4LF5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf5Q00
1NMFA 2BH8A 3T1HQ 3MXNB 1T9HA 2NZHA 4GLVB 3K81C 5BR8Q 4DNIA 3CCVA 3U50C 2VUMH 4JBJA 5M3MH 2Q2IA 1EQQA 2UXCL 5JJLA 4HJAA 1XMOL 3G71A 4GN3B 5HY6A 1PH4A 4UP8A 1VQ5A 3TREA 3PV0A 2PQAA 2YV5A 1XMOQ 3GTOH 2R93H 2AWOA 4A3BH 1G291 2WAQE 1Y1WG 2GN5A 3UE0A 1VQ8A 2V1CC 3AFQA 4PZ8A 1UEBA 1VQJA 1PV4A 3HOWG 3S2HH 4X6AH 2NN6I 2I0QA 3DM3A 1L0WA 5LMNW 3J7A5 3KFUA 1UE1A 3PUWA 4DUYL 2Q2HA 3BZKA 4BBSG 4DV4Q 1K73C 4NXML 3TEHB 3F2BA 5IP9G 1X56A 3PF4A 1D7QA 1Q7YC 1JJCB 1NJIC 1QVFA 3LGJA 4AYBG 4DUYQ 4POGA 2R6GA 5IE8A 4BBRG 4NXMQ 1YJWA 3JAMi 2L15A 3I4NH 2K4KA 2KHJA 1Q46A 3BU2A 4HIOA 2LXKA 1AE2A 2VNUD 5M5WH 1A8VA 1SN8A 1NBWA 4L5QA 5M5YH 1KL9A 1XTDA 1HR0W 4DR7Q 1K9MC 2WB1G 1TWHH 1X55A 1N34L 3NELA 2JA5H 1QUQB 1KXLA 4IOAA 1SLJA 2E8GA 4UP9A 4JI0L 3CPWA 4JI6L 3GTKH 2JA7H 3CC7A 5K36G 1NE3A 2PI2A 1N34Q 1C9OA 4MZ9A 1WFQA 1Y1VH 3JAMc 3RLNA 2A8VA 4JI0Q 4JI6Q 1W2BA 3GTJH 3AYHB 1L1OA 1KIXA 2B63H 1B7YB 3ULPA 5GAGC 4YHHL 1XJVA 4YCUA 1VCIA 5GROA 4A3GH 1Z9FA 3CPFA 1JE5A 1D8LA 2E2IH 4IO9A 3CCUA 4YHHQ 1H95A 4QY7A 3HOXG 3ICEA 4JYAL 2JEAI 1KRSA 4A3CH 3J81i 2ZTCA 3S15H 4QL5A 1WI5A 4R4QA 5IYCH 3FP9A 5H1SE 4IOCA 2Z6KA 3PO2H 3A0JA 2MNAA 4BY7H 4JYAQ 1LTLA 2I5MX 4JOIA 4C2MH 3S1QH 4L5SA 1YHQA 3U4VA 4HIMA 2OTJA 4LWCA 4GKJL 1B8AA 3DLLA 2UUCL 3K0XA 5AJ3L 1VQHA 4IPDA 4A75A 4R4CA 3H3VH 1X9NA 4GKJQ 4NXNL 5C0XG 3KJPA 3W5OA 3KLWA 4HJ7A 3HOUG 2UUCQ 2VQEL 5AJ3Q 5JEAG 3HKZG 3Q8DA 2QEXA 4HJ8A 3J81c 4A3EG 2PQAB 3FHWA 3CAMA 4BY1G 1VQOA 1FL0A 4LF8L 3HOZG 5GAHC 2N3SA 2VQEQ 5C0XJ 1V9PA 2UUAL 2YTYA 1W3SA 4TQUS 4AH6A 4DAYB 5C4XH 3NBHB 4OONA 1BBUA 4JCVE 2K50A 5JEAJ 4LF5L 4R4IA 4JI3L 4LF8Q 2Z0SA 4A3LG 1E3PA 1WOCA 4P74A 2UUAQ 1M1KC 1VQ9A 2OQ0A 1QUQA 4FDBA 4LF5Q 2Y0SE 4UPAA 2BA1A 1TWGH 2D62A 3PUZA 3PSIA 3UDFA 4JI3Q 2JA8H 3UDGA 3K7AH 3KDFB 4B3RL 3H0GG 1IZ6A 1I94L 5M3FG 4A76A 5E7NA 2N49A 1WCMG 1SFOH 4B3RQ 4DR2Q 1M90C 2NN6G 1EIYB 2R7FA 4R4OA 1Q86C 4B3MQ 3K8AA 3M3YH 3HOWH 1HNXL 1AE3A 1KAWA 4P73A 3SGIA 3UDXA 4PZ6A 4A4IA 1FVIA 5C3EG 3UE1A 4AIMA 4BBSH 4Y52H 3ULJA 2ZJPA 4WJ4A 1X3GA 5IP9H 4YY3L 1HNXQ 3TS2A 5ELOA 3S16H 1LM0A 5J3BA 4UP7A 1X65A 1E1OA 4BBRH 1L1OB 3HKZE 4YY3Q 1Y14B 4NPSA 3A74A 3AEVA 4LFAL 2OCEA 3A5UA 2CKZB 4DR4L 1N32L 1Q81C 2YYZA 4JBWA 2WFWA 3W1GA 3EIVA 4IJLA 4ALPA 1BVSA 1XPRA 1OTCA 3CMAA 1N8RC 4LFAQ 3STBC 3KF6B 1GO3E 4YCWA 3S24A 2VY3A 1QZHA 3M4OH 4DR4Q 1N32Q 4DV0L 2KCMA 4GN4B 1YI2A 3AQQA 3M4PA 4LUZA 4PG3A 2QA4A 1X3EA 3I2ZA 2RF4A 4DV4L 5IYDG 4X64Q 4DV0Q 1KD1C 2IY5B 2HIVA 2Q2TA 1NMGA 2A19A 3EN2A 1K8GA 4A3DG 1R9TH 5IP7G 3KF8B 2BH2A 3S2DH 1Q1BA 4DV1Q 2NVXH 1MJEA 1YJ9A 1XNQL 2KENA 1RIPA 3E9IA 3GTMH 1OXTA 5IY0A 3KDFA 4KHPQ 2E5LL 3HOXH 4LFBL 4DR7L 2VL6A 1VQAA 5ELNA 2R92G 4J15A 1UWVA 1XNQQ 3FKIG 3RLFA 4DV3L 2R7ZG 2PMZE 1E22A 1HZCA 1EWIA 5LMUQ 2E5LQ 2NVTH 4LFBQ 4A3MG 1WJJA 3W1BA 3ULLA 4R4TA 1VQ6A 1N36L 2K14A 1YEZA 4DV3Q 4KI0A 4GN5A 4JI2L 4DK3C 1SMXA 2BA0A 1P16A 1PH5A 1N36Q 4GOPB 3S14H 5C44H 2ES2A 1Q1EA 5FJ8H 4HJ5A 4X65L 4GNXC 1IXRA 3KJOA 1UE6A 4QIWE 4JI2Q 3TQYA 3HOUH 5JJKA 1BBWA 1IBLL 3CD6A 5IYBG 1XNRL 4IJHA 3RN5A 2WP8J 1G6PA 4A3EH 3GD7A 3ZJYC 4X65Q 4L5TA 4BY1H 4JI5L 1KHIA 2Y0SG 5GAEC 4PZ7A 1CUKA 2KBNA 3HOZH 3E0EA 4LFCL 1IBLQ 5M3MG 4C3HH 1XNRQ 4JC0A 1IBKL 2ID0A 3S1NH 3ER0A 1MKHA 1Q12A 5GQOA 1X6OA 4JI5Q 2CCZA 4LFCQ 4OO1I 3KF6A 4OWTB 3CCSA 1GD7A 1PHJA 1IBKQ 1RL2A 4GLAC 3J81j 1FJGL 2R93G 4A3BG 1I5FA 1CSQA 1S3OA 3RR5A 3PUYA 1I50H 4AQYL 3PF5A 1C0AA 1L1OC 1L2FA 1FJGQ 4BXXG 1NTGA 2RHSB 1VQDA 1V43A 3CCRA 4A3KG 3MEFA 1Z47A 3VDYA 5M3FH 4A93G 4AQYQ 3CCLA 1WCMH 4P75A 3HOYG 1KRTA 2K5VA 1LUZA 2C35B 4P71A 1TWCH 1VQPA 2E2JH 1CKNB 4DKAC 4DR6Q 1EOVA 1JMCA 3H15A 3HKSA 2JEBI 4R1JA 1VQKA 5C3EH 2JJQA 2UUBL 1UE5A 4A3FG 3D0FA 2Z6KC 1PH9A 4IFDJ 1K83H 1X3FA 1YZ6A 2LSSA 2LXJA 3HOVH 1OXXK 4PMWA 5FLMH 3GTPH 4IPGA 2UUBQ 1HZ9A 1XPOA 1LYLA 2YU9H 3HFZB 2F3IA 4BY7G 2D0PA 2JQOA 3GTGH 4K0KL 2F4VL 1VS0A 1A0IA 2ZTDA 2ZTEA 1QZGA 5IT9c 4QQBX 3K80C 4GOPA 2YTXA 2F52A 2K52A 4LUVA 4ME3A 1KQSA 1N9WA 1XPUA 4K0KQ 2F4VQ 1Y1VG 2VW9A 4JI1Q 4DR2L 3I4MG 3L7ZC 4JBMA 1YBYA 3B6YA 4DR3Q 2ATWA 2FXQA 4JI4L 2B63G 3GTLH 5JJIA 2N78A 3F8TA 1Y1WH 3EBEA 3JC66 3PGZA 1OXSC 2XTIA 3OTOL 2ZM6L 1IBML 4A3GG 4LF7Q 4B3TQ 2HT1A 4L5RC 4JI4Q 4IPHA 5IYDH 4YWLA 4IFDI 3L0OA 1CKMA 2HQLA 3OTOQ 2ZM6Q 2AWNA 1IBMQ 1OXUA 1VQCA 5EAYA 4A3DH 5IP7H 1HNWL 2ASBA 3TS0A 2PNHA 1HZAA 4JI7Q 2CFMA 3U58A 1VQIA 2OQKA 1HJPA 4HIKA 1HNWQ 2CQOA 1SROA 3M85A 2VQFQ 2HHHL 4DR1Q 2Q2UA 1VQNA 2R92H 4JV5L 4A3IG 3FKIH 4MTNA 2JA6G 4OWXB 4RG1A 3GDEA 2VZAA 2HHHQ 1JJGA 3PO3G 3CCJA 4JV5Q 2H5XA 1CKNA 1IL2A 2I5HA 4LNQA 2A1AA 4JI8L 5DLQE 1S72A 4DUZL 3CCQA 2ZJQA 4C3JH 1V1QA 2MO1A 1NY4A 1U5KA 4RMFA 4X64L 4LF6L 4C3IH 2EQSA 2EIFA 2QGQA 3A5ZB 3CCMA 4DV7Q 1IYJB 1VQMA 1YHAA 4JG2A 4DPGA 4JI8Q 3S17H 4DUZQ 3U4ZA 1B70B 5C4JH 4DV1L 1G51A 4GKKL 3F2DA 3M9BA 2KHIA 4QJFA 5IYBH 3OW2A 4LF6Q 1Q82C 4DK6C 4A3JG 3T1YL 1GM5A 3STBD 4Y7NH 1JB7A 4XTCS 4GKKQ 4HIDA 4KHPL 2JA9A 1E1TA 2OTLA 3CQZH 1ASYA 1J5EQ 2JA8G 4B3SL 1EIFA 4OO1G 2NZOA 3WWVA 2AHOB 3T1YQ 4WJ3M 2IX0A 5LMUL 3IRBA 1I3QH 1E7ZA 2UXCQ 4EX5A 4B3SQ 2UXBL 2CWPA 1EFWA 3UDIA 4X62L 3CP0A 1VQGA 4BXXH 2UXBQ 4A3KH 1TWAH 4LUOA 3H3VI 4A93H 1PYSB 1VQFA 4H02A 4X62Q 4IPCA 1CKOA 3PUVA 3HOYH 3S1MH 1YVCA 4DV2L 4GNXA 1JT8A 3NEMA 3NENA 1TXYA 2K75A 4A3FH 4O2DA 4P72A 4OXPA 2EXDA 4DV2Q 3KYHC 4MNOA 2B3GA 2VUMG 1I6HH 3CC2A 2R7DA 2IHFA 1TWFH 2UXDL 4O0AA 5LMNL 2XGTA 2MQHA 3I55A 4UY8C 3D31A 3BZCA 4KLKA 1A62A 4OWWB 4A3LH 1S40A 1U0LA 4EQ5A 1PA6A 1E24A 2UXDQ 1VQ4A 1SRUA 1PVOA 5LMNQ 4LW1A 1EQRA 2NVYH 3CXCA 3CF5A 1PYBA 3TRZA 3RNUA 3I56A 2DUDA 2MO0A 2PI2E 1XMQL 1BKBA 3H0GH 3I4MH 1MJCA 5HGQA 5FLXc 4LF4L 1Q8KA 4TVAB 4GS3A 3RLOA 2MFIA 3CW2C 1HR0L 4DR6L 1PH1A 3L2PA 1XMQQ 1PH6A 4OX9L 3GTQH 4IFDG 1ASZA 2N8NA 3PUXA 4X66L 3J7ZC 3PIOA 1HNZL 4LF4Q 4YWMA 4APVA 2B29A 1HR0Q 4DV5L 1YNXA 3OYYA 4OX9Q 2VS1A 1YHBA 3I4NG 1HNZQ 4X66Q 2K5HA 4JOIC 5M5XH 3KOJA 2ZJRA 4DV5Q 1GVPA 4B3ML 2YTVA 1PFSA 4AYBE 3BJUA 1VQ7A 5IWAL 3CCEA 2JA5G 2K5NA 4YCVA 1HH2P 1HZBA 4JI1L 1O7IA 4A3IH 1QVCA 1JJ2A 1QVGA 2RCNA 1VQLA 1CSPA 1SR3A 3I7FA 3K7UC 5FJ8G 5C44G 2JA6H 4DR3L 2JA7G 3ERSX 2JE6I 3I4OA 5IWAQ 3PO3H 3RZDH 1C7YA 2WB1E 3E9HA 1DGSA 3PIPA 4LF7L 1EYGA 4B3TL 1YJNA 4NXNQ 3S1RH 1K8AC 4BA2I 3J80i 1P8LA 3CMEA 2AMCB 1PH3A 1N33L 3CC4A 3GO5A 2DGYA 3M4QA 2GVAA 3RN2A 4JI7L 2ALYB 3G4SA 4A3JH 3RZOH 4GOPC 1VQEA 2I5LX 2KCTA 1N33Q 4A3CG 2WAQG 2VQFL 1WYDA 2RHQB 5IYCG 1J6QA 1YIJA 4YWKA 4DR1L 1KC8C 2AKWB 4DV6L 1PH2A 4XIGS 1PH8A 1EUJA 2OWOA 4GNXB 2IX1A 3PO2G 1AH9A 3G48A 1K3RA 1SE8A 2CWAA 1YITA 1A63A 4DV6Q 3J80c 2IHEA 2IT1A 5GADC 4HJ9A 4GLXA 1PH7A 2R7ZH 3F1ZA 4NB3A 4LF9L 3M7NA 4A3MH 1FGUA 2NVQH 1I94Q 1UE7A 3F2CA 4DV7L 4QGUA 4DAMA 2E2HH 1GKHA 4DR5L 2UU9L 4LF9Q 3G6EA 5C0XI 4POFA 2GVBA 3HOVG 4BA1I 3T1HL 2HIXA 4JBKA 4KHZA 4DR5Q 5C4XG 2JK8A 2UU9Q 5FLMG 1X54A 2D0OA 5BR8L 1K0RA 1OXVA 3PCOB 3AFPA 1J5EL 1VQBA 1MIUA
chains in the Genus database with same CATH superfamily
3GV6A 3T1HQ 3MXNB 2NZHA 1LV9A 3K81C 4ODGA 1SYBA 4DNIA 3CCVA 3U9SA 1PTOF 2Q2IA 5JJLA 4HJAA 1TU2B 4EQOA 5HY6A 4UP8A 1D5MC 4DGZA 1XMOQ 2YV5A 5JJZA 1DYQA 3A54A 3UE0A 1PFMA 4AYBB 3J80E 2AUJD 3NBHA 4X6AH 1H9MA 1E0BA 4DUYL 4BBSG 1K73C 4NXML 2B2TA 4IFDH 5IP9G 1X56A 1Q7YC 1NJIC 1QE6A 4FO2A 3LGJA 2RA4A 2A5HA 1Q46A 4M1UB 3MTSA 1A8VA 3SK6A 1UEAB 2BCOA 2B2WA 3NELA 1SLJA 1MSHA 4UP9A 3GTKH 1PMRA 4JI6L 2JA7H 2NUCA 4FF3A 1DM0B 1KAAA 1N34Q 2DNEA 1C9OA 2A8VA 3A56A 3GTJH 3BYTB 4OIJA 1XYIA 3D4DA 3ULPA 5GAGC 4YHHL 2WKCA 5LHY1 1JE5A 1MD2D 3A8JE 1WTVA 4GZYC 1L0XB 1H95A 3HOXG 4ZYSA 1E2ZA 1KRSA 4QF4A 2JEAI 4J6HA 4CGYB 3J81i 4X3UA 2G9DA 5IYCH 2B2VC 4JYAQ 2MNAA 3S1QH 1IW7D 3U4VA 4NKLA 1B8AA 1U4LA 3G7LA 4ZQ3A 3T4AC 2HQEA 1VQHA 5EQ0A 4R4CA 4GKJQ 3KJPA 3KLWA 1GUOA 1TS4A 5AJ3Q 5JEAG 3Q8DA 1VQOA 3CAMA 4BY1G 2NBFA 2C5CA 3KBXA 2N3SA 4C3HG 2UUAL 4DAYB 1AZPA 1GUNA 3NBHB 1BBUA 2DN8A 3DUZA 5CR3A 3MZ5A 1I4RA 1WTHA 2KVMA 4OIKA 1SNOA 1SYEA 3J7YW 1QUQA 1TWCB 4LF5Q 2Y0SE 4UPAA 1TWGH 3PUZA 2SEBD 3UDFA 4B3RL 3H0GG 3R8BA 4XXEA 2OT2A 1I94L 2F0VA 2PZUA 3BVMA 3DXJC 1A3VA 3NTHA 5E7NA 2N49A 3NWTA 1M90C 2KOLA 3GTPB 1Q86C 1AZQA 2B2UC 3M3YH 3HOWH 1Y8NB 4B9XA 1AE3A 1KAWA 5C3EG 3VR6A 1EL0A 3ULJA 1G91A 4YY3L 1LTGD 3S16H 1X65A 4CJ1B 1JR0D 3GTLB 3KLRA 1A6XA 3AEVA 2OCEA 3A5UA 1PTOD 1L0YB 1D1IA 3AMUA 4BBSB 1GO3E 4CKBA 3M4OH 4DR4Q 2K28A 4F8MA 1PYWD 2KCMA 3AQQA 4KY5A 4L63B 4X64Q 1KD1C 2L11A 3EN2A 2A19A 4RA8A 1V1PB 4U68A 2BH2A 4KY7A 2NVXH 1YJ9A 2K5QA 5A2QE 1RIPA 3A8IE 3GTMH 3Q23A 4C3JB 1EEFD 2E5LL 4KHPQ 1O7ZA 3FKIG 1CA5A 2XVSA 2R7ZG 5C4JB 5EKKA 2EY5A 1Q8IA 4LFBQ 1N36L 2K14A 1I4GA 2F0HA 4DV3Q 2J7ZA 4G4KA 4Y7NB 1CHQD 5LL6X 2B2TC 4DK3C 1SMXA 2XSCA 4GOPB 2ES2A 1Q1EA 4H0LC 1UE6A 5JJKA 2KUMA 1IBLL 3RN5A 1G6PA 4A3EH 2FINB 1WD0A 4L5TA 2ICEC 3PMFA 5GAEC 4UDUC 3HOZH 3E0EA 2NTSA 1ML0D 2B2WC 4DAVA 4JI5Q 1X6OA 4LFCQ 1AEXA 3KF6A 4OO1I 1FJGL 1DONA 1S3OA 3RR5A 1STBA 3PUYA 3PQIA 4AQYL 2C9OA 1NTGA 1EIHA 1RCVD 5M3FH 1I6HB 2XRQD 1TWFB 2PO4A 1LUZA 1I4QA 2C35B 1HFNA 5LL6S 4RH6A 3HKSA 1VQKA 2NVYB 5DAUA 2IJ0A 5I4DA 1X3FA 1YZ6A 3HOVH 1XXGA 3H0GB 4PMWA 4HSVA 2UUBQ 2YU9H 1LYLA 2F3IA 4K0KL 1KLGD 4L8JA 1HUMA 4IUPA 3GTQB 2ZTEA 2ZTDA 2EDGA 5IODA 1A3UA 4QQBX 1B53A 2F52A 4ME3A 1XPUA 1GJXA 2HUGA 2F4VQ 2F0EA 1QG7A 5IIFA 5C3EB 3I4MG 2Q8RE 3MAQA 2ATWA 4JI4L 2EXZA 3QOJA 3QO2A 2N78A 1FD7D 3PGZA 1OXSC 3HP3A 4LF7Q 3GTGB 2WACA 4IFDI 4RGOS 4A3IB 4XT1B 2ZM6Q 1IBMQ 1F77A 4A3DH 1HNWL 1HZAA 3C1FA 4K8JA 5A2QL 4HIKA 4XQQA 4ZK9B 1PZJD 3M85A 1VMCA 2VQFQ 2KCNA 1EY8A 1KNAA 4MTNA 2JA6G 4OWXB 2HHHQ 1UNSA 2VZAA 3NE5B 1JJGA 3PO3G 2D5DA 1CKNA 1BCPC 4LNQA 1S72A 1NY4A 4RMFA 1VQMA 2EIFA 4JG2A 4JI8Q 4KV6A 3U4ZA 1B70B 2PZTA 1BCPF 2KHIA 5ELFA 4LF6Q 1GM5A 1JB7A 2R7ZB 2JA9A 1E1TA 3CQZH 1ASYA 2NZOA 3WWVA 1Q3LA 1WTRA 3T13A 4F7XA 1DD2A 4B3SQ 3VYUA 2FMMA 4X62L 1VQGA 1JE4A 4A3KH 4H02A 4PMBA 1CKOA 1LLRD 2F3WA 2QF7A 4GNXA 2AQ1B 1JT8A 2QCPX 5FOBB 1RKNA 2K75A 3JAML 1LT5D 1VF7A 4P72A 4OXPA 2CHBD 3CC2A 4F87A 3EA6A 1TWAB 3VA7A 1MI2A 1HA5A 4ILWA 1A62A 4EQ5A 5DM63 3C3LA 1PYBA 3TRZA 1T5EA 3RNUA 4JPBW 3I56A 2B39A 1BKBA 3FEWX 1E2VA 1MJCA 4HR7B 4GS3A 1R4PB 3RLOA 4DR6L 1ASZA 4ZAIA 3I90A 2Z4IA 3SVMA 4DV5L 3GTKB 2VS1A 1YHBA 2MUYA 2JA7B 3FPUB 1SXTA 2ZJRA 3CRKC 1YNNC 3M4YA 1TS3A 1FGBD 3Q0AA 4JI1L 2F0OA 1HH2P 1HZBA 4YCVA 1VQLA 2NZ1D 4B3MQ 2EY6A 1CSPA 3K7UC 2BE5C 4K5XA 5CC4A 1EY9A 1EYCA 1CQFA 1J8IA 1K8AC 4KTAA 1PH3A 2M2LA 5EBDA 2ZXRA 1ESRA 3GO5A 1C48A 1EY5A 2JA6B 1N33Q 1H9RA 1V8QA 1KC8C 4DR1L 3PO2G 4R9WA 4GNXB 3G48A 2D2CC 2LMCB 1IKLA 1SE8A 4V0BA 4ZKBB 1GUGA 3NSWA 2PZWA 4OGQC 3F1ZA 1K8OA 3OW7A 3M7NA 4A3MH 3M7GA 1I94Q 5IGEA 4DV7L 1I4XA 4QGUA 4PMCA 1WD1A 1GHKA 2EJMA 1GHJA 2UU9L 4ZRZA 3HOVG 4HCSA 4JBKA 4K2LA 5BR8L 4DAPA 1STAA 1BCPD 1S5CD 2HCIA 1T9HA 2RSNA 4IUTA 4K5VA 3U50C 2VUMH 4JBJA 5M3MH 1DOMA 1HCZA 1PZKD 1T5XD 3M3YB 3HOWB 1PH4A 3H91A 3NHHA 1VQ5A 1VMPA 3OWFA 3GTOH 2AWOA 1G291 2WAQE 3WOFA 2GN5A 2ZXOA 1QOHA 1D1KA 1VQJA 2I0QA 1L0WA 3KFUA 1UE1A 2WKDA 2Q2HA 1X3QA 1NCVA 2F1MA 1GUSA 3F2BA 1D7QA 4N9PA 1JJCB 4NW2A 5JVH3 1QVFA 4AYBG 4POGA 4ABNA 3E6ZX 4BBRG 3M4OB 1YJWA 1K0SA 1SYCA 3MFYA 3JAMi 5CV4A 4RWSC 3KUPA 2AQ3B 4EGVA 2EYLA 2F3VA 4HIOA 2VNUD 1SN8A 3HG9A 1NBWA 1HR0W 5CBEE 1FR3A 5KNBA 2F0SA 1SE2A 5KYLA 1X55A 3R93A 2JA5H 2NVXB 4IOAA 2E8GA 3D6CA 4JI0L 2CQAA 3CPWA 5K36G 3K5OA 3GTMB 2L9HA 2PI2A 3T53B 4EVOA 3AYHB 1L1OA 5CMDA 1KIXA 5G3LF 1B7YB 2BDOA 1VCIA 3CPFA 1ET9A 2KQ3A 2E2IH 4IO9A 3ICEA 1II3A 3V96A 3IL8A 3S15H 1WI5A 3MWYW 3FP9A 3LNNA 1LTLA 4UHVA 4YIJA 4A3EB 1A2UA 2H1EA 2OTJA 2RDGA 3HOZB 5D3DA 1ZYRD 1AFPA 3KF8A 1G2TA 4IPDA 4A75A 2KJXA 4I7AA 2L5TA 3H3VH 3W5OA 2K1BA 1BO0A 2UUCQ 2VQEL 3MEHA 1YNND 2QEXA 4ZLTF 4HJ8A 3J81c 3BVZA 1A3TA 3TP6A 3PO2B 4TKOB 5GAHC 5C0XJ 2E74C 4TQUS 2BE5D 5C4XH 5M3FB 4LF8Q 2Z0SA 1VQ9A 1I4HA 4FDBA 4K2KA 1WTOA 1CZGA 2BA1A 4EQPA 1QNKA 4JI3Q 3UDGA 1SNMA 4HCEA 1MGSA 4H44C 3HOVB 2K5DA 1Y8OB 4K5WA 2YU9B 1NR2A 4R4OA 1PRTB 4DK1A 4WJWA 2NTTA 3UDXA 4JK1C 4XYOA 1EZ6A 2ZJPA 4WJ4A 4S3SA 3C1EA 1HNXQ 3TS2A 1PDQA 1LM0A 1LT6D 1L1OB 3NQIA 3HKZE 3QOLA 3A74A 4LFAL 1N32L 3URYA 2WFWA 4IJLA 1XPRA 4FXKC 4A3DB 1N8RC 4LMQD 3LWUA 4YCWA 1TS2A 3S24A 1YI2A 3M4PA 1X3EA 4BBRB 2RF4A 4DAYA 5IYDG 4DV0Q 2IY5B 2G5DA 5IP7G 3KF8B 1Q1BA 1MJEA 3QWNA 1EQTA 1XNQL 2KENA 5K5PA 3OPOA 2VL6A 1VQAA 1DZ1A 4IUQA 1STHA 3RLFA 1MSGA 2PMZE 1E22A 2NVTH 4A3MG 3W1BA 3ULLA 4R4TA 2RSOA 4JW0A 1YEZA 4KI0A 2F0FA 2D9UA 4GN5A 4C3JG 3CQZB 1P16A 3OWEB 1S4ZA 2FJ2A 3S14H 1H9KA 2E76C 5FJ8H 5C44H 4X65L 1IXRA 5E1FA 3KJOA 1MHWC 2SDFA 5C5LA 4QIWE 4JI2Q 5C0XH 3HOUH 1ILQA 3AU7A 5L37A 3CD6A 1XNRL 1JWSD 2WP8J 3VR4A 5G3LD 4PZ7A 5M3MG 4JC0A 4OELB 4OL7A 4OEMB 3D3RA 5BN3A 2MPMA 2IX3A 5HGTA 1RD9D 2F0TA 4OWTB 1GD7A 1PHJA 1IBKQ 4DXFA 1RJTA 2PPBC 2K7VA 4IQZA 1JWMD 3PF5A 1C0AA 1L1OC 4BXXG 1VQDA 1K8MA 1Z47A 4KJOA 3SXHA 3VDYA 2L12A 4H7BA 1V1PA 2CH4A 1TY0A 1WCMH 2XN9C 2NN6H 5ISRA 2RCFA 5A35A 2EE1A 2LY7A 5EPJA 4DR6Q 1JMCA 1Y69U 3H15A 1HPCA 4R1JA 1ENCA 4QCLA 1JWUD 4IUNA 3OMCA 2LXJA 1DCZA 4ID6A 2NWGA 2GA4B 4XT3B 1HZ9A 1XPOA 3HFZB 5COYA 2D0PA 3VYRA 2RBMA 1B44D 5IGGA 1QZGA 4FF4A 4HEDA 3FMCA 4GOPA 2VW9A 4JI1Q 3EROA 5KEEA 2Z1CA 1B9NA 1YBYA 1LTTD 2FXQA 2K33A 1S5ED 4M8AA 3F8TA 1EWCA 3OTOL 3J80L 3CHBD 2HT1A 1SYFA 4IPHA 4YWLA 3L3OC 1ICFB 1OXUA 2RQXA 3BDCA 1HTLD 4DU9A 3MXPA 2PNHA 5EKLA 4KD4A 2OQKA 1D5XC 2CQOA 1STNA 3DMUA 4DR1Q 2Q2UA 1VQNA 2R92H 4A3IG 5DNFA 1SNQA 3TP5A 1GOZA 1F9SA 5ELCA 4JV5Q 1SNDA 2I5HA 2A1AA 4DUZL 3K5NA 4G7HC 4C3IH 2EQSA 2QGQA 3A5ZB 4DV7Q 1CTMA 4GKKL 5EJWA 2E2DC 3M9BA 5IYBH 1Q82C 2RKSA 1JQYD 2XIWA 4XTCS 4HIDA 4A3MB 2F0MA 3A55A 3QJYA 3E5SA 5AFWA 3K0YA 4OO1G 3I72A 1Z6HA 1SEBD 2AHOB 2G9HD 3T1YQ 4FNFA 4JVZA 2CH4W 5CYUA 1F2YA 4WJ3M 2UXBL 3TZDA 3O13A 3UDIA 2QDBA 4R8NA 1A15A 1B2TA 2HD3A 4LUOA 3H3VI 4A93H 2VUMB 2IPKD 5M3MB 4IPCA 3PUVA 4FXGC 4PQXA 3HOYH 3RD4A 1X32A 3NEMA 1PTOH 2TMPA 3NENA 3NXWA 4A3FH 4OHJA 4DV2Q 3T51B 1TY2A 2A6HD 2L1BA 2MQHA 4UY8C 3D31A 3BZCA 3I8ZA 1AP0A 3X3MA 1S40A 1U0LA 4Z9CB 2UXDQ 5T1GA 5LMNQ 3SE0A 3CF5A 2A69D 4KHVA 1EU4A 2PI2E 1SAPA 1XMQL 2XNAC 3TP7A 3NBIA 3K6OA 1HR0L 3ND8A 3NUCA 5FO7B 4IFDG 4X66L 3K5MA 4LF4Q 2JA5B 2FFKB 2RDHA 4OX9Q 3EFXD 1HNZQ 1QILA 2KEEA 2F0LA 3BS1A 5BN5A 1D5ZC 2F0GA 1EYAA 4AYBE 1VQ7A 4ZCKA 5IWAL 4BWGB 2LKVA 3U9OA 2MHVA 1PLFA 5C44G 2JA7G 5FJ8G 2FMCA 2E2IB 1JOOA 2DJFC 1C7YA 4QMGA 3MA2B 4CKCA 1DGSA 3S15B 5I9PA 4B3TL 1YJNA 2R3ZA 2VB2X 3MHBA 3J80i 3CMEA 5J1ZA 3SR1A 3CC4A 1LACA 5C4HA 3HEJA 4JI7L 1NUCA 1Z7TA 5CV6A 4A3JH 4GOPC 3TSSA 2I5LX 3IFTA 5IYCG 3RZDB 1YIJA 1ICWA 2AKWB 2OWOA 1ZXTA 4NDXA 2R61A 1YITA 4DV6Q 1BUVT 1TKWB 2IT1A 4HJ9A 1PH7A 1QNUA 4NB3A 4LF9L 2PQEA 5IT9E 1UE7A 1RDPD 4XYQA 4DR5L 3V2TA 5C0XI 4HAEA 1RTOA 2GVBA 5KRUA 4ULLA 3T1HL 2HIXA 3TZUA 2JK8A 4WFN3 1X54A 3S9WA 1K0RA 4G57A 3AFPA 1TR5A 1NMFA 2BH8A 5I9OA 5J22A 4GLVB 1O7LA 3NK9A 1UAPA 1KNEA 1XMOL 5HURA 4CJ0B 3G71A 3CU7A 4GN3B 3TP8A 1JCKB 2EY2A 2XWJB 2Z9HA 2PQAA 2R93H 3J7AF 3T56B 2JXMB 3BVGA 1VQ8A 5CV8A 3AFQA 3N52A 4IALA 4PZ8A 1UEBA 3S2HH 3HOWG 4QUFA 2NN6I 3J7A5 1ENAA 3RUZA 3DHQA 3BZKA 2K04A 1WTWA 5C5MA 3TEHB 3PF4A 2WB1B 1RF2D 1KTKA 4DUYQ 4ME5A 4NXMQ 3H6MA 3D4WA 1IKMA 2L15A 4KKUA 1XX8A 2K4KA 2KHJA 3I4NH 1EYDA 3BU2A 1AE2A 5M5WH 2HDLA 1KL9A 1SJHD 1XTDA 1NR4A 1SYDA 1N34L 1FNVA 4H13C 2PCFB 3CC7A 1NE3A 4HMJA 1U4RA 4KKTA 5D14A 3JAMc 3HRZC 1TT2A 3RLNA 4JI6Q 2JYOA 2XRSD 2B63H 1HFGA 2NVTB 1XJVA 4YCUA 1BXTA 3K57A 4A3GH 1Z9FA 1D8LA 3GQBA 1CZWA 2XWBB 3CCUA 1CFMA 4YHHQ 5IGBA 3BZDB 4JYAL 1ZYRC 3S14B 5C44B 4A3CH 2SNSA 4QL5A 4R4QA 3HOUB 5H1SE 4BY7H 1EWHA 4JOIA 2I5MX 3GTJB 1G6ZA 4L5SA 1YHQA 2ZXPA 1LTID 4LWCA 4GKJL 1CK1A 2I46A 3DLLA 5AJ3L 3K59A 1X9NA 4NXNL 2PW5A 4HJ7A 2HCCA 2IL8A 1NNXA 4A3EG 2PQAB 1EFID 1FL0A 1GUTA 5FLXE 3HOZG 1ZKOA 2X69A 3ERQA 4MHEA 3S1QB 2YTYA 1W3SA 3CRLC 2EZVA 4OONA 4LF5L 5JEAJ 4R4IA 1LTAD 1WCMB 4ZKCB 4DNTB 2UUAQ 2O5JC 1S5BD 2D62A 2DNCA 2VXWA 3PSIA 4NMZA 2EYFA 3FRPB 3KDFB 1IZ6A 5JVG3 4DFAA 2F0PA 4O42A 5M3FG 4B3RQ 4C1NI 1SFOH 3BYYB 2R7FA 5C4ZA 3K8AA 1EY7A 4KJNA 4P73A 4A4IA 4PZ6A 1FVIA 1EU3A 2F0KA 3UE1A 1TWGB 4AIMA 4BBSH 2F0WA 4Y52H 5I2YA 1STYA 2JP1A 5IP9H 1JB3A 2K03A 5ELOA 5JPMC 4UP7A 2KA7A 1WTPA 1E1OA 4YY3Q 1LT4D 4NPSA 2IWHA 5FO8B 2CKZB 4DR4L 1Q81C 4QB4A 4JBWA 1D2BA 4ALPA 1OTCA 4NP5A 3CMAA 3STBC 1VDZA 4RCOA 2VY3A 4V190 1ET6A 3I4LA 2Z4HA 4WORA 3E0JA 3S16B 4GN4B 4MIUA 2L4NA 4PG3A 3Q24A 2L0CA 3MC0B 3FPPA 4DV4L 2R92B 3H09A 2HIVA 2Q2TA 1NMGA 5F2DA 4A3DG 4XDXA 5EGTA 1R9TH 3S2DH 1X3PA 3DWQA 2Z8LA 1QJOA 3E9IA 1EQVA 4RKLA 3HOXH 3NPPA 4LFBL 4DR7L 1K28A 4C3IB 4K8IA 4DV3L 5KYIA 2DJGC 2E5LQ 1ENFA 1WJJA 2AUKA 2EYHA 3KLSA 4RHRA 2PNRC 2Y0SB 4X3SA 2BA0A 1PH5A 1N36Q 2J0TD 4GNXC 2SNMA 3SK5A 3TQYA 4DNRB 4K6LA 3ZJYC 4BY1H 2QEJC 4JI5L 1KHIA 5FLXL 4LFCL 1IBLQ 4C3HH 2ID0A 3S1NH 3ER0A 1Q12A 1B3AA 4A93B 5IGCA 3HOYB 2R93G 3CCSA 1SNPA 4GLAC 4TRDA 4RFBA 1I5FA 1ZEQX 2F0DA 1I50H 1PTOB 1HA6A 1L2FA 1FJGQ 3D8GA 1XTCD 1BQQT 3CCRA 4A3KG 4A3FB 1STGA 2EYPA 1LABA 4AQYQ 1SMYD 4Q5VA 2K5VA 4P71A 2E2JH 4DKAC 1IYUA 1JOKA 4RGTA 4HN7A 5FKAC 5C3EH 2JJQA 4TSSA 2UUBL 1UE5A 4IFDJ 1PH9A 1K83H 1TS5A 1SYGA 2JQOA 3GTGH 2F4VL 1VS0A 3RMHA 1WTQA 3K80C 4RKBA 4K0KQ 2RDFA 1N9WA 2I07B 1TQOA 3QB3A 4G7OC 4DR2L 1EIGA 2WV6D 5EBCA 3L7ZC 4JBMA 5T1IA 3G6JB 2B63G 5JPNC 1W6KA 3A7LA 4HSPA 1Y1WH 3EBEA 2ZM6L 4A3GG 2XTIA 1IBML 4B3TQ 4Q0FA 4L5RC 4JI4Q 1BBXC 3MXUA 3L0OA 5ELEA 2HQLA 1F9PA 3QG1A 4X3TA 4UAIA 4B9WA 1OO9B 5IGDA 3R3OA 4JI7Q 1HJPA 3ITPA 3E3XA 1HNWQ 2HHHL 4KD3A 1MBYA 3FKIH 5JOBA 2K05A 4RG1A 3DWAA 1EZ8A 3LX0A 3CCJA 1B4OA 2H5XA 2KEDA 3ND9A 4P2CB 1IL2A 5I2XA 3PIP3 4JI8L 4C56C 3CCQA 1V1QA 2MO1A 1F9QA 4CKEA 1U5KA 4LF6L 2HDMA 3CCMA 3S17H 1YHAA 4DV1L 1G51A 4PV1C 3F2DA 4QJFA 1UUPA 2Z6BA 3BDOA 4DK6C 3STBD 1EY0A 1HQRD 3OMGA 1K3BC 3UI2A 4B3SL 1EIFA 4N8FA 2QDLA 2IX0A 4O1NA 5LMUL 2BDNA 1I3QH 3DEOA 1E7ZA 2PW7A 2LS01 2CWPA 1B3QA 4K6DA 2LFNA 1TWAH 3QIAA 5KIXA 4X62Q 1VQFA 2A6HC 1BNZA 1I4PA 1KDCA 3S1MH 1YVCA 2R93B 2CW0C 4O2DA 2A69C 4MNOA 1PRTC 2VUMG 2IHFA 3S2HB 2B8GA 1KDAA 4A3KB 4FXDA 2XGTA 3I55A 1HQMC 4OWWB 4A3LH 4KK7A 4B08A 4CHTB 1E24A 1ILPA 1SRUA 1PVOA 1PRTF 3OIPA 3CXCA 4J1MA 1S5DD 4KN4C 2DUDA 2MO0A 2EOTA 3I4NB 3I4MH 5IOCA 3C46A 1Q8KA 2F4IA 5M5WB 1PFBA 3CW2C 1PH6A 3W3AA 3X3NA 3PIOA 3PUXA 1EOTA 4YWMA 3NTKA 3OYYA 5EPLA 1SBBB 1STEA 2K5HA 4N9TA 2EJGC 5M5XH 3KOJA 3IAYA 4DV5Q 4B3ML 2A6EC 2YTVA 5DM73 3IFDA 1PFSA 2B63B 3BJUA 3NP8A 2JA5G 4A3GB 3V05A 1QVGA 2RCNA 3I7FA 2MP1A 4XQNA 3SDZA 2K6AA 2JA6H 4DR3L 5DEHA 3PO3H 3W2DA 1V1OA 4CJ2C 3PIPA 3OIQA 1CM9A 4LAAA 4NXNQ 3S1RH 4BY7B 4BA2I 1P8LA 2KCCA 1N33L 3RN2A 1BR9A 5EPKA 3G4SA 1AW7A 3RZOH 1VQEA 2DY8A 2KCTA 3KBGA 2WAQG 4KKSA 1WYDA 1J6QA 2B8FA 1PH8A 1AH9A 4E6IA 1XWEA 4IN3A 1K3RA 1A63A 1SSOA 3J80c 1JORA 4GLXA 2KECA 3MVVA 3VYTA 2NVQH 1FGUA 5CV9A 2M9VA 1IL8A 1LT3D 2A74C 5C3WA 3F2CA 4DAMA 2E2HH 3N6RA 1GKHA 2PYKA 4FF1A 3G6EA 1SE3A 4CDEC 2B2YA 1CQVA 1FNUA 2MGSA 5C4XG 2UU9Q 1C4QA 1J5EL 1SDFA 1MIUA 1SFOB 2KHSA 5TSSA 5BR8Q 4CBVA 1EQQA 2UXCL 3FVQA 1F2MA 1S5FD 5C3XA 2WIIB 3LWEA 2MJ8A 4CDCC 3TREA 3PV0A 4A3BH 1W6JA 1Y1WG 2A73B 3EVQA 1CA6A 2V1CC 1Q90A 1PV4A 3D4RA 2EPBA 3DM3A 3F2UA 5NUCA 5LMNW 3PUWA 1F2ZA 1KDBA 1LTSD 2N88A 2QW7A 4DV4Q 1H9SA 5J39A 2EYJA 3T16A 2R6GA 5IE8A 1LTBD 3GTOB 2Q8IB 4DK0A 2LXKA 5M5YH 4L5QA 1U9RA 4DR7Q 1D6EC 1K9MC 1VF5C 2WB1G 1TWHH 4ZUJA 1CI3M 1R9TB 3S2DB 1QWYA 1QUQB 1KXLA 2CW0D 3TDQA 4DN4M 5EKIA 1PRTD 4MZ9A 3HOXB 1WFQA 1Y1VH 2EYOA 4JI0Q 1W2BA 2TSSA 4RCNA 2X6GA 2P5ZX 5D65A 5GROA 3QR8A 3VR3A 4QY7A 1BCPB 2E75C 2ZTCA 4IOCA 2Z6KA 3PO2H 3A0JA 1JOQA 4C2MH 2N55A 4BY1B 3I70A 3OOCA 4HIMA 1DXMA 1IHZA 2UUCL 4C3HB 3K0XA 4EQNA 3S1NB 1EY6A 5IGFA 5C0XG 3DM1A 3HOUG 3HKZG 2A6ED 1GXDC 3FHWA 1RTNA 2ENBA 2WAQB 3JAME 4LF8L 1I50B 2VQEQ 2A68C 1V9PA 3R2TA 4AH6A 3K58A 4JCVE 2K50A 3P1HA 3GP7A 4KY6A 4JI3L 4A3LG 1E3PA 1WOCA 4P74A 1M1KC 2OQ0A 1RODA 1H9SB 3C2PA 3MFGA 2E2JB 2JA8H 2O5IC 3K7AH 1Y8PB 2JSOA 2EY1A 4WRDA 5CORA 1O78A 4C1NK 3SK4A 1K83B 4A76A 1BDOA 2F0NA 1WCMG 5C4XB 4DR2Q 2NN6G 1EIYB 1WVLA 1HNXL 1R4QB 3SGIA 1IYVA 1B50A 4KN7C 1SJED 2O4XA 3KK7A 1X3GA 2ZT9C 3Q22A 4I7ZC 5J3BA 1DOKA 4ZUIA 1DJRD 4BBRH 1BOSA 2K5WA 1Y14B 2K32A 1Y1WB 5D3IB 2YYZA 3W1GA 3EIVA 1BVSA 3DWPA 1B9MA 4LFAQ 1C8CA 3KF6B 1QZHA 2B2YC 3I3CA 1N32Q 4DV0L 5K36H 2F03A 4LUZA 2QA4A 2BOSA 1QCBD 1DOLA 3A7AB 3D6WA 3I2ZA 4KMUC 2JN4A 1O80A 3FKIB 1HXYD 1K8GA 3SK8A 2F0JA 4DV1Q 1OXTA 5IY0A 3KDFA 4J8QA 1I6VC 5ELNA 2R92G 4J15A 1UWVA 1XNQQ 3S17B 1YNJC 1HZCA 1EWIA 1M4VA 5LMUQ 3IKJA 1VQ6A 2EVBA 4RHSA 4JI2L 3H3VC 1A2TA 3HZXA 4C3IG 4HJ5A 3AB9A 3TN2A 4LJZC 5ELBA 1I3QB 1BBWA 4QUCA 3OSOA 5IYBG 4IJHA 4LK1C 5JAVA 3GV3A 3GD7A 4X65Q 3CKIB 3EQLC 2Y0SG 1CUKA 2KBNA 1XNRQ 1IBKL 3NQTA 1NAPA 1MKHA 5GQOA 2L55A 2CCZA 4MTKA 2FHTA 1SMYC 5I6YA 1RL2A 3J81j 3S1MB 4A3BG 2OF1A 3ONAB 1JICA 1TVXA 1CSQA 3HKZB 4FVMA 2AQ2B 2RHSB 5CV7A 3ZYYX 1V43A 3MEFA 1CT1D 3SEBA 4A93G 3BDLA 3CCLA 4P75A 3HOYG 1KRTA 2CVRA 1TWCH 1VQPA 3OHXC 1CHPD 1CKNB 1LO5D 3H94A 4HTHA 5IT9L 4IURA 1EOVA 2OEOA 1EEID 4N8X1 2JEBI 3KLSX 1F9RA 3MXGA 4A3FG 3D0FA 2Z6KC 1G2SA 2LSSA 1OXXK 3I4MB 4PNYA 5FLMH 4IPGA 2F0IA 3P75A 3GTPH 2H4OA 5KNCA 1A0IA 5IT9c 4FYDA 1G8ZD 2YTXA 2K52A 3K5LA 4LUVA 1KQSA 1HTPA 1Y1VG 2A68D 3R2IA 2V4DA 2F0UA 2PMZB 3B6YA 1ONLA 3TMEA 4DR3Q 5M5XB 3GTLH 1WTXA 1QB5D 5JJIA 3JC66 2J4XA 5IYDH 1CKMA 1BF4A 3OTOQ 2AWNA 1VQCA 5EAYA 5IP7H 2ASBA 4QIWB 3J81E 3TS0A 3PO3B 5KNDA 2CFMA 3U58A 1VQIA 3NWSA 5C6AA 4IUUA 1SROA 1JC7A 3S1RB 3I91A 4JV5L 5FO9B 3Q6SA 2EJFC 3BG3A 3GDEA 1E2WA 1HRJA 3VA5A 5BN4A 3RZOB 4RAUC 2ZJQA 5DLQE 4C3JH 4U673 4RGMA 3VYSA 2NB0A 4X64L 4CDDC 1PZID 2QILA 3L9AX 3P20A 1IYJB 4DPGA 2SOBA 4DUZQ 5C4JH 4R8IA 3OW2A 4IZ8A 1HHVA 1U4MA 3TBIB 4A3JG 3T1YL 4Y7NH 4GKKQ 4KHPL 2NVQB 4XQJA 3SHLA 2OTLA 2JA8G 4DXGA 1J5EQ 2E2HB 1LTRD 1U4PA 3IRBA 4CDFC 2UXCQ 4EX5A 1J9OA 1EFWA 3FDTA 3CP0A 4BXXH 2UXBQ 2O2LD 2K01A 1EY4A 5E4WC 5KGUA 1PYSB 3WOEA 1O7YA 1YNJD 4DV2L 3HS0C 1H9JA 4FP5D 5JEAH 4F88A 1TXYA 4A3BB 3A8KE 2EXDA 3KYHC 4RGNA 2B3GA 1I6HH 2WINB 2R7DA 1TWFH 4MN3A 1ESFA 2UXDL 5E4XA 4O0AA 5LMNL 1F2LA 4HMIA 4KLKA 4IUVA 1PA6A 1VQ4A 4LW1A 1EQRA 2NVYH 3VR5A 3EJIA 3H0GH 2B2VA 5FLXc 5HGQA 4LF4L 4TVAB 4L6TB 2MFIA 1SNCA 5M5YB 3MXNA 1PH1A 3L2PA 1XMQQ 3GTQH 4OX9L 1HUNA 2DY7A 1TWHB 2N8NA 3J7ZC 1HNZL 1SE4A 1PFNA 1IW7C 4APVA 2B29A 1TIID 1HR0Q 2IW3A 1YNXA 3I4NG 2NYZD 4X66Q 4K14A 4JOIC 3J81L 1Y1VB 1GVPA 5CV5A 3NTIA 3CCEA 1NSNS 2K5NA 3I73A 4DF7A 1O7IA 5ELDA 1QVCA 5M9OA 4A3IH 1JJ2A 5CGKA 1SR3A 3ERSX 2JE6I 3I4OA 5IWAQ 3RZDH 1M8AA 3WDNA 2ICIA 2WB1E 3E9HA 2X6LA 5FK9C 4LF7L 5CBAE 1EYGA 2F0QA 2Q8TA 1FYCA 4C2MB 2AMCB 3PIO3 5I6WA 2DGYA 3M4QA 2GVAA 2ALYB 2B2UA 4A3CG 4G7ZC 2VQFL 2RHQB 3DEPA 4YWKA 1PH2A 4BY7G 4DV6L 1AN8A 2QKIC 4XIGS 1EUJA 4OO1H 4BS9A 2IX1A 4FF2A 1GUWA 1KABA 1B1ZA 2CWAA 2EYMA 2RVLA 2IHEA 5E3FA 5GADC 2R7ZH 3J7AV 1FNWA 4DA2A 2M00A 1KLUD 2OXPA 4I65A 4A3JB 4LF9Q 2VB3X 2JA8B 3P7JA 3K7AB 1PTOC 4BA1I 3HGBA 4KHZA 4DR5Q 4X3KA 5FLMG 2D0OA 3VR2A 1OXVA 1RHPA 3PCOB 4POFA 1PXUA 1VQBA
chains in the Genus database with same CATH topology
1NMFA 2BH8A 3T1HQ 3MXNB 1T9HA 2NZHA 4GLVB 3K81C 5BR8Q 4DNIA 3CCVA 3U50C 2VUMH 4JBJA 5M3MH 2Q2IA 1EQQA 2UXCL 5JJLA 4HJAA 1XMOL 3G71A 4GN3B 5HY6A 1PH4A 4UP8A 1VQ5A 3TREA 3PV0A 2PQAA 2YV5A 1XMOQ 3GTOH 2R93H 2AWOA 4A3BH 1G291 2WAQE 1Y1WG 2GN5A 3UE0A 1VQ8A 2V1CC 3AFQA 4PZ8A 1UEBA 1VQJA 1PV4A 3HOWG 3S2HH 4X6AH 2NN6I 2I0QA 3DM3A 1L0WA 5LMNW 3J7A5 3KFUA 1UE1A 3PUWA 4DUYL 2Q2HA 3BZKA 4BBSG 4DV4Q 1K73C 4NXML 3TEHB 3F2BA 5IP9G 1X56A 3PF4A 1D7QA 1Q7YC 1JJCB 1NJIC 1QVFA 3LGJA 4AYBG 4DUYQ 4POGA 2R6GA 5IE8A 4BBRG 4NXMQ 1YJWA 3JAMi 2L15A 3I4NH 2K4KA 2KHJA 1Q46A 3BU2A 4HIOA 2LXKA 1AE2A 2VNUD 5M5WH 1A8VA 1SN8A 1NBWA 4L5QA 5M5YH 1KL9A 1XTDA 1HR0W 4DR7Q 1K9MC 2WB1G 1TWHH 1X55A 1N34L 3NELA 2JA5H 1QUQB 1KXLA 4IOAA 1SLJA 2E8GA 4UP9A 4JI0L 3CPWA 4JI6L 3GTKH 2JA7H 3CC7A 5K36G 1NE3A 2PI2A 1N34Q 1C9OA 4MZ9A 1WFQA 1Y1VH 3JAMc 3RLNA 2A8VA 4JI0Q 4JI6Q 1W2BA 3GTJH 3AYHB 1L1OA 1KIXA 2B63H 1B7YB 3ULPA 5GAGC 4YHHL 1XJVA 4YCUA 1VCIA 5GROA 4A3GH 1Z9FA 3CPFA 1JE5A 1D8LA 2E2IH 4IO9A 3CCUA 4YHHQ 1H95A 4QY7A 3HOXG 3ICEA 4JYAL 2JEAI 1KRSA 4A3CH 3J81i 2ZTCA 3S15H 4QL5A 1WI5A 4R4QA 5IYCH 3FP9A 5H1SE 4IOCA 2Z6KA 3PO2H 3A0JA 2MNAA 4BY7H 4JYAQ 1LTLA 2I5MX 4JOIA 4C2MH 3S1QH 4L5SA 1YHQA 3U4VA 4HIMA 2OTJA 4LWCA 4GKJL 1B8AA 3DLLA 2UUCL 3K0XA 5AJ3L 1VQHA 4IPDA 4A75A 4R4CA 3H3VH 1X9NA 4GKJQ 4NXNL 5C0XG 3KJPA 3W5OA 3KLWA 4HJ7A 3HOUG 2UUCQ 2VQEL 5AJ3Q 5JEAG 3HKZG 3Q8DA 2QEXA 4HJ8A 3J81c 4A3EG 2PQAB 3FHWA 3CAMA 4BY1G 1VQOA 1FL0A 4LF8L 3HOZG 5GAHC 2N3SA 2VQEQ 5C0XJ 1V9PA 2UUAL 2YTYA 1W3SA 4TQUS 4AH6A 4DAYB 5C4XH 3NBHB 4OONA 1BBUA 4JCVE 2K50A 5JEAJ 4LF5L 4R4IA 4JI3L 4LF8Q 2Z0SA 4A3LG 1E3PA 1WOCA 4P74A 2UUAQ 1M1KC 1VQ9A 2OQ0A 1QUQA 4FDBA 4LF5Q 2Y0SE 4UPAA 2BA1A 1TWGH 2D62A 3PUZA 3PSIA 3UDFA 4JI3Q 2JA8H 3UDGA 3K7AH 3KDFB 4B3RL 3H0GG 1IZ6A 1I94L 5M3FG 4A76A 5E7NA 2N49A 1WCMG 1SFOH 4B3RQ 4DR2Q 1M90C 2NN6G 1EIYB 2R7FA 4R4OA 1Q86C 4B3MQ 3K8AA 3M3YH 3HOWH 1HNXL 1AE3A 1KAWA 4P73A 3SGIA 3UDXA 4PZ6A 4A4IA 1FVIA 5C3EG 3UE1A 4AIMA 4BBSH 4Y52H 3ULJA 2ZJPA 4WJ4A 1X3GA 5IP9H 4YY3L 1HNXQ 3TS2A 5ELOA 3S16H 1LM0A 5J3BA 4UP7A 1X65A 1E1OA 4BBRH 1L1OB 3HKZE 4YY3Q 1Y14B 4NPSA 3A74A 3AEVA 4LFAL 2OCEA 3A5UA 2CKZB 4DR4L 1N32L 1Q81C 2YYZA 4JBWA 2WFWA 3W1GA 3EIVA 4IJLA 4ALPA 1BVSA 1XPRA 1OTCA 3CMAA 1N8RC 4LFAQ 3STBC 3KF6B 1GO3E 4YCWA 3S24A 2VY3A 1QZHA 3M4OH 4DR4Q 1N32Q 4DV0L 2KCMA 4GN4B 1YI2A 3AQQA 3M4PA 4LUZA 4PG3A 2QA4A 1X3EA 3I2ZA 2RF4A 4DV4L 5IYDG 4X64Q 4DV0Q 1KD1C 2IY5B 2HIVA 2Q2TA 1NMGA 2A19A 3EN2A 1K8GA 4A3DG 1R9TH 5IP7G 3KF8B 2BH2A 3S2DH 1Q1BA 4DV1Q 2NVXH 1MJEA 1YJ9A 1XNQL 2KENA 1RIPA 3E9IA 3GTMH 1OXTA 5IY0A 3KDFA 4KHPQ 2E5LL 3HOXH 4LFBL 4DR7L 2VL6A 1VQAA 5ELNA 2R92G 4J15A 1UWVA 1XNQQ 3FKIG 3RLFA 4DV3L 2R7ZG 2PMZE 1E22A 1HZCA 1EWIA 5LMUQ 2E5LQ 2NVTH 4LFBQ 4A3MG 1WJJA 3W1BA 3ULLA 4R4TA 1VQ6A 1N36L 2K14A 1YEZA 4DV3Q 4KI0A 4GN5A 4JI2L 4DK3C 1SMXA 2BA0A 1P16A 1PH5A 1N36Q 4GOPB 3S14H 5C44H 2ES2A 1Q1EA 5FJ8H 4HJ5A 4X65L 4GNXC 1IXRA 3KJOA 1UE6A 4QIWE 4JI2Q 3TQYA 3HOUH 5JJKA 1BBWA 1IBLL 3CD6A 5IYBG 1XNRL 4IJHA 3RN5A 2WP8J 1G6PA 4A3EH 3GD7A 3ZJYC 4X65Q 4L5TA 4BY1H 4JI5L 1KHIA 2Y0SG 5GAEC 4PZ7A 1CUKA 2KBNA 3HOZH 3E0EA 4LFCL 1IBLQ 5M3MG 4C3HH 1XNRQ 4JC0A 1IBKL 2ID0A 3S1NH 3ER0A 1MKHA 1Q12A 5GQOA 1X6OA 4JI5Q 2CCZA 4LFCQ 4OO1I 3KF6A 4OWTB 3CCSA 1GD7A 1PHJA 1IBKQ 1RL2A 4GLAC 3J81j 1FJGL 2R93G 4A3BG 1I5FA 1CSQA 1S3OA 3RR5A 3PUYA 1I50H 4AQYL 3PF5A 1C0AA 1L1OC 1L2FA 1FJGQ 4BXXG 1NTGA 2RHSB 1VQDA 1V43A 3CCRA 4A3KG 3MEFA 1Z47A 3VDYA 5M3FH 4A93G 4AQYQ 3CCLA 1WCMH 4P75A 3HOYG 1KRTA 2K5VA 1LUZA 2C35B 4P71A 1TWCH 1VQPA 2E2JH 1CKNB 4DKAC 4DR6Q 1EOVA 1JMCA 3H15A 3HKSA 2JEBI 4R1JA 1VQKA 5C3EH 2JJQA 2UUBL 1UE5A 4A3FG 3D0FA 2Z6KC 1PH9A 4IFDJ 1K83H 1X3FA 1YZ6A 2LSSA 2LXJA 3HOVH 1OXXK 4PMWA 5FLMH 3GTPH 4IPGA 2UUBQ 1HZ9A 1XPOA 1LYLA 2YU9H 3HFZB 2F3IA 4BY7G 2D0PA 2JQOA 3GTGH 4K0KL 2F4VL 1VS0A 1A0IA 2ZTDA 2ZTEA 1QZGA 5IT9c 4QQBX 3K80C 4GOPA 2YTXA 2F52A 2K52A 4LUVA 4ME3A 1KQSA 1N9WA 1XPUA 4K0KQ 2F4VQ 1Y1VG 2VW9A 4JI1Q 4DR2L 3I4MG 3L7ZC 4JBMA 1YBYA 3B6YA 4DR3Q 2ATWA 2FXQA 4JI4L 2B63G 3GTLH 5JJIA 2N78A 3F8TA 1Y1WH 3EBEA 3JC66 3PGZA 1OXSC 2XTIA 3OTOL 2ZM6L 1IBML 4A3GG 4LF7Q 4B3TQ 2HT1A 4L5RC 4JI4Q 4IPHA 5IYDH 4YWLA 4IFDI 3L0OA 1CKMA 2HQLA 3OTOQ 2ZM6Q 2AWNA 1IBMQ 1OXUA 1VQCA 5EAYA 4A3DH 5IP7H 1HNWL 2ASBA 3TS0A 2PNHA 1HZAA 4JI7Q 2CFMA 3U58A 1VQIA 2OQKA 1HJPA 4HIKA 1HNWQ 2CQOA 1SROA 3M85A 2VQFQ 2HHHL 4DR1Q 2Q2UA 1VQNA 2R92H 4JV5L 4A3IG 3FKIH 4MTNA 2JA6G 4OWXB 4RG1A 3GDEA 2VZAA 2HHHQ 1JJGA 3PO3G 3CCJA 4JV5Q 2H5XA 1CKNA 1IL2A 2I5HA 4LNQA 2A1AA 4JI8L 5DLQE 1S72A 4DUZL 3CCQA 2ZJQA 4C3JH 1V1QA 2MO1A 1NY4A 1U5KA 4RMFA 4X64L 4LF6L 4C3IH 2EQSA 2EIFA 2QGQA 3A5ZB 3CCMA 4DV7Q 1IYJB 1VQMA 1YHAA 4JG2A 4DPGA 4JI8Q 3S17H 4DUZQ 3U4ZA 1B70B 5C4JH 4DV1L 1G51A 4GKKL 3F2DA 3M9BA 2KHIA 4QJFA 5IYBH 3OW2A 4LF6Q 1Q82C 4DK6C 4A3JG 3T1YL 1GM5A 3STBD 4Y7NH 1JB7A 4XTCS 4GKKQ 4HIDA 4KHPL 2JA9A 1E1TA 2OTLA 3CQZH 1ASYA 1J5EQ 2JA8G 4B3SL 1EIFA 4OO1G 2NZOA 3WWVA 2AHOB 3T1YQ 4WJ3M 2IX0A 5LMUL 3IRBA 1I3QH 1E7ZA 2UXCQ 4EX5A 4B3SQ 2UXBL 2CWPA 1EFWA 3UDIA 4X62L 3CP0A 1VQGA 4BXXH 2UXBQ 4A3KH 1TWAH 4LUOA 3H3VI 4A93H 1PYSB 1VQFA 4H02A 4X62Q 4IPCA 1CKOA 3PUVA 3HOYH 3S1MH 1YVCA 4DV2L 4GNXA 1JT8A 3NEMA 3NENA 1TXYA 2K75A 4A3FH 4O2DA 4P72A 4OXPA 2EXDA 4DV2Q 3KYHC 4MNOA 2B3GA 2VUMG 1I6HH 3CC2A 2R7DA 2IHFA 1TWFH 2UXDL 4O0AA 5LMNL 2XGTA 2MQHA 3I55A 4UY8C 3D31A 3BZCA 4KLKA 1A62A 4OWWB 4A3LH 1S40A 1U0LA 4EQ5A 1PA6A 1E24A 2UXDQ 1VQ4A 1SRUA 1PVOA 5LMNQ 4LW1A 1EQRA 2NVYH 3CXCA 3CF5A 1PYBA 3TRZA 3RNUA 3I56A 2DUDA 2MO0A 2PI2E 1XMQL 1BKBA 3H0GH 3I4MH 1MJCA 5HGQA 5FLXc 4LF4L 1Q8KA 4TVAB 4GS3A 3RLOA 2MFIA 3CW2C 1HR0L 4DR6L 1PH1A 3L2PA 1XMQQ 1PH6A 4OX9L 3GTQH 4IFDG 1ASZA 2N8NA 3PUXA 4X66L 3J7ZC 3PIOA 1HNZL 4LF4Q 4YWMA 4APVA 2B29A 1HR0Q 4DV5L 1YNXA 3OYYA 4OX9Q 2VS1A 1YHBA 3I4NG 1HNZQ 4X66Q 2K5HA 4JOIC 5M5XH 3KOJA 2ZJRA 4DV5Q 1GVPA 4B3ML 2YTVA 1PFSA 4AYBE 3BJUA 1VQ7A 5IWAL 3CCEA 2JA5G 2K5NA 4YCVA 1HH2P 1HZBA 4JI1L 1O7IA 4A3IH 1QVCA 1JJ2A 1QVGA 2RCNA 1VQLA 1CSPA 1SR3A 3I7FA 3K7UC 5FJ8G 5C44G 2JA6H 4DR3L 2JA7G 3ERSX 2JE6I 3I4OA 5IWAQ 3PO3H 3RZDH 1C7YA 2WB1E 3E9HA 1DGSA 3PIPA 4LF7L 1EYGA 4B3TL 1YJNA 4NXNQ 3S1RH 1K8AC 4BA2I 3J80i 1P8LA 3CMEA 2AMCB 1PH3A 1N33L 3CC4A 3GO5A 2DGYA 3M4QA 2GVAA 3RN2A 4JI7L 2ALYB 3G4SA 4A3JH 3RZOH 4GOPC 1VQEA 2I5LX 2KCTA 1N33Q 4A3CG 2WAQG 2VQFL 1WYDA 2RHQB 5IYCG 1J6QA 1YIJA 4YWKA 4DR1L 1KC8C 2AKWB 4DV6L 1PH2A 4XIGS 1PH8A 1EUJA 2OWOA 4GNXB 2IX1A 3PO2G 1AH9A 3G48A 1K3RA 1SE8A 2CWAA 1YITA 1A63A 4DV6Q 3J80c 2IHEA 2IT1A 5GADC 4HJ9A 4GLXA 1PH7A 2R7ZH 3F1ZA 4NB3A 4LF9L 3M7NA 4A3MH 1FGUA 2NVQH 1I94Q 1UE7A 3F2CA 4DV7L 4QGUA 4DAMA 2E2HH 1GKHA 4DR5L 2UU9L 4LF9Q 3G6EA 5C0XI 4POFA 2GVBA 3HOVG 4BA1I 3T1HL 2HIXA 4JBKA 4KHZA 4DR5Q 5C4XG 2JK8A 2UU9Q 5FLMG 1X54A 2D0OA 5BR8L 1K0RA 1OXVA 3PCOB 3AFPA 1J5EL 1VQBA 1MIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMF A;  2BH8 A;  3T1H Q;  3MXN B;  1T9H A;  2NZH A;  4GLV B;  3K81 C;  5BR8 Q;  4DNI A;  3CCV A;  3U50 C;  2VUM H;  4JBJ A;  5M3M H;  2Q2I A;  1EQQ A;  2UXC L;  5JJL A;  4HJA A;  1XMO L;  3G71 A;  4GN3 B;  5HY6 A;  1PH4 A;  4UP8 A;  1VQ5 A;  3TRE A;  3PV0 A;  2PQA A;  2YV5 A;  1XMO Q;  3GTO H;  2R93 H;  2AWO A;  4A3B H;  1G29 1;  2WAQ E;  1Y1W G;  2GN5 A;  3UE0 A;  1VQ8 A;  2V1C C;  3AFQ A;  4PZ8 A;  1UEB A;  1VQJ A;  1PV4 A;  3HOW G;  3S2H H;  4X6A H;  2NN6 I;  2I0Q A;  3DM3 A;  1L0W A;  5LMN W;  3J7A 5;  3KFU A;  1UE1 A;  3PUW A;  4DUY L;  2Q2H A;  3BZK A;  4BBS G;  4DV4 Q;  1K73 C;  4NXM L;  3TEH B;  3F2B A;  5IP9 G;  1X56 A;  3PF4 A;  1D7Q A;  1Q7Y C;  1JJC B;  1NJI C;  1QVF A;  3LGJ A;  4AYB G;  4DUY Q;  4POG A;  2R6G A;  5IE8 A;  4BBR G;  4NXM Q;  1YJW A;  3JAM i;  2L15 A;  3I4N H;  2K4K A;  2KHJ A;  1Q46 A;  3BU2 A;  4HIO A;  2LXK A;  1AE2 A;  2VNU D;  5M5W H;  1A8V A;  1SN8 A;  1NBW A;  4L5Q A;  5M5Y H;  1KL9 A;  1XTD A;  1HR0 W;  4DR7 Q;  1K9M C;  2WB1 G;  1TWH H;  1X55 A;  1N34 L;  3NEL A;  2JA5 H;  1QUQ B;  1KXL A;  4IOA A;  1SLJ A;  2E8G A;  4UP9 A;  4JI0 L;  3CPW A;  4JI6 L;  3GTK H;  2JA7 H;  3CC7 A;  5K36 G;  1NE3 A;  2PI2 A;  1N34 Q;  1C9O A;  4MZ9 A;  1WFQ A;  1Y1V H;  3JAM c;  3RLN A;  2A8V A;  4JI0 Q;  4JI6 Q;  1W2B A;  3GTJ H;  3AYH B;  1L1O A;  1KIX A;  2B63 H;  1B7Y B;  3ULP A;  5GAG C;  4YHH L;  1XJV A;  4YCU A;  1VCI A;  5GRO A;  4A3G H;  1Z9F A;  3CPF A;  1JE5 A;  1D8L A;  2E2I H;  4IO9 A;  3CCU A;  4YHH Q;  1H95 A;  4QY7 A;  3HOX G;  3ICE A;  4JYA L;  2JEA I;  1KRS A;  4A3C H;  3J81 i;  2ZTC A;  3S15 H;  4QL5 A;  1WI5 A;  4R4Q A;  5IYC H;  3FP9 A;  5H1S E;  4IOC A;  2Z6K A;  3PO2 H;  3A0J A;  2MNA A;  4BY7 H;  4JYA Q;  1LTL A;  2I5M X;  4JOI A;  4C2M H;  3S1Q H;  4L5S A;  1YHQ A;  3U4V A;  4HIM A;  2OTJ A;  4LWC A;  4GKJ L;  1B8A A;  3DLL A;  2UUC L;  3K0X A;  5AJ3 L;  1VQH A;  4IPD A;  4A75 A;  4R4C A;  3H3V H;  1X9N A;  4GKJ Q;  4NXN L;  5C0X G;  3KJP A;  3W5O A;  3KLW A;  4HJ7 A;  3HOU G;  2UUC Q;  2VQE L;  5AJ3 Q;  5JEA G;  3HKZ G;  3Q8D A;  2QEX A;  4HJ8 A;  3J81 c;  4A3E G;  2PQA B;  3FHW A;  3CAM A;  4BY1 G;  1VQO A;  1FL0 A;  4LF8 L;  3HOZ G;  5GAH C;  2N3S A;  2VQE Q;  5C0X J;  1V9P A;  2UUA L;  2YTY A;  1W3S A;  4TQU S;  4AH6 A;  4DAY B;  5C4X H;  3NBH B;  4OON A;  1BBU A;  4JCV E;  2K50 A;  5JEA J;  4LF5 L;  4R4I A;  4JI3 L;  4LF8 Q;  2Z0S A;  4A3L G;  1E3P A;  1WOC A;  4P74 A;  2UUA Q;  1M1K C;  1VQ9 A;  2OQ0 A;  1QUQ A;  4FDB A;  4LF5 Q;  2Y0S E;  4UPA A;  2BA1 A;  1TWG H;  2D62 A;  3PUZ A;  3PSI A;  3UDF A;  4JI3 Q;  2JA8 H;  3UDG A;  3K7A H;  3KDF B;  4B3R L;  3H0G G;  1IZ6 A;  1I94 L;  5M3F G;  4A76 A;  5E7N A;  2N49 A;  1WCM G;  1SFO H;  4B3R Q;  4DR2 Q;  1M90 C;  2NN6 G;  1EIY B;  2R7F A;  4R4O A;  1Q86 C;  4B3M Q;  3K8A A;  3M3Y H;  3HOW H;  1HNX L;  1AE3 A;  1KAW A;  4P73 A;  3SGI A;  3UDX A;  4PZ6 A;  4A4I A;  1FVI A;  5C3E G;  3UE1 A;  4AIM A;  4BBS H;  4Y52 H;  3ULJ A;  2ZJP A;  4WJ4 A;  1X3G A;  5IP9 H;  4YY3 L;  1HNX Q;  3TS2 A;  5ELO A;  3S16 H;  1LM0 A;  5J3B A;  4UP7 A;  1X65 A;  1E1O A;  4BBR H;  1L1O B;  3HKZ E;  4YY3 Q;  1Y14 B;  4NPS A;  3A74 A;  3AEV A;  4LFA L;  2OCE A;  3A5U A;  2CKZ B;  4DR4 L;  1N32 L;  1Q81 C;  2YYZ A;  4JBW A;  2WFW A;  3W1G A;  3EIV A;  4IJL A;  4ALP A;  1BVS A;  1XPR A;  1OTC A;  3CMA A;  1N8R C;  4LFA Q;  3STB C;  3KF6 B;  1GO3 E;  4YCW A;  3S24 A;  2VY3 A;  1QZH A;  3M4O H;  4DR4 Q;  1N32 Q;  4DV0 L;  2KCM A;  4GN4 B;  1YI2 A;  3AQQ A;  3M4P A;  4LUZ A;  4PG3 A;  2QA4 A;  1X3E A;  3I2Z A;  2RF4 A;  4DV4 L;  5IYD G;  4X64 Q;  4DV0 Q;  1KD1 C;  2IY5 B;  2HIV A;  2Q2T A;  1NMG A;  2A19 A;  3EN2 A;  1K8G A;  4A3D G;  1R9T H;  5IP7 G;  3KF8 B;  2BH2 A;  3S2D H;  1Q1B A;  4DV1 Q;  2NVX H;  1MJE A;  1YJ9 A;  1XNQ L;  2KEN A;  1RIP A;  3E9I A;  3GTM H;  1OXT A;  5IY0 A;  3KDF A;  4KHP Q;  2E5L L;  3HOX H;  4LFB L;  4DR7 L;  2VL6 A;  1VQA A;  5ELN A;  2R92 G;  4J15 A;  1UWV A;  1XNQ Q;  3FKI G;  3RLF A;  4DV3 L;  2R7Z G;  2PMZ E;  1E22 A;  1HZC A;  1EWI A;  5LMU Q;  2E5L Q;  2NVT H;  4LFB Q;  4A3M G;  1WJJ A;  3W1B A;  3ULL A;  4R4T A;  1VQ6 A;  1N36 L;  2K14 A;  1YEZ A;  4DV3 Q;  4KI0 A;  4GN5 A;  4JI2 L;  4DK3 C;  1SMX A;  2BA0 A;  1P16 A;  1PH5 A;  1N36 Q;  4GOP B;  3S14 H;  5C44 H;  2ES2 A;  1Q1E A;  5FJ8 H;  4HJ5 A;  4X65 L;  4GNX C;  1IXR A;  3KJO A;  1UE6 A;  4QIW E;  4JI2 Q;  3TQY A;  3HOU H;  5JJK A;  1BBW A;  1IBL L;  3CD6 A;  5IYB G;  1XNR L;  4IJH A;  3RN5 A;  2WP8 J;  1G6P A;  4A3E H;  3GD7 A;  3ZJY C;  4X65 Q;  4L5T A;  4BY1 H;  4JI5 L;  1KHI A;  2Y0S G;  5GAE C;  4PZ7 A;  1CUK A;  2KBN A;  3HOZ H;  3E0E A;  4LFC L;  1IBL Q;  5M3M G;  4C3H H;  1XNR Q;  4JC0 A;  1IBK L;  2ID0 A;  3S1N H;  3ER0 A;  1MKH A;  1Q12 A;  5GQO A;  1X6O A;  4JI5 Q;  2CCZ A;  4LFC Q;  4OO1 I;  3KF6 A;  4OWT B;  3CCS A;  1GD7 A;  1PHJ A;  1IBK Q;  1RL2 A;  4GLA C;  3J81 j;  1FJG L;  2R93 G;  4A3B G;  1I5F A;  1CSQ A;  1S3O A;  3RR5 A;  3PUY A;  1I50 H;  4AQY L;  3PF5 A;  1C0A A;  1L1O C;  1L2F A;  1FJG Q;  4BXX G;  1NTG A;  2RHS B;  1VQD A;  1V43 A;  3CCR A;  4A3K G;  3MEF A;  1Z47 A;  3VDY A;  5M3F H;  4A93 G;  4AQY Q;  3CCL A;  1WCM H;  4P75 A;  3HOY G;  1KRT A;  2K5V A;  1LUZ A;  2C35 B;  4P71 A;  1TWC H;  1VQP A;  2E2J H;  1CKN B;  4DKA C;  4DR6 Q;  1EOV A;  1JMC A;  3H15 A;  3HKS A;  2JEB I;  4R1J A;  1VQK A;  5C3E H;  2JJQ A;  2UUB L;  1UE5 A;  4A3F G;  3D0F A;  2Z6K C;  1PH9 A;  4IFD J;  1K83 H;  1X3F A;  1YZ6 A;  2LSS A;  2LXJ A;  3HOV H;  1OXX K;  4PMW A;  5FLM H;  3GTP H;  4IPG A;  2UUB Q;  1HZ9 A;  1XPO A;  1LYL A;  2YU9 H;  3HFZ B;  2F3I A;  4BY7 G;  2D0P A;  2JQO A;  3GTG H;  4K0K L;  2F4V L;  1VS0 A;  1A0I A;  2ZTD A;  2ZTE A;  1QZG A;  5IT9 c;  4QQB X;  3K80 C;  4GOP A;  2YTX A;  2F52 A;  2K52 A;  4LUV A;  4ME3 A;  1KQS A;  1N9W A;  1XPU A;  4K0K Q;  2F4V Q;  1Y1V G;  2VW9 A;  4JI1 Q;  4DR2 L;  3I4M G;  3L7Z C;  4JBM A;  1YBY A;  3B6Y A;  4DR3 Q;  2ATW A;  2FXQ A;  4JI4 L;  2B63 G;  3GTL H;  5JJI A;  2N78 A;  3F8T A;  1Y1W H;  3EBE A;  3JC6 6;  3PGZ A;  1OXS C;  2XTI A;  3OTO L;  2ZM6 L;  1IBM L;  4A3G G;  4LF7 Q;  4B3T Q;  2HT1 A;  4L5R C;  4JI4 Q;  4IPH A;  5IYD H;  4YWL A;  4IFD I;  3L0O A;  1CKM A;  2HQL A;  3OTO Q;  2ZM6 Q;  2AWN A;  1IBM Q;  1OXU A;  1VQC A;  5EAY A;  4A3D H;  5IP7 H;  1HNW L;  2ASB A;  3TS0 A;  2PNH A;  1HZA A;  4JI7 Q;  2CFM A;  3U58 A;  1VQI A;  2OQK A;  1HJP A;  4HIK A;  1HNW Q;  2CQO A;  1SRO A;  3M85 A;  2VQF Q;  2HHH L;  4DR1 Q;  2Q2U A;  1VQN A;  2R92 H;  4JV5 L;  4A3I G;  3FKI H;  4MTN A;  2JA6 G;  4OWX B;  4RG1 A;  3GDE A;  2VZA A;  2HHH Q;  1JJG A;  3PO3 G;  3CCJ A;  4JV5 Q;  2H5X A;  1CKN A;  1IL2 A;  2I5H A;  4LNQ A;  2A1A A;  4JI8 L;  5DLQ E;  1S72 A;  4DUZ L;  3CCQ A;  2ZJQ A;  4C3J H;  1V1Q A;  2MO1 A;  1NY4 A;  1U5K A;  4RMF A;  4X64 L;  4LF6 L;  4C3I H;  2EQS A;  2EIF A;  2QGQ A;  3A5Z B;  3CCM A;  4DV7 Q;  1IYJ B;  1VQM A;  1YHA A;  4JG2 A;  4DPG A;  4JI8 Q;  3S17 H;  4DUZ Q;  3U4Z A;  1B70 B;  5C4J H;  4DV1 L;  1G51 A;  4GKK L;  3F2D A;  3M9B A;  2KHI A;  4QJF A;  5IYB H;  3OW2 A;  4LF6 Q;  1Q82 C;  4DK6 C;  4A3J G;  3T1Y L;  1GM5 A;  3STB D;  4Y7N H;  1JB7 A;  4XTC S;  4GKK Q;  4HID A;  4KHP L;  2JA9 A;  1E1T A;  2OTL A;  3CQZ H;  1ASY A;  1J5E Q;  2JA8 G;  4B3S L;  1EIF A;  4OO1 G;  2NZO A;  3WWV A;  2AHO B;  3T1Y Q;  4WJ3 M;  2IX0 A;  5LMU L;  3IRB A;  1I3Q H;  1E7Z A;  2UXC Q;  4EX5 A;  4B3S Q;  2UXB L;  2CWP A;  1EFW A;  3UDI A;  4X62 L;  3CP0 A;  1VQG A;  4BXX H;  2UXB Q;  4A3K H;  1TWA H;  4LUO A;  3H3V I;  4A93 H;  1PYS B;  1VQF A;  4H02 A;  4X62 Q;  4IPC A;  1CKO A;  3PUV A;  3HOY H;  3S1M H;  1YVC A;  4DV2 L;  4GNX A;  1JT8 A;  3NEM A;  3NEN A;  1TXY A;  2K75 A;  4A3F H;  4O2D A;  4P72 A;  4OXP A;  2EXD A;  4DV2 Q;  3KYH C;  4MNO A;  2B3G A;  2VUM G;  1I6H H;  3CC2 A;  2R7D A;  2IHF A;  1TWF H;  2UXD L;  4O0A A;  5LMN L;  2XGT A;  2MQH A;  3I55 A;  4UY8 C;  3D31 A;  3BZC A;  4KLK A;  1A62 A;  4OWW B;  4A3L H;  1S40 A;  1U0L A;  4EQ5 A;  1PA6 A;  1E24 A;  2UXD Q;  1VQ4 A;  1SRU A;  1PVO A;  5LMN Q;  4LW1 A;  1EQR A;  2NVY H;  3CXC A;  3CF5 A;  1PYB A;  3TRZ A;  3RNU A;  3I56 A;  2DUD A;  2MO0 A;  2PI2 E;  1XMQ L;  1BKB A;  3H0G H;  3I4M H;  1MJC A;  5HGQ A;  5FLX c;  4LF4 L;  1Q8K A;  4TVA B;  4GS3 A;  3RLO A;  2MFI A;  3CW2 C;  1HR0 L;  4DR6 L;  1PH1 A;  3L2P A;  1XMQ Q;  1PH6 A;  4OX9 L;  3GTQ H;  4IFD G;  1ASZ A;  2N8N A;  3PUX A;  4X66 L;  3J7Z C;  3PIO A;  1HNZ L;  4LF4 Q;  4YWM A;  4APV A;  2B29 A;  1HR0 Q;  4DV5 L;  1YNX A;  3OYY A;  4OX9 Q;  2VS1 A;  1YHB A;  3I4N G;  1HNZ Q;  4X66 Q;  2K5H A;  4JOI C;  5M5X H;  3KOJ A;  2ZJR A;  4DV5 Q;  1GVP A;  4B3M L;  2YTV A;  1PFS A;  4AYB E;  3BJU A;  1VQ7 A;  5IWA L;  3CCE A;  2JA5 G;  2K5N A;  4YCV A;  1HH2 P;  1HZB A;  4JI1 L;  1O7I A;  4A3I H;  1QVC A;  1JJ2 A;  1QVG A;  2RCN A;  1VQL A;  1CSP A;  1SR3 A;  3I7F A;  3K7U C;  5FJ8 G;  5C44 G;  2JA6 H;  4DR3 L;  2JA7 G;  3ERS X;  2JE6 I;  3I4O A;  5IWA Q;  3PO3 H;  3RZD H;  1C7Y A;  2WB1 E;  3E9H A;  1DGS A;  3PIP A;  4LF7 L;  1EYG A;  4B3T L;  1YJN A;  4NXN Q;  3S1R H;  1K8A C;  4BA2 I;  3J80 i;  1P8L A;  3CME A;  2AMC B;  1PH3 A;  1N33 L;  3CC4 A;  3GO5 A;  2DGY A;  3M4Q A;  2GVA A;  3RN2 A;  4JI7 L;  2ALY B;  3G4S A;  4A3J H;  3RZO H;  4GOP C;  1VQE A;  2I5L X;  2KCT A;  1N33 Q;  4A3C G;  2WAQ G;  2VQF L;  1WYD A;  2RHQ B;  5IYC G;  1J6Q A;  1YIJ A;  4YWK A;  4DR1 L;  1KC8 C;  2AKW B;  4DV6 L;  1PH2 A;  4XIG S;  1PH8 A;  1EUJ A;  2OWO A;  4GNX B;  2IX1 A;  3PO2 G;  1AH9 A;  3G48 A;  1K3R A;  1SE8 A;  2CWA A;  1YIT A;  1A63 A;  4DV6 Q;  3J80 c;  2IHE A;  2IT1 A;  5GAD C;  4HJ9 A;  4GLX A;  1PH7 A;  2R7Z H;  3F1Z A;  4NB3 A;  4LF9 L;  3M7N A;  4A3M H;  1FGU A;  2NVQ H;  1I94 Q;  1UE7 A;  3F2C A;  4DV7 L;  4QGU A;  4DAM A;  2E2H H;  1GKH A;  4DR5 L;  2UU9 L;  4LF9 Q;  3G6E A;  5C0X I;  4POF A;  2GVB A;  3HOV G;  4BA1 I;  3T1H L;  2HIX A;  4JBK A;  4KHZ A;  4DR5 Q;  5C4X G;  2JK8 A;  2UU9 Q;  5FLM G;  1X54 A;  2D0O A;  5BR8 L;  1K0R A;  1OXV A;  3PCO B;  3AFP A;  1J5E L;  1VQB A;  1MIU A; 
#chains in the Genus database with same CATH topology
 3GV6 A;  3T1H Q;  3MXN B;  2NZH A;  1LV9 A;  3K81 C;  4ODG A;  1SYB A;  4DNI A;  3CCV A;  3U9S A;  1PTO F;  2Q2I A;  5JJL A;  4HJA A;  1TU2 B;  4EQO A;  5HY6 A;  4UP8 A;  1D5M C;  4DGZ A;  1XMO Q;  2YV5 A;  5JJZ A;  1DYQ A;  3A54 A;  3UE0 A;  1PFM A;  4AYB B;  3J80 E;  2AUJ D;  3NBH A;  4X6A H;  1H9M A;  1E0B A;  4DUY L;  4BBS G;  1K73 C;  4NXM L;  2B2T A;  4IFD H;  5IP9 G;  1X56 A;  1Q7Y C;  1NJI C;  1QE6 A;  4FO2 A;  3LGJ A;  2RA4 A;  2A5H A;  1Q46 A;  4M1U B;  3MTS A;  1A8V A;  3SK6 A;  1UEA B;  2BCO A;  2B2W A;  3NEL A;  1SLJ A;  1MSH A;  4UP9 A;  3GTK H;  1PMR A;  4JI6 L;  2JA7 H;  2NUC A;  4FF3 A;  1DM0 B;  1KAA A;  1N34 Q;  2DNE A;  1C9O A;  2A8V A;  3A56 A;  3GTJ H;  3BYT B;  4OIJ A;  1XYI A;  3D4D A;  3ULP A;  5GAG C;  4YHH L;  2WKC A;  5LHY 1;  1JE5 A;  1MD2 D;  3A8J E;  1WTV A;  4GZY C;  1L0X B;  1H95 A;  3HOX G;  4ZYS A;  1E2Z A;  1KRS A;  4QF4 A;  2JEA I;  4J6H A;  4CGY B;  3J81 i;  4X3U A;  2G9D A;  5IYC H;  2B2V C;  4JYA Q;  2MNA A;  3S1Q H;  1IW7 D;  3U4V A;  4NKL A;  1B8A A;  1U4L A;  3G7L A;  4ZQ3 A;  3T4A C;  2HQE A;  1VQH A;  5EQ0 A;  4R4C A;  4GKJ Q;  3KJP A;  3KLW A;  1GUO A;  1TS4 A;  5AJ3 Q;  5JEA G;  3Q8D A;  1VQO A;  3CAM A;  4BY1 G;  2NBF A;  2C5C A;  3KBX A;  2N3S A;  4C3H G;  2UUA L;  4DAY B;  1AZP A;  1GUN A;  3NBH B;  1BBU A;  2DN8 A;  3DUZ A;  5CR3 A;  3MZ5 A;  1I4R A;  1WTH A;  2KVM A;  4OIK A;  1SNO A;  1SYE A;  3J7Y W;  1QUQ A;  1TWC B;  4LF5 Q;  2Y0S E;  4UPA A;  1TWG H;  3PUZ A;  2SEB D;  3UDF A;  4B3R L;  3H0G G;  3R8B A;  4XXE A;  2OT2 A;  1I94 L;  2F0V A;  2PZU A;  3BVM A;  3DXJ C;  1A3V A;  3NTH A;  5E7N A;  2N49 A;  3NWT A;  1M90 C;  2KOL A;  3GTP B;  1Q86 C;  1AZQ A;  2B2U C;  3M3Y H;  3HOW H;  1Y8N B;  4B9X A;  1AE3 A;  1KAW A;  5C3E G;  3VR6 A;  1EL0 A;  3ULJ A;  1G91 A;  4YY3 L;  1LTG D;  3S16 H;  1X65 A;  4CJ1 B;  1JR0 D;  3GTL B;  3KLR A;  1A6X A;  3AEV A;  2OCE A;  3A5U A;  1PTO D;  1L0Y B;  1D1I A;  3AMU A;  4BBS B;  1GO3 E;  4CKB A;  3M4O H;  4DR4 Q;  2K28 A;  4F8M A;  1PYW D;  2KCM A;  3AQQ A;  4KY5 A;  4L63 B;  4X64 Q;  1KD1 C;  2L11 A;  3EN2 A;  2A19 A;  4RA8 A;  1V1P B;  4U68 A;  2BH2 A;  4KY7 A;  2NVX H;  1YJ9 A;  2K5Q A;  5A2Q E;  1RIP A;  3A8I E;  3GTM H;  3Q23 A;  4C3J B;  1EEF D;  2E5L L;  4KHP Q;  1O7Z A;  3FKI G;  1CA5 A;  2XVS A;  2R7Z G;  5C4J B;  5EKK A;  2EY5 A;  1Q8I A;  4LFB Q;  1N36 L;  2K14 A;  1I4G A;  2F0H A;  4DV3 Q;  2J7Z A;  4G4K A;  4Y7N B;  1CHQ D;  5LL6 X;  2B2T C;  4DK3 C;  1SMX A;  2XSC A;  4GOP B;  2ES2 A;  1Q1E A;  4H0L C;  1UE6 A;  5JJK A;  2KUM A;  1IBL L;  3RN5 A;  1G6P A;  4A3E H;  2FIN B;  1WD0 A;  4L5T A;  2ICE C;  3PMF A;  5GAE C;  4UDU C;  3HOZ H;  3E0E A;  2NTS A;  1ML0 D;  2B2W C;  4DAV A;  4JI5 Q;  1X6O A;  4LFC Q;  1AEX A;  3KF6 A;  4OO1 I;  1FJG L;  1DON A;  1S3O A;  3RR5 A;  1STB A;  3PUY A;  3PQI A;  4AQY L;  2C9O A;  1NTG A;  1EIH A;  1RCV D;  5M3F H;  1I6H B;  2XRQ D;  1TWF B;  2PO4 A;  1LUZ A;  1I4Q A;  2C35 B;  1HFN A;  5LL6 S;  4RH6 A;  3HKS A;  1VQK A;  2NVY B;  5DAU A;  2IJ0 A;  5I4D A;  1X3F A;  1YZ6 A;  3HOV H;  1XXG A;  3H0G B;  4PMW A;  4HSV A;  2UUB Q;  2YU9 H;  1LYL A;  2F3I A;  4K0K L;  1KLG D;  4L8J A;  1HUM A;  4IUP A;  3GTQ B;  2ZTE A;  2ZTD A;  2EDG A;  5IOD A;  1A3U A;  4QQB X;  1B53 A;  2F52 A;  4ME3 A;  1XPU A;  1GJX A;  2HUG A;  2F4V Q;  2F0E A;  1QG7 A;  5IIF A;  5C3E B;  3I4M G;  2Q8R E;  3MAQ A;  2ATW A;  4JI4 L;  2EXZ A;  3QOJ A;  3QO2 A;  2N78 A;  1FD7 D;  3PGZ A;  1OXS C;  3HP3 A;  4LF7 Q;  3GTG B;  2WAC A;  4IFD I;  4RGO S;  4A3I B;  4XT1 B;  2ZM6 Q;  1IBM Q;  1F77 A;  4A3D H;  1HNW L;  1HZA A;  3C1F A;  4K8J A;  5A2Q L;  4HIK A;  4XQQ A;  4ZK9 B;  1PZJ D;  3M85 A;  1VMC A;  2VQF Q;  2KCN A;  1EY8 A;  1KNA A;  4MTN A;  2JA6 G;  4OWX B;  2HHH Q;  1UNS A;  2VZA A;  3NE5 B;  1JJG A;  3PO3 G;  2D5D A;  1CKN A;  1BCP C;  4LNQ A;  1S72 A;  1NY4 A;  4RMF A;  1VQM A;  2EIF A;  4JG2 A;  4JI8 Q;  4KV6 A;  3U4Z A;  1B70 B;  2PZT A;  1BCP F;  2KHI A;  5ELF A;  4LF6 Q;  1GM5 A;  1JB7 A;  2R7Z B;  2JA9 A;  1E1T A;  3CQZ H;  1ASY A;  2NZO A;  3WWV A;  1Q3L A;  1WTR A;  3T13 A;  4F7X A;  1DD2 A;  4B3S Q;  3VYU A;  2FMM A;  4X62 L;  1VQG A;  1JE4 A;  4A3K H;  4H02 A;  4PMB A;  1CKO A;  1LLR D;  2F3W A;  2QF7 A;  4GNX A;  2AQ1 B;  1JT8 A;  2QCP X;  5FOB B;  1RKN A;  2K75 A;  3JAM L;  1LT5 D;  1VF7 A;  4P72 A;  4OXP A;  2CHB D;  3CC2 A;  4F87 A;  3EA6 A;  1TWA B;  3VA7 A;  1MI2 A;  1HA5 A;  4ILW A;  1A62 A;  4EQ5 A;  5DM6 3;  3C3L A;  1PYB A;  3TRZ A;  1T5E A;  3RNU A;  4JPB W;  3I56 A;  2B39 A;  1BKB A;  3FEW X;  1E2V A;  1MJC A;  4HR7 B;  4GS3 A;  1R4P B;  3RLO A;  4DR6 L;  1ASZ A;  4ZAI A;  3I90 A;  2Z4I A;  3SVM A;  4DV5 L;  3GTK B;  2VS1 A;  1YHB A;  2MUY A;  2JA7 B;  3FPU B;  1SXT A;  2ZJR A;  3CRK C;  1YNN C;  3M4Y A;  1TS3 A;  1FGB D;  3Q0A A;  4JI1 L;  2F0O A;  1HH2 P;  1HZB A;  4YCV A;  1VQL A;  2NZ1 D;  4B3M Q;  2EY6 A;  1CSP A;  3K7U C;  2BE5 C;  4K5X A;  5CC4 A;  1EY9 A;  1EYC A;  1CQF A;  1J8I A;  1K8A C;  4KTA A;  1PH3 A;  2M2L A;  5EBD A;  2ZXR A;  1ESR A;  3GO5 A;  1C48 A;  1EY5 A;  2JA6 B;  1N33 Q;  1H9R A;  1V8Q A;  1KC8 C;  4DR1 L;  3PO2 G;  4R9W A;  4GNX B;  3G48 A;  2D2C C;  2LMC B;  1IKL A;  1SE8 A;  4V0B A;  4ZKB B;  1GUG A;  3NSW A;  2PZW A;  4OGQ C;  3F1Z A;  1K8O A;  3OW7 A;  3M7N A;  4A3M H;  3M7G A;  1I94 Q;  5IGE A;  4DV7 L;  1I4X A;  4QGU A;  4PMC A;  1WD1 A;  1GHK A;  2EJM A;  1GHJ A;  2UU9 L;  4ZRZ A;  3HOV G;  4HCS A;  4JBK A;  4K2L A;  5BR8 L;  4DAP A;  1STA A;  1BCP D;  1S5C D;  2HCI A;  1T9H A;  2RSN A;  4IUT A;  4K5V A;  3U50 C;  2VUM H;  4JBJ A;  5M3M H;  1DOM A;  1HCZ A;  1PZK D;  1T5X D;  3M3Y B;  3HOW B;  1PH4 A;  3H91 A;  3NHH A;  1VQ5 A;  1VMP A;  3OWF A;  3GTO H;  2AWO A;  1G29 1;  2WAQ E;  3WOF A;  2GN5 A;  2ZXO A;  1QOH A;  1D1K A;  1VQJ A;  2I0Q A;  1L0W A;  3KFU A;  1UE1 A;  2WKD A;  2Q2H A;  1X3Q A;  1NCV A;  2F1M A;  1GUS A;  3F2B A;  1D7Q A;  4N9P A;  1JJC B;  4NW2 A;  5JVH 3;  1QVF A;  4AYB G;  4POG A;  4ABN A;  3E6Z X;  4BBR G;  3M4O B;  1YJW A;  1K0S A;  1SYC A;  3MFY A;  3JAM i;  5CV4 A;  4RWS C;  3KUP A;  2AQ3 B;  4EGV A;  2EYL A;  2F3V A;  4HIO A;  2VNU D;  1SN8 A;  3HG9 A;  1NBW A;  1HR0 W;  5CBE E;  1FR3 A;  5KNB A;  2F0S A;  1SE2 A;  5KYL A;  1X55 A;  3R93 A;  2JA5 H;  2NVX B;  4IOA A;  2E8G A;  3D6C A;  4JI0 L;  2CQA A;  3CPW A;  5K36 G;  3K5O A;  3GTM B;  2L9H A;  2PI2 A;  3T53 B;  4EVO A;  3AYH B;  1L1O A;  5CMD A;  1KIX A;  5G3L F;  1B7Y B;  2BDO A;  1VCI A;  3CPF A;  1ET9 A;  2KQ3 A;  2E2I H;  4IO9 A;  3ICE A;  1II3 A;  3V96 A;  3IL8 A;  3S15 H;  1WI5 A;  3MWY W;  3FP9 A;  3LNN A;  1LTL A;  4UHV A;  4YIJ A;  4A3E B;  1A2U A;  2H1E A;  2OTJ A;  2RDG A;  3HOZ B;  5D3D A;  1ZYR D;  1AFP A;  3KF8 A;  1G2T A;  4IPD A;  4A75 A;  2KJX A;  4I7A A;  2L5T A;  3H3V H;  3W5O A;  2K1B A;  1BO0 A;  2UUC Q;  2VQE L;  3MEH A;  1YNN D;  2QEX A;  4ZLT F;  4HJ8 A;  3J81 c;  3BVZ A;  1A3T A;  3TP6 A;  3PO2 B;  4TKO B;  5GAH C;  5C0X J;  2E74 C;  4TQU S;  2BE5 D;  5C4X H;  5M3F B;  4LF8 Q;  2Z0S A;  1VQ9 A;  1I4H A;  4FDB A;  4K2K A;  1WTO A;  1CZG A;  2BA1 A;  4EQP A;  1QNK A;  4JI3 Q;  3UDG A;  1SNM A;  4HCE A;  1MGS A;  4H44 C;  3HOV B;  2K5D A;  1Y8O B;  4K5W A;  2YU9 B;  1NR2 A;  4R4O A;  1PRT B;  4DK1 A;  4WJW A;  2NTT A;  3UDX A;  4JK1 C;  4XYO A;  1EZ6 A;  2ZJP A;  4WJ4 A;  4S3S A;  3C1E A;  1HNX Q;  3TS2 A;  1PDQ A;  1LM0 A;  1LT6 D;  1L1O B;  3NQI A;  3HKZ E;  3QOL A;  3A74 A;  4LFA L;  1N32 L;  3URY A;  2WFW A;  4IJL A;  1XPR A;  4FXK C;  4A3D B;  1N8R C;  4LMQ D;  3LWU A;  4YCW A;  1TS2 A;  3S24 A;  1YI2 A;  3M4P A;  1X3E A;  4BBR B;  2RF4 A;  4DAY A;  5IYD G;  4DV0 Q;  2IY5 B;  2G5D A;  5IP7 G;  3KF8 B;  1Q1B A;  1MJE A;  3QWN A;  1EQT A;  1XNQ L;  2KEN A;  5K5P A;  3OPO A;  2VL6 A;  1VQA A;  1DZ1 A;  4IUQ A;  1STH A;  3RLF A;  1MSG A;  2PMZ E;  1E22 A;  2NVT H;  4A3M G;  3W1B A;  3ULL A;  4R4T A;  2RSO A;  4JW0 A;  1YEZ A;  4KI0 A;  2F0F A;  2D9U A;  4GN5 A;  4C3J G;  3CQZ B;  1P16 A;  3OWE B;  1S4Z A;  2FJ2 A;  3S14 H;  1H9K A;  2E76 C;  5FJ8 H;  5C44 H;  4X65 L;  1IXR A;  5E1F A;  3KJO A;  1MHW C;  2SDF A;  5C5L A;  4QIW E;  4JI2 Q;  5C0X H;  3HOU H;  1ILQ A;  3AU7 A;  5L37 A;  3CD6 A;  1XNR L;  1JWS D;  2WP8 J;  3VR4 A;  5G3L D;  4PZ7 A;  5M3M G;  4JC0 A;  4OEL B;  4OL7 A;  4OEM B;  3D3R A;  5BN3 A;  2MPM A;  2IX3 A;  5HGT A;  1RD9 D;  2F0T A;  4OWT B;  1GD7 A;  1PHJ A;  1IBK Q;  4DXF A;  1RJT A;  2PPB C;  2K7V A;  4IQZ A;  1JWM D;  3PF5 A;  1C0A A;  1L1O C;  4BXX G;  1VQD A;  1K8M A;  1Z47 A;  4KJO A;  3SXH A;  3VDY A;  2L12 A;  4H7B A;  1V1P A;  2CH4 A;  1TY0 A;  1WCM H;  2XN9 C;  2NN6 H;  5ISR A;  2RCF A;  5A35 A;  2EE1 A;  2LY7 A;  5EPJ A;  4DR6 Q;  1JMC A;  1Y69 U;  3H15 A;  1HPC A;  4R1J A;  1ENC A;  4QCL A;  1JWU D;  4IUN A;  3OMC A;  2LXJ A;  1DCZ A;  4ID6 A;  2NWG A;  2GA4 B;  4XT3 B;  1HZ9 A;  1XPO A;  3HFZ B;  5COY A;  2D0P A;  3VYR A;  2RBM A;  1B44 D;  5IGG A;  1QZG A;  4FF4 A;  4HED A;  3FMC A;  4GOP A;  2VW9 A;  4JI1 Q;  3ERO A;  5KEE A;  2Z1C A;  1B9N A;  1YBY A;  1LTT D;  2FXQ A;  2K33 A;  1S5E D;  4M8A A;  3F8T A;  1EWC A;  3OTO L;  3J80 L;  3CHB D;  2HT1 A;  1SYF A;  4IPH A;  4YWL A;  3L3O C;  1ICF B;  1OXU A;  2RQX A;  3BDC A;  1HTL D;  4DU9 A;  3MXP A;  2PNH A;  5EKL A;  4KD4 A;  2OQK A;  1D5X C;  2CQO A;  1STN A;  3DMU A;  4DR1 Q;  2Q2U A;  1VQN A;  2R92 H;  4A3I G;  5DNF A;  1SNQ A;  3TP5 A;  1GOZ A;  1F9S A;  5ELC A;  4JV5 Q;  1SND A;  2I5H A;  2A1A A;  4DUZ L;  3K5N A;  4G7H C;  4C3I H;  2EQS A;  2QGQ A;  3A5Z B;  4DV7 Q;  1CTM A;  4GKK L;  5EJW A;  2E2D C;  3M9B A;  5IYB H;  1Q82 C;  2RKS A;  1JQY D;  2XIW A;  4XTC S;  4HID A;  4A3M B;  2F0M A;  3A55 A;  3QJY A;  3E5S A;  5AFW A;  3K0Y A;  4OO1 G;  3I72 A;  1Z6H A;  1SEB D;  2AHO B;  2G9H D;  3T1Y Q;  4FNF A;  4JVZ A;  2CH4 W;  5CYU A;  1F2Y A;  4WJ3 M;  2UXB L;  3TZD A;  3O13 A;  3UDI A;  2QDB A;  4R8N A;  1A15 A;  1B2T A;  2HD3 A;  4LUO A;  3H3V I;  4A93 H;  2VUM B;  2IPK D;  5M3M B;  4IPC A;  3PUV A;  4FXG C;  4PQX A;  3HOY H;  3RD4 A;  1X32 A;  3NEM A;  1PTO H;  2TMP A;  3NEN A;  3NXW A;  4A3F H;  4OHJ A;  4DV2 Q;  3T51 B;  1TY2 A;  2A6H D;  2L1B A;  2MQH A;  4UY8 C;  3D31 A;  3BZC A;  3I8Z A;  1AP0 A;  3X3M A;  1S40 A;  1U0L A;  4Z9C B;  2UXD Q;  5T1G A;  5LMN Q;  3SE0 A;  3CF5 A;  2A69 D;  4KHV A;  1EU4 A;  2PI2 E;  1SAP A;  1XMQ L;  2XNA C;  3TP7 A;  3NBI A;  3K6O A;  1HR0 L;  3ND8 A;  3NUC A;  5FO7 B;  4IFD G;  4X66 L;  3K5M A;  4LF4 Q;  2JA5 B;  2FFK B;  2RDH A;  4OX9 Q;  3EFX D;  1HNZ Q;  1QIL A;  2KEE A;  2F0L A;  3BS1 A;  5BN5 A;  1D5Z C;  2F0G A;  1EYA A;  4AYB E;  1VQ7 A;  4ZCK A;  5IWA L;  4BWG B;  2LKV A;  3U9O A;  2MHV A;  1PLF A;  5C44 G;  2JA7 G;  5FJ8 G;  2FMC A;  2E2I B;  1JOO A;  2DJF C;  1C7Y A;  4QMG A;  3MA2 B;  4CKC A;  1DGS A;  3S15 B;  5I9P A;  4B3T L;  1YJN A;  2R3Z A;  2VB2 X;  3MHB A;  3J80 i;  3CME A;  5J1Z A;  3SR1 A;  3CC4 A;  1LAC A;  5C4H A;  3HEJ A;  4JI7 L;  1NUC A;  1Z7T A;  5CV6 A;  4A3J H;  4GOP C;  3TSS A;  2I5L X;  3IFT A;  5IYC G;  3RZD B;  1YIJ A;  1ICW A;  2AKW B;  2OWO A;  1ZXT A;  4NDX A;  2R61 A;  1YIT A;  4DV6 Q;  1BUV T;  1TKW B;  2IT1 A;  4HJ9 A;  1PH7 A;  1QNU A;  4NB3 A;  4LF9 L;  2PQE A;  5IT9 E;  1UE7 A;  1RDP D;  4XYQ A;  4DR5 L;  3V2T A;  5C0X I;  4HAE A;  1RTO A;  2GVB A;  5KRU A;  4ULL A;  3T1H L;  2HIX A;  3TZU A;  2JK8 A;  4WFN 3;  1X54 A;  3S9W A;  1K0R A;  4G57 A;  3AFP A;  1TR5 A;  1NMF A;  2BH8 A;  5I9O A;  5J22 A;  4GLV B;  1O7L A;  3NK9 A;  1UAP A;  1KNE A;  1XMO L;  5HUR A;  4CJ0 B;  3G71 A;  3CU7 A;  4GN3 B;  3TP8 A;  1JCK B;  2EY2 A;  2XWJ B;  2Z9H A;  2PQA A;  2R93 H;  3J7A F;  3T56 B;  2JXM B;  3BVG A;  1VQ8 A;  5CV8 A;  3AFQ A;  3N52 A;  4IAL A;  4PZ8 A;  1UEB A;  3S2H H;  3HOW G;  4QUF A;  2NN6 I;  3J7A 5;  1ENA A;  3RUZ A;  3DHQ A;  3BZK A;  2K04 A;  1WTW A;  5C5M A;  3TEH B;  3PF4 A;  2WB1 B;  1RF2 D;  1KTK A;  4DUY Q;  4ME5 A;  4NXM Q;  3H6M A;  3D4W A;  1IKM A;  2L15 A;  4KKU A;  1XX8 A;  2K4K A;  2KHJ A;  3I4N H;  1EYD A;  3BU2 A;  1AE2 A;  5M5W H;  2HDL A;  1KL9 A;  1SJH D;  1XTD A;  1NR4 A;  1SYD A;  1N34 L;  1FNV A;  4H13 C;  2PCF B;  3CC7 A;  1NE3 A;  4HMJ A;  1U4R A;  4KKT A;  5D14 A;  3JAM c;  3HRZ C;  1TT2 A;  3RLN A;  4JI6 Q;  2JYO A;  2XRS D;  2B63 H;  1HFG A;  2NVT B;  1XJV A;  4YCU A;  1BXT A;  3K57 A;  4A3G H;  1Z9F A;  1D8L A;  3GQB A;  1CZW A;  2XWB B;  3CCU A;  1CFM A;  4YHH Q;  5IGB A;  3BZD B;  4JYA L;  1ZYR C;  3S14 B;  5C44 B;  4A3C H;  2SNS A;  4QL5 A;  4R4Q A;  3HOU B;  5H1S E;  4BY7 H;  1EWH A;  4JOI A;  2I5M X;  3GTJ B;  1G6Z A;  4L5S A;  1YHQ A;  2ZXP A;  1LTI D;  4LWC A;  4GKJ L;  1CK1 A;  2I46 A;  3DLL A;  5AJ3 L;  3K59 A;  1X9N A;  4NXN L;  2PW5 A;  4HJ7 A;  2HCC A;  2IL8 A;  1NNX A;  4A3E G;  2PQA B;  1EFI D;  1FL0 A;  1GUT A;  5FLX E;  3HOZ G;  1ZKO A;  2X69 A;  3ERQ A;  4MHE A;  3S1Q B;  2YTY A;  1W3S A;  3CRL C;  2EZV A;  4OON A;  4LF5 L;  5JEA J;  4R4I A;  1LTA D;  1WCM B;  4ZKC B;  4DNT B;  2UUA Q;  2O5J C;  1S5B D;  2D62 A;  2DNC A;  2VXW A;  3PSI A;  4NMZ A;  2EYF A;  3FRP B;  3KDF B;  1IZ6 A;  5JVG 3;  4DFA A;  2F0P A;  4O42 A;  5M3F G;  4B3R Q;  4C1N I;  1SFO H;  3BYY B;  2R7F A;  5C4Z A;  3K8A A;  1EY7 A;  4KJN A;  4P73 A;  4A4I A;  4PZ6 A;  1FVI A;  1EU3 A;  2F0K A;  3UE1 A;  1TWG B;  4AIM A;  4BBS H;  2F0W A;  4Y52 H;  5I2Y A;  1STY A;  2JP1 A;  5IP9 H;  1JB3 A;  2K03 A;  5ELO A;  5JPM C;  4UP7 A;  2KA7 A;  1WTP A;  1E1O A;  4YY3 Q;  1LT4 D;  4NPS A;  2IWH A;  5FO8 B;  2CKZ B;  4DR4 L;  1Q81 C;  4QB4 A;  4JBW A;  1D2B A;  4ALP A;  1OTC A;  4NP5 A;  3CMA A;  3STB C;  1VDZ A;  4RCO A;  2VY3 A;  4V19 0;  1ET6 A;  3I4L A;  2Z4H A;  4WOR A;  3E0J A;  3S16 B;  4GN4 B;  4MIU A;  2L4N A;  4PG3 A;  3Q24 A;  2L0C A;  3MC0 B;  3FPP A;  4DV4 L;  2R92 B;  3H09 A;  2HIV A;  2Q2T A;  1NMG A;  5F2D A;  4A3D G;  4XDX A;  5EGT A;  1R9T H;  3S2D H;  1X3P A;  3DWQ A;  2Z8L A;  1QJO A;  3E9I A;  1EQV A;  4RKL A;  3HOX H;  3NPP A;  4LFB L;  4DR7 L;  1K28 A;  4C3I B;  4K8I A;  4DV3 L;  5KYI A;  2DJG C;  2E5L Q;  1ENF A;  1WJJ A;  2AUK A;  2EYH A;  3KLS A;  4RHR A;  2PNR C;  2Y0S B;  4X3S A;  2BA0 A;  1PH5 A;  1N36 Q;  2J0T D;  4GNX C;  2SNM A;  3SK5 A;  3TQY A;  4DNR B;  4K6L A;  3ZJY C;  4BY1 H;  2QEJ C;  4JI5 L;  1KHI A;  5FLX L;  4LFC L;  1IBL Q;  4C3H H;  2ID0 A;  3S1N H;  3ER0 A;  1Q12 A;  1B3A A;  4A93 B;  5IGC A;  3HOY B;  2R93 G;  3CCS A;  1SNP A;  4GLA C;  4TRD A;  4RFB A;  1I5F A;  1ZEQ X;  2F0D A;  1I50 H;  1PTO B;  1HA6 A;  1L2F A;  1FJG Q;  3D8G A;  1XTC D;  1BQQ T;  3CCR A;  4A3K G;  4A3F B;  1STG A;  2EYP A;  1LAB A;  4AQY Q;  1SMY D;  4Q5V A;  2K5V A;  4P71 A;  2E2J H;  4DKA C;  1IYU A;  1JOK A;  4RGT A;  4HN7 A;  5FKA C;  5C3E H;  2JJQ A;  4TSS A;  2UUB L;  1UE5 A;  4IFD J;  1PH9 A;  1K83 H;  1TS5 A;  1SYG A;  2JQO A;  3GTG H;  2F4V L;  1VS0 A;  3RMH A;  1WTQ A;  3K80 C;  4RKB A;  4K0K Q;  2RDF A;  1N9W A;  2I07 B;  1TQO A;  3QB3 A;  4G7O C;  4DR2 L;  1EIG A;  2WV6 D;  5EBC A;  3L7Z C;  4JBM A;  5T1I A;  3G6J B;  2B63 G;  5JPN C;  1W6K A;  3A7L A;  4HSP A;  1Y1W H;  3EBE A;  2ZM6 L;  4A3G G;  2XTI A;  1IBM L;  4B3T Q;  4Q0F A;  4L5R C;  4JI4 Q;  1BBX C;  3MXU A;  3L0O A;  5ELE A;  2HQL A;  1F9P A;  3QG1 A;  4X3T A;  4UAI A;  4B9W A;  1OO9 B;  5IGD A;  3R3O A;  4JI7 Q;  1HJP A;  3ITP A;  3E3X A;  1HNW Q;  2HHH L;  4KD3 A;  1MBY A;  3FKI H;  5JOB A;  2K05 A;  4RG1 A;  3DWA A;  1EZ8 A;  3LX0 A;  3CCJ A;  1B4O A;  2H5X A;  2KED A;  3ND9 A;  4P2C B;  1IL2 A;  5I2X A;  3PIP 3;  4JI8 L;  4C56 C;  3CCQ A;  1V1Q A;  2MO1 A;  1F9Q A;  4CKE A;  1U5K A;  4LF6 L;  2HDM A;  3CCM A;  3S17 H;  1YHA A;  4DV1 L;  1G51 A;  4PV1 C;  3F2D A;  4QJF A;  1UUP A;  2Z6B A;  3BDO A;  4DK6 C;  3STB D;  1EY0 A;  1HQR D;  3OMG A;  1K3B C;  3UI2 A;  4B3S L;  1EIF A;  4N8F A;  2QDL A;  2IX0 A;  4O1N A;  5LMU L;  2BDN A;  1I3Q H;  3DEO A;  1E7Z A;  2PW7 A;  2LS0 1;  2CWP A;  1B3Q A;  4K6D A;  2LFN A;  1TWA H;  3QIA A;  5KIX A;  4X62 Q;  1VQF A;  2A6H C;  1BNZ A;  1I4P A;  1KDC A;  3S1M H;  1YVC A;  2R93 B;  2CW0 C;  4O2D A;  2A69 C;  4MNO A;  1PRT C;  2VUM G;  2IHF A;  3S2H B;  2B8G A;  1KDA A;  4A3K B;  4FXD A;  2XGT A;  3I55 A;  1HQM C;  4OWW B;  4A3L H;  4KK7 A;  4B08 A;  4CHT B;  1E24 A;  1ILP A;  1SRU A;  1PVO A;  1PRT F;  3OIP A;  3CXC A;  4J1M A;  1S5D D;  4KN4 C;  2DUD A;  2MO0 A;  2EOT A;  3I4N B;  3I4M H;  5IOC A;  3C46 A;  1Q8K A;  2F4I A;  5M5W B;  1PFB A;  3CW2 C;  1PH6 A;  3W3A A;  3X3N A;  3PIO A;  3PUX A;  1EOT A;  4YWM A;  3NTK A;  3OYY A;  5EPL A;  1SBB B;  1STE A;  2K5H A;  4N9T A;  2EJG C;  5M5X H;  3KOJ A;  3IAY A;  4DV5 Q;  4B3M L;  2A6E C;  2YTV A;  5DM7 3;  3IFD A;  1PFS A;  2B63 B;  3BJU A;  3NP8 A;  2JA5 G;  4A3G B;  3V05 A;  1QVG A;  2RCN A;  3I7F A;  2MP1 A;  4XQN A;  3SDZ A;  2K6A A;  2JA6 H;  4DR3 L;  5DEH A;  3PO3 H;  3W2D A;  1V1O A;  4CJ2 C;  3PIP A;  3OIQ A;  1CM9 A;  4LAA A;  4NXN Q;  3S1R H;  4BY7 B;  4BA2 I;  1P8L A;  2KCC A;  1N33 L;  3RN2 A;  1BR9 A;  5EPK A;  3G4S A;  1AW7 A;  3RZO H;  1VQE A;  2DY8 A;  2KCT A;  3KBG A;  2WAQ G;  4KKS A;  1WYD A;  1J6Q A;  2B8F A;  1PH8 A;  1AH9 A;  4E6I A;  1XWE A;  4IN3 A;  1K3R A;  1A63 A;  1SSO A;  3J80 c;  1JOR A;  4GLX A;  2KEC A;  3MVV A;  3VYT A;  2NVQ H;  1FGU A;  5CV9 A;  2M9V A;  1IL8 A;  1LT3 D;  2A74 C;  5C3W A;  3F2C A;  4DAM A;  2E2H H;  3N6R A;  1GKH A;  2PYK A;  4FF1 A;  3G6E A;  1SE3 A;  4CDE C;  2B2Y A;  1CQV A;  1FNU A;  2MGS A;  5C4X G;  2UU9 Q;  1C4Q A;  1J5E L;  1SDF A;  1MIU A;  1SFO B;  2KHS A;  5TSS A;  5BR8 Q;  4CBV A;  1EQQ A;  2UXC L;  3FVQ A;  1F2M A;  1S5F D;  5C3X A;  2WII B;  3LWE A;  2MJ8 A;  4CDC C;  3TRE A;  3PV0 A;  4A3B H;  1W6J A;  1Y1W G;  2A73 B;  3EVQ A;  1CA6 A;  2V1C C;  1Q90 A;  1PV4 A;  3D4R A;  2EPB A;  3DM3 A;  3F2U A;  5NUC A;  5LMN W;  3PUW A;  1F2Z A;  1KDB A;  1LTS D;  2N88 A;  2QW7 A;  4DV4 Q;  1H9S A;  5J39 A;  2EYJ A;  3T16 A;  2R6G A;  5IE8 A;  1LTB D;  3GTO B;  2Q8I B;  4DK0 A;  2LXK A;  5M5Y H;  4L5Q A;  1U9R A;  4DR7 Q;  1D6E C;  1K9M C;  1VF5 C;  2WB1 G;  1TWH H;  4ZUJ A;  1CI3 M;  1R9T B;  3S2D B;  1QWY A;  1QUQ B;  1KXL A;  2CW0 D;  3TDQ A;  4DN4 M;  5EKI A;  1PRT D;  4MZ9 A;  3HOX B;  1WFQ A;  1Y1V H;  2EYO A;  4JI0 Q;  1W2B A;  2TSS A;  4RCN A;  2X6G A;  2P5Z X;  5D65 A;  5GRO A;  3QR8 A;  3VR3 A;  4QY7 A;  1BCP B;  2E75 C;  2ZTC A;  4IOC A;  2Z6K A;  3PO2 H;  3A0J A;  1JOQ A;  4C2M H;  2N55 A;  4BY1 B;  3I70 A;  3OOC A;  4HIM A;  1DXM A;  1IHZ A;  2UUC L;  4C3H B;  3K0X A;  4EQN A;  3S1N B;  1EY6 A;  5IGF A;  5C0X G;  3DM1 A;  3HOU G;  3HKZ G;  2A6E D;  1GXD C;  3FHW A;  1RTN A;  2ENB A;  2WAQ B;  3JAM E;  4LF8 L;  1I50 B;  2VQE Q;  2A68 C;  1V9P A;  3R2T A;  4AH6 A;  3K58 A;  4JCV E;  2K50 A;  3P1H A;  3GP7 A;  4KY6 A;  4JI3 L;  4A3L G;  1E3P A;  1WOC A;  4P74 A;  1M1K C;  2OQ0 A;  1ROD A;  1H9S B;  3C2P A;  3MFG A;  2E2J B;  2JA8 H;  2O5I C;  3K7A H;  1Y8P B;  2JSO A;  2EY1 A;  4WRD A;  5COR A;  1O78 A;  4C1N K;  3SK4 A;  1K83 B;  4A76 A;  1BDO A;  2F0N A;  1WCM G;  5C4X B;  4DR2 Q;  2NN6 G;  1EIY B;  1WVL A;  1HNX L;  1R4Q B;  3SGI A;  1IYV A;  1B50 A;  4KN7 C;  1SJE D;  2O4X A;  3KK7 A;  1X3G A;  2ZT9 C;  3Q22 A;  4I7Z C;  5J3B A;  1DOK A;  4ZUI A;  1DJR D;  4BBR H;  1BOS A;  2K5W A;  1Y14 B;  2K32 A;  1Y1W B;  5D3I B;  2YYZ A;  3W1G A;  3EIV A;  1BVS A;  3DWP A;  1B9M A;  4LFA Q;  1C8C A;  3KF6 B;  1QZH A;  2B2Y C;  3I3C A;  1N32 Q;  4DV0 L;  5K36 H;  2F03 A;  4LUZ A;  2QA4 A;  2BOS A;  1QCB D;  1DOL A;  3A7A B;  3D6W A;  3I2Z A;  4KMU C;  2JN4 A;  1O80 A;  3FKI B;  1HXY D;  1K8G A;  3SK8 A;  2F0J A;  4DV1 Q;  1OXT A;  5IY0 A;  3KDF A;  4J8Q A;  1I6V C;  5ELN A;  2R92 G;  4J15 A;  1UWV A;  1XNQ Q;  3S17 B;  1YNJ C;  1HZC A;  1EWI A;  1M4V A;  5LMU Q;  3IKJ A;  1VQ6 A;  2EVB A;  4RHS A;  4JI2 L;  3H3V C;  1A2T A;  3HZX A;  4C3I G;  4HJ5 A;  3AB9 A;  3TN2 A;  4LJZ C;  5ELB A;  1I3Q B;  1BBW A;  4QUC A;  3OSO A;  5IYB G;  4IJH A;  4LK1 C;  5JAV A;  3GV3 A;  3GD7 A;  4X65 Q;  3CKI B;  3EQL C;  2Y0S G;  1CUK A;  2KBN A;  1XNR Q;  1IBK L;  3NQT A;  1NAP A;  1MKH A;  5GQO A;  2L55 A;  2CCZ A;  4MTK A;  2FHT A;  1SMY C;  5I6Y A;  1RL2 A;  3J81 j;  3S1M B;  4A3B G;  2OF1 A;  3ONA B;  1JIC A;  1TVX A;  1CSQ A;  3HKZ B;  4FVM A;  2AQ2 B;  2RHS B;  5CV7 A;  3ZYY X;  1V43 A;  3MEF A;  1CT1 D;  3SEB A;  4A93 G;  3BDL A;  3CCL A;  4P75 A;  3HOY G;  1KRT A;  2CVR A;  1TWC H;  1VQP A;  3OHX C;  1CHP D;  1CKN B;  1LO5 D;  3H94 A;  4HTH A;  5IT9 L;  4IUR A;  1EOV A;  2OEO A;  1EEI D;  4N8X 1;  2JEB I;  3KLS X;  1F9R A;  3MXG A;  4A3F G;  3D0F A;  2Z6K C;  1G2S A;  2LSS A;  1OXX K;  3I4M B;  4PNY A;  5FLM H;  4IPG A;  2F0I A;  3P75 A;  3GTP H;  2H4O A;  5KNC A;  1A0I A;  5IT9 c;  4FYD A;  1G8Z D;  2YTX A;  2K52 A;  3K5L A;  4LUV A;  1KQS A;  1HTP A;  1Y1V G;  2A68 D;  3R2I A;  2V4D A;  2F0U A;  2PMZ B;  3B6Y A;  1ONL A;  3TME A;  4DR3 Q;  5M5X B;  3GTL H;  1WTX A;  1QB5 D;  5JJI A;  3JC6 6;  2J4X A;  5IYD H;  1CKM A;  1BF4 A;  3OTO Q;  2AWN A;  1VQC A;  5EAY A;  5IP7 H;  2ASB A;  4QIW B;  3J81 E;  3TS0 A;  3PO3 B;  5KND A;  2CFM A;  3U58 A;  1VQI A;  3NWS A;  5C6A A;  4IUU A;  1SRO A;  1JC7 A;  3S1R B;  3I91 A;  4JV5 L;  5FO9 B;  3Q6S A;  2EJF C;  3BG3 A;  3GDE A;  1E2W A;  1HRJ A;  3VA5 A;  5BN4 A;  3RZO B;  4RAU C;  2ZJQ A;  5DLQ E;  4C3J H;  4U67 3;  4RGM A;  3VYS A;  2NB0 A;  4X64 L;  4CDD C;  1PZI D;  2QIL A;  3L9A X;  3P20 A;  1IYJ B;  4DPG A;  2SOB A;  4DUZ Q;  5C4J H;  4R8I A;  3OW2 A;  4IZ8 A;  1HHV A;  1U4M A;  3TBI B;  4A3J G;  3T1Y L;  4Y7N H;  4GKK Q;  4KHP L;  2NVQ B;  4XQJ A;  3SHL A;  2OTL A;  2JA8 G;  4DXG A;  1J5E Q;  2E2H B;  1LTR D;  1U4P A;  3IRB A;  4CDF C;  2UXC Q;  4EX5 A;  1J9O A;  1EFW A;  3FDT A;  3CP0 A;  4BXX H;  2UXB Q;  2O2L D;  2K01 A;  1EY4 A;  5E4W C;  5KGU A;  1PYS B;  3WOE A;  1O7Y A;  1YNJ D;  4DV2 L;  3HS0 C;  1H9J A;  4FP5 D;  5JEA H;  4F88 A;  1TXY A;  4A3B B;  3A8K E;  2EXD A;  3KYH C;  4RGN A;  2B3G A;  1I6H H;  2WIN B;  2R7D A;  1TWF H;  4MN3 A;  1ESF A;  2UXD L;  5E4X A;  4O0A A;  5LMN L;  1F2L A;  4HMI A;  4KLK A;  4IUV A;  1PA6 A;  1VQ4 A;  4LW1 A;  1EQR A;  2NVY H;  3VR5 A;  3EJI A;  3H0G H;  2B2V A;  5FLX c;  5HGQ A;  4LF4 L;  4TVA B;  4L6T B;  2MFI A;  1SNC A;  5M5Y B;  3MXN A;  1PH1 A;  3L2P A;  1XMQ Q;  3GTQ H;  4OX9 L;  1HUN A;  2DY7 A;  1TWH B;  2N8N A;  3J7Z C;  1HNZ L;  1SE4 A;  1PFN A;  1IW7 C;  4APV A;  2B29 A;  1TII D;  1HR0 Q;  2IW3 A;  1YNX A;  3I4N G;  2NYZ D;  4X66 Q;  4K14 A;  4JOI C;  3J81 L;  1Y1V B;  1GVP A;  5CV5 A;  3NTI A;  3CCE A;  1NSN S;  2K5N A;  3I73 A;  4DF7 A;  1O7I A;  5ELD A;  1QVC A;  5M9O A;  4A3I H;  1JJ2 A;  5CGK A;  1SR3 A;  3ERS X;  2JE6 I;  3I4O A;  5IWA Q;  3RZD H;  1M8A A;  3WDN A;  2ICI A;  2WB1 E;  3E9H A;  2X6L A;  5FK9 C;  4LF7 L;  5CBA E;  1EYG A;  2F0Q A;  2Q8T A;  1FYC A;  4C2M B;  2AMC B;  3PIO 3;  5I6W A;  2DGY A;  3M4Q A;  2GVA A;  2ALY B;  2B2U A;  4A3C G;  4G7Z C;  2VQF L;  2RHQ B;  3DEP A;  4YWK A;  1PH2 A;  4BY7 G;  4DV6 L;  1AN8 A;  2QKI C;  4XIG S;  1EUJ A;  4OO1 H;  4BS9 A;  2IX1 A;  4FF2 A;  1GUW A;  1KAB A;  1B1Z A;  2CWA A;  2EYM A;  2RVL A;  2IHE A;  5E3F A;  5GAD C;  2R7Z H;  3J7A V;  1FNW A;  4DA2 A;  2M00 A;  1KLU D;  2OXP A;  4I65 A;  4A3J B;  4LF9 Q;  2VB3 X;  2JA8 B;  3P7J A;  3K7A B;  1PTO C;  4BA1 I;  3HGB A;  4KHZ A;  4DR5 Q;  4X3K A;  5FLM G;  2D0O A;  3VR2 A;  1OXV A;  1RHP A;  3PCO B;  4POF A;  1PXU A;  1VQB A; 
#chains in the Genus database with same CATH homology
 1NMF A;  2BH8 A;  3T1H Q;  3MXN B;  1T9H A;  2NZH A;  4GLV B;  3K81 C;  5BR8 Q;  4DNI A;  3CCV A;  3U50 C;  2VUM H;  4JBJ A;  5M3M H;  2Q2I A;  1EQQ A;  2UXC L;  5JJL A;  4HJA A;  1XMO L;  3G71 A;  4GN3 B;  5HY6 A;  1PH4 A;  4UP8 A;  1VQ5 A;  3TRE A;  3PV0 A;  2PQA A;  2YV5 A;  1XMO Q;  3GTO H;  2R93 H;  2AWO A;  4A3B H;  1G29 1;  2WAQ E;  1Y1W G;  2GN5 A;  3UE0 A;  1VQ8 A;  2V1C C;  3AFQ A;  4PZ8 A;  1UEB A;  1VQJ A;  1PV4 A;  3HOW G;  3S2H H;  4X6A H;  2NN6 I;  2I0Q A;  3DM3 A;  1L0W A;  5LMN W;  3J7A 5;  3KFU A;  1UE1 A;  3PUW A;  4DUY L;  2Q2H A;  3BZK A;  4BBS G;  4DV4 Q;  1K73 C;  4NXM L;  3TEH B;  3F2B A;  5IP9 G;  1X56 A;  3PF4 A;  1D7Q A;  1Q7Y C;  1JJC B;  1NJI C;  1QVF A;  3LGJ A;  4AYB G;  4DUY Q;  4POG A;  2R6G A;  5IE8 A;  4BBR G;  4NXM Q;  1YJW A;  3JAM i;  2L15 A;  3I4N H;  2K4K A;  2KHJ A;  1Q46 A;  3BU2 A;  4HIO A;  2LXK A;  1AE2 A;  2VNU D;  5M5W H;  1A8V A;  1SN8 A;  1NBW A;  4L5Q A;  5M5Y H;  1KL9 A;  1XTD A;  1HR0 W;  4DR7 Q;  1K9M C;  2WB1 G;  1TWH H;  1X55 A;  1N34 L;  3NEL A;  2JA5 H;  1QUQ B;  1KXL A;  4IOA A;  1SLJ A;  2E8G A;  4UP9 A;  4JI0 L;  3CPW A;  4JI6 L;  3GTK H;  2JA7 H;  3CC7 A;  5K36 G;  1NE3 A;  2PI2 A;  1N34 Q;  1C9O A;  4MZ9 A;  1WFQ A;  1Y1V H;  3JAM c;  3RLN A;  2A8V A;  4JI0 Q;  4JI6 Q;  1W2B A;  3GTJ H;  3AYH B;  1L1O A;  1KIX A;  2B63 H;  1B7Y B;  3ULP A;  5GAG C;  4YHH L;  1XJV A;  4YCU A;  1VCI A;  5GRO A;  4A3G H;  1Z9F A;  3CPF A;  1JE5 A;  1D8L A;  2E2I H;  4IO9 A;  3CCU A;  4YHH Q;  1H95 A;  4QY7 A;  3HOX G;  3ICE A;  4JYA L;  2JEA I;  1KRS A;  4A3C H;  3J81 i;  2ZTC A;  3S15 H;  4QL5 A;  1WI5 A;  4R4Q A;  5IYC H;  3FP9 A;  5H1S E;  4IOC A;  2Z6K A;  3PO2 H;  3A0J A;  2MNA A;  4BY7 H;  4JYA Q;  1LTL A;  2I5M X;  4JOI A;  4C2M H;  3S1Q H;  4L5S A;  1YHQ A;  3U4V A;  4HIM A;  2OTJ A;  4LWC A;  4GKJ L;  1B8A A;  3DLL A;  2UUC L;  3K0X A;  5AJ3 L;  1VQH A;  4IPD A;  4A75 A;  4R4C A;  3H3V H;  1X9N A;  4GKJ Q;  4NXN L;  5C0X G;  3KJP A;  3W5O A;  3KLW A;  4HJ7 A;  3HOU G;  2UUC Q;  2VQE L;  5AJ3 Q;  5JEA G;  3HKZ G;  3Q8D A;  2QEX A;  4HJ8 A;  3J81 c;  4A3E G;  2PQA B;  3FHW A;  3CAM A;  4BY1 G;  1VQO A;  1FL0 A;  4LF8 L;  3HOZ G;  5GAH C;  2N3S A;  2VQE Q;  5C0X J;  1V9P A;  2UUA L;  2YTY A;  1W3S A;  4TQU S;  4AH6 A;  4DAY B;  5C4X H;  3NBH B;  4OON A;  1BBU A;  4JCV E;  2K50 A;  5JEA J;  4LF5 L;  4R4I A;  4JI3 L;  4LF8 Q;  2Z0S A;  4A3L G;  1E3P A;  1WOC A;  4P74 A;  2UUA Q;  1M1K C;  1VQ9 A;  2OQ0 A;  1QUQ A;  4FDB A;  4LF5 Q;  2Y0S E;  4UPA A;  2BA1 A;  1TWG H;  2D62 A;  3PUZ A;  3PSI A;  3UDF A;  4JI3 Q;  2JA8 H;  3UDG A;  3K7A H;  3KDF B;  4B3R L;  3H0G G;  1IZ6 A;  1I94 L;  5M3F G;  4A76 A;  5E7N A;  2N49 A;  1WCM G;  1SFO H;  4B3R Q;  4DR2 Q;  1M90 C;  2NN6 G;  1EIY B;  2R7F A;  4R4O A;  1Q86 C;  4B3M Q;  3K8A A;  3M3Y H;  3HOW H;  1HNX L;  1AE3 A;  1KAW A;  4P73 A;  3SGI A;  3UDX A;  4PZ6 A;  4A4I A;  1FVI A;  5C3E G;  3UE1 A;  4AIM A;  4BBS H;  4Y52 H;  3ULJ A;  2ZJP A;  4WJ4 A;  1X3G A;  5IP9 H;  4YY3 L;  1HNX Q;  3TS2 A;  5ELO A;  3S16 H;  1LM0 A;  5J3B A;  4UP7 A;  1X65 A;  1E1O A;  4BBR H;  1L1O B;  3HKZ E;  4YY3 Q;  1Y14 B;  4NPS A;  3A74 A;  3AEV A;  4LFA L;  2OCE A;  3A5U A;  2CKZ B;  4DR4 L;  1N32 L;  1Q81 C;  2YYZ A;  4JBW A;  2WFW A;  3W1G A;  3EIV A;  4IJL A;  4ALP A;  1BVS A;  1XPR A;  1OTC A;  3CMA A;  1N8R C;  4LFA Q;  3STB C;  3KF6 B;  1GO3 E;  4YCW A;  3S24 A;  2VY3 A;  1QZH A;  3M4O H;  4DR4 Q;  1N32 Q;  4DV0 L;  2KCM A;  4GN4 B;  1YI2 A;  3AQQ A;  3M4P A;  4LUZ A;  4PG3 A;  2QA4 A;  1X3E A;  3I2Z A;  2RF4 A;  4DV4 L;  5IYD G;  4X64 Q;  4DV0 Q;  1KD1 C;  2IY5 B;  2HIV A;  2Q2T A;  1NMG A;  2A19 A;  3EN2 A;  1K8G A;  4A3D G;  1R9T H;  5IP7 G;  3KF8 B;  2BH2 A;  3S2D H;  1Q1B A;  4DV1 Q;  2NVX H;  1MJE A;  1YJ9 A;  1XNQ L;  2KEN A;  1RIP A;  3E9I A;  3GTM H;  1OXT A;  5IY0 A;  3KDF A;  4KHP Q;  2E5L L;  3HOX H;  4LFB L;  4DR7 L;  2VL6 A;  1VQA A;  5ELN A;  2R92 G;  4J15 A;  1UWV A;  1XNQ Q;  3FKI G;  3RLF A;  4DV3 L;  2R7Z G;  2PMZ E;  1E22 A;  1HZC A;  1EWI A;  5LMU Q;  2E5L Q;  2NVT H;  4LFB Q;  4A3M G;  1WJJ A;  3W1B A;  3ULL A;  4R4T A;  1VQ6 A;  1N36 L;  2K14 A;  1YEZ A;  4DV3 Q;  4KI0 A;  4GN5 A;  4JI2 L;  4DK3 C;  1SMX A;  2BA0 A;  1P16 A;  1PH5 A;  1N36 Q;  4GOP B;  3S14 H;  5C44 H;  2ES2 A;  1Q1E A;  5FJ8 H;  4HJ5 A;  4X65 L;  4GNX C;  1IXR A;  3KJO A;  1UE6 A;  4QIW E;  4JI2 Q;  3TQY A;  3HOU H;  5JJK A;  1BBW A;  1IBL L;  3CD6 A;  5IYB G;  1XNR L;  4IJH A;  3RN5 A;  2WP8 J;  1G6P A;  4A3E H;  3GD7 A;  3ZJY C;  4X65 Q;  4L5T A;  4BY1 H;  4JI5 L;  1KHI A;  2Y0S G;  5GAE C;  4PZ7 A;  1CUK A;  2KBN A;  3HOZ H;  3E0E A;  4LFC L;  1IBL Q;  5M3M G;  4C3H H;  1XNR Q;  4JC0 A;  1IBK L;  2ID0 A;  3S1N H;  3ER0 A;  1MKH A;  1Q12 A;  5GQO A;  1X6O A;  4JI5 Q;  2CCZ A;  4LFC Q;  4OO1 I;  3KF6 A;  4OWT B;  3CCS A;  1GD7 A;  1PHJ A;  1IBK Q;  1RL2 A;  4GLA C;  3J81 j;  1FJG L;  2R93 G;  4A3B G;  1I5F A;  1CSQ A;  1S3O A;  3RR5 A;  3PUY A;  1I50 H;  4AQY L;  3PF5 A;  1C0A A;  1L1O C;  1L2F A;  1FJG Q;  4BXX G;  1NTG A;  2RHS B;  1VQD A;  1V43 A;  3CCR A;  4A3K G;  3MEF A;  1Z47 A;  3VDY A;  5M3F H;  4A93 G;  4AQY Q;  3CCL A;  1WCM H;  4P75 A;  3HOY G;  1KRT A;  2K5V A;  1LUZ A;  2C35 B;  4P71 A;  1TWC H;  1VQP A;  2E2J H;  1CKN B;  4DKA C;  4DR6 Q;  1EOV A;  1JMC A;  3H15 A;  3HKS A;  2JEB I;  4R1J A;  1VQK A;  5C3E H;  2JJQ A;  2UUB L;  1UE5 A;  4A3F G;  3D0F A;  2Z6K C;  1PH9 A;  4IFD J;  1K83 H;  1X3F A;  1YZ6 A;  2LSS A;  2LXJ A;  3HOV H;  1OXX K;  4PMW A;  5FLM H;  3GTP H;  4IPG A;  2UUB Q;  1HZ9 A;  1XPO A;  1LYL A;  2YU9 H;  3HFZ B;  2F3I A;  4BY7 G;  2D0P A;  2JQO A;  3GTG H;  4K0K L;  2F4V L;  1VS0 A;  1A0I A;  2ZTD A;  2ZTE A;  1QZG A;  5IT9 c;  4QQB X;  3K80 C;  4GOP A;  2YTX A;  2F52 A;  2K52 A;  4LUV A;  4ME3 A;  1KQS A;  1N9W A;  1XPU A;  4K0K Q;  2F4V Q;  1Y1V G;  2VW9 A;  4JI1 Q;  4DR2 L;  3I4M G;  3L7Z C;  4JBM A;  1YBY A;  3B6Y A;  4DR3 Q;  2ATW A;  2FXQ A;  4JI4 L;  2B63 G;  3GTL H;  5JJI A;  2N78 A;  3F8T A;  1Y1W H;  3EBE A;  3JC6 6;  3PGZ A;  1OXS C;  2XTI A;  3OTO L;  2ZM6 L;  1IBM L;  4A3G G;  4LF7 Q;  4B3T Q;  2HT1 A;  4L5R C;  4JI4 Q;  4IPH A;  5IYD H;  4YWL A;  4IFD I;  3L0O A;  1CKM A;  2HQL A;  3OTO Q;  2ZM6 Q;  2AWN A;  1IBM Q;  1OXU A;  1VQC A;  5EAY A;  4A3D H;  5IP7 H;  1HNW L;  2ASB A;  3TS0 A;  2PNH A;  1HZA A;  4JI7 Q;  2CFM A;  3U58 A;  1VQI A;  2OQK A;  1HJP A;  4HIK A;  1HNW Q;  2CQO A;  1SRO A;  3M85 A;  2VQF Q;  2HHH L;  4DR1 Q;  2Q2U A;  1VQN A;  2R92 H;  4JV5 L;  4A3I G;  3FKI H;  4MTN A;  2JA6 G;  4OWX B;  4RG1 A;  3GDE A;  2VZA A;  2HHH Q;  1JJG A;  3PO3 G;  3CCJ A;  4JV5 Q;  2H5X A;  1CKN A;  1IL2 A;  2I5H A;  4LNQ A;  2A1A A;  4JI8 L;  5DLQ E;  1S72 A;  4DUZ L;  3CCQ A;  2ZJQ A;  4C3J H;  1V1Q A;  2MO1 A;  1NY4 A;  1U5K A;  4RMF A;  4X64 L;  4LF6 L;  4C3I H;  2EQS A;  2EIF A;  2QGQ A;  3A5Z B;  3CCM A;  4DV7 Q;  1IYJ B;  1VQM A;  1YHA A;  4JG2 A;  4DPG A;  4JI8 Q;  3S17 H;  4DUZ Q;  3U4Z A;  1B70 B;  5C4J H;  4DV1 L;  1G51 A;  4GKK L;  3F2D A;  3M9B A;  2KHI A;  4QJF A;  5IYB H;  3OW2 A;  4LF6 Q;  1Q82 C;  4DK6 C;  4A3J G;  3T1Y L;  1GM5 A;  3STB D;  4Y7N H;  1JB7 A;  4XTC S;  4GKK Q;  4HID A;  4KHP L;  2JA9 A;  1E1T A;  2OTL A;  3CQZ H;  1ASY A;  1J5E Q;  2JA8 G;  4B3S L;  1EIF A;  4OO1 G;  2NZO A;  3WWV A;  2AHO B;  3T1Y Q;  4WJ3 M;  2IX0 A;  5LMU L;  3IRB A;  1I3Q H;  1E7Z A;  2UXC Q;  4EX5 A;  4B3S Q;  2UXB L;  2CWP A;  1EFW A;  3UDI A;  4X62 L;  3CP0 A;  1VQG A;  4BXX H;  2UXB Q;  4A3K H;  1TWA H;  4LUO A;  3H3V I;  4A93 H;  1PYS B;  1VQF A;  4H02 A;  4X62 Q;  4IPC A;  1CKO A;  3PUV A;  3HOY H;  3S1M H;  1YVC A;  4DV2 L;  4GNX A;  1JT8 A;  3NEM A;  3NEN A;  1TXY A;  2K75 A;  4A3F H;  4O2D A;  4P72 A;  4OXP A;  2EXD A;  4DV2 Q;  3KYH C;  4MNO A;  2B3G A;  2VUM G;  1I6H H;  3CC2 A;  2R7D A;  2IHF A;  1TWF H;  2UXD L;  4O0A A;  5LMN L;  2XGT A;  2MQH A;  3I55 A;  4UY8 C;  3D31 A;  3BZC A;  4KLK A;  1A62 A;  4OWW B;  4A3L H;  1S40 A;  1U0L A;  4EQ5 A;  1PA6 A;  1E24 A;  2UXD Q;  1VQ4 A;  1SRU A;  1PVO A;  5LMN Q;  4LW1 A;  1EQR A;  2NVY H;  3CXC A;  3CF5 A;  1PYB A;  3TRZ A;  3RNU A;  3I56 A;  2DUD A;  2MO0 A;  2PI2 E;  1XMQ L;  1BKB A;  3H0G H;  3I4M H;  1MJC A;  5HGQ A;  5FLX c;  4LF4 L;  1Q8K A;  4TVA B;  4GS3 A;  3RLO A;  2MFI A;  3CW2 C;  1HR0 L;  4DR6 L;  1PH1 A;  3L2P A;  1XMQ Q;  1PH6 A;  4OX9 L;  3GTQ H;  4IFD G;  1ASZ A;  2N8N A;  3PUX A;  4X66 L;  3J7Z C;  3PIO A;  1HNZ L;  4LF4 Q;  4YWM A;  4APV A;  2B29 A;  1HR0 Q;  4DV5 L;  1YNX A;  3OYY A;  4OX9 Q;  2VS1 A;  1YHB A;  3I4N G;  1HNZ Q;  4X66 Q;  2K5H A;  4JOI C;  5M5X H;  3KOJ A;  2ZJR A;  4DV5 Q;  1GVP A;  4B3M L;  2YTV A;  1PFS A;  4AYB E;  3BJU A;  1VQ7 A;  5IWA L;  3CCE A;  2JA5 G;  2K5N A;  4YCV A;  1HH2 P;  1HZB A;  4JI1 L;  1O7I A;  4A3I H;  1QVC A;  1JJ2 A;  1QVG A;  2RCN A;  1VQL A;  1CSP A;  1SR3 A;  3I7F A;  3K7U C;  5FJ8 G;  5C44 G;  2JA6 H;  4DR3 L;  2JA7 G;  3ERS X;  2JE6 I;  3I4O A;  5IWA Q;  3PO3 H;  3RZD H;  1C7Y A;  2WB1 E;  3E9H A;  1DGS A;  3PIP A;  4LF7 L;  1EYG A;  4B3T L;  1YJN A;  4NXN Q;  3S1R H;  1K8A C;  4BA2 I;  3J80 i;  1P8L A;  3CME A;  2AMC B;  1PH3 A;  1N33 L;  3CC4 A;  3GO5 A;  2DGY A;  3M4Q A;  2GVA A;  3RN2 A;  4JI7 L;  2ALY B;  3G4S A;  4A3J H;  3RZO H;  4GOP C;  1VQE A;  2I5L X;  2KCT A;  1N33 Q;  4A3C G;  2WAQ G;  2VQF L;  1WYD A;  2RHQ B;  5IYC G;  1J6Q A;  1YIJ A;  4YWK A;  4DR1 L;  1KC8 C;  2AKW B;  4DV6 L;  1PH2 A;  4XIG S;  1PH8 A;  1EUJ A;  2OWO A;  4GNX B;  2IX1 A;  3PO2 G;  1AH9 A;  3G48 A;  1K3R A;  1SE8 A;  2CWA A;  1YIT A;  1A63 A;  4DV6 Q;  3J80 c;  2IHE A;  2IT1 A;  5GAD C;  4HJ9 A;  4GLX A;  1PH7 A;  2R7Z H;  3F1Z A;  4NB3 A;  4LF9 L;  3M7N A;  4A3M H;  1FGU A;  2NVQ H;  1I94 Q;  1UE7 A;  3F2C A;  4DV7 L;  4QGU A;  4DAM A;  2E2H H;  1GKH A;  4DR5 L;  2UU9 L;  4LF9 Q;  3G6E A;  5C0X I;  4POF A;  2GVB A;  3HOV G;  4BA1 I;  3T1H L;  2HIX A;  4JBK A;  4KHZ A;  4DR5 Q;  5C4X G;  2JK8 A;  2UU9 Q;  5FLM G;  1X54 A;  2D0O A;  5BR8 L;  1K0R A;  1OXV A;  3PCO B;  3AFP A;  1J5E L;  1VQB A;  1MIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...