2LSSA

Solution structure of the r. rickettsii cold shock-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
MATNIVGKVKWYNSTKNFGFIEQDNGGKDVFVHKSAVDAAGLHSLEEGQDVIFDLEEKQGKAYAVNLRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein, dna binding protein
molecule keywords Cold shock-like protein
publication title Solution structure of the cold-shock-like protein from Rickettsia rickettsii.
pubmed doi rcsb
source organism Rickettsia rickettsii
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lssA00
2MO1A 5LMNL 3S1NH 2UXDL 1SN8A 4DKAC 1BVSA 5M3FG 1PH7A 5FLMH 3S17H 1VQAA 1IYJB 4A3DG 4A76A 1H95A 1VQKA 4X65L 4AYBE 1M90C 1Y1VH 2VZAA 1I3QH 1OXSC 3DLLA 4DR1L 3RLNA 1EOVA 4X64Q 1PYSB 2KHIA 3PUWA 2JA6H 3TREA 1SFOH 4JYAQ 1G51A 1NE3A 5M5WH 1A0IA 1LYLA 3PUVA 1TXYA 2R7DA 3GTLH 5M3MG 1SLJA 4GN5A 3S14H 3HOZH 1XMOQ 2MFIA 1KD1C 4QJFA 2VQFL 1GM5A 1JB7A 3PO2H 5JJLA 1SRUA 4QGUA 4JI6L 4OO1I 4R4IA 3CCLA 2BH2A 3BJUA 4R4CA 4A3KH 3CC4A 4GKKL 2HT1A 2A1AA 2Q2HA 4GNXB 1I6HH 2HHHQ 5IYCH 4LNQA 1YBYA 1AE3A 4C3HH 3JAMi 3MEFA 5J3BA 4B3RQ 3B6YA 4DV7L 1BKBA 2JA9A 1U5KA 4P72A 4UP9A 1P16A 4UP8A 1Q82C 1W3SA 2HIVA 3CF5A 3CC2A 3PV0A 1LM0A 4GOPA 3CCSA 4GOPC 1PA6A 2R93H 2ALYB 2CWAA 4P74A 4JI8L 4JI0L 4JC0A 1B8AA 4LWCA 4HIKA 2IX1A 3S1QH 4A3CG 2Y0SE 3KYHC 3L7ZC 4LFCL 3M4PA 4IO9A 1NMFA 2HIXA 4JBWA 4DV4L 1M1KC 3KDFB 4NXML 1VQIA 1P8LA 2NZOA 3E9HA 1YITA 5ELOA 3PO3G 5M3FH 4HIOA 1YJWA 4A3DH 2VNUD 4YHHQ 4DV6L 3OTOQ 2UXBL 2R6GA 1B70B 4B3SQ 3HOYG 4IPCA 3G71A 2LSSA 4WJ4A 1FJGQ 3JAMc 2IHEA 2FXQA 3FKIG 3CCMA 3CCRA 3NELA 4KI0A 4JI2Q 3UDIA 5FLXc 4AQYQ 1X55A 4IOCA 1N32Q 2Z6KA 5M3MH 2Z6KC 2UXCQ 1CSQA 4X62L 3VDYA 4A3IG 1VQ5A 2L15A 3PUZA 2YV5A 3E9IA 4DR6L 3Q8DA 1Q86C 3I56A 1NBWA 3CCUA 1I94L 1C9OA 2IT1A 4R1JA 5LMUQ 1QVGA 2QEXA 1O7IA 3L0OA 4QY7A 2VS1A 2ZM6Q 4BBRG 3S1RH 1BBUA 1HZ9A 1VQJA 3K8AA 5HY6A 2UUBQ 5LMNW 1EIFA 1VQ7A 4DV1L 1EIYB 4JI4L 4HJ9A 4DV0L 1HNWL 1JE5A 5C3EG 3U58A 4JI3L 1L1OA 1EUJA 3GO5A 1L1OC 4O0AA 4IPHA 1IBML 2OTLA 4LF4Q 3RN2A 4A93H 3HOXG 1AH9A 1PH8A 4A3CH 1VQFA 1XMQQ 1V9PA 3IRBA 2VY3A 4OONA 1S3OA 1LTLA 4DUZL 3CP0A 4LF8L 3CQZH 2DUDA 3EN2A 3I7FA 2K50A 1K9MC 1A63A 3PO3H 3HFZB 1MJEA 4Y52H 2N78A 4GOPB 4DV3L 2BH8A 3HOYH 4DR5Q 4IOAA 5IYDG 5C4JH 4X65Q 4DR3Q 2R7ZG 1VQLA 4BA2I 2Q2UA 4WJ3M 4HIDA 4LFAL 1E24A 1PH1A 1KQSA 4OWXB 2UU9L 4DV2L 4DR1Q 3FKIH 2CFMA 1N33Q 4LUOA 4K0KL 4PZ8A 2EQSA 4LF5L 4LF7L 1XJVA 3RLOA 4IJHA 1K73C 3GD7A 1YJNA 3GTJH 1WJJA 2PMZE 4JG2A 4GKJL 2GVBA 2ZTDA 4DK3C 3ER0A 3OYYA 4DAMA 1Q46A 1IXRA 2N49A 4DUYL 4LUVA 4A3IH 1Q7YC 1QUQB 1VQGA 5C44G 1PV4A 3K7UC 1SMXA 3HKZE 2NZHA 2VQFQ 5IYBG 1N8RC 1EWIA 1KC8C 3CD6A 3K0XA 4JI6Q 2K14A 3UE0A 2E5LL 2ASBA 4GKKQ 4X6AH 3G6EA 2C35B 1PH3A 3RZDH 1MIUA 4AIMA 1CKMA 4BBRH 4DNIA 1HR0L 4JI7L 4P73A 5IWAQ 2YU9H 1PYBA 3GTGH 4BY7G 3BZCA 2MO0A 2RHQB 2PNHA 4DV7Q 1N36L 1XNRL 3KJPA 1EFWA 4DR4Q 5C4XG 2WAQG 5C3EH 4YWMA 1I5FA 1K3RA 1XPRA 1VQCA 4GS3A 1KL9A 2IX0A 4MTNA 4P75A 3HOXH 3F2DA 1QZHA 3HOWG 3STBD 5JEAJ 2EXDA 4JI8Q 1CKOA 3KF6A 5FJ8G 4JI0Q 2NVTH 1VS0A 1KIXA 3CPWA 1CSPA 2I0QA 1C0AA 2A19A 4LFCQ 4A3FG 4DV4Q 3K80C 1JMCA 4NXMQ 1YHBA 3RNUA 1B7YB 5E7NA 1UE6A 4NPSA 4R4TA 3OW2A 1J5EQ 3KJOA 1QVCA 4DV6Q 3T1HL 5IYDH 1OXTA 1E1OA 2R7ZH 2OTJA 4KHZA 3J80i 4P71A 3PIPA 1PH4A 1NMGA 1YHAA 3GTOH 1LUZA 3G48A 3H3VH 2EIFA 2OCEA 4HJ5A 2WB1E 2ZTEA 2HQLA 4C2MH 5C0XJ 1YJ9A 1XTDA 1A62A 1G291 4A4IA 1Y1WG 3AYHB 3ICEA 1HZCA 1IBLL 5EAYA 2E2JH 1IBKQ 2YTVA 4A3LG 1HNXL 4L5SA 5C44H 1XNQQ 3S1MH 4IFDI 3UDFA 1Q12A 1VQHA 1HNZQ 5IYBH 1N34L 3NEMA 3LGJA 3DM3A 2NVYH 2F4VL 2YTXA 5IP9G 2ZJPA 4KLKA 1CKNA 4DR2L 4BBSG 4LF6L 4L5TA 1KRTA 2PI2A 1X3FA 2ZJQA 4BY7H 1TWGH 4B3TL 4NXNL 2B63G 4RG1A 2CWPA 3PIOA 3RR5A 5C4XH 3J80c 4DV1Q 3NENA 4L5RC 3CW2C 4JI4Q 1Q8KA 2Z0SA 4DV0Q 4TVAB 4B3MQ 4JI3Q 4A3EG 2F3IA 3HOWH 1IBMQ 3CCQA 5FJ8H 5AJ3L 5IP7G 4GN3B 4A3BG 1RIPA 1T9HA 2WFWA 4X64L 4YY3L 5HGQA 2KCMA 4DUZQ 4A3FH 1VQ8A 2I5LX 1X54A 4NB3A 1K0RA 1TWHH 1XMOL 4ME3A 1JT8A 3T1YL 1HJPA 4DV3Q 2QGQA 3CCEA 4C3JH 1Q81C 1E7ZA 1IZ6A 3M9BA 2JA5G 3EIVA 3CMEA 4OWWB 4K0KQ 4DV2Q 2AKWB 2PQAA 1X9NA 2I5HA 1HR0W 4LF5Q 4YCUA 4LF7Q 1PH6A 5BR8L 4J15A 2R92G 3S2DH 1Y1WH 4A3LH 1TWFH 2K5VA 2Q2TA 4GKJQ 4B3RL 5C0XI 1K8GA 4AYBG 1KHIA 1SR3A 3PCOB 4BXXG 1Z47A 2DGYA 4DR7Q 2LXJA 2YTYA 1UE1A 5GAGC 3J81i 4ALPA 1ASZA 3U4ZA 1E22A 5K36G 1OXXK 1X65A 3NBHB 5IP9H 1V43A 5IT9c 1DGSA 4DV5L 1YI2A 5GADC 1WCMG 4BBSH 2XGTA 4TQUS 4EX5A 3TS2A 4OWTB 1YZ6A 4H02A 1HR0Q 4JI7Q 2KCTA 3ERSX 1PH9A 2B63H 4A3GG 2JEBI 3PSIA 3D31A 5LMNQ 2BA0A 2UXDQ 1L0WA 5GQOA 1N36Q 2E2HH 1XNRQ 1QZGA 3OTOL 4A3EH 1QVFA 1VQNA 2KHJA 2UUCL 2JA8G 3M3YH 3U4VA 1VQ9A 2NN6I 5IP7H 2K5NA 4A3BH 3ZJYC 2GN5A 1Y14B 2R7FA 1XPOA 3H3VI 1VQBA 4Y7NH 2JE6I 1KAWA 2D62A 3TQYA 4GNXA 1NY4A 4GNXC 1ASYA 2CCZA 4JI2L 1V1QA 3I55A 3PUXA 3CCJA 1UE7A 3I4MG 4PMWA 2WP8J 1VQEA 3F1ZA 1RL2A 3RLFA 2N3SA 1PHJA 4KHPL 2RCNA 1IL2A 3T1HQ 4YCWA 3UDGA 1OXVA 2BA1A 2Y0SG 4JBJA 5GROA 5H1SE 2LXKA 3BU2A 4O2DA 2VQEL 1VQ4A 2ES2A 2JA5H 4LF9L 1D8LA 1OTCA 3W1BA 2MQHA 2NVXH 2RF4A 2ATWA 2R92H 1FL0A 4UP7A 1X56A 3PF4A 1IBLQ 3K81C 2UUAL 4BXXH 4C3IH 5M5YH 2JK8A 1EYGA 1YIJA 5ELNA 4JI5L 2K75A 1N34Q 3AEVA 1YNXA 3PGZA 3W5OA 3EBEA 1X3GA 2AHOB 4JBMA 2F4VQ 5JJIA 1CUKA 1WCMH 1BBWA 4DR2Q 2ZTCA 1XMQL 4HIMA 4X66L 1NTGA 3AQQA 2D0OA 1AE2A 4A3GH 3A0JA 4B3TQ 4NXNQ 3A5UA 1L1OB 1X6OA 2UXBQ 4BY1G 4A3MG 1VCIA 4DR5L 4JI1L 2JA8H 4DR3L 2B3GA 4UPAA 1L2FA 2JJQA 1N33L 1PVOA 5AJ3Q 3KLWA 1D7QA 4XIGS 3M4OH 4YY3Q 4JV5L 3CCVA 3I4MH 2I5MX 4POFA 1U0LA 2Q2IA 4GLAC 3M7NA 4X62Q 3L2PA 4HJAA 4LFBL 1W2BA 4A75A 4DR6Q 1J6QA 3ULJA 3M4QA 3T1YQ 1I94Q 4IJLA 4UY8C 4OO1G 1UEBA 1X3EA 2CQOA 3F2CA 2OQ0A 4JBKA 1GKHA 1YVCA 3I4NG 5DLQE 1HZAA 4IPGA 4YWLA 1FGUA 1YEZA 4DPGA 1Z9FA 5BR8Q 3MXNB 2ID0A 2VL6A 4MZ9A 4APVA 1FVIA 5IWAL 4HJ8A 3ULLA 2AWNA 3GDEA 1K8AC 1MKHA 3PF5A 4OX9L 4DAYB 1VQDA 4IFDG 3AFQA 1HNWQ 4DR4L 4OXPA 3HOUG 3D0FA 5GAEC 2MNAA 4JCVE 1GO3E 3FHWA 4DV5Q 1G6PA 2VUMG 1TWAH 4LF8Q 4JYAL 3CAMA 3A5ZB 4HJ7A 1WI5A 3H0GG 3K7AH 3HKZG 1JJCB 2D0PA 1JJ2A 2K5HA 3S15H 2V1CC 1J5EL 4BY1H 4PZ7A 3KOJA 3WWVA 4A3MH 4LUZA 1QUQA 1VQ6A 2OQKA 1EQRA 3KF6B 2WAQE 4PG3A 4LFAQ 5M5XH 2UUCQ 3CMAA 1EQQA 1NJIC 2UU9Q 3CXCA 2OWOA 3U50C 3M85A 4EQ5A 2HHHL 2IHFA 3KF8B 4GN4B 4YCVA 3I4OA 5JEAG 4QL5A 1KXLA 2IY5B 4DUYQ 2ZJRA 3F8TA 3W1GA 3TS0A 1UWVA 1IBKL 2K4KA 4JOIA 4JOIC 2H5XA 1R9TH 1XNQL 4R4QA 1C7YA 4KHPQ 3HOVG 4BA1I 1HNZL 4A3JG 2JA7G 2VQEQ 3GTMH 2E5LQ 3J7A5 2QA4A 2AMCB 1S72A 4LF9Q 1WFQA 3ULPA 3I4NH 4FDBA 4L5QA 1VQMA 2KENA 3GTQH 3TRZA 3S24A 3SGIA 3CPFA 1HH2P 5C0XG 4GLXA 2UUAQ 1OXUA 4YHHL 2JQOA 4B3SL 5FLMG 1KRSA 2YYZA 3HOUH 2B29A 3CC7A 1GVPA 3RN5A 4B3ML 1CKNB 4JI5Q 3KFUA 1FJGL 1Y1VG 1N9WA 2WB1G 5GAHC 5IE8A 2KBNA 2N8NA 5JJKA 3TEHB 4R4OA 1SROA 1YHQA 2VUMH 2F52A 4DK6C 2JA6G 2RHSB 4X66Q 3J81c 4AQYL 2CKZB 2VW9A 1N32L 2K52A 2E8GA 3H0GH 3I2ZA 1GD7A 4IPDA 4YWKA 2UXCL 2AWOA 1I50H 3HKSA 3HOZG 3S16H 1WOCA 3PO2G 3G4SA 1WYDA 1K83H 1HZBA 4JI1Q 4A3KG 1E3PA 2NN6G 5LMUL 1PH5A 1TWCH 2ZM6L 4MNOA 1UE5A 5IY0A 1Q1EA 4RMFA 5IYCG 4QQBX 4JV5Q 3PUYA 4GLVB 4LW1A 2UUBL 2XTIA 3F2BA 1Q1BA 4IFDJ 1HNXQ 3E0EA 3KDFA 2NVQH 3JC66 2A8VA 4LFBQ 3STBC 4DR7L 3HOVH 1SE8A 1VQOA 4A3JH 1PH2A 4LF4L 2JEAI 2JA7H 3GTPH 2PQAB 3UE1A 1XPUA 1VQPA 2R93G 3UDXA 1PFSA 3GTKH 4QIWE 3RZOH 4A93G 3J81j 3BZKA 4LF6Q 4POGA 1S40A 3AFPA 1JJGA 1A8VA 1E1TA 2PI2E 2GVAA 4XTCS 3A74A 3J7ZC 2E2IH 1MJCA 4AH6A 3H15A 3S2HH 3FP9A 4PZ6A 4OX9Q
chains in the Genus database with same CATH superfamily
1L0YB 4FF2A 2UXDL 1SN8A 1BVSA 5M3FG 2KCNA 1VQAA 2DN8A 1VQKA 2HUGA 2EYPA 2VZAA 2Y0SB 1OXSC 5CORA 1VF5C 1EOVA 1VF7A 4E6IA 2JA6H 2XNAC 1G51A 1NE3A 1LYLA 2RVLA 5FK9C 1SLJA 3I91A 1PFMA 4JK1C 2VQFL 3DM1A 1SRUA 3OSOA 5I6YA 2BH2A 1LT6D 1AW7A 1S5FD 1QB5D 4A3KH 3CC4A 3TP7A 2CQAA 1L0XB 4GNXB 1TWAB 5JPMC 4RHSA 4KY6A 4B3RQ 1R4PB 1Q82C 4UP9A 1E2ZA 1P16A 1PTOD 1EIHA 2A68C 2HIVA 4IUVA 3S15B 3PV0A 4EQPA 4XXEA 4JC0A 1B8AA 3KYHC 1RCVD 1SJHD 2Z4IA 3A56A 4CGYB 5ELEA 5TSSA 1YJWA 5K36G 4DV6L 2UXBL 2XIWA 1ONLA 4N8X1 1TVXA 3NELA 2DY8A 1X55A 2Z6BA 1N32Q 3JAME 3SK6A 1QJOA 2L15A 1PZJD 3PUZA 2NWGA 3E9IA 1NBWA 2EY6A 2LKVA 2QEJC 2IT1A 1R4QB 3J80L 3L0OA 2ZM6Q 3QOJA 1XTCD 5LMNW 4CDCC 5J22A 2NBFA 3HKZB 1HHVA 2RBMA 1EIYB 4QF4A 4DV0L 2ICIA 3I73A 2E76C 5JVG3 4IPHA 1AH9A 1O80A 1TS3A 2AUKA 4KMUC 5IOCA 1CA5A 3HEJA 4DUZL 4LF8L 1LTLA 4IUNA 5COYA 3H09A 3EN2A 1K9MC 2BDNA 2RKSA 3C3LA 3PO3H 3HFZB 1MJEA 2M00A 1D5ZC 3OMCA 1A3UA 1X32A 4DR5Q 2R7ZG 4BA2I 5KNBA 1PZID 4RCOA 1B3QA 4LFAL 1KQSA 3HP3A 3VYUA 3VR3A 4ZK9B 1WJJA 2GVBA 1TS4A 4DAMA 4DUYL 1IXRA 3BDCA 4LUVA 3MXNA 1QG7A 5C44G 3F2UA 3S17B 2VQFQ 2AUJD 3CD6A 1KC8C 4QCLA 1DONA 2WB1B 4DGZA 2C35B 2PYKA 3RZDH 2A6HD 3VYSA 4KTAA 4K6DA 1DXMA 2F0DA 5IWAQ 2YU9H 1SFOB 4BY7G 5M5WB 2Q8RE 5C4XG 3S14B 1I5FA 2IW3A 3H94A 3J81L 1GJXA 1QZHA 4FO2A 3HOWG 4IQZA 3KF6A 5D65A 2BCOA 3KUPA 1VS0A 3OW7A 4U673 1I6HB 1CZGA 4C3HB 1JMCA 2IPKD 3FEWX 1UE6A 1J5EQ 5T1GA 2FMCA 3KJOA 2ICEC 4DV6Q 1F9RA 1SNOA 5IYDH 2XRSD 1PH4A 4P71A 3G48A 2EIFA 5IIFA 4F7XA 1ENAA 3O13A 3QB3A 2ZT9C 3ICEA 3AYHB 3T13A 5EAYA 1IBKQ 1B50A 1HNXL 1E2VA 1XNQQ 3UDFA 1HNZQ 5IYBH 3DUZA 2L1BA 3NEMA 4I7ZC 2RSNA 3IKJA 3LGJA 4RA8A 2NVYH 5CV6A 2PI2A 5AFWA 5E4WC 3MC0B 5M3MB 3NENA 4XYOA 1TS5A 1CT1D 4DV0Q 4TVAB 1JWMD 4KK7A 4B3MQ 3N52A 3J80E 1RTOA 2PPBC 2N55A 1MSGA 5HGQA 4DUZQ 3S1RB 2RDHA 2K33A 1S5ED 4Q5VA 4NB3A 4PV1C 4K5XA 3LWEA 1JT8A 2QGQA 4C3JH 4G7OC 2JA5G 3CMEA 4OWWB 2I5HA 3HS0C 5BR8L 2R92G 1BCPB 4A3LH 1TWFH 1KHIA 1WD1A 3T16A 1EL0A 2QW7A 2YTYA 1IHZA 4ALPA 1GHJA 4CKEA 3HOYB 1OXXK 2K5DA 5C4JB 1SYFA 5IP9H 1DGSA 4DV5L 3AB9A 2EYJA 3TDQA 1SNQA 1UEAB 2KCTA 1PH9A 2B63H 3PSIA 2F0EA 1RDPD 1TS2A 5IT9E 4A3IB 2E2HH 1C48A 3C1FA 3OTOL 3SHLA 4A3EH 1QVFA 1VQNA 2KHJA 2JA8G 5CV9A 1ZYRD 3U4VA 2K5NA 3R2IA 2GN5A 3OWEB 2RCFA 4IZ8A 4BBRB 4GNXA 2PNRC 2CCZA 3D6CA 1V1QA 3PUXA 1KLGD 1UE7A 3I4MG 4PMWA 3VYRA 3GTGB 1JICA 1Y8NB 3RLFA 2N3SA 5C3EB 1VDZA 4F88A 5GROA 5H1SE 1VQ4A 3DWPA 1VMCA 1D8LA 2N88A 3W1BA 3VR5A 2RF4A 2R61A 1UAPA 1CQFA 3RMHA 1KLUD 1SAPA 4QUFA 2D9UA 4JW0A 3K81C 4C1NK 4C3IH 4HAEA 4FXKC 2JK8A 1EYGA 3FDTA 3VR6A 3OIQA 1U4PA 5IGDA 3NHHA 4JBMA 5JJIA 1BBWA 3GTOB 2ZTCA 1XMQL 4K8JA 3A7AB 4B9WA 3SEBA 4C2MB 5JPNC 3E3XA 3K0YA 4MIUA 1L1OB 3TSSA 4XQQA 1DOMA 1SSOA 3FPPA 4X3TA 4FXGC 1N33L 3MFGA 1D7QA 3M4OH 1ESFA 3MFYA 3GP7A 4X62Q 1GUSA 4BWGB 4KD3A 2K5QA 4LFBL 4A75A 2F0WA 1I94Q 2FFKB 1HRJA 1UEBA 1A3TA 3BZDB 1U9RA 4J8QA 4JBKA 2EJMA 2F0PA 4DAPA 2HCCA 2C5CA 4DPGA 1YEZA 2CH4W 4ODGA 3W2DA 4MZ9A 5BR8Q 1FVIA 3ULLA 2AWNA 4OXPA 5T1IA 5KRUA 3HOUG 2LY7A 2MNAA 1GUNA 4DV5Q 1TWAH 4HMJA 2QF7A 4OHJA 5K5PA 4J1MA 4HJ7A 4FP5D 3H0GG 2D0PA 2K5HA 3S15H 2KVMA 2V1CC 4PZ7A 3WWVA 1EQRA 2B2TC 1IW7D 2WAQE 4QUCA 2OWOA 4EQ5A 4G57A 3KF8B 4BBSB 3CRKC 4QL5A 4UAIA 2F0KA 3IFDA 1MBYA 5C3WA 1UWVA 3NTIA 3LWUA 5BN3A 4LAAA 2JA7G 2EXZA 4OEMB 3ULPA 1EFID 1FYCA 1VQMA 4L5QA 2PW5A 1SYEA 4C1NI 4Y7NB 5IGFA 3D8GA 4B3SL 2A74C 2YYZA 2B29A 3RN5A 4RCNA 2PO4A 1CHQD 3TEHB 4R4OA 3TBIB 1TY0A 1EY8A 1IKLA 3W3AA 2K52A 3I2ZA 4IPDA 3K6OA 1S4ZA 5M5YB 2H4OA 3SE0A 4ZKCB 3ND9A 3G6JB 1E3PA 5LMUL 1K8MA 5JJZA 1H9SA 5IY0A 1Q1EA 5IYCG 3V96A 4QQBX 1H9RA 2UUBL 4RWSC 3KDFA 2F1MA 4A3GB 3PIP3 4LFBQ 4XQJA 1PLFA 3TP5A 1VQOA 1PH2A 4H7BA 3I4LA 1XPUA 2R93G 1PFSA 2L55A 4A93G 4LF6Q 3AFPA 1JJGA 1KNEA 1I4XA 2A5HA 2EYFA 1YNJC 4PZ6A 4YIJA 4K2LA 4H44C 1PH7A 3S17H 5FLMH 4A3DG 1IYJB 1Q90A 4AYBE 2RQXA 1ZEQX 2NTTA 2NVYB 5EBDA 1SNPA 1PYSB 1SFOH 2Q8IB 5M5WH 1TXYA 1JWUD 3S14H 4RGMA 3RD4A 2IJ0A 1KD1C 2HD3A 3NSWA 4QGUA 1AZPA 2KEDA 4DNTB 1SNMA 3BJUA 2QDBA 1STAA 2Q2HA 1I6HH 3GQBA 5A35A 4C3HH 3EVQA 3I8ZA 1U5KA 4UP8A 1WTOA 1W3SA 3UI2A 4O42A 3H91A 5FO9B 1SE4A 4BY1B 1LM0A 2MPMA 4GOPA 3CCSA 3M7GA 1SYDA 1PA6A 3BVZA 4ZKBB 2CWAA 1LT5D 1JOOA 4P74A 4JI0L 4R8IA 1PRTB 4A3CG 4LFCL 1VQIA 5CBAE 2VNUD 4HIOA 2R6GA 4B3SQ 4NP5A 3G71A 4WJ4A 1QE6A 3TZUA 1B9NA 4WJWA 3FKIG 1G91A 3CCMA 3I4NB 3UDIA 2B8GA 1XX8A 3WDNA 5FLXc 2B63B 5M3MH 1D1IA 3DEPA 2BE5C 5I6WA 2KCCA 3CCUA 2PW7A 5ISRA 3E6ZX 5DAUA 5LMUQ 1QVGA 2PMZB 4QY7A 1HUNA 4HSPA 3S1RH 4CJ1B 1HZ9A 1LO5D 2CW0C 3MWYW 5I4DA 2UUBQ 1M4VA 4TKOB 4DV1L 3OHXC 4KN4C 4HJ9A 1HFGA 1HNWL 1JE5A 1I50B 1L1OA 4O0AA 2NYZD 4ULLA 1IBML 1HTLD 3HOXG 1PH8A 3NTKA 2E2DC 2VY3A 3OPOA 1ESRA 2K50A 3QWNA 4EQOA 3K58A 1S5BD 2NVQB 4DV3L 3HOYH 5C4JH 3HOVB 4WJ3M 4A3JB 2Q2UA 2K5WA 4HIDA 5C6AA 1PH1A 4OWXB 4K0KL 4LUOA 4PZ8A 2EQSA 4HEDA 5JEAH 1XJVA 4IJHA 5EKIA 3J7YW 2ZTDA 1LT4D 2E2IB 3ER0A 3OYYA 1Q7YC 1Q46A 1ICFB 2N49A 4IALA 4A3IH 3S2HB 1SXTA 4G7HC 3S1NB 1LTRD 1SMXA 4X3UA 1B9MA 3UE0A 1Y1VB 4IUUA 3G6EA 3AMUA 1SYCA 4BBRH 4DNIA 4JI7L 1FGBD 4CJ0B 1PYBA 5C0XH 3GTGH 1F2MA 3BZCA 2B2WA 5KNCA 1XNRL 2WAQG 5C3EH 4UHVA 3HOZB 2XVSA 3PO2B 3CU7A 3SXHA 4GS3A 1KL9A 2F3VA 3U9OA 5FJ8G 4JI0Q 3PIO3 1KIXA 2A19A 1K3BC 4LFCQ 4A3FG 3K80C 3V05A 1YHBA 5E7NA 3BDLA 4NPSA 1QVCA 1ZKOA 1YNJD 3T1HL 4IUTA 3X3NA 4KHZA 1NMGA 2BDOA 4HR7B 3H3VH 1FR3A 3GTOH 1HA6A 4DXGA 3S1QB 4HJ5A 1DZ1A 2XRQD 4FYDA 2HQLA 3LX0A 4C2MH 1YJ9A 3R93A 4A4IA 1Y1WG 2YTVA 1GUGA 1VQHA 2WKCA 5M3FB 2B2UA 3DM3A 1RHPA 2F0IA 1D2BA 3MXPA 1SJED 4KLKA 1KNAA 2BOSA 4L5TA 1I4HA 1H9JA 2ZXRA 4KKTA 4XQNA 1GHKA 1ENCA 3RR5A 1BF4A 1ET6A 4DV1Q 2NB0A 1F2LA 1DM0B 2Z0SA 3MXGA 1HCZA 1BCPF 4R8NA 3EQLC 3IL8A 1IBMQ 1GOZA 3CCQA 5IP7G 4A3BG 1RIPA 1T9HA 4K6LA 4X64L 5JVH3 2VB2X 5E3FA 1LT3D 1TU2B 1CM9A 2KCMA 2XWBB 1VQ8A 2GA4B 2I5LX 3R2TA 1XMOL 3URYA 4EQNA 5KGUA 1HJPA 1G8ZD 4DV3Q 2RA4A 4OIJA 4K0KQ 1EZ6A 3BYTB 2AKWB 3Q0AA 1X9NA 1HR0W 1PH6A 2F0OA 2OXPA 1KDAA 1RD9D 2K5VA 3CQZB 4AYBG 1DJRD 3PCOB 1IL8A 4DR7Q 1ASZA 1BQQT 1E22A 1X65A 2BE5D 1V43A 4KN7C 4BBSH 1WCMG 2HDMA 3TS2A 1YZ6A 2EY2A 1O7ZA 4JI7Q 3K57A 2JEBI 1STHA 3D31A 2A73B 2UXDQ 1L0WA 1XNRQ 2CW0D 3CRLC 2DNEA 5FLXL 2UUCL 4NMZA 2NN6I 1GUOA 1Y14B 1VQBA 4Y7NH 2SOBA 1ASYA 4JI2L 1NY4A 4GNXC 2P5ZX 2WP8J 5FOBB 5EQ0A 1RJTA 1RL2A 1PHJA 4KHPL 2RCNA 3T1HQ 3UDGA 1OXVA 2BA1A 4JBJA 2LXKA 3BU2A 5J39A 4LF9L 2ES2A 1LTGD 1EU3A 1O7LA 2F0UA 2MQHA 2ATWA 2NVTB 5FO8B 3X3MA 4FF3A 2UUAL 4BXXH 3G7LA 5M5YH 1KAAA 4RKLA 1YIJA 1QNKA 2R7ZB 3AEVA 1YNXA 2ZXOA 2OF1A 1FNUA 3EBEA 4KY5A 4HIMA 1JQYD 2KECA 4CDFC 2D0OA 4A3GH 3LNNA 1WTXA 2E2JB 3A5UA 3KBGA 2UXBQ 4XT1B 5C44B 3TZDA 3S1MB 5IGGA 4KD4A 4DR3L 1L2FA 2FINB 3AU7A 5A2QL 5I9PA 3CCVA 1EY5A 4BY7B 1HQRD 1ML0D 5C4XB 2L11A 4OO1G 4WORA 3HOWB 2OQ0A 1GKHA 2O5JC 5JOBA 4S3SA 1EY9A 4IPGA 3CCLA 2ID0A 1EWHA 2VL6A 2EY5A 1BUVT 1MKHA 3Q24A 4DXFA 4IFDG 2G9HD 3AFQA 4DR4L 2A68D 5LL6S 2TMPA 2SNMA 3FHWA 1G6PA 2VUMG 4LF8Q 3N6RA 3VYTA 4JYAL 3CAMA 1WI5A 3QO2A 4P2CB 5CR3A 5CC4A 1PTOF 4KV6A 4BY1H 3KOJA 4A3MH 1VQ6A 2OQKA 4RAUC 4LFAQ 2UUCQ 2MUYA 1MGSA 3KLSX 3U50C 3DHQA 1D5XC 5ELCA 2L9HA 4GN4B 4KKSA 5JEAG 4NKLA 3ZYYX 4DUYQ 3MAQA 1MD2D 3K5LA 2K4KA 4JOIA 4FVMA 2K04A 3A55A 1LTTD 4KHPQ 3D6WA 3SVMA 3GTMH 1S72A 4LF9Q 4WFN3 2EOTA 1SBBB 3I4NH 4FDBA 3D4WA 4DK0A 2DJFC 3CPFA 1WTWA 5C0XG 2UUAQ 1CK1A 2JQOA 2FHTA 4QIWB 1TR5A 1FJGL 5GAHC 2KBNA 2JA5B 1A2UA 1SROA 3ONAB 2AQ2B 2F52A 5D14A 4DK6C 2NVXB 5G3LD 2JA6G 3J7AV 2R92B 2CKZB 2VW9A 2E8GA 1GD7A 1JOQA 1AFPA 1I50H 3HKSA 4KJOA 3MTSA 4K14A 2LS01 1TT2A 1WYDA 3SK4A 1HZBA 3J81E 4DF7A 4A3KG 4MNOA 1UE5A 2LFNA 4ABNA 1CFMA 3BVGA 4O1NA 1B1ZA 4GLVB 2MP1A 2XTIA 4IFDJ 1STBA 3E0EA 1HNXQ 5C4HA 1K28A 2NVQH 2A8VA 2KUMA 3HOVH 4ZLTF 4A3JH 4LF4L 2B2VA 2PZTA 2PQAB 2JA8B 3UDXA 1B44D 4HN7A 3J81j 2B2YA 2PI2E 2F0HA 2GVAA 2E2IH 3A74A 4AH6A 3S2HH 1JB7A 3I4MB 2MO1A 5LMNL 3S1NH 4U68A 4DKAC 1SNCA 4OELB 1H95A 1D1KA 4X65L 2J4XA 1M90C 1Y1VH 4HCEA 3DLLA 4DR1L 1FNWA 2KHIA 4BS9A 1TKWB 3PUWA 3TREA 1LLRD 1U4LA 4JYAQ 5KYIA 2KHSA 3PUVA 2R7DA 1PRTF 1JB3A 3HOZH 1BCPC 2MFIA 1STYA 4QJFA 3PO2H 5JJLA 5C5MA 4JI6L 3EJIA 4OO1I 4UDUC 2NN6H 4R9WA 4GKKL 2AQ3B 2A1AA 4PMBA 1YNNC 3NBIA 4PMCA 1YBYA 3JAMi 3MEFA 4DV7L 1BKBA 1DOKA 3TP6A 3K7AB 4G4KA 3CF5A 1JWSD 4CDDC 4GOPC 2ALYB 4JI8L 5M5XB 4HIKA 3S1QH 2EYOA 2Y0SE 3L7ZC 5I2XA 2RDGA 3M4PA 4IO9A 1NMFA 3MVVA 2CHBD 4JBWA 1P8LA 3E9HA 2F0NA 5ELOA 1YITA 5M3FH 3PO3G 4KY7A 3OTOQ 1AEXA 4IPCA 2FMMA 2LSSA 2NTSA 2EYMA 3JAMc 1FJGQ 2IHEA 2FXQA 3WOFA 2SDFA 5DNFA 2JP1A 4N9TA 1BOSA 4ZRZA 2Z6KA 1CSQA 2K6AA 1QILA 4DR6L 3HOUB 3BYYB 4R1JA 1PTOB 5ELDA 1EEID 1EY4A 2QEXA 1O7IA 1WD0A 2VS1A 3BDOA 5IGEA 1VQJA 1GUTA 3H3VC 5HY6A 2EE1A 2K03A 1VQ7A 3H0GB 1J8IA 3U58A 3ND8A 3S16B 3Q6SA 2OTLA 1L1OC 4LF4Q 4HSVA 1K83B 2D2CC 1Q8IA 1XMQQ 2DJGC 1TWCB 2M9VA 2JN4A 1STNA 3CQZH 2K7VA 5K36H 4Y52H 2BH8A 2QKIC 4IOAA 5IYDG 4X65Q 4M8AA 3FVQA 2JA7B 2MHVA 3Q23A 1N33Q 2UU9L 4DV2L 4DR1Q 4K5WA 2CFMA 3RZOB 3KLSA 4LF7L 1V1PB 3RLOA 3GD7A 2X6GA 3MHBA 1EYDA 1YJNA 5EKLA 4DK3C 4I7AA 4QB4A 2R3ZA 2A6EC 2ENBA 3K7UC 4N9PA 3HKZE 2NZHA 1WTRA 4ID6A 5IYBG 4DNRB 3K0XA 4JI6Q 2K14A 4DA2A 2E5LL 2VB3X 3NXWA 2PCFB 4GKKQ 1I3QB 3HG9A 4K8IA 4AIMA 1Z7TA 2WIIB 3QIAA 4P73A 5I2YA 1SE3A 2KJXA 4LMQD 1H9MA 2B2WC 2RHQB 4DV7Q 1EFWA 3GTLB 2NZ1D 2G5DA 4TRDA 1KABA 4MTNA 4JI8Q 1CKOA 2NVTH 3FMCA 2NUCA 2RDFA 5L37A 1C0AA 2HDLA 1LTBD 1B7YB 2I07B 3OW2A 1SE2A 3H6MA 1OXTA 1E1OA 2R7ZH 2OTJA 1EYCA 3J80i 4C3JG 2R93B 4C56C 3NP8A 1BNZA 2WB1E 2ZTEA 5IGCA 1A62A 4N8FA 5BN5A 2E2JH 4A3LG 1ILPA 3T56B 2KQ3A 1EWCA 3NTHA 5C44H 3S1MH 1C4QA 1Q12A 3FRPB 4A3DB 4A3MB 3BG3A 1N34L 1JOKA 3CHBD 1BCPD 2B2UC 1QOHA 3IFTA 2F4VL 2YTXA 5IP9G 2ZJPA 1WVLA 1II3A 4DR2L 3K59A 3DMUA 1KRTA 2J7ZA 3VA5A 4BY7H 4B3TL 4ILWA 4V0BA 2B63G 1DYQA 3PIOA 4CKCA 1D6EC 2L4NA 5C4XH 3J80c 1B53A 1U4MA 4G7ZC 2B39A 2EVBA 5CV7A 4A3EG 3HOWH 3GTMB 3WOEA 4LJZC 4RGNA 3NE5B 4GN3B 2EYHA 4X3SA 3NPPA 1MHWC 1V8QA 1NUCA 2PZWA 3A8KE 5HGTA 1JE4A 4ZQ3A 1X54A 3DWQA 1K0RA 3P1HA 4ME3A 3CCEA 1IZ6A 3R3OA 4F8MA 4DV2Q 2PQAA 4LF7Q 5FO7B 2Q2TA 1QNUA 2O2LD 1PDQA 5C5LA 5C3XA 4B3RL 3E5SA 2IWHA 2DGYA 4C3IG 1UE1A 3J81i 3SR1A 4TSSA 3NBHB 2F0JA 5IT9c 1YI2A 4TQUS 3FKIB 1STEA 3GTJB 3ERSX 4J6HA 3QOLA 3VR2A 2BA0A 3A8JE 1F9SA 3JAML 3D4RA 2M2LA 2O4XA 4FF4A 4Q0FA 1BO0A 3RUZA 3ZJYC 4OIKA 4WRDA 1KAWA 2D62A 2F0MA 5D3IB 1B2TA 3I55A 3CCJA 5EPLA 4ME5A 4CDEC 1NSNS 4MN3A 1IL2A 2VQEL 2IL8A 2Y0SG 2JA5H 3HOXB 1X3QA 1OTCA 2NVXH 4KKUA 2R92H 1PRTC 4DFAA 1X56A 2F0TA 2WACA 1JCKB 2J0TD 5DM63 1G6ZA 4GZYC 4JI5L 2K75A 4HCSA 2A6ED 2Z4HA 3PGZA 1N34Q 3W5OA 5BN4A 1X3GA 2F4VQ 3I90A 1UUPA 4DR2Q 4X66L 1NTGA 3KF8A 3AQQA 1I4GA 3D4DA 3A0JA 3TN2A 4B3TQ 2XSCA 1X6OA 3R8BA 1ENFA 1VCIA 4RGOS 4JI1L 4DR5L 1HTPA 2JA8H 2B3GA 3VR4A 4F87A 4UPAA 2AQ1B 4JV5L 2A69C 4Z9CB 3FPUB 3T53B 3I4MH 2I5MX 4POFA 4ZUJA 3M7NA 1TWGB 4GLAC 2Z1CA 3L2PA 4PQXA 1W2BA 2WAQB 5EGTA 1J6QA 3ULJA 3M4QA 4UY8C 1X3EA 4XDXA 2CQOA 3F2CA 3I72A 1YVCA 1T5XD 4RH6A 5DLQE 3L3OC 1HZAA 4KHVA 1EQTA 2F0GA 4APVA 5IWAL 4A3FB 3PF5A 1Q3LA 4DAYB 1EQVA 1VQDA 3CKIB 1HNWQ 1DD2A 2C9OA 1TWHB 5E4XA 2PQEA 4JCVE 5FKAC 4XT3B 3A5ZB 4ZAIA 1ICWA 2EPBA 1JORA 1V1PA 1TY2A 1Y1WB 3K7AH 3S2DB 3HKZG 5NUCA 2HCIA 1J5EL 1WTPA 5KIXA 3NQIA 3I3CA 5M5XH 5IGBA 3CMAA 1EQQA 2HHHL 3TMEA 3MEHA 4IURA 3M4YA 4KJNA 1KXLA 3F8TA 3W1GA 3TS0A 1IBKL 2K28A 4JVZA 4JOIC 1W6JA 1XNQL 1C7YA 3GV6A 2VXWA 4BA1I 1HNZL 5D3DA 4NW2A 2K05A 2VQEQ 2QILA 2AMCB 3M3YB 4A3BB 5CYUA 2H1EA 3SGIA 4GLXA 1OXUA 4YHHL 4HMIA 1DCZA 5FLMG 1ZYRC 3HOUH 4B3ML 1GVPA 1CKNB 4JI5Q 1PTOH 3KFUA 2WB1G 1N9WA 2N8NA 4RKBA 1SYBA 1YHQA 3SK5A 3OMGA 1EOTA 1SYGA 4X66Q 4AQYL 3H0GH 2UXCL 4YWKA 4AYBB 1EY0A 3S16H 2DY7A 4DU9A 3G4SA 1K83H 4JI1Q 4OL7A 5EBCA 1S5CD 1F77A 1TWCH 2CVRA 1WCMB 2XN9C 4JV5Q 4C3HG 3PUYA 4LW1A 1Q1BA 2SEBD 3E0JA 1QCBD 5IT9L 3STBC 3A8IE 2B2VC 2JA7H 3UE1A 1VQPA 3RZOH 1UNSA 4POGA 1S40A 2B2YC 1A8VA 2F0FA 4DAVA 4XTCS 3J7ZC 1MJCA 5ELBA 3KK7A 2KEEA 3GV3A 5JAVA 3DWAA 1PRTD 4A76A 4DN4M 4H0LC 5LHY1 1I4PA 1RKNA 1I3QH 4RHRA 1PFNA 3RLNA 3VA7A 4X64Q 1B4OA 5CV8A 4CBVA 1A0IA 3GTLH 5M3MG 4OGQC 4GN5A 1PFBA 1XMOQ 4RGTA 4FNFA 1GM5A 4R4IA 4R4CA 3P75A 2HT1A 3NBHA 2HHHQ 5IYCH 4LNQA 4HTHA 1SDFA 1AE3A 5CGKA 2X6LA 5J3BA 3B6YA 2JA9A 4P72A 1HFNA 1B3AA 2A69D 1OO9B 3CC2A 5EPJA 3A54A 4L63B 2KA7A 2R93H 4A93H 2IX1A 1H9SB 4LWCA 4EGVA 2D5DA 3D3RA 1ET9A 1SMYC 2FJ2A 2HIXA 4DV4L 1M1KC 3KDFB 4NXML 4B08A 2NZOA 3OIPA 1BR9A 4A3DH 4YHHQ 1IW7C 1VMPA 1B70B 3QG1A 1R9TB 3HOYG 3K5OA 1G2SA 1RF2D 1G2TA 1MI2A 2HQEA 3CCRA 5KYLA 1IYUA 4KI0A 4JI2Q 1E2WA 1EYAA 4AQYQ 4IOCA 3GTQB 2Z6KC 2UXCQ 5HURA 1IYVA 4X62L 3VDYA 4A3IG 5CV4A 2Z9HA 1VQ5A 1SNDA 2YV5A 2V4DA 3Q8DA 1Q86C 1I4RA 3I56A 1I94L 4IN3A 1C9OA 5FLXE 1AN8A 4BBRG 2VUMB 1BBUA 3K8AA 1EIFA 3C2PA 3NK9A 3BVMA 4JI4L 4CHTB 5C3EG 4JI3L 1IKMA 1EUJA 3GO5A 2F3WA 3K5MA 3RN2A 1XXGA 4A3CH 1E0BA 1VQFA 3S9WA 1V9PA 3IRBA 4QMGA 4OONA 1S3OA 4FF1A 3CP0A 2F0VA 2DUDA 3I7FA 1A63A 1PYWD 1LTSD 2N78A 5KNDA 4GOPB 2E75C 4DR3Q 3P20A 1VQLA 1KDBA 2PZUA 1E24A 1A15A 1HUMA 2L5TA 1WTQA 3GTPB 3FKIH 4MTKA 3GTKB 4LF5L 3SK8A 1K73C 4MHEA 5I9OA 3GTJH 2PMZE 4JG2A 4CJ2C 4GKJL 1WTHA 1QUQB 1VQGA 1PV4A 1GXDC 4DAYA 1N8RC 1EWIA 4JPBW 4NDXA 1CTMA 5KEEA 2EYLA 2ASBA 4X6AH 3U9SA 3P7JA 1O7YA 1PH3A 1MIUA 1PXUA 1CKMA 5A2QE 1XWEA 1HR0L 1EU4A 2JA6B 2MO0A 1KDCA 2PNHA 3ERQA 1KTKA 3ITPA 1N36L 3KJPA 4DR4Q 2F4IA 2MGSA 4YWMA 1K3RA 1T5EA 1XPRA 1VQCA 4P75A 2IX0A 3HOXH 3F2DA 5LL6X 3STBD 5JEAJ 2EXDA 1LV9A 4A3KB 3QJYA 4B9XA 1J9OA 3CPWA 1CSPA 2L0CA 2I0QA 1ILQA 1K0SA 1CI3M 1MSHA 4DV4Q 1WTVA 4NXMQ 3RNUA 4R4TA 1Y8OB 3PIPA 1K8OA 1YHAA 1LUZA 2OCEA 5C0XJ 1XTDA 1G291 3OWFA 1EZ8A 1HZCA 1IBLL 4L5SA 1CZWA 5E1FA 4IFDI 1O78A 1C8CA 1NR2A 1GUWA 5CMDA 2WKDA 1BDOA 1CKNA 3SDZA 4BBSG 4LF6L 5J1ZA 1PMRA 1X3FA 2F03A 2ZJQA 1A2TA 4DK1A 2E74C 1BBXC 1TWGH 1ZXTA 4NXNL 4RG1A 2CWPA 3HZXA 4V190 1LACA 5CV5A 2EDGA 4L5RC 3CW2C 4JI4Q 1Q8KA 4JI3Q 1BXTA 2F3IA 3EA6A 3MXUA 1S5DD 5FJ8H 5AJ3L 4M1UB 2WFWA 1HQMC 4YY3L 3BS1A 3EFXD 2EJFC 2QCPX 4A3FH 1F2ZA 4H13C 2EZVA 1SMYD 1TWHH 1A6XA 3T1YL 5DM73 1Q81C 1E7ZA 1TQOA 3M9BA 3EIVA 2EJGC 4LF5Q 1F9PA 3C46A 3HRZC 4YCUA 3J7AF 4J15A 3S2DH 1Y1WH 3NQTA 4GKJQ 5C0XI 1K8GA 1SR3A 4BXXG 1Z47A 3PO3B 1DOLA 2LXJA 5GAGC 3U4ZA 1Y8PB 4RFBA 1D5MC 5GADC 4FXDA 2XGTA 4EX5A 4OWTB 4H02A 1HR0Q 1TIID 1NNXA 1HXYD 2K01A 5JJKA 4A3GG 2B8FA 5LMNQ 3I70A 5GQOA 1N36Q 1QZGA 2OEOA 2F0QA 2WINB 2ZXPA 3M3YH 2F0SA 1VQ9A 1RODA 5IP7H 4A3BH 2R7FA 1XPOA 2SNSA 3DEOA 1NR4A 3H3VI 3RZDB 2JE6I 3TQYA 2JYOA 2YU9B 1VQEA 3C1EA 3F1ZA 2LMCB 3PQIA 4YCWA 5EKKA 4O2DA 3PMFA 5G3LF 1FL0A 4UP7A 3PF4A 1IBLQ 4X3KA 3TP8A 1HA5A 1CQVA 2RSOA 5ELNA 1FD7D 2AHOB 3MA2B 1STGA 1CUKA 1WCMH 2O5IC 2F0LA 1AZQA 2Z8LA 1AE2A 3K5NA 4NXNQ 2G9DA 4BY1G 4ZYSA 3OOCA 4A3MG 3HGBA 1QWYA 2KOLA 3NWSA 4A93B 1W6KA 2JJQA 1PVOA 5AJ3Q 3KLWA 2DNCA 4XIGS 4YY3Q 1PTOC 2OT2A 1JR0D 3NWTA 4L6TB 1U0LA 2Q2IA 1LABA 1EY7A 3L9AX 1EY6A 1M8AA 4K5VA 4HJAA 5IODA 4DR6Q 3T1YQ 1SEBD 4IJLA 1A3VA 3V2TA 3I4NG 4YWLA 1FGUA 1YNND 1Z9FA 1F2YA 3MXNB 4HJ8A 4OX9L 3GDEA 1K8AC 1Z6HA 3IAYA 2MJ8A 2I46A 3D0FA 1NAPA 4C3JB 4L8JA 5C4ZA 5GAEC 1HPCA 4IUPA 1GO3E 1CA6A 5ELFA 2K1BA 1JJCB 1TWFB 4CKBA 1JJ2A 3A7LA 3MZ5A 4K2KA 4LUZA 1QUQA 2B2TA 3KF6B 4PG3A 3NUCA 3QR8A 1NJIC 1NCVA 2UU9Q 3CXCA 3M85A 4PNYA 5F2DA 2IHFA 1Y69U 4YCVA 3I4OA 1F9QA 2IY5B 2ZJRA 2H5XA 1R9TH 2WV6D 1EIGA 4R4QA 4OO1H 2E2HB 3HOVG 4A3JG 1I4QA 5EPKA 3DXJC 2E5LQ 4A3EB 2QA4A 3J7A5 2TSSA 1WFQA 1JC7A 1X3PA 4EVOA 2XWJB 1CHPD 2KENA 2JXMB 3GTQH 3TRZA 1RTNA 3KBXA 3S24A 1HH2P 4IFDH 1PZKD 1KRSA 1LTAD 2K32A 3CC7A 2JSOA 1Y1VG 4XYQA 5IE8A 5CBEE 2VUMH 3EROA 4I65A 2RHSB 2CH4A 3J81c 3T4AC 2Q8TA 3KLRA 1N32L 2QDLA 1U4RA 4IUQA 2AWOA 1LTID 4LK1C 2IX3A 3HOZG 3T51B 4C3IB 1WOCA 3PO2G 1FNVA 2A6HC 4ZCKA 1XYIA 1H9KA 2NN6G 1PH5A 2ZM6L 4RMFA 5DEHA 3F2BA 3JC66 1V1OA 2EY1A 4DR7L 1SE8A 5EJWA 5M9OA 2JEAI 1AP0A 3Q22A 4ZUIA 3GTPH 2X69A 3GTKH 4QIWE 2L12A 1I6VC 1EEFD 3BZKA 1E1TA 3M4OB 3H15A 3FP9A 4OX9Q
chains in the Genus database with same CATH topology
2MO1A 5LMNL 3S1NH 2UXDL 1SN8A 4DKAC 1BVSA 5M3FG 1PH7A 5FLMH 3S17H 1VQAA 1IYJB 4A3DG 4A76A 1H95A 1VQKA 4X65L 4AYBE 1M90C 1Y1VH 2VZAA 1I3QH 1OXSC 3DLLA 4DR1L 3RLNA 1EOVA 4X64Q 1PYSB 2KHIA 3PUWA 2JA6H 3TREA 1SFOH 4JYAQ 1G51A 1NE3A 5M5WH 1A0IA 1LYLA 3PUVA 1TXYA 2R7DA 3GTLH 5M3MG 1SLJA 4GN5A 3S14H 3HOZH 1XMOQ 2MFIA 1KD1C 4QJFA 2VQFL 1GM5A 1JB7A 3PO2H 5JJLA 1SRUA 4QGUA 4JI6L 4OO1I 4R4IA 3CCLA 2BH2A 3BJUA 4R4CA 4A3KH 3CC4A 4GKKL 2HT1A 2A1AA 2Q2HA 4GNXB 1I6HH 2HHHQ 5IYCH 4LNQA 1YBYA 1AE3A 4C3HH 3JAMi 3MEFA 5J3BA 4B3RQ 3B6YA 4DV7L 1BKBA 2JA9A 1U5KA 4P72A 4UP9A 1P16A 4UP8A 1Q82C 1W3SA 2HIVA 3CF5A 3CC2A 3PV0A 1LM0A 4GOPA 3CCSA 4GOPC 1PA6A 2R93H 2ALYB 2CWAA 4P74A 4JI8L 4JI0L 4JC0A 1B8AA 4LWCA 4HIKA 2IX1A 3S1QH 4A3CG 2Y0SE 3KYHC 3L7ZC 4LFCL 3M4PA 4IO9A 1NMFA 2HIXA 4JBWA 4DV4L 1M1KC 3KDFB 4NXML 1VQIA 1P8LA 2NZOA 3E9HA 1YITA 5ELOA 3PO3G 5M3FH 4HIOA 1YJWA 4A3DH 2VNUD 4YHHQ 4DV6L 3OTOQ 2UXBL 2R6GA 1B70B 4B3SQ 3HOYG 4IPCA 3G71A 2LSSA 4WJ4A 1FJGQ 3JAMc 2IHEA 2FXQA 3FKIG 3CCMA 3CCRA 3NELA 4KI0A 4JI2Q 3UDIA 5FLXc 4AQYQ 1X55A 4IOCA 1N32Q 2Z6KA 5M3MH 2Z6KC 2UXCQ 1CSQA 4X62L 3VDYA 4A3IG 1VQ5A 2L15A 3PUZA 2YV5A 3E9IA 4DR6L 3Q8DA 1Q86C 3I56A 1NBWA 3CCUA 1I94L 1C9OA 2IT1A 4R1JA 5LMUQ 1QVGA 2QEXA 1O7IA 3L0OA 4QY7A 2VS1A 2ZM6Q 4BBRG 3S1RH 1BBUA 1HZ9A 1VQJA 3K8AA 5HY6A 2UUBQ 5LMNW 1EIFA 1VQ7A 4DV1L 1EIYB 4JI4L 4HJ9A 4DV0L 1HNWL 1JE5A 5C3EG 3U58A 4JI3L 1L1OA 1EUJA 3GO5A 1L1OC 4O0AA 4IPHA 1IBML 2OTLA 4LF4Q 3RN2A 4A93H 3HOXG 1AH9A 1PH8A 4A3CH 1VQFA 1XMQQ 1V9PA 3IRBA 2VY3A 4OONA 1S3OA 1LTLA 4DUZL 3CP0A 4LF8L 3CQZH 2DUDA 3EN2A 3I7FA 2K50A 1K9MC 1A63A 3PO3H 3HFZB 1MJEA 4Y52H 2N78A 4GOPB 4DV3L 2BH8A 3HOYH 4DR5Q 4IOAA 5IYDG 5C4JH 4X65Q 4DR3Q 2R7ZG 1VQLA 4BA2I 2Q2UA 4WJ3M 4HIDA 4LFAL 1E24A 1PH1A 1KQSA 4OWXB 2UU9L 4DV2L 4DR1Q 3FKIH 2CFMA 1N33Q 4LUOA 4K0KL 4PZ8A 2EQSA 4LF5L 4LF7L 1XJVA 3RLOA 4IJHA 1K73C 3GD7A 1YJNA 3GTJH 1WJJA 2PMZE 4JG2A 4GKJL 2GVBA 2ZTDA 4DK3C 3ER0A 3OYYA 4DAMA 1Q46A 1IXRA 2N49A 4DUYL 4LUVA 4A3IH 1Q7YC 1QUQB 1VQGA 5C44G 1PV4A 3K7UC 1SMXA 3HKZE 2NZHA 2VQFQ 5IYBG 1N8RC 1EWIA 1KC8C 3CD6A 3K0XA 4JI6Q 2K14A 3UE0A 2E5LL 2ASBA 4GKKQ 4X6AH 3G6EA 2C35B 1PH3A 3RZDH 1MIUA 4AIMA 1CKMA 4BBRH 4DNIA 1HR0L 4JI7L 4P73A 5IWAQ 2YU9H 1PYBA 3GTGH 4BY7G 3BZCA 2MO0A 2RHQB 2PNHA 4DV7Q 1N36L 1XNRL 3KJPA 1EFWA 4DR4Q 5C4XG 2WAQG 5C3EH 4YWMA 1I5FA 1K3RA 1XPRA 1VQCA 4GS3A 1KL9A 2IX0A 4MTNA 4P75A 3HOXH 3F2DA 1QZHA 3HOWG 3STBD 5JEAJ 2EXDA 4JI8Q 1CKOA 3KF6A 5FJ8G 4JI0Q 2NVTH 1VS0A 1KIXA 3CPWA 1CSPA 2I0QA 1C0AA 2A19A 4LFCQ 4A3FG 4DV4Q 3K80C 1JMCA 4NXMQ 1YHBA 3RNUA 1B7YB 5E7NA 1UE6A 4NPSA 4R4TA 3OW2A 1J5EQ 3KJOA 1QVCA 4DV6Q 3T1HL 5IYDH 1OXTA 1E1OA 2R7ZH 2OTJA 4KHZA 3J80i 4P71A 3PIPA 1PH4A 1NMGA 1YHAA 3GTOH 1LUZA 3G48A 3H3VH 2EIFA 2OCEA 4HJ5A 2WB1E 2ZTEA 2HQLA 4C2MH 5C0XJ 1YJ9A 1XTDA 1A62A 1G291 4A4IA 1Y1WG 3AYHB 3ICEA 1HZCA 1IBLL 5EAYA 2E2JH 1IBKQ 2YTVA 4A3LG 1HNXL 4L5SA 5C44H 1XNQQ 3S1MH 4IFDI 3UDFA 1Q12A 1VQHA 1HNZQ 5IYBH 1N34L 3NEMA 3LGJA 3DM3A 2NVYH 2F4VL 2YTXA 5IP9G 2ZJPA 4KLKA 1CKNA 4DR2L 4BBSG 4LF6L 4L5TA 1KRTA 2PI2A 1X3FA 2ZJQA 4BY7H 1TWGH 4B3TL 4NXNL 2B63G 4RG1A 2CWPA 3PIOA 3RR5A 5C4XH 3J80c 4DV1Q 3NENA 4L5RC 3CW2C 4JI4Q 1Q8KA 2Z0SA 4DV0Q 4TVAB 4B3MQ 4JI3Q 4A3EG 2F3IA 3HOWH 1IBMQ 3CCQA 5FJ8H 5AJ3L 5IP7G 4GN3B 4A3BG 1RIPA 1T9HA 2WFWA 4X64L 4YY3L 5HGQA 2KCMA 4DUZQ 4A3FH 1VQ8A 2I5LX 1X54A 4NB3A 1K0RA 1TWHH 1XMOL 4ME3A 1JT8A 3T1YL 1HJPA 4DV3Q 2QGQA 3CCEA 4C3JH 1Q81C 1E7ZA 1IZ6A 3M9BA 2JA5G 3EIVA 3CMEA 4OWWB 4K0KQ 4DV2Q 2AKWB 2PQAA 1X9NA 2I5HA 1HR0W 4LF5Q 4YCUA 4LF7Q 1PH6A 5BR8L 4J15A 2R92G 3S2DH 1Y1WH 4A3LH 1TWFH 2K5VA 2Q2TA 4GKJQ 4B3RL 5C0XI 1K8GA 4AYBG 1KHIA 1SR3A 3PCOB 4BXXG 1Z47A 2DGYA 4DR7Q 2LXJA 2YTYA 1UE1A 5GAGC 3J81i 4ALPA 1ASZA 3U4ZA 1E22A 5K36G 1OXXK 1X65A 3NBHB 5IP9H 1V43A 5IT9c 1DGSA 4DV5L 1YI2A 5GADC 1WCMG 4BBSH 2XGTA 4TQUS 4EX5A 3TS2A 4OWTB 1YZ6A 4H02A 1HR0Q 4JI7Q 2KCTA 3ERSX 1PH9A 2B63H 4A3GG 2JEBI 3PSIA 3D31A 5LMNQ 2BA0A 2UXDQ 1L0WA 5GQOA 1N36Q 2E2HH 1XNRQ 1QZGA 3OTOL 4A3EH 1QVFA 1VQNA 2KHJA 2UUCL 2JA8G 3M3YH 3U4VA 1VQ9A 2NN6I 5IP7H 2K5NA 4A3BH 3ZJYC 2GN5A 1Y14B 2R7FA 1XPOA 3H3VI 1VQBA 4Y7NH 2JE6I 1KAWA 2D62A 3TQYA 4GNXA 1NY4A 4GNXC 1ASYA 2CCZA 4JI2L 1V1QA 3I55A 3PUXA 3CCJA 1UE7A 3I4MG 4PMWA 2WP8J 1VQEA 3F1ZA 1RL2A 3RLFA 2N3SA 1PHJA 4KHPL 2RCNA 1IL2A 3T1HQ 4YCWA 3UDGA 1OXVA 2BA1A 2Y0SG 4JBJA 5GROA 5H1SE 2LXKA 3BU2A 4O2DA 2VQEL 1VQ4A 2ES2A 2JA5H 4LF9L 1D8LA 1OTCA 3W1BA 2MQHA 2NVXH 2RF4A 2ATWA 2R92H 1FL0A 4UP7A 1X56A 3PF4A 1IBLQ 3K81C 2UUAL 4BXXH 4C3IH 5M5YH 2JK8A 1EYGA 1YIJA 5ELNA 4JI5L 2K75A 1N34Q 3AEVA 1YNXA 3PGZA 3W5OA 3EBEA 1X3GA 2AHOB 4JBMA 2F4VQ 5JJIA 1CUKA 1WCMH 1BBWA 4DR2Q 2ZTCA 1XMQL 4HIMA 4X66L 1NTGA 3AQQA 2D0OA 1AE2A 4A3GH 3A0JA 4B3TQ 4NXNQ 3A5UA 1L1OB 1X6OA 2UXBQ 4BY1G 4A3MG 1VCIA 4DR5L 4JI1L 2JA8H 4DR3L 2B3GA 4UPAA 1L2FA 2JJQA 1N33L 1PVOA 5AJ3Q 3KLWA 1D7QA 4XIGS 3M4OH 4YY3Q 4JV5L 3CCVA 3I4MH 2I5MX 4POFA 1U0LA 2Q2IA 4GLAC 3M7NA 4X62Q 3L2PA 4HJAA 4LFBL 1W2BA 4A75A 4DR6Q 1J6QA 3ULJA 3M4QA 3T1YQ 1I94Q 4IJLA 4UY8C 4OO1G 1UEBA 1X3EA 2CQOA 3F2CA 2OQ0A 4JBKA 1GKHA 1YVCA 3I4NG 5DLQE 1HZAA 4IPGA 4YWLA 1FGUA 1YEZA 4DPGA 1Z9FA 5BR8Q 3MXNB 2ID0A 2VL6A 4MZ9A 4APVA 1FVIA 5IWAL 4HJ8A 3ULLA 2AWNA 3GDEA 1K8AC 1MKHA 3PF5A 4OX9L 4DAYB 1VQDA 4IFDG 3AFQA 1HNWQ 4DR4L 4OXPA 3HOUG 3D0FA 5GAEC 2MNAA 4JCVE 1GO3E 3FHWA 4DV5Q 1G6PA 2VUMG 1TWAH 4LF8Q 4JYAL 3CAMA 3A5ZB 4HJ7A 1WI5A 3H0GG 3K7AH 3HKZG 1JJCB 2D0PA 1JJ2A 2K5HA 3S15H 2V1CC 1J5EL 4BY1H 4PZ7A 3KOJA 3WWVA 4A3MH 4LUZA 1QUQA 1VQ6A 2OQKA 1EQRA 3KF6B 2WAQE 4PG3A 4LFAQ 5M5XH 2UUCQ 3CMAA 1EQQA 1NJIC 2UU9Q 3CXCA 2OWOA 3U50C 3M85A 4EQ5A 2HHHL 2IHFA 3KF8B 4GN4B 4YCVA 3I4OA 5JEAG 4QL5A 1KXLA 2IY5B 4DUYQ 2ZJRA 3F8TA 3W1GA 3TS0A 1UWVA 1IBKL 2K4KA 4JOIA 4JOIC 2H5XA 1R9TH 1XNQL 4R4QA 1C7YA 4KHPQ 3HOVG 4BA1I 1HNZL 4A3JG 2JA7G 2VQEQ 3GTMH 2E5LQ 3J7A5 2QA4A 2AMCB 1S72A 4LF9Q 1WFQA 3ULPA 3I4NH 4FDBA 4L5QA 1VQMA 2KENA 3GTQH 3TRZA 3S24A 3SGIA 3CPFA 1HH2P 5C0XG 4GLXA 2UUAQ 1OXUA 4YHHL 2JQOA 4B3SL 5FLMG 1KRSA 2YYZA 3HOUH 2B29A 3CC7A 1GVPA 3RN5A 4B3ML 1CKNB 4JI5Q 3KFUA 1FJGL 1Y1VG 1N9WA 2WB1G 5GAHC 5IE8A 2KBNA 2N8NA 5JJKA 3TEHB 4R4OA 1SROA 1YHQA 2VUMH 2F52A 4DK6C 2JA6G 2RHSB 4X66Q 3J81c 4AQYL 2CKZB 2VW9A 1N32L 2K52A 2E8GA 3H0GH 3I2ZA 1GD7A 4IPDA 4YWKA 2UXCL 2AWOA 1I50H 3HKSA 3HOZG 3S16H 1WOCA 3PO2G 3G4SA 1WYDA 1K83H 1HZBA 4JI1Q 4A3KG 1E3PA 2NN6G 5LMUL 1PH5A 1TWCH 2ZM6L 4MNOA 1UE5A 5IY0A 1Q1EA 4RMFA 5IYCG 4QQBX 4JV5Q 3PUYA 4GLVB 4LW1A 2UUBL 2XTIA 3F2BA 1Q1BA 4IFDJ 1HNXQ 3E0EA 3KDFA 2NVQH 3JC66 2A8VA 4LFBQ 3STBC 4DR7L 3HOVH 1SE8A 1VQOA 4A3JH 1PH2A 4LF4L 2JEAI 2JA7H 3GTPH 2PQAB 3UE1A 1XPUA 1VQPA 2R93G 3UDXA 1PFSA 3GTKH 4QIWE 3RZOH 4A93G 3J81j 3BZKA 4LF6Q 4POGA 1S40A 3AFPA 1JJGA 1A8VA 1E1TA 2PI2E 2GVAA 4XTCS 3A74A 3J7ZC 2E2IH 1MJCA 4AH6A 3H15A 3S2HH 3FP9A 4PZ6A 4OX9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MO1 A;  5LMN L;  3S1N H;  2UXD L;  1SN8 A;  4DKA C;  1BVS A;  5M3F G;  1PH7 A;  5FLM H;  3S17 H;  1VQA A;  1IYJ B;  4A3D G;  4A76 A;  1H95 A;  1VQK A;  4X65 L;  4AYB E;  1M90 C;  1Y1V H;  2VZA A;  1I3Q H;  1OXS C;  3DLL A;  4DR1 L;  3RLN A;  1EOV A;  4X64 Q;  1PYS B;  2KHI A;  3PUW A;  2JA6 H;  3TRE A;  1SFO H;  4JYA Q;  1G51 A;  1NE3 A;  5M5W H;  1A0I A;  1LYL A;  3PUV A;  1TXY A;  2R7D A;  3GTL H;  5M3M G;  1SLJ A;  4GN5 A;  3S14 H;  3HOZ H;  1XMO Q;  2MFI A;  1KD1 C;  4QJF A;  2VQF L;  1GM5 A;  1JB7 A;  3PO2 H;  5JJL A;  1SRU A;  4QGU A;  4JI6 L;  4OO1 I;  4R4I A;  3CCL A;  2BH2 A;  3BJU A;  4R4C A;  4A3K H;  3CC4 A;  4GKK L;  2HT1 A;  2A1A A;  2Q2H A;  4GNX B;  1I6H H;  2HHH Q;  5IYC H;  4LNQ A;  1YBY A;  1AE3 A;  4C3H H;  3JAM i;  3MEF A;  5J3B A;  4B3R Q;  3B6Y A;  4DV7 L;  1BKB A;  2JA9 A;  1U5K A;  4P72 A;  4UP9 A;  1P16 A;  4UP8 A;  1Q82 C;  1W3S A;  2HIV A;  3CF5 A;  3CC2 A;  3PV0 A;  1LM0 A;  4GOP A;  3CCS A;  4GOP C;  1PA6 A;  2R93 H;  2ALY B;  2CWA A;  4P74 A;  4JI8 L;  4JI0 L;  4JC0 A;  1B8A A;  4LWC A;  4HIK A;  2IX1 A;  3S1Q H;  4A3C G;  2Y0S E;  3KYH C;  3L7Z C;  4LFC L;  3M4P A;  4IO9 A;  1NMF A;  2HIX A;  4JBW A;  4DV4 L;  1M1K C;  3KDF B;  4NXM L;  1VQI A;  1P8L A;  2NZO A;  3E9H A;  1YIT A;  5ELO A;  3PO3 G;  5M3F H;  4HIO A;  1YJW A;  4A3D H;  2VNU D;  4YHH Q;  4DV6 L;  3OTO Q;  2UXB L;  2R6G A;  1B70 B;  4B3S Q;  3HOY G;  4IPC A;  3G71 A;  2LSS A;  4WJ4 A;  1FJG Q;  3JAM c;  2IHE A;  2FXQ A;  3FKI G;  3CCM A;  3CCR A;  3NEL A;  4KI0 A;  4JI2 Q;  3UDI A;  5FLX c;  4AQY Q;  1X55 A;  4IOC A;  1N32 Q;  2Z6K A;  5M3M H;  2Z6K C;  2UXC Q;  1CSQ A;  4X62 L;  3VDY A;  4A3I G;  1VQ5 A;  2L15 A;  3PUZ A;  2YV5 A;  3E9I A;  4DR6 L;  3Q8D A;  1Q86 C;  3I56 A;  1NBW A;  3CCU A;  1I94 L;  1C9O A;  2IT1 A;  4R1J A;  5LMU Q;  1QVG A;  2QEX A;  1O7I A;  3L0O A;  4QY7 A;  2VS1 A;  2ZM6 Q;  4BBR G;  3S1R H;  1BBU A;  1HZ9 A;  1VQJ A;  3K8A A;  5HY6 A;  2UUB Q;  5LMN W;  1EIF A;  1VQ7 A;  4DV1 L;  1EIY B;  4JI4 L;  4HJ9 A;  4DV0 L;  1HNW L;  1JE5 A;  5C3E G;  3U58 A;  4JI3 L;  1L1O A;  1EUJ A;  3GO5 A;  1L1O C;  4O0A A;  4IPH A;  1IBM L;  2OTL A;  4LF4 Q;  3RN2 A;  4A93 H;  3HOX G;  1AH9 A;  1PH8 A;  4A3C H;  1VQF A;  1XMQ Q;  1V9P A;  3IRB A;  2VY3 A;  4OON A;  1S3O A;  1LTL A;  4DUZ L;  3CP0 A;  4LF8 L;  3CQZ H;  2DUD A;  3EN2 A;  3I7F A;  2K50 A;  1K9M C;  1A63 A;  3PO3 H;  3HFZ B;  1MJE A;  4Y52 H;  2N78 A;  4GOP B;  4DV3 L;  2BH8 A;  3HOY H;  4DR5 Q;  4IOA A;  5IYD G;  5C4J H;  4X65 Q;  4DR3 Q;  2R7Z G;  1VQL A;  4BA2 I;  2Q2U A;  4WJ3 M;  4HID A;  4LFA L;  1E24 A;  1PH1 A;  1KQS A;  4OWX B;  2UU9 L;  4DV2 L;  4DR1 Q;  3FKI H;  2CFM A;  1N33 Q;  4LUO A;  4K0K L;  4PZ8 A;  2EQS A;  4LF5 L;  4LF7 L;  1XJV A;  3RLO A;  4IJH A;  1K73 C;  3GD7 A;  1YJN A;  3GTJ H;  1WJJ A;  2PMZ E;  4JG2 A;  4GKJ L;  2GVB A;  2ZTD A;  4DK3 C;  3ER0 A;  3OYY A;  4DAM A;  1Q46 A;  1IXR A;  2N49 A;  4DUY L;  4LUV A;  4A3I H;  1Q7Y C;  1QUQ B;  1VQG A;  5C44 G;  1PV4 A;  3K7U C;  1SMX A;  3HKZ E;  2NZH A;  2VQF Q;  5IYB G;  1N8R C;  1EWI A;  1KC8 C;  3CD6 A;  3K0X A;  4JI6 Q;  2K14 A;  3UE0 A;  2E5L L;  2ASB A;  4GKK Q;  4X6A H;  3G6E A;  2C35 B;  1PH3 A;  3RZD H;  1MIU A;  4AIM A;  1CKM A;  4BBR H;  4DNI A;  1HR0 L;  4JI7 L;  4P73 A;  5IWA Q;  2YU9 H;  1PYB A;  3GTG H;  4BY7 G;  3BZC A;  2MO0 A;  2RHQ B;  2PNH A;  4DV7 Q;  1N36 L;  1XNR L;  3KJP A;  1EFW A;  4DR4 Q;  5C4X G;  2WAQ G;  5C3E H;  4YWM A;  1I5F A;  1K3R A;  1XPR A;  1VQC A;  4GS3 A;  1KL9 A;  2IX0 A;  4MTN A;  4P75 A;  3HOX H;  3F2D A;  1QZH A;  3HOW G;  3STB D;  5JEA J;  2EXD A;  4JI8 Q;  1CKO A;  3KF6 A;  5FJ8 G;  4JI0 Q;  2NVT H;  1VS0 A;  1KIX A;  3CPW A;  1CSP A;  2I0Q A;  1C0A A;  2A19 A;  4LFC Q;  4A3F G;  4DV4 Q;  3K80 C;  1JMC A;  4NXM Q;  1YHB A;  3RNU A;  1B7Y B;  5E7N A;  1UE6 A;  4NPS A;  4R4T A;  3OW2 A;  1J5E Q;  3KJO A;  1QVC A;  4DV6 Q;  3T1H L;  5IYD H;  1OXT A;  1E1O A;  2R7Z H;  2OTJ A;  4KHZ A;  3J80 i;  4P71 A;  3PIP A;  1PH4 A;  1NMG A;  1YHA A;  3GTO H;  1LUZ A;  3G48 A;  3H3V H;  2EIF A;  2OCE A;  4HJ5 A;  2WB1 E;  2ZTE A;  2HQL A;  4C2M H;  5C0X J;  1YJ9 A;  1XTD A;  1A62 A;  1G29 1;  4A4I A;  1Y1W G;  3AYH B;  3ICE A;  1HZC A;  1IBL L;  5EAY A;  2E2J H;  1IBK Q;  2YTV A;  4A3L G;  1HNX L;  4L5S A;  5C44 H;  1XNQ Q;  3S1M H;  4IFD I;  3UDF A;  1Q12 A;  1VQH A;  1HNZ Q;  5IYB H;  1N34 L;  3NEM A;  3LGJ A;  3DM3 A;  2NVY H;  2F4V L;  2YTX A;  5IP9 G;  2ZJP A;  4KLK A;  1CKN A;  4DR2 L;  4BBS G;  4LF6 L;  4L5T A;  1KRT A;  2PI2 A;  1X3F A;  2ZJQ A;  4BY7 H;  1TWG H;  4B3T L;  4NXN L;  2B63 G;  4RG1 A;  2CWP A;  3PIO A;  3RR5 A;  5C4X H;  3J80 c;  4DV1 Q;  3NEN A;  4L5R C;  3CW2 C;  4JI4 Q;  1Q8K A;  2Z0S A;  4DV0 Q;  4TVA B;  4B3M Q;  4JI3 Q;  4A3E G;  2F3I A;  3HOW H;  1IBM Q;  3CCQ A;  5FJ8 H;  5AJ3 L;  5IP7 G;  4GN3 B;  4A3B G;  1RIP A;  1T9H A;  2WFW A;  4X64 L;  4YY3 L;  5HGQ A;  2KCM A;  4DUZ Q;  4A3F H;  1VQ8 A;  2I5L X;  1X54 A;  4NB3 A;  1K0R A;  1TWH H;  1XMO L;  4ME3 A;  1JT8 A;  3T1Y L;  1HJP A;  4DV3 Q;  2QGQ A;  3CCE A;  4C3J H;  1Q81 C;  1E7Z A;  1IZ6 A;  3M9B A;  2JA5 G;  3EIV A;  3CME A;  4OWW B;  4K0K Q;  4DV2 Q;  2AKW B;  2PQA A;  1X9N A;  2I5H A;  1HR0 W;  4LF5 Q;  4YCU A;  4LF7 Q;  1PH6 A;  5BR8 L;  4J15 A;  2R92 G;  3S2D H;  1Y1W H;  4A3L H;  1TWF H;  2K5V A;  2Q2T A;  4GKJ Q;  4B3R L;  5C0X I;  1K8G A;  4AYB G;  1KHI A;  1SR3 A;  3PCO B;  4BXX G;  1Z47 A;  2DGY A;  4DR7 Q;  2LXJ A;  2YTY A;  1UE1 A;  5GAG C;  3J81 i;  4ALP A;  1ASZ A;  3U4Z A;  1E22 A;  5K36 G;  1OXX K;  1X65 A;  3NBH B;  5IP9 H;  1V43 A;  5IT9 c;  1DGS A;  4DV5 L;  1YI2 A;  5GAD C;  1WCM G;  4BBS H;  2XGT A;  4TQU S;  4EX5 A;  3TS2 A;  4OWT B;  1YZ6 A;  4H02 A;  1HR0 Q;  4JI7 Q;  2KCT A;  3ERS X;  1PH9 A;  2B63 H;  4A3G G;  2JEB I;  3PSI A;  3D31 A;  5LMN Q;  2BA0 A;  2UXD Q;  1L0W A;  5GQO A;  1N36 Q;  2E2H H;  1XNR Q;  1QZG A;  3OTO L;  4A3E H;  1QVF A;  1VQN A;  2KHJ A;  2UUC L;  2JA8 G;  3M3Y H;  3U4V A;  1VQ9 A;  2NN6 I;  5IP7 H;  2K5N A;  4A3B H;  3ZJY C;  2GN5 A;  1Y14 B;  2R7F A;  1XPO A;  3H3V I;  1VQB A;  4Y7N H;  2JE6 I;  1KAW A;  2D62 A;  3TQY A;  4GNX A;  1NY4 A;  4GNX C;  1ASY A;  2CCZ A;  4JI2 L;  1V1Q A;  3I55 A;  3PUX A;  3CCJ A;  1UE7 A;  3I4M G;  4PMW A;  2WP8 J;  1VQE A;  3F1Z A;  1RL2 A;  3RLF A;  2N3S A;  1PHJ A;  4KHP L;  2RCN A;  1IL2 A;  3T1H Q;  4YCW A;  3UDG A;  1OXV A;  2BA1 A;  2Y0S G;  4JBJ A;  5GRO A;  5H1S E;  2LXK A;  3BU2 A;  4O2D A;  2VQE L;  1VQ4 A;  2ES2 A;  2JA5 H;  4LF9 L;  1D8L A;  1OTC A;  3W1B A;  2MQH A;  2NVX H;  2RF4 A;  2ATW A;  2R92 H;  1FL0 A;  4UP7 A;  1X56 A;  3PF4 A;  1IBL Q;  3K81 C;  2UUA L;  4BXX H;  4C3I H;  5M5Y H;  2JK8 A;  1EYG A;  1YIJ A;  5ELN A;  4JI5 L;  2K75 A;  1N34 Q;  3AEV A;  1YNX A;  3PGZ A;  3W5O A;  3EBE A;  1X3G A;  2AHO B;  4JBM A;  2F4V Q;  5JJI A;  1CUK A;  1WCM H;  1BBW A;  4DR2 Q;  2ZTC A;  1XMQ L;  4HIM A;  4X66 L;  1NTG A;  3AQQ A;  2D0O A;  1AE2 A;  4A3G H;  3A0J A;  4B3T Q;  4NXN Q;  3A5U A;  1L1O B;  1X6O A;  2UXB Q;  4BY1 G;  4A3M G;  1VCI A;  4DR5 L;  4JI1 L;  2JA8 H;  4DR3 L;  2B3G A;  4UPA A;  1L2F A;  2JJQ A;  1N33 L;  1PVO A;  5AJ3 Q;  3KLW A;  1D7Q A;  4XIG S;  3M4O H;  4YY3 Q;  4JV5 L;  3CCV A;  3I4M H;  2I5M X;  4POF A;  1U0L A;  2Q2I A;  4GLA C;  3M7N A;  4X62 Q;  3L2P A;  4HJA A;  4LFB L;  1W2B A;  4A75 A;  4DR6 Q;  1J6Q A;  3ULJ A;  3M4Q A;  3T1Y Q;  1I94 Q;  4IJL A;  4UY8 C;  4OO1 G;  1UEB A;  1X3E A;  2CQO A;  3F2C A;  2OQ0 A;  4JBK A;  1GKH A;  1YVC A;  3I4N G;  5DLQ E;  1HZA A;  4IPG A;  4YWL A;  1FGU A;  1YEZ A;  4DPG A;  1Z9F A;  5BR8 Q;  3MXN B;  2ID0 A;  2VL6 A;  4MZ9 A;  4APV A;  1FVI A;  5IWA L;  4HJ8 A;  3ULL A;  2AWN A;  3GDE A;  1K8A C;  1MKH A;  3PF5 A;  4OX9 L;  4DAY B;  1VQD A;  4IFD G;  3AFQ A;  1HNW Q;  4DR4 L;  4OXP A;  3HOU G;  3D0F A;  5GAE C;  2MNA A;  4JCV E;  1GO3 E;  3FHW A;  4DV5 Q;  1G6P A;  2VUM G;  1TWA H;  4LF8 Q;  4JYA L;  3CAM A;  3A5Z B;  4HJ7 A;  1WI5 A;  3H0G G;  3K7A H;  3HKZ G;  1JJC B;  2D0P A;  1JJ2 A;  2K5H A;  3S15 H;  2V1C C;  1J5E L;  4BY1 H;  4PZ7 A;  3KOJ A;  3WWV A;  4A3M H;  4LUZ A;  1QUQ A;  1VQ6 A;  2OQK A;  1EQR A;  3KF6 B;  2WAQ E;  4PG3 A;  4LFA Q;  5M5X H;  2UUC Q;  3CMA A;  1EQQ A;  1NJI C;  2UU9 Q;  3CXC A;  2OWO A;  3U50 C;  3M85 A;  4EQ5 A;  2HHH L;  2IHF A;  3KF8 B;  4GN4 B;  4YCV A;  3I4O A;  5JEA G;  4QL5 A;  1KXL A;  2IY5 B;  4DUY Q;  2ZJR A;  3F8T A;  3W1G A;  3TS0 A;  1UWV A;  1IBK L;  2K4K A;  4JOI A;  4JOI C;  2H5X A;  1R9T H;  1XNQ L;  4R4Q A;  1C7Y A;  4KHP Q;  3HOV G;  4BA1 I;  1HNZ L;  4A3J G;  2JA7 G;  2VQE Q;  3GTM H;  2E5L Q;  3J7A 5;  2QA4 A;  2AMC B;  1S72 A;  4LF9 Q;  1WFQ A;  3ULP A;  3I4N H;  4FDB A;  4L5Q A;  1VQM A;  2KEN A;  3GTQ H;  3TRZ A;  3S24 A;  3SGI A;  3CPF A;  1HH2 P;  5C0X G;  4GLX A;  2UUA Q;  1OXU A;  4YHH L;  2JQO A;  4B3S L;  5FLM G;  1KRS A;  2YYZ A;  3HOU H;  2B29 A;  3CC7 A;  1GVP A;  3RN5 A;  4B3M L;  1CKN B;  4JI5 Q;  3KFU A;  1FJG L;  1Y1V G;  1N9W A;  2WB1 G;  5GAH C;  5IE8 A;  2KBN A;  2N8N A;  5JJK A;  3TEH B;  4R4O A;  1SRO A;  1YHQ A;  2VUM H;  2F52 A;  4DK6 C;  2JA6 G;  2RHS B;  4X66 Q;  3J81 c;  4AQY L;  2CKZ B;  2VW9 A;  1N32 L;  2K52 A;  2E8G A;  3H0G H;  3I2Z A;  1GD7 A;  4IPD A;  4YWK A;  2UXC L;  2AWO A;  1I50 H;  3HKS A;  3HOZ G;  3S16 H;  1WOC A;  3PO2 G;  3G4S A;  1WYD A;  1K83 H;  1HZB A;  4JI1 Q;  4A3K G;  1E3P A;  2NN6 G;  5LMU L;  1PH5 A;  1TWC H;  2ZM6 L;  4MNO A;  1UE5 A;  5IY0 A;  1Q1E A;  4RMF A;  5IYC G;  4QQB X;  4JV5 Q;  3PUY A;  4GLV B;  4LW1 A;  2UUB L;  2XTI A;  3F2B A;  1Q1B A;  4IFD J;  1HNX Q;  3E0E A;  3KDF A;  2NVQ H;  3JC6 6;  2A8V A;  4LFB Q;  3STB C;  4DR7 L;  3HOV H;  1SE8 A;  1VQO A;  4A3J H;  1PH2 A;  4LF4 L;  2JEA I;  2JA7 H;  3GTP H;  2PQA B;  3UE1 A;  1XPU A;  1VQP A;  2R93 G;  3UDX A;  1PFS A;  3GTK H;  4QIW E;  3RZO H;  4A93 G;  3J81 j;  3BZK A;  4LF6 Q;  4POG A;  1S40 A;  3AFP A;  1JJG A;  1A8V A;  1E1T A;  2PI2 E;  2GVA A;  4XTC S;  3A74 A;  3J7Z C;  2E2I H;  1MJC A;  4AH6 A;  3H15 A;  3S2H H;  3FP9 A;  4PZ6 A;  4OX9 Q; 
#chains in the Genus database with same CATH topology
 1L0Y B;  4FF2 A;  2UXD L;  1SN8 A;  1BVS A;  5M3F G;  2KCN A;  1VQA A;  2DN8 A;  1VQK A;  2HUG A;  2EYP A;  2VZA A;  2Y0S B;  1OXS C;  5COR A;  1VF5 C;  1EOV A;  1VF7 A;  4E6I A;  2JA6 H;  2XNA C;  1G51 A;  1NE3 A;  1LYL A;  2RVL A;  5FK9 C;  1SLJ A;  3I91 A;  1PFM A;  4JK1 C;  2VQF L;  3DM1 A;  1SRU A;  3OSO A;  5I6Y A;  2BH2 A;  1LT6 D;  1AW7 A;  1S5F D;  1QB5 D;  4A3K H;  3CC4 A;  3TP7 A;  2CQA A;  1L0X B;  4GNX B;  1TWA B;  5JPM C;  4RHS A;  4KY6 A;  4B3R Q;  1R4P B;  1Q82 C;  4UP9 A;  1E2Z A;  1P16 A;  1PTO D;  1EIH A;  2A68 C;  2HIV A;  4IUV A;  3S15 B;  3PV0 A;  4EQP A;  4XXE A;  4JC0 A;  1B8A A;  3KYH C;  1RCV D;  1SJH D;  2Z4I A;  3A56 A;  4CGY B;  5ELE A;  5TSS A;  1YJW A;  5K36 G;  4DV6 L;  2UXB L;  2XIW A;  1ONL A;  4N8X 1;  1TVX A;  3NEL A;  2DY8 A;  1X55 A;  2Z6B A;  1N32 Q;  3JAM E;  3SK6 A;  1QJO A;  2L15 A;  1PZJ D;  3PUZ A;  2NWG A;  3E9I A;  1NBW A;  2EY6 A;  2LKV A;  2QEJ C;  2IT1 A;  1R4Q B;  3J80 L;  3L0O A;  2ZM6 Q;  3QOJ A;  1XTC D;  5LMN W;  4CDC C;  5J22 A;  2NBF A;  3HKZ B;  1HHV A;  2RBM A;  1EIY B;  4QF4 A;  4DV0 L;  2ICI A;  3I73 A;  2E76 C;  5JVG 3;  4IPH A;  1AH9 A;  1O80 A;  1TS3 A;  2AUK A;  4KMU C;  5IOC A;  1CA5 A;  3HEJ A;  4DUZ L;  4LF8 L;  1LTL A;  4IUN A;  5COY A;  3H09 A;  3EN2 A;  1K9M C;  2BDN A;  2RKS A;  3C3L A;  3PO3 H;  3HFZ B;  1MJE A;  2M00 A;  1D5Z C;  3OMC A;  1A3U A;  1X32 A;  4DR5 Q;  2R7Z G;  4BA2 I;  5KNB A;  1PZI D;  4RCO A;  1B3Q A;  4LFA L;  1KQS A;  3HP3 A;  3VYU A;  3VR3 A;  4ZK9 B;  1WJJ A;  2GVB A;  1TS4 A;  4DAM A;  4DUY L;  1IXR A;  3BDC A;  4LUV A;  3MXN A;  1QG7 A;  5C44 G;  3F2U A;  3S17 B;  2VQF Q;  2AUJ D;  3CD6 A;  1KC8 C;  4QCL A;  1DON A;  2WB1 B;  4DGZ A;  2C35 B;  2PYK A;  3RZD H;  2A6H D;  3VYS A;  4KTA A;  4K6D A;  1DXM A;  2F0D A;  5IWA Q;  2YU9 H;  1SFO B;  4BY7 G;  5M5W B;  2Q8R E;  5C4X G;  3S14 B;  1I5F A;  2IW3 A;  3H94 A;  3J81 L;  1GJX A;  1QZH A;  4FO2 A;  3HOW G;  4IQZ A;  3KF6 A;  5D65 A;  2BCO A;  3KUP A;  1VS0 A;  3OW7 A;  4U67 3;  1I6H B;  1CZG A;  4C3H B;  1JMC A;  2IPK D;  3FEW X;  1UE6 A;  1J5E Q;  5T1G A;  2FMC A;  3KJO A;  2ICE C;  4DV6 Q;  1F9R A;  1SNO A;  5IYD H;  2XRS D;  1PH4 A;  4P71 A;  3G48 A;  2EIF A;  5IIF A;  4F7X A;  1ENA A;  3O13 A;  3QB3 A;  2ZT9 C;  3ICE A;  3AYH B;  3T13 A;  5EAY A;  1IBK Q;  1B50 A;  1HNX L;  1E2V A;  1XNQ Q;  3UDF A;  1HNZ Q;  5IYB H;  3DUZ A;  2L1B A;  3NEM A;  4I7Z C;  2RSN A;  3IKJ A;  3LGJ A;  4RA8 A;  2NVY H;  5CV6 A;  2PI2 A;  5AFW A;  5E4W C;  3MC0 B;  5M3M B;  3NEN A;  4XYO A;  1TS5 A;  1CT1 D;  4DV0 Q;  4TVA B;  1JWM D;  4KK7 A;  4B3M Q;  3N52 A;  3J80 E;  1RTO A;  2PPB C;  2N55 A;  1MSG A;  5HGQ A;  4DUZ Q;  3S1R B;  2RDH A;  2K33 A;  1S5E D;  4Q5V A;  4NB3 A;  4PV1 C;  4K5X A;  3LWE A;  1JT8 A;  2QGQ A;  4C3J H;  4G7O C;  2JA5 G;  3CME A;  4OWW B;  2I5H A;  3HS0 C;  5BR8 L;  2R92 G;  1BCP B;  4A3L H;  1TWF H;  1KHI A;  1WD1 A;  3T16 A;  1EL0 A;  2QW7 A;  2YTY A;  1IHZ A;  4ALP A;  1GHJ A;  4CKE A;  3HOY B;  1OXX K;  2K5D A;  5C4J B;  1SYF A;  5IP9 H;  1DGS A;  4DV5 L;  3AB9 A;  2EYJ A;  3TDQ A;  1SNQ A;  1UEA B;  2KCT A;  1PH9 A;  2B63 H;  3PSI A;  2F0E A;  1RDP D;  1TS2 A;  5IT9 E;  4A3I B;  2E2H H;  1C48 A;  3C1F A;  3OTO L;  3SHL A;  4A3E H;  1QVF A;  1VQN A;  2KHJ A;  2JA8 G;  5CV9 A;  1ZYR D;  3U4V A;  2K5N A;  3R2I A;  2GN5 A;  3OWE B;  2RCF A;  4IZ8 A;  4BBR B;  4GNX A;  2PNR C;  2CCZ A;  3D6C A;  1V1Q A;  3PUX A;  1KLG D;  1UE7 A;  3I4M G;  4PMW A;  3VYR A;  3GTG B;  1JIC A;  1Y8N B;  3RLF A;  2N3S A;  5C3E B;  1VDZ A;  4F88 A;  5GRO A;  5H1S E;  1VQ4 A;  3DWP A;  1VMC A;  1D8L A;  2N88 A;  3W1B A;  3VR5 A;  2RF4 A;  2R61 A;  1UAP A;  1CQF A;  3RMH A;  1KLU D;  1SAP A;  4QUF A;  2D9U A;  4JW0 A;  3K81 C;  4C1N K;  4C3I H;  4HAE A;  4FXK C;  2JK8 A;  1EYG A;  3FDT A;  3VR6 A;  3OIQ A;  1U4P A;  5IGD A;  3NHH A;  4JBM A;  5JJI A;  1BBW A;  3GTO B;  2ZTC A;  1XMQ L;  4K8J A;  3A7A B;  4B9W A;  3SEB A;  4C2M B;  5JPN C;  3E3X A;  3K0Y A;  4MIU A;  1L1O B;  3TSS A;  4XQQ A;  1DOM A;  1SSO A;  3FPP A;  4X3T A;  4FXG C;  1N33 L;  3MFG A;  1D7Q A;  3M4O H;  1ESF A;  3MFY A;  3GP7 A;  4X62 Q;  1GUS A;  4BWG B;  4KD3 A;  2K5Q A;  4LFB L;  4A75 A;  2F0W A;  1I94 Q;  2FFK B;  1HRJ A;  1UEB A;  1A3T A;  3BZD B;  1U9R A;  4J8Q A;  4JBK A;  2EJM A;  2F0P A;  4DAP A;  2HCC A;  2C5C A;  4DPG A;  1YEZ A;  2CH4 W;  4ODG A;  3W2D A;  4MZ9 A;  5BR8 Q;  1FVI A;  3ULL A;  2AWN A;  4OXP A;  5T1I A;  5KRU A;  3HOU G;  2LY7 A;  2MNA A;  1GUN A;  4DV5 Q;  1TWA H;  4HMJ A;  2QF7 A;  4OHJ A;  5K5P A;  4J1M A;  4HJ7 A;  4FP5 D;  3H0G G;  2D0P A;  2K5H A;  3S15 H;  2KVM A;  2V1C C;  4PZ7 A;  3WWV A;  1EQR A;  2B2T C;  1IW7 D;  2WAQ E;  4QUC A;  2OWO A;  4EQ5 A;  4G57 A;  3KF8 B;  4BBS B;  3CRK C;  4QL5 A;  4UAI A;  2F0K A;  3IFD A;  1MBY A;  5C3W A;  1UWV A;  3NTI A;  3LWU A;  5BN3 A;  4LAA A;  2JA7 G;  2EXZ A;  4OEM B;  3ULP A;  1EFI D;  1FYC A;  1VQM A;  4L5Q A;  2PW5 A;  1SYE A;  4C1N I;  4Y7N B;  5IGF A;  3D8G A;  4B3S L;  2A74 C;  2YYZ A;  2B29 A;  3RN5 A;  4RCN A;  2PO4 A;  1CHQ D;  3TEH B;  4R4O A;  3TBI B;  1TY0 A;  1EY8 A;  1IKL A;  3W3A A;  2K52 A;  3I2Z A;  4IPD A;  3K6O A;  1S4Z A;  5M5Y B;  2H4O A;  3SE0 A;  4ZKC B;  3ND9 A;  3G6J B;  1E3P A;  5LMU L;  1K8M A;  5JJZ A;  1H9S A;  5IY0 A;  1Q1E A;  5IYC G;  3V96 A;  4QQB X;  1H9R A;  2UUB L;  4RWS C;  3KDF A;  2F1M A;  4A3G B;  3PIP 3;  4LFB Q;  4XQJ A;  1PLF A;  3TP5 A;  1VQO A;  1PH2 A;  4H7B A;  3I4L A;  1XPU A;  2R93 G;  1PFS A;  2L55 A;  4A93 G;  4LF6 Q;  3AFP A;  1JJG A;  1KNE A;  1I4X A;  2A5H A;  2EYF A;  1YNJ C;  4PZ6 A;  4YIJ A;  4K2L A;  4H44 C;  1PH7 A;  3S17 H;  5FLM H;  4A3D G;  1IYJ B;  1Q90 A;  4AYB E;  2RQX A;  1ZEQ X;  2NTT A;  2NVY B;  5EBD A;  1SNP A;  1PYS B;  1SFO H;  2Q8I B;  5M5W H;  1TXY A;  1JWU D;  3S14 H;  4RGM A;  3RD4 A;  2IJ0 A;  1KD1 C;  2HD3 A;  3NSW A;  4QGU A;  1AZP A;  2KED A;  4DNT B;  1SNM A;  3BJU A;  2QDB A;  1STA A;  2Q2H A;  1I6H H;  3GQB A;  5A35 A;  4C3H H;  3EVQ A;  3I8Z A;  1U5K A;  4UP8 A;  1WTO A;  1W3S A;  3UI2 A;  4O42 A;  3H91 A;  5FO9 B;  1SE4 A;  4BY1 B;  1LM0 A;  2MPM A;  4GOP A;  3CCS A;  3M7G A;  1SYD A;  1PA6 A;  3BVZ A;  4ZKB B;  2CWA A;  1LT5 D;  1JOO A;  4P74 A;  4JI0 L;  4R8I A;  1PRT B;  4A3C G;  4LFC L;  1VQI A;  5CBA E;  2VNU D;  4HIO A;  2R6G A;  4B3S Q;  4NP5 A;  3G71 A;  4WJ4 A;  1QE6 A;  3TZU A;  1B9N A;  4WJW A;  3FKI G;  1G91 A;  3CCM A;  3I4N B;  3UDI A;  2B8G A;  1XX8 A;  3WDN A;  5FLX c;  2B63 B;  5M3M H;  1D1I A;  3DEP A;  2BE5 C;  5I6W A;  2KCC A;  3CCU A;  2PW7 A;  5ISR A;  3E6Z X;  5DAU A;  5LMU Q;  1QVG A;  2PMZ B;  4QY7 A;  1HUN A;  4HSP A;  3S1R H;  4CJ1 B;  1HZ9 A;  1LO5 D;  2CW0 C;  3MWY W;  5I4D A;  2UUB Q;  1M4V A;  4TKO B;  4DV1 L;  3OHX C;  4KN4 C;  4HJ9 A;  1HFG A;  1HNW L;  1JE5 A;  1I50 B;  1L1O A;  4O0A A;  2NYZ D;  4ULL A;  1IBM L;  1HTL D;  3HOX G;  1PH8 A;  3NTK A;  2E2D C;  2VY3 A;  3OPO A;  1ESR A;  2K50 A;  3QWN A;  4EQO A;  3K58 A;  1S5B D;  2NVQ B;  4DV3 L;  3HOY H;  5C4J H;  3HOV B;  4WJ3 M;  4A3J B;  2Q2U A;  2K5W A;  4HID A;  5C6A A;  1PH1 A;  4OWX B;  4K0K L;  4LUO A;  4PZ8 A;  2EQS A;  4HED A;  5JEA H;  1XJV A;  4IJH A;  5EKI A;  3J7Y W;  2ZTD A;  1LT4 D;  2E2I B;  3ER0 A;  3OYY A;  1Q7Y C;  1Q46 A;  1ICF B;  2N49 A;  4IAL A;  4A3I H;  3S2H B;  1SXT A;  4G7H C;  3S1N B;  1LTR D;  1SMX A;  4X3U A;  1B9M A;  3UE0 A;  1Y1V B;  4IUU A;  3G6E A;  3AMU A;  1SYC A;  4BBR H;  4DNI A;  4JI7 L;  1FGB D;  4CJ0 B;  1PYB A;  5C0X H;  3GTG H;  1F2M A;  3BZC A;  2B2W A;  5KNC A;  1XNR L;  2WAQ G;  5C3E H;  4UHV A;  3HOZ B;  2XVS A;  3PO2 B;  3CU7 A;  3SXH A;  4GS3 A;  1KL9 A;  2F3V A;  3U9O A;  5FJ8 G;  4JI0 Q;  3PIO 3;  1KIX A;  2A19 A;  1K3B C;  4LFC Q;  4A3F G;  3K80 C;  3V05 A;  1YHB A;  5E7N A;  3BDL A;  4NPS A;  1QVC A;  1ZKO A;  1YNJ D;  3T1H L;  4IUT A;  3X3N A;  4KHZ A;  1NMG A;  2BDO A;  4HR7 B;  3H3V H;  1FR3 A;  3GTO H;  1HA6 A;  4DXG A;  3S1Q B;  4HJ5 A;  1DZ1 A;  2XRQ D;  4FYD A;  2HQL A;  3LX0 A;  4C2M H;  1YJ9 A;  3R93 A;  4A4I A;  1Y1W G;  2YTV A;  1GUG A;  1VQH A;  2WKC A;  5M3F B;  2B2U A;  3DM3 A;  1RHP A;  2F0I A;  1D2B A;  3MXP A;  1SJE D;  4KLK A;  1KNA A;  2BOS A;  4L5T A;  1I4H A;  1H9J A;  2ZXR A;  4KKT A;  4XQN A;  1GHK A;  1ENC A;  3RR5 A;  1BF4 A;  1ET6 A;  4DV1 Q;  2NB0 A;  1F2L A;  1DM0 B;  2Z0S A;  3MXG A;  1HCZ A;  1BCP F;  4R8N A;  3EQL C;  3IL8 A;  1IBM Q;  1GOZ A;  3CCQ A;  5IP7 G;  4A3B G;  1RIP A;  1T9H A;  4K6L A;  4X64 L;  5JVH 3;  2VB2 X;  5E3F A;  1LT3 D;  1TU2 B;  1CM9 A;  2KCM A;  2XWB B;  1VQ8 A;  2GA4 B;  2I5L X;  3R2T A;  1XMO L;  3URY A;  4EQN A;  5KGU A;  1HJP A;  1G8Z D;  4DV3 Q;  2RA4 A;  4OIJ A;  4K0K Q;  1EZ6 A;  3BYT B;  2AKW B;  3Q0A A;  1X9N A;  1HR0 W;  1PH6 A;  2F0O A;  2OXP A;  1KDA A;  1RD9 D;  2K5V A;  3CQZ B;  4AYB G;  1DJR D;  3PCO B;  1IL8 A;  4DR7 Q;  1ASZ A;  1BQQ T;  1E22 A;  1X65 A;  2BE5 D;  1V43 A;  4KN7 C;  4BBS H;  1WCM G;  2HDM A;  3TS2 A;  1YZ6 A;  2EY2 A;  1O7Z A;  4JI7 Q;  3K57 A;  2JEB I;  1STH A;  3D31 A;  2A73 B;  2UXD Q;  1L0W A;  1XNR Q;  2CW0 D;  3CRL C;  2DNE A;  5FLX L;  2UUC L;  4NMZ A;  2NN6 I;  1GUO A;  1Y14 B;  1VQB A;  4Y7N H;  2SOB A;  1ASY A;  4JI2 L;  1NY4 A;  4GNX C;  2P5Z X;  2WP8 J;  5FOB B;  5EQ0 A;  1RJT A;  1RL2 A;  1PHJ A;  4KHP L;  2RCN A;  3T1H Q;  3UDG A;  1OXV A;  2BA1 A;  4JBJ A;  2LXK A;  3BU2 A;  5J39 A;  4LF9 L;  2ES2 A;  1LTG D;  1EU3 A;  1O7L A;  2F0U A;  2MQH A;  2ATW A;  2NVT B;  5FO8 B;  3X3M A;  4FF3 A;  2UUA L;  4BXX H;  3G7L A;  5M5Y H;  1KAA A;  4RKL A;  1YIJ A;  1QNK A;  2R7Z B;  3AEV A;  1YNX A;  2ZXO A;  2OF1 A;  1FNU A;  3EBE A;  4KY5 A;  4HIM A;  1JQY D;  2KEC A;  4CDF C;  2D0O A;  4A3G H;  3LNN A;  1WTX A;  2E2J B;  3A5U A;  3KBG A;  2UXB Q;  4XT1 B;  5C44 B;  3TZD A;  3S1M B;  5IGG A;  4KD4 A;  4DR3 L;  1L2F A;  2FIN B;  3AU7 A;  5A2Q L;  5I9P A;  3CCV A;  1EY5 A;  4BY7 B;  1HQR D;  1ML0 D;  5C4X B;  2L11 A;  4OO1 G;  4WOR A;  3HOW B;  2OQ0 A;  1GKH A;  2O5J C;  5JOB A;  4S3S A;  1EY9 A;  4IPG A;  3CCL A;  2ID0 A;  1EWH A;  2VL6 A;  2EY5 A;  1BUV T;  1MKH A;  3Q24 A;  4DXF A;  4IFD G;  2G9H D;  3AFQ A;  4DR4 L;  2A68 D;  5LL6 S;  2TMP A;  2SNM A;  3FHW A;  1G6P A;  2VUM G;  4LF8 Q;  3N6R A;  3VYT A;  4JYA L;  3CAM A;  1WI5 A;  3QO2 A;  4P2C B;  5CR3 A;  5CC4 A;  1PTO F;  4KV6 A;  4BY1 H;  3KOJ A;  4A3M H;  1VQ6 A;  2OQK A;  4RAU C;  4LFA Q;  2UUC Q;  2MUY A;  1MGS A;  3KLS X;  3U50 C;  3DHQ A;  1D5X C;  5ELC A;  2L9H A;  4GN4 B;  4KKS A;  5JEA G;  4NKL A;  3ZYY X;  4DUY Q;  3MAQ A;  1MD2 D;  3K5L A;  2K4K A;  4JOI A;  4FVM A;  2K04 A;  3A55 A;  1LTT D;  4KHP Q;  3D6W A;  3SVM A;  3GTM H;  1S72 A;  4LF9 Q;  4WFN 3;  2EOT A;  1SBB B;  3I4N H;  4FDB A;  3D4W A;  4DK0 A;  2DJF C;  3CPF A;  1WTW A;  5C0X G;  2UUA Q;  1CK1 A;  2JQO A;  2FHT A;  4QIW B;  1TR5 A;  1FJG L;  5GAH C;  2KBN A;  2JA5 B;  1A2U A;  1SRO A;  3ONA B;  2AQ2 B;  2F52 A;  5D14 A;  4DK6 C;  2NVX B;  5G3L D;  2JA6 G;  3J7A V;  2R92 B;  2CKZ B;  2VW9 A;  2E8G A;  1GD7 A;  1JOQ A;  1AFP A;  1I50 H;  3HKS A;  4KJO A;  3MTS A;  4K14 A;  2LS0 1;  1TT2 A;  1WYD A;  3SK4 A;  1HZB A;  3J81 E;  4DF7 A;  4A3K G;  4MNO A;  1UE5 A;  2LFN A;  4ABN A;  1CFM A;  3BVG A;  4O1N A;  1B1Z A;  4GLV B;  2MP1 A;  2XTI A;  4IFD J;  1STB A;  3E0E A;  1HNX Q;  5C4H A;  1K28 A;  2NVQ H;  2A8V A;  2KUM A;  3HOV H;  4ZLT F;  4A3J H;  4LF4 L;  2B2V A;  2PZT A;  2PQA B;  2JA8 B;  3UDX A;  1B44 D;  4HN7 A;  3J81 j;  2B2Y A;  2PI2 E;  2F0H A;  2GVA A;  2E2I H;  3A74 A;  4AH6 A;  3S2H H;  1JB7 A;  3I4M B;  2MO1 A;  5LMN L;  3S1N H;  4U68 A;  4DKA C;  1SNC A;  4OEL B;  1H95 A;  1D1K A;  4X65 L;  2J4X A;  1M90 C;  1Y1V H;  4HCE A;  3DLL A;  4DR1 L;  1FNW A;  2KHI A;  4BS9 A;  1TKW B;  3PUW A;  3TRE A;  1LLR D;  1U4L A;  4JYA Q;  5KYI A;  2KHS A;  3PUV A;  2R7D A;  1PRT F;  1JB3 A;  3HOZ H;  1BCP C;  2MFI A;  1STY A;  4QJF A;  3PO2 H;  5JJL A;  5C5M A;  4JI6 L;  3EJI A;  4OO1 I;  4UDU C;  2NN6 H;  4R9W A;  4GKK L;  2AQ3 B;  2A1A A;  4PMB A;  1YNN C;  3NBI A;  4PMC A;  1YBY A;  3JAM i;  3MEF A;  4DV7 L;  1BKB A;  1DOK A;  3TP6 A;  3K7A B;  4G4K A;  3CF5 A;  1JWS D;  4CDD C;  4GOP C;  2ALY B;  4JI8 L;  5M5X B;  4HIK A;  3S1Q H;  2EYO A;  2Y0S E;  3L7Z C;  5I2X A;  2RDG A;  3M4P A;  4IO9 A;  1NMF A;  3MVV A;  2CHB D;  4JBW A;  1P8L A;  3E9H A;  2F0N A;  5ELO A;  1YIT A;  5M3F H;  3PO3 G;  4KY7 A;  3OTO Q;  1AEX A;  4IPC A;  2FMM A;  2LSS A;  2NTS A;  2EYM A;  3JAM c;  1FJG Q;  2IHE A;  2FXQ A;  3WOF A;  2SDF A;  5DNF A;  2JP1 A;  4N9T A;  1BOS A;  4ZRZ A;  2Z6K A;  1CSQ A;  2K6A A;  1QIL A;  4DR6 L;  3HOU B;  3BYY B;  4R1J A;  1PTO B;  5ELD A;  1EEI D;  1EY4 A;  2QEX A;  1O7I A;  1WD0 A;  2VS1 A;  3BDO A;  5IGE A;  1VQJ A;  1GUT A;  3H3V C;  5HY6 A;  2EE1 A;  2K03 A;  1VQ7 A;  3H0G B;  1J8I A;  3U58 A;  3ND8 A;  3S16 B;  3Q6S A;  2OTL A;  1L1O C;  4LF4 Q;  4HSV A;  1K83 B;  2D2C C;  1Q8I A;  1XMQ Q;  2DJG C;  1TWC B;  2M9V A;  2JN4 A;  1STN A;  3CQZ H;  2K7V A;  5K36 H;  4Y52 H;  2BH8 A;  2QKI C;  4IOA A;  5IYD G;  4X65 Q;  4M8A A;  3FVQ A;  2JA7 B;  2MHV A;  3Q23 A;  1N33 Q;  2UU9 L;  4DV2 L;  4DR1 Q;  4K5W A;  2CFM A;  3RZO B;  3KLS A;  4LF7 L;  1V1P B;  3RLO A;  3GD7 A;  2X6G A;  3MHB A;  1EYD A;  1YJN A;  5EKL A;  4DK3 C;  4I7A A;  4QB4 A;  2R3Z A;  2A6E C;  2ENB A;  3K7U C;  4N9P A;  3HKZ E;  2NZH A;  1WTR A;  4ID6 A;  5IYB G;  4DNR B;  3K0X A;  4JI6 Q;  2K14 A;  4DA2 A;  2E5L L;  2VB3 X;  3NXW A;  2PCF B;  4GKK Q;  1I3Q B;  3HG9 A;  4K8I A;  4AIM A;  1Z7T A;  2WII B;  3QIA A;  4P73 A;  5I2Y A;  1SE3 A;  2KJX A;  4LMQ D;  1H9M A;  2B2W C;  2RHQ B;  4DV7 Q;  1EFW A;  3GTL B;  2NZ1 D;  2G5D A;  4TRD A;  1KAB A;  4MTN A;  4JI8 Q;  1CKO A;  2NVT H;  3FMC A;  2NUC A;  2RDF A;  5L37 A;  1C0A A;  2HDL A;  1LTB D;  1B7Y B;  2I07 B;  3OW2 A;  1SE2 A;  3H6M A;  1OXT A;  1E1O A;  2R7Z H;  2OTJ A;  1EYC A;  3J80 i;  4C3J G;  2R93 B;  4C56 C;  3NP8 A;  1BNZ A;  2WB1 E;  2ZTE A;  5IGC A;  1A62 A;  4N8F A;  5BN5 A;  2E2J H;  4A3L G;  1ILP A;  3T56 B;  2KQ3 A;  1EWC A;  3NTH A;  5C44 H;  3S1M H;  1C4Q A;  1Q12 A;  3FRP B;  4A3D B;  4A3M B;  3BG3 A;  1N34 L;  1JOK A;  3CHB D;  1BCP D;  2B2U C;  1QOH A;  3IFT A;  2F4V L;  2YTX A;  5IP9 G;  2ZJP A;  1WVL A;  1II3 A;  4DR2 L;  3K59 A;  3DMU A;  1KRT A;  2J7Z A;  3VA5 A;  4BY7 H;  4B3T L;  4ILW A;  4V0B A;  2B63 G;  1DYQ A;  3PIO A;  4CKC A;  1D6E C;  2L4N A;  5C4X H;  3J80 c;  1B53 A;  1U4M A;  4G7Z C;  2B39 A;  2EVB A;  5CV7 A;  4A3E G;  3HOW H;  3GTM B;  3WOE A;  4LJZ C;  4RGN A;  3NE5 B;  4GN3 B;  2EYH A;  4X3S A;  3NPP A;  1MHW C;  1V8Q A;  1NUC A;  2PZW A;  3A8K E;  5HGT A;  1JE4 A;  4ZQ3 A;  1X54 A;  3DWQ A;  1K0R A;  3P1H A;  4ME3 A;  3CCE A;  1IZ6 A;  3R3O A;  4F8M A;  4DV2 Q;  2PQA A;  4LF7 Q;  5FO7 B;  2Q2T A;  1QNU A;  2O2L D;  1PDQ A;  5C5L A;  5C3X A;  4B3R L;  3E5S A;  2IWH A;  2DGY A;  4C3I G;  1UE1 A;  3J81 i;  3SR1 A;  4TSS A;  3NBH B;  2F0J A;  5IT9 c;  1YI2 A;  4TQU S;  3FKI B;  1STE A;  3GTJ B;  3ERS X;  4J6H A;  3QOL A;  3VR2 A;  2BA0 A;  3A8J E;  1F9S A;  3JAM L;  3D4R A;  2M2L A;  2O4X A;  4FF4 A;  4Q0F A;  1BO0 A;  3RUZ A;  3ZJY C;  4OIK A;  4WRD A;  1KAW A;  2D62 A;  2F0M A;  5D3I B;  1B2T A;  3I55 A;  3CCJ A;  5EPL A;  4ME5 A;  4CDE C;  1NSN S;  4MN3 A;  1IL2 A;  2VQE L;  2IL8 A;  2Y0S G;  2JA5 H;  3HOX B;  1X3Q A;  1OTC A;  2NVX H;  4KKU A;  2R92 H;  1PRT C;  4DFA A;  1X56 A;  2F0T A;  2WAC A;  1JCK B;  2J0T D;  5DM6 3;  1G6Z A;  4GZY C;  4JI5 L;  2K75 A;  4HCS A;  2A6E D;  2Z4H A;  3PGZ A;  1N34 Q;  3W5O A;  5BN4 A;  1X3G A;  2F4V Q;  3I90 A;  1UUP A;  4DR2 Q;  4X66 L;  1NTG A;  3KF8 A;  3AQQ A;  1I4G A;  3D4D A;  3A0J A;  3TN2 A;  4B3T Q;  2XSC A;  1X6O A;  3R8B A;  1ENF A;  1VCI A;  4RGO S;  4JI1 L;  4DR5 L;  1HTP A;  2JA8 H;  2B3G A;  3VR4 A;  4F87 A;  4UPA A;  2AQ1 B;  4JV5 L;  2A69 C;  4Z9C B;  3FPU B;  3T53 B;  3I4M H;  2I5M X;  4POF A;  4ZUJ A;  3M7N A;  1TWG B;  4GLA C;  2Z1C A;  3L2P A;  4PQX A;  1W2B A;  2WAQ B;  5EGT A;  1J6Q A;  3ULJ A;  3M4Q A;  4UY8 C;  1X3E A;  4XDX A;  2CQO A;  3F2C A;  3I72 A;  1YVC A;  1T5X D;  4RH6 A;  5DLQ E;  3L3O C;  1HZA A;  4KHV A;  1EQT A;  2F0G A;  4APV A;  5IWA L;  4A3F B;  3PF5 A;  1Q3L A;  4DAY B;  1EQV A;  1VQD A;  3CKI B;  1HNW Q;  1DD2 A;  2C9O A;  1TWH B;  5E4X A;  2PQE A;  4JCV E;  5FKA C;  4XT3 B;  3A5Z B;  4ZAI A;  1ICW A;  2EPB A;  1JOR A;  1V1P A;  1TY2 A;  1Y1W B;  3K7A H;  3S2D B;  3HKZ G;  5NUC A;  2HCI A;  1J5E L;  1WTP A;  5KIX A;  3NQI A;  3I3C A;  5M5X H;  5IGB A;  3CMA A;  1EQQ A;  2HHH L;  3TME A;  3MEH A;  4IUR A;  3M4Y A;  4KJN A;  1KXL A;  3F8T A;  3W1G A;  3TS0 A;  1IBK L;  2K28 A;  4JVZ A;  4JOI C;  1W6J A;  1XNQ L;  1C7Y A;  3GV6 A;  2VXW A;  4BA1 I;  1HNZ L;  5D3D A;  4NW2 A;  2K05 A;  2VQE Q;  2QIL A;  2AMC B;  3M3Y B;  4A3B B;  5CYU A;  2H1E A;  3SGI A;  4GLX A;  1OXU A;  4YHH L;  4HMI A;  1DCZ A;  5FLM G;  1ZYR C;  3HOU H;  4B3M L;  1GVP A;  1CKN B;  4JI5 Q;  1PTO H;  3KFU A;  2WB1 G;  1N9W A;  2N8N A;  4RKB A;  1SYB A;  1YHQ A;  3SK5 A;  3OMG A;  1EOT A;  1SYG A;  4X66 Q;  4AQY L;  3H0G H;  2UXC L;  4YWK A;  4AYB B;  1EY0 A;  3S16 H;  2DY7 A;  4DU9 A;  3G4S A;  1K83 H;  4JI1 Q;  4OL7 A;  5EBC A;  1S5C D;  1F77 A;  1TWC H;  2CVR A;  1WCM B;  2XN9 C;  4JV5 Q;  4C3H G;  3PUY A;  4LW1 A;  1Q1B A;  2SEB D;  3E0J A;  1QCB D;  5IT9 L;  3STB C;  3A8I E;  2B2V C;  2JA7 H;  3UE1 A;  1VQP A;  3RZO H;  1UNS A;  4POG A;  1S40 A;  2B2Y C;  1A8V A;  2F0F A;  4DAV A;  4XTC S;  3J7Z C;  1MJC A;  5ELB A;  3KK7 A;  2KEE A;  3GV3 A;  5JAV A;  3DWA A;  1PRT D;  4A76 A;  4DN4 M;  4H0L C;  5LHY 1;  1I4P A;  1RKN A;  1I3Q H;  4RHR A;  1PFN A;  3RLN A;  3VA7 A;  4X64 Q;  1B4O A;  5CV8 A;  4CBV A;  1A0I A;  3GTL H;  5M3M G;  4OGQ C;  4GN5 A;  1PFB A;  1XMO Q;  4RGT A;  4FNF A;  1GM5 A;  4R4I A;  4R4C A;  3P75 A;  2HT1 A;  3NBH A;  2HHH Q;  5IYC H;  4LNQ A;  4HTH A;  1SDF A;  1AE3 A;  5CGK A;  2X6L A;  5J3B A;  3B6Y A;  2JA9 A;  4P72 A;  1HFN A;  1B3A A;  2A69 D;  1OO9 B;  3CC2 A;  5EPJ A;  3A54 A;  4L63 B;  2KA7 A;  2R93 H;  4A93 H;  2IX1 A;  1H9S B;  4LWC A;  4EGV A;  2D5D A;  3D3R A;  1ET9 A;  1SMY C;  2FJ2 A;  2HIX A;  4DV4 L;  1M1K C;  3KDF B;  4NXM L;  4B08 A;  2NZO A;  3OIP A;  1BR9 A;  4A3D H;  4YHH Q;  1IW7 C;  1VMP A;  1B70 B;  3QG1 A;  1R9T B;  3HOY G;  3K5O A;  1G2S A;  1RF2 D;  1G2T A;  1MI2 A;  2HQE A;  3CCR A;  5KYL A;  1IYU A;  4KI0 A;  4JI2 Q;  1E2W A;  1EYA A;  4AQY Q;  4IOC A;  3GTQ B;  2Z6K C;  2UXC Q;  5HUR A;  1IYV A;  4X62 L;  3VDY A;  4A3I G;  5CV4 A;  2Z9H A;  1VQ5 A;  1SND A;  2YV5 A;  2V4D A;  3Q8D A;  1Q86 C;  1I4R A;  3I56 A;  1I94 L;  4IN3 A;  1C9O A;  5FLX E;  1AN8 A;  4BBR G;  2VUM B;  1BBU A;  3K8A A;  1EIF A;  3C2P A;  3NK9 A;  3BVM A;  4JI4 L;  4CHT B;  5C3E G;  4JI3 L;  1IKM A;  1EUJ A;  3GO5 A;  2F3W A;  3K5M A;  3RN2 A;  1XXG A;  4A3C H;  1E0B A;  1VQF A;  3S9W A;  1V9P A;  3IRB A;  4QMG A;  4OON A;  1S3O A;  4FF1 A;  3CP0 A;  2F0V A;  2DUD A;  3I7F A;  1A63 A;  1PYW D;  1LTS D;  2N78 A;  5KND A;  4GOP B;  2E75 C;  4DR3 Q;  3P20 A;  1VQL A;  1KDB A;  2PZU A;  1E24 A;  1A15 A;  1HUM A;  2L5T A;  1WTQ A;  3GTP B;  3FKI H;  4MTK A;  3GTK B;  4LF5 L;  3SK8 A;  1K73 C;  4MHE A;  5I9O A;  3GTJ H;  2PMZ E;  4JG2 A;  4CJ2 C;  4GKJ L;  1WTH A;  1QUQ B;  1VQG A;  1PV4 A;  1GXD C;  4DAY A;  1N8R C;  1EWI A;  4JPB W;  4NDX A;  1CTM A;  5KEE A;  2EYL A;  2ASB A;  4X6A H;  3U9S A;  3P7J A;  1O7Y A;  1PH3 A;  1MIU A;  1PXU A;  1CKM A;  5A2Q E;  1XWE A;  1HR0 L;  1EU4 A;  2JA6 B;  2MO0 A;  1KDC A;  2PNH A;  3ERQ A;  1KTK A;  3ITP A;  1N36 L;  3KJP A;  4DR4 Q;  2F4I A;  2MGS A;  4YWM A;  1K3R A;  1T5E A;  1XPR A;  1VQC A;  4P75 A;  2IX0 A;  3HOX H;  3F2D A;  5LL6 X;  3STB D;  5JEA J;  2EXD A;  1LV9 A;  4A3K B;  3QJY A;  4B9X A;  1J9O A;  3CPW A;  1CSP A;  2L0C A;  2I0Q A;  1ILQ A;  1K0S A;  1CI3 M;  1MSH A;  4DV4 Q;  1WTV A;  4NXM Q;  3RNU A;  4R4T A;  1Y8O B;  3PIP A;  1K8O A;  1YHA A;  1LUZ A;  2OCE A;  5C0X J;  1XTD A;  1G29 1;  3OWF A;  1EZ8 A;  1HZC A;  1IBL L;  4L5S A;  1CZW A;  5E1F A;  4IFD I;  1O78 A;  1C8C A;  1NR2 A;  1GUW A;  5CMD A;  2WKD A;  1BDO A;  1CKN A;  3SDZ A;  4BBS G;  4LF6 L;  5J1Z A;  1PMR A;  1X3F A;  2F03 A;  2ZJQ A;  1A2T A;  4DK1 A;  2E74 C;  1BBX C;  1TWG H;  1ZXT A;  4NXN L;  4RG1 A;  2CWP A;  3HZX A;  4V19 0;  1LAC A;  5CV5 A;  2EDG A;  4L5R C;  3CW2 C;  4JI4 Q;  1Q8K A;  4JI3 Q;  1BXT A;  2F3I A;  3EA6 A;  3MXU A;  1S5D D;  5FJ8 H;  5AJ3 L;  4M1U B;  2WFW A;  1HQM C;  4YY3 L;  3BS1 A;  3EFX D;  2EJF C;  2QCP X;  4A3F H;  1F2Z A;  4H13 C;  2EZV A;  1SMY D;  1TWH H;  1A6X A;  3T1Y L;  5DM7 3;  1Q81 C;  1E7Z A;  1TQO A;  3M9B A;  3EIV A;  2EJG C;  4LF5 Q;  1F9P A;  3C46 A;  3HRZ C;  4YCU A;  3J7A F;  4J15 A;  3S2D H;  1Y1W H;  3NQT A;  4GKJ Q;  5C0X I;  1K8G A;  1SR3 A;  4BXX G;  1Z47 A;  3PO3 B;  1DOL A;  2LXJ A;  5GAG C;  3U4Z A;  1Y8P B;  4RFB A;  1D5M C;  5GAD C;  4FXD A;  2XGT A;  4EX5 A;  4OWT B;  4H02 A;  1HR0 Q;  1TII D;  1NNX A;  1HXY D;  2K01 A;  5JJK A;  4A3G G;  2B8F A;  5LMN Q;  3I70 A;  5GQO A;  1N36 Q;  1QZG A;  2OEO A;  2F0Q A;  2WIN B;  2ZXP A;  3M3Y H;  2F0S A;  1VQ9 A;  1ROD A;  5IP7 H;  4A3B H;  2R7F A;  1XPO A;  2SNS A;  3DEO A;  1NR4 A;  3H3V I;  3RZD B;  2JE6 I;  3TQY A;  2JYO A;  2YU9 B;  1VQE A;  3C1E A;  3F1Z A;  2LMC B;  3PQI A;  4YCW A;  5EKK A;  4O2D A;  3PMF A;  5G3L F;  1FL0 A;  4UP7 A;  3PF4 A;  1IBL Q;  4X3K A;  3TP8 A;  1HA5 A;  1CQV A;  2RSO A;  5ELN A;  1FD7 D;  2AHO B;  3MA2 B;  1STG A;  1CUK A;  1WCM H;  2O5I C;  2F0L A;  1AZQ A;  2Z8L A;  1AE2 A;  3K5N A;  4NXN Q;  2G9D A;  4BY1 G;  4ZYS A;  3OOC A;  4A3M G;  3HGB A;  1QWY A;  2KOL A;  3NWS A;  4A93 B;  1W6K A;  2JJQ A;  1PVO A;  5AJ3 Q;  3KLW A;  2DNC A;  4XIG S;  4YY3 Q;  1PTO C;  2OT2 A;  1JR0 D;  3NWT A;  4L6T B;  1U0L A;  2Q2I A;  1LAB A;  1EY7 A;  3L9A X;  1EY6 A;  1M8A A;  4K5V A;  4HJA A;  5IOD A;  4DR6 Q;  3T1Y Q;  1SEB D;  4IJL A;  1A3V A;  3V2T A;  3I4N G;  4YWL A;  1FGU A;  1YNN D;  1Z9F A;  1F2Y A;  3MXN B;  4HJ8 A;  4OX9 L;  3GDE A;  1K8A C;  1Z6H A;  3IAY A;  2MJ8 A;  2I46 A;  3D0F A;  1NAP A;  4C3J B;  4L8J A;  5C4Z A;  5GAE C;  1HPC A;  4IUP A;  1GO3 E;  1CA6 A;  5ELF A;  2K1B A;  1JJC B;  1TWF B;  4CKB A;  1JJ2 A;  3A7L A;  3MZ5 A;  4K2K A;  4LUZ A;  1QUQ A;  2B2T A;  3KF6 B;  4PG3 A;  3NUC A;  3QR8 A;  1NJI C;  1NCV A;  2UU9 Q;  3CXC A;  3M85 A;  4PNY A;  5F2D A;  2IHF A;  1Y69 U;  4YCV A;  3I4O A;  1F9Q A;  2IY5 B;  2ZJR A;  2H5X A;  1R9T H;  2WV6 D;  1EIG A;  4R4Q A;  4OO1 H;  2E2H B;  3HOV G;  4A3J G;  1I4Q A;  5EPK A;  3DXJ C;  2E5L Q;  4A3E B;  2QA4 A;  3J7A 5;  2TSS A;  1WFQ A;  1JC7 A;  1X3P A;  4EVO A;  2XWJ B;  1CHP D;  2KEN A;  2JXM B;  3GTQ H;  3TRZ A;  1RTN A;  3KBX A;  3S24 A;  1HH2 P;  4IFD H;  1PZK D;  1KRS A;  1LTA D;  2K32 A;  3CC7 A;  2JSO A;  1Y1V G;  4XYQ A;  5IE8 A;  5CBE E;  2VUM H;  3ERO A;  4I65 A;  2RHS B;  2CH4 A;  3J81 c;  3T4A C;  2Q8T A;  3KLR A;  1N32 L;  2QDL A;  1U4R A;  4IUQ A;  2AWO A;  1LTI D;  4LK1 C;  2IX3 A;  3HOZ G;  3T51 B;  4C3I B;  1WOC A;  3PO2 G;  1FNV A;  2A6H C;  4ZCK A;  1XYI A;  1H9K A;  2NN6 G;  1PH5 A;  2ZM6 L;  4RMF A;  5DEH A;  3F2B A;  3JC6 6;  1V1O A;  2EY1 A;  4DR7 L;  1SE8 A;  5EJW A;  5M9O A;  2JEA I;  1AP0 A;  3Q22 A;  4ZUI A;  3GTP H;  2X69 A;  3GTK H;  4QIW E;  2L12 A;  1I6V C;  1EEF D;  3BZK A;  1E1T A;  3M4O B;  3H15 A;  3FP9 A;  4OX9 Q; 
#chains in the Genus database with same CATH homology
 2MO1 A;  5LMN L;  3S1N H;  2UXD L;  1SN8 A;  4DKA C;  1BVS A;  5M3F G;  1PH7 A;  5FLM H;  3S17 H;  1VQA A;  1IYJ B;  4A3D G;  4A76 A;  1H95 A;  1VQK A;  4X65 L;  4AYB E;  1M90 C;  1Y1V H;  2VZA A;  1I3Q H;  1OXS C;  3DLL A;  4DR1 L;  3RLN A;  1EOV A;  4X64 Q;  1PYS B;  2KHI A;  3PUW A;  2JA6 H;  3TRE A;  1SFO H;  4JYA Q;  1G51 A;  1NE3 A;  5M5W H;  1A0I A;  1LYL A;  3PUV A;  1TXY A;  2R7D A;  3GTL H;  5M3M G;  1SLJ A;  4GN5 A;  3S14 H;  3HOZ H;  1XMO Q;  2MFI A;  1KD1 C;  4QJF A;  2VQF L;  1GM5 A;  1JB7 A;  3PO2 H;  5JJL A;  1SRU A;  4QGU A;  4JI6 L;  4OO1 I;  4R4I A;  3CCL A;  2BH2 A;  3BJU A;  4R4C A;  4A3K H;  3CC4 A;  4GKK L;  2HT1 A;  2A1A A;  2Q2H A;  4GNX B;  1I6H H;  2HHH Q;  5IYC H;  4LNQ A;  1YBY A;  1AE3 A;  4C3H H;  3JAM i;  3MEF A;  5J3B A;  4B3R Q;  3B6Y A;  4DV7 L;  1BKB A;  2JA9 A;  1U5K A;  4P72 A;  4UP9 A;  1P16 A;  4UP8 A;  1Q82 C;  1W3S A;  2HIV A;  3CF5 A;  3CC2 A;  3PV0 A;  1LM0 A;  4GOP A;  3CCS A;  4GOP C;  1PA6 A;  2R93 H;  2ALY B;  2CWA A;  4P74 A;  4JI8 L;  4JI0 L;  4JC0 A;  1B8A A;  4LWC A;  4HIK A;  2IX1 A;  3S1Q H;  4A3C G;  2Y0S E;  3KYH C;  3L7Z C;  4LFC L;  3M4P A;  4IO9 A;  1NMF A;  2HIX A;  4JBW A;  4DV4 L;  1M1K C;  3KDF B;  4NXM L;  1VQI A;  1P8L A;  2NZO A;  3E9H A;  1YIT A;  5ELO A;  3PO3 G;  5M3F H;  4HIO A;  1YJW A;  4A3D H;  2VNU D;  4YHH Q;  4DV6 L;  3OTO Q;  2UXB L;  2R6G A;  1B70 B;  4B3S Q;  3HOY G;  4IPC A;  3G71 A;  2LSS A;  4WJ4 A;  1FJG Q;  3JAM c;  2IHE A;  2FXQ A;  3FKI G;  3CCM A;  3CCR A;  3NEL A;  4KI0 A;  4JI2 Q;  3UDI A;  5FLX c;  4AQY Q;  1X55 A;  4IOC A;  1N32 Q;  2Z6K A;  5M3M H;  2Z6K C;  2UXC Q;  1CSQ A;  4X62 L;  3VDY A;  4A3I G;  1VQ5 A;  2L15 A;  3PUZ A;  2YV5 A;  3E9I A;  4DR6 L;  3Q8D A;  1Q86 C;  3I56 A;  1NBW A;  3CCU A;  1I94 L;  1C9O A;  2IT1 A;  4R1J A;  5LMU Q;  1QVG A;  2QEX A;  1O7I A;  3L0O A;  4QY7 A;  2VS1 A;  2ZM6 Q;  4BBR G;  3S1R H;  1BBU A;  1HZ9 A;  1VQJ A;  3K8A A;  5HY6 A;  2UUB Q;  5LMN W;  1EIF A;  1VQ7 A;  4DV1 L;  1EIY B;  4JI4 L;  4HJ9 A;  4DV0 L;  1HNW L;  1JE5 A;  5C3E G;  3U58 A;  4JI3 L;  1L1O A;  1EUJ A;  3GO5 A;  1L1O C;  4O0A A;  4IPH A;  1IBM L;  2OTL A;  4LF4 Q;  3RN2 A;  4A93 H;  3HOX G;  1AH9 A;  1PH8 A;  4A3C H;  1VQF A;  1XMQ Q;  1V9P A;  3IRB A;  2VY3 A;  4OON A;  1S3O A;  1LTL A;  4DUZ L;  3CP0 A;  4LF8 L;  3CQZ H;  2DUD A;  3EN2 A;  3I7F A;  2K50 A;  1K9M C;  1A63 A;  3PO3 H;  3HFZ B;  1MJE A;  4Y52 H;  2N78 A;  4GOP B;  4DV3 L;  2BH8 A;  3HOY H;  4DR5 Q;  4IOA A;  5IYD G;  5C4J H;  4X65 Q;  4DR3 Q;  2R7Z G;  1VQL A;  4BA2 I;  2Q2U A;  4WJ3 M;  4HID A;  4LFA L;  1E24 A;  1PH1 A;  1KQS A;  4OWX B;  2UU9 L;  4DV2 L;  4DR1 Q;  3FKI H;  2CFM A;  1N33 Q;  4LUO A;  4K0K L;  4PZ8 A;  2EQS A;  4LF5 L;  4LF7 L;  1XJV A;  3RLO A;  4IJH A;  1K73 C;  3GD7 A;  1YJN A;  3GTJ H;  1WJJ A;  2PMZ E;  4JG2 A;  4GKJ L;  2GVB A;  2ZTD A;  4DK3 C;  3ER0 A;  3OYY A;  4DAM A;  1Q46 A;  1IXR A;  2N49 A;  4DUY L;  4LUV A;  4A3I H;  1Q7Y C;  1QUQ B;  1VQG A;  5C44 G;  1PV4 A;  3K7U C;  1SMX A;  3HKZ E;  2NZH A;  2VQF Q;  5IYB G;  1N8R C;  1EWI A;  1KC8 C;  3CD6 A;  3K0X A;  4JI6 Q;  2K14 A;  3UE0 A;  2E5L L;  2ASB A;  4GKK Q;  4X6A H;  3G6E A;  2C35 B;  1PH3 A;  3RZD H;  1MIU A;  4AIM A;  1CKM A;  4BBR H;  4DNI A;  1HR0 L;  4JI7 L;  4P73 A;  5IWA Q;  2YU9 H;  1PYB A;  3GTG H;  4BY7 G;  3BZC A;  2MO0 A;  2RHQ B;  2PNH A;  4DV7 Q;  1N36 L;  1XNR L;  3KJP A;  1EFW A;  4DR4 Q;  5C4X G;  2WAQ G;  5C3E H;  4YWM A;  1I5F A;  1K3R A;  1XPR A;  1VQC A;  4GS3 A;  1KL9 A;  2IX0 A;  4MTN A;  4P75 A;  3HOX H;  3F2D A;  1QZH A;  3HOW G;  3STB D;  5JEA J;  2EXD A;  4JI8 Q;  1CKO A;  3KF6 A;  5FJ8 G;  4JI0 Q;  2NVT H;  1VS0 A;  1KIX A;  3CPW A;  1CSP A;  2I0Q A;  1C0A A;  2A19 A;  4LFC Q;  4A3F G;  4DV4 Q;  3K80 C;  1JMC A;  4NXM Q;  1YHB A;  3RNU A;  1B7Y B;  5E7N A;  1UE6 A;  4NPS A;  4R4T A;  3OW2 A;  1J5E Q;  3KJO A;  1QVC A;  4DV6 Q;  3T1H L;  5IYD H;  1OXT A;  1E1O A;  2R7Z H;  2OTJ A;  4KHZ A;  3J80 i;  4P71 A;  3PIP A;  1PH4 A;  1NMG A;  1YHA A;  3GTO H;  1LUZ A;  3G48 A;  3H3V H;  2EIF A;  2OCE A;  4HJ5 A;  2WB1 E;  2ZTE A;  2HQL A;  4C2M H;  5C0X J;  1YJ9 A;  1XTD A;  1A62 A;  1G29 1;  4A4I A;  1Y1W G;  3AYH B;  3ICE A;  1HZC A;  1IBL L;  5EAY A;  2E2J H;  1IBK Q;  2YTV A;  4A3L G;  1HNX L;  4L5S A;  5C44 H;  1XNQ Q;  3S1M H;  4IFD I;  3UDF A;  1Q12 A;  1VQH A;  1HNZ Q;  5IYB H;  1N34 L;  3NEM A;  3LGJ A;  3DM3 A;  2NVY H;  2F4V L;  2YTX A;  5IP9 G;  2ZJP A;  4KLK A;  1CKN A;  4DR2 L;  4BBS G;  4LF6 L;  4L5T A;  1KRT A;  2PI2 A;  1X3F A;  2ZJQ A;  4BY7 H;  1TWG H;  4B3T L;  4NXN L;  2B63 G;  4RG1 A;  2CWP A;  3PIO A;  3RR5 A;  5C4X H;  3J80 c;  4DV1 Q;  3NEN A;  4L5R C;  3CW2 C;  4JI4 Q;  1Q8K A;  2Z0S A;  4DV0 Q;  4TVA B;  4B3M Q;  4JI3 Q;  4A3E G;  2F3I A;  3HOW H;  1IBM Q;  3CCQ A;  5FJ8 H;  5AJ3 L;  5IP7 G;  4GN3 B;  4A3B G;  1RIP A;  1T9H A;  2WFW A;  4X64 L;  4YY3 L;  5HGQ A;  2KCM A;  4DUZ Q;  4A3F H;  1VQ8 A;  2I5L X;  1X54 A;  4NB3 A;  1K0R A;  1TWH H;  1XMO L;  4ME3 A;  1JT8 A;  3T1Y L;  1HJP A;  4DV3 Q;  2QGQ A;  3CCE A;  4C3J H;  1Q81 C;  1E7Z A;  1IZ6 A;  3M9B A;  2JA5 G;  3EIV A;  3CME A;  4OWW B;  4K0K Q;  4DV2 Q;  2AKW B;  2PQA A;  1X9N A;  2I5H A;  1HR0 W;  4LF5 Q;  4YCU A;  4LF7 Q;  1PH6 A;  5BR8 L;  4J15 A;  2R92 G;  3S2D H;  1Y1W H;  4A3L H;  1TWF H;  2K5V A;  2Q2T A;  4GKJ Q;  4B3R L;  5C0X I;  1K8G A;  4AYB G;  1KHI A;  1SR3 A;  3PCO B;  4BXX G;  1Z47 A;  2DGY A;  4DR7 Q;  2LXJ A;  2YTY A;  1UE1 A;  5GAG C;  3J81 i;  4ALP A;  1ASZ A;  3U4Z A;  1E22 A;  5K36 G;  1OXX K;  1X65 A;  3NBH B;  5IP9 H;  1V43 A;  5IT9 c;  1DGS A;  4DV5 L;  1YI2 A;  5GAD C;  1WCM G;  4BBS H;  2XGT A;  4TQU S;  4EX5 A;  3TS2 A;  4OWT B;  1YZ6 A;  4H02 A;  1HR0 Q;  4JI7 Q;  2KCT A;  3ERS X;  1PH9 A;  2B63 H;  4A3G G;  2JEB I;  3PSI A;  3D31 A;  5LMN Q;  2BA0 A;  2UXD Q;  1L0W A;  5GQO A;  1N36 Q;  2E2H H;  1XNR Q;  1QZG A;  3OTO L;  4A3E H;  1QVF A;  1VQN A;  2KHJ A;  2UUC L;  2JA8 G;  3M3Y H;  3U4V A;  1VQ9 A;  2NN6 I;  5IP7 H;  2K5N A;  4A3B H;  3ZJY C;  2GN5 A;  1Y14 B;  2R7F A;  1XPO A;  3H3V I;  1VQB A;  4Y7N H;  2JE6 I;  1KAW A;  2D62 A;  3TQY A;  4GNX A;  1NY4 A;  4GNX C;  1ASY A;  2CCZ A;  4JI2 L;  1V1Q A;  3I55 A;  3PUX A;  3CCJ A;  1UE7 A;  3I4M G;  4PMW A;  2WP8 J;  1VQE A;  3F1Z A;  1RL2 A;  3RLF A;  2N3S A;  1PHJ A;  4KHP L;  2RCN A;  1IL2 A;  3T1H Q;  4YCW A;  3UDG A;  1OXV A;  2BA1 A;  2Y0S G;  4JBJ A;  5GRO A;  5H1S E;  2LXK A;  3BU2 A;  4O2D A;  2VQE L;  1VQ4 A;  2ES2 A;  2JA5 H;  4LF9 L;  1D8L A;  1OTC A;  3W1B A;  2MQH A;  2NVX H;  2RF4 A;  2ATW A;  2R92 H;  1FL0 A;  4UP7 A;  1X56 A;  3PF4 A;  1IBL Q;  3K81 C;  2UUA L;  4BXX H;  4C3I H;  5M5Y H;  2JK8 A;  1EYG A;  1YIJ A;  5ELN A;  4JI5 L;  2K75 A;  1N34 Q;  3AEV A;  1YNX A;  3PGZ A;  3W5O A;  3EBE A;  1X3G A;  2AHO B;  4JBM A;  2F4V Q;  5JJI A;  1CUK A;  1WCM H;  1BBW A;  4DR2 Q;  2ZTC A;  1XMQ L;  4HIM A;  4X66 L;  1NTG A;  3AQQ A;  2D0O A;  1AE2 A;  4A3G H;  3A0J A;  4B3T Q;  4NXN Q;  3A5U A;  1L1O B;  1X6O A;  2UXB Q;  4BY1 G;  4A3M G;  1VCI A;  4DR5 L;  4JI1 L;  2JA8 H;  4DR3 L;  2B3G A;  4UPA A;  1L2F A;  2JJQ A;  1N33 L;  1PVO A;  5AJ3 Q;  3KLW A;  1D7Q A;  4XIG S;  3M4O H;  4YY3 Q;  4JV5 L;  3CCV A;  3I4M H;  2I5M X;  4POF A;  1U0L A;  2Q2I A;  4GLA C;  3M7N A;  4X62 Q;  3L2P A;  4HJA A;  4LFB L;  1W2B A;  4A75 A;  4DR6 Q;  1J6Q A;  3ULJ A;  3M4Q A;  3T1Y Q;  1I94 Q;  4IJL A;  4UY8 C;  4OO1 G;  1UEB A;  1X3E A;  2CQO A;  3F2C A;  2OQ0 A;  4JBK A;  1GKH A;  1YVC A;  3I4N G;  5DLQ E;  1HZA A;  4IPG A;  4YWL A;  1FGU A;  1YEZ A;  4DPG A;  1Z9F A;  5BR8 Q;  3MXN B;  2ID0 A;  2VL6 A;  4MZ9 A;  4APV A;  1FVI A;  5IWA L;  4HJ8 A;  3ULL A;  2AWN A;  3GDE A;  1K8A C;  1MKH A;  3PF5 A;  4OX9 L;  4DAY B;  1VQD A;  4IFD G;  3AFQ A;  1HNW Q;  4DR4 L;  4OXP A;  3HOU G;  3D0F A;  5GAE C;  2MNA A;  4JCV E;  1GO3 E;  3FHW A;  4DV5 Q;  1G6P A;  2VUM G;  1TWA H;  4LF8 Q;  4JYA L;  3CAM A;  3A5Z B;  4HJ7 A;  1WI5 A;  3H0G G;  3K7A H;  3HKZ G;  1JJC B;  2D0P A;  1JJ2 A;  2K5H A;  3S15 H;  2V1C C;  1J5E L;  4BY1 H;  4PZ7 A;  3KOJ A;  3WWV A;  4A3M H;  4LUZ A;  1QUQ A;  1VQ6 A;  2OQK A;  1EQR A;  3KF6 B;  2WAQ E;  4PG3 A;  4LFA Q;  5M5X H;  2UUC Q;  3CMA A;  1EQQ A;  1NJI C;  2UU9 Q;  3CXC A;  2OWO A;  3U50 C;  3M85 A;  4EQ5 A;  2HHH L;  2IHF A;  3KF8 B;  4GN4 B;  4YCV A;  3I4O A;  5JEA G;  4QL5 A;  1KXL A;  2IY5 B;  4DUY Q;  2ZJR A;  3F8T A;  3W1G A;  3TS0 A;  1UWV A;  1IBK L;  2K4K A;  4JOI A;  4JOI C;  2H5X A;  1R9T H;  1XNQ L;  4R4Q A;  1C7Y A;  4KHP Q;  3HOV G;  4BA1 I;  1HNZ L;  4A3J G;  2JA7 G;  2VQE Q;  3GTM H;  2E5L Q;  3J7A 5;  2QA4 A;  2AMC B;  1S72 A;  4LF9 Q;  1WFQ A;  3ULP A;  3I4N H;  4FDB A;  4L5Q A;  1VQM A;  2KEN A;  3GTQ H;  3TRZ A;  3S24 A;  3SGI A;  3CPF A;  1HH2 P;  5C0X G;  4GLX A;  2UUA Q;  1OXU A;  4YHH L;  2JQO A;  4B3S L;  5FLM G;  1KRS A;  2YYZ A;  3HOU H;  2B29 A;  3CC7 A;  1GVP A;  3RN5 A;  4B3M L;  1CKN B;  4JI5 Q;  3KFU A;  1FJG L;  1Y1V G;  1N9W A;  2WB1 G;  5GAH C;  5IE8 A;  2KBN A;  2N8N A;  5JJK A;  3TEH B;  4R4O A;  1SRO A;  1YHQ A;  2VUM H;  2F52 A;  4DK6 C;  2JA6 G;  2RHS B;  4X66 Q;  3J81 c;  4AQY L;  2CKZ B;  2VW9 A;  1N32 L;  2K52 A;  2E8G A;  3H0G H;  3I2Z A;  1GD7 A;  4IPD A;  4YWK A;  2UXC L;  2AWO A;  1I50 H;  3HKS A;  3HOZ G;  3S16 H;  1WOC A;  3PO2 G;  3G4S A;  1WYD A;  1K83 H;  1HZB A;  4JI1 Q;  4A3K G;  1E3P A;  2NN6 G;  5LMU L;  1PH5 A;  1TWC H;  2ZM6 L;  4MNO A;  1UE5 A;  5IY0 A;  1Q1E A;  4RMF A;  5IYC G;  4QQB X;  4JV5 Q;  3PUY A;  4GLV B;  4LW1 A;  2UUB L;  2XTI A;  3F2B A;  1Q1B A;  4IFD J;  1HNX Q;  3E0E A;  3KDF A;  2NVQ H;  3JC6 6;  2A8V A;  4LFB Q;  3STB C;  4DR7 L;  3HOV H;  1SE8 A;  1VQO A;  4A3J H;  1PH2 A;  4LF4 L;  2JEA I;  2JA7 H;  3GTP H;  2PQA B;  3UE1 A;  1XPU A;  1VQP A;  2R93 G;  3UDX A;  1PFS A;  3GTK H;  4QIW E;  3RZO H;  4A93 G;  3J81 j;  3BZK A;  4LF6 Q;  4POG A;  1S40 A;  3AFP A;  1JJG A;  1A8V A;  1E1T A;  2PI2 E;  2GVA A;  4XTC S;  3A74 A;  3J7Z C;  2E2I H;  1MJC A;  4AH6 A;  3H15 A;  3S2H H;  3FP9 A;  4PZ6 A;  4OX9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...