4LF6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf6L00
4APVA 2RHQB 3RZDH 4J15A 2ASBA 4LF6L 1X3FA 1C7YA 3H15A 1L0WA 3S1RH 5C3EH 5ELNA 1N32Q 4L5TA 3GD7A 4DR2Q 1HNXL 2ZJQA 4JOIC 4GKJL 3EN2A 3BU2A 1H95A 3PIOA 3L2PA 4UP7A 3GTGH 3A74A 2ES2A 3AFQA 3CQZH 3EBEA 4YCWA 3E9IA 4DV1L 2UXBQ 1UE1A 4IJHA 3M85A 4A3CH 2N78A 3I2ZA 1EQRA 1V43A 1NMFA 1SN8A 1VQ6A 1HH2P 1Y1WG 1N32L 2K4KA 1PH2A 3M4PA 2Z6KA 4DR2L 4AYBE 2R7ZH 3S1NH 4QGUA 2I5MX 5ELOA 2A8VA 3CCJA 1K8GA 3PO2H 5JJIA 4L5QA 3KOJA 4DR5Q 3ER0A 1W2BA 1KQSA 2N3SA 2UXBL 1EOVA 2R7FA 1M90C 1PHJA 2NVTH 4X66Q 4DR7Q 4LFCQ 5M3FG 3UDFA 1Q1EA 2NZHA 5IYDH 2OTLA 3HKZE 4C3JH 1XTDA 3PF5A 1YITA 2PMZE 4P74A 1Q86C 4DK3C 1YJWA 2JE6I 1SRUA 2JA6G 3GTLH 2WFWA 3KLWA 5IWAQ 4BBSG 1SMXA 4DR5L 4YWMA 4YCVA 4DV5Q 1Q12A 3RNUA 4JG2A 3HOZG 3S2HH 2JA5G 4LF7Q 2AWNA 3KF6A 2E2HH 1M1KC 2F3IA 4A3BH 2HQLA 5FLMH 2Y0SE 4DR7L 2JEBI 5LMUQ 4JI8Q 4X65Q 4LUOA 4DV2Q 1XNQQ 2YU9H 1FJGQ 2JA7H 3H3VI 4JV5Q 3S14H 1PH1A 3UE0A 4R4TA 5M5WH 5IWAL 1YBYA 4DV5L 2BH2A 1WJJA 1J5EQ 1Q82C 4LF7L 1K83H 3H0GG 3CCUA 1WCMG 5J3BA 2R92G 1JE5A 2PI2A 5IYDG 2AWOA 4HIDA 1KRTA 3TREA 3UDXA 2B29A 3PUVA 1Q81C 4A93H 5LMUL 4JI8L 2AMCB 1Z47A 4X65L 3KDFA 4DV2L 1XNQL 4JI0Q 2LXKA 1FJGL 3T1YQ 3E9HA 4A3KH 2YYZA 4JV5L 5DLQE 1TWGH 3T1HQ 1J5EL 2VL6A 4JBWA 4OX9Q 5IY0A 1AE3A 4HIKA 1ASYA 3A0JA 3M3YH 1PH4A 3GO5A 4JI3Q 1I94L 2KHJA 5JEAG 4IFDJ 3FHWA 3K80C 2Q2TA 1WYDA 1KAWA 3D0FA 4X6AH 3PUWA 4H02A 1E1TA 5FLXc 1XPOA 4JI0L 4A3CG 4JBJA 3T1YL 1TXYA 3G6EA 2LSSA 1YZ6A 2E2JH 5BR8Q 1P8LA 2WB1E 3B6YA 2EQSA 4A75A 3S16H 2YTXA 1I50H 4GLAC 3I55A 2R7ZG 2VZAA 2BA1A 2PQAA 4A3JG 4OX9L 1FVIA 1CKOA 1X3GA 4LF8Q 4BBSH 3PO2G 1D7QA 3RN2A 2CQOA 4X62Q 5C0XI 2CCZA 2KENA 3IRBA 1VQ9A 3STBD 4DR3Q 1L1OA 3EIVA 3L0OA 5LMNL 4HIOA 1X54A 2CWAA 2QA4A 1UWVA 2NZOA 3HKSA 5BR8L 3J80c 1JJGA 4LF9Q 1CSQA 4WJ4A 3M9BA 1IBLQ 3HFZB 2MNAA 4AYBG 3ULLA 4IFDI 4LF8L 4C3HH 2NVQH 1X3EA 3F8TA 4UPAA 4X62L 2ATWA 3KDFB 4KHZA 3I56A 2K5HA 2VY3A 4GN5A 3RN5A 1ASZA 5GROA 4DUZQ 1NBWA 2HIVA 3CC7A 4DV3L 4DR3L 3CCLA 4A3BG 1WI5A 2IY5B 3CCMA 2BA0A 2N49A 5FLMG 1JJ2A 4A3GH 4P73A 3S15H 4R1JA 4BA2I 3W5OA 1I6HH 1YI2A 1OXXK 1X65A 3TQYA 3W1BA 1MJEA 2E5LL 4LF9L 1K73C 3HKZG 1VQIA 2I0QA 4NXMQ 2VQFQ 2JA7G 1IBLL 4DR6Q 2V1CC 4DV6Q 3PGZA 1VQGA 1VQ8A 1E3PA 3KJPA 3TS0A 4QY7A 4AH6A 4JI3L 1N36Q 3HOYH 4DUZL 4K0KQ 2UUAQ 4B3TQ 3DM3A 3G48A 3VDYA 1EUJA 3CW2C 1DGSA 4A93G 2Y0SG 1PA6A 3TRZA 2E2IH 2NVYH 2PQAB 5H1SE 3DLLA 3UDGA 1TWAH 5IP7H 2VQEQ 4A3KG 1HZCA 4NXML 2QGQA 2VQFL 4DR6L 3PSIA 4DV6L 3FP9A 3UDIA 5LMNW 4AIMA 2IHEA 4JI7Q 4WJ3M 4A3JH 5IYCH 5C4JH 1Q7YC 1Q46A 1L1OB 3I4OA 4JI1Q 1N36L 4OO1G 4K0KL 3A5UA 1KXLA 1NTGA 2UUAL 4JOIA 3AFPA 1PYBA 3SGIA 3J80i 4BXXG 1EWIA 2N8NA 2WAQE 1O7IA 4GOPC 3ERSX 2HT1A 2B3GA 1VQPA 2VQEL 2E8GA 3K8AA 1HNWQ 4GS3A 5GQOA 4BY7H 2B63H 1LTLA 1W3SA 2VW9A 1SFOH 4JBMA 1C0AA 1VCIA 1SLJA 4MZ9A 1VQEA 3CMEA 1Q1BA 1QZHA 3M7NA 5HGQA 2JA8G 4JI7L 2VNUD 4LUZA 3E0EA 4JI1L 1PH5A 1KC8C 2XGTA 4KI0A 4O2DA 4B3SQ 2DGYA 2JA9A 2JEAI 4JI4Q 3TEHB 2GVAA 4HIMA 4PZ7A 1GM5A 1SROA 2ZTEA 1YJ9A 4A76A 1IZ6A 5M3MH 1HR0Q 1PH7A 3A5ZB 1X56A 4YHHQ 3I4NH 3TS2A 4RMFA 1FGUA 2OQ0A 4X66L 4LFCL 4Y7NH 1JMCA 4POFA 1HNWL 1LYLA 3CC4A 2XTIA 1VQLA 2EXDA 4A3FH 2WB1G 4JI6Q 3S17H 5GAGC 4UY8C 5M5YH 3J7ZC 4QIWE 4B3SL 4L5RC 4LF5Q 4P75A 1VQKA 4JI4L 4A4IA 4BBRH 1LUZA 1VQMA 2ZM6Q 3BZKA 1HR0L 4DAYB 1HJPA 4YHHL 1IYJB 4O0AA 3CC2A 1VQJA 3NEMA 3GTPH 3J7A5 3U4VA 4XIGS 5C4XH 2K52A 2YTVA 5C0XJ 2A1AA 3CMAA 4JI6L 2YV5A 4LWCA 4A3GG 5GADC 4LNQA 2F4VQ 4QQBX 1X6OA 2KBNA 1QVFA 1V9PA 2PNHA 4LF5L 3J81c 4GNXC 1J6QA 3I7FA 2ZM6L 1SR3A 3KFUA 3M4QA 2EIFA 1VS0A 1EQQA 1KD1C 3HOYG 3GTQH 4NB3A 2K50A 4PZ8A 1AE2A 3HOUH 4BXXH 2K14A 2BH8A 3CPFA 1U0LA 4MNOA 5IE8A 1B7YB 1IBMQ 3ULJA 1T9HA 4R4IA 4R4QA 1XMQQ 4P71A 3AEVA 4OWWB 2JJQA 1L2FA 5IP7G 2F4VL 3GTOH 1WFQA 2ID0A 3AYHB 3PUYA 4YCUA 4IPDA 4GN3B 3BJUA 2MO0A 1YEZA 2JA8H 3S1QH 3F1ZA 3T1HL 1PH6A 5IYCG 3CCSA 1OXSC 3JAMc 3HOVH 2NN6G 4A3MH 3FKIH 3S2DH 2RCNA 4LFAQ 1IBML 1P16A 3CCEA 3F2DA 4R4OA 1NJIC 4L5SA 4P72A 2JK8A 1XMQL 2MFIA 1XJVA 3HOWH 2Z0SA 4JCVE 1E7ZA 1BBUA 1EYGA 4BY7G 1HR0W 2B63G 1RIPA 2UUCQ 4LF4Q 4UP8A 1S40A 5JJLA 1Z9FA 4HJ8A 4HJAA 1OXUA 3H3VH 4YWKA 2I5HA 4JC0A 5EAYA 5IP9G 4DAMA 4IFDG 1PV4A 1PVOA 2CKZB 2AKWB 2AHOB 4LFAL 1AH9A 3PIPA 5AJ3Q 1G291 1A62A 3NENA 5M3MG 1CKNA 1BKBA 1VQDA 3I4NG 3CXCA 2HIXA 5C44H 5JJKA 3OTOQ 1VQBA 3CF5A 2UUCL 1OTCA 4LF4L 2R93H 4OXPA 4A3FG 4DKAC 1MJCA 1PH3A 4TQUS 1I3QH 3W1GA 3OW2A 4DPGA 2OQKA 1IBKQ 1NMGA 4TVAB 1PH8A 2KCTA 4BBRG 4B3RQ 4NPSA 2UXCQ 4KLKA 5AJ3L 4OONA 2K5VA 2HHHQ 1YVCA 1E1OA 1X55A 4A3DH 1JT8A 4JBKA 2GN5A 4GLVB 4DNIA 3RLNA 3HOXH 5C4XG 5FJ8H 3OTOL 1UEBA 3K81C 2QEXA 1C9OA 1G6PA 4A3EH 3OYYA 3RZOH 3JAMi 1K0RA 1IBKL 2UXCL 4B3RL 2Z6KC 3MEFA 1IL2A 3U4ZA 4BY1H 4Y52H 1KL9A 4DV7Q 2HHHL 4B3TL 3PO3H 1U5KA 3Q8DA 4OWXB 1Y1VH 3GTJH 1HNZQ 2VUMH 3HOUG 1UE6A 5K36G 1VQ7A 3AQQA 4GN4B 3K0XA 1QUQB 5GAEC 5GAHC 1A63A 1XPUA 1TWCH 3CPWA 1UE7A 1VQOA 2MO1A 2VS1A 1NY4A 2H5XA 2UUBQ 1GVPA 3RR5A 4A3LH 4EX5A 2ZJPA 2D0PA 5IYBG 1CKNB 1JJCB 1HZ9A 3F2CA 5IP9H 3PUZA 4DV7L 4DUYQ 4GNXB 1VQNA 4DR4Q 1Q8KA 5IT9c 3HOVG 4A3MG 1HNZL 3FKIG 4DV4Q 4LUVA 5M5XH 3I4MH 4OO1I 1BVSA 1EIFA 2C35B 4IPGA 2Q2UA 4MTNA 4YY3Q 1Y14B 3G4SA 3HOWG 4GOPA 2D0OA 1JB7A 2Q2IA 1N8RC 2OTJA 2ALYB 1YJNA 1IXRA 2UUBL 1D8LA 1KHIA 2L15A 4C2MH 3ZJYC 2K5NA 4KHPQ 3GDEA 1EFWA 3BZCA 3L7ZC 2JQOA 4DR4L 1B8AA 1CKMA 2I5LX 2WP8J 4DUYL 5HY6A 2IHFA 1VQAA 4PZ6A 4DV4L 1TWFH 4C3IH 1YHBA 1VQ4A 1B70B 2ZTDA 4YY3L 3ICEA 3K7AH 1KRSA 3J81j 3M4OH 3RLFA 5C44G 2LXJA 4IOCA 1G51A 2K75A 2R93G 4KHPL 4LFBQ 5E7NA 2NVXH 2R7DA 1XMOQ 5JEAJ 2UU9Q 2Q2HA 3PF4A 1KIXA 3MXNB 4UP9A 4DR1Q 3CCQA 2ZJRA 1VQ5A 1E24A 4POGA 1LM0A 4PMWA 3GTMH 1PYSB 1WOCA 4AQYQ 4A3DG 3RLOA 1N34Q 4FDBA 4IOAA 2R6GA 3HOXG 1SE8A 5FJ8G 1YHQA 2YTYA 4RG1A 3D31A 3PUXA 4B3MQ 4LW1A 1FL0A 1HZAA 1YIJA 4A3EG 2FXQA 4A3IG 2OCEA 4LFBL 1CSPA 1A8VA 3WWVA 3CAMA 1XMOL 1R9TH 1XNRQ 2UXDQ 2UU9L 1S72A 2ZTCA 5IYBH 4GKKQ 1YHAA 4DK6C 4BY1G 4DR1L 1Y1WH 5C3EG 4GNXA 4GOPB 1X9NA 1XPRA 2IX1A 3GTKH 4JI5Q 4AQYL 3PO3G 1V1QA 1Y1VG 5C0XG 3STBC 1N34L 1I5FA 2VUMG 4ME3A 1UE5A 4JI2Q 4QL5A 2GVBA 1PH9A 1QVCA 4B3ML 1OXVA 1L1OC 2RF4A 1NE3A 4NXNQ 2KCMA 1K3RA 2CFMA 4GLXA 2IX0A 3K7UC 3NBHB 1XNRL 5LMNQ 2UXDL 4A3LG 5M3FH 2PI2E 1E22A 1RL2A 1BBWA 1PFSA 3UE1A 4HJ5A 4HJ7A 4GKKL 1N33Q 1QUQA 3KYHC 2KHIA 3KF6B 4IO9A 4EQ5A 1HZBA 4JI5L 2JA6H 3I4MG 3CD6A 1A0IA 4QJFA 3PCOB 2OWOA 4IJLA 2WAQG 1EIYB 2NN6I 2A19A 3S24A 4JI2L 3HOZH 4BA1I 2JA5H 4XTCS 4JYAQ 3G71A 4NXNL 1VQHA 1CUKA 4IPCA 1OXTA 2MQHA 4DV3Q 1GKHA 4DV0Q 3KF8B 4OWTB 4YWLA 3J81i 3U58A 3JC66 4X64Q 2D62A 1I94Q 1N33L 2IT1A 1S3OA 1VQFA 1QZGA 1GO3E 2E5LQ 3PV0A 3F2BA 1K9MC 4LF6Q 4ALPA 3KJOA 3S1MH 1N9WA 2RHSB 1QVGA 3NELA 3ULPA 1HNXQ 1MKHA 4IPHA 4R4CA 4JYAL 3H0GH 3U50C 3CCRA 1MIUA 1WCMH 3CCVA 2R92H 1GD7A 1VQCA 4HJ9A 4GKJQ 2DUDA 1TWHH 3LGJA 4PG3A 2F52A 4DV0L 1K8AC 3CP0A 4X64L 4A3IH 4DV1Q 1YNXA 2CWPA
chains in the Genus database with same CATH superfamily
3V05A 1PRTB 1SDFA 2MJ8A 5JOBA 4DR2Q 2DNEA 4G57A 4GKJL 2DY8A 4HMJA 4BWGB 3GTGH 1QNKA 3CQZH 2UXBQ 4CKBA 3CQZB 5EKIA 1SN8A 4K5XA 3SE0A 1N32L 2Z6KA 4C1NI 1PTOD 1ENCA 5IGEA 3L3OC 5ELOA 3CCJA 1ICWA 3D4RA 4L5QA 4DR5Q 3ER0A 1W2BA 2N3SA 4HR7B 1M90C 4G7ZC 1PHJA 3BG3A 1RD9D 4DR7Q 2IL8A 1BUVT 2QF7A 4N9TA 1QB5D 2OTLA 5FK9C 4C3JH 2PMZE 4DK3C 1YJWA 1SRUA 4C3JB 4G4KA 3QJYA 3NTIA 4BBSG 1SMXA 4YWMA 3S2HH 4JG2A 2JA5G 3I72A 2K28A 1M1KC 2MUYA 3S2HB 5JVG3 3IFTA 4XQQA 3HZXA 5I2YA 2A6HC 4JI8Q 2KA7A 4CDCC 1FJGQ 2JA7H 3OMCA 4JV5Q 4C1NK 3UE0A 3RMHA 4R4TA 1Y8PB 2JA7B 5IWAL 1YBYA 2TMPA 1BCPD 2PMZB 2Z8LA 5M5YB 3E0JA 1K83H 5IYDG 3UDXA 1K83B 1STEA 1GJXA 1CT1D 1Z47A 3KDFA 3MHBA 4DV2L 4M8AA 1TKWB 3UI2A 3GP7A 3DM1A 1JQYD 4OX9Q 3BZDB 1K8MA 3M3YH 1PH4A 2A73B 3GO5A 3ERQA 3FHWA 3M3YB 1M8AA 4H02A 2K33A 4JBJA 3T1YL 1F9RA 1BXTA 2LSSA 3VYSA 3LNNA 2E2JH 5BR8Q 2EQSA 3B6YA 1B4OA 1XX8A 4JPBW 2E2JB 2PQAA 4A3JG 5CV6A 1CKOA 2K03A 1ZKOA 3PO2G 5FO7B 3RN2A 2CQOA 2DY7A 5C0XI 1PMRA 1A3TA 5IGGA 1SYEA 5LMNL 3D3RA 1JJGA 1LTTD 4OL7A 2IWHA 3O13A 1ZEQX 1VMCA 4LF8L 4C3HH 2NVQH 4UPAA 2A6EC 1E2VA 2CH4W 2D9UA 2VY3A 4KD3A 1ICFB 2NVQB 2HIVA 4DR3L 3CCLA 4A3BG 3EVQA 5A2QE 1E0BA 4J6HA 3OHXC 3PIO3 1NUCA 1YI2A 1K73C 4HAEA 2PZTA 1VF5C 2I0QA 2V1CC 4DV6Q 1NSNS 3PGZA 1VQ8A 4H13C 4RCNA 1D1IA 3KJPA 3TS0A 1IL8A 3SK8A 2WINB 2F0PA 2Y0SG 5H1SE 4NXML 1TWAH 2VQFL 1ILQA 1IYUA 1TWAB 3UDIA 4RGOS 5C4JH 4OO1G 1L1OB 2V4DA 4JI1Q 3A5UA 1NTGA 2NN6H 4JOIA 1PYBA 3SGIA 1EWIA 2EY5A 2KJXA 3SVMA 1KDBA 2VQEL 1EYDA 4K8JA 1Y8OB 1W3SA 2EYPA 3TP5A 3CMEA 1Q1BA 1QZHA 1FD7D 2XGTA 4N8FA 3ZYYX 3TEHB 2O4XA 2ZTEA 1YJ9A 1QCBD 1S5FD 4A76A 1TU2B 4XT1B 4YHHQ 4RMFA 1JMCA 1HNWL 2XTIA 4Q0FA 4A3FH 2RVLA 2WB1G 3C46A 3S17H 4IN3A 1TS4A 4IUPA 3J7ZC 4A3FB 2F0WA 3S17B 4L5RC 1VQKA 4A4IA 4BBRH 1VQMA 1Q3LA 2F0FA 4BBRB 2AQ1B 3MEHA 3GTPH 3QOLA 3AU7A 5C4XH 2CH4A 1SNPA 3VA5A 5C6AA 4LWCA 5GADC 4LNQA 1YNNC 1X6OA 3MZ5A 5IT9L 1QVFA 2JYOA 3TP6A 4GNXC 1J6QA 3I7FA 1VS0A 5COYA 1PRTC 2ENBA 1RJTA 2K14A 5KNBA 1U4LA 4MNOA 1B7YB 5K36H 3ULJA 4R4IA 4ZCKA 4R4QA 4P71A 4OWWB 4OHJA 3GTOH 3K6OA 3BJUA 4N8X1 3GTOB 2JA8H 3FDTA 4L63B 2ZXPA 2SNMA 2RCNA 1DXMA 1F9SA 4LFAQ 3F2DA 2RDFA 4R4OA 3N52A 1NJIC 2QCPX 1XMQL 5ELFA 3GTKB 2MFIA 2J4XA 4JCVE 1BBUA 1AN8A 1RIPA 4FXKC 1Z9FA 4HCSA 1OXUA 1KABA 2H1EA 4YWKA 4ZQ3A 2AHOB 3PIPA 2F1MA 3VA7A 5M3MG 3NWTA 1LT3D 3H91A 3CF5A 1VQBA 2QW7A 1OTCA 1F2LA 1I6VC 1MJCA 4ZYSA 3JAML 1I3QH 1O7YA 5EKKA 3W1GA 2UXCQ 2KCTA 1I3QB 4RAUC 4OONA 2HHHQ 1E1OA 4K6DA 1T5XD 1X55A 1XWEA 4JBKA 1UEBA 4RKBA 2QEXA 3SK6A 3D4DA 1STNA 1G6PA 3RZOH 1GUSA 5IGBA 4RHSA 1IBKL 1CZWA 3RZOB 1IL2A 4DU9A 4DV7Q 3J7AV 2AUKA 4RHRA 2N55A 1IW7C 2EDGA 5C3EB 1VQ7A 3AQQA 4GN4B 3K0XA 1XPUA 5C4HA 1LT4D 2XSCA 1VQOA 1F2MA 1NY4A 1SMYC 4XDXA 4EX5A 2B2TA 3PUZA 5IP9H 4KY6A 4DUYQ 1Q8KA 2X6LA 4IUUA 4DV4Q 4WJWA 3I4MH 1RTOA 5EJWA 1EY5A 4YY3Q 1CA6A 3K0YA 1Y14B 3I4MB 1KLUD 1WD1A 1IW7D 1JB7A 4LAAA 1PFBA 4K6LA 3DHQA 4CDDC 1EYCA 3P75A 3BZCA 2EY6A 1B8AA 2I5LX 1GUNA 3TP7A 1SMYD 1VQAA 4PZ6A 4ULLA 2ICIA 1GXDC 3K7AH 1KRSA 2AQ2B 3K7AB 1BBXC 5C44G 4RA8A 1HCZA 1G51A 1JB3A 3X3MA 4KHPL 1WTHA 1CM9A 4ZUJA 3GV3A 1PYWD 4K14A 3PF4A 1JWSD 2ZJRA 1VQ5A 3RLOA 1N34Q 2L9HA 5FJ8G 4IUQA 4RG1A 2X6GA 3D31A 4EVOA 3OSOA 4B3MQ 1FL0A 1YIJA 2L5TA 2OCEA 3BDCA 1CSPA 3CAMA 4GKKQ 5IYBH 4DR1L 4L6TB 4KTAA 4JI5Q 4R9WA 3STBC 1UE5A 3T16A 4KV6A 1WTOA 4JI2Q 2GVBA 1L1OC 2RF4A 2RDHA 2AQ3B 2KQ3A 4HSVA 1X3PA 4GLXA 3K7UC 2UXDL 1RL2A 2K5DA 2D5DA 2HD3A 2KHIA 4IO9A 4EQ5A 4F88A 3CD6A 2QILA 2F0UA 2NN6I 2IPKD 3S24A 4KD4A 4BA1I 4DFAA 2JA5H 4JYAQ 4BBSB 4IPCA 2MQHA 2B2VC 4DXFA 2JA5B 3KBGA 2E76C 3KF8B 3J81i 4X64Q 2D62A 2HDLA 1EZ6A 2K7VA 2XIWA 2F3VA 1GUGA 1N9WA 1QVGA 4C3IG 4DA2A 2NBFA 2JXMB 1JOQA 1MKHA 4IPHA 4C56C 1HTLD 5F2DA 4GKJQ 1VQCA 5IYDH 1TWHH 5EGTA 3CP0A 1EYAA 3I90A 1NNXA 1TWHB 4APVA 3E6ZX 5M9OA 3RZDH 4LF6L 3T4AC 2E2DC 4OIKA 1LTRD 3RZDB 3KLSX 1N32Q 1I4GA 3MFYA 3I4LA 1HNXL 2ZJQA 2NUCA 3FEWX 5G3LF 3EN2A 1LT5D 2E75C 4UP7A 3PIOA 3A74A 3HP3A 2ES2A 3AFQA 1Y69U 2KHSA 3E9IA 3K5MA 1M4VA 3M85A 1V43A 2RDGA 2E2IB 1VQ6A 1Y1WG 5KEEA 1LLRD 3C2PA 4KN7C 2RQXA 1HHVA 3PO2H 4A3JB 1BF4A 5DNFA 3PO2B 3NK9A 1WTXA 1O78A 5C5LA 4X66Q 5EPKA 3KLSA 1XTDA 5JJZA 1Q86C 4P74A 2JA6G 5ISRA 1ENFA 4UDUC 2WKDA 3QG1A 5I9PA 5IWAQ 5EBCA 3RNUA 1ZYRC 4RWSC 1B3QA 2E2HH 4OELB 2F3IA 4A3BH 1UAPA 2F0DA 1WTPA 2E2HB 2Y0SE 2JEBI 3NBIA 4A3BB 5CV7A 3FPPA 4LUOA 4DV2Q 2YU9H 2K32A 1S5ED 5ELBA 3KF8A 2YU9B 1IYVA 3WOFA 4OEMB 1WJJA 3Q6SA 4IZ8A 2PW7A 1EY9A 2NWGA 5CGKA 1WCMG 1OO9B 2R92G 1JE5A 3PUVA 4JVZA 2C9OA 1ZYRD 2B2YA 5LMUL 3E3XA 4X65L 4RFBA 1XNQL 3T1YQ 3E9HA 3IL8A 2Y0SB 3NXWA 4FNFA 5DLQE 1TWGH 1HFNA 3T1HQ 2C5CA 3J7AF 4OO1H 1DOLA 4HIKA 3A0JA 4CJ1B 2KHJA 4IFDJ 4NKLA 2Q2TA 1EWHA 1LTAD 4JI0L 4A3CG 4L8JA 5CV8A 3TMEA 1TXYA 5CMDA 2F0EA 2ZT9C 1P8LA 2WB1E 3S16H 4NW2A 4GLAC 2G5DA 4X3SA 2VZAA 3S16B 1TY2A 1X3GA 4LF8Q 3LWEA 4FP5D 1EY0A 3VYTA 2FMCA 1VQ9A 1IKLA 4DNTB 1SE3A 4DR3Q 3EIVA 3L0OA 1U9RA 4HIOA 1LTBD 1V8QA 1UWVA 3HKSA 1TVXA 4PMBA 1TR5A 3IKJA 4DNRB 3DXJC 1WTRA 4WRDA 1TY0A 3HFZB 2MNAA 2WB1B 3ULLA 1BR9A 3A7AB 4IFDI 3ND9A 4KJOA 4X62L 2HDMA 2Z4IA 2LMCB 3KDFB 4KHZA 1SJED 2K5HA 4GN5A 3I56A 3RN5A 1ASZA 2CHBD 1ESFA 4KMUC 2IY5B 2OF1A 2N49A 4QCLA 1SEBD 2CVRA 3S15H 4R1JA 1I6HH 4P2CB 3W5OA 3U9SA 1OXXK 3TQYA 4NXMQ 3HKZG 3S15B 1I6HB 2VQFQ 2B8FA 3L9AX 2BOSA 2XNAC 3BDLA 3D6WA 4B9WA 4JI3L 4B3TQ 3DM3A 5EPLA 5JEAH 3CW2C 1KNAA 1PZJD 2PPBC 1STBA 4H44C 2NVYH 2PQAB 3NTKA 1SNCA 4EGVA 2VQEQ 4A3KG 2QGQA 5DM73 4DR6L 2NVYB 1MD2D 4FO2A 4RCOA 2EYFA 5LMNW 4AIMA 4WJ3M 3TP8A 3D4WA 1N36L 4K0KL 1KXLA 2N8NA 4J1MA 3ERSX 2HT1A 1B1ZA 2B3GA 2E8GA 4DAVA 3K8AA 2A68C 1HNWQ 1EL0A 2O5IC 1VCIA 2WACA 1VQEA 1KAAA 5HGQA 1SE2A 4JI7L 1G8ZD 4IUTA 1PH5A 1RKNA 4KI0A 2DGYA 1STYA 1PFNA 2GVAA 4HIMA 1GM5A 2L4NA 1IZ6A 5M3MH 1SNMA 1FGUA 4X66L 1LV9A 4POFA 5M3MB 1O80A 1VQLA 3P20A 5AFWA 3NSWA 3K5OA 2QEJC 5E4WC 5M5YH 4U673 2EYOA 4JI4L 2F0TA 1HR0L 3A8JE 1ENAA 1IYJB 4KJNA 4O0AA 3J7A5 1SAPA 2EJFC 5CV4A 2HUGA 5ELCA 2L12A 5C0XJ 1QJOA 2YV5A 4A3GG 2F0QA 1CK1A 2KBNA 2A6HD 4LF5L 3VR5A 5CBEE 3KFUA 2BDNA 1EQQA 1ESRA 3GTQH 4XQNA 4BXXH 1F2ZA 4MN3A 2BH8A 3CPFA 3GTQB 1XMQQ 3EA6A 2NTSA 1L2FA 2F4VL 2ID0A 3PUYA 4IPDA 3TSSA 1YEZA 2A74C 3T1HL 1PH6A 3TBIB 5IYCG 3JAMc 2EYJA 3CCEA 2WKCA 3OOCA 4L5SA 4EQOA 1IKMA 2JK8A 1I4QA 2EYMA 5KYIA 2Z0SA 4HN7A 1FR3A 1JWMD 4UP8A 1S40A 4ODGA 5JJLA 3H3VH 4HJAA 2CW0C 2XRSD 4KK7A 4IURA 4I7ZC 2CKZB 4RGMA 1FNVA 1G291 1CKNA 3CXCA 2HIXA 5C44H 3VYRA 3LWUA 3TDQA 2F0IA 2FJ2A 5C44B 2F0HA 1CZGA 4KKSA 2HCIA 4DPGA 3OW2A 1IBKQ 1HA5A 4IUNA 1WD0A 4TVAB 1JORA 4NPSA 3WDNA 5AJ3L 3W3AA 1WTVA 4KY5A 1JT8A 3RD4A 4LJZC 4GLVB 1MI2A 3M7GA 2A6ED 4UHVA 3RLNA 5FJ8H 5KNCA 3OTOL 1G2TA 3K81C 4F8MA 2I46A 5KNDA 3OYYA 3JAMi 1K0RA 2SEBD 3JAME 1EQTA 2Z6KC 5IIFA 1SNOA 1KL9A 1B44D 4DK1A 4HSPA 4B3TL 3R3OA 1U5KA 3Q8DA 4OWXB 3HOUG 2RCFA 3SR1A 1UE6A 2K1BA 2L11A 3BDOA 3MXNA 5GAHC 3CPWA 1UE7A 4FF1A 2MO1A 3R8BA 2H5XA 1O7ZA 3V2TA 2NZ1D 2ZJPA 1I4PA 3F2CA 4HCEA 3MAQA 4A3MG 1HNZL 4LUVA 4HMIA 1R4PB 4OO1I 3S1NB 2C35B 4IPGA 3MXPA 3C1EA 4X3UA 3HOWG 4GOPA 3VR4A 1B53A 3X3NA 1BNZA 1IXRA 4LMQD 1D8LA 2L15A 4C2MH 3ZJYC 2F0OA 4KHPQ 3L7ZC 4DR4L 4C2MB 1E2ZA 1V1OA 3BYYB 4C3IH 4B08A 5DEHA 1VQ4A 3A8IE 1B70B 3NTHA 5E1FA 1EEFD 4C3IB 4ZUIA 3J81j 4K5WA 4RGTA 2R3ZA 2K75A 2R93G 2GA4B 4QF4A 5IOCA 5E7NA 2DJFC 5JEAJ 1G91A 5LL6X 4DR1Q 5KYLA 5FO9B 3GTMH 4F87A 1PYSB 4A3DG 4IOAA 3GTMB 2YTYA 4A3EG 4A3IG 1XMOL 1R9TH 2UXDQ 2UU9L 4CKEA 4ID6A 2ZTCA 4DK6C 1R9TB 1TQOA 1YNND 1Y1WH 1I4RA 1Z7TA 1X9NA 2VXWA 2IX1A 3IFDA 3GTKH 4AQYL 3PO3G 1Y1WB 2VUMG 3ONAB 1BQQT 5EKLA 1PRTD 1QVCA 2RSOA 2SNSA 1K3RA 2CFMA 5FOBB 2IX0A 3NBHB 3FMCA 3CRLC 5E4XA 1XNRL 3HEJA 2BCOA 2PI2E 1BBWA 3UE1A 4HJ7A 3EJIA 4U68A 3NP8A 2JA6H 1A0IA 2JA6B 5EPJA 1MSGA 2EOTA 4XTCS 1I4XA 3G71A 4NXNL 1OXTA 5A2QL 3MVVA 4DV3Q 2OWOA 3JC66 3NQIA 1N33L 1S3OA 4CKCA 5JVH3 3I8ZA 4LF6Q 1X3QA 1K9MC 1HPCA 4ALPA 3URYA 1EY4A 2BE5C 2Z9HA 3ULPA 1HNXQ 4R4CA 2ZXRA 1HQRD 3CCRA 1MIUA 1WCMH 2R92H 1GD7A 4QQBX 4HJ9A 4DV0L 2VB3X 2R92B 1WCMB 4A3IH 1GHJA 1BOSA 1AZPA 2WV6D 4WFN3 1A3VA 2ASBA 3FVQA 3H15A 2Z6BA 5C3EH 5ELNA 3QO2A 5T1IA 4JOIC 1S5DD 3K59A 3BU2A 1SJHD 3TN2A 4DV1L 1UE1A 4IJHA 4A3CH 2N78A 1EQRA 1JICA 2QDBA 2O2LD 1HH2P 2K4KA 1PH2A 2EYLA 1E2WA 2QKIC 2I5MX 3F2UA 2KOLA 5JJIA 1CQVA 1DOMA 1EOVA 2NVTH 3UDFA 1Q1EA 2NVTB 2NZHA 5J1ZA 3HKZE 1F9QA 2JE6I 2XWBB 3NBHA 5L37A 5BN5A 2WFWA 1Q12A 3I91A 3HOZG 2B8GA 1L0YB 5EBDA 2F0LA 3H3VC 2HQLA 3NE5B 2DNCA 1G6ZA 4UAIA 1PTOF 5LMUQ 4X65Q 1XNQQ 3MXGA 3H3VI 3S14H 2B2WA 3HS0C 3HKZB 4C3HG 4DV5L 3DWPA 3LX0A 3NQTA 2BH2A 1DYQA 5DAUA 3S14B 4OGQC 4LF7L 1PTOH 2LY7A 2PI2A 1KRTA 3TREA 1PTOB 2AMCB 4KKTA 4JI0Q 2CQAA 2LXKA 2RA4A 4CDEC 4A3KH 3IAYA 3Q0AA 4A3KB 4EQNA 1EU3A 3OMGA 1J5EL 2VL6A 4DGZA 1D5ZC 1HFGA 4JBWA 5IY0A 2EY2A 1RDPD 4ILWA 2K6AA 3H09A 3K80C 4X6AH 3PUWA 1E1TA 5NUCA 3G6EA 4PMCA 1BCPF 2R7ZG 5E3FA 4BBSH 1D7QA 4X62Q 2PW5A 2CCZA 1PFMA 3STBD 2SDFA 1BCPB 3T51B 3EQLC 1SNQA 1U4PA 1HXYD 4XT3B 3T13A 3D8GA 1CSQA 2L55A 4AYBG 2OEOA 5CR3A 3F8TA 5D14A 2ATWA 5FLXL 4JI3Q 2XN9C 5GROA 1NBWA 4DV3L 1LABA 2BA0A 5FLMG 4P73A 4BA2I 4LF9L 4A3GH 4ZKBB 4DR6Q 5KGUA 1IBLL 4FXGC 4PNYA 4XXEA 4A3GB 1E3PA 1DONA 4KHVA 4QY7A 4AH6A 1N36Q 4K0KQ 4DUZL 1FNUA 4IQZA 3BYTB 1K28A 3J80L 3G48A 1TT2A 4ME5A 1EUJA 1STGA 3VDYA 1WTWA 1VF7A 4A93G 1UNSA 3TRZA 3OIQA 4IALA 2E2IH 5HURA 3DLLA 2EY1A 3PSIA 5BN4A 5IGDA 2B2TC 4JI7Q 4A3JH 5IYCH 1Q46A 1DJRD 3I4OA 1STAA 1DOKA 5IGFA 2UUAL 4XQJA 3AFPA 2PZWA 5BN3A 3QR8A 2NB0A 2HCCA 4FXDA 2FHTA 4ZAIA 5GQOA 1LTLA 4EQPA 1SFOH 1WTQA 2KCNA 1MGSA 4MZ9A 2VNUD 1LTGD 2JA8G 3E0EA 3BVZA 1SFOB 1F77A 1EY6A 1KC8C 5FKAC 4O2DA 2JA9A 2EVBA 4JI4Q 1AFPA 4PZ7A 1Q90A 1HR0Q 3TS2A 3G6JB 2OQ0A 4Y7NH 1FGBD 4Y7NB 3VR6A 2IW3A 4UY8C 2F0GA 3AB9A 1SNDA 1PDQA 4B3SL 4LF5Q 1XXGA 2B2WC 2L0CA 4TRDA 2Q8RE 1VQJA 3U4VA 4NP5A 4XIGS 1J9OA 4JI6L 2F4VQ 1EIGA 4Z9CB 2PNHA 2ZM6L 1LO5D 1SR3A 3PQIA 3HOYG 2K50A 1AE2A 3HOUH 5IE8A 3CRKC 3HOUB 2JJQA 5IP7G 1WFQA 4GN3B 1ML0D 1EFID 1C48A 3FRPB 2E74C 3F1ZA 1AW7A 3CCSA 3NWSA 1OXSC 4A3MH 4KY7A 1IBML 5CYUA 1D5MC 4A3MB 4QUCA 1MSHA 4H0LC 1EEID 4P72A 3HOWH 4BY7G 1HR0W 1QILA 2OXPA 2B63G 3HOWB 3J81L 2F4IA 1FYCA 2F0NA 2I5HA 4JC0A 1G2SA 5IP9G 1GUOA 2JP1A 4K8IA 3Q22A 4IFDG 1EY8A 1PV4A 1PVOA 5EQ0A 5AJ3Q 5I6YA 1VQDA 3I4NG 2N88A 5C5MA 3OTOQ 3OPOA 1SXTA 1TIID 1X32A 2UUCL 4LF4L 2R93H 1LTID 4OXPA 4DKAC 5T1GA 1PH3A 1STHA 4TQUS 2R93B 1SYFA 2OQKA 1HA6A 1NMGA 1PH8A 3RUZA 3GQBA 1JOOA 2K5VA 4JW0A 1H9KA 4A3DH 1VDZA 2A69C 1DD2A 4A3DB 3DMUA 5ELDA 4A3EH 4ABNA 1D6EC 1JE4A 5CBAE 1PTOC 4A3EB 5I6WA 4A3IB 4B3RL 1KNEA 3MEFA 1CHQD 1QG7A 3PO3H 1HNZQ 3T53B 1ZXTA 3GTJH 2VUMH 1EQVA 5CV5A 3PO3B 2F0VA 2LKVA 3GTJB 2VUMB 5GAEC 3R2IA 1TWCH 5JAVA 3GTGB 2A69D 2ICEC 5I2XA 2VS1A 2JSOA 1TWCB 1GVPA 5IYBG 3BS1A 4MHEA 1CKNB 1HZ9A 1VQNA 4DR4Q 2DJGC 5IT9c 3HOVG 2IJ0A 3FKIG 5M5XH 3Q23A 1BVSA 2G9DA 5D3IB 3TZDA 1RCVD 4MTNA 5M5XB 1H9SB 2F3WA 3I73A 2R61A 1S5BD 2EZVA 2Q2IA 1N8RC 1YJNA 2UUBL 1RODA 1KHIA 4CJ2C 4MIUA 2ZXOA 2K5NA 1T5EA 2RSNA 1EFWA 1KLGD 2A68D 2JQOA 1CKMA 1BCPC 4JK1C 5HY6A 2EE1A 2IHFA 3SK4A 5KIXA 1ET6A 3ICEA 2F0MA 3M4YA 3I70A 4DK0A 3DWAA 3RLFA 2LXJA 2B2YC 4I7AA 1UEAB 4IOCA 4ZLTF 2TSSA 1RHPA 1CHPD 2R7DA 4ZKCB 1XMOQ 2UU9Q 3MXNB 1U4RA 4FYDA 4UP9A 2PCFB 1BDOA 3CHBD 3CCQA 1IHZA 1J8IA 1QE6A 4POGA 4PMWA 4AQYQ 4DAPA 4FDBA 4CJ0B 5ELEA 3HOXG 1YHQA 3PUXA 5A35A 4LW1A 5D65A 4LFBL 4DF7A 3WWVA 4H7BA 1XNRQ 1GUWA 5IT9E 4XYOA 4BY1G 4GNXA 4GOPB 1Y8NB 1V1QA 1Y1VG 5C0XG 1I5FA 4ME3A 1PH9A 2KECA 2XVSA 3BVGA 4DN4M 3SDZA 1NE3A 4NXNQ 3E5SA 4CHTB 2EJGC 4A3LG 1E22A 1PFSA 1N33Q 3KYHC 3C1FA 4PQXA 3A56A 3OWFA 3KF6B 3A8KE 1BO0A 4QJFA 5LHY1 2A19A 3HOZH 1B9NA 1NR4A 1VQHA 4F7XA 3HOZB 4DV0Q 4OWTB 5G3LD 5IODA 2K04A 3SEBA 3K57A 1H9SA 1CFMA 3NPPA 2KEEA 4DXGA 1QZGA 2E5LQ 3F2BA 1WVLA 3S1MH 2RHSB 2CW0D 3S1MB 2PYKA 3G7LA 3N6RA 4C3HB 3LGJA 3NHHA 2SOBA 1YNXA 4RKLA 1JR0D 4DV1Q 2RHQB 1I94L 3D6CA 4J15A 1X3FA 1C7YA 1W6JA 1DZ1A 1RTNA 1L0WA 3SXHA 5J39A 1NR2A 1SYCA 3S1RH 2Z1CA 4L5TA 3GD7A 4ZK9B 4S3SA 3S1RB 1H95A 3L2PA 4G7OC 4YIJA 3EBEA 4YCWA 3OW7A 5HGTA 4FF3A 2EPBA 1B2TA 3QOJA 3I2ZA 2H4OA 1NMFA 2NYZD 3S1NH 3M4PA 4DR2L 3QB3A 4AYBE 2R7ZH 1K3BC 4TKOB 4QGUA 2A8VA 2R7ZB 1K8GA 1SSOA 2JN4A 5C4JB 3KOJA 1KQSA 3MC0B 2UXBL 2R7FA 4CGYB 3Q24A 5JPMC 4LFCQ 5M3FG 1S4ZA 1R4QB 2G9HD 4RGNA 1YITA 3PF5A 1CQFA 3GTLH 1PZID 3KLWA 2VB2X 2M00A 4DR5L 4DV5Q 4YCVA 2PO4A 4AYBB 3GTLB 4LF7Q 2AWNA 3KF6A 2MHVA 5FLMH 4DR7L 4FF4A 2EYHA 3CKIB 1W6KA 1PH1A 5M5WH 1J5EQ 1Q82C 3H0GG 2KUMA 3CCUA 5J3BA 5M5WB 2AWOA 2MPMA 3OWEB 4B9XA 4HIDA 2NTTA 3J7YW 5C4ZA 1JOKA 2B29A 1Q81C 4A93H 5K5PA 4JI8L 1HTPA 3GTPB 1RF2D 1FJGL 2F03A 5C4XB 4A93B 2YYZA 4JV5L 2XWJB 3DUZA 4K2LA 1LACA 5TSSA 1Q8IA 3V96A 4X3TA 1ONLA 1AE3A 1LT6D 1ASYA 1CTMA 1C8CA 3I3CA 5JEAG 2F0SA 1WYDA 1KAWA 3D0FA 3QIAA 1XPOA 5FLXc 1CA5A 5C3WA 5FO8B 1YZ6A 4A75A 2YTXA 1I50H 3I55A 1HUNA 2BA1A 4OX9L 1FVIA 1I50B 1KDCA 4KKUA 1D2BA 2JA8B 5I9OA 2B39A 3KLRA 1XYIA 2B2UA 2KENA 2M9VA 3IRBA 2KCCA 1HRJA 1L1OA 3A55A 1X54A 2CWAA 3U9OA 2QA4A 1II3A 2NZOA 3J80c 5BR8L 1A3UA 4BS9A 4C3JG 4LF9Q 4WJ4A 4GZYC 2MP1A 3M9BA 1IBLQ 2P5ZX 3A54A 2Z4HA 1H9RA 1X3EA 2PNRC 2HQEA 4DUZQ 3CC7A 3SHLA 3HG9A 1WI5A 4M1UB 3CCMA 4V190 1SYDA 1JJ2A 2B2VA 1F2YA 1JWUD 1X65A 3W1BA 1MJEA 2E5LL 1QNUA 4OIJA 2JA7G 1VQIA 2FINB 1VQGA 1B50A 3WOEA 5CC4A 3VR3A 3DEOA 1EU4A 3HOYH 1PXUA 2UUAQ 5FLXE 2RKSA 1D5XC 2BE5D 3HOYB 1DGSA 1FNWA 5C3XA 1PA6A 1SYBA 3UDGA 5IP7H 1HZCA 4DV6L 3FP9A 1TS5A 1I4HA 1NAPA 2IHEA 4ZRZA 1Q7YC 3KK7A 2XRQD 1QOHA 4FF2A 5J22A 1Z6HA 4BXXG 3J80i 2OT2A 2WAQE 3MXUA 2PQEA 1O7IA 3NUCA 3J80E 4GOPC 1VQPA 1D1KA 1JC7A 4GS3A 4NDXA 4BY7H 2B63H 2VW9A 4JBMA 3H6MA 1C0AA 1SLJA 3M7NA 4BY7B 2B63B 1GHKA 2K05A 4LUZA 4JI1L 4IFDH 4B3SQ 2JEAI 1DCZA 4WORA 1SBBB 3R2TA 1B3AA 3HRZC 1SROA 1PH7A 3A5ZB 1X56A 1VMPA 3I4NH 4LFCL 2WAQB 1LYLA 3CC4A 3ITPA 1C4QA 2A5HA 3I4NB 2EXDA 4JI6Q 1PZKD 5GAGC 3VR2A 4QIWE 4P75A 2FMMA 1LUZA 2ZM6Q 3BZKA 4HTHA 3H94A 4DAYB 1HJPA 4YHHL 3CC2A 3KBXA 3EFXD 3NEMA 5CORA 1TS2A 1A6XA 2J7ZA 1HQMC 4V0BA 2K52A 2YTVA 1SYGA 1SE4A 2A1AA 3CMAA 5DM63 1NCVA 1S5CD 1V9PA 4HEDA 3J81c 3M4QA 2EIFA 2Q8IB 1KD1C 4QIWB 4NB3A 4PZ8A 1IBMQ 1U0LA 1UUPA 2EJMA 1L0XB 1T9HA 4NMZA 3AEVA 2K01A 2LFNA 2X69A 4XYQA 3MWYW 2RBMA 1O7LA 1YNJC 3AYHB 4YCUA 5LL6S 2MO0A 4KN4C 3S1QH 4O42A 1QWYA 1CI3M 3HOVH 2NN6G 3S1QB 3FKIH 4QUFA 3S2DH 1A2UA 2K5WA 1P16A 3HOVB 2B2UC 3FKIB 3S2DB 3DEPA 1TS3A 1XJVA 3QWNA 2F0JA 3MTSA 3DWQA 1E7ZA 1EYGA 2UUCQ 4LF4Q 2WIIB 3C3LA 4HJ8A 5D3DA 3ND8A 5EAYA 1YNJD 4DAMA 4K5VA 1LTSD 5I4DA 2AKWB 4LFAL 1AH9A 2MGSA 2KVMA 1A62A 3NENA 4Q5VA 1BKBA 5JPNC 1JCKB 5JJKA 4A3FG 3MA2B 1GOZA 3VYUA 4K2KA 3J81E 3GV6A 4PV1C 2KEDA 2DN8A 1AEXA 4BBRG 4B3RQ 3A7LA 4KLKA 3S9WA 4N9PA 4CBVA 1YVCA 4IUVA 2GN5A 4DNIA 5C4XG 3HOXH 3KUPA 1C9OA 3HOXB 4DAYA 4TSSA 3W2DA 1HUMA 2UXCL 3U4ZA 4BY1H 4Y52H 2HHHL 4FVMA 1Y1VH 5C0XH 4BY1B 2QDLA 3P7JA 5K36G 4R8NA 1H9JA 1Y1VB 5KRUA 1QUQB 1A63A 1MBYA 3AMUA 1U4MA 3SK5A 1MHWC 2UUBQ 4A3LH 3RR5A 3CU7A 1K8OA 1EY7A 2D0PA 1JJCB 3BVMA 4QB4A 4DV7L 1KTKA 5CV9A 1V1PB 1EIFA 4QMGA 1ET9A 2Q2UA 3T56B 3G4SA 2D0OA 2OTJA 2D2CC 2ALYB 4X3KA 3GDEA 4LK1C 2WP8J 5IGCA 4DUYL 3K5LA 2K5QA 3FPUB 3P1HA 4DV4L 1TWFH 1YHBA 2AUJD 2ZTDA 4YY3L 3PMFA 1TWFB 1B9MA 1PLFA 3MFGA 4LFBQ 2PZUA 1A2TA 2NVXH 2M2LA 1KDAA 2Q2HA 2NVXB 1KIXA 1A15A 3TZUA 1H9MA 1DM0B 1E24A 1LM0A 3EROA 1WOCA 4R8IA 1GUTA 2R6GA 4O1NA 1SE8A 1HZAA 1XTCD 2FXQA 1A8VA 1S72A 1AZQA 2FFKB 1YHAA 2EXZA 5C3EG 3K5NA 1XPRA 1K0SA 3M4OH 2Q8TA 1ILPA 1TWGB 1N34L 1EWCA 2J0TD 3M4OB 4QL5A 4B3ML 1OXVA 4J8QA 2IX3A 2O5JC 2KCMA 3PIP3 5LMNQ 5M3FH 4HJ5A 4GKKL 2F0KA 2I07B 1QUQA 3K58A 5M3FB 1HZBA 4JI5L 2L1BA 4CDFC 3I4MG 4E6IA 3PCOB 4IJLA 2WAQG 1EIYB 4JI2L 2LS01 1CUKA 1EIHA 1GKHA 4MTKA 3HGBA 4YWLA 3U58A 1V1PA 1I94Q 2IT1A 1AP0A 3OIPA 1VQFA 1GO3E 1EZ8A 3PV0A 4G7HC 4RH6A 3KJOA 1EOTA 4I65A 1PRTF 3NELA 2BDOA 4JYAL 3H0GH 3U50C 3CCVA 2DUDA 4PG3A 3R93A 1K8AC 2F52A 3H0GB 4X64L 4GNXB 2CWPA 1F9PA
chains in the Genus database with same CATH topology
4APVA 2RHQB 3RZDH 4J15A 2ASBA 4LF6L 1X3FA 1C7YA 3H15A 1L0WA 3S1RH 5C3EH 5ELNA 1N32Q 4L5TA 3GD7A 4DR2Q 1HNXL 2ZJQA 4JOIC 4GKJL 3EN2A 3BU2A 1H95A 3PIOA 3L2PA 4UP7A 3GTGH 3A74A 2ES2A 3AFQA 3CQZH 3EBEA 4YCWA 3E9IA 4DV1L 2UXBQ 1UE1A 4IJHA 3M85A 4A3CH 2N78A 3I2ZA 1EQRA 1V43A 1NMFA 1SN8A 1VQ6A 1HH2P 1Y1WG 1N32L 2K4KA 1PH2A 3M4PA 2Z6KA 4DR2L 4AYBE 2R7ZH 3S1NH 4QGUA 2I5MX 5ELOA 2A8VA 3CCJA 1K8GA 3PO2H 5JJIA 4L5QA 3KOJA 4DR5Q 3ER0A 1W2BA 1KQSA 2N3SA 2UXBL 1EOVA 2R7FA 1M90C 1PHJA 2NVTH 4X66Q 4DR7Q 4LFCQ 5M3FG 3UDFA 1Q1EA 2NZHA 5IYDH 2OTLA 3HKZE 4C3JH 1XTDA 3PF5A 1YITA 2PMZE 4P74A 1Q86C 4DK3C 1YJWA 2JE6I 1SRUA 2JA6G 3GTLH 2WFWA 3KLWA 5IWAQ 4BBSG 1SMXA 4DR5L 4YWMA 4YCVA 4DV5Q 1Q12A 3RNUA 4JG2A 3HOZG 3S2HH 2JA5G 4LF7Q 2AWNA 3KF6A 2E2HH 1M1KC 2F3IA 4A3BH 2HQLA 5FLMH 2Y0SE 4DR7L 2JEBI 5LMUQ 4JI8Q 4X65Q 4LUOA 4DV2Q 1XNQQ 2YU9H 1FJGQ 2JA7H 3H3VI 4JV5Q 3S14H 1PH1A 3UE0A 4R4TA 5M5WH 5IWAL 1YBYA 4DV5L 2BH2A 1WJJA 1J5EQ 1Q82C 4LF7L 1K83H 3H0GG 3CCUA 1WCMG 5J3BA 2R92G 1JE5A 2PI2A 5IYDG 2AWOA 4HIDA 1KRTA 3TREA 3UDXA 2B29A 3PUVA 1Q81C 4A93H 5LMUL 4JI8L 2AMCB 1Z47A 4X65L 3KDFA 4DV2L 1XNQL 4JI0Q 2LXKA 1FJGL 3T1YQ 3E9HA 4A3KH 2YYZA 4JV5L 5DLQE 1TWGH 3T1HQ 1J5EL 2VL6A 4JBWA 4OX9Q 5IY0A 1AE3A 4HIKA 1ASYA 3A0JA 3M3YH 1PH4A 3GO5A 4JI3Q 1I94L 2KHJA 5JEAG 4IFDJ 3FHWA 3K80C 2Q2TA 1WYDA 1KAWA 3D0FA 4X6AH 3PUWA 4H02A 1E1TA 5FLXc 1XPOA 4JI0L 4A3CG 4JBJA 3T1YL 1TXYA 3G6EA 2LSSA 1YZ6A 2E2JH 5BR8Q 1P8LA 2WB1E 3B6YA 2EQSA 4A75A 3S16H 2YTXA 1I50H 4GLAC 3I55A 2R7ZG 2VZAA 2BA1A 2PQAA 4A3JG 4OX9L 1FVIA 1CKOA 1X3GA 4LF8Q 4BBSH 3PO2G 1D7QA 3RN2A 2CQOA 4X62Q 5C0XI 2CCZA 2KENA 3IRBA 1VQ9A 3STBD 4DR3Q 1L1OA 3EIVA 3L0OA 5LMNL 4HIOA 1X54A 2CWAA 2QA4A 1UWVA 2NZOA 3HKSA 5BR8L 3J80c 1JJGA 4LF9Q 1CSQA 4WJ4A 3M9BA 1IBLQ 3HFZB 2MNAA 4AYBG 3ULLA 4IFDI 4LF8L 4C3HH 2NVQH 1X3EA 3F8TA 4UPAA 4X62L 2ATWA 3KDFB 4KHZA 3I56A 2K5HA 2VY3A 4GN5A 3RN5A 1ASZA 5GROA 4DUZQ 1NBWA 2HIVA 3CC7A 4DV3L 4DR3L 3CCLA 4A3BG 1WI5A 2IY5B 3CCMA 2BA0A 2N49A 5FLMG 1JJ2A 4A3GH 4P73A 3S15H 4R1JA 4BA2I 3W5OA 1I6HH 1YI2A 1OXXK 1X65A 3TQYA 3W1BA 1MJEA 2E5LL 4LF9L 1K73C 3HKZG 1VQIA 2I0QA 4NXMQ 2VQFQ 2JA7G 1IBLL 4DR6Q 2V1CC 4DV6Q 3PGZA 1VQGA 1VQ8A 1E3PA 3KJPA 3TS0A 4QY7A 4AH6A 4JI3L 1N36Q 3HOYH 4DUZL 4K0KQ 2UUAQ 4B3TQ 3DM3A 3G48A 3VDYA 1EUJA 3CW2C 1DGSA 4A93G 2Y0SG 1PA6A 3TRZA 2E2IH 2NVYH 2PQAB 5H1SE 3DLLA 3UDGA 1TWAH 5IP7H 2VQEQ 4A3KG 1HZCA 4NXML 2QGQA 2VQFL 4DR6L 3PSIA 4DV6L 3FP9A 3UDIA 5LMNW 4AIMA 2IHEA 4JI7Q 4WJ3M 4A3JH 5IYCH 5C4JH 1Q7YC 1Q46A 1L1OB 3I4OA 4JI1Q 1N36L 4OO1G 4K0KL 3A5UA 1KXLA 1NTGA 2UUAL 4JOIA 3AFPA 1PYBA 3SGIA 3J80i 4BXXG 1EWIA 2N8NA 2WAQE 1O7IA 4GOPC 3ERSX 2HT1A 2B3GA 1VQPA 2VQEL 2E8GA 3K8AA 1HNWQ 4GS3A 5GQOA 4BY7H 2B63H 1LTLA 1W3SA 2VW9A 1SFOH 4JBMA 1C0AA 1VCIA 1SLJA 4MZ9A 1VQEA 3CMEA 1Q1BA 1QZHA 3M7NA 5HGQA 2JA8G 4JI7L 2VNUD 4LUZA 3E0EA 4JI1L 1PH5A 1KC8C 2XGTA 4KI0A 4O2DA 4B3SQ 2DGYA 2JA9A 2JEAI 4JI4Q 3TEHB 2GVAA 4HIMA 4PZ7A 1GM5A 1SROA 2ZTEA 1YJ9A 4A76A 1IZ6A 5M3MH 1HR0Q 1PH7A 3A5ZB 1X56A 4YHHQ 3I4NH 3TS2A 4RMFA 1FGUA 2OQ0A 4X66L 4LFCL 4Y7NH 1JMCA 4POFA 1HNWL 1LYLA 3CC4A 2XTIA 1VQLA 2EXDA 4A3FH 2WB1G 4JI6Q 3S17H 5GAGC 4UY8C 5M5YH 3J7ZC 4QIWE 4B3SL 4L5RC 4LF5Q 4P75A 1VQKA 4JI4L 4A4IA 4BBRH 1LUZA 1VQMA 2ZM6Q 3BZKA 1HR0L 4DAYB 1HJPA 4YHHL 1IYJB 4O0AA 3CC2A 1VQJA 3NEMA 3GTPH 3J7A5 3U4VA 4XIGS 5C4XH 2K52A 2YTVA 5C0XJ 2A1AA 3CMAA 4JI6L 2YV5A 4LWCA 4A3GG 5GADC 4LNQA 2F4VQ 4QQBX 1X6OA 2KBNA 1QVFA 1V9PA 2PNHA 4LF5L 3J81c 4GNXC 1J6QA 3I7FA 2ZM6L 1SR3A 3KFUA 3M4QA 2EIFA 1VS0A 1EQQA 1KD1C 3HOYG 3GTQH 4NB3A 2K50A 4PZ8A 1AE2A 3HOUH 4BXXH 2K14A 2BH8A 3CPFA 1U0LA 4MNOA 5IE8A 1B7YB 1IBMQ 3ULJA 1T9HA 4R4IA 4R4QA 1XMQQ 4P71A 3AEVA 4OWWB 2JJQA 1L2FA 5IP7G 2F4VL 3GTOH 1WFQA 2ID0A 3AYHB 3PUYA 4YCUA 4IPDA 4GN3B 3BJUA 2MO0A 1YEZA 2JA8H 3S1QH 3F1ZA 3T1HL 1PH6A 5IYCG 3CCSA 1OXSC 3JAMc 3HOVH 2NN6G 4A3MH 3FKIH 3S2DH 2RCNA 4LFAQ 1IBML 1P16A 3CCEA 3F2DA 4R4OA 1NJIC 4L5SA 4P72A 2JK8A 1XMQL 2MFIA 1XJVA 3HOWH 2Z0SA 4JCVE 1E7ZA 1BBUA 1EYGA 4BY7G 1HR0W 2B63G 1RIPA 2UUCQ 4LF4Q 4UP8A 1S40A 5JJLA 1Z9FA 4HJ8A 4HJAA 1OXUA 3H3VH 4YWKA 2I5HA 4JC0A 5EAYA 5IP9G 4DAMA 4IFDG 1PV4A 1PVOA 2CKZB 2AKWB 2AHOB 4LFAL 1AH9A 3PIPA 5AJ3Q 1G291 1A62A 3NENA 5M3MG 1CKNA 1BKBA 1VQDA 3I4NG 3CXCA 2HIXA 5C44H 5JJKA 3OTOQ 1VQBA 3CF5A 2UUCL 1OTCA 4LF4L 2R93H 4OXPA 4A3FG 4DKAC 1MJCA 1PH3A 4TQUS 1I3QH 3W1GA 3OW2A 4DPGA 2OQKA 1IBKQ 1NMGA 4TVAB 1PH8A 2KCTA 4BBRG 4B3RQ 4NPSA 2UXCQ 4KLKA 5AJ3L 4OONA 2K5VA 2HHHQ 1YVCA 1E1OA 1X55A 4A3DH 1JT8A 4JBKA 2GN5A 4GLVB 4DNIA 3RLNA 3HOXH 5C4XG 5FJ8H 3OTOL 1UEBA 3K81C 2QEXA 1C9OA 1G6PA 4A3EH 3OYYA 3RZOH 3JAMi 1K0RA 1IBKL 2UXCL 4B3RL 2Z6KC 3MEFA 1IL2A 3U4ZA 4BY1H 4Y52H 1KL9A 4DV7Q 2HHHL 4B3TL 3PO3H 1U5KA 3Q8DA 4OWXB 1Y1VH 3GTJH 1HNZQ 2VUMH 3HOUG 1UE6A 5K36G 1VQ7A 3AQQA 4GN4B 3K0XA 1QUQB 5GAEC 5GAHC 1A63A 1XPUA 1TWCH 3CPWA 1UE7A 1VQOA 2MO1A 2VS1A 1NY4A 2H5XA 2UUBQ 1GVPA 3RR5A 4A3LH 4EX5A 2ZJPA 2D0PA 5IYBG 1CKNB 1JJCB 1HZ9A 3F2CA 5IP9H 3PUZA 4DV7L 4DUYQ 4GNXB 1VQNA 4DR4Q 1Q8KA 5IT9c 3HOVG 4A3MG 1HNZL 3FKIG 4DV4Q 4LUVA 5M5XH 3I4MH 4OO1I 1BVSA 1EIFA 2C35B 4IPGA 2Q2UA 4MTNA 4YY3Q 1Y14B 3G4SA 3HOWG 4GOPA 2D0OA 1JB7A 2Q2IA 1N8RC 2OTJA 2ALYB 1YJNA 1IXRA 2UUBL 1D8LA 1KHIA 2L15A 4C2MH 3ZJYC 2K5NA 4KHPQ 3GDEA 1EFWA 3BZCA 3L7ZC 2JQOA 4DR4L 1B8AA 1CKMA 2I5LX 2WP8J 4DUYL 5HY6A 2IHFA 1VQAA 4PZ6A 4DV4L 1TWFH 4C3IH 1YHBA 1VQ4A 1B70B 2ZTDA 4YY3L 3ICEA 3K7AH 1KRSA 3J81j 3M4OH 3RLFA 5C44G 2LXJA 4IOCA 1G51A 2K75A 2R93G 4KHPL 4LFBQ 5E7NA 2NVXH 2R7DA 1XMOQ 5JEAJ 2UU9Q 2Q2HA 3PF4A 1KIXA 3MXNB 4UP9A 4DR1Q 3CCQA 2ZJRA 1VQ5A 1E24A 4POGA 1LM0A 4PMWA 3GTMH 1PYSB 1WOCA 4AQYQ 4A3DG 3RLOA 1N34Q 4FDBA 4IOAA 2R6GA 3HOXG 1SE8A 5FJ8G 1YHQA 2YTYA 4RG1A 3D31A 3PUXA 4B3MQ 4LW1A 1FL0A 1HZAA 1YIJA 4A3EG 2FXQA 4A3IG 2OCEA 4LFBL 1CSPA 1A8VA 3WWVA 3CAMA 1XMOL 1R9TH 1XNRQ 2UXDQ 2UU9L 1S72A 2ZTCA 5IYBH 4GKKQ 1YHAA 4DK6C 4BY1G 4DR1L 1Y1WH 5C3EG 4GNXA 4GOPB 1X9NA 1XPRA 2IX1A 3GTKH 4JI5Q 4AQYL 3PO3G 1V1QA 1Y1VG 5C0XG 3STBC 1N34L 1I5FA 2VUMG 4ME3A 1UE5A 4JI2Q 4QL5A 2GVBA 1PH9A 1QVCA 4B3ML 1OXVA 1L1OC 2RF4A 1NE3A 4NXNQ 2KCMA 1K3RA 2CFMA 4GLXA 2IX0A 3K7UC 3NBHB 1XNRL 5LMNQ 2UXDL 4A3LG 5M3FH 2PI2E 1E22A 1RL2A 1BBWA 1PFSA 3UE1A 4HJ5A 4HJ7A 4GKKL 1N33Q 1QUQA 3KYHC 2KHIA 3KF6B 4IO9A 4EQ5A 1HZBA 4JI5L 2JA6H 3I4MG 3CD6A 1A0IA 4QJFA 3PCOB 2OWOA 4IJLA 2WAQG 1EIYB 2NN6I 2A19A 3S24A 4JI2L 3HOZH 4BA1I 2JA5H 4XTCS 4JYAQ 3G71A 4NXNL 1VQHA 1CUKA 4IPCA 1OXTA 2MQHA 4DV3Q 1GKHA 4DV0Q 3KF8B 4OWTB 4YWLA 3J81i 3U58A 3JC66 4X64Q 2D62A 1I94Q 1N33L 2IT1A 1S3OA 1VQFA 1QZGA 1GO3E 2E5LQ 3PV0A 3F2BA 1K9MC 4LF6Q 4ALPA 3KJOA 3S1MH 1N9WA 2RHSB 1QVGA 3NELA 3ULPA 1HNXQ 1MKHA 4IPHA 4R4CA 4JYAL 3H0GH 3U50C 3CCRA 1MIUA 1WCMH 3CCVA 2R92H 1GD7A 1VQCA 4HJ9A 4GKJQ 2DUDA 1TWHH 3LGJA 4PG3A 2F52A 4DV0L 1K8AC 3CP0A 4X64L 4A3IH 4DV1Q 1YNXA 2CWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4APV A;  2RHQ B;  3RZD H;  4J15 A;  2ASB A;  4LF6 L;  1X3F A;  1C7Y A;  3H15 A;  1L0W A;  3S1R H;  5C3E H;  5ELN A;  1N32 Q;  4L5T A;  3GD7 A;  4DR2 Q;  1HNX L;  2ZJQ A;  4JOI C;  4GKJ L;  3EN2 A;  3BU2 A;  1H95 A;  3PIO A;  3L2P A;  4UP7 A;  3GTG H;  3A74 A;  2ES2 A;  3AFQ A;  3CQZ H;  3EBE A;  4YCW A;  3E9I A;  4DV1 L;  2UXB Q;  1UE1 A;  4IJH A;  3M85 A;  4A3C H;  2N78 A;  3I2Z A;  1EQR A;  1V43 A;  1NMF A;  1SN8 A;  1VQ6 A;  1HH2 P;  1Y1W G;  1N32 L;  2K4K A;  1PH2 A;  3M4P A;  2Z6K A;  4DR2 L;  4AYB E;  2R7Z H;  3S1N H;  4QGU A;  2I5M X;  5ELO A;  2A8V A;  3CCJ A;  1K8G A;  3PO2 H;  5JJI A;  4L5Q A;  3KOJ A;  4DR5 Q;  3ER0 A;  1W2B A;  1KQS A;  2N3S A;  2UXB L;  1EOV A;  2R7F A;  1M90 C;  1PHJ A;  2NVT H;  4X66 Q;  4DR7 Q;  4LFC Q;  5M3F G;  3UDF A;  1Q1E A;  2NZH A;  5IYD H;  2OTL A;  3HKZ E;  4C3J H;  1XTD A;  3PF5 A;  1YIT A;  2PMZ E;  4P74 A;  1Q86 C;  4DK3 C;  1YJW A;  2JE6 I;  1SRU A;  2JA6 G;  3GTL H;  2WFW A;  3KLW A;  5IWA Q;  4BBS G;  1SMX A;  4DR5 L;  4YWM A;  4YCV A;  4DV5 Q;  1Q12 A;  3RNU A;  4JG2 A;  3HOZ G;  3S2H H;  2JA5 G;  4LF7 Q;  2AWN A;  3KF6 A;  2E2H H;  1M1K C;  2F3I A;  4A3B H;  2HQL A;  5FLM H;  2Y0S E;  4DR7 L;  2JEB I;  5LMU Q;  4JI8 Q;  4X65 Q;  4LUO A;  4DV2 Q;  1XNQ Q;  2YU9 H;  1FJG Q;  2JA7 H;  3H3V I;  4JV5 Q;  3S14 H;  1PH1 A;  3UE0 A;  4R4T A;  5M5W H;  5IWA L;  1YBY A;  4DV5 L;  2BH2 A;  1WJJ A;  1J5E Q;  1Q82 C;  4LF7 L;  1K83 H;  3H0G G;  3CCU A;  1WCM G;  5J3B A;  2R92 G;  1JE5 A;  2PI2 A;  5IYD G;  2AWO A;  4HID A;  1KRT A;  3TRE A;  3UDX A;  2B29 A;  3PUV A;  1Q81 C;  4A93 H;  5LMU L;  4JI8 L;  2AMC B;  1Z47 A;  4X65 L;  3KDF A;  4DV2 L;  1XNQ L;  4JI0 Q;  2LXK A;  1FJG L;  3T1Y Q;  3E9H A;  4A3K H;  2YYZ A;  4JV5 L;  5DLQ E;  1TWG H;  3T1H Q;  1J5E L;  2VL6 A;  4JBW A;  4OX9 Q;  5IY0 A;  1AE3 A;  4HIK A;  1ASY A;  3A0J A;  3M3Y H;  1PH4 A;  3GO5 A;  4JI3 Q;  1I94 L;  2KHJ A;  5JEA G;  4IFD J;  3FHW A;  3K80 C;  2Q2T A;  1WYD A;  1KAW A;  3D0F A;  4X6A H;  3PUW A;  4H02 A;  1E1T A;  5FLX c;  1XPO A;  4JI0 L;  4A3C G;  4JBJ A;  3T1Y L;  1TXY A;  3G6E A;  2LSS A;  1YZ6 A;  2E2J H;  5BR8 Q;  1P8L A;  2WB1 E;  3B6Y A;  2EQS A;  4A75 A;  3S16 H;  2YTX A;  1I50 H;  4GLA C;  3I55 A;  2R7Z G;  2VZA A;  2BA1 A;  2PQA A;  4A3J G;  4OX9 L;  1FVI A;  1CKO A;  1X3G A;  4LF8 Q;  4BBS H;  3PO2 G;  1D7Q A;  3RN2 A;  2CQO A;  4X62 Q;  5C0X I;  2CCZ A;  2KEN A;  3IRB A;  1VQ9 A;  3STB D;  4DR3 Q;  1L1O A;  3EIV A;  3L0O A;  5LMN L;  4HIO A;  1X54 A;  2CWA A;  2QA4 A;  1UWV A;  2NZO A;  3HKS A;  5BR8 L;  3J80 c;  1JJG A;  4LF9 Q;  1CSQ A;  4WJ4 A;  3M9B A;  1IBL Q;  3HFZ B;  2MNA A;  4AYB G;  3ULL A;  4IFD I;  4LF8 L;  4C3H H;  2NVQ H;  1X3E A;  3F8T A;  4UPA A;  4X62 L;  2ATW A;  3KDF B;  4KHZ A;  3I56 A;  2K5H A;  2VY3 A;  4GN5 A;  3RN5 A;  1ASZ A;  5GRO A;  4DUZ Q;  1NBW A;  2HIV A;  3CC7 A;  4DV3 L;  4DR3 L;  3CCL A;  4A3B G;  1WI5 A;  2IY5 B;  3CCM A;  2BA0 A;  2N49 A;  5FLM G;  1JJ2 A;  4A3G H;  4P73 A;  3S15 H;  4R1J A;  4BA2 I;  3W5O A;  1I6H H;  1YI2 A;  1OXX K;  1X65 A;  3TQY A;  3W1B A;  1MJE A;  2E5L L;  4LF9 L;  1K73 C;  3HKZ G;  1VQI A;  2I0Q A;  4NXM Q;  2VQF Q;  2JA7 G;  1IBL L;  4DR6 Q;  2V1C C;  4DV6 Q;  3PGZ A;  1VQG A;  1VQ8 A;  1E3P A;  3KJP A;  3TS0 A;  4QY7 A;  4AH6 A;  4JI3 L;  1N36 Q;  3HOY H;  4DUZ L;  4K0K Q;  2UUA Q;  4B3T Q;  3DM3 A;  3G48 A;  3VDY A;  1EUJ A;  3CW2 C;  1DGS A;  4A93 G;  2Y0S G;  1PA6 A;  3TRZ A;  2E2I H;  2NVY H;  2PQA B;  5H1S E;  3DLL A;  3UDG A;  1TWA H;  5IP7 H;  2VQE Q;  4A3K G;  1HZC A;  4NXM L;  2QGQ A;  2VQF L;  4DR6 L;  3PSI A;  4DV6 L;  3FP9 A;  3UDI A;  5LMN W;  4AIM A;  2IHE A;  4JI7 Q;  4WJ3 M;  4A3J H;  5IYC H;  5C4J H;  1Q7Y C;  1Q46 A;  1L1O B;  3I4O A;  4JI1 Q;  1N36 L;  4OO1 G;  4K0K L;  3A5U A;  1KXL A;  1NTG A;  2UUA L;  4JOI A;  3AFP A;  1PYB A;  3SGI A;  3J80 i;  4BXX G;  1EWI A;  2N8N A;  2WAQ E;  1O7I A;  4GOP C;  3ERS X;  2HT1 A;  2B3G A;  1VQP A;  2VQE L;  2E8G A;  3K8A A;  1HNW Q;  4GS3 A;  5GQO A;  4BY7 H;  2B63 H;  1LTL A;  1W3S A;  2VW9 A;  1SFO H;  4JBM A;  1C0A A;  1VCI A;  1SLJ A;  4MZ9 A;  1VQE A;  3CME A;  1Q1B A;  1QZH A;  3M7N A;  5HGQ A;  2JA8 G;  4JI7 L;  2VNU D;  4LUZ A;  3E0E A;  4JI1 L;  1PH5 A;  1KC8 C;  2XGT A;  4KI0 A;  4O2D A;  4B3S Q;  2DGY A;  2JA9 A;  2JEA I;  4JI4 Q;  3TEH B;  2GVA A;  4HIM A;  4PZ7 A;  1GM5 A;  1SRO A;  2ZTE A;  1YJ9 A;  4A76 A;  1IZ6 A;  5M3M H;  1HR0 Q;  1PH7 A;  3A5Z B;  1X56 A;  4YHH Q;  3I4N H;  3TS2 A;  4RMF A;  1FGU A;  2OQ0 A;  4X66 L;  4LFC L;  4Y7N H;  1JMC A;  4POF A;  1HNW L;  1LYL A;  3CC4 A;  2XTI A;  1VQL A;  2EXD A;  4A3F H;  2WB1 G;  4JI6 Q;  3S17 H;  5GAG C;  4UY8 C;  5M5Y H;  3J7Z C;  4QIW E;  4B3S L;  4L5R C;  4LF5 Q;  4P75 A;  1VQK A;  4JI4 L;  4A4I A;  4BBR H;  1LUZ A;  1VQM A;  2ZM6 Q;  3BZK A;  1HR0 L;  4DAY B;  1HJP A;  4YHH L;  1IYJ B;  4O0A A;  3CC2 A;  1VQJ A;  3NEM A;  3GTP H;  3J7A 5;  3U4V A;  4XIG S;  5C4X H;  2K52 A;  2YTV A;  5C0X J;  2A1A A;  3CMA A;  4JI6 L;  2YV5 A;  4LWC A;  4A3G G;  5GAD C;  4LNQ A;  2F4V Q;  4QQB X;  1X6O A;  2KBN A;  1QVF A;  1V9P A;  2PNH A;  4LF5 L;  3J81 c;  4GNX C;  1J6Q A;  3I7F A;  2ZM6 L;  1SR3 A;  3KFU A;  3M4Q A;  2EIF A;  1VS0 A;  1EQQ A;  1KD1 C;  3HOY G;  3GTQ H;  4NB3 A;  2K50 A;  4PZ8 A;  1AE2 A;  3HOU H;  4BXX H;  2K14 A;  2BH8 A;  3CPF A;  1U0L A;  4MNO A;  5IE8 A;  1B7Y B;  1IBM Q;  3ULJ A;  1T9H A;  4R4I A;  4R4Q A;  1XMQ Q;  4P71 A;  3AEV A;  4OWW B;  2JJQ A;  1L2F A;  5IP7 G;  2F4V L;  3GTO H;  1WFQ A;  2ID0 A;  3AYH B;  3PUY A;  4YCU A;  4IPD A;  4GN3 B;  3BJU A;  2MO0 A;  1YEZ A;  2JA8 H;  3S1Q H;  3F1Z A;  3T1H L;  1PH6 A;  5IYC G;  3CCS A;  1OXS C;  3JAM c;  3HOV H;  2NN6 G;  4A3M H;  3FKI H;  3S2D H;  2RCN A;  4LFA Q;  1IBM L;  1P16 A;  3CCE A;  3F2D A;  4R4O A;  1NJI C;  4L5S A;  4P72 A;  2JK8 A;  1XMQ L;  2MFI A;  1XJV A;  3HOW H;  2Z0S A;  4JCV E;  1E7Z A;  1BBU A;  1EYG A;  4BY7 G;  1HR0 W;  2B63 G;  1RIP A;  2UUC Q;  4LF4 Q;  4UP8 A;  1S40 A;  5JJL A;  1Z9F A;  4HJ8 A;  4HJA A;  1OXU A;  3H3V H;  4YWK A;  2I5H A;  4JC0 A;  5EAY A;  5IP9 G;  4DAM A;  4IFD G;  1PV4 A;  1PVO A;  2CKZ B;  2AKW B;  2AHO B;  4LFA L;  1AH9 A;  3PIP A;  5AJ3 Q;  1G29 1;  1A62 A;  3NEN A;  5M3M G;  1CKN A;  1BKB A;  1VQD A;  3I4N G;  3CXC A;  2HIX A;  5C44 H;  5JJK A;  3OTO Q;  1VQB A;  3CF5 A;  2UUC L;  1OTC A;  4LF4 L;  2R93 H;  4OXP A;  4A3F G;  4DKA C;  1MJC A;  1PH3 A;  4TQU S;  1I3Q H;  3W1G A;  3OW2 A;  4DPG A;  2OQK A;  1IBK Q;  1NMG A;  4TVA B;  1PH8 A;  2KCT A;  4BBR G;  4B3R Q;  4NPS A;  2UXC Q;  4KLK A;  5AJ3 L;  4OON A;  2K5V A;  2HHH Q;  1YVC A;  1E1O A;  1X55 A;  4A3D H;  1JT8 A;  4JBK A;  2GN5 A;  4GLV B;  4DNI A;  3RLN A;  3HOX H;  5C4X G;  5FJ8 H;  3OTO L;  1UEB A;  3K81 C;  2QEX A;  1C9O A;  1G6P A;  4A3E H;  3OYY A;  3RZO H;  3JAM i;  1K0R A;  1IBK L;  2UXC L;  4B3R L;  2Z6K C;  3MEF A;  1IL2 A;  3U4Z A;  4BY1 H;  4Y52 H;  1KL9 A;  4DV7 Q;  2HHH L;  4B3T L;  3PO3 H;  1U5K A;  3Q8D A;  4OWX B;  1Y1V H;  3GTJ H;  1HNZ Q;  2VUM H;  3HOU G;  1UE6 A;  5K36 G;  1VQ7 A;  3AQQ A;  4GN4 B;  3K0X A;  1QUQ B;  5GAE C;  5GAH C;  1A63 A;  1XPU A;  1TWC H;  3CPW A;  1UE7 A;  1VQO A;  2MO1 A;  2VS1 A;  1NY4 A;  2H5X A;  2UUB Q;  1GVP A;  3RR5 A;  4A3L H;  4EX5 A;  2ZJP A;  2D0P A;  5IYB G;  1CKN B;  1JJC B;  1HZ9 A;  3F2C A;  5IP9 H;  3PUZ A;  4DV7 L;  4DUY Q;  4GNX B;  1VQN A;  4DR4 Q;  1Q8K A;  5IT9 c;  3HOV G;  4A3M G;  1HNZ L;  3FKI G;  4DV4 Q;  4LUV A;  5M5X H;  3I4M H;  4OO1 I;  1BVS A;  1EIF A;  2C35 B;  4IPG A;  2Q2U A;  4MTN A;  4YY3 Q;  1Y14 B;  3G4S A;  3HOW G;  4GOP A;  2D0O A;  1JB7 A;  2Q2I A;  1N8R C;  2OTJ A;  2ALY B;  1YJN A;  1IXR A;  2UUB L;  1D8L A;  1KHI A;  2L15 A;  4C2M H;  3ZJY C;  2K5N A;  4KHP Q;  3GDE A;  1EFW A;  3BZC A;  3L7Z C;  2JQO A;  4DR4 L;  1B8A A;  1CKM A;  2I5L X;  2WP8 J;  4DUY L;  5HY6 A;  2IHF A;  1VQA A;  4PZ6 A;  4DV4 L;  1TWF H;  4C3I H;  1YHB A;  1VQ4 A;  1B70 B;  2ZTD A;  4YY3 L;  3ICE A;  3K7A H;  1KRS A;  3J81 j;  3M4O H;  3RLF A;  5C44 G;  2LXJ A;  4IOC A;  1G51 A;  2K75 A;  2R93 G;  4KHP L;  4LFB Q;  5E7N A;  2NVX H;  2R7D A;  1XMO Q;  5JEA J;  2UU9 Q;  2Q2H A;  3PF4 A;  1KIX A;  3MXN B;  4UP9 A;  4DR1 Q;  3CCQ A;  2ZJR A;  1VQ5 A;  1E24 A;  4POG A;  1LM0 A;  4PMW A;  3GTM H;  1PYS B;  1WOC A;  4AQY Q;  4A3D G;  3RLO A;  1N34 Q;  4FDB A;  4IOA A;  2R6G A;  3HOX G;  1SE8 A;  5FJ8 G;  1YHQ A;  2YTY A;  4RG1 A;  3D31 A;  3PUX A;  4B3M Q;  4LW1 A;  1FL0 A;  1HZA A;  1YIJ A;  4A3E G;  2FXQ A;  4A3I G;  2OCE A;  4LFB L;  1CSP A;  1A8V A;  3WWV A;  3CAM A;  1XMO L;  1R9T H;  1XNR Q;  2UXD Q;  2UU9 L;  1S72 A;  2ZTC A;  5IYB H;  4GKK Q;  1YHA A;  4DK6 C;  4BY1 G;  4DR1 L;  1Y1W H;  5C3E G;  4GNX A;  4GOP B;  1X9N A;  1XPR A;  2IX1 A;  3GTK H;  4JI5 Q;  4AQY L;  3PO3 G;  1V1Q A;  1Y1V G;  5C0X G;  3STB C;  1N34 L;  1I5F A;  2VUM G;  4ME3 A;  1UE5 A;  4JI2 Q;  4QL5 A;  2GVB A;  1PH9 A;  1QVC A;  4B3M L;  1OXV A;  1L1O C;  2RF4 A;  1NE3 A;  4NXN Q;  2KCM A;  1K3R A;  2CFM A;  4GLX A;  2IX0 A;  3K7U C;  3NBH B;  1XNR L;  5LMN Q;  2UXD L;  4A3L G;  5M3F H;  2PI2 E;  1E22 A;  1RL2 A;  1BBW A;  1PFS A;  3UE1 A;  4HJ5 A;  4HJ7 A;  4GKK L;  1N33 Q;  1QUQ A;  3KYH C;  2KHI A;  3KF6 B;  4IO9 A;  4EQ5 A;  1HZB A;  4JI5 L;  2JA6 H;  3I4M G;  3CD6 A;  1A0I A;  4QJF A;  3PCO B;  2OWO A;  4IJL A;  2WAQ G;  1EIY B;  2NN6 I;  2A19 A;  3S24 A;  4JI2 L;  3HOZ H;  4BA1 I;  2JA5 H;  4XTC S;  4JYA Q;  3G71 A;  4NXN L;  1VQH A;  1CUK A;  4IPC A;  1OXT A;  2MQH A;  4DV3 Q;  1GKH A;  4DV0 Q;  3KF8 B;  4OWT B;  4YWL A;  3J81 i;  3U58 A;  3JC6 6;  4X64 Q;  2D62 A;  1I94 Q;  1N33 L;  2IT1 A;  1S3O A;  1VQF A;  1QZG A;  1GO3 E;  2E5L Q;  3PV0 A;  3F2B A;  1K9M C;  4LF6 Q;  4ALP A;  3KJO A;  3S1M H;  1N9W A;  2RHS B;  1QVG A;  3NEL A;  3ULP A;  1HNX Q;  1MKH A;  4IPH A;  4R4C A;  4JYA L;  3H0G H;  3U50 C;  3CCR A;  1MIU A;  1WCM H;  3CCV A;  2R92 H;  1GD7 A;  1VQC A;  4HJ9 A;  4GKJ Q;  2DUD A;  1TWH H;  3LGJ A;  4PG3 A;  2F52 A;  4DV0 L;  1K8A C;  3CP0 A;  4X64 L;  4A3I H;  4DV1 Q;  1YNX A;  2CWP A; 
#chains in the Genus database with same CATH topology
 3V05 A;  1PRT B;  1SDF A;  2MJ8 A;  5JOB A;  4DR2 Q;  2DNE A;  4G57 A;  4GKJ L;  2DY8 A;  4HMJ A;  4BWG B;  3GTG H;  1QNK A;  3CQZ H;  2UXB Q;  4CKB A;  3CQZ B;  5EKI A;  1SN8 A;  4K5X A;  3SE0 A;  1N32 L;  2Z6K A;  4C1N I;  1PTO D;  1ENC A;  5IGE A;  3L3O C;  5ELO A;  3CCJ A;  1ICW A;  3D4R A;  4L5Q A;  4DR5 Q;  3ER0 A;  1W2B A;  2N3S A;  4HR7 B;  1M90 C;  4G7Z C;  1PHJ A;  3BG3 A;  1RD9 D;  4DR7 Q;  2IL8 A;  1BUV T;  2QF7 A;  4N9T A;  1QB5 D;  2OTL A;  5FK9 C;  4C3J H;  2PMZ E;  4DK3 C;  1YJW A;  1SRU A;  4C3J B;  4G4K A;  3QJY A;  3NTI A;  4BBS G;  1SMX A;  4YWM A;  3S2H H;  4JG2 A;  2JA5 G;  3I72 A;  2K28 A;  1M1K C;  2MUY A;  3S2H B;  5JVG 3;  3IFT A;  4XQQ A;  3HZX A;  5I2Y A;  2A6H C;  4JI8 Q;  2KA7 A;  4CDC C;  1FJG Q;  2JA7 H;  3OMC A;  4JV5 Q;  4C1N K;  3UE0 A;  3RMH A;  4R4T A;  1Y8P B;  2JA7 B;  5IWA L;  1YBY A;  2TMP A;  1BCP D;  2PMZ B;  2Z8L A;  5M5Y B;  3E0J A;  1K83 H;  5IYD G;  3UDX A;  1K83 B;  1STE A;  1GJX A;  1CT1 D;  1Z47 A;  3KDF A;  3MHB A;  4DV2 L;  4M8A A;  1TKW B;  3UI2 A;  3GP7 A;  3DM1 A;  1JQY D;  4OX9 Q;  3BZD B;  1K8M A;  3M3Y H;  1PH4 A;  2A73 B;  3GO5 A;  3ERQ A;  3FHW A;  3M3Y B;  1M8A A;  4H02 A;  2K33 A;  4JBJ A;  3T1Y L;  1F9R A;  1BXT A;  2LSS A;  3VYS A;  3LNN A;  2E2J H;  5BR8 Q;  2EQS A;  3B6Y A;  1B4O A;  1XX8 A;  4JPB W;  2E2J B;  2PQA A;  4A3J G;  5CV6 A;  1CKO A;  2K03 A;  1ZKO A;  3PO2 G;  5FO7 B;  3RN2 A;  2CQO A;  2DY7 A;  5C0X I;  1PMR A;  1A3T A;  5IGG A;  1SYE A;  5LMN L;  3D3R A;  1JJG A;  1LTT D;  4OL7 A;  2IWH A;  3O13 A;  1ZEQ X;  1VMC A;  4LF8 L;  4C3H H;  2NVQ H;  4UPA A;  2A6E C;  1E2V A;  2CH4 W;  2D9U A;  2VY3 A;  4KD3 A;  1ICF B;  2NVQ B;  2HIV A;  4DR3 L;  3CCL A;  4A3B G;  3EVQ A;  5A2Q E;  1E0B A;  4J6H A;  3OHX C;  3PIO 3;  1NUC A;  1YI2 A;  1K73 C;  4HAE A;  2PZT A;  1VF5 C;  2I0Q A;  2V1C C;  4DV6 Q;  1NSN S;  3PGZ A;  1VQ8 A;  4H13 C;  4RCN A;  1D1I A;  3KJP A;  3TS0 A;  1IL8 A;  3SK8 A;  2WIN B;  2F0P A;  2Y0S G;  5H1S E;  4NXM L;  1TWA H;  2VQF L;  1ILQ A;  1IYU A;  1TWA B;  3UDI A;  4RGO S;  5C4J H;  4OO1 G;  1L1O B;  2V4D A;  4JI1 Q;  3A5U A;  1NTG A;  2NN6 H;  4JOI A;  1PYB A;  3SGI A;  1EWI A;  2EY5 A;  2KJX A;  3SVM A;  1KDB A;  2VQE L;  1EYD A;  4K8J A;  1Y8O B;  1W3S A;  2EYP A;  3TP5 A;  3CME A;  1Q1B A;  1QZH A;  1FD7 D;  2XGT A;  4N8F A;  3ZYY X;  3TEH B;  2O4X A;  2ZTE A;  1YJ9 A;  1QCB D;  1S5F D;  4A76 A;  1TU2 B;  4XT1 B;  4YHH Q;  4RMF A;  1JMC A;  1HNW L;  2XTI A;  4Q0F A;  4A3F H;  2RVL A;  2WB1 G;  3C46 A;  3S17 H;  4IN3 A;  1TS4 A;  4IUP A;  3J7Z C;  4A3F B;  2F0W A;  3S17 B;  4L5R C;  1VQK A;  4A4I A;  4BBR H;  1VQM A;  1Q3L A;  2F0F A;  4BBR B;  2AQ1 B;  3MEH A;  3GTP H;  3QOL A;  3AU7 A;  5C4X H;  2CH4 A;  1SNP A;  3VA5 A;  5C6A A;  4LWC A;  5GAD C;  4LNQ A;  1YNN C;  1X6O A;  3MZ5 A;  5IT9 L;  1QVF A;  2JYO A;  3TP6 A;  4GNX C;  1J6Q A;  3I7F A;  1VS0 A;  5COY A;  1PRT C;  2ENB A;  1RJT A;  2K14 A;  5KNB A;  1U4L A;  4MNO A;  1B7Y B;  5K36 H;  3ULJ A;  4R4I A;  4ZCK A;  4R4Q A;  4P71 A;  4OWW B;  4OHJ A;  3GTO H;  3K6O A;  3BJU A;  4N8X 1;  3GTO B;  2JA8 H;  3FDT A;  4L63 B;  2ZXP A;  2SNM A;  2RCN A;  1DXM A;  1F9S A;  4LFA Q;  3F2D A;  2RDF A;  4R4O A;  3N52 A;  1NJI C;  2QCP X;  1XMQ L;  5ELF A;  3GTK B;  2MFI A;  2J4X A;  4JCV E;  1BBU A;  1AN8 A;  1RIP A;  4FXK C;  1Z9F A;  4HCS A;  1OXU A;  1KAB A;  2H1E A;  4YWK A;  4ZQ3 A;  2AHO B;  3PIP A;  2F1M A;  3VA7 A;  5M3M G;  3NWT A;  1LT3 D;  3H91 A;  3CF5 A;  1VQB A;  2QW7 A;  1OTC A;  1F2L A;  1I6V C;  1MJC A;  4ZYS A;  3JAM L;  1I3Q H;  1O7Y A;  5EKK A;  3W1G A;  2UXC Q;  2KCT A;  1I3Q B;  4RAU C;  4OON A;  2HHH Q;  1E1O A;  4K6D A;  1T5X D;  1X55 A;  1XWE A;  4JBK A;  1UEB A;  4RKB A;  2QEX A;  3SK6 A;  3D4D A;  1STN A;  1G6P A;  3RZO H;  1GUS A;  5IGB A;  4RHS A;  1IBK L;  1CZW A;  3RZO B;  1IL2 A;  4DU9 A;  4DV7 Q;  3J7A V;  2AUK A;  4RHR A;  2N55 A;  1IW7 C;  2EDG A;  5C3E B;  1VQ7 A;  3AQQ A;  4GN4 B;  3K0X A;  1XPU A;  5C4H A;  1LT4 D;  2XSC A;  1VQO A;  1F2M A;  1NY4 A;  1SMY C;  4XDX A;  4EX5 A;  2B2T A;  3PUZ A;  5IP9 H;  4KY6 A;  4DUY Q;  1Q8K A;  2X6L A;  4IUU A;  4DV4 Q;  4WJW A;  3I4M H;  1RTO A;  5EJW A;  1EY5 A;  4YY3 Q;  1CA6 A;  3K0Y A;  1Y14 B;  3I4M B;  1KLU D;  1WD1 A;  1IW7 D;  1JB7 A;  4LAA A;  1PFB A;  4K6L A;  3DHQ A;  4CDD C;  1EYC A;  3P75 A;  3BZC A;  2EY6 A;  1B8A A;  2I5L X;  1GUN A;  3TP7 A;  1SMY D;  1VQA A;  4PZ6 A;  4ULL A;  2ICI A;  1GXD C;  3K7A H;  1KRS A;  2AQ2 B;  3K7A B;  1BBX C;  5C44 G;  4RA8 A;  1HCZ A;  1G51 A;  1JB3 A;  3X3M A;  4KHP L;  1WTH A;  1CM9 A;  4ZUJ A;  3GV3 A;  1PYW D;  4K14 A;  3PF4 A;  1JWS D;  2ZJR A;  1VQ5 A;  3RLO A;  1N34 Q;  2L9H A;  5FJ8 G;  4IUQ A;  4RG1 A;  2X6G A;  3D31 A;  4EVO A;  3OSO A;  4B3M Q;  1FL0 A;  1YIJ A;  2L5T A;  2OCE A;  3BDC A;  1CSP A;  3CAM A;  4GKK Q;  5IYB H;  4DR1 L;  4L6T B;  4KTA A;  4JI5 Q;  4R9W A;  3STB C;  1UE5 A;  3T16 A;  4KV6 A;  1WTO A;  4JI2 Q;  2GVB A;  1L1O C;  2RF4 A;  2RDH A;  2AQ3 B;  2KQ3 A;  4HSV A;  1X3P A;  4GLX A;  3K7U C;  2UXD L;  1RL2 A;  2K5D A;  2D5D A;  2HD3 A;  2KHI A;  4IO9 A;  4EQ5 A;  4F88 A;  3CD6 A;  2QIL A;  2F0U A;  2NN6 I;  2IPK D;  3S24 A;  4KD4 A;  4BA1 I;  4DFA A;  2JA5 H;  4JYA Q;  4BBS B;  4IPC A;  2MQH A;  2B2V C;  4DXF A;  2JA5 B;  3KBG A;  2E76 C;  3KF8 B;  3J81 i;  4X64 Q;  2D62 A;  2HDL A;  1EZ6 A;  2K7V A;  2XIW A;  2F3V A;  1GUG A;  1N9W A;  1QVG A;  4C3I G;  4DA2 A;  2NBF A;  2JXM B;  1JOQ A;  1MKH A;  4IPH A;  4C56 C;  1HTL D;  5F2D A;  4GKJ Q;  1VQC A;  5IYD H;  1TWH H;  5EGT A;  3CP0 A;  1EYA A;  3I90 A;  1NNX A;  1TWH B;  4APV A;  3E6Z X;  5M9O A;  3RZD H;  4LF6 L;  3T4A C;  2E2D C;  4OIK A;  1LTR D;  3RZD B;  3KLS X;  1N32 Q;  1I4G A;  3MFY A;  3I4L A;  1HNX L;  2ZJQ A;  2NUC A;  3FEW X;  5G3L F;  3EN2 A;  1LT5 D;  2E75 C;  4UP7 A;  3PIO A;  3A74 A;  3HP3 A;  2ES2 A;  3AFQ A;  1Y69 U;  2KHS A;  3E9I A;  3K5M A;  1M4V A;  3M85 A;  1V43 A;  2RDG A;  2E2I B;  1VQ6 A;  1Y1W G;  5KEE A;  1LLR D;  3C2P A;  4KN7 C;  2RQX A;  1HHV A;  3PO2 H;  4A3J B;  1BF4 A;  5DNF A;  3PO2 B;  3NK9 A;  1WTX A;  1O78 A;  5C5L A;  4X66 Q;  5EPK A;  3KLS A;  1XTD A;  5JJZ A;  1Q86 C;  4P74 A;  2JA6 G;  5ISR A;  1ENF A;  4UDU C;  2WKD A;  3QG1 A;  5I9P A;  5IWA Q;  5EBC A;  3RNU A;  1ZYR C;  4RWS C;  1B3Q A;  2E2H H;  4OEL B;  2F3I A;  4A3B H;  1UAP A;  2F0D A;  1WTP A;  2E2H B;  2Y0S E;  2JEB I;  3NBI A;  4A3B B;  5CV7 A;  3FPP A;  4LUO A;  4DV2 Q;  2YU9 H;  2K32 A;  1S5E D;  5ELB A;  3KF8 A;  2YU9 B;  1IYV A;  3WOF A;  4OEM B;  1WJJ A;  3Q6S A;  4IZ8 A;  2PW7 A;  1EY9 A;  2NWG A;  5CGK A;  1WCM G;  1OO9 B;  2R92 G;  1JE5 A;  3PUV A;  4JVZ A;  2C9O A;  1ZYR D;  2B2Y A;  5LMU L;  3E3X A;  4X65 L;  4RFB A;  1XNQ L;  3T1Y Q;  3E9H A;  3IL8 A;  2Y0S B;  3NXW A;  4FNF A;  5DLQ E;  1TWG H;  1HFN A;  3T1H Q;  2C5C A;  3J7A F;  4OO1 H;  1DOL A;  4HIK A;  3A0J A;  4CJ1 B;  2KHJ A;  4IFD J;  4NKL A;  2Q2T A;  1EWH A;  1LTA D;  4JI0 L;  4A3C G;  4L8J A;  5CV8 A;  3TME A;  1TXY A;  5CMD A;  2F0E A;  2ZT9 C;  1P8L A;  2WB1 E;  3S16 H;  4NW2 A;  4GLA C;  2G5D A;  4X3S A;  2VZA A;  3S16 B;  1TY2 A;  1X3G A;  4LF8 Q;  3LWE A;  4FP5 D;  1EY0 A;  3VYT A;  2FMC A;  1VQ9 A;  1IKL A;  4DNT B;  1SE3 A;  4DR3 Q;  3EIV A;  3L0O A;  1U9R A;  4HIO A;  1LTB D;  1V8Q A;  1UWV A;  3HKS A;  1TVX A;  4PMB A;  1TR5 A;  3IKJ A;  4DNR B;  3DXJ C;  1WTR A;  4WRD A;  1TY0 A;  3HFZ B;  2MNA A;  2WB1 B;  3ULL A;  1BR9 A;  3A7A B;  4IFD I;  3ND9 A;  4KJO A;  4X62 L;  2HDM A;  2Z4I A;  2LMC B;  3KDF B;  4KHZ A;  1SJE D;  2K5H A;  4GN5 A;  3I56 A;  3RN5 A;  1ASZ A;  2CHB D;  1ESF A;  4KMU C;  2IY5 B;  2OF1 A;  2N49 A;  4QCL A;  1SEB D;  2CVR A;  3S15 H;  4R1J A;  1I6H H;  4P2C B;  3W5O A;  3U9S A;  1OXX K;  3TQY A;  4NXM Q;  3HKZ G;  3S15 B;  1I6H B;  2VQF Q;  2B8F A;  3L9A X;  2BOS A;  2XNA C;  3BDL A;  3D6W A;  4B9W A;  4JI3 L;  4B3T Q;  3DM3 A;  5EPL A;  5JEA H;  3CW2 C;  1KNA A;  1PZJ D;  2PPB C;  1STB A;  4H44 C;  2NVY H;  2PQA B;  3NTK A;  1SNC A;  4EGV A;  2VQE Q;  4A3K G;  2QGQ A;  5DM7 3;  4DR6 L;  2NVY B;  1MD2 D;  4FO2 A;  4RCO A;  2EYF A;  5LMN W;  4AIM A;  4WJ3 M;  3TP8 A;  3D4W A;  1N36 L;  4K0K L;  1KXL A;  2N8N A;  4J1M A;  3ERS X;  2HT1 A;  1B1Z A;  2B3G A;  2E8G A;  4DAV A;  3K8A A;  2A68 C;  1HNW Q;  1EL0 A;  2O5I C;  1VCI A;  2WAC A;  1VQE A;  1KAA A;  5HGQ A;  1SE2 A;  4JI7 L;  1G8Z D;  4IUT A;  1PH5 A;  1RKN A;  4KI0 A;  2DGY A;  1STY A;  1PFN A;  2GVA A;  4HIM A;  1GM5 A;  2L4N A;  1IZ6 A;  5M3M H;  1SNM A;  1FGU A;  4X66 L;  1LV9 A;  4POF A;  5M3M B;  1O80 A;  1VQL A;  3P20 A;  5AFW A;  3NSW A;  3K5O A;  2QEJ C;  5E4W C;  5M5Y H;  4U67 3;  2EYO A;  4JI4 L;  2F0T A;  1HR0 L;  3A8J E;  1ENA A;  1IYJ B;  4KJN A;  4O0A A;  3J7A 5;  1SAP A;  2EJF C;  5CV4 A;  2HUG A;  5ELC A;  2L12 A;  5C0X J;  1QJO A;  2YV5 A;  4A3G G;  2F0Q A;  1CK1 A;  2KBN A;  2A6H D;  4LF5 L;  3VR5 A;  5CBE E;  3KFU A;  2BDN A;  1EQQ A;  1ESR A;  3GTQ H;  4XQN A;  4BXX H;  1F2Z A;  4MN3 A;  2BH8 A;  3CPF A;  3GTQ B;  1XMQ Q;  3EA6 A;  2NTS A;  1L2F A;  2F4V L;  2ID0 A;  3PUY A;  4IPD A;  3TSS A;  1YEZ A;  2A74 C;  3T1H L;  1PH6 A;  3TBI B;  5IYC G;  3JAM c;  2EYJ A;  3CCE A;  2WKC A;  3OOC A;  4L5S A;  4EQO A;  1IKM A;  2JK8 A;  1I4Q A;  2EYM A;  5KYI A;  2Z0S A;  4HN7 A;  1FR3 A;  1JWM D;  4UP8 A;  1S40 A;  4ODG A;  5JJL A;  3H3V H;  4HJA A;  2CW0 C;  2XRS D;  4KK7 A;  4IUR A;  4I7Z C;  2CKZ B;  4RGM A;  1FNV A;  1G29 1;  1CKN A;  3CXC A;  2HIX A;  5C44 H;  3VYR A;  3LWU A;  3TDQ A;  2F0I A;  2FJ2 A;  5C44 B;  2F0H A;  1CZG A;  4KKS A;  2HCI A;  4DPG A;  3OW2 A;  1IBK Q;  1HA5 A;  4IUN A;  1WD0 A;  4TVA B;  1JOR A;  4NPS A;  3WDN A;  5AJ3 L;  3W3A A;  1WTV A;  4KY5 A;  1JT8 A;  3RD4 A;  4LJZ C;  4GLV B;  1MI2 A;  3M7G A;  2A6E D;  4UHV A;  3RLN A;  5FJ8 H;  5KNC A;  3OTO L;  1G2T A;  3K81 C;  4F8M A;  2I46 A;  5KND A;  3OYY A;  3JAM i;  1K0R A;  2SEB D;  3JAM E;  1EQT A;  2Z6K C;  5IIF A;  1SNO A;  1KL9 A;  1B44 D;  4DK1 A;  4HSP A;  4B3T L;  3R3O A;  1U5K A;  3Q8D A;  4OWX B;  3HOU G;  2RCF A;  3SR1 A;  1UE6 A;  2K1B A;  2L11 A;  3BDO A;  3MXN A;  5GAH C;  3CPW A;  1UE7 A;  4FF1 A;  2MO1 A;  3R8B A;  2H5X A;  1O7Z A;  3V2T A;  2NZ1 D;  2ZJP A;  1I4P A;  3F2C A;  4HCE A;  3MAQ A;  4A3M G;  1HNZ L;  4LUV A;  4HMI A;  1R4P B;  4OO1 I;  3S1N B;  2C35 B;  4IPG A;  3MXP A;  3C1E A;  4X3U A;  3HOW G;  4GOP A;  3VR4 A;  1B53 A;  3X3N A;  1BNZ A;  1IXR A;  4LMQ D;  1D8L A;  2L15 A;  4C2M H;  3ZJY C;  2F0O A;  4KHP Q;  3L7Z C;  4DR4 L;  4C2M B;  1E2Z A;  1V1O A;  3BYY B;  4C3I H;  4B08 A;  5DEH A;  1VQ4 A;  3A8I E;  1B70 B;  3NTH A;  5E1F A;  1EEF D;  4C3I B;  4ZUI A;  3J81 j;  4K5W A;  4RGT A;  2R3Z A;  2K75 A;  2R93 G;  2GA4 B;  4QF4 A;  5IOC A;  5E7N A;  2DJF C;  5JEA J;  1G91 A;  5LL6 X;  4DR1 Q;  5KYL A;  5FO9 B;  3GTM H;  4F87 A;  1PYS B;  4A3D G;  4IOA A;  3GTM B;  2YTY A;  4A3E G;  4A3I G;  1XMO L;  1R9T H;  2UXD Q;  2UU9 L;  4CKE A;  4ID6 A;  2ZTC A;  4DK6 C;  1R9T B;  1TQO A;  1YNN D;  1Y1W H;  1I4R A;  1Z7T A;  1X9N A;  2VXW A;  2IX1 A;  3IFD A;  3GTK H;  4AQY L;  3PO3 G;  1Y1W B;  2VUM G;  3ONA B;  1BQQ T;  5EKL A;  1PRT D;  1QVC A;  2RSO A;  2SNS A;  1K3R A;  2CFM A;  5FOB B;  2IX0 A;  3NBH B;  3FMC A;  3CRL C;  5E4X A;  1XNR L;  3HEJ A;  2BCO A;  2PI2 E;  1BBW A;  3UE1 A;  4HJ7 A;  3EJI A;  4U68 A;  3NP8 A;  2JA6 H;  1A0I A;  2JA6 B;  5EPJ A;  1MSG A;  2EOT A;  4XTC S;  1I4X A;  3G71 A;  4NXN L;  1OXT A;  5A2Q L;  3MVV A;  4DV3 Q;  2OWO A;  3JC6 6;  3NQI A;  1N33 L;  1S3O A;  4CKC A;  5JVH 3;  3I8Z A;  4LF6 Q;  1X3Q A;  1K9M C;  1HPC A;  4ALP A;  3URY A;  1EY4 A;  2BE5 C;  2Z9H A;  3ULP A;  1HNX Q;  4R4C A;  2ZXR A;  1HQR D;  3CCR A;  1MIU A;  1WCM H;  2R92 H;  1GD7 A;  4QQB X;  4HJ9 A;  4DV0 L;  2VB3 X;  2R92 B;  1WCM B;  4A3I H;  1GHJ A;  1BOS A;  1AZP A;  2WV6 D;  4WFN 3;  1A3V A;  2ASB A;  3FVQ A;  3H15 A;  2Z6B A;  5C3E H;  5ELN A;  3QO2 A;  5T1I A;  4JOI C;  1S5D D;  3K59 A;  3BU2 A;  1SJH D;  3TN2 A;  4DV1 L;  1UE1 A;  4IJH A;  4A3C H;  2N78 A;  1EQR A;  1JIC A;  2QDB A;  2O2L D;  1HH2 P;  2K4K A;  1PH2 A;  2EYL A;  1E2W A;  2QKI C;  2I5M X;  3F2U A;  2KOL A;  5JJI A;  1CQV A;  1DOM A;  1EOV A;  2NVT H;  3UDF A;  1Q1E A;  2NVT B;  2NZH A;  5J1Z A;  3HKZ E;  1F9Q A;  2JE6 I;  2XWB B;  3NBH A;  5L37 A;  5BN5 A;  2WFW A;  1Q12 A;  3I91 A;  3HOZ G;  2B8G A;  1L0Y B;  5EBD A;  2F0L A;  3H3V C;  2HQL A;  3NE5 B;  2DNC A;  1G6Z A;  4UAI A;  1PTO F;  5LMU Q;  4X65 Q;  1XNQ Q;  3MXG A;  3H3V I;  3S14 H;  2B2W A;  3HS0 C;  3HKZ B;  4C3H G;  4DV5 L;  3DWP A;  3LX0 A;  3NQT A;  2BH2 A;  1DYQ A;  5DAU A;  3S14 B;  4OGQ C;  4LF7 L;  1PTO H;  2LY7 A;  2PI2 A;  1KRT A;  3TRE A;  1PTO B;  2AMC B;  4KKT A;  4JI0 Q;  2CQA A;  2LXK A;  2RA4 A;  4CDE C;  4A3K H;  3IAY A;  3Q0A A;  4A3K B;  4EQN A;  1EU3 A;  3OMG A;  1J5E L;  2VL6 A;  4DGZ A;  1D5Z C;  1HFG A;  4JBW A;  5IY0 A;  2EY2 A;  1RDP D;  4ILW A;  2K6A A;  3H09 A;  3K80 C;  4X6A H;  3PUW A;  1E1T A;  5NUC A;  3G6E A;  4PMC A;  1BCP F;  2R7Z G;  5E3F A;  4BBS H;  1D7Q A;  4X62 Q;  2PW5 A;  2CCZ A;  1PFM A;  3STB D;  2SDF A;  1BCP B;  3T51 B;  3EQL C;  1SNQ A;  1U4P A;  1HXY D;  4XT3 B;  3T13 A;  3D8G A;  1CSQ A;  2L55 A;  4AYB G;  2OEO A;  5CR3 A;  3F8T A;  5D14 A;  2ATW A;  5FLX L;  4JI3 Q;  2XN9 C;  5GRO A;  1NBW A;  4DV3 L;  1LAB A;  2BA0 A;  5FLM G;  4P73 A;  4BA2 I;  4LF9 L;  4A3G H;  4ZKB B;  4DR6 Q;  5KGU A;  1IBL L;  4FXG C;  4PNY A;  4XXE A;  4A3G B;  1E3P A;  1DON A;  4KHV A;  4QY7 A;  4AH6 A;  1N36 Q;  4K0K Q;  4DUZ L;  1FNU A;  4IQZ A;  3BYT B;  1K28 A;  3J80 L;  3G48 A;  1TT2 A;  4ME5 A;  1EUJ A;  1STG A;  3VDY A;  1WTW A;  1VF7 A;  4A93 G;  1UNS A;  3TRZ A;  3OIQ A;  4IAL A;  2E2I H;  5HUR A;  3DLL A;  2EY1 A;  3PSI A;  5BN4 A;  5IGD A;  2B2T C;  4JI7 Q;  4A3J H;  5IYC H;  1Q46 A;  1DJR D;  3I4O A;  1STA A;  1DOK A;  5IGF A;  2UUA L;  4XQJ A;  3AFP A;  2PZW A;  5BN3 A;  3QR8 A;  2NB0 A;  2HCC A;  4FXD A;  2FHT A;  4ZAI A;  5GQO A;  1LTL A;  4EQP A;  1SFO H;  1WTQ A;  2KCN A;  1MGS A;  4MZ9 A;  2VNU D;  1LTG D;  2JA8 G;  3E0E A;  3BVZ A;  1SFO B;  1F77 A;  1EY6 A;  1KC8 C;  5FKA C;  4O2D A;  2JA9 A;  2EVB A;  4JI4 Q;  1AFP A;  4PZ7 A;  1Q90 A;  1HR0 Q;  3TS2 A;  3G6J B;  2OQ0 A;  4Y7N H;  1FGB D;  4Y7N B;  3VR6 A;  2IW3 A;  4UY8 C;  2F0G A;  3AB9 A;  1SND A;  1PDQ A;  4B3S L;  4LF5 Q;  1XXG A;  2B2W C;  2L0C A;  4TRD A;  2Q8R E;  1VQJ A;  3U4V A;  4NP5 A;  4XIG S;  1J9O A;  4JI6 L;  2F4V Q;  1EIG A;  4Z9C B;  2PNH A;  2ZM6 L;  1LO5 D;  1SR3 A;  3PQI A;  3HOY G;  2K50 A;  1AE2 A;  3HOU H;  5IE8 A;  3CRK C;  3HOU B;  2JJQ A;  5IP7 G;  1WFQ A;  4GN3 B;  1ML0 D;  1EFI D;  1C48 A;  3FRP B;  2E74 C;  3F1Z A;  1AW7 A;  3CCS A;  3NWS A;  1OXS C;  4A3M H;  4KY7 A;  1IBM L;  5CYU A;  1D5M C;  4A3M B;  4QUC A;  1MSH A;  4H0L C;  1EEI D;  4P72 A;  3HOW H;  4BY7 G;  1HR0 W;  1QIL A;  2OXP A;  2B63 G;  3HOW B;  3J81 L;  2F4I A;  1FYC A;  2F0N A;  2I5H A;  4JC0 A;  1G2S A;  5IP9 G;  1GUO A;  2JP1 A;  4K8I A;  3Q22 A;  4IFD G;  1EY8 A;  1PV4 A;  1PVO A;  5EQ0 A;  5AJ3 Q;  5I6Y A;  1VQD A;  3I4N G;  2N88 A;  5C5M A;  3OTO Q;  3OPO A;  1SXT A;  1TII D;  1X32 A;  2UUC L;  4LF4 L;  2R93 H;  1LTI D;  4OXP A;  4DKA C;  5T1G A;  1PH3 A;  1STH A;  4TQU S;  2R93 B;  1SYF A;  2OQK A;  1HA6 A;  1NMG A;  1PH8 A;  3RUZ A;  3GQB A;  1JOO A;  2K5V A;  4JW0 A;  1H9K A;  4A3D H;  1VDZ A;  2A69 C;  1DD2 A;  4A3D B;  3DMU A;  5ELD A;  4A3E H;  4ABN A;  1D6E C;  1JE4 A;  5CBA E;  1PTO C;  4A3E B;  5I6W A;  4A3I B;  4B3R L;  1KNE A;  3MEF A;  1CHQ D;  1QG7 A;  3PO3 H;  1HNZ Q;  3T53 B;  1ZXT A;  3GTJ H;  2VUM H;  1EQV A;  5CV5 A;  3PO3 B;  2F0V A;  2LKV A;  3GTJ B;  2VUM B;  5GAE C;  3R2I A;  1TWC H;  5JAV A;  3GTG B;  2A69 D;  2ICE C;  5I2X A;  2VS1 A;  2JSO A;  1TWC B;  1GVP A;  5IYB G;  3BS1 A;  4MHE A;  1CKN B;  1HZ9 A;  1VQN A;  4DR4 Q;  2DJG C;  5IT9 c;  3HOV G;  2IJ0 A;  3FKI G;  5M5X H;  3Q23 A;  1BVS A;  2G9D A;  5D3I B;  3TZD A;  1RCV D;  4MTN A;  5M5X B;  1H9S B;  2F3W A;  3I73 A;  2R61 A;  1S5B D;  2EZV A;  2Q2I A;  1N8R C;  1YJN A;  2UUB L;  1ROD A;  1KHI A;  4CJ2 C;  4MIU A;  2ZXO A;  2K5N A;  1T5E A;  2RSN A;  1EFW A;  1KLG D;  2A68 D;  2JQO A;  1CKM A;  1BCP C;  4JK1 C;  5HY6 A;  2EE1 A;  2IHF A;  3SK4 A;  5KIX A;  1ET6 A;  3ICE A;  2F0M A;  3M4Y A;  3I70 A;  4DK0 A;  3DWA A;  3RLF A;  2LXJ A;  2B2Y C;  4I7A A;  1UEA B;  4IOC A;  4ZLT F;  2TSS A;  1RHP A;  1CHP D;  2R7D A;  4ZKC B;  1XMO Q;  2UU9 Q;  3MXN B;  1U4R A;  4FYD A;  4UP9 A;  2PCF B;  1BDO A;  3CHB D;  3CCQ A;  1IHZ A;  1J8I A;  1QE6 A;  4POG A;  4PMW A;  4AQY Q;  4DAP A;  4FDB A;  4CJ0 B;  5ELE A;  3HOX G;  1YHQ A;  3PUX A;  5A35 A;  4LW1 A;  5D65 A;  4LFB L;  4DF7 A;  3WWV A;  4H7B A;  1XNR Q;  1GUW A;  5IT9 E;  4XYO A;  4BY1 G;  4GNX A;  4GOP B;  1Y8N B;  1V1Q A;  1Y1V G;  5C0X G;  1I5F A;  4ME3 A;  1PH9 A;  2KEC A;  2XVS A;  3BVG A;  4DN4 M;  3SDZ A;  1NE3 A;  4NXN Q;  3E5S A;  4CHT B;  2EJG C;  4A3L G;  1E22 A;  1PFS A;  1N33 Q;  3KYH C;  3C1F A;  4PQX A;  3A56 A;  3OWF A;  3KF6 B;  3A8K E;  1BO0 A;  4QJF A;  5LHY 1;  2A19 A;  3HOZ H;  1B9N A;  1NR4 A;  1VQH A;  4F7X A;  3HOZ B;  4DV0 Q;  4OWT B;  5G3L D;  5IOD A;  2K04 A;  3SEB A;  3K57 A;  1H9S A;  1CFM A;  3NPP A;  2KEE A;  4DXG A;  1QZG A;  2E5L Q;  3F2B A;  1WVL A;  3S1M H;  2RHS B;  2CW0 D;  3S1M B;  2PYK A;  3G7L A;  3N6R A;  4C3H B;  3LGJ A;  3NHH A;  2SOB A;  1YNX A;  4RKL A;  1JR0 D;  4DV1 Q;  2RHQ B;  1I94 L;  3D6C A;  4J15 A;  1X3F A;  1C7Y A;  1W6J A;  1DZ1 A;  1RTN A;  1L0W A;  3SXH A;  5J39 A;  1NR2 A;  1SYC A;  3S1R H;  2Z1C A;  4L5T A;  3GD7 A;  4ZK9 B;  4S3S A;  3S1R B;  1H95 A;  3L2P A;  4G7O C;  4YIJ A;  3EBE A;  4YCW A;  3OW7 A;  5HGT A;  4FF3 A;  2EPB A;  1B2T A;  3QOJ A;  3I2Z A;  2H4O A;  1NMF A;  2NYZ D;  3S1N H;  3M4P A;  4DR2 L;  3QB3 A;  4AYB E;  2R7Z H;  1K3B C;  4TKO B;  4QGU A;  2A8V A;  2R7Z B;  1K8G A;  1SSO A;  2JN4 A;  5C4J B;  3KOJ A;  1KQS A;  3MC0 B;  2UXB L;  2R7F A;  4CGY B;  3Q24 A;  5JPM C;  4LFC Q;  5M3F G;  1S4Z A;  1R4Q B;  2G9H D;  4RGN A;  1YIT A;  3PF5 A;  1CQF A;  3GTL H;  1PZI D;  3KLW A;  2VB2 X;  2M00 A;  4DR5 L;  4DV5 Q;  4YCV A;  2PO4 A;  4AYB B;  3GTL B;  4LF7 Q;  2AWN A;  3KF6 A;  2MHV A;  5FLM H;  4DR7 L;  4FF4 A;  2EYH A;  3CKI B;  1W6K A;  1PH1 A;  5M5W H;  1J5E Q;  1Q82 C;  3H0G G;  2KUM A;  3CCU A;  5J3B A;  5M5W B;  2AWO A;  2MPM A;  3OWE B;  4B9X A;  4HID A;  2NTT A;  3J7Y W;  5C4Z A;  1JOK A;  2B29 A;  1Q81 C;  4A93 H;  5K5P A;  4JI8 L;  1HTP A;  3GTP B;  1RF2 D;  1FJG L;  2F03 A;  5C4X B;  4A93 B;  2YYZ A;  4JV5 L;  2XWJ B;  3DUZ A;  4K2L A;  1LAC A;  5TSS A;  1Q8I A;  3V96 A;  4X3T A;  1ONL A;  1AE3 A;  1LT6 D;  1ASY A;  1CTM A;  1C8C A;  3I3C A;  5JEA G;  2F0S A;  1WYD A;  1KAW A;  3D0F A;  3QIA A;  1XPO A;  5FLX c;  1CA5 A;  5C3W A;  5FO8 B;  1YZ6 A;  4A75 A;  2YTX A;  1I50 H;  3I55 A;  1HUN A;  2BA1 A;  4OX9 L;  1FVI A;  1I50 B;  1KDC A;  4KKU A;  1D2B A;  2JA8 B;  5I9O A;  2B39 A;  3KLR A;  1XYI A;  2B2U A;  2KEN A;  2M9V A;  3IRB A;  2KCC A;  1HRJ A;  1L1O A;  3A55 A;  1X54 A;  2CWA A;  3U9O A;  2QA4 A;  1II3 A;  2NZO A;  3J80 c;  5BR8 L;  1A3U A;  4BS9 A;  4C3J G;  4LF9 Q;  4WJ4 A;  4GZY C;  2MP1 A;  3M9B A;  1IBL Q;  2P5Z X;  3A54 A;  2Z4H A;  1H9R A;  1X3E A;  2PNR C;  2HQE A;  4DUZ Q;  3CC7 A;  3SHL A;  3HG9 A;  1WI5 A;  4M1U B;  3CCM A;  4V19 0;  1SYD A;  1JJ2 A;  2B2V A;  1F2Y A;  1JWU D;  1X65 A;  3W1B A;  1MJE A;  2E5L L;  1QNU A;  4OIJ A;  2JA7 G;  1VQI A;  2FIN B;  1VQG A;  1B50 A;  3WOE A;  5CC4 A;  3VR3 A;  3DEO A;  1EU4 A;  3HOY H;  1PXU A;  2UUA Q;  5FLX E;  2RKS A;  1D5X C;  2BE5 D;  3HOY B;  1DGS A;  1FNW A;  5C3X A;  1PA6 A;  1SYB A;  3UDG A;  5IP7 H;  1HZC A;  4DV6 L;  3FP9 A;  1TS5 A;  1I4H A;  1NAP A;  2IHE A;  4ZRZ A;  1Q7Y C;  3KK7 A;  2XRQ D;  1QOH A;  4FF2 A;  5J22 A;  1Z6H A;  4BXX G;  3J80 i;  2OT2 A;  2WAQ E;  3MXU A;  2PQE A;  1O7I A;  3NUC A;  3J80 E;  4GOP C;  1VQP A;  1D1K A;  1JC7 A;  4GS3 A;  4NDX A;  4BY7 H;  2B63 H;  2VW9 A;  4JBM A;  3H6M A;  1C0A A;  1SLJ A;  3M7N A;  4BY7 B;  2B63 B;  1GHK A;  2K05 A;  4LUZ A;  4JI1 L;  4IFD H;  4B3S Q;  2JEA I;  1DCZ A;  4WOR A;  1SBB B;  3R2T A;  1B3A A;  3HRZ C;  1SRO A;  1PH7 A;  3A5Z B;  1X56 A;  1VMP A;  3I4N H;  4LFC L;  2WAQ B;  1LYL A;  3CC4 A;  3ITP A;  1C4Q A;  2A5H A;  3I4N B;  2EXD A;  4JI6 Q;  1PZK D;  5GAG C;  3VR2 A;  4QIW E;  4P75 A;  2FMM A;  1LUZ A;  2ZM6 Q;  3BZK A;  4HTH A;  3H94 A;  4DAY B;  1HJP A;  4YHH L;  3CC2 A;  3KBX A;  3EFX D;  3NEM A;  5COR A;  1TS2 A;  1A6X A;  2J7Z A;  1HQM C;  4V0B A;  2K52 A;  2YTV A;  1SYG A;  1SE4 A;  2A1A A;  3CMA A;  5DM6 3;  1NCV A;  1S5C D;  1V9P A;  4HED A;  3J81 c;  3M4Q A;  2EIF A;  2Q8I B;  1KD1 C;  4QIW B;  4NB3 A;  4PZ8 A;  1IBM Q;  1U0L A;  1UUP A;  2EJM A;  1L0X B;  1T9H A;  4NMZ A;  3AEV A;  2K01 A;  2LFN A;  2X69 A;  4XYQ A;  3MWY W;  2RBM A;  1O7L A;  1YNJ C;  3AYH B;  4YCU A;  5LL6 S;  2MO0 A;  4KN4 C;  3S1Q H;  4O42 A;  1QWY A;  1CI3 M;  3HOV H;  2NN6 G;  3S1Q B;  3FKI H;  4QUF A;  3S2D H;  1A2U A;  2K5W A;  1P16 A;  3HOV B;  2B2U C;  3FKI B;  3S2D B;  3DEP A;  1TS3 A;  1XJV A;  3QWN A;  2F0J A;  3MTS A;  3DWQ A;  1E7Z A;  1EYG A;  2UUC Q;  4LF4 Q;  2WII B;  3C3L A;  4HJ8 A;  5D3D A;  3ND8 A;  5EAY A;  1YNJ D;  4DAM A;  4K5V A;  1LTS D;  5I4D A;  2AKW B;  4LFA L;  1AH9 A;  2MGS A;  2KVM A;  1A62 A;  3NEN A;  4Q5V A;  1BKB A;  5JPN C;  1JCK B;  5JJK A;  4A3F G;  3MA2 B;  1GOZ A;  3VYU A;  4K2K A;  3J81 E;  3GV6 A;  4PV1 C;  2KED A;  2DN8 A;  1AEX A;  4BBR G;  4B3R Q;  3A7L A;  4KLK A;  3S9W A;  4N9P A;  4CBV A;  1YVC A;  4IUV A;  2GN5 A;  4DNI A;  5C4X G;  3HOX H;  3KUP A;  1C9O A;  3HOX B;  4DAY A;  4TSS A;  3W2D A;  1HUM A;  2UXC L;  3U4Z A;  4BY1 H;  4Y52 H;  2HHH L;  4FVM A;  1Y1V H;  5C0X H;  4BY1 B;  2QDL A;  3P7J A;  5K36 G;  4R8N A;  1H9J A;  1Y1V B;  5KRU A;  1QUQ B;  1A63 A;  1MBY A;  3AMU A;  1U4M A;  3SK5 A;  1MHW C;  2UUB Q;  4A3L H;  3RR5 A;  3CU7 A;  1K8O A;  1EY7 A;  2D0P A;  1JJC B;  3BVM A;  4QB4 A;  4DV7 L;  1KTK A;  5CV9 A;  1V1P B;  1EIF A;  4QMG A;  1ET9 A;  2Q2U A;  3T56 B;  3G4S A;  2D0O A;  2OTJ A;  2D2C C;  2ALY B;  4X3K A;  3GDE A;  4LK1 C;  2WP8 J;  5IGC A;  4DUY L;  3K5L A;  2K5Q A;  3FPU B;  3P1H A;  4DV4 L;  1TWF H;  1YHB A;  2AUJ D;  2ZTD A;  4YY3 L;  3PMF A;  1TWF B;  1B9M A;  1PLF A;  3MFG A;  4LFB Q;  2PZU A;  1A2T A;  2NVX H;  2M2L A;  1KDA A;  2Q2H A;  2NVX B;  1KIX A;  1A15 A;  3TZU A;  1H9M A;  1DM0 B;  1E24 A;  1LM0 A;  3ERO A;  1WOC A;  4R8I A;  1GUT A;  2R6G A;  4O1N A;  1SE8 A;  1HZA A;  1XTC D;  2FXQ A;  1A8V A;  1S72 A;  1AZQ A;  2FFK B;  1YHA A;  2EXZ A;  5C3E G;  3K5N A;  1XPR A;  1K0S A;  3M4O H;  2Q8T A;  1ILP A;  1TWG B;  1N34 L;  1EWC A;  2J0T D;  3M4O B;  4QL5 A;  4B3M L;  1OXV A;  4J8Q A;  2IX3 A;  2O5J C;  2KCM A;  3PIP 3;  5LMN Q;  5M3F H;  4HJ5 A;  4GKK L;  2F0K A;  2I07 B;  1QUQ A;  3K58 A;  5M3F B;  1HZB A;  4JI5 L;  2L1B A;  4CDF C;  3I4M G;  4E6I A;  3PCO B;  4IJL A;  2WAQ G;  1EIY B;  4JI2 L;  2LS0 1;  1CUK A;  1EIH A;  1GKH A;  4MTK A;  3HGB A;  4YWL A;  3U58 A;  1V1P A;  1I94 Q;  2IT1 A;  1AP0 A;  3OIP A;  1VQF A;  1GO3 E;  1EZ8 A;  3PV0 A;  4G7H C;  4RH6 A;  3KJO A;  1EOT A;  4I65 A;  1PRT F;  3NEL A;  2BDO A;  4JYA L;  3H0G H;  3U50 C;  3CCV A;  2DUD A;  4PG3 A;  3R93 A;  1K8A C;  2F52 A;  3H0G B;  4X64 L;  4GNX B;  2CWP A;  1F9P A; 
#chains in the Genus database with same CATH homology
 4APV A;  2RHQ B;  3RZD H;  4J15 A;  2ASB A;  4LF6 L;  1X3F A;  1C7Y A;  3H15 A;  1L0W A;  3S1R H;  5C3E H;  5ELN A;  1N32 Q;  4L5T A;  3GD7 A;  4DR2 Q;  1HNX L;  2ZJQ A;  4JOI C;  4GKJ L;  3EN2 A;  3BU2 A;  1H95 A;  3PIO A;  3L2P A;  4UP7 A;  3GTG H;  3A74 A;  2ES2 A;  3AFQ A;  3CQZ H;  3EBE A;  4YCW A;  3E9I A;  4DV1 L;  2UXB Q;  1UE1 A;  4IJH A;  3M85 A;  4A3C H;  2N78 A;  3I2Z A;  1EQR A;  1V43 A;  1NMF A;  1SN8 A;  1VQ6 A;  1HH2 P;  1Y1W G;  1N32 L;  2K4K A;  1PH2 A;  3M4P A;  2Z6K A;  4DR2 L;  4AYB E;  2R7Z H;  3S1N H;  4QGU A;  2I5M X;  5ELO A;  2A8V A;  3CCJ A;  1K8G A;  3PO2 H;  5JJI A;  4L5Q A;  3KOJ A;  4DR5 Q;  3ER0 A;  1W2B A;  1KQS A;  2N3S A;  2UXB L;  1EOV A;  2R7F A;  1M90 C;  1PHJ A;  2NVT H;  4X66 Q;  4DR7 Q;  4LFC Q;  5M3F G;  3UDF A;  1Q1E A;  2NZH A;  5IYD H;  2OTL A;  3HKZ E;  4C3J H;  1XTD A;  3PF5 A;  1YIT A;  2PMZ E;  4P74 A;  1Q86 C;  4DK3 C;  1YJW A;  2JE6 I;  1SRU A;  2JA6 G;  3GTL H;  2WFW A;  3KLW A;  5IWA Q;  4BBS G;  1SMX A;  4DR5 L;  4YWM A;  4YCV A;  4DV5 Q;  1Q12 A;  3RNU A;  4JG2 A;  3HOZ G;  3S2H H;  2JA5 G;  4LF7 Q;  2AWN A;  3KF6 A;  2E2H H;  1M1K C;  2F3I A;  4A3B H;  2HQL A;  5FLM H;  2Y0S E;  4DR7 L;  2JEB I;  5LMU Q;  4JI8 Q;  4X65 Q;  4LUO A;  4DV2 Q;  1XNQ Q;  2YU9 H;  1FJG Q;  2JA7 H;  3H3V I;  4JV5 Q;  3S14 H;  1PH1 A;  3UE0 A;  4R4T A;  5M5W H;  5IWA L;  1YBY A;  4DV5 L;  2BH2 A;  1WJJ A;  1J5E Q;  1Q82 C;  4LF7 L;  1K83 H;  3H0G G;  3CCU A;  1WCM G;  5J3B A;  2R92 G;  1JE5 A;  2PI2 A;  5IYD G;  2AWO A;  4HID A;  1KRT A;  3TRE A;  3UDX A;  2B29 A;  3PUV A;  1Q81 C;  4A93 H;  5LMU L;  4JI8 L;  2AMC B;  1Z47 A;  4X65 L;  3KDF A;  4DV2 L;  1XNQ L;  4JI0 Q;  2LXK A;  1FJG L;  3T1Y Q;  3E9H A;  4A3K H;  2YYZ A;  4JV5 L;  5DLQ E;  1TWG H;  3T1H Q;  1J5E L;  2VL6 A;  4JBW A;  4OX9 Q;  5IY0 A;  1AE3 A;  4HIK A;  1ASY A;  3A0J A;  3M3Y H;  1PH4 A;  3GO5 A;  4JI3 Q;  1I94 L;  2KHJ A;  5JEA G;  4IFD J;  3FHW A;  3K80 C;  2Q2T A;  1WYD A;  1KAW A;  3D0F A;  4X6A H;  3PUW A;  4H02 A;  1E1T A;  5FLX c;  1XPO A;  4JI0 L;  4A3C G;  4JBJ A;  3T1Y L;  1TXY A;  3G6E A;  2LSS A;  1YZ6 A;  2E2J H;  5BR8 Q;  1P8L A;  2WB1 E;  3B6Y A;  2EQS A;  4A75 A;  3S16 H;  2YTX A;  1I50 H;  4GLA C;  3I55 A;  2R7Z G;  2VZA A;  2BA1 A;  2PQA A;  4A3J G;  4OX9 L;  1FVI A;  1CKO A;  1X3G A;  4LF8 Q;  4BBS H;  3PO2 G;  1D7Q A;  3RN2 A;  2CQO A;  4X62 Q;  5C0X I;  2CCZ A;  2KEN A;  3IRB A;  1VQ9 A;  3STB D;  4DR3 Q;  1L1O A;  3EIV A;  3L0O A;  5LMN L;  4HIO A;  1X54 A;  2CWA A;  2QA4 A;  1UWV A;  2NZO A;  3HKS A;  5BR8 L;  3J80 c;  1JJG A;  4LF9 Q;  1CSQ A;  4WJ4 A;  3M9B A;  1IBL Q;  3HFZ B;  2MNA A;  4AYB G;  3ULL A;  4IFD I;  4LF8 L;  4C3H H;  2NVQ H;  1X3E A;  3F8T A;  4UPA A;  4X62 L;  2ATW A;  3KDF B;  4KHZ A;  3I56 A;  2K5H A;  2VY3 A;  4GN5 A;  3RN5 A;  1ASZ A;  5GRO A;  4DUZ Q;  1NBW A;  2HIV A;  3CC7 A;  4DV3 L;  4DR3 L;  3CCL A;  4A3B G;  1WI5 A;  2IY5 B;  3CCM A;  2BA0 A;  2N49 A;  5FLM G;  1JJ2 A;  4A3G H;  4P73 A;  3S15 H;  4R1J A;  4BA2 I;  3W5O A;  1I6H H;  1YI2 A;  1OXX K;  1X65 A;  3TQY A;  3W1B A;  1MJE A;  2E5L L;  4LF9 L;  1K73 C;  3HKZ G;  1VQI A;  2I0Q A;  4NXM Q;  2VQF Q;  2JA7 G;  1IBL L;  4DR6 Q;  2V1C C;  4DV6 Q;  3PGZ A;  1VQG A;  1VQ8 A;  1E3P A;  3KJP A;  3TS0 A;  4QY7 A;  4AH6 A;  4JI3 L;  1N36 Q;  3HOY H;  4DUZ L;  4K0K Q;  2UUA Q;  4B3T Q;  3DM3 A;  3G48 A;  3VDY A;  1EUJ A;  3CW2 C;  1DGS A;  4A93 G;  2Y0S G;  1PA6 A;  3TRZ A;  2E2I H;  2NVY H;  2PQA B;  5H1S E;  3DLL A;  3UDG A;  1TWA H;  5IP7 H;  2VQE Q;  4A3K G;  1HZC A;  4NXM L;  2QGQ A;  2VQF L;  4DR6 L;  3PSI A;  4DV6 L;  3FP9 A;  3UDI A;  5LMN W;  4AIM A;  2IHE A;  4JI7 Q;  4WJ3 M;  4A3J H;  5IYC H;  5C4J H;  1Q7Y C;  1Q46 A;  1L1O B;  3I4O A;  4JI1 Q;  1N36 L;  4OO1 G;  4K0K L;  3A5U A;  1KXL A;  1NTG A;  2UUA L;  4JOI A;  3AFP A;  1PYB A;  3SGI A;  3J80 i;  4BXX G;  1EWI A;  2N8N A;  2WAQ E;  1O7I A;  4GOP C;  3ERS X;  2HT1 A;  2B3G A;  1VQP A;  2VQE L;  2E8G A;  3K8A A;  1HNW Q;  4GS3 A;  5GQO A;  4BY7 H;  2B63 H;  1LTL A;  1W3S A;  2VW9 A;  1SFO H;  4JBM A;  1C0A A;  1VCI A;  1SLJ A;  4MZ9 A;  1VQE A;  3CME A;  1Q1B A;  1QZH A;  3M7N A;  5HGQ A;  2JA8 G;  4JI7 L;  2VNU D;  4LUZ A;  3E0E A;  4JI1 L;  1PH5 A;  1KC8 C;  2XGT A;  4KI0 A;  4O2D A;  4B3S Q;  2DGY A;  2JA9 A;  2JEA I;  4JI4 Q;  3TEH B;  2GVA A;  4HIM A;  4PZ7 A;  1GM5 A;  1SRO A;  2ZTE A;  1YJ9 A;  4A76 A;  1IZ6 A;  5M3M H;  1HR0 Q;  1PH7 A;  3A5Z B;  1X56 A;  4YHH Q;  3I4N H;  3TS2 A;  4RMF A;  1FGU A;  2OQ0 A;  4X66 L;  4LFC L;  4Y7N H;  1JMC A;  4POF A;  1HNW L;  1LYL A;  3CC4 A;  2XTI A;  1VQL A;  2EXD A;  4A3F H;  2WB1 G;  4JI6 Q;  3S17 H;  5GAG C;  4UY8 C;  5M5Y H;  3J7Z C;  4QIW E;  4B3S L;  4L5R C;  4LF5 Q;  4P75 A;  1VQK A;  4JI4 L;  4A4I A;  4BBR H;  1LUZ A;  1VQM A;  2ZM6 Q;  3BZK A;  1HR0 L;  4DAY B;  1HJP A;  4YHH L;  1IYJ B;  4O0A A;  3CC2 A;  1VQJ A;  3NEM A;  3GTP H;  3J7A 5;  3U4V A;  4XIG S;  5C4X H;  2K52 A;  2YTV A;  5C0X J;  2A1A A;  3CMA A;  4JI6 L;  2YV5 A;  4LWC A;  4A3G G;  5GAD C;  4LNQ A;  2F4V Q;  4QQB X;  1X6O A;  2KBN A;  1QVF A;  1V9P A;  2PNH A;  4LF5 L;  3J81 c;  4GNX C;  1J6Q A;  3I7F A;  2ZM6 L;  1SR3 A;  3KFU A;  3M4Q A;  2EIF A;  1VS0 A;  1EQQ A;  1KD1 C;  3HOY G;  3GTQ H;  4NB3 A;  2K50 A;  4PZ8 A;  1AE2 A;  3HOU H;  4BXX H;  2K14 A;  2BH8 A;  3CPF A;  1U0L A;  4MNO A;  5IE8 A;  1B7Y B;  1IBM Q;  3ULJ A;  1T9H A;  4R4I A;  4R4Q A;  1XMQ Q;  4P71 A;  3AEV A;  4OWW B;  2JJQ A;  1L2F A;  5IP7 G;  2F4V L;  3GTO H;  1WFQ A;  2ID0 A;  3AYH B;  3PUY A;  4YCU A;  4IPD A;  4GN3 B;  3BJU A;  2MO0 A;  1YEZ A;  2JA8 H;  3S1Q H;  3F1Z A;  3T1H L;  1PH6 A;  5IYC G;  3CCS A;  1OXS C;  3JAM c;  3HOV H;  2NN6 G;  4A3M H;  3FKI H;  3S2D H;  2RCN A;  4LFA Q;  1IBM L;  1P16 A;  3CCE A;  3F2D A;  4R4O A;  1NJI C;  4L5S A;  4P72 A;  2JK8 A;  1XMQ L;  2MFI A;  1XJV A;  3HOW H;  2Z0S A;  4JCV E;  1E7Z A;  1BBU A;  1EYG A;  4BY7 G;  1HR0 W;  2B63 G;  1RIP A;  2UUC Q;  4LF4 Q;  4UP8 A;  1S40 A;  5JJL A;  1Z9F A;  4HJ8 A;  4HJA A;  1OXU A;  3H3V H;  4YWK A;  2I5H A;  4JC0 A;  5EAY A;  5IP9 G;  4DAM A;  4IFD G;  1PV4 A;  1PVO A;  2CKZ B;  2AKW B;  2AHO B;  4LFA L;  1AH9 A;  3PIP A;  5AJ3 Q;  1G29 1;  1A62 A;  3NEN A;  5M3M G;  1CKN A;  1BKB A;  1VQD A;  3I4N G;  3CXC A;  2HIX A;  5C44 H;  5JJK A;  3OTO Q;  1VQB A;  3CF5 A;  2UUC L;  1OTC A;  4LF4 L;  2R93 H;  4OXP A;  4A3F G;  4DKA C;  1MJC A;  1PH3 A;  4TQU S;  1I3Q H;  3W1G A;  3OW2 A;  4DPG A;  2OQK A;  1IBK Q;  1NMG A;  4TVA B;  1PH8 A;  2KCT A;  4BBR G;  4B3R Q;  4NPS A;  2UXC Q;  4KLK A;  5AJ3 L;  4OON A;  2K5V A;  2HHH Q;  1YVC A;  1E1O A;  1X55 A;  4A3D H;  1JT8 A;  4JBK A;  2GN5 A;  4GLV B;  4DNI A;  3RLN A;  3HOX H;  5C4X G;  5FJ8 H;  3OTO L;  1UEB A;  3K81 C;  2QEX A;  1C9O A;  1G6P A;  4A3E H;  3OYY A;  3RZO H;  3JAM i;  1K0R A;  1IBK L;  2UXC L;  4B3R L;  2Z6K C;  3MEF A;  1IL2 A;  3U4Z A;  4BY1 H;  4Y52 H;  1KL9 A;  4DV7 Q;  2HHH L;  4B3T L;  3PO3 H;  1U5K A;  3Q8D A;  4OWX B;  1Y1V H;  3GTJ H;  1HNZ Q;  2VUM H;  3HOU G;  1UE6 A;  5K36 G;  1VQ7 A;  3AQQ A;  4GN4 B;  3K0X A;  1QUQ B;  5GAE C;  5GAH C;  1A63 A;  1XPU A;  1TWC H;  3CPW A;  1UE7 A;  1VQO A;  2MO1 A;  2VS1 A;  1NY4 A;  2H5X A;  2UUB Q;  1GVP A;  3RR5 A;  4A3L H;  4EX5 A;  2ZJP A;  2D0P A;  5IYB G;  1CKN B;  1JJC B;  1HZ9 A;  3F2C A;  5IP9 H;  3PUZ A;  4DV7 L;  4DUY Q;  4GNX B;  1VQN A;  4DR4 Q;  1Q8K A;  5IT9 c;  3HOV G;  4A3M G;  1HNZ L;  3FKI G;  4DV4 Q;  4LUV A;  5M5X H;  3I4M H;  4OO1 I;  1BVS A;  1EIF A;  2C35 B;  4IPG A;  2Q2U A;  4MTN A;  4YY3 Q;  1Y14 B;  3G4S A;  3HOW G;  4GOP A;  2D0O A;  1JB7 A;  2Q2I A;  1N8R C;  2OTJ A;  2ALY B;  1YJN A;  1IXR A;  2UUB L;  1D8L A;  1KHI A;  2L15 A;  4C2M H;  3ZJY C;  2K5N A;  4KHP Q;  3GDE A;  1EFW A;  3BZC A;  3L7Z C;  2JQO A;  4DR4 L;  1B8A A;  1CKM A;  2I5L X;  2WP8 J;  4DUY L;  5HY6 A;  2IHF A;  1VQA A;  4PZ6 A;  4DV4 L;  1TWF H;  4C3I H;  1YHB A;  1VQ4 A;  1B70 B;  2ZTD A;  4YY3 L;  3ICE A;  3K7A H;  1KRS A;  3J81 j;  3M4O H;  3RLF A;  5C44 G;  2LXJ A;  4IOC A;  1G51 A;  2K75 A;  2R93 G;  4KHP L;  4LFB Q;  5E7N A;  2NVX H;  2R7D A;  1XMO Q;  5JEA J;  2UU9 Q;  2Q2H A;  3PF4 A;  1KIX A;  3MXN B;  4UP9 A;  4DR1 Q;  3CCQ A;  2ZJR A;  1VQ5 A;  1E24 A;  4POG A;  1LM0 A;  4PMW A;  3GTM H;  1PYS B;  1WOC A;  4AQY Q;  4A3D G;  3RLO A;  1N34 Q;  4FDB A;  4IOA A;  2R6G A;  3HOX G;  1SE8 A;  5FJ8 G;  1YHQ A;  2YTY A;  4RG1 A;  3D31 A;  3PUX A;  4B3M Q;  4LW1 A;  1FL0 A;  1HZA A;  1YIJ A;  4A3E G;  2FXQ A;  4A3I G;  2OCE A;  4LFB L;  1CSP A;  1A8V A;  3WWV A;  3CAM A;  1XMO L;  1R9T H;  1XNR Q;  2UXD Q;  2UU9 L;  1S72 A;  2ZTC A;  5IYB H;  4GKK Q;  1YHA A;  4DK6 C;  4BY1 G;  4DR1 L;  1Y1W H;  5C3E G;  4GNX A;  4GOP B;  1X9N A;  1XPR A;  2IX1 A;  3GTK H;  4JI5 Q;  4AQY L;  3PO3 G;  1V1Q A;  1Y1V G;  5C0X G;  3STB C;  1N34 L;  1I5F A;  2VUM G;  4ME3 A;  1UE5 A;  4JI2 Q;  4QL5 A;  2GVB A;  1PH9 A;  1QVC A;  4B3M L;  1OXV A;  1L1O C;  2RF4 A;  1NE3 A;  4NXN Q;  2KCM A;  1K3R A;  2CFM A;  4GLX A;  2IX0 A;  3K7U C;  3NBH B;  1XNR L;  5LMN Q;  2UXD L;  4A3L G;  5M3F H;  2PI2 E;  1E22 A;  1RL2 A;  1BBW A;  1PFS A;  3UE1 A;  4HJ5 A;  4HJ7 A;  4GKK L;  1N33 Q;  1QUQ A;  3KYH C;  2KHI A;  3KF6 B;  4IO9 A;  4EQ5 A;  1HZB A;  4JI5 L;  2JA6 H;  3I4M G;  3CD6 A;  1A0I A;  4QJF A;  3PCO B;  2OWO A;  4IJL A;  2WAQ G;  1EIY B;  2NN6 I;  2A19 A;  3S24 A;  4JI2 L;  3HOZ H;  4BA1 I;  2JA5 H;  4XTC S;  4JYA Q;  3G71 A;  4NXN L;  1VQH A;  1CUK A;  4IPC A;  1OXT A;  2MQH A;  4DV3 Q;  1GKH A;  4DV0 Q;  3KF8 B;  4OWT B;  4YWL A;  3J81 i;  3U58 A;  3JC6 6;  4X64 Q;  2D62 A;  1I94 Q;  1N33 L;  2IT1 A;  1S3O A;  1VQF A;  1QZG A;  1GO3 E;  2E5L Q;  3PV0 A;  3F2B A;  1K9M C;  4LF6 Q;  4ALP A;  3KJO A;  3S1M H;  1N9W A;  2RHS B;  1QVG A;  3NEL A;  3ULP A;  1HNX Q;  1MKH A;  4IPH A;  4R4C A;  4JYA L;  3H0G H;  3U50 C;  3CCR A;  1MIU A;  1WCM H;  3CCV A;  2R92 H;  1GD7 A;  1VQC A;  4HJ9 A;  4GKJ Q;  2DUD A;  1TWH H;  3LGJ A;  4PG3 A;  2F52 A;  4DV0 L;  1K8A C;  3CP0 A;  4X64 L;  4A3I H;  4DV1 Q;  1YNX A;  2CWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...