4ZAIA

Crystal structure of cxcl13
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-X-C motif chemokine 13
publication title Crystal structure of CXCL13
rcsb
source organism Homo sapiens
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zaiA00
2K03A 2Q8TA 2HUGA 2B2VC 2D9UA 3TZDA 2NYZD 2M2LA 1ICWA 1WTVA 4XT3B 1B53A 1F9PA 1O80A 2B2UC 2HCIA 5EPLA 1BNZA 1B2TA 2B2TC 3MWYW 1G6ZA 2MGSA 1BO0A 3ONAB 1ESRA 4X3SA 5DNFA 1BF4A 2RVLA 1ML0D 3G7LA 1NCVA 4QUFA 1IL8A 2B2YC 2L12A 2VXWA 4R8IA 1G2SA 1EQTA 4DN4M 1XX8A 2DY7A 1B4OA 4ZKBB 1F9SA 1EOTA 1IKMA 1AZPA 2H1EA 2EOTA 4ZLTF 1U4MA 1HRJA 3I3CA 2B2WA 4HEDA 2JP1A 3D6WA 1J9OA 1PFNA 1KNEA 2K05A 4ZK9B 2J7ZA 4RAUC 5COYA 1RTOA 3IFDA 3KUPA 2FHTA 1JICA 1U4RA 2B2WC 3GV3A 4U68A 5CBAE 1SDFA 3I91A 1SSOA 1CM9A 2HDLA 1Q3LA 1NR4A 2KOLA 2NZ1D 3I8ZA 1RODA 1JE4A 4IUUA 2HCCA 1HUNA 1SAPA 1DOLA 2RSOA 1WTOA 1QNKA 4CJ2C 2KEEA 2RA4A 2L9HA 5E4WC 1X3QA 2RSNA 2L1BA 1QG7A 4XDXA 1EIHA 1O7YA 2KUMA 1HA6A 1VMCA 2BDNA 4MHEA 4QUCA 4IUTA 5T1GA 3HP3A 1NR2A 3F2UA 1RJTA 1U4PA 1DOKA 2FMMA 2X6GA 2FJ2A 3DEOA 3UI2A 1ILQA 4IURA 1B50A 3H91A 1PFBA 1ILPA 2HDMA 1EL0A 5EJWA 1F9RA 1QE6A 3KBXA 4HAEA 2JYOA 4HCSA 2KECA 4RWSC 2EE1A 4MN3A 1B3AA 4NW2A 4OIJA 1E0BA 5D14A 1DONA 1DZ1A 2DY8A 2R3ZA 1C8CA 1LV9A 2K04A 1EIGA 3FDTA 2CVRA 2X69A 3GV6A 1S4ZA 3LWEA 4CJ0B 4O42A 1J8IA 1WTXA 2L11A 1KNAA 2X6LA 1X32A 2K01A 1GUWA 1X3PA 1MI2A 4IUVA 5EPJA 1O7ZA 1U4LA 3FPUB 2EPBA 4LMQD 4OIKA 2FINB 1WD0A 5EQ0A 3DEPA 3IL8A 5CBEE 1WD1A 2IL8A 2FFKB 4X3UA 2KEDA 2Q8RE 4UAIA 4X3TA 1VMPA 3N52A 3R93A 4RA8A 2NWGA 1CA5A 1HFGA 2MJ8A 1M8AA 2SDFA 1WVLA 4ZAIA 1BBXC 1G91A 5T1IA 2B2YA 1PLFA 1ZXTA 1PFMA 1F2LA 2XIWA 3P7JA 5EPKA 1CA6A 1HFNA 1DOMA 1RTNA 1MSGA 1AZQA 1F9QA 2L4NA 2KVMA 4IUPA 1HUMA 5CORA 5EKIA 3TN2A 4R9WA 1WTPA 3DM1A 4CJ1B 3MTSA 5JJZA 4XT1B 1PDQA 4ZKCB 1XYIA 1G2TA 1MGSA 1AP0A 1RHPA 5AFWA 2MP1A 3QO2A 1NAPA 4IUQA 2MPMA 2B2VA 5E4XA 5D65A 4HSVA 1WTQA 3I90A 1WTRA 1HHVA 2K1BA 1A15A 1MSHA 2B2UA 2N88A 1TVXA 3SVMA 2K28A 5CMDA 2B2TA 3Q6SA 2N55A 1IKLA 4X3KA 1WTWA
chains in the Genus database with same CATH superfamily
3J7AF 4OL7A 2JA6B 4R4OA 4CDDC 1AW7A 5EPLA 4BBRG 1UE6A 3MWYW 2UUCL 1NY4A 1X65A 4ZCKA 2VXWA 2ATWA 2UXDL 1Y8OB 1XX8A 2E76C 4LW1A 1AZPA 4A3FH 1N33L 1U4MA 4A76A 1HRJA 4LF4Q 1UE5A 2RCFA 4WJWA 2XRQD 1E2WA 2LY7A 4K5XA 2KJXA 2PQAB 4IN3A 3RZOH 4FXDA 2KOLA 2XVSA 2NTTA 1ZKOA 1K73C 2NUCA 1QNKA 2OQKA 3CQZH 2YU9H 2L1BA 2KQ3A 4KK7A 1EIHA 2AKWB 1EIFA 4POGA 1L0XB 4DUZL 5DM63 3CCQA 4PV1C 5HY6A 1L1OC 4ID6A 2O5IC 1I4GA 4MIUA 3I56A 1C8CA 2K5WA 2CVRA 1D1IA 4OXPA 1SMYD 3T13A 1WCMB 2GN5A 3EQLC 2DJGC 4LF5Q 2CHBD 3CPFA 2JSOA 1QUQB 4HN7A 4KD3A 4JI3L 4A3JH 2E8GA 2JA5H 3M3YH 1WYDA 1PFMA 2RKSA 3MXUA 4IJLA 3P1HA 4B9XA 3X3MA 1DOMA 1JB3A 2ZT9C 5J3BA 5FO7B 3NQTA 1IHZA 1VQNA 4K5VA 4XT1B 2F0QA 1H9RA 1MGSA 5EKLA 3CD6A 1E3PA 2LSSA 3D4WA 4C2MB 2PMZE 5IYCH 4B3SL 1ET9A 3NBHB 2WKCA 1I3QH 1H9SB 4JYAL 1A15A 4OO1I 4K8IA 1VQAA 2H5XA 2JEBI 4P72A 2HD3A 3TP5A 4CKBA 5NUCA 4N8X1 1V1QA 2D9UA 2D0OA 2B39A 1ICWA 3EN2A 4A3MH 3ND8A 3T56B 2Q2IA 3HKZE 1ESRA 1BCPD 4A3CH 4ZRZA 1EWIA 2B8FA 2AHOB 3BJUA 4B3MQ 4HJ5A 3H0GH 4OWTB 4IOAA 3L0OA 3TBIB 2B63H 4BY7H 2Z8LA 5C6AA 4S3SA 1GOZA 3C1FA 3HEJA 5I9PA 1VQPA 4DK6C 3HFZB 4EVOA 1TT2A 2E5LL 1VQFA 1WFQA 4KMUC 1P8LA 2MHVA 3S1MB 1EEFD 2RSOA 3HOVB 3LX0A 1VQOA 1HNXQ 4HMJA 2L9HA 1SYDA 2CH4A 2F0SA 4LJZC 4DUYL 3DUZA 5ELNA 1V1PB 2ZXPA 1ILQA 4DK0A 2E2IH 1PFBA 1HZBA 5JEAJ 1IXRA 1Q8IA 4HCSA 3S1QH 2RDFA 1OXSC 4OIJA 1E0BA 3A56A 1A8VA 1LV9A 3GV6A 1KLUD 1J8IA 3HOZB 3SK4A 1H9KA 3F2BA 4G4KA 3ND9A 4RGOS 3KJPA 5M3MB 4DV6Q 3PO2B 2OCEA 3GTMH 2IX1A 3BU2A 2R93G 4WRDA 2A8VA 3E0JA 3NHHA 1STBA 3T4AC 2KEDA 3PUXA 3S14H 4K2KA 4ZYSA 1NMGA 3I4NB 3MXNA 1Q1EA 2L5TA 4DPGA 1JORA 4QF4A 1PTOB 3FHWA 3C1EA 1HFNA 4A3EH 4KHVA 5KNDA 3GTKH 2C5CA 3G48A 1VQBA 3D4DA 3HG9A 3TN2A 4TRDA 1WTPA 3DM1A 5ELOA 4C1NK 4DU9A 4ZKCB 2JA5G 4DA2A 1KDCA 1J6QA 4OELB 1QOHA 3C3LA 5M3FB 1YHQA 5HURA 1TWCH 2B2UA 3H15A 3I73A 2UUBQ 3DM3A 1OO9B 1WTWA 4XYQA 2QDBA 3EROA 3M9BA 1JQYD 2Y0SG 1B53A 2B2UC 4DNIA 1YITA 1S72A 3QB3A 4G7ZC 2NVYH 4C3JH 1Y14B 2B2YC 2WV6D 3H09A 3TP6A 3SK6A 1VQKA 4I7ZC 3X3NA 3VYRA 4I7AA 4KV6A 4A3CG 4LF6Q 3D6WA 1D5XC 5JPMC 3MA2B 4UP7A 3K0YA 5KYLA 1PRTB 4PZ6A 2NZOA 2B63G 4IPHA 3T51B 2G9DA 3NUCA 1HTPA 4CBVA 4LF9Q 2QEXA 2WB1B 1TR5A 5JAVA 2EYPA 4H13C 1SJHD 2PW7A 2RSNA 3SHLA 4XDXA 1PH2A 4DR5Q 5T1GA 4OONA 4IUTA 2J0TD 4PG3A 3CMAA 1II3A 4H0LC 4GKJQ 2X6GA 3PSIA 2Z9HA 2IT1A 1TS4A 1IZ6A 2NVXH 4KY7A 3V05A 2V4DA 2F0OA 1FNWA 2IW3A 5I6YA 2A6HC 3N6RA 3PCOB 2TMPA 3OW7A 3CKIB 4BA1I 4F87A 1I94L 1B70B 1RIPA 3U9OA 1WD0A 3V2TA 5IWAL 5IYDH 4P71A 3OOCA 2RCNA 1KIXA 3GP7A 4NXNQ 1KQSA 1E2ZA 1G8ZD 4V190 2Q8RE 4X62Q 3N52A 4RA8A 5C44H 3BDOA 1AFPA 1W2BA 3PUWA 1GJXA 3QOJA 4RKLA 2RDGA 4TQUS 2JA8H 4B3TL 2N49A 1D5MC 2QF7A 2ALYB 3K59A 5JPNC 4CKCA 3UDFA 3IRBA 1NNXA 3GTLH 2BOSA 4A3BH 4G57A 4JI8Q 3JAME 1Y1VH 4LUZA 2XWJB 4ULLA 4OO1H 1NE3A 3QO2A 4IUQA 4ABNA 2QA4A 2PI2E 3S1NH 2CFMA 1KL9A 3Q6SA 1XJVA 2Q2HA 1NTGA 4C3HG 2E75C 3K6OA 1TY2A 3A8JE 2F0PA 2K50A 1H9JA 1RD9D 5ELBA 3SDZA 3NBHA 5GAEC 1H9SA 5D3IB 2JA7G 4LF4L 3CPWA 1SE8A 2JP1A 1H9MA 4NDXA 1FVIA 2K05A 5COYA 1CTMA 4MNOA 2FHTA 1IBLQ 5EAYA 4U68A 1CM9A 4Y7NB 1N36L 1SN8A 3PO3B 4JI2Q 5M5YH 3S24A 4K5WA 2D2CC 3U58A 1ET6A 1R4PB 2V1CC 3NWSA 3G6JB 1Y8NB 1BUVT 1IBMQ 1SNDA 4GLAC 5KNBA 4RCNA 3STBD 3VR5A 3C46A 1MD2D 4FXGC 1DJRD 4DR2Q 3KLRA 3PV0A 4KI0A 3EJIA 2DY8A 3AQQA 2PZWA 4FF2A 3C2PA 5CV4A 1VQLA 4DAMA 3FPPA 4A3IB 3F1ZA 1YZ6A 3FMCA 4LF5L 1EYDA 1EFID 1Z47A 3GDEA 1NBWA 4OIKA 1DGSA 3KF6A 3SGIA 5CBEE 1WD1A 3HOUB 4MTKA 1L1OB 2A6EC 4DNRB 5ELCA 2JA6G 1PTOD 2QCPX 2SNMA 1EOVA 2XGTA 1JT8A 3TSSA 5IYDG 3MVVA 5KNCA 1MSGA 4ALPA 3S1RB 4KD4A 5IGCA 2Z1CA 1PZID 4DFAA 5IOCA 1PA6A 3MFGA 3DMUA 1I50B 5FJ8G 5CR3A 1TS3A 2F4IA 3OHXC 2I0QA 3DHQA 3GTGB 5G3LD 2A69C 2EDGA 3MFYA 3UDXA 4DV5Q 3KLWA 2HIXA 4FO2A 3HOXH 4JI4Q 2F0MA 1MSHA 2C35B 4WJ4A 4DK1A 1CZWA 4KY6A 1Y1VG 3G4SA 1X56A 4WFN3 3FVQA 3AMUA 4EGVA 3VYUA 3R3OA 2EYMA 4H02A 3T53B 2WINB 2Q2TA 2OWOA 4X3SA 3BZKA 3PUYA 2MNAA 3RN5A 3HOWB 2L12A 2NTSA 2Y0SE 3HOYB 4P75A 3SXHA 3H94A 4DV7L 2EOTA 3TS2A 1FR3A 4NXMQ 1E2VA 2WP8J 3ER0A 1UUPA 4QIWB 3K58A 3MC0B 3HKZG 3R8BA 2OEOA 3A5UA 3GV3A 4BY1H 4ZUJA 3CC2A 1STYA 2BE5C 1XMOQ 1TWFH 3GTJH 1RODA 4JBWA 1PFSA 4CJ2C 1UE1A 5IY0A 1R9TH 2EY1A 1RDPD 4K0KQ 1HR0L 2K52A 1E22A 3HP3A 3RUZA 2R92H 4M8AA 1VCIA 5BR8L 1I5FA 1QB5D 2K5QA 2N3SA 4IJHA 4YWMA 4JBJA 5CYUA 4IURA 1KDAA 4AH6A 1PH7A 5GROA 5J1ZA 3MHBA 1BCPF 1CK1A 3LGJA 3E9IA 1B3AA 1FGBD 1JJCB 1AE2A 2E2JH 2PI2A 3JC66 1PH5A 4DV1Q 1HZ9A 4FYDA 3D3RA 4DKAC 1EU3A 3QOLA 3K81C 3U4ZA 3HKSA 5F2DA 1KTKA 3BZDB 3ULPA 1YEZA 4C3IH 4JI1L 1JMCA 4RHSA 1D6EC 2O5JC 2OF1A 4C1NI 2F0EA 5J39A 2RBMA 4GLVB 4DAVA 5HGTA 4EQOA 1YNJC 4A3KB 1BBXC 3M85A 2NVTB 1CQVA 3P7JA 1IBKL 5EPKA 4FF1A 1FD7D 3RR5A 1JWUD 4UP8A 2Z0SA 1JWSD 1AN8A 4A3GH 1ZYRC 4CJ1B 3KJOA 3TEHB 2D62A 1GXDC 1JR0D 1DXMA 3DLLA 1G291 1W3SA 5EBDA 1NAPA 1GHJA 2I46A 2CW0C 2UUBL 4PZ7A 2K1BA 5AJ3Q 4DK3C 3S17H 4LUOA 3ULJA 4RCOA 5CGKA 5BN5A 2AUKA 5C3WA 1EY8A 4OEMB 3CCVA 4DV3Q 3HOXG 1L2FA 3T16A 3HOVG 1A2UA 2CH4W 2D0PA 4AYBE 5KIXA 1EQRA 1X54A 1PYWD 1ENFA 1M90C 2IWHA 4L63B 4LF6L 4DR6L 3I3CA 2RF4A 3NTKA 3IFDA 2A74C 4IQZA 4X6AH 1U4RA 3Q23A 1VQDA 1C4QA 5GQOA 1BXTA 2SNSA 4MTNA 4LF9L 3BDCA 5D3DA 3HOZG 1SNOA 1DOLA 2BH8A 2KEEA 2O4XA 1VS0A 2A1AA 1FYCA 3PO2G 4BY1G 4NP5A 3U4VA 3V96A 1XMQQ 1QG7A 2ZM6Q 2KUMA 2UUAQ 1X3EA 5JJIA 3RZDH 4A3DB 5C4JB 3IFTA 1SROA 3I2ZA 1DOKA 4TKOB 2DNEA 3H91A 3I4NG 4WORA 2MO1A 2HDMA 4JI7L 4JI6Q 2ZXRA 4KJNA 3NXWA 2R92G 4YCWA 3OTOL 4ME3A 1LT6D 3OWEB 1LT3D 3E5SA 1SYEA 5M3FG 4F8MA 3OSOA 1O7ZA 1CSQA 3DEPA 2F52A 3IL8A 1C0AA 2IL8A 4YCVA 1TWAB 1A3TA 2I07B 1HFGA 2SDFA 3AFPA 3K5MA 1N9WA 2VW9A 4EQNA 3OMCA 1TIID 3VA7A 4C3IG 2KHSA 2DUDA 1J5EL 2AMCB 2KENA 5EKIA 2R93H 1Z7TA 4JI8L 2F0GA 3K5OA 1HH2P 1Z6HA 1TWGH 3PIPA 1SXTA 2HHHQ 1S40A 1WTQA 4A3GG 3PGZA 3SVMA 4JV5Q 3GTQB 4MZ9A 3P20A 1XNQL 2B2TA 3KFUA 1EQQA 2K03A 3S2DH 3NENA 4UY8C 1EYCA 1LTLA 1T5XD 4Q0FA 1V8QA 1F9PA 3AEVA 3CCLA 4RGTA 1B2TA 2B2TC 2UXCL 1PYSB 2MGSA 3M4PA 4BBSH 1CZGA 5M5XB 4K8JA 1ENCA 1K3RA 3PIO3 1GHKA 2I5HA 4YWKA 1SMYC 4XIGS 3GTPH 2EJGC 3J81i 2VB3X 1PFNA 1IBLL 2B8GA 5C5MA 3WOEA 3KUPA 1VQ6A 1K83B 5CBAE 2OTLA 5DLQE 2A68D 4JI2L 4IUNA 3I8ZA 1E7ZA 1HUNA 1TXYA 5JVG3 5LMUQ 3TDQA 5C3EB 4XQNA 1D1KA 4A3LH 4UDUC 2MUYA 5KEEA 1Y1WB 1VQ7A 1EYAA 3E0EA 4CGYB 5A2QL 5DAUA 2NB0A 2JK8A 1IBML 1O78A 2QEJC 3DWQA 1B3QA 5M5WB 5C4XB 2JE6I 1B1ZA 4LFAQ 4DR2L 3FRPB 1EL0A 1K8OA 4JBMA 3VR4A 4MN3A 1YBYA 1JC7A 3FKIB 2DNCA 4R4CA 2K04A 1WTXA 4B3RQ 1KNAA 2J4XA 1D7QA 5C4HA 3L9AX 1BCPC 1A63A 1U4LA 3KF8A 4O0AA 4TSSA 4JC0A 2F1MA 1Q86C 1MIUA 5EKKA 2F0LA 4X3UA 3T1YQ 4X66L 3GQBA 3WWVA 1LACA 3NK9A 2CWPA 3F8TA 5CC4A 1XWEA 2VUMB 2F3VA 1RTNA 2KCNA 2FMCA 3GTOB 4DAYA 1GUNA 2KVMA 2IHEA 4R9WA 3J7YW 1EYGA 1CFMA 2VB2X 2JQOA 4DV5L 4EQ5A 1MJCA 4JI4L 2YTYA 1W6KA 4LF7L 3VYTA 2IPKD 4DR7Q 1QJOA 1A0IA 1SYFA 1BNZA 4BBRB 2BA0A 1BO0A 2NVQB 3NE5B 3A74A 1A3UA 1V1OA 1ML0D 3DXJC 1NCVA 1LYLA 3R2TA 4ILWA 1U9RA 5CV5A 3L7ZC 4KKSA 1TS2A 4C3HH 4NXML 3CCMA 1IW7C 2R7ZB 1PTOF 4BBSG 3P75A 1STNA 2DN8A 4GKKL 4K6LA 4GNXB 3D4RA 1K0RA 3S16B 4CDEC 1BVSA 1PYBA 2PPBC 1TWHB 3I91A 1LTID 3A0JA 2HDLA 2JA7H 1JB7A 5G3LF 3OMGA 2E2HB 4DR4L 4A3IG 2EYLA 4X64Q 4A3KH 4K0KL 4DXFA 3I4OA 2K33A 1N32Q 1CT1D 5IODA 4DAPA 1SFOH 3J7AV 2RHQB 4A3LG 3S15B 4N9PA 2K14A 4ME5A 4R4QA 5ELFA 1Y69U 1F9RA 4GZYC 2I5LX 2JYOA 3ERSX 2KCTA 1DZ1A 1HNZQ 1FL0A 4R4TA 3H3VI 4GN4B 1X32A 3PIP3 1FJGL 4XYOA 1AH9A 4IUVA 3T1HQ 3SK8A 1PRTF 1V9PA 4K6DA 1JWMD 1KHIA 1Q46A 3HGBA 4FF4A 1C7YA 5C4ZA 1X9NA 1QVGA 1B9MA 2P5ZX 2PQAA 2A6HD 1XPOA 3BYYB 4YY3L 2VQFQ 2A5HA 1VQGA 1SNMA 3UDIA 5IGFA 3S2HB 4PQXA 5LMNW 1ENAA 1GM5A 5IP9H 1GUSA 4JOIA 1F9QA 1LO5D 4JI5Q 3QR8A 2F0TA 1PDQA 4J15A 3HOYG 2UXDQ 2EJMA 4JOIC 2JA6H 1LT4D 3CC4A 4LFBL 1KC8C 1N33Q 1HNWQ 3EBEA 5AJ3L 3TS0A 3K7AB 4JI0Q 2K28A 1XNRQ 5FJ8H 1B9NA 3G71A 1WTVA 1CKNB 4DV3L 4IO9A 2HCIA 4ZQ3A 4LUVA 1PH6A 2LKVA 1S5CD 5C4JH 3BVZA 1G6ZA 1KD1C 1BF4A 1EWCA 3J81L 2KHJA 2G9HD 4N8FA 2OXPA 1QUQA 4GOPB 1SE3A 1F9SA 1IKMA 3UE1A 2AWNA 1KNEA 2EVBA 3I4MB 4RAUC 4F7XA 3L2PA 4DUZQ 5GADC 5A35A 1SDFA 1Q82C 4AYBG 1I4PA 1QVFA 1WOCA 4A3FB 1I4HA 1NR4A 1HXYD 3HRZC 3A55A 5FK9C 1F77A 1M4VA 4DV2Q 4BWGB 1XMQL 4C56C 1VDZA 3TZUA 5E4WC 2ZM6L 1VF7A 2QKIC 4L5TA 1EU4A 1EY7A 4FVMA 3RZOB 5EBCA 2EY6A 4HMIA 1CQFA 5E7NA 3VR6A 2FJ2A 3KK7A 4A3KG 1WCMH 4DGZA 3CQZB 2AQ3B 4JI6L 1IYJB 1BBUA 3AB9A 3NWTA 4AIMA 2AQ2B 4QY7A 2Z6KA 2X69A 3EVQA 1KDBA 4APVA 1XXGA 2VL6A 4J8QA 1UEBA 1GUWA 2Z6KC 4YIJA 1JOKA 1SLJA 1YHBA 4HIDA 4JCVE 2FINB 3NTIA 3W5OA 1VQIA 4B3SQ 1YNNC 2N78A 1BDOA 5K36G 1I4XA 2NWGA 3CU7A 1CA5A 4ZAIA 4C2MH 1UEAB 1AZQA 4L8JA 1UAPA 1L0WA 2XNAC 3K80C 4OX9Q 1K9MC 3I70A 4A3JB 2JA5B 3OIPA 2QGQA 4QB4A 4BS9A 2A6ED 1V1PA 5IP9G 4A4IA 4BXXG 4JV5L 1YJ9A 4HSPA 2CKZB 3W1BA 1XTCD 1IKLA 2VNUD 2G5DA 2HUGA 1SNQA 1S5DD 3STBC 2E5LQ 1OXVA 1CUKA 5DNFA 3I55A 5JOBA 3G7LA 1EZ8A 1GVPA 2K32A 3U50C 1PH4A 1LLRD 3NEMA 4RGNA 2AWOA 3EIVA 4A3MB 2H1EA 1K3BC 4DUYQ 3H3VC 3S1MH 5IP7G 3CAMA 2WAQB 4ZK9B 3HOVH 5KRUA 5LL6S 1JICA 3H0GB 3PUVA 5C0XG 4AQYQ 2B63B 4BY7B 1PTOC 3PMFA 5LMUL 5CV7A 1ASYA 5IGGA 1SAPA 2PYKA 4B3ML 1SEBD 4B9WA 3I72A 2RA4A 1X3QA 1DCZA 4O2DA 2Z6BA 4ZUIA 5ELDA 5BN4A 1XPUA 1RJTA 1YNXA 2VZAA 2FMMA 3CRKC 2BE5D 3HOZH 3UI2A 1B50A 2LFNA 2PNHA 5M3MH 1QE6A 1EQVA 1T9HA 3H3VH 3OWFA 3PO2H 4NW2A 1DONA 4KHPQ 3KBGA 5IT9L 4DV0Q 2R3ZA 3HZXA 3Q0AA 4B3RL 4QGUA 1WCMG 3EFXD 5J22A 2XRSD 1HNXL 2E2IB 4CDCC 4IPGA 1S5ED 3I4NH 3J80i 3PIOA 1PTOH 5EQ0A 1A62A 2UU9Q 3T1YL 1I4RA 4UAIA 1PH1A 3IKJA 3I4LA 1F2ZA 1NMFA 1M8AA 3BS1A 1G91A 1U0LA 1LTAD 3K0XA 3GTMB 1F2LA 1PRTC 3WOFA 5M3FH 1QNUA 5LHY1 3TRZA 2OTJA 4IALA 4CKEA 1EY0A 1SMXA 2L4NA 5JJLA 1GKHA 4KTAA 4L5QA 4YHHQ 1LTSD 3GO5A 3RD4A 1ONLA 3LNNA 4DV6L 5CV6A 5GAGC 1Q7YC 3TP7A 3W3AA 5LL6X 1F2YA 4A3EB 2QILA 3GTKB 1HQMC 1HZCA 1VQ5A 1HHVA 3VR3A 5FLXL 3D8GA 4A93B 1BKBA 1Q12A 5I6WA 4J1MA 1GO3E 1IYUA 1VQHA 4QIWE 3ULLA 4UP9A 5CV9A 1TWCB 4RHRA 2K4KA 5C3EG 1SE4A 4IPDA 4R8IA 5M9OA 1UE7A 1J9OA 1V43A 3QWNA 1G6PA 2HQEA 2NVYB 3RLOA 4H44C 4C3JB 2CWAA 5I2YA 2H4OA 4L6TB 1D2BA 3FKIG 3W2DA 2IY5B 4IOCA 3MXNB 1LTBD 2EXDA 4KN4C 2WKDA 1Y8PB 1LTGD 4GOPA 4LFCQ 2F0FA 2JEAI 2L55A 5I4DA 3CP0A 3OW2A 4TVAB 4QUCA 4MHEA 3G6EA 2NN6H 3F2UA 3E9HA 2YYZA 5A2QE 3CHBD 3FEWX 3D6CA 2KA7A 1B7YB 5IYBH 4HAEA 2VUMG 3URYA 2EE1A 1HNZL 1R4QB 4E6IA 3J80c 3ZJYC 4O42A 2KBNA 2NVXB 1DD2A 4FXKC 2AUJD 5M3MG 3RLNA 3CCJA 4DR5L 3FPUB 2EPBA 4DXGA 3A8KE 1KXLA 5FOBB 4GKJL 2ZTCA 3CXCA 4GN3B 2VQFL 1Q1BA 2UXBQ 1KAAA 3H6MA 2SEBD 4RKBA 3R2IA 2EZVA 4JI5L 1HUMA 4R1JA 4IZ8A 2L0CA 3I4MH 1O7LA 3AYHB 3MTSA 3NTHA 5C44B 2VQEQ 3NSWA 1XYIA 4YCUA 2R7ZG 2BCOA 1HNWL 2JA8B 3KLSA 3DWAA 4NXNL 4KJOA 3F2DA 4JI0L 1XNRL 4HSVA 4X62L 1Q90A 3GTLB 2PZTA 3VR2A 4A3BB 1Y1VB 2F03A 1EY6A 1SRUA 1O80A 1KRTA 2F4VQ 1S5BD 1KAWA 1N36Q 3KYHC 5I2XA 2PMZB 3S1NB 4LAAA 4IFDG 1IL8A 2OT2A 3M7GA 1I6HB 2KCCA 3RLFA 1JE5A 1L1OA 4Y7NH 3BG3A 4HCEA 3PO3H 2RQXA 4PNYA 4LK1C 1PMRA 2GVAA 2F0DA 2XWBB 2R7DA 1STHA 1WTHA 1CHQD 3HKZB 3VA5A 1JJGA 2D5DA 5L37A 1Q3LA 2KCMA 2KHIA 5E3FA 4BA2I 3MEFA 4NB3A 1FNVA 2WB1G 3D31A 3A7LA 2BDOA 2HCCA 4DV2L 4LWCA 1IYVA 4R8NA 1CI3M 4JK1C 2BDNA 2GVBA 1T5EA 1X6OA 4KKUA 2JJQA 1H95A 5LMNQ 2MFIA 3NBIA 5M5YB 3DEOA 2LXJA 2Z4IA 3RMHA 5C0XI 4A3IH 4DR3Q 3KBXA 3K57A 2KECA 3HS0C 3J80L 2NN6G 1PVOA 4QJFA 2EJFC 3E6ZX 3HOUH 2F0VA 5IYBG 3BZCA 1MBYA 2ES2A 1X3PA 3E3XA 1HTLD 3FP9A 4RMFA 4HJAA 3S1RH 1VQMA 4RH6A 2I5MX 3DWPA 1I50H 1EWHA 3NP8A 3A54A 3GTGH 4JW0A 3K7UC 1ZEQX 4R4IA 3BYTB 3O13A 2IX0A 4OX9L 2A68C 1A3VA 1G2TA 5JEAH 5AFWA 1SJED 1QZGA 2JN4A 4DV7Q 4FF3A 2F3WA 2B2VA 5EGTA 3Q24A 1PV4A 2NBFA 3B6YA 4DR1Q 3I4MG 1U5KA 3HOWH 4X3KA 4DV4Q 3MAQA 2B2VC 3HOYH 3PF4A 3Q8DA 4A3FG 4KLKA 4POFA 3HOXB 4OWWB 4P2CB 1AE3A 3BVGA 2K5NA 4Z9CB 4KKTA 3A5ZB 1YI2A 1SNCA 2GA4B 4PMBA 1I4QA 1SYGA 2DY7A 3J81E 3L3OC 1EOTA 2F0UA 1HR0Q 4ZLTF 5E1FA 1BOSA 5BR8Q 3ITPA 3CCEA 3KF6B 1RTOA 2E74C 4AQYL 5IGEA 4HIKA 3UE0A 1OXXK 5DM73 2TSSA 3PO3G 2IX3A 1EY9A 1WTOA 1IW7D 2A73B 1NSNS 1LTRD 2LMCB 3J81c 4BY1B 2PCFB 1LTTD 1LABA 1HA6A 5FO8B 1VMCA 3CRLC 1TWFB 2F0WA 3GD7A 1N34Q 2BH2A 4JI1Q 3GTJB 3NELA 2RHSB 4HJ7A 5CV8A 3OPOA 4OHJA 4J6HA 1R9TB 4JG2A 4NPSA 4KHPL 4DV0L 4RWSC 1XMOL 2ZXOA 1IBKQ 2Z4HA 2R92B 2YV5A 3FDTA 1WVLA 4CJ0B 4A93H 1MJEA 3J7ZC 4A3JG 2X6LA 2M9VA 1YHAA 2NVTH 5EPJA 1KRSA 3QG1A 2UU9L 3CW2C 1Q8KA 1E24A 3RNUA 4LF8Q 4X65Q 4KN7C 2E2JB 1X3FA 3HOUG 4PZ8A 1PZKD 3M7NA 1M1KC 1SYBA 1HCZA 1OXUA 2MJ8A 5C5LA 5IYCG 1K0SA 1YJNA 2B2YA 2XN9C 1ZXTA 3W1GA 2CQAA 1L0YB 4C3IB 4NMZA 4YHHL 4NKLA 4DV1L 1LT5D 2R6GA 5K36H 5HGQA 2IHFA 4A3MG 1RHPA 1SNPA 1I6VC 3JAMi 4DR6Q 4XXEA 5IE8A 2WAQG 2QDLA 5ELEA 4A3GB 5CMDA 1STEA 1S3OA 2FXQA 3H0GG 4FDBA 5JEAG 4BY7G 2ZJQA 1NUCA 1SBBB 1P16A 4BXXH 3BDLA 2RVLA 1RF2D 1STAA 4QUFA 2UUCQ 3HOWG 4QMGA 5JJKA 3S17B 1G2SA 1PHJA 2F0IA 2HT1A 2DJFC 4HEDA 1BR9A 1MHWC 1D8LA 3CMEA 4K14A 2BA1A 1EEID 3BVMA 4Q5VA 4GN5A 4RGMA 4JI7Q 2MO0A 2Q8IB 4IFDI 4LFCL 4DNTB 4A3DH 2NZ1D 4HIOA 1JE4A 2SOBA 1K8MA 1PXUA 4PMWA 3OTOQ 5IP7H 3M4OB 2WACA 4OWXB 3AU7A 4U673 4P73A 2O2LD 3KDFB 3M4QA 5TSSA 2WB1E 5C0XH 2PZUA 1QILA 1Z9FA 2CQOA 4FNFA 1NR2A 4B08A 5IIFA 5FLMH 3MXGA 1ILPA 1C48A 2HQLA 3PUZA 4V0BA 1CHPD 2ENBA 4OGQC 5DEHA 3Q22A 2CCZA 3RZDB 5IGBA 1DYQA 2F0KA 4FP5D 3LWEA 2VS1A 1J5EQ 1TWAH 1WI5A 5IT9E 1K8GA 3SR1A 2K01A 2UUAL 4HR7B 2EYOA 4A3EG 5H1SE 3F2CA 1JCKB 3A7AB 1SYCA 2UXBL 4A93G 2VY3A 4X3TA 3KOJA 3OIQA 2K7VA 3UDGA 2C9OA 1XNQQ 5C0XJ 2YU9B 2ZJPA 1PZJD 2NN6I 1RKNA 1HA5A 1PLFA 1HR0W 4JI3Q 1I6HH 1EUJA 2XIWA 4I65A 2ZTEA 4A75A 1HZAA 4CDFC 4EQPA 2JXMB 2R7FA 2VQEL 2UXCQ 1PH9A 1CSPA 3IAYA 5IT9c 5GAHC 3GTQH 1ESFA 1QVCA 4XQJA 1TU2B 3JAMc 1YNND 3NQIA 1VQ9A 1E1OA 2F3IA 2K75A 2ASBA 1B8AA 2AQ1B 3SEBA 3ZYYX 4UHVA 2EXZA 1W6JA 5E4XA 4C3JG 1EY5A 3I90A 5M5XH 2ICIA 2R93B 1O7IA 1TVXA 1VQ8A 4JYAQ 2F4VL 1VF5C 4H7BA 5FLXE 2L15A 2NYZD 1BBWA 1MKHA 1TWGB 3SE0A 4HIMA 1IL2A 3ONAB 2M00A 4DF7A 1C9OA 3J7A5 2EQSA 2PNRC 1EZ6A 5K5PA 1K28A 4DN4M 3S2DB 1K83H 1JOOA 1B4OA 3OYYA 4ZKBB 2HHHL 3M3YB 1HPCA 2EYHA 4JVZA 4BBSB 3K8AA 2K5VA 3TQYA 1PH8A 2EY2A 2IJ0A 2J7ZA 3RN2A 5C3EH 3LWUA 3SK5A 5FO9B 2ZJRA 1Y1WH 5FLXc 2N8NA 1VQEA 1TQOA 3MEHA 2E2DC 1SSOA 3GTPB 1YIJA 2Y0SB 2B29A 4L5SA 1I3QB 4EX5A 4IUUA 2A69D 1YJWA 3CCRA 5C4XH 5M5WH 1VQ4A 1OTCA 2NZHA 1EY4A 1S5FD 2ICEC 1TKWB 1D5ZC 1GUTA 3VYSA 2PO4A 5LMNL 3FKIH 4A3DG 3J81j 3A8IE 4KY5A 3PQIA 3TREA 5C3XA 5JVH3 1X55A 1UNSA 4DR3L 4GLXA 3EA6A 4X66Q 1NJIC 3AFQA 1OXTA 1CKOA 5EJWA 1BQQT 1AEXA 5D14A 4LNQA 4GS3A 2EY5A 1EIGA 1A2TA 2ID0A 1S4ZA 5C44G 1B44D 2F0HA 2L11A 3CCSA 5FLMG 4CHTB 4F88A 1A6XA 2JA8G 1MI2A 4LMQD 4KHZA 2VUMH 3WDNA 1RCVD 2WFWA 3GTOH 1EFWA 4GNXA 2FFKB 3S9WA 1RL2A 4LFAL 4A3BG 4O1NA 4OO1G 4LF7Q 3TP8A 1HJPA 1DM0B 2MQHA 3ICEA 2XSCA 4GNXC 3TMEA 2EIFA 5IGDA 3D0FA 2XTIA 2K5DA 2LXKA 3MXPA 2A19A 4IUPA 4HTHA 4JBKA 3JAML 2PW5A 1G51A 4Y52H 1LM0A 5KYIA 1SR3A 2EYJA 5I9OA 3S1QB 3CC7A 4BBRH 4DR1L 2MPMA 3MZ5A 4QCLA 2NVQH 5D65A 1LUZA 2WIIB 1PRTD 4DV4L 1JOQA 5KGUA 2N55A 4GKKQ 1PH3A 2Q8TA 4YWLA 2F0JA 3TZDA 3QIAA 2M2LA 4XT3B 4G7OC 2WAQE 2R7ZH 1GUGA 1JJ2A 4P74A 1STGA 1EIYB 1BCPB 4DR4Q 3S14B 1UWVA 4WJ3M 1EQTA 3S16H 1TWHH 1VQJA 1TY0A 1YNJD 2B2WA 3KF8B 2E2HH 2OQ0A 1TS5A 4IFDH 1XTDA 1XPRA 2EYFA 1QZHA 4DR7L 4QQBX 2B2WC 3CF5A 4K2LA 1ZYRD 4C3HB 4XQQA 3I7FA 2PQEA 4AYBB 3K5NA 3VDYA 3CCUA 4PMCA 1GD7A 4IPCA 4UPAA 4DAYB 1Y1WG 2QW7A 3S15H 1SE2A 2CW0D 1FJGQ 1KLGD 1N34L 3PF5A 1O7YA 5FKAC 4HJ9A 4L5RC 2JA7B 1ICFB 1YVCA 2ZTDA 1QWYA 1U4PA 5C4XG 1KABA 2RDHA 1CKNA 1ASZA 4YY3Q 2LS01 2YTXA 2JA9A 3KLSX 4QL5A 4M1UB 3ERQA 1SFOB 2R61A 1Q81C 4IFDJ 3KDFA 4ODGA 4X64L 3J80E 4JPBW 2Q2UA 4HJ8A 2K5HA 3S2HH 1E1TA 1N32L 4LF8L 2K6AA 4X65L 5BN3A 4LFBQ 4GOPC 4N9TA 1I94Q 5IWAQ 1CKMA 1VMPA 3R93A 3U9SA 1HQRD 1X3GA 1VQCA 1N8RC 5T1IA 3M4YA 5ISRA 2YTVA 1CA6A 1WJJA 3NPPA 4B3TQ 1F2MA 5CORA 2B3GA 2F0NA 3K7AH 4G7HC 5JJZA 1FGUA 2DGYA 3T1HL 3K5LA 1AP0A 1FNUA 2MP1A 2HIVA 1K8AC 4XTCS 3QJYA 1WTRA 1GUOA 3M4OH 1QCBD 2N88A 4RFBA 4RG1A
chains in the Genus database with same CATH topology
3J7AF 4OL7A 2JA6B 1AW7A 5EPLA 3MWYW 2VXWA 1Y8OB 1XX8A 2E76C 1AZPA 1U4MA 1HRJA 4WJWA 2XRQD 1E2WA 2LY7A 4K5XA 2KJXA 4IN3A 4FXDA 2KOLA 2XVSA 2NTTA 1ZKOA 2NUCA 1QNKA 2L1BA 2KQ3A 4KK7A 1EIHA 1L0XB 5DM63 4PV1C 4ID6A 2O5IC 1I4GA 4MIUA 1C8CA 2K5WA 2CVRA 1D1IA 1SMYD 3T13A 1WCMB 3EQLC 2CHBD 2JSOA 4HN7A 4KD3A 1PFMA 2RKSA 3MXUA 3P1HA 4B9XA 3X3MA 1DOMA 1JB3A 2ZT9C 5FO7B 3NQTA 1IHZA 4K5VA 4XT1B 2F0QA 1H9RA 1MGSA 5EKLA 3D4WA 4C2MB 1ET9A 2WKCA 1H9SB 1A15A 4OO1I 4K8IA 2JEBI 3TP5A 4CKBA 5NUCA 2D9UA 2B39A 1ICWA 3ND8A 3T56B 1ESRA 1BCPD 4ZRZA 2B8FA 3TBIB 2Z8LA 5C6AA 4S3SA 1GOZA 3C1FA 3HEJA 5I9PA 4EVOA 1TT2A 4KMUC 2MHVA 3S1MB 1EEFD 2RSOA 3HOVB 3LX0A 4HMJA 2L9HA 1SYDA 2F0SA 4LJZC 3DUZA 1V1PB 2ZXPA 1ILQA 4DK0A 1PFBA 5JEAJ 1Q8IA 4HCSA 2RDFA 1OXSC 4OIJA 1E0BA 3A56A 1LV9A 3GV6A 1KLUD 1J8IA 3HOZB 3SK4A 1H9KA 4G4KA 3ND9A 4RGOS 5M3MB 3PO2B 2IX1A 4WRDA 3E0JA 3NHHA 1STBA 3T4AC 2KEDA 3PUXA 4K2KA 4ZYSA 3I4NB 3MXNA 1Q1EA 2L5TA 1JORA 4QF4A 1PTOB 3C1EA 1HFNA 4KHVA 5KNDA 2C5CA 3D4DA 3HG9A 3TN2A 4TRDA 1WTPA 3DM1A 4C1NK 4DU9A 4ZKCB 4DA2A 1KDCA 1QOHA 3C3LA 5M3FB 5HURA 2B2UA 3I73A 1OO9B 1WTWA 4XYQA 2QDBA 3EROA 1JQYD 1B53A 2B2UC 3QB3A 4G7ZC 2B2YC 2WV6D 3H09A 3TP6A 3SK6A 4I7ZC 3X3NA 3VYRA 4KV6A 3D6WA 1D5XC 5JPMC 3MA2B 3K0YA 5KYLA 1PRTB 3T51B 2G9DA 3NUCA 1HTPA 4CBVA 2WB1B 1TR5A 5JAVA 2EYPA 4H13C 1SJHD 2PW7A 2RSNA 3SHLA 4XDXA 5T1GA 4IUTA 2J0TD 1II3A 4H0LC 2X6GA 2IT1A 1TS4A 4KY7A 3V05A 2V4DA 2F0OA 1FNWA 2IW3A 5I6YA 2A6HC 3N6RA 2TMPA 3OW7A 3CKIB 4BA1I 4F87A 3U9OA 1WD0A 3V2TA 3OOCA 3GP7A 1E2ZA 1G8ZD 4V190 2Q8RE 3N52A 4RA8A 3BDOA 1AFPA 3PUWA 1GJXA 3QOJA 4RKLA 2RDGA 4TQUS 1D5MC 2QF7A 3K59A 5JPNC 4CKCA 2BOSA 4G57A 3JAME 2XWJB 4ULLA 4OO1H 3QO2A 4IUQA 4ABNA 3Q6SA 4C3HG 2E75C 3K6OA 1TY2A 3A8JE 2F0PA 1H9JA 1RD9D 5ELBA 3SDZA 3NBHA 1H9SA 5D3IB 2JP1A 1H9MA 4NDXA 2K05A 5COYA 1CTMA 2FHTA 4U68A 1CM9A 4Y7NB 3PO3B 4K5WA 2D2CC 1ET6A 1R4PB 3NWSA 3G6JB 1Y8NB 1BUVT 1SNDA 5KNBA 4RCNA 3VR5A 3C46A 1MD2D 4FXGC 1DJRD 3KLRA 3PV0A 4KI0A 3EJIA 2DY8A 4FF2A 2PZWA 3C2PA 5CV4A 3FPPA 4A3IB 3FMCA 1EYDA 1EFID 1Z47A 4OIKA 5CBEE 1WD1A 3HOUB 4DNRB 2A6EC 5ELCA 1PTOD 2QCPX 2SNMA 3TSSA 3MVVA 5KNCA 1MSGA 3S1RB 4KD4A 5IGCA 2Z1CA 1PZID 4DFAA 5IOCA 3MFGA 3DMUA 1I50B 5CR3A 1TS3A 2F4IA 3OHXC 3DHQA 3GTGB 5G3LD 2A69C 2EDGA 3MFYA 4FO2A 2F0MA 1MSHA 4DK1A 1CZWA 4KY6A 4WFN3 3FVQA 3AMUA 4EGVA 3VYUA 3R3OA 2EYMA 3T53B 2WINB 4X3SA 3PUYA 3HOWB 2L12A 2NTSA 3HOYB 3SXHA 3H94A 2EOTA 1FR3A 1E2VA 2WP8J 1UUPA 4QIWB 3K58A 3MC0B 3R8BA 2OEOA 3GV3A 4ZUJA 1STYA 2BE5C 1RODA 4JBWA 4CJ2C 2EY1A 1RDPD 3HP3A 3RUZA 4M8AA 1VCIA 1QB5D 2K5QA 5CYUA 4IURA 1KDAA 5J1ZA 3MHBA 1BCPF 1CK1A 1B3AA 1FGBD 4FYDA 3D3RA 1EU3A 3QOLA 5F2DA 1KTKA 3BZDB 4RHSA 1D6EC 2O5JC 2OF1A 4C1NI 2F0EA 5J39A 2RBMA 4DAVA 5HGTA 4EQOA 1YNJC 4A3KB 1BBXC 3M85A 2NVTB 1CQVA 3P7JA 5EPKA 4FF1A 1FD7D 1JWUD 1JWSD 1AN8A 1ZYRC 4CJ1B 2D62A 1GXDC 1JR0D 1DXMA 1G291 5EBDA 1NAPA 1GHJA 2I46A 2CW0C 2K1BA 4RCOA 5CGKA 5BN5A 2AUKA 5C3WA 1EY8A 3T16A 1A2UA 5KIXA 1PYWD 1ENFA 2IWHA 4L63B 3I3CA 3NTKA 3IFDA 2A74C 4IQZA 1U4RA 3Q23A 1C4QA 1BXTA 2SNSA 3BDCA 5D3DA 1SNOA 1DOLA 2KEEA 2O4XA 1FYCA 4NP5A 3V96A 1QG7A 2KUMA 4A3DB 5C4JB 3IFTA 4TKOB 1DOKA 2DNEA 3H91A 4WORA 2HDMA 2ZXRA 4KJNA 3NXWA 1LT6D 3OWEB 1LT3D 3E5SA 1SYEA 4F8MA 3OSOA 1O7ZA 3DEPA 3IL8A 2IL8A 1TWAB 1A3TA 2I07B 1HFGA 2SDFA 3K5MA 4EQNA 3OMCA 1TIID 3VA7A 4C3IG 2KHSA 5EKIA 1Z7TA 2F0GA 3K5OA 1Z6HA 1SXTA 1WTQA 3SVMA 3GTQB 3P20A 2B2TA 2K03A 1EYCA 1T5XD 4Q0FA 1V8QA 1F9PA 4RGTA 1B2TA 2B2TC 2MGSA 1CZGA 5M5XB 4K8JA 1ENCA 3PIO3 1GHKA 1SMYC 4XIGS 2EJGC 2VB3X 1PFNA 2B8GA 5C5MA 3WOEA 3KUPA 1K83B 5CBAE 2A68D 4IUNA 3I8ZA 1HUNA 5JVG3 3TDQA 5C3EB 4XQNA 1D1KA 4UDUC 2MUYA 5KEEA 1Y1WB 1EYAA 4CGYB 5A2QL 5DAUA 2NB0A 1O78A 2QEJC 3DWQA 5M5WB 5C4XB 2JE6I 1B1ZA 3FRPB 1EL0A 1K8OA 3VR4A 4MN3A 1JC7A 3FKIB 2DNCA 2K04A 1WTXA 1KNAA 2J4XA 5C4HA 3L9AX 1BCPC 1U4LA 3KF8A 4TSSA 2F1MA 5EKKA 2F0LA 4X3UA 3GQBA 1LACA 3NK9A 5CC4A 1XWEA 2VUMB 2F3VA 1RTNA 2KCNA 2FMCA 3GTOB 4DAYA 1GUNA 2KVMA 4R9WA 3J7YW 1CFMA 2VB2X 1W6KA 3VYTA 2IPKD 1QJOA 1SYFA 1BNZA 4BBRB 2BA0A 1BO0A 2NVQB 3NE5B 1A3UA 1V1OA 1ML0D 3DXJC 1NCVA 3R2TA 4ILWA 1U9RA 5CV5A 3L7ZC 4KKSA 1TS2A 1IW7C 2R7ZB 1PTOF 3P75A 1STNA 2DN8A 4K6LA 3D4RA 3S16B 2PPBC 1TWHB 3I91A 1LTID 2HDLA 5G3LF 3OMGA 2E2HB 2EYLA 4DXFA 2K33A 1CT1D 5IODA 4DAPA 3J7AV 3S15B 4N9PA 4ME5A 5ELFA 1Y69U 4GZYC 1F9RA 2JYOA 1DZ1A 1X32A 3PIP3 4XYOA 4IUVA 3SK8A 1PRTF 4K6DA 1JWMD 3HGBA 4FF4A 5C4ZA 1B9MA 2A6HD 3BYYB 2A5HA 1SNMA 5IGFA 3S2HB 4PQXA 1ENAA 1GUSA 1F9QA 1LO5D 2F0TA 1PDQA 2EJMA 1LT4D 3K7AB 2K28A 1B9NA 1WTVA 2HCIA 4ZQ3A 2LKVA 1S5CD 3BVZA 1G6ZA 1BF4A 1EWCA 3J81L 2G9HD 2OXPA 1SE3A 1F9SA 1IKMA 2AWNA 1KNEA 2EVBA 3I4MB 4RAUC 4F7XA 5A35A 1SDFA 1I4PA 4A3FB 1I4HA 1NR4A 1HXYD 3HRZC 3A55A 5FK9C 1F77A 1M4VA 4BWGB 4C56C 1VDZA 3TZUA 5E4WC 1VF7A 2QKIC 1EU4A 1EY7A 4FVMA 3RZOB 5EBCA 2EY6A 4HMIA 1CQFA 3VR6A 2FJ2A 3KK7A 4DGZA 3CQZB 2AQ3B 3NWTA 3AB9A 2AQ2B 2X69A 3EVQA 1KDBA 1XXGA 4J8QA 1GUWA 4YIJA 1JOKA 2FINB 3NTIA 1YNNC 1BDOA 5K36G 1I4XA 2NWGA 3CU7A 1CA5A 4ZAIA 1UEAB 1AZQA 4L8JA 1UAPA 2XNAC 3I70A 4A3JB 2JA5B 3OIPA 4QB4A 4BS9A 2A6ED 1V1PA 4HSPA 1XTCD 1IKLA 2VNUD 2HUGA 1SNQA 1S5DD 1OXVA 5DNFA 5JOBA 3G7LA 1EZ8A 2K32A 1LLRD 4RGNA 2AWOA 4A3MB 2H1EA 3H3VC 2WAQB 4ZK9B 5KRUA 5LL6S 1JICA 3H0GB 3PUVA 5C0XG 2B63B 4BY7B 1PTOC 3PMFA 5CV7A 5IGGA 1SAPA 2PYKA 1SEBD 4B9WA 3I72A 2RA4A 1X3QA 1DCZA 4ZUIA 5ELDA 5BN4A 1RJTA 2FMMA 3CRKC 2BE5D 3UI2A 1B50A 2LFNA 1QE6A 1EQVA 3OWFA 4NW2A 1DONA 3KBGA 5IT9L 2R3ZA 3HZXA 3Q0AA 3EFXD 5J22A 2XRSD 2E2IB 1S5ED 1PTOH 5EQ0A 1I4RA 4UAIA 3IKJA 3I4LA 1F2ZA 1M8AA 3BS1A 1G91A 1LTAD 3GTMB 1F2LA 1PRTC 3WOFA 1QNUA 5LHY1 4IALA 4CKEA 1EY0A 2L4NA 4KTAA 1LTSD 3GO5A 3RD4A 1ONLA 3LNNA 5CV6A 3TP7A 3W3AA 5LL6X 1F2YA 4A3EB 2QILA 3GTKB 1HQMC 1HHVA 3VR3A 5FLXL 3D8GA 4A93B 1Q12A 5I6WA 4J1MA 1IYUA 5CV9A 1TWCB 4RHRA 1SE4A 4R8IA 5M9OA 1J9OA 1V43A 3QWNA 2HQEA 2NVYB 4H44C 4C3JB 5I2YA 2H4OA 4L6TB 1D2BA 3W2DA 1LTBD 4KN4C 2WKDA 1Y8PB 1LTGD 2F0FA 2JEAI 2L55A 5I4DA 4QUCA 4MHEA 2NN6H 3F2UA 2YYZA 5A2QE 3CHBD 3FEWX 3D6CA 2KA7A 4HAEA 3URYA 2EE1A 1R4QB 4E6IA 4O42A 2NVXB 1DD2A 4FXKC 2AUJD 3FPUB 2EPBA 4DXGA 3A8KE 5FOBB 1Q1BA 1KAAA 3H6MA 2SEBD 4RKBA 3R2IA 2EZVA 1HUMA 4IZ8A 2L0CA 1O7LA 3MTSA 3NTHA 5C44B 3NSWA 1XYIA 2BCOA 2JA8B 3KLSA 3DWAA 4KJOA 4HSVA 1Q90A 3GTLB 2PZTA 3VR2A 4A3BB 1Y1VB 2F03A 1EY6A 1O80A 1S5BD 5I2XA 2PMZB 3S1NB 4LAAA 4IFDG 1IL8A 2OT2A 3M7GA 1I6HB 2KCCA 3RLFA 3BG3A 4HCEA 2RQXA 4PNYA 4LK1C 1PMRA 2F0DA 2XWBB 1STHA 3HKZB 1CHQD 3VA5A 2D5DA 1Q3LA 5E3FA 4BA2I 1FNVA 3D31A 3A7LA 2BDOA 2HCCA 1IYVA 4R8NA 1CI3M 4JK1C 2BDNA 1T5EA 4KKUA 3NBIA 5M5YB 3DEOA 2Z4IA 3RMHA 5C0XI 3KBXA 3K57A 2KECA 3HS0C 3J80L 2NN6G 2EJFC 3E6ZX 2F0VA 1MBYA 1X3PA 1HTLD 4RH6A 3DWPA 1EWHA 3NP8A 3A54A 1ZEQX 3BYTB 3O13A 2IX0A 2A68C 1A3VA 1G2TA 5JEAH 5AFWA 1SJED 4FF3A 2F3WA 2B2VA 5EGTA 3Q24A 2NBFA 4X3KA 3MAQA 2B2VC 3HOXB 4P2CB 3BVGA 4Z9CB 4KKTA 1SNCA 2GA4B 4PMBA 1I4QA 1SYGA 2DY7A 3J81E 3L3OC 1EOTA 2F0UA 4ZLTF 5E1FA 1BOSA 3ITPA 1RTOA 2E74C 5IGEA 1OXXK 5DM73 2TSSA 2IX3A 1EY9A 1WTOA 1IW7D 2A73B 1NSNS 1LTRD 2LMCB 4BY1B 2PCFB 1LTTD 1LABA 1HA6A 5FO8B 1VMCA 3CRLC 1TWFB 2F0WA 3GD7A 3GTJB 5CV8A 3OPOA 4OHJA 4J6HA 1R9TB 4RWSC 2ZXOA 2Z4HA 2R92B 3FDTA 1WVLA 4CJ0B 2X6LA 2M9VA 5EPJA 3QG1A 4KN7C 2E2JB 1PZKD 3M7NA 1SYBA 1HCZA 1OXUA 2MJ8A 5C5LA 2B2YA 2XN9C 1ZXTA 2CQAA 1L0YB 4C3IB 4NMZA 4NKLA 1LT5D 2R6GA 5K36H 1RHPA 1SNPA 1I6VC 4XXEA 5ELEA 4A3GB 5CMDA 1STEA 5JEAG 1NUCA 1SBBB 3BDLA 2RVLA 1RF2D 1STAA 4QUFA 4QMGA 3S17B 1G2SA 2F0IA 4HEDA 1BR9A 4K14A 2BA1A 1EEID 3BVMA 4Q5VA 4RGMA 2Q8IB 4IFDI 4DNTB 2NZ1D 1JE4A 2SOBA 1K8MA 1PXUA 4PMWA 3M4OB 2WACA 3AU7A 4U673 2O2LD 5TSSA 5C0XH 2PZUA 1QILA 4FNFA 1NR2A 4B08A 5IIFA 3MXGA 1ILPA 1C48A 3PUZA 4V0BA 1CHPD 2ENBA 4OGQC 5DEHA 3Q22A 3RZDB 5IGBA 1DYQA 2F0KA 4FP5D 3LWEA 5IT9E 3SR1A 2K01A 4HR7B 2EYOA 1JCKB 3A7AB 1SYCA 4X3TA 3OIQA 2K7VA 2C9OA 5C0XJ 2YU9B 1PZJD 2NN6I 1RKNA 1HA5A 1PLFA 2XIWA 4I65A 4EQPA 2JXMB 3IAYA 1ESFA 4XQJA 1TU2B 1YNND 3NQIA 2AQ1B 3SEBA 3ZYYX 2EXZA 1W6JA 5E4XA 4C3JG 1EY5A 3I90A 2ICIA 2R93B 1TVXA 1VF5C 4H7BA 5FLXE 1TWGB 2NYZD 3SE0A 3ONAB 2M00A 4DF7A 2PNRC 1EZ6A 5K5PA 4DN4M 3S2DB 1JOOA 1B4OA 4ZKBB 3M3YB 1HPCA 2EYHA 4BBSB 2EY2A 2IJ0A 2J7ZA 3LWUA 3SK5A 5FO9B 1TQOA 3MEHA 2E2DC 1SSOA 3GTPB 2Y0SB 1I3QB 4IUUA 2A69D 1EY4A 1S5FD 2ICEC 1TKWB 1D5ZC 1GUTA 3VYSA 2PO4A 3A8IE 4KY5A 5C3XA 5JVH3 1UNSA 3EA6A 1OXTA 5EJWA 1BQQT 1AEXA 5D14A 2EY5A 1EIGA 1A2TA 2ID0A 1S4ZA 1B44D 2F0HA 2L11A 4CHTB 4F88A 1A6XA 1MI2A 4LMQD 4KHZA 3WDNA 1RCVD 2FFKB 3S9WA 4O1NA 4OO1G 3TP8A 1DM0B 2XSCA 3TMEA 5IGDA 2K5DA 3MXPA 4IUPA 4HTHA 3JAML 2PW5A 5KYIA 2EYJA 5I9OA 3S1QB 2MPMA 3MZ5A 4QCLA 5D65A 2WIIB 1PRTD 1JOQA 5KGUA 2N55A 2Q8TA 2F0JA 3TZDA 3QIAA 2M2LA 4XT3B 4G7OC 1GUGA 1STGA 1BCPB 3S14B 1EQTA 1TY0A 1YNJD 2B2WA 1TS5A 4IFDH 2EYFA 2B2WC 4K2LA 1ZYRD 4C3HB 4XQQA 4AYBB 2PQEA 3K5NA 4PMCA 1SE2A 2CW0D 1KLGD 1O7YA 5FKAC 2JA7B 1QWYA 1U4PA 1KABA 2RDHA 2LS01 3KLSX 4M1UB 3ERQA 1SFOB 2R61A 4IFDJ 4ODGA 3J80E 2K6AA 5BN3A 4N9TA 1VMPA 3R93A 3U9SA 1HQRD 5T1IA 3M4YA 5ISRA 1CA6A 3NPPA 1F2MA 5CORA 2F0NA 4G7HC 5JJZA 3K5LA 1AP0A 1FNUA 2MP1A 4XTCS 3QJYA 1WTRA 1GUOA 1QCBD 2N88A 4RFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K03 A;  2Q8T A;  2HUG A;  2B2V C;  2D9U A;  3TZD A;  2NYZ D;  2M2L A;  1ICW A;  1WTV A;  4XT3 B;  1B53 A;  1F9P A;  1O80 A;  2B2U C;  2HCI A;  5EPL A;  1BNZ A;  1B2T A;  2B2T C;  3MWY W;  1G6Z A;  2MGS A;  1BO0 A;  3ONA B;  1ESR A;  4X3S A;  5DNF A;  1BF4 A;  2RVL A;  1ML0 D;  3G7L A;  1NCV A;  4QUF A;  1IL8 A;  2B2Y C;  2L12 A;  2VXW A;  4R8I A;  1G2S A;  1EQT A;  4DN4 M;  1XX8 A;  2DY7 A;  1B4O A;  4ZKB B;  1F9S A;  1EOT A;  1IKM A;  1AZP A;  2H1E A;  2EOT A;  4ZLT F;  1U4M A;  1HRJ A;  3I3C A;  2B2W A;  4HED A;  2JP1 A;  3D6W A;  1J9O A;  1PFN A;  1KNE A;  2K05 A;  4ZK9 B;  2J7Z A;  4RAU C;  5COY A;  1RTO A;  3IFD A;  3KUP A;  2FHT A;  1JIC A;  1U4R A;  2B2W C;  3GV3 A;  4U68 A;  5CBA E;  1SDF A;  3I91 A;  1SSO A;  1CM9 A;  2HDL A;  1Q3L A;  1NR4 A;  2KOL A;  2NZ1 D;  3I8Z A;  1ROD A;  1JE4 A;  4IUU A;  2HCC A;  1HUN A;  1SAP A;  1DOL A;  2RSO A;  1WTO A;  1QNK A;  4CJ2 C;  2KEE A;  2RA4 A;  2L9H A;  5E4W C;  1X3Q A;  2RSN A;  2L1B A;  1QG7 A;  4XDX A;  1EIH A;  1O7Y A;  2KUM A;  1HA6 A;  1VMC A;  2BDN A;  4MHE A;  4QUC A;  4IUT A;  5T1G A;  3HP3 A;  1NR2 A;  3F2U A;  1RJT A;  1U4P A;  1DOK A;  2FMM A;  2X6G A;  2FJ2 A;  3DEO A;  3UI2 A;  1ILQ A;  4IUR A;  1B50 A;  3H91 A;  1PFB A;  1ILP A;  2HDM A;  1EL0 A;  5EJW A;  1F9R A;  1QE6 A;  3KBX A;  4HAE A;  2JYO A;  4HCS A;  2KEC A;  4RWS C;  2EE1 A;  4MN3 A;  1B3A A;  4NW2 A;  4OIJ A;  1E0B A;  5D14 A;  1DON A;  1DZ1 A;  2DY8 A;  2R3Z A;  1C8C A;  1LV9 A;  2K04 A;  1EIG A;  3FDT A;  2CVR A;  2X69 A;  3GV6 A;  1S4Z A;  3LWE A;  4CJ0 B;  4O42 A;  1J8I A;  1WTX A;  2L11 A;  1KNA A;  2X6L A;  1X32 A;  2K01 A;  1GUW A;  1X3P A;  1MI2 A;  4IUV A;  5EPJ A;  1O7Z A;  1U4L A;  3FPU B;  2EPB A;  4LMQ D;  4OIK A;  2FIN B;  1WD0 A;  5EQ0 A;  3DEP A;  3IL8 A;  5CBE E;  1WD1 A;  2IL8 A;  2FFK B;  4X3U A;  2KED A;  2Q8R E;  4UAI A;  4X3T A;  1VMP A;  3N52 A;  3R93 A;  4RA8 A;  2NWG A;  1CA5 A;  1HFG A;  2MJ8 A;  1M8A A;  2SDF A;  1WVL A;  4ZAI A;  1BBX C;  1G91 A;  5T1I A;  2B2Y A;  1PLF A;  1ZXT A;  1PFM A;  1F2L A;  2XIW A;  3P7J A;  5EPK A;  1CA6 A;  1HFN A;  1DOM A;  1RTN A;  1MSG A;  1AZQ A;  1F9Q A;  2L4N A;  2KVM A;  4IUP A;  1HUM A;  5COR A;  5EKI A;  3TN2 A;  4R9W A;  1WTP A;  3DM1 A;  4CJ1 B;  3MTS A;  5JJZ A;  4XT1 B;  1PDQ A;  4ZKC B;  1XYI A;  1G2T A;  1MGS A;  1AP0 A;  1RHP A;  5AFW A;  2MP1 A;  3QO2 A;  1NAP A;  4IUQ A;  2MPM A;  2B2V A;  5E4X A;  5D65 A;  4HSV A;  1WTQ A;  3I90 A;  1WTR A;  1HHV A;  2K1B A;  1A15 A;  1MSH A;  2B2U A;  2N88 A;  1TVX A;  3SVM A;  2K28 A;  5CMD A;  2B2T A;  3Q6S A;  2N55 A;  1IKL A;  4X3K A;  1WTW A; 
#chains in the Genus database with same CATH topology
 3J7A F;  4OL7 A;  2JA6 B;  4R4O A;  4CDD C;  1AW7 A;  5EPL A;  4BBR G;  1UE6 A;  3MWY W;  2UUC L;  1NY4 A;  1X65 A;  4ZCK A;  2VXW A;  2ATW A;  2UXD L;  1Y8O B;  1XX8 A;  2E76 C;  4LW1 A;  1AZP A;  4A3F H;  1N33 L;  1U4M A;  4A76 A;  1HRJ A;  4LF4 Q;  1UE5 A;  2RCF A;  4WJW A;  2XRQ D;  1E2W A;  2LY7 A;  4K5X A;  2KJX A;  2PQA B;  4IN3 A;  3RZO H;  4FXD A;  2KOL A;  2XVS A;  2NTT A;  1ZKO A;  1K73 C;  2NUC A;  1QNK A;  2OQK A;  3CQZ H;  2YU9 H;  2L1B A;  2KQ3 A;  4KK7 A;  1EIH A;  2AKW B;  1EIF A;  4POG A;  1L0X B;  4DUZ L;  5DM6 3;  3CCQ A;  4PV1 C;  5HY6 A;  1L1O C;  4ID6 A;  2O5I C;  1I4G A;  4MIU A;  3I56 A;  1C8C A;  2K5W A;  2CVR A;  1D1I A;  4OXP A;  1SMY D;  3T13 A;  1WCM B;  2GN5 A;  3EQL C;  2DJG C;  4LF5 Q;  2CHB D;  3CPF A;  2JSO A;  1QUQ B;  4HN7 A;  4KD3 A;  4JI3 L;  4A3J H;  2E8G A;  2JA5 H;  3M3Y H;  1WYD A;  1PFM A;  2RKS A;  3MXU A;  4IJL A;  3P1H A;  4B9X A;  3X3M A;  1DOM A;  1JB3 A;  2ZT9 C;  5J3B A;  5FO7 B;  3NQT A;  1IHZ A;  1VQN A;  4K5V A;  4XT1 B;  2F0Q A;  1H9R A;  1MGS A;  5EKL A;  3CD6 A;  1E3P A;  2LSS A;  3D4W A;  4C2M B;  2PMZ E;  5IYC H;  4B3S L;  1ET9 A;  3NBH B;  2WKC A;  1I3Q H;  1H9S B;  4JYA L;  1A15 A;  4OO1 I;  4K8I A;  1VQA A;  2H5X A;  2JEB I;  4P72 A;  2HD3 A;  3TP5 A;  4CKB A;  5NUC A;  4N8X 1;  1V1Q A;  2D9U A;  2D0O A;  2B39 A;  1ICW A;  3EN2 A;  4A3M H;  3ND8 A;  3T56 B;  2Q2I A;  3HKZ E;  1ESR A;  1BCP D;  4A3C H;  4ZRZ A;  1EWI A;  2B8F A;  2AHO B;  3BJU A;  4B3M Q;  4HJ5 A;  3H0G H;  4OWT B;  4IOA A;  3L0O A;  3TBI B;  2B63 H;  4BY7 H;  2Z8L A;  5C6A A;  4S3S A;  1GOZ A;  3C1F A;  3HEJ A;  5I9P A;  1VQP A;  4DK6 C;  3HFZ B;  4EVO A;  1TT2 A;  2E5L L;  1VQF A;  1WFQ A;  4KMU C;  1P8L A;  2MHV A;  3S1M B;  1EEF D;  2RSO A;  3HOV B;  3LX0 A;  1VQO A;  1HNX Q;  4HMJ A;  2L9H A;  1SYD A;  2CH4 A;  2F0S A;  4LJZ C;  4DUY L;  3DUZ A;  5ELN A;  1V1P B;  2ZXP A;  1ILQ A;  4DK0 A;  2E2I H;  1PFB A;  1HZB A;  5JEA J;  1IXR A;  1Q8I A;  4HCS A;  3S1Q H;  2RDF A;  1OXS C;  4OIJ A;  1E0B A;  3A56 A;  1A8V A;  1LV9 A;  3GV6 A;  1KLU D;  1J8I A;  3HOZ B;  3SK4 A;  1H9K A;  3F2B A;  4G4K A;  3ND9 A;  4RGO S;  3KJP A;  5M3M B;  4DV6 Q;  3PO2 B;  2OCE A;  3GTM H;  2IX1 A;  3BU2 A;  2R93 G;  4WRD A;  2A8V A;  3E0J A;  3NHH A;  1STB A;  3T4A C;  2KED A;  3PUX A;  3S14 H;  4K2K A;  4ZYS A;  1NMG A;  3I4N B;  3MXN A;  1Q1E A;  2L5T A;  4DPG A;  1JOR A;  4QF4 A;  1PTO B;  3FHW A;  3C1E A;  1HFN A;  4A3E H;  4KHV A;  5KND A;  3GTK H;  2C5C A;  3G48 A;  1VQB A;  3D4D A;  3HG9 A;  3TN2 A;  4TRD A;  1WTP A;  3DM1 A;  5ELO A;  4C1N K;  4DU9 A;  4ZKC B;  2JA5 G;  4DA2 A;  1KDC A;  1J6Q A;  4OEL B;  1QOH A;  3C3L A;  5M3F B;  1YHQ A;  5HUR A;  1TWC H;  2B2U A;  3H15 A;  3I73 A;  2UUB Q;  3DM3 A;  1OO9 B;  1WTW A;  4XYQ A;  2QDB A;  3ERO A;  3M9B A;  1JQY D;  2Y0S G;  1B53 A;  2B2U C;  4DNI A;  1YIT A;  1S72 A;  3QB3 A;  4G7Z C;  2NVY H;  4C3J H;  1Y14 B;  2B2Y C;  2WV6 D;  3H09 A;  3TP6 A;  3SK6 A;  1VQK A;  4I7Z C;  3X3N A;  3VYR A;  4I7A A;  4KV6 A;  4A3C G;  4LF6 Q;  3D6W A;  1D5X C;  5JPM C;  3MA2 B;  4UP7 A;  3K0Y A;  5KYL A;  1PRT B;  4PZ6 A;  2NZO A;  2B63 G;  4IPH A;  3T51 B;  2G9D A;  3NUC A;  1HTP A;  4CBV A;  4LF9 Q;  2QEX A;  2WB1 B;  1TR5 A;  5JAV A;  2EYP A;  4H13 C;  1SJH D;  2PW7 A;  2RSN A;  3SHL A;  4XDX A;  1PH2 A;  4DR5 Q;  5T1G A;  4OON A;  4IUT A;  2J0T D;  4PG3 A;  3CMA A;  1II3 A;  4H0L C;  4GKJ Q;  2X6G A;  3PSI A;  2Z9H A;  2IT1 A;  1TS4 A;  1IZ6 A;  2NVX H;  4KY7 A;  3V05 A;  2V4D A;  2F0O A;  1FNW A;  2IW3 A;  5I6Y A;  2A6H C;  3N6R A;  3PCO B;  2TMP A;  3OW7 A;  3CKI B;  4BA1 I;  4F87 A;  1I94 L;  1B70 B;  1RIP A;  3U9O A;  1WD0 A;  3V2T A;  5IWA L;  5IYD H;  4P71 A;  3OOC A;  2RCN A;  1KIX A;  3GP7 A;  4NXN Q;  1KQS A;  1E2Z A;  1G8Z D;  4V19 0;  2Q8R E;  4X62 Q;  3N52 A;  4RA8 A;  5C44 H;  3BDO A;  1AFP A;  1W2B A;  3PUW A;  1GJX A;  3QOJ A;  4RKL A;  2RDG A;  4TQU S;  2JA8 H;  4B3T L;  2N49 A;  1D5M C;  2QF7 A;  2ALY B;  3K59 A;  5JPN C;  4CKC A;  3UDF A;  3IRB A;  1NNX A;  3GTL H;  2BOS A;  4A3B H;  4G57 A;  4JI8 Q;  3JAM E;  1Y1V H;  4LUZ A;  2XWJ B;  4ULL A;  4OO1 H;  1NE3 A;  3QO2 A;  4IUQ A;  4ABN A;  2QA4 A;  2PI2 E;  3S1N H;  2CFM A;  1KL9 A;  3Q6S A;  1XJV A;  2Q2H A;  1NTG A;  4C3H G;  2E75 C;  3K6O A;  1TY2 A;  3A8J E;  2F0P A;  2K50 A;  1H9J A;  1RD9 D;  5ELB A;  3SDZ A;  3NBH A;  5GAE C;  1H9S A;  5D3I B;  2JA7 G;  4LF4 L;  3CPW A;  1SE8 A;  2JP1 A;  1H9M A;  4NDX A;  1FVI A;  2K05 A;  5COY A;  1CTM A;  4MNO A;  2FHT A;  1IBL Q;  5EAY A;  4U68 A;  1CM9 A;  4Y7N B;  1N36 L;  1SN8 A;  3PO3 B;  4JI2 Q;  5M5Y H;  3S24 A;  4K5W A;  2D2C C;  3U58 A;  1ET6 A;  1R4P B;  2V1C C;  3NWS A;  3G6J B;  1Y8N B;  1BUV T;  1IBM Q;  1SND A;  4GLA C;  5KNB A;  4RCN A;  3STB D;  3VR5 A;  3C46 A;  1MD2 D;  4FXG C;  1DJR D;  4DR2 Q;  3KLR A;  3PV0 A;  4KI0 A;  3EJI A;  2DY8 A;  3AQQ A;  2PZW A;  4FF2 A;  3C2P A;  5CV4 A;  1VQL A;  4DAM A;  3FPP A;  4A3I B;  3F1Z A;  1YZ6 A;  3FMC A;  4LF5 L;  1EYD A;  1EFI D;  1Z47 A;  3GDE A;  1NBW A;  4OIK A;  1DGS A;  3KF6 A;  3SGI A;  5CBE E;  1WD1 A;  3HOU B;  4MTK A;  1L1O B;  2A6E C;  4DNR B;  5ELC A;  2JA6 G;  1PTO D;  2QCP X;  2SNM A;  1EOV A;  2XGT A;  1JT8 A;  3TSS A;  5IYD G;  3MVV A;  5KNC A;  1MSG A;  4ALP A;  3S1R B;  4KD4 A;  5IGC A;  2Z1C A;  1PZI D;  4DFA A;  5IOC A;  1PA6 A;  3MFG A;  3DMU A;  1I50 B;  5FJ8 G;  5CR3 A;  1TS3 A;  2F4I A;  3OHX C;  2I0Q A;  3DHQ A;  3GTG B;  5G3L D;  2A69 C;  2EDG A;  3MFY A;  3UDX A;  4DV5 Q;  3KLW A;  2HIX A;  4FO2 A;  3HOX H;  4JI4 Q;  2F0M A;  1MSH A;  2C35 B;  4WJ4 A;  4DK1 A;  1CZW A;  4KY6 A;  1Y1V G;  3G4S A;  1X56 A;  4WFN 3;  3FVQ A;  3AMU A;  4EGV A;  3VYU A;  3R3O A;  2EYM A;  4H02 A;  3T53 B;  2WIN B;  2Q2T A;  2OWO A;  4X3S A;  3BZK A;  3PUY A;  2MNA A;  3RN5 A;  3HOW B;  2L12 A;  2NTS A;  2Y0S E;  3HOY B;  4P75 A;  3SXH A;  3H94 A;  4DV7 L;  2EOT A;  3TS2 A;  1FR3 A;  4NXM Q;  1E2V A;  2WP8 J;  3ER0 A;  1UUP A;  4QIW B;  3K58 A;  3MC0 B;  3HKZ G;  3R8B A;  2OEO A;  3A5U A;  3GV3 A;  4BY1 H;  4ZUJ A;  3CC2 A;  1STY A;  2BE5 C;  1XMO Q;  1TWF H;  3GTJ H;  1ROD A;  4JBW A;  1PFS A;  4CJ2 C;  1UE1 A;  5IY0 A;  1R9T H;  2EY1 A;  1RDP D;  4K0K Q;  1HR0 L;  2K52 A;  1E22 A;  3HP3 A;  3RUZ A;  2R92 H;  4M8A A;  1VCI A;  5BR8 L;  1I5F A;  1QB5 D;  2K5Q A;  2N3S A;  4IJH A;  4YWM A;  4JBJ A;  5CYU A;  4IUR A;  1KDA A;  4AH6 A;  1PH7 A;  5GRO A;  5J1Z A;  3MHB A;  1BCP F;  1CK1 A;  3LGJ A;  3E9I A;  1B3A A;  1FGB D;  1JJC B;  1AE2 A;  2E2J H;  2PI2 A;  3JC6 6;  1PH5 A;  4DV1 Q;  1HZ9 A;  4FYD A;  3D3R A;  4DKA C;  1EU3 A;  3QOL A;  3K81 C;  3U4Z A;  3HKS A;  5F2D A;  1KTK A;  3BZD B;  3ULP A;  1YEZ A;  4C3I H;  4JI1 L;  1JMC A;  4RHS A;  1D6E C;  2O5J C;  2OF1 A;  4C1N I;  2F0E A;  5J39 A;  2RBM A;  4GLV B;  4DAV A;  5HGT A;  4EQO A;  1YNJ C;  4A3K B;  1BBX C;  3M85 A;  2NVT B;  1CQV A;  3P7J A;  1IBK L;  5EPK A;  4FF1 A;  1FD7 D;  3RR5 A;  1JWU D;  4UP8 A;  2Z0S A;  1JWS D;  1AN8 A;  4A3G H;  1ZYR C;  4CJ1 B;  3KJO A;  3TEH B;  2D62 A;  1GXD C;  1JR0 D;  1DXM A;  3DLL A;  1G29 1;  1W3S A;  5EBD A;  1NAP A;  1GHJ A;  2I46 A;  2CW0 C;  2UUB L;  4PZ7 A;  2K1B A;  5AJ3 Q;  4DK3 C;  3S17 H;  4LUO A;  3ULJ A;  4RCO A;  5CGK A;  5BN5 A;  2AUK A;  5C3W A;  1EY8 A;  4OEM B;  3CCV A;  4DV3 Q;  3HOX G;  1L2F A;  3T16 A;  3HOV G;  1A2U A;  2CH4 W;  2D0P A;  4AYB E;  5KIX A;  1EQR A;  1X54 A;  1PYW D;  1ENF A;  1M90 C;  2IWH A;  4L63 B;  4LF6 L;  4DR6 L;  3I3C A;  2RF4 A;  3NTK A;  3IFD A;  2A74 C;  4IQZ A;  4X6A H;  1U4R A;  3Q23 A;  1VQD A;  1C4Q A;  5GQO A;  1BXT A;  2SNS A;  4MTN A;  4LF9 L;  3BDC A;  5D3D A;  3HOZ G;  1SNO A;  1DOL A;  2BH8 A;  2KEE A;  2O4X A;  1VS0 A;  2A1A A;  1FYC A;  3PO2 G;  4BY1 G;  4NP5 A;  3U4V A;  3V96 A;  1XMQ Q;  1QG7 A;  2ZM6 Q;  2KUM A;  2UUA Q;  1X3E A;  5JJI A;  3RZD H;  4A3D B;  5C4J B;  3IFT A;  1SRO A;  3I2Z A;  1DOK A;  4TKO B;  2DNE A;  3H91 A;  3I4N G;  4WOR A;  2MO1 A;  2HDM A;  4JI7 L;  4JI6 Q;  2ZXR A;  4KJN A;  3NXW A;  2R92 G;  4YCW A;  3OTO L;  4ME3 A;  1LT6 D;  3OWE B;  1LT3 D;  3E5S A;  1SYE A;  5M3F G;  4F8M A;  3OSO A;  1O7Z A;  1CSQ A;  3DEP A;  2F52 A;  3IL8 A;  1C0A A;  2IL8 A;  4YCV A;  1TWA B;  1A3T A;  2I07 B;  1HFG A;  2SDF A;  3AFP A;  3K5M A;  1N9W A;  2VW9 A;  4EQN A;  3OMC A;  1TII D;  3VA7 A;  4C3I G;  2KHS A;  2DUD A;  1J5E L;  2AMC B;  2KEN A;  5EKI A;  2R93 H;  1Z7T A;  4JI8 L;  2F0G A;  3K5O A;  1HH2 P;  1Z6H A;  1TWG H;  3PIP A;  1SXT A;  2HHH Q;  1S40 A;  1WTQ A;  4A3G G;  3PGZ A;  3SVM A;  4JV5 Q;  3GTQ B;  4MZ9 A;  3P20 A;  1XNQ L;  2B2T A;  3KFU A;  1EQQ A;  2K03 A;  3S2D H;  3NEN A;  4UY8 C;  1EYC A;  1LTL A;  1T5X D;  4Q0F A;  1V8Q A;  1F9P A;  3AEV A;  3CCL A;  4RGT A;  1B2T A;  2B2T C;  2UXC L;  1PYS B;  2MGS A;  3M4P A;  4BBS H;  1CZG A;  5M5X B;  4K8J A;  1ENC A;  1K3R A;  3PIO 3;  1GHK A;  2I5H A;  4YWK A;  1SMY C;  4XIG S;  3GTP H;  2EJG C;  3J81 i;  2VB3 X;  1PFN A;  1IBL L;  2B8G A;  5C5M A;  3WOE A;  3KUP A;  1VQ6 A;  1K83 B;  5CBA E;  2OTL A;  5DLQ E;  2A68 D;  4JI2 L;  4IUN A;  3I8Z A;  1E7Z A;  1HUN A;  1TXY A;  5JVG 3;  5LMU Q;  3TDQ A;  5C3E B;  4XQN A;  1D1K A;  4A3L H;  4UDU C;  2MUY A;  5KEE A;  1Y1W B;  1VQ7 A;  1EYA A;  3E0E A;  4CGY B;  5A2Q L;  5DAU A;  2NB0 A;  2JK8 A;  1IBM L;  1O78 A;  2QEJ C;  3DWQ A;  1B3Q A;  5M5W B;  5C4X B;  2JE6 I;  1B1Z A;  4LFA Q;  4DR2 L;  3FRP B;  1EL0 A;  1K8O A;  4JBM A;  3VR4 A;  4MN3 A;  1YBY A;  1JC7 A;  3FKI B;  2DNC A;  4R4C A;  2K04 A;  1WTX A;  4B3R Q;  1KNA A;  2J4X A;  1D7Q A;  5C4H A;  3L9A X;  1BCP C;  1A63 A;  1U4L A;  3KF8 A;  4O0A A;  4TSS A;  4JC0 A;  2F1M A;  1Q86 C;  1MIU A;  5EKK A;  2F0L A;  4X3U A;  3T1Y Q;  4X66 L;  3GQB A;  3WWV A;  1LAC A;  3NK9 A;  2CWP A;  3F8T A;  5CC4 A;  1XWE A;  2VUM B;  2F3V A;  1RTN A;  2KCN A;  2FMC A;  3GTO B;  4DAY A;  1GUN A;  2KVM A;  2IHE A;  4R9W A;  3J7Y W;  1EYG A;  1CFM A;  2VB2 X;  2JQO A;  4DV5 L;  4EQ5 A;  1MJC A;  4JI4 L;  2YTY A;  1W6K A;  4LF7 L;  3VYT A;  2IPK D;  4DR7 Q;  1QJO A;  1A0I A;  1SYF A;  1BNZ A;  4BBR B;  2BA0 A;  1BO0 A;  2NVQ B;  3NE5 B;  3A74 A;  1A3U A;  1V1O A;  1ML0 D;  3DXJ C;  1NCV A;  1LYL A;  3R2T A;  4ILW A;  1U9R A;  5CV5 A;  3L7Z C;  4KKS A;  1TS2 A;  4C3H H;  4NXM L;  3CCM A;  1IW7 C;  2R7Z B;  1PTO F;  4BBS G;  3P75 A;  1STN A;  2DN8 A;  4GKK L;  4K6L A;  4GNX B;  3D4R A;  1K0R A;  3S16 B;  4CDE C;  1BVS A;  1PYB A;  2PPB C;  1TWH B;  3I91 A;  1LTI D;  3A0J A;  2HDL A;  2JA7 H;  1JB7 A;  5G3L F;  3OMG A;  2E2H B;  4DR4 L;  4A3I G;  2EYL A;  4X64 Q;  4A3K H;  4K0K L;  4DXF A;  3I4O A;  2K33 A;  1N32 Q;  1CT1 D;  5IOD A;  4DAP A;  1SFO H;  3J7A V;  2RHQ B;  4A3L G;  3S15 B;  4N9P A;  2K14 A;  4ME5 A;  4R4Q A;  5ELF A;  1Y69 U;  1F9R A;  4GZY C;  2I5L X;  2JYO A;  3ERS X;  2KCT A;  1DZ1 A;  1HNZ Q;  1FL0 A;  4R4T A;  3H3V I;  4GN4 B;  1X32 A;  3PIP 3;  1FJG L;  4XYO A;  1AH9 A;  4IUV A;  3T1H Q;  3SK8 A;  1PRT F;  1V9P A;  4K6D A;  1JWM D;  1KHI A;  1Q46 A;  3HGB A;  4FF4 A;  1C7Y A;  5C4Z A;  1X9N A;  1QVG A;  1B9M A;  2P5Z X;  2PQA A;  2A6H D;  1XPO A;  3BYY B;  4YY3 L;  2VQF Q;  2A5H A;  1VQG A;  1SNM A;  3UDI A;  5IGF A;  3S2H B;  4PQX A;  5LMN W;  1ENA A;  1GM5 A;  5IP9 H;  1GUS A;  4JOI A;  1F9Q A;  1LO5 D;  4JI5 Q;  3QR8 A;  2F0T A;  1PDQ A;  4J15 A;  3HOY G;  2UXD Q;  2EJM A;  4JOI C;  2JA6 H;  1LT4 D;  3CC4 A;  4LFB L;  1KC8 C;  1N33 Q;  1HNW Q;  3EBE A;  5AJ3 L;  3TS0 A;  3K7A B;  4JI0 Q;  2K28 A;  1XNR Q;  5FJ8 H;  1B9N A;  3G71 A;  1WTV A;  1CKN B;  4DV3 L;  4IO9 A;  2HCI A;  4ZQ3 A;  4LUV A;  1PH6 A;  2LKV A;  1S5C D;  5C4J H;  3BVZ A;  1G6Z A;  1KD1 C;  1BF4 A;  1EWC A;  3J81 L;  2KHJ A;  2G9H D;  4N8F A;  2OXP A;  1QUQ A;  4GOP B;  1SE3 A;  1F9S A;  1IKM A;  3UE1 A;  2AWN A;  1KNE A;  2EVB A;  3I4M B;  4RAU C;  4F7X A;  3L2P A;  4DUZ Q;  5GAD C;  5A35 A;  1SDF A;  1Q82 C;  4AYB G;  1I4P A;  1QVF A;  1WOC A;  4A3F B;  1I4H A;  1NR4 A;  1HXY D;  3HRZ C;  3A55 A;  5FK9 C;  1F77 A;  1M4V A;  4DV2 Q;  4BWG B;  1XMQ L;  4C56 C;  1VDZ A;  3TZU A;  5E4W C;  2ZM6 L;  1VF7 A;  2QKI C;  4L5T A;  1EU4 A;  1EY7 A;  4FVM A;  3RZO B;  5EBC A;  2EY6 A;  4HMI A;  1CQF A;  5E7N A;  3VR6 A;  2FJ2 A;  3KK7 A;  4A3K G;  1WCM H;  4DGZ A;  3CQZ B;  2AQ3 B;  4JI6 L;  1IYJ B;  1BBU A;  3AB9 A;  3NWT A;  4AIM A;  2AQ2 B;  4QY7 A;  2Z6K A;  2X69 A;  3EVQ A;  1KDB A;  4APV A;  1XXG A;  2VL6 A;  4J8Q A;  1UEB A;  1GUW A;  2Z6K C;  4YIJ A;  1JOK A;  1SLJ A;  1YHB A;  4HID A;  4JCV E;  2FIN B;  3NTI A;  3W5O A;  1VQI A;  4B3S Q;  1YNN C;  2N78 A;  1BDO A;  5K36 G;  1I4X A;  2NWG A;  3CU7 A;  1CA5 A;  4ZAI A;  4C2M H;  1UEA B;  1AZQ A;  4L8J A;  1UAP A;  1L0W A;  2XNA C;  3K80 C;  4OX9 Q;  1K9M C;  3I70 A;  4A3J B;  2JA5 B;  3OIP A;  2QGQ A;  4QB4 A;  4BS9 A;  2A6E D;  1V1P A;  5IP9 G;  4A4I A;  4BXX G;  4JV5 L;  1YJ9 A;  4HSP A;  2CKZ B;  3W1B A;  1XTC D;  1IKL A;  2VNU D;  2G5D A;  2HUG A;  1SNQ A;  1S5D D;  3STB C;  2E5L Q;  1OXV A;  1CUK A;  5DNF A;  3I55 A;  5JOB A;  3G7L A;  1EZ8 A;  1GVP A;  2K32 A;  3U50 C;  1PH4 A;  1LLR D;  3NEM A;  4RGN A;  2AWO A;  3EIV A;  4A3M B;  2H1E A;  1K3B C;  4DUY Q;  3H3V C;  3S1M H;  5IP7 G;  3CAM A;  2WAQ B;  4ZK9 B;  3HOV H;  5KRU A;  5LL6 S;  1JIC A;  3H0G B;  3PUV A;  5C0X G;  4AQY Q;  2B63 B;  4BY7 B;  1PTO C;  3PMF A;  5LMU L;  5CV7 A;  1ASY A;  5IGG A;  1SAP A;  2PYK A;  4B3M L;  1SEB D;  4B9W A;  3I72 A;  2RA4 A;  1X3Q A;  1DCZ A;  4O2D A;  2Z6B A;  4ZUI A;  5ELD A;  5BN4 A;  1XPU A;  1RJT A;  1YNX A;  2VZA A;  2FMM A;  3CRK C;  2BE5 D;  3HOZ H;  3UI2 A;  1B50 A;  2LFN A;  2PNH A;  5M3M H;  1QE6 A;  1EQV A;  1T9H A;  3H3V H;  3OWF A;  3PO2 H;  4NW2 A;  1DON A;  4KHP Q;  3KBG A;  5IT9 L;  4DV0 Q;  2R3Z A;  3HZX A;  3Q0A A;  4B3R L;  4QGU A;  1WCM G;  3EFX D;  5J22 A;  2XRS D;  1HNX L;  2E2I B;  4CDC C;  4IPG A;  1S5E D;  3I4N H;  3J80 i;  3PIO A;  1PTO H;  5EQ0 A;  1A62 A;  2UU9 Q;  3T1Y L;  1I4R A;  4UAI A;  1PH1 A;  3IKJ A;  3I4L A;  1F2Z A;  1NMF A;  1M8A A;  3BS1 A;  1G91 A;  1U0L A;  1LTA D;  3K0X A;  3GTM B;  1F2L A;  1PRT C;  3WOF A;  5M3F H;  1QNU A;  5LHY 1;  3TRZ A;  2OTJ A;  4IAL A;  4CKE A;  1EY0 A;  1SMX A;  2L4N A;  5JJL A;  1GKH A;  4KTA A;  4L5Q A;  4YHH Q;  1LTS D;  3GO5 A;  3RD4 A;  1ONL A;  3LNN A;  4DV6 L;  5CV6 A;  5GAG C;  1Q7Y C;  3TP7 A;  3W3A A;  5LL6 X;  1F2Y A;  4A3E B;  2QIL A;  3GTK B;  1HQM C;  1HZC A;  1VQ5 A;  1HHV A;  3VR3 A;  5FLX L;  3D8G A;  4A93 B;  1BKB A;  1Q12 A;  5I6W A;  4J1M A;  1GO3 E;  1IYU A;  1VQH A;  4QIW E;  3ULL A;  4UP9 A;  5CV9 A;  1TWC B;  4RHR A;  2K4K A;  5C3E G;  1SE4 A;  4IPD A;  4R8I A;  5M9O A;  1UE7 A;  1J9O A;  1V43 A;  3QWN A;  1G6P A;  2HQE A;  2NVY B;  3RLO A;  4H44 C;  4C3J B;  2CWA A;  5I2Y A;  2H4O A;  4L6T B;  1D2B A;  3FKI G;  3W2D A;  2IY5 B;  4IOC A;  3MXN B;  1LTB D;  2EXD A;  4KN4 C;  2WKD A;  1Y8P B;  1LTG D;  4GOP A;  4LFC Q;  2F0F A;  2JEA I;  2L55 A;  5I4D A;  3CP0 A;  3OW2 A;  4TVA B;  4QUC A;  4MHE A;  3G6E A;  2NN6 H;  3F2U A;  3E9H A;  2YYZ A;  5A2Q E;  3CHB D;  3FEW X;  3D6C A;  2KA7 A;  1B7Y B;  5IYB H;  4HAE A;  2VUM G;  3URY A;  2EE1 A;  1HNZ L;  1R4Q B;  4E6I A;  3J80 c;  3ZJY C;  4O42 A;  2KBN A;  2NVX B;  1DD2 A;  4FXK C;  2AUJ D;  5M3M G;  3RLN A;  3CCJ A;  4DR5 L;  3FPU B;  2EPB A;  4DXG A;  3A8K E;  1KXL A;  5FOB B;  4GKJ L;  2ZTC A;  3CXC A;  4GN3 B;  2VQF L;  1Q1B A;  2UXB Q;  1KAA A;  3H6M A;  2SEB D;  4RKB A;  3R2I A;  2EZV A;  4JI5 L;  1HUM A;  4R1J A;  4IZ8 A;  2L0C A;  3I4M H;  1O7L A;  3AYH B;  3MTS A;  3NTH A;  5C44 B;  2VQE Q;  3NSW A;  1XYI A;  4YCU A;  2R7Z G;  2BCO A;  1HNW L;  2JA8 B;  3KLS A;  3DWA A;  4NXN L;  4KJO A;  3F2D A;  4JI0 L;  1XNR L;  4HSV A;  4X62 L;  1Q90 A;  3GTL B;  2PZT A;  3VR2 A;  4A3B B;  1Y1V B;  2F03 A;  1EY6 A;  1SRU A;  1O80 A;  1KRT A;  2F4V Q;  1S5B D;  1KAW A;  1N36 Q;  3KYH C;  5I2X A;  2PMZ B;  3S1N B;  4LAA A;  4IFD G;  1IL8 A;  2OT2 A;  3M7G A;  1I6H B;  2KCC A;  3RLF A;  1JE5 A;  1L1O A;  4Y7N H;  3BG3 A;  4HCE A;  3PO3 H;  2RQX A;  4PNY A;  4LK1 C;  1PMR A;  2GVA A;  2F0D A;  2XWB B;  2R7D A;  1STH A;  1WTH A;  1CHQ D;  3HKZ B;  3VA5 A;  1JJG A;  2D5D A;  5L37 A;  1Q3L A;  2KCM A;  2KHI A;  5E3F A;  4BA2 I;  3MEF A;  4NB3 A;  1FNV A;  2WB1 G;  3D31 A;  3A7L A;  2BDO A;  2HCC A;  4DV2 L;  4LWC A;  1IYV A;  4R8N A;  1CI3 M;  4JK1 C;  2BDN A;  2GVB A;  1T5E A;  1X6O A;  4KKU A;  2JJQ A;  1H95 A;  5LMN Q;  2MFI A;  3NBI A;  5M5Y B;  3DEO A;  2LXJ A;  2Z4I A;  3RMH A;  5C0X I;  4A3I H;  4DR3 Q;  3KBX A;  3K57 A;  2KEC A;  3HS0 C;  3J80 L;  2NN6 G;  1PVO A;  4QJF A;  2EJF C;  3E6Z X;  3HOU H;  2F0V A;  5IYB G;  3BZC A;  1MBY A;  2ES2 A;  1X3P A;  3E3X A;  1HTL D;  3FP9 A;  4RMF A;  4HJA A;  3S1R H;  1VQM A;  4RH6 A;  2I5M X;  3DWP A;  1I50 H;  1EWH A;  3NP8 A;  3A54 A;  3GTG H;  4JW0 A;  3K7U C;  1ZEQ X;  4R4I A;  3BYT B;  3O13 A;  2IX0 A;  4OX9 L;  2A68 C;  1A3V A;  1G2T A;  5JEA H;  5AFW A;  1SJE D;  1QZG A;  2JN4 A;  4DV7 Q;  4FF3 A;  2F3W A;  2B2V A;  5EGT A;  3Q24 A;  1PV4 A;  2NBF A;  3B6Y A;  4DR1 Q;  3I4M G;  1U5K A;  3HOW H;  4X3K A;  4DV4 Q;  3MAQ A;  2B2V C;  3HOY H;  3PF4 A;  3Q8D A;  4A3F G;  4KLK A;  4POF A;  3HOX B;  4OWW B;  4P2C B;  1AE3 A;  3BVG A;  2K5N A;  4Z9C B;  4KKT A;  3A5Z B;  1YI2 A;  1SNC A;  2GA4 B;  4PMB A;  1I4Q A;  1SYG A;  2DY7 A;  3J81 E;  3L3O C;  1EOT A;  2F0U A;  1HR0 Q;  4ZLT F;  5E1F A;  1BOS A;  5BR8 Q;  3ITP A;  3CCE A;  3KF6 B;  1RTO A;  2E74 C;  4AQY L;  5IGE A;  4HIK A;  3UE0 A;  1OXX K;  5DM7 3;  2TSS A;  3PO3 G;  2IX3 A;  1EY9 A;  1WTO A;  1IW7 D;  2A73 B;  1NSN S;  1LTR D;  2LMC B;  3J81 c;  4BY1 B;  2PCF B;  1LTT D;  1LAB A;  1HA6 A;  5FO8 B;  1VMC A;  3CRL C;  1TWF B;  2F0W A;  3GD7 A;  1N34 Q;  2BH2 A;  4JI1 Q;  3GTJ B;  3NEL A;  2RHS B;  4HJ7 A;  5CV8 A;  3OPO A;  4OHJ A;  4J6H A;  1R9T B;  4JG2 A;  4NPS A;  4KHP L;  4DV0 L;  4RWS C;  1XMO L;  2ZXO A;  1IBK Q;  2Z4H A;  2R92 B;  2YV5 A;  3FDT A;  1WVL A;  4CJ0 B;  4A93 H;  1MJE A;  3J7Z C;  4A3J G;  2X6L A;  2M9V A;  1YHA A;  2NVT H;  5EPJ A;  1KRS A;  3QG1 A;  2UU9 L;  3CW2 C;  1Q8K A;  1E24 A;  3RNU A;  4LF8 Q;  4X65 Q;  4KN7 C;  2E2J B;  1X3F A;  3HOU G;  4PZ8 A;  1PZK D;  3M7N A;  1M1K C;  1SYB A;  1HCZ A;  1OXU A;  2MJ8 A;  5C5L A;  5IYC G;  1K0S A;  1YJN A;  2B2Y A;  2XN9 C;  1ZXT A;  3W1G A;  2CQA A;  1L0Y B;  4C3I B;  4NMZ A;  4YHH L;  4NKL A;  4DV1 L;  1LT5 D;  2R6G A;  5K36 H;  5HGQ A;  2IHF A;  4A3M G;  1RHP A;  1SNP A;  1I6V C;  3JAM i;  4DR6 Q;  4XXE A;  5IE8 A;  2WAQ G;  2QDL A;  5ELE A;  4A3G B;  5CMD A;  1STE A;  1S3O A;  2FXQ A;  3H0G G;  4FDB A;  5JEA G;  4BY7 G;  2ZJQ A;  1NUC A;  1SBB B;  1P16 A;  4BXX H;  3BDL A;  2RVL A;  1RF2 D;  1STA A;  4QUF A;  2UUC Q;  3HOW G;  4QMG A;  5JJK A;  3S17 B;  1G2S A;  1PHJ A;  2F0I A;  2HT1 A;  2DJF C;  4HED A;  1BR9 A;  1MHW C;  1D8L A;  3CME A;  4K14 A;  2BA1 A;  1EEI D;  3BVM A;  4Q5V A;  4GN5 A;  4RGM A;  4JI7 Q;  2MO0 A;  2Q8I B;  4IFD I;  4LFC L;  4DNT B;  4A3D H;  2NZ1 D;  4HIO A;  1JE4 A;  2SOB A;  1K8M A;  1PXU A;  4PMW A;  3OTO Q;  5IP7 H;  3M4O B;  2WAC A;  4OWX B;  3AU7 A;  4U67 3;  4P73 A;  2O2L D;  3KDF B;  3M4Q A;  5TSS A;  2WB1 E;  5C0X H;  2PZU A;  1QIL A;  1Z9F A;  2CQO A;  4FNF A;  1NR2 A;  4B08 A;  5IIF A;  5FLM H;  3MXG A;  1ILP A;  1C48 A;  2HQL A;  3PUZ A;  4V0B A;  1CHP D;  2ENB A;  4OGQ C;  5DEH A;  3Q22 A;  2CCZ A;  3RZD B;  5IGB A;  1DYQ A;  2F0K A;  4FP5 D;  3LWE A;  2VS1 A;  1J5E Q;  1TWA H;  1WI5 A;  5IT9 E;  1K8G A;  3SR1 A;  2K01 A;  2UUA L;  4HR7 B;  2EYO A;  4A3E G;  5H1S E;  3F2C A;  1JCK B;  3A7A B;  1SYC A;  2UXB L;  4A93 G;  2VY3 A;  4X3T A;  3KOJ A;  3OIQ A;  2K7V A;  3UDG A;  2C9O A;  1XNQ Q;  5C0X J;  2YU9 B;  2ZJP A;  1PZJ D;  2NN6 I;  1RKN A;  1HA5 A;  1PLF A;  1HR0 W;  4JI3 Q;  1I6H H;  1EUJ A;  2XIW A;  4I65 A;  2ZTE A;  4A75 A;  1HZA A;  4CDF C;  4EQP A;  2JXM B;  2R7F A;  2VQE L;  2UXC Q;  1PH9 A;  1CSP A;  3IAY A;  5IT9 c;  5GAH C;  3GTQ H;  1ESF A;  1QVC A;  4XQJ A;  1TU2 B;  3JAM c;  1YNN D;  3NQI A;  1VQ9 A;  1E1O A;  2F3I A;  2K75 A;  2ASB A;  1B8A A;  2AQ1 B;  3SEB A;  3ZYY X;  4UHV A;  2EXZ A;  1W6J A;  5E4X A;  4C3J G;  1EY5 A;  3I90 A;  5M5X H;  2ICI A;  2R93 B;  1O7I A;  1TVX A;  1VQ8 A;  4JYA Q;  2F4V L;  1VF5 C;  4H7B A;  5FLX E;  2L15 A;  2NYZ D;  1BBW A;  1MKH A;  1TWG B;  3SE0 A;  4HIM A;  1IL2 A;  3ONA B;  2M00 A;  4DF7 A;  1C9O A;  3J7A 5;  2EQS A;  2PNR C;  1EZ6 A;  5K5P A;  1K28 A;  4DN4 M;  3S2D B;  1K83 H;  1JOO A;  1B4O A;  3OYY A;  4ZKB B;  2HHH L;  3M3Y B;  1HPC A;  2EYH A;  4JVZ A;  4BBS B;  3K8A A;  2K5V A;  3TQY A;  1PH8 A;  2EY2 A;  2IJ0 A;  2J7Z A;  3RN2 A;  5C3E H;  3LWU A;  3SK5 A;  5FO9 B;  2ZJR A;  1Y1W H;  5FLX c;  2N8N A;  1VQE A;  1TQO A;  3MEH A;  2E2D C;  1SSO A;  3GTP B;  1YIJ A;  2Y0S B;  2B29 A;  4L5S A;  1I3Q B;  4EX5 A;  4IUU A;  2A69 D;  1YJW A;  3CCR A;  5C4X H;  5M5W H;  1VQ4 A;  1OTC A;  2NZH A;  1EY4 A;  1S5F D;  2ICE C;  1TKW B;  1D5Z C;  1GUT A;  3VYS A;  2PO4 A;  5LMN L;  3FKI H;  4A3D G;  3J81 j;  3A8I E;  4KY5 A;  3PQI A;  3TRE A;  5C3X A;  5JVH 3;  1X55 A;  1UNS A;  4DR3 L;  4GLX A;  3EA6 A;  4X66 Q;  1NJI C;  3AFQ A;  1OXT A;  1CKO A;  5EJW A;  1BQQ T;  1AEX A;  5D14 A;  4LNQ A;  4GS3 A;  2EY5 A;  1EIG A;  1A2T A;  2ID0 A;  1S4Z A;  5C44 G;  1B44 D;  2F0H A;  2L11 A;  3CCS A;  5FLM G;  4CHT B;  4F88 A;  1A6X A;  2JA8 G;  1MI2 A;  4LMQ D;  4KHZ A;  2VUM H;  3WDN A;  1RCV D;  2WFW A;  3GTO H;  1EFW A;  4GNX A;  2FFK B;  3S9W A;  1RL2 A;  4LFA L;  4A3B G;  4O1N A;  4OO1 G;  4LF7 Q;  3TP8 A;  1HJP A;  1DM0 B;  2MQH A;  3ICE A;  2XSC A;  4GNX C;  3TME A;  2EIF A;  5IGD A;  3D0F A;  2XTI A;  2K5D A;  2LXK A;  3MXP A;  2A19 A;  4IUP A;  4HTH A;  4JBK A;  3JAM L;  2PW5 A;  1G51 A;  4Y52 H;  1LM0 A;  5KYI A;  1SR3 A;  2EYJ A;  5I9O A;  3S1Q B;  3CC7 A;  4BBR H;  4DR1 L;  2MPM A;  3MZ5 A;  4QCL A;  2NVQ H;  5D65 A;  1LUZ A;  2WII B;  1PRT D;  4DV4 L;  1JOQ A;  5KGU A;  2N55 A;  4GKK Q;  1PH3 A;  2Q8T A;  4YWL A;  2F0J A;  3TZD A;  3QIA A;  2M2L A;  4XT3 B;  4G7O C;  2WAQ E;  2R7Z H;  1GUG A;  1JJ2 A;  4P74 A;  1STG A;  1EIY B;  1BCP B;  4DR4 Q;  3S14 B;  1UWV A;  4WJ3 M;  1EQT A;  3S16 H;  1TWH H;  1VQJ A;  1TY0 A;  1YNJ D;  2B2W A;  3KF8 B;  2E2H H;  2OQ0 A;  1TS5 A;  4IFD H;  1XTD A;  1XPR A;  2EYF A;  1QZH A;  4DR7 L;  4QQB X;  2B2W C;  3CF5 A;  4K2L A;  1ZYR D;  4C3H B;  4XQQ A;  3I7F A;  2PQE A;  4AYB B;  3K5N A;  3VDY A;  3CCU A;  4PMC A;  1GD7 A;  4IPC A;  4UPA A;  4DAY B;  1Y1W G;  2QW7 A;  3S15 H;  1SE2 A;  2CW0 D;  1FJG Q;  1KLG D;  1N34 L;  3PF5 A;  1O7Y A;  5FKA C;  4HJ9 A;  4L5R C;  2JA7 B;  1ICF B;  1YVC A;  2ZTD A;  1QWY A;  1U4P A;  5C4X G;  1KAB A;  2RDH A;  1CKN A;  1ASZ A;  4YY3 Q;  2LS0 1;  2YTX A;  2JA9 A;  3KLS X;  4QL5 A;  4M1U B;  3ERQ A;  1SFO B;  2R61 A;  1Q81 C;  4IFD J;  3KDF A;  4ODG A;  4X64 L;  3J80 E;  4JPB W;  2Q2U A;  4HJ8 A;  2K5H A;  3S2H H;  1E1T A;  1N32 L;  4LF8 L;  2K6A A;  4X65 L;  5BN3 A;  4LFB Q;  4GOP C;  4N9T A;  1I94 Q;  5IWA Q;  1CKM A;  1VMP A;  3R93 A;  3U9S A;  1HQR D;  1X3G A;  1VQC A;  1N8R C;  5T1I A;  3M4Y A;  5ISR A;  2YTV A;  1CA6 A;  1WJJ A;  3NPP A;  4B3T Q;  1F2M A;  5COR A;  2B3G A;  2F0N A;  3K7A H;  4G7H C;  5JJZ A;  1FGU A;  2DGY A;  3T1H L;  3K5L A;  1AP0 A;  1FNU A;  2MP1 A;  2HIV A;  1K8A C;  4XTC S;  3QJY A;  1WTR A;  1GUO A;  3M4O H;  1QCB D;  2N88 A;  4RFB A;  4RG1 A; 
#chains in the Genus database with same CATH homology
 3J7A F;  4OL7 A;  2JA6 B;  1AW7 A;  5EPL A;  3MWY W;  2VXW A;  1Y8O B;  1XX8 A;  2E76 C;  1AZP A;  1U4M A;  1HRJ A;  4WJW A;  2XRQ D;  1E2W A;  2LY7 A;  4K5X A;  2KJX A;  4IN3 A;  4FXD A;  2KOL A;  2XVS A;  2NTT A;  1ZKO A;  2NUC A;  1QNK A;  2L1B A;  2KQ3 A;  4KK7 A;  1EIH A;  1L0X B;  5DM6 3;  4PV1 C;  4ID6 A;  2O5I C;  1I4G A;  4MIU A;  1C8C A;  2K5W A;  2CVR A;  1D1I A;  1SMY D;  3T13 A;  1WCM B;  3EQL C;  2CHB D;  2JSO A;  4HN7 A;  4KD3 A;  1PFM A;  2RKS A;  3MXU A;  3P1H A;  4B9X A;  3X3M A;  1DOM A;  1JB3 A;  2ZT9 C;  5FO7 B;  3NQT A;  1IHZ A;  4K5V A;  4XT1 B;  2F0Q A;  1H9R A;  1MGS A;  5EKL A;  3D4W A;  4C2M B;  1ET9 A;  2WKC A;  1H9S B;  1A15 A;  4OO1 I;  4K8I A;  2JEB I;  3TP5 A;  4CKB A;  5NUC A;  2D9U A;  2B39 A;  1ICW A;  3ND8 A;  3T56 B;  1ESR A;  1BCP D;  4ZRZ A;  2B8F A;  3TBI B;  2Z8L A;  5C6A A;  4S3S A;  1GOZ A;  3C1F A;  3HEJ A;  5I9P A;  4EVO A;  1TT2 A;  4KMU C;  2MHV A;  3S1M B;  1EEF D;  2RSO A;  3HOV B;  3LX0 A;  4HMJ A;  2L9H A;  1SYD A;  2F0S A;  4LJZ C;  3DUZ A;  1V1P B;  2ZXP A;  1ILQ A;  4DK0 A;  1PFB A;  5JEA J;  1Q8I A;  4HCS A;  2RDF A;  1OXS C;  4OIJ A;  1E0B A;  3A56 A;  1LV9 A;  3GV6 A;  1KLU D;  1J8I A;  3HOZ B;  3SK4 A;  1H9K A;  4G4K A;  3ND9 A;  4RGO S;  5M3M B;  3PO2 B;  2IX1 A;  4WRD A;  3E0J A;  3NHH A;  1STB A;  3T4A C;  2KED A;  3PUX A;  4K2K A;  4ZYS A;  3I4N B;  3MXN A;  1Q1E A;  2L5T A;  1JOR A;  4QF4 A;  1PTO B;  3C1E A;  1HFN A;  4KHV A;  5KND A;  2C5C A;  3D4D A;  3HG9 A;  3TN2 A;  4TRD A;  1WTP A;  3DM1 A;  4C1N K;  4DU9 A;  4ZKC B;  4DA2 A;  1KDC A;  1QOH A;  3C3L A;  5M3F B;  5HUR A;  2B2U A;  3I73 A;  1OO9 B;  1WTW A;  4XYQ A;  2QDB A;  3ERO A;  1JQY D;  1B53 A;  2B2U C;  3QB3 A;  4G7Z C;  2B2Y C;  2WV6 D;  3H09 A;  3TP6 A;  3SK6 A;  4I7Z C;  3X3N A;  3VYR A;  4KV6 A;  3D6W A;  1D5X C;  5JPM C;  3MA2 B;  3K0Y A;  5KYL A;  1PRT B;  3T51 B;  2G9D A;  3NUC A;  1HTP A;  4CBV A;  2WB1 B;  1TR5 A;  5JAV A;  2EYP A;  4H13 C;  1SJH D;  2PW7 A;  2RSN A;  3SHL A;  4XDX A;  5T1G A;  4IUT A;  2J0T D;  1II3 A;  4H0L C;  2X6G A;  2IT1 A;  1TS4 A;  4KY7 A;  3V05 A;  2V4D A;  2F0O A;  1FNW A;  2IW3 A;  5I6Y A;  2A6H C;  3N6R A;  2TMP A;  3OW7 A;  3CKI B;  4BA1 I;  4F87 A;  3U9O A;  1WD0 A;  3V2T A;  3OOC A;  3GP7 A;  1E2Z A;  1G8Z D;  4V19 0;  2Q8R E;  3N52 A;  4RA8 A;  3BDO A;  1AFP A;  3PUW A;  1GJX A;  3QOJ A;  4RKL A;  2RDG A;  4TQU S;  1D5M C;  2QF7 A;  3K59 A;  5JPN C;  4CKC A;  2BOS A;  4G57 A;  3JAM E;  2XWJ B;  4ULL A;  4OO1 H;  3QO2 A;  4IUQ A;  4ABN A;  3Q6S A;  4C3H G;  2E75 C;  3K6O A;  1TY2 A;  3A8J E;  2F0P A;  1H9J A;  1RD9 D;  5ELB A;  3SDZ A;  3NBH A;  1H9S A;  5D3I B;  2JP1 A;  1H9M A;  4NDX A;  2K05 A;  5COY A;  1CTM A;  2FHT A;  4U68 A;  1CM9 A;  4Y7N B;  3PO3 B;  4K5W A;  2D2C C;  1ET6 A;  1R4P B;  3NWS A;  3G6J B;  1Y8N B;  1BUV T;  1SND A;  5KNB A;  4RCN A;  3VR5 A;  3C46 A;  1MD2 D;  4FXG C;  1DJR D;  3KLR A;  3PV0 A;  4KI0 A;  3EJI A;  2DY8 A;  4FF2 A;  2PZW A;  3C2P A;  5CV4 A;  3FPP A;  4A3I B;  3FMC A;  1EYD A;  1EFI D;  1Z47 A;  4OIK A;  5CBE E;  1WD1 A;  3HOU B;  4DNR B;  2A6E C;  5ELC A;  1PTO D;  2QCP X;  2SNM A;  3TSS A;  3MVV A;  5KNC A;  1MSG A;  3S1R B;  4KD4 A;  5IGC A;  2Z1C A;  1PZI D;  4DFA A;  5IOC A;  3MFG A;  3DMU A;  1I50 B;  5CR3 A;  1TS3 A;  2F4I A;  3OHX C;  3DHQ A;  3GTG B;  5G3L D;  2A69 C;  2EDG A;  3MFY A;  4FO2 A;  2F0M A;  1MSH A;  4DK1 A;  1CZW A;  4KY6 A;  4WFN 3;  3FVQ A;  3AMU A;  4EGV A;  3VYU A;  3R3O A;  2EYM A;  3T53 B;  2WIN B;  4X3S A;  3PUY A;  3HOW B;  2L12 A;  2NTS A;  3HOY B;  3SXH A;  3H94 A;  2EOT A;  1FR3 A;  1E2V A;  2WP8 J;  1UUP A;  4QIW B;  3K58 A;  3MC0 B;  3R8B A;  2OEO A;  3GV3 A;  4ZUJ A;  1STY A;  2BE5 C;  1ROD A;  4JBW A;  4CJ2 C;  2EY1 A;  1RDP D;  3HP3 A;  3RUZ A;  4M8A A;  1VCI A;  1QB5 D;  2K5Q A;  5CYU A;  4IUR A;  1KDA A;  5J1Z A;  3MHB A;  1BCP F;  1CK1 A;  1B3A A;  1FGB D;  4FYD A;  3D3R A;  1EU3 A;  3QOL A;  5F2D A;  1KTK A;  3BZD B;  4RHS A;  1D6E C;  2O5J C;  2OF1 A;  4C1N I;  2F0E A;  5J39 A;  2RBM A;  4DAV A;  5HGT A;  4EQO A;  1YNJ C;  4A3K B;  1BBX C;  3M85 A;  2NVT B;  1CQV A;  3P7J A;  5EPK A;  4FF1 A;  1FD7 D;  1JWU D;  1JWS D;  1AN8 A;  1ZYR C;  4CJ1 B;  2D62 A;  1GXD C;  1JR0 D;  1DXM A;  1G29 1;  5EBD A;  1NAP A;  1GHJ A;  2I46 A;  2CW0 C;  2K1B A;  4RCO A;  5CGK A;  5BN5 A;  2AUK A;  5C3W A;  1EY8 A;  3T16 A;  1A2U A;  5KIX A;  1PYW D;  1ENF A;  2IWH A;  4L63 B;  3I3C A;  3NTK A;  3IFD A;  2A74 C;  4IQZ A;  1U4R A;  3Q23 A;  1C4Q A;  1BXT A;  2SNS A;  3BDC A;  5D3D A;  1SNO A;  1DOL A;  2KEE A;  2O4X A;  1FYC A;  4NP5 A;  3V96 A;  1QG7 A;  2KUM A;  4A3D B;  5C4J B;  3IFT A;  4TKO B;  1DOK A;  2DNE A;  3H91 A;  4WOR A;  2HDM A;  2ZXR A;  4KJN A;  3NXW A;  1LT6 D;  3OWE B;  1LT3 D;  3E5S A;  1SYE A;  4F8M A;  3OSO A;  1O7Z A;  3DEP A;  3IL8 A;  2IL8 A;  1TWA B;  1A3T A;  2I07 B;  1HFG A;  2SDF A;  3K5M A;  4EQN A;  3OMC A;  1TII D;  3VA7 A;  4C3I G;  2KHS A;  5EKI A;  1Z7T A;  2F0G A;  3K5O A;  1Z6H A;  1SXT A;  1WTQ A;  3SVM A;  3GTQ B;  3P20 A;  2B2T A;  2K03 A;  1EYC A;  1T5X D;  4Q0F A;  1V8Q A;  1F9P A;  4RGT A;  1B2T A;  2B2T C;  2MGS A;  1CZG A;  5M5X B;  4K8J A;  1ENC A;  3PIO 3;  1GHK A;  1SMY C;  4XIG S;  2EJG C;  2VB3 X;  1PFN A;  2B8G A;  5C5M A;  3WOE A;  3KUP A;  1K83 B;  5CBA E;  2A68 D;  4IUN A;  3I8Z A;  1HUN A;  5JVG 3;  3TDQ A;  5C3E B;  4XQN A;  1D1K A;  4UDU C;  2MUY A;  5KEE A;  1Y1W B;  1EYA A;  4CGY B;  5A2Q L;  5DAU A;  2NB0 A;  1O78 A;  2QEJ C;  3DWQ A;  5M5W B;  5C4X B;  2JE6 I;  1B1Z A;  3FRP B;  1EL0 A;  1K8O A;  3VR4 A;  4MN3 A;  1JC7 A;  3FKI B;  2DNC A;  2K04 A;  1WTX A;  1KNA A;  2J4X A;  5C4H A;  3L9A X;  1BCP C;  1U4L A;  3KF8 A;  4TSS A;  2F1M A;  5EKK A;  2F0L A;  4X3U A;  3GQB A;  1LAC A;  3NK9 A;  5CC4 A;  1XWE A;  2VUM B;  2F3V A;  1RTN A;  2KCN A;  2FMC A;  3GTO B;  4DAY A;  1GUN A;  2KVM A;  4R9W A;  3J7Y W;  1CFM A;  2VB2 X;  1W6K A;  3VYT A;  2IPK D;  1QJO A;  1SYF A;  1BNZ A;  4BBR B;  2BA0 A;  1BO0 A;  2NVQ B;  3NE5 B;  1A3U A;  1V1O A;  1ML0 D;  3DXJ C;  1NCV A;  3R2T A;  4ILW A;  1U9R A;  5CV5 A;  3L7Z C;  4KKS A;  1TS2 A;  1IW7 C;  2R7Z B;  1PTO F;  3P75 A;  1STN A;  2DN8 A;  4K6L A;  3D4R A;  3S16 B;  2PPB C;  1TWH B;  3I91 A;  1LTI D;  2HDL A;  5G3L F;  3OMG A;  2E2H B;  2EYL A;  4DXF A;  2K33 A;  1CT1 D;  5IOD A;  4DAP A;  3J7A V;  3S15 B;  4N9P A;  4ME5 A;  5ELF A;  1Y69 U;  4GZY C;  1F9R A;  2JYO A;  1DZ1 A;  1X32 A;  3PIP 3;  4XYO A;  4IUV A;  3SK8 A;  1PRT F;  4K6D A;  1JWM D;  3HGB A;  4FF4 A;  5C4Z A;  1B9M A;  2A6H D;  3BYY B;  2A5H A;  1SNM A;  5IGF A;  3S2H B;  4PQX A;  1ENA A;  1GUS A;  1F9Q A;  1LO5 D;  2F0T A;  1PDQ A;  2EJM A;  1LT4 D;  3K7A B;  2K28 A;  1B9N A;  1WTV A;  2HCI A;  4ZQ3 A;  2LKV A;  1S5C D;  3BVZ A;  1G6Z A;  1BF4 A;  1EWC A;  3J81 L;  2G9H D;  2OXP A;  1SE3 A;  1F9S A;  1IKM A;  2AWN A;  1KNE A;  2EVB A;  3I4M B;  4RAU C;  4F7X A;  5A35 A;  1SDF A;  1I4P A;  4A3F B;  1I4H A;  1NR4 A;  1HXY D;  3HRZ C;  3A55 A;  5FK9 C;  1F77 A;  1M4V A;  4BWG B;  4C56 C;  1VDZ A;  3TZU A;  5E4W C;  1VF7 A;  2QKI C;  1EU4 A;  1EY7 A;  4FVM A;  3RZO B;  5EBC A;  2EY6 A;  4HMI A;  1CQF A;  3VR6 A;  2FJ2 A;  3KK7 A;  4DGZ A;  3CQZ B;  2AQ3 B;  3NWT A;  3AB9 A;  2AQ2 B;  2X69 A;  3EVQ A;  1KDB A;  1XXG A;  4J8Q A;  1GUW A;  4YIJ A;  1JOK A;  2FIN B;  3NTI A;  1YNN C;  1BDO A;  5K36 G;  1I4X A;  2NWG A;  3CU7 A;  1CA5 A;  4ZAI A;  1UEA B;  1AZQ A;  4L8J A;  1UAP A;  2XNA C;  3I70 A;  4A3J B;  2JA5 B;  3OIP A;  4QB4 A;  4BS9 A;  2A6E D;  1V1P A;  4HSP A;  1XTC D;  1IKL A;  2VNU D;  2HUG A;  1SNQ A;  1S5D D;  1OXV A;  5DNF A;  5JOB A;  3G7L A;  1EZ8 A;  2K32 A;  1LLR D;  4RGN A;  2AWO A;  4A3M B;  2H1E A;  3H3V C;  2WAQ B;  4ZK9 B;  5KRU A;  5LL6 S;  1JIC A;  3H0G B;  3PUV A;  5C0X G;  2B63 B;  4BY7 B;  1PTO C;  3PMF A;  5CV7 A;  5IGG A;  1SAP A;  2PYK A;  1SEB D;  4B9W A;  3I72 A;  2RA4 A;  1X3Q A;  1DCZ A;  4ZUI A;  5ELD A;  5BN4 A;  1RJT A;  2FMM A;  3CRK C;  2BE5 D;  3UI2 A;  1B50 A;  2LFN A;  1QE6 A;  1EQV A;  3OWF A;  4NW2 A;  1DON A;  3KBG A;  5IT9 L;  2R3Z A;  3HZX A;  3Q0A A;  3EFX D;  5J22 A;  2XRS D;  2E2I B;  1S5E D;  1PTO H;  5EQ0 A;  1I4R A;  4UAI A;  3IKJ A;  3I4L A;  1F2Z A;  1M8A A;  3BS1 A;  1G91 A;  1LTA D;  3GTM B;  1F2L A;  1PRT C;  3WOF A;  1QNU A;  5LHY 1;  4IAL A;  4CKE A;  1EY0 A;  2L4N A;  4KTA A;  1LTS D;  3GO5 A;  3RD4 A;  1ONL A;  3LNN A;  5CV6 A;  3TP7 A;  3W3A A;  5LL6 X;  1F2Y A;  4A3E B;  2QIL A;  3GTK B;  1HQM C;  1HHV A;  3VR3 A;  5FLX L;  3D8G A;  4A93 B;  1Q12 A;  5I6W A;  4J1M A;  1IYU A;  5CV9 A;  1TWC B;  4RHR A;  1SE4 A;  4R8I A;  5M9O A;  1J9O A;  1V43 A;  3QWN A;  2HQE A;  2NVY B;  4H44 C;  4C3J B;  5I2Y A;  2H4O A;  4L6T B;  1D2B A;  3W2D A;  1LTB D;  4KN4 C;  2WKD A;  1Y8P B;  1LTG D;  2F0F A;  2JEA I;  2L55 A;  5I4D A;  4QUC A;  4MHE A;  2NN6 H;  3F2U A;  2YYZ A;  5A2Q E;  3CHB D;  3FEW X;  3D6C A;  2KA7 A;  4HAE A;  3URY A;  2EE1 A;  1R4Q B;  4E6I A;  4O42 A;  2NVX B;  1DD2 A;  4FXK C;  2AUJ D;  3FPU B;  2EPB A;  4DXG A;  3A8K E;  5FOB B;  1Q1B A;  1KAA A;  3H6M A;  2SEB D;  4RKB A;  3R2I A;  2EZV A;  1HUM A;  4IZ8 A;  2L0C A;  1O7L A;  3MTS A;  3NTH A;  5C44 B;  3NSW A;  1XYI A;  2BCO A;  2JA8 B;  3KLS A;  3DWA A;  4KJO A;  4HSV A;  1Q90 A;  3GTL B;  2PZT A;  3VR2 A;  4A3B B;  1Y1V B;  2F03 A;  1EY6 A;  1O80 A;  1S5B D;  5I2X A;  2PMZ B;  3S1N B;  4LAA A;  4IFD G;  1IL8 A;  2OT2 A;  3M7G A;  1I6H B;  2KCC A;  3RLF A;  3BG3 A;  4HCE A;  2RQX A;  4PNY A;  4LK1 C;  1PMR A;  2F0D A;  2XWB B;  1STH A;  3HKZ B;  1CHQ D;  3VA5 A;  2D5D A;  1Q3L A;  5E3F A;  4BA2 I;  1FNV A;  3D31 A;  3A7L A;  2BDO A;  2HCC A;  1IYV A;  4R8N A;  1CI3 M;  4JK1 C;  2BDN A;  1T5E A;  4KKU A;  3NBI A;  5M5Y B;  3DEO A;  2Z4I A;  3RMH A;  5C0X I;  3KBX A;  3K57 A;  2KEC A;  3HS0 C;  3J80 L;  2NN6 G;  2EJF C;  3E6Z X;  2F0V A;  1MBY A;  1X3P A;  1HTL D;  4RH6 A;  3DWP A;  1EWH A;  3NP8 A;  3A54 A;  1ZEQ X;  3BYT B;  3O13 A;  2IX0 A;  2A68 C;  1A3V A;  1G2T A;  5JEA H;  5AFW A;  1SJE D;  4FF3 A;  2F3W A;  2B2V A;  5EGT A;  3Q24 A;  2NBF A;  4X3K A;  3MAQ A;  2B2V C;  3HOX B;  4P2C B;  3BVG A;  4Z9C B;  4KKT A;  1SNC A;  2GA4 B;  4PMB A;  1I4Q A;  1SYG A;  2DY7 A;  3J81 E;  3L3O C;  1EOT A;  2F0U A;  4ZLT F;  5E1F A;  1BOS A;  3ITP A;  1RTO A;  2E74 C;  5IGE A;  1OXX K;  5DM7 3;  2TSS A;  2IX3 A;  1EY9 A;  1WTO A;  1IW7 D;  2A73 B;  1NSN S;  1LTR D;  2LMC B;  4BY1 B;  2PCF B;  1LTT D;  1LAB A;  1HA6 A;  5FO8 B;  1VMC A;  3CRL C;  1TWF B;  2F0W A;  3GD7 A;  3GTJ B;  5CV8 A;  3OPO A;  4OHJ A;  4J6H A;  1R9T B;  4RWS C;  2ZXO A;  2Z4H A;  2R92 B;  3FDT A;  1WVL A;  4CJ0 B;  2X6L A;  2M9V A;  5EPJ A;  3QG1 A;  4KN7 C;  2E2J B;  1PZK D;  3M7N A;  1SYB A;  1HCZ A;  1OXU A;  2MJ8 A;  5C5L A;  2B2Y A;  2XN9 C;  1ZXT A;  2CQA A;  1L0Y B;  4C3I B;  4NMZ A;  4NKL A;  1LT5 D;  2R6G A;  5K36 H;  1RHP A;  1SNP A;  1I6V C;  4XXE A;  5ELE A;  4A3G B;  5CMD A;  1STE A;  5JEA G;  1NUC A;  1SBB B;  3BDL A;  2RVL A;  1RF2 D;  1STA A;  4QUF A;  4QMG A;  3S17 B;  1G2S A;  2F0I A;  4HED A;  1BR9 A;  4K14 A;  2BA1 A;  1EEI D;  3BVM A;  4Q5V A;  4RGM A;  2Q8I B;  4IFD I;  4DNT B;  2NZ1 D;  1JE4 A;  2SOB A;  1K8M A;  1PXU A;  4PMW A;  3M4O B;  2WAC A;  3AU7 A;  4U67 3;  2O2L D;  5TSS A;  5C0X H;  2PZU A;  1QIL A;  4FNF A;  1NR2 A;  4B08 A;  5IIF A;  3MXG A;  1ILP A;  1C48 A;  3PUZ A;  4V0B A;  1CHP D;  2ENB A;  4OGQ C;  5DEH A;  3Q22 A;  3RZD B;  5IGB A;  1DYQ A;  2F0K A;  4FP5 D;  3LWE A;  5IT9 E;  3SR1 A;  2K01 A;  4HR7 B;  2EYO A;  1JCK B;  3A7A B;  1SYC A;  4X3T A;  3OIQ A;  2K7V A;  2C9O A;  5C0X J;  2YU9 B;  1PZJ D;  2NN6 I;  1RKN A;  1HA5 A;  1PLF A;  2XIW A;  4I65 A;  4EQP A;  2JXM B;  3IAY A;  1ESF A;  4XQJ A;  1TU2 B;  1YNN D;  3NQI A;  2AQ1 B;  3SEB A;  3ZYY X;  2EXZ A;  1W6J A;  5E4X A;  4C3J G;  1EY5 A;  3I90 A;  2ICI A;  2R93 B;  1TVX A;  1VF5 C;  4H7B A;  5FLX E;  1TWG B;  2NYZ D;  3SE0 A;  3ONA B;  2M00 A;  4DF7 A;  2PNR C;  1EZ6 A;  5K5P A;  4DN4 M;  3S2D B;  1JOO A;  1B4O A;  4ZKB B;  3M3Y B;  1HPC A;  2EYH A;  4BBS B;  2EY2 A;  2IJ0 A;  2J7Z A;  3LWU A;  3SK5 A;  5FO9 B;  1TQO A;  3MEH A;  2E2D C;  1SSO A;  3GTP B;  2Y0S B;  1I3Q B;  4IUU A;  2A69 D;  1EY4 A;  1S5F D;  2ICE C;  1TKW B;  1D5Z C;  1GUT A;  3VYS A;  2PO4 A;  3A8I E;  4KY5 A;  5C3X A;  5JVH 3;  1UNS A;  3EA6 A;  1OXT A;  5EJW A;  1BQQ T;  1AEX A;  5D14 A;  2EY5 A;  1EIG A;  1A2T A;  2ID0 A;  1S4Z A;  1B44 D;  2F0H A;  2L11 A;  4CHT B;  4F88 A;  1A6X A;  1MI2 A;  4LMQ D;  4KHZ A;  3WDN A;  1RCV D;  2FFK B;  3S9W A;  4O1N A;  4OO1 G;  3TP8 A;  1DM0 B;  2XSC A;  3TME A;  5IGD A;  2K5D A;  3MXP A;  4IUP A;  4HTH A;  3JAM L;  2PW5 A;  5KYI A;  2EYJ A;  5I9O A;  3S1Q B;  2MPM A;  3MZ5 A;  4QCL A;  5D65 A;  2WII B;  1PRT D;  1JOQ A;  5KGU A;  2N55 A;  2Q8T A;  2F0J A;  3TZD A;  3QIA A;  2M2L A;  4XT3 B;  4G7O C;  1GUG A;  1STG A;  1BCP B;  3S14 B;  1EQT A;  1TY0 A;  1YNJ D;  2B2W A;  1TS5 A;  4IFD H;  2EYF A;  2B2W C;  4K2L A;  1ZYR D;  4C3H B;  4XQQ A;  4AYB B;  2PQE A;  3K5N A;  4PMC A;  1SE2 A;  2CW0 D;  1KLG D;  1O7Y A;  5FKA C;  2JA7 B;  1QWY A;  1U4P A;  1KAB A;  2RDH A;  2LS0 1;  3KLS X;  4M1U B;  3ERQ A;  1SFO B;  2R61 A;  4IFD J;  4ODG A;  3J80 E;  2K6A A;  5BN3 A;  4N9T A;  1VMP A;  3R93 A;  3U9S A;  1HQR D;  5T1I A;  3M4Y A;  5ISR A;  1CA6 A;  3NPP A;  1F2M A;  5COR A;  2F0N A;  4G7H C;  5JJZ A;  3K5L A;  1AP0 A;  1FNU A;  2MP1 A;  4XTC S;  3QJY A;  1WTR A;  1GUO A;  1QCB D;  2N88 A;  4RFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...