4ZAIA

Crystal structure of cxcl13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CXCL13
rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords C-X-C motif chemokine 13
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zaiA00
2H1EA 1CA5A 1B53A 2B2TC 3DM1A 1U4RA 1J8IA 4RA8A 1BF4A 1BBXC 5E4WC 1CA6A 1WD1A 2B2UC 1G91A 3F2UA 1ICWA 1DOKA 1WTXA 2KECA 4U68A 2HCIA 2XIWA 1B4OA 1WTOA 4UAIA 1BNZA 2IL8A 2B2WC 4CJ2C 4XT3B 1C8CA 1AZPA 1AP0A 1HHVA 2Q8RE 1PDQA 3FPUB 1BO0A 1NCVA 1EOTA 2FJ2A 2R3ZA 4NW2A 1QE6A 4ZKCB 2NYZD 1ILPA 2KEEA 1PLFA 4ZAIA 4O42A 3D6WA 2NWGA 4R8IA 1O7ZA 2HUGA 2JYOA 1WTRA 1WTWA 2B2WA 2L4NA 1MSHA 1HUNA 2RVLA 4RWSC 4IUPA 4DN4M 3I8ZA 3G7LA 4XDXA 2FMMA 2N55A 5EJWA 2B2UA 2RSNA 1G6ZA 1GUWA 2EOTA 4RAUC 2L12A 1NR4A 1XYIA 1O80A 3SVMA 3Q6SA 1EIHA 4IUQA 3QO2A 2NZ1D 2BDNA 5EQ0A 4IUUA 1LV9A 1ILQA 1ESRA 1MI2A 1RJTA 5CMDA 4HEDA 2B2YA 1DOMA 2K1BA 2L9HA 4ZLTF 2K05A 1PFNA 5CBEE 3H91A 2SDFA 5EPJA 1X3PA 2K03A 5CBAE 4IUTA 2DY8A 3LWEA 1HUMA 1VMCA 1X32A 1AZQA 1PFBA 2B2VC 1E0BA 1F2LA 2KEDA 3MWYW 4IUVA 1RTOA 4MHEA 1CM9A 2RSOA 3KUPA 3FDTA 2J7ZA 3GV6A 5D65A 2FINB 4ZKBB 4MN3A 1IL8A 2MP1A 1G2SA 1U4PA 1PFMA 2M2LA 2KVMA 2B2YC 3MTSA 5T1IA 1WD0A 1HA6A 1U4LA 2B2VA 2FHTA 2JP1A 3ONAB 1F9RA 3UI2A 4ZK9B 1DZ1A 3IFDA 5D14A 4QUCA 3I91A 2HCCA 1JE4A 4XT1B 1RTNA 2K01A 1WTVA 2MPMA 1EQTA 1IKLA 2KUMA 1DOLA 3P7JA 4HSVA 3TN2A 1B50A 1F9QA 4CJ0B 1HFNA 1ZXTA 1B2TA 4X3UA 2Q8TA 1DONA 4HCSA 1SDFA 2HDMA 1F9SA 1MSGA 2K28A 1SSOA 1WTQA 1VMPA 1HFGA 2X6GA 2MGSA 4OIKA 5EKIA 1RHPA 1G2TA 5DNFA 2L1BA 5JJZA 4X3TA 2X69A 1J9OA 2K04A 1U4MA 2EPBA 2CVRA 4X3KA 3DEPA 1M8AA 3IL8A 3KBXA 1NR2A 3HP3A 1TVXA 2VXWA 1IKMA 5E4XA 1KNAA 3I3CA 4IURA 5AFWA 3TZDA 3I90A 5CORA 2N88A 3R93A 4OIJA 1WVLA 1ML0D 1MGSA 1QNKA 3GV3A 5COYA 2D9UA 2DY7A 2L11A 4CJ1B 1HRJA 4QUFA 1F9PA 2MJ8A 5EPKA 2EE1A 1Q3LA 2B2TA 1S4ZA 4R9WA 4X3SA 2RA4A 1EL0A 1KNEA 1O7YA 4HAEA 1SAPA 1B3AA 3DEOA 1NAPA 1WTPA 2FFKB 1JICA 1A15A 1QG7A 2X6LA 1EIGA 3N52A 5EPLA 2HDLA 1XX8A 4LMQD 5T1GA 1X3QA 1RODA 2KOLA
chains in the Genus database with same CATH superfamily
2KENA 3RD4A 3S2DH 4A3FH 4DV3L 1C4QA 2XNAC 3I7FA 3FHWA 1VQGA 4U68A 3RUZA 1D5ZC 3VR4A 4U673 4K5XA 4TSSA 1S40A 2IL8A 1PZKD 1BO0A 1PTOD 1IL2A 2ENBA 1ASZA 1EQVA 2KEEA 3WOFA 4DXGA 4IFDG 3AYHB 1E2WA 5D3IB 2IPKD 3HOUG 1U5KA 5JVH3 5JPMC 3NPPA 3BVZA 3S1RH 5C4XB 4CHTB 4JCVE 4XDXA 4PMBA 1YNXA 1X55A 1GUWA 2EOTA 1NR4A 3ND8A 5HY6A 1LV9A 3OSOA 4APVA 4C2MB 3L3OC 1YZ6A 1R9TB 2NVXH 4DV4L 2B2YA 1X9NA 1CI3M 3FMCA 1XNRL 4GKKQ 2UXDQ 4NB3A 1B44D 1HNXQ 2DY8A 1WJJA 4LFAL 5FJ8G 4ODGA 4DR2Q 1SMXA 5I6WA 3CCJA 2EY2A 2SEBD 1S5CD 2F0MA 4MN3A 4KD4A 4XIGS 4DV7Q 2B2YC 5T1IA 3CC7A 1KTKA 4LW1A 1QOHA 1YNJD 1KAWA 5FO7B 5JVG3 4OO1H 3K7AB 4IUNA 2BDOA 4DR4L 1NY4A 1I5FA 3PUZA 4R4QA 2J0TD 1IKLA 3N6RA 3KOJA 4GNXA 4YHHL 4K2LA 1NUCA 2R7ZB 1IXRA 1SSOA 3P20A 5ELEA 1RHPA 3NSWA 3KLWA 1TWCH 2DUDA 2ZJRA 2F0WA 4AYBB 2IHEA 3CC4A 5KNCA 4DK1A 4WORA 2F3IA 1GUOA 2AKWB 2ES2A 1VQJA 1Y1WH 1F2MA 2FMCA 2R7DA 3PUWA 2EE1A 4A3GH 2VUMG 5AJ3L 1I94Q 1A0IA 2QCPX 1Z47A 3LGJA 1N8RC 2PPBC 4CGYB 3M7NA 3MA2B 1YIJA 3K81C 1NAPA 2VB3X 4R4IA 2CKZB 2HDLA 2ZXRA 1K8MA 1STNA 3CCLA 1TWFB 2KOLA 4XYQA 4R1JA 1E22A 3T1YL 3G6EA 2UUCL 1U4RA 3EROA 4K6LA 4KI0A 1KLUD 4RHRA 4DPGA 3W2DA 3EJIA 4NXML 1Q8KA 2E76C 3D4RA 3PIPA 3PQIA 4FF2A 2Y0SB 4KN7C 5C4HA 2OF1A 3I4LA 1PYBA 2O5JC 5IYBH 2MO0A 2BCOA 3TBIB 4KY7A 3OYYA 2VB2X 4G57A 2QA4A 1AEXA 2N55A 1G6ZA 1R9TH 5FLXE 2L12A 3Q6SA 3T1YQ 1QVGA 2JN4A 3M7GA 3K8AA 2Q2TA 5JJLA 1MI2A 3E3XA 2CW0C 1CQFA 2VUMB 4WRDA 4J1MA 2SDFA 4HSPA 5CBAE 4JI4Q 1Q12A 1TWGH 4RGMA 1RKNA 2JA5H 2ZTEA 5I9OA 2RKSA 2ZT9C 2RSOA 4DAMA 4EQNA 3ER0A 3ND9A 3HOYH 5KIXA 5EGTA 2D62A 3CCRA 2E2JB 2N3SA 3GDEA 1UUPA 3K59A 5C3EG 1RTNA 4DAVA 3RZOB 1CSPA 2I5LX 5M3MH 2WB1B 2C5CA 1DONA 2K28A 3K58A 2MGSA 3NTHA 5K36G 4B9XA 4KHZA 3TP7A 5KNDA 3NWSA 3D31A 1LUZA 3F2CA 3W1BA 1C7YA 5A2QE 2B8GA 2HQLA 3LX0A 4QB4A 1VQ9A 3VYSA 3TSSA 2N88A 1VQ4A 4MIUA 2IW3A 1ML0D 3KJPA 3CPFA 5JAVA 3M9BA 4BBSH 4BY7G 3KLRA 4NXNQ 2L11A 1BXTA 4KY6A 4P71A 3PF5A 2NUCA 4JI0L 2L5TA 1S4ZA 1BCPD 4LF5Q 2M9VA 5FJ8H 2NTSA 1PRTD 5FK9C 4A3IH 5M5WB 3HRZC 4HIOA 3TP8A 1WI5A 2NVQB 4RGTA 4L6TB 5GAGC 3S16H 3D6CA 3D8GA 2B2TC 4IO9A 3Q23A 2EY1A 5E4WC 2UXCL 1KQSA 3BZCA 1G91A 2NB0A 5LMNL 2E2HB 3A5ZB 4M8AA 3BJUA 1C8CA 4BBRG 1AP0A 3R2TA 2FJ2A 2RCNA 3BYTB 2QKIC 1Y1WG 4MTKA 1NSNS 1TS4A 3HOWH 2B3GA 4LFBQ 4QF4A 3BDCA 1D7QA 1WTWA 1VQ5A 3GTPB 4P72A 2JA6B 4DR3L 5EJWA 1O80A 3FKIH 5J39A 4DUYL 2ASBA 4KHPL 2E5LL 4IUUA 4ME3A 2ZJPA 4CDDC 1JR0D 1SBBB 5G3LD 2NVXB 2VZAA 1LYLA 4ZLTF 1PFNA 2F0LA 3H91A 5CC4A 4BY1H 2O4XA 5EPJA 1IW7D 5M3FB 1SYBA 2PQAB 1X32A 1X6OA 4DV1Q 1UEAB 4Y7NH 2J7ZA 1JT8A 1TWHB 2KHIA 2A68D 1J5EQ 3CP0A 2EJGC 1G2SA 1PFMA 4LJZC 4JI8Q 4A3JB 1WD0A 1Z6HA 1XPUA 1F9RA 3J80i 1K3RA 3R8BA 1HNWQ 1DM0B 2KA7A 1TR5A 1UE7A 1PH7A 1F9QA 3E0EA 5M3FG 5IGGA 4HCSA 4BBRB 3E6ZX 4ZUIA 4BY7H 5CV4A 4RMFA 4H0LC 4QL5A 4HIKA 3S1NH 2JA7H 1HJPA 2X69A 4O1NA 3TREA 5C4JH 4GOPC 3MXGA 3NELA 1LM0A 4A3JG 5HURA 1H9KA 5BN4A 2Y0SE 4OIJA 2D2CC 4DV0Q 1HZ9A 1EY8A 1TWFH 4FO2A 1SMYD 2XVSA 1RD9D 2OT2A 2KCMA 5KGUA 2E2IH 2ZTCA 1YNND 3CF5A 3VR5A 1M90C 4R8NA 3HOVB 2I07B 3BYYB 5LMNW 1YI2A 1EZ8A 1WTHA 3VYUA 1Y1VB 3J80L 2PZUA 5C3EB 2F0SA 2NVYB 5IT9L 2VL6A 4RKLA 3PGZA 1WD1A 1ZKOA 3F2UA 1K83H 4YY3Q 1EOVA 2LMCB 3T4AC 4YWLA 3EFXD 4NPSA 1KAAA 3G6JB 5ELFA 5I6YA 3MXNA 2OWOA 2B63G 4ZKCB 2K33A 2CH4W 4C3IB 3HOXH 4P75A 4NMZA 3QIAA 3RN5A 4C3JG 1M1KC 1STHA 3CMEA 1JORA 2OTLA 3KBGA 1HUNA 4MNOA 4QIWB 4WJWA 3J7A5 2YTVA 5BN3A 1SLJA 4FNFA 1YNJC 2DJFC 3K57A 2BDNA 2UU9Q 3S1MB 2SOBA 1AW7A 5M3FH 4HJ7A 2AWNA 4LF7Q 3DWPA 3OTOQ 4C3IG 4KKSA 2JJQA 4UY8C 4FXDA 4YWMA 3EN2A 2UXDL 4GKKL 5LMNQ 1HNWL 1E0BA 3PUYA 1GO3E 4IOAA 4ZKBB 2YU9B 1SNPA 4B3SL 2K50A 1RCVD 2A69C 2KVMA 3PO3B 1U4LA 4DV6Q 4OO1I 1I3QB 4XXEA 2EYOA 4OWXB 3A7AB 1ICFB 1MJEA 4AYBE 5IP7H 3BDLA 2NN6G 1NJIC 4UP8A 1U9RA 1IZ6A 3I4NB 4OIKA 4JBJA 3TP5A 1GOZA 4A3KG 1RIPA 3A74A 1IYVA 1BVSA 4LF4Q 4OX9L 5ELCA 3KJOA 4TKOB 3GTJB 3CPWA 1H9SB 2K75A 4A3KH 2RHQB 4UP7A 3H0GB 2I5MX 4ZRZA 4OWTB 2Y0SG 1QWYA 1KRSA 1F2ZA 3DWAA 4RCNA 4IFDJ 4NKLA 2PQAA 2ZXOA 4FP5D 4KJNA 2EYFA 3MXNB 3MC0B 4JBWA 4GKJL 1Y1VH 4DAYB 1CZGA 4AQYL 1I94L 2O5IC 2N8NA 2FFKB 5T1GA 2JP1A 1DZ1A 4JI2Q 3J7AV 1K83B 3TS2A 3MFYA 2F0KA 5M5XH 1BF4A 2L0CA 1BBXC 2XRSD 5BR8L 1BOSA 2Z9HA 4C3IH 1Y1WB 2XIWA 4DV5Q 1XNRQ 2EYJA 1ENFA 2IX1A 2R3ZA 5FO8B 1EOTA 1BUVT 4M1UB 4ZAIA 3NEMA 4BBSG 4NXNL 3D4DA 4IALA 3K5MA 2VQEQ 1S72A 1E1TA 3NQIA 5FLMH 3OMCA 3L2PA 2F0NA 4LF6Q 2AMCB 5C5LA 3HOXG 4DV2L 3DM3A 3VA7A 5DM73 1KXLA 2K05A 3ERSX 1EY9A 1SNOA 1SRUA 2F3WA 2HD3A 2B2VC 1VCIA 1F77A 5TSSA 3JAMc 2UU9L 2K52A 1PRTC 2F4VL 5J3BA 1HZAA 5M5YH 1GVPA 2NVTB 2IJ0A 3IFDA 3T53B 2HCCA 3DWQA 1BDOA 3Q8DA 3EA6A 1EQTA 1VDZA 1JE5A 1OTCA 1G6PA 3RZOH 2TSSA 4DXFA 2K6AA 4DV5L 4X65L 1FGBD 2HHHL 3WOEA 1O7IA 2HIVA 3FP9A 4IZ8A 1CQVA 5M5XB 1N32Q 1V1PB 5FLXL 2DN8A 3X3NA 3GV3A 4XQNA 2MUYA 2PCFB 3KFUA 1LTTD 5C3XA 1SR3A 2B2TA 4JOIA 1II3A 1LT4D 4A3DB 4BBSB 1Y14B 3R2IA 4ZYSA 1C0AA 2PI2A 4V190 2Q8IB 3B6YA 5LL6X 5FKAC 2JQOA 4UPAA 1JWSD 5FOBB 1Y8OB 3N52A 1XX8A 5C0XJ 3OMGA 3GTOH 1I50B 2SNMA 3J81L 5C44G 4OXPA 4Q5VA 4GLAC 3MAQA 1TKWB 3I73A 1MHWC 3S2HH 1HNZL 4BY1G 3S16B 3PIO3 1B3QA 2B63B 4UP9A 5A35A 1HCZA 2YTYA 4PMWA 4CJ2C 4XT3B 3TZUA 3I4MG 4B08A 1LO5D 1QE6A 2K5VA 3TEHB 3IAYA 1PLFA 4G7OC 3AQQA 2A6EC 2NWGA 3NHHA 4DV2Q 1FNWA 1SXTA 4ID6A 5C44H 1SE2A 2UUBL 3T1HQ 3DXJC 3CQZH 4HJ8A 3NBIA 4HN7A 3CAMA 1A2TA 4Y52H 1TIID 4X65Q 4C3HG 3RZDH 1EIHA 2QILA 4B3TL 1X3GA 3RNUA 2JA6H 5E1FA 1GUSA 1CSQA 2Z0SA 5CYUA 1VQPA 2QGQA 2CQOA 4I65A 4JI6Q 2LFNA 4AH6A 1VF7A 3OTOL 1VMCA 1DGSA 2JA8H 1F2LA 4MHEA 1BKBA 4DUZQ 3KUPA 4DKAC 3QWNA 1GM5A 4Z9CB 1TY0A 4DV3Q 2JK8A 3S1RB 1A2UA 4F7XA 4K6DA 2E75C 1B70B 1JB3A 3VR6A 5L37A 2JE6I 1HZBA 3W5OA 2PZWA 5IYDG 5M3MB 3NENA 4CJ0B 1L2FA 4LFBL 1PH2A 4A3EB 1I4XA 4R4CA 1RF2D 2P5ZX 1D1KA 3AFPA 1R4QB 2NZOA 3WDNA 1Y1VG 1G2TA 1QILA 4BXXH 2EVBA 2WB1G 2CVRA 4RGNA 1YITA 2UXBL 1WYDA 4GOPB 1MGSA 1PH9A 1KC8C 2EY5A 3A0JA 5DEHA 4MTNA 5M3MG 3F2BA 1IHZA 5IT9c 1UEBA 4RHSA 2IY5B 1CKNA 1EY0A 1KNEA 1HTPA 3DEOA 1STAA 3I4MH 1ESFA 3A5UA 2BH2A 4LMQD 1RODA 4RGOS 2I46A 1CFMA 4RA8A 1IBMQ 3VYTA 1BBUA 1IW7C 1CTMA 2UXBQ 4LF9L 3F8TA 1ICWA 1WTXA 4PG3A 1EYGA 1GUNA 4A4IA 5GADC 2QEJC 5DAUA 3A54A 5IYDH 1ENCA 1QNUA 1AZPA 4NW2A 2F3VA 1CHPD 4IPDA 1NMFA 1TQOA 3D6WA 1CUKA 2LXKA 3UDGA 2L4NA 4RWSC 3BZDB 1JJ2A 5JPNC 3HOXB 2DJGC 4DN4M 2LSSA 2FMMA 2LY7A 4FF1A 2B2UA 2DGYA 3A56A 2HHHQ 1XYIA 2V1CC 2A73B 1RJTA 2K7VA 1FR3A 2B39A 5EBDA 2QF7A 4J8QA 4I7AA 4PNYA 1PZJD 1X3PA 4B3ML 1HR0L 4IFDH 1JC7A 4EQ5A 2G5DA 1PTOF 3U4VA 1N36Q 3UDFA 3W3AA 1VQFA 1HA6A 4B3SQ 4P73A 5DM63 1S5BD 4L5QA 4YCVA 2ATWA 4XT1B 3CRLC 4IOCA 4ZCKA 5ISRA 1HNXL 1DOLA 1KLGD 1T9HA 5DLQE 1VMPA 3MEFA 2XRQD 3F1ZA 5C4JB 1JMCA 2PO4A 1J9OA 1PTOC 3CW2C 1DJRD 1IBLQ 2GA4B 1M8AA 3PUXA 5E4XA 1SN8A 3FVQA 4DR6L 4DV6L 4GS3A 2F4VQ 2ZM6L 1VS0A 2F4IA 1PZID 2WINB 1I50H 1DD2A 3KF6B 3KLSX 4Q0FA 1HZCA 4A3KB 4B3RQ 4JBKA 4A76A 1PA6A 2RA4A 3O13A 3MXUA 1LTLA 3S2DB 3U9SA 5J22A 1JICA 1O78A 3QOJA 2L15A 2PW5A 4DU9A 4K8IA 4KJOA 5CV9A 3M4OH 2L55A 1B53A 5BN5A 4JI2L 4GN3B 1H9JA 5IP9H 1NE3A 3T51B 1NMGA 1OXSC 2HQEA 1XTCD 2K5DA 3PIP3 3PIOA 2ALYB 1TU2B 1UE6A 3DHQA 4JOIC 4UAIA 1XWEA 4LFCQ 2Q8RE 3NK9A 2OQKA 2NYZD 3UE1A 2JYOA 3C2PA 4JI5Q 5IY0A 1XMOQ 4A3GG 2OXPA 4HMIA 4KMUC 3GO5A 2J4XA 4KKUA 1UE5A 1EQQA 1P8LA 5I9PA 1AFPA 4DR5Q 1HH2P 1FGUA 4YCWA 2WAQB 5IGCA 2ICIA 4XTCS 3TRZA 3PO2B 2AWOA 1H9RA 3NBHB 1Q1EA 1A6XA 2EXZA 2OCEA 2CFMA 3DUZA 1LACA 3SR1A 3HOWB 2KEDA 2UXCQ 4A3BH 1RTOA 4A3FG 2FINB 2K5QA 1Y8NB 1U4PA 3MTSA 3HOUB 1L1OA 5IODA 2A74C 4HIDA 1ET6A 1PMRA 5D14A 1JE4A 1SNCA 4TRDA 1HQMC 2EXDA 1GHJA 1XTDA 4JG2A 3ULLA 3D0FA 1B2TA 3AFQA 4X3UA 2Q8TA 4DA2A 2KHJA 4H7BA 4JVZA 4GNXB 4KKTA 2XWJB 1YHQA 3S15H 3HOZH 1I4RA 5IP9G 2K5WA 5JJZA 2H4OA 4LNQA 4X3KA 4J15A 1E2VA 3E9HA 5H1SE 1KABA 3J81E 1NR2A 4WJ4A 2F0TA 1IKMA 5CGKA 3FRPB 3U50C 1XXGA 1MBYA 3NQTA 4XQQA 3DMUA 1EFWA 4ILWA 3NUCA 1I6VC 3VA5A 3M4YA 2Z8LA 1A3UA 3M4QA 1I4PA 3CCSA 3S24A 1UAPA 3HKSA 4HAEA 1CKMA 3FKIG 4DR4Q 4LF9Q 3JAML 1ZYRC 1SNDA 4C1NI 5ELDA 4KHVA 1AH9A 4DUZL 1J6QA 3HKZE 1EUJA 2PYKA 1DCZA 3OWEB 1BCPC 3L0OA 1S5ED 4LF5L 4KY5A 3M3YB 1K3BC 2PMZB 1BNZA 2NN6H 2G9HD 1E2ZA 3SEBA 1HHVA 4B3RL 3GTQH 2DNEA 2A5HA 1IYUA 3OWFA 4A3FB 2UUAL 1KDAA 2F0QA 2F0VA 3CMAA 1VQKA 3J80E 3PO2H 2RBMA 4QGUA 4GN5A 1Q8IA 3NP8A 1EZ6A 2EYHA 2EY6A 3QO2A 4A3EG 1OXTA 4A3JH 2PNHA 4FVMA 3QOLA 4X66Q 4NDXA 1B9MA 3K80C 1EY7A 3FEWX 1HR0W 1ET9A 1LABA 3AEVA 1X65A 2Z6KC 4JI0Q 1QB5D 1TS2A 2QW7A 2PW7A 1X56A 4KK7A 1F2YA 1VQDA 1ZEQX 3E0JA 2EYLA 4C3JH 3GQBA 1SNMA 1UWVA 2D5DA 5ELOA 1T5XD 1VQLA 5IE8A 2QEXA 3S1MH 3RN2A 1S3OA 2RDHA 4K0KQ 1XPOA 2C9OA 5C0XG 2AUJD 4LUZA 4LAAA 1K8GA 1PHJA 4CBVA 1CZWA 4LFCL 3SHLA 4EVOA 2WV6D 4N9PA 1L1OB 1TVXA 1CT1D 1I6HH 4J6HA 1LTAD 3HZXA 2IX3A 4DR1Q 1KDBA 4CDFC 1KRTA 3MFGA 1PVOA 4DNRB 2A68C 1CK1A 2LXJA 3IRBA 3F2DA 4JYAL 2F52A 1PH4A 4EQPA 4LF8L 3HOWG 1QVFA 4O0AA 1JB7A 4NXMQ 4IJHA 2LKVA 1ONLA 2UUCQ 4JV5Q 3KDFA 4IURA 3HEJA 1A8VA 4BXXG 4YCUA 1SYDA 4IQZA 3M3YH 4K5VA 3KYHC 1FVIA 1QVCA 1EFID 3T1HL 1JQYD 3NTKA 3H3VC 2RF4A 5LL6S 1Q1BA 3BU2A 2ZTDA 1HA5A 4A3CH 1NCVA 4GLXA 2GVAA 3I70A 1SE4A 1GXDC 1BR9A 3LWUA 4O42A 1K0RA 4R8IA 1O7ZA 5IWAL 3FPPA 1A63A 4A3CG 2VNUD 4B9WA 3I4MB 1Q46A 4JI1Q 4HTHA 1SYEA 2NZHA 2RSNA 1GHKA 3CKIB 2KHSA 1SYCA 1BQQT 3K5NA 1SEBD 1XPRA 1YJNA 4FXKC 2E2JH 4HEDA 2L9HA 4A3BG 2Q2IA 4PQXA 3ZJYC 4N8FA 5ELNA 4DR7L 1VQBA 3KF6A 3MWYW 1CM9A 1Y8PB 5D65A 2AUKA 3JC66 4H02A 1VQOA 5C0XI 3I4NH 4RH6A 2WACA 2HT1A 2RDFA 5CV6A 1VQMA 2Z6KA 4ULLA 4UHVA 5KYLA 2JA8B 2PQEA 1UNSA 2VQFL 2JA5G 1SE3A 2A6ED 3M85A 2G9DA 4RG1A 2EJMA 4X3TA 3H3VI 5GAEC 3IL8A 1FJGL 1EY5A 3TZDA 2WB1E 1D5XC 1U0LA 2A8VA 5KEEA 1PH3A 5COYA 4GZYC 1EIFA 2F0FA 5CV8A 1DYQA 4HCEA 4RCOA 1Q3LA 4LWCA 4X3SA 1QZHA 1EL0A 3EIVA 5CR3A 3GTMH 1EWCA 4JI6L 1BCPB 4N8X1 3UE0A 1SE8A 4X66L 1VQ7A 1A15A 3SGIA 2X6LA 3CCUA 2Z1CA 1N33Q 2PI2E 2F0GA 2JA6G 2F0IA 3E5SA 4DR6Q 3PCOB 4DV1L 1CA6A 4OONA 3NWTA 4P2CB 1JJGA 4JI1L 3D4WA 3BG3A 4DGZA 2CW0D 1Q7YC 1WTOA 2R7ZG 4GKJQ 3GP7A 3GTLH 2F0HA 1B1ZA 2K5HA 3GTQB 3J81c 1PFSA 2C35B 4DUYQ 4IN3A 4TQUS 4L8JA 1Z7TA 2YU9H 1MSHA 1STBA 2F0OA 2B29A 3J7YW 2AHOB 5BR8Q 5D3DA 1V1PA 3I8ZA 3A55A 3SVMA 2XWBB 2K4KA 4IUQA 1KIXA 1EWHA 1K9MC 4DFAA 1HPCA 2CQAA 4OELB 3NTIA 2VW9A 3K0YA 2GVBA 2NVTH 1CKNB 5JJKA 4BY1B 1K8AC 5IYCG 2H5XA 4IUTA 1XNQQ 4ZQ3A 1IBKL 1VQAA 3HS0C 4YY3L 1NNXA 1V1QA 2AQ1B 3URYA 3CCEA 5FLMG 1KDCA 4V0BA 3GV6A 1N34L 4KHPQ 1JWUD 3NXWA 3CXCA 1W2BA 3UI2A 3RR5A 1Q86C 2ZJQA 2OTJA 3QJYA 4HJAA 4ME5A 1WTVA 1I4HA 3VYRA 3TN2A 3P7JA 2JEBI 5KNBA 1ZXTA 3ITPA 1QCBD 1W6KA 1MSGA 1TWHH 3I55A 3MEHA 1WFQA 5EKIA 1LT3D 5LMUQ 5DNFA 2L1BA 2K14A 4A3DH 4L5SA 2CCZA 4NP5A 4JI7Q 3KBXA 1I6HB 1IBLL 3G48A 2MHVA 1I4QA 1OXXK 4IFDI 4ZUJA 4CJ1B 3H94A 1F9PA 1YHAA 3PUVA 5JJIA 4A93B 1TT2A 5CV5A 5FLXc 3ERQA 1GKHA 4K2KA 3KK7A 3STBD 5IGBA 5I4DA 4DV4Q 3HOZB 4OL7A 3JAMi 3BS1A 1QG7A 3I4NG 3A8KE 1TS3A 4RFBA 1EYDA 2MFIA 3V05A 5C4XH 4IJLA 2MQHA 1E3PA 2QDLA 5K5PA 1EU3A 3IKJA 1UE1A 3K6OA 3GTLB 4JW0A 2WKCA 1GJXA 2HCIA 4X64L 1B4OA 4C56C 2DNCA 5E7NA 4G4KA 4DAYA 3H09A 3AB9A 1E24A 2NBFA 5M5WH 2R93G 2HIXA 1CKOA 3RLOA 3HG9A 4C1NK 3HKZG 3Q22A 4A3IG 5NUCA 1SFOB 5GROA 3ULJA 1LTBD 1ESRA 4GNXC 2VS1A 1EEFD 3ICEA 1JCKB 1FNVA 3S1QB 3CCVA 2B8FA 5E3FA 1JOQA 4C3JB 1PH5A 3NE5B 2R7FA 2PZTA 2RDGA 3C3LA 3MHBA 1XMQL 1YNNC 3HOUH 1Y69U 4B3TQ 4KLKA 1WCMG 1G51A 1D2BA 3S9WA 3MVVA 2FHTA 3ONAB 4ZK9B 1B8AA 4QUCA 5IGDA 2EYPA 2R6GA 1XNQL 4OX9Q 4FYDA 4B3MQ 2JA5B 4BA1I 1B50A 1PXUA 3H6MA 2UUAQ 3GTGH 1H9MA 3W1GA 1PRTF 1SDFA 2HDMA 1PTOB 4YWKA 3J81j 2IHFA 1WTQA 2E5LQ 1HFGA 4XYOA 1I3QH 2EQSA 2K04A 2KBNA 1STGA 1TY2A 1U4MA 2Q2HA 3P1HA 1D1IA 4BBRH 3HOYG 2LS01 1X3EA 4JC0A 4BY7B 2R61A 3HP3A 1MD2D 3PO3G 1S5FD 1PYSB 1STEA 4A93H 1R4PB 2E74C 4JPBW 1L1OC 3CC2A 4H44C 4C3HB 5C3WA 2MJ8A 3S17B 1RL2A 1EEID 2D0OA 1HR0Q 1LTRD 1O7YA 5C6AA 4JYAQ 4R4TA 3GTKH 3ZYYX 2ZXPA 4N9TA 5LHY1 1EIGA 3VDYA 2NN6I 1QJOA 3CRKC 1AE2A 1HRJA 2H1EA 1SJED 2MNAA 2WIIB 4G7HC 1FD7D 3K0XA 5HGQA 1N9WA 2JA7G 5IYBG 2IWHA 3V96A 1Q81C 1ASYA 3LNNA 1E7ZA 4DF7A 1BBWA 2XN9C 3OW2A 2D0PA 3QB3A 1PYWD 3M4PA 2NVQH 3EBEA 1OXUA 1ILPA 2F0EA 4KD3A 3D3RA 5IYCH 1QZGA 1LTID 4DV0L 2ID0A 4YIJA 1EY6A 2B2WA 3RZDB 1D5MC 4FF3A 4CKEA 1P16A 4PZ8A 2RQXA 2R93H 3PSIA 1K0SA 4IUPA 5EAYA 3OIQA 4EX5A 1PV4A 5C3EH 4RAUC 2YTXA 4DV7L 3IFTA 1RDPD 4A93G 1MKHA 1ILQA 1V1OA 4BS9A 1XJVA 3HOVG 1W6JA 3C46A 1FNUA 4LFAQ 4R4OA 2EJFC 2R92B 4IPGA 4P74A 1AZQA 3T56B 4QJFA 5F2DA 3C1EA 3FDTA 3P75A 4QMGA 1YJ9A 2N49A 2BA1A 3U9OA 1H9SA 2ZM6Q 1J5EL 1E1OA 2QDBA 4F87A 4JV5L 1VQIA 1IBKQ 2MPMA 1T5EA 3T13A 4FF4A 4HSVA 1VQHA 1V43A 2MO1A 3AMUA 2I0QA 1SYFA 1PH6A 4QCLA 3AU7A 4OO1G 5C5MA 3VR3A 2X6GA 1SNQA 1EIYB 5IGEA 4DNIA 4EGVA 1N32L 4IPCA 1A3TA 4CKBA 2WFWA 2VXWA 3OIPA 1KL9A 3I90A 1W3SA 2A19A 3BVMA 3K5LA 1WVLA 1LTSD 4JI8L 1B9NA 3GTOB 5FO9B 2F0PA 1O7LA 5EKLA 2E2HH 2JSOA 2V4DA 3MZ5A 3OOCA 1N34Q 3S14B 1LT6D 1EQRA 4K14A 1LLRD 2KQ3A 4X62Q 3GTKB 1YBYA 4DR7Q 5CV7A 1PH8A 1YHBA 1HNZQ 2A69D 1A3VA 3J7AF 4WFN3 1YEZA 3DLLA 3DM1A 5K36H 1J8IA 2KCCA 3A8IE 3C1FA 2B2UC 2I5HA 1BCPF 2WKDA 5C4XG 1SROA 3HGBA 2B2WC 2NTTA 1SFOH 2N78A 3FPUB 3K7UC 4AIMA 3CCMA 1G291 3SE0A 4CKCA 2BH8A 2Z4HA 3BZKA 1VQNA 4DR5L 1WTRA 5JEAJ 2JEAI 5C44B 3S2HB 3CD6A 2KJXA 5I2YA 1TWGB 1FJGQ 4X6AH 3CCQA 3SK8A 4K5WA 3KDFB 4A3BB 2NZ1D 4JK1C 2OEOA 4K8JA 5C0XH 1CHQD 1Q90A 1PH1A 3Q24A 5M9OA 2R7ZH 5CBEE 3S1QH 4A3DG 3OPOA 2E8GA 2CWPA 3LWEA 1D8LA 1S5DD 3CQZB 1MIUA 4X62L 4S3SA 4A3LH 1IL8A 2MP1A 3H3VH 4DR1L 2JA8G 2B2VA 4O2DA 1VQ6A 2M00A 2CH4A 5GAHC 4RKBA 4WJ3M 3SK4A 5G3LF 4POFA 2A6HC 1TWAB 4KTAA 4ABNA 4PZ6A 2BE5D 1SMYC 3SK5A 4A3EH 4POGA 5J1ZA 4OWWB 4C3HH 2VQFQ 4KN4C 3VR2A 1Z9FA 3NBHA 1YJWA 1VQCA 3L9AX 4E6IA 4LF6L 3DEPA 2E2DC 1KNAA 3I3CA 4QQBX 3RLFA 1QNKA 2OQ0A 5EBCA 1N33L 1G8ZD 2DY7A 4QUFA 3R3OA 3SK6A 2O2LD 5EPKA 2WAQG 1LT5D 5JEAG 4R9WA 1GD7A 4JI4L 4HJ9A 4TVAB 4PZ7A 4DK6C 3H0GH 4A3IB 2F03A 5EPLA 3TP6A 2WP8J 5ELBA 1GUGA 1JJCB 3WWVA 1B7YB 4HR7B 2EZVA 2F0DA 2XSCA 4AYBG 1KHIA 4OGQC 1FL0A 3GTPH 4I7ZC 3I4OA 3JAME 5EKKA 3ULPA 5KYIA 4LF8Q 5IWAQ 4A3MH 2IT1A 2PNRC 4FXGC 5LMUL 1SJHD 1LTGD 4QIWE 1C48A 1EY4A 2EIFA 2HUGA 2KCTA 3J80c 4HIMA 2AQ2B 2A1AA 2BE5C 2RVLA 4DR3Q 1TS5A 3G7LA 2K5NA 4L5TA 3H15A 1WOCA 4DAPA 4C2MH 3BVGA 5EQ0A 3RLNA 5CMDA 1N36L 2R92G 1PRTB 2ICEC 4F8MA 4IPHA 4YHHQ 1EU4A 3G71A 4K0KL 2EYMA 3PV0A 3RMHA 3HOYB 3HKZB 5AJ3Q 3OW7A 4LUVA 4HJ5A 1JOOA 4JI3Q 4G7ZC 1IBML 2PMZE 1IYJB 3KLSA 4GN4B 2VUMH 1EYCA 1ZYRD 3STBC 3I91A 4L63B 2UUBQ 5I2XA 2KUMA 1VF5C 2JXMB 4L5RC 1QUQA 4KV6A 3X3MA 5JOBA 1I4GA 2XGTA 1HFNA 1DXMA 3KF8A 1D6EC 1WCMB 2IX0A 3I72A 3J7ZC 2JA7B 1K73C 3GD7A 2CHBD 2RCFA 3K7AH 3HOVH 3QR8A 3QG1A 5AFWA 1JOKA 4JI7L 5CORA 3R93A 3S17H 3J81i 4JI5L 3EQLC 2VQEL 4EQOA 1X54A 2CWAA 2D9UA 1XMQQ 3CU7A 4PV1C 3S14H 2Z4IA 4DR2L 1TWCB 3TMEA 2EDGA 1AN8A 1NTGA 3E9IA 4X64Q 3Q0AA 4MZ9A 1SAPA 1K28A 5IGFA 3I56A 1VQEA 1MJCA 1EWIA 2RHSB 2F0UA 2Z6BA 1KD1C 4H13C 4LUOA 1X3QA 4PMCA 4OHJA 3HFZB 5A2QL 2XTIA 2AQ3B 2BA0A 2F1MA 1CA5A 3T16A 2VY3A 3M4OB 4A3MB 2NVYH 1JWMD 5IIFA 3SXHA 1NBWA 1DOKA 2KECA 4XQJA 2TMPA 2YV5A 4CDEC 3BDOA 1XMOL 2F0JA 2YYZA 1PDQA 5GQOA 1H95A 3GTMB 1M4VA 2SNSA 1V9PA 3V2TA 1OO9B 3EVQA 1YVCA 4BA2I 4CDCC 1VQ8A 3FKIB 1SYGA 3I2ZA 3A7LA 3L7ZC 4GOPA 1L0YB 4DK0A 1V8QA 5M5YB 4GLVB 4LF4L 3PMFA 1C9OA 1HTLD 1HXYD 2R93B 4JBMA 1TXYA 4DK3C 3PO3H 3SDZA 1DOMA 2K1BA 3G4SA 5IP7G 1OXVA 4UDUC 2K03A 3U58A 2Q2UA 1HUMA 2GN5A 5KRUA 4A75A 1PFBA 2WAQE 4IUVA 4DNTB 1Q82C 1ENAA 2R92H 3CHBD 4F88A 2M2LA 3UDXA 3A8JE 3S15B 3TS0A 1FYCA 1L0WA 4JI3L 5HGTA 4Y7NB 2FXQA 2K01A 1TWAH 1WCMH 2KCNA 3U4ZA 3KF8B 3GTGB 4BWGB 1K8OA 1AE3A 4LF7L 1PTOH 1F9SA 1L0XB 1QUQB 1EYAA 4HMJA 2BOSA 3MXPA 1A62A 5C4ZA 2EPBA 4A3LG 4A3MG 5IOCA 3S1NB 2A6HD 3TQYA 2K32A 3GTJH 2E2IB 1X3FA 4FDBA 3HOZG 4QY7A 4OEMB 2B63H 2JA9A 3UDIA 3PO2G 3OHXC 3H0GG 1GUTA 3PF4A 4AQYQ 5IT9E 1STYA 4ALPA 3TDQA 1HQRD 1B3AA 4LK1C 4A3GB 5JEAH 3K5OA 1WTPA
chains in the Genus database with same CATH topology
3RD4A 1C4QA 2XNAC 4U68A 3RUZA 1D5ZC 3VR4A 4U673 4K5XA 4TSSA 2IL8A 1PZKD 1BO0A 1PTOD 2ENBA 1EQVA 2KEEA 3WOFA 4DXGA 4IFDG 1E2WA 5D3IB 2IPKD 5JVH3 5JPMC 3NPPA 3BVZA 5C4XB 4CHTB 4XDXA 4PMBA 1GUWA 2EOTA 1NR4A 3ND8A 1LV9A 3OSOA 4C2MB 3L3OC 1R9TB 2B2YA 1CI3M 3FMCA 1B44D 2DY8A 4ODGA 5I6WA 2EY2A 2SEBD 1S5CD 2F0MA 4MN3A 4KD4A 4XIGS 2B2YC 5T1IA 1KTKA 1QOHA 1YNJD 5FO7B 5JVG3 4OO1H 3K7AB 4IUNA 2BDOA 3PUZA 2J0TD 1IKLA 3N6RA 4K2LA 1NUCA 2R7ZB 1SSOA 3P20A 5ELEA 1RHPA 3NSWA 2F0WA 4AYBB 5KNCA 4DK1A 4WORA 1GUOA 1F2MA 2FMCA 3PUWA 2EE1A 2QCPX 1Z47A 2PPBC 4CGYB 3M7NA 3MA2B 1NAPA 2VB3X 2HDLA 2ZXRA 1K8MA 1STNA 1TWFB 2KOLA 4XYQA 1U4RA 3EROA 4K6LA 4KI0A 1KLUD 4RHRA 3W2DA 3EJIA 2E76C 3D4RA 4FF2A 2Y0SB 4KN7C 5C4HA 2OF1A 3I4LA 2O5JC 2BCOA 3TBIB 4KY7A 2VB2X 4G57A 1AEXA 2N55A 1G6ZA 5FLXE 2L12A 3Q6SA 3M7GA 1MI2A 2CW0C 1CQFA 2VUMB 4WRDA 4J1MA 2SDFA 4HSPA 5CBAE 1Q12A 4RGMA 1RKNA 5I9OA 2RKSA 2ZT9C 2RSOA 4EQNA 3ND9A 5KIXA 5EGTA 2D62A 2E2JB 1UUPA 3K59A 1RTNA 4DAVA 3RZOB 2WB1B 2C5CA 1DONA 2K28A 3K58A 2MGSA 3NTHA 5K36G 4B9XA 4KHZA 3TP7A 5KNDA 3NWSA 3D31A 5A2QE 2B8GA 3LX0A 4QB4A 3VYSA 3TSSA 2N88A 4MIUA 2IW3A 1ML0D 5JAVA 3KLRA 2L11A 1BXTA 4KY6A 2NUCA 2L5TA 1S4ZA 1BCPD 2M9VA 2NTSA 1PRTD 5FK9C 5M5WB 3HRZC 3TP8A 2NVQB 4RGTA 4L6TB 3D6CA 3D8GA 2B2TC 3Q23A 2EY1A 5E4WC 1G91A 2NB0A 2E2HB 4M8AA 1C8CA 1AP0A 3R2TA 2FJ2A 3BYTB 2QKIC 1NSNS 1TS4A 4QF4A 3BDCA 1WTWA 3GTPB 2JA6B 5EJWA 1O80A 5J39A 4IUUA 1JR0D 1SBBB 5G3LD 2NVXB 4ZLTF 1PFNA 2F0LA 3H91A 5CC4A 2O4XA 5EPJA 1IW7D 5M3FB 1SYBA 1X32A 1UEAB 2J7ZA 1TWHB 2A68D 2EJGC 1G2SA 1PFMA 4LJZC 4A3JB 1WD0A 1Z6HA 1F9RA 3R8BA 1DM0B 2KA7A 1TR5A 1F9QA 5IGGA 4HCSA 4BBRB 3E6ZX 4ZUIA 5CV4A 4H0LC 2X69A 4O1NA 3MXGA 5HURA 1H9KA 5BN4A 4OIJA 2D2CC 1EY8A 4FO2A 1SMYD 2XVSA 1RD9D 2OT2A 5KGUA 1YNND 3VR5A 4R8NA 3HOVB 2I07B 3BYYB 1EZ8A 3VYUA 1Y1VB 3J80L 2PZUA 5C3EB 2F0SA 2NVYB 5IT9L 4RKLA 1WD1A 1ZKOA 3F2UA 2LMCB 3T4AC 3EFXD 1KAAA 3G6JB 5ELFA 5I6YA 3MXNA 4ZKCB 2K33A 4C3IB 4NMZA 3QIAA 4C3JG 1STHA 1JORA 3KBGA 1HUNA 4QIWB 4WJWA 5BN3A 4FNFA 1YNJC 3K57A 2BDNA 3S1MB 2SOBA 1AW7A 2AWNA 3DWPA 4C3IG 4KKSA 4FXDA 1E0BA 3PUYA 4ZKBB 2YU9B 1SNPA 1RCVD 2A69C 2KVMA 3PO3B 1U4LA 4OO1I 1I3QB 4XXEA 2EYOA 3A7AB 3BDLA 2NN6G 1U9RA 3I4NB 4OIKA 3TP5A 1GOZA 1IYVA 5ELCA 4TKOB 3GTJB 1H9SB 3H0GB 4ZRZA 1QWYA 1F2ZA 3DWAA 4RCNA 4IFDJ 4NKLA 2ZXOA 4FP5D 4KJNA 2EYFA 3MC0B 4JBWA 1CZGA 2O5IC 2FFKB 5T1GA 2JP1A 1DZ1A 3J7AV 1K83B 3MFYA 2F0KA 1BF4A 2L0CA 1BBXC 2XRSD 1BOSA 1Y1WB 2XIWA 2EYJA 1ENFA 2IX1A 2R3ZA 5FO8B 1EOTA 1BUVT 4M1UB 4ZAIA 3D4DA 4IALA 3K5MA 3NQIA 3OMCA 2F0NA 5C5LA 3VA7A 5DM73 2K05A 1EY9A 1SNOA 2F3WA 2B2VC 1VCIA 1F77A 5TSSA 1PRTC 2NVTB 2IJ0A 3IFDA 3T53B 2HCCA 3DWQA 1BDOA 3EA6A 1EQTA 1VDZA 2TSSA 4DXFA 2K6AA 1FGBD 3WOEA 4IZ8A 1CQVA 5M5XB 1V1PB 5FLXL 2DN8A 3X3NA 3GV3A 4XQNA 2MUYA 2PCFB 1LTTD 5C3XA 2B2TA 1II3A 1LT4D 4A3DB 4BBSB 3R2IA 4ZYSA 4V190 2Q8IB 5LL6X 5FKAC 1JWSD 5FOBB 1Y8OB 3N52A 1XX8A 5C0XJ 3OMGA 1I50B 2SNMA 3J81L 4Q5VA 3MAQA 1TKWB 3I73A 3S16B 3PIO3 2B63B 5A35A 1HCZA 4PMWA 4CJ2C 4XT3B 3TZUA 4B08A 1LO5D 1QE6A 3IAYA 1PLFA 4G7OC 2A6EC 2NWGA 3NHHA 1FNWA 1SXTA 4ID6A 1SE2A 3DXJC 3NBIA 4HN7A 1A2TA 1TIID 4C3HG 1EIHA 2QILA 5E1FA 1GUSA 5CYUA 4I65A 2LFNA 1VF7A 1VMCA 1F2LA 4MHEA 3KUPA 3QWNA 4Z9CB 1TY0A 3S1RB 1A2UA 4F7XA 4K6DA 2E75C 1JB3A 3VR6A 2JE6I 2PZWA 5M3MB 4CJ0B 4A3EB 1I4XA 1RF2D 1D1KA 1R4QB 3WDNA 1G2TA 1QILA 2EVBA 2CVRA 4RGNA 1MGSA 2EY5A 5DEHA 1IHZA 4RHSA 1EY0A 1KNEA 1HTPA 3DEOA 1STAA 1ESFA 4LMQD 1RODA 4RGOS 2I46A 1CFMA 4RA8A 3VYTA 1IW7C 1CTMA 1ICWA 1WTXA 1GUNA 2QEJC 5DAUA 3A54A 1ENCA 1QNUA 1AZPA 4NW2A 2F3VA 1CHPD 1TQOA 3D6WA 2L4NA 4RWSC 3BZDB 3HOXB 5JPNC 4DN4M 2FMMA 2LY7A 4FF1A 2B2UA 3A56A 1XYIA 2A73B 1RJTA 2K7VA 1FR3A 2B39A 5EBDA 2QF7A 4J8QA 4PNYA 1PZJD 1X3PA 4IFDH 1JC7A 1PTOF 3W3AA 1HA6A 5DM63 1S5BD 4XT1B 3CRLC 5ISRA 1DOLA 1KLGD 1VMPA 2XRQD 5C4JB 2PO4A 1J9OA 1PTOC 1DJRD 2GA4B 1M8AA 3PUXA 5E4XA 3FVQA 2F4IA 1DD2A 1PZID 2WINB 4Q0FA 3KLSX 4A3KB 2RA4A 3O13A 3MXUA 3S2DB 3U9SA 5J22A 1JICA 1O78A 3QOJA 2PW5A 4DU9A 4K8IA 4KJOA 5CV9A 2L55A 1B53A 5BN5A 1H9JA 3T51B 1OXSC 2HQEA 1XTCD 2K5DA 3PIP3 3DHQA 1TU2B 4UAIA 1XWEA 2Q8RE 3NK9A 2NYZD 2JYOA 3C2PA 2OXPA 4HMIA 4KMUC 3GO5A 2J4XA 4KKUA 5I9PA 1AFPA 5IGCA 2WAQB 2ICIA 4XTCS 3PO2B 2AWOA 1H9RA 1Q1EA 1A6XA 2EXZA 3DUZA 1LACA 3SR1A 3HOWB 2KEDA 1RTOA 2FINB 2K5QA 1Y8NB 1U4PA 3MTSA 3HOUB 5IODA 2A74C 1ET6A 1PMRA 5D14A 1JE4A 1SNCA 4TRDA 1HQMC 1GHJA 1B2TA 4X3UA 2Q8TA 4DA2A 4H7BA 4KKTA 2XWJB 1I4RA 2K5WA 5JJZA 2H4OA 4X3KA 1E2VA 1KABA 3J81E 1NR2A 1IKMA 2F0TA 5CGKA 3FRPB 1XXGA 1MBYA 3NQTA 4XQQA 3DMUA 4ILWA 3NUCA 1I6VC 3VA5A 3M4YA 2Z8LA 1A3UA 1I4PA 1UAPA 4HAEA 3JAML 1ZYRC 1SNDA 4C1NI 5ELDA 4KHVA 2PYKA 1DCZA 3OWEB 1BCPC 1S5ED 4KY5A 3M3YB 2PMZB 1BNZA 2NN6H 2G9HD 1E2ZA 3SEBA 1HHVA 2DNEA 2A5HA 1IYUA 3OWFA 4A3FB 1KDAA 2F0QA 2F0VA 3J80E 2RBMA 1Q8IA 3NP8A 1EZ6A 2EYHA 2EY6A 3QO2A 1OXTA 4FVMA 3QOLA 4NDXA 1B9MA 1EY7A 3FEWX 1ET9A 1LABA 1QB5D 1TS2A 2PW7A 4KK7A 1F2YA 1ZEQX 3E0JA 2EYLA 3GQBA 1SNMA 2D5DA 1T5XD 2RDHA 2C9OA 5C0XG 2AUJD 4LAAA 4CBVA 1CZWA 3SHLA 4EVOA 2WV6D 4N9PA 1TVXA 1CT1D 4J6HA 1LTAD 3HZXA 2IX3A 1KDBA 3MFGA 4DNRB 2A68C 1CK1A 4EQPA 2LKVA 1ONLA 4IURA 3HEJA 1SYDA 4IQZA 4K5VA 1EFID 1JQYD 3NTKA 3H3VC 5LL6S 1Q1BA 1HA5A 1NCVA 3I70A 1SE4A 1GXDC 1BR9A 3LWUA 4O42A 4R8IA 1O7ZA 3FPPA 2VNUD 4B9WA 3I4MB 4HTHA 1SYEA 2RSNA 1GHKA 3CKIB 2KHSA 1SYCA 1BQQT 3K5NA 1SEBD 4FXKC 4HEDA 2L9HA 4PQXA 3MWYW 1CM9A 1Y8PB 5D65A 2AUKA 5C0XI 4RH6A 2WACA 2RDFA 5CV6A 4ULLA 5KYLA 2JA8B 2PQEA 1UNSA 1SE3A 2A6ED 3M85A 2G9DA 2EJMA 4X3TA 3IL8A 1EY5A 3TZDA 1D5XC 5KEEA 5COYA 4GZYC 2F0FA 5CV8A 1DYQA 4HCEA 4RCOA 1Q3LA 4X3SA 1EL0A 5CR3A 1EWCA 1BCPB 1A15A 2X6LA 2Z1CA 2F0GA 2F0IA 3E5SA 1CA6A 3NWTA 4P2CB 3D4WA 3BG3A 4DGZA 2CW0D 1WTOA 3GP7A 2F0HA 1B1ZA 3GTQB 4IN3A 4TQUS 4L8JA 1Z7TA 1MSHA 1STBA 2F0OA 3J7YW 5D3DA 1V1PA 3I8ZA 3A55A 3SVMA 2XWBB 4IUQA 1EWHA 4DFAA 1HPCA 2CQAA 3NTIA 3K0YA 4BY1B 4IUTA 4ZQ3A 3HS0C 2AQ1B 3URYA 1KDCA 4V0BA 3GV6A 1JWUD 3NXWA 3UI2A 3QJYA 4ME5A 1WTVA 1I4HA 3VYRA 3TN2A 3P7JA 2JEBI 5KNBA 1ZXTA 3ITPA 1QCBD 1W6KA 1MSGA 3MEHA 5EKIA 1LT3D 5DNFA 2L1BA 4NP5A 3KBXA 1I6HB 2MHVA 1I4QA 1OXXK 4IFDI 4ZUJA 4CJ1B 3H94A 1F9PA 3PUVA 4A93B 1TT2A 5CV5A 3ERQA 4K2KA 3KK7A 5IGBA 5I4DA 3HOZB 4OL7A 3BS1A 1QG7A 3A8KE 1TS3A 4RFBA 1EYDA 3V05A 5K5PA 1EU3A 3IKJA 3K6OA 3GTLB 2WKCA 1GJXA 2HCIA 1B4OA 4C56C 2DNCA 4G4KA 4DAYA 3H09A 3AB9A 2NBFA 3HG9A 4C1NK 3Q22A 5NUCA 1SFOB 1LTBD 1ESRA 1EEFD 1JCKB 1FNVA 3S1QB 2B8FA 5E3FA 1JOQA 4C3JB 3NE5B 2PZTA 2RDGA 3C3LA 3MHBA 1YNNC 1D2BA 1Y69U 3S9WA 3MVVA 2FHTA 3ONAB 4ZK9B 4QUCA 5IGDA 2EYPA 2R6GA 4FYDA 2JA5B 4BA1I 1B50A 1PXUA 3H6MA 1H9MA 1PRTF 1SDFA 2HDMA 1PTOB 1WTQA 1HFGA 4XYOA 2K04A 1STGA 1TY2A 1U4MA 3P1HA 1D1IA 2LS01 4BY7B 2R61A 3HP3A 1MD2D 1S5FD 1STEA 1R4PB 2E74C 4H44C 4C3HB 5C3WA 2MJ8A 3S17B 1EEID 1LTRD 1O7YA 5C6AA 3ZYYX 2ZXPA 4N9TA 5LHY1 1EIGA 2NN6I 1QJOA 3CRKC 1HRJA 2H1EA 1SJED 2WIIB 4G7HC 1FD7D 2IWHA 3V96A 3LNNA 4DF7A 2XN9C 1PYWD 3QB3A 1OXUA 1ILPA 2F0EA 4KD3A 3D3RA 1LTID 2ID0A 4YIJA 1EY6A 2B2WA 3RZDB 1D5MC 4FF3A 4CKEA 2RQXA 4IUPA 3OIQA 4RAUC 3IFTA 1RDPD 1ILQA 1V1OA 4BS9A 1W6JA 3C46A 1FNUA 2EJFC 2R92B 1AZQA 3T56B 5F2DA 3C1EA 3FDTA 3P75A 4QMGA 2BA1A 3U9OA 1H9SA 2QDBA 4F87A 2MPMA 1T5EA 3T13A 4FF4A 4HSVA 1V43A 3AMUA 1SYFA 4QCLA 3AU7A 4OO1G 5C5MA 3VR3A 2X6GA 1SNQA 5IGEA 4EGVA 1A3TA 4CKBA 3OIPA 2VXWA 3I90A 3BVMA 3K5LA 1WVLA 1LTSD 1B9NA 3GTOB 5FO9B 2F0PA 1O7LA 5EKLA 2JSOA 2V4DA 3MZ5A 3OOCA 3S14B 1LT6D 4K14A 1LLRD 2KQ3A 3GTKB 5CV7A 2A69D 1A3VA 3J7AF 4WFN3 3DM1A 5K36H 1J8IA 2KCCA 3A8IE 3C1FA 2B2UC 1BCPF 2WKDA 3HGBA 2B2WC 2NTTA 3FPUB 1G291 3SE0A 4CKCA 2Z4HA 1WTRA 5JEAJ 2JEAI 5C44B 3S2HB 2KJXA 5I2YA 1TWGB 3SK8A 4K5WA 4A3BB 2NZ1D 4JK1C 2OEOA 4K8JA 5C0XH 1CHQD 1Q90A 3Q24A 5M9OA 5CBEE 3OPOA 3LWEA 1S5DD 3CQZB 4S3SA 1IL8A 2MP1A 2B2VA 2M00A 4RKBA 3SK4A 5G3LF 2A6HC 1TWAB 4KTAA 4ABNA 2BE5D 1SMYC 3SK5A 5J1ZA 4KN4C 3VR2A 3NBHA 3L9AX 4E6IA 3DEPA 2E2DC 1KNAA 3I3CA 3RLFA 1QNKA 5EBCA 1G8ZD 2DY7A 4QUFA 3R3OA 3SK6A 2O2LD 5EPKA 1LT5D 5JEAG 4R9WA 4A3IB 2F03A 5EPLA 3TP6A 2WP8J 5ELBA 1GUGA 4HR7B 2EZVA 2F0DA 2XSCA 4OGQC 4I7ZC 3JAME 5EKKA 5KYIA 2IT1A 2PNRC 4FXGC 1SJHD 1LTGD 1C48A 1EY4A 2HUGA 2AQ2B 2BE5C 2RVLA 1TS5A 3G7LA 4DAPA 3BVGA 5EQ0A 5CMDA 1PRTB 2ICEC 4F8MA 1EU4A 2EYMA 3PV0A 3RMHA 3HOYB 3HKZB 3OW7A 1JOOA 4G7ZC 3KLSA 1EYCA 1ZYRD 3I91A 4L63B 5I2XA 2KUMA 1VF5C 2JXMB 4KV6A 3X3MA 5JOBA 1I4GA 1HFNA 1DXMA 3KF8A 1D6EC 1WCMB 2IX0A 3I72A 2JA7B 3GD7A 2CHBD 3QG1A 5AFWA 1JOKA 5CORA 3R93A 3EQLC 4EQOA 2D9UA 3CU7A 4PV1C 2Z4IA 1TWCB 3TMEA 2EDGA 1AN8A 3Q0AA 5IGFA 1SAPA 2F0UA 4H13C 1X3QA 4PMCA 4OHJA 5A2QL 2AQ3B 2BA0A 2F1MA 1CA5A 3T16A 3M4OB 4A3MB 1JWMD 5IIFA 3SXHA 1DOKA 2KECA 4XQJA 2TMPA 3BDOA 2F0JA 2YYZA 1PDQA 3GTMB 1M4VA 2SNSA 3V2TA 1OO9B 3EVQA 4BA2I 3FKIB 1SYGA 3A7LA 3L7ZC 1L0YB 4DK0A 1V8QA 5M5YB 3PMFA 1HTLD 1HXYD 2R93B 3SDZA 1DOMA 2K1BA 1OXVA 4UDUC 2K03A 1HUMA 5KRUA 1PFBA 4IUVA 4DNTB 1ENAA 3CHBD 4F88A 2M2LA 3S15B 3A8JE 1FYCA 5HGTA 4Y7NB 2K01A 2KCNA 3GTGB 4BWGB 1K8OA 1PTOH 1F9SA 1L0XB 1EYAA 4HMJA 2BOSA 3MXPA 5C4ZA 2EPBA 5IOCA 3S1NB 2A6HD 2K32A 2E2IB 3OHXC 1GUTA 5IT9E 1STYA 3TDQA 1HQRD 1B3AA 4LK1C 4A3GB 5JEAH 3K5OA 1WTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1E A;  1CA5 A;  1B53 A;  2B2T C;  3DM1 A;  1U4R A;  1J8I A;  4RA8 A;  1BF4 A;  1BBX C;  5E4W C;  1CA6 A;  1WD1 A;  2B2U C;  1G91 A;  3F2U A;  1ICW A;  1DOK A;  1WTX A;  2KEC A;  4U68 A;  2HCI A;  2XIW A;  1B4O A;  1WTO A;  4UAI A;  1BNZ A;  2IL8 A;  2B2W C;  4CJ2 C;  4XT3 B;  1C8C A;  1AZP A;  1AP0 A;  1HHV A;  2Q8R E;  1PDQ A;  3FPU B;  1BO0 A;  1NCV A;  1EOT A;  2FJ2 A;  2R3Z A;  4NW2 A;  1QE6 A;  4ZKC B;  2NYZ D;  1ILP A;  2KEE A;  1PLF A;  4ZAI A;  4O42 A;  3D6W A;  2NWG A;  4R8I A;  1O7Z A;  2HUG A;  2JYO A;  1WTR A;  1WTW A;  2B2W A;  2L4N A;  1MSH A;  1HUN A;  2RVL A;  4RWS C;  4IUP A;  4DN4 M;  3I8Z A;  3G7L A;  4XDX A;  2FMM A;  2N55 A;  5EJW A;  2B2U A;  2RSN A;  1G6Z A;  1GUW A;  2EOT A;  4RAU C;  2L12 A;  1NR4 A;  1XYI A;  1O80 A;  3SVM A;  3Q6S A;  1EIH A;  4IUQ A;  3QO2 A;  2NZ1 D;  2BDN A;  5EQ0 A;  4IUU A;  1LV9 A;  1ILQ A;  1ESR A;  1MI2 A;  1RJT A;  5CMD A;  4HED A;  2B2Y A;  1DOM A;  2K1B A;  2L9H A;  4ZLT F;  2K05 A;  1PFN A;  5CBE E;  3H91 A;  2SDF A;  5EPJ A;  1X3P A;  2K03 A;  5CBA E;  4IUT A;  2DY8 A;  3LWE A;  1HUM A;  1VMC A;  1X32 A;  1AZQ A;  1PFB A;  2B2V C;  1E0B A;  1F2L A;  2KED A;  3MWY W;  4IUV A;  1RTO A;  4MHE A;  1CM9 A;  2RSO A;  3KUP A;  3FDT A;  2J7Z A;  3GV6 A;  5D65 A;  2FIN B;  4ZKB B;  4MN3 A;  1IL8 A;  2MP1 A;  1G2S A;  1U4P A;  1PFM A;  2M2L A;  2KVM A;  2B2Y C;  3MTS A;  5T1I A;  1WD0 A;  1HA6 A;  1U4L A;  2B2V A;  2FHT A;  2JP1 A;  3ONA B;  1F9R A;  3UI2 A;  4ZK9 B;  1DZ1 A;  3IFD A;  5D14 A;  4QUC A;  3I91 A;  2HCC A;  1JE4 A;  4XT1 B;  1RTN A;  2K01 A;  1WTV A;  2MPM A;  1EQT A;  1IKL A;  2KUM A;  1DOL A;  3P7J A;  4HSV A;  3TN2 A;  1B50 A;  1F9Q A;  4CJ0 B;  1HFN A;  1ZXT A;  1B2T A;  4X3U A;  2Q8T A;  1DON A;  4HCS A;  1SDF A;  2HDM A;  1F9S A;  1MSG A;  2K28 A;  1SSO A;  1WTQ A;  1VMP A;  1HFG A;  2X6G A;  2MGS A;  4OIK A;  5EKI A;  1RHP A;  1G2T A;  5DNF A;  2L1B A;  5JJZ A;  4X3T A;  2X69 A;  1J9O A;  2K04 A;  1U4M A;  2EPB A;  2CVR A;  4X3K A;  3DEP A;  1M8A A;  3IL8 A;  3KBX A;  1NR2 A;  3HP3 A;  1TVX A;  2VXW A;  1IKM A;  5E4X A;  1KNA A;  3I3C A;  4IUR A;  5AFW A;  3TZD A;  3I90 A;  5COR A;  2N88 A;  3R93 A;  4OIJ A;  1WVL A;  1ML0 D;  1MGS A;  1QNK A;  3GV3 A;  5COY A;  2D9U A;  2DY7 A;  2L11 A;  4CJ1 B;  1HRJ A;  4QUF A;  1F9P A;  2MJ8 A;  5EPK A;  2EE1 A;  1Q3L A;  2B2T A;  1S4Z A;  4R9W A;  4X3S A;  2RA4 A;  1EL0 A;  1KNE A;  1O7Y A;  4HAE A;  1SAP A;  1B3A A;  3DEO A;  1NAP A;  1WTP A;  2FFK B;  1JIC A;  1A15 A;  1QG7 A;  2X6L A;  1EIG A;  3N52 A;  5EPL A;  2HDL A;  1XX8 A;  4LMQ D;  5T1G A;  1X3Q A;  1ROD A;  2KOL A; 
#chains in the Genus database with same CATH topology
 2KEN A;  3RD4 A;  3S2D H;  4A3F H;  4DV3 L;  1C4Q A;  2XNA C;  3I7F A;  3FHW A;  1VQG A;  4U68 A;  3RUZ A;  1D5Z C;  3VR4 A;  4U67 3;  4K5X A;  4TSS A;  1S40 A;  2IL8 A;  1PZK D;  1BO0 A;  1PTO D;  1IL2 A;  2ENB A;  1ASZ A;  1EQV A;  2KEE A;  3WOF A;  4DXG A;  4IFD G;  3AYH B;  1E2W A;  5D3I B;  2IPK D;  3HOU G;  1U5K A;  5JVH 3;  5JPM C;  3NPP A;  3BVZ A;  3S1R H;  5C4X B;  4CHT B;  4JCV E;  4XDX A;  4PMB A;  1YNX A;  1X55 A;  1GUW A;  2EOT A;  1NR4 A;  3ND8 A;  5HY6 A;  1LV9 A;  3OSO A;  4APV A;  4C2M B;  3L3O C;  1YZ6 A;  1R9T B;  2NVX H;  4DV4 L;  2B2Y A;  1X9N A;  1CI3 M;  3FMC A;  1XNR L;  4GKK Q;  2UXD Q;  4NB3 A;  1B44 D;  1HNX Q;  2DY8 A;  1WJJ A;  4LFA L;  5FJ8 G;  4ODG A;  4DR2 Q;  1SMX A;  5I6W A;  3CCJ A;  2EY2 A;  2SEB D;  1S5C D;  2F0M A;  4MN3 A;  4KD4 A;  4XIG S;  4DV7 Q;  2B2Y C;  5T1I A;  3CC7 A;  1KTK A;  4LW1 A;  1QOH A;  1YNJ D;  1KAW A;  5FO7 B;  5JVG 3;  4OO1 H;  3K7A B;  4IUN A;  2BDO A;  4DR4 L;  1NY4 A;  1I5F A;  3PUZ A;  4R4Q A;  2J0T D;  1IKL A;  3N6R A;  3KOJ A;  4GNX A;  4YHH L;  4K2L A;  1NUC A;  2R7Z B;  1IXR A;  1SSO A;  3P20 A;  5ELE A;  1RHP A;  3NSW A;  3KLW A;  1TWC H;  2DUD A;  2ZJR A;  2F0W A;  4AYB B;  2IHE A;  3CC4 A;  5KNC A;  4DK1 A;  4WOR A;  2F3I A;  1GUO A;  2AKW B;  2ES2 A;  1VQJ A;  1Y1W H;  1F2M A;  2FMC A;  2R7D A;  3PUW A;  2EE1 A;  4A3G H;  2VUM G;  5AJ3 L;  1I94 Q;  1A0I A;  2QCP X;  1Z47 A;  3LGJ A;  1N8R C;  2PPB C;  4CGY B;  3M7N A;  3MA2 B;  1YIJ A;  3K81 C;  1NAP A;  2VB3 X;  4R4I A;  2CKZ B;  2HDL A;  2ZXR A;  1K8M A;  1STN A;  3CCL A;  1TWF B;  2KOL A;  4XYQ A;  4R1J A;  1E22 A;  3T1Y L;  3G6E A;  2UUC L;  1U4R A;  3ERO A;  4K6L A;  4KI0 A;  1KLU D;  4RHR A;  4DPG A;  3W2D A;  3EJI A;  4NXM L;  1Q8K A;  2E76 C;  3D4R A;  3PIP A;  3PQI A;  4FF2 A;  2Y0S B;  4KN7 C;  5C4H A;  2OF1 A;  3I4L A;  1PYB A;  2O5J C;  5IYB H;  2MO0 A;  2BCO A;  3TBI B;  4KY7 A;  3OYY A;  2VB2 X;  4G57 A;  2QA4 A;  1AEX A;  2N55 A;  1G6Z A;  1R9T H;  5FLX E;  2L12 A;  3Q6S A;  3T1Y Q;  1QVG A;  2JN4 A;  3M7G A;  3K8A A;  2Q2T A;  5JJL A;  1MI2 A;  3E3X A;  2CW0 C;  1CQF A;  2VUM B;  4WRD A;  4J1M A;  2SDF A;  4HSP A;  5CBA E;  4JI4 Q;  1Q12 A;  1TWG H;  4RGM A;  1RKN A;  2JA5 H;  2ZTE A;  5I9O A;  2RKS A;  2ZT9 C;  2RSO A;  4DAM A;  4EQN A;  3ER0 A;  3ND9 A;  3HOY H;  5KIX A;  5EGT A;  2D62 A;  3CCR A;  2E2J B;  2N3S A;  3GDE A;  1UUP A;  3K59 A;  5C3E G;  1RTN A;  4DAV A;  3RZO B;  1CSP A;  2I5L X;  5M3M H;  2WB1 B;  2C5C A;  1DON A;  2K28 A;  3K58 A;  2MGS A;  3NTH A;  5K36 G;  4B9X A;  4KHZ A;  3TP7 A;  5KND A;  3NWS A;  3D31 A;  1LUZ A;  3F2C A;  3W1B A;  1C7Y A;  5A2Q E;  2B8G A;  2HQL A;  3LX0 A;  4QB4 A;  1VQ9 A;  3VYS A;  3TSS A;  2N88 A;  1VQ4 A;  4MIU A;  2IW3 A;  1ML0 D;  3KJP A;  3CPF A;  5JAV A;  3M9B A;  4BBS H;  4BY7 G;  3KLR A;  4NXN Q;  2L11 A;  1BXT A;  4KY6 A;  4P71 A;  3PF5 A;  2NUC A;  4JI0 L;  2L5T A;  1S4Z A;  1BCP D;  4LF5 Q;  2M9V A;  5FJ8 H;  2NTS A;  1PRT D;  5FK9 C;  4A3I H;  5M5W B;  3HRZ C;  4HIO A;  3TP8 A;  1WI5 A;  2NVQ B;  4RGT A;  4L6T B;  5GAG C;  3S16 H;  3D6C A;  3D8G A;  2B2T C;  4IO9 A;  3Q23 A;  2EY1 A;  5E4W C;  2UXC L;  1KQS A;  3BZC A;  1G91 A;  2NB0 A;  5LMN L;  2E2H B;  3A5Z B;  4M8A A;  3BJU A;  1C8C A;  4BBR G;  1AP0 A;  3R2T A;  2FJ2 A;  2RCN A;  3BYT B;  2QKI C;  1Y1W G;  4MTK A;  1NSN S;  1TS4 A;  3HOW H;  2B3G A;  4LFB Q;  4QF4 A;  3BDC A;  1D7Q A;  1WTW A;  1VQ5 A;  3GTP B;  4P72 A;  2JA6 B;  4DR3 L;  5EJW A;  1O80 A;  3FKI H;  5J39 A;  4DUY L;  2ASB A;  4KHP L;  2E5L L;  4IUU A;  4ME3 A;  2ZJP A;  4CDD C;  1JR0 D;  1SBB B;  5G3L D;  2NVX B;  2VZA A;  1LYL A;  4ZLT F;  1PFN A;  2F0L A;  3H91 A;  5CC4 A;  4BY1 H;  2O4X A;  5EPJ A;  1IW7 D;  5M3F B;  1SYB A;  2PQA B;  1X32 A;  1X6O A;  4DV1 Q;  1UEA B;  4Y7N H;  2J7Z A;  1JT8 A;  1TWH B;  2KHI A;  2A68 D;  1J5E Q;  3CP0 A;  2EJG C;  1G2S A;  1PFM A;  4LJZ C;  4JI8 Q;  4A3J B;  1WD0 A;  1Z6H A;  1XPU A;  1F9R A;  3J80 i;  1K3R A;  3R8B A;  1HNW Q;  1DM0 B;  2KA7 A;  1TR5 A;  1UE7 A;  1PH7 A;  1F9Q A;  3E0E A;  5M3F G;  5IGG A;  4HCS A;  4BBR B;  3E6Z X;  4ZUI A;  4BY7 H;  5CV4 A;  4RMF A;  4H0L C;  4QL5 A;  4HIK A;  3S1N H;  2JA7 H;  1HJP A;  2X69 A;  4O1N A;  3TRE A;  5C4J H;  4GOP C;  3MXG A;  3NEL A;  1LM0 A;  4A3J G;  5HUR A;  1H9K A;  5BN4 A;  2Y0S E;  4OIJ A;  2D2C C;  4DV0 Q;  1HZ9 A;  1EY8 A;  1TWF H;  4FO2 A;  1SMY D;  2XVS A;  1RD9 D;  2OT2 A;  2KCM A;  5KGU A;  2E2I H;  2ZTC A;  1YNN D;  3CF5 A;  3VR5 A;  1M90 C;  4R8N A;  3HOV B;  2I07 B;  3BYY B;  5LMN W;  1YI2 A;  1EZ8 A;  1WTH A;  3VYU A;  1Y1V B;  3J80 L;  2PZU A;  5C3E B;  2F0S A;  2NVY B;  5IT9 L;  2VL6 A;  4RKL A;  3PGZ A;  1WD1 A;  1ZKO A;  3F2U A;  1K83 H;  4YY3 Q;  1EOV A;  2LMC B;  3T4A C;  4YWL A;  3EFX D;  4NPS A;  1KAA A;  3G6J B;  5ELF A;  5I6Y A;  3MXN A;  2OWO A;  2B63 G;  4ZKC B;  2K33 A;  2CH4 W;  4C3I B;  3HOX H;  4P75 A;  4NMZ A;  3QIA A;  3RN5 A;  4C3J G;  1M1K C;  1STH A;  3CME A;  1JOR A;  2OTL A;  3KBG A;  1HUN A;  4MNO A;  4QIW B;  4WJW A;  3J7A 5;  2YTV A;  5BN3 A;  1SLJ A;  4FNF A;  1YNJ C;  2DJF C;  3K57 A;  2BDN A;  2UU9 Q;  3S1M B;  2SOB A;  1AW7 A;  5M3F H;  4HJ7 A;  2AWN A;  4LF7 Q;  3DWP A;  3OTO Q;  4C3I G;  4KKS A;  2JJQ A;  4UY8 C;  4FXD A;  4YWM A;  3EN2 A;  2UXD L;  4GKK L;  5LMN Q;  1HNW L;  1E0B A;  3PUY A;  1GO3 E;  4IOA A;  4ZKB B;  2YU9 B;  1SNP A;  4B3S L;  2K50 A;  1RCV D;  2A69 C;  2KVM A;  3PO3 B;  1U4L A;  4DV6 Q;  4OO1 I;  1I3Q B;  4XXE A;  2EYO A;  4OWX B;  3A7A B;  1ICF B;  1MJE A;  4AYB E;  5IP7 H;  3BDL A;  2NN6 G;  1NJI C;  4UP8 A;  1U9R A;  1IZ6 A;  3I4N B;  4OIK A;  4JBJ A;  3TP5 A;  1GOZ A;  4A3K G;  1RIP A;  3A74 A;  1IYV A;  1BVS A;  4LF4 Q;  4OX9 L;  5ELC A;  3KJO A;  4TKO B;  3GTJ B;  3CPW A;  1H9S B;  2K75 A;  4A3K H;  2RHQ B;  4UP7 A;  3H0G B;  2I5M X;  4ZRZ A;  4OWT B;  2Y0S G;  1QWY A;  1KRS A;  1F2Z A;  3DWA A;  4RCN A;  4IFD J;  4NKL A;  2PQA A;  2ZXO A;  4FP5 D;  4KJN A;  2EYF A;  3MXN B;  3MC0 B;  4JBW A;  4GKJ L;  1Y1V H;  4DAY B;  1CZG A;  4AQY L;  1I94 L;  2O5I C;  2N8N A;  2FFK B;  5T1G A;  2JP1 A;  1DZ1 A;  4JI2 Q;  3J7A V;  1K83 B;  3TS2 A;  3MFY A;  2F0K A;  5M5X H;  1BF4 A;  2L0C A;  1BBX C;  2XRS D;  5BR8 L;  1BOS A;  2Z9H A;  4C3I H;  1Y1W B;  2XIW A;  4DV5 Q;  1XNR Q;  2EYJ A;  1ENF A;  2IX1 A;  2R3Z A;  5FO8 B;  1EOT A;  1BUV T;  4M1U B;  4ZAI A;  3NEM A;  4BBS G;  4NXN L;  3D4D A;  4IAL A;  3K5M A;  2VQE Q;  1S72 A;  1E1T A;  3NQI A;  5FLM H;  3OMC A;  3L2P A;  2F0N A;  4LF6 Q;  2AMC B;  5C5L A;  3HOX G;  4DV2 L;  3DM3 A;  3VA7 A;  5DM7 3;  1KXL A;  2K05 A;  3ERS X;  1EY9 A;  1SNO A;  1SRU A;  2F3W A;  2HD3 A;  2B2V C;  1VCI A;  1F77 A;  5TSS A;  3JAM c;  2UU9 L;  2K52 A;  1PRT C;  2F4V L;  5J3B A;  1HZA A;  5M5Y H;  1GVP A;  2NVT B;  2IJ0 A;  3IFD A;  3T53 B;  2HCC A;  3DWQ A;  1BDO A;  3Q8D A;  3EA6 A;  1EQT A;  1VDZ A;  1JE5 A;  1OTC A;  1G6P A;  3RZO H;  2TSS A;  4DXF A;  2K6A A;  4DV5 L;  4X65 L;  1FGB D;  2HHH L;  3WOE A;  1O7I A;  2HIV A;  3FP9 A;  4IZ8 A;  1CQV A;  5M5X B;  1N32 Q;  1V1P B;  5FLX L;  2DN8 A;  3X3N A;  3GV3 A;  4XQN A;  2MUY A;  2PCF B;  3KFU A;  1LTT D;  5C3X A;  1SR3 A;  2B2T A;  4JOI A;  1II3 A;  1LT4 D;  4A3D B;  4BBS B;  1Y14 B;  3R2I A;  4ZYS A;  1C0A A;  2PI2 A;  4V19 0;  2Q8I B;  3B6Y A;  5LL6 X;  5FKA C;  2JQO A;  4UPA A;  1JWS D;  5FOB B;  1Y8O B;  3N52 A;  1XX8 A;  5C0X J;  3OMG A;  3GTO H;  1I50 B;  2SNM A;  3J81 L;  5C44 G;  4OXP A;  4Q5V A;  4GLA C;  3MAQ A;  1TKW B;  3I73 A;  1MHW C;  3S2H H;  1HNZ L;  4BY1 G;  3S16 B;  3PIO 3;  1B3Q A;  2B63 B;  4UP9 A;  5A35 A;  1HCZ A;  2YTY A;  4PMW A;  4CJ2 C;  4XT3 B;  3TZU A;  3I4M G;  4B08 A;  1LO5 D;  1QE6 A;  2K5V A;  3TEH B;  3IAY A;  1PLF A;  4G7O C;  3AQQ A;  2A6E C;  2NWG A;  3NHH A;  4DV2 Q;  1FNW A;  1SXT A;  4ID6 A;  5C44 H;  1SE2 A;  2UUB L;  3T1H Q;  3DXJ C;  3CQZ H;  4HJ8 A;  3NBI A;  4HN7 A;  3CAM A;  1A2T A;  4Y52 H;  1TII D;  4X65 Q;  4C3H G;  3RZD H;  1EIH A;  2QIL A;  4B3T L;  1X3G A;  3RNU A;  2JA6 H;  5E1F A;  1GUS A;  1CSQ A;  2Z0S A;  5CYU A;  1VQP A;  2QGQ A;  2CQO A;  4I65 A;  4JI6 Q;  2LFN A;  4AH6 A;  1VF7 A;  3OTO L;  1VMC A;  1DGS A;  2JA8 H;  1F2L A;  4MHE A;  1BKB A;  4DUZ Q;  3KUP A;  4DKA C;  3QWN A;  1GM5 A;  4Z9C B;  1TY0 A;  4DV3 Q;  2JK8 A;  3S1R B;  1A2U A;  4F7X A;  4K6D A;  2E75 C;  1B70 B;  1JB3 A;  3VR6 A;  5L37 A;  2JE6 I;  1HZB A;  3W5O A;  2PZW A;  5IYD G;  5M3M B;  3NEN A;  4CJ0 B;  1L2F A;  4LFB L;  1PH2 A;  4A3E B;  1I4X A;  4R4C A;  1RF2 D;  2P5Z X;  1D1K A;  3AFP A;  1R4Q B;  2NZO A;  3WDN A;  1Y1V G;  1G2T A;  1QIL A;  4BXX H;  2EVB A;  2WB1 G;  2CVR A;  4RGN A;  1YIT A;  2UXB L;  1WYD A;  4GOP B;  1MGS A;  1PH9 A;  1KC8 C;  2EY5 A;  3A0J A;  5DEH A;  4MTN A;  5M3M G;  3F2B A;  1IHZ A;  5IT9 c;  1UEB A;  4RHS A;  2IY5 B;  1CKN A;  1EY0 A;  1KNE A;  1HTP A;  3DEO A;  1STA A;  3I4M H;  1ESF A;  3A5U A;  2BH2 A;  4LMQ D;  1ROD A;  4RGO S;  2I46 A;  1CFM A;  4RA8 A;  1IBM Q;  3VYT A;  1BBU A;  1IW7 C;  1CTM A;  2UXB Q;  4LF9 L;  3F8T A;  1ICW A;  1WTX A;  4PG3 A;  1EYG A;  1GUN A;  4A4I A;  5GAD C;  2QEJ C;  5DAU A;  3A54 A;  5IYD H;  1ENC A;  1QNU A;  1AZP A;  4NW2 A;  2F3V A;  1CHP D;  4IPD A;  1NMF A;  1TQO A;  3D6W A;  1CUK A;  2LXK A;  3UDG A;  2L4N A;  4RWS C;  3BZD B;  1JJ2 A;  5JPN C;  3HOX B;  2DJG C;  4DN4 M;  2LSS A;  2FMM A;  2LY7 A;  4FF1 A;  2B2U A;  2DGY A;  3A56 A;  2HHH Q;  1XYI A;  2V1C C;  2A73 B;  1RJT A;  2K7V A;  1FR3 A;  2B39 A;  5EBD A;  2QF7 A;  4J8Q A;  4I7A A;  4PNY A;  1PZJ D;  1X3P A;  4B3M L;  1HR0 L;  4IFD H;  1JC7 A;  4EQ5 A;  2G5D A;  1PTO F;  3U4V A;  1N36 Q;  3UDF A;  3W3A A;  1VQF A;  1HA6 A;  4B3S Q;  4P73 A;  5DM6 3;  1S5B D;  4L5Q A;  4YCV A;  2ATW A;  4XT1 B;  3CRL C;  4IOC A;  4ZCK A;  5ISR A;  1HNX L;  1DOL A;  1KLG D;  1T9H A;  5DLQ E;  1VMP A;  3MEF A;  2XRQ D;  3F1Z A;  5C4J B;  1JMC A;  2PO4 A;  1J9O A;  1PTO C;  3CW2 C;  1DJR D;  1IBL Q;  2GA4 B;  1M8A A;  3PUX A;  5E4X A;  1SN8 A;  3FVQ A;  4DR6 L;  4DV6 L;  4GS3 A;  2F4V Q;  2ZM6 L;  1VS0 A;  2F4I A;  1PZI D;  2WIN B;  1I50 H;  1DD2 A;  3KF6 B;  3KLS X;  4Q0F A;  1HZC A;  4A3K B;  4B3R Q;  4JBK A;  4A76 A;  1PA6 A;  2RA4 A;  3O13 A;  3MXU A;  1LTL A;  3S2D B;  3U9S A;  5J22 A;  1JIC A;  1O78 A;  3QOJ A;  2L15 A;  2PW5 A;  4DU9 A;  4K8I A;  4KJO A;  5CV9 A;  3M4O H;  2L55 A;  1B53 A;  5BN5 A;  4JI2 L;  4GN3 B;  1H9J A;  5IP9 H;  1NE3 A;  3T51 B;  1NMG A;  1OXS C;  2HQE A;  1XTC D;  2K5D A;  3PIP 3;  3PIO A;  2ALY B;  1TU2 B;  1UE6 A;  3DHQ A;  4JOI C;  4UAI A;  1XWE A;  4LFC Q;  2Q8R E;  3NK9 A;  2OQK A;  2NYZ D;  3UE1 A;  2JYO A;  3C2P A;  4JI5 Q;  5IY0 A;  1XMO Q;  4A3G G;  2OXP A;  4HMI A;  4KMU C;  3GO5 A;  2J4X A;  4KKU A;  1UE5 A;  1EQQ A;  1P8L A;  5I9P A;  1AFP A;  4DR5 Q;  1HH2 P;  1FGU A;  4YCW A;  2WAQ B;  5IGC A;  2ICI A;  4XTC S;  3TRZ A;  3PO2 B;  2AWO A;  1H9R A;  3NBH B;  1Q1E A;  1A6X A;  2EXZ A;  2OCE A;  2CFM A;  3DUZ A;  1LAC A;  3SR1 A;  3HOW B;  2KED A;  2UXC Q;  4A3B H;  1RTO A;  4A3F G;  2FIN B;  2K5Q A;  1Y8N B;  1U4P A;  3MTS A;  3HOU B;  1L1O A;  5IOD A;  2A74 C;  4HID A;  1ET6 A;  1PMR A;  5D14 A;  1JE4 A;  1SNC A;  4TRD A;  1HQM C;  2EXD A;  1GHJ A;  1XTD A;  4JG2 A;  3ULL A;  3D0F A;  1B2T A;  3AFQ A;  4X3U A;  2Q8T A;  4DA2 A;  2KHJ A;  4H7B A;  4JVZ A;  4GNX B;  4KKT A;  2XWJ B;  1YHQ A;  3S15 H;  3HOZ H;  1I4R A;  5IP9 G;  2K5W A;  5JJZ A;  2H4O A;  4LNQ A;  4X3K A;  4J15 A;  1E2V A;  3E9H A;  5H1S E;  1KAB A;  3J81 E;  1NR2 A;  4WJ4 A;  2F0T A;  1IKM A;  5CGK A;  3FRP B;  3U50 C;  1XXG A;  1MBY A;  3NQT A;  4XQQ A;  3DMU A;  1EFW A;  4ILW A;  3NUC A;  1I6V C;  3VA5 A;  3M4Y A;  2Z8L A;  1A3U A;  3M4Q A;  1I4P A;  3CCS A;  3S24 A;  1UAP A;  3HKS A;  4HAE A;  1CKM A;  3FKI G;  4DR4 Q;  4LF9 Q;  3JAM L;  1ZYR C;  1SND A;  4C1N I;  5ELD A;  4KHV A;  1AH9 A;  4DUZ L;  1J6Q A;  3HKZ E;  1EUJ A;  2PYK A;  1DCZ A;  3OWE B;  1BCP C;  3L0O A;  1S5E D;  4LF5 L;  4KY5 A;  3M3Y B;  1K3B C;  2PMZ B;  1BNZ A;  2NN6 H;  2G9H D;  1E2Z A;  3SEB A;  1HHV A;  4B3R L;  3GTQ H;  2DNE A;  2A5H A;  1IYU A;  3OWF A;  4A3F B;  2UUA L;  1KDA A;  2F0Q A;  2F0V A;  3CMA A;  1VQK A;  3J80 E;  3PO2 H;  2RBM A;  4QGU A;  4GN5 A;  1Q8I A;  3NP8 A;  1EZ6 A;  2EYH A;  2EY6 A;  3QO2 A;  4A3E G;  1OXT A;  4A3J H;  2PNH A;  4FVM A;  3QOL A;  4X66 Q;  4NDX A;  1B9M A;  3K80 C;  1EY7 A;  3FEW X;  1HR0 W;  1ET9 A;  1LAB A;  3AEV A;  1X65 A;  2Z6K C;  4JI0 Q;  1QB5 D;  1TS2 A;  2QW7 A;  2PW7 A;  1X56 A;  4KK7 A;  1F2Y A;  1VQD A;  1ZEQ X;  3E0J A;  2EYL A;  4C3J H;  3GQB A;  1SNM A;  1UWV A;  2D5D A;  5ELO A;  1T5X D;  1VQL A;  5IE8 A;  2QEX A;  3S1M H;  3RN2 A;  1S3O A;  2RDH A;  4K0K Q;  1XPO A;  2C9O A;  5C0X G;  2AUJ D;  4LUZ A;  4LAA A;  1K8G A;  1PHJ A;  4CBV A;  1CZW A;  4LFC L;  3SHL A;  4EVO A;  2WV6 D;  4N9P A;  1L1O B;  1TVX A;  1CT1 D;  1I6H H;  4J6H A;  1LTA D;  3HZX A;  2IX3 A;  4DR1 Q;  1KDB A;  4CDF C;  1KRT A;  3MFG A;  1PVO A;  4DNR B;  2A68 C;  1CK1 A;  2LXJ A;  3IRB A;  3F2D A;  4JYA L;  2F52 A;  1PH4 A;  4EQP A;  4LF8 L;  3HOW G;  1QVF A;  4O0A A;  1JB7 A;  4NXM Q;  4IJH A;  2LKV A;  1ONL A;  2UUC Q;  4JV5 Q;  3KDF A;  4IUR A;  3HEJ A;  1A8V A;  4BXX G;  4YCU A;  1SYD A;  4IQZ A;  3M3Y H;  4K5V A;  3KYH C;  1FVI A;  1QVC A;  1EFI D;  3T1H L;  1JQY D;  3NTK A;  3H3V C;  2RF4 A;  5LL6 S;  1Q1B A;  3BU2 A;  2ZTD A;  1HA5 A;  4A3C H;  1NCV A;  4GLX A;  2GVA A;  3I70 A;  1SE4 A;  1GXD C;  1BR9 A;  3LWU A;  4O42 A;  1K0R A;  4R8I A;  1O7Z A;  5IWA L;  3FPP A;  1A63 A;  4A3C G;  2VNU D;  4B9W A;  3I4M B;  1Q46 A;  4JI1 Q;  4HTH A;  1SYE A;  2NZH A;  2RSN A;  1GHK A;  3CKI B;  2KHS A;  1SYC A;  1BQQ T;  3K5N A;  1SEB D;  1XPR A;  1YJN A;  4FXK C;  2E2J H;  4HED A;  2L9H A;  4A3B G;  2Q2I A;  4PQX A;  3ZJY C;  4N8F A;  5ELN A;  4DR7 L;  1VQB A;  3KF6 A;  3MWY W;  1CM9 A;  1Y8P B;  5D65 A;  2AUK A;  3JC6 6;  4H02 A;  1VQO A;  5C0X I;  3I4N H;  4RH6 A;  2WAC A;  2HT1 A;  2RDF A;  5CV6 A;  1VQM A;  2Z6K A;  4ULL A;  4UHV A;  5KYL A;  2JA8 B;  2PQE A;  1UNS A;  2VQF L;  2JA5 G;  1SE3 A;  2A6E D;  3M85 A;  2G9D A;  4RG1 A;  2EJM A;  4X3T A;  3H3V I;  5GAE C;  3IL8 A;  1FJG L;  1EY5 A;  3TZD A;  2WB1 E;  1D5X C;  1U0L A;  2A8V A;  5KEE A;  1PH3 A;  5COY A;  4GZY C;  1EIF A;  2F0F A;  5CV8 A;  1DYQ A;  4HCE A;  4RCO A;  1Q3L A;  4LWC A;  4X3S A;  1QZH A;  1EL0 A;  3EIV A;  5CR3 A;  3GTM H;  1EWC A;  4JI6 L;  1BCP B;  4N8X 1;  3UE0 A;  1SE8 A;  4X66 L;  1VQ7 A;  1A15 A;  3SGI A;  2X6L A;  3CCU A;  2Z1C A;  1N33 Q;  2PI2 E;  2F0G A;  2JA6 G;  2F0I A;  3E5S A;  4DR6 Q;  3PCO B;  4DV1 L;  1CA6 A;  4OON A;  3NWT A;  4P2C B;  1JJG A;  4JI1 L;  3D4W A;  3BG3 A;  4DGZ A;  2CW0 D;  1Q7Y C;  1WTO A;  2R7Z G;  4GKJ Q;  3GP7 A;  3GTL H;  2F0H A;  1B1Z A;  2K5H A;  3GTQ B;  3J81 c;  1PFS A;  2C35 B;  4DUY Q;  4IN3 A;  4TQU S;  4L8J A;  1Z7T A;  2YU9 H;  1MSH A;  1STB A;  2F0O A;  2B29 A;  3J7Y W;  2AHO B;  5BR8 Q;  5D3D A;  1V1P A;  3I8Z A;  3A55 A;  3SVM A;  2XWB B;  2K4K A;  4IUQ A;  1KIX A;  1EWH A;  1K9M C;  4DFA A;  1HPC A;  2CQA A;  4OEL B;  3NTI A;  2VW9 A;  3K0Y A;  2GVB A;  2NVT H;  1CKN B;  5JJK A;  4BY1 B;  1K8A C;  5IYC G;  2H5X A;  4IUT A;  1XNQ Q;  4ZQ3 A;  1IBK L;  1VQA A;  3HS0 C;  4YY3 L;  1NNX A;  1V1Q A;  2AQ1 B;  3URY A;  3CCE A;  5FLM G;  1KDC A;  4V0B A;  3GV6 A;  1N34 L;  4KHP Q;  1JWU D;  3NXW A;  3CXC A;  1W2B A;  3UI2 A;  3RR5 A;  1Q86 C;  2ZJQ A;  2OTJ A;  3QJY A;  4HJA A;  4ME5 A;  1WTV A;  1I4H A;  3VYR A;  3TN2 A;  3P7J A;  2JEB I;  5KNB A;  1ZXT A;  3ITP A;  1QCB D;  1W6K A;  1MSG A;  1TWH H;  3I55 A;  3MEH A;  1WFQ A;  5EKI A;  1LT3 D;  5LMU Q;  5DNF A;  2L1B A;  2K14 A;  4A3D H;  4L5S A;  2CCZ A;  4NP5 A;  4JI7 Q;  3KBX A;  1I6H B;  1IBL L;  3G48 A;  2MHV A;  1I4Q A;  1OXX K;  4IFD I;  4ZUJ A;  4CJ1 B;  3H94 A;  1F9P A;  1YHA A;  3PUV A;  5JJI A;  4A93 B;  1TT2 A;  5CV5 A;  5FLX c;  3ERQ A;  1GKH A;  4K2K A;  3KK7 A;  3STB D;  5IGB A;  5I4D A;  4DV4 Q;  3HOZ B;  4OL7 A;  3JAM i;  3BS1 A;  1QG7 A;  3I4N G;  3A8K E;  1TS3 A;  4RFB A;  1EYD A;  2MFI A;  3V05 A;  5C4X H;  4IJL A;  2MQH A;  1E3P A;  2QDL A;  5K5P A;  1EU3 A;  3IKJ A;  1UE1 A;  3K6O A;  3GTL B;  4JW0 A;  2WKC A;  1GJX A;  2HCI A;  4X64 L;  1B4O A;  4C56 C;  2DNC A;  5E7N A;  4G4K A;  4DAY A;  3H09 A;  3AB9 A;  1E24 A;  2NBF A;  5M5W H;  2R93 G;  2HIX A;  1CKO A;  3RLO A;  3HG9 A;  4C1N K;  3HKZ G;  3Q22 A;  4A3I G;  5NUC A;  1SFO B;  5GRO A;  3ULJ A;  1LTB D;  1ESR A;  4GNX C;  2VS1 A;  1EEF D;  3ICE A;  1JCK B;  1FNV A;  3S1Q B;  3CCV A;  2B8F A;  5E3F A;  1JOQ A;  4C3J B;  1PH5 A;  3NE5 B;  2R7F A;  2PZT A;  2RDG A;  3C3L A;  3MHB A;  1XMQ L;  1YNN C;  3HOU H;  1Y69 U;  4B3T Q;  4KLK A;  1WCM G;  1G51 A;  1D2B A;  3S9W A;  3MVV A;  2FHT A;  3ONA B;  4ZK9 B;  1B8A A;  4QUC A;  5IGD A;  2EYP A;  2R6G A;  1XNQ L;  4OX9 Q;  4FYD A;  4B3M Q;  2JA5 B;  4BA1 I;  1B50 A;  1PXU A;  3H6M A;  2UUA Q;  3GTG H;  1H9M A;  3W1G A;  1PRT F;  1SDF A;  2HDM A;  1PTO B;  4YWK A;  3J81 j;  2IHF A;  1WTQ A;  2E5L Q;  1HFG A;  4XYO A;  1I3Q H;  2EQS A;  2K04 A;  2KBN A;  1STG A;  1TY2 A;  1U4M A;  2Q2H A;  3P1H A;  1D1I A;  4BBR H;  3HOY G;  2LS0 1;  1X3E A;  4JC0 A;  4BY7 B;  2R61 A;  3HP3 A;  1MD2 D;  3PO3 G;  1S5F D;  1PYS B;  1STE A;  4A93 H;  1R4P B;  2E74 C;  4JPB W;  1L1O C;  3CC2 A;  4H44 C;  4C3H B;  5C3W A;  2MJ8 A;  3S17 B;  1RL2 A;  1EEI D;  2D0O A;  1HR0 Q;  1LTR D;  1O7Y A;  5C6A A;  4JYA Q;  4R4T A;  3GTK H;  3ZYY X;  2ZXP A;  4N9T A;  5LHY 1;  1EIG A;  3VDY A;  2NN6 I;  1QJO A;  3CRK C;  1AE2 A;  1HRJ A;  2H1E A;  1SJE D;  2MNA A;  2WII B;  4G7H C;  1FD7 D;  3K0X A;  5HGQ A;  1N9W A;  2JA7 G;  5IYB G;  2IWH A;  3V96 A;  1Q81 C;  1ASY A;  3LNN A;  1E7Z A;  4DF7 A;  1BBW A;  2XN9 C;  3OW2 A;  2D0P A;  3QB3 A;  1PYW D;  3M4P A;  2NVQ H;  3EBE A;  1OXU A;  1ILP A;  2F0E A;  4KD3 A;  3D3R A;  5IYC H;  1QZG A;  1LTI D;  4DV0 L;  2ID0 A;  4YIJ A;  1EY6 A;  2B2W A;  3RZD B;  1D5M C;  4FF3 A;  4CKE A;  1P16 A;  4PZ8 A;  2RQX A;  2R93 H;  3PSI A;  1K0S A;  4IUP A;  5EAY A;  3OIQ A;  4EX5 A;  1PV4 A;  5C3E H;  4RAU C;  2YTX A;  4DV7 L;  3IFT A;  1RDP D;  4A93 G;  1MKH A;  1ILQ A;  1V1O A;  4BS9 A;  1XJV A;  3HOV G;  1W6J A;  3C46 A;  1FNU A;  4LFA Q;  4R4O A;  2EJF C;  2R92 B;  4IPG A;  4P74 A;  1AZQ A;  3T56 B;  4QJF A;  5F2D A;  3C1E A;  3FDT A;  3P75 A;  4QMG A;  1YJ9 A;  2N49 A;  2BA1 A;  3U9O A;  1H9S A;  2ZM6 Q;  1J5E L;  1E1O A;  2QDB A;  4F87 A;  4JV5 L;  1VQI A;  1IBK Q;  2MPM A;  1T5E A;  3T13 A;  4FF4 A;  4HSV A;  1VQH A;  1V43 A;  2MO1 A;  3AMU A;  2I0Q A;  1SYF A;  1PH6 A;  4QCL A;  3AU7 A;  4OO1 G;  5C5M A;  3VR3 A;  2X6G A;  1SNQ A;  1EIY B;  5IGE A;  4DNI A;  4EGV A;  1N32 L;  4IPC A;  1A3T A;  4CKB A;  2WFW A;  2VXW A;  3OIP A;  1KL9 A;  3I90 A;  1W3S A;  2A19 A;  3BVM A;  3K5L A;  1WVL A;  1LTS D;  4JI8 L;  1B9N A;  3GTO B;  5FO9 B;  2F0P A;  1O7L A;  5EKL A;  2E2H H;  2JSO A;  2V4D A;  3MZ5 A;  3OOC A;  1N34 Q;  3S14 B;  1LT6 D;  1EQR A;  4K14 A;  1LLR D;  2KQ3 A;  4X62 Q;  3GTK B;  1YBY A;  4DR7 Q;  5CV7 A;  1PH8 A;  1YHB A;  1HNZ Q;  2A69 D;  1A3V A;  3J7A F;  4WFN 3;  1YEZ A;  3DLL A;  3DM1 A;  5K36 H;  1J8I A;  2KCC A;  3A8I E;  3C1F A;  2B2U C;  2I5H A;  1BCP F;  2WKD A;  5C4X G;  1SRO A;  3HGB A;  2B2W C;  2NTT A;  1SFO H;  2N78 A;  3FPU B;  3K7U C;  4AIM A;  3CCM A;  1G29 1;  3SE0 A;  4CKC A;  2BH8 A;  2Z4H A;  3BZK A;  1VQN A;  4DR5 L;  1WTR A;  5JEA J;  2JEA I;  5C44 B;  3S2H B;  3CD6 A;  2KJX A;  5I2Y A;  1TWG B;  1FJG Q;  4X6A H;  3CCQ A;  3SK8 A;  4K5W A;  3KDF B;  4A3B B;  2NZ1 D;  4JK1 C;  2OEO A;  4K8J A;  5C0X H;  1CHQ D;  1Q90 A;  1PH1 A;  3Q24 A;  5M9O A;  2R7Z H;  5CBE E;  3S1Q H;  4A3D G;  3OPO A;  2E8G A;  2CWP A;  3LWE A;  1D8L A;  1S5D D;  3CQZ B;  1MIU A;  4X62 L;  4S3S A;  4A3L H;  1IL8 A;  2MP1 A;  3H3V H;  4DR1 L;  2JA8 G;  2B2V A;  4O2D A;  1VQ6 A;  2M00 A;  2CH4 A;  5GAH C;  4RKB A;  4WJ3 M;  3SK4 A;  5G3L F;  4POF A;  2A6H C;  1TWA B;  4KTA A;  4ABN A;  4PZ6 A;  2BE5 D;  1SMY C;  3SK5 A;  4A3E H;  4POG A;  5J1Z A;  4OWW B;  4C3H H;  2VQF Q;  4KN4 C;  3VR2 A;  1Z9F A;  3NBH A;  1YJW A;  1VQC A;  3L9A X;  4E6I A;  4LF6 L;  3DEP A;  2E2D C;  1KNA A;  3I3C A;  4QQB X;  3RLF A;  1QNK A;  2OQ0 A;  5EBC A;  1N33 L;  1G8Z D;  2DY7 A;  4QUF A;  3R3O A;  3SK6 A;  2O2L D;  5EPK A;  2WAQ G;  1LT5 D;  5JEA G;  4R9W A;  1GD7 A;  4JI4 L;  4HJ9 A;  4TVA B;  4PZ7 A;  4DK6 C;  3H0G H;  4A3I B;  2F03 A;  5EPL A;  3TP6 A;  2WP8 J;  5ELB A;  1GUG A;  1JJC B;  3WWV A;  1B7Y B;  4HR7 B;  2EZV A;  2F0D A;  2XSC A;  4AYB G;  1KHI A;  4OGQ C;  1FL0 A;  3GTP H;  4I7Z C;  3I4O A;  3JAM E;  5EKK A;  3ULP A;  5KYI A;  4LF8 Q;  5IWA Q;  4A3M H;  2IT1 A;  2PNR C;  4FXG C;  5LMU L;  1SJH D;  1LTG D;  4QIW E;  1C48 A;  1EY4 A;  2EIF A;  2HUG A;  2KCT A;  3J80 c;  4HIM A;  2AQ2 B;  2A1A A;  2BE5 C;  2RVL A;  4DR3 Q;  1TS5 A;  3G7L A;  2K5N A;  4L5T A;  3H15 A;  1WOC A;  4DAP A;  4C2M H;  3BVG A;  5EQ0 A;  3RLN A;  5CMD A;  1N36 L;  2R92 G;  1PRT B;  2ICE C;  4F8M A;  4IPH A;  4YHH Q;  1EU4 A;  3G71 A;  4K0K L;  2EYM A;  3PV0 A;  3RMH A;  3HOY B;  3HKZ B;  5AJ3 Q;  3OW7 A;  4LUV A;  4HJ5 A;  1JOO A;  4JI3 Q;  4G7Z C;  1IBM L;  2PMZ E;  1IYJ B;  3KLS A;  4GN4 B;  2VUM H;  1EYC A;  1ZYR D;  3STB C;  3I91 A;  4L63 B;  2UUB Q;  5I2X A;  2KUM A;  1VF5 C;  2JXM B;  4L5R C;  1QUQ A;  4KV6 A;  3X3M A;  5JOB A;  1I4G A;  2XGT A;  1HFN A;  1DXM A;  3KF8 A;  1D6E C;  1WCM B;  2IX0 A;  3I72 A;  3J7Z C;  2JA7 B;  1K73 C;  3GD7 A;  2CHB D;  2RCF A;  3K7A H;  3HOV H;  3QR8 A;  3QG1 A;  5AFW A;  1JOK A;  4JI7 L;  5COR A;  3R93 A;  3S17 H;  3J81 i;  4JI5 L;  3EQL C;  2VQE L;  4EQO A;  1X54 A;  2CWA A;  2D9U A;  1XMQ Q;  3CU7 A;  4PV1 C;  3S14 H;  2Z4I A;  4DR2 L;  1TWC B;  3TME A;  2EDG A;  1AN8 A;  1NTG A;  3E9I A;  4X64 Q;  3Q0A A;  4MZ9 A;  1SAP A;  1K28 A;  5IGF A;  3I56 A;  1VQE A;  1MJC A;  1EWI A;  2RHS B;  2F0U A;  2Z6B A;  1KD1 C;  4H13 C;  4LUO A;  1X3Q A;  4PMC A;  4OHJ A;  3HFZ B;  5A2Q L;  2XTI A;  2AQ3 B;  2BA0 A;  2F1M A;  1CA5 A;  3T16 A;  2VY3 A;  3M4O B;  4A3M B;  2NVY H;  1JWM D;  5IIF A;  3SXH A;  1NBW A;  1DOK A;  2KEC A;  4XQJ A;  2TMP A;  2YV5 A;  4CDE C;  3BDO A;  1XMO L;  2F0J A;  2YYZ A;  1PDQ A;  5GQO A;  1H95 A;  3GTM B;  1M4V A;  2SNS A;  1V9P A;  3V2T A;  1OO9 B;  3EVQ A;  1YVC A;  4BA2 I;  4CDC C;  1VQ8 A;  3FKI B;  1SYG A;  3I2Z A;  3A7L A;  3L7Z C;  4GOP A;  1L0Y B;  4DK0 A;  1V8Q A;  5M5Y B;  4GLV B;  4LF4 L;  3PMF A;  1C9O A;  1HTL D;  1HXY D;  2R93 B;  4JBM A;  1TXY A;  4DK3 C;  3PO3 H;  3SDZ A;  1DOM A;  2K1B A;  3G4S A;  5IP7 G;  1OXV A;  4UDU C;  2K03 A;  3U58 A;  2Q2U A;  1HUM A;  2GN5 A;  5KRU A;  4A75 A;  1PFB A;  2WAQ E;  4IUV A;  4DNT B;  1Q82 C;  1ENA A;  2R92 H;  3CHB D;  4F88 A;  2M2L A;  3UDX A;  3A8J E;  3S15 B;  3TS0 A;  1FYC A;  1L0W A;  4JI3 L;  5HGT A;  4Y7N B;  2FXQ A;  2K01 A;  1TWA H;  1WCM H;  2KCN A;  3U4Z A;  3KF8 B;  3GTG B;  4BWG B;  1K8O A;  1AE3 A;  4LF7 L;  1PTO H;  1F9S A;  1L0X B;  1QUQ B;  1EYA A;  4HMJ A;  2BOS A;  3MXP A;  1A62 A;  5C4Z A;  2EPB A;  4A3L G;  4A3M G;  5IOC A;  3S1N B;  2A6H D;  3TQY A;  2K32 A;  3GTJ H;  2E2I B;  1X3F A;  4FDB A;  3HOZ G;  4QY7 A;  4OEM B;  2B63 H;  2JA9 A;  3UDI A;  3PO2 G;  3OHX C;  3H0G G;  1GUT A;  3PF4 A;  4AQY Q;  5IT9 E;  1STY A;  4ALP A;  3TDQ A;  1HQR D;  1B3A A;  4LK1 C;  4A3G B;  5JEA H;  3K5O A;  1WTP A; 
#chains in the Genus database with same CATH homology
 3RD4 A;  1C4Q A;  2XNA C;  4U68 A;  3RUZ A;  1D5Z C;  3VR4 A;  4U67 3;  4K5X A;  4TSS A;  2IL8 A;  1PZK D;  1BO0 A;  1PTO D;  2ENB A;  1EQV A;  2KEE A;  3WOF A;  4DXG A;  4IFD G;  1E2W A;  5D3I B;  2IPK D;  5JVH 3;  5JPM C;  3NPP A;  3BVZ A;  5C4X B;  4CHT B;  4XDX A;  4PMB A;  1GUW A;  2EOT A;  1NR4 A;  3ND8 A;  1LV9 A;  3OSO A;  4C2M B;  3L3O C;  1R9T B;  2B2Y A;  1CI3 M;  3FMC A;  1B44 D;  2DY8 A;  4ODG A;  5I6W A;  2EY2 A;  2SEB D;  1S5C D;  2F0M A;  4MN3 A;  4KD4 A;  4XIG S;  2B2Y C;  5T1I A;  1KTK A;  1QOH A;  1YNJ D;  5FO7 B;  5JVG 3;  4OO1 H;  3K7A B;  4IUN A;  2BDO A;  3PUZ A;  2J0T D;  1IKL A;  3N6R A;  4K2L A;  1NUC A;  2R7Z B;  1SSO A;  3P20 A;  5ELE A;  1RHP A;  3NSW A;  2F0W A;  4AYB B;  5KNC A;  4DK1 A;  4WOR A;  1GUO A;  1F2M A;  2FMC A;  3PUW A;  2EE1 A;  2QCP X;  1Z47 A;  2PPB C;  4CGY B;  3M7N A;  3MA2 B;  1NAP A;  2VB3 X;  2HDL A;  2ZXR A;  1K8M A;  1STN A;  1TWF B;  2KOL A;  4XYQ A;  1U4R A;  3ERO A;  4K6L A;  4KI0 A;  1KLU D;  4RHR A;  3W2D A;  3EJI A;  2E76 C;  3D4R A;  4FF2 A;  2Y0S B;  4KN7 C;  5C4H A;  2OF1 A;  3I4L A;  2O5J C;  2BCO A;  3TBI B;  4KY7 A;  2VB2 X;  4G57 A;  1AEX A;  2N55 A;  1G6Z A;  5FLX E;  2L12 A;  3Q6S A;  3M7G A;  1MI2 A;  2CW0 C;  1CQF A;  2VUM B;  4WRD A;  4J1M A;  2SDF A;  4HSP A;  5CBA E;  1Q12 A;  4RGM A;  1RKN A;  5I9O A;  2RKS A;  2ZT9 C;  2RSO A;  4EQN A;  3ND9 A;  5KIX A;  5EGT A;  2D62 A;  2E2J B;  1UUP A;  3K59 A;  1RTN A;  4DAV A;  3RZO B;  2WB1 B;  2C5C A;  1DON A;  2K28 A;  3K58 A;  2MGS A;  3NTH A;  5K36 G;  4B9X A;  4KHZ A;  3TP7 A;  5KND A;  3NWS A;  3D31 A;  5A2Q E;  2B8G A;  3LX0 A;  4QB4 A;  3VYS A;  3TSS A;  2N88 A;  4MIU A;  2IW3 A;  1ML0 D;  5JAV A;  3KLR A;  2L11 A;  1BXT A;  4KY6 A;  2NUC A;  2L5T A;  1S4Z A;  1BCP D;  2M9V A;  2NTS A;  1PRT D;  5FK9 C;  5M5W B;  3HRZ C;  3TP8 A;  2NVQ B;  4RGT A;  4L6T B;  3D6C A;  3D8G A;  2B2T C;  3Q23 A;  2EY1 A;  5E4W C;  1G91 A;  2NB0 A;  2E2H B;  4M8A A;  1C8C A;  1AP0 A;  3R2T A;  2FJ2 A;  3BYT B;  2QKI C;  1NSN S;  1TS4 A;  4QF4 A;  3BDC A;  1WTW A;  3GTP B;  2JA6 B;  5EJW A;  1O80 A;  5J39 A;  4IUU A;  1JR0 D;  1SBB B;  5G3L D;  2NVX B;  4ZLT F;  1PFN A;  2F0L A;  3H91 A;  5CC4 A;  2O4X A;  5EPJ A;  1IW7 D;  5M3F B;  1SYB A;  1X32 A;  1UEA B;  2J7Z A;  1TWH B;  2A68 D;  2EJG C;  1G2S A;  1PFM A;  4LJZ C;  4A3J B;  1WD0 A;  1Z6H A;  1F9R A;  3R8B A;  1DM0 B;  2KA7 A;  1TR5 A;  1F9Q A;  5IGG A;  4HCS A;  4BBR B;  3E6Z X;  4ZUI A;  5CV4 A;  4H0L C;  2X69 A;  4O1N A;  3MXG A;  5HUR A;  1H9K A;  5BN4 A;  4OIJ A;  2D2C C;  1EY8 A;  4FO2 A;  1SMY D;  2XVS A;  1RD9 D;  2OT2 A;  5KGU A;  1YNN D;  3VR5 A;  4R8N A;  3HOV B;  2I07 B;  3BYY B;  1EZ8 A;  3VYU A;  1Y1V B;  3J80 L;  2PZU A;  5C3E B;  2F0S A;  2NVY B;  5IT9 L;  4RKL A;  1WD1 A;  1ZKO A;  3F2U A;  2LMC B;  3T4A C;  3EFX D;  1KAA A;  3G6J B;  5ELF A;  5I6Y A;  3MXN A;  4ZKC B;  2K33 A;  4C3I B;  4NMZ A;  3QIA A;  4C3J G;  1STH A;  1JOR A;  3KBG A;  1HUN A;  4QIW B;  4WJW A;  5BN3 A;  4FNF A;  1YNJ C;  3K57 A;  2BDN A;  3S1M B;  2SOB A;  1AW7 A;  2AWN A;  3DWP A;  4C3I G;  4KKS A;  4FXD A;  1E0B A;  3PUY A;  4ZKB B;  2YU9 B;  1SNP A;  1RCV D;  2A69 C;  2KVM A;  3PO3 B;  1U4L A;  4OO1 I;  1I3Q B;  4XXE A;  2EYO A;  3A7A B;  3BDL A;  2NN6 G;  1U9R A;  3I4N B;  4OIK A;  3TP5 A;  1GOZ A;  1IYV A;  5ELC A;  4TKO B;  3GTJ B;  1H9S B;  3H0G B;  4ZRZ A;  1QWY A;  1F2Z A;  3DWA A;  4RCN A;  4IFD J;  4NKL A;  2ZXO A;  4FP5 D;  4KJN A;  2EYF A;  3MC0 B;  4JBW A;  1CZG A;  2O5I C;  2FFK B;  5T1G A;  2JP1 A;  1DZ1 A;  3J7A V;  1K83 B;  3MFY A;  2F0K A;  1BF4 A;  2L0C A;  1BBX C;  2XRS D;  1BOS A;  1Y1W B;  2XIW A;  2EYJ A;  1ENF A;  2IX1 A;  2R3Z A;  5FO8 B;  1EOT A;  1BUV T;  4M1U B;  4ZAI A;  3D4D A;  4IAL A;  3K5M A;  3NQI A;  3OMC A;  2F0N A;  5C5L A;  3VA7 A;  5DM7 3;  2K05 A;  1EY9 A;  1SNO A;  2F3W A;  2B2V C;  1VCI A;  1F77 A;  5TSS A;  1PRT C;  2NVT B;  2IJ0 A;  3IFD A;  3T53 B;  2HCC A;  3DWQ A;  1BDO A;  3EA6 A;  1EQT A;  1VDZ A;  2TSS A;  4DXF A;  2K6A A;  1FGB D;  3WOE A;  4IZ8 A;  1CQV A;  5M5X B;  1V1P B;  5FLX L;  2DN8 A;  3X3N A;  3GV3 A;  4XQN A;  2MUY A;  2PCF B;  1LTT D;  5C3X A;  2B2T A;  1II3 A;  1LT4 D;  4A3D B;  4BBS B;  3R2I A;  4ZYS A;  4V19 0;  2Q8I B;  5LL6 X;  5FKA C;  1JWS D;  5FOB B;  1Y8O B;  3N52 A;  1XX8 A;  5C0X J;  3OMG A;  1I50 B;  2SNM A;  3J81 L;  4Q5V A;  3MAQ A;  1TKW B;  3I73 A;  3S16 B;  3PIO 3;  2B63 B;  5A35 A;  1HCZ A;  4PMW A;  4CJ2 C;  4XT3 B;  3TZU A;  4B08 A;  1LO5 D;  1QE6 A;  3IAY A;  1PLF A;  4G7O C;  2A6E C;  2NWG A;  3NHH A;  1FNW A;  1SXT A;  4ID6 A;  1SE2 A;  3DXJ C;  3NBI A;  4HN7 A;  1A2T A;  1TII D;  4C3H G;  1EIH A;  2QIL A;  5E1F A;  1GUS A;  5CYU A;  4I65 A;  2LFN A;  1VF7 A;  1VMC A;  1F2L A;  4MHE A;  3KUP A;  3QWN A;  4Z9C B;  1TY0 A;  3S1R B;  1A2U A;  4F7X A;  4K6D A;  2E75 C;  1JB3 A;  3VR6 A;  2JE6 I;  2PZW A;  5M3M B;  4CJ0 B;  4A3E B;  1I4X A;  1RF2 D;  1D1K A;  1R4Q B;  3WDN A;  1G2T A;  1QIL A;  2EVB A;  2CVR A;  4RGN A;  1MGS A;  2EY5 A;  5DEH A;  1IHZ A;  4RHS A;  1EY0 A;  1KNE A;  1HTP A;  3DEO A;  1STA A;  1ESF A;  4LMQ D;  1ROD A;  4RGO S;  2I46 A;  1CFM A;  4RA8 A;  3VYT A;  1IW7 C;  1CTM A;  1ICW A;  1WTX A;  1GUN A;  2QEJ C;  5DAU A;  3A54 A;  1ENC A;  1QNU A;  1AZP A;  4NW2 A;  2F3V A;  1CHP D;  1TQO A;  3D6W A;  2L4N A;  4RWS C;  3BZD B;  3HOX B;  5JPN C;  4DN4 M;  2FMM A;  2LY7 A;  4FF1 A;  2B2U A;  3A56 A;  1XYI A;  2A73 B;  1RJT A;  2K7V A;  1FR3 A;  2B39 A;  5EBD A;  2QF7 A;  4J8Q A;  4PNY A;  1PZJ D;  1X3P A;  4IFD H;  1JC7 A;  1PTO F;  3W3A A;  1HA6 A;  5DM6 3;  1S5B D;  4XT1 B;  3CRL C;  5ISR A;  1DOL A;  1KLG D;  1VMP A;  2XRQ D;  5C4J B;  2PO4 A;  1J9O A;  1PTO C;  1DJR D;  2GA4 B;  1M8A A;  3PUX A;  5E4X A;  3FVQ A;  2F4I A;  1DD2 A;  1PZI D;  2WIN B;  4Q0F A;  3KLS X;  4A3K B;  2RA4 A;  3O13 A;  3MXU A;  3S2D B;  3U9S A;  5J22 A;  1JIC A;  1O78 A;  3QOJ A;  2PW5 A;  4DU9 A;  4K8I A;  4KJO A;  5CV9 A;  2L55 A;  1B53 A;  5BN5 A;  1H9J A;  3T51 B;  1OXS C;  2HQE A;  1XTC D;  2K5D A;  3PIP 3;  3DHQ A;  1TU2 B;  4UAI A;  1XWE A;  2Q8R E;  3NK9 A;  2NYZ D;  2JYO A;  3C2P A;  2OXP A;  4HMI A;  4KMU C;  3GO5 A;  2J4X A;  4KKU A;  5I9P A;  1AFP A;  5IGC A;  2WAQ B;  2ICI A;  4XTC S;  3PO2 B;  2AWO A;  1H9R A;  1Q1E A;  1A6X A;  2EXZ A;  3DUZ A;  1LAC A;  3SR1 A;  3HOW B;  2KED A;  1RTO A;  2FIN B;  2K5Q A;  1Y8N B;  1U4P A;  3MTS A;  3HOU B;  5IOD A;  2A74 C;  1ET6 A;  1PMR A;  5D14 A;  1JE4 A;  1SNC A;  4TRD A;  1HQM C;  1GHJ A;  1B2T A;  4X3U A;  2Q8T A;  4DA2 A;  4H7B A;  4KKT A;  2XWJ B;  1I4R A;  2K5W A;  5JJZ A;  2H4O A;  4X3K A;  1E2V A;  1KAB A;  3J81 E;  1NR2 A;  1IKM A;  2F0T A;  5CGK A;  3FRP B;  1XXG A;  1MBY A;  3NQT A;  4XQQ A;  3DMU A;  4ILW A;  3NUC A;  1I6V C;  3VA5 A;  3M4Y A;  2Z8L A;  1A3U A;  1I4P A;  1UAP A;  4HAE A;  3JAM L;  1ZYR C;  1SND A;  4C1N I;  5ELD A;  4KHV A;  2PYK A;  1DCZ A;  3OWE B;  1BCP C;  1S5E D;  4KY5 A;  3M3Y B;  2PMZ B;  1BNZ A;  2NN6 H;  2G9H D;  1E2Z A;  3SEB A;  1HHV A;  2DNE A;  2A5H A;  1IYU A;  3OWF A;  4A3F B;  1KDA A;  2F0Q A;  2F0V A;  3J80 E;  2RBM A;  1Q8I A;  3NP8 A;  1EZ6 A;  2EYH A;  2EY6 A;  3QO2 A;  1OXT A;  4FVM A;  3QOL A;  4NDX A;  1B9M A;  1EY7 A;  3FEW X;  1ET9 A;  1LAB A;  1QB5 D;  1TS2 A;  2PW7 A;  4KK7 A;  1F2Y A;  1ZEQ X;  3E0J A;  2EYL A;  3GQB A;  1SNM A;  2D5D A;  1T5X D;  2RDH A;  2C9O A;  5C0X G;  2AUJ D;  4LAA A;  4CBV A;  1CZW A;  3SHL A;  4EVO A;  2WV6 D;  4N9P A;  1TVX A;  1CT1 D;  4J6H A;  1LTA D;  3HZX A;  2IX3 A;  1KDB A;  3MFG A;  4DNR B;  2A68 C;  1CK1 A;  4EQP A;  2LKV A;  1ONL A;  4IUR A;  3HEJ A;  1SYD A;  4IQZ A;  4K5V A;  1EFI D;  1JQY D;  3NTK A;  3H3V C;  5LL6 S;  1Q1B A;  1HA5 A;  1NCV A;  3I70 A;  1SE4 A;  1GXD C;  1BR9 A;  3LWU A;  4O42 A;  4R8I A;  1O7Z A;  3FPP A;  2VNU D;  4B9W A;  3I4M B;  4HTH A;  1SYE A;  2RSN A;  1GHK A;  3CKI B;  2KHS A;  1SYC A;  1BQQ T;  3K5N A;  1SEB D;  4FXK C;  4HED A;  2L9H A;  4PQX A;  3MWY W;  1CM9 A;  1Y8P B;  5D65 A;  2AUK A;  5C0X I;  4RH6 A;  2WAC A;  2RDF A;  5CV6 A;  4ULL A;  5KYL A;  2JA8 B;  2PQE A;  1UNS A;  1SE3 A;  2A6E D;  3M85 A;  2G9D A;  2EJM A;  4X3T A;  3IL8 A;  1EY5 A;  3TZD A;  1D5X C;  5KEE A;  5COY A;  4GZY C;  2F0F A;  5CV8 A;  1DYQ A;  4HCE A;  4RCO A;  1Q3L A;  4X3S A;  1EL0 A;  5CR3 A;  1EWC A;  1BCP B;  1A15 A;  2X6L A;  2Z1C A;  2F0G A;  2F0I A;  3E5S A;  1CA6 A;  3NWT A;  4P2C B;  3D4W A;  3BG3 A;  4DGZ A;  2CW0 D;  1WTO A;  3GP7 A;  2F0H A;  1B1Z A;  3GTQ B;  4IN3 A;  4TQU S;  4L8J A;  1Z7T A;  1MSH A;  1STB A;  2F0O A;  3J7Y W;  5D3D A;  1V1P A;  3I8Z A;  3A55 A;  3SVM A;  2XWB B;  4IUQ A;  1EWH A;  4DFA A;  1HPC A;  2CQA A;  3NTI A;  3K0Y A;  4BY1 B;  4IUT A;  4ZQ3 A;  3HS0 C;  2AQ1 B;  3URY A;  1KDC A;  4V0B A;  3GV6 A;  1JWU D;  3NXW A;  3UI2 A;  3QJY A;  4ME5 A;  1WTV A;  1I4H A;  3VYR A;  3TN2 A;  3P7J A;  2JEB I;  5KNB A;  1ZXT A;  3ITP A;  1QCB D;  1W6K A;  1MSG A;  3MEH A;  5EKI A;  1LT3 D;  5DNF A;  2L1B A;  4NP5 A;  3KBX A;  1I6H B;  2MHV A;  1I4Q A;  1OXX K;  4IFD I;  4ZUJ A;  4CJ1 B;  3H94 A;  1F9P A;  3PUV A;  4A93 B;  1TT2 A;  5CV5 A;  3ERQ A;  4K2K A;  3KK7 A;  5IGB A;  5I4D A;  3HOZ B;  4OL7 A;  3BS1 A;  1QG7 A;  3A8K E;  1TS3 A;  4RFB A;  1EYD A;  3V05 A;  5K5P A;  1EU3 A;  3IKJ A;  3K6O A;  3GTL B;  2WKC A;  1GJX A;  2HCI A;  1B4O A;  4C56 C;  2DNC A;  4G4K A;  4DAY A;  3H09 A;  3AB9 A;  2NBF A;  3HG9 A;  4C1N K;  3Q22 A;  5NUC A;  1SFO B;  1LTB D;  1ESR A;  1EEF D;  1JCK B;  1FNV A;  3S1Q B;  2B8F A;  5E3F A;  1JOQ A;  4C3J B;  3NE5 B;  2PZT A;  2RDG A;  3C3L A;  3MHB A;  1YNN C;  1D2B A;  1Y69 U;  3S9W A;  3MVV A;  2FHT A;  3ONA B;  4ZK9 B;  4QUC A;  5IGD A;  2EYP A;  2R6G A;  4FYD A;  2JA5 B;  4BA1 I;  1B50 A;  1PXU A;  3H6M A;  1H9M A;  1PRT F;  1SDF A;  2HDM A;  1PTO B;  1WTQ A;  1HFG A;  4XYO A;  2K04 A;  1STG A;  1TY2 A;  1U4M A;  3P1H A;  1D1I A;  2LS0 1;  4BY7 B;  2R61 A;  3HP3 A;  1MD2 D;  1S5F D;  1STE A;  1R4P B;  2E74 C;  4H44 C;  4C3H B;  5C3W A;  2MJ8 A;  3S17 B;  1EEI D;  1LTR D;  1O7Y A;  5C6A A;  3ZYY X;  2ZXP A;  4N9T A;  5LHY 1;  1EIG A;  2NN6 I;  1QJO A;  3CRK C;  1HRJ A;  2H1E A;  1SJE D;  2WII B;  4G7H C;  1FD7 D;  2IWH A;  3V96 A;  3LNN A;  4DF7 A;  2XN9 C;  1PYW D;  3QB3 A;  1OXU A;  1ILP A;  2F0E A;  4KD3 A;  3D3R A;  1LTI D;  2ID0 A;  4YIJ A;  1EY6 A;  2B2W A;  3RZD B;  1D5M C;  4FF3 A;  4CKE A;  2RQX A;  4IUP A;  3OIQ A;  4RAU C;  3IFT A;  1RDP D;  1ILQ A;  1V1O A;  4BS9 A;  1W6J A;  3C46 A;  1FNU A;  2EJF C;  2R92 B;  1AZQ A;  3T56 B;  5F2D A;  3C1E A;  3FDT A;  3P75 A;  4QMG A;  2BA1 A;  3U9O A;  1H9S A;  2QDB A;  4F87 A;  2MPM A;  1T5E A;  3T13 A;  4FF4 A;  4HSV A;  1V43 A;  3AMU A;  1SYF A;  4QCL A;  3AU7 A;  4OO1 G;  5C5M A;  3VR3 A;  2X6G A;  1SNQ A;  5IGE A;  4EGV A;  1A3T A;  4CKB A;  3OIP A;  2VXW A;  3I90 A;  3BVM A;  3K5L A;  1WVL A;  1LTS D;  1B9N A;  3GTO B;  5FO9 B;  2F0P A;  1O7L A;  5EKL A;  2JSO A;  2V4D A;  3MZ5 A;  3OOC A;  3S14 B;  1LT6 D;  4K14 A;  1LLR D;  2KQ3 A;  3GTK B;  5CV7 A;  2A69 D;  1A3V A;  3J7A F;  4WFN 3;  3DM1 A;  5K36 H;  1J8I A;  2KCC A;  3A8I E;  3C1F A;  2B2U C;  1BCP F;  2WKD A;  3HGB A;  2B2W C;  2NTT A;  3FPU B;  1G29 1;  3SE0 A;  4CKC A;  2Z4H A;  1WTR A;  5JEA J;  2JEA I;  5C44 B;  3S2H B;  2KJX A;  5I2Y A;  1TWG B;  3SK8 A;  4K5W A;  4A3B B;  2NZ1 D;  4JK1 C;  2OEO A;  4K8J A;  5C0X H;  1CHQ D;  1Q90 A;  3Q24 A;  5M9O A;  5CBE E;  3OPO A;  3LWE A;  1S5D D;  3CQZ B;  4S3S A;  1IL8 A;  2MP1 A;  2B2V A;  2M00 A;  4RKB A;  3SK4 A;  5G3L F;  2A6H C;  1TWA B;  4KTA A;  4ABN A;  2BE5 D;  1SMY C;  3SK5 A;  5J1Z A;  4KN4 C;  3VR2 A;  3NBH A;  3L9A X;  4E6I A;  3DEP A;  2E2D C;  1KNA A;  3I3C A;  3RLF A;  1QNK A;  5EBC A;  1G8Z D;  2DY7 A;  4QUF A;  3R3O A;  3SK6 A;  2O2L D;  5EPK A;  1LT5 D;  5JEA G;  4R9W A;  4A3I B;  2F03 A;  5EPL A;  3TP6 A;  2WP8 J;  5ELB A;  1GUG A;  4HR7 B;  2EZV A;  2F0D A;  2XSC A;  4OGQ C;  4I7Z C;  3JAM E;  5EKK A;  5KYI A;  2IT1 A;  2PNR C;  4FXG C;  1SJH D;  1LTG D;  1C48 A;  1EY4 A;  2HUG A;  2AQ2 B;  2BE5 C;  2RVL A;  1TS5 A;  3G7L A;  4DAP A;  3BVG A;  5EQ0 A;  5CMD A;  1PRT B;  2ICE C;  4F8M A;  1EU4 A;  2EYM A;  3PV0 A;  3RMH A;  3HOY B;  3HKZ B;  3OW7 A;  1JOO A;  4G7Z C;  3KLS A;  1EYC A;  1ZYR D;  3I91 A;  4L63 B;  5I2X A;  2KUM A;  1VF5 C;  2JXM B;  4KV6 A;  3X3M A;  5JOB A;  1I4G A;  1HFN A;  1DXM A;  3KF8 A;  1D6E C;  1WCM B;  2IX0 A;  3I72 A;  2JA7 B;  3GD7 A;  2CHB D;  3QG1 A;  5AFW A;  1JOK A;  5COR A;  3R93 A;  3EQL C;  4EQO A;  2D9U A;  3CU7 A;  4PV1 C;  2Z4I A;  1TWC B;  3TME A;  2EDG A;  1AN8 A;  3Q0A A;  5IGF A;  1SAP A;  2F0U A;  4H13 C;  1X3Q A;  4PMC A;  4OHJ A;  5A2Q L;  2AQ3 B;  2BA0 A;  2F1M A;  1CA5 A;  3T16 A;  3M4O B;  4A3M B;  1JWM D;  5IIF A;  3SXH A;  1DOK A;  2KEC A;  4XQJ A;  2TMP A;  3BDO A;  2F0J A;  2YYZ A;  1PDQ A;  3GTM B;  1M4V A;  2SNS A;  3V2T A;  1OO9 B;  3EVQ A;  4BA2 I;  3FKI B;  1SYG A;  3A7L A;  3L7Z C;  1L0Y B;  4DK0 A;  1V8Q A;  5M5Y B;  3PMF A;  1HTL D;  1HXY D;  2R93 B;  3SDZ A;  1DOM A;  2K1B A;  1OXV A;  4UDU C;  2K03 A;  1HUM A;  5KRU A;  1PFB A;  4IUV A;  4DNT B;  1ENA A;  3CHB D;  4F88 A;  2M2L A;  3S15 B;  3A8J E;  1FYC A;  5HGT A;  4Y7N B;  2K01 A;  2KCN A;  3GTG B;  4BWG B;  1K8O A;  1PTO H;  1F9S A;  1L0X B;  1EYA A;  4HMJ A;  2BOS A;  3MXP A;  5C4Z A;  2EPB A;  5IOC A;  3S1N B;  2A6H D;  2K32 A;  2E2I B;  3OHX C;  1GUT A;  5IT9 E;  1STY A;  3TDQ A;  1HQR D;  1B3A A;  4LK1 C;  4A3G B;  5JEA H;  3K5O A;  1WTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...