4LF6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf6L00
2R7ZG 5JJIA 1X65A 4YY3L 4GNXC 2JA8H 4GN3B 4LF9Q 3S1QH 1KAWA 5J3BA 1YI2A 4YWKA 3F1ZA 4DR7Q 4O2DA 5IWAQ 3PUZA 1Y1WG 2F4VQ 2Z6KA 3RN2A 1VQ4A 1K8AC 4L5SA 3KFUA 4OONA 3TQYA 1K83H 2ALYB 3RLOA 4A3GH 3PO3G 2RHQB 1TWGH 2FXQA 1I94L 1XMOL 2KBNA 3RNUA 3A5UA 2YTYA 3PUYA 1SRUA 5C3EG 2VQEQ 3J7A5 3RZOH 3GTPH 1JJGA 3I4OA 4QIWE 1SROA 2VW9A 1X9NA 1IBKL 5M3MG 2KENA 2B63G 4LFBQ 1G291 2KCMA 3I4MG 4DV5L 1E1OA 1TWAH 5IYCG 4NXNL 5IYBH 3CC2A 4A93H 4WJ4A 4GOPC 5FLMG 4DR3Q 4DR4L 2F52A 1WYDA 3AYHB 1JMCA 2K5NA 4UY8C 2BA1A 1NBWA 1X55A 4DV4Q 3SGIA 4TQUS 5C4JH 2JA5H 1VQCA 5E7NA 3CC4A 2E2HH 5IP9G 3FKIH 3U4ZA 4BY1H 4OWXB 3PUVA 2WB1E 1UWVA 3K8AA 4X66L 3UDIA 1FJGQ 1JJCB 1U0LA 4GKJQ 1HR0Q 1BVSA 2CCZA 1XPUA 4C3IH 2CFMA 1JE5A 1QVGA 1PFSA 1VQ5A 3H3VH 5K36G 4JI8Q 3PF5A 3HKZG 3S16H 4A3LH 4JI2L 3CW2C 2ZJRA 2BH8A 3F8TA 1PH9A 2E5LL 4BXXG 4LUVA 4QL5A 1YVCA 4Y52H 3BU2A 2VUMH 4OX9Q 1RL2A 3U58A 1E24A 5IYDH 3UDFA 1EQQA 1PH3A 3S15H 2R92H 3NEMA 1VQJA 2IT1A 3CMAA 2D62A 1MIUA 1N36Q 4A75A 4LFCQ 3IRBA 4POGA 4DR6L 4L5RC 4DV4L 4JBJA 1WCMH 4DV0Q 4GS3A 1QZGA 2JA7G 2JE6I 5IP7G 4JI4Q 3F2DA 4DV1Q 3RLFA 1CKNB 3GO5A 1FJGL 4DR5Q 4YCVA 3TS0A 4B3SL 1YZ6A 3PIPA 4AQYQ 1Q7YC 2E2JH 1HR0L 1I50H 1Z9FA 2JEAI 3UDGA 1AE2A 1SN8A 4JI8L 1Y1VH 4AIMA 1VQMA 3U4VA 4X64L 4B3RQ 2HHHQ 3CCUA 3H0GG 4KI0A 3T1HQ 1WFQA 4A3JH 4A3EG 1TWHH 3I4NG 4KHZA 5C4XH 2K5VA 1VQ7A 4NB3A 1P8LA 1HH2P 1NMGA 1PHJA 4OO1I 1V1QA 3FP9A 4JOIA 1HZ9A 3ULPA 1OXSC 1FL0A 1NY4A 1OTCA 1UE1A 4DR1Q 3F2CA 3CPWA 2YV5A 2NVTH 4PZ6A 4LFCL 4APVA 3S14H 3HFZB 3I2ZA 1NE3A 3GTGH 2NN6I 4A3BH 4BBSG 1HJPA 4O0AA 4P74A 2Q2TA 1RIPA 3PF4A 1CKMA 4IJLA 1HNWL 3U50C 4JI0Q 3AFPA 4HIDA 3PSIA 3HOVG 1Q82C 4NXMQ 3GTJH 3K0XA 3OTOQ 3S24A 4LF5Q 3ZJYC 2QA4A 3HOYH 3KJOA 4OWTB 1XJVA 2UUBL 1VQOA 3CCEA 4A3MG 4LF7Q 4IFDG 4A3CH 3PCOB 4MZ9A 3NELA 4JI1L 4C3JH 3WWVA 5FJ8G 5FLXc 3UE0A 4HJ5A 3H3VI 1I94Q 2HIXA 1UE7A 5M5YH 4XTCS 4A3IG 1VCIA 2E8GA 2WP8J 1KQSA 2DGYA 4A3KH 4WJ3M 1CUKA 3RN5A 4IPGA 4BBRG 4R4CA 1IBKQ 1IXRA 3KYHC 2NZHA 5M3FG 3HOWH 4DR1L 2PQAB 3EN2A 4JBMA 1N34Q 3L2PA 4DV5Q 2VY3A 3J81j 1MJEA 1HZCA 3RR5A 3PIOA 1PH6A 5H1SE 4HJ7A 4DR4Q 2XGTA 2A8VA 1O7IA 5JEAJ 2K5HA 1R9TH 2RHSB 4JI0L 3I56A 4NPSA 1QVFA 4AYBG 2PQAA 5GAEC 4YCWA 1VQKA 5IYBG 2K75A 1KRTA 4NXML 3OTOL 4LF5L 1YEZA 3PGZA 3HOXG 4A93G 1IL2A 3GDEA 2JA6H 1C0AA 4X66Q 2BA0A 2KCTA 4POFA 4A3FG 1L1OA 1EIFA 1PH5A 4LF7L 4BA1I 1Q12A 1QUQA 2WAQG 2VNUD 4HJ9A 1K9MC 1VQFA 4P72A 1HR0W 1JT8A 2JJQA 4JI2Q 3CCVA 1N9WA 3F2BA 4ME3A 1B70B 2R7DA 2BH2A 3KF8B 1VQNA 3ICEA 2E5LQ 4JC0A 5GADC 4L5TA 3CF5A 4DNIA 2EXDA 4DV6L 5JJKA 3TRZA 3EIVA 4IOCA 4R1JA 1N34L 4DAMA 1JB7A 3M7NA 5LMNL 4BY7H 2LXKA 4JV5L 2B29A 1VS0A 1VQBA 3EBEA 3A74A 2D0OA 4LNQA 2Y0SG 3TEHB 4DR6Q 3UE1A 3OW2A 1HNXL 5M5XH 2VL6A 4ALPA 2IX1A 1C7YA 2IX0A 4A3DG 3W1GA 3CP0A 3M4QA 1EIYB 2PMZE 2I0QA 2D0PA 4B3SQ 2HIVA 4P73A 2ES2A 1E1TA 1SE8A 2R7ZH 1OXXK 1J5EL 2K4KA 4B3TL 4UP9A 1GM5A 5AJ3Q 2AWOA 4B3ML 3PUXA 2AKWB 4IPCA 3S1RH 3VDYA 1KHIA 1Q86C 1X3EA 1QVCA 4X64Q 1Y1WH 1VQEA 1XPRA 1D8LA 3D31A 1XNQL 2K14A 4QJFA 4DV2Q 4PZ8A 3PO3H 3D0FA 1XPOA 1Q1BA 4BA2I 4JYAL 4R4IA 4PG3A 3A5ZB 4QGUA 1WOCA 4MTNA 4QQBX 1M1KC 4IOAA 1X54A 2N49A 4DAYB 1XNRL 3PO2G 2LSSA 2R93G 1SLJA 3T1YL 4A3JG 1I3QH 4H02A 1WI5A 4DV3L 3GTLH 1WJJA 4JBKA 1IBLQ 1YIJA 4GNXA 3K7UC 2GVAA 2B63H 4LF6L 3I4MH 3L0OA 4X65L 1J6QA 3PV0A 2I5MX 1HNWQ 5ELOA 3S2DH 3STBC 4LUZA 5BR8Q 1AH9A 3M4OH 1W2BA 2DUDA 2PI2E 5FLMH 4R4TA 1VQ6A 4LUOA 4PMWA 5AJ3L 2NVXH 4A3BG 2UUBQ 3UDXA 1MKHA 1NJIC 4LF8L 3HOUG 1PV4A 4JI5Q 4IPHA 2VQFL 4JI1Q 5IP9H 1CSQA 1ASYA 1VQGA 2OTJA 3JAMc 1G6PA 3E9IA 3GTMH 4DR2L 4GOPB 4UPAA 1K73C 4LF4L 4DV2L 1FVIA 1KRSA 4GN4B 4K0KL 2VZAA 3HOZG 4A3CG 1PH2A 3K80C 4IFDI 1HNZL 5C0XI 1Q46A 1TWCH 3K81C 1M90C 5JJLA 2F3IA 3M4PA 1A62A 1YJNA 1LM0A 1EUJA 2MNAA 3CAMA 4A3KG 4GOPA 2Z6KC 4C3HH 3G48A 3JAMi 1PH1A 1IBLL 5HGQA 3MEFA 5LMNW 1BKBA 1LYLA 2NZOA 2WB1G 5C44G 1PH4A 5M5WH 1JJ2A 3KDFA 4Y7NH 1S72A 4EQ5A 1EQRA 5BR8L 4UP8A 1BBUA 4GN5A 3S17H 2R6GA 4HIMA 2C35B 4DKAC 5C0XJ 1QZHA 1VQIA 4JI5L 2JA7H 2JA8G 5IP7H 2Q2IA 4AH6A 1ASZA 2N78A 1PYSB 1GD7A 2NVYH 3HKSA 4JCVE 4J15A 2ZTDA 4UP7A 1V43A 4YWMA 4JI6Q 4KHPQ 1C9OA 1KC8C 4JI3Q 4A3GG 4DV6Q 4RG1A 1L2FA 3J7ZC 3G4SA 4IJHA 1EYGA 4LFAL 2OCEA 3ULLA 3H0GH 5IE8A 5LMNQ 3S2HH 2AMCB 1A0IA 2EQSA 4JV5Q 3I4NH 1AE3A 3M85A 3CXCA 4XIGS 1L1OB 4OO1G 4R4QA 1W3SA 2JA9A 3CQZH 2E2IH 1MJCA 1QUQB 2K52A 4HIKA 3FHWA 1HNXQ 4P71A 1TXYA 3MXNB 1XMQQ 1D7QA 2B3GA 4QY7A 4YWLA 2N3SA 3OYYA 4OWWB 1N33L 3W1BA 2MO1A 1I5FA 3HKZE 5HY6A 4JG2A 4BBSH 4HJAA 1J5EQ 2KHIA 1IBMQ 4B3TQ 1H95A 1KXLA 2L15A 3W5OA 4B3MQ 2JA5G 1SMXA 1YITA 2UUAL 3HOVH 1CSPA 3FKIG 2CQOA 4JI6L 4KHPL 3G71A 4BY1G 3A0JA 3CPFA 2Z0SA 1E3PA 4JI3L 5IY0A 1XNQQ 4A3MH 2UXBL 4EX5A 5JEAG 3CCJA 5FJ8H 1SR3A 4A3LG 2GN5A 4JYAQ 4A3IH 4IO9A 5GAHC 1KIXA 5EAYA 4DK3C 1YJ9A 4YHHL 1CKOA 4DV7L 1KD1C 4BBRH 1K8GA 1XNRQ 1EWIA 5LMUL 2LXJA 3AQQA 3T1YQ 2ATWA 2ASBA 4DV3Q 2OTLA 3KOJA 2VUMG 1FGUA 5M3FH 3Q8DA 1XMQL 1VQ8A 4LWCA 4LF6Q 5IYDG 2YTVA 2JK8A 4X65Q 4C2MH 1VQLA 3GD7A 1V9PA 2R92G 1DGSA 4JBWA 2UUCL 3RLNA 3CCLA 3GTOH 2UXCL 1GKHA 3STBD 1IBML 1VQAA 2AWNA 1WCMG 2AHOB 4JOIC 4IPDA 4OXPA 3CCSA 4LF8Q 2UXDQ 2OQ0A 2ZTCA 4YCUA 1N32L 2VQFQ 3CCMA 4PZ7A 3HOXH 2ZM6L 3GTQH 4DUZQ 4DR2Q 1GO3E 4A3FH 4LF4Q 1YHBA 4LF9L 4GNXB 1YJWA 1Y14B 4LW1A 4GKKQ 3H15A 4K0KQ 4DR7L 1K0RA 1Y1VG 1HNZQ 5IWAL 5GAGC 2F4VL 3NENA 1VQ9A 3TREA 1NMFA 4L5QA 5ELNA 3S1MH 3CD6A 5C3EH 4GLXA 3JC66 5C4XG 3KF6B 1B7YB 1VQDA 5M3MH 3L7ZC 2QGQA 3GTKH 2Q2HA 5IYCH 1Q8KA 1YNXA 1A63A 2VQEL 2UU9Q 2YU9H 1HZBA 4X62Q 5GQOA 1UEBA 2PI2A 3J81c 3KF6A 4LFBL 2RCNA 4GLAC 3AFQA 3ER0A 1VQPA 3S1NH 2UXDL 1K3RA 3DM3A 2WFWA 3CCRA 1X6OA 4A76A 3NBHB 1OXVA 3J80c 3ERSX 4A3DH 4DUYQ 3B6YA 2V1CC 4DUZL 1E22A 4DR3L 2HT1A 2YTXA 3K7AH 3I7FA 1E7ZA 3DLLA 1T9HA 3HOYG 3M3YH 2MO0A 1U5KA 4DK6C 2I5LX 1LUZA 1PH7A 3J81i 4GKKL 3KDFB 1EFWA 1IYJB 1KL9A 1X56A 5IT9c 1N8RC 4LFAQ 4TVAB 2I5HA 1UE6A 2VS1A 4FDBA 3J80i 4GKJL 4BXXH 4JI7Q 1PH8A 1B8AA 2CKZB 4AYBE 1L1OC 1XTDA 4HJ8A 4GLVB 3ULJA 2OQKA 2K50A 3HOWG 1IZ6A 4MNOA 1CKNA 3PUWA 2UU9L 4X62L 2HQLA 1HZAA 3E9HA 3PO2H 2R93H 2WAQE 2A19A 1OXTA 1N33Q 4OX9L 3M9BA 4IFDJ 2ZJQA 1Q1EA 1S40A 1Q81C 1SFOH 5GROA 1OXUA 4DUYL 4HIOA 1A8VA 2CWPA 2YYZA 2UUAQ 1EOVA 2CWAA 2JEBI 2QEXA 1N36L 2JA6G 3BZKA 4KLKA 2GVBA 4DV0L 5DLQE 3CC7A 1YHAA 4YY3Q 2IHFA 3HOUH 1YHQA 4DV1L 4DPGA 2ZJPA 4JI4L 1PVOA 2UXBQ 3TS2A 1X3FA 4DR5L 1I6HH 3G6EA 3LGJA 3BJUA 4AQYL 2Y0SE 2Q2UA 2NVQH 4RMFA 2IHEA 2PNHA 4JI7L 1BBWA 4A3EH 4YHHQ 4DV7Q 2XTIA 2OWOA 3HOZH 1PYBA 5C0XG 5LMUQ 3CMEA 1PA6A 4B3RL 2ID0A 2H5XA 2HHHL 2IY5B 1VQHA 1NTGA 1GVPA 1LTLA 2R7FA 3T1HL 4A4IA 1UE5A 1XMOQ 4BY7G 1X3GA 2N8NA 1TWFH 1Z47A 2JQOA 2MFIA 4P75A 2NN6G 2RF4A 1G51A 2UUCQ 1S3OA 3AEVA 2UXCQ 5C44H 2EIFA 2MQHA 3E0EA 3CCQA 3RZDH 4R4OA 1P16A 2ZTEA 3KLWA 1L0WA 3KJPA 3BZCA 2KHJA 2A1AA 1YBYA 4NXNQ 3I55A 1N32Q 2ZM6Q 4X6AH
chains in the Genus database with same CATH superfamily
5JJIA 4YIJA 1C8CA 1EYDA 1Y8OB 4GN3B 1U4RA 1KAWA 5J3BA 3MFYA 2QDLA 2NVYB 5IWAQ 4U673 1K83H 4A3GH 3HOWB 1XXGA 4IUNA 1Y69U 1TWGH 2PO4A 1ESRA 2QILA 2EJMA 2YTYA 5C3EG 1KDBA 3RZOH 4CDCC 4QIWE 2VW9A 1SROA 1X9NA 1TS5A 2LMCB 4LFBQ 1G291 2KCMA 4XQNA 1TWAH 1F2YA 2SNMA 1C4QA 1YNNC 4IUVA 3OMGA 4NXNL 5A35A 5C5LA 3J7YW 2F52A 3AYHB 1KTKA 2BA1A 3IAYA 4DV4Q 4IUTA 2JA5H 2E2HH 2NYZD 4OWXB 3K8AA 1UWVA 2MP1A 4TKOB 4X66L 1FNUA 1U0LA 4A3MB 3FDTA 1BVSA 1XPUA 3ND8A 3T53B 2Q8RE 1EFID 4JI2L 1PTOC 4A3IB 1EQVA 4BXXG 4B9XA 4C3HG 2EYHA 2XSCA 4ZUJA 3GQBA 5JAVA 1RL2A 4ABNA 1DJRD 1FYCA 3U58A 5IYDH 3UDFA 1M4VA 3S15H 4J1MA 1W6KA 2R92H 2IT1A 2R7ZB 1MIUA 2XWBB 3IRBA 5BN3A 4POGA 3TMEA 3VR4A 3MEHA 4GS3A 1QZGA 4AYBB 2JE6I 4NMZA 5IP7G 4ZK9B 5F2DA 5C3WA 4DV1Q 2IL8A 3GO5A 2EYLA 1Q7YC 1HR0L 2JEAI 3UDGA 3PO3B 2WAQB 5E3FA 2FFKB 5CV4A 4KI0A 3K6OA 3C2PA 4A3EG 3I4NG 2K5VA 3BDOA 5AFWA 3I4MB 1V1QA 3DUZA 3FP9A 1HZ9A 4JOIA 3ULPA 4BWGB 3BZDB 3U9SA 4LFCL 3NE5B 3V96A 2F0OA 4APVA 4N9PA 3GTGH 4V190 1CZWA 4BBSG 3U9OA 4P74A 4HAEA 3PF4A 1QILA 2K01A 3I4LA 1ESFA 2CH4A 1F9QA 1TT2A 5IIFA 3OTOQ 3S24A 4LF5Q 2PNRC 2UUBL 2B2UA 3CCEA 4LF7Q 1RTOA 3E5SA 3W3AA 1HA6A 1VDZA 3NELA 3TZUA 5JPMC 1CQVA 1I94Q 2HIXA 2E8GA 4WJ3M 1RCVD 1CUKA 2FJ2A 4NW2A 1SE2A 2F0JA 2K6AA 1IBKQ 1IXRA 1DXMA 3EN2A 4DF7A 4DV5Q 1B2TA 2R93B 2EYJA 1MJEA 1Y8NB 4DR4Q 2XGTA 1YNND 1O7IA 5G3LD 3I56A 4NPSA 4DAVA 1QVFA 4NXML 5IYBG 2K75A 4ULLA 2JA6H 4G7OC 2BA0A 2F0SA 3MXGA 4ODGA 4POFA 5NUCA 3HOUB 1MGSA 2A69D 1QUQA 3Q6SA 5FLXE 2VNUD 3SHLA 5E4XA 3H0GB 4P72A 1HR0W 3S2HB 1JT8A 2K1BA 2XWJB 4CJ0B 3F2BA 4ME3A 3ICEA 4KTAA 2E5LQ 5GADC 1O7YA 4DNIA 3CKIB 1PZJD 3QJYA 3EIVA 3N6RA 4R1JA 1N34L 4DAMA 1JB7A 3AU7A 4BY7H 2B29A 1WTOA 2EYFA 2NN6H 1S5BD 2RA4A 2WB1B 2D0OA 3H3VC 3UE1A 3OW2A 2G5DA 5I2YA 5M5XH 4XQJA 1C7YA 3HOVB 3QG1A 1CQFA 2IX0A 3CP0A 3M4QA 4WJWA 4N8X1 5A2QE 4UP9A 3VDYA 1SE3A 2EXZA 1X3EA 1QVCA 1Y1WH 1A2TA 1VQEA 1OO9B 2J4XA 1MHWC 2HUGA 4DV2Q 3DEPA 4PZ8A 4R4IA 4QGUA 2G9DA 2ICEC 5J22A 2N49A 1JCKB 4DAYB 1LLRD 3PO2G 2LSSA 1SLJA 1I3QH 2IW3A 4DV3L 1IBLQ 3IFTA 2Z9HA 1SAPA 3L0OA 4X65L 1WTQA 5EPKA 4LUZA 1H9JA 5BR8Q 3GTQB 1W2BA 2DUDA 5EGTA 3M4OH 1AH9A 3ITPA 4DAYA 4LUOA 3PMFA 1MKHA 5C4JB 2LS01 5EKLA 2Z4HA 3FKIB 2VQFL 4JI1Q 1ET9A 5IP9H 2B2WC 1ASYA 4V0BA 4DNTB 4DR2L 3VR3A 4GN4B 2VZAA 4A3CG 2XNAC 3K80C 1PH2A 4IFDI 5C0XI 1GJXA 1TWCH 5JJLA 3M4PA 3NWSA 5D65A 1A62A 1EUJA 3SR1A 1X3PA 3G48A 1JC7A 2Q8TA 4L8JA 1AP0A 2Z4IA 4A3DB 4GN5A 1K8MA 3S17H 1D1IA 4DKAC 1VQIA 2JA8G 2EE1A 2RBMA 4G7HC 3JAME 1ASZA 2F0WA 1V1OA 2NVYH 1I50B 2ZTDA 2RCFA 4DN4M 1DOKA 1BDOA 4ZAIA 1Y1VB 2XRQD 4DV6Q 1DD2A 2OCEA 1RDPD 5IE8A 5KGUA 2AMCB 1SEBD 1A0IA 3I70A 4JV5Q 2J0TD 3NBIA 4XIGS 2JP1A 4KD4A 1BNZA 1B44D 5J39A 2B3GA 4KKSA 5KNBA 2N3SA 5D3DA 4A3BB 3RUZA 3P20A 3T16A 5CYUA 2KHIA 1IBMQ 4QIWB 1KXLA 1B9NA 2JXMB 1I6HB 1SMXA 2L5TA 1TS3A 2UUAL 4JI6L 3EA6A 4BY1G 3G71A 3HOYB 1SYGA 3NK9A 1E3PA 1XNQQ 4A3MH 1CK1A 3R2IA 5JEAG 3LWEA 4R9WA 3OIQA 2RDHA 1BOSA 5M5YB 5KNCA 1H9SB 4A3IH 5EAYA 1YJ9A 3NTHA 1KD1C 1XNRQ 2LXJA 4EVOA 2ATWA 4HMIA 1A2UA 1FGUA 3OMCA 4LWCA 4LF6Q 4K5WA 3GD7A 4I65A 3VA5A 1AFPA 2UXCL 1VQAA 1F2ZA 2AHOB 2BCOA 4IPDA 4JOIC 4OXPA 4PNYA 1N32L 2DNCA 1RHPA 4TSSA 3VYRA 4DUZQ 1GO3E 1YHBA 1YJWA 1XYIA 1Y14B 1TWGB 3PIO3 4GKKQ 1EZ6A 4K0KQ 1DOMA 2B8GA 5IWAL 3SK6A 2F0VA 1NMFA 4L5QA 5ELNA 4ZLTF 4M1UB 2B2UC 3KF6B 2B2TA 1I4PA 1II3A 1JOKA 3DWPA 3FRPB 2YU9H 4FF4A 3PQIA 1SNQA 2PI2A 1B53A 3KF6A 5KNDA 4LFBL 4GLAC 1VQPA 4ALPA 3CCRA 2E2HB 3NBHB 3J80c 1U9RA 1D5ZC 2V1CC 2PZUA 2ENBA 2YTXA 3I7FA 1E7ZA 3K7AH 3NQIA 2I5LX 1Q3LA 1IYJB 3NBHA 2SNSA 3D4DA 2FINB 4FDBA 1EY6A 1O7LA 3MFGA 4AYBE 1JOOA 3ULJA 3K5NA 1V1PA 1TVXA 2R92B 4X62L 3QO2A 1HZAA 3E9HA 2R93H 2WAQE 3TDQA 3J81E 1OXTA 1N33Q 1DM0B 2PQEA 2IWHA 4E6IA 3MA2B 1Q81C 4LJZC 2KECA 1OXUA 5IGGA 2YYZA 2JEBI 4FNFA 2RDGA 1ENCA 5E4WC 3MXPA 3A54A 3CC7A 4YY3Q 3HOUH 1JQYD 4DV1L 2AUJD 2KEDA 5IT9E 1X3FA 3CRKC 3G6EA 1GUTA 2Y0SE 4RMFA 3I73A 4C1NK 5CV5A 1UEAB 2A6EC 2H5XA 4KN4C 1LTLA 4Q5VA 2C9OA 4IOAA 1ENAA 2N8NA 4C3HB 1EU4A 1Z47A 3BVMA 3GTGB 1PYWD 4RKBA 3FEWX 2E2DC 3E0EA 2DY8A 3RZDH 1L0WA 3KLWA 2RDFA 4RGTA 4X6AH 2A5HA 4K6DA 1X65A 5C6AA 1CTMA 3S1QH 5I9PA 2B2VA 2R61A 1JE4A 3F1ZA 3PUZA 2F4VQ 2MPMA 3TBIB 4KKTA 1K8AC 4L5SA 3KFUA 3TQYA 2CW0D 2FXQA 1I94L 1XMOL 3O13A 1SRUA 4M8AA 1JJGA 1RKNA 5FO8B 1IBKL 2QF7A 2E2IB 2KENA 1FNVA 4DV5L 1EY7A 5IYCG 2A73B 1SDFA 5I2XA 2KVMA 3NQTA 4DR4L 1WYDA 1JMCA 2M2LA 2PZWA 4I7ZC 4S3SA 5C4JH 2K5QA 1LV9A 5E7NA 3FKIH 2WB1E 4GKJQ 3A56A 2NTSA 3FPPA 2Z8LA 2CCZA 2CFMA 4JI8Q 3PF5A 4BY7B 1Y8PB 4J6HA 1NR4A 1PMRA 2E5LL 4QL5A 1YVCA 5BN5A 4Y52H 2O2LD 2OF1A 3CRLC 2TMPA 5M5XB 1BR9A 2IPKD 1GHJA 4NDXA 2E76C 1VQJA 3W2DA 2D62A 4A75A 3C3LA 4ZKBB 1H9KA 2JA7G 2F0QA 1FJGL 1EEFD 3D4WA 4RGNA 3PIPA 1I50H 1Z9FA 1SYCA 1Y1VH 4AIMA 2JN4A 5IGCA 3CCUA 3IL8A 4C1NI 1XTCD 1MSHA 1I3QB 1TWHH 3DWQA 1IW7D 4KHZA 5C4XH 4TRDA 5M9OA 2O5IC 5M3MB 1ML0D 1NMGA 5FKAC 4XQQA 1OXSC 1FL0A 3WOFA 1LTBD 1OTCA 3M4OB 1ZYRC 4DR1Q 3F2CA 5IGDA 4PZ6A 3I2ZA 1NE3A 2HDMA 4A3BH 2DJGC 1D5XC 1RIPA 2XVSA 3U50C 3FVQA 4JI0Q 1GUNA 1Q82C 1PRTD 3GTJH 2CVRA 3HOYH 3KJOA 4OWTB 1XJVA 1IKLA 1TS4A 1MD2D 4IFDG 1I4GA 2NZ1D 4MZ9A 1LTID 2EDGA 3GV6A 4JI1L 4C3JH 2ZT9C 5FJ8G 1UE7A 2K03A 5M5YH 1VCIA 4RGMA 3ND9A 5LL6S 1BCPD 1D6EC 4BBRG 3BYYB 1SYEA 4HCEA 5M3FG 1NSNS 1SMYD 4H44C 3BDLA 3S17B 2FMCA 3PIOA 4HJ7A 1RTNA 3MWYW 2B2TC 1SFOB 4F8MA 5GAEC 1S5ED 1VQKA 1KRTA 3HOXG 1IL2A 3H09A 1C0AA 2L12A 2PZTA 4BA1I 4QMGA 1Q12A 1B50A 1D5MC 1VQFA 3G7LA 4CDDC 1N9WA 2K5WA 2F0NA 2BH2A 2R7DA 5I9OA 4IUPA 4UAIA 4JC0A 5C0XH 1F9SA 3RD4A 4DV6L 3IKJA 3DM1A 4J8QA 4JV5L 1VS0A 3TP6A 3OWFA 1U4MA 5FOBB 4CBVA 3A74A 3TEHB 3ZYYX 4H0LC 4RWSC 2VL6A 4ID6A 3H6MA 3W1GA 2B39A 4FXDA 1E0BA 2PMZE 2A69C 4B3SQ 3D8GA 2HIVA 2ES2A 1SE8A 1OXXK 2JA8B 4I7AA 5AJ3Q 2F0FA 3PUXA 4IPCA 1KHIA 1Q86C 1PLFA 4X64Q 1EYAA 3OIPA 1VF7A 3D31A 1XNQL 2K14A 3FPUB 1QE6A 1EIHA 5COYA 4BA2I 3MZ5A 5CV9A 1JWMD 1ZXTA 1WOCA 1BO0A 4CDEC 2P5ZX 1XNRL 1WI5A 1ZYRD 3K7UC 2GVAA 1K3BC 4LF6L 4IUQA 1NUCA 3LX0A 1J6QA 1HUMA 3S2DH 4A93B 3STBC 2PI2E 2AUKA 1TIID 2NVXH 1JWUD 3UDXA 1CI3M 4ZQ3A 4DGZA 1PV4A 4JI5Q 4IPHA 1E2WA 2OTJA 1G6PA 4GOPB 2L4NA 2K05A 1SXTA 4C3IB 3CU7A 4K0KL 2EVBA 4X3SA 4ZUIA 3HOZG 3OW7A 3S16B 1CA5A 2B2VC 2VXWA 2F3IA 1LABA 3L9AX 3SK8A 1LM0A 2DN8A 3CAMA 2YU9B 4GOPA 4C3HH 2Y0SB 1PH1A 5HGQA 3MEFA 1WD1A 1DCZA 1EY9A 3KDFA 4JPBW 4Q0FA 3I90A 4B08A 4EQ5A 1STBA 1GHKA 3E6ZX 1BBUA 1BBXC 3J7AF 3K7AB 2RQXA 3DHQA 2R6GA 2KA7A 2NTTA 5JVG3 2FMMA 5C0XJ 5T1IA 4ZKCB 1WD0A 2C5CA 5IP7H 3URYA 4AH6A 3VR5A 4JCVE 2WINB 3AMUA 1V43A 1C9OA 1I6VC 5EPJA 3KUPA 4LMQD 1G91A 4RG1A 1L2FA 1G6ZA 4X3TA 2DJFC 1GUWA 5LMNQ 2L9HA 4A3JB 3I4NH 1TU2B 2KQ3A 4OO1G 3HRZC 4R4QA 4HTHA 4OEMB 1EYCA 2E2IH 1HA5A 1QUQB 2K52A 3BG3A 4P71A 1XMQQ 2MJ8A 4HN7A 2QDBA 2NVTB 4YWLA 5FLXL 5CV8A 1N33L 2MO1A 5HY6A 5CV6A 4BBSH 3W5OA 2PW5A 1YITA 1CA6A 3LWUA 1CSPA 4KHPL 1QNUA 3A0JA 1L0XB 4B9WA 2Z0SA 4JI3L 5IY0A 1ICFB 3K5LA 4CJ1B 1SR3A 4A3LG 2GN5A 1EWHA 2F0IA 2QKIC 1S5DD 5GAHC 4DK3C 4A3KB 1KIXA 1KLGD 1CKOA 1EWIA 5CMDA 1AN8A 3T1YQ 3KOJA 2VUMG 3RZDB 3EFXD 3Q8DA 2L11A 5A2QL 1V9PA 1DGSA 3RLNA 2CQAA 3STBD 1NNXA 3S1QB 2AWNA 1WCMG 3SDZA 1ILPA 4OELB 4LF8Q 2UXDQ 4MIUA 2AQ3B 2ZTCA 4YCUA 5FO9B 4PZ7A 4DFAA 4LF4Q 3T13A 1PRTB 4F88A 3BVGA 2BDOA 4LW1A 1H9RA 3H15A 1K0RA 1HNZQ 2F4VL 3NENA 1VQ9A 1UUPA 3WOEA 3JC66 2M00A 4OL7A 5M3MH 2QGQA 2Q2HA 1BCPB 5JJZA 4JK1C 1PFMA 2F0DA 2HDLA 4IZ8A 2MUYA 1IYVA 1WTVA 2RCNA 1K3RA 3DM3A 1X6OA 4NP5A 5KIXA 2HT1A 1TY2A 3SK4A 4F7XA 4KY7A 1LT6D 1T9HA 3M3YH 3WDNA 2KJXA 1KL9A 2HCCA 3A7LA 3J80i 4RFBA 4GKJL 3C1FA 3G6JB 1PH8A 4RA8A 4HJ8A 1XTDA 1TY0A 2OQKA 3HOWG 1A6XA 1CKNA 3PUWA 2UU9L 2I46A 1LACA 1JWSD 2HQLA 3PO2H 5JOBA 3KBXA 3GTLB 2A19A 2EY6A 3JAML 4IURA 3T51B 3M9BA 1KNEA 2ZJQA 2DNEA 1S40A 1SBBB 4EQPA 1I4XA 3I3CA 1SFOH 4DUYL 3MTSA 4X3UA 4H13C 2LY7A 1G2TA 1AW7A 5DLQE 5LHY1 2F0KA 1CHPD 3TS2A 2K32A 4XT1B 3T56B 3GTMB 2JYOA 4KKUA 4JI7L 1J9OA 2PNHA 1TWHB 4FXKC 4OIKA 3V05A 5C4XB 4YHHQ 4KJNA 2XTIA 4FO2A 4CKEA 1PYBA 5C3XA 3PIP3 2IY5B 2ID0A 2RVLA 1GVPA 1R4PB 4A4IA 1UE5A 3TP5A 2SDFA 1KLUD 5M5WB 5EBCA 1NCVA 2SOBA 4WORA 4R4OA 1GUSA 1P16A 1BUVT 5CORA 3KJPA 3KK7A 2KCNA 3BZCA 2KHJA 2A1AA 1YBYA 3A8KE 5ELCA 1FGBD 3GTJB 4NXNQ 5I6WA 2ZM6Q 3DMUA 2R7ZG 2JA7B 3ONAB 2WKCA 4C3JB 4LF9Q 3C46A 2JA8H 1EY5A 3TN2A 4RHSA 4YWKA 4DR7Q 4O2DA 1T5XD 3V2TA 1C48A 2PMZB 4MHEA 2OXPA 2ALYB 3PO3G 2KCCA 3K58A 2KBNA 3P7JA 5LL6X 3A5UA 3GTPH 3KLSX 3I4OA 3CQZB 2F0UA 2BE5D 2B63G 3I4MG 4GZYC 2WACA 3NHHA 4A93H 5IGEA 3QR8A 4GOPC 1A15A 1I4HA 3KF8A 5FLMG 4DR3Q 4UY8C 1NBWA 2A6HD 2CHBD 4TQUS 1VQCA 2CW0C 3U4ZA 4BY1H 3PUVA 3UDIA 1JJCB 1HR0Q 2L1BA 4C3IH 1K28A 5JEAH 1PFSA 5K36G 3HKZG 3S16H 3CW2C 2D5DA 2ZJRA 2BH8A 3F8TA 5CBAE 3QWNA 1PH9A 5E1FA 3BDCA 4LUVA 1S5FD 4ILWA 3C1EA 4OX9Q 4K8JA 1E24A 1O80A 2Z6BA 1EQQA 1PH3A 4FF3A 3NEMA 3CMAA 3OPOA 4LFCQ 1N36Q 4L5RC 1SYFA 4DV4L 4JBJA 4CKCA 1V1PB 5EPLA 4KY5A 3RLFA 3HOXB 4B3SL 1HFNA 4KN7C 2NWGA 1PRTF 3VR2A 4K14A 4PMCA 3D6WA 1SNOA 3J81L 1VQMA 1AZPA 2XIWA 2HCIA 4X64L 5IODA 2HHHQ 3HGBA 5C3EB 3H0GG 1WFQA 4A3JH 4RCOA 1VQ7A 4NB3A 1P8LA 1SE4A 2IX3A 4OO1I 5J1ZA 1BCPF 3S2DB 3R2TA 1UE1A 3CPWA 2NVTH 3A7AB 5IT9L 1HTLD 2KHSA 2NVXB 2NN6I 3DXJC 1TQOA 5D3IB 3S1NB 4XT3B 4IJLA 1Q8IA 4HIDA 2OT2A 3HOVG 4NXMQ 3ZJYC 2QA4A 4DU9A 1LTGD 5HGTA 1VQOA 1PFBA 5JPNC 1NAPA 3I91A 3WWVA 1IW7C 5FLXc 3UE0A 2F03A 1EEID 1EOTA 3H3VI 3NTIA 4XTCS 3KBGA 4A3KH 4ZRZA 3RN5A 3TP7A 4R4CA 1O78A 2JSOA 1E2VA 3Q24A 2PQAB 4JBMA 1N34Q 3L2PA 3M4YA 2VY3A 4WFN3 1TS2A 4MTKA 2FHTA 1PFNA 2RSNA 3DWAA 1CT1D 5TSSA 1PRTC 2A8VA 2Z1CA 5JEAJ 2RHSB 1G8ZD 2F0EA 2PQAA 5FK9C 3OTOL 4LF5L 1YEZA 2IJ0A 4QUCA 4LF7L 4KJOA 4A3FG 4FF2A 1L1OA 1VF5C 3VA7A 4QCLA 5FO7B 1QCBD 1K9MC 1BCPC 3MXNA 2KEEA 2JJQA 4A3EB 3I4NB 1B70B 1SMYC 2WIIB 5C4HA 1KDAA 3CF5A 1RD9D 1U4PA 3MC0B 3IFDA 5JJKA 3NXWA 1EIGA 4IOCA 3D3RA 2E75C 3M7NA 5ELBA 5LMNL 4FXGC 4O42A 1F9PA 4BBSB 3NP8A 4HR7B 1JB3A 4KMUC 4DR6Q 2CH4W 4XXEA 4A3DG 1EIYB 1E1TA 1ZKOA 1KAAA 1GM5A 2K33A 2AWOA 1ICWA 2AKWB 4FP5D 3S1RH 4CKBA 3S9WA 4PV1C 2EYPA 3R8BA 1XWEA 1LTSD 1Q1BA 3A5ZB 4QQBX 1M1KC 3BYTB 3T1YL 4QUFA 4H02A 3GTLH 1WJJA 2A74C 5IGFA 4GNXA 4DK0A 3PV0A 2I5MX 4K8IA 1A3UA 1HNWQ 3CHBD 1D2BA 5CR3A 1KABA 1H9MA 4A3BG 1D1KA 4HCSA 1NJIC 4LF8L 1CSQA 3JAMc 3E9IA 3GTMH 5DM73 4UPAA 4LF4L 4DV2L 1ET6A 3RMHA 1HNZL 3K81C 2E74C 1IBLL 2VUMB 5LMNW 1LYLA 1B9MA 2NZOA 2X69A 5C44G 4EQNA 5M5WH 1JJ2A 1IKMA 4Y7NH 1EQRA 5BR8L 3K5MA 1I4QA 4UP8A 4HIMA 3HZXA 3P75A 1WVLA 4DAPA 3M3YB 1QNKA 2KUMA 3EVQA 1QZHA 2JA7H 4DK1A 2Q2IA 2NUCA 3GV3A 2N78A 3HKSA 1GD7A 5L37A 4J15A 4UP7A 4YWMA 4JI6Q 3R3OA 1SJED 4A3GG 2PPBC 5KYIA 1QWYA 1EYGA 3I8ZA 3PO2B 2EQSA 3M85A 3CXCA 3VYSA 3CQZH 1FNWA 1MJCA 1F2MA 4HIKA 2EY1A 3FHWA 1HNXQ 4XYOA 4U68A 3KLSA 1BXTA 3S14B 3OYYA 4OWWB 1HUNA 2EJGC 4UDUC 4FYDA 2F0PA 2K5DA 4HJAA 1J5EQ 4B3TQ 2L15A 4B3MQ 2JA5G 1IYUA 3NSWA 2CQOA 2MHVA 1RJTA 3CPFA 4IN3A 1QB5D 3Q23A 4FVMA 4IFDH 4EX5A 3CCJA 1HQRD 3QB3A 5FJ8H 5I6YA 4JYAQ 2X6GA 2H1EA 4YHHL 5EQ0A 1MBYA 4BBRH 2EY2A 5C5MA 3AQQA 3OWEB 2ASBA 2OTLA 5EJWA 3KLRA 4PMBA 5M3FH 1VQ8A 5IYDG 5BN4A 2KOLA 3QOJA 2JK8A 4C2MH 2R92G 3CCLA 4JBWA 3GTOH 2TSSA 2J7ZA 1GKHA 1IBML 1R9TB 3CCSA 1SYDA 1I4RA 2OQ0A 3CCMA 3HOXH 2WV6D 5T1GA 2ZM6L 3UI2A 2BDNA 4LF9L 1MSGA 1STHA 4C56C 4DR7L 4RCNA 3EQLC 4N8FA 5D14A 3S1MH 3TREA 2WKDA 4R8NA 5C3EH 4GLXA 3GTPB 1QJOA 1XX8A 3K57A 1B7YB 1VQDA 3NTKA 4JW0A 3GTKH 1GXDC 1ENFA 1RF2D 1Q8KA 1YNXA 4DXGA 1KNAA 4X62Q 3J81c 3S1NH 4A76A 1X3QA 1OXVA 1PTOH 2EOTA 3ERSX 3OOCA 4BY1B 3B6YA 1DYQA 3QOLA 4DUZL 4DR3L 1E22A 4OHJA 1FR3A 3DLLA 5DEHA 1U5KA 4GKKL 1LUZA 2ICIA 1X32A 3KDFB 3E0JA 1X56A 5IT9c 2QEJC 4LFAQ 1N8RC 1B1ZA 1UE6A 2BOSA 4BXXH 1L1OC 2GA4B 2PW7A 2K50A 2EJFC 2RKSA 3J80L 1A3TA 4OX9L 2B63B 4IFDJ 1Q1EA 2N88A 3J80E 3VYUA 5GROA 1PZKD 2AQ1B 3HP3A 1MI2A 2CWPA 2A68D 1O7ZA 1EOVA 2CWAA 2QEXA 1N36L 4L63B 1HHVA 2JA6G 4KLKA 5ELEA 1YHAA 2IHFA 2UXBQ 1PDQA 2NVQH 4IQZA 1LT3D 1BBWA 4A3EH 4RGOS 4DV7Q 4OGQC 2OWOA 3HOZH 2B2YA 5LMUQ 1TR5A 4LAAA 3X3NA 5IGBA 3HKZB 3CMEA 4RKLA 2HHHL 4BY7G 1XMOQ 4JVZA 2JQOA 4P75A 2MFIA 2NN6G 1G51A 2UUCQ 1IL8A 2EIFA 2MQHA 3CCQA 2L55A 4IUUA 1GUOA 2ZTEA 5CV7A 1S4ZA 2SEBD 1JICA 1PA6A 2F0LA 1Z6HA 4YY3L 4GNXC 1YI2A 5KEEA 3AB9A 4P2CB 1Y1WG 2Z6KA 1STAA 3RN2A 1VQ4A 4OONA 1DONA 4N9TA 3HG9A 3RLOA 2RHQB 3LNNA 1EL0A 3RNUA 3PUYA 3J7A5 2VQEQ 4OO1H 1PTOD 3P1HA 5M3MG 2LFNA 1E1OA 5IYBH 3CC2A 4WJ4A 2EYOA 4CGYB 2K5NA 1FD7D 2OEOA 1X55A 3I72A 3SGIA 1EQTA 5K5PA 1LO5D 3CC4A 1EZ8A 5IP9G 4LK1C 1WTRA 1FJGQ 1ILQA 4XDXA 1PZID 2I07B 3H91A 1QVGA 1JE5A 3H3VH 1VQ5A 1R4QB 4A3LH 2EZVA 2K04A 2BE5C 4CHTB 1HCZA 4K2LA 3BU2A 2VUMH 1VMPA 1WTWA 2A6HC 4RAUC 5C4ZA 1LTAD 1F77A 4KD3A 4DR6L 4DV0Q 1WCMH 3S1RB 4JI4Q 3F2DA 1CKNB 4DR5Q 4YCVA 3TS0A 1YZ6A 4AQYQ 2E2JH 4A3FB 1AE2A 1SN8A 4JI8L 4L6TB 3M7GA 3U4VA 1LTTD 4B3RQ 1AEXA 5DM63 3L3OC 5CBEE 3T1HQ 1SNDA 1IHZA 1HH2P 1YNJC 1PHJA 5ELDA 1NY4A 4X3KA 2G9HD 1CM9A 2XRSD 2YV5A 3OHXC 3S14H 3HFZB 1HJPA 4O0AA 2Q2TA 3K59A 1ZEQX 1CKMA 1HNWL 3AFPA 3PSIA 4K5XA 5ISRA 3K0XA 3TSSA 4KK7A 4A3MG 4A3CH 3PCOB 2QCPX 2D2CC 3EJIA 1Q90A 2F0HA 1Z7TA 2AQ2B 4HJ5A 2MGSA 4A3IG 2WP8J 2F4IA 1KQSA 2DGYA 5EKKA 2H4OA 4IPGA 4KV6A 4Y7NB 3KYHC 2NZHA 4OIJA 2F1MA 3HOWH 1E2ZA 4DR1L 4FF1A 3J81j 1HZCA 1JR0D 3RR5A 1PH6A 5H1SE 1LTRD 4K5VA 1VMCA 1R9TH 4EGVA 2K5HA 4JI0L 5HURA 4AYBG 4YCWA 1K8OA 4A93G 3PGZA 4EQOA 3SEBA 3GDEA 4X66Q 2KCTA 4K2KA 1PH5A 1EIFA 1SNCA 3HS0C 1S5CD 5DAUA 2WAQG 4HJ9A 4CDFC 1AZQA 3CCVA 4JI2Q 3KF8B 1VQNA 1JOQA 3H94A 4L5TA 2EXDA 3FMCA 4C3IG 3TRZA 2D9UA 1STYA 2RSOA 1GUGA 2LXKA 1T5EA 1TWFB 1HTPA 1VQBA 4BS9A 2O5JC 3EBEA 5C44B 2L0CA 4G4KA 2Y0SG 4LNQA 3ERQA 1QOHA 1HNXL 2IX1A 1H9SA 4RHRA 1RODA 2I0QA 1SSOA 2D0PA 3SXHA 2R3ZA 4P73A 4R8IA 2ZXRA 2R7ZH 4CJ2C 1J5EL 2K4KA 1WTXA 2K7VA 4B3TL 1KDCA 4B3ML 1W6JA 1G2SA 3HEJA 4DNRB 1M8AA 1XPRA 4BBRB 1HPCA 1D8LA 1EY8A 1A3VA 2F3VA 4MN3A 1K83B 4QJFA 3MHBA 4A3GB 5M3FB 1F9RA 3PO3H 3D0FA 1LT4D 2NB0A 1XPOA 2HD3A 4JYAL 4PG3A 4C2MB 4MTNA 1X54A 1YNJD 4ZCKA 3RZOB 3GTOB 2R93G 3A8JE 4A3JG 4HEDA 4JBKA 1YIJA 2B2YC 2B63H 3I4MH 1TWAB 5ELOA 3X3MA 5FLMH 4R4TA 3A55A 1VQ6A 4PMWA 1SNPA 5AJ3L 2UUBQ 4DXFA 2XN9C 3NWTA 3HOUG 2JA5B 3K0YA 4PQXA 3S1MB 5CGKA 1VQGA 5IOCA 4HMJA 1K73C 1FVIA 1KRSA 3GTKB 5K36H 1Q46A 1F2LA 1M90C 2F0MA 1YJNA 2MNAA 4A3KG 2Z6KC 3JAMi 3N52A 1WTPA 3NUCA 1BKBA 1PH4A 2WB1G 3E3XA 1B3QA 1STEA 1S72A 1PTOB 1ONLA 4KHVA 3S15B 3D6CA 3TP8A 3QIAA 2C35B 3J7AV 3A8IE 3SK5A 4JI5L 4G57A 1HQMC 1PYSB 2EPBA 4KHPQ 1STNA 3VR6A 1U4LA 1KC8C 4JI3Q 1DZ1A 2ZXOA 3J7ZC 3G4SA 4LFAL 4IJHA 2X6LA 3ULLA 3H0GH 3T4AC 3S2HH 1SJHD 5EBDA 1AE3A 2B8FA 1UNSA 1L1OB 1W3SA 1EWCA 2JA9A 1JORA 4DA2A 1L0YB 1TXYA 3MXNB 1D7QA 4QY7A 1NR2A 3W1BA 1I5FA 3HKZE 4JG2A 3MVVA 3NPPA 1H95A 4F87A 2NVQB 3HOVH 3FKIG 4IALA 5KRUA 1B4OA 3HOZB 3SVMA 1BF4A 2UXBL 2PYKA 2K28A 4RH6A 5EKIA 4IO9A 3D4RA 2QW7A 4DV7L 1CZGA 3MAQA 3Q22A 1K8GA 3R93A 5LMUL 4WRDA 1HXYD 4DV3Q 1XMQL 3EROA 2F0TA 2YTVA 4X65Q 1VQLA 2UUCL 2EY5A 3GP7A 2ZXPA 2VQFQ 3MXUA 3BVZA 2JA6B 3GTQH 4DR2Q 4A3FH 4UHVA 4GNXB 4ZYSA 1V8QA 1Y1VG 5GAGC 1STGA 4XYQA 3CD6A 4Z9CB 3OSOA 4G7ZC 2F0GA 5C4XG 4O1NA 3L7ZC 2N55A 5IYCH 1UAPA 5DNFA 1A63A 2VQEL 3DEOA 1TKWB 2UU9Q 1HZBA 5GQOA 1QG7A 1UEBA 3AFQA 3ER0A 3F2UA 2UXDL 2WFWA 4A3DH 1BQQT 5KYLA 4DUYQ 1SNMA 3HOYG 2LKVA 4H7BA 2MO0A 1DOLA 4DK6C 1PH7A 3J81i 4KY6A 4ME5A 1EFWA 1EU3A 4HSPA 4C3JG 2VB2X 1Y1WB 4TVAB 5JVH3 2I5HA 2VS1A 3K5OA 1WTHA 1HFGA 4JI7Q 1B8AA 2CKZB 3TZDA 3BS1A 4GLVB 4NKLA 1GOZA 1IZ6A 4MNOA 2V4DA 2A6ED 2VB3X 1WCMB 2Q8IB 1HRJA 5ELFA 4HIOA 1A8VA 4K6LA 5I4DA 2UUAQ 2E2JB 2NBFA 3BZKA 2GVBA 4DV0L 1SYBA 2O4XA 1EY0A 1YHQA 4JI4L 4DPGA 1LT5D 2ZJPA 1PVOA 1J8IA 1CHQD 4DR5L 1I6HH 5G3LF 3LGJA 3BJUA 4AQYL 2Q2UA 2F3WA 4QF4A 2IHEA 1K0SA 2M9VA 2HQEA 5C0XG 1TWCB 4B3RL 1VQHA 1NTGA 1PXUA 3Q0AA 2R7FA 1B3AA 3T1HL 1CFMA 2PCFB 1X3GA 1TWFH 2RF4A 1S3OA 3AEVA 5CC4A 2UXCQ 5C44H 2A68C 4QB4A 1PTOF 3SE0A 2B2WA 4HSVA 2EYMA 3VYTA 2DY7A 3I55A 1N32Q 1EY4A
chains in the Genus database with same CATH topology
2R7ZG 5JJIA 1X65A 4YY3L 4GNXC 2JA8H 4GN3B 4LF9Q 3S1QH 1KAWA 5J3BA 1YI2A 4YWKA 3F1ZA 4DR7Q 4O2DA 5IWAQ 3PUZA 1Y1WG 2F4VQ 2Z6KA 3RN2A 1VQ4A 1K8AC 4L5SA 3KFUA 4OONA 3TQYA 1K83H 2ALYB 3RLOA 4A3GH 3PO3G 2RHQB 1TWGH 2FXQA 1I94L 1XMOL 2KBNA 3RNUA 3A5UA 2YTYA 3PUYA 1SRUA 5C3EG 2VQEQ 3J7A5 3RZOH 3GTPH 1JJGA 3I4OA 4QIWE 1SROA 2VW9A 1X9NA 1IBKL 5M3MG 2KENA 2B63G 4LFBQ 1G291 2KCMA 3I4MG 4DV5L 1E1OA 1TWAH 5IYCG 4NXNL 5IYBH 3CC2A 4A93H 4WJ4A 4GOPC 5FLMG 4DR3Q 4DR4L 2F52A 1WYDA 3AYHB 1JMCA 2K5NA 4UY8C 2BA1A 1NBWA 1X55A 4DV4Q 3SGIA 4TQUS 5C4JH 2JA5H 1VQCA 5E7NA 3CC4A 2E2HH 5IP9G 3FKIH 3U4ZA 4BY1H 4OWXB 3PUVA 2WB1E 1UWVA 3K8AA 4X66L 3UDIA 1FJGQ 1JJCB 1U0LA 4GKJQ 1HR0Q 1BVSA 2CCZA 1XPUA 4C3IH 2CFMA 1JE5A 1QVGA 1PFSA 1VQ5A 3H3VH 5K36G 4JI8Q 3PF5A 3HKZG 3S16H 4A3LH 4JI2L 3CW2C 2ZJRA 2BH8A 3F8TA 1PH9A 2E5LL 4BXXG 4LUVA 4QL5A 1YVCA 4Y52H 3BU2A 2VUMH 4OX9Q 1RL2A 3U58A 1E24A 5IYDH 3UDFA 1EQQA 1PH3A 3S15H 2R92H 3NEMA 1VQJA 2IT1A 3CMAA 2D62A 1MIUA 1N36Q 4A75A 4LFCQ 3IRBA 4POGA 4DR6L 4L5RC 4DV4L 4JBJA 1WCMH 4DV0Q 4GS3A 1QZGA 2JA7G 2JE6I 5IP7G 4JI4Q 3F2DA 4DV1Q 3RLFA 1CKNB 3GO5A 1FJGL 4DR5Q 4YCVA 3TS0A 4B3SL 1YZ6A 3PIPA 4AQYQ 1Q7YC 2E2JH 1HR0L 1I50H 1Z9FA 2JEAI 3UDGA 1AE2A 1SN8A 4JI8L 1Y1VH 4AIMA 1VQMA 3U4VA 4X64L 4B3RQ 2HHHQ 3CCUA 3H0GG 4KI0A 3T1HQ 1WFQA 4A3JH 4A3EG 1TWHH 3I4NG 4KHZA 5C4XH 2K5VA 1VQ7A 4NB3A 1P8LA 1HH2P 1NMGA 1PHJA 4OO1I 1V1QA 3FP9A 4JOIA 1HZ9A 3ULPA 1OXSC 1FL0A 1NY4A 1OTCA 1UE1A 4DR1Q 3F2CA 3CPWA 2YV5A 2NVTH 4PZ6A 4LFCL 4APVA 3S14H 3HFZB 3I2ZA 1NE3A 3GTGH 2NN6I 4A3BH 4BBSG 1HJPA 4O0AA 4P74A 2Q2TA 1RIPA 3PF4A 1CKMA 4IJLA 1HNWL 3U50C 4JI0Q 3AFPA 4HIDA 3PSIA 3HOVG 1Q82C 4NXMQ 3GTJH 3K0XA 3OTOQ 3S24A 4LF5Q 3ZJYC 2QA4A 3HOYH 3KJOA 4OWTB 1XJVA 2UUBL 1VQOA 3CCEA 4A3MG 4LF7Q 4IFDG 4A3CH 3PCOB 4MZ9A 3NELA 4JI1L 4C3JH 3WWVA 5FJ8G 5FLXc 3UE0A 4HJ5A 3H3VI 1I94Q 2HIXA 1UE7A 5M5YH 4XTCS 4A3IG 1VCIA 2E8GA 2WP8J 1KQSA 2DGYA 4A3KH 4WJ3M 1CUKA 3RN5A 4IPGA 4BBRG 4R4CA 1IBKQ 1IXRA 3KYHC 2NZHA 5M3FG 3HOWH 4DR1L 2PQAB 3EN2A 4JBMA 1N34Q 3L2PA 4DV5Q 2VY3A 3J81j 1MJEA 1HZCA 3RR5A 3PIOA 1PH6A 5H1SE 4HJ7A 4DR4Q 2XGTA 2A8VA 1O7IA 5JEAJ 2K5HA 1R9TH 2RHSB 4JI0L 3I56A 4NPSA 1QVFA 4AYBG 2PQAA 5GAEC 4YCWA 1VQKA 5IYBG 2K75A 1KRTA 4NXML 3OTOL 4LF5L 1YEZA 3PGZA 3HOXG 4A93G 1IL2A 3GDEA 2JA6H 1C0AA 4X66Q 2BA0A 2KCTA 4POFA 4A3FG 1L1OA 1EIFA 1PH5A 4LF7L 4BA1I 1Q12A 1QUQA 2WAQG 2VNUD 4HJ9A 1K9MC 1VQFA 4P72A 1HR0W 1JT8A 2JJQA 4JI2Q 3CCVA 1N9WA 3F2BA 4ME3A 1B70B 2R7DA 2BH2A 3KF8B 1VQNA 3ICEA 2E5LQ 4JC0A 5GADC 4L5TA 3CF5A 4DNIA 2EXDA 4DV6L 5JJKA 3TRZA 3EIVA 4IOCA 4R1JA 1N34L 4DAMA 1JB7A 3M7NA 5LMNL 4BY7H 2LXKA 4JV5L 2B29A 1VS0A 1VQBA 3EBEA 3A74A 2D0OA 4LNQA 2Y0SG 3TEHB 4DR6Q 3UE1A 3OW2A 1HNXL 5M5XH 2VL6A 4ALPA 2IX1A 1C7YA 2IX0A 4A3DG 3W1GA 3CP0A 3M4QA 1EIYB 2PMZE 2I0QA 2D0PA 4B3SQ 2HIVA 4P73A 2ES2A 1E1TA 1SE8A 2R7ZH 1OXXK 1J5EL 2K4KA 4B3TL 4UP9A 1GM5A 5AJ3Q 2AWOA 4B3ML 3PUXA 2AKWB 4IPCA 3S1RH 3VDYA 1KHIA 1Q86C 1X3EA 1QVCA 4X64Q 1Y1WH 1VQEA 1XPRA 1D8LA 3D31A 1XNQL 2K14A 4QJFA 4DV2Q 4PZ8A 3PO3H 3D0FA 1XPOA 1Q1BA 4BA2I 4JYAL 4R4IA 4PG3A 3A5ZB 4QGUA 1WOCA 4MTNA 4QQBX 1M1KC 4IOAA 1X54A 2N49A 4DAYB 1XNRL 3PO2G 2LSSA 2R93G 1SLJA 3T1YL 4A3JG 1I3QH 4H02A 1WI5A 4DV3L 3GTLH 1WJJA 4JBKA 1IBLQ 1YIJA 4GNXA 3K7UC 2GVAA 2B63H 4LF6L 3I4MH 3L0OA 4X65L 1J6QA 3PV0A 2I5MX 1HNWQ 5ELOA 3S2DH 3STBC 4LUZA 5BR8Q 1AH9A 3M4OH 1W2BA 2DUDA 2PI2E 5FLMH 4R4TA 1VQ6A 4LUOA 4PMWA 5AJ3L 2NVXH 4A3BG 2UUBQ 3UDXA 1MKHA 1NJIC 4LF8L 3HOUG 1PV4A 4JI5Q 4IPHA 2VQFL 4JI1Q 5IP9H 1CSQA 1ASYA 1VQGA 2OTJA 3JAMc 1G6PA 3E9IA 3GTMH 4DR2L 4GOPB 4UPAA 1K73C 4LF4L 4DV2L 1FVIA 1KRSA 4GN4B 4K0KL 2VZAA 3HOZG 4A3CG 1PH2A 3K80C 4IFDI 1HNZL 5C0XI 1Q46A 1TWCH 3K81C 1M90C 5JJLA 2F3IA 3M4PA 1A62A 1YJNA 1LM0A 1EUJA 2MNAA 3CAMA 4A3KG 4GOPA 2Z6KC 4C3HH 3G48A 3JAMi 1PH1A 1IBLL 5HGQA 3MEFA 5LMNW 1BKBA 1LYLA 2NZOA 2WB1G 5C44G 1PH4A 5M5WH 1JJ2A 3KDFA 4Y7NH 1S72A 4EQ5A 1EQRA 5BR8L 4UP8A 1BBUA 4GN5A 3S17H 2R6GA 4HIMA 2C35B 4DKAC 5C0XJ 1QZHA 1VQIA 4JI5L 2JA7H 2JA8G 5IP7H 2Q2IA 4AH6A 1ASZA 2N78A 1PYSB 1GD7A 2NVYH 3HKSA 4JCVE 4J15A 2ZTDA 4UP7A 1V43A 4YWMA 4JI6Q 4KHPQ 1C9OA 1KC8C 4JI3Q 4A3GG 4DV6Q 4RG1A 1L2FA 3J7ZC 3G4SA 4IJHA 1EYGA 4LFAL 2OCEA 3ULLA 3H0GH 5IE8A 5LMNQ 3S2HH 2AMCB 1A0IA 2EQSA 4JV5Q 3I4NH 1AE3A 3M85A 3CXCA 4XIGS 1L1OB 4OO1G 4R4QA 1W3SA 2JA9A 3CQZH 2E2IH 1MJCA 1QUQB 2K52A 4HIKA 3FHWA 1HNXQ 4P71A 1TXYA 3MXNB 1XMQQ 1D7QA 2B3GA 4QY7A 4YWLA 2N3SA 3OYYA 4OWWB 1N33L 3W1BA 2MO1A 1I5FA 3HKZE 5HY6A 4JG2A 4BBSH 4HJAA 1J5EQ 2KHIA 1IBMQ 4B3TQ 1H95A 1KXLA 2L15A 3W5OA 4B3MQ 2JA5G 1SMXA 1YITA 2UUAL 3HOVH 1CSPA 3FKIG 2CQOA 4JI6L 4KHPL 3G71A 4BY1G 3A0JA 3CPFA 2Z0SA 1E3PA 4JI3L 5IY0A 1XNQQ 4A3MH 2UXBL 4EX5A 5JEAG 3CCJA 5FJ8H 1SR3A 4A3LG 2GN5A 4JYAQ 4A3IH 4IO9A 5GAHC 1KIXA 5EAYA 4DK3C 1YJ9A 4YHHL 1CKOA 4DV7L 1KD1C 4BBRH 1K8GA 1XNRQ 1EWIA 5LMUL 2LXJA 3AQQA 3T1YQ 2ATWA 2ASBA 4DV3Q 2OTLA 3KOJA 2VUMG 1FGUA 5M3FH 3Q8DA 1XMQL 1VQ8A 4LWCA 4LF6Q 5IYDG 2YTVA 2JK8A 4X65Q 4C2MH 1VQLA 3GD7A 1V9PA 2R92G 1DGSA 4JBWA 2UUCL 3RLNA 3CCLA 3GTOH 2UXCL 1GKHA 3STBD 1IBML 1VQAA 2AWNA 1WCMG 2AHOB 4JOIC 4IPDA 4OXPA 3CCSA 4LF8Q 2UXDQ 2OQ0A 2ZTCA 4YCUA 1N32L 2VQFQ 3CCMA 4PZ7A 3HOXH 2ZM6L 3GTQH 4DUZQ 4DR2Q 1GO3E 4A3FH 4LF4Q 1YHBA 4LF9L 4GNXB 1YJWA 1Y14B 4LW1A 4GKKQ 3H15A 4K0KQ 4DR7L 1K0RA 1Y1VG 1HNZQ 5IWAL 5GAGC 2F4VL 3NENA 1VQ9A 3TREA 1NMFA 4L5QA 5ELNA 3S1MH 3CD6A 5C3EH 4GLXA 3JC66 5C4XG 3KF6B 1B7YB 1VQDA 5M3MH 3L7ZC 2QGQA 3GTKH 2Q2HA 5IYCH 1Q8KA 1YNXA 1A63A 2VQEL 2UU9Q 2YU9H 1HZBA 4X62Q 5GQOA 1UEBA 2PI2A 3J81c 3KF6A 4LFBL 2RCNA 4GLAC 3AFQA 3ER0A 1VQPA 3S1NH 2UXDL 1K3RA 3DM3A 2WFWA 3CCRA 1X6OA 4A76A 3NBHB 1OXVA 3J80c 3ERSX 4A3DH 4DUYQ 3B6YA 2V1CC 4DUZL 1E22A 4DR3L 2HT1A 2YTXA 3K7AH 3I7FA 1E7ZA 3DLLA 1T9HA 3HOYG 3M3YH 2MO0A 1U5KA 4DK6C 2I5LX 1LUZA 1PH7A 3J81i 4GKKL 3KDFB 1EFWA 1IYJB 1KL9A 1X56A 5IT9c 1N8RC 4LFAQ 4TVAB 2I5HA 1UE6A 2VS1A 4FDBA 3J80i 4GKJL 4BXXH 4JI7Q 1PH8A 1B8AA 2CKZB 4AYBE 1L1OC 1XTDA 4HJ8A 4GLVB 3ULJA 2OQKA 2K50A 3HOWG 1IZ6A 4MNOA 1CKNA 3PUWA 2UU9L 4X62L 2HQLA 1HZAA 3E9HA 3PO2H 2R93H 2WAQE 2A19A 1OXTA 1N33Q 4OX9L 3M9BA 4IFDJ 2ZJQA 1Q1EA 1S40A 1Q81C 1SFOH 5GROA 1OXUA 4DUYL 4HIOA 1A8VA 2CWPA 2YYZA 2UUAQ 1EOVA 2CWAA 2JEBI 2QEXA 1N36L 2JA6G 3BZKA 4KLKA 2GVBA 4DV0L 5DLQE 3CC7A 1YHAA 4YY3Q 2IHFA 3HOUH 1YHQA 4DV1L 4DPGA 2ZJPA 4JI4L 1PVOA 2UXBQ 3TS2A 1X3FA 4DR5L 1I6HH 3G6EA 3LGJA 3BJUA 4AQYL 2Y0SE 2Q2UA 2NVQH 4RMFA 2IHEA 2PNHA 4JI7L 1BBWA 4A3EH 4YHHQ 4DV7Q 2XTIA 2OWOA 3HOZH 1PYBA 5C0XG 5LMUQ 3CMEA 1PA6A 4B3RL 2ID0A 2H5XA 2HHHL 2IY5B 1VQHA 1NTGA 1GVPA 1LTLA 2R7FA 3T1HL 4A4IA 1UE5A 1XMOQ 4BY7G 1X3GA 2N8NA 1TWFH 1Z47A 2JQOA 2MFIA 4P75A 2NN6G 2RF4A 1G51A 2UUCQ 1S3OA 3AEVA 2UXCQ 5C44H 2EIFA 2MQHA 3E0EA 3CCQA 3RZDH 4R4OA 1P16A 2ZTEA 3KLWA 1L0WA 3KJPA 3BZCA 2KHJA 2A1AA 1YBYA 4NXNQ 3I55A 1N32Q 2ZM6Q 4X6AH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z G;  5JJI A;  1X65 A;  4YY3 L;  4GNX C;  2JA8 H;  4GN3 B;  4LF9 Q;  3S1Q H;  1KAW A;  5J3B A;  1YI2 A;  4YWK A;  3F1Z A;  4DR7 Q;  4O2D A;  5IWA Q;  3PUZ A;  1Y1W G;  2F4V Q;  2Z6K A;  3RN2 A;  1VQ4 A;  1K8A C;  4L5S A;  3KFU A;  4OON A;  3TQY A;  1K83 H;  2ALY B;  3RLO A;  4A3G H;  3PO3 G;  2RHQ B;  1TWG H;  2FXQ A;  1I94 L;  1XMO L;  2KBN A;  3RNU A;  3A5U A;  2YTY A;  3PUY A;  1SRU A;  5C3E G;  2VQE Q;  3J7A 5;  3RZO H;  3GTP H;  1JJG A;  3I4O A;  4QIW E;  1SRO A;  2VW9 A;  1X9N A;  1IBK L;  5M3M G;  2KEN A;  2B63 G;  4LFB Q;  1G29 1;  2KCM A;  3I4M G;  4DV5 L;  1E1O A;  1TWA H;  5IYC G;  4NXN L;  5IYB H;  3CC2 A;  4A93 H;  4WJ4 A;  4GOP C;  5FLM G;  4DR3 Q;  4DR4 L;  2F52 A;  1WYD A;  3AYH B;  1JMC A;  2K5N A;  4UY8 C;  2BA1 A;  1NBW A;  1X55 A;  4DV4 Q;  3SGI A;  4TQU S;  5C4J H;  2JA5 H;  1VQC A;  5E7N A;  3CC4 A;  2E2H H;  5IP9 G;  3FKI H;  3U4Z A;  4BY1 H;  4OWX B;  3PUV A;  2WB1 E;  1UWV A;  3K8A A;  4X66 L;  3UDI A;  1FJG Q;  1JJC B;  1U0L A;  4GKJ Q;  1HR0 Q;  1BVS A;  2CCZ A;  1XPU A;  4C3I H;  2CFM A;  1JE5 A;  1QVG A;  1PFS A;  1VQ5 A;  3H3V H;  5K36 G;  4JI8 Q;  3PF5 A;  3HKZ G;  3S16 H;  4A3L H;  4JI2 L;  3CW2 C;  2ZJR A;  2BH8 A;  3F8T A;  1PH9 A;  2E5L L;  4BXX G;  4LUV A;  4QL5 A;  1YVC A;  4Y52 H;  3BU2 A;  2VUM H;  4OX9 Q;  1RL2 A;  3U58 A;  1E24 A;  5IYD H;  3UDF A;  1EQQ A;  1PH3 A;  3S15 H;  2R92 H;  3NEM A;  1VQJ A;  2IT1 A;  3CMA A;  2D62 A;  1MIU A;  1N36 Q;  4A75 A;  4LFC Q;  3IRB A;  4POG A;  4DR6 L;  4L5R C;  4DV4 L;  4JBJ A;  1WCM H;  4DV0 Q;  4GS3 A;  1QZG A;  2JA7 G;  2JE6 I;  5IP7 G;  4JI4 Q;  3F2D A;  4DV1 Q;  3RLF A;  1CKN B;  3GO5 A;  1FJG L;  4DR5 Q;  4YCV A;  3TS0 A;  4B3S L;  1YZ6 A;  3PIP A;  4AQY Q;  1Q7Y C;  2E2J H;  1HR0 L;  1I50 H;  1Z9F A;  2JEA I;  3UDG A;  1AE2 A;  1SN8 A;  4JI8 L;  1Y1V H;  4AIM A;  1VQM A;  3U4V A;  4X64 L;  4B3R Q;  2HHH Q;  3CCU A;  3H0G G;  4KI0 A;  3T1H Q;  1WFQ A;  4A3J H;  4A3E G;  1TWH H;  3I4N G;  4KHZ A;  5C4X H;  2K5V A;  1VQ7 A;  4NB3 A;  1P8L A;  1HH2 P;  1NMG A;  1PHJ A;  4OO1 I;  1V1Q A;  3FP9 A;  4JOI A;  1HZ9 A;  3ULP A;  1OXS C;  1FL0 A;  1NY4 A;  1OTC A;  1UE1 A;  4DR1 Q;  3F2C A;  3CPW A;  2YV5 A;  2NVT H;  4PZ6 A;  4LFC L;  4APV A;  3S14 H;  3HFZ B;  3I2Z A;  1NE3 A;  3GTG H;  2NN6 I;  4A3B H;  4BBS G;  1HJP A;  4O0A A;  4P74 A;  2Q2T A;  1RIP A;  3PF4 A;  1CKM A;  4IJL A;  1HNW L;  3U50 C;  4JI0 Q;  3AFP A;  4HID A;  3PSI A;  3HOV G;  1Q82 C;  4NXM Q;  3GTJ H;  3K0X A;  3OTO Q;  3S24 A;  4LF5 Q;  3ZJY C;  2QA4 A;  3HOY H;  3KJO A;  4OWT B;  1XJV A;  2UUB L;  1VQO A;  3CCE A;  4A3M G;  4LF7 Q;  4IFD G;  4A3C H;  3PCO B;  4MZ9 A;  3NEL A;  4JI1 L;  4C3J H;  3WWV A;  5FJ8 G;  5FLX c;  3UE0 A;  4HJ5 A;  3H3V I;  1I94 Q;  2HIX A;  1UE7 A;  5M5Y H;  4XTC S;  4A3I G;  1VCI A;  2E8G A;  2WP8 J;  1KQS A;  2DGY A;  4A3K H;  4WJ3 M;  1CUK A;  3RN5 A;  4IPG A;  4BBR G;  4R4C A;  1IBK Q;  1IXR A;  3KYH C;  2NZH A;  5M3F G;  3HOW H;  4DR1 L;  2PQA B;  3EN2 A;  4JBM A;  1N34 Q;  3L2P A;  4DV5 Q;  2VY3 A;  3J81 j;  1MJE A;  1HZC A;  3RR5 A;  3PIO A;  1PH6 A;  5H1S E;  4HJ7 A;  4DR4 Q;  2XGT A;  2A8V A;  1O7I A;  5JEA J;  2K5H A;  1R9T H;  2RHS B;  4JI0 L;  3I56 A;  4NPS A;  1QVF A;  4AYB G;  2PQA A;  5GAE C;  4YCW A;  1VQK A;  5IYB G;  2K75 A;  1KRT A;  4NXM L;  3OTO L;  4LF5 L;  1YEZ A;  3PGZ A;  3HOX G;  4A93 G;  1IL2 A;  3GDE A;  2JA6 H;  1C0A A;  4X66 Q;  2BA0 A;  2KCT A;  4POF A;  4A3F G;  1L1O A;  1EIF A;  1PH5 A;  4LF7 L;  4BA1 I;  1Q12 A;  1QUQ A;  2WAQ G;  2VNU D;  4HJ9 A;  1K9M C;  1VQF A;  4P72 A;  1HR0 W;  1JT8 A;  2JJQ A;  4JI2 Q;  3CCV A;  1N9W A;  3F2B A;  4ME3 A;  1B70 B;  2R7D A;  2BH2 A;  3KF8 B;  1VQN A;  3ICE A;  2E5L Q;  4JC0 A;  5GAD C;  4L5T A;  3CF5 A;  4DNI A;  2EXD A;  4DV6 L;  5JJK A;  3TRZ A;  3EIV A;  4IOC A;  4R1J A;  1N34 L;  4DAM A;  1JB7 A;  3M7N A;  5LMN L;  4BY7 H;  2LXK A;  4JV5 L;  2B29 A;  1VS0 A;  1VQB A;  3EBE A;  3A74 A;  2D0O A;  4LNQ A;  2Y0S G;  3TEH B;  4DR6 Q;  3UE1 A;  3OW2 A;  1HNX L;  5M5X H;  2VL6 A;  4ALP A;  2IX1 A;  1C7Y A;  2IX0 A;  4A3D G;  3W1G A;  3CP0 A;  3M4Q A;  1EIY B;  2PMZ E;  2I0Q A;  2D0P A;  4B3S Q;  2HIV A;  4P73 A;  2ES2 A;  1E1T A;  1SE8 A;  2R7Z H;  1OXX K;  1J5E L;  2K4K A;  4B3T L;  4UP9 A;  1GM5 A;  5AJ3 Q;  2AWO A;  4B3M L;  3PUX A;  2AKW B;  4IPC A;  3S1R H;  3VDY A;  1KHI A;  1Q86 C;  1X3E A;  1QVC A;  4X64 Q;  1Y1W H;  1VQE A;  1XPR A;  1D8L A;  3D31 A;  1XNQ L;  2K14 A;  4QJF A;  4DV2 Q;  4PZ8 A;  3PO3 H;  3D0F A;  1XPO A;  1Q1B A;  4BA2 I;  4JYA L;  4R4I A;  4PG3 A;  3A5Z B;  4QGU A;  1WOC A;  4MTN A;  4QQB X;  1M1K C;  4IOA A;  1X54 A;  2N49 A;  4DAY B;  1XNR L;  3PO2 G;  2LSS A;  2R93 G;  1SLJ A;  3T1Y L;  4A3J G;  1I3Q H;  4H02 A;  1WI5 A;  4DV3 L;  3GTL H;  1WJJ A;  4JBK A;  1IBL Q;  1YIJ A;  4GNX A;  3K7U C;  2GVA A;  2B63 H;  4LF6 L;  3I4M H;  3L0O A;  4X65 L;  1J6Q A;  3PV0 A;  2I5M X;  1HNW Q;  5ELO A;  3S2D H;  3STB C;  4LUZ A;  5BR8 Q;  1AH9 A;  3M4O H;  1W2B A;  2DUD A;  2PI2 E;  5FLM H;  4R4T A;  1VQ6 A;  4LUO A;  4PMW A;  5AJ3 L;  2NVX H;  4A3B G;  2UUB Q;  3UDX A;  1MKH A;  1NJI C;  4LF8 L;  3HOU G;  1PV4 A;  4JI5 Q;  4IPH A;  2VQF L;  4JI1 Q;  5IP9 H;  1CSQ A;  1ASY A;  1VQG A;  2OTJ A;  3JAM c;  1G6P A;  3E9I A;  3GTM H;  4DR2 L;  4GOP B;  4UPA A;  1K73 C;  4LF4 L;  4DV2 L;  1FVI A;  1KRS A;  4GN4 B;  4K0K L;  2VZA A;  3HOZ G;  4A3C G;  1PH2 A;  3K80 C;  4IFD I;  1HNZ L;  5C0X I;  1Q46 A;  1TWC H;  3K81 C;  1M90 C;  5JJL A;  2F3I A;  3M4P A;  1A62 A;  1YJN A;  1LM0 A;  1EUJ A;  2MNA A;  3CAM A;  4A3K G;  4GOP A;  2Z6K C;  4C3H H;  3G48 A;  3JAM i;  1PH1 A;  1IBL L;  5HGQ A;  3MEF A;  5LMN W;  1BKB A;  1LYL A;  2NZO A;  2WB1 G;  5C44 G;  1PH4 A;  5M5W H;  1JJ2 A;  3KDF A;  4Y7N H;  1S72 A;  4EQ5 A;  1EQR A;  5BR8 L;  4UP8 A;  1BBU A;  4GN5 A;  3S17 H;  2R6G A;  4HIM A;  2C35 B;  4DKA C;  5C0X J;  1QZH A;  1VQI A;  4JI5 L;  2JA7 H;  2JA8 G;  5IP7 H;  2Q2I A;  4AH6 A;  1ASZ A;  2N78 A;  1PYS B;  1GD7 A;  2NVY H;  3HKS A;  4JCV E;  4J15 A;  2ZTD A;  4UP7 A;  1V43 A;  4YWM A;  4JI6 Q;  4KHP Q;  1C9O A;  1KC8 C;  4JI3 Q;  4A3G G;  4DV6 Q;  4RG1 A;  1L2F A;  3J7Z C;  3G4S A;  4IJH A;  1EYG A;  4LFA L;  2OCE A;  3ULL A;  3H0G H;  5IE8 A;  5LMN Q;  3S2H H;  2AMC B;  1A0I A;  2EQS A;  4JV5 Q;  3I4N H;  1AE3 A;  3M85 A;  3CXC A;  4XIG S;  1L1O B;  4OO1 G;  4R4Q A;  1W3S A;  2JA9 A;  3CQZ H;  2E2I H;  1MJC A;  1QUQ B;  2K52 A;  4HIK A;  3FHW A;  1HNX Q;  4P71 A;  1TXY A;  3MXN B;  1XMQ Q;  1D7Q A;  2B3G A;  4QY7 A;  4YWL A;  2N3S A;  3OYY A;  4OWW B;  1N33 L;  3W1B A;  2MO1 A;  1I5F A;  3HKZ E;  5HY6 A;  4JG2 A;  4BBS H;  4HJA A;  1J5E Q;  2KHI A;  1IBM Q;  4B3T Q;  1H95 A;  1KXL A;  2L15 A;  3W5O A;  4B3M Q;  2JA5 G;  1SMX A;  1YIT A;  2UUA L;  3HOV H;  1CSP A;  3FKI G;  2CQO A;  4JI6 L;  4KHP L;  3G71 A;  4BY1 G;  3A0J A;  3CPF A;  2Z0S A;  1E3P A;  4JI3 L;  5IY0 A;  1XNQ Q;  4A3M H;  2UXB L;  4EX5 A;  5JEA G;  3CCJ A;  5FJ8 H;  1SR3 A;  4A3L G;  2GN5 A;  4JYA Q;  4A3I H;  4IO9 A;  5GAH C;  1KIX A;  5EAY A;  4DK3 C;  1YJ9 A;  4YHH L;  1CKO A;  4DV7 L;  1KD1 C;  4BBR H;  1K8G A;  1XNR Q;  1EWI A;  5LMU L;  2LXJ A;  3AQQ A;  3T1Y Q;  2ATW A;  2ASB A;  4DV3 Q;  2OTL A;  3KOJ A;  2VUM G;  1FGU A;  5M3F H;  3Q8D A;  1XMQ L;  1VQ8 A;  4LWC A;  4LF6 Q;  5IYD G;  2YTV A;  2JK8 A;  4X65 Q;  4C2M H;  1VQL A;  3GD7 A;  1V9P A;  2R92 G;  1DGS A;  4JBW A;  2UUC L;  3RLN A;  3CCL A;  3GTO H;  2UXC L;  1GKH A;  3STB D;  1IBM L;  1VQA A;  2AWN A;  1WCM G;  2AHO B;  4JOI C;  4IPD A;  4OXP A;  3CCS A;  4LF8 Q;  2UXD Q;  2OQ0 A;  2ZTC A;  4YCU A;  1N32 L;  2VQF Q;  3CCM A;  4PZ7 A;  3HOX H;  2ZM6 L;  3GTQ H;  4DUZ Q;  4DR2 Q;  1GO3 E;  4A3F H;  4LF4 Q;  1YHB A;  4LF9 L;  4GNX B;  1YJW A;  1Y14 B;  4LW1 A;  4GKK Q;  3H15 A;  4K0K Q;  4DR7 L;  1K0R A;  1Y1V G;  1HNZ Q;  5IWA L;  5GAG C;  2F4V L;  3NEN A;  1VQ9 A;  3TRE A;  1NMF A;  4L5Q A;  5ELN A;  3S1M H;  3CD6 A;  5C3E H;  4GLX A;  3JC6 6;  5C4X G;  3KF6 B;  1B7Y B;  1VQD A;  5M3M H;  3L7Z C;  2QGQ A;  3GTK H;  2Q2H A;  5IYC H;  1Q8K A;  1YNX A;  1A63 A;  2VQE L;  2UU9 Q;  2YU9 H;  1HZB A;  4X62 Q;  5GQO A;  1UEB A;  2PI2 A;  3J81 c;  3KF6 A;  4LFB L;  2RCN A;  4GLA C;  3AFQ A;  3ER0 A;  1VQP A;  3S1N H;  2UXD L;  1K3R A;  3DM3 A;  2WFW A;  3CCR A;  1X6O A;  4A76 A;  3NBH B;  1OXV A;  3J80 c;  3ERS X;  4A3D H;  4DUY Q;  3B6Y A;  2V1C C;  4DUZ L;  1E22 A;  4DR3 L;  2HT1 A;  2YTX A;  3K7A H;  3I7F A;  1E7Z A;  3DLL A;  1T9H A;  3HOY G;  3M3Y H;  2MO0 A;  1U5K A;  4DK6 C;  2I5L X;  1LUZ A;  1PH7 A;  3J81 i;  4GKK L;  3KDF B;  1EFW A;  1IYJ B;  1KL9 A;  1X56 A;  5IT9 c;  1N8R C;  4LFA Q;  4TVA B;  2I5H A;  1UE6 A;  2VS1 A;  4FDB A;  3J80 i;  4GKJ L;  4BXX H;  4JI7 Q;  1PH8 A;  1B8A A;  2CKZ B;  4AYB E;  1L1O C;  1XTD A;  4HJ8 A;  4GLV B;  3ULJ A;  2OQK A;  2K50 A;  3HOW G;  1IZ6 A;  4MNO A;  1CKN A;  3PUW A;  2UU9 L;  4X62 L;  2HQL A;  1HZA A;  3E9H A;  3PO2 H;  2R93 H;  2WAQ E;  2A19 A;  1OXT A;  1N33 Q;  4OX9 L;  3M9B A;  4IFD J;  2ZJQ A;  1Q1E A;  1S40 A;  1Q81 C;  1SFO H;  5GRO A;  1OXU A;  4DUY L;  4HIO A;  1A8V A;  2CWP A;  2YYZ A;  2UUA Q;  1EOV A;  2CWA A;  2JEB I;  2QEX A;  1N36 L;  2JA6 G;  3BZK A;  4KLK A;  2GVB A;  4DV0 L;  5DLQ E;  3CC7 A;  1YHA A;  4YY3 Q;  2IHF A;  3HOU H;  1YHQ A;  4DV1 L;  4DPG A;  2ZJP A;  4JI4 L;  1PVO A;  2UXB Q;  3TS2 A;  1X3F A;  4DR5 L;  1I6H H;  3G6E A;  3LGJ A;  3BJU A;  4AQY L;  2Y0S E;  2Q2U A;  2NVQ H;  4RMF A;  2IHE A;  2PNH A;  4JI7 L;  1BBW A;  4A3E H;  4YHH Q;  4DV7 Q;  2XTI A;  2OWO A;  3HOZ H;  1PYB A;  5C0X G;  5LMU Q;  3CME A;  1PA6 A;  4B3R L;  2ID0 A;  2H5X A;  2HHH L;  2IY5 B;  1VQH A;  1NTG A;  1GVP A;  1LTL A;  2R7F A;  3T1H L;  4A4I A;  1UE5 A;  1XMO Q;  4BY7 G;  1X3G A;  2N8N A;  1TWF H;  1Z47 A;  2JQO A;  2MFI A;  4P75 A;  2NN6 G;  2RF4 A;  1G51 A;  2UUC Q;  1S3O A;  3AEV A;  2UXC Q;  5C44 H;  2EIF A;  2MQH A;  3E0E A;  3CCQ A;  3RZD H;  4R4O A;  1P16 A;  2ZTE A;  3KLW A;  1L0W A;  3KJP A;  3BZC A;  2KHJ A;  2A1A A;  1YBY A;  4NXN Q;  3I55 A;  1N32 Q;  2ZM6 Q;  4X6A H; 
#chains in the Genus database with same CATH topology
 5JJI A;  4YIJ A;  1C8C A;  1EYD A;  1Y8O B;  4GN3 B;  1U4R A;  1KAW A;  5J3B A;  3MFY A;  2QDL A;  2NVY B;  5IWA Q;  4U67 3;  1K83 H;  4A3G H;  3HOW B;  1XXG A;  4IUN A;  1Y69 U;  1TWG H;  2PO4 A;  1ESR A;  2QIL A;  2EJM A;  2YTY A;  5C3E G;  1KDB A;  3RZO H;  4CDC C;  4QIW E;  2VW9 A;  1SRO A;  1X9N A;  1TS5 A;  2LMC B;  4LFB Q;  1G29 1;  2KCM A;  4XQN A;  1TWA H;  1F2Y A;  2SNM A;  1C4Q A;  1YNN C;  4IUV A;  3OMG A;  4NXN L;  5A35 A;  5C5L A;  3J7Y W;  2F52 A;  3AYH B;  1KTK A;  2BA1 A;  3IAY A;  4DV4 Q;  4IUT A;  2JA5 H;  2E2H H;  2NYZ D;  4OWX B;  3K8A A;  1UWV A;  2MP1 A;  4TKO B;  4X66 L;  1FNU A;  1U0L A;  4A3M B;  3FDT A;  1BVS A;  1XPU A;  3ND8 A;  3T53 B;  2Q8R E;  1EFI D;  4JI2 L;  1PTO C;  4A3I B;  1EQV A;  4BXX G;  4B9X A;  4C3H G;  2EYH A;  2XSC A;  4ZUJ A;  3GQB A;  5JAV A;  1RL2 A;  4ABN A;  1DJR D;  1FYC A;  3U58 A;  5IYD H;  3UDF A;  1M4V A;  3S15 H;  4J1M A;  1W6K A;  2R92 H;  2IT1 A;  2R7Z B;  1MIU A;  2XWB B;  3IRB A;  5BN3 A;  4POG A;  3TME A;  3VR4 A;  3MEH A;  4GS3 A;  1QZG A;  4AYB B;  2JE6 I;  4NMZ A;  5IP7 G;  4ZK9 B;  5F2D A;  5C3W A;  4DV1 Q;  2IL8 A;  3GO5 A;  2EYL A;  1Q7Y C;  1HR0 L;  2JEA I;  3UDG A;  3PO3 B;  2WAQ B;  5E3F A;  2FFK B;  5CV4 A;  4KI0 A;  3K6O A;  3C2P A;  4A3E G;  3I4N G;  2K5V A;  3BDO A;  5AFW A;  3I4M B;  1V1Q A;  3DUZ A;  3FP9 A;  1HZ9 A;  4JOI A;  3ULP A;  4BWG B;  3BZD B;  3U9S A;  4LFC L;  3NE5 B;  3V96 A;  2F0O A;  4APV A;  4N9P A;  3GTG H;  4V19 0;  1CZW A;  4BBS G;  3U9O A;  4P74 A;  4HAE A;  3PF4 A;  1QIL A;  2K01 A;  3I4L A;  1ESF A;  2CH4 A;  1F9Q A;  1TT2 A;  5IIF A;  3OTO Q;  3S24 A;  4LF5 Q;  2PNR C;  2UUB L;  2B2U A;  3CCE A;  4LF7 Q;  1RTO A;  3E5S A;  3W3A A;  1HA6 A;  1VDZ A;  3NEL A;  3TZU A;  5JPM C;  1CQV A;  1I94 Q;  2HIX A;  2E8G A;  4WJ3 M;  1RCV D;  1CUK A;  2FJ2 A;  4NW2 A;  1SE2 A;  2F0J A;  2K6A A;  1IBK Q;  1IXR A;  1DXM A;  3EN2 A;  4DF7 A;  4DV5 Q;  1B2T A;  2R93 B;  2EYJ A;  1MJE A;  1Y8N B;  4DR4 Q;  2XGT A;  1YNN D;  1O7I A;  5G3L D;  3I56 A;  4NPS A;  4DAV A;  1QVF A;  4NXM L;  5IYB G;  2K75 A;  4ULL A;  2JA6 H;  4G7O C;  2BA0 A;  2F0S A;  3MXG A;  4ODG A;  4POF A;  5NUC A;  3HOU B;  1MGS A;  2A69 D;  1QUQ A;  3Q6S A;  5FLX E;  2VNU D;  3SHL A;  5E4X A;  3H0G B;  4P72 A;  1HR0 W;  3S2H B;  1JT8 A;  2K1B A;  2XWJ B;  4CJ0 B;  3F2B A;  4ME3 A;  3ICE A;  4KTA A;  2E5L Q;  5GAD C;  1O7Y A;  4DNI A;  3CKI B;  1PZJ D;  3QJY A;  3EIV A;  3N6R A;  4R1J A;  1N34 L;  4DAM A;  1JB7 A;  3AU7 A;  4BY7 H;  2B29 A;  1WTO A;  2EYF A;  2NN6 H;  1S5B D;  2RA4 A;  2WB1 B;  2D0O A;  3H3V C;  3UE1 A;  3OW2 A;  2G5D A;  5I2Y A;  5M5X H;  4XQJ A;  1C7Y A;  3HOV B;  3QG1 A;  1CQF A;  2IX0 A;  3CP0 A;  3M4Q A;  4WJW A;  4N8X 1;  5A2Q E;  4UP9 A;  3VDY A;  1SE3 A;  2EXZ A;  1X3E A;  1QVC A;  1Y1W H;  1A2T A;  1VQE A;  1OO9 B;  2J4X A;  1MHW C;  2HUG A;  4DV2 Q;  3DEP A;  4PZ8 A;  4R4I A;  4QGU A;  2G9D A;  2ICE C;  5J22 A;  2N49 A;  1JCK B;  4DAY B;  1LLR D;  3PO2 G;  2LSS A;  1SLJ A;  1I3Q H;  2IW3 A;  4DV3 L;  1IBL Q;  3IFT A;  2Z9H A;  1SAP A;  3L0O A;  4X65 L;  1WTQ A;  5EPK A;  4LUZ A;  1H9J A;  5BR8 Q;  3GTQ B;  1W2B A;  2DUD A;  5EGT A;  3M4O H;  1AH9 A;  3ITP A;  4DAY A;  4LUO A;  3PMF A;  1MKH A;  5C4J B;  2LS0 1;  5EKL A;  2Z4H A;  3FKI B;  2VQF L;  4JI1 Q;  1ET9 A;  5IP9 H;  2B2W C;  1ASY A;  4V0B A;  4DNT B;  4DR2 L;  3VR3 A;  4GN4 B;  2VZA A;  4A3C G;  2XNA C;  3K80 C;  1PH2 A;  4IFD I;  5C0X I;  1GJX A;  1TWC H;  5JJL A;  3M4P A;  3NWS A;  5D65 A;  1A62 A;  1EUJ A;  3SR1 A;  1X3P A;  3G48 A;  1JC7 A;  2Q8T A;  4L8J A;  1AP0 A;  2Z4I A;  4A3D B;  4GN5 A;  1K8M A;  3S17 H;  1D1I A;  4DKA C;  1VQI A;  2JA8 G;  2EE1 A;  2RBM A;  4G7H C;  3JAM E;  1ASZ A;  2F0W A;  1V1O A;  2NVY H;  1I50 B;  2ZTD A;  2RCF A;  4DN4 M;  1DOK A;  1BDO A;  4ZAI A;  1Y1V B;  2XRQ D;  4DV6 Q;  1DD2 A;  2OCE A;  1RDP D;  5IE8 A;  5KGU A;  2AMC B;  1SEB D;  1A0I A;  3I70 A;  4JV5 Q;  2J0T D;  3NBI A;  4XIG S;  2JP1 A;  4KD4 A;  1BNZ A;  1B44 D;  5J39 A;  2B3G A;  4KKS A;  5KNB A;  2N3S A;  5D3D A;  4A3B B;  3RUZ A;  3P20 A;  3T16 A;  5CYU A;  2KHI A;  1IBM Q;  4QIW B;  1KXL A;  1B9N A;  2JXM B;  1I6H B;  1SMX A;  2L5T A;  1TS3 A;  2UUA L;  4JI6 L;  3EA6 A;  4BY1 G;  3G71 A;  3HOY B;  1SYG A;  3NK9 A;  1E3P A;  1XNQ Q;  4A3M H;  1CK1 A;  3R2I A;  5JEA G;  3LWE A;  4R9W A;  3OIQ A;  2RDH A;  1BOS A;  5M5Y B;  5KNC A;  1H9S B;  4A3I H;  5EAY A;  1YJ9 A;  3NTH A;  1KD1 C;  1XNR Q;  2LXJ A;  4EVO A;  2ATW A;  4HMI A;  1A2U A;  1FGU A;  3OMC A;  4LWC A;  4LF6 Q;  4K5W A;  3GD7 A;  4I65 A;  3VA5 A;  1AFP A;  2UXC L;  1VQA A;  1F2Z A;  2AHO B;  2BCO A;  4IPD A;  4JOI C;  4OXP A;  4PNY A;  1N32 L;  2DNC A;  1RHP A;  4TSS A;  3VYR A;  4DUZ Q;  1GO3 E;  1YHB A;  1YJW A;  1XYI A;  1Y14 B;  1TWG B;  3PIO 3;  4GKK Q;  1EZ6 A;  4K0K Q;  1DOM A;  2B8G A;  5IWA L;  3SK6 A;  2F0V A;  1NMF A;  4L5Q A;  5ELN A;  4ZLT F;  4M1U B;  2B2U C;  3KF6 B;  2B2T A;  1I4P A;  1II3 A;  1JOK A;  3DWP A;  3FRP B;  2YU9 H;  4FF4 A;  3PQI A;  1SNQ A;  2PI2 A;  1B53 A;  3KF6 A;  5KND A;  4LFB L;  4GLA C;  1VQP A;  4ALP A;  3CCR A;  2E2H B;  3NBH B;  3J80 c;  1U9R A;  1D5Z C;  2V1C C;  2PZU A;  2ENB A;  2YTX A;  3I7F A;  1E7Z A;  3K7A H;  3NQI A;  2I5L X;  1Q3L A;  1IYJ B;  3NBH A;  2SNS A;  3D4D A;  2FIN B;  4FDB A;  1EY6 A;  1O7L A;  3MFG A;  4AYB E;  1JOO A;  3ULJ A;  3K5N A;  1V1P A;  1TVX A;  2R92 B;  4X62 L;  3QO2 A;  1HZA A;  3E9H A;  2R93 H;  2WAQ E;  3TDQ A;  3J81 E;  1OXT A;  1N33 Q;  1DM0 B;  2PQE A;  2IWH A;  4E6I A;  3MA2 B;  1Q81 C;  4LJZ C;  2KEC A;  1OXU A;  5IGG A;  2YYZ A;  2JEB I;  4FNF A;  2RDG A;  1ENC A;  5E4W C;  3MXP A;  3A54 A;  3CC7 A;  4YY3 Q;  3HOU H;  1JQY D;  4DV1 L;  2AUJ D;  2KED A;  5IT9 E;  1X3F A;  3CRK C;  3G6E A;  1GUT A;  2Y0S E;  4RMF A;  3I73 A;  4C1N K;  5CV5 A;  1UEA B;  2A6E C;  2H5X A;  4KN4 C;  1LTL A;  4Q5V A;  2C9O A;  4IOA A;  1ENA A;  2N8N A;  4C3H B;  1EU4 A;  1Z47 A;  3BVM A;  3GTG B;  1PYW D;  4RKB A;  3FEW X;  2E2D C;  3E0E A;  2DY8 A;  3RZD H;  1L0W A;  3KLW A;  2RDF A;  4RGT A;  4X6A H;  2A5H A;  4K6D A;  1X65 A;  5C6A A;  1CTM A;  3S1Q H;  5I9P A;  2B2V A;  2R61 A;  1JE4 A;  3F1Z A;  3PUZ A;  2F4V Q;  2MPM A;  3TBI B;  4KKT A;  1K8A C;  4L5S A;  3KFU A;  3TQY A;  2CW0 D;  2FXQ A;  1I94 L;  1XMO L;  3O13 A;  1SRU A;  4M8A A;  1JJG A;  1RKN A;  5FO8 B;  1IBK L;  2QF7 A;  2E2I B;  2KEN A;  1FNV A;  4DV5 L;  1EY7 A;  5IYC G;  2A73 B;  1SDF A;  5I2X A;  2KVM A;  3NQT A;  4DR4 L;  1WYD A;  1JMC A;  2M2L A;  2PZW A;  4I7Z C;  4S3S A;  5C4J H;  2K5Q A;  1LV9 A;  5E7N A;  3FKI H;  2WB1 E;  4GKJ Q;  3A56 A;  2NTS A;  3FPP A;  2Z8L A;  2CCZ A;  2CFM A;  4JI8 Q;  3PF5 A;  4BY7 B;  1Y8P B;  4J6H A;  1NR4 A;  1PMR A;  2E5L L;  4QL5 A;  1YVC A;  5BN5 A;  4Y52 H;  2O2L D;  2OF1 A;  3CRL C;  2TMP A;  5M5X B;  1BR9 A;  2IPK D;  1GHJ A;  4NDX A;  2E76 C;  1VQJ A;  3W2D A;  2D62 A;  4A75 A;  3C3L A;  4ZKB B;  1H9K A;  2JA7 G;  2F0Q A;  1FJG L;  1EEF D;  3D4W A;  4RGN A;  3PIP A;  1I50 H;  1Z9F A;  1SYC A;  1Y1V H;  4AIM A;  2JN4 A;  5IGC A;  3CCU A;  3IL8 A;  4C1N I;  1XTC D;  1MSH A;  1I3Q B;  1TWH H;  3DWQ A;  1IW7 D;  4KHZ A;  5C4X H;  4TRD A;  5M9O A;  2O5I C;  5M3M B;  1ML0 D;  1NMG A;  5FKA C;  4XQQ A;  1OXS C;  1FL0 A;  3WOF A;  1LTB D;  1OTC A;  3M4O B;  1ZYR C;  4DR1 Q;  3F2C A;  5IGD A;  4PZ6 A;  3I2Z A;  1NE3 A;  2HDM A;  4A3B H;  2DJG C;  1D5X C;  1RIP A;  2XVS A;  3U50 C;  3FVQ A;  4JI0 Q;  1GUN A;  1Q82 C;  1PRT D;  3GTJ H;  2CVR A;  3HOY H;  3KJO A;  4OWT B;  1XJV A;  1IKL A;  1TS4 A;  1MD2 D;  4IFD G;  1I4G A;  2NZ1 D;  4MZ9 A;  1LTI D;  2EDG A;  3GV6 A;  4JI1 L;  4C3J H;  2ZT9 C;  5FJ8 G;  1UE7 A;  2K03 A;  5M5Y H;  1VCI A;  4RGM A;  3ND9 A;  5LL6 S;  1BCP D;  1D6E C;  4BBR G;  3BYY B;  1SYE A;  4HCE A;  5M3F G;  1NSN S;  1SMY D;  4H44 C;  3BDL A;  3S17 B;  2FMC A;  3PIO A;  4HJ7 A;  1RTN A;  3MWY W;  2B2T C;  1SFO B;  4F8M A;  5GAE C;  1S5E D;  1VQK A;  1KRT A;  3HOX G;  1IL2 A;  3H09 A;  1C0A A;  2L12 A;  2PZT A;  4BA1 I;  4QMG A;  1Q12 A;  1B50 A;  1D5M C;  1VQF A;  3G7L A;  4CDD C;  1N9W A;  2K5W A;  2F0N A;  2BH2 A;  2R7D A;  5I9O A;  4IUP A;  4UAI A;  4JC0 A;  5C0X H;  1F9S A;  3RD4 A;  4DV6 L;  3IKJ A;  3DM1 A;  4J8Q A;  4JV5 L;  1VS0 A;  3TP6 A;  3OWF A;  1U4M A;  5FOB B;  4CBV A;  3A74 A;  3TEH B;  3ZYY X;  4H0L C;  4RWS C;  2VL6 A;  4ID6 A;  3H6M A;  3W1G A;  2B39 A;  4FXD A;  1E0B A;  2PMZ E;  2A69 C;  4B3S Q;  3D8G A;  2HIV A;  2ES2 A;  1SE8 A;  1OXX K;  2JA8 B;  4I7A A;  5AJ3 Q;  2F0F A;  3PUX A;  4IPC A;  1KHI A;  1Q86 C;  1PLF A;  4X64 Q;  1EYA A;  3OIP A;  1VF7 A;  3D31 A;  1XNQ L;  2K14 A;  3FPU B;  1QE6 A;  1EIH A;  5COY A;  4BA2 I;  3MZ5 A;  5CV9 A;  1JWM D;  1ZXT A;  1WOC A;  1BO0 A;  4CDE C;  2P5Z X;  1XNR L;  1WI5 A;  1ZYR D;  3K7U C;  2GVA A;  1K3B C;  4LF6 L;  4IUQ A;  1NUC A;  3LX0 A;  1J6Q A;  1HUM A;  3S2D H;  4A93 B;  3STB C;  2PI2 E;  2AUK A;  1TII D;  2NVX H;  1JWU D;  3UDX A;  1CI3 M;  4ZQ3 A;  4DGZ A;  1PV4 A;  4JI5 Q;  4IPH A;  1E2W A;  2OTJ A;  1G6P A;  4GOP B;  2L4N A;  2K05 A;  1SXT A;  4C3I B;  3CU7 A;  4K0K L;  2EVB A;  4X3S A;  4ZUI A;  3HOZ G;  3OW7 A;  3S16 B;  1CA5 A;  2B2V C;  2VXW A;  2F3I A;  1LAB A;  3L9A X;  3SK8 A;  1LM0 A;  2DN8 A;  3CAM A;  2YU9 B;  4GOP A;  4C3H H;  2Y0S B;  1PH1 A;  5HGQ A;  3MEF A;  1WD1 A;  1DCZ A;  1EY9 A;  3KDF A;  4JPB W;  4Q0F A;  3I90 A;  4B08 A;  4EQ5 A;  1STB A;  1GHK A;  3E6Z X;  1BBU A;  1BBX C;  3J7A F;  3K7A B;  2RQX A;  3DHQ A;  2R6G A;  2KA7 A;  2NTT A;  5JVG 3;  2FMM A;  5C0X J;  5T1I A;  4ZKC B;  1WD0 A;  2C5C A;  5IP7 H;  3URY A;  4AH6 A;  3VR5 A;  4JCV E;  2WIN B;  3AMU A;  1V43 A;  1C9O A;  1I6V C;  5EPJ A;  3KUP A;  4LMQ D;  1G91 A;  4RG1 A;  1L2F A;  1G6Z A;  4X3T A;  2DJF C;  1GUW A;  5LMN Q;  2L9H A;  4A3J B;  3I4N H;  1TU2 B;  2KQ3 A;  4OO1 G;  3HRZ C;  4R4Q A;  4HTH A;  4OEM B;  1EYC A;  2E2I H;  1HA5 A;  1QUQ B;  2K52 A;  3BG3 A;  4P71 A;  1XMQ Q;  2MJ8 A;  4HN7 A;  2QDB A;  2NVT B;  4YWL A;  5FLX L;  5CV8 A;  1N33 L;  2MO1 A;  5HY6 A;  5CV6 A;  4BBS H;  3W5O A;  2PW5 A;  1YIT A;  1CA6 A;  3LWU A;  1CSP A;  4KHP L;  1QNU A;  3A0J A;  1L0X B;  4B9W A;  2Z0S A;  4JI3 L;  5IY0 A;  1ICF B;  3K5L A;  4CJ1 B;  1SR3 A;  4A3L G;  2GN5 A;  1EWH A;  2F0I A;  2QKI C;  1S5D D;  5GAH C;  4DK3 C;  4A3K B;  1KIX A;  1KLG D;  1CKO A;  1EWI A;  5CMD A;  1AN8 A;  3T1Y Q;  3KOJ A;  2VUM G;  3RZD B;  3EFX D;  3Q8D A;  2L11 A;  5A2Q L;  1V9P A;  1DGS A;  3RLN A;  2CQA A;  3STB D;  1NNX A;  3S1Q B;  2AWN A;  1WCM G;  3SDZ A;  1ILP A;  4OEL B;  4LF8 Q;  2UXD Q;  4MIU A;  2AQ3 B;  2ZTC A;  4YCU A;  5FO9 B;  4PZ7 A;  4DFA A;  4LF4 Q;  3T13 A;  1PRT B;  4F88 A;  3BVG A;  2BDO A;  4LW1 A;  1H9R A;  3H15 A;  1K0R A;  1HNZ Q;  2F4V L;  3NEN A;  1VQ9 A;  1UUP A;  3WOE A;  3JC6 6;  2M00 A;  4OL7 A;  5M3M H;  2QGQ A;  2Q2H A;  1BCP B;  5JJZ A;  4JK1 C;  1PFM A;  2F0D A;  2HDL A;  4IZ8 A;  2MUY A;  1IYV A;  1WTV A;  2RCN A;  1K3R A;  3DM3 A;  1X6O A;  4NP5 A;  5KIX A;  2HT1 A;  1TY2 A;  3SK4 A;  4F7X A;  4KY7 A;  1LT6 D;  1T9H A;  3M3Y H;  3WDN A;  2KJX A;  1KL9 A;  2HCC A;  3A7L A;  3J80 i;  4RFB A;  4GKJ L;  3C1F A;  3G6J B;  1PH8 A;  4RA8 A;  4HJ8 A;  1XTD A;  1TY0 A;  2OQK A;  3HOW G;  1A6X A;  1CKN A;  3PUW A;  2UU9 L;  2I46 A;  1LAC A;  1JWS D;  2HQL A;  3PO2 H;  5JOB A;  3KBX A;  3GTL B;  2A19 A;  2EY6 A;  3JAM L;  4IUR A;  3T51 B;  3M9B A;  1KNE A;  2ZJQ A;  2DNE A;  1S40 A;  1SBB B;  4EQP A;  1I4X A;  3I3C A;  1SFO H;  4DUY L;  3MTS A;  4X3U A;  4H13 C;  2LY7 A;  1G2T A;  1AW7 A;  5DLQ E;  5LHY 1;  2F0K A;  1CHP D;  3TS2 A;  2K32 A;  4XT1 B;  3T56 B;  3GTM B;  2JYO A;  4KKU A;  4JI7 L;  1J9O A;  2PNH A;  1TWH B;  4FXK C;  4OIK A;  3V05 A;  5C4X B;  4YHH Q;  4KJN A;  2XTI A;  4FO2 A;  4CKE A;  1PYB A;  5C3X A;  3PIP 3;  2IY5 B;  2ID0 A;  2RVL A;  1GVP A;  1R4P B;  4A4I A;  1UE5 A;  3TP5 A;  2SDF A;  1KLU D;  5M5W B;  5EBC A;  1NCV A;  2SOB A;  4WOR A;  4R4O A;  1GUS A;  1P16 A;  1BUV T;  5COR A;  3KJP A;  3KK7 A;  2KCN A;  3BZC A;  2KHJ A;  2A1A A;  1YBY A;  3A8K E;  5ELC A;  1FGB D;  3GTJ B;  4NXN Q;  5I6W A;  2ZM6 Q;  3DMU A;  2R7Z G;  2JA7 B;  3ONA B;  2WKC A;  4C3J B;  4LF9 Q;  3C46 A;  2JA8 H;  1EY5 A;  3TN2 A;  4RHS A;  4YWK A;  4DR7 Q;  4O2D A;  1T5X D;  3V2T A;  1C48 A;  2PMZ B;  4MHE A;  2OXP A;  2ALY B;  3PO3 G;  2KCC A;  3K58 A;  2KBN A;  3P7J A;  5LL6 X;  3A5U A;  3GTP H;  3KLS X;  3I4O A;  3CQZ B;  2F0U A;  2BE5 D;  2B63 G;  3I4M G;  4GZY C;  2WAC A;  3NHH A;  4A93 H;  5IGE A;  3QR8 A;  4GOP C;  1A15 A;  1I4H A;  3KF8 A;  5FLM G;  4DR3 Q;  4UY8 C;  1NBW A;  2A6H D;  2CHB D;  4TQU S;  1VQC A;  2CW0 C;  3U4Z A;  4BY1 H;  3PUV A;  3UDI A;  1JJC B;  1HR0 Q;  2L1B A;  4C3I H;  1K28 A;  5JEA H;  1PFS A;  5K36 G;  3HKZ G;  3S16 H;  3CW2 C;  2D5D A;  2ZJR A;  2BH8 A;  3F8T A;  5CBA E;  3QWN A;  1PH9 A;  5E1F A;  3BDC A;  4LUV A;  1S5F D;  4ILW A;  3C1E A;  4OX9 Q;  4K8J A;  1E24 A;  1O80 A;  2Z6B A;  1EQQ A;  1PH3 A;  4FF3 A;  3NEM A;  3CMA A;  3OPO A;  4LFC Q;  1N36 Q;  4L5R C;  1SYF A;  4DV4 L;  4JBJ A;  4CKC A;  1V1P B;  5EPL A;  4KY5 A;  3RLF A;  3HOX B;  4B3S L;  1HFN A;  4KN7 C;  2NWG A;  1PRT F;  3VR2 A;  4K14 A;  4PMC A;  3D6W A;  1SNO A;  3J81 L;  1VQM A;  1AZP A;  2XIW A;  2HCI A;  4X64 L;  5IOD A;  2HHH Q;  3HGB A;  5C3E B;  3H0G G;  1WFQ A;  4A3J H;  4RCO A;  1VQ7 A;  4NB3 A;  1P8L A;  1SE4 A;  2IX3 A;  4OO1 I;  5J1Z A;  1BCP F;  3S2D B;  3R2T A;  1UE1 A;  3CPW A;  2NVT H;  3A7A B;  5IT9 L;  1HTL D;  2KHS A;  2NVX B;  2NN6 I;  3DXJ C;  1TQO A;  5D3I B;  3S1N B;  4XT3 B;  4IJL A;  1Q8I A;  4HID A;  2OT2 A;  3HOV G;  4NXM Q;  3ZJY C;  2QA4 A;  4DU9 A;  1LTG D;  5HGT A;  1VQO A;  1PFB A;  5JPN C;  1NAP A;  3I91 A;  3WWV A;  1IW7 C;  5FLX c;  3UE0 A;  2F03 A;  1EEI D;  1EOT A;  3H3V I;  3NTI A;  4XTC S;  3KBG A;  4A3K H;  4ZRZ A;  3RN5 A;  3TP7 A;  4R4C A;  1O78 A;  2JSO A;  1E2V A;  3Q24 A;  2PQA B;  4JBM A;  1N34 Q;  3L2P A;  3M4Y A;  2VY3 A;  4WFN 3;  1TS2 A;  4MTK A;  2FHT A;  1PFN A;  2RSN A;  3DWA A;  1CT1 D;  5TSS A;  1PRT C;  2A8V A;  2Z1C A;  5JEA J;  2RHS B;  1G8Z D;  2F0E A;  2PQA A;  5FK9 C;  3OTO L;  4LF5 L;  1YEZ A;  2IJ0 A;  4QUC A;  4LF7 L;  4KJO A;  4A3F G;  4FF2 A;  1L1O A;  1VF5 C;  3VA7 A;  4QCL A;  5FO7 B;  1QCB D;  1K9M C;  1BCP C;  3MXN A;  2KEE A;  2JJQ A;  4A3E B;  3I4N B;  1B70 B;  1SMY C;  2WII B;  5C4H A;  1KDA A;  3CF5 A;  1RD9 D;  1U4P A;  3MC0 B;  3IFD A;  5JJK A;  3NXW A;  1EIG A;  4IOC A;  3D3R A;  2E75 C;  3M7N A;  5ELB A;  5LMN L;  4FXG C;  4O42 A;  1F9P A;  4BBS B;  3NP8 A;  4HR7 B;  1JB3 A;  4KMU C;  4DR6 Q;  2CH4 W;  4XXE A;  4A3D G;  1EIY B;  1E1T A;  1ZKO A;  1KAA A;  1GM5 A;  2K33 A;  2AWO A;  1ICW A;  2AKW B;  4FP5 D;  3S1R H;  4CKB A;  3S9W A;  4PV1 C;  2EYP A;  3R8B A;  1XWE A;  1LTS D;  1Q1B A;  3A5Z B;  4QQB X;  1M1K C;  3BYT B;  3T1Y L;  4QUF A;  4H02 A;  3GTL H;  1WJJ A;  2A74 C;  5IGF A;  4GNX A;  4DK0 A;  3PV0 A;  2I5M X;  4K8I A;  1A3U A;  1HNW Q;  3CHB D;  1D2B A;  5CR3 A;  1KAB A;  1H9M A;  4A3B G;  1D1K A;  4HCS A;  1NJI C;  4LF8 L;  1CSQ A;  3JAM c;  3E9I A;  3GTM H;  5DM7 3;  4UPA A;  4LF4 L;  4DV2 L;  1ET6 A;  3RMH A;  1HNZ L;  3K81 C;  2E74 C;  1IBL L;  2VUM B;  5LMN W;  1LYL A;  1B9M A;  2NZO A;  2X69 A;  5C44 G;  4EQN A;  5M5W H;  1JJ2 A;  1IKM A;  4Y7N H;  1EQR A;  5BR8 L;  3K5M A;  1I4Q A;  4UP8 A;  4HIM A;  3HZX A;  3P75 A;  1WVL A;  4DAP A;  3M3Y B;  1QNK A;  2KUM A;  3EVQ A;  1QZH A;  2JA7 H;  4DK1 A;  2Q2I A;  2NUC A;  3GV3 A;  2N78 A;  3HKS A;  1GD7 A;  5L37 A;  4J15 A;  4UP7 A;  4YWM A;  4JI6 Q;  3R3O A;  1SJE D;  4A3G G;  2PPB C;  5KYI A;  1QWY A;  1EYG A;  3I8Z A;  3PO2 B;  2EQS A;  3M85 A;  3CXC A;  3VYS A;  3CQZ H;  1FNW A;  1MJC A;  1F2M A;  4HIK A;  2EY1 A;  3FHW A;  1HNX Q;  4XYO A;  4U68 A;  3KLS A;  1BXT A;  3S14 B;  3OYY A;  4OWW B;  1HUN A;  2EJG C;  4UDU C;  4FYD A;  2F0P A;  2K5D A;  4HJA A;  1J5E Q;  4B3T Q;  2L15 A;  4B3M Q;  2JA5 G;  1IYU A;  3NSW A;  2CQO A;  2MHV A;  1RJT A;  3CPF A;  4IN3 A;  1QB5 D;  3Q23 A;  4FVM A;  4IFD H;  4EX5 A;  3CCJ A;  1HQR D;  3QB3 A;  5FJ8 H;  5I6Y A;  4JYA Q;  2X6G A;  2H1E A;  4YHH L;  5EQ0 A;  1MBY A;  4BBR H;  2EY2 A;  5C5M A;  3AQQ A;  3OWE B;  2ASB A;  2OTL A;  5EJW A;  3KLR A;  4PMB A;  5M3F H;  1VQ8 A;  5IYD G;  5BN4 A;  2KOL A;  3QOJ A;  2JK8 A;  4C2M H;  2R92 G;  3CCL A;  4JBW A;  3GTO H;  2TSS A;  2J7Z A;  1GKH A;  1IBM L;  1R9T B;  3CCS A;  1SYD A;  1I4R A;  2OQ0 A;  3CCM A;  3HOX H;  2WV6 D;  5T1G A;  2ZM6 L;  3UI2 A;  2BDN A;  4LF9 L;  1MSG A;  1STH A;  4C56 C;  4DR7 L;  4RCN A;  3EQL C;  4N8F A;  5D14 A;  3S1M H;  3TRE A;  2WKD A;  4R8N A;  5C3E H;  4GLX A;  3GTP B;  1QJO A;  1XX8 A;  3K57 A;  1B7Y B;  1VQD A;  3NTK A;  4JW0 A;  3GTK H;  1GXD C;  1ENF A;  1RF2 D;  1Q8K A;  1YNX A;  4DXG A;  1KNA A;  4X62 Q;  3J81 c;  3S1N H;  4A76 A;  1X3Q A;  1OXV A;  1PTO H;  2EOT A;  3ERS X;  3OOC A;  4BY1 B;  3B6Y A;  1DYQ A;  3QOL A;  4DUZ L;  4DR3 L;  1E22 A;  4OHJ A;  1FR3 A;  3DLL A;  5DEH A;  1U5K A;  4GKK L;  1LUZ A;  2ICI A;  1X32 A;  3KDF B;  3E0J A;  1X56 A;  5IT9 c;  2QEJ C;  4LFA Q;  1N8R C;  1B1Z A;  1UE6 A;  2BOS A;  4BXX H;  1L1O C;  2GA4 B;  2PW7 A;  2K50 A;  2EJF C;  2RKS A;  3J80 L;  1A3T A;  4OX9 L;  2B63 B;  4IFD J;  1Q1E A;  2N88 A;  3J80 E;  3VYU A;  5GRO A;  1PZK D;  2AQ1 B;  3HP3 A;  1MI2 A;  2CWP A;  2A68 D;  1O7Z A;  1EOV A;  2CWA A;  2QEX A;  1N36 L;  4L63 B;  1HHV A;  2JA6 G;  4KLK A;  5ELE A;  1YHA A;  2IHF A;  2UXB Q;  1PDQ A;  2NVQ H;  4IQZ A;  1LT3 D;  1BBW A;  4A3E H;  4RGO S;  4DV7 Q;  4OGQ C;  2OWO A;  3HOZ H;  2B2Y A;  5LMU Q;  1TR5 A;  4LAA A;  3X3N A;  5IGB A;  3HKZ B;  3CME A;  4RKL A;  2HHH L;  4BY7 G;  1XMO Q;  4JVZ A;  2JQO A;  4P75 A;  2MFI A;  2NN6 G;  1G51 A;  2UUC Q;  1IL8 A;  2EIF A;  2MQH A;  3CCQ A;  2L55 A;  4IUU A;  1GUO A;  2ZTE A;  5CV7 A;  1S4Z A;  2SEB D;  1JIC A;  1PA6 A;  2F0L A;  1Z6H A;  4YY3 L;  4GNX C;  1YI2 A;  5KEE A;  3AB9 A;  4P2C B;  1Y1W G;  2Z6K A;  1STA A;  3RN2 A;  1VQ4 A;  4OON A;  1DON A;  4N9T A;  3HG9 A;  3RLO A;  2RHQ B;  3LNN A;  1EL0 A;  3RNU A;  3PUY A;  3J7A 5;  2VQE Q;  4OO1 H;  1PTO D;  3P1H A;  5M3M G;  2LFN A;  1E1O A;  5IYB H;  3CC2 A;  4WJ4 A;  2EYO A;  4CGY B;  2K5N A;  1FD7 D;  2OEO A;  1X55 A;  3I72 A;  3SGI A;  1EQT A;  5K5P A;  1LO5 D;  3CC4 A;  1EZ8 A;  5IP9 G;  4LK1 C;  1WTR A;  1FJG Q;  1ILQ A;  4XDX A;  1PZI D;  2I07 B;  3H91 A;  1QVG A;  1JE5 A;  3H3V H;  1VQ5 A;  1R4Q B;  4A3L H;  2EZV A;  2K04 A;  2BE5 C;  4CHT B;  1HCZ A;  4K2L A;  3BU2 A;  2VUM H;  1VMP A;  1WTW A;  2A6H C;  4RAU C;  5C4Z A;  1LTA D;  1F77 A;  4KD3 A;  4DR6 L;  4DV0 Q;  1WCM H;  3S1R B;  4JI4 Q;  3F2D A;  1CKN B;  4DR5 Q;  4YCV A;  3TS0 A;  1YZ6 A;  4AQY Q;  2E2J H;  4A3F B;  1AE2 A;  1SN8 A;  4JI8 L;  4L6T B;  3M7G A;  3U4V A;  1LTT D;  4B3R Q;  1AEX A;  5DM6 3;  3L3O C;  5CBE E;  3T1H Q;  1SND A;  1IHZ A;  1HH2 P;  1YNJ C;  1PHJ A;  5ELD A;  1NY4 A;  4X3K A;  2G9H D;  1CM9 A;  2XRS D;  2YV5 A;  3OHX C;  3S14 H;  3HFZ B;  1HJP A;  4O0A A;  2Q2T A;  3K59 A;  1ZEQ X;  1CKM A;  1HNW L;  3AFP A;  3PSI A;  4K5X A;  5ISR A;  3K0X A;  3TSS A;  4KK7 A;  4A3M G;  4A3C H;  3PCO B;  2QCP X;  2D2C C;  3EJI A;  1Q90 A;  2F0H A;  1Z7T A;  2AQ2 B;  4HJ5 A;  2MGS A;  4A3I G;  2WP8 J;  2F4I A;  1KQS A;  2DGY A;  5EKK A;  2H4O A;  4IPG A;  4KV6 A;  4Y7N B;  3KYH C;  2NZH A;  4OIJ A;  2F1M A;  3HOW H;  1E2Z A;  4DR1 L;  4FF1 A;  3J81 j;  1HZC A;  1JR0 D;  3RR5 A;  1PH6 A;  5H1S E;  1LTR D;  4K5V A;  1VMC A;  1R9T H;  4EGV A;  2K5H A;  4JI0 L;  5HUR A;  4AYB G;  4YCW A;  1K8O A;  4A93 G;  3PGZ A;  4EQO A;  3SEB A;  3GDE A;  4X66 Q;  2KCT A;  4K2K A;  1PH5 A;  1EIF A;  1SNC A;  3HS0 C;  1S5C D;  5DAU A;  2WAQ G;  4HJ9 A;  4CDF C;  1AZQ A;  3CCV A;  4JI2 Q;  3KF8 B;  1VQN A;  1JOQ A;  3H94 A;  4L5T A;  2EXD A;  3FMC A;  4C3I G;  3TRZ A;  2D9U A;  1STY A;  2RSO A;  1GUG A;  2LXK A;  1T5E A;  1TWF B;  1HTP A;  1VQB A;  4BS9 A;  2O5J C;  3EBE A;  5C44 B;  2L0C A;  4G4K A;  2Y0S G;  4LNQ A;  3ERQ A;  1QOH A;  1HNX L;  2IX1 A;  1H9S A;  4RHR A;  1ROD A;  2I0Q A;  1SSO A;  2D0P A;  3SXH A;  2R3Z A;  4P73 A;  4R8I A;  2ZXR A;  2R7Z H;  4CJ2 C;  1J5E L;  2K4K A;  1WTX A;  2K7V A;  4B3T L;  1KDC A;  4B3M L;  1W6J A;  1G2S A;  3HEJ A;  4DNR B;  1M8A A;  1XPR A;  4BBR B;  1HPC A;  1D8L A;  1EY8 A;  1A3V A;  2F3V A;  4MN3 A;  1K83 B;  4QJF A;  3MHB A;  4A3G B;  5M3F B;  1F9R A;  3PO3 H;  3D0F A;  1LT4 D;  2NB0 A;  1XPO A;  2HD3 A;  4JYA L;  4PG3 A;  4C2M B;  4MTN A;  1X54 A;  1YNJ D;  4ZCK A;  3RZO B;  3GTO B;  2R93 G;  3A8J E;  4A3J G;  4HED A;  4JBK A;  1YIJ A;  2B2Y C;  2B63 H;  3I4M H;  1TWA B;  5ELO A;  3X3M A;  5FLM H;  4R4T A;  3A55 A;  1VQ6 A;  4PMW A;  1SNP A;  5AJ3 L;  2UUB Q;  4DXF A;  2XN9 C;  3NWT A;  3HOU G;  2JA5 B;  3K0Y A;  4PQX A;  3S1M B;  5CGK A;  1VQG A;  5IOC A;  4HMJ A;  1K73 C;  1FVI A;  1KRS A;  3GTK B;  5K36 H;  1Q46 A;  1F2L A;  1M90 C;  2F0M A;  1YJN A;  2MNA A;  4A3K G;  2Z6K C;  3JAM i;  3N52 A;  1WTP A;  3NUC A;  1BKB A;  1PH4 A;  2WB1 G;  3E3X A;  1B3Q A;  1STE A;  1S72 A;  1PTO B;  1ONL A;  4KHV A;  3S15 B;  3D6C A;  3TP8 A;  3QIA A;  2C35 B;  3J7A V;  3A8I E;  3SK5 A;  4JI5 L;  4G57 A;  1HQM C;  1PYS B;  2EPB A;  4KHP Q;  1STN A;  3VR6 A;  1U4L A;  1KC8 C;  4JI3 Q;  1DZ1 A;  2ZXO A;  3J7Z C;  3G4S A;  4LFA L;  4IJH A;  2X6L A;  3ULL A;  3H0G H;  3T4A C;  3S2H H;  1SJH D;  5EBD A;  1AE3 A;  2B8F A;  1UNS A;  1L1O B;  1W3S A;  1EWC A;  2JA9 A;  1JOR A;  4DA2 A;  1L0Y B;  1TXY A;  3MXN B;  1D7Q A;  4QY7 A;  1NR2 A;  3W1B A;  1I5F A;  3HKZ E;  4JG2 A;  3MVV A;  3NPP A;  1H95 A;  4F87 A;  2NVQ B;  3HOV H;  3FKI G;  4IAL A;  5KRU A;  1B4O A;  3HOZ B;  3SVM A;  1BF4 A;  2UXB L;  2PYK A;  2K28 A;  4RH6 A;  5EKI A;  4IO9 A;  3D4R A;  2QW7 A;  4DV7 L;  1CZG A;  3MAQ A;  3Q22 A;  1K8G A;  3R93 A;  5LMU L;  4WRD A;  1HXY D;  4DV3 Q;  1XMQ L;  3ERO A;  2F0T A;  2YTV A;  4X65 Q;  1VQL A;  2UUC L;  2EY5 A;  3GP7 A;  2ZXP A;  2VQF Q;  3MXU A;  3BVZ A;  2JA6 B;  3GTQ H;  4DR2 Q;  4A3F H;  4UHV A;  4GNX B;  4ZYS A;  1V8Q A;  1Y1V G;  5GAG C;  1STG A;  4XYQ A;  3CD6 A;  4Z9C B;  3OSO A;  4G7Z C;  2F0G A;  5C4X G;  4O1N A;  3L7Z C;  2N55 A;  5IYC H;  1UAP A;  5DNF A;  1A63 A;  2VQE L;  3DEO A;  1TKW B;  2UU9 Q;  1HZB A;  5GQO A;  1QG7 A;  1UEB A;  3AFQ A;  3ER0 A;  3F2U A;  2UXD L;  2WFW A;  4A3D H;  1BQQ T;  5KYL A;  4DUY Q;  1SNM A;  3HOY G;  2LKV A;  4H7B A;  2MO0 A;  1DOL A;  4DK6 C;  1PH7 A;  3J81 i;  4KY6 A;  4ME5 A;  1EFW A;  1EU3 A;  4HSP A;  4C3J G;  2VB2 X;  1Y1W B;  4TVA B;  5JVH 3;  2I5H A;  2VS1 A;  3K5O A;  1WTH A;  1HFG A;  4JI7 Q;  1B8A A;  2CKZ B;  3TZD A;  3BS1 A;  4GLV B;  4NKL A;  1GOZ A;  1IZ6 A;  4MNO A;  2V4D A;  2A6E D;  2VB3 X;  1WCM B;  2Q8I B;  1HRJ A;  5ELF A;  4HIO A;  1A8V A;  4K6L A;  5I4D A;  2UUA Q;  2E2J B;  2NBF A;  3BZK A;  2GVB A;  4DV0 L;  1SYB A;  2O4X A;  1EY0 A;  1YHQ A;  4JI4 L;  4DPG A;  1LT5 D;  2ZJP A;  1PVO A;  1J8I A;  1CHQ D;  4DR5 L;  1I6H H;  5G3L F;  3LGJ A;  3BJU A;  4AQY L;  2Q2U A;  2F3W A;  4QF4 A;  2IHE A;  1K0S A;  2M9V A;  2HQE A;  5C0X G;  1TWC B;  4B3R L;  1VQH A;  1NTG A;  1PXU A;  3Q0A A;  2R7F A;  1B3A A;  3T1H L;  1CFM A;  2PCF B;  1X3G A;  1TWF H;  2RF4 A;  1S3O A;  3AEV A;  5CC4 A;  2UXC Q;  5C44 H;  2A68 C;  4QB4 A;  1PTO F;  3SE0 A;  2B2W A;  4HSV A;  2EYM A;  3VYT A;  2DY7 A;  3I55 A;  1N32 Q;  1EY4 A; 
#chains in the Genus database with same CATH homology
 2R7Z G;  5JJI A;  1X65 A;  4YY3 L;  4GNX C;  2JA8 H;  4GN3 B;  4LF9 Q;  3S1Q H;  1KAW A;  5J3B A;  1YI2 A;  4YWK A;  3F1Z A;  4DR7 Q;  4O2D A;  5IWA Q;  3PUZ A;  1Y1W G;  2F4V Q;  2Z6K A;  3RN2 A;  1VQ4 A;  1K8A C;  4L5S A;  3KFU A;  4OON A;  3TQY A;  1K83 H;  2ALY B;  3RLO A;  4A3G H;  3PO3 G;  2RHQ B;  1TWG H;  2FXQ A;  1I94 L;  1XMO L;  2KBN A;  3RNU A;  3A5U A;  2YTY A;  3PUY A;  1SRU A;  5C3E G;  2VQE Q;  3J7A 5;  3RZO H;  3GTP H;  1JJG A;  3I4O A;  4QIW E;  1SRO A;  2VW9 A;  1X9N A;  1IBK L;  5M3M G;  2KEN A;  2B63 G;  4LFB Q;  1G29 1;  2KCM A;  3I4M G;  4DV5 L;  1E1O A;  1TWA H;  5IYC G;  4NXN L;  5IYB H;  3CC2 A;  4A93 H;  4WJ4 A;  4GOP C;  5FLM G;  4DR3 Q;  4DR4 L;  2F52 A;  1WYD A;  3AYH B;  1JMC A;  2K5N A;  4UY8 C;  2BA1 A;  1NBW A;  1X55 A;  4DV4 Q;  3SGI A;  4TQU S;  5C4J H;  2JA5 H;  1VQC A;  5E7N A;  3CC4 A;  2E2H H;  5IP9 G;  3FKI H;  3U4Z A;  4BY1 H;  4OWX B;  3PUV A;  2WB1 E;  1UWV A;  3K8A A;  4X66 L;  3UDI A;  1FJG Q;  1JJC B;  1U0L A;  4GKJ Q;  1HR0 Q;  1BVS A;  2CCZ A;  1XPU A;  4C3I H;  2CFM A;  1JE5 A;  1QVG A;  1PFS A;  1VQ5 A;  3H3V H;  5K36 G;  4JI8 Q;  3PF5 A;  3HKZ G;  3S16 H;  4A3L H;  4JI2 L;  3CW2 C;  2ZJR A;  2BH8 A;  3F8T A;  1PH9 A;  2E5L L;  4BXX G;  4LUV A;  4QL5 A;  1YVC A;  4Y52 H;  3BU2 A;  2VUM H;  4OX9 Q;  1RL2 A;  3U58 A;  1E24 A;  5IYD H;  3UDF A;  1EQQ A;  1PH3 A;  3S15 H;  2R92 H;  3NEM A;  1VQJ A;  2IT1 A;  3CMA A;  2D62 A;  1MIU A;  1N36 Q;  4A75 A;  4LFC Q;  3IRB A;  4POG A;  4DR6 L;  4L5R C;  4DV4 L;  4JBJ A;  1WCM H;  4DV0 Q;  4GS3 A;  1QZG A;  2JA7 G;  2JE6 I;  5IP7 G;  4JI4 Q;  3F2D A;  4DV1 Q;  3RLF A;  1CKN B;  3GO5 A;  1FJG L;  4DR5 Q;  4YCV A;  3TS0 A;  4B3S L;  1YZ6 A;  3PIP A;  4AQY Q;  1Q7Y C;  2E2J H;  1HR0 L;  1I50 H;  1Z9F A;  2JEA I;  3UDG A;  1AE2 A;  1SN8 A;  4JI8 L;  1Y1V H;  4AIM A;  1VQM A;  3U4V A;  4X64 L;  4B3R Q;  2HHH Q;  3CCU A;  3H0G G;  4KI0 A;  3T1H Q;  1WFQ A;  4A3J H;  4A3E G;  1TWH H;  3I4N G;  4KHZ A;  5C4X H;  2K5V A;  1VQ7 A;  4NB3 A;  1P8L A;  1HH2 P;  1NMG A;  1PHJ A;  4OO1 I;  1V1Q A;  3FP9 A;  4JOI A;  1HZ9 A;  3ULP A;  1OXS C;  1FL0 A;  1NY4 A;  1OTC A;  1UE1 A;  4DR1 Q;  3F2C A;  3CPW A;  2YV5 A;  2NVT H;  4PZ6 A;  4LFC L;  4APV A;  3S14 H;  3HFZ B;  3I2Z A;  1NE3 A;  3GTG H;  2NN6 I;  4A3B H;  4BBS G;  1HJP A;  4O0A A;  4P74 A;  2Q2T A;  1RIP A;  3PF4 A;  1CKM A;  4IJL A;  1HNW L;  3U50 C;  4JI0 Q;  3AFP A;  4HID A;  3PSI A;  3HOV G;  1Q82 C;  4NXM Q;  3GTJ H;  3K0X A;  3OTO Q;  3S24 A;  4LF5 Q;  3ZJY C;  2QA4 A;  3HOY H;  3KJO A;  4OWT B;  1XJV A;  2UUB L;  1VQO A;  3CCE A;  4A3M G;  4LF7 Q;  4IFD G;  4A3C H;  3PCO B;  4MZ9 A;  3NEL A;  4JI1 L;  4C3J H;  3WWV A;  5FJ8 G;  5FLX c;  3UE0 A;  4HJ5 A;  3H3V I;  1I94 Q;  2HIX A;  1UE7 A;  5M5Y H;  4XTC S;  4A3I G;  1VCI A;  2E8G A;  2WP8 J;  1KQS A;  2DGY A;  4A3K H;  4WJ3 M;  1CUK A;  3RN5 A;  4IPG A;  4BBR G;  4R4C A;  1IBK Q;  1IXR A;  3KYH C;  2NZH A;  5M3F G;  3HOW H;  4DR1 L;  2PQA B;  3EN2 A;  4JBM A;  1N34 Q;  3L2P A;  4DV5 Q;  2VY3 A;  3J81 j;  1MJE A;  1HZC A;  3RR5 A;  3PIO A;  1PH6 A;  5H1S E;  4HJ7 A;  4DR4 Q;  2XGT A;  2A8V A;  1O7I A;  5JEA J;  2K5H A;  1R9T H;  2RHS B;  4JI0 L;  3I56 A;  4NPS A;  1QVF A;  4AYB G;  2PQA A;  5GAE C;  4YCW A;  1VQK A;  5IYB G;  2K75 A;  1KRT A;  4NXM L;  3OTO L;  4LF5 L;  1YEZ A;  3PGZ A;  3HOX G;  4A93 G;  1IL2 A;  3GDE A;  2JA6 H;  1C0A A;  4X66 Q;  2BA0 A;  2KCT A;  4POF A;  4A3F G;  1L1O A;  1EIF A;  1PH5 A;  4LF7 L;  4BA1 I;  1Q12 A;  1QUQ A;  2WAQ G;  2VNU D;  4HJ9 A;  1K9M C;  1VQF A;  4P72 A;  1HR0 W;  1JT8 A;  2JJQ A;  4JI2 Q;  3CCV A;  1N9W A;  3F2B A;  4ME3 A;  1B70 B;  2R7D A;  2BH2 A;  3KF8 B;  1VQN A;  3ICE A;  2E5L Q;  4JC0 A;  5GAD C;  4L5T A;  3CF5 A;  4DNI A;  2EXD A;  4DV6 L;  5JJK A;  3TRZ A;  3EIV A;  4IOC A;  4R1J A;  1N34 L;  4DAM A;  1JB7 A;  3M7N A;  5LMN L;  4BY7 H;  2LXK A;  4JV5 L;  2B29 A;  1VS0 A;  1VQB A;  3EBE A;  3A74 A;  2D0O A;  4LNQ A;  2Y0S G;  3TEH B;  4DR6 Q;  3UE1 A;  3OW2 A;  1HNX L;  5M5X H;  2VL6 A;  4ALP A;  2IX1 A;  1C7Y A;  2IX0 A;  4A3D G;  3W1G A;  3CP0 A;  3M4Q A;  1EIY B;  2PMZ E;  2I0Q A;  2D0P A;  4B3S Q;  2HIV A;  4P73 A;  2ES2 A;  1E1T A;  1SE8 A;  2R7Z H;  1OXX K;  1J5E L;  2K4K A;  4B3T L;  4UP9 A;  1GM5 A;  5AJ3 Q;  2AWO A;  4B3M L;  3PUX A;  2AKW B;  4IPC A;  3S1R H;  3VDY A;  1KHI A;  1Q86 C;  1X3E A;  1QVC A;  4X64 Q;  1Y1W H;  1VQE A;  1XPR A;  1D8L A;  3D31 A;  1XNQ L;  2K14 A;  4QJF A;  4DV2 Q;  4PZ8 A;  3PO3 H;  3D0F A;  1XPO A;  1Q1B A;  4BA2 I;  4JYA L;  4R4I A;  4PG3 A;  3A5Z B;  4QGU A;  1WOC A;  4MTN A;  4QQB X;  1M1K C;  4IOA A;  1X54 A;  2N49 A;  4DAY B;  1XNR L;  3PO2 G;  2LSS A;  2R93 G;  1SLJ A;  3T1Y L;  4A3J G;  1I3Q H;  4H02 A;  1WI5 A;  4DV3 L;  3GTL H;  1WJJ A;  4JBK A;  1IBL Q;  1YIJ A;  4GNX A;  3K7U C;  2GVA A;  2B63 H;  4LF6 L;  3I4M H;  3L0O A;  4X65 L;  1J6Q A;  3PV0 A;  2I5M X;  1HNW Q;  5ELO A;  3S2D H;  3STB C;  4LUZ A;  5BR8 Q;  1AH9 A;  3M4O H;  1W2B A;  2DUD A;  2PI2 E;  5FLM H;  4R4T A;  1VQ6 A;  4LUO A;  4PMW A;  5AJ3 L;  2NVX H;  4A3B G;  2UUB Q;  3UDX A;  1MKH A;  1NJI C;  4LF8 L;  3HOU G;  1PV4 A;  4JI5 Q;  4IPH A;  2VQF L;  4JI1 Q;  5IP9 H;  1CSQ A;  1ASY A;  1VQG A;  2OTJ A;  3JAM c;  1G6P A;  3E9I A;  3GTM H;  4DR2 L;  4GOP B;  4UPA A;  1K73 C;  4LF4 L;  4DV2 L;  1FVI A;  1KRS A;  4GN4 B;  4K0K L;  2VZA A;  3HOZ G;  4A3C G;  1PH2 A;  3K80 C;  4IFD I;  1HNZ L;  5C0X I;  1Q46 A;  1TWC H;  3K81 C;  1M90 C;  5JJL A;  2F3I A;  3M4P A;  1A62 A;  1YJN A;  1LM0 A;  1EUJ A;  2MNA A;  3CAM A;  4A3K G;  4GOP A;  2Z6K C;  4C3H H;  3G48 A;  3JAM i;  1PH1 A;  1IBL L;  5HGQ A;  3MEF A;  5LMN W;  1BKB A;  1LYL A;  2NZO A;  2WB1 G;  5C44 G;  1PH4 A;  5M5W H;  1JJ2 A;  3KDF A;  4Y7N H;  1S72 A;  4EQ5 A;  1EQR A;  5BR8 L;  4UP8 A;  1BBU A;  4GN5 A;  3S17 H;  2R6G A;  4HIM A;  2C35 B;  4DKA C;  5C0X J;  1QZH A;  1VQI A;  4JI5 L;  2JA7 H;  2JA8 G;  5IP7 H;  2Q2I A;  4AH6 A;  1ASZ A;  2N78 A;  1PYS B;  1GD7 A;  2NVY H;  3HKS A;  4JCV E;  4J15 A;  2ZTD A;  4UP7 A;  1V43 A;  4YWM A;  4JI6 Q;  4KHP Q;  1C9O A;  1KC8 C;  4JI3 Q;  4A3G G;  4DV6 Q;  4RG1 A;  1L2F A;  3J7Z C;  3G4S A;  4IJH A;  1EYG A;  4LFA L;  2OCE A;  3ULL A;  3H0G H;  5IE8 A;  5LMN Q;  3S2H H;  2AMC B;  1A0I A;  2EQS A;  4JV5 Q;  3I4N H;  1AE3 A;  3M85 A;  3CXC A;  4XIG S;  1L1O B;  4OO1 G;  4R4Q A;  1W3S A;  2JA9 A;  3CQZ H;  2E2I H;  1MJC A;  1QUQ B;  2K52 A;  4HIK A;  3FHW A;  1HNX Q;  4P71 A;  1TXY A;  3MXN B;  1XMQ Q;  1D7Q A;  2B3G A;  4QY7 A;  4YWL A;  2N3S A;  3OYY A;  4OWW B;  1N33 L;  3W1B A;  2MO1 A;  1I5F A;  3HKZ E;  5HY6 A;  4JG2 A;  4BBS H;  4HJA A;  1J5E Q;  2KHI A;  1IBM Q;  4B3T Q;  1H95 A;  1KXL A;  2L15 A;  3W5O A;  4B3M Q;  2JA5 G;  1SMX A;  1YIT A;  2UUA L;  3HOV H;  1CSP A;  3FKI G;  2CQO A;  4JI6 L;  4KHP L;  3G71 A;  4BY1 G;  3A0J A;  3CPF A;  2Z0S A;  1E3P A;  4JI3 L;  5IY0 A;  1XNQ Q;  4A3M H;  2UXB L;  4EX5 A;  5JEA G;  3CCJ A;  5FJ8 H;  1SR3 A;  4A3L G;  2GN5 A;  4JYA Q;  4A3I H;  4IO9 A;  5GAH C;  1KIX A;  5EAY A;  4DK3 C;  1YJ9 A;  4YHH L;  1CKO A;  4DV7 L;  1KD1 C;  4BBR H;  1K8G A;  1XNR Q;  1EWI A;  5LMU L;  2LXJ A;  3AQQ A;  3T1Y Q;  2ATW A;  2ASB A;  4DV3 Q;  2OTL A;  3KOJ A;  2VUM G;  1FGU A;  5M3F H;  3Q8D A;  1XMQ L;  1VQ8 A;  4LWC A;  4LF6 Q;  5IYD G;  2YTV A;  2JK8 A;  4X65 Q;  4C2M H;  1VQL A;  3GD7 A;  1V9P A;  2R92 G;  1DGS A;  4JBW A;  2UUC L;  3RLN A;  3CCL A;  3GTO H;  2UXC L;  1GKH A;  3STB D;  1IBM L;  1VQA A;  2AWN A;  1WCM G;  2AHO B;  4JOI C;  4IPD A;  4OXP A;  3CCS A;  4LF8 Q;  2UXD Q;  2OQ0 A;  2ZTC A;  4YCU A;  1N32 L;  2VQF Q;  3CCM A;  4PZ7 A;  3HOX H;  2ZM6 L;  3GTQ H;  4DUZ Q;  4DR2 Q;  1GO3 E;  4A3F H;  4LF4 Q;  1YHB A;  4LF9 L;  4GNX B;  1YJW A;  1Y14 B;  4LW1 A;  4GKK Q;  3H15 A;  4K0K Q;  4DR7 L;  1K0R A;  1Y1V G;  1HNZ Q;  5IWA L;  5GAG C;  2F4V L;  3NEN A;  1VQ9 A;  3TRE A;  1NMF A;  4L5Q A;  5ELN A;  3S1M H;  3CD6 A;  5C3E H;  4GLX A;  3JC6 6;  5C4X G;  3KF6 B;  1B7Y B;  1VQD A;  5M3M H;  3L7Z C;  2QGQ A;  3GTK H;  2Q2H A;  5IYC H;  1Q8K A;  1YNX A;  1A63 A;  2VQE L;  2UU9 Q;  2YU9 H;  1HZB A;  4X62 Q;  5GQO A;  1UEB A;  2PI2 A;  3J81 c;  3KF6 A;  4LFB L;  2RCN A;  4GLA C;  3AFQ A;  3ER0 A;  1VQP A;  3S1N H;  2UXD L;  1K3R A;  3DM3 A;  2WFW A;  3CCR A;  1X6O A;  4A76 A;  3NBH B;  1OXV A;  3J80 c;  3ERS X;  4A3D H;  4DUY Q;  3B6Y A;  2V1C C;  4DUZ L;  1E22 A;  4DR3 L;  2HT1 A;  2YTX A;  3K7A H;  3I7F A;  1E7Z A;  3DLL A;  1T9H A;  3HOY G;  3M3Y H;  2MO0 A;  1U5K A;  4DK6 C;  2I5L X;  1LUZ A;  1PH7 A;  3J81 i;  4GKK L;  3KDF B;  1EFW A;  1IYJ B;  1KL9 A;  1X56 A;  5IT9 c;  1N8R C;  4LFA Q;  4TVA B;  2I5H A;  1UE6 A;  2VS1 A;  4FDB A;  3J80 i;  4GKJ L;  4BXX H;  4JI7 Q;  1PH8 A;  1B8A A;  2CKZ B;  4AYB E;  1L1O C;  1XTD A;  4HJ8 A;  4GLV B;  3ULJ A;  2OQK A;  2K50 A;  3HOW G;  1IZ6 A;  4MNO A;  1CKN A;  3PUW A;  2UU9 L;  4X62 L;  2HQL A;  1HZA A;  3E9H A;  3PO2 H;  2R93 H;  2WAQ E;  2A19 A;  1OXT A;  1N33 Q;  4OX9 L;  3M9B A;  4IFD J;  2ZJQ A;  1Q1E A;  1S40 A;  1Q81 C;  1SFO H;  5GRO A;  1OXU A;  4DUY L;  4HIO A;  1A8V A;  2CWP A;  2YYZ A;  2UUA Q;  1EOV A;  2CWA A;  2JEB I;  2QEX A;  1N36 L;  2JA6 G;  3BZK A;  4KLK A;  2GVB A;  4DV0 L;  5DLQ E;  3CC7 A;  1YHA A;  4YY3 Q;  2IHF A;  3HOU H;  1YHQ A;  4DV1 L;  4DPG A;  2ZJP A;  4JI4 L;  1PVO A;  2UXB Q;  3TS2 A;  1X3F A;  4DR5 L;  1I6H H;  3G6E A;  3LGJ A;  3BJU A;  4AQY L;  2Y0S E;  2Q2U A;  2NVQ H;  4RMF A;  2IHE A;  2PNH A;  4JI7 L;  1BBW A;  4A3E H;  4YHH Q;  4DV7 Q;  2XTI A;  2OWO A;  3HOZ H;  1PYB A;  5C0X G;  5LMU Q;  3CME A;  1PA6 A;  4B3R L;  2ID0 A;  2H5X A;  2HHH L;  2IY5 B;  1VQH A;  1NTG A;  1GVP A;  1LTL A;  2R7F A;  3T1H L;  4A4I A;  1UE5 A;  1XMO Q;  4BY7 G;  1X3G A;  2N8N A;  1TWF H;  1Z47 A;  2JQO A;  2MFI A;  4P75 A;  2NN6 G;  2RF4 A;  1G51 A;  2UUC Q;  1S3O A;  3AEV A;  2UXC Q;  5C44 H;  2EIF A;  2MQH A;  3E0E A;  3CCQ A;  3RZD H;  4R4O A;  1P16 A;  2ZTE A;  3KLW A;  1L0W A;  3KJP A;  3BZC A;  2KHJ A;  2A1A A;  1YBY A;  4NXN Q;  3I55 A;  1N32 Q;  2ZM6 Q;  4X6A H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...