4ZAIA

Crystal structure of cxcl13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-X-C motif chemokine 13
publication title Crystal structure of CXCL13
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zaiA00
1DONA 2B2YA 2MGSA 5EJWA 4CJ1B 5COYA 2KOLA 4XT3B 2J7ZA 2NZ1D 1HA6A 3QO2A 4HSVA 1J9OA 1NR2A 3DM1A 1QG7A 2NYZD 1MGSA 3H91A 1NR4A 4RA8A 4CJ2C 2FMMA 1WTOA 5T1GA 2N55A 1AZQA 2B2UA 2X6GA 1BBXC 5EPJA 5T1IA 2CVRA 1EL0A 3P7JA 2Q8TA 2N88A 2Q8RE 4X3SA 1JE4A 1KNEA 1RHPA 4IUPA 2XIWA 1M8AA 2KEEA 1ICWA 1QE6A 4IUQA 5EPLA 1WTXA 2B2TA 1RJTA 2HCCA 2X69A 3I91A 5EPKA 2JYOA 1VMCA 2RSNA 3TN2A 3IL8A 2HCIA 5CORA 1WTRA 4UAIA 2EE1A 2KEDA 4NW2A 4R9WA 2FJ2A 1DOKA 4OIJA 1E0BA 3GV6A 4ZK9B 1HRJA 1WVLA 1C8CA 1ML0D 5D65A 4CJ0B 1WTQA 1VMPA 2K05A 2D9UA 1AZPA 1G2TA 3KUPA 2K01A 1DOMA 1F9SA 2B2WC 1CM9A 2M2LA 1O7YA 2KUMA 1WTWA 5D14A 4IUTA 2HDMA 1PFNA 3UI2A 2MP1A 2MJ8A 1B3AA 3FPUB 1O80A 3I3CA 4O42A 1PDQA 4X3TA 1G91A 4HCSA 3I90A 2L12A 2VXWA 5EKIA 4MHEA 1ESRA 2FINB 2L1BA 4QUFA 4ZKBB 1X3PA 1LV9A 4IUVA 2X6LA 1RODA 3MWYW 1HHVA 1F9RA 4IURA 2EPBA 4QUCA 2B2YC 2RA4A 1BO0A 2L9HA 1EOTA 3SVMA 1RTOA 1DOLA 5AFWA 1B53A 1XX8A 2B2VA 1U4MA 3TZDA 4ZAIA 4DN4M 1ILPA 1IKMA 4ZKCB 1WD1A 2NWGA 1AP0A 1SDFA 1HUMA 2B2UC 3DEPA 2B2WA 2HDLA 3IFDA 1SSOA 1O7ZA 2DY7A 1WTVA 2BDNA 1EQTA 1J8IA 2SDFA 4RAUC 2K04A 4ZLTF 1NAPA 2B2TC 1MSHA 1PFBA 1QNKA 2H1EA 3D6WA 3KBXA 3ONAB 3Q6SA 4OIKA 1X32A 5CBAE 1PFMA 2KVMA 5E4WC 1NCVA 2FFKB 1PLFA 1WD0A 5DNFA 1B2TA 1U4PA 2RVLA 2KECA 3LWEA 1F9PA 1MI2A 1HFGA 5JJZA 1JICA 4RWSC 1U4RA 1ILQA 2K03A 1TVXA 4LMQD 3GV3A 3DEOA 1X3QA 3FDTA 2L4NA 1ZXTA 1HFNA 3R93A 4XT1B 1F2LA 4MN3A 4R8IA 2K1BA 2L11A 1BNZA 2R3ZA 1IL8A 5EQ0A 1U4LA 2RSOA 1BF4A 1KNAA 3F2UA 1B4OA 1EIGA 2HUGA 1S4ZA 2JP1A 2DY8A 1DZ1A 4HAEA 2MPMA 3I8ZA 1A15A 1GUWA 4U68A 1F9QA 1SAPA 3N52A 2IL8A 5CMDA 2K28A 2EOTA 1EIHA 4IUUA 1WTPA 3HP3A 5E4XA 3MTSA 1CA5A 1CA6A 1MSGA 1Q3LA 1IKLA 1RTNA 3G7LA 4X3UA 4XDXA 1G6ZA 4X3KA 1G2SA 2FHTA 5CBEE 1B50A 4HEDA 1HUNA 1XYIA 2B2VC
chains in the Genus database with same CATH superfamily
1QNUA 3EVQA 2IW3A 4DU9A 4HSVA 4GNXA 5IY0A 3MXGA 1A63A 2I07B 4OX9Q 2F52A 5EKKA 1AZQA 4X65L 3L2PA 4A3KB 1GHJA 4KJNA 4UHVA 1TS4A 2L5TA 3M4YA 3KLWA 2UUAQ 2PMZB 1KL9A 2E2HB 1I4XA 3NENA 1GUOA 5IODA 1SE8A 1U5KA 4B3MQ 1S40A 2AQ3B 4LF4Q 4XXEA 1C4QA 3PIPA 1CK1A 4XYQA 1SR3A 3NP8A 1PZKD 1PRTC 2K4KA 3UE0A 2HDMA 1PFNA 1H9SB 2EY5A 1K3RA 5M3MB 5C4XB 4HCSA 3I90A 1HR0W 1E1OA 1H9JA 3H0GH 5C5LA 4B9XA 1FYCA 2JQOA 5FKAC 2VS1A 3AYHB 1BR9A 3H94A 3K8AA 2DJFC 2F0KA 3J7ZC 1DXMA 1DOLA 1O78A 4JC0A 1G291 4GKKL 1CHQD 4LF7Q 4HIKA 1BBWA 1IYJB 3PUZA 4OO1G 4A3BH 1I3QB 1A3VA 4NP5A 4RGTA 5C0XG 2BDNA 3GTOB 3OSOA 2LMCB 4DAPA 4CGYB 2DUDA 3MEFA 1B2TA 1ZKOA 4JG2A 2KECA 3GTOH 1HNXQ 4BXXH 3X3MA 4DF7A 3EFXD 1VS0A 2K5DA 5KNDA 3OMGA 4XT1B 5IGCA 1XPUA 1SFOH 4GKJQ 2EYFA 2WINB 3I4MG 4BA2I 1S4ZA 3M4QA 5F2DA 1Q81C 1P16A 2MPMA 2NZOA 1PTOH 1SAPA 3PUXA 1ENFA 5FO7B 1E3PA 1EZ6A 3CHBD 2ZXOA 4GNXB 3OW7A 4LF6L 5A2QL 4V190 3HOVB 2PZUA 3P1HA 4JW0A 2KOLA 4Q0FA 1QG7A 3HOZG 1BUVT 1E2VA 1N34Q 1F2MA 1QB5D 5AJ3Q 2PQEA 1HPCA 4JI8L 1GM5A 3Q23A 2B63B 3GTPH 4IUPA 3SGIA 3EA6A 4AYBE 2HCCA 3H15A 1M1KC 2O2LD 4RGNA 5BR8L 4OHJA 4O0AA 4BBRB 2SOBA 1VQBA 3RN5A 5JJIA 1VDZA 3MFGA 2VQEQ 2K5VA 2A69C 2I46A 4A3CG 1W2BA 3HG9A 1TY0A 1AEXA 3PQIA 1TR5A 2K7VA 4KHVA 3FP9A 1JC7A 1KC8C 2VL6A 3I2ZA 1G91A 4JI0L 1GVPA 1TS5A 5ELFA 1JMCA 2IX1A 3GTMH 1FGBD 2VUMG 2IHEA 4HR7B 4DUZL 3VYUA 2F1MA 1HR0L 2GA4B 3CCQA 1PRTB 5A2QE 3I56A 3FMCA 4JI2Q 1OTCA 4IJHA 1VQKA 3C2PA 3KF8A 3PIO3 3K80C 4ZKCB 2NWGA 1NE3A 1EY5A 2Q8IB 4A3KG 3P20A 3I4NB 1GXDC 1IBLL 4LW1A 2Z4HA 4Y52H 4K2LA 5LMNQ 2EYJA 4N8FA 1IXRA 3H3VH 3A0JA 3K5NA 5E4WC 1B9MA 3MAQA 2WB1B 4POFA 2ZJRA 3GTGH 4RWSC 1EWCA 1QCBD 1N9WA 4DPGA 4FVMA 3HKZE 3M4OH 3U58A 2L4NA 1ZXTA 3VA7A 1TQOA 5GQOA 4DV2L 2EJGC 1X54A 3SXHA 3VYSA 4DXGA 5M3MG 2MO1A 3D3RA 3BYTB 2G9HD 1PH1A 1N33L 2N78A 1LTBD 3DM3A 1EYAA 3PGZA 3OTOL 5FO9B 2L15A 3V2TA 1DYQA 3J81L 3RLFA 2IX0A 1Q3LA 4HCEA 2UUCQ 2CHBD 1IBKQ 1V1QA 2F0HA 2FXQA 3NTHA 2PZTA 3Q0AA 2XRQD 3M7GA 3T1HL 2F0TA 4LFAQ 4NKLA 5IT9L 1DD2A 2QW7A 3S14B 1QJOA 1RDPD 2YYZA 1HZBA 2ZJPA 1CQFA 2X6GA 4MTKA 4FF2A 2N88A 2O5IC 2KCCA 5I2XA 1X3GA 4WFN3 2MO0A 2QGQA 4BWGB 4IOCA 4B3TL 5JOBA 1SMYD 2UXDL 2JA7H 3HFZB 3KK7A 4XIGS 1VQ4A 4DNRB 4YHHQ 3C3LA 2CH4A 1DOKA 1HQRD 2AUKA 4LUZA 4ODGA 1WVLA 1X65A 1EQVA 1W6JA 1EIFA 1DOMA 3OWFA 1N36L 2B2WC 5M5WB 5C44B 1KLGD 2UXCQ 4QGUA 3J80i 1TWCB 2NUCA 4IO9A 2X6LA 1E2ZA 2QF7A 4F87A 1H9MA 2EPBA 3BS1A 3KF8B 5M9OA 3MC0B 1FNUA 3FRPB 4KJOA 3K7AB 1BDOA 2EYPA 1STGA 3W5OA 5D3IB 2R93B 4UY8C 4N9PA 4A3EH 1SNQA 2Z9HA 3DEPA 1ET9A 4RGOS 2B2WA 3S2DB 2B63G 1C9OA 2HD3A 3N6RA 2F4VL 2XTIA 1WOCA 4ZYSA 3JAMi 1U0LA 1IYUA 2H1EA 4BBRG 4LF8Q 1BOSA 3FPPA 5DNFA 2E5LQ 1XMQQ 1EYCA 1PFSA 2IHFA 1HFGA 3K57A 5CV7A 1WYDA 2NVQH 2K03A 1LTAD 1NMFA 2PZWA 4S3SA 4TVAB 5CYUA 1QILA 2JK8A 4JI6L 2R3ZA 5EQ0A 2NZHA 1BF4A 2NVYH 3HOUH 2R6GA 1EIGA 3F2UA 4OWXB 2HUGA 3CCMA 4ID6A 4KHPQ 5DLQE 1TS2A 3RR5A 3PO2B 5GADC 1YIJA 2IL8A 2N3SA 3A5UA 2R7ZB 2N8NA 1V1OA 1T9HA 1D5MC 2PYKA 3I73A 1WTHA 5M5YB 3SK5A 3TS2A 4C3IG 4IFDH 2PCFB 2F0DA 1HA6A 3HKZB 5CGKA 2NYZD 4BBSB 4JI1Q 3ICEA 1GHKA 3RZDB 4CJ2C 2B29A 3BVGA 2Y0SB 1SYBA 4L5QA 3NE5B 5KIXA 4X66Q 3P7JA 2Q8TA 1KABA 4AQYQ 4YWMA 4ZUJA 1SE4A 1B7YB 3QWNA 3L9AX 4L6TB 1WTXA 1C0AA 4KKSA 3S16H 4DR5Q 4A3DH 4R4TA 4A3JH 4DR6Q 1E7ZA 2K5NA 2EY2A 3A7LA 1V8QA 4JV5Q 4LFBL 3UI2A 2R92G 4AH6A 1GOZA 5IYCH 5EKIA 3K58A 3M3YH 3S1MH 4DV7Q 2F0LA 1VQIA 3A56A 4CKBA 5JVH3 3GTLB 3MWYW 2OCEA 2TMPA 1W6KA 2RA4A 1EOTA 5I6WA 3A5ZB 4X64Q 3CCLA 1JR0D 2I0QA 1H95A 3CCVA 5KGUA 2ZTEA 1JORA 4MZ9A 2E75C 1AH9A 1I6HB 1ICFB 3MXUA 1EQTA 2OT2A 3S1QH 2JA5H 1PFBA 4LJZC 1XJVA 2AQ1B 1IL2A 4KY6A 2B8GA 1JWUD 2Z6BA 3PO3G 4DR7Q 4DK0A 4EGVA 4K5WA 3QB3A 4DV3L 4N9TA 2NN6G 1R9TB 1GUGA 3A54A 1ENAA 1YJWA 3AFQA 3SK4A 1DZ1A 4B3RL 4LUVA 2KHSA 1Y8NB 5GROA 1PRTF 1K9MC 1DJRD 3VA5A 4AYBG 2Q2UA 4EVOA 2RBMA 4HJ8A 4YWKA 3PV0A 4DGZA 2KJXA 1TXYA 1A62A 4J1MA 3NTIA 1Q1EA 1J9OA 3H91A 1KHIA 3TRZA 1X3EA 2CW0C 1YNND 1SMXA 2BE5D 2B2UA 4KV6A 2K33A 4DUYQ 3K0YA 1UE6A 2CVRA 4QJFA 5C0XI 4A3MG 5IWAL 3GQBA 4BY7H 3HOWG 1LACA 4JI4Q 4GOPC 2EY6A 4CBVA 2EXDA 3MXNA 2B2TA 1RJTA 2I5LX 3I4OA 2EQSA 2IWHA 1VMCA 3VR5A 3A8JE 1HRJA 4KKTA 2D9UA 2E2IH 3D0FA 1F9SA 2VY3A 1CKMA 5G3LF 5D14A 4NXNQ 3RNUA 3S2HB 2HQLA 4OL7A 2R7ZG 3M85A 1ESRA 3PCOB 2L1BA 1TWHB 1IW7D 4LUOA 3VYTA 2XSCA 1RODA 4A3IB 1Q8IA 3W3AA 1HNXL 4IURA 2CCZA 1PYSB 1EY6A 4QUCA 5IYDH 1PH7A 2B2YC 2L9HA 3HKZG 4OO1H 5KYLA 2O4XA 5IYBH 3UDIA 2IX3A 3TZDA 3CD6A 4ZAIA 2F0WA 4RFBA 1STHA 2MFIA 2HDLA 3KF6B 2EYOA 5HURA 1PVOA 3GD7A 3I4MB 1SROA 1FGUA 1TWGB 3R8BA 1K28A 4KD3A 3Q6SA 4OIKA 1FVIA 4JI7L 3KBXA 1H9SA 1PFMA 2AQ2B 1D1KA 3OPOA 2E2JH 1N32Q 1OXVA 1F9PA 4IPCA 2DN8A 5HY6A 1K8OA 2NVXB 2WP8J 1C7YA 5IIFA 2F0SA 1I50B 3F2CA 4E6IA 3I7FA 4DV1L 1N34L 1A2TA 2QDBA 5C3EG 2A74C 3S17H 1G8ZD 3HS0C 4KMUC 3HOZB 3OOCA 1SYDA 3HOXB 3P75A 1YJNA 2A73B 2ASBA 4AIMA 4FF3A 2Z8LA 1SYGA 3IAYA 1CA5A 1CKNA 4QL5A 5C5MA 4KK7A 3HOZH 1G6ZA 1HUNA 1NSNS 5LL6X 4RA8A 3J7AV 3K5OA 3NWTA 1XNRQ 1QVFA 1L1OA 2HT1A 5I9OA 5T1GA 1KAAA 2N55A 3TEHB 2ZM6L 4A76A 3GTQH 2CQOA 3MXNB 4HSPA 1STEA 2UUBL 1KNEA 2XNAC 3V05A 2D2CC 1XPRA 4IPDA 4GLVB 2JYOA 4KTAA 1BQQT 4Y7NB 3RMHA 4DV6Q 3U4VA 1E0BA 1MD2D 4A4IA 3NTKA 1R4PB 3C46A 4A3FG 3VDYA 3KJPA 1GKHA 3KYHC 3WOFA 3CCJA 1BBUA 1BCPC 4IUTA 2VUMH 4ZQ3A 5JEAH 5D3DA 5EBDA 1FNWA 3ER0A 4POGA 1PDQA 4NXMQ 2WAQE 2UXBQ 4YCVA 4GOPB 3VR4A 2JA6G 1B3QA 3TDQA 3J7A5 1PRTD 2LKVA 1LM0A 1VQHA 2EYMA 4LF5L 2F0UA 5E7NA 5TSSA 5J22A 4A3KH 1RTOA 2RF4A 4DR3Q 3HGBA 4DNTB 5CR3A 3IRBA 5E3FA 2CH4W 4A75A 4DR2L 2E2HH 3JC66 2F0QA 4C3JG 2GN5A 5IE8A 1IBML 1VQ5A 4H44C 4NB3A 2NB0A 5C4JB 1Y8PB 3BZCA 3OHXC 5I4DA 1YITA 4C56C 4KHZA 3D6WA 2ID0A 2VQFL 1SYFA 4DV5L 2KVMA 1HNZQ 3FKIG 2IPKD 1IBKL 5C4JH 4B3SL 1MI2A 5C4XH 5M3MH 4YY3Q 1U4RA 2JSOA 3SE0A 4LFAL 3MVVA 5IP9H 1K8AC 3L0OA 4JVZA 3J80c 3UDXA 4K2KA 4XQQA 3VYRA 4DAVA 1HNWQ 1R4QB 3KBGA 1X6OA 1GUSA 3UE1A 4H7BA 2UU9L 4P75A 1KLUD 3KJOA 3MEHA 1VCIA 2YTVA 4A3IG 1GUWA 1CKNB 1EY7A 3CF5A 2YTYA 3BZDB 1I3QH 3VR2A 4XTCS 1L1OB 1YHAA 4JBKA 2A8VA 4QY7A 2BH2A 4DXFA 2M9VA 4ZRZA 4V0BA 4JYAQ 5I6YA 1PH9A 3F1ZA 1UE1A 1ZEQX 4RH6A 4NDXA 4PV1C 4U673 5LMUQ 4G7ZC 1PH5A 2OEOA 2RHSB 2F0GA 1JJCB 1XTDA 2OTLA 3IL8A 1TWAB 4C3HG 1XMOL 1OXUA 4ZK9B 3A8IE 1VMPA 4BS9A 2YTXA 3HOXG 2HIXA 4O42A 3CMAA 3HOVH 3SHLA 3RZOB 1ET6A 2K5HA 4YIJA 4PMBA 2A69D 1X3FA 1X3PA 2MHVA 4X62Q 1AW7A 1YI2A 4Q5VA 3T56B 2E5LL 1F9RA 2QEJC 1Q46A 1BO0A 1VQ9A 2B63H 2SNSA 3D6CA 1SEBD 4XQJA 2M00A 4DK6C 2XN9C 4JI3Q 3D4WA 4HTHA 4R1JA 1EY9A 2EZVA 4LNQA 2NTTA 1SJED 1SDFA 1YHQA 2KHJA 4KHPL 1SSOA 4BBRH 4DR1Q 1PXUA 1NAPA 1A3TA 2BOSA 1VQDA 5FJ8G 2DJGC 2KA7A 4EQNA 4LMQD 1VQOA 4EX5A 2HHHL 2F0NA 3PIOA 3QJYA 1Z9FA 4CDCC 5ELEA 4C3IB 3K59A 5FK9C 4AQYL 1T5EA 1GD7A 1F9QA 1JOKA 1STBA 4C3IH 3CXCA 2K75A 4IUUA 3T1YQ 4JBMA 2A19A 2K32A 3I4NH 4DR6L 4JI5Q 4EQOA 2AUJD 4RKLA 2CWPA 4PG3A 4CJ1B 5EJWA 4FF1A 1NR2A 4JV5L 3F8TA 2ICIA 2AKWB 1EEID 2LY7A 1WTOA 1UWVA 3DWPA 1D6EC 1K73C 4K6LA 4X3SA 2B3GA 4DV7L 2R92B 1J5EQ 4UP9A 2A68D 3H0GG 4A93B 3ITPA 3AQQA 3J80E 2KEDA 4X64L 1LTRD 1SBBB 2WIIB 1OXXK 3I55A 5CV4A 5I2YA 1JWSD 1Y1VG 4R4CA 1O7YA 4H0LC 4UPAA 2NN6I 2MP1A 5E1FA 3T53B 2PI2E 2P5ZX 1B70B 3S14H 3ULJA 4JPBW 1EQQA 1PV4A 1XTCD 3BVZA 3E6ZX 4QQBX 3BZKA 5H1SE 4IPHA 5C6AA 4IZ8A 3STBC 4MIUA 3CCRA 4C1NI 3PO3B 4GKKQ 4DK3C 4WJ4A 1NJIC 1S5CD 5FLXc 1T5XD 2L55A 2DY7A 5J1ZA 1NBWA 1STAA 4C2MB 1J8IA 1DM0B 2PO4A 3E9HA 4ZLTF 4IJLA 3G6JB 2ZTCA 1RIPA 2WKCA 5M5WH 1UAPA 5C44H 1PLFA 5DM63 3G71A 2Q2TA 2KENA 4AYBB 5JJZA 2MNAA 3F2DA 5IP7G 2PQAB 1TWCH 2PNHA 3CPFA 4L5SA 1VQ6A 5KYIA 2GVAA 4CDEC 1SMYC 3K5MA 2RSOA 1EOVA 4XQNA 1LT6D 3UDFA 2L0CA 2VW9A 5M5XB 3K7AH 4HAEA 5FO8B 5ELDA 2R93H 4FYDA 4O1NA 1EIHA 5ISRA 3S2DH 1KTKA 1IHZA 1CA6A 1JOQA 5KRUA 4FXKC 4A3MB 1KXLA 3MZ5A 1JWMD 1QWYA 1EFWA 3HOWB 4LF6Q 3QG1A 3M4PA 2B2VC 3NHHA 4WJWA 1MKHA 2J7ZA 1Y1WB 1H9RA 4A3MH 3O13A 1SE2A 3PUYA 3HOWH 4X6AH 1CHPD 5JAVA 2WAQG 4OEMB 2Q2HA 2RCFA 1UEBA 3KDFB 1XNQL 1JE4A 5K5PA 4IFDJ 1I4RA 3NUCA 1AE2A 3CCSA 2QKIC 2HIVA 3PO2H 1ML0D 3T13A 4A3LG 1G2TA 1GJXA 2R7ZH 2K01A 4K0KQ 3LNNA 2M2LA 4L63B 3J81i 4DNIA 4ZUIA 2MJ8A 5M5YH 1HCZA 1EWHA 3M7NA 1JB7A 2LFNA 4JI0Q 1V9PA 2XWBB 4FXDA 4IUVA 4BBSH 2VZAA 5JPMC 5C4HA 3RZDH 3S1NB 3G4SA 4DUZQ 1HR0Q 4ULLA 4WJ3M 3U4ZA 5DM73 1HXYD 2RKSA 5KNCA 5CV6A 2VNUD 3VR6A 1IKMA 1AP0A 4R8NA 5ELOA 2CKZB 4IALA 2C9OA 1IBLQ 1FJGL 4DV0Q 1CQVA 5C3EB 1I4PA 1GUTA 1HH2P 2K52A 4A93G 1X32A 1VQGA 1WD0A 1I4QA 2RVLA 1D2BA 3MXPA 2WV6D 2ZXPA 4JBJA 5C3EH 4G57A 4UDUC 2RDGA 1E24A 1XNRL 3GTLH 1B8AA 4DV2Q 2FMCA 4I65A 1KRSA 2V1CC 1K0RA 1N33Q 4HMJA 4G7HC 3OTOQ 1BCPF 3KF6A 1WTPA 1WCMB 3BU2A 1ENCA 4K8IA 1MSGA 1I6HH 1LT3D 3D31A 2NVTB 4P74A 2NTSA 4HEDA 4HJAA 1NNXA 5FLXE 2NZ1D 1K83B 3T1HQ 1MGSA 4OX9L 5FLMG 2UXBL 1LTLA 4A3FB 2D0PA 1BBXC 4N8X1 3QIAA 2A6EC 1EY4A 4CKEA 3IFTA 2F3WA 2UUAL 4QCLA 2EJFC 4QMGA 2CW0D 5CV8A 1YNJC 1PZID 1SJHD 4B3TQ 3KOJA 3T16A 1R9TH 2JA6B 2UXDQ 1WTRA 4DR3L 5CC4A 3OYYA 4L5TA 1YZ6A 1PH6A 2FJ2A 4B3ML 4HIOA 4DAYB 4LF4L 3GV6A 5D65A 3SEBA 4CJ0B 1CI3M 1OXSC 4UP7A 3KUPA 1KAWA 1KIXA 1N36Q 2KUMA 3E5SA 4IQZA 1B3AA 1Q8KA 2EXZA 1TU2B 4C3JB 1KDBA 1K0SA 4QUFA 3CC2A 3M9BA 2F4IA 4LWCA 1TWFB 2BA0A 1G6PA 3DXJC 4PNYA 3SR1A 1HHVA 3KLSX 2KQ3A 2YV5A 3MFYA 3NELA 4C3JH 2F0EA 4KN4C 5JPNC 4R4IA 5IGEA 1Y1WG 3FKIB 3NSWA 4BY1G 5AFWA 2ZTDA 1CFMA 2OF1A 2EYHA 4LF7L 1A6XA 4GN4B 1SXTA 3A74A 4J15A 4R4OA 1WD1A 5LL6S 1SNOA 2F4VQ 3K5LA 5CV5A 1L0YB 2K04A 4TQUS 3HOYB 2EIFA 3ONAB 2Z6KC 2KBNA 3BJUA 4CKCA 2QA4A 3GTJB 4KI0A 5CBAE 1NCVA 3PSIA 3I4LA 4IUNA 4DFAA 4GOPA 3MHBA 3AU7A 3S2HH 2GVBA 1EWIA 3SDZA 1KRTA 3U9SA 1TVXA 1D7QA 1EU4A 1TWHH 2LXJA 5C0XH 4YCWA 5HGTA 4GKJL 4A3IH 1QVGA 1BNZA 4A3GG 1UE7A 2C5CA 4IN3A 2O5JC 1JB3A 2PNRC 5LHY1 3K6OA 1QZHA 2DY8A 2ATWA 3I8ZA 1HZ9A 1EU3A 1JQYD 2JA8B 1EUJA 3MTSA 4PZ8A 3HRZC 1YNXA 4ZCKA 3I4MH 5CBEE 1JE5A 3CAMA 1TWGH 2B2YA 4JK1C 5BN3A 1XPOA 5M3FG 2EY1A 4A3DG 2I5HA 2ZXRA 1P8LA 5BN4A 4C3HB 1RCVD 1I4GA 4JCVE 5AJ3L 2NVXH 2WACA 1WI5A 3TP8A 3OW2A 2IJ0A 1I50H 1UEAB 3DMUA 1M8AA 2K5WA 2A6HC 1QOHA 3SK8A 5GAEC 1M90C 1JOOA 4KN7C 4DA2A 4JI3L 3HOXH 4F8MA 1VF5C 3J81j 1WTQA 1AZPA 2VQEL 2K05A 4HIDA 2QDLA 1KD1C 4DV4Q 1RF2D 2ZJQA 4OWWB 1ZYRC 5K36G 5IOCA 2QILA 2AMCB 4B9WA 1PTOC 3EIVA 3FPUB 2G9DA 4LF9Q 4C1NK 3OIPA 4JOIC 2L12A 2VXWA 1N8RC 4NMZA 1WCMG 3I70A 4DR4Q 1LTSD 3GO5A 3R2TA 3ULLA 2WFWA 3NK9A 2BH8A 5JJLA 1IYVA 4XYOA 4PMWA 2JA5G 2JJQA 5NUCA 4A3CH 3GTKB 1DGSA 3S15B 3NWSA 1CTMA 4H02A 5JEAJ 4JI2L 3BDOA 3ZYYX 3GDEA 2ES2A 1CKOA 1U4MA 4DN4M 4RKBA 4DAMA 2DNCA 1HUMA 1EY8A 1I6VC 2E74C 5IGGA 4Y7NH 3S15H 1B1ZA 3WOEA 1O7ZA 2DNEA 3DHQA 5LMNL 3S1RB 2SDFA 4JOIA 4ME3A 4R4QA 3J7AF 2N49A 1FD7D 1PH4A 2K6AA 4LFCQ 3W2DA 5BN5A 1EZ8A 4JI5L 1EQRA 2F0MA 3LWEA 3AB9A 4J6HA 1I94Q 1JICA 2E2DC 1ILQA 3GV3A 1X56A 3CRLC 4P72A 1U9RA 4MN3A 4DV3Q 1Q7YC 3L3OC 1JCKB 4HIMA 1STYA 2RDFA 1S5FD 2EJMA 4K5VA 4L5RC 3WDNA 5DAUA 5IGFA 1HJPA 1J5EL 4U68A 1VQMA 4B3RQ 2I5MX 4QIWE 3D4RA 2J4XA 1XXGA 1PZJD 2UUCL 1W3SA 1IKLA 4X3UA 4XDXA 4BY7G 2FHTA 1JJGA 3ND9A 3DWQA 4MNOA 3DUZA 3H0GB 5COYA 3PIP3 3QO2A 3A8KE 1B9NA 1SN8A 1EYGA 1MJCA 1SYEA 2FMMA 1A0IA 5FOBB 4FO2A 1HQMC 1PMRA 5G3LD 2Q2IA 4P71A 5EPJA 3H3VC 3HOYG 2YU9B 1M4VA 1Y1VB 4Z9CB 5ELCA 2RHQB 3EROA 1RHPA 5A35A 3A7AB 4RG1A 4K5XA 5IWAQ 2XIWA 2WB1E 2LXKA 2X69A 1LTTD 2RSNA 3TZUA 2HQEA 4YHHL 2YU9H 1HA5A 2CWAA 2F3IA 4A3BB 1Y1VH 2EE1A 1PH3A 2B8FA 1C48A 3G6EA 5IYDG 3JAMc 1CM9A 2V4DA 1LTID 2UXCL 4TRDA 5IGBA 5IYBG 4KKUA 1O80A 3CC4A 2JA8G 3URYA 1WJJA 4K14A 1VQPA 1SFOB 1S5DD 2XVSA 1LO5D 2SEBD 2JE6I 1CUKA 3L7ZC 1YVCA 2EDGA 1PTOB 3NBIA 1ILPA 4K6DA 3U9OA 3IFDA 2WKDA 1TWAH 1EIYB 1HZCA 4HJ5A 3PUWA 2PW5A 1BKBA 5IP7H 1UUPA 2KCMA 4JI7Q 1LABA 1VQCA 4LF8L 1K8MA 3EJIA 1BVSA 1XMQL 1L2FA 5ELNA 1II3A 3J81c 3RZOH 3TP7A 3AEVA 3GTPB 1X3QA 3NXWA 1BCPB 3R93A 4I7AA 5EGTA 2EYLA 2Z0SA 4DV1Q 2F0FA 1B4OA 1L0XB 1SNMA 2ALYB 2D0OA 1K3BC 2BCOA 2JP1A 3OWEB 5IT9c 4LAAA 1ASZA 4RHRA 3R2IA 2MQHA 2WAQB 2DGYA 2JXMB 2K28A 2XRSD 3J80L 3PF5A 3RUZA 2XWJB 1NY4A 1LLRD 4RHSA 4X3KA 3TBIB 2MGSA 3H3VI 4K0KL 3ERSX 4JI1L 3GTMB 4DK1A 2PQAA 2KCTA 4X66L 1VQAA 2ZM6Q 3FEWX 1Z6HA 3IKJA 3CU7A 1MIUA 2UUBQ 5JEAG 4RCOA 4A3LH 5EPKA 4DR5L 3TN2A 4QIWB 5KEEA 1I4HA 4DKAC 2HCIA 4UAIA 3JAML 1PH8A 1VQNA 1D5XC 4YCUA 4BA1I 4OWTB 1Y14B 4GLXA 1TIID 1WTWA 3TREA 3PUVA 5GAHC 5C3WA 3AMUA 3GTGB 4DV0L 4X3TA 2OWOA 2K14A 4FNFA 4X65Q 4MHEA 1EY0A 3M4OB 1O7LA 1PH2A 2F0PA 2VB3X 3S9WA 3E9IA 2ICEC 3KDFA 3RLOA 4LF5Q 1LT5D 1L0WA 3T51B 3ND8A 4H13C 3DLLA 3PMFA 2LS01 2R92H 5J3BA 2G5DA 2F0OA 3A55A 1LTGD 4PQXA 3F2BA 5C4XG 3C1FA 2Y0SE 4DR2Q 2ZT9C 4A93H 5IP9G 1X9NA 1IBMQ 2JN4A 3STBD 3CCUA 2QEXA 3BDLA 4F7XA 2SNMA 4PZ7A 4A3BG 2VQFQ 4DV5Q 1O7IA 2NBFA 3MA2B 3NBHA 4DR7L 4B3SQ 3JAME 1V43A 2OXPA 3TMEA 2BA1A 3LWUA 3QOJA 5C4ZA 1CZGA 2L11A 1PA6A 2OTJA 4FP5D 4BXXG 2A68C 2JA7B 2RCNA 1QZGA 3EBEA 1AN8A 3HEJA 2UU9Q 5CV9A 3N52A 3QR8A 3PO3H 1VF7A 1JJ2A 1CSPA 1YEZA 1RTNA 3ERQA 5FLMH 1B50A 4C2MH 2PI2A 2NN6H 3HKSA 1DONA 1SYCA 1SE3A 5GAGC 1D5ZC 1E1TA 3CW2C 3DM1A 4TSSA 4YWLA 3TP5A 2J0TD 4RCNA 5EAYA 4K8JA 1SNCA 3TQYA 5IGDA 2R61A 4DUYL 5T1IA 1EL0A 3ULPA 3RLNA 4HN7A 4JI4L 3J81E 4HJ9A 1KDAA 2KEEA 3I72A 5EPLA 4A3EB 3HOVG 3LX0A 2E8GA 3G48A 5EBCA 1D8LA 4HJ7A 2JA9A 5KNBA 5M5XH 2E76C 4OONA 1SRUA 1XMOQ 1MBYA 3WWVA 3K81C 3CC7A 5IT9E 1F77A 2VB2X 2KCNA 3LGJA 4CDFC 4BY1B 1B44D 1K8GA 2F0IA 1YJ9A 3TSSA 1CT1D 4NXNL 4IFDI 4TKOB 1EEFD 4M8AA 2OQKA 1X55A 3BDCA 2NVQB 3CRKC 4JI8Q 1FR3A 1GO3E 4QF4A 4ZKBB 1YHBA 1Y1WH 1CSQA 4MTNA 4BY1H 1LV9A 1UNSA 2K5QA 2QCPX 3CQZB 2NVYB 3HOUB 5I9PA 5BR8Q 1H9KA 2B2VA 4IOAA 3E0JA 3H6MA 4KY7A 3CQZH 4NPSA 4DAYA 3TS0A 1SNPA 1TKWB 1SNDA 1WTVA 2A1AA 3V96A 1PHJA 4A3GB 5JJKA 3NBHB 1OXTA 3QOLA 1MSHA 1N32L 4GN5A 2IY5B 4KLKA 4A3GH 1S72A 4OXPA 5FLXL 1S5ED 3W1BA 3Q8DA 3I4NG 3KLSA 3U50C 2HHHQ 2K1BA 1IL8A 1NMGA 3S1NH 2H4OA 5M3FB 1U4LA 3S16B 4FXGC 3T4AC 1KNAA 4A3DB 4A3JB 3E0EA 1VQ7A 1VQJA 2WB1G 3CMEA 1VQFA 4G4KA 1PTOF 5M3FH 4P73A 1F2ZA 1QVCA 3HP3A 1LT4D 3HZXA 3S24A 3G7LA 1G2SA 1CZWA 1SLJA 4L8JA 4DV4L 2C35B 4XT3B 3M3YB 3S1MB 2TSSA 1E2WA 2AHOB 1NR4A 3BG3A 4PMCA 2JEAI 4LF9L 1V1PA 1TS3A 3K0XA 3BVMA 2Q8RE 4DR4L 1VQEA 3FHWA 1Y69U 2JEBI 1HZAA 1QE6A 3I91A 4WORA 5J39A 1QUQA 4G7OC 1AE3A 4DV6L 5K36H 2A6ED 4NW2A 4JBWA 1C8CA 2PW7A 1NTGA 2IT1A 3S1QB 2JA5B 1JT8A 1BXTA 2JA7G 1YNJD 1PYBA 1WCMH 3B6YA 1A2UA 4NXML 2NVTH 4APVA 1Q90A 3FVQA 4CDDC 4GN3B 2FINB 1K83H 3J7YW 4LFCL 4ABNA 3EQLC 4QB4A 3DWAA 4I7ZC 4A3FH 1I94L 4KY5A 1Q12A 1RD9D 5C44G 1XX8A 1LUZA 2OQ0A 2B2UC 4FDBA 2JA6H 2ENBA 1STNA 3CP0A 4A3EG 4RAUC 2CFMA 3AFPA 2CQAA 1LYLA 2B2TC 1QNKA 3K7UC 1HNZL 1KQSA 3OIQA 1S5BD 4YY3L 2R93G 3SK6A 3RN2A 1FL0A 4ILWA 1Z47A 3DEOA 3FDTA 1HFNA 1GUNA 5LMNW 1TWFH 4BY7B 1HNWL 4J8QA 3ZJYC 4OO1I 5ELBA 2RQXA 3FKIH 1DCZA 1EYDA 1UE5A 2PMZE 4RGMA 3Q22A 4EQ5A 2LSSA 3PF4A 2E2IB 1TT2A 3HOUG 2EOTA 1VQLA 1ASYA 5C0XJ 1YNNC 4GS3A 4PZ6A 3GP7A 1Q86C 2BE5C 2B39A 2F03A 3R3OA 1KDCA 1ONLA 1V1PB 2H5XA 3HOYH 3GTJH 4B08A 4JI6Q 2F0VA 4JYAL 3PO2G 3W1GA 4OELB 4CHTB 1I5FA 4IFDG 1J6QA 5JVG3 5C3XA 5LMUL 1QUQB 4F88A 1XNQQ 1D1IA 1MJEA 4IUQA 1ICWA 3NPPA 1NUCA 2Z6KA 2D5DA 5CORA 2PPBC 1FNVA 4R9WA 2AWOA 2AWNA 4OIJA 4BBSG 2F0JA 1S3OA 2EVBA 3X3NA 3NQIA 2F3VA 2A6HD 1IW7C 2Y0SG 1A8VA 1F2YA 2JA8H 5DEHA 4A3JG 2MUYA 5L37A 1Q1BA 1RKNA 1HTPA 4OGQC 3I3CA 2E2JB 1A3UA 3UDGA 2Z4IA 1AFPA 4X62L 4C3HH 4WRDA 1ZYRD 1MHWC 1PTOD 5IYCG 3VR3A 3S17B 3OMCA 3CKIB 3TP6A 4RMFA 4ALPA 1RL2A 2D62A 1IZ6A 4HMIA 1B53A 1L1OC 1TY2A 4P2CB 1Z7TA 2XGTA 1ESFA 4LFBQ 4DR1L 3D4DA 1HTLD 5HGQA 1FJGQ 4IPGA 4GLAC 1XWEA 3EN2A 1Q82C 3Q24A 2A5HA 3D8GA 1BCPD 2FFKB 3H09A 1U4PA 2R7DA 3E3XA 3GTQB 5EKLA 3RD4A 3NEMA 1Y8OB 3C1EA 1PYWD 3CPWA 4M1UB 2RDHA 4GNXC 4UP8A 1F2LA 2KHIA 4R8IA 4KD4A 4ME5A 3KFUA 2Z1CA 3BYYB 4FF4A 3GTKH 3CCEA 4EQPA 5FJ8H 2R7FA 1WFQA 1E22A 1A15A 2BDOA 4GZYC 5CMDA 1G51A 4LK1C 3T1YL 1YBYA 1EFID 3NQTA 5E4XA 3KLRA 2K50A 1OO9B 2VUMB 3S1RH 1XYIA 4O2DA 3SVMA 1VQ8A
chains in the Genus database with same CATH topology
1QNUA 3EVQA 2IW3A 4DU9A 4HSVA 3MXGA 2I07B 5EKKA 1AZQA 4A3KB 1GHJA 4KJNA 1TS4A 2L5TA 3M4YA 2PMZB 2E2HB 1I4XA 1GUOA 5IODA 2AQ3B 4XXEA 1C4QA 1CK1A 4XYQA 3NP8A 1PZKD 1PRTC 2HDMA 1PFNA 1H9SB 2EY5A 5M3MB 5C4XB 4HCSA 3I90A 1H9JA 5C5LA 4B9XA 1FYCA 5FKAC 1BR9A 3H94A 2F0KA 1DXMA 1DOLA 1O78A 1G291 1CHQD 3PUZA 4OO1G 1I3QB 1A3VA 4NP5A 4RGTA 5C0XG 2BDNA 3GTOB 3OSOA 2LMCB 4DAPA 4CGYB 1B2TA 1ZKOA 2KECA 3X3MA 4DF7A 3EFXD 2K5DA 5KNDA 3OMGA 4XT1B 5IGCA 2EYFA 2WINB 4BA2I 1S4ZA 5F2DA 2MPMA 3PUXA 1PTOH 1SAPA 1ENFA 5FO7B 1EZ6A 3CHBD 2ZXOA 3OW7A 5A2QL 4V190 3HOVB 2PZUA 3P1HA 2KOLA 4Q0FA 1QG7A 1BUVT 1E2VA 1F2MA 1QB5D 2PQEA 1HPCA 3Q23A 2B63B 4IUPA 3EA6A 2HCCA 2O2LD 4RGNA 4OHJA 4BBRB 2SOBA 1VDZA 3MFGA 2A69C 2I46A 3HG9A 1TY0A 1AEXA 1TR5A 2K7VA 4KHVA 1JC7A 1G91A 1TS5A 5ELFA 2IX1A 1FGBD 4HR7B 3VYUA 2F1MA 2GA4B 1PRTB 5A2QE 3FMCA 3C2PA 3KF8A 3PIO3 4ZKCB 2NWGA 1EY5A 2Q8IB 3P20A 3I4NB 1GXDC 2Z4HA 4K2LA 2EYJA 3K5NA 5E4WC 1B9MA 3MAQA 2WB1B 4RWSC 1EWCA 1QCBD 4FVMA 2L4NA 1ZXTA 3VA7A 1TQOA 2EJGC 3SXHA 4DXGA 3VYSA 3D3RA 3BYTB 2G9HD 1LTBD 1EYAA 5FO9B 3J81L 3V2TA 1DYQA 3RLFA 2IX0A 1Q3LA 4HCEA 2CHBD 2F0HA 3NTHA 2PZTA 3Q0AA 2XRQD 3M7GA 2F0TA 5IT9L 4NKLA 1DD2A 3S14B 1QJOA 1RDPD 2YYZA 1CQFA 2X6GA 4FF2A 2N88A 2O5IC 2KCCA 5I2XA 4WFN3 4BWGB 5JOBA 1SMYD 3KK7A 4XIGS 4DNRB 3C3LA 1DOKA 1HQRD 2AUKA 4ODGA 1WVLA 1EQVA 1W6JA 1DOMA 3OWFA 2B2WC 5M5WB 5C44B 1KLGD 1TWCB 2NUCA 2X6LA 1E2ZA 2QF7A 4F87A 1H9MA 2EPBA 3BS1A 5M9OA 4KJOA 3MC0B 1FNUA 3FRPB 3K7AB 1BDOA 2EYPA 1STGA 5D3IB 2R93B 4N9PA 1SNQA 3DEPA 1ET9A 4RGOS 2B2WA 3S2DB 3N6RA 4ZYSA 1IYUA 2H1EA 1BOSA 3FPPA 5DNFA 1EYCA 1HFGA 3K57A 5CV7A 2K03A 1LTAD 2PZWA 4S3SA 5CYUA 1QILA 2R3ZA 5EQ0A 1BF4A 2R6GA 1EIGA 3F2UA 2HUGA 4ID6A 1TS2A 3PO2B 2IL8A 2R7ZB 1V1OA 1D5MC 2PYKA 3I73A 5M5YB 3SK5A 4C3IG 4IFDH 2PCFB 2F0DA 1HA6A 3HKZB 5CGKA 2NYZD 4BBSB 1GHKA 3RZDB 4CJ2C 3BVGA 2Y0SB 1SYBA 5KIXA 3NE5B 3P7JA 2Q8TA 1KABA 4ZUJA 1SE4A 3QWNA 3L9AX 4L6TB 1WTXA 4KKSA 2EY2A 3A7LA 1V8QA 3UI2A 1GOZA 5EKIA 3K58A 2F0LA 3A56A 4CKBA 3GTLB 5JVH3 3MWYW 2TMPA 1W6KA 2RA4A 1EOTA 5I6WA 1JR0D 5KGUA 1JORA 2E75C 1I6HB 3MXUA 1EQTA 2OT2A 1PFBA 4LJZC 2AQ1B 4KY6A 2B8GA 1JWUD 4DK0A 4EGVA 4K5WA 3QB3A 4N9TA 2NN6G 1R9TB 1GUGA 3A54A 1ENAA 3SK4A 1DZ1A 2KHSA 1Y8NB 1PRTF 1DJRD 3VA5A 4EVOA 2RBMA 3PV0A 4DGZA 2KJXA 4J1MA 3NTIA 1Q1EA 1J9OA 3H91A 2CW0C 1YNND 2BE5D 2B2UA 4KV6A 2K33A 3K0YA 2CVRA 5C0XI 3GQBA 1LACA 2EY6A 4CBVA 3MXNA 2B2TA 1RJTA 2IWHA 1VMCA 3VR5A 3A8JE 1HRJA 4KKTA 2D9UA 1F9SA 5G3LF 5D14A 3S2HB 4OL7A 3M85A 1ESRA 2L1BA 1TWHB 1IW7D 3VYTA 2XSCA 1RODA 4A3IB 1Q8IA 3W3AA 4IURA 1EY6A 4QUCA 2B2YC 2L9HA 4OO1H 5KYLA 2O4XA 2IX3A 3TZDA 4ZAIA 2F0WA 4RFBA 1STHA 2HDLA 2EYOA 5HURA 3GD7A 3I4MB 1TWGB 3R8BA 4KD3A 3Q6SA 4OIKA 3KBXA 1H9SA 1PFMA 2AQ2B 1D1KA 3OPOA 1OXVA 1F9PA 1K8OA 2DN8A 2NVXB 2WP8J 5IIFA 2F0SA 1I50B 4E6IA 1A2TA 2QDBA 2A74C 1G8ZD 3HS0C 4KMUC 3HOZB 3OOCA 1SYDA 3HOXB 3P75A 2A73B 4FF3A 2Z8LA 1SYGA 3IAYA 1CA5A 5C5MA 4KK7A 1G6ZA 1HUNA 1NSNS 5LL6X 4RA8A 3J7AV 3K5OA 3NWTA 5I9OA 5T1GA 1KAAA 2N55A 4HSPA 1STEA 1KNEA 2XNAC 3V05A 2D2CC 2JYOA 4KTAA 1BQQT 4Y7NB 3RMHA 1E0BA 1MD2D 3NTKA 1R4PB 3C46A 3WOFA 1BCPC 4IUTA 4ZQ3A 5JEAH 5D3DA 5EBDA 1FNWA 1PDQA 3VR4A 3TDQA 1PRTD 2LKVA 2EYMA 2F0UA 5TSSA 5J22A 1RTOA 3HGBA 4DNTB 5CR3A 5E3FA 4C3JG 2F0QA 4H44C 2NB0A 5C4JB 1Y8PB 3OHXC 5I4DA 4C56C 4KHZA 3D6WA 2ID0A 1SYFA 2KVMA 2IPKD 1MI2A 1U4RA 2JSOA 3SE0A 3MVVA 4K2KA 4XQQA 3VYRA 4DAVA 1R4QB 3KBGA 1GUSA 4H7BA 1KLUD 3MEHA 1VCIA 1GUWA 1EY7A 3BZDB 3VR2A 4XTCS 4DXFA 2M9VA 4ZRZA 4V0BA 5I6YA 1ZEQX 4RH6A 4NDXA 4PV1C 4U673 4G7ZC 2OEOA 2F0GA 3IL8A 1TWAB 4C3HG 1OXUA 4ZK9B 3A8IE 1VMPA 4BS9A 4O42A 3SHLA 3RZOB 1ET6A 4YIJA 4PMBA 2A69D 1X3PA 2MHVA 1AW7A 4Q5VA 3T56B 1F9RA 2QEJC 1BO0A 2SNSA 3D6CA 1SEBD 4XQJA 2M00A 2XN9C 3D4WA 4HTHA 1EY9A 2EZVA 2NTTA 1SJED 1SDFA 1SSOA 1PXUA 1NAPA 1A3TA 2BOSA 2KA7A 4EQNA 4LMQD 2F0NA 3QJYA 5ELEA 4C3IB 3K59A 5FK9C 1T5EA 1F9QA 1JOKA 1STBA 4IUUA 2K32A 4EQOA 2AUJD 4RKLA 4CJ1B 5EJWA 4FF1A 1NR2A 2ICIA 1EEID 2LY7A 1WTOA 3DWPA 1D6EC 4K6LA 4X3SA 2R92B 2A68D 4A93B 3ITPA 3J80E 2KEDA 1LTRD 1SBBB 2WIIB 1OXXK 5CV4A 5I2YA 1JWSD 1O7YA 4H0LC 2NN6I 2MP1A 5E1FA 3T53B 1XTCD 3BVZA 3E6ZX 5C6AA 4IZ8A 4MIUA 4C1NI 3PO3B 1S5CD 1T5XD 2L55A 2DY7A 5J1ZA 1STAA 4C2MB 1J8IA 1DM0B 2PO4A 4ZLTF 3G6JB 2WKCA 1UAPA 1PLFA 5DM63 4AYBB 5JJZA 5KYIA 1SMYC 3K5MA 2RSOA 4XQNA 1LT6D 2L0CA 5M5XB 4HAEA 5FO8B 5ELDA 4FYDA 4O1NA 1EIHA 5ISRA 1KTKA 1IHZA 1CA6A 1JOQA 5KRUA 4FXKC 4A3MB 3MZ5A 1JWMD 1QWYA 3HOWB 3QG1A 2B2VC 3NHHA 4WJWA 2J7ZA 1Y1WB 1H9RA 3O13A 1SE2A 3PUYA 1CHPD 5JAVA 1JE4A 5K5PA 4IFDJ 1I4RA 3NUCA 2QKIC 1ML0D 3T13A 1G2TA 1GJXA 2K01A 3LNNA 2M2LA 4L63B 4ZUIA 2MJ8A 1HCZA 1EWHA 3M7NA 2LFNA 2XWBB 4FXDA 4IUVA 5JPMC 5C4HA 3S1NB 4ULLA 5DM73 1HXYD 2RKSA 5KNCA 5CV6A 2VNUD 3VR6A 1IKMA 1AP0A 4R8NA 4IALA 2C9OA 1CQVA 5C3EB 1I4PA 1GUTA 1X32A 1WD0A 1I4QA 2RVLA 1D2BA 3MXPA 2WV6D 2ZXPA 4G57A 4UDUC 2RDGA 2FMCA 4I65A 4HMJA 4G7HC 1BCPF 1WTPA 1WCMB 1ENCA 4K8IA 1MSGA 1LT3D 3D31A 2NVTB 2NTSA 4HEDA 5FLXE 2NZ1D 1K83B 1MGSA 4A3FB 1BBXC 3QIAA 2A6EC 1EY4A 4CKEA 3IFTA 2F3WA 4QCLA 2EJFC 4QMGA 2CW0D 5CV8A 1YNJC 1PZID 1SJHD 3T16A 2JA6B 1WTRA 5CC4A 2FJ2A 3GV6A 5D65A 3SEBA 4CJ0B 1CI3M 1OXSC 3KUPA 2KUMA 3E5SA 4IQZA 1B3AA 2EXZA 1TU2B 4C3JB 1KDBA 4QUFA 2F4IA 1TWFB 2BA0A 3DXJC 4PNYA 3SR1A 1HHVA 3KLSX 2KQ3A 3MFYA 2F0EA 4KN4C 5JPNC 5IGEA 3FKIB 3NSWA 5AFWA 1CFMA 2OF1A 2EYHA 1A6XA 1SXTA 1WD1A 5LL6S 1SNOA 3K5LA 5CV5A 1L0YB 2K04A 4TQUS 3HOYB 3ONAB 4CKCA 3GTJB 4KI0A 5CBAE 1NCVA 3I4LA 4IUNA 4DFAA 3MHBA 3AU7A 3SDZA 3U9SA 1TVXA 1EU4A 5C0XH 5HGTA 1BNZA 2C5CA 4IN3A 2O5JC 1JB3A 2PNRC 5LHY1 3K6OA 2DY8A 3I8ZA 1EU3A 1JQYD 2JA8B 3MTSA 3HRZC 5CBEE 5BN3A 4JK1C 2B2YA 2EY1A 2ZXRA 5BN4A 4C3HB 1RCVD 1I4GA 2WACA 3TP8A 2IJ0A 1UEAB 3DMUA 1M8AA 2K5WA 2A6HC 1QOHA 3SK8A 1JOOA 4KN7C 4DA2A 4F8MA 1VF5C 1WTQA 1AZPA 2K05A 1RF2D 1ZYRC 5K36G 5IOCA 2QILA 4B9WA 1PTOC 3FPUB 2G9DA 4C1NK 3OIPA 2L12A 2VXWA 4NMZA 3I70A 1LTSD 3GO5A 3R2TA 3NK9A 1IYVA 4XYOA 4PMWA 5NUCA 3GTKB 3S15B 3NWSA 1CTMA 5JEAJ 3BDOA 3ZYYX 1U4MA 4DN4M 4RKBA 2DNCA 1HUMA 1EY8A 1I6VC 2E74C 5IGGA 1B1ZA 3WOEA 1O7ZA 2DNEA 3DHQA 3S1RB 2SDFA 3J7AF 1FD7D 2K6AA 3W2DA 5BN5A 1EZ8A 2F0MA 3LWEA 3AB9A 4J6HA 1JICA 2E2DC 1ILQA 3GV3A 3CRLC 1U9RA 4MN3A 3L3OC 1JCKB 1STYA 2RDFA 1S5FD 2EJMA 4K5VA 3WDNA 5DAUA 5IGFA 4U68A 3D4RA 2J4XA 1XXGA 1PZJD 1IKLA 4X3UA 4XDXA 2FHTA 3ND9A 3DWQA 3DUZA 3H0GB 5COYA 3PIP3 3QO2A 3A8KE 1B9NA 1SYEA 2FMMA 5FOBB 4FO2A 1HQMC 1PMRA 5G3LD 5EPJA 3H3VC 2YU9B 1M4VA 1Y1VB 4Z9CB 5ELCA 3EROA 1RHPA 5A35A 3A7AB 4K5XA 2XIWA 2X69A 1LTTD 2RSNA 3TZUA 2HQEA 1HA5A 4A3BB 2EE1A 2B8FA 1C48A 1CM9A 2V4DA 1LTID 5IGBA 4TRDA 4KKUA 1O80A 3URYA 4K14A 1SFOB 1S5DD 2XVSA 1LO5D 2SEBD 2JE6I 3L7ZC 2EDGA 1PTOB 3NBIA 1ILPA 4K6DA 3U9OA 3IFDA 2WKDA 3PUWA 2PW5A 1UUPA 1LABA 1K8MA 3EJIA 1II3A 3TP7A 3GTPB 1X3QA 3NXWA 1BCPB 3R93A 5EGTA 2EYLA 2F0FA 1B4OA 1L0XB 1SNMA 2BCOA 2JP1A 3OWEB 4LAAA 4RHRA 3R2IA 2WAQB 2JXMB 2K28A 2XRSD 3J80L 3RUZA 2XWJB 4RHSA 1LLRD 4X3KA 3TBIB 2MGSA 3GTMB 4DK1A 3FEWX 1Z6HA 3IKJA 3CU7A 5JEAG 4RCOA 5EPKA 3TN2A 4QIWB 5KEEA 1I4HA 2HCIA 4UAIA 3JAML 1D5XC 4BA1I 1TIID 1WTWA 3PUVA 5C3WA 3AMUA 3GTGB 4X3TA 4FNFA 4MHEA 1EY0A 3M4OB 1O7LA 2F0PA 2VB3X 3S9WA 2ICEC 1LT5D 3T51B 3ND8A 4H13C 3PMFA 2LS01 2F0OA 3A55A 1LTGD 4PQXA 3C1FA 2ZT9C 3BDLA 4F7XA 2SNMA 2NBFA 3MA2B 3NBHA 3JAME 1V43A 2OXPA 3TMEA 2BA1A 3LWUA 3QOJA 5C4ZA 1CZGA 2L11A 4FP5D 2A68C 2JA7B 1AN8A 3HEJA 5CV9A 3N52A 1VF7A 1RTNA 3ERQA 1B50A 2NN6H 1DONA 1SYCA 1SE3A 1D5ZC 3DM1A 4TSSA 3TP5A 2J0TD 4RCNA 4K8JA 1SNCA 5IGDA 2R61A 5T1IA 1EL0A 4HN7A 3J81E 1KDAA 2KEEA 3I72A 5EPLA 4A3EB 3LX0A 5EBCA 5KNBA 2E76C 1MBYA 5IT9E 1F77A 2VB2X 2KCNA 4BY1B 1B44D 2F0IA 3TSSA 1CT1D 4IFDI 4TKOB 1EEFD 4M8AA 3BDCA 2NVQB 3CRKC 1FR3A 4QF4A 4ZKBB 1LV9A 1UNSA 2K5QA 2QCPX 3CQZB 2NVYB 3HOUB 5I9PA 1H9KA 2B2VA 3E0JA 3H6MA 4KY7A 4DAYA 1SNPA 1TKWB 1SNDA 1WTVA 3V96A 4A3GB 1OXTA 3QOLA 1MSHA 5FLXL 1S5ED 3KLSA 2K1BA 1IL8A 2H4OA 5M3FB 1U4LA 3S16B 4FXGC 3T4AC 1KNAA 4A3DB 4A3JB 4G4KA 1PTOF 1F2ZA 3HP3A 1LT4D 3HZXA 3G7LA 1G2SA 1CZWA 4L8JA 4XT3B 3M3YB 3S1MB 2TSSA 1E2WA 1NR4A 3BG3A 4PMCA 2JEAI 1V1PA 1TS3A 3BVMA 2Q8RE 1Y69U 2JEBI 1QE6A 3I91A 4WORA 5J39A 4G7OC 5K36H 2A6ED 4NW2A 4JBWA 1C8CA 2PW7A 2IT1A 3S1QB 2JA5B 1BXTA 1YNJD 1A2UA 1Q90A 3FVQA 2FINB 3J7YW 4ABNA 3EQLC 4QB4A 3DWAA 4I7ZC 4KY5A 1Q12A 1RD9D 1XX8A 2B2UC 2ENBA 1STNA 4RAUC 2CQAA 2B2TC 1QNKA 3OIQA 1S5BD 3SK6A 4ILWA 1Z47A 3DEOA 3FDTA 1HFNA 1GUNA 4BY7B 4J8QA 4OO1I 5ELBA 2RQXA 1DCZA 1EYDA 4RGMA 3Q22A 2E2IB 1TT2A 2EOTA 5C0XJ 1YNNC 3GP7A 2BE5C 2B39A 2F03A 3R3OA 1KDCA 1ONLA 1V1PB 4B08A 2F0VA 4CHTB 4IFDG 5JVG3 5C3XA 4F88A 1D1IA 4IUQA 1ICWA 3NPPA 1NUCA 2D5DA 5CORA 2PPBC 1FNVA 4R9WA 2AWOA 2AWNA 4OIJA 2F0JA 2EVBA 3X3NA 3NQIA 2F3VA 2A6HD 1IW7C 1F2YA 5DEHA 2MUYA 1Q1BA 1RKNA 1HTPA 4OGQC 3I3CA 2E2JB 1A3UA 2Z4IA 1AFPA 4WRDA 1ZYRD 1PTOD 3VR3A 3S17B 3OMCA 3CKIB 3TP6A 2D62A 4HMIA 1B53A 1TY2A 4P2CB 1Z7TA 1ESFA 3D4DA 1HTLD 1XWEA 3Q24A 2A5HA 3D8GA 1BCPD 2FFKB 3H09A 1U4PA 3GTQB 5EKLA 3RD4A 1Y8OB 3C1EA 1PYWD 4M1UB 2RDHA 1F2LA 4R8IA 4KD4A 4ME5A 2Z1CA 3BYYB 4FF4A 4EQPA 1A15A 2BDOA 4GZYC 5CMDA 4LK1C 1EFID 3NQTA 5E4XA 3KLRA 1OO9B 2VUMB 1XYIA 3SVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DON A;  2B2Y A;  2MGS A;  5EJW A;  4CJ1 B;  5COY A;  2KOL A;  4XT3 B;  2J7Z A;  2NZ1 D;  1HA6 A;  3QO2 A;  4HSV A;  1J9O A;  1NR2 A;  3DM1 A;  1QG7 A;  2NYZ D;  1MGS A;  3H91 A;  1NR4 A;  4RA8 A;  4CJ2 C;  2FMM A;  1WTO A;  5T1G A;  2N55 A;  1AZQ A;  2B2U A;  2X6G A;  1BBX C;  5EPJ A;  5T1I A;  2CVR A;  1EL0 A;  3P7J A;  2Q8T A;  2N88 A;  2Q8R E;  4X3S A;  1JE4 A;  1KNE A;  1RHP A;  4IUP A;  2XIW A;  1M8A A;  2KEE A;  1ICW A;  1QE6 A;  4IUQ A;  5EPL A;  1WTX A;  2B2T A;  1RJT A;  2HCC A;  2X69 A;  3I91 A;  5EPK A;  2JYO A;  1VMC A;  2RSN A;  3TN2 A;  3IL8 A;  2HCI A;  5COR A;  1WTR A;  4UAI A;  2EE1 A;  2KED A;  4NW2 A;  4R9W A;  2FJ2 A;  1DOK A;  4OIJ A;  1E0B A;  3GV6 A;  4ZK9 B;  1HRJ A;  1WVL A;  1C8C A;  1ML0 D;  5D65 A;  4CJ0 B;  1WTQ A;  1VMP A;  2K05 A;  2D9U A;  1AZP A;  1G2T A;  3KUP A;  2K01 A;  1DOM A;  1F9S A;  2B2W C;  1CM9 A;  2M2L A;  1O7Y A;  2KUM A;  1WTW A;  5D14 A;  4IUT A;  2HDM A;  1PFN A;  3UI2 A;  2MP1 A;  2MJ8 A;  1B3A A;  3FPU B;  1O80 A;  3I3C A;  4O42 A;  1PDQ A;  4X3T A;  1G91 A;  4HCS A;  3I90 A;  2L12 A;  2VXW A;  5EKI A;  4MHE A;  1ESR A;  2FIN B;  2L1B A;  4QUF A;  4ZKB B;  1X3P A;  1LV9 A;  4IUV A;  2X6L A;  1ROD A;  3MWY W;  1HHV A;  1F9R A;  4IUR A;  2EPB A;  4QUC A;  2B2Y C;  2RA4 A;  1BO0 A;  2L9H A;  1EOT A;  3SVM A;  1RTO A;  1DOL A;  5AFW A;  1B53 A;  1XX8 A;  2B2V A;  1U4M A;  3TZD A;  4ZAI A;  4DN4 M;  1ILP A;  1IKM A;  4ZKC B;  1WD1 A;  2NWG A;  1AP0 A;  1SDF A;  1HUM A;  2B2U C;  3DEP A;  2B2W A;  2HDL A;  3IFD A;  1SSO A;  1O7Z A;  2DY7 A;  1WTV A;  2BDN A;  1EQT A;  1J8I A;  2SDF A;  4RAU C;  2K04 A;  4ZLT F;  1NAP A;  2B2T C;  1MSH A;  1PFB A;  1QNK A;  2H1E A;  3D6W A;  3KBX A;  3ONA B;  3Q6S A;  4OIK A;  1X32 A;  5CBA E;  1PFM A;  2KVM A;  5E4W C;  1NCV A;  2FFK B;  1PLF A;  1WD0 A;  5DNF A;  1B2T A;  1U4P A;  2RVL A;  2KEC A;  3LWE A;  1F9P A;  1MI2 A;  1HFG A;  5JJZ A;  1JIC A;  4RWS C;  1U4R A;  1ILQ A;  2K03 A;  1TVX A;  4LMQ D;  3GV3 A;  3DEO A;  1X3Q A;  3FDT A;  2L4N A;  1ZXT A;  1HFN A;  3R93 A;  4XT1 B;  1F2L A;  4MN3 A;  4R8I A;  2K1B A;  2L11 A;  1BNZ A;  2R3Z A;  1IL8 A;  5EQ0 A;  1U4L A;  2RSO A;  1BF4 A;  1KNA A;  3F2U A;  1B4O A;  1EIG A;  2HUG A;  1S4Z A;  2JP1 A;  2DY8 A;  1DZ1 A;  4HAE A;  2MPM A;  3I8Z A;  1A15 A;  1GUW A;  4U68 A;  1F9Q A;  1SAP A;  3N52 A;  2IL8 A;  5CMD A;  2K28 A;  2EOT A;  1EIH A;  4IUU A;  1WTP A;  3HP3 A;  5E4X A;  3MTS A;  1CA5 A;  1CA6 A;  1MSG A;  1Q3L A;  1IKL A;  1RTN A;  3G7L A;  4X3U A;  4XDX A;  1G6Z A;  4X3K A;  1G2S A;  2FHT A;  5CBE E;  1B50 A;  4HED A;  1HUN A;  1XYI A;  2B2V C; 
#chains in the Genus database with same CATH topology
 1QNU A;  3EVQ A;  2IW3 A;  4DU9 A;  4HSV A;  4GNX A;  5IY0 A;  3MXG A;  1A63 A;  2I07 B;  4OX9 Q;  2F52 A;  5EKK A;  1AZQ A;  4X65 L;  3L2P A;  4A3K B;  1GHJ A;  4KJN A;  4UHV A;  1TS4 A;  2L5T A;  3M4Y A;  3KLW A;  2UUA Q;  2PMZ B;  1KL9 A;  2E2H B;  1I4X A;  3NEN A;  1GUO A;  5IOD A;  1SE8 A;  1U5K A;  4B3M Q;  1S40 A;  2AQ3 B;  4LF4 Q;  4XXE A;  1C4Q A;  3PIP A;  1CK1 A;  4XYQ A;  1SR3 A;  3NP8 A;  1PZK D;  1PRT C;  2K4K A;  3UE0 A;  2HDM A;  1PFN A;  1H9S B;  2EY5 A;  1K3R A;  5M3M B;  5C4X B;  4HCS A;  3I90 A;  1HR0 W;  1E1O A;  1H9J A;  3H0G H;  5C5L A;  4B9X A;  1FYC A;  2JQO A;  5FKA C;  2VS1 A;  3AYH B;  1BR9 A;  3H94 A;  3K8A A;  2DJF C;  2F0K A;  3J7Z C;  1DXM A;  1DOL A;  1O78 A;  4JC0 A;  1G29 1;  4GKK L;  1CHQ D;  4LF7 Q;  4HIK A;  1BBW A;  1IYJ B;  3PUZ A;  4OO1 G;  4A3B H;  1I3Q B;  1A3V A;  4NP5 A;  4RGT A;  5C0X G;  2BDN A;  3GTO B;  3OSO A;  2LMC B;  4DAP A;  4CGY B;  2DUD A;  3MEF A;  1B2T A;  1ZKO A;  4JG2 A;  2KEC A;  3GTO H;  1HNX Q;  4BXX H;  3X3M A;  4DF7 A;  3EFX D;  1VS0 A;  2K5D A;  5KND A;  3OMG A;  4XT1 B;  5IGC A;  1XPU A;  1SFO H;  4GKJ Q;  2EYF A;  2WIN B;  3I4M G;  4BA2 I;  1S4Z A;  3M4Q A;  5F2D A;  1Q81 C;  1P16 A;  2MPM A;  2NZO A;  1PTO H;  1SAP A;  3PUX A;  1ENF A;  5FO7 B;  1E3P A;  1EZ6 A;  3CHB D;  2ZXO A;  4GNX B;  3OW7 A;  4LF6 L;  5A2Q L;  4V19 0;  3HOV B;  2PZU A;  3P1H A;  4JW0 A;  2KOL A;  4Q0F A;  1QG7 A;  3HOZ G;  1BUV T;  1E2V A;  1N34 Q;  1F2M A;  1QB5 D;  5AJ3 Q;  2PQE A;  1HPC A;  4JI8 L;  1GM5 A;  3Q23 A;  2B63 B;  3GTP H;  4IUP A;  3SGI A;  3EA6 A;  4AYB E;  2HCC A;  3H15 A;  1M1K C;  2O2L D;  4RGN A;  5BR8 L;  4OHJ A;  4O0A A;  4BBR B;  2SOB A;  1VQB A;  3RN5 A;  5JJI A;  1VDZ A;  3MFG A;  2VQE Q;  2K5V A;  2A69 C;  2I46 A;  4A3C G;  1W2B A;  3HG9 A;  1TY0 A;  1AEX A;  3PQI A;  1TR5 A;  2K7V A;  4KHV A;  3FP9 A;  1JC7 A;  1KC8 C;  2VL6 A;  3I2Z A;  1G91 A;  4JI0 L;  1GVP A;  1TS5 A;  5ELF A;  1JMC A;  2IX1 A;  3GTM H;  1FGB D;  2VUM G;  2IHE A;  4HR7 B;  4DUZ L;  3VYU A;  2F1M A;  1HR0 L;  2GA4 B;  3CCQ A;  1PRT B;  5A2Q E;  3I56 A;  3FMC A;  4JI2 Q;  1OTC A;  4IJH A;  1VQK A;  3C2P A;  3KF8 A;  3PIO 3;  3K80 C;  4ZKC B;  2NWG A;  1NE3 A;  1EY5 A;  2Q8I B;  4A3K G;  3P20 A;  3I4N B;  1GXD C;  1IBL L;  4LW1 A;  2Z4H A;  4Y52 H;  4K2L A;  5LMN Q;  2EYJ A;  4N8F A;  1IXR A;  3H3V H;  3A0J A;  3K5N A;  5E4W C;  1B9M A;  3MAQ A;  2WB1 B;  4POF A;  2ZJR A;  3GTG H;  4RWS C;  1EWC A;  1QCB D;  1N9W A;  4DPG A;  4FVM A;  3HKZ E;  3M4O H;  3U58 A;  2L4N A;  1ZXT A;  3VA7 A;  1TQO A;  5GQO A;  4DV2 L;  2EJG C;  1X54 A;  3SXH A;  3VYS A;  4DXG A;  5M3M G;  2MO1 A;  3D3R A;  3BYT B;  2G9H D;  1PH1 A;  1N33 L;  2N78 A;  1LTB D;  3DM3 A;  1EYA A;  3PGZ A;  3OTO L;  5FO9 B;  2L15 A;  3V2T A;  1DYQ A;  3J81 L;  3RLF A;  2IX0 A;  1Q3L A;  4HCE A;  2UUC Q;  2CHB D;  1IBK Q;  1V1Q A;  2F0H A;  2FXQ A;  3NTH A;  2PZT A;  3Q0A A;  2XRQ D;  3M7G A;  3T1H L;  2F0T A;  4LFA Q;  4NKL A;  5IT9 L;  1DD2 A;  2QW7 A;  3S14 B;  1QJO A;  1RDP D;  2YYZ A;  1HZB A;  2ZJP A;  1CQF A;  2X6G A;  4MTK A;  4FF2 A;  2N88 A;  2O5I C;  2KCC A;  5I2X A;  1X3G A;  4WFN 3;  2MO0 A;  2QGQ A;  4BWG B;  4IOC A;  4B3T L;  5JOB A;  1SMY D;  2UXD L;  2JA7 H;  3HFZ B;  3KK7 A;  4XIG S;  1VQ4 A;  4DNR B;  4YHH Q;  3C3L A;  2CH4 A;  1DOK A;  1HQR D;  2AUK A;  4LUZ A;  4ODG A;  1WVL A;  1X65 A;  1EQV A;  1W6J A;  1EIF A;  1DOM A;  3OWF A;  1N36 L;  2B2W C;  5M5W B;  5C44 B;  1KLG D;  2UXC Q;  4QGU A;  3J80 i;  1TWC B;  2NUC A;  4IO9 A;  2X6L A;  1E2Z A;  2QF7 A;  4F87 A;  1H9M A;  2EPB A;  3BS1 A;  3KF8 B;  5M9O A;  3MC0 B;  1FNU A;  3FRP B;  4KJO A;  3K7A B;  1BDO A;  2EYP A;  1STG A;  3W5O A;  5D3I B;  2R93 B;  4UY8 C;  4N9P A;  4A3E H;  1SNQ A;  2Z9H A;  3DEP A;  1ET9 A;  4RGO S;  2B2W A;  3S2D B;  2B63 G;  1C9O A;  2HD3 A;  3N6R A;  2F4V L;  2XTI A;  1WOC A;  4ZYS A;  3JAM i;  1U0L A;  1IYU A;  2H1E A;  4BBR G;  4LF8 Q;  1BOS A;  3FPP A;  5DNF A;  2E5L Q;  1XMQ Q;  1EYC A;  1PFS A;  2IHF A;  1HFG A;  3K57 A;  5CV7 A;  1WYD A;  2NVQ H;  2K03 A;  1LTA D;  1NMF A;  2PZW A;  4S3S A;  4TVA B;  5CYU A;  1QIL A;  2JK8 A;  4JI6 L;  2R3Z A;  5EQ0 A;  2NZH A;  1BF4 A;  2NVY H;  3HOU H;  2R6G A;  1EIG A;  3F2U A;  4OWX B;  2HUG A;  3CCM A;  4ID6 A;  4KHP Q;  5DLQ E;  1TS2 A;  3RR5 A;  3PO2 B;  5GAD C;  1YIJ A;  2IL8 A;  2N3S A;  3A5U A;  2R7Z B;  2N8N A;  1V1O A;  1T9H A;  1D5M C;  2PYK A;  3I73 A;  1WTH A;  5M5Y B;  3SK5 A;  3TS2 A;  4C3I G;  4IFD H;  2PCF B;  2F0D A;  1HA6 A;  3HKZ B;  5CGK A;  2NYZ D;  4BBS B;  4JI1 Q;  3ICE A;  1GHK A;  3RZD B;  4CJ2 C;  2B29 A;  3BVG A;  2Y0S B;  1SYB A;  4L5Q A;  3NE5 B;  5KIX A;  4X66 Q;  3P7J A;  2Q8T A;  1KAB A;  4AQY Q;  4YWM A;  4ZUJ A;  1SE4 A;  1B7Y B;  3QWN A;  3L9A X;  4L6T B;  1WTX A;  1C0A A;  4KKS A;  3S16 H;  4DR5 Q;  4A3D H;  4R4T A;  4A3J H;  4DR6 Q;  1E7Z A;  2K5N A;  2EY2 A;  3A7L A;  1V8Q A;  4JV5 Q;  4LFB L;  3UI2 A;  2R92 G;  4AH6 A;  1GOZ A;  5IYC H;  5EKI A;  3K58 A;  3M3Y H;  3S1M H;  4DV7 Q;  2F0L A;  1VQI A;  3A56 A;  4CKB A;  5JVH 3;  3GTL B;  3MWY W;  2OCE A;  2TMP A;  1W6K A;  2RA4 A;  1EOT A;  5I6W A;  3A5Z B;  4X64 Q;  3CCL A;  1JR0 D;  2I0Q A;  1H95 A;  3CCV A;  5KGU A;  2ZTE A;  1JOR A;  4MZ9 A;  2E75 C;  1AH9 A;  1I6H B;  1ICF B;  3MXU A;  1EQT A;  2OT2 A;  3S1Q H;  2JA5 H;  1PFB A;  4LJZ C;  1XJV A;  2AQ1 B;  1IL2 A;  4KY6 A;  2B8G A;  1JWU D;  2Z6B A;  3PO3 G;  4DR7 Q;  4DK0 A;  4EGV A;  4K5W A;  3QB3 A;  4DV3 L;  4N9T A;  2NN6 G;  1R9T B;  1GUG A;  3A54 A;  1ENA A;  1YJW A;  3AFQ A;  3SK4 A;  1DZ1 A;  4B3R L;  4LUV A;  2KHS A;  1Y8N B;  5GRO A;  1PRT F;  1K9M C;  1DJR D;  3VA5 A;  4AYB G;  2Q2U A;  4EVO A;  2RBM A;  4HJ8 A;  4YWK A;  3PV0 A;  4DGZ A;  2KJX A;  1TXY A;  1A62 A;  4J1M A;  3NTI A;  1Q1E A;  1J9O A;  3H91 A;  1KHI A;  3TRZ A;  1X3E A;  2CW0 C;  1YNN D;  1SMX A;  2BE5 D;  2B2U A;  4KV6 A;  2K33 A;  4DUY Q;  3K0Y A;  1UE6 A;  2CVR A;  4QJF A;  5C0X I;  4A3M G;  5IWA L;  3GQB A;  4BY7 H;  3HOW G;  1LAC A;  4JI4 Q;  4GOP C;  2EY6 A;  4CBV A;  2EXD A;  3MXN A;  2B2T A;  1RJT A;  2I5L X;  3I4O A;  2EQS A;  2IWH A;  1VMC A;  3VR5 A;  3A8J E;  1HRJ A;  4KKT A;  2D9U A;  2E2I H;  3D0F A;  1F9S A;  2VY3 A;  1CKM A;  5G3L F;  5D14 A;  4NXN Q;  3RNU A;  3S2H B;  2HQL A;  4OL7 A;  2R7Z G;  3M85 A;  1ESR A;  3PCO B;  2L1B A;  1TWH B;  1IW7 D;  4LUO A;  3VYT A;  2XSC A;  1ROD A;  4A3I B;  1Q8I A;  3W3A A;  1HNX L;  4IUR A;  2CCZ A;  1PYS B;  1EY6 A;  4QUC A;  5IYD H;  1PH7 A;  2B2Y C;  2L9H A;  3HKZ G;  4OO1 H;  5KYL A;  2O4X A;  5IYB H;  3UDI A;  2IX3 A;  3TZD A;  3CD6 A;  4ZAI A;  2F0W A;  4RFB A;  1STH A;  2MFI A;  2HDL A;  3KF6 B;  2EYO A;  5HUR A;  1PVO A;  3GD7 A;  3I4M B;  1SRO A;  1FGU A;  1TWG B;  3R8B A;  1K28 A;  4KD3 A;  3Q6S A;  4OIK A;  1FVI A;  4JI7 L;  3KBX A;  1H9S A;  1PFM A;  2AQ2 B;  1D1K A;  3OPO A;  2E2J H;  1N32 Q;  1OXV A;  1F9P A;  4IPC A;  2DN8 A;  5HY6 A;  1K8O A;  2NVX B;  2WP8 J;  1C7Y A;  5IIF A;  2F0S A;  1I50 B;  3F2C A;  4E6I A;  3I7F A;  4DV1 L;  1N34 L;  1A2T A;  2QDB A;  5C3E G;  2A74 C;  3S17 H;  1G8Z D;  3HS0 C;  4KMU C;  3HOZ B;  3OOC A;  1SYD A;  3HOX B;  3P75 A;  1YJN A;  2A73 B;  2ASB A;  4AIM A;  4FF3 A;  2Z8L A;  1SYG A;  3IAY A;  1CA5 A;  1CKN A;  4QL5 A;  5C5M A;  4KK7 A;  3HOZ H;  1G6Z A;  1HUN A;  1NSN S;  5LL6 X;  4RA8 A;  3J7A V;  3K5O A;  3NWT A;  1XNR Q;  1QVF A;  1L1O A;  2HT1 A;  5I9O A;  5T1G A;  1KAA A;  2N55 A;  3TEH B;  2ZM6 L;  4A76 A;  3GTQ H;  2CQO A;  3MXN B;  4HSP A;  1STE A;  2UUB L;  1KNE A;  2XNA C;  3V05 A;  2D2C C;  1XPR A;  4IPD A;  4GLV B;  2JYO A;  4KTA A;  1BQQ T;  4Y7N B;  3RMH A;  4DV6 Q;  3U4V A;  1E0B A;  1MD2 D;  4A4I A;  3NTK A;  1R4P B;  3C46 A;  4A3F G;  3VDY A;  3KJP A;  1GKH A;  3KYH C;  3WOF A;  3CCJ A;  1BBU A;  1BCP C;  4IUT A;  2VUM H;  4ZQ3 A;  5JEA H;  5D3D A;  5EBD A;  1FNW A;  3ER0 A;  4POG A;  1PDQ A;  4NXM Q;  2WAQ E;  2UXB Q;  4YCV A;  4GOP B;  3VR4 A;  2JA6 G;  1B3Q A;  3TDQ A;  3J7A 5;  1PRT D;  2LKV A;  1LM0 A;  1VQH A;  2EYM A;  4LF5 L;  2F0U A;  5E7N A;  5TSS A;  5J22 A;  4A3K H;  1RTO A;  2RF4 A;  4DR3 Q;  3HGB A;  4DNT B;  5CR3 A;  3IRB A;  5E3F A;  2CH4 W;  4A75 A;  4DR2 L;  2E2H H;  3JC6 6;  2F0Q A;  4C3J G;  2GN5 A;  5IE8 A;  1IBM L;  1VQ5 A;  4H44 C;  4NB3 A;  2NB0 A;  5C4J B;  1Y8P B;  3BZC A;  3OHX C;  5I4D A;  1YIT A;  4C56 C;  4KHZ A;  3D6W A;  2ID0 A;  2VQF L;  1SYF A;  4DV5 L;  2KVM A;  1HNZ Q;  3FKI G;  2IPK D;  1IBK L;  5C4J H;  4B3S L;  1MI2 A;  5C4X H;  5M3M H;  4YY3 Q;  1U4R A;  2JSO A;  3SE0 A;  4LFA L;  3MVV A;  5IP9 H;  1K8A C;  3L0O A;  4JVZ A;  3J80 c;  3UDX A;  4K2K A;  4XQQ A;  3VYR A;  4DAV A;  1HNW Q;  1R4Q B;  3KBG A;  1X6O A;  1GUS A;  3UE1 A;  4H7B A;  2UU9 L;  4P75 A;  1KLU D;  3KJO A;  3MEH A;  1VCI A;  2YTV A;  4A3I G;  1GUW A;  1CKN B;  1EY7 A;  3CF5 A;  2YTY A;  3BZD B;  1I3Q H;  3VR2 A;  4XTC S;  1L1O B;  1YHA A;  4JBK A;  2A8V A;  4QY7 A;  2BH2 A;  4DXF A;  2M9V A;  4ZRZ A;  4V0B A;  4JYA Q;  5I6Y A;  1PH9 A;  3F1Z A;  1UE1 A;  1ZEQ X;  4RH6 A;  4NDX A;  4PV1 C;  4U67 3;  5LMU Q;  4G7Z C;  1PH5 A;  2OEO A;  2RHS B;  2F0G A;  1JJC B;  1XTD A;  2OTL A;  3IL8 A;  1TWA B;  4C3H G;  1XMO L;  1OXU A;  4ZK9 B;  3A8I E;  1VMP A;  4BS9 A;  2YTX A;  3HOX G;  2HIX A;  4O42 A;  3CMA A;  3HOV H;  3SHL A;  3RZO B;  1ET6 A;  2K5H A;  4YIJ A;  4PMB A;  2A69 D;  1X3F A;  1X3P A;  2MHV A;  4X62 Q;  1AW7 A;  1YI2 A;  4Q5V A;  3T56 B;  2E5L L;  1F9R A;  2QEJ C;  1Q46 A;  1BO0 A;  1VQ9 A;  2B63 H;  2SNS A;  3D6C A;  1SEB D;  4XQJ A;  2M00 A;  4DK6 C;  2XN9 C;  4JI3 Q;  3D4W A;  4HTH A;  4R1J A;  1EY9 A;  2EZV A;  4LNQ A;  2NTT A;  1SJE D;  1SDF A;  1YHQ A;  2KHJ A;  4KHP L;  1SSO A;  4BBR H;  4DR1 Q;  1PXU A;  1NAP A;  1A3T A;  2BOS A;  1VQD A;  5FJ8 G;  2DJG C;  2KA7 A;  4EQN A;  4LMQ D;  1VQO A;  4EX5 A;  2HHH L;  2F0N A;  3PIO A;  3QJY A;  1Z9F A;  4CDC C;  5ELE A;  4C3I B;  3K59 A;  5FK9 C;  4AQY L;  1T5E A;  1GD7 A;  1F9Q A;  1JOK A;  1STB A;  4C3I H;  3CXC A;  2K75 A;  4IUU A;  3T1Y Q;  4JBM A;  2A19 A;  2K32 A;  3I4N H;  4DR6 L;  4JI5 Q;  4EQO A;  2AUJ D;  4RKL A;  2CWP A;  4PG3 A;  4CJ1 B;  5EJW A;  4FF1 A;  1NR2 A;  4JV5 L;  3F8T A;  2ICI A;  2AKW B;  1EEI D;  2LY7 A;  1WTO A;  1UWV A;  3DWP A;  1D6E C;  1K73 C;  4K6L A;  4X3S A;  2B3G A;  4DV7 L;  2R92 B;  1J5E Q;  4UP9 A;  2A68 D;  3H0G G;  4A93 B;  3ITP A;  3AQQ A;  3J80 E;  2KED A;  4X64 L;  1LTR D;  1SBB B;  2WII B;  1OXX K;  3I55 A;  5CV4 A;  5I2Y A;  1JWS D;  1Y1V G;  4R4C A;  1O7Y A;  4H0L C;  4UPA A;  2NN6 I;  2MP1 A;  5E1F A;  3T53 B;  2PI2 E;  2P5Z X;  1B70 B;  3S14 H;  3ULJ A;  4JPB W;  1EQQ A;  1PV4 A;  1XTC D;  3BVZ A;  3E6Z X;  4QQB X;  3BZK A;  5H1S E;  4IPH A;  5C6A A;  4IZ8 A;  3STB C;  4MIU A;  3CCR A;  4C1N I;  3PO3 B;  4GKK Q;  4DK3 C;  4WJ4 A;  1NJI C;  1S5C D;  5FLX c;  1T5X D;  2L55 A;  2DY7 A;  5J1Z A;  1NBW A;  1STA A;  4C2M B;  1J8I A;  1DM0 B;  2PO4 A;  3E9H A;  4ZLT F;  4IJL A;  3G6J B;  2ZTC A;  1RIP A;  2WKC A;  5M5W H;  1UAP A;  5C44 H;  1PLF A;  5DM6 3;  3G71 A;  2Q2T A;  2KEN A;  4AYB B;  5JJZ A;  2MNA A;  3F2D A;  5IP7 G;  2PQA B;  1TWC H;  2PNH A;  3CPF A;  4L5S A;  1VQ6 A;  5KYI A;  2GVA A;  4CDE C;  1SMY C;  3K5M A;  2RSO A;  1EOV A;  4XQN A;  1LT6 D;  3UDF A;  2L0C A;  2VW9 A;  5M5X B;  3K7A H;  4HAE A;  5FO8 B;  5ELD A;  2R93 H;  4FYD A;  4O1N A;  1EIH A;  5ISR A;  3S2D H;  1KTK A;  1IHZ A;  1CA6 A;  1JOQ A;  5KRU A;  4FXK C;  4A3M B;  1KXL A;  3MZ5 A;  1JWM D;  1QWY A;  1EFW A;  3HOW B;  4LF6 Q;  3QG1 A;  3M4P A;  2B2V C;  3NHH A;  4WJW A;  1MKH A;  2J7Z A;  1Y1W B;  1H9R A;  4A3M H;  3O13 A;  1SE2 A;  3PUY A;  3HOW H;  4X6A H;  1CHP D;  5JAV A;  2WAQ G;  4OEM B;  2Q2H A;  2RCF A;  1UEB A;  3KDF B;  1XNQ L;  1JE4 A;  5K5P A;  4IFD J;  1I4R A;  3NUC A;  1AE2 A;  3CCS A;  2QKI C;  2HIV A;  3PO2 H;  1ML0 D;  3T13 A;  4A3L G;  1G2T A;  1GJX A;  2R7Z H;  2K01 A;  4K0K Q;  3LNN A;  2M2L A;  4L63 B;  3J81 i;  4DNI A;  4ZUI A;  2MJ8 A;  5M5Y H;  1HCZ A;  1EWH A;  3M7N A;  1JB7 A;  2LFN A;  4JI0 Q;  1V9P A;  2XWB B;  4FXD A;  4IUV A;  4BBS H;  2VZA A;  5JPM C;  5C4H A;  3RZD H;  3S1N B;  3G4S A;  4DUZ Q;  1HR0 Q;  4ULL A;  4WJ3 M;  3U4Z A;  5DM7 3;  1HXY D;  2RKS A;  5KNC A;  5CV6 A;  2VNU D;  3VR6 A;  1IKM A;  1AP0 A;  4R8N A;  5ELO A;  2CKZ B;  4IAL A;  2C9O A;  1IBL Q;  1FJG L;  4DV0 Q;  1CQV A;  5C3E B;  1I4P A;  1GUT A;  1HH2 P;  2K52 A;  4A93 G;  1X32 A;  1VQG A;  1WD0 A;  1I4Q A;  2RVL A;  1D2B A;  3MXP A;  2WV6 D;  2ZXP A;  4JBJ A;  5C3E H;  4G57 A;  4UDU C;  2RDG A;  1E24 A;  1XNR L;  3GTL H;  1B8A A;  4DV2 Q;  2FMC A;  4I65 A;  1KRS A;  2V1C C;  1K0R A;  1N33 Q;  4HMJ A;  4G7H C;  3OTO Q;  1BCP F;  3KF6 A;  1WTP A;  1WCM B;  3BU2 A;  1ENC A;  4K8I A;  1MSG A;  1I6H H;  1LT3 D;  3D31 A;  2NVT B;  4P74 A;  2NTS A;  4HED A;  4HJA A;  1NNX A;  5FLX E;  2NZ1 D;  1K83 B;  3T1H Q;  1MGS A;  4OX9 L;  5FLM G;  2UXB L;  1LTL A;  4A3F B;  2D0P A;  1BBX C;  4N8X 1;  3QIA A;  2A6E C;  1EY4 A;  4CKE A;  3IFT A;  2F3W A;  2UUA L;  4QCL A;  2EJF C;  4QMG A;  2CW0 D;  5CV8 A;  1YNJ C;  1PZI D;  1SJH D;  4B3T Q;  3KOJ A;  3T16 A;  1R9T H;  2JA6 B;  2UXD Q;  1WTR A;  4DR3 L;  5CC4 A;  3OYY A;  4L5T A;  1YZ6 A;  1PH6 A;  2FJ2 A;  4B3M L;  4HIO A;  4DAY B;  4LF4 L;  3GV6 A;  5D65 A;  3SEB A;  4CJ0 B;  1CI3 M;  1OXS C;  4UP7 A;  3KUP A;  1KAW A;  1KIX A;  1N36 Q;  2KUM A;  3E5S A;  4IQZ A;  1B3A A;  1Q8K A;  2EXZ A;  1TU2 B;  4C3J B;  1KDB A;  1K0S A;  4QUF A;  3CC2 A;  3M9B A;  2F4I A;  4LWC A;  1TWF B;  2BA0 A;  1G6P A;  3DXJ C;  4PNY A;  3SR1 A;  1HHV A;  3KLS X;  2KQ3 A;  2YV5 A;  3MFY A;  3NEL A;  4C3J H;  2F0E A;  4KN4 C;  5JPN C;  4R4I A;  5IGE A;  1Y1W G;  3FKI B;  3NSW A;  4BY1 G;  5AFW A;  2ZTD A;  1CFM A;  2OF1 A;  2EYH A;  4LF7 L;  1A6X A;  4GN4 B;  1SXT A;  3A74 A;  4J15 A;  4R4O A;  1WD1 A;  5LL6 S;  1SNO A;  2F4V Q;  3K5L A;  5CV5 A;  1L0Y B;  2K04 A;  4TQU S;  3HOY B;  2EIF A;  3ONA B;  2Z6K C;  2KBN A;  3BJU A;  4CKC A;  2QA4 A;  3GTJ B;  4KI0 A;  5CBA E;  1NCV A;  3PSI A;  3I4L A;  4IUN A;  4DFA A;  4GOP A;  3MHB A;  3AU7 A;  3S2H H;  2GVB A;  1EWI A;  3SDZ A;  1KRT A;  3U9S A;  1TVX A;  1D7Q A;  1EU4 A;  1TWH H;  2LXJ A;  5C0X H;  4YCW A;  5HGT A;  4GKJ L;  4A3I H;  1QVG A;  1BNZ A;  4A3G G;  1UE7 A;  2C5C A;  4IN3 A;  2O5J C;  1JB3 A;  2PNR C;  5LHY 1;  3K6O A;  1QZH A;  2DY8 A;  2ATW A;  3I8Z A;  1HZ9 A;  1EU3 A;  1JQY D;  2JA8 B;  1EUJ A;  3MTS A;  4PZ8 A;  3HRZ C;  1YNX A;  4ZCK A;  3I4M H;  5CBE E;  1JE5 A;  3CAM A;  1TWG H;  2B2Y A;  4JK1 C;  5BN3 A;  1XPO A;  5M3F G;  2EY1 A;  4A3D G;  2I5H A;  2ZXR A;  1P8L A;  5BN4 A;  4C3H B;  1RCV D;  1I4G A;  4JCV E;  5AJ3 L;  2NVX H;  2WAC A;  1WI5 A;  3TP8 A;  3OW2 A;  2IJ0 A;  1I50 H;  1UEA B;  3DMU A;  1M8A A;  2K5W A;  2A6H C;  1QOH A;  3SK8 A;  5GAE C;  1M90 C;  1JOO A;  4KN7 C;  4DA2 A;  4JI3 L;  3HOX H;  4F8M A;  1VF5 C;  3J81 j;  1WTQ A;  1AZP A;  2VQE L;  2K05 A;  4HID A;  2QDL A;  1KD1 C;  4DV4 Q;  1RF2 D;  2ZJQ A;  4OWW B;  1ZYR C;  5K36 G;  5IOC A;  2QIL A;  2AMC B;  4B9W A;  1PTO C;  3EIV A;  3FPU B;  2G9D A;  4LF9 Q;  4C1N K;  3OIP A;  4JOI C;  2L12 A;  2VXW A;  1N8R C;  4NMZ A;  1WCM G;  3I70 A;  4DR4 Q;  1LTS D;  3GO5 A;  3R2T A;  3ULL A;  2WFW A;  3NK9 A;  2BH8 A;  5JJL A;  1IYV A;  4XYO A;  4PMW A;  2JA5 G;  2JJQ A;  5NUC A;  4A3C H;  3GTK B;  1DGS A;  3S15 B;  3NWS A;  1CTM A;  4H02 A;  5JEA J;  4JI2 L;  3BDO A;  3ZYY X;  3GDE A;  2ES2 A;  1CKO A;  1U4M A;  4DN4 M;  4RKB A;  4DAM A;  2DNC A;  1HUM A;  1EY8 A;  1I6V C;  2E74 C;  5IGG A;  4Y7N H;  3S15 H;  1B1Z A;  3WOE A;  1O7Z A;  2DNE A;  3DHQ A;  5LMN L;  3S1R B;  2SDF A;  4JOI A;  4ME3 A;  4R4Q A;  3J7A F;  2N49 A;  1FD7 D;  1PH4 A;  2K6A A;  4LFC Q;  3W2D A;  5BN5 A;  1EZ8 A;  4JI5 L;  1EQR A;  2F0M A;  3LWE A;  3AB9 A;  4J6H A;  1I94 Q;  1JIC A;  2E2D C;  1ILQ A;  3GV3 A;  1X56 A;  3CRL C;  4P72 A;  1U9R A;  4MN3 A;  4DV3 Q;  1Q7Y C;  3L3O C;  1JCK B;  4HIM A;  1STY A;  2RDF A;  1S5F D;  2EJM A;  4K5V A;  4L5R C;  3WDN A;  5DAU A;  5IGF A;  1HJP A;  1J5E L;  4U68 A;  1VQM A;  4B3R Q;  2I5M X;  4QIW E;  3D4R A;  2J4X A;  1XXG A;  1PZJ D;  2UUC L;  1W3S A;  1IKL A;  4X3U A;  4XDX A;  4BY7 G;  2FHT A;  1JJG A;  3ND9 A;  3DWQ A;  4MNO A;  3DUZ A;  3H0G B;  5COY A;  3PIP 3;  3QO2 A;  3A8K E;  1B9N A;  1SN8 A;  1EYG A;  1MJC A;  1SYE A;  2FMM A;  1A0I A;  5FOB B;  4FO2 A;  1HQM C;  1PMR A;  5G3L D;  2Q2I A;  4P71 A;  5EPJ A;  3H3V C;  3HOY G;  2YU9 B;  1M4V A;  1Y1V B;  4Z9C B;  5ELC A;  2RHQ B;  3ERO A;  1RHP A;  5A35 A;  3A7A B;  4RG1 A;  4K5X A;  5IWA Q;  2XIW A;  2WB1 E;  2LXK A;  2X69 A;  1LTT D;  2RSN A;  3TZU A;  2HQE A;  4YHH L;  2YU9 H;  1HA5 A;  2CWA A;  2F3I A;  4A3B B;  1Y1V H;  2EE1 A;  1PH3 A;  2B8F A;  1C48 A;  3G6E A;  5IYD G;  3JAM c;  1CM9 A;  2V4D A;  1LTI D;  2UXC L;  4TRD A;  5IGB A;  5IYB G;  4KKU A;  1O80 A;  3CC4 A;  2JA8 G;  3URY A;  1WJJ A;  4K14 A;  1VQP A;  1SFO B;  1S5D D;  2XVS A;  1LO5 D;  2SEB D;  2JE6 I;  1CUK A;  3L7Z C;  1YVC A;  2EDG A;  1PTO B;  3NBI A;  1ILP A;  4K6D A;  3U9O A;  3IFD A;  2WKD A;  1TWA H;  1EIY B;  1HZC A;  4HJ5 A;  3PUW A;  2PW5 A;  1BKB A;  5IP7 H;  1UUP A;  2KCM A;  4JI7 Q;  1LAB A;  1VQC A;  4LF8 L;  1K8M A;  3EJI A;  1BVS A;  1XMQ L;  1L2F A;  5ELN A;  1II3 A;  3J81 c;  3RZO H;  3TP7 A;  3AEV A;  3GTP B;  1X3Q A;  3NXW A;  1BCP B;  3R93 A;  4I7A A;  5EGT A;  2EYL A;  2Z0S A;  4DV1 Q;  2F0F A;  1B4O A;  1L0X B;  1SNM A;  2ALY B;  2D0O A;  1K3B C;  2BCO A;  2JP1 A;  3OWE B;  5IT9 c;  4LAA A;  1ASZ A;  4RHR A;  3R2I A;  2MQH A;  2WAQ B;  2DGY A;  2JXM B;  2K28 A;  2XRS D;  3J80 L;  3PF5 A;  3RUZ A;  2XWJ B;  1NY4 A;  1LLR D;  4RHS A;  4X3K A;  3TBI B;  2MGS A;  3H3V I;  4K0K L;  3ERS X;  4JI1 L;  3GTM B;  4DK1 A;  2PQA A;  2KCT A;  4X66 L;  1VQA A;  2ZM6 Q;  3FEW X;  1Z6H A;  3IKJ A;  3CU7 A;  1MIU A;  2UUB Q;  5JEA G;  4RCO A;  4A3L H;  5EPK A;  4DR5 L;  3TN2 A;  4QIW B;  5KEE A;  1I4H A;  4DKA C;  2HCI A;  4UAI A;  3JAM L;  1PH8 A;  1VQN A;  1D5X C;  4YCU A;  4BA1 I;  4OWT B;  1Y14 B;  4GLX A;  1TII D;  1WTW A;  3TRE A;  3PUV A;  5GAH C;  5C3W A;  3AMU A;  3GTG B;  4DV0 L;  4X3T A;  2OWO A;  2K14 A;  4FNF A;  4X65 Q;  4MHE A;  1EY0 A;  3M4O B;  1O7L A;  1PH2 A;  2F0P A;  2VB3 X;  3S9W A;  3E9I A;  2ICE C;  3KDF A;  3RLO A;  4LF5 Q;  1LT5 D;  1L0W A;  3T51 B;  3ND8 A;  4H13 C;  3DLL A;  3PMF A;  2LS0 1;  2R92 H;  5J3B A;  2G5D A;  2F0O A;  3A55 A;  1LTG D;  4PQX A;  3F2B A;  5C4X G;  3C1F A;  2Y0S E;  4DR2 Q;  2ZT9 C;  4A93 H;  5IP9 G;  1X9N A;  1IBM Q;  2JN4 A;  3STB D;  3CCU A;  2QEX A;  3BDL A;  4F7X A;  2SNM A;  4PZ7 A;  4A3B G;  2VQF Q;  4DV5 Q;  1O7I A;  2NBF A;  3MA2 B;  3NBH A;  4DR7 L;  4B3S Q;  3JAM E;  1V43 A;  2OXP A;  3TME A;  2BA1 A;  3LWU A;  3QOJ A;  5C4Z A;  1CZG A;  2L11 A;  1PA6 A;  2OTJ A;  4FP5 D;  4BXX G;  2A68 C;  2JA7 B;  2RCN A;  1QZG A;  3EBE A;  1AN8 A;  3HEJ A;  2UU9 Q;  5CV9 A;  3N52 A;  3QR8 A;  3PO3 H;  1VF7 A;  1JJ2 A;  1CSP A;  1YEZ A;  1RTN A;  3ERQ A;  5FLM H;  1B50 A;  4C2M H;  2PI2 A;  2NN6 H;  3HKS A;  1DON A;  1SYC A;  1SE3 A;  5GAG C;  1D5Z C;  1E1T A;  3CW2 C;  3DM1 A;  4TSS A;  4YWL A;  3TP5 A;  2J0T D;  4RCN A;  5EAY A;  4K8J A;  1SNC A;  3TQY A;  5IGD A;  2R61 A;  4DUY L;  5T1I A;  1EL0 A;  3ULP A;  3RLN A;  4HN7 A;  4JI4 L;  3J81 E;  4HJ9 A;  1KDA A;  2KEE A;  3I72 A;  5EPL A;  4A3E B;  3HOV G;  3LX0 A;  2E8G A;  3G48 A;  5EBC A;  1D8L A;  4HJ7 A;  2JA9 A;  5KNB A;  5M5X H;  2E76 C;  4OON A;  1SRU A;  1XMO Q;  1MBY A;  3WWV A;  3K81 C;  3CC7 A;  5IT9 E;  1F77 A;  2VB2 X;  2KCN A;  3LGJ A;  4CDF C;  4BY1 B;  1B44 D;  1K8G A;  2F0I A;  1YJ9 A;  3TSS A;  1CT1 D;  4NXN L;  4IFD I;  4TKO B;  1EEF D;  4M8A A;  2OQK A;  1X55 A;  3BDC A;  2NVQ B;  3CRK C;  4JI8 Q;  1FR3 A;  1GO3 E;  4QF4 A;  4ZKB B;  1YHB A;  1Y1W H;  1CSQ A;  4MTN A;  4BY1 H;  1LV9 A;  1UNS A;  2K5Q A;  2QCP X;  3CQZ B;  2NVY B;  3HOU B;  5I9P A;  5BR8 Q;  1H9K A;  2B2V A;  4IOA A;  3E0J A;  3H6M A;  4KY7 A;  3CQZ H;  4NPS A;  4DAY A;  3TS0 A;  1SNP A;  1TKW B;  1SND A;  1WTV A;  2A1A A;  3V96 A;  1PHJ A;  4A3G B;  5JJK A;  3NBH B;  1OXT A;  3QOL A;  1MSH A;  1N32 L;  4GN5 A;  2IY5 B;  4KLK A;  4A3G H;  1S72 A;  4OXP A;  5FLX L;  1S5E D;  3W1B A;  3Q8D A;  3I4N G;  3KLS A;  3U50 C;  2HHH Q;  2K1B A;  1IL8 A;  1NMG A;  3S1N H;  2H4O A;  5M3F B;  1U4L A;  3S16 B;  4FXG C;  3T4A C;  1KNA A;  4A3D B;  4A3J B;  3E0E A;  1VQ7 A;  1VQJ A;  2WB1 G;  3CME A;  1VQF A;  4G4K A;  1PTO F;  5M3F H;  4P73 A;  1F2Z A;  1QVC A;  3HP3 A;  1LT4 D;  3HZX A;  3S24 A;  3G7L A;  1G2S A;  1CZW A;  1SLJ A;  4L8J A;  4DV4 L;  2C35 B;  4XT3 B;  3M3Y B;  3S1M B;  2TSS A;  1E2W A;  2AHO B;  1NR4 A;  3BG3 A;  4PMC A;  2JEA I;  4LF9 L;  1V1P A;  1TS3 A;  3K0X A;  3BVM A;  2Q8R E;  4DR4 L;  1VQE A;  3FHW A;  1Y69 U;  2JEB I;  1HZA A;  1QE6 A;  3I91 A;  4WOR A;  5J39 A;  1QUQ A;  4G7O C;  1AE3 A;  4DV6 L;  5K36 H;  2A6E D;  4NW2 A;  4JBW A;  1C8C A;  2PW7 A;  1NTG A;  2IT1 A;  3S1Q B;  2JA5 B;  1JT8 A;  1BXT A;  2JA7 G;  1YNJ D;  1PYB A;  1WCM H;  3B6Y A;  1A2U A;  4NXM L;  2NVT H;  4APV A;  1Q90 A;  3FVQ A;  4CDD C;  4GN3 B;  2FIN B;  1K83 H;  3J7Y W;  4LFC L;  4ABN A;  3EQL C;  4QB4 A;  3DWA A;  4I7Z C;  4A3F H;  1I94 L;  4KY5 A;  1Q12 A;  1RD9 D;  5C44 G;  1XX8 A;  1LUZ A;  2OQ0 A;  2B2U C;  4FDB A;  2JA6 H;  2ENB A;  1STN A;  3CP0 A;  4A3E G;  4RAU C;  2CFM A;  3AFP A;  2CQA A;  1LYL A;  2B2T C;  1QNK A;  3K7U C;  1HNZ L;  1KQS A;  3OIQ A;  1S5B D;  4YY3 L;  2R93 G;  3SK6 A;  3RN2 A;  1FL0 A;  4ILW A;  1Z47 A;  3DEO A;  3FDT A;  1HFN A;  1GUN A;  5LMN W;  1TWF H;  4BY7 B;  1HNW L;  4J8Q A;  3ZJY C;  4OO1 I;  5ELB A;  2RQX A;  3FKI H;  1DCZ A;  1EYD A;  1UE5 A;  2PMZ E;  4RGM A;  3Q22 A;  4EQ5 A;  2LSS A;  3PF4 A;  2E2I B;  1TT2 A;  3HOU G;  2EOT A;  1VQL A;  1ASY A;  5C0X J;  1YNN C;  4GS3 A;  4PZ6 A;  3GP7 A;  1Q86 C;  2BE5 C;  2B39 A;  2F03 A;  3R3O A;  1KDC A;  1ONL A;  1V1P B;  2H5X A;  3HOY H;  3GTJ H;  4B08 A;  4JI6 Q;  2F0V A;  4JYA L;  3PO2 G;  3W1G A;  4OEL B;  4CHT B;  1I5F A;  4IFD G;  1J6Q A;  5JVG 3;  5C3X A;  5LMU L;  1QUQ B;  4F88 A;  1XNQ Q;  1D1I A;  1MJE A;  4IUQ A;  1ICW A;  3NPP A;  1NUC A;  2Z6K A;  2D5D A;  5COR A;  2PPB C;  1FNV A;  4R9W A;  2AWO A;  2AWN A;  4OIJ A;  4BBS G;  2F0J A;  1S3O A;  2EVB A;  3X3N A;  3NQI A;  2F3V A;  2A6H D;  1IW7 C;  2Y0S G;  1A8V A;  1F2Y A;  2JA8 H;  5DEH A;  4A3J G;  2MUY A;  5L37 A;  1Q1B A;  1RKN A;  1HTP A;  4OGQ C;  3I3C A;  2E2J B;  1A3U A;  3UDG A;  2Z4I A;  1AFP A;  4X62 L;  4C3H H;  4WRD A;  1ZYR D;  1MHW C;  1PTO D;  5IYC G;  3VR3 A;  3S17 B;  3OMC A;  3CKI B;  3TP6 A;  4RMF A;  4ALP A;  1RL2 A;  2D62 A;  1IZ6 A;  4HMI A;  1B53 A;  1L1O C;  1TY2 A;  4P2C B;  1Z7T A;  2XGT A;  1ESF A;  4LFB Q;  4DR1 L;  3D4D A;  1HTL D;  5HGQ A;  1FJG Q;  4IPG A;  4GLA C;  1XWE A;  3EN2 A;  1Q82 C;  3Q24 A;  2A5H A;  3D8G A;  1BCP D;  2FFK B;  3H09 A;  1U4P A;  2R7D A;  3E3X A;  3GTQ B;  5EKL A;  3RD4 A;  3NEM A;  1Y8O B;  3C1E A;  1PYW D;  3CPW A;  4M1U B;  2RDH A;  4GNX C;  4UP8 A;  1F2L A;  2KHI A;  4R8I A;  4KD4 A;  4ME5 A;  3KFU A;  2Z1C A;  3BYY B;  4FF4 A;  3GTK H;  3CCE A;  4EQP A;  5FJ8 H;  2R7F A;  1WFQ A;  1E22 A;  1A15 A;  2BDO A;  4GZY C;  5CMD A;  1G51 A;  4LK1 C;  3T1Y L;  1YBY A;  1EFI D;  3NQT A;  5E4X A;  3KLR A;  2K50 A;  1OO9 B;  2VUM B;  3S1R H;  1XYI A;  4O2D A;  3SVM A;  1VQ8 A; 
#chains in the Genus database with same CATH homology
 1QNU A;  3EVQ A;  2IW3 A;  4DU9 A;  4HSV A;  3MXG A;  2I07 B;  5EKK A;  1AZQ A;  4A3K B;  1GHJ A;  4KJN A;  1TS4 A;  2L5T A;  3M4Y A;  2PMZ B;  2E2H B;  1I4X A;  1GUO A;  5IOD A;  2AQ3 B;  4XXE A;  1C4Q A;  1CK1 A;  4XYQ A;  3NP8 A;  1PZK D;  1PRT C;  2HDM A;  1PFN A;  1H9S B;  2EY5 A;  5M3M B;  5C4X B;  4HCS A;  3I90 A;  1H9J A;  5C5L A;  4B9X A;  1FYC A;  5FKA C;  1BR9 A;  3H94 A;  2F0K A;  1DXM A;  1DOL A;  1O78 A;  1G29 1;  1CHQ D;  3PUZ A;  4OO1 G;  1I3Q B;  1A3V A;  4NP5 A;  4RGT A;  5C0X G;  2BDN A;  3GTO B;  3OSO A;  2LMC B;  4DAP A;  4CGY B;  1B2T A;  1ZKO A;  2KEC A;  3X3M A;  4DF7 A;  3EFX D;  2K5D A;  5KND A;  3OMG A;  4XT1 B;  5IGC A;  2EYF A;  2WIN B;  4BA2 I;  1S4Z A;  5F2D A;  2MPM A;  3PUX A;  1PTO H;  1SAP A;  1ENF A;  5FO7 B;  1EZ6 A;  3CHB D;  2ZXO A;  3OW7 A;  5A2Q L;  4V19 0;  3HOV B;  2PZU A;  3P1H A;  2KOL A;  4Q0F A;  1QG7 A;  1BUV T;  1E2V A;  1F2M A;  1QB5 D;  2PQE A;  1HPC A;  3Q23 A;  2B63 B;  4IUP A;  3EA6 A;  2HCC A;  2O2L D;  4RGN A;  4OHJ A;  4BBR B;  2SOB A;  1VDZ A;  3MFG A;  2A69 C;  2I46 A;  3HG9 A;  1TY0 A;  1AEX A;  1TR5 A;  2K7V A;  4KHV A;  1JC7 A;  1G91 A;  1TS5 A;  5ELF A;  2IX1 A;  1FGB D;  4HR7 B;  3VYU A;  2F1M A;  2GA4 B;  1PRT B;  5A2Q E;  3FMC A;  3C2P A;  3KF8 A;  3PIO 3;  4ZKC B;  2NWG A;  1EY5 A;  2Q8I B;  3P20 A;  3I4N B;  1GXD C;  2Z4H A;  4K2L A;  2EYJ A;  3K5N A;  5E4W C;  1B9M A;  3MAQ A;  2WB1 B;  4RWS C;  1EWC A;  1QCB D;  4FVM A;  2L4N A;  1ZXT A;  3VA7 A;  1TQO A;  2EJG C;  3SXH A;  4DXG A;  3VYS A;  3D3R A;  3BYT B;  2G9H D;  1LTB D;  1EYA A;  5FO9 B;  3J81 L;  3V2T A;  1DYQ A;  3RLF A;  2IX0 A;  1Q3L A;  4HCE A;  2CHB D;  2F0H A;  3NTH A;  2PZT A;  3Q0A A;  2XRQ D;  3M7G A;  2F0T A;  5IT9 L;  4NKL A;  1DD2 A;  3S14 B;  1QJO A;  1RDP D;  2YYZ A;  1CQF A;  2X6G A;  4FF2 A;  2N88 A;  2O5I C;  2KCC A;  5I2X A;  4WFN 3;  4BWG B;  5JOB A;  1SMY D;  3KK7 A;  4XIG S;  4DNR B;  3C3L A;  1DOK A;  1HQR D;  2AUK A;  4ODG A;  1WVL A;  1EQV A;  1W6J A;  1DOM A;  3OWF A;  2B2W C;  5M5W B;  5C44 B;  1KLG D;  1TWC B;  2NUC A;  2X6L A;  1E2Z A;  2QF7 A;  4F87 A;  1H9M A;  2EPB A;  3BS1 A;  5M9O A;  4KJO A;  3MC0 B;  1FNU A;  3FRP B;  3K7A B;  1BDO A;  2EYP A;  1STG A;  5D3I B;  2R93 B;  4N9P A;  1SNQ A;  3DEP A;  1ET9 A;  4RGO S;  2B2W A;  3S2D B;  3N6R A;  4ZYS A;  1IYU A;  2H1E A;  1BOS A;  3FPP A;  5DNF A;  1EYC A;  1HFG A;  3K57 A;  5CV7 A;  2K03 A;  1LTA D;  2PZW A;  4S3S A;  5CYU A;  1QIL A;  2R3Z A;  5EQ0 A;  1BF4 A;  2R6G A;  1EIG A;  3F2U A;  2HUG A;  4ID6 A;  1TS2 A;  3PO2 B;  2IL8 A;  2R7Z B;  1V1O A;  1D5M C;  2PYK A;  3I73 A;  5M5Y B;  3SK5 A;  4C3I G;  4IFD H;  2PCF B;  2F0D A;  1HA6 A;  3HKZ B;  5CGK A;  2NYZ D;  4BBS B;  1GHK A;  3RZD B;  4CJ2 C;  3BVG A;  2Y0S B;  1SYB A;  5KIX A;  3NE5 B;  3P7J A;  2Q8T A;  1KAB A;  4ZUJ A;  1SE4 A;  3QWN A;  3L9A X;  4L6T B;  1WTX A;  4KKS A;  2EY2 A;  3A7L A;  1V8Q A;  3UI2 A;  1GOZ A;  5EKI A;  3K58 A;  2F0L A;  3A56 A;  4CKB A;  3GTL B;  5JVH 3;  3MWY W;  2TMP A;  1W6K A;  2RA4 A;  1EOT A;  5I6W A;  1JR0 D;  5KGU A;  1JOR A;  2E75 C;  1I6H B;  3MXU A;  1EQT A;  2OT2 A;  1PFB A;  4LJZ C;  2AQ1 B;  4KY6 A;  2B8G A;  1JWU D;  4DK0 A;  4EGV A;  4K5W A;  3QB3 A;  4N9T A;  2NN6 G;  1R9T B;  1GUG A;  3A54 A;  1ENA A;  3SK4 A;  1DZ1 A;  2KHS A;  1Y8N B;  1PRT F;  1DJR D;  3VA5 A;  4EVO A;  2RBM A;  3PV0 A;  4DGZ A;  2KJX A;  4J1M A;  3NTI A;  1Q1E A;  1J9O A;  3H91 A;  2CW0 C;  1YNN D;  2BE5 D;  2B2U A;  4KV6 A;  2K33 A;  3K0Y A;  2CVR A;  5C0X I;  3GQB A;  1LAC A;  2EY6 A;  4CBV A;  3MXN A;  2B2T A;  1RJT A;  2IWH A;  1VMC A;  3VR5 A;  3A8J E;  1HRJ A;  4KKT A;  2D9U A;  1F9S A;  5G3L F;  5D14 A;  3S2H B;  4OL7 A;  3M85 A;  1ESR A;  2L1B A;  1TWH B;  1IW7 D;  3VYT A;  2XSC A;  1ROD A;  4A3I B;  1Q8I A;  3W3A A;  4IUR A;  1EY6 A;  4QUC A;  2B2Y C;  2L9H A;  4OO1 H;  5KYL A;  2O4X A;  2IX3 A;  3TZD A;  4ZAI A;  2F0W A;  4RFB A;  1STH A;  2HDL A;  2EYO A;  5HUR A;  3GD7 A;  3I4M B;  1TWG B;  3R8B A;  4KD3 A;  3Q6S A;  4OIK A;  3KBX A;  1H9S A;  1PFM A;  2AQ2 B;  1D1K A;  3OPO A;  1OXV A;  1F9P A;  1K8O A;  2DN8 A;  2NVX B;  2WP8 J;  5IIF A;  2F0S A;  1I50 B;  4E6I A;  1A2T A;  2QDB A;  2A74 C;  1G8Z D;  3HS0 C;  4KMU C;  3HOZ B;  3OOC A;  1SYD A;  3HOX B;  3P75 A;  2A73 B;  4FF3 A;  2Z8L A;  1SYG A;  3IAY A;  1CA5 A;  5C5M A;  4KK7 A;  1G6Z A;  1HUN A;  1NSN S;  5LL6 X;  4RA8 A;  3J7A V;  3K5O A;  3NWT A;  5I9O A;  5T1G A;  1KAA A;  2N55 A;  4HSP A;  1STE A;  1KNE A;  2XNA C;  3V05 A;  2D2C C;  2JYO A;  4KTA A;  1BQQ T;  4Y7N B;  3RMH A;  1E0B A;  1MD2 D;  3NTK A;  1R4P B;  3C46 A;  3WOF A;  1BCP C;  4IUT A;  4ZQ3 A;  5JEA H;  5D3D A;  5EBD A;  1FNW A;  1PDQ A;  3VR4 A;  3TDQ A;  1PRT D;  2LKV A;  2EYM A;  2F0U A;  5TSS A;  5J22 A;  1RTO A;  3HGB A;  4DNT B;  5CR3 A;  5E3F A;  4C3J G;  2F0Q A;  4H44 C;  2NB0 A;  5C4J B;  1Y8P B;  3OHX C;  5I4D A;  4C56 C;  4KHZ A;  3D6W A;  2ID0 A;  1SYF A;  2KVM A;  2IPK D;  1MI2 A;  1U4R A;  2JSO A;  3SE0 A;  3MVV A;  4K2K A;  4XQQ A;  3VYR A;  4DAV A;  1R4Q B;  3KBG A;  1GUS A;  4H7B A;  1KLU D;  3MEH A;  1VCI A;  1GUW A;  1EY7 A;  3BZD B;  3VR2 A;  4XTC S;  4DXF A;  2M9V A;  4ZRZ A;  4V0B A;  5I6Y A;  1ZEQ X;  4RH6 A;  4NDX A;  4PV1 C;  4U67 3;  4G7Z C;  2OEO A;  2F0G A;  3IL8 A;  1TWA B;  4C3H G;  1OXU A;  4ZK9 B;  3A8I E;  1VMP A;  4BS9 A;  4O42 A;  3SHL A;  3RZO B;  1ET6 A;  4YIJ A;  4PMB A;  2A69 D;  1X3P A;  2MHV A;  1AW7 A;  4Q5V A;  3T56 B;  1F9R A;  2QEJ C;  1BO0 A;  2SNS A;  3D6C A;  1SEB D;  4XQJ A;  2M00 A;  2XN9 C;  3D4W A;  4HTH A;  1EY9 A;  2EZV A;  2NTT A;  1SJE D;  1SDF A;  1SSO A;  1PXU A;  1NAP A;  1A3T A;  2BOS A;  2KA7 A;  4EQN A;  4LMQ D;  2F0N A;  3QJY A;  5ELE A;  4C3I B;  3K59 A;  5FK9 C;  1T5E A;  1F9Q A;  1JOK A;  1STB A;  4IUU A;  2K32 A;  4EQO A;  2AUJ D;  4RKL A;  4CJ1 B;  5EJW A;  4FF1 A;  1NR2 A;  2ICI A;  1EEI D;  2LY7 A;  1WTO A;  3DWP A;  1D6E C;  4K6L A;  4X3S A;  2R92 B;  2A68 D;  4A93 B;  3ITP A;  3J80 E;  2KED A;  1LTR D;  1SBB B;  2WII B;  1OXX K;  5CV4 A;  5I2Y A;  1JWS D;  1O7Y A;  4H0L C;  2NN6 I;  2MP1 A;  5E1F A;  3T53 B;  1XTC D;  3BVZ A;  3E6Z X;  5C6A A;  4IZ8 A;  4MIU A;  4C1N I;  3PO3 B;  1S5C D;  1T5X D;  2L55 A;  2DY7 A;  5J1Z A;  1STA A;  4C2M B;  1J8I A;  1DM0 B;  2PO4 A;  4ZLT F;  3G6J B;  2WKC A;  1UAP A;  1PLF A;  5DM6 3;  4AYB B;  5JJZ A;  5KYI A;  1SMY C;  3K5M A;  2RSO A;  4XQN A;  1LT6 D;  2L0C A;  5M5X B;  4HAE A;  5FO8 B;  5ELD A;  4FYD A;  4O1N A;  1EIH A;  5ISR A;  1KTK A;  1IHZ A;  1CA6 A;  1JOQ A;  5KRU A;  4FXK C;  4A3M B;  3MZ5 A;  1JWM D;  1QWY A;  3HOW B;  3QG1 A;  2B2V C;  3NHH A;  4WJW A;  2J7Z A;  1Y1W B;  1H9R A;  3O13 A;  1SE2 A;  3PUY A;  1CHP D;  5JAV A;  1JE4 A;  5K5P A;  4IFD J;  1I4R A;  3NUC A;  2QKI C;  1ML0 D;  3T13 A;  1G2T A;  1GJX A;  2K01 A;  3LNN A;  2M2L A;  4L63 B;  4ZUI A;  2MJ8 A;  1HCZ A;  1EWH A;  3M7N A;  2LFN A;  2XWB B;  4FXD A;  4IUV A;  5JPM C;  5C4H A;  3S1N B;  4ULL A;  5DM7 3;  1HXY D;  2RKS A;  5KNC A;  5CV6 A;  2VNU D;  3VR6 A;  1IKM A;  1AP0 A;  4R8N A;  4IAL A;  2C9O A;  1CQV A;  5C3E B;  1I4P A;  1GUT A;  1X32 A;  1WD0 A;  1I4Q A;  2RVL A;  1D2B A;  3MXP A;  2WV6 D;  2ZXP A;  4G57 A;  4UDU C;  2RDG A;  2FMC A;  4I65 A;  4HMJ A;  4G7H C;  1BCP F;  1WTP A;  1WCM B;  1ENC A;  4K8I A;  1MSG A;  1LT3 D;  3D31 A;  2NVT B;  2NTS A;  4HED A;  5FLX E;  2NZ1 D;  1K83 B;  1MGS A;  4A3F B;  1BBX C;  3QIA A;  2A6E C;  1EY4 A;  4CKE A;  3IFT A;  2F3W A;  4QCL A;  2EJF C;  4QMG A;  2CW0 D;  5CV8 A;  1YNJ C;  1PZI D;  1SJH D;  3T16 A;  2JA6 B;  1WTR A;  5CC4 A;  2FJ2 A;  3GV6 A;  5D65 A;  3SEB A;  4CJ0 B;  1CI3 M;  1OXS C;  3KUP A;  2KUM A;  3E5S A;  4IQZ A;  1B3A A;  2EXZ A;  1TU2 B;  4C3J B;  1KDB A;  4QUF A;  2F4I A;  1TWF B;  2BA0 A;  3DXJ C;  4PNY A;  3SR1 A;  1HHV A;  3KLS X;  2KQ3 A;  3MFY A;  2F0E A;  4KN4 C;  5JPN C;  5IGE A;  3FKI B;  3NSW A;  5AFW A;  1CFM A;  2OF1 A;  2EYH A;  1A6X A;  1SXT A;  1WD1 A;  5LL6 S;  1SNO A;  3K5L A;  5CV5 A;  1L0Y B;  2K04 A;  4TQU S;  3HOY B;  3ONA B;  4CKC A;  3GTJ B;  4KI0 A;  5CBA E;  1NCV A;  3I4L A;  4IUN A;  4DFA A;  3MHB A;  3AU7 A;  3SDZ A;  3U9S A;  1TVX A;  1EU4 A;  5C0X H;  5HGT A;  1BNZ A;  2C5C A;  4IN3 A;  2O5J C;  1JB3 A;  2PNR C;  5LHY 1;  3K6O A;  2DY8 A;  3I8Z A;  1EU3 A;  1JQY D;  2JA8 B;  3MTS A;  3HRZ C;  5CBE E;  5BN3 A;  4JK1 C;  2B2Y A;  2EY1 A;  2ZXR A;  5BN4 A;  4C3H B;  1RCV D;  1I4G A;  2WAC A;  3TP8 A;  2IJ0 A;  1UEA B;  3DMU A;  1M8A A;  2K5W A;  2A6H C;  1QOH A;  3SK8 A;  1JOO A;  4KN7 C;  4DA2 A;  4F8M A;  1VF5 C;  1WTQ A;  1AZP A;  2K05 A;  1RF2 D;  1ZYR C;  5K36 G;  5IOC A;  2QIL A;  4B9W A;  1PTO C;  3FPU B;  2G9D A;  4C1N K;  3OIP A;  2L12 A;  2VXW A;  4NMZ A;  3I70 A;  1LTS D;  3GO5 A;  3R2T A;  3NK9 A;  1IYV A;  4XYO A;  4PMW A;  5NUC A;  3GTK B;  3S15 B;  3NWS A;  1CTM A;  5JEA J;  3BDO A;  3ZYY X;  1U4M A;  4DN4 M;  4RKB A;  2DNC A;  1HUM A;  1EY8 A;  1I6V C;  2E74 C;  5IGG A;  1B1Z A;  3WOE A;  1O7Z A;  2DNE A;  3DHQ A;  3S1R B;  2SDF A;  3J7A F;  1FD7 D;  2K6A A;  3W2D A;  5BN5 A;  1EZ8 A;  2F0M A;  3LWE A;  3AB9 A;  4J6H A;  1JIC A;  2E2D C;  1ILQ A;  3GV3 A;  3CRL C;  1U9R A;  4MN3 A;  3L3O C;  1JCK B;  1STY A;  2RDF A;  1S5F D;  2EJM A;  4K5V A;  3WDN A;  5DAU A;  5IGF A;  4U68 A;  3D4R A;  2J4X A;  1XXG A;  1PZJ D;  1IKL A;  4X3U A;  4XDX A;  2FHT A;  3ND9 A;  3DWQ A;  3DUZ A;  3H0G B;  5COY A;  3PIP 3;  3QO2 A;  3A8K E;  1B9N A;  1SYE A;  2FMM A;  5FOB B;  4FO2 A;  1HQM C;  1PMR A;  5G3L D;  5EPJ A;  3H3V C;  2YU9 B;  1M4V A;  1Y1V B;  4Z9C B;  5ELC A;  3ERO A;  1RHP A;  5A35 A;  3A7A B;  4K5X A;  2XIW A;  2X69 A;  1LTT D;  2RSN A;  3TZU A;  2HQE A;  1HA5 A;  4A3B B;  2EE1 A;  2B8F A;  1C48 A;  1CM9 A;  2V4D A;  1LTI D;  5IGB A;  4TRD A;  4KKU A;  1O80 A;  3URY A;  4K14 A;  1SFO B;  1S5D D;  2XVS A;  1LO5 D;  2SEB D;  2JE6 I;  3L7Z C;  2EDG A;  1PTO B;  3NBI A;  1ILP A;  4K6D A;  3U9O A;  3IFD A;  2WKD A;  3PUW A;  2PW5 A;  1UUP A;  1LAB A;  1K8M A;  3EJI A;  1II3 A;  3TP7 A;  3GTP B;  1X3Q A;  3NXW A;  1BCP B;  3R93 A;  5EGT A;  2EYL A;  2F0F A;  1B4O A;  1L0X B;  1SNM A;  2BCO A;  2JP1 A;  3OWE B;  4LAA A;  4RHR A;  3R2I A;  2WAQ B;  2JXM B;  2K28 A;  2XRS D;  3J80 L;  3RUZ A;  2XWJ B;  4RHS A;  1LLR D;  4X3K A;  3TBI B;  2MGS A;  3GTM B;  4DK1 A;  3FEW X;  1Z6H A;  3IKJ A;  3CU7 A;  5JEA G;  4RCO A;  5EPK A;  3TN2 A;  4QIW B;  5KEE A;  1I4H A;  2HCI A;  4UAI A;  3JAM L;  1D5X C;  4BA1 I;  1TII D;  1WTW A;  3PUV A;  5C3W A;  3AMU A;  3GTG B;  4X3T A;  4FNF A;  4MHE A;  1EY0 A;  3M4O B;  1O7L A;  2F0P A;  2VB3 X;  3S9W A;  2ICE C;  1LT5 D;  3T51 B;  3ND8 A;  4H13 C;  3PMF A;  2LS0 1;  2F0O A;  3A55 A;  1LTG D;  4PQX A;  3C1F A;  2ZT9 C;  3BDL A;  4F7X A;  2SNM A;  2NBF A;  3MA2 B;  3NBH A;  3JAM E;  1V43 A;  2OXP A;  3TME A;  2BA1 A;  3LWU A;  3QOJ A;  5C4Z A;  1CZG A;  2L11 A;  4FP5 D;  2A68 C;  2JA7 B;  1AN8 A;  3HEJ A;  5CV9 A;  3N52 A;  1VF7 A;  1RTN A;  3ERQ A;  1B50 A;  2NN6 H;  1DON A;  1SYC A;  1SE3 A;  1D5Z C;  3DM1 A;  4TSS A;  3TP5 A;  2J0T D;  4RCN A;  4K8J A;  1SNC A;  5IGD A;  2R61 A;  5T1I A;  1EL0 A;  4HN7 A;  3J81 E;  1KDA A;  2KEE A;  3I72 A;  5EPL A;  4A3E B;  3LX0 A;  5EBC A;  5KNB A;  2E76 C;  1MBY A;  5IT9 E;  1F77 A;  2VB2 X;  2KCN A;  4BY1 B;  1B44 D;  2F0I A;  3TSS A;  1CT1 D;  4IFD I;  4TKO B;  1EEF D;  4M8A A;  3BDC A;  2NVQ B;  3CRK C;  1FR3 A;  4QF4 A;  4ZKB B;  1LV9 A;  1UNS A;  2K5Q A;  2QCP X;  3CQZ B;  2NVY B;  3HOU B;  5I9P A;  1H9K A;  2B2V A;  3E0J A;  3H6M A;  4KY7 A;  4DAY A;  1SNP A;  1TKW B;  1SND A;  1WTV A;  3V96 A;  4A3G B;  1OXT A;  3QOL A;  1MSH A;  5FLX L;  1S5E D;  3KLS A;  2K1B A;  1IL8 A;  2H4O A;  5M3F B;  1U4L A;  3S16 B;  4FXG C;  3T4A C;  1KNA A;  4A3D B;  4A3J B;  4G4K A;  1PTO F;  1F2Z A;  3HP3 A;  1LT4 D;  3HZX A;  3G7L A;  1G2S A;  1CZW A;  4L8J A;  4XT3 B;  3M3Y B;  3S1M B;  2TSS A;  1E2W A;  1NR4 A;  3BG3 A;  4PMC A;  2JEA I;  1V1P A;  1TS3 A;  3BVM A;  2Q8R E;  1Y69 U;  2JEB I;  1QE6 A;  3I91 A;  4WOR A;  5J39 A;  4G7O C;  5K36 H;  2A6E D;  4NW2 A;  4JBW A;  1C8C A;  2PW7 A;  2IT1 A;  3S1Q B;  2JA5 B;  1BXT A;  1YNJ D;  1A2U A;  1Q90 A;  3FVQ A;  2FIN B;  3J7Y W;  4ABN A;  3EQL C;  4QB4 A;  3DWA A;  4I7Z C;  4KY5 A;  1Q12 A;  1RD9 D;  1XX8 A;  2B2U C;  2ENB A;  1STN A;  4RAU C;  2CQA A;  2B2T C;  1QNK A;  3OIQ A;  1S5B D;  3SK6 A;  4ILW A;  1Z47 A;  3DEO A;  3FDT A;  1HFN A;  1GUN A;  4BY7 B;  4J8Q A;  4OO1 I;  5ELB A;  2RQX A;  1DCZ A;  1EYD A;  4RGM A;  3Q22 A;  2E2I B;  1TT2 A;  2EOT A;  5C0X J;  1YNN C;  3GP7 A;  2BE5 C;  2B39 A;  2F03 A;  3R3O A;  1KDC A;  1ONL A;  1V1P B;  4B08 A;  2F0V A;  4CHT B;  4IFD G;  5JVG 3;  5C3X A;  4F88 A;  1D1I A;  4IUQ A;  1ICW A;  3NPP A;  1NUC A;  2D5D A;  5COR A;  2PPB C;  1FNV A;  4R9W A;  2AWO A;  2AWN A;  4OIJ A;  2F0J A;  2EVB A;  3X3N A;  3NQI A;  2F3V A;  2A6H D;  1IW7 C;  1F2Y A;  5DEH A;  2MUY A;  1Q1B A;  1RKN A;  1HTP A;  4OGQ C;  3I3C A;  2E2J B;  1A3U A;  2Z4I A;  1AFP A;  4WRD A;  1ZYR D;  1PTO D;  3VR3 A;  3S17 B;  3OMC A;  3CKI B;  3TP6 A;  2D62 A;  4HMI A;  1B53 A;  1TY2 A;  4P2C B;  1Z7T A;  1ESF A;  3D4D A;  1HTL D;  1XWE A;  3Q24 A;  2A5H A;  3D8G A;  1BCP D;  2FFK B;  3H09 A;  1U4P A;  3GTQ B;  5EKL A;  3RD4 A;  1Y8O B;  3C1E A;  1PYW D;  4M1U B;  2RDH A;  1F2L A;  4R8I A;  4KD4 A;  4ME5 A;  2Z1C A;  3BYY B;  4FF4 A;  4EQP A;  1A15 A;  2BDO A;  4GZY C;  5CMD A;  4LK1 C;  1EFI D;  3NQT A;  5E4X A;  3KLR A;  1OO9 B;  2VUM B;  1XYI A;  3SVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...