W A;  5IT9 c;  2GVA A;  2AWO A;  4YCU A;  2YTV A;  1SRO A;  2VY3 A;  1X3F A;  2JA7 H;  2PQA B;  1MIU A;  4GKJ Q;  2VS1 A;  2JEB I;  2JA8 H;  2RCN A;  4R4C A;  1JJ2 A;  3WWV A;  1YHQ A;  3AYH B;  3GTQ H;  5M3M H;  2B63 G;  3GTG H;  2EXD A;  1NBW A;  3OYY A;  1VQ5 A;  1HNW Q;  2R93 H;  4OON A;  1VQL A;  4R1J A;  5GAD C;  2UUC Q;  2I5L X;  3ULJ A;  4DR2 Q;  3S14 H;  1HNW L;  2D62 A;  1P16 A;  4GN5 A;  4DV4 Q;  4DV5 Q;  1YBY A;  4O0A A;  2R7D A;  2KCT A;  3F1Z A;  4YWM A;  3I55 A;  4DR2 L;  1YEZ A;  2NN6 I;  1B8A A;  2UUC L;  4AYB G;  5GRO A;  4OWX B;  3ZJY C;  4X6A H;  2XGT A;  3STB C;  4DV2 Q;  2Q2T A;  3PIP A;  3U50 C;  4K0K Q;  1TWF H;  3GTM H;  4A3L G;  2K5H A;  1YJ9 A;  1XNR Q;  4DV2 L;  5C44 G;  4HJ9 A;  1Q86 C;  4JBJ A;  3NEL A;  1NE3 A;  3UDF A;  4K0K L;  3A0J A;  4C3H H;  4DAY B;  4NXM L;  4IFD G;  1CKO A;  1XNR L;  3HOU H;  4IFD J;  3KOJ A;  2YV5 A;  4X66 L;  3PO2 G;  2JA6 H;  3DM3 A;  1QZH A;  2UUB Q;  1H95 A;  2CQO A;  4UP9 A;  2CWA A;  4LFA L;  3PSI A;  1V43 A;  1EUJ A;  3FHW A;  4L5Q A;  4B3T Q;  4DV1 Q;  3CC7 A;  3CCE A;  1TXY A;  1XJV A;  3CD6 A;  5ELN A;  2JA9 A;  1KQS A;  4LF5 Q;  4OX9 Q;  3L0O A;  4DV1 L;  1Q1E A;  1Y1W G;  1D8L A;  2CCZ A;  4DR3 Q;  1EIY B;  3I4N H;  2IY5 B;  1AE3 A;  3CQZ H;  1PFS A;  3I4O A;  3HOV G;  1CSP A;  4LF5 L;  1KAW A;  4DR3 L;  3T1H Q;  2DUD A;  3S2H H;  2Y0S G;  1IYJ B;  1YHB A;  2KBN A;  3GDE A;  1KRT A;  2E2H H;  4HJ8 A;  4IOC A;  1TWC H;  4IO9 A;  3T1H L;  1W2B A;  1PH2 A;  3J7A 5;  4GLX A;  4PMW A;  5GAE C;  4A3K G;  3ICE A;  2HIX A;  4LF8 Q;  4B3R Q;  4OWW B;  1TWG H;  3W1B A;  4BBS H;  4A3G H;  4IPD A;  4JBM A;  4LF4 L;  1P8L A;  3RN2 A;  5GAG C;  2VQE Q;  5IP7 G;  4LF8 L;  5IYB G;  3J7Z C;  1HNX Q;  3F2B A;  4A76 A;  1EQQ A;  4DUZ Q;  3PIO A;  4GKJ L;  4B3M Q;  2OQ0 A;  1L1O C;  1G29 1;  4ME3 A;  1X9N A;  1K8A C;  1HNX L;  1K3R A;  1OTC A;  2JA7 G;  3I4M H;  4DUZ L;  1VQN A;  3AEV A;  1E1T A;  2K5V A;  4B3M L;  4LF7 Q;  2YU9 H;  4A3I G;  3S16 H;  3M4O H;  4JI8 Q;  2RF4 A;  4BY1 H;  1S40 A;  3J81 j;  1GKH A;  1TWA H;  3RZO H;  5C0X G;  5JJL A;  1K73 C;  4QJF A;  3PGZ A;  4TQU S;  3Q8D A;  3S1Q H;  4JI8 L;  4JBK A;  5IYD H;  1LTL A;  1VQ6 A;  2R93 G;  2WB1 E;  1SR3 A;  2IT1 A;  3BU2 A;  1C0A A;  4QIW E;  2CWP A;  5M5Y H;  4DR5 Q;  4RG1 A;  1IBM Q;  3W1G A;  4P75 A;  1NMG A;  4DR5 L;  1OXV A;  2RHS B;  1JJC B;  4POF A;  4X65 Q;  1XPU A;  1E22 A;  1IBM L;  1FJG L;  1KD1 C;  2D0O A;  3ER0 A;  4JI7 L;  3EN2 A;  1IZ6 A;  3S1N H;  4BY7 H;  2K14 A;  2R7Z H;  2MNA A;  5HGQ A;  5FLM G;  5FLX c;  4A93 H;  3K8A A;  1WJJ A;  4PZ6 A;  1NJI C;  1J5E L;  4DKA C;  2MFI A;  3M3Y H;  1OXT A;  1UE7 A;  5H1S E;  2JA5 G;  4JYA L;  3HOU G;  5IWA Q;  2ALY B;  3CCR A;  4A3F H;  1QVG A;  4DV6 Q;  3G4S A;  2JA6 G;  4LWC A;  1EWI A;  2QGQ A;  3KF6 A;  2WP8 J;  1YHA A;  4Y52 H;  1N33 L;  4DV6 L;  1WCM G;  4NPS A;  2CFM A;  2F3I A;  1L1O B;  2Q2I A;  1N36 L;  4XIG S;  4J15 A;  4MZ9 A;  4MTN A;  2R92 H;  1EOV A;  1PH4 A;  4UP8 A;  3I4N G;  2Z6K C;  3D0F A;  2ZJR A;  1VS0 A;  5ELO A;  3I7F A;  3UE0 A;  4P71 A;  4AIM A;  4A3D H;  2F4V Q;  3GTL H;  3U58 A;  2HHH L;  1RIP A;  1E3P A;  4QY7 A;  3HOW H;  3HFZ B;  1MJC A;  3UDI A;  5LMU Q;  4GS3 A;  1XMQ L;  2F4V L;  2VUM H;  3UDG A;  1A0I A;  3RNU A;  1QUQ A;  5LMU L;  5M5W H;  1YJN A;  4A3G G;  3CME A;  1EQR A;  4LNQ A;  2OTJ A;  1N8R C;  3CC2 A;  1GO3 E;  3JAM i;  2VQF Q;  2AHO B;  4LF6 Q;  3CCL A;  2UU9 L;  4A3B H;  1VCI A;  4B3R L;  4HID A;  5C4X H;  3K7A H;  2IX0 A;  4Y7N H;  3CMA A;  2VQF L;  5EAY A;  3AFP A;  4LF6 L;  3I2Z A;  3BZC A;  1VQK A;  3OTO Q;  1ASZ A;  5LMN W;  3T1Y Q;  3BJU A;  1WFQ A;  3HKS A;  4DUY Q;  1C7Y A;  3PO3 H;  2JE6 I;  4BY1 G;  3LGJ A;  2QA4 A;  1Q1B A;  3OTO L;  2I5H A;  3GTJ H;  3T1Y L;  5E7N A;  4DUY L;  3S1M H;  3BZK A;  2N49 A;  2UXB L;  5IYD G;  4NXM Q;  2AKW B;  2ZJQ A;  1PV4 A;  4JV5 Q;  4GLA C;  4X64 Q;  4X66 Q;  4OO1 I;  1CUK A;  4EQ5 A;  4C3I H;  1WYD A;  1YNX A;  2GN5 A;  3PCO B;  2ZTE A;  1CKN B;  4JV5 L;  4X64 L;  4LFA Q;  4IPC A;  4A3M H;  1PH7 A;  3PF4 A;  4A3J H;  2Q2U A;  4GKK Q;  2K75 A;  3S17 H;  3SGI A;  4LF9 L;  5FJ8 H;  4JOI A;  1GD7 A;  3JAM c;  4GNX A;  2VL6 A;  4RMF A;  3HOX G;  4BY7 G;  3M4Q A;  4DAM A;  1XNQ Q;  3GTP H;  1PH5 A;  3E9I A;  1W3S A;  1N34 L;  4O2D A;  1VQA A;  1XNQ L;  2FXQ A;  5BR8 Q;  4AYB E;  3HOZ H;  1Y1V G;  3H0G G;  3PUY A;  2Z0S A;  4A3E H;  2UXC Q;  1ASY A;  3KLW A;  4A3F G;  4C3J H;  1HZC A;  2R6G A;  5BR8 L;  1B70 B;  3KF6 B;  4H02 A;  2WAQ E;  3J80 i;  1SLJ A;  2UXC L;  2QEX A;  2NVT H;  4JI2 Q;  4JI6 Q;  1YI2 A;  4BXX G;  2A1A A;  4JI2 L;  1IL2 A;  3ULL A;  3HOY G;  1IXR A;  3TS2 A;  4JI6 L;  2PMZ E;  4EX5 A;  2N8N A;  1VQO A;  1PH6 A;  1KC8 C;  1VQE A;  2R92 G;  1D7Q A;  3EBE A;  2AMC B;  4L5S A;  4DR7 L;  2MO0 A;  1NMF A;  4A75 A;  1MJE A;  4A3D G;  2YTX A;  3FKI H;  3S2D H;  3M7N A;  1X6O A;  3CXC A;  3HOW G;  1V9P A;  4PZ7 A;  3B6Y A;  3F2C A;  1YIJ A;  1T9H A;  2IHF A;  3VDY A;  3CAM A;  1XMO Q;  1TWH H;  2JA8 G;  3JC6 6;  3KYH C;  1QUQ B;  1Y14 B;  5M3M G;  4HJ7 A;  4DK3 C;  3ERS X;  1XMO L;  3RN5 A;  2B63 H;  2Y0S E;  1SRU A;  2UUA Q;  3K7U C;  1BBU A;  1U0L A;  3CPW A;  4A3B G;  2RHQ B;  4A3C H;  3OW2 A;  2L15 A;  3J80 c;  1PYS B;  1PH8 A;  5C4X G;  1IBL L;  2UUA L;  1FJG Q;  4DPG A;  2NN6 G;  3F2D A;  4DV0 Q;  1I50 H;  4JI7 Q;  1YJW A;  4AH6 A;  3TEH B;  3TRZ A;  1NTG A;  3M85 A;  1IBK L;  4DV0 L;  3KDF A;  3NEN A;  1J5E Q;  1E1O A;  3W5O A;  3KJP A;  4JYA Q;  4OO1 G;  3FP9 A;  3TS0 A;  5DLQ E;  5IY0 A;  2Q2H A;  4GLV B;  2I0Q A;  4QQB X;  4IJL A;  1BVS A;  5C44 H;  5LMN Q;  4P73 A;  4HIK A;  1B7Y B;  4HIO A;  1PVO A;  2UXD Q;  3CPF A;  3KFU A;  4R4I A;  4UPA A;  3UE1 A;  1N33 Q;  1HR0 W;  2ES2 A;  5LMN L;  1R9T H;  4YWK A;  4AQY Q;  1N36 Q;  2UXD L;  1N9W A;  4GN3 B;  4C2M H;  3GO5 A;  3M9B A;  3K80 C;  1HJP A;  1VQD A;  1PH1 A;  5JJK A;  1SN8 A;  1AH9 A;  1VQ7 A;  1S72 A;  4AQY L;  1YVC A;  2HIV A;  1SE8 A;  1VQ4 A;  1M1K C;  4BA2 I;  4KHZ A;  2V1C C;  1PHJ A;  2A19 A;  2LXK A;  1QVC A;  1Y1W H;  2HHH Q;  2OWO A;  1FL0 A;  5M3F H;  2IHE A;  1JE5 A;  1SMX A;  1GVP A;  4GN4 B;  5C3E H;  3CC4 A;  4APV A;  1XMQ Q;  3HOV H;  1E7Z A;  1WOC A;  2C35 B;  1LM0 A;  2N3S A;  2ZTD A;  3PF5 A;  1C9O A;  1A62 A;  3MXN B;  3S15 H;  5C4J H;  3PUX A;  4DV7 Q;  4JI5 Q;  2E2I H;  2JEA I;  2ZM6 Q;  3A5U A;  3HKZ E;  1NY4 A;  4TVA B;  4HIM A;  4PG3 A;  2PI2 A;  4GOP A;  3F8T A;  4FDB A;  4JI5 L;  1Q46 A;  4DV7 L;  1I94 L;  3STB D;  2ZM6 L;  5AJ3 Q;  2UU9 Q;  4BBS G;  2K4K A;  1VQF A;  4X62 Q;  4YY3 L;  4JCV E;  4UP7 A;  5AJ3 L;  2K50 A;  3GD7 A;  1RL2 A;  5JEA G;  5JEA J;  3EIV A;  4X62 L;  1M90 C;  1X54 A;  2BA0 A;  3MEF A;  4LW1 A;  3I4M G;  3FKI G;  4KI0 A;  1QZG A;  3KJO A;  5IP9 H;  2UXB Q;  4A3I H;  3H15 A;  2KHJ A;  4L5T A;  4PZ8 A;  4DR7 Q;  3AQQ A;  1UWV A;  3TRE A;  5C0X I;  3TQY A;  1JJG A;  3K0X A;  4BBR H;  2MQH A;  3A74 A;  4A3C G;  4L5R C;  4LF9 Q;  2KCM A;  3J81 i;  1L2F A;  2ID0 A;  1A8V A;  2EQS A;  1LYL A;  4LUZ A;  4GOP C;  2OTL A;  2YTY A;  4R4Q A;  3GTK H;  4WJ4 A;  4R4O A;  1Q7Y C;  4P74 A;  1I3Q H;  4DV4 L;  4DV5 L;  4JC0 A;  4NXN Q;  4DR4 Q;  3KDF B;  1N34 Q;  3AFQ A;  3CCM A;  2R7Z G;  5IE8 A;  2ATW A;  3IRB A;  4P72 A;  2PI2 E;  1YIT A;  4A93 G;  4YWL A;  4NXN L;  4DR4 L;  2MO1 A;  5FLM H;  3S1R H;  2WAQ G;  3G6E A;  1Q12 A;  2IX1 A;  3E9H A;  2JA5 H;  2A8V A;  3U4V A;  1Q8K A;  3U4Z A;  2HQL A;  4LUV A;  1OXU A;  4JI3 Q;  1CSQ A;  3H3V H;  4HJA A;  4DR6 Q;  4OWT B;  4DV3 Q;  3RZD H;  1JMC A;  3H3V I;  1N32 Q;  4GKK L;  2N78 A;  4JI3 L;  4WJ3 M;  4DR6 L;  4DNI A;  2GVB A;  4DV3 L;  5IYC H;  1WCM H;  1VQG A;  1L1O A;  1K9M C;  1G6P A;  3NEM A;  1N32 L;  3RLF A;  2UUB L;  2LSS A;  1JT8 A;  3CF5 A;  1V1Q A;  1O7I A;  1X56 A;  1XTD A;  1X3G A;  2VZA A;  3E0E A;  4R4T A;  3J81 c;  3CW2 C;  1PH3 A;  4B3T L;  1HR0 Q;  4YCV A;  5M3F G;  4JOI C;  5C3E G;  1VQ8 A;  1A63 A;  4OX9 L;  1KXL A;  3I56 A;  3PUV A;  1I5F A;  4GNX C;  1HR0 L;  2DGY A;  2PQA A;  4IPH A;  2R7F A;  1BKB A;  1UE5 A;  2WB1 G;  3L7Z C;  3PV0 A;  4JI4 Q;  1WI5 A;  2VUM G;  2ASB A;  3RR5 A;  1KL9 A;  4YHH Q;  2HT1 A;  4JI4 L;  2F52 A;  4POG A;  1HZB A;  1VQ9 A;  1PH9 A;  1VQI A;  4GOP B;  3A5Z B;  4YHH L;  4JG2 A;  2ZJP A;  4IJH A;  1IBL Q;  1X55 A;  3D31 A;  2H5X A;  1XPR A;  1Q82 C;  1BBW A;  1HZA A;  1I6H H;  1K8G A;  5GAH C;  4MNO A;  3G48 A;  1HZ9 A;  1QVF A;  1LUZ A;  2XTI A;  5JJI A;  2B3G A;  2D0P A;  2I5M X;  1SFO H;  2VQE L;  2BH8 A;  4ALP A;  2NVQ H;  1IBK Q;  4LFB Q;  2KEN A;  2K5N A;  5IP9 G;  3CCJ A;  1VQH A;  4XTC S;  3PO3 G;  2E8G A;  3CCS A;  1EFW A;  4LFB L;  2WFW A;  1UE1 A;  2E5L Q;  3DLL A;  3RLN A;  3L2P A;  2B29 A;  5C0X J;  4LF7 L;  2OCE A;  1MKH A;  3NBH B;  5J3B A;  2NZH A;  4LFC Q;  4A3L H;  1KRS A;  1OXX K;  2KHI A;  2BA1 A;  1FGU A;  2E5L L;  2NVY H;  1DGS A;  1PYB A;  2YYZ A;  4JI0 Q;  2BH2 A;  4B3S Q;  4YCW A;  4BBR G;  4QGU A;  1K0R A;  4LFC L;  1FVI A;  4JI0 L;  1CKN A;  4A3M G;  4DK6 C;  2PNH A;  2NVX H;  1Q81 C;  2E2J H;  3CCQ A;  4B3S L;  3HOZ G;  4A3J G;  3PO2 H;  4IFD I;  2CKZ B;  3G71 A;  2LXJ A;  3UDX A;  2Z6K A;  1GM5 A;  5M5X H;  5FJ8 G;  4QL5 A;  1G51 A;  2VW9 A;  4OXP A;  3RLO A;  3S24 A;  1PA6 A;  1Z9F A;  2JJQ A;  3PUZ A;  1S3O A;  1X3E A;  4KLK A;  4NB3 A;  4GNX B;  5K36 G;  3HOX H;  4UY8 C;  1XPO A;  4HJ5 A;  4X65 L;  4LF4 Q;  2ZTC A;  2JQO A;  4DR1 Q;  3CCV A;  3M4P A;  1UE6 A;  3HKZ G;  1E24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...