4LF6L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf6L00
5IWAQ 3DLLA 1VQ4A 5FJ8G 1SFOH 1Q86C 2XTIA 2VQEQ 1N34Q 1XMQQ 1A62A 4QL5A 1QVCA 1HZ9A 4LWCA 4GNXC 4X64Q 1PH7A 1K9MC 2WAQG 2ATWA 4JV5L 5HGQA 1KC8C 2EXDA 5M5YH 1HZBA 4DR7Q 1K8GA 3CD6A 5IP9G 1QUQA 1CKMA 4X65Q 4AQYL 1NY4A 4OX9Q 4JI5L 3I4OA 4C2MH 4A3IH 1XMOL 2CFMA 1J6QA 2ZM6Q 5ELOA 1OXXK 4O0AA 5J3BA 2R93H 1IXRA 3NBHB 4GS3A 2ALYB 1A63A 3T1YQ 4UY8C 1QVFA 1TWHH 2KCTA 1Q12A 4B3MQ 3CCEA 4K0KQ 1R9TH 2K5VA 4LUOA 3G71A 5GROA 4A3LH 2E5LQ 2CKZB 3K80C 2PQAA 1UEBA 4P71A 4PZ8A 4UP8A 2VQEL 4DV5L 1UE6A 4HJ9A 3UDIA 1EWIA 3A74A 5M5WH 5LMNL 1PH3A 2BA1A 4JI0L 1WCMH 4DV4Q 4YWLA 4UP7A 2R7DA 4JI8L 2ZJPA 1K83H 5C4XG 1HH2P 1VQCA 1Q81C 3I4MH 1YHQA 4JBWA 1VQ7A 1X65A 2UXCL 1VS0A 4LFCL 5JEAG 4DR3L 4A3JG 5C4XH 1X9NA 3S14H 1OTCA 2A19A 3D0FA 4PZ7A 2QEXA 4GKJL 4A93H 3TREA 5AJ3L 1PYBA 1E7ZA 5C4JH 2AKWB 3H0GG 3UDFA 3F2CA 2PMZE 3TQYA 1Z47A 3T1HL 2JA5H 4DV7L 1EIFA 1XJVA 4QQBX 2F4VQ 1JJCB 5C0XG 2KBNA 3GTMH 4PZ6A 1E1TA 1KAWA 5HY6A 5FLXc 1GO3E 2ZJRA 3AEVA 4DNIA 3CC7A 4DUZQ 1NMFA 3U4ZA 3OTOL 4MZ9A 1IYJB 3HOVG 1JT8A 1HZCA 1PA6A 3PUZA 1I6HH 3ULLA 1XMQL 1EYGA 4DR4L 4LF6L 1NE3A 4A3FH 3HOWG 1FJGQ 4LW1A 1U5KA 3TEHB 4X66L 4TQUS 2ZTEA 1Y1WG 2MO1A 4JV5Q 1PYSB 1AE2A 3RLNA 5C44H 1N36Q 2LXKA 3BZKA 2JA7G 4IJLA 3S2DH 1HNWL 1C0AA 1H95A 1LUZA 1OXUA 2OQ0A 4ME3A 4YCWA 2VQFQ 1WFQA 3IRBA 5C0XI 4DV3Q 4DV2L 1D7QA 3M9BA 1VQKA 1GD7A 3HKZG 4LF9Q 3FKIG 2JA6G 1UE5A 4O2DA 2VW9A 4R4IA 2ZM6L 2R7ZG 1OXSC 3CCLA 2KENA 4P72A 4L5TA 2B29A 5FJ8H 1KQSA 3PUWA 4DV5Q 1VQ9A 1SROA 4LFBL 1X55A 2RHQB 2FXQA 2B3GA 3CP0A 2NVTH 3OTOQ 4IOCA 3J7A5 5LMNQ 3AFQA 3I4NH 2BH2A 2Q2HA 5LMUQ 2UXDL 2IT1A 2JA9A 1T9HA 4GNXB 1I50H 4DAYB 2CCZA 1WI5A 3KYHC 2RCNA 4JOIA 4LF8L 1VQIA 2UUBL 2UUCQ 2E2JH 2ZTCA 3KJPA 1VCIA 4LF9L 1Y1VH 3EN2A 1LYLA 2MNAA 3U58A 4A3MH 2OTLA 4A3BH 2VL6A 4HIKA 1L2FA 3OYYA 4JI1Q 2QGQA 1PV4A 1U0LA 1AH9A 4GN5A 4A93G 4NB3A 2AWOA 2F3IA 4A3JH 1QZGA 1YJNA 2YU9H 4LFBQ 1HNZQ 1SLJA 1L1OA 1YHAA 2R7FA 1N8RC 3PO3G 2K75A 3D31A 3J81i 2MFIA 1W2BA 4B3SQ 3A5ZB 3BU2A 1TWAH 3AYHB 1VQ6A 3CCUA 1N33Q 4GLXA 4MNOA 5C44G 1HNXQ 2I5HA 1L1OC 2I5MX 2Q2IA 4BA2I 4A3CG 2YTVA 1KIXA 1YZ6A 3W1GA 4LF8Q 3LGJA 3RN5A 1PH1A 3CC2A 2E8GA 2QA4A 1RIPA 4GKJQ 3GTLH 1CKOA 5C3EG 1E22A 1S3OA 4EQ5A 2VUMH 4A3CH 4RMFA 2YTYA 4UPAA 1HR0L 1VQ8A 4WJ3M 2LSSA 1X6OA 5LMNW 5JJKA 3HFZB 2R92G 1GM5A 1VQBA 2VQFL 4DV2Q 2A8VA 3M4PA 3S1NH 4YHHQ 3VDYA 3GTKH 3S1QH 4JI3Q 1YHBA 3L7ZC 4BBRH 1NMGA 4OO1I 1P8LA 2GVAA 3JC66 2JQOA 2K5NA 1V9PA 1KXLA 4HJ5A 4X6AH 4OWTB 1NJIC 2IX0A 3MXNB 3MEFA 5LMUL 1N33L 2UXDQ 3CCVA 2K50A 3GTGH 3E0EA 1HNXL 3TS2A 4GOPC 2IHFA 4B3RL 5M5XH 4IPCA 1PH2A 4HIDA 1KL9A 2B63G 1X3GA 5JEAJ 4HIOA 1VQOA 4R4TA 2JA7H 2HIXA 3J80c 1YITA 3G6EA 3I7FA 4PG3A 3PV0A 1FGUA 4LF4L 2I0QA 1KD1C 4XIGS 3I4NG 3PO2H 4JI4L 4P75A 2UXBL 4JI7Q 3CCMA 2V1CC 1OXVA 3GTJH 4JOIC 3KDFB 1CUKA 4R4OA 1N36L 4JBKA 1HNWQ 1UE7A 1EFWA 2C35B 3ULPA 2XGTA 1VQHA 1IBMQ 1ASYA 3STBC 4A76A 1HNZL 4C3HH 4LF7Q 4JI1L 2KHIA 3PO3H 3S15H 4EX5A 3GO5A 1G51A 3M4OH 1ASZA 4Y7NH 1S72A 1SE8A 2JJQA 1EUJA 1YVCA 2YYZA 2OWOA 3NEMA 5H1SE 4B3TL 3CCSA 2NVYH 3H15A 2JA8H 1A8VA 3F2DA 1Y1WH 4P73A 2OQKA 3KDFA 4GN4B 3S2HH 1Y1VG 2ID0A 2K52A 4DV6Q 2B63H 1QUQB 4BBSH 3M4QA 3FKIH 4IJHA 1YNXA 5IE8A 3K8AA 4KHPL 3UE1A 2N3SA 1BBWA 3PIPA 1EQRA 5M3FH 4X62L 2ZTDA 3KLWA 1NTGA 1YIJA 1Q82C 1MKHA 1VQFA 1SN8A 2Z6KC 3JAMc 3JAMi 3PGZA 3M85A 2WB1E 4HJAA 1VQ5A 2HHHQ 2Q2UA 4NXNQ 5AJ3Q 1XPUA 4IFDI 4A4IA 4AQYQ 3U4VA 5C3EH 2VNUD 4OWXB 5IYBH 1OXTA 4BXXH 5GAHC 2OTJA 3CPFA 4H02A 2RHSB 3FHWA 2CQOA 4J15A 4QIWE 1QVGA 1WJJA 2PQAB 5E7NA 4R4QA 2F52A 3KJOA 3HOVH 4P74A 1K3RA 4L5QA 2K4KA 3PF4A 2BA0A 2D62A 1AE3A 2UUAQ 2JA6H 3HOYG 3BZCA 4QGUA 1N9WA 3I4MG 4LUZA 1PH4A 3TRZA 3UDXA 1Q1EA 1VQEA 5IYCG 1JE5A 1JB7A 3ZJYC 4YCUA 2NN6I 2K5HA 5IYDH 1D8LA 4LFAQ 4A3MG 1GVPA 1CSPA 1XMOQ 4IOAA 2E2IH 3PF5A 4DV4L 4DK3C 2JEBI 5IYDG 4LF4Q 2JEAI 4IPHA 1V43A 4NXNL 3W1BA 2N8NA 1I94L 2R7ZH 1MIUA 4DUYL 1PFSA 1X56A 3TS0A 3RLOA 3PCOB 3J81j 4JC0A 4DR3Q 4LFCQ 2AHOB 3E9HA 1PH9A 4BY7H 3S24A 2WB1G 4DR1L 4TVAB 4JI2L 1KRTA 3K81C 4OONA 1HR0W 4GKKQ 1BKBA 1LTLA 1WCMG 1C7YA 2UUAL 1Q8KA 4A3KH 4JI0Q 4BY1G 3M7NA 2Z6KA 3T1HQ 4DR5L 4IO9A 2E2HH 2DUDA 3PIOA 3A0JA 1S40A 1J5EQ 1FVIA 1SR3A 5GADC 4NXMQ 4JI4Q 3GD7A 2UXBQ 3L2PA 1KRSA 4DR2Q 1N32L 5M3FG 2K14A 4LF5Q 2A1AA 1Y14B 3U50C 1WYDA 4R4CA 2R93G 3WWVA 3F2BA 1I94Q 1PH5A 4IFDG 4MTNA 2UUBQ 2VZAA 3J7ZC 4GNXA 4DAMA 2HHHL 4YY3L 1UWVA 3CMEA 4JYAL 4DV1L 5C0XJ 1I3QH 2HIVA 4C3IH 3CMAA 4JI5Q 3H3VH 4RG1A 1E3PA 3PSIA 4A3FG 2ES2A 1BVSA 2D0PA 4KLKA 1BBUA 1IBKL 3CXCA 2PI2A 4YWKA 3BJUA 5IT9c 1FL0A 4GLAC 4APVA 2JK8A 2Y0SG 4DUZL 4LF7L 2N49A 1QZHA 1B8AA 4DKAC 4LUVA 1IL2A 4R1JA 2UU9L 3GTPH 1VQDA 4AH6A 2GVBA 2I5LX 1NBWA 3HOXH 4POFA 1J5EL 4LF6Q 5IWAL 5IYBG 4BXXG 5IY0A 3I56A 4DV6L 2JA5G 1B7YB 3J80i 3GTOH 1LM0A 2DGYA 4DR6L 5K36G 3HOXG 5EAYA 2ASBA 4A3IG 5GAGC 3M3YH 2GN5A 2R92H 1CSQA 4BA1I 3RNUA 1XNQL 4X65L 3CQZH 3E9IA 3S1MH 1SRUA 1HR0Q 3B6YA 5BR8Q 3I2ZA 3CCJA 4KHPQ 4IFDJ 4A3GH 3STBD 3ER0A 4X62Q 1KHIA 3G4SA 3SGIA 5IP7G 1PH6A 1EOVA 2EIFA 4A3EG 3PUXA 3S1RH 4QY7A 3G48A 1UE1A 4A75A 3ULJA 1L0WA 2VS1A 1JJGA 1CKNB 3KF8B 4A3EH 4A3DH 1CKNA 4L5RC 4A3BG 2EQSA 4B3TQ 3ERSX 2CWPA 3HOWH 1JMCA 1K8AC 3CC4A 1O7IA 3W5OA 4GOPA 3UE0A 2H5XA 2NZOA 1IBLL 1XNRL 3AFPA 3OW2A 2JE6I 1Q7YC 2UUCL 4WJ4A 2LXJA 2WP8J 3HOZH 1X3EA 3S17H 2Q2TA 1YJWA 3GTQH 4ALPA 4NPSA 3Q8DA 4LF5L 2VY3A 4JI6Q 4LFAL 3I55A 3CF5A 2UXCQ 4X64L 4JI7L 3PUVA 4DV3L 4DR7L 4IPDA 4PMWA 4LNQA 2PI2E 3ICEA 1IBKQ 2RF4A 4OO1G 4DV1Q 4JBMA 1Q46A 2MO0A 3NELA 3AQQA 5FLMH 3A5UA 5JJLA 3F8TA 1XPOA 4K0KL 3HOUG 1VQAA 1MJCA 1JJ2A 4KHZA 1TWFH 2PNHA 4OX9L 3H0GH 1EQQA 2BH8A 5FLMG 4DV7Q 4JBJA 4DR5Q 4DR1Q 1K73C 1M1KC 3KFUA 1TWGH 2Y0SE 4IPGA 1L1OB 1IZ6A 1K0RA 4NXML 4DV0Q 1VQJA 2KCMA 1C9OA 5GAEC 2NVQH 2R6GA 1N34L 4L5SA 1N32Q 4YWMA 3RN2A 5DLQE 2Z0SA 3EIVA 4GLVB 1E1OA 2WAQE 4A3LG 2E5LL 4YCVA 4AYBG 3KF6B 2ZJQA 1YI2A 1XNQQ 4A3GG 4DR6Q 4AYBE 1FJGL 2IHEA 2HT1A 4DR2L 4AIMA 4HJ7A 3HOYH 3KOJA 1V1QA 1WOCA 3K0XA 4YHHL 4POGA 1YJ9A 1G291 4DK6C 3F1ZA 3RZOH 1XTDA 3CCQA 1EIYB 3S16H 2NVXH 5BR8L 4YY3Q 4GN3B 4JYAQ 3T1YL 3RLFA 5M3MG 1RL2A 4A3KG 1W3SA 1Q1BA 1PVOA 5IP9H 2HQLA 4HJ8A 4A3DG 3PO2G 1VQLA 2F4VL 3K7AH 2JA8G 1PHJA 4FDBA 4JI2Q 1XPRA 4B3RQ 4JG2A 2NZHA 5GQOA 2KHJA 4DV0L 3CAMA 4B3ML 1SMXA 1VQNA 3HKSA 3RZDH 1VQMA 4DPGA 2L15A 3HOUH 2NN6G 1VQPA 5JJIA 4JCVE 5ELNA 1PH8A 4B3SL 2UU9Q 1E24A 3FP9A 1IBLQ 1YEZA 4C3JH 4QJFA 3H3VI 3CCRA 4JI8Q 2IX1A 4UP9A 4HIMA 4DR4Q 3PUYA 1P16A 3NENA 1TWCH 2IY5B 1G6PA 4X66Q 2D0OA 3K7UC 2AWNA 1X54A 1Z9FA 1XNRQ 1YBYA 1HJPA 2MQHA 1GKHA 5IP7H 5M3MH 4BBRG 1HZAA 5IYCH 3KF6A 1IBML 4JI6L 3GDEA 4BY7G 1MJEA 2CWAA 3L0OA 4GOPB 2OCEA 4DUYQ 1M90C 1X3FA 1VQGA 2YV5A 2VUMG 1DGSA 2N78A 4XTCS 3UDGA 3DM3A 3CPWA 4BBSG 1A0IA 4JI3L 1B70B 4BY1H 4KI0A 1TXYA 3RR5A 1I5FA 3J81c 4GKKL 2AMCB 3EBEA 4OWWB 2YTXA 3CW2C 4OXPA 3HKZE 2WFWA 3HOZG 4Y52H
chains in the Genus database with same CATH superfamily
5IWAQ 2F0WA 5FJ8G 1N34Q 1XMQQ 1K28A 1T5XD 1VF7A 4P2CB 4XYQA 1BXTA 3MAQA 2EYFA 4JV5L 5HGQA 3V05A 2EXDA 1HZBA 4TSSA 5C3EB 2MHVA 1PLFA 1SEBD 5IP9G 1CKMA 1NAPA 4XQJA 4AQYL 1DOKA 1NR4A 3IFDA 1JR0D 2ZM6Q 1OXXK 1STGA 2R93H 3H0GB 1A63A 4UY8C 1TWHH 4KMUC 3S1QB 3H3VC 2RDGA 3KBXA 3G71A 1TY2A 4KY7A 4P71A 4UP8A 4DV5L 1CFMA 2VQEL 1AN8A 4XQQA 3UDIA 1EWIA 3A74A 5LMNL 1WCMH 5IGBA 4DV4Q 3I70A 1ESRA 3QG1A 4HAEA 5C4XG 3HG9A 1Y8OB 3EFXD 1Q81C 2UXCL 4A3JG 2F0JA 4PZ7A 2F0SA 5ISRA 1TS4A 1JWMD 1GHKA 1E7ZA 1YNJD 1AZQA 2AKWB 2CH4A 1KLUD 3UDFA 1LTGD 3TP8A 3F2CA 2IJ0A 1Z47A 2G5DA 2F4VQ 1JJCB 4K5WA 2B2WC 5HY6A 1GO3E 4XT3B 4DNIA 4DUZQ 1PDQA 3OTOL 1IYJB 5JVG3 1HZCA 1DJRD 3ULLA 3I3CA 2NWGA 1EYGA 4DR4L 1NE3A 2WKCA 3BVGA 1HTLD 4X66L 3SXHA 5C44H 4IJLA 5D3DA 1OXUA 4ZK9B 5E4WC 3U9OA 4DV2L 5C0XI 4H13C 3M9BA 1WTRA 4FF2A 2F0LA 3VYTA 3MTSA 2JA6G 5E3FA 2XIWA 5CC4A 1XYIA 1EY6A 3CCLA 1SMYC 4L5TA 1KQSA 1SROA 2Q8TA 2FXQA 1F9PA 3VYRA 3HOYB 1VMCA 3I4NH 4ODGA 2UXDL 2JA9A 3E6ZX 3NWSA 4DAYB 4TKOB 1O7YA 1STAA 4LMQD 1Y1WB 2UUCQ 1RTOA 3VR2A 1V1PB 2F1MA 4LF9L 2R92B 2Q8RE 2B2TC 4HIKA 1NNXA 3OYYA 3GTLB 3HKZB 5JAVA 1AH9A 2WIIB 2WB1B 2AWOA 3MZ5A 4KY5A 1L1OA 3DWQA 3KBGA 1F2ZA 3A7LA 3J81i 1U4MA 1STHA 2PW7A 3C1FA 1I6HB 5EKLA 3T51B 4GLXA 3FVQA 2WKDA 4KTAA 2YTVA 3CQZB 1KIXA 2WAQB 5A2QL 3LGJA 4LF8Q 3CC2A 1QG7A 2QA4A 4J8QA 1CKOA 3O13A 3TSSA 1MSGA 1DONA 5E4XA 1GM5A 2G9DA 1ILPA 3S1QH 1HXYD 2EVBA 4GZYC 1TWAB 2JN4A 2ZT9C 3JC66 4RGMA 2K5NA 1F9RA 3TZDA 1V9PA 2DNEA 4OWTB 2C5CA 2CW0D 5LMUL 1B3AA 3CCVA 3GTGH 3TS2A 5KEEA 4B3RL 3R8BA 1KL9A 2B63G 5JEAJ 2JA7H 2F0TA 4A3IB 1WTOA 3I7FA 1PRTD 5IGCA 2I0QA 1KD1C 1EY5A 2UXBL 2RCFA 4J1MA 2V1CC 1AW7A 1CUKA 4R4OA 4JBKA 4CDFC 2ZXRA 3LWUA 3MHBA 3CKIB 2F3VA 2PZUA 3CU7A 2RVLA 4JI1L 2A5HA 2FJ2A 3GO5A 1G51A 1ASZA 2M2LA 1BO0A 4XYOA 3I91A 1XXGA 3S1RB 2JJQA 1YVCA 3NEMA 3CCSA 1ENAA 2NVYH 3D3RA 5JOBA 5K5PA 1J9OA 4P73A 3KDFA 3HGBA 5FK9C 1Y1VG 2K5DA 4DV6Q 3M4QA 1AZPA 4G4KA 3UE1A 1EQRA 4LK1C 1PZKD 4XDXA 5CBEE 3QOLA 1NTGA 2J7ZA 2A6ED 1RJTA 1SN8A 2Z6KC 5C0XH 3PGZA 2L12A 2HHHQ 4NXNQ 2QDBA 5IYBH 2RHSB 1QVGA 3KJOA 2VB2X 1ZXTA 2V4DA 2Z9HA 3OSOA 1N9WA 3K7AB 1PH4A 2LS01 1IW7C 5IYCG 2BDOA 1JB7A 1I4RA 3TP6A 2ENBA 2R93B 1CSPA 1CZWA 3MXGA 2JEAI 2B2WA 2EE1A 4X3UA 1V43A 1WTHA 1MIUA 4RGTA 1EEID 4DR3Q 2DY7A 2H4OA 1HPCA 1LV9A 3S24A 3V96A 1QILA 2Y0SB 2IPKD 3K81C 1C48A 1WCMG 2UUAL 1Q8KA 2EYLA 5CYUA 4IO9A 2DUDA 1S40A 1FVIA 4NXMQ 1TT2A 3GD7A 4DR2Q 3QJYA 1Y14B 2EYOA 5D3IB 2EYMA 1G91A 1WYDA 4R4CA 3F2BA 3BDOA 3SE0A 2UUBQ 5I9PA 3LNNA 5FLXL 4GNXA 3T56B 4C3IH 4RG1A 4KLKA 1XTCD 1BBUA 1BQQT 1IBKL 4YWKA 3BJUA 3C2PA 3N6RA 1B8AA 2A68C 2NVXB 4LUVA 3GTPH 3NXWA 4POFA 4BXXG 5IY0A 2JA5G 2K33A 3J80i 1LM0A 2H1EA 4DR6L 1EY4A 1CQFA 2ASBA 1VDZA 2KUMA 1PTOC 3TMEA 1KNEA 2OEOA 4X65L 3E9IA 4B9WA 1SRUA 1OO9B 1HR0Q 2BCOA 4TRDA 1D1IA 2L9HA 3STBD 1HQRD 4FVMA 4WRDA 3S1RH 1A15A 4DAPA 5FKAC 4A3EH 2TSSA 4A3BG 3HOWH 2MPMA 5FLXE 4G7OC 2A69D 1JMCA 1D5XC 1O7IA 1BUVT 3J7AF 1CM9A 2PCFB 2DJFC 4GOPA 2H5XA 3P1HA 4PNYA 3OW2A 1EU4A 4A3GB 3DEOA 3HZXA 2R3ZA 4RHRA 4ALPA 2FHTA 2VY3A 2ZXOA 1B50A 1EFID 1F77A 4LNQA 1JICA 3OIQA 4MTKA 5M3MB 1PXUA 1IBKQ 4A3KB 4OO1G 4G57A 4DV1Q 4JBMA 1DD2A 3NELA 4N8FA 2Z4HA 1XPOA 5EKKA 1SJED 1EQQA 5FLMG 1GUOA 3SK6A 4JBJA 1EWCA 3AB9A 1QNKA 1H9JA 5GAEC 5EQ0A 2NVQH 5COYA 1N32Q 1LTTD 4L5SA 3I4MB 1EIGA 4YWMA 3EIVA 2WAQE 1DYQA 1YI2A 3K6OA 2XVSA 3HOWB 3HOYH 4DR2L 4HJ7A 2B39A 1E2WA 2F0NA 1TWCB 1ML0D 1JCKB 2WINB 1EIHA 2EYPA 3FKIB 1PVOA 4A3DG 3PO2G 4FDBA 1XPRA 4Z9CB 4B3RQ 1VQNA 2KHJA 3KF8A 3JAME 5IODA 4RCNA 5JJIA 1MBYA 5ELNA 3VYUA 4B3SL 2JYOA 3IAYA 4JI8Q 2IX1A 4HIMA 4DR4Q 3NENA 2IY5B 3RZOB 2OF1A 2D0OA 1XNRQ 1X54A 5EGTA 2EDGA 4WFN3 1S4ZA 5IP7H 4JW0A 3K5MA 4V0BA 4MN3A 1ZYRD 2SOBA 1MJEA 4GOPB 1M90C 4A3FB 1I4PA 2VUMG 2N78A 3RD4A 4BBSG 2F0OA 1K8OA 4KI0A 2A73B 1TXYA 3RR5A 2DN8A 1I5FA 4GKKL 4UHVA 5IGEA 3EBEA 1IYUA 3CW2C 3Q23A 2X6LA 2EY2A 1Z7TA 3HOZG 1SE4A 5I2XA 3DLLA 1VQ4A 2C9OA 1U4RA 2VQEQ 2A74C 2E2IB 5ELCA 4J6HA 1PH7A 4X64Q 3J80E 1BOSA 2K04A 3NP8A 1K9MC 2ATWA 1SNQA 4C3IG 1IKMA 4DR7Q 2B2UA 1JOKA 1JC7A 1QUQA 3E0JA 5K36H 1JOQA 4BY7B 2XNAC 3I4OA 4A3IH 1XMOL 2F0QA 4O0AA 4GS3A 3T1YQ 1H9MA 1Q12A 1G8ZD 1R9TH 1L0XB 2K5VA 3K80C 2J0TD 3VR6A 4F87A 5CV6A 3WDNA 4DXFA 5M5WH 3HOVB 4JI0L 3NBIA 3QIAA 1TS3A 1VQ7A 2LY7A 4DR3L 2NZ1D 3S14H 2A19A 3D0FA 5BN3A 4GKJL 2PMZB 5KNCA 2R7ZB 2ZXPA 3H0GG 4RGOS 1B2TA 2PMZE 1ICFB 1YNJC 2JA5H 4DV7L 4C3JG 1XJVA 5C0XG 2B2YA 3A55A 3EJIA 5FLXc 5M9OA 5C3WA 4HMIA 1V1OA 2DJGC 3U4ZA 3HS0C 4MZ9A 1I6HH 1XMQL 3G6JB 3CRLC 2F03A 1M8AA 1FJGQ 4TQUS 4CHTB 2ZTEA 2F0IA 3R93A 3RLNA 1AE2A 1N36Q 1X3PA 2JA7G 4A3JB 1LUZA 2VQFQ 3GTQB 2KECA 3IRBA 4DV3Q 1GD7A 5D65A 5J22A 1UE5A 2VW9A 4R4IA 2KQ3A 2B29A 4DV5Q 5HURA 1X55A 2RHQB 5EBDA 3CP0A 3OMGA 2L11A 3SDZA 5LMNQ 5C44B 4K6LA 3AMUA 3K5NA 2CCZA 3NQTA 2F3WA 2KEEA 2WV6D 4JVZA 1EY9A 3KUPA 2ICIA 2UUBL 3KLRA 2PZWA 4C1NI 1Y1VH 3EN2A 1F9SA 4A3BH 5I6YA 2VL6A 3S2HB 5CBAE 3FDTA 1QJOA 2JSOA 4IUVA 2JA6B 2M00A 1LT3D 4A3JH 2F3IA 3C3LA 1YJNA 1HNZQ 1LTRD 3MC0B 2R7FA 5FO8B 1N8RC 4NP5A 3D31A 3A8IE 2MFIA 1DCZA 1TQOA 4CKEA 3SK8A 4B3SQ 1ZEQX 3AYHB 3CCUA 1GUTA 4ZAIA 1HNXQ 2AUJD 2BDNA 3RZDB 2I5MX 2D2CC 2B2YC 3BDLA 4A3CG 3GTPB 1YZ6A 3W1GA 3RN5A 2E8GA 2FINB 1RIPA 3GTLH 3NSWA 4IALA 2VUMH 5T1IA 2KOLA 2B8GA 4UPAA 1HR0L 2F0GA 1TIID 1LT5D 3HFZB 2R92G 3G7LA 1VQBA 3A7AB 4YHHQ 3MVVA 3GTKH 1YHBA 3L7ZC 4BBRH 2O5IC 3U9SA 4RWSC 2HD3A 3SVMA 4RKLA 4X6AH 1PFNA 1ZKOA 3D4RA 2IX0A 1LTSD 3MEFA 3CHBD 2A6HC 2UXDQ 2K50A 3E0EA 3OPOA 2IHFA 5M5XH 4IPCA 1PH2A 4HIDA 1O7ZA 1VQOA 4HIOA 3ERQA 3T16A 4LF4L 4X3TA 3I4NG 3PO2H 3CCMA 4QB4A 2AQ3B 4JOIC 1N36L 5JJZA 1UE7A 3VA5A 2RDHA 3J81E 3OW7A 1IBMQ 3BDCA 3HP3A 3STBC 1HNZL 2EYJA 3PO3H 1FNUA 4HEDA 3EA6A 2B2UC 1PTOH 2M9VA 4C3HB 2YYZA 1EUJA 2RQXA 1FNVA 5ELDA 2SDFA 1V1PA 1SYCA 2EZVA 4KD4A 3X3MA 2JP1A 1QUQB 4BBSH 4OGQC 1STNA 1D2BA 1G2TA 3PIPA 4DAYA 2ZTDA 1PTOF 4MIUA 1Q82C 5IIFA 3Q0AA 1C0AA 3WOFA 1QE6A 2WB1E 4IFDI 1XPUA 1LT4D 1KLGD 2A6EC 2VNUD 1YNND 5GAHC 4LAAA 1LLRD 4QIWE 3FHWA 2E2HB 4EQPA 3DEPA 2FFKB 2PQAB 4HR7B 5M5WB 3HOVH 3NHHA 3W3AA 4KJNA 2K4KA 2QEJC 2D62A 3P20A 2WACA 2UUAQ 2A6HD 3M4OB 3BZCA 2EY1A 4LUZA 1Q1EA 3IL8A 2XSCA 4DFAA 3ZJYC 5M3FB 1RCVD 5IYDH 1D8LA 4R8IA 4A3MG 1GVPA 1XMOQ 3PF5A 1JB3A 4DK3C 2JEBI 4FXKC 2CH4W 2GA4B 3TP7A 4KY6A 1X56A 3PCOB 3J81j 4JC0A 4LFCQ 5EKIA 3E9HA 4NW2A 4TVAB 4GKKQ 5LL6S 5J1ZA 1SJHD 1PRTC 3M7NA 2Z6KA 1G6ZA 1SYBA 3T1HQ 2F0KA 4DR5L 1O78A 2E2HH 3FMCA 1J5EQ 5GADC 3IKJA 4LF5Q 1QOHA 2A1AA 3KLSX 2R93G 1I94Q 1CT1D 4MTNA 2VZAA 2K32A 2HHHL 2VB3X 1Q90A 3CMEA 2XRQD 1KTKA 4PMCA 3GTKB 4JYAL 1I3QH 1KDCA 2EJFC 3H3VH 1A2TA 4A3EB 1CHQD 4IUTA 4APVA 2JK8A 2Y0SG 4DUZL 2N49A 2OT2A 1IL2A 5F2DA 2I5LX 4WORA 4IURA 5IWAL 5IYBG 1BNZA 1NCVA 1R9TB 3HOXG 3C46A 4ZYSA 5GAGC 2R92H 1CSQA 1XNQL 1R4QB 3CQZH 4H7BA 5BR8Q 3I2ZA 4U673 1KAAA 4X62Q 1KHIA 3SGIA 5IP7G 1CA5A 3DWAA 3PUXA 3MEHA 3W2DA 3LWEA 1SNPA 3OIPA 4A3DH 2EQSA 3OWEB 4B3TQ 1X3QA 2CWPA 3ERSX 2Z8LA 1UUPA 1I6VC 1DZ1A 1K8AC 3CC4A 1ILQA 3W5OA 4O42A 3UE0A 2JA5B 1IBLL 2DY8A 1Q7YC 2JE6I 1DOLA 2UUCL 2LXJA 3HOZH 3VA7A 1X3EA 2SNSA 1YJWA 3Q8DA 4JI6Q 1CK1A 4RKBA 5IGFA 2UXCQ 4DU9A 4X64L 4RH6A 4M8AA 1CZGA 1I50B 1SNOA 2RSNA 2KCCA 1RD9D 3D6WA 3PUVA 4DV3L 1FGBD 2RF4A 3S1MB 1Q46A 3AQQA 5JJLA 3ND8A 3F8TA 3TBIB 1CQVA 1JJ2A 4KHZA 1TWFH 2PNHA 2BH8A 1SNDA 3MXUA 1B44D 4B9XA 1M1KC 4F88A 3S1NB 2R6GA 1N34L 3BVMA 4GLVB 1WTWA 4AYBG 2CQAA 2QDLA 3QOJA 3X3NA 4A3GG 4DR6Q 4AYBE 4CJ0B 2HT1A 4BBRB 1WOCA 4BS9A 3TN2A 5C4JB 1O80A 2K01A 2KCNA 4K2KA 1XTDA 4I65A 4OEMB 4CJ1B 2E2DC 1PZID 3CCQA 1EIYB 4YY3Q 4JYAQ 3KLSA 3RLFA 1RL2A 3A8JE 3SHLA 5M3MG 2I07B 4A3KG 5IP9H 2HQLA 2O5JC 1EYAA 1PHJA 4JI2Q 2B2VC 5GQOA 4DV0L 2Q8IB 3EVQA 4B3ML 1TS5A 4BY1B 4DPGA 3HOUH 4K8IA 2NN6G 4ZRZA 1VQPA 1PH8A 4FNFA 1E24A 4C3JH 4KD3A 2TMPA 3PUYA 1TWCH 5BN5A 4C2MB 1DM0B 4KV6A 2MQHA 1GKHA 1JWSD 3RMHA 1ZYRC 2KJXA 4IUUA 1X3FA 2YV5A 3BVZA 5E1FA 3UDGA 3DM3A 3CPWA 1JORA 1A0IA 4JI3L 1B70B 1SYGA 3GV6A 5JPMC 4Q0FA 3J81c 1I4XA 2D5DA 4OWWB 2YTXA 1LTBD 1K3BC 4OXPA 3EROA 2WFWA 2RBMA 4Y52H 4V190 3S15B 1Q86C 1EYCA 2XTIA 1HZ9A 4LWCA 2KEDA 3A56A 2PNRC 2WAQG 1KC8C 5M5YH 5DM73 2R61A 4XXEA 4X65Q 1K8GA 5HGTA 1I4QA 3P75A 1NY4A 4OX9Q 4C2MH 2CFMA 2XN9C 3HRZC 5EPJA 1J6QA 2D9UA 3SEBA 3GTMB 2IWHA 3NBHB 1MGSA 2ALYB 5CMDA 2KCTA 4B3MQ 1AP0A 3CCEA 1RHPA 1LACA 3LX0A 3T13A 2SNMA 1F2LA 2E5LQ 2PQAA 1UE6A 5I4DA 4ZKBB 4OL7A 4L6TB 2NTTA 2B63B 3OWFA 4YWLA 4UP7A 1SBBB 2ZJPA 2F0VA 3J7AV 1SFOB 3P7JA 4CKCA 1BDOA 4C3IB 3I4MH 4LFCL 2X69A 1VMPA 1GUGA 5C4XH 2L5TA 4K6DA 2BE5D 1HA6A 3EQLC 5C4JH 1GOZA 3GTMH 1KAWA 4NDXA 3AEVA 3CC7A 5I2YA 3HOVG 1JT8A 1PA6A 4JPBW 2G9HD 4LF6L 1Y1VB 4LW1A 3TEHB 1TVXA 4JV5Q 1PYSB 4ZKCB 2EJGC 2LXKA 3BZKA 3S2DH 1SAPA 2OQ0A 4ME3A 2F0UA 1WFQA 4LF9Q 2ZM6L 1PTOD 2R7ZG 1U4LA 1WTXA 2JA8B 1U9RA 2Z6BA 4DNRB 1BCPF 2SEBD 3VR3A 4P72A 3PUWA 2NVTH 3OTOQ 4IOCA 3J7A5 5C6AA 2Q2HA 2IT1A 1T9HA 4GNXB 1I50H 5CV9A 3A8KE 5IT9E 1WI5A 1ET9A 3KYHC 5KNDA 2RCNA 4JOIA 4RA8A 4LF8L 1VQIA 5KNBA 1DXMA 1UAPA 4KKSA 1ONLA 1LYLA 4A3MH 1L2FA 5C5LA 2QGQA 1PV4A 2MP1A 4GN5A 4IUPA 4A93G 2IX3A 1B3QA 1WCMB 4EGVA 1PRTF 1H9SA 3PO3G 3A5ZB 1H9RA 1B1ZA 1Z6HA 2EYHA 1EY7A 1PFMA 5C44G 1S5BD 2I5HA 3T53B 1L1OC 5C5MA 1PH1A 5C3EG 4ZUIA 4XT1B 4PQXA 4RMFA 2YTYA 4WJ3M 2ICEC 2N88A 1IYVA 2LSSA 1GHJA 1HA5A 1X6OA 2RSOA 4DV2Q 3M4PA 4DF7A 3S1NH 1EY8A 1PRTB 3NQIA 1SNMA 3AU7A 4JI3Q 2HUGA 2QF7A 4OO1I 2JQOA 5EPLA 1TY0A 1KXLA 1EZ8A 4EQNA 2NTSA 1SSOA 3QR8A 1N33L 4X3SA 4ABNA 3PIO3 1A2UA 1PMRA 3BG3A 4H0LC 3I73A 2E2JB 5C4XB 1A3UA 1TR5A 4PG3A 3TDQA 1B9NA 3ITPA 2Z4IA 4P75A 4CGYB 5CORA 3GTJH 4IUQA 3KDFB 1RF2D 2FMMA 4IN3A 1NSNS 1IKLA 2XGTA 3K5LA 2EY6A 4KKUA 1ASYA 2F0PA 2KHIA 1JWUD 3S15H 2B2TA 5ELFA 3M4OH 4YIJA 4Y7NH 4FF4A 1S72A 1D6EC 2OWOA 5H1SE 2KVMA 1K0SA 2QCPX 4CDCC 1A8VA 3F2DA 3PMFA 1Y1WH 1ESFA 1D5MC 3I4LA 3J81L 2A68D 2VXWA 2E74C 4IJHA 3FKIH 1HUNA 4KN7C 3K8AA 4KHPL 2N3SA 1BBWA 2I46A 4X62L 1ET6A 4HCSA 3S9WA 1EQTA 1VQFA 3JAMi 4LFBL 3JAMc 3M85A 1VQ5A 2Q2UA 4AQYQ 3U4VA 2OXPA 1BR9A 1OXTA 2OTJA 4J15A 1FR3A 5NUCA 5E7NA 2NYZD 4UDUC 4B08A 5ELEA 4C3HG 2BA0A 2RDFA 2JA6H 3HOYG 2XWJB 2CW0C 3I4MG 1TWGB 1JE4A 3TRZA 1RDPD 1VQEA 3UDXA 1SXTA 4KN4C 4UAIA 1EL0A 4YCUA 2JXMB 2K5HA 1YNNC 4LFAQ 3K57A 5C3XA 4IOAA 1VF5C 1J8IA 4DV4L 1HTPA 4LF4Q 4IPHA 5EBCA 3W1BA 4NXNL 1Y8PB 2XWBB 2R7ZH 1ICWA 4I7ZC 3PQIA 4NKLA 4DUYL 1CTMA 3TS0A 5BN4A 3RLOA 3FPPA 2AHOB 2WB1G 4DR1L 4OONA 2EJMA 1BKBA 1HQMC 1C7YA 1UEAB 4A3KH 4JI0Q 4IUNA 3MXPA 4L8JA 3A54A 3GV3A 3NE5B 2K28A 1SYFA 1SR3A 4FP5D 4JI4Q 3S16B 2L1BA 4ULLA 1N32L 5M3FG 1B4OA 1CI3M 5JVH3 4DAMA 4YY3L 1UWVA 3I90A 3HEJA 1S5DD 2NBFA 4JI5Q 3CMAA 1E3PA 3PSIA 4A3FG 2ES2A 1BVSA 2O2LD 2PI2A 5IGDA 1SYDA 5IT9c 4LF7L 1KNAA 1QZHA 4DKAC 4R1JA 1VQDA 2GVBA 1NBWA 3HOZB 3CRKC 4Y7NB 4LF6Q 2L55A 2B8FA 1D5ZC 4DV6L 1B7YB 1F2MA 1IHZA 2EPBA 3PIP3 5K36G 5A35A 4A3IG 3M3YH 3NTIA 3RNUA 3L9AX 3S1MH 3D6CA 3B6YA 4IFDJ 1FNWA 4KHPQ 2PO4A 3G4SA 4S3SA 4EQOA 2EIFA 4FF3A 4A3EG 3IFTA 4QY7A 1WTPA 2VS1A 1BCPC 1CKNB 3KF8B 2Z1CA 3QB3A 3K58A 1IW7D 2NZOA 1XNRL 3AFPA 4WJ4A 1KDBA 2PZTA 1Q8IA 2WP8J 3ND9A 1LO5D 3HOXB 3S17H 1XWEA 2PPBC 3H94A 3J7YW 4LFAL 1GUNA 1MSHA 4DR7L 3ICEA 4FF1A 5FLMH 5C4HA 2K6AA 1SE3A 4K0KL 3HOUG 2K05A 1MJCA 4OX9L 2PQEA 4FO2A 4DV7Q 4C3JB 4QMGA 4DR1Q 1K73C 1TU2B 3KFUA 1TWGH 2Y0SE 4IPGA 3DUZA 1IZ6A 1K0RA 4DV0Q 1VQJA 2KCMA 1C9OA 2F0FA 5C4ZA 2YU9B 3RN2A 2NVQB 3K5OA 3KF6B 1XNQQ 2L0CA 1FJGL 2IHEA 2DNCA 4AIMA 1V8QA 5FO9B 1V1QA 4YHHL 4POGA 3QWNA 1YJ9A 3V2TA 4DK6C 3F1ZA 1GUSA 1EZ6A 3S17B 2NVXH 1LABA 4DA2A 1STBA 2LMCB 5DM63 4HJ8A 3J80L 2EY5A 3R3OA 3SR1A 4JG2A 2NZHA 3CAMA 3HKSA 3RZDH 1VQMA 2L15A 1I4HA 2HDMA 4CDDC 2UU9Q 3FP9A 1IBLQ 1YEZA 1KDAA 4QJFA 3CCRA 4HTHA 1S5CD 3GTJB 1P16A 1RTNA 1G6PA 1T5EA 3NPPA 3K7UC 5CR3A 2AWNA 4K2LA 2QW7A 3I72A 4BBRG 1HZAA 5IYCH 1IBML 4JI6L 1H9KA 3GDEA 2AQ1B 2CWAA 1MHWC 1Q3LA 2OCEA 4DUYQ 4XTCS 3SK4A 2F0DA 4RCOA 2N55A 1CHPD 3MA2B 3HKZE 3H0GH 2J4XA 5IGGA 5KGUA 3M4YA 3JAML 1SFOH 1LTID 1EEFD 1A62A 4QL5A 4QIWB 1QVCA 4GNXC 1Y8NB 2RA4A 5KYLA 5G3LD 3CD6A 3K0YA 1PZJD 4KJOA 4JI5L 5ELOA 5J3BA 1IXRA 3D4DA 1TS2A 4OIKA 1QVFA 1BF4A 4FXGC 2NVYB 3DHQA 2NB0A 4K0KQ 4K8JA 1HUMA 3MXNA 4LUOA 5GROA 3BYYB 4A3LH 2CKZB 4PZ8A 2CVRA 1UEBA 5EPKA 4PV1C 4ZQ3A 5M5YB 5I9OA 4HJ9A 1PH3A 2BA1A 2R7DA 3C1EA 4JI8L 1O7LA 1STEA 3KK7A 1K83H 2QKIC 4IZ8A 1I3QB 1HH2P 1VQCA 4JBWA 1PYWD 1SMYD 1X65A 2E76C 1VS0A 2E75C 5JEAG 2MUYA 1EWHA 4I7AA 1X9NA 1OTCA 2QEXA 4WJWA 3URYA 3K59A 4A93H 3TREA 5AJ3L 1PYBA 5D14A 3NUCA 4HN7A 3BZDB 2F0HA 3TQYA 3E3XA 3T1HL 4QQBX 1EIFA 4M1UB 4KHVA 2KBNA 1KABA 4PZ6A 1E1TA 2ZJRA 2K1BA 2O4XA 4DGZA 1NMFA 1STYA 3FPUB 4OELB 3PUZA 3E5SA 1WVLA 1IL8A 5IT9L 4A3FH 3HOWG 4ZLTF 1U5KA 5LL6X 1Y1WG 2MO1A 1HNWL 1H95A 4YCWA 1D7QA 1EU3A 3T4AC 3HKZG 2P5ZX 4F8MA 1VQKA 3FKIG 1EOTA 1SDFA 4O2DA 1OXSC 3FRPB 2KENA 5TSSA 5FJ8H 1VQ9A 4ZUJA 4OO1H 5J39A 2B3GA 4XQNA 3GP7A 3AFQA 4ILWA 2BH2A 5LMUQ 4KKTA 1GXDC 3VYSA 3NWTA 4DNTB 3MWYW 4JK1C 2BOSA 3GTOB 4G7ZC 2E2JH 2ZTCA 3F2UA 3KJPA 1VCIA 3DWPA 2MNAA 3U58A 2VUMB 2OTLA 1Y69U 4JI1Q 4BBSB 2HCIA 1WD1A 1U0LA 1S5FD 4NB3A 4LFBQ 1QZGA 2YU9H 4FYDA 1SLJA 1YHAA 4LJZC 2A69C 2K75A 2QILA 1W2BA 4EVOA 4K5VA 1I4GA 1EQVA 1TWAH 3BU2A 1RODA 2B2VA 3OMCA 1VQ6A 1N33Q 5G3LF 4N9TA 4MNOA 4NMZA 3OHXC 3DMUA 5KRUA 2Q2IA 4QCLA 1RKNA 4BA2I 4IFDH 4RFBA 4GKJQ 1E22A 4R9WA 1S3OA 4EQ5A 4A3CH 3L3OC 1S5ED 1BBXC 1VQ8A 1GUWA 2K7VA 1SE2A 5LMNW 5JJKA 5FO7B 2VQFL 4CJ2C 2A8VA 3VDYA 1WTQA 5KIXA 1C4QA 1A3TA 4BWGB 1NMGA 1R4PB 2K5WA 1P8LA 1MI2A 2XRSD 4HJ5A 4ZCKA 2X6GA 1II3A 1NJIC 4DK0A 4X3KA 4H44C 5M5XB 3MXNB 3WOEA 3PO3B 1X32A 1QNUA 4CBVA 1HNXL 4GOPC 1FD7D 1SNCA 1X3GA 1E2VA 4R4TA 1HHVA 2HIXA 3J80c 3SK5A 1YITA 1EY0A 3G6EA 3PV0A 1FGUA 5JPNC 4RGNA 4XIGS 4JI4L 1BCPD 3I8ZA 4JI7Q 4QF4A 1OXVA 1HNWQ 5L37A 1EFWA 1F9QA 2C35B 3ULPA 1VQHA 3FEWX 4C1NK 1E0BA 4A76A 3Q22A 1H9SB 4C3HH 4LF7Q 4EX5A 1HCZA 1CA6A 1SE8A 4B3TL 4FXDA 3H15A 1D1KA 2JA8H 3D8GA 1PTOB 3ZYYX 4ME5A 2OQKA 2CHBD 4GN4B 4CKBA 4DN4M 3S2HH 2ID0A 2K52A 2HQEA 2B63H 3R2TA 3BYTB 1YNXA 5IE8A 2JA7B 3Q6SA 5M3FH 1AFPA 3KLWA 4OHJA 1YIJA 1MKHA 5DNFA 5IOCA 4HJAA 2K5QA 1HFNA 1B53A 5AJ3Q 4U68A 4A4IA 5C3EH 2L4NA 4OWXB 4BXXH 3CPFA 2MGSA 4H02A 1UNSA 2CQOA 3S14B 5CV4A 1WJJA 4R4QA 1B9MA 2F52A 4P74A 1K3RA 4L5QA 4RHSA 3H6MA 3PF4A 4Q5VA 1AE3A 4QGUA 1E2ZA 5JEAH 1JE5A 3NTKA 4AYBB 2NN6I 5CV5A 4G7HC 4PMBA 2LKVA 2E2IH 1HFGA 5IYDG 4ID6A 1K8MA 3M3YB 2N8NA 1I94L 5FOBB 1PFSA 2NN6H 1WD0A 3DXJC 3VR4A 5A2QE 1PH9A 4BY7H 3ONAB 1LT6D 2F0EA 4HCEA 1KRTA 4JI2L 1JQYD 1HR0W 1LTLA 3H91A 3NTHA 4KK7A 4HMJA 1NUCA 1K83B 4BY1G 5CV8A 1TWHB 4MHEA 1TWFB 1ENFA 3PIOA 3A0JA 2UXBQ 5KYIA 3L2PA 1KRSA 3S2DB 2K14A 3U50C 3WWVA 1PH5A 3OOCA 4IFDG 3J7ZC 4DV1L 5C0XJ 2HIVA 1HRJA 1SYEA 2D0PA 2IW3A 2RKSA 4OIJA 3CXCA 1MD2D 4DXGA 2AQ2B 1FL0A 4GLAC 3UI2A 4A3BB 5LHY1 2UU9L 1LTAD 1QCBD 4AH6A 4F7XA 3NBHA 3HOXH 1J5EL 1C8CA 3I56A 3GTOH 4RAUC 3RUZA 2DGYA 3VR5A 4N8X1 5EAYA 1FYCA 1F2YA 1PFBA 5DAUA 2GN5A 3H09A 2LFNA 4BA1I 3I4NB 1XX8A 1DOMA 4K5XA 3CCJA 4A3GH 3ER0A 1PH6A 1EOVA 1A6XA 5CV7A 1U4PA 1UE1A 3G48A 4A75A 3ULJA 2NUCA 2EXZA 1L0WA 1JJGA 1TKWB 1CKNA 1JOOA 1WTVA 4L5RC 3Q24A 2PW5A 4QUCA 3GQBA 5ELBA 1QWYA 3N52A 1L0YB 4O1NA 2Q2TA 1M4VA 4K14A 1A3VA 3GTQH 1W6JA 2K03A 4NPSA 4LF5L 5DEHA 3I55A 3CF5A 1EYDA 3DM1A 1AEXA 4JI7L 3BS1A 4IPDA 4PMWA 2PI2E 1G2SA 2MO0A 4R8NA 3A5UA 4A3DB 2F4IA 3PO2B 2NVTB 2EOTA 1VQAA 3R2IA 4DR5Q 4CDEC 4DK1A 2FMCA 3D4WA 1L1OB 4NXML 1QB5D 5DLQE 2Z0SA 4HSVA 1E1OA 4A3LG 2E5LL 5I6WA 4YCVA 3MFGA 3TP5A 4C56C 2ZJQA 4A3MB 5EJWA 3QO2A 4IQZA 3KOJA 5AFWA 3K0XA 1G291 2PYKA 3TZUA 3RZOH 3S16H 2MJ8A 5BR8L 5T1GA 1ENCA 2BE5C 4GN3B 2KHSA 3T1YL 1W3SA 1Q1BA 1W6KA 1VQLA 2F0MA 3K7AH 2F4VL 2HCCA 2IL8A 2JA8G 3HOUB 1SMXA 2KA7A 4JCVE 3M7GA 3H3VI 1BCPB 4QUFA 1NR2A 4UP9A 3MFYA 2HDLA 4X66Q 4E6IA 1Z9FA 3GTGB 1YBYA 1HJPA 3NK9A 2AUKA 5M3MH 3KF6A 4BY7G 3L0OA 5CGKA 1VQGA 1DGSA 4HSPA 4BY1H 4A93B 4DAVA 4N9PA 2AMCB 4L63B 1YHQA 2GVAA 1GJXA
chains in the Genus database with same CATH topology
5IWAQ 3DLLA 1VQ4A 5FJ8G 1SFOH 1Q86C 2XTIA 2VQEQ 1N34Q 1XMQQ 1A62A 4QL5A 1QVCA 1HZ9A 4LWCA 4GNXC 4X64Q 1PH7A 1K9MC 2WAQG 2ATWA 4JV5L 5HGQA 1KC8C 2EXDA 5M5YH 1HZBA 4DR7Q 1K8GA 3CD6A 5IP9G 1QUQA 1CKMA 4X65Q 4AQYL 1NY4A 4OX9Q 4JI5L 3I4OA 4C2MH 4A3IH 1XMOL 2CFMA 1J6QA 2ZM6Q 5ELOA 1OXXK 4O0AA 5J3BA 2R93H 1IXRA 3NBHB 4GS3A 2ALYB 1A63A 3T1YQ 4UY8C 1QVFA 1TWHH 2KCTA 1Q12A 4B3MQ 3CCEA 4K0KQ 1R9TH 2K5VA 4LUOA 3G71A 5GROA 4A3LH 2E5LQ 2CKZB 3K80C 2PQAA 1UEBA 4P71A 4PZ8A 4UP8A 2VQEL 4DV5L 1UE6A 4HJ9A 3UDIA 1EWIA 3A74A 5M5WH 5LMNL 1PH3A 2BA1A 4JI0L 1WCMH 4DV4Q 4YWLA 4UP7A 2R7DA 4JI8L 2ZJPA 1K83H 5C4XG 1HH2P 1VQCA 1Q81C 3I4MH 1YHQA 4JBWA 1VQ7A 1X65A 2UXCL 1VS0A 4LFCL 5JEAG 4DR3L 4A3JG 5C4XH 1X9NA 3S14H 1OTCA 2A19A 3D0FA 4PZ7A 2QEXA 4GKJL 4A93H 3TREA 5AJ3L 1PYBA 1E7ZA 5C4JH 2AKWB 3H0GG 3UDFA 3F2CA 2PMZE 3TQYA 1Z47A 3T1HL 2JA5H 4DV7L 1EIFA 1XJVA 4QQBX 2F4VQ 1JJCB 5C0XG 2KBNA 3GTMH 4PZ6A 1E1TA 1KAWA 5HY6A 5FLXc 1GO3E 2ZJRA 3AEVA 4DNIA 3CC7A 4DUZQ 1NMFA 3U4ZA 3OTOL 4MZ9A 1IYJB 3HOVG 1JT8A 1HZCA 1PA6A 3PUZA 1I6HH 3ULLA 1XMQL 1EYGA 4DR4L 4LF6L 1NE3A 4A3FH 3HOWG 1FJGQ 4LW1A 1U5KA 3TEHB 4X66L 4TQUS 2ZTEA 1Y1WG 2MO1A 4JV5Q 1PYSB 1AE2A 3RLNA 5C44H 1N36Q 2LXKA 3BZKA 2JA7G 4IJLA 3S2DH 1HNWL 1C0AA 1H95A 1LUZA 1OXUA 2OQ0A 4ME3A 4YCWA 2VQFQ 1WFQA 3IRBA 5C0XI 4DV3Q 4DV2L 1D7QA 3M9BA 1VQKA 1GD7A 3HKZG 4LF9Q 3FKIG 2JA6G 1UE5A 4O2DA 2VW9A 4R4IA 2ZM6L 2R7ZG 1OXSC 3CCLA 2KENA 4P72A 4L5TA 2B29A 5FJ8H 1KQSA 3PUWA 4DV5Q 1VQ9A 1SROA 4LFBL 1X55A 2RHQB 2FXQA 2B3GA 3CP0A 2NVTH 3OTOQ 4IOCA 3J7A5 5LMNQ 3AFQA 3I4NH 2BH2A 2Q2HA 5LMUQ 2UXDL 2IT1A 2JA9A 1T9HA 4GNXB 1I50H 4DAYB 2CCZA 1WI5A 3KYHC 2RCNA 4JOIA 4LF8L 1VQIA 2UUBL 2UUCQ 2E2JH 2ZTCA 3KJPA 1VCIA 4LF9L 1Y1VH 3EN2A 1LYLA 2MNAA 3U58A 4A3MH 2OTLA 4A3BH 2VL6A 4HIKA 1L2FA 3OYYA 4JI1Q 2QGQA 1PV4A 1U0LA 1AH9A 4GN5A 4A93G 4NB3A 2AWOA 2F3IA 4A3JH 1QZGA 1YJNA 2YU9H 4LFBQ 1HNZQ 1SLJA 1L1OA 1YHAA 2R7FA 1N8RC 3PO3G 2K75A 3D31A 3J81i 2MFIA 1W2BA 4B3SQ 3A5ZB 3BU2A 1TWAH 3AYHB 1VQ6A 3CCUA 1N33Q 4GLXA 4MNOA 5C44G 1HNXQ 2I5HA 1L1OC 2I5MX 2Q2IA 4BA2I 4A3CG 2YTVA 1KIXA 1YZ6A 3W1GA 4LF8Q 3LGJA 3RN5A 1PH1A 3CC2A 2E8GA 2QA4A 1RIPA 4GKJQ 3GTLH 1CKOA 5C3EG 1E22A 1S3OA 4EQ5A 2VUMH 4A3CH 4RMFA 2YTYA 4UPAA 1HR0L 1VQ8A 4WJ3M 2LSSA 1X6OA 5LMNW 5JJKA 3HFZB 2R92G 1GM5A 1VQBA 2VQFL 4DV2Q 2A8VA 3M4PA 3S1NH 4YHHQ 3VDYA 3GTKH 3S1QH 4JI3Q 1YHBA 3L7ZC 4BBRH 1NMGA 4OO1I 1P8LA 2GVAA 3JC66 2JQOA 2K5NA 1V9PA 1KXLA 4HJ5A 4X6AH 4OWTB 1NJIC 2IX0A 3MXNB 3MEFA 5LMUL 1N33L 2UXDQ 3CCVA 2K50A 3GTGH 3E0EA 1HNXL 3TS2A 4GOPC 2IHFA 4B3RL 5M5XH 4IPCA 1PH2A 4HIDA 1KL9A 2B63G 1X3GA 5JEAJ 4HIOA 1VQOA 4R4TA 2JA7H 2HIXA 3J80c 1YITA 3G6EA 3I7FA 4PG3A 3PV0A 1FGUA 4LF4L 2I0QA 1KD1C 4XIGS 3I4NG 3PO2H 4JI4L 4P75A 2UXBL 4JI7Q 3CCMA 2V1CC 1OXVA 3GTJH 4JOIC 3KDFB 1CUKA 4R4OA 1N36L 4JBKA 1HNWQ 1UE7A 1EFWA 2C35B 3ULPA 2XGTA 1VQHA 1IBMQ 1ASYA 3STBC 4A76A 1HNZL 4C3HH 4LF7Q 4JI1L 2KHIA 3PO3H 3S15H 4EX5A 3GO5A 1G51A 3M4OH 1ASZA 4Y7NH 1S72A 1SE8A 2JJQA 1EUJA 1YVCA 2YYZA 2OWOA 3NEMA 5H1SE 4B3TL 3CCSA 2NVYH 3H15A 2JA8H 1A8VA 3F2DA 1Y1WH 4P73A 2OQKA 3KDFA 4GN4B 3S2HH 1Y1VG 2ID0A 2K52A 4DV6Q 2B63H 1QUQB 4BBSH 3M4QA 3FKIH 4IJHA 1YNXA 5IE8A 3K8AA 4KHPL 3UE1A 2N3SA 1BBWA 3PIPA 1EQRA 5M3FH 4X62L 2ZTDA 3KLWA 1NTGA 1YIJA 1Q82C 1MKHA 1VQFA 1SN8A 2Z6KC 3JAMc 3JAMi 3PGZA 3M85A 2WB1E 4HJAA 1VQ5A 2HHHQ 2Q2UA 4NXNQ 5AJ3Q 1XPUA 4IFDI 4A4IA 4AQYQ 3U4VA 5C3EH 2VNUD 4OWXB 5IYBH 1OXTA 4BXXH 5GAHC 2OTJA 3CPFA 4H02A 2RHSB 3FHWA 2CQOA 4J15A 4QIWE 1QVGA 1WJJA 2PQAB 5E7NA 4R4QA 2F52A 3KJOA 3HOVH 4P74A 1K3RA 4L5QA 2K4KA 3PF4A 2BA0A 2D62A 1AE3A 2UUAQ 2JA6H 3HOYG 3BZCA 4QGUA 1N9WA 3I4MG 4LUZA 1PH4A 3TRZA 3UDXA 1Q1EA 1VQEA 5IYCG 1JE5A 1JB7A 3ZJYC 4YCUA 2NN6I 2K5HA 5IYDH 1D8LA 4LFAQ 4A3MG 1GVPA 1CSPA 1XMOQ 4IOAA 2E2IH 3PF5A 4DV4L 4DK3C 2JEBI 5IYDG 4LF4Q 2JEAI 4IPHA 1V43A 4NXNL 3W1BA 2N8NA 1I94L 2R7ZH 1MIUA 4DUYL 1PFSA 1X56A 3TS0A 3RLOA 3PCOB 3J81j 4JC0A 4DR3Q 4LFCQ 2AHOB 3E9HA 1PH9A 4BY7H 3S24A 2WB1G 4DR1L 4TVAB 4JI2L 1KRTA 3K81C 4OONA 1HR0W 4GKKQ 1BKBA 1LTLA 1WCMG 1C7YA 2UUAL 1Q8KA 4A3KH 4JI0Q 4BY1G 3M7NA 2Z6KA 3T1HQ 4DR5L 4IO9A 2E2HH 2DUDA 3PIOA 3A0JA 1S40A 1J5EQ 1FVIA 1SR3A 5GADC 4NXMQ 4JI4Q 3GD7A 2UXBQ 3L2PA 1KRSA 4DR2Q 1N32L 5M3FG 2K14A 4LF5Q 2A1AA 1Y14B 3U50C 1WYDA 4R4CA 2R93G 3WWVA 3F2BA 1I94Q 1PH5A 4IFDG 4MTNA 2UUBQ 2VZAA 3J7ZC 4GNXA 4DAMA 2HHHL 4YY3L 1UWVA 3CMEA 4JYAL 4DV1L 5C0XJ 1I3QH 2HIVA 4C3IH 3CMAA 4JI5Q 3H3VH 4RG1A 1E3PA 3PSIA 4A3FG 2ES2A 1BVSA 2D0PA 4KLKA 1BBUA 1IBKL 3CXCA 2PI2A 4YWKA 3BJUA 5IT9c 1FL0A 4GLAC 4APVA 2JK8A 2Y0SG 4DUZL 4LF7L 2N49A 1QZHA 1B8AA 4DKAC 4LUVA 1IL2A 4R1JA 2UU9L 3GTPH 1VQDA 4AH6A 2GVBA 2I5LX 1NBWA 3HOXH 4POFA 1J5EL 4LF6Q 5IWAL 5IYBG 4BXXG 5IY0A 3I56A 4DV6L 2JA5G 1B7YB 3J80i 3GTOH 1LM0A 2DGYA 4DR6L 5K36G 3HOXG 5EAYA 2ASBA 4A3IG 5GAGC 3M3YH 2GN5A 2R92H 1CSQA 4BA1I 3RNUA 1XNQL 4X65L 3CQZH 3E9IA 3S1MH 1SRUA 1HR0Q 3B6YA 5BR8Q 3I2ZA 3CCJA 4KHPQ 4IFDJ 4A3GH 3STBD 3ER0A 4X62Q 1KHIA 3G4SA 3SGIA 5IP7G 1PH6A 1EOVA 2EIFA 4A3EG 3PUXA 3S1RH 4QY7A 3G48A 1UE1A 4A75A 3ULJA 1L0WA 2VS1A 1JJGA 1CKNB 3KF8B 4A3EH 4A3DH 1CKNA 4L5RC 4A3BG 2EQSA 4B3TQ 3ERSX 2CWPA 3HOWH 1JMCA 1K8AC 3CC4A 1O7IA 3W5OA 4GOPA 3UE0A 2H5XA 2NZOA 1IBLL 1XNRL 3AFPA 3OW2A 2JE6I 1Q7YC 2UUCL 4WJ4A 2LXJA 2WP8J 3HOZH 1X3EA 3S17H 2Q2TA 1YJWA 3GTQH 4ALPA 4NPSA 3Q8DA 4LF5L 2VY3A 4JI6Q 4LFAL 3I55A 3CF5A 2UXCQ 4X64L 4JI7L 3PUVA 4DV3L 4DR7L 4IPDA 4PMWA 4LNQA 2PI2E 3ICEA 1IBKQ 2RF4A 4OO1G 4DV1Q 4JBMA 1Q46A 2MO0A 3NELA 3AQQA 5FLMH 3A5UA 5JJLA 3F8TA 1XPOA 4K0KL 3HOUG 1VQAA 1MJCA 1JJ2A 4KHZA 1TWFH 2PNHA 4OX9L 3H0GH 1EQQA 2BH8A 5FLMG 4DV7Q 4JBJA 4DR5Q 4DR1Q 1K73C 1M1KC 3KFUA 1TWGH 2Y0SE 4IPGA 1L1OB 1IZ6A 1K0RA 4NXML 4DV0Q 1VQJA 2KCMA 1C9OA 5GAEC 2NVQH 2R6GA 1N34L 4L5SA 1N32Q 4YWMA 3RN2A 5DLQE 2Z0SA 3EIVA 4GLVB 1E1OA 2WAQE 4A3LG 2E5LL 4YCVA 4AYBG 3KF6B 2ZJQA 1YI2A 1XNQQ 4A3GG 4DR6Q 4AYBE 1FJGL 2IHEA 2HT1A 4DR2L 4AIMA 4HJ7A 3HOYH 3KOJA 1V1QA 1WOCA 3K0XA 4YHHL 4POGA 1YJ9A 1G291 4DK6C 3F1ZA 3RZOH 1XTDA 3CCQA 1EIYB 3S16H 2NVXH 5BR8L 4YY3Q 4GN3B 4JYAQ 3T1YL 3RLFA 5M3MG 1RL2A 4A3KG 1W3SA 1Q1BA 1PVOA 5IP9H 2HQLA 4HJ8A 4A3DG 3PO2G 1VQLA 2F4VL 3K7AH 2JA8G 1PHJA 4FDBA 4JI2Q 1XPRA 4B3RQ 4JG2A 2NZHA 5GQOA 2KHJA 4DV0L 3CAMA 4B3ML 1SMXA 1VQNA 3HKSA 3RZDH 1VQMA 4DPGA 2L15A 3HOUH 2NN6G 1VQPA 5JJIA 4JCVE 5ELNA 1PH8A 4B3SL 2UU9Q 1E24A 3FP9A 1IBLQ 1YEZA 4C3JH 4QJFA 3H3VI 3CCRA 4JI8Q 2IX1A 4UP9A 4HIMA 4DR4Q 3PUYA 1P16A 3NENA 1TWCH 2IY5B 1G6PA 4X66Q 2D0OA 3K7UC 2AWNA 1X54A 1Z9FA 1XNRQ 1YBYA 1HJPA 2MQHA 1GKHA 5IP7H 5M3MH 4BBRG 1HZAA 5IYCH 3KF6A 1IBML 4JI6L 3GDEA 4BY7G 1MJEA 2CWAA 3L0OA 4GOPB 2OCEA 4DUYQ 1M90C 1X3FA 1VQGA 2YV5A 2VUMG 1DGSA 2N78A 4XTCS 3UDGA 3DM3A 3CPWA 4BBSG 1A0IA 4JI3L 1B70B 4BY1H 4KI0A 1TXYA 3RR5A 1I5FA 3J81c 4GKKL 2AMCB 3EBEA 4OWWB 2YTXA 3CW2C 4OXPA 3HKZE 2WFWA 3HOZG 4Y52H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA Q;  3DLL A;  1VQ4 A;  5FJ8 G;  1SFO H;  1Q86 C;  2XTI A;  2VQE Q;  1N34 Q;  1XMQ Q;  1A62 A;  4QL5 A;  1QVC A;  1HZ9 A;  4LWC A;  4GNX C;  4X64 Q;  1PH7 A;  1K9M C;  2WAQ G;  2ATW A;  4JV5 L;  5HGQ A;  1KC8 C;  2EXD A;  5M5Y H;  1HZB A;  4DR7 Q;  1K8G A;  3CD6 A;  5IP9 G;  1QUQ A;  1CKM A;  4X65 Q;  4AQY L;  1NY4 A;  4OX9 Q;  4JI5 L;  3I4O A;  4C2M H;  4A3I H;  1XMO L;  2CFM A;  1J6Q A;  2ZM6 Q;  5ELO A;  1OXX K;  4O0A A;  5J3B A;  2R93 H;  1IXR A;  3NBH B;  4GS3 A;  2ALY B;  1A63 A;  3T1Y Q;  4UY8 C;  1QVF A;  1TWH H;  2KCT A;  1Q12 A;  4B3M Q;  3CCE A;  4K0K Q;  1R9T H;  2K5V A;  4LUO A;  3G71 A;  5GRO A;  4A3L H;  2E5L Q;  2CKZ B;  3K80 C;  2PQA A;  1UEB A;  4P71 A;  4PZ8 A;  4UP8 A;  2VQE L;  4DV5 L;  1UE6 A;  4HJ9 A;  3UDI A;  1EWI A;  3A74 A;  5M5W H;  5LMN L;  1PH3 A;  2BA1 A;  4JI0 L;  1WCM H;  4DV4 Q;  4YWL A;  4UP7 A;  2R7D A;  4JI8 L;  2ZJP A;  1K83 H;  5C4X G;  1HH2 P;  1VQC A;  1Q81 C;  3I4M H;  1YHQ A;  4JBW A;  1VQ7 A;  1X65 A;  2UXC L;  1VS0 A;  4LFC L;  5JEA G;  4DR3 L;  4A3J G;  5C4X H;  1X9N A;  3S14 H;  1OTC A;  2A19 A;  3D0F A;  4PZ7 A;  2QEX A;  4GKJ L;  4A93 H;  3TRE A;  5AJ3 L;  1PYB A;  1E7Z A;  5C4J H;  2AKW B;  3H0G G;  3UDF A;  3F2C A;  2PMZ E;  3TQY A;  1Z47 A;  3T1H L;  2JA5 H;  4DV7 L;  1EIF A;  1XJV A;  4QQB X;  2F4V Q;  1JJC B;  5C0X G;  2KBN A;  3GTM H;  4PZ6 A;  1E1T A;  1KAW A;  5HY6 A;  5FLX c;  1GO3 E;  2ZJR A;  3AEV A;  4DNI A;  3CC7 A;  4DUZ Q;  1NMF A;  3U4Z A;  3OTO L;  4MZ9 A;  1IYJ B;  3HOV G;  1JT8 A;  1HZC A;  1PA6 A;  3PUZ A;  1I6H H;  3ULL A;  1XMQ L;  1EYG A;  4DR4 L;  4LF6 L;  1NE3 A;  4A3F H;  3HOW G;  1FJG Q;  4LW1 A;  1U5K A;  3TEH B;  4X66 L;  4TQU S;  2ZTE A;  1Y1W G;  2MO1 A;  4JV5 Q;  1PYS B;  1AE2 A;  3RLN A;  5C44 H;  1N36 Q;  2LXK A;  3BZK A;  2JA7 G;  4IJL A;  3S2D H;  1HNW L;  1C0A A;  1H95 A;  1LUZ A;  1OXU A;  2OQ0 A;  4ME3 A;  4YCW A;  2VQF Q;  1WFQ A;  3IRB A;  5C0X I;  4DV3 Q;  4DV2 L;  1D7Q A;  3M9B A;  1VQK A;  1GD7 A;  3HKZ G;  4LF9 Q;  3FKI G;  2JA6 G;  1UE5 A;  4O2D A;  2VW9 A;  4R4I A;  2ZM6 L;  2R7Z G;  1OXS C;  3CCL A;  2KEN A;  4P72 A;  4L5T A;  2B29 A;  5FJ8 H;  1KQS A;  3PUW A;  4DV5 Q;  1VQ9 A;  1SRO A;  4LFB L;  1X55 A;  2RHQ B;  2FXQ A;  2B3G A;  3CP0 A;  2NVT H;  3OTO Q;  4IOC A;  3J7A 5;  5LMN Q;  3AFQ A;  3I4N H;  2BH2 A;  2Q2H A;  5LMU Q;  2UXD L;  2IT1 A;  2JA9 A;  1T9H A;  4GNX B;  1I50 H;  4DAY B;  2CCZ A;  1WI5 A;  3KYH C;  2RCN A;  4JOI A;  4LF8 L;  1VQI A;  2UUB L;  2UUC Q;  2E2J H;  2ZTC A;  3KJP A;  1VCI A;  4LF9 L;  1Y1V H;  3EN2 A;  1LYL A;  2MNA A;  3U58 A;  4A3M H;  2OTL A;  4A3B H;  2VL6 A;  4HIK A;  1L2F A;  3OYY A;  4JI1 Q;  2QGQ A;  1PV4 A;  1U0L A;  1AH9 A;  4GN5 A;  4A93 G;  4NB3 A;  2AWO A;  2F3I A;  4A3J H;  1QZG A;  1YJN A;  2YU9 H;  4LFB Q;  1HNZ Q;  1SLJ A;  1L1O A;  1YHA A;  2R7F A;  1N8R C;  3PO3 G;  2K75 A;  3D31 A;  3J81 i;  2MFI A;  1W2B A;  4B3S Q;  3A5Z B;  3BU2 A;  1TWA H;  3AYH B;  1VQ6 A;  3CCU A;  1N33 Q;  4GLX A;  4MNO A;  5C44 G;  1HNX Q;  2I5H A;  1L1O C;  2I5M X;  2Q2I A;  4BA2 I;  4A3C G;  2YTV A;  1KIX A;  1YZ6 A;  3W1G A;  4LF8 Q;  3LGJ A;  3RN5 A;  1PH1 A;  3CC2 A;  2E8G A;  2QA4 A;  1RIP A;  4GKJ Q;  3GTL H;  1CKO A;  5C3E G;  1E22 A;  1S3O A;  4EQ5 A;  2VUM H;  4A3C H;  4RMF A;  2YTY A;  4UPA A;  1HR0 L;  1VQ8 A;  4WJ3 M;  2LSS A;  1X6O A;  5LMN W;  5JJK A;  3HFZ B;  2R92 G;  1GM5 A;  1VQB A;  2VQF L;  4DV2 Q;  2A8V A;  3M4P A;  3S1N H;  4YHH Q;  3VDY A;  3GTK H;  3S1Q H;  4JI3 Q;  1YHB A;  3L7Z C;  4BBR H;  1NMG A;  4OO1 I;  1P8L A;  2GVA A;  3JC6 6;  2JQO A;  2K5N A;  1V9P A;  1KXL A;  4HJ5 A;  4X6A H;  4OWT B;  1NJI C;  2IX0 A;  3MXN B;  3MEF A;  5LMU L;  1N33 L;  2UXD Q;  3CCV A;  2K50 A;  3GTG H;  3E0E A;  1HNX L;  3TS2 A;  4GOP C;  2IHF A;  4B3R L;  5M5X H;  4IPC A;  1PH2 A;  4HID A;  1KL9 A;  2B63 G;  1X3G A;  5JEA J;  4HIO A;  1VQO A;  4R4T A;  2JA7 H;  2HIX A;  3J80 c;  1YIT A;  3G6E A;  3I7F A;  4PG3 A;  3PV0 A;  1FGU A;  4LF4 L;  2I0Q A;  1KD1 C;  4XIG S;  3I4N G;  3PO2 H;  4JI4 L;  4P75 A;  2UXB L;  4JI7 Q;  3CCM A;  2V1C C;  1OXV A;  3GTJ H;  4JOI C;  3KDF B;  1CUK A;  4R4O A;  1N36 L;  4JBK A;  1HNW Q;  1UE7 A;  1EFW A;  2C35 B;  3ULP A;  2XGT A;  1VQH A;  1IBM Q;  1ASY A;  3STB C;  4A76 A;  1HNZ L;  4C3H H;  4LF7 Q;  4JI1 L;  2KHI A;  3PO3 H;  3S15 H;  4EX5 A;  3GO5 A;  1G51 A;  3M4O H;  1ASZ A;  4Y7N H;  1S72 A;  1SE8 A;  2JJQ A;  1EUJ A;  1YVC A;  2YYZ A;  2OWO A;  3NEM A;  5H1S E;  4B3T L;  3CCS A;  2NVY H;  3H15 A;  2JA8 H;  1A8V A;  3F2D A;  1Y1W H;  4P73 A;  2OQK A;  3KDF A;  4GN4 B;  3S2H H;  1Y1V G;  2ID0 A;  2K52 A;  4DV6 Q;  2B63 H;  1QUQ B;  4BBS H;  3M4Q A;  3FKI H;  4IJH A;  1YNX A;  5IE8 A;  3K8A A;  4KHP L;  3UE1 A;  2N3S A;  1BBW A;  3PIP A;  1EQR A;  5M3F H;  4X62 L;  2ZTD A;  3KLW A;  1NTG A;  1YIJ A;  1Q82 C;  1MKH A;  1VQF A;  1SN8 A;  2Z6K C;  3JAM c;  3JAM i;  3PGZ A;  3M85 A;  2WB1 E;  4HJA A;  1VQ5 A;  2HHH Q;  2Q2U A;  4NXN Q;  5AJ3 Q;  1XPU A;  4IFD I;  4A4I A;  4AQY Q;  3U4V A;  5C3E H;  2VNU D;  4OWX B;  5IYB H;  1OXT A;  4BXX H;  5GAH C;  2OTJ A;  3CPF A;  4H02 A;  2RHS B;  3FHW A;  2CQO A;  4J15 A;  4QIW E;  1QVG A;  1WJJ A;  2PQA B;  5E7N A;  4R4Q A;  2F52 A;  3KJO A;  3HOV H;  4P74 A;  1K3R A;  4L5Q A;  2K4K A;  3PF4 A;  2BA0 A;  2D62 A;  1AE3 A;  2UUA Q;  2JA6 H;  3HOY G;  3BZC A;  4QGU A;  1N9W A;  3I4M G;  4LUZ A;  1PH4 A;  3TRZ A;  3UDX A;  1Q1E A;  1VQE A;  5IYC G;  1JE5 A;  1JB7 A;  3ZJY C;  4YCU A;  2NN6 I;  2K5H A;  5IYD H;  1D8L A;  4LFA Q;  4A3M G;  1GVP A;  1CSP A;  1XMO Q;  4IOA A;  2E2I H;  3PF5 A;  4DV4 L;  4DK3 C;  2JEB I;  5IYD G;  4LF4 Q;  2JEA I;  4IPH A;  1V43 A;  4NXN L;  3W1B A;  2N8N A;  1I94 L;  2R7Z H;  1MIU A;  4DUY L;  1PFS A;  1X56 A;  3TS0 A;  3RLO A;  3PCO B;  3J81 j;  4JC0 A;  4DR3 Q;  4LFC Q;  2AHO B;  3E9H A;  1PH9 A;  4BY7 H;  3S24 A;  2WB1 G;  4DR1 L;  4TVA B;  4JI2 L;  1KRT A;  3K81 C;  4OON A;  1HR0 W;  4GKK Q;  1BKB A;  1LTL A;  1WCM G;  1C7Y A;  2UUA L;  1Q8K A;  4A3K H;  4JI0 Q;  4BY1 G;  3M7N A;  2Z6K A;  3T1H Q;  4DR5 L;  4IO9 A;  2E2H H;  2DUD A;  3PIO A;  3A0J A;  1S40 A;  1J5E Q;  1FVI A;  1SR3 A;  5GAD C;  4NXM Q;  4JI4 Q;  3GD7 A;  2UXB Q;  3L2P A;  1KRS A;  4DR2 Q;  1N32 L;  5M3F G;  2K14 A;  4LF5 Q;  2A1A A;  1Y14 B;  3U50 C;  1WYD A;  4R4C A;  2R93 G;  3WWV A;  3F2B A;  1I94 Q;  1PH5 A;  4IFD G;  4MTN A;  2UUB Q;  2VZA A;  3J7Z C;  4GNX A;  4DAM A;  2HHH L;  4YY3 L;  1UWV A;  3CME A;  4JYA L;  4DV1 L;  5C0X J;  1I3Q H;  2HIV A;  4C3I H;  3CMA A;  4JI5 Q;  3H3V H;  4RG1 A;  1E3P A;  3PSI A;  4A3F G;  2ES2 A;  1BVS A;  2D0P A;  4KLK A;  1BBU A;  1IBK L;  3CXC A;  2PI2 A;  4YWK A;  3BJU A;  5IT9 c;  1FL0 A;  4GLA C;  4APV A;  2JK8 A;  2Y0S G;  4DUZ L;  4LF7 L;  2N49 A;  1QZH A;  1B8A A;  4DKA C;  4LUV A;  1IL2 A;  4R1J A;  2UU9 L;  3GTP H;  1VQD A;  4AH6 A;  2GVB A;  2I5L X;  1NBW A;  3HOX H;  4POF A;  1J5E L;  4LF6 Q;  5IWA L;  5IYB G;  4BXX G;  5IY0 A;  3I56 A;  4DV6 L;  2JA5 G;  1B7Y B;  3J80 i;  3GTO H;  1LM0 A;  2DGY A;  4DR6 L;  5K36 G;  3HOX G;  5EAY A;  2ASB A;  4A3I G;  5GAG C;  3M3Y H;  2GN5 A;  2R92 H;  1CSQ A;  4BA1 I;  3RNU A;  1XNQ L;  4X65 L;  3CQZ H;  3E9I A;  3S1M H;  1SRU A;  1HR0 Q;  3B6Y A;  5BR8 Q;  3I2Z A;  3CCJ A;  4KHP Q;  4IFD J;  4A3G H;  3STB D;  3ER0 A;  4X62 Q;  1KHI A;  3G4S A;  3SGI A;  5IP7 G;  1PH6 A;  1EOV A;  2EIF A;  4A3E G;  3PUX A;  3S1R H;  4QY7 A;  3G48 A;  1UE1 A;  4A75 A;  3ULJ A;  1L0W A;  2VS1 A;  1JJG A;  1CKN B;  3KF8 B;  4A3E H;  4A3D H;  1CKN A;  4L5R C;  4A3B G;  2EQS A;  4B3T Q;  3ERS X;  2CWP A;  3HOW H;  1JMC A;  1K8A C;  3CC4 A;  1O7I A;  3W5O A;  4GOP A;  3UE0 A;  2H5X A;  2NZO A;  1IBL L;  1XNR L;  3AFP A;  3OW2 A;  2JE6 I;  1Q7Y C;  2UUC L;  4WJ4 A;  2LXJ A;  2WP8 J;  3HOZ H;  1X3E A;  3S17 H;  2Q2T A;  1YJW A;  3GTQ H;  4ALP A;  4NPS A;  3Q8D A;  4LF5 L;  2VY3 A;  4JI6 Q;  4LFA L;  3I55 A;  3CF5 A;  2UXC Q;  4X64 L;  4JI7 L;  3PUV A;  4DV3 L;  4DR7 L;  4IPD A;  4PMW A;  4LNQ A;  2PI2 E;  3ICE A;  1IBK Q;  2RF4 A;  4OO1 G;  4DV1 Q;  4JBM A;  1Q46 A;  2MO0 A;  3NEL A;  3AQQ A;  5FLM H;  3A5U A;  5JJL A;  3F8T A;  1XPO A;  4K0K L;  3HOU G;  1VQA A;  1MJC A;  1JJ2 A;  4KHZ A;  1TWF H;  2PNH A;  4OX9 L;  3H0G H;  1EQQ A;  2BH8 A;  5FLM G;  4DV7 Q;  4JBJ A;  4DR5 Q;  4DR1 Q;  1K73 C;  1M1K C;  3KFU A;  1TWG H;  2Y0S E;  4IPG A;  1L1O B;  1IZ6 A;  1K0R A;  4NXM L;  4DV0 Q;  1VQJ A;  2KCM A;  1C9O A;  5GAE C;  2NVQ H;  2R6G A;  1N34 L;  4L5S A;  1N32 Q;  4YWM A;  3RN2 A;  5DLQ E;  2Z0S A;  3EIV A;  4GLV B;  1E1O A;  2WAQ E;  4A3L G;  2E5L L;  4YCV A;  4AYB G;  3KF6 B;  2ZJQ A;  1YI2 A;  1XNQ Q;  4A3G G;  4DR6 Q;  4AYB E;  1FJG L;  2IHE A;  2HT1 A;  4DR2 L;  4AIM A;  4HJ7 A;  3HOY H;  3KOJ A;  1V1Q A;  1WOC A;  3K0X A;  4YHH L;  4POG A;  1YJ9 A;  1G29 1;  4DK6 C;  3F1Z A;  3RZO H;  1XTD A;  3CCQ A;  1EIY B;  3S16 H;  2NVX H;  5BR8 L;  4YY3 Q;  4GN3 B;  4JYA Q;  3T1Y L;  3RLF A;  5M3M G;  1RL2 A;  4A3K G;  1W3S A;  1Q1B A;  1PVO A;  5IP9 H;  2HQL A;  4HJ8 A;  4A3D G;  3PO2 G;  1VQL A;  2F4V L;  3K7A H;  2JA8 G;  1PHJ A;  4FDB A;  4JI2 Q;  1XPR A;  4B3R Q;  4JG2 A;  2NZH A;  5GQO A;  2KHJ A;  4DV0 L;  3CAM A;  4B3M L;  1SMX A;  1VQN A;  3HKS A;  3RZD H;  1VQM A;  4DPG A;  2L15 A;  3HOU H;  2NN6 G;  1VQP A;  5JJI A;  4JCV E;  5ELN A;  1PH8 A;  4B3S L;  2UU9 Q;  1E24 A;  3FP9 A;  1IBL Q;  1YEZ A;  4C3J H;  4QJF A;  3H3V I;  3CCR A;  4JI8 Q;  2IX1 A;  4UP9 A;  4HIM A;  4DR4 Q;  3PUY A;  1P16 A;  3NEN A;  1TWC H;  2IY5 B;  1G6P A;  4X66 Q;  2D0O A;  3K7U C;  2AWN A;  1X54 A;  1Z9F A;  1XNR Q;  1YBY A;  1HJP A;  2MQH A;  1GKH A;  5IP7 H;  5M3M H;  4BBR G;  1HZA A;  5IYC H;  3KF6 A;  1IBM L;  4JI6 L;  3GDE A;  4BY7 G;  1MJE A;  2CWA A;  3L0O A;  4GOP B;  2OCE A;  4DUY Q;  1M90 C;  1X3F A;  1VQG A;  2YV5 A;  2VUM G;  1DGS A;  2N78 A;  4XTC S;  3UDG A;  3DM3 A;  3CPW A;  4BBS G;  1A0I A;  4JI3 L;  1B70 B;  4BY1 H;  4KI0 A;  1TXY A;  3RR5 A;  1I5F A;  3J81 c;  4GKK L;  2AMC B;  3EBE A;  4OWW B;  2YTX A;  3CW2 C;  4OXP A;  3HKZ E;  2WFW A;  3HOZ G;  4Y52 H; 
#chains in the Genus database with same CATH topology
 5IWA Q;  2F0W A;  5FJ8 G;  1N34 Q;  1XMQ Q;  1K28 A;  1T5X D;  1VF7 A;  4P2C B;  4XYQ A;  1BXT A;  3MAQ A;  2EYF A;  4JV5 L;  5HGQ A;  3V05 A;  2EXD A;  1HZB A;  4TSS A;  5C3E B;  2MHV A;  1PLF A;  1SEB D;  5IP9 G;  1CKM A;  1NAP A;  4XQJ A;  4AQY L;  1DOK A;  1NR4 A;  3IFD A;  1JR0 D;  2ZM6 Q;  1OXX K;  1STG A;  2R93 H;  3H0G B;  1A63 A;  4UY8 C;  1TWH H;  4KMU C;  3S1Q B;  3H3V C;  2RDG A;  3KBX A;  3G71 A;  1TY2 A;  4KY7 A;  4P71 A;  4UP8 A;  4DV5 L;  1CFM A;  2VQE L;  1AN8 A;  4XQQ A;  3UDI A;  1EWI A;  3A74 A;  5LMN L;  1WCM H;  5IGB A;  4DV4 Q;  3I70 A;  1ESR A;  3QG1 A;  4HAE A;  5C4X G;  3HG9 A;  1Y8O B;  3EFX D;  1Q81 C;  2UXC L;  4A3J G;  2F0J A;  4PZ7 A;  2F0S A;  5ISR A;  1TS4 A;  1JWM D;  1GHK A;  1E7Z A;  1YNJ D;  1AZQ A;  2AKW B;  2CH4 A;  1KLU D;  3UDF A;  1LTG D;  3TP8 A;  3F2C A;  2IJ0 A;  1Z47 A;  2G5D A;  2F4V Q;  1JJC B;  4K5W A;  2B2W C;  5HY6 A;  1GO3 E;  4XT3 B;  4DNI A;  4DUZ Q;  1PDQ A;  3OTO L;  1IYJ B;  5JVG 3;  1HZC A;  1DJR D;  3ULL A;  3I3C A;  2NWG A;  1EYG A;  4DR4 L;  1NE3 A;  2WKC A;  3BVG A;  1HTL D;  4X66 L;  3SXH A;  5C44 H;  4IJL A;  5D3D A;  1OXU A;  4ZK9 B;  5E4W C;  3U9O A;  4DV2 L;  5C0X I;  4H13 C;  3M9B A;  1WTR A;  4FF2 A;  2F0L A;  3VYT A;  3MTS A;  2JA6 G;  5E3F A;  2XIW A;  5CC4 A;  1XYI A;  1EY6 A;  3CCL A;  1SMY C;  4L5T A;  1KQS A;  1SRO A;  2Q8T A;  2FXQ A;  1F9P A;  3VYR A;  3HOY B;  1VMC A;  3I4N H;  4ODG A;  2UXD L;  2JA9 A;  3E6Z X;  3NWS A;  4DAY B;  4TKO B;  1O7Y A;  1STA A;  4LMQ D;  1Y1W B;  2UUC Q;  1RTO A;  3VR2 A;  1V1P B;  2F1M A;  4LF9 L;  2R92 B;  2Q8R E;  2B2T C;  4HIK A;  1NNX A;  3OYY A;  3GTL B;  3HKZ B;  5JAV A;  1AH9 A;  2WII B;  2WB1 B;  2AWO A;  3MZ5 A;  4KY5 A;  1L1O A;  3DWQ A;  3KBG A;  1F2Z A;  3A7L A;  3J81 i;  1U4M A;  1STH A;  2PW7 A;  3C1F A;  1I6H B;  5EKL A;  3T51 B;  4GLX A;  3FVQ A;  2WKD A;  4KTA A;  2YTV A;  3CQZ B;  1KIX A;  2WAQ B;  5A2Q L;  3LGJ A;  4LF8 Q;  3CC2 A;  1QG7 A;  2QA4 A;  4J8Q A;  1CKO A;  3O13 A;  3TSS A;  1MSG A;  1DON A;  5E4X A;  1GM5 A;  2G9D A;  1ILP A;  3S1Q H;  1HXY D;  2EVB A;  4GZY C;  1TWA B;  2JN4 A;  2ZT9 C;  3JC6 6;  4RGM A;  2K5N A;  1F9R A;  3TZD A;  1V9P A;  2DNE A;  4OWT B;  2C5C A;  2CW0 D;  5LMU L;  1B3A A;  3CCV A;  3GTG H;  3TS2 A;  5KEE A;  4B3R L;  3R8B A;  1KL9 A;  2B63 G;  5JEA J;  2JA7 H;  2F0T A;  4A3I B;  1WTO A;  3I7F A;  1PRT D;  5IGC A;  2I0Q A;  1KD1 C;  1EY5 A;  2UXB L;  2RCF A;  4J1M A;  2V1C C;  1AW7 A;  1CUK A;  4R4O A;  4JBK A;  4CDF C;  2ZXR A;  3LWU A;  3MHB A;  3CKI B;  2F3V A;  2PZU A;  3CU7 A;  2RVL A;  4JI1 L;  2A5H A;  2FJ2 A;  3GO5 A;  1G51 A;  1ASZ A;  2M2L A;  1BO0 A;  4XYO A;  3I91 A;  1XXG A;  3S1R B;  2JJQ A;  1YVC A;  3NEM A;  3CCS A;  1ENA A;  2NVY H;  3D3R A;  5JOB A;  5K5P A;  1J9O A;  4P73 A;  3KDF A;  3HGB A;  5FK9 C;  1Y1V G;  2K5D A;  4DV6 Q;  3M4Q A;  1AZP A;  4G4K A;  3UE1 A;  1EQR A;  4LK1 C;  1PZK D;  4XDX A;  5CBE E;  3QOL A;  1NTG A;  2J7Z A;  2A6E D;  1RJT A;  1SN8 A;  2Z6K C;  5C0X H;  3PGZ A;  2L12 A;  2HHH Q;  4NXN Q;  2QDB A;  5IYB H;  2RHS B;  1QVG A;  3KJO A;  2VB2 X;  1ZXT A;  2V4D A;  2Z9H A;  3OSO A;  1N9W A;  3K7A B;  1PH4 A;  2LS0 1;  1IW7 C;  5IYC G;  2BDO A;  1JB7 A;  1I4R A;  3TP6 A;  2ENB A;  2R93 B;  1CSP A;  1CZW A;  3MXG A;  2JEA I;  2B2W A;  2EE1 A;  4X3U A;  1V43 A;  1WTH A;  1MIU A;  4RGT A;  1EEI D;  4DR3 Q;  2DY7 A;  2H4O A;  1HPC A;  1LV9 A;  3S24 A;  3V96 A;  1QIL A;  2Y0S B;  2IPK D;  3K81 C;  1C48 A;  1WCM G;  2UUA L;  1Q8K A;  2EYL A;  5CYU A;  4IO9 A;  2DUD A;  1S40 A;  1FVI A;  4NXM Q;  1TT2 A;  3GD7 A;  4DR2 Q;  3QJY A;  1Y14 B;  2EYO A;  5D3I B;  2EYM A;  1G91 A;  1WYD A;  4R4C A;  3F2B A;  3BDO A;  3SE0 A;  2UUB Q;  5I9P A;  3LNN A;  5FLX L;  4GNX A;  3T56 B;  4C3I H;  4RG1 A;  4KLK A;  1XTC D;  1BBU A;  1BQQ T;  1IBK L;  4YWK A;  3BJU A;  3C2P A;  3N6R A;  1B8A A;  2A68 C;  2NVX B;  4LUV A;  3GTP H;  3NXW A;  4POF A;  4BXX G;  5IY0 A;  2JA5 G;  2K33 A;  3J80 i;  1LM0 A;  2H1E A;  4DR6 L;  1EY4 A;  1CQF A;  2ASB A;  1VDZ A;  2KUM A;  1PTO C;  3TME A;  1KNE A;  2OEO A;  4X65 L;  3E9I A;  4B9W A;  1SRU A;  1OO9 B;  1HR0 Q;  2BCO A;  4TRD A;  1D1I A;  2L9H A;  3STB D;  1HQR D;  4FVM A;  4WRD A;  3S1R H;  1A15 A;  4DAP A;  5FKA C;  4A3E H;  2TSS A;  4A3B G;  3HOW H;  2MPM A;  5FLX E;  4G7O C;  2A69 D;  1JMC A;  1D5X C;  1O7I A;  1BUV T;  3J7A F;  1CM9 A;  2PCF B;  2DJF C;  4GOP A;  2H5X A;  3P1H A;  4PNY A;  3OW2 A;  1EU4 A;  4A3G B;  3DEO A;  3HZX A;  2R3Z A;  4RHR A;  4ALP A;  2FHT A;  2VY3 A;  2ZXO A;  1B50 A;  1EFI D;  1F77 A;  4LNQ A;  1JIC A;  3OIQ A;  4MTK A;  5M3M B;  1PXU A;  1IBK Q;  4A3K B;  4OO1 G;  4G57 A;  4DV1 Q;  4JBM A;  1DD2 A;  3NEL A;  4N8F A;  2Z4H A;  1XPO A;  5EKK A;  1SJE D;  1EQQ A;  5FLM G;  1GUO A;  3SK6 A;  4JBJ A;  1EWC A;  3AB9 A;  1QNK A;  1H9J A;  5GAE C;  5EQ0 A;  2NVQ H;  5COY A;  1N32 Q;  1LTT D;  4L5S A;  3I4M B;  1EIG A;  4YWM A;  3EIV A;  2WAQ E;  1DYQ A;  1YI2 A;  3K6O A;  2XVS A;  3HOW B;  3HOY H;  4DR2 L;  4HJ7 A;  2B39 A;  1E2W A;  2F0N A;  1TWC B;  1ML0 D;  1JCK B;  2WIN B;  1EIH A;  2EYP A;  3FKI B;  1PVO A;  4A3D G;  3PO2 G;  4FDB A;  1XPR A;  4Z9C B;  4B3R Q;  1VQN A;  2KHJ A;  3KF8 A;  3JAM E;  5IOD A;  4RCN A;  5JJI A;  1MBY A;  5ELN A;  3VYU A;  4B3S L;  2JYO A;  3IAY A;  4JI8 Q;  2IX1 A;  4HIM A;  4DR4 Q;  3NEN A;  2IY5 B;  3RZO B;  2OF1 A;  2D0O A;  1XNR Q;  1X54 A;  5EGT A;  2EDG A;  4WFN 3;  1S4Z A;  5IP7 H;  4JW0 A;  3K5M A;  4V0B A;  4MN3 A;  1ZYR D;  2SOB A;  1MJE A;  4GOP B;  1M90 C;  4A3F B;  1I4P A;  2VUM G;  2N78 A;  3RD4 A;  4BBS G;  2F0O A;  1K8O A;  4KI0 A;  2A73 B;  1TXY A;  3RR5 A;  2DN8 A;  1I5F A;  4GKK L;  4UHV A;  5IGE A;  3EBE A;  1IYU A;  3CW2 C;  3Q23 A;  2X6L A;  2EY2 A;  1Z7T A;  3HOZ G;  1SE4 A;  5I2X A;  3DLL A;  1VQ4 A;  2C9O A;  1U4R A;  2VQE Q;  2A74 C;  2E2I B;  5ELC A;  4J6H A;  1PH7 A;  4X64 Q;  3J80 E;  1BOS A;  2K04 A;  3NP8 A;  1K9M C;  2ATW A;  1SNQ A;  4C3I G;  1IKM A;  4DR7 Q;  2B2U A;  1JOK A;  1JC7 A;  1QUQ A;  3E0J A;  5K36 H;  1JOQ A;  4BY7 B;  2XNA C;  3I4O A;  4A3I H;  1XMO L;  2F0Q A;  4O0A A;  4GS3 A;  3T1Y Q;  1H9M A;  1Q12 A;  1G8Z D;  1R9T H;  1L0X B;  2K5V A;  3K80 C;  2J0T D;  3VR6 A;  4F87 A;  5CV6 A;  3WDN A;  4DXF A;  5M5W H;  3HOV B;  4JI0 L;  3NBI A;  3QIA A;  1TS3 A;  1VQ7 A;  2LY7 A;  4DR3 L;  2NZ1 D;  3S14 H;  2A19 A;  3D0F A;  5BN3 A;  4GKJ L;  2PMZ B;  5KNC A;  2R7Z B;  2ZXP A;  3H0G G;  4RGO S;  1B2T A;  2PMZ E;  1ICF B;  1YNJ C;  2JA5 H;  4DV7 L;  4C3J G;  1XJV A;  5C0X G;  2B2Y A;  3A55 A;  3EJI A;  5FLX c;  5M9O A;  5C3W A;  4HMI A;  1V1O A;  2DJG C;  3U4Z A;  3HS0 C;  4MZ9 A;  1I6H H;  1XMQ L;  3G6J B;  3CRL C;  2F03 A;  1M8A A;  1FJG Q;  4TQU S;  4CHT B;  2ZTE A;  2F0I A;  3R93 A;  3RLN A;  1AE2 A;  1N36 Q;  1X3P A;  2JA7 G;  4A3J B;  1LUZ A;  2VQF Q;  3GTQ B;  2KEC A;  3IRB A;  4DV3 Q;  1GD7 A;  5D65 A;  5J22 A;  1UE5 A;  2VW9 A;  4R4I A;  2KQ3 A;  2B29 A;  4DV5 Q;  5HUR A;  1X55 A;  2RHQ B;  5EBD A;  3CP0 A;  3OMG A;  2L11 A;  3SDZ A;  5LMN Q;  5C44 B;  4K6L A;  3AMU A;  3K5N A;  2CCZ A;  3NQT A;  2F3W A;  2KEE A;  2WV6 D;  4JVZ A;  1EY9 A;  3KUP A;  2ICI A;  2UUB L;  3KLR A;  2PZW A;  4C1N I;  1Y1V H;  3EN2 A;  1F9S A;  4A3B H;  5I6Y A;  2VL6 A;  3S2H B;  5CBA E;  3FDT A;  1QJO A;  2JSO A;  4IUV A;  2JA6 B;  2M00 A;  1LT3 D;  4A3J H;  2F3I A;  3C3L A;  1YJN A;  1HNZ Q;  1LTR D;  3MC0 B;  2R7F A;  5FO8 B;  1N8R C;  4NP5 A;  3D31 A;  3A8I E;  2MFI A;  1DCZ A;  1TQO A;  4CKE A;  3SK8 A;  4B3S Q;  1ZEQ X;  3AYH B;  3CCU A;  1GUT A;  4ZAI A;  1HNX Q;  2AUJ D;  2BDN A;  3RZD B;  2I5M X;  2D2C C;  2B2Y C;  3BDL A;  4A3C G;  3GTP B;  1YZ6 A;  3W1G A;  3RN5 A;  2E8G A;  2FIN B;  1RIP A;  3GTL H;  3NSW A;  4IAL A;  2VUM H;  5T1I A;  2KOL A;  2B8G A;  4UPA A;  1HR0 L;  2F0G A;  1TII D;  1LT5 D;  3HFZ B;  2R92 G;  3G7L A;  1VQB A;  3A7A B;  4YHH Q;  3MVV A;  3GTK H;  1YHB A;  3L7Z C;  4BBR H;  2O5I C;  3U9S A;  4RWS C;  2HD3 A;  3SVM A;  4RKL A;  4X6A H;  1PFN A;  1ZKO A;  3D4R A;  2IX0 A;  1LTS D;  3MEF A;  3CHB D;  2A6H C;  2UXD Q;  2K50 A;  3E0E A;  3OPO A;  2IHF A;  5M5X H;  4IPC A;  1PH2 A;  4HID A;  1O7Z A;  1VQO A;  4HIO A;  3ERQ A;  3T16 A;  4LF4 L;  4X3T A;  3I4N G;  3PO2 H;  3CCM A;  4QB4 A;  2AQ3 B;  4JOI C;  1N36 L;  5JJZ A;  1UE7 A;  3VA5 A;  2RDH A;  3J81 E;  3OW7 A;  1IBM Q;  3BDC A;  3HP3 A;  3STB C;  1HNZ L;  2EYJ A;  3PO3 H;  1FNU A;  4HED A;  3EA6 A;  2B2U C;  1PTO H;  2M9V A;  4C3H B;  2YYZ A;  1EUJ A;  2RQX A;  1FNV A;  5ELD A;  2SDF A;  1V1P A;  1SYC A;  2EZV A;  4KD4 A;  3X3M A;  2JP1 A;  1QUQ B;  4BBS H;  4OGQ C;  1STN A;  1D2B A;  1G2T A;  3PIP A;  4DAY A;  2ZTD A;  1PTO F;  4MIU A;  1Q82 C;  5IIF A;  3Q0A A;  1C0A A;  3WOF A;  1QE6 A;  2WB1 E;  4IFD I;  1XPU A;  1LT4 D;  1KLG D;  2A6E C;  2VNU D;  1YNN D;  5GAH C;  4LAA A;  1LLR D;  4QIW E;  3FHW A;  2E2H B;  4EQP A;  3DEP A;  2FFK B;  2PQA B;  4HR7 B;  5M5W B;  3HOV H;  3NHH A;  3W3A A;  4KJN A;  2K4K A;  2QEJ C;  2D62 A;  3P20 A;  2WAC A;  2UUA Q;  2A6H D;  3M4O B;  3BZC A;  2EY1 A;  4LUZ A;  1Q1E A;  3IL8 A;  2XSC A;  4DFA A;  3ZJY C;  5M3F B;  1RCV D;  5IYD H;  1D8L A;  4R8I A;  4A3M G;  1GVP A;  1XMO Q;  3PF5 A;  1JB3 A;  4DK3 C;  2JEB I;  4FXK C;  2CH4 W;  2GA4 B;  3TP7 A;  4KY6 A;  1X56 A;  3PCO B;  3J81 j;  4JC0 A;  4LFC Q;  5EKI A;  3E9H A;  4NW2 A;  4TVA B;  4GKK Q;  5LL6 S;  5J1Z A;  1SJH D;  1PRT C;  3M7N A;  2Z6K A;  1G6Z A;  1SYB A;  3T1H Q;  2F0K A;  4DR5 L;  1O78 A;  2E2H H;  3FMC A;  1J5E Q;  5GAD C;  3IKJ A;  4LF5 Q;  1QOH A;  2A1A A;  3KLS X;  2R93 G;  1I94 Q;  1CT1 D;  4MTN A;  2VZA A;  2K32 A;  2HHH L;  2VB3 X;  1Q90 A;  3CME A;  2XRQ D;  1KTK A;  4PMC A;  3GTK B;  4JYA L;  1I3Q H;  1KDC A;  2EJF C;  3H3V H;  1A2T A;  4A3E B;  1CHQ D;  4IUT A;  4APV A;  2JK8 A;  2Y0S G;  4DUZ L;  2N49 A;  2OT2 A;  1IL2 A;  5F2D A;  2I5L X;  4WOR A;  4IUR A;  5IWA L;  5IYB G;  1BNZ A;  1NCV A;  1R9T B;  3HOX G;  3C46 A;  4ZYS A;  5GAG C;  2R92 H;  1CSQ A;  1XNQ L;  1R4Q B;  3CQZ H;  4H7B A;  5BR8 Q;  3I2Z A;  4U67 3;  1KAA A;  4X62 Q;  1KHI A;  3SGI A;  5IP7 G;  1CA5 A;  3DWA A;  3PUX A;  3MEH A;  3W2D A;  3LWE A;  1SNP A;  3OIP A;  4A3D H;  2EQS A;  3OWE B;  4B3T Q;  1X3Q A;  2CWP A;  3ERS X;  2Z8L A;  1UUP A;  1I6V C;  1DZ1 A;  1K8A C;  3CC4 A;  1ILQ A;  3W5O A;  4O42 A;  3UE0 A;  2JA5 B;  1IBL L;  2DY8 A;  1Q7Y C;  2JE6 I;  1DOL A;  2UUC L;  2LXJ A;  3HOZ H;  3VA7 A;  1X3E A;  2SNS A;  1YJW A;  3Q8D A;  4JI6 Q;  1CK1 A;  4RKB A;  5IGF A;  2UXC Q;  4DU9 A;  4X64 L;  4RH6 A;  4M8A A;  1CZG A;  1I50 B;  1SNO A;  2RSN A;  2KCC A;  1RD9 D;  3D6W A;  3PUV A;  4DV3 L;  1FGB D;  2RF4 A;  3S1M B;  1Q46 A;  3AQQ A;  5JJL A;  3ND8 A;  3F8T A;  3TBI B;  1CQV A;  1JJ2 A;  4KHZ A;  1TWF H;  2PNH A;  2BH8 A;  1SND A;  3MXU A;  1B44 D;  4B9X A;  1M1K C;  4F88 A;  3S1N B;  2R6G A;  1N34 L;  3BVM A;  4GLV B;  1WTW A;  4AYB G;  2CQA A;  2QDL A;  3QOJ A;  3X3N A;  4A3G G;  4DR6 Q;  4AYB E;  4CJ0 B;  2HT1 A;  4BBR B;  1WOC A;  4BS9 A;  3TN2 A;  5C4J B;  1O80 A;  2K01 A;  2KCN A;  4K2K A;  1XTD A;  4I65 A;  4OEM B;  4CJ1 B;  2E2D C;  1PZI D;  3CCQ A;  1EIY B;  4YY3 Q;  4JYA Q;  3KLS A;  3RLF A;  1RL2 A;  3A8J E;  3SHL A;  5M3M G;  2I07 B;  4A3K G;  5IP9 H;  2HQL A;  2O5J C;  1EYA A;  1PHJ A;  4JI2 Q;  2B2V C;  5GQO A;  4DV0 L;  2Q8I B;  3EVQ A;  4B3M L;  1TS5 A;  4BY1 B;  4DPG A;  3HOU H;  4K8I A;  2NN6 G;  4ZRZ A;  1VQP A;  1PH8 A;  4FNF A;  1E24 A;  4C3J H;  4KD3 A;  2TMP A;  3PUY A;  1TWC H;  5BN5 A;  4C2M B;  1DM0 B;  4KV6 A;  2MQH A;  1GKH A;  1JWS D;  3RMH A;  1ZYR C;  2KJX A;  4IUU A;  1X3F A;  2YV5 A;  3BVZ A;  5E1F A;  3UDG A;  3DM3 A;  3CPW A;  1JOR A;  1A0I A;  4JI3 L;  1B70 B;  1SYG A;  3GV6 A;  5JPM C;  4Q0F A;  3J81 c;  1I4X A;  2D5D A;  4OWW B;  2YTX A;  1LTB D;  1K3B C;  4OXP A;  3ERO A;  2WFW A;  2RBM A;  4Y52 H;  4V19 0;  3S15 B;  1Q86 C;  1EYC A;  2XTI A;  1HZ9 A;  4LWC A;  2KED A;  3A56 A;  2PNR C;  2WAQ G;  1KC8 C;  5M5Y H;  5DM7 3;  2R61 A;  4XXE A;  4X65 Q;  1K8G A;  5HGT A;  1I4Q A;  3P75 A;  1NY4 A;  4OX9 Q;  4C2M H;  2CFM A;  2XN9 C;  3HRZ C;  5EPJ A;  1J6Q A;  2D9U A;  3SEB A;  3GTM B;  2IWH A;  3NBH B;  1MGS A;  2ALY B;  5CMD A;  2KCT A;  4B3M Q;  1AP0 A;  3CCE A;  1RHP A;  1LAC A;  3LX0 A;  3T13 A;  2SNM A;  1F2L A;  2E5L Q;  2PQA A;  1UE6 A;  5I4D A;  4ZKB B;  4OL7 A;  4L6T B;  2NTT A;  2B63 B;  3OWF A;  4YWL A;  4UP7 A;  1SBB B;  2ZJP A;  2F0V A;  3J7A V;  1SFO B;  3P7J A;  4CKC A;  1BDO A;  4C3I B;  3I4M H;  4LFC L;  2X69 A;  1VMP A;  1GUG A;  5C4X H;  2L5T A;  4K6D A;  2BE5 D;  1HA6 A;  3EQL C;  5C4J H;  1GOZ A;  3GTM H;  1KAW A;  4NDX A;  3AEV A;  3CC7 A;  5I2Y A;  3HOV G;  1JT8 A;  1PA6 A;  4JPB W;  2G9H D;  4LF6 L;  1Y1V B;  4LW1 A;  3TEH B;  1TVX A;  4JV5 Q;  1PYS B;  4ZKC B;  2EJG C;  2LXK A;  3BZK A;  3S2D H;  1SAP A;  2OQ0 A;  4ME3 A;  2F0U A;  1WFQ A;  4LF9 Q;  2ZM6 L;  1PTO D;  2R7Z G;  1U4L A;  1WTX A;  2JA8 B;  1U9R A;  2Z6B A;  4DNR B;  1BCP F;  2SEB D;  3VR3 A;  4P72 A;  3PUW A;  2NVT H;  3OTO Q;  4IOC A;  3J7A 5;  5C6A A;  2Q2H A;  2IT1 A;  1T9H A;  4GNX B;  1I50 H;  5CV9 A;  3A8K E;  5IT9 E;  1WI5 A;  1ET9 A;  3KYH C;  5KND A;  2RCN A;  4JOI A;  4RA8 A;  4LF8 L;  1VQI A;  5KNB A;  1DXM A;  1UAP A;  4KKS A;  1ONL A;  1LYL A;  4A3M H;  1L2F A;  5C5L A;  2QGQ A;  1PV4 A;  2MP1 A;  4GN5 A;  4IUP A;  4A93 G;  2IX3 A;  1B3Q A;  1WCM B;  4EGV A;  1PRT F;  1H9S A;  3PO3 G;  3A5Z B;  1H9R A;  1B1Z A;  1Z6H A;  2EYH A;  1EY7 A;  1PFM A;  5C44 G;  1S5B D;  2I5H A;  3T53 B;  1L1O C;  5C5M A;  1PH1 A;  5C3E G;  4ZUI A;  4XT1 B;  4PQX A;  4RMF A;  2YTY A;  4WJ3 M;  2ICE C;  2N88 A;  1IYV A;  2LSS A;  1GHJ A;  1HA5 A;  1X6O A;  2RSO A;  4DV2 Q;  3M4P A;  4DF7 A;  3S1N H;  1EY8 A;  1PRT B;  3NQI A;  1SNM A;  3AU7 A;  4JI3 Q;  2HUG A;  2QF7 A;  4OO1 I;  2JQO A;  5EPL A;  1TY0 A;  1KXL A;  1EZ8 A;  4EQN A;  2NTS A;  1SSO A;  3QR8 A;  1N33 L;  4X3S A;  4ABN A;  3PIO 3;  1A2U A;  1PMR A;  3BG3 A;  4H0L C;  3I73 A;  2E2J B;  5C4X B;  1A3U A;  1TR5 A;  4PG3 A;  3TDQ A;  1B9N A;  3ITP A;  2Z4I A;  4P75 A;  4CGY B;  5COR A;  3GTJ H;  4IUQ A;  3KDF B;  1RF2 D;  2FMM A;  4IN3 A;  1NSN S;  1IKL A;  2XGT A;  3K5L A;  2EY6 A;  4KKU A;  1ASY A;  2F0P A;  2KHI A;  1JWU D;  3S15 H;  2B2T A;  5ELF A;  3M4O H;  4YIJ A;  4Y7N H;  4FF4 A;  1S72 A;  1D6E C;  2OWO A;  5H1S E;  2KVM A;  1K0S A;  2QCP X;  4CDC C;  1A8V A;  3F2D A;  3PMF A;  1Y1W H;  1ESF A;  1D5M C;  3I4L A;  3J81 L;  2A68 D;  2VXW A;  2E74 C;  4IJH A;  3FKI H;  1HUN A;  4KN7 C;  3K8A A;  4KHP L;  2N3S A;  1BBW A;  2I46 A;  4X62 L;  1ET6 A;  4HCS A;  3S9W A;  1EQT A;  1VQF A;  3JAM i;  4LFB L;  3JAM c;  3M85 A;  1VQ5 A;  2Q2U A;  4AQY Q;  3U4V A;  2OXP A;  1BR9 A;  1OXT A;  2OTJ A;  4J15 A;  1FR3 A;  5NUC A;  5E7N A;  2NYZ D;  4UDU C;  4B08 A;  5ELE A;  4C3H G;  2BA0 A;  2RDF A;  2JA6 H;  3HOY G;  2XWJ B;  2CW0 C;  3I4M G;  1TWG B;  1JE4 A;  3TRZ A;  1RDP D;  1VQE A;  3UDX A;  1SXT A;  4KN4 C;  4UAI A;  1EL0 A;  4YCU A;  2JXM B;  2K5H A;  1YNN C;  4LFA Q;  3K57 A;  5C3X A;  4IOA A;  1VF5 C;  1J8I A;  4DV4 L;  1HTP A;  4LF4 Q;  4IPH A;  5EBC A;  3W1B A;  4NXN L;  1Y8P B;  2XWB B;  2R7Z H;  1ICW A;  4I7Z C;  3PQI A;  4NKL A;  4DUY L;  1CTM A;  3TS0 A;  5BN4 A;  3RLO A;  3FPP A;  2AHO B;  2WB1 G;  4DR1 L;  4OON A;  2EJM A;  1BKB A;  1HQM C;  1C7Y A;  1UEA B;  4A3K H;  4JI0 Q;  4IUN A;  3MXP A;  4L8J A;  3A54 A;  3GV3 A;  3NE5 B;  2K28 A;  1SYF A;  1SR3 A;  4FP5 D;  4JI4 Q;  3S16 B;  2L1B A;  4ULL A;  1N32 L;  5M3F G;  1B4O A;  1CI3 M;  5JVH 3;  4DAM A;  4YY3 L;  1UWV A;  3I90 A;  3HEJ A;  1S5D D;  2NBF A;  4JI5 Q;  3CMA A;  1E3P A;  3PSI A;  4A3F G;  2ES2 A;  1BVS A;  2O2L D;  2PI2 A;  5IGD A;  1SYD A;  5IT9 c;  4LF7 L;  1KNA A;  1QZH A;  4DKA C;  4R1J A;  1VQD A;  2GVB A;  1NBW A;  3HOZ B;  3CRK C;  4Y7N B;  4LF6 Q;  2L55 A;  2B8F A;  1D5Z C;  4DV6 L;  1B7Y B;  1F2M A;  1IHZ A;  2EPB A;  3PIP 3;  5K36 G;  5A35 A;  4A3I G;  3M3Y H;  3NTI A;  3RNU A;  3L9A X;  3S1M H;  3D6C A;  3B6Y A;  4IFD J;  1FNW A;  4KHP Q;  2PO4 A;  3G4S A;  4S3S A;  4EQO A;  2EIF A;  4FF3 A;  4A3E G;  3IFT A;  4QY7 A;  1WTP A;  2VS1 A;  1BCP C;  1CKN B;  3KF8 B;  2Z1C A;  3QB3 A;  3K58 A;  1IW7 D;  2NZO A;  1XNR L;  3AFP A;  4WJ4 A;  1KDB A;  2PZT A;  1Q8I A;  2WP8 J;  3ND9 A;  1LO5 D;  3HOX B;  3S17 H;  1XWE A;  2PPB C;  3H94 A;  3J7Y W;  4LFA L;  1GUN A;  1MSH A;  4DR7 L;  3ICE A;  4FF1 A;  5FLM H;  5C4H A;  2K6A A;  1SE3 A;  4K0K L;  3HOU G;  2K05 A;  1MJC A;  4OX9 L;  2PQE A;  4FO2 A;  4DV7 Q;  4C3J B;  4QMG A;  4DR1 Q;  1K73 C;  1TU2 B;  3KFU A;  1TWG H;  2Y0S E;  4IPG A;  3DUZ A;  1IZ6 A;  1K0R A;  4DV0 Q;  1VQJ A;  2KCM A;  1C9O A;  2F0F A;  5C4Z A;  2YU9 B;  3RN2 A;  2NVQ B;  3K5O A;  3KF6 B;  1XNQ Q;  2L0C A;  1FJG L;  2IHE A;  2DNC A;  4AIM A;  1V8Q A;  5FO9 B;  1V1Q A;  4YHH L;  4POG A;  3QWN A;  1YJ9 A;  3V2T A;  4DK6 C;  3F1Z A;  1GUS A;  1EZ6 A;  3S17 B;  2NVX H;  1LAB A;  4DA2 A;  1STB A;  2LMC B;  5DM6 3;  4HJ8 A;  3J80 L;  2EY5 A;  3R3O A;  3SR1 A;  4JG2 A;  2NZH A;  3CAM A;  3HKS A;  3RZD H;  1VQM A;  2L15 A;  1I4H A;  2HDM A;  4CDD C;  2UU9 Q;  3FP9 A;  1IBL Q;  1YEZ A;  1KDA A;  4QJF A;  3CCR A;  4HTH A;  1S5C D;  3GTJ B;  1P16 A;  1RTN A;  1G6P A;  1T5E A;  3NPP A;  3K7U C;  5CR3 A;  2AWN A;  4K2L A;  2QW7 A;  3I72 A;  4BBR G;  1HZA A;  5IYC H;  1IBM L;  4JI6 L;  1H9K A;  3GDE A;  2AQ1 B;  2CWA A;  1MHW C;  1Q3L A;  2OCE A;  4DUY Q;  4XTC S;  3SK4 A;  2F0D A;  4RCO A;  2N55 A;  1CHP D;  3MA2 B;  3HKZ E;  3H0G H;  2J4X A;  5IGG A;  5KGU A;  3M4Y A;  3JAM L;  1SFO H;  1LTI D;  1EEF D;  1A62 A;  4QL5 A;  4QIW B;  1QVC A;  4GNX C;  1Y8N B;  2RA4 A;  5KYL A;  5G3L D;  3CD6 A;  3K0Y A;  1PZJ D;  4KJO A;  4JI5 L;  5ELO A;  5J3B A;  1IXR A;  3D4D A;  1TS2 A;  4OIK A;  1QVF A;  1BF4 A;  4FXG C;  2NVY B;  3DHQ A;  2NB0 A;  4K0K Q;  4K8J A;  1HUM A;  3MXN A;  4LUO A;  5GRO A;  3BYY B;  4A3L H;  2CKZ B;  4PZ8 A;  2CVR A;  1UEB A;  5EPK A;  4PV1 C;  4ZQ3 A;  5M5Y B;  5I9O A;  4HJ9 A;  1PH3 A;  2BA1 A;  2R7D A;  3C1E A;  4JI8 L;  1O7L A;  1STE A;  3KK7 A;  1K83 H;  2QKI C;  4IZ8 A;  1I3Q B;  1HH2 P;  1VQC A;  4JBW A;  1PYW D;  1SMY D;  1X65 A;  2E76 C;  1VS0 A;  2E75 C;  5JEA G;  2MUY A;  1EWH A;  4I7A A;  1X9N A;  1OTC A;  2QEX A;  4WJW A;  3URY A;  3K59 A;  4A93 H;  3TRE A;  5AJ3 L;  1PYB A;  5D14 A;  3NUC A;  4HN7 A;  3BZD B;  2F0H A;  3TQY A;  3E3X A;  3T1H L;  4QQB X;  1EIF A;  4M1U B;  4KHV A;  2KBN A;  1KAB A;  4PZ6 A;  1E1T A;  2ZJR A;  2K1B A;  2O4X A;  4DGZ A;  1NMF A;  1STY A;  3FPU B;  4OEL B;  3PUZ A;  3E5S A;  1WVL A;  1IL8 A;  5IT9 L;  4A3F H;  3HOW G;  4ZLT F;  1U5K A;  5LL6 X;  1Y1W G;  2MO1 A;  1HNW L;  1H95 A;  4YCW A;  1D7Q A;  1EU3 A;  3T4A C;  3HKZ G;  2P5Z X;  4F8M A;  1VQK A;  3FKI G;  1EOT A;  1SDF A;  4O2D A;  1OXS C;  3FRP B;  2KEN A;  5TSS A;  5FJ8 H;  1VQ9 A;  4ZUJ A;  4OO1 H;  5J39 A;  2B3G A;  4XQN A;  3GP7 A;  3AFQ A;  4ILW A;  2BH2 A;  5LMU Q;  4KKT A;  1GXD C;  3VYS A;  3NWT A;  4DNT B;  3MWY W;  4JK1 C;  2BOS A;  3GTO B;  4G7Z C;  2E2J H;  2ZTC A;  3F2U A;  3KJP A;  1VCI A;  3DWP A;  2MNA A;  3U58 A;  2VUM B;  2OTL A;  1Y69 U;  4JI1 Q;  4BBS B;  2HCI A;  1WD1 A;  1U0L A;  1S5F D;  4NB3 A;  4LFB Q;  1QZG A;  2YU9 H;  4FYD A;  1SLJ A;  1YHA A;  4LJZ C;  2A69 C;  2K75 A;  2QIL A;  1W2B A;  4EVO A;  4K5V A;  1I4G A;  1EQV A;  1TWA H;  3BU2 A;  1ROD A;  2B2V A;  3OMC A;  1VQ6 A;  1N33 Q;  5G3L F;  4N9T A;  4MNO A;  4NMZ A;  3OHX C;  3DMU A;  5KRU A;  2Q2I A;  4QCL A;  1RKN A;  4BA2 I;  4IFD H;  4RFB A;  4GKJ Q;  1E22 A;  4R9W A;  1S3O A;  4EQ5 A;  4A3C H;  3L3O C;  1S5E D;  1BBX C;  1VQ8 A;  1GUW A;  2K7V A;  1SE2 A;  5LMN W;  5JJK A;  5FO7 B;  2VQF L;  4CJ2 C;  2A8V A;  3VDY A;  1WTQ A;  5KIX A;  1C4Q A;  1A3T A;  4BWG B;  1NMG A;  1R4P B;  2K5W A;  1P8L A;  1MI2 A;  2XRS D;  4HJ5 A;  4ZCK A;  2X6G A;  1II3 A;  1NJI C;  4DK0 A;  4X3K A;  4H44 C;  5M5X B;  3MXN B;  3WOE A;  3PO3 B;  1X32 A;  1QNU A;  4CBV A;  1HNX L;  4GOP C;  1FD7 D;  1SNC A;  1X3G A;  1E2V A;  4R4T A;  1HHV A;  2HIX A;  3J80 c;  3SK5 A;  1YIT A;  1EY0 A;  3G6E A;  3PV0 A;  1FGU A;  5JPN C;  4RGN A;  4XIG S;  4JI4 L;  1BCP D;  3I8Z A;  4JI7 Q;  4QF4 A;  1OXV A;  1HNW Q;  5L37 A;  1EFW A;  1F9Q A;  2C35 B;  3ULP A;  1VQH A;  3FEW X;  4C1N K;  1E0B A;  4A76 A;  3Q22 A;  1H9S B;  4C3H H;  4LF7 Q;  4EX5 A;  1HCZ A;  1CA6 A;  1SE8 A;  4B3T L;  4FXD A;  3H15 A;  1D1K A;  2JA8 H;  3D8G A;  1PTO B;  3ZYY X;  4ME5 A;  2OQK A;  2CHB D;  4GN4 B;  4CKB A;  4DN4 M;  3S2H H;  2ID0 A;  2K52 A;  2HQE A;  2B63 H;  3R2T A;  3BYT B;  1YNX A;  5IE8 A;  2JA7 B;  3Q6S A;  5M3F H;  1AFP A;  3KLW A;  4OHJ A;  1YIJ A;  1MKH A;  5DNF A;  5IOC A;  4HJA A;  2K5Q A;  1HFN A;  1B53 A;  5AJ3 Q;  4U68 A;  4A4I A;  5C3E H;  2L4N A;  4OWX B;  4BXX H;  3CPF A;  2MGS A;  4H02 A;  1UNS A;  2CQO A;  3S14 B;  5CV4 A;  1WJJ A;  4R4Q A;  1B9M A;  2F52 A;  4P74 A;  1K3R A;  4L5Q A;  4RHS A;  3H6M A;  3PF4 A;  4Q5V A;  1AE3 A;  4QGU A;  1E2Z A;  5JEA H;  1JE5 A;  3NTK A;  4AYB B;  2NN6 I;  5CV5 A;  4G7H C;  4PMB A;  2LKV A;  2E2I H;  1HFG A;  5IYD G;  4ID6 A;  1K8M A;  3M3Y B;  2N8N A;  1I94 L;  5FOB B;  1PFS A;  2NN6 H;  1WD0 A;  3DXJ C;  3VR4 A;  5A2Q E;  1PH9 A;  4BY7 H;  3ONA B;  1LT6 D;  2F0E A;  4HCE A;  1KRT A;  4JI2 L;  1JQY D;  1HR0 W;  1LTL A;  3H91 A;  3NTH A;  4KK7 A;  4HMJ A;  1NUC A;  1K83 B;  4BY1 G;  5CV8 A;  1TWH B;  4MHE A;  1TWF B;  1ENF A;  3PIO A;  3A0J A;  2UXB Q;  5KYI A;  3L2P A;  1KRS A;  3S2D B;  2K14 A;  3U50 C;  3WWV A;  1PH5 A;  3OOC A;  4IFD G;  3J7Z C;  4DV1 L;  5C0X J;  2HIV A;  1HRJ A;  1SYE A;  2D0P A;  2IW3 A;  2RKS A;  4OIJ A;  3CXC A;  1MD2 D;  4DXG A;  2AQ2 B;  1FL0 A;  4GLA C;  3UI2 A;  4A3B B;  5LHY 1;  2UU9 L;  1LTA D;  1QCB D;  4AH6 A;  4F7X A;  3NBH A;  3HOX H;  1J5E L;  1C8C A;  3I56 A;  3GTO H;  4RAU C;  3RUZ A;  2DGY A;  3VR5 A;  4N8X 1;  5EAY A;  1FYC A;  1F2Y A;  1PFB A;  5DAU A;  2GN5 A;  3H09 A;  2LFN A;  4BA1 I;  3I4N B;  1XX8 A;  1DOM A;  4K5X A;  3CCJ A;  4A3G H;  3ER0 A;  1PH6 A;  1EOV A;  1A6X A;  5CV7 A;  1U4P A;  1UE1 A;  3G48 A;  4A75 A;  3ULJ A;  2NUC A;  2EXZ A;  1L0W A;  1JJG A;  1TKW B;  1CKN A;  1JOO A;  1WTV A;  4L5R C;  3Q24 A;  2PW5 A;  4QUC A;  3GQB A;  5ELB A;  1QWY A;  3N52 A;  1L0Y B;  4O1N A;  2Q2T A;  1M4V A;  4K14 A;  1A3V A;  3GTQ H;  1W6J A;  2K03 A;  4NPS A;  4LF5 L;  5DEH A;  3I55 A;  3CF5 A;  1EYD A;  3DM1 A;  1AEX A;  4JI7 L;  3BS1 A;  4IPD A;  4PMW A;  2PI2 E;  1G2S A;  2MO0 A;  4R8N A;  3A5U A;  4A3D B;  2F4I A;  3PO2 B;  2NVT B;  2EOT A;  1VQA A;  3R2I A;  4DR5 Q;  4CDE C;  4DK1 A;  2FMC A;  3D4W A;  1L1O B;  4NXM L;  1QB5 D;  5DLQ E;  2Z0S A;  4HSV A;  1E1O A;  4A3L G;  2E5L L;  5I6W A;  4YCV A;  3MFG A;  3TP5 A;  4C56 C;  2ZJQ A;  4A3M B;  5EJW A;  3QO2 A;  4IQZ A;  3KOJ A;  5AFW A;  3K0X A;  1G29 1;  2PYK A;  3TZU A;  3RZO H;  3S16 H;  2MJ8 A;  5BR8 L;  5T1G A;  1ENC A;  2BE5 C;  4GN3 B;  2KHS A;  3T1Y L;  1W3S A;  1Q1B A;  1W6K A;  1VQL A;  2F0M A;  3K7A H;  2F4V L;  2HCC A;  2IL8 A;  2JA8 G;  3HOU B;  1SMX A;  2KA7 A;  4JCV E;  3M7G A;  3H3V I;  1BCP B;  4QUF A;  1NR2 A;  4UP9 A;  3MFY A;  2HDL A;  4X66 Q;  4E6I A;  1Z9F A;  3GTG B;  1YBY A;  1HJP A;  3NK9 A;  2AUK A;  5M3M H;  3KF6 A;  4BY7 G;  3L0O A;  5CGK A;  1VQG A;  1DGS A;  4HSP A;  4BY1 H;  4A93 B;  4DAV A;  4N9P A;  2AMC B;  4L63 B;  1YHQ A;  2GVA A;  1GJX A; 
#chains in the Genus database with same CATH homology
 5IWA Q;  3DLL A;  1VQ4 A;  5FJ8 G;  1SFO H;  1Q86 C;  2XTI A;  2VQE Q;  1N34 Q;  1XMQ Q;  1A62 A;  4QL5 A;  1QVC A;  1HZ9 A;  4LWC A;  4GNX C;  4X64 Q;  1PH7 A;  1K9M C;  2WAQ G;  2ATW A;  4JV5 L;  5HGQ A;  1KC8 C;  2EXD A;  5M5Y H;  1HZB A;  4DR7 Q;  1K8G A;  3CD6 A;  5IP9 G;  1QUQ A;  1CKM A;  4X65 Q;  4AQY L;  1NY4 A;  4OX9 Q;  4JI5 L;  3I4O A;  4C2M H;  4A3I H;  1XMO L;  2CFM A;  1J6Q A;  2ZM6 Q;  5ELO A;  1OXX K;  4O0A A;  5J3B A;  2R93 H;  1IXR A;  3NBH B;  4GS3 A;  2ALY B;  1A63 A;  3T1Y Q;  4UY8 C;  1QVF A;  1TWH H;  2KCT A;  1Q12 A;  4B3M Q;  3CCE A;  4K0K Q;  1R9T H;  2K5V A;  4LUO A;  3G71 A;  5GRO A;  4A3L H;  2E5L Q;  2CKZ B;  3K80 C;  2PQA A;  1UEB A;  4P71 A;  4PZ8 A;  4UP8 A;  2VQE L;  4DV5 L;  1UE6 A;  4HJ9 A;  3UDI A;  1EWI A;  3A74 A;  5M5W H;  5LMN L;  1PH3 A;  2BA1 A;  4JI0 L;  1WCM H;  4DV4 Q;  4YWL A;  4UP7 A;  2R7D A;  4JI8 L;  2ZJP A;  1K83 H;  5C4X G;  1HH2 P;  1VQC A;  1Q81 C;  3I4M H;  1YHQ A;  4JBW A;  1VQ7 A;  1X65 A;  2UXC L;  1VS0 A;  4LFC L;  5JEA G;  4DR3 L;  4A3J G;  5C4X H;  1X9N A;  3S14 H;  1OTC A;  2A19 A;  3D0F A;  4PZ7 A;  2QEX A;  4GKJ L;  4A93 H;  3TRE A;  5AJ3 L;  1PYB A;  1E7Z A;  5C4J H;  2AKW B;  3H0G G;  3UDF A;  3F2C A;  2PMZ E;  3TQY A;  1Z47 A;  3T1H L;  2JA5 H;  4DV7 L;  1EIF A;  1XJV A;  4QQB X;  2F4V Q;  1JJC B;  5C0X G;  2KBN A;  3GTM H;  4PZ6 A;  1E1T A;  1KAW A;  5HY6 A;  5FLX c;  1GO3 E;  2ZJR A;  3AEV A;  4DNI A;  3CC7 A;  4DUZ Q;  1NMF A;  3U4Z A;  3OTO L;  4MZ9 A;  1IYJ B;  3HOV G;  1JT8 A;  1HZC A;  1PA6 A;  3PUZ A;  1I6H H;  3ULL A;  1XMQ L;  1EYG A;  4DR4 L;  4LF6 L;  1NE3 A;  4A3F H;  3HOW G;  1FJG Q;  4LW1 A;  1U5K A;  3TEH B;  4X66 L;  4TQU S;  2ZTE A;  1Y1W G;  2MO1 A;  4JV5 Q;  1PYS B;  1AE2 A;  3RLN A;  5C44 H;  1N36 Q;  2LXK A;  3BZK A;  2JA7 G;  4IJL A;  3S2D H;  1HNW L;  1C0A A;  1H95 A;  1LUZ A;  1OXU A;  2OQ0 A;  4ME3 A;  4YCW A;  2VQF Q;  1WFQ A;  3IRB A;  5C0X I;  4DV3 Q;  4DV2 L;  1D7Q A;  3M9B A;  1VQK A;  1GD7 A;  3HKZ G;  4LF9 Q;  3FKI G;  2JA6 G;  1UE5 A;  4O2D A;  2VW9 A;  4R4I A;  2ZM6 L;  2R7Z G;  1OXS C;  3CCL A;  2KEN A;  4P72 A;  4L5T A;  2B29 A;  5FJ8 H;  1KQS A;  3PUW A;  4DV5 Q;  1VQ9 A;  1SRO A;  4LFB L;  1X55 A;  2RHQ B;  2FXQ A;  2B3G A;  3CP0 A;  2NVT H;  3OTO Q;  4IOC A;  3J7A 5;  5LMN Q;  3AFQ A;  3I4N H;  2BH2 A;  2Q2H A;  5LMU Q;  2UXD L;  2IT1 A;  2JA9 A;  1T9H A;  4GNX B;  1I50 H;  4DAY B;  2CCZ A;  1WI5 A;  3KYH C;  2RCN A;  4JOI A;  4LF8 L;  1VQI A;  2UUB L;  2UUC Q;  2E2J H;  2ZTC A;  3KJP A;  1VCI A;  4LF9 L;  1Y1V H;  3EN2 A;  1LYL A;  2MNA A;  3U58 A;  4A3M H;  2OTL A;  4A3B H;  2VL6 A;  4HIK A;  1L2F A;  3OYY A;  4JI1 Q;  2QGQ A;  1PV4 A;  1U0L A;  1AH9 A;  4GN5 A;  4A93 G;  4NB3 A;  2AWO A;  2F3I A;  4A3J H;  1QZG A;  1YJN A;  2YU9 H;  4LFB Q;  1HNZ Q;  1SLJ A;  1L1O A;  1YHA A;  2R7F A;  1N8R C;  3PO3 G;  2K75 A;  3D31 A;  3J81 i;  2MFI A;  1W2B A;  4B3S Q;  3A5Z B;  3BU2 A;  1TWA H;  3AYH B;  1VQ6 A;  3CCU A;  1N33 Q;  4GLX A;  4MNO A;  5C44 G;  1HNX Q;  2I5H A;  1L1O C;  2I5M X;  2Q2I A;  4BA2 I;  4A3C G;  2YTV A;  1KIX A;  1YZ6 A;  3W1G A;  4LF8 Q;  3LGJ A;  3RN5 A;  1PH1 A;  3CC2 A;  2E8G A;  2QA4 A;  1RIP A;  4GKJ Q;  3GTL H;  1CKO A;  5C3E G;  1E22 A;  1S3O A;  4EQ5 A;  2VUM H;  4A3C H;  4RMF A;  2YTY A;  4UPA A;  1HR0 L;  1VQ8 A;  4WJ3 M;  2LSS A;  1X6O A;  5LMN W;  5JJK A;  3HFZ B;  2R92 G;  1GM5 A;  1VQB A;  2VQF L;  4DV2 Q;  2A8V A;  3M4P A;  3S1N H;  4YHH Q;  3VDY A;  3GTK H;  3S1Q H;  4JI3 Q;  1YHB A;  3L7Z C;  4BBR H;  1NMG A;  4OO1 I;  1P8L A;  2GVA A;  3JC6 6;  2JQO A;  2K5N A;  1V9P A;  1KXL A;  4HJ5 A;  4X6A H;  4OWT B;  1NJI C;  2IX0 A;  3MXN B;  3MEF A;  5LMU L;  1N33 L;  2UXD Q;  3CCV A;  2K50 A;  3GTG H;  3E0E A;  1HNX L;  3TS2 A;  4GOP C;  2IHF A;  4B3R L;  5M5X H;  4IPC A;  1PH2 A;  4HID A;  1KL9 A;  2B63 G;  1X3G A;  5JEA J;  4HIO A;  1VQO A;  4R4T A;  2JA7 H;  2HIX A;  3J80 c;  1YIT A;  3G6E A;  3I7F A;  4PG3 A;  3PV0 A;  1FGU A;  4LF4 L;  2I0Q A;  1KD1 C;  4XIG S;  3I4N G;  3PO2 H;  4JI4 L;  4P75 A;  2UXB L;  4JI7 Q;  3CCM A;  2V1C C;  1OXV A;  3GTJ H;  4JOI C;  3KDF B;  1CUK A;  4R4O A;  1N36 L;  4JBK A;  1HNW Q;  1UE7 A;  1EFW A;  2C35 B;  3ULP A;  2XGT A;  1VQH A;  1IBM Q;  1ASY A;  3STB C;  4A76 A;  1HNZ L;  4C3H H;  4LF7 Q;  4JI1 L;  2KHI A;  3PO3 H;  3S15 H;  4EX5 A;  3GO5 A;  1G51 A;  3M4O H;  1ASZ A;  4Y7N H;  1S72 A;  1SE8 A;  2JJQ A;  1EUJ A;  1YVC A;  2YYZ A;  2OWO A;  3NEM A;  5H1S E;  4B3T L;  3CCS A;  2NVY H;  3H15 A;  2JA8 H;  1A8V A;  3F2D A;  1Y1W H;  4P73 A;  2OQK A;  3KDF A;  4GN4 B;  3S2H H;  1Y1V G;  2ID0 A;  2K52 A;  4DV6 Q;  2B63 H;  1QUQ B;  4BBS H;  3M4Q A;  3FKI H;  4IJH A;  1YNX A;  5IE8 A;  3K8A A;  4KHP L;  3UE1 A;  2N3S A;  1BBW A;  3PIP A;  1EQR A;  5M3F H;  4X62 L;  2ZTD A;  3KLW A;  1NTG A;  1YIJ A;  1Q82 C;  1MKH A;  1VQF A;  1SN8 A;  2Z6K C;  3JAM c;  3JAM i;  3PGZ A;  3M85 A;  2WB1 E;  4HJA A;  1VQ5 A;  2HHH Q;  2Q2U A;  4NXN Q;  5AJ3 Q;  1XPU A;  4IFD I;  4A4I A;  4AQY Q;  3U4V A;  5C3E H;  2VNU D;  4OWX B;  5IYB H;  1OXT A;  4BXX H;  5GAH C;  2OTJ A;  3CPF A;  4H02 A;  2RHS B;  3FHW A;  2CQO A;  4J15 A;  4QIW E;  1QVG A;  1WJJ A;  2PQA B;  5E7N A;  4R4Q A;  2F52 A;  3KJO A;  3HOV H;  4P74 A;  1K3R A;  4L5Q A;  2K4K A;  3PF4 A;  2BA0 A;  2D62 A;  1AE3 A;  2UUA Q;  2JA6 H;  3HOY G;  3BZC A;  4QGU A;  1N9W A;  3I4M G;  4LUZ A;  1PH4 A;  3TRZ A;  3UDX A;  1Q1E A;  1VQE A;  5IYC G;  1JE5 A;  1JB7 A;  3ZJY C;  4YCU A;  2NN6 I;  2K5H A;  5IYD H;  1D8L A;  4LFA Q;  4A3M G;  1GVP A;  1CSP A;  1XMO Q;  4IOA A;  2E2I H;  3PF5 A;  4DV4 L;  4DK3 C;  2JEB I;  5IYD G;  4LF4 Q;  2JEA I;  4IPH A;  1V43 A;  4NXN L;  3W1B A;  2N8N A;  1I94 L;  2R7Z H;  1MIU A;  4DUY L;  1PFS A;  1X56 A;  3TS0 A;  3RLO A;  3PCO B;  3J81 j;  4JC0 A;  4DR3 Q;  4LFC Q;  2AHO B;  3E9H A;  1PH9 A;  4BY7 H;  3S24 A;  2WB1 G;  4DR1 L;  4TVA B;  4JI2 L;  1KRT A;  3K81 C;  4OON A;  1HR0 W;  4GKK Q;  1BKB A;  1LTL A;  1WCM G;  1C7Y A;  2UUA L;  1Q8K A;  4A3K H;  4JI0 Q;  4BY1 G;  3M7N A;  2Z6K A;  3T1H Q;  4DR5 L;  4IO9 A;  2E2H H;  2DUD A;  3PIO A;  3A0J A;  1S40 A;  1J5E Q;  1FVI A;  1SR3 A;  5GAD C;  4NXM Q;  4JI4 Q;  3GD7 A;  2UXB Q;  3L2P A;  1KRS A;  4DR2 Q;  1N32 L;  5M3F G;  2K14 A;  4LF5 Q;  2A1A A;  1Y14 B;  3U50 C;  1WYD A;  4R4C A;  2R93 G;  3WWV A;  3F2B A;  1I94 Q;  1PH5 A;  4IFD G;  4MTN A;  2UUB Q;  2VZA A;  3J7Z C;  4GNX A;  4DAM A;  2HHH L;  4YY3 L;  1UWV A;  3CME A;  4JYA L;  4DV1 L;  5C0X J;  1I3Q H;  2HIV A;  4C3I H;  3CMA A;  4JI5 Q;  3H3V H;  4RG1 A;  1E3P A;  3PSI A;  4A3F G;  2ES2 A;  1BVS A;  2D0P A;  4KLK A;  1BBU A;  1IBK L;  3CXC A;  2PI2 A;  4YWK A;  3BJU A;  5IT9 c;  1FL0 A;  4GLA C;  4APV A;  2JK8 A;  2Y0S G;  4DUZ L;  4LF7 L;  2N49 A;  1QZH A;  1B8A A;  4DKA C;  4LUV A;  1IL2 A;  4R1J A;  2UU9 L;  3GTP H;  1VQD A;  4AH6 A;  2GVB A;  2I5L X;  1NBW A;  3HOX H;  4POF A;  1J5E L;  4LF6 Q;  5IWA L;  5IYB G;  4BXX G;  5IY0 A;  3I56 A;  4DV6 L;  2JA5 G;  1B7Y B;  3J80 i;  3GTO H;  1LM0 A;  2DGY A;  4DR6 L;  5K36 G;  3HOX G;  5EAY A;  2ASB A;  4A3I G;  5GAG C;  3M3Y H;  2GN5 A;  2R92 H;  1CSQ A;  4BA1 I;  3RNU A;  1XNQ L;  4X65 L;  3CQZ H;  3E9I A;  3S1M H;  1SRU A;  1HR0 Q;  3B6Y A;  5BR8 Q;  3I2Z A;  3CCJ A;  4KHP Q;  4IFD J;  4A3G H;  3STB D;  3ER0 A;  4X62 Q;  1KHI A;  3G4S A;  3SGI A;  5IP7 G;  1PH6 A;  1EOV A;  2EIF A;  4A3E G;  3PUX A;  3S1R H;  4QY7 A;  3G48 A;  1UE1 A;  4A75 A;  3ULJ A;  1L0W A;  2VS1 A;  1JJG A;  1CKN B;  3KF8 B;  4A3E H;  4A3D H;  1CKN A;  4L5R C;  4A3B G;  2EQS A;  4B3T Q;  3ERS X;  2CWP A;  3HOW H;  1JMC A;  1K8A C;  3CC4 A;  1O7I A;  3W5O A;  4GOP A;  3UE0 A;  2H5X A;  2NZO A;  1IBL L;  1XNR L;  3AFP A;  3OW2 A;  2JE6 I;  1Q7Y C;  2UUC L;  4WJ4 A;  2LXJ A;  2WP8 J;  3HOZ H;  1X3E A;  3S17 H;  2Q2T A;  1YJW A;  3GTQ H;  4ALP A;  4NPS A;  3Q8D A;  4LF5 L;  2VY3 A;  4JI6 Q;  4LFA L;  3I55 A;  3CF5 A;  2UXC Q;  4X64 L;  4JI7 L;  3PUV A;  4DV3 L;  4DR7 L;  4IPD A;  4PMW A;  4LNQ A;  2PI2 E;  3ICE A;  1IBK Q;  2RF4 A;  4OO1 G;  4DV1 Q;  4JBM A;  1Q46 A;  2MO0 A;  3NEL A;  3AQQ A;  5FLM H;  3A5U A;  5JJL A;  3F8T A;  1XPO A;  4K0K L;  3HOU G;  1VQA A;  1MJC A;  1JJ2 A;  4KHZ A;  1TWF H;  2PNH A;  4OX9 L;  3H0G H;  1EQQ A;  2BH8 A;  5FLM G;  4DV7 Q;  4JBJ A;  4DR5 Q;  4DR1 Q;  1K73 C;  1M1K C;  3KFU A;  1TWG H;  2Y0S E;  4IPG A;  1L1O B;  1IZ6 A;  1K0R A;  4NXM L;  4DV0 Q;  1VQJ A;  2KCM A;  1C9O A;  5GAE C;  2NVQ H;  2R6G A;  1N34 L;  4L5S A;  1N32 Q;  4YWM A;  3RN2 A;  5DLQ E;  2Z0S A;  3EIV A;  4GLV B;  1E1O A;  2WAQ E;  4A3L G;  2E5L L;  4YCV A;  4AYB G;  3KF6 B;  2ZJQ A;  1YI2 A;  1XNQ Q;  4A3G G;  4DR6 Q;  4AYB E;  1FJG L;  2IHE A;  2HT1 A;  4DR2 L;  4AIM A;  4HJ7 A;  3HOY H;  3KOJ A;  1V1Q A;  1WOC A;  3K0X A;  4YHH L;  4POG A;  1YJ9 A;  1G29 1;  4DK6 C;  3F1Z A;  3RZO H;  1XTD A;  3CCQ A;  1EIY B;  3S16 H;  2NVX H;  5BR8 L;  4YY3 Q;  4GN3 B;  4JYA Q;  3T1Y L;  3RLF A;  5M3M G;  1RL2 A;  4A3K G;  1W3S A;  1Q1B A;  1PVO A;  5IP9 H;  2HQL A;  4HJ8 A;  4A3D G;  3PO2 G;  1VQL A;  2F4V L;  3K7A H;  2JA8 G;  1PHJ A;  4FDB A;  4JI2 Q;  1XPR A;  4B3R Q;  4JG2 A;  2NZH A;  5GQO A;  2KHJ A;  4DV0 L;  3CAM A;  4B3M L;  1SMX A;  1VQN A;  3HKS A;  3RZD H;  1VQM A;  4DPG A;  2L15 A;  3HOU H;  2NN6 G;  1VQP A;  5JJI A;  4JCV E;  5ELN A;  1PH8 A;  4B3S L;  2UU9 Q;  1E24 A;  3FP9 A;  1IBL Q;  1YEZ A;  4C3J H;  4QJF A;  3H3V I;  3CCR A;  4JI8 Q;  2IX1 A;  4UP9 A;  4HIM A;  4DR4 Q;  3PUY A;  1P16 A;  3NEN A;  1TWC H;  2IY5 B;  1G6P A;  4X66 Q;  2D0O A;  3K7U C;  2AWN A;  1X54 A;  1Z9F A;  1XNR Q;  1YBY A;  1HJP A;  2MQH A;  1GKH A;  5IP7 H;  5M3M H;  4BBR G;  1HZA A;  5IYC H;  3KF6 A;  1IBM L;  4JI6 L;  3GDE A;  4BY7 G;  1MJE A;  2CWA A;  3L0O A;  4GOP B;  2OCE A;  4DUY Q;  1M90 C;  1X3F A;  1VQG A;  2YV5 A;  2VUM G;  1DGS A;  2N78 A;  4XTC S;  3UDG A;  3DM3 A;  3CPW A;  4BBS G;  1A0I A;  4JI3 L;  1B70 B;  4BY1 H;  4KI0 A;  1TXY A;  3RR5 A;  1I5F A;  3J81 c;  4GKK L;  2AMC B;  3EBE A;  4OWW B;  2YTX A;  3CW2 C;  4OXP A;  3HKZ E;  2WFW A;  3HOZ G;  4Y52 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...