2SNSA

Staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
141
structure length
141
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFNKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THERMONUCLEASE PRECURSOR
publication title Staphylococcal nuclease: proposed mechanism of action based on structure of enzyme-thymidine 3',5'-bisphosphate-calcium ion complex at 1.5-A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 25
structure length 141
sequence length 141
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1982-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2snsA00
2F0FA 4G57A 2F0JA 3MEHA 5ISRA 5F2DA 5C3XA 4R8NA 1IHZA 1U9RA 3SK6A 4YIJA 3SR1A 1JOOA 4EVOA 4KY6A 1A3VA 1STNA 5IGGA 5IGBA 5J39A 1EYCA 4ZUJA 1A3UA 1EZ6A 2SOBA 2HQEA 4KY5A 5HGTA 4N9TA 4HTHA 5KGUA 3P1HA 4KV6A 4IUNA 5KYIA 2LKVA 3H6MA 2F0EA 2O4XA 5HURA 2PW5A 2PQEA 4H7BA 3C1FA 2M00A 4EQNA 1SNMA 2EY6A 3E5SA 4RKBA 3TP7A 4F7XA 5IOCA 1EY5A 1TT2A 1A3TA 2EYPA 1SYDA 2F0QA 5KIXA 3P75A 4E6IA 5CGKA 2EYFA 4QF4A 1JOKA 2EYOA 4B9XA 1KDCA 1NUCA 5I6YA 2F0OA 3D8GA 5IGCA 5E1FA 5CR3A 3SK8A 2F0UA 4DFAA 1A2TA 5EKKA 4DGZA 4KY7A 2F0GA 1II3A 3PMFA 4NP5A 2EY5A 2RDFA 4S3SA 2F0PA 1KAAA 4WRDA 1EZ8A 2F3WA 5CV5A 2F0LA 3NK9A 4K8JA 3TP5A 5KYLA 2RKSA 1KABA 1SYBA 4K8IA 5KEEA 3T16A 1EY4A 3NXWA 4OL7A 2PYKA 2PZTA 2EYJA 2EY1A 2EY2A 1AEXA 2F0KA 4K14A 3SK5A 3RUZA 5I6WA 1EY8A 3BDCA 1EYAA 2SNSA 1EY0A 4K5XA 5EKLA 4EQOA 1SYEA 3NHHA 2SNMA 5C4ZA 5C3WA 3HZXA 3MZ5A 5CV8A 4HMIA 1SYFA 3VA5A 1JORA 2F0MA 5JOBA 3ERQA 5CV4A 5I9OA 3EVQA 3LX0A 3NQTA 3QB3A 5JAVA 4N9PA 1RKNA 4WORA 1NSNS 4EQPA 2PW7A 4MIUA 4K2KA 2F0IA 4K5VA 4HMJA 1ENAA 2F0VA 2F0NA 1SNQA 5IIFA 3SHLA 5M9OA 2EXZA 5C5LA 5CC4A 1JOQA 1SNCA 1SNDA 3OSOA 4K6DA 2QDBA 4F8MA 4B9WA 3D4WA 4DU9A 5J22A 2F3VA 3DHQA 3SK4A 2EYMA 3D6CA 1TR5A 5CV9A 4KTAA 4ODGA 5E3FA 4KD3A 2WACA 1TQOA 5DAUA 1SNOA 4ZUIA 1STHA 4KD4A 2KQ3A 5K5PA 4RKLA 5C6AA 1STBA 2ENBA 3V2TA 3EJIA 2NUCA 2OF1A 3HEJA 4K5WA 4ME5A 4PMCA 1SYGA 2RBMA 5IGEA 1F2YA 1SYCA 4KHVA 4KJNA 3TP6A 2OEOA 4K2LA 4PMBA 3T13A 5KRUA 3MXPA 5EGTA 2EYLA 5C4HA 5CV7A 5IGFA 4NMZA 1STGA 5DEHA 5I9PA 2KHSA 4NKLA 4IZ8A 3MVVA 2F0SA 3S9WA 3QOJA 3QOLA 4ZQ3A 5C5MA 1KDAA 4TRDA 3EROA 1F2ZA 5CV6A 3ITPA 4DF7A 5IGDA 4QMGA 4IALA 1STYA 2F0DA 3C1EA 2F0HA 4KJOA 2PZWA 4NDXA 2OXPA 2EYHA 1STAA 3DMUA 1F2MA 3OWFA 3R3OA 4J1MA 1SNPA 4LAAA 5J1ZA 3TP8A 1EQVA 5IODA 1EYDA 3NP8A 1A2UA 3OMGA 3OMCA 1KDBA 4QB4A 4J6HA 3MHBA 3U9OA 2F0TA 5NUCA 2F0WA 1ENCA 1EY6A 1EY9A 3BDLA 1EY7A 2PZUA 3D4DA 4I65A 4ID6A 3TMEA 4PNYA 3NUCA 3SXHA
chains in the Genus database with same CATH superfamily
3FKIB 4DV0Q 1QNKA 1HQMC 3HOUH 2F3IA 5IYBG 1IHZA 3BZKA 3GP7A 4EVOA 1STNA 1CHPD 1M8AA 4DV1L 3T4AC 1K3BC 4LFAL 4GKJL 3HOVH 2VNUD 3ZJYC 3TBIB 2PNRC 1FJGQ 3BZDB 4ZRZA 1W2BA 4JI0Q 1K8MA 4GOPB 1PZID 1EY5A 2BH2A 5M3MH 4E6IA 1ICFB 4CKBA 2EYFA 3H94A 1JOKA 1JC7A 1KDCA 1NUCA 2E2IB 3SK8A 1BR9A 4JI5Q 2E5LQ 5D3IB 4GLXA 2AMCB 3GTJH 1EZ8A 2OWOA 3SE0A 3I56A 1HNXQ 1N32Q 1WTOA 1S3OA 1SROA 1AEXA 2F0KA 1ZXTA 1B3QA 1V8QA 2VY3A 4IN3A 5EKLA 3HZXA 2KECA 3MA2B 3NQTA 1EL0A 1SSOA 5FLXc 4BBRG 5DM63 2OCEA 1LABA 3CCUA 1AE2A 4RGTA 4JI7Q 2DJGC 3OHXC 4G7ZC 4FYDA 4IPCA 1HA6A 2Z0SA 3J80i 2HHHL 4RGNA 4PG3A 2DN8A 4QGUA 3HOYH 1T5XD 3FRPB 2CH4A 2F52A 1S4ZA 1H9MA 1A63A 4OIJA 3HRZC 3L9AX 3CCEA 1FGBD 1LV9A 1PA6A 4UHVA 2JSOA 3OIQA 4UP8A 3GTQH 4A3BH 1IKMA 1H9RA 4P73A 1VMCA 3C3LA 1MI2A 1Q8KA 2WKCA 1PTOF 1I4GA 3SGIA 4FVMA 3MVVA 2F0SA 4OHJA 1I4HA 1FJGL 2BE5C 1SLJA 4JI0L 1PMRA 1KDAA 1KLUD 1Q7YC 3S2HB 4A3EG 2H5XA 1MKHA 1QILA 3MXNB 4KJOA 1DONA 4L6TB 1B8AA 2ES2A 4JI5L 2EJFC 2E5LL 4A3MG 1W3SA 1GKHA 3Q6SA 1IKLA 1HNXL 3AEVA 1N32L 5I2XA 1CKMA 4RAUC 3I90A 1WTHA 5M5YB 3WDNA 1YNJD 2N78A 2WB1G 5IYDH 2G9HD 1QVFA 1K0RA 1LTAD 5KYIA 4CDEC 2K52A 1SR3A 2WAQG 2L0CA 4JI7L 2K7VA 2YTYA 1GOZA 4A3FB 5LMNW 4JOIA 1B70B 3KUPA 4DV2Q 1NCVA 3J80L 1WFQA 2ZTDA 4QIWB 2HUGA 2B8FA 4IPHA 2XN9C 1KAAA 2RDHA 3I7FA 5C4JH 3HOWG 4B3RQ 5C0XJ 3K7UC 2PZTA 3CD6A 2A6HD 1XJVA 4A3GB 2K5VA 5FOBB 1BOSA 4BS9A 1SMYC 4IUPA 4V0BA 2EJMA 5C4ZA 4WFN3 4XYQA 1UWVA 3U58A 2I5HA 4QUFA 1YITA 2EJGC 3AU7A 4JPBW 1MSGA 3J81j 1I3QB 2QEXA 1F77A 2K5DA 4GN4B 2VXWA 5ELOA 2F0IA 1FR3A 1VCIA 3A0JA 3VYTA 4X66Q 5BN4A 1BCPC 1JCKB 2HD3A 3S1MB 2NBFA 4C3JG 2HT1A 3DEPA 4KD3A 1Y1VH 1SBBB 1Y69U 5D65A 4PMBA 1SE8A 2DGYA 4DUZQ 1GM5A 5EGTA 2EYLA 5CV7A 2B3GA 2PQAA 1LTGD 1NJIC 1DOMA 1GO3E 3C1EA 4DV2L 1HXYD 5IY0A 1I94Q 3OWFA 1DZ1A 3L2PA 2TSSA 1IBLQ 4IOAA 1CI3M 1XTCD 2JXMB 1X6OA 1VQMA 1JMCA 4DR4Q 5JPMC 1EY6A 3H09A 4U673 1TY2A 3I4NH 2OTLA 2HCIA 3TREA 4UP9A 2LFNA 3J80c 1Z9FA 4XQQA 1EIFA 4IPDA 1DCZA 5C44G 1JWSD 2QKIC 1N33Q 2ASBA 1YZ6A 1VQJA 4BY7G 1CKOA 4ZUJA 5HGTA 2M2LA 2SOBA 3BYTB 3A7AB 5ELNA 3M7NA 2K5NA 2BA0A 4JI2Q 1V1PB 2F0EA 2B2VC 3KBXA 4PZ7A 2RHQB 4TVAB 1UEAB 4C3HH 1Y1WB 4AYBE 4X66L 4OX9Q 2EYOA 4DK0A 3AFPA 4C2MB 4DGZA 3UDFA 2K5WA 1CKNB 4DV7Q 5M3FB 1XNRQ 3LGJA 5JJIA 2D9UA 1B2TA 2EY2A 2D2CC 1XNQQ 3FMCA 4DUZL 3F1ZA 1EY8A 2F1MA 2JA8G 2Q2HA 2VUMH 1EIGA 2CHBD 1YNXA 3E0EA 4OO1G 4GOPA 3PV0A 1Y14B 3FKIG 1JWUD 2E2HH 3HOZH 4A3IB 4O2DA 3B6YA 4K5VA 3IFDA 4R8IA 2F0VA 1I94L 3SHLA 1HTLD 1IBLL 4LNQA 3RZOB 1JOQA 2JA6G 4KHPQ 4DR4L 1IW7D 2Y0SG 1TS4A 4EGVA 4MTKA 4IJLA 2JJQA 2NZ1D 1VMPA 1GJXA 1STHA 3T1YQ 1YNND 2ENBA 2XIWA 2KCTA 2Q2IA 4FXGC 2R7ZG 1N33L 1IBMQ 1A62A 2R7DA 4Y7NB 1BCPB 1AP0A 4U68A 5IGFA 5C4HA 1WCMB 3PO3H 4LFCQ 5IT9L 2GVBA 1T5EA 2VB3X 3Q8DA 4JI2L 1N8RC 1VQ6A 1SJED 3M4OB 3EROA 1D2BA 3JAME 3ITPA 1E24A 4IJHA 3GQBA 3PSIA 2EYHA 3I2ZA 3HS0C 1OXXK 1RTOA 3OMGA 4B3TQ 5KNCA 5GAHC 2EOTA 1PH3A 4IPGA 5JEAJ 4QQBX 4DV7L 3P20A 1MD2D 3GTKB 4ZYSA 1XNRL 4R4TA 2NVTB 1IBKL 4JOIC 3STBC 5ISRA 3NBIA 2AQ1B 4A93G 1CM9A 1QVGA 1K28A 2XNAC 1JOOA 2D5DA 3AFQA 1HPCA 1TWFB 1OXTA 1KAWA 1LACA 2F4IA 4IUNA 1I4RA 3S17B 1V1QA 5IOCA 3TP7A 3RLOA 1TWAB 1CQFA 1A3TA 1O7LA 1TS3A 1NMFA 4IUTA 4QF4A 1DYQA 5I6YA 1F9QA 3NQIA 4KHPL 4YWLA 4DN4M 2J4XA 4BBRB 2EY5A 1B44D 1AW7A 2F0LA 4R4QA 5JPNC 4IQZA 3T51B 3T1YL 3AMUA 2IL8A 1O80A 2KCCA 4OL7A 3A56A 1RJTA 1IBML 2I5LX 1IYJB 1L0YB 1AFPA 3S15B 2SNSA 4LF8Q 2N3SA 4LFCL 4DKAC 4C1NI 2H4OA 1UE6A 2ZTEA 5I9OA 2QDLA 1HR0W 3Q0AA 1GUOA 1I4QA 1XMOQ 4HMJA 5IT9c 4HIKA 5IYCG 2I0QA 3CRKC 1PLFA 3DEOA 4GS3A 1SNCA 4B3TL 1K83B 2YYZA 3J81L 1HZBA 2FXQA 4A3EB 1NE3A 2B29A 3CC7A 2PI2A 1QE6A 2I5MX 3DXJC 1DOLA 4XYOA 2FMMA 4ZLTF 4K0KQ 5FKAC 4A3GH 2OEOA 3HKZG 3I73A 1SE4A 4ZKCB 4IFDH 2NN6G 4A3MB 2Q8TA 2DY8A 2CQAA 4OXPA 2DUDA 4MHEA 3KJOA 1PH5A 1STYA 3FVQA 3U4ZA 4ULLA 4BXXG 2WB1B 2A74C 1Q1BA 1STAA 4YHHQ 4DK1A 2BOSA 3A8KE 2IX0A 3WOFA 1VQHA 4C3IG 2L11A 5KNBA 1JB7A 3N52A 1P8LA 3K7AB 1RCVD 1EOVA 2F0FA 3DWPA 4OELB 4A3JH 2MO1A 5I4DA 1TWGB 1K8GA 4LF8L 1DOKA 3J80E 3ULPA 4A3DH 2O5JC 4KKTA 5T1GA 4HTHA 4X3UA 1ILQA 1E3PA 3HOWB 2MO0A 4YY3Q 4A3LH 2PPBC 2E2JB 2EYPA 3BVZA 2B2WA 2CW0D 5CGKA 4LW1A 4HN7A 3BZCA 3URYA 3LNNA 3FHWA 3K0XA 2C5CA 4GOPC 3OW7A 3VYRA 4CHTB 3S9WA 4WRDA 1BUVT 1PRTD 2DNEA 3NK9A 4KKUA 5M5XB 2XWJB 4UDUC 5FLMG 1RTNA 4OWTB 1VQ7A 4K0KL 1LTRD 3I70A 1HFGA 2RVLA 2AHOB 3QJYA 5C4XG 1SRUA 2WFWA 4C3JB 4HMIA 4GLVB 3H0GH 1RKNA 3SDZA 4EQPA 3HOXH 3CPFA 2P5ZX 4CDCC 2ZXPA 4L5TA 1Y1WH 2F0NA 1LO5D 4YHHL 5C5LA 5CC4A 5JVG3 3RD4A 4K6DA 1Q12A 4F8MA 1CKNA 4C2MH 3DHQA 2A73B 5M3FH 3MFYA 5K5PA 5C6AA 4Z9CB 2A8VA 2M9VA 3HEJA 1CA6A 3V05A 3TP6A 1QWYA 4K2LA 3T13A 2MNAA 1F9RA 5I9PA 5E4XA 4NKLA 2PQAB 3S16H 1MHWC 2PCFB 3PGZA 5C3EB 4BA1I 4DUYQ 4KN7C 5K36H 4YWKA 2EQSA 4YY3L 4TKOB 4IOCA 3A54A 4IALA 1ESFA 3CP0A 3RR5A 4XXEA 3J7A5 2VZAA 2OXPA 1I5FA 4HJ5A 3TQYA 1WTWA 4BY7B 5HY6A 2AQ3B 4LF5Q 3NP8A 1JJGA 2LY7A 4QB4A 2ICEC 4A3IG 1QUQA 5GAGC 5FLXL 2RHSB 4UPAA 1ASZA 2EIFA 1E2ZA 4OONA 1DXMA 3CF5A 1F9PA 2QILA 3SR1A 4Y7NH 1V9PA 3EN2A 5J39A 1RF2D 5LMUQ 1PH9A 3VR2A 4FF4A 1TWCH 3M3YB 3E9HA 4N9TA 4NXMQ 1EWHA 3KLRA 5EPJA 1SDFA 4R9WA 2OQKA 3RLFA 3NWTA 1OTCA 2L55A 1SFOH 3QO2A 4XDXA 1Z47A 3D8GA 3C46A 2AKWB 1HA5A 2F0GA 4DR2Q 4UY8C 3MXUA 3GV6A 1HNZQ 2MJ8A 5KYLA 4HEDA 3W1GA 4HSVA 4HIMA 1K0SA 4DV6Q 1GHKA 1SN8A 1WJJA 2PYKA 1WTRA 3SK5A 1IYVA 3GTOH 2JA6B 1Q3LA 4H44C 1NBWA 1ENFA 2J7ZA 5C3WA 2Y0SB 1X3GA 1XX8A 5EAYA 4FDBA 3F2UA 4ALPA 3CCSA 4DUYL 3EVQA 3LX0A 3BU2A 3QB3A 1O78A 4YCUA 1PH7A 4OEMB 3S17H 2GN5A 4DNIA 3L3OC 2R7ZB 1HCZA 4Y52H 4BA2I 4EQ5A 3CCLA 4JBMA 3U4VA 4LF5L 2QDBA 4Q5VA 2R92H 4P2CB 2B2VA 2O2LD 2RCNA 3D31A 4B9WA 1Q1EA 3KYHC 1S5DD 1AZPA 1CZWA 4MTNA 5IT9E 1I50B 4KTAA 3H15A 3GTMH 4HJ8A 2LSSA 1STBA 2NZOA 3I72A 4A3KG 5ELDA 4ME5A 4BBSH 4TSSA 1KQSA 3S1QB 1E0BA 1F2YA 1G2TA 1BVSA 3KDFA 1SEBD 1PFMA 4FF3A 1PRTF 4DV3Q 5LMUL 3AYHB 2A6EC 3S15H 4NMZA 5DEHA 3K57A 2KHSA 4NXML 3QOJA 2YTVA 3F8TA 1BNZA 3ERSX 1EIHA 3K59A 1QZHA 4A93B 3X3MA 2WV6D 1K3RA 5BN5A 4IFDI 5J1ZA 1EQRA 1EYDA 3OMCA 1C4QA 3PF5A 2R61A 3Q24A 4DR2L 4DV0L 2G9DA 3W1BA 1HNZL 2QCPX 1B50A 2JYOA 2XTIA 3OOCA 4DV6L 5C3XA 2B2WC 1GVPA 4DNTB 3GTLH 1V1OA 1D7QA 1VQLA 1U9RA 1IZ6A 2EZVA 4KY6A 1E2WA 3VR4A 1LTTD 3GTGB 4A3CG 1C9OA 1EZ6A 4A3MH 1LTSD 5KGUA 2LKVA 2O4XA 4AH6A 4APVA 3KFUA 1C0AA 5CBEE 3E5SA 1PTOC 3HOYG 3CMAA 2D62A 2CCZA 4C1NK 2X6GA 2FINB 4LUVA 1SXTA 1WI5A 1MIUA 2YU9B 4WJ3M 1II3A 4FXKC 4P72A 5JVH3 1R9TB 2V4DA 3K7AH 3T16A 4R1JA 2MGSA 1QG7A 3T53B 2PMZE 1BXTA 1WD0A 2UXBQ 4AYBG 1EWIA 1WTVA 4B3MQ 1K8OA 3O13A 4BY1H 2K1BA 3HG9A 3FEWX 4DV3L 3R93A 4FO2A 1SYEA 1UE7A 1HNWQ 1K9MC 1HUMA 4WJ4A 5JOBA 1L0WA 2KVMA 4LUZA 2B63H 1EWCA 4FXDA 2FMCA 4N9PA 3HOWH 1PFSA 3J81E 2EE1A 5J3BA 1KIXA 3HKZB 1U4MA 3TEHB 2EXZA 2I07B 4DXGA 5C0XG 2ZXOA 1LM0A 1L1OB 3K6OA 4ZCKA 1A8VA 2EYMA 2PO4A 3MWYW 3GTPH 3D0FA 4CDDC 5DAUA 5M5XH 2HQLA 3BG3A 4RCNA 1PZJD 5IP7G 3K58A 4KJNA 2JA7B 1VQ4A 2CWPA 4OIKA 4C3IB 4C3JH 3OWEB 1LTBD 3S14H 4HIDA 1CSQA 3CQZB 1A2UA 2RA4A 3STBD 3EQLC 2E2DC 1GXDC 3R2IA 1YVCA 2UUAQ 1Y8NB 3E9IA 2IX3A 4G57A 2UXBL 3CKIB 3G71A 2B2TA 4B3ML 1H9JA 3K5MA 1G2SA 5JJKA 3KF8B 1W6KA 1ET9A 5G3LD 3D6WA 4JVZA 1HNWL 1EYCA 2Z4HA 2KUMA 4YWMA 2NVQB 3H3VC 1LT5D 1MSHA 2SEBD 2PQEA 2L15A 1HUNA 5BR8Q 1ML0D 1VDZA 5C44H 4X3TA 1IL8A 4IUQA 3G48A 1YHBA 1CUKA 4JCVE 4MNOA 3FPPA 1FVIA 5EBCA 4BY7H 5C4XB 5C3EG 1Y1VG 4AIMA 3NTHA 4I7ZC 3S1NH 4B3RL 4GKKQ 3PMFA 4HR7B 4RG1A 4S3SA 2Z6KA 2RKSA 1PTOB 4ABNA 3K81C 4KK7A 1EY4A 3W2DA 1I4PA 1VQIA 4LWCA 4JI1Q 3WOEA 2I46A 1SAPA 4FF2A 2CKZB 1VQFA 1EU3A 2SNMA 3M85A 3M3YH 1VQGA 1JICA 2LS01 3PO2G 1HZCA 1TY0A 3CCJA 1UAPA 5FJ8G 1A0IA 1ILPA 2R93G 2Q2UA 3DLLA 3KBGA 3OTOQ 4O0AA 2JA8H 1TWHH 1ZYRD 3ND8A 4ILWA 4OO1H 1J6QA 1TXYA 1G6ZA 4LUOA 3FKIH 5M5WB 3D6CA 2Z8LA 2UUAL 1PYSB 5EBDA 1QNUA 2WB1E 1XXGA 1S5FD 3VR3A 2CQOA 2JA6H 5FO9B 1X56A 4PZ8A 2G5DA 5DM73 5LMNQ 2WAQE 5EPLA 4RHRA 1HH2P 4DV4Q 1KRTA 5BN3A 3Q22A 3RZDB 3F2CA 5FLXE 4GLAC 4DAYA 2R7ZH 2E2IH 3CU7A 2OQ0A 2F0HA 3V96A 1JWMD 4NDXA 1YNJC 4P75A 1LT4D 3TP8A 2IY5B 5IP9G 1ONLA 4J6HA 2A69D 1JJ2A 4GKKL 1NY4A 1QUQB 5NUCA 4H02A 2K75A 4XQJA 2VUMG 4CGYB 3QG1A 4J8QA 2K50A 1KNEA 1RODA 4JI1L 4YIJA 4DPGA 1WOCA 1BBXC 2J0TD 2AUKA 1A3UA 4G7HC 3NTIA 1YJNA 2JE6I 3U50C 2A1AA 1D8LA 4DV5Q 1X55A 4L8JA 4OX9L 3PUYA 5TSSA 4CJ0B 1QZGA 1H95A 3M4YA 2Q8IB 1TT2A 5JEAG 4A93H 2A6HC 3OTOL 1WVLA 3I4MB 1R4QB 1YEZA 4P74A 3RN2A 1WTPA 5EKIA 5D3DA 3S2DB 4L63B 1Q82C 4DR6Q 2NVXB 1XNQL 1XMQQ 3KLWA 2E74C 4K8IA 1L0XB 1CZGA 4K14A 2LXJA 4DK6C 3R2TA 4ZAIA 2IWHA 2XRSD 3GTGH 2R7FA 5LMNL 1XPRA 3NHHA 4DAVA 3S2HH 3HOUB 4DV4L 2F0MA 5EJWA 4A3KB 1NSNS 5G3LF 4EX5A 3HOVB 1OXSC 2RSOA 2H1EA 2L9HA 1TIID 5M3MB 1HFNA 2A68C 2FFKB 1TR5A 2HCCA 5M5YH 5JAVA 2WACA 4QCLA 2KQ3A 4RKLA 1O7IA 3UDIA 1Q8IA 2CWAA 3MTSA 5IYCH 2XRQD 3KDFB 1X9NA 3CXCA 1PH6A 3Q23A 2K33A 2VL6A 3DUZA 5KRUA 5HGQA 1KNAA 4DAPA 2EVBA 1S5BD 3EIVA 4A3FH 2F4VQ 4M1UB 2B8GA 4LF6Q 1LTLA 4JYAQ 4A75A 4F88A 4FNFA 5CV6A 5GQOA 4FP5D 2B2TC 3BDOA 2QEJC 2JA5G 1FNUA 2N8NA 3DMUA 3R3OA 4CJ2C 1L1OA 3HGBA 2NN6H 1EQVA 1BO0A 1KDBA 1VQOA 2WINB 2F0TA 2F0WA 5AFWA 3OIPA 4DR6L 1EY7A 3HOYB 1HQRD 4KLKA 4KI0A 3KJPA 4BXXH 3BVMA 4GNXC 1EFWA 2JEAI 3NENA 4R8NA 3TDQA 1J5EQ 3UI2A 1J9OA 2D0PA 1I3QH 2RDGA 4A3BB 4A76A 4C3IH 4AQYQ 4X3SA 1C7YA 2Z6KC 5HURA 4EQNA 4AYBB 4ZKBB 2JA7G 1VQEA 4L5QA 3NPPA 3S1MH 3NWSA 4NW2A 4XQNA 3GD7A 4DR5Q 2F0OA 3QWNA 3IFTA 3J7AV 1VQNA 1SMXA 1C8CA 5CV5A 1FL0A 1SE2A 4UAIA 1PVOA 1QOHA 2BH8A 3I8ZA 4HCEA 3KF8A 1YBYA 1EOTA 4IFDJ 1U4LA 5CMDA 1KTKA 3TRZA 3NBHB 5I6WA 3CC2A 3LWUA 2GVAA 2IT1A 4YCVA 3KF6B 3M9BA 1IW7C 1XMOL 2F4VL 4LF4Q 4LF6L 5FK9C 1GUWA 4QJFA 4IURA 5FLMH 1YNNC 2JP1A 2XWBB 2UXCQ 1B53A 1QCBD 4O1NA 5T1IA 4GN3B 5C4XH 2ICIA 3HP3A 2JQOA 1ICWA 3HKSA 3CMEA 5L37A 4ODGA 4A3JG 3ULLA 1FD7D 3V2TA 2OF1A 4A3DG 1PV4A 2K01A 1VQDA 1J5EL 3CW2C 4GN5A 1TKWB 5C4JB 1GUSA 4OO1I 2ID0A 1STGA 5LL6S 4A3LG 4AQYL 1XTDA 3X3NA 5IGDA 3VR6A 4A4IA 1WTQA 4RKBA 4F87A 2ZJPA 2VQFQ 3DWAA 4UP7A 3MHBA 2BDOA 4MN3A 3BDLA 1X3PA 4PQXA 2BE5D 3D4DA 5M5WH 1P16A 4PNYA 3NUCA 3SXHA 3DM3A 2L4NA 2F0JA 3MEHA 3L0OA 1LTID 3JAMi 1HR0Q 4CKEA 1Y1VB 3SK6A 5LL6X 4JI6Q 3VR5A 5IGBA 5IGGA 3H0GG 3I4LA 1AH9A 1BBUA 3E0JA 2HQEA 4KY5A 2VS1A 4A3IH 3P1HA 4LF4L 1U0LA 2KBNA 1F2LA 1U5KA 3SVMA 2PW5A 4DAMA 3RZDH 1D1IA 3MXGA 2UXDQ 1PZKD 3RZOH 1H9SB 3PCOB 4GNXB 2UXCL 2B2YA 3P75A 1VQ8A 4CJ1B 1PFBA 1VF5C 4JV5Q 5E1FA 3PO2B 2MHVA 2RDFA 4QIWE 3TP5A 3HKZE 5H1SE 4JI4Q 2R93B 2KA7A 4DA2A 1WCMH 3I4NB 1JT8A 4DR3Q 5K36G 3M4OH 5ELEA 2PI2E 2V1CC 5IYBH 3ERQA 1X54A 2K14A 4O42A 1QVCA 1BKBA 2N88A 3S24A 1VQ5A 2NB0A 2EPBA 2WIIB 4K2KA 1SNQA 1GUTA 2VQFL 1G8ZD 4HJ9A 4HSPA 3NTKA 3OSOA 1SMYD 2NVTH 3GTKH 4C3HB 2DNCA 3H3VH 2NVXH 1N9WA 3I4MG 1B3AA 1TWFH 2NUCA 4HJAA 2R3ZA 1HR0L 1GUNA 4JI6L 1L1OC 2BA1A 2K32A 1X65A 1SE3A 1OXUA 1BCPD 5DLQE 2NWGA 1OXVA 1E7ZA 1DJRD 4RCOA 1TWAH 3M4PA 3M4QA 2VUMB 1B9NA 2UXDL 4DAYB 4A3KH 1F2ZA 1XWEA 4B3SQ 1FNVA 4J1MA 4BBRH 2ZXRA 3HOUG 2E2HB 1WTXA 3HOZB 4JV5L 4NB3A 5CYUA 4IUVA 1H9KA 4X6AH 2PNHA 1ENCA 4ID6A 4RH6A 3HOVG 5JJLA 1GHJA 2PZUA 2KEEA 4JI4L 2K04A 3E3XA 1EFID 3A5ZB 3U9SA 2HIVA 1HRJA 1CSPA 2CW0C 3VA7A 2NN6I 5M3MG 4DR3L 1A3VA 3CRLC 2Z6BA 5D14A 1IL2A 1I6HB 1HTPA 2KCNA 3DWQA 3PIP3 1PRTC 2QA4A 2KJXA 3QIAA 3P7JA 2M00A 2IJ0A 4OGQC 3PO3B 4Q0FA 2FJ2A 1K83H 2R92G 2NVYB 2CVRA 2VQEQ 3T1HQ 4A3CH 1UUPA 4A3EH 2MUYA 1ASYA 3A7LA 3E6ZX 4DFAA 1MGSA 1VQPA 1A2TA 5EKKA 4KHZA 3G4SA 3OW2A 4BBSG 4C56C 4K8JA 1B9MA 2WKDA 3TZDA 2KHJA 4HCSA 3OYYA 1PH1A 4G4KA 1V43A 1EY0A 3CHBD 1LUZA 4RGOS 1SYFA 1YHAA 1VF7A 1JJCB 5CV4A 1Q46A 2AQ2B 3JAMc 4H13C 4LMQD 4B3SL 2JA9A 5A2QL 1HHVA 1M1KC 2TMPA 4ZK9B 1VQCA 3TS0A 4A3BG 1YHQA 1SNDA 1CA5A 2SDFA 3D4WA 5J22A 1PH8A 1LT3D 2IX1A 1LYLA 1OO9B 1PYBA 3ULJA 3FDTA 1TWGH 3D3RA 3NBHA 2RQXA 2JA5B 3EJIA 3UE0A 4PMCA 1BF4A 2IPKD 5IGEA 3KF6A 1DGSA 4CKCA 5C0XH 5IE8A 1D1KA 3MFGA 4IO9A 4P71A 2KEDA 1KLGD 1IYUA 4IZ8A 1NR4A 2E2JH 2XGTA 1NMGA 2LMCB 2YTXA 2ALYB 4RMFA 5IP7H 1I6VC 4LJZC 2EXDA 4R4CA 5KNDA 2K4KA 3T1HL 2VQEL 1FYCA 4QY7A 1E1TA 5IYDG 3CPWA 4HJ7A 3A5UA 1Z6HA 4BY1G 1AE3A 3I3CA 1TS5A 1S5CD 1EU4A 3CC4A 4X65Q 1X3QA 2B2YC 4YCWA 1CFMA 2B63G 4H0LC 2WP8J 1C48A 4POGA 2YV5A 3G7LA 4KV6A 1B1ZA 3A55A 3TSSA 4LF7Q 3RN5A 3C1FA 1SNMA 2EY6A 1J8IA 1EQQA 1BCPF 4XTCS 2D0OA 2C9OA 5GADC 2Z4IA 3FPUB 2VW9A 3AB9A 1Q90A 1KD1C 1KRSA 5A35A 1PRTB 4KKSA 2X69A 1KABA 1JR0D 4JBJA 1CHQD 3NXWA 4I7AA 3C2PA 1U4RA 1A6XA 1UNSA 4PMWA 4XT1B 5FO8B 5C3EH 4L5SA 4N8X1 3UE1A 3RNUA 3ZYYX 3MZ5A 1JORA 1G291 4JC0A 1MBYA 1H9SA 4GNXA 4A3JB 5IWAQ 1KXLA 2QW7A 1D5ZC 1X3EA 4A3DB 1X32A 3CCRA 4JI3Q 1EUJA 2A68D 1QB5D 4J15A 3IAYA 5IIFA 1JE5A 1RIPA 1N36Q 3PO2H 3NSWA 3K5NA 2UUCQ 2K05A 1YJWA 4DK3C 5FJ8H 3S1RB 5E3FA 2K6AA 3I4OA 1SNOA 4KD4A 2R93H 4X65L 4DXFA 2A5HA 2NYZD 3PIO3 4K5WA 3H91A 3D4RA 1PXUA 3MEFA 2K5QA 2E75C 3N6RA 3H3VI 2GA4B 3MAQA 4RFBA 2BCOA 1UEBA 1E22A 3QOLA 4LF7L 1D5MC 5AJ3Q 3I4NG 2Z1CA 2Z9HA 4DF7A 3EBEA 3ND9A 3BYYB 1M90C 4POFA 3IL8A 3H0GB 2E8GA 1SNPA 4ME3A 3HOXB 3G6EA 4JG2A 1CK1A 1T9HA 1VS0A 2L12A 3U9OA 4X62Q 3UDGA 3TMEA 1HZAA 1RDPD 4NXNQ 3K80C 1O7ZA 3KK7A 5EQ0A 3F2BA 4C3HG 5IP9H 1S40A 3PUWA 1XPUA 1IBKQ 1K8AC 3BS1A 2ZTCA 3W5OA 5BR8L 5IWAL 1HJPA 4H7BA 4G7OC 1Y8OB 3A8JE 3S16B 4JI3L 3PQIA 4LK1C 1MJEA 3J7YW 5KIXA 2MP1A 1BQQT 1N36L 1I50H 5IGCA 1S72A 2KENA 3KLSA 2UUCL 2CH4W 2PMZB 2F0PA 3S1QH 5JEAH 5KEEA 4DR1Q 1VQKA 3RMHA 3NEMA 1FGUA 3HOZG 1MJCA 1TU2B 2C35B 2K5HA 2FHTA 3NELA 3VA5A 3ICEA 1I6HH 2IW3A 3RLNA 4HIOA 1JQYD 2JEBI 5AJ3L 3QR8A 3GV3A 1TWCB 2MPMA 4PZ6A 4X3KA 3WWVA 3K5LA 2HDLA 1N34Q 2B2UA 2NVYH 2K28A 3A74A 4JK1C 3SEBA 5M9OA 1NAPA 2EDGA 2N55A 4N8FA 2UUBQ 1O7YA 1R4PB 4DU9A 2F3VA 3GDEA 3IRBA 4X62L 1SFOB 3PO3G 4LFBQ 1I4XA 4X64Q 2NTTA 4TQUS 1ZEQX 4NXNL 1GD7A 1D6EC 1L2FA 3J81i 3KOJA 2ZJQA 1SYGA 2RBMA 1EEFD 4LF9Q 1G6PA 3J7ZC 4RGMA 1YI2A 2X6LA 3GTOB 2HIXA 3CCQA 2JK8A 5I2YA 2AWNA 1STEA 1PHJA 1WD1A 1EQTA 4CBVA 2QF7A 2YU9H 5C0XI 4NP5A 1VQBA 4FF1A 1F2MA 3PUZA 3MXNA 1EYGA 3M7GA 1R9TH 4V190 2A19A 3VYUA 1FNWA 2IHEA 3KLSX 4I65A 3GTJB 2R92B 2DJFC 1JE4A 4DR1L 1DD2A 1DM0B 2JA5H 5F2DA 4DR7Q 3GTMB 4DV5L 3PIPA 4DNRB 1XPOA 4BBSB 2OT2A 1E2VA 2F03A 1CTMA 1BBWA 2Q2TA 3CCVA 1N34L 3NE5B 1SYDA 4JBWA 2ZT9C 1G91A 3T56B 2OTJA 1HZ9A 2VB2X 3PUXA 1NTGA 4OWXB 1XMQL 2UUBL 4RA8A 5CR3A 2F0UA 4KY7A 3R8BA 3ONAB 4LFBL 1XYIA 1RD9D 1RHPA 4X64L 4QL5A 2JA7H 1CQVA 5CBAE 1UE5A 2CFMA 3GTQB 3BJUA 3K0YA 2EYJA 2EY1A 1TVXA 4LF9L 2Q8RE 4RHSA 5A2QE 4A3FG 3EFXD 1EEID 1ZYRC 2E76C 2IHFA 1EYAA 4K5XA 4EQOA 1B4OA 3TN2A 3AQQA 2XSCA 3GTLB 3UDXA 1PDQA 3CQZH 3L7ZC 1B7YB 4XIGS 2L5TA 2Y0SE 4WORA 2PW7A 4MIUA 3MC0B 5ELBA 1Q81C 4KMUC 1X3FA 1Y8PB 2B39A 4A3GG 1IXRA 4IFDG 2NTSA 3SK4A 3OPOA 1G51A 2AUJD 3HFZB 5E4WC 5CV9A 3TS2A 4ZUIA 3FP9A 1PH4A 3TZUA 4DR7L 2K03A 1SJHD 5EPKA 2WAQB 2NVQH 2L1BA 4JYAL 2QGQA 3IKJA 3MXPA 4CDFC 4OWWB 1BDOA 2A69C 4JI8Q 4BY1B 2ATWA 3EA6A 4L5RC 4HAEA 3JC66 5CORA 2AWOA 5C5MA 1ESRA 5DNFA 4QMGA 2MFIA 2F0DA 2RSNA 4R4IA 2B63B 3DM1A 2BDNA 3GO5A 4NPSA 3G6JB 4LAAA 5IODA 2RF4A 2A6ED 4QUCA 4XT3B 1PTOH 4R4OA 2ZM6Q 3PF4A 2XVSA 1EY9A 3S1RH 1Q86C 3F2DA 2JN4A 4M8AA 3A8IE 2UU9Q 1AZQA 1D5XC 3GTPB 1Z7TA 5ELFA 1KC8C 2DY7A 4K6LA 4BWGB 1PYWD 5GROA 1LT6D 2RCFA 1AN8A 3CAMA 3H6MA 3J81c 3K5OA 4PV1C 1GUGA 1V1PA 4F7XA 4DR5L 1RL2A 2F0QA 3S14B 4B9XA 1NNXA 1TS2A 5FO7B 3J7AF 4JBKA 4IUUA 3BVGA 2F3WA 1SYBA 5LHY1 1PTOD 1U4PA 2B2UC 3HOXG 5COYA 3RUZA 1Y1WG 1QJOA 3BDCA 1YJ9A 1W6JA 4DV1Q 1VQAA 4JI8L 5CV8A 4LFAQ 4GKJQ 2ZJRA 2MQHA 1E1OA 2HDMA 2KCMA 2O5IC 3PUVA 5M3FG 1JB3A 1ENAA 2N49A 4WJWA 1ZKOA 1K73C 4RWSC 5C44B 2ZM6L 3I55A 3PIOA 1TQOA 3ER0A 1CT1D 3S1NB 4B08A 4GZYC 4MZ9A 1PFNA 1ET6A 5E7NA 2UU9L 1PH2A 3CCMA 3W3AA 1SYCA 3K8AA 1KHIA 4KHVA 5JJZA 1EIYB 4KN4C 2LXKA 3VDYA 1S5ED 1NR2A 3LWEA 3I91A 2R6GA 1KL9A 3I4MH 1LLRD 4ZQ3A 4TRDA 5ELCA 3VYSA 1WYDA 3S2DH 1YIJA 2PZWA 1F9SA 2KHIA 5GAEC 2HHHQ 1VQ9A 1WCMG 2JA8B 1TWHB 2NZHA 2KOLA 1M4VA 1A15A 4JW0A 3JAML 1UE1A
chains in the Genus database with same CATH topology
3FKIB 1QNKA 1HQMC 1IHZA 3GP7A 4EVOA 1STNA 1CHPD 1M8AA 3T4AC 2VNUD 3TBIB 2PNRC 3BZDB 4ZRZA 1K8MA 1PZID 1EY5A 4E6IA 4CKBA 2EYFA 3H94A 1JOKA 1JC7A 1KDCA 1NUCA 2E2IB 3SK8A 1BR9A 5D3IB 1EZ8A 3SE0A 1WTOA 1AEXA 2F0KA 1ZXTA 1V8QA 4IN3A 5EKLA 3HZXA 2KECA 3MA2B 3NQTA 1EL0A 1SSOA 5DM63 1LABA 4RGTA 3OHXC 4G7ZC 4FYDA 1HA6A 4RGNA 2DN8A 1T5XD 3FRPB 1S4ZA 1H9MA 4OIJA 3HRZC 3L9AX 1FGBD 1LV9A 2JSOA 3OIQA 1IKMA 1H9RA 1VMCA 3C3LA 1MI2A 2WKCA 1PTOF 1I4GA 4FVMA 3MVVA 2F0SA 4OHJA 1I4HA 2BE5C 1PMRA 1KDAA 1KLUD 3S2HB 1QILA 4KJOA 1DONA 4L6TB 2EJFC 3Q6SA 1IKLA 5I2XA 4RAUC 3I90A 5M5YB 3WDNA 1YNJD 2G9HD 1LTAD 5KYIA 2L0CA 2K7VA 1GOZA 4A3FB 3KUPA 1NCVA 3J80L 4QIWB 2HUGA 2B8FA 2XN9C 1KAAA 2RDHA 5C0XJ 2PZTA 2A6HD 4A3GB 5FOBB 1BOSA 4BS9A 1SMYC 4IUPA 4V0BA 2EJMA 5C4ZA 4WFN3 4XYQA 4QUFA 2EJGC 3AU7A 1MSGA 1I3QB 1F77A 2K5DA 2VXWA 2F0IA 1FR3A 1VCIA 3VYTA 5BN4A 1BCPC 1JCKB 3S1MB 2NBFA 4C3JG 3DEPA 4KD3A 1SBBB 1Y69U 5D65A 4PMBA 5EGTA 2EYLA 5CV7A 1LTGD 1DOMA 3C1EA 1HXYD 3OWFA 1DZ1A 2TSSA 1CI3M 1XTCD 2JXMB 5JPMC 1EY6A 3H09A 4U673 1TY2A 2HCIA 2LFNA 4XQQA 1DCZA 1JWSD 2QKIC 4ZUJA 5HGTA 2M2LA 2SOBA 3BYTB 3A7AB 3M7NA 2BA0A 1V1PB 2F0EA 2B2VC 3KBXA 1UEAB 1Y1WB 2EYOA 4DK0A 4C2MB 4DGZA 2K5WA 5M3FB 2D9UA 1B2TA 2EY2A 2D2CC 3FMCA 1EY8A 2F1MA 1EIGA 2CHBD 4OO1G 3PV0A 1JWUD 4A3IB 4K5VA 3IFDA 4R8IA 2F0VA 3SHLA 1HTLD 3RZOB 1JOQA 1IW7D 1TS4A 4EGVA 2NZ1D 1VMPA 1GJXA 1STHA 1YNND 2ENBA 2XIWA 4FXGC 4Y7NB 1BCPB 1AP0A 4U68A 5IGFA 5C4HA 1WCMB 5IT9L 1T5EA 2VB3X 1SJED 3M4OB 3EROA 1D2BA 3JAME 3ITPA 3GQBA 2EYHA 3HS0C 1OXXK 1RTOA 3OMGA 5KNCA 2EOTA 5JEAJ 3P20A 1MD2D 3GTKB 4ZYSA 2NVTB 5ISRA 3NBIA 2AQ1B 1CM9A 2XNAC 1JOOA 2D5DA 1HPCA 1TWFB 1OXTA 1LACA 2F4IA 4IUNA 1I4RA 3S17B 5IOCA 3TP7A 1TWAB 1CQFA 1A3TA 1O7LA 1TS3A 4IUTA 4QF4A 1DYQA 5I6YA 1F9QA 3NQIA 4DN4M 2J4XA 4BBRB 2EY5A 1B44D 1AW7A 2F0LA 5JPNC 4IQZA 3T51B 3AMUA 2IL8A 1O80A 2KCCA 4OL7A 3A56A 1RJTA 1L0YB 1AFPA 3S15B 2SNSA 4C1NI 2H4OA 5I9OA 3Q0AA 1GUOA 1I4QA 4HMJA 3CRKC 1PLFA 3DEOA 1SNCA 1K83B 2YYZA 3J81L 4A3EB 1QE6A 3DXJC 1DOLA 4XYOA 2FMMA 4ZLTF 5FKAC 2OEOA 3I73A 1SE4A 4ZKCB 4IFDH 2NN6G 4A3MB 2Q8TA 2DY8A 2CQAA 4MHEA 1STYA 3FVQA 4ULLA 2WB1B 2A74C 1Q1BA 1STAA 4DK1A 2BOSA 3A8KE 2IX0A 3WOFA 4C3IG 2L11A 5KNBA 3N52A 3K7AB 1RCVD 2F0FA 3DWPA 5I4DA 1TWGB 1DOKA 3J80E 2O5JC 4KKTA 5T1GA 4HTHA 4X3UA 1ILQA 3HOWB 2PPBC 2E2JB 2EYPA 3BVZA 2B2WA 2CW0D 5CGKA 4HN7A 3URYA 3LNNA 2C5CA 3OW7A 3VYRA 4CHTB 3S9WA 4WRDA 1BUVT 1PRTD 2DNEA 3NK9A 4KKUA 5M5XB 2XWJB 4UDUC 1RTNA 1LTRD 3I70A 1HFGA 2RVLA 3QJYA 4C3JB 4HMIA 1RKNA 3SDZA 4EQPA 2ZXPA 2F0NA 1LO5D 5C5LA 5CC4A 5JVG3 3RD4A 4K6DA 1Q12A 4F8MA 3DHQA 2A73B 3MFYA 5K5PA 5C6AA 4Z9CB 2M9VA 3HEJA 1CA6A 3V05A 3TP6A 1QWYA 4K2LA 3T13A 1F9RA 5I9PA 5E4XA 4NKLA 2PCFB 5C3EB 4BA1I 4KN7C 5K36H 4TKOB 3A54A 4IALA 1ESFA 4XXEA 2OXPA 4BY7B 1WTWA 2AQ3B 3NP8A 2LY7A 4QB4A 2ICEC 5FLXL 1E2ZA 1DXMA 1F9PA 2QILA 3SR1A 5J39A 1RF2D 3VR2A 4FF4A 3M3YB 4N9TA 1EWHA 3KLRA 5EPJA 1SDFA 4R9WA 3RLFA 3NWTA 2L55A 3QO2A 4XDXA 1Z47A 3D8GA 3C46A 1HA5A 2F0GA 3MXUA 3GV6A 2MJ8A 5KYLA 4HEDA 4HSVA 1GHKA 2PYKA 1WTRA 3SK5A 1IYVA 2JA6B 1Q3LA 4H44C 1ENFA 2J7ZA 5C3WA 2Y0SB 1XX8A 3F2UA 3EVQA 3LX0A 3QB3A 1O78A 3L3OC 2R7ZB 1HCZA 4BA2I 2QDBA 4Q5VA 4P2CB 2B2VA 2O2LD 4B9WA 3D31A 1Q1EA 1S5DD 1AZPA 1CZWA 5IT9E 1I50B 4KTAA 1STBA 3I72A 5ELDA 4ME5A 4TSSA 3S1QB 1E0BA 1F2YA 1G2TA 1SEBD 1PFMA 4FF3A 1PRTF 2A6EC 4NMZA 5DEHA 3K57A 2KHSA 3QOJA 1BNZA 1EIHA 3K59A 4A93B 3X3MA 2WV6D 5BN5A 4IFDI 5J1ZA 1EYDA 3OMCA 1C4QA 2R61A 3Q24A 2G9DA 2QCPX 1B50A 2JYOA 3OOCA 5C3XA 2B2WC 4DNTB 1V1OA 1U9RA 2EZVA 4KY6A 1E2WA 3VR4A 1LTTD 3GTGB 1EZ6A 1LTSD 5KGUA 2LKVA 2O4XA 5CBEE 3E5SA 1PTOC 2D62A 4C1NK 2X6GA 2FINB 1SXTA 2YU9B 1II3A 4FXKC 5JVH3 1R9TB 2V4DA 3T16A 2MGSA 1QG7A 3T53B 1WD0A 1BXTA 1WTVA 1K8OA 3O13A 2K1BA 3HG9A 3FEWX 3R93A 4FO2A 1SYEA 1HUMA 5JOBA 2KVMA 1EWCA 4FXDA 2FMCA 4N9PA 3J81E 2EE1A 3HKZB 1U4MA 2EXZA 2I07B 4DXGA 5C0XG 2ZXOA 3K6OA 2EYMA 2PO4A 3MWYW 5DAUA 3BG3A 4RCNA 1PZJD 3K58A 4KJNA 2JA7B 4OIKA 4C3IB 3OWEB 1LTBD 3CQZB 1A2UA 2RA4A 3EQLC 2E2DC 1GXDC 3R2IA 1Y8NB 2IX3A 4G57A 3CKIB 2B2TA 1H9JA 3K5MA 1G2SA 1W6KA 1ET9A 5G3LD 3D6WA 1EYCA 2Z4HA 2KUMA 2NVQB 3H3VC 1LT5D 1MSHA 2SEBD 2PQEA 1HUNA 1ML0D 1VDZA 4X3TA 1IL8A 4IUQA 3FPPA 5EBCA 5C4XB 3NTHA 4I7ZC 3PMFA 4HR7B 4S3SA 2RKSA 1PTOB 4ABNA 4KK7A 1EY4A 3W2DA 1I4PA 3WOEA 2I46A 1SAPA 4FF2A 1EU3A 2SNMA 3M85A 1JICA 2LS01 1TY0A 1UAPA 1ILPA 3KBGA 1ZYRD 3ND8A 4ILWA 4OO1H 1G6ZA 5M5WB 3D6CA 2Z8LA 5EBDA 1QNUA 1XXGA 1S5FD 3VR3A 5FO9B 5DM73 5EPLA 4RHRA 5BN3A 3Q22A 3RZDB 5FLXE 4DAYA 3CU7A 2F0HA 3V96A 1JWMD 4NDXA 1YNJC 1LT4D 3TP8A 1ONLA 4J6HA 2A69D 5NUCA 4XQJA 4CGYB 3QG1A 4J8QA 1KNEA 1RODA 4YIJA 1BBXC 2J0TD 2AUKA 1A3UA 4G7HC 3NTIA 2JE6I 4L8JA 3PUYA 5TSSA 4CJ0B 3M4YA 2Q8IB 1TT2A 5JEAG 2A6HC 1WVLA 3I4MB 1R4QB 1WTPA 5EKIA 5D3DA 3S2DB 4L63B 2NVXB 2E74C 4K8IA 1L0XB 1CZGA 4K14A 3R2TA 4ZAIA 2IWHA 2XRSD 3NHHA 4DAVA 3HOUB 2F0MA 5EJWA 4A3KB 1NSNS 5G3LF 3HOVB 1OXSC 2RSOA 2H1EA 2L9HA 1TIID 5M3MB 1HFNA 2A68C 2FFKB 1TR5A 2HCCA 5JAVA 2WACA 4QCLA 2KQ3A 4RKLA 1Q8IA 3MTSA 2XRQD 3Q23A 2K33A 3DUZA 5KRUA 1KNAA 4DAPA 2EVBA 1S5BD 4M1UB 2B8GA 4F88A 4FNFA 5CV6A 4FP5D 2B2TC 3BDOA 2QEJC 1FNUA 3DMUA 3R3OA 4CJ2C 3HGBA 2NN6H 1EQVA 1BO0A 1KDBA 2WINB 2F0TA 2F0WA 5AFWA 3OIPA 1EY7A 3HOYB 1HQRD 4KI0A 3BVMA 2JEAI 4R8NA 3TDQA 3UI2A 1J9OA 2RDGA 4A3BB 4X3SA 5HURA 4EQNA 4AYBB 4ZKBB 3NPPA 3NWSA 4NW2A 4XQNA 3GD7A 2F0OA 3QWNA 3IFTA 3J7AV 1C8CA 5CV5A 1SE2A 4UAIA 1QOHA 3I8ZA 4HCEA 3KF8A 4IFDJ 1EOTA 1U4LA 5CMDA 1KTKA 5I6WA 3LWUA 2IT1A 1IW7C 5FK9C 1GUWA 4IURA 1YNNC 2JP1A 2XWBB 1B53A 1QCBD 4O1NA 5T1IA 2ICIA 3HP3A 1ICWA 4ODGA 1FD7D 3V2TA 2OF1A 2K01A 5C4JB 1TKWB 1GUSA 4OO1I 2ID0A 1STGA 5LL6S 3X3NA 5IGDA 3VR6A 1WTQA 4RKBA 4F87A 3DWAA 3MHBA 2BDOA 4MN3A 3BDLA 1X3PA 4PQXA 2BE5D 3D4DA 4PNYA 3NUCA 3SXHA 2L4NA 2F0JA 3MEHA 1LTID 4CKEA 1Y1VB 3SK6A 5LL6X 3VR5A 5IGBA 5IGGA 3I4LA 3E0JA 2HQEA 4KY5A 3P1HA 1F2LA 3SVMA 2PW5A 1D1IA 3MXGA 1PZKD 1H9SB 2B2YA 3P75A 4CJ1B 1PFBA 1VF5C 5E1FA 3PO2B 2MHVA 2RDFA 3TP5A 2R93B 2KA7A 4DA2A 3I4NB 5K36G 5ELEA 3ERQA 4O42A 2N88A 2NB0A 2EPBA 2WIIB 4K2KA 1SNQA 1GUTA 1G8ZD 4HSPA 3NTKA 3OSOA 1SMYD 4C3HB 2DNCA 1B3AA 2NUCA 2R3ZA 1GUNA 2BA1A 2K32A 1SE3A 1OXUA 1BCPD 2NWGA 1OXVA 1DJRD 4RCOA 2VUMB 1B9NA 1F2ZA 1XWEA 1FNVA 4J1MA 2ZXRA 2E2HB 1WTXA 3HOZB 5CYUA 4IUVA 1H9KA 1ENCA 4ID6A 4RH6A 1GHJA 2PZUA 2KEEA 2K04A 1EFID 3U9SA 1HRJA 2CW0C 3VA7A 2NN6I 1A3VA 3CRLC 5D14A 1I6HB 1HTPA 2KCNA 3DWQA 3PIP3 1PRTC 2KJXA 3QIAA 3P7JA 2M00A 2IJ0A 4OGQC 3PO3B 4Q0FA 2FJ2A 2NVYB 2CVRA 1UUPA 2MUYA 3A7LA 3E6ZX 4DFAA 1MGSA 1A2TA 5EKKA 4KHZA 4C56C 4K8JA 1B9MA 2WKDA 3TZDA 4HCSA 4G4KA 1V43A 1EY0A 3CHBD 4RGOS 1SYFA 1VF7A 5CV4A 2AQ2B 4H13C 4LMQD 5A2QL 1HHVA 2TMPA 4ZK9B 1SNDA 1CA5A 2SDFA 3D4WA 5J22A 2IX1A 1LT3D 1OO9B 3FDTA 3D3RA 3NBHA 2RQXA 2JA5B 3EJIA 1BF4A 4PMCA 2IPKD 5IGEA 4CKCA 5C0XH 1D1KA 3MFGA 2KEDA 1KLGD 1IYUA 4IZ8A 1NR4A 2LMCB 1I6VC 4LJZC 5KNDA 1FYCA 1Z6HA 3I3CA 1TS5A 1S5CD 1EU4A 1X3QA 2B2YC 1CFMA 4H0LC 2WP8J 1C48A 3G7LA 4KV6A 1B1ZA 3A55A 3TSSA 3C1FA 1SNMA 2EY6A 1J8IA 1BCPF 4XTCS 2C9OA 2Z4IA 3FPUB 3AB9A 1Q90A 5A35A 1PRTB 4KKSA 2X69A 1KABA 1JR0D 1CHQD 3NXWA 3C2PA 1U4RA 1A6XA 1UNSA 4PMWA 4XT1B 5FO8B 3ZYYX 3MZ5A 1JORA 1G291 1MBYA 1H9SA 4A3JB 1D5ZC 4A3DB 1X32A 2A68D 1QB5D 3IAYA 5IIFA 3NSWA 3K5NA 2K05A 3S1RB 5E3FA 2K6AA 1SNOA 4KD4A 4DXFA 2A5HA 2NYZD 3PIO3 4K5WA 3H91A 3D4RA 1PXUA 2K5QA 2E75C 3N6RA 2GA4B 3MAQA 4RFBA 2BCOA 3QOLA 1D5MC 2Z1CA 4DF7A 3ND9A 3BYYB 3IL8A 3H0GB 1SNPA 3HOXB 1CK1A 2L12A 3U9OA 3TMEA 1RDPD 1O7ZA 3KK7A 5EQ0A 4C3HG 3PUWA 3BS1A 4H7BA 4G7OC 1Y8OB 3A8JE 3S16B 4LK1C 3J7YW 5KIXA 2MP1A 1BQQT 5IGCA 3KLSA 2PMZB 2F0PA 5JEAH 5KEEA 3RMHA 1TU2B 2FHTA 3VA5A 2IW3A 1JQYD 2JEBI 3GV3A 1TWCB 2MPMA 4X3KA 3K5LA 2HDLA 2B2UA 2K28A 4JK1C 3SEBA 5M9OA 1NAPA 2EDGA 2N55A 1O7YA 1R4PB 4DU9A 2F3VA 1SFOB 1I4XA 2NTTA 4TQUS 1ZEQX 1D6EC 1SYGA 2RBMA 1EEFD 4RGMA 2X6LA 3GTOB 5I2YA 2AWNA 1STEA 1WD1A 1EQTA 4CBVA 2QF7A 5C0XI 4NP5A 4FF1A 1F2MA 3PUZA 3MXNA 3M7GA 4V190 3VYUA 1FNWA 3KLSX 4I65A 3GTJB 2R92B 1JE4A 1DD2A 1DM0B 5F2DA 3GTMB 4DNRB 4BBSB 2OT2A 1E2VA 2F03A 1CTMA 3NE5B 1SYDA 4JBWA 2ZT9C 1G91A 3T56B 2VB2X 3PUXA 4RA8A 5CR3A 2F0UA 4KY7A 3R8BA 3ONAB 1XYIA 1RD9D 1RHPA 1CQVA 5CBAE 3GTQB 3K0YA 2EYJA 2EY1A 1TVXA 2Q8RE 4RHSA 5A2QE 3EFXD 1EEID 1ZYRC 2E76C 1EYAA 4K5XA 4EQOA 1B4OA 3TN2A 3GTLB 2XSCA 1PDQA 3L7ZC 4XIGS 2L5TA 4WORA 2PW7A 4MIUA 3MC0B 5ELBA 4KMUC 1Y8PB 2B39A 4IFDG 2NTSA 3SK4A 3OPOA 2AUJD 5E4WC 5CV9A 4ZUIA 3TZUA 2K03A 1SJHD 5EPKA 2WAQB 2L1BA 3IKJA 3MXPA 1BDOA 2A69C 4BY1B 3EA6A 4HAEA 5CORA 2AWOA 5C5MA 1ESRA 5DNFA 4QMGA 2F0DA 2RSNA 2B63B 3DM1A 2BDNA 3GO5A 3G6JB 4LAAA 5IODA 2A6ED 4QUCA 4XT3B 1PTOH 2XVSA 1EY9A 4M8AA 3A8IE 1AZQA 1D5XC 3GTPB 1Z7TA 5ELFA 2DY7A 4K6LA 4BWGB 1PYWD 1LT6D 1AN8A 3H6MA 3K5OA 4PV1C 1GUGA 1V1PA 4F7XA 2F0QA 3S14B 4B9XA 1TS2A 5FO7B 3J7AF 4IUUA 3BVGA 2F3WA 1SYBA 5LHY1 1PTOD 1U4PA 2B2UC 5COYA 3RUZA 1QJOA 3BDCA 1W6JA 5CV8A 2HDMA 2O5IC 3PUVA 1JB3A 1ENAA 4WJWA 1ZKOA 4RWSC 5C44B 1TQOA 1CT1D 3S1NB 4B08A 4GZYC 1PFNA 1ET6A 3W3AA 5JJZA 1SYCA 4KHVA 4KN4C 1S5ED 1NR2A 3LWEA 3I91A 2R6GA 1LLRD 4ZQ3A 4TRDA 5ELCA 3VYSA 2PZWA 1F9SA 2JA8B 1TWHB 2KOLA 1M4VA 1A15A 3JAML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0F A;  4G57 A;  2F0J A;  3MEH A;  5ISR A;  5F2D A;  5C3X A;  4R8N A;  1IHZ A;  1U9R A;  3SK6 A;  4YIJ A;  3SR1 A;  1JOO A;  4EVO A;  4KY6 A;  1A3V A;  1STN A;  5IGG A;  5IGB A;  5J39 A;  1EYC A;  4ZUJ A;  1A3U A;  1EZ6 A;  2SOB A;  2HQE A;  4KY5 A;  5HGT A;  4N9T A;  4HTH A;  5KGU A;  3P1H A;  4KV6 A;  4IUN A;  5KYI A;  2LKV A;  3H6M A;  2F0E A;  2O4X A;  5HUR A;  2PW5 A;  2PQE A;  4H7B A;  3C1F A;  2M00 A;  4EQN A;  1SNM A;  2EY6 A;  3E5S A;  4RKB A;  3TP7 A;  4F7X A;  5IOC A;  1EY5 A;  1TT2 A;  1A3T A;  2EYP A;  1SYD A;  2F0Q A;  5KIX A;  3P75 A;  4E6I A;  5CGK A;  2EYF A;  4QF4 A;  1JOK A;  2EYO A;  4B9X A;  1KDC A;  1NUC A;  5I6Y A;  2F0O A;  3D8G A;  5IGC A;  5E1F A;  5CR3 A;  3SK8 A;  2F0U A;  4DFA A;  1A2T A;  5EKK A;  4DGZ A;  4KY7 A;  2F0G A;  1II3 A;  3PMF A;  4NP5 A;  2EY5 A;  2RDF A;  4S3S A;  2F0P A;  1KAA A;  4WRD A;  1EZ8 A;  2F3W A;  5CV5 A;  2F0L A;  3NK9 A;  4K8J A;  3TP5 A;  5KYL A;  2RKS A;  1KAB A;  1SYB A;  4K8I A;  5KEE A;  3T16 A;  1EY4 A;  3NXW A;  4OL7 A;  2PYK A;  2PZT A;  2EYJ A;  2EY1 A;  2EY2 A;  1AEX A;  2F0K A;  4K14 A;  3SK5 A;  3RUZ A;  5I6W A;  1EY8 A;  3BDC A;  1EYA A;  2SNS A;  1EY0 A;  4K5X A;  5EKL A;  4EQO A;  1SYE A;  3NHH A;  2SNM A;  5C4Z A;  5C3W A;  3HZX A;  3MZ5 A;  5CV8 A;  4HMI A;  1SYF A;  3VA5 A;  1JOR A;  2F0M A;  5JOB A;  3ERQ A;  5CV4 A;  5I9O A;  3EVQ A;  3LX0 A;  3NQT A;  3QB3 A;  5JAV A;  4N9P A;  1RKN A;  4WOR A;  1NSN S;  4EQP A;  2PW7 A;  4MIU A;  4K2K A;  2F0I A;  4K5V A;  4HMJ A;  1ENA A;  2F0V A;  2F0N A;  1SNQ A;  5IIF A;  3SHL A;  5M9O A;  2EXZ A;  5C5L A;  5CC4 A;  1JOQ A;  1SNC A;  1SND A;  3OSO A;  4K6D A;  2QDB A;  4F8M A;  4B9W A;  3D4W A;  4DU9 A;  5J22 A;  2F3V A;  3DHQ A;  3SK4 A;  2EYM A;  3D6C A;  1TR5 A;  5CV9 A;  4KTA A;  4ODG A;  5E3F A;  4KD3 A;  2WAC A;  1TQO A;  5DAU A;  1SNO A;  4ZUI A;  1STH A;  4KD4 A;  2KQ3 A;  5K5P A;  4RKL A;  5C6A A;  1STB A;  2ENB A;  3V2T A;  3EJI A;  2NUC A;  2OF1 A;  3HEJ A;  4K5W A;  4ME5 A;  4PMC A;  1SYG A;  2RBM A;  5IGE A;  1F2Y A;  1SYC A;  4KHV A;  4KJN A;  3TP6 A;  2OEO A;  4K2L A;  4PMB A;  3T13 A;  5KRU A;  3MXP A;  5EGT A;  2EYL A;  5C4H A;  5CV7 A;  5IGF A;  4NMZ A;  1STG A;  5DEH A;  5I9P A;  2KHS A;  4NKL A;  4IZ8 A;  3MVV A;  2F0S A;  3S9W A;  3QOJ A;  3QOL A;  4ZQ3 A;  5C5M A;  1KDA A;  4TRD A;  3ERO A;  1F2Z A;  5CV6 A;  3ITP A;  4DF7 A;  5IGD A;  4QMG A;  4IAL A;  1STY A;  2F0D A;  3C1E A;  2F0H A;  4KJO A;  2PZW A;  4NDX A;  2OXP A;  2EYH A;  1STA A;  3DMU A;  1F2M A;  3OWF A;  3R3O A;  4J1M A;  1SNP A;  4LAA A;  5J1Z A;  3TP8 A;  1EQV A;  5IOD A;  1EYD A;  3NP8 A;  1A2U A;  3OMG A;  3OMC A;  1KDB A;  4QB4 A;  4J6H A;  3MHB A;  3U9O A;  2F0T A;  5NUC A;  2F0W A;  1ENC A;  1EY6 A;  1EY9 A;  3BDL A;  1EY7 A;  2PZU A;  3D4D A;  4I65 A;  4ID6 A;  3TME A;  4PNY A;  3NUC A;  3SXH A; 
#chains in the Genus database with same CATH topology
 3FKI B;  4DV0 Q;  1QNK A;  1HQM C;  3HOU H;  2F3I A;  5IYB G;  1IHZ A;  3BZK A;  3GP7 A;  4EVO A;  1STN A;  1CHP D;  1M8A A;  4DV1 L;  3T4A C;  1K3B C;  4LFA L;  4GKJ L;  3HOV H;  2VNU D;  3ZJY C;  3TBI B;  2PNR C;  1FJG Q;  3BZD B;  4ZRZ A;  1W2B A;  4JI0 Q;  1K8M A;  4GOP B;  1PZI D;  1EY5 A;  2BH2 A;  5M3M H;  4E6I A;  1ICF B;  4CKB A;  2EYF A;  3H94 A;  1JOK A;  1JC7 A;  1KDC A;  1NUC A;  2E2I B;  3SK8 A;  1BR9 A;  4JI5 Q;  2E5L Q;  5D3I B;  4GLX A;  2AMC B;  3GTJ H;  1EZ8 A;  2OWO A;  3SE0 A;  3I56 A;  1HNX Q;  1N32 Q;  1WTO A;  1S3O A;  1SRO A;  1AEX A;  2F0K A;  1ZXT A;  1B3Q A;  1V8Q A;  2VY3 A;  4IN3 A;  5EKL A;  3HZX A;  2KEC A;  3MA2 B;  3NQT A;  1EL0 A;  1SSO A;  5FLX c;  4BBR G;  5DM6 3;  2OCE A;  1LAB A;  3CCU A;  1AE2 A;  4RGT A;  4JI7 Q;  2DJG C;  3OHX C;  4G7Z C;  4FYD A;  4IPC A;  1HA6 A;  2Z0S A;  3J80 i;  2HHH L;  4RGN A;  4PG3 A;  2DN8 A;  4QGU A;  3HOY H;  1T5X D;  3FRP B;  2CH4 A;  2F52 A;  1S4Z A;  1H9M A;  1A63 A;  4OIJ A;  3HRZ C;  3L9A X;  3CCE A;  1FGB D;  1LV9 A;  1PA6 A;  4UHV A;  2JSO A;  3OIQ A;  4UP8 A;  3GTQ H;  4A3B H;  1IKM A;  1H9R A;  4P73 A;  1VMC A;  3C3L A;  1MI2 A;  1Q8K A;  2WKC A;  1PTO F;  1I4G A;  3SGI A;  4FVM A;  3MVV A;  2F0S A;  4OHJ A;  1I4H A;  1FJG L;  2BE5 C;  1SLJ A;  4JI0 L;  1PMR A;  1KDA A;  1KLU D;  1Q7Y C;  3S2H B;  4A3E G;  2H5X A;  1MKH A;  1QIL A;  3MXN B;  4KJO A;  1DON A;  4L6T B;  1B8A A;  2ES2 A;  4JI5 L;  2EJF C;  2E5L L;  4A3M G;  1W3S A;  1GKH A;  3Q6S A;  1IKL A;  1HNX L;  3AEV A;  1N32 L;  5I2X A;  1CKM A;  4RAU C;  3I90 A;  1WTH A;  5M5Y B;  3WDN A;  1YNJ D;  2N78 A;  2WB1 G;  5IYD H;  2G9H D;  1QVF A;  1K0R A;  1LTA D;  5KYI A;  4CDE C;  2K52 A;  1SR3 A;  2WAQ G;  2L0C A;  4JI7 L;  2K7V A;  2YTY A;  1GOZ A;  4A3F B;  5LMN W;  4JOI A;  1B70 B;  3KUP A;  4DV2 Q;  1NCV A;  3J80 L;  1WFQ A;  2ZTD A;  4QIW B;  2HUG A;  2B8F A;  4IPH A;  2XN9 C;  1KAA A;  2RDH A;  3I7F A;  5C4J H;  3HOW G;  4B3R Q;  5C0X J;  3K7U C;  2PZT A;  3CD6 A;  2A6H D;  1XJV A;  4A3G B;  2K5V A;  5FOB B;  1BOS A;  4BS9 A;  1SMY C;  4IUP A;  4V0B A;  2EJM A;  5C4Z A;  4WFN 3;  4XYQ A;  1UWV A;  3U58 A;  2I5H A;  4QUF A;  1YIT A;  2EJG C;  3AU7 A;  4JPB W;  1MSG A;  3J81 j;  1I3Q B;  2QEX A;  1F77 A;  2K5D A;  4GN4 B;  2VXW A;  5ELO A;  2F0I A;  1FR3 A;  1VCI A;  3A0J A;  3VYT A;  4X66 Q;  5BN4 A;  1BCP C;  1JCK B;  2HD3 A;  3S1M B;  2NBF A;  4C3J G;  2HT1 A;  3DEP A;  4KD3 A;  1Y1V H;  1SBB B;  1Y69 U;  5D65 A;  4PMB A;  1SE8 A;  2DGY A;  4DUZ Q;  1GM5 A;  5EGT A;  2EYL A;  5CV7 A;  2B3G A;  2PQA A;  1LTG D;  1NJI C;  1DOM A;  1GO3 E;  3C1E A;  4DV2 L;  1HXY D;  5IY0 A;  1I94 Q;  3OWF A;  1DZ1 A;  3L2P A;  2TSS A;  1IBL Q;  4IOA A;  1CI3 M;  1XTC D;  2JXM B;  1X6O A;  1VQM A;  1JMC A;  4DR4 Q;  5JPM C;  1EY6 A;  3H09 A;  4U67 3;  1TY2 A;  3I4N H;  2OTL A;  2HCI A;  3TRE A;  4UP9 A;  2LFN A;  3J80 c;  1Z9F A;  4XQQ A;  1EIF A;  4IPD A;  1DCZ A;  5C44 G;  1JWS D;  2QKI C;  1N33 Q;  2ASB A;  1YZ6 A;  1VQJ A;  4BY7 G;  1CKO A;  4ZUJ A;  5HGT A;  2M2L A;  2SOB A;  3BYT B;  3A7A B;  5ELN A;  3M7N A;  2K5N A;  2BA0 A;  4JI2 Q;  1V1P B;  2F0E A;  2B2V C;  3KBX A;  4PZ7 A;  2RHQ B;  4TVA B;  1UEA B;  4C3H H;  1Y1W B;  4AYB E;  4X66 L;  4OX9 Q;  2EYO A;  4DK0 A;  3AFP A;  4C2M B;  4DGZ A;  3UDF A;  2K5W A;  1CKN B;  4DV7 Q;  5M3F B;  1XNR Q;  3LGJ A;  5JJI A;  2D9U A;  1B2T A;  2EY2 A;  2D2C C;  1XNQ Q;  3FMC A;  4DUZ L;  3F1Z A;  1EY8 A;  2F1M A;  2JA8 G;  2Q2H A;  2VUM H;  1EIG A;  2CHB D;  1YNX A;  3E0E A;  4OO1 G;  4GOP A;  3PV0 A;  1Y14 B;  3FKI G;  1JWU D;  2E2H H;  3HOZ H;  4A3I B;  4O2D A;  3B6Y A;  4K5V A;  3IFD A;  4R8I A;  2F0V A;  1I94 L;  3SHL A;  1HTL D;  1IBL L;  4LNQ A;  3RZO B;  1JOQ A;  2JA6 G;  4KHP Q;  4DR4 L;  1IW7 D;  2Y0S G;  1TS4 A;  4EGV A;  4MTK A;  4IJL A;  2JJQ A;  2NZ1 D;  1VMP A;  1GJX A;  1STH A;  3T1Y Q;  1YNN D;  2ENB A;  2XIW A;  2KCT A;  2Q2I A;  4FXG C;  2R7Z G;  1N33 L;  1IBM Q;  1A62 A;  2R7D A;  4Y7N B;  1BCP B;  1AP0 A;  4U68 A;  5IGF A;  5C4H A;  1WCM B;  3PO3 H;  4LFC Q;  5IT9 L;  2GVB A;  1T5E A;  2VB3 X;  3Q8D A;  4JI2 L;  1N8R C;  1VQ6 A;  1SJE D;  3M4O B;  3ERO A;  1D2B A;  3JAM E;  3ITP A;  1E24 A;  4IJH A;  3GQB A;  3PSI A;  2EYH A;  3I2Z A;  3HS0 C;  1OXX K;  1RTO A;  3OMG A;  4B3T Q;  5KNC A;  5GAH C;  2EOT A;  1PH3 A;  4IPG A;  5JEA J;  4QQB X;  4DV7 L;  3P20 A;  1MD2 D;  3GTK B;  4ZYS A;  1XNR L;  4R4T A;  2NVT B;  1IBK L;  4JOI C;  3STB C;  5ISR A;  3NBI A;  2AQ1 B;  4A93 G;  1CM9 A;  1QVG A;  1K28 A;  2XNA C;  1JOO A;  2D5D A;  3AFQ A;  1HPC A;  1TWF B;  1OXT A;  1KAW A;  1LAC A;  2F4I A;  4IUN A;  1I4R A;  3S17 B;  1V1Q A;  5IOC A;  3TP7 A;  3RLO A;  1TWA B;  1CQF A;  1A3T A;  1O7L A;  1TS3 A;  1NMF A;  4IUT A;  4QF4 A;  1DYQ A;  5I6Y A;  1F9Q A;  3NQI A;  4KHP L;  4YWL A;  4DN4 M;  2J4X A;  4BBR B;  2EY5 A;  1B44 D;  1AW7 A;  2F0L A;  4R4Q A;  5JPN C;  4IQZ A;  3T51 B;  3T1Y L;  3AMU A;  2IL8 A;  1O80 A;  2KCC A;  4OL7 A;  3A56 A;  1RJT A;  1IBM L;  2I5L X;  1IYJ B;  1L0Y B;  1AFP A;  3S15 B;  2SNS A;  4LF8 Q;  2N3S A;  4LFC L;  4DKA C;  4C1N I;  2H4O A;  1UE6 A;  2ZTE A;  5I9O A;  2QDL A;  1HR0 W;  3Q0A A;  1GUO A;  1I4Q A;  1XMO Q;  4HMJ A;  5IT9 c;  4HIK A;  5IYC G;  2I0Q A;  3CRK C;  1PLF A;  3DEO A;  4GS3 A;  1SNC A;  4B3T L;  1K83 B;  2YYZ A;  3J81 L;  1HZB A;  2FXQ A;  4A3E B;  1NE3 A;  2B29 A;  3CC7 A;  2PI2 A;  1QE6 A;  2I5M X;  3DXJ C;  1DOL A;  4XYO A;  2FMM A;  4ZLT F;  4K0K Q;  5FKA C;  4A3G H;  2OEO A;  3HKZ G;  3I73 A;  1SE4 A;  4ZKC B;  4IFD H;  2NN6 G;  4A3M B;  2Q8T A;  2DY8 A;  2CQA A;  4OXP A;  2DUD A;  4MHE A;  3KJO A;  1PH5 A;  1STY A;  3FVQ A;  3U4Z A;  4ULL A;  4BXX G;  2WB1 B;  2A74 C;  1Q1B A;  1STA A;  4YHH Q;  4DK1 A;  2BOS A;  3A8K E;  2IX0 A;  3WOF A;  1VQH A;  4C3I G;  2L11 A;  5KNB A;  1JB7 A;  3N52 A;  1P8L A;  3K7A B;  1RCV D;  1EOV A;  2F0F A;  3DWP A;  4OEL B;  4A3J H;  2MO1 A;  5I4D A;  1TWG B;  1K8G A;  4LF8 L;  1DOK A;  3J80 E;  3ULP A;  4A3D H;  2O5J C;  4KKT A;  5T1G A;  4HTH A;  4X3U A;  1ILQ A;  1E3P A;  3HOW B;  2MO0 A;  4YY3 Q;  4A3L H;  2PPB C;  2E2J B;  2EYP A;  3BVZ A;  2B2W A;  2CW0 D;  5CGK A;  4LW1 A;  4HN7 A;  3BZC A;  3URY A;  3LNN A;  3FHW A;  3K0X A;  2C5C A;  4GOP C;  3OW7 A;  3VYR A;  4CHT B;  3S9W A;  4WRD A;  1BUV T;  1PRT D;  2DNE A;  3NK9 A;  4KKU A;  5M5X B;  2XWJ B;  4UDU C;  5FLM G;  1RTN A;  4OWT B;  1VQ7 A;  4K0K L;  1LTR D;  3I70 A;  1HFG A;  2RVL A;  2AHO B;  3QJY A;  5C4X G;  1SRU A;  2WFW A;  4C3J B;  4HMI A;  4GLV B;  3H0G H;  1RKN A;  3SDZ A;  4EQP A;  3HOX H;  3CPF A;  2P5Z X;  4CDC C;  2ZXP A;  4L5T A;  1Y1W H;  2F0N A;  1LO5 D;  4YHH L;  5C5L A;  5CC4 A;  5JVG 3;  3RD4 A;  4K6D A;  1Q12 A;  4F8M A;  1CKN A;  4C2M H;  3DHQ A;  2A73 B;  5M3F H;  3MFY A;  5K5P A;  5C6A A;  4Z9C B;  2A8V A;  2M9V A;  3HEJ A;  1CA6 A;  3V05 A;  3TP6 A;  1QWY A;  4K2L A;  3T13 A;  2MNA A;  1F9R A;  5I9P A;  5E4X A;  4NKL A;  2PQA B;  3S16 H;  1MHW C;  2PCF B;  3PGZ A;  5C3E B;  4BA1 I;  4DUY Q;  4KN7 C;  5K36 H;  4YWK A;  2EQS A;  4YY3 L;  4TKO B;  4IOC A;  3A54 A;  4IAL A;  1ESF A;  3CP0 A;  3RR5 A;  4XXE A;  3J7A 5;  2VZA A;  2OXP A;  1I5F A;  4HJ5 A;  3TQY A;  1WTW A;  4BY7 B;  5HY6 A;  2AQ3 B;  4LF5 Q;  3NP8 A;  1JJG A;  2LY7 A;  4QB4 A;  2ICE C;  4A3I G;  1QUQ A;  5GAG C;  5FLX L;  2RHS B;  4UPA A;  1ASZ A;  2EIF A;  1E2Z A;  4OON A;  1DXM A;  3CF5 A;  1F9P A;  2QIL A;  3SR1 A;  4Y7N H;  1V9P A;  3EN2 A;  5J39 A;  1RF2 D;  5LMU Q;  1PH9 A;  3VR2 A;  4FF4 A;  1TWC H;  3M3Y B;  3E9H A;  4N9T A;  4NXM Q;  1EWH A;  3KLR A;  5EPJ A;  1SDF A;  4R9W A;  2OQK A;  3RLF A;  3NWT A;  1OTC A;  2L55 A;  1SFO H;  3QO2 A;  4XDX A;  1Z47 A;  3D8G A;  3C46 A;  2AKW B;  1HA5 A;  2F0G A;  4DR2 Q;  4UY8 C;  3MXU A;  3GV6 A;  1HNZ Q;  2MJ8 A;  5KYL A;  4HED A;  3W1G A;  4HSV A;  4HIM A;  1K0S A;  4DV6 Q;  1GHK A;  1SN8 A;  1WJJ A;  2PYK A;  1WTR A;  3SK5 A;  1IYV A;  3GTO H;  2JA6 B;  1Q3L A;  4H44 C;  1NBW A;  1ENF A;  2J7Z A;  5C3W A;  2Y0S B;  1X3G A;  1XX8 A;  5EAY A;  4FDB A;  3F2U A;  4ALP A;  3CCS A;  4DUY L;  3EVQ A;  3LX0 A;  3BU2 A;  3QB3 A;  1O78 A;  4YCU A;  1PH7 A;  4OEM B;  3S17 H;  2GN5 A;  4DNI A;  3L3O C;  2R7Z B;  1HCZ A;  4Y52 H;  4BA2 I;  4EQ5 A;  3CCL A;  4JBM A;  3U4V A;  4LF5 L;  2QDB A;  4Q5V A;  2R92 H;  4P2C B;  2B2V A;  2O2L D;  2RCN A;  3D31 A;  4B9W A;  1Q1E A;  3KYH C;  1S5D D;  1AZP A;  1CZW A;  4MTN A;  5IT9 E;  1I50 B;  4KTA A;  3H15 A;  3GTM H;  4HJ8 A;  2LSS A;  1STB A;  2NZO A;  3I72 A;  4A3K G;  5ELD A;  4ME5 A;  4BBS H;  4TSS A;  1KQS A;  3S1Q B;  1E0B A;  1F2Y A;  1G2T A;  1BVS A;  3KDF A;  1SEB D;  1PFM A;  4FF3 A;  1PRT F;  4DV3 Q;  5LMU L;  3AYH B;  2A6E C;  3S15 H;  4NMZ A;  5DEH A;  3K57 A;  2KHS A;  4NXM L;  3QOJ A;  2YTV A;  3F8T A;  1BNZ A;  3ERS X;  1EIH A;  3K59 A;  1QZH A;  4A93 B;  3X3M A;  2WV6 D;  1K3R A;  5BN5 A;  4IFD I;  5J1Z A;  1EQR A;  1EYD A;  3OMC A;  1C4Q A;  3PF5 A;  2R61 A;  3Q24 A;  4DR2 L;  4DV0 L;  2G9D A;  3W1B A;  1HNZ L;  2QCP X;  1B50 A;  2JYO A;  2XTI A;  3OOC A;  4DV6 L;  5C3X A;  2B2W C;  1GVP A;  4DNT B;  3GTL H;  1V1O A;  1D7Q A;  1VQL A;  1U9R A;  1IZ6 A;  2EZV A;  4KY6 A;  1E2W A;  3VR4 A;  1LTT D;  3GTG B;  4A3C G;  1C9O A;  1EZ6 A;  4A3M H;  1LTS D;  5KGU A;  2LKV A;  2O4X A;  4AH6 A;  4APV A;  3KFU A;  1C0A A;  5CBE E;  3E5S A;  1PTO C;  3HOY G;  3CMA A;  2D62 A;  2CCZ A;  4C1N K;  2X6G A;  2FIN B;  4LUV A;  1SXT A;  1WI5 A;  1MIU A;  2YU9 B;  4WJ3 M;  1II3 A;  4FXK C;  4P72 A;  5JVH 3;  1R9T B;  2V4D A;  3K7A H;  3T16 A;  4R1J A;  2MGS A;  1QG7 A;  3T53 B;  2PMZ E;  1BXT A;  1WD0 A;  2UXB Q;  4AYB G;  1EWI A;  1WTV A;  4B3M Q;  1K8O A;  3O13 A;  4BY1 H;  2K1B A;  3HG9 A;  3FEW X;  4DV3 L;  3R93 A;  4FO2 A;  1SYE A;  1UE7 A;  1HNW Q;  1K9M C;  1HUM A;  4WJ4 A;  5JOB A;  1L0W A;  2KVM A;  4LUZ A;  2B63 H;  1EWC A;  4FXD A;  2FMC A;  4N9P A;  3HOW H;  1PFS A;  3J81 E;  2EE1 A;  5J3B A;  1KIX A;  3HKZ B;  1U4M A;  3TEH B;  2EXZ A;  2I07 B;  4DXG A;  5C0X G;  2ZXO A;  1LM0 A;  1L1O B;  3K6O A;  4ZCK A;  1A8V A;  2EYM A;  2PO4 A;  3MWY W;  3GTP H;  3D0F A;  4CDD C;  5DAU A;  5M5X H;  2HQL A;  3BG3 A;  4RCN A;  1PZJ D;  5IP7 G;  3K58 A;  4KJN A;  2JA7 B;  1VQ4 A;  2CWP A;  4OIK A;  4C3I B;  4C3J H;  3OWE B;  1LTB D;  3S14 H;  4HID A;  1CSQ A;  3CQZ B;  1A2U A;  2RA4 A;  3STB D;  3EQL C;  2E2D C;  1GXD C;  3R2I A;  1YVC A;  2UUA Q;  1Y8N B;  3E9I A;  2IX3 A;  4G57 A;  2UXB L;  3CKI B;  3G71 A;  2B2T A;  4B3M L;  1H9J A;  3K5M A;  1G2S A;  5JJK A;  3KF8 B;  1W6K A;  1ET9 A;  5G3L D;  3D6W A;  4JVZ A;  1HNW L;  1EYC A;  2Z4H A;  2KUM A;  4YWM A;  2NVQ B;  3H3V C;  1LT5 D;  1MSH A;  2SEB D;  2PQE A;  2L15 A;  1HUN A;  5BR8 Q;  1ML0 D;  1VDZ A;  5C44 H;  4X3T A;  1IL8 A;  4IUQ A;  3G48 A;  1YHB A;  1CUK A;  4JCV E;  4MNO A;  3FPP A;  1FVI A;  5EBC A;  4BY7 H;  5C4X B;  5C3E G;  1Y1V G;  4AIM A;  3NTH A;  4I7Z C;  3S1N H;  4B3R L;  4GKK Q;  3PMF A;  4HR7 B;  4RG1 A;  4S3S A;  2Z6K A;  2RKS A;  1PTO B;  4ABN A;  3K81 C;  4KK7 A;  1EY4 A;  3W2D A;  1I4P A;  1VQI A;  4LWC A;  4JI1 Q;  3WOE A;  2I46 A;  1SAP A;  4FF2 A;  2CKZ B;  1VQF A;  1EU3 A;  2SNM A;  3M85 A;  3M3Y H;  1VQG A;  1JIC A;  2LS0 1;  3PO2 G;  1HZC A;  1TY0 A;  3CCJ A;  1UAP A;  5FJ8 G;  1A0I A;  1ILP A;  2R93 G;  2Q2U A;  3DLL A;  3KBG A;  3OTO Q;  4O0A A;  2JA8 H;  1TWH H;  1ZYR D;  3ND8 A;  4ILW A;  4OO1 H;  1J6Q A;  1TXY A;  1G6Z A;  4LUO A;  3FKI H;  5M5W B;  3D6C A;  2Z8L A;  2UUA L;  1PYS B;  5EBD A;  1QNU A;  2WB1 E;  1XXG A;  1S5F D;  3VR3 A;  2CQO A;  2JA6 H;  5FO9 B;  1X56 A;  4PZ8 A;  2G5D A;  5DM7 3;  5LMN Q;  2WAQ E;  5EPL A;  4RHR A;  1HH2 P;  4DV4 Q;  1KRT A;  5BN3 A;  3Q22 A;  3RZD B;  3F2C A;  5FLX E;  4GLA C;  4DAY A;  2R7Z H;  2E2I H;  3CU7 A;  2OQ0 A;  2F0H A;  3V96 A;  1JWM D;  4NDX A;  1YNJ C;  4P75 A;  1LT4 D;  3TP8 A;  2IY5 B;  5IP9 G;  1ONL A;  4J6H A;  2A69 D;  1JJ2 A;  4GKK L;  1NY4 A;  1QUQ B;  5NUC A;  4H02 A;  2K75 A;  4XQJ A;  2VUM G;  4CGY B;  3QG1 A;  4J8Q A;  2K50 A;  1KNE A;  1ROD A;  4JI1 L;  4YIJ A;  4DPG A;  1WOC A;  1BBX C;  2J0T D;  2AUK A;  1A3U A;  4G7H C;  3NTI A;  1YJN A;  2JE6 I;  3U50 C;  2A1A A;  1D8L A;  4DV5 Q;  1X55 A;  4L8J A;  4OX9 L;  3PUY A;  5TSS A;  4CJ0 B;  1QZG A;  1H95 A;  3M4Y A;  2Q8I B;  1TT2 A;  5JEA G;  4A93 H;  2A6H C;  3OTO L;  1WVL A;  3I4M B;  1R4Q B;  1YEZ A;  4P74 A;  3RN2 A;  1WTP A;  5EKI A;  5D3D A;  3S2D B;  4L63 B;  1Q82 C;  4DR6 Q;  2NVX B;  1XNQ L;  1XMQ Q;  3KLW A;  2E74 C;  4K8I A;  1L0X B;  1CZG A;  4K14 A;  2LXJ A;  4DK6 C;  3R2T A;  4ZAI A;  2IWH A;  2XRS D;  3GTG H;  2R7F A;  5LMN L;  1XPR A;  3NHH A;  4DAV A;  3S2H H;  3HOU B;  4DV4 L;  2F0M A;  5EJW A;  4A3K B;  1NSN S;  5G3L F;  4EX5 A;  3HOV B;  1OXS C;  2RSO A;  2H1E A;  2L9H A;  1TII D;  5M3M B;  1HFN A;  2A68 C;  2FFK B;  1TR5 A;  2HCC A;  5M5Y H;  5JAV A;  2WAC A;  4QCL A;  2KQ3 A;  4RKL A;  1O7I A;  3UDI A;  1Q8I A;  2CWA A;  3MTS A;  5IYC H;  2XRQ D;  3KDF B;  1X9N A;  3CXC A;  1PH6 A;  3Q23 A;  2K33 A;  2VL6 A;  3DUZ A;  5KRU A;  5HGQ A;  1KNA A;  4DAP A;  2EVB A;  1S5B D;  3EIV A;  4A3F H;  2F4V Q;  4M1U B;  2B8G A;  4LF6 Q;  1LTL A;  4JYA Q;  4A75 A;  4F88 A;  4FNF A;  5CV6 A;  5GQO A;  4FP5 D;  2B2T C;  3BDO A;  2QEJ C;  2JA5 G;  1FNU A;  2N8N A;  3DMU A;  3R3O A;  4CJ2 C;  1L1O A;  3HGB A;  2NN6 H;  1EQV A;  1BO0 A;  1KDB A;  1VQO A;  2WIN B;  2F0T A;  2F0W A;  5AFW A;  3OIP A;  4DR6 L;  1EY7 A;  3HOY B;  1HQR D;  4KLK A;  4KI0 A;  3KJP A;  4BXX H;  3BVM A;  4GNX C;  1EFW A;  2JEA I;  3NEN A;  4R8N A;  3TDQ A;  1J5E Q;  3UI2 A;  1J9O A;  2D0P A;  1I3Q H;  2RDG A;  4A3B B;  4A76 A;  4C3I H;  4AQY Q;  4X3S A;  1C7Y A;  2Z6K C;  5HUR A;  4EQN A;  4AYB B;  4ZKB B;  2JA7 G;  1VQE A;  4L5Q A;  3NPP A;  3S1M H;  3NWS A;  4NW2 A;  4XQN A;  3GD7 A;  4DR5 Q;  2F0O A;  3QWN A;  3IFT A;  3J7A V;  1VQN A;  1SMX A;  1C8C A;  5CV5 A;  1FL0 A;  1SE2 A;  4UAI A;  1PVO A;  1QOH A;  2BH8 A;  3I8Z A;  4HCE A;  3KF8 A;  1YBY A;  1EOT A;  4IFD J;  1U4L A;  5CMD A;  1KTK A;  3TRZ A;  3NBH B;  5I6W A;  3CC2 A;  3LWU A;  2GVA A;  2IT1 A;  4YCV A;  3KF6 B;  3M9B A;  1IW7 C;  1XMO L;  2F4V L;  4LF4 Q;  4LF6 L;  5FK9 C;  1GUW A;  4QJF A;  4IUR A;  5FLM H;  1YNN C;  2JP1 A;  2XWB B;  2UXC Q;  1B53 A;  1QCB D;  4O1N A;  5T1I A;  4GN3 B;  5C4X H;  2ICI A;  3HP3 A;  2JQO A;  1ICW A;  3HKS A;  3CME A;  5L37 A;  4ODG A;  4A3J G;  3ULL A;  1FD7 D;  3V2T A;  2OF1 A;  4A3D G;  1PV4 A;  2K01 A;  1VQD A;  1J5E L;  3CW2 C;  4GN5 A;  1TKW B;  5C4J B;  1GUS A;  4OO1 I;  2ID0 A;  1STG A;  5LL6 S;  4A3L G;  4AQY L;  1XTD A;  3X3N A;  5IGD A;  3VR6 A;  4A4I A;  1WTQ A;  4RKB A;  4F87 A;  2ZJP A;  2VQF Q;  3DWA A;  4UP7 A;  3MHB A;  2BDO A;  4MN3 A;  3BDL A;  1X3P A;  4PQX A;  2BE5 D;  3D4D A;  5M5W H;  1P16 A;  4PNY A;  3NUC A;  3SXH A;  3DM3 A;  2L4N A;  2F0J A;  3MEH A;  3L0O A;  1LTI D;  3JAM i;  1HR0 Q;  4CKE A;  1Y1V B;  3SK6 A;  5LL6 X;  4JI6 Q;  3VR5 A;  5IGB A;  5IGG A;  3H0G G;  3I4L A;  1AH9 A;  1BBU A;  3E0J A;  2HQE A;  4KY5 A;  2VS1 A;  4A3I H;  3P1H A;  4LF4 L;  1U0L A;  2KBN A;  1F2L A;  1U5K A;  3SVM A;  2PW5 A;  4DAM A;  3RZD H;  1D1I A;  3MXG A;  2UXD Q;  1PZK D;  3RZO H;  1H9S B;  3PCO B;  4GNX B;  2UXC L;  2B2Y A;  3P75 A;  1VQ8 A;  4CJ1 B;  1PFB A;  1VF5 C;  4JV5 Q;  5E1F A;  3PO2 B;  2MHV A;  2RDF A;  4QIW E;  3TP5 A;  3HKZ E;  5H1S E;  4JI4 Q;  2R93 B;  2KA7 A;  4DA2 A;  1WCM H;  3I4N B;  1JT8 A;  4DR3 Q;  5K36 G;  3M4O H;  5ELE A;  2PI2 E;  2V1C C;  5IYB H;  3ERQ A;  1X54 A;  2K14 A;  4O42 A;  1QVC A;  1BKB A;  2N88 A;  3S24 A;  1VQ5 A;  2NB0 A;  2EPB A;  2WII B;  4K2K A;  1SNQ A;  1GUT A;  2VQF L;  1G8Z D;  4HJ9 A;  4HSP A;  3NTK A;  3OSO A;  1SMY D;  2NVT H;  3GTK H;  4C3H B;  2DNC A;  3H3V H;  2NVX H;  1N9W A;  3I4M G;  1B3A A;  1TWF H;  2NUC A;  4HJA A;  2R3Z A;  1HR0 L;  1GUN A;  4JI6 L;  1L1O C;  2BA1 A;  2K32 A;  1X65 A;  1SE3 A;  1OXU A;  1BCP D;  5DLQ E;  2NWG A;  1OXV A;  1E7Z A;  1DJR D;  4RCO A;  1TWA H;  3M4P A;  3M4Q A;  2VUM B;  1B9N A;  2UXD L;  4DAY B;  4A3K H;  1F2Z A;  1XWE A;  4B3S Q;  1FNV A;  4J1M A;  4BBR H;  2ZXR A;  3HOU G;  2E2H B;  1WTX A;  3HOZ B;  4JV5 L;  4NB3 A;  5CYU A;  4IUV A;  1H9K A;  4X6A H;  2PNH A;  1ENC A;  4ID6 A;  4RH6 A;  3HOV G;  5JJL A;  1GHJ A;  2PZU A;  2KEE A;  4JI4 L;  2K04 A;  3E3X A;  1EFI D;  3A5Z B;  3U9S A;  2HIV A;  1HRJ A;  1CSP A;  2CW0 C;  3VA7 A;  2NN6 I;  5M3M G;  4DR3 L;  1A3V A;  3CRL C;  2Z6B A;  5D14 A;  1IL2 A;  1I6H B;  1HTP A;  2KCN A;  3DWQ A;  3PIP 3;  1PRT C;  2QA4 A;  2KJX A;  3QIA A;  3P7J A;  2M00 A;  2IJ0 A;  4OGQ C;  3PO3 B;  4Q0F A;  2FJ2 A;  1K83 H;  2R92 G;  2NVY B;  2CVR A;  2VQE Q;  3T1H Q;  4A3C H;  1UUP A;  4A3E H;  2MUY A;  1ASY A;  3A7L A;  3E6Z X;  4DFA A;  1MGS A;  1VQP A;  1A2T A;  5EKK A;  4KHZ A;  3G4S A;  3OW2 A;  4BBS G;  4C56 C;  4K8J A;  1B9M A;  2WKD A;  3TZD A;  2KHJ A;  4HCS A;  3OYY A;  1PH1 A;  4G4K A;  1V43 A;  1EY0 A;  3CHB D;  1LUZ A;  4RGO S;  1SYF A;  1YHA A;  1VF7 A;  1JJC B;  5CV4 A;  1Q46 A;  2AQ2 B;  3JAM c;  4H13 C;  4LMQ D;  4B3S L;  2JA9 A;  5A2Q L;  1HHV A;  1M1K C;  2TMP A;  4ZK9 B;  1VQC A;  3TS0 A;  4A3B G;  1YHQ A;  1SND A;  1CA5 A;  2SDF A;  3D4W A;  5J22 A;  1PH8 A;  1LT3 D;  2IX1 A;  1LYL A;  1OO9 B;  1PYB A;  3ULJ A;  3FDT A;  1TWG H;  3D3R A;  3NBH A;  2RQX A;  2JA5 B;  3EJI A;  3UE0 A;  4PMC A;  1BF4 A;  2IPK D;  5IGE A;  3KF6 A;  1DGS A;  4CKC A;  5C0X H;  5IE8 A;  1D1K A;  3MFG A;  4IO9 A;  4P71 A;  2KED A;  1KLG D;  1IYU A;  4IZ8 A;  1NR4 A;  2E2J H;  2XGT A;  1NMG A;  2LMC B;  2YTX A;  2ALY B;  4RMF A;  5IP7 H;  1I6V C;  4LJZ C;  2EXD A;  4R4C A;  5KND A;  2K4K A;  3T1H L;  2VQE L;  1FYC A;  4QY7 A;  1E1T A;  5IYD G;  3CPW A;  4HJ7 A;  3A5U A;  1Z6H A;  4BY1 G;  1AE3 A;  3I3C A;  1TS5 A;  1S5C D;  1EU4 A;  3CC4 A;  4X65 Q;  1X3Q A;  2B2Y C;  4YCW A;  1CFM A;  2B63 G;  4H0L C;  2WP8 J;  1C48 A;  4POG A;  2YV5 A;  3G7L A;  4KV6 A;  1B1Z A;  3A55 A;  3TSS A;  4LF7 Q;  3RN5 A;  3C1F A;  1SNM A;  2EY6 A;  1J8I A;  1EQQ A;  1BCP F;  4XTC S;  2D0O A;  2C9O A;  5GAD C;  2Z4I A;  3FPU B;  2VW9 A;  3AB9 A;  1Q90 A;  1KD1 C;  1KRS A;  5A35 A;  1PRT B;  4KKS A;  2X69 A;  1KAB A;  1JR0 D;  4JBJ A;  1CHQ D;  3NXW A;  4I7A A;  3C2P A;  1U4R A;  1A6X A;  1UNS A;  4PMW A;  4XT1 B;  5FO8 B;  5C3E H;  4L5S A;  4N8X 1;  3UE1 A;  3RNU A;  3ZYY X;  3MZ5 A;  1JOR A;  1G29 1;  4JC0 A;  1MBY A;  1H9S A;  4GNX A;  4A3J B;  5IWA Q;  1KXL A;  2QW7 A;  1D5Z C;  1X3E A;  4A3D B;  1X32 A;  3CCR A;  4JI3 Q;  1EUJ A;  2A68 D;  1QB5 D;  4J15 A;  3IAY A;  5IIF A;  1JE5 A;  1RIP A;  1N36 Q;  3PO2 H;  3NSW A;  3K5N A;  2UUC Q;  2K05 A;  1YJW A;  4DK3 C;  5FJ8 H;  3S1R B;  5E3F A;  2K6A A;  3I4O A;  1SNO A;  4KD4 A;  2R93 H;  4X65 L;  4DXF A;  2A5H A;  2NYZ D;  3PIO 3;  4K5W A;  3H91 A;  3D4R A;  1PXU A;  3MEF A;  2K5Q A;  2E75 C;  3N6R A;  3H3V I;  2GA4 B;  3MAQ A;  4RFB A;  2BCO A;  1UEB A;  1E22 A;  3QOL A;  4LF7 L;  1D5M C;  5AJ3 Q;  3I4N G;  2Z1C A;  2Z9H A;  4DF7 A;  3EBE A;  3ND9 A;  3BYY B;  1M90 C;  4POF A;  3IL8 A;  3H0G B;  2E8G A;  1SNP A;  4ME3 A;  3HOX B;  3G6E A;  4JG2 A;  1CK1 A;  1T9H A;  1VS0 A;  2L12 A;  3U9O A;  4X62 Q;  3UDG A;  3TME A;  1HZA A;  1RDP D;  4NXN Q;  3K80 C;  1O7Z A;  3KK7 A;  5EQ0 A;  3F2B A;  4C3H G;  5IP9 H;  1S40 A;  3PUW A;  1XPU A;  1IBK Q;  1K8A C;  3BS1 A;  2ZTC A;  3W5O A;  5BR8 L;  5IWA L;  1HJP A;  4H7B A;  4G7O C;  1Y8O B;  3A8J E;  3S16 B;  4JI3 L;  3PQI A;  4LK1 C;  1MJE A;  3J7Y W;  5KIX A;  2MP1 A;  1BQQ T;  1N36 L;  1I50 H;  5IGC A;  1S72 A;  2KEN A;  3KLS A;  2UUC L;  2CH4 W;  2PMZ B;  2F0P A;  3S1Q H;  5JEA H;  5KEE A;  4DR1 Q;  1VQK A;  3RMH A;  3NEM A;  1FGU A;  3HOZ G;  1MJC A;  1TU2 B;  2C35 B;  2K5H A;  2FHT A;  3NEL A;  3VA5 A;  3ICE A;  1I6H H;  2IW3 A;  3RLN A;  4HIO A;  1JQY D;  2JEB I;  5AJ3 L;  3QR8 A;  3GV3 A;  1TWC B;  2MPM A;  4PZ6 A;  4X3K A;  3WWV A;  3K5L A;  2HDL A;  1N34 Q;  2B2U A;  2NVY H;  2K28 A;  3A74 A;  4JK1 C;  3SEB A;  5M9O A;  1NAP A;  2EDG A;  2N55 A;  4N8F A;  2UUB Q;  1O7Y A;  1R4P B;  4DU9 A;  2F3V A;  3GDE A;  3IRB A;  4X62 L;  1SFO B;  3PO3 G;  4LFB Q;  1I4X A;  4X64 Q;  2NTT A;  4TQU S;  1ZEQ X;  4NXN L;  1GD7 A;  1D6E C;  1L2F A;  3J81 i;  3KOJ A;  2ZJQ A;  1SYG A;  2RBM A;  1EEF D;  4LF9 Q;  1G6P A;  3J7Z C;  4RGM A;  1YI2 A;  2X6L A;  3GTO B;  2HIX A;  3CCQ A;  2JK8 A;  5I2Y A;  2AWN A;  1STE A;  1PHJ A;  1WD1 A;  1EQT A;  4CBV A;  2QF7 A;  2YU9 H;  5C0X I;  4NP5 A;  1VQB A;  4FF1 A;  1F2M A;  3PUZ A;  3MXN A;  1EYG A;  3M7G A;  1R9T H;  4V19 0;  2A19 A;  3VYU A;  1FNW A;  2IHE A;  3KLS X;  4I65 A;  3GTJ B;  2R92 B;  2DJF C;  1JE4 A;  4DR1 L;  1DD2 A;  1DM0 B;  2JA5 H;  5F2D A;  4DR7 Q;  3GTM B;  4DV5 L;  3PIP A;  4DNR B;  1XPO A;  4BBS B;  2OT2 A;  1E2V A;  2F03 A;  1CTM A;  1BBW A;  2Q2T A;  3CCV A;  1N34 L;  3NE5 B;  1SYD A;  4JBW A;  2ZT9 C;  1G91 A;  3T56 B;  2OTJ A;  1HZ9 A;  2VB2 X;  3PUX A;  1NTG A;  4OWX B;  1XMQ L;  2UUB L;  4RA8 A;  5CR3 A;  2F0U A;  4KY7 A;  3R8B A;  3ONA B;  4LFB L;  1XYI A;  1RD9 D;  1RHP A;  4X64 L;  4QL5 A;  2JA7 H;  1CQV A;  5CBA E;  1UE5 A;  2CFM A;  3GTQ B;  3BJU A;  3K0Y A;  2EYJ A;  2EY1 A;  1TVX A;  4LF9 L;  2Q8R E;  4RHS A;  5A2Q E;  4A3F G;  3EFX D;  1EEI D;  1ZYR C;  2E76 C;  2IHF A;  1EYA A;  4K5X A;  4EQO A;  1B4O A;  3TN2 A;  3AQQ A;  2XSC A;  3GTL B;  3UDX A;  1PDQ A;  3CQZ H;  3L7Z C;  1B7Y B;  4XIG S;  2L5T A;  2Y0S E;  4WOR A;  2PW7 A;  4MIU A;  3MC0 B;  5ELB A;  1Q81 C;  4KMU C;  1X3F A;  1Y8P B;  2B39 A;  4A3G G;  1IXR A;  4IFD G;  2NTS A;  3SK4 A;  3OPO A;  1G51 A;  2AUJ D;  3HFZ B;  5E4W C;  5CV9 A;  3TS2 A;  4ZUI A;  3FP9 A;  1PH4 A;  3TZU A;  4DR7 L;  2K03 A;  1SJH D;  5EPK A;  2WAQ B;  2NVQ H;  2L1B A;  4JYA L;  2QGQ A;  3IKJ A;  3MXP A;  4CDF C;  4OWW B;  1BDO A;  2A69 C;  4JI8 Q;  4BY1 B;  2ATW A;  3EA6 A;  4L5R C;  4HAE A;  3JC6 6;  5COR A;  2AWO A;  5C5M A;  1ESR A;  5DNF A;  4QMG A;  2MFI A;  2F0D A;  2RSN A;  4R4I A;  2B63 B;  3DM1 A;  2BDN A;  3GO5 A;  4NPS A;  3G6J B;  4LAA A;  5IOD A;  2RF4 A;  2A6E D;  4QUC A;  4XT3 B;  1PTO H;  4R4O A;  2ZM6 Q;  3PF4 A;  2XVS A;  1EY9 A;  3S1R H;  1Q86 C;  3F2D A;  2JN4 A;  4M8A A;  3A8I E;  2UU9 Q;  1AZQ A;  1D5X C;  3GTP B;  1Z7T A;  5ELF A;  1KC8 C;  2DY7 A;  4K6L A;  4BWG B;  1PYW D;  5GRO A;  1LT6 D;  2RCF A;  1AN8 A;  3CAM A;  3H6M A;  3J81 c;  3K5O A;  4PV1 C;  1GUG A;  1V1P A;  4F7X A;  4DR5 L;  1RL2 A;  2F0Q A;  3S14 B;  4B9X A;  1NNX A;  1TS2 A;  5FO7 B;  3J7A F;  4JBK A;  4IUU A;  3BVG A;  2F3W A;  1SYB A;  5LHY 1;  1PTO D;  1U4P A;  2B2U C;  3HOX G;  5COY A;  3RUZ A;  1Y1W G;  1QJO A;  3BDC A;  1YJ9 A;  1W6J A;  4DV1 Q;  1VQA A;  4JI8 L;  5CV8 A;  4LFA Q;  4GKJ Q;  2ZJR A;  2MQH A;  1E1O A;  2HDM A;  2KCM A;  2O5I C;  3PUV A;  5M3F G;  1JB3 A;  1ENA A;  2N49 A;  4WJW A;  1ZKO A;  1K73 C;  4RWS C;  5C44 B;  2ZM6 L;  3I55 A;  3PIO A;  1TQO A;  3ER0 A;  1CT1 D;  3S1N B;  4B08 A;  4GZY C;  4MZ9 A;  1PFN A;  1ET6 A;  5E7N A;  2UU9 L;  1PH2 A;  3CCM A;  3W3A A;  1SYC A;  3K8A A;  1KHI A;  4KHV A;  5JJZ A;  1EIY B;  4KN4 C;  2LXK A;  3VDY A;  1S5E D;  1NR2 A;  3LWE A;  3I91 A;  2R6G A;  1KL9 A;  3I4M H;  1LLR D;  4ZQ3 A;  4TRD A;  5ELC A;  3VYS A;  1WYD A;  3S2D H;  1YIJ A;  2PZW A;  1F9S A;  2KHI A;  5GAE C;  2HHH Q;  1VQ9 A;  1WCM G;  2JA8 B;  1TWH B;  2NZH A;  2KOL A;  1M4V A;  1A15 A;  4JW0 A;  3JAM L;  1UE1 A; 
#chains in the Genus database with same CATH homology
 3FKI B;  1QNK A;  1HQM C;  1IHZ A;  3GP7 A;  4EVO A;  1STN A;  1CHP D;  1M8A A;  3T4A C;  2VNU D;  3TBI B;  2PNR C;  3BZD B;  4ZRZ A;  1K8M A;  1PZI D;  1EY5 A;  4E6I A;  4CKB A;  2EYF A;  3H94 A;  1JOK A;  1JC7 A;  1KDC A;  1NUC A;  2E2I B;  3SK8 A;  1BR9 A;  5D3I B;  1EZ8 A;  3SE0 A;  1WTO A;  1AEX A;  2F0K A;  1ZXT A;  1V8Q A;  4IN3 A;  5EKL A;  3HZX A;  2KEC A;  3MA2 B;  3NQT A;  1EL0 A;  1SSO A;  5DM6 3;  1LAB A;  4RGT A;  3OHX C;  4G7Z C;  4FYD A;  1HA6 A;  4RGN A;  2DN8 A;  1T5X D;  3FRP B;  1S4Z A;  1H9M A;  4OIJ A;  3HRZ C;  3L9A X;  1FGB D;  1LV9 A;  2JSO A;  3OIQ A;  1IKM A;  1H9R A;  1VMC A;  3C3L A;  1MI2 A;  2WKC A;  1PTO F;  1I4G A;  4FVM A;  3MVV A;  2F0S A;  4OHJ A;  1I4H A;  2BE5 C;  1PMR A;  1KDA A;  1KLU D;  3S2H B;  1QIL A;  4KJO A;  1DON A;  4L6T B;  2EJF C;  3Q6S A;  1IKL A;  5I2X A;  4RAU C;  3I90 A;  5M5Y B;  3WDN A;  1YNJ D;  2G9H D;  1LTA D;  5KYI A;  2L0C A;  2K7V A;  1GOZ A;  4A3F B;  3KUP A;  1NCV A;  3J80 L;  4QIW B;  2HUG A;  2B8F A;  2XN9 C;  1KAA A;  2RDH A;  5C0X J;  2PZT A;  2A6H D;  4A3G B;  5FOB B;  1BOS A;  4BS9 A;  1SMY C;  4IUP A;  4V0B A;  2EJM A;  5C4Z A;  4WFN 3;  4XYQ A;  4QUF A;  2EJG C;  3AU7 A;  1MSG A;  1I3Q B;  1F77 A;  2K5D A;  2VXW A;  2F0I A;  1FR3 A;  1VCI A;  3VYT A;  5BN4 A;  1BCP C;  1JCK B;  3S1M B;  2NBF A;  4C3J G;  3DEP A;  4KD3 A;  1SBB B;  1Y69 U;  5D65 A;  4PMB A;  5EGT A;  2EYL A;  5CV7 A;  1LTG D;  1DOM A;  3C1E A;  1HXY D;  3OWF A;  1DZ1 A;  2TSS A;  1CI3 M;  1XTC D;  2JXM B;  5JPM C;  1EY6 A;  3H09 A;  4U67 3;  1TY2 A;  2HCI A;  2LFN A;  4XQQ A;  1DCZ A;  1JWS D;  2QKI C;  4ZUJ A;  5HGT A;  2M2L A;  2SOB A;  3BYT B;  3A7A B;  3M7N A;  2BA0 A;  1V1P B;  2F0E A;  2B2V C;  3KBX A;  1UEA B;  1Y1W B;  2EYO A;  4DK0 A;  4C2M B;  4DGZ A;  2K5W A;  5M3F B;  2D9U A;  1B2T A;  2EY2 A;  2D2C C;  3FMC A;  1EY8 A;  2F1M A;  1EIG A;  2CHB D;  4OO1 G;  3PV0 A;  1JWU D;  4A3I B;  4K5V A;  3IFD A;  4R8I A;  2F0V A;  3SHL A;  1HTL D;  3RZO B;  1JOQ A;  1IW7 D;  1TS4 A;  4EGV A;  2NZ1 D;  1VMP A;  1GJX A;  1STH A;  1YNN D;  2ENB A;  2XIW A;  4FXG C;  4Y7N B;  1BCP B;  1AP0 A;  4U68 A;  5IGF A;  5C4H A;  1WCM B;  5IT9 L;  1T5E A;  2VB3 X;  1SJE D;  3M4O B;  3ERO A;  1D2B A;  3JAM E;  3ITP A;  3GQB A;  2EYH A;  3HS0 C;  1OXX K;  1RTO A;  3OMG A;  5KNC A;  2EOT A;  5JEA J;  3P20 A;  1MD2 D;  3GTK B;  4ZYS A;  2NVT B;  5ISR A;  3NBI A;  2AQ1 B;  1CM9 A;  2XNA C;  1JOO A;  2D5D A;  1HPC A;  1TWF B;  1OXT A;  1LAC A;  2F4I A;  4IUN A;  1I4R A;  3S17 B;  5IOC A;  3TP7 A;  1TWA B;  1CQF A;  1A3T A;  1O7L A;  1TS3 A;  4IUT A;  4QF4 A;  1DYQ A;  5I6Y A;  1F9Q A;  3NQI A;  4DN4 M;  2J4X A;  4BBR B;  2EY5 A;  1B44 D;  1AW7 A;  2F0L A;  5JPN C;  4IQZ A;  3T51 B;  3AMU A;  2IL8 A;  1O80 A;  2KCC A;  4OL7 A;  3A56 A;  1RJT A;  1L0Y B;  1AFP A;  3S15 B;  2SNS A;  4C1N I;  2H4O A;  5I9O A;  3Q0A A;  1GUO A;  1I4Q A;  4HMJ A;  3CRK C;  1PLF A;  3DEO A;  1SNC A;  1K83 B;  2YYZ A;  3J81 L;  4A3E B;  1QE6 A;  3DXJ C;  1DOL A;  4XYO A;  2FMM A;  4ZLT F;  5FKA C;  2OEO A;  3I73 A;  1SE4 A;  4ZKC B;  4IFD H;  2NN6 G;  4A3M B;  2Q8T A;  2DY8 A;  2CQA A;  4MHE A;  1STY A;  3FVQ A;  4ULL A;  2WB1 B;  2A74 C;  1Q1B A;  1STA A;  4DK1 A;  2BOS A;  3A8K E;  2IX0 A;  3WOF A;  4C3I G;  2L11 A;  5KNB A;  3N52 A;  3K7A B;  1RCV D;  2F0F A;  3DWP A;  5I4D A;  1TWG B;  1DOK A;  3J80 E;  2O5J C;  4KKT A;  5T1G A;  4HTH A;  4X3U A;  1ILQ A;  3HOW B;  2PPB C;  2E2J B;  2EYP A;  3BVZ A;  2B2W A;  2CW0 D;  5CGK A;  4HN7 A;  3URY A;  3LNN A;  2C5C A;  3OW7 A;  3VYR A;  4CHT B;  3S9W A;  4WRD A;  1BUV T;  1PRT D;  2DNE A;  3NK9 A;  4KKU A;  5M5X B;  2XWJ B;  4UDU C;  1RTN A;  1LTR D;  3I70 A;  1HFG A;  2RVL A;  3QJY A;  4C3J B;  4HMI A;  1RKN A;  3SDZ A;  4EQP A;  2ZXP A;  2F0N A;  1LO5 D;  5C5L A;  5CC4 A;  5JVG 3;  3RD4 A;  4K6D A;  1Q12 A;  4F8M A;  3DHQ A;  2A73 B;  3MFY A;  5K5P A;  5C6A A;  4Z9C B;  2M9V A;  3HEJ A;  1CA6 A;  3V05 A;  3TP6 A;  1QWY A;  4K2L A;  3T13 A;  1F9R A;  5I9P A;  5E4X A;  4NKL A;  2PCF B;  5C3E B;  4BA1 I;  4KN7 C;  5K36 H;  4TKO B;  3A54 A;  4IAL A;  1ESF A;  4XXE A;  2OXP A;  4BY7 B;  1WTW A;  2AQ3 B;  3NP8 A;  2LY7 A;  4QB4 A;  2ICE C;  5FLX L;  1E2Z A;  1DXM A;  1F9P A;  2QIL A;  3SR1 A;  5J39 A;  1RF2 D;  3VR2 A;  4FF4 A;  3M3Y B;  4N9T A;  1EWH A;  3KLR A;  5EPJ A;  1SDF A;  4R9W A;  3RLF A;  3NWT A;  2L55 A;  3QO2 A;  4XDX A;  1Z47 A;  3D8G A;  3C46 A;  1HA5 A;  2F0G A;  3MXU A;  3GV6 A;  2MJ8 A;  5KYL A;  4HED A;  4HSV A;  1GHK A;  2PYK A;  1WTR A;  3SK5 A;  1IYV A;  2JA6 B;  1Q3L A;  4H44 C;  1ENF A;  2J7Z A;  5C3W A;  2Y0S B;  1XX8 A;  3F2U A;  3EVQ A;  3LX0 A;  3QB3 A;  1O78 A;  3L3O C;  2R7Z B;  1HCZ A;  4BA2 I;  2QDB A;  4Q5V A;  4P2C B;  2B2V A;  2O2L D;  4B9W A;  3D31 A;  1Q1E A;  1S5D D;  1AZP A;  1CZW A;  5IT9 E;  1I50 B;  4KTA A;  1STB A;  3I72 A;  5ELD A;  4ME5 A;  4TSS A;  3S1Q B;  1E0B A;  1F2Y A;  1G2T A;  1SEB D;  1PFM A;  4FF3 A;  1PRT F;  2A6E C;  4NMZ A;  5DEH A;  3K57 A;  2KHS A;  3QOJ A;  1BNZ A;  1EIH A;  3K59 A;  4A93 B;  3X3M A;  2WV6 D;  5BN5 A;  4IFD I;  5J1Z A;  1EYD A;  3OMC A;  1C4Q A;  2R61 A;  3Q24 A;  2G9D A;  2QCP X;  1B50 A;  2JYO A;  3OOC A;  5C3X A;  2B2W C;  4DNT B;  1V1O A;  1U9R A;  2EZV A;  4KY6 A;  1E2W A;  3VR4 A;  1LTT D;  3GTG B;  1EZ6 A;  1LTS D;  5KGU A;  2LKV A;  2O4X A;  5CBE E;  3E5S A;  1PTO C;  2D62 A;  4C1N K;  2X6G A;  2FIN B;  1SXT A;  2YU9 B;  1II3 A;  4FXK C;  5JVH 3;  1R9T B;  2V4D A;  3T16 A;  2MGS A;  1QG7 A;  3T53 B;  1WD0 A;  1BXT A;  1WTV A;  1K8O A;  3O13 A;  2K1B A;  3HG9 A;  3FEW X;  3R93 A;  4FO2 A;  1SYE A;  1HUM A;  5JOB A;  2KVM A;  1EWC A;  4FXD A;  2FMC A;  4N9P A;  3J81 E;  2EE1 A;  3HKZ B;  1U4M A;  2EXZ A;  2I07 B;  4DXG A;  5C0X G;  2ZXO A;  3K6O A;  2EYM A;  2PO4 A;  3MWY W;  5DAU A;  3BG3 A;  4RCN A;  1PZJ D;  3K58 A;  4KJN A;  2JA7 B;  4OIK A;  4C3I B;  3OWE B;  1LTB D;  3CQZ B;  1A2U A;  2RA4 A;  3EQL C;  2E2D C;  1GXD C;  3R2I A;  1Y8N B;  2IX3 A;  4G57 A;  3CKI B;  2B2T A;  1H9J A;  3K5M A;  1G2S A;  1W6K A;  1ET9 A;  5G3L D;  3D6W A;  1EYC A;  2Z4H A;  2KUM A;  2NVQ B;  3H3V C;  1LT5 D;  1MSH A;  2SEB D;  2PQE A;  1HUN A;  1ML0 D;  1VDZ A;  4X3T A;  1IL8 A;  4IUQ A;  3FPP A;  5EBC A;  5C4X B;  3NTH A;  4I7Z C;  3PMF A;  4HR7 B;  4S3S A;  2RKS A;  1PTO B;  4ABN A;  4KK7 A;  1EY4 A;  3W2D A;  1I4P A;  3WOE A;  2I46 A;  1SAP A;  4FF2 A;  1EU3 A;  2SNM A;  3M85 A;  1JIC A;  2LS0 1;  1TY0 A;  1UAP A;  1ILP A;  3KBG A;  1ZYR D;  3ND8 A;  4ILW A;  4OO1 H;  1G6Z A;  5M5W B;  3D6C A;  2Z8L A;  5EBD A;  1QNU A;  1XXG A;  1S5F D;  3VR3 A;  5FO9 B;  5DM7 3;  5EPL A;  4RHR A;  5BN3 A;  3Q22 A;  3RZD B;  5FLX E;  4DAY A;  3CU7 A;  2F0H A;  3V96 A;  1JWM D;  4NDX A;  1YNJ C;  1LT4 D;  3TP8 A;  1ONL A;  4J6H A;  2A69 D;  5NUC A;  4XQJ A;  4CGY B;  3QG1 A;  4J8Q A;  1KNE A;  1ROD A;  4YIJ A;  1BBX C;  2J0T D;  2AUK A;  1A3U A;  4G7H C;  3NTI A;  2JE6 I;  4L8J A;  3PUY A;  5TSS A;  4CJ0 B;  3M4Y A;  2Q8I B;  1TT2 A;  5JEA G;  2A6H C;  1WVL A;  3I4M B;  1R4Q B;  1WTP A;  5EKI A;  5D3D A;  3S2D B;  4L63 B;  2NVX B;  2E74 C;  4K8I A;  1L0X B;  1CZG A;  4K14 A;  3R2T A;  4ZAI A;  2IWH A;  2XRS D;  3NHH A;  4DAV A;  3HOU B;  2F0M A;  5EJW A;  4A3K B;  1NSN S;  5G3L F;  3HOV B;  1OXS C;  2RSO A;  2H1E A;  2L9H A;  1TII D;  5M3M B;  1HFN A;  2A68 C;  2FFK B;  1TR5 A;  2HCC A;  5JAV A;  2WAC A;  4QCL A;  2KQ3 A;  4RKL A;  1Q8I A;  3MTS A;  2XRQ D;  3Q23 A;  2K33 A;  3DUZ A;  5KRU A;  1KNA A;  4DAP A;  2EVB A;  1S5B D;  4M1U B;  2B8G A;  4F88 A;  4FNF A;  5CV6 A;  4FP5 D;  2B2T C;  3BDO A;  2QEJ C;  1FNU A;  3DMU A;  3R3O A;  4CJ2 C;  3HGB A;  2NN6 H;  1EQV A;  1BO0 A;  1KDB A;  2WIN B;  2F0T A;  2F0W A;  5AFW A;  3OIP A;  1EY7 A;  3HOY B;  1HQR D;  4KI0 A;  3BVM A;  2JEA I;  4R8N A;  3TDQ A;  3UI2 A;  1J9O A;  2RDG A;  4A3B B;  4X3S A;  5HUR A;  4EQN A;  4AYB B;  4ZKB B;  3NPP A;  3NWS A;  4NW2 A;  4XQN A;  3GD7 A;  2F0O A;  3QWN A;  3IFT A;  3J7A V;  1C8C A;  5CV5 A;  1SE2 A;  4UAI A;  1QOH A;  3I8Z A;  4HCE A;  3KF8 A;  4IFD J;  1EOT A;  1U4L A;  5CMD A;  1KTK A;  5I6W A;  3LWU A;  2IT1 A;  1IW7 C;  5FK9 C;  1GUW A;  4IUR A;  1YNN C;  2JP1 A;  2XWB B;  1B53 A;  1QCB D;  4O1N A;  5T1I A;  2ICI A;  3HP3 A;  1ICW A;  4ODG A;  1FD7 D;  3V2T A;  2OF1 A;  2K01 A;  5C4J B;  1TKW B;  1GUS A;  4OO1 I;  2ID0 A;  1STG A;  5LL6 S;  3X3N A;  5IGD A;  3VR6 A;  1WTQ A;  4RKB A;  4F87 A;  3DWA A;  3MHB A;  2BDO A;  4MN3 A;  3BDL A;  1X3P A;  4PQX A;  2BE5 D;  3D4D A;  4PNY A;  3NUC A;  3SXH A;  2L4N A;  2F0J A;  3MEH A;  1LTI D;  4CKE A;  1Y1V B;  3SK6 A;  5LL6 X;  3VR5 A;  5IGB A;  5IGG A;  3I4L A;  3E0J A;  2HQE A;  4KY5 A;  3P1H A;  1F2L A;  3SVM A;  2PW5 A;  1D1I A;  3MXG A;  1PZK D;  1H9S B;  2B2Y A;  3P75 A;  4CJ1 B;  1PFB A;  1VF5 C;  5E1F A;  3PO2 B;  2MHV A;  2RDF A;  3TP5 A;  2R93 B;  2KA7 A;  4DA2 A;  3I4N B;  5K36 G;  5ELE A;  3ERQ A;  4O42 A;  2N88 A;  2NB0 A;  2EPB A;  2WII B;  4K2K A;  1SNQ A;  1GUT A;  1G8Z D;  4HSP A;  3NTK A;  3OSO A;  1SMY D;  4C3H B;  2DNC A;  1B3A A;  2NUC A;  2R3Z A;  1GUN A;  2BA1 A;  2K32 A;  1SE3 A;  1OXU A;  1BCP D;  2NWG A;  1OXV A;  1DJR D;  4RCO A;  2VUM B;  1B9N A;  1F2Z A;  1XWE A;  1FNV A;  4J1M A;  2ZXR A;  2E2H B;  1WTX A;  3HOZ B;  5CYU A;  4IUV A;  1H9K A;  1ENC A;  4ID6 A;  4RH6 A;  1GHJ A;  2PZU A;  2KEE A;  2K04 A;  1EFI D;  3U9S A;  1HRJ A;  2CW0 C;  3VA7 A;  2NN6 I;  1A3V A;  3CRL C;  5D14 A;  1I6H B;  1HTP A;  2KCN A;  3DWQ A;  3PIP 3;  1PRT C;  2KJX A;  3QIA A;  3P7J A;  2M00 A;  2IJ0 A;  4OGQ C;  3PO3 B;  4Q0F A;  2FJ2 A;  2NVY B;  2CVR A;  1UUP A;  2MUY A;  3A7L A;  3E6Z X;  4DFA A;  1MGS A;  1A2T A;  5EKK A;  4KHZ A;  4C56 C;  4K8J A;  1B9M A;  2WKD A;  3TZD A;  4HCS A;  4G4K A;  1V43 A;  1EY0 A;  3CHB D;  4RGO S;  1SYF A;  1VF7 A;  5CV4 A;  2AQ2 B;  4H13 C;  4LMQ D;  5A2Q L;  1HHV A;  2TMP A;  4ZK9 B;  1SND A;  1CA5 A;  2SDF A;  3D4W A;  5J22 A;  2IX1 A;  1LT3 D;  1OO9 B;  3FDT A;  3D3R A;  3NBH A;  2RQX A;  2JA5 B;  3EJI A;  1BF4 A;  4PMC A;  2IPK D;  5IGE A;  4CKC A;  5C0X H;  1D1K A;  3MFG A;  2KED A;  1KLG D;  1IYU A;  4IZ8 A;  1NR4 A;  2LMC B;  1I6V C;  4LJZ C;  5KND A;  1FYC A;  1Z6H A;  3I3C A;  1TS5 A;  1S5C D;  1EU4 A;  1X3Q A;  2B2Y C;  1CFM A;  4H0L C;  2WP8 J;  1C48 A;  3G7L A;  4KV6 A;  1B1Z A;  3A55 A;  3TSS A;  3C1F A;  1SNM A;  2EY6 A;  1J8I A;  1BCP F;  4XTC S;  2C9O A;  2Z4I A;  3FPU B;  3AB9 A;  1Q90 A;  5A35 A;  1PRT B;  4KKS A;  2X69 A;  1KAB A;  1JR0 D;  1CHQ D;  3NXW A;  3C2P A;  1U4R A;  1A6X A;  1UNS A;  4PMW A;  4XT1 B;  5FO8 B;  3ZYY X;  3MZ5 A;  1JOR A;  1G29 1;  1MBY A;  1H9S A;  4A3J B;  1D5Z C;  4A3D B;  1X32 A;  2A68 D;  1QB5 D;  3IAY A;  5IIF A;  3NSW A;  3K5N A;  2K05 A;  3S1R B;  5E3F A;  2K6A A;  1SNO A;  4KD4 A;  4DXF A;  2A5H A;  2NYZ D;  3PIO 3;  4K5W A;  3H91 A;  3D4R A;  1PXU A;  2K5Q A;  2E75 C;  3N6R A;  2GA4 B;  3MAQ A;  4RFB A;  2BCO A;  3QOL A;  1D5M C;  2Z1C A;  4DF7 A;  3ND9 A;  3BYY B;  3IL8 A;  3H0G B;  1SNP A;  3HOX B;  1CK1 A;  2L12 A;  3U9O A;  3TME A;  1RDP D;  1O7Z A;  3KK7 A;  5EQ0 A;  4C3H G;  3PUW A;  3BS1 A;  4H7B A;  4G7O C;  1Y8O B;  3A8J E;  3S16 B;  4LK1 C;  3J7Y W;  5KIX A;  2MP1 A;  1BQQ T;  5IGC A;  3KLS A;  2PMZ B;  2F0P A;  5JEA H;  5KEE A;  3RMH A;  1TU2 B;  2FHT A;  3VA5 A;  2IW3 A;  1JQY D;  2JEB I;  3GV3 A;  1TWC B;  2MPM A;  4X3K A;  3K5L A;  2HDL A;  2B2U A;  2K28 A;  4JK1 C;  3SEB A;  5M9O A;  1NAP A;  2EDG A;  2N55 A;  1O7Y A;  1R4P B;  4DU9 A;  2F3V A;  1SFO B;  1I4X A;  2NTT A;  4TQU S;  1ZEQ X;  1D6E C;  1SYG A;  2RBM A;  1EEF D;  4RGM A;  2X6L A;  3GTO B;  5I2Y A;  2AWN A;  1STE A;  1WD1 A;  1EQT A;  4CBV A;  2QF7 A;  5C0X I;  4NP5 A;  4FF1 A;  1F2M A;  3PUZ A;  3MXN A;  3M7G A;  4V19 0;  3VYU A;  1FNW A;  3KLS X;  4I65 A;  3GTJ B;  2R92 B;  1JE4 A;  1DD2 A;  1DM0 B;  5F2D A;  3GTM B;  4DNR B;  4BBS B;  2OT2 A;  1E2V A;  2F03 A;  1CTM A;  3NE5 B;  1SYD A;  4JBW A;  2ZT9 C;  1G91 A;  3T56 B;  2VB2 X;  3PUX A;  4RA8 A;  5CR3 A;  2F0U A;  4KY7 A;  3R8B A;  3ONA B;  1XYI A;  1RD9 D;  1RHP A;  1CQV A;  5CBA E;  3GTQ B;  3K0Y A;  2EYJ A;  2EY1 A;  1TVX A;  2Q8R E;  4RHS A;  5A2Q E;  3EFX D;  1EEI D;  1ZYR C;  2E76 C;  1EYA A;  4K5X A;  4EQO A;  1B4O A;  3TN2 A;  3GTL B;  2XSC A;  1PDQ A;  3L7Z C;  4XIG S;  2L5T A;  4WOR A;  2PW7 A;  4MIU A;  3MC0 B;  5ELB A;  4KMU C;  1Y8P B;  2B39 A;  4IFD G;  2NTS A;  3SK4 A;  3OPO A;  2AUJ D;  5E4W C;  5CV9 A;  4ZUI A;  3TZU A;  2K03 A;  1SJH D;  5EPK A;  2WAQ B;  2L1B A;  3IKJ A;  3MXP A;  1BDO A;  2A69 C;  4BY1 B;  3EA6 A;  4HAE A;  5COR A;  2AWO A;  5C5M A;  1ESR A;  5DNF A;  4QMG A;  2F0D A;  2RSN A;  2B63 B;  3DM1 A;  2BDN A;  3GO5 A;  3G6J B;  4LAA A;  5IOD A;  2A6E D;  4QUC A;  4XT3 B;  1PTO H;  2XVS A;  1EY9 A;  4M8A A;  3A8I E;  1AZQ A;  1D5X C;  3GTP B;  1Z7T A;  5ELF A;  2DY7 A;  4K6L A;  4BWG B;  1PYW D;  1LT6 D;  1AN8 A;  3H6M A;  3K5O A;  4PV1 C;  1GUG A;  1V1P A;  4F7X A;  2F0Q A;  3S14 B;  4B9X A;  1TS2 A;  5FO7 B;  3J7A F;  4IUU A;  3BVG A;  2F3W A;  1SYB A;  5LHY 1;  1PTO D;  1U4P A;  2B2U C;  5COY A;  3RUZ A;  1QJO A;  3BDC A;  1W6J A;  5CV8 A;  2HDM A;  2O5I C;  3PUV A;  1JB3 A;  1ENA A;  4WJW A;  1ZKO A;  4RWS C;  5C44 B;  1TQO A;  1CT1 D;  3S1N B;  4B08 A;  4GZY C;  1PFN A;  1ET6 A;  3W3A A;  5JJZ A;  1SYC A;  4KHV A;  4KN4 C;  1S5E D;  1NR2 A;  3LWE A;  3I91 A;  2R6G A;  1LLR D;  4ZQ3 A;  4TRD A;  5ELC A;  3VYS A;  2PZW A;  1F9S A;  2JA8 B;  1TWH B;  2KOL A;  1M4V A;  1A15 A;  3JAM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...