4ZAIA

Crystal structure of cxcl13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CXCL13
rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords C-X-C motif chemokine 13
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zaiA00
5AFWA 5CBAE 4IUVA 4DN4M 1DONA 1WTVA 3F2UA 3HP3A 1EIHA 2FJ2A 1HUNA 2N88A 2NWGA 1WTQA 5JJZA 5D65A 1O80A 2X6GA 3MTSA 1J9OA 2HUGA 2K1BA 1J8IA 3MWYW 2FINB 1CM9A 1ZXTA 2B2UC 2B2VA 2MGSA 3SVMA 1WD1A 3DEOA 1VMCA 2H1EA 2L4NA 4ZAIA 5EKIA 1ICWA 2HCIA 4LMQD 1WD0A 1AP0A 1AZPA 5EJWA 2MJ8A 2K28A 3R93A 3TN2A 5EQ0A 2BDNA 3FDTA 4R9WA 4ZLTF 4CJ0B 1EOTA 2MP1A 4ZKBB 1G2TA 1MGSA 1JE4A 1U4MA 5EPKA 1WTPA 1B4OA 3GV6A 1HFGA 2EE1A 4MHEA 2K05A 2K04A 1WVLA 2D9UA 1WTRA 2MPMA 1B2TA 3DM1A 2KECA 1WTXA 2KOLA 1HFNA 1NAPA 4CJ1B 2RA4A 1G6ZA 1M8AA 3ONAB 1B50A 4X3UA 4U68A 5D14A 2B2YC 2RVLA 4IUUA 1HRJA 1DOLA 3DEPA 1SDFA 1X3QA 2VXWA 1F9QA 3FPUB 4IUPA 5CBEE 1SSOA 1QE6A 1ILPA 1WTWA 3KBXA 1IKLA 2HCCA 4O42A 2NZ1D 1ML0D 2K03A 2Q8TA 1AZQA 1O7ZA 2JP1A 1IL8A 1RODA 1U4LA 2FHTA 1PFMA 2J7ZA 1NR2A 2KEEA 4OIKA 5DNFA 3TZDA 4QUFA 3I8ZA 1TVXA 4ZK9B 1F2LA 3N52A 4R8IA 4IURA 1WTOA 1F9RA 2KUMA 4CJ2C 2K01A 4QUCA 1CA5A 1RTNA 2B2WA 2L11A 4ZKCB 1DZ1A 4RAUC 4RWSC 2SDFA 3G7LA 1X3PA 2DY7A 4X3SA 1HA6A 2B2VC 2M2LA 1XYIA 4XT1B 4HCSA 1HUMA 1S4ZA 1E0BA 1ESRA 2KEDA 4OIJA 1VMPA 3H91A 1MSGA 4XT3B 2Q8RE 2IL8A 3IL8A 1BBXC 1PFNA 1JICA 1MI2A 1DOKA 4HEDA 2CVRA 1Q3LA 2FMMA 1RJTA 1B3AA 1QNKA 1PLFA 1U4RA 4X3TA 1BO0A 2B2UA 3I3CA 1PDQA 1SAPA 3UI2A 1G91A 4UAIA 1GUWA 2X6LA 1IKMA 2KVMA 2N55A 3GV3A 5T1IA 3D6WA 1BNZA 1HHVA 2NYZD 4XDXA 3I91A 4IUQA 1ILQA 1RHPA 1C8CA 4MN3A 1BF4A 5CMDA 1EIGA 4NW2A 2B2WC 2EOTA 3KUPA 4IUTA 2X69A 1MSHA 2B2TC 3IFDA 1NR4A 1KNAA 2L1BA 2FFKB 5EPJA 1O7YA 2L12A 4RA8A 1G2SA 1LV9A 1XX8A 2EPBA 2B2YA 1CA6A 4X3KA 1QG7A 2R3ZA 2XIWA 1B53A 2L9HA 1F9SA 5E4WC 2HDLA 4HSVA 3Q6SA 3QO2A 1PFBA 2DY8A 1A15A 5E4XA 5CORA 5COYA 1KNEA 4HAEA 1EQTA 1NCVA 5EPLA 5T1GA 1RTOA 2RSOA 3LWEA 2JYOA 2B2TA 3P7JA 1DOMA 1F9PA 1X32A 1U4PA 2HDMA 3I90A 2RSNA 1EL0A
chains in the Genus database with same CATH superfamily
1FD7D 5C4ZA 1TR5A 4FF1A 5BN5A 2A69D 4IUNA 4DV1L 3HZXA 2RDHA 4C3IG 5C5MA 2X6GA 1K3BC 4YWKA 1E7ZA 2L4NA 2MO0A 4KV6A 5EKIA 2A6EC 3OMGA 2VL6A 2R7ZH 2K28A 1PXUA 4CJ0B 4RKLA 2MP1A 2CH4A 2NZOA 1PH2A 3RMHA 3S24A 2K04A 4OXPA 2D9UA 3L3OC 1OO9B 5KEEA 4N8X1 3DM1A 3TDQA 4A3IG 3HOXB 1Y1WB 4X3UA 3ULLA 1TWGH 3MFGA 4IALA 1HRJA 1RDPD 1A2TA 2CQAA 2R7DA 4L6TB 1Y14B 3MXNA 3RZOH 1KLGD 4ME3A 3SK4A 3W2DA 3I7FA 4GNXB 1SYDA 1N32Q 1O7ZA 4A3KH 4KKUA 3TZDA 4A3GB 2KEEA 4UHVA 4ZK9B 3I8ZA 2K5VA 3CQZH 4OGQC 4X66L 4DV5L 4QCLA 1F2MA 2CFMA 3CCQA 2UXDQ 4J6HA 4GN4B 2WINB 3H94A 3OTOQ 1GHJA 1STAA 4A3DB 3H91A 5IGBA 3Q8DA 2K7VA 4JI7Q 1SNPA 1GUGA 3JAMi 1EY6A 2MNAA 2Z0SA 2JK8A 1MIUA 2YV5A 4C3JG 1EUJA 1I4RA 2B2UA 4LW1A 1EYDA 2I46A 4DAYB 4F88A 5A2QE 1UAPA 2L55A 1VS0A 3GV3A 1UEAB 5EBCA 2NBFA 3A8JE 2B8FA 1ILQA 1D8LA 3M7NA 1STBA 2Z6BA 5J3BA 1Q81C 4PG3A 2ZJPA 1FGBD 2Z8LA 4OO1G 3HOWH 2UXBQ 4OX9Q 2A6HC 3QOLA 4NDXA 1TS5A 1VQOA 2Q8IB 1TXYA 1YJWA 1LM0A 4POGA 4OWXB 2NVQH 5JJIA 1G6PA 4DR5Q 1OTCA 2BH2A 3G6EA 3NENA 4DV2Q 5FKAC 2EZVA 4CJ2C 4DAPA 3FKIH 4ZRZA 2GVBA 3ND8A 2PI2A 2CW0C 1SR3A 4X62L 1CHQD 5JPMC 1BKBA 3FRPB 2N78A 3A7AB 4CKBA 3PGZA 5HGTA 3W3AA 1EY9A 1S72A 3BZCA 1SE4A 1IW7D 4F87A 2F0DA 5IGDA 3JAML 3T56B 1NUCA 1I6VC 1MGSA 5M3MB 2E74C 1Z47A 1WVLA 1CK1A 4DU9A 3D0FA 1Y8OB 2V4DA 3BVZA 4IQZA 3U9OA 1B50A 5CV7A 1R9TB 3HOYG 2B2YC 3HKZE 1PH5A 2CWPA 1BXTA 1K8GA 1BCPF 2PCFB 5IGCA 1I4PA 2O4XA 5GADC 4B3SL 2UUAQ 2QILA 1F2LA 3K5OA 4DA2A 4K2KA 4DV1Q 4JV5L 3D4DA 3T1YQ 2D62A 4XYQA 5AJ3Q 4B3RQ 2ES2A 1C4QA 1PRTB 1STYA 2EJGC 2R92H 4C3HH 1TWFB 1VCIA 2Q8RE 1MI2A 4J1MA 2VNUD 1F77A 3CXCA 1FL0A 2QGQA 5IT9E 1PTOC 2I5HA 1SRUA 3SK6A 5KNDA 4TKOB 4P72A 1JMCA 1UWVA 3T16A 2VUMH 3MVVA 2JA8H 4LF7Q 2OQKA 2D2CC 1QVCA 2A8VA 3D6CA 5IP9H 1AE2A 4LF7L 2Q2IA 2AUKA 4PZ7A 1V43A 1PTOF 1XJVA 1KTKA 4HSVA 3Q6SA 4LFCQ 2E5LL 2ICIA 1EQTA 1G8ZD 1RTOA 4MIUA 3EN2A 3PO2B 1PMRA 3I90A 2HDMA 4RHSA 2E8GA 4A3EB 1Z7TA 4ABNA 4DN4M 2ZT9C 4C3IH 3WOFA 4Y52H 1M90C 5IGFA 4QIWB 1IHZA 4K0KL 4DUYQ 4DV0Q 2EJMA 4BA2I 1F2ZA 1U5KA 3GTJB 3Q23A 1HR0Q 4KHPQ 1FR3A 1MD2D 2IT1A 3JC66 1BCPC 4MNOA 4A3JB 4B3MQ 1XNQL 2E76C 3A56A 3KLSX 5J39A 5FLXc 1KABA 1GVPA 3TEHB 1L2FA 1Z6HA 1T9HA 2DJFC 3NE5B 1HNWQ 3ONAB 2JSOA 2L15A 1ZKOA 3H3VC 2WAQB 4DV4L 1VQFA 3URYA 3HOZH 2QDBA 4LF9L 4GKKL 4G7ZC 5IY0A 1O7LA 1SMYC 2NZ1D 3CP0A 3X3MA 1M1KC 1CQFA 3P20A 2AWOA 4R4QA 5DNFA 1IXRA 3I70A 1O78A 5C3EH 5DEHA 1PTOD 4BS9A 1YNJD 5M3FH 1CKNA 1HNXL 5IYCG 1FYCA 2NZHA 1YI2A 3TP6A 4DV6Q 3W5OA 3F2DA 5C44H 3TSSA 3PIOA 3K80C 1K0SA 2UU9L 3KOJA 3C2PA 1I5FA 1CTMA 3S2DH 2KEDA 4MTNA 2PMZB 3G6JB 1A2UA 3W1GA 1EWCA 3J7AF 3A5ZB 4DV6L 4JBWA 2K5HA 1SBBB 4TQUS 1A62A 2JA7H 5C4JB 4DXGA 1KAAA 2EYLA 2N55A 3WDNA 1U9RA 3S1QH 1XPOA 4YIJA 1JWSD 2CKZB 4PMBA 3EROA 2F0KA 1TWCH 3OW7A 4JV5Q 2F0PA 1LV9A 4LF4L 4O2DA 3NP8A 4C3HB 1E22A 2DN8A 2UUAL 1K83B 2AQ3B 3KJPA 3IKJA 2NVTH 1B53A 5CORA 2OT2A 3GTGB 4IFDJ 4JI5Q 2N3SA 3H6MA 4GLAC 4FF3A 3LWEA 4X6AH 3TS2A 2MHVA 4HCSA 1D5MC 1VQHA 2HIVA 1H95A 1LTBD 2C5CA 1R4PB 1Q7YC 4IPHA 3DHQA 1LTRD 3ULPA 1Y1WG 4Q5VA 3H0GG 1J8IA 3SVMA 2HT1A 3BZDB 1AP0A 4A3BB 1Y8NB 4PV1C 1K28A 3R93A 3CCRA 2WIIB 5C6AA 4HIOA 1HNWL 2EXZA 1B4OA 5L37A 1WCMH 3I4MB 3BYTB 2DGYA 2M9VA 3LX0A 3RN5A 5D14A 4EGVA 1SYEA 4A3DH 3I73A 5IYBH 2VZAA 1PZKD 4YHHL 2OWOA 2Z6KA 1AW7A 1S5DD 2NUCA 2UXDL 1TWHB 4A3LH 1JB3A 2RHQB 4JYAQ 2JP1A 3GDEA 5I4DA 2BE5D 3K57A 4M8AA 4L8JA 2KUMA 3S9WA 2K01A 4AIMA 4HTHA 2F0VA 3G7LA 3CD6A 3I55A 2CHBD 1VF7A 4JCVE 2A73B 3GD7A 1CFMA 4O0AA 4A3FH 1E0BA 5FLXL 3PO3B 1WOCA 3S2HH 1DOKA 4JI2Q 1B3AA 3RUZA 1SLJA 3J81L 3BDOA 3A7LA 1H9SA 2Q2HA 4WJWA 1HTPA 2BDOA 3UE0A 4DR2Q 5LMNW 2KCMA 3PIP3 4JI2L 3HOUB 4OWTB 1KDBA 3EVQA 3L7ZC 4DAMA 1VQ5A 1CUKA 4NW2A 1E1OA 4LF8L 4DR6L 5CYUA 2VY3A 1EEID 1KHIA 1HPCA 5IYCH 2YU9B 2G9HD 3ER0A 4NMZA 4KHVA 5JVH3 4KLKA 1AN8A 1IBMQ 3J7YW 4EVOA 2UU9Q 3K0XA 3HS0C 5E4WC 4A3EG 1OXTA 3CQZB 3ULJA 1WTHA 1C0AA 4JOIA 3GTOH 3KF8B 1NCVA 4IFDI 1BUVT 5T1GA 1LYLA 3HOZG 2WB1B 2PMZE 3TS0A 2B2TA 5A35A 1UE1A 3BYYB 3AMUA 1K8OA 3PUZA 3EJIA 5M5YB 3I4NG 5JJZA 1UE6A 1JQYD 3SR1A 1H9JA 3M85A 1J9OA 4CKEA 2MGSA 2UUCL 2F4VQ 2UUBL 4BXXH 3R8BA 1ICWA 1E2WA 1OXVA 2YYZA 5D3DA 4APVA 4BXXG 1AFPA 3Q24A 3NELA 1G2TA 2UUCQ 2F4VL 2VQEL 5IWAQ 4POFA 1XPUA 1EYCA 2IHEA 5M5XB 3CRKC 4AQYL 4U673 4X65L 1IBKL 2I07B 1QZGA 2VQFQ 4L5RC 5IP7H 2F1MA 3CCSA 4FYDA 1X3QA 3T1YL 2WAQE 2CW0D 2KA7A 5ELBA 1N8RC 4QMGA 1FJGQ 4P75A 4DV3L 1X9NA 4A3EH 2KHJA 1AZQA 4KHZA 5A2QL 1SNCA 4LFAQ 1NR2A 1SYFA 1YNJC 1ZYRD 2RCNA 1FNUA 3RD4A 2O2LD 1WTOA 5IIFA 3GTJH 2E2JB 4RAUC 2V1CC 3HOZB 3MZ5A 2F0LA 2CQOA 4EQOA 4OIJA 4K8JA 4XT3B 2A68C 4HEDA 5I9PA 3OSOA 3M7GA 4GN5A 1VQLA 3L9AX 2AHOB 3I3CA 1XTDA 3S17B 1WFQA 4A3FG 2KJXA 3KF6B 5C44B 4C3HG 4C2MH 1RHPA 5CC4A 3J80c 2HQLA 2NTTA 3OWFA 1CSQA 1EIGA 3QB3A 1UEBA 1JORA 4ALPA 3FEWX 3NPPA 3QIAA 4JI3L 4GKJL 2B2YA 1D5ZC 1EY0A 4MTKA 4H13C 2A69C 2WKDA 5K5PA 2R3ZA 4UY8C 2JEAI 3S2HB 2WB1G 3D3RA 3K6OA 3VR5A 3S1QB 4BBRH 1B1ZA 2Y0SB 2NVXB 3E0EA 5M5WH 2XRQD 1SXTA 3M4OH 1VQCA 1DOMA 4NKLA 2E2HB 1GOZA 3AFQA 4PZ6A 1JB7A 3CCJA 3PUXA 4A3CG 2N88A 1FNVA 4JG2A 4JI8L 4HCEA 2AQ2B 1LT3D 3B6YA 3I4OA 5E3FA 1AZPA 4HSPA 3TP7A 3S1MH 3MEFA 3J80L 2J4XA 1L1OA 5EAYA 1SE8A 5C5LA 1MBYA 2VQFL 3SXHA 4N9TA 4FF2A 1GM5A 5ELOA 3PIO3 3VR6A 1NAPA 4HMIA 4U68A 4RG1A 2Q2TA 2QW7A 1II3A 4FNFA 3J81c 4BWGB 5FO9B 1RODA 2MFIA 5IOCA 1DGSA 1TVXA 2EY6A 4HMJA 1X55A 3I72A 4F8MA 5K36H 1CI3M 1CA5A 2ZJRA 2OF1A 3K81C 5IGGA 4LF9Q 1HA6A 2B2VC 1O7IA 2IPKD 5TSSA 2JA6B 4XT1B 2F0TA 2UXCQ 2XWJB 1BVSA 1MSGA 2PW7A 4LF5L 1SNDA 1Q3LA 2FMMA 2ZTDA 3D31A 1YJNA 2HHHL 1PLFA 3H09A 4RKBA 4WFN3 1GUWA 3QOJA 4UAIA 3CC2A 1IYVA 1FJGL 4C3JH 3SDZA 4OHJA 1HZ9A 4IPCA 2R7ZG 3V2TA 3QG1A 4LF6Q 4F7XA 2E2JH 2JQOA 2FFKB 2LXJA 2L12A 2B63H 4LUVA 1N9WA 1KIXA 3MXUA 4A3MG 4DR3Q 1SFOB 4DR7Q 4X3KA 2AWNA 2XVSA 1QCBD 1RF2D 2VQEQ 2L9HA 1YHBA 1RKNA 2BA0A 2RBMA 4JC0A 3M4YA 2EJFC 4DNRB 5IT9c 4QGUA 4A3BG 1MHWC 2Z9HA 4PMWA 1F9PA 1X32A 4KK7A 1D5XC 1STGA 4CDFC 5FO7B 5CBAE 4IUVA 1SFOH 4KJNA 1EIHA 3KJOA 4A3IH 2EQSA 3MWYW 4FVMA 5C4JH 1WD1A 2R7FA 2H1EA 1WCMG 4YY3Q 2E2IB 3O13A 3T51B 3OTOL 3J81j 2Y0SG 3T13A 4DXFA 5JAVA 1TQOA 1CZWA 3CU7A 2NVXH 4X64Q 3G71A 4RHRA 3C3LA 4KN4C 3KF8A 3GTPH 2KOLA 3PIPA 1WI5A 2K5DA 4TSSA 1D6EC 5M3FB 3HKZB 3A8KE 1B8AA 4UP7A 3UE1A 4K2LA 4X64L 2A6HD 3NTIA 4BBSG 1XWEA 1YNXA 1ASYA 4OONA 1ILPA 5DAUA 1LLRD 5ELDA 5AJ3L 1BR9A 2GA4B 4FO2A 4RFBA 2Q8TA 3JAME 1V1OA 2OTLA 1XMOL 4OIKA 4QUFA 2ZM6L 3N6RA 3M4OB 1G6ZA 1PFSA 1YNNC 2CCZA 4R8IA 3KDFA 1JJ2A 4P73A 4QUCA 4YCUA 3S1RH 1PZJD 1RTNA 4A3JG 3Q22A 4DF7A 3OW2A 2PW5A 3AFPA 4RMFA 4Y7NH 4L5SA 4A3BH 1PYBA 4LJZC 1JICA 2C9OA 1ZEQX 1E2VA 5E7NA 1HR0W 4RGTA 3M3YH 2F3VA 2RQXA 3GTKH 1KDAA 2JA7G 2B8GA 2QF7A 1Q1EA 3I91A 1A3TA 5CV5A 1CT1D 1BF4A 1I94Q 1E2ZA 3VYSA 1O7YA 4K5XA 4UP9A 4ID6A 3GTLH 1EU4A 1G2SA 1HTLD 1IZ6A 1CA6A 3NBHB 5EKLA 2PPBC 2JEBI 5M3FG 5G3LD 1IYUA 5I2YA 3A55A 4MZ9A 5CR3A 3HOVG 1D1IA 2K52A 4RH6A 1Z9FA 5EBDA 1JOKA 4R9WA 1N34Q 3F2UA 1NTGA 1HZBA 2F52A 1WCMB 1WTQA 2OTJA 5K36G 1LUZA 2EYOA 1L1OC 4A3MB 1VQ8A 2B2VA 1LTAD 1G51A 1LTLA 5IWAL 2MJ8A 4DV4Q 1BQQT 1JOOA 5JEAJ 4A3GG 3DWPA 1XNRL 2WB1E 4XXEA 3GV6A 1HFGA 4JI4L 4QJFA 3PUYA 4JI1Q 3HOWB 4DR4Q 2F0JA 1VQKA 1PZID 1XNQQ 2BCOA 3UDFA 1PTOB 3MFYA 2MUYA 3OWEB 4A3IB 1J5EQ 2LXKA 5M9OA 1QE6A 5KRUA 2EVBA 3NBIA 1WTWA 2AQ1B 5C0XI 5I6WA 2QCPX 1IBKQ 3HOYB 3I4NB 3FVQA 3GQBA 1E3PA 1LTTD 2PZTA 1SJED 4AH6A 1BBUA 3RR5A 1SJHD 4YCVA 5IE8A 1KDCA 4A3CH 2K5NA 4AYBE 3GTPB 2ALYB 3BDLA 3A5UA 3FMCA 3R2TA 5JVG3 1KQSA 1S4ZA 4C1NI 1RIPA 2Z4IA 2R7ZB 1STHA 1BBXC 2ZXOA 2ASBA 1FVIA 3HGBA 4BBRB 3DUZA 1G91A 3V96A 1I4QA 1VQBA 4CGYB 2F3WA 2X6LA 2RDGA 1HQMC 4GS3A 3H0GB 1T5EA 4HR7B 4IUQA 1JR0D 3S1MB 5FLMG 2N49A 4NP5A 3J81E 1MKHA 1YBYA 2HD3A 1QUQB 3KUPA 1DM0B 3K7AH 2L5TA 3IRBA 3E0JA 1PH9A 2R93B 3CPWA 1XX8A 5FO8B 5M5YH 2NB0A 3H15A 1NSNS 4A3GH 3NTKA 5C0XG 2EY2A 5G3LF 5COYA 3AQQA 1X54A 4PZ8A 2F0MA 5EPLA 5C4XB 1I6HB 3K59A 3D4WA 1KC8C 3H3VH 4EQNA 4YWMA 4DAYA 4WJ3M 2ZXRA 5LL6X 3PQIA 4DV7L 2RSNA 1GJXA 4P71A 3PF4A 5AFWA 4DUZQ 1IBLL 2CWAA 1WTVA 4G7OC 1K3RA 1FNWA 3SK8A 1JJGA 1V9PA 4K5WA 4C3JB 5GQOA 1VQNA 3STBD 2K1BA 5D3IB 5I2XA 5BN4A 2M00A 2SNMA 3DMUA 3AB9A 1JCKB 1TY2A 3E9HA 3J7AV 3PV0A 2K75A 4IFDG 3OMCA 3GO5A 2EE1A 4BBRG 3VA7A 1I4XA 3QWNA 1Y8PB 1B2TA 4R8NA 1WTXA 1Q12A 1HFNA 4IUUA 1S5FD 1F2YA 3J7ZC 4RCNA 1LTID 2JE6I 3NQIA 5FLMH 3NHHA 1A6XA 3AU7A 4DV5Q 3S14H 2RCFA 4K6LA 2F0QA 4V0BA 2F03A 2ID0A 2DUDA 4IURA 4A3KG 2HHHQ 3CKIB 3HOWG 1LT6D 1M4VA 4XYOA 3ICEA 5FK9C 2XSCA 3ZJYC 1X65A 4X3SA 3PUWA 1LT4D 2N8NA 2XGTA 3KLSA 1HUMA 4A3JH 4C2MB 1VQMA 1RL2A 3VR3A 4ZQ3A 3IL8A 1EOVA 1WYDA 3AEVA 1PDQA 4B3TL 3K0YA 2HIXA 3F8TA 4JBMA 4CBVA 1TWAB 3KDFB 2B2TC 4DFAA 1BBWA 5M5WB 4LFBL 1AEXA 4CDDC 3HOXG 4JOIC 2ZM6Q 1W2BA 2XIWA 5BN3A 2EY5A 4AYBB 1A15A 1TY0A 3S2DB 3PUVA 4TVAB 2OQ0A 3VDYA 2ENBA 2EYJA 1ONLA 4A93B 2F4IA 2K50A 1Y1WH 2F0HA 4X62Q 2PNRC 1EL0A 2K5QA 1W3SA 2EYFA 2J0TD 2ZTCA 3MXNB 1IBML 3CMEA 4DGZA 4RGNA 4B9XA 1VQIA 1PH4A 1N32L 4I7AA 1D1KA 2KQ3A 1PRTD 5IYDG 4GOPA 1EYAA 4LMQD 2JA9A 4ZUIA 4KKTA 3KLRA 2A74C 4ZLTF 1TWCB 3P1HA 1I3QB 4OELB 2JA8B 1U4MA 2HQEA 1Q90A 4YCWA 3TBIB 3M4PA 5C4XH 5IGEA 4MHEA 1C9OA 1UE7A 1Q86C 1SE2A 2F0IA 3WWVA 1XMOQ 1PVOA 2B63G 3GTQH 4GKJQ 4CJ1B 5HGQA 2XNAC 2SNSA 2IHFA 3QJYA 4JBJA 2PNHA 4HJ5A 3DWAA 2KHIA 2XRSD 2VXWA 2EDGA 4P2CB 5CBEE 4OL7A 1NJIC 4KD4A 2IY5B 1IKLA 1PH1A 2AUJD 1BDOA 5C0XJ 1HH2P 3I4MH 1S5BD 1HQRD 3DXJC 4R4IA 2WACA 1BCPD 4GN3B 2UXBL 1PTOH 1GO3E 3PSIA 1BOSA 3UDXA 2Q2UA 4RWSC 2SDFA 4DR5L 3S16B 1TWHH 2VB3X 4NXNL 4R4OA 1KD1C 4NB3A 2B39A 3CAMA 1NE3A 1YHQA 1YHAA 1R9TH 4L5QA 1BO0A 5E1FA 2ATWA 1HZAA 4HIMA 1EWIA 1YVCA 4JYAL 4XDXA 4FXDA 2PI2E 1C8CA 4NXNQ 1HCZA 1U0LA 2WAQG 4CHTB 3KK7A 3LGJA 3LWUA 4IUTA 3TQYA 4LUZA 4ZYSA 2FXQA 4FF4A 3RN2A 5IYBG 1S3OA 4RA8A 3TP5A 3BS1A 3CCVA 4X65Q 4QQBX 1JJCB 2O5JC 2E2DC 3VYUA 2GVAA 5GROA 1SYGA 4DNTB 4G7HC 3QO2A 1PFBA 1Y1VG 5C3EB 1D2BA 5NUCA 1TS4A 2Y0SE 3X3NA 5LHY1 4LF5Q 4RCOA 2G5DA 4KKSA 3SHLA 2E2IH 3U58A 2PQAB 1EY4A 1VQJA 3P7JA 5C44G 3EA6A 2AMCB 4DKAC 4LUOA 2KBNA 1K8MA 3HP3A 3NQTA 2FJ2A 3UDGA 4JPBW 1JT8A 3LNNA 1JC7A 1B44D 4OEMB 3T1HL 2JA7B 2HUGA 1IBLQ 4G57A 2RHSB 3M3YB 4BY7H 3S1NH 3VR4A 1A3UA 3HG9A 4R1JA 5EQ0A 2BDNA 4B9WA 2JA6G 1J5EL 2R93H 2QEXA 3K5LA 1TWAH 1WTPA 1SNQA 2BE5C 2NN6H 3QR8A 4LNQA 4BY1H 4RGOS 4DK6C 2OCEA 4A93H 3ITPA 1Q82C 2F0EA 4QL5A 2A19A 1BCPB 1EQQA 4GZYC 3U9SA 2F0FA 3MA2B 3S1NB 2R92B 1SDFA 3FPUB 1LABA 1H9SB 4LF8Q 3GTKB 1I94L 4DR6Q 1GKHA 1EQVA 3CCLA 3KBXA 1ML0D 2AKWB 1SMXA 1LT5D 3MEHA 1VQ6A 1IL8A 5GAGC 1W6KA 2C35B 3E9IA 1PH3A 1EU3A 2F0WA 2B2WA 4DAVA 5LMUQ 2NVTB 3SE0A 4GNXC 4JI6L 1TS2A 1UUPA 1I50H 5KNCA 2NVQB 2E5LQ 1VMPA 3L2PA 4K5VA 5J1ZA 3E5SA 2IX3A 3Q0AA 1RJTA 1EFWA 2E75C 4LK1C 1XMQQ 4LF4Q 1ENFA 1D7QA 4Q0FA 1NBWA 1X3GA 5T1IA 1CKOA 4IOAA 5IP9G 2Z1CA 1KAWA 2DJGC 3A74A 3SK5A 1ASZA 2EOTA 1X6OA 3TP8A 1KNAA 5IP7G 5EPJA 2VUMG 1PH7A 4Z9CB 1GUTA 2MO1A 1XMQL 4DK1A 2K33A 2PQEA 4H44C 4A3FB 2EYMA 1QG7A 2NVYH 4KY6A 1ICFB 4JI4Q 2LY7A 1NMFA 3HKZG 5GAHC 1L0YB 3KBGA 2H5XA 1A0IA 5ISRA 1OXSC 1S5ED 4FXKC 4JI7L 3FKIG 2NWGA 2TSSA 4OX9L 3I4NH 4NXMQ 1HNZL 3MTSA 4B3SQ 1CM9A 3DEOA 2KCCA 3HOVH 1I4GA 1H9KA 5ELEA 3S15B 1QB5D 2ZXPA 1XXGA 4XQQA 1FGUA 3FHWA 2IJ0A 2L0CA 2F0UA 2F0GA 4J15A 4DNIA 2IW3A 4DK0A 4DPGA 1IYJB 3DEPA 4AQYQ 3A8IE 1SSOA 5CV9A 3W1BA 2VUMB 1Y1VH 2A68D 1V1PB 3ND9A 4DUYL 4DV0L 3RLNA 1LTGD 4E6IA 2J7ZA 1PFMA 3V05A 2LKVA 1GXDC 3UDIA 4CDCC 3HRZC 2JN4A 5DM63 2QKIC 5EGTA 5I6YA 1XYIA 2R92G 2DNEA 3CHBD 3PCOB 1DYQA 4IZ8A 4DV7Q 1XTCD 4LFCL 4DR1L 4BBSB 1QVGA 5ELFA 3K7AB 3RZOB 4HIKA 1CQVA 3VR2A 4BY1G 1SAPA 3A0JA 5M5XH 3BVMA 3NUCA 4YY3L 2JA6H 1HHVA 2NYZD 2B29A 2XWBB 1SN8A 5EKKA 1QJOA 2K5WA 5JEAH 4BBSH 5DLQE 1JWMD 1KRSA 3CPFA 2ZJQA 2L1BA 1JOQA 1K9MC 1CKNB 4WJ4A 2NTSA 3K5NA 3DLLA 4S3SA 3ERSX 3OPOA 5J22A 1K73C 1YNND 4A75A 2EYPA 2DY8A 1I3QH 4PNYA 4HAEA 4LAAA 2YTYA 3MXPA 3CCUA 4B3RL 1SYCA 5LL6S 1VDZA 1LACA 2JYOA 3CF5A 3M9BA 3CCEA 3RZDB 2B63B 1U4PA 4JI0L 4OO1I 3KF6A 4JK1C 4JI1L 4DR4L 4ZUJA 4LF6L 1QUQA 1IL2A 1ZXTA 5LMNQ 1CKMA 2WV6D 3RLOA 4HJ8A 1KLUD 1SROA 2R93G 2P5ZX 1TT2A 2HCIA 2NN6G 3PO3G 5EJWA 1N36Q 1KXLA 2XTIA 3S17H 1EOTA 4ZKBB 1HNXQ 4IOCA 5LMNL 1NNXA 2YU9H 5EPKA 5IT9L 1TU2B 1S40A 4UP8A 3CCMA 4PQXA 4EQ5A 3S14B 2K14A 3S16H 3T1HQ 3K8AA 4IN3A 3K7UC 3FKIB 2Z6KC 2PQAA 3NTHA 4R4TA 2OXPA 5KNBA 4I65A 3GTMB 3NWSA 2WFWA 3MC0B 2NN6I 1L0XB 4CDEC 3M4QA 2RKSA 2FHTA 1B3QA 3IAYA 3H0GH 3N52A 5M3MH 1EY5A 3I4MG 3L0OA 1G291 1RCVD 4BY7B 2L11A 3CRLC 3OIQA 4KN7C 3GTMH 2QEJC 3OOCA 1SNMA 1NMGA 3NBHA 4KHPL 5H1SE 4BY1B 1JE5A 4ZCKA 1ET9A 5KIXA 3J7A5 1STEA 1PYSB 2O5IC 5JPNC 2CVRA 1Y1VB 5C3EG 4X3TA 2G9DA 4K8IA 4QIWE 5HURA 2WP8J 4FDBA 4EX5A 2JA5H 3DM3A 3OIPA 2CH4W 1QILA 5FLXE 1N36L 4JI6Q 1QNUA 1YJ9A 4DK3C 2B2WC 4A3KB 2X69A 1B70B 1NR4A 1K0RA 2BH8A 3TREA 3R3OA 1ENAA 3P75A 4DUZL 2PO4A 4OWWB 1SYBA 4P74A 4FXGC 5M3MG 3GTQB 4RGMA 4HN7A 4UDUC 4DR1Q 1KNEA 3J80i 2YTXA 4QY7A 2D0PA 3K58A 3FPPA 5C3WA 2UUBQ 3C1FA 4I7ZC 1HUNA 1SE3A 5JJKA 1HJPA 1P16A 2VS1A 3EBEA 4IJHA 4IFDH 4A76A 2B2UC 5JEAG 3F2BA 5C4XG 1WD0A 3C46A 4IJLA 2K6AA 1ZYRC 2YTVA 1N33Q 1AH9A 4KJOA 5IYDH 3PO3H 4ME5A 1HA5A 5FJ8H 1PYWD 1X3EA 4O1NA 3RZDH 2WKCA 1Q8KA 1VQGA 2RA4A 1M8AA 1UE5A 4GKKQ 1W6JA 2D0OA 3D8GA 4JI5L 1S5CD 4ODGA 1MJEA 4B3ML 3NEMA 1QWYA 1PRTC 4H0LC 2LS01 4J8QA 1U4LA 1KL9A 1V1QA 3J80E 4NPSA 4PMCA 3BU2A 3CC4A 3U4VA 1F9RA 3VYTA 2F3IA 3MHBA 1EQRA 4XIGS 3HOXH 4B08A 3I4LA 3HOUH 5I9OA 2BOSA 2R61A 4G4KA 5GAEC 3DWQA 3JAMc 3F1ZA 5KYIA 1QNKA 4JI8Q 5ELNA 3UI2A 1NY4A 3ZYYX 4UPAA 1GUSA 1P8LA 1KRTA 4FP5D 1BNZA 1A63A 2UXCL 1YIJA 2E2HH 2TMPA 5CMDA 3S1RB 2VW9A 2I5LX 3HOYH 2QDLA 4BA1I 3RLFA 5CV6A 2Z4HA 1ET6A 3D4RA 3PF5A 2EPBA 1RD9D 2EIFA 4Y7NB 5CGKA 1XPRA 4WRDA 4ILWA 5CV4A 1L1OB 2XN9C 3HKSA 4LFBQ 2LFNA 2JJQA 2F0OA 3VYRA 3SGIA 1T5XD 4N8FA 2JA5B 5C0XH 4KMUC 1A8VA 3SEBA 4YWLA 4IPDA 4XQNA 1E24A 1DCZA 4GLXA 5JJLA 2EYHA 1DONA 4KI0A 3ERQA 2IX1A 4EQPA 5BR8L 5D65A 1O80A 1QOHA 5CV8A 2RDFA 3KYHC 4DR2L 4KY5A 4GNXA 1PH6A 3GTLB 5JOBA 2LMCB 4C1NK 4GLVB 1TWGB 4M1UB 2OEOA 1VQ4A 2H4OA 3NXWA 1AE3A 1R4QB 1TWFH 3TN2A 4YHHQ 4OO1H 2BA1A 1JE4A 1GD7A 4H02A 1Q46A 2MQHA 2ICEC 2K05A 3TRZA 3EQLC 1WTRA 5F2DA 1TIID 3BG3A 1XNRQ 3MXGA 4K6DA 5FOBB 2KCNA 3A54A 1DOLA 1VQ9A 4C56C 2KENA 4O42A 2QA4A 2JA8G 1HZCA 1PRTF 1X3FA 1Q8IA 1I50B 4ZKCB 4HJ9A 4DR3L 4JI0Q 4DR7L 1J6QA 2PYKA 3VA5A 2F0NA 1EZ8A 4JI3Q 1N33L 1I4HA 3BJUA 4IPGA 1Y69U 2ZTEA 2DY7A 3HOUG 3PO2H 1PH8A 2M2LA 1HXYD 3G48A 1CZGA 3H3VI 1ESRA 1C7YA 4JW0A 1VF5C 3PO2G 5KGUA 1PFNA 4HJAA 2K4KA 1VQPA 1EWHA 1YZ6A 5KYLA 1EYGA 3IFTA 4CKCA 3CW2C 1IKMA 2RF4A 3D6WA 3EIVA 1EY7A 2EY1A 2F0SA 1GHKA 4K14A 1CSPA 4MN3A 3HFZB 4ULLA 1DJRD 3MAQA 4X66Q 3OHXC 1X56A 1SNOA 4LFAL 4KTAA 4KY7A 1STNA 2SOBA 4XQJA 4H7BA 1B9NA 1H9RA 2K32A 3WOEA 2FMCA 3U4ZA 3FP9A 5C3XA 3KLWA 2HDLA 1LO5D 3R2IA 2DNCA 5E4XA 4HIDA 4JBKA 2A1AA 4XTCS 3S15H 4IO9A 1DD2A 2PZWA 4KD3A 3GTGH 1GUNA 1MJCA 2SEBD 2FINB 3EFXD 3TMEA 4A93G 1GUOA 1VMCA 4ZAIA 4GOPC 1B9MA 2JXMB 4N9PA 2B3GA 5ELCA 3FDTA 3PMFA 1IW7C 1JWUD 1OXUA 1QVFA 3GTOB 4WORA 1TKWB 4BY7G 1SEBD 2MPMA 4B3TQ 2KECA 3T4AC 5HY6A 3NK9A 2RVLA 4DV3Q 1EY8A 2KHSA 4IUPA 1F9QA 2A5HA 3E3XA 3KFUA 1TS3A 3F2CA 3NSWA 4A4IA 4L5TA 1VQEA 2R6GA 5C4HA 3CC7A 2HCCA 5IODA 3BDCA 2K03A 4NXML 1SMYD 1VQ7A 2IX0A 1K83H 1I6HH 2PZUA 2EXDA 1EIYB 1YITA 1QZHA 4A3MH 5BR8Q 1B7YB 2LSSA 5DM73 4C3IB 1VQDA 4LWCA 1PHJA 2GN5A 3E6ZX 1DZ1A 2I0QA 3U50C 1X3PA 3BZKA 1V8QA 1YEZA 2D5DA 4R4CA 4DV2L 4HJ7A 5LMUL 1DXMA 1PV4A 2NVYB 2IL8A 1EIFA 3GP7A 1EEFD 3J81i 1U4RA 4K0KQ 1LTSD 3CMAA 3C1EA 4TRDA 3STBC 1N34L 2KVMA 1A3VA 2KCTA 1UNSA 1HR0L 1V1PA 2VB2X 4L63B 3RNUA 1WJJA 1EZ6A 3G4SA 3IFDA 1MSHA 1OXXK 3NWTA 1K8AC 3T53B 4GOPB 4QB4A 3TZUA 2JA5G 3K5MA 2I5MX 1CHPD 4V190 1EFID 1ENCA 2A6ED 1PA6A 3HOVB 2IWHA 3I2ZA 1F9SA 1HNZQ 5FJ8G 1ESFA 1E1TA 3I56A 4A3LG 3AYHB 1H9MA 1Q1BA 4AYBG 4JVZA 3HEJA 1C48A 3OYYA 2RSOA 3BVGA 4QF4A 4A3DG 1L0WA 1VQAA
chains in the Genus database with same CATH topology
1FD7D 5C4ZA 1TR5A 4FF1A 5BN5A 2A69D 4IUNA 3HZXA 2RDHA 4C3IG 5C5MA 2X6GA 2L4NA 4KV6A 5EKIA 2A6EC 3OMGA 2K28A 1PXUA 4CJ0B 4RKLA 2MP1A 3RMHA 2K04A 2D9UA 3L3OC 1OO9B 5KEEA 3DM1A 3TDQA 3HOXB 1Y1WB 4X3UA 3MFGA 4IALA 1HRJA 1RDPD 1A2TA 2CQAA 4L6TB 3MXNA 1KLGD 3SK4A 3W2DA 1SYDA 1O7ZA 4KKUA 3TZDA 4A3GB 2KEEA 4ZK9B 3I8ZA 4OGQC 4QCLA 1F2MA 4J6HA 2WINB 3H94A 1GHJA 1STAA 4A3DB 3H91A 5IGBA 2K7VA 1SNPA 1GUGA 1EY6A 4C3JG 1I4RA 2B2UA 1EYDA 2I46A 4F88A 5A2QE 1UAPA 2L55A 3GV3A 1UEAB 5EBCA 2NBFA 3A8JE 2B8FA 1ILQA 3M7NA 1STBA 1FGBD 2Z8LA 4OO1G 2A6HC 3QOLA 4NDXA 1TS5A 2Q8IB 5FKAC 2EZVA 4CJ2C 4DAPA 4ZRZA 3ND8A 2CW0C 1CHQD 5JPMC 3FRPB 3A7AB 4CKBA 5HGTA 3W3AA 1EY9A 1SE4A 1IW7D 4F87A 2F0DA 5IGDA 3JAML 3T56B 1NUCA 1I6VC 1MGSA 5M3MB 2E74C 1Z47A 1WVLA 1CK1A 4DU9A 1Y8OB 2V4DA 3BVZA 4IQZA 3U9OA 1B50A 5CV7A 1R9TB 2B2YC 1BXTA 1BCPF 2PCFB 5IGCA 1I4PA 2O4XA 2QILA 1F2LA 3K5OA 4DA2A 4K2KA 3D4DA 2D62A 4XYQA 1C4QA 1PRTB 1STYA 2EJGC 1TWFB 1VCIA 2Q8RE 1MI2A 4J1MA 2VNUD 1F77A 5IT9E 1PTOC 3SK6A 5KNDA 4TKOB 3T16A 3MVVA 2D2CC 3D6CA 2AUKA 1V43A 1PTOF 1KTKA 4HSVA 3Q6SA 2ICIA 1EQTA 1G8ZD 1RTOA 4MIUA 3PO2B 1PMRA 3I90A 2HDMA 4RHSA 4A3EB 1Z7TA 4DN4M 4ABNA 2ZT9C 3WOFA 5IGFA 4QIWB 1IHZA 2EJMA 4BA2I 1F2ZA 3GTJB 3Q23A 1FR3A 1MD2D 2IT1A 1BCPC 4A3JB 2E76C 3A56A 3KLSX 5J39A 1KABA 1Z6HA 3NE5B 3ONAB 2JSOA 1ZKOA 3H3VC 2WAQB 3URYA 2QDBA 4G7ZC 1O7LA 1SMYC 2NZ1D 3X3MA 1CQFA 3P20A 2AWOA 5DNFA 3I70A 1O78A 5DEHA 1PTOD 4BS9A 1YNJD 1FYCA 3TP6A 3TSSA 3C2PA 1CTMA 2KEDA 2PMZB 3G6JB 1A2UA 1EWCA 3J7AF 4JBWA 1SBBB 4TQUS 5C4JB 4DXGA 1KAAA 2EYLA 2N55A 3WDNA 1U9RA 4YIJA 1JWSD 4PMBA 3EROA 2F0KA 3OW7A 2F0PA 1LV9A 4C3HB 3NP8A 2DN8A 1K83B 2AQ3B 3IKJA 1B53A 5CORA 2OT2A 3GTGB 4IFDJ 3H6MA 4FF3A 3LWEA 2MHVA 4HCSA 1D5MC 1LTBD 2C5CA 1R4PB 3DHQA 1LTRD 4Q5VA 1J8IA 3SVMA 3BZDB 1AP0A 4A3BB 1Y8NB 4PV1C 3R93A 2WIIB 5C6AA 2EXZA 1B4OA 3I4MB 3BYTB 2M9VA 3LX0A 5D14A 4EGVA 1SYEA 3I73A 1PZKD 1AW7A 1S5DD 2NUCA 1TWHB 1JB3A 2JP1A 5I4DA 2BE5D 3K57A 4M8AA 4L8JA 2KUMA 3S9WA 2K01A 4HTHA 2F0VA 3G7LA 2CHBD 1VF7A 3PO3B 2A73B 3GD7A 1CFMA 1E0BA 5FLXL 1DOKA 1B3AA 3RUZA 3J81L 3BDOA 3A7LA 1H9SA 4WJWA 1HTPA 2BDOA 3PIP3 3HOUB 1KDBA 3EVQA 3L7ZC 4NW2A 5CYUA 1EEID 1HPCA 2YU9B 2G9HD 4KHVA 5JVH3 4NMZA 1AN8A 3J7YW 4EVOA 5E4WC 3HS0C 1OXTA 3CQZB 1NCVA 4IFDI 1BUVT 5T1GA 2WB1B 2B2TA 5A35A 3BYYB 3AMUA 1K8OA 3PUZA 3EJIA 5M5YB 5JJZA 1JQYD 3SR1A 1H9JA 3M85A 1J9OA 4CKEA 2MGSA 3R8BA 1ICWA 1E2WA 1OXVA 2YYZA 5D3DA 1AFPA 3Q24A 1G2TA 1EYCA 5M5XB 3CRKC 4U673 2I07B 2F1MA 4FYDA 1X3QA 2CW0D 2KA7A 5ELBA 4QMGA 1AZQA 4KHZA 5A2QL 1SNCA 3RD4A 1NR2A 1SYFA 1YNJC 1ZYRD 1FNUA 2O2LD 1WTOA 5IIFA 2E2JB 4RAUC 3HOZB 3MZ5A 2F0LA 4EQOA 4OIJA 4K8JA 4XT3B 2A68C 4HEDA 5I9PA 3OSOA 3M7GA 3L9AX 3I3CA 3S17B 2KJXA 5C44B 4C3HG 1RHPA 5CC4A 2NTTA 3OWFA 1EIGA 3QB3A 1JORA 3FEWX 3NPPA 3QIAA 2B2YA 1D5ZC 1EY0A 4H13C 2A69C 2WKDA 5K5PA 2R3ZA 2JEAI 3S2HB 3D3RA 3K6OA 3VR5A 3S1QB 1B1ZA 2Y0SB 2NVXB 2XRQD 1SXTA 1DOMA 4NKLA 2E2HB 1GOZA 3PUXA 2N88A 1FNVA 4HCEA 2AQ2B 1LT3D 5E3FA 1AZPA 4HSPA 3TP7A 3J80L 2J4XA 5C5LA 4FF2A 1MBYA 3SXHA 4N9TA 3PIO3 3VR6A 1NAPA 4HMIA 4U68A 1II3A 4FNFA 4BWGB 5FO9B 1RODA 5IOCA 1TVXA 2EY6A 4HMJA 3I72A 4F8MA 5K36H 1CI3M 1CA5A 2OF1A 5IGGA 1HA6A 2B2VC 2IPKD 5TSSA 2JA6B 4XT1B 2F0TA 2XWJB 2PW7A 1MSGA 1SNDA 1Q3LA 2FMMA 3D31A 1PLFA 3H09A 4RKBA 4WFN3 1GUWA 3QOJA 4UAIA 1IYVA 3SDZA 4OHJA 3V2TA 3QG1A 4F7XA 2FFKB 2L12A 3MXUA 1SFOB 4X3KA 2AWNA 2XVSA 1QCBD 1RF2D 2L9HA 2RBMA 1RKNA 2BA0A 3M4YA 2EJFC 4DNRB 4PMWA 1F9PA 1X32A 4KK7A 1D5XC 1STGA 5FO7B 5CBAE 4IUVA 4KJNA 1EIHA 3MWYW 4FVMA 1WD1A 2H1EA 2E2IB 3O13A 3T51B 3T13A 4DXFA 5JAVA 1TQOA 1CZWA 3CU7A 4RHRA 3C3LA 4KN4C 3KF8A 2KOLA 2K5DA 4TSSA 1D6EC 5M3FB 3HKZB 3A8KE 4K2LA 2A6HD 3NTIA 1XWEA 1ILPA 5DAUA 1LLRD 5ELDA 1BR9A 2GA4B 4FO2A 4RFBA 2Q8TA 3JAME 1V1OA 4OIKA 4QUFA 1G6ZA 3N6RA 3M4OB 1YNNC 4R8IA 4QUCA 1PZJD 1RTNA 3Q22A 4DF7A 2PW5A 4LJZC 1JICA 2C9OA 1ZEQX 1E2VA 4RGTA 2F3VA 2RQXA 1KDAA 2B8GA 2QF7A 1Q1EA 3I91A 1A3TA 5CV5A 1CT1D 1BF4A 1E2ZA 3VYSA 1O7YA 4K5XA 4ID6A 1EU4A 1G2SA 1HTLD 1CA6A 5EKLA 2PPBC 2JEBI 5G3LD 1IYUA 5I2YA 3A55A 5CR3A 1D1IA 4RH6A 5EBDA 1JOKA 4R9WA 3F2UA 1WCMB 1WTQA 5K36G 2EYOA 4A3MB 2B2VA 1LTAD 2MJ8A 1BQQT 1JOOA 5JEAJ 3DWPA 4XXEA 3GV6A 1HFGA 3PUYA 3HOWB 2F0JA 1PZID 2BCOA 1PTOB 3MFYA 2MUYA 3OWEB 4A3IB 5M9OA 1QE6A 5KRUA 2EVBA 3NBIA 1WTWA 2AQ1B 5C0XI 5I6WA 2QCPX 3HOYB 3I4NB 3FVQA 3GQBA 1LTTD 2PZTA 1SJED 1SJHD 1KDCA 3GTPB 3BDLA 3FMCA 3R2TA 5JVG3 1S4ZA 4C1NI 2Z4IA 2R7ZB 1STHA 1BBXC 2ZXOA 3HGBA 4BBRB 3DUZA 1G91A 3V96A 1I4QA 4CGYB 2F3WA 2X6LA 2RDGA 1HQMC 3H0GB 1T5EA 4HR7B 4IUQA 1JR0D 3S1MB 4NP5A 3J81E 3KUPA 1DM0B 2L5TA 3E0JA 2R93B 1XX8A 5FO8B 2NB0A 1NSNS 3NTKA 5C0XG 2EY2A 5G3LF 5COYA 2F0MA 5EPLA 5C4XB 1I6HB 3K59A 3D4WA 4EQNA 4DAYA 2ZXRA 5LL6X 2RSNA 1GJXA 5AFWA 1WTVA 4G7OC 1FNWA 3SK8A 4K5WA 4C3JB 2K1BA 5D3IB 5I2XA 5BN4A 2M00A 2SNMA 3AB9A 3DMUA 1JCKB 1TY2A 3J7AV 3PV0A 4IFDG 3OMCA 3GO5A 2EE1A 3VA7A 1I4XA 3QWNA 1Y8PB 1B2TA 4R8NA 1WTXA 1Q12A 1HFNA 4IUUA 1S5FD 1F2YA 4RCNA 1LTID 2JE6I 3NQIA 1A6XA 3NHHA 3AU7A 4K6LA 2F0QA 4V0BA 2F03A 2ID0A 4IURA 3CKIB 1LT6D 1M4VA 4XYOA 5FK9C 2XSCA 4X3SA 3PUWA 1LT4D 3KLSA 1HUMA 4C2MB 3VR3A 4ZQ3A 3IL8A 1PDQA 3K0YA 4CBVA 1TWAB 2B2TC 4DFAA 5M5WB 1AEXA 2XIWA 5BN3A 2EY5A 4AYBB 1A15A 1TY0A 3S2DB 3PUVA 2ENBA 2EYJA 1ONLA 4A93B 2F4IA 2F0HA 2PNRC 1EL0A 2K5QA 2EYFA 2J0TD 4DGZA 4RGNA 4B9XA 1D1KA 2KQ3A 1PRTD 1EYAA 4LMQD 4ZUIA 4KKTA 3KLRA 2A74C 4ZLTF 1TWCB 3P1HA 1I3QB 2JA8B 1U4MA 2HQEA 1Q90A 3TBIB 5IGEA 4MHEA 1SE2A 2F0IA 4CJ1B 2XNAC 2SNSA 3QJYA 3DWAA 2XRSD 2VXWA 2EDGA 4P2CB 5CBEE 4OL7A 4KD4A 1IKLA 2AUJD 1BDOA 5C0XJ 1S5BD 1HQRD 3DXJC 2WACA 1BCPD 1PTOH 1BOSA 4RWSC 2SDFA 3S16B 2VB3X 2B39A 1BO0A 5E1FA 4FXDA 4XDXA 1C8CA 1HCZA 4CHTB 3KK7A 3LWUA 4IUTA 4ZYSA 4FF4A 4RA8A 3TP5A 3BS1A 2O5JC 2E2DC 3VYUA 1SYGA 4DNTB 4G7HC 3QO2A 1PFBA 5C3EB 1D2BA 5NUCA 1TS4A 3X3NA 5LHY1 4RCOA 4KKSA 3SHLA 1EY4A 3P7JA 3EA6A 1K8MA 3HP3A 3NQTA 2FJ2A 3LNNA 1JC7A 1B44D 2JA7B 2HUGA 4G57A 3M3YB 3VR4A 1A3UA 3HG9A 5EQ0A 2BDNA 4B9WA 3K5LA 1WTPA 1SNQA 2BE5C 2NN6H 4RGOS 3ITPA 2F0EA 1BCPB 4GZYC 3U9SA 2F0FA 3MA2B 3S1NB 2R92B 1SDFA 3FPUB 1LABA 1H9SB 3GTKB 1EQVA 3KBXA 1ML0D 1LT5D 3MEHA 1IL8A 1W6KA 1EU3A 2F0WA 2B2WA 4DAVA 2NVTB 3SE0A 1TS2A 1UUPA 5KNCA 2NVQB 1VMPA 4K5VA 5J1ZA 3E5SA 2IX3A 3Q0AA 1RJTA 2E75C 4LK1C 1ENFA 4Q0FA 5T1IA 2Z1CA 3SK5A 2EOTA 3TP8A 1KNAA 5EPJA 4Z9CB 1GUTA 4DK1A 2K33A 2PQEA 4H44C 4A3FB 2EYMA 1QG7A 4KY6A 2LY7A 1L0YB 3KBGA 5ISRA 1OXSC 1S5ED 4FXKC 2NWGA 2TSSA 3MTSA 1CM9A 3DEOA 2KCCA 1I4GA 1H9KA 5ELEA 3S15B 1QB5D 2ZXPA 1XXGA 4XQQA 2IJ0A 2L0CA 2F0UA 2F0GA 2IW3A 4DK0A 3DEPA 3A8IE 1SSOA 5CV9A 2VUMB 2A68D 1V1PB 3ND9A 1LTGD 4E6IA 2J7ZA 1PFMA 3V05A 2LKVA 1GXDC 3HRZC 5DM63 2QKIC 5EGTA 5I6YA 1XYIA 2DNEA 3CHBD 4IZ8A 1DYQA 1XTCD 4BBSB 5ELFA 3K7AB 3RZOB 1CQVA 3VR2A 1SAPA 3BVMA 3NUCA 1HHVA 2NYZD 2XWBB 5EKKA 1QJOA 2K5WA 5JEAH 1JWMD 2L1BA 1JOQA 3K5NA 2NTSA 4S3SA 3OPOA 5J22A 1YNND 2EYPA 2DY8A 4PNYA 4HAEA 4LAAA 3MXPA 1SYCA 5LL6S 1VDZA 1LACA 2B63B 2JYOA 3RZDB 1U4PA 4OO1I 4JK1C 4ZUJA 1ZXTA 2WV6D 1KLUD 1TT2A 2HCIA 2NN6G 5EJWA 1EOTA 4ZKBB 5EPKA 5IT9L 1TU2B 4PQXA 3S14B 4IN3A 3FKIB 3NTHA 2OXPA 5KNBA 4I65A 3GTMB 3NWSA 3MC0B 2NN6I 1L0XB 2RKSA 2FHTA 3IAYA 3N52A 1EY5A 1G291 1RCVD 4BY7B 2L11A 3CRLC 3OIQA 4KN7C 2QEJC 3OOCA 1SNMA 3NBHA 4BY1B 5KIXA 1ET9A 1STEA 2O5IC 5JPNC 2CVRA 1Y1VB 4X3TA 2G9DA 4K8IA 5HURA 2WP8J 3OIPA 1QILA 5FLXE 1QNUA 2B2WC 4A3KB 2X69A 1NR4A 3R3OA 1ENAA 3P75A 2PO4A 1SYBA 4FXGC 3GTQB 4RGMA 4HN7A 4UDUC 1KNEA 3K58A 3FPPA 5C3WA 3C1FA 4I7ZC 1HUNA 1SE3A 4IFDH 2B2UC 5JEAG 1WD0A 3C46A 2K6AA 1ZYRC 4KJOA 4ME5A 1HA5A 1PYWD 4O1NA 2WKCA 2RA4A 1M8AA 1W6JA 3D8GA 1S5CD 4ODGA 1QWYA 1PRTC 4H0LC 2LS01 4J8QA 1U4LA 3J80E 4PMCA 1F9RA 3VYTA 3MHBA 4XIGS 4B08A 3I4LA 5I9OA 2BOSA 2R61A 4G4KA 3DWQA 5KYIA 1QNKA 3UI2A 3ZYYX 1GUSA 4FP5D 1BNZA 2TMPA 5CMDA 3S1RB 4BA1I 3RLFA 5CV6A 2Z4HA 1ET6A 3D4RA 2EPBA 1RD9D 4Y7NB 5CGKA 4WRDA 5CV4A 4ILWA 2XN9C 2LFNA 2F0OA 3VYRA 1T5XD 2JA5B 5C0XH 4KMUC 3SEBA 4XQNA 1DCZA 2EYHA 1DONA 4KI0A 3ERQA 2IX1A 4EQPA 5D65A 1O80A 1QOHA 5CV8A 2RDFA 4KY5A 3GTLB 5JOBA 2LMCB 4C1NK 1TWGB 4M1UB 2OEOA 2H4OA 3NXWA 1R4QB 3TN2A 4OO1H 2BA1A 1JE4A 2ICEC 2K05A 3EQLC 1WTRA 5F2DA 1TIID 3BG3A 3MXGA 4K6DA 5FOBB 2KCNA 3A54A 1DOLA 4C56C 4O42A 1PRTF 1Q8IA 1I50B 4ZKCB 2PYKA 3VA5A 2F0NA 1EZ8A 1I4HA 1Y69U 2DY7A 2M2LA 1HXYD 1CZGA 1ESRA 1VF5C 5KGUA 1PFNA 1EWHA 5KYLA 3IFTA 4CKCA 1IKMA 3D6WA 1EY7A 2EY1A 2F0SA 1GHKA 4K14A 4MN3A 4ULLA 1DJRD 3MAQA 3OHXC 1SNOA 4KTAA 4XQJA 1STNA 2SOBA 4KY7A 3WOEA 1B9NA 1H9RA 2K32A 4H7BA 2FMCA 5C3XA 2HDLA 1LO5D 3R2IA 2DNCA 5E4XA 4XTCS 1DD2A 2PZWA 4KD3A 1GUNA 2SEBD 3EFXD 2FINB 3TMEA 1GUOA 1VMCA 4ZAIA 1B9MA 2JXMB 4N9PA 5ELCA 3FDTA 3PMFA 1IW7C 1JWUD 1OXUA 3GTOB 4WORA 1TKWB 1SEBD 2MPMA 2KECA 3T4AC 3NK9A 2RVLA 1EY8A 2KHSA 4IUPA 1F9QA 2A5HA 1TS3A 3NSWA 2R6GA 5C4HA 2HCCA 5IODA 3BDCA 2K03A 1SMYD 2IX0A 2PZUA 5DM73 4C3IB 3E6ZX 1DZ1A 1X3PA 1V8QA 2D5DA 1DXMA 2NVYB 2IL8A 3GP7A 1EEFD 1U4RA 1LTSD 3C1EA 4TRDA 2KVMA 1A3VA 1UNSA 1V1PA 2VB2X 4L63B 1EZ6A 1MSHA 3IFDA 1OXXK 3NWTA 3T53B 4QB4A 3TZUA 3K5MA 4V190 1CHPD 1EFID 1ENCA 2A6ED 3HOVB 2IWHA 1F9SA 1ESFA 1H9MA 1Q1BA 3HEJA 1C48A 2RSOA 3BVGA 4QF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFW A;  5CBA E;  4IUV A;  4DN4 M;  1DON A;  1WTV A;  3F2U A;  3HP3 A;  1EIH A;  2FJ2 A;  1HUN A;  2N88 A;  2NWG A;  1WTQ A;  5JJZ A;  5D65 A;  1O80 A;  2X6G A;  3MTS A;  1J9O A;  2HUG A;  2K1B A;  1J8I A;  3MWY W;  2FIN B;  1CM9 A;  1ZXT A;  2B2U C;  2B2V A;  2MGS A;  3SVM A;  1WD1 A;  3DEO A;  1VMC A;  2H1E A;  2L4N A;  4ZAI A;  5EKI A;  1ICW A;  2HCI A;  4LMQ D;  1WD0 A;  1AP0 A;  1AZP A;  5EJW A;  2MJ8 A;  2K28 A;  3R93 A;  3TN2 A;  5EQ0 A;  2BDN A;  3FDT A;  4R9W A;  4ZLT F;  4CJ0 B;  1EOT A;  2MP1 A;  4ZKB B;  1G2T A;  1MGS A;  1JE4 A;  1U4M A;  5EPK A;  1WTP A;  1B4O A;  3GV6 A;  1HFG A;  2EE1 A;  4MHE A;  2K05 A;  2K04 A;  1WVL A;  2D9U A;  1WTR A;  2MPM A;  1B2T A;  3DM1 A;  2KEC A;  1WTX A;  2KOL A;  1HFN A;  1NAP A;  4CJ1 B;  2RA4 A;  1G6Z A;  1M8A A;  3ONA B;  1B50 A;  4X3U A;  4U68 A;  5D14 A;  2B2Y C;  2RVL A;  4IUU A;  1HRJ A;  1DOL A;  3DEP A;  1SDF A;  1X3Q A;  2VXW A;  1F9Q A;  3FPU B;  4IUP A;  5CBE E;  1SSO A;  1QE6 A;  1ILP A;  1WTW A;  3KBX A;  1IKL A;  2HCC A;  4O42 A;  2NZ1 D;  1ML0 D;  2K03 A;  2Q8T A;  1AZQ A;  1O7Z A;  2JP1 A;  1IL8 A;  1ROD A;  1U4L A;  2FHT A;  1PFM A;  2J7Z A;  1NR2 A;  2KEE A;  4OIK A;  5DNF A;  3TZD A;  4QUF A;  3I8Z A;  1TVX A;  4ZK9 B;  1F2L A;  3N52 A;  4R8I A;  4IUR A;  1WTO A;  1F9R A;  2KUM A;  4CJ2 C;  2K01 A;  4QUC A;  1CA5 A;  1RTN A;  2B2W A;  2L11 A;  4ZKC B;  1DZ1 A;  4RAU C;  4RWS C;  2SDF A;  3G7L A;  1X3P A;  2DY7 A;  4X3S A;  1HA6 A;  2B2V C;  2M2L A;  1XYI A;  4XT1 B;  4HCS A;  1HUM A;  1S4Z A;  1E0B A;  1ESR A;  2KED A;  4OIJ A;  1VMP A;  3H91 A;  1MSG A;  4XT3 B;  2Q8R E;  2IL8 A;  3IL8 A;  1BBX C;  1PFN A;  1JIC A;  1MI2 A;  1DOK A;  4HED A;  2CVR A;  1Q3L A;  2FMM A;  1RJT A;  1B3A A;  1QNK A;  1PLF A;  1U4R A;  4X3T A;  1BO0 A;  2B2U A;  3I3C A;  1PDQ A;  1SAP A;  3UI2 A;  1G91 A;  4UAI A;  1GUW A;  2X6L A;  1IKM A;  2KVM A;  2N55 A;  3GV3 A;  5T1I A;  3D6W A;  1BNZ A;  1HHV A;  2NYZ D;  4XDX A;  3I91 A;  4IUQ A;  1ILQ A;  1RHP A;  1C8C A;  4MN3 A;  1BF4 A;  5CMD A;  1EIG A;  4NW2 A;  2B2W C;  2EOT A;  3KUP A;  4IUT A;  2X69 A;  1MSH A;  2B2T C;  3IFD A;  1NR4 A;  1KNA A;  2L1B A;  2FFK B;  5EPJ A;  1O7Y A;  2L12 A;  4RA8 A;  1G2S A;  1LV9 A;  1XX8 A;  2EPB A;  2B2Y A;  1CA6 A;  4X3K A;  1QG7 A;  2R3Z A;  2XIW A;  1B53 A;  2L9H A;  1F9S A;  5E4W C;  2HDL A;  4HSV A;  3Q6S A;  3QO2 A;  1PFB A;  2DY8 A;  1A15 A;  5E4X A;  5COR A;  5COY A;  1KNE A;  4HAE A;  1EQT A;  1NCV A;  5EPL A;  5T1G A;  1RTO A;  2RSO A;  3LWE A;  2JYO A;  2B2T A;  3P7J A;  1DOM A;  1F9P A;  1X32 A;  1U4P A;  2HDM A;  3I90 A;  2RSN A;  1EL0 A; 
#chains in the Genus database with same CATH topology
 1FD7 D;  5C4Z A;  1TR5 A;  4FF1 A;  5BN5 A;  2A69 D;  4IUN A;  4DV1 L;  3HZX A;  2RDH A;  4C3I G;  5C5M A;  2X6G A;  1K3B C;  4YWK A;  1E7Z A;  2L4N A;  2MO0 A;  4KV6 A;  5EKI A;  2A6E C;  3OMG A;  2VL6 A;  2R7Z H;  2K28 A;  1PXU A;  4CJ0 B;  4RKL A;  2MP1 A;  2CH4 A;  2NZO A;  1PH2 A;  3RMH A;  3S24 A;  2K04 A;  4OXP A;  2D9U A;  3L3O C;  1OO9 B;  5KEE A;  4N8X 1;  3DM1 A;  3TDQ A;  4A3I G;  3HOX B;  1Y1W B;  4X3U A;  3ULL A;  1TWG H;  3MFG A;  4IAL A;  1HRJ A;  1RDP D;  1A2T A;  2CQA A;  2R7D A;  4L6T B;  1Y14 B;  3MXN A;  3RZO H;  1KLG D;  4ME3 A;  3SK4 A;  3W2D A;  3I7F A;  4GNX B;  1SYD A;  1N32 Q;  1O7Z A;  4A3K H;  4KKU A;  3TZD A;  4A3G B;  2KEE A;  4UHV A;  4ZK9 B;  3I8Z A;  2K5V A;  3CQZ H;  4OGQ C;  4X66 L;  4DV5 L;  4QCL A;  1F2M A;  2CFM A;  3CCQ A;  2UXD Q;  4J6H A;  4GN4 B;  2WIN B;  3H94 A;  3OTO Q;  1GHJ A;  1STA A;  4A3D B;  3H91 A;  5IGB A;  3Q8D A;  2K7V A;  4JI7 Q;  1SNP A;  1GUG A;  3JAM i;  1EY6 A;  2MNA A;  2Z0S A;  2JK8 A;  1MIU A;  2YV5 A;  4C3J G;  1EUJ A;  1I4R A;  2B2U A;  4LW1 A;  1EYD A;  2I46 A;  4DAY B;  4F88 A;  5A2Q E;  1UAP A;  2L55 A;  1VS0 A;  3GV3 A;  1UEA B;  5EBC A;  2NBF A;  3A8J E;  2B8F A;  1ILQ A;  1D8L A;  3M7N A;  1STB A;  2Z6B A;  5J3B A;  1Q81 C;  4PG3 A;  2ZJP A;  1FGB D;  2Z8L A;  4OO1 G;  3HOW H;  2UXB Q;  4OX9 Q;  2A6H C;  3QOL A;  4NDX A;  1TS5 A;  1VQO A;  2Q8I B;  1TXY A;  1YJW A;  1LM0 A;  4POG A;  4OWX B;  2NVQ H;  5JJI A;  1G6P A;  4DR5 Q;  1OTC A;  2BH2 A;  3G6E A;  3NEN A;  4DV2 Q;  5FKA C;  2EZV A;  4CJ2 C;  4DAP A;  3FKI H;  4ZRZ A;  2GVB A;  3ND8 A;  2PI2 A;  2CW0 C;  1SR3 A;  4X62 L;  1CHQ D;  5JPM C;  1BKB A;  3FRP B;  2N78 A;  3A7A B;  4CKB A;  3PGZ A;  5HGT A;  3W3A A;  1EY9 A;  1S72 A;  3BZC A;  1SE4 A;  1IW7 D;  4F87 A;  2F0D A;  5IGD A;  3JAM L;  3T56 B;  1NUC A;  1I6V C;  1MGS A;  5M3M B;  2E74 C;  1Z47 A;  1WVL A;  1CK1 A;  4DU9 A;  3D0F A;  1Y8O B;  2V4D A;  3BVZ A;  4IQZ A;  3U9O A;  1B50 A;  5CV7 A;  1R9T B;  3HOY G;  2B2Y C;  3HKZ E;  1PH5 A;  2CWP A;  1BXT A;  1K8G A;  1BCP F;  2PCF B;  5IGC A;  1I4P A;  2O4X A;  5GAD C;  4B3S L;  2UUA Q;  2QIL A;  1F2L A;  3K5O A;  4DA2 A;  4K2K A;  4DV1 Q;  4JV5 L;  3D4D A;  3T1Y Q;  2D62 A;  4XYQ A;  5AJ3 Q;  4B3R Q;  2ES2 A;  1C4Q A;  1PRT B;  1STY A;  2EJG C;  2R92 H;  4C3H H;  1TWF B;  1VCI A;  2Q8R E;  1MI2 A;  4J1M A;  2VNU D;  1F77 A;  3CXC A;  1FL0 A;  2QGQ A;  5IT9 E;  1PTO C;  2I5H A;  1SRU A;  3SK6 A;  5KND A;  4TKO B;  4P72 A;  1JMC A;  1UWV A;  3T16 A;  2VUM H;  3MVV A;  2JA8 H;  4LF7 Q;  2OQK A;  2D2C C;  1QVC A;  2A8V A;  3D6C A;  5IP9 H;  1AE2 A;  4LF7 L;  2Q2I A;  2AUK A;  4PZ7 A;  1V43 A;  1PTO F;  1XJV A;  1KTK A;  4HSV A;  3Q6S A;  4LFC Q;  2E5L L;  2ICI A;  1EQT A;  1G8Z D;  1RTO A;  4MIU A;  3EN2 A;  3PO2 B;  1PMR A;  3I90 A;  2HDM A;  4RHS A;  2E8G A;  4A3E B;  1Z7T A;  4ABN A;  4DN4 M;  2ZT9 C;  4C3I H;  3WOF A;  4Y52 H;  1M90 C;  5IGF A;  4QIW B;  1IHZ A;  4K0K L;  4DUY Q;  4DV0 Q;  2EJM A;  4BA2 I;  1F2Z A;  1U5K A;  3GTJ B;  3Q23 A;  1HR0 Q;  4KHP Q;  1FR3 A;  1MD2 D;  2IT1 A;  3JC6 6;  1BCP C;  4MNO A;  4A3J B;  4B3M Q;  1XNQ L;  2E76 C;  3A56 A;  3KLS X;  5J39 A;  5FLX c;  1KAB A;  1GVP A;  3TEH B;  1L2F A;  1Z6H A;  1T9H A;  2DJF C;  3NE5 B;  1HNW Q;  3ONA B;  2JSO A;  2L15 A;  1ZKO A;  3H3V C;  2WAQ B;  4DV4 L;  1VQF A;  3URY A;  3HOZ H;  2QDB A;  4LF9 L;  4GKK L;  4G7Z C;  5IY0 A;  1O7L A;  1SMY C;  2NZ1 D;  3CP0 A;  3X3M A;  1M1K C;  1CQF A;  3P20 A;  2AWO A;  4R4Q A;  5DNF A;  1IXR A;  3I70 A;  1O78 A;  5C3E H;  5DEH A;  1PTO D;  4BS9 A;  1YNJ D;  5M3F H;  1CKN A;  1HNX L;  5IYC G;  1FYC A;  2NZH A;  1YI2 A;  3TP6 A;  4DV6 Q;  3W5O A;  3F2D A;  5C44 H;  3TSS A;  3PIO A;  3K80 C;  1K0S A;  2UU9 L;  3KOJ A;  3C2P A;  1I5F A;  1CTM A;  3S2D H;  2KED A;  4MTN A;  2PMZ B;  3G6J B;  1A2U A;  3W1G A;  1EWC A;  3J7A F;  3A5Z B;  4DV6 L;  4JBW A;  2K5H A;  1SBB B;  4TQU S;  1A62 A;  2JA7 H;  5C4J B;  4DXG A;  1KAA A;  2EYL A;  2N55 A;  3WDN A;  1U9R A;  3S1Q H;  1XPO A;  4YIJ A;  1JWS D;  2CKZ B;  4PMB A;  3ERO A;  2F0K A;  1TWC H;  3OW7 A;  4JV5 Q;  2F0P A;  1LV9 A;  4LF4 L;  4O2D A;  3NP8 A;  4C3H B;  1E22 A;  2DN8 A;  2UUA L;  1K83 B;  2AQ3 B;  3KJP A;  3IKJ A;  2NVT H;  1B53 A;  5COR A;  2OT2 A;  3GTG B;  4IFD J;  4JI5 Q;  2N3S A;  3H6M A;  4GLA C;  4FF3 A;  3LWE A;  4X6A H;  3TS2 A;  2MHV A;  4HCS A;  1D5M C;  1VQH A;  2HIV A;  1H95 A;  1LTB D;  2C5C A;  1R4P B;  1Q7Y C;  4IPH A;  3DHQ A;  1LTR D;  3ULP A;  1Y1W G;  4Q5V A;  3H0G G;  1J8I A;  3SVM A;  2HT1 A;  3BZD B;  1AP0 A;  4A3B B;  1Y8N B;  4PV1 C;  1K28 A;  3R93 A;  3CCR A;  2WII B;  5C6A A;  4HIO A;  1HNW L;  2EXZ A;  1B4O A;  5L37 A;  1WCM H;  3I4M B;  3BYT B;  2DGY A;  2M9V A;  3LX0 A;  3RN5 A;  5D14 A;  4EGV A;  1SYE A;  4A3D H;  3I73 A;  5IYB H;  2VZA A;  1PZK D;  4YHH L;  2OWO A;  2Z6K A;  1AW7 A;  1S5D D;  2NUC A;  2UXD L;  1TWH B;  4A3L H;  1JB3 A;  2RHQ B;  4JYA Q;  2JP1 A;  3GDE A;  5I4D A;  2BE5 D;  3K57 A;  4M8A A;  4L8J A;  2KUM A;  3S9W A;  2K01 A;  4AIM A;  4HTH A;  2F0V A;  3G7L A;  3CD6 A;  3I55 A;  2CHB D;  1VF7 A;  4JCV E;  2A73 B;  3GD7 A;  1CFM A;  4O0A A;  4A3F H;  1E0B A;  5FLX L;  3PO3 B;  1WOC A;  3S2H H;  1DOK A;  4JI2 Q;  1B3A A;  3RUZ A;  1SLJ A;  3J81 L;  3BDO A;  3A7L A;  1H9S A;  2Q2H A;  4WJW A;  1HTP A;  2BDO A;  3UE0 A;  4DR2 Q;  5LMN W;  2KCM A;  3PIP 3;  4JI2 L;  3HOU B;  4OWT B;  1KDB A;  3EVQ A;  3L7Z C;  4DAM A;  1VQ5 A;  1CUK A;  4NW2 A;  1E1O A;  4LF8 L;  4DR6 L;  5CYU A;  2VY3 A;  1EEI D;  1KHI A;  1HPC A;  5IYC H;  2YU9 B;  2G9H D;  3ER0 A;  4NMZ A;  4KHV A;  5JVH 3;  4KLK A;  1AN8 A;  1IBM Q;  3J7Y W;  4EVO A;  2UU9 Q;  3K0X A;  3HS0 C;  5E4W C;  4A3E G;  1OXT A;  3CQZ B;  3ULJ A;  1WTH A;  1C0A A;  4JOI A;  3GTO H;  3KF8 B;  1NCV A;  4IFD I;  1BUV T;  5T1G A;  1LYL A;  3HOZ G;  2WB1 B;  2PMZ E;  3TS0 A;  2B2T A;  5A35 A;  1UE1 A;  3BYY B;  3AMU A;  1K8O A;  3PUZ A;  3EJI A;  5M5Y B;  3I4N G;  5JJZ A;  1UE6 A;  1JQY D;  3SR1 A;  1H9J A;  3M85 A;  1J9O A;  4CKE A;  2MGS A;  2UUC L;  2F4V Q;  2UUB L;  4BXX H;  3R8B A;  1ICW A;  1E2W A;  1OXV A;  2YYZ A;  5D3D A;  4APV A;  4BXX G;  1AFP A;  3Q24 A;  3NEL A;  1G2T A;  2UUC Q;  2F4V L;  2VQE L;  5IWA Q;  4POF A;  1XPU A;  1EYC A;  2IHE A;  5M5X B;  3CRK C;  4AQY L;  4U67 3;  4X65 L;  1IBK L;  2I07 B;  1QZG A;  2VQF Q;  4L5R C;  5IP7 H;  2F1M A;  3CCS A;  4FYD A;  1X3Q A;  3T1Y L;  2WAQ E;  2CW0 D;  2KA7 A;  5ELB A;  1N8R C;  4QMG A;  1FJG Q;  4P75 A;  4DV3 L;  1X9N A;  4A3E H;  2KHJ A;  1AZQ A;  4KHZ A;  5A2Q L;  1SNC A;  4LFA Q;  1NR2 A;  1SYF A;  1YNJ C;  1ZYR D;  2RCN A;  1FNU A;  3RD4 A;  2O2L D;  1WTO A;  5IIF A;  3GTJ H;  2E2J B;  4RAU C;  2V1C C;  3HOZ B;  3MZ5 A;  2F0L A;  2CQO A;  4EQO A;  4OIJ A;  4K8J A;  4XT3 B;  2A68 C;  4HED A;  5I9P A;  3OSO A;  3M7G A;  4GN5 A;  1VQL A;  3L9A X;  2AHO B;  3I3C A;  1XTD A;  3S17 B;  1WFQ A;  4A3F G;  2KJX A;  3KF6 B;  5C44 B;  4C3H G;  4C2M H;  1RHP A;  5CC4 A;  3J80 c;  2HQL A;  2NTT A;  3OWF A;  1CSQ A;  1EIG A;  3QB3 A;  1UEB A;  1JOR A;  4ALP A;  3FEW X;  3NPP A;  3QIA A;  4JI3 L;  4GKJ L;  2B2Y A;  1D5Z C;  1EY0 A;  4MTK A;  4H13 C;  2A69 C;  2WKD A;  5K5P A;  2R3Z A;  4UY8 C;  2JEA I;  3S2H B;  2WB1 G;  3D3R A;  3K6O A;  3VR5 A;  3S1Q B;  4BBR H;  1B1Z A;  2Y0S B;  2NVX B;  3E0E A;  5M5W H;  2XRQ D;  1SXT A;  3M4O H;  1VQC A;  1DOM A;  4NKL A;  2E2H B;  1GOZ A;  3AFQ A;  4PZ6 A;  1JB7 A;  3CCJ A;  3PUX A;  4A3C G;  2N88 A;  1FNV A;  4JG2 A;  4JI8 L;  4HCE A;  2AQ2 B;  1LT3 D;  3B6Y A;  3I4O A;  5E3F A;  1AZP A;  4HSP A;  3TP7 A;  3S1M H;  3MEF A;  3J80 L;  2J4X A;  1L1O A;  5EAY A;  1SE8 A;  5C5L A;  1MBY A;  2VQF L;  3SXH A;  4N9T A;  4FF2 A;  1GM5 A;  5ELO A;  3PIO 3;  3VR6 A;  1NAP A;  4HMI A;  4U68 A;  4RG1 A;  2Q2T A;  2QW7 A;  1II3 A;  4FNF A;  3J81 c;  4BWG B;  5FO9 B;  1ROD A;  2MFI A;  5IOC A;  1DGS A;  1TVX A;  2EY6 A;  4HMJ A;  1X55 A;  3I72 A;  4F8M A;  5K36 H;  1CI3 M;  1CA5 A;  2ZJR A;  2OF1 A;  3K81 C;  5IGG A;  4LF9 Q;  1HA6 A;  2B2V C;  1O7I A;  2IPK D;  5TSS A;  2JA6 B;  4XT1 B;  2F0T A;  2UXC Q;  2XWJ B;  1BVS A;  1MSG A;  2PW7 A;  4LF5 L;  1SND A;  1Q3L A;  2FMM A;  2ZTD A;  3D31 A;  1YJN A;  2HHH L;  1PLF A;  3H09 A;  4RKB A;  4WFN 3;  1GUW A;  3QOJ A;  4UAI A;  3CC2 A;  1IYV A;  1FJG L;  4C3J H;  3SDZ A;  4OHJ A;  1HZ9 A;  4IPC A;  2R7Z G;  3V2T A;  3QG1 A;  4LF6 Q;  4F7X A;  2E2J H;  2JQO A;  2FFK B;  2LXJ A;  2L12 A;  2B63 H;  4LUV A;  1N9W A;  1KIX A;  3MXU A;  4A3M G;  4DR3 Q;  1SFO B;  4DR7 Q;  4X3K A;  2AWN A;  2XVS A;  1QCB D;  1RF2 D;  2VQE Q;  2L9H A;  1YHB A;  1RKN A;  2BA0 A;  2RBM A;  4JC0 A;  3M4Y A;  2EJF C;  4DNR B;  5IT9 c;  4QGU A;  4A3B G;  1MHW C;  2Z9H A;  4PMW A;  1F9P A;  1X32 A;  4KK7 A;  1D5X C;  1STG A;  4CDF C;  5FO7 B;  5CBA E;  4IUV A;  1SFO H;  4KJN A;  1EIH A;  3KJO A;  4A3I H;  2EQS A;  3MWY W;  4FVM A;  5C4J H;  1WD1 A;  2R7F A;  2H1E A;  1WCM G;  4YY3 Q;  2E2I B;  3O13 A;  3T51 B;  3OTO L;  3J81 j;  2Y0S G;  3T13 A;  4DXF A;  5JAV A;  1TQO A;  1CZW A;  3CU7 A;  2NVX H;  4X64 Q;  3G71 A;  4RHR A;  3C3L A;  4KN4 C;  3KF8 A;  3GTP H;  2KOL A;  3PIP A;  1WI5 A;  2K5D A;  4TSS A;  1D6E C;  5M3F B;  3HKZ B;  3A8K E;  1B8A A;  4UP7 A;  3UE1 A;  4K2L A;  4X64 L;  2A6H D;  3NTI A;  4BBS G;  1XWE A;  1YNX A;  1ASY A;  4OON A;  1ILP A;  5DAU A;  1LLR D;  5ELD A;  5AJ3 L;  1BR9 A;  2GA4 B;  4FO2 A;  4RFB A;  2Q8T A;  3JAM E;  1V1O A;  2OTL A;  1XMO L;  4OIK A;  4QUF A;  2ZM6 L;  3N6R A;  3M4O B;  1G6Z A;  1PFS A;  1YNN C;  2CCZ A;  4R8I A;  3KDF A;  1JJ2 A;  4P73 A;  4QUC A;  4YCU A;  3S1R H;  1PZJ D;  1RTN A;  4A3J G;  3Q22 A;  4DF7 A;  3OW2 A;  2PW5 A;  3AFP A;  4RMF A;  4Y7N H;  4L5S A;  4A3B H;  1PYB A;  4LJZ C;  1JIC A;  2C9O A;  1ZEQ X;  1E2V A;  5E7N A;  1HR0 W;  4RGT A;  3M3Y H;  2F3V A;  2RQX A;  3GTK H;  1KDA A;  2JA7 G;  2B8G A;  2QF7 A;  1Q1E A;  3I91 A;  1A3T A;  5CV5 A;  1CT1 D;  1BF4 A;  1I94 Q;  1E2Z A;  3VYS A;  1O7Y A;  4K5X A;  4UP9 A;  4ID6 A;  3GTL H;  1EU4 A;  1G2S A;  1HTL D;  1IZ6 A;  1CA6 A;  3NBH B;  5EKL A;  2PPB C;  2JEB I;  5M3F G;  5G3L D;  1IYU A;  5I2Y A;  3A55 A;  4MZ9 A;  5CR3 A;  3HOV G;  1D1I A;  2K52 A;  4RH6 A;  1Z9F A;  5EBD A;  1JOK A;  4R9W A;  1N34 Q;  3F2U A;  1NTG A;  1HZB A;  2F52 A;  1WCM B;  1WTQ A;  2OTJ A;  5K36 G;  1LUZ A;  2EYO A;  1L1O C;  4A3M B;  1VQ8 A;  2B2V A;  1LTA D;  1G51 A;  1LTL A;  5IWA L;  2MJ8 A;  4DV4 Q;  1BQQ T;  1JOO A;  5JEA J;  4A3G G;  3DWP A;  1XNR L;  2WB1 E;  4XXE A;  3GV6 A;  1HFG A;  4JI4 L;  4QJF A;  3PUY A;  4JI1 Q;  3HOW B;  4DR4 Q;  2F0J A;  1VQK A;  1PZI D;  1XNQ Q;  2BCO A;  3UDF A;  1PTO B;  3MFY A;  2MUY A;  3OWE B;  4A3I B;  1J5E Q;  2LXK A;  5M9O A;  1QE6 A;  5KRU A;  2EVB A;  3NBI A;  1WTW A;  2AQ1 B;  5C0X I;  5I6W A;  2QCP X;  1IBK Q;  3HOY B;  3I4N B;  3FVQ A;  3GQB A;  1E3P A;  1LTT D;  2PZT A;  1SJE D;  4AH6 A;  1BBU A;  3RR5 A;  1SJH D;  4YCV A;  5IE8 A;  1KDC A;  4A3C H;  2K5N A;  4AYB E;  3GTP B;  2ALY B;  3BDL A;  3A5U A;  3FMC A;  3R2T A;  5JVG 3;  1KQS A;  1S4Z A;  4C1N I;  1RIP A;  2Z4I A;  2R7Z B;  1STH A;  1BBX C;  2ZXO A;  2ASB A;  1FVI A;  3HGB A;  4BBR B;  3DUZ A;  1G91 A;  3V96 A;  1I4Q A;  1VQB A;  4CGY B;  2F3W A;  2X6L A;  2RDG A;  1HQM C;  4GS3 A;  3H0G B;  1T5E A;  4HR7 B;  4IUQ A;  1JR0 D;  3S1M B;  5FLM G;  2N49 A;  4NP5 A;  3J81 E;  1MKH A;  1YBY A;  2HD3 A;  1QUQ B;  3KUP A;  1DM0 B;  3K7A H;  2L5T A;  3IRB A;  3E0J A;  1PH9 A;  2R93 B;  3CPW A;  1XX8 A;  5FO8 B;  5M5Y H;  2NB0 A;  3H15 A;  1NSN S;  4A3G H;  3NTK A;  5C0X G;  2EY2 A;  5G3L F;  5COY A;  3AQQ A;  1X54 A;  4PZ8 A;  2F0M A;  5EPL A;  5C4X B;  1I6H B;  3K59 A;  3D4W A;  1KC8 C;  3H3V H;  4EQN A;  4YWM A;  4DAY A;  4WJ3 M;  2ZXR A;  5LL6 X;  3PQI A;  4DV7 L;  2RSN A;  1GJX A;  4P71 A;  3PF4 A;  5AFW A;  4DUZ Q;  1IBL L;  2CWA A;  1WTV A;  4G7O C;  1K3R A;  1FNW A;  3SK8 A;  1JJG A;  1V9P A;  4K5W A;  4C3J B;  5GQO A;  1VQN A;  3STB D;  2K1B A;  5D3I B;  5I2X A;  5BN4 A;  2M00 A;  2SNM A;  3DMU A;  3AB9 A;  1JCK B;  1TY2 A;  3E9H A;  3J7A V;  3PV0 A;  2K75 A;  4IFD G;  3OMC A;  3GO5 A;  2EE1 A;  4BBR G;  3VA7 A;  1I4X A;  3QWN A;  1Y8P B;  1B2T A;  4R8N A;  1WTX A;  1Q12 A;  1HFN A;  4IUU A;  1S5F D;  1F2Y A;  3J7Z C;  4RCN A;  1LTI D;  2JE6 I;  3NQI A;  5FLM H;  3NHH A;  1A6X A;  3AU7 A;  4DV5 Q;  3S14 H;  2RCF A;  4K6L A;  2F0Q A;  4V0B A;  2F03 A;  2ID0 A;  2DUD A;  4IUR A;  4A3K G;  2HHH Q;  3CKI B;  3HOW G;  1LT6 D;  1M4V A;  4XYO A;  3ICE A;  5FK9 C;  2XSC A;  3ZJY C;  1X65 A;  4X3S A;  3PUW A;  1LT4 D;  2N8N A;  2XGT A;  3KLS A;  1HUM A;  4A3J H;  4C2M B;  1VQM A;  1RL2 A;  3VR3 A;  4ZQ3 A;  3IL8 A;  1EOV A;  1WYD A;  3AEV A;  1PDQ A;  4B3T L;  3K0Y A;  2HIX A;  3F8T A;  4JBM A;  4CBV A;  1TWA B;  3KDF B;  2B2T C;  4DFA A;  1BBW A;  5M5W B;  4LFB L;  1AEX A;  4CDD C;  3HOX G;  4JOI C;  2ZM6 Q;  1W2B A;  2XIW A;  5BN3 A;  2EY5 A;  4AYB B;  1A15 A;  1TY0 A;  3S2D B;  3PUV A;  4TVA B;  2OQ0 A;  3VDY A;  2ENB A;  2EYJ A;  1ONL A;  4A93 B;  2F4I A;  2K50 A;  1Y1W H;  2F0H A;  4X62 Q;  2PNR C;  1EL0 A;  2K5Q A;  1W3S A;  2EYF A;  2J0T D;  2ZTC A;  3MXN B;  1IBM L;  3CME A;  4DGZ A;  4RGN A;  4B9X A;  1VQI A;  1PH4 A;  1N32 L;  4I7A A;  1D1K A;  2KQ3 A;  1PRT D;  5IYD G;  4GOP A;  1EYA A;  4LMQ D;  2JA9 A;  4ZUI A;  4KKT A;  3KLR A;  2A74 C;  4ZLT F;  1TWC B;  3P1H A;  1I3Q B;  4OEL B;  2JA8 B;  1U4M A;  2HQE A;  1Q90 A;  4YCW A;  3TBI B;  3M4P A;  5C4X H;  5IGE A;  4MHE A;  1C9O A;  1UE7 A;  1Q86 C;  1SE2 A;  2F0I A;  3WWV A;  1XMO Q;  1PVO A;  2B63 G;  3GTQ H;  4GKJ Q;  4CJ1 B;  5HGQ A;  2XNA C;  2SNS A;  2IHF A;  3QJY A;  4JBJ A;  2PNH A;  4HJ5 A;  3DWA A;  2KHI A;  2XRS D;  2VXW A;  2EDG A;  4P2C B;  5CBE E;  4OL7 A;  1NJI C;  4KD4 A;  2IY5 B;  1IKL A;  1PH1 A;  2AUJ D;  1BDO A;  5C0X J;  1HH2 P;  3I4M H;  1S5B D;  1HQR D;  3DXJ C;  4R4I A;  2WAC A;  1BCP D;  4GN3 B;  2UXB L;  1PTO H;  1GO3 E;  3PSI A;  1BOS A;  3UDX A;  2Q2U A;  4RWS C;  2SDF A;  4DR5 L;  3S16 B;  1TWH H;  2VB3 X;  4NXN L;  4R4O A;  1KD1 C;  4NB3 A;  2B39 A;  3CAM A;  1NE3 A;  1YHQ A;  1YHA A;  1R9T H;  4L5Q A;  1BO0 A;  5E1F A;  2ATW A;  1HZA A;  4HIM A;  1EWI A;  1YVC A;  4JYA L;  4XDX A;  4FXD A;  2PI2 E;  1C8C A;  4NXN Q;  1HCZ A;  1U0L A;  2WAQ G;  4CHT B;  3KK7 A;  3LGJ A;  3LWU A;  4IUT A;  3TQY A;  4LUZ A;  4ZYS A;  2FXQ A;  4FF4 A;  3RN2 A;  5IYB G;  1S3O A;  4RA8 A;  3TP5 A;  3BS1 A;  3CCV A;  4X65 Q;  4QQB X;  1JJC B;  2O5J C;  2E2D C;  3VYU A;  2GVA A;  5GRO A;  1SYG A;  4DNT B;  4G7H C;  3QO2 A;  1PFB A;  1Y1V G;  5C3E B;  1D2B A;  5NUC A;  1TS4 A;  2Y0S E;  3X3N A;  5LHY 1;  4LF5 Q;  4RCO A;  2G5D A;  4KKS A;  3SHL A;  2E2I H;  3U58 A;  2PQA B;  1EY4 A;  1VQJ A;  3P7J A;  5C44 G;  3EA6 A;  2AMC B;  4DKA C;  4LUO A;  2KBN A;  1K8M A;  3HP3 A;  3NQT A;  2FJ2 A;  3UDG A;  4JPB W;  1JT8 A;  3LNN A;  1JC7 A;  1B44 D;  4OEM B;  3T1H L;  2JA7 B;  2HUG A;  1IBL Q;  4G57 A;  2RHS B;  3M3Y B;  4BY7 H;  3S1N H;  3VR4 A;  1A3U A;  3HG9 A;  4R1J A;  5EQ0 A;  2BDN A;  4B9W A;  2JA6 G;  1J5E L;  2R93 H;  2QEX A;  3K5L A;  1TWA H;  1WTP A;  1SNQ A;  2BE5 C;  2NN6 H;  3QR8 A;  4LNQ A;  4BY1 H;  4RGO S;  4DK6 C;  2OCE A;  4A93 H;  3ITP A;  1Q82 C;  2F0E A;  4QL5 A;  2A19 A;  1BCP B;  1EQQ A;  4GZY C;  3U9S A;  2F0F A;  3MA2 B;  3S1N B;  2R92 B;  1SDF A;  3FPU B;  1LAB A;  1H9S B;  4LF8 Q;  3GTK B;  1I94 L;  4DR6 Q;  1GKH A;  1EQV A;  3CCL A;  3KBX A;  1ML0 D;  2AKW B;  1SMX A;  1LT5 D;  3MEH A;  1VQ6 A;  1IL8 A;  5GAG C;  1W6K A;  2C35 B;  3E9I A;  1PH3 A;  1EU3 A;  2F0W A;  2B2W A;  4DAV A;  5LMU Q;  2NVT B;  3SE0 A;  4GNX C;  4JI6 L;  1TS2 A;  1UUP A;  1I50 H;  5KNC A;  2NVQ B;  2E5L Q;  1VMP A;  3L2P A;  4K5V A;  5J1Z A;  3E5S A;  2IX3 A;  3Q0A A;  1RJT A;  1EFW A;  2E75 C;  4LK1 C;  1XMQ Q;  4LF4 Q;  1ENF A;  1D7Q A;  4Q0F A;  1NBW A;  1X3G A;  5T1I A;  1CKO A;  4IOA A;  5IP9 G;  2Z1C A;  1KAW A;  2DJG C;  3A74 A;  3SK5 A;  1ASZ A;  2EOT A;  1X6O A;  3TP8 A;  1KNA A;  5IP7 G;  5EPJ A;  2VUM G;  1PH7 A;  4Z9C B;  1GUT A;  2MO1 A;  1XMQ L;  4DK1 A;  2K33 A;  2PQE A;  4H44 C;  4A3F B;  2EYM A;  1QG7 A;  2NVY H;  4KY6 A;  1ICF B;  4JI4 Q;  2LY7 A;  1NMF A;  3HKZ G;  5GAH C;  1L0Y B;  3KBG A;  2H5X A;  1A0I A;  5ISR A;  1OXS C;  1S5E D;  4FXK C;  4JI7 L;  3FKI G;  2NWG A;  2TSS A;  4OX9 L;  3I4N H;  4NXM Q;  1HNZ L;  3MTS A;  4B3S Q;  1CM9 A;  3DEO A;  2KCC A;  3HOV H;  1I4G A;  1H9K A;  5ELE A;  3S15 B;  1QB5 D;  2ZXP A;  1XXG A;  4XQQ A;  1FGU A;  3FHW A;  2IJ0 A;  2L0C A;  2F0U A;  2F0G A;  4J15 A;  4DNI A;  2IW3 A;  4DK0 A;  4DPG A;  1IYJ B;  3DEP A;  4AQY Q;  3A8I E;  1SSO A;  5CV9 A;  3W1B A;  2VUM B;  1Y1V H;  2A68 D;  1V1P B;  3ND9 A;  4DUY L;  4DV0 L;  3RLN A;  1LTG D;  4E6I A;  2J7Z A;  1PFM A;  3V05 A;  2LKV A;  1GXD C;  3UDI A;  4CDC C;  3HRZ C;  2JN4 A;  5DM6 3;  2QKI C;  5EGT A;  5I6Y A;  1XYI A;  2R92 G;  2DNE A;  3CHB D;  3PCO B;  1DYQ A;  4IZ8 A;  4DV7 Q;  1XTC D;  4LFC L;  4DR1 L;  4BBS B;  1QVG A;  5ELF A;  3K7A B;  3RZO B;  4HIK A;  1CQV A;  3VR2 A;  4BY1 G;  1SAP A;  3A0J A;  5M5X H;  3BVM A;  3NUC A;  4YY3 L;  2JA6 H;  1HHV A;  2NYZ D;  2B29 A;  2XWB B;  1SN8 A;  5EKK A;  1QJO A;  2K5W A;  5JEA H;  4BBS H;  5DLQ E;  1JWM D;  1KRS A;  3CPF A;  2ZJQ A;  2L1B A;  1JOQ A;  1K9M C;  1CKN B;  4WJ4 A;  2NTS A;  3K5N A;  3DLL A;  4S3S A;  3ERS X;  3OPO A;  5J22 A;  1K73 C;  1YNN D;  4A75 A;  2EYP A;  2DY8 A;  1I3Q H;  4PNY A;  4HAE A;  4LAA A;  2YTY A;  3MXP A;  3CCU A;  4B3R L;  1SYC A;  5LL6 S;  1VDZ A;  1LAC A;  2JYO A;  3CF5 A;  3M9B A;  3CCE A;  3RZD B;  2B63 B;  1U4P A;  4JI0 L;  4OO1 I;  3KF6 A;  4JK1 C;  4JI1 L;  4DR4 L;  4ZUJ A;  4LF6 L;  1QUQ A;  1IL2 A;  1ZXT A;  5LMN Q;  1CKM A;  2WV6 D;  3RLO A;  4HJ8 A;  1KLU D;  1SRO A;  2R93 G;  2P5Z X;  1TT2 A;  2HCI A;  2NN6 G;  3PO3 G;  5EJW A;  1N36 Q;  1KXL A;  2XTI A;  3S17 H;  1EOT A;  4ZKB B;  1HNX Q;  4IOC A;  5LMN L;  1NNX A;  2YU9 H;  5EPK A;  5IT9 L;  1TU2 B;  1S40 A;  4UP8 A;  3CCM A;  4PQX A;  4EQ5 A;  3S14 B;  2K14 A;  3S16 H;  3T1H Q;  3K8A A;  4IN3 A;  3K7U C;  3FKI B;  2Z6K C;  2PQA A;  3NTH A;  4R4T A;  2OXP A;  5KNB A;  4I65 A;  3GTM B;  3NWS A;  2WFW A;  3MC0 B;  2NN6 I;  1L0X B;  4CDE C;  3M4Q A;  2RKS A;  2FHT A;  1B3Q A;  3IAY A;  3H0G H;  3N52 A;  5M3M H;  1EY5 A;  3I4M G;  3L0O A;  1G29 1;  1RCV D;  4BY7 B;  2L11 A;  3CRL C;  3OIQ A;  4KN7 C;  3GTM H;  2QEJ C;  3OOC A;  1SNM A;  1NMG A;  3NBH A;  4KHP L;  5H1S E;  4BY1 B;  1JE5 A;  4ZCK A;  1ET9 A;  5KIX A;  3J7A 5;  1STE A;  1PYS B;  2O5I C;  5JPN C;  2CVR A;  1Y1V B;  5C3E G;  4X3T A;  2G9D A;  4K8I A;  4QIW E;  5HUR A;  2WP8 J;  4FDB A;  4EX5 A;  2JA5 H;  3DM3 A;  3OIP A;  2CH4 W;  1QIL A;  5FLX E;  1N36 L;  4JI6 Q;  1QNU A;  1YJ9 A;  4DK3 C;  2B2W C;  4A3K B;  2X69 A;  1B70 B;  1NR4 A;  1K0R A;  2BH8 A;  3TRE A;  3R3O A;  1ENA A;  3P75 A;  4DUZ L;  2PO4 A;  4OWW B;  1SYB A;  4P74 A;  4FXG C;  5M3M G;  3GTQ B;  4RGM A;  4HN7 A;  4UDU C;  4DR1 Q;  1KNE A;  3J80 i;  2YTX A;  4QY7 A;  2D0P A;  3K58 A;  3FPP A;  5C3W A;  2UUB Q;  3C1F A;  4I7Z C;  1HUN A;  1SE3 A;  5JJK A;  1HJP A;  1P16 A;  2VS1 A;  3EBE A;  4IJH A;  4IFD H;  4A76 A;  2B2U C;  5JEA G;  3F2B A;  5C4X G;  1WD0 A;  3C46 A;  4IJL A;  2K6A A;  1ZYR C;  2YTV A;  1N33 Q;  1AH9 A;  4KJO A;  5IYD H;  3PO3 H;  4ME5 A;  1HA5 A;  5FJ8 H;  1PYW D;  1X3E A;  4O1N A;  3RZD H;  2WKC A;  1Q8K A;  1VQG A;  2RA4 A;  1M8A A;  1UE5 A;  4GKK Q;  1W6J A;  2D0O A;  3D8G A;  4JI5 L;  1S5C D;  4ODG A;  1MJE A;  4B3M L;  3NEM A;  1QWY A;  1PRT C;  4H0L C;  2LS0 1;  4J8Q A;  1U4L A;  1KL9 A;  1V1Q A;  3J80 E;  4NPS A;  4PMC A;  3BU2 A;  3CC4 A;  3U4V A;  1F9R A;  3VYT A;  2F3I A;  3MHB A;  1EQR A;  4XIG S;  3HOX H;  4B08 A;  3I4L A;  3HOU H;  5I9O A;  2BOS A;  2R61 A;  4G4K A;  5GAE C;  3DWQ A;  3JAM c;  3F1Z A;  5KYI A;  1QNK A;  4JI8 Q;  5ELN A;  3UI2 A;  1NY4 A;  3ZYY X;  4UPA A;  1GUS A;  1P8L A;  1KRT A;  4FP5 D;  1BNZ A;  1A63 A;  2UXC L;  1YIJ A;  2E2H H;  2TMP A;  5CMD A;  3S1R B;  2VW9 A;  2I5L X;  3HOY H;  2QDL A;  4BA1 I;  3RLF A;  5CV6 A;  2Z4H A;  1ET6 A;  3D4R A;  3PF5 A;  2EPB A;  1RD9 D;  2EIF A;  4Y7N B;  5CGK A;  1XPR A;  4WRD A;  4ILW A;  5CV4 A;  1L1O B;  2XN9 C;  3HKS A;  4LFB Q;  2LFN A;  2JJQ A;  2F0O A;  3VYR A;  3SGI A;  1T5X D;  4N8F A;  2JA5 B;  5C0X H;  4KMU C;  1A8V A;  3SEB A;  4YWL A;  4IPD A;  4XQN A;  1E24 A;  1DCZ A;  4GLX A;  5JJL A;  2EYH A;  1DON A;  4KI0 A;  3ERQ A;  2IX1 A;  4EQP A;  5BR8 L;  5D65 A;  1O80 A;  1QOH A;  5CV8 A;  2RDF A;  3KYH C;  4DR2 L;  4KY5 A;  4GNX A;  1PH6 A;  3GTL B;  5JOB A;  2LMC B;  4C1N K;  4GLV B;  1TWG B;  4M1U B;  2OEO A;  1VQ4 A;  2H4O A;  3NXW A;  1AE3 A;  1R4Q B;  1TWF H;  3TN2 A;  4YHH Q;  4OO1 H;  2BA1 A;  1JE4 A;  1GD7 A;  4H02 A;  1Q46 A;  2MQH A;  2ICE C;  2K05 A;  3TRZ A;  3EQL C;  1WTR A;  5F2D A;  1TII D;  3BG3 A;  1XNR Q;  3MXG A;  4K6D A;  5FOB B;  2KCN A;  3A54 A;  1DOL A;  1VQ9 A;  4C56 C;  2KEN A;  4O42 A;  2QA4 A;  2JA8 G;  1HZC A;  1PRT F;  1X3F A;  1Q8I A;  1I50 B;  4ZKC B;  4HJ9 A;  4DR3 L;  4JI0 Q;  4DR7 L;  1J6Q A;  2PYK A;  3VA5 A;  2F0N A;  1EZ8 A;  4JI3 Q;  1N33 L;  1I4H A;  3BJU A;  4IPG A;  1Y69 U;  2ZTE A;  2DY7 A;  3HOU G;  3PO2 H;  1PH8 A;  2M2L A;  1HXY D;  3G48 A;  1CZG A;  3H3V I;  1ESR A;  1C7Y A;  4JW0 A;  1VF5 C;  3PO2 G;  5KGU A;  1PFN A;  4HJA A;  2K4K A;  1VQP A;  1EWH A;  1YZ6 A;  5KYL A;  1EYG A;  3IFT A;  4CKC A;  3CW2 C;  1IKM A;  2RF4 A;  3D6W A;  3EIV A;  1EY7 A;  2EY1 A;  2F0S A;  1GHK A;  4K14 A;  1CSP A;  4MN3 A;  3HFZ B;  4ULL A;  1DJR D;  3MAQ A;  4X66 Q;  3OHX C;  1X56 A;  1SNO A;  4LFA L;  4KTA A;  4KY7 A;  1STN A;  2SOB A;  4XQJ A;  4H7B A;  1B9N A;  1H9R A;  2K32 A;  3WOE A;  2FMC A;  3U4Z A;  3FP9 A;  5C3X A;  3KLW A;  2HDL A;  1LO5 D;  3R2I A;  2DNC A;  5E4X A;  4HID A;  4JBK A;  2A1A A;  4XTC S;  3S15 H;  4IO9 A;  1DD2 A;  2PZW A;  4KD3 A;  3GTG H;  1GUN A;  1MJC A;  2SEB D;  2FIN B;  3EFX D;  3TME A;  4A93 G;  1GUO A;  1VMC A;  4ZAI A;  4GOP C;  1B9M A;  2JXM B;  4N9P A;  2B3G A;  5ELC A;  3FDT A;  3PMF A;  1IW7 C;  1JWU D;  1OXU A;  1QVF A;  3GTO B;  4WOR A;  1TKW B;  4BY7 G;  1SEB D;  2MPM A;  4B3T Q;  2KEC A;  3T4A C;  5HY6 A;  3NK9 A;  2RVL A;  4DV3 Q;  1EY8 A;  2KHS A;  4IUP A;  1F9Q A;  2A5H A;  3E3X A;  3KFU A;  1TS3 A;  3F2C A;  3NSW A;  4A4I A;  4L5T A;  1VQE A;  2R6G A;  5C4H A;  3CC7 A;  2HCC A;  5IOD A;  3BDC A;  2K03 A;  4NXM L;  1SMY D;  1VQ7 A;  2IX0 A;  1K83 H;  1I6H H;  2PZU A;  2EXD A;  1EIY B;  1YIT A;  1QZH A;  4A3M H;  5BR8 Q;  1B7Y B;  2LSS A;  5DM7 3;  4C3I B;  1VQD A;  4LWC A;  1PHJ A;  2GN5 A;  3E6Z X;  1DZ1 A;  2I0Q A;  3U50 C;  1X3P A;  3BZK A;  1V8Q A;  1YEZ A;  2D5D A;  4R4C A;  4DV2 L;  4HJ7 A;  5LMU L;  1DXM A;  1PV4 A;  2NVY B;  2IL8 A;  1EIF A;  3GP7 A;  1EEF D;  3J81 i;  1U4R A;  4K0K Q;  1LTS D;  3CMA A;  3C1E A;  4TRD A;  3STB C;  1N34 L;  2KVM A;  1A3V A;  2KCT A;  1UNS A;  1HR0 L;  1V1P A;  2VB2 X;  4L63 B;  3RNU A;  1WJJ A;  1EZ6 A;  3G4S A;  3IFD A;  1MSH A;  1OXX K;  3NWT A;  1K8A C;  3T53 B;  4GOP B;  4QB4 A;  3TZU A;  2JA5 G;  3K5M A;  2I5M X;  1CHP D;  4V19 0;  1EFI D;  1ENC A;  2A6E D;  1PA6 A;  3HOV B;  2IWH A;  3I2Z A;  1F9S A;  1HNZ Q;  5FJ8 G;  1ESF A;  1E1T A;  3I56 A;  4A3L G;  3AYH B;  1H9M A;  1Q1B A;  4AYB G;  4JVZ A;  3HEJ A;  1C48 A;  3OYY A;  2RSO A;  3BVG A;  4QF4 A;  4A3D G;  1L0W A;  1VQA A; 
#chains in the Genus database with same CATH homology
 1FD7 D;  5C4Z A;  1TR5 A;  4FF1 A;  5BN5 A;  2A69 D;  4IUN A;  3HZX A;  2RDH A;  4C3I G;  5C5M A;  2X6G A;  2L4N A;  4KV6 A;  5EKI A;  2A6E C;  3OMG A;  2K28 A;  1PXU A;  4CJ0 B;  4RKL A;  2MP1 A;  3RMH A;  2K04 A;  2D9U A;  3L3O C;  1OO9 B;  5KEE A;  3DM1 A;  3TDQ A;  3HOX B;  1Y1W B;  4X3U A;  3MFG A;  4IAL A;  1HRJ A;  1RDP D;  1A2T A;  2CQA A;  4L6T B;  3MXN A;  1KLG D;  3SK4 A;  3W2D A;  1SYD A;  1O7Z A;  4KKU A;  3TZD A;  4A3G B;  2KEE A;  4ZK9 B;  3I8Z A;  4OGQ C;  4QCL A;  1F2M A;  4J6H A;  2WIN B;  3H94 A;  1GHJ A;  1STA A;  4A3D B;  3H91 A;  5IGB A;  2K7V A;  1SNP A;  1GUG A;  1EY6 A;  4C3J G;  1I4R A;  2B2U A;  1EYD A;  2I46 A;  4F88 A;  5A2Q E;  1UAP A;  2L55 A;  3GV3 A;  1UEA B;  5EBC A;  2NBF A;  3A8J E;  2B8F A;  1ILQ A;  3M7N A;  1STB A;  1FGB D;  2Z8L A;  4OO1 G;  2A6H C;  3QOL A;  4NDX A;  1TS5 A;  2Q8I B;  5FKA C;  2EZV A;  4CJ2 C;  4DAP A;  4ZRZ A;  3ND8 A;  2CW0 C;  1CHQ D;  5JPM C;  3FRP B;  3A7A B;  4CKB A;  5HGT A;  3W3A A;  1EY9 A;  1SE4 A;  1IW7 D;  4F87 A;  2F0D A;  5IGD A;  3JAM L;  3T56 B;  1NUC A;  1I6V C;  1MGS A;  5M3M B;  2E74 C;  1Z47 A;  1WVL A;  1CK1 A;  4DU9 A;  1Y8O B;  2V4D A;  3BVZ A;  4IQZ A;  3U9O A;  1B50 A;  5CV7 A;  1R9T B;  2B2Y C;  1BXT A;  1BCP F;  2PCF B;  5IGC A;  1I4P A;  2O4X A;  2QIL A;  1F2L A;  3K5O A;  4DA2 A;  4K2K A;  3D4D A;  2D62 A;  4XYQ A;  1C4Q A;  1PRT B;  1STY A;  2EJG C;  1TWF B;  1VCI A;  2Q8R E;  1MI2 A;  4J1M A;  2VNU D;  1F77 A;  5IT9 E;  1PTO C;  3SK6 A;  5KND A;  4TKO B;  3T16 A;  3MVV A;  2D2C C;  3D6C A;  2AUK A;  1V43 A;  1PTO F;  1KTK A;  4HSV A;  3Q6S A;  2ICI A;  1EQT A;  1G8Z D;  1RTO A;  4MIU A;  3PO2 B;  1PMR A;  3I90 A;  2HDM A;  4RHS A;  4A3E B;  1Z7T A;  4DN4 M;  4ABN A;  2ZT9 C;  3WOF A;  5IGF A;  4QIW B;  1IHZ A;  2EJM A;  4BA2 I;  1F2Z A;  3GTJ B;  3Q23 A;  1FR3 A;  1MD2 D;  2IT1 A;  1BCP C;  4A3J B;  2E76 C;  3A56 A;  3KLS X;  5J39 A;  1KAB A;  1Z6H A;  3NE5 B;  3ONA B;  2JSO A;  1ZKO A;  3H3V C;  2WAQ B;  3URY A;  2QDB A;  4G7Z C;  1O7L A;  1SMY C;  2NZ1 D;  3X3M A;  1CQF A;  3P20 A;  2AWO A;  5DNF A;  3I70 A;  1O78 A;  5DEH A;  1PTO D;  4BS9 A;  1YNJ D;  1FYC A;  3TP6 A;  3TSS A;  3C2P A;  1CTM A;  2KED A;  2PMZ B;  3G6J B;  1A2U A;  1EWC A;  3J7A F;  4JBW A;  1SBB B;  4TQU S;  5C4J B;  4DXG A;  1KAA A;  2EYL A;  2N55 A;  3WDN A;  1U9R A;  4YIJ A;  1JWS D;  4PMB A;  3ERO A;  2F0K A;  3OW7 A;  2F0P A;  1LV9 A;  4C3H B;  3NP8 A;  2DN8 A;  1K83 B;  2AQ3 B;  3IKJ A;  1B53 A;  5COR A;  2OT2 A;  3GTG B;  4IFD J;  3H6M A;  4FF3 A;  3LWE A;  2MHV A;  4HCS A;  1D5M C;  1LTB D;  2C5C A;  1R4P B;  3DHQ A;  1LTR D;  4Q5V A;  1J8I A;  3SVM A;  3BZD B;  1AP0 A;  4A3B B;  1Y8N B;  4PV1 C;  3R93 A;  2WII B;  5C6A A;  2EXZ A;  1B4O A;  3I4M B;  3BYT B;  2M9V A;  3LX0 A;  5D14 A;  4EGV A;  1SYE A;  3I73 A;  1PZK D;  1AW7 A;  1S5D D;  2NUC A;  1TWH B;  1JB3 A;  2JP1 A;  5I4D A;  2BE5 D;  3K57 A;  4M8A A;  4L8J A;  2KUM A;  3S9W A;  2K01 A;  4HTH A;  2F0V A;  3G7L A;  2CHB D;  1VF7 A;  3PO3 B;  2A73 B;  3GD7 A;  1CFM A;  1E0B A;  5FLX L;  1DOK A;  1B3A A;  3RUZ A;  3J81 L;  3BDO A;  3A7L A;  1H9S A;  4WJW A;  1HTP A;  2BDO A;  3PIP 3;  3HOU B;  1KDB A;  3EVQ A;  3L7Z C;  4NW2 A;  5CYU A;  1EEI D;  1HPC A;  2YU9 B;  2G9H D;  4KHV A;  5JVH 3;  4NMZ A;  1AN8 A;  3J7Y W;  4EVO A;  5E4W C;  3HS0 C;  1OXT A;  3CQZ B;  1NCV A;  4IFD I;  1BUV T;  5T1G A;  2WB1 B;  2B2T A;  5A35 A;  3BYY B;  3AMU A;  1K8O A;  3PUZ A;  3EJI A;  5M5Y B;  5JJZ A;  1JQY D;  3SR1 A;  1H9J A;  3M85 A;  1J9O A;  4CKE A;  2MGS A;  3R8B A;  1ICW A;  1E2W A;  1OXV A;  2YYZ A;  5D3D A;  1AFP A;  3Q24 A;  1G2T A;  1EYC A;  5M5X B;  3CRK C;  4U67 3;  2I07 B;  2F1M A;  4FYD A;  1X3Q A;  2CW0 D;  2KA7 A;  5ELB A;  4QMG A;  1AZQ A;  4KHZ A;  5A2Q L;  1SNC A;  3RD4 A;  1NR2 A;  1SYF A;  1YNJ C;  1ZYR D;  1FNU A;  2O2L D;  1WTO A;  5IIF A;  2E2J B;  4RAU C;  3HOZ B;  3MZ5 A;  2F0L A;  4EQO A;  4OIJ A;  4K8J A;  4XT3 B;  2A68 C;  4HED A;  5I9P A;  3OSO A;  3M7G A;  3L9A X;  3I3C A;  3S17 B;  2KJX A;  5C44 B;  4C3H G;  1RHP A;  5CC4 A;  2NTT A;  3OWF A;  1EIG A;  3QB3 A;  1JOR A;  3FEW X;  3NPP A;  3QIA A;  2B2Y A;  1D5Z C;  1EY0 A;  4H13 C;  2A69 C;  2WKD A;  5K5P A;  2R3Z A;  2JEA I;  3S2H B;  3D3R A;  3K6O A;  3VR5 A;  3S1Q B;  1B1Z A;  2Y0S B;  2NVX B;  2XRQ D;  1SXT A;  1DOM A;  4NKL A;  2E2H B;  1GOZ A;  3PUX A;  2N88 A;  1FNV A;  4HCE A;  2AQ2 B;  1LT3 D;  5E3F A;  1AZP A;  4HSP A;  3TP7 A;  3J80 L;  2J4X A;  5C5L A;  4FF2 A;  1MBY A;  3SXH A;  4N9T A;  3PIO 3;  3VR6 A;  1NAP A;  4HMI A;  4U68 A;  1II3 A;  4FNF A;  4BWG B;  5FO9 B;  1ROD A;  5IOC A;  1TVX A;  2EY6 A;  4HMJ A;  3I72 A;  4F8M A;  5K36 H;  1CI3 M;  1CA5 A;  2OF1 A;  5IGG A;  1HA6 A;  2B2V C;  2IPK D;  5TSS A;  2JA6 B;  4XT1 B;  2F0T A;  2XWJ B;  2PW7 A;  1MSG A;  1SND A;  1Q3L A;  2FMM A;  3D31 A;  1PLF A;  3H09 A;  4RKB A;  4WFN 3;  1GUW A;  3QOJ A;  4UAI A;  1IYV A;  3SDZ A;  4OHJ A;  3V2T A;  3QG1 A;  4F7X A;  2FFK B;  2L12 A;  3MXU A;  1SFO B;  4X3K A;  2AWN A;  2XVS A;  1QCB D;  1RF2 D;  2L9H A;  2RBM A;  1RKN A;  2BA0 A;  3M4Y A;  2EJF C;  4DNR B;  4PMW A;  1F9P A;  1X32 A;  4KK7 A;  1D5X C;  1STG A;  5FO7 B;  5CBA E;  4IUV A;  4KJN A;  1EIH A;  3MWY W;  4FVM A;  1WD1 A;  2H1E A;  2E2I B;  3O13 A;  3T51 B;  3T13 A;  4DXF A;  5JAV A;  1TQO A;  1CZW A;  3CU7 A;  4RHR A;  3C3L A;  4KN4 C;  3KF8 A;  2KOL A;  2K5D A;  4TSS A;  1D6E C;  5M3F B;  3HKZ B;  3A8K E;  4K2L A;  2A6H D;  3NTI A;  1XWE A;  1ILP A;  5DAU A;  1LLR D;  5ELD A;  1BR9 A;  2GA4 B;  4FO2 A;  4RFB A;  2Q8T A;  3JAM E;  1V1O A;  4OIK A;  4QUF A;  1G6Z A;  3N6R A;  3M4O B;  1YNN C;  4R8I A;  4QUC A;  1PZJ D;  1RTN A;  3Q22 A;  4DF7 A;  2PW5 A;  4LJZ C;  1JIC A;  2C9O A;  1ZEQ X;  1E2V A;  4RGT A;  2F3V A;  2RQX A;  1KDA A;  2B8G A;  2QF7 A;  1Q1E A;  3I91 A;  1A3T A;  5CV5 A;  1CT1 D;  1BF4 A;  1E2Z A;  3VYS A;  1O7Y A;  4K5X A;  4ID6 A;  1EU4 A;  1G2S A;  1HTL D;  1CA6 A;  5EKL A;  2PPB C;  2JEB I;  5G3L D;  1IYU A;  5I2Y A;  3A55 A;  5CR3 A;  1D1I A;  4RH6 A;  5EBD A;  1JOK A;  4R9W A;  3F2U A;  1WCM B;  1WTQ A;  5K36 G;  2EYO A;  4A3M B;  2B2V A;  1LTA D;  2MJ8 A;  1BQQ T;  1JOO A;  5JEA J;  3DWP A;  4XXE A;  3GV6 A;  1HFG A;  3PUY A;  3HOW B;  2F0J A;  1PZI D;  2BCO A;  1PTO B;  3MFY A;  2MUY A;  3OWE B;  4A3I B;  5M9O A;  1QE6 A;  5KRU A;  2EVB A;  3NBI A;  1WTW A;  2AQ1 B;  5C0X I;  5I6W A;  2QCP X;  3HOY B;  3I4N B;  3FVQ A;  3GQB A;  1LTT D;  2PZT A;  1SJE D;  1SJH D;  1KDC A;  3GTP B;  3BDL A;  3FMC A;  3R2T A;  5JVG 3;  1S4Z A;  4C1N I;  2Z4I A;  2R7Z B;  1STH A;  1BBX C;  2ZXO A;  3HGB A;  4BBR B;  3DUZ A;  1G91 A;  3V96 A;  1I4Q A;  4CGY B;  2F3W A;  2X6L A;  2RDG A;  1HQM C;  3H0G B;  1T5E A;  4HR7 B;  4IUQ A;  1JR0 D;  3S1M B;  4NP5 A;  3J81 E;  3KUP A;  1DM0 B;  2L5T A;  3E0J A;  2R93 B;  1XX8 A;  5FO8 B;  2NB0 A;  1NSN S;  3NTK A;  5C0X G;  2EY2 A;  5G3L F;  5COY A;  2F0M A;  5EPL A;  5C4X B;  1I6H B;  3K59 A;  3D4W A;  4EQN A;  4DAY A;  2ZXR A;  5LL6 X;  2RSN A;  1GJX A;  5AFW A;  1WTV A;  4G7O C;  1FNW A;  3SK8 A;  4K5W A;  4C3J B;  2K1B A;  5D3I B;  5I2X A;  5BN4 A;  2M00 A;  2SNM A;  3AB9 A;  3DMU A;  1JCK B;  1TY2 A;  3J7A V;  3PV0 A;  4IFD G;  3OMC A;  3GO5 A;  2EE1 A;  3VA7 A;  1I4X A;  3QWN A;  1Y8P B;  1B2T A;  4R8N A;  1WTX A;  1Q12 A;  1HFN A;  4IUU A;  1S5F D;  1F2Y A;  4RCN A;  1LTI D;  2JE6 I;  3NQI A;  1A6X A;  3NHH A;  3AU7 A;  4K6L A;  2F0Q A;  4V0B A;  2F03 A;  2ID0 A;  4IUR A;  3CKI B;  1LT6 D;  1M4V A;  4XYO A;  5FK9 C;  2XSC A;  4X3S A;  3PUW A;  1LT4 D;  3KLS A;  1HUM A;  4C2M B;  3VR3 A;  4ZQ3 A;  3IL8 A;  1PDQ A;  3K0Y A;  4CBV A;  1TWA B;  2B2T C;  4DFA A;  5M5W B;  1AEX A;  2XIW A;  5BN3 A;  2EY5 A;  4AYB B;  1A15 A;  1TY0 A;  3S2D B;  3PUV A;  2ENB A;  2EYJ A;  1ONL A;  4A93 B;  2F4I A;  2F0H A;  2PNR C;  1EL0 A;  2K5Q A;  2EYF A;  2J0T D;  4DGZ A;  4RGN A;  4B9X A;  1D1K A;  2KQ3 A;  1PRT D;  1EYA A;  4LMQ D;  4ZUI A;  4KKT A;  3KLR A;  2A74 C;  4ZLT F;  1TWC B;  3P1H A;  1I3Q B;  2JA8 B;  1U4M A;  2HQE A;  1Q90 A;  3TBI B;  5IGE A;  4MHE A;  1SE2 A;  2F0I A;  4CJ1 B;  2XNA C;  2SNS A;  3QJY A;  3DWA A;  2XRS D;  2VXW A;  2EDG A;  4P2C B;  5CBE E;  4OL7 A;  4KD4 A;  1IKL A;  2AUJ D;  1BDO A;  5C0X J;  1S5B D;  1HQR D;  3DXJ C;  2WAC A;  1BCP D;  1PTO H;  1BOS A;  4RWS C;  2SDF A;  3S16 B;  2VB3 X;  2B39 A;  1BO0 A;  5E1F A;  4FXD A;  4XDX A;  1C8C A;  1HCZ A;  4CHT B;  3KK7 A;  3LWU A;  4IUT A;  4ZYS A;  4FF4 A;  4RA8 A;  3TP5 A;  3BS1 A;  2O5J C;  2E2D C;  3VYU A;  1SYG A;  4DNT B;  4G7H C;  3QO2 A;  1PFB A;  5C3E B;  1D2B A;  5NUC A;  1TS4 A;  3X3N A;  5LHY 1;  4RCO A;  4KKS A;  3SHL A;  1EY4 A;  3P7J A;  3EA6 A;  1K8M A;  3HP3 A;  3NQT A;  2FJ2 A;  3LNN A;  1JC7 A;  1B44 D;  2JA7 B;  2HUG A;  4G57 A;  3M3Y B;  3VR4 A;  1A3U A;  3HG9 A;  5EQ0 A;  2BDN A;  4B9W A;  3K5L A;  1WTP A;  1SNQ A;  2BE5 C;  2NN6 H;  4RGO S;  3ITP A;  2F0E A;  1BCP B;  4GZY C;  3U9S A;  2F0F A;  3MA2 B;  3S1N B;  2R92 B;  1SDF A;  3FPU B;  1LAB A;  1H9S B;  3GTK B;  1EQV A;  3KBX A;  1ML0 D;  1LT5 D;  3MEH A;  1IL8 A;  1W6K A;  1EU3 A;  2F0W A;  2B2W A;  4DAV A;  2NVT B;  3SE0 A;  1TS2 A;  1UUP A;  5KNC A;  2NVQ B;  1VMP A;  4K5V A;  5J1Z A;  3E5S A;  2IX3 A;  3Q0A A;  1RJT A;  2E75 C;  4LK1 C;  1ENF A;  4Q0F A;  5T1I A;  2Z1C A;  3SK5 A;  2EOT A;  3TP8 A;  1KNA A;  5EPJ A;  4Z9C B;  1GUT A;  4DK1 A;  2K33 A;  2PQE A;  4H44 C;  4A3F B;  2EYM A;  1QG7 A;  4KY6 A;  2LY7 A;  1L0Y B;  3KBG A;  5ISR A;  1OXS C;  1S5E D;  4FXK C;  2NWG A;  2TSS A;  3MTS A;  1CM9 A;  3DEO A;  2KCC A;  1I4G A;  1H9K A;  5ELE A;  3S15 B;  1QB5 D;  2ZXP A;  1XXG A;  4XQQ A;  2IJ0 A;  2L0C A;  2F0U A;  2F0G A;  2IW3 A;  4DK0 A;  3DEP A;  3A8I E;  1SSO A;  5CV9 A;  2VUM B;  2A68 D;  1V1P B;  3ND9 A;  1LTG D;  4E6I A;  2J7Z A;  1PFM A;  3V05 A;  2LKV A;  1GXD C;  3HRZ C;  5DM6 3;  2QKI C;  5EGT A;  5I6Y A;  1XYI A;  2DNE A;  3CHB D;  4IZ8 A;  1DYQ A;  1XTC D;  4BBS B;  5ELF A;  3K7A B;  3RZO B;  1CQV A;  3VR2 A;  1SAP A;  3BVM A;  3NUC A;  1HHV A;  2NYZ D;  2XWB B;  5EKK A;  1QJO A;  2K5W A;  5JEA H;  1JWM D;  2L1B A;  1JOQ A;  3K5N A;  2NTS A;  4S3S A;  3OPO A;  5J22 A;  1YNN D;  2EYP A;  2DY8 A;  4PNY A;  4HAE A;  4LAA A;  3MXP A;  1SYC A;  5LL6 S;  1VDZ A;  1LAC A;  2B63 B;  2JYO A;  3RZD B;  1U4P A;  4OO1 I;  4JK1 C;  4ZUJ A;  1ZXT A;  2WV6 D;  1KLU D;  1TT2 A;  2HCI A;  2NN6 G;  5EJW A;  1EOT A;  4ZKB B;  5EPK A;  5IT9 L;  1TU2 B;  4PQX A;  3S14 B;  4IN3 A;  3FKI B;  3NTH A;  2OXP A;  5KNB A;  4I65 A;  3GTM B;  3NWS A;  3MC0 B;  2NN6 I;  1L0X B;  2RKS A;  2FHT A;  3IAY A;  3N52 A;  1EY5 A;  1G29 1;  1RCV D;  4BY7 B;  2L11 A;  3CRL C;  3OIQ A;  4KN7 C;  2QEJ C;  3OOC A;  1SNM A;  3NBH A;  4BY1 B;  5KIX A;  1ET9 A;  1STE A;  2O5I C;  5JPN C;  2CVR A;  1Y1V B;  4X3T A;  2G9D A;  4K8I A;  5HUR A;  2WP8 J;  3OIP A;  1QIL A;  5FLX E;  1QNU A;  2B2W C;  4A3K B;  2X69 A;  1NR4 A;  3R3O A;  1ENA A;  3P75 A;  2PO4 A;  1SYB A;  4FXG C;  3GTQ B;  4RGM A;  4HN7 A;  4UDU C;  1KNE A;  3K58 A;  3FPP A;  5C3W A;  3C1F A;  4I7Z C;  1HUN A;  1SE3 A;  4IFD H;  2B2U C;  5JEA G;  1WD0 A;  3C46 A;  2K6A A;  1ZYR C;  4KJO A;  4ME5 A;  1HA5 A;  1PYW D;  4O1N A;  2WKC A;  2RA4 A;  1M8A A;  1W6J A;  3D8G A;  1S5C D;  4ODG A;  1QWY A;  1PRT C;  4H0L C;  2LS0 1;  4J8Q A;  1U4L A;  3J80 E;  4PMC A;  1F9R A;  3VYT A;  3MHB A;  4XIG S;  4B08 A;  3I4L A;  5I9O A;  2BOS A;  2R61 A;  4G4K A;  3DWQ A;  5KYI A;  1QNK A;  3UI2 A;  3ZYY X;  1GUS A;  4FP5 D;  1BNZ A;  2TMP A;  5CMD A;  3S1R B;  4BA1 I;  3RLF A;  5CV6 A;  2Z4H A;  1ET6 A;  3D4R A;  2EPB A;  1RD9 D;  4Y7N B;  5CGK A;  4WRD A;  5CV4 A;  4ILW A;  2XN9 C;  2LFN A;  2F0O A;  3VYR A;  1T5X D;  2JA5 B;  5C0X H;  4KMU C;  3SEB A;  4XQN A;  1DCZ A;  2EYH A;  1DON A;  4KI0 A;  3ERQ A;  2IX1 A;  4EQP A;  5D65 A;  1O80 A;  1QOH A;  5CV8 A;  2RDF A;  4KY5 A;  3GTL B;  5JOB A;  2LMC B;  4C1N K;  1TWG B;  4M1U B;  2OEO A;  2H4O A;  3NXW A;  1R4Q B;  3TN2 A;  4OO1 H;  2BA1 A;  1JE4 A;  2ICE C;  2K05 A;  3EQL C;  1WTR A;  5F2D A;  1TII D;  3BG3 A;  3MXG A;  4K6D A;  5FOB B;  2KCN A;  3A54 A;  1DOL A;  4C56 C;  4O42 A;  1PRT F;  1Q8I A;  1I50 B;  4ZKC B;  2PYK A;  3VA5 A;  2F0N A;  1EZ8 A;  1I4H A;  1Y69 U;  2DY7 A;  2M2L A;  1HXY D;  1CZG A;  1ESR A;  1VF5 C;  5KGU A;  1PFN A;  1EWH A;  5KYL A;  3IFT A;  4CKC A;  1IKM A;  3D6W A;  1EY7 A;  2EY1 A;  2F0S A;  1GHK A;  4K14 A;  4MN3 A;  4ULL A;  1DJR D;  3MAQ A;  3OHX C;  1SNO A;  4KTA A;  4XQJ A;  1STN A;  2SOB A;  4KY7 A;  3WOE A;  1B9N A;  1H9R A;  2K32 A;  4H7B A;  2FMC A;  5C3X A;  2HDL A;  1LO5 D;  3R2I A;  2DNC A;  5E4X A;  4XTC S;  1DD2 A;  2PZW A;  4KD3 A;  1GUN A;  2SEB D;  3EFX D;  2FIN B;  3TME A;  1GUO A;  1VMC A;  4ZAI A;  1B9M A;  2JXM B;  4N9P A;  5ELC A;  3FDT A;  3PMF A;  1IW7 C;  1JWU D;  1OXU A;  3GTO B;  4WOR A;  1TKW B;  1SEB D;  2MPM A;  2KEC A;  3T4A C;  3NK9 A;  2RVL A;  1EY8 A;  2KHS A;  4IUP A;  1F9Q A;  2A5H A;  1TS3 A;  3NSW A;  2R6G A;  5C4H A;  2HCC A;  5IOD A;  3BDC A;  2K03 A;  1SMY D;  2IX0 A;  2PZU A;  5DM7 3;  4C3I B;  3E6Z X;  1DZ1 A;  1X3P A;  1V8Q A;  2D5D A;  1DXM A;  2NVY B;  2IL8 A;  3GP7 A;  1EEF D;  1U4R A;  1LTS D;  3C1E A;  4TRD A;  2KVM A;  1A3V A;  1UNS A;  1V1P A;  2VB2 X;  4L63 B;  1EZ6 A;  1MSH A;  3IFD A;  1OXX K;  3NWT A;  3T53 B;  4QB4 A;  3TZU A;  3K5M A;  4V19 0;  1CHP D;  1EFI D;  1ENC A;  2A6E D;  3HOV B;  2IWH A;  1F9S A;  1ESF A;  1H9M A;  1Q1B A;  3HEJ A;  1C48 A;  2RSO A;  3BVG A;  4QF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...