2LSSA

Solution structure of the r. rickettsii cold shock-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
MATNIVGKVKWYNSTKNFGFIEQDNGGKDVFVHKSAVDAAGLHSLEEGQDVIFDLEEKQGKAYAVNLRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock-like protein
publication title Solution structure of the cold-shock-like protein from Rickettsia rickettsii.
pubmed doi rcsb
source organism Rickettsia rickettsii
molecule tags Rna binding protein, dna binding protein
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lssA00
2NZHA 1Z9FA 2ATWA 3TRZA 1OXUA 4JI8Q 1EIFA 4GLVB 4C3JH 1MJEA 4KHPQ 1FVIA 2VL6A 4MZ9A 4DR5L 1PH5A 3L2PA 3PGZA 1GM5A 4HIMA 2VNUD 2E8GA 4H02A 4DV1Q 5IWAQ 5IYCH 3HOVH 1GD7A 4O0AA 3M9BA 3I4OA 4HIDA 2VUMH 3I7FA 5J3BA 1GKHA 1EUJA 2UXDL 1VQHA 1IBKL 1V43A 1YJNA 2H5XA 1OTCA 4B3TQ 1Y1VG 1I3QH 2E2HH 1N8RC 3PSIA 3RN2A 1VQIA 1K73C 1HZ9A 1E22A 3H0GH 2WB1G 2BA0A 3RZOH 1E1OA 2IHEA 1S40A 4GKKQ 1EWIA 1Q81C 1WJJA 1UE1A 4A93G 3ERSX 2I5LX 4A76A 2RHSB 3A74A 3W5OA 2R7DA 3JC66 4NXNL 3JAMc 1TWAH 1U5KA 4X65L 3I4MH 3U58A 1Q1EA 4PZ7A 4DV0L 4GOPC 1VQFA 3HOZH 4KHZA 4BBSG 4A3LH 1UE5A 2UU9L 3PO2H 3E9IA 4DR2L 4LF5L 1QVGA 5GQOA 3S15H 1SRUA 1WI5A 1XNQL 1SE8A 1CKMA 3A0JA 3U4ZA 2E2IH 2JA8G 2JA7G 2RF4A 1SMXA 4DR3L 4LF7Q 4AIMA 3OW2A 2UUBQ 1FL0A 1UE6A 3K7UC 3I56A 1RIPA 4C3HH 1I50H 5M5XH 1XPRA 3WWVA 1VQEA 2EQSA 4JI3L 5IP9H 3G6EA 2N3SA 1WFQA 3FP9A 4OX9L 2R7ZG 4EX5A 3RZDH 1KRSA 4LF6L 1VQ6A 4GNXC 2IX1A 4Y52H 3FKIG 4DR5Q 1J5EL 1PH4A 1FJGL 2IX0A 3BU2A 1NE3A 4A3CH 1Q46A 4HJ5A 4BY1H 3AFQA 4YWMA 5M5YH 4LNQA 1PH8A 2A19A 1VQ7A 1YHQA 2Y0SE 4QY7A 4A3MH 2JA5G 3PIPA 4BY7H 3JAMi 2PI2A 3GTLH 2R6GA 2R93H 1N32L 3G48A 1V1QA 2UXDQ 4JI1L 3F2BA 1L1OB 4DV2L 1IBKQ 1Q8KA 3M7NA 3MXNB 4ME3A 5M3MH 1BBWA 2JE6I 3SGIA 2YV5A 3OTOL 2K5HA 1WCMG 4X66L 4A3IG 2F4VL 4LFBL 4RG1A 2CWPA 4DKAC 1IXRA 2QEXA 4GN5A 4GNXA 1PH3A 3NENA 4OWWB 4AH6A 1JJGA 5LMNL 4X62L 2I5MX 2MFIA 1QUQA 2K14A 1X55A 2XGTA 1M90C 5GAHC 4NXNQ 1OXXK 1UE7A 4P75A 2Q2HA 3K81C 1TXYA 3HOXH 1HNZL 1Y1WG 3TREA 1KC8C 1VQMA 4DV0Q 5ELNA 4OO1I 2NN6G 4DK6C 4GKJL 2WAQE 1PH6A 3HOWH 2UU9Q 3B6YA 4A3GG 1TWGH 4DR2Q 1CKNA 2VY3A 4LF5Q 1PH9A 5C3EH 1XNQQ 3CD6A 3F2CA 2IT1A 5C4JH 3VDYA 3D31A 2CCZA 3AFPA 3HOUH 4IJHA 1A0IA 4LF8Q 2Z6KC 5IYDH 1K8AC 2AWNA 4DR3Q 1VQ5A 1JJCB 1NTGA 1K83H 1EYGA 1G291 2ZM6L 1IZ6A 2NVTH 3ULJA 1V9PA 4P71A 5C44G 4DPGA 3TS2A 3AEVA 4JI5L 4JI3Q 2B29A 3UDXA 4OX9Q 3BZKA 4DR6L 1L2FA 1W2BA 4LF6Q 3L7ZC 5C4XH 2N78A 1HR0W 1KRTA 4JBWA 1FJGQ 1JMCA 3CCVA 2Z6KA 1QVFA 3NBHB 4GLXA 2R92G 5GROA 5HGQA 1RL2A 2Q2IA 3KF6B 5IP7G 2EXDA 4LF9Q 4A3JG 2E2JH 2D62A 1UWVA 3W1GA 2KENA 2V1CC 4RMFA 2CQOA 3DLLA 4L5RC 4JI1Q 1N32Q 4DV2Q 1HZBA 1X56A 2OWOA 4AYBE 2MO0A 3OTOQ 4PZ6A 3RLOA 2NVQH 1E1TA 4OXPA 5M3FH 2HHHL 3DM3A 3HOYG 4X66Q 4DV3L 4HIKA 2F4VQ 4LFBQ 4LW1A 2ALYB 5BR8L 3CMAA 2DGYA 1L0WA 4A3KG 1HZCA 5LMNQ 4A3FG 5JJLA 1E24A 4X62Q 4BBRH 3STBD 2JA6H 2Q2UA 1R9TH 5IYBH 1TWCH 4X64Q 2OCEA 3CCJA 4GN3B 2N8NA 3PF4A 2PMZE 1N9WA 4WJ4A 3F8TA 1GVPA 1D7QA 3EN2A 1HNZQ 1Y1VH 4BXXG 1YEZA 4JCVE 1G6PA 3I4NH 1QZGA 4QL5A 4GKJQ 1I6HH 1B70B 4NXML 5K36G 1EFWA 3CCLA 3S1NH 3PF5A 4LFCL 2I5HA 3PUWA 4A3EG 4R4QA 1QZHA 2PQAB 2EIFA 4B3RL 2ZJPA 4UPAA 3H3VI 4L5TA 1PV4A 1W3SA 4MTNA 3UDIA 3BZCA 3HKZE 3EBEA 1OXSC 3J81j 1HNXL 4PMWA 4DV7L 3S1RH 1VQKA 3H3VH 4LFAL 4UP9A 2CKZB 4DNIA 2D0OA 2ZM6Q 1HH2P 2Z0SA 4JYAL 1NJIC 2VUMG 4BBSH 2HT1A 4DR1L 1AH9A 2VZAA 1M1KC 1UEBA 3T1YL 4JI5Q 3T1HL 1IBLL 4DK3C 4IPHA 3J7ZC 1PH7A 4DR7L 4DR6Q 1C9OA 2UXCL 3M4QA 5FLMH 4IFDG 3U4VA 3RN5A 2YTVA 3M3YH 4B3SL 1TWHH 4OWTB 2L15A 3H0GG 1PVOA 1KL9A 2N49A 2OTLA 5LMUL 4JC0A 4DUYL 1X65A 2CWAA 1VQPA 1CSPA 2BH2A 3RLFA 2AHOB 3IRBA 4KI0A 1MKHA 3CF5A 3J81c 2UUAQ 3S17H 3W1BA 4OONA 1SR3A 4GOPA 1XJVA 4B3ML 3GTOH 3I4MG 2NZOA 2K52A 3KOJA 3S1QH 4DV5L 4A75A 2HHHQ 4Y7NH 1PYSB 3FKIH 3HOZG 4DV3Q 2YU9H 3CW2C 2YTYA 1YHBA 2LSSA 5BR8Q 3AYHB 3NELA 5AJ3L 4LUOA 4P73A 4JBMA 4JOIC 1NBWA 4YWLA 4R4IA 1ASZA 1EQRA 1GO3E 2JA5H 1BVSA 3Q8DA 3MEFA 1ASYA 1VQ8A 3GTPH 2ZJQA 2LXJA 4QIWE 2YYZA 3F2DA 2A8VA 3TEHB 1Q12A 1WCMH 1L1OC 5IT9c 1X3EA 1TWFH 4A3IH 3J7A5 4K0KL 4NXMQ 1KIXA 3GTKH 3KJPA 2B63H 1O7IA 5IP9G 4LFCQ 3PCOB 2QGQA 4JI0L 5ELOA 4QGUA 2WP8J 3L0OA 2MNAA 4B3RQ 4JOIA 2R7FA 4JBJA 4DAMA 4DUZL 3I55A 4C3IH 1HNXQ 4R4CA 5M5WH 4DV7Q 3G4SA 4QJFA 4BY1G 1YITA 4A3DH 2RCNA 4LFAQ 5FJ8H 4X65Q 1Y1WH 4JYAQ 2KHJA 4BY7G 4IPGA 1JE5A 4A3BG 3J81i 4TVAB 4DR1Q 2R93G 3CC7A 5HY6A 1N34L 1T9HA 1L1OA 4AQYL 3T1YQ 1Y14B 2HQLA 1KHIA 3PUYA 4JI8L 3T1HQ 1B8AA 5M3MG 1AE3A 1LTLA 5C0XG 3G71A 3CC2A 4DR7Q 4KHPL 2UXCQ 1P16A 1BKBA 2DUDA 2LXKA 4HJ7A 1C7YA 2WB1E 4B3SQ 2GVBA 2ZTCA 4UP8A 3CAMA 1YBYA 4YWKA 1E7ZA 3M85A 4L5SA 1A62A 3S16H 3BJUA 2NVXH 1Q7YC 4HJ8A 2RHQB 5LMUQ 1S72A 5JJKA 4DUYQ 2OQ0A 3HFZB 4GN4B 1IBLQ 2JEAI 2I0QA 3CCRA 5GADC 3RLNA 2CFMA 4EQ5A 4B3MQ 4IPCA 3CPWA 4DV5Q 3UDGA 1I5FA 4C2MH 2F52A 4YHHL 2GN5A 4JI7L 3NEMA 1PH2A 1J5EQ 4OO1G 3STBC 3GTJH 3PO3G 1NY4A 2KHIA 2ASBA 4UP7A 1YJ9A 2QA4A 5IP7H 1VQAA 2VQEL 2XTIA 3KDFB 2K75A 1PHJA 1XNRL 3ER0A 3KJOA 1IYJB 2Q2TA 2UUCL 4LWCA 5DLQE 3CCQA 3GDEA 3M4OH 2JK8A 2K4KA 1XMOL 2NVYH 3U50C 4K0KQ 1VQDA 2OQKA 3LGJA 3PUZA 4JI2L 4JV5L 2IY5B 4A3KH 1QVCA 3TQYA 4DV6L 2KCTA 4HJAA 1SROA 4UY8C 4WJ3M 5H1SE 3M4PA 4P72A 4DUZQ 2PI2E 1PFSA 2Y0SG 3J80c 2E5LL 1P8LA 2VQFL 3KF8B 2K50A 5LMNW 1XMQL 4JBKA 1VQJA 3KF6A 1U0LA 1EQQA 1MJCA 2UXBL 3AQQA 3CCUA 1N34Q 4DAYB 4AQYQ 4A3EH 4LF4L 1YIJA 4KLKA 5JEAG 4YY3L 1SFOH 3H15A 4A93H 1KXLA 1K8GA 3CMEA 5M3FG 4IFDJ 1I94L 3PV0A 1X6OA 2ZTEA 3PUXA 1VQBA 3RR5A 2JEBI 4OWXB 3F1ZA 5GAEC 2JA6G 4BBRG 5IYCG 3HOVG 5IYBG 2VW9A 4YCUA 4HJ9A 4HIOA 1XTDA 3K7AH 4ALPA 1N36L 4IFDI 2WAQG 1MIUA 2AKWB 4YHHQ 4JI7Q 2JA8H 3I4NG 1B7YB 1JB7A 3K80C 2JA7H 1X3FA 5GAGC 5JJIA 4IPDA 3S2DH 1VQCA 4BA1I 5IY0A 1J6QA 2WFWA 4XIGS 2PQAA 3A5ZB 3E9HA 2JA9A 1HNWL 2VQEQ 1VQGA 3FHWA 2B3GA 4P74A 2GVAA 3J80i 1N33L 1XNRQ 1X54A 1K3RA 1JJ2A 2MO1A 4X6AH 4GOPB 2K5VA 3CP0A 2UUCQ 5IE8A 2KCMA 3ICEA 1YHAA 4IO9A 1KQSA 2R7ZH 1XMOQ 1PA6A 1E3PA 3I2ZA 4JI2Q 4JV5Q 3CQZH 4A3LG 1VQOA 4IJLA 3K8AA 4DV6Q 3PO2G 1EOVA 1X3GA 3CXCA 1CKOA 4IOAA 5FLMG 2A1AA 1K9MC 4LF8L 1CSQA 1YVCA 1IBML 3ULLA 2E5LQ 1BBUA 4JI4L 2VQFQ 2BA1A 2D0PA 3KYHC 4JI6L 1XMQQ 2VS1A 4R4OA 4NB3A 4APVA 1VQ9A 1VS0A 4LUVA 4AYBG 1HR0L 3GD7A 2UXBQ 4R1JA 3ZJYC 1H95A 1NMFA 3HKSA 4GNXB 4J15A 3CC4A 4LF4Q 3K0XA 3UE0A 4YY3Q 5C0XJ 1YJWA 2AWOA 1QUQB 2ZTDA 4DR4L 1I94Q 4R4TA 3CCMA 2OTJA 4A3CG 1HZAA 2NN6I 4FDBA 1WOCA 4MNOA 4DV4L 4L5QA 4A3BH 4LF9L 4A3MG 1OXVA 2ZJRA 5C0XI 1AE2A 3CCSA 1N36Q 3KFUA 4LUZA 3ULPA 4A3GH 4POGA 1X9NA 1LUZA 1CKNB 1Q82C 1S3OA 2HIXA 2IHFA 4POFA 4O2DA 1LM0A 1A8VA 4JG2A 1XPUA 5EAYA 2B63G 4IOCA 3S1MH 2JJQA 3KLWA 1SLJA 4DV1L 3S2HH 1NMGA 5IWAL 3GTQH 1CUKA 3HKZG 1D8LA 2YTXA 1HNWQ 1A63A 4X64L 1VQ4A 4YCWA 1N33Q 5C44H 1DGSA 1Z47A 1KAWA 4A3DG 1VCIA 3RNUA 2MQHA 5FJ8G 5FLXc 3HOXG 4B3TL 2FXQA 1PYBA 4BA2I 1YNXA 4GLAC 1LYLA 1VQNA 3A5UA 1YZ6A 4A4IA 2ES2A 3HOWG 2HIVA 1HJPA 2C35B 1Q86C 3PO3H 3EIVA 3GO5A 5AJ3Q 5C3EG 2R92H 1K0RA 4GKKL 4GS3A 1Q1BA 3CPFA 1KD1C 3HOUG 1IBMQ 4A3JH 3GTMH 1FGUA 5IYDG 3UE1A 1VQLA 4JI4Q 4JI6Q 5E7NA 2AMCB 1XPOA 4PG3A 3PIOA 4TQUS 3UDFA 4PZ8A 2ID0A 1HR0Q 3HOYH 4YCVA 2KBNA 3S14H 3TS0A 1JT8A 1G51A 1SN8A 3S24A 3CCEA 2PNHA 4QQBX 2BH8A 4A3FH 4JI0Q 1C0AA 5JEAJ 3GTGH 4NPSA 4DR4Q 5C4XG 3OYYA 4LF7L 2K5NA 1OXTA 4XTCS 1YI2A 2UUBL 1PH1A 1WYDA 3E0EA 3D0FA 1IL2A 2F3IA 4BXXH 4DV4Q 2UUAL 3KDFA 3PUVA 2JQOA 1EIYB
chains in the Genus database with same CATH superfamily
2NZHA 1TU2B 1Z9FA 3NPPA 5CR3A 2HUGA 5EKIA 1PMRA 3J80E 4MZ9A 3TDQA 3WOEA 4DXFA 2E8GA 4X3SA 2NVQB 4H02A 1MHWC 1GD7A 3DUZA 3I7FA 1ZYRD 1SJHD 1R9TB 2A73B 1OTCA 1I3QH 1N8RC 1VQIA 4RKBA 1HZ9A 1S5FD 1E22A 2WB1G 3VYSA 3RZOH 1I6HB 1NR4A 2QEJC 1UE1A 2R3ZA 1NSNS 2Z9HA 4EQOA 1G2TA 1O78A 3JAMc 4XQNA 3MEHA 3MC0B 2X6GA 2LY7A 3QO2A 4DV0L 2F0EA 2J4XA 4GOPC 1GUTA 1ENFA 2F0JA 1JWMD 2V4DA 1JICA 3E9IA 1TT2A 1QVGA 1SE8A 2X6LA 3TN2A 4OEMB 2F0GA 4CHTB 2F03A 1SMXA 1YNJD 3NBIA 1XPRA 3MFYA 2B8FA 5M5XB 5IP9H 3G6EA 1STGA 2N3SA 1JWSD 1Y8NB 3FP9A 2JXMB 4OX9L 4EX5A 1B9NA 4GNXC 2IX1A 4DR5Q 4CBVA 3VA7A 1J5EL 1PH4A 1FJGL 2IX0A 1Q46A 3AFQA 4YWMA 5M5YH 3V2TA 1VQ7A 1LTAD 4K6DA 1YHQA 2JA5G 3PIPA 1PZID 2OEOA 3GTLH 2R6GA 1N32L 4JI1L 3F2BA 3M7NA 1Q8KA 3A8JE 3MXNB 4EQPA 4FF1A 2JE6I 2YV5A 3OTOL 3SHLA 5C5LA 4X66L 2F4VL 4RG1A 4OWWB 4RHSA 3SK5A 1FD7D 1V1PB 4X3UA 1LT3D 2B63B 2PW5A 1HTLD 1PFMA 2XGTA 2PZTA 3HKZB 4C3IG 4P75A 4TKOB 3K81C 3S9WA 1Y1WG 3ND8A 3TREA 4OHJA 5C6AA 2E76C 3B6YA 4HSPA 1TWGH 1B50A 1HPCA 3D6WA 1NR2A 4LF5Q 3CD6A 2F0TA 3I8ZA 2A69D 1JQYD 5C4JH 3AFPA 4GZYC 4WFN3 4IJHA 2WKCA 5C3EB 1D1KA 5CYUA 1BNZA 4JPBW 1G291 1IZ6A 4KY6A 3ULJA 1V9PA 5KNDA 3U9OA 3UDXA 1SNPA 2EYHA 3DEOA 1L2FA 2CH4W 2E75C 4I65A 1JMCA 4RHRA 2Z6KA 1QVFA 3NBHB 2R92G 1ZYRC 2O4XA 1RL2A 2F1MA 1ENAA 4LF9Q 2E2JH 1X3QA 3DLLA 1I6VC 4QIWB 4DV2Q 1CK1A 2MO0A 1IW7C 3ONAB 2NVQH 4K6LA 3HOYG 2TSSA 1SE2A 4HIKA 5BR8L 2DGYA 3J81L 1L0WA 2KJXA 1TIID 5LMNQ 1DOKA 3STBD 4J6HA 1R9TH 4I7ZC 4QB4A 4DGZA 3PF4A 2JP1A 1H9MA 1TWCB 4JCVE 1BUVT 2SEBD 3NUCA 1WVLA 4GKJQ 1HQRD 1I6HH 5K36G 1EFWA 3CCLA 1PXUA 3PUWA 4A3EG 4FVMA 3LX0A 3C1EA 3S1NB 1YNJC 5IT9L 1PV4A 1W3SA 3HKZE 1SFOB 4A93B 3H3VH 2O5JC 4DNIA 4DA2A 4JYAL 1KAAA 1X3PA 1VF7A 1SSOA 1M1KC 3T1YL 3T1HL 4BBSB 4IPHA 5G3LF 4DR7L 1C9OA 5FLMH 1B1ZA 4B3SL 1TWHH 2Q8IB 1E2WA 1H9SA 2L15A 3H0GG 1ET9A 3GQBA 1FNWA 5LMUL 4JC0A 1VQPA 1CSPA 4FXDA 2AHOB 3CF5A 2OF1A 3W1BA 5EBDA 1SR3A 3I4MG 1PFNA 3IL8A 1B3QA 3GTOH 2K52A 3KOJA 1FGBD 3HRZC 4F87A 4FP5D 2HHHQ 1LT6D 1PYSB 1SYGA 3VYTA 1O7YA 4LUOA 4P73A 5AJ3L 4Y7NB 1NBWA 3CQZB 2OXPA 1EQRA 2JA5H 2FFKB 3TMEA 2HD3A 3Q8DA 1ASYA 1VQ8A 1HA5A 2LXJA 4QIWE 2A8VA 3D8GA 3J7A5 1L1OC 1C4QA 1SYDA 3KJPA 3K57A 2B63H 4JI0L 2QGQA 1WCMB 1TWFB 1ILQA 2WP8J 4L6TB 4JBJA 4C3IH 1HNXQ 4BY1G 4LFAQ 1Y1WH 3KLSX 4CJ0B 2XVSA 1ET6A 4A3BG 1EEFD 5HY6A 1N34L 1WTXA 2PO4A 1Y14B 3J80L 1KHIA 5M3MG 1AE3A 3CC2A 3A55A 1BKBA 2DUDA 3Q0AA 4UP8A 3X3NA 1IHZA 1YBYA 2XSCA 3BJUA 1Q7YC 5JJKA 2G5DA 1F9PA 1EYCA 3HFZB 1DYQA 2I0QA 2L4NA 2CFMA 3TZUA 4B3MQ 3KLSA 4OELB 1WTOA 2B8GA 5E3FA 3HP3A 1PH2A 3N6RA 1J5EQ 4OO1G 3STBC 4C2MB 5C3XA 1G91A 4UP7A 1YJ9A 2QA4A 1S4ZA 1FNUA 2K75A 5ELBA 4QMGA 1SJED 2E2DC 5CBEE 3M4YA 2FMCA 1LACA 4K0KQ 1EIGA 3LGJA 4H0LC 2WIIB 1SBBB 2WINB 3QG1A 4WJ3M 1GXDC 4G7OC 4DUZQ 4A3FB 2EOTA 2VQFL 4ZKCB 1KABA 3Q6SA 3HEJA 1U0LA 1EQQA 1BCPD 2A74C 1HQMC 2WKDA 3TP5A 5K36H 1F2ZA 4H44C 4AQYQ 4A3EH 1STAA 1SFOH 4A93H 4HMIA 4R8IA 2RDHA 5TSSA 1GOZA 3UI2A 4BBRG 5IYCG 3HOVG 4HJ9A 3K59A 4HIOA 1XTDA 5T1GA 5CMDA 4K8IA 3NK9A 4OL7A 2WAQG 2EYJA 2B2VC 5F2DA 2MUYA 5JJIA 1UEAB 2EJGC 4NKLA 4DK1A 4BA1I 1SE3A 4RGTA 3MAQA 2PQAA 2VQEQ 2AQ2B 1JJ2A 4RCNA 2MO1A 2UUCQ 3BS1A 3ICEA 1YHAA 4P2CB 4IO9A 2KHSA 3KBXA 4JI2Q 3CQZH 2CH4A 2NTTA 5DM63 4MHEA 5FLXL 1SE4A 2A1AA 4LF8L 1BOSA 3S15B 4K5WA 2E5LQ 1BBUA 3SEBA 3H09A 5NUCA 4JI6L 1XMQQ 4K2LA 4RGOS 1VS0A 4EVOA 5LHY1 1HR0L 4IN3A 2MPMA 5DNFA 3UE0A 4QF4A 1MBYA 1Z6HA 2A6EC 1U4LA 4FDBA 4JK1C 2O2LD 4MNOA 4R9WA 2EYPA 4A3BH 2NN6H 4A3MG 4XQQA 3CCSA 1N36Q 3ULPA 4BY7B 4POGA 1LUZA 5EJWA 3URYA 4POFA 3TP8A 1EYAA 1F2LA 3KLWA 1SLJA 1DGSA 5JVG3 4A3DG 3LWUA 2MQHA 3HOXG 1PYBA 2Z1CA 4ZUIA 3VYRA 1PZJD 1VQNA 1YZ6A 2ES2A 2HIVA 3EIVA 5AJ3Q 5CV4A 1K0RA 1KD1C 3DXJC 4JI4Q 4ZQ3A 2QCPX 3T13A 3PIOA 4TQUS 1HUMA 2K5QA 4PZ8A 2DJGC 3CCEA 2PCFB 4A3FH 4JI0Q 4RKLA 4K2KA 3GTGH 4DR4Q 1K28A 5C4XG 3EJIA 3T53B 1PH1A 1JR0D 1IL2A 2Y0SB 4DV4Q 4B9XA 5EPLA 3KDFA 1EOTA 4ME5A 2JQOA 2ATWA 3TRZA 4KD3A 4N8FA 1EIFA 3I70A 1MI2A 2DNCA 1A2UA 5IGDA 4DR5L 1PH5A 4ZYSA 3K5OA 5IYCH 3HOVH 4HAEA 4O0AA 3M9BA 1JCKB 2JA6B 1GKHA 1VQHA 1V43A 4IZ8A 2L11A 2E2HH 3RN2A 2G9HD 1O7LA 2WV6D 2N55A 2AQ3B 1HFGA 2BA0A 4DNTB 3VYUA 2IHEA 1Q81C 2PW7A 1WJJA 4CKCA 3ERSX 2I5LX 4A76A 1U5KA 4G57A 3U9SA 1WTQA 1RCVD 4IUVA 1QOHA 5L37A 4LF5L 3S15H 2BE5D 4IUNA 3A0JA 3OIPA 2EZVA 1U4MA 1B3AA 4KJOA 1KDBA 1HXYD 1FL0A 3PQIA 1TS5A 4J8QA 3N52A 4XYQA 2B2YC 4AYBB 3EFXD 1QNUA 2R7ZG 1U4PA 1VQ6A 3T16A 3FKIG 4QUFA 4Y52H 3S1QB 5I2YA 1QNKA 1NE3A 1AN8A 4OGQC 4XT1B 2JN4A 2A19A 2Y0SE 4QY7A 4A3MH 4BY7H 4OIKA 3JAMi 2UXDQ 1IBKQ 4DV2L 3SGIA 3TP7A 2K01A 2K5HA 4YIJA 1IXRA 4GNXA 4GN5A 3NENA 4AH6A 5LMNL 1IYUA 1A15A 5E4WC 4HMJA 1QUQA 2F4IA 1X55A 3NQTA 3QB3A 3HOXH 1TXYA 3M7GA 5M5WB 4DK6C 3BYYB 4GKJL 1EL0A 1PRTF 4A3GG 1CKNA 2VY3A 3SE0A 2IT1A 3VDYA 2EE1A 1J8IA 1TWGB 1A0IA 2IPKD 4LF8Q 1K8AC 1JOQA 1VQ5A 5IGEA 5C4JB 1NTGA 3EVQA 2RKSA 2NVTH 3I72A 2ZXRA 5K5PA 5C44G 1XX8A 1H9KA 4JI3Q 2B29A 1VF5C 2R61A 5C4XH 3MXPA 3OWEB 1K3BC 5HGQA 5CGKA 4A3JG 2V1CC 3NSWA 2CQOA 1X56A 3W3AA 4AYBE 2E2JB 3FMCA 4PZ6A 1E1TA 1TKWB 2HHHL 1I4GA 4LFBQ 1K8OA 5JJLA 1PRTB 2O5IC 2JA6H 1PYWD 2EYFA 5IYBH 1F9SA 4WJ4A 1H9JA 1I4QA 2RBMA 1HNZQ 1YEZA 5ISRA 1MGSA 2D2CC 5IOCA 2BE5C 1IW7D 1EY6A 4H7BA 3PF5A 1SNCA 4C3JG 1STYA 4RWSC 2EIFA 5KYIA 2WB1B 1BDOA 5CBAE 4FF4A 3H3VI 4L5TA 3J81j 3BZCA 1HNXL 1SAPA 1C48A 4LFAL 2CKZB 2D0OA 2Z0SA 2VUMG 1R4QB 2HT1A 1L0YB 2VZAA 1UEBA 2EYLA 3Q24A 3H3VC 3J7ZC 4DR6Q 2EYOA 3JAME 2X69A 3I3CA 2PZUA 5I6YA 4Q0FA 2N49A 1CQFA 1TWHB 1X65A 3RLFA 2F0OA 3I73A 1MKHA 3S17H 4FYDA 4OONA 1XJVA 4B3ML 3K5NA 2NZOA 3S1QH 4R8NA 2ZT9C 3FKIH 3HOZG 3GTOB 2Z8LA 3AYHB 4LAAA 1PZKD 2Z4IA 4JOIC 4R4IA 1ASZA 1BVSA 5HURA 4I7AA 4IUPA 3GTPH 2ZJQA 2KEDA 2JA5B 2FHTA 1TS3A 3TEHB 2F3WA 1B2TA 4K0KL 3P75A 1CM9A 3FRPB 1U4RA 1O7IA 3O13A 1KNAA 4LFCQ 3KLRA 2H4OA 2B2WC 5M9OA 2R7FA 4DUZL 2K03A 1NAPA 2F0PA 5M5WH 1J9OA 2RCNA 2ICEC 4C3IB 1JE5A 4DR1Q 2R93G 1II3A 4PV1C 1Y1WB 1D5MC 1L1OA 4AQYL 4JI8L 3PUYA 1LTLA 1CZGA 4KJNA 4HJ7A 2WB1E 2QF7A 3CAMA 1E7ZA 3S16H 1D5XC 2RHQB 4F8MA 3S1MB 3OPOA 4QUCA 1WTVA 1MD2D 3KK7A 4GN4B 2XWJB 1LT5D 5GADC 3RLNA 4EQ5A 1CHPD 2RSNA 1NNXA 3CPWA 3UDGA 2GN5A 2HDLA 3PO3G 2ASBA 4JVZA 1TVXA 2VQEL 2EY5A 1PHJA 2R92B 1DD2A 1HRJA 3I4LA 2Q2TA 2UUCL 3V05A 4U673 3TBIB 3U50C 3PUZA 2K05A 3MWYW 4JI2L 2IY5B 3HOYB 1QVCA 2KCTA 1STNA 4HJAA 4UY8C 5H1SE 4CDEC 3M4PA 4P72A 1EEID 3DHQA 2E5LL 5ELEA 1XMQL 1PTOD 1VQJA 3IKJA 3KF6A 1EQVA 1V8QA 3AQQA 2XWBB 3CCUA 1M4VA 3CMEA 1HTPA 5M3FG 4A3EB 1RTNA 2CQAA 2ZTEA 3PUXA 3RUZA 3OHXC 3I91A 4OWXB 3ND9A 3F1ZA 5IODA 4YCUA 5DM73 1A2TA 1N36L 2MP1A 5EKLA 4K5XA 2GA4B 2RDGA 4HEDA 4JI7Q 2F0VA 3I4NG 1JB7A 2QILA 4HCSA 1X3FA 3X3MA 4EGVA 4IPDA 1RHPA 3GV6A 1GHKA 5IY0A 2HCCA 2WFWA 1CZWA 3H0GB 3FHWA 5D65A 1XNRQ 1K3RA 3ITPA 3Q23A 2NZ1D 1S5BD 1XMOQ 3I4MB 1HHVA 5JOBA 2B2VA 1B4OA 4A3LG 4ZAIA 4NP5A 3PO2G 3CXCA 3P7JA 5A2QE 1ICWA 4KK7A 2JSOA 2SDFA 4JI4L 2E2IB 5BN3A 3OIQA 2LS01 2VS1A 3EROA 1CQVA 2D5DA 3CHBD 4C3HG 1QB5D 2UXBQ 1LTID 1I50B 1NMFA 4J15A 3CC4A 2Z6BA 1LT4D 4KMUC 4Z9CB 3K0XA 4YY3Q 1TS2A 2A6HD 3SDZA 5C4HA 3SR1A 4DR4L 4R4TA 3RZDB 2KOLA 1SNMA 4A3CG 2NN6I 1STEA 4N8X1 4DV4L 4L5QA 4BY1B 2QDLA 4A3BB 1Q82C 1R4PB 1U9RA 2L5TA 3SK8A 3V96A 5E1FA 1V1OA 1XPUA 5M3MB 1GUWA 4RFBA 3S1MH 4DU9A 4G7ZC 1HNWQ 5DAUA 4X64L 1EY7A 2A6ED 1Z47A 4Q5VA 4LJZC 5FJ8G 4BA2I 3MFGA 1STBA 2NTSA 4V190 4A4IA 3PO3H 1Q86C 3GO5A 2R92H 5FKAC 3GP7A 3CPFA 3HOUG 1IBMQ 1AFPA 1D5ZC 2K28A 2DN8A 3UE1A 3EA6A 1PTOC 5IGFA 5JPMC 5C5MA 5E7NA 1WD1A 2L9HA 4G7HC 3HOYH 2ID0A 3J7AF 3S14H 1KDCA 1D6EC 1G51A 1SN8A 3JAML 4QQBX 3DMUA 1OXTA 1LTGD 3D0FA 3GTGB 2F3IA 3HS0C 3DEPA 3PUVA 3A56A 2PYKA 4JI8Q 3L3OC 3K58A 1W6KA 1FVIA 1GM5A 3PGZA 1BQQT 4DV1Q 3I4OA 4ID6A 2BCOA 2C9OA 5J3BA 4BBRB 3HOVB 1EUJA 4HCEA 1SXTA 2UXDL 2HDMA 1IBKL 2H5XA 2EY2A 1Y1VG 4ABNA 2FMMA 5KRUA 3PSIA 2WAQB 4DAYA 2E2HB 1H9SB 3H0GH 4UHVA 4GKKQ 2EY1A 3QWNA 3A74A 3W5OA 1A3VA 2R7DA 1VMPA 1TWAH 3ERQA 1C8CA 3I4MH 1CA5A 3U58A 1HCZA 3S1RB 1SYEA 4KHZA 4A3LH 2A6HC 3VR6A 3PO2H 3PIP3 1ONLA 5GQOA 3R3OA 1WI5A 3D4DA 1CKMA 4KKUA 3U4ZA 3NWTA 2E2IH 2JA7G 2JA8G 3OMGA 1SNOA 4AIMA 1XYIA 3K7UC 1UE6A 3I56A 1EU3A 4C3HH 1I50H 1DOMA 3WWVA 3QOJA 2EQSA 1EY0A 1SMYC 4JI3L 1AW7A 1WFQA 1D2BA 2A68C 4UAIA 3RZDH 1KRSA 1QWYA 4OIJA 3BU2A 1M8AA 4A3CH 4ODGA 4HJ5A 4BY1H 2YU9B 1I4HA 4LNQA 3SK4A 4FXKC 2PZWA 5C3WA 3G48A 4A3MB 1TR5A 2AQ1B 4ME3A 5M3MH 1BBWA 2B2YA 3MA2B 2K1BA 4A3IG 4CJ2C 4LFBL 2CWPA 5CORA 5C4ZA 2QEXA 1PH3A 2F0DA 5D3IB 1JJGA 1BCPF 1EY9A 4XDXA 2I5MX 2MFIA 2TMPA 3OWFA 2K14A 3QR8A 5GAHC 4NXNQ 2M00A 2MJ8A 4E6IA 1OXXK 3R8BA 2Q2HA 1LO5D 1Q8IA 1HNZL 1BXTA 3G6JB 1KC8C 1SNDA 1VQMA 5ELNA 4A3DB 4DN4M 3HOXB 2WAQE 4XXEA 2UU9Q 4V0BA 4OO1H 3D4WA 4DR2Q 2BDNA 1PH9A 1XNQQ 3F2CA 3J7AV 5CC4A 3C3LA 3D31A 3HOUH 2HQEA 2MHVA 4PNYA 2K7VA 2AWNA 1EQTA 4DR3Q 1K83H 1EYGA 5I2XA 4P71A 2NVXB 4KN7C 4DPGA 2F0SA 2FINB 2QW7A 2XIWA 2NVTB 2BOSA 3NTHA 4DR6L 1S5ED 1W2BA 4LF6Q 3L7ZC 3BG3A 3QIAA 1KRTA 4JBWA 1QE6A 2M2LA 3CCVA 2K6AA 5C4XB 4GLXA 2RCFA 1BF4A 1BCPB 4C1NI 4CKEA 2KENA 4RMFA 3TP6A 2OWOA 1WD0A 4ZUJA 5IGCA 1CFMA 3M4OB 2ALYB 1LTBD 5A2QL 1TY2A 1WTRA 4A3KG 2CHBD 1Z7TA 4X62Q 4BBRH 2Q2UA 4LMQD 4X64Q 3A7AB 5A35A 4C1NK 3EN2A 3KF8A 1Y1VH 1AZQA 4BXXG 3R2IA 4CGYB 1QZGA 1LABA 4EQNA 1B70B 1VDZA 1IKMA 1QJOA 2CW0C 4LFCL 4KY7A 3OSOA 1IYVA 2B2TC 2G9DA 1QZHA 2PQAB 4ZLTF 2K5DA 2L1BA 2ZJPA 4UPAA 4MTNA 2HCIA 3UDIA 5FO8B 1OXSC 4PMWA 3S1RH 3QJYA 1PDQA 1PRTD 4UP9A 2ZM6Q 1HH2P 1NJIC 1OO9B 4DR1L 4JI5Q 4DK3C 1KLUD 4IFDG 3RN5A 3M3YH 4DFAA 3BZDB 3D6CA 4NDXA 2CWAA 5D3DA 3IRBA 4KI0A 3J81c 4GOPA 2EXZA 3S17B 2NYZD 5LL6X 4DV3Q 2YU9H 2YTYA 2R7ZB 2VXWA 3E3XA 3FKIB 3D4RA 1GO3E 4DAVA 2SNMA 3C46A 2F0LA 2NB0A 2YYZA 5HGTA 3GTPB 5IT9c 4A3IH 4NXMQ 5IP9G 5J39A 1SYBA 5KGUA 2MGSA 3L0OA 2MNAA 4B3RQ 4JOIA 2AUKA 3WDNA 4ZKBB 4HSVA 3BDCA 4R4CA 4DV7Q 4A3DH 3G4SA 4QJFA 1YITA 5ELCA 2KHJA 3FPUB 2EPBA 4IPGA 4TVAB 3QOLA 3CC7A 4CDDC 1T9HA 1BO0A 1IBLQ 3MXNA 3G71A 5C0XG 4KHPL 2UXCQ 4A3GB 1C7YA 2J7ZA 1EY8A 2ZTCA 4CDCC 2B2WA 1A62A 2NVXH 4DUYQ 2OQ0A 3DWPA 2JEAI 3S16B 4M1UB 5D14A 2EY6A 2VB2X 3IFDA 5C44B 4DV5Q 2F0WA 2F52A 4JI7L 3FDTA 1PLFA 2KHIA 5KIXA 3T4AC 4L8JA 1DZ1A 3KDFB 1EU4A 1XNRL 4BS9A 1EY5A 1IYJB 3TSSA 4LWCA 4A3JB 3GTMB 3M4OH 2JK8A 5EBCA 1XMOL 1DCZA 1VQDA 2SNSA 3I90A 4A3KH 4O42A 3NHHA 3H6MA 1EFID 3A8IE 4WRDA 2K04A 1PRTC 3J80c 2KVMA 3NBHA 3KF8B 1JORA 4JBKA 4ILWA 2UXBL 1UUPA 3P1HA 5BN5A 3MTSA 1HA6A 4X3TA 4KLKA 5JEAG 3DM1A 4YY3L 3T56B 1KXLA 1K8GA 2PQEA 3R2TA 4IFDJ 3PV0A 3OMCA 4C3JB 5JJZA 2RA4A 2JEBI 5CV7A 1DONA 1Y8OB 4DXGA 1JC7A 5KYLA 3K7AH 1GHJA 2VUMB 2AKWB 2H1EA 4NW2A 4DNRB 4IFDH 5KNBA 4YHHQ 4L63B 3K80C 5CV5A 2I46A 3NTIA 1VQCA 1J6QA 3HZXA 4HN7A 1HNWL 2JA9A 1VQGA 2JYOA 4P74A 4C56C 4GOPB 1CTMA 3CP0A 4ZRZA 2KCMA 2R7ZH 3BYTB 2DY7A 1E3PA 3I2ZA 4JV5Q 3TZDA 3F2UA 4PQXA 1RJTA 1UNSA 3K8AA 4DV6Q 1EOVA 1X3GA 3HOZB 1CKOA 4WJWA 3MXUA 2L55A 5FLMG 1YNNC 1K9MC 1YVCA 1IBML 3CRLC 4H13C 2D0PA 1H9RA 3KYHC 3C1FA 4R4OA 3KBGA 4APVA 2L12A 2KCNA 4TSSA 3GD7A 4R1JA 3CKIB 1GUGA 3HKSA 4GNXB 4LF4Q 2ICIA 5C0XJ 1YJWA 2B2UC 1PFBA 2KA7A 1QUQB 2ZTDA 1I94Q 4M8AA 3G7LA 3CCMA 2OTJA 5EGTA 1JOOA 1WOCA 3CRKC 5CV8A 3KUPA 4JW0A 1I4XA 3GV3A 1AE2A 3KFUA 4LUZA 4A3GH 5C0XH 1X9NA 1CKNB 2R93B 4KKTA 1RODA 1XWEA 1QG7A 2RDFA 1A8VA 4JG2A 1RTOA 5EAYA 2C5CA 3PIO3 2B63G 4F88A 2JJQA 4DV1L 1EIHA 1NMGA 3HKZG 4XYOA 1D8LA 2YTXA 5IGGA 5ELDA 2F0QA 1BBXC 5G3LD 4YCWA 5EKKA 3VR5A 1QCBD 1UAPA 5C44H 1N33Q 1KAWA 1VCIA 3RNUA 4FO2A 5FLXc 3R93A 4GLAC 5J22A 1EZ6A 2RVLA 3A5UA 3HOWG 1HJPA 2SOBA 1ESRA 2EYMA 5C3EG 3HOWB 4GKKL 4GS3A 1Q1BA 3PO3B 4KY5A 4A3JH 3GTMH 1FGUA 5IYDG 2L0CA 5LL6S 5FLXE 1VQLA 3E6ZX 2AMCB 1XPOA 1RKNA 2XN9C 1B53A 4NMZA 3K0YA 1EWHA 3TS0A 4QCLA 3S24A 2BH8A 3S14B 2Z4HA 4K8JA 5JEAJ 5ELFA 2EDGA 2K5NA 2ZXOA 4U68A 3E0EA 1WYDA 2EJMA 2J0TD 2KQ3A 1BR9A 1D1IA 3LNNA 4KV6A 3C2PA 1CI3M 2UUAL 3IAYA 5EPKA 1MSHA 1EIYB 1GUSA 2I07B 1OXUA 4GLVB 5JEAH 1L0XB 4C3JH 1MJEA 4KHPQ 2VL6A 3VR4A 1KDAA 3L2PA 4HIMA 2VNUD 4KN4C 5FO7B 3SXHA 1NCVA 5M3FB 5IWAQ 1JE4A 1ZXTA 1G2SA 4HIDA 2VUMH 1YJNA 4B3TQ 5I4DA 3RD4A 2NUCA 1K73C 2ENBA 1F2YA 2PPBC 3I4NB 3H94A 1E1OA 1S40A 4A93G 1EWIA 4XT3B 2RHSB 3JC66 1AP0A 2F0NA 4NXNL 2LKVA 4X65L 1S5DD 1Q1EA 5IGBA 4PZ7A 1TWAB 1VQFA 3HOZH 4BBSG 1UE5A 2UU9L 2LMCB 1FR3A 4DR2L 1SRUA 1XNQL 2K33A 3PO2B 2D9UA 1GJXA 2RF4A 1XXGA 4DR3L 4LF7Q 3OW2A 2UUBQ 3CU7A 1RIPA 5M5XH 3E5SA 3LWEA 1AEXA 1VQEA 3MVVA 4C3HB 1X32A 1K8MA 4LF6L 4MTKA 2LFNA 1PH8A 5AFWA 2PMZB 2PI2A 1K0SA 2R93H 4KTAA 1V1QA 1CT1D 1L1OB 1SMYD 1WCMG 1SYCA 2A69C 3BVMA 3OW7A 2A68D 1PTOF 4DKAC 1O80A 2DY8A 2DJFC 2IX3A 3K5LA 4X62L 1DM0B 1WTWA 3GTKB 4HTHA 2IJ0A 1M90C 1Q3LA 2OT2A 1JB3A 1UE7A 5J1ZA 1ENCA 4DV0Q 4OO1I 4PMCA 1DOLA 2NN6G 3AMUA 1FNVA 1PH6A 3HOWH 2F0MA 5C3EH 1Y8PB 2CCZA 4RGMA 2Z6KC 5IYDH 2Q8TA 5I9PA 1F77A 1JJCB 3HOUB 2CVRA 1A3UA 2ZM6L 2FJ2A 1K83B 3TS2A 3FEWX 3OOCA 4JI5L 3AEVA 1SEBD 4OX9Q 3BZKA 1E2ZA 2N78A 1HR0W 1FJGQ 1T5EA 3E0JA 1RDPD 3AU7A 1PTOB 1RF2D 3K6OA 3HG9A 2IW3A 5GROA 1AZPA 2Q2IA 3AB9A 3KF6B 4HR7B 2EXDA 5IP7G 3H91A 1JWUD 3GTJB 2D62A 1UWVA 3W1GA 1N32Q 1EY4A 4L5RC 4JI1Q 1HZBA 1EZ8A 1Q90A 3OTOQ 3RLOA 4OXPA 5M3FH 3DM3A 4TRDA 2WACA 4X66Q 4DV3L 2F4VQ 4LW1A 3CMAA 1EWCA 4MIUA 2NVYB 1HZCA 2F0FA 4A3FG 1E24A 3SVMA 3NXWA 1TWCH 2OCEA 4RH6A 3CCJA 4GN3B 2N8NA 2PMZE 1N9WA 4K14A 3F8TA 1GVPA 1D7QA 1A3TA 2ZXPA 1F9QA 1G6PA 3I4NH 4QL5A 2DNEA 1Y1VB 4NXML 3S1NH 4IUUA 2I5HA 3BDLA 4R4QA 1DXMA 4B3RL 2P5ZX 1S5CD 1ZEQX 1DJRD 3EBEA 4DV7L 1VQKA 1EYDA 1ICFB 1TQOA 4IUQA 2E74C 3MHBA 4BBSH 1AH9A 2K32A 2XRQD 1IBLL 4DF7A 1PH7A 1SYFA 2UXCL 3M4QA 3U4VA 2CW0D 2YTVA 2B2TA 4OWTB 1CA6A 5IIFA 2IL8A 2JA8B 2JA7B 1PVOA 1Y69U 1KL9A 2OTLA 3M3YB 3S2DB 1LTTD 4DUYL 2BH2A 4WORA 1TS4A 4CKBA 2UUAQ 4FF3A 1GUNA 1E0BA 4DV5L 5FK9C 4DAPA 4A75A 4Y7NH 5I9OA 3CW2C 4CDFC 3FVQA 1YHBA 2LSSA 3T51B 5BR8Q 3NELA 3BVGA 5JAVA 5DEHA 4JBMA 4YWLA 4IUTA 3MEFA 3A7LA 4X3KA 1I4RA 3NQIA 2Q8RE 2VB3X 3F2DA 5CV6A 1HFNA 2QDBA 1Q12A 1WCMH 1B9MA 1X3EA 1TWFH 2N88A 1KIXA 3GTKH 1QILA 3PCOB 4FNFA 5ELOA 4QGUA 4A3IB 1LLRD 4B9WA 4DAMA 3I55A 1F9RA 1ILPA 5FJ8H 4X65Q 4JYAQ 4BY7G 3K5MA 3J81i 3P20A 4IALA 3T1YQ 2HQLA 2IWHA 3T1HQ 1B8AA 4DR7Q 3D3RA 1P16A 2LXKA 4B3SQ 2GVBA 4YWKA 3M85A 4L5SA 4KD4A 4HJ8A 5LMUQ 1S72A 3NTKA 3S2HB 3GTQB 1RD9D 3CCRA 4IPCA 1W6JA 1I5FA 4C2MH 2QKIC 3BVZA 4YHHL 2B39A 1G6ZA 3NEMA 1PTOH 5FOBB 1VMCA 3GTJH 1NY4A 5IP7H 1VQAA 2BDOA 2NWGA 2XTIA 4RA8A 3ER0A 1BCPC 3KJOA 3DWQA 5DLQE 3CCQA 3GDEA 2K4KA 2EJFC 2NVYH 2OQKA 4JV5L 5FO9B 2RQXA 4DK0A 1STHA 2F0IA 3TQYA 4DV6L 1SROA 4A3KB 1JOKA 3PMFA 1XTCD 2PI2E 1PFSA 2K5WA 2Y0SG 1P8LA 2K50A 5LMNW 3FPPA 2XNAC 1MJCA 1N34Q 2RSOA 1LTSD 4DAYB 1G8ZD 3Q22A 4LF4L 1YIJA 2F3VA 3H15A 1I94L 1WTPA 1X6OA 1LV9A 1VQBA 3RR5A 3DWAA 5GAEC 1CHQD 2JA6G 4ZK9B 4MN3A 5IYBG 2KUMA 2VW9A 4IQZA 1SDFA 4XQJA 4ALPA 4ZCKA 1NUCA 4PMBA 4IFDI 1MIUA 3J7YW 3K7AB 1TY0A 1IL8A 3SK6A 1B7YB 2JA7H 2M9VA 5EQ0A 5GAGC 2JA8H 1ESFA 3S2DH 1I3QB 4B08A 4N9PA 1A6XA 5T1IA 4XIGS 3A5ZB 3E9HA 5EPJA 2B3GA 2GVAA 1E2VA 4G4KA 3J80i 3RZOB 1N33L 3NE5B 1X54A 4KHVA 4X6AH 2K5VA 5IE8A 1KQSA 1ML0D 4LK1C 1PA6A 3ZYYX 4UDUC 1VQOA 1SNQA 5I6WA 4IJLA 4KKSA 3IFTA 4N9TA 4ULLA 4IOAA 3W2DA 3J81E 1CSQA 3ULLA 3WOFA 1FYCA 2VQFQ 2BA1A 1F2MA 5BN4A 4NB3A 1VQ9A 2KEEA 4RGNA 1WTHA 4LUVA 4O1NA 4AYBG 3ZJYC 1B44D 1H95A 4FF2A 3A54A 2F0UA 2AWOA 3MXGA 1YNND 1HZAA 1KNEA 5IT9E 2EVBA 3A8KE 4LF9L 2F0HA 1OXVA 2ZJRA 5C0XI 5M5YB 3NWSA 4CJ1B 4J1MA 3GTLB 1IKLA 1S3OA 2HIXA 2IHFA 2A5HA 4O2DA 1LM0A 3VR3A 3VR2A 2B2UA 4IOCA 3MZ5A 3S2HH 1V1PA 4S3SA 5IWAL 1CUKA 3GTQH 1A63A 5COYA 1O7ZA 1VQ4A 1GUOA 4FXGC 5KNCA 1T5XD 3VA5A 4B3TL 2FXQA 1YNXA 3EQLC 1LTRD 1LYLA 4RCOA 2C35B 5JVH3 1KTKA 2F0KA 2KCCA 5CV9A 4IURA 3BDOA 1HUNA 4JI6Q 2PNRC 2AUJD 4PG3A 3NP8A 1I4PA 2KECA 4K5VA 3UDFA 2NBFA 1HR0Q 4YCVA 2KBNA 1JT8A 4RAUC 2PNHA 1C0AA 1ZKOA 4F7XA 1MSGA 3HGBA 4NPSA 3OYYA 4LF7L 4XTCS 2XRSD 5KEEA 4BWGB 1YI2A 2UUBL 3RMHA 5E4XA 4BXXH 1KLGD 3L9AX 5JPNC
chains in the Genus database with same CATH topology
2NZHA 1Z9FA 2ATWA 3TRZA 1OXUA 4JI8Q 1EIFA 4GLVB 4C3JH 1MJEA 4KHPQ 1FVIA 2VL6A 4MZ9A 4DR5L 1PH5A 3L2PA 3PGZA 1GM5A 4HIMA 2VNUD 2E8GA 4H02A 4DV1Q 5IWAQ 5IYCH 3HOVH 1GD7A 4O0AA 3M9BA 3I4OA 4HIDA 2VUMH 3I7FA 5J3BA 1GKHA 1EUJA 2UXDL 1VQHA 1IBKL 1V43A 1YJNA 2H5XA 1OTCA 4B3TQ 1Y1VG 1I3QH 2E2HH 1N8RC 3PSIA 3RN2A 1VQIA 1K73C 1HZ9A 1E22A 3H0GH 2WB1G 2BA0A 3RZOH 1E1OA 2IHEA 1S40A 4GKKQ 1EWIA 1Q81C 1WJJA 1UE1A 4A93G 3ERSX 2I5LX 4A76A 2RHSB 3A74A 3W5OA 2R7DA 3JC66 4NXNL 3JAMc 1TWAH 1U5KA 4X65L 3I4MH 3U58A 1Q1EA 4PZ7A 4DV0L 4GOPC 1VQFA 3HOZH 4KHZA 4BBSG 4A3LH 1UE5A 2UU9L 3PO2H 3E9IA 4DR2L 4LF5L 1QVGA 5GQOA 3S15H 1SRUA 1WI5A 1XNQL 1SE8A 1CKMA 3A0JA 3U4ZA 2E2IH 2JA8G 2JA7G 2RF4A 1SMXA 4DR3L 4LF7Q 4AIMA 3OW2A 2UUBQ 1FL0A 1UE6A 3K7UC 3I56A 1RIPA 4C3HH 1I50H 5M5XH 1XPRA 3WWVA 1VQEA 2EQSA 4JI3L 5IP9H 3G6EA 2N3SA 1WFQA 3FP9A 4OX9L 2R7ZG 4EX5A 3RZDH 1KRSA 4LF6L 1VQ6A 4GNXC 2IX1A 4Y52H 3FKIG 4DR5Q 1J5EL 1PH4A 1FJGL 2IX0A 3BU2A 1NE3A 4A3CH 1Q46A 4HJ5A 4BY1H 3AFQA 4YWMA 5M5YH 4LNQA 1PH8A 2A19A 1VQ7A 1YHQA 2Y0SE 4QY7A 4A3MH 2JA5G 3PIPA 4BY7H 3JAMi 2PI2A 3GTLH 2R6GA 2R93H 1N32L 3G48A 1V1QA 2UXDQ 4JI1L 3F2BA 1L1OB 4DV2L 1IBKQ 1Q8KA 3M7NA 3MXNB 4ME3A 5M3MH 1BBWA 2JE6I 3SGIA 2YV5A 3OTOL 2K5HA 1WCMG 4X66L 4A3IG 2F4VL 4LFBL 4RG1A 2CWPA 4DKAC 1IXRA 2QEXA 4GN5A 4GNXA 1PH3A 3NENA 4OWWB 4AH6A 1JJGA 5LMNL 4X62L 2I5MX 2MFIA 1QUQA 2K14A 1X55A 2XGTA 1M90C 5GAHC 4NXNQ 1OXXK 1UE7A 4P75A 2Q2HA 3K81C 1TXYA 3HOXH 1HNZL 1Y1WG 3TREA 1KC8C 1VQMA 4DV0Q 5ELNA 4OO1I 2NN6G 4DK6C 4GKJL 2WAQE 1PH6A 3HOWH 2UU9Q 3B6YA 4A3GG 1TWGH 4DR2Q 1CKNA 2VY3A 4LF5Q 1PH9A 5C3EH 1XNQQ 3CD6A 3F2CA 2IT1A 5C4JH 3VDYA 3D31A 2CCZA 3AFPA 3HOUH 4IJHA 1A0IA 4LF8Q 2Z6KC 5IYDH 1K8AC 2AWNA 4DR3Q 1VQ5A 1JJCB 1NTGA 1K83H 1EYGA 1G291 2ZM6L 1IZ6A 2NVTH 3ULJA 1V9PA 4P71A 5C44G 4DPGA 3TS2A 3AEVA 4JI5L 4JI3Q 2B29A 3UDXA 4OX9Q 3BZKA 4DR6L 1L2FA 1W2BA 4LF6Q 3L7ZC 5C4XH 2N78A 1HR0W 1KRTA 4JBWA 1FJGQ 1JMCA 3CCVA 2Z6KA 1QVFA 3NBHB 4GLXA 2R92G 5GROA 5HGQA 1RL2A 2Q2IA 3KF6B 5IP7G 2EXDA 4LF9Q 4A3JG 2E2JH 2D62A 1UWVA 3W1GA 2KENA 2V1CC 4RMFA 2CQOA 3DLLA 4L5RC 4JI1Q 1N32Q 4DV2Q 1HZBA 1X56A 2OWOA 4AYBE 2MO0A 3OTOQ 4PZ6A 3RLOA 2NVQH 1E1TA 4OXPA 5M3FH 2HHHL 3DM3A 3HOYG 4X66Q 4DV3L 4HIKA 2F4VQ 4LFBQ 4LW1A 2ALYB 5BR8L 3CMAA 2DGYA 1L0WA 4A3KG 1HZCA 5LMNQ 4A3FG 5JJLA 1E24A 4X62Q 4BBRH 3STBD 2JA6H 2Q2UA 1R9TH 5IYBH 1TWCH 4X64Q 2OCEA 3CCJA 4GN3B 2N8NA 3PF4A 2PMZE 1N9WA 4WJ4A 3F8TA 1GVPA 1D7QA 3EN2A 1HNZQ 1Y1VH 4BXXG 1YEZA 4JCVE 1G6PA 3I4NH 1QZGA 4QL5A 4GKJQ 1I6HH 1B70B 4NXML 5K36G 1EFWA 3CCLA 3S1NH 3PF5A 4LFCL 2I5HA 3PUWA 4A3EG 4R4QA 1QZHA 2PQAB 2EIFA 4B3RL 2ZJPA 4UPAA 3H3VI 4L5TA 1PV4A 1W3SA 4MTNA 3UDIA 3BZCA 3HKZE 3EBEA 1OXSC 3J81j 1HNXL 4PMWA 4DV7L 3S1RH 1VQKA 3H3VH 4LFAL 4UP9A 2CKZB 4DNIA 2D0OA 2ZM6Q 1HH2P 2Z0SA 4JYAL 1NJIC 2VUMG 4BBSH 2HT1A 4DR1L 1AH9A 2VZAA 1M1KC 1UEBA 3T1YL 4JI5Q 3T1HL 1IBLL 4DK3C 4IPHA 3J7ZC 1PH7A 4DR7L 4DR6Q 1C9OA 2UXCL 3M4QA 5FLMH 4IFDG 3U4VA 3RN5A 2YTVA 3M3YH 4B3SL 1TWHH 4OWTB 2L15A 3H0GG 1PVOA 1KL9A 2N49A 2OTLA 5LMUL 4JC0A 4DUYL 1X65A 2CWAA 1VQPA 1CSPA 2BH2A 3RLFA 2AHOB 3IRBA 4KI0A 1MKHA 3CF5A 3J81c 2UUAQ 3S17H 3W1BA 4OONA 1SR3A 4GOPA 1XJVA 4B3ML 3GTOH 3I4MG 2NZOA 2K52A 3KOJA 3S1QH 4DV5L 4A75A 2HHHQ 4Y7NH 1PYSB 3FKIH 3HOZG 4DV3Q 2YU9H 3CW2C 2YTYA 1YHBA 2LSSA 5BR8Q 3AYHB 3NELA 5AJ3L 4LUOA 4P73A 4JBMA 4JOIC 1NBWA 4YWLA 4R4IA 1ASZA 1EQRA 1GO3E 2JA5H 1BVSA 3Q8DA 3MEFA 1ASYA 1VQ8A 3GTPH 2ZJQA 2LXJA 4QIWE 2YYZA 3F2DA 2A8VA 3TEHB 1Q12A 1WCMH 1L1OC 5IT9c 1X3EA 1TWFH 4A3IH 3J7A5 4K0KL 4NXMQ 1KIXA 3GTKH 3KJPA 2B63H 1O7IA 5IP9G 4LFCQ 3PCOB 2QGQA 4JI0L 5ELOA 4QGUA 2WP8J 3L0OA 2MNAA 4B3RQ 4JOIA 2R7FA 4JBJA 4DAMA 4DUZL 3I55A 4C3IH 1HNXQ 4R4CA 5M5WH 4DV7Q 3G4SA 4QJFA 4BY1G 1YITA 4A3DH 2RCNA 4LFAQ 5FJ8H 4X65Q 1Y1WH 4JYAQ 2KHJA 4BY7G 4IPGA 1JE5A 4A3BG 3J81i 4TVAB 4DR1Q 2R93G 3CC7A 5HY6A 1N34L 1T9HA 1L1OA 4AQYL 3T1YQ 1Y14B 2HQLA 1KHIA 3PUYA 4JI8L 3T1HQ 1B8AA 5M3MG 1AE3A 1LTLA 5C0XG 3G71A 3CC2A 4DR7Q 4KHPL 2UXCQ 1P16A 1BKBA 2DUDA 2LXKA 4HJ7A 1C7YA 2WB1E 4B3SQ 2GVBA 2ZTCA 4UP8A 3CAMA 1YBYA 4YWKA 1E7ZA 3M85A 4L5SA 1A62A 3S16H 3BJUA 2NVXH 1Q7YC 4HJ8A 2RHQB 5LMUQ 1S72A 5JJKA 4DUYQ 2OQ0A 3HFZB 4GN4B 1IBLQ 2JEAI 2I0QA 3CCRA 5GADC 3RLNA 2CFMA 4EQ5A 4B3MQ 4IPCA 3CPWA 4DV5Q 3UDGA 1I5FA 4C2MH 2F52A 4YHHL 2GN5A 4JI7L 3NEMA 1PH2A 1J5EQ 4OO1G 3STBC 3GTJH 3PO3G 1NY4A 2KHIA 2ASBA 4UP7A 1YJ9A 2QA4A 5IP7H 1VQAA 2VQEL 2XTIA 3KDFB 2K75A 1PHJA 1XNRL 3ER0A 3KJOA 1IYJB 2Q2TA 2UUCL 4LWCA 5DLQE 3CCQA 3GDEA 3M4OH 2JK8A 2K4KA 1XMOL 2NVYH 3U50C 4K0KQ 1VQDA 2OQKA 3LGJA 3PUZA 4JI2L 4JV5L 2IY5B 4A3KH 1QVCA 3TQYA 4DV6L 2KCTA 4HJAA 1SROA 4UY8C 4WJ3M 5H1SE 3M4PA 4P72A 4DUZQ 2PI2E 1PFSA 2Y0SG 3J80c 2E5LL 1P8LA 2VQFL 3KF8B 2K50A 5LMNW 1XMQL 4JBKA 1VQJA 3KF6A 1U0LA 1EQQA 1MJCA 2UXBL 3AQQA 3CCUA 1N34Q 4DAYB 4AQYQ 4A3EH 4LF4L 1YIJA 4KLKA 5JEAG 4YY3L 1SFOH 3H15A 4A93H 1KXLA 1K8GA 3CMEA 5M3FG 4IFDJ 1I94L 3PV0A 1X6OA 2ZTEA 3PUXA 1VQBA 3RR5A 2JEBI 4OWXB 3F1ZA 5GAEC 2JA6G 4BBRG 5IYCG 3HOVG 5IYBG 2VW9A 4YCUA 4HJ9A 4HIOA 1XTDA 3K7AH 4ALPA 1N36L 4IFDI 2WAQG 1MIUA 2AKWB 4YHHQ 4JI7Q 2JA8H 3I4NG 1B7YB 1JB7A 3K80C 2JA7H 1X3FA 5GAGC 5JJIA 4IPDA 3S2DH 1VQCA 4BA1I 5IY0A 1J6QA 2WFWA 4XIGS 2PQAA 3A5ZB 3E9HA 2JA9A 1HNWL 2VQEQ 1VQGA 3FHWA 2B3GA 4P74A 2GVAA 3J80i 1N33L 1XNRQ 1X54A 1K3RA 1JJ2A 2MO1A 4X6AH 4GOPB 2K5VA 3CP0A 2UUCQ 5IE8A 2KCMA 3ICEA 1YHAA 4IO9A 1KQSA 2R7ZH 1XMOQ 1PA6A 1E3PA 3I2ZA 4JI2Q 4JV5Q 3CQZH 4A3LG 1VQOA 4IJLA 3K8AA 4DV6Q 3PO2G 1EOVA 1X3GA 3CXCA 1CKOA 4IOAA 5FLMG 2A1AA 1K9MC 4LF8L 1CSQA 1YVCA 1IBML 3ULLA 2E5LQ 1BBUA 4JI4L 2VQFQ 2BA1A 2D0PA 3KYHC 4JI6L 1XMQQ 2VS1A 4R4OA 4NB3A 4APVA 1VQ9A 1VS0A 4LUVA 4AYBG 1HR0L 3GD7A 2UXBQ 4R1JA 3ZJYC 1H95A 1NMFA 3HKSA 4GNXB 4J15A 3CC4A 4LF4Q 3K0XA 3UE0A 4YY3Q 5C0XJ 1YJWA 2AWOA 1QUQB 2ZTDA 4DR4L 1I94Q 4R4TA 3CCMA 2OTJA 4A3CG 1HZAA 2NN6I 4FDBA 1WOCA 4MNOA 4DV4L 4L5QA 4A3BH 4LF9L 4A3MG 1OXVA 2ZJRA 5C0XI 1AE2A 3CCSA 1N36Q 3KFUA 4LUZA 3ULPA 4A3GH 4POGA 1X9NA 1LUZA 1CKNB 1Q82C 1S3OA 2HIXA 2IHFA 4POFA 4O2DA 1LM0A 1A8VA 4JG2A 1XPUA 5EAYA 2B63G 4IOCA 3S1MH 2JJQA 3KLWA 1SLJA 4DV1L 3S2HH 1NMGA 5IWAL 3GTQH 1CUKA 3HKZG 1D8LA 2YTXA 1HNWQ 1A63A 4X64L 1VQ4A 4YCWA 1N33Q 5C44H 1DGSA 1Z47A 1KAWA 4A3DG 1VCIA 3RNUA 2MQHA 5FJ8G 5FLXc 3HOXG 4B3TL 2FXQA 1PYBA 4BA2I 1YNXA 4GLAC 1LYLA 1VQNA 3A5UA 1YZ6A 4A4IA 2ES2A 3HOWG 2HIVA 1HJPA 2C35B 1Q86C 3PO3H 3EIVA 3GO5A 5AJ3Q 5C3EG 2R92H 1K0RA 4GKKL 4GS3A 1Q1BA 3CPFA 1KD1C 3HOUG 1IBMQ 4A3JH 3GTMH 1FGUA 5IYDG 3UE1A 1VQLA 4JI4Q 4JI6Q 5E7NA 2AMCB 1XPOA 4PG3A 3PIOA 4TQUS 3UDFA 4PZ8A 2ID0A 1HR0Q 3HOYH 4YCVA 2KBNA 3S14H 3TS0A 1JT8A 1G51A 1SN8A 3S24A 3CCEA 2PNHA 4QQBX 2BH8A 4A3FH 4JI0Q 1C0AA 5JEAJ 3GTGH 4NPSA 4DR4Q 5C4XG 3OYYA 4LF7L 2K5NA 1OXTA 4XTCS 1YI2A 2UUBL 1PH1A 1WYDA 3E0EA 3D0FA 1IL2A 2F3IA 4BXXH 4DV4Q 2UUAL 3KDFA 3PUVA 2JQOA 1EIYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZH A;  1Z9F A;  2ATW A;  3TRZ A;  1OXU A;  4JI8 Q;  1EIF A;  4GLV B;  4C3J H;  1MJE A;  4KHP Q;  1FVI A;  2VL6 A;  4MZ9 A;  4DR5 L;  1PH5 A;  3L2P A;  3PGZ A;  1GM5 A;  4HIM A;  2VNU D;  2E8G A;  4H02 A;  4DV1 Q;  5IWA Q;  5IYC H;  3HOV H;  1GD7 A;  4O0A A;  3M9B A;  3I4O A;  4HID A;  2VUM H;  3I7F A;  5J3B A;  1GKH A;  1EUJ A;  2UXD L;  1VQH A;  1IBK L;  1V43 A;  1YJN A;  2H5X A;  1OTC A;  4B3T Q;  1Y1V G;  1I3Q H;  2E2H H;  1N8R C;  3PSI A;  3RN2 A;  1VQI A;  1K73 C;  1HZ9 A;  1E22 A;  3H0G H;  2WB1 G;  2BA0 A;  3RZO H;  1E1O A;  2IHE A;  1S40 A;  4GKK Q;  1EWI A;  1Q81 C;  1WJJ A;  1UE1 A;  4A93 G;  3ERS X;  2I5L X;  4A76 A;  2RHS B;  3A74 A;  3W5O A;  2R7D A;  3JC6 6;  4NXN L;  3JAM c;  1TWA H;  1U5K A;  4X65 L;  3I4M H;  3U58 A;  1Q1E A;  4PZ7 A;  4DV0 L;  4GOP C;  1VQF A;  3HOZ H;  4KHZ A;  4BBS G;  4A3L H;  1UE5 A;  2UU9 L;  3PO2 H;  3E9I A;  4DR2 L;  4LF5 L;  1QVG A;  5GQO A;  3S15 H;  1SRU A;  1WI5 A;  1XNQ L;  1SE8 A;  1CKM A;  3A0J A;  3U4Z A;  2E2I H;  2JA8 G;  2JA7 G;  2RF4 A;  1SMX A;  4DR3 L;  4LF7 Q;  4AIM A;  3OW2 A;  2UUB Q;  1FL0 A;  1UE6 A;  3K7U C;  3I56 A;  1RIP A;  4C3H H;  1I50 H;  5M5X H;  1XPR A;  3WWV A;  1VQE A;  2EQS A;  4JI3 L;  5IP9 H;  3G6E A;  2N3S A;  1WFQ A;  3FP9 A;  4OX9 L;  2R7Z G;  4EX5 A;  3RZD H;  1KRS A;  4LF6 L;  1VQ6 A;  4GNX C;  2IX1 A;  4Y52 H;  3FKI G;  4DR5 Q;  1J5E L;  1PH4 A;  1FJG L;  2IX0 A;  3BU2 A;  1NE3 A;  4A3C H;  1Q46 A;  4HJ5 A;  4BY1 H;  3AFQ A;  4YWM A;  5M5Y H;  4LNQ A;  1PH8 A;  2A19 A;  1VQ7 A;  1YHQ A;  2Y0S E;  4QY7 A;  4A3M H;  2JA5 G;  3PIP A;  4BY7 H;  3JAM i;  2PI2 A;  3GTL H;  2R6G A;  2R93 H;  1N32 L;  3G48 A;  1V1Q A;  2UXD Q;  4JI1 L;  3F2B A;  1L1O B;  4DV2 L;  1IBK Q;  1Q8K A;  3M7N A;  3MXN B;  4ME3 A;  5M3M H;  1BBW A;  2JE6 I;  3SGI A;  2YV5 A;  3OTO L;  2K5H A;  1WCM G;  4X66 L;  4A3I G;  2F4V L;  4LFB L;  4RG1 A;  2CWP A;  4DKA C;  1IXR A;  2QEX A;  4GN5 A;  4GNX A;  1PH3 A;  3NEN A;  4OWW B;  4AH6 A;  1JJG A;  5LMN L;  4X62 L;  2I5M X;  2MFI A;  1QUQ A;  2K14 A;  1X55 A;  2XGT A;  1M90 C;  5GAH C;  4NXN Q;  1OXX K;  1UE7 A;  4P75 A;  2Q2H A;  3K81 C;  1TXY A;  3HOX H;  1HNZ L;  1Y1W G;  3TRE A;  1KC8 C;  1VQM A;  4DV0 Q;  5ELN A;  4OO1 I;  2NN6 G;  4DK6 C;  4GKJ L;  2WAQ E;  1PH6 A;  3HOW H;  2UU9 Q;  3B6Y A;  4A3G G;  1TWG H;  4DR2 Q;  1CKN A;  2VY3 A;  4LF5 Q;  1PH9 A;  5C3E H;  1XNQ Q;  3CD6 A;  3F2C A;  2IT1 A;  5C4J H;  3VDY A;  3D31 A;  2CCZ A;  3AFP A;  3HOU H;  4IJH A;  1A0I A;  4LF8 Q;  2Z6K C;  5IYD H;  1K8A C;  2AWN A;  4DR3 Q;  1VQ5 A;  1JJC B;  1NTG A;  1K83 H;  1EYG A;  1G29 1;  2ZM6 L;  1IZ6 A;  2NVT H;  3ULJ A;  1V9P A;  4P71 A;  5C44 G;  4DPG A;  3TS2 A;  3AEV A;  4JI5 L;  4JI3 Q;  2B29 A;  3UDX A;  4OX9 Q;  3BZK A;  4DR6 L;  1L2F A;  1W2B A;  4LF6 Q;  3L7Z C;  5C4X H;  2N78 A;  1HR0 W;  1KRT A;  4JBW A;  1FJG Q;  1JMC A;  3CCV A;  2Z6K A;  1QVF A;  3NBH B;  4GLX A;  2R92 G;  5GRO A;  5HGQ A;  1RL2 A;  2Q2I A;  3KF6 B;  5IP7 G;  2EXD A;  4LF9 Q;  4A3J G;  2E2J H;  2D62 A;  1UWV A;  3W1G A;  2KEN A;  2V1C C;  4RMF A;  2CQO A;  3DLL A;  4L5R C;  4JI1 Q;  1N32 Q;  4DV2 Q;  1HZB A;  1X56 A;  2OWO A;  4AYB E;  2MO0 A;  3OTO Q;  4PZ6 A;  3RLO A;  2NVQ H;  1E1T A;  4OXP A;  5M3F H;  2HHH L;  3DM3 A;  3HOY G;  4X66 Q;  4DV3 L;  4HIK A;  2F4V Q;  4LFB Q;  4LW1 A;  2ALY B;  5BR8 L;  3CMA A;  2DGY A;  1L0W A;  4A3K G;  1HZC A;  5LMN Q;  4A3F G;  5JJL A;  1E24 A;  4X62 Q;  4BBR H;  3STB D;  2JA6 H;  2Q2U A;  1R9T H;  5IYB H;  1TWC H;  4X64 Q;  2OCE A;  3CCJ A;  4GN3 B;  2N8N A;  3PF4 A;  2PMZ E;  1N9W A;  4WJ4 A;  3F8T A;  1GVP A;  1D7Q A;  3EN2 A;  1HNZ Q;  1Y1V H;  4BXX G;  1YEZ A;  4JCV E;  1G6P A;  3I4N H;  1QZG A;  4QL5 A;  4GKJ Q;  1I6H H;  1B70 B;  4NXM L;  5K36 G;  1EFW A;  3CCL A;  3S1N H;  3PF5 A;  4LFC L;  2I5H A;  3PUW A;  4A3E G;  4R4Q A;  1QZH A;  2PQA B;  2EIF A;  4B3R L;  2ZJP A;  4UPA A;  3H3V I;  4L5T A;  1PV4 A;  1W3S A;  4MTN A;  3UDI A;  3BZC A;  3HKZ E;  3EBE A;  1OXS C;  3J81 j;  1HNX L;  4PMW A;  4DV7 L;  3S1R H;  1VQK A;  3H3V H;  4LFA L;  4UP9 A;  2CKZ B;  4DNI A;  2D0O A;  2ZM6 Q;  1HH2 P;  2Z0S A;  4JYA L;  1NJI C;  2VUM G;  4BBS H;  2HT1 A;  4DR1 L;  1AH9 A;  2VZA A;  1M1K C;  1UEB A;  3T1Y L;  4JI5 Q;  3T1H L;  1IBL L;  4DK3 C;  4IPH A;  3J7Z C;  1PH7 A;  4DR7 L;  4DR6 Q;  1C9O A;  2UXC L;  3M4Q A;  5FLM H;  4IFD G;  3U4V A;  3RN5 A;  2YTV A;  3M3Y H;  4B3S L;  1TWH H;  4OWT B;  2L15 A;  3H0G G;  1PVO A;  1KL9 A;  2N49 A;  2OTL A;  5LMU L;  4JC0 A;  4DUY L;  1X65 A;  2CWA A;  1VQP A;  1CSP A;  2BH2 A;  3RLF A;  2AHO B;  3IRB A;  4KI0 A;  1MKH A;  3CF5 A;  3J81 c;  2UUA Q;  3S17 H;  3W1B A;  4OON A;  1SR3 A;  4GOP A;  1XJV A;  4B3M L;  3GTO H;  3I4M G;  2NZO A;  2K52 A;  3KOJ A;  3S1Q H;  4DV5 L;  4A75 A;  2HHH Q;  4Y7N H;  1PYS B;  3FKI H;  3HOZ G;  4DV3 Q;  2YU9 H;  3CW2 C;  2YTY A;  1YHB A;  2LSS A;  5BR8 Q;  3AYH B;  3NEL A;  5AJ3 L;  4LUO A;  4P73 A;  4JBM A;  4JOI C;  1NBW A;  4YWL A;  4R4I A;  1ASZ A;  1EQR A;  1GO3 E;  2JA5 H;  1BVS A;  3Q8D A;  3MEF A;  1ASY A;  1VQ8 A;  3GTP H;  2ZJQ A;  2LXJ A;  4QIW E;  2YYZ A;  3F2D A;  2A8V A;  3TEH B;  1Q12 A;  1WCM H;  1L1O C;  5IT9 c;  1X3E A;  1TWF H;  4A3I H;  3J7A 5;  4K0K L;  4NXM Q;  1KIX A;  3GTK H;  3KJP A;  2B63 H;  1O7I A;  5IP9 G;  4LFC Q;  3PCO B;  2QGQ A;  4JI0 L;  5ELO A;  4QGU A;  2WP8 J;  3L0O A;  2MNA A;  4B3R Q;  4JOI A;  2R7F A;  4JBJ A;  4DAM A;  4DUZ L;  3I55 A;  4C3I H;  1HNX Q;  4R4C A;  5M5W H;  4DV7 Q;  3G4S A;  4QJF A;  4BY1 G;  1YIT A;  4A3D H;  2RCN A;  4LFA Q;  5FJ8 H;  4X65 Q;  1Y1W H;  4JYA Q;  2KHJ A;  4BY7 G;  4IPG A;  1JE5 A;  4A3B G;  3J81 i;  4TVA B;  4DR1 Q;  2R93 G;  3CC7 A;  5HY6 A;  1N34 L;  1T9H A;  1L1O A;  4AQY L;  3T1Y Q;  1Y14 B;  2HQL A;  1KHI A;  3PUY A;  4JI8 L;  3T1H Q;  1B8A A;  5M3M G;  1AE3 A;  1LTL A;  5C0X G;  3G71 A;  3CC2 A;  4DR7 Q;  4KHP L;  2UXC Q;  1P16 A;  1BKB A;  2DUD A;  2LXK A;  4HJ7 A;  1C7Y A;  2WB1 E;  4B3S Q;  2GVB A;  2ZTC A;  4UP8 A;  3CAM A;  1YBY A;  4YWK A;  1E7Z A;  3M85 A;  4L5S A;  1A62 A;  3S16 H;  3BJU A;  2NVX H;  1Q7Y C;  4HJ8 A;  2RHQ B;  5LMU Q;  1S72 A;  5JJK A;  4DUY Q;  2OQ0 A;  3HFZ B;  4GN4 B;  1IBL Q;  2JEA I;  2I0Q A;  3CCR A;  5GAD C;  3RLN A;  2CFM A;  4EQ5 A;  4B3M Q;  4IPC A;  3CPW A;  4DV5 Q;  3UDG A;  1I5F A;  4C2M H;  2F52 A;  4YHH L;  2GN5 A;  4JI7 L;  3NEM A;  1PH2 A;  1J5E Q;  4OO1 G;  3STB C;  3GTJ H;  3PO3 G;  1NY4 A;  2KHI A;  2ASB A;  4UP7 A;  1YJ9 A;  2QA4 A;  5IP7 H;  1VQA A;  2VQE L;  2XTI A;  3KDF B;  2K75 A;  1PHJ A;  1XNR L;  3ER0 A;  3KJO A;  1IYJ B;  2Q2T A;  2UUC L;  4LWC A;  5DLQ E;  3CCQ A;  3GDE A;  3M4O H;  2JK8 A;  2K4K A;  1XMO L;  2NVY H;  3U50 C;  4K0K Q;  1VQD A;  2OQK A;  3LGJ A;  3PUZ A;  4JI2 L;  4JV5 L;  2IY5 B;  4A3K H;  1QVC A;  3TQY A;  4DV6 L;  2KCT A;  4HJA A;  1SRO A;  4UY8 C;  4WJ3 M;  5H1S E;  3M4P A;  4P72 A;  4DUZ Q;  2PI2 E;  1PFS A;  2Y0S G;  3J80 c;  2E5L L;  1P8L A;  2VQF L;  3KF8 B;  2K50 A;  5LMN W;  1XMQ L;  4JBK A;  1VQJ A;  3KF6 A;  1U0L A;  1EQQ A;  1MJC A;  2UXB L;  3AQQ A;  3CCU A;  1N34 Q;  4DAY B;  4AQY Q;  4A3E H;  4LF4 L;  1YIJ A;  4KLK A;  5JEA G;  4YY3 L;  1SFO H;  3H15 A;  4A93 H;  1KXL A;  1K8G A;  3CME A;  5M3F G;  4IFD J;  1I94 L;  3PV0 A;  1X6O A;  2ZTE A;  3PUX A;  1VQB A;  3RR5 A;  2JEB I;  4OWX B;  3F1Z A;  5GAE C;  2JA6 G;  4BBR G;  5IYC G;  3HOV G;  5IYB G;  2VW9 A;  4YCU A;  4HJ9 A;  4HIO A;  1XTD A;  3K7A H;  4ALP A;  1N36 L;  4IFD I;  2WAQ G;  1MIU A;  2AKW B;  4YHH Q;  4JI7 Q;  2JA8 H;  3I4N G;  1B7Y B;  1JB7 A;  3K80 C;  2JA7 H;  1X3F A;  5GAG C;  5JJI A;  4IPD A;  3S2D H;  1VQC A;  4BA1 I;  5IY0 A;  1J6Q A;  2WFW A;  4XIG S;  2PQA A;  3A5Z B;  3E9H A;  2JA9 A;  1HNW L;  2VQE Q;  1VQG A;  3FHW A;  2B3G A;  4P74 A;  2GVA A;  3J80 i;  1N33 L;  1XNR Q;  1X54 A;  1K3R A;  1JJ2 A;  2MO1 A;  4X6A H;  4GOP B;  2K5V A;  3CP0 A;  2UUC Q;  5IE8 A;  2KCM A;  3ICE A;  1YHA A;  4IO9 A;  1KQS A;  2R7Z H;  1XMO Q;  1PA6 A;  1E3P A;  3I2Z A;  4JI2 Q;  4JV5 Q;  3CQZ H;  4A3L G;  1VQO A;  4IJL A;  3K8A A;  4DV6 Q;  3PO2 G;  1EOV A;  1X3G A;  3CXC A;  1CKO A;  4IOA A;  5FLM G;  2A1A A;  1K9M C;  4LF8 L;  1CSQ A;  1YVC A;  1IBM L;  3ULL A;  2E5L Q;  1BBU A;  4JI4 L;  2VQF Q;  2BA1 A;  2D0P A;  3KYH C;  4JI6 L;  1XMQ Q;  2VS1 A;  4R4O A;  4NB3 A;  4APV A;  1VQ9 A;  1VS0 A;  4LUV A;  4AYB G;  1HR0 L;  3GD7 A;  2UXB Q;  4R1J A;  3ZJY C;  1H95 A;  1NMF A;  3HKS A;  4GNX B;  4J15 A;  3CC4 A;  4LF4 Q;  3K0X A;  3UE0 A;  4YY3 Q;  5C0X J;  1YJW A;  2AWO A;  1QUQ B;  2ZTD A;  4DR4 L;  1I94 Q;  4R4T A;  3CCM A;  2OTJ A;  4A3C G;  1HZA A;  2NN6 I;  4FDB A;  1WOC A;  4MNO A;  4DV4 L;  4L5Q A;  4A3B H;  4LF9 L;  4A3M G;  1OXV A;  2ZJR A;  5C0X I;  1AE2 A;  3CCS A;  1N36 Q;  3KFU A;  4LUZ A;  3ULP A;  4A3G H;  4POG A;  1X9N A;  1LUZ A;  1CKN B;  1Q82 C;  1S3O A;  2HIX A;  2IHF A;  4POF A;  4O2D A;  1LM0 A;  1A8V A;  4JG2 A;  1XPU A;  5EAY A;  2B63 G;  4IOC A;  3S1M H;  2JJQ A;  3KLW A;  1SLJ A;  4DV1 L;  3S2H H;  1NMG A;  5IWA L;  3GTQ H;  1CUK A;  3HKZ G;  1D8L A;  2YTX A;  1HNW Q;  1A63 A;  4X64 L;  1VQ4 A;  4YCW A;  1N33 Q;  5C44 H;  1DGS A;  1Z47 A;  1KAW A;  4A3D G;  1VCI A;  3RNU A;  2MQH A;  5FJ8 G;  5FLX c;  3HOX G;  4B3T L;  2FXQ A;  1PYB A;  4BA2 I;  1YNX A;  4GLA C;  1LYL A;  1VQN A;  3A5U A;  1YZ6 A;  4A4I A;  2ES2 A;  3HOW G;  2HIV A;  1HJP A;  2C35 B;  1Q86 C;  3PO3 H;  3EIV A;  3GO5 A;  5AJ3 Q;  5C3E G;  2R92 H;  1K0R A;  4GKK L;  4GS3 A;  1Q1B A;  3CPF A;  1KD1 C;  3HOU G;  1IBM Q;  4A3J H;  3GTM H;  1FGU A;  5IYD G;  3UE1 A;  1VQL A;  4JI4 Q;  4JI6 Q;  5E7N A;  2AMC B;  1XPO A;  4PG3 A;  3PIO A;  4TQU S;  3UDF A;  4PZ8 A;  2ID0 A;  1HR0 Q;  3HOY H;  4YCV A;  2KBN A;  3S14 H;  3TS0 A;  1JT8 A;  1G51 A;  1SN8 A;  3S24 A;  3CCE A;  2PNH A;  4QQB X;  2BH8 A;  4A3F H;  4JI0 Q;  1C0A A;  5JEA J;  3GTG H;  4NPS A;  4DR4 Q;  5C4X G;  3OYY A;  4LF7 L;  2K5N A;  1OXT A;  4XTC S;  1YI2 A;  2UUB L;  1PH1 A;  1WYD A;  3E0E A;  3D0F A;  1IL2 A;  2F3I A;  4BXX H;  4DV4 Q;  2UUA L;  3KDF A;  3PUV A;  2JQO A;  1EIY B; 
#chains in the Genus database with same CATH topology
 2NZH A;  1TU2 B;  1Z9F A;  3NPP A;  5CR3 A;  2HUG A;  5EKI A;  1PMR A;  3J80 E;  4MZ9 A;  3TDQ A;  3WOE A;  4DXF A;  2E8G A;  4X3S A;  2NVQ B;  4H02 A;  1MHW C;  1GD7 A;  3DUZ A;  3I7F A;  1ZYR D;  1SJH D;  1R9T B;  2A73 B;  1OTC A;  1I3Q H;  1N8R C;  1VQI A;  4RKB A;  1HZ9 A;  1S5F D;  1E22 A;  2WB1 G;  3VYS A;  3RZO H;  1I6H B;  1NR4 A;  2QEJ C;  1UE1 A;  2R3Z A;  1NSN S;  2Z9H A;  4EQO A;  1G2T A;  1O78 A;  3JAM c;  4XQN A;  3MEH A;  3MC0 B;  2X6G A;  2LY7 A;  3QO2 A;  4DV0 L;  2F0E A;  2J4X A;  4GOP C;  1GUT A;  1ENF A;  2F0J A;  1JWM D;  2V4D A;  1JIC A;  3E9I A;  1TT2 A;  1QVG A;  1SE8 A;  2X6L A;  3TN2 A;  4OEM B;  2F0G A;  4CHT B;  2F03 A;  1SMX A;  1YNJ D;  3NBI A;  1XPR A;  3MFY A;  2B8F A;  5M5X B;  5IP9 H;  3G6E A;  1STG A;  2N3S A;  1JWS D;  1Y8N B;  3FP9 A;  2JXM B;  4OX9 L;  4EX5 A;  1B9N A;  4GNX C;  2IX1 A;  4DR5 Q;  4CBV A;  3VA7 A;  1J5E L;  1PH4 A;  1FJG L;  2IX0 A;  1Q46 A;  3AFQ A;  4YWM A;  5M5Y H;  3V2T A;  1VQ7 A;  1LTA D;  4K6D A;  1YHQ A;  2JA5 G;  3PIP A;  1PZI D;  2OEO A;  3GTL H;  2R6G A;  1N32 L;  4JI1 L;  3F2B A;  3M7N A;  1Q8K A;  3A8J E;  3MXN B;  4EQP A;  4FF1 A;  2JE6 I;  2YV5 A;  3OTO L;  3SHL A;  5C5L A;  4X66 L;  2F4V L;  4RG1 A;  4OWW B;  4RHS A;  3SK5 A;  1FD7 D;  1V1P B;  4X3U A;  1LT3 D;  2B63 B;  2PW5 A;  1HTL D;  1PFM A;  2XGT A;  2PZT A;  3HKZ B;  4C3I G;  4P75 A;  4TKO B;  3K81 C;  3S9W A;  1Y1W G;  3ND8 A;  3TRE A;  4OHJ A;  5C6A A;  2E76 C;  3B6Y A;  4HSP A;  1TWG H;  1B50 A;  1HPC A;  3D6W A;  1NR2 A;  4LF5 Q;  3CD6 A;  2F0T A;  3I8Z A;  2A69 D;  1JQY D;  5C4J H;  3AFP A;  4GZY C;  4WFN 3;  4IJH A;  2WKC A;  5C3E B;  1D1K A;  5CYU A;  1BNZ A;  4JPB W;  1G29 1;  1IZ6 A;  4KY6 A;  3ULJ A;  1V9P A;  5KND A;  3U9O A;  3UDX A;  1SNP A;  2EYH A;  3DEO A;  1L2F A;  2CH4 W;  2E75 C;  4I65 A;  1JMC A;  4RHR A;  2Z6K A;  1QVF A;  3NBH B;  2R92 G;  1ZYR C;  2O4X A;  1RL2 A;  2F1M A;  1ENA A;  4LF9 Q;  2E2J H;  1X3Q A;  3DLL A;  1I6V C;  4QIW B;  4DV2 Q;  1CK1 A;  2MO0 A;  1IW7 C;  3ONA B;  2NVQ H;  4K6L A;  3HOY G;  2TSS A;  1SE2 A;  4HIK A;  5BR8 L;  2DGY A;  3J81 L;  1L0W A;  2KJX A;  1TII D;  5LMN Q;  1DOK A;  3STB D;  4J6H A;  1R9T H;  4I7Z C;  4QB4 A;  4DGZ A;  3PF4 A;  2JP1 A;  1H9M A;  1TWC B;  4JCV E;  1BUV T;  2SEB D;  3NUC A;  1WVL A;  4GKJ Q;  1HQR D;  1I6H H;  5K36 G;  1EFW A;  3CCL A;  1PXU A;  3PUW A;  4A3E G;  4FVM A;  3LX0 A;  3C1E A;  3S1N B;  1YNJ C;  5IT9 L;  1PV4 A;  1W3S A;  3HKZ E;  1SFO B;  4A93 B;  3H3V H;  2O5J C;  4DNI A;  4DA2 A;  4JYA L;  1KAA A;  1X3P A;  1VF7 A;  1SSO A;  1M1K C;  3T1Y L;  3T1H L;  4BBS B;  4IPH A;  5G3L F;  4DR7 L;  1C9O A;  5FLM H;  1B1Z A;  4B3S L;  1TWH H;  2Q8I B;  1E2W A;  1H9S A;  2L15 A;  3H0G G;  1ET9 A;  3GQB A;  1FNW A;  5LMU L;  4JC0 A;  1VQP A;  1CSP A;  4FXD A;  2AHO B;  3CF5 A;  2OF1 A;  3W1B A;  5EBD A;  1SR3 A;  3I4M G;  1PFN A;  3IL8 A;  1B3Q A;  3GTO H;  2K52 A;  3KOJ A;  1FGB D;  3HRZ C;  4F87 A;  4FP5 D;  2HHH Q;  1LT6 D;  1PYS B;  1SYG A;  3VYT A;  1O7Y A;  4LUO A;  4P73 A;  5AJ3 L;  4Y7N B;  1NBW A;  3CQZ B;  2OXP A;  1EQR A;  2JA5 H;  2FFK B;  3TME A;  2HD3 A;  3Q8D A;  1ASY A;  1VQ8 A;  1HA5 A;  2LXJ A;  4QIW E;  2A8V A;  3D8G A;  3J7A 5;  1L1O C;  1C4Q A;  1SYD A;  3KJP A;  3K57 A;  2B63 H;  4JI0 L;  2QGQ A;  1WCM B;  1TWF B;  1ILQ A;  2WP8 J;  4L6T B;  4JBJ A;  4C3I H;  1HNX Q;  4BY1 G;  4LFA Q;  1Y1W H;  3KLS X;  4CJ0 B;  2XVS A;  1ET6 A;  4A3B G;  1EEF D;  5HY6 A;  1N34 L;  1WTX A;  2PO4 A;  1Y14 B;  3J80 L;  1KHI A;  5M3M G;  1AE3 A;  3CC2 A;  3A55 A;  1BKB A;  2DUD A;  3Q0A A;  4UP8 A;  3X3N A;  1IHZ A;  1YBY A;  2XSC A;  3BJU A;  1Q7Y C;  5JJK A;  2G5D A;  1F9P A;  1EYC A;  3HFZ B;  1DYQ A;  2I0Q A;  2L4N A;  2CFM A;  3TZU A;  4B3M Q;  3KLS A;  4OEL B;  1WTO A;  2B8G A;  5E3F A;  3HP3 A;  1PH2 A;  3N6R A;  1J5E Q;  4OO1 G;  3STB C;  4C2M B;  5C3X A;  1G91 A;  4UP7 A;  1YJ9 A;  2QA4 A;  1S4Z A;  1FNU A;  2K75 A;  5ELB A;  4QMG A;  1SJE D;  2E2D C;  5CBE E;  3M4Y A;  2FMC A;  1LAC A;  4K0K Q;  1EIG A;  3LGJ A;  4H0L C;  2WII B;  1SBB B;  2WIN B;  3QG1 A;  4WJ3 M;  1GXD C;  4G7O C;  4DUZ Q;  4A3F B;  2EOT A;  2VQF L;  4ZKC B;  1KAB A;  3Q6S A;  3HEJ A;  1U0L A;  1EQQ A;  1BCP D;  2A74 C;  1HQM C;  2WKD A;  3TP5 A;  5K36 H;  1F2Z A;  4H44 C;  4AQY Q;  4A3E H;  1STA A;  1SFO H;  4A93 H;  4HMI A;  4R8I A;  2RDH A;  5TSS A;  1GOZ A;  3UI2 A;  4BBR G;  5IYC G;  3HOV G;  4HJ9 A;  3K59 A;  4HIO A;  1XTD A;  5T1G A;  5CMD A;  4K8I A;  3NK9 A;  4OL7 A;  2WAQ G;  2EYJ A;  2B2V C;  5F2D A;  2MUY A;  5JJI A;  1UEA B;  2EJG C;  4NKL A;  4DK1 A;  4BA1 I;  1SE3 A;  4RGT A;  3MAQ A;  2PQA A;  2VQE Q;  2AQ2 B;  1JJ2 A;  4RCN A;  2MO1 A;  2UUC Q;  3BS1 A;  3ICE A;  1YHA A;  4P2C B;  4IO9 A;  2KHS A;  3KBX A;  4JI2 Q;  3CQZ H;  2CH4 A;  2NTT A;  5DM6 3;  4MHE A;  5FLX L;  1SE4 A;  2A1A A;  4LF8 L;  1BOS A;  3S15 B;  4K5W A;  2E5L Q;  1BBU A;  3SEB A;  3H09 A;  5NUC A;  4JI6 L;  1XMQ Q;  4K2L A;  4RGO S;  1VS0 A;  4EVO A;  5LHY 1;  1HR0 L;  4IN3 A;  2MPM A;  5DNF A;  3UE0 A;  4QF4 A;  1MBY A;  1Z6H A;  2A6E C;  1U4L A;  4FDB A;  4JK1 C;  2O2L D;  4MNO A;  4R9W A;  2EYP A;  4A3B H;  2NN6 H;  4A3M G;  4XQQ A;  3CCS A;  1N36 Q;  3ULP A;  4BY7 B;  4POG A;  1LUZ A;  5EJW A;  3URY A;  4POF A;  3TP8 A;  1EYA A;  1F2L A;  3KLW A;  1SLJ A;  1DGS A;  5JVG 3;  4A3D G;  3LWU A;  2MQH A;  3HOX G;  1PYB A;  2Z1C A;  4ZUI A;  3VYR A;  1PZJ D;  1VQN A;  1YZ6 A;  2ES2 A;  2HIV A;  3EIV A;  5AJ3 Q;  5CV4 A;  1K0R A;  1KD1 C;  3DXJ C;  4JI4 Q;  4ZQ3 A;  2QCP X;  3T13 A;  3PIO A;  4TQU S;  1HUM A;  2K5Q A;  4PZ8 A;  2DJG C;  3CCE A;  2PCF B;  4A3F H;  4JI0 Q;  4RKL A;  4K2K A;  3GTG H;  4DR4 Q;  1K28 A;  5C4X G;  3EJI A;  3T53 B;  1PH1 A;  1JR0 D;  1IL2 A;  2Y0S B;  4DV4 Q;  4B9X A;  5EPL A;  3KDF A;  1EOT A;  4ME5 A;  2JQO A;  2ATW A;  3TRZ A;  4KD3 A;  4N8F A;  1EIF A;  3I70 A;  1MI2 A;  2DNC A;  1A2U A;  5IGD A;  4DR5 L;  1PH5 A;  4ZYS A;  3K5O A;  5IYC H;  3HOV H;  4HAE A;  4O0A A;  3M9B A;  1JCK B;  2JA6 B;  1GKH A;  1VQH A;  1V43 A;  4IZ8 A;  2L11 A;  2E2H H;  3RN2 A;  2G9H D;  1O7L A;  2WV6 D;  2N55 A;  2AQ3 B;  1HFG A;  2BA0 A;  4DNT B;  3VYU A;  2IHE A;  1Q81 C;  2PW7 A;  1WJJ A;  4CKC A;  3ERS X;  2I5L X;  4A76 A;  1U5K A;  4G57 A;  3U9S A;  1WTQ A;  1RCV D;  4IUV A;  1QOH A;  5L37 A;  4LF5 L;  3S15 H;  2BE5 D;  4IUN A;  3A0J A;  3OIP A;  2EZV A;  1U4M A;  1B3A A;  4KJO A;  1KDB A;  1HXY D;  1FL0 A;  3PQI A;  1TS5 A;  4J8Q A;  3N52 A;  4XYQ A;  2B2Y C;  4AYB B;  3EFX D;  1QNU A;  2R7Z G;  1U4P A;  1VQ6 A;  3T16 A;  3FKI G;  4QUF A;  4Y52 H;  3S1Q B;  5I2Y A;  1QNK A;  1NE3 A;  1AN8 A;  4OGQ C;  4XT1 B;  2JN4 A;  2A19 A;  2Y0S E;  4QY7 A;  4A3M H;  4BY7 H;  4OIK A;  3JAM i;  2UXD Q;  1IBK Q;  4DV2 L;  3SGI A;  3TP7 A;  2K01 A;  2K5H A;  4YIJ A;  1IXR A;  4GNX A;  4GN5 A;  3NEN A;  4AH6 A;  5LMN L;  1IYU A;  1A15 A;  5E4W C;  4HMJ A;  1QUQ A;  2F4I A;  1X55 A;  3NQT A;  3QB3 A;  3HOX H;  1TXY A;  3M7G A;  5M5W B;  4DK6 C;  3BYY B;  4GKJ L;  1EL0 A;  1PRT F;  4A3G G;  1CKN A;  2VY3 A;  3SE0 A;  2IT1 A;  3VDY A;  2EE1 A;  1J8I A;  1TWG B;  1A0I A;  2IPK D;  4LF8 Q;  1K8A C;  1JOQ A;  1VQ5 A;  5IGE A;  5C4J B;  1NTG A;  3EVQ A;  2RKS A;  2NVT H;  3I72 A;  2ZXR A;  5K5P A;  5C44 G;  1XX8 A;  1H9K A;  4JI3 Q;  2B29 A;  1VF5 C;  2R61 A;  5C4X H;  3MXP A;  3OWE B;  1K3B C;  5HGQ A;  5CGK A;  4A3J G;  2V1C C;  3NSW A;  2CQO A;  1X56 A;  3W3A A;  4AYB E;  2E2J B;  3FMC A;  4PZ6 A;  1E1T A;  1TKW B;  2HHH L;  1I4G A;  4LFB Q;  1K8O A;  5JJL A;  1PRT B;  2O5I C;  2JA6 H;  1PYW D;  2EYF A;  5IYB H;  1F9S A;  4WJ4 A;  1H9J A;  1I4Q A;  2RBM A;  1HNZ Q;  1YEZ A;  5ISR A;  1MGS A;  2D2C C;  5IOC A;  2BE5 C;  1IW7 D;  1EY6 A;  4H7B A;  3PF5 A;  1SNC A;  4C3J G;  1STY A;  4RWS C;  2EIF A;  5KYI A;  2WB1 B;  1BDO A;  5CBA E;  4FF4 A;  3H3V I;  4L5T A;  3J81 j;  3BZC A;  1HNX L;  1SAP A;  1C48 A;  4LFA L;  2CKZ B;  2D0O A;  2Z0S A;  2VUM G;  1R4Q B;  2HT1 A;  1L0Y B;  2VZA A;  1UEB A;  2EYL A;  3Q24 A;  3H3V C;  3J7Z C;  4DR6 Q;  2EYO A;  3JAM E;  2X69 A;  3I3C A;  2PZU A;  5I6Y A;  4Q0F A;  2N49 A;  1CQF A;  1TWH B;  1X65 A;  3RLF A;  2F0O A;  3I73 A;  1MKH A;  3S17 H;  4FYD A;  4OON A;  1XJV A;  4B3M L;  3K5N A;  2NZO A;  3S1Q H;  4R8N A;  2ZT9 C;  3FKI H;  3HOZ G;  3GTO B;  2Z8L A;  3AYH B;  4LAA A;  1PZK D;  2Z4I A;  4JOI C;  4R4I A;  1ASZ A;  1BVS A;  5HUR A;  4I7A A;  4IUP A;  3GTP H;  2ZJQ A;  2KED A;  2JA5 B;  2FHT A;  1TS3 A;  3TEH B;  2F3W A;  1B2T A;  4K0K L;  3P75 A;  1CM9 A;  3FRP B;  1U4R A;  1O7I A;  3O13 A;  1KNA A;  4LFC Q;  3KLR A;  2H4O A;  2B2W C;  5M9O A;  2R7F A;  4DUZ L;  2K03 A;  1NAP A;  2F0P A;  5M5W H;  1J9O A;  2RCN A;  2ICE C;  4C3I B;  1JE5 A;  4DR1 Q;  2R93 G;  1II3 A;  4PV1 C;  1Y1W B;  1D5M C;  1L1O A;  4AQY L;  4JI8 L;  3PUY A;  1LTL A;  1CZG A;  4KJN A;  4HJ7 A;  2WB1 E;  2QF7 A;  3CAM A;  1E7Z A;  3S16 H;  1D5X C;  2RHQ B;  4F8M A;  3S1M B;  3OPO A;  4QUC A;  1WTV A;  1MD2 D;  3KK7 A;  4GN4 B;  2XWJ B;  1LT5 D;  5GAD C;  3RLN A;  4EQ5 A;  1CHP D;  2RSN A;  1NNX A;  3CPW A;  3UDG A;  2GN5 A;  2HDL A;  3PO3 G;  2ASB A;  4JVZ A;  1TVX A;  2VQE L;  2EY5 A;  1PHJ A;  2R92 B;  1DD2 A;  1HRJ A;  3I4L A;  2Q2T A;  2UUC L;  3V05 A;  4U67 3;  3TBI B;  3U50 C;  3PUZ A;  2K05 A;  3MWY W;  4JI2 L;  2IY5 B;  3HOY B;  1QVC A;  2KCT A;  1STN A;  4HJA A;  4UY8 C;  5H1S E;  4CDE C;  3M4P A;  4P72 A;  1EEI D;  3DHQ A;  2E5L L;  5ELE A;  1XMQ L;  1PTO D;  1VQJ A;  3IKJ A;  3KF6 A;  1EQV A;  1V8Q A;  3AQQ A;  2XWB B;  3CCU A;  1M4V A;  3CME A;  1HTP A;  5M3F G;  4A3E B;  1RTN A;  2CQA A;  2ZTE A;  3PUX A;  3RUZ A;  3OHX C;  3I91 A;  4OWX B;  3ND9 A;  3F1Z A;  5IOD A;  4YCU A;  5DM7 3;  1A2T A;  1N36 L;  2MP1 A;  5EKL A;  4K5X A;  2GA4 B;  2RDG A;  4HED A;  4JI7 Q;  2F0V A;  3I4N G;  1JB7 A;  2QIL A;  4HCS A;  1X3F A;  3X3M A;  4EGV A;  4IPD A;  1RHP A;  3GV6 A;  1GHK A;  5IY0 A;  2HCC A;  2WFW A;  1CZW A;  3H0G B;  3FHW A;  5D65 A;  1XNR Q;  1K3R A;  3ITP A;  3Q23 A;  2NZ1 D;  1S5B D;  1XMO Q;  3I4M B;  1HHV A;  5JOB A;  2B2V A;  1B4O A;  4A3L G;  4ZAI A;  4NP5 A;  3PO2 G;  3CXC A;  3P7J A;  5A2Q E;  1ICW A;  4KK7 A;  2JSO A;  2SDF A;  4JI4 L;  2E2I B;  5BN3 A;  3OIQ A;  2LS0 1;  2VS1 A;  3ERO A;  1CQV A;  2D5D A;  3CHB D;  4C3H G;  1QB5 D;  2UXB Q;  1LTI D;  1I50 B;  1NMF A;  4J15 A;  3CC4 A;  2Z6B A;  1LT4 D;  4KMU C;  4Z9C B;  3K0X A;  4YY3 Q;  1TS2 A;  2A6H D;  3SDZ A;  5C4H A;  3SR1 A;  4DR4 L;  4R4T A;  3RZD B;  2KOL A;  1SNM A;  4A3C G;  2NN6 I;  1STE A;  4N8X 1;  4DV4 L;  4L5Q A;  4BY1 B;  2QDL A;  4A3B B;  1Q82 C;  1R4P B;  1U9R A;  2L5T A;  3SK8 A;  3V96 A;  5E1F A;  1V1O A;  1XPU A;  5M3M B;  1GUW A;  4RFB A;  3S1M H;  4DU9 A;  4G7Z C;  1HNW Q;  5DAU A;  4X64 L;  1EY7 A;  2A6E D;  1Z47 A;  4Q5V A;  4LJZ C;  5FJ8 G;  4BA2 I;  3MFG A;  1STB A;  2NTS A;  4V19 0;  4A4I A;  3PO3 H;  1Q86 C;  3GO5 A;  2R92 H;  5FKA C;  3GP7 A;  3CPF A;  3HOU G;  1IBM Q;  1AFP A;  1D5Z C;  2K28 A;  2DN8 A;  3UE1 A;  3EA6 A;  1PTO C;  5IGF A;  5JPM C;  5C5M A;  5E7N A;  1WD1 A;  2L9H A;  4G7H C;  3HOY H;  2ID0 A;  3J7A F;  3S14 H;  1KDC A;  1D6E C;  1G51 A;  1SN8 A;  3JAM L;  4QQB X;  3DMU A;  1OXT A;  1LTG D;  3D0F A;  3GTG B;  2F3I A;  3HS0 C;  3DEP A;  3PUV A;  3A56 A;  2PYK A;  4JI8 Q;  3L3O C;  3K58 A;  1W6K A;  1FVI A;  1GM5 A;  3PGZ A;  1BQQ T;  4DV1 Q;  3I4O A;  4ID6 A;  2BCO A;  2C9O A;  5J3B A;  4BBR B;  3HOV B;  1EUJ A;  4HCE A;  1SXT A;  2UXD L;  2HDM A;  1IBK L;  2H5X A;  2EY2 A;  1Y1V G;  4ABN A;  2FMM A;  5KRU A;  3PSI A;  2WAQ B;  4DAY A;  2E2H B;  1H9S B;  3H0G H;  4UHV A;  4GKK Q;  2EY1 A;  3QWN A;  3A74 A;  3W5O A;  1A3V A;  2R7D A;  1VMP A;  1TWA H;  3ERQ A;  1C8C A;  3I4M H;  1CA5 A;  3U58 A;  1HCZ A;  3S1R B;  1SYE A;  4KHZ A;  4A3L H;  2A6H C;  3VR6 A;  3PO2 H;  3PIP 3;  1ONL A;  5GQO A;  3R3O A;  1WI5 A;  3D4D A;  1CKM A;  4KKU A;  3U4Z A;  3NWT A;  2E2I H;  2JA7 G;  2JA8 G;  3OMG A;  1SNO A;  4AIM A;  1XYI A;  3K7U C;  1UE6 A;  3I56 A;  1EU3 A;  4C3H H;  1I50 H;  1DOM A;  3WWV A;  3QOJ A;  2EQS A;  1EY0 A;  1SMY C;  4JI3 L;  1AW7 A;  1WFQ A;  1D2B A;  2A68 C;  4UAI A;  3RZD H;  1KRS A;  1QWY A;  4OIJ A;  3BU2 A;  1M8A A;  4A3C H;  4ODG A;  4HJ5 A;  4BY1 H;  2YU9 B;  1I4H A;  4LNQ A;  3SK4 A;  4FXK C;  2PZW A;  5C3W A;  3G48 A;  4A3M B;  1TR5 A;  2AQ1 B;  4ME3 A;  5M3M H;  1BBW A;  2B2Y A;  3MA2 B;  2K1B A;  4A3I G;  4CJ2 C;  4LFB L;  2CWP A;  5COR A;  5C4Z A;  2QEX A;  1PH3 A;  2F0D A;  5D3I B;  1JJG A;  1BCP F;  1EY9 A;  4XDX A;  2I5M X;  2MFI A;  2TMP A;  3OWF A;  2K14 A;  3QR8 A;  5GAH C;  4NXN Q;  2M00 A;  2MJ8 A;  4E6I A;  1OXX K;  3R8B A;  2Q2H A;  1LO5 D;  1Q8I A;  1HNZ L;  1BXT A;  3G6J B;  1KC8 C;  1SND A;  1VQM A;  5ELN A;  4A3D B;  4DN4 M;  3HOX B;  2WAQ E;  4XXE A;  2UU9 Q;  4V0B A;  4OO1 H;  3D4W A;  4DR2 Q;  2BDN A;  1PH9 A;  1XNQ Q;  3F2C A;  3J7A V;  5CC4 A;  3C3L A;  3D31 A;  3HOU H;  2HQE A;  2MHV A;  4PNY A;  2K7V A;  2AWN A;  1EQT A;  4DR3 Q;  1K83 H;  1EYG A;  5I2X A;  4P71 A;  2NVX B;  4KN7 C;  4DPG A;  2F0S A;  2FIN B;  2QW7 A;  2XIW A;  2NVT B;  2BOS A;  3NTH A;  4DR6 L;  1S5E D;  1W2B A;  4LF6 Q;  3L7Z C;  3BG3 A;  3QIA A;  1KRT A;  4JBW A;  1QE6 A;  2M2L A;  3CCV A;  2K6A A;  5C4X B;  4GLX A;  2RCF A;  1BF4 A;  1BCP B;  4C1N I;  4CKE A;  2KEN A;  4RMF A;  3TP6 A;  2OWO A;  1WD0 A;  4ZUJ A;  5IGC A;  1CFM A;  3M4O B;  2ALY B;  1LTB D;  5A2Q L;  1TY2 A;  1WTR A;  4A3K G;  2CHB D;  1Z7T A;  4X62 Q;  4BBR H;  2Q2U A;  4LMQ D;  4X64 Q;  3A7A B;  5A35 A;  4C1N K;  3EN2 A;  3KF8 A;  1Y1V H;  1AZQ A;  4BXX G;  3R2I A;  4CGY B;  1QZG A;  1LAB A;  4EQN A;  1B70 B;  1VDZ A;  1IKM A;  1QJO A;  2CW0 C;  4LFC L;  4KY7 A;  3OSO A;  1IYV A;  2B2T C;  2G9D A;  1QZH A;  2PQA B;  4ZLT F;  2K5D A;  2L1B A;  2ZJP A;  4UPA A;  4MTN A;  2HCI A;  3UDI A;  5FO8 B;  1OXS C;  4PMW A;  3S1R H;  3QJY A;  1PDQ A;  1PRT D;  4UP9 A;  2ZM6 Q;  1HH2 P;  1NJI C;  1OO9 B;  4DR1 L;  4JI5 Q;  4DK3 C;  1KLU D;  4IFD G;  3RN5 A;  3M3Y H;  4DFA A;  3BZD B;  3D6C A;  4NDX A;  2CWA A;  5D3D A;  3IRB A;  4KI0 A;  3J81 c;  4GOP A;  2EXZ A;  3S17 B;  2NYZ D;  5LL6 X;  4DV3 Q;  2YU9 H;  2YTY A;  2R7Z B;  2VXW A;  3E3X A;  3FKI B;  3D4R A;  1GO3 E;  4DAV A;  2SNM A;  3C46 A;  2F0L A;  2NB0 A;  2YYZ A;  5HGT A;  3GTP B;  5IT9 c;  4A3I H;  4NXM Q;  5IP9 G;  5J39 A;  1SYB A;  5KGU A;  2MGS A;  3L0O A;  2MNA A;  4B3R Q;  4JOI A;  2AUK A;  3WDN A;  4ZKB B;  4HSV A;  3BDC A;  4R4C A;  4DV7 Q;  4A3D H;  3G4S A;  4QJF A;  1YIT A;  5ELC A;  2KHJ A;  3FPU B;  2EPB A;  4IPG A;  4TVA B;  3QOL A;  3CC7 A;  4CDD C;  1T9H A;  1BO0 A;  1IBL Q;  3MXN A;  3G71 A;  5C0X G;  4KHP L;  2UXC Q;  4A3G B;  1C7Y A;  2J7Z A;  1EY8 A;  2ZTC A;  4CDC C;  2B2W A;  1A62 A;  2NVX H;  4DUY Q;  2OQ0 A;  3DWP A;  2JEA I;  3S16 B;  4M1U B;  5D14 A;  2EY6 A;  2VB2 X;  3IFD A;  5C44 B;  4DV5 Q;  2F0W A;  2F52 A;  4JI7 L;  3FDT A;  1PLF A;  2KHI A;  5KIX A;  3T4A C;  4L8J A;  1DZ1 A;  3KDF B;  1EU4 A;  1XNR L;  4BS9 A;  1EY5 A;  1IYJ B;  3TSS A;  4LWC A;  4A3J B;  3GTM B;  3M4O H;  2JK8 A;  5EBC A;  1XMO L;  1DCZ A;  1VQD A;  2SNS A;  3I90 A;  4A3K H;  4O42 A;  3NHH A;  3H6M A;  1EFI D;  3A8I E;  4WRD A;  2K04 A;  1PRT C;  3J80 c;  2KVM A;  3NBH A;  3KF8 B;  1JOR A;  4JBK A;  4ILW A;  2UXB L;  1UUP A;  3P1H A;  5BN5 A;  3MTS A;  1HA6 A;  4X3T A;  4KLK A;  5JEA G;  3DM1 A;  4YY3 L;  3T56 B;  1KXL A;  1K8G A;  2PQE A;  3R2T A;  4IFD J;  3PV0 A;  3OMC A;  4C3J B;  5JJZ A;  2RA4 A;  2JEB I;  5CV7 A;  1DON A;  1Y8O B;  4DXG A;  1JC7 A;  5KYL A;  3K7A H;  1GHJ A;  2VUM B;  2AKW B;  2H1E A;  4NW2 A;  4DNR B;  4IFD H;  5KNB A;  4YHH Q;  4L63 B;  3K80 C;  5CV5 A;  2I46 A;  3NTI A;  1VQC A;  1J6Q A;  3HZX A;  4HN7 A;  1HNW L;  2JA9 A;  1VQG A;  2JYO A;  4P74 A;  4C56 C;  4GOP B;  1CTM A;  3CP0 A;  4ZRZ A;  2KCM A;  2R7Z H;  3BYT B;  2DY7 A;  1E3P A;  3I2Z A;  4JV5 Q;  3TZD A;  3F2U A;  4PQX A;  1RJT A;  1UNS A;  3K8A A;  4DV6 Q;  1EOV A;  1X3G A;  3HOZ B;  1CKO A;  4WJW A;  3MXU A;  2L55 A;  5FLM G;  1YNN C;  1K9M C;  1YVC A;  1IBM L;  3CRL C;  4H13 C;  2D0P A;  1H9R A;  3KYH C;  3C1F A;  4R4O A;  3KBG A;  4APV A;  2L12 A;  2KCN A;  4TSS A;  3GD7 A;  4R1J A;  3CKI B;  1GUG A;  3HKS A;  4GNX B;  4LF4 Q;  2ICI A;  5C0X J;  1YJW A;  2B2U C;  1PFB A;  2KA7 A;  1QUQ B;  2ZTD A;  1I94 Q;  4M8A A;  3G7L A;  3CCM A;  2OTJ A;  5EGT A;  1JOO A;  1WOC A;  3CRK C;  5CV8 A;  3KUP A;  4JW0 A;  1I4X A;  3GV3 A;  1AE2 A;  3KFU A;  4LUZ A;  4A3G H;  5C0X H;  1X9N A;  1CKN B;  2R93 B;  4KKT A;  1ROD A;  1XWE A;  1QG7 A;  2RDF A;  1A8V A;  4JG2 A;  1RTO A;  5EAY A;  2C5C A;  3PIO 3;  2B63 G;  4F88 A;  2JJQ A;  4DV1 L;  1EIH A;  1NMG A;  3HKZ G;  4XYO A;  1D8L A;  2YTX A;  5IGG A;  5ELD A;  2F0Q A;  1BBX C;  5G3L D;  4YCW A;  5EKK A;  3VR5 A;  1QCB D;  1UAP A;  5C44 H;  1N33 Q;  1KAW A;  1VCI A;  3RNU A;  4FO2 A;  5FLX c;  3R93 A;  4GLA C;  5J22 A;  1EZ6 A;  2RVL A;  3A5U A;  3HOW G;  1HJP A;  2SOB A;  1ESR A;  2EYM A;  5C3E G;  3HOW B;  4GKK L;  4GS3 A;  1Q1B A;  3PO3 B;  4KY5 A;  4A3J H;  3GTM H;  1FGU A;  5IYD G;  2L0C A;  5LL6 S;  5FLX E;  1VQL A;  3E6Z X;  2AMC B;  1XPO A;  1RKN A;  2XN9 C;  1B53 A;  4NMZ A;  3K0Y A;  1EWH A;  3TS0 A;  4QCL A;  3S24 A;  2BH8 A;  3S14 B;  2Z4H A;  4K8J A;  5JEA J;  5ELF A;  2EDG A;  2K5N A;  2ZXO A;  4U68 A;  3E0E A;  1WYD A;  2EJM A;  2J0T D;  2KQ3 A;  1BR9 A;  1D1I A;  3LNN A;  4KV6 A;  3C2P A;  1CI3 M;  2UUA L;  3IAY A;  5EPK A;  1MSH A;  1EIY B;  1GUS A;  2I07 B;  1OXU A;  4GLV B;  5JEA H;  1L0X B;  4C3J H;  1MJE A;  4KHP Q;  2VL6 A;  3VR4 A;  1KDA A;  3L2P A;  4HIM A;  2VNU D;  4KN4 C;  5FO7 B;  3SXH A;  1NCV A;  5M3F B;  5IWA Q;  1JE4 A;  1ZXT A;  1G2S A;  4HID A;  2VUM H;  1YJN A;  4B3T Q;  5I4D A;  3RD4 A;  2NUC A;  1K73 C;  2ENB A;  1F2Y A;  2PPB C;  3I4N B;  3H94 A;  1E1O A;  1S40 A;  4A93 G;  1EWI A;  4XT3 B;  2RHS B;  3JC6 6;  1AP0 A;  2F0N A;  4NXN L;  2LKV A;  4X65 L;  1S5D D;  1Q1E A;  5IGB A;  4PZ7 A;  1TWA B;  1VQF A;  3HOZ H;  4BBS G;  1UE5 A;  2UU9 L;  2LMC B;  1FR3 A;  4DR2 L;  1SRU A;  1XNQ L;  2K33 A;  3PO2 B;  2D9U A;  1GJX A;  2RF4 A;  1XXG A;  4DR3 L;  4LF7 Q;  3OW2 A;  2UUB Q;  3CU7 A;  1RIP A;  5M5X H;  3E5S A;  3LWE A;  1AEX A;  1VQE A;  3MVV A;  4C3H B;  1X32 A;  1K8M A;  4LF6 L;  4MTK A;  2LFN A;  1PH8 A;  5AFW A;  2PMZ B;  2PI2 A;  1K0S A;  2R93 H;  4KTA A;  1V1Q A;  1CT1 D;  1L1O B;  1SMY D;  1WCM G;  1SYC A;  2A69 C;  3BVM A;  3OW7 A;  2A68 D;  1PTO F;  4DKA C;  1O80 A;  2DY8 A;  2DJF C;  2IX3 A;  3K5L A;  4X62 L;  1DM0 B;  1WTW A;  3GTK B;  4HTH A;  2IJ0 A;  1M90 C;  1Q3L A;  2OT2 A;  1JB3 A;  1UE7 A;  5J1Z A;  1ENC A;  4DV0 Q;  4OO1 I;  4PMC A;  1DOL A;  2NN6 G;  3AMU A;  1FNV A;  1PH6 A;  3HOW H;  2F0M A;  5C3E H;  1Y8P B;  2CCZ A;  4RGM A;  2Z6K C;  5IYD H;  2Q8T A;  5I9P A;  1F77 A;  1JJC B;  3HOU B;  2CVR A;  1A3U A;  2ZM6 L;  2FJ2 A;  1K83 B;  3TS2 A;  3FEW X;  3OOC A;  4JI5 L;  3AEV A;  1SEB D;  4OX9 Q;  3BZK A;  1E2Z A;  2N78 A;  1HR0 W;  1FJG Q;  1T5E A;  3E0J A;  1RDP D;  3AU7 A;  1PTO B;  1RF2 D;  3K6O A;  3HG9 A;  2IW3 A;  5GRO A;  1AZP A;  2Q2I A;  3AB9 A;  3KF6 B;  4HR7 B;  2EXD A;  5IP7 G;  3H91 A;  1JWU D;  3GTJ B;  2D62 A;  1UWV A;  3W1G A;  1N32 Q;  1EY4 A;  4L5R C;  4JI1 Q;  1HZB A;  1EZ8 A;  1Q90 A;  3OTO Q;  3RLO A;  4OXP A;  5M3F H;  3DM3 A;  4TRD A;  2WAC A;  4X66 Q;  4DV3 L;  2F4V Q;  4LW1 A;  3CMA A;  1EWC A;  4MIU A;  2NVY B;  1HZC A;  2F0F A;  4A3F G;  1E24 A;  3SVM A;  3NXW A;  1TWC H;  2OCE A;  4RH6 A;  3CCJ A;  4GN3 B;  2N8N A;  2PMZ E;  1N9W A;  4K14 A;  3F8T A;  1GVP A;  1D7Q A;  1A3T A;  2ZXP A;  1F9Q A;  1G6P A;  3I4N H;  4QL5 A;  2DNE A;  1Y1V B;  4NXM L;  3S1N H;  4IUU A;  2I5H A;  3BDL A;  4R4Q A;  1DXM A;  4B3R L;  2P5Z X;  1S5C D;  1ZEQ X;  1DJR D;  3EBE A;  4DV7 L;  1VQK A;  1EYD A;  1ICF B;  1TQO A;  4IUQ A;  2E74 C;  3MHB A;  4BBS H;  1AH9 A;  2K32 A;  2XRQ D;  1IBL L;  4DF7 A;  1PH7 A;  1SYF A;  2UXC L;  3M4Q A;  3U4V A;  2CW0 D;  2YTV A;  2B2T A;  4OWT B;  1CA6 A;  5IIF A;  2IL8 A;  2JA8 B;  2JA7 B;  1PVO A;  1Y69 U;  1KL9 A;  2OTL A;  3M3Y B;  3S2D B;  1LTT D;  4DUY L;  2BH2 A;  4WOR A;  1TS4 A;  4CKB A;  2UUA Q;  4FF3 A;  1GUN A;  1E0B A;  4DV5 L;  5FK9 C;  4DAP A;  4A75 A;  4Y7N H;  5I9O A;  3CW2 C;  4CDF C;  3FVQ A;  1YHB A;  2LSS A;  3T51 B;  5BR8 Q;  3NEL A;  3BVG A;  5JAV A;  5DEH A;  4JBM A;  4YWL A;  4IUT A;  3MEF A;  3A7L A;  4X3K A;  1I4R A;  3NQI A;  2Q8R E;  2VB3 X;  3F2D A;  5CV6 A;  1HFN A;  2QDB A;  1Q12 A;  1WCM H;  1B9M A;  1X3E A;  1TWF H;  2N88 A;  1KIX A;  3GTK H;  1QIL A;  3PCO B;  4FNF A;  5ELO A;  4QGU A;  4A3I B;  1LLR D;  4B9W A;  4DAM A;  3I55 A;  1F9R A;  1ILP A;  5FJ8 H;  4X65 Q;  4JYA Q;  4BY7 G;  3K5M A;  3J81 i;  3P20 A;  4IAL A;  3T1Y Q;  2HQL A;  2IWH A;  3T1H Q;  1B8A A;  4DR7 Q;  3D3R A;  1P16 A;  2LXK A;  4B3S Q;  2GVB A;  4YWK A;  3M85 A;  4L5S A;  4KD4 A;  4HJ8 A;  5LMU Q;  1S72 A;  3NTK A;  3S2H B;  3GTQ B;  1RD9 D;  3CCR A;  4IPC A;  1W6J A;  1I5F A;  4C2M H;  2QKI C;  3BVZ A;  4YHH L;  2B39 A;  1G6Z A;  3NEM A;  1PTO H;  5FOB B;  1VMC A;  3GTJ H;  1NY4 A;  5IP7 H;  1VQA A;  2BDO A;  2NWG A;  2XTI A;  4RA8 A;  3ER0 A;  1BCP C;  3KJO A;  3DWQ A;  5DLQ E;  3CCQ A;  3GDE A;  2K4K A;  2EJF C;  2NVY H;  2OQK A;  4JV5 L;  5FO9 B;  2RQX A;  4DK0 A;  1STH A;  2F0I A;  3TQY A;  4DV6 L;  1SRO A;  4A3K B;  1JOK A;  3PMF A;  1XTC D;  2PI2 E;  1PFS A;  2K5W A;  2Y0S G;  1P8L A;  2K50 A;  5LMN W;  3FPP A;  2XNA C;  1MJC A;  1N34 Q;  2RSO A;  1LTS D;  4DAY B;  1G8Z D;  3Q22 A;  4LF4 L;  1YIJ A;  2F3V A;  3H15 A;  1I94 L;  1WTP A;  1X6O A;  1LV9 A;  1VQB A;  3RR5 A;  3DWA A;  5GAE C;  1CHQ D;  2JA6 G;  4ZK9 B;  4MN3 A;  5IYB G;  2KUM A;  2VW9 A;  4IQZ A;  1SDF A;  4XQJ A;  4ALP A;  4ZCK A;  1NUC A;  4PMB A;  4IFD I;  1MIU A;  3J7Y W;  3K7A B;  1TY0 A;  1IL8 A;  3SK6 A;  1B7Y B;  2JA7 H;  2M9V A;  5EQ0 A;  5GAG C;  2JA8 H;  1ESF A;  3S2D H;  1I3Q B;  4B08 A;  4N9P A;  1A6X A;  5T1I A;  4XIG S;  3A5Z B;  3E9H A;  5EPJ A;  2B3G A;  2GVA A;  1E2V A;  4G4K A;  3J80 i;  3RZO B;  1N33 L;  3NE5 B;  1X54 A;  4KHV A;  4X6A H;  2K5V A;  5IE8 A;  1KQS A;  1ML0 D;  4LK1 C;  1PA6 A;  3ZYY X;  4UDU C;  1VQO A;  1SNQ A;  5I6W A;  4IJL A;  4KKS A;  3IFT A;  4N9T A;  4ULL A;  4IOA A;  3W2D A;  3J81 E;  1CSQ A;  3ULL A;  3WOF A;  1FYC A;  2VQF Q;  2BA1 A;  1F2M A;  5BN4 A;  4NB3 A;  1VQ9 A;  2KEE A;  4RGN A;  1WTH A;  4LUV A;  4O1N A;  4AYB G;  3ZJY C;  1B44 D;  1H95 A;  4FF2 A;  3A54 A;  2F0U A;  2AWO A;  3MXG A;  1YNN D;  1HZA A;  1KNE A;  5IT9 E;  2EVB A;  3A8K E;  4LF9 L;  2F0H A;  1OXV A;  2ZJR A;  5C0X I;  5M5Y B;  3NWS A;  4CJ1 B;  4J1M A;  3GTL B;  1IKL A;  1S3O A;  2HIX A;  2IHF A;  2A5H A;  4O2D A;  1LM0 A;  3VR3 A;  3VR2 A;  2B2U A;  4IOC A;  3MZ5 A;  3S2H H;  1V1P A;  4S3S A;  5IWA L;  1CUK A;  3GTQ H;  1A63 A;  5COY A;  1O7Z A;  1VQ4 A;  1GUO A;  4FXG C;  5KNC A;  1T5X D;  3VA5 A;  4B3T L;  2FXQ A;  1YNX A;  3EQL C;  1LTR D;  1LYL A;  4RCO A;  2C35 B;  5JVH 3;  1KTK A;  2F0K A;  2KCC A;  5CV9 A;  4IUR A;  3BDO A;  1HUN A;  4JI6 Q;  2PNR C;  2AUJ D;  4PG3 A;  3NP8 A;  1I4P A;  2KEC A;  4K5V A;  3UDF A;  2NBF A;  1HR0 Q;  4YCV A;  2KBN A;  1JT8 A;  4RAU C;  2PNH A;  1C0A A;  1ZKO A;  4F7X A;  1MSG A;  3HGB A;  4NPS A;  3OYY A;  4LF7 L;  4XTC S;  2XRS D;  5KEE A;  4BWG B;  1YI2 A;  2UUB L;  3RMH A;  5E4X A;  4BXX H;  1KLG D;  3L9A X;  5JPN C; 
#chains in the Genus database with same CATH homology
 2NZH A;  1Z9F A;  2ATW A;  3TRZ A;  1OXU A;  4JI8 Q;  1EIF A;  4GLV B;  4C3J H;  1MJE A;  4KHP Q;  1FVI A;  2VL6 A;  4MZ9 A;  4DR5 L;  1PH5 A;  3L2P A;  3PGZ A;  1GM5 A;  4HIM A;  2VNU D;  2E8G A;  4H02 A;  4DV1 Q;  5IWA Q;  5IYC H;  3HOV H;  1GD7 A;  4O0A A;  3M9B A;  3I4O A;  4HID A;  2VUM H;  3I7F A;  5J3B A;  1GKH A;  1EUJ A;  2UXD L;  1VQH A;  1IBK L;  1V43 A;  1YJN A;  2H5X A;  1OTC A;  4B3T Q;  1Y1V G;  1I3Q H;  2E2H H;  1N8R C;  3PSI A;  3RN2 A;  1VQI A;  1K73 C;  1HZ9 A;  1E22 A;  3H0G H;  2WB1 G;  2BA0 A;  3RZO H;  1E1O A;  2IHE A;  1S40 A;  4GKK Q;  1EWI A;  1Q81 C;  1WJJ A;  1UE1 A;  4A93 G;  3ERS X;  2I5L X;  4A76 A;  2RHS B;  3A74 A;  3W5O A;  2R7D A;  3JC6 6;  4NXN L;  3JAM c;  1TWA H;  1U5K A;  4X65 L;  3I4M H;  3U58 A;  1Q1E A;  4PZ7 A;  4DV0 L;  4GOP C;  1VQF A;  3HOZ H;  4KHZ A;  4BBS G;  4A3L H;  1UE5 A;  2UU9 L;  3PO2 H;  3E9I A;  4DR2 L;  4LF5 L;  1QVG A;  5GQO A;  3S15 H;  1SRU A;  1WI5 A;  1XNQ L;  1SE8 A;  1CKM A;  3A0J A;  3U4Z A;  2E2I H;  2JA8 G;  2JA7 G;  2RF4 A;  1SMX A;  4DR3 L;  4LF7 Q;  4AIM A;  3OW2 A;  2UUB Q;  1FL0 A;  1UE6 A;  3K7U C;  3I56 A;  1RIP A;  4C3H H;  1I50 H;  5M5X H;  1XPR A;  3WWV A;  1VQE A;  2EQS A;  4JI3 L;  5IP9 H;  3G6E A;  2N3S A;  1WFQ A;  3FP9 A;  4OX9 L;  2R7Z G;  4EX5 A;  3RZD H;  1KRS A;  4LF6 L;  1VQ6 A;  4GNX C;  2IX1 A;  4Y52 H;  3FKI G;  4DR5 Q;  1J5E L;  1PH4 A;  1FJG L;  2IX0 A;  3BU2 A;  1NE3 A;  4A3C H;  1Q46 A;  4HJ5 A;  4BY1 H;  3AFQ A;  4YWM A;  5M5Y H;  4LNQ A;  1PH8 A;  2A19 A;  1VQ7 A;  1YHQ A;  2Y0S E;  4QY7 A;  4A3M H;  2JA5 G;  3PIP A;  4BY7 H;  3JAM i;  2PI2 A;  3GTL H;  2R6G A;  2R93 H;  1N32 L;  3G48 A;  1V1Q A;  2UXD Q;  4JI1 L;  3F2B A;  1L1O B;  4DV2 L;  1IBK Q;  1Q8K A;  3M7N A;  3MXN B;  4ME3 A;  5M3M H;  1BBW A;  2JE6 I;  3SGI A;  2YV5 A;  3OTO L;  2K5H A;  1WCM G;  4X66 L;  4A3I G;  2F4V L;  4LFB L;  4RG1 A;  2CWP A;  4DKA C;  1IXR A;  2QEX A;  4GN5 A;  4GNX A;  1PH3 A;  3NEN A;  4OWW B;  4AH6 A;  1JJG A;  5LMN L;  4X62 L;  2I5M X;  2MFI A;  1QUQ A;  2K14 A;  1X55 A;  2XGT A;  1M90 C;  5GAH C;  4NXN Q;  1OXX K;  1UE7 A;  4P75 A;  2Q2H A;  3K81 C;  1TXY A;  3HOX H;  1HNZ L;  1Y1W G;  3TRE A;  1KC8 C;  1VQM A;  4DV0 Q;  5ELN A;  4OO1 I;  2NN6 G;  4DK6 C;  4GKJ L;  2WAQ E;  1PH6 A;  3HOW H;  2UU9 Q;  3B6Y A;  4A3G G;  1TWG H;  4DR2 Q;  1CKN A;  2VY3 A;  4LF5 Q;  1PH9 A;  5C3E H;  1XNQ Q;  3CD6 A;  3F2C A;  2IT1 A;  5C4J H;  3VDY A;  3D31 A;  2CCZ A;  3AFP A;  3HOU H;  4IJH A;  1A0I A;  4LF8 Q;  2Z6K C;  5IYD H;  1K8A C;  2AWN A;  4DR3 Q;  1VQ5 A;  1JJC B;  1NTG A;  1K83 H;  1EYG A;  1G29 1;  2ZM6 L;  1IZ6 A;  2NVT H;  3ULJ A;  1V9P A;  4P71 A;  5C44 G;  4DPG A;  3TS2 A;  3AEV A;  4JI5 L;  4JI3 Q;  2B29 A;  3UDX A;  4OX9 Q;  3BZK A;  4DR6 L;  1L2F A;  1W2B A;  4LF6 Q;  3L7Z C;  5C4X H;  2N78 A;  1HR0 W;  1KRT A;  4JBW A;  1FJG Q;  1JMC A;  3CCV A;  2Z6K A;  1QVF A;  3NBH B;  4GLX A;  2R92 G;  5GRO A;  5HGQ A;  1RL2 A;  2Q2I A;  3KF6 B;  5IP7 G;  2EXD A;  4LF9 Q;  4A3J G;  2E2J H;  2D62 A;  1UWV A;  3W1G A;  2KEN A;  2V1C C;  4RMF A;  2CQO A;  3DLL A;  4L5R C;  4JI1 Q;  1N32 Q;  4DV2 Q;  1HZB A;  1X56 A;  2OWO A;  4AYB E;  2MO0 A;  3OTO Q;  4PZ6 A;  3RLO A;  2NVQ H;  1E1T A;  4OXP A;  5M3F H;  2HHH L;  3DM3 A;  3HOY G;  4X66 Q;  4DV3 L;  4HIK A;  2F4V Q;  4LFB Q;  4LW1 A;  2ALY B;  5BR8 L;  3CMA A;  2DGY A;  1L0W A;  4A3K G;  1HZC A;  5LMN Q;  4A3F G;  5JJL A;  1E24 A;  4X62 Q;  4BBR H;  3STB D;  2JA6 H;  2Q2U A;  1R9T H;  5IYB H;  1TWC H;  4X64 Q;  2OCE A;  3CCJ A;  4GN3 B;  2N8N A;  3PF4 A;  2PMZ E;  1N9W A;  4WJ4 A;  3F8T A;  1GVP A;  1D7Q A;  3EN2 A;  1HNZ Q;  1Y1V H;  4BXX G;  1YEZ A;  4JCV E;  1G6P A;  3I4N H;  1QZG A;  4QL5 A;  4GKJ Q;  1I6H H;  1B70 B;  4NXM L;  5K36 G;  1EFW A;  3CCL A;  3S1N H;  3PF5 A;  4LFC L;  2I5H A;  3PUW A;  4A3E G;  4R4Q A;  1QZH A;  2PQA B;  2EIF A;  4B3R L;  2ZJP A;  4UPA A;  3H3V I;  4L5T A;  1PV4 A;  1W3S A;  4MTN A;  3UDI A;  3BZC A;  3HKZ E;  3EBE A;  1OXS C;  3J81 j;  1HNX L;  4PMW A;  4DV7 L;  3S1R H;  1VQK A;  3H3V H;  4LFA L;  4UP9 A;  2CKZ B;  4DNI A;  2D0O A;  2ZM6 Q;  1HH2 P;  2Z0S A;  4JYA L;  1NJI C;  2VUM G;  4BBS H;  2HT1 A;  4DR1 L;  1AH9 A;  2VZA A;  1M1K C;  1UEB A;  3T1Y L;  4JI5 Q;  3T1H L;  1IBL L;  4DK3 C;  4IPH A;  3J7Z C;  1PH7 A;  4DR7 L;  4DR6 Q;  1C9O A;  2UXC L;  3M4Q A;  5FLM H;  4IFD G;  3U4V A;  3RN5 A;  2YTV A;  3M3Y H;  4B3S L;  1TWH H;  4OWT B;  2L15 A;  3H0G G;  1PVO A;  1KL9 A;  2N49 A;  2OTL A;  5LMU L;  4JC0 A;  4DUY L;  1X65 A;  2CWA A;  1VQP A;  1CSP A;  2BH2 A;  3RLF A;  2AHO B;  3IRB A;  4KI0 A;  1MKH A;  3CF5 A;  3J81 c;  2UUA Q;  3S17 H;  3W1B A;  4OON A;  1SR3 A;  4GOP A;  1XJV A;  4B3M L;  3GTO H;  3I4M G;  2NZO A;  2K52 A;  3KOJ A;  3S1Q H;  4DV5 L;  4A75 A;  2HHH Q;  4Y7N H;  1PYS B;  3FKI H;  3HOZ G;  4DV3 Q;  2YU9 H;  3CW2 C;  2YTY A;  1YHB A;  2LSS A;  5BR8 Q;  3AYH B;  3NEL A;  5AJ3 L;  4LUO A;  4P73 A;  4JBM A;  4JOI C;  1NBW A;  4YWL A;  4R4I A;  1ASZ A;  1EQR A;  1GO3 E;  2JA5 H;  1BVS A;  3Q8D A;  3MEF A;  1ASY A;  1VQ8 A;  3GTP H;  2ZJQ A;  2LXJ A;  4QIW E;  2YYZ A;  3F2D A;  2A8V A;  3TEH B;  1Q12 A;  1WCM H;  1L1O C;  5IT9 c;  1X3E A;  1TWF H;  4A3I H;  3J7A 5;  4K0K L;  4NXM Q;  1KIX A;  3GTK H;  3KJP A;  2B63 H;  1O7I A;  5IP9 G;  4LFC Q;  3PCO B;  2QGQ A;  4JI0 L;  5ELO A;  4QGU A;  2WP8 J;  3L0O A;  2MNA A;  4B3R Q;  4JOI A;  2R7F A;  4JBJ A;  4DAM A;  4DUZ L;  3I55 A;  4C3I H;  1HNX Q;  4R4C A;  5M5W H;  4DV7 Q;  3G4S A;  4QJF A;  4BY1 G;  1YIT A;  4A3D H;  2RCN A;  4LFA Q;  5FJ8 H;  4X65 Q;  1Y1W H;  4JYA Q;  2KHJ A;  4BY7 G;  4IPG A;  1JE5 A;  4A3B G;  3J81 i;  4TVA B;  4DR1 Q;  2R93 G;  3CC7 A;  5HY6 A;  1N34 L;  1T9H A;  1L1O A;  4AQY L;  3T1Y Q;  1Y14 B;  2HQL A;  1KHI A;  3PUY A;  4JI8 L;  3T1H Q;  1B8A A;  5M3M G;  1AE3 A;  1LTL A;  5C0X G;  3G71 A;  3CC2 A;  4DR7 Q;  4KHP L;  2UXC Q;  1P16 A;  1BKB A;  2DUD A;  2LXK A;  4HJ7 A;  1C7Y A;  2WB1 E;  4B3S Q;  2GVB A;  2ZTC A;  4UP8 A;  3CAM A;  1YBY A;  4YWK A;  1E7Z A;  3M85 A;  4L5S A;  1A62 A;  3S16 H;  3BJU A;  2NVX H;  1Q7Y C;  4HJ8 A;  2RHQ B;  5LMU Q;  1S72 A;  5JJK A;  4DUY Q;  2OQ0 A;  3HFZ B;  4GN4 B;  1IBL Q;  2JEA I;  2I0Q A;  3CCR A;  5GAD C;  3RLN A;  2CFM A;  4EQ5 A;  4B3M Q;  4IPC A;  3CPW A;  4DV5 Q;  3UDG A;  1I5F A;  4C2M H;  2F52 A;  4YHH L;  2GN5 A;  4JI7 L;  3NEM A;  1PH2 A;  1J5E Q;  4OO1 G;  3STB C;  3GTJ H;  3PO3 G;  1NY4 A;  2KHI A;  2ASB A;  4UP7 A;  1YJ9 A;  2QA4 A;  5IP7 H;  1VQA A;  2VQE L;  2XTI A;  3KDF B;  2K75 A;  1PHJ A;  1XNR L;  3ER0 A;  3KJO A;  1IYJ B;  2Q2T A;  2UUC L;  4LWC A;  5DLQ E;  3CCQ A;  3GDE A;  3M4O H;  2JK8 A;  2K4K A;  1XMO L;  2NVY H;  3U50 C;  4K0K Q;  1VQD A;  2OQK A;  3LGJ A;  3PUZ A;  4JI2 L;  4JV5 L;  2IY5 B;  4A3K H;  1QVC A;  3TQY A;  4DV6 L;  2KCT A;  4HJA A;  1SRO A;  4UY8 C;  4WJ3 M;  5H1S E;  3M4P A;  4P72 A;  4DUZ Q;  2PI2 E;  1PFS A;  2Y0S G;  3J80 c;  2E5L L;  1P8L A;  2VQF L;  3KF8 B;  2K50 A;  5LMN W;  1XMQ L;  4JBK A;  1VQJ A;  3KF6 A;  1U0L A;  1EQQ A;  1MJC A;  2UXB L;  3AQQ A;  3CCU A;  1N34 Q;  4DAY B;  4AQY Q;  4A3E H;  4LF4 L;  1YIJ A;  4KLK A;  5JEA G;  4YY3 L;  1SFO H;  3H15 A;  4A93 H;  1KXL A;  1K8G A;  3CME A;  5M3F G;  4IFD J;  1I94 L;  3PV0 A;  1X6O A;  2ZTE A;  3PUX A;  1VQB A;  3RR5 A;  2JEB I;  4OWX B;  3F1Z A;  5GAE C;  2JA6 G;  4BBR G;  5IYC G;  3HOV G;  5IYB G;  2VW9 A;  4YCU A;  4HJ9 A;  4HIO A;  1XTD A;  3K7A H;  4ALP A;  1N36 L;  4IFD I;  2WAQ G;  1MIU A;  2AKW B;  4YHH Q;  4JI7 Q;  2JA8 H;  3I4N G;  1B7Y B;  1JB7 A;  3K80 C;  2JA7 H;  1X3F A;  5GAG C;  5JJI A;  4IPD A;  3S2D H;  1VQC A;  4BA1 I;  5IY0 A;  1J6Q A;  2WFW A;  4XIG S;  2PQA A;  3A5Z B;  3E9H A;  2JA9 A;  1HNW L;  2VQE Q;  1VQG A;  3FHW A;  2B3G A;  4P74 A;  2GVA A;  3J80 i;  1N33 L;  1XNR Q;  1X54 A;  1K3R A;  1JJ2 A;  2MO1 A;  4X6A H;  4GOP B;  2K5V A;  3CP0 A;  2UUC Q;  5IE8 A;  2KCM A;  3ICE A;  1YHA A;  4IO9 A;  1KQS A;  2R7Z H;  1XMO Q;  1PA6 A;  1E3P A;  3I2Z A;  4JI2 Q;  4JV5 Q;  3CQZ H;  4A3L G;  1VQO A;  4IJL A;  3K8A A;  4DV6 Q;  3PO2 G;  1EOV A;  1X3G A;  3CXC A;  1CKO A;  4IOA A;  5FLM G;  2A1A A;  1K9M C;  4LF8 L;  1CSQ A;  1YVC A;  1IBM L;  3ULL A;  2E5L Q;  1BBU A;  4JI4 L;  2VQF Q;  2BA1 A;  2D0P A;  3KYH C;  4JI6 L;  1XMQ Q;  2VS1 A;  4R4O A;  4NB3 A;  4APV A;  1VQ9 A;  1VS0 A;  4LUV A;  4AYB G;  1HR0 L;  3GD7 A;  2UXB Q;  4R1J A;  3ZJY C;  1H95 A;  1NMF A;  3HKS A;  4GNX B;  4J15 A;  3CC4 A;  4LF4 Q;  3K0X A;  3UE0 A;  4YY3 Q;  5C0X J;  1YJW A;  2AWO A;  1QUQ B;  2ZTD A;  4DR4 L;  1I94 Q;  4R4T A;  3CCM A;  2OTJ A;  4A3C G;  1HZA A;  2NN6 I;  4FDB A;  1WOC A;  4MNO A;  4DV4 L;  4L5Q A;  4A3B H;  4LF9 L;  4A3M G;  1OXV A;  2ZJR A;  5C0X I;  1AE2 A;  3CCS A;  1N36 Q;  3KFU A;  4LUZ A;  3ULP A;  4A3G H;  4POG A;  1X9N A;  1LUZ A;  1CKN B;  1Q82 C;  1S3O A;  2HIX A;  2IHF A;  4POF A;  4O2D A;  1LM0 A;  1A8V A;  4JG2 A;  1XPU A;  5EAY A;  2B63 G;  4IOC A;  3S1M H;  2JJQ A;  3KLW A;  1SLJ A;  4DV1 L;  3S2H H;  1NMG A;  5IWA L;  3GTQ H;  1CUK A;  3HKZ G;  1D8L A;  2YTX A;  1HNW Q;  1A63 A;  4X64 L;  1VQ4 A;  4YCW A;  1N33 Q;  5C44 H;  1DGS A;  1Z47 A;  1KAW A;  4A3D G;  1VCI A;  3RNU A;  2MQH A;  5FJ8 G;  5FLX c;  3HOX G;  4B3T L;  2FXQ A;  1PYB A;  4BA2 I;  1YNX A;  4GLA C;  1LYL A;  1VQN A;  3A5U A;  1YZ6 A;  4A4I A;  2ES2 A;  3HOW G;  2HIV A;  1HJP A;  2C35 B;  1Q86 C;  3PO3 H;  3EIV A;  3GO5 A;  5AJ3 Q;  5C3E G;  2R92 H;  1K0R A;  4GKK L;  4GS3 A;  1Q1B A;  3CPF A;  1KD1 C;  3HOU G;  1IBM Q;  4A3J H;  3GTM H;  1FGU A;  5IYD G;  3UE1 A;  1VQL A;  4JI4 Q;  4JI6 Q;  5E7N A;  2AMC B;  1XPO A;  4PG3 A;  3PIO A;  4TQU S;  3UDF A;  4PZ8 A;  2ID0 A;  1HR0 Q;  3HOY H;  4YCV A;  2KBN A;  3S14 H;  3TS0 A;  1JT8 A;  1G51 A;  1SN8 A;  3S24 A;  3CCE A;  2PNH A;  4QQB X;  2BH8 A;  4A3F H;  4JI0 Q;  1C0A A;  5JEA J;  3GTG H;  4NPS A;  4DR4 Q;  5C4X G;  3OYY A;  4LF7 L;  2K5N A;  1OXT A;  4XTC S;  1YI2 A;  2UUB L;  1PH1 A;  1WYD A;  3E0E A;  3D0F A;  1IL2 A;  2F3I A;  4BXX H;  4DV4 Q;  2UUA L;  3KDF A;  3PUV A;  2JQO A;  1EIY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...