4LF5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf5Q00
1E7ZA 1S3OA 2NVYH 3I55A 1JJGA 4GN3B 3UDIA 1IYJB 2PQAB 3GTJH 3H3VI 4NB3A 3EIVA 1SROA 1FJGQ 2F4VL 3M3YH 5EAYA 4LFCL 1L1OA 1P8LA 1H95A 5JJIA 4DV2Q 1HZCA 1X3GA 2CKZB 3HOWG 5DLQE 4LFAQ 3KLWA 2D62A 1N36Q 4UP9A 4L5SA 2ATWA 3KDFA 3D0FA 1N9WA 5J3BA 2NZHA 1XMOQ 1HZ9A 3H0GH 1CKNB 2R6GA 3H0GG 3DLLA 4DV1L 4K0KL 2DGYA 4B3SQ 2L15A 4LF5Q 4IFDG 1CKOA 1SMXA 3VDYA 4B3RL 4DR5L 2JK8A 2IX1A 4EQ5A 3S17H 2NVTH 4ME3A 4NPSA 4JOIC 3CW2C 5IYCH 3OTOQ 4HJ7A 1PHJA 2UUBL 5IYCG 4MNOA 1NY4A 2UXDQ 2HIXA 4JI1L 1PH1A 1QUQB 1YHAA 3I56A 1CSQA 1X56A 4HJ9A 3H15A 4B3TL 4LF8L 1B8AA 2MNAA 1IZ6A 4DV5L 4DPGA 4JI0L 3CCRA 4JI8L 3RN2A 1V43A 3UE1A 3RNUA 2JA7G 1TXYA 1X55A 1EFWA 3W1BA 2HT1A 2KHJA 1PH7A 4YWMA 3ULLA 2HQLA 4YHHL 1VQKA 2WFWA 4Y7NH 4KHPL 4AYBE 1B7YB 2WAQG 1SR3A 2CQOA 3F2BA 2ZJPA 3M85A 3CCSA 5LMNQ 1OTCA 1A62A 2HIVA 3CQZH 4IJHA 4TVAB 3RLOA 1IBKL 4GKKL 1I6HH 1A63A 1L1OB 3PV0A 1VQJA 3BZCA 4DV0L 1Q82C 4L5RC 1G6PA 4A4IA 3K7AH 4DR3L 2I0QA 1YVCA 1XNRQ 3M4PA 3CCLA 1LUZA 2VL6A 3GO5A 2I5MX 4JI5Q 1TWHH 3EN2A 4O0AA 1GD7A 1JE5A 3K7UC 3JAMi 4A3CH 4A3IH 4YWKA 2EIFA 4A3CG 4Y52H 4DR6L 4O2DA 3KOJA 5IP7H 4DV3Q 2YV5A 1OXXK 5IP9H 5IP7G 4C2MH 5C4JH 1HNZL 1X54A 5C4XG 4DV4Q 3E9IA 4BBSH 3AFPA 1PH4A 4RMFA 4LF4L 4BBSG 4HJAA 3BJUA 1B70B 1G51A 4A3KH 3GTQH 4YCWA 5IYDH 4A3KG 1K8GA 3G71A 2ALYB 3HOXH 5IYDG 1PFSA 5BR8Q 1MKHA 1W2BA 4JOIA 3HOXG 4OWTB 3S2HH 4JBJA 4R4IA 1CSPA 5JJKA 4GNXC 4JI7L 4NXNQ 2PMZE 4KHZA 4DR1L 1SFOH 1BBWA 5M3MH 4EX5A 2K4KA 1Q1EA 2B3GA 5M5XH 2R7ZH 1N34Q 1JB7A 2UXBQ 4UP8A 2R7ZG 1PYSB 3HKSA 2Q2UA 5JEAJ 2LSSA 2N78A 3RR5A 2BH8A 1NBWA 1VCIA 4P71A 5C0XJ 3OYYA 5C3EG 1QZHA 4YCUA 2N49A 2MFIA 3B6YA 4YY3Q 4QGUA 1L0WA 1HZBA 1K83H 1Z47A 3NBHB 2AKWB 4QY7A 4R1JA 2ZM6L 1YITA 4OX9L 3CP0A 4JI2Q 3TRZA 4P73A 4MZ9A 2E5LQ 4X66Q 5LMNW 1Q1BA 4JYAQ 1FL0A 1G291 1PYBA 5AJ3L 3FHWA 4DUYL 2BH2A 1PVOA 4BY1H 5M3FH 4GLVB 4GLXA 4BY1G 2JA6H 3U4VA 5M3FG 1Y14B 2ZTEA 2JA6G 4IOCA 1XMQQ 5LMUL 2NZOA 2GN5A 4X64L 3I4NH 3UDGA 1HR0W 4IOAA 4IPGA 4DV7Q 2N8NA 1N32Q 1K9MC 3E0EA 1FGUA 4KI0A 3W5OA 4UY8C 2JEBI 5GADC 2ZJRA 3M4QA 4HJ5A 1QVGA 1X3FA 3GDEA 1S72A 2UUCQ 1UE1A 3F8TA 2F3IA 4GLAC 3CF5A 3GTKH 1XNQQ 3U58A 1LM0A 1OXVA 3FKIH 5FLXc 1UE6A 3FKIG 3T1YQ 4HJ8A 4RG1A 3KJOA 4R4CA 4GNXA 1N8RC 4K0KQ 4JV5L 1HJPA 3HOYH 1NTGA 1BVSA 2VW9A 1UEBA 4X62L 4A3EH 2NVXH 1YI2A 3HOYG 4A3EG 2Q2IA 1I94L 1VQ6A 2MO1A 4HIMA 4DUZQ 3A74A 5M5WH 1KD1C 2ZTCA 1YIJA 3HOWH 1KXLA 3J7A5 3K8AA 5JJLA 1XPOA 5IWAL 3CCEA 1C0AA 2A19A 1Q12A 1HH2P 3PUZA 1QVCA 3AQQA 2RCNA 1K8AC 4P74A 1N33L 2VQEL 1J5EL 1VS0A 2K5HA 3STBD 3L2PA 1HNWL 2CWPA 2UXCQ 1TWGH 4DR4L 1EQRA 3CXCA 3AFQA 4DR7Q 1JMCA 2VS1A 4DR2Q 2A8VA 3CD6A 3A5UA 3AEVA 3HOVH 4DAMA 4GN4B 2BA1A 5IE8A 4AQYL 1ASYA 3HOVG 1T9HA 1S40A 1YHBA 1LTLA 1HNXL 1YJ9A 4GKJQ 1HR0L 5ELOA 4NXMQ 4IO9A 4A3GH 2GVBA 3A0JA 2RHQB 4A3GG 4LF7L 4L5TA 4X65Q 4R4QA 5C0XI 3PIOA 1GM5A 2JA7H 4JI3L 3L7ZC 4QL5A 1YNXA 1VQBA 4GNXB 3S1NH 2UUAL 1VQ4A 4PZ6A 1GVPA 1O7IA 1RL2A 3UDFA 4JI6L 3JC66 4OO1G 5K36G 2F4VQ 4JI4L 1VQGA 3T1HL 4A75A 4A76A 4LFCQ 1VQ7A 1UE7A 4OO1I 1K3RA 4DKAC 1IBLL 1WFQA 3D31A 3UE0A 2JA8H 1M1KC 1D8LA 4APVA 1LYLA 2JA8G 3G48A 5GROA 4AIMA 1E1TA 3KDFB 2QEXA 3CAMA 4IJLA 2JA9A 1KRSA 1PV4A 2BA0A 4P75A 3J81i 2E2IH 4B3ML 4JBMA 1UE5A 1I50H 1VQDA 3KYHC 2IHEA 3K81C 4BY7G 1Q46A 4DV1Q 1C7YA 4LF9L 1L2FA 3I2ZA 5C4XH 4B3RQ 1IBML 4DV6L 1X65A 4DR5Q 1J6QA 4BA2I 2JA5H 1NMFA 5GAGC 1MJEA 2B63H 3RLNA 1YHQA 2JA5G 2B63G 1VQ5A 2UUBQ 4LF6L 2I5HA 1JJCB 2R7FA 3RZDH 4JI1Q 4UP7A 3J81j 4B3TQ 4LF8Q 1SLJA 4KLKA 2NN6G 2QGQA 3ER0A 1KIXA 4DV5Q 4JI0Q 2OQ0A 2JE6I 1VQFA 4JI8Q 3S24A 3BZKA 2NN6I 1E1OA 1NE3A 4OXPA 1MIUA 3CMAA 4IPCA 2E2JH 4OWWB 5M5YH 3G6EA 1OXUA 3CCQA 3JAMc 2Z0SA 3CCMA 4YHHQ 2JJQA 3J81c 5C3EH 3DM3A 1VQOA 4KHPQ 3U4ZA 3I7FA 1ASZA 3HOUH 2V1CC 4GKKQ 1WOCA 3HOUG 3NEMA 3GTLH 1IBKQ 2R93H 2HHHL 4DV0Q 2K52A 4LFBL 2ZTDA 2R93G 2VQFL 4DR3Q 2UU9L 2ZJQA 3M7NA 4YCVA 1XPUA 4HIKA 4IFDJ 3I4MH 4X6AH 1AE3A 3KFUA 3I4MG 1UWVA 1GO3E 1TWFH 4R4OA 4TQUS 2VNUD 1K73C 3PO2G 3ZJYC 2PNHA 3PUYA 4DR6Q 4GS3A 2XGTA 1L1OC 1AH9A 2PQAA 2D0PA 1YJWA 1Y1VG 1FJGL 1AE2A 1HNZQ 4DK6C 4GN5A 1CKMA 1E22A 1V1QA 1X3EA 2D0OA 2IHFA 3PCOB 5GQOA 4LUZA 4LF4Q 1VQHA 2IX0A 2QA4A 2YTYA 4DV2L 1VQLA 2MO0A 2AHOB 2OTJA 1JT8A 2K14A 1VQPA 3F2DA 4LFAL 1N36L 1PH3A 4A3DH 2B29A 2GVAA 1XMOL 4A3DG 1KRTA 1EQQA 4JI7Q 2ES2A 4DR1Q 1HZAA 2Y0SE 3K80C 4B3SL 4LF5L 4JC0A 5E7NA 2EXDA 5IT9c 3CMEA 5IYBH 1Q86C 3GTGH 4HIDA 4GOPC 5IYBG 3OTOL 4JG2A 2UXDL 4XTCS 1YZ6A 2Q2HA 1QZGA 1GKHA 4A3JH 2CFMA 4A3JG 3HKZE 3F1ZA 1EOVA 1PH6A 1VQEA 3F2CA 2HHHQ 1VQNA 2ID0A 2ZM6Q 4OX9Q 4BXXH 2OQKA 1PH5A 2VUMG 4BXXG 2RHSB 3M9BA 4IPDA 3NELA 4JBWA 4R4TA 4BBRH 1XPRA 3GTPH 4AH6A 4PZ8A 4BBRG 5C44H 5AJ3Q 3TEHB 5C44G 4DUYQ 3BU2A 3ICEA 4A3LH 1WJJA 4P72A 2Z6KC 2OCEA 4A3MH 3WWVA 2CCZA 3FP9A 4A3LG 1N32L 5LMNL 4QJFA 1NMGA 3W1GA 1OXTA 2IT1A 4A3MG 5LMUQ 1XTDA 4X64Q 2LXKA 1A8VA 2R92H 1I3QH 3GD7A 3S14H 5FLMH 2E8GA 2JQOA 2A1AA 2R92G 4JV5Q 2IY5B 4LWCA 5FLMG 1XNRL 2K50A 2OWOA 2FXQA 1TWCH 2KBNA 5JEAG 4JI5L 3K0XA 3U50C 5C0XG 1EUJA 4C3JH 5FJ8H 5FJ8G 3PF4A 3CC4A 3LGJA 5ELNA 3ERSX 2MQHA 2EQSA 2E2HH 2KENA 4DV3L 1Q8KA 1Z9FA 3PGZA 1Y1WH 4UPAA 1Y1WG 4JBKA 1VQIA 3MEFA 3PO3H 4DV4L 4DK3C 4DNIA 3TS2A 1I5FA 4YWLA 1SN8A 1PA6A 1VQCA 1YBYA 2WB1G 1TWAH 2I5LX 1R9TH 3PO3G 4X62Q 4IFDI 4FDBA 4L5QA 2K75A 3TS0A 1I94Q 2R7DA 3ULJA 5BR8L 4GOPA 3E9HA 2AMCB 1OXSC 1IXRA 1E24A 2PI2E 3KJPA 3PSIA 5IWAQ 4QQBX 4A3FH 1YEZA 4NXNL 4A3FG 3S16H 1N33Q 3HFZB 2VQEQ 2YTXA 4LW1A 1J5EQ 3IRBA 4LNQA 2XTIA 4BY7H 1N34L 1HNWQ 2UXBL 3KF8B 1EIFA 4C3IH 4DR4Q 3OW2A 3STBC 1E3PA 1YJNA 4LUOA 2Y0SG 2Z6KA 5HGQA 1PH8A 3S15H 4AQYQ 1U5KA 4YY3L 1PH2A 3J80i 2VY3A 3J7ZC 3EBEA 1BBUA 1VQ8A 1HNXQ 1DGSA 1CUKA 4JI2L 3S1QH 4BA1I 4PG3A 1NJIC 4QIWE 5HY6A 4X66L 3PUVA 1C9OA 1HR0Q 2E5LL 2YU9H 3HOZH 3S1MH 4JYAL 1Q7YC 3RLFA 3HOZG 1U0LA 2JEAI 1M90C 2KCTA 4LF7Q 3TREA 4C3HH 1K0RA 3Q8DA 4HIOA 4A3IG 3S2DH 4JI3Q 3HKZG 1SRUA 1V9PA 2LXJA 2YYZA 4XIGS 3TQYA 1VQMA 1XMQL 2KHIA 2CWAA 2UUAQ 5H1SE 3S1RH 5IP9G 3GTOH 1W3SA 3KF6A 1KQSA 4DV7L 4JI6Q 2K5NA 3CCUA 4H02A 2AWNA 1KHIA 3MXNB 4DAYB 4JI4Q 3T1HQ 5IY0A 1VQ9A 2UUCL 4GOPB 4WJ4A 3AYHB 4OONA 1IBLQ 1Q81C 4A3BH 1XNQL 2KCMA 4A3BG 4JCVE 3PIPA 2DUDA 3PUXA 1X6OA 3J80c 4B3MQ 3ULPA 2WB1E 4PMWA 3T1YL 3PO2H 3CC7A 1WCMH 4POFA 5M3MG 1WCMG 3CPWA 1WYDA 1KAWA 3I4OA 5GAHC 3CCJA 1JJ2A 1Y1VH 3CC2A 2ASBA 4LF9Q 3G4SA 1QVFA 1EIYB 2VZAA 1IBMQ 4DV6Q 1A0IA 4DUZL 1FVIA 4J15A 4A93H 4LF6Q 2PI2A 3RZOH 4A93G 3SGIA 2OTLA 2WP8J 1EWIA 2C35B 2YTVA 3CPFA 3UDXA 2N3SA 2WAQE 3PF5A 2AWOA 2UXCL 1XJVA 1PH9A 1EYGA 1CKNA 1WI5A 4DR7L 1KL9A 4IPHA 3RN5A 4WJ3M 1BKBA 5GAEC 4DR2L 4POGA 3KF6B 3M4OH 2K5VA 1X9NA 3I4NG 4MTNA 1RIPA 1KC8C 4PZ7A 3NENA 1IL2A 1SE8A 2NVQH 1D7QA 4OWXB 1QUQA 4AYBG 3CCVA 3L0OA 4GKJL 4LFBQ 2F52A 2VQFQ 2UU9Q 4NXML 1MJCA 2VUMH 3A5ZB 4ALPA 1P16A 4X65L 2RF4A 3GTMH 1VQAA 4LUVA 3PUWA 2H5XA 2Q2TA 3H3VH
chains in the Genus database with same CATH superfamily
1F2MA 1V1PA 4FO2A 4A93B 2NVYH 3I55A 1IYJB 2PQAB 3RZOB 1SE3A 5EKKA 4BS9A 1TIID 5DM63 4NB3A 2CQAA 1F9PA 4LFCL 1RKNA 5JJIA 1HZCA 2CKZB 3HOWG 4PMCA 2K32A 1K8MA 2D62A 1N36Q 4L5SA 2NZHA 1XMOQ 3NQTA 2X69A 4IFDH 1F9QA 1CKOA 1VDZA 3DWQA 4B3RL 2IX1A 4HCSA 4Q0FA 1PHJA 2J0TD 3OTOQ 5IYCG 4K5WA 3GTMB 4XYQA 1PH1A 1YHAA 4B3TL 4K6DA 4LF8L 3VR3A 1DOLA 1A2UA 3GTJB 2ENBA 1PFNA 3CCRA 3M3YB 4OL7A 3UE1A 2H1EA 3RNUA 4DAVA 2HT1A 5AFWA 5C6AA 5JJZA 4AYBE 2CQOA 3F2BA 5IGGA 5LMNQ 1A62A 3A55A 1DONA 1SYDA 1H9MA 1VQJA 3H0GB 3K7AH 4A4IA 3CCLA 3MFYA 3NBHA 4ZKCB 2RDGA 4A3CH 3OMGA 4YWKA 4Y52H 3URYA 4EQOA 1AN8A 5IP7H 4DV3Q 5C4XG 1DCZA 4QMGA 1NCVA 1RTNA 4BBSH 4OHJA 3G7LA 1QWYA 4LF4L 4RGNA 2L5TA 2B39A 4JPBW 4I7AA 3GTQH 3G71A 1PFSA 4RHRA 5BR8Q 2WAQB 5JJKA 5C5MA 4H44C 3CQZB 4NXNQ 4LAAA 2K4KA 2B3GA 5M5XH 5IIFA 1KNAA 4UP8A 1D5ZC 2R7ZG 2PW7A 2Q2UA 5JEAJ 2LSSA 3C1FA 5ELBA 1VCIA 1QZHA 2DNCA 1L0WA 1HZBA 1Z47A 1SNPA 3TRZA 2AKWB 4R1JA 3SEBA 4OX9L 2FMMA 3CP0A 4JI2Q 5G3LD 3MTSA 1JB3A 1PYBA 4BY1H 2JA6H 3T56B 2ZTEA 2EDGA 3MEHA 3I4NH 2I07B 4IOAA 3S2HB 3H91A 2OF1A 4DK0A 4UY8C 2MJ8A 1CK1A 2JEBI 4DFAA 4ULLA 5A35A 2UUCQ 1G8ZD 2F3IA 3GTKH 1C4QA 1YNJD 3FKIH 4YIJA 5EKIA 4KHVA 1HJPA 5G3LF 3QOJA 4HIMA 1B1ZA 1KXLA 4DNTB 3SXHA 4OIJA 1PZKD 1HH2P 1Y8PB 5JAVA 3BDOA 1J5EL 2O2LD 4B08A 3K58A 2FHTA 1CT1D 1JMCA 3DEPA 2EY5A 3A5UA 4QUCA 4DAMA 4GN4B 1ASYA 4AQYL 3HOVG 1S40A 3IL8A 1YHBA 4C1NI 4XT3B 1LTLA 4RWSC 1HR0L 5ELOA 2GVBA 1B50A 1GJXA 4A3EB 5C0XI 4K5VA 1F9RA 5J22A 4QL5A 5M5WB 3S1NH 2UUAL 3DMUA 5COYA 1BOSA 5CV5A 3UDFA 4JI6L 5K36G 1W6JA 3GTPB 1VQGA 1IBLL 2B2TC 2SDFA 1TKWB 2F0IA 2B8GA 1K8OA 3KDFB 4B3ML 1QILA 1I3QB 1I50H 5C3WA 4RCNA 3K81C 3ND8A 4F87A 4DV1Q 1Z7TA 1L2FA 1BNZA 1RJTA 3V2TA 4DR5Q 1J6QA 4HSPA 5CMDA 4BA2I 4A3GB 1AP0A 1YHQA 1CI3M 3OW7A 5KRUA 1Y1WB 1NAPA 1SLJA 5J1ZA 1BDOA 4JI0Q 4V190 2B2VC 4JI8Q 5CR3A 4EQNA 1H9KA 3TZDA 4OXPA 2MHVA 4IPCA 2E2JH 3DUZA 3MHBA 5M5YH 3G6EA 3CCQA 1VQOA 3J81c 5C3EH 1XYIA 2KEDA 3DWPA 3I7FA 4JW0A 4GKKQ 3NEMA 1IBKQ 3RD4A 2K52A 4BY7B 4DR3Q 1R4QB 3WOEA 3M7NA 3HEJA 2B2YC 1HPCA 3I4MH 4X3KA 1QOHA 1UWVA 3OHXC 2B63B 2JA5B 2B2TA 1EY0A 2VNUD 1CFMA 2A73B 2XGTA 4FNFA 2PQAA 1AE2A 1S5ED 1TVXA 3NTKA 1CKMA 3S1MB 1LTGD 1V1QA 1X3EA 5GQOA 2AQ3B 4LUZA 2QA4A 1T5EA 2K14A 4LFAL 3QR8A 3K0YA 1PH3A 4A3DH 2B29A 2OEOA 2GVAA 3OIPA 2ES2A 1KDBA 1NR4A 2QDLA 2R93B 1HZAA 2Y0SE 2F0NA 3VYSA 2EXDA 3CMEA 2B2VA 2M9VA 4HIDA 2QCPX 3CRLC 2UXDL 2LS01 1QZGA 5KIXA 1U9RA 1WD0A 4A3JH 2B8FA 3Q23A 2CFMA 3WDNA 3HKZE 2HHHQ 1STAA 2OQKA 1HQMC 2VUMG 2QW7A 1LT6D 3NELA 4R4TA 4HCEA 2AUJD 2C9OA 2B2YA 1FGBD 3KK7A 4DXGA 3KF8A 4P72A 4R9WA 4A3LG 2EYOA 1N32L 4ZUIA 1NMGA 2IT1A 2BDOA 5LMUQ 2LXKA 1HUNA 4IUTA 5FLMH 2E8GA 5FOBB 2F0PA 1HHVA 1XNRL 3SDZA 1D1IA 5C0XH 3U50C 4JVZA 3Q22A 4KY5A 1EUJA 2K7VA 4TRDA 2X6LA 4F88A 1PLFA 3CC4A 3P75A 5JPMC 2KJXA 4IUPA 2E2HH 5EPKA 3BVZA 1Y1WG 4JBKA 1YNJC 1BF4A 3MEFA 4DV4L 4DK3C 1JR0D 3TS2A 4YWLA 1SN8A 1VQCA 2KQ3A 1TWAH 2I5LX 1GUTA 4FDBA 3K57A 2K75A 4BBRB 4DAYA 2BDNA 4QIWB 5EPLA 1QB5D 2AMCB 2EYJA 3E5SA 3PSIA 4A3FH 1SMYD 1YEZA 3HFZB 2VQEQ 3S14B 3K5OA 5C4ZA 1U4LA 1EZ6A 4XYOA 1TWCB 5F2DA 1LO5D 2J7ZA 4LUOA 4XT1B 2PZTA 3O13A 1PH8A 2VY3A 3TZUA 3J7ZC 1BBUA 5JVG3 1LTRD 1HNXQ 1CUKA 1LT5D 4PG3A 4ZRZA 1PYWD 5HY6A 1C9OA 3PO3B 4JYAL 3HOZG 1U0LA 4QCLA 1RDPD 3TREA 4HIOA 1LTAD 3S2DH 1SRUA 2LXJA 4PQXA 2YYZA 4CDEC 4EVOA 1XMQL 2KHIA 5DAUA 2CWAA 4NW2A 3S1RH 5I4DA 3KLRA 4DV7L 3KBXA 4H02A 3S16B 2AWNA 1KHIA 3MXNB 4KKSA 3T1HQ 5T1GA 1VQ9A 1GXDC 4C3IB 1E0BA 1L0YB 4A3BH 2EE1A 4JCVE 2FINB 2DUDA 2Y0SB 2D5DA 3PO2H 4PMWA 4POFA 1KABA 3I4OA 1KDCA 5GAHC 3CCJA 1JJ2A 1Y1VH 1AZPA 2JSOA 1DOMA 1V8QA 5EQ0A 1GHJA 5CGKA 4G7OC 3HKZB 4A93H 3RZOH 5KNBA 2DN8A 4K2LA 2C35B 2YTVA 3GTOB 2FFKB 4O42A 2UXCL 1EYGA 1CKNA 1WI5A 1KL9A 1NR2A 1PTOD 4DR2L 2EY2A 4BWGB 1SNCA 5KEEA 2K5VA 3KUPA 1X9NA 3I4NG 1IKMA 3FEWX 3TP6A 3NENA 1SE8A 4ZUJA 1QUQA 2F52A 2VQFQ 1CA6A 2E76C 4HTHA 4X65L 3GTMH 1F9SA 2B2UA 4LUVA 4JC0A 3OWEB 3BVMA 2A6ED 1ZKOA 1B3AA 1QCBD 4ZAIA 5EPJA 3GTJH 1EY9A 1JWUD 1WTRA 1B9NA 4RCOA 1UAPA 1FJGQ 2F4VL 3M3YH 3TP8A 3BYYB 2M00A 1L1OA 2AQ1B 3T16A 4DV2Q 3I70A 1NNXA 1PTOF 4WORA 5DLQE 4UP9A 3KDFA 4ZLTF 3H0GH 4RFBA 1DOKA 4LF5Q 4DF7A 3D4RA 5CC4A 3QO2A 2EZVA 5FKAC 1NY4A 4ZYSA 1TS5A 3F2UA 4HJ9A 1X56A 4FVMA 1B8AA 1TT2A 4NKLA 5IT9E 1IZ6A 1CTMA 3E6ZX 3TP5A 3EA6A 1TXYA 1EFWA 3HOWB 1BUVT 2HQLA 4YHHL 3A7LA 4J6HA 1SE2A 3EFXD 3M85A 3CQZH 3RLOA 1SNDA 3I3CA 4IJHA 4TVAB 3HP3A 4L5RC 3BZCA 4DV0L 1Q82C 3A8JE 1AEXA 2I0QA 3CU7A 1YVCA 3OOCA 3MXUA 2ZT9C 4HSVA 4O0AA 3ONAB 3DXJC 3K7UC 3S17B 1ICFB 4A3IH 4IUNA 4IURA 1EFID 3ND9A 5IP9H 1HNZL 1X54A 3I8ZA 1G6ZA 4HJAA 2F1MA 4XQNA 4A3KG 1K8GA 5IYDG 1W2BA 3HOXG 4OWTB 1FNUA 3S2HH 1CSPA 2O4XA 4GNXC 4JI7L 1I6HB 1ICWA 1BBWA 1EU4A 1WTXA 1N34Q 1SMYC 1PYSB 1I4QA 4MIUA 2BH8A 1JC7A 1NBWA 4QB4A 1TWHB 1WTHA 2EY1A 5C3EG 1QJOA 1CQVA 2QKIC 4C56C 1A6XA 4CJ1B 3CHBD 1HRJA 2ZM6L 1STHA 1TU2B 5C4XB 4MZ9A 2R61A 4G7ZC 1G291 3MXGA 1Q90A 4KN7C 3FHWA 4DUYL 1RD9D 3U4VA 5M3FG 1Y14B 5EGTA 5FO8B 2K01A 1B3QA 2NZOA 1I4HA 2GN5A 1MI2A 1E2WA 4X64L 3UDGA 1HR0W 4IPGA 1K9MC 4M8AA 1FGUA 1NUCA 2ZJRA 1GHKA 1Y69U 1O7ZA 3H09A 3GDEA 2R7ZB 1S72A 1UE1A 3F8TA 2QDBA 1ET6A 1XNQQ 3U58A 1Y8OB 3Q0AA 1UE6A 3T1YQ 1IKLA 2KVMA 4RG1A 1X32A 2HUGA 4GNXA 1K83B 1N8RC 1M8AA 4JV5L 1BVSA 2VW9A 1UEBA 3T13A 4X62L 4A3EH 3HOYG 4UDUC 3J80E 2MO1A 5M5WH 1KD1C 1YIJA 3J7A5 1EWCA 3K8AA 2NUCA 1XPOA 5JJLA 2A5HA 1C0AA 1Q12A 2K5QA 2RCNA 3ERQA 1N33L 1VS0A 2F0MA 2SNMA 3STBD 1HNWL 2WINB 3CXCA 2L12A 2VS1A 2ZXOA 4KJOA 3CD6A 2A8VA 4V0BA 3TDQA 3AEVA 5IE8A 1PTOC 1T9HA 5CBEE 1TR5A 2NTTA 2NYZD 4A3GH 1K0SA 5ELDA 2EY6A 3OIQA 2JA7H 3VYTA 1TY0A 2BE5D 3L7ZC 1VQBA 3J81L 5BN4A 2RKSA 1GVPA 1RL2A 3JC66 2A6EC 4ID6A 2NBFA 4A75A 4LFCQ 1UE7A 2IJ0A 4RKBA 1TWGB 4DA2A 2L9HA 4L6TB 2JA8H 1M1KC 1D8LA 5D3DA 4AIMA 3CAMA 2E2IH 2JA9A 1XTCD 4S3SA 3J81i 3HOVB 1UE5A 3DHQA 3HGBA 3R2TA 2IHEA 4KTAA 1Q46A 1C7YA 4LF9L 1EL0A 3I2ZA 4Z9CB 4B3RQ 1IBML 4DV6L 4IZ8A 2JA5H 1MJEA 2B63H 1QNKA 1VQ5A 4O1NA 1JJCB 1LTTD 4KKUA 5E4XA 4LF6L 1S5FD 4UP7A 1D6EC 3J81j 4B3TQ 5FO7B 3SK5A 4LF8Q 4ZK9B 2CHBD 2QGQA 2WKCA 3MVVA 4K8IA 4KJNA 2OQ0A 2NN6I 1E1OA 1S5BD 4ODGA 1BR9A 2EJFC 1OXUA 4Q5VA 2Z0SA 2JJQA 3U4ZA 3HOUH 2EYFA 1WTOA 1WOCA 2R93H 1F77A 2OXPA 3GV6A 1H9JA 1XPUA 1AE3A 1IYUA 1GO3E 4R4OA 4TQUS 1WD1A 3PO2G 3ZJYC 3RZDB 3RMHA 1EIHA 1AH9A 1YJWA 1Y1VG 4F7XA 4DK6C 2MP1A 4C1NK 3D3RA 2IHFA 5CORA 4LF4Q 1E2VA 2YTYA 5TSSA 2MO0A 2OTJA 1EYCA 2Q8TA 4MHEA 2LKVA 2F0EA 5DNFA 5NUCA 1KRTA 3LX0A 4B3SL 5CV9A 4N9PA 1A3TA 1UEAB 1JE4A 5IT9c 5IYBH 2RDHA 1RF2D 2Q2HA 5EBDA 1GKHA 2PZUA 3KLSA 4LMQD 1PH6A 1EOVA 3F2CA 4OX9Q 1KTKA 4BXXH 2RSNA 4BBRH 3TEHB 5C44G 3PIP3 1WJJA 3H6MA 3FP9A 4DNRB 1L0XB 4A3MG 3W1GA 4CDCC 3S14H 3GD7A 4FF4A 1HA6A 4G4KA 2R92G 5JEAH 1I4XA 1TWCH 5IGCA 4JI5L 3U9OA 1X3QA 3QJYA 1SSOA 3GTGB 5LHY1 4C3JG 5ELFA 5FJ8G 4DXFA 5ELNA 1SAPA 3GP7A 4R8NA 1MGSA 1Q8KA 3PGZA 5ELCA 1GOZA 2F0LA 1ET9A 2WKDA 3DM1A 3PO3H 1I5FA 1PA6A 2WB1G 2VUMB 2R3ZA 1I4RA 2TSSA 5FLXE 1VMCA 1II3A 1PDQA 4CBVA 2NVYB 1E24A 4B9WA 4LJZC 2IW3A 5BN5A 3S16H 1EEID 4LW1A 1J5EQ 2ICEC 2DY7A 2XTIA 1WTPA 2UXBL 2A74C 4C3IH 3OW2A 3C46A 3STBC 5I2XA 3HS0C 1SNQA 1YJNA 5KNCA 1FNVA 2KHSA 4RHSA 1ENFA 4AQYQ 4YY3L 4ZQ3A 1B44D 4BA1I 2HCCA 2NN6H 2X6GA 4QIWE 1HR0Q 4X66L 3PUVA 2E5LL 3D8GA 2JEAI 1M90C 2KCTA 1FR3A 4C3HH 4A3IG 3T51B 3X3MA 3TQYA 2HDLA 1VQMA 2Z8LA 1PTOH 4K14A 2UUAQ 5I9PA 3GTOH 5IP9G 4KD4A 3KF6A 2EJMA 2BE5C 1GUSA 1OO9B 4KV6A 3ZYYX 4JI6Q 2F0FA 5IY0A 4GOPB 1QG7A 2DY8A 3AYHB 1IBLQ 2RDFA 2EYLA 2KCMA 3PIPA 3PUXA 2NTSA 3J80c 4B3MQ 2CH4A 3TBIB 1SYCA 1J9OA 5BN3A 4U68A 4IUVA 5K5PA 1WCMG 3NQIA 3CPWA 1H9RA 3CC2A 4K0KL 3G4SA 1HFGA 3S1QB 4FF3A 2VZAA 3HOZB 4DUZL 3MC0B 1FVIA 4J15A 1BCPB 2PI2A 4N9TA 3HG9A 2OTLA 2WP8J 3UDXA 5JPNC 2N3SA 2F03A 2AWOA 4RGMA 2ZXPA 1AFPA 1BCPD 3MXPA 3BS1A 1YNND 3SK6A 1FNWA 4DR7L 4IPHA 2IX3A 2HCIA 3NWTA 1SNMA 1RIPA 1GUGA 1G2TA 2RBMA 1MBYA 4AYBG 3CCVA 4GKJL 4HEDA 4CHTB 4NXML 1MJCA 3JAME 4ALPA 2RF4A 1H9SB 2N88A 1FD7D 3D4DA 3PUWA 3H3VH 1E7ZA 3FPPA 1S3OA 2Z4IA 4GN3B 3MWYW 3BDLA 3EIVA 4RAUC 1MD2D 2L55A 4HMJA 1PMRA 1BCPF 1T5XD 1P8LA 4CJ2C 1PFMA 1H95A 2XVSA 2J4XA 1RODA 1KLUD 3UI2A 4LFAQ 1VF5C 3M4OB 3I4NB 1N9WA 5J3BA 3P7JA 3NPPA 1HZ9A 1O78A 2R6GA 1BQQT 1A3UA 3DLLA 2CH4W 1EU3A 2DGYA 4KKTA 2L15A 4IFDG 1TS2A 3GQBA 3GTKB 4EQ5A 3S17H 2NVTH 4ME3A 4NPSA 1VMPA 3MFGA 4JOIC 5IYCH 4HJ7A 2UUBL 2UXDQ 2M2LA 4MNOA 1HFNA 3BYTB 4JI1L 1CSQA 3H15A 2MNAA 3BG3A 4FF1A 4DV5L 4DPGA 5EBCA 1U4RA 5C5LA 2JA7G 1V1PB 3W1BA 2KHJA 4YWMA 5A2QE 3ULLA 2WFWA 4KHPL 3QB3A 1SR3A 1OTCA 2ZJPA 1N32Q 2HIVA 1I6HH 1Y8NB 3PV0A 1BXTA 1WTVA 1XNRQ 3VR6A 2VL6A 3GO5A 3PMFA 2I5MX 2O5IC 1EOTA 1TWHH 3EN2A 4ZKBB 2PMZB 3JAMi 2NB0A 2EIFA 2F0JA 4A3CG 4DR6L 1WTWA 1DZ1A 1OXXK 5IP7G 5KGUA 2SNSA 3AU7A 4C2MH 5C4JH 5IGDA 4DV4Q 2I46A 3AFPA 4BBSG 1G51A 2K33A 2RQXA 4YCWA 2O5JC 4FXGC 1JWMD 2ALYB 1MKHA 4JOIA 4Y7NB 4XQQA 4R4IA 3J7AF 4KHZA 4DR1L 5M3MH 1IL8A 2PYKA 1Q1EA 3QWNA 2R7ZH 1JB7A 3EVQA 3HKSA 2G5DA 3VR5A 2N78A 3RR5A 4P71A 3Q6SA 2FMCA 5I6YA 1DJRD 1XWEA 1IHZA 2N49A 1AZQA 3NWSA 2MFIA 1LV9A 3B6YA 1A2TA 2N55A 4QGUA 1K83H 3NBHB 4QY7A 1YITA 1SE4A 4P73A 3NBIA 4RA8A 5LMNW 4JYAQ 1FL0A 5AJ3L 2XWBB 2BH2A 4WJWA 1PVOA 1DYQA 2BCOA 4A3KB 4GLXA 4BY1G 3HOXB 2JA6G 1XMQQ 1ZEQX 1LT4D 3CRKC 4K2KA 4DV7Q 3VR2A 3TP7A 2WV6D 5GADC 1SFOB 2Z4HA 4HJ5A 3SVMA 3U9SA 5M5YB 4ILWA 3DEOA 5C3EB 1OXVA 5FLXc 1EY5A 2SEBD 3FKIG 1SYGA 2CW0D 4J1MA 4UHVA 4R4CA 3N6RA 1YI2A 4IN3A 1DM0B 2Q2IA 1I94L 1VQ6A 2MUYA 3FVQA 2ZTCA 5M3FB 2Q8RE 4OELB 5IWAL 3CCEA 1KNEA 1QVCA 1K8AC 2IPKD 2K5HA 2UXCQ 3V96A 2AQ2B 1S5DD 1TWGH 1CHQD 4DR4L 1EQRA 3AFQA 1S5CD 3BZDB 4DR2Q 1BCPC 3NP8A 2AUKA 2PNRC 1YNNC 4CJ0B 3HOVH 2BA1A 2WACA 2K03A 4E6IA 1HQRD 3L3OC 1E2ZA 5IGFA 1YJ9A 2XIWA 4PMBA 4IO9A 1ZYRD 1PXUA 3A0JA 3AMUA 2RHQB 3HOYB 5CV8A 2NVXB 5LL6X 4LF7L 4X65Q 1I4PA 4R4QA 1ML0D 4JI3L 4L8JA 3W2DA 1HA5A 3IFDA 1YNXA 1EY8A 3NHHA 4U673 5K36H 5D14A 2F4VQ 1HCZA 4JI4L 4OO1I 4A76A 1VQ7A 4APVA 1LYLA 5GROA 2QEXA 1E1TA 1PV4A 4IJLA 1KRSA 2BA0A 4KMUC 4P75A 3X3NA 1IYVA 3KYHC 1LACA 4K8JA 5GAGC 4FYDA 5E1FA 4J8QA 3Q24A 2JYOA 1B2TA 1AW7A 3RZDH 2PCFB 2Q8IB 4KLKA 5DM73 2NN6G 1LT3D 1JOQA 1TWAB 2JE6I 3A8IE 3I4LA 3T53B 2XRSD 4C3HG 3CMAA 2L1BA 5IT9L 4WJ4A 3JAMc 4YHHQ 1B53A 3A8KE 3DM3A 4A3FB 2V1CC 3MA2B 4FXDA 1IW7D 1STYA 4DV0Q 4LFBL 2ZTDA 2UU9L 2ZJQA 1B4OA 2D2CC 2K04A 4IFDJ 1K3BC 3I4MG 2CVRA 1SEBD 2PNHA 3LWUA 3PUYA 3FPUB 2D0PA 2RCFA 1HNZQ 4GN5A 1E22A 1PFBA 2D0OA 3PCOB 4G7HC 1VQHA 1G2SA 4RGTA 2AHOB 1F2YA 4DU9A 2K1BA 1VQPA 3F2DA 1ESFA 1N36L 1EEFD 1MSGA 1A3VA 3IAYA 3S1RB 2V4DA 3OPOA 1XMOL 4A3DG 1EQQA 1R4PB 4JI7Q 3GTLB 4K5XA 2Z1CA 1TS3A 3K80C 1Q86C 3GTGH 3P1HA 4A3BB 2A69D 3OTOL 1JCKB 4XTCS 1YZ6A 3PO2B 1TWFB 2Z6BA 3EJIA 4A3JG 3L9AX 1VQEA 1VQNA 3NXWA 1EQTA 1Y1VB 3TMEA 2ZM6Q 2XN9C 3NK9A 2K28A 4JBWA 3GTPH 3W3AA 4PZ8A 1D1KA 5CYUA 4DUYQ 4A3LH 5CV4A 5LMNL 4QJFA 1XTDA 3J7YW 4X64Q 5E3FA 2ICIA 1I3QH 1VF7A 2JQOA 1BBXC 5FLMG 2K50A 3VR4A 2OWOA 1CHPD 2FXQA 2F0OA 2KBNA 4CDFC 3D6CA 3K0XA 5C0XG 1TS4A 2KOLA 3LGJA 5M9OA 3ERSX 2MQHA 4X3UA 2EQSA 2KENA 4DV3L 3K5LA 1Z9FA 2EJGC 1Y1WH 1F2LA 4OO1H 4DNIA 4FF2A 2IL8A 4JV5Q 1J8IA 2RVLA 1YBYA 2CW0C 4X62Q 5IGEA 3R2IA 2R7DA 3SHLA 3MXNA 5C44B 5BR8L 1SJED 3KJPA 3T4AC 1UNSA 4A3MB 1LTSD 1O7LA 1U4PA 4NXNL 2VXWA 5EKLA 3J80L 4A3FG 1N33Q 2R92B 2HD3A 5I2YA 2SOBA 4BY7H 1HNWQ 4N8X1 3KF8B 5C3XA 2G9HD 1KDAA 5KYIA 3H94A 3ITPA 4C3JB 3K5MA 5HGQA 1Q8IA 1U5KA 1PH2A 3J80i 3EBEA 2BOSA 2L11A 1VQ8A 1DGSA 4JI2L 3AB9A 3S1QH 2WB1B 3HOZH 3S1MH 1STNA 1Q7YC 3RLFA 1R9TB 5IGBA 1K0RA 3Q8DA 5FK9C 1V9PA 1ZYRC 4OGQC 3NTIA 1SXTA 1W3SA 1KQSA 3H3VC 3CCUA 4LK1C 4DAYB 3I72A 2UUCL 1SYFA 4JK1C 4A3BG 1PZID 1X6OA 3ULPA 3CC7A 5M3MG 3S15B 5CBAE 2ASBA 4LF9Q 4H7BA 1QVFA 1S4ZA 1EIYB 1IBMQ 4DV6Q 2YU9B 1ONLA 4OIKA 1STGA 4A3IB 1ILQA 4LF6Q 4A93G 3N52A 3D6WA 3FMCA 1EWIA 4RKLA 2F0QA 3PF5A 4H0LC 5J39A 4CKBA 5C4HA 5GAEC 4POGA 1JICA 3M4OH 2RA4A 4MTNA 4KD3A 1KC8C 1IL2A 2F4IA 3VYRA 1WCMB 2F3VA 3M7GA 1EIGA 1IW7C 4EGVA 1LABA 1VQAA 1STEA 2Q2TA 1CA5A 1CZWA 1JJGA 1O80A 3UDIA 3CKIB 2EYMA 1JWSD 3H3VI 1SROA 3KBGA 4I65A 5EAYA 1C48A 1ENAA 4EQPA 1X3GA 2DJFC 2EVBA 2OT2A 3KLWA 1EY7A 5D65A 2ATWA 3D0FA 2E75C 1ZXTA 1CKNB 3H0GG 2NVQB 4DV1L 4AYBB 4B3SQ 3TN2A 1SMXA 3VDYA 2VB3X 2JK8A 4DR5L 4PV1C 3CW2C 2HIXA 2JXMB 2XNAC 1QUQB 3I56A 2A69C 1TQOA 1CM9A 1EY6A 2PW5A 3K6OA 3V05A 5D3IB 4JI0L 3NE5B 4JI8L 3RN2A 3I91A 1V43A 3C3LA 1X55A 1PH7A 5KNDA 1VQKA 4Y7NH 1WVLA 1B7YB 2WAQG 2A68D 3CCSA 4GKKL 1IBKL 3K5NA 1A63A 1L1OB 1G6PA 4DR3L 1HTLD 3M4PA 1LUZA 4JI5Q 1GD7A 1RTOA 1JE5A 3K59A 4KY6A 4NP5A 1I6VC 4O2DA 3KOJA 4L63B 2YV5A 4CKEA 1V1OA 4MTKA 3E9IA 5HGTA 1PH4A 4RMFA 2A6HD 3BJUA 5LL6S 4DK1A 1B70B 2JA7B 4A3KH 2DJGC 3SR1A 1X3PA 1LLRD 5E4WC 5IYDH 3HOXH 2GA4B 4JBJA 2WIIB 5FLXL 2DNEA 3A54A 2PMZE 1SFOH 1SBBB 1JOKA 4MN3A 4EX5A 4KK7A 3K7AB 2UXBQ 3PIO3 2JA8B 5C0XJ 3OYYA 3EROA 4YCUA 3HZXA 4CGYB 2E2IB 4YY3Q 2HHHL 2L0CA 2E5LQ 4X66Q 1NSNS 1Q1BA 1JOOA 1RCVD 4BBSB 2K6AA 4ZCKA 3DWAA 4IUQA 3GTQB 2F0UA 5M3FH 4GLVB 5JVH3 3QOLA 4IOCA 1GUNA 2EOTA 5LMUL 2F0SA 2E74C 3J7AV 2N8NA 3E0EA 4KI0A 3W5OA 1QVGA 3M4QA 1GUOA 1SJHD 1X3FA 2NZ1D 5M5XB 2KUMA 2NWGA 4GLAC 3SE0A 3CF5A 2KCCA 3SK4A 4IALA 3HOUB 1LM0A 2EYPA 4HJ8A 3KJOA 3FDTA 1SNOA 4K0KQ 3HOYH 1NTGA 1D5XC 1STBA 3OSOA 2NVXH 2F0GA 4A3EG 4DUZQ 3A74A 3HOWH 3E3XA 1U4MA 4BY1B 3D4WA 4KN4C 2JA6B 2A19A 3WOFA 3PUZA 3AQQA 1LTBD 4P74A 1HTPA 3OWFA 2VQEL 4PNYA 5T1IA 4TKOB 3VA7A 3L2PA 2CWPA 2RSOA 4FP5D 4DR7Q 3IFTA 4XDXA 3C1EA 1PRTB 1EY4A 3FKIB 1QE6A 2MPMA 1HNXL 4GKJQ 4NDXA 4NXMQ 5JOBA 5EJWA 4A3GG 1PRTD 4L5TA 3PIOA 3MZ5A 1GM5A 2K05A 2D9UA 4TSSA 2FJ2A 4GNXB 3JAML 1VQ4A 4PZ6A 1O7IA 3LWEA 3C2PA 3OMCA 5IODA 4IQZA 4OO1G 3R3OA 3IKJA 1XX8A 1W6KA 3T1HL 1DD2A 1EQVA 1K3RA 2G9DA 4DKAC 1WTQA 1WFQA 3D31A 3LNNA 3UE0A 2JA8G 3G48A 4JBMA 4HR7B 1VQDA 4BY7G 1Q3LA 2MGSA 1JQYD 5C4XH 1X65A 1PRTF 2K5DA 1NMFA 3RLNA 3R93A 2JA5G 2B63G 2UUBQ 4RGOS 3VA5A 2I5HA 2R7FA 4HN7A 4JI1Q 1CZGA 3MAQA 3S1NB 4DN4M 1UUPA 3ER0A 1KIXA 4DV5Q 2F3WA 4OEMB 1VQFA 3S24A 3BZKA 1FYCA 4DGZA 4F8MA 1NE3A 1JORA 1MIUA 1C8CA 4OWWB 2F0VA 3CCMA 1LTID 1O7YA 4KHPQ 5CV7A 1A15A 3VYUA 1ASZA 2JN4A 1B9MA 3HOUG 5IOCA 3GTLH 2XWJB 5CV6A 1G91A 1I50B 3G6JB 5A2QL 2R93G 3SK8A 2VQFL 2A68C 1MSHA 1CQFA 2B2UC 4YCVA 4HIKA 2E2DC 1KAAA 4X6AH 3KFUA 1TWFH 4CDDC 1K73C 4DR6Q 3BDCA 2F0DA 4GS3A 1L1OC 1D2BA 4N8FA 1DXMA 1FJGL 4GZYC 4WRDA 4DV2L 2IX0A 4C3HB 1VQLA 4IUUA 1MHWC 4K6LA 1JT8A 2E2JB 2B2WC 1HXYD 2A6HC 1PTOB 3I73A 1RHPA 4DR1Q 4R8IA 4LF5L 4CKCA 5E7NA 3I90A 1BO0A 2PZWA 1I4GA 3NSWA 4B9XA 4GOPC 5IYBG 2LY7A 3I4MB 4JG2A 1EYAA 4UAIA 5HURA 1D5MC 1HUMA 3F1ZA 2K5WA 2ID0A 1PH5A 2EPBA 4X3SA 4BXXG 2RHSB 3M9BA 4IPDA 1XPRA 1SYEA 2IWHA 4AH6A 4BBRG 4KY7A 2HDMA 5C44H 5AJ3Q 3ICEA 4I7ZC 3BU2A 2QILA 2Z6KC 2OCEA 4A3MH 4NMZA 2F0TA 3WWVA 2CCZA 1OXTA 5L37A 3A7AB 4A3DB 1A8VA 4FXKC 2R92H 1ESRA 2A1AA 2IY5B 3HRZC 4LWCA 2F0KA 5JEAG 3A56A 2XRQD 4C3JH 5FJ8H 3PF4A 2H4OA 4RH6A 2B2WA 1KLGD 4A3JB 2JP1A 4UPAA 1EWHA 3RUZA 1VQIA 2LMCB 3PO3G 1R9TH 4IFDI 4L5QA 3TS0A 1I94Q 4M1UB 3ULJA 5ISRA 1F2ZA 4GOPA 3E9HA 1OXSC 1IXRA 1XXGA 2PI2E 5DEHA 5IWAQ 4QQBX 4G57A 4ABNA 1ENCA 3E0JA 2YTXA 3GV3A 3IRBA 4LNQA 1K28A 1N34L 2KA7A 1EIFA 4DR4Q 1SDFA 4C3IG 2F0WA 2TMPA 2VB2X 4QUFA 1E3PA 3R8BA 2Y0SG 2Z6KA 3NUCA 3S15H 2P5ZX 3BVGA 1GUWA 2LFNA 4H13C 2E2HB 1TY2A 1Z6HA 1NJIC 2YU9H 4HMIA 2KECA 2NVTB 5I9OA 4XXEA 4LF7Q 4JI3Q 3HKZG 4XIGS 1SYBA 1PRTC 5H1SE 2ZXRA 2KEEA 2K5NA 2EXZA 3PQIA 1EZ8A 4JI4Q 3QIAA 4OONA 1EYDA 2C5CA 1Q81C 4HAEA 3TSSA 1XNQL 1M4VA 4XQJA 4WFN3 2PPBC 2QF7A 5I6WA 1H9SA 2WB1E 3T1YL 1QNUA 1WCMH 3M4YA 1WYDA 1KAWA 2Z9HA 3QG1A 1A0IA 2QEJC 3EQLC 4X3TA 4P2CB 3S2DB 3SGIA 3S9WA 3CPFA 4C2MB 3FRPB 5C4JB 4DAPA 2WAQE 1XJVA 1PH9A 2PO4A 2HQEA 1ILPA 3RN5A 4WJ3M 1BKBA 3KLSX 3KF6B 3NTHA 4QF4A 2L4NA 2XSCA 2F0HA 1D7QA 4PZ7A 2EYHA 2NVQH 2KCNA 5M3MB 3P20A 4OWXB 4LFBQ 3L0OA 2UU9Q 5ELEA 3J81E 3A5ZB 2VUMH 1P16A 5KYLA 1PZJD 2H5XA 4ME5A 2PQEA 5FO9B
chains in the Genus database with same CATH topology
1E7ZA 1S3OA 2NVYH 3I55A 1JJGA 4GN3B 3UDIA 1IYJB 2PQAB 3GTJH 3H3VI 4NB3A 3EIVA 1SROA 1FJGQ 2F4VL 3M3YH 5EAYA 4LFCL 1L1OA 1P8LA 1H95A 5JJIA 4DV2Q 1HZCA 1X3GA 2CKZB 3HOWG 5DLQE 4LFAQ 3KLWA 2D62A 1N36Q 4UP9A 4L5SA 2ATWA 3KDFA 3D0FA 1N9WA 5J3BA 2NZHA 1XMOQ 1HZ9A 3H0GH 1CKNB 2R6GA 3H0GG 3DLLA 4DV1L 4K0KL 2DGYA 4B3SQ 2L15A 4LF5Q 4IFDG 1CKOA 1SMXA 3VDYA 4B3RL 4DR5L 2JK8A 2IX1A 4EQ5A 3S17H 2NVTH 4ME3A 4NPSA 4JOIC 3CW2C 5IYCH 3OTOQ 4HJ7A 1PHJA 2UUBL 5IYCG 4MNOA 1NY4A 2UXDQ 2HIXA 4JI1L 1PH1A 1QUQB 1YHAA 3I56A 1CSQA 1X56A 4HJ9A 3H15A 4B3TL 4LF8L 1B8AA 2MNAA 1IZ6A 4DV5L 4DPGA 4JI0L 3CCRA 4JI8L 3RN2A 1V43A 3UE1A 3RNUA 2JA7G 1TXYA 1X55A 1EFWA 3W1BA 2HT1A 2KHJA 1PH7A 4YWMA 3ULLA 2HQLA 4YHHL 1VQKA 2WFWA 4Y7NH 4KHPL 4AYBE 1B7YB 2WAQG 1SR3A 2CQOA 3F2BA 2ZJPA 3M85A 3CCSA 5LMNQ 1OTCA 1A62A 2HIVA 3CQZH 4IJHA 4TVAB 3RLOA 1IBKL 4GKKL 1I6HH 1A63A 1L1OB 3PV0A 1VQJA 3BZCA 4DV0L 1Q82C 4L5RC 1G6PA 4A4IA 3K7AH 4DR3L 2I0QA 1YVCA 1XNRQ 3M4PA 3CCLA 1LUZA 2VL6A 3GO5A 2I5MX 4JI5Q 1TWHH 3EN2A 4O0AA 1GD7A 1JE5A 3K7UC 3JAMi 4A3CH 4A3IH 4YWKA 2EIFA 4A3CG 4Y52H 4DR6L 4O2DA 3KOJA 5IP7H 4DV3Q 2YV5A 1OXXK 5IP9H 5IP7G 4C2MH 5C4JH 1HNZL 1X54A 5C4XG 4DV4Q 3E9IA 4BBSH 3AFPA 1PH4A 4RMFA 4LF4L 4BBSG 4HJAA 3BJUA 1B70B 1G51A 4A3KH 3GTQH 4YCWA 5IYDH 4A3KG 1K8GA 3G71A 2ALYB 3HOXH 5IYDG 1PFSA 5BR8Q 1MKHA 1W2BA 4JOIA 3HOXG 4OWTB 3S2HH 4JBJA 4R4IA 1CSPA 5JJKA 4GNXC 4JI7L 4NXNQ 2PMZE 4KHZA 4DR1L 1SFOH 1BBWA 5M3MH 4EX5A 2K4KA 1Q1EA 2B3GA 5M5XH 2R7ZH 1N34Q 1JB7A 2UXBQ 4UP8A 2R7ZG 1PYSB 3HKSA 2Q2UA 5JEAJ 2LSSA 2N78A 3RR5A 2BH8A 1NBWA 1VCIA 4P71A 5C0XJ 3OYYA 5C3EG 1QZHA 4YCUA 2N49A 2MFIA 3B6YA 4YY3Q 4QGUA 1L0WA 1HZBA 1K83H 1Z47A 3NBHB 2AKWB 4QY7A 4R1JA 2ZM6L 1YITA 4OX9L 3CP0A 4JI2Q 3TRZA 4P73A 4MZ9A 2E5LQ 4X66Q 5LMNW 1Q1BA 4JYAQ 1FL0A 1G291 1PYBA 5AJ3L 3FHWA 4DUYL 2BH2A 1PVOA 4BY1H 5M3FH 4GLVB 4GLXA 4BY1G 2JA6H 3U4VA 5M3FG 1Y14B 2ZTEA 2JA6G 4IOCA 1XMQQ 5LMUL 2NZOA 2GN5A 4X64L 3I4NH 3UDGA 1HR0W 4IOAA 4IPGA 4DV7Q 2N8NA 1N32Q 1K9MC 3E0EA 1FGUA 4KI0A 3W5OA 4UY8C 2JEBI 5GADC 2ZJRA 3M4QA 4HJ5A 1QVGA 1X3FA 3GDEA 1S72A 2UUCQ 1UE1A 3F8TA 2F3IA 4GLAC 3CF5A 3GTKH 1XNQQ 3U58A 1LM0A 1OXVA 3FKIH 5FLXc 1UE6A 3FKIG 3T1YQ 4HJ8A 4RG1A 3KJOA 4R4CA 4GNXA 1N8RC 4K0KQ 4JV5L 1HJPA 3HOYH 1NTGA 1BVSA 2VW9A 1UEBA 4X62L 4A3EH 2NVXH 1YI2A 3HOYG 4A3EG 2Q2IA 1I94L 1VQ6A 2MO1A 4HIMA 4DUZQ 3A74A 5M5WH 1KD1C 2ZTCA 1YIJA 3HOWH 1KXLA 3J7A5 3K8AA 5JJLA 1XPOA 5IWAL 3CCEA 1C0AA 2A19A 1Q12A 1HH2P 3PUZA 1QVCA 3AQQA 2RCNA 1K8AC 4P74A 1N33L 2VQEL 1J5EL 1VS0A 2K5HA 3STBD 3L2PA 1HNWL 2CWPA 2UXCQ 1TWGH 4DR4L 1EQRA 3CXCA 3AFQA 4DR7Q 1JMCA 2VS1A 4DR2Q 2A8VA 3CD6A 3A5UA 3AEVA 3HOVH 4DAMA 4GN4B 2BA1A 5IE8A 4AQYL 1ASYA 3HOVG 1T9HA 1S40A 1YHBA 1LTLA 1HNXL 1YJ9A 4GKJQ 1HR0L 5ELOA 4NXMQ 4IO9A 4A3GH 2GVBA 3A0JA 2RHQB 4A3GG 4LF7L 4L5TA 4X65Q 4R4QA 5C0XI 3PIOA 1GM5A 2JA7H 4JI3L 3L7ZC 4QL5A 1YNXA 1VQBA 4GNXB 3S1NH 2UUAL 1VQ4A 4PZ6A 1GVPA 1O7IA 1RL2A 3UDFA 4JI6L 3JC66 4OO1G 5K36G 2F4VQ 4JI4L 1VQGA 3T1HL 4A75A 4A76A 4LFCQ 1VQ7A 1UE7A 4OO1I 1K3RA 4DKAC 1IBLL 1WFQA 3D31A 3UE0A 2JA8H 1M1KC 1D8LA 4APVA 1LYLA 2JA8G 3G48A 5GROA 4AIMA 1E1TA 3KDFB 2QEXA 3CAMA 4IJLA 2JA9A 1KRSA 1PV4A 2BA0A 4P75A 3J81i 2E2IH 4B3ML 4JBMA 1UE5A 1I50H 1VQDA 3KYHC 2IHEA 3K81C 4BY7G 1Q46A 4DV1Q 1C7YA 4LF9L 1L2FA 3I2ZA 5C4XH 4B3RQ 1IBML 4DV6L 1X65A 4DR5Q 1J6QA 4BA2I 2JA5H 1NMFA 5GAGC 1MJEA 2B63H 3RLNA 1YHQA 2JA5G 2B63G 1VQ5A 2UUBQ 4LF6L 2I5HA 1JJCB 2R7FA 3RZDH 4JI1Q 4UP7A 3J81j 4B3TQ 4LF8Q 1SLJA 4KLKA 2NN6G 2QGQA 3ER0A 1KIXA 4DV5Q 4JI0Q 2OQ0A 2JE6I 1VQFA 4JI8Q 3S24A 3BZKA 2NN6I 1E1OA 1NE3A 4OXPA 1MIUA 3CMAA 4IPCA 2E2JH 4OWWB 5M5YH 3G6EA 1OXUA 3CCQA 3JAMc 2Z0SA 3CCMA 4YHHQ 2JJQA 3J81c 5C3EH 3DM3A 1VQOA 4KHPQ 3U4ZA 3I7FA 1ASZA 3HOUH 2V1CC 4GKKQ 1WOCA 3HOUG 3NEMA 3GTLH 1IBKQ 2R93H 2HHHL 4DV0Q 2K52A 4LFBL 2ZTDA 2R93G 2VQFL 4DR3Q 2UU9L 2ZJQA 3M7NA 4YCVA 1XPUA 4HIKA 4IFDJ 3I4MH 4X6AH 1AE3A 3KFUA 3I4MG 1UWVA 1GO3E 1TWFH 4R4OA 4TQUS 2VNUD 1K73C 3PO2G 3ZJYC 2PNHA 3PUYA 4DR6Q 4GS3A 2XGTA 1L1OC 1AH9A 2PQAA 2D0PA 1YJWA 1Y1VG 1FJGL 1AE2A 1HNZQ 4DK6C 4GN5A 1CKMA 1E22A 1V1QA 1X3EA 2D0OA 2IHFA 3PCOB 5GQOA 4LUZA 4LF4Q 1VQHA 2IX0A 2QA4A 2YTYA 4DV2L 1VQLA 2MO0A 2AHOB 2OTJA 1JT8A 2K14A 1VQPA 3F2DA 4LFAL 1N36L 1PH3A 4A3DH 2B29A 2GVAA 1XMOL 4A3DG 1KRTA 1EQQA 4JI7Q 2ES2A 4DR1Q 1HZAA 2Y0SE 3K80C 4B3SL 4LF5L 4JC0A 5E7NA 2EXDA 5IT9c 3CMEA 5IYBH 1Q86C 3GTGH 4HIDA 4GOPC 5IYBG 3OTOL 4JG2A 2UXDL 4XTCS 1YZ6A 2Q2HA 1QZGA 1GKHA 4A3JH 2CFMA 4A3JG 3HKZE 3F1ZA 1EOVA 1PH6A 1VQEA 3F2CA 2HHHQ 1VQNA 2ID0A 2ZM6Q 4OX9Q 4BXXH 2OQKA 1PH5A 2VUMG 4BXXG 2RHSB 3M9BA 4IPDA 3NELA 4JBWA 4R4TA 4BBRH 1XPRA 3GTPH 4AH6A 4PZ8A 4BBRG 5C44H 5AJ3Q 3TEHB 5C44G 4DUYQ 3BU2A 3ICEA 4A3LH 1WJJA 4P72A 2Z6KC 2OCEA 4A3MH 3WWVA 2CCZA 3FP9A 4A3LG 1N32L 5LMNL 4QJFA 1NMGA 3W1GA 1OXTA 2IT1A 4A3MG 5LMUQ 1XTDA 4X64Q 2LXKA 1A8VA 2R92H 1I3QH 3GD7A 3S14H 5FLMH 2E8GA 2JQOA 2A1AA 2R92G 4JV5Q 2IY5B 4LWCA 5FLMG 1XNRL 2K50A 2OWOA 2FXQA 1TWCH 2KBNA 5JEAG 4JI5L 3K0XA 3U50C 5C0XG 1EUJA 4C3JH 5FJ8H 5FJ8G 3PF4A 3CC4A 3LGJA 5ELNA 3ERSX 2MQHA 2EQSA 2E2HH 2KENA 4DV3L 1Q8KA 1Z9FA 3PGZA 1Y1WH 4UPAA 1Y1WG 4JBKA 1VQIA 3MEFA 3PO3H 4DV4L 4DK3C 4DNIA 3TS2A 1I5FA 4YWLA 1SN8A 1PA6A 1VQCA 1YBYA 2WB1G 1TWAH 2I5LX 1R9TH 3PO3G 4X62Q 4IFDI 4FDBA 4L5QA 2K75A 3TS0A 1I94Q 2R7DA 3ULJA 5BR8L 4GOPA 3E9HA 2AMCB 1OXSC 1IXRA 1E24A 2PI2E 3KJPA 3PSIA 5IWAQ 4QQBX 4A3FH 1YEZA 4NXNL 4A3FG 3S16H 1N33Q 3HFZB 2VQEQ 2YTXA 4LW1A 1J5EQ 3IRBA 4LNQA 2XTIA 4BY7H 1N34L 1HNWQ 2UXBL 3KF8B 1EIFA 4C3IH 4DR4Q 3OW2A 3STBC 1E3PA 1YJNA 4LUOA 2Y0SG 2Z6KA 5HGQA 1PH8A 3S15H 4AQYQ 1U5KA 4YY3L 1PH2A 3J80i 2VY3A 3J7ZC 3EBEA 1BBUA 1VQ8A 1HNXQ 1DGSA 1CUKA 4JI2L 3S1QH 4BA1I 4PG3A 1NJIC 4QIWE 5HY6A 4X66L 3PUVA 1C9OA 1HR0Q 2E5LL 2YU9H 3HOZH 3S1MH 4JYAL 1Q7YC 3RLFA 3HOZG 1U0LA 2JEAI 1M90C 2KCTA 4LF7Q 3TREA 4C3HH 1K0RA 3Q8DA 4HIOA 4A3IG 3S2DH 4JI3Q 3HKZG 1SRUA 1V9PA 2LXJA 2YYZA 4XIGS 3TQYA 1VQMA 1XMQL 2KHIA 2CWAA 2UUAQ 5H1SE 3S1RH 5IP9G 3GTOH 1W3SA 3KF6A 1KQSA 4DV7L 4JI6Q 2K5NA 3CCUA 4H02A 2AWNA 1KHIA 3MXNB 4DAYB 4JI4Q 3T1HQ 5IY0A 1VQ9A 2UUCL 4GOPB 4WJ4A 3AYHB 4OONA 1IBLQ 1Q81C 4A3BH 1XNQL 2KCMA 4A3BG 4JCVE 3PIPA 2DUDA 3PUXA 1X6OA 3J80c 4B3MQ 3ULPA 2WB1E 4PMWA 3T1YL 3PO2H 3CC7A 1WCMH 4POFA 5M3MG 1WCMG 3CPWA 1WYDA 1KAWA 3I4OA 5GAHC 3CCJA 1JJ2A 1Y1VH 3CC2A 2ASBA 4LF9Q 3G4SA 1QVFA 1EIYB 2VZAA 1IBMQ 4DV6Q 1A0IA 4DUZL 1FVIA 4J15A 4A93H 4LF6Q 2PI2A 3RZOH 4A93G 3SGIA 2OTLA 2WP8J 1EWIA 2C35B 2YTVA 3CPFA 3UDXA 2N3SA 2WAQE 3PF5A 2AWOA 2UXCL 1XJVA 1PH9A 1EYGA 1CKNA 1WI5A 4DR7L 1KL9A 4IPHA 3RN5A 4WJ3M 1BKBA 5GAEC 4DR2L 4POGA 3KF6B 3M4OH 2K5VA 1X9NA 3I4NG 4MTNA 1RIPA 1KC8C 4PZ7A 3NENA 1IL2A 1SE8A 2NVQH 1D7QA 4OWXB 1QUQA 4AYBG 3CCVA 3L0OA 4GKJL 4LFBQ 2F52A 2VQFQ 2UU9Q 4NXML 1MJCA 2VUMH 3A5ZB 4ALPA 1P16A 4X65L 2RF4A 3GTMH 1VQAA 4LUVA 3PUWA 2H5XA 2Q2TA 3H3VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7Z A;  1S3O A;  2NVY H;  3I55 A;  1JJG A;  4GN3 B;  3UDI A;  1IYJ B;  2PQA B;  3GTJ H;  3H3V I;  4NB3 A;  3EIV A;  1SRO A;  1FJG Q;  2F4V L;  3M3Y H;  5EAY A;  4LFC L;  1L1O A;  1P8L A;  1H95 A;  5JJI A;  4DV2 Q;  1HZC A;  1X3G A;  2CKZ B;  3HOW G;  5DLQ E;  4LFA Q;  3KLW A;  2D62 A;  1N36 Q;  4UP9 A;  4L5S A;  2ATW A;  3KDF A;  3D0F A;  1N9W A;  5J3B A;  2NZH A;  1XMO Q;  1HZ9 A;  3H0G H;  1CKN B;  2R6G A;  3H0G G;  3DLL A;  4DV1 L;  4K0K L;  2DGY A;  4B3S Q;  2L15 A;  4LF5 Q;  4IFD G;  1CKO A;  1SMX A;  3VDY A;  4B3R L;  4DR5 L;  2JK8 A;  2IX1 A;  4EQ5 A;  3S17 H;  2NVT H;  4ME3 A;  4NPS A;  4JOI C;  3CW2 C;  5IYC H;  3OTO Q;  4HJ7 A;  1PHJ A;  2UUB L;  5IYC G;  4MNO A;  1NY4 A;  2UXD Q;  2HIX A;  4JI1 L;  1PH1 A;  1QUQ B;  1YHA A;  3I56 A;  1CSQ A;  1X56 A;  4HJ9 A;  3H15 A;  4B3T L;  4LF8 L;  1B8A A;  2MNA A;  1IZ6 A;  4DV5 L;  4DPG A;  4JI0 L;  3CCR A;  4JI8 L;  3RN2 A;  1V43 A;  3UE1 A;  3RNU A;  2JA7 G;  1TXY A;  1X55 A;  1EFW A;  3W1B A;  2HT1 A;  2KHJ A;  1PH7 A;  4YWM A;  3ULL A;  2HQL A;  4YHH L;  1VQK A;  2WFW A;  4Y7N H;  4KHP L;  4AYB E;  1B7Y B;  2WAQ G;  1SR3 A;  2CQO A;  3F2B A;  2ZJP A;  3M85 A;  3CCS A;  5LMN Q;  1OTC A;  1A62 A;  2HIV A;  3CQZ H;  4IJH A;  4TVA B;  3RLO A;  1IBK L;  4GKK L;  1I6H H;  1A63 A;  1L1O B;  3PV0 A;  1VQJ A;  3BZC A;  4DV0 L;  1Q82 C;  4L5R C;  1G6P A;  4A4I A;  3K7A H;  4DR3 L;  2I0Q A;  1YVC A;  1XNR Q;  3M4P A;  3CCL A;  1LUZ A;  2VL6 A;  3GO5 A;  2I5M X;  4JI5 Q;  1TWH H;  3EN2 A;  4O0A A;  1GD7 A;  1JE5 A;  3K7U C;  3JAM i;  4A3C H;  4A3I H;  4YWK A;  2EIF A;  4A3C G;  4Y52 H;  4DR6 L;  4O2D A;  3KOJ A;  5IP7 H;  4DV3 Q;  2YV5 A;  1OXX K;  5IP9 H;  5IP7 G;  4C2M H;  5C4J H;  1HNZ L;  1X54 A;  5C4X G;  4DV4 Q;  3E9I A;  4BBS H;  3AFP A;  1PH4 A;  4RMF A;  4LF4 L;  4BBS G;  4HJA A;  3BJU A;  1B70 B;  1G51 A;  4A3K H;  3GTQ H;  4YCW A;  5IYD H;  4A3K G;  1K8G A;  3G71 A;  2ALY B;  3HOX H;  5IYD G;  1PFS A;  5BR8 Q;  1MKH A;  1W2B A;  4JOI A;  3HOX G;  4OWT B;  3S2H H;  4JBJ A;  4R4I A;  1CSP A;  5JJK A;  4GNX C;  4JI7 L;  4NXN Q;  2PMZ E;  4KHZ A;  4DR1 L;  1SFO H;  1BBW A;  5M3M H;  4EX5 A;  2K4K A;  1Q1E A;  2B3G A;  5M5X H;  2R7Z H;  1N34 Q;  1JB7 A;  2UXB Q;  4UP8 A;  2R7Z G;  1PYS B;  3HKS A;  2Q2U A;  5JEA J;  2LSS A;  2N78 A;  3RR5 A;  2BH8 A;  1NBW A;  1VCI A;  4P71 A;  5C0X J;  3OYY A;  5C3E G;  1QZH A;  4YCU A;  2N49 A;  2MFI A;  3B6Y A;  4YY3 Q;  4QGU A;  1L0W A;  1HZB A;  1K83 H;  1Z47 A;  3NBH B;  2AKW B;  4QY7 A;  4R1J A;  2ZM6 L;  1YIT A;  4OX9 L;  3CP0 A;  4JI2 Q;  3TRZ A;  4P73 A;  4MZ9 A;  2E5L Q;  4X66 Q;  5LMN W;  1Q1B A;  4JYA Q;  1FL0 A;  1G29 1;  1PYB A;  5AJ3 L;  3FHW A;  4DUY L;  2BH2 A;  1PVO A;  4BY1 H;  5M3F H;  4GLV B;  4GLX A;  4BY1 G;  2JA6 H;  3U4V A;  5M3F G;  1Y14 B;  2ZTE A;  2JA6 G;  4IOC A;  1XMQ Q;  5LMU L;  2NZO A;  2GN5 A;  4X64 L;  3I4N H;  3UDG A;  1HR0 W;  4IOA A;  4IPG A;  4DV7 Q;  2N8N A;  1N32 Q;  1K9M C;  3E0E A;  1FGU A;  4KI0 A;  3W5O A;  4UY8 C;  2JEB I;  5GAD C;  2ZJR A;  3M4Q A;  4HJ5 A;  1QVG A;  1X3F A;  3GDE A;  1S72 A;  2UUC Q;  1UE1 A;  3F8T A;  2F3I A;  4GLA C;  3CF5 A;  3GTK H;  1XNQ Q;  3U58 A;  1LM0 A;  1OXV A;  3FKI H;  5FLX c;  1UE6 A;  3FKI G;  3T1Y Q;  4HJ8 A;  4RG1 A;  3KJO A;  4R4C A;  4GNX A;  1N8R C;  4K0K Q;  4JV5 L;  1HJP A;  3HOY H;  1NTG A;  1BVS A;  2VW9 A;  1UEB A;  4X62 L;  4A3E H;  2NVX H;  1YI2 A;  3HOY G;  4A3E G;  2Q2I A;  1I94 L;  1VQ6 A;  2MO1 A;  4HIM A;  4DUZ Q;  3A74 A;  5M5W H;  1KD1 C;  2ZTC A;  1YIJ A;  3HOW H;  1KXL A;  3J7A 5;  3K8A A;  5JJL A;  1XPO A;  5IWA L;  3CCE A;  1C0A A;  2A19 A;  1Q12 A;  1HH2 P;  3PUZ A;  1QVC A;  3AQQ A;  2RCN A;  1K8A C;  4P74 A;  1N33 L;  2VQE L;  1J5E L;  1VS0 A;  2K5H A;  3STB D;  3L2P A;  1HNW L;  2CWP A;  2UXC Q;  1TWG H;  4DR4 L;  1EQR A;  3CXC A;  3AFQ A;  4DR7 Q;  1JMC A;  2VS1 A;  4DR2 Q;  2A8V A;  3CD6 A;  3A5U A;  3AEV A;  3HOV H;  4DAM A;  4GN4 B;  2BA1 A;  5IE8 A;  4AQY L;  1ASY A;  3HOV G;  1T9H A;  1S40 A;  1YHB A;  1LTL A;  1HNX L;  1YJ9 A;  4GKJ Q;  1HR0 L;  5ELO A;  4NXM Q;  4IO9 A;  4A3G H;  2GVB A;  3A0J A;  2RHQ B;  4A3G G;  4LF7 L;  4L5T A;  4X65 Q;  4R4Q A;  5C0X I;  3PIO A;  1GM5 A;  2JA7 H;  4JI3 L;  3L7Z C;  4QL5 A;  1YNX A;  1VQB A;  4GNX B;  3S1N H;  2UUA L;  1VQ4 A;  4PZ6 A;  1GVP A;  1O7I A;  1RL2 A;  3UDF A;  4JI6 L;  3JC6 6;  4OO1 G;  5K36 G;  2F4V Q;  4JI4 L;  1VQG A;  3T1H L;  4A75 A;  4A76 A;  4LFC Q;  1VQ7 A;  1UE7 A;  4OO1 I;  1K3R A;  4DKA C;  1IBL L;  1WFQ A;  3D31 A;  3UE0 A;  2JA8 H;  1M1K C;  1D8L A;  4APV A;  1LYL A;  2JA8 G;  3G48 A;  5GRO A;  4AIM A;  1E1T A;  3KDF B;  2QEX A;  3CAM A;  4IJL A;  2JA9 A;  1KRS A;  1PV4 A;  2BA0 A;  4P75 A;  3J81 i;  2E2I H;  4B3M L;  4JBM A;  1UE5 A;  1I50 H;  1VQD A;  3KYH C;  2IHE A;  3K81 C;  4BY7 G;  1Q46 A;  4DV1 Q;  1C7Y A;  4LF9 L;  1L2F A;  3I2Z A;  5C4X H;  4B3R Q;  1IBM L;  4DV6 L;  1X65 A;  4DR5 Q;  1J6Q A;  4BA2 I;  2JA5 H;  1NMF A;  5GAG C;  1MJE A;  2B63 H;  3RLN A;  1YHQ A;  2JA5 G;  2B63 G;  1VQ5 A;  2UUB Q;  4LF6 L;  2I5H A;  1JJC B;  2R7F A;  3RZD H;  4JI1 Q;  4UP7 A;  3J81 j;  4B3T Q;  4LF8 Q;  1SLJ A;  4KLK A;  2NN6 G;  2QGQ A;  3ER0 A;  1KIX A;  4DV5 Q;  4JI0 Q;  2OQ0 A;  2JE6 I;  1VQF A;  4JI8 Q;  3S24 A;  3BZK A;  2NN6 I;  1E1O A;  1NE3 A;  4OXP A;  1MIU A;  3CMA A;  4IPC A;  2E2J H;  4OWW B;  5M5Y H;  3G6E A;  1OXU A;  3CCQ A;  3JAM c;  2Z0S A;  3CCM A;  4YHH Q;  2JJQ A;  3J81 c;  5C3E H;  3DM3 A;  1VQO A;  4KHP Q;  3U4Z A;  3I7F A;  1ASZ A;  3HOU H;  2V1C C;  4GKK Q;  1WOC A;  3HOU G;  3NEM A;  3GTL H;  1IBK Q;  2R93 H;  2HHH L;  4DV0 Q;  2K52 A;  4LFB L;  2ZTD A;  2R93 G;  2VQF L;  4DR3 Q;  2UU9 L;  2ZJQ A;  3M7N A;  4YCV A;  1XPU A;  4HIK A;  4IFD J;  3I4M H;  4X6A H;  1AE3 A;  3KFU A;  3I4M G;  1UWV A;  1GO3 E;  1TWF H;  4R4O A;  4TQU S;  2VNU D;  1K73 C;  3PO2 G;  3ZJY C;  2PNH A;  3PUY A;  4DR6 Q;  4GS3 A;  2XGT A;  1L1O C;  1AH9 A;  2PQA A;  2D0P A;  1YJW A;  1Y1V G;  1FJG L;  1AE2 A;  1HNZ Q;  4DK6 C;  4GN5 A;  1CKM A;  1E22 A;  1V1Q A;  1X3E A;  2D0O A;  2IHF A;  3PCO B;  5GQO A;  4LUZ A;  4LF4 Q;  1VQH A;  2IX0 A;  2QA4 A;  2YTY A;  4DV2 L;  1VQL A;  2MO0 A;  2AHO B;  2OTJ A;  1JT8 A;  2K14 A;  1VQP A;  3F2D A;  4LFA L;  1N36 L;  1PH3 A;  4A3D H;  2B29 A;  2GVA A;  1XMO L;  4A3D G;  1KRT A;  1EQQ A;  4JI7 Q;  2ES2 A;  4DR1 Q;  1HZA A;  2Y0S E;  3K80 C;  4B3S L;  4LF5 L;  4JC0 A;  5E7N A;  2EXD A;  5IT9 c;  3CME A;  5IYB H;  1Q86 C;  3GTG H;  4HID A;  4GOP C;  5IYB G;  3OTO L;  4JG2 A;  2UXD L;  4XTC S;  1YZ6 A;  2Q2H A;  1QZG A;  1GKH A;  4A3J H;  2CFM A;  4A3J G;  3HKZ E;  3F1Z A;  1EOV A;  1PH6 A;  1VQE A;  3F2C A;  2HHH Q;  1VQN A;  2ID0 A;  2ZM6 Q;  4OX9 Q;  4BXX H;  2OQK A;  1PH5 A;  2VUM G;  4BXX G;  2RHS B;  3M9B A;  4IPD A;  3NEL A;  4JBW A;  4R4T A;  4BBR H;  1XPR A;  3GTP H;  4AH6 A;  4PZ8 A;  4BBR G;  5C44 H;  5AJ3 Q;  3TEH B;  5C44 G;  4DUY Q;  3BU2 A;  3ICE A;  4A3L H;  1WJJ A;  4P72 A;  2Z6K C;  2OCE A;  4A3M H;  3WWV A;  2CCZ A;  3FP9 A;  4A3L G;  1N32 L;  5LMN L;  4QJF A;  1NMG A;  3W1G A;  1OXT A;  2IT1 A;  4A3M G;  5LMU Q;  1XTD A;  4X64 Q;  2LXK A;  1A8V A;  2R92 H;  1I3Q H;  3GD7 A;  3S14 H;  5FLM H;  2E8G A;  2JQO A;  2A1A A;  2R92 G;  4JV5 Q;  2IY5 B;  4LWC A;  5FLM G;  1XNR L;  2K50 A;  2OWO A;  2FXQ A;  1TWC H;  2KBN A;  5JEA G;  4JI5 L;  3K0X A;  3U50 C;  5C0X G;  1EUJ A;  4C3J H;  5FJ8 H;  5FJ8 G;  3PF4 A;  3CC4 A;  3LGJ A;  5ELN A;  3ERS X;  2MQH A;  2EQS A;  2E2H H;  2KEN A;  4DV3 L;  1Q8K A;  1Z9F A;  3PGZ A;  1Y1W H;  4UPA A;  1Y1W G;  4JBK A;  1VQI A;  3MEF A;  3PO3 H;  4DV4 L;  4DK3 C;  4DNI A;  3TS2 A;  1I5F A;  4YWL A;  1SN8 A;  1PA6 A;  1VQC A;  1YBY A;  2WB1 G;  1TWA H;  2I5L X;  1R9T H;  3PO3 G;  4X62 Q;  4IFD I;  4FDB A;  4L5Q A;  2K75 A;  3TS0 A;  1I94 Q;  2R7D A;  3ULJ A;  5BR8 L;  4GOP A;  3E9H A;  2AMC B;  1OXS C;  1IXR A;  1E24 A;  2PI2 E;  3KJP A;  3PSI A;  5IWA Q;  4QQB X;  4A3F H;  1YEZ A;  4NXN L;  4A3F G;  3S16 H;  1N33 Q;  3HFZ B;  2VQE Q;  2YTX A;  4LW1 A;  1J5E Q;  3IRB A;  4LNQ A;  2XTI A;  4BY7 H;  1N34 L;  1HNW Q;  2UXB L;  3KF8 B;  1EIF A;  4C3I H;  4DR4 Q;  3OW2 A;  3STB C;  1E3P A;  1YJN A;  4LUO A;  2Y0S G;  2Z6K A;  5HGQ A;  1PH8 A;  3S15 H;  4AQY Q;  1U5K A;  4YY3 L;  1PH2 A;  3J80 i;  2VY3 A;  3J7Z C;  3EBE A;  1BBU A;  1VQ8 A;  1HNX Q;  1DGS A;  1CUK A;  4JI2 L;  3S1Q H;  4BA1 I;  4PG3 A;  1NJI C;  4QIW E;  5HY6 A;  4X66 L;  3PUV A;  1C9O A;  1HR0 Q;  2E5L L;  2YU9 H;  3HOZ H;  3S1M H;  4JYA L;  1Q7Y C;  3RLF A;  3HOZ G;  1U0L A;  2JEA I;  1M90 C;  2KCT A;  4LF7 Q;  3TRE A;  4C3H H;  1K0R A;  3Q8D A;  4HIO A;  4A3I G;  3S2D H;  4JI3 Q;  3HKZ G;  1SRU A;  1V9P A;  2LXJ A;  2YYZ A;  4XIG S;  3TQY A;  1VQM A;  1XMQ L;  2KHI A;  2CWA A;  2UUA Q;  5H1S E;  3S1R H;  5IP9 G;  3GTO H;  1W3S A;  3KF6 A;  1KQS A;  4DV7 L;  4JI6 Q;  2K5N A;  3CCU A;  4H02 A;  2AWN A;  1KHI A;  3MXN B;  4DAY B;  4JI4 Q;  3T1H Q;  5IY0 A;  1VQ9 A;  2UUC L;  4GOP B;  4WJ4 A;  3AYH B;  4OON A;  1IBL Q;  1Q81 C;  4A3B H;  1XNQ L;  2KCM A;  4A3B G;  4JCV E;  3PIP A;  2DUD A;  3PUX A;  1X6O A;  3J80 c;  4B3M Q;  3ULP A;  2WB1 E;  4PMW A;  3T1Y L;  3PO2 H;  3CC7 A;  1WCM H;  4POF A;  5M3M G;  1WCM G;  3CPW A;  1WYD A;  1KAW A;  3I4O A;  5GAH C;  3CCJ A;  1JJ2 A;  1Y1V H;  3CC2 A;  2ASB A;  4LF9 Q;  3G4S A;  1QVF A;  1EIY B;  2VZA A;  1IBM Q;  4DV6 Q;  1A0I A;  4DUZ L;  1FVI A;  4J15 A;  4A93 H;  4LF6 Q;  2PI2 A;  3RZO H;  4A93 G;  3SGI A;  2OTL A;  2WP8 J;  1EWI A;  2C35 B;  2YTV A;  3CPF A;  3UDX A;  2N3S A;  2WAQ E;  3PF5 A;  2AWO A;  2UXC L;  1XJV A;  1PH9 A;  1EYG A;  1CKN A;  1WI5 A;  4DR7 L;  1KL9 A;  4IPH A;  3RN5 A;  4WJ3 M;  1BKB A;  5GAE C;  4DR2 L;  4POG A;  3KF6 B;  3M4O H;  2K5V A;  1X9N A;  3I4N G;  4MTN A;  1RIP A;  1KC8 C;  4PZ7 A;  3NEN A;  1IL2 A;  1SE8 A;  2NVQ H;  1D7Q A;  4OWX B;  1QUQ A;  4AYB G;  3CCV A;  3L0O A;  4GKJ L;  4LFB Q;  2F52 A;  2VQF Q;  2UU9 Q;  4NXM L;  1MJC A;  2VUM H;  3A5Z B;  4ALP A;  1P16 A;  4X65 L;  2RF4 A;  3GTM H;  1VQA A;  4LUV A;  3PUW A;  2H5X A;  2Q2T A;  3H3V H; 
#chains in the Genus database with same CATH topology
 1F2M A;  1V1P A;  4FO2 A;  4A93 B;  2NVY H;  3I55 A;  1IYJ B;  2PQA B;  3RZO B;  1SE3 A;  5EKK A;  4BS9 A;  1TII D;  5DM6 3;  4NB3 A;  2CQA A;  1F9P A;  4LFC L;  1RKN A;  5JJI A;  1HZC A;  2CKZ B;  3HOW G;  4PMC A;  2K32 A;  1K8M A;  2D62 A;  1N36 Q;  4L5S A;  2NZH A;  1XMO Q;  3NQT A;  2X69 A;  4IFD H;  1F9Q A;  1CKO A;  1VDZ A;  3DWQ A;  4B3R L;  2IX1 A;  4HCS A;  4Q0F A;  1PHJ A;  2J0T D;  3OTO Q;  5IYC G;  4K5W A;  3GTM B;  4XYQ A;  1PH1 A;  1YHA A;  4B3T L;  4K6D A;  4LF8 L;  3VR3 A;  1DOL A;  1A2U A;  3GTJ B;  2ENB A;  1PFN A;  3CCR A;  3M3Y B;  4OL7 A;  3UE1 A;  2H1E A;  3RNU A;  4DAV A;  2HT1 A;  5AFW A;  5C6A A;  5JJZ A;  4AYB E;  2CQO A;  3F2B A;  5IGG A;  5LMN Q;  1A62 A;  3A55 A;  1DON A;  1SYD A;  1H9M A;  1VQJ A;  3H0G B;  3K7A H;  4A4I A;  3CCL A;  3MFY A;  3NBH A;  4ZKC B;  2RDG A;  4A3C H;  3OMG A;  4YWK A;  4Y52 H;  3URY A;  4EQO A;  1AN8 A;  5IP7 H;  4DV3 Q;  5C4X G;  1DCZ A;  4QMG A;  1NCV A;  1RTN A;  4BBS H;  4OHJ A;  3G7L A;  1QWY A;  4LF4 L;  4RGN A;  2L5T A;  2B39 A;  4JPB W;  4I7A A;  3GTQ H;  3G71 A;  1PFS A;  4RHR A;  5BR8 Q;  2WAQ B;  5JJK A;  5C5M A;  4H44 C;  3CQZ B;  4NXN Q;  4LAA A;  2K4K A;  2B3G A;  5M5X H;  5IIF A;  1KNA A;  4UP8 A;  1D5Z C;  2R7Z G;  2PW7 A;  2Q2U A;  5JEA J;  2LSS A;  3C1F A;  5ELB A;  1VCI A;  1QZH A;  2DNC A;  1L0W A;  1HZB A;  1Z47 A;  1SNP A;  3TRZ A;  2AKW B;  4R1J A;  3SEB A;  4OX9 L;  2FMM A;  3CP0 A;  4JI2 Q;  5G3L D;  3MTS A;  1JB3 A;  1PYB A;  4BY1 H;  2JA6 H;  3T56 B;  2ZTE A;  2EDG A;  3MEH A;  3I4N H;  2I07 B;  4IOA A;  3S2H B;  3H91 A;  2OF1 A;  4DK0 A;  4UY8 C;  2MJ8 A;  1CK1 A;  2JEB I;  4DFA A;  4ULL A;  5A35 A;  2UUC Q;  1G8Z D;  2F3I A;  3GTK H;  1C4Q A;  1YNJ D;  3FKI H;  4YIJ A;  5EKI A;  4KHV A;  1HJP A;  5G3L F;  3QOJ A;  4HIM A;  1B1Z A;  1KXL A;  4DNT B;  3SXH A;  4OIJ A;  1PZK D;  1HH2 P;  1Y8P B;  5JAV A;  3BDO A;  1J5E L;  2O2L D;  4B08 A;  3K58 A;  2FHT A;  1CT1 D;  1JMC A;  3DEP A;  2EY5 A;  3A5U A;  4QUC A;  4DAM A;  4GN4 B;  1ASY A;  4AQY L;  3HOV G;  1S40 A;  3IL8 A;  1YHB A;  4C1N I;  4XT3 B;  1LTL A;  4RWS C;  1HR0 L;  5ELO A;  2GVB A;  1B50 A;  1GJX A;  4A3E B;  5C0X I;  4K5V A;  1F9R A;  5J22 A;  4QL5 A;  5M5W B;  3S1N H;  2UUA L;  3DMU A;  5COY A;  1BOS A;  5CV5 A;  3UDF A;  4JI6 L;  5K36 G;  1W6J A;  3GTP B;  1VQG A;  1IBL L;  2B2T C;  2SDF A;  1TKW B;  2F0I A;  2B8G A;  1K8O A;  3KDF B;  4B3M L;  1QIL A;  1I3Q B;  1I50 H;  5C3W A;  4RCN A;  3K81 C;  3ND8 A;  4F87 A;  4DV1 Q;  1Z7T A;  1L2F A;  1BNZ A;  1RJT A;  3V2T A;  4DR5 Q;  1J6Q A;  4HSP A;  5CMD A;  4BA2 I;  4A3G B;  1AP0 A;  1YHQ A;  1CI3 M;  3OW7 A;  5KRU A;  1Y1W B;  1NAP A;  1SLJ A;  5J1Z A;  1BDO A;  4JI0 Q;  4V19 0;  2B2V C;  4JI8 Q;  5CR3 A;  4EQN A;  1H9K A;  3TZD A;  4OXP A;  2MHV A;  4IPC A;  2E2J H;  3DUZ A;  3MHB A;  5M5Y H;  3G6E A;  3CCQ A;  1VQO A;  3J81 c;  5C3E H;  1XYI A;  2KED A;  3DWP A;  3I7F A;  4JW0 A;  4GKK Q;  3NEM A;  1IBK Q;  3RD4 A;  2K52 A;  4BY7 B;  4DR3 Q;  1R4Q B;  3WOE A;  3M7N A;  3HEJ A;  2B2Y C;  1HPC A;  3I4M H;  4X3K A;  1QOH A;  1UWV A;  3OHX C;  2B63 B;  2JA5 B;  2B2T A;  1EY0 A;  2VNU D;  1CFM A;  2A73 B;  2XGT A;  4FNF A;  2PQA A;  1AE2 A;  1S5E D;  1TVX A;  3NTK A;  1CKM A;  3S1M B;  1LTG D;  1V1Q A;  1X3E A;  5GQO A;  2AQ3 B;  4LUZ A;  2QA4 A;  1T5E A;  2K14 A;  4LFA L;  3QR8 A;  3K0Y A;  1PH3 A;  4A3D H;  2B29 A;  2OEO A;  2GVA A;  3OIP A;  2ES2 A;  1KDB A;  1NR4 A;  2QDL A;  2R93 B;  1HZA A;  2Y0S E;  2F0N A;  3VYS A;  2EXD A;  3CME A;  2B2V A;  2M9V A;  4HID A;  2QCP X;  3CRL C;  2UXD L;  2LS0 1;  1QZG A;  5KIX A;  1U9R A;  1WD0 A;  4A3J H;  2B8F A;  3Q23 A;  2CFM A;  3WDN A;  3HKZ E;  2HHH Q;  1STA A;  2OQK A;  1HQM C;  2VUM G;  2QW7 A;  1LT6 D;  3NEL A;  4R4T A;  4HCE A;  2AUJ D;  2C9O A;  2B2Y A;  1FGB D;  3KK7 A;  4DXG A;  3KF8 A;  4P72 A;  4R9W A;  4A3L G;  2EYO A;  1N32 L;  4ZUI A;  1NMG A;  2IT1 A;  2BDO A;  5LMU Q;  2LXK A;  1HUN A;  4IUT A;  5FLM H;  2E8G A;  5FOB B;  2F0P A;  1HHV A;  1XNR L;  3SDZ A;  1D1I A;  5C0X H;  3U50 C;  4JVZ A;  3Q22 A;  4KY5 A;  1EUJ A;  2K7V A;  4TRD A;  2X6L A;  4F88 A;  1PLF A;  3CC4 A;  3P75 A;  5JPM C;  2KJX A;  4IUP A;  2E2H H;  5EPK A;  3BVZ A;  1Y1W G;  4JBK A;  1YNJ C;  1BF4 A;  3MEF A;  4DV4 L;  4DK3 C;  1JR0 D;  3TS2 A;  4YWL A;  1SN8 A;  1VQC A;  2KQ3 A;  1TWA H;  2I5L X;  1GUT A;  4FDB A;  3K57 A;  2K75 A;  4BBR B;  4DAY A;  2BDN A;  4QIW B;  5EPL A;  1QB5 D;  2AMC B;  2EYJ A;  3E5S A;  3PSI A;  4A3F H;  1SMY D;  1YEZ A;  3HFZ B;  2VQE Q;  3S14 B;  3K5O A;  5C4Z A;  1U4L A;  1EZ6 A;  4XYO A;  1TWC B;  5F2D A;  1LO5 D;  2J7Z A;  4LUO A;  4XT1 B;  2PZT A;  3O13 A;  1PH8 A;  2VY3 A;  3TZU A;  3J7Z C;  1BBU A;  5JVG 3;  1LTR D;  1HNX Q;  1CUK A;  1LT5 D;  4PG3 A;  4ZRZ A;  1PYW D;  5HY6 A;  1C9O A;  3PO3 B;  4JYA L;  3HOZ G;  1U0L A;  4QCL A;  1RDP D;  3TRE A;  4HIO A;  1LTA D;  3S2D H;  1SRU A;  2LXJ A;  4PQX A;  2YYZ A;  4CDE C;  4EVO A;  1XMQ L;  2KHI A;  5DAU A;  2CWA A;  4NW2 A;  3S1R H;  5I4D A;  3KLR A;  4DV7 L;  3KBX A;  4H02 A;  3S16 B;  2AWN A;  1KHI A;  3MXN B;  4KKS A;  3T1H Q;  5T1G A;  1VQ9 A;  1GXD C;  4C3I B;  1E0B A;  1L0Y B;  4A3B H;  2EE1 A;  4JCV E;  2FIN B;  2DUD A;  2Y0S B;  2D5D A;  3PO2 H;  4PMW A;  4POF A;  1KAB A;  3I4O A;  1KDC A;  5GAH C;  3CCJ A;  1JJ2 A;  1Y1V H;  1AZP A;  2JSO A;  1DOM A;  1V8Q A;  5EQ0 A;  1GHJ A;  5CGK A;  4G7O C;  3HKZ B;  4A93 H;  3RZO H;  5KNB A;  2DN8 A;  4K2L A;  2C35 B;  2YTV A;  3GTO B;  2FFK B;  4O42 A;  2UXC L;  1EYG A;  1CKN A;  1WI5 A;  1KL9 A;  1NR2 A;  1PTO D;  4DR2 L;  2EY2 A;  4BWG B;  1SNC A;  5KEE A;  2K5V A;  3KUP A;  1X9N A;  3I4N G;  1IKM A;  3FEW X;  3TP6 A;  3NEN A;  1SE8 A;  4ZUJ A;  1QUQ A;  2F52 A;  2VQF Q;  1CA6 A;  2E76 C;  4HTH A;  4X65 L;  3GTM H;  1F9S A;  2B2U A;  4LUV A;  4JC0 A;  3OWE B;  3BVM A;  2A6E D;  1ZKO A;  1B3A A;  1QCB D;  4ZAI A;  5EPJ A;  3GTJ H;  1EY9 A;  1JWU D;  1WTR A;  1B9N A;  4RCO A;  1UAP A;  1FJG Q;  2F4V L;  3M3Y H;  3TP8 A;  3BYY B;  2M00 A;  1L1O A;  2AQ1 B;  3T16 A;  4DV2 Q;  3I70 A;  1NNX A;  1PTO F;  4WOR A;  5DLQ E;  4UP9 A;  3KDF A;  4ZLT F;  3H0G H;  4RFB A;  1DOK A;  4LF5 Q;  4DF7 A;  3D4R A;  5CC4 A;  3QO2 A;  2EZV A;  5FKA C;  1NY4 A;  4ZYS A;  1TS5 A;  3F2U A;  4HJ9 A;  1X56 A;  4FVM A;  1B8A A;  1TT2 A;  4NKL A;  5IT9 E;  1IZ6 A;  1CTM A;  3E6Z X;  3TP5 A;  3EA6 A;  1TXY A;  1EFW A;  3HOW B;  1BUV T;  2HQL A;  4YHH L;  3A7L A;  4J6H A;  1SE2 A;  3EFX D;  3M85 A;  3CQZ H;  3RLO A;  1SND A;  3I3C A;  4IJH A;  4TVA B;  3HP3 A;  4L5R C;  3BZC A;  4DV0 L;  1Q82 C;  3A8J E;  1AEX A;  2I0Q A;  3CU7 A;  1YVC A;  3OOC A;  3MXU A;  2ZT9 C;  4HSV A;  4O0A A;  3ONA B;  3DXJ C;  3K7U C;  3S17 B;  1ICF B;  4A3I H;  4IUN A;  4IUR A;  1EFI D;  3ND9 A;  5IP9 H;  1HNZ L;  1X54 A;  3I8Z A;  1G6Z A;  4HJA A;  2F1M A;  4XQN A;  4A3K G;  1K8G A;  5IYD G;  1W2B A;  3HOX G;  4OWT B;  1FNU A;  3S2H H;  1CSP A;  2O4X A;  4GNX C;  4JI7 L;  1I6H B;  1ICW A;  1BBW A;  1EU4 A;  1WTX A;  1N34 Q;  1SMY C;  1PYS B;  1I4Q A;  4MIU A;  2BH8 A;  1JC7 A;  1NBW A;  4QB4 A;  1TWH B;  1WTH A;  2EY1 A;  5C3E G;  1QJO A;  1CQV A;  2QKI C;  4C56 C;  1A6X A;  4CJ1 B;  3CHB D;  1HRJ A;  2ZM6 L;  1STH A;  1TU2 B;  5C4X B;  4MZ9 A;  2R61 A;  4G7Z C;  1G29 1;  3MXG A;  1Q90 A;  4KN7 C;  3FHW A;  4DUY L;  1RD9 D;  3U4V A;  5M3F G;  1Y14 B;  5EGT A;  5FO8 B;  2K01 A;  1B3Q A;  2NZO A;  1I4H A;  2GN5 A;  1MI2 A;  1E2W A;  4X64 L;  3UDG A;  1HR0 W;  4IPG A;  1K9M C;  4M8A A;  1FGU A;  1NUC A;  2ZJR A;  1GHK A;  1Y69 U;  1O7Z A;  3H09 A;  3GDE A;  2R7Z B;  1S72 A;  1UE1 A;  3F8T A;  2QDB A;  1ET6 A;  1XNQ Q;  3U58 A;  1Y8O B;  3Q0A A;  1UE6 A;  3T1Y Q;  1IKL A;  2KVM A;  4RG1 A;  1X32 A;  2HUG A;  4GNX A;  1K83 B;  1N8R C;  1M8A A;  4JV5 L;  1BVS A;  2VW9 A;  1UEB A;  3T13 A;  4X62 L;  4A3E H;  3HOY G;  4UDU C;  3J80 E;  2MO1 A;  5M5W H;  1KD1 C;  1YIJ A;  3J7A 5;  1EWC A;  3K8A A;  2NUC A;  1XPO A;  5JJL A;  2A5H A;  1C0A A;  1Q12 A;  2K5Q A;  2RCN A;  3ERQ A;  1N33 L;  1VS0 A;  2F0M A;  2SNM A;  3STB D;  1HNW L;  2WIN B;  3CXC A;  2L12 A;  2VS1 A;  2ZXO A;  4KJO A;  3CD6 A;  2A8V A;  4V0B A;  3TDQ A;  3AEV A;  5IE8 A;  1PTO C;  1T9H A;  5CBE E;  1TR5 A;  2NTT A;  2NYZ D;  4A3G H;  1K0S A;  5ELD A;  2EY6 A;  3OIQ A;  2JA7 H;  3VYT A;  1TY0 A;  2BE5 D;  3L7Z C;  1VQB A;  3J81 L;  5BN4 A;  2RKS A;  1GVP A;  1RL2 A;  3JC6 6;  2A6E C;  4ID6 A;  2NBF A;  4A75 A;  4LFC Q;  1UE7 A;  2IJ0 A;  4RKB A;  1TWG B;  4DA2 A;  2L9H A;  4L6T B;  2JA8 H;  1M1K C;  1D8L A;  5D3D A;  4AIM A;  3CAM A;  2E2I H;  2JA9 A;  1XTC D;  4S3S A;  3J81 i;  3HOV B;  1UE5 A;  3DHQ A;  3HGB A;  3R2T A;  2IHE A;  4KTA A;  1Q46 A;  1C7Y A;  4LF9 L;  1EL0 A;  3I2Z A;  4Z9C B;  4B3R Q;  1IBM L;  4DV6 L;  4IZ8 A;  2JA5 H;  1MJE A;  2B63 H;  1QNK A;  1VQ5 A;  4O1N A;  1JJC B;  1LTT D;  4KKU A;  5E4X A;  4LF6 L;  1S5F D;  4UP7 A;  1D6E C;  3J81 j;  4B3T Q;  5FO7 B;  3SK5 A;  4LF8 Q;  4ZK9 B;  2CHB D;  2QGQ A;  2WKC A;  3MVV A;  4K8I A;  4KJN A;  2OQ0 A;  2NN6 I;  1E1O A;  1S5B D;  4ODG A;  1BR9 A;  2EJF C;  1OXU A;  4Q5V A;  2Z0S A;  2JJQ A;  3U4Z A;  3HOU H;  2EYF A;  1WTO A;  1WOC A;  2R93 H;  1F77 A;  2OXP A;  3GV6 A;  1H9J A;  1XPU A;  1AE3 A;  1IYU A;  1GO3 E;  4R4O A;  4TQU S;  1WD1 A;  3PO2 G;  3ZJY C;  3RZD B;  3RMH A;  1EIH A;  1AH9 A;  1YJW A;  1Y1V G;  4F7X A;  4DK6 C;  2MP1 A;  4C1N K;  3D3R A;  2IHF A;  5COR A;  4LF4 Q;  1E2V A;  2YTY A;  5TSS A;  2MO0 A;  2OTJ A;  1EYC A;  2Q8T A;  4MHE A;  2LKV A;  2F0E A;  5DNF A;  5NUC A;  1KRT A;  3LX0 A;  4B3S L;  5CV9 A;  4N9P A;  1A3T A;  1UEA B;  1JE4 A;  5IT9 c;  5IYB H;  2RDH A;  1RF2 D;  2Q2H A;  5EBD A;  1GKH A;  2PZU A;  3KLS A;  4LMQ D;  1PH6 A;  1EOV A;  3F2C A;  4OX9 Q;  1KTK A;  4BXX H;  2RSN A;  4BBR H;  3TEH B;  5C44 G;  3PIP 3;  1WJJ A;  3H6M A;  3FP9 A;  4DNR B;  1L0X B;  4A3M G;  3W1G A;  4CDC C;  3S14 H;  3GD7 A;  4FF4 A;  1HA6 A;  4G4K A;  2R92 G;  5JEA H;  1I4X A;  1TWC H;  5IGC A;  4JI5 L;  3U9O A;  1X3Q A;  3QJY A;  1SSO A;  3GTG B;  5LHY 1;  4C3J G;  5ELF A;  5FJ8 G;  4DXF A;  5ELN A;  1SAP A;  3GP7 A;  4R8N A;  1MGS A;  1Q8K A;  3PGZ A;  5ELC A;  1GOZ A;  2F0L A;  1ET9 A;  2WKD A;  3DM1 A;  3PO3 H;  1I5F A;  1PA6 A;  2WB1 G;  2VUM B;  2R3Z A;  1I4R A;  2TSS A;  5FLX E;  1VMC A;  1II3 A;  1PDQ A;  4CBV A;  2NVY B;  1E24 A;  4B9W A;  4LJZ C;  2IW3 A;  5BN5 A;  3S16 H;  1EEI D;  4LW1 A;  1J5E Q;  2ICE C;  2DY7 A;  2XTI A;  1WTP A;  2UXB L;  2A74 C;  4C3I H;  3OW2 A;  3C46 A;  3STB C;  5I2X A;  3HS0 C;  1SNQ A;  1YJN A;  5KNC A;  1FNV A;  2KHS A;  4RHS A;  1ENF A;  4AQY Q;  4YY3 L;  4ZQ3 A;  1B44 D;  4BA1 I;  2HCC A;  2NN6 H;  2X6G A;  4QIW E;  1HR0 Q;  4X66 L;  3PUV A;  2E5L L;  3D8G A;  2JEA I;  1M90 C;  2KCT A;  1FR3 A;  4C3H H;  4A3I G;  3T51 B;  3X3M A;  3TQY A;  2HDL A;  1VQM A;  2Z8L A;  1PTO H;  4K14 A;  2UUA Q;  5I9P A;  3GTO H;  5IP9 G;  4KD4 A;  3KF6 A;  2EJM A;  2BE5 C;  1GUS A;  1OO9 B;  4KV6 A;  3ZYY X;  4JI6 Q;  2F0F A;  5IY0 A;  4GOP B;  1QG7 A;  2DY8 A;  3AYH B;  1IBL Q;  2RDF A;  2EYL A;  2KCM A;  3PIP A;  3PUX A;  2NTS A;  3J80 c;  4B3M Q;  2CH4 A;  3TBI B;  1SYC A;  1J9O A;  5BN3 A;  4U68 A;  4IUV A;  5K5P A;  1WCM G;  3NQI A;  3CPW A;  1H9R A;  3CC2 A;  4K0K L;  3G4S A;  1HFG A;  3S1Q B;  4FF3 A;  2VZA A;  3HOZ B;  4DUZ L;  3MC0 B;  1FVI A;  4J15 A;  1BCP B;  2PI2 A;  4N9T A;  3HG9 A;  2OTL A;  2WP8 J;  3UDX A;  5JPN C;  2N3S A;  2F03 A;  2AWO A;  4RGM A;  2ZXP A;  1AFP A;  1BCP D;  3MXP A;  3BS1 A;  1YNN D;  3SK6 A;  1FNW A;  4DR7 L;  4IPH A;  2IX3 A;  2HCI A;  3NWT A;  1SNM A;  1RIP A;  1GUG A;  1G2T A;  2RBM A;  1MBY A;  4AYB G;  3CCV A;  4GKJ L;  4HED A;  4CHT B;  4NXM L;  1MJC A;  3JAM E;  4ALP A;  2RF4 A;  1H9S B;  2N88 A;  1FD7 D;  3D4D A;  3PUW A;  3H3V H;  1E7Z A;  3FPP A;  1S3O A;  2Z4I A;  4GN3 B;  3MWY W;  3BDL A;  3EIV A;  4RAU C;  1MD2 D;  2L55 A;  4HMJ A;  1PMR A;  1BCP F;  1T5X D;  1P8L A;  4CJ2 C;  1PFM A;  1H95 A;  2XVS A;  2J4X A;  1ROD A;  1KLU D;  3UI2 A;  4LFA Q;  1VF5 C;  3M4O B;  3I4N B;  1N9W A;  5J3B A;  3P7J A;  3NPP A;  1HZ9 A;  1O78 A;  2R6G A;  1BQQ T;  1A3U A;  3DLL A;  2CH4 W;  1EU3 A;  2DGY A;  4KKT A;  2L15 A;  4IFD G;  1TS2 A;  3GQB A;  3GTK B;  4EQ5 A;  3S17 H;  2NVT H;  4ME3 A;  4NPS A;  1VMP A;  3MFG A;  4JOI C;  5IYC H;  4HJ7 A;  2UUB L;  2UXD Q;  2M2L A;  4MNO A;  1HFN A;  3BYT B;  4JI1 L;  1CSQ A;  3H15 A;  2MNA A;  3BG3 A;  4FF1 A;  4DV5 L;  4DPG A;  5EBC A;  1U4R A;  5C5L A;  2JA7 G;  1V1P B;  3W1B A;  2KHJ A;  4YWM A;  5A2Q E;  3ULL A;  2WFW A;  4KHP L;  3QB3 A;  1SR3 A;  1OTC A;  2ZJP A;  1N32 Q;  2HIV A;  1I6H H;  1Y8N B;  3PV0 A;  1BXT A;  1WTV A;  1XNR Q;  3VR6 A;  2VL6 A;  3GO5 A;  3PMF A;  2I5M X;  2O5I C;  1EOT A;  1TWH H;  3EN2 A;  4ZKB B;  2PMZ B;  3JAM i;  2NB0 A;  2EIF A;  2F0J A;  4A3C G;  4DR6 L;  1WTW A;  1DZ1 A;  1OXX K;  5IP7 G;  5KGU A;  2SNS A;  3AU7 A;  4C2M H;  5C4J H;  5IGD A;  4DV4 Q;  2I46 A;  3AFP A;  4BBS G;  1G51 A;  2K33 A;  2RQX A;  4YCW A;  2O5J C;  4FXG C;  1JWM D;  2ALY B;  1MKH A;  4JOI A;  4Y7N B;  4XQQ A;  4R4I A;  3J7A F;  4KHZ A;  4DR1 L;  5M3M H;  1IL8 A;  2PYK A;  1Q1E A;  3QWN A;  2R7Z H;  1JB7 A;  3EVQ A;  3HKS A;  2G5D A;  3VR5 A;  2N78 A;  3RR5 A;  4P71 A;  3Q6S A;  2FMC A;  5I6Y A;  1DJR D;  1XWE A;  1IHZ A;  2N49 A;  1AZQ A;  3NWS A;  2MFI A;  1LV9 A;  3B6Y A;  1A2T A;  2N55 A;  4QGU A;  1K83 H;  3NBH B;  4QY7 A;  1YIT A;  1SE4 A;  4P73 A;  3NBI A;  4RA8 A;  5LMN W;  4JYA Q;  1FL0 A;  5AJ3 L;  2XWB B;  2BH2 A;  4WJW A;  1PVO A;  1DYQ A;  2BCO A;  4A3K B;  4GLX A;  4BY1 G;  3HOX B;  2JA6 G;  1XMQ Q;  1ZEQ X;  1LT4 D;  3CRK C;  4K2K A;  4DV7 Q;  3VR2 A;  3TP7 A;  2WV6 D;  5GAD C;  1SFO B;  2Z4H A;  4HJ5 A;  3SVM A;  3U9S A;  5M5Y B;  4ILW A;  3DEO A;  5C3E B;  1OXV A;  5FLX c;  1EY5 A;  2SEB D;  3FKI G;  1SYG A;  2CW0 D;  4J1M A;  4UHV A;  4R4C A;  3N6R A;  1YI2 A;  4IN3 A;  1DM0 B;  2Q2I A;  1I94 L;  1VQ6 A;  2MUY A;  3FVQ A;  2ZTC A;  5M3F B;  2Q8R E;  4OEL B;  5IWA L;  3CCE A;  1KNE A;  1QVC A;  1K8A C;  2IPK D;  2K5H A;  2UXC Q;  3V96 A;  2AQ2 B;  1S5D D;  1TWG H;  1CHQ D;  4DR4 L;  1EQR A;  3AFQ A;  1S5C D;  3BZD B;  4DR2 Q;  1BCP C;  3NP8 A;  2AUK A;  2PNR C;  1YNN C;  4CJ0 B;  3HOV H;  2BA1 A;  2WAC A;  2K03 A;  4E6I A;  1HQR D;  3L3O C;  1E2Z A;  5IGF A;  1YJ9 A;  2XIW A;  4PMB A;  4IO9 A;  1ZYR D;  1PXU A;  3A0J A;  3AMU A;  2RHQ B;  3HOY B;  5CV8 A;  2NVX B;  5LL6 X;  4LF7 L;  4X65 Q;  1I4P A;  4R4Q A;  1ML0 D;  4JI3 L;  4L8J A;  3W2D A;  1HA5 A;  3IFD A;  1YNX A;  1EY8 A;  3NHH A;  4U67 3;  5K36 H;  5D14 A;  2F4V Q;  1HCZ A;  4JI4 L;  4OO1 I;  4A76 A;  1VQ7 A;  4APV A;  1LYL A;  5GRO A;  2QEX A;  1E1T A;  1PV4 A;  4IJL A;  1KRS A;  2BA0 A;  4KMU C;  4P75 A;  3X3N A;  1IYV A;  3KYH C;  1LAC A;  4K8J A;  5GAG C;  4FYD A;  5E1F A;  4J8Q A;  3Q24 A;  2JYO A;  1B2T A;  1AW7 A;  3RZD H;  2PCF B;  2Q8I B;  4KLK A;  5DM7 3;  2NN6 G;  1LT3 D;  1JOQ A;  1TWA B;  2JE6 I;  3A8I E;  3I4L A;  3T53 B;  2XRS D;  4C3H G;  3CMA A;  2L1B A;  5IT9 L;  4WJ4 A;  3JAM c;  4YHH Q;  1B53 A;  3A8K E;  3DM3 A;  4A3F B;  2V1C C;  3MA2 B;  4FXD A;  1IW7 D;  1STY A;  4DV0 Q;  4LFB L;  2ZTD A;  2UU9 L;  2ZJQ A;  1B4O A;  2D2C C;  2K04 A;  4IFD J;  1K3B C;  3I4M G;  2CVR A;  1SEB D;  2PNH A;  3LWU A;  3PUY A;  3FPU B;  2D0P A;  2RCF A;  1HNZ Q;  4GN5 A;  1E22 A;  1PFB A;  2D0O A;  3PCO B;  4G7H C;  1VQH A;  1G2S A;  4RGT A;  2AHO B;  1F2Y A;  4DU9 A;  2K1B A;  1VQP A;  3F2D A;  1ESF A;  1N36 L;  1EEF D;  1MSG A;  1A3V A;  3IAY A;  3S1R B;  2V4D A;  3OPO A;  1XMO L;  4A3D G;  1EQQ A;  1R4P B;  4JI7 Q;  3GTL B;  4K5X A;  2Z1C A;  1TS3 A;  3K80 C;  1Q86 C;  3GTG H;  3P1H A;  4A3B B;  2A69 D;  3OTO L;  1JCK B;  4XTC S;  1YZ6 A;  3PO2 B;  1TWF B;  2Z6B A;  3EJI A;  4A3J G;  3L9A X;  1VQE A;  1VQN A;  3NXW A;  1EQT A;  1Y1V B;  3TME A;  2ZM6 Q;  2XN9 C;  3NK9 A;  2K28 A;  4JBW A;  3GTP H;  3W3A A;  4PZ8 A;  1D1K A;  5CYU A;  4DUY Q;  4A3L H;  5CV4 A;  5LMN L;  4QJF A;  1XTD A;  3J7Y W;  4X64 Q;  5E3F A;  2ICI A;  1I3Q H;  1VF7 A;  2JQO A;  1BBX C;  5FLM G;  2K50 A;  3VR4 A;  2OWO A;  1CHP D;  2FXQ A;  2F0O A;  2KBN A;  4CDF C;  3D6C A;  3K0X A;  5C0X G;  1TS4 A;  2KOL A;  3LGJ A;  5M9O A;  3ERS X;  2MQH A;  4X3U A;  2EQS A;  2KEN A;  4DV3 L;  3K5L A;  1Z9F A;  2EJG C;  1Y1W H;  1F2L A;  4OO1 H;  4DNI A;  4FF2 A;  2IL8 A;  4JV5 Q;  1J8I A;  2RVL A;  1YBY A;  2CW0 C;  4X62 Q;  5IGE A;  3R2I A;  2R7D A;  3SHL A;  3MXN A;  5C44 B;  5BR8 L;  1SJE D;  3KJP A;  3T4A C;  1UNS A;  4A3M B;  1LTS D;  1O7L A;  1U4P A;  4NXN L;  2VXW A;  5EKL A;  3J80 L;  4A3F G;  1N33 Q;  2R92 B;  2HD3 A;  5I2Y A;  2SOB A;  4BY7 H;  1HNW Q;  4N8X 1;  3KF8 B;  5C3X A;  2G9H D;  1KDA A;  5KYI A;  3H94 A;  3ITP A;  4C3J B;  3K5M A;  5HGQ A;  1Q8I A;  1U5K A;  1PH2 A;  3J80 i;  3EBE A;  2BOS A;  2L11 A;  1VQ8 A;  1DGS A;  4JI2 L;  3AB9 A;  3S1Q H;  2WB1 B;  3HOZ H;  3S1M H;  1STN A;  1Q7Y C;  3RLF A;  1R9T B;  5IGB A;  1K0R A;  3Q8D A;  5FK9 C;  1V9P A;  1ZYR C;  4OGQ C;  3NTI A;  1SXT A;  1W3S A;  1KQS A;  3H3V C;  3CCU A;  4LK1 C;  4DAY B;  3I72 A;  2UUC L;  1SYF A;  4JK1 C;  4A3B G;  1PZI D;  1X6O A;  3ULP A;  3CC7 A;  5M3M G;  3S15 B;  5CBA E;  2ASB A;  4LF9 Q;  4H7B A;  1QVF A;  1S4Z A;  1EIY B;  1IBM Q;  4DV6 Q;  2YU9 B;  1ONL A;  4OIK A;  1STG A;  4A3I B;  1ILQ A;  4LF6 Q;  4A93 G;  3N52 A;  3D6W A;  3FMC A;  1EWI A;  4RKL A;  2F0Q A;  3PF5 A;  4H0L C;  5J39 A;  4CKB A;  5C4H A;  5GAE C;  4POG A;  1JIC A;  3M4O H;  2RA4 A;  4MTN A;  4KD3 A;  1KC8 C;  1IL2 A;  2F4I A;  3VYR A;  1WCM B;  2F3V A;  3M7G A;  1EIG A;  1IW7 C;  4EGV A;  1LAB A;  1VQA A;  1STE A;  2Q2T A;  1CA5 A;  1CZW A;  1JJG A;  1O80 A;  3UDI A;  3CKI B;  2EYM A;  1JWS D;  3H3V I;  1SRO A;  3KBG A;  4I65 A;  5EAY A;  1C48 A;  1ENA A;  4EQP A;  1X3G A;  2DJF C;  2EVB A;  2OT2 A;  3KLW A;  1EY7 A;  5D65 A;  2ATW A;  3D0F A;  2E75 C;  1ZXT A;  1CKN B;  3H0G G;  2NVQ B;  4DV1 L;  4AYB B;  4B3S Q;  3TN2 A;  1SMX A;  3VDY A;  2VB3 X;  2JK8 A;  4DR5 L;  4PV1 C;  3CW2 C;  2HIX A;  2JXM B;  2XNA C;  1QUQ B;  3I56 A;  2A69 C;  1TQO A;  1CM9 A;  1EY6 A;  2PW5 A;  3K6O A;  3V05 A;  5D3I B;  4JI0 L;  3NE5 B;  4JI8 L;  3RN2 A;  3I91 A;  1V43 A;  3C3L A;  1X55 A;  1PH7 A;  5KND A;  1VQK A;  4Y7N H;  1WVL A;  1B7Y B;  2WAQ G;  2A68 D;  3CCS A;  4GKK L;  1IBK L;  3K5N A;  1A63 A;  1L1O B;  1G6P A;  4DR3 L;  1HTL D;  3M4P A;  1LUZ A;  4JI5 Q;  1GD7 A;  1RTO A;  1JE5 A;  3K59 A;  4KY6 A;  4NP5 A;  1I6V C;  4O2D A;  3KOJ A;  4L63 B;  2YV5 A;  4CKE A;  1V1O A;  4MTK A;  3E9I A;  5HGT A;  1PH4 A;  4RMF A;  2A6H D;  3BJU A;  5LL6 S;  4DK1 A;  1B70 B;  2JA7 B;  4A3K H;  2DJG C;  3SR1 A;  1X3P A;  1LLR D;  5E4W C;  5IYD H;  3HOX H;  2GA4 B;  4JBJ A;  2WII B;  5FLX L;  2DNE A;  3A54 A;  2PMZ E;  1SFO H;  1SBB B;  1JOK A;  4MN3 A;  4EX5 A;  4KK7 A;  3K7A B;  2UXB Q;  3PIO 3;  2JA8 B;  5C0X J;  3OYY A;  3ERO A;  4YCU A;  3HZX A;  4CGY B;  2E2I B;  4YY3 Q;  2HHH L;  2L0C A;  2E5L Q;  4X66 Q;  1NSN S;  1Q1B A;  1JOO A;  1RCV D;  4BBS B;  2K6A A;  4ZCK A;  3DWA A;  4IUQ A;  3GTQ B;  2F0U A;  5M3F H;  4GLV B;  5JVH 3;  3QOL A;  4IOC A;  1GUN A;  2EOT A;  5LMU L;  2F0S A;  2E74 C;  3J7A V;  2N8N A;  3E0E A;  4KI0 A;  3W5O A;  1QVG A;  3M4Q A;  1GUO A;  1SJH D;  1X3F A;  2NZ1 D;  5M5X B;  2KUM A;  2NWG A;  4GLA C;  3SE0 A;  3CF5 A;  2KCC A;  3SK4 A;  4IAL A;  3HOU B;  1LM0 A;  2EYP A;  4HJ8 A;  3KJO A;  3FDT A;  1SNO A;  4K0K Q;  3HOY H;  1NTG A;  1D5X C;  1STB A;  3OSO A;  2NVX H;  2F0G A;  4A3E G;  4DUZ Q;  3A74 A;  3HOW H;  3E3X A;  1U4M A;  4BY1 B;  3D4W A;  4KN4 C;  2JA6 B;  2A19 A;  3WOF A;  3PUZ A;  3AQQ A;  1LTB D;  4P74 A;  1HTP A;  3OWF A;  2VQE L;  4PNY A;  5T1I A;  4TKO B;  3VA7 A;  3L2P A;  2CWP A;  2RSO A;  4FP5 D;  4DR7 Q;  3IFT A;  4XDX A;  3C1E A;  1PRT B;  1EY4 A;  3FKI B;  1QE6 A;  2MPM A;  1HNX L;  4GKJ Q;  4NDX A;  4NXM Q;  5JOB A;  5EJW A;  4A3G G;  1PRT D;  4L5T A;  3PIO A;  3MZ5 A;  1GM5 A;  2K05 A;  2D9U A;  4TSS A;  2FJ2 A;  4GNX B;  3JAM L;  1VQ4 A;  4PZ6 A;  1O7I A;  3LWE A;  3C2P A;  3OMC A;  5IOD A;  4IQZ A;  4OO1 G;  3R3O A;  3IKJ A;  1XX8 A;  1W6K A;  3T1H L;  1DD2 A;  1EQV A;  1K3R A;  2G9D A;  4DKA C;  1WTQ A;  1WFQ A;  3D31 A;  3LNN A;  3UE0 A;  2JA8 G;  3G48 A;  4JBM A;  4HR7 B;  1VQD A;  4BY7 G;  1Q3L A;  2MGS A;  1JQY D;  5C4X H;  1X65 A;  1PRT F;  2K5D A;  1NMF A;  3RLN A;  3R93 A;  2JA5 G;  2B63 G;  2UUB Q;  4RGO S;  3VA5 A;  2I5H A;  2R7F A;  4HN7 A;  4JI1 Q;  1CZG A;  3MAQ A;  3S1N B;  4DN4 M;  1UUP A;  3ER0 A;  1KIX A;  4DV5 Q;  2F3W A;  4OEM B;  1VQF A;  3S24 A;  3BZK A;  1FYC A;  4DGZ A;  4F8M A;  1NE3 A;  1JOR A;  1MIU A;  1C8C A;  4OWW B;  2F0V A;  3CCM A;  1LTI D;  1O7Y A;  4KHP Q;  5CV7 A;  1A15 A;  3VYU A;  1ASZ A;  2JN4 A;  1B9M A;  3HOU G;  5IOC A;  3GTL H;  2XWJ B;  5CV6 A;  1G91 A;  1I50 B;  3G6J B;  5A2Q L;  2R93 G;  3SK8 A;  2VQF L;  2A68 C;  1MSH A;  1CQF A;  2B2U C;  4YCV A;  4HIK A;  2E2D C;  1KAA A;  4X6A H;  3KFU A;  1TWF H;  4CDD C;  1K73 C;  4DR6 Q;  3BDC A;  2F0D A;  4GS3 A;  1L1O C;  1D2B A;  4N8F A;  1DXM A;  1FJG L;  4GZY C;  4WRD A;  4DV2 L;  2IX0 A;  4C3H B;  1VQL A;  4IUU A;  1MHW C;  4K6L A;  1JT8 A;  2E2J B;  2B2W C;  1HXY D;  2A6H C;  1PTO B;  3I73 A;  1RHP A;  4DR1 Q;  4R8I A;  4LF5 L;  4CKC A;  5E7N A;  3I90 A;  1BO0 A;  2PZW A;  1I4G A;  3NSW A;  4B9X A;  4GOP C;  5IYB G;  2LY7 A;  3I4M B;  4JG2 A;  1EYA A;  4UAI A;  5HUR A;  1D5M C;  1HUM A;  3F1Z A;  2K5W A;  2ID0 A;  1PH5 A;  2EPB A;  4X3S A;  4BXX G;  2RHS B;  3M9B A;  4IPD A;  1XPR A;  1SYE A;  2IWH A;  4AH6 A;  4BBR G;  4KY7 A;  2HDM A;  5C44 H;  5AJ3 Q;  3ICE A;  4I7Z C;  3BU2 A;  2QIL A;  2Z6K C;  2OCE A;  4A3M H;  4NMZ A;  2F0T A;  3WWV A;  2CCZ A;  1OXT A;  5L37 A;  3A7A B;  4A3D B;  1A8V A;  4FXK C;  2R92 H;  1ESR A;  2A1A A;  2IY5 B;  3HRZ C;  4LWC A;  2F0K A;  5JEA G;  3A56 A;  2XRQ D;  4C3J H;  5FJ8 H;  3PF4 A;  2H4O A;  4RH6 A;  2B2W A;  1KLG D;  4A3J B;  2JP1 A;  4UPA A;  1EWH A;  3RUZ A;  1VQI A;  2LMC B;  3PO3 G;  1R9T H;  4IFD I;  4L5Q A;  3TS0 A;  1I94 Q;  4M1U B;  3ULJ A;  5ISR A;  1F2Z A;  4GOP A;  3E9H A;  1OXS C;  1IXR A;  1XXG A;  2PI2 E;  5DEH A;  5IWA Q;  4QQB X;  4G57 A;  4ABN A;  1ENC A;  3E0J A;  2YTX A;  3GV3 A;  3IRB A;  4LNQ A;  1K28 A;  1N34 L;  2KA7 A;  1EIF A;  4DR4 Q;  1SDF A;  4C3I G;  2F0W A;  2TMP A;  2VB2 X;  4QUF A;  1E3P A;  3R8B A;  2Y0S G;  2Z6K A;  3NUC A;  3S15 H;  2P5Z X;  3BVG A;  1GUW A;  2LFN A;  4H13 C;  2E2H B;  1TY2 A;  1Z6H A;  1NJI C;  2YU9 H;  4HMI A;  2KEC A;  2NVT B;  5I9O A;  4XXE A;  4LF7 Q;  4JI3 Q;  3HKZ G;  4XIG S;  1SYB A;  1PRT C;  5H1S E;  2ZXR A;  2KEE A;  2K5N A;  2EXZ A;  3PQI A;  1EZ8 A;  4JI4 Q;  3QIA A;  4OON A;  1EYD A;  2C5C A;  1Q81 C;  4HAE A;  3TSS A;  1XNQ L;  1M4V A;  4XQJ A;  4WFN 3;  2PPB C;  2QF7 A;  5I6W A;  1H9S A;  2WB1 E;  3T1Y L;  1QNU A;  1WCM H;  3M4Y A;  1WYD A;  1KAW A;  2Z9H A;  3QG1 A;  1A0I A;  2QEJ C;  3EQL C;  4X3T A;  4P2C B;  3S2D B;  3SGI A;  3S9W A;  3CPF A;  4C2M B;  3FRP B;  5C4J B;  4DAP A;  2WAQ E;  1XJV A;  1PH9 A;  2PO4 A;  2HQE A;  1ILP A;  3RN5 A;  4WJ3 M;  1BKB A;  3KLS X;  3KF6 B;  3NTH A;  4QF4 A;  2L4N A;  2XSC A;  2F0H A;  1D7Q A;  4PZ7 A;  2EYH A;  2NVQ H;  2KCN A;  5M3M B;  3P20 A;  4OWX B;  4LFB Q;  3L0O A;  2UU9 Q;  5ELE A;  3J81 E;  3A5Z B;  2VUM H;  1P16 A;  5KYL A;  1PZJ D;  2H5X A;  4ME5 A;  2PQE A;  5FO9 B; 
#chains in the Genus database with same CATH homology
 1E7Z A;  1S3O A;  2NVY H;  3I55 A;  1JJG A;  4GN3 B;  3UDI A;  1IYJ B;  2PQA B;  3GTJ H;  3H3V I;  4NB3 A;  3EIV A;  1SRO A;  1FJG Q;  2F4V L;  3M3Y H;  5EAY A;  4LFC L;  1L1O A;  1P8L A;  1H95 A;  5JJI A;  4DV2 Q;  1HZC A;  1X3G A;  2CKZ B;  3HOW G;  5DLQ E;  4LFA Q;  3KLW A;  2D62 A;  1N36 Q;  4UP9 A;  4L5S A;  2ATW A;  3KDF A;  3D0F A;  1N9W A;  5J3B A;  2NZH A;  1XMO Q;  1HZ9 A;  3H0G H;  1CKN B;  2R6G A;  3H0G G;  3DLL A;  4DV1 L;  4K0K L;  2DGY A;  4B3S Q;  2L15 A;  4LF5 Q;  4IFD G;  1CKO A;  1SMX A;  3VDY A;  4B3R L;  4DR5 L;  2JK8 A;  2IX1 A;  4EQ5 A;  3S17 H;  2NVT H;  4ME3 A;  4NPS A;  4JOI C;  3CW2 C;  5IYC H;  3OTO Q;  4HJ7 A;  1PHJ A;  2UUB L;  5IYC G;  4MNO A;  1NY4 A;  2UXD Q;  2HIX A;  4JI1 L;  1PH1 A;  1QUQ B;  1YHA A;  3I56 A;  1CSQ A;  1X56 A;  4HJ9 A;  3H15 A;  4B3T L;  4LF8 L;  1B8A A;  2MNA A;  1IZ6 A;  4DV5 L;  4DPG A;  4JI0 L;  3CCR A;  4JI8 L;  3RN2 A;  1V43 A;  3UE1 A;  3RNU A;  2JA7 G;  1TXY A;  1X55 A;  1EFW A;  3W1B A;  2HT1 A;  2KHJ A;  1PH7 A;  4YWM A;  3ULL A;  2HQL A;  4YHH L;  1VQK A;  2WFW A;  4Y7N H;  4KHP L;  4AYB E;  1B7Y B;  2WAQ G;  1SR3 A;  2CQO A;  3F2B A;  2ZJP A;  3M85 A;  3CCS A;  5LMN Q;  1OTC A;  1A62 A;  2HIV A;  3CQZ H;  4IJH A;  4TVA B;  3RLO A;  1IBK L;  4GKK L;  1I6H H;  1A63 A;  1L1O B;  3PV0 A;  1VQJ A;  3BZC A;  4DV0 L;  1Q82 C;  4L5R C;  1G6P A;  4A4I A;  3K7A H;  4DR3 L;  2I0Q A;  1YVC A;  1XNR Q;  3M4P A;  3CCL A;  1LUZ A;  2VL6 A;  3GO5 A;  2I5M X;  4JI5 Q;  1TWH H;  3EN2 A;  4O0A A;  1GD7 A;  1JE5 A;  3K7U C;  3JAM i;  4A3C H;  4A3I H;  4YWK A;  2EIF A;  4A3C G;  4Y52 H;  4DR6 L;  4O2D A;  3KOJ A;  5IP7 H;  4DV3 Q;  2YV5 A;  1OXX K;  5IP9 H;  5IP7 G;  4C2M H;  5C4J H;  1HNZ L;  1X54 A;  5C4X G;  4DV4 Q;  3E9I A;  4BBS H;  3AFP A;  1PH4 A;  4RMF A;  4LF4 L;  4BBS G;  4HJA A;  3BJU A;  1B70 B;  1G51 A;  4A3K H;  3GTQ H;  4YCW A;  5IYD H;  4A3K G;  1K8G A;  3G71 A;  2ALY B;  3HOX H;  5IYD G;  1PFS A;  5BR8 Q;  1MKH A;  1W2B A;  4JOI A;  3HOX G;  4OWT B;  3S2H H;  4JBJ A;  4R4I A;  1CSP A;  5JJK A;  4GNX C;  4JI7 L;  4NXN Q;  2PMZ E;  4KHZ A;  4DR1 L;  1SFO H;  1BBW A;  5M3M H;  4EX5 A;  2K4K A;  1Q1E A;  2B3G A;  5M5X H;  2R7Z H;  1N34 Q;  1JB7 A;  2UXB Q;  4UP8 A;  2R7Z G;  1PYS B;  3HKS A;  2Q2U A;  5JEA J;  2LSS A;  2N78 A;  3RR5 A;  2BH8 A;  1NBW A;  1VCI A;  4P71 A;  5C0X J;  3OYY A;  5C3E G;  1QZH A;  4YCU A;  2N49 A;  2MFI A;  3B6Y A;  4YY3 Q;  4QGU A;  1L0W A;  1HZB A;  1K83 H;  1Z47 A;  3NBH B;  2AKW B;  4QY7 A;  4R1J A;  2ZM6 L;  1YIT A;  4OX9 L;  3CP0 A;  4JI2 Q;  3TRZ A;  4P73 A;  4MZ9 A;  2E5L Q;  4X66 Q;  5LMN W;  1Q1B A;  4JYA Q;  1FL0 A;  1G29 1;  1PYB A;  5AJ3 L;  3FHW A;  4DUY L;  2BH2 A;  1PVO A;  4BY1 H;  5M3F H;  4GLV B;  4GLX A;  4BY1 G;  2JA6 H;  3U4V A;  5M3F G;  1Y14 B;  2ZTE A;  2JA6 G;  4IOC A;  1XMQ Q;  5LMU L;  2NZO A;  2GN5 A;  4X64 L;  3I4N H;  3UDG A;  1HR0 W;  4IOA A;  4IPG A;  4DV7 Q;  2N8N A;  1N32 Q;  1K9M C;  3E0E A;  1FGU A;  4KI0 A;  3W5O A;  4UY8 C;  2JEB I;  5GAD C;  2ZJR A;  3M4Q A;  4HJ5 A;  1QVG A;  1X3F A;  3GDE A;  1S72 A;  2UUC Q;  1UE1 A;  3F8T A;  2F3I A;  4GLA C;  3CF5 A;  3GTK H;  1XNQ Q;  3U58 A;  1LM0 A;  1OXV A;  3FKI H;  5FLX c;  1UE6 A;  3FKI G;  3T1Y Q;  4HJ8 A;  4RG1 A;  3KJO A;  4R4C A;  4GNX A;  1N8R C;  4K0K Q;  4JV5 L;  1HJP A;  3HOY H;  1NTG A;  1BVS A;  2VW9 A;  1UEB A;  4X62 L;  4A3E H;  2NVX H;  1YI2 A;  3HOY G;  4A3E G;  2Q2I A;  1I94 L;  1VQ6 A;  2MO1 A;  4HIM A;  4DUZ Q;  3A74 A;  5M5W H;  1KD1 C;  2ZTC A;  1YIJ A;  3HOW H;  1KXL A;  3J7A 5;  3K8A A;  5JJL A;  1XPO A;  5IWA L;  3CCE A;  1C0A A;  2A19 A;  1Q12 A;  1HH2 P;  3PUZ A;  1QVC A;  3AQQ A;  2RCN A;  1K8A C;  4P74 A;  1N33 L;  2VQE L;  1J5E L;  1VS0 A;  2K5H A;  3STB D;  3L2P A;  1HNW L;  2CWP A;  2UXC Q;  1TWG H;  4DR4 L;  1EQR A;  3CXC A;  3AFQ A;  4DR7 Q;  1JMC A;  2VS1 A;  4DR2 Q;  2A8V A;  3CD6 A;  3A5U A;  3AEV A;  3HOV H;  4DAM A;  4GN4 B;  2BA1 A;  5IE8 A;  4AQY L;  1ASY A;  3HOV G;  1T9H A;  1S40 A;  1YHB A;  1LTL A;  1HNX L;  1YJ9 A;  4GKJ Q;  1HR0 L;  5ELO A;  4NXM Q;  4IO9 A;  4A3G H;  2GVB A;  3A0J A;  2RHQ B;  4A3G G;  4LF7 L;  4L5T A;  4X65 Q;  4R4Q A;  5C0X I;  3PIO A;  1GM5 A;  2JA7 H;  4JI3 L;  3L7Z C;  4QL5 A;  1YNX A;  1VQB A;  4GNX B;  3S1N H;  2UUA L;  1VQ4 A;  4PZ6 A;  1GVP A;  1O7I A;  1RL2 A;  3UDF A;  4JI6 L;  3JC6 6;  4OO1 G;  5K36 G;  2F4V Q;  4JI4 L;  1VQG A;  3T1H L;  4A75 A;  4A76 A;  4LFC Q;  1VQ7 A;  1UE7 A;  4OO1 I;  1K3R A;  4DKA C;  1IBL L;  1WFQ A;  3D31 A;  3UE0 A;  2JA8 H;  1M1K C;  1D8L A;  4APV A;  1LYL A;  2JA8 G;  3G48 A;  5GRO A;  4AIM A;  1E1T A;  3KDF B;  2QEX A;  3CAM A;  4IJL A;  2JA9 A;  1KRS A;  1PV4 A;  2BA0 A;  4P75 A;  3J81 i;  2E2I H;  4B3M L;  4JBM A;  1UE5 A;  1I50 H;  1VQD A;  3KYH C;  2IHE A;  3K81 C;  4BY7 G;  1Q46 A;  4DV1 Q;  1C7Y A;  4LF9 L;  1L2F A;  3I2Z A;  5C4X H;  4B3R Q;  1IBM L;  4DV6 L;  1X65 A;  4DR5 Q;  1J6Q A;  4BA2 I;  2JA5 H;  1NMF A;  5GAG C;  1MJE A;  2B63 H;  3RLN A;  1YHQ A;  2JA5 G;  2B63 G;  1VQ5 A;  2UUB Q;  4LF6 L;  2I5H A;  1JJC B;  2R7F A;  3RZD H;  4JI1 Q;  4UP7 A;  3J81 j;  4B3T Q;  4LF8 Q;  1SLJ A;  4KLK A;  2NN6 G;  2QGQ A;  3ER0 A;  1KIX A;  4DV5 Q;  4JI0 Q;  2OQ0 A;  2JE6 I;  1VQF A;  4JI8 Q;  3S24 A;  3BZK A;  2NN6 I;  1E1O A;  1NE3 A;  4OXP A;  1MIU A;  3CMA A;  4IPC A;  2E2J H;  4OWW B;  5M5Y H;  3G6E A;  1OXU A;  3CCQ A;  3JAM c;  2Z0S A;  3CCM A;  4YHH Q;  2JJQ A;  3J81 c;  5C3E H;  3DM3 A;  1VQO A;  4KHP Q;  3U4Z A;  3I7F A;  1ASZ A;  3HOU H;  2V1C C;  4GKK Q;  1WOC A;  3HOU G;  3NEM A;  3GTL H;  1IBK Q;  2R93 H;  2HHH L;  4DV0 Q;  2K52 A;  4LFB L;  2ZTD A;  2R93 G;  2VQF L;  4DR3 Q;  2UU9 L;  2ZJQ A;  3M7N A;  4YCV A;  1XPU A;  4HIK A;  4IFD J;  3I4M H;  4X6A H;  1AE3 A;  3KFU A;  3I4M G;  1UWV A;  1GO3 E;  1TWF H;  4R4O A;  4TQU S;  2VNU D;  1K73 C;  3PO2 G;  3ZJY C;  2PNH A;  3PUY A;  4DR6 Q;  4GS3 A;  2XGT A;  1L1O C;  1AH9 A;  2PQA A;  2D0P A;  1YJW A;  1Y1V G;  1FJG L;  1AE2 A;  1HNZ Q;  4DK6 C;  4GN5 A;  1CKM A;  1E22 A;  1V1Q A;  1X3E A;  2D0O A;  2IHF A;  3PCO B;  5GQO A;  4LUZ A;  4LF4 Q;  1VQH A;  2IX0 A;  2QA4 A;  2YTY A;  4DV2 L;  1VQL A;  2MO0 A;  2AHO B;  2OTJ A;  1JT8 A;  2K14 A;  1VQP A;  3F2D A;  4LFA L;  1N36 L;  1PH3 A;  4A3D H;  2B29 A;  2GVA A;  1XMO L;  4A3D G;  1KRT A;  1EQQ A;  4JI7 Q;  2ES2 A;  4DR1 Q;  1HZA A;  2Y0S E;  3K80 C;  4B3S L;  4LF5 L;  4JC0 A;  5E7N A;  2EXD A;  5IT9 c;  3CME A;  5IYB H;  1Q86 C;  3GTG H;  4HID A;  4GOP C;  5IYB G;  3OTO L;  4JG2 A;  2UXD L;  4XTC S;  1YZ6 A;  2Q2H A;  1QZG A;  1GKH A;  4A3J H;  2CFM A;  4A3J G;  3HKZ E;  3F1Z A;  1EOV A;  1PH6 A;  1VQE A;  3F2C A;  2HHH Q;  1VQN A;  2ID0 A;  2ZM6 Q;  4OX9 Q;  4BXX H;  2OQK A;  1PH5 A;  2VUM G;  4BXX G;  2RHS B;  3M9B A;  4IPD A;  3NEL A;  4JBW A;  4R4T A;  4BBR H;  1XPR A;  3GTP H;  4AH6 A;  4PZ8 A;  4BBR G;  5C44 H;  5AJ3 Q;  3TEH B;  5C44 G;  4DUY Q;  3BU2 A;  3ICE A;  4A3L H;  1WJJ A;  4P72 A;  2Z6K C;  2OCE A;  4A3M H;  3WWV A;  2CCZ A;  3FP9 A;  4A3L G;  1N32 L;  5LMN L;  4QJF A;  1NMG A;  3W1G A;  1OXT A;  2IT1 A;  4A3M G;  5LMU Q;  1XTD A;  4X64 Q;  2LXK A;  1A8V A;  2R92 H;  1I3Q H;  3GD7 A;  3S14 H;  5FLM H;  2E8G A;  2JQO A;  2A1A A;  2R92 G;  4JV5 Q;  2IY5 B;  4LWC A;  5FLM G;  1XNR L;  2K50 A;  2OWO A;  2FXQ A;  1TWC H;  2KBN A;  5JEA G;  4JI5 L;  3K0X A;  3U50 C;  5C0X G;  1EUJ A;  4C3J H;  5FJ8 H;  5FJ8 G;  3PF4 A;  3CC4 A;  3LGJ A;  5ELN A;  3ERS X;  2MQH A;  2EQS A;  2E2H H;  2KEN A;  4DV3 L;  1Q8K A;  1Z9F A;  3PGZ A;  1Y1W H;  4UPA A;  1Y1W G;  4JBK A;  1VQI A;  3MEF A;  3PO3 H;  4DV4 L;  4DK3 C;  4DNI A;  3TS2 A;  1I5F A;  4YWL A;  1SN8 A;  1PA6 A;  1VQC A;  1YBY A;  2WB1 G;  1TWA H;  2I5L X;  1R9T H;  3PO3 G;  4X62 Q;  4IFD I;  4FDB A;  4L5Q A;  2K75 A;  3TS0 A;  1I94 Q;  2R7D A;  3ULJ A;  5BR8 L;  4GOP A;  3E9H A;  2AMC B;  1OXS C;  1IXR A;  1E24 A;  2PI2 E;  3KJP A;  3PSI A;  5IWA Q;  4QQB X;  4A3F H;  1YEZ A;  4NXN L;  4A3F G;  3S16 H;  1N33 Q;  3HFZ B;  2VQE Q;  2YTX A;  4LW1 A;  1J5E Q;  3IRB A;  4LNQ A;  2XTI A;  4BY7 H;  1N34 L;  1HNW Q;  2UXB L;  3KF8 B;  1EIF A;  4C3I H;  4DR4 Q;  3OW2 A;  3STB C;  1E3P A;  1YJN A;  4LUO A;  2Y0S G;  2Z6K A;  5HGQ A;  1PH8 A;  3S15 H;  4AQY Q;  1U5K A;  4YY3 L;  1PH2 A;  3J80 i;  2VY3 A;  3J7Z C;  3EBE A;  1BBU A;  1VQ8 A;  1HNX Q;  1DGS A;  1CUK A;  4JI2 L;  3S1Q H;  4BA1 I;  4PG3 A;  1NJI C;  4QIW E;  5HY6 A;  4X66 L;  3PUV A;  1C9O A;  1HR0 Q;  2E5L L;  2YU9 H;  3HOZ H;  3S1M H;  4JYA L;  1Q7Y C;  3RLF A;  3HOZ G;  1U0L A;  2JEA I;  1M90 C;  2KCT A;  4LF7 Q;  3TRE A;  4C3H H;  1K0R A;  3Q8D A;  4HIO A;  4A3I G;  3S2D H;  4JI3 Q;  3HKZ G;  1SRU A;  1V9P A;  2LXJ A;  2YYZ A;  4XIG S;  3TQY A;  1VQM A;  1XMQ L;  2KHI A;  2CWA A;  2UUA Q;  5H1S E;  3S1R H;  5IP9 G;  3GTO H;  1W3S A;  3KF6 A;  1KQS A;  4DV7 L;  4JI6 Q;  2K5N A;  3CCU A;  4H02 A;  2AWN A;  1KHI A;  3MXN B;  4DAY B;  4JI4 Q;  3T1H Q;  5IY0 A;  1VQ9 A;  2UUC L;  4GOP B;  4WJ4 A;  3AYH B;  4OON A;  1IBL Q;  1Q81 C;  4A3B H;  1XNQ L;  2KCM A;  4A3B G;  4JCV E;  3PIP A;  2DUD A;  3PUX A;  1X6O A;  3J80 c;  4B3M Q;  3ULP A;  2WB1 E;  4PMW A;  3T1Y L;  3PO2 H;  3CC7 A;  1WCM H;  4POF A;  5M3M G;  1WCM G;  3CPW A;  1WYD A;  1KAW A;  3I4O A;  5GAH C;  3CCJ A;  1JJ2 A;  1Y1V H;  3CC2 A;  2ASB A;  4LF9 Q;  3G4S A;  1QVF A;  1EIY B;  2VZA A;  1IBM Q;  4DV6 Q;  1A0I A;  4DUZ L;  1FVI A;  4J15 A;  4A93 H;  4LF6 Q;  2PI2 A;  3RZO H;  4A93 G;  3SGI A;  2OTL A;  2WP8 J;  1EWI A;  2C35 B;  2YTV A;  3CPF A;  3UDX A;  2N3S A;  2WAQ E;  3PF5 A;  2AWO A;  2UXC L;  1XJV A;  1PH9 A;  1EYG A;  1CKN A;  1WI5 A;  4DR7 L;  1KL9 A;  4IPH A;  3RN5 A;  4WJ3 M;  1BKB A;  5GAE C;  4DR2 L;  4POG A;  3KF6 B;  3M4O H;  2K5V A;  1X9N A;  3I4N G;  4MTN A;  1RIP A;  1KC8 C;  4PZ7 A;  3NEN A;  1IL2 A;  1SE8 A;  2NVQ H;  1D7Q A;  4OWX B;  1QUQ A;  4AYB G;  3CCV A;  3L0O A;  4GKJ L;  4LFB Q;  2F52 A;  2VQF Q;  2UU9 Q;  4NXM L;  1MJC A;  2VUM H;  3A5Z B;  4ALP A;  1P16 A;  4X65 L;  2RF4 A;  3GTM H;  1VQA A;  4LUV A;  3PUW A;  2H5X A;  2Q2T A;  3H3V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...