4LF5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf5Q00
1Y1VH 4DV5Q 4UP8A 2AWOA 3CP0A 3PUVA 2UUBQ 3K80C 1Q12A 2UUCQ 1TWAH 3RN2A 1Y1WH 3W5OA 1L1OA 1UE1A 4P71A 3HKSA 3S15H 3I4NG 3B6YA 1XMQL 3CC7A 4QY7A 4HJAA 2D0OA 4L5QA 1XPUA 2LSSA 1PV4A 2IHFA 4POGA 1QVCA 2VQFQ 3CCEA 4UY8C 4DR7L 1VQDA 2ID0A 2PQAA 2WP8J 2Y0SG 4BA1I 4EQ5A 3F2DA 3E0EA 3CCVA 1EQQA 2E5LL 2UUBL 3S17H 3OYYA 4GN3B 4K0KL 3HOYH 5JJIA 1IBMQ 2NN6I 2GVAA 1Q7YC 4A3MH 3RLOA 4R4OA 1TWGH 5FLMH 3CD6A 3FHWA 1G51A 4DV2Q 2I5HA 3H3VH 3TS2A 4A3CG 4KHPQ 5ELOA 1N33L 3J80i 1VQPA 4GLAC 4LF5L 4R1JA 3D31A 3HOXG 2VQFL 4DV4Q 1VQJA 2CKZB 1E7ZA 3BJUA 3A5UA 2IT1A 4BA2I 1X3EA 4C3IH 5JJLA 1Q1EA 2JQOA 4A3JH 3DM3A 5H1SE 2ZM6L 3KF6B 1H95A 1WYDA 2VUMH 3CPWA 4OWWB 2K14A 5ELNA 4A3GG 2JA7G 4GKKL 4KHPL 3HOVH 4L5SA 1IYJB 1B8AA 4BBRH 1KD1C 1K8GA 4X66Q 2WFWA 2ZTCA 1MJEA 1JJCB 4DNIA 1P8LA 1AH9A 5M5YH 2Q2IA 3CCJA 1HNXQ 4LF7L 3U4VA 1CKMA 2RHQB 4JI3Q 2EQSA 1Q8KA 2N78A 3OW2A 3STBD 2K75A 1FL0A 4YHHQ 3CC4A 4A93H 1VCIA 1D8LA 3CMAA 3I4OA 5C44G 1TWCH 2H5XA 3I4MH 4YY3Q 2E2HH 2OQ0A 2B63G 5C0XI 1BKBA 3CCQA 2ZTDA 1KC8C 1SFOH 2K5HA 3CCUA 4X64L 1RIPA 4IO9A 3U4ZA 4JBWA 4B3MQ 4B3RQ 5M3FH 1KXLA 2PI2E 4B3TQ 3CXCA 4JI4Q 2NZHA 1OXVA 4LUZA 4DR5Q 5C4XG 1TWFH 1E24A 4GOPA 3HKZG 1PH1A 4B3SQ 3H0GH 4GKJQ 2DGYA 4XTCS 4H02A 4DR3Q 3PSIA 4BY1H 1J6QA 2F52A 3A5ZB 5FLXc 2BA1A 4IPDA 4GNXC 4LF6L 1AE3A 2ATWA 3HOWG 1CSQA 4B3TL 1EYGA 4JI0L 3S1QH 4A3FH 3J80c 2EXDA 5HY6A 4A3KG 3GD7A 2LXJA 3I7FA 4JYAQ 1VQHA 4ALPA 2C35B 4DR5L 4A3IG 1VQFA 4Y52H 3F2CA 4APVA 2R92G 3E9HA 3G6EA 2L15A 1B7YB 1L1OB 4PZ8A 4IJHA 4DR3L 1VQ8A 4JBMA 3W1BA 2AHOB 1EWIA 4KI0A 1EOVA 1PH9A 4LFBQ 1QZGA 1K9MC 4DR4L 1YEZA 4J15A 3CPFA 3OTOQ 1XMOQ 2UUAL 4LNQA 4JI2Q 1NY4A 2PQAB 3M9BA 3HOZG 1N36Q 2CCZA 3K0XA 3FP9A 1E3PA 1AE2A 4DR2Q 2PNHA 5GAGC 1YIJA 1PH2A 4GS3A 1PH7A 2ZJQA 4JI5L 3ZJYC 2QA4A 3I55A 3PO3H 1EFWA 1YZ6A 2VZAA 5C3EH 4DV6L 1GO3E 2VQEL 4GLXA 4A3DG 4JV5Q 1QUQA 4DV0Q 1BBUA 4LFCQ 5BR8L 2K5VA 1E1OA 2D0PA 3G71A 1HNWL 2YV5A 1A0IA 1SN8A 4P73A 4DK3C 4DR2L 1JMCA 1XNQQ 4BBSG 4FDBA 2GVBA 5IYCG 4OO1I 3RZDH 3T1HL 3S1RH 2YTXA 3FKIH 2R7ZG 2VNUD 1O7IA 2I0QA 4LFAL 2N8NA 5FJ8H 4DAMA 2Z6KC 5GQOA 3KYHC 2MQHA 2N3SA 2CFMA 5J3BA 4LFCL 5M3MG 3GTJH 4DUZQ 4DV0L 5DLQE 1XNRQ 3LGJA 3ERSX 1IXRA 3HOUG 1L2FA 1Y1VG 4IPCA 3UDIA 1HR0W 3S1MH 1X6OA 1NBWA 2ZTEA 1N34Q 1X3FA 5IWAQ 1PH5A 2R93G 1Y1WG 3GTMH 1Z9FA 1C7YA 1VQ6A 1N9WA 2UXDL 2CQOA 2VS1A 3I56A 4HIDA 4JI8Q 1X9NA 1K8AC 3STBC 1C0AA 5LMUQ 1D7QA 2JA5H 2MNAA 1XPRA 4JI1Q 4DV5L 1I94Q 1R9TH 1KIXA 4BY7G 2ALYB 2YTYA 4DKAC 3CW2C 2IY5B 4UP7A 1EQRA 2UUCL 3HOYG 3MXNB 1B70B 3M85A 1VQIA 5IWAL 5LMNW 2IX1A 3CQZH 4A3MG 4IJLA 2PI2A 4GOPB 3RZOH 2RHSB 3S14H 5FLMG 1IBLQ 1Q46A 3UDGA 1I5FA 3NBHB 1PH6A 5JJKA 1CKOA 4O2DA 1K0RA 3UDFA 1YNXA 3VDYA 2JA6H 3NEMA 1IL2A 4JBJA 1VQBA 2F4VL 3F1ZA 3BZKA 1I50H 1YJWA 4A3JG 1IBML 1TWHH 3U58A 2NVYH 1XTDA 2D62A 4A4IA 1VQKA 2VUMG 2VY3A 3AEVA 4AYBE 4DV2L 2CWPA 1NTGA 3L7ZC 2Q2TA 4HJ5A 2R7DA 1NMFA 3PUZA 3HOVG 1V1QA 3CCRA 4BBRG 4DV4L 1HZBA 2OCEA 2QGQA 4LUVA 1FVIA 1A63A 4JOIC 3M4QA 2DUDA 1WOCA 1J5EQ 3H15A 4JG2A 2YU9H 1VQ5A 2OQKA 2KBNA 1QVGA 3A74A 3I4MG 1IBKQ 3GTQH 4QQBX 1WCMH 4LF4Q 4X66L 4AQYQ 2NN6G 2JA7H 3M7NA 2WAQE 3RLFA 1VQNA 4UP9A 1HNXL 1M1KC 1YVCA 3PUYA 1T9HA 4YCWA 4C2MH 4JI3L 3W1GA 1SRUA 1HNZQ 1QUQB 3GTKH 3RLNA 4YHHL 5M3FG 3TQYA 1HR0Q 4DV7Q 4YY3L 4DR6Q 3MEFA 2EIFA 1IBKL 3PUWA 1LTLA 1L1OC 2JE6I 4X62Q 5C44H 3S1NH 3H0GG 3TS0A 3KJOA 3J7ZC 3PF5A 4PZ6A 4BY1G 4A3EH 2OTJA 4B3ML 1A62A 3UE0A 1HNZL 2E2JH 1C9OA 4B3RL 2Z6KA 1V43A 4TQUS 1GVPA 4DV3Q 3GTPH 1Q82C 4HIMA 5IE8A 1X55A 1PA6A 4A3LH 3NELA 4X65Q 2CWAA 1HR0L 3BU2A 4JI4L 4OX9Q 3PO2H 4DR6L 2B29A 2HQLA 1YITA 1I3QH 3UE1A 1UE7A 1YBYA 4MZ9A 5LMNQ 4HJ8A 1NJIC 4B3SL 4GKJL 4DV1Q 1Q81C 4DPGA 3TEHB 4Y7NH 3PGZA 1GKHA 2K5NA 1PYSB 2F3IA 1KHIA 4DUYQ 3ULLA 2JA8H 3JAMi 1EIYB 1HZCA 3T1YQ 1LUZA 1PFSA 5C0XG 3KOJA 4AH6A 1N8RC 4IFDI 4DAYB 2MFIA 4O0AA 4PMWA 2OWOA 4JYAL 5C0XJ 1YJ9A 5IYBG 4YWLA 4C3JH 3CC2A 3NENA 5LMNL 3CAMA 2A8VA 1FGUA 4NB3A 5E7NA 3CCLA 1A8VA 2HIXA 2YYZA 2Z0SA 3KLWA 4HIKA 2HHHQ 4JI7Q 1LYLA 5M5WH 1RL2A 4MNOA 2R92H 4JC0A 2BH2A 1LM0A 4BXXH 1WJJA 3K81C 3PIOA 4LFBL 2R6GA 4OXPA 3EN2A 5C3EG 3T1YL 3OTOL 1XMOL 1PYBA 4KLKA 4JI2L 4LF9Q 4OONA 3G4SA 3L2PA 4HJ9A 1N36L 1VQCA 1VS0A 4NXNQ 1S40A 3GTGH 1P16A 2K50A 5IP7H 1VQAA 2Q2UA 1OTCA 2GN5A 2RF4A 5GROA 4GN5A 1VQ7A 2JEAI 3UDXA 1U0LA 1VQOA 4GLVB 1VQGA 3CCMA 5AJ3Q 4X6AH 3M4PA 3F2BA 1E1TA 1JB7A 1OXTA 4JV5L 2NZOA 1EIFA 1YHQA 3D0FA 5FJ8G 5IYDH 4NXMQ 5JEAG 5GAHC 1OXXK 1FJGQ 4QL5A 3GTOH 4A3DH 5JEAJ 3KDFA 1XNQL 3A0JA 3RR5A 2UU9Q 1VQMA 3RNUA 4A3BH 4R4QA 5AJ3L 2HT1A 1HH2P 1YHAA 2BH8A 4GOPC 2FXQA 1VQ9A 1KRSA 3F8TA 4BBSH 2AKWB 2NVXH 2F4VQ 2AWNA 5IP9H 4NXML 2JJQA 4A75A 3RN5A 4DUZL 4HJ7A 3G48A 4LUOA 1GM5A 3Q8DA 1X65A 1XNRL 4YCUA 1N32Q 2OTLA 3ICEA 2KHJA 2UU9L 4LF8Q 4RG1A 1M90C 3JAMc 1G6PA 1N34L 2WB1E 4AYBG 4HIOA 3AQQA 2E5LQ 1WI5A 1OXSC 1SE8A 2LXKA 3ULPA 1VQ4A 2MO1A 1PH3A 3ER0A 4K0KQ 4XIGS 3BZCA 2R93H 4JI8L 1DGSA 1V9PA 5LMUL 3I4NH 4JI1L 5C4JH 1CKNA 4A76A 1Q86C 1I94L 1N32L 3AYHB 3SGIA 2JA6G 4OO1G 2UXBQ 3GO5A 1PH8A 1N33Q 4LF5Q 4GNXA 4LF8L 2HIVA 4BY7H 2JK8A 2VW9A 4AIMA 1XJVA 4IPGA 5GAEC 2ZM6Q 2UXCQ 1IBLL 1JT8A 3AFPA 2WAQG 3S16H 1G291 1GD7A 4QGUA 1YI2A 1XPOA 4JCVE 4A3CH 4WJ4A 1BBWA 2I5LX 2UXBL 4QIWE 4GKKQ 4R4CA 3K7UC 2MO0A 1QVFA 1PH4A 2B3GA 3HOXH 2Q2HA 3M3YH 1K73C 1SMXA 1Z47A 1HJPA 4JBKA 1KRTA 5IT9c 4ME3A 4LF7Q 4A93G 3S2DH 2Y0SE 2A1AA 5GADC 2UXCL 2ZJRA 3S24A 2V1CC 4P75A 1WCMG 4A3GH 2I5MX 1ASYA 2NVTH 3PCOB 3PV0A 2ASBA 1I6HH 3E9IA 1KQSA 4IPHA 2R7FA 4KHZA 3KFUA 1J5EL 1K3RA 4PG3A 1UEBA 3GDEA 1SROA 3KF8B 4X64Q 1K83H 1ASZA 3I2ZA 3J81c 4IOAA 2YTVA 3PUXA 4LF4L 2KHIA 4NPSA 4AQYL 1JJ2A 1JJGA 4WJ3M 3DLLA 1KAWA 2ZJPA 1Q1BA 1CUKA 2E2IH 2B63H 3CMEA 1MIUA 4IOCA 4EX5A 4A3EG 1VQLA 1U5KA 1UE6A 4P72A 2QEXA 4P74A 3J7A5 4OWTB 3WWVA 4UPAA 2VL6A 4A3FG 2XTIA 3KDFB 4GN4B 4L5TA 4DV7L 3PO2G 4A3LG 4QJFA 4LF6Q 3EBEA 1YJNA 4X62L 4JI0Q 2KCMA 5C4XH 1E22A 1SLJA 1EUJA 2A19A 2E8GA 3TRZA 1IZ6A 4LWCA 2JA8G 1HZAA 1BVSA 4DV3L 1WFQA 1X3GA 4OWXB 2BA0A 3S2HH 4X65L 3HOWH 4OX9L 2K4KA 4YCVA 4A3KH 4DR4Q 1W2BA 1SR3A 2JEBI 1Y14B 3KF6A 4DV1L 2UUAQ 3CCSA 4POFA 4A3IH 4JI6Q 3PIPA 2JA9A 4DUYL 2NVQH 1PHJA 3PO3G 1CSPA 4BXXG 2IHEA 1L0WA 3HKZE 2PMZE 3GTLH 1UE5A 1CKNB 3M4OH 1UWVA 4JI5Q 3AFQA 4R4TA 4DR1Q 1X54A 4DV6Q 3U50C 1MJCA 2VQEQ 2KENA 4R4IA 4GNXB 1QZHA 1NE3A 2IX0A 4TVAB 4MTNA 5IP7G 2HHHL 4JI7L 3HOZH 5IYBH 5BR8Q 1S72A 3PF4A 4JI6L 2AMCB 1HNWQ 4DK6C 1NMGA 1W3SA 3FKIG 4YWKA 3TREA 3HOUH 5EAYA 3CF5A 2K52A 1OXUA 2RCNA 5K36G 5IYDG 4LF9L 1HZ9A 3K8AA 3L0OA 4C3HH 4DR1L 3T1HQ 3K7AH 4RMFA 4LFAQ 4NXNL 3JC66 2WB1G 5HGQA 1MKHA 4L5RC 4JOIA 3ULJA 3J81j 3H3VI 1X56A 3IRBA 4A3BG 4YWMA 3HFZB 4IFDG 1PVOA 2ES2A 2KCTA 5IY0A 3KJPA 4IFDJ 5IYCH 5M5XH 2XGTA 5IP9G 2R7ZH 1FJGL 1KL9A 3J81i 2JA5G 4PZ7A 1XMQQ 1S3OA 2UXDQ 4LW1A 5M3MH 3EIVA 1JE5A 2N49A 1YHBA 4DR7Q 1TXYA 1VQEA
chains in the Genus database with same CATH superfamily
1Y1VH 4DV5Q 2ZXPA 4UP8A 3CP0A 5E4XA 1MI2A 3RN2A 2TMPA 3HKSA 4R9WA 1MBYA 4C3JB 3S9WA 1XMQL 3RZOB 1Z7TA 4POGA 2VQFQ 4BA1I 2F0VA 4KMUC 3F2DA 4EQ5A 3CCVA 1EQQA 3E0EA 4ZUJA 4K0KL 1CM9A 2PZUA 1Q7YC 4ZUIA 1QCBD 2A68C 1A3VA 3H3VH 3J7AV 4DV2Q 2I5HA 4I7ZC 4GLAC 1CFMA 3VR5A 1E2VA 3D31A 4LF5L 2L5TA 1W6JA 1X3EA 3DXJC 3TSSA 5JJLA 3DM3A 1IYVA 2Z6BA 3KF6B 3QOLA 2KUMA 1GHJA 1WYDA 2K14A 1B1ZA 3GTOB 2JA7G 4L5SA 5C3XA 1LT5D 1GOZA 1MJEA 2ZTCA 4DNIA 4DN4M 5M5YH 3CCJA 1MSHA 1AH9A 4LF7L 3U4VA 4BBSB 2NVXB 2EQSA 3OW2A 4LAAA 1NCVA 2PO4A 1EY0A 1VCIA 1FNUA 5C44G 1HFNA 1TWCH 3I4MH 1SNQA 2OQ0A 2F0DA 3NE5B 2RQXA 4EQNA 3TN2A 1KC8C 4X64L 1RIPA 3U4ZA 3URYA 2WKCA 5M3FH 3A54A 2Z4HA 1PXUA 3L9AX 1BR9A 1NR4A 3BVMA 5A2QE 1F2YA 3KUPA 3EA6A 1E24A 4GOPA 2DY8A 1PH1A 3H0GH 2DGYA 3K6OA 2SNSA 4K2LA 4BY1H 3A5ZB 4IPDA 1PZJD 1B3AA 4YIJA 4WORA 2KECA 2EXDA 5HY6A 2C9OA 4EQOA 5A2QL 4RKBA 3F2CA 3VA7A 3KLSA 3OPOA 4DFAA 4PZ8A 1VQ8A 5EBDA 4I7AA 3TP5A 3S2DB 4KI0A 1EOVA 1PH9A 1JC7A 1YEZA 3OTOQ 3ERQA 3LX0A 4JI2Q 1N36Q 2O5JC 1O80A 1WTXA 4LK1C 1AE2A 2N88A 5GAGC 4DR2Q 1I6HB 1AFPA 5LL6X 5G3LF 1KAAA 1PH7A 3FPPA 5JJZA 3PO3H 5C3EH 4DV6L 3SK8A 2VQEL 1PRTC 2L11A 2K5VA 1HNWL 2YV5A 3DUZA 1PRTF 5COYA 3T1HL 1SJED 2VNUD 1O7IA 4RA8A 3T56B 4KJOA 5FJ8H 2Z6KC 5FLXE 1EY9A 3BVGA 3J7YW 5C4XB 1IXRA 3TMEA 3D8GA 1X6OA 3O13A 5IWAQ 3S2HB 2R93G 3HOWB 2RA4A 3T51B 1BNZA 2K28A 5FLXL 4A3KB 1K8AC 1HCZA 4QF4A 4DAYA 3I70A 1I94Q 3J80L 1R9TH 2IY5B 4UP7A 3FPUB 5J39A 1B70B 3KBXA 5CGKA 3M85A 2KOLA 2NUCA 4A3MG 1UUPA 2K04A 4GOPB 2ICEC 4CKEA 1Q46A 4O2DA 1LT6D 1YNXA 1BXTA 2JA6H 3NEMA 4C3IG 1TS5A 4DK0A 5D14A 1IBML 3ZYYX 1TWHH 3BDLA 4G7ZC 1JOOA 5JPMC 2HCIA 2R7DA 1NMFA 3HOVG 2K01A 2B2YC 4DV4L 1H9JA 1HZBA 2OCEA 2NB0A 2LMCB 1TT2A 3K5MA 4Q0FA 2DUDA 3D4DA 2R7ZB 2LY7A 1GHKA 1STAA 1SYGA 5I2XA 3HOUB 5KNDA 1M1KC 1T9HA 2ICIA 2IL8A 4JI3L 3GTKH 1EOTA 1Y1WB 3TQYA 1PYWD 1II3A 1SNOA 1TS2A 2A74C 1HR0Q 4IZ8A 4YY3L 1IBKL 1XXGA 1SJHD 1L1OC 4X62Q 3S1NH 1Q90A 3J7ZC 4NMZA 3I91A 1A62A 3UE0A 1HNZL 3HOYB 1STYA 2IPKD 1PA6A 4HIMA 2EJMA 4A3LH 1TWGB 3PO2H 2CWAA 4JI4L 1NJIC 4FP5D 1LLRD 4DPGA 1GKHA 1K8MA 2F3IA 2K5NA 4DXFA 1HZCA 2CHBD 1EIYB 1LUZA 4AH6A 4PQXA 4CJ2C 4DAYB 4O0AA 4JYAL 5C0XJ 1STGA 3CC2A 2A8VA 1FGUA 4BBRB 3CCLA 2HHHQ 5M5WH 1RL2A 2R92H 3ITPA 3K81C 4LFBL 4OXPA 3EN2A 1WTVA 1D1IA 3T1YL 2SOBA 1PYBA 4KLKA 4A93B 5D3IB 1L0YB 1P16A 2LS01 5IP7H 2JEAI 2F0LA 1OTCA 4IQZA 1VQ7A 1VQGA 3OIPA 3F2BA 1E1TA 4UHVA 1TQOA 2NZOA 1YHQA 3A8IE 2EVBA 2A6ED 4IUNA 1OXXK 1FJGQ 1SYEA 1VDZA 4A3DH 5JEAJ 1WD0A 3A0JA 1AW7A 2EJFC 2KVMA 1G2SA 1VQMA 2ENBA 4A3BH 1XX8A 2BH8A 2FINB 4OL7A 4ZLTF 4NXML 1V8QA 4HJ7A 3S1QB 4LUOA 5FK9C 1XNRL 2SDFA 4RG1A 3BG3A 1QJOA 5FKAC 4U68A 4HIOA 1ICWA 2EY2A 4K0KQ 2MO1A 2NZ1D 1Q86C 4LF5Q 4HSPA 2VW9A 1Q3LA 3RMHA 4IPGA 3S16H 4EGVA 3NTIA 1GD7A 2L9HA 1XPOA 1A15A 2I5LX 4QIWE 2I46A 2Q2HA 1U4RA 1GUGA 4KTAA 2M00A 5IT9c 1LT4D 4LF7Q 3E5SA 2OEOA 1HTLD 3I3CA 3GTJB 1PDQA 5J22A 1ASYA 1WD1A 2QF7A 3DWQA 1IW7D 1EQTA 3S1MB 2R7FA 1LT3D 2XRSD 2B2UA 2E76C 1A3UA 3GDEA 3I72A 3SR1A 4X64Q 4HCSA 4X3SA 1YNNC 1K83H 3NTKA 1LACA 1JJ2A 5IODA 1WTPA 1Q1BA 2F0NA 3BDOA 4IOCA 4AYBB 1DCZA 1UE6A 2QEXA 1NNXA 3J7A5 3CQZB 1PFNA 2ZXOA 4GN4B 1BCPC 2KCMA 1G91A 3DEOA 4KK7A 2E8GA 1I50B 3T13A 1BCPF 1SE4A 1GJXA 1I4RA 1WFQA 4DV3L 1ILPA 1ZEQX 1WTHA 5J1ZA 2WAQB 1EY7A 4C3JG 3D3RA 4POFA 4JI6Q 4DUYL 2JA9A 3OWEB 1PHJA 3PO3G 1VMCA 2IHEA 3HKZE 1UE5A 2YU9B 4DV6Q 2VQEQ 3GTQB 1WCMB 1QE6A 1NE3A 2IX0A 4MTNA 4DNTB 4WRDA 4K5WA 1HNWQ 4DK6C 5LHY1 1ICFB 4YWKA 3CF5A 2K52A 2RCNA 4LF9L 3L0OA 4ABNA 3T1HQ 2HUGA 3FDTA 4RMFA 3JC66 1TY2A 1MKHA 2NTSA 3ULJA 2WKDA 3D6CA 1X56A 1ESFA 4YWMA 1TS3A 4A3EB 3WOFA 2KCTA 5DM63 2E2JB 5KYLA 4IFDJ 2G9HD 2H4OA 5M5XH 1BO0A 3A8KE 5TSSA 2V4DA 3VA5A 4XXEA 1S3OA 4LW1A 5JEAH 2N49A 3HG9A 1MHWC 3FEWX 4Y7NB 1VQEA 1B9MA 1OO9B 2AWOA 4C56C 1K8OA 2JA8B 2UUBQ 3K80C 1FNVA 3W5OA 4RKLA 1UE1A 3S15H 4HJAA 4QY7A 2D0OA 1QNKA 1XPUA 2D9UA 1PV4A 4UY8C 4CDFC 2CH4A 1ILQA 1VMPA 3S17H 4GN3B 1L0XB 5JJIA 3MXUA 4IALA 1IBMQ 2GVAA 4A3MH 2AUKA 3RLOA 1LO5D 2L55A 1G51A 4KHPQ 3J80i 1VQPA 4R1JA 1U9RA 3BJUA 4DV4Q 1BDOA 2RKSA 4C3IH 1Q1EA 3RD4A 2JQOA 4FXKC 3R93A 1XWEA 4GKKL 4EQPA 2EY1A 3HOVH 1IYUA 1KD1C 3H3VC 5I6YA 4IUVA 3Q6SA 1U4PA 4KN4C 1JWSD 4JI3Q 2N78A 1FL0A 4K8IA 2XVSA 1D8LA 3CMAA 1I4QA 3I4OA 1CI3M 2KCNA 4YY3Q 1YNJD 5C0XI 4KY5A 4GZYC 4PMCA 2ZTDA 2F0FA 2F0QA 4JBWA 1KXLA 2PI2E 1EEID 4DNRB 1EYDA 4B3TQ 1DYQA 3I4NB 5C4JB 4JI4Q 2NZHA 2K32A 4LUZA 5C4XG 1TWFH 3Q22A 3EFXD 3NBHA 4BY7B 5IGDA 3PSIA 2EY5A 3IKJA 3HOWG 4GNXC 5D65A 4FO2A 3DWAA 5KYIA 1EYGA 4JI0L 4A3FH 4A3KG 3I7FA 4JYAQ 4DR5L 2C35B 1VQFA 5BN4A 1Z6HA 2R92G 3QIAA 4DR3L 4JBMA 3W1BA 4OGQC 4LFBQ 5C4HA 1ZYRD 4KD4A 3K5NA 4DR4L 2RBMA 2NVTB 3FP9A 2MGSA 2XWJB 3AU7A 3ZJYC 2QA4A 2VZAA 4GLXA 4A3DG 1ENCA 3AB9A 1RD9D 4F87A 5BR8L 4O1NA 5IGFA 5IGGA 3G71A 2J4XA 4CJ1B 4DK3C 4HCEA 3I4LA 1MSGA 1E2ZA 4OO1I 3RZDH 2YTXA 2R7ZG 1FD7D 4DAMA 2N3SA 4DV0L 4LFCL 1I4PA 1GXDC 1XNRQ 4OHJA 3ERSX 3HOUG 4B08A 3P75A 1NBWA 3NXWA 1Y1WG 3GTMH 2NYZD 1Z9FA 1C7YA 1VQ6A 1N9WA 1RTNA 5EPLA 3D4WA 3STBC 2JA5H 2MNAA 1XPRA 4A3IB 2EPBA 2YTYA 3R3OA 2RDHA 1PTOB 3WOEA 3GTLB 5CV8A 3HOYG 2HDLA 1DOMA 3M4OB 1HA6A 1X3QA 4IJLA 2RHSB 1MGSA 1RDPD 4FXGC 2PCFB 3NBHB 1PH6A 1CKOA 2IW3A 2M2LA 4JBJA 3BZKA 1YJWA 2KEEA 2EYHA 2Z4IA 3BVZA 2NVYH 1Y8OB 5KNCA 4C3HB 3NPPA 3H91A 3AEVA 3L7ZC 4HJ5A 3T4AC 4ZRZA 3PUZA 4N8FA 4J6HA 1V1QA 4G4KA 4BBRG 2JN4A 2RSNA 3VYTA 2OT2A 2F0WA 2SNMA 3M4QA 5CV4A 1IKLA 1EY5A 2Z1CA 1ESRA 1VQ5A 2OQKA 1UEAB 1QVGA 5M3MB 4QQBX 1HRJA 3GV6A 3RLFA 2MPMA 1VQNA 1HNXL 1RCVD 1DM0B 1RODA 2DNEA 4YCWA 4C2MH 2F0GA 5CYUA 1TWAB 1CQFA 1H9MA 4HSVA 4YHHL 4WJWA 1FYCA 1RJTA 4KJNA 4R8IA 4DR6Q 5BN5A 1JORA 3TS0A 3KJOA 3PF5A 4PZ6A 1LTTD 2H1EA 1EU4A 1C9OA 4B3RL 1PZKD 2Z6KA 3GTPH 2O4XA 3MC0B 4DV3Q 2F3WA 1YITA 5T1IA 1I3QH 4HJ8A 1UE7A 1YBYA 5LMNQ 4B3SL 2X6GA 4GKJL 3TEHB 4DUYQ 1KHIA 4A3JB 2IX3A 1H9SA 5C0XG 2VUMB 1SYBA 4IFDI 2LKVA 4G7OC 4YWLA 4C3JH 2B8FA 4NB3A 4V190 3RZOH 2YYZA 2HIXA 2RDGA 4KKSA 4HIKA 3SEBA 1AN8A 4JC0A 1Y8PB 2CW0D 4ILWA 3MZ5A 1WJJA 2R6GA 4CKBA 4LF9Q 3L2PA 1VQCA 2E2HB 1A2TA 3HEJA 2Q2UA 2RF4A 4KHVA 2F0KA 1SFOB 1U0LA 1MD2D 3CCMA 4CJ0B 4BWGB 5JEAG 2B2YA 1SEBD 3J80E 3GTOH 5HURA 3VYSA 3KDFA 5ISRA 1XNQL 1RKNA 4B9XA 1F9QA 4RH6A 3RR5A 1RF2D 4HTHA 2IJ0A 4R4QA 5AJ3L 4GOPC 1JB3A 2DN8A 2FXQA 5M9OA 1KRSA 3F8TA 1WVLA 4BBSH 2AKWB 2NVXH 4IUUA 4DUZL 1J8IA 2Q8RE 4YCUA 1Y69U 2KEDA 2OTLA 1PRTB 2KHJA 4ME5A 2UU9L 4LF8Q 1B50A 2WB1E 4AYBG 3WDNA 5DM73 2LXKA 1EZ8A 3AMUA 1JOKA 4XIGS 4JI8L 1AEXA 1DGSA 2B8GA 5LMUL 2K05A 4CDDC 4JI1L 1N32L 4OO1G 4JW0A 3GO5A 1CTMA 1LABA 1F9RA 3OW7A 4PMBA 2VXWA 1TIID 2NTTA 3OMGA 1EIGA 4AIMA 4IUTA 3C3LA 3VYRA 2XN9C 1PTOD 1IBLL 1TU2B 1F77A 2UXCQ 1NR2A 2WAQG 5IGBA 1G291 1YI2A 4QGUA 4JCVE 2UXBL 4GKKQ 3K7UC 2J7ZA 1H9SB 1SMXA 1Z47A 1HJPA 3HP3A 5CBAE 3S1RB 1I4HA 3FKIB 2FJ2A 1FGBD 3S2DH 2PNRC 2A1AA 5GADC 2ZJRA 1HA5A 1BOSA 1WCMG 3VR3A 3U9SA 4RFBA 2EYOA 4L6TB 2ASBA 1U4LA 2DNCA 4V0BA 1KQSA 1I6HH 4KV6A 1K3RA 4A3BB 4F88A 1EY6A 1UEBA 3JAME 1F2LA 4QB4A 2P5ZX 1ASZA 2I07B 3MVVA 4LF4L 4AQYL 1JJGA 1HUMA 3DMUA 2B2VC 3DLLA 4DAPA 1JR0D 3CMEA 5DNFA 3CRKC 4EX5A 2A73B 4A3EG 2BCOA 3P1HA 1U5KA 3SDZA 4P72A 2R61A 3JAML 2A68D 1O7YA 2VL6A 4A3FG 3KDFB 4L5TA 3S14B 2A6HC 4QJFA 4ODGA 1STHA 3TP6A 4JI0Q 5EQ0A 5DAUA 1HQRD 5C4XH 2EYLA 1EUJA 2A19A 1AZQA 1IZ6A 5KGUA 1ZKOA 3K0YA 2JA8G 2EYFA 2BA0A 3S2HH 4X65L 3HOWH 2K4KA 3NK9A 4YCVA 4A3KH 4DR4Q 5LL6S 2JEBI 1Y14B 4DV1L 4RWSC 1PMRA 2NVQH 3J7AF 5CMDA 4BXXG 3K59A 3AFQA 5FO7B 4FF3A 3LWUA 2AUJD 1QZHA 4JI7L 4XDXA 3NWSA 1O7LA 2JA7B 5BR8Q 1NMGA 1W3SA 3TREA 1OXUA 4K5XA 3NWTA 1K3BC 3K8AA 4DR1L 4NXNL 2FFKB 3EJIA 2F0IA 1SNMA 5HGQA 1BBXC 3NUCA 5C44B 1GUNA 4JOIA 1G8ZD 3J81j 1PVOA 4IFDG 5EBCA 4H13C 5IY0A 1EEFD 3M4YA 2R7ZH 3E6ZX 1KL9A 1O7ZA 4KY6A 2JA5G 4PZ7A 1XMQQ 1SSOA 1HHVA 2Z8LA 1JE5A 1YHBA 2K6AA 4PG3A 3DEPA 4FF4A 1SNCA 5BN3A 3HOUH 1NUCA 2WV6D 4JPBW 3OOCA 2R3ZA 1Y1WH 2XIWA 3KLRA 3I4NG 3B6YA 3GP7A 3CC7A 4OIKA 3P7JA 2LSSA 2IHFA 5C6AA 3CCEA 4DR7L 4CDEC 1VQDA 2ID0A 2PQAA 2Y0SG 2E5LL 1J9OA 1SMYD 1SAPA 3TP7A 3HOYH 1DXMA 2NN6I 4R4OA 1TWGH 1K0SA 3TS2A 3GTGB 5KNBA 2DJFC 4ID6A 2VQFL 1E7ZA 1R4PB 3HS0C 3PMFA 3A5UA 2IT1A 2K5WA 4DAVA 1HTPA 4F7XA 2PPBC 1M4VA 5ELNA 1LTGD 1B8AA 4BBRH 2K1BA 1K8GA 1UNSA 1P8LA 1HNXQ 2Q2IA 2K7VA 1G6ZA 5IOCA 1TKWB 2PW7A 3T16A 2RHQB 2A69C 3SE0A 2B2WC 1Q8KA 3DHQA 4YHHQ 4A93H 2BE5D 2B2TC 4HEDA 3M7GA 4QUCA 1KLUD 3CCQA 1B4OA 1D5MC 3K58A 2K5HA 3VYUA 4DF7A 2QKIC 1BQQT 1BF4A 4B3RQ 4QIWB 2R93B 3CXCA 2F0UA 2CQAA 4ZYSA 4B3SQ 3MA2B 4GKJQ 1CHPD 1SYFA 4XTCS 4H02A 3H6MA 3D4RA 4X3KA 5FLXc 2BA1A 1GUWA 4LF6L 2HCCA 3S1QH 3J80c 2VB2X 2LXJA 5IIFA 4F8MA 1VQHA 4A3IG 4Y52H 2D5DA 4APVA 3HOXB 1EZ6A 3M3YB 4EVOA 3V96A 2L15A 2PYKA 4G7HC 1ENAA 3FVQA 5C0XH 4CKCA 4J15A 3J81E 4A3GB 4LNQA 1NY4A 2PQAB 3K0XA 2WINB 5I9PA 2FMCA 2PNHA 2ZJQA 2KHSA 4JI5L 1EFID 3I55A 1EFWA 4R8NA 1YZ6A 2IWHA 4C3HG 1GO3E 1QB5D 3SK4A 1FNWA 1JWMD 2B2UC 2J0TD 3J81L 1BBUA 1JQYD 5EJWA 4CGYB 2E74C 2ZXRA 2B63B 2E2IB 1E1OA 2D0PA 2SEBD 3MFGA 4TSSA 1JMCA 1A0IA 4DR2L 1XNQQ 1LV9A 1V1OA 4BBSG 1CZGA 4FDBA 5IGCA 2GVBA 1EWCA 2I0QA 4LFAL 2N8NA 1G2TA 2KA7A 3KYHC 3GTJH 4DUZQ 5M3MG 2ZT9C 3ND8A 5DLQE 3LGJA 3HKZB 3K5LA 2EYJA 1DOLA 3UDIA 4ZCKA 1HR0W 3S1MH 4RCOA 2PZTA 2ZTEA 1CQVA 1LTRD 1X3FA 4RHRA 5KEEA 2UXDL 2VS1A 2AQ3B 4JI8Q 1X9NA 4C1NK 1C0AA 5LMUQ 1D7QA 2CH4W 4JI1Q 2F0TA 4IURA 2CVRA 1GUTA 3KLSX 2UUCL 2QW7A 2XSCA 3ONAB 4K5VA 2F0EA 5IWAL 2MHVA 3CQZH 2IX1A 1ET9A 2PI2A 2XNAC 5FLMG 1IBLQ 3UDGA 3HOZB 3H09A 4OO1H 4DA2A 1IL2A 2F4VL 1VQBA 5EGTA 3FMCA 3D6WA 1I50H 5JAVA 5C4ZA 4A3JG 3U58A 1XTDA 2D62A 5I4DA 2VUMG 2VY3A 2AQ2B 3K7AB 2CWPA 1NTGA 3PIO3 3CHBD 1JCKB 3OMCA 4LUVA 1FVIA 1A63A 2TSSA 1WOCA 3H15A 1D2BA 2G9DA 1IL8A 2F1MA 2YU9H 3EROA 3A74A 1IBKQ 3GTQH 2K33A 1WCMH 5ELBA 4LF4Q 4X66L 4AQYQ 2NN6G 3M7NA 1Y1VB 3I90A 1S5CD 1VF7A 1SRUA 3MXPA 4HAEA 1HNZQ 1DOKA 3RLNA 4G57A 2O5IC 2OXPA 2CW0C 2NWGA 5EKIA 3MEFA 1B44D 2EIFA 2BOSA 3SHLA 2JE6I 2G5DA 5F2DA 2JSOA 1PZID 4A3EH 2OTJA 4B3ML 2E2JH 2F0JA 1V43A 3X3MA 4OELB 1X55A 5IE8A 4X65Q 1K28A 1HR0L 1U4MA 2B29A 1O78A 5L37A 4DV1Q 4Y7NH 3PGZA 1F2ZA 2JA8H 3JAMi 3LNNA 4DU9A 1CA5A 5I2YA 4IUQA 1EYAA 3T1YQ 1PFSA 1N8RC 2MFIA 4PMWA 1YJ9A 3NENA 3CAMA 2F0HA 1A8VA 4JI7Q 3KLWA 4MNOA 1SE2A 5M5YB 1UAPA 4BXXH 3PIOA 3OIQA 1XMOL 1D5ZC 4HJ9A 1TWCB 3I4MB 4NXNQ 1VS0A 5E4WC 4KY7A 1VQAA 2GN5A 5GROA 4GN5A 3A7AB 1VQOA 3KBGA 3OHXC 3M4PA 1JB7A 4JV5L 1M8AA 5M3FB 4NXMQ 3TBIB 4KKTA 3SK5A 1KDAA 1KLGD 1PTOC 3H0GB 5CR3A 4IFDH 4BY1B 1EIHA 1HH2P 1YHAA 1VQ9A 2M9VA 4ZKCB 5C5LA 1PTOF 2JJQA 4A75A 3RN5A 3G48A 4RGNA 1EL0A 3ICEA 1JE4A 2WIIB 1G6PA 1N34L 2L4NA 4J1MA 2E5LQ 1WI5A 1OXSC 1SE8A 3A8JE 3ULPA 1JOQA 3BZCA 4M1UB 4HR7B 1V9PA 3I4NH 5C4JH 4A76A 3V2TA 4CDCC 4MHEA 1PH8A 2EE1A 5JPNC 2HIVA 4BY7H 2JK8A 1BUVT 1IKMA 3PO3B 3Q24A 1XJVA 5C3EB 1NAPA 3HZXA 5GAEC 3HRZC 1I4GA 3PIP3 1QG7A 3AFPA 2F0SA 5ELDA 4XQQA 1JT8A 4WJ4A 3NSWA 1S5DD 1QVFA 4H7BA 5JVH3 1PH4A 2B3GA 1T5XD 1F9PA 1GUSA 4JBKA 4ME3A 4A93G 3F2UA 3L3OC 3EVQA 2AQ1B 2V1CC 4P75A 2I5MX 1C48A 2NVTH 5NUCA 4IPHA 2EOTA 4KHZA 1J5EL 3CRLC 1STBA 2F3VA 2PW5A 3MXGA 2B39A 3J81c 4IOAA 3BYYB 4FYDA 1QILA 3PUXA 2MJ8A 2DY7A 3QR8A 1KAWA 1R9TB 1CUKA 3DM1A 1HPCA 2JP1A 3TZUA 1MIUA 3MAQA 1HUNA 1VQLA 1XTCD 5C5MA 3RUZA 5FO8B 2PZWA 2XTIA 4TKOB 4DV7L 1Q8IA 1SYCA 5ELCA 2N55A 4LF6Q 3I8ZA 3EBEA 4L63B 2A6EC 2JA6B 2EXZA 1E22A 3GQBA 1SLJA 4N9PA 2EYMA 3TRZA 4LWCA 5EPKA 3BS1A 1X3GA 1TWHB 1AZPA 1A2UA 4OX9L 5IT9E 4K2KA 1W2BA 1SR3A 4XYOA 3NQIA 1KNAA 3CCSA 4A3IH 3PIPA 5CV7A 1SYDA 1CSPA 1PTOH 2LFNA 3QOJA 5T1GA 2PMZE 3GTLH 1LTBD 3M4OH 4JI5Q 4O42A 5IT9L 3U50C 1MJCA 4R4IA 4DK1A 4TVAB 4RGTA 4L8JA 5IYBH 3C46A 1S72A 3PF4A 4JI6L 1SDFA 4K6DA 3GTKB 1A6XA 5IYDG 3CD6A 3N52A 4C3HH 5K5PA 1SMYC 4LFAQ 4OEMB 3TZDA 3S1NB 3H3VI 1I4XA 2ES2A 2JYOA 3ND9A 3KJPA 1D6EC 3Q0AA 4K8JA 2XGTA 5IP9G 3NBIA 3PO2B 3J81i 5FOBB 2UXDQ 2EZVA 5M3MH 3NQTA 1TR5A 2PMZB 2QDLA 3PUVA 4E6IA 1IW7C 2XWBB 1Q12A 2UUCQ 1TWAH 3CU7A 4HMJA 1L1OA 4P71A 3C2PA 2EJGC 2B2VA 2L12A 4L5QA 1QVCA 4FF2A 5M5WB 1H9RA 2BE5C 2WP8J 2F4VQ 2A5HA 2R92B 2NVQB 2UUBL 3OYYA 5D3DA 4DXGA 5IGEA 4KD3A 4QUFA 1S5ED 1PFMA 2NBFA 5FLMH 1EU3A 3FHWA 2FMMA 4A3CG 1HQMC 5ELOA 1N33L 3IFDA 4IUPA 3HOXG 1IHZA 4K14A 1VQJA 2CKZB 4BA2I 3I73A 4H44C 4A3JH 5H1SE 2ZM6L 1H95A 2VUMH 3NP8A 3CPWA 3E3XA 4OWWB 5FO9B 4A3GG 4A3DB 4KKUA 2WB1B 5EPJA 4KHPL 1IYJB 4X66Q 2WFWA 1SNPA 2X6LA 1JJCB 4S3SA 3SK6A 1CKMA 4NDXA 1DZ1A 1CA6A 3STBD 2K75A 3CC4A 2RDFA 2H5XA 5CC4A 2E2HH 2B63G 1BKBA 5I9OA 2NN6H 3K57A 2EY6A 1SFOH 2K5DA 3CCUA 4NW2A 4IO9A 4B3MQ 4U673 1CHQD 3MXNA 3VR4A 1OXVA 3TP8A 4DR5Q 3C1EA 3HKZG 4RHSA 2RSOA 3DWPA 4DR3Q 5I6WA 1J6QA 2F52A 2ATWA 4H0LC 1AE3A 1JICA 1CSQA 4B3TL 3S16B 1KABA 1WTOA 3GD7A 3X3NA 4ALPA 4Z9CB 5C3WA 3E9HA 5CV5A 1EWHA 3G6EA 1B7YB 1L1OB 3GV3A 3V05A 4IJHA 4LJZC 2AHOB 1EWIA 1QZGA 3IAYA 1DJRD 1K9MC 3CPFA 1XMOQ 2UUAL 3HOZG 3M9BA 3BDCA 2CCZA 1E3PA 5E1FA 4FXDA 1YIJA 1WTRA 1Y8NB 1PH2A 4GS3A 1V1PA 1F2MA 1SXTA 3UI2A 1K83B 1EY8A 4JK1C 5KRUA 3QB3A 4JV5Q 1ENFA 1PLFA 1FR3A 1QUQA 4DV0Q 4LFCQ 2JXMB 4P73A 1SN8A 3OWFA 3K5OA 1S4ZA 5IYCG 3TDQA 3S1RH 3FKIH 4Q5VA 1F9SA 2Q8TA 5K36H 4JVZA 5GQOA 4C1NI 2MQHA 5J3BA 2CFMA 3A7LA 1L2FA 1Y1VG 3KK7A 5DEHA 4IPCA 5G3LD 2B2WA 1N34Q 1D1KA 4M8AA 1TVXA 1PH5A 2B2TA 2CQOA 3I56A 1HXYD 3MTSA 4HIDA 2D2CC 4FF1A 4NP5A 4ZAIA 4QCLA 4DV5L 4BY7G 1KIXA 2ALYB 1YNJC 3CW2C 2L1BA 4DKAC 1PRTD 1EQRA 4RCNA 3MXNB 1VQIA 5LMNW 3S14H 3MHBA 1I5FA 5JJKA 1K0RA 3UDFA 3VDYA 1B2TA 5EKLA 3F1ZA 5EKKA 1ZXTA 3G7LA 4A4IA 1VQKA 4AYBE 2HDMA 4DV2L 2Q2TA 4N8X1 2K03A 3W2DA 3CCRA 1B3QA 3HGBA 1ET6A 2RCFA 5E3FA 1DONA 1ONLA 1EY4A 3VR2A 2QGQA 1AP0A 1E0BA 4JOIC 4KN7C 5M5XB 2MUYA 1J5EQ 1KDCA 1ML0D 4JG2A 2KBNA 3I4MG 2VB3X 1ZYRC 2MP1A 4XQNA 1V1PB 2JA7H 2QCPX 2WAQE 4UP9A 1YVCA 5AFWA 3PUYA 3W1GA 1QUQB 1TY0A 5HGTA 5M3FG 4N9TA 1LTID 3G6JB 4HN7A 3S15B 4DV7Q 1VF5C 1KNEA 1LTLA 3PUWA 4UAIA 5C44H 2FHTA 3H0GG 1LTSD 2PQEA 3S17B 4BY1G 4ZKBB 1KDBA 1QWYA 4MIUA 4TQUS 1GVPA 1Q82C 4A3MB 5JOBA 2DJGC 3NELA 2X69A 1EQVA 3BU2A 1X3PA 3IL8A 4OX9Q 4DR6L 3U9OA 2HQLA 3NHHA 3UE1A 4MZ9A 3CKIB 2HD3A 5JVG3 2BDOA 3BYTB 5ELFA 1Q81C 4C3IB 5CORA 1PYSB 3ULLA 2Q8IB 3PQIA 1XYIA 3KOJA 1JWUD 1I6VC 4UDUC 2OWOA 5IYBG 3HOVB 2F03A 5LMNL 4CBVA 1BCPB 5E7NA 2Z0SA 3H94A 1LYLA 1B53A 3P20A 2BH2A 1LM0A 4J8QA 3SXHA 5C3EG 3OTOL 4JI2L 4X3TA 4OONA 3G4SA 1N36L 2L0CA 3KF8A 1SBBB 1S5BD 1S40A 3GTGH 2BDNA 2K50A 1T5EA 3UDXA 4GLVB 5AJ3Q 2QILA 5KIXA 4X6AH 2A6HD 1OXTA 1GUOA 5A35A 1EIFA 4FNFA 3D0FA 5FJ8G 5IYDH 4RGMA 5GAHC 3FRPB 4QL5A 5ELEA 3OSOA 3LWEA 1TWFB 2UU9Q 3RNUA 3W3AA 4K6LA 1QOHA 1R4QB 2HT1A 3QG1A 4PNYA 4RAUC 2AWNA 5IP9H 1D5XC 1X32A 2WACA 4A3FB 4ZK9B 1GM5A 1N32Q 3Q8DA 1X65A 2EDGA 3MEHA 1M90C 3JAMc 3AQQA 1S5FD 1PH3A 4ULLA 4XT3B 1VQ4A 3ER0A 2F4IA 2R93H 1EYCA 3N6RA 1CKNA 3R2TA 1I94L 3AYHB 2KJXA 2F0PA 4LMQD 3SGIA 2JA6G 2UXBQ 1N33Q 4NKLA 1A3TA 3A56A 4LF8L 4GNXA 2KCCA 1C8CA 4CHTB 4HMIA 2EYPA 2ZM6Q 4P2CB 4WFN3 3EQLC 4A3CH 1BBWA 3MWYW 4XYQA 1TS4A 1WTQA 4R4CA 2MO0A 4DGZA 3HOXH 3M3YH 1K73C 1C4QA 3Q23A 4MTKA 1KRTA 3RZDB 1B9NA 2Y0SE 2UXCL 1H9KA 2QEJC 3S24A 3BZDB 4A3GH 3T53B 3R8BA 3PCOB 3PV0A 2OF1A 4RGOS 2KQ3A 3E9IA 4ZQ3A 3KFUA 5CV6A 1STNA 1SNDA 1DD2A 1CZWA 2QDBA 1SROA 3KF8B 4TRDA 3GTMB 3VR6A 3I2ZA 2F0MA 4B9WA 2YTVA 2KHIA 4NPSA 2JA5B 1PFBA 4WJ3M 2K5QA 2E2IH 2ZJPA 2B63H 3IFTA 1CK1A 2C5CA 4I65A 4P74A 1RTOA 4OWTB 3WWVA 4UPAA 3SVMA 4A3LG 3PO2G 2Z9HA 1W6KA 1YJNA 2RVLA 3QWNA 4X62L 3E0JA 4PV1C 2HQEA 2E75C 3C1FA 5CV9A 1HZAA 1BVSA 2Y0SB 3QO2A 4OWXB 2NVYB 2O2LD 4FVMA 1STEA 4OIJA 4MN3A 3KF6A 2UUAQ 4QMGA 1E2WA 2XRQD 4X3UA 1YNND 3A55A 1SE3A 2A69D 4IN3A 1KTKA 1L0WA 1CKNB 4XT1B 1UWVA 4R4TA 4DR1Q 1X54A 1LTAD 4XQJA 2KENA 4GNXB 2F0OA 5IP7G 2HHHL 3HOZH 1CT1D 4BS9A 2GA4B 2AMCB 1HFGA 4C2MB 3FKIG 1BCPD 1QNUA 5EAYA 3MFYA 5K36G 1HZ9A 3K7AH 3QJYA 1WTWA 3NTHA 2WB1G 4L5RC 3IRBA 4A3BG 3HFZB 2E2DC 3GTPB 5IYCH 1FJGL 5CBEE 1I3QB 3EIVA 1NSNS 1RHPA 4DR7Q 3R2IA 1TXYA
chains in the Genus database with same CATH topology
1Y1VH 4DV5Q 4UP8A 2AWOA 3CP0A 3PUVA 2UUBQ 3K80C 1Q12A 2UUCQ 1TWAH 3RN2A 1Y1WH 3W5OA 1L1OA 1UE1A 4P71A 3HKSA 3S15H 3I4NG 3B6YA 1XMQL 3CC7A 4QY7A 4HJAA 2D0OA 4L5QA 1XPUA 2LSSA 1PV4A 2IHFA 4POGA 1QVCA 2VQFQ 3CCEA 4UY8C 4DR7L 1VQDA 2ID0A 2PQAA 2WP8J 2Y0SG 4BA1I 4EQ5A 3F2DA 3E0EA 3CCVA 1EQQA 2E5LL 2UUBL 3S17H 3OYYA 4GN3B 4K0KL 3HOYH 5JJIA 1IBMQ 2NN6I 2GVAA 1Q7YC 4A3MH 3RLOA 4R4OA 1TWGH 5FLMH 3CD6A 3FHWA 1G51A 4DV2Q 2I5HA 3H3VH 3TS2A 4A3CG 4KHPQ 5ELOA 1N33L 3J80i 1VQPA 4GLAC 4LF5L 4R1JA 3D31A 3HOXG 2VQFL 4DV4Q 1VQJA 2CKZB 1E7ZA 3BJUA 3A5UA 2IT1A 4BA2I 1X3EA 4C3IH 5JJLA 1Q1EA 2JQOA 4A3JH 3DM3A 5H1SE 2ZM6L 3KF6B 1H95A 1WYDA 2VUMH 3CPWA 4OWWB 2K14A 5ELNA 4A3GG 2JA7G 4GKKL 4KHPL 3HOVH 4L5SA 1IYJB 1B8AA 4BBRH 1KD1C 1K8GA 4X66Q 2WFWA 2ZTCA 1MJEA 1JJCB 4DNIA 1P8LA 1AH9A 5M5YH 2Q2IA 3CCJA 1HNXQ 4LF7L 3U4VA 1CKMA 2RHQB 4JI3Q 2EQSA 1Q8KA 2N78A 3OW2A 3STBD 2K75A 1FL0A 4YHHQ 3CC4A 4A93H 1VCIA 1D8LA 3CMAA 3I4OA 5C44G 1TWCH 2H5XA 3I4MH 4YY3Q 2E2HH 2OQ0A 2B63G 5C0XI 1BKBA 3CCQA 2ZTDA 1KC8C 1SFOH 2K5HA 3CCUA 4X64L 1RIPA 4IO9A 3U4ZA 4JBWA 4B3MQ 4B3RQ 5M3FH 1KXLA 2PI2E 4B3TQ 3CXCA 4JI4Q 2NZHA 1OXVA 4LUZA 4DR5Q 5C4XG 1TWFH 1E24A 4GOPA 3HKZG 1PH1A 4B3SQ 3H0GH 4GKJQ 2DGYA 4XTCS 4H02A 4DR3Q 3PSIA 4BY1H 1J6QA 2F52A 3A5ZB 5FLXc 2BA1A 4IPDA 4GNXC 4LF6L 1AE3A 2ATWA 3HOWG 1CSQA 4B3TL 1EYGA 4JI0L 3S1QH 4A3FH 3J80c 2EXDA 5HY6A 4A3KG 3GD7A 2LXJA 3I7FA 4JYAQ 1VQHA 4ALPA 2C35B 4DR5L 4A3IG 1VQFA 4Y52H 3F2CA 4APVA 2R92G 3E9HA 3G6EA 2L15A 1B7YB 1L1OB 4PZ8A 4IJHA 4DR3L 1VQ8A 4JBMA 3W1BA 2AHOB 1EWIA 4KI0A 1EOVA 1PH9A 4LFBQ 1QZGA 1K9MC 4DR4L 1YEZA 4J15A 3CPFA 3OTOQ 1XMOQ 2UUAL 4LNQA 4JI2Q 1NY4A 2PQAB 3M9BA 3HOZG 1N36Q 2CCZA 3K0XA 3FP9A 1E3PA 1AE2A 4DR2Q 2PNHA 5GAGC 1YIJA 1PH2A 4GS3A 1PH7A 2ZJQA 4JI5L 3ZJYC 2QA4A 3I55A 3PO3H 1EFWA 1YZ6A 2VZAA 5C3EH 4DV6L 1GO3E 2VQEL 4GLXA 4A3DG 4JV5Q 1QUQA 4DV0Q 1BBUA 4LFCQ 5BR8L 2K5VA 1E1OA 2D0PA 3G71A 1HNWL 2YV5A 1A0IA 1SN8A 4P73A 4DK3C 4DR2L 1JMCA 1XNQQ 4BBSG 4FDBA 2GVBA 5IYCG 4OO1I 3RZDH 3T1HL 3S1RH 2YTXA 3FKIH 2R7ZG 2VNUD 1O7IA 2I0QA 4LFAL 2N8NA 5FJ8H 4DAMA 2Z6KC 5GQOA 3KYHC 2MQHA 2N3SA 2CFMA 5J3BA 4LFCL 5M3MG 3GTJH 4DUZQ 4DV0L 5DLQE 1XNRQ 3LGJA 3ERSX 1IXRA 3HOUG 1L2FA 1Y1VG 4IPCA 3UDIA 1HR0W 3S1MH 1X6OA 1NBWA 2ZTEA 1N34Q 1X3FA 5IWAQ 1PH5A 2R93G 1Y1WG 3GTMH 1Z9FA 1C7YA 1VQ6A 1N9WA 2UXDL 2CQOA 2VS1A 3I56A 4HIDA 4JI8Q 1X9NA 1K8AC 3STBC 1C0AA 5LMUQ 1D7QA 2JA5H 2MNAA 1XPRA 4JI1Q 4DV5L 1I94Q 1R9TH 1KIXA 4BY7G 2ALYB 2YTYA 4DKAC 3CW2C 2IY5B 4UP7A 1EQRA 2UUCL 3HOYG 3MXNB 1B70B 3M85A 1VQIA 5IWAL 5LMNW 2IX1A 3CQZH 4A3MG 4IJLA 2PI2A 4GOPB 3RZOH 2RHSB 3S14H 5FLMG 1IBLQ 1Q46A 3UDGA 1I5FA 3NBHB 1PH6A 5JJKA 1CKOA 4O2DA 1K0RA 3UDFA 1YNXA 3VDYA 2JA6H 3NEMA 1IL2A 4JBJA 1VQBA 2F4VL 3F1ZA 3BZKA 1I50H 1YJWA 4A3JG 1IBML 1TWHH 3U58A 2NVYH 1XTDA 2D62A 4A4IA 1VQKA 2VUMG 2VY3A 3AEVA 4AYBE 4DV2L 2CWPA 1NTGA 3L7ZC 2Q2TA 4HJ5A 2R7DA 1NMFA 3PUZA 3HOVG 1V1QA 3CCRA 4BBRG 4DV4L 1HZBA 2OCEA 2QGQA 4LUVA 1FVIA 1A63A 4JOIC 3M4QA 2DUDA 1WOCA 1J5EQ 3H15A 4JG2A 2YU9H 1VQ5A 2OQKA 2KBNA 1QVGA 3A74A 3I4MG 1IBKQ 3GTQH 4QQBX 1WCMH 4LF4Q 4X66L 4AQYQ 2NN6G 2JA7H 3M7NA 2WAQE 3RLFA 1VQNA 4UP9A 1HNXL 1M1KC 1YVCA 3PUYA 1T9HA 4YCWA 4C2MH 4JI3L 3W1GA 1SRUA 1HNZQ 1QUQB 3GTKH 3RLNA 4YHHL 5M3FG 3TQYA 1HR0Q 4DV7Q 4YY3L 4DR6Q 3MEFA 2EIFA 1IBKL 3PUWA 1LTLA 1L1OC 2JE6I 4X62Q 5C44H 3S1NH 3H0GG 3TS0A 3KJOA 3J7ZC 3PF5A 4PZ6A 4BY1G 4A3EH 2OTJA 4B3ML 1A62A 3UE0A 1HNZL 2E2JH 1C9OA 4B3RL 2Z6KA 1V43A 4TQUS 1GVPA 4DV3Q 3GTPH 1Q82C 4HIMA 5IE8A 1X55A 1PA6A 4A3LH 3NELA 4X65Q 2CWAA 1HR0L 3BU2A 4JI4L 4OX9Q 3PO2H 4DR6L 2B29A 2HQLA 1YITA 1I3QH 3UE1A 1UE7A 1YBYA 4MZ9A 5LMNQ 4HJ8A 1NJIC 4B3SL 4GKJL 4DV1Q 1Q81C 4DPGA 3TEHB 4Y7NH 3PGZA 1GKHA 2K5NA 1PYSB 2F3IA 1KHIA 4DUYQ 3ULLA 2JA8H 3JAMi 1EIYB 1HZCA 3T1YQ 1LUZA 1PFSA 5C0XG 3KOJA 4AH6A 1N8RC 4IFDI 4DAYB 2MFIA 4O0AA 4PMWA 2OWOA 4JYAL 5C0XJ 1YJ9A 5IYBG 4YWLA 4C3JH 3CC2A 3NENA 5LMNL 3CAMA 2A8VA 1FGUA 4NB3A 5E7NA 3CCLA 1A8VA 2HIXA 2YYZA 2Z0SA 3KLWA 4HIKA 2HHHQ 4JI7Q 1LYLA 5M5WH 1RL2A 4MNOA 2R92H 4JC0A 2BH2A 1LM0A 4BXXH 1WJJA 3K81C 3PIOA 4LFBL 2R6GA 4OXPA 3EN2A 5C3EG 3T1YL 3OTOL 1XMOL 1PYBA 4KLKA 4JI2L 4LF9Q 4OONA 3G4SA 3L2PA 4HJ9A 1N36L 1VQCA 1VS0A 4NXNQ 1S40A 3GTGH 1P16A 2K50A 5IP7H 1VQAA 2Q2UA 1OTCA 2GN5A 2RF4A 5GROA 4GN5A 1VQ7A 2JEAI 3UDXA 1U0LA 1VQOA 4GLVB 1VQGA 3CCMA 5AJ3Q 4X6AH 3M4PA 3F2BA 1E1TA 1JB7A 1OXTA 4JV5L 2NZOA 1EIFA 1YHQA 3D0FA 5FJ8G 5IYDH 4NXMQ 5JEAG 5GAHC 1OXXK 1FJGQ 4QL5A 3GTOH 4A3DH 5JEAJ 3KDFA 1XNQL 3A0JA 3RR5A 2UU9Q 1VQMA 3RNUA 4A3BH 4R4QA 5AJ3L 2HT1A 1HH2P 1YHAA 2BH8A 4GOPC 2FXQA 1VQ9A 1KRSA 3F8TA 4BBSH 2AKWB 2NVXH 2F4VQ 2AWNA 5IP9H 4NXML 2JJQA 4A75A 3RN5A 4DUZL 4HJ7A 3G48A 4LUOA 1GM5A 3Q8DA 1X65A 1XNRL 4YCUA 1N32Q 2OTLA 3ICEA 2KHJA 2UU9L 4LF8Q 4RG1A 1M90C 3JAMc 1G6PA 1N34L 2WB1E 4AYBG 4HIOA 3AQQA 2E5LQ 1WI5A 1OXSC 1SE8A 2LXKA 3ULPA 1VQ4A 2MO1A 1PH3A 3ER0A 4K0KQ 4XIGS 3BZCA 2R93H 4JI8L 1DGSA 1V9PA 5LMUL 3I4NH 4JI1L 5C4JH 1CKNA 4A76A 1Q86C 1I94L 1N32L 3AYHB 3SGIA 2JA6G 4OO1G 2UXBQ 3GO5A 1PH8A 1N33Q 4LF5Q 4GNXA 4LF8L 2HIVA 4BY7H 2JK8A 2VW9A 4AIMA 1XJVA 4IPGA 5GAEC 2ZM6Q 2UXCQ 1IBLL 1JT8A 3AFPA 2WAQG 3S16H 1G291 1GD7A 4QGUA 1YI2A 1XPOA 4JCVE 4A3CH 4WJ4A 1BBWA 2I5LX 2UXBL 4QIWE 4GKKQ 4R4CA 3K7UC 2MO0A 1QVFA 1PH4A 2B3GA 3HOXH 2Q2HA 3M3YH 1K73C 1SMXA 1Z47A 1HJPA 4JBKA 1KRTA 5IT9c 4ME3A 4LF7Q 4A93G 3S2DH 2Y0SE 2A1AA 5GADC 2UXCL 2ZJRA 3S24A 2V1CC 4P75A 1WCMG 4A3GH 2I5MX 1ASYA 2NVTH 3PCOB 3PV0A 2ASBA 1I6HH 3E9IA 1KQSA 4IPHA 2R7FA 4KHZA 3KFUA 1J5EL 1K3RA 4PG3A 1UEBA 3GDEA 1SROA 3KF8B 4X64Q 1K83H 1ASZA 3I2ZA 3J81c 4IOAA 2YTVA 3PUXA 4LF4L 2KHIA 4NPSA 4AQYL 1JJ2A 1JJGA 4WJ3M 3DLLA 1KAWA 2ZJPA 1Q1BA 1CUKA 2E2IH 2B63H 3CMEA 1MIUA 4IOCA 4EX5A 4A3EG 1VQLA 1U5KA 1UE6A 4P72A 2QEXA 4P74A 3J7A5 4OWTB 3WWVA 4UPAA 2VL6A 4A3FG 2XTIA 3KDFB 4GN4B 4L5TA 4DV7L 3PO2G 4A3LG 4QJFA 4LF6Q 3EBEA 1YJNA 4X62L 4JI0Q 2KCMA 5C4XH 1E22A 1SLJA 1EUJA 2A19A 2E8GA 3TRZA 1IZ6A 4LWCA 2JA8G 1HZAA 1BVSA 4DV3L 1WFQA 1X3GA 4OWXB 2BA0A 3S2HH 4X65L 3HOWH 4OX9L 2K4KA 4YCVA 4A3KH 4DR4Q 1W2BA 1SR3A 2JEBI 1Y14B 3KF6A 4DV1L 2UUAQ 3CCSA 4POFA 4A3IH 4JI6Q 3PIPA 2JA9A 4DUYL 2NVQH 1PHJA 3PO3G 1CSPA 4BXXG 2IHEA 1L0WA 3HKZE 2PMZE 3GTLH 1UE5A 1CKNB 3M4OH 1UWVA 4JI5Q 3AFQA 4R4TA 4DR1Q 1X54A 4DV6Q 3U50C 1MJCA 2VQEQ 2KENA 4R4IA 4GNXB 1QZHA 1NE3A 2IX0A 4TVAB 4MTNA 5IP7G 2HHHL 4JI7L 3HOZH 5IYBH 5BR8Q 1S72A 3PF4A 4JI6L 2AMCB 1HNWQ 4DK6C 1NMGA 1W3SA 3FKIG 4YWKA 3TREA 3HOUH 5EAYA 3CF5A 2K52A 1OXUA 2RCNA 5K36G 5IYDG 4LF9L 1HZ9A 3K8AA 3L0OA 4C3HH 4DR1L 3T1HQ 3K7AH 4RMFA 4LFAQ 4NXNL 3JC66 2WB1G 5HGQA 1MKHA 4L5RC 4JOIA 3ULJA 3J81j 3H3VI 1X56A 3IRBA 4A3BG 4YWMA 3HFZB 4IFDG 1PVOA 2ES2A 2KCTA 5IY0A 3KJPA 4IFDJ 5IYCH 5M5XH 2XGTA 5IP9G 2R7ZH 1FJGL 1KL9A 3J81i 2JA5G 4PZ7A 1XMQQ 1S3OA 2UXDQ 4LW1A 5M3MH 3EIVA 1JE5A 2N49A 1YHBA 4DR7Q 1TXYA 1VQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V H;  4DV5 Q;  4UP8 A;  2AWO A;  3CP0 A;  3PUV A;  2UUB Q;  3K80 C;  1Q12 A;  2UUC Q;  1TWA H;  3RN2 A;  1Y1W H;  3W5O A;  1L1O A;  1UE1 A;  4P71 A;  3HKS A;  3S15 H;  3I4N G;  3B6Y A;  1XMQ L;  3CC7 A;  4QY7 A;  4HJA A;  2D0O A;  4L5Q A;  1XPU A;  2LSS A;  1PV4 A;  2IHF A;  4POG A;  1QVC A;  2VQF Q;  3CCE A;  4UY8 C;  4DR7 L;  1VQD A;  2ID0 A;  2PQA A;  2WP8 J;  2Y0S G;  4BA1 I;  4EQ5 A;  3F2D A;  3E0E A;  3CCV A;  1EQQ A;  2E5L L;  2UUB L;  3S17 H;  3OYY A;  4GN3 B;  4K0K L;  3HOY H;  5JJI A;  1IBM Q;  2NN6 I;  2GVA A;  1Q7Y C;  4A3M H;  3RLO A;  4R4O A;  1TWG H;  5FLM H;  3CD6 A;  3FHW A;  1G51 A;  4DV2 Q;  2I5H A;  3H3V H;  3TS2 A;  4A3C G;  4KHP Q;  5ELO A;  1N33 L;  3J80 i;  1VQP A;  4GLA C;  4LF5 L;  4R1J A;  3D31 A;  3HOX G;  2VQF L;  4DV4 Q;  1VQJ A;  2CKZ B;  1E7Z A;  3BJU A;  3A5U A;  2IT1 A;  4BA2 I;  1X3E A;  4C3I H;  5JJL A;  1Q1E A;  2JQO A;  4A3J H;  3DM3 A;  5H1S E;  2ZM6 L;  3KF6 B;  1H95 A;  1WYD A;  2VUM H;  3CPW A;  4OWW B;  2K14 A;  5ELN A;  4A3G G;  2JA7 G;  4GKK L;  4KHP L;  3HOV H;  4L5S A;  1IYJ B;  1B8A A;  4BBR H;  1KD1 C;  1K8G A;  4X66 Q;  2WFW A;  2ZTC A;  1MJE A;  1JJC B;  4DNI A;  1P8L A;  1AH9 A;  5M5Y H;  2Q2I A;  3CCJ A;  1HNX Q;  4LF7 L;  3U4V A;  1CKM A;  2RHQ B;  4JI3 Q;  2EQS A;  1Q8K A;  2N78 A;  3OW2 A;  3STB D;  2K75 A;  1FL0 A;  4YHH Q;  3CC4 A;  4A93 H;  1VCI A;  1D8L A;  3CMA A;  3I4O A;  5C44 G;  1TWC H;  2H5X A;  3I4M H;  4YY3 Q;  2E2H H;  2OQ0 A;  2B63 G;  5C0X I;  1BKB A;  3CCQ A;  2ZTD A;  1KC8 C;  1SFO H;  2K5H A;  3CCU A;  4X64 L;  1RIP A;  4IO9 A;  3U4Z A;  4JBW A;  4B3M Q;  4B3R Q;  5M3F H;  1KXL A;  2PI2 E;  4B3T Q;  3CXC A;  4JI4 Q;  2NZH A;  1OXV A;  4LUZ A;  4DR5 Q;  5C4X G;  1TWF H;  1E24 A;  4GOP A;  3HKZ G;  1PH1 A;  4B3S Q;  3H0G H;  4GKJ Q;  2DGY A;  4XTC S;  4H02 A;  4DR3 Q;  3PSI A;  4BY1 H;  1J6Q A;  2F52 A;  3A5Z B;  5FLX c;  2BA1 A;  4IPD A;  4GNX C;  4LF6 L;  1AE3 A;  2ATW A;  3HOW G;  1CSQ A;  4B3T L;  1EYG A;  4JI0 L;  3S1Q H;  4A3F H;  3J80 c;  2EXD A;  5HY6 A;  4A3K G;  3GD7 A;  2LXJ A;  3I7F A;  4JYA Q;  1VQH A;  4ALP A;  2C35 B;  4DR5 L;  4A3I G;  1VQF A;  4Y52 H;  3F2C A;  4APV A;  2R92 G;  3E9H A;  3G6E A;  2L15 A;  1B7Y B;  1L1O B;  4PZ8 A;  4IJH A;  4DR3 L;  1VQ8 A;  4JBM A;  3W1B A;  2AHO B;  1EWI A;  4KI0 A;  1EOV A;  1PH9 A;  4LFB Q;  1QZG A;  1K9M C;  4DR4 L;  1YEZ A;  4J15 A;  3CPF A;  3OTO Q;  1XMO Q;  2UUA L;  4LNQ A;  4JI2 Q;  1NY4 A;  2PQA B;  3M9B A;  3HOZ G;  1N36 Q;  2CCZ A;  3K0X A;  3FP9 A;  1E3P A;  1AE2 A;  4DR2 Q;  2PNH A;  5GAG C;  1YIJ A;  1PH2 A;  4GS3 A;  1PH7 A;  2ZJQ A;  4JI5 L;  3ZJY C;  2QA4 A;  3I55 A;  3PO3 H;  1EFW A;  1YZ6 A;  2VZA A;  5C3E H;  4DV6 L;  1GO3 E;  2VQE L;  4GLX A;  4A3D G;  4JV5 Q;  1QUQ A;  4DV0 Q;  1BBU A;  4LFC Q;  5BR8 L;  2K5V A;  1E1O A;  2D0P A;  3G71 A;  1HNW L;  2YV5 A;  1A0I A;  1SN8 A;  4P73 A;  4DK3 C;  4DR2 L;  1JMC A;  1XNQ Q;  4BBS G;  4FDB A;  2GVB A;  5IYC G;  4OO1 I;  3RZD H;  3T1H L;  3S1R H;  2YTX A;  3FKI H;  2R7Z G;  2VNU D;  1O7I A;  2I0Q A;  4LFA L;  2N8N A;  5FJ8 H;  4DAM A;  2Z6K C;  5GQO A;  3KYH C;  2MQH A;  2N3S A;  2CFM A;  5J3B A;  4LFC L;  5M3M G;  3GTJ H;  4DUZ Q;  4DV0 L;  5DLQ E;  1XNR Q;  3LGJ A;  3ERS X;  1IXR A;  3HOU G;  1L2F A;  1Y1V G;  4IPC A;  3UDI A;  1HR0 W;  3S1M H;  1X6O A;  1NBW A;  2ZTE A;  1N34 Q;  1X3F A;  5IWA Q;  1PH5 A;  2R93 G;  1Y1W G;  3GTM H;  1Z9F A;  1C7Y A;  1VQ6 A;  1N9W A;  2UXD L;  2CQO A;  2VS1 A;  3I56 A;  4HID A;  4JI8 Q;  1X9N A;  1K8A C;  3STB C;  1C0A A;  5LMU Q;  1D7Q A;  2JA5 H;  2MNA A;  1XPR A;  4JI1 Q;  4DV5 L;  1I94 Q;  1R9T H;  1KIX A;  4BY7 G;  2ALY B;  2YTY A;  4DKA C;  3CW2 C;  2IY5 B;  4UP7 A;  1EQR A;  2UUC L;  3HOY G;  3MXN B;  1B70 B;  3M85 A;  1VQI A;  5IWA L;  5LMN W;  2IX1 A;  3CQZ H;  4A3M G;  4IJL A;  2PI2 A;  4GOP B;  3RZO H;  2RHS B;  3S14 H;  5FLM G;  1IBL Q;  1Q46 A;  3UDG A;  1I5F A;  3NBH B;  1PH6 A;  5JJK A;  1CKO A;  4O2D A;  1K0R A;  3UDF A;  1YNX A;  3VDY A;  2JA6 H;  3NEM A;  1IL2 A;  4JBJ A;  1VQB A;  2F4V L;  3F1Z A;  3BZK A;  1I50 H;  1YJW A;  4A3J G;  1IBM L;  1TWH H;  3U58 A;  2NVY H;  1XTD A;  2D62 A;  4A4I A;  1VQK A;  2VUM G;  2VY3 A;  3AEV A;  4AYB E;  4DV2 L;  2CWP A;  1NTG A;  3L7Z C;  2Q2T A;  4HJ5 A;  2R7D A;  1NMF A;  3PUZ A;  3HOV G;  1V1Q A;  3CCR A;  4BBR G;  4DV4 L;  1HZB A;  2OCE A;  2QGQ A;  4LUV A;  1FVI A;  1A63 A;  4JOI C;  3M4Q A;  2DUD A;  1WOC A;  1J5E Q;  3H15 A;  4JG2 A;  2YU9 H;  1VQ5 A;  2OQK A;  2KBN A;  1QVG A;  3A74 A;  3I4M G;  1IBK Q;  3GTQ H;  4QQB X;  1WCM H;  4LF4 Q;  4X66 L;  4AQY Q;  2NN6 G;  2JA7 H;  3M7N A;  2WAQ E;  3RLF A;  1VQN A;  4UP9 A;  1HNX L;  1M1K C;  1YVC A;  3PUY A;  1T9H A;  4YCW A;  4C2M H;  4JI3 L;  3W1G A;  1SRU A;  1HNZ Q;  1QUQ B;  3GTK H;  3RLN A;  4YHH L;  5M3F G;  3TQY A;  1HR0 Q;  4DV7 Q;  4YY3 L;  4DR6 Q;  3MEF A;  2EIF A;  1IBK L;  3PUW A;  1LTL A;  1L1O C;  2JE6 I;  4X62 Q;  5C44 H;  3S1N H;  3H0G G;  3TS0 A;  3KJO A;  3J7Z C;  3PF5 A;  4PZ6 A;  4BY1 G;  4A3E H;  2OTJ A;  4B3M L;  1A62 A;  3UE0 A;  1HNZ L;  2E2J H;  1C9O A;  4B3R L;  2Z6K A;  1V43 A;  4TQU S;  1GVP A;  4DV3 Q;  3GTP H;  1Q82 C;  4HIM A;  5IE8 A;  1X55 A;  1PA6 A;  4A3L H;  3NEL A;  4X65 Q;  2CWA A;  1HR0 L;  3BU2 A;  4JI4 L;  4OX9 Q;  3PO2 H;  4DR6 L;  2B29 A;  2HQL A;  1YIT A;  1I3Q H;  3UE1 A;  1UE7 A;  1YBY A;  4MZ9 A;  5LMN Q;  4HJ8 A;  1NJI C;  4B3S L;  4GKJ L;  4DV1 Q;  1Q81 C;  4DPG A;  3TEH B;  4Y7N H;  3PGZ A;  1GKH A;  2K5N A;  1PYS B;  2F3I A;  1KHI A;  4DUY Q;  3ULL A;  2JA8 H;  3JAM i;  1EIY B;  1HZC A;  3T1Y Q;  1LUZ A;  1PFS A;  5C0X G;  3KOJ A;  4AH6 A;  1N8R C;  4IFD I;  4DAY B;  2MFI A;  4O0A A;  4PMW A;  2OWO A;  4JYA L;  5C0X J;  1YJ9 A;  5IYB G;  4YWL A;  4C3J H;  3CC2 A;  3NEN A;  5LMN L;  3CAM A;  2A8V A;  1FGU A;  4NB3 A;  5E7N A;  3CCL A;  1A8V A;  2HIX A;  2YYZ A;  2Z0S A;  3KLW A;  4HIK A;  2HHH Q;  4JI7 Q;  1LYL A;  5M5W H;  1RL2 A;  4MNO A;  2R92 H;  4JC0 A;  2BH2 A;  1LM0 A;  4BXX H;  1WJJ A;  3K81 C;  3PIO A;  4LFB L;  2R6G A;  4OXP A;  3EN2 A;  5C3E G;  3T1Y L;  3OTO L;  1XMO L;  1PYB A;  4KLK A;  4JI2 L;  4LF9 Q;  4OON A;  3G4S A;  3L2P A;  4HJ9 A;  1N36 L;  1VQC A;  1VS0 A;  4NXN Q;  1S40 A;  3GTG H;  1P16 A;  2K50 A;  5IP7 H;  1VQA A;  2Q2U A;  1OTC A;  2GN5 A;  2RF4 A;  5GRO A;  4GN5 A;  1VQ7 A;  2JEA I;  3UDX A;  1U0L A;  1VQO A;  4GLV B;  1VQG A;  3CCM A;  5AJ3 Q;  4X6A H;  3M4P A;  3F2B A;  1E1T A;  1JB7 A;  1OXT A;  4JV5 L;  2NZO A;  1EIF A;  1YHQ A;  3D0F A;  5FJ8 G;  5IYD H;  4NXM Q;  5JEA G;  5GAH C;  1OXX K;  1FJG Q;  4QL5 A;  3GTO H;  4A3D H;  5JEA J;  3KDF A;  1XNQ L;  3A0J A;  3RR5 A;  2UU9 Q;  1VQM A;  3RNU A;  4A3B H;  4R4Q A;  5AJ3 L;  2HT1 A;  1HH2 P;  1YHA A;  2BH8 A;  4GOP C;  2FXQ A;  1VQ9 A;  1KRS A;  3F8T A;  4BBS H;  2AKW B;  2NVX H;  2F4V Q;  2AWN A;  5IP9 H;  4NXM L;  2JJQ A;  4A75 A;  3RN5 A;  4DUZ L;  4HJ7 A;  3G48 A;  4LUO A;  1GM5 A;  3Q8D A;  1X65 A;  1XNR L;  4YCU A;  1N32 Q;  2OTL A;  3ICE A;  2KHJ A;  2UU9 L;  4LF8 Q;  4RG1 A;  1M90 C;  3JAM c;  1G6P A;  1N34 L;  2WB1 E;  4AYB G;  4HIO A;  3AQQ A;  2E5L Q;  1WI5 A;  1OXS C;  1SE8 A;  2LXK A;  3ULP A;  1VQ4 A;  2MO1 A;  1PH3 A;  3ER0 A;  4K0K Q;  4XIG S;  3BZC A;  2R93 H;  4JI8 L;  1DGS A;  1V9P A;  5LMU L;  3I4N H;  4JI1 L;  5C4J H;  1CKN A;  4A76 A;  1Q86 C;  1I94 L;  1N32 L;  3AYH B;  3SGI A;  2JA6 G;  4OO1 G;  2UXB Q;  3GO5 A;  1PH8 A;  1N33 Q;  4LF5 Q;  4GNX A;  4LF8 L;  2HIV A;  4BY7 H;  2JK8 A;  2VW9 A;  4AIM A;  1XJV A;  4IPG A;  5GAE C;  2ZM6 Q;  2UXC Q;  1IBL L;  1JT8 A;  3AFP A;  2WAQ G;  3S16 H;  1G29 1;  1GD7 A;  4QGU A;  1YI2 A;  1XPO A;  4JCV E;  4A3C H;  4WJ4 A;  1BBW A;  2I5L X;  2UXB L;  4QIW E;  4GKK Q;  4R4C A;  3K7U C;  2MO0 A;  1QVF A;  1PH4 A;  2B3G A;  3HOX H;  2Q2H A;  3M3Y H;  1K73 C;  1SMX A;  1Z47 A;  1HJP A;  4JBK A;  1KRT A;  5IT9 c;  4ME3 A;  4LF7 Q;  4A93 G;  3S2D H;  2Y0S E;  2A1A A;  5GAD C;  2UXC L;  2ZJR A;  3S24 A;  2V1C C;  4P75 A;  1WCM G;  4A3G H;  2I5M X;  1ASY A;  2NVT H;  3PCO B;  3PV0 A;  2ASB A;  1I6H H;  3E9I A;  1KQS A;  4IPH A;  2R7F A;  4KHZ A;  3KFU A;  1J5E L;  1K3R A;  4PG3 A;  1UEB A;  3GDE A;  1SRO A;  3KF8 B;  4X64 Q;  1K83 H;  1ASZ A;  3I2Z A;  3J81 c;  4IOA A;  2YTV A;  3PUX A;  4LF4 L;  2KHI A;  4NPS A;  4AQY L;  1JJ2 A;  1JJG A;  4WJ3 M;  3DLL A;  1KAW A;  2ZJP A;  1Q1B A;  1CUK A;  2E2I H;  2B63 H;  3CME A;  1MIU A;  4IOC A;  4EX5 A;  4A3E G;  1VQL A;  1U5K A;  1UE6 A;  4P72 A;  2QEX A;  4P74 A;  3J7A 5;  4OWT B;  3WWV A;  4UPA A;  2VL6 A;  4A3F G;  2XTI A;  3KDF B;  4GN4 B;  4L5T A;  4DV7 L;  3PO2 G;  4A3L G;  4QJF A;  4LF6 Q;  3EBE A;  1YJN A;  4X62 L;  4JI0 Q;  2KCM A;  5C4X H;  1E22 A;  1SLJ A;  1EUJ A;  2A19 A;  2E8G A;  3TRZ A;  1IZ6 A;  4LWC A;  2JA8 G;  1HZA A;  1BVS A;  4DV3 L;  1WFQ A;  1X3G A;  4OWX B;  2BA0 A;  3S2H H;  4X65 L;  3HOW H;  4OX9 L;  2K4K A;  4YCV A;  4A3K H;  4DR4 Q;  1W2B A;  1SR3 A;  2JEB I;  1Y14 B;  3KF6 A;  4DV1 L;  2UUA Q;  3CCS A;  4POF A;  4A3I H;  4JI6 Q;  3PIP A;  2JA9 A;  4DUY L;  2NVQ H;  1PHJ A;  3PO3 G;  1CSP A;  4BXX G;  2IHE A;  1L0W A;  3HKZ E;  2PMZ E;  3GTL H;  1UE5 A;  1CKN B;  3M4O H;  1UWV A;  4JI5 Q;  3AFQ A;  4R4T A;  4DR1 Q;  1X54 A;  4DV6 Q;  3U50 C;  1MJC A;  2VQE Q;  2KEN A;  4R4I A;  4GNX B;  1QZH A;  1NE3 A;  2IX0 A;  4TVA B;  4MTN A;  5IP7 G;  2HHH L;  4JI7 L;  3HOZ H;  5IYB H;  5BR8 Q;  1S72 A;  3PF4 A;  4JI6 L;  2AMC B;  1HNW Q;  4DK6 C;  1NMG A;  1W3S A;  3FKI G;  4YWK A;  3TRE A;  3HOU H;  5EAY A;  3CF5 A;  2K52 A;  1OXU A;  2RCN A;  5K36 G;  5IYD G;  4LF9 L;  1HZ9 A;  3K8A A;  3L0O A;  4C3H H;  4DR1 L;  3T1H Q;  3K7A H;  4RMF A;  4LFA Q;  4NXN L;  3JC6 6;  2WB1 G;  5HGQ A;  1MKH A;  4L5R C;  4JOI A;  3ULJ A;  3J81 j;  3H3V I;  1X56 A;  3IRB A;  4A3B G;  4YWM A;  3HFZ B;  4IFD G;  1PVO A;  2ES2 A;  2KCT A;  5IY0 A;  3KJP A;  4IFD J;  5IYC H;  5M5X H;  2XGT A;  5IP9 G;  2R7Z H;  1FJG L;  1KL9 A;  3J81 i;  2JA5 G;  4PZ7 A;  1XMQ Q;  1S3O A;  2UXD Q;  4LW1 A;  5M3M H;  3EIV A;  1JE5 A;  2N49 A;  1YHB A;  4DR7 Q;  1TXY A;  1VQE A; 
#chains in the Genus database with same CATH topology
 1Y1V H;  4DV5 Q;  2ZXP A;  4UP8 A;  3CP0 A;  5E4X A;  1MI2 A;  3RN2 A;  2TMP A;  3HKS A;  4R9W A;  1MBY A;  4C3J B;  3S9W A;  1XMQ L;  3RZO B;  1Z7T A;  4POG A;  2VQF Q;  4BA1 I;  2F0V A;  4KMU C;  3F2D A;  4EQ5 A;  3CCV A;  1EQQ A;  3E0E A;  4ZUJ A;  4K0K L;  1CM9 A;  2PZU A;  1Q7Y C;  4ZUI A;  1QCB D;  2A68 C;  1A3V A;  3H3V H;  3J7A V;  4DV2 Q;  2I5H A;  4I7Z C;  4GLA C;  1CFM A;  3VR5 A;  1E2V A;  3D31 A;  4LF5 L;  2L5T A;  1W6J A;  1X3E A;  3DXJ C;  3TSS A;  5JJL A;  3DM3 A;  1IYV A;  2Z6B A;  3KF6 B;  3QOL A;  2KUM A;  1GHJ A;  1WYD A;  2K14 A;  1B1Z A;  3GTO B;  2JA7 G;  4L5S A;  5C3X A;  1LT5 D;  1GOZ A;  1MJE A;  2ZTC A;  4DNI A;  4DN4 M;  5M5Y H;  3CCJ A;  1MSH A;  1AH9 A;  4LF7 L;  3U4V A;  4BBS B;  2NVX B;  2EQS A;  3OW2 A;  4LAA A;  1NCV A;  2PO4 A;  1EY0 A;  1VCI A;  1FNU A;  5C44 G;  1HFN A;  1TWC H;  3I4M H;  1SNQ A;  2OQ0 A;  2F0D A;  3NE5 B;  2RQX A;  4EQN A;  3TN2 A;  1KC8 C;  4X64 L;  1RIP A;  3U4Z A;  3URY A;  2WKC A;  5M3F H;  3A54 A;  2Z4H A;  1PXU A;  3L9A X;  1BR9 A;  1NR4 A;  3BVM A;  5A2Q E;  1F2Y A;  3KUP A;  3EA6 A;  1E24 A;  4GOP A;  2DY8 A;  1PH1 A;  3H0G H;  2DGY A;  3K6O A;  2SNS A;  4K2L A;  4BY1 H;  3A5Z B;  4IPD A;  1PZJ D;  1B3A A;  4YIJ A;  4WOR A;  2KEC A;  2EXD A;  5HY6 A;  2C9O A;  4EQO A;  5A2Q L;  4RKB A;  3F2C A;  3VA7 A;  3KLS A;  3OPO A;  4DFA A;  4PZ8 A;  1VQ8 A;  5EBD A;  4I7A A;  3TP5 A;  3S2D B;  4KI0 A;  1EOV A;  1PH9 A;  1JC7 A;  1YEZ A;  3OTO Q;  3ERQ A;  3LX0 A;  4JI2 Q;  1N36 Q;  2O5J C;  1O80 A;  1WTX A;  4LK1 C;  1AE2 A;  2N88 A;  5GAG C;  4DR2 Q;  1I6H B;  1AFP A;  5LL6 X;  5G3L F;  1KAA A;  1PH7 A;  3FPP A;  5JJZ A;  3PO3 H;  5C3E H;  4DV6 L;  3SK8 A;  2VQE L;  1PRT C;  2L11 A;  2K5V A;  1HNW L;  2YV5 A;  3DUZ A;  1PRT F;  5COY A;  3T1H L;  1SJE D;  2VNU D;  1O7I A;  4RA8 A;  3T56 B;  4KJO A;  5FJ8 H;  2Z6K C;  5FLX E;  1EY9 A;  3BVG A;  3J7Y W;  5C4X B;  1IXR A;  3TME A;  3D8G A;  1X6O A;  3O13 A;  5IWA Q;  3S2H B;  2R93 G;  3HOW B;  2RA4 A;  3T51 B;  1BNZ A;  2K28 A;  5FLX L;  4A3K B;  1K8A C;  1HCZ A;  4QF4 A;  4DAY A;  3I70 A;  1I94 Q;  3J80 L;  1R9T H;  2IY5 B;  4UP7 A;  3FPU B;  5J39 A;  1B70 B;  3KBX A;  5CGK A;  3M85 A;  2KOL A;  2NUC A;  4A3M G;  1UUP A;  2K04 A;  4GOP B;  2ICE C;  4CKE A;  1Q46 A;  4O2D A;  1LT6 D;  1YNX A;  1BXT A;  2JA6 H;  3NEM A;  4C3I G;  1TS5 A;  4DK0 A;  5D14 A;  1IBM L;  3ZYY X;  1TWH H;  3BDL A;  4G7Z C;  1JOO A;  5JPM C;  2HCI A;  2R7D A;  1NMF A;  3HOV G;  2K01 A;  2B2Y C;  4DV4 L;  1H9J A;  1HZB A;  2OCE A;  2NB0 A;  2LMC B;  1TT2 A;  3K5M A;  4Q0F A;  2DUD A;  3D4D A;  2R7Z B;  2LY7 A;  1GHK A;  1STA A;  1SYG A;  5I2X A;  3HOU B;  5KND A;  1M1K C;  1T9H A;  2ICI A;  2IL8 A;  4JI3 L;  3GTK H;  1EOT A;  1Y1W B;  3TQY A;  1PYW D;  1II3 A;  1SNO A;  1TS2 A;  2A74 C;  1HR0 Q;  4IZ8 A;  4YY3 L;  1IBK L;  1XXG A;  1SJH D;  1L1O C;  4X62 Q;  3S1N H;  1Q90 A;  3J7Z C;  4NMZ A;  3I91 A;  1A62 A;  3UE0 A;  1HNZ L;  3HOY B;  1STY A;  2IPK D;  1PA6 A;  4HIM A;  2EJM A;  4A3L H;  1TWG B;  3PO2 H;  2CWA A;  4JI4 L;  1NJI C;  4FP5 D;  1LLR D;  4DPG A;  1GKH A;  1K8M A;  2F3I A;  2K5N A;  4DXF A;  1HZC A;  2CHB D;  1EIY B;  1LUZ A;  4AH6 A;  4PQX A;  4CJ2 C;  4DAY B;  4O0A A;  4JYA L;  5C0X J;  1STG A;  3CC2 A;  2A8V A;  1FGU A;  4BBR B;  3CCL A;  2HHH Q;  5M5W H;  1RL2 A;  2R92 H;  3ITP A;  3K81 C;  4LFB L;  4OXP A;  3EN2 A;  1WTV A;  1D1I A;  3T1Y L;  2SOB A;  1PYB A;  4KLK A;  4A93 B;  5D3I B;  1L0Y B;  1P16 A;  2LS0 1;  5IP7 H;  2JEA I;  2F0L A;  1OTC A;  4IQZ A;  1VQ7 A;  1VQG A;  3OIP A;  3F2B A;  1E1T A;  4UHV A;  1TQO A;  2NZO A;  1YHQ A;  3A8I E;  2EVB A;  2A6E D;  4IUN A;  1OXX K;  1FJG Q;  1SYE A;  1VDZ A;  4A3D H;  5JEA J;  1WD0 A;  3A0J A;  1AW7 A;  2EJF C;  2KVM A;  1G2S A;  1VQM A;  2ENB A;  4A3B H;  1XX8 A;  2BH8 A;  2FIN B;  4OL7 A;  4ZLT F;  4NXM L;  1V8Q A;  4HJ7 A;  3S1Q B;  4LUO A;  5FK9 C;  1XNR L;  2SDF A;  4RG1 A;  3BG3 A;  1QJO A;  5FKA C;  4U68 A;  4HIO A;  1ICW A;  2EY2 A;  4K0K Q;  2MO1 A;  2NZ1 D;  1Q86 C;  4LF5 Q;  4HSP A;  2VW9 A;  1Q3L A;  3RMH A;  4IPG A;  3S16 H;  4EGV A;  3NTI A;  1GD7 A;  2L9H A;  1XPO A;  1A15 A;  2I5L X;  4QIW E;  2I46 A;  2Q2H A;  1U4R A;  1GUG A;  4KTA A;  2M00 A;  5IT9 c;  1LT4 D;  4LF7 Q;  3E5S A;  2OEO A;  1HTL D;  3I3C A;  3GTJ B;  1PDQ A;  5J22 A;  1ASY A;  1WD1 A;  2QF7 A;  3DWQ A;  1IW7 D;  1EQT A;  3S1M B;  2R7F A;  1LT3 D;  2XRS D;  2B2U A;  2E76 C;  1A3U A;  3GDE A;  3I72 A;  3SR1 A;  4X64 Q;  4HCS A;  4X3S A;  1YNN C;  1K83 H;  3NTK A;  1LAC A;  1JJ2 A;  5IOD A;  1WTP A;  1Q1B A;  2F0N A;  3BDO A;  4IOC A;  4AYB B;  1DCZ A;  1UE6 A;  2QEX A;  1NNX A;  3J7A 5;  3CQZ B;  1PFN A;  2ZXO A;  4GN4 B;  1BCP C;  2KCM A;  1G91 A;  3DEO A;  4KK7 A;  2E8G A;  1I50 B;  3T13 A;  1BCP F;  1SE4 A;  1GJX A;  1I4R A;  1WFQ A;  4DV3 L;  1ILP A;  1ZEQ X;  1WTH A;  5J1Z A;  2WAQ B;  1EY7 A;  4C3J G;  3D3R A;  4POF A;  4JI6 Q;  4DUY L;  2JA9 A;  3OWE B;  1PHJ A;  3PO3 G;  1VMC A;  2IHE A;  3HKZ E;  1UE5 A;  2YU9 B;  4DV6 Q;  2VQE Q;  3GTQ B;  1WCM B;  1QE6 A;  1NE3 A;  2IX0 A;  4MTN A;  4DNT B;  4WRD A;  4K5W A;  1HNW Q;  4DK6 C;  5LHY 1;  1ICF B;  4YWK A;  3CF5 A;  2K52 A;  2RCN A;  4LF9 L;  3L0O A;  4ABN A;  3T1H Q;  2HUG A;  3FDT A;  4RMF A;  3JC6 6;  1TY2 A;  1MKH A;  2NTS A;  3ULJ A;  2WKD A;  3D6C A;  1X56 A;  1ESF A;  4YWM A;  1TS3 A;  4A3E B;  3WOF A;  2KCT A;  5DM6 3;  2E2J B;  5KYL A;  4IFD J;  2G9H D;  2H4O A;  5M5X H;  1BO0 A;  3A8K E;  5TSS A;  2V4D A;  3VA5 A;  4XXE A;  1S3O A;  4LW1 A;  5JEA H;  2N49 A;  3HG9 A;  1MHW C;  3FEW X;  4Y7N B;  1VQE A;  1B9M A;  1OO9 B;  2AWO A;  4C56 C;  1K8O A;  2JA8 B;  2UUB Q;  3K80 C;  1FNV A;  3W5O A;  4RKL A;  1UE1 A;  3S15 H;  4HJA A;  4QY7 A;  2D0O A;  1QNK A;  1XPU A;  2D9U A;  1PV4 A;  4UY8 C;  4CDF C;  2CH4 A;  1ILQ A;  1VMP A;  3S17 H;  4GN3 B;  1L0X B;  5JJI A;  3MXU A;  4IAL A;  1IBM Q;  2GVA A;  4A3M H;  2AUK A;  3RLO A;  1LO5 D;  2L55 A;  1G51 A;  4KHP Q;  3J80 i;  1VQP A;  4R1J A;  1U9R A;  3BJU A;  4DV4 Q;  1BDO A;  2RKS A;  4C3I H;  1Q1E A;  3RD4 A;  2JQO A;  4FXK C;  3R93 A;  1XWE A;  4GKK L;  4EQP A;  2EY1 A;  3HOV H;  1IYU A;  1KD1 C;  3H3V C;  5I6Y A;  4IUV A;  3Q6S A;  1U4P A;  4KN4 C;  1JWS D;  4JI3 Q;  2N78 A;  1FL0 A;  4K8I A;  2XVS A;  1D8L A;  3CMA A;  1I4Q A;  3I4O A;  1CI3 M;  2KCN A;  4YY3 Q;  1YNJ D;  5C0X I;  4KY5 A;  4GZY C;  4PMC A;  2ZTD A;  2F0F A;  2F0Q A;  4JBW A;  1KXL A;  2PI2 E;  1EEI D;  4DNR B;  1EYD A;  4B3T Q;  1DYQ A;  3I4N B;  5C4J B;  4JI4 Q;  2NZH A;  2K32 A;  4LUZ A;  5C4X G;  1TWF H;  3Q22 A;  3EFX D;  3NBH A;  4BY7 B;  5IGD A;  3PSI A;  2EY5 A;  3IKJ A;  3HOW G;  4GNX C;  5D65 A;  4FO2 A;  3DWA A;  5KYI A;  1EYG A;  4JI0 L;  4A3F H;  4A3K G;  3I7F A;  4JYA Q;  4DR5 L;  2C35 B;  1VQF A;  5BN4 A;  1Z6H A;  2R92 G;  3QIA A;  4DR3 L;  4JBM A;  3W1B A;  4OGQ C;  4LFB Q;  5C4H A;  1ZYR D;  4KD4 A;  3K5N A;  4DR4 L;  2RBM A;  2NVT B;  3FP9 A;  2MGS A;  2XWJ B;  3AU7 A;  3ZJY C;  2QA4 A;  2VZA A;  4GLX A;  4A3D G;  1ENC A;  3AB9 A;  1RD9 D;  4F87 A;  5BR8 L;  4O1N A;  5IGF A;  5IGG A;  3G71 A;  2J4X A;  4CJ1 B;  4DK3 C;  4HCE A;  3I4L A;  1MSG A;  1E2Z A;  4OO1 I;  3RZD H;  2YTX A;  2R7Z G;  1FD7 D;  4DAM A;  2N3S A;  4DV0 L;  4LFC L;  1I4P A;  1GXD C;  1XNR Q;  4OHJ A;  3ERS X;  3HOU G;  4B08 A;  3P75 A;  1NBW A;  3NXW A;  1Y1W G;  3GTM H;  2NYZ D;  1Z9F A;  1C7Y A;  1VQ6 A;  1N9W A;  1RTN A;  5EPL A;  3D4W A;  3STB C;  2JA5 H;  2MNA A;  1XPR A;  4A3I B;  2EPB A;  2YTY A;  3R3O A;  2RDH A;  1PTO B;  3WOE A;  3GTL B;  5CV8 A;  3HOY G;  2HDL A;  1DOM A;  3M4O B;  1HA6 A;  1X3Q A;  4IJL A;  2RHS B;  1MGS A;  1RDP D;  4FXG C;  2PCF B;  3NBH B;  1PH6 A;  1CKO A;  2IW3 A;  2M2L A;  4JBJ A;  3BZK A;  1YJW A;  2KEE A;  2EYH A;  2Z4I A;  3BVZ A;  2NVY H;  1Y8O B;  5KNC A;  4C3H B;  3NPP A;  3H91 A;  3AEV A;  3L7Z C;  4HJ5 A;  3T4A C;  4ZRZ A;  3PUZ A;  4N8F A;  4J6H A;  1V1Q A;  4G4K A;  4BBR G;  2JN4 A;  2RSN A;  3VYT A;  2OT2 A;  2F0W A;  2SNM A;  3M4Q A;  5CV4 A;  1IKL A;  1EY5 A;  2Z1C A;  1ESR A;  1VQ5 A;  2OQK A;  1UEA B;  1QVG A;  5M3M B;  4QQB X;  1HRJ A;  3GV6 A;  3RLF A;  2MPM A;  1VQN A;  1HNX L;  1RCV D;  1DM0 B;  1ROD A;  2DNE A;  4YCW A;  4C2M H;  2F0G A;  5CYU A;  1TWA B;  1CQF A;  1H9M A;  4HSV A;  4YHH L;  4WJW A;  1FYC A;  1RJT A;  4KJN A;  4R8I A;  4DR6 Q;  5BN5 A;  1JOR A;  3TS0 A;  3KJO A;  3PF5 A;  4PZ6 A;  1LTT D;  2H1E A;  1EU4 A;  1C9O A;  4B3R L;  1PZK D;  2Z6K A;  3GTP H;  2O4X A;  3MC0 B;  4DV3 Q;  2F3W A;  1YIT A;  5T1I A;  1I3Q H;  4HJ8 A;  1UE7 A;  1YBY A;  5LMN Q;  4B3S L;  2X6G A;  4GKJ L;  3TEH B;  4DUY Q;  1KHI A;  4A3J B;  2IX3 A;  1H9S A;  5C0X G;  2VUM B;  1SYB A;  4IFD I;  2LKV A;  4G7O C;  4YWL A;  4C3J H;  2B8F A;  4NB3 A;  4V19 0;  3RZO H;  2YYZ A;  2HIX A;  2RDG A;  4KKS A;  4HIK A;  3SEB A;  1AN8 A;  4JC0 A;  1Y8P B;  2CW0 D;  4ILW A;  3MZ5 A;  1WJJ A;  2R6G A;  4CKB A;  4LF9 Q;  3L2P A;  1VQC A;  2E2H B;  1A2T A;  3HEJ A;  2Q2U A;  2RF4 A;  4KHV A;  2F0K A;  1SFO B;  1U0L A;  1MD2 D;  3CCM A;  4CJ0 B;  4BWG B;  5JEA G;  2B2Y A;  1SEB D;  3J80 E;  3GTO H;  5HUR A;  3VYS A;  3KDF A;  5ISR A;  1XNQ L;  1RKN A;  4B9X A;  1F9Q A;  4RH6 A;  3RR5 A;  1RF2 D;  4HTH A;  2IJ0 A;  4R4Q A;  5AJ3 L;  4GOP C;  1JB3 A;  2DN8 A;  2FXQ A;  5M9O A;  1KRS A;  3F8T A;  1WVL A;  4BBS H;  2AKW B;  2NVX H;  4IUU A;  4DUZ L;  1J8I A;  2Q8R E;  4YCU A;  1Y69 U;  2KED A;  2OTL A;  1PRT B;  2KHJ A;  4ME5 A;  2UU9 L;  4LF8 Q;  1B50 A;  2WB1 E;  4AYB G;  3WDN A;  5DM7 3;  2LXK A;  1EZ8 A;  3AMU A;  1JOK A;  4XIG S;  4JI8 L;  1AEX A;  1DGS A;  2B8G A;  5LMU L;  2K05 A;  4CDD C;  4JI1 L;  1N32 L;  4OO1 G;  4JW0 A;  3GO5 A;  1CTM A;  1LAB A;  1F9R A;  3OW7 A;  4PMB A;  2VXW A;  1TII D;  2NTT A;  3OMG A;  1EIG A;  4AIM A;  4IUT A;  3C3L A;  3VYR A;  2XN9 C;  1PTO D;  1IBL L;  1TU2 B;  1F77 A;  2UXC Q;  1NR2 A;  2WAQ G;  5IGB A;  1G29 1;  1YI2 A;  4QGU A;  4JCV E;  2UXB L;  4GKK Q;  3K7U C;  2J7Z A;  1H9S B;  1SMX A;  1Z47 A;  1HJP A;  3HP3 A;  5CBA E;  3S1R B;  1I4H A;  3FKI B;  2FJ2 A;  1FGB D;  3S2D H;  2PNR C;  2A1A A;  5GAD C;  2ZJR A;  1HA5 A;  1BOS A;  1WCM G;  3VR3 A;  3U9S A;  4RFB A;  2EYO A;  4L6T B;  2ASB A;  1U4L A;  2DNC A;  4V0B A;  1KQS A;  1I6H H;  4KV6 A;  1K3R A;  4A3B B;  4F88 A;  1EY6 A;  1UEB A;  3JAM E;  1F2L A;  4QB4 A;  2P5Z X;  1ASZ A;  2I07 B;  3MVV A;  4LF4 L;  4AQY L;  1JJG A;  1HUM A;  3DMU A;  2B2V C;  3DLL A;  4DAP A;  1JR0 D;  3CME A;  5DNF A;  3CRK C;  4EX5 A;  2A73 B;  4A3E G;  2BCO A;  3P1H A;  1U5K A;  3SDZ A;  4P72 A;  2R61 A;  3JAM L;  2A68 D;  1O7Y A;  2VL6 A;  4A3F G;  3KDF B;  4L5T A;  3S14 B;  2A6H C;  4QJF A;  4ODG A;  1STH A;  3TP6 A;  4JI0 Q;  5EQ0 A;  5DAU A;  1HQR D;  5C4X H;  2EYL A;  1EUJ A;  2A19 A;  1AZQ A;  1IZ6 A;  5KGU A;  1ZKO A;  3K0Y A;  2JA8 G;  2EYF A;  2BA0 A;  3S2H H;  4X65 L;  3HOW H;  2K4K A;  3NK9 A;  4YCV A;  4A3K H;  4DR4 Q;  5LL6 S;  2JEB I;  1Y14 B;  4DV1 L;  4RWS C;  1PMR A;  2NVQ H;  3J7A F;  5CMD A;  4BXX G;  3K59 A;  3AFQ A;  5FO7 B;  4FF3 A;  3LWU A;  2AUJ D;  1QZH A;  4JI7 L;  4XDX A;  3NWS A;  1O7L A;  2JA7 B;  5BR8 Q;  1NMG A;  1W3S A;  3TRE A;  1OXU A;  4K5X A;  3NWT A;  1K3B C;  3K8A A;  4DR1 L;  4NXN L;  2FFK B;  3EJI A;  2F0I A;  1SNM A;  5HGQ A;  1BBX C;  3NUC A;  5C44 B;  1GUN A;  4JOI A;  1G8Z D;  3J81 j;  1PVO A;  4IFD G;  5EBC A;  4H13 C;  5IY0 A;  1EEF D;  3M4Y A;  2R7Z H;  3E6Z X;  1KL9 A;  1O7Z A;  4KY6 A;  2JA5 G;  4PZ7 A;  1XMQ Q;  1SSO A;  1HHV A;  2Z8L A;  1JE5 A;  1YHB A;  2K6A A;  4PG3 A;  3DEP A;  4FF4 A;  1SNC A;  5BN3 A;  3HOU H;  1NUC A;  2WV6 D;  4JPB W;  3OOC A;  2R3Z A;  1Y1W H;  2XIW A;  3KLR A;  3I4N G;  3B6Y A;  3GP7 A;  3CC7 A;  4OIK A;  3P7J A;  2LSS A;  2IHF A;  5C6A A;  3CCE A;  4DR7 L;  4CDE C;  1VQD A;  2ID0 A;  2PQA A;  2Y0S G;  2E5L L;  1J9O A;  1SMY D;  1SAP A;  3TP7 A;  3HOY H;  1DXM A;  2NN6 I;  4R4O A;  1TWG H;  1K0S A;  3TS2 A;  3GTG B;  5KNB A;  2DJF C;  4ID6 A;  2VQF L;  1E7Z A;  1R4P B;  3HS0 C;  3PMF A;  3A5U A;  2IT1 A;  2K5W A;  4DAV A;  1HTP A;  4F7X A;  2PPB C;  1M4V A;  5ELN A;  1LTG D;  1B8A A;  4BBR H;  2K1B A;  1K8G A;  1UNS A;  1P8L A;  1HNX Q;  2Q2I A;  2K7V A;  1G6Z A;  5IOC A;  1TKW B;  2PW7 A;  3T16 A;  2RHQ B;  2A69 C;  3SE0 A;  2B2W C;  1Q8K A;  3DHQ A;  4YHH Q;  4A93 H;  2BE5 D;  2B2T C;  4HED A;  3M7G A;  4QUC A;  1KLU D;  3CCQ A;  1B4O A;  1D5M C;  3K58 A;  2K5H A;  3VYU A;  4DF7 A;  2QKI C;  1BQQ T;  1BF4 A;  4B3R Q;  4QIW B;  2R93 B;  3CXC A;  2F0U A;  2CQA A;  4ZYS A;  4B3S Q;  3MA2 B;  4GKJ Q;  1CHP D;  1SYF A;  4XTC S;  4H02 A;  3H6M A;  3D4R A;  4X3K A;  5FLX c;  2BA1 A;  1GUW A;  4LF6 L;  2HCC A;  3S1Q H;  3J80 c;  2VB2 X;  2LXJ A;  5IIF A;  4F8M A;  1VQH A;  4A3I G;  4Y52 H;  2D5D A;  4APV A;  3HOX B;  1EZ6 A;  3M3Y B;  4EVO A;  3V96 A;  2L15 A;  2PYK A;  4G7H C;  1ENA A;  3FVQ A;  5C0X H;  4CKC A;  4J15 A;  3J81 E;  4A3G B;  4LNQ A;  1NY4 A;  2PQA B;  3K0X A;  2WIN B;  5I9P A;  2FMC A;  2PNH A;  2ZJQ A;  2KHS A;  4JI5 L;  1EFI D;  3I55 A;  1EFW A;  4R8N A;  1YZ6 A;  2IWH A;  4C3H G;  1GO3 E;  1QB5 D;  3SK4 A;  1FNW A;  1JWM D;  2B2U C;  2J0T D;  3J81 L;  1BBU A;  1JQY D;  5EJW A;  4CGY B;  2E74 C;  2ZXR A;  2B63 B;  2E2I B;  1E1O A;  2D0P A;  2SEB D;  3MFG A;  4TSS A;  1JMC A;  1A0I A;  4DR2 L;  1XNQ Q;  1LV9 A;  1V1O A;  4BBS G;  1CZG A;  4FDB A;  5IGC A;  2GVB A;  1EWC A;  2I0Q A;  4LFA L;  2N8N A;  1G2T A;  2KA7 A;  3KYH C;  3GTJ H;  4DUZ Q;  5M3M G;  2ZT9 C;  3ND8 A;  5DLQ E;  3LGJ A;  3HKZ B;  3K5L A;  2EYJ A;  1DOL A;  3UDI A;  4ZCK A;  1HR0 W;  3S1M H;  4RCO A;  2PZT A;  2ZTE A;  1CQV A;  1LTR D;  1X3F A;  4RHR A;  5KEE A;  2UXD L;  2VS1 A;  2AQ3 B;  4JI8 Q;  1X9N A;  4C1N K;  1C0A A;  5LMU Q;  1D7Q A;  2CH4 W;  4JI1 Q;  2F0T A;  4IUR A;  2CVR A;  1GUT A;  3KLS X;  2UUC L;  2QW7 A;  2XSC A;  3ONA B;  4K5V A;  2F0E A;  5IWA L;  2MHV A;  3CQZ H;  2IX1 A;  1ET9 A;  2PI2 A;  2XNA C;  5FLM G;  1IBL Q;  3UDG A;  3HOZ B;  3H09 A;  4OO1 H;  4DA2 A;  1IL2 A;  2F4V L;  1VQB A;  5EGT A;  3FMC A;  3D6W A;  1I50 H;  5JAV A;  5C4Z A;  4A3J G;  3U58 A;  1XTD A;  2D62 A;  5I4D A;  2VUM G;  2VY3 A;  2AQ2 B;  3K7A B;  2CWP A;  1NTG A;  3PIO 3;  3CHB D;  1JCK B;  3OMC A;  4LUV A;  1FVI A;  1A63 A;  2TSS A;  1WOC A;  3H15 A;  1D2B A;  2G9D A;  1IL8 A;  2F1M A;  2YU9 H;  3ERO A;  3A74 A;  1IBK Q;  3GTQ H;  2K33 A;  1WCM H;  5ELB A;  4LF4 Q;  4X66 L;  4AQY Q;  2NN6 G;  3M7N A;  1Y1V B;  3I90 A;  1S5C D;  1VF7 A;  1SRU A;  3MXP A;  4HAE A;  1HNZ Q;  1DOK A;  3RLN A;  4G57 A;  2O5I C;  2OXP A;  2CW0 C;  2NWG A;  5EKI A;  3MEF A;  1B44 D;  2EIF A;  2BOS A;  3SHL A;  2JE6 I;  2G5D A;  5F2D A;  2JSO A;  1PZI D;  4A3E H;  2OTJ A;  4B3M L;  2E2J H;  2F0J A;  1V43 A;  3X3M A;  4OEL B;  1X55 A;  5IE8 A;  4X65 Q;  1K28 A;  1HR0 L;  1U4M A;  2B29 A;  1O78 A;  5L37 A;  4DV1 Q;  4Y7N H;  3PGZ A;  1F2Z A;  2JA8 H;  3JAM i;  3LNN A;  4DU9 A;  1CA5 A;  5I2Y A;  4IUQ A;  1EYA A;  3T1Y Q;  1PFS A;  1N8R C;  2MFI A;  4PMW A;  1YJ9 A;  3NEN A;  3CAM A;  2F0H A;  1A8V A;  4JI7 Q;  3KLW A;  4MNO A;  1SE2 A;  5M5Y B;  1UAP A;  4BXX H;  3PIO A;  3OIQ A;  1XMO L;  1D5Z C;  4HJ9 A;  1TWC B;  3I4M B;  4NXN Q;  1VS0 A;  5E4W C;  4KY7 A;  1VQA A;  2GN5 A;  5GRO A;  4GN5 A;  3A7A B;  1VQO A;  3KBG A;  3OHX C;  3M4P A;  1JB7 A;  4JV5 L;  1M8A A;  5M3F B;  4NXM Q;  3TBI B;  4KKT A;  3SK5 A;  1KDA A;  1KLG D;  1PTO C;  3H0G B;  5CR3 A;  4IFD H;  4BY1 B;  1EIH A;  1HH2 P;  1YHA A;  1VQ9 A;  2M9V A;  4ZKC B;  5C5L A;  1PTO F;  2JJQ A;  4A75 A;  3RN5 A;  3G48 A;  4RGN A;  1EL0 A;  3ICE A;  1JE4 A;  2WII B;  1G6P A;  1N34 L;  2L4N A;  4J1M A;  2E5L Q;  1WI5 A;  1OXS C;  1SE8 A;  3A8J E;  3ULP A;  1JOQ A;  3BZC A;  4M1U B;  4HR7 B;  1V9P A;  3I4N H;  5C4J H;  4A76 A;  3V2T A;  4CDC C;  4MHE A;  1PH8 A;  2EE1 A;  5JPN C;  2HIV A;  4BY7 H;  2JK8 A;  1BUV T;  1IKM A;  3PO3 B;  3Q24 A;  1XJV A;  5C3E B;  1NAP A;  3HZX A;  5GAE C;  3HRZ C;  1I4G A;  3PIP 3;  1QG7 A;  3AFP A;  2F0S A;  5ELD A;  4XQQ A;  1JT8 A;  4WJ4 A;  3NSW A;  1S5D D;  1QVF A;  4H7B A;  5JVH 3;  1PH4 A;  2B3G A;  1T5X D;  1F9P A;  1GUS A;  4JBK A;  4ME3 A;  4A93 G;  3F2U A;  3L3O C;  3EVQ A;  2AQ1 B;  2V1C C;  4P75 A;  2I5M X;  1C48 A;  2NVT H;  5NUC A;  4IPH A;  2EOT A;  4KHZ A;  1J5E L;  3CRL C;  1STB A;  2F3V A;  2PW5 A;  3MXG A;  2B39 A;  3J81 c;  4IOA A;  3BYY B;  4FYD A;  1QIL A;  3PUX A;  2MJ8 A;  2DY7 A;  3QR8 A;  1KAW A;  1R9T B;  1CUK A;  3DM1 A;  1HPC A;  2JP1 A;  3TZU A;  1MIU A;  3MAQ A;  1HUN A;  1VQL A;  1XTC D;  5C5M A;  3RUZ A;  5FO8 B;  2PZW A;  2XTI A;  4TKO B;  4DV7 L;  1Q8I A;  1SYC A;  5ELC A;  2N55 A;  4LF6 Q;  3I8Z A;  3EBE A;  4L63 B;  2A6E C;  2JA6 B;  2EXZ A;  1E22 A;  3GQB A;  1SLJ A;  4N9P A;  2EYM A;  3TRZ A;  4LWC A;  5EPK A;  3BS1 A;  1X3G A;  1TWH B;  1AZP A;  1A2U A;  4OX9 L;  5IT9 E;  4K2K A;  1W2B A;  1SR3 A;  4XYO A;  3NQI A;  1KNA A;  3CCS A;  4A3I H;  3PIP A;  5CV7 A;  1SYD A;  1CSP A;  1PTO H;  2LFN A;  3QOJ A;  5T1G A;  2PMZ E;  3GTL H;  1LTB D;  3M4O H;  4JI5 Q;  4O42 A;  5IT9 L;  3U50 C;  1MJC A;  4R4I A;  4DK1 A;  4TVA B;  4RGT A;  4L8J A;  5IYB H;  3C46 A;  1S72 A;  3PF4 A;  4JI6 L;  1SDF A;  4K6D A;  3GTK B;  1A6X A;  5IYD G;  3CD6 A;  3N52 A;  4C3H H;  5K5P A;  1SMY C;  4LFA Q;  4OEM B;  3TZD A;  3S1N B;  3H3V I;  1I4X A;  2ES2 A;  2JYO A;  3ND9 A;  3KJP A;  1D6E C;  3Q0A A;  4K8J A;  2XGT A;  5IP9 G;  3NBI A;  3PO2 B;  3J81 i;  5FOB B;  2UXD Q;  2EZV A;  5M3M H;  3NQT A;  1TR5 A;  2PMZ B;  2QDL A;  3PUV A;  4E6I A;  1IW7 C;  2XWB B;  1Q12 A;  2UUC Q;  1TWA H;  3CU7 A;  4HMJ A;  1L1O A;  4P71 A;  3C2P A;  2EJG C;  2B2V A;  2L12 A;  4L5Q A;  1QVC A;  4FF2 A;  5M5W B;  1H9R A;  2BE5 C;  2WP8 J;  2F4V Q;  2A5H A;  2R92 B;  2NVQ B;  2UUB L;  3OYY A;  5D3D A;  4DXG A;  5IGE A;  4KD3 A;  4QUF A;  1S5E D;  1PFM A;  2NBF A;  5FLM H;  1EU3 A;  3FHW A;  2FMM A;  4A3C G;  1HQM C;  5ELO A;  1N33 L;  3IFD A;  4IUP A;  3HOX G;  1IHZ A;  4K14 A;  1VQJ A;  2CKZ B;  4BA2 I;  3I73 A;  4H44 C;  4A3J H;  5H1S E;  2ZM6 L;  1H95 A;  2VUM H;  3NP8 A;  3CPW A;  3E3X A;  4OWW B;  5FO9 B;  4A3G G;  4A3D B;  4KKU A;  2WB1 B;  5EPJ A;  4KHP L;  1IYJ B;  4X66 Q;  2WFW A;  1SNP A;  2X6L A;  1JJC B;  4S3S A;  3SK6 A;  1CKM A;  4NDX A;  1DZ1 A;  1CA6 A;  3STB D;  2K75 A;  3CC4 A;  2RDF A;  2H5X A;  5CC4 A;  2E2H H;  2B63 G;  1BKB A;  5I9O A;  2NN6 H;  3K57 A;  2EY6 A;  1SFO H;  2K5D A;  3CCU A;  4NW2 A;  4IO9 A;  4B3M Q;  4U67 3;  1CHQ D;  3MXN A;  3VR4 A;  1OXV A;  3TP8 A;  4DR5 Q;  3C1E A;  3HKZ G;  4RHS A;  2RSO A;  3DWP A;  4DR3 Q;  5I6W A;  1J6Q A;  2F52 A;  2ATW A;  4H0L C;  1AE3 A;  1JIC A;  1CSQ A;  4B3T L;  3S16 B;  1KAB A;  1WTO A;  3GD7 A;  3X3N A;  4ALP A;  4Z9C B;  5C3W A;  3E9H A;  5CV5 A;  1EWH A;  3G6E A;  1B7Y B;  1L1O B;  3GV3 A;  3V05 A;  4IJH A;  4LJZ C;  2AHO B;  1EWI A;  1QZG A;  3IAY A;  1DJR D;  1K9M C;  3CPF A;  1XMO Q;  2UUA L;  3HOZ G;  3M9B A;  3BDC A;  2CCZ A;  1E3P A;  5E1F A;  4FXD A;  1YIJ A;  1WTR A;  1Y8N B;  1PH2 A;  4GS3 A;  1V1P A;  1F2M A;  1SXT A;  3UI2 A;  1K83 B;  1EY8 A;  4JK1 C;  5KRU A;  3QB3 A;  4JV5 Q;  1ENF A;  1PLF A;  1FR3 A;  1QUQ A;  4DV0 Q;  4LFC Q;  2JXM B;  4P73 A;  1SN8 A;  3OWF A;  3K5O A;  1S4Z A;  5IYC G;  3TDQ A;  3S1R H;  3FKI H;  4Q5V A;  1F9S A;  2Q8T A;  5K36 H;  4JVZ A;  5GQO A;  4C1N I;  2MQH A;  5J3B A;  2CFM A;  3A7L A;  1L2F A;  1Y1V G;  3KK7 A;  5DEH A;  4IPC A;  5G3L D;  2B2W A;  1N34 Q;  1D1K A;  4M8A A;  1TVX A;  1PH5 A;  2B2T A;  2CQO A;  3I56 A;  1HXY D;  3MTS A;  4HID A;  2D2C C;  4FF1 A;  4NP5 A;  4ZAI A;  4QCL A;  4DV5 L;  4BY7 G;  1KIX A;  2ALY B;  1YNJ C;  3CW2 C;  2L1B A;  4DKA C;  1PRT D;  1EQR A;  4RCN A;  3MXN B;  1VQI A;  5LMN W;  3S14 H;  3MHB A;  1I5F A;  5JJK A;  1K0R A;  3UDF A;  3VDY A;  1B2T A;  5EKL A;  3F1Z A;  5EKK A;  1ZXT A;  3G7L A;  4A4I A;  1VQK A;  4AYB E;  2HDM A;  4DV2 L;  2Q2T A;  4N8X 1;  2K03 A;  3W2D A;  3CCR A;  1B3Q A;  3HGB A;  1ET6 A;  2RCF A;  5E3F A;  1DON A;  1ONL A;  1EY4 A;  3VR2 A;  2QGQ A;  1AP0 A;  1E0B A;  4JOI C;  4KN7 C;  5M5X B;  2MUY A;  1J5E Q;  1KDC A;  1ML0 D;  4JG2 A;  2KBN A;  3I4M G;  2VB3 X;  1ZYR C;  2MP1 A;  4XQN A;  1V1P B;  2JA7 H;  2QCP X;  2WAQ E;  4UP9 A;  1YVC A;  5AFW A;  3PUY A;  3W1G A;  1QUQ B;  1TY0 A;  5HGT A;  5M3F G;  4N9T A;  1LTI D;  3G6J B;  4HN7 A;  3S15 B;  4DV7 Q;  1VF5 C;  1KNE A;  1LTL A;  3PUW A;  4UAI A;  5C44 H;  2FHT A;  3H0G G;  1LTS D;  2PQE A;  3S17 B;  4BY1 G;  4ZKB B;  1KDB A;  1QWY A;  4MIU A;  4TQU S;  1GVP A;  1Q82 C;  4A3M B;  5JOB A;  2DJG C;  3NEL A;  2X69 A;  1EQV A;  3BU2 A;  1X3P A;  3IL8 A;  4OX9 Q;  4DR6 L;  3U9O A;  2HQL A;  3NHH A;  3UE1 A;  4MZ9 A;  3CKI B;  2HD3 A;  5JVG 3;  2BDO A;  3BYT B;  5ELF A;  1Q81 C;  4C3I B;  5COR A;  1PYS B;  3ULL A;  2Q8I B;  3PQI A;  1XYI A;  3KOJ A;  1JWU D;  1I6V C;  4UDU C;  2OWO A;  5IYB G;  3HOV B;  2F03 A;  5LMN L;  4CBV A;  1BCP B;  5E7N A;  2Z0S A;  3H94 A;  1LYL A;  1B53 A;  3P20 A;  2BH2 A;  1LM0 A;  4J8Q A;  3SXH A;  5C3E G;  3OTO L;  4JI2 L;  4X3T A;  4OON A;  3G4S A;  1N36 L;  2L0C A;  3KF8 A;  1SBB B;  1S5B D;  1S40 A;  3GTG H;  2BDN A;  2K50 A;  1T5E A;  3UDX A;  4GLV B;  5AJ3 Q;  2QIL A;  5KIX A;  4X6A H;  2A6H D;  1OXT A;  1GUO A;  5A35 A;  1EIF A;  4FNF A;  3D0F A;  5FJ8 G;  5IYD H;  4RGM A;  5GAH C;  3FRP B;  4QL5 A;  5ELE A;  3OSO A;  3LWE A;  1TWF B;  2UU9 Q;  3RNU A;  3W3A A;  4K6L A;  1QOH A;  1R4Q B;  2HT1 A;  3QG1 A;  4PNY A;  4RAU C;  2AWN A;  5IP9 H;  1D5X C;  1X32 A;  2WAC A;  4A3F B;  4ZK9 B;  1GM5 A;  1N32 Q;  3Q8D A;  1X65 A;  2EDG A;  3MEH A;  1M90 C;  3JAM c;  3AQQ A;  1S5F D;  1PH3 A;  4ULL A;  4XT3 B;  1VQ4 A;  3ER0 A;  2F4I A;  2R93 H;  1EYC A;  3N6R A;  1CKN A;  3R2T A;  1I94 L;  3AYH B;  2KJX A;  2F0P A;  4LMQ D;  3SGI A;  2JA6 G;  2UXB Q;  1N33 Q;  4NKL A;  1A3T A;  3A56 A;  4LF8 L;  4GNX A;  2KCC A;  1C8C A;  4CHT B;  4HMI A;  2EYP A;  2ZM6 Q;  4P2C B;  4WFN 3;  3EQL C;  4A3C H;  1BBW A;  3MWY W;  4XYQ A;  1TS4 A;  1WTQ A;  4R4C A;  2MO0 A;  4DGZ A;  3HOX H;  3M3Y H;  1K73 C;  1C4Q A;  3Q23 A;  4MTK A;  1KRT A;  3RZD B;  1B9N A;  2Y0S E;  2UXC L;  1H9K A;  2QEJ C;  3S24 A;  3BZD B;  4A3G H;  3T53 B;  3R8B A;  3PCO B;  3PV0 A;  2OF1 A;  4RGO S;  2KQ3 A;  3E9I A;  4ZQ3 A;  3KFU A;  5CV6 A;  1STN A;  1SND A;  1DD2 A;  1CZW A;  2QDB A;  1SRO A;  3KF8 B;  4TRD A;  3GTM B;  3VR6 A;  3I2Z A;  2F0M A;  4B9W A;  2YTV A;  2KHI A;  4NPS A;  2JA5 B;  1PFB A;  4WJ3 M;  2K5Q A;  2E2I H;  2ZJP A;  2B63 H;  3IFT A;  1CK1 A;  2C5C A;  4I65 A;  4P74 A;  1RTO A;  4OWT B;  3WWV A;  4UPA A;  3SVM A;  4A3L G;  3PO2 G;  2Z9H A;  1W6K A;  1YJN A;  2RVL A;  3QWN A;  4X62 L;  3E0J A;  4PV1 C;  2HQE A;  2E75 C;  3C1F A;  5CV9 A;  1HZA A;  1BVS A;  2Y0S B;  3QO2 A;  4OWX B;  2NVY B;  2O2L D;  4FVM A;  1STE A;  4OIJ A;  4MN3 A;  3KF6 A;  2UUA Q;  4QMG A;  1E2W A;  2XRQ D;  4X3U A;  1YNN D;  3A55 A;  1SE3 A;  2A69 D;  4IN3 A;  1KTK A;  1L0W A;  1CKN B;  4XT1 B;  1UWV A;  4R4T A;  4DR1 Q;  1X54 A;  1LTA D;  4XQJ A;  2KEN A;  4GNX B;  2F0O A;  5IP7 G;  2HHH L;  3HOZ H;  1CT1 D;  4BS9 A;  2GA4 B;  2AMC B;  1HFG A;  4C2M B;  3FKI G;  1BCP D;  1QNU A;  5EAY A;  3MFY A;  5K36 G;  1HZ9 A;  3K7A H;  3QJY A;  1WTW A;  3NTH A;  2WB1 G;  4L5R C;  3IRB A;  4A3B G;  3HFZ B;  2E2D C;  3GTP B;  5IYC H;  1FJG L;  5CBE E;  1I3Q B;  3EIV A;  1NSN S;  1RHP A;  4DR7 Q;  3R2I A;  1TXY A; 
#chains in the Genus database with same CATH homology
 1Y1V H;  4DV5 Q;  4UP8 A;  2AWO A;  3CP0 A;  3PUV A;  2UUB Q;  3K80 C;  1Q12 A;  2UUC Q;  1TWA H;  3RN2 A;  1Y1W H;  3W5O A;  1L1O A;  1UE1 A;  4P71 A;  3HKS A;  3S15 H;  3I4N G;  3B6Y A;  1XMQ L;  3CC7 A;  4QY7 A;  4HJA A;  2D0O A;  4L5Q A;  1XPU A;  2LSS A;  1PV4 A;  2IHF A;  4POG A;  1QVC A;  2VQF Q;  3CCE A;  4UY8 C;  4DR7 L;  1VQD A;  2ID0 A;  2PQA A;  2WP8 J;  2Y0S G;  4BA1 I;  4EQ5 A;  3F2D A;  3E0E A;  3CCV A;  1EQQ A;  2E5L L;  2UUB L;  3S17 H;  3OYY A;  4GN3 B;  4K0K L;  3HOY H;  5JJI A;  1IBM Q;  2NN6 I;  2GVA A;  1Q7Y C;  4A3M H;  3RLO A;  4R4O A;  1TWG H;  5FLM H;  3CD6 A;  3FHW A;  1G51 A;  4DV2 Q;  2I5H A;  3H3V H;  3TS2 A;  4A3C G;  4KHP Q;  5ELO A;  1N33 L;  3J80 i;  1VQP A;  4GLA C;  4LF5 L;  4R1J A;  3D31 A;  3HOX G;  2VQF L;  4DV4 Q;  1VQJ A;  2CKZ B;  1E7Z A;  3BJU A;  3A5U A;  2IT1 A;  4BA2 I;  1X3E A;  4C3I H;  5JJL A;  1Q1E A;  2JQO A;  4A3J H;  3DM3 A;  5H1S E;  2ZM6 L;  3KF6 B;  1H95 A;  1WYD A;  2VUM H;  3CPW A;  4OWW B;  2K14 A;  5ELN A;  4A3G G;  2JA7 G;  4GKK L;  4KHP L;  3HOV H;  4L5S A;  1IYJ B;  1B8A A;  4BBR H;  1KD1 C;  1K8G A;  4X66 Q;  2WFW A;  2ZTC A;  1MJE A;  1JJC B;  4DNI A;  1P8L A;  1AH9 A;  5M5Y H;  2Q2I A;  3CCJ A;  1HNX Q;  4LF7 L;  3U4V A;  1CKM A;  2RHQ B;  4JI3 Q;  2EQS A;  1Q8K A;  2N78 A;  3OW2 A;  3STB D;  2K75 A;  1FL0 A;  4YHH Q;  3CC4 A;  4A93 H;  1VCI A;  1D8L A;  3CMA A;  3I4O A;  5C44 G;  1TWC H;  2H5X A;  3I4M H;  4YY3 Q;  2E2H H;  2OQ0 A;  2B63 G;  5C0X I;  1BKB A;  3CCQ A;  2ZTD A;  1KC8 C;  1SFO H;  2K5H A;  3CCU A;  4X64 L;  1RIP A;  4IO9 A;  3U4Z A;  4JBW A;  4B3M Q;  4B3R Q;  5M3F H;  1KXL A;  2PI2 E;  4B3T Q;  3CXC A;  4JI4 Q;  2NZH A;  1OXV A;  4LUZ A;  4DR5 Q;  5C4X G;  1TWF H;  1E24 A;  4GOP A;  3HKZ G;  1PH1 A;  4B3S Q;  3H0G H;  4GKJ Q;  2DGY A;  4XTC S;  4H02 A;  4DR3 Q;  3PSI A;  4BY1 H;  1J6Q A;  2F52 A;  3A5Z B;  5FLX c;  2BA1 A;  4IPD A;  4GNX C;  4LF6 L;  1AE3 A;  2ATW A;  3HOW G;  1CSQ A;  4B3T L;  1EYG A;  4JI0 L;  3S1Q H;  4A3F H;  3J80 c;  2EXD A;  5HY6 A;  4A3K G;  3GD7 A;  2LXJ A;  3I7F A;  4JYA Q;  1VQH A;  4ALP A;  2C35 B;  4DR5 L;  4A3I G;  1VQF A;  4Y52 H;  3F2C A;  4APV A;  2R92 G;  3E9H A;  3G6E A;  2L15 A;  1B7Y B;  1L1O B;  4PZ8 A;  4IJH A;  4DR3 L;  1VQ8 A;  4JBM A;  3W1B A;  2AHO B;  1EWI A;  4KI0 A;  1EOV A;  1PH9 A;  4LFB Q;  1QZG A;  1K9M C;  4DR4 L;  1YEZ A;  4J15 A;  3CPF A;  3OTO Q;  1XMO Q;  2UUA L;  4LNQ A;  4JI2 Q;  1NY4 A;  2PQA B;  3M9B A;  3HOZ G;  1N36 Q;  2CCZ A;  3K0X A;  3FP9 A;  1E3P A;  1AE2 A;  4DR2 Q;  2PNH A;  5GAG C;  1YIJ A;  1PH2 A;  4GS3 A;  1PH7 A;  2ZJQ A;  4JI5 L;  3ZJY C;  2QA4 A;  3I55 A;  3PO3 H;  1EFW A;  1YZ6 A;  2VZA A;  5C3E H;  4DV6 L;  1GO3 E;  2VQE L;  4GLX A;  4A3D G;  4JV5 Q;  1QUQ A;  4DV0 Q;  1BBU A;  4LFC Q;  5BR8 L;  2K5V A;  1E1O A;  2D0P A;  3G71 A;  1HNW L;  2YV5 A;  1A0I A;  1SN8 A;  4P73 A;  4DK3 C;  4DR2 L;  1JMC A;  1XNQ Q;  4BBS G;  4FDB A;  2GVB A;  5IYC G;  4OO1 I;  3RZD H;  3T1H L;  3S1R H;  2YTX A;  3FKI H;  2R7Z G;  2VNU D;  1O7I A;  2I0Q A;  4LFA L;  2N8N A;  5FJ8 H;  4DAM A;  2Z6K C;  5GQO A;  3KYH C;  2MQH A;  2N3S A;  2CFM A;  5J3B A;  4LFC L;  5M3M G;  3GTJ H;  4DUZ Q;  4DV0 L;  5DLQ E;  1XNR Q;  3LGJ A;  3ERS X;  1IXR A;  3HOU G;  1L2F A;  1Y1V G;  4IPC A;  3UDI A;  1HR0 W;  3S1M H;  1X6O A;  1NBW A;  2ZTE A;  1N34 Q;  1X3F A;  5IWA Q;  1PH5 A;  2R93 G;  1Y1W G;  3GTM H;  1Z9F A;  1C7Y A;  1VQ6 A;  1N9W A;  2UXD L;  2CQO A;  2VS1 A;  3I56 A;  4HID A;  4JI8 Q;  1X9N A;  1K8A C;  3STB C;  1C0A A;  5LMU Q;  1D7Q A;  2JA5 H;  2MNA A;  1XPR A;  4JI1 Q;  4DV5 L;  1I94 Q;  1R9T H;  1KIX A;  4BY7 G;  2ALY B;  2YTY A;  4DKA C;  3CW2 C;  2IY5 B;  4UP7 A;  1EQR A;  2UUC L;  3HOY G;  3MXN B;  1B70 B;  3M85 A;  1VQI A;  5IWA L;  5LMN W;  2IX1 A;  3CQZ H;  4A3M G;  4IJL A;  2PI2 A;  4GOP B;  3RZO H;  2RHS B;  3S14 H;  5FLM G;  1IBL Q;  1Q46 A;  3UDG A;  1I5F A;  3NBH B;  1PH6 A;  5JJK A;  1CKO A;  4O2D A;  1K0R A;  3UDF A;  1YNX A;  3VDY A;  2JA6 H;  3NEM A;  1IL2 A;  4JBJ A;  1VQB A;  2F4V L;  3F1Z A;  3BZK A;  1I50 H;  1YJW A;  4A3J G;  1IBM L;  1TWH H;  3U58 A;  2NVY H;  1XTD A;  2D62 A;  4A4I A;  1VQK A;  2VUM G;  2VY3 A;  3AEV A;  4AYB E;  4DV2 L;  2CWP A;  1NTG A;  3L7Z C;  2Q2T A;  4HJ5 A;  2R7D A;  1NMF A;  3PUZ A;  3HOV G;  1V1Q A;  3CCR A;  4BBR G;  4DV4 L;  1HZB A;  2OCE A;  2QGQ A;  4LUV A;  1FVI A;  1A63 A;  4JOI C;  3M4Q A;  2DUD A;  1WOC A;  1J5E Q;  3H15 A;  4JG2 A;  2YU9 H;  1VQ5 A;  2OQK A;  2KBN A;  1QVG A;  3A74 A;  3I4M G;  1IBK Q;  3GTQ H;  4QQB X;  1WCM H;  4LF4 Q;  4X66 L;  4AQY Q;  2NN6 G;  2JA7 H;  3M7N A;  2WAQ E;  3RLF A;  1VQN A;  4UP9 A;  1HNX L;  1M1K C;  1YVC A;  3PUY A;  1T9H A;  4YCW A;  4C2M H;  4JI3 L;  3W1G A;  1SRU A;  1HNZ Q;  1QUQ B;  3GTK H;  3RLN A;  4YHH L;  5M3F G;  3TQY A;  1HR0 Q;  4DV7 Q;  4YY3 L;  4DR6 Q;  3MEF A;  2EIF A;  1IBK L;  3PUW A;  1LTL A;  1L1O C;  2JE6 I;  4X62 Q;  5C44 H;  3S1N H;  3H0G G;  3TS0 A;  3KJO A;  3J7Z C;  3PF5 A;  4PZ6 A;  4BY1 G;  4A3E H;  2OTJ A;  4B3M L;  1A62 A;  3UE0 A;  1HNZ L;  2E2J H;  1C9O A;  4B3R L;  2Z6K A;  1V43 A;  4TQU S;  1GVP A;  4DV3 Q;  3GTP H;  1Q82 C;  4HIM A;  5IE8 A;  1X55 A;  1PA6 A;  4A3L H;  3NEL A;  4X65 Q;  2CWA A;  1HR0 L;  3BU2 A;  4JI4 L;  4OX9 Q;  3PO2 H;  4DR6 L;  2B29 A;  2HQL A;  1YIT A;  1I3Q H;  3UE1 A;  1UE7 A;  1YBY A;  4MZ9 A;  5LMN Q;  4HJ8 A;  1NJI C;  4B3S L;  4GKJ L;  4DV1 Q;  1Q81 C;  4DPG A;  3TEH B;  4Y7N H;  3PGZ A;  1GKH A;  2K5N A;  1PYS B;  2F3I A;  1KHI A;  4DUY Q;  3ULL A;  2JA8 H;  3JAM i;  1EIY B;  1HZC A;  3T1Y Q;  1LUZ A;  1PFS A;  5C0X G;  3KOJ A;  4AH6 A;  1N8R C;  4IFD I;  4DAY B;  2MFI A;  4O0A A;  4PMW A;  2OWO A;  4JYA L;  5C0X J;  1YJ9 A;  5IYB G;  4YWL A;  4C3J H;  3CC2 A;  3NEN A;  5LMN L;  3CAM A;  2A8V A;  1FGU A;  4NB3 A;  5E7N A;  3CCL A;  1A8V A;  2HIX A;  2YYZ A;  2Z0S A;  3KLW A;  4HIK A;  2HHH Q;  4JI7 Q;  1LYL A;  5M5W H;  1RL2 A;  4MNO A;  2R92 H;  4JC0 A;  2BH2 A;  1LM0 A;  4BXX H;  1WJJ A;  3K81 C;  3PIO A;  4LFB L;  2R6G A;  4OXP A;  3EN2 A;  5C3E G;  3T1Y L;  3OTO L;  1XMO L;  1PYB A;  4KLK A;  4JI2 L;  4LF9 Q;  4OON A;  3G4S A;  3L2P A;  4HJ9 A;  1N36 L;  1VQC A;  1VS0 A;  4NXN Q;  1S40 A;  3GTG H;  1P16 A;  2K50 A;  5IP7 H;  1VQA A;  2Q2U A;  1OTC A;  2GN5 A;  2RF4 A;  5GRO A;  4GN5 A;  1VQ7 A;  2JEA I;  3UDX A;  1U0L A;  1VQO A;  4GLV B;  1VQG A;  3CCM A;  5AJ3 Q;  4X6A H;  3M4P A;  3F2B A;  1E1T A;  1JB7 A;  1OXT A;  4JV5 L;  2NZO A;  1EIF A;  1YHQ A;  3D0F A;  5FJ8 G;  5IYD H;  4NXM Q;  5JEA G;  5GAH C;  1OXX K;  1FJG Q;  4QL5 A;  3GTO H;  4A3D H;  5JEA J;  3KDF A;  1XNQ L;  3A0J A;  3RR5 A;  2UU9 Q;  1VQM A;  3RNU A;  4A3B H;  4R4Q A;  5AJ3 L;  2HT1 A;  1HH2 P;  1YHA A;  2BH8 A;  4GOP C;  2FXQ A;  1VQ9 A;  1KRS A;  3F8T A;  4BBS H;  2AKW B;  2NVX H;  2F4V Q;  2AWN A;  5IP9 H;  4NXM L;  2JJQ A;  4A75 A;  3RN5 A;  4DUZ L;  4HJ7 A;  3G48 A;  4LUO A;  1GM5 A;  3Q8D A;  1X65 A;  1XNR L;  4YCU A;  1N32 Q;  2OTL A;  3ICE A;  2KHJ A;  2UU9 L;  4LF8 Q;  4RG1 A;  1M90 C;  3JAM c;  1G6P A;  1N34 L;  2WB1 E;  4AYB G;  4HIO A;  3AQQ A;  2E5L Q;  1WI5 A;  1OXS C;  1SE8 A;  2LXK A;  3ULP A;  1VQ4 A;  2MO1 A;  1PH3 A;  3ER0 A;  4K0K Q;  4XIG S;  3BZC A;  2R93 H;  4JI8 L;  1DGS A;  1V9P A;  5LMU L;  3I4N H;  4JI1 L;  5C4J H;  1CKN A;  4A76 A;  1Q86 C;  1I94 L;  1N32 L;  3AYH B;  3SGI A;  2JA6 G;  4OO1 G;  2UXB Q;  3GO5 A;  1PH8 A;  1N33 Q;  4LF5 Q;  4GNX A;  4LF8 L;  2HIV A;  4BY7 H;  2JK8 A;  2VW9 A;  4AIM A;  1XJV A;  4IPG A;  5GAE C;  2ZM6 Q;  2UXC Q;  1IBL L;  1JT8 A;  3AFP A;  2WAQ G;  3S16 H;  1G29 1;  1GD7 A;  4QGU A;  1YI2 A;  1XPO A;  4JCV E;  4A3C H;  4WJ4 A;  1BBW A;  2I5L X;  2UXB L;  4QIW E;  4GKK Q;  4R4C A;  3K7U C;  2MO0 A;  1QVF A;  1PH4 A;  2B3G A;  3HOX H;  2Q2H A;  3M3Y H;  1K73 C;  1SMX A;  1Z47 A;  1HJP A;  4JBK A;  1KRT A;  5IT9 c;  4ME3 A;  4LF7 Q;  4A93 G;  3S2D H;  2Y0S E;  2A1A A;  5GAD C;  2UXC L;  2ZJR A;  3S24 A;  2V1C C;  4P75 A;  1WCM G;  4A3G H;  2I5M X;  1ASY A;  2NVT H;  3PCO B;  3PV0 A;  2ASB A;  1I6H H;  3E9I A;  1KQS A;  4IPH A;  2R7F A;  4KHZ A;  3KFU A;  1J5E L;  1K3R A;  4PG3 A;  1UEB A;  3GDE A;  1SRO A;  3KF8 B;  4X64 Q;  1K83 H;  1ASZ A;  3I2Z A;  3J81 c;  4IOA A;  2YTV A;  3PUX A;  4LF4 L;  2KHI A;  4NPS A;  4AQY L;  1JJ2 A;  1JJG A;  4WJ3 M;  3DLL A;  1KAW A;  2ZJP A;  1Q1B A;  1CUK A;  2E2I H;  2B63 H;  3CME A;  1MIU A;  4IOC A;  4EX5 A;  4A3E G;  1VQL A;  1U5K A;  1UE6 A;  4P72 A;  2QEX A;  4P74 A;  3J7A 5;  4OWT B;  3WWV A;  4UPA A;  2VL6 A;  4A3F G;  2XTI A;  3KDF B;  4GN4 B;  4L5T A;  4DV7 L;  3PO2 G;  4A3L G;  4QJF A;  4LF6 Q;  3EBE A;  1YJN A;  4X62 L;  4JI0 Q;  2KCM A;  5C4X H;  1E22 A;  1SLJ A;  1EUJ A;  2A19 A;  2E8G A;  3TRZ A;  1IZ6 A;  4LWC A;  2JA8 G;  1HZA A;  1BVS A;  4DV3 L;  1WFQ A;  1X3G A;  4OWX B;  2BA0 A;  3S2H H;  4X65 L;  3HOW H;  4OX9 L;  2K4K A;  4YCV A;  4A3K H;  4DR4 Q;  1W2B A;  1SR3 A;  2JEB I;  1Y14 B;  3KF6 A;  4DV1 L;  2UUA Q;  3CCS A;  4POF A;  4A3I H;  4JI6 Q;  3PIP A;  2JA9 A;  4DUY L;  2NVQ H;  1PHJ A;  3PO3 G;  1CSP A;  4BXX G;  2IHE A;  1L0W A;  3HKZ E;  2PMZ E;  3GTL H;  1UE5 A;  1CKN B;  3M4O H;  1UWV A;  4JI5 Q;  3AFQ A;  4R4T A;  4DR1 Q;  1X54 A;  4DV6 Q;  3U50 C;  1MJC A;  2VQE Q;  2KEN A;  4R4I A;  4GNX B;  1QZH A;  1NE3 A;  2IX0 A;  4TVA B;  4MTN A;  5IP7 G;  2HHH L;  4JI7 L;  3HOZ H;  5IYB H;  5BR8 Q;  1S72 A;  3PF4 A;  4JI6 L;  2AMC B;  1HNW Q;  4DK6 C;  1NMG A;  1W3S A;  3FKI G;  4YWK A;  3TRE A;  3HOU H;  5EAY A;  3CF5 A;  2K52 A;  1OXU A;  2RCN A;  5K36 G;  5IYD G;  4LF9 L;  1HZ9 A;  3K8A A;  3L0O A;  4C3H H;  4DR1 L;  3T1H Q;  3K7A H;  4RMF A;  4LFA Q;  4NXN L;  3JC6 6;  2WB1 G;  5HGQ A;  1MKH A;  4L5R C;  4JOI A;  3ULJ A;  3J81 j;  3H3V I;  1X56 A;  3IRB A;  4A3B G;  4YWM A;  3HFZ B;  4IFD G;  1PVO A;  2ES2 A;  2KCT A;  5IY0 A;  3KJP A;  4IFD J;  5IYC H;  5M5X H;  2XGT A;  5IP9 G;  2R7Z H;  1FJG L;  1KL9 A;  3J81 i;  2JA5 G;  4PZ7 A;  1XMQ Q;  1S3O A;  2UXD Q;  4LW1 A;  5M3M H;  3EIV A;  1JE5 A;  2N49 A;  1YHB A;  4DR7 Q;  1TXY A;  1VQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...