4ZAIA

Crystal structure of cxcl13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
b'MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-X-C motif chemokine 13
molecule tags Cytokine
source organism Homo sapiens
publication title Crystal structure of CXCL13
rcsb
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zaiA00
2NWGA 4O42A 2K04A 4X3KA 1G2TA 2FHTA 3I3CA 2RSNA 2SDFA 2X69A 1SAPA 3HP3A 2K05A 4HCSA 3R93A 1S4ZA 1WTWA 3MTSA 1GUWA 1DONA 1EIHA 1B3AA 1TVXA 1WD0A 1M8AA 5EQ0A 3SVMA 3KBXA 2EE1A 1X3PA 1WTPA 3LWEA 2D9UA 1VMPA 2L9HA 5T1IA 1DZ1A 5EPKA 4DN4M 1J8IA 4OIJA 2MJ8A 1QG7A 1AP0A 1BBXC 1QNKA 2FFKB 2Q8TA 4ZKBB 4ZAIA 1SDFA 1IKLA 4IUVA 1F9PA 1A15A 1HFNA 2K1BA 1SSOA 2MP1A 1EL0A 4IURA 2DY8A 2K28A 3DEPA 1G2SA 2EOTA 2HDLA 2J7ZA 2KUMA 2KVMA 1CM9A 5CBAE 1PFBA 4IUTA 4ZLTF 4UAIA 2RSOA 1F9QA 2R3ZA 1EIGA 5EKIA 1WD1A 2RVLA 5EPJA 1RTOA 2FMMA 3I91A 1HUNA 1O7ZA 1G6ZA 4HSVA 2HCCA 5EPLA 1HUMA 3UI2A 2IL8A 1O80A 2L11A 1ILPA 1G91A 2L1BA 4CJ1B 2N88A 3GV6A 1CA6A 5T1GA 1X32A 4XT1B 3F2UA 1IKMA 4HAEA 1KNEA 1PDQA 1RTNA 2Q8RE 5D65A 1ML0D 1NR4A 3FPUB 4RWSC 1E0BA 2X6GA 2NZ1D 4X3SA 2B2TA 1EQTA 1NCVA 4IUUA 4QUFA 1U4PA 2HUGA 1PFMA 1RJTA 2NYZD 1RHPA 2EPBA 1F2LA 3QO2A 4CJ0B 1MSHA 2B2UA 1WTXA 1ESRA 5EJWA 1DOKA 1ICWA 2KEEA 3H91A 2K01A 2B2UC 1J9OA 2VXWA 3I8ZA 3IFDA 2L4NA 1B4OA 1NAPA 4U68A 4XT3B 2MGSA 4HEDA 1HRJA 4RA8A 1MGSA 1DOLA 4ZKCB 5COYA 1VMCA 2CVRA 5E4XA 2HDMA 1RODA 4ZK9B 5DNFA 4R9WA 1XX8A 1HA6A 3D6WA 3FDTA 1HFGA 5AFWA 1LV9A 4CJ2C 4IUQA 1C8CA 1U4LA 3ONAB 4X3UA 2B2WA 2B2TC 1MI2A 3DEOA 5CMDA 1QE6A 2BDNA 1WTVA 1O7YA 1MSGA 2FINB 3G7LA 3MWYW 4X3TA 5CORA 2HCIA 2KEDA 3GV3A 1AZQA 3N52A 1XYIA 1AZPA 1CA5A 1B2TA 2L12A 3DM1A 1BO0A 1EOTA 2KECA 4R8IA 1HHVA 1Q3LA 2M2LA 4XDXA 1F9SA 4LMQD 4NW2A 1F9RA 3TN2A 1BNZA 1IL8A 2FJ2A 2X6LA 1ZXTA 1PLFA 2DY7A 1WTOA 1WTRA 1B50A 1JE4A 1DOMA 2H1EA 2B2VC 3Q6SA 2JP1A 4OIKA 5JJZA 4MN3A 1BF4A 1ILQA 2B2YC 1B53A 5D14A 2N55A 2RA4A 5E4WC 2B2VA 2XIWA 2JYOA 4MHEA 1WVLA 2MPMA 2B2YA 3TZDA 2B2WC 1PFNA 1U4RA 1U4MA 4QUCA 4RAUC 3P7JA 1KNAA 3KUPA 1NR2A 5CBEE 3IL8A 4IUPA 1JICA 3I90A 2K03A 1WTQA 2KOLA 1X3QA
chains in the Genus database with same CATH superfamily
4WJ4A 2SDFA 3DWPA 4AYBE 2A6ED 1M1KC 2LS01 1IYUA 2ZXOA 4DK0A 4K6LA 1DZ1A 1R9TB 3HOVB 2UXDL 4A3MB 2BDOA 1SBBB 2HD3A 3A8IE 3P20A 3K58A 5IGDA 1HNXQ 3S1RH 4ZKBB 1SMYC 4X64Q 4GNXA 1SN8A 2MP1A 2E5LQ 4JI3L 1HNZQ 1SLJA 1JWUD 3S16H 1B70B 2BE5D 1K0SA 2EJGC 3T1YL 4RFBA 4IO9A 1K0RA 1SYGA 4A3IB 1F9QA 1TIID 3KOJA 4ILWA 3KLRA 2SNMA 2XNAC 4POGA 1N34L 2F0WA 4M1UB 1O80A 2QILA 2N88A 3RLFA 1TS4A 3A8JE 5JJIA 2K52A 3HGBA 3UE0A 1NR4A 4HIMA 1SNDA 2N78A 4DV2Q 2PQAB 2HUGA 5DM73 4B3TL 2UU9L 5LMUQ 2BA1A 1PZID 3IFDA 3GQBA 2Z6KA 4XT3B 1J5EL 2DGYA 5C0XJ 1HZBA 2L0CA 1LACA 4DFAA 3RLNA 3OOCA 4A93G 4ZK9B 1TY2A 3RZDB 3L0OA 1EFID 5IYCH 3SGIA 1U5KA 4EQ5A 3MEHA 1I5FA 5C44G 4OXPA 1OTCA 1CHQD 2FINB 1YNJD 1E2ZA 5HGTA 1KLUD 4A3GG 2HCIA 1EFWA 1CA5A 1LO5D 3SK8A 3BG3A 3HOXG 2GN5A 4OX9Q 3J80i 3PIO3 3MAQA 1XWEA 5IOCA 4MN3A 1SNQA 4AYBB 3V96A 4JI6L 3S2HH 2B2VA 4QIWB 4MHEA 1VQJA 3CP0A 4DR5L 2ZJRA 2H5XA 4L5QA 3RLOA 3I4OA 3V05A 1SFOB 2PMZE 4G4KA 2Q2TA 1Q8KA 5IYDH 1MJCA 1PRTD 2JA7G 3SK5A 1IW7D 3R93A 1XPRA 1X54A 1BXTA 5J39A 4JBKA 1NBWA 3CW2C 2F0LA 2EE1A 2F0GA 2D9UA 2V1CC 3K57A 4DR2Q 1RL2A 2QKIC 5FJ8G 1GXDC 4R4IA 3PO3G 5IYBH 2PZUA 4A3DB 1FNWA 1ZYRC 5M3FB 3A56A 4ME3A 5C0XI 4L8JA 2CHBD 5C6AA 3QG1A 2DY8A 2K28A 1XNRQ 2J7ZA 4A3EH 3NSWA 4XTCS 5ELNA 1LTSD 5C4HA 4BY7G 4DAYA 1EIGA 2CW0D 3PUYA 5EKLA 4DR4Q 2UU9Q 2F0UA 4K5XA 1G91A 2D5DA 3JAMi 1T5XD 3AB9A 4XT1B 5DM63 4K8JA 3S24A 1TU2B 4FO2A 1PFMA 3QO2A 1TXYA 3PO2B 1A6XA 3AYHB 1P16A 1ICWA 1EY4A 2JEBI 4KD4A 4N9PA 4LFAQ 4PZ6A 1AN8A 3NELA 2C9OA 2MGSA 2B8FA 3MC0B 2R7ZH 4R4QA 2IX3A 2F0TA 4OHJA 2HDMA 4DR7L 5DNFA 3HFZB 2LMCB 2NBFA 4DV3L 5J3BA 1UE5A 4R4OA 1XXGA 4JBMA 3T53B 3DUZA 4X3UA 5G3LD 4E6IA 1HR0Q 4A3DG 1JOKA 1A0IA 3HKZE 4LFCQ 5FJ8H 4A3GH 2NZHA 2NVXB 4JI2Q 1TQOA 1UE1A 2VY3A 3K8AA 4IZ8A 5IP7G 4A76A 1L1OC 5ELCA 5K36G 4MTNA 3W5OA 1HR0L 3E0EA 4BY7B 2EYOA 4BS9A 4FXKC 5JVG3 4NB3A 4KHVA 2WB1G 1BCPB 2MO1A 2I5MX 1VCIA 2WFWA 2A69D 1STGA 1PH3A 4LUZA 1U4RA 5M5YH 1JQYD 3KUPA 4PG3A 2XSCA 4DR1Q 1KIXA 1EY7A 3D4WA 1JICA 4DNIA 1PH6A 4OELB 2AHOB 1SAPA 3J80E 5CV7A 5JJKA 3U4ZA 4OGQC 3PGZA 1D1KA 4Q0FA 3NBHA 5IE8A 5IWAQ 3TRZA 3LWEA 4B3ML 1D2BA 1CKOA 3AFPA 4LF9L 2PMZB 3HOWH 1HQRD 1GHKA 1TWGB 1Z7TA 1K83H 3LX0A 4I7AA 5E1FA 4JI7L 2V4DA 5IP9H 3S1NH 1F2ZA 5M3FH 4L5TA 3TBIB 1G51A 3I55A 1STBA 5FO8B 4DR6L 2R92B 5BR8Q 5M5XH 1GUGA 1NY4A 3Q23A 2D62A 4N8FA 2I07B 2KHSA 5EPLA 2G9DA 3NWTA 2ICEC 1Z47A 2D2CC 3W1GA 3F2UA 1IKMA 1LTID 5H1SE 1KNEA 2EY2A 2EY5A 3HOXH 4MNOA 4CJ1B 1SR3A 2XVSA 1U4PA 4A3BB 3BYTB 1EYDA 1LTRD 4CGYB 4JCVE 4IJLA 4HR7B 1S3OA 1IL2A 1HJPA 4OWXB 2Z1CA 2YYZA 4U68A 5JOBA 4AIMA 4IFDG 3QR8A 2F0FA 3K6OA 4YCUA 3EA6A 1FJGQ 1O7IA 1Q86C 1ENCA 1PTOD 4DV4L 1KD1C 1QILA 4UHVA 2PCFB 3GD7A 3OYYA 3HOVG 3DEOA 2IT1A 3K59A 1SNOA 1O7YA 2Y0SG 4QQBX 4DAVA 1JE5A 5BN5A 2L12A 4A3GB 2AWOA 2SEBD 5A2QE 2KJXA 5AJ3Q 2EVBA 2ZM6L 4A3JB 1M4VA 2RCNA 5JJZA 2B29A 4AQYQ 2PZWA 1TWAH 5CV6A 1H9JA 2OEOA 3FMCA 2A5HA 2B2WC 2XRSD 3P7JA 5EGTA 5IODA 1PVOA 3NBIA 5M5YB 1D1IA 3K5LA 4A3BG 2QEXA 3M4PA 3U4VA 3PF5A 1VQPA 1N36L 3QOJA 2A74C 2XRQD 2PW7A 1STEA 3I4MB 4IFDJ 4L6TB 1STYA 4JI4Q 5HGQA 3M9BA 1L0XB 4JI1L 3GTQH 1QCBD 2L9HA 3K81C 4GKKL 3GTLH 5EPKA 5IIFA 4K8IA 1QG7A 1W6JA 3H0GB 1AP0A 1Y1WG 1QNKA 2Z9HA 2JA5B 1F9PA 1A15A 1VQBA 4KHZA 5ELFA 4DV4Q 4IURA 1MIUA 3KF8B 2YTVA 4LFBL 3CRKC 1S5CD 5M3MG 2QDLA 3K5NA 4Z9CB 4DAYB 1EY5A 3TSSA 3MEFA 5M5XB 1RKNA 1I3QB 5LMUL 3CCUA 3EN2A 2QF7A 1II3A 5LMNW 2PQAA 1KXLA 1AEXA 2KBNA 5IGGA 1CZWA 1AFPA 1C48A 1V8QA 3GTMH 3D4RA 3TP8A 4HJ8A 4KKUA 4IFDH 2A68C 3K5MA 3TMEA 1MJEA 3GTGB 1VQCA 4JYAL 1BDOA 3FPPA 4JBWA 1PZKD 2Q2IA 3IAYA 5E4XA 1VQHA 3DLLA 2AMCB 1HNZL 2K5NA 1JB7A 3OMCA 1R4PB 1X3EA 2B2TC 5DEHA 2F4IA 5CMDA 4JOIC 3M4YA 4DUYL 3FKIG 4GN3B 1HHVA 4I65A 3PCOB 1OO9B 2WACA 2Z0SA 4R8IA 3S1RB 1E3PA 4A3KH 1YNNC 1X55A 3F2CA 4NXML 2J4XA 4APVA 5KNBA 4H13C 5JPNC 1O78A 3QWNA 4IN3A 3O13A 4A4IA 2EYLA 5KRUA 2CQOA 2RA4A 4LAAA 2NN6I 3S2DB 1VF7A 3A5UA 1TWAB 4GNXC 3G71A 3IRBA 4LF8Q 4DV7Q 3SK6A 4OONA 1BQQT 3RD4A 1EZ8A 5D3IB 1E24A 5CV9A 2LXJA 4KTAA 5ELBA 2N3SA 3C1FA 4HCSA 4BBRB 3UDFA 2PNRC 3R3OA 1I4PA 4V190 3H3VI 3E9IA 4CDDC 1I4XA 4BA2I 1H9RA 1B44D 1UWVA 1VMPA 2UXCL 2TMPA 4ABNA 1MKHA 2F0OA 2KCNA 3QB3A 4LF6L 1UAPA 4ZAIA 1SDFA 4QMGA 5FLMG 1KRSA 3D0FA 2F0DA 2JA6B 5NUCA 3GTJH 4GLAC 3EIVA 4ZLTF 4AH6A 5EBCA 2ATWA 3E5SA 5KNDA 1NSNS 5E7NA 1HZAA 5DLQE 4ZCKA 3Q0AA 1L2FA 3GV6A 1I94Q 1YNJC 3VYTA 3RR5A 1QNUA 3S14B 1RTNA 2E2JH 3FPUB 1PTOF 4R1JA 4X3SA 1N36Q 2B63G 1AH9A 3GTMB 2ZXPA 1IBMQ 3PF4A 5ELOA 1JOOA 2F0QA 1TKWB 3OIQA 3GTGH 1VQAA 3CHBD 4HEDA 5IGFA 5C44H 4IPHA 1GUSA 1K9MC 3HZXA 2CVRA 1LM0A 4B08A 2EXDA 4DNTB 4Q5VA 4GN4B 3CU7A 4J1MA 4YCVA 2K5HA 2G5DA 5AJ3L 4L5SA 4K2KA 2EZVA 3AFQA 2GVAA 1ENAA 4UP7A 1B2TA 3OWFA 3CC2A 1DXMA 4QY7A 1PFSA 1CK1A 2JN4A 1W6KA 1F9RA 3H3VC 2FJ2A 2IX0A 1OXTA 2ZTEA 3Q6SA 3I4NG 3PSIA 1NMFA 1TWCB 3BDCA 3ICEA 2XIWA 3CAMA 3JAMc 5GAHC 4UPAA 1A8VA 3PO3H 3KBGA 2FXQA 5FLXL 4GKJL 2K03A 1X3QA 5ISRA 4OWWB 4IPGA 1G2TA 1HTLD 2CW0C 1S5BD 4KMUC 2K05A 3BVMA 3J7A5 1GUTA 1ICFB 3M3YH 3JAML 4DV5L 3KBXA 2PQEA 2IJ0A 2LSSA 1VQ8A 2Z4IA 2RBMA 3G48A 3TZUA 4JV5L 4KKTA 4PNYA 1PTOC 2NVYH 3PUXA 3U50C 2F0VA 2R7ZG 1KDBA 4A3MH 5EKIA 2Q2HA 2WIIB 2PZTA 1V43A 2NVXH 1CSPA 4HSVA 2HQLA 3CRLC 1SROA 2F3WA 1TWFB 1IBML 1Q46A 3T51B 1ASZA 3SDZA 1U0LA 4YWLA 1A3UA 1P8LA 1DGSA 1FGBD 4K0KL 4IOAA 4A3KG 3H6MA 1EQTA 4JI5L 2JJQA 5C5MA 4JI8Q 1MSHA 2WAQG 4K6DA 3S1MH 1A2UA 2VUMG 1YEZA 3AU7A 4DV0L 1SJHD 2Q2UA 3KF6B 3I8ZA 1QUQA 2YU9B 3HKZG 4C3HH 1ET6A 1FYCA 1MD2D 3A5ZB 1Z9FA 3WDNA 3GTKH 4A93B 2FMCA 3J7ZC 4CDFC 4NXMQ 3TP5A 1B9NA 1GD7A 2HT1A 3GTOH 1UEAB 1YJWA 1Y69U 4LF9Q 3OTOQ 4B3SQ 1OXXK 1XNQQ 4HJ9A 3GV3A 2CH4A 1TS3A 1K83B 1IXRA 3NK9A 3MFYA 2NTSA 2DY7A 2EYPA 1A62A 4GZYC 1H9MA 5A2QL 5IYDG 5IT9E 1S72A 2OTJA 1WVLA 4P75A 2MPMA 5KGUA 1VQFA 1YNND 2LFNA 2K33A 3W3AA 3KK7A 4XQJA 1N8RC 3IL8A 4JYAQ 2PI2A 1LLRD 4ULLA 2F0MA 2NWGA 4O42A 2K04A 4KY5A 4PZ7A 4JI5Q 3RN5A 5I4DA 2X69A 3B6YA 2PNHA 1BBUA 4P74A 3M4OH 1EIHA 4X65Q 4C56C 2L55A 1X9NA 2RDGA 4B3SL 1SFOH 1VQDA 3H0GG 2I5HA 1I6HH 1LTAD 1QZGA 1KHIA 3PIP3 3KJPA 4IUVA 1YZ6A 3I56A 3L9AX 1MHWC 1QZHA 1V9PA 1GO3E 2NVYB 4DR7Q 1G2SA 2PW5A 4NP5A 4EX5A 3GO5A 5CBAE 2BH2A 2I46A 4A3LH 3OPOA 1G6ZA 4PMWA 4KY7A 4TKOB 1A3VA 3CC7A 1GOZA 2VS1A 5T1GA 3G4SA 1GVPA 4A3EB 4HAEA 1Y8OB 1BUVT 2I5LX 4NMZA 1FGUA 4QUFA 1X56A 4C3IG 2EPBA 1F2LA 2UXBQ 4DR4L 3S1MB 1KTKA 2QEJC 4FNFA 1VS0A 4FVMA 4KKSA 4RA8A 5C0XG 2YTYA 1VQNA 2A69C 2OT2A 3J81c 2F0JA 3A0JA 1GUNA 3TREA 3NWSA 3S17H 4WJWA 3PQIA 4R4TA 1ZKOA 5LHY1 1RIPA 4OEMB 2DNCA 3OW2A 4JV5Q 3D4DA 4YCWA 1RDPD 3BVGA 5IP7H 2JA8B 1SYDA 2CH4W 1CKMA 3G7LA 4DUZL 1B1ZA 1BBWA 3Q24A 2KEDA 1EWCA 4X6AH 3ITPA 3BDOA 3JC66 3ND9A 1YHQA 1GUOA 4JI4L 1WTRA 4B3RQ 4O0AA 4A3FB 1CFMA 2R7DA 1VQ4A 1XTCD 1FD7D 3F8TA 5CV4A 4UP8A 4AYBG 4KK7A 4G7HC 1FJGL 3K7UC 5EAYA 2JEAI 4GKJQ 4XIGS 2JYOA 5KYLA 3FHWA 1PFNA 1G6PA 4XXEA 1B8AA 2HHHL 4PV1C 1WTQA 1EY6A 2CQAA 5CC4A 2RSNA 1PHJA 4Y7NH 5C4XG 1SJED 1GUWA 4V0BA 2K5WA 3T13A 5C5LA 3NUCA 1CHPD 3I7FA 3KFUA 1EUJA 4KI0A 3ZJYC 5FO7B 3CF5A 4KY6A 1F77A 1OXSC 4OIJA 2MJ8A 2PI2E 1QVCA 5CV8A 1VF5C 4A3CH 3BYYB 1IW7C 1DJRD 1CQVA 4UP9A 2K1BA 4KN4C 1SNCA 3I4NH 2EOTA 2KVMA 3CCQA 1LUZA 2XTIA 4A3JG 4RMFA 2PYKA 4FF4A 3HOWB 2RVLA 1ZYRD 1O7ZA 2ENBA 4BY1H 4LF4Q 1KL9A 4DR3Q 3NTHA 4YWMA 3S1NB 2KHJA 4ZQ3A 2N8NA 4GOPC 4N9TA 4JG2A 2NZ1D 1XMQL 4JI0L 3C3LA 2CWPA 1JC7A 1SYCA 1HXYD 5E3FA 5IY0A 1ESRA 5KYIA 2J0TD 4X66Q 1QOHA 2E2IB 2NN6G 2KEEA 5DAUA 4RKBA 2F0SA 5KNCA 4HIKA 2ZT9C 5GROA 4P2CB 2VNUD 5G3LF 3A8KE 3BVZA 1EEFD 5KIXA 3QJYA 2WINB 5COYA 4K14A 3T1YQ 1RODA 3PIOA 1EEID 4KJOA 4EQOA 5J22A 2E74C 2OF1A 1LV9A 4IPCA 4J8QA 1UE6A 3G6JB 2BDNA 1MSGA 4RHSA 1AZQA 1HZ9A 4RKLA 1RD9D 2EXZA 1K8OA 4HMJA 1BO0A 3V2TA 3TS0A 1YIJA 3L3OC 4MIUA 3SHLA 3K0YA 5I6WA 2OQKA 2WB1B 4R4CA 1AE3A 2WV6D 4DV3Q 2B2VC 3STBC 3CPWA 2EY6A 1EY8A 3Q22A 1XJVA 2N55A 1EU4A 3IFTA 4LF8L 4BA1I 5IGCA 1LT6D 1F2YA 1FL0A 1STHA 1KNAA 3S1QB 4DK3C 4A3JH 1SRUA 2KCMA 3CQZB 1EZ6A 3STBD 4JI8L 4GLVB 2Z8LA 5TSSA 1XMQQ 2E2JB 3E3XA 1Y1VH 4JPBW 1EQRA 4EQNA 1TVXA 2B8GA 4WORA 1W2BA 4DR3L 4LUVA 2QA4A 5C44B 1DM0B 4DV1L 1BBXC 3A7AB 2Q8TA 4F8MA 2MQHA 1YITA 4KN7C 1SSOA 2MHVA 2XGTA 3AMUA 2RHQB 4DU9A 2JA7H 3GTQB 4P73A 2HDLA 3E9HA 4LFBQ 4ZYSA 2A8VA 1I50H 5M5WH 4FXDA 1JWMD 1PFBA 4UAIA 3E0JA 4S3SA 3H0GH 1E2VA 1CI3M 1HQMC 1HUNA 4HJAA 2WKCA 1HUMA 2E2DC 2L11A 3VR2A 1C9OA 1PH1A 1TWGH 3RZOB 2QGQA 2NVQB 4C3IB 1W3SA 4GLXA 2A19A 3HG9A 3PMFA 1ML0D 2R6GA 1E0BA 2X6GA 1YJ9A 2D0PA 4B9XA 3SK4A 5K5PA 1K73C 1SYBA 2QW7A 2VQFL 4ZUIA 3J81j 3DWAA 2E2HH 3H09A 4CDCC 2B2UC 4HIDA 2JA9A 4DAMA 5JPMC 4ZKCB 5IYCG 4DKAC 3ULLA 1WOCA 2K5QA 1HNWL 1BKBA 3KF8A 4FYDA 1PV4A 3J81E 1JB3A 1DCZA 2DUDA 3EFXD 2AQ2B 2KCTA 3PUZA 4IOCA 1E22A 1PRTC 2Y0SB 2ZTDA 2LY7A 1L1OB 3I73A 1I6VC 1EIYB 1L0YB 1NTGA 3ND8A 3DM1A 2F3VA 1EWHA 3T56B 5LL6X 1Q3LA 1UEBA 4DAPA 2RQXA 4LMQD 1BNZA 2X6LA 4PZ8A 4DGZA 1B50A 1TS2A 1TR5A 4A3FG 1DD2A 3P75A 4K5VA 1BF4A 3BDLA 1B53A 5E4WC 4LWCA 3TEHB 4OO1G 1U4MA 4L63B 1EY9A 3GTPB 4POFA 1NR2A 4HSPA 2VUMH 4A3KB 3PO2G 2D0OA 2R93H 3MFGA 1TY0A 3OWEB 4A75A 2MFIA 3CQZH 2WAQB 1LT5D 2M9VA 3NPPA 4KHPQ 4B3RL 1JJ2A 3S2DH 4BBRG 4HN7A 1WTWA 3W2DA 4HCEA 4H44C 1M8AA 2CCZA 3S15H 1VQ5A 2GA4B 2R93G 2F0HA 3FKIH 1ZEQX 4GOPB 3MXNA 2O5JC 1IZ6A 1EQQA 3E6ZX 4P72A 1HFNA 4BBSB 1LYLA 3DWQA 3A7LA 1Q90A 3DEPA 2E5LL 3GTOB 3HKSA 1J5EQ 2AUKA 3MVVA 2DJGC 2EYFA 4NDXA 4B3TQ 2C35B 2L1BA 4A3IG 1PZJD 2F0NA 2EQSA 2NVQH 3RZOH 2JA6H 5D65A 2RHSB 1IBLQ 3K7AH 1PRTF 1S5ED 2IY5B 3HOUH 1I94L 1RJTA 3L2PA 2Y0SE 2K4KA 2VQEL 4DV7L 1CKNB 3AQQA 1WCMH 4JBJA 5BR8L 4YY3Q 2Z6KC 3AEVA 5M3MH 1Q1BA 2RF4A 1XX8A 4JI3Q 3MXUA 3HOYH 5GAGC 4IUQA 4U673 1XPOA 1BVSA 5J1ZA 2B2WA 2UUCQ 2K14A 4ID6A 1SNMA 3X3MA 4OL7A 1JCKB 1WTVA 1Y8PB 5CORA 2B3GA 4F7XA 5C4ZA 4JI2L 4ODGA 1Q8IA 3LWUA 1AZPA 1XNQL 1PXUA 5IWAL 1Q7YC 4DUYQ 1K8MA 4L5RC 1R4QB 4XDXA 3M7GA 5M9OA 1KDAA 4X62L 2H1EA 1VQGA 4OIKA 1PMRA 2B2YC 3T1HQ 4YY3L 4BWGB 2K5DA 1N32L 3SE0A 1CT1D 3PUWA 1K3RA 4TVAB 1TT2A 4FF2A 1N32Q 1PH5A 1EL0A 2VUMB 3ERQA 3L7ZC 4NKLA 2K7VA 2VB2X 3J80L 3WOEA 4HIOA 4CKEA 4LK1C 5LL6S 3CKIB 4LUOA 1Q81C 2WAQE 2AKWB 1PH9A 4DN4M 2NB0A 1J8IA 2UUCL 2EJFC 5CR3A 4C3JH 1IKLA 3MZ5A 1C4QA 3SR1A 4ME5A 2JA8G 4BBSH 5I9PA 5C3EG 3M3YB 5M3FG 2Z4HA 3MXNB 1X3FA 3D8GA 4G7ZC 1RF2D 1H95A 1VQOA 1WD1A 2BCOA 1SE3A 2E76C 2B39A 4ALPA 4IQZA 2IL8A 4CDEC 4DR2L 1K8AC 4ZRZA 2NZOA 1JR0D 2ZJPA 4A3FH 1LT4D 1IBKL 5JEAG 3RZDH 1PTOB 1PDQA 3T1HL 1STAA 2B2TA 1NCVA 4IPDA 4XYQA 1RHPA 2OQ0A 3GTJB 4GN5A 2R7FA 4IJHA 1QWYA 1D5ZC 5ELDA 1PRTB 2K32A 1PYWD 3UDGA 1FNUA 2G9HD 3OW7A 1VMCA 3FRPB 2Z6BA 3S9WA 3S2HB 3HOYB 4MTKA 1CQFA 1UUPA 2SNSA 5K36H 3CCRA 1MI2A 2YTXA 1QE6A 4RGMA 4X3TA 4C3HB 1Y8NB 1T5EA 1M90C 3BJUA 3TS2A 1QJOA 3OSOA 3NENA 2OCEA 1X6OA 4LW1A 2JK8A 1SE2A 3VR5A 4NW2A 3TN2A 2UUBL 2O5IC 1PLFA 1ASYA 1PH2A 1Q82C 3I4NB 1KLGD 3CMEA 5CGKA 1IHZA 1O7LA 2IWHA 3W1BA 3HRZC 3I4LA 3IKJA 1K28A 4BY1B 4H02A 1WJJA 2NN6H 5CBEE 2VQFQ 3T4AC 2VB3X 4AQYL 4RGNA 3WWVA 1PH7A 4DV2L 5EBDA 1CUKA 5C4XH 3F2BA 3TP7A 1NJIC 3KLSA 1ESFA 2F03A 2IHFA 4TQUS 3CCEA 4K5WA 1SNPA 2A1AA 2A6EC 2HQEA 1STNA 4QF4A 2L15A 1GHJA 4GOPA 1SMYD 1YBYA 2QDBA 3FP9A 1T9HA 2R61A 3U9SA 3MXGA 3VYUA 3PO3B 4PQXA 5FOBB 4KJNA 1PH8A 2I0QA 1Y1VG 2A68D 1C7YA 3M4OB 4ZUJA 2ICIA 3R2TA 4BXXG 3KDFA 1TWHB 4JI7Q 5HURA 1VQ6A 1EWIA 1E2WA 1A63A 2R7ZB 3CCSA 5CV5A 2BE5C 4XQNA 1CA6A 4DPGA 2CKZB 3K0XA 1SXTA 3NP8A 3TP6A 2DJFC 4K2LA 3FEWX 1V1OA 3BZCA 2OTLA 3Q8DA 1EOVA 4DK6C 1Q12A 1I4RA 1B7YB 3H91A 5C0XH 1CKNA 3CXCA 2LKVA 3EQLC 1J9OA 2VXWA 1LTBD 2ALYB 3RUZA 3A74A 3F1ZA 4BY7H 1TWFH 1GJXA 1E1TA 4RH6A 1B3QA 1I4HA 2TSSA 2K50A 1IYJB 1Y1VB 4J6HA 1SYFA 4R9WA 3FDTA 1HFGA 4XYOA 1D7QA 2ZJQA 1I4GA 4RCOA 4HJ5A 1C8CA 2AQ3B 3OMGA 4X64L 2AWNA 2WKDA 3NHHA 4YWKA 3UDXA 3H3VH 4GS3A 4CBVA 5EKKA 2EDGA 1WTHA 3KDFB 1F9SA 2NTTA 4EQPA 1JE4A 5BN4A 3VDYA 2JA6G 1JOQA 2ZXRA 2EYHA 4DV6Q 1BCPF 1CZGA 2EY1A 3GTKB 4RHRA 4A93H 2JA8H 5GAEC 2EYMA 4DNRB 3VR6A 2Q8IB 4FP5D 3UE1A 1ET9A 4IUPA 1UE7A 5JVH3 2KOLA 2HCCA 4X66L 3NTKA 4C3IH 1B9MA 4JI0Q 3ER0A 1C0AA 2FHTA 1F2MA 4LNQA 1VQEA 3HP3A 2R92H 2KQ3A 5FKAC 5F2DA 3MTSA 5I2XA 1Y1WH 4KD3A 4K0KQ 1B3AA 2BA0A 1WD0A 5EQ0A 3CCVA 3M4QA 5IT9c 2MNAA 2E2HB 1A2TA 1GM5A 3OTOL 2HIXA 4JVZA 2F0KA 3HOZB 2F3IA 2YV5A 1JJCB 3NEMA 5IGEA 4FF1A 2H4OA 2MO0A 1IYVA 2M00A 3CCLA 1YJNA 1SYEA 1HH2P 1EIFA 2K5VA 1XNRL 3J7AF 4TRDA 4A3BH 4R8NA 1CM9A 5I6YA 2JA5G 2WP8J 1HA5A 4IUTA 4JC0A 2R3ZA 1BR9A 1K3BC 3HOWG 1RTOA 2FMMA 3I91A 1KDCA 2VQEQ 3ULPA 1YHBA 3UI2A 4GKKQ 3LGJA 4RCNA 2KCCA 1I6HB 2KA7A 3KYHC 2JE6I 4DV5Q 5GQOA 4IFDI 1FR3A 3GP7A 3R2IA 4CJ0B 5FO9B 2B2UA 3HKZB 1WTXA 2DN8A 4LF4L 2A73B 3NTIA 3ULJA 1JORA 1R9TH 3HOVH 3RNUA 3HEJA 4JW0A 1KAWA 3VA5A 1BCPC 3DHQA 1ONLA 3NQTA 2BOSA 3HOUG 5FK9C 3P1HA 2E2IH 2UUBQ 3J81i 1BOSA 2ZM6Q 3PUVA 1XMOQ 1QVFA 2BH8A 1S5FD 2PO4A 1D8LA 4A3IH 1XTDA 4J15A 5LMNQ 5LMNL 1K8GA 4PMCA 4JOIA 1CSQA 3C2PA 2KECA 5HY6A 2CWAA 4JI1Q 2JQOA 1EY0A 2KHIA 1NUCA 3H94A 4Y52H 3MXPA 2R92G 4JK1C 1S5DD 3I70A 3CCJA 1KQSA 3BZDB 3S17B 1I4QA 4OO1I 2HHHQ 3GTLB 3VYRA 2HIVA 4NXNQ 2E75C 2RDFA 4IUNA 5FLXE 2JA5H 2UXBL 4X3KA 3I3CA 4H0LC 2F0EA 3I2ZA 3HOUB 1DONA 3ERSX 4HTHA 2EYJA 3PV0A 1SE8A 1SMXA 1I3QH 3SEBA 3S1QH 5T1IA 1FVIA 4DUZQ 1N34Q 4A3MG 1XMOL 3HOZH 4RGTA 2VL6A 5C3EB 2F52A 4UY8C 3D6CA 1H9SB 3HOYG 1HNWQ 2EJMA 4Y7NB 4RG1A 4C3HG 3K5OA 2F4VL 1YVCA 3DXJC 1JWSD 5EPJA 4OWTB 1HR0W 1D5MC 3FVQA 2UXCQ 1QVGA 1ILPA 3VR3A 1X32A 5M5WB 3A54A 4RWSC 1IBKQ 1EU3A 1LTGD 3NXWA 1D5XC 2XN9C 3BZKA 4QJFA 3X3NA 4RGOS 5EJWA 1WI5A 2QCPX 3CCMA 4DR1L 4QCLA 2XWBB 1A3TA 5A35A 2JSOA 5GADC 2F1MA 4A3DH 4F87A 4LF5Q 4C2MH 1DOLA 4WFN3 4BXXH 1OXVA 4QL5A 2OXPA 1N33Q 3WOFA 3C46A 4DV6L 1HA6A 1YNXA 1FNVA 1SE4A 2UUAL 1HCZA 3OHXC 2NVTB 4LF6Q 3MA2B 4MZ9A 3EJIA 3KLSX 1KABA 2O2LD 1GKHA 2P5ZX 4H7BA 4BBRH 1ZXTA 4HMIA 4IALA 5D14A 2VW9A 1LTTD 2K6AA 5IT9L 3I4MH 1S40A 5IP9G 3PO2H 4BY1G 1CTMA 3N6RA 5I2YA 4QUCA 5C3WA 1E1OA 3J80c 1XPUA 4OO1H 3EROA 4FDBA 4DF7A 4DV0Q 1OXUA 3VYSA 2B63H 3CD6A 2WB1E 1PTOH 3M7NA 5IGBA 1IBLL 3TQYA 3SVMA 5IYBG 4QGUA 3GTPH 1VQIA 2GVBA 3UDIA 1HTPA 4I7ZC 2L5TA 3QIAA 4LFCL 4EGVA 1JJGA 3KJOA 3D31A 1U9RA 1Z6HA 4GNXB 3F2DA 3U9OA 2F4VQ 1DYQA 2UUAQ 3C1EA 5C3EH 2KUMA 2IPKD 5CYUA 4C3JG 4C1NK 1V1PA 4TSSA 1D6EC 3FKIB 2RSOA 4KLKA 2F0PA 1HPCA 3QOLA 2AQ1B 2OWOA 3JAME 1VQKA 1WFQA 4DA2A 1N9WA 3KLWA 4YHHQ 1EYGA 4G57A 2AUJD 4CHTB 4FF3A 1NNXA 1X3GA 1L0WA 3DM3A 2JA7B 2RCFA 1H9KA 3T16A 1LABA 3BS1A 4FXGC 1VQLA 1EYAA 1I50B 1DOKA 3U58A 4NXNL 1KC8C 3I4MG 3NBHB 3CPFA 2VZAA 3DMUA 1Q1EA 4QIWE 4C2MB 4JI6Q 4XQQA 5L37A 5C4XB 4WJ3M 4BBSG 3D6WA 1TWCH 5AFWA 4LF7L 4OX9L 2A6HD 5FLMH 1PA6A 3OIPA 2RDHA 2PPBC 1YHAA 2ZTCA 3SXHA 2NVTH 1ENFA 4YIJA 4PMBA 3N52A 5M3MB 3CMAA 4G7OC 2M2LA 1V1QA 3TDQA 1AE2A 2A6HC 5JEAH 5C4JH 4DXFA 4KHPL 4A3EG 2JP1A 3H15A 3HOXB 1TWHH 2O4XA 2JXMB 3TZDA 1NMGA 3RMHA 4A3LG 1EYCA 1VQ9A 2N49A 1PH4A 1SEBD 1AW7A 4DR5Q 3NQIA 5D3DA 1QUQB 3A55A 5ELEA 3ZYYX 3D3RA 3BU2A 1BCPD 5FLXc 2B63B 1S4ZA 3CC4A 1NE3A 2KENA 1VQMA 3R8BA 3VA7A 1J6QA 1X3PA 1WTPA 4DXGA 1VQ7A 1X65A 1LT3D 4F88A 3LNNA 2FFKB 2R93B 4LF7Q 1EQVA 3EVQA 3S16B 2C5CA 4DR6Q 3J7AV 3G6EA 3S14H 1E7ZA 3EBEA 1WCMG 3RN2A 1JMCA 1JT8A 1HNXL 1LTLA 1L1OA 3S15B 2YU9H 4C3JB 4HJ7A 4CKCA 4B3MQ 3J81L 4B9WA 1V1PB 1MBYA 4X65L 1HZCA 2Q8RE 2EIFA 4KV6A 2IW3A 4IUUA 1G291 1WTOA 2NYZD 2LXKA 4O1NA 2SOBA 4YHHL 2NUCA 2DNEA 2RKSA 1KAAA 2ASBA 2K01A 4P71A 4M8AA 3KF6A 2L4NA 1B4OA 1NAPA 3I72A 1HRJA 1MGSA 1YI2A 2ID0A 2ES2A 2F0IA 4CKBA 4UDUC 4N8X1 4QB4A 3J7YW 3K80C 1WYDA 4X62Q 1Y1WB 4CJ2C 1U4LA 3K7AB 3ONAB 3HOZG 4A3CG 3MHBA 3PIPA 4DV1Q 1KRTA 3HS0C 3MWYW 2UXDQ 2CFMA 1QB5D 5KEEA 1XYIA 2XWJB 3VR4A 3URYA 1EOTA 1PYSB 4EVOA 3M85A 1PYBA 2E8GA 1VDZA 4WRDA 4DK1A 1Y14B 1RCVD 1IL8A 1WCMB 2IX1A 1DOMA 1H9SA 3NE5B 4C1NI 5C4JB 1N33L 3GDEA 5JJLA 1ILQA 2IHEA 1G8ZD 5JEAJ 5C3XA 1TS5A 2B2YA 4LF5L 4O2DA 4LJZC 4RAUC 2K75A 4LFAL 5BN3A 1UNSA 4NPSA 5I9OA 5JAVA 3I90A 2MUYA
chains in the Genus database with same CATH topology
2SDFA 3DWPA 2A6ED 2LS01 1IYUA 2ZXOA 4DK0A 4K6LA 1DZ1A 1R9TB 3HOVB 4A3MB 2BDOA 1SBBB 3A8IE 3P20A 3K58A 5IGDA 4ZKBB 1SMYC 2MP1A 1JWUD 2BE5D 2EJGC 4RFBA 1SYGA 4A3IB 1F9QA 1TIID 4ILWA 3KLRA 2SNMA 2XNAC 2F0WA 4M1UB 1O80A 2QILA 2N88A 3RLFA 1TS4A 3A8JE 3HGBA 1NR4A 1SNDA 2HUGA 5DM73 2BA1A 1PZID 3IFDA 3GQBA 4XT3B 5C0XJ 2L0CA 1LACA 4DFAA 3OOCA 4ZK9B 1TY2A 3RZDB 1EFID 3MEHA 1CHQD 2FINB 1YNJD 1E2ZA 5HGTA 1KLUD 2HCIA 1CA5A 1LO5D 3SK8A 3BG3A 3PIO3 3MAQA 1XWEA 5IOCA 4MN3A 1SNQA 4AYBB 3V96A 2B2VA 4QIWB 4MHEA 3V05A 1SFOB 4G4KA 1PRTD 3SK5A 1IW7D 3R93A 1BXTA 5J39A 2F0LA 2EE1A 2F0GA 2D9UA 3K57A 2QKIC 1GXDC 4A3DB 2PZUA 1FNWA 1ZYRC 5M3FB 3A56A 5C0XI 4L8JA 2CHBD 5C6AA 3QG1A 2DY8A 2K28A 2J7ZA 3NSWA 4XTCS 1LTSD 5C4HA 4DAYA 1EIGA 2CW0D 3PUYA 5EKLA 2F0UA 4K5XA 1G91A 2D5DA 1T5XD 3AB9A 4XT1B 5DM63 4K8JA 1TU2B 4FO2A 1PFMA 3QO2A 3PO2B 1A6XA 1ICWA 1EY4A 2JEBI 4KD4A 4N9PA 1AN8A 2C9OA 2MGSA 2B8FA 3MC0B 2IX3A 2F0TA 4OHJA 2HDMA 5DNFA 2LMCB 2NBFA 1XXGA 3T53B 3DUZA 4X3UA 5G3LD 4E6IA 1JOKA 2NVXB 1TQOA 4IZ8A 5ELCA 5K36G 4BY7B 2EYOA 4BS9A 4FXKC 5JVG3 4KHVA 1BCPB 1VCIA 2A69D 1STGA 1U4RA 1JQYD 3KUPA 2XSCA 1EY7A 3D4WA 1JICA 1SAPA 3J80E 5CV7A 4OGQC 1D1KA 4Q0FA 3NBHA 3LWEA 1D2BA 2PMZB 1HQRD 1GHKA 1TWGB 1Z7TA 3LX0A 5E1FA 2V4DA 1F2ZA 3TBIB 1STBA 5FO8B 2R92B 1GUGA 3Q23A 2D62A 2I07B 2KHSA 5EPLA 2G9DA 3NWTA 2ICEC 1Z47A 2D2CC 3F2UA 1IKMA 1LTID 1KNEA 2EY2A 2EY5A 4CJ1B 2XVSA 1U4PA 4A3BB 3BYTB 1EYDA 1LTRD 4CGYB 4HR7B 2Z1CA 2YYZA 4U68A 5JOBA 4IFDG 2F0FA 3K6OA 3EA6A 1ENCA 1PTOD 1QILA 2PCFB 3GD7A 3DEOA 2IT1A 3K59A 1SNOA 1O7YA 4DAVA 5BN5A 2L12A 4A3GB 2AWOA 2SEBD 5A2QE 2KJXA 2EVBA 4A3JB 1M4VA 5JJZA 2PZWA 5CV6A 1H9JA 2OEOA 3FMCA 2A5HA 2B2WC 2XRSD 3P7JA 5EGTA 5IODA 3NBIA 5M5YB 1D1IA 3K5LA 3QOJA 2A74C 2XRQD 2PW7A 1STEA 3I4MB 4IFDJ 4L6TB 1STYA 1L0XB 1QCBD 2L9HA 5EPKA 5IIFA 4K8IA 1QG7A 1W6JA 3H0GB 1AP0A 1QNKA 2JA5B 1F9PA 1A15A 4KHZA 5ELFA 4IURA 3CRKC 1S5CD 3K5NA 4Z9CB 1EY5A 3TSSA 5M5XB 1RKNA 1I3QB 2QF7A 1II3A 1AEXA 5IGGA 1CZWA 1AFPA 1C48A 1V8QA 3D4RA 3TP8A 4KKUA 4IFDH 2A68C 3K5MA 3TMEA 3GTGB 1BDOA 3FPPA 4JBWA 1PZKD 3IAYA 5E4XA 3OMCA 1R4PB 5DEHA 2B2TC 2F4IA 5CMDA 3M4YA 1HHVA 4I65A 1OO9B 2WACA 3S1RB 4R8IA 1YNNC 2J4XA 5KNBA 4H13C 5JPNC 1O78A 3QWNA 4IN3A 3O13A 2EYLA 5KRUA 2RA4A 4LAAA 2NN6I 3S2DB 1VF7A 1TWAB 3SK6A 1BQQT 3RD4A 1EZ8A 5D3IB 5CV9A 4KTAA 5ELBA 3C1FA 4HCSA 4BBRB 2PNRC 3R3OA 1I4PA 4V190 1I4XA 4BA2I 1H9RA 1B44D 1VMPA 2TMPA 4ABNA 2F0OA 2KCNA 3QB3A 1UAPA 4ZAIA 1SDFA 4QMGA 2F0DA 2JA6B 5NUCA 4ZLTF 5EBCA 3E5SA 5KNDA 1NSNS 3Q0AA 3GV6A 1YNJC 3VYTA 1QNUA 3S14B 1RTNA 3FPUB 1PTOF 4X3SA 3GTMB 2ZXPA 1JOOA 2F0QA 1TKWB 3OIQA 3CHBD 4HEDA 5IGFA 1GUSA 3HZXA 2CVRA 4B08A 4DNTB 4Q5VA 3CU7A 4J1MA 4K2KA 2EZVA 1ENAA 1B2TA 3OWFA 1DXMA 1CK1A 1W6KA 1F9RA 3H3VC 2FJ2A 2IX0A 1OXTA 3Q6SA 1TWCB 3BDCA 2XIWA 3KBGA 5FLXL 2K03A 1X3QA 5ISRA 1G2TA 1HTLD 2CW0C 1S5BD 4KMUC 2K05A 3BVMA 1GUTA 3JAML 3KBXA 2PQEA 2IJ0A 2Z4IA 2RBMA 3TZUA 4KKTA 4PNYA 1PTOC 3PUXA 2F0VA 1KDBA 5EKIA 2WIIB 2PZTA 1V43A 4HSVA 3CRLC 2F3WA 1TWFB 3T51B 3SDZA 1A3UA 1FGBD 3H6MA 1EQTA 5C5MA 1MSHA 4K6DA 1A2UA 3AU7A 1SJHD 3I8ZA 2YU9B 1ET6A 1FYCA 1MD2D 3WDNA 4A93B 2FMCA 3TP5A 1B9NA 1UEAB 1Y69U 1OXXK 3GV3A 1TS3A 1K83B 3NK9A 3MFYA 2NTSA 2DY7A 2EYPA 4GZYC 1H9MA 5A2QL 5IT9E 1WVLA 2MPMA 5KGUA 1YNND 2LFNA 2K33A 3W3AA 3KK7A 4XQJA 3IL8A 1LLRD 4ULLA 2F0MA 2NWGA 4O42A 2K04A 4KY5A 5I4DA 2X69A 1EIHA 4C56C 2L55A 2RDGA 1LTAD 3PIP3 4IUVA 3L9AX 2NVYB 1G2SA 2PW5A 4NP5A 3GO5A 5CBAE 2I46A 3OPOA 1G6ZA 4PMWA 4KY7A 4TKOB 1A3VA 1GOZA 5T1GA 4A3EB 4HAEA 1Y8OB 1BUVT 4NMZA 4QUFA 4C3IG 2EPBA 1F2LA 3S1MB 1KTKA 2QEJC 4FNFA 4FVMA 4KKSA 4RA8A 5C0XG 2A69C 2OT2A 2F0JA 1GUNA 3NWSA 4WJWA 1ZKOA 5LHY1 2DNCA 3D4DA 1RDPD 3BVGA 2JA8B 1SYDA 3G7LA 1B1ZA 3Q24A 2KEDA 1EWCA 3ITPA 3BDOA 3ND9A 1GUOA 1WTRA 4A3FB 1CFMA 1XTCD 1FD7D 5CV4A 4KK7A 4G7HC 2JEAI 4XIGS 2JYOA 5KYLA 1PFNA 4XXEA 4PV1C 1WTQA 1EY6A 2CQAA 5CC4A 2RSNA 1SJED 1GUWA 4V0BA 2K5WA 3T13A 5C5LA 3NUCA 1CHPD 4KI0A 5FO7B 4KY6A 1F77A 1OXSC 4OIJA 2MJ8A 5CV8A 1VF5C 3BYYB 1IW7C 1DJRD 1CQVA 2K1BA 4KN4C 1SNCA 2EOTA 2KVMA 2PYKA 4FF4A 3HOWB 2RVLA 1ZYRD 1O7ZA 2ENBA 3NTHA 3S1NB 4ZQ3A 4N9TA 2NZ1D 3C3LA 1SYCA 5KYIA 1JC7A 1HXYD 5E3FA 1ESRA 2J0TD 1QOHA 2E2IB 2NN6G 2KEEA 5KNCA 4RKBA 2F0SA 5DAUA 2ZT9C 4P2CB 2VNUD 5G3LF 3A8KE 3BVZA 5KIXA 1EEFD 3QJYA 2WINB 5COYA 4K14A 1RODA 1EEID 4KJOA 4EQOA 5J22A 2E74C 2OF1A 1LV9A 4J8QA 3G6JB 2BDNA 1MSGA 4RHSA 1AZQA 1K8OA 4RKLA 1RD9D 2EXZA 4HMJA 1BO0A 3V2TA 3L3OC 4MIUA 3SHLA 3K0YA 5I6WA 2WB1B 2WV6D 2B2VC 2EY6A 1EY8A 3Q22A 2N55A 1EU4A 3IFTA 4BA1I 5IGCA 1LT6D 1F2YA 1STHA 1KNAA 3S1QB 3CQZB 1EZ6A 5TSSA 2Z8LA 2E2JB 4EQNA 1TVXA 2B8GA 4WORA 5C44B 1DM0B 1BBXC 3A7AB 2Q8TA 4F8MA 4KN7C 1SSOA 2MHVA 3AMUA 4DU9A 3GTQB 2HDLA 4ZYSA 4FXDA 1JWMD 1PFBA 4UAIA 3E0JA 4S3SA 1E2VA 1CI3M 1HQMC 1HUNA 2WKCA 1HUMA 2E2DC 2L11A 3VR2A 3RZOB 2NVQB 4C3IB 3HG9A 3PMFA 1ML0D 2R6GA 1E0BA 2X6GA 4B9XA 3SK4A 5K5PA 1SYBA 4ZUIA 3DWAA 3H09A 2B2UC 5JPMC 4ZKCB 2K5QA 3KF8A 4FYDA 3J81E 1JB3A 1DCZA 3EFXD 2AQ2B 3PUZA 1PRTC 2Y0SB 2LY7A 3I73A 1I6VC 1L0YB 3ND8A 3DM1A 2F3VA 1EWHA 3T56B 5LL6X 1Q3LA 4DAPA 2RQXA 4LMQD 1BNZA 2X6LA 4DGZA 1B50A 1TS2A 1TR5A 1DD2A 3P75A 4K5VA 1BF4A 3BDLA 1B53A 5E4WC 4OO1G 1U4MA 4L63B 1EY9A 3GTPB 1NR2A 4HSPA 4A3KB 3MFGA 1TY0A 3OWEB 2WAQB 1LT5D 2M9VA 3NPPA 4HN7A 1WTWA 3W2DA 4HCEA 4H44C 1M8AA 2GA4B 2F0HA 1ZEQX 3MXNA 2O5JC 3E6ZX 1HFNA 4BBSB 3DWQA 3A7LA 1Q90A 3DEPA 3GTOB 2AUKA 3MVVA 2EYFA 4NDXA 2L1BA 1PZJD 2F0NA 5D65A 1S5ED 1PRTF 1RJTA 1Q1BA 1XX8A 3MXUA 4IUQA 4U673 5J1ZA 2B2WA 4ID6A 1SNMA 3X3MA 4OL7A 1JCKB 1WTVA 1Y8PB 5CORA 4F7XA 5C4ZA 4ODGA 1Q8IA 3LWUA 1AZPA 1PXUA 1K8MA 1R4QB 4XDXA 3M7GA 5M9OA 1KDAA 2H1EA 4OIKA 1PMRA 2B2YC 4BWGB 2K5DA 3SE0A 1CT1D 3PUWA 1TT2A 4FF2A 1EL0A 2VUMB 3ERQA 3L7ZC 4NKLA 2K7VA 2VB2X 3J80L 3WOEA 4CKEA 4LK1C 5LL6S 3CKIB 4DN4M 2NB0A 1J8IA 2EJFC 5CR3A 1IKLA 3MZ5A 1C4QA 3SR1A 4ME5A 5I9PA 3M3YB 2Z4HA 3D8GA 4G7ZC 1RF2D 1WD1A 2BCOA 1SE3A 2E76C 2B39A 4IQZA 2IL8A 4ZRZA 1JR0D 1LT4D 5JEAG 1PTOB 1PDQA 1STAA 2B2TA 1NCVA 4XYQA 1RHPA 3GTJB 1QWYA 1D5ZC 5ELDA 1PRTB 2K32A 1PYWD 1FNUA 2G9HD 3OW7A 1VMCA 3FRPB 3S9WA 3S2HB 3HOYB 1CQFA 1UUPA 2SNSA 5K36H 1MI2A 1QE6A 4RGMA 4X3TA 4C3HB 1Y8NB 1T5EA 1QJOA 3OSOA 1SE2A 3VR5A 4NW2A 3TN2A 2O5IC 1PLFA 3I4NB 1KLGD 5CGKA 1IHZA 1O7LA 2IWHA 3HRZC 3I4LA 3IKJA 4BY1B 2NN6H 5CBEE 3T4AC 2VB3X 4RGNA 5EBDA 3TP7A 3KLSA 1ESFA 2F03A 4TQUS 4K5WA 1SNPA 2A6EC 2HQEA 1STNA 4QF4A 1GHJA 1SMYD 2QDBA 3VYUA 3U9SA 2R61A 3PO3B 3MXGA 4PQXA 5FOBB 4KJNA 2A68D 3M4OB 4ZUJA 2ICIA 3R2TA 1TWHB 5HURA 1E2WA 2R7ZB 5CV5A 2BE5C 4XQNA 1CA6A 1SXTA 3NP8A 3TP6A 4K2LA 3FEWX 1V1OA 1Q12A 1I4RA 5C0XH 3H91A 2LKVA 3EQLC 1J9OA 2VXWA 1LTBD 3RUZA 1GJXA 4RH6A 1I4HA 2TSSA 1Y1VB 4J6HA 1SYFA 4R9WA 3FDTA 1HFGA 4XYOA 1I4GA 4RCOA 1C8CA 2AQ3B 3OMGA 2AWNA 2WKDA 3NHHA 4CBVA 5EKKA 2EDGA 1F9SA 2NTTA 4EQPA 1JE4A 5BN4A 1JOQA 2ZXRA 2EYHA 1BCPF 1CZGA 2EY1A 3GTKB 4RHRA 2EYMA 4DNRB 3VR6A 2Q8IB 4FP5D 1ET9A 4IUPA 5JVH3 2KOLA 2HCCA 3NTKA 1B9MA 2FHTA 1F2MA 3HP3A 2KQ3A 5FKAC 5F2DA 3MTSA 5I2XA 4KD3A 1B3AA 2BA0A 1WD0A 5EQ0A 2E2HB 1A2TA 2F0KA 3HOZB 5IGEA 4FF1A 2H4OA 1IYVA 2M00A 1SYEA 3J7AF 4TRDA 4R8NA 1CM9A 5I6YA 2WP8J 1HA5A 4IUTA 2R3ZA 1BR9A 1RTOA 2FMMA 3I91A 1KDCA 3UI2A 4RCNA 2KCCA 1I6HB 2KA7A 2JE6I 4IFDI 1FR3A 3GP7A 3R2IA 4CJ0B 5FO9B 2B2UA 3HKZB 1WTXA 2DN8A 2A73B 3NTIA 1JORA 3HEJA 3VA5A 1BCPC 3DHQA 1ONLA 3NQTA 2BOSA 5FK9C 3P1HA 1BOSA 3PUVA 1S5FD 2PO4A 4PMCA 3C2PA 2KECA 1EY0A 1NUCA 3H94A 3MXPA 4JK1C 1S5DD 3I70A 3BZDB 3S17B 1I4QA 4OO1I 3GTLB 3VYRA 2E75C 2RDFA 4IUNA 5FLXE 4X3KA 3I3CA 4H0LC 2F0EA 3HOUB 1DONA 4HTHA 2EYJA 3PV0A 3SEBA 5T1IA 4RGTA 5C3EB 3D6CA 1H9SB 2EJMA 4Y7NB 4C3HG 3K5OA 3DXJC 1JWSD 5EPJA 1D5MC 3FVQA 1ILPA 3VR3A 1X32A 5M5WB 3A54A 4RWSC 1EU3A 1LTGD 3NXWA 1D5XC 2XN9C 3X3NA 4RGOS 5EJWA 2QCPX 4QCLA 2XWBB 1A3TA 5A35A 2JSOA 2F1MA 4F87A 1DOLA 4WFN3 1OXVA 2OXPA 3WOFA 3C46A 1HA6A 1FNVA 1SE4A 1HCZA 3OHXC 2NVTB 3MA2B 3EJIA 3KLSX 1KABA 2O2LD 4H7BA 1ZXTA 4HMIA 4IALA 5D14A 1LTTD 2K6AA 5IT9L 1CTMA 3N6RA 5I2YA 4QUCA 5C3WA 4OO1H 3EROA 4DF7A 1OXUA 3VYSA 3M7NA 1PTOH 5IGBA 3SVMA 1HTPA 4I7ZC 2L5TA 3QIAA 4EGVA 3D31A 1U9RA 1Z6HA 3U9OA 1DYQA 3C1EA 2KUMA 2IPKD 5CYUA 4C3JG 4C1NK 1V1PA 4TSSA 1D6EC 3FKIB 2RSOA 2F0PA 1HPCA 3QOLA 2AQ1B 3JAME 4DA2A 4G57A 2AUJD 4CHTB 4FF3A 2JA7B 1H9KA 3T16A 3BS1A 1LABA 4FXGC 1EYAA 1I50B 1DOKA 3DMUA 1Q1EA 4C2MB 4XQQA 5C4XB 3D6WA 5AFWA 2A6HD 3OIPA 2RDHA 2PPBC 3SXHA 1ENFA 4YIJA 4PMBA 3N52A 5M3MB 4G7OC 2M2LA 3TDQA 2A6HC 5JEAH 4DXFA 2JP1A 3HOXB 2O4XA 2JXMB 3TZDA 3RMHA 1EYCA 1SEBD 1AW7A 3NQIA 5D3DA 3A55A 5ELEA 3ZYYX 3D3RA 1BCPD 2B63B 1S4ZA 3R8BA 3VA7A 1X3PA 1WTPA 4DXGA 1LT3D 4F88A 3LNNA 2FFKB 2R93B 1EQVA 3EVQA 3S16B 2C5CA 3J7AV 3S15B 4C3JB 4CKCA 3J81L 4B9WA 1V1PB 1MBYA 2Q8RE 4KV6A 2IW3A 4IUUA 1G291 1WTOA 2NYZD 4O1NA 2SOBA 2NUCA 2DNEA 2RKSA 1KAAA 2K01A 4M8AA 2L4NA 1B4OA 1NAPA 3I72A 1HRJA 1MGSA 2ID0A 2F0IA 4CKBA 4UDUC 4QB4A 3J7YW 1Y1WB 4CJ2C 1U4LA 3K7AB 3ONAB 3MHBA 3HS0C 3MWYW 1QB5D 5KEEA 1XYIA 2XWJB 3VR4A 3URYA 1EOTA 4EVOA 3M85A 4DK1A 1VDZA 4WRDA 1RCVD 1IL8A 1WCMB 2IX1A 1DOMA 1H9SA 3NE5B 4C1NI 5C4JB 1ILQA 1G8ZD 5JEAJ 5C3XA 1TS5A 2B2YA 4LJZC 4RAUC 5BN3A 1UNSA 5I9OA 5JAVA 3I90A 2MUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWG A;  4O42 A;  2K04 A;  4X3K A;  1G2T A;  2FHT A;  3I3C A;  2RSN A;  2SDF A;  2X69 A;  1SAP A;  3HP3 A;  2K05 A;  4HCS A;  3R93 A;  1S4Z A;  1WTW A;  3MTS A;  1GUW A;  1DON A;  1EIH A;  1B3A A;  1TVX A;  1WD0 A;  1M8A A;  5EQ0 A;  3SVM A;  3KBX A;  2EE1 A;  1X3P A;  1WTP A;  3LWE A;  2D9U A;  1VMP A;  2L9H A;  5T1I A;  1DZ1 A;  5EPK A;  4DN4 M;  1J8I A;  4OIJ A;  2MJ8 A;  1QG7 A;  1AP0 A;  1BBX C;  1QNK A;  2FFK B;  2Q8T A;  4ZKB B;  4ZAI A;  1SDF A;  1IKL A;  4IUV A;  1F9P A;  1A15 A;  1HFN A;  2K1B A;  1SSO A;  2MP1 A;  1EL0 A;  4IUR A;  2DY8 A;  2K28 A;  3DEP A;  1G2S A;  2EOT A;  2HDL A;  2J7Z A;  2KUM A;  2KVM A;  1CM9 A;  5CBA E;  1PFB A;  4IUT A;  4ZLT F;  4UAI A;  2RSO A;  1F9Q A;  2R3Z A;  1EIG A;  5EKI A;  1WD1 A;  2RVL A;  5EPJ A;  1RTO A;  2FMM A;  3I91 A;  1HUN A;  1O7Z A;  1G6Z A;  4HSV A;  2HCC A;  5EPL A;  1HUM A;  3UI2 A;  2IL8 A;  1O80 A;  2L11 A;  1ILP A;  1G91 A;  2L1B A;  4CJ1 B;  2N88 A;  3GV6 A;  1CA6 A;  5T1G A;  1X32 A;  4XT1 B;  3F2U A;  1IKM A;  4HAE A;  1KNE A;  1PDQ A;  1RTN A;  2Q8R E;  5D65 A;  1ML0 D;  1NR4 A;  3FPU B;  4RWS C;  1E0B A;  2X6G A;  2NZ1 D;  4X3S A;  2B2T A;  1EQT A;  1NCV A;  4IUU A;  4QUF A;  1U4P A;  2HUG A;  1PFM A;  1RJT A;  2NYZ D;  1RHP A;  2EPB A;  1F2L A;  3QO2 A;  4CJ0 B;  1MSH A;  2B2U A;  1WTX A;  1ESR A;  5EJW A;  1DOK A;  1ICW A;  2KEE A;  3H91 A;  2K01 A;  2B2U C;  1J9O A;  2VXW A;  3I8Z A;  3IFD A;  2L4N A;  1B4O A;  1NAP A;  4U68 A;  4XT3 B;  2MGS A;  4HED A;  1HRJ A;  4RA8 A;  1MGS A;  1DOL A;  4ZKC B;  5COY A;  1VMC A;  2CVR A;  5E4X A;  2HDM A;  1ROD A;  4ZK9 B;  5DNF A;  4R9W A;  1XX8 A;  1HA6 A;  3D6W A;  3FDT A;  1HFG A;  5AFW A;  1LV9 A;  4CJ2 C;  4IUQ A;  1C8C A;  1U4L A;  3ONA B;  4X3U A;  2B2W A;  2B2T C;  1MI2 A;  3DEO A;  5CMD A;  1QE6 A;  2BDN A;  1WTV A;  1O7Y A;  1MSG A;  2FIN B;  3G7L A;  3MWY W;  4X3T A;  5COR A;  2HCI A;  2KED A;  3GV3 A;  1AZQ A;  3N52 A;  1XYI A;  1AZP A;  1CA5 A;  1B2T A;  2L12 A;  3DM1 A;  1BO0 A;  1EOT A;  2KEC A;  4R8I A;  1HHV A;  1Q3L A;  2M2L A;  4XDX A;  1F9S A;  4LMQ D;  4NW2 A;  1F9R A;  3TN2 A;  1BNZ A;  1IL8 A;  2FJ2 A;  2X6L A;  1ZXT A;  1PLF A;  2DY7 A;  1WTO A;  1WTR A;  1B50 A;  1JE4 A;  1DOM A;  2H1E A;  2B2V C;  3Q6S A;  2JP1 A;  4OIK A;  5JJZ A;  4MN3 A;  1BF4 A;  1ILQ A;  2B2Y C;  1B53 A;  5D14 A;  2N55 A;  2RA4 A;  5E4W C;  2B2V A;  2XIW A;  2JYO A;  4MHE A;  1WVL A;  2MPM A;  2B2Y A;  3TZD A;  2B2W C;  1PFN A;  1U4R A;  1U4M A;  4QUC A;  4RAU C;  3P7J A;  1KNA A;  3KUP A;  1NR2 A;  5CBE E;  3IL8 A;  4IUP A;  1JIC A;  3I90 A;  2K03 A;  1WTQ A;  2KOL A;  1X3Q A; 
#chains in the Genus database with same CATH topology
 4WJ4 A;  2SDF A;  3DWP A;  4AYB E;  2A6E D;  1M1K C;  2LS0 1;  1IYU A;  2ZXO A;  4DK0 A;  4K6L A;  1DZ1 A;  1R9T B;  3HOV B;  2UXD L;  4A3M B;  2BDO A;  1SBB B;  2HD3 A;  3A8I E;  3P20 A;  3K58 A;  5IGD A;  1HNX Q;  3S1R H;  4ZKB B;  1SMY C;  4X64 Q;  4GNX A;  1SN8 A;  2MP1 A;  2E5L Q;  4JI3 L;  1HNZ Q;  1SLJ A;  1JWU D;  3S16 H;  1B70 B;  2BE5 D;  1K0S A;  2EJG C;  3T1Y L;  4RFB A;  4IO9 A;  1K0R A;  1SYG A;  4A3I B;  1F9Q A;  1TII D;  3KOJ A;  4ILW A;  3KLR A;  2SNM A;  2XNA C;  4POG A;  1N34 L;  2F0W A;  4M1U B;  1O80 A;  2QIL A;  2N88 A;  3RLF A;  1TS4 A;  3A8J E;  5JJI A;  2K52 A;  3HGB A;  3UE0 A;  1NR4 A;  4HIM A;  1SND A;  2N78 A;  4DV2 Q;  2PQA B;  2HUG A;  5DM7 3;  4B3T L;  2UU9 L;  5LMU Q;  2BA1 A;  1PZI D;  3IFD A;  3GQB A;  2Z6K A;  4XT3 B;  1J5E L;  2DGY A;  5C0X J;  1HZB A;  2L0C A;  1LAC A;  4DFA A;  3RLN A;  3OOC A;  4A93 G;  4ZK9 B;  1TY2 A;  3RZD B;  3L0O A;  1EFI D;  5IYC H;  3SGI A;  1U5K A;  4EQ5 A;  3MEH A;  1I5F A;  5C44 G;  4OXP A;  1OTC A;  1CHQ D;  2FIN B;  1YNJ D;  1E2Z A;  5HGT A;  1KLU D;  4A3G G;  2HCI A;  1EFW A;  1CA5 A;  1LO5 D;  3SK8 A;  3BG3 A;  3HOX G;  2GN5 A;  4OX9 Q;  3J80 i;  3PIO 3;  3MAQ A;  1XWE A;  5IOC A;  4MN3 A;  1SNQ A;  4AYB B;  3V96 A;  4JI6 L;  3S2H H;  2B2V A;  4QIW B;  4MHE A;  1VQJ A;  3CP0 A;  4DR5 L;  2ZJR A;  2H5X A;  4L5Q A;  3RLO A;  3I4O A;  3V05 A;  1SFO B;  2PMZ E;  4G4K A;  2Q2T A;  1Q8K A;  5IYD H;  1MJC A;  1PRT D;  2JA7 G;  3SK5 A;  1IW7 D;  3R93 A;  1XPR A;  1X54 A;  1BXT A;  5J39 A;  4JBK A;  1NBW A;  3CW2 C;  2F0L A;  2EE1 A;  2F0G A;  2D9U A;  2V1C C;  3K57 A;  4DR2 Q;  1RL2 A;  2QKI C;  5FJ8 G;  1GXD C;  4R4I A;  3PO3 G;  5IYB H;  2PZU A;  4A3D B;  1FNW A;  1ZYR C;  5M3F B;  3A56 A;  4ME3 A;  5C0X I;  4L8J A;  2CHB D;  5C6A A;  3QG1 A;  2DY8 A;  2K28 A;  1XNR Q;  2J7Z A;  4A3E H;  3NSW A;  4XTC S;  5ELN A;  1LTS D;  5C4H A;  4BY7 G;  4DAY A;  1EIG A;  2CW0 D;  3PUY A;  5EKL A;  4DR4 Q;  2UU9 Q;  2F0U A;  4K5X A;  1G91 A;  2D5D A;  3JAM i;  1T5X D;  3AB9 A;  4XT1 B;  5DM6 3;  4K8J A;  3S24 A;  1TU2 B;  4FO2 A;  1PFM A;  3QO2 A;  1TXY A;  3PO2 B;  1A6X A;  3AYH B;  1P16 A;  1ICW A;  1EY4 A;  2JEB I;  4KD4 A;  4N9P A;  4LFA Q;  4PZ6 A;  1AN8 A;  3NEL A;  2C9O A;  2MGS A;  2B8F A;  3MC0 B;  2R7Z H;  4R4Q A;  2IX3 A;  2F0T A;  4OHJ A;  2HDM A;  4DR7 L;  5DNF A;  3HFZ B;  2LMC B;  2NBF A;  4DV3 L;  5J3B A;  1UE5 A;  4R4O A;  1XXG A;  4JBM A;  3T53 B;  3DUZ A;  4X3U A;  5G3L D;  4E6I A;  1HR0 Q;  4A3D G;  1JOK A;  1A0I A;  3HKZ E;  4LFC Q;  5FJ8 H;  4A3G H;  2NZH A;  2NVX B;  4JI2 Q;  1TQO A;  1UE1 A;  2VY3 A;  3K8A A;  4IZ8 A;  5IP7 G;  4A76 A;  1L1O C;  5ELC A;  5K36 G;  4MTN A;  3W5O A;  1HR0 L;  3E0E A;  4BY7 B;  2EYO A;  4BS9 A;  4FXK C;  5JVG 3;  4NB3 A;  4KHV A;  2WB1 G;  1BCP B;  2MO1 A;  2I5M X;  1VCI A;  2WFW A;  2A69 D;  1STG A;  1PH3 A;  4LUZ A;  1U4R A;  5M5Y H;  1JQY D;  3KUP A;  4PG3 A;  2XSC A;  4DR1 Q;  1KIX A;  1EY7 A;  3D4W A;  1JIC A;  4DNI A;  1PH6 A;  4OEL B;  2AHO B;  1SAP A;  3J80 E;  5CV7 A;  5JJK A;  3U4Z A;  4OGQ C;  3PGZ A;  1D1K A;  4Q0F A;  3NBH A;  5IE8 A;  5IWA Q;  3TRZ A;  3LWE A;  4B3M L;  1D2B A;  1CKO A;  3AFP A;  4LF9 L;  2PMZ B;  3HOW H;  1HQR D;  1GHK A;  1TWG B;  1Z7T A;  1K83 H;  3LX0 A;  4I7A A;  5E1F A;  4JI7 L;  2V4D A;  5IP9 H;  3S1N H;  1F2Z A;  5M3F H;  4L5T A;  3TBI B;  1G51 A;  3I55 A;  1STB A;  5FO8 B;  4DR6 L;  2R92 B;  5BR8 Q;  5M5X H;  1GUG A;  1NY4 A;  3Q23 A;  2D62 A;  4N8F A;  2I07 B;  2KHS A;  5EPL A;  2G9D A;  3NWT A;  2ICE C;  1Z47 A;  2D2C C;  3W1G A;  3F2U A;  1IKM A;  1LTI D;  5H1S E;  1KNE A;  2EY2 A;  2EY5 A;  3HOX H;  4MNO A;  4CJ1 B;  1SR3 A;  2XVS A;  1U4P A;  4A3B B;  3BYT B;  1EYD A;  1LTR D;  4CGY B;  4JCV E;  4IJL A;  4HR7 B;  1S3O A;  1IL2 A;  1HJP A;  4OWX B;  2Z1C A;  2YYZ A;  4U68 A;  5JOB A;  4AIM A;  4IFD G;  3QR8 A;  2F0F A;  3K6O A;  4YCU A;  3EA6 A;  1FJG Q;  1O7I A;  1Q86 C;  1ENC A;  1PTO D;  4DV4 L;  1KD1 C;  1QIL A;  4UHV A;  2PCF B;  3GD7 A;  3OYY A;  3HOV G;  3DEO A;  2IT1 A;  3K59 A;  1SNO A;  1O7Y A;  2Y0S G;  4QQB X;  4DAV A;  1JE5 A;  5BN5 A;  2L12 A;  4A3G B;  2AWO A;  2SEB D;  5A2Q E;  2KJX A;  5AJ3 Q;  2EVB A;  2ZM6 L;  4A3J B;  1M4V A;  2RCN A;  5JJZ A;  2B29 A;  4AQY Q;  2PZW A;  1TWA H;  5CV6 A;  1H9J A;  2OEO A;  3FMC A;  2A5H A;  2B2W C;  2XRS D;  3P7J A;  5EGT A;  5IOD A;  1PVO A;  3NBI A;  5M5Y B;  1D1I A;  3K5L A;  4A3B G;  2QEX A;  3M4P A;  3U4V A;  3PF5 A;  1VQP A;  1N36 L;  3QOJ A;  2A74 C;  2XRQ D;  2PW7 A;  1STE A;  3I4M B;  4IFD J;  4L6T B;  1STY A;  4JI4 Q;  5HGQ A;  3M9B A;  1L0X B;  4JI1 L;  3GTQ H;  1QCB D;  2L9H A;  3K81 C;  4GKK L;  3GTL H;  5EPK A;  5IIF A;  4K8I A;  1QG7 A;  1W6J A;  3H0G B;  1AP0 A;  1Y1W G;  1QNK A;  2Z9H A;  2JA5 B;  1F9P A;  1A15 A;  1VQB A;  4KHZ A;  5ELF A;  4DV4 Q;  4IUR A;  1MIU A;  3KF8 B;  2YTV A;  4LFB L;  3CRK C;  1S5C D;  5M3M G;  2QDL A;  3K5N A;  4Z9C B;  4DAY B;  1EY5 A;  3TSS A;  3MEF A;  5M5X B;  1RKN A;  1I3Q B;  5LMU L;  3CCU A;  3EN2 A;  2QF7 A;  1II3 A;  5LMN W;  2PQA A;  1KXL A;  1AEX A;  2KBN A;  5IGG A;  1CZW A;  1AFP A;  1C48 A;  1V8Q A;  3GTM H;  3D4R A;  3TP8 A;  4HJ8 A;  4KKU A;  4IFD H;  2A68 C;  3K5M A;  3TME A;  1MJE A;  3GTG B;  1VQC A;  4JYA L;  1BDO A;  3FPP A;  4JBW A;  1PZK D;  2Q2I A;  3IAY A;  5E4X A;  1VQH A;  3DLL A;  2AMC B;  1HNZ L;  2K5N A;  1JB7 A;  3OMC A;  1R4P B;  1X3E A;  2B2T C;  5DEH A;  2F4I A;  5CMD A;  4JOI C;  3M4Y A;  4DUY L;  3FKI G;  4GN3 B;  1HHV A;  4I65 A;  3PCO B;  1OO9 B;  2WAC A;  2Z0S A;  4R8I A;  3S1R B;  1E3P A;  4A3K H;  1YNN C;  1X55 A;  3F2C A;  4NXM L;  2J4X A;  4APV A;  5KNB A;  4H13 C;  5JPN C;  1O78 A;  3QWN A;  4IN3 A;  3O13 A;  4A4I A;  2EYL A;  5KRU A;  2CQO A;  2RA4 A;  4LAA A;  2NN6 I;  3S2D B;  1VF7 A;  3A5U A;  1TWA B;  4GNX C;  3G71 A;  3IRB A;  4LF8 Q;  4DV7 Q;  3SK6 A;  4OON A;  1BQQ T;  3RD4 A;  1EZ8 A;  5D3I B;  1E24 A;  5CV9 A;  2LXJ A;  4KTA A;  5ELB A;  2N3S A;  3C1F A;  4HCS A;  4BBR B;  3UDF A;  2PNR C;  3R3O A;  1I4P A;  4V19 0;  3H3V I;  3E9I A;  4CDD C;  1I4X A;  4BA2 I;  1H9R A;  1B44 D;  1UWV A;  1VMP A;  2UXC L;  2TMP A;  4ABN A;  1MKH A;  2F0O A;  2KCN A;  3QB3 A;  4LF6 L;  1UAP A;  4ZAI A;  1SDF A;  4QMG A;  5FLM G;  1KRS A;  3D0F A;  2F0D A;  2JA6 B;  5NUC A;  3GTJ H;  4GLA C;  3EIV A;  4ZLT F;  4AH6 A;  5EBC A;  2ATW A;  3E5S A;  5KND A;  1NSN S;  5E7N A;  1HZA A;  5DLQ E;  4ZCK A;  3Q0A A;  1L2F A;  3GV6 A;  1I94 Q;  1YNJ C;  3VYT A;  3RR5 A;  1QNU A;  3S14 B;  1RTN A;  2E2J H;  3FPU B;  1PTO F;  4R1J A;  4X3S A;  1N36 Q;  2B63 G;  1AH9 A;  3GTM B;  2ZXP A;  1IBM Q;  3PF4 A;  5ELO A;  1JOO A;  2F0Q A;  1TKW B;  3OIQ A;  3GTG H;  1VQA A;  3CHB D;  4HED A;  5IGF A;  5C44 H;  4IPH A;  1GUS A;  1K9M C;  3HZX A;  2CVR A;  1LM0 A;  4B08 A;  2EXD A;  4DNT B;  4Q5V A;  4GN4 B;  3CU7 A;  4J1M A;  4YCV A;  2K5H A;  2G5D A;  5AJ3 L;  4L5S A;  4K2K A;  2EZV A;  3AFQ A;  2GVA A;  1ENA A;  4UP7 A;  1B2T A;  3OWF A;  3CC2 A;  1DXM A;  4QY7 A;  1PFS A;  1CK1 A;  2JN4 A;  1W6K A;  1F9R A;  3H3V C;  2FJ2 A;  2IX0 A;  1OXT A;  2ZTE A;  3Q6S A;  3I4N G;  3PSI A;  1NMF A;  1TWC B;  3BDC A;  3ICE A;  2XIW A;  3CAM A;  3JAM c;  5GAH C;  4UPA A;  1A8V A;  3PO3 H;  3KBG A;  2FXQ A;  5FLX L;  4GKJ L;  2K03 A;  1X3Q A;  5ISR A;  4OWW B;  4IPG A;  1G2T A;  1HTL D;  2CW0 C;  1S5B D;  4KMU C;  2K05 A;  3BVM A;  3J7A 5;  1GUT A;  1ICF B;  3M3Y H;  3JAM L;  4DV5 L;  3KBX A;  2PQE A;  2IJ0 A;  2LSS A;  1VQ8 A;  2Z4I A;  2RBM A;  3G48 A;  3TZU A;  4JV5 L;  4KKT A;  4PNY A;  1PTO C;  2NVY H;  3PUX A;  3U50 C;  2F0V A;  2R7Z G;  1KDB A;  4A3M H;  5EKI A;  2Q2H A;  2WII B;  2PZT A;  1V43 A;  2NVX H;  1CSP A;  4HSV A;  2HQL A;  3CRL C;  1SRO A;  2F3W A;  1TWF B;  1IBM L;  1Q46 A;  3T51 B;  1ASZ A;  3SDZ A;  1U0L A;  4YWL A;  1A3U A;  1P8L A;  1DGS A;  1FGB D;  4K0K L;  4IOA A;  4A3K G;  3H6M A;  1EQT A;  4JI5 L;  2JJQ A;  5C5M A;  4JI8 Q;  1MSH A;  2WAQ G;  4K6D A;  3S1M H;  1A2U A;  2VUM G;  1YEZ A;  3AU7 A;  4DV0 L;  1SJH D;  2Q2U A;  3KF6 B;  3I8Z A;  1QUQ A;  2YU9 B;  3HKZ G;  4C3H H;  1ET6 A;  1FYC A;  1MD2 D;  3A5Z B;  1Z9F A;  3WDN A;  3GTK H;  4A93 B;  2FMC A;  3J7Z C;  4CDF C;  4NXM Q;  3TP5 A;  1B9N A;  1GD7 A;  2HT1 A;  3GTO H;  1UEA B;  1YJW A;  1Y69 U;  4LF9 Q;  3OTO Q;  4B3S Q;  1OXX K;  1XNQ Q;  4HJ9 A;  3GV3 A;  2CH4 A;  1TS3 A;  1K83 B;  1IXR A;  3NK9 A;  3MFY A;  2NTS A;  2DY7 A;  2EYP A;  1A62 A;  4GZY C;  1H9M A;  5A2Q L;  5IYD G;  5IT9 E;  1S72 A;  2OTJ A;  1WVL A;  4P75 A;  2MPM A;  5KGU A;  1VQF A;  1YNN D;  2LFN A;  2K33 A;  3W3A A;  3KK7 A;  4XQJ A;  1N8R C;  3IL8 A;  4JYA Q;  2PI2 A;  1LLR D;  4ULL A;  2F0M A;  2NWG A;  4O42 A;  2K04 A;  4KY5 A;  4PZ7 A;  4JI5 Q;  3RN5 A;  5I4D A;  2X69 A;  3B6Y A;  2PNH A;  1BBU A;  4P74 A;  3M4O H;  1EIH A;  4X65 Q;  4C56 C;  2L55 A;  1X9N A;  2RDG A;  4B3S L;  1SFO H;  1VQD A;  3H0G G;  2I5H A;  1I6H H;  1LTA D;  1QZG A;  1KHI A;  3PIP 3;  3KJP A;  4IUV A;  1YZ6 A;  3I56 A;  3L9A X;  1MHW C;  1QZH A;  1V9P A;  1GO3 E;  2NVY B;  4DR7 Q;  1G2S A;  2PW5 A;  4NP5 A;  4EX5 A;  3GO5 A;  5CBA E;  2BH2 A;  2I46 A;  4A3L H;  3OPO A;  1G6Z A;  4PMW A;  4KY7 A;  4TKO B;  1A3V A;  3CC7 A;  1GOZ A;  2VS1 A;  5T1G A;  3G4S A;  1GVP A;  4A3E B;  4HAE A;  1Y8O B;  1BUV T;  2I5L X;  4NMZ A;  1FGU A;  4QUF A;  1X56 A;  4C3I G;  2EPB A;  1F2L A;  2UXB Q;  4DR4 L;  3S1M B;  1KTK A;  2QEJ C;  4FNF A;  1VS0 A;  4FVM A;  4KKS A;  4RA8 A;  5C0X G;  2YTY A;  1VQN A;  2A69 C;  2OT2 A;  3J81 c;  2F0J A;  3A0J A;  1GUN A;  3TRE A;  3NWS A;  3S17 H;  4WJW A;  3PQI A;  4R4T A;  1ZKO A;  5LHY 1;  1RIP A;  4OEM B;  2DNC A;  3OW2 A;  4JV5 Q;  3D4D A;  4YCW A;  1RDP D;  3BVG A;  5IP7 H;  2JA8 B;  1SYD A;  2CH4 W;  1CKM A;  3G7L A;  4DUZ L;  1B1Z A;  1BBW A;  3Q24 A;  2KED A;  1EWC A;  4X6A H;  3ITP A;  3BDO A;  3JC6 6;  3ND9 A;  1YHQ A;  1GUO A;  4JI4 L;  1WTR A;  4B3R Q;  4O0A A;  4A3F B;  1CFM A;  2R7D A;  1VQ4 A;  1XTC D;  1FD7 D;  3F8T A;  5CV4 A;  4UP8 A;  4AYB G;  4KK7 A;  4G7H C;  1FJG L;  3K7U C;  5EAY A;  2JEA I;  4GKJ Q;  4XIG S;  2JYO A;  5KYL A;  3FHW A;  1PFN A;  1G6P A;  4XXE A;  1B8A A;  2HHH L;  4PV1 C;  1WTQ A;  1EY6 A;  2CQA A;  5CC4 A;  2RSN A;  1PHJ A;  4Y7N H;  5C4X G;  1SJE D;  1GUW A;  4V0B A;  2K5W A;  3T13 A;  5C5L A;  3NUC A;  1CHP D;  3I7F A;  3KFU A;  1EUJ A;  4KI0 A;  3ZJY C;  5FO7 B;  3CF5 A;  4KY6 A;  1F77 A;  1OXS C;  4OIJ A;  2MJ8 A;  2PI2 E;  1QVC A;  5CV8 A;  1VF5 C;  4A3C H;  3BYY B;  1IW7 C;  1DJR D;  1CQV A;  4UP9 A;  2K1B A;  4KN4 C;  1SNC A;  3I4N H;  2EOT A;  2KVM A;  3CCQ A;  1LUZ A;  2XTI A;  4A3J G;  4RMF A;  2PYK A;  4FF4 A;  3HOW B;  2RVL A;  1ZYR D;  1O7Z A;  2ENB A;  4BY1 H;  4LF4 Q;  1KL9 A;  4DR3 Q;  3NTH A;  4YWM A;  3S1N B;  2KHJ A;  4ZQ3 A;  2N8N A;  4GOP C;  4N9T A;  4JG2 A;  2NZ1 D;  1XMQ L;  4JI0 L;  3C3L A;  2CWP A;  1JC7 A;  1SYC A;  1HXY D;  5E3F A;  5IY0 A;  1ESR A;  5KYI A;  2J0T D;  4X66 Q;  1QOH A;  2E2I B;  2NN6 G;  2KEE A;  5DAU A;  4RKB A;  2F0S A;  5KNC A;  4HIK A;  2ZT9 C;  5GRO A;  4P2C B;  2VNU D;  5G3L F;  3A8K E;  3BVZ A;  1EEF D;  5KIX A;  3QJY A;  2WIN B;  5COY A;  4K14 A;  3T1Y Q;  1ROD A;  3PIO A;  1EEI D;  4KJO A;  4EQO A;  5J22 A;  2E74 C;  2OF1 A;  1LV9 A;  4IPC A;  4J8Q A;  1UE6 A;  3G6J B;  2BDN A;  1MSG A;  4RHS A;  1AZQ A;  1HZ9 A;  4RKL A;  1RD9 D;  2EXZ A;  1K8O A;  4HMJ A;  1BO0 A;  3V2T A;  3TS0 A;  1YIJ A;  3L3O C;  4MIU A;  3SHL A;  3K0Y A;  5I6W A;  2OQK A;  2WB1 B;  4R4C A;  1AE3 A;  2WV6 D;  4DV3 Q;  2B2V C;  3STB C;  3CPW A;  2EY6 A;  1EY8 A;  3Q22 A;  1XJV A;  2N55 A;  1EU4 A;  3IFT A;  4LF8 L;  4BA1 I;  5IGC A;  1LT6 D;  1F2Y A;  1FL0 A;  1STH A;  1KNA A;  3S1Q B;  4DK3 C;  4A3J H;  1SRU A;  2KCM A;  3CQZ B;  1EZ6 A;  3STB D;  4JI8 L;  4GLV B;  2Z8L A;  5TSS A;  1XMQ Q;  2E2J B;  3E3X A;  1Y1V H;  4JPB W;  1EQR A;  4EQN A;  1TVX A;  2B8G A;  4WOR A;  1W2B A;  4DR3 L;  4LUV A;  2QA4 A;  5C44 B;  1DM0 B;  4DV1 L;  1BBX C;  3A7A B;  2Q8T A;  4F8M A;  2MQH A;  1YIT A;  4KN7 C;  1SSO A;  2MHV A;  2XGT A;  3AMU A;  2RHQ B;  4DU9 A;  2JA7 H;  3GTQ B;  4P73 A;  2HDL A;  3E9H A;  4LFB Q;  4ZYS A;  2A8V A;  1I50 H;  5M5W H;  4FXD A;  1JWM D;  1PFB A;  4UAI A;  3E0J A;  4S3S A;  3H0G H;  1E2V A;  1CI3 M;  1HQM C;  1HUN A;  4HJA A;  2WKC A;  1HUM A;  2E2D C;  2L11 A;  3VR2 A;  1C9O A;  1PH1 A;  1TWG H;  3RZO B;  2QGQ A;  2NVQ B;  4C3I B;  1W3S A;  4GLX A;  2A19 A;  3HG9 A;  3PMF A;  1ML0 D;  2R6G A;  1E0B A;  2X6G A;  1YJ9 A;  2D0P A;  4B9X A;  3SK4 A;  5K5P A;  1K73 C;  1SYB A;  2QW7 A;  2VQF L;  4ZUI A;  3J81 j;  3DWA A;  2E2H H;  3H09 A;  4CDC C;  2B2U C;  4HID A;  2JA9 A;  4DAM A;  5JPM C;  4ZKC B;  5IYC G;  4DKA C;  3ULL A;  1WOC A;  2K5Q A;  1HNW L;  1BKB A;  3KF8 A;  4FYD A;  1PV4 A;  3J81 E;  1JB3 A;  1DCZ A;  2DUD A;  3EFX D;  2AQ2 B;  2KCT A;  3PUZ A;  4IOC A;  1E22 A;  1PRT C;  2Y0S B;  2ZTD A;  2LY7 A;  1L1O B;  3I73 A;  1I6V C;  1EIY B;  1L0Y B;  1NTG A;  3ND8 A;  3DM1 A;  2F3V A;  1EWH A;  3T56 B;  5LL6 X;  1Q3L A;  1UEB A;  4DAP A;  2RQX A;  4LMQ D;  1BNZ A;  2X6L A;  4PZ8 A;  4DGZ A;  1B50 A;  1TS2 A;  1TR5 A;  4A3F G;  1DD2 A;  3P75 A;  4K5V A;  1BF4 A;  3BDL A;  1B53 A;  5E4W C;  4LWC A;  3TEH B;  4OO1 G;  1U4M A;  4L63 B;  1EY9 A;  3GTP B;  4POF A;  1NR2 A;  4HSP A;  2VUM H;  4A3K B;  3PO2 G;  2D0O A;  2R93 H;  3MFG A;  1TY0 A;  3OWE B;  4A75 A;  2MFI A;  3CQZ H;  2WAQ B;  1LT5 D;  2M9V A;  3NPP A;  4KHP Q;  4B3R L;  1JJ2 A;  3S2D H;  4BBR G;  4HN7 A;  1WTW A;  3W2D A;  4HCE A;  4H44 C;  1M8A A;  2CCZ A;  3S15 H;  1VQ5 A;  2GA4 B;  2R93 G;  2F0H A;  3FKI H;  1ZEQ X;  4GOP B;  3MXN A;  2O5J C;  1IZ6 A;  1EQQ A;  3E6Z X;  4P72 A;  1HFN A;  4BBS B;  1LYL A;  3DWQ A;  3A7L A;  1Q90 A;  3DEP A;  2E5L L;  3GTO B;  3HKS A;  1J5E Q;  2AUK A;  3MVV A;  2DJG C;  2EYF A;  4NDX A;  4B3T Q;  2C35 B;  2L1B A;  4A3I G;  1PZJ D;  2F0N A;  2EQS A;  2NVQ H;  3RZO H;  2JA6 H;  5D65 A;  2RHS B;  1IBL Q;  3K7A H;  1PRT F;  1S5E D;  2IY5 B;  3HOU H;  1I94 L;  1RJT A;  3L2P A;  2Y0S E;  2K4K A;  2VQE L;  4DV7 L;  1CKN B;  3AQQ A;  1WCM H;  4JBJ A;  5BR8 L;  4YY3 Q;  2Z6K C;  3AEV A;  5M3M H;  1Q1B A;  2RF4 A;  1XX8 A;  4JI3 Q;  3MXU A;  3HOY H;  5GAG C;  4IUQ A;  4U67 3;  1XPO A;  1BVS A;  5J1Z A;  2B2W A;  2UUC Q;  2K14 A;  4ID6 A;  1SNM A;  3X3M A;  4OL7 A;  1JCK B;  1WTV A;  1Y8P B;  5COR A;  2B3G A;  4F7X A;  5C4Z A;  4JI2 L;  4ODG A;  1Q8I A;  3LWU A;  1AZP A;  1XNQ L;  1PXU A;  5IWA L;  1Q7Y C;  4DUY Q;  1K8M A;  4L5R C;  1R4Q B;  4XDX A;  3M7G A;  5M9O A;  1KDA A;  4X62 L;  2H1E A;  1VQG A;  4OIK A;  1PMR A;  2B2Y C;  3T1H Q;  4YY3 L;  4BWG B;  2K5D A;  1N32 L;  3SE0 A;  1CT1 D;  3PUW A;  1K3R A;  4TVA B;  1TT2 A;  4FF2 A;  1N32 Q;  1PH5 A;  1EL0 A;  2VUM B;  3ERQ A;  3L7Z C;  4NKL A;  2K7V A;  2VB2 X;  3J80 L;  3WOE A;  4HIO A;  4CKE A;  4LK1 C;  5LL6 S;  3CKI B;  4LUO A;  1Q81 C;  2WAQ E;  2AKW B;  1PH9 A;  4DN4 M;  2NB0 A;  1J8I A;  2UUC L;  2EJF C;  5CR3 A;  4C3J H;  1IKL A;  3MZ5 A;  1C4Q A;  3SR1 A;  4ME5 A;  2JA8 G;  4BBS H;  5I9P A;  5C3E G;  3M3Y B;  5M3F G;  2Z4H A;  3MXN B;  1X3F A;  3D8G A;  4G7Z C;  1RF2 D;  1H95 A;  1VQO A;  1WD1 A;  2BCO A;  1SE3 A;  2E76 C;  2B39 A;  4ALP A;  4IQZ A;  2IL8 A;  4CDE C;  4DR2 L;  1K8A C;  4ZRZ A;  2NZO A;  1JR0 D;  2ZJP A;  4A3F H;  1LT4 D;  1IBK L;  5JEA G;  3RZD H;  1PTO B;  1PDQ A;  3T1H L;  1STA A;  2B2T A;  1NCV A;  4IPD A;  4XYQ A;  1RHP A;  2OQ0 A;  3GTJ B;  4GN5 A;  2R7F A;  4IJH A;  1QWY A;  1D5Z C;  5ELD A;  1PRT B;  2K32 A;  1PYW D;  3UDG A;  1FNU A;  2G9H D;  3OW7 A;  1VMC A;  3FRP B;  2Z6B A;  3S9W A;  3S2H B;  3HOY B;  4MTK A;  1CQF A;  1UUP A;  2SNS A;  5K36 H;  3CCR A;  1MI2 A;  2YTX A;  1QE6 A;  4RGM A;  4X3T A;  4C3H B;  1Y8N B;  1T5E A;  1M90 C;  3BJU A;  3TS2 A;  1QJO A;  3OSO A;  3NEN A;  2OCE A;  1X6O A;  4LW1 A;  2JK8 A;  1SE2 A;  3VR5 A;  4NW2 A;  3TN2 A;  2UUB L;  2O5I C;  1PLF A;  1ASY A;  1PH2 A;  1Q82 C;  3I4N B;  1KLG D;  3CME A;  5CGK A;  1IHZ A;  1O7L A;  2IWH A;  3W1B A;  3HRZ C;  3I4L A;  3IKJ A;  1K28 A;  4BY1 B;  4H02 A;  1WJJ A;  2NN6 H;  5CBE E;  2VQF Q;  3T4A C;  2VB3 X;  4AQY L;  4RGN A;  3WWV A;  1PH7 A;  4DV2 L;  5EBD A;  1CUK A;  5C4X H;  3F2B A;  3TP7 A;  1NJI C;  3KLS A;  1ESF A;  2F03 A;  2IHF A;  4TQU S;  3CCE A;  4K5W A;  1SNP A;  2A1A A;  2A6E C;  2HQE A;  1STN A;  4QF4 A;  2L15 A;  1GHJ A;  4GOP A;  1SMY D;  1YBY A;  2QDB A;  3FP9 A;  1T9H A;  2R61 A;  3U9S A;  3MXG A;  3VYU A;  3PO3 B;  4PQX A;  5FOB B;  4KJN A;  1PH8 A;  2I0Q A;  1Y1V G;  2A68 D;  1C7Y A;  3M4O B;  4ZUJ A;  2ICI A;  3R2T A;  4BXX G;  3KDF A;  1TWH B;  4JI7 Q;  5HUR A;  1VQ6 A;  1EWI A;  1E2W A;  1A63 A;  2R7Z B;  3CCS A;  5CV5 A;  2BE5 C;  4XQN A;  1CA6 A;  4DPG A;  2CKZ B;  3K0X A;  1SXT A;  3NP8 A;  3TP6 A;  2DJF C;  4K2L A;  3FEW X;  1V1O A;  3BZC A;  2OTL A;  3Q8D A;  1EOV A;  4DK6 C;  1Q12 A;  1I4R A;  1B7Y B;  3H91 A;  5C0X H;  1CKN A;  3CXC A;  2LKV A;  3EQL C;  1J9O A;  2VXW A;  1LTB D;  2ALY B;  3RUZ A;  3A74 A;  3F1Z A;  4BY7 H;  1TWF H;  1GJX A;  1E1T A;  4RH6 A;  1B3Q A;  1I4H A;  2TSS A;  2K50 A;  1IYJ B;  1Y1V B;  4J6H A;  1SYF A;  4R9W A;  3FDT A;  1HFG A;  4XYO A;  1D7Q A;  2ZJQ A;  1I4G A;  4RCO A;  4HJ5 A;  1C8C A;  2AQ3 B;  3OMG A;  4X64 L;  2AWN A;  2WKD A;  3NHH A;  4YWK A;  3UDX A;  3H3V H;  4GS3 A;  4CBV A;  5EKK A;  2EDG A;  1WTH A;  3KDF B;  1F9S A;  2NTT A;  4EQP A;  1JE4 A;  5BN4 A;  3VDY A;  2JA6 G;  1JOQ A;  2ZXR A;  2EYH A;  4DV6 Q;  1BCP F;  1CZG A;  2EY1 A;  3GTK B;  4RHR A;  4A93 H;  2JA8 H;  5GAE C;  2EYM A;  4DNR B;  3VR6 A;  2Q8I B;  4FP5 D;  3UE1 A;  1ET9 A;  4IUP A;  1UE7 A;  5JVH 3;  2KOL A;  2HCC A;  4X66 L;  3NTK A;  4C3I H;  1B9M A;  4JI0 Q;  3ER0 A;  1C0A A;  2FHT A;  1F2M A;  4LNQ A;  1VQE A;  3HP3 A;  2R92 H;  2KQ3 A;  5FKA C;  5F2D A;  3MTS A;  5I2X A;  1Y1W H;  4KD3 A;  4K0K Q;  1B3A A;  2BA0 A;  1WD0 A;  5EQ0 A;  3CCV A;  3M4Q A;  5IT9 c;  2MNA A;  2E2H B;  1A2T A;  1GM5 A;  3OTO L;  2HIX A;  4JVZ A;  2F0K A;  3HOZ B;  2F3I A;  2YV5 A;  1JJC B;  3NEM A;  5IGE A;  4FF1 A;  2H4O A;  2MO0 A;  1IYV A;  2M00 A;  3CCL A;  1YJN A;  1SYE A;  1HH2 P;  1EIF A;  2K5V A;  1XNR L;  3J7A F;  4TRD A;  4A3B H;  4R8N A;  1CM9 A;  5I6Y A;  2JA5 G;  2WP8 J;  1HA5 A;  4IUT A;  4JC0 A;  2R3Z A;  1BR9 A;  1K3B C;  3HOW G;  1RTO A;  2FMM A;  3I91 A;  1KDC A;  2VQE Q;  3ULP A;  1YHB A;  3UI2 A;  4GKK Q;  3LGJ A;  4RCN A;  2KCC A;  1I6H B;  2KA7 A;  3KYH C;  2JE6 I;  4DV5 Q;  5GQO A;  4IFD I;  1FR3 A;  3GP7 A;  3R2I A;  4CJ0 B;  5FO9 B;  2B2U A;  3HKZ B;  1WTX A;  2DN8 A;  4LF4 L;  2A73 B;  3NTI A;  3ULJ A;  1JOR A;  1R9T H;  3HOV H;  3RNU A;  3HEJ A;  4JW0 A;  1KAW A;  3VA5 A;  1BCP C;  3DHQ A;  1ONL A;  3NQT A;  2BOS A;  3HOU G;  5FK9 C;  3P1H A;  2E2I H;  2UUB Q;  3J81 i;  1BOS A;  2ZM6 Q;  3PUV A;  1XMO Q;  1QVF A;  2BH8 A;  1S5F D;  2PO4 A;  1D8L A;  4A3I H;  1XTD A;  4J15 A;  5LMN Q;  5LMN L;  1K8G A;  4PMC A;  4JOI A;  1CSQ A;  3C2P A;  2KEC A;  5HY6 A;  2CWA A;  4JI1 Q;  2JQO A;  1EY0 A;  2KHI A;  1NUC A;  3H94 A;  4Y52 H;  3MXP A;  2R92 G;  4JK1 C;  1S5D D;  3I70 A;  3CCJ A;  1KQS A;  3BZD B;  3S17 B;  1I4Q A;  4OO1 I;  2HHH Q;  3GTL B;  3VYR A;  2HIV A;  4NXN Q;  2E75 C;  2RDF A;  4IUN A;  5FLX E;  2JA5 H;  2UXB L;  4X3K A;  3I3C A;  4H0L C;  2F0E A;  3I2Z A;  3HOU B;  1DON A;  3ERS X;  4HTH A;  2EYJ A;  3PV0 A;  1SE8 A;  1SMX A;  1I3Q H;  3SEB A;  3S1Q H;  5T1I A;  1FVI A;  4DUZ Q;  1N34 Q;  4A3M G;  1XMO L;  3HOZ H;  4RGT A;  2VL6 A;  5C3E B;  2F52 A;  4UY8 C;  3D6C A;  1H9S B;  3HOY G;  1HNW Q;  2EJM A;  4Y7N B;  4RG1 A;  4C3H G;  3K5O A;  2F4V L;  1YVC A;  3DXJ C;  1JWS D;  5EPJ A;  4OWT B;  1HR0 W;  1D5M C;  3FVQ A;  2UXC Q;  1QVG A;  1ILP A;  3VR3 A;  1X32 A;  5M5W B;  3A54 A;  4RWS C;  1IBK Q;  1EU3 A;  1LTG D;  3NXW A;  1D5X C;  2XN9 C;  3BZK A;  4QJF A;  3X3N A;  4RGO S;  5EJW A;  1WI5 A;  2QCP X;  3CCM A;  4DR1 L;  4QCL A;  2XWB B;  1A3T A;  5A35 A;  2JSO A;  5GAD C;  2F1M A;  4A3D H;  4F87 A;  4LF5 Q;  4C2M H;  1DOL A;  4WFN 3;  4BXX H;  1OXV A;  4QL5 A;  2OXP A;  1N33 Q;  3WOF A;  3C46 A;  4DV6 L;  1HA6 A;  1YNX A;  1FNV A;  1SE4 A;  2UUA L;  1HCZ A;  3OHX C;  2NVT B;  4LF6 Q;  3MA2 B;  4MZ9 A;  3EJI A;  3KLS X;  1KAB A;  2O2L D;  1GKH A;  2P5Z X;  4H7B A;  4BBR H;  1ZXT A;  4HMI A;  4IAL A;  5D14 A;  2VW9 A;  1LTT D;  2K6A A;  5IT9 L;  3I4M H;  1S40 A;  5IP9 G;  3PO2 H;  4BY1 G;  1CTM A;  3N6R A;  5I2Y A;  4QUC A;  5C3W A;  1E1O A;  3J80 c;  1XPU A;  4OO1 H;  3ERO A;  4FDB A;  4DF7 A;  4DV0 Q;  1OXU A;  3VYS A;  2B63 H;  3CD6 A;  2WB1 E;  1PTO H;  3M7N A;  5IGB A;  1IBL L;  3TQY A;  3SVM A;  5IYB G;  4QGU A;  3GTP H;  1VQI A;  2GVB A;  3UDI A;  1HTP A;  4I7Z C;  2L5T A;  3QIA A;  4LFC L;  4EGV A;  1JJG A;  3KJO A;  3D31 A;  1U9R A;  1Z6H A;  4GNX B;  3F2D A;  3U9O A;  2F4V Q;  1DYQ A;  2UUA Q;  3C1E A;  5C3E H;  2KUM A;  2IPK D;  5CYU A;  4C3J G;  4C1N K;  1V1P A;  4TSS A;  1D6E C;  3FKI B;  2RSO A;  4KLK A;  2F0P A;  1HPC A;  3QOL A;  2AQ1 B;  2OWO A;  3JAM E;  1VQK A;  1WFQ A;  4DA2 A;  1N9W A;  3KLW A;  4YHH Q;  1EYG A;  4G57 A;  2AUJ D;  4CHT B;  4FF3 A;  1NNX A;  1X3G A;  1L0W A;  3DM3 A;  2JA7 B;  2RCF A;  1H9K A;  3T16 A;  1LAB A;  3BS1 A;  4FXG C;  1VQL A;  1EYA A;  1I50 B;  1DOK A;  3U58 A;  4NXN L;  1KC8 C;  3I4M G;  3NBH B;  3CPF A;  2VZA A;  3DMU A;  1Q1E A;  4QIW E;  4C2M B;  4JI6 Q;  4XQQ A;  5L37 A;  5C4X B;  4WJ3 M;  4BBS G;  3D6W A;  1TWC H;  5AFW A;  4LF7 L;  4OX9 L;  2A6H D;  5FLM H;  1PA6 A;  3OIP A;  2RDH A;  2PPB C;  1YHA A;  2ZTC A;  3SXH A;  2NVT H;  1ENF A;  4YIJ A;  4PMB A;  3N52 A;  5M3M B;  3CMA A;  4G7O C;  2M2L A;  1V1Q A;  3TDQ A;  1AE2 A;  2A6H C;  5JEA H;  5C4J H;  4DXF A;  4KHP L;  4A3E G;  2JP1 A;  3H15 A;  3HOX B;  1TWH H;  2O4X A;  2JXM B;  3TZD A;  1NMG A;  3RMH A;  4A3L G;  1EYC A;  1VQ9 A;  2N49 A;  1PH4 A;  1SEB D;  1AW7 A;  4DR5 Q;  3NQI A;  5D3D A;  1QUQ B;  3A55 A;  5ELE A;  3ZYY X;  3D3R A;  3BU2 A;  1BCP D;  5FLX c;  2B63 B;  1S4Z A;  3CC4 A;  1NE3 A;  2KEN A;  1VQM A;  3R8B A;  3VA7 A;  1J6Q A;  1X3P A;  1WTP A;  4DXG A;  1VQ7 A;  1X65 A;  1LT3 D;  4F88 A;  3LNN A;  2FFK B;  2R93 B;  4LF7 Q;  1EQV A;  3EVQ A;  3S16 B;  2C5C A;  4DR6 Q;  3J7A V;  3G6E A;  3S14 H;  1E7Z A;  3EBE A;  1WCM G;  3RN2 A;  1JMC A;  1JT8 A;  1HNX L;  1LTL A;  1L1O A;  3S15 B;  2YU9 H;  4C3J B;  4HJ7 A;  4CKC A;  4B3M Q;  3J81 L;  4B9W A;  1V1P B;  1MBY A;  4X65 L;  1HZC A;  2Q8R E;  2EIF A;  4KV6 A;  2IW3 A;  4IUU A;  1G29 1;  1WTO A;  2NYZ D;  2LXK A;  4O1N A;  2SOB A;  4YHH L;  2NUC A;  2DNE A;  2RKS A;  1KAA A;  2ASB A;  2K01 A;  4P71 A;  4M8A A;  3KF6 A;  2L4N A;  1B4O A;  1NAP A;  3I72 A;  1HRJ A;  1MGS A;  1YI2 A;  2ID0 A;  2ES2 A;  2F0I A;  4CKB A;  4UDU C;  4N8X 1;  4QB4 A;  3J7Y W;  3K80 C;  1WYD A;  4X62 Q;  1Y1W B;  4CJ2 C;  1U4L A;  3K7A B;  3ONA B;  3HOZ G;  4A3C G;  3MHB A;  3PIP A;  4DV1 Q;  1KRT A;  3HS0 C;  3MWY W;  2UXD Q;  2CFM A;  1QB5 D;  5KEE A;  1XYI A;  2XWJ B;  3VR4 A;  3URY A;  1EOT A;  1PYS B;  4EVO A;  3M85 A;  1PYB A;  2E8G A;  1VDZ A;  4WRD A;  4DK1 A;  1Y14 B;  1RCV D;  1IL8 A;  1WCM B;  2IX1 A;  1DOM A;  1H9S A;  3NE5 B;  4C1N I;  5C4J B;  1N33 L;  3GDE A;  5JJL A;  1ILQ A;  2IHE A;  1G8Z D;  5JEA J;  5C3X A;  1TS5 A;  2B2Y A;  4LF5 L;  4O2D A;  4LJZ C;  4RAU C;  2K75 A;  4LFA L;  5BN3 A;  1UNS A;  4NPS A;  5I9O A;  5JAV A;  3I90 A;  2MUY A; 
#chains in the Genus database with same CATH homology
 2SDF A;  3DWP A;  2A6E D;  2LS0 1;  1IYU A;  2ZXO A;  4DK0 A;  4K6L A;  1DZ1 A;  1R9T B;  3HOV B;  4A3M B;  2BDO A;  1SBB B;  3A8I E;  3P20 A;  3K58 A;  5IGD A;  4ZKB B;  1SMY C;  2MP1 A;  1JWU D;  2BE5 D;  2EJG C;  4RFB A;  1SYG A;  4A3I B;  1F9Q A;  1TII D;  4ILW A;  3KLR A;  2SNM A;  2XNA C;  2F0W A;  4M1U B;  1O80 A;  2QIL A;  2N88 A;  3RLF A;  1TS4 A;  3A8J E;  3HGB A;  1NR4 A;  1SND A;  2HUG A;  5DM7 3;  2BA1 A;  1PZI D;  3IFD A;  3GQB A;  4XT3 B;  5C0X J;  2L0C A;  1LAC A;  4DFA A;  3OOC A;  4ZK9 B;  1TY2 A;  3RZD B;  1EFI D;  3MEH A;  1CHQ D;  2FIN B;  1YNJ D;  1E2Z A;  5HGT A;  1KLU D;  2HCI A;  1CA5 A;  1LO5 D;  3SK8 A;  3BG3 A;  3PIO 3;  3MAQ A;  1XWE A;  5IOC A;  4MN3 A;  1SNQ A;  4AYB B;  3V96 A;  2B2V A;  4QIW B;  4MHE A;  3V05 A;  1SFO B;  4G4K A;  1PRT D;  3SK5 A;  1IW7 D;  3R93 A;  1BXT A;  5J39 A;  2F0L A;  2EE1 A;  2F0G A;  2D9U A;  3K57 A;  2QKI C;  1GXD C;  4A3D B;  2PZU A;  1FNW A;  1ZYR C;  5M3F B;  3A56 A;  5C0X I;  4L8J A;  2CHB D;  5C6A A;  3QG1 A;  2DY8 A;  2K28 A;  2J7Z A;  3NSW A;  4XTC S;  1LTS D;  5C4H A;  4DAY A;  1EIG A;  2CW0 D;  3PUY A;  5EKL A;  2F0U A;  4K5X A;  1G91 A;  2D5D A;  1T5X D;  3AB9 A;  4XT1 B;  5DM6 3;  4K8J A;  1TU2 B;  4FO2 A;  1PFM A;  3QO2 A;  3PO2 B;  1A6X A;  1ICW A;  1EY4 A;  2JEB I;  4KD4 A;  4N9P A;  1AN8 A;  2C9O A;  2MGS A;  2B8F A;  3MC0 B;  2IX3 A;  2F0T A;  4OHJ A;  2HDM A;  5DNF A;  2LMC B;  2NBF A;  1XXG A;  3T53 B;  3DUZ A;  4X3U A;  5G3L D;  4E6I A;  1JOK A;  2NVX B;  1TQO A;  4IZ8 A;  5ELC A;  5K36 G;  4BY7 B;  2EYO A;  4BS9 A;  4FXK C;  5JVG 3;  4KHV A;  1BCP B;  1VCI A;  2A69 D;  1STG A;  1U4R A;  1JQY D;  3KUP A;  2XSC A;  1EY7 A;  3D4W A;  1JIC A;  1SAP A;  3J80 E;  5CV7 A;  4OGQ C;  1D1K A;  4Q0F A;  3NBH A;  3LWE A;  1D2B A;  2PMZ B;  1HQR D;  1GHK A;  1TWG B;  1Z7T A;  3LX0 A;  5E1F A;  2V4D A;  1F2Z A;  3TBI B;  1STB A;  5FO8 B;  2R92 B;  1GUG A;  3Q23 A;  2D62 A;  2I07 B;  2KHS A;  5EPL A;  2G9D A;  3NWT A;  2ICE C;  1Z47 A;  2D2C C;  3F2U A;  1IKM A;  1LTI D;  1KNE A;  2EY2 A;  2EY5 A;  4CJ1 B;  2XVS A;  1U4P A;  4A3B B;  3BYT B;  1EYD A;  1LTR D;  4CGY B;  4HR7 B;  2Z1C A;  2YYZ A;  4U68 A;  5JOB A;  4IFD G;  2F0F A;  3K6O A;  3EA6 A;  1ENC A;  1PTO D;  1QIL A;  2PCF B;  3GD7 A;  3DEO A;  2IT1 A;  3K59 A;  1SNO A;  1O7Y A;  4DAV A;  5BN5 A;  2L12 A;  4A3G B;  2AWO A;  2SEB D;  5A2Q E;  2KJX A;  2EVB A;  4A3J B;  1M4V A;  5JJZ A;  2PZW A;  5CV6 A;  1H9J A;  2OEO A;  3FMC A;  2A5H A;  2B2W C;  2XRS D;  3P7J A;  5EGT A;  5IOD A;  3NBI A;  5M5Y B;  1D1I A;  3K5L A;  3QOJ A;  2A74 C;  2XRQ D;  2PW7 A;  1STE A;  3I4M B;  4IFD J;  4L6T B;  1STY A;  1L0X B;  1QCB D;  2L9H A;  5EPK A;  5IIF A;  4K8I A;  1QG7 A;  1W6J A;  3H0G B;  1AP0 A;  1QNK A;  2JA5 B;  1F9P A;  1A15 A;  4KHZ A;  5ELF A;  4IUR A;  3CRK C;  1S5C D;  3K5N A;  4Z9C B;  1EY5 A;  3TSS A;  5M5X B;  1RKN A;  1I3Q B;  2QF7 A;  1II3 A;  1AEX A;  5IGG A;  1CZW A;  1AFP A;  1C48 A;  1V8Q A;  3D4R A;  3TP8 A;  4KKU A;  4IFD H;  2A68 C;  3K5M A;  3TME A;  3GTG B;  1BDO A;  3FPP A;  4JBW A;  1PZK D;  3IAY A;  5E4X A;  3OMC A;  1R4P B;  5DEH A;  2B2T C;  2F4I A;  5CMD A;  3M4Y A;  1HHV A;  4I65 A;  1OO9 B;  2WAC A;  3S1R B;  4R8I A;  1YNN C;  2J4X A;  5KNB A;  4H13 C;  5JPN C;  1O78 A;  3QWN A;  4IN3 A;  3O13 A;  2EYL A;  5KRU A;  2RA4 A;  4LAA A;  2NN6 I;  3S2D B;  1VF7 A;  1TWA B;  3SK6 A;  1BQQ T;  3RD4 A;  1EZ8 A;  5D3I B;  5CV9 A;  4KTA A;  5ELB A;  3C1F A;  4HCS A;  4BBR B;  2PNR C;  3R3O A;  1I4P A;  4V19 0;  1I4X A;  4BA2 I;  1H9R A;  1B44 D;  1VMP A;  2TMP A;  4ABN A;  2F0O A;  2KCN A;  3QB3 A;  1UAP A;  4ZAI A;  1SDF A;  4QMG A;  2F0D A;  2JA6 B;  5NUC A;  4ZLT F;  5EBC A;  3E5S A;  5KND A;  1NSN S;  3Q0A A;  3GV6 A;  1YNJ C;  3VYT A;  1QNU A;  3S14 B;  1RTN A;  3FPU B;  1PTO F;  4X3S A;  3GTM B;  2ZXP A;  1JOO A;  2F0Q A;  1TKW B;  3OIQ A;  3CHB D;  4HED A;  5IGF A;  1GUS A;  3HZX A;  2CVR A;  4B08 A;  4DNT B;  4Q5V A;  3CU7 A;  4J1M A;  4K2K A;  2EZV A;  1ENA A;  1B2T A;  3OWF A;  1DXM A;  1CK1 A;  1W6K A;  1F9R A;  3H3V C;  2FJ2 A;  2IX0 A;  1OXT A;  3Q6S A;  1TWC B;  3BDC A;  2XIW A;  3KBG A;  5FLX L;  2K03 A;  1X3Q A;  5ISR A;  1G2T A;  1HTL D;  2CW0 C;  1S5B D;  4KMU C;  2K05 A;  3BVM A;  1GUT A;  3JAM L;  3KBX A;  2PQE A;  2IJ0 A;  2Z4I A;  2RBM A;  3TZU A;  4KKT A;  4PNY A;  1PTO C;  3PUX A;  2F0V A;  1KDB A;  5EKI A;  2WII B;  2PZT A;  1V43 A;  4HSV A;  3CRL C;  2F3W A;  1TWF B;  3T51 B;  3SDZ A;  1A3U A;  1FGB D;  3H6M A;  1EQT A;  5C5M A;  1MSH A;  4K6D A;  1A2U A;  3AU7 A;  1SJH D;  3I8Z A;  2YU9 B;  1ET6 A;  1FYC A;  1MD2 D;  3WDN A;  4A93 B;  2FMC A;  3TP5 A;  1B9N A;  1UEA B;  1Y69 U;  1OXX K;  3GV3 A;  1TS3 A;  1K83 B;  3NK9 A;  3MFY A;  2NTS A;  2DY7 A;  2EYP A;  4GZY C;  1H9M A;  5A2Q L;  5IT9 E;  1WVL A;  2MPM A;  5KGU A;  1YNN D;  2LFN A;  2K33 A;  3W3A A;  3KK7 A;  4XQJ A;  3IL8 A;  1LLR D;  4ULL A;  2F0M A;  2NWG A;  4O42 A;  2K04 A;  4KY5 A;  5I4D A;  2X69 A;  1EIH A;  4C56 C;  2L55 A;  2RDG A;  1LTA D;  3PIP 3;  4IUV A;  3L9A X;  2NVY B;  1G2S A;  2PW5 A;  4NP5 A;  3GO5 A;  5CBA E;  2I46 A;  3OPO A;  1G6Z A;  4PMW A;  4KY7 A;  4TKO B;  1A3V A;  1GOZ A;  5T1G A;  4A3E B;  4HAE A;  1Y8O B;  1BUV T;  4NMZ A;  4QUF A;  4C3I G;  2EPB A;  1F2L A;  3S1M B;  1KTK A;  2QEJ C;  4FNF A;  4FVM A;  4KKS A;  4RA8 A;  5C0X G;  2A69 C;  2OT2 A;  2F0J A;  1GUN A;  3NWS A;  4WJW A;  1ZKO A;  5LHY 1;  2DNC A;  3D4D A;  1RDP D;  3BVG A;  2JA8 B;  1SYD A;  3G7L A;  1B1Z A;  3Q24 A;  2KED A;  1EWC A;  3ITP A;  3BDO A;  3ND9 A;  1GUO A;  1WTR A;  4A3F B;  1CFM A;  1XTC D;  1FD7 D;  5CV4 A;  4KK7 A;  4G7H C;  2JEA I;  4XIG S;  2JYO A;  5KYL A;  1PFN A;  4XXE A;  4PV1 C;  1WTQ A;  1EY6 A;  2CQA A;  5CC4 A;  2RSN A;  1SJE D;  1GUW A;  4V0B A;  2K5W A;  3T13 A;  5C5L A;  3NUC A;  1CHP D;  4KI0 A;  5FO7 B;  4KY6 A;  1F77 A;  1OXS C;  4OIJ A;  2MJ8 A;  5CV8 A;  1VF5 C;  3BYY B;  1IW7 C;  1DJR D;  1CQV A;  2K1B A;  4KN4 C;  1SNC A;  2EOT A;  2KVM A;  2PYK A;  4FF4 A;  3HOW B;  2RVL A;  1ZYR D;  1O7Z A;  2ENB A;  3NTH A;  3S1N B;  4ZQ3 A;  4N9T A;  2NZ1 D;  3C3L A;  1SYC A;  5KYI A;  1JC7 A;  1HXY D;  5E3F A;  1ESR A;  2J0T D;  1QOH A;  2E2I B;  2NN6 G;  2KEE A;  5KNC A;  4RKB A;  2F0S A;  5DAU A;  2ZT9 C;  4P2C B;  2VNU D;  5G3L F;  3A8K E;  3BVZ A;  5KIX A;  1EEF D;  3QJY A;  2WIN B;  5COY A;  4K14 A;  1ROD A;  1EEI D;  4KJO A;  4EQO A;  5J22 A;  2E74 C;  2OF1 A;  1LV9 A;  4J8Q A;  3G6J B;  2BDN A;  1MSG A;  4RHS A;  1AZQ A;  1K8O A;  4RKL A;  1RD9 D;  2EXZ A;  4HMJ A;  1BO0 A;  3V2T A;  3L3O C;  4MIU A;  3SHL A;  3K0Y A;  5I6W A;  2WB1 B;  2WV6 D;  2B2V C;  2EY6 A;  1EY8 A;  3Q22 A;  2N55 A;  1EU4 A;  3IFT A;  4BA1 I;  5IGC A;  1LT6 D;  1F2Y A;  1STH A;  1KNA A;  3S1Q B;  3CQZ B;  1EZ6 A;  5TSS A;  2Z8L A;  2E2J B;  4EQN A;  1TVX A;  2B8G A;  4WOR A;  5C44 B;  1DM0 B;  1BBX C;  3A7A B;  2Q8T A;  4F8M A;  4KN7 C;  1SSO A;  2MHV A;  3AMU A;  4DU9 A;  3GTQ B;  2HDL A;  4ZYS A;  4FXD A;  1JWM D;  1PFB A;  4UAI A;  3E0J A;  4S3S A;  1E2V A;  1CI3 M;  1HQM C;  1HUN A;  2WKC A;  1HUM A;  2E2D C;  2L11 A;  3VR2 A;  3RZO B;  2NVQ B;  4C3I B;  3HG9 A;  3PMF A;  1ML0 D;  2R6G A;  1E0B A;  2X6G A;  4B9X A;  3SK4 A;  5K5P A;  1SYB A;  4ZUI A;  3DWA A;  3H09 A;  2B2U C;  5JPM C;  4ZKC B;  2K5Q A;  3KF8 A;  4FYD A;  3J81 E;  1JB3 A;  1DCZ A;  3EFX D;  2AQ2 B;  3PUZ A;  1PRT C;  2Y0S B;  2LY7 A;  3I73 A;  1I6V C;  1L0Y B;  3ND8 A;  3DM1 A;  2F3V A;  1EWH A;  3T56 B;  5LL6 X;  1Q3L A;  4DAP A;  2RQX A;  4LMQ D;  1BNZ A;  2X6L A;  4DGZ A;  1B50 A;  1TS2 A;  1TR5 A;  1DD2 A;  3P75 A;  4K5V A;  1BF4 A;  3BDL A;  1B53 A;  5E4W C;  4OO1 G;  1U4M A;  4L63 B;  1EY9 A;  3GTP B;  1NR2 A;  4HSP A;  4A3K B;  3MFG A;  1TY0 A;  3OWE B;  2WAQ B;  1LT5 D;  2M9V A;  3NPP A;  4HN7 A;  1WTW A;  3W2D A;  4HCE A;  4H44 C;  1M8A A;  2GA4 B;  2F0H A;  1ZEQ X;  3MXN A;  2O5J C;  3E6Z X;  1HFN A;  4BBS B;  3DWQ A;  3A7L A;  1Q90 A;  3DEP A;  3GTO B;  2AUK A;  3MVV A;  2EYF A;  4NDX A;  2L1B A;  1PZJ D;  2F0N A;  5D65 A;  1S5E D;  1PRT F;  1RJT A;  1Q1B A;  1XX8 A;  3MXU A;  4IUQ A;  4U67 3;  5J1Z A;  2B2W A;  4ID6 A;  1SNM A;  3X3M A;  4OL7 A;  1JCK B;  1WTV A;  1Y8P B;  5COR A;  4F7X A;  5C4Z A;  4ODG A;  1Q8I A;  3LWU A;  1AZP A;  1PXU A;  1K8M A;  1R4Q B;  4XDX A;  3M7G A;  5M9O A;  1KDA A;  2H1E A;  4OIK A;  1PMR A;  2B2Y C;  4BWG B;  2K5D A;  3SE0 A;  1CT1 D;  3PUW A;  1TT2 A;  4FF2 A;  1EL0 A;  2VUM B;  3ERQ A;  3L7Z C;  4NKL A;  2K7V A;  2VB2 X;  3J80 L;  3WOE A;  4CKE A;  4LK1 C;  5LL6 S;  3CKI B;  4DN4 M;  2NB0 A;  1J8I A;  2EJF C;  5CR3 A;  1IKL A;  3MZ5 A;  1C4Q A;  3SR1 A;  4ME5 A;  5I9P A;  3M3Y B;  2Z4H A;  3D8G A;  4G7Z C;  1RF2 D;  1WD1 A;  2BCO A;  1SE3 A;  2E76 C;  2B39 A;  4IQZ A;  2IL8 A;  4ZRZ A;  1JR0 D;  1LT4 D;  5JEA G;  1PTO B;  1PDQ A;  1STA A;  2B2T A;  1NCV A;  4XYQ A;  1RHP A;  3GTJ B;  1QWY A;  1D5Z C;  5ELD A;  1PRT B;  2K32 A;  1PYW D;  1FNU A;  2G9H D;  3OW7 A;  1VMC A;  3FRP B;  3S9W A;  3S2H B;  3HOY B;  1CQF A;  1UUP A;  2SNS A;  5K36 H;  1MI2 A;  1QE6 A;  4RGM A;  4X3T A;  4C3H B;  1Y8N B;  1T5E A;  1QJO A;  3OSO A;  1SE2 A;  3VR5 A;  4NW2 A;  3TN2 A;  2O5I C;  1PLF A;  3I4N B;  1KLG D;  5CGK A;  1IHZ A;  1O7L A;  2IWH A;  3HRZ C;  3I4L A;  3IKJ A;  4BY1 B;  2NN6 H;  5CBE E;  3T4A C;  2VB3 X;  4RGN A;  5EBD A;  3TP7 A;  3KLS A;  1ESF A;  2F03 A;  4TQU S;  4K5W A;  1SNP A;  2A6E C;  2HQE A;  1STN A;  4QF4 A;  1GHJ A;  1SMY D;  2QDB A;  3VYU A;  3U9S A;  2R61 A;  3PO3 B;  3MXG A;  4PQX A;  5FOB B;  4KJN A;  2A68 D;  3M4O B;  4ZUJ A;  2ICI A;  3R2T A;  1TWH B;  5HUR A;  1E2W A;  2R7Z B;  5CV5 A;  2BE5 C;  4XQN A;  1CA6 A;  1SXT A;  3NP8 A;  3TP6 A;  4K2L A;  3FEW X;  1V1O A;  1Q12 A;  1I4R A;  5C0X H;  3H91 A;  2LKV A;  3EQL C;  1J9O A;  2VXW A;  1LTB D;  3RUZ A;  1GJX A;  4RH6 A;  1I4H A;  2TSS A;  1Y1V B;  4J6H A;  1SYF A;  4R9W A;  3FDT A;  1HFG A;  4XYO A;  1I4G A;  4RCO A;  1C8C A;  2AQ3 B;  3OMG A;  2AWN A;  2WKD A;  3NHH A;  4CBV A;  5EKK A;  2EDG A;  1F9S A;  2NTT A;  4EQP A;  1JE4 A;  5BN4 A;  1JOQ A;  2ZXR A;  2EYH A;  1BCP F;  1CZG A;  2EY1 A;  3GTK B;  4RHR A;  2EYM A;  4DNR B;  3VR6 A;  2Q8I B;  4FP5 D;  1ET9 A;  4IUP A;  5JVH 3;  2KOL A;  2HCC A;  3NTK A;  1B9M A;  2FHT A;  1F2M A;  3HP3 A;  2KQ3 A;  5FKA C;  5F2D A;  3MTS A;  5I2X A;  4KD3 A;  1B3A A;  2BA0 A;  1WD0 A;  5EQ0 A;  2E2H B;  1A2T A;  2F0K A;  3HOZ B;  5IGE A;  4FF1 A;  2H4O A;  1IYV A;  2M00 A;  1SYE A;  3J7A F;  4TRD A;  4R8N A;  1CM9 A;  5I6Y A;  2WP8 J;  1HA5 A;  4IUT A;  2R3Z A;  1BR9 A;  1RTO A;  2FMM A;  3I91 A;  1KDC A;  3UI2 A;  4RCN A;  2KCC A;  1I6H B;  2KA7 A;  2JE6 I;  4IFD I;  1FR3 A;  3GP7 A;  3R2I A;  4CJ0 B;  5FO9 B;  2B2U A;  3HKZ B;  1WTX A;  2DN8 A;  2A73 B;  3NTI A;  1JOR A;  3HEJ A;  3VA5 A;  1BCP C;  3DHQ A;  1ONL A;  3NQT A;  2BOS A;  5FK9 C;  3P1H A;  1BOS A;  3PUV A;  1S5F D;  2PO4 A;  4PMC A;  3C2P A;  2KEC A;  1EY0 A;  1NUC A;  3H94 A;  3MXP A;  4JK1 C;  1S5D D;  3I70 A;  3BZD B;  3S17 B;  1I4Q A;  4OO1 I;  3GTL B;  3VYR A;  2E75 C;  2RDF A;  4IUN A;  5FLX E;  4X3K A;  3I3C A;  4H0L C;  2F0E A;  3HOU B;  1DON A;  4HTH A;  2EYJ A;  3PV0 A;  3SEB A;  5T1I A;  4RGT A;  5C3E B;  3D6C A;  1H9S B;  2EJM A;  4Y7N B;  4C3H G;  3K5O A;  3DXJ C;  1JWS D;  5EPJ A;  1D5M C;  3FVQ A;  1ILP A;  3VR3 A;  1X32 A;  5M5W B;  3A54 A;  4RWS C;  1EU3 A;  1LTG D;  3NXW A;  1D5X C;  2XN9 C;  3X3N A;  4RGO S;  5EJW A;  2QCP X;  4QCL A;  2XWB B;  1A3T A;  5A35 A;  2JSO A;  2F1M A;  4F87 A;  1DOL A;  4WFN 3;  1OXV A;  2OXP A;  3WOF A;  3C46 A;  1HA6 A;  1FNV A;  1SE4 A;  1HCZ A;  3OHX C;  2NVT B;  3MA2 B;  3EJI A;  3KLS X;  1KAB A;  2O2L D;  4H7B A;  1ZXT A;  4HMI A;  4IAL A;  5D14 A;  1LTT D;  2K6A A;  5IT9 L;  1CTM A;  3N6R A;  5I2Y A;  4QUC A;  5C3W A;  4OO1 H;  3ERO A;  4DF7 A;  1OXU A;  3VYS A;  3M7N A;  1PTO H;  5IGB A;  3SVM A;  1HTP A;  4I7Z C;  2L5T A;  3QIA A;  4EGV A;  3D31 A;  1U9R A;  1Z6H A;  3U9O A;  1DYQ A;  3C1E A;  2KUM A;  2IPK D;  5CYU A;  4C3J G;  4C1N K;  1V1P A;  4TSS A;  1D6E C;  3FKI B;  2RSO A;  2F0P A;  1HPC A;  3QOL A;  2AQ1 B;  3JAM E;  4DA2 A;  4G57 A;  2AUJ D;  4CHT B;  4FF3 A;  2JA7 B;  1H9K A;  3T16 A;  3BS1 A;  1LAB A;  4FXG C;  1EYA A;  1I50 B;  1DOK A;  3DMU A;  1Q1E A;  4C2M B;  4XQQ A;  5C4X B;  3D6W A;  5AFW A;  2A6H D;  3OIP A;  2RDH A;  2PPB C;  3SXH A;  1ENF A;  4YIJ A;  4PMB A;  3N52 A;  5M3M B;  4G7O C;  2M2L A;  3TDQ A;  2A6H C;  5JEA H;  4DXF A;  2JP1 A;  3HOX B;  2O4X A;  2JXM B;  3TZD A;  3RMH A;  1EYC A;  1SEB D;  1AW7 A;  3NQI A;  5D3D A;  3A55 A;  5ELE A;  3ZYY X;  3D3R A;  1BCP D;  2B63 B;  1S4Z A;  3R8B A;  3VA7 A;  1X3P A;  1WTP A;  4DXG A;  1LT3 D;  4F88 A;  3LNN A;  2FFK B;  2R93 B;  1EQV A;  3EVQ A;  3S16 B;  2C5C A;  3J7A V;  3S15 B;  4C3J B;  4CKC A;  3J81 L;  4B9W A;  1V1P B;  1MBY A;  2Q8R E;  4KV6 A;  2IW3 A;  4IUU A;  1G29 1;  1WTO A;  2NYZ D;  4O1N A;  2SOB A;  2NUC A;  2DNE A;  2RKS A;  1KAA A;  2K01 A;  4M8A A;  2L4N A;  1B4O A;  1NAP A;  3I72 A;  1HRJ A;  1MGS A;  2ID0 A;  2F0I A;  4CKB A;  4UDU C;  4QB4 A;  3J7Y W;  1Y1W B;  4CJ2 C;  1U4L A;  3K7A B;  3ONA B;  3MHB A;  3HS0 C;  3MWY W;  1QB5 D;  5KEE A;  1XYI A;  2XWJ B;  3VR4 A;  3URY A;  1EOT A;  4EVO A;  3M85 A;  4DK1 A;  1VDZ A;  4WRD A;  1RCV D;  1IL8 A;  1WCM B;  2IX1 A;  1DOM A;  1H9S A;  3NE5 B;  4C1N I;  5C4J B;  1ILQ A;  1G8Z D;  5JEA J;  5C3X A;  1TS5 A;  2B2Y A;  4LJZ C;  4RAU C;  5BN3 A;  1UNS A;  5I9O A;  5JAV A;  3I90 A;  2MUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...