2LSSA

Solution structure of the r. rickettsii cold shock-like protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
MATNIVGKVKWYNSTKNFGFIEQDNGGKDVFVHKSAVDAAGLHSLEEGQDVIFDLEEKQGKAYAVNLRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the cold-shock-like protein from Rickettsia rickettsii.
pubmed doi rcsb
source organism Rickettsia rickettsii
molecule tags Rna binding protein, dna binding protein
molecule keywords Cold shock-like protein
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2012-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2lssA00
1WJJA 1X3EA 3A74A 1C9OA 3IRBA 4EQ5A 3JAMc 1IBLQ 1CSPA 1I5FA 4JI3Q 4AH6A 3KDFA 1Y1WG 2N49A 3FP9A 2YTYA 2Q2TA 4DAYB 4DUYQ 1E1OA 4JBMA 3FKIH 1QUQB 4R1JA 3J80i 3STBC 2PNHA 4LF5L 5JEAJ 4X66Q 4KHPQ 3CCMA 4GOPA 2UUBL 4JCVE 3CXCA 1VQ5A 1IL2A 4PZ7A 1YJWA 1G6PA 3FKIG 4LF4L 2F4VL 2CFMA 2I5MX 4IPCA 1A62A 2AHOB 2VUMG 1HNXQ 1QVFA 2Z0SA 4GN3B 4NXNQ 1Q46A 3M7NA 4UP8A 1N36L 4L5SA 5IWAL 4A3KH 2OTLA 4OXPA 2DUDA 2JA6H 3KFUA 1GKHA 4PMWA 5IYBG 1OXSC 4JI5Q 1PH2A 1Q1BA 4HIKA 4LUZA 3I7FA 1W3SA 3TQYA 1CKOA 2IHEA 4A93H 4IJLA 4HJ5A 4GOPB 1XNRL 4BBRG 2E2IH 4HJ8A 1PYSB 4KHZA 3KJPA 3S1MH 2E2JH 3CMEA 1UE6A 1XMQL 4POFA 1YHAA 1SROA 1JJ2A 4B3MQ 3RZOH 1UEBA 1IBLL 1SLJA 4BY1H 1E3PA 4JC0A 1KD1C 4JI4L 2HIXA 2I0QA 2MQHA 4BBRH 2GVBA 2VQEL 5GAGC 4OWXB 1GM5A 1N9WA 1ASZA 1SR3A 5EAYA 3RLFA 3K80C 5IYDG 4IJHA 1K8AC 1E7ZA 3Q8DA 1B70B 2VNUD 4X66L 1P16A 5C44G 3J80c 1PHJA 4LFCQ 4DK3C 4KHPL 4BY1G 4YCWA 4C2MH 1OXVA 3CP0A 2CKZB 3UE0A 3H3VI 2NZHA 4GLXA 2JA7H 3F2BA 2A8VA 1EYGA 1S40A 1N32Q 4A3LH 3A0JA 3JAMi 1XPUA 3NELA 4P74A 3T1HL 2NZOA 2Z6KA 2Y0SE 4A3DH 3M9BA 1Y14B 4R4CA 3S17H 4B3RQ 4GLVB 3MEFA 3ULLA 2Z6KC 3ZJYC 1JE5A 4DR5L 1K0RA 4DR1Q 4JI7Q 5IWAQ 3GTJH 4GNXC 5E7NA 3VDYA 3KF6A 4YWMA 2D0PA 4ME3A 4A3IG 1YJ9A 2JA5H 1LUZA 4LF9L 2D0OA 3GTGH 5IY0A 5LMNW 2B63H 4P75A 3NENA 2DGYA 3CCUA 2VZAA 2I5HA 2E5LQ 1XMOQ 1YI2A 2UXCL 3EIVA 1Q7YC 1OTCA 1KRTA 1PH9A 2R92H 4YHHQ 2VUMH 4AQYQ 4DR6Q 1K8GA 5M5WH 3TS2A 3MXNB 3K8AA 4OONA 2JK8A 4A3BH 2NN6G 3GO5A 4B3TQ 3UE1A 4A76A 3HFZB 1YHBA 2JA6G 1V43A 3J7A5 4X64L 5AJ3L 4XTCS 3UDIA 2EQSA 2R7ZG 4DR2L 1HZ9A 4KI0A 4DR7Q 5BR8L 1PYBA 4DV1L 4KLKA 3PV0A 5ELNA 4B3SQ 3NEMA 4JOIC 1N34L 2UUCQ 4LFBL 1RL2A 3U50C 4A3JG 1MJEA 1N33Q 2VW9A 2K52A 4X65L 1XPOA 1K83H 4LFCL 1Y1WH 5C4JH 4A75A 2HQLA 3PUVA 4YCVA 2OQ0A 3GD7A 2AKWB 4O2DA 5M3MH 2JA8H 5IP7H 4IPDA 4JV5Q 4LUVA 1HZCA 5JEAG 2ATWA 1VQHA 2ZTCA 3DM3A 5HY6A 5FLMG 1X3FA 2MNAA 1LTLA 4B3RL 2MO0A 2CCZA 3AYHB 1NY4A 3JC66 4DV2Q 3HKZE 3PUWA 4YWLA 4X6AH 1B8AA 5LMNQ 1QZGA 4PZ8A 2GN5A 1SRUA 3OW2A 3CCLA 5M3FG 2IT1A 1FVIA 1VCIA 3GTOH 1Q1EA 4QGUA 1G291 4OWTB 4A3FH 1JJCB 4LF8L 3CCVA 3M3YH 2PI2E 4L5QA 1XMOL 2E5LL 4NXML 4A3CH 2UXDQ 2ALYB 3L0OA 4GN4B 4GS3A 3K81C 2R93G 1Q8KA 2WB1E 3J7ZC 1T9HA 2KHJA 2RCNA 4AYBG 3RN5A 4BXXG 2YTVA 1BBUA 3GTKH 1X65A 2OCEA 1R9TH 3CC7A 1IYJB 2B3GA 4P72A 3BZCA 3UDFA 4BY7G 1VQFA 1LM0A 4DK6C 1KHIA 3HOVG 1PFSA 1A0IA 1CUKA 3ULPA 5C0XI 3HOXH 1HZAA 1VQEA 4JBWA 4DR3Q 2RHQB 3F2CA 1PH5A 3U58A 1HH2P 4LF7L 2R7ZH 2C35B 4MZ9A 3OTOL 3T1YL 1QUQA 2VS1A 4A3BG 1MIUA 4DAMA 3S1NH 4WJ4A 1TWFH 4DV7L 1PVOA 3ULJA 2HHHL 2Q2HA 4IPHA 2ID0A 4LWCA 1EUJA 5FJ8G 3PF4A 1HNWL 4R4IA 4RMFA 1VQ4A 1PH3A 4HJAA 3TEHB 1C0AA 1WOCA 1PH8A 2VY3A 4UY8C 4GKJQ 4QL5A 1Z47A 3G71A 3HOYH 4A3GH 3CPWA 1VQJA 4BA2I 5IP7G 2R7DA 3EBEA 1W2BA 4UP9A 2KCMA 3CPFA 3F8TA 3U4ZA 1K3RA 1EQQA 3PO2H 3S2DH 4JYAL 1L1OB 4NXMQ 1KL9A 4B3ML 4GKKQ 2IHFA 4IFDG 2N78A 3H3VH 3PUXA 1DGSA 4A3GG 1TWGH 3RNUA 1OXTA 1X3GA 3LGJA 1J6QA 3W1BA 1OXXK 1JT8A 4L5TA 1K73C 1WI5A 2WAQE 5C3EG 3DLLA 5C4XH 3KLWA 4A3IH 1IBKL 3GTLH 2EIFA 4XIGS 1HNZL 1X6OA 4LFAQ 4LF9Q 4DPGA 2KHIA 5HGQA 1QVGA 2NVYH 1V1QA 2B29A 2YYZA 1N8RC 3RLNA 1NE3A 2UXBL 1JB7A 2JJQA 4TQUS 3CMAA 2UUAQ 1A63A 1VQIA 2UXCQ 4BA1I 1NMGA 4JI3L 3TREA 4YHHL 4GNXA 4JI7L 4HIDA 2R93H 3S2HH 3GDEA 1CKMA 2JA5G 4LF6L 4A3FG 2HT1A 3KOJA 2BA1A 1TWCH 3M85A 1YNXA 3E9HA 3HKSA 3KYHC 5C0XJ 3ERSX 1BKBA 1E24A 1GVPA 4LF5Q 1M1KC 1VQAA 2NN6I 4DR4Q 5ELOA 5IT9c 3I4NH 5BR8Q 4APVA 5C3EH 3CC2A 2JEBI 3BJUA 3BZKA 4YWKA 3CAMA 3GTMH 1GD7A 4QQBX 2WP8J 1U0LA 4A3MH 4NXNL 1OXUA 3KF8B 1C7YA 2JQOA 4DUZL 4X62L 3G48A 5M3FH 1YIJA 1NJIC 1SFOH 3ICEA 1WFQA 4DR7L 1GO3E 1MJCA 2H5XA 1L1OC 2N3SA 2UUCL 4A4IA 3M4PA 3S24A 3HOWH 3NBHB 2UU9Q 4JI5L 3A5UA 3CD6A 1CSQA 3UDXA 5M5XH 1RIPA 1VQ6A 4IOCA 3CCEA 2PI2A 2WFWA 4O0AA 1IZ6A 1XNRQ 1I94L 4DV6L 1YJNA 1FL0A 3K7UC 3I4OA 4LUOA 5LMUQ 2UXBQ 5GQOA 1JJGA 4LF8Q 1L0WA 1I50H 5DLQE 3KF6B 2CWAA 1LYLA 2A19A 3CQZH 4TVAB 3AFPA 4DV2L 3FHWA 1X9NA 4DV4Q 3PUZA 3HOXG 5JJLA 5GADC 1VQ8A 2IX0A 2MO1A 3M4QA 4HJ7A 4DUYL 2ES2A 2ASBA 1SE8A 2A1AA 5GAEC 3S1QH 1WCMH 2AMCB 4K0KL 1PH6A 4NB3A 4OX9Q 1HR0L 2NVQH 1HR0W 4JI8L 5IP9G 2ZJPA 3KJOA 1D8LA 1PH4A 2JEAI 4GOPC 2RF4A 3TRZA 4AYBE 4EX5A 3WWVA 4DR3L 4GLAC 5JJKA 4R4OA 1M90C 3RLOA 4A3LG 2VQFL 1X54A 2RHSB 2XTIA 4LF7Q 1CKNA 3TS0A 4DR1L 1VQMA 4A3CG 1NTGA 4JI0Q 4AIMA 2IY5B 1XNQL 2K75A 2K4KA 5FLXc 1VQPA 1XJVA 1L2FA 3I55A 4A93G 3I4NG 1Q86C 2F52A 4QIWE 4PG3A 1UE1A 2EXDA 1XTDA 4JG2A 4A3DG 2BH8A 3E0EA 3GTQH 2Y0SG 1ASYA 4DV3L 3OTOQ 3T1YQ 1YHQA 3PUYA 3G4SA 5LMUL 2OQKA 4B3TL 1X56A 4DV7Q 1SN8A 5C44H 1HZBA 4X64Q 4OO1G 2OWOA 2YTXA 2BH2A 5IYDH 3S1RH 1XMQQ 4DR2Q 1TWAH 4JI2Q 2CWPA 1VQBA 2AWNA 4LNQA 1UWVA 2PQAB 2MFIA 3B6YA 4DV4L 2YU9H 1VS0A 2XGTA 3F2DA 4IFDI 1VQ7A 3PO2G 4LFBQ 4GNXB 4OO1I 5K36G 1IBMQ 2Q2UA 2NVTH 5C4XG 3EN2A 1YBYA 1VQOA 1NBWA 4HIMA 4K0KQ 4OWWB 3W5OA 1VQLA 4QY7A 4OX9L 5JJIA 1HR0Q 5H1SE 1PH1A 3J81j 1PV4A 4LFAL 3HOZG 2BA0A 4JI1Q 1TXYA 5C0XG 3HOWG 1I6HH 5GROA 2IX1A 2ZJQA 1AH9A 4QJFA 2UUAL 3CCRA 4JI6L 5IYCH 3PCOB 1PA6A 2R92G 3HOUH 3PIOA 5IYBH 1MKHA 3CC4A 3KDFB 4P71A 4JOIA 1WYDA 1IBKQ 4LF6Q 2QGQA 1VQNA 1XNQQ 4A3MG 1EFWA 3OYYA 2KENA 4ALPA 2JE6I 4YY3L 4C3JH 3SGIA 4JBKA 1UE5A 2E8GA 1Y1VH 4JBJA 4DR4L 1L1OA 2N8NA 2UXDL 1VQCA 5IE8A 3CCJA 4DNIA 2VL6A 4HJ9A 3K7AH 4DV3Q 1BBWA 4UP7A 2KBNA 2JA9A 2LXKA 4UPAA 1D7QA 1FGUA 4X62Q 3S14H 2ZM6Q 3I4MH 1VQGA 4R4QA 5AJ3Q 1SMXA 2OTJA 1CKNB 2WB1G 1EWIA 1TWHH 3H0GH 3H0GG 1KAWA 4MTNA 4DV0L 1N33L 4LF4Q 4Y7NH 2F4VQ 2V1CC 2YV5A 3STBD 4X65Q 1QZHA 1HNXL 4DUZQ 1KXLA 1I3QH 5FLMH 2K50A 1AE2A 1NMFA 4DKAC 2K5NA 1J5EL 2L15A 4JI6Q 4P73A 1XPRA 2PQAA 2R7FA 4LW1A 3HOVH 4BBSG 2HHHQ 3M4OH 4PZ6A 5IP9H 3S16H 3PO3G 2ZJRA 3PIPA 3CCQA 4JI4Q 1WCMG 2KCTA 5GAHC 1I94Q 4H02A 2VQEQ 4DV6Q 3AQQA 3CW2C 5LMNL 3UDGA 3J81c 1U5KA 4C3IH 4A3JH 3HOYG 1A8VA 2ZTDA 2NVXH 3I4MG 4A3KG 4A3EG 4RG1A 3I56A 2LXJA 1EQRA 4JI8Q 1X55A 1EOVA 2QA4A 1Q82C 1BVSA 4J15A 4POGA 1EIYB 3RR5A 1O7IA 3HOUG 1E22A 1G51A 5IYCG 3T1HQ 2ZM6L 3J81i 4JI0L 3D31A 4DV5L 3H15A 2I5LX 1HNZQ 2D62A 4DR5Q 1Q81C 1AE3A 1PH7A 2QEXA 2CQOA 1KRSA 3AFQA 1EIFA 3F1ZA 2GVAA 1VQ9A 1E1TA 1FJGQ 4IFDJ 4Y52H 1H95A 1K9MC 1JMCA 4DV0Q 1N32L 2VQFQ 3AEVA 4IO9A 1Z9FA 3PF5A 3A5ZB 2E2HH 4HIOA 3S15H 1Y1VG 2AWOA 4IPGA 4YCUA 3W1GA 1J5EQ 3GTPH 3G6EA 4DR6L 4A3EH 4C3HH 3HOZH 2LSSA 3RN2A 1V9PA 5J3BA 5FJ8H 2JA7G 1HJPA 3U4VA 1VQKA 2R6GA 1YZ6A 1B7YB 3L2PA 2K5VA 2Q2IA 4BY7H 3I2ZA 4L5RC 4GN5A 1HNWQ 4NPSA 1IBML 2UUBQ 1YVCA 4GKJL 1N34Q 4IOAA 3E9IA 5M5YH 4BBSH 2WAQG 4AQYL 4JYAQ 1UE7A 3CCSA 3PSIA 1Q12A 3BU2A 2F3IA 4JI2L 1KQSA 2B63G 4GKKL 1KIXA 1N36Q 3L7ZC 1YITA 1P8LA 4JV5L 4WJ3M 4DV1Q 4FDBA 5M3MG 4B3SL 2JA8G 2UU9L 3PGZA 4MNOA 3PO3H 2ZTEA 4DV5Q 3K0XA 1YEZA 3HKZG 2PMZE 3D0FA 4JI1L 4YY3Q 3CF5A 4BXXH 3RZDH 1FJGL 1S72A 2FXQA 1QVCA 1IXRA 2HIVA 1S3OA 1VQDA 4R4TA 2K14A 3ER0A 1KC8C 2K5HA
chains in the Genus database with same CATH superfamily
1SNCA 1STYA 1IBLQ 4AH6A 4DAYB 2SNSA 1Y1WB 1Y8PB 4R1JA 2WB1B 1HFNA 2O5JC 2LKVA 1EOTA 5C6AA 1VQ5A 1IL2A 4PZ7A 2CFMA 1M4VA 1Q46A 1EWHA 4MN3A 3KLSA 2LY7A 1ENAA 1F77A 1F9SA 3D4DA 3SR1A 2DUDA 3KFUA 1O7YA 3E6ZX 1PMRA 1PH2A 1FGBD 4LUZA 4OGQC 1CKOA 4IJLA 3AB9A 4HJ5A 2E2IH 4HJ8A 4RCOA 2AQ3B 5C3WA 3KJPA 4A3EB 5IIFA 1Q3LA 2E2JH 1HTPA 3S1NB 1YHAA 4B3MQ 1UEBA 4J8QA 2FHTA 4HR7B 2B2YA 1E3PA 4JC0A 2MQHA 3TSSA 2VQEL 1GM5A 5GAGC 1N9WA 4FVMA 2NYZD 3K80C 4UAIA 3Q8DA 1B70B 2DNEA 2VB2X 1PHJA 3NXWA 4YCWA 4C2MH 2CKZB 2NZHA 1ILQA 2XWBB 1S40A 1EYGA 3A0JA 2C9OA 4ODGA 2NZOA 5G3LF 3M9BA 4XT3B 4IFDH 2KECA 3MEFA 3ZJYC 2Z6KC 4IUNA 1CA6A 4DR1Q 3C3LA 4CKEA 5IWAQ 3GTJH 4GNXC 1CTMA 4LF9L 4DFAA 3BDLA 3GV3A 2E5LQ 1TS5A 2UXCL 1OTCA 2K5DA 4PMBA 1FNUA 2VUMH 1K8GA 3MXNB 2JK8A 3GO5A 1DXMA 3UE1A 1UEAB 3NHHA 1V43A 4X64L 2PW7A 2F0MA 3H6MA 4G57A 4RAUC 3VR5A 4QUCA 2A6EC 5BR8L 4DV1L 4KLKA 4B3SQ 2Z6BA 3KF8A 4DR7Q 1X3QA 1N34L 1SNOA 1RL2A 4LFBL 3U50C 3P7JA 4MIUA 5CV8A 1MJEA 1N33Q 2K52A 4K5XA 1JWSD 4A75A 1R4QB 2HQLA 2OQ0A 3GD7A 2DY7A 5M3MH 2JA8H 1S5BD 1E2ZA 4LUVA 5NUCA 1HXYD 1I4XA 1O7ZA 1ZEQX 1B1ZA 1CQFA 1F9PA 2D9UA 1GXDC 2HDLA 1NY4A 4IURA 4ULLA 3HKZE 4YWLA 4X6AH 3MC0B 5LMNQ 5C5MA 2GN5A 3FPUB 3OW2A 3M4OB 2P5ZX 3GTOH 4QGUA 2A6HC 1JJCB 4R9WA 4LF8L 2E5LL 1LTTD 2K32A 1J9OA 4GS3A 1CHPD 2KHJA 1MD2D 2XRSD 3RN5A 3GTQB 4BXXG 4MHEA 2YTVA 3GTKH 2OCEA 1GUTA 4ZAIA 1LLRD 4BY7G 3OWEB 1LM0A 4EVOA 4ILWA 5JPMC 1CUKA 1YNND 3ULPA 2EYOA 1PDQA 3A8KE 3HG9A 4A3FB 2F0PA 2HUGA 4LF7L 3V2TA 2M00A 5KYLA 1QUQA 5IT9E 3S1NH 1TWFH 4IPHA 4LWCA 3PO3B 1EUJA 5FJ8G 4R4IA 4MTKA 1FNVA 3TEHB 2XSCA 4QL5A 1L0YB 4A3GH 4WFN3 4BA2I 5IP7G 4CJ0B 2R7DA 1GJXA 1W2BA 3S2DH 4BY7B 1IW7C 1K3RA 4QIWB 2B2TA 2E76C 2IHFA 1SXTA 2N78A 2BDOA 1PRTB 3SK4A 5I6WA 1X3GA 5IT9L 5EKLA 1K73C 2WAQE 2J0TD 2Z9HA 3DLLA 2A5HA 2F0IA 1V1PA 2EIFA 5DEHA 2NN6H 2F0JA 2I46A 1QVGA 2KOLA 1IHZA 2UXBL 2EPBA 1JB7A 2OEOA 1VQIA 3DWPA 1AEXA 4YHHL 4PNYA 3PIP3 4HIDA 3S2HH 4L8JA 4OIJA 1CKMA 2BA1A 1TWCH 3KYHC 4FF3A 2KA7A 1BKBA 1GVPA 4LF5Q 3ND9A 1D1KA 3OMGA 4H13C 3I4NH 5C3EH 4XDXA 2K04A 1FNWA 3BJUA 5ELEA 1XXGA 3GTMH 1GD7A 1EQVA 1PXUA 4C2MB 4ID6A 3KBGA 3G48A 2X69A 4X3SA 1SFOH 4P2CB 4M1UB 5JPNC 2UUCL 5KGUA 2QILA 1DOLA 4JI5L 1VQ6A 4IOCA 1XYIA 3CCEA 3T13A 2PI2A 1RTOA 1NSNS 1TY2A 2M2LA 1FL0A 2NWGA 4EQNA 3H94A 1I50H 2RCFA 5EKIA 1BNZA 1CA5A 4DV4Q 2F0WA 2F3VA 3H91A 1VQ8A 1JR0D 2MO1A 2ASBA 1ESFA 1PH6A 3D4RA 1GUOA 5M3FB 3TP7A 2JEAI 1D8LA 2R7ZB 3HP3A 1LACA 3WWVA 5JJKA 4GLAC 5I2YA 2G9HD 2XTIA 1GHKA 1LTGD 4A3CG 2K75A 4JK1C 1SBBB 1NAPA 4CGYB 4KKUA 1XTDA 4CDCC 4CHTB 3E0EA 3GTQH 4RHRA 4HCSA 5A2QL 1YHQA 3K59A 4KY5A 2F0HA 3MAQA 2AQ1B 4B3TL 5C44H 2E75C 1SJED 2BE5D 1LTBD 2SOBA 4JI2Q 2CWPA 2IL8A 2RDHA 1UWVA 2YU9H 1EIGA 5L37A 3PO2G 4OO1I 1TWFB 5K36G 2Q2UA 4F8MA 5C4XG 1YBYA 4QY7A 2VB3X 1PH1A 1IYUA 3J81j 1K8MA 4KKSA 3SK5A 1TXYA 1I6HH 2WAQB 2ZJQA 2UUAL 3CCRA 5IYCH 3HOUH 2JA5B 2NTTA 3NP8A 3ZYYX 2Z8LA 4P71A 4LF6Q 2QGQA 4J1MA 2KENA 5CYUA 4YY3L 3QJYA 4LAAA 1L1OA 4HMJA 2UXDL 1VQCA 5IE8A 3SK8A 4M8AA 3BVMA 2VL6A 4HJ9A 5A2QE 1CI3M 5K5PA 2Q8RE 3K5LA 1Y8OB 1O80A 4RWSC 4X62Q 3S14H 2MUYA 3I4MH 1SMXA 1FD7D 2RKSA 3TZUA 2Z4HA 4CBVA 3VR2A 4CKCA 2F0DA 3WOFA 2EZVA 4Y7NH 2YV5A 3STBD 1KTKA 1HNXL 1I3QH 4K2LA 1EY5A 1NMFA 1QB5D 3RUZA 2PQAA 3HOVH 4LW1A 4BBSG 4KJOA 3BG3A 5IP9H 2D5DA 2ZJRA 4JI4Q 2F0OA 2X6GA 2B8FA 1U5KA 4C3IH 2ZTDA 4A3KG 2ICEC 4FP5D 3L3OC 1EOVA 4XYQA 3K6OA 1O7IA 2VXWA 1ENFA 3T1HQ 2EYMA 1STGA 1SE4A 2NTSA 1EEFD 1STNA 1HUMA 4DV5L 2I5LX 1YNNC 2D62A 3X3NA 1PH7A 2CQOA 3Q23A 3BVGA 1HPCA 2GVAA 1E1TA 4ZQ3A 5C4ZA 1N32L 3K7AB 1EQTA 3AEVA 2EYJA 4FXKC 2M9VA 1B44D 1Y1VB 1B3QA 4G7HC 4DR6L 4IUTA 2LS01 3HOZH 4CJ1B 3FPPA 2I07B 4A3IB 5FJ8H 2JYOA 1HJPA 1B7YB 4OIKA 1HNWQ 1LTRD 1IBML 1RHPA 2UUBQ 4GKJL 2F0VA 3E9IA 2XIWA 1MSGA 3KUPA 4IUQA 3HOWB 2Z4IA 1UE7A 3PSIA 3BU2A 4JI2L 4O42A 3KBXA 3L7ZC 4WJ3M 1EWCA 1RD9D 4ZRZA 4DV1Q 5M3MG 4RGOS 4B3SL 2JA8G 3VA5A 2UU9L 2RDGA 1TKWB 3NTIA 1G91A 3PO3H 4OEMB 1TT2A 3H3VC 3FVQA 3K0XA 5IGCA 2K28A 2BDNA 4LK1C 3GTGB 3V05A 4BXXH 3RZOB 2FXQA 1QVCA 1IXRA 2HIVA 1SAPA 1VQDA 3SDZA 1HCZA 1WJJA 5J1ZA 1C9OA 3J7AF 2NZ1D 1CSPA 2A74C 3NSWA 1Y1WG 2K1BA 4DUYQ 1E1OA 1QUQB 1UNSA 1I6HB 4A3KB 1SE2A 4X66Q 1HQMC 1BBXC 4X3UA 3FKIG 3TP8A 4LF4L 5DM73 2F4VL 4IPCA 1A62A 2E74C 4TRDA 4RGTA 4X3TA 4WRDA 2PZUA 3D6WA 4A3KH 1IKLA 4C56C 4KN7C 4OXPA 2PZWA 4ZK9B 2RSNA 3HOXB 2B39A 5EPJA 3T56B 4RGNA 3E3XA 5ELCA 4JI5Q 1Q1BA 3MTSA 1W3SA 1EU4A 1AZQA 3QR8A 4F87A 3FMCA 3VYSA 3CMEA 3RD4A 4FYDA 1SROA 3ITPA 4IUVA 1SLJA 3HKZB 1KD1C 4JI4L 2VUMB 1SEBD 3S14B 4OWXB 1SR3A 4C3HB 1P16A 3J80c 4NKLA 1R4PB 4IN3A 3H3VI 3MA2B 2HD3A 2JP1A 4XYOA 2JA7H 4V0BA 1XPUA 3A54A 2Y0SE 4A3DH 4ZYSA 4B3RQ 1QCBD 1K0RA 2L11A 4DGZA 4YWMA 1YJ9A 3R93A 2D0OA 3W2DA 4P75A 2DGYA 2VZAA 4N8FA 2I5HA 1XMOQ 1M8AA 3I73A 1PYWD 1IYVA 1PH9A 1BCPC 5CV5A 2BE5C 1BR9A 3TS2A 3MFYA 1DOKA 2NN6G 4B3TQ 5KNDA 3EROA 2BCOA 3OIQA 5AJ3L 4XTCS 2XWJB 3SHLA 3VR3A 5M3MB 1TWAB 2JA8B 4KI0A 3PV0A 4KJNA 3BDCA 4A3JG 1TR5A 3OSOA 4X65L 1Y1WH 5C4JH 3NQTA 4YCVA 1PFBA 4O2DA 2RBMA 5IP7H 1PTOF 4ZUIA 4FF1A 1VQHA 4B3RL 5HY6A 1X3FA 1PRTF 2MO0A 2Z1CA 3JC66 3LWUA 1H9KA 3S16B 1SRUA 5M3FG 2IT1A 1Q1EA 4A3FH 1RCVD 4WJWA 3M3YH 4A3CH 2PI2E 3DM1A 4GN4B 3K81C 1T9HA 4AYBG 2PYKA 1LT3D 1BBUA 4F88A 2XNAC 3GP7A 1R9TH 1HRJA 3BZCA 1MSHA 5I4DA 3K5NA 5C0XI 5DNFA 4JBWA 1S5FD 3U58A 1DZ1A 2EXZA 2N88A 2C35B 3OTOL 1XX8A 2SNMA 3T1YL 2AUJD 3F2UA 5IGEA 2VS1A 4V190 4DAMA 4WJ4A 5E3FA 1PVOA 2K6AA 3I72A 3PF4A 1PH3A 4HJAA 4UY8C 2Q8IB 3G71A 2K7VA 3HOYH 2EOTA 3HOVB 3CPWA 1VQJA 3CQZB 1SSOA 4UP9A 3CPFA 5I9OA 1L1OB 4GKKQ 3CRLC 3QG1A 4OO1H 3H3VH 1HFGA 1CQVA 1TWGH 2HDMA 4JW0A 1J6QA 3W1BA 3RMHA 3TN2A 1G2SA 3C1EA 5C3EG 4QUFA 3KLWA 3GTLH 1A2TA 4LF9Q 4DPGA 5HGQA 4R8IA 2B29A 1NE3A 3S15B 4TQUS 3CMAA 3P1HA 1KAAA 1NMGA 2PCFB 4EGVA 5CBEE 2L9HA 3EQLC 1C8CA 1KABA 4GZYC 3GDEA 4LF6L 4RKBA 3KOJA 3HKSA 5C0XJ 3ERSX 1E24A 4DR4Q 5ELOA 1NCVA 5BR8Q 4KN4C 1FR3A 1PRTD 2QCPX 4F7XA 2NBFA 1U0LA 3R8BA 4NXNL 3KF8B 1C7YA 3TDQA 2F1MA 4X62L 2NVXB 5M3FH 1YIJA 1WFQA 1MJCA 1EY4A 1L1OC 3OHXC 4HEDA 5IOCA 2L1BA 1UAPA 5FLXL 3HOWH 3M4PA 2UU9Q 1CSQA 1XNRQ 1I94L 1YJNA 3K7UC 4LUOA 3I4OA 1I4QA 1JJGA 4LF8Q 5DLQE 4IALA 2CWAA 2QKIC 1RODA 2K03A 3FHWA 4DV2L 2CW0C 5GADC 4BWGB 2IX0A 4DUYL 2A1AA 5GAEC 4U68A 1WCMH 3O13A 3A55A 4OX9Q 4JI8L 1WCMB 4C3JB 5I9PA 3KJOA 4QF4A 4GOPC 5G3LD 3K5MA 4XQJA 4EX5A 2H1EA 4OL7A 4A3LG 1G2TA 2VQFL 1X54A 4LF7Q 2F0GA 5EBCA 1C48A 4DR1L 4AIMA 1SE3A 1XJVA 3I55A 4HMIA 4A93G 1Q86C 1H9SB 4QIWE 1KDBA 4A3DG 2BH8A 2PZTA 2Y0SG 2NVTB 1TIID 4DV3L 3A7LA 2ICIA 3OTOQ 3T1YQ 3PUYA 3G4SA 5LMUL 2OQKA 3M3YB 2WV6D 3VA7A 2YTXA 1RKNA 1D5MC 1XMQQ 2F0TA 3VYRA 3B6YA 3R2TA 2XGTA 3D8GA 1VQ7A 4LFBQ 1EIHA 3MXNA 1IBMQ 3IFDA 2NVTH 3EN2A 1VQOA 4EQOA 1EYAA 3W5OA 1VQLA 4OX9L 2E2JB 1HR0Q 1NUCA 4LFAL 1PV4A 5D3IB 2BA0A 4JI1Q 1B3AA 5C0XG 1NR4A 3J81E 2RSOA 3PCOB 1PA6A 3ERQA 1MKHA 2F0FA 3QIAA 1LTID 1WYDA 1IBKQ 1XNQQ 1FYCA 4K6LA 4A3MG 5KYIA 2KCCA 1ESRA 2O2LD 4IUUA 1UE5A 4C3IB 2N8NA 1HTLD 3CKIB 2EDGA 3CCJA 4DNIA 2Q8TA 4I7AA 3HS0C 1U4PA 2EJFC 2JA9A 4X3KA 4KKTA 1FGUA 2MP1A 4TKOB 2DN8A 2ZM6Q 1I50B 4DAPA 4R4QA 1WTVA 5AJ3Q 3W3AA 1U4RA 3NBIA 1CKNB 2OTJA 1D1IA 3A56A 5IGBA 2HQEA 5CMDA 1KAWA 3A8IE 4X65Q 2JSOA 1PFMA 5FLMH 4DKAC 2K5NA 1X32A 5CV7A 5C3XA 3M4OH 3IL8A 2B2UC 3PO3G 4K5WA 2HCIA 1TVXA 1WCMG 2KCTA 1QILA 5GAHC 4H02A 2VQEQ 4DV6Q 1I94Q 1MGSA 2NVXH 2R92B 4A3EG 4RG1A 2LXJA 3GTKB 1ZYRD 2QA4A 1B50A 3S17B 4J15A 4POGA 1EIYB 3HOUG 5IYCG 4DAYA 2L0CA 2ZM6L 4JI0L 4HSPA 3H15A 1HNZQ 1LTAD 5LHY1 3BS1A 3AFQA 3L9AX 3F1ZA 1EIFA 1VQ9A 1FJGQ 1SYCA 3NQIA 1H95A 2VQFQ 4YIJA 1Z9FA 4BY1B 1VDZA 2FMMA 3A5ZB 1EZ6A 1Z7TA 2AWOA 4IPGA 3RN2A 1D5XC 1V9PA 1DCZA 4BY7H 1U4LA 3S2DB 1Z6HA 1YVCA 1JOOA 2B8GA 4DXGA 5M5YH 1MBYA 4AQYL 1CFMA 4JYAQ 4UHVA 4NP5A 2B63G 2F3WA 1KIXA 4GKKL 3X3MA 1N36Q 1LTSD 3VR4A 4MNOA 1SNDA 3PIO3 1YEZA 3HKZG 3I90A 1ET6A 4JI1L 1K0SA 1FJGL 1S72A 2A6ED 5C3EB 1B53A 1KNEA 1S3OA 2KEEA 4QMGA 1STAA 4S3SA 2K5HA 3TZDA 1X3EA 1LT5D 1ET9A 5J39A 3JAMc 1I5FA 4DF7A 3KDFA 2N49A 3FP9A 3G6JB 3J80i 5AFWA 5JVH3 5JEAJ 1QNKA 1PRTC 4KHPQ 5JEAH 3HOYB 5D14A 2F0UA 4J6HA 1DJRD 4GOPA 2HCCA 3TMEA 4JCVE 2G5DA 2F03A 1I4PA 1G6ZA 1JICA 2WKDA 3FEWX 3TP6A 4ZKBB 2AHOB 2VUMG 1HNXQ 1QVFA 4GN3B 4UDUC 5JAVA 4NXNQ 3M7NA 1SYEA 4UP8A 1QJOA 3M7GA 3DMUA 1N36L 3OWFA 5IWAL 1A6XA 2EY2A 2ZT9C 2OTLA 1MHWC 2JA6H 4PMWA 3T53B 1OXSC 1GUSA 3I7FA 5CV9A 3P75A 2IHEA 4A93H 1XNRL 4BBRG 1PYSB 5CV6A 1UE6A 4KTAA 4KD3A 4POFA 1JJ2A 1D5ZC 5EQ0A 1IBLL 2JA7B 3AU7A 4XXEA 2GVBA 3MVVA 3S1RB 5EAYA 2VNUD 4IJHA 2FJ2A 1IL8A 1E7ZA 1S4ZA 4KHPL 5C44G 3DHQA 1ONLA 3UE0A 1ZXTA 3F2BA 2A8VA 4K14A 1N32Q 3BVZA 3NELA 4P74A 3KLRA 2Z6KA 2PO4A 3D3RA 3S17H 4GLVB 3KLSX 1JE5A 4H0LC 5DAUA 1S5ED 3I8ZA 4LJZC 3KF6A 2D0PA 4ME3A 4A3IG 1LUZA 5LMNW 2B63H 4B9XA 1W6JA 3NENA 3CCUA 2L5TA 3CU7A 3EIVA 1Q7YC 1KRTA 4CDEC 3DEPA 2R92H 4DXFA 2NVYB 3NTKA 3NBHA 3N52A 3V96A 4OONA 1YHBA 1JCKB 3J7A5 5BN3A 3K57A 4DR2L 2E2IB 4C3JG 1HZ9A 1PYBA 4H44C 5ELNA 4BBRB 3NEMA 2UUCQ 1S5DD 2IX3A 2VW9A 3DEOA 3M4YA 2K33A 2J7ZA 4JV5Q 4IPDA 2PPBC 1HZCA 2B2VC 2MJ8A 4JPBW 2MNAA 5FLMG 1LTLA 1EU3A 2CCZA 3AYHB 1EL0A 5LL6S 1B8AA 1QZGA 3GQBA 4PZ8A 2KCNA 5IGFA 1FVIA 1VCIA 3CCVA 2ALYB 3L0OA 1KDAA 2R93G 1TS2A 1Q8KA 3J7ZC 3AMUA 2RCNA 1QWYA 5CR3A 3Q24A 1X65A 3HEJA 1IYJB 2B3GA 4P72A 3UDFA 4DK6C 1KHIA 2E2DC 1PFSA 2JA6B 1HA6A 1A2UA 4Q0FA 3HOXH 1HZAA 1VQEA 4DR3Q 3OPOA 2RHQB 1Y8NB 2TMPA 1DYQA 4MZ9A 3IKJA 2AQ2B 5FO9B 1XTCD 3ULJA 2HHHL 2Q2HA 2CQAA 3VYUA 1CK1A 3QOLA 5FLXE 4Y7NB 1HNWL 4RMFA 1C0AA 1WOCA 4GKJQ 1VF5C 1I6VC 3F8TA 2B2TC 1EQQA 1VMCA 4B3ML 4IFDG 1HA5A 4HTHA 4A3GG 3BZDB 3RNUA 2CH4A 3LGJA 1L0XB 1BF4A 1JT8A 3J80L 4DAVA 1B9NA 5C4XH 4A3IH 4XIGS 1HNZL 4LFAQ 2KHIA 1V1QA 2YYZA 2K5QA 3RLNA 2JJQA 3OOCA 4BA1I 4ZLTF 4K6DA 4JI3L 3TREA 4GNXA 2R93H 3MFGA 2GA4B 2JA5G 4Z9CB 2HT1A 1RF2D 1AP0A 3M85A 1YNXA 3E9HA 2CVRA 1CHQD 1M1KC 2NN6I 1U4MA 3BDOA 4APVA 3BZKA 1PLFA 3D4WA 3ND8A 4YWKA 3CAMA 1KNAA 1JORA 4QQBX 3PO2B 3VR6A 2WP8J 3HOZB 1E2VA 3MXUA 4CJ2C 2JQOA 4DUZL 3MXPA 5C44B 3HRZC 2EJGC 3ICEA 4DR7L 5KEEA 5KNBA 2H5XA 1PTOH 2N3SA 3HZXA 4A4IA 3S24A 3A5UA 3CD6A 1QG7A 3EA6A 3WOEA 1STEA 2WFWA 4O0AA 1IZ6A 3I70A 5EBDA 2UXBQ 5GQOA 1VMPA 4RKLA 2A19A 1A3TA 3MWYW 1BXTA 1X9NA 3PUZA 1KLUD 1CM9A 4N9TA 5JJLA 4HJ7A 2ES2A 4FF4A 3S1QH 2AMCB 4NB3A 3S2HB 3QOJA 5M9OA 1HR0W 2X6LA 5IP9G 1EFID 4K5VA 5CV4A 5KRUA 5EPKA 1TWGB 4R4OA 1EY0A 4DNTB 4A3MB 1SYBA 2SDFA 5FO8B 3OMCA 1KDCA 1YNJC 1HQRD 1WTXA 4JI0Q 1D2BA 1CZWA 2IY5B 1HUNA 1WD1A 2K4KA 5FLXc 2MGSA 1L2FA 3I4NG 4HN7A 4C1NI 1UE1A 1VF7A 2F0NA 1ASYA 4I7ZC 3T16A 1BOSA 1OO9B 2O5IC 2IPKD 5I2XA 4CKBA 4G4KA 1X56A 4RHSA 1SN8A 3SEBA 4OO1G 1NNXA 2BH2A 1LO5D 4EQPA 1ML0D 3Q0AA 4LNQA 2WKCA 2PQAB 4DV4L 3F2DA 2ZXPA 5D65A 4KD4A 1NBWA 1A3VA 2RQXA 3LWEA 4FXDA 5BN4A 3SK6A 5H1SE 1JB3A 2MPMA 4A93B 2L4NA 3EFXD 5ELBA 5GROA 4QJFA 2J4XA 3C46A 4JI6L 2RVLA 3TP5A 4NDXA 3CC4A 5JOBA 2K05A 4B08A 1SYGA 1JC7A 5EPLA 3J7YW 2E8GA 4JBJA 1Y1VH 4DR4L 4DK1A 2NUCA 2R93B 5C4XB 1U9RA 3K7AH 2F0LA 2KQ3A 4UPAA 3PQIA 4N9PA 1TS4A 1AW7A 3R2IA 3GV6A 3MEHA 4NMZA 1H9RA 1JOQA 1CZGA 2L55A 1GUNA 3OW7A 2RA4A 3H0GG 4CDDC 1N33L 5CBAE 4DUZQ 1X3PA 1V1PB 3T51B 1PTOB 5T1IA 2EYHA 1PTOC 1J5EL 1I4HA 2L15A 4JI6Q 2KEDA 1XPRA 2R7FA 2A69C 2ZXRA 3S16H 5IGGA 4FF2A 4KMUC 2AUKA 3PIPA 3CCQA 5JJZA 3CW2C 4A3JH 5LMNL 2DNCA 3I56A 4RA8A 4JI8Q 1EQRA 3S1MB 1QNUA 1ILPA 4DA2A 3IAYA 2IWHA 1BVSA 3RR5A 5FO7B 1G51A 4FXGC 5J22A 1EY6A 3SVMA 1TS3A 4RGMA 5C5LA 2QF7A 4ABNA 1Q81C 4DR5Q 1R9TB 1AE3A 1SYDA 1KRSA 1TWCB 4Y52H 4IFDJ 1K9MC 5M5WB 4IO9A 1J8IA 3PF5A 4HIOA 3PMFA 5LL6X 1Y1VG 1J5EQ 2QEJC 5ELDA 4A3EH 2LSSA 5J3BA 2JA7G 1UUPA 1YZ6A 1WTOA 2K5VA 4KK7A 4IOAA 1DM0B 1EY7A 3P20A 4XT1B 1EZ8A 3CCSA 2A68D 1K83B 2F3IA 1KQSA 1YITA 5FKAC 2TSSA 3NE5B 2OXPA 4I65A 2WIIB 3MZ5A 4DV5Q 4L63B 3GTMB 1SMYC 2PMZE 2PQEA 3CF5A 2E2HB 1O7LA 3RZDH 4HAEA 1TU2B 3FRPB 4HSVA 4BBSB 1X55A 1LABA 3A74A 3IRBA 4EQ5A 5DM63 4A3DB 4JI3Q 3OIPA 2WINB 2Q2TA 1D6EC 2YTYA 4JBMA 3FKIH 2KUMA 2BOSA 3RZDB 2B2VA 3STBC 2PNHA 4LF5L 2ZXOA 1E2WA 1F2ZA 3CCMA 2OT2A 3CXCA 2UUBL 1PZID 4PV1C 1YJWA 1G6PA 2EYPA 2I5MX 5CC4A 2Z0SA 1B9MA 1BUVT 3NWSA 4FNFA 1T5XD 4L5SA 2EYFA 1W6KA 4RH6A 4G7ZC 2O4XA 2PNRC 1BCPB 1GUGA 2Y0SB 2B63B 2F0EA 1GKHA 5IYBG 4HIKA 3TQYA 4GOPB 3S1MH 4KHZA 1XMQL 4ME5A 1MI2A 3RZOH 4BY1H 2HIXA 2I0QA 4WORA 4BBRH 4DN4M 1ASZA 3RLFA 5IYDG 5I6YA 1K8AC 4X66L 4LFCQ 4DK3C 3FDTA 1F9QA 4BY1G 1OXVA 3CP0A 4K2KA 4HCEA 1C4QA 4GLXA 1WD0A 1YNJD 1WTQA 4A3LH 3JAMi 3T1HL 4IZ8A 4ZUJA 1Y14B 4R4CA 1XWEA 2B2UA 4KY6A 3ULLA 4DR5L 4JI7Q 3E0JA 3VDYA 5E7NA 2KVMA 2JA5H 3HOUB 1WVLA 3GTGH 5IY0A 1E0BA 4K8JA 1STHA 5EKKA 2WACA 1YI2A 4C3HG 1JWUD 5TSSA 4YHHQ 4DR6Q 4AQYQ 2SEBD 4E6IA 1JOKA 5M5WH 2EVBA 3K8AA 4A3BH 5FOBB 4A76A 4KHVA 1NR2A 3HFZB 4BS9A 2JA6G 1G8ZD 1I3QB 3UDIA 2R7ZG 2EQSA 3J80E 4JOIC 2DJGC 1AFPA 2K01A 1XPOA 1K83H 4OHJA 4LFCL 4KY7A 3I4NB 2EJMA 3PUVA 5HURA 2AKWB 3QB3A 4QB4A 4PMCA 5IODA 3U9SA 5JEAG 2A73B 2ATWA 1WTWA 2ZTCA 3DM3A 5E4XA 4KV6A 1GHJA 3NPPA 4DV2Q 1LV9A 3PUWA 1SFOB 4JVZA 2V4DA 3CCLA 3GTPB 4TSSA 1G291 2B2WC 4OWTB 2UXDQ 4L5QA 1PFNA 1XMOL 4NXML 1H9MA 2WB1E 2NVQB 3MHBA 4C3IG 5T1GA 3R3OA 4NW2A 3CC7A 2F4IA 1VQFA 4LMQD 3DXJC 3HOVG 1A0IA 3U9OA 1EYCA 1QOHA 1PTOD 3F2CA 1PH5A 1HH2P 3J81L 2R7ZH 2A69D 5C4HA 5HGTA 2N55A 4A3BG 1MIUA 4DV7L 1EY9A 2EYLA 2ID0A 2F0KA 1VQ4A 1SJHD 1PH8A 2VY3A 1Z47A 4L6TB 3EBEA 3Q6SA 2KCMA 5KNCA 3U4ZA 3PO2H 4JYAL 1SDFA 3N6RA 4NXMQ 1KL9A 2ENBA 1S5CD 2QW7A 5COYA 3PUXA 1DGSA 1PZKD 4DK0A 1OXTA 1STBA 3I4LA 1OXXK 2FMCA 4L5TA 4CDFC 1WI5A 1IBKL 2QDLA 3MXGA 1X6OA 1BCPD 1BQQT 1GOZA 1JE4A 5IGDA 2PW5A 2NVYH 2PMZB 1WTRA 1N8RC 2UUAQ 1A63A 5JVG3 2UXCQ 2QDBA 5A35A 3S9WA 3JAML 4JI7L 1A15A 4A3FG 3UI2A 3QO2A 3G7LA 4OELB 5M5YB 1VQAA 4K8IA 2R61A 5E4WC 5IT9c 1AN8A 1TWHB 3H0GB 5CORA 3HGBA 3CC2A 3NUCA 5FK9C 2JEBI 2A68C 3LNNA 2JN4A 2G9DA 2XRQD 4A3MH 1OXUA 1H9SA 3WDNA 1SYFA 3JAME 1NJIC 1GO3E 1SNPA 3D6CA 3S1QB 2LFNA 5C0XH 1CT1D 1SMYD 3I91A 3NBHB 5ELFA 1ZKOA 3UDXA 5M5XH 1K3BC 1RIPA 2DY8A 5ISRA 3NTHA 1HHVA 5EGTA 4Q5VA 2FFKB 4DV6L 5LMUQ 2JXMB 1RDPD 2EY1A 3BYYB 1L0WA 1JQYD 4DU9A 3KF6B 1LYLA 3CQZH 4TVAB 2IW3A 3AFPA 4R8NA 3HOXG 5M5XB 4B9WA 3M4QA 2EY6A 1SE8A 1GUWA 3I4MB 1V8QA 4K0KL 1HR0L 2NVQH 3DWAA 2RDFA 1F2LA 2ZJPA 2CHBD 1PH4A 4FO2A 2RF4A 3TRZA 3IFTA 4AYBE 4DR3L 5CGKA 1M90C 3RLOA 2RHSB 1CKNA 3TS0A 1PZJD 1VQMA 1WTHA 1NTGA 2K5WA 1ZYRC 1XNQL 1VQPA 2D2CC 4PG3A 2EXDA 4JG2A 1RTNA 1I4RA 3K5OA 1WTPA 3EJIA 4U673 4DV7Q 1HZBA 4X64Q 2OWOA 3NWTA 5IYDH 3QWNA 3S1RH 4DR2Q 1TWAH 1DONA 1VQBA 2AWNA 4IFDI 2MFIA 1VS0A 4H7BA 4IQZA 3URYA 4GNXB 1F2YA 4HIMA 4K0KQ 4OWWB 3SXHA 5JJIA 3HOZG 3K58A 4RCNA 3HOWG 1EY8A 3E5SA 2IX1A 1AH9A 1EYDA 1F2MA 5C4JB 1AZPA 2H4OA 2R92G 3J7AV 3PIOA 5IYBH 1SNMA 3KDFB 1IKMA 1B2TA 1O78A 4JOIA 1VQNA 2F0QA 2NB0A 1EFWA 3OYYA 4ALPA 2JE6I 4PQXA 4C3JH 1LT6D 3SGIA 4AYBB 4JBKA 2LMCB 4C1NK 3DUZA 4DV3Q 1BBWA 2YU9B 4UP7A 2A6HD 2KBNA 3SE0A 2LXKA 2L12A 3C2PA 1D7QA 2DJFC 1DOMA 4O1NA 2MHVA 3VYTA 4XQQA 1TY0A 1VQGA 2XN9C 4QCLA 2B2WA 2WB1G 4A3GB 1EWIA 1TWHH 3H0GH 3I3CA 4MTNA 1F9RA 4DV0L 1Y69U 4LF4Q 2F4VQ 2V1CC 1TQOA 1QZHA 1KXLA 2KHSA 2K50A 1AE2A 1T5EA 2CW0D 5F2DA 1LT4D 3H09A 4A3JB 1Q8IA 4P73A 4A3BB 2HHHQ 4PZ6A 1ENCA 2CH4W 3Q22A 4XQNA 1BDOA 1BCPF 2XVSA 3CRKC 3UDGA 3AQQA 3J81c 3HOYG 1ICWA 1A8VA 3A8JE 3I4MG 1DD2A 1EEID 1QE6A 1Q82C 1IW7D 2EY5A 1E22A 5EJWA 2IJ0A 1V1OA 3NK9A 3BYTB 1II3A 3GTJB 3J81i 3D31A 3KK7A 1SNQA 2QEXA 1I4GA 2FINB 3DWQA 1H9JA 2KJXA 2EE1A 1K8OA 1B4OA 5BN5A 1A3UA 1ICFB 5D3DA 4ZKCB 3GTLB 1JMCA 4DV0Q 1KLGD 1K28A 3A7AB 2E2HH 1JWMD 3S15H 4YCUA 3W1GA 4DNRB 3GTPH 3G6EA 4C3HH 3EVQA 3CHBD 3C1FA 2R3ZA 1VQKA 3U4VA 2R6GA 5KIXA 3L2PA 2Q2IA 5K36H 3I2ZA 4L5RC 4GN5A 3ONAB 4NPSA 1N34Q 2OF1A 4G7OC 3TBIB 4ZCKA 4BBSH 2WAQG 5E1FA 1Q12A 4N8X1 1P8LA 4JV5L 4FDBA 4IUPA 3PGZA 2ZTEA 3GTOB 1RJTA 2C5CA 3T4AC 3D0FA 4YY3Q 3K0YA 3FKIB 2B2YC 2F0SA 4R4TA 1BO0A 2K14A 3LX0A 3ER0A 1Q90A 1KC8C 4RFBA 2F52A
chains in the Genus database with same CATH topology
1WJJA 1X3EA 3A74A 1C9OA 3IRBA 4EQ5A 3JAMc 1IBLQ 1CSPA 1I5FA 4JI3Q 4AH6A 3KDFA 1Y1WG 2N49A 3FP9A 2YTYA 2Q2TA 4DAYB 4DUYQ 1E1OA 4JBMA 3FKIH 1QUQB 4R1JA 3J80i 3STBC 2PNHA 4LF5L 5JEAJ 4X66Q 4KHPQ 3CCMA 4GOPA 2UUBL 4JCVE 3CXCA 1VQ5A 1IL2A 4PZ7A 1YJWA 1G6PA 3FKIG 4LF4L 2F4VL 2CFMA 2I5MX 4IPCA 1A62A 2AHOB 2VUMG 1HNXQ 1QVFA 2Z0SA 4GN3B 4NXNQ 1Q46A 3M7NA 4UP8A 1N36L 4L5SA 5IWAL 4A3KH 2OTLA 4OXPA 2DUDA 2JA6H 3KFUA 1GKHA 4PMWA 5IYBG 1OXSC 4JI5Q 1PH2A 1Q1BA 4HIKA 4LUZA 3I7FA 1W3SA 3TQYA 1CKOA 2IHEA 4A93H 4IJLA 4HJ5A 4GOPB 1XNRL 4BBRG 2E2IH 4HJ8A 1PYSB 4KHZA 3KJPA 3S1MH 2E2JH 3CMEA 1UE6A 1XMQL 4POFA 1YHAA 1SROA 1JJ2A 4B3MQ 3RZOH 1UEBA 1IBLL 1SLJA 4BY1H 1E3PA 4JC0A 1KD1C 4JI4L 2HIXA 2I0QA 2MQHA 4BBRH 2GVBA 2VQEL 5GAGC 4OWXB 1GM5A 1N9WA 1ASZA 1SR3A 5EAYA 3RLFA 3K80C 5IYDG 4IJHA 1K8AC 1E7ZA 3Q8DA 1B70B 2VNUD 4X66L 1P16A 5C44G 3J80c 1PHJA 4LFCQ 4DK3C 4KHPL 4BY1G 4YCWA 4C2MH 1OXVA 3CP0A 2CKZB 3UE0A 3H3VI 2NZHA 4GLXA 2JA7H 3F2BA 2A8VA 1EYGA 1S40A 1N32Q 4A3LH 3A0JA 3JAMi 1XPUA 3NELA 4P74A 3T1HL 2NZOA 2Z6KA 2Y0SE 4A3DH 3M9BA 1Y14B 4R4CA 3S17H 4B3RQ 4GLVB 3MEFA 3ULLA 2Z6KC 3ZJYC 1JE5A 4DR5L 1K0RA 4DR1Q 4JI7Q 5IWAQ 3GTJH 4GNXC 5E7NA 3VDYA 3KF6A 4YWMA 2D0PA 4ME3A 4A3IG 1YJ9A 2JA5H 1LUZA 4LF9L 2D0OA 3GTGH 5IY0A 5LMNW 2B63H 4P75A 3NENA 2DGYA 3CCUA 2VZAA 2I5HA 2E5LQ 1XMOQ 1YI2A 2UXCL 3EIVA 1Q7YC 1OTCA 1KRTA 1PH9A 2R92H 4YHHQ 2VUMH 4AQYQ 4DR6Q 1K8GA 5M5WH 3TS2A 3MXNB 3K8AA 4OONA 2JK8A 4A3BH 2NN6G 3GO5A 4B3TQ 3UE1A 4A76A 3HFZB 1YHBA 2JA6G 1V43A 3J7A5 4X64L 5AJ3L 4XTCS 3UDIA 2EQSA 2R7ZG 4DR2L 1HZ9A 4KI0A 4DR7Q 5BR8L 1PYBA 4DV1L 4KLKA 3PV0A 5ELNA 4B3SQ 3NEMA 4JOIC 1N34L 2UUCQ 4LFBL 1RL2A 3U50C 4A3JG 1MJEA 1N33Q 2VW9A 2K52A 4X65L 1XPOA 1K83H 4LFCL 1Y1WH 5C4JH 4A75A 2HQLA 3PUVA 4YCVA 2OQ0A 3GD7A 2AKWB 4O2DA 5M3MH 2JA8H 5IP7H 4IPDA 4JV5Q 4LUVA 1HZCA 5JEAG 2ATWA 1VQHA 2ZTCA 3DM3A 5HY6A 5FLMG 1X3FA 2MNAA 1LTLA 4B3RL 2MO0A 2CCZA 3AYHB 1NY4A 3JC66 4DV2Q 3HKZE 3PUWA 4YWLA 4X6AH 1B8AA 5LMNQ 1QZGA 4PZ8A 2GN5A 1SRUA 3OW2A 3CCLA 5M3FG 2IT1A 1FVIA 1VCIA 3GTOH 1Q1EA 4QGUA 1G291 4OWTB 4A3FH 1JJCB 4LF8L 3CCVA 3M3YH 2PI2E 4L5QA 1XMOL 2E5LL 4NXML 4A3CH 2UXDQ 2ALYB 3L0OA 4GN4B 4GS3A 3K81C 2R93G 1Q8KA 2WB1E 3J7ZC 1T9HA 2KHJA 2RCNA 4AYBG 3RN5A 4BXXG 2YTVA 1BBUA 3GTKH 1X65A 2OCEA 1R9TH 3CC7A 1IYJB 2B3GA 4P72A 3BZCA 3UDFA 4BY7G 1VQFA 1LM0A 4DK6C 1KHIA 3HOVG 1PFSA 1A0IA 1CUKA 3ULPA 5C0XI 3HOXH 1HZAA 1VQEA 4JBWA 4DR3Q 2RHQB 3F2CA 1PH5A 3U58A 1HH2P 4LF7L 2R7ZH 2C35B 4MZ9A 3OTOL 3T1YL 1QUQA 2VS1A 4A3BG 1MIUA 4DAMA 3S1NH 4WJ4A 1TWFH 4DV7L 1PVOA 3ULJA 2HHHL 2Q2HA 4IPHA 2ID0A 4LWCA 1EUJA 5FJ8G 3PF4A 1HNWL 4R4IA 4RMFA 1VQ4A 1PH3A 4HJAA 3TEHB 1C0AA 1WOCA 1PH8A 2VY3A 4UY8C 4GKJQ 4QL5A 1Z47A 3G71A 3HOYH 4A3GH 3CPWA 1VQJA 4BA2I 5IP7G 2R7DA 3EBEA 1W2BA 4UP9A 2KCMA 3CPFA 3F8TA 3U4ZA 1K3RA 1EQQA 3PO2H 3S2DH 4JYAL 1L1OB 4NXMQ 1KL9A 4B3ML 4GKKQ 2IHFA 4IFDG 2N78A 3H3VH 3PUXA 1DGSA 4A3GG 1TWGH 3RNUA 1OXTA 1X3GA 3LGJA 1J6QA 3W1BA 1OXXK 1JT8A 4L5TA 1K73C 1WI5A 2WAQE 5C3EG 3DLLA 5C4XH 3KLWA 4A3IH 1IBKL 3GTLH 2EIFA 4XIGS 1HNZL 1X6OA 4LFAQ 4LF9Q 4DPGA 2KHIA 5HGQA 1QVGA 2NVYH 1V1QA 2B29A 2YYZA 1N8RC 3RLNA 1NE3A 2UXBL 1JB7A 2JJQA 4TQUS 3CMAA 2UUAQ 1A63A 1VQIA 2UXCQ 4BA1I 1NMGA 4JI3L 3TREA 4YHHL 4GNXA 4JI7L 4HIDA 2R93H 3S2HH 3GDEA 1CKMA 2JA5G 4LF6L 4A3FG 2HT1A 3KOJA 2BA1A 1TWCH 3M85A 1YNXA 3E9HA 3HKSA 3KYHC 5C0XJ 3ERSX 1BKBA 1E24A 1GVPA 4LF5Q 1M1KC 1VQAA 2NN6I 4DR4Q 5ELOA 5IT9c 3I4NH 5BR8Q 4APVA 5C3EH 3CC2A 2JEBI 3BJUA 3BZKA 4YWKA 3CAMA 3GTMH 1GD7A 4QQBX 2WP8J 1U0LA 4A3MH 4NXNL 1OXUA 3KF8B 1C7YA 2JQOA 4DUZL 4X62L 3G48A 5M3FH 1YIJA 1NJIC 1SFOH 3ICEA 1WFQA 4DR7L 1GO3E 1MJCA 2H5XA 1L1OC 2N3SA 2UUCL 4A4IA 3M4PA 3S24A 3HOWH 3NBHB 2UU9Q 4JI5L 3A5UA 3CD6A 1CSQA 3UDXA 5M5XH 1RIPA 1VQ6A 4IOCA 3CCEA 2PI2A 2WFWA 4O0AA 1IZ6A 1XNRQ 1I94L 4DV6L 1YJNA 1FL0A 3K7UC 3I4OA 4LUOA 5LMUQ 2UXBQ 5GQOA 1JJGA 4LF8Q 1L0WA 1I50H 5DLQE 3KF6B 2CWAA 1LYLA 2A19A 3CQZH 4TVAB 3AFPA 4DV2L 3FHWA 1X9NA 4DV4Q 3PUZA 3HOXG 5JJLA 5GADC 1VQ8A 2IX0A 2MO1A 3M4QA 4HJ7A 4DUYL 2ES2A 2ASBA 1SE8A 2A1AA 5GAEC 3S1QH 1WCMH 2AMCB 4K0KL 1PH6A 4NB3A 4OX9Q 1HR0L 2NVQH 1HR0W 4JI8L 5IP9G 2ZJPA 3KJOA 1D8LA 1PH4A 2JEAI 4GOPC 2RF4A 3TRZA 4AYBE 4EX5A 3WWVA 4DR3L 4GLAC 5JJKA 4R4OA 1M90C 3RLOA 4A3LG 2VQFL 1X54A 2RHSB 2XTIA 4LF7Q 1CKNA 3TS0A 4DR1L 1VQMA 4A3CG 1NTGA 4JI0Q 4AIMA 2IY5B 1XNQL 2K75A 2K4KA 5FLXc 1VQPA 1XJVA 1L2FA 3I55A 4A93G 3I4NG 1Q86C 2F52A 4QIWE 4PG3A 1UE1A 2EXDA 1XTDA 4JG2A 4A3DG 2BH8A 3E0EA 3GTQH 2Y0SG 1ASYA 4DV3L 3OTOQ 3T1YQ 1YHQA 3PUYA 3G4SA 5LMUL 2OQKA 4B3TL 1X56A 4DV7Q 1SN8A 5C44H 1HZBA 4X64Q 4OO1G 2OWOA 2YTXA 2BH2A 5IYDH 3S1RH 1XMQQ 4DR2Q 1TWAH 4JI2Q 2CWPA 1VQBA 2AWNA 4LNQA 1UWVA 2PQAB 2MFIA 3B6YA 4DV4L 2YU9H 1VS0A 2XGTA 3F2DA 4IFDI 1VQ7A 3PO2G 4LFBQ 4GNXB 4OO1I 5K36G 1IBMQ 2Q2UA 2NVTH 5C4XG 3EN2A 1YBYA 1VQOA 1NBWA 4HIMA 4K0KQ 4OWWB 3W5OA 1VQLA 4QY7A 4OX9L 5JJIA 1HR0Q 5H1SE 1PH1A 3J81j 1PV4A 4LFAL 3HOZG 2BA0A 4JI1Q 1TXYA 5C0XG 3HOWG 1I6HH 5GROA 2IX1A 2ZJQA 1AH9A 4QJFA 2UUAL 3CCRA 4JI6L 5IYCH 3PCOB 1PA6A 2R92G 3HOUH 3PIOA 5IYBH 1MKHA 3CC4A 3KDFB 4P71A 4JOIA 1WYDA 1IBKQ 4LF6Q 2QGQA 1VQNA 1XNQQ 4A3MG 1EFWA 3OYYA 2KENA 4ALPA 2JE6I 4YY3L 4C3JH 3SGIA 4JBKA 1UE5A 2E8GA 1Y1VH 4JBJA 4DR4L 1L1OA 2N8NA 2UXDL 1VQCA 5IE8A 3CCJA 4DNIA 2VL6A 4HJ9A 3K7AH 4DV3Q 1BBWA 4UP7A 2KBNA 2JA9A 2LXKA 4UPAA 1D7QA 1FGUA 4X62Q 3S14H 2ZM6Q 3I4MH 1VQGA 4R4QA 5AJ3Q 1SMXA 2OTJA 1CKNB 2WB1G 1EWIA 1TWHH 3H0GH 3H0GG 1KAWA 4MTNA 4DV0L 1N33L 4LF4Q 4Y7NH 2F4VQ 2V1CC 2YV5A 3STBD 4X65Q 1QZHA 1HNXL 4DUZQ 1KXLA 1I3QH 5FLMH 2K50A 1AE2A 1NMFA 4DKAC 2K5NA 1J5EL 2L15A 4JI6Q 4P73A 1XPRA 2PQAA 2R7FA 4LW1A 3HOVH 4BBSG 2HHHQ 3M4OH 4PZ6A 5IP9H 3S16H 3PO3G 2ZJRA 3PIPA 3CCQA 4JI4Q 1WCMG 2KCTA 5GAHC 1I94Q 4H02A 2VQEQ 4DV6Q 3AQQA 3CW2C 5LMNL 3UDGA 3J81c 1U5KA 4C3IH 4A3JH 3HOYG 1A8VA 2ZTDA 2NVXH 3I4MG 4A3KG 4A3EG 4RG1A 3I56A 2LXJA 1EQRA 4JI8Q 1X55A 1EOVA 2QA4A 1Q82C 1BVSA 4J15A 4POGA 1EIYB 3RR5A 1O7IA 3HOUG 1E22A 1G51A 5IYCG 3T1HQ 2ZM6L 3J81i 4JI0L 3D31A 4DV5L 3H15A 2I5LX 1HNZQ 2D62A 4DR5Q 1Q81C 1AE3A 1PH7A 2QEXA 2CQOA 1KRSA 3AFQA 1EIFA 3F1ZA 2GVAA 1VQ9A 1E1TA 1FJGQ 4IFDJ 4Y52H 1H95A 1K9MC 1JMCA 4DV0Q 1N32L 2VQFQ 3AEVA 4IO9A 1Z9FA 3PF5A 3A5ZB 2E2HH 4HIOA 3S15H 1Y1VG 2AWOA 4IPGA 4YCUA 3W1GA 1J5EQ 3GTPH 3G6EA 4DR6L 4A3EH 4C3HH 3HOZH 2LSSA 3RN2A 1V9PA 5J3BA 5FJ8H 2JA7G 1HJPA 3U4VA 1VQKA 2R6GA 1YZ6A 1B7YB 3L2PA 2K5VA 2Q2IA 4BY7H 3I2ZA 4L5RC 4GN5A 1HNWQ 4NPSA 1IBML 2UUBQ 1YVCA 4GKJL 1N34Q 4IOAA 3E9IA 5M5YH 4BBSH 2WAQG 4AQYL 4JYAQ 1UE7A 3CCSA 3PSIA 1Q12A 3BU2A 2F3IA 4JI2L 1KQSA 2B63G 4GKKL 1KIXA 1N36Q 3L7ZC 1YITA 1P8LA 4JV5L 4WJ3M 4DV1Q 4FDBA 5M3MG 4B3SL 2JA8G 2UU9L 3PGZA 4MNOA 3PO3H 2ZTEA 4DV5Q 3K0XA 1YEZA 3HKZG 2PMZE 3D0FA 4JI1L 4YY3Q 3CF5A 4BXXH 3RZDH 1FJGL 1S72A 2FXQA 1QVCA 1IXRA 2HIVA 1S3OA 1VQDA 4R4TA 2K14A 3ER0A 1KC8C 2K5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJJ A;  1X3E A;  3A74 A;  1C9O A;  3IRB A;  4EQ5 A;  3JAM c;  1IBL Q;  1CSP A;  1I5F A;  4JI3 Q;  4AH6 A;  3KDF A;  1Y1W G;  2N49 A;  3FP9 A;  2YTY A;  2Q2T A;  4DAY B;  4DUY Q;  1E1O A;  4JBM A;  3FKI H;  1QUQ B;  4R1J A;  3J80 i;  3STB C;  2PNH A;  4LF5 L;  5JEA J;  4X66 Q;  4KHP Q;  3CCM A;  4GOP A;  2UUB L;  4JCV E;  3CXC A;  1VQ5 A;  1IL2 A;  4PZ7 A;  1YJW A;  1G6P A;  3FKI G;  4LF4 L;  2F4V L;  2CFM A;  2I5M X;  4IPC A;  1A62 A;  2AHO B;  2VUM G;  1HNX Q;  1QVF A;  2Z0S A;  4GN3 B;  4NXN Q;  1Q46 A;  3M7N A;  4UP8 A;  1N36 L;  4L5S A;  5IWA L;  4A3K H;  2OTL A;  4OXP A;  2DUD A;  2JA6 H;  3KFU A;  1GKH A;  4PMW A;  5IYB G;  1OXS C;  4JI5 Q;  1PH2 A;  1Q1B A;  4HIK A;  4LUZ A;  3I7F A;  1W3S A;  3TQY A;  1CKO A;  2IHE A;  4A93 H;  4IJL A;  4HJ5 A;  4GOP B;  1XNR L;  4BBR G;  2E2I H;  4HJ8 A;  1PYS B;  4KHZ A;  3KJP A;  3S1M H;  2E2J H;  3CME A;  1UE6 A;  1XMQ L;  4POF A;  1YHA A;  1SRO A;  1JJ2 A;  4B3M Q;  3RZO H;  1UEB A;  1IBL L;  1SLJ A;  4BY1 H;  1E3P A;  4JC0 A;  1KD1 C;  4JI4 L;  2HIX A;  2I0Q A;  2MQH A;  4BBR H;  2GVB A;  2VQE L;  5GAG C;  4OWX B;  1GM5 A;  1N9W A;  1ASZ A;  1SR3 A;  5EAY A;  3RLF A;  3K80 C;  5IYD G;  4IJH A;  1K8A C;  1E7Z A;  3Q8D A;  1B70 B;  2VNU D;  4X66 L;  1P16 A;  5C44 G;  3J80 c;  1PHJ A;  4LFC Q;  4DK3 C;  4KHP L;  4BY1 G;  4YCW A;  4C2M H;  1OXV A;  3CP0 A;  2CKZ B;  3UE0 A;  3H3V I;  2NZH A;  4GLX A;  2JA7 H;  3F2B A;  2A8V A;  1EYG A;  1S40 A;  1N32 Q;  4A3L H;  3A0J A;  3JAM i;  1XPU A;  3NEL A;  4P74 A;  3T1H L;  2NZO A;  2Z6K A;  2Y0S E;  4A3D H;  3M9B A;  1Y14 B;  4R4C A;  3S17 H;  4B3R Q;  4GLV B;  3MEF A;  3ULL A;  2Z6K C;  3ZJY C;  1JE5 A;  4DR5 L;  1K0R A;  4DR1 Q;  4JI7 Q;  5IWA Q;  3GTJ H;  4GNX C;  5E7N A;  3VDY A;  3KF6 A;  4YWM A;  2D0P A;  4ME3 A;  4A3I G;  1YJ9 A;  2JA5 H;  1LUZ A;  4LF9 L;  2D0O A;  3GTG H;  5IY0 A;  5LMN W;  2B63 H;  4P75 A;  3NEN A;  2DGY A;  3CCU A;  2VZA A;  2I5H A;  2E5L Q;  1XMO Q;  1YI2 A;  2UXC L;  3EIV A;  1Q7Y C;  1OTC A;  1KRT A;  1PH9 A;  2R92 H;  4YHH Q;  2VUM H;  4AQY Q;  4DR6 Q;  1K8G A;  5M5W H;  3TS2 A;  3MXN B;  3K8A A;  4OON A;  2JK8 A;  4A3B H;  2NN6 G;  3GO5 A;  4B3T Q;  3UE1 A;  4A76 A;  3HFZ B;  1YHB A;  2JA6 G;  1V43 A;  3J7A 5;  4X64 L;  5AJ3 L;  4XTC S;  3UDI A;  2EQS A;  2R7Z G;  4DR2 L;  1HZ9 A;  4KI0 A;  4DR7 Q;  5BR8 L;  1PYB A;  4DV1 L;  4KLK A;  3PV0 A;  5ELN A;  4B3S Q;  3NEM A;  4JOI C;  1N34 L;  2UUC Q;  4LFB L;  1RL2 A;  3U50 C;  4A3J G;  1MJE A;  1N33 Q;  2VW9 A;  2K52 A;  4X65 L;  1XPO A;  1K83 H;  4LFC L;  1Y1W H;  5C4J H;  4A75 A;  2HQL A;  3PUV A;  4YCV A;  2OQ0 A;  3GD7 A;  2AKW B;  4O2D A;  5M3M H;  2JA8 H;  5IP7 H;  4IPD A;  4JV5 Q;  4LUV A;  1HZC A;  5JEA G;  2ATW A;  1VQH A;  2ZTC A;  3DM3 A;  5HY6 A;  5FLM G;  1X3F A;  2MNA A;  1LTL A;  4B3R L;  2MO0 A;  2CCZ A;  3AYH B;  1NY4 A;  3JC6 6;  4DV2 Q;  3HKZ E;  3PUW A;  4YWL A;  4X6A H;  1B8A A;  5LMN Q;  1QZG A;  4PZ8 A;  2GN5 A;  1SRU A;  3OW2 A;  3CCL A;  5M3F G;  2IT1 A;  1FVI A;  1VCI A;  3GTO H;  1Q1E A;  4QGU A;  1G29 1;  4OWT B;  4A3F H;  1JJC B;  4LF8 L;  3CCV A;  3M3Y H;  2PI2 E;  4L5Q A;  1XMO L;  2E5L L;  4NXM L;  4A3C H;  2UXD Q;  2ALY B;  3L0O A;  4GN4 B;  4GS3 A;  3K81 C;  2R93 G;  1Q8K A;  2WB1 E;  3J7Z C;  1T9H A;  2KHJ A;  2RCN A;  4AYB G;  3RN5 A;  4BXX G;  2YTV A;  1BBU A;  3GTK H;  1X65 A;  2OCE A;  1R9T H;  3CC7 A;  1IYJ B;  2B3G A;  4P72 A;  3BZC A;  3UDF A;  4BY7 G;  1VQF A;  1LM0 A;  4DK6 C;  1KHI A;  3HOV G;  1PFS A;  1A0I A;  1CUK A;  3ULP A;  5C0X I;  3HOX H;  1HZA A;  1VQE A;  4JBW A;  4DR3 Q;  2RHQ B;  3F2C A;  1PH5 A;  3U58 A;  1HH2 P;  4LF7 L;  2R7Z H;  2C35 B;  4MZ9 A;  3OTO L;  3T1Y L;  1QUQ A;  2VS1 A;  4A3B G;  1MIU A;  4DAM A;  3S1N H;  4WJ4 A;  1TWF H;  4DV7 L;  1PVO A;  3ULJ A;  2HHH L;  2Q2H A;  4IPH A;  2ID0 A;  4LWC A;  1EUJ A;  5FJ8 G;  3PF4 A;  1HNW L;  4R4I A;  4RMF A;  1VQ4 A;  1PH3 A;  4HJA A;  3TEH B;  1C0A A;  1WOC A;  1PH8 A;  2VY3 A;  4UY8 C;  4GKJ Q;  4QL5 A;  1Z47 A;  3G71 A;  3HOY H;  4A3G H;  3CPW A;  1VQJ A;  4BA2 I;  5IP7 G;  2R7D A;  3EBE A;  1W2B A;  4UP9 A;  2KCM A;  3CPF A;  3F8T A;  3U4Z A;  1K3R A;  1EQQ A;  3PO2 H;  3S2D H;  4JYA L;  1L1O B;  4NXM Q;  1KL9 A;  4B3M L;  4GKK Q;  2IHF A;  4IFD G;  2N78 A;  3H3V H;  3PUX A;  1DGS A;  4A3G G;  1TWG H;  3RNU A;  1OXT A;  1X3G A;  3LGJ A;  1J6Q A;  3W1B A;  1OXX K;  1JT8 A;  4L5T A;  1K73 C;  1WI5 A;  2WAQ E;  5C3E G;  3DLL A;  5C4X H;  3KLW A;  4A3I H;  1IBK L;  3GTL H;  2EIF A;  4XIG S;  1HNZ L;  1X6O A;  4LFA Q;  4LF9 Q;  4DPG A;  2KHI A;  5HGQ A;  1QVG A;  2NVY H;  1V1Q A;  2B29 A;  2YYZ A;  1N8R C;  3RLN A;  1NE3 A;  2UXB L;  1JB7 A;  2JJQ A;  4TQU S;  3CMA A;  2UUA Q;  1A63 A;  1VQI A;  2UXC Q;  4BA1 I;  1NMG A;  4JI3 L;  3TRE A;  4YHH L;  4GNX A;  4JI7 L;  4HID A;  2R93 H;  3S2H H;  3GDE A;  1CKM A;  2JA5 G;  4LF6 L;  4A3F G;  2HT1 A;  3KOJ A;  2BA1 A;  1TWC H;  3M85 A;  1YNX A;  3E9H A;  3HKS A;  3KYH C;  5C0X J;  3ERS X;  1BKB A;  1E24 A;  1GVP A;  4LF5 Q;  1M1K C;  1VQA A;  2NN6 I;  4DR4 Q;  5ELO A;  5IT9 c;  3I4N H;  5BR8 Q;  4APV A;  5C3E H;  3CC2 A;  2JEB I;  3BJU A;  3BZK A;  4YWK A;  3CAM A;  3GTM H;  1GD7 A;  4QQB X;  2WP8 J;  1U0L A;  4A3M H;  4NXN L;  1OXU A;  3KF8 B;  1C7Y A;  2JQO A;  4DUZ L;  4X62 L;  3G48 A;  5M3F H;  1YIJ A;  1NJI C;  1SFO H;  3ICE A;  1WFQ A;  4DR7 L;  1GO3 E;  1MJC A;  2H5X A;  1L1O C;  2N3S A;  2UUC L;  4A4I A;  3M4P A;  3S24 A;  3HOW H;  3NBH B;  2UU9 Q;  4JI5 L;  3A5U A;  3CD6 A;  1CSQ A;  3UDX A;  5M5X H;  1RIP A;  1VQ6 A;  4IOC A;  3CCE A;  2PI2 A;  2WFW A;  4O0A A;  1IZ6 A;  1XNR Q;  1I94 L;  4DV6 L;  1YJN A;  1FL0 A;  3K7U C;  3I4O A;  4LUO A;  5LMU Q;  2UXB Q;  5GQO A;  1JJG A;  4LF8 Q;  1L0W A;  1I50 H;  5DLQ E;  3KF6 B;  2CWA A;  1LYL A;  2A19 A;  3CQZ H;  4TVA B;  3AFP A;  4DV2 L;  3FHW A;  1X9N A;  4DV4 Q;  3PUZ A;  3HOX G;  5JJL A;  5GAD C;  1VQ8 A;  2IX0 A;  2MO1 A;  3M4Q A;  4HJ7 A;  4DUY L;  2ES2 A;  2ASB A;  1SE8 A;  2A1A A;  5GAE C;  3S1Q H;  1WCM H;  2AMC B;  4K0K L;  1PH6 A;  4NB3 A;  4OX9 Q;  1HR0 L;  2NVQ H;  1HR0 W;  4JI8 L;  5IP9 G;  2ZJP A;  3KJO A;  1D8L A;  1PH4 A;  2JEA I;  4GOP C;  2RF4 A;  3TRZ A;  4AYB E;  4EX5 A;  3WWV A;  4DR3 L;  4GLA C;  5JJK A;  4R4O A;  1M90 C;  3RLO A;  4A3L G;  2VQF L;  1X54 A;  2RHS B;  2XTI A;  4LF7 Q;  1CKN A;  3TS0 A;  4DR1 L;  1VQM A;  4A3C G;  1NTG A;  4JI0 Q;  4AIM A;  2IY5 B;  1XNQ L;  2K75 A;  2K4K A;  5FLX c;  1VQP A;  1XJV A;  1L2F A;  3I55 A;  4A93 G;  3I4N G;  1Q86 C;  2F52 A;  4QIW E;  4PG3 A;  1UE1 A;  2EXD A;  1XTD A;  4JG2 A;  4A3D G;  2BH8 A;  3E0E A;  3GTQ H;  2Y0S G;  1ASY A;  4DV3 L;  3OTO Q;  3T1Y Q;  1YHQ A;  3PUY A;  3G4S A;  5LMU L;  2OQK A;  4B3T L;  1X56 A;  4DV7 Q;  1SN8 A;  5C44 H;  1HZB A;  4X64 Q;  4OO1 G;  2OWO A;  2YTX A;  2BH2 A;  5IYD H;  3S1R H;  1XMQ Q;  4DR2 Q;  1TWA H;  4JI2 Q;  2CWP A;  1VQB A;  2AWN A;  4LNQ A;  1UWV A;  2PQA B;  2MFI A;  3B6Y A;  4DV4 L;  2YU9 H;  1VS0 A;  2XGT A;  3F2D A;  4IFD I;  1VQ7 A;  3PO2 G;  4LFB Q;  4GNX B;  4OO1 I;  5K36 G;  1IBM Q;  2Q2U A;  2NVT H;  5C4X G;  3EN2 A;  1YBY A;  1VQO A;  1NBW A;  4HIM A;  4K0K Q;  4OWW B;  3W5O A;  1VQL A;  4QY7 A;  4OX9 L;  5JJI A;  1HR0 Q;  5H1S E;  1PH1 A;  3J81 j;  1PV4 A;  4LFA L;  3HOZ G;  2BA0 A;  4JI1 Q;  1TXY A;  5C0X G;  3HOW G;  1I6H H;  5GRO A;  2IX1 A;  2ZJQ A;  1AH9 A;  4QJF A;  2UUA L;  3CCR A;  4JI6 L;  5IYC H;  3PCO B;  1PA6 A;  2R92 G;  3HOU H;  3PIO A;  5IYB H;  1MKH A;  3CC4 A;  3KDF B;  4P71 A;  4JOI A;  1WYD A;  1IBK Q;  4LF6 Q;  2QGQ A;  1VQN A;  1XNQ Q;  4A3M G;  1EFW A;  3OYY A;  2KEN A;  4ALP A;  2JE6 I;  4YY3 L;  4C3J H;  3SGI A;  4JBK A;  1UE5 A;  2E8G A;  1Y1V H;  4JBJ A;  4DR4 L;  1L1O A;  2N8N A;  2UXD L;  1VQC A;  5IE8 A;  3CCJ A;  4DNI A;  2VL6 A;  4HJ9 A;  3K7A H;  4DV3 Q;  1BBW A;  4UP7 A;  2KBN A;  2JA9 A;  2LXK A;  4UPA A;  1D7Q A;  1FGU A;  4X62 Q;  3S14 H;  2ZM6 Q;  3I4M H;  1VQG A;  4R4Q A;  5AJ3 Q;  1SMX A;  2OTJ A;  1CKN B;  2WB1 G;  1EWI A;  1TWH H;  3H0G H;  3H0G G;  1KAW A;  4MTN A;  4DV0 L;  1N33 L;  4LF4 Q;  4Y7N H;  2F4V Q;  2V1C C;  2YV5 A;  3STB D;  4X65 Q;  1QZH A;  1HNX L;  4DUZ Q;  1KXL A;  1I3Q H;  5FLM H;  2K50 A;  1AE2 A;  1NMF A;  4DKA C;  2K5N A;  1J5E L;  2L15 A;  4JI6 Q;  4P73 A;  1XPR A;  2PQA A;  2R7F A;  4LW1 A;  3HOV H;  4BBS G;  2HHH Q;  3M4O H;  4PZ6 A;  5IP9 H;  3S16 H;  3PO3 G;  2ZJR A;  3PIP A;  3CCQ A;  4JI4 Q;  1WCM G;  2KCT A;  5GAH C;  1I94 Q;  4H02 A;  2VQE Q;  4DV6 Q;  3AQQ A;  3CW2 C;  5LMN L;  3UDG A;  3J81 c;  1U5K A;  4C3I H;  4A3J H;  3HOY G;  1A8V A;  2ZTD A;  2NVX H;  3I4M G;  4A3K G;  4A3E G;  4RG1 A;  3I56 A;  2LXJ A;  1EQR A;  4JI8 Q;  1X55 A;  1EOV A;  2QA4 A;  1Q82 C;  1BVS A;  4J15 A;  4POG A;  1EIY B;  3RR5 A;  1O7I A;  3HOU G;  1E22 A;  1G51 A;  5IYC G;  3T1H Q;  2ZM6 L;  3J81 i;  4JI0 L;  3D31 A;  4DV5 L;  3H15 A;  2I5L X;  1HNZ Q;  2D62 A;  4DR5 Q;  1Q81 C;  1AE3 A;  1PH7 A;  2QEX A;  2CQO A;  1KRS A;  3AFQ A;  1EIF A;  3F1Z A;  2GVA A;  1VQ9 A;  1E1T A;  1FJG Q;  4IFD J;  4Y52 H;  1H95 A;  1K9M C;  1JMC A;  4DV0 Q;  1N32 L;  2VQF Q;  3AEV A;  4IO9 A;  1Z9F A;  3PF5 A;  3A5Z B;  2E2H H;  4HIO A;  3S15 H;  1Y1V G;  2AWO A;  4IPG A;  4YCU A;  3W1G A;  1J5E Q;  3GTP H;  3G6E A;  4DR6 L;  4A3E H;  4C3H H;  3HOZ H;  2LSS A;  3RN2 A;  1V9P A;  5J3B A;  5FJ8 H;  2JA7 G;  1HJP A;  3U4V A;  1VQK A;  2R6G A;  1YZ6 A;  1B7Y B;  3L2P A;  2K5V A;  2Q2I A;  4BY7 H;  3I2Z A;  4L5R C;  4GN5 A;  1HNW Q;  4NPS A;  1IBM L;  2UUB Q;  1YVC A;  4GKJ L;  1N34 Q;  4IOA A;  3E9I A;  5M5Y H;  4BBS H;  2WAQ G;  4AQY L;  4JYA Q;  1UE7 A;  3CCS A;  3PSI A;  1Q12 A;  3BU2 A;  2F3I A;  4JI2 L;  1KQS A;  2B63 G;  4GKK L;  1KIX A;  1N36 Q;  3L7Z C;  1YIT A;  1P8L A;  4JV5 L;  4WJ3 M;  4DV1 Q;  4FDB A;  5M3M G;  4B3S L;  2JA8 G;  2UU9 L;  3PGZ A;  4MNO A;  3PO3 H;  2ZTE A;  4DV5 Q;  3K0X A;  1YEZ A;  3HKZ G;  2PMZ E;  3D0F A;  4JI1 L;  4YY3 Q;  3CF5 A;  4BXX H;  3RZD H;  1FJG L;  1S72 A;  2FXQ A;  1QVC A;  1IXR A;  2HIV A;  1S3O A;  1VQD A;  4R4T A;  2K14 A;  3ER0 A;  1KC8 C;  2K5H A; 
#chains in the Genus database with same CATH topology
 1SNC A;  1STY A;  1IBL Q;  4AH6 A;  4DAY B;  2SNS A;  1Y1W B;  1Y8P B;  4R1J A;  2WB1 B;  1HFN A;  2O5J C;  2LKV A;  1EOT A;  5C6A A;  1VQ5 A;  1IL2 A;  4PZ7 A;  2CFM A;  1M4V A;  1Q46 A;  1EWH A;  4MN3 A;  3KLS A;  2LY7 A;  1ENA A;  1F77 A;  1F9S A;  3D4D A;  3SR1 A;  2DUD A;  3KFU A;  1O7Y A;  3E6Z X;  1PMR A;  1PH2 A;  1FGB D;  4LUZ A;  4OGQ C;  1CKO A;  4IJL A;  3AB9 A;  4HJ5 A;  2E2I H;  4HJ8 A;  4RCO A;  2AQ3 B;  5C3W A;  3KJP A;  4A3E B;  5IIF A;  1Q3L A;  2E2J H;  1HTP A;  3S1N B;  1YHA A;  4B3M Q;  1UEB A;  4J8Q A;  2FHT A;  4HR7 B;  2B2Y A;  1E3P A;  4JC0 A;  2MQH A;  3TSS A;  2VQE L;  1GM5 A;  5GAG C;  1N9W A;  4FVM A;  2NYZ D;  3K80 C;  4UAI A;  3Q8D A;  1B70 B;  2DNE A;  2VB2 X;  1PHJ A;  3NXW A;  4YCW A;  4C2M H;  2CKZ B;  2NZH A;  1ILQ A;  2XWB B;  1S40 A;  1EYG A;  3A0J A;  2C9O A;  4ODG A;  2NZO A;  5G3L F;  3M9B A;  4XT3 B;  4IFD H;  2KEC A;  3MEF A;  3ZJY C;  2Z6K C;  4IUN A;  1CA6 A;  4DR1 Q;  3C3L A;  4CKE A;  5IWA Q;  3GTJ H;  4GNX C;  1CTM A;  4LF9 L;  4DFA A;  3BDL A;  3GV3 A;  2E5L Q;  1TS5 A;  2UXC L;  1OTC A;  2K5D A;  4PMB A;  1FNU A;  2VUM H;  1K8G A;  3MXN B;  2JK8 A;  3GO5 A;  1DXM A;  3UE1 A;  1UEA B;  3NHH A;  1V43 A;  4X64 L;  2PW7 A;  2F0M A;  3H6M A;  4G57 A;  4RAU C;  3VR5 A;  4QUC A;  2A6E C;  5BR8 L;  4DV1 L;  4KLK A;  4B3S Q;  2Z6B A;  3KF8 A;  4DR7 Q;  1X3Q A;  1N34 L;  1SNO A;  1RL2 A;  4LFB L;  3U50 C;  3P7J A;  4MIU A;  5CV8 A;  1MJE A;  1N33 Q;  2K52 A;  4K5X A;  1JWS D;  4A75 A;  1R4Q B;  2HQL A;  2OQ0 A;  3GD7 A;  2DY7 A;  5M3M H;  2JA8 H;  1S5B D;  1E2Z A;  4LUV A;  5NUC A;  1HXY D;  1I4X A;  1O7Z A;  1ZEQ X;  1B1Z A;  1CQF A;  1F9P A;  2D9U A;  1GXD C;  2HDL A;  1NY4 A;  4IUR A;  4ULL A;  3HKZ E;  4YWL A;  4X6A H;  3MC0 B;  5LMN Q;  5C5M A;  2GN5 A;  3FPU B;  3OW2 A;  3M4O B;  2P5Z X;  3GTO H;  4QGU A;  2A6H C;  1JJC B;  4R9W A;  4LF8 L;  2E5L L;  1LTT D;  2K32 A;  1J9O A;  4GS3 A;  1CHP D;  2KHJ A;  1MD2 D;  2XRS D;  3RN5 A;  3GTQ B;  4BXX G;  4MHE A;  2YTV A;  3GTK H;  2OCE A;  1GUT A;  4ZAI A;  1LLR D;  4BY7 G;  3OWE B;  1LM0 A;  4EVO A;  4ILW A;  5JPM C;  1CUK A;  1YNN D;  3ULP A;  2EYO A;  1PDQ A;  3A8K E;  3HG9 A;  4A3F B;  2F0P A;  2HUG A;  4LF7 L;  3V2T A;  2M00 A;  5KYL A;  1QUQ A;  5IT9 E;  3S1N H;  1TWF H;  4IPH A;  4LWC A;  3PO3 B;  1EUJ A;  5FJ8 G;  4R4I A;  4MTK A;  1FNV A;  3TEH B;  2XSC A;  4QL5 A;  1L0Y B;  4A3G H;  4WFN 3;  4BA2 I;  5IP7 G;  4CJ0 B;  2R7D A;  1GJX A;  1W2B A;  3S2D H;  4BY7 B;  1IW7 C;  1K3R A;  4QIW B;  2B2T A;  2E76 C;  2IHF A;  1SXT A;  2N78 A;  2BDO A;  1PRT B;  3SK4 A;  5I6W A;  1X3G A;  5IT9 L;  5EKL A;  1K73 C;  2WAQ E;  2J0T D;  2Z9H A;  3DLL A;  2A5H A;  2F0I A;  1V1P A;  2EIF A;  5DEH A;  2NN6 H;  2F0J A;  2I46 A;  1QVG A;  2KOL A;  1IHZ A;  2UXB L;  2EPB A;  1JB7 A;  2OEO A;  1VQI A;  3DWP A;  1AEX A;  4YHH L;  4PNY A;  3PIP 3;  4HID A;  3S2H H;  4L8J A;  4OIJ A;  1CKM A;  2BA1 A;  1TWC H;  3KYH C;  4FF3 A;  2KA7 A;  1BKB A;  1GVP A;  4LF5 Q;  3ND9 A;  1D1K A;  3OMG A;  4H13 C;  3I4N H;  5C3E H;  4XDX A;  2K04 A;  1FNW A;  3BJU A;  5ELE A;  1XXG A;  3GTM H;  1GD7 A;  1EQV A;  1PXU A;  4C2M B;  4ID6 A;  3KBG A;  3G48 A;  2X69 A;  4X3S A;  1SFO H;  4P2C B;  4M1U B;  5JPN C;  2UUC L;  5KGU A;  2QIL A;  1DOL A;  4JI5 L;  1VQ6 A;  4IOC A;  1XYI A;  3CCE A;  3T13 A;  2PI2 A;  1RTO A;  1NSN S;  1TY2 A;  2M2L A;  1FL0 A;  2NWG A;  4EQN A;  3H94 A;  1I50 H;  2RCF A;  5EKI A;  1BNZ A;  1CA5 A;  4DV4 Q;  2F0W A;  2F3V A;  3H91 A;  1VQ8 A;  1JR0 D;  2MO1 A;  2ASB A;  1ESF A;  1PH6 A;  3D4R A;  1GUO A;  5M3F B;  3TP7 A;  2JEA I;  1D8L A;  2R7Z B;  3HP3 A;  1LAC A;  3WWV A;  5JJK A;  4GLA C;  5I2Y A;  2G9H D;  2XTI A;  1GHK A;  1LTG D;  4A3C G;  2K75 A;  4JK1 C;  1SBB B;  1NAP A;  4CGY B;  4KKU A;  1XTD A;  4CDC C;  4CHT B;  3E0E A;  3GTQ H;  4RHR A;  4HCS A;  5A2Q L;  1YHQ A;  3K59 A;  4KY5 A;  2F0H A;  3MAQ A;  2AQ1 B;  4B3T L;  5C44 H;  2E75 C;  1SJE D;  2BE5 D;  1LTB D;  2SOB A;  4JI2 Q;  2CWP A;  2IL8 A;  2RDH A;  1UWV A;  2YU9 H;  1EIG A;  5L37 A;  3PO2 G;  4OO1 I;  1TWF B;  5K36 G;  2Q2U A;  4F8M A;  5C4X G;  1YBY A;  4QY7 A;  2VB3 X;  1PH1 A;  1IYU A;  3J81 j;  1K8M A;  4KKS A;  3SK5 A;  1TXY A;  1I6H H;  2WAQ B;  2ZJQ A;  2UUA L;  3CCR A;  5IYC H;  3HOU H;  2JA5 B;  2NTT A;  3NP8 A;  3ZYY X;  2Z8L A;  4P71 A;  4LF6 Q;  2QGQ A;  4J1M A;  2KEN A;  5CYU A;  4YY3 L;  3QJY A;  4LAA A;  1L1O A;  4HMJ A;  2UXD L;  1VQC A;  5IE8 A;  3SK8 A;  4M8A A;  3BVM A;  2VL6 A;  4HJ9 A;  5A2Q E;  1CI3 M;  5K5P A;  2Q8R E;  3K5L A;  1Y8O B;  1O80 A;  4RWS C;  4X62 Q;  3S14 H;  2MUY A;  3I4M H;  1SMX A;  1FD7 D;  2RKS A;  3TZU A;  2Z4H A;  4CBV A;  3VR2 A;  4CKC A;  2F0D A;  3WOF A;  2EZV A;  4Y7N H;  2YV5 A;  3STB D;  1KTK A;  1HNX L;  1I3Q H;  4K2L A;  1EY5 A;  1NMF A;  1QB5 D;  3RUZ A;  2PQA A;  3HOV H;  4LW1 A;  4BBS G;  4KJO A;  3BG3 A;  5IP9 H;  2D5D A;  2ZJR A;  4JI4 Q;  2F0O A;  2X6G A;  2B8F A;  1U5K A;  4C3I H;  2ZTD A;  4A3K G;  2ICE C;  4FP5 D;  3L3O C;  1EOV A;  4XYQ A;  3K6O A;  1O7I A;  2VXW A;  1ENF A;  3T1H Q;  2EYM A;  1STG A;  1SE4 A;  2NTS A;  1EEF D;  1STN A;  1HUM A;  4DV5 L;  2I5L X;  1YNN C;  2D62 A;  3X3N A;  1PH7 A;  2CQO A;  3Q23 A;  3BVG A;  1HPC A;  2GVA A;  1E1T A;  4ZQ3 A;  5C4Z A;  1N32 L;  3K7A B;  1EQT A;  3AEV A;  2EYJ A;  4FXK C;  2M9V A;  1B44 D;  1Y1V B;  1B3Q A;  4G7H C;  4DR6 L;  4IUT A;  2LS0 1;  3HOZ H;  4CJ1 B;  3FPP A;  2I07 B;  4A3I B;  5FJ8 H;  2JYO A;  1HJP A;  1B7Y B;  4OIK A;  1HNW Q;  1LTR D;  1IBM L;  1RHP A;  2UUB Q;  4GKJ L;  2F0V A;  3E9I A;  2XIW A;  1MSG A;  3KUP A;  4IUQ A;  3HOW B;  2Z4I A;  1UE7 A;  3PSI A;  3BU2 A;  4JI2 L;  4O42 A;  3KBX A;  3L7Z C;  4WJ3 M;  1EWC A;  1RD9 D;  4ZRZ A;  4DV1 Q;  5M3M G;  4RGO S;  4B3S L;  2JA8 G;  3VA5 A;  2UU9 L;  2RDG A;  1TKW B;  3NTI A;  1G91 A;  3PO3 H;  4OEM B;  1TT2 A;  3H3V C;  3FVQ A;  3K0X A;  5IGC A;  2K28 A;  2BDN A;  4LK1 C;  3GTG B;  3V05 A;  4BXX H;  3RZO B;  2FXQ A;  1QVC A;  1IXR A;  2HIV A;  1SAP A;  1VQD A;  3SDZ A;  1HCZ A;  1WJJ A;  5J1Z A;  1C9O A;  3J7A F;  2NZ1 D;  1CSP A;  2A74 C;  3NSW A;  1Y1W G;  2K1B A;  4DUY Q;  1E1O A;  1QUQ B;  1UNS A;  1I6H B;  4A3K B;  1SE2 A;  4X66 Q;  1HQM C;  1BBX C;  4X3U A;  3FKI G;  3TP8 A;  4LF4 L;  5DM7 3;  2F4V L;  4IPC A;  1A62 A;  2E74 C;  4TRD A;  4RGT A;  4X3T A;  4WRD A;  2PZU A;  3D6W A;  4A3K H;  1IKL A;  4C56 C;  4KN7 C;  4OXP A;  2PZW A;  4ZK9 B;  2RSN A;  3HOX B;  2B39 A;  5EPJ A;  3T56 B;  4RGN A;  3E3X A;  5ELC A;  4JI5 Q;  1Q1B A;  3MTS A;  1W3S A;  1EU4 A;  1AZQ A;  3QR8 A;  4F87 A;  3FMC A;  3VYS A;  3CME A;  3RD4 A;  4FYD A;  1SRO A;  3ITP A;  4IUV A;  1SLJ A;  3HKZ B;  1KD1 C;  4JI4 L;  2VUM B;  1SEB D;  3S14 B;  4OWX B;  1SR3 A;  4C3H B;  1P16 A;  3J80 c;  4NKL A;  1R4P B;  4IN3 A;  3H3V I;  3MA2 B;  2HD3 A;  2JP1 A;  4XYO A;  2JA7 H;  4V0B A;  1XPU A;  3A54 A;  2Y0S E;  4A3D H;  4ZYS A;  4B3R Q;  1QCB D;  1K0R A;  2L11 A;  4DGZ A;  4YWM A;  1YJ9 A;  3R93 A;  2D0O A;  3W2D A;  4P75 A;  2DGY A;  2VZA A;  4N8F A;  2I5H A;  1XMO Q;  1M8A A;  3I73 A;  1PYW D;  1IYV A;  1PH9 A;  1BCP C;  5CV5 A;  2BE5 C;  1BR9 A;  3TS2 A;  3MFY A;  1DOK A;  2NN6 G;  4B3T Q;  5KND A;  3ERO A;  2BCO A;  3OIQ A;  5AJ3 L;  4XTC S;  2XWJ B;  3SHL A;  3VR3 A;  5M3M B;  1TWA B;  2JA8 B;  4KI0 A;  3PV0 A;  4KJN A;  3BDC A;  4A3J G;  1TR5 A;  3OSO A;  4X65 L;  1Y1W H;  5C4J H;  3NQT A;  4YCV A;  1PFB A;  4O2D A;  2RBM A;  5IP7 H;  1PTO F;  4ZUI A;  4FF1 A;  1VQH A;  4B3R L;  5HY6 A;  1X3F A;  1PRT F;  2MO0 A;  2Z1C A;  3JC6 6;  3LWU A;  1H9K A;  3S16 B;  1SRU A;  5M3F G;  2IT1 A;  1Q1E A;  4A3F H;  1RCV D;  4WJW A;  3M3Y H;  4A3C H;  2PI2 E;  3DM1 A;  4GN4 B;  3K81 C;  1T9H A;  4AYB G;  2PYK A;  1LT3 D;  1BBU A;  4F88 A;  2XNA C;  3GP7 A;  1R9T H;  1HRJ A;  3BZC A;  1MSH A;  5I4D A;  3K5N A;  5C0X I;  5DNF A;  4JBW A;  1S5F D;  3U58 A;  1DZ1 A;  2EXZ A;  2N88 A;  2C35 B;  3OTO L;  1XX8 A;  2SNM A;  3T1Y L;  2AUJ D;  3F2U A;  5IGE A;  2VS1 A;  4V19 0;  4DAM A;  4WJ4 A;  5E3F A;  1PVO A;  2K6A A;  3I72 A;  3PF4 A;  1PH3 A;  4HJA A;  4UY8 C;  2Q8I B;  3G71 A;  2K7V A;  3HOY H;  2EOT A;  3HOV B;  3CPW A;  1VQJ A;  3CQZ B;  1SSO A;  4UP9 A;  3CPF A;  5I9O A;  1L1O B;  4GKK Q;  3CRL C;  3QG1 A;  4OO1 H;  3H3V H;  1HFG A;  1CQV A;  1TWG H;  2HDM A;  4JW0 A;  1J6Q A;  3W1B A;  3RMH A;  3TN2 A;  1G2S A;  3C1E A;  5C3E G;  4QUF A;  3KLW A;  3GTL H;  1A2T A;  4LF9 Q;  4DPG A;  5HGQ A;  4R8I A;  2B29 A;  1NE3 A;  3S15 B;  4TQU S;  3CMA A;  3P1H A;  1KAA A;  1NMG A;  2PCF B;  4EGV A;  5CBE E;  2L9H A;  3EQL C;  1C8C A;  1KAB A;  4GZY C;  3GDE A;  4LF6 L;  4RKB A;  3KOJ A;  3HKS A;  5C0X J;  3ERS X;  1E24 A;  4DR4 Q;  5ELO A;  1NCV A;  5BR8 Q;  4KN4 C;  1FR3 A;  1PRT D;  2QCP X;  4F7X A;  2NBF A;  1U0L A;  3R8B A;  4NXN L;  3KF8 B;  1C7Y A;  3TDQ A;  2F1M A;  4X62 L;  2NVX B;  5M3F H;  1YIJ A;  1WFQ A;  1MJC A;  1EY4 A;  1L1O C;  3OHX C;  4HED A;  5IOC A;  2L1B A;  1UAP A;  5FLX L;  3HOW H;  3M4P A;  2UU9 Q;  1CSQ A;  1XNR Q;  1I94 L;  1YJN A;  3K7U C;  4LUO A;  3I4O A;  1I4Q A;  1JJG A;  4LF8 Q;  5DLQ E;  4IAL A;  2CWA A;  2QKI C;  1ROD A;  2K03 A;  3FHW A;  4DV2 L;  2CW0 C;  5GAD C;  4BWG B;  2IX0 A;  4DUY L;  2A1A A;  5GAE C;  4U68 A;  1WCM H;  3O13 A;  3A55 A;  4OX9 Q;  4JI8 L;  1WCM B;  4C3J B;  5I9P A;  3KJO A;  4QF4 A;  4GOP C;  5G3L D;  3K5M A;  4XQJ A;  4EX5 A;  2H1E A;  4OL7 A;  4A3L G;  1G2T A;  2VQF L;  1X54 A;  4LF7 Q;  2F0G A;  5EBC A;  1C48 A;  4DR1 L;  4AIM A;  1SE3 A;  1XJV A;  3I55 A;  4HMI A;  4A93 G;  1Q86 C;  1H9S B;  4QIW E;  1KDB A;  4A3D G;  2BH8 A;  2PZT A;  2Y0S G;  2NVT B;  1TII D;  4DV3 L;  3A7L A;  2ICI A;  3OTO Q;  3T1Y Q;  3PUY A;  3G4S A;  5LMU L;  2OQK A;  3M3Y B;  2WV6 D;  3VA7 A;  2YTX A;  1RKN A;  1D5M C;  1XMQ Q;  2F0T A;  3VYR A;  3B6Y A;  3R2T A;  2XGT A;  3D8G A;  1VQ7 A;  4LFB Q;  1EIH A;  3MXN A;  1IBM Q;  3IFD A;  2NVT H;  3EN2 A;  1VQO A;  4EQO A;  1EYA A;  3W5O A;  1VQL A;  4OX9 L;  2E2J B;  1HR0 Q;  1NUC A;  4LFA L;  1PV4 A;  5D3I B;  2BA0 A;  4JI1 Q;  1B3A A;  5C0X G;  1NR4 A;  3J81 E;  2RSO A;  3PCO B;  1PA6 A;  3ERQ A;  1MKH A;  2F0F A;  3QIA A;  1LTI D;  1WYD A;  1IBK Q;  1XNQ Q;  1FYC A;  4K6L A;  4A3M G;  5KYI A;  2KCC A;  1ESR A;  2O2L D;  4IUU A;  1UE5 A;  4C3I B;  2N8N A;  1HTL D;  3CKI B;  2EDG A;  3CCJ A;  4DNI A;  2Q8T A;  4I7A A;  3HS0 C;  1U4P A;  2EJF C;  2JA9 A;  4X3K A;  4KKT A;  1FGU A;  2MP1 A;  4TKO B;  2DN8 A;  2ZM6 Q;  1I50 B;  4DAP A;  4R4Q A;  1WTV A;  5AJ3 Q;  3W3A A;  1U4R A;  3NBI A;  1CKN B;  2OTJ A;  1D1I A;  3A56 A;  5IGB A;  2HQE A;  5CMD A;  1KAW A;  3A8I E;  4X65 Q;  2JSO A;  1PFM A;  5FLM H;  4DKA C;  2K5N A;  1X32 A;  5CV7 A;  5C3X A;  3M4O H;  3IL8 A;  2B2U C;  3PO3 G;  4K5W A;  2HCI A;  1TVX A;  1WCM G;  2KCT A;  1QIL A;  5GAH C;  4H02 A;  2VQE Q;  4DV6 Q;  1I94 Q;  1MGS A;  2NVX H;  2R92 B;  4A3E G;  4RG1 A;  2LXJ A;  3GTK B;  1ZYR D;  2QA4 A;  1B50 A;  3S17 B;  4J15 A;  4POG A;  1EIY B;  3HOU G;  5IYC G;  4DAY A;  2L0C A;  2ZM6 L;  4JI0 L;  4HSP A;  3H15 A;  1HNZ Q;  1LTA D;  5LHY 1;  3BS1 A;  3AFQ A;  3L9A X;  3F1Z A;  1EIF A;  1VQ9 A;  1FJG Q;  1SYC A;  3NQI A;  1H95 A;  2VQF Q;  4YIJ A;  1Z9F A;  4BY1 B;  1VDZ A;  2FMM A;  3A5Z B;  1EZ6 A;  1Z7T A;  2AWO A;  4IPG A;  3RN2 A;  1D5X C;  1V9P A;  1DCZ A;  4BY7 H;  1U4L A;  3S2D B;  1Z6H A;  1YVC A;  1JOO A;  2B8G A;  4DXG A;  5M5Y H;  1MBY A;  4AQY L;  1CFM A;  4JYA Q;  4UHV A;  4NP5 A;  2B63 G;  2F3W A;  1KIX A;  4GKK L;  3X3M A;  1N36 Q;  1LTS D;  3VR4 A;  4MNO A;  1SND A;  3PIO 3;  1YEZ A;  3HKZ G;  3I90 A;  1ET6 A;  4JI1 L;  1K0S A;  1FJG L;  1S72 A;  2A6E D;  5C3E B;  1B53 A;  1KNE A;  1S3O A;  2KEE A;  4QMG A;  1STA A;  4S3S A;  2K5H A;  3TZD A;  1X3E A;  1LT5 D;  1ET9 A;  5J39 A;  3JAM c;  1I5F A;  4DF7 A;  3KDF A;  2N49 A;  3FP9 A;  3G6J B;  3J80 i;  5AFW A;  5JVH 3;  5JEA J;  1QNK A;  1PRT C;  4KHP Q;  5JEA H;  3HOY B;  5D14 A;  2F0U A;  4J6H A;  1DJR D;  4GOP A;  2HCC A;  3TME A;  4JCV E;  2G5D A;  2F03 A;  1I4P A;  1G6Z A;  1JIC A;  2WKD A;  3FEW X;  3TP6 A;  4ZKB B;  2AHO B;  2VUM G;  1HNX Q;  1QVF A;  4GN3 B;  4UDU C;  5JAV A;  4NXN Q;  3M7N A;  1SYE A;  4UP8 A;  1QJO A;  3M7G A;  3DMU A;  1N36 L;  3OWF A;  5IWA L;  1A6X A;  2EY2 A;  2ZT9 C;  2OTL A;  1MHW C;  2JA6 H;  4PMW A;  3T53 B;  1OXS C;  1GUS A;  3I7F A;  5CV9 A;  3P75 A;  2IHE A;  4A93 H;  1XNR L;  4BBR G;  1PYS B;  5CV6 A;  1UE6 A;  4KTA A;  4KD3 A;  4POF A;  1JJ2 A;  1D5Z C;  5EQ0 A;  1IBL L;  2JA7 B;  3AU7 A;  4XXE A;  2GVB A;  3MVV A;  3S1R B;  5EAY A;  2VNU D;  4IJH A;  2FJ2 A;  1IL8 A;  1E7Z A;  1S4Z A;  4KHP L;  5C44 G;  3DHQ A;  1ONL A;  3UE0 A;  1ZXT A;  3F2B A;  2A8V A;  4K14 A;  1N32 Q;  3BVZ A;  3NEL A;  4P74 A;  3KLR A;  2Z6K A;  2PO4 A;  3D3R A;  3S17 H;  4GLV B;  3KLS X;  1JE5 A;  4H0L C;  5DAU A;  1S5E D;  3I8Z A;  4LJZ C;  3KF6 A;  2D0P A;  4ME3 A;  4A3I G;  1LUZ A;  5LMN W;  2B63 H;  4B9X A;  1W6J A;  3NEN A;  3CCU A;  2L5T A;  3CU7 A;  3EIV A;  1Q7Y C;  1KRT A;  4CDE C;  3DEP A;  2R92 H;  4DXF A;  2NVY B;  3NTK A;  3NBH A;  3N52 A;  3V96 A;  4OON A;  1YHB A;  1JCK B;  3J7A 5;  5BN3 A;  3K57 A;  4DR2 L;  2E2I B;  4C3J G;  1HZ9 A;  1PYB A;  4H44 C;  5ELN A;  4BBR B;  3NEM A;  2UUC Q;  1S5D D;  2IX3 A;  2VW9 A;  3DEO A;  3M4Y A;  2K33 A;  2J7Z A;  4JV5 Q;  4IPD A;  2PPB C;  1HZC A;  2B2V C;  2MJ8 A;  4JPB W;  2MNA A;  5FLM G;  1LTL A;  1EU3 A;  2CCZ A;  3AYH B;  1EL0 A;  5LL6 S;  1B8A A;  1QZG A;  3GQB A;  4PZ8 A;  2KCN A;  5IGF A;  1FVI A;  1VCI A;  3CCV A;  2ALY B;  3L0O A;  1KDA A;  2R93 G;  1TS2 A;  1Q8K A;  3J7Z C;  3AMU A;  2RCN A;  1QWY A;  5CR3 A;  3Q24 A;  1X65 A;  3HEJ A;  1IYJ B;  2B3G A;  4P72 A;  3UDF A;  4DK6 C;  1KHI A;  2E2D C;  1PFS A;  2JA6 B;  1HA6 A;  1A2U A;  4Q0F A;  3HOX H;  1HZA A;  1VQE A;  4DR3 Q;  3OPO A;  2RHQ B;  1Y8N B;  2TMP A;  1DYQ A;  4MZ9 A;  3IKJ A;  2AQ2 B;  5FO9 B;  1XTC D;  3ULJ A;  2HHH L;  2Q2H A;  2CQA A;  3VYU A;  1CK1 A;  3QOL A;  5FLX E;  4Y7N B;  1HNW L;  4RMF A;  1C0A A;  1WOC A;  4GKJ Q;  1VF5 C;  1I6V C;  3F8T A;  2B2T C;  1EQQ A;  1VMC A;  4B3M L;  4IFD G;  1HA5 A;  4HTH A;  4A3G G;  3BZD B;  3RNU A;  2CH4 A;  3LGJ A;  1L0X B;  1BF4 A;  1JT8 A;  3J80 L;  4DAV A;  1B9N A;  5C4X H;  4A3I H;  4XIG S;  1HNZ L;  4LFA Q;  2KHI A;  1V1Q A;  2YYZ A;  2K5Q A;  3RLN A;  2JJQ A;  3OOC A;  4BA1 I;  4ZLT F;  4K6D A;  4JI3 L;  3TRE A;  4GNX A;  2R93 H;  3MFG A;  2GA4 B;  2JA5 G;  4Z9C B;  2HT1 A;  1RF2 D;  1AP0 A;  3M85 A;  1YNX A;  3E9H A;  2CVR A;  1CHQ D;  1M1K C;  2NN6 I;  1U4M A;  3BDO A;  4APV A;  3BZK A;  1PLF A;  3D4W A;  3ND8 A;  4YWK A;  3CAM A;  1KNA A;  1JOR A;  4QQB X;  3PO2 B;  3VR6 A;  2WP8 J;  3HOZ B;  1E2V A;  3MXU A;  4CJ2 C;  2JQO A;  4DUZ L;  3MXP A;  5C44 B;  3HRZ C;  2EJG C;  3ICE A;  4DR7 L;  5KEE A;  5KNB A;  2H5X A;  1PTO H;  2N3S A;  3HZX A;  4A4I A;  3S24 A;  3A5U A;  3CD6 A;  1QG7 A;  3EA6 A;  3WOE A;  1STE A;  2WFW A;  4O0A A;  1IZ6 A;  3I70 A;  5EBD A;  2UXB Q;  5GQO A;  1VMP A;  4RKL A;  2A19 A;  1A3T A;  3MWY W;  1BXT A;  1X9N A;  3PUZ A;  1KLU D;  1CM9 A;  4N9T A;  5JJL A;  4HJ7 A;  2ES2 A;  4FF4 A;  3S1Q H;  2AMC B;  4NB3 A;  3S2H B;  3QOJ A;  5M9O A;  1HR0 W;  2X6L A;  5IP9 G;  1EFI D;  4K5V A;  5CV4 A;  5KRU A;  5EPK A;  1TWG B;  4R4O A;  1EY0 A;  4DNT B;  4A3M B;  1SYB A;  2SDF A;  5FO8 B;  3OMC A;  1KDC A;  1YNJ C;  1HQR D;  1WTX A;  4JI0 Q;  1D2B A;  1CZW A;  2IY5 B;  1HUN A;  1WD1 A;  2K4K A;  5FLX c;  2MGS A;  1L2F A;  3I4N G;  4HN7 A;  4C1N I;  1UE1 A;  1VF7 A;  2F0N A;  1ASY A;  4I7Z C;  3T16 A;  1BOS A;  1OO9 B;  2O5I C;  2IPK D;  5I2X A;  4CKB A;  4G4K A;  1X56 A;  4RHS A;  1SN8 A;  3SEB A;  4OO1 G;  1NNX A;  2BH2 A;  1LO5 D;  4EQP A;  1ML0 D;  3Q0A A;  4LNQ A;  2WKC A;  2PQA B;  4DV4 L;  3F2D A;  2ZXP A;  5D65 A;  4KD4 A;  1NBW A;  1A3V A;  2RQX A;  3LWE A;  4FXD A;  5BN4 A;  3SK6 A;  5H1S E;  1JB3 A;  2MPM A;  4A93 B;  2L4N A;  3EFX D;  5ELB A;  5GRO A;  4QJF A;  2J4X A;  3C46 A;  4JI6 L;  2RVL A;  3TP5 A;  4NDX A;  3CC4 A;  5JOB A;  2K05 A;  4B08 A;  1SYG A;  1JC7 A;  5EPL A;  3J7Y W;  2E8G A;  4JBJ A;  1Y1V H;  4DR4 L;  4DK1 A;  2NUC A;  2R93 B;  5C4X B;  1U9R A;  3K7A H;  2F0L A;  2KQ3 A;  4UPA A;  3PQI A;  4N9P A;  1TS4 A;  1AW7 A;  3R2I A;  3GV6 A;  3MEH A;  4NMZ A;  1H9R A;  1JOQ A;  1CZG A;  2L55 A;  1GUN A;  3OW7 A;  2RA4 A;  3H0G G;  4CDD C;  1N33 L;  5CBA E;  4DUZ Q;  1X3P A;  1V1P B;  3T51 B;  1PTO B;  5T1I A;  2EYH A;  1PTO C;  1J5E L;  1I4H A;  2L15 A;  4JI6 Q;  2KED A;  1XPR A;  2R7F A;  2A69 C;  2ZXR A;  3S16 H;  5IGG A;  4FF2 A;  4KMU C;  2AUK A;  3PIP A;  3CCQ A;  5JJZ A;  3CW2 C;  4A3J H;  5LMN L;  2DNC A;  3I56 A;  4RA8 A;  4JI8 Q;  1EQR A;  3S1M B;  1QNU A;  1ILP A;  4DA2 A;  3IAY A;  2IWH A;  1BVS A;  3RR5 A;  5FO7 B;  1G51 A;  4FXG C;  5J22 A;  1EY6 A;  3SVM A;  1TS3 A;  4RGM A;  5C5L A;  2QF7 A;  4ABN A;  1Q81 C;  4DR5 Q;  1R9T B;  1AE3 A;  1SYD A;  1KRS A;  1TWC B;  4Y52 H;  4IFD J;  1K9M C;  5M5W B;  4IO9 A;  1J8I A;  3PF5 A;  4HIO A;  3PMF A;  5LL6 X;  1Y1V G;  1J5E Q;  2QEJ C;  5ELD A;  4A3E H;  2LSS A;  5J3B A;  2JA7 G;  1UUP A;  1YZ6 A;  1WTO A;  2K5V A;  4KK7 A;  4IOA A;  1DM0 B;  1EY7 A;  3P20 A;  4XT1 B;  1EZ8 A;  3CCS A;  2A68 D;  1K83 B;  2F3I A;  1KQS A;  1YIT A;  5FKA C;  2TSS A;  3NE5 B;  2OXP A;  4I65 A;  2WII B;  3MZ5 A;  4DV5 Q;  4L63 B;  3GTM B;  1SMY C;  2PMZ E;  2PQE A;  3CF5 A;  2E2H B;  1O7L A;  3RZD H;  4HAE A;  1TU2 B;  3FRP B;  4HSV A;  4BBS B;  1X55 A;  1LAB A;  3A74 A;  3IRB A;  4EQ5 A;  5DM6 3;  4A3D B;  4JI3 Q;  3OIP A;  2WIN B;  2Q2T A;  1D6E C;  2YTY A;  4JBM A;  3FKI H;  2KUM A;  2BOS A;  3RZD B;  2B2V A;  3STB C;  2PNH A;  4LF5 L;  2ZXO A;  1E2W A;  1F2Z A;  3CCM A;  2OT2 A;  3CXC A;  2UUB L;  1PZI D;  4PV1 C;  1YJW A;  1G6P A;  2EYP A;  2I5M X;  5CC4 A;  2Z0S A;  1B9M A;  1BUV T;  3NWS A;  4FNF A;  1T5X D;  4L5S A;  2EYF A;  1W6K A;  4RH6 A;  4G7Z C;  2O4X A;  2PNR C;  1BCP B;  1GUG A;  2Y0S B;  2B63 B;  2F0E A;  1GKH A;  5IYB G;  4HIK A;  3TQY A;  4GOP B;  3S1M H;  4KHZ A;  1XMQ L;  4ME5 A;  1MI2 A;  3RZO H;  4BY1 H;  2HIX A;  2I0Q A;  4WOR A;  4BBR H;  4DN4 M;  1ASZ A;  3RLF A;  5IYD G;  5I6Y A;  1K8A C;  4X66 L;  4LFC Q;  4DK3 C;  3FDT A;  1F9Q A;  4BY1 G;  1OXV A;  3CP0 A;  4K2K A;  4HCE A;  1C4Q A;  4GLX A;  1WD0 A;  1YNJ D;  1WTQ A;  4A3L H;  3JAM i;  3T1H L;  4IZ8 A;  4ZUJ A;  1Y14 B;  4R4C A;  1XWE A;  2B2U A;  4KY6 A;  3ULL A;  4DR5 L;  4JI7 Q;  3E0J A;  3VDY A;  5E7N A;  2KVM A;  2JA5 H;  3HOU B;  1WVL A;  3GTG H;  5IY0 A;  1E0B A;  4K8J A;  1STH A;  5EKK A;  2WAC A;  1YI2 A;  4C3H G;  1JWU D;  5TSS A;  4YHH Q;  4DR6 Q;  4AQY Q;  2SEB D;  4E6I A;  1JOK A;  5M5W H;  2EVB A;  3K8A A;  4A3B H;  5FOB B;  4A76 A;  4KHV A;  1NR2 A;  3HFZ B;  4BS9 A;  2JA6 G;  1G8Z D;  1I3Q B;  3UDI A;  2R7Z G;  2EQS A;  3J80 E;  4JOI C;  2DJG C;  1AFP A;  2K01 A;  1XPO A;  1K83 H;  4OHJ A;  4LFC L;  4KY7 A;  3I4N B;  2EJM A;  3PUV A;  5HUR A;  2AKW B;  3QB3 A;  4QB4 A;  4PMC A;  5IOD A;  3U9S A;  5JEA G;  2A73 B;  2ATW A;  1WTW A;  2ZTC A;  3DM3 A;  5E4X A;  4KV6 A;  1GHJ A;  3NPP A;  4DV2 Q;  1LV9 A;  3PUW A;  1SFO B;  4JVZ A;  2V4D A;  3CCL A;  3GTP B;  4TSS A;  1G29 1;  2B2W C;  4OWT B;  2UXD Q;  4L5Q A;  1PFN A;  1XMO L;  4NXM L;  1H9M A;  2WB1 E;  2NVQ B;  3MHB A;  4C3I G;  5T1G A;  3R3O A;  4NW2 A;  3CC7 A;  2F4I A;  1VQF A;  4LMQ D;  3DXJ C;  3HOV G;  1A0I A;  3U9O A;  1EYC A;  1QOH A;  1PTO D;  3F2C A;  1PH5 A;  1HH2 P;  3J81 L;  2R7Z H;  2A69 D;  5C4H A;  5HGT A;  2N55 A;  4A3B G;  1MIU A;  4DV7 L;  1EY9 A;  2EYL A;  2ID0 A;  2F0K A;  1VQ4 A;  1SJH D;  1PH8 A;  2VY3 A;  1Z47 A;  4L6T B;  3EBE A;  3Q6S A;  2KCM A;  5KNC A;  3U4Z A;  3PO2 H;  4JYA L;  1SDF A;  3N6R A;  4NXM Q;  1KL9 A;  2ENB A;  1S5C D;  2QW7 A;  5COY A;  3PUX A;  1DGS A;  1PZK D;  4DK0 A;  1OXT A;  1STB A;  3I4L A;  1OXX K;  2FMC A;  4L5T A;  4CDF C;  1WI5 A;  1IBK L;  2QDL A;  3MXG A;  1X6O A;  1BCP D;  1BQQ T;  1GOZ A;  1JE4 A;  5IGD A;  2PW5 A;  2NVY H;  2PMZ B;  1WTR A;  1N8R C;  2UUA Q;  1A63 A;  5JVG 3;  2UXC Q;  2QDB A;  5A35 A;  3S9W A;  3JAM L;  4JI7 L;  1A15 A;  4A3F G;  3UI2 A;  3QO2 A;  3G7L A;  4OEL B;  5M5Y B;  1VQA A;  4K8I A;  2R61 A;  5E4W C;  5IT9 c;  1AN8 A;  1TWH B;  3H0G B;  5COR A;  3HGB A;  3CC2 A;  3NUC A;  5FK9 C;  2JEB I;  2A68 C;  3LNN A;  2JN4 A;  2G9D A;  2XRQ D;  4A3M H;  1OXU A;  1H9S A;  3WDN A;  1SYF A;  3JAM E;  1NJI C;  1GO3 E;  1SNP A;  3D6C A;  3S1Q B;  2LFN A;  5C0X H;  1CT1 D;  1SMY D;  3I91 A;  3NBH B;  5ELF A;  1ZKO A;  3UDX A;  5M5X H;  1K3B C;  1RIP A;  2DY8 A;  5ISR A;  3NTH A;  1HHV A;  5EGT A;  4Q5V A;  2FFK B;  4DV6 L;  5LMU Q;  2JXM B;  1RDP D;  2EY1 A;  3BYY B;  1L0W A;  1JQY D;  4DU9 A;  3KF6 B;  1LYL A;  3CQZ H;  4TVA B;  2IW3 A;  3AFP A;  4R8N A;  3HOX G;  5M5X B;  4B9W A;  3M4Q A;  2EY6 A;  1SE8 A;  1GUW A;  3I4M B;  1V8Q A;  4K0K L;  1HR0 L;  2NVQ H;  3DWA A;  2RDF A;  1F2L A;  2ZJP A;  2CHB D;  1PH4 A;  4FO2 A;  2RF4 A;  3TRZ A;  3IFT A;  4AYB E;  4DR3 L;  5CGK A;  1M90 C;  3RLO A;  2RHS B;  1CKN A;  3TS0 A;  1PZJ D;  1VQM A;  1WTH A;  1NTG A;  2K5W A;  1ZYR C;  1XNQ L;  1VQP A;  2D2C C;  4PG3 A;  2EXD A;  4JG2 A;  1RTN A;  1I4R A;  3K5O A;  1WTP A;  3EJI A;  4U67 3;  4DV7 Q;  1HZB A;  4X64 Q;  2OWO A;  3NWT A;  5IYD H;  3QWN A;  3S1R H;  4DR2 Q;  1TWA H;  1DON A;  1VQB A;  2AWN A;  4IFD I;  2MFI A;  1VS0 A;  4H7B A;  4IQZ A;  3URY A;  4GNX B;  1F2Y A;  4HIM A;  4K0K Q;  4OWW B;  3SXH A;  5JJI A;  3HOZ G;  3K58 A;  4RCN A;  3HOW G;  1EY8 A;  3E5S A;  2IX1 A;  1AH9 A;  1EYD A;  1F2M A;  5C4J B;  1AZP A;  2H4O A;  2R92 G;  3J7A V;  3PIO A;  5IYB H;  1SNM A;  3KDF B;  1IKM A;  1B2T A;  1O78 A;  4JOI A;  1VQN A;  2F0Q A;  2NB0 A;  1EFW A;  3OYY A;  4ALP A;  2JE6 I;  4PQX A;  4C3J H;  1LT6 D;  3SGI A;  4AYB B;  4JBK A;  2LMC B;  4C1N K;  3DUZ A;  4DV3 Q;  1BBW A;  2YU9 B;  4UP7 A;  2A6H D;  2KBN A;  3SE0 A;  2LXK A;  2L12 A;  3C2P A;  1D7Q A;  2DJF C;  1DOM A;  4O1N A;  2MHV A;  3VYT A;  4XQQ A;  1TY0 A;  1VQG A;  2XN9 C;  4QCL A;  2B2W A;  2WB1 G;  4A3G B;  1EWI A;  1TWH H;  3H0G H;  3I3C A;  4MTN A;  1F9R A;  4DV0 L;  1Y69 U;  4LF4 Q;  2F4V Q;  2V1C C;  1TQO A;  1QZH A;  1KXL A;  2KHS A;  2K50 A;  1AE2 A;  1T5E A;  2CW0 D;  5F2D A;  1LT4 D;  3H09 A;  4A3J B;  1Q8I A;  4P73 A;  4A3B B;  2HHH Q;  4PZ6 A;  1ENC A;  2CH4 W;  3Q22 A;  4XQN A;  1BDO A;  1BCP F;  2XVS A;  3CRK C;  3UDG A;  3AQQ A;  3J81 c;  3HOY G;  1ICW A;  1A8V A;  3A8J E;  3I4M G;  1DD2 A;  1EEI D;  1QE6 A;  1Q82 C;  1IW7 D;  2EY5 A;  1E22 A;  5EJW A;  2IJ0 A;  1V1O A;  3NK9 A;  3BYT B;  1II3 A;  3GTJ B;  3J81 i;  3D31 A;  3KK7 A;  1SNQ A;  2QEX A;  1I4G A;  2FIN B;  3DWQ A;  1H9J A;  2KJX A;  2EE1 A;  1K8O A;  1B4O A;  5BN5 A;  1A3U A;  1ICF B;  5D3D A;  4ZKC B;  3GTL B;  1JMC A;  4DV0 Q;  1KLG D;  1K28 A;  3A7A B;  2E2H H;  1JWM D;  3S15 H;  4YCU A;  3W1G A;  4DNR B;  3GTP H;  3G6E A;  4C3H H;  3EVQ A;  3CHB D;  3C1F A;  2R3Z A;  1VQK A;  3U4V A;  2R6G A;  5KIX A;  3L2P A;  2Q2I A;  5K36 H;  3I2Z A;  4L5R C;  4GN5 A;  3ONA B;  4NPS A;  1N34 Q;  2OF1 A;  4G7O C;  3TBI B;  4ZCK A;  4BBS H;  2WAQ G;  5E1F A;  1Q12 A;  4N8X 1;  1P8L A;  4JV5 L;  4FDB A;  4IUP A;  3PGZ A;  2ZTE A;  3GTO B;  1RJT A;  2C5C A;  3T4A C;  3D0F A;  4YY3 Q;  3K0Y A;  3FKI B;  2B2Y C;  2F0S A;  4R4T A;  1BO0 A;  2K14 A;  3LX0 A;  3ER0 A;  1Q90 A;  1KC8 C;  4RFB A;  2F52 A; 
#chains in the Genus database with same CATH homology
 1WJJ A;  1X3E A;  3A74 A;  1C9O A;  3IRB A;  4EQ5 A;  3JAM c;  1IBL Q;  1CSP A;  1I5F A;  4JI3 Q;  4AH6 A;  3KDF A;  1Y1W G;  2N49 A;  3FP9 A;  2YTY A;  2Q2T A;  4DAY B;  4DUY Q;  1E1O A;  4JBM A;  3FKI H;  1QUQ B;  4R1J A;  3J80 i;  3STB C;  2PNH A;  4LF5 L;  5JEA J;  4X66 Q;  4KHP Q;  3CCM A;  4GOP A;  2UUB L;  4JCV E;  3CXC A;  1VQ5 A;  1IL2 A;  4PZ7 A;  1YJW A;  1G6P A;  3FKI G;  4LF4 L;  2F4V L;  2CFM A;  2I5M X;  4IPC A;  1A62 A;  2AHO B;  2VUM G;  1HNX Q;  1QVF A;  2Z0S A;  4GN3 B;  4NXN Q;  1Q46 A;  3M7N A;  4UP8 A;  1N36 L;  4L5S A;  5IWA L;  4A3K H;  2OTL A;  4OXP A;  2DUD A;  2JA6 H;  3KFU A;  1GKH A;  4PMW A;  5IYB G;  1OXS C;  4JI5 Q;  1PH2 A;  1Q1B A;  4HIK A;  4LUZ A;  3I7F A;  1W3S A;  3TQY A;  1CKO A;  2IHE A;  4A93 H;  4IJL A;  4HJ5 A;  4GOP B;  1XNR L;  4BBR G;  2E2I H;  4HJ8 A;  1PYS B;  4KHZ A;  3KJP A;  3S1M H;  2E2J H;  3CME A;  1UE6 A;  1XMQ L;  4POF A;  1YHA A;  1SRO A;  1JJ2 A;  4B3M Q;  3RZO H;  1UEB A;  1IBL L;  1SLJ A;  4BY1 H;  1E3P A;  4JC0 A;  1KD1 C;  4JI4 L;  2HIX A;  2I0Q A;  2MQH A;  4BBR H;  2GVB A;  2VQE L;  5GAG C;  4OWX B;  1GM5 A;  1N9W A;  1ASZ A;  1SR3 A;  5EAY A;  3RLF A;  3K80 C;  5IYD G;  4IJH A;  1K8A C;  1E7Z A;  3Q8D A;  1B70 B;  2VNU D;  4X66 L;  1P16 A;  5C44 G;  3J80 c;  1PHJ A;  4LFC Q;  4DK3 C;  4KHP L;  4BY1 G;  4YCW A;  4C2M H;  1OXV A;  3CP0 A;  2CKZ B;  3UE0 A;  3H3V I;  2NZH A;  4GLX A;  2JA7 H;  3F2B A;  2A8V A;  1EYG A;  1S40 A;  1N32 Q;  4A3L H;  3A0J A;  3JAM i;  1XPU A;  3NEL A;  4P74 A;  3T1H L;  2NZO A;  2Z6K A;  2Y0S E;  4A3D H;  3M9B A;  1Y14 B;  4R4C A;  3S17 H;  4B3R Q;  4GLV B;  3MEF A;  3ULL A;  2Z6K C;  3ZJY C;  1JE5 A;  4DR5 L;  1K0R A;  4DR1 Q;  4JI7 Q;  5IWA Q;  3GTJ H;  4GNX C;  5E7N A;  3VDY A;  3KF6 A;  4YWM A;  2D0P A;  4ME3 A;  4A3I G;  1YJ9 A;  2JA5 H;  1LUZ A;  4LF9 L;  2D0O A;  3GTG H;  5IY0 A;  5LMN W;  2B63 H;  4P75 A;  3NEN A;  2DGY A;  3CCU A;  2VZA A;  2I5H A;  2E5L Q;  1XMO Q;  1YI2 A;  2UXC L;  3EIV A;  1Q7Y C;  1OTC A;  1KRT A;  1PH9 A;  2R92 H;  4YHH Q;  2VUM H;  4AQY Q;  4DR6 Q;  1K8G A;  5M5W H;  3TS2 A;  3MXN B;  3K8A A;  4OON A;  2JK8 A;  4A3B H;  2NN6 G;  3GO5 A;  4B3T Q;  3UE1 A;  4A76 A;  3HFZ B;  1YHB A;  2JA6 G;  1V43 A;  3J7A 5;  4X64 L;  5AJ3 L;  4XTC S;  3UDI A;  2EQS A;  2R7Z G;  4DR2 L;  1HZ9 A;  4KI0 A;  4DR7 Q;  5BR8 L;  1PYB A;  4DV1 L;  4KLK A;  3PV0 A;  5ELN A;  4B3S Q;  3NEM A;  4JOI C;  1N34 L;  2UUC Q;  4LFB L;  1RL2 A;  3U50 C;  4A3J G;  1MJE A;  1N33 Q;  2VW9 A;  2K52 A;  4X65 L;  1XPO A;  1K83 H;  4LFC L;  1Y1W H;  5C4J H;  4A75 A;  2HQL A;  3PUV A;  4YCV A;  2OQ0 A;  3GD7 A;  2AKW B;  4O2D A;  5M3M H;  2JA8 H;  5IP7 H;  4IPD A;  4JV5 Q;  4LUV A;  1HZC A;  5JEA G;  2ATW A;  1VQH A;  2ZTC A;  3DM3 A;  5HY6 A;  5FLM G;  1X3F A;  2MNA A;  1LTL A;  4B3R L;  2MO0 A;  2CCZ A;  3AYH B;  1NY4 A;  3JC6 6;  4DV2 Q;  3HKZ E;  3PUW A;  4YWL A;  4X6A H;  1B8A A;  5LMN Q;  1QZG A;  4PZ8 A;  2GN5 A;  1SRU A;  3OW2 A;  3CCL A;  5M3F G;  2IT1 A;  1FVI A;  1VCI A;  3GTO H;  1Q1E A;  4QGU A;  1G29 1;  4OWT B;  4A3F H;  1JJC B;  4LF8 L;  3CCV A;  3M3Y H;  2PI2 E;  4L5Q A;  1XMO L;  2E5L L;  4NXM L;  4A3C H;  2UXD Q;  2ALY B;  3L0O A;  4GN4 B;  4GS3 A;  3K81 C;  2R93 G;  1Q8K A;  2WB1 E;  3J7Z C;  1T9H A;  2KHJ A;  2RCN A;  4AYB G;  3RN5 A;  4BXX G;  2YTV A;  1BBU A;  3GTK H;  1X65 A;  2OCE A;  1R9T H;  3CC7 A;  1IYJ B;  2B3G A;  4P72 A;  3BZC A;  3UDF A;  4BY7 G;  1VQF A;  1LM0 A;  4DK6 C;  1KHI A;  3HOV G;  1PFS A;  1A0I A;  1CUK A;  3ULP A;  5C0X I;  3HOX H;  1HZA A;  1VQE A;  4JBW A;  4DR3 Q;  2RHQ B;  3F2C A;  1PH5 A;  3U58 A;  1HH2 P;  4LF7 L;  2R7Z H;  2C35 B;  4MZ9 A;  3OTO L;  3T1Y L;  1QUQ A;  2VS1 A;  4A3B G;  1MIU A;  4DAM A;  3S1N H;  4WJ4 A;  1TWF H;  4DV7 L;  1PVO A;  3ULJ A;  2HHH L;  2Q2H A;  4IPH A;  2ID0 A;  4LWC A;  1EUJ A;  5FJ8 G;  3PF4 A;  1HNW L;  4R4I A;  4RMF A;  1VQ4 A;  1PH3 A;  4HJA A;  3TEH B;  1C0A A;  1WOC A;  1PH8 A;  2VY3 A;  4UY8 C;  4GKJ Q;  4QL5 A;  1Z47 A;  3G71 A;  3HOY H;  4A3G H;  3CPW A;  1VQJ A;  4BA2 I;  5IP7 G;  2R7D A;  3EBE A;  1W2B A;  4UP9 A;  2KCM A;  3CPF A;  3F8T A;  3U4Z A;  1K3R A;  1EQQ A;  3PO2 H;  3S2D H;  4JYA L;  1L1O B;  4NXM Q;  1KL9 A;  4B3M L;  4GKK Q;  2IHF A;  4IFD G;  2N78 A;  3H3V H;  3PUX A;  1DGS A;  4A3G G;  1TWG H;  3RNU A;  1OXT A;  1X3G A;  3LGJ A;  1J6Q A;  3W1B A;  1OXX K;  1JT8 A;  4L5T A;  1K73 C;  1WI5 A;  2WAQ E;  5C3E G;  3DLL A;  5C4X H;  3KLW A;  4A3I H;  1IBK L;  3GTL H;  2EIF A;  4XIG S;  1HNZ L;  1X6O A;  4LFA Q;  4LF9 Q;  4DPG A;  2KHI A;  5HGQ A;  1QVG A;  2NVY H;  1V1Q A;  2B29 A;  2YYZ A;  1N8R C;  3RLN A;  1NE3 A;  2UXB L;  1JB7 A;  2JJQ A;  4TQU S;  3CMA A;  2UUA Q;  1A63 A;  1VQI A;  2UXC Q;  4BA1 I;  1NMG A;  4JI3 L;  3TRE A;  4YHH L;  4GNX A;  4JI7 L;  4HID A;  2R93 H;  3S2H H;  3GDE A;  1CKM A;  2JA5 G;  4LF6 L;  4A3F G;  2HT1 A;  3KOJ A;  2BA1 A;  1TWC H;  3M85 A;  1YNX A;  3E9H A;  3HKS A;  3KYH C;  5C0X J;  3ERS X;  1BKB A;  1E24 A;  1GVP A;  4LF5 Q;  1M1K C;  1VQA A;  2NN6 I;  4DR4 Q;  5ELO A;  5IT9 c;  3I4N H;  5BR8 Q;  4APV A;  5C3E H;  3CC2 A;  2JEB I;  3BJU A;  3BZK A;  4YWK A;  3CAM A;  3GTM H;  1GD7 A;  4QQB X;  2WP8 J;  1U0L A;  4A3M H;  4NXN L;  1OXU A;  3KF8 B;  1C7Y A;  2JQO A;  4DUZ L;  4X62 L;  3G48 A;  5M3F H;  1YIJ A;  1NJI C;  1SFO H;  3ICE A;  1WFQ A;  4DR7 L;  1GO3 E;  1MJC A;  2H5X A;  1L1O C;  2N3S A;  2UUC L;  4A4I A;  3M4P A;  3S24 A;  3HOW H;  3NBH B;  2UU9 Q;  4JI5 L;  3A5U A;  3CD6 A;  1CSQ A;  3UDX A;  5M5X H;  1RIP A;  1VQ6 A;  4IOC A;  3CCE A;  2PI2 A;  2WFW A;  4O0A A;  1IZ6 A;  1XNR Q;  1I94 L;  4DV6 L;  1YJN A;  1FL0 A;  3K7U C;  3I4O A;  4LUO A;  5LMU Q;  2UXB Q;  5GQO A;  1JJG A;  4LF8 Q;  1L0W A;  1I50 H;  5DLQ E;  3KF6 B;  2CWA A;  1LYL A;  2A19 A;  3CQZ H;  4TVA B;  3AFP A;  4DV2 L;  3FHW A;  1X9N A;  4DV4 Q;  3PUZ A;  3HOX G;  5JJL A;  5GAD C;  1VQ8 A;  2IX0 A;  2MO1 A;  3M4Q A;  4HJ7 A;  4DUY L;  2ES2 A;  2ASB A;  1SE8 A;  2A1A A;  5GAE C;  3S1Q H;  1WCM H;  2AMC B;  4K0K L;  1PH6 A;  4NB3 A;  4OX9 Q;  1HR0 L;  2NVQ H;  1HR0 W;  4JI8 L;  5IP9 G;  2ZJP A;  3KJO A;  1D8L A;  1PH4 A;  2JEA I;  4GOP C;  2RF4 A;  3TRZ A;  4AYB E;  4EX5 A;  3WWV A;  4DR3 L;  4GLA C;  5JJK A;  4R4O A;  1M90 C;  3RLO A;  4A3L G;  2VQF L;  1X54 A;  2RHS B;  2XTI A;  4LF7 Q;  1CKN A;  3TS0 A;  4DR1 L;  1VQM A;  4A3C G;  1NTG A;  4JI0 Q;  4AIM A;  2IY5 B;  1XNQ L;  2K75 A;  2K4K A;  5FLX c;  1VQP A;  1XJV A;  1L2F A;  3I55 A;  4A93 G;  3I4N G;  1Q86 C;  2F52 A;  4QIW E;  4PG3 A;  1UE1 A;  2EXD A;  1XTD A;  4JG2 A;  4A3D G;  2BH8 A;  3E0E A;  3GTQ H;  2Y0S G;  1ASY A;  4DV3 L;  3OTO Q;  3T1Y Q;  1YHQ A;  3PUY A;  3G4S A;  5LMU L;  2OQK A;  4B3T L;  1X56 A;  4DV7 Q;  1SN8 A;  5C44 H;  1HZB A;  4X64 Q;  4OO1 G;  2OWO A;  2YTX A;  2BH2 A;  5IYD H;  3S1R H;  1XMQ Q;  4DR2 Q;  1TWA H;  4JI2 Q;  2CWP A;  1VQB A;  2AWN A;  4LNQ A;  1UWV A;  2PQA B;  2MFI A;  3B6Y A;  4DV4 L;  2YU9 H;  1VS0 A;  2XGT A;  3F2D A;  4IFD I;  1VQ7 A;  3PO2 G;  4LFB Q;  4GNX B;  4OO1 I;  5K36 G;  1IBM Q;  2Q2U A;  2NVT H;  5C4X G;  3EN2 A;  1YBY A;  1VQO A;  1NBW A;  4HIM A;  4K0K Q;  4OWW B;  3W5O A;  1VQL A;  4QY7 A;  4OX9 L;  5JJI A;  1HR0 Q;  5H1S E;  1PH1 A;  3J81 j;  1PV4 A;  4LFA L;  3HOZ G;  2BA0 A;  4JI1 Q;  1TXY A;  5C0X G;  3HOW G;  1I6H H;  5GRO A;  2IX1 A;  2ZJQ A;  1AH9 A;  4QJF A;  2UUA L;  3CCR A;  4JI6 L;  5IYC H;  3PCO B;  1PA6 A;  2R92 G;  3HOU H;  3PIO A;  5IYB H;  1MKH A;  3CC4 A;  3KDF B;  4P71 A;  4JOI A;  1WYD A;  1IBK Q;  4LF6 Q;  2QGQ A;  1VQN A;  1XNQ Q;  4A3M G;  1EFW A;  3OYY A;  2KEN A;  4ALP A;  2JE6 I;  4YY3 L;  4C3J H;  3SGI A;  4JBK A;  1UE5 A;  2E8G A;  1Y1V H;  4JBJ A;  4DR4 L;  1L1O A;  2N8N A;  2UXD L;  1VQC A;  5IE8 A;  3CCJ A;  4DNI A;  2VL6 A;  4HJ9 A;  3K7A H;  4DV3 Q;  1BBW A;  4UP7 A;  2KBN A;  2JA9 A;  2LXK A;  4UPA A;  1D7Q A;  1FGU A;  4X62 Q;  3S14 H;  2ZM6 Q;  3I4M H;  1VQG A;  4R4Q A;  5AJ3 Q;  1SMX A;  2OTJ A;  1CKN B;  2WB1 G;  1EWI A;  1TWH H;  3H0G H;  3H0G G;  1KAW A;  4MTN A;  4DV0 L;  1N33 L;  4LF4 Q;  4Y7N H;  2F4V Q;  2V1C C;  2YV5 A;  3STB D;  4X65 Q;  1QZH A;  1HNX L;  4DUZ Q;  1KXL A;  1I3Q H;  5FLM H;  2K50 A;  1AE2 A;  1NMF A;  4DKA C;  2K5N A;  1J5E L;  2L15 A;  4JI6 Q;  4P73 A;  1XPR A;  2PQA A;  2R7F A;  4LW1 A;  3HOV H;  4BBS G;  2HHH Q;  3M4O H;  4PZ6 A;  5IP9 H;  3S16 H;  3PO3 G;  2ZJR A;  3PIP A;  3CCQ A;  4JI4 Q;  1WCM G;  2KCT A;  5GAH C;  1I94 Q;  4H02 A;  2VQE Q;  4DV6 Q;  3AQQ A;  3CW2 C;  5LMN L;  3UDG A;  3J81 c;  1U5K A;  4C3I H;  4A3J H;  3HOY G;  1A8V A;  2ZTD A;  2NVX H;  3I4M G;  4A3K G;  4A3E G;  4RG1 A;  3I56 A;  2LXJ A;  1EQR A;  4JI8 Q;  1X55 A;  1EOV A;  2QA4 A;  1Q82 C;  1BVS A;  4J15 A;  4POG A;  1EIY B;  3RR5 A;  1O7I A;  3HOU G;  1E22 A;  1G51 A;  5IYC G;  3T1H Q;  2ZM6 L;  3J81 i;  4JI0 L;  3D31 A;  4DV5 L;  3H15 A;  2I5L X;  1HNZ Q;  2D62 A;  4DR5 Q;  1Q81 C;  1AE3 A;  1PH7 A;  2QEX A;  2CQO A;  1KRS A;  3AFQ A;  1EIF A;  3F1Z A;  2GVA A;  1VQ9 A;  1E1T A;  1FJG Q;  4IFD J;  4Y52 H;  1H95 A;  1K9M C;  1JMC A;  4DV0 Q;  1N32 L;  2VQF Q;  3AEV A;  4IO9 A;  1Z9F A;  3PF5 A;  3A5Z B;  2E2H H;  4HIO A;  3S15 H;  1Y1V G;  2AWO A;  4IPG A;  4YCU A;  3W1G A;  1J5E Q;  3GTP H;  3G6E A;  4DR6 L;  4A3E H;  4C3H H;  3HOZ H;  2LSS A;  3RN2 A;  1V9P A;  5J3B A;  5FJ8 H;  2JA7 G;  1HJP A;  3U4V A;  1VQK A;  2R6G A;  1YZ6 A;  1B7Y B;  3L2P A;  2K5V A;  2Q2I A;  4BY7 H;  3I2Z A;  4L5R C;  4GN5 A;  1HNW Q;  4NPS A;  1IBM L;  2UUB Q;  1YVC A;  4GKJ L;  1N34 Q;  4IOA A;  3E9I A;  5M5Y H;  4BBS H;  2WAQ G;  4AQY L;  4JYA Q;  1UE7 A;  3CCS A;  3PSI A;  1Q12 A;  3BU2 A;  2F3I A;  4JI2 L;  1KQS A;  2B63 G;  4GKK L;  1KIX A;  1N36 Q;  3L7Z C;  1YIT A;  1P8L A;  4JV5 L;  4WJ3 M;  4DV1 Q;  4FDB A;  5M3M G;  4B3S L;  2JA8 G;  2UU9 L;  3PGZ A;  4MNO A;  3PO3 H;  2ZTE A;  4DV5 Q;  3K0X A;  1YEZ A;  3HKZ G;  2PMZ E;  3D0F A;  4JI1 L;  4YY3 Q;  3CF5 A;  4BXX H;  3RZD H;  1FJG L;  1S72 A;  2FXQ A;  1QVC A;  1IXR A;  2HIV A;  1S3O A;  1VQD A;  4R4T A;  2K14 A;  3ER0 A;  1KC8 C;  2K5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...