2SNSA

Staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
141
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFNKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Staphylococcal nuclease: proposed mechanism of action based on structure of enzyme-thymidine 3',5'-bisphosphate-calcium ion complex at 1.5-A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
molecule keywords THERMONUCLEASE PRECURSOR
total genus 25
structure length 141
sequence length 141
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1982-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2snsA00
3OMCA 4EQOA 2EXZA 3BDCA 3EVQA 5IGGA 4PNYA 2PW5A 5CC4A 3NK9A 2PZTA 4E6IA 2F0LA 1A2TA 1SYFA 5DEHA 3SHLA 1SNDA 1EY9A 2PW7A 3HZXA 1A3VA 3P75A 4HTHA 2KQ3A 5JOBA 3VA5A 2EYLA 2RKSA 4DU9A 5DAUA 2RBMA 4DGZA 2F0MA 3LX0A 3ITPA 3D6CA 5CV8A 3SK4A 5J1ZA 5IOCA 2PQEA 1EY8A 1SNMA 3TP8A 2EYHA 2SNSA 3D4DA 4IZ8A 4N9PA 1EZ6A 4WORA 4WRDA 5E3FA 5IIFA 2OXPA 4IUNA 3EJIA 2F0KA 5J22A 2F3VA 1STYA 3OMGA 5KGUA 1EY6A 4ZQ3A 5HURA 3NUCA 5I9OA 3C1EA 2QDBA 4K8JA 2EYPA 4QB4A 5E1FA 3S9WA 4EQNA 1SYEA 4F8MA 3MHBA 1U9RA 2EYFA 5KYIA 4QMGA 1EYCA 1RKNA 1JOQA 1A2UA 3RUZA 4K5XA 1ENAA 4K5VA 2F0FA 4H7BA 5CV4A 5IGCA 2SOBA 5CGKA 2F0NA 4ID6A 4LAAA 4K6DA 2F0PA 2F0HA 4KD3A 3TP7A 1SYDA 2EY5A 1EYDA 2M00A 4G57A 4KY6A 1SYCA 2LKVA 4RKLA 4KV6A 3V2TA 5IGDA 3T13A 2PYKA 1JORA 5KYLA 4J6HA 5NUCA 3SK5A 3D8GA 3HEJA 5C3XA 5C3WA 5C4ZA 5I6YA 4K8IA 3R3OA 1KABA 5IGEA 2RDFA 4OL7A 4PMCA 1STBA 5EKKA 4TRDA 4DF7A 3NHHA 2F0TA 1EY7A 1TQOA 4IALA 2EY1A 1STGA 2F0GA 1IHZA 4K14A 4NKLA 4PMBA 1SNQA 2EY2A 2NUCA 3OSOA 3QOLA 1JOKA 3T16A 3C1FA 5CV9A 5C5MA 1SYBA 2F0IA 5F2DA 4EQPA 5KEEA 2EYMA 2F0WA 2F0JA 3BDLA 4F7XA 3TMEA 3MVVA 5IGBA 5KIXA 2F0UA 5HGTA 1A3TA 1EZ8A 1SNOA 1STAA 4RKBA 5CV5A 1NSNS 2O4XA 1II3A 3MZ5A 3E5SA 1JOOA 3SR1A 3QOJA 1EY4A 4I65A 4EVOA 5IGFA 4KJOA 3MEHA 4QF4A 3ERQA 4KTAA 2KHSA 5EGTA 3QB3A 2F0DA 4KY7A 5M9OA 1EQVA 3OWFA 4KY5A 2HQEA 2PZUA 4K2LA 4HMJA 3SXHA 1NUCA 3PMFA 1STHA 5CR3A 3NP8A 1F2YA 1SNCA 3TP5A 5IODA 1A3UA 4YIJA 5ISRA 1ENCA 5C4HA 2PZWA 5JAVA 5KRUA 1AEXA 1TR5A 5CV6A 2F0VA 4B9WA 5CV7A 3DMUA 1TT2A 2F0OA 3EROA 4DFAA 4ZUJA 5I9PA 1SYGA 1F2MA 1KAAA 2EYOA 3NQTA 2ENBA 1KDAA 2EY6A 3MXPA 4K2KA 4KJNA 2F3WA 4ODGA 2F0QA 2F0EA 2OEOA 1EY5A 4HMIA 3NXWA 4S3SA 2F0SA 4R8NA 4NP5A 2SNMA 4J1MA 4KD4A 4NDXA 5C6AA 1KDBA 4K5WA 3DHQA 4B9XA 1F2ZA 1EY0A 2OF1A 4NMZA 4N9TA 3SK8A 1EYAA 3TP6A 5I6WA 5K5PA 5J39A 3H6MA 2EYJA 5C5LA 2WACA 5EKLA 3U9OA 1STNA 3SK6A 4ME5A 4ZUIA 1SNPA 3D4WA 1KDCA 4MIUA 3P1HA 4KHVA
chains in the Genus database with same CATH superfamily
1ICWA 2K14A 2K28A 4CJ2C 3RLNA 3VDYA 4A3CG 3GTLB 3Q8DA 1Y69U 4WORA 1L1OA 2OXPA 4X62Q 2E8GA 3BVMA 1JR0D 5HURA 1V1PA 4P73A 4DUZQ 1QCBD 2VS1A 3KDFA 1HHVA 1AFPA 2KCTA 4EGVA 4WJWA 1EEFD 1JMCA 1R4QB 3KLSA 4LF6Q 4BA2I 3CPWA 4BA1I 3E9HA 5EGTA 2EY5A 2WAQG 4RKLA 2A19A 5JJIA 5IP9G 1M4VA 3J7ZC 1N36L 2BDOA 4LW1A 2N3SA 1DXMA 1V43A 3I70A 1LV9A 2KHIA 1KC8C 1HNWQ 2XTIA 4P2CB 5EKKA 5BR8Q 3KOJA 1JWMD 1K8MA 1GM5A 2B2TA 2NUCA 2K50A 4RWSC 1SYBA 1ILQA 2XN9C 4R4OA 4FYDA 4CHTB 1SMYC 4V190 2I07B 3TMEA 3MVVA 2JN4A 3MFYA 4F7XA 1W2BA 3S15H 4GKJL 1XPRA 3TEHB 1A6XA 2R7FA 1GUOA 1CHQD 1CK1A 1KQSA 1C9OA 2FHTA 1I5FA 1OXSC 1PH9A 5JEAJ 1J8IA 5C3EH 2YYZA 3FHWA 2J7ZA 1B50A 1X54A 5ELOA 1B44D 2D0PA 3K8AA 3G4SA 1W3SA 5TSSA 1CZGA 1YIJA 3HOYH 2A6ED 3WOFA 4DR6Q 2MJ8A 1VF5C 2AQ2B 3TSSA 1Q46A 3QWNA 5GAEC 2F4VQ 4DFAA 1NJIC 5I9PA 4L5RC 1RHPA 3M7NA 3RZOH 4QUCA 4ZKCB 4DV1L 2IY5B 1IBLL 5LMNQ 4IFDH 1QILA 1WTWA 1HA5A 4A3JH 2A6HC 1A0IA 1EIYB 3TS2A 3C2PA 1YEZA 4IFDI 1F9PA 2EYJA 1Q12A 3I2ZA 1EQQA 4MTNA 3P1HA 5FO7B 4DNTB 4AQYL 4DNIA 1SN8A 3S17H 5IGGA 1G2TA 5JPMC 5CC4A 3HOUB 5D14A 1HUNA 4YY3L 2CWAA 3RN5A 1VQOA 1WTHA 5J39A 3FPPA 4KKSA 2CWPA 2HDLA 2Z6KA 3LX0A 3PO2G 5J1ZA 2PQEA 2EXDA 2E5LQ 2ZJPA 3HOXB 1G6PA 2E5LL 3H0GH 1GO3E 3EQLC 5JEAH 1EIFA 4EQNA 3RN2A 4IOCA 1G6ZA 2MGSA 4QMGA 3CCQA 1EYCA 4JK1C 4AQYQ 4IUVA 1UE7A 1PRTF 4ID6A 4KLKA 2QKIC 3K0YA 2F0HA 4JI5L 3OW2A 1IZ6A 2M00A 5KGUA 2IL8A 3SGIA 5IGDA 3FMCA 4JI7Q 1HA6A 3D8GA 1I6HH 3CP0A 2R92G 1DOMA 1G2SA 2RDFA 4BBRB 4TRDA 2NBFA 3PIO3 4A3JG 2EY2A 1LTGD 1SJHD 2NB0A 4A3DG 5CV9A 1GUWA 4DUYL 3PF5A 1PDQA 1IBMQ 2R7ZG 2K7VA 1F9QA 1Z47A 1EZ8A 1S40A 3NWSA 2O4XA 4HCEA 1I94L 3DWAA 3OYYA 1RODA 2B2VA 3JAME 1XMOL 3FVQA 2E2JH 3PCOB 4K2LA 1YVCA 5JJZA 1FNUA 4A3IB 3GTMH 1QUQB 1ENCA 4DV0Q 4DV6L 5GAHC 2F0VA 5C0XG 3K0XA 2EYOA 2DJGC 2VY3A 1DOLA 2Z4HA 5IYBG 4GKKQ 2KA7A 5LMUQ 1ICFB 4A3LG 5C4JB 3PGZA 3MXNB 1D2BA 1VQJA 2B2UA 2WV6D 5AFWA 4A93B 1TS5A 3SK8A 2AMCB 2RSNA 1WTPA 1VQBA 2YV5A 2E74C 4LFAQ 3VA7A 4N8X1 1AZPA 4MTKA 5C4XH 1AH9A 2HCIA 1XWEA 3H91A 1NR2A 3KF6B 4GN5A 3TREA 4KHVA 3J81E 3HKSA 1FR3A 3S1RB 2B2WA 3LNNA 5GQOA 1FGBD 3T1YQ 3S1MB 2MFIA 2LY7A 3MTSA 1HFGA 3PSIA 4TSSA 2RVLA 3J80L 2X6LA 2G9HD 1DJRD 1J5EQ 1LTTD 3BDOA 3SK4A 2L55A 2IJ0A 3GTGB 4CKBA 5E3FA 2AKWB 4CDEC 1SE4A 1CSPA 2IX0A 3NUCA 4ULLA 4DR7L 3H3VI 2KUMA 4B3TQ 2JA5G 2E75C 3MHBA 2UU9L 5KYIA 1PH8A 1VDZA 1K8GA 1PVOA 2VXWA 5I2YA 4CBVA 2F03A 3KFUA 2WKDA 4CDFC 1WJJA 4KHPQ 4RH6A 2HUGA 5ELDA 3J81i 2BE5D 2GA4B 3JC66 2VQFQ 1CFMA 4JYAL 3K7AB 1ESRA 4J8QA 3SK5A 1N33L 2NVTH 2CH4A 4K8IA 3Q23A 4GOPC 4YCWA 3KF8A 4OEMB 1EY7A 4A3GH 4C1NI 1LT6D 3K5NA 4AIMA 2ZXOA 4HJAA 1HR0L 2F0UA 1YITA 4RKBA 3D31A 5CBAE 3I8ZA 3CF5A 4KJOA 1BR9A 4JI1L 4YCUA 1HRJA 2KHSA 1RJTA 1NCVA 4DR2L 3K6OA 3RNUA 4RG1A 3OWEB 4M1UB 3SXHA 2K75A 2R92H 3F2UA 3F2DA 4OELB 4YIJA 3PUXA 1SXTA 4CGYB 1DCZA 3AFQA 2BDNA 4YWKA 1HR0W 3K5LA 2F0OA 3K81C 4A3GG 2K5VA 2R7ZB 2F3WA 4X3KA 1MD2D 5M5WH 3CD6A 4O2DA 1LO5D 1IL8A 4K5WA 1EWHA 1Q82C 4P72A 1EY0A 3BZDB 4FF1A 1XNRL 4WJ4A 4A3EG 2G9DA 3S1QH 1A8VA 2WKCA 4L5QA 4ABNA 3HOVH 2PI2A 3D4WA 3H3VC 3N52A 4LFBQ 2EXZA 2E2IH 1ZEQX 2KHJA 2L9HA 2JA5H 2B63G 2VL6A 3S14H 4DKAC 1GUTA 2A69D 4L5TA 1UUPA 1Y8OB 1SNDA 4JI2L 1SAPA 4R9WA 2Q2IA 1F9SA 2JSOA 4R4IA 1SNMA 4WFN3 3S14B 1SROA 1CA5A 1SDFA 2B8GA 5FOBB 1STYA 2ZXPA 4ZQ3A 5C44H 3PO3B 1IBML 5GROA 3BU2A 1QOHA 3MXNA 3I4MG 3S2HH 1C48A 2XNAC 2YTXA 2VQEQ 4LF5L 4B3TL 4UY8C 4DXGA 1MJEA 2NVXB 1HNZQ 3M85A 1E2ZA 1ET6A 1DD2A 3M7GA 2VUMG 2PYKA 2C5CA 1S5FD 5IGEA 2FJ2A 1BUVT 5FK9C 3CCSA 2A8VA 1H9SA 3T16A 2CFMA 3C1FA 3GD7A 4A3BH 3IL8A 2ZJRA 1JWSD 4DR4Q 1MSGA 2N78A 2QGQA 4C56C 1NSNS 2JEAI 3F8TA 2A74C 3C3LA 1BOSA 4YCVA 4DUZL 4FP5D 4JBWA 1M8AA 3GQBA 5JPNC 4KHZA 5LL6S 4KY7A 4GNXB 1EQVA 2A6EC 2MO1A 4G7HC 3PMFA 3KLSX 1XMQL 1XYIA 2PZWA 1DONA 2FFKB 2BA0A 1HR0Q 5CV7A 5M5XH 3HOZH 4TVAB 3D0FA 1IYVA 1FJGQ 1Y1VB 4DV4L 3BYYB 2YU9B 1I4QA 1XXGA 1VQPA 3PQIA 3E3XA 4GLXA 1SFOB 2Y0SG 1LABA 3TP6A 3WDNA 5K5PA 4JI2Q 3J81j 3QIAA 3OTOL 3BZCA 4IO9A 1U4MA 1B3QA 5ELBA 2R93H 2F4VL 1UE6A 3MWYW 4HIMA 1D7QA 1X65A 4PNYA 2B2YC 3NK9A 1IL2A 4LFBL 1H9KA 2UU9Q 1EY9A 1BBUA 3KDFB 1YBYA 2LXJA 1WCMH 1P16A 3D4DA 1X55A 1OXXK 2WINB 1R9TH 2E2HB 1I4RA 5M5YH 3RD4A 2F3VA 1LLRD 1NMGA 4HJ7A 3S9WA 2MPMA 3SDZA 3S16B 3PF4A 3DM1A 3GTKB 3A74A 3D6WA 1U4LA 3CC4A 2F0NA 3J7A5 1U4RA 1L0XB 1CQFA 3L2PA 3F2BA 4KY6A 4BY1G 1DGSA 3M4QA 4KV6A 1M90C 1TWGH 3FEWX 2N49A 1NMFA 2VUMH 1Y1WG 5C4ZA 3I4NB 4I7ZC 4KMUC 4BS9A 4DF7A 4GNXA 1GOZA 1NAPA 3IRBA 4YY3Q 4NKLA 2L1BA 1Y8NB 3L3OC 4QJFA 4DV5L 5JJKA 4UP9A 1GXDC 3PV0A 5JJLA 1VQMA 4GN4B 2BH8A 4POGA 1HZBA 3MEHA 4QF4A 5DLQE 4C3IG 4DR3L 1E1TA 2G5DA 1AZQA 3OWFA 1XJVA 4HMJA 1IBLQ 1RIPA 1STHA 3AB9A 4K0KL 2GN5A 1KNAA 2VNUD 1YNXA 2Z6KC 2JA7B 1J9OA 3HKZG 1TS2A 4NW2A 1AW7A 4M8AA 2EY6A 1PRTC 1XTCD 2IPKD 2R6GA 4HSPA 4DR5L 3CKIB 4CDCC 1EWCA 5IYDH 3GTOH 1Y1WH 3A8IE 2OF1A 4DA2A 3R93A 1L1OB 4BY1H 2KENA 2XWBB 1PV4A 4U68A 4ZKBB 1BCPD 4QIWE 5ELEA 2Q2HA 1X3GA 1ZXTA 2NWGA 2PZTA 3M4OH 1S5DD 1L2FA 1HXYD 1A3VA 1B7YB 1GHJA 5DAUA 2RBMA 3D6CA 2JQOA 4QGUA 3HKZB 2FXQA 1Q7YC 1EOTA 1WCMG 2EYHA 3W3AA 4GN3B 4IFDG 4H13C 5LMUL 1WTRA 1H9MA 4L5SA 4JI8L 5E1FA 4LF6L 4F8MA 2J4XA 3L7ZC 3JAMc 4A3KB 4RGOS 1VQ4A 3U58A 1A2UA 1PLFA 1L1OC 4LK1C 5GADC 2OQ0A 1KRTA 1ZYRD 3ULPA 1SYCA 3NTHA 4GLVB 1BXTA 5KYLA 5NUCA 1WI5A 3GTQB 4X66Q 4PZ8A 4IUTA 5I6YA 1MIUA 2R61A 3H94A 4JBMA 4OL7A 2K5DA 3EIVA 1LTSD 1BO0A 1W6KA 1STGA 4DV1Q 3STBD 4A3FH 1KD1C 2NVQB 3GTQH 3HKZE 4EQPA 3PIOA 3NSWA 5LHY1 2B2UC 1HFNA 3LGJA 4PZ6A 3RR5A 3S15B 2DGYA 3QO2A 1EY4A 2B2TC 4PZ7A 3R2TA 5IWAQ 1YNNC 2UXBL 1TWFB 2B2WC 2IX3A 4X66L 3QB3A 1EQRA 4X64L 4DR1L 4NXNQ 3UDFA 1JWUD 1VQEA 1YNND 2HQEA 5IT9c 1QNUA 4LNQA 5T1IA 4JC0A 1JB7A 3TP5A 2X69A 3DXJC 1U5KA 2D0OA 2L0CA 2TMPA 3DEOA 4JI6L 1WTOA 3EROA 4HIKA 1KDAA 2KOLA 1SR3A 4MZ9A 3W2DA 1EY5A 1JJGA 4KN7C 2D9UA 2Z4IA 4IPCA 1OXVA 1JE4A 4R8NA 3GTGH 4ILWA 2UXDQ 2NTTA 4NDXA 1ENFA 2IHFA 1XNRQ 3MXGA 3F1ZA 3DHQA 2BE5C 4R1JA 4R4QA 4UP7A 4B08A 2CCZA 1PTOH 4A3JB 4N9TA 1IKMA 3PIPA 1GUGA 1GUNA 5DM73 3P20A 3U50C 5HGQA 3G6EA 4FXGC 4C3JH 1FL0A 3CMEA 2OTLA 1YJ9A 2XIWA 1TS3A 2ZM6L 4NXMQ 4E6IA 4JV5L 2F0LA 1TS4A 3SHLA 4KK7A 3G71A 2PW7A 2NN6I 2JA8B 2IX1A 1CKOA 1XX8A 4DGZA 3TP8A 1Q1EA 1YI2A 3HOWB 4OGQC 2KEDA 1VQ5A 3BS1A 4DR5Q 2GVAA 4A3GB 3C1EA 3J81L 3CXCA 4I7AA 4A3LH 1X6OA 4GS3A 1N34L 2R7DA 3S1NB 3K59A 4LUOA 3CAMA 3HOVG 2SOBA 3KUPA 4IPDA 2ZJQA 4K6DA 1VF7A 2CVRA 4BXXG 4DV2Q 1B70B 3RMHA 1SSOA 4UHVA 4Y7NB 1JE5A 1M1KC 3S1NH 4F88A 5KNDA 1EUJA 3KYHC 3CQZB 3G7LA 5CBEE 4XQQA 1KRSA 1X3QA 1X56A 2Q8RE 3JAMi 1LYLA 4Y7NH 3CCUA 1RL2A 1PXUA 2ZTCA 5KEEA 1FYCA 3DM3A 3BDLA 1L0WA 1EL0A 2AWNA 2K1BA 1VQ9A 1JT8A 2VZAA 5HGTA 1D5ZC 4DK6C 4DR7Q 3ND9A 3E5SA 2JJQA 3I72A 3PO2H 4A3DH 2KCMA 1N32L 1TWAB 2NVYB 4XIGS 3TS0A 1F77A 1XPOA 1SLJA 1O80A 2D62A 1S5ED 2JXMB 2I0QA 3A8KE 2E2JB 3FP9A 5EBCA 3HOVB 3KLWA 1QJOA 1NTGA 3T1YL 1K0RA 4DAMA 1TR5A 2E2IB 4ZUJA 4L63B 3J7AV 2YTVA 2RQXA 1V1PB 3NELA 3HFZB 3OW7A 1YHQA 4PQXA 4LF8Q 4RHRA 2FMMA 1VQ8A 3E0JA 2EIFA 5A2QL 4DR1Q 1E2WA 2JA8G 1KIXA 1Z7TA 1VQGA 3H6MA 2WACA 5EKLA 1QZGA 1STNA 4HIDA 3Q24A 3S2DH 5EAYA 3EVQA 3I4NG 3F2CA 5FO8B 3DWQA 4B3SQ 1ML0D 1TY0A 5IOCA 1SMYD 1YHAA 3P75A 5ELFA 1G91A 2EYLA 3NBHB 2PPBC 3UE1A 2MQHA 2ZXRA 2XRSD 5COYA 2Z6BA 5EPLA 4JI4L 2UXCL 4IUNA 1PTOC 1YNJD 4JYAQ 2JA6H 1X32A 3RZDH 2WIIB 1H95A 5I9OA 3NBHA 3VR6A 3PUYA 1PTOD 1SYEA 4B3RQ 1UAPA 2WFWA 4GKJQ 5T1GA 2JA6B 3KLRA 5CYUA 1E22A 1HZCA 2AQ3B 4RHSA 1WD0A 2RDGA 5AJ3L 2WP8J 3M4YA 3ZYYX 4Z9CB 1EU3A 3LWEA 3R3OA 1D8LA 3OOCA 1PH5A 2NVTB 4RMFA 1EIHA 1KXLA 3ZJYC 1HQRD 5IYBH 2O5IC 3CCVA 1I4XA 2F4IA 3J80i 1BVSA 2NZHA 2Q2TA 1WFQA 5C5MA 5D3DA 5M3MH 2EYMA 1AE3A 3T56B 4JBKA 4HEDA 2N55A 2ICEC 1T5EA 1P8LA 1A3TA 1II3A 3I73A 4HAEA 1JOOA 1EFWA 1LTID 5E4XA 4MNOA 4QCLA 4U673 1A63A 1I4PA 1I3QB 4IUUA 3CCLA 1N8RC 2B2YA 5M9OA 5C4XG 2A68C 4ALPA 3CRKC 2NTSA 3G6JB 1H9RA 5IODA 2J0TD 4FF2A 1Q1BA 4FVMA 3E0EA 1S5BD 1XNQL 1PRTD 2IW3A 4ZCKA 2R93B 2HT1A 1W6JA 4IUQA 5IYCH 3Q0AA 4OO1H 1TT2A 2LFNA 2PNRC 3A5ZB 3KBGA 4HJ9A 4A3BG 1F2LA 5LMNW 1WCMB 4J1MA 1X3FA 1PZID 1HZAA 3KBXA 3BVGA 5IP7G 3I4LA 3VYUA 3AQQA 2UUAL 1Z6HA 1BBWA 3S1QB 2LMCB 4RAUC 3UE0A 1YJNA 2HHHL 1B53A 1QZHA 1VQAA 5K36H 2YTYA 1KDCA 2WB1B 1HQMC 4OWXB 3GTKH 3OMCA 1GHKA 3MEFA 1HTLD 3UDIA 3BDCA 4IQZA 5FJ8H 3D3RA 1C8CA 4GNXC 3GV3A 4POFA 4A3MH 1E3PA 2KQ3A 3HOYB 5M3FH 1O7ZA 4DU9A 2A69C 4LF7Q 1UEAB 4N9PA 1EYGA 1DZ1A 2L4NA 2HQLA 4IPHA 1Q81C 4IUPA 1A62A 5C44B 4K8JA 3I55A 5CORA 4UPAA 4A75A 5BN3A 2EYFA 2K52A 4C3IH 3G48A 1KHIA 3RUZA 2ASBA 4LUVA 1PYSB 4JBJA 2F0PA 1LTAD 3KK7A 4KD3A 2Q2UA 2OTJA 2PI2E 2NVXH 1PH1A 3V2TA 4A3CH 1B9NA 4C3IB 3CPFA 1EOVA 4WJ3M 4C3HH 2QA4A 1PFSA 1TIID 5FLMG 2K04A 3GTJB 3AMUA 1PRTB 3VR4A 4A3EH 1FVIA 1WYDA 3NQIA 2EY1A 1K73C 1N32Q 2F0GA 2K5WA 4K14A 3BVZA 3OSOA 4C3HB 3VYSA 4XQJA 1B3AA 1E24A 2Z9HA 2Z1CA 1Q8KA 4A3BB 4N8FA 4DN4M 3FPUB 4LF4Q 3MFGA 4DV0L 4DV6Q 3A5UA 1IYJB 1TWHH 4GLAC 4IURA 5I4DA 1Y1WB 1YNJC 2BOSA 2DNCA 3SEBA 4GZYC 5KNCA 4BY1B 2HDMA 4O1NA 4XYOA 2V4DA 3A56A 4B9WA 4BBRH 1HPCA 1FJGL 3GTLH 1S3OA 3M4OB 3PUZA 3I90A 3M9BA 3B6YA 4DAYA 2QEXA 5JVG3 4NP5A 1E7ZA 3CRLC 3M3YH 1U4PA 4B9XA 2RCNA 1SFOH 1ILPA 4X3UA 5I6WA 1UNSA 4JW0A 1J5EL 1MGSA 1SBBB 2DN8A 2EOTA 3NEMA 4ZUIA 2ZM6Q 1NY4A 4RFBA 1DYQA 3STBC 2PW5A 2QEJC 4HCSA 5KNBA 1YJWA 1TU2B 5E4WC 4ZRZA 4ZYSA 3AYHB 4ZAIA 3KJOA 1F9RA 3ITPA 1VS0A 1SJED 1CZWA 4QUFA 4ZLTF 5IIFA 4OX9Q 3NWTA 1V1OA 4A3MG 1BDOA 1YHBA 1PH2A 1PH7A 4JI1Q 1ASYA 5CMDA 2UXDL 4Q5VA 2NN6G 3S16H 1I6VC 2MHVA 4FXDA 5EJWA 1ENAA 5IGCA 5C3EB 1HNXQ 1HTPA 3ONAB 3BYTB 1TVXA 4UAIA 1PHJA 4ZK9B 2HIXA 3T51B 2K32A 2AWOA 1TWGB 1NNXA 3EFXD 2A1AA 3P7JA 4TQUS 2KJXA 4KI0A 1BCPC 2PMZB 2ALYB 2K5NA 3EN2A 4IALA 3J80c 1MI2A 4JI0Q 5ISRA 3TRZA 1JCKB 1QB5D 1RTOA 4YHHQ 1NBWA 2Q8IB 2IHEA 2L11A 2PQAB 3FDTA 1VQCA 4P75A 1QE6A 3MZ5A 1QUQA 1LTBD 1ONLA 1SE3A 4DR3Q 3CHBD 4RGMA 2KVMA 3S17B 4MHEA 3N6RA 1CT1D 3TZDA 2JA6G 1PFBA 3NTIA 3H3VH 4DAVA 1JICA 4A3IG 1B9MA 2N88A 1H9SB 1BBXC 5LL6X 1ZKOA 2JA7H 1KAAA 2RCFA 3C46A 2L15A 1A15A 2UUCQ 1SE2A 4JI8Q 2SNMA 5IYCG 1V1QA 4OO1G 3BZKA 2JK8A 3HOWH 2PO4A 2WB1G 1VQFA 4AH6A 4A76A 3Q6SA 1J6QA 3IAYA 1SNPA 3FRPB 4G7OC 1IBKL 4JCVE 3HS0C 4KKUA 4QQBX 1RCVD 2M2LA 2XSCA 2R92B 1SYFA 5FLXE 1JC7A 4IFDJ 1O7YA 1ET9A 1K28A 1TXYA 3J80E 2NZ1D 4WRDA 2L5TA 3ER0A 2MNAA 3BJUA 2R7ZH 5J22A 2V1CC 2I5LX 3S24A 2VW9A 3OMGA 1VQNA 1WD1A 2ATWA 2RHQB 1BKBA 2AHOB 2EYPA 5A2QE 1KL9A 1U9RA 2LXKA 3GV6A 4K5XA 4K5VA 1EQTA 2XWJB 4A3KH 2PQAA 3A8JE 3MA2B 3TDQA 4DPGA 3PIP3 4DR6L 3PUVA 3K58A 1SYDA 4H0LC 1IW7D 4QL5A 1MSHA 3W1BA 4A3IH 1TWAH 2WB1E 1JORA 3OTOQ 4J6HA 4DV3L 4LMQD 2EE1A 5EKIA 2Z0SA 3GTPB 1K83H 2M9VA 1TQOA 2K5QA 4XT1B 1I50H 1Z9FA 4KHPL 4LJZC 1VQ7A 4A3FB 2NVQH 4PMWA 3H09A 1HNXL 4FF3A 4JVZA 1I50B 1TWCB 3I4OA 2B29A 2VB2X 4JOIC 3T4AC 5BN5A 2AUJD 1LTLA 4X65Q 1LT5D 3S1RH 4DK0A 2B39A 3K80C 1NR4A 4H44C 2DNEA 3NP8A 1HZ9A 4BY7B 4KKTA 1JB3A 1K8OA 4JI3Q 2KBNA 2UUBQ 4L8JA 1N9WA 3EBEA 1LUZA 1B1ZA 3MXPA 4KJNA 1SE8A 2F0EA 4BY7H 3NXWA 4S3SA 2H1EA 5E7NA 2B63B 1KDBA 1CSQA 1EFID 1C7YA 1K8AC 1PTOB 3J7AF 2QF7A 5AJ3Q 4C3HG 4APVA 2C9OA 4P71A 4HSVA 1CUKA 3ULLA 5FO9B 1EU4A 3OIPA 4UP8A 3VA5A 4HTHA 3X3NA 4XQNA 2RKSA 2JA8H 2F0MA 1D1IA 2WAQB 5CV8A 2KECA 1X3PA 4DNRB 1UEBA 1EZ6A 4X6AH 1QWYA 1Y1VH 4OIKA 2AQ1B 1NE3A 1LTRD 1E0BA 2CQOA 2YU9H 2QDBA 3L9AX 1R4PB 5EPKA 5CV4A 3H0GG 1PTOF 3Q22A 1I4HA 2B3GA 5CGKA 4UDUC 4JI0L 4HN7A 4FO2A 1YZ6A 3VR3A 4X3SA 3ICEA 3CC7A 1QVFA 3HEJA 2H4OA 1LT4D 2DJFC 1I3QH 3GDEA 4A3FG 4JI7L 1SMXA 1PZJD 3KJPA 3CQZH 5DM63 3CCJA 1WTQA 1PFNA 4DAYB 4DK3C 1N36Q 1SNQA 5M5WB 2ZT9C 5F2DA 1RF2D 1TY2A 3AU7A 5EPJA 4YWLA 5M5YB 2L12A 4DR4L 2ES2A 3UDGA 3I56A 2OCEA 5GAGC 4G7ZC 4I65A 1V9PA 3CCRA 3DUZA 4LWCA 4C3JG 4OO1I 1AP0A 3KF6A 4C1NK 5H1SE 2JA5B 2UUCL 1B4OA 5JEAG 5BN4A 1SNCA 4BBSG 4YWMA 3R8BA 1PZKD 2RA4A 3DMUA 5ELCA 3NQTA 1F2MA 3CCEA 2EDGA 2FINB 4A3MB 2F3IA 2R3ZA 3FKIB 4KD4A 4P74A 5C6AA 1U0LA 4OXPA 1OXTA 2ZTDA 2UXBQ 1FD7D 1LT3D 4DV3Q 3MXUA 2VQFL 1N33Q 3HGBA 5C5LA 4XT3B 3U9OA 3FKIH 3A54A 5M3FG 4DV4Q 4A93G 3URYA 4B3SL 2NYZD 1B8AA 1DM0B 3K5MA 2EJMA 1SEBD 4DV5Q 5C0XI 1QNKA 5DEHA 1KLGD 3HZXA 1VMPA 1K3RA 2K03A 1V8QA 4X3TA 3DWPA 1Q86C 2WAQE 1K0SA 4ME3A 3HOXH 3GTJH 2VB3X 2KCNA 1HNWL 4LUZA 3H0GB 3A7LA 1C0AA 4IN3A 4HJ8A 3MAQA 5IP7H 3NE5B 2MP1A 5ELNA 2JA7G 1HJPA 2K01A 5C0XH 1K9MC 1EWIA 3RLOA 2QW7A 2X6GA 2F0FA 4JG2A 2IWHA 4NXML 4HR7B 4DXFA 2UUBL 3TP7A 3UDXA 4G57A 4IJLA 1G51A 4XYQA 4RGNA 1I6HB 2QDLA 3UI2A 2AUKA 4OWTB 4F87A 4FXKC 3HOZB 5IE8A 3AFPA 3K57A 4X65L 3V96A 1GVPA 2DUDA 4LF7L 1TKWB 2JEBI 3QOLA 5IY0A 4BBRG 5FLMH 3FKIG 1STEA 3NTKA 2B2VC 3T53B 5M3MB 2F0JA 5IGBA 1RD9D 2VQEL 4LF5Q 1Y1VG 1KAWA 5CV5A 2F52A 3X3MA 4X62L 5C3EG 2CH4W 1SRUA 2OT2A 4K6LA 3U4VA 1VQKA 3E9IA 1JQYD 3NBIA 3E6ZX 2DY7A 1F2YA 1S72A 2A73B 1KNEA 2OQKA 2A68D 3TZUA 3HOXG 1PMRA 4RGTA 5EQ0A 1SYGA 1R9TB 1GUSA 1CA6A 1VMCA 1N34Q 5C0XJ 1G8ZD 1VQIA 1PH3A 4K0KQ 4HMIA 2RHSB 1MHWC 5FLXL 1I4GA 4J15A 4A93H 3I7FA 1PFMA 3K5OA 2EVBA 4NMZA 3SE0A 3SVMA 1OTCA 2MUYA 1ASZA 1Q90A 5FLXc 3ULJA 2LKVA 4OIJA 2VUMB 4AYBE 2D5DA 1MBYA 3I4NH 1O7IA 3HG9A 3RZOB 1IBKQ 1Q8IA 2PNHA 2Y0SB 3IFDA 4DAPA 2RF4A 4LFAL 2OWOA 2SNSA 4IZ8A 2QILA 2Y0SE 1BCPB 3EJIA 1EY6A 2CQAA 2EJGC 2ID0A 4QB4A 3J7YW 2LS01 4IOAA 3WOEA 4QY7A 1EEID 1QVGA 1HH2P 4LFCL 4GOPA 2CKZB 1MJCA 3CMAA 3HOUH 2A6HD 1QG7A 2JP1A 3K7AH 1UWVA 1QVCA 4RA8A 4C3JB 2HD3A 1ZYRC 5C3XA 5M3MG 1CKNA 4GOPB 1XMOQ 4PMCA 4NPSA 1STBA 3R2IA 4R4CA 3NHHA 5LMNL 4A3EB 2KCCA 2SEBD 5EBDA 1Y8PB 1B2TA 2D2CC 3NENA 4Q0FA 3HOZG 2EQSA 4IJHA 3GTOB 5HY6A 1BCPF 1HUMA 4EX5A 5KIXA 1AN8A 1SNOA 1VQ6A 3I3CA 3CCMA 1TWHB 4B3ML 3I4MH 4BY7G 2LSSA 2E76C 4KY5A 3L0OA 5C44G 1NUCA 3GP7A 4LF4L 3K7UC 1CHPD 4LF8L 4G4KA 1PH4A 5KRUA 1D5MC 2RSOA 5JAVA 3I4MB 3VR5A 1GJXA 1PYBA 2K05A 1RDPD 4JI5Q 3WWVA 2KEEA 4ODGA 1XPUA 3V05A 2EJFC 3TN2A 3IKJA 2F0SA 4R8IA 1KTKA 1BQQT 1H9JA 4XTCS 2EPBA 1WTVA 2GVBA 1IW7C 3QR8A 1F2ZA 3M3YB 3D4RA 4NB3A 1D5XC 1T5XD 2I46A 4A3DB 5FJ8G 4ME5A 3GTMB 2HIVA 1MKHA 4MIUA 2NVYH 2EZVA 4QIWB 3T1HL 4CJ1B 5L37A 1E2VA 2XRQD 3CW2C 1JJ2A 1S4ZA 2HCCA 4AYBG 1A2TA 3VR2A 1HCZA 4XXEA 1K3BC 5D3IB 4DR2Q 1EIGA 5C4JH 1EY8A 1JJCB 2K5HA 2NZOA 1K83B 2F0KA 2ICIA 4BBSB 3HOWG 3PO3H 3QJYA 3I91A 1I94Q 5C4XB 3S2HB 3KF8B 1TWFH 1DOKA 2K6AA 1PH6A 4O0AA 3AEVA 1E1OA 4BBSH 4DUYQ 1TWCH 5D65A 3BG3A 3S1MH 1KLUD 3DLLA 2N8NA 4OHJA 1CKMA 4PG3A 2HHHQ 3S2DB 1G291 4CDDC 3ND8A 4BWGB 5IT9E 3HOUG 1KABA 1WVLA 4FDBA 2JYOA 3U4ZA 2F0TA 4DV2L 2XGTA 1IHZA 1C4QA 5G3LD 2ZTEA 5C3WA 1JOKA 2F0IA 2JA9A 2F0WA 4FNFA 1AE2A 4LFCQ 2XVSA 3RZDB 3A0JA 4DK1A 1STAA 3T1HQ 1XMQQ 2IT1A 1XNQQ 2I5MX 2Q8TA 1PYWD 4RCNA 5A35A 4EVOA 2B63H 4EQ5A 4DV7L 2F0DA 4PV1C 2RDHA 2BA1A 3OIQA 3PO3G 5CR3A 4Y52H 2PMZE 1A3UA 2I5HA 3TBIB 1AEXA 1O7LA 4CKEA 4GKKL 5M5XB 5CV6A 5FKAC 2JE6I 4CKCA 4K2KA 1WTXA 3ERSX 1FNVA 2B8FA 2F0QA 5I2XA 2OEOA 5JVH3 2Z8LA 4LF9Q 1UE5A 3VYTA 4R4TA 4MN3A 1EYAA 4O42A 2BH2A 4C2MH 4BXXH 4B3MQ 3HP3A 1CTMA 5J3BA 1HNZL 1RTNA 3SK6A 2K4KA 1X9NA 2PCFB 1IKLA 4EQOA 2FMCA 4JI6Q 1BF4A 4TKOB 1WOCA 3HRZC 4C2MB 2E2DC 3M4PA 3LWUA 3VYRA 5IT9L 1S5CD 3U9SA 4CJ0B 1IYUA 4B3RL 4H02A 5JOBA 3OPOA 3PUWA 3CU7A 1PA6A 4NXNL 4X64Q 2O5JC 4JI4Q 2E2HH 4V0BA 5DNFA 5G3LF 1GD7A 2UXCQ 1T9HA 5IWAL 4HIOA 1CM9A 4A4IA 3QG1A 2NN6H 3CC2A 1FNWA 2SDFA 5IYDG 3PO2B 2BCOA 4RCOA 3A7AB 3GO5A 1O78A 1XTDA 1RKNA 1JOQA 4YHHL 4H7BA 3J81c 4OWWB 4LAAA 1EYDA 1GKHA 1CI3M 4HJ5A 3T13A 3HOYG 5K36G 5IP9H 1VQHA 1VQLA 3H15A 2F1MA 5BR8L 1BNZA 4OX9L 3EA6A 2TSSA 1VCIA 4LF9L 3GTPH 4JPBW 5M3FB 4JV5Q 4PMBA 3A55A 1Y14B 3JAML 2CHBD 4JI3L 1D1KA 3SR1A 3QOJA 3W5OA 5IGFA 3ERQA 3DEPA 4KTAA 2P5ZX 1ESFA 1Q3LA 1X3EA 3TQYA 4DV7Q 1CKNB 2PZUA 2A5HA 1FGUA 2C35B 4OONA 2QCPX 2R93G 4JOIA 1CQVA 4IPGA 5C4HA 4FF4A 4A3KG 2DY8A 2O2LD 3RLFA 1IXRA 3MC0B 4XDXA 2ENBA 1OO9B 1L0YB 4AYBB 4KN4C 1D6EC 1OXUA 1LACA 1VQDA 3OHXC 2UUAQ 2K33A 3IFTA 4L6TB 2H5XA 2CW0D 2MO0A 1LM0A 1UE1A 3O13A 2CW0C 3NPPA 3W1GA
chains in the Genus database with same CATH topology
1ICWA 2K28A 4CJ2C 3GTLB 1Y69U 4WORA 2OXPA 3BVMA 1JR0D 5HURA 1V1PA 1QCBD 1HHVA 1AFPA 4EGVA 4WJWA 1EEFD 1R4QB 3KLSA 4BA2I 4BA1I 5EGTA 2EY5A 4RKLA 1M4VA 2BDOA 1DXMA 1V43A 3I70A 1LV9A 4P2CB 5EKKA 1JWMD 1K8MA 2B2TA 2NUCA 4RWSC 1SYBA 1ILQA 2XN9C 4FYDA 4CHTB 1SMYC 4V190 2I07B 3TMEA 3MVVA 3MFYA 4F7XA 1A6XA 1GUOA 1CHQD 1CK1A 2FHTA 1OXSC 5JEAJ 1J8IA 2YYZA 2J7ZA 1B50A 1B44D 5TSSA 1CZGA 2A6ED 3WOFA 2MJ8A 1VF5C 2AQ2B 3TSSA 3QWNA 4DFAA 5I9PA 1RHPA 3M7NA 4QUCA 4ZKCB 4IFDH 1QILA 1WTWA 1HA5A 2A6HC 3C2PA 4IFDI 1F9PA 2EYJA 1Q12A 3P1HA 5FO7B 4DNTB 5IGGA 1G2TA 5JPMC 5CC4A 3HOUB 5D14A 1HUNA 5J39A 3FPPA 4KKSA 2HDLA 3LX0A 5J1ZA 2PQEA 3HOXB 3EQLC 5JEAH 4EQNA 1G6ZA 2MGSA 4QMGA 1EYCA 4JK1C 4IUVA 1PRTF 4ID6A 2QKIC 3K0YA 2F0HA 2M00A 5KGUA 2IL8A 5IGDA 3FMCA 1HA6A 3D8GA 1DOMA 1G2SA 2RDFA 4BBRB 4TRDA 2NBFA 3PIO3 2EY2A 1LTGD 1SJHD 2NB0A 1GUWA 5CV9A 1PDQA 2K7VA 1F9QA 1Z47A 1EZ8A 3NWSA 2O4XA 4HCEA 3DWAA 1RODA 2B2VA 3JAME 3FVQA 4K2LA 5JJZA 1FNUA 4A3IB 1ENCA 2F0VA 5C0XG 2EYOA 1DOLA 2Z4HA 2KA7A 5C4JB 1D2BA 2B2UA 2WV6D 5AFWA 4A93B 1TS5A 3SK8A 2RSNA 1WTPA 2E74C 3VA7A 1AZPA 2HCIA 1XWEA 3H91A 1NR2A 3J81E 4KHVA 1FR3A 3S1RB 2B2WA 3LNNA 1FGBD 3S1MB 2LY7A 3MTSA 1HFGA 4TSSA 3J80L 2RVLA 2X6LA 2G9HD 1DJRD 1LTTD 3BDOA 3SK4A 2L55A 2IJ0A 3GTGB 4CKBA 5E3FA 1SE4A 2IX0A 3NUCA 4ULLA 2KUMA 2E75C 3MHBA 5KYIA 1VDZA 2VXWA 5I2YA 4CBVA 2F03A 2WKDA 4RH6A 2HUGA 5ELDA 2BE5D 2GA4B 1CFMA 3K7AB 1ESRA 4J8QA 3SK5A 3Q23A 4K8IA 3KF8A 1EY7A 4C1NI 1LT6D 3K5NA 2ZXOA 2F0UA 4RKBA 3D31A 5CBAE 3I8ZA 4KJOA 1BR9A 1HRJA 2KHSA 1RJTA 1NCVA 3K6OA 3OWEB 4M1UB 3SXHA 3F2UA 4YIJA 3PUXA 1SXTA 4CGYB 1DCZA 2BDNA 3K5LA 2F0OA 2R7ZB 2F3WA 4X3KA 1MD2D 1LO5D 1IL8A 4K5WA 1EWHA 1EY0A 3BZDB 4FF1A 2G9DA 2WKCA 4ABNA 3D4WA 3H3VC 3N52A 2EXZA 1ZEQX 2L9HA 1GUTA 2A69D 1UUPA 1Y8OB 1SNDA 1SAPA 4R9WA 1F9SA 2JSOA 1SNMA 4WFN3 3S14B 1CA5A 1SDFA 2B8GA 5FOBB 1STYA 2ZXPA 4ZQ3A 3PO3B 1QOHA 3MXNA 1C48A 2XNAC 4DXGA 2NVXB 3M85A 1E2ZA 1ET6A 1DD2A 3M7GA 2PYKA 2C5CA 1S5FD 5IGEA 2FJ2A 1BUVT 5FK9C 1H9SA 3T16A 3C1FA 3GD7A 3IL8A 1JWSD 1MSGA 4C56C 1NSNS 2JEAI 2A74C 3C3LA 1BOSA 4FP5D 4JBWA 1M8AA 3GQBA 5JPNC 4KHZA 5LL6S 4KY7A 1EQVA 2A6EC 4G7HC 3PMFA 3KLSX 1XYIA 2PZWA 1DONA 2FFKB 2BA0A 5CV7A 1IYVA 1Y1VB 3BYYB 2YU9B 1I4QA 1XXGA 1SFOB 1LABA 3TP6A 3WDNA 5K5PA 3QIAA 1U4MA 5ELBA 3MWYW 4PNYA 2B2YC 3NK9A 1H9KA 1EY9A 3D4DA 1OXXK 2WINB 2E2HB 1I4RA 3RD4A 2F3VA 1LLRD 3S9WA 2MPMA 3SDZA 3S16B 3DM1A 3GTKB 3D6WA 1U4LA 2F0NA 1U4RA 1L0XB 1CQFA 4KY6A 4KV6A 3FEWX 5C4ZA 3I4NB 4I7ZC 4KMUC 4BS9A 4DF7A 1GOZA 1NAPA 4NKLA 2L1BA 1Y8NB 3L3OC 1GXDC 3PV0A 3MEHA 4QF4A 4C3IG 1AZQA 3OWFA 4HMJA 1STHA 3AB9A 1KNAA 2VNUD 2JA7B 1J9OA 1TS2A 4NW2A 1AW7A 4M8AA 2EY6A 1PRTC 1XTCD 2IPKD 2R6GA 4HSPA 3CKIB 1EWCA 3A8IE 2OF1A 4DA2A 3R93A 2XWBB 4U68A 4ZKBB 1BCPD 5ELEA 1ZXTA 2NWGA 2PZTA 1S5DD 1HXYD 1A3VA 1GHJA 5DAUA 2RBMA 3D6CA 3HKZB 1EOTA 2EYHA 3W3AA 4IFDG 4H13C 1WTRA 1H9MA 5E1FA 4F8MA 2J4XA 3L7ZC 4A3KB 4RGOS 1A2UA 1PLFA 4LK1C 1ZYRD 1SYCA 3NTHA 1BXTA 5KYLA 5NUCA 3GTQB 5I6YA 4IUTA 2R61A 3H94A 4OL7A 2K5DA 1LTSD 1BO0A 1W6KA 1STGA 2NVQB 4EQPA 3NSWA 5LHY1 2B2UC 1HFNA 3S15B 3QO2A 1EY4A 2B2TC 3R2TA 1YNNC 1TWFB 2B2WC 2IX3A 3QB3A 1JWUD 1YNND 2HQEA 1QNUA 5T1IA 3TP5A 2X69A 3DXJC 2L0CA 2TMPA 3DEOA 1WTOA 3EROA 1KDAA 2KOLA 3W2DA 1EY5A 4KN7C 2D9UA 2Z4IA 1OXVA 1JE4A 4R8NA 4ILWA 2NTTA 4NDXA 1ENFA 3MXGA 3DHQA 2BE5C 4B08A 1PTOH 4A3JB 4N9TA 1IKMA 1GUGA 1GUNA 5DM73 3P20A 4FXGC 2XIWA 1TS3A 4E6IA 2F0LA 3SHLA 1TS4A 4KK7A 2PW7A 2NN6I 2JA8B 2IX1A 1XX8A 4DGZA 3TP8A 1Q1EA 3HOWB 4OGQC 2KEDA 3BS1A 4A3GB 3C1EA 3J81L 3S1NB 3K59A 2SOBA 3KUPA 4K6DA 1VF7A 2CVRA 3RMHA 1SSOA 4Y7NB 4F88A 5KNDA 3CQZB 3G7LA 5CBEE 4XQQA 1X3QA 2Q8RE 1PXUA 5KEEA 1FYCA 3BDLA 1EL0A 2AWNA 2K1BA 5HGTA 1D5ZC 3ND9A 3E5SA 3I72A 1TWAB 2NVYB 4XIGS 1F77A 1O80A 2D62A 1S5ED 2JXMB 3A8KE 2E2JB 5EBCA 3HOVB 1QJOA 2E2IB 1TR5A 4ZUJA 4L63B 3J7AV 2RQXA 1V1PB 3OW7A 4PQXA 4RHRA 2FMMA 3E0JA 5A2QL 1E2WA 1Z7TA 3H6MA 2WACA 5EKLA 1STNA 3Q24A 3EVQA 5FO8B 3DWQA 1TY0A 1ML0D 5IOCA 1SMYD 3P75A 5ELFA 1G91A 2EYLA 2PPBC 2ZXRA 2XRSD 5COYA 5EPLA 4IUNA 1PTOC 1YNJD 1X32A 2WIIB 5I9OA 3NBHA 3VR6A 3PUYA 1PTOD 1SYEA 1UAPA 5T1GA 2JA6B 3KLRA 5CYUA 2AQ3B 4RHSA 1WD0A 2RDGA 2WP8J 3M4YA 3ZYYX 4Z9CB 1EU3A 3LWEA 3R3OA 3OOCA 1EIHA 2NVTB 1HQRD 2O5IC 1I4XA 2F4IA 5C5MA 5D3DA 2EYMA 3T56B 4HEDA 2N55A 2ICEC 1T5EA 1A3TA 1II3A 3I73A 4HAEA 1JOOA 1LTID 5E4XA 4QCLA 4U673 1I4PA 1I3QB 4IUUA 2B2YA 5M9OA 2A68C 3CRKC 2NTSA 3G6JB 1H9RA 5IODA 2J0TD 4FF2A 1Q1BA 4FVMA 1S5BD 1PRTD 2IW3A 2R93B 1W6JA 4IUQA 3Q0AA 4OO1H 1TT2A 2LFNA 2PNRC 3KBGA 1F2LA 1WCMB 4J1MA 1PZID 3KBXA 3BVGA 3I4LA 3VYUA 1Z6HA 3S1QB 2LMCB 4RAUC 1B53A 5K36H 1KDCA 2WB1B 1HQMC 3OMCA 1GHKA 1HTLD 3BDCA 4IQZA 1C8CA 3D3RA 3GV3A 2KQ3A 3HOYB 1O7ZA 4DU9A 2A69C 1UEAB 4N9PA 1DZ1A 2L4NA 4IUPA 5C44B 4K8JA 5CORA 5BN3A 2EYFA 3RUZA 2F0PA 1LTAD 3KK7A 4KD3A 3V2TA 1B9NA 4C3IB 1TIID 2K04A 3GTJB 3AMUA 1PRTB 3VR4A 3NQIA 2EY1A 2F0GA 2K5WA 4K14A 3BVZA 3OSOA 4C3HB 3VYSA 4XQJA 1B3AA 2Z1CA 4A3BB 4DN4M 3FPUB 3MFGA 4IURA 5I4DA 1Y1WB 1YNJC 2BOSA 2DNCA 3SEBA 4GZYC 5KNCA 4BY1B 2HDMA 4O1NA 4XYOA 2V4DA 3A56A 4B9WA 1HPCA 3M4OB 3PUZA 3I90A 4DAYA 5JVG3 4NP5A 3CRLC 1U4PA 4B9XA 1ILPA 4X3UA 5I6WA 1UNSA 1MGSA 1SBBB 2DN8A 2EOTA 4ZUIA 4RFBA 1DYQA 2PW5A 2QEJC 4HCSA 5KNBA 1TU2B 5E4WC 4ZRZA 4ZYSA 4ZAIA 1F9RA 3ITPA 1SJED 1CZWA 4QUFA 4ZLTF 5IIFA 3NWTA 1V1OA 1BDOA 5CMDA 4Q5VA 2NN6G 1I6VC 2MHVA 4FXDA 5EJWA 1ENAA 5IGCA 5C3EB 1HTPA 3ONAB 3BYTB 1TVXA 4UAIA 4ZK9B 3T51B 2K32A 2AWOA 1TWGB 3EFXD 3P7JA 4TQUS 2KJXA 4KI0A 1BCPC 2PMZB 4IALA 1MI2A 5ISRA 1JCKB 1QB5D 1RTOA 2Q8IB 2L11A 3FDTA 1QE6A 3MZ5A 1LTBD 1ONLA 1SE3A 3CHBD 4RGMA 2KVMA 3S17B 4MHEA 3N6RA 1CT1D 3TZDA 1PFBA 3NTIA 4DAVA 1JICA 1B9MA 2N88A 1H9SB 1BBXC 5LL6X 1ZKOA 1KAAA 3C46A 1A15A 1SE2A 2SNMA 4OO1G 2PO4A 3Q6SA 3IAYA 1SNPA 3FRPB 4G7OC 4KKUA 3HS0C 1RCVD 2M2LA 2XSCA 2R92B 1SYFA 5FLXE 1JC7A 4IFDJ 1O7YA 1ET9A 3J80E 2NZ1D 4WRDA 2L5TA 5J22A 3OMGA 1WD1A 5A2QE 2EYPA 1U9RA 3GV6A 4K5XA 4K5VA 1EQTA 2XWJB 3A8JE 3MA2B 3TDQA 3PIP3 3PUVA 3K58A 1SYDA 4H0LC 1IW7D 1MSHA 1JORA 4J6HA 4LMQD 2EE1A 5EKIA 3GTPB 2M9VA 1TQOA 2K5QA 4XT1B 4LJZC 4A3FB 4PMWA 3H09A 4FF3A 1I50B 1TWCB 2VB2X 5BN5A 3T4AC 2AUJD 1LT5D 4DK0A 2B39A 1NR4A 4H44C 2DNEA 3NP8A 4BY7B 4KKTA 1JB3A 1K8OA 4L8JA 1B1ZA 3MXPA 4KJNA 2F0EA 3NXWA 4S3SA 2H1EA 2B63B 1KDBA 1EFID 1PTOB 3J7AF 2QF7A 4C3HG 2C9OA 4HSVA 5FO9B 1EU4A 3OIPA 3VA5A 4HTHA 3X3NA 4XQNA 2RKSA 2F0MA 1D1IA 2WAQB 5CV8A 2KECA 1X3PA 4DNRB 1EZ6A 1QWYA 4OIKA 2AQ1B 1LTRD 1E0BA 2QDBA 3L9AX 1R4PB 5EPKA 5CV4A 1PTOF 3Q22A 1I4HA 5CGKA 4UDUC 4HN7A 4FO2A 3VR3A 4X3SA 3HEJA 2H4OA 1LT4D 1PZJD 5DM63 1WTQA 1PFNA 1SNQA 5M5WB 2ZT9C 5F2DA 1RF2D 1TY2A 3AU7A 5EPJA 5M5YB 2L12A 4G7ZC 4I65A 3DUZA 4C3JG 4OO1I 1AP0A 4C1NK 2JA5B 1B4OA 5JEAG 5BN4A 1SNCA 3R8BA 1PZKD 2RA4A 3DMUA 5ELCA 3NQTA 1F2MA 2EDGA 2FINB 4A3MB 2R3ZA 3FKIB 4KD4A 5C6AA 1OXTA 1FD7D 1LT3D 3MXUA 3HGBA 5C5LA 4XT3B 3U9OA 3A54A 3URYA 2NYZD 1DM0B 3K5MA 2EJMA 1SEBD 5C0XI 1QNKA 5DEHA 1KLGD 3HZXA 1VMPA 2K03A 1V8QA 4X3TA 3DWPA 2VB3X 2KCNA 3H0GB 3A7LA 4IN3A 3MAQA 3NE5B 2MP1A 2K01A 5C0XH 2X6GA 2F0FA 2IWHA 4HR7B 4DXFA 3TP7A 4G57A 4XYQA 4RGNA 1I6HB 3UI2A 2AUKA 4F87A 4FXKC 3HOZB 3K57A 3V96A 1TKWB 2JEBI 3QOLA 1STEA 3NTKA 2B2VC 3T53B 5M3MB 2F0JA 5IGBA 1RD9D 5CV5A 3X3MA 2OT2A 4K6LA 1JQYD 3NBIA 3E6ZX 2DY7A 1F2YA 2A73B 1KNEA 2A68D 3TZUA 1PMRA 4RGTA 5EQ0A 1R9TB 1SYGA 1GUSA 1CA6A 1VMCA 5C0XJ 1G8ZD 4HMIA 5FLXL 1I4GA 1PFMA 3K5OA 2EVBA 4NMZA 3SE0A 3SVMA 2MUYA 1Q90A 2LKVA 4OIJA 2VUMB 2D5DA 1MBYA 3HG9A 3RZOB 1Q8IA 2Y0SB 3IFDA 4DAPA 2SNSA 4IZ8A 2QILA 1BCPB 3EJIA 1EY6A 2CQAA 2EJGC 2ID0A 4QB4A 3J7YW 2LS01 3WOEA 1EEID 2A6HD 1QG7A 2JP1A 4RA8A 4C3JB 1ZYRC 5C3XA 4PMCA 1STBA 3R2IA 3NHHA 4A3EB 2KCCA 2SEBD 5EBDA 1Y8PB 1B2TA 2D2CC 4Q0FA 3GTOB 1BCPF 1HUMA 5KIXA 1AN8A 1SNOA 3I3CA 1TWHB 2E76C 4KY5A 1NUCA 3GP7A 1CHPD 4G4KA 5KRUA 1D5MC 2RSOA 5JAVA 3I4MB 3VR5A 1GJXA 2K05A 1RDPD 2KEEA 4ODGA 3V05A 2EJFC 3TN2A 3IKJA 2F0SA 4R8IA 1KTKA 1BQQT 1H9JA 4XTCS 2EPBA 1WTVA 1IW7C 1F2ZA 3M3YB 3D4RA 1D5XC 1T5XD 2I46A 4A3DB 4ME5A 3GTMB 4MIUA 2EZVA 4QIWB 4CJ1B 1E2VA 2XRQD 1S4ZA 2HCCA 1A2TA 3VR2A 1HCZA 4XXEA 5D3IB 1EIGA 1EY8A 1K83B 2F0KA 2ICIA 4BBSB 3QJYA 3I91A 5C4XB 3S2HB 2K6AA 1DOKA 5D65A 3BG3A 1KLUD 4OHJA 3S2DB 1G291 5IT9E 3ND8A 4BWGB 1KABA 1WVLA 2JYOA 2F0TA 1IHZA 1C4QA 5G3LD 5C3WA 1JOKA 2F0IA 2F0WA 4FNFA 2XVSA 3RZDB 4DK1A 1STAA 2IT1A 2Q8TA 1PYWD 4RCNA 5A35A 4EVOA 2F0DA 4PV1C 2RDHA 2BA1A 3OIQA 5CR3A 1A3UA 3TBIB 1AEXA 1O7LA 4CKEA 5M5XB 5CV6A 5FKAC 2JE6I 4CKCA 4K2KA 1WTXA 1FNVA 2B8FA 2F0QA 5I2XA 2OEOA 5JVH3 2Z8LA 3VYTA 4MN3A 1EYAA 4O42A 3HP3A 1CTMA 1RTNA 3SK6A 2PCFB 1IKLA 4EQOA 2FMCA 1BF4A 4TKOB 3HRZC 4C2MB 2E2DC 3VYRA 3LWUA 5IT9L 1S5CD 3U9SA 4CJ0B 1IYUA 5JOBA 3OPOA 3PUWA 3CU7A 2O5JC 4V0BA 5DNFA 5G3LF 1CM9A 3QG1A 2NN6H 1FNWA 2SDFA 3PO2B 2BCOA 4RCOA 3A7AB 3GO5A 1O78A 1RKNA 1JOQA 4H7BA 4LAAA 1EYDA 1CI3M 3T13A 5K36G 2F1MA 1BNZA 3EA6A 2TSSA 1VCIA 5M3FB 4PMBA 3A55A 3JAML 2CHBD 1D1KA 3SR1A 3QOJA 5IGFA 3ERQA 3DEPA 4KTAA 1ESFA 1Q3LA 2PZUA 2A5HA 2QCPX 1CQVA 5C4HA 4FF4A 2DY8A 2O2LD 3RLFA 3MC0B 4XDXA 2ENBA 1OO9B 1L0YB 4AYBB 4KN4C 1D6EC 1OXUA 1LACA 3OHXC 2K33A 3IFTA 4L6TB 2CW0D 3O13A 2CW0C 3NPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMC A;  4EQO A;  2EXZ A;  3BDC A;  3EVQ A;  5IGG A;  4PNY A;  2PW5 A;  5CC4 A;  3NK9 A;  2PZT A;  4E6I A;  2F0L A;  1A2T A;  1SYF A;  5DEH A;  3SHL A;  1SND A;  1EY9 A;  2PW7 A;  3HZX A;  1A3V A;  3P75 A;  4HTH A;  2KQ3 A;  5JOB A;  3VA5 A;  2EYL A;  2RKS A;  4DU9 A;  5DAU A;  2RBM A;  4DGZ A;  2F0M A;  3LX0 A;  3ITP A;  3D6C A;  5CV8 A;  3SK4 A;  5J1Z A;  5IOC A;  2PQE A;  1EY8 A;  1SNM A;  3TP8 A;  2EYH A;  2SNS A;  3D4D A;  4IZ8 A;  4N9P A;  1EZ6 A;  4WOR A;  4WRD A;  5E3F A;  5IIF A;  2OXP A;  4IUN A;  3EJI A;  2F0K A;  5J22 A;  2F3V A;  1STY A;  3OMG A;  5KGU A;  1EY6 A;  4ZQ3 A;  5HUR A;  3NUC A;  5I9O A;  3C1E A;  2QDB A;  4K8J A;  2EYP A;  4QB4 A;  5E1F A;  3S9W A;  4EQN A;  1SYE A;  4F8M A;  3MHB A;  1U9R A;  2EYF A;  5KYI A;  4QMG A;  1EYC A;  1RKN A;  1JOQ A;  1A2U A;  3RUZ A;  4K5X A;  1ENA A;  4K5V A;  2F0F A;  4H7B A;  5CV4 A;  5IGC A;  2SOB A;  5CGK A;  2F0N A;  4ID6 A;  4LAA A;  4K6D A;  2F0P A;  2F0H A;  4KD3 A;  3TP7 A;  1SYD A;  2EY5 A;  1EYD A;  2M00 A;  4G57 A;  4KY6 A;  1SYC A;  2LKV A;  4RKL A;  4KV6 A;  3V2T A;  5IGD A;  3T13 A;  2PYK A;  1JOR A;  5KYL A;  4J6H A;  5NUC A;  3SK5 A;  3D8G A;  3HEJ A;  5C3X A;  5C3W A;  5C4Z A;  5I6Y A;  4K8I A;  3R3O A;  1KAB A;  5IGE A;  2RDF A;  4OL7 A;  4PMC A;  1STB A;  5EKK A;  4TRD A;  4DF7 A;  3NHH A;  2F0T A;  1EY7 A;  1TQO A;  4IAL A;  2EY1 A;  1STG A;  2F0G A;  1IHZ A;  4K14 A;  4NKL A;  4PMB A;  1SNQ A;  2EY2 A;  2NUC A;  3OSO A;  3QOL A;  1JOK A;  3T16 A;  3C1F A;  5CV9 A;  5C5M A;  1SYB A;  2F0I A;  5F2D A;  4EQP A;  5KEE A;  2EYM A;  2F0W A;  2F0J A;  3BDL A;  4F7X A;  3TME A;  3MVV A;  5IGB A;  5KIX A;  2F0U A;  5HGT A;  1A3T A;  1EZ8 A;  1SNO A;  1STA A;  4RKB A;  5CV5 A;  1NSN S;  2O4X A;  1II3 A;  3MZ5 A;  3E5S A;  1JOO A;  3SR1 A;  3QOJ A;  1EY4 A;  4I65 A;  4EVO A;  5IGF A;  4KJO A;  3MEH A;  4QF4 A;  3ERQ A;  4KTA A;  2KHS A;  5EGT A;  3QB3 A;  2F0D A;  4KY7 A;  5M9O A;  1EQV A;  3OWF A;  4KY5 A;  2HQE A;  2PZU A;  4K2L A;  4HMJ A;  3SXH A;  1NUC A;  3PMF A;  1STH A;  5CR3 A;  3NP8 A;  1F2Y A;  1SNC A;  3TP5 A;  5IOD A;  1A3U A;  4YIJ A;  5ISR A;  1ENC A;  5C4H A;  2PZW A;  5JAV A;  5KRU A;  1AEX A;  1TR5 A;  5CV6 A;  2F0V A;  4B9W A;  5CV7 A;  3DMU A;  1TT2 A;  2F0O A;  3ERO A;  4DFA A;  4ZUJ A;  5I9P A;  1SYG A;  1F2M A;  1KAA A;  2EYO A;  3NQT A;  2ENB A;  1KDA A;  2EY6 A;  3MXP A;  4K2K A;  4KJN A;  2F3W A;  4ODG A;  2F0Q A;  2F0E A;  2OEO A;  1EY5 A;  4HMI A;  3NXW A;  4S3S A;  2F0S A;  4R8N A;  4NP5 A;  2SNM A;  4J1M A;  4KD4 A;  4NDX A;  5C6A A;  1KDB A;  4K5W A;  3DHQ A;  4B9X A;  1F2Z A;  1EY0 A;  2OF1 A;  4NMZ A;  4N9T A;  3SK8 A;  1EYA A;  3TP6 A;  5I6W A;  5K5P A;  5J39 A;  3H6M A;  2EYJ A;  5C5L A;  2WAC A;  5EKL A;  3U9O A;  1STN A;  3SK6 A;  4ME5 A;  4ZUI A;  1SNP A;  3D4W A;  1KDC A;  4MIU A;  3P1H A;  4KHV A; 
#chains in the Genus database with same CATH topology
 1ICW A;  2K14 A;  2K28 A;  4CJ2 C;  3RLN A;  3VDY A;  4A3C G;  3GTL B;  3Q8D A;  1Y69 U;  4WOR A;  1L1O A;  2OXP A;  4X62 Q;  2E8G A;  3BVM A;  1JR0 D;  5HUR A;  1V1P A;  4P73 A;  4DUZ Q;  1QCB D;  2VS1 A;  3KDF A;  1HHV A;  1AFP A;  2KCT A;  4EGV A;  4WJW A;  1EEF D;  1JMC A;  1R4Q B;  3KLS A;  4LF6 Q;  4BA2 I;  3CPW A;  4BA1 I;  3E9H A;  5EGT A;  2EY5 A;  2WAQ G;  4RKL A;  2A19 A;  5JJI A;  5IP9 G;  1M4V A;  3J7Z C;  1N36 L;  2BDO A;  4LW1 A;  2N3S A;  1DXM A;  1V43 A;  3I70 A;  1LV9 A;  2KHI A;  1KC8 C;  1HNW Q;  2XTI A;  4P2C B;  5EKK A;  5BR8 Q;  3KOJ A;  1JWM D;  1K8M A;  1GM5 A;  2B2T A;  2NUC A;  2K50 A;  4RWS C;  1SYB A;  1ILQ A;  2XN9 C;  4R4O A;  4FYD A;  4CHT B;  1SMY C;  4V19 0;  2I07 B;  3TME A;  3MVV A;  2JN4 A;  3MFY A;  4F7X A;  1W2B A;  3S15 H;  4GKJ L;  1XPR A;  3TEH B;  1A6X A;  2R7F A;  1GUO A;  1CHQ D;  1CK1 A;  1KQS A;  1C9O A;  2FHT A;  1I5F A;  1OXS C;  1PH9 A;  5JEA J;  1J8I A;  5C3E H;  2YYZ A;  3FHW A;  2J7Z A;  1B50 A;  1X54 A;  5ELO A;  1B44 D;  2D0P A;  3K8A A;  3G4S A;  1W3S A;  5TSS A;  1CZG A;  1YIJ A;  3HOY H;  2A6E D;  3WOF A;  4DR6 Q;  2MJ8 A;  1VF5 C;  2AQ2 B;  3TSS A;  1Q46 A;  3QWN A;  5GAE C;  2F4V Q;  4DFA A;  1NJI C;  5I9P A;  4L5R C;  1RHP A;  3M7N A;  3RZO H;  4QUC A;  4ZKC B;  4DV1 L;  2IY5 B;  1IBL L;  5LMN Q;  4IFD H;  1QIL A;  1WTW A;  1HA5 A;  4A3J H;  2A6H C;  1A0I A;  1EIY B;  3TS2 A;  3C2P A;  1YEZ A;  4IFD I;  1F9P A;  2EYJ A;  1Q12 A;  3I2Z A;  1EQQ A;  4MTN A;  3P1H A;  5FO7 B;  4DNT B;  4AQY L;  4DNI A;  1SN8 A;  3S17 H;  5IGG A;  1G2T A;  5JPM C;  5CC4 A;  3HOU B;  5D14 A;  1HUN A;  4YY3 L;  2CWA A;  3RN5 A;  1VQO A;  1WTH A;  5J39 A;  3FPP A;  4KKS A;  2CWP A;  2HDL A;  2Z6K A;  3LX0 A;  3PO2 G;  5J1Z A;  2PQE A;  2EXD A;  2E5L Q;  2ZJP A;  3HOX B;  1G6P A;  2E5L L;  3H0G H;  1GO3 E;  3EQL C;  5JEA H;  1EIF A;  4EQN A;  3RN2 A;  4IOC A;  1G6Z A;  2MGS A;  4QMG A;  3CCQ A;  1EYC A;  4JK1 C;  4AQY Q;  4IUV A;  1UE7 A;  1PRT F;  4ID6 A;  4KLK A;  2QKI C;  3K0Y A;  2F0H A;  4JI5 L;  3OW2 A;  1IZ6 A;  2M00 A;  5KGU A;  2IL8 A;  3SGI A;  5IGD A;  3FMC A;  4JI7 Q;  1HA6 A;  3D8G A;  1I6H H;  3CP0 A;  2R92 G;  1DOM A;  1G2S A;  2RDF A;  4BBR B;  4TRD A;  2NBF A;  3PIO 3;  4A3J G;  2EY2 A;  1LTG D;  1SJH D;  2NB0 A;  4A3D G;  5CV9 A;  1GUW A;  4DUY L;  3PF5 A;  1PDQ A;  1IBM Q;  2R7Z G;  2K7V A;  1F9Q A;  1Z47 A;  1EZ8 A;  1S40 A;  3NWS A;  2O4X A;  4HCE A;  1I94 L;  3DWA A;  3OYY A;  1ROD A;  2B2V A;  3JAM E;  1XMO L;  3FVQ A;  2E2J H;  3PCO B;  4K2L A;  1YVC A;  5JJZ A;  1FNU A;  4A3I B;  3GTM H;  1QUQ B;  1ENC A;  4DV0 Q;  4DV6 L;  5GAH C;  2F0V A;  5C0X G;  3K0X A;  2EYO A;  2DJG C;  2VY3 A;  1DOL A;  2Z4H A;  5IYB G;  4GKK Q;  2KA7 A;  5LMU Q;  1ICF B;  4A3L G;  5C4J B;  3PGZ A;  3MXN B;  1D2B A;  1VQJ A;  2B2U A;  2WV6 D;  5AFW A;  4A93 B;  1TS5 A;  3SK8 A;  2AMC B;  2RSN A;  1WTP A;  1VQB A;  2YV5 A;  2E74 C;  4LFA Q;  3VA7 A;  4N8X 1;  1AZP A;  4MTK A;  5C4X H;  1AH9 A;  2HCI A;  1XWE A;  3H91 A;  1NR2 A;  3KF6 B;  4GN5 A;  3TRE A;  4KHV A;  3J81 E;  3HKS A;  1FR3 A;  3S1R B;  2B2W A;  3LNN A;  5GQO A;  1FGB D;  3T1Y Q;  3S1M B;  2MFI A;  2LY7 A;  3MTS A;  1HFG A;  3PSI A;  4TSS A;  2RVL A;  3J80 L;  2X6L A;  2G9H D;  1DJR D;  1J5E Q;  1LTT D;  3BDO A;  3SK4 A;  2L55 A;  2IJ0 A;  3GTG B;  4CKB A;  5E3F A;  2AKW B;  4CDE C;  1SE4 A;  1CSP A;  2IX0 A;  3NUC A;  4ULL A;  4DR7 L;  3H3V I;  2KUM A;  4B3T Q;  2JA5 G;  2E75 C;  3MHB A;  2UU9 L;  5KYI A;  1PH8 A;  1VDZ A;  1K8G A;  1PVO A;  2VXW A;  5I2Y A;  4CBV A;  2F03 A;  3KFU A;  2WKD A;  4CDF C;  1WJJ A;  4KHP Q;  4RH6 A;  2HUG A;  5ELD A;  3J81 i;  2BE5 D;  2GA4 B;  3JC6 6;  2VQF Q;  1CFM A;  4JYA L;  3K7A B;  1ESR A;  4J8Q A;  3SK5 A;  1N33 L;  2NVT H;  2CH4 A;  4K8I A;  3Q23 A;  4GOP C;  4YCW A;  3KF8 A;  4OEM B;  1EY7 A;  4A3G H;  4C1N I;  1LT6 D;  3K5N A;  4AIM A;  2ZXO A;  4HJA A;  1HR0 L;  2F0U A;  1YIT A;  4RKB A;  3D31 A;  5CBA E;  3I8Z A;  3CF5 A;  4KJO A;  1BR9 A;  4JI1 L;  4YCU A;  1HRJ A;  2KHS A;  1RJT A;  1NCV A;  4DR2 L;  3K6O A;  3RNU A;  4RG1 A;  3OWE B;  4M1U B;  3SXH A;  2K75 A;  2R92 H;  3F2U A;  3F2D A;  4OEL B;  4YIJ A;  3PUX A;  1SXT A;  4CGY B;  1DCZ A;  3AFQ A;  2BDN A;  4YWK A;  1HR0 W;  3K5L A;  2F0O A;  3K81 C;  4A3G G;  2K5V A;  2R7Z B;  2F3W A;  4X3K A;  1MD2 D;  5M5W H;  3CD6 A;  4O2D A;  1LO5 D;  1IL8 A;  4K5W A;  1EWH A;  1Q82 C;  4P72 A;  1EY0 A;  3BZD B;  4FF1 A;  1XNR L;  4WJ4 A;  4A3E G;  2G9D A;  3S1Q H;  1A8V A;  2WKC A;  4L5Q A;  4ABN A;  3HOV H;  2PI2 A;  3D4W A;  3H3V C;  3N52 A;  4LFB Q;  2EXZ A;  2E2I H;  1ZEQ X;  2KHJ A;  2L9H A;  2JA5 H;  2B63 G;  2VL6 A;  3S14 H;  4DKA C;  1GUT A;  2A69 D;  4L5T A;  1UUP A;  1Y8O B;  1SND A;  4JI2 L;  1SAP A;  4R9W A;  2Q2I A;  1F9S A;  2JSO A;  4R4I A;  1SNM A;  4WFN 3;  3S14 B;  1SRO A;  1CA5 A;  1SDF A;  2B8G A;  5FOB B;  1STY A;  2ZXP A;  4ZQ3 A;  5C44 H;  3PO3 B;  1IBM L;  5GRO A;  3BU2 A;  1QOH A;  3MXN A;  3I4M G;  3S2H H;  1C48 A;  2XNA C;  2YTX A;  2VQE Q;  4LF5 L;  4B3T L;  4UY8 C;  4DXG A;  1MJE A;  2NVX B;  1HNZ Q;  3M85 A;  1E2Z A;  1ET6 A;  1DD2 A;  3M7G A;  2VUM G;  2PYK A;  2C5C A;  1S5F D;  5IGE A;  2FJ2 A;  1BUV T;  5FK9 C;  3CCS A;  2A8V A;  1H9S A;  3T16 A;  2CFM A;  3C1F A;  3GD7 A;  4A3B H;  3IL8 A;  2ZJR A;  1JWS D;  4DR4 Q;  1MSG A;  2N78 A;  2QGQ A;  4C56 C;  1NSN S;  2JEA I;  3F8T A;  2A74 C;  3C3L A;  1BOS A;  4YCV A;  4DUZ L;  4FP5 D;  4JBW A;  1M8A A;  3GQB A;  5JPN C;  4KHZ A;  5LL6 S;  4KY7 A;  4GNX B;  1EQV A;  2A6E C;  2MO1 A;  4G7H C;  3PMF A;  3KLS X;  1XMQ L;  1XYI A;  2PZW A;  1DON A;  2FFK B;  2BA0 A;  1HR0 Q;  5CV7 A;  5M5X H;  3HOZ H;  4TVA B;  3D0F A;  1IYV A;  1FJG Q;  1Y1V B;  4DV4 L;  3BYY B;  2YU9 B;  1I4Q A;  1XXG A;  1VQP A;  3PQI A;  3E3X A;  4GLX A;  1SFO B;  2Y0S G;  1LAB A;  3TP6 A;  3WDN A;  5K5P A;  4JI2 Q;  3J81 j;  3QIA A;  3OTO L;  3BZC A;  4IO9 A;  1U4M A;  1B3Q A;  5ELB A;  2R93 H;  2F4V L;  1UE6 A;  3MWY W;  4HIM A;  1D7Q A;  1X65 A;  4PNY A;  2B2Y C;  3NK9 A;  1IL2 A;  4LFB L;  1H9K A;  2UU9 Q;  1EY9 A;  1BBU A;  3KDF B;  1YBY A;  2LXJ A;  1WCM H;  1P16 A;  3D4D A;  1X55 A;  1OXX K;  2WIN B;  1R9T H;  2E2H B;  1I4R A;  5M5Y H;  3RD4 A;  2F3V A;  1LLR D;  1NMG A;  4HJ7 A;  3S9W A;  2MPM A;  3SDZ A;  3S16 B;  3PF4 A;  3DM1 A;  3GTK B;  3A74 A;  3D6W A;  1U4L A;  3CC4 A;  2F0N A;  3J7A 5;  1U4R A;  1L0X B;  1CQF A;  3L2P A;  3F2B A;  4KY6 A;  4BY1 G;  1DGS A;  3M4Q A;  4KV6 A;  1M90 C;  1TWG H;  3FEW X;  2N49 A;  1NMF A;  2VUM H;  1Y1W G;  5C4Z A;  3I4N B;  4I7Z C;  4KMU C;  4BS9 A;  4DF7 A;  4GNX A;  1GOZ A;  1NAP A;  3IRB A;  4YY3 Q;  4NKL A;  2L1B A;  1Y8N B;  3L3O C;  4QJF A;  4DV5 L;  5JJK A;  4UP9 A;  1GXD C;  3PV0 A;  5JJL A;  1VQM A;  4GN4 B;  2BH8 A;  4POG A;  1HZB A;  3MEH A;  4QF4 A;  5DLQ E;  4C3I G;  4DR3 L;  1E1T A;  2G5D A;  1AZQ A;  3OWF A;  1XJV A;  4HMJ A;  1IBL Q;  1RIP A;  1STH A;  3AB9 A;  4K0K L;  2GN5 A;  1KNA A;  2VNU D;  1YNX A;  2Z6K C;  2JA7 B;  1J9O A;  3HKZ G;  1TS2 A;  4NW2 A;  1AW7 A;  4M8A A;  2EY6 A;  1PRT C;  1XTC D;  2IPK D;  2R6G A;  4HSP A;  4DR5 L;  3CKI B;  4CDC C;  1EWC A;  5IYD H;  3GTO H;  1Y1W H;  3A8I E;  2OF1 A;  4DA2 A;  3R93 A;  1L1O B;  4BY1 H;  2KEN A;  2XWB B;  1PV4 A;  4U68 A;  4ZKB B;  1BCP D;  4QIW E;  5ELE A;  2Q2H A;  1X3G A;  1ZXT A;  2NWG A;  2PZT A;  3M4O H;  1S5D D;  1L2F A;  1HXY D;  1A3V A;  1B7Y B;  1GHJ A;  5DAU A;  2RBM A;  3D6C A;  2JQO A;  4QGU A;  3HKZ B;  2FXQ A;  1Q7Y C;  1EOT A;  1WCM G;  2EYH A;  3W3A A;  4GN3 B;  4IFD G;  4H13 C;  5LMU L;  1WTR A;  1H9M A;  4L5S A;  4JI8 L;  5E1F A;  4LF6 L;  4F8M A;  2J4X A;  3L7Z C;  3JAM c;  4A3K B;  4RGO S;  1VQ4 A;  3U58 A;  1A2U A;  1PLF A;  1L1O C;  4LK1 C;  5GAD C;  2OQ0 A;  1KRT A;  1ZYR D;  3ULP A;  1SYC A;  3NTH A;  4GLV B;  1BXT A;  5KYL A;  5NUC A;  1WI5 A;  3GTQ B;  4X66 Q;  4PZ8 A;  4IUT A;  5I6Y A;  1MIU A;  2R61 A;  3H94 A;  4JBM A;  4OL7 A;  2K5D A;  3EIV A;  1LTS D;  1BO0 A;  1W6K A;  1STG A;  4DV1 Q;  3STB D;  4A3F H;  1KD1 C;  2NVQ B;  3GTQ H;  3HKZ E;  4EQP A;  3PIO A;  3NSW A;  5LHY 1;  2B2U C;  1HFN A;  3LGJ A;  4PZ6 A;  3RR5 A;  3S15 B;  2DGY A;  3QO2 A;  1EY4 A;  2B2T C;  4PZ7 A;  3R2T A;  5IWA Q;  1YNN C;  2UXB L;  1TWF B;  2B2W C;  2IX3 A;  4X66 L;  3QB3 A;  1EQR A;  4X64 L;  4DR1 L;  4NXN Q;  3UDF A;  1JWU D;  1VQE A;  1YNN D;  2HQE A;  5IT9 c;  1QNU A;  4LNQ A;  5T1I A;  4JC0 A;  1JB7 A;  3TP5 A;  2X69 A;  3DXJ C;  1U5K A;  2D0O A;  2L0C A;  2TMP A;  3DEO A;  4JI6 L;  1WTO A;  3ERO A;  4HIK A;  1KDA A;  2KOL A;  1SR3 A;  4MZ9 A;  3W2D A;  1EY5 A;  1JJG A;  4KN7 C;  2D9U A;  2Z4I A;  4IPC A;  1OXV A;  1JE4 A;  4R8N A;  3GTG H;  4ILW A;  2UXD Q;  2NTT A;  4NDX A;  1ENF A;  2IHF A;  1XNR Q;  3MXG A;  3F1Z A;  3DHQ A;  2BE5 C;  4R1J A;  4R4Q A;  4UP7 A;  4B08 A;  2CCZ A;  1PTO H;  4A3J B;  4N9T A;  1IKM A;  3PIP A;  1GUG A;  1GUN A;  5DM7 3;  3P20 A;  3U50 C;  5HGQ A;  3G6E A;  4FXG C;  4C3J H;  1FL0 A;  3CME A;  2OTL A;  1YJ9 A;  2XIW A;  1TS3 A;  2ZM6 L;  4NXM Q;  4E6I A;  4JV5 L;  2F0L A;  1TS4 A;  3SHL A;  4KK7 A;  3G71 A;  2PW7 A;  2NN6 I;  2JA8 B;  2IX1 A;  1CKO A;  1XX8 A;  4DGZ A;  3TP8 A;  1Q1E A;  1YI2 A;  3HOW B;  4OGQ C;  2KED A;  1VQ5 A;  3BS1 A;  4DR5 Q;  2GVA A;  4A3G B;  3C1E A;  3J81 L;  3CXC A;  4I7A A;  4A3L H;  1X6O A;  4GS3 A;  1N34 L;  2R7D A;  3S1N B;  3K59 A;  4LUO A;  3CAM A;  3HOV G;  2SOB A;  3KUP A;  4IPD A;  2ZJQ A;  4K6D A;  1VF7 A;  2CVR A;  4BXX G;  4DV2 Q;  1B70 B;  3RMH A;  1SSO A;  4UHV A;  4Y7N B;  1JE5 A;  1M1K C;  3S1N H;  4F88 A;  5KND A;  1EUJ A;  3KYH C;  3CQZ B;  3G7L A;  5CBE E;  4XQQ A;  1KRS A;  1X3Q A;  1X56 A;  2Q8R E;  3JAM i;  1LYL A;  4Y7N H;  3CCU A;  1RL2 A;  1PXU A;  2ZTC A;  5KEE A;  1FYC A;  3DM3 A;  3BDL A;  1L0W A;  1EL0 A;  2AWN A;  2K1B A;  1VQ9 A;  1JT8 A;  2VZA A;  5HGT A;  1D5Z C;  4DK6 C;  4DR7 Q;  3ND9 A;  3E5S A;  2JJQ A;  3I72 A;  3PO2 H;  4A3D H;  2KCM A;  1N32 L;  1TWA B;  2NVY B;  4XIG S;  3TS0 A;  1F77 A;  1XPO A;  1SLJ A;  1O80 A;  2D62 A;  1S5E D;  2JXM B;  2I0Q A;  3A8K E;  2E2J B;  3FP9 A;  5EBC A;  3HOV B;  3KLW A;  1QJO A;  1NTG A;  3T1Y L;  1K0R A;  4DAM A;  1TR5 A;  2E2I B;  4ZUJ A;  4L63 B;  3J7A V;  2YTV A;  2RQX A;  1V1P B;  3NEL A;  3HFZ B;  3OW7 A;  1YHQ A;  4PQX A;  4LF8 Q;  4RHR A;  2FMM A;  1VQ8 A;  3E0J A;  2EIF A;  5A2Q L;  4DR1 Q;  1E2W A;  2JA8 G;  1KIX A;  1Z7T A;  1VQG A;  3H6M A;  2WAC A;  5EKL A;  1QZG A;  1STN A;  4HID A;  3Q24 A;  3S2D H;  5EAY A;  3EVQ A;  3I4N G;  3F2C A;  5FO8 B;  3DWQ A;  4B3S Q;  1ML0 D;  1TY0 A;  5IOC A;  1SMY D;  1YHA A;  3P75 A;  5ELF A;  1G91 A;  2EYL A;  3NBH B;  2PPB C;  3UE1 A;  2MQH A;  2ZXR A;  2XRS D;  5COY A;  2Z6B A;  5EPL A;  4JI4 L;  2UXC L;  4IUN A;  1PTO C;  1YNJ D;  4JYA Q;  2JA6 H;  1X32 A;  3RZD H;  2WII B;  1H95 A;  5I9O A;  3NBH A;  3VR6 A;  3PUY A;  1PTO D;  1SYE A;  4B3R Q;  1UAP A;  2WFW A;  4GKJ Q;  5T1G A;  2JA6 B;  3KLR A;  5CYU A;  1E22 A;  1HZC A;  2AQ3 B;  4RHS A;  1WD0 A;  2RDG A;  5AJ3 L;  2WP8 J;  3M4Y A;  3ZYY X;  4Z9C B;  1EU3 A;  3LWE A;  3R3O A;  1D8L A;  3OOC A;  1PH5 A;  2NVT B;  4RMF A;  1EIH A;  1KXL A;  3ZJY C;  1HQR D;  5IYB H;  2O5I C;  3CCV A;  1I4X A;  2F4I A;  3J80 i;  1BVS A;  2NZH A;  2Q2T A;  1WFQ A;  5C5M A;  5D3D A;  5M3M H;  2EYM A;  1AE3 A;  3T56 B;  4JBK A;  4HED A;  2N55 A;  2ICE C;  1T5E A;  1P8L A;  1A3T A;  1II3 A;  3I73 A;  4HAE A;  1JOO A;  1EFW A;  1LTI D;  5E4X A;  4MNO A;  4QCL A;  4U67 3;  1A63 A;  1I4P A;  1I3Q B;  4IUU A;  3CCL A;  1N8R C;  2B2Y A;  5M9O A;  5C4X G;  2A68 C;  4ALP A;  3CRK C;  2NTS A;  3G6J B;  1H9R A;  5IOD A;  2J0T D;  4FF2 A;  1Q1B A;  4FVM A;  3E0E A;  1S5B D;  1XNQ L;  1PRT D;  2IW3 A;  4ZCK A;  2R93 B;  2HT1 A;  1W6J A;  4IUQ A;  5IYC H;  3Q0A A;  4OO1 H;  1TT2 A;  2LFN A;  2PNR C;  3A5Z B;  3KBG A;  4HJ9 A;  4A3B G;  1F2L A;  5LMN W;  1WCM B;  4J1M A;  1X3F A;  1PZI D;  1HZA A;  3KBX A;  3BVG A;  5IP7 G;  3I4L A;  3VYU A;  3AQQ A;  2UUA L;  1Z6H A;  1BBW A;  3S1Q B;  2LMC B;  4RAU C;  3UE0 A;  1YJN A;  2HHH L;  1B53 A;  1QZH A;  1VQA A;  5K36 H;  2YTY A;  1KDC A;  2WB1 B;  1HQM C;  4OWX B;  3GTK H;  3OMC A;  1GHK A;  3MEF A;  1HTL D;  3UDI A;  3BDC A;  4IQZ A;  5FJ8 H;  3D3R A;  1C8C A;  4GNX C;  3GV3 A;  4POF A;  4A3M H;  1E3P A;  2KQ3 A;  3HOY B;  5M3F H;  1O7Z A;  4DU9 A;  2A69 C;  4LF7 Q;  1UEA B;  4N9P A;  1EYG A;  1DZ1 A;  2L4N A;  2HQL A;  4IPH A;  1Q81 C;  4IUP A;  1A62 A;  5C44 B;  4K8J A;  3I55 A;  5COR A;  4UPA A;  4A75 A;  5BN3 A;  2EYF A;  2K52 A;  4C3I H;  3G48 A;  1KHI A;  3RUZ A;  2ASB A;  4LUV A;  1PYS B;  4JBJ A;  2F0P A;  1LTA D;  3KK7 A;  4KD3 A;  2Q2U A;  2OTJ A;  2PI2 E;  2NVX H;  1PH1 A;  3V2T A;  4A3C H;  1B9N A;  4C3I B;  3CPF A;  1EOV A;  4WJ3 M;  4C3H H;  2QA4 A;  1PFS A;  1TII D;  5FLM G;  2K04 A;  3GTJ B;  3AMU A;  1PRT B;  3VR4 A;  4A3E H;  1FVI A;  1WYD A;  3NQI A;  2EY1 A;  1K73 C;  1N32 Q;  2F0G A;  2K5W A;  4K14 A;  3BVZ A;  3OSO A;  4C3H B;  3VYS A;  4XQJ A;  1B3A A;  1E24 A;  2Z9H A;  2Z1C A;  1Q8K A;  4A3B B;  4N8F A;  4DN4 M;  3FPU B;  4LF4 Q;  3MFG A;  4DV0 L;  4DV6 Q;  3A5U A;  1IYJ B;  1TWH H;  4GLA C;  4IUR A;  5I4D A;  1Y1W B;  1YNJ C;  2BOS A;  2DNC A;  3SEB A;  4GZY C;  5KNC A;  4BY1 B;  2HDM A;  4O1N A;  4XYO A;  2V4D A;  3A56 A;  4B9W A;  4BBR H;  1HPC A;  1FJG L;  3GTL H;  1S3O A;  3M4O B;  3PUZ A;  3I90 A;  3M9B A;  3B6Y A;  4DAY A;  2QEX A;  5JVG 3;  4NP5 A;  1E7Z A;  3CRL C;  3M3Y H;  1U4P A;  4B9X A;  2RCN A;  1SFO H;  1ILP A;  4X3U A;  5I6W A;  1UNS A;  4JW0 A;  1J5E L;  1MGS A;  1SBB B;  2DN8 A;  2EOT A;  3NEM A;  4ZUI A;  2ZM6 Q;  1NY4 A;  4RFB A;  1DYQ A;  3STB C;  2PW5 A;  2QEJ C;  4HCS A;  5KNB A;  1YJW A;  1TU2 B;  5E4W C;  4ZRZ A;  4ZYS A;  3AYH B;  4ZAI A;  3KJO A;  1F9R A;  3ITP A;  1VS0 A;  1SJE D;  1CZW A;  4QUF A;  4ZLT F;  5IIF A;  4OX9 Q;  3NWT A;  1V1O A;  4A3M G;  1BDO A;  1YHB A;  1PH2 A;  1PH7 A;  4JI1 Q;  1ASY A;  5CMD A;  2UXD L;  4Q5V A;  2NN6 G;  3S16 H;  1I6V C;  2MHV A;  4FXD A;  5EJW A;  1ENA A;  5IGC A;  5C3E B;  1HNX Q;  1HTP A;  3ONA B;  3BYT B;  1TVX A;  4UAI A;  1PHJ A;  4ZK9 B;  2HIX A;  3T51 B;  2K32 A;  2AWO A;  1TWG B;  1NNX A;  3EFX D;  2A1A A;  3P7J A;  4TQU S;  2KJX A;  4KI0 A;  1BCP C;  2PMZ B;  2ALY B;  2K5N A;  3EN2 A;  4IAL A;  3J80 c;  1MI2 A;  4JI0 Q;  5ISR A;  3TRZ A;  1JCK B;  1QB5 D;  1RTO A;  4YHH Q;  1NBW A;  2Q8I B;  2IHE A;  2L11 A;  2PQA B;  3FDT A;  1VQC A;  4P75 A;  1QE6 A;  3MZ5 A;  1QUQ A;  1LTB D;  1ONL A;  1SE3 A;  4DR3 Q;  3CHB D;  4RGM A;  2KVM A;  3S17 B;  4MHE A;  3N6R A;  1CT1 D;  3TZD A;  2JA6 G;  1PFB A;  3NTI A;  3H3V H;  4DAV A;  1JIC A;  4A3I G;  1B9M A;  2N88 A;  1H9S B;  1BBX C;  5LL6 X;  1ZKO A;  2JA7 H;  1KAA A;  2RCF A;  3C46 A;  2L15 A;  1A15 A;  2UUC Q;  1SE2 A;  4JI8 Q;  2SNM A;  5IYC G;  1V1Q A;  4OO1 G;  3BZK A;  2JK8 A;  3HOW H;  2PO4 A;  2WB1 G;  1VQF A;  4AH6 A;  4A76 A;  3Q6S A;  1J6Q A;  3IAY A;  1SNP A;  3FRP B;  4G7O C;  1IBK L;  4JCV E;  3HS0 C;  4KKU A;  4QQB X;  1RCV D;  2M2L A;  2XSC A;  2R92 B;  1SYF A;  5FLX E;  1JC7 A;  4IFD J;  1O7Y A;  1ET9 A;  1K28 A;  1TXY A;  3J80 E;  2NZ1 D;  4WRD A;  2L5T A;  3ER0 A;  2MNA A;  3BJU A;  2R7Z H;  5J22 A;  2V1C C;  2I5L X;  3S24 A;  2VW9 A;  3OMG A;  1VQN A;  1WD1 A;  2ATW A;  2RHQ B;  1BKB A;  2AHO B;  2EYP A;  5A2Q E;  1KL9 A;  1U9R A;  2LXK A;  3GV6 A;  4K5X A;  4K5V A;  1EQT A;  2XWJ B;  4A3K H;  2PQA A;  3A8J E;  3MA2 B;  3TDQ A;  4DPG A;  3PIP 3;  4DR6 L;  3PUV A;  3K58 A;  1SYD A;  4H0L C;  1IW7 D;  4QL5 A;  1MSH A;  3W1B A;  4A3I H;  1TWA H;  2WB1 E;  1JOR A;  3OTO Q;  4J6H A;  4DV3 L;  4LMQ D;  2EE1 A;  5EKI A;  2Z0S A;  3GTP B;  1K83 H;  2M9V A;  1TQO A;  2K5Q A;  4XT1 B;  1I50 H;  1Z9F A;  4KHP L;  4LJZ C;  1VQ7 A;  4A3F B;  2NVQ H;  4PMW A;  3H09 A;  1HNX L;  4FF3 A;  4JVZ A;  1I50 B;  1TWC B;  3I4O A;  2B29 A;  2VB2 X;  4JOI C;  3T4A C;  5BN5 A;  2AUJ D;  1LTL A;  4X65 Q;  1LT5 D;  3S1R H;  4DK0 A;  2B39 A;  3K80 C;  1NR4 A;  4H44 C;  2DNE A;  3NP8 A;  1HZ9 A;  4BY7 B;  4KKT A;  1JB3 A;  1K8O A;  4JI3 Q;  2KBN A;  2UUB Q;  4L8J A;  1N9W A;  3EBE A;  1LUZ A;  1B1Z A;  3MXP A;  4KJN A;  1SE8 A;  2F0E A;  4BY7 H;  3NXW A;  4S3S A;  2H1E A;  5E7N A;  2B63 B;  1KDB A;  1CSQ A;  1EFI D;  1C7Y A;  1K8A C;  1PTO B;  3J7A F;  2QF7 A;  5AJ3 Q;  4C3H G;  4APV A;  2C9O A;  4P71 A;  4HSV A;  1CUK A;  3ULL A;  5FO9 B;  1EU4 A;  3OIP A;  4UP8 A;  3VA5 A;  4HTH A;  3X3N A;  4XQN A;  2RKS A;  2JA8 H;  2F0M A;  1D1I A;  2WAQ B;  5CV8 A;  2KEC A;  1X3P A;  4DNR B;  1UEB A;  1EZ6 A;  4X6A H;  1QWY A;  1Y1V H;  4OIK A;  2AQ1 B;  1NE3 A;  1LTR D;  1E0B A;  2CQO A;  2YU9 H;  2QDB A;  3L9A X;  1R4P B;  5EPK A;  5CV4 A;  3H0G G;  1PTO F;  3Q22 A;  1I4H A;  2B3G A;  5CGK A;  4UDU C;  4JI0 L;  4HN7 A;  4FO2 A;  1YZ6 A;  3VR3 A;  4X3S A;  3ICE A;  3CC7 A;  1QVF A;  3HEJ A;  2H4O A;  1LT4 D;  2DJF C;  1I3Q H;  3GDE A;  4A3F G;  4JI7 L;  1SMX A;  1PZJ D;  3KJP A;  3CQZ H;  5DM6 3;  3CCJ A;  1WTQ A;  1PFN A;  4DAY B;  4DK3 C;  1N36 Q;  1SNQ A;  5M5W B;  2ZT9 C;  5F2D A;  1RF2 D;  1TY2 A;  3AU7 A;  5EPJ A;  4YWL A;  5M5Y B;  2L12 A;  4DR4 L;  2ES2 A;  3UDG A;  3I56 A;  2OCE A;  5GAG C;  4G7Z C;  4I65 A;  1V9P A;  3CCR A;  3DUZ A;  4LWC A;  4C3J G;  4OO1 I;  1AP0 A;  3KF6 A;  4C1N K;  5H1S E;  2JA5 B;  2UUC L;  1B4O A;  5JEA G;  5BN4 A;  1SNC A;  4BBS G;  4YWM A;  3R8B A;  1PZK D;  2RA4 A;  3DMU A;  5ELC A;  3NQT A;  1F2M A;  3CCE A;  2EDG A;  2FIN B;  4A3M B;  2F3I A;  2R3Z A;  3FKI B;  4KD4 A;  4P74 A;  5C6A A;  1U0L A;  4OXP A;  1OXT A;  2ZTD A;  2UXB Q;  1FD7 D;  1LT3 D;  4DV3 Q;  3MXU A;  2VQF L;  1N33 Q;  3HGB A;  5C5L A;  4XT3 B;  3U9O A;  3FKI H;  3A54 A;  5M3F G;  4DV4 Q;  4A93 G;  3URY A;  4B3S L;  2NYZ D;  1B8A A;  1DM0 B;  3K5M A;  2EJM A;  1SEB D;  4DV5 Q;  5C0X I;  1QNK A;  5DEH A;  1KLG D;  3HZX A;  1VMP A;  1K3R A;  2K03 A;  1V8Q A;  4X3T A;  3DWP A;  1Q86 C;  2WAQ E;  1K0S A;  4ME3 A;  3HOX H;  3GTJ H;  2VB3 X;  2KCN A;  1HNW L;  4LUZ A;  3H0G B;  3A7L A;  1C0A A;  4IN3 A;  4HJ8 A;  3MAQ A;  5IP7 H;  3NE5 B;  2MP1 A;  5ELN A;  2JA7 G;  1HJP A;  2K01 A;  5C0X H;  1K9M C;  1EWI A;  3RLO A;  2QW7 A;  2X6G A;  2F0F A;  4JG2 A;  2IWH A;  4NXM L;  4HR7 B;  4DXF A;  2UUB L;  3TP7 A;  3UDX A;  4G57 A;  4IJL A;  1G51 A;  4XYQ A;  4RGN A;  1I6H B;  2QDL A;  3UI2 A;  2AUK A;  4OWT B;  4F87 A;  4FXK C;  3HOZ B;  5IE8 A;  3AFP A;  3K57 A;  4X65 L;  3V96 A;  1GVP A;  2DUD A;  4LF7 L;  1TKW B;  2JEB I;  3QOL A;  5IY0 A;  4BBR G;  5FLM H;  3FKI G;  1STE A;  3NTK A;  2B2V C;  3T53 B;  5M3M B;  2F0J A;  5IGB A;  1RD9 D;  2VQE L;  4LF5 Q;  1Y1V G;  1KAW A;  5CV5 A;  2F52 A;  3X3M A;  4X62 L;  5C3E G;  2CH4 W;  1SRU A;  2OT2 A;  4K6L A;  3U4V A;  1VQK A;  3E9I A;  1JQY D;  3NBI A;  3E6Z X;  2DY7 A;  1F2Y A;  1S72 A;  2A73 B;  1KNE A;  2OQK A;  2A68 D;  3TZU A;  3HOX G;  1PMR A;  4RGT A;  5EQ0 A;  1SYG A;  1R9T B;  1GUS A;  1CA6 A;  1VMC A;  1N34 Q;  5C0X J;  1G8Z D;  1VQI A;  1PH3 A;  4K0K Q;  4HMI A;  2RHS B;  1MHW C;  5FLX L;  1I4G A;  4J15 A;  4A93 H;  3I7F A;  1PFM A;  3K5O A;  2EVB A;  4NMZ A;  3SE0 A;  3SVM A;  1OTC A;  2MUY A;  1ASZ A;  1Q90 A;  5FLX c;  3ULJ A;  2LKV A;  4OIJ A;  2VUM B;  4AYB E;  2D5D A;  1MBY A;  3I4N H;  1O7I A;  3HG9 A;  3RZO B;  1IBK Q;  1Q8I A;  2PNH A;  2Y0S B;  3IFD A;  4DAP A;  2RF4 A;  4LFA L;  2OWO A;  2SNS A;  4IZ8 A;  2QIL A;  2Y0S E;  1BCP B;  3EJI A;  1EY6 A;  2CQA A;  2EJG C;  2ID0 A;  4QB4 A;  3J7Y W;  2LS0 1;  4IOA A;  3WOE A;  4QY7 A;  1EEI D;  1QVG A;  1HH2 P;  4LFC L;  4GOP A;  2CKZ B;  1MJC A;  3CMA A;  3HOU H;  2A6H D;  1QG7 A;  2JP1 A;  3K7A H;  1UWV A;  1QVC A;  4RA8 A;  4C3J B;  2HD3 A;  1ZYR C;  5C3X A;  5M3M G;  1CKN A;  4GOP B;  1XMO Q;  4PMC A;  4NPS A;  1STB A;  3R2I A;  4R4C A;  3NHH A;  5LMN L;  4A3E B;  2KCC A;  2SEB D;  5EBD A;  1Y8P B;  1B2T A;  2D2C C;  3NEN A;  4Q0F A;  3HOZ G;  2EQS A;  4IJH A;  3GTO B;  5HY6 A;  1BCP F;  1HUM A;  4EX5 A;  5KIX A;  1AN8 A;  1SNO A;  1VQ6 A;  3I3C A;  3CCM A;  1TWH B;  4B3M L;  3I4M H;  4BY7 G;  2LSS A;  2E76 C;  4KY5 A;  3L0O A;  5C44 G;  1NUC A;  3GP7 A;  4LF4 L;  3K7U C;  1CHP D;  4LF8 L;  4G4K A;  1PH4 A;  5KRU A;  1D5M C;  2RSO A;  5JAV A;  3I4M B;  3VR5 A;  1GJX A;  1PYB A;  2K05 A;  1RDP D;  4JI5 Q;  3WWV A;  2KEE A;  4ODG A;  1XPU A;  3V05 A;  2EJF C;  3TN2 A;  3IKJ A;  2F0S A;  4R8I A;  1KTK A;  1BQQ T;  1H9J A;  4XTC S;  2EPB A;  1WTV A;  2GVB A;  1IW7 C;  3QR8 A;  1F2Z A;  3M3Y B;  3D4R A;  4NB3 A;  1D5X C;  1T5X D;  2I46 A;  4A3D B;  5FJ8 G;  4ME5 A;  3GTM B;  2HIV A;  1MKH A;  4MIU A;  2NVY H;  2EZV A;  4QIW B;  3T1H L;  4CJ1 B;  5L37 A;  1E2V A;  2XRQ D;  3CW2 C;  1JJ2 A;  1S4Z A;  2HCC A;  4AYB G;  1A2T A;  3VR2 A;  1HCZ A;  4XXE A;  1K3B C;  5D3I B;  4DR2 Q;  1EIG A;  5C4J H;  1EY8 A;  1JJC B;  2K5H A;  2NZO A;  1K83 B;  2F0K A;  2ICI A;  4BBS B;  3HOW G;  3PO3 H;  3QJY A;  3I91 A;  1I94 Q;  5C4X B;  3S2H B;  3KF8 B;  1TWF H;  1DOK A;  2K6A A;  1PH6 A;  4O0A A;  3AEV A;  1E1O A;  4BBS H;  4DUY Q;  1TWC H;  5D65 A;  3BG3 A;  3S1M H;  1KLU D;  3DLL A;  2N8N A;  4OHJ A;  1CKM A;  4PG3 A;  2HHH Q;  3S2D B;  1G29 1;  4CDD C;  3ND8 A;  4BWG B;  5IT9 E;  3HOU G;  1KAB A;  1WVL A;  4FDB A;  2JYO A;  3U4Z A;  2F0T A;  4DV2 L;  2XGT A;  1IHZ A;  1C4Q A;  5G3L D;  2ZTE A;  5C3W A;  1JOK A;  2F0I A;  2JA9 A;  2F0W A;  4FNF A;  1AE2 A;  4LFC Q;  2XVS A;  3RZD B;  3A0J A;  4DK1 A;  1STA A;  3T1H Q;  1XMQ Q;  2IT1 A;  1XNQ Q;  2I5M X;  2Q8T A;  1PYW D;  4RCN A;  5A35 A;  4EVO A;  2B63 H;  4EQ5 A;  4DV7 L;  2F0D A;  4PV1 C;  2RDH A;  2BA1 A;  3OIQ A;  3PO3 G;  5CR3 A;  4Y52 H;  2PMZ E;  1A3U A;  2I5H A;  3TBI B;  1AEX A;  1O7L A;  4CKE A;  4GKK L;  5M5X B;  5CV6 A;  5FKA C;  2JE6 I;  4CKC A;  4K2K A;  1WTX A;  3ERS X;  1FNV A;  2B8F A;  2F0Q A;  5I2X A;  2OEO A;  5JVH 3;  2Z8L A;  4LF9 Q;  1UE5 A;  3VYT A;  4R4T A;  4MN3 A;  1EYA A;  4O42 A;  2BH2 A;  4C2M H;  4BXX H;  4B3M Q;  3HP3 A;  1CTM A;  5J3B A;  1HNZ L;  1RTN A;  3SK6 A;  2K4K A;  1X9N A;  2PCF B;  1IKL A;  4EQO A;  2FMC A;  4JI6 Q;  1BF4 A;  4TKO B;  1WOC A;  3HRZ C;  4C2M B;  2E2D C;  3M4P A;  3LWU A;  3VYR A;  5IT9 L;  1S5C D;  3U9S A;  4CJ0 B;  1IYU A;  4B3R L;  4H02 A;  5JOB A;  3OPO A;  3PUW A;  3CU7 A;  1PA6 A;  4NXN L;  4X64 Q;  2O5J C;  4JI4 Q;  2E2H H;  4V0B A;  5DNF A;  5G3L F;  1GD7 A;  2UXC Q;  1T9H A;  5IWA L;  4HIO A;  1CM9 A;  4A4I A;  3QG1 A;  2NN6 H;  3CC2 A;  1FNW A;  2SDF A;  5IYD G;  3PO2 B;  2BCO A;  4RCO A;  3A7A B;  3GO5 A;  1O78 A;  1XTD A;  1RKN A;  1JOQ A;  4YHH L;  4H7B A;  3J81 c;  4OWW B;  4LAA A;  1EYD A;  1GKH A;  1CI3 M;  4HJ5 A;  3T13 A;  3HOY G;  5K36 G;  5IP9 H;  1VQH A;  1VQL A;  3H15 A;  2F1M A;  5BR8 L;  1BNZ A;  4OX9 L;  3EA6 A;  2TSS A;  1VCI A;  4LF9 L;  3GTP H;  4JPB W;  5M3F B;  4JV5 Q;  4PMB A;  3A55 A;  1Y14 B;  3JAM L;  2CHB D;  4JI3 L;  1D1K A;  3SR1 A;  3QOJ A;  3W5O A;  5IGF A;  3ERQ A;  3DEP A;  4KTA A;  2P5Z X;  1ESF A;  1Q3L A;  1X3E A;  3TQY A;  4DV7 Q;  1CKN B;  2PZU A;  2A5H A;  1FGU A;  2C35 B;  4OON A;  2QCP X;  2R93 G;  4JOI A;  1CQV A;  4IPG A;  5C4H A;  4FF4 A;  4A3K G;  2DY8 A;  2O2L D;  3RLF A;  1IXR A;  3MC0 B;  4XDX A;  2ENB A;  1OO9 B;  1L0Y B;  4AYB B;  4KN4 C;  1D6E C;  1OXU A;  1LAC A;  1VQD A;  3OHX C;  2UUA Q;  2K33 A;  3IFT A;  4L6T B;  2H5X A;  2CW0 D;  2MO0 A;  1LM0 A;  1UE1 A;  3O13 A;  2CW0 C;  3NPP A;  3W1G A; 
#chains in the Genus database with same CATH homology
 1ICW A;  2K28 A;  4CJ2 C;  3GTL B;  1Y69 U;  4WOR A;  2OXP A;  3BVM A;  1JR0 D;  5HUR A;  1V1P A;  1QCB D;  1HHV A;  1AFP A;  4EGV A;  4WJW A;  1EEF D;  1R4Q B;  3KLS A;  4BA2 I;  4BA1 I;  5EGT A;  2EY5 A;  4RKL A;  1M4V A;  2BDO A;  1DXM A;  1V43 A;  3I70 A;  1LV9 A;  4P2C B;  5EKK A;  1JWM D;  1K8M A;  2B2T A;  2NUC A;  4RWS C;  1SYB A;  1ILQ A;  2XN9 C;  4FYD A;  4CHT B;  1SMY C;  4V19 0;  2I07 B;  3TME A;  3MVV A;  3MFY A;  4F7X A;  1A6X A;  1GUO A;  1CHQ D;  1CK1 A;  2FHT A;  1OXS C;  5JEA J;  1J8I A;  2YYZ A;  2J7Z A;  1B50 A;  1B44 D;  5TSS A;  1CZG A;  2A6E D;  3WOF A;  2MJ8 A;  1VF5 C;  2AQ2 B;  3TSS A;  3QWN A;  4DFA A;  5I9P A;  1RHP A;  3M7N A;  4QUC A;  4ZKC B;  4IFD H;  1QIL A;  1WTW A;  1HA5 A;  2A6H C;  3C2P A;  4IFD I;  1F9P A;  2EYJ A;  1Q12 A;  3P1H A;  5FO7 B;  4DNT B;  5IGG A;  1G2T A;  5JPM C;  5CC4 A;  3HOU B;  5D14 A;  1HUN A;  5J39 A;  3FPP A;  4KKS A;  2HDL A;  3LX0 A;  5J1Z A;  2PQE A;  3HOX B;  3EQL C;  5JEA H;  4EQN A;  1G6Z A;  2MGS A;  4QMG A;  1EYC A;  4JK1 C;  4IUV A;  1PRT F;  4ID6 A;  2QKI C;  3K0Y A;  2F0H A;  2M00 A;  5KGU A;  2IL8 A;  5IGD A;  3FMC A;  1HA6 A;  3D8G A;  1DOM A;  1G2S A;  2RDF A;  4BBR B;  4TRD A;  2NBF A;  3PIO 3;  2EY2 A;  1LTG D;  1SJH D;  2NB0 A;  1GUW A;  5CV9 A;  1PDQ A;  2K7V A;  1F9Q A;  1Z47 A;  1EZ8 A;  3NWS A;  2O4X A;  4HCE A;  3DWA A;  1ROD A;  2B2V A;  3JAM E;  3FVQ A;  4K2L A;  5JJZ A;  1FNU A;  4A3I B;  1ENC A;  2F0V A;  5C0X G;  2EYO A;  1DOL A;  2Z4H A;  2KA7 A;  5C4J B;  1D2B A;  2B2U A;  2WV6 D;  5AFW A;  4A93 B;  1TS5 A;  3SK8 A;  2RSN A;  1WTP A;  2E74 C;  3VA7 A;  1AZP A;  2HCI A;  1XWE A;  3H91 A;  1NR2 A;  3J81 E;  4KHV A;  1FR3 A;  3S1R B;  2B2W A;  3LNN A;  1FGB D;  3S1M B;  2LY7 A;  3MTS A;  1HFG A;  4TSS A;  3J80 L;  2RVL A;  2X6L A;  2G9H D;  1DJR D;  1LTT D;  3BDO A;  3SK4 A;  2L55 A;  2IJ0 A;  3GTG B;  4CKB A;  5E3F A;  1SE4 A;  2IX0 A;  3NUC A;  4ULL A;  2KUM A;  2E75 C;  3MHB A;  5KYI A;  1VDZ A;  2VXW A;  5I2Y A;  4CBV A;  2F03 A;  2WKD A;  4RH6 A;  2HUG A;  5ELD A;  2BE5 D;  2GA4 B;  1CFM A;  3K7A B;  1ESR A;  4J8Q A;  3SK5 A;  3Q23 A;  4K8I A;  3KF8 A;  1EY7 A;  4C1N I;  1LT6 D;  3K5N A;  2ZXO A;  2F0U A;  4RKB A;  3D31 A;  5CBA E;  3I8Z A;  4KJO A;  1BR9 A;  1HRJ A;  2KHS A;  1RJT A;  1NCV A;  3K6O A;  3OWE B;  4M1U B;  3SXH A;  3F2U A;  4YIJ A;  3PUX A;  1SXT A;  4CGY B;  1DCZ A;  2BDN A;  3K5L A;  2F0O A;  2R7Z B;  2F3W A;  4X3K A;  1MD2 D;  1LO5 D;  1IL8 A;  4K5W A;  1EWH A;  1EY0 A;  3BZD B;  4FF1 A;  2G9D A;  2WKC A;  4ABN A;  3D4W A;  3H3V C;  3N52 A;  2EXZ A;  1ZEQ X;  2L9H A;  1GUT A;  2A69 D;  1UUP A;  1Y8O B;  1SND A;  1SAP A;  4R9W A;  1F9S A;  2JSO A;  1SNM A;  4WFN 3;  3S14 B;  1CA5 A;  1SDF A;  2B8G A;  5FOB B;  1STY A;  2ZXP A;  4ZQ3 A;  3PO3 B;  1QOH A;  3MXN A;  1C48 A;  2XNA C;  4DXG A;  2NVX B;  3M85 A;  1E2Z A;  1ET6 A;  1DD2 A;  3M7G A;  2PYK A;  2C5C A;  1S5F D;  5IGE A;  2FJ2 A;  1BUV T;  5FK9 C;  1H9S A;  3T16 A;  3C1F A;  3GD7 A;  3IL8 A;  1JWS D;  1MSG A;  4C56 C;  1NSN S;  2JEA I;  2A74 C;  3C3L A;  1BOS A;  4FP5 D;  4JBW A;  1M8A A;  3GQB A;  5JPN C;  4KHZ A;  5LL6 S;  4KY7 A;  1EQV A;  2A6E C;  4G7H C;  3PMF A;  3KLS X;  1XYI A;  2PZW A;  1DON A;  2FFK B;  2BA0 A;  5CV7 A;  1IYV A;  1Y1V B;  3BYY B;  2YU9 B;  1I4Q A;  1XXG A;  1SFO B;  1LAB A;  3TP6 A;  3WDN A;  5K5P A;  3QIA A;  1U4M A;  5ELB A;  3MWY W;  4PNY A;  2B2Y C;  3NK9 A;  1H9K A;  1EY9 A;  3D4D A;  1OXX K;  2WIN B;  2E2H B;  1I4R A;  3RD4 A;  2F3V A;  1LLR D;  3S9W A;  2MPM A;  3SDZ A;  3S16 B;  3DM1 A;  3GTK B;  3D6W A;  1U4L A;  2F0N A;  1U4R A;  1L0X B;  1CQF A;  4KY6 A;  4KV6 A;  3FEW X;  5C4Z A;  3I4N B;  4I7Z C;  4KMU C;  4BS9 A;  4DF7 A;  1GOZ A;  1NAP A;  4NKL A;  2L1B A;  1Y8N B;  3L3O C;  1GXD C;  3PV0 A;  3MEH A;  4QF4 A;  4C3I G;  1AZQ A;  3OWF A;  4HMJ A;  1STH A;  3AB9 A;  1KNA A;  2VNU D;  2JA7 B;  1J9O A;  1TS2 A;  4NW2 A;  1AW7 A;  4M8A A;  2EY6 A;  1PRT C;  1XTC D;  2IPK D;  2R6G A;  4HSP A;  3CKI B;  1EWC A;  3A8I E;  2OF1 A;  4DA2 A;  3R93 A;  2XWB B;  4U68 A;  4ZKB B;  1BCP D;  5ELE A;  1ZXT A;  2NWG A;  2PZT A;  1S5D D;  1HXY D;  1A3V A;  1GHJ A;  5DAU A;  2RBM A;  3D6C A;  3HKZ B;  1EOT A;  2EYH A;  3W3A A;  4IFD G;  4H13 C;  1WTR A;  1H9M A;  5E1F A;  4F8M A;  2J4X A;  3L7Z C;  4A3K B;  4RGO S;  1A2U A;  1PLF A;  4LK1 C;  1ZYR D;  1SYC A;  3NTH A;  1BXT A;  5KYL A;  5NUC A;  3GTQ B;  5I6Y A;  4IUT A;  2R61 A;  3H94 A;  4OL7 A;  2K5D A;  1LTS D;  1BO0 A;  1W6K A;  1STG A;  2NVQ B;  4EQP A;  3NSW A;  5LHY 1;  2B2U C;  1HFN A;  3S15 B;  3QO2 A;  1EY4 A;  2B2T C;  3R2T A;  1YNN C;  1TWF B;  2B2W C;  2IX3 A;  3QB3 A;  1JWU D;  1YNN D;  2HQE A;  1QNU A;  5T1I A;  3TP5 A;  2X69 A;  3DXJ C;  2L0C A;  2TMP A;  3DEO A;  1WTO A;  3ERO A;  1KDA A;  2KOL A;  3W2D A;  1EY5 A;  4KN7 C;  2D9U A;  2Z4I A;  1OXV A;  1JE4 A;  4R8N A;  4ILW A;  2NTT A;  4NDX A;  1ENF A;  3MXG A;  3DHQ A;  2BE5 C;  4B08 A;  1PTO H;  4A3J B;  4N9T A;  1IKM A;  1GUG A;  1GUN A;  5DM7 3;  3P20 A;  4FXG C;  2XIW A;  1TS3 A;  4E6I A;  2F0L A;  3SHL A;  1TS4 A;  4KK7 A;  2PW7 A;  2NN6 I;  2JA8 B;  2IX1 A;  1XX8 A;  4DGZ A;  3TP8 A;  1Q1E A;  3HOW B;  4OGQ C;  2KED A;  3BS1 A;  4A3G B;  3C1E A;  3J81 L;  3S1N B;  3K59 A;  2SOB A;  3KUP A;  4K6D A;  1VF7 A;  2CVR A;  3RMH A;  1SSO A;  4Y7N B;  4F88 A;  5KND A;  3CQZ B;  3G7L A;  5CBE E;  4XQQ A;  1X3Q A;  2Q8R E;  1PXU A;  5KEE A;  1FYC A;  3BDL A;  1EL0 A;  2AWN A;  2K1B A;  5HGT A;  1D5Z C;  3ND9 A;  3E5S A;  3I72 A;  1TWA B;  2NVY B;  4XIG S;  1F77 A;  1O80 A;  2D62 A;  1S5E D;  2JXM B;  3A8K E;  2E2J B;  5EBC A;  3HOV B;  1QJO A;  2E2I B;  1TR5 A;  4ZUJ A;  4L63 B;  3J7A V;  2RQX A;  1V1P B;  3OW7 A;  4PQX A;  4RHR A;  2FMM A;  3E0J A;  5A2Q L;  1E2W A;  1Z7T A;  3H6M A;  2WAC A;  5EKL A;  1STN A;  3Q24 A;  3EVQ A;  5FO8 B;  3DWQ A;  1TY0 A;  1ML0 D;  5IOC A;  1SMY D;  3P75 A;  5ELF A;  1G91 A;  2EYL A;  2PPB C;  2ZXR A;  2XRS D;  5COY A;  5EPL A;  4IUN A;  1PTO C;  1YNJ D;  1X32 A;  2WII B;  5I9O A;  3NBH A;  3VR6 A;  3PUY A;  1PTO D;  1SYE A;  1UAP A;  5T1G A;  2JA6 B;  3KLR A;  5CYU A;  2AQ3 B;  4RHS A;  1WD0 A;  2RDG A;  2WP8 J;  3M4Y A;  3ZYY X;  4Z9C B;  1EU3 A;  3LWE A;  3R3O A;  3OOC A;  1EIH A;  2NVT B;  1HQR D;  2O5I C;  1I4X A;  2F4I A;  5C5M A;  5D3D A;  2EYM A;  3T56 B;  4HED A;  2N55 A;  2ICE C;  1T5E A;  1A3T A;  1II3 A;  3I73 A;  4HAE A;  1JOO A;  1LTI D;  5E4X A;  4QCL A;  4U67 3;  1I4P A;  1I3Q B;  4IUU A;  2B2Y A;  5M9O A;  2A68 C;  3CRK C;  2NTS A;  3G6J B;  1H9R A;  5IOD A;  2J0T D;  4FF2 A;  1Q1B A;  4FVM A;  1S5B D;  1PRT D;  2IW3 A;  2R93 B;  1W6J A;  4IUQ A;  3Q0A A;  4OO1 H;  1TT2 A;  2LFN A;  2PNR C;  3KBG A;  1F2L A;  1WCM B;  4J1M A;  1PZI D;  3KBX A;  3BVG A;  3I4L A;  3VYU A;  1Z6H A;  3S1Q B;  2LMC B;  4RAU C;  1B53 A;  5K36 H;  1KDC A;  2WB1 B;  1HQM C;  3OMC A;  1GHK A;  1HTL D;  3BDC A;  4IQZ A;  1C8C A;  3D3R A;  3GV3 A;  2KQ3 A;  3HOY B;  1O7Z A;  4DU9 A;  2A69 C;  1UEA B;  4N9P A;  1DZ1 A;  2L4N A;  4IUP A;  5C44 B;  4K8J A;  5COR A;  5BN3 A;  2EYF A;  3RUZ A;  2F0P A;  1LTA D;  3KK7 A;  4KD3 A;  3V2T A;  1B9N A;  4C3I B;  1TII D;  2K04 A;  3GTJ B;  3AMU A;  1PRT B;  3VR4 A;  3NQI A;  2EY1 A;  2F0G A;  2K5W A;  4K14 A;  3BVZ A;  3OSO A;  4C3H B;  3VYS A;  4XQJ A;  1B3A A;  2Z1C A;  4A3B B;  4DN4 M;  3FPU B;  3MFG A;  4IUR A;  5I4D A;  1Y1W B;  1YNJ C;  2BOS A;  2DNC A;  3SEB A;  4GZY C;  5KNC A;  4BY1 B;  2HDM A;  4O1N A;  4XYO A;  2V4D A;  3A56 A;  4B9W A;  1HPC A;  3M4O B;  3PUZ A;  3I90 A;  4DAY A;  5JVG 3;  4NP5 A;  3CRL C;  1U4P A;  4B9X A;  1ILP A;  4X3U A;  5I6W A;  1UNS A;  1MGS A;  1SBB B;  2DN8 A;  2EOT A;  4ZUI A;  4RFB A;  1DYQ A;  2PW5 A;  2QEJ C;  4HCS A;  5KNB A;  1TU2 B;  5E4W C;  4ZRZ A;  4ZYS A;  4ZAI A;  1F9R A;  3ITP A;  1SJE D;  1CZW A;  4QUF A;  4ZLT F;  5IIF A;  3NWT A;  1V1O A;  1BDO A;  5CMD A;  4Q5V A;  2NN6 G;  1I6V C;  2MHV A;  4FXD A;  5EJW A;  1ENA A;  5IGC A;  5C3E B;  1HTP A;  3ONA B;  3BYT B;  1TVX A;  4UAI A;  4ZK9 B;  3T51 B;  2K32 A;  2AWO A;  1TWG B;  3EFX D;  3P7J A;  4TQU S;  2KJX A;  4KI0 A;  1BCP C;  2PMZ B;  4IAL A;  1MI2 A;  5ISR A;  1JCK B;  1QB5 D;  1RTO A;  2Q8I B;  2L11 A;  3FDT A;  1QE6 A;  3MZ5 A;  1LTB D;  1ONL A;  1SE3 A;  3CHB D;  4RGM A;  2KVM A;  3S17 B;  4MHE A;  3N6R A;  1CT1 D;  3TZD A;  1PFB A;  3NTI A;  4DAV A;  1JIC A;  1B9M A;  2N88 A;  1H9S B;  1BBX C;  5LL6 X;  1ZKO A;  1KAA A;  3C46 A;  1A15 A;  1SE2 A;  2SNM A;  4OO1 G;  2PO4 A;  3Q6S A;  3IAY A;  1SNP A;  3FRP B;  4G7O C;  4KKU A;  3HS0 C;  1RCV D;  2M2L A;  2XSC A;  2R92 B;  1SYF A;  5FLX E;  1JC7 A;  4IFD J;  1O7Y A;  1ET9 A;  3J80 E;  2NZ1 D;  4WRD A;  2L5T A;  5J22 A;  3OMG A;  1WD1 A;  5A2Q E;  2EYP A;  1U9R A;  3GV6 A;  4K5X A;  4K5V A;  1EQT A;  2XWJ B;  3A8J E;  3MA2 B;  3TDQ A;  3PIP 3;  3PUV A;  3K58 A;  1SYD A;  4H0L C;  1IW7 D;  1MSH A;  1JOR A;  4J6H A;  4LMQ D;  2EE1 A;  5EKI A;  3GTP B;  2M9V A;  1TQO A;  2K5Q A;  4XT1 B;  4LJZ C;  4A3F B;  4PMW A;  3H09 A;  4FF3 A;  1I50 B;  1TWC B;  2VB2 X;  5BN5 A;  3T4A C;  2AUJ D;  1LT5 D;  4DK0 A;  2B39 A;  1NR4 A;  4H44 C;  2DNE A;  3NP8 A;  4BY7 B;  4KKT A;  1JB3 A;  1K8O A;  4L8J A;  1B1Z A;  3MXP A;  4KJN A;  2F0E A;  3NXW A;  4S3S A;  2H1E A;  2B63 B;  1KDB A;  1EFI D;  1PTO B;  3J7A F;  2QF7 A;  4C3H G;  2C9O A;  4HSV A;  5FO9 B;  1EU4 A;  3OIP A;  3VA5 A;  4HTH A;  3X3N A;  4XQN A;  2RKS A;  2F0M A;  1D1I A;  2WAQ B;  5CV8 A;  2KEC A;  1X3P A;  4DNR B;  1EZ6 A;  1QWY A;  4OIK A;  2AQ1 B;  1LTR D;  1E0B A;  2QDB A;  3L9A X;  1R4P B;  5EPK A;  5CV4 A;  1PTO F;  3Q22 A;  1I4H A;  5CGK A;  4UDU C;  4HN7 A;  4FO2 A;  3VR3 A;  4X3S A;  3HEJ A;  2H4O A;  1LT4 D;  1PZJ D;  5DM6 3;  1WTQ A;  1PFN A;  1SNQ A;  5M5W B;  2ZT9 C;  5F2D A;  1RF2 D;  1TY2 A;  3AU7 A;  5EPJ A;  5M5Y B;  2L12 A;  4G7Z C;  4I65 A;  3DUZ A;  4C3J G;  4OO1 I;  1AP0 A;  4C1N K;  2JA5 B;  1B4O A;  5JEA G;  5BN4 A;  1SNC A;  3R8B A;  1PZK D;  2RA4 A;  3DMU A;  5ELC A;  3NQT A;  1F2M A;  2EDG A;  2FIN B;  4A3M B;  2R3Z A;  3FKI B;  4KD4 A;  5C6A A;  1OXT A;  1FD7 D;  1LT3 D;  3MXU A;  3HGB A;  5C5L A;  4XT3 B;  3U9O A;  3A54 A;  3URY A;  2NYZ D;  1DM0 B;  3K5M A;  2EJM A;  1SEB D;  5C0X I;  1QNK A;  5DEH A;  1KLG D;  3HZX A;  1VMP A;  2K03 A;  1V8Q A;  4X3T A;  3DWP A;  2VB3 X;  2KCN A;  3H0G B;  3A7L A;  4IN3 A;  3MAQ A;  3NE5 B;  2MP1 A;  2K01 A;  5C0X H;  2X6G A;  2F0F A;  2IWH A;  4HR7 B;  4DXF A;  3TP7 A;  4G57 A;  4XYQ A;  4RGN A;  1I6H B;  3UI2 A;  2AUK A;  4F87 A;  4FXK C;  3HOZ B;  3K57 A;  3V96 A;  1TKW B;  2JEB I;  3QOL A;  1STE A;  3NTK A;  2B2V C;  3T53 B;  5M3M B;  2F0J A;  5IGB A;  1RD9 D;  5CV5 A;  3X3M A;  2OT2 A;  4K6L A;  1JQY D;  3NBI A;  3E6Z X;  2DY7 A;  1F2Y A;  2A73 B;  1KNE A;  2A68 D;  3TZU A;  1PMR A;  4RGT A;  5EQ0 A;  1R9T B;  1SYG A;  1GUS A;  1CA6 A;  1VMC A;  5C0X J;  1G8Z D;  4HMI A;  5FLX L;  1I4G A;  1PFM A;  3K5O A;  2EVB A;  4NMZ A;  3SE0 A;  3SVM A;  2MUY A;  1Q90 A;  2LKV A;  4OIJ A;  2VUM B;  2D5D A;  1MBY A;  3HG9 A;  3RZO B;  1Q8I A;  2Y0S B;  3IFD A;  4DAP A;  2SNS A;  4IZ8 A;  2QIL A;  1BCP B;  3EJI A;  1EY6 A;  2CQA A;  2EJG C;  2ID0 A;  4QB4 A;  3J7Y W;  2LS0 1;  3WOE A;  1EEI D;  2A6H D;  1QG7 A;  2JP1 A;  4RA8 A;  4C3J B;  1ZYR C;  5C3X A;  4PMC A;  1STB A;  3R2I A;  3NHH A;  4A3E B;  2KCC A;  2SEB D;  5EBD A;  1Y8P B;  1B2T A;  2D2C C;  4Q0F A;  3GTO B;  1BCP F;  1HUM A;  5KIX A;  1AN8 A;  1SNO A;  3I3C A;  1TWH B;  2E76 C;  4KY5 A;  1NUC A;  3GP7 A;  1CHP D;  4G4K A;  5KRU A;  1D5M C;  2RSO A;  5JAV A;  3I4M B;  3VR5 A;  1GJX A;  2K05 A;  1RDP D;  2KEE A;  4ODG A;  3V05 A;  2EJF C;  3TN2 A;  3IKJ A;  2F0S A;  4R8I A;  1KTK A;  1BQQ T;  1H9J A;  4XTC S;  2EPB A;  1WTV A;  1IW7 C;  1F2Z A;  3M3Y B;  3D4R A;  1D5X C;  1T5X D;  2I46 A;  4A3D B;  4ME5 A;  3GTM B;  4MIU A;  2EZV A;  4QIW B;  4CJ1 B;  1E2V A;  2XRQ D;  1S4Z A;  2HCC A;  1A2T A;  3VR2 A;  1HCZ A;  4XXE A;  5D3I B;  1EIG A;  1EY8 A;  1K83 B;  2F0K A;  2ICI A;  4BBS B;  3QJY A;  3I91 A;  5C4X B;  3S2H B;  2K6A A;  1DOK A;  5D65 A;  3BG3 A;  1KLU D;  4OHJ A;  3S2D B;  1G29 1;  5IT9 E;  3ND8 A;  4BWG B;  1KAB A;  1WVL A;  2JYO A;  2F0T A;  1IHZ A;  1C4Q A;  5G3L D;  5C3W A;  1JOK A;  2F0I A;  2F0W A;  4FNF A;  2XVS A;  3RZD B;  4DK1 A;  1STA A;  2IT1 A;  2Q8T A;  1PYW D;  4RCN A;  5A35 A;  4EVO A;  2F0D A;  4PV1 C;  2RDH A;  2BA1 A;  3OIQ A;  5CR3 A;  1A3U A;  3TBI B;  1AEX A;  1O7L A;  4CKE A;  5M5X B;  5CV6 A;  5FKA C;  2JE6 I;  4CKC A;  4K2K A;  1WTX A;  1FNV A;  2B8F A;  2F0Q A;  5I2X A;  2OEO A;  5JVH 3;  2Z8L A;  3VYT A;  4MN3 A;  1EYA A;  4O42 A;  3HP3 A;  1CTM A;  1RTN A;  3SK6 A;  2PCF B;  1IKL A;  4EQO A;  2FMC A;  1BF4 A;  4TKO B;  3HRZ C;  4C2M B;  2E2D C;  3VYR A;  3LWU A;  5IT9 L;  1S5C D;  3U9S A;  4CJ0 B;  1IYU A;  5JOB A;  3OPO A;  3PUW A;  3CU7 A;  2O5J C;  4V0B A;  5DNF A;  5G3L F;  1CM9 A;  3QG1 A;  2NN6 H;  1FNW A;  2SDF A;  3PO2 B;  2BCO A;  4RCO A;  3A7A B;  3GO5 A;  1O78 A;  1RKN A;  1JOQ A;  4H7B A;  4LAA A;  1EYD A;  1CI3 M;  3T13 A;  5K36 G;  2F1M A;  1BNZ A;  3EA6 A;  2TSS A;  1VCI A;  5M3F B;  4PMB A;  3A55 A;  3JAM L;  2CHB D;  1D1K A;  3SR1 A;  3QOJ A;  5IGF A;  3ERQ A;  3DEP A;  4KTA A;  1ESF A;  1Q3L A;  2PZU A;  2A5H A;  2QCP X;  1CQV A;  5C4H A;  4FF4 A;  2DY8 A;  2O2L D;  3RLF A;  3MC0 B;  4XDX A;  2ENB A;  1OO9 B;  1L0Y B;  4AYB B;  4KN4 C;  1D6E C;  1OXU A;  1LAC A;  3OHX C;  2K33 A;  3IFT A;  4L6T B;  2CW0 D;  3O13 A;  2CW0 C;  3NPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...