2SNSA

Staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
141
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFNKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THERMONUCLEASE PRECURSOR
publication title Staphylococcal nuclease: proposed mechanism of action based on structure of enzyme-thymidine 3',5'-bisphosphate-calcium ion complex at 1.5-A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 25
structure length 141
sequence length 141
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1982-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2snsA00
3D6CA 4WORA 3HZXA 1F2YA 1KDBA 4KY5A 1A3VA 5IGDA 5CV6A 1JOQA 1NSNS 2EY2A 3ERQA 4ID6A 2O4XA 4WRDA 5IGEA 2HQEA 2LKVA 5KRUA 3RUZA 2EY6A 3EJIA 4N9TA 1EZ8A 2EYPA 5IGBA 4J1MA 4PNYA 4KY7A 4QB4A 4N9PA 3C1FA 4KJNA 2PZTA 5KIXA 3EROA 2RKSA 4IZ8A 5C5LA 3P1HA 5F2DA 1EYDA 1F2MA 2OEOA 4NP5A 3LX0A 4B9WA 5IGFA 5IODA 1NUCA 4RKLA 1II3A 2QDBA 3TMEA 1SYGA 4KD4A 2EY5A 1A2TA 4ZUIA 4HMIA 5HGTA 2EYMA 2F0UA 4LAAA 5E3FA 5HURA 3T13A 4ME5A 2OXPA 3D4WA 5C4HA 1A3UA 1ENAA 1STYA 1JOOA 2EYFA 2PZUA 3SXHA 4DU9A 4I65A 5KGUA 4G57A 2EXZA 3DHQA 1JORA 1AEXA 3TP5A 5CV9A 5C3XA 2F0DA 3BDLA 5C5MA 2PZWA 2EYOA 4K6DA 3SR1A 5CC4A 2F0KA 4F7XA 2ENBA 2PW7A 2F0QA 1EYCA 5DEHA 5ISRA 3P75A 4OL7A 1KDCA 1SNPA 1SYBA 5CR3A 1KDAA 3T16A 2F0PA 4K2KA 5EGTA 5J1ZA 5CGKA 1F2ZA 1JOKA 5C4ZA 3OMGA 5KYLA 2SNMA 2F0VA 3MHBA 3QOJA 4B9XA 4PMCA 5C6AA 2PW5A 2RDFA 4RKBA 3U9OA 5J39A 4KJOA 5IGGA 1U9RA 1EY5A 3OSOA 4MIUA 1A3TA 1EY9A 5KEEA 1RKNA 4HTHA 2F0GA 1SNCA 4NMZA 1SYFA 5CV7A 5E1FA 5NUCA 2F0WA 4KD3A 2F0NA 3NK9A 1EY8A 5EKKA 5I6YA 4NDXA 1A2UA 4HMJA 3QB3A 3QOLA 3MZ5A 2OF1A 3TP7A 4K8IA 1EY4A 1EY0A 2F0JA 2SNSA 5I9PA 3S9WA 1SYDA 5CV5A 1IHZA 5EKLA 1EY6A 3NUCA 4IALA 4PMBA 4K8JA 1EYAA 3MEHA 4QMGA 5DAUA 3SHLA 3DMUA 4K5VA 5IIFA 2NUCA 2EYJA 5JOBA 3V2TA 3EVQA 3HEJA 2PQEA 3OMCA 3TP6A 1SNOA 2KQ3A 5I6WA 2F0TA 2F0MA 2EYHA 1TT2A 2F3WA 2PYKA 2F0SA 4YIJA 4ZQ3A 5KYIA 5I9OA 2F3VA 3NHHA 1EZ6A 1TR5A 3BDCA 3TP8A 4TRDA 1SYEA 2RBMA 4EQNA 1STGA 4NKLA 3D8GA 3OWFA 5CV8A 4KTAA 3C1EA 3H6MA 4F8MA 5JAVA 3D4DA 3SK8A 5K5PA 1SNQA 3PMFA 2EY1A 2EYLA 1SYCA 2F0FA 2F0LA 2M00A 3ITPA 2SOBA 4EQPA 3SK6A 1STBA 5C3WA 4KY6A 1KABA 4K5WA 2F0OA 2F0IA 3MVVA 4IUNA 4R8NA 1TQOA 3SK4A 4ZUJA 3VA5A 4EVOA 2F0EA 2WACA 5CV4A 4K14A 4K5XA 3MXPA 3NP8A 3R3OA 4J6HA 4K2LA 3SK5A 4ODGA 3E5SA 4DGZA 3NXWA 2F0HA 4S3SA 1SNMA 4EQOA 5IGCA 5M9OA 5IOCA 4DF7A 1EY7A 1ENCA 1EQVA 1SNDA 1STHA 4KV6A 4QF4A 2KHSA 4KHVA 5J22A 3NQTA 4DFAA 4H7BA 1STAA 4E6IA 1KAAA 1STNA
chains in the Genus database with same CATH superfamily
3GO5A 1Y1VG 4HJ8A 3C46A 1I4PA 4L5QA 4IUUA 2O4XA 1GM5A 3H3VC 3H3VI 4I7AA 1S4ZA 2JE6I 3EBEA 3PO3G 2D62A 4B9WA 1G51A 2N8NA 2RSNA 3MFYA 1JB7A 2A73B 1JE4A 5M3MH 2PQAA 3KBXA 3BYYB 4A3LG 3CMAA 4A3EH 2NN6H 4QL5A 1CKOA 4BA1I 5FO9B 3S15B 2B3GA 1E2ZA 5CV9A 2Q2UA 1V8QA 3I4NB 4BBRB 1QG7A 1W6KA 4KHPL 1BO0A 1U4RA 1X6OA 3RN5A 4QGUA 4KHPQ 1KNEA 2CW0C 4LUVA 4HIDA 3QOJA 1IKMA 5J39A 4RKBA 5EJWA 5M5XH 4LWCA 1EY5A 1IBML 1IBMQ 3HOYH 3ICEA 1HNWL 1HNWQ 1ESFA 1CUKA 3O13A 2OF1A 4NPSA 2A6ED 3CP0A 3PIPA 4XT3B 3GTQH 4TQUS 5CV5A 1QUQB 3NUCA 1PYBA 1S5CD 4QMGA 2EYJA 1PXUA 4CKCA 1K0SA 1VQOA 5JJLA 3PO2G 3K7AH 4ZKBB 1QVGA 1EZ6A 4QUCA 2G5DA 1CM9A 3S2HH 1VQ8A 1WTPA 1CSQA 2Q8RE 5BR8L 1GO3E 5BR8Q 3S1NH 1FNWA 1EIHA 1YEZA 2RCFA 1QCBD 3GD7A 3PIO3 2AQ3B 2R3ZA 2EPBA 5GADC 2FMCA 2AKWB 1PFMA 2RDHA 2F0EA 2NN6I 1PV4A 2E2DC 3E5SA 1VQDA 2I0QA 1EY7A 1ENCA 2I5MX 4L6TB 2K5NA 2H4OA 5C3EB 1VQCA 1Q1BA 5KRUA 2MO0A 3FEWX 3MXNA 4QB4A 1KAWA 4IZ8A 1Z9FA 1XPUA 4OONA 1JT8A 1LTRD 3HKZE 3UDFA 2IY5B 3J81L 3E6ZX 4JK1C 2XGTA 1CKNB 5H1SE 4HMIA 2K52A 5HURA 4B3RQ 2LS01 2EYFA 1BCPF 1V1PB 2JJQA 1GOZA 2B2UA 4IFDG 4YY3L 2EYOA 4YY3Q 3SEBA 2V4DA 3TQYA 1ILPA 2B63B 2WB1E 2IL8A 3NBIA 2VQEL 4A3JB 1CI3M 2VQEQ 3DWPA 2B8GA 4X3SA 3CAMA 4B9XA 1SEBD 2CHBD 2M9VA 1HZ9A 3Q22A 1U0LA 2NVXH 2B2UC 2LMCB 1X3FA 2F0GA 1IYJB 4J15A 2R93H 3C3LA 1CTMA 4DAVA 1KQSA 5HY6A 3NSWA 2E2IB 1O7ZA 3CKIB 4HJ5A 1S40A 1YBYA 1EYAA 3I2ZA 1KC8C 2PQEA 1UAPA 2X6GA 3T1YL 4DXGA 3AB9A 2HT1A 1DONA 1G6ZA 1X3PA 1FGBD 4RGNA 1HQMC 4TRDA 3FRPB 2F4IA 3NELA 5GAHC 3AMUA 4BBSB 4OO1G 4IUTA 1K8GA 4KTAA 4F8MA 2L12A 5JJZA 5IYDG 3S17H 2K01A 2IW3A 4GLXA 3KFUA 1B8AA 5ELFA 4LF7L 4EVOA 1LT6D 4LF7Q 4N8FA 4UP9A 3NP8A 1Z47A 2NZOA 1ILQA 2EZVA 2RQXA 5ELDA 4H0LC 5M9OA 4QIWB 3GTJH 1EQVA 1Y1WB 4BY1B 1SR3A 1UWVA 1SLJA 3V05A 3DLLA 1SSOA 2CWAA 3KLSX 5C44G 4ZCKA 3KDFB 3J80L 4IPHA 3U4VA 1FJGL 1KD1C 1FJGQ 1PZKD 1IZ6A 1EZ8A 1SROA 4KJNA 4QUFA 2EXDA 2R7FA 2F1MA 1EWIA 3GTKB 1NCVA 2TSSA 4JI8L 3OWEB 2O5JC 3H94A 4LUZA 4JI8Q 1E7ZA 3PUVA 5C4HA 1SJHD 4LF8L 4LF8Q 3T4AC 1YHBA 3S1QB 1K83B 3S1MH 1B9MA 4EGVA 4F7XA 2ENBA 1DYQA 4P74A 3ND8A 4A3DB 1NBWA 1TS5A 1D1IA 1WOCA 2CCZA 1JOKA 3F2UA 1V43A 1GUNA 4DK0A 2QA4A 4HSVA 1TIID 4TKOB 2PO4A 1I50H 1YNNC 2B2YC 2AUJD 2N3SA 3J81c 1IW7D 4C3HG 4QQBX 4K6LA 4C3JG 2WFWA 5EPKA 2F0WA 1E1OA 1SRUA 3M4PA 1SDFA 4GS3A 2QF7A 3I55A 5FO8B 2KBNA 3M4QA 5I9PA 3NBHA 4X65L 2K33A 1BXTA 5EKLA 4X65Q 5I2YA 5M3MB 2GA4B 4XTCS 2F3IA 4A3EB 1JJ2A 1B50A 4DPGA 1TWGH 3SGIA 1QOHA 3GP7A 3MAQA 1PLFA 1PFBA 3HEJA 4HSPA 1MI2A 4IPCA 3L3OC 2JA6H 1XYIA 4P72A 1GUSA 4JI4L 5JEAG 2MNAA 1JE5A 4JI4Q 2B2WA 2OTLA 1CKMA 1IXRA 2FINB 5CV8A 1UE7A 3CHBD 4KKTA 1SNQA 3RD4A 5M5XB 3MA2B 1CSPA 3D6WA 3HOYB 4FDBA 4P75A 1XJVA 1QNKA 3AEVA 3CCQA 3S16H 2E5LL 1ZYRD 2E5LQ 5C0XH 3GTQB 4OWWB 1Q90A 1B44D 3KF6A 4LJZC 3PQIA 1VQGA 2WP8J 4YWKA 4DV5L 4WORA 4DV5Q 3HGBA 1I94L 1VQ6A 3ERQA 1I94Q 1PH9A 5ELEA 2A19A 2FHTA 3ULLA 3K7AB 1MD2D 3I4NG 2KEEA 1Q7YC 5HGQA 1EYDA 4YCUA 3C2PA 5GROA 3S2HB 2R6GA 1NUCA 4FXDA 1R4PB 2A68D 4RKLA 1TS4A 4IOAA 3S1NB 2R92H 1HCZA 5M3FG 3MC0B 3K81C 2EXZA 4UPAA 4UY8C 1EU4A 1XWEA 2XN9C 5T1IA 4GNXA 2E74C 3M9BA 2KCMA 5IE8A 1WTWA 4LFAL 4LFAQ 3HOZH 1DD2A 2L0CA 5J1ZA 2YTVA 1IBKL 3R2TA 1F2ZA 3T51B 1IBKQ 1HNXL 1HNXQ 2HIVA 2PW5A 3CPFA 2MFIA 4DNTB 2GN5A 3NPPA 2Z6BA 3DEPA 1VQJA 3G7LA 5E1FA 4C3IG 2JQOA 1YI2A 1RTOA 3UE0A 3S9WA 1SYDA 3A5UA 4A3KH 4FP5D 3HS0C 5IY0A 5C0XI 1B4OA 3CC7A 1SFOH 2F0TA 4IJHA 4BY7G 1TT2A 1QILA 3A7LA 5LL6S 1TR5A 1TS3A 4POFA 4RCOA 2FXQA 4LFCL 1LTAD 2R7ZG 1PTOD 2XIWA 3KLRA 4O2DA 4LFCQ 1I4XA 2EQSA 1PVOA 2BE5C 2K5QA 4A75A 5JAVA 3A5ZB 3ITPA 2BA0A 4ZRZA 4QY7A 2OCEA 1D2BA 2NVXB 3KUPA 2AHOB 4IUNA 1A6XA 4ZUJA 1PFSA 1YITA 2R93B 1PRTF 3W1BA 3NXWA 1I6VC 4JI7L 2D0PA 4JI7Q 1MSGA 3HOUH 5BN3A 2MO1A 1PZJD 4KKSA 4KI0A 3QO2A 2L4NA 5FJ8H 4DA2A 4WRDA 4A3BH 1Q46A 5COYA 3EJIA 4N9TA 4AH6A 3QWNA 5IGBA 2B2TC 2JK8A 5IP7H 3M85A 2UUBL 1CT1D 2UUBQ 5JJIA 3AFPA 3EROA 5EPJA 4F88A 2QILA 2WIIB 3Q0AA 2D2CC 4L63B 4A3JG 3HOVG 4G7ZC 3BG3A 3EQLC 2ZXOA 1DJRD 1YVCA 1DM0B 1V9PA 5KNCA 2LY7A 3RZOH 3S17B 3D4WA 3SXHA 1G2TA 3NENA 2K32A 3PIOA 4A3CH 1Y8NB 3Q23A 1HXYD 4I7ZC 3V96A 3GTJB 4XQQA 1AZQA 4DAYB 2Y0SB 4AYBE 1U4PA 3T16A 1J6QA 4CJ1B 1SE8A 4DV3L 3ERSX 4DV3Q 1NAPA 3CCRA 1U9RA 3DXJC 1OTCA 1IKLA 1UE1A 1A3TA 4H13C 5IYCG 5K36G 1GKHA 3PUZA 1YZ6A 2WKCA 1XTDA 4BWGB 1M90C 4JC0A 1NJIC 1Y69U 1EY0A 2K1BA 3M4OH 2ZM6L 1BBXC 2Z6KA 2ZM6Q 1GUTA 2NZ1D 3SHLA 4ZK9B 1E3PA 5M5WH 3EVQA 3PF5A 2ZJRA 1Q8IA 2ZT9C 1G6PA 4JI3L 4O0AA 4JI3Q 3S1MB 3KYHC 4X3KA 3HOWH 3L2PA 4BY1G 1I4RA 2BA1A 2K5DA 4A3MH 1LV9A 2VQFL 2OT2A 2PNHA 2VQFQ 4A3FG 3E0EA 1QNUA 5K5PA 3GQBA 3VYTA 2EY1A 1I50B 2F0FA 3MXGA 2YYZA 2WAQB 4XT1B 1EIGA 3L7ZC 3MVVA 1Z7TA 3OW2A 4A3IH 1CZWA 4JOIA 3I7FA 3X3NA 1SNMA 1UE5A 3I4MG 2O2LD 3WOEA 1TWGB 3D6CA 3ONAB 1JR0D 3RUZA 2D0OA 2JA6B 4JOIC 2MJ8A 1IYVA 4G4KA 3STBD 3GTMH 4A76A 1O7YA 2D9UA 2HCIA 4NP5A 4JW0A 5IODA 4J8QA 1WTVA 1KRSA 5C0XJ 4UHVA 4GOPA 4ZUIA 3S14B 3HRZC 3BVMA 4A93H 1KXLA 2XTIA 1JOOA 1BNZA 1E22A 5KGUA 3CCLA 1S5DD 2CWPA 3NQIA 3PUXA 1X32A 2OTJA 1AW7A 3VYRA 5FLMG 2HCCA 3J7AV 3S16B 2XWBB 1ET6A 4P71A 5DEHA 3I90A 1CZGA 2LXJA 1C9OA 5D3IB 4NB3A 1LT5D 2JA8H 1ESRA 4OELB 4RCNA 4CJ2C 4MNOA 2JA7G 2HUGA 3CD6A 4YCWA 5FK9C 4DR6L 3RR5A 2HD3A 5JPMC 4DR6Q 2RHQB 5IP9H 1JWSD 2NZHA 3BVZA 3RZDH 3K5NA 4FXGC 3KJOA 4FF3A 1XX8A 2IX0A 2CVRA 1EY4A 2KEDA 2K4KA 4C3HH 3DWQA 2R92B 2JEAI 2SEBD 3FKIG 2TMPA 1WI5A 1SMXA 3OMCA 2QDLA 1OXUA 3QJYA 4MHEA 3J7ZC 2Y0SE 3PO3H 3S1RH 3OPOA 3HOZB 2RBMA 3D4RA 4YWLA 1HA5A 3VR2A 1H9SA 1NNXA 2B2VA 2L55A 4A3LH 2F52A 1F9RA 1C4QA 3H6MA 2UXCL 3R93A 3CC2A 1TWFH 2UXCQ 1U4LA 2SOBA 4XXEA 1N9WA 3KF8A 3LWEA 4GLVB 3EA6A 2EOTA 3W5OA 4ZYSA 1UEAB 3L0OA 5I4DA 3BDOA 1HQRD 1KLUD 2A6HC 1PH4A 4DAPA 4A3KB 1H9KA 1JOQA 2ZXPA 1WD1A 1EIFA 3T53B 4A3GG 1SFOB 3U50C 1S5ED 4J1MA 1HRJA 2L5TA 5FO7B 1LTBD 4DUYL 2EE1A 4DUYQ 1RIPA 1II3A 5EBDA 1VMCA 2WAQE 2EYMA 4PZ7A 5E3FA 3I4LA 3KK7A 1YHQA 1C48A 1STYA 4GN4B 1SN8A 3NEMA 4HIOA 1RCVD 3PO2H 1IYUA 1R9TH 2KVMA 1ASZA 1O7LA 1MIUA 1O78A 2F0DA 2DNEA 1WFQA 3ZJYC 2KHJA 2VUMG 4H02A 3H91A 5JJKA 1LTLA 4NXNL 2XNAC 4NXNQ 5ISRA 3HOUB 1PH5A 1M1KC 1SNPA 1SYBA 5KYLA 1E2VA 2NVYH 3MHBA 1BCPC 4A3BB 4B3RL 4HTHA 1J9OA 4NMZA 1SYFA 2Z0SA 4KD3A 5I6YA 2VZAA 1LTSD 4KMUC 3NWSA 2ALYB 2ZTDA 2F03A 3RZOB 2CQAA 2R61A 5DAUA 4JG2A 1L1OA 5IYBG 2IPKD 1BR9A 4XIGS 2JA5G 5I6WA 2F0MA 5D3DA 3HOXG 4RG1A 1AE3A 1HTPA 2QEJC 3WOFA 3K6OA 4FF4A 3Q6SA 3M3YH 5BN4A 2C5CA 1N34L 3J7A5 1N34Q 1DCZA 2AWOA 1DOKA 4X3UA 4EQPA 3FP9A 4IFDH 1F9QA 2F0OA 3NE5B 2VB2X 5G3LD 1TS2A 5CBEE 4OGQC 3M4OB 2K14A 3KLWA 5J22A 5FOBB 3F1ZA 3FVQA 3R2IA 4PMWA 1ET9A 2XRQD 5M5WB 2MQHA 1DZ1A 2PI2A 1LYLA 3NTKA 4DAMA 4JBWA 4ABNA 4CDEC 3HOWB 4HAEA 2PNRC 4A3MB 4ZKCB 2ZJPA 2EDGA 1I6HH 1YNXA 4FF2A 2Z4HA 4UP7A 4CJ0B 3T13A 1GXDC 1A3UA 2AQ2B 3A54A 3I4OA 1HPCA 4A3IB 4PG3A 2A1AA 2IJ0A 3KJPA 3CMEA 3BS1A 2BDOA 1HJPA 4OO1H 3IL8A 4RGMA 3G6EA 2DUDA 2PQAB 1EUJA 2K28A 5CGKA 2XSCA 5IYDH 1W3SA 1WTHA 5C4XB 1UUPA 2F0VA 1Q86C 4WJ3M 5IGGA 4UAIA 4IN3A 3M4YA 4RH6A 4X6AH 3HKSA 3GTMB 1A2UA 3RLFA 1ONLA 2GVAA 1K8AC 1TWAH 1AE2A 2EVBA 2MHVA 2NTTA 4K8JA 2NBFA 5C44H 3MEHA 4XYOA 4A93B 2N78A 3HG9A 2ASBA 2HHHL 2HHHQ 1LT3D 5GAEC 1C8CA 1VMPA 2F3WA 1PH3A 1B1ZA 5E4WC 1PTOF 4DR4L 4DR4Q 3D8GA 4QCLA 3CPWA 3S2DH 3SK8A 1FNUA 1SYCA 1VDZA 2JA8B 4GKKL 3HKZG 1BKBA 1KABA 2RDGA 3BZKA 1N8RC 3IAYA 4GKKQ 1G2SA 1ICWA 5ELBA 4G7OC 3RZDB 4ODGA 2NVQH 1A63A 2A69C 1STHA 4CKEA 4C3HB 4OO1I 1E2WA 2WINB 1QVFA 4JI2L 2FMMA 4JI2Q 1KLGD 5L37A 3LGJA 3OIPA 1ASYA 4C3JH 2WB1G 3GTGH 1HR0W 3PO3B 3FHWA 3H15A 3S1RB 4FF1A 3MXUA 1FYCA 2K04A 2K5WA 1BCPB 4V190 1WCMH 2B2WC 1PYWD 1TWFB 2N88A 2LXKA 3CCVA 5EQ0A 2JXMB 4ME5A 1LT4D 2PZUA 4HCEA 4B08A 4I65A 3LNNA 5LMNW 3TDQA 3MXNB 1ZEQX 3TP5A 4L5SA 2IX1A 3BDLA 5JEAH 4AYBB 2PZWA 4K6DA 2PW7A 1XNRL 2QCPX 1B3QA 1XNRQ 1WTRA 3A8IE 4BBRG 2R92G 1KDCA 1KDAA 2Z4IA 3OMGA 2UXDL 2BH8A 2UXDQ 1RTNA 3PCOB 4JI0L 3UE1A 4JI0Q 2HDMA 2L15A 3A56A 3X3MA 3A8JE 4DV1L 1HUNA 2B39A 4DV1Q 1STNA 1EOVA 5GAGC 3NK9A 4IJLA 4NDXA 4L8JA 4DV6L 4M8AA 4DUZL 4DV6Q 3MFGA 3ND9A 3OHXC 4DUZQ 3PF4A 4K8IA 1RDPD 2F0JA 5DM73 3PV0A 3PUWA 3DWAA 1H9JA 4IALA 2OQKA 4P2CB 1HZCA 2NTSA 1WYDA 1MGSA 1IL8A 3G6JB 1EEFD 3CCEA 3G4SA 1JMCA 3TP6A 3EN2A 4RGTA 1R9TB 3PO2B 1VF5C 1K3BC 1O80A 3CQZH 1PH1A 3NHHA 4YWMA 1TY2A 2E8GA 3RN2A 1X65A 4XQNA 4GNXC 3IKJA 3GTPH 3AFQA 3U58A 4IUPA 4JVZA 1SMYD 3AU7A 3UDIA 3FDTA 1D7QA 1M4VA 1JQYD 4DR5L 2NVYB 5M3FH 3D4DA 4DR5Q 2JP1A 3PMFA 2F0LA 4C1NK 2C35B 3SE0A 4R9WA 5C3WA 3A74A 5I2XA 1A15A 4R4OA 4LMQD 1YIJA 2DJFC 5LHY1 3SK5A 4O42A 2CFMA 3SDZA 1RJTA 5E4XA 1VQ9A 1SNDA 2UUCL 2UUCQ 2ICIA 1KAAA 5FKAC 1G91A 1F2YA 4CDCC 5C3EG 1K9MC 1GHKA 4C3IH 2HQEA 4IFDJ 4DR2L 5J3BA 2VW9A 1LO5D 2EY6A 1XMOL 4DR2Q 2YU9H 1XMOQ 1SJED 4NW2A 1EQTA 2Q8IB 1X9NA 1PRTC 2YTYA 4RWSC 1XTCD 1T5EA 3P1HA 5F2DA 3IFDA 4IUQA 3CC4A 3FMCA 3M3YB 3AYHB 1C0AA 1GHJA 5FJ8G 3ULJA 4A3BG 4BY7H 3URYA 2RCNA 1JORA 2JA9A 2MPMA 2SDFA 1XNQL 5C5MA 1XNQQ 4JV5Q 1A0IA 2R7ZH 1JCKB 3H0GH 2F0QA 3VA7A 1X55A 4DR3L 2B63G 2DJGC 4DR3Q 3S24A 3T56B 3OIQA 3WDNA 4U673 1QUQA 3HP3A 4L5RC 2BH2A 1H9MA 3J7YW 1AN8A 1RKNA 1J5EL 5E7NA 2IX3A 1J5EQ 2RSOA 2F0NA 3CXCA 3TEHB 2R7DA 5DNFA 4X62L 1VQHA 4X64Q 2SNSA 2DY8A 4RHSA 4X62Q 4G7HC 4JBMA 1PH7A 1I6HB 1BOSA 1EY6A 3CRKC 4K5VA 1EFID 3PUYA 1PYSB 1E0BA 2PYKA 4DV7L 2A6EC 4DV7Q 1A62A 4A3JH 3HOVH 3TP8A 1P8LA 2HIXA 3TRZA 1YNJD 1JWMD 3NBHB 4WJ4A 4DK1A 3PGZA 1VF7A 3DM1A 4POGA 2Q2TA 4BBSG 1MJCA 4CDFC 3W1GA 4R4CA 4KN4C 4RAUC 1W2BA 5D14A 4ZAIA 1VQBA 3B6YA 4TVAB 4WJWA 5CV4A 3GV6A 2L1BA 1D6EC 4DF7A 3VYSA 1TWCH 1TWAB 2RF4A 1EWHA 5C44B 1Y1WG 1F2LA 1CKNA 4IPDA 3Q8DA 2Z6KC 5K36H 4KY5A 4BXXG 3CCSA 1NSNS 4LUOA 4JPBW 1B3AA 1I4GA 5JVH3 1V1PA 1F9SA 1EQRA 3E3XA 3M7NA 1HUMA 2PZTA 4CHTB 4ME3A 4EQ5A 3QIAA 3LX0A 3KF6B 3BJUA 3TMEA 5C4XG 3IFTA 1A2TA 2NVTH 3S2DB 2E76C 2F0UA 1E1TA 1N36L 1N36Q 1VQEA 1PHJA 4F87A 3DM3A 3DHQA 4EX5A 1KIXA 2PI2E 4ILWA 2NVQB 1EIYB 3RNUA 2G9DA 1DOMA 2D5DA 3F2CA 2KECA 4A3FH 5TSSA 2N55A 3NTIA 3JAMc 5M5YH 4B3SL 1R4QB 4K2KA 4A3DG 4B3SQ 3CCUA 1WTXA 4KLKA 1N32L 2SNMA 1N32Q 4BS9A 1WTOA 3U9OA 4C3JB 3CU7A 1A8VA 4GNXB 5NUCA 4JBKA 2A5HA 2X69A 5JEAJ 4DV2L 4DV2Q 3CCJA 1CQVA 2OWOA 3I4MH 3MZ5A 2Z1CA 2I46A 2NWGA 4GZYC 1H9RA 2KCTA 1WCMB 5KNBA 1KNAA 3K5MA 5M3MG 3SVMA 4GOPC 2BE5D 2EIFA 3V2TA 4A3EG 2NN6G 2UXBL 2KCNA 2QKIC 2G9HD 2X6LA 4JCVE 2UXBQ 2GVBA 3J80i 1QVCA 2F0SA 4YIJA 1EOTA 3NTHA 1B9NA 4ZQ3A 1Y14B 1EFWA 2HQLA 1KRTA 2MP1A 3I73A 2K6AA 4ULLA 1V1QA 4NKLA 1Q8KA 2H1EA 1OXSC 3OWFA 1RODA 4GN3B 3BZDB 3C1EA 4HEDA 2PPBC 4P73A 1BBWA 1HFGA 1PRTB 3I56A 4YHHL 1PH6A 4YHHQ 1EL0A 5FLMH 1Y1VH 3KDFA 4JBJA 1EQQA 4R4QA 5G3LF 3TS0A 3HOYG 1DOLA 4O1NA 3I91A 3R3OA 3N6RA 4MTKA 1Q3LA 5FLXE 4S3SA 4EQOA 1HFNA 5CYUA 4QF4A 2BOSA 3MWYW 2BCOA 5CORA 2FFKB 4DXFA 1STAA 1RHPA 3FPUB 2JA7H 1A3VA 5CMDA 4ID6A 5IT9E 1Q1EA 3P7JA 4GN5A 5IGEA 2P5ZX 4AYBG 3E9IA 3J7AF 3CQZB 2M2LA 2AUKA 3GTPB 4XQJA 1EEID 2AQ1B 2IHEA 3QR8A 5IGFA 1N33L 1SBBB 1N33Q 3FKIH 5HGTA 5M3FB 1LM0A 4LAAA 2B2VC 5EKIA 4R4TA 1KTKA 2ATWA 1NE3A 5D65A 4G57A 2IHFA 1X3EA 3F8TA 1PA6A 4WFN3 3L9AX 1KL9A 2L9HA 3F2BA 2I07B 5CC4A 2DGYA 1TWHH 3P20A 4MZ9A 1MHWC 3DEOA 5EGTA 1JJGA 3TZDA 1MKHA 2VB3X 3UI2A 2K7VA 4PQXA 3OSOA 1BBUA 4DK3C 4C3IB 5KEEA 2IWHA 1ZKOA 1CQFA 3I3CA 2YU9B 4XDXA 1VQLA 1MSHA 2VS1A 5EKKA 1C7YA 2K75A 4HJ9A 1B53A 2JEBI 1T9HA 2FJ2A 3EFXD 1IW7C 2O5IC 1XPOA 3DMUA 3RLOA 1AFPA 4A3GH 5JOBA 2QEXA 4BY7B 3TN2A 4FYDA 1I5FA 2VNUD 2R7ZB 4LF5L 3OW7A 4LF5Q 3H0GB 1STGA 3JAME 1BF4A 1F9PA 4LF4L 1OXVA 4LF4Q 2J0TD 2VY3A 3BZCA 1QWYA 1P16A 4L5TA 2EYLA 3VR3A 4MN3A 1STBA 2F0IA 4R8NA 2K5HA 1Y8PB 1TQOA 4KN7C 2VUMH 1L0YB 1T5XD 2WACA 4K5XA 4N8X1 4PZ6A 1XMQL 3D0FA 1NR2A 1XMQQ 2XWJB 4DGZA 2R93G 4H44C 1GD7A 4DR1L 1QZHA 2ID0A 4DR1Q 4KV6A 2KHSA 4KHVA 2HDLA 3A7AB 3ULPA 2E2HH 1PFNA 3MTSA 4E6IA 1SXTA 2E2JH 1FL0A 4Q5VA 2KOLA 1L1OC 1D8LA 1ZYRC 2ZTEA 4KY7A 1HA6A 3HOVB 5KIXA 4OHJA 2RKSA 3U9SA 1F2MA 1STEA 1XXGA 4MTNA 2CQOA 1SYGA 4KD4A 2JYOA 1DGSA 4OX9L 5IYBH 3VR5A 2KUMA 4OX9Q 4DKAC 2JA5H 3MEFA 1PTOH 3JAMi 3HOXH 1CHPD 1E24A 1HZAA 3DUZA 1Z6HA 5C3XA 3GDEA 3K0YA 3VYUA 1D1KA 2F0KA 1EYGA 2A68C 3K5LA 2KA7A 3NWTA 5ELOA 2UUAL 2F4VL 4GOPB 2UUAQ 2F4VQ 3K57A 1G291 1NMFA 1TWCB 2F0PA 3GTLH 4DN4M 3M7GA 2Y0SG 4FO2A 3T1YQ 1PDQA 5A2QE 2N49A 3OOCA 1YJWA 4APVA 1Q82C 2B29A 3D31A 2CW0D 2ICEC 1XPRA 1QB5D 2AWNA 4DV0L 4DV0Q 4HMJA 1U5KA 1PH8A 3U4ZA 5CBAE 4R1JA 4FXKC 1IHZA 3RMHA 4Z9CB 2NVTB 4RA8A 4OIKA 3KLSA 5IIFA 1JJCB 1GVPA 1GUWA 1MBYA 4KK7A 1BVSA 2ZTCA 1SMYC 2K05A 2LSSA 2E75C 1HZBA 2F3VA 1TKWB 4OXPA 4ALPA 3I8ZA 4EQNA 2I5LX 4A3FB 4PV1C 5M5YB 1FNVA 4IFDI 3GTOH 1QE6A 4LFBL 2CH4A 4LW1A 2A6HD 1IL2A 4LFBQ 3SK6A 1L0XB 2KCCA 1L2FA 4QJFA 4KKUA 2WAQG 4M1UB 4UDUC 1K8MA 2QGQA 4CGYB 4J6HA 1K0RA 1PTOC 3WWVA 3I4MB 1H9SB 1RD9D 3UDXA 4IPGA 4XYQA 1CFMA 3W3AA 4GKJL 4C2MH 5ELNA 2B2YA 4GKJQ 1FVIA 4U68A 1KDBA 1X54A 3I72A 3KF8B 4Y7NH 1WTQA 3E0JA 3TBIB 1ZXTA 3PIP3 1NTGA 1VCIA 1TXYA 3QG1A 1B7YB 5C5LA 2JA6G 3JC66 2OEOA 4FNFA 1S5FD 3VR6A 4CDDC 3Q24A 2UU9L 2EY5A 4DAYA 2UU9Q 1PH2A 3TSSA 3R8BA 2OXPA 1HR0L 3K59A 5DM63 1QZGA 1HR0Q 2AMCB 1Y1VB 4PZ8A 4AQYL 2A74C 3T1HL 1VQPA 1BCPD 5IWAL 4AQYQ 5C4JH 3T1HQ 3SR1A 5IWAQ 4IOCA 2XRSD 4JI5L 4JI5Q 2Q2HA 1EYCA 1WCMG 3E9HA 3K5OA 4LK1C 5CR3A 2PCFB 3CW2C 5C0XG 5LMNL 1GUGA 1NMGA 5LMNQ 3CRLC 4IUVA 3A8KE 5C6AA 2JA7B 1G8ZD 1DXMA 4KJOA 5AFWA 1WJJA 4JI6L 1FGUA 2Z8LA 1VQ5A 1I3QH 4JI6Q 1SNCA 5CV7A 1EY8A 2RHSB 1I4HA 2BDNA 1BQQT 1I4QA 5FLXL 1UE6A 3S14H 2CH4W 2PMZB 3FKIB 2VL6A 4PMBA 4DK6C 1K73C 4OEMB 3TREA 1YNJC 4IQZA 4FVMA 1VQFA 2H5XA 1OO9B 5IT9L 4HCSA 3EIVA 1TWHB 1SYEA 2QW7A 1QJOA 2ZJQA 2K03A 3HOZG 5JVG3 4RMFA 2Q8TA 1L1OB 5GQOA 2KENA 1YJNA 1IBLL 4LNQA 5EPLA 3G48A 1IBLQ 4KY6A 3VR4A 3S15H 1CA5A 1HHVA 4K14A 1YJ9A 3FPPA 3LWUA 2V1CC 2OQ0A 1SE4A 1GJXA 4HIKA 3I4NH 1X3QA 4BBRH 1HTLD 1VS0A 4GLAC 1Q81C 1AH9A 4OWXB 3BU2A 1B2TA 4Q0FA 1KHIA 3NQTA 1HNZL 4B3TL 2IT1A 1HNZQ 4B3TQ 2B8FA 1SE3A 4QIWE 4A3GB 4A3KG 1NR4A 2EY2A 3J80c 1LABA 4R4IA 2MGSA 1CK1A 4PNYA 4N9PA 2DY7A 2J4XA 3AQQA 3F2DA 1VQIA 4LF6L 1D5MC 4LF6Q 2QDBA 2RVLA 4B3ML 3IRBA 4OIJA 4BA2I 4B3MQ 4RGOS 2K5VA 4CKBA 2XVSA 2A8VA 1LTID 1ICFB 2NB0A 1ENAA 1YHAA 3D3RA 1RL2A 1AEXA 3STBC 2VUMB 1RF2D 1EWCA 3ER0A 2K50A 1BDOA 1UNSA 2DNCA 4DNIA 4HIMA 3JAML 3P75A 4OL7A 1V1OA 1PMRA 2E2HB 5C4ZA 3HOUG 2MUYA 2YTXA 4PMCA 4DR7L 2RDFA 2E2JB 1VQMA 4DR7Q 5EAYA 2ES2A 1EY9A 2Z9HA 4LF9L 1WVLA 1K3RA 4LF9Q 4AIMA 4V0BA 5T1GA 3H0GG 3A55A 5IP7G 1OXTA 3QB3A 4HR7B 1SAPA 1YNND 1ENFA 3TP7A 1W6JA 3J81E 5ELCA 2KJXA 4JV5L 4KHZA 1Y8OB 2C9OA 5C3EH 2JA5B 1EU3A 1LLRD 4UP8A 3OTOL 3TS2A 1PTOB 3CCMA 3OTOQ 2B2TA 3K80C 1FR3A 2VXWA 3HOXB 1SNOA 2WKDA 2KQ3A 3K0XA 2EYHA 5KYIA 1WD0A 1JICA 4A3CG 4NXML 1B70B 4NXMQ 5AJ3L 5AJ3Q 4OWTB 3GTLB 4C1NI 4X66L 2A69D 4X66Q 3K58A 4X64L 1O7IA 2ZXRA 5FLXc 2M00A 5EBCA 3N52A 5LMUL 1U4MA 3VA5A 5LMUQ 3J81j 2PMZE 2RA4A 5LL6X 5IGCA 1LACA 1PZID 5IOCA 5IT9c 2B63H 3I70A 4YCVA 2CKZB 3ZYYX 4DFAA 4H7BA 5BN5A 1LUZA 5A2QL 3HZXA 5IGDA 5CV6A 5JPNC 2JSOA 4C56C 2LKVA 3J81i 1X3GA 2EYPA 4A4IA 3C1FA 5KNDA 1ML0D 1M8AA 2E2IH 1AZPA 2EJGC 3HOWG 4A3MG 3GTOB 1TVXA 1VQAA 2JN4A 3W2DA 2KHIA 4DU9A 1D5XC 4IURA 1LTTD 5IYCH 1VQKA 4TSSA 1JC7A 3PSIA 4A3IG 3GV3A 4CBVA 5A35A 4RHRA 1CA6A 4BBSH 2I5HA 3VDYA 1HH2P 3A0JA 4C2MB 1VQ7A 2NYZD 3H3VH 1FD7D 1X56A 4Y7NB 3J80E 4MIUA 1OXXK 2YV5A 1AP0A 5DLQE 3CF5A 1UEBA 3H09A 3TZUA 4HJ7A 3BYTB 3G71A 1Q12A 2DN8A 3QOLA 2J7ZA 4Y52H 1TY0A 4X3TA 1Y1WH 4BY1H 1K28A 4HJAA 1SE2A 1VQNA 4BXXH 1S72A 2NUCA 4ZLTF 1NY4A 4DNRB 1TU2B 4A93G 4RFBA 1H95A 1L0WA 2WV6D 3RLNA 5I9OA 5C4JB 3HFZB 1MJEA 1CHQD 1JWUD 3BDCA 3BVGA 1J8IA 4K0KL 3GTGB 1GUOA 2EJFC 4DV4L 4IO9A 4K0KQ 1K8OA 4R8IA 5C4XH 4DV4Q 4JYAL 3K8AA 4JYAQ 3GTKH 1D5ZC 1F77A 2EJMA 2Q2IA 1BUVT 3HKZB 4K5WA 4HN7A 1VQ4A 1JB3A 1I3QB 3K7UC 3SK4A 2LFNA 2JA8G 3KBGA 1S5BD 1S3OA 3MXPA 3S1QH 4JI1L 1K83H 4K2LA 4JI1Q 3UDGA 2F0HA 3KOJA 5IP9G 1PRTD 4A3DH 3OYYA 1LTGD 2WB1B 2L11A
chains in the Genus database with same CATH topology
3GO5A 3C46A 1I4PA 4IUUA 2O4XA 3H3VC 1S4ZA 2JE6I 2D62A 4B9WA 2RSNA 3MFYA 2A73B 1JE4A 3KBXA 3BYYB 2NN6H 4BA1I 5FO9B 3S15B 1E2ZA 5CV9A 1V8QA 3I4NB 4BBRB 1QG7A 1W6KA 1BO0A 1U4RA 1KNEA 2CW0C 3QOJA 1IKMA 5J39A 4RKBA 5EJWA 1EY5A 1ESFA 3O13A 2OF1A 2A6ED 4XT3B 4TQUS 5CV5A 3NUCA 1S5CD 4QMGA 2EYJA 1PXUA 4CKCA 4ZKBB 1EZ6A 4QUCA 1CM9A 1WTPA 2Q8RE 1EIHA 1FNWA 1QCBD 3GD7A 3PIO3 2AQ3B 2R3ZA 2EPBA 2FMCA 1PFMA 2RDHA 2F0EA 2NN6I 2E2DC 3E5SA 1EY7A 1ENCA 4L6TB 2H4OA 5C3EB 1Q1BA 5KRUA 3FEWX 3MXNA 4QB4A 4IZ8A 1LTRD 3J81L 3E6ZX 4JK1C 4HMIA 5HURA 2LS01 2EYFA 1BCPF 1V1PB 1GOZA 2B2UA 4IFDG 2EYOA 3SEBA 2V4DA 1ILPA 2B63B 2IL8A 3NBIA 4A3JB 1CI3M 3DWPA 2B8GA 4X3SA 4B9XA 1SEBD 2CHBD 2M9VA 3Q22A 2B2UC 2LMCB 2F0GA 3C3LA 1CTMA 4DAVA 3NSWA 2E2IB 1O7ZA 3CKIB 1EYAA 2PQEA 1UAPA 2X6GA 4DXGA 3AB9A 1DONA 1G6ZA 1X3PA 1FGBD 4RGNA 1HQMC 4TRDA 3FRPB 2F4IA 3AMUA 4BBSB 4OO1G 4IUTA 4KTAA 4F8MA 2L12A 5JJZA 2K01A 2IW3A 5ELFA 4EVOA 1LT6D 3NP8A 1Z47A 1ILQA 2EZVA 2RQXA 5ELDA 4H0LC 5M9OA 4QIWB 1EQVA 1Y1WB 4BY1B 3V05A 1SSOA 3KLSX 3J80L 1PZKD 1EZ8A 4KJNA 4QUFA 2F1MA 3GTKB 1NCVA 2TSSA 3OWEB 2O5JC 3H94A 3PUVA 5C4HA 1SJHD 3T4AC 3S1QB 1K83B 1B9MA 4EGVA 4F7XA 2ENBA 1DYQA 3ND8A 4A3DB 1TS5A 1D1IA 1JOKA 3F2UA 1V43A 1GUNA 4DK0A 4HSVA 1TIID 4TKOB 2PO4A 1YNNC 2B2YC 2AUJD 1IW7D 4K6LA 4C3JG 5EPKA 2F0WA 1SDFA 2QF7A 5FO8B 5I9PA 3NBHA 2K33A 1BXTA 5EKLA 5I2YA 5M3MB 2GA4B 4XTCS 4A3EB 1B50A 1QOHA 3GP7A 3MAQA 1PLFA 1PFBA 3HEJA 4HSPA 1MI2A 3L3OC 1XYIA 1GUSA 5JEAG 2B2WA 2FINB 5CV8A 3CHBD 4KKTA 1SNQA 3RD4A 5M5XB 3MA2B 3D6WA 3HOYB 1QNKA 1ZYRD 5C0XH 3GTQB 1Q90A 1B44D 4LJZC 2WP8J 4WORA 3HGBA 3ERQA 5ELEA 2FHTA 3K7AB 1MD2D 2KEEA 1EYDA 3C2PA 3S2HB 2R6GA 1NUCA 4FXDA 1R4PB 2A68D 4RKLA 1TS4A 3S1NB 1HCZA 3MC0B 2EXZA 1EU4A 1XWEA 2XN9C 5T1IA 2E74C 1WTWA 1DD2A 2L0CA 5J1ZA 3R2TA 1F2ZA 3T51B 2PW5A 4DNTB 3NPPA 3DEPA 3G7LA 5E1FA 4C3IG 1RTOA 3S9WA 1SYDA 4FP5D 3HS0C 5C0XI 1B4OA 2F0TA 1TT2A 1QILA 3A7LA 5LL6S 1TR5A 1TS3A 4RCOA 1LTAD 1PTOD 2XIWA 3KLRA 1I4XA 2BE5C 2K5QA 5JAVA 3ITPA 2BA0A 4ZRZA 1D2BA 2NVXB 3KUPA 4IUNA 1A6XA 4ZUJA 2R93B 1PRTF 3NXWA 1I6VC 1MSGA 5BN3A 1PZJD 4KKSA 4KI0A 3QO2A 2L4NA 4DA2A 4WRDA 5COYA 3EJIA 4N9TA 3QWNA 5IGBA 2B2TC 3M85A 1CT1D 3EROA 5EPJA 4F88A 2QILA 2WIIB 3Q0AA 2D2CC 4L63B 4G7ZC 3BG3A 3EQLC 2ZXOA 1DJRD 1DM0B 5KNCA 2LY7A 3S17B 3D4WA 3SXHA 1G2TA 2K32A 1Y8NB 3Q23A 1HXYD 4I7ZC 3V96A 3GTJB 4XQQA 1AZQA 2Y0SB 1U4PA 3T16A 4CJ1B 1NAPA 1U9RA 3DXJC 1IKLA 1A3TA 4H13C 5K36G 3PUZA 2WKCA 4BWGB 1Y69U 1EY0A 2K1BA 1BBXC 1GUTA 2NZ1D 3SHLA 4ZK9B 3EVQA 1Q8IA 2ZT9C 3S1MB 4X3KA 1I4RA 2BA1A 2K5DA 1LV9A 2OT2A 1QNUA 5K5PA 3GQBA 3VYTA 2EY1A 1I50B 2F0FA 3MXGA 2YYZA 2WAQB 4XT1B 1EIGA 3L7ZC 3MVVA 1Z7TA 1CZWA 3X3NA 1SNMA 2O2LD 3WOEA 1TWGB 3D6CA 3ONAB 1JR0D 3RUZA 2JA6B 2MJ8A 1IYVA 4G4KA 1O7YA 2D9UA 2HCIA 4NP5A 5IODA 4J8QA 1WTVA 5C0XJ 4ZUIA 3S14B 3HRZC 3BVMA 1JOOA 1BNZA 5KGUA 1S5DD 3NQIA 3PUXA 1X32A 1AW7A 3VYRA 2HCCA 3J7AV 3S16B 2XWBB 1ET6A 5DEHA 3I90A 1CZGA 5D3IB 1LT5D 1ESRA 4RCNA 4CJ2C 2HUGA 5FK9C 5JPMC 1JWSD 3BVZA 3K5NA 4FXGC 4FF3A 1XX8A 2IX0A 2CVRA 1EY4A 2KEDA 3DWQA 2R92B 2JEAI 2SEBD 2TMPA 3OMCA 1OXUA 3QJYA 4MHEA 3OPOA 3HOZB 2RBMA 3D4RA 1HA5A 3VR2A 1H9SA 2B2VA 2L55A 1F9RA 1C4QA 3H6MA 3R93A 1U4LA 2SOBA 4XXEA 3KF8A 3LWEA 3EA6A 2EOTA 4ZYSA 1UEAB 5I4DA 3BDOA 1HQRD 1KLUD 2A6HC 4DAPA 4A3KB 1H9KA 1JOQA 2ZXPA 1WD1A 3T53B 1SFOB 1S5ED 4J1MA 1HRJA 2L5TA 5FO7B 1LTBD 2EE1A 1II3A 5EBDA 1VMCA 2EYMA 5E3FA 3I4LA 3KK7A 1C48A 1STYA 1RCVD 1IYUA 2KVMA 1O7LA 1O78A 2F0DA 2DNEA 3H91A 2XNAC 5ISRA 3HOUB 1SNPA 1SYBA 5KYLA 1E2VA 3MHBA 1BCPC 4A3BB 4HTHA 1J9OA 4NMZA 1SYFA 4KD3A 5I6YA 4KMUC 1LTSD 3NWSA 2F03A 3RZOB 2CQAA 2R61A 5DAUA 2IPKD 1BR9A 4XIGS 5I6WA 2F0MA 5D3DA 2QEJC 1HTPA 3WOFA 3K6OA 4FF4A 3Q6SA 5BN4A 2C5CA 1DCZA 2AWOA 1DOKA 4X3UA 4EQPA 4IFDH 1F9QA 2F0OA 3NE5B 2VB2X 5G3LD 1TS2A 5CBEE 4OGQC 3M4OB 5J22A 5FOBB 3FVQA 3R2IA 4PMWA 1ET9A 2XRQD 5M5WB 1DZ1A 3NTKA 4JBWA 4ABNA 3HOWB 4HAEA 2PNRC 4A3MB 4ZKCB 2EDGA 4FF2A 2Z4HA 4CJ0B 3T13A 1GXDC 1A3UA 2AQ2B 3A54A 1HPCA 4A3IB 2IJ0A 3BS1A 2BDOA 4OO1H 3IL8A 4RGMA 2K28A 5CGKA 2XSCA 5C4XB 1UUPA 2F0VA 5IGGA 4UAIA 4IN3A 3M4YA 4RH6A 3GTMB 1A2UA 3RLFA 1ONLA 2MHVA 2EVBA 2NTTA 4K8JA 2NBFA 3MEHA 4XYOA 4A93B 3HG9A 1LT3D 1C8CA 1VMPA 2F3WA 1B1ZA 5E4WC 1PTOF 3D8GA 4QCLA 3SK8A 1FNUA 1SYCA 1VDZA 2JA8B 1KABA 2RDGA 3IAYA 1G2SA 1ICWA 5ELBA 4G7OC 3RZDB 4ODGA 2A69C 1STHA 4CKEA 4C3HB 4OO1I 1E2WA 2WINB 2FMMA 1KLGD 3OIPA 3PO3B 4FF1A 3S1RB 3MXUA 1FYCA 2K04A 2K5WA 1BCPB 4V190 2B2WC 1PYWD 1TWFB 2N88A 5EQ0A 2JXMB 4ME5A 1LT4D 2PZUA 4HCEA 4B08A 4I65A 3LNNA 3TDQA 1ZEQX 3TP5A 2IX1A 3BDLA 5JEAH 4AYBB 2PZWA 4K6DA 2PW7A 2QCPX 1WTRA 3A8IE 1KDCA 1KDAA 2Z4IA 3OMGA 1RTNA 2HDMA 3A56A 3X3MA 3A8JE 1HUNA 2B39A 1STNA 3NK9A 4NDXA 4L8JA 4M8AA 3MFGA 3ND9A 3OHXC 4K8IA 1RDPD 2F0JA 5DM73 3PV0A 3PUWA 3DWAA 1H9JA 4IALA 4P2CB 2NTSA 1MGSA 1IL8A 3G6JB 1EEFD 3TP6A 3PO2B 4RGTA 1R9TB 1VF5C 1O80A 3NHHA 1TY2A 4XQNA 3IKJA 4IUPA 1SMYD 3AU7A 3FDTA 1M4VA 1JQYD 2NVYB 3D4DA 2JP1A 3PMFA 2F0LA 4C1NK 3SE0A 4R9WA 5C3WA 5I2XA 1A15A 4LMQD 5LHY1 3SK5A 4O42A 3SDZA 1RJTA 5E4XA 1SNDA 2ICIA 1KAAA 5FKAC 1G91A 1F2YA 1GHKA 2HQEA 4IFDJ 1LO5D 2EY6A 1SJED 4NW2A 1EQTA 2Q8IB 1PRTC 4RWSC 1XTCD 1T5EA 3P1HA 5F2DA 3IFDA 4IUQA 3FMCA 3M3YB 1GHJA 3URYA 1JORA 2MPMA 2SDFA 5C5MA 1JCKB 2F0QA 3VA7A 3T56B 3OIQA 3WDNA 4U673 3HP3A 1H9MA 2WB1B 3J7YW 1AN8A 1RKNA 2IX3A 2RSOA 2F0NA 4G7HC 5DNFA 2SNSA 2DY8A 4RHSA 1I6HB 1BOSA 1EY6A 3CRKC 4K5VA 1EFID 3PUYA 1E0BA 2PYKA 2A6EC 3TP8A 1YNJD 1JWMD 4DK1A 1VF7A 3DM1A 4RAUC 4KN4C 5D14A 4ZAIA 4WJWA 5CV4A 3GV6A 2L1BA 1D6EC 4DF7A 3VYSA 1TWAB 1EWHA 5C44B 1F2LA 5K36H 4KY5A 1NSNS 1B3AA 1I4GA 5JVH3 1V1PA 1F9SA 3M7NA 1HUMA 2PZTA 4CHTB 3QIAA 3LX0A 3TMEA 3IFTA 1A2TA 3S2DB 2E76C 2F0UA 4F87A 3DHQA 4ILWA 2NVQB 2G9DA 1DOMA 2D5DA 2KECA 5TSSA 2N55A 3NTIA 1R4QB 4K2KA 1WTXA 2SNMA 4BS9A 1WTOA 3U9OA 4C3JB 3CU7A 5NUCA 2A5HA 2X69A 5JEAJ 1CQVA 3MZ5A 2Z1CA 2I46A 2NWGA 4GZYC 1H9RA 1WCMB 5KNBA 1KNAA 3K5MA 3SVMA 2BE5D 3V2TA 2NN6G 2KCNA 2QKIC 2G9HD 2X6LA 4ZQ3A 2F0SA 4YIJA 1EOTA 3NTHA 1B9NA 2MP1A 3I73A 2K6AA 4ULLA 4NKLA 2H1EA 1OXSC 3OWFA 1RODA 3BZDB 3C1EA 4HEDA 2PPBC 1HFGA 1PRTB 1EL0A 5G3LF 1DOLA 4O1NA 3I91A 3R3OA 3N6RA 1Q3LA 5FLXE 4S3SA 4EQOA 1HFNA 5CYUA 4QF4A 2BOSA 3MWYW 2BCOA 5CORA 2FFKB 4DXFA 1STAA 1RHPA 3FPUB 1A3VA 5CMDA 4ID6A 5IT9E 1Q1EA 3P7JA 5IGEA 3J7AF 3CQZB 2M2LA 2AUKA 3GTPB 4XQJA 1EEID 2AQ1B 5IGFA 1SBBB 5HGTA 5M3FB 5EKIA 4LAAA 2B2VC 1KTKA 5D65A 4G57A 4WFN3 3L9AX 2L9HA 2I07B 5CC4A 3P20A 3DEOA 5EGTA 3TZDA 2VB3X 3UI2A 2K7VA 4PQXA 3OSOA 4C3IB 5KEEA 2IWHA 1ZKOA 1CQFA 3I3CA 2YU9B 4XDXA 1MSHA 5EKKA 1B53A 2JEBI 2FJ2A 3EFXD 1IW7C 2O5IC 3DMUA 1AFPA 5JOBA 4BY7B 3TN2A 4FYDA 2VNUD 2R7ZB 3OW7A 3H0GB 1STGA 3JAME 1BF4A 1F9PA 1OXVA 2J0TD 1QWYA 2EYLA 3VR3A 4MN3A 1STBA 2F0IA 4R8NA 1Y8PB 1TQOA 4KN7C 1L0YB 1T5XD 2WACA 4K5XA 1NR2A 2XWJB 4DGZA 4H44C 2ID0A 4KV6A 2KHSA 4KHVA 2HDLA 3A7AB 1PFNA 3MTSA 4E6IA 1SXTA 4Q5VA 2KOLA 1ZYRC 4KY7A 1HA6A 3HOVB 5KIXA 4OHJA 2RKSA 3U9SA 1F2MA 1STEA 1XXGA 1SYGA 4KD4A 2JYOA 3VR5A 2KUMA 1PTOH 1CHPD 3DUZA 1Z6HA 5C3XA 3K0YA 3VYUA 1D1KA 2F0KA 2A68C 3K5LA 2KA7A 3NWTA 3K57A 1G291 1TWCB 2F0PA 4DN4M 3M7GA 4FO2A 1PDQA 5A2QE 3OOCA 3D31A 2CW0D 2ICEC 1QB5D 2AWNA 4HMJA 5CBAE 4FXKC 1IHZA 3RMHA 4Z9CB 2NVTB 4RA8A 4OIKA 3KLSA 5IIFA 1GUWA 1MBYA 4KK7A 1SMYC 2K05A 2E75C 2F3VA 1TKWB 3I8ZA 4EQNA 4A3FB 4PV1C 5M5YB 1FNVA 4IFDI 1QE6A 2A6HD 3SK6A 1L0XB 2KCCA 4KKUA 4UDUC 4M1UB 1K8MA 4CGYB 4J6HA 1PTOC 3I4MB 1H9SB 1RD9D 4XYQA 1CFMA 3W3AA 2B2YA 4U68A 1KDBA 3I72A 1WTQA 3E0JA 3TBIB 1ZXTA 3PIP3 1VCIA 3QG1A 5C5LA 2OEOA 4FNFA 1S5FD 3VR6A 3Q24A 2EY5A 4DAYA 3TSSA 3R8BA 2OXPA 3K59A 5DM63 1Y1VB 2A74C 1BCPD 3SR1A 2XRSD 1EYCA 3K5OA 4LK1C 5CR3A 2PCFB 5C0XG 1GUGA 3CRLC 4IUVA 3A8KE 5C6AA 2JA7B 1G8ZD 1DXMA 4KJOA 5AFWA 2Z8LA 1SNCA 5CV7A 1EY8A 1I4HA 2BDNA 1BQQT 1I4QA 5FLXL 2PMZB 3FKIB 4PMBA 1YNJC 4IQZA 4FVMA 1OO9B 5IT9L 4HCSA 1TWHB 1SYEA 1QJOA 2K03A 5JVG3 2Q8TA 5EPLA 4KY6A 3VR4A 1CA5A 1HHVA 4K14A 3FPPA 3LWUA 1SE4A 1GJXA 1X3QA 1HTLD 1B2TA 4Q0FA 3NQTA 2IT1A 2B8FA 1SE3A 4A3GB 1NR4A 2EY2A 1LABA 2MGSA 1CK1A 4PNYA 4N9PA 2DY7A 2J4XA 1D5MC 2QDBA 2RVLA 4BA2I 4OIJA 4RGOS 4CKBA 2XVSA 1LTID 2NB0A 1ENAA 3D3RA 1AEXA 2VUMB 1RF2D 1EWCA 1BDOA 1UNSA 2DNCA 3JAML 3P75A 4OL7A 1V1OA 1PMRA 2E2HB 5C4ZA 2MUYA 4PMCA 2E2JB 2RDFA 1EY9A 1WVLA 4V0BA 5T1GA 3A55A 1OXTA 3QB3A 4HR7B 1SAPA 1YNND 1ENFA 3TP7A 1W6JA 3J81E 5ELCA 2KJXA 4KHZA 1Y8OB 2C9OA 2JA5B 1EU3A 1LLRD 1PTOB 2B2TA 3HOXB 1FR3A 2VXWA 1SNOA 2WKDA 2KQ3A 2EYHA 5KYIA 1WD0A 1JICA 3GTLB 4C1NI 2A69D 3K58A 2ZXRA 2M00A 5EBCA 3N52A 1U4MA 3VA5A 2RA4A 5LL6X 5IGCA 1LACA 1PZID 5IOCA 3I70A 3ZYYX 4DFAA 4H7BA 5BN5A 5A2QL 3HZXA 5IGDA 5CV6A 5JPNC 2JSOA 4C56C 2LKVA 2EYPA 3C1FA 5KNDA 1ML0D 1M8AA 1AZPA 2EJGC 3GTOB 1TVXA 3W2DA 4DU9A 1D5XC 4IURA 1LTTD 4TSSA 1JC7A 3GV3A 4CBVA 5A35A 4RHRA 1CA6A 4C2MB 2NYZD 1FD7D 4Y7NB 3J80E 4MIUA 1OXXK 1AP0A 3H09A 3TZUA 3BYTB 1Q12A 2DN8A 3QOLA 2J7ZA 1TY0A 4X3TA 1SE2A 2NUCA 4ZLTF 4DNRB 1TU2B 4RFBA 2WV6D 5C4JB 5I9OA 1CHQD 1JWUD 3BDCA 3BVGA 1J8IA 3GTGB 1GUOA 2EJFC 1K8OA 4R8IA 1D5ZC 1F77A 2EJMA 1BUVT 3HKZB 4K5WA 4HN7A 1JB3A 1I3QB 3SK4A 2LFNA 3KBGA 1S5BD 3MXPA 4K2LA 2F0HA 1PRTD 1LTGD 4C3HG 2L11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6C A;  4WOR A;  3HZX A;  1F2Y A;  1KDB A;  4KY5 A;  1A3V A;  5IGD A;  5CV6 A;  1JOQ A;  1NSN S;  2EY2 A;  3ERQ A;  4ID6 A;  2O4X A;  4WRD A;  5IGE A;  2HQE A;  2LKV A;  5KRU A;  3RUZ A;  2EY6 A;  3EJI A;  4N9T A;  1EZ8 A;  2EYP A;  5IGB A;  4J1M A;  4PNY A;  4KY7 A;  4QB4 A;  4N9P A;  3C1F A;  4KJN A;  2PZT A;  5KIX A;  3ERO A;  2RKS A;  4IZ8 A;  5C5L A;  3P1H A;  5F2D A;  1EYD A;  1F2M A;  2OEO A;  4NP5 A;  3LX0 A;  4B9W A;  5IGF A;  5IOD A;  1NUC A;  4RKL A;  1II3 A;  2QDB A;  3TME A;  1SYG A;  4KD4 A;  2EY5 A;  1A2T A;  4ZUI A;  4HMI A;  5HGT A;  2EYM A;  2F0U A;  4LAA A;  5E3F A;  5HUR A;  3T13 A;  4ME5 A;  2OXP A;  3D4W A;  5C4H A;  1A3U A;  1ENA A;  1STY A;  1JOO A;  2EYF A;  2PZU A;  3SXH A;  4DU9 A;  4I65 A;  5KGU A;  4G57 A;  2EXZ A;  3DHQ A;  1JOR A;  1AEX A;  3TP5 A;  5CV9 A;  5C3X A;  2F0D A;  3BDL A;  5C5M A;  2PZW A;  2EYO A;  4K6D A;  3SR1 A;  5CC4 A;  2F0K A;  4F7X A;  2ENB A;  2PW7 A;  2F0Q A;  1EYC A;  5DEH A;  5ISR A;  3P75 A;  4OL7 A;  1KDC A;  1SNP A;  1SYB A;  5CR3 A;  1KDA A;  3T16 A;  2F0P A;  4K2K A;  5EGT A;  5J1Z A;  5CGK A;  1F2Z A;  1JOK A;  5C4Z A;  3OMG A;  5KYL A;  2SNM A;  2F0V A;  3MHB A;  3QOJ A;  4B9X A;  4PMC A;  5C6A A;  2PW5 A;  2RDF A;  4RKB A;  3U9O A;  5J39 A;  4KJO A;  5IGG A;  1U9R A;  1EY5 A;  3OSO A;  4MIU A;  1A3T A;  1EY9 A;  5KEE A;  1RKN A;  4HTH A;  2F0G A;  1SNC A;  4NMZ A;  1SYF A;  5CV7 A;  5E1F A;  5NUC A;  2F0W A;  4KD3 A;  2F0N A;  3NK9 A;  1EY8 A;  5EKK A;  5I6Y A;  4NDX A;  1A2U A;  4HMJ A;  3QB3 A;  3QOL A;  3MZ5 A;  2OF1 A;  3TP7 A;  4K8I A;  1EY4 A;  1EY0 A;  2F0J A;  2SNS A;  5I9P A;  3S9W A;  1SYD A;  5CV5 A;  1IHZ A;  5EKL A;  1EY6 A;  3NUC A;  4IAL A;  4PMB A;  4K8J A;  1EYA A;  3MEH A;  4QMG A;  5DAU A;  3SHL A;  3DMU A;  4K5V A;  5IIF A;  2NUC A;  2EYJ A;  5JOB A;  3V2T A;  3EVQ A;  3HEJ A;  2PQE A;  3OMC A;  3TP6 A;  1SNO A;  2KQ3 A;  5I6W A;  2F0T A;  2F0M A;  2EYH A;  1TT2 A;  2F3W A;  2PYK A;  2F0S A;  4YIJ A;  4ZQ3 A;  5KYI A;  5I9O A;  2F3V A;  3NHH A;  1EZ6 A;  1TR5 A;  3BDC A;  3TP8 A;  4TRD A;  1SYE A;  2RBM A;  4EQN A;  1STG A;  4NKL A;  3D8G A;  3OWF A;  5CV8 A;  4KTA A;  3C1E A;  3H6M A;  4F8M A;  5JAV A;  3D4D A;  3SK8 A;  5K5P A;  1SNQ A;  3PMF A;  2EY1 A;  2EYL A;  1SYC A;  2F0F A;  2F0L A;  2M00 A;  3ITP A;  2SOB A;  4EQP A;  3SK6 A;  1STB A;  5C3W A;  4KY6 A;  1KAB A;  4K5W A;  2F0O A;  2F0I A;  3MVV A;  4IUN A;  4R8N A;  1TQO A;  3SK4 A;  4ZUJ A;  3VA5 A;  4EVO A;  2F0E A;  2WAC A;  5CV4 A;  4K14 A;  4K5X A;  3MXP A;  3NP8 A;  3R3O A;  4J6H A;  4K2L A;  3SK5 A;  4ODG A;  3E5S A;  4DGZ A;  3NXW A;  2F0H A;  4S3S A;  1SNM A;  4EQO A;  5IGC A;  5M9O A;  5IOC A;  4DF7 A;  1EY7 A;  1ENC A;  1EQV A;  1SND A;  1STH A;  4KV6 A;  4QF4 A;  2KHS A;  4KHV A;  5J22 A;  3NQT A;  4DFA A;  4H7B A;  1STA A;  4E6I A;  1KAA A;  1STN A; 
#chains in the Genus database with same CATH topology
 3GO5 A;  1Y1V G;  4HJ8 A;  3C46 A;  1I4P A;  4L5Q A;  4IUU A;  2O4X A;  1GM5 A;  3H3V C;  3H3V I;  4I7A A;  1S4Z A;  2JE6 I;  3EBE A;  3PO3 G;  2D62 A;  4B9W A;  1G51 A;  2N8N A;  2RSN A;  3MFY A;  1JB7 A;  2A73 B;  1JE4 A;  5M3M H;  2PQA A;  3KBX A;  3BYY B;  4A3L G;  3CMA A;  4A3E H;  2NN6 H;  4QL5 A;  1CKO A;  4BA1 I;  5FO9 B;  3S15 B;  2B3G A;  1E2Z A;  5CV9 A;  2Q2U A;  1V8Q A;  3I4N B;  4BBR B;  1QG7 A;  1W6K A;  4KHP L;  1BO0 A;  1U4R A;  1X6O A;  3RN5 A;  4QGU A;  4KHP Q;  1KNE A;  2CW0 C;  4LUV A;  4HID A;  3QOJ A;  1IKM A;  5J39 A;  4RKB A;  5EJW A;  5M5X H;  4LWC A;  1EY5 A;  1IBM L;  1IBM Q;  3HOY H;  3ICE A;  1HNW L;  1HNW Q;  1ESF A;  1CUK A;  3O13 A;  2OF1 A;  4NPS A;  2A6E D;  3CP0 A;  3PIP A;  4XT3 B;  3GTQ H;  4TQU S;  5CV5 A;  1QUQ B;  3NUC A;  1PYB A;  1S5C D;  4QMG A;  2EYJ A;  1PXU A;  4CKC A;  1K0S A;  1VQO A;  5JJL A;  3PO2 G;  3K7A H;  4ZKB B;  1QVG A;  1EZ6 A;  4QUC A;  2G5D A;  1CM9 A;  3S2H H;  1VQ8 A;  1WTP A;  1CSQ A;  2Q8R E;  5BR8 L;  1GO3 E;  5BR8 Q;  3S1N H;  1FNW A;  1EIH A;  1YEZ A;  2RCF A;  1QCB D;  3GD7 A;  3PIO 3;  2AQ3 B;  2R3Z A;  2EPB A;  5GAD C;  2FMC A;  2AKW B;  1PFM A;  2RDH A;  2F0E A;  2NN6 I;  1PV4 A;  2E2D C;  3E5S A;  1VQD A;  2I0Q A;  1EY7 A;  1ENC A;  2I5M X;  4L6T B;  2K5N A;  2H4O A;  5C3E B;  1VQC A;  1Q1B A;  5KRU A;  2MO0 A;  3FEW X;  3MXN A;  4QB4 A;  1KAW A;  4IZ8 A;  1Z9F A;  1XPU A;  4OON A;  1JT8 A;  1LTR D;  3HKZ E;  3UDF A;  2IY5 B;  3J81 L;  3E6Z X;  4JK1 C;  2XGT A;  1CKN B;  5H1S E;  4HMI A;  2K52 A;  5HUR A;  4B3R Q;  2LS0 1;  2EYF A;  1BCP F;  1V1P B;  2JJQ A;  1GOZ A;  2B2U A;  4IFD G;  4YY3 L;  2EYO A;  4YY3 Q;  3SEB A;  2V4D A;  3TQY A;  1ILP A;  2B63 B;  2WB1 E;  2IL8 A;  3NBI A;  2VQE L;  4A3J B;  1CI3 M;  2VQE Q;  3DWP A;  2B8G A;  4X3S A;  3CAM A;  4B9X A;  1SEB D;  2CHB D;  2M9V A;  1HZ9 A;  3Q22 A;  1U0L A;  2NVX H;  2B2U C;  2LMC B;  1X3F A;  2F0G A;  1IYJ B;  4J15 A;  2R93 H;  3C3L A;  1CTM A;  4DAV A;  1KQS A;  5HY6 A;  3NSW A;  2E2I B;  1O7Z A;  3CKI B;  4HJ5 A;  1S40 A;  1YBY A;  1EYA A;  3I2Z A;  1KC8 C;  2PQE A;  1UAP A;  2X6G A;  3T1Y L;  4DXG A;  3AB9 A;  2HT1 A;  1DON A;  1G6Z A;  1X3P A;  1FGB D;  4RGN A;  1HQM C;  4TRD A;  3FRP B;  2F4I A;  3NEL A;  5GAH C;  3AMU A;  4BBS B;  4OO1 G;  4IUT A;  1K8G A;  4KTA A;  4F8M A;  2L12 A;  5JJZ A;  5IYD G;  3S17 H;  2K01 A;  2IW3 A;  4GLX A;  3KFU A;  1B8A A;  5ELF A;  4LF7 L;  4EVO A;  1LT6 D;  4LF7 Q;  4N8F A;  4UP9 A;  3NP8 A;  1Z47 A;  2NZO A;  1ILQ A;  2EZV A;  2RQX A;  5ELD A;  4H0L C;  5M9O A;  4QIW B;  3GTJ H;  1EQV A;  1Y1W B;  4BY1 B;  1SR3 A;  1UWV A;  1SLJ A;  3V05 A;  3DLL A;  1SSO A;  2CWA A;  3KLS X;  5C44 G;  4ZCK A;  3KDF B;  3J80 L;  4IPH A;  3U4V A;  1FJG L;  1KD1 C;  1FJG Q;  1PZK D;  1IZ6 A;  1EZ8 A;  1SRO A;  4KJN A;  4QUF A;  2EXD A;  2R7F A;  2F1M A;  1EWI A;  3GTK B;  1NCV A;  2TSS A;  4JI8 L;  3OWE B;  2O5J C;  3H94 A;  4LUZ A;  4JI8 Q;  1E7Z A;  3PUV A;  5C4H A;  1SJH D;  4LF8 L;  4LF8 Q;  3T4A C;  1YHB A;  3S1Q B;  1K83 B;  3S1M H;  1B9M A;  4EGV A;  4F7X A;  2ENB A;  1DYQ A;  4P74 A;  3ND8 A;  4A3D B;  1NBW A;  1TS5 A;  1D1I A;  1WOC A;  2CCZ A;  1JOK A;  3F2U A;  1V43 A;  1GUN A;  4DK0 A;  2QA4 A;  4HSV A;  1TII D;  4TKO B;  2PO4 A;  1I50 H;  1YNN C;  2B2Y C;  2AUJ D;  2N3S A;  3J81 c;  1IW7 D;  4C3H G;  4QQB X;  4K6L A;  4C3J G;  2WFW A;  5EPK A;  2F0W A;  1E1O A;  1SRU A;  3M4P A;  1SDF A;  4GS3 A;  2QF7 A;  3I55 A;  5FO8 B;  2KBN A;  3M4Q A;  5I9P A;  3NBH A;  4X65 L;  2K33 A;  1BXT A;  5EKL A;  4X65 Q;  5I2Y A;  5M3M B;  2GA4 B;  4XTC S;  2F3I A;  4A3E B;  1JJ2 A;  1B50 A;  4DPG A;  1TWG H;  3SGI A;  1QOH A;  3GP7 A;  3MAQ A;  1PLF A;  1PFB A;  3HEJ A;  4HSP A;  1MI2 A;  4IPC A;  3L3O C;  2JA6 H;  1XYI A;  4P72 A;  1GUS A;  4JI4 L;  5JEA G;  2MNA A;  1JE5 A;  4JI4 Q;  2B2W A;  2OTL A;  1CKM A;  1IXR A;  2FIN B;  5CV8 A;  1UE7 A;  3CHB D;  4KKT A;  1SNQ A;  3RD4 A;  5M5X B;  3MA2 B;  1CSP A;  3D6W A;  3HOY B;  4FDB A;  4P75 A;  1XJV A;  1QNK A;  3AEV A;  3CCQ A;  3S16 H;  2E5L L;  1ZYR D;  2E5L Q;  5C0X H;  3GTQ B;  4OWW B;  1Q90 A;  1B44 D;  3KF6 A;  4LJZ C;  3PQI A;  1VQG A;  2WP8 J;  4YWK A;  4DV5 L;  4WOR A;  4DV5 Q;  3HGB A;  1I94 L;  1VQ6 A;  3ERQ A;  1I94 Q;  1PH9 A;  5ELE A;  2A19 A;  2FHT A;  3ULL A;  3K7A B;  1MD2 D;  3I4N G;  2KEE A;  1Q7Y C;  5HGQ A;  1EYD A;  4YCU A;  3C2P A;  5GRO A;  3S2H B;  2R6G A;  1NUC A;  4FXD A;  1R4P B;  2A68 D;  4RKL A;  1TS4 A;  4IOA A;  3S1N B;  2R92 H;  1HCZ A;  5M3F G;  3MC0 B;  3K81 C;  2EXZ A;  4UPA A;  4UY8 C;  1EU4 A;  1XWE A;  2XN9 C;  5T1I A;  4GNX A;  2E74 C;  3M9B A;  2KCM A;  5IE8 A;  1WTW A;  4LFA L;  4LFA Q;  3HOZ H;  1DD2 A;  2L0C A;  5J1Z A;  2YTV A;  1IBK L;  3R2T A;  1F2Z A;  3T51 B;  1IBK Q;  1HNX L;  1HNX Q;  2HIV A;  2PW5 A;  3CPF A;  2MFI A;  4DNT B;  2GN5 A;  3NPP A;  2Z6B A;  3DEP A;  1VQJ A;  3G7L A;  5E1F A;  4C3I G;  2JQO A;  1YI2 A;  1RTO A;  3UE0 A;  3S9W A;  1SYD A;  3A5U A;  4A3K H;  4FP5 D;  3HS0 C;  5IY0 A;  5C0X I;  1B4O A;  3CC7 A;  1SFO H;  2F0T A;  4IJH A;  4BY7 G;  1TT2 A;  1QIL A;  3A7L A;  5LL6 S;  1TR5 A;  1TS3 A;  4POF A;  4RCO A;  2FXQ A;  4LFC L;  1LTA D;  2R7Z G;  1PTO D;  2XIW A;  3KLR A;  4O2D A;  4LFC Q;  1I4X A;  2EQS A;  1PVO A;  2BE5 C;  2K5Q A;  4A75 A;  5JAV A;  3A5Z B;  3ITP A;  2BA0 A;  4ZRZ A;  4QY7 A;  2OCE A;  1D2B A;  2NVX B;  3KUP A;  2AHO B;  4IUN A;  1A6X A;  4ZUJ A;  1PFS A;  1YIT A;  2R93 B;  1PRT F;  3W1B A;  3NXW A;  1I6V C;  4JI7 L;  2D0P A;  4JI7 Q;  1MSG A;  3HOU H;  5BN3 A;  2MO1 A;  1PZJ D;  4KKS A;  4KI0 A;  3QO2 A;  2L4N A;  5FJ8 H;  4DA2 A;  4WRD A;  4A3B H;  1Q46 A;  5COY A;  3EJI A;  4N9T A;  4AH6 A;  3QWN A;  5IGB A;  2B2T C;  2JK8 A;  5IP7 H;  3M85 A;  2UUB L;  1CT1 D;  2UUB Q;  5JJI A;  3AFP A;  3ERO A;  5EPJ A;  4F88 A;  2QIL A;  2WII B;  3Q0A A;  2D2C C;  4L63 B;  4A3J G;  3HOV G;  4G7Z C;  3BG3 A;  3EQL C;  2ZXO A;  1DJR D;  1YVC A;  1DM0 B;  1V9P A;  5KNC A;  2LY7 A;  3RZO H;  3S17 B;  3D4W A;  3SXH A;  1G2T A;  3NEN A;  2K32 A;  3PIO A;  4A3C H;  1Y8N B;  3Q23 A;  1HXY D;  4I7Z C;  3V96 A;  3GTJ B;  4XQQ A;  1AZQ A;  4DAY B;  2Y0S B;  4AYB E;  1U4P A;  3T16 A;  1J6Q A;  4CJ1 B;  1SE8 A;  4DV3 L;  3ERS X;  4DV3 Q;  1NAP A;  3CCR A;  1U9R A;  3DXJ C;  1OTC A;  1IKL A;  1UE1 A;  1A3T A;  4H13 C;  5IYC G;  5K36 G;  1GKH A;  3PUZ A;  1YZ6 A;  2WKC A;  1XTD A;  4BWG B;  1M90 C;  4JC0 A;  1NJI C;  1Y69 U;  1EY0 A;  2K1B A;  3M4O H;  2ZM6 L;  1BBX C;  2Z6K A;  2ZM6 Q;  1GUT A;  2NZ1 D;  3SHL A;  4ZK9 B;  1E3P A;  5M5W H;  3EVQ A;  3PF5 A;  2ZJR A;  1Q8I A;  2ZT9 C;  1G6P A;  4JI3 L;  4O0A A;  4JI3 Q;  3S1M B;  3KYH C;  4X3K A;  3HOW H;  3L2P A;  4BY1 G;  1I4R A;  2BA1 A;  2K5D A;  4A3M H;  1LV9 A;  2VQF L;  2OT2 A;  2PNH A;  2VQF Q;  4A3F G;  3E0E A;  1QNU A;  5K5P A;  3GQB A;  3VYT A;  2EY1 A;  1I50 B;  2F0F A;  3MXG A;  2YYZ A;  2WAQ B;  4XT1 B;  1EIG A;  3L7Z C;  3MVV A;  1Z7T A;  3OW2 A;  4A3I H;  1CZW A;  4JOI A;  3I7F A;  3X3N A;  1SNM A;  1UE5 A;  3I4M G;  2O2L D;  3WOE A;  1TWG B;  3D6C A;  3ONA B;  1JR0 D;  3RUZ A;  2D0O A;  2JA6 B;  4JOI C;  2MJ8 A;  1IYV A;  4G4K A;  3STB D;  3GTM H;  4A76 A;  1O7Y A;  2D9U A;  2HCI A;  4NP5 A;  4JW0 A;  5IOD A;  4J8Q A;  1WTV A;  1KRS A;  5C0X J;  4UHV A;  4GOP A;  4ZUI A;  3S14 B;  3HRZ C;  3BVM A;  4A93 H;  1KXL A;  2XTI A;  1JOO A;  1BNZ A;  1E22 A;  5KGU A;  3CCL A;  1S5D D;  2CWP A;  3NQI A;  3PUX A;  1X32 A;  2OTJ A;  1AW7 A;  3VYR A;  5FLM G;  2HCC A;  3J7A V;  3S16 B;  2XWB B;  1ET6 A;  4P71 A;  5DEH A;  3I90 A;  1CZG A;  2LXJ A;  1C9O A;  5D3I B;  4NB3 A;  1LT5 D;  2JA8 H;  1ESR A;  4OEL B;  4RCN A;  4CJ2 C;  4MNO A;  2JA7 G;  2HUG A;  3CD6 A;  4YCW A;  5FK9 C;  4DR6 L;  3RR5 A;  2HD3 A;  5JPM C;  4DR6 Q;  2RHQ B;  5IP9 H;  1JWS D;  2NZH A;  3BVZ A;  3RZD H;  3K5N A;  4FXG C;  3KJO A;  4FF3 A;  1XX8 A;  2IX0 A;  2CVR A;  1EY4 A;  2KED A;  2K4K A;  4C3H H;  3DWQ A;  2R92 B;  2JEA I;  2SEB D;  3FKI G;  2TMP A;  1WI5 A;  1SMX A;  3OMC A;  2QDL A;  1OXU A;  3QJY A;  4MHE A;  3J7Z C;  2Y0S E;  3PO3 H;  3S1R H;  3OPO A;  3HOZ B;  2RBM A;  3D4R A;  4YWL A;  1HA5 A;  3VR2 A;  1H9S A;  1NNX A;  2B2V A;  2L55 A;  4A3L H;  2F52 A;  1F9R A;  1C4Q A;  3H6M A;  2UXC L;  3R93 A;  3CC2 A;  1TWF H;  2UXC Q;  1U4L A;  2SOB A;  4XXE A;  1N9W A;  3KF8 A;  3LWE A;  4GLV B;  3EA6 A;  2EOT A;  3W5O A;  4ZYS A;  1UEA B;  3L0O A;  5I4D A;  3BDO A;  1HQR D;  1KLU D;  2A6H C;  1PH4 A;  4DAP A;  4A3K B;  1H9K A;  1JOQ A;  2ZXP A;  1WD1 A;  1EIF A;  3T53 B;  4A3G G;  1SFO B;  3U50 C;  1S5E D;  4J1M A;  1HRJ A;  2L5T A;  5FO7 B;  1LTB D;  4DUY L;  2EE1 A;  4DUY Q;  1RIP A;  1II3 A;  5EBD A;  1VMC A;  2WAQ E;  2EYM A;  4PZ7 A;  5E3F A;  3I4L A;  3KK7 A;  1YHQ A;  1C48 A;  1STY A;  4GN4 B;  1SN8 A;  3NEM A;  4HIO A;  1RCV D;  3PO2 H;  1IYU A;  1R9T H;  2KVM A;  1ASZ A;  1O7L A;  1MIU A;  1O78 A;  2F0D A;  2DNE A;  1WFQ A;  3ZJY C;  2KHJ A;  2VUM G;  4H02 A;  3H91 A;  5JJK A;  1LTL A;  4NXN L;  2XNA C;  4NXN Q;  5ISR A;  3HOU B;  1PH5 A;  1M1K C;  1SNP A;  1SYB A;  5KYL A;  1E2V A;  2NVY H;  3MHB A;  1BCP C;  4A3B B;  4B3R L;  4HTH A;  1J9O A;  4NMZ A;  1SYF A;  2Z0S A;  4KD3 A;  5I6Y A;  2VZA A;  1LTS D;  4KMU C;  3NWS A;  2ALY B;  2ZTD A;  2F03 A;  3RZO B;  2CQA A;  2R61 A;  5DAU A;  4JG2 A;  1L1O A;  5IYB G;  2IPK D;  1BR9 A;  4XIG S;  2JA5 G;  5I6W A;  2F0M A;  5D3D A;  3HOX G;  4RG1 A;  1AE3 A;  1HTP A;  2QEJ C;  3WOF A;  3K6O A;  4FF4 A;  3Q6S A;  3M3Y H;  5BN4 A;  2C5C A;  1N34 L;  3J7A 5;  1N34 Q;  1DCZ A;  2AWO A;  1DOK A;  4X3U A;  4EQP A;  3FP9 A;  4IFD H;  1F9Q A;  2F0O A;  3NE5 B;  2VB2 X;  5G3L D;  1TS2 A;  5CBE E;  4OGQ C;  3M4O B;  2K14 A;  3KLW A;  5J22 A;  5FOB B;  3F1Z A;  3FVQ A;  3R2I A;  4PMW A;  1ET9 A;  2XRQ D;  5M5W B;  2MQH A;  1DZ1 A;  2PI2 A;  1LYL A;  3NTK A;  4DAM A;  4JBW A;  4ABN A;  4CDE C;  3HOW B;  4HAE A;  2PNR C;  4A3M B;  4ZKC B;  2ZJP A;  2EDG A;  1I6H H;  1YNX A;  4FF2 A;  2Z4H A;  4UP7 A;  4CJ0 B;  3T13 A;  1GXD C;  1A3U A;  2AQ2 B;  3A54 A;  3I4O A;  1HPC A;  4A3I B;  4PG3 A;  2A1A A;  2IJ0 A;  3KJP A;  3CME A;  3BS1 A;  2BDO A;  1HJP A;  4OO1 H;  3IL8 A;  4RGM A;  3G6E A;  2DUD A;  2PQA B;  1EUJ A;  2K28 A;  5CGK A;  2XSC A;  5IYD H;  1W3S A;  1WTH A;  5C4X B;  1UUP A;  2F0V A;  1Q86 C;  4WJ3 M;  5IGG A;  4UAI A;  4IN3 A;  3M4Y A;  4RH6 A;  4X6A H;  3HKS A;  3GTM B;  1A2U A;  3RLF A;  1ONL A;  2GVA A;  1K8A C;  1TWA H;  1AE2 A;  2EVB A;  2MHV A;  2NTT A;  4K8J A;  2NBF A;  5C44 H;  3MEH A;  4XYO A;  4A93 B;  2N78 A;  3HG9 A;  2ASB A;  2HHH L;  2HHH Q;  1LT3 D;  5GAE C;  1C8C A;  1VMP A;  2F3W A;  1PH3 A;  1B1Z A;  5E4W C;  1PTO F;  4DR4 L;  4DR4 Q;  3D8G A;  4QCL A;  3CPW A;  3S2D H;  3SK8 A;  1FNU A;  1SYC A;  1VDZ A;  2JA8 B;  4GKK L;  3HKZ G;  1BKB A;  1KAB A;  2RDG A;  3BZK A;  1N8R C;  3IAY A;  4GKK Q;  1G2S A;  1ICW A;  5ELB A;  4G7O C;  3RZD B;  4ODG A;  2NVQ H;  1A63 A;  2A69 C;  1STH A;  4CKE A;  4C3H B;  4OO1 I;  1E2W A;  2WIN B;  1QVF A;  4JI2 L;  2FMM A;  4JI2 Q;  1KLG D;  5L37 A;  3LGJ A;  3OIP A;  1ASY A;  4C3J H;  2WB1 G;  3GTG H;  1HR0 W;  3PO3 B;  3FHW A;  3H15 A;  3S1R B;  4FF1 A;  3MXU A;  1FYC A;  2K04 A;  2K5W A;  1BCP B;  4V19 0;  1WCM H;  2B2W C;  1PYW D;  1TWF B;  2N88 A;  2LXK A;  3CCV A;  5EQ0 A;  2JXM B;  4ME5 A;  1LT4 D;  2PZU A;  4HCE A;  4B08 A;  4I65 A;  3LNN A;  5LMN W;  3TDQ A;  3MXN B;  1ZEQ X;  3TP5 A;  4L5S A;  2IX1 A;  3BDL A;  5JEA H;  4AYB B;  2PZW A;  4K6D A;  2PW7 A;  1XNR L;  2QCP X;  1B3Q A;  1XNR Q;  1WTR A;  3A8I E;  4BBR G;  2R92 G;  1KDC A;  1KDA A;  2Z4I A;  3OMG A;  2UXD L;  2BH8 A;  2UXD Q;  1RTN A;  3PCO B;  4JI0 L;  3UE1 A;  4JI0 Q;  2HDM A;  2L15 A;  3A56 A;  3X3M A;  3A8J E;  4DV1 L;  1HUN A;  2B39 A;  4DV1 Q;  1STN A;  1EOV A;  5GAG C;  3NK9 A;  4IJL A;  4NDX A;  4L8J A;  4DV6 L;  4M8A A;  4DUZ L;  4DV6 Q;  3MFG A;  3ND9 A;  3OHX C;  4DUZ Q;  3PF4 A;  4K8I A;  1RDP D;  2F0J A;  5DM7 3;  3PV0 A;  3PUW A;  3DWA A;  1H9J A;  4IAL A;  2OQK A;  4P2C B;  1HZC A;  2NTS A;  1WYD A;  1MGS A;  1IL8 A;  3G6J B;  1EEF D;  3CCE A;  3G4S A;  1JMC A;  3TP6 A;  3EN2 A;  4RGT A;  1R9T B;  3PO2 B;  1VF5 C;  1K3B C;  1O80 A;  3CQZ H;  1PH1 A;  3NHH A;  4YWM A;  1TY2 A;  2E8G A;  3RN2 A;  1X65 A;  4XQN A;  4GNX C;  3IKJ A;  3GTP H;  3AFQ A;  3U58 A;  4IUP A;  4JVZ A;  1SMY D;  3AU7 A;  3UDI A;  3FDT A;  1D7Q A;  1M4V A;  1JQY D;  4DR5 L;  2NVY B;  5M3F H;  3D4D A;  4DR5 Q;  2JP1 A;  3PMF A;  2F0L A;  4C1N K;  2C35 B;  3SE0 A;  4R9W A;  5C3W A;  3A74 A;  5I2X A;  1A15 A;  4R4O A;  4LMQ D;  1YIJ A;  2DJF C;  5LHY 1;  3SK5 A;  4O42 A;  2CFM A;  3SDZ A;  1RJT A;  5E4X A;  1VQ9 A;  1SND A;  2UUC L;  2UUC Q;  2ICI A;  1KAA A;  5FKA C;  1G91 A;  1F2Y A;  4CDC C;  5C3E G;  1K9M C;  1GHK A;  4C3I H;  2HQE A;  4IFD J;  4DR2 L;  5J3B A;  2VW9 A;  1LO5 D;  2EY6 A;  1XMO L;  4DR2 Q;  2YU9 H;  1XMO Q;  1SJE D;  4NW2 A;  1EQT A;  2Q8I B;  1X9N A;  1PRT C;  2YTY A;  4RWS C;  1XTC D;  1T5E A;  3P1H A;  5F2D A;  3IFD A;  4IUQ A;  3CC4 A;  3FMC A;  3M3Y B;  3AYH B;  1C0A A;  1GHJ A;  5FJ8 G;  3ULJ A;  4A3B G;  4BY7 H;  3URY A;  2RCN A;  1JOR A;  2JA9 A;  2MPM A;  2SDF A;  1XNQ L;  5C5M A;  1XNQ Q;  4JV5 Q;  1A0I A;  2R7Z H;  1JCK B;  3H0G H;  2F0Q A;  3VA7 A;  1X55 A;  4DR3 L;  2B63 G;  2DJG C;  4DR3 Q;  3S24 A;  3T56 B;  3OIQ A;  3WDN A;  4U67 3;  1QUQ A;  3HP3 A;  4L5R C;  2BH2 A;  1H9M A;  3J7Y W;  1AN8 A;  1RKN A;  1J5E L;  5E7N A;  2IX3 A;  1J5E Q;  2RSO A;  2F0N A;  3CXC A;  3TEH B;  2R7D A;  5DNF A;  4X62 L;  1VQH A;  4X64 Q;  2SNS A;  2DY8 A;  4RHS A;  4X62 Q;  4G7H C;  4JBM A;  1PH7 A;  1I6H B;  1BOS A;  1EY6 A;  3CRK C;  4K5V A;  1EFI D;  3PUY A;  1PYS B;  1E0B A;  2PYK A;  4DV7 L;  2A6E C;  4DV7 Q;  1A62 A;  4A3J H;  3HOV H;  3TP8 A;  1P8L A;  2HIX A;  3TRZ A;  1YNJ D;  1JWM D;  3NBH B;  4WJ4 A;  4DK1 A;  3PGZ A;  1VF7 A;  3DM1 A;  4POG A;  2Q2T A;  4BBS G;  1MJC A;  4CDF C;  3W1G A;  4R4C A;  4KN4 C;  4RAU C;  1W2B A;  5D14 A;  4ZAI A;  1VQB A;  3B6Y A;  4TVA B;  4WJW A;  5CV4 A;  3GV6 A;  2L1B A;  1D6E C;  4DF7 A;  3VYS A;  1TWC H;  1TWA B;  2RF4 A;  1EWH A;  5C44 B;  1Y1W G;  1F2L A;  1CKN A;  4IPD A;  3Q8D A;  2Z6K C;  5K36 H;  4KY5 A;  4BXX G;  3CCS A;  1NSN S;  4LUO A;  4JPB W;  1B3A A;  1I4G A;  5JVH 3;  1V1P A;  1F9S A;  1EQR A;  3E3X A;  3M7N A;  1HUM A;  2PZT A;  4CHT B;  4ME3 A;  4EQ5 A;  3QIA A;  3LX0 A;  3KF6 B;  3BJU A;  3TME A;  5C4X G;  3IFT A;  1A2T A;  2NVT H;  3S2D B;  2E76 C;  2F0U A;  1E1T A;  1N36 L;  1N36 Q;  1VQE A;  1PHJ A;  4F87 A;  3DM3 A;  3DHQ A;  4EX5 A;  1KIX A;  2PI2 E;  4ILW A;  2NVQ B;  1EIY B;  3RNU A;  2G9D A;  1DOM A;  2D5D A;  3F2C A;  2KEC A;  4A3F H;  5TSS A;  2N55 A;  3NTI A;  3JAM c;  5M5Y H;  4B3S L;  1R4Q B;  4K2K A;  4A3D G;  4B3S Q;  3CCU A;  1WTX A;  4KLK A;  1N32 L;  2SNM A;  1N32 Q;  4BS9 A;  1WTO A;  3U9O A;  4C3J B;  3CU7 A;  1A8V A;  4GNX B;  5NUC A;  4JBK A;  2A5H A;  2X69 A;  5JEA J;  4DV2 L;  4DV2 Q;  3CCJ A;  1CQV A;  2OWO A;  3I4M H;  3MZ5 A;  2Z1C A;  2I46 A;  2NWG A;  4GZY C;  1H9R A;  2KCT A;  1WCM B;  5KNB A;  1KNA A;  3K5M A;  5M3M G;  3SVM A;  4GOP C;  2BE5 D;  2EIF A;  3V2T A;  4A3E G;  2NN6 G;  2UXB L;  2KCN A;  2QKI C;  2G9H D;  2X6L A;  4JCV E;  2UXB Q;  2GVB A;  3J80 i;  1QVC A;  2F0S A;  4YIJ A;  1EOT A;  3NTH A;  1B9N A;  4ZQ3 A;  1Y14 B;  1EFW A;  2HQL A;  1KRT A;  2MP1 A;  3I73 A;  2K6A A;  4ULL A;  1V1Q A;  4NKL A;  1Q8K A;  2H1E A;  1OXS C;  3OWF A;  1ROD A;  4GN3 B;  3BZD B;  3C1E A;  4HED A;  2PPB C;  4P73 A;  1BBW A;  1HFG A;  1PRT B;  3I56 A;  4YHH L;  1PH6 A;  4YHH Q;  1EL0 A;  5FLM H;  1Y1V H;  3KDF A;  4JBJ A;  1EQQ A;  4R4Q A;  5G3L F;  3TS0 A;  3HOY G;  1DOL A;  4O1N A;  3I91 A;  3R3O A;  3N6R A;  4MTK A;  1Q3L A;  5FLX E;  4S3S A;  4EQO A;  1HFN A;  5CYU A;  4QF4 A;  2BOS A;  3MWY W;  2BCO A;  5COR A;  2FFK B;  4DXF A;  1STA A;  1RHP A;  3FPU B;  2JA7 H;  1A3V A;  5CMD A;  4ID6 A;  5IT9 E;  1Q1E A;  3P7J A;  4GN5 A;  5IGE A;  2P5Z X;  4AYB G;  3E9I A;  3J7A F;  3CQZ B;  2M2L A;  2AUK A;  3GTP B;  4XQJ A;  1EEI D;  2AQ1 B;  2IHE A;  3QR8 A;  5IGF A;  1N33 L;  1SBB B;  1N33 Q;  3FKI H;  5HGT A;  5M3F B;  1LM0 A;  4LAA A;  2B2V C;  5EKI A;  4R4T A;  1KTK A;  2ATW A;  1NE3 A;  5D65 A;  4G57 A;  2IHF A;  1X3E A;  3F8T A;  1PA6 A;  4WFN 3;  3L9A X;  1KL9 A;  2L9H A;  3F2B A;  2I07 B;  5CC4 A;  2DGY A;  1TWH H;  3P20 A;  4MZ9 A;  1MHW C;  3DEO A;  5EGT A;  1JJG A;  3TZD A;  1MKH A;  2VB3 X;  3UI2 A;  2K7V A;  4PQX A;  3OSO A;  1BBU A;  4DK3 C;  4C3I B;  5KEE A;  2IWH A;  1ZKO A;  1CQF A;  3I3C A;  2YU9 B;  4XDX A;  1VQL A;  1MSH A;  2VS1 A;  5EKK A;  1C7Y A;  2K75 A;  4HJ9 A;  1B53 A;  2JEB I;  1T9H A;  2FJ2 A;  3EFX D;  1IW7 C;  2O5I C;  1XPO A;  3DMU A;  3RLO A;  1AFP A;  4A3G H;  5JOB A;  2QEX A;  4BY7 B;  3TN2 A;  4FYD A;  1I5F A;  2VNU D;  2R7Z B;  4LF5 L;  3OW7 A;  4LF5 Q;  3H0G B;  1STG A;  3JAM E;  1BF4 A;  1F9P A;  4LF4 L;  1OXV A;  4LF4 Q;  2J0T D;  2VY3 A;  3BZC A;  1QWY A;  1P16 A;  4L5T A;  2EYL A;  3VR3 A;  4MN3 A;  1STB A;  2F0I A;  4R8N A;  2K5H A;  1Y8P B;  1TQO A;  4KN7 C;  2VUM H;  1L0Y B;  1T5X D;  2WAC A;  4K5X A;  4N8X 1;  4PZ6 A;  1XMQ L;  3D0F A;  1NR2 A;  1XMQ Q;  2XWJ B;  4DGZ A;  2R93 G;  4H44 C;  1GD7 A;  4DR1 L;  1QZH A;  2ID0 A;  4DR1 Q;  4KV6 A;  2KHS A;  4KHV A;  2HDL A;  3A7A B;  3ULP A;  2E2H H;  1PFN A;  3MTS A;  4E6I A;  1SXT A;  2E2J H;  1FL0 A;  4Q5V A;  2KOL A;  1L1O C;  1D8L A;  1ZYR C;  2ZTE A;  4KY7 A;  1HA6 A;  3HOV B;  5KIX A;  4OHJ A;  2RKS A;  3U9S A;  1F2M A;  1STE A;  1XXG A;  4MTN A;  2CQO A;  1SYG A;  4KD4 A;  2JYO A;  1DGS A;  4OX9 L;  5IYB H;  3VR5 A;  2KUM A;  4OX9 Q;  4DKA C;  2JA5 H;  3MEF A;  1PTO H;  3JAM i;  3HOX H;  1CHP D;  1E24 A;  1HZA A;  3DUZ A;  1Z6H A;  5C3X A;  3GDE A;  3K0Y A;  3VYU A;  1D1K A;  2F0K A;  1EYG A;  2A68 C;  3K5L A;  2KA7 A;  3NWT A;  5ELO A;  2UUA L;  2F4V L;  4GOP B;  2UUA Q;  2F4V Q;  3K57 A;  1G29 1;  1NMF A;  1TWC B;  2F0P A;  3GTL H;  4DN4 M;  3M7G A;  2Y0S G;  4FO2 A;  3T1Y Q;  1PDQ A;  5A2Q E;  2N49 A;  3OOC A;  1YJW A;  4APV A;  1Q82 C;  2B29 A;  3D31 A;  2CW0 D;  2ICE C;  1XPR A;  1QB5 D;  2AWN A;  4DV0 L;  4DV0 Q;  4HMJ A;  1U5K A;  1PH8 A;  3U4Z A;  5CBA E;  4R1J A;  4FXK C;  1IHZ A;  3RMH A;  4Z9C B;  2NVT B;  4RA8 A;  4OIK A;  3KLS A;  5IIF A;  1JJC B;  1GVP A;  1GUW A;  1MBY A;  4KK7 A;  1BVS A;  2ZTC A;  1SMY C;  2K05 A;  2LSS A;  2E75 C;  1HZB A;  2F3V A;  1TKW B;  4OXP A;  4ALP A;  3I8Z A;  4EQN A;  2I5L X;  4A3F B;  4PV1 C;  5M5Y B;  1FNV A;  4IFD I;  3GTO H;  1QE6 A;  4LFB L;  2CH4 A;  4LW1 A;  2A6H D;  1IL2 A;  4LFB Q;  3SK6 A;  1L0X B;  2KCC A;  1L2F A;  4QJF A;  4KKU A;  2WAQ G;  4M1U B;  4UDU C;  1K8M A;  2QGQ A;  4CGY B;  4J6H A;  1K0R A;  1PTO C;  3WWV A;  3I4M B;  1H9S B;  1RD9 D;  3UDX A;  4IPG A;  4XYQ A;  1CFM A;  3W3A A;  4GKJ L;  4C2M H;  5ELN A;  2B2Y A;  4GKJ Q;  1FVI A;  4U68 A;  1KDB A;  1X54 A;  3I72 A;  3KF8 B;  4Y7N H;  1WTQ A;  3E0J A;  3TBI B;  1ZXT A;  3PIP 3;  1NTG A;  1VCI A;  1TXY A;  3QG1 A;  1B7Y B;  5C5L A;  2JA6 G;  3JC6 6;  2OEO A;  4FNF A;  1S5F D;  3VR6 A;  4CDD C;  3Q24 A;  2UU9 L;  2EY5 A;  4DAY A;  2UU9 Q;  1PH2 A;  3TSS A;  3R8B A;  2OXP A;  1HR0 L;  3K59 A;  5DM6 3;  1QZG A;  1HR0 Q;  2AMC B;  1Y1V B;  4PZ8 A;  4AQY L;  2A74 C;  3T1H L;  1VQP A;  1BCP D;  5IWA L;  4AQY Q;  5C4J H;  3T1H Q;  3SR1 A;  5IWA Q;  4IOC A;  2XRS D;  4JI5 L;  4JI5 Q;  2Q2H A;  1EYC A;  1WCM G;  3E9H A;  3K5O A;  4LK1 C;  5CR3 A;  2PCF B;  3CW2 C;  5C0X G;  5LMN L;  1GUG A;  1NMG A;  5LMN Q;  3CRL C;  4IUV A;  3A8K E;  5C6A A;  2JA7 B;  1G8Z D;  1DXM A;  4KJO A;  5AFW A;  1WJJ A;  4JI6 L;  1FGU A;  2Z8L A;  1VQ5 A;  1I3Q H;  4JI6 Q;  1SNC A;  5CV7 A;  1EY8 A;  2RHS B;  1I4H A;  2BDN A;  1BQQ T;  1I4Q A;  5FLX L;  1UE6 A;  3S14 H;  2CH4 W;  2PMZ B;  3FKI B;  2VL6 A;  4PMB A;  4DK6 C;  1K73 C;  4OEM B;  3TRE A;  1YNJ C;  4IQZ A;  4FVM A;  1VQF A;  2H5X A;  1OO9 B;  5IT9 L;  4HCS A;  3EIV A;  1TWH B;  1SYE A;  2QW7 A;  1QJO A;  2ZJQ A;  2K03 A;  3HOZ G;  5JVG 3;  4RMF A;  2Q8T A;  1L1O B;  5GQO A;  2KEN A;  1YJN A;  1IBL L;  4LNQ A;  5EPL A;  3G48 A;  1IBL Q;  4KY6 A;  3VR4 A;  3S15 H;  1CA5 A;  1HHV A;  4K14 A;  1YJ9 A;  3FPP A;  3LWU A;  2V1C C;  2OQ0 A;  1SE4 A;  1GJX A;  4HIK A;  3I4N H;  1X3Q A;  4BBR H;  1HTL D;  1VS0 A;  4GLA C;  1Q81 C;  1AH9 A;  4OWX B;  3BU2 A;  1B2T A;  4Q0F A;  1KHI A;  3NQT A;  1HNZ L;  4B3T L;  2IT1 A;  1HNZ Q;  4B3T Q;  2B8F A;  1SE3 A;  4QIW E;  4A3G B;  4A3K G;  1NR4 A;  2EY2 A;  3J80 c;  1LAB A;  4R4I A;  2MGS A;  1CK1 A;  4PNY A;  4N9P A;  2DY7 A;  2J4X A;  3AQQ A;  3F2D A;  1VQI A;  4LF6 L;  1D5M C;  4LF6 Q;  2QDB A;  2RVL A;  4B3M L;  3IRB A;  4OIJ A;  4BA2 I;  4B3M Q;  4RGO S;  2K5V A;  4CKB A;  2XVS A;  2A8V A;  1LTI D;  1ICF B;  2NB0 A;  1ENA A;  1YHA A;  3D3R A;  1RL2 A;  1AEX A;  3STB C;  2VUM B;  1RF2 D;  1EWC A;  3ER0 A;  2K50 A;  1BDO A;  1UNS A;  2DNC A;  4DNI A;  4HIM A;  3JAM L;  3P75 A;  4OL7 A;  1V1O A;  1PMR A;  2E2H B;  5C4Z A;  3HOU G;  2MUY A;  2YTX A;  4PMC A;  4DR7 L;  2RDF A;  2E2J B;  1VQM A;  4DR7 Q;  5EAY A;  2ES2 A;  1EY9 A;  2Z9H A;  4LF9 L;  1WVL A;  1K3R A;  4LF9 Q;  4AIM A;  4V0B A;  5T1G A;  3H0G G;  3A55 A;  5IP7 G;  1OXT A;  3QB3 A;  4HR7 B;  1SAP A;  1YNN D;  1ENF A;  3TP7 A;  1W6J A;  3J81 E;  5ELC A;  2KJX A;  4JV5 L;  4KHZ A;  1Y8O B;  2C9O A;  5C3E H;  2JA5 B;  1EU3 A;  1LLR D;  4UP8 A;  3OTO L;  3TS2 A;  1PTO B;  3CCM A;  3OTO Q;  2B2T A;  3K80 C;  1FR3 A;  2VXW A;  3HOX B;  1SNO A;  2WKD A;  2KQ3 A;  3K0X A;  2EYH A;  5KYI A;  1WD0 A;  1JIC A;  4A3C G;  4NXM L;  1B70 B;  4NXM Q;  5AJ3 L;  5AJ3 Q;  4OWT B;  3GTL B;  4C1N I;  4X66 L;  2A69 D;  4X66 Q;  3K58 A;  4X64 L;  1O7I A;  2ZXR A;  5FLX c;  2M00 A;  5EBC A;  3N52 A;  5LMU L;  1U4M A;  3VA5 A;  5LMU Q;  3J81 j;  2PMZ E;  2RA4 A;  5LL6 X;  5IGC A;  1LAC A;  1PZI D;  5IOC A;  5IT9 c;  2B63 H;  3I70 A;  4YCV A;  2CKZ B;  3ZYY X;  4DFA A;  4H7B A;  5BN5 A;  1LUZ A;  5A2Q L;  3HZX A;  5IGD A;  5CV6 A;  5JPN C;  2JSO A;  4C56 C;  2LKV A;  3J81 i;  1X3G A;  2EYP A;  4A4I A;  3C1F A;  5KND A;  1ML0 D;  1M8A A;  2E2I H;  1AZP A;  2EJG C;  3HOW G;  4A3M G;  3GTO B;  1TVX A;  1VQA A;  2JN4 A;  3W2D A;  2KHI A;  4DU9 A;  1D5X C;  4IUR A;  1LTT D;  5IYC H;  1VQK A;  4TSS A;  1JC7 A;  3PSI A;  4A3I G;  3GV3 A;  4CBV A;  5A35 A;  4RHR A;  1CA6 A;  4BBS H;  2I5H A;  3VDY A;  1HH2 P;  3A0J A;  4C2M B;  1VQ7 A;  2NYZ D;  3H3V H;  1FD7 D;  1X56 A;  4Y7N B;  3J80 E;  4MIU A;  1OXX K;  2YV5 A;  1AP0 A;  5DLQ E;  3CF5 A;  1UEB A;  3H09 A;  3TZU A;  4HJ7 A;  3BYT B;  3G71 A;  1Q12 A;  2DN8 A;  3QOL A;  2J7Z A;  4Y52 H;  1TY0 A;  4X3T A;  1Y1W H;  4BY1 H;  1K28 A;  4HJA A;  1SE2 A;  1VQN A;  4BXX H;  1S72 A;  2NUC A;  4ZLT F;  1NY4 A;  4DNR B;  1TU2 B;  4A93 G;  4RFB A;  1H95 A;  1L0W A;  2WV6 D;  3RLN A;  5I9O A;  5C4J B;  3HFZ B;  1MJE A;  1CHQ D;  1JWU D;  3BDC A;  3BVG A;  1J8I A;  4K0K L;  3GTG B;  1GUO A;  2EJF C;  4DV4 L;  4IO9 A;  4K0K Q;  1K8O A;  4R8I A;  5C4X H;  4DV4 Q;  4JYA L;  3K8A A;  4JYA Q;  3GTK H;  1D5Z C;  1F77 A;  2EJM A;  2Q2I A;  1BUV T;  3HKZ B;  4K5W A;  4HN7 A;  1VQ4 A;  1JB3 A;  1I3Q B;  3K7U C;  3SK4 A;  2LFN A;  2JA8 G;  3KBG A;  1S5B D;  1S3O A;  3MXP A;  3S1Q H;  4JI1 L;  1K83 H;  4K2L A;  4JI1 Q;  3UDG A;  2F0H A;  3KOJ A;  5IP9 G;  1PRT D;  4A3D H;  3OYY A;  1LTG D;  2WB1 B;  2L11 A; 
#chains in the Genus database with same CATH homology
 3GO5 A;  3C46 A;  1I4P A;  4IUU A;  2O4X A;  3H3V C;  1S4Z A;  2JE6 I;  2D62 A;  4B9W A;  2RSN A;  3MFY A;  2A73 B;  1JE4 A;  3KBX A;  3BYY B;  2NN6 H;  4BA1 I;  5FO9 B;  3S15 B;  1E2Z A;  5CV9 A;  1V8Q A;  3I4N B;  4BBR B;  1QG7 A;  1W6K A;  1BO0 A;  1U4R A;  1KNE A;  2CW0 C;  3QOJ A;  1IKM A;  5J39 A;  4RKB A;  5EJW A;  1EY5 A;  1ESF A;  3O13 A;  2OF1 A;  2A6E D;  4XT3 B;  4TQU S;  5CV5 A;  3NUC A;  1S5C D;  4QMG A;  2EYJ A;  1PXU A;  4CKC A;  4ZKB B;  1EZ6 A;  4QUC A;  1CM9 A;  1WTP A;  2Q8R E;  1EIH A;  1FNW A;  1QCB D;  3GD7 A;  3PIO 3;  2AQ3 B;  2R3Z A;  2EPB A;  2FMC A;  1PFM A;  2RDH A;  2F0E A;  2NN6 I;  2E2D C;  3E5S A;  1EY7 A;  1ENC A;  4L6T B;  2H4O A;  5C3E B;  1Q1B A;  5KRU A;  3FEW X;  3MXN A;  4QB4 A;  4IZ8 A;  1LTR D;  3J81 L;  3E6Z X;  4JK1 C;  4HMI A;  5HUR A;  2LS0 1;  2EYF A;  1BCP F;  1V1P B;  1GOZ A;  2B2U A;  4IFD G;  2EYO A;  3SEB A;  2V4D A;  1ILP A;  2B63 B;  2IL8 A;  3NBI A;  4A3J B;  1CI3 M;  3DWP A;  2B8G A;  4X3S A;  4B9X A;  1SEB D;  2CHB D;  2M9V A;  3Q22 A;  2B2U C;  2LMC B;  2F0G A;  3C3L A;  1CTM A;  4DAV A;  3NSW A;  2E2I B;  1O7Z A;  3CKI B;  1EYA A;  2PQE A;  1UAP A;  2X6G A;  4DXG A;  3AB9 A;  1DON A;  1G6Z A;  1X3P A;  1FGB D;  4RGN A;  1HQM C;  4TRD A;  3FRP B;  2F4I A;  3AMU A;  4BBS B;  4OO1 G;  4IUT A;  4KTA A;  4F8M A;  2L12 A;  5JJZ A;  2K01 A;  2IW3 A;  5ELF A;  4EVO A;  1LT6 D;  3NP8 A;  1Z47 A;  1ILQ A;  2EZV A;  2RQX A;  5ELD A;  4H0L C;  5M9O A;  4QIW B;  1EQV A;  1Y1W B;  4BY1 B;  3V05 A;  1SSO A;  3KLS X;  3J80 L;  1PZK D;  1EZ8 A;  4KJN A;  4QUF A;  2F1M A;  3GTK B;  1NCV A;  2TSS A;  3OWE B;  2O5J C;  3H94 A;  3PUV A;  5C4H A;  1SJH D;  3T4A C;  3S1Q B;  1K83 B;  1B9M A;  4EGV A;  4F7X A;  2ENB A;  1DYQ A;  3ND8 A;  4A3D B;  1TS5 A;  1D1I A;  1JOK A;  3F2U A;  1V43 A;  1GUN A;  4DK0 A;  4HSV A;  1TII D;  4TKO B;  2PO4 A;  1YNN C;  2B2Y C;  2AUJ D;  1IW7 D;  4K6L A;  4C3J G;  5EPK A;  2F0W A;  1SDF A;  2QF7 A;  5FO8 B;  5I9P A;  3NBH A;  2K33 A;  1BXT A;  5EKL A;  5I2Y A;  5M3M B;  2GA4 B;  4XTC S;  4A3E B;  1B50 A;  1QOH A;  3GP7 A;  3MAQ A;  1PLF A;  1PFB A;  3HEJ A;  4HSP A;  1MI2 A;  3L3O C;  1XYI A;  1GUS A;  5JEA G;  2B2W A;  2FIN B;  5CV8 A;  3CHB D;  4KKT A;  1SNQ A;  3RD4 A;  5M5X B;  3MA2 B;  3D6W A;  3HOY B;  1QNK A;  1ZYR D;  5C0X H;  3GTQ B;  1Q90 A;  1B44 D;  4LJZ C;  2WP8 J;  4WOR A;  3HGB A;  3ERQ A;  5ELE A;  2FHT A;  3K7A B;  1MD2 D;  2KEE A;  1EYD A;  3C2P A;  3S2H B;  2R6G A;  1NUC A;  4FXD A;  1R4P B;  2A68 D;  4RKL A;  1TS4 A;  3S1N B;  1HCZ A;  3MC0 B;  2EXZ A;  1EU4 A;  1XWE A;  2XN9 C;  5T1I A;  2E74 C;  1WTW A;  1DD2 A;  2L0C A;  5J1Z A;  3R2T A;  1F2Z A;  3T51 B;  2PW5 A;  4DNT B;  3NPP A;  3DEP A;  3G7L A;  5E1F A;  4C3I G;  1RTO A;  3S9W A;  1SYD A;  4FP5 D;  3HS0 C;  5C0X I;  1B4O A;  2F0T A;  1TT2 A;  1QIL A;  3A7L A;  5LL6 S;  1TR5 A;  1TS3 A;  4RCO A;  1LTA D;  1PTO D;  2XIW A;  3KLR A;  1I4X A;  2BE5 C;  2K5Q A;  5JAV A;  3ITP A;  2BA0 A;  4ZRZ A;  1D2B A;  2NVX B;  3KUP A;  4IUN A;  1A6X A;  4ZUJ A;  2R93 B;  1PRT F;  3NXW A;  1I6V C;  1MSG A;  5BN3 A;  1PZJ D;  4KKS A;  4KI0 A;  3QO2 A;  2L4N A;  4DA2 A;  4WRD A;  5COY A;  3EJI A;  4N9T A;  3QWN A;  5IGB A;  2B2T C;  3M85 A;  1CT1 D;  3ERO A;  5EPJ A;  4F88 A;  2QIL A;  2WII B;  3Q0A A;  2D2C C;  4L63 B;  4G7Z C;  3BG3 A;  3EQL C;  2ZXO A;  1DJR D;  1DM0 B;  5KNC A;  2LY7 A;  3S17 B;  3D4W A;  3SXH A;  1G2T A;  2K32 A;  1Y8N B;  3Q23 A;  1HXY D;  4I7Z C;  3V96 A;  3GTJ B;  4XQQ A;  1AZQ A;  2Y0S B;  1U4P A;  3T16 A;  4CJ1 B;  1NAP A;  1U9R A;  3DXJ C;  1IKL A;  1A3T A;  4H13 C;  5K36 G;  3PUZ A;  2WKC A;  4BWG B;  1Y69 U;  1EY0 A;  2K1B A;  1BBX C;  1GUT A;  2NZ1 D;  3SHL A;  4ZK9 B;  3EVQ A;  1Q8I A;  2ZT9 C;  3S1M B;  4X3K A;  1I4R A;  2BA1 A;  2K5D A;  1LV9 A;  2OT2 A;  1QNU A;  5K5P A;  3GQB A;  3VYT A;  2EY1 A;  1I50 B;  2F0F A;  3MXG A;  2YYZ A;  2WAQ B;  4XT1 B;  1EIG A;  3L7Z C;  3MVV A;  1Z7T A;  1CZW A;  3X3N A;  1SNM A;  2O2L D;  3WOE A;  1TWG B;  3D6C A;  3ONA B;  1JR0 D;  3RUZ A;  2JA6 B;  2MJ8 A;  1IYV A;  4G4K A;  1O7Y A;  2D9U A;  2HCI A;  4NP5 A;  5IOD A;  4J8Q A;  1WTV A;  5C0X J;  4ZUI A;  3S14 B;  3HRZ C;  3BVM A;  1JOO A;  1BNZ A;  5KGU A;  1S5D D;  3NQI A;  3PUX A;  1X32 A;  1AW7 A;  3VYR A;  2HCC A;  3J7A V;  3S16 B;  2XWB B;  1ET6 A;  5DEH A;  3I90 A;  1CZG A;  5D3I B;  1LT5 D;  1ESR A;  4RCN A;  4CJ2 C;  2HUG A;  5FK9 C;  5JPM C;  1JWS D;  3BVZ A;  3K5N A;  4FXG C;  4FF3 A;  1XX8 A;  2IX0 A;  2CVR A;  1EY4 A;  2KED A;  3DWQ A;  2R92 B;  2JEA I;  2SEB D;  2TMP A;  3OMC A;  1OXU A;  3QJY A;  4MHE A;  3OPO A;  3HOZ B;  2RBM A;  3D4R A;  1HA5 A;  3VR2 A;  1H9S A;  2B2V A;  2L55 A;  1F9R A;  1C4Q A;  3H6M A;  3R93 A;  1U4L A;  2SOB A;  4XXE A;  3KF8 A;  3LWE A;  3EA6 A;  2EOT A;  4ZYS A;  1UEA B;  5I4D A;  3BDO A;  1HQR D;  1KLU D;  2A6H C;  4DAP A;  4A3K B;  1H9K A;  1JOQ A;  2ZXP A;  1WD1 A;  3T53 B;  1SFO B;  1S5E D;  4J1M A;  1HRJ A;  2L5T A;  5FO7 B;  1LTB D;  2EE1 A;  1II3 A;  5EBD A;  1VMC A;  2EYM A;  5E3F A;  3I4L A;  3KK7 A;  1C48 A;  1STY A;  1RCV D;  1IYU A;  2KVM A;  1O7L A;  1O78 A;  2F0D A;  2DNE A;  3H91 A;  2XNA C;  5ISR A;  3HOU B;  1SNP A;  1SYB A;  5KYL A;  1E2V A;  3MHB A;  1BCP C;  4A3B B;  4HTH A;  1J9O A;  4NMZ A;  1SYF A;  4KD3 A;  5I6Y A;  4KMU C;  1LTS D;  3NWS A;  2F03 A;  3RZO B;  2CQA A;  2R61 A;  5DAU A;  2IPK D;  1BR9 A;  4XIG S;  5I6W A;  2F0M A;  5D3D A;  2QEJ C;  1HTP A;  3WOF A;  3K6O A;  4FF4 A;  3Q6S A;  5BN4 A;  2C5C A;  1DCZ A;  2AWO A;  1DOK A;  4X3U A;  4EQP A;  4IFD H;  1F9Q A;  2F0O A;  3NE5 B;  2VB2 X;  5G3L D;  1TS2 A;  5CBE E;  4OGQ C;  3M4O B;  5J22 A;  5FOB B;  3FVQ A;  3R2I A;  4PMW A;  1ET9 A;  2XRQ D;  5M5W B;  1DZ1 A;  3NTK A;  4JBW A;  4ABN A;  3HOW B;  4HAE A;  2PNR C;  4A3M B;  4ZKC B;  2EDG A;  4FF2 A;  2Z4H A;  4CJ0 B;  3T13 A;  1GXD C;  1A3U A;  2AQ2 B;  3A54 A;  1HPC A;  4A3I B;  2IJ0 A;  3BS1 A;  2BDO A;  4OO1 H;  3IL8 A;  4RGM A;  2K28 A;  5CGK A;  2XSC A;  5C4X B;  1UUP A;  2F0V A;  5IGG A;  4UAI A;  4IN3 A;  3M4Y A;  4RH6 A;  3GTM B;  1A2U A;  3RLF A;  1ONL A;  2MHV A;  2EVB A;  2NTT A;  4K8J A;  2NBF A;  3MEH A;  4XYO A;  4A93 B;  3HG9 A;  1LT3 D;  1C8C A;  1VMP A;  2F3W A;  1B1Z A;  5E4W C;  1PTO F;  3D8G A;  4QCL A;  3SK8 A;  1FNU A;  1SYC A;  1VDZ A;  2JA8 B;  1KAB A;  2RDG A;  3IAY A;  1G2S A;  1ICW A;  5ELB A;  4G7O C;  3RZD B;  4ODG A;  2A69 C;  1STH A;  4CKE A;  4C3H B;  4OO1 I;  1E2W A;  2WIN B;  2FMM A;  1KLG D;  3OIP A;  3PO3 B;  4FF1 A;  3S1R B;  3MXU A;  1FYC A;  2K04 A;  2K5W A;  1BCP B;  4V19 0;  2B2W C;  1PYW D;  1TWF B;  2N88 A;  5EQ0 A;  2JXM B;  4ME5 A;  1LT4 D;  2PZU A;  4HCE A;  4B08 A;  4I65 A;  3LNN A;  3TDQ A;  1ZEQ X;  3TP5 A;  2IX1 A;  3BDL A;  5JEA H;  4AYB B;  2PZW A;  4K6D A;  2PW7 A;  2QCP X;  1WTR A;  3A8I E;  1KDC A;  1KDA A;  2Z4I A;  3OMG A;  1RTN A;  2HDM A;  3A56 A;  3X3M A;  3A8J E;  1HUN A;  2B39 A;  1STN A;  3NK9 A;  4NDX A;  4L8J A;  4M8A A;  3MFG A;  3ND9 A;  3OHX C;  4K8I A;  1RDP D;  2F0J A;  5DM7 3;  3PV0 A;  3PUW A;  3DWA A;  1H9J A;  4IAL A;  4P2C B;  2NTS A;  1MGS A;  1IL8 A;  3G6J B;  1EEF D;  3TP6 A;  3PO2 B;  4RGT A;  1R9T B;  1VF5 C;  1O80 A;  3NHH A;  1TY2 A;  4XQN A;  3IKJ A;  4IUP A;  1SMY D;  3AU7 A;  3FDT A;  1M4V A;  1JQY D;  2NVY B;  3D4D A;  2JP1 A;  3PMF A;  2F0L A;  4C1N K;  3SE0 A;  4R9W A;  5C3W A;  5I2X A;  1A15 A;  4LMQ D;  5LHY 1;  3SK5 A;  4O42 A;  3SDZ A;  1RJT A;  5E4X A;  1SND A;  2ICI A;  1KAA A;  5FKA C;  1G91 A;  1F2Y A;  1GHK A;  2HQE A;  4IFD J;  1LO5 D;  2EY6 A;  1SJE D;  4NW2 A;  1EQT A;  2Q8I B;  1PRT C;  4RWS C;  1XTC D;  1T5E A;  3P1H A;  5F2D A;  3IFD A;  4IUQ A;  3FMC A;  3M3Y B;  1GHJ A;  3URY A;  1JOR A;  2MPM A;  2SDF A;  5C5M A;  1JCK B;  2F0Q A;  3VA7 A;  3T56 B;  3OIQ A;  3WDN A;  4U67 3;  3HP3 A;  1H9M A;  2WB1 B;  3J7Y W;  1AN8 A;  1RKN A;  2IX3 A;  2RSO A;  2F0N A;  4G7H C;  5DNF A;  2SNS A;  2DY8 A;  4RHS A;  1I6H B;  1BOS A;  1EY6 A;  3CRK C;  4K5V A;  1EFI D;  3PUY A;  1E0B A;  2PYK A;  2A6E C;  3TP8 A;  1YNJ D;  1JWM D;  4DK1 A;  1VF7 A;  3DM1 A;  4RAU C;  4KN4 C;  5D14 A;  4ZAI A;  4WJW A;  5CV4 A;  3GV6 A;  2L1B A;  1D6E C;  4DF7 A;  3VYS A;  1TWA B;  1EWH A;  5C44 B;  1F2L A;  5K36 H;  4KY5 A;  1NSN S;  1B3A A;  1I4G A;  5JVH 3;  1V1P A;  1F9S A;  3M7N A;  1HUM A;  2PZT A;  4CHT B;  3QIA A;  3LX0 A;  3TME A;  3IFT A;  1A2T A;  3S2D B;  2E76 C;  2F0U A;  4F87 A;  3DHQ A;  4ILW A;  2NVQ B;  2G9D A;  1DOM A;  2D5D A;  2KEC A;  5TSS A;  2N55 A;  3NTI A;  1R4Q B;  4K2K A;  1WTX A;  2SNM A;  4BS9 A;  1WTO A;  3U9O A;  4C3J B;  3CU7 A;  5NUC A;  2A5H A;  2X69 A;  5JEA J;  1CQV A;  3MZ5 A;  2Z1C A;  2I46 A;  2NWG A;  4GZY C;  1H9R A;  1WCM B;  5KNB A;  1KNA A;  3K5M A;  3SVM A;  2BE5 D;  3V2T A;  2NN6 G;  2KCN A;  2QKI C;  2G9H D;  2X6L A;  4ZQ3 A;  2F0S A;  4YIJ A;  1EOT A;  3NTH A;  1B9N A;  2MP1 A;  3I73 A;  2K6A A;  4ULL A;  4NKL A;  2H1E A;  1OXS C;  3OWF A;  1ROD A;  3BZD B;  3C1E A;  4HED A;  2PPB C;  1HFG A;  1PRT B;  1EL0 A;  5G3L F;  1DOL A;  4O1N A;  3I91 A;  3R3O A;  3N6R A;  1Q3L A;  5FLX E;  4S3S A;  4EQO A;  1HFN A;  5CYU A;  4QF4 A;  2BOS A;  3MWY W;  2BCO A;  5COR A;  2FFK B;  4DXF A;  1STA A;  1RHP A;  3FPU B;  1A3V A;  5CMD A;  4ID6 A;  5IT9 E;  1Q1E A;  3P7J A;  5IGE A;  3J7A F;  3CQZ B;  2M2L A;  2AUK A;  3GTP B;  4XQJ A;  1EEI D;  2AQ1 B;  5IGF A;  1SBB B;  5HGT A;  5M3F B;  5EKI A;  4LAA A;  2B2V C;  1KTK A;  5D65 A;  4G57 A;  4WFN 3;  3L9A X;  2L9H A;  2I07 B;  5CC4 A;  3P20 A;  3DEO A;  5EGT A;  3TZD A;  2VB3 X;  3UI2 A;  2K7V A;  4PQX A;  3OSO A;  4C3I B;  5KEE A;  2IWH A;  1ZKO A;  1CQF A;  3I3C A;  2YU9 B;  4XDX A;  1MSH A;  5EKK A;  1B53 A;  2JEB I;  2FJ2 A;  3EFX D;  1IW7 C;  2O5I C;  3DMU A;  1AFP A;  5JOB A;  4BY7 B;  3TN2 A;  4FYD A;  2VNU D;  2R7Z B;  3OW7 A;  3H0G B;  1STG A;  3JAM E;  1BF4 A;  1F9P A;  1OXV A;  2J0T D;  1QWY A;  2EYL A;  3VR3 A;  4MN3 A;  1STB A;  2F0I A;  4R8N A;  1Y8P B;  1TQO A;  4KN7 C;  1L0Y B;  1T5X D;  2WAC A;  4K5X A;  1NR2 A;  2XWJ B;  4DGZ A;  4H44 C;  2ID0 A;  4KV6 A;  2KHS A;  4KHV A;  2HDL A;  3A7A B;  1PFN A;  3MTS A;  4E6I A;  1SXT A;  4Q5V A;  2KOL A;  1ZYR C;  4KY7 A;  1HA6 A;  3HOV B;  5KIX A;  4OHJ A;  2RKS A;  3U9S A;  1F2M A;  1STE A;  1XXG A;  1SYG A;  4KD4 A;  2JYO A;  3VR5 A;  2KUM A;  1PTO H;  1CHP D;  3DUZ A;  1Z6H A;  5C3X A;  3K0Y A;  3VYU A;  1D1K A;  2F0K A;  2A68 C;  3K5L A;  2KA7 A;  3NWT A;  3K57 A;  1G29 1;  1TWC B;  2F0P A;  4DN4 M;  3M7G A;  4FO2 A;  1PDQ A;  5A2Q E;  3OOC A;  3D31 A;  2CW0 D;  2ICE C;  1QB5 D;  2AWN A;  4HMJ A;  5CBA E;  4FXK C;  1IHZ A;  3RMH A;  4Z9C B;  2NVT B;  4RA8 A;  4OIK A;  3KLS A;  5IIF A;  1GUW A;  1MBY A;  4KK7 A;  1SMY C;  2K05 A;  2E75 C;  2F3V A;  1TKW B;  3I8Z A;  4EQN A;  4A3F B;  4PV1 C;  5M5Y B;  1FNV A;  4IFD I;  1QE6 A;  2A6H D;  3SK6 A;  1L0X B;  2KCC A;  4KKU A;  4UDU C;  4M1U B;  1K8M A;  4CGY B;  4J6H A;  1PTO C;  3I4M B;  1H9S B;  1RD9 D;  4XYQ A;  1CFM A;  3W3A A;  2B2Y A;  4U68 A;  1KDB A;  3I72 A;  1WTQ A;  3E0J A;  3TBI B;  1ZXT A;  3PIP 3;  1VCI A;  3QG1 A;  5C5L A;  2OEO A;  4FNF A;  1S5F D;  3VR6 A;  3Q24 A;  2EY5 A;  4DAY A;  3TSS A;  3R8B A;  2OXP A;  3K59 A;  5DM6 3;  1Y1V B;  2A74 C;  1BCP D;  3SR1 A;  2XRS D;  1EYC A;  3K5O A;  4LK1 C;  5CR3 A;  2PCF B;  5C0X G;  1GUG A;  3CRL C;  4IUV A;  3A8K E;  5C6A A;  2JA7 B;  1G8Z D;  1DXM A;  4KJO A;  5AFW A;  2Z8L A;  1SNC A;  5CV7 A;  1EY8 A;  1I4H A;  2BDN A;  1BQQ T;  1I4Q A;  5FLX L;  2PMZ B;  3FKI B;  4PMB A;  1YNJ C;  4IQZ A;  4FVM A;  1OO9 B;  5IT9 L;  4HCS A;  1TWH B;  1SYE A;  1QJO A;  2K03 A;  5JVG 3;  2Q8T A;  5EPL A;  4KY6 A;  3VR4 A;  1CA5 A;  1HHV A;  4K14 A;  3FPP A;  3LWU A;  1SE4 A;  1GJX A;  1X3Q A;  1HTL D;  1B2T A;  4Q0F A;  3NQT A;  2IT1 A;  2B8F A;  1SE3 A;  4A3G B;  1NR4 A;  2EY2 A;  1LAB A;  2MGS A;  1CK1 A;  4PNY A;  4N9P A;  2DY7 A;  2J4X A;  1D5M C;  2QDB A;  2RVL A;  4BA2 I;  4OIJ A;  4RGO S;  4CKB A;  2XVS A;  1LTI D;  2NB0 A;  1ENA A;  3D3R A;  1AEX A;  2VUM B;  1RF2 D;  1EWC A;  1BDO A;  1UNS A;  2DNC A;  3JAM L;  3P75 A;  4OL7 A;  1V1O A;  1PMR A;  2E2H B;  5C4Z A;  2MUY A;  4PMC A;  2E2J B;  2RDF A;  1EY9 A;  1WVL A;  4V0B A;  5T1G A;  3A55 A;  1OXT A;  3QB3 A;  4HR7 B;  1SAP A;  1YNN D;  1ENF A;  3TP7 A;  1W6J A;  3J81 E;  5ELC A;  2KJX A;  4KHZ A;  1Y8O B;  2C9O A;  2JA5 B;  1EU3 A;  1LLR D;  1PTO B;  2B2T A;  3HOX B;  1FR3 A;  2VXW A;  1SNO A;  2WKD A;  2KQ3 A;  2EYH A;  5KYI A;  1WD0 A;  1JIC A;  3GTL B;  4C1N I;  2A69 D;  3K58 A;  2ZXR A;  2M00 A;  5EBC A;  3N52 A;  1U4M A;  3VA5 A;  2RA4 A;  5LL6 X;  5IGC A;  1LAC A;  1PZI D;  5IOC A;  3I70 A;  3ZYY X;  4DFA A;  4H7B A;  5BN5 A;  5A2Q L;  3HZX A;  5IGD A;  5CV6 A;  5JPN C;  2JSO A;  4C56 C;  2LKV A;  2EYP A;  3C1F A;  5KND A;  1ML0 D;  1M8A A;  1AZP A;  2EJG C;  3GTO B;  1TVX A;  3W2D A;  4DU9 A;  1D5X C;  4IUR A;  1LTT D;  4TSS A;  1JC7 A;  3GV3 A;  4CBV A;  5A35 A;  4RHR A;  1CA6 A;  4C2M B;  2NYZ D;  1FD7 D;  4Y7N B;  3J80 E;  4MIU A;  1OXX K;  1AP0 A;  3H09 A;  3TZU A;  3BYT B;  1Q12 A;  2DN8 A;  3QOL A;  2J7Z A;  1TY0 A;  4X3T A;  1SE2 A;  2NUC A;  4ZLT F;  4DNR B;  1TU2 B;  4RFB A;  2WV6 D;  5C4J B;  5I9O A;  1CHQ D;  1JWU D;  3BDC A;  3BVG A;  1J8I A;  3GTG B;  1GUO A;  2EJF C;  1K8O A;  4R8I A;  1D5Z C;  1F77 A;  2EJM A;  1BUV T;  3HKZ B;  4K5W A;  4HN7 A;  1JB3 A;  1I3Q B;  3SK4 A;  2LFN A;  3KBG A;  1S5B D;  3MXP A;  4K2L A;  2F0H A;  1PRT D;  1LTG D;  4C3H G;  2L11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...