1HHVA

Solution structure of virus chemokine vmip-ii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
b'GDTLGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRUS CHEMOKINE VMIP-II
publication title CCR2 and CCR5 receptor-binding properties of herpesvirus-8 vMIP-II based on sequence analysis and its solution structure
pubmed doi rcsb
molecule tags Viral protein
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1998-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hhvA00
2L12A 4XT3B 4CJ2C 4X3SA 3F2UA 3P7JA 1EQTA 4XDXA 2B2TC 1NR2A 2X69A 4RAUC 4HSVA 2XIWA 1ICWA 1EOTA 1B2TA 5CORA 3G7LA 5EPJA 1G2SA 2B2TA 1B50A 4CJ1B 1NCVA 2K03A 4IUVA 4DN4M 4RWSC 1M8AA 1HFGA 3TN2A 4R9WA 3I8ZA 3TZDA 1U4MA 2KVMA 2KEEA 2X6GA 1MI2A 1NAPA 1RJTA 2K01A 3DEPA 1WVLA 1WTOA 1J8IA 1ML0D 1ILPA 2KOLA 4MN3A 1RTNA 2SDFA 2DY7A 1BF4A 3FDTA 1DOLA 1DOMA 1ESRA 4ZKCB 4XT1B 2NZ1D 1U4RA 1QG7A 2HDLA 2NWGA 2L9HA 2K28A 2Q8RE 2NYZD 1EIGA 2RSNA 3I91A 5D65A 1RHPA 1NR4A 1PFNA 2BDNA 2EPBA 2MGSA 4ZAIA 1DZ1A 1S4ZA 4HAEA 1F2LA 3HP3A 1IL8A 4NW2A 4ZK9B 5CBEE 1AP0A 1E0BA 1QNKA 1MGSA 2H1EA 1CA5A 2L1BA 1X3QA 4X3KA 2K05A 1HUMA 2HUGA 3DM1A 1WTWA 3D6WA 1IKMA 1DONA 4X3TA 3QO2A 4HCSA 4IUPA 1QE6A 4OIJA 2EE1A 5EKIA 1EIHA 4CJ0B 1KNEA 1U4PA 2MJ8A 2N88A 2HDMA 3GV6A 5D14A 1Q3LA 5T1IA 4U68A 1TVXA 2IL8A 5COYA 2B2VA 4IURA 4QUFA 1G2TA 4MHEA 1CM9A 1U4LA 4UAIA 2MPMA 3DEOA 4IUTA 1AZPA 2L11A 3H91A 3IL8A 2EOTA 4OIKA 1SSOA 1F9SA 3GV3A 4IUQA 1EL0A 1B3AA 1BO0A 1PFMA 4ZKBB 5CMDA 3I90A 1J9OA 2J7ZA 2JP1A 2Q8TA 1XYIA 1B4OA 3I3CA 2HCIA 1X32A 2RA4A 5EJWA 1JICA 4ZLTF 1F9QA 3MWYW 4IUUA 3FPUB 3IFDA 3N52A 2CVRA 1VMCA 1O7YA 5E4XA 1O7ZA 1WD0A 1VMPA 1DOKA 2D9UA 2FFKB 2HCCA 2RVLA 1IKLA 2VXWA 3MTSA 4R8IA 2B2VC 3UI2A 3KUPA 1WTRA 5EQ0A 1PDQA 4LMQD 5CBAE 2B2WC 1RODA 1SDFA 1F9PA 2DY8A 5JJZA 2FINB 1MSGA 2B2YA 1PLFA 2N55A 1HA6A 1ILQA 1MSHA 3KBXA 1BBXC 1A15A 3SVMA 5EPKA 2B2WA 5T1GA 1C8CA 3LWEA 2FHTA 5DNFA 2KECA 1G91A 1SAPA 4RA8A 1ZXTA 2K04A 1G6ZA 1PFBA 4HEDA 4X3UA 1AZQA 1HUNA 2KUMA 1WTXA 1WTVA 2R3ZA 1RTOA 3R93A 1HFNA 1F9RA 3Q6SA 1WTPA 1HHVA 4O42A 2B2UC 4QUCA 2JYOA 5E4WC 2FMMA 1WTQA 2MP1A 1KNAA 1LV9A 1JE4A 1X3PA 1WD1A 2RSOA 1O80A 2B2YC 2B2UA 1XX8A 2L4NA 1B53A 2KEDA 1CA6A 1HRJA 1GUWA 3ONAB 2K1BA 2M2LA 1BNZA 5AFWA 5EPLA 2X6LA 2FJ2A
chains in the Genus database with same CATH superfamily
3TSSA 2NN6I 2Y0SE 3T13A 4DR2Q 1GHJA 2LKVA 3VA5A 1G8ZD 2EDGA 2B2TA 1B50A 2K03A 2M9VA 5C3EG 4ILWA 1HFGA 2SOBA 4DAVA 2WAQE 3NTHA 4RKLA 2F0OA 5FO8B 3SE0A 1WVLA 2SDFA 2DY7A 1OO9B 1YNND 3MVVA 1Y1VB 2NZ1D 3HRZC 5D65A 2K5DA 4GKJL 2MGSA 1DZ1A 2G9DA 1A3TA 4PNYA 2PI2A 4LF9Q 2K52A 4A3BB 5JPNC 2HQEA 4X3TA 3UE1A 1Y1VG 4K2KA 2EE1A 5KYIA 1M4VA 4O1NA 4DV6L 3BDCA 5LMNQ 1TKWB 3EBEA 1K83H 1FL0A 4OWTB 2BCOA 5IYCG 4NKLA 5LL6X 1A3UA 4X62L 4A3BG 5C0XJ 5I2YA 1BBUA 1EY9A 4V0BA 4EGVA 1OXVA 1QZHA 4JI7Q 2A8VA 4HJ5A 2F52A 4FP5D 1LYLA 3PIO3 3M7GA 3KF8B 4POGA 1F9QA 4C2MH 3KDFB 2CVRA 4HIDA 2EVBA 2JK8A 2EY2A 4I65A 1UAPA 4KJNA 4JI8L 3STBD 1FJGQ 2HHHQ 2PI2E 1F9PA 2B2YA 1PLFA 1A2TA 2VS1A 1GXDC 3E0EA 2JEBI 1BDOA 1MSHA 5BR8L 1N36L 1EY8A 1TS4A 1PH2A 5JEAJ 2KHIA 1EYGA 5D3IB 1S5DD 2FHTA 4LUVA 4E6IA 5I4DA 1EY6A 3HOZG 1D1IA 1S5CD 1IW7C 1EWHA 1XMOL 4HCEA 5DLQE 2ES2A 3K7UC 5EKKA 3JAME 4RHRA 2NTTA 1VQ9A 2EXZA 4GN4B 1VQCA 1B7YB 3EA6A 2B2UA 4ZQ3A 1VQLA 1QOHA 4KY5A 2WFWA 1GUWA 1QCBD 1MD2D 1VS0A 1JC7A 2RHQB 2QF7A 3NQTA 4YCVA 3TS2A 1A3VA 1VQAA 3H0GH 4KI0A 1TS3A 3MFGA 4B3TL 5JVH3 3NUCA 4RGTA 3MXGA 2BDOA 3E5SA 4DUZQ 1TWAH 2PQEA 5C4ZA 4X64Q 3CD6A 3VR2A 4BBRB 3K7AH 2A1AA 2UU9Q 2CWPA 1NR4A 1IBML 2A6EC 5KNBA 5J22A 3QWNA 1TXYA 1SNPA 2F3VA 4KN4C 3KF6A 5ELDA 3F2CA 1STBA 3M7NA 3ERQA 4BBRG 1FNVA 2YV5A 1QVFA 1ASZA 4K0KL 5IT9L 3ZYYX 4OX9Q 3FKIB 1J6QA 1D5MC 4C3JB 1QWYA 1XNRQ 1HA5A 5GAGC 4JBJA 2F0TA 2Q8IB 1KTKA 1G51A 2JEAI 2F0EA 2UXDL 5I2XA 2MO1A 3H3VC 2ZM6Q 4IOAA 3QOJA 4KMUC 3FKIG 3S2DH 3H09A 2KCCA 4C3JG 4AYBE 4A3KB 4BXXH 4ODGA 3ICEA 1P16A 2R93H 5E4XA 4OWWB 1ZKOA 4U673 2BA1A 1D2BA 2F0JA 3M4YA 4FF3A 3RZDH 5BN5A 3BJUA 1VQ4A 3H6MA 4GN5A 4PMCA 4MZ9A 4O2DA 2PCFB 5JJZA 1TIID 1JOQA 2XSCA 1HA6A 5M5WB 4A3KG 3W1GA 2CH4A 1TWCH 4B08A 1SAPA 3L2PA 2F4VL 1V1PB 4K8IA 1PFBA 3CC7A 1Z6HA 5FJ8G 2B63H 3S17H 4LUOA 1I6HH 1HUNA 4JI4Q 2R3ZA 1RTOA 1L1OA 1TQOA 5IGFA 1R9TB 1OXUA 1PYSB 4A93B 2JA5B 1YJ9A 1L0WA 3UDFA 1Y8PB 2ICIA 3OTOL 1HRJA 4KJOA 1KLUD 1SJHD 2MQHA 2F0VA 3ONAB 1PXUA 2M2LA 3I4LA 2FJ2A 1XJVA 2NVTB 3T1YL 2O2LD 4DV1Q 1OXTA 1SE4A 5I9PA 2X69A 2IT1A 2YTXA 4A93G 3K80C 2JA5G 2N78A 5FO7B 4JBMA 3PO2B 3R2TA 1B2TA 4ZUIA 5C4HA 2K33A 1VQPA 1H95A 2R7ZH 3MA2B 3CP0A 5IYBG 2RBMA 1LT4D 1XXGA 3D31A 2WIIB 1WTHA 1S5ED 1HXYD 3PO2G 4CDEC 2NYZD 1EIGA 3HOVB 2I46A 4DNTB 1I94L 4ZK9B 5EBDA 5IWAL 2ZJPA 5IP7G 4JI3L 1G291 2JA6H 1FGBD 2VQEL 2D5DA 2LS01 4BWGB 1FR3A 4K2LA 4IUPA 4RHSA 4LFAL 2O5IC 1C9OA 3HOUH 1J5EL 4DR2L 1BOSA 3SK4A 3HKSA 2IX0A 2VQFQ 3HOVG 4HJ7A 2A73B 4UPAA 4A3FH 3I4NB 2F0DA 4IPHA 1U4LA 1TWGH 3H91A 3IL8A 2NVYH 2YU9H 4KD4A 5A35A 1YNNC 1UUPA 1EL0A 2J7ZA 4A3CG 1JICA 5G3LD 4R1JA 1UEBA 2F0KA 3GTGB 3I4NG 3SGIA 1BCPC 3TRZA 2VXWA 4R8IA 4A75A 4NMZA 1B9NA 4KKSA 2PMZE 5K36H 1BQQT 1Q86C 2F0GA 3K59A 4GKKL 1WCMH 1ILQA 2SEBD 4LF9L 3S2HH 1SYFA 3CHBD 5EBCA 4A3DB 2KECA 3H94A 3CPWA 1YITA 1JWMD 1W6JA 4HIOA 3IAYA 3HOYB 3PUZA 4HEDA 4R4QA 3FP9A 5M5XH 2E2HB 1T5EA 4FF2A 4BA2I 1YHQA 2RDHA 3W1BA 1WTQA 2F0FA 2EYPA 4A3DG 2GA4B 1XX8A 3KLWA 3HOYG 5I6YA 5AFWA 1DD2A 4IQZA 3I56A 2EZVA 4EQPA 3STBC 2PW5A 2CCZA 3HOZH 2XNAC 4HR7B 3UDIA 3NP8A 2LXJA 1R4QB 2IW3A 4GZYC 3BS1A 1FJGL 2HHHL 4GKJQ 2CKZB 3PQIA 4KY6A 1GM5A 2EIFA 2F0WA 5EAYA 2AQ2B 1RDPD 2X6GA 3QB3A 1MJEA 5FLXc 2OWOA 2E8GA 1ZYRD 1PMRA 1CZGA 3AFQA 3RLFA 1SN8A 4A3JH 1EY0A 1YJNA 1YJWA 4ZAIA 1SNOA 4ID6A 4BY1H 5CBEE 4M8AA 2Q2HA 5ELCA 1TR5A 2L1BA 2G9HD 5EKLA 4JBKA 4X62Q 1VDZA 2BOSA 4N9PA 4R8NA 4DGZA 4QQBX 1LT6D 4LW1A 2SNMA 1E2ZA 2V1CC 4YWKA 3Q22A 3URYA 2MJ8A 3S9WA 1NBWA 2HDMA 3GTLH 2XRSD 4JOIC 3Q24A 1K0SA 5ISRA 3CU7A 4RCNA 2GVAA 3KBGA 2NVQB 4IUTA 5JJLA 2E76C 1PZID 3QJYA 4OO1G 3A55A 4WJWA 4KK7A 3VR3A 2EJFC 2ZXOA 1WFQA 4KKTA 2R61A 2ZJRA 3HOXB 1PV4A 4IFDI 4K14A 1W6KA 2FFKB 3D6CA 2VUMB 5AJ3Q 1QILA 1PDQA 4B3RQ 4YY3L 3PIP3 2Y0SB 3EJIA 2CQOA 3SVMA 3A8JE 3GTMB 1I4RA 3A7LA 1LTAD 1RKNA 3HOXG 4ZUJA 4R4OA 2VUMG 1EEID 5LMUQ 4OX9L 1SYEA 3PCOB 2JA8B 2OCEA 1VQBA 2WAQB 3QOLA 3UE0A 2AUJD 2FMMA 4DAPA 1K8AC 2R92H 3PF4A 3DWPA 1KDBA 1O80A 2VNUD 5GADC 4B3TQ 4H13C 2IX3A 1VQ8A 3RNUA 4DK3C 2JA8G 1EQRA 1VCIA 1EIYB 1HZCA 4JI1Q 1LT5D 4RAUC 5IT9E 4IALA 1PRTB 3R8BA 4MTKA 4Q0FA 2QDLA 4XXEA 4CJ1B 4IUVA 2H4OA 5FO9B 3PMFA 1IBMQ 1F2MA 1NMFA 2QA4A 1IZ6A 3DEPA 4WJ4A 1HQMC 2EYJA 3G6EA 3OWEB 3NXWA 4AH6A 2I5LX 4DR6Q 3GD7A 1DOMA 2HDLA 1B44D 3UDGA 1JMCA 3RD4A 1PFNA 1YNJD 4JI4L 3CMAA 4IPDA 1F2LA 3TREA 2KCMA 3PO3H 5IIFA 3D4WA 3AMUA 2DNEA 3E6ZX 2ATWA 3ND9A 2K7VA 1PTOH 5IYBH 1X54A 4A3LH 2K50A 4LF6Q 3DM3A 3CMEA 1D6EC 1W2BA 1VQMA 5CR3A 4CJ0B 2EY6A 2E5LQ 4L5RC 3B6YA 1U0LA 3A7AB 3J80i 4DV1L 4LF4L 4YCUA 5C0XH 1ENCA 4K5XA 1HH2P 2OEOA 3K0YA 2BH2A 2EOTA 3A54A 1F9SA 4B3SL 2ID0A 3I7FA 1VQ5A 2KJXA 1NNXA 1PRTD 1CSPA 2NB0A 2F0IA 2F4VQ 2D9UA 3GTKH 2PZTA 1Z7TA 5EQ0A 5C44H 3NWSA 3L9AX 5JEAH 3A8IE 3J80c 4L5SA 3WWVA 3D0FA 5EPKA 1IBLQ 3G4SA 2AQ1B 3K0XA 3OTOQ 4NB3A 1HQRD 2N49A 2IHEA 5C5LA 1LTRD 2RF4A 3CCMA 2VQFL 3S1NH 3SXHA 1ENAA 2OQKA 4NXML 3ERSX 1D1KA 1KRTA 1T5XD 2JYOA 2A5HA 4LF5Q 3I4MG 4C56C 3BVGA 1JE4A 3N6RA 1IL2A 4K8JA 2IY5B 1SNQA 1CZWA 2L4NA 1B53A 5E1FA 4GLXA 3GTOH 4IUNA 5CMDA 1H9KA 2AWNA 2TSSA 3J81c 1I6HB 3CQZH 3MHBA 5I6WA 2ZTEA 4R4TA 3OW2A 3P7JA 1X3EA 1SXTA 1I5FA 2MNAA 1V8QA 2ZT9C 2XIWA 1X65A 3KLSA 1TY0A 1FNUA 5EPJA 4YCWA 4C1NI 2EYOA 1NCVA 4GNXA 4JW0A 4G4KA 1XTCD 1L0XB 1TWHH 4JI3Q 4ME3A 5C6AA 3QG1A 1A62A 2NN6H 4L8JA 4LFAQ 2CWAA 1J5EQ 2EPBA 1I4GA 2C9OA 1BKBA 1YVCA 1SE8A 4HAEA 2YTYA 4NP5A 3PSIA 2RDFA 1Q81C 1CA5A 3Q23A 4X3KA 3M85A 1PH3A 1GKHA 1MHWC 5ELBA 4DAMA 3P1HA 3P20A 4S3SA 4CGYB 1Q3LA 3RR5A 4C3IB 4DV5L 2F3WA 4U68A 5T1IA 4A4IA 3KF6B 2D0PA 5M3FB 1X3FA 1KAWA 3EIVA 2WV6D 1G2TA 1HCZA 1PYWD 3GTPB 2MO0A 1ZYRC 2NVXH 3M3YB 4GLAC 2IHFA 3D8GA 4A3GB 2KBNA 4GKKQ 4C3IG 5M3FG 5KGUA 3TQYA 4GN3B 3N52A 3S1MB 4DV3Q 4JG2A 1VMPA 1DOKA 4DV4Q 1SEBD 1IKLA 1UE7A 3RZOH 1EWIA 1VF7A 4YWLA 1WI5A 2B2WC 1I50B 1BBWA 4A3GG 2FINB 1MSGA 2LXKA 4PMBA 1QUQA 3GO5A 4IPCA 3KFUA 5JPMC 2RHSB 1HTLD 4OO1I 3BZKA 2PNRC 3LWUA 1ZXTA 4HIMA 2K4KA 3S24A 3BYYB 3NTIA 2JA9A 4IO9A 1YEZA 3UDXA 1H9MA 4XQJA 3S2HB 4QB4A 2VL6A 5IP9H 5FLMH 4PV1C 5KIXA 5DM73 3I73A 2WB1B 1XMQQ 4FDBA 1JJGA 4FVMA 1MIUA 5JVG3 3NPPA 4XDXA 4JI2L 2Z4IA 5JOBA 2F0LA 5HY6A 1Q12A 3HGBA 1G2SA 1NE3A 5AJ3L 1E1TA 4IOCA 3S14B 1NUCA 4DN4M 5KYLA 4B3RL 3L3OC 1I6VC 1BCPF 2KVMA 3AB9A 2WB1G 1KL9A 3EFXD 4DV7Q 2LMCB 4NPSA 1YNXA 1AH9A 3V05A 2PQAB 1KHIA 5IGBA 1DOLA 1ET9A 1PHJA 5C4XB 2Q8RE 3BYTB 4RGMA 5JJIA 2L15A 4HMJA 3TP5A 5LMUL 3P75A 3H3VH 1JCKB 3HP3A 3A5UA 1IYUA 3PIOA 1EYDA 2Q2IA 1I4HA 1X3QA 2AWOA 4Z9CB 1HUMA 2HUGA 1SMYC 1VQ7A 3PUXA 3SK8A 3QO2A 5C4XG 2LFNA 3NBHA 3HOWH 3PGZA 2IWHA 2Z4HA 3ZJYC 4A3MB 2N88A 2ICEC 3M4OB 4F8MA 1SFOH 1O7LA 1MKHA 2EJGC 4JI1L 4IN3A 1D5ZC 2Z6KA 4BBSH 4RFBA 3L7ZC 1IHZA 1BO0A 4QMGA 1PFMA 4YY3Q 2E2JB 4A3MG 1CKOA 3BVZA 1YNJC 2E2IH 3BU2A 3U9OA 4BY7B 4DR6L 1IXRA 1EIFA 5LHY1 4JV5L 4LK1C 1VMCA 4LAAA 5M3MH 1E2VA 3MTSA 3WDNA 4IFDG 1GUTA 1TWFB 3TP6A 1CQVA 3MXUA 4UP8A 4Y7NB 1VQEA 1XPOA 5M5YB 1Q90A 3I72A 1P8LA 5IYDH 4LF6L 2VY3A 2K04A 4LUZA 2DN8A 5CGKA 1LUZA 2UXCQ 2E5LL 4DAYB 3NELA 1N33Q 2BA0A 1I3QB 1CFMA 3U9SA 4QIWE 1KNAA 2D2CC 1PRTC 4TRDA 2EXDA 1Y1WB 1DXMA 2PYKA 4K6DA 2AKWB 3I70A 3VDYA 2KCTA 5CV5A 4CKBA 1HNZQ 2VB2X 1VQ6A 3OIPA 2XGTA 1JT8A 3MEHA 2B2TC 4H02A 1ICFB 1EY7A 5NUCA 5CORA 4PG3A 3OMCA 2QW7A 4EQ5A 3I4MH 1Y1WG 3SR1A 1LTLA 4IPGA 4GOPA 3GTQB 4FNFA 4DR3Q 3S1QH 1HR0W 1PH4A 4AQYQ 1LO5D 1NAPA 1I4XA 1RD9D 1IBLL 1H9RA 4JBWA 2A6HD 4JOIA 4AIMA 1YI2A 2L5TA 2LY7A 5BN3A 4DNIA 1S4ZA 4MTNA 4LF4Q 3Q8DA 4LF5L 1A0IA 3J7A5 4C3HB 3CW2C 1QB5D 3MXNA 4B3SQ 5GAEC 2WKCA 4R4IA 2P5ZX 1JJ2A 5D14A 2NZOA 3S16B 4FO2A 1TVXA 1CKMA 1DM0B 2EJMA 1V1OA 4C3HG 2RKSA 4P71A 2B39A 1NSNS 5C3EH 1GO3E 2MHVA 2Q8TA 3I3CA 3WOFA 5J3BA 3LGJA 3F1ZA 3GTJB 4DR1Q 3KLRA 4A3EB 2JQOA 1VQDA 5HGTA 2CW0D 2AUKA 4NXMQ 1RL2A 1B8AA 1G6PA 2N55A 4ZRZA 5D3DA 3NWTA 4ZYSA 1G6ZA 4K6LA 2KHSA 1PYBA 4G7OC 3W3AA 1V1QA 1Y1VH 3GDEA 4WORA 1WTXA 3R93A 1A8VA 3QIAA 2B2UC 5E3FA 3V2TA 2MP1A 1CKNB 2Z9HA 1Q82C 5IYCH 4JI6Q 2QDBA 3KJPA 1GUSA 4A3BH 1STEA 1U5KA 1B70B 2F0NA 3T56B 2I5HA 1PTOD 3S1RB 3MZ5A 3J81j 4DV3L 4DV4L 2J0TD 3KLSX 1EEFD 3S15B 1GUGA 1E22A 1AW7A 4OEMB 4RMFA 1WTOA 3OIQA 1CT1D 2K6AA 3ULLA 3F8TA 4MN3A 1X3GA 5LL6S 3T51B 5C4JB 1U4RA 2Z8LA 2HD3A 4J6HA 2A74C 3SDZA 3A56A 4DXFA 3JAMi 1TY2A 2JA7B 1S3OA 4DV5Q 4LF8L 4LF7Q 3AU7A 2Z1CA 4F87A 1WYDA 2K05A 4IJLA 1DONA 4EVOA 4A3IB 2Q2TA 1TT2A 3J7AF 3CPFA 2JA7G 1XMQL 1V1PA 4QY7A 2K5NA 3C2PA 2C35B 4N9TA 4QUFA 3VYSA 4G57A 4A3IG 1SSOA 1NY4A 1Z9FA 3E3XA 3W5OA 3V96A 1TS2A 1SROA 3JAMc 1Q7YC 1B4OA 2VB3X 4DV7L 2DGYA 4ZCKA 2F4IA 2AQ3B 5HGQA 2PW7A 3UI2A 4HJAA 3KBXA 5LMNW 3WOEA 5CV8A 2NZHA 1H9SA 1KABA 2V4DA 1CQFA 1C8CA 5DNFA 3BG3A 3HKZB 3D4RA 3DUZA 4BBRH 5FLXL 1K83B 1HFNA 4DR7Q 1HHVA 3FEWX 2VZAA 4JI2Q 4QUCA 4WRDA 4EQNA 1B9MA 1LV9A 4HMIA 3PUWA 3EROA 3HKZG 1CA6A 2XN9C 1BNZA 5ELEA 2OTLA 4X66L 1EYAA 4OL7A 2L0CA 4CJ2C 2F03A 3VR4A 4X3SA 1A63A 3FKIH 1EOVA 4C2MB 1PH7A 4C3JH 3R2IA 1S5FD 2E2DC 1LM0A 4KY7A 3OHXC 5M9OA 1GJXA 3GP7A 1Q8KA 1N32Q 4RWSC 5TSSA 3R3OA 4R9WA 2KEEA 2Y0SG 2KCNA 1M90C 1MI2A 1RJTA 4I7ZC 5JAVA 4A3KH 5GROA 1PH5A 2Q2UA 1HZBA 4DUYL 4GNXB 2NWGA 2UXCL 2VW9A 5FJ8H 1E24A 1IW7D 4TQUS 1N33L 2WAQG 1STHA 3OPOA 4DR4Q 3M4PA 5M5WH 1AFPA 4MIUA 5ELOA 4LNQA 2AMCB 4OIJA 1BUVT 4X65L 1E2WA 5CYUA 1HNZL 3PIPA 3KJOA 4XQQA 1F2YA 3H0GB 4JV5Q 4IURA 1Y8OB 1CHQD 1R9TH 1PA6A 1SYCA 4UAIA 4A93H 2JA5H 2L11A 1F2ZA 1AN8A 2I07B 4DR3L 4RCOA 5KRUA 1HR0Q 4AQYL 3CCEA 1Q46A 2K5VA 1TWAB 5IGCA 2HCIA 1LTGD 3NEMA 1SE3A 3H0GG 2NVTH 2H5XA 3FVQA 3K7AB 5BN4A 3D4DA 4P73A 3CCLA 3CKIB 3PO2H 2UXBL 2RVLA 1D7QA 2WP8J 2MFIA 3NENA 1VQFA 3PUYA 4NXNQ 3JC66 2N3SA 1K3BC 3DLLA 2NTSA 2CFMA 1K73C 2JE6I 5IP7H 3VA7A 3K81C 1BXTA 4H0LC 3SHLA 3K5MA 3NQIA 1E1OA 2O4XA 3HG9A 3SK5A 1QUQB 2QEJC 2KUMA 1WTVA 2K14A 4DU9A 1F9RA 3HOVH 3K5NA 2R7DA 4KN7C 1E7ZA 1X3PA 5CC4A 3CCSA 3MXPA 2R7FA 4XIGS 3J81i 1GVPA 1EY5A 1V43A 2K1BA 1Q1EA 3OWFA 4XT3B 2RDGA 4HIKA 3S2DB 2TMPA 2J4XA 1JQYD 1PZKD 1F77A 2BE5D 1EQTA 5IE8A 4A3CH 2R93B 4PZ6A 4F88A 1O78A 5GQOA 4DR1L 4LFBL 3RZDB 2AHOB 2XVSA 2RQXA 3I4NH 2RCFA 3CCUA 3T1HQ 4YHHQ 2DUDA 1PH8A 4IFDJ 2KHJA 2EYFA 3ULPA 2R93G 1TWCB 1GOZA 1L0YB 3HZXA 3CRLC 2K5HA 4CKCA 3GTGH 4HTHA 5GAHC 1ESRA 2EYLA 4XT1B 2JSOA 2B63B 3S17B 2DNCA 3I91A 3K57A 1GHKA 3C1EA 4B3ML 1SRUA 2XRQD 4NW2A 3AFPA 1PH1A 1PVOA 1QNKA 5L37A 4QCLA 3NBIA 4JI6L 4N8X1 2XWBB 1PFSA 4NDXA 1Y8NB 4HCSA 4A3DH 3BZCA 4DA2A 2B63G 1PRTF 3HOYH 1KNEA 1MBYA 1UE1A 1XNQQ 1QVCA 2OT2A 2F0SA 3T53B 2E2HH 1VQIA 1FD7D 5COYA 4TKOB 3TBIB 1CM9A 3VR5A 1M1KC 4KTAA 4IJHA 1SE2A 3U58A 3Q0AA 2A69D 4WFN3 1B3AA 1W3SA 2F0MA 1EZ8A 4TVAB 2R7ZB 1J9OA 3NE5B 4I7AA 4EQOA 1CI3M 1JR0D 1XYIA 1VQNA 2RA4A 4AYBB 4QL5A 1SJED 3IFDA 3K5LA 5FK9C 2CH4W 1SR3A 3NSWA 2K75A 2B8GA 3SK6A 3D3RA 4G7HC 1JWUD 1STGA 2B2VC 1CHPD 3KUPA 1VQOA 2K5WA 4LF7L 1SDFA 2R7ZG 1N34L 2NUCA 2Z6BA 3EN2A 2JA6B 3OSOA 4AYBG 4OGQC 1HNXQ 5KEEA 2QEXA 1Z47A 3HOUB 5A2QL 1X56A 4FXKC 2OF1A 4R4CA 2ZXPA 1LTBD 2JJQA 4DV2L 5FKAC 1OXXK 4XTCS 4A3FB 2JA6G 2DJGC 1TWGB 2NVYB 2YU9B 3MC0B 2IX1A 3EQLC 3OMGA 3RMHA 3HOUG 4UDUC 2UUAL 1EWCA 5EPLA 1K0RA 2I0QA 1JORA 1AE3A 4OO1H 4RKBA 1D5XC 4A3FG 5HURA 3A0JA 1A2UA 1BCPD 1LLRD 2NVQH 4JI0Q 1KIXA 4UP7A 4LF8Q 1WCMB 1KXLA 2F0PA 1U9RA 1XWEA 5C3WA 3AEVA 1SLJA 2A19A 4O0AA 4PMWA 3TMEA 5IGDA 1UWVA 2KA7A 4ZKCB 4GOPB 3HOXH 5M5XB 1FGUA 1L1OB 5K36G 2BDNA 2VUMH 2WKDA 3CXCA 2QCPX 4DR7L 2G5DA 1WCMG 4P75A 4G7ZC 4OHJA 4JYAQ 1JWSD 4QF4A 3TP7A 1JB3A 3GTMH 3VYUA 1QE6A 1A6XA 2O5JC 1RCVD 1DGSA 3T4AC 3HOZB 4DR5Q 2JA8H 4APVA 5I9OA 5FLXE 2XWJB 3MXNB 5C5MA 3E0JA 1R4PB 3IRBA 4A76A 4FYDA 1N32L 3J7AV 1K9MC 1KDAA 1LABA 2JP1A 3I55A 1XPRA 2ZJQA 4ME5A 1PH9A 1CK1A 3E9HA 2Z0SA 3C3LA 1EU3A 2MUYA 2HQLA 3C46A 1O7YA 1K3RA 4A3JB 2A68D 4DV0Q 2RCNA 1CTMA 2UUCL 4BY1B 2PMZB 1GUNA 2PZUA 1NTGA 4DR4L 1Y69U 1IBKL 1UE6A 5IT9c 1A15A 3MAQA 4KHVA 5J39A 2K5QA 4OWXB 3H3VI 4A3JG 1X55A 4X66Q 1SBBB 3GTLB 5IGGA 3RUZA 4BY1G 1O7IA 1EZ6A 5E7NA 1Q1BA 4O42A 4OELB 1YBYA 4KD3A 4ALPA 2SNSA 1YIJA 2RSOA 3K58A 1OTCA 5DAUA 1UNSA 3H15A 1HR0L 1WTWA 1EFID 3TDQA 4BY7G 4JVZA 4OONA 1EOTA 4DUYQ 1CUKA 1FYCA 4GNXC 3MFYA 4L6TB 1M8AA 5KNDA 3I8ZA 3K6OA 4NXNL 2YYZA 4L5QA 2UUBQ 1PZJD 3LX0A 3J7YW 1ML0D 2GVBA 1EUJA 2D62A 3M9BA 3M4QA 1QNUA 4YWMA 1II3A 3I4OA 4X65Q 2F1MA 2K28A 2L9HA 2RSNA 2GN5A 4DK0A 1RHPA 5IY0A 2HIXA 4ULLA 2OXPA 3U4VA 1AP0A 1E0BA 1EQVA 2R92B 4EX5A 1H9JA 1ENFA 3I2ZA 4CDFC 2BE5C 3A8KE 3D6WA 3HEJA 3FMCA 2F3IA 5EKIA 1U4PA 4DPGA 3DWAA 5CV9A 4N8FA 4P2CB 1STAA 2R92G 4Y52H 3NK9A 3NHHA 3KF8A 2MPMA 3DEOA 2UXBQ 1KRSA 3KDFA 3OW7A 3T1HL 1I4PA 3KK7A 4YHHL 3G48A 1HPCA 5C3XA 2FMCA 2NBFA 4CBVA 2F0UA 1EFWA 3RLOA 4B9XA 2B3GA 3OOCA 2ZTDA 3FPPA 4RGOS 1KLGD 1EYCA 1B1ZA 1VQJA 4PZ7A 4RGNA 4UY8C 2N8NA 4HSPA 3AYHB 5CBAE 3PO3B 3SEBA 1WOCA 2I5MX 1JOOA 2L55A 1PTOB 4CHTB 4GLVB 2E74C 1HNWQ 4KHPQ 1LACA 4BS9A 1XNQL 1HTPA 5EGTA 2PQAA 2BH8A 1AZQA 3FHWA 2A69C 4XYQA 2IJ0A 3PO3G 1H9SB 3F2BA 1STYA 4HJ9A 2EQSA 5E4WC 3ND8A 4LFCQ 1SYDA 3K8AA 2ZXRA 1ET6A 4LFBQ 4A3LG 4JI5L 4UHVA 2XTIA 2B2YC 2F0HA 4JPBW 1I4QA 2QKIC 1STNA 2WACA 1MJCA 1UEAB 3BDOA 2WB1E 5C0XG 2KQ3A 4C3IH 5M3FH 1NR2A 3J80E 4UP9A 4HSVA 2PZWA 1HZAA 4A3EG 5H1SE 1EQQA 3G7LA 3GTPH 3GTKB 4DFAA 5CV6A 3DWQA 3M3YH 5C44B 4L63B 4B3MQ 1RIPA 4A3GH 2R6GA 3O13A 3T16A 4CDCC 1HNXL 4WJ3M 2K32A 1J8IA 2KENA 1RTNA 1C4QA 3S1MH 1LT3D 3A5ZB 1ZEQX 1WTRA 3S1NB 5C44G 5JEAG 3J81E 3RN5A 1I50H 1DCZA 1MGSA 3DM1A 1NMGA 2IPKD 4RH6A 1FNWA 5ELFA 3GTOB 3CQZB 4H7BA 1N9WA 3KOJA 4GS3A 5A2QE 1JOKA 2Z6KC 1EU4A 4DAYA 1SNMA 3CAMA 2EYHA 4FF4A 4K5WA 3BZDB 4JI0L 4B9WA 4OIKA 3QR8A 1YHBA 4J1MA 3I90A 1N34Q 1SMXA 1TWHB 5LMNL 3TZUA 3VYTA 2C5CA 3PF5A 1YHAA 1VQKA 1QJOA 1UE5A 3W2DA 4KV6A 4HJ8A 3ITPA 4MNOA 2D0OA 5G3LF 3OYYA 4DV2Q 2OTJA 3S14H 1RODA 4JI7L 2DY8A 2YTVA 2EY5A 4JYAL 3FRPB 1C48A 1ESFA 2NN6G 4FXDA 1C7YA 4RA8A 1PTOF 1D8LA 2UUAQ 5C4XH 2B29A 3CCQA 2LSSA 3G6JB 4H44C 2HIVA 3CCRA 4DR5L 1B3QA 1SYGA 3NTKA 2NVXB 3CCVA 3TEHB 2B8FA 1GD7A 2A68C 2X6LA 5CV7A 2L12A 2HT1A 4DV6Q 1S72A 3F2UA 4CKEA 4A3MH 3M4OH 1BR9A 1DJRD 3HS0C 1S5BD 4XYOA 4PZ8A 4DK1A 4GOPC 1ICWA 1K8OA 1L1OC 1TU2B 4K5VA 3U50C 4DV0L 3RZOB 3AQQA 1Q8IA 3MEFA 1C0AA 1JE5A 3TN2A 4IFDH 2F0QA 1QZGA 4BA1I 2E2JH 1XPUA 4ABNA 1LTID 4BY7H 1BF4A 1SYBA 3IFTA 3JAML 4X6AH 1QG7A 1V9PA 4JI8Q 3C1FA 2ALYB 2E75C 1TWFH 4XQNA 4YIJA 3LNNA 3L0OA 4Y7NH 3ER0A 5M5YH 2H1EA 1SNDA 4LWCA 5BR8Q 4DUZL 1N36Q 4X64L 2FXQA 2UU9L 2QILA 1BVSA 1EIHA 3EVQA 3PUVA 4QGUA 4DK6C 1XMOQ 2ZTCA 2IL8A 1KD1C 2B2VA 1I3QH 5IP9G 5DEHA 1AZPA 3TS0A 5IOCA 5FLMG 2ENBA 5JJKA 3GV3A 1CKNA 1KDCA 1Y1WH 2UUCQ 1CSQA 2JN4A 1TS5A 4ZKBB 1VQGA 3KYHC 2UUBL 4LJZC 1IBKQ 1X32A 5EJWA 3G71A 1XNRL 4ZLTF 1T9HA 3MWYW 4IUUA 2PO4A 1O7ZA 2CQAA 2HCCA 2PPBC 2ZM6L 4RG1A 1WJJA 1Y14B 2EY1A 3GTQH 5F2DA 1NJIC 1JJCB 4POFA 1DYQA 1SMYD 2B2WA 5KNCA 3TP8A 4C1NK 5IODA 3HOWB 2A6HC 3CC4A 1E3PA 1K8GA 5DM63 4X3UA 1SFOB 1KQSA 3Q6SA 1WTPA 2JXMB 3BDLA 4TSSA 4C3HH 4BBSB 3HOWG 1KC8C 2KEDA 1JB7A 2A6ED 4K0KQ 4V190 1OXSC 1K28A 5FOBB 3A74A 1L2FA 1KAAA 2E2IB 4DNRB 1PH6A 1IYJB 1FVIA 4M1UB 3S16H 4FXGC 1VQHA 5M3MB 1AE2A 2M00A 2UXDQ 1HZ9A 4BBSG 3VYRA 1ONLA 2EYMA 3TZDA 1QVGA 1XTDA 1U4MA 4DKAC 4QJFA 2K01A 1LTTD 2ASBA 1ILPA 2KOLA 1HNWL 5M3MG 3DHQA 3FDTA 4KHPL 3X3MA 4DXGA 3GTJH 5C0XI 4A3EH 2PNHA 3CF5A 4JK1C 2CW0C 1IL8A 4JC0A 3F2DA 5J1ZA 4LFCL 1X9NA 4KHZA 1K8MA 5IYDG 1S40A 4OXPA 1X6OA 1IKMA 4DF7A 4BXXG 3GV6A 4P74A 1LTSD 1SNCA 1EY4A 4MHEA 3RN2A 3I4MB 3PV0A 5CV4A 3J7ZC 2DJFC 4IUQA 4Q5VA 3S1QB 2OQ0A 3HFZB 4IZ8A 4FF1A 4KLKA 1HJPA 2CHBD 2WINB 3U4ZA 1PTOC 3DXJC 4KKUA 1GUOA 3T1YQ 3E9IA 3FPUB 3S1RH 1RF2D 3X3NA 1IYVA 5ELNA 5IGEA 1WD0A 1VF5C 4P72A 3J80L 3RLNA 3VR6A 4L5TA 4CDDC 4LMQD 3S15H 3CCJA 3BVMA 3ULJA 1BBXC 3NBHB 4J15A 4JI5Q 2QGQA 5T1GA 3GQBA 3LWEA 4PQXA 1ASYA 1G91A 3HKZE 4HN7A 5C4JH 1BCPB 4J8QA 5K5PA 1I94Q 2JA7H 5IWAQ 3J81L 4QIWB 2VQEQ 1N8RC 3K5OA 1WD1A 1AEXA 4JCVE 3CRKC 3CC2A 1YZ6A 3DMUA 5C3EB 4A3IH 4F7XA 3IKJA
chains in the Genus database with same CATH topology
3TSSA 2NN6I 3T13A 1GHJA 2LKVA 3VA5A 1G8ZD 2EDGA 2B2TA 1B50A 2K03A 2M9VA 4ILWA 1HFGA 2SOBA 4DAVA 3NTHA 4RKLA 2F0OA 5FO8B 3SE0A 1WVLA 2SDFA 2DY7A 1OO9B 1YNND 3MVVA 1Y1VB 2NZ1D 3HRZC 5D65A 2K5DA 2MGSA 1DZ1A 2G9DA 1A3TA 4PNYA 4A3BB 5JPNC 2HQEA 4X3TA 4K2KA 2EE1A 5KYIA 1M4VA 4O1NA 3BDCA 1TKWB 2BCOA 4NKLA 5LL6X 1A3UA 5C0XJ 5I2YA 1EY9A 4V0BA 4EGVA 1OXVA 4FP5D 3PIO3 3M7GA 1F9QA 2CVRA 2EVBA 2EY2A 4I65A 1UAPA 4KJNA 1F9PA 2B2YA 1PLFA 1A2TA 1GXDC 2JEBI 1BDOA 1MSHA 1EY8A 1TS4A 5JEAJ 5D3IB 1S5DD 2FHTA 4E6IA 5I4DA 1EY6A 1D1IA 1S5CD 1IW7C 1EWHA 4HCEA 5EKKA 3JAME 4RHRA 2NTTA 2EXZA 3EA6A 2B2UA 4ZQ3A 1QOHA 4KY5A 1GUWA 1QCBD 1MD2D 1JC7A 2QF7A 3NQTA 1A3VA 4KI0A 1TS3A 3MFGA 5JVH3 3NUCA 4RGTA 3MXGA 2BDOA 3E5SA 2PQEA 5C4ZA 3VR2A 4BBRB 1NR4A 2A6EC 5KNBA 5J22A 3QWNA 1SNPA 2F3VA 4KN4C 5ELDA 1STBA 3M7NA 3ERQA 1FNVA 5IT9L 3ZYYX 3FKIB 1D5MC 4C3JB 1QWYA 1HA5A 2F0TA 2Q8IB 1KTKA 2JEAI 2F0EA 5I2XA 3H3VC 3QOJA 4KMUC 3H09A 2KCCA 4C3JG 4A3KB 4ODGA 5E4XA 1ZKOA 4U673 2BA1A 1D2BA 2F0JA 3M4YA 4FF3A 5BN5A 3H6MA 4PMCA 2PCFB 5JJZA 1TIID 1JOQA 2XSCA 1HA6A 5M5WB 4B08A 1SAPA 1V1PB 4K8IA 1PFBA 1Z6HA 1HUNA 2R3ZA 1RTOA 5IGFA 1TQOA 1R9TB 1OXUA 4A93B 2JA5B 1Y8PB 2ICIA 1HRJA 4KJOA 1KLUD 1SJHD 2F0VA 3ONAB 1PXUA 2M2LA 3I4LA 2FJ2A 2NVTB 2O2LD 1OXTA 1SE4A 5I9PA 2X69A 2IT1A 5FO7B 3PO2B 3R2TA 1B2TA 4ZUIA 5C4HA 2K33A 3MA2B 2RBMA 1LT4D 1XXGA 3D31A 2WIIB 1S5ED 1HXYD 2NYZD 1EIGA 3HOVB 2I46A 4DNTB 4ZK9B 5EBDA 1G291 1FGBD 2D5DA 2LS01 4BWGB 1FR3A 4K2LA 4IUPA 4RHSA 2O5IC 1BOSA 3SK4A 2IX0A 2A73B 3I4NB 2F0DA 1U4LA 3H91A 3IL8A 4KD4A 5A35A 1YNNC 1UUPA 1EL0A 2J7ZA 1JICA 5G3LD 2F0KA 3GTGB 1BCPC 2VXWA 4R8IA 4NMZA 1B9NA 4KKSA 5K36H 1BQQT 2F0GA 3K59A 1ILQA 2SEBD 1SYFA 3CHBD 5EBCA 4A3DB 2KECA 3H94A 3HOYB 1JWMD 1W6JA 3IAYA 3PUZA 4HEDA 2E2HB 1T5EA 4FF2A 4BA2I 2RDHA 1WTQA 2F0FA 2EYPA 2GA4B 1XX8A 5I6YA 5AFWA 1DD2A 4IQZA 2EZVA 4EQPA 2PW5A 2XNAC 4HR7B 3NP8A 1R4QB 2IW3A 4GZYC 3BS1A 4KY6A 2F0WA 2AQ2B 1RDPD 2X6GA 3QB3A 1ZYRD 1PMRA 1CZGA 3RLFA 1EY0A 4ZAIA 1SNOA 4ID6A 5CBEE 4M8AA 5ELCA 1TR5A 2L1BA 2G9HD 5EKLA 1VDZA 2BOSA 4N9PA 4R8NA 4DGZA 1LT6D 2SNMA 1E2ZA 3Q22A 3URYA 2MJ8A 3S9WA 2HDMA 2XRSD 3Q24A 5ISRA 3CU7A 4RCNA 3KBGA 2NVQB 4IUTA 2E76C 1PZID 3QJYA 4OO1G 3A55A 4WJWA 4KK7A 3VR3A 2EJFC 2ZXOA 4KKTA 2R61A 4IFDI 3HOXB 4K14A 1W6KA 2FFKB 3D6CA 2VUMB 1QILA 1PDQA 3PIP3 2Y0SB 3EJIA 3SVMA 3A8JE 3GTMB 1I4RA 3A7LA 1LTAD 1RKNA 4ZUJA 1EEID 1SYEA 2JA8B 2WAQB 3QOLA 2AUJD 2FMMA 4DAPA 3DWPA 1KDBA 1O80A 2VNUD 4H13C 2IX3A 1VCIA 5IT9E 1LT5D 4RAUC 4IALA 1PRTB 3R8BA 4Q0FA 4XXEA 4CJ1B 4IUVA 2H4OA 5FO9B 3PMFA 1F2MA 3DEPA 1HQMC 2EYJA 3OWEB 3NXWA 3GD7A 1DOMA 2HDLA 1B44D 3RD4A 1PFNA 1YNJD 1F2LA 5IIFA 3D4WA 3AMUA 2DNEA 3E6ZX 3ND9A 2K7VA 1PTOH 1D6EC 5CR3A 4CJ0B 2EY6A 3A7AB 5C0XH 1ENCA 4K5XA 2OEOA 3K0YA 2EOTA 3A54A 1F9SA 2ID0A 2KJXA 1PRTD 2NB0A 2F0IA 2D9UA 2PZTA 1Z7TA 5EQ0A 3NWSA 3L9AX 5JEAH 3A8IE 5EPKA 2AQ1B 1HQRD 5C5LA 1LTRD 3SXHA 1ENAA 1D1KA 1T5XD 2JYOA 2A5HA 4C56C 3BVGA 1JE4A 3N6RA 4K8JA 1SNQA 1CZWA 2L4NA 1B53A 5E1FA 4IUNA 5CMDA 1H9KA 2AWNA 2TSSA 1I6HB 3MHBA 5I6WA 3P7JA 1SXTA 1V8QA 2ZT9C 2XIWA 3KLSA 1TY0A 1FNUA 5EPJA 4C1NI 2EYOA 1NCVA 4G4KA 1XTCD 1L0XB 5C6AA 3QG1A 2NN6H 4L8JA 2EPBA 1I4GA 2C9OA 4HAEA 4NP5A 2RDFA 1CA5A 3Q23A 4X3KA 3M85A 5ELBA 3P1HA 3P20A 4S3SA 4CGYB 1Q3LA 4C3IB 5M3FB 2F3WA 4U68A 5T1IA 2WV6D 1G2TA 1HCZA 1PYWD 3GTPB 1ZYRC 3M3YB 3D8GA 4A3GB 4C3IG 5KGUA 3N52A 3S1MB 1VMPA 1DOKA 1SEBD 1IKLA 1VF7A 2B2WC 1I50B 2FINB 1MSGA 4PMBA 3GO5A 5JPMC 1HTLD 4OO1I 2PNRC 3LWUA 1ZXTA 3BYYB 3NTIA 1H9MA 4XQJA 3S2HB 4QB4A 4PV1C 5KIXA 5DM73 3I73A 2WB1B 4FVMA 5JVG3 3NPPA 4XDXA 2Z4IA 5JOBA 2F0LA 1Q12A 3HGBA 1G2SA 3S14B 1NUCA 4DN4M 5KYLA 3L3OC 1I6VC 1BCPF 2KVMA 3AB9A 3EFXD 2LMCB 3V05A 5IGBA 1DOLA 1ET9A 5C4XB 2Q8RE 3BYTB 4RGMA 4HMJA 3TP5A 3P75A 1JCKB 3HP3A 1IYUA 1EYDA 1I4HA 1X3QA 2AWOA 4Z9CB 1HUMA 2HUGA 1SMYC 3PUXA 3SK8A 3QO2A 2LFNA 3NBHA 2IWHA 2Z4HA 4A3MB 2N88A 2ICEC 3M4OB 4F8MA 1O7LA 2EJGC 4IN3A 1D5ZC 4RFBA 1IHZA 3L7ZC 1BO0A 4QMGA 1PFMA 2E2JB 3BVZA 1YNJC 3U9OA 4BY7B 5LHY1 4LK1C 1VMCA 4LAAA 1E2VA 3MTSA 3WDNA 4IFDG 1GUTA 1TWFB 3TP6A 1CQVA 3MXUA 4Y7NB 5M5YB 1Q90A 3I72A 2K04A 2DN8A 5CGKA 2BA0A 1I3QB 1CFMA 3U9SA 1KNAA 2D2CC 1PRTC 4TRDA 1Y1WB 1DXMA 2PYKA 4K6DA 3I70A 5CV5A 4CKBA 2VB2X 3OIPA 3MEHA 2B2TC 1EY7A 5NUCA 5CORA 3OMCA 3SR1A 3GTQB 4FNFA 1LO5D 1NAPA 1I4XA 1RD9D 1H9RA 4JBWA 2A6HD 2L5TA 2LY7A 5BN3A 1S4ZA 4C3HB 1QB5D 3MXNA 2WKCA 5D14A 3S16B 4FO2A 1TVXA 1DM0B 2EJMA 1V1OA 4C3HG 2RKSA 2B39A 1NSNS 2MHVA 2Q8TA 3I3CA 3WOFA 3GTJB 3KLRA 4A3EB 5HGTA 2CW0D 2AUKA 2N55A 4ZRZA 5D3DA 3NWTA 4ZYSA 1G6ZA 4K6LA 2KHSA 4G7OC 3W3AA 4WORA 1WTXA 3R93A 3QIAA 2B2UC 5E3FA 3V2TA 2MP1A 2QDBA 1GUSA 1STEA 2F0NA 3T56B 1PTOD 3S1RB 3MZ5A 2J0TD 3KLSX 1EEFD 3S15B 1GUGA 1AW7A 1WTOA 3OIQA 1CT1D 2K6AA 4MN3A 5LL6S 3T51B 5C4JB 1U4RA 2Z8LA 4J6HA 2A74C 3SDZA 3A56A 4DXFA 1TY2A 2JA7B 3AU7A 2Z1CA 4F87A 2K05A 1DONA 4EVOA 4A3IB 1TT2A 3J7AF 1V1PA 3C2PA 4N9TA 4QUFA 3VYSA 4G57A 1SSOA 3V96A 1TS2A 1B4OA 2VB3X 2F4IA 2AQ3B 2PW7A 3UI2A 3KBXA 3WOEA 5CV8A 1H9SA 1KABA 2V4DA 1CQFA 1C8CA 5DNFA 3BG3A 3HKZB 3D4RA 3DUZA 5FLXL 1K83B 1HFNA 1HHVA 3FEWX 4QUCA 4WRDA 4EQNA 1B9MA 1LV9A 4HMIA 3PUWA 3EROA 1CA6A 2XN9C 1BNZA 5ELEA 1EYAA 4OL7A 2L0CA 4CJ2C 2F03A 3VR4A 4X3SA 4C2MB 3R2IA 1S5FD 2E2DC 4KY7A 3OHXC 5M9OA 1GJXA 3GP7A 4RWSC 5TSSA 3R3OA 4R9WA 2KEEA 2KCNA 1MI2A 1RJTA 4I7ZC 5JAVA 2NWGA 1IW7D 4TQUS 1STHA 3OPOA 1AFPA 4MIUA 4OIJA 1BUVT 1E2WA 5CYUA 4XQQA 1F2YA 3H0GB 4IURA 1Y8OB 1CHQD 1SYCA 4UAIA 2L11A 1F2ZA 1AN8A 2I07B 4RCOA 5KRUA 5IGCA 1TWAB 2HCIA 1LTGD 1SE3A 3FVQA 3K7AB 5BN4A 3D4DA 3CKIB 2RVLA 2WP8J 3PUYA 2NTSA 2JE6I 3VA7A 1BXTA 4H0LC 3SHLA 3K5MA 3NQIA 2O4XA 3HG9A 3SK5A 2QEJC 2KUMA 1WTVA 4DU9A 1F9RA 3K5NA 4KN7C 1X3PA 5CC4A 3MXPA 4XIGS 1EY5A 1V43A 2K1BA 1Q1EA 3OWFA 4XT3B 2RDGA 3S2DB 2TMPA 2J4XA 1JQYD 1PZKD 1F77A 2BE5D 1EQTA 2R93B 4F88A 1O78A 3RZDB 2XVSA 2RQXA 4IFDJ 2EYFA 1TWCB 1GOZA 1L0YB 3HZXA 3CRLC 4CKCA 4HTHA 1ESRA 2EYLA 4XT1B 2JSOA 2B63B 3S17B 2DNCA 3I91A 3K57A 1GHKA 3C1EA 2XRQD 4NW2A 1QNKA 4QCLA 3NBIA 2XWBB 4NDXA 1Y8NB 4HCSA 4DA2A 1PRTF 1KNEA 1MBYA 2OT2A 2F0SA 3T53B 1FD7D 5COYA 4TKOB 3TBIB 1CM9A 3VR5A 4KTAA 1SE2A 3Q0AA 2A69D 4WFN3 1B3AA 2F0MA 1EZ8A 2R7ZB 1J9OA 3NE5B 4EQOA 1CI3M 1JR0D 1XYIA 2RA4A 4AYBB 1SJED 3IFDA 3K5LA 5FK9C 3NSWA 2B8GA 3SK6A 3D3RA 4G7HC 1JWUD 1STGA 2B2VC 1CHPD 3KUPA 2K5WA 1SDFA 2NUCA 2JA6B 3OSOA 4OGQC 5KEEA 1Z47A 3HOUB 5A2QL 4FXKC 2OF1A 2ZXPA 1LTBD 5FKAC 1OXXK 4XTCS 4A3FB 1TWGB 2NVYB 2YU9B 3MC0B 2IX1A 3EQLC 3OMGA 3RMHA 4UDUC 1EWCA 5EPLA 1JORA 4OO1H 4RKBA 1D5XC 5HURA 1A2UA 1BCPD 1LLRD 1WCMB 2F0PA 1U9RA 1XWEA 5C3WA 4PMWA 3TMEA 5IGDA 2KA7A 4ZKCB 5M5XB 5K36G 2BDNA 2WKDA 2QCPX 4G7ZC 4OHJA 1JWSD 4QF4A 3TP7A 1JB3A 3VYUA 1QE6A 1A6XA 2O5JC 1RCVD 3T4AC 3HOZB 5I9OA 5FLXE 2XWJB 5C5MA 3E0JA 1R4PB 4FYDA 3J7AV 1KDAA 1LABA 2JP1A 4ME5A 1CK1A 3C3LA 1EU3A 2MUYA 3C46A 1O7YA 4A3JB 2A68D 1CTMA 4BY1B 2PMZB 1GUNA 2PZUA 1Y69U 1A15A 3MAQA 4KHVA 5J39A 2K5QA 1SBBB 3GTLB 5IGGA 3RUZA 1EZ6A 1Q1BA 4O42A 4KD3A 2SNSA 2RSOA 3K58A 5DAUA 1UNSA 1WTWA 1EFID 3TDQA 1EOTA 1FYCA 3MFYA 4L6TB 1M8AA 5KNDA 3I8ZA 3K6OA 2YYZA 1PZJD 3LX0A 3J7YW 1ML0D 2D62A 1QNUA 1II3A 2F1MA 2K28A 2L9HA 2RSNA 4DK0A 1RHPA 4ULLA 2OXPA 1AP0A 1E0BA 1EQVA 2R92B 1H9JA 1ENFA 2BE5C 3A8KE 3D6WA 3HEJA 3FMCA 5EKIA 1U4PA 3DWAA 5CV9A 4P2CB 1STAA 3NK9A 3NHHA 3KF8A 2MPMA 3DEOA 3OW7A 1I4PA 3KK7A 1HPCA 5C3XA 2FMCA 2NBFA 4CBVA 2F0UA 4B9XA 3OOCA 3FPPA 4RGOS 1KLGD 1EYCA 1B1ZA 4RGNA 4HSPA 5CBAE 3PO3B 3SEBA 1JOOA 2L55A 1PTOB 4CHTB 2E74C 1LACA 4BS9A 1HTPA 5EGTA 1AZQA 2A69C 4XYQA 2IJ0A 1H9SB 1STYA 5E4WC 3ND8A 1SYDA 2ZXRA 1ET6A 2B2YC 2F0HA 1I4QA 2QKIC 1STNA 2WACA 1UEAB 3BDOA 5C0XG 2KQ3A 1NR2A 3J80E 4HSVA 2PZWA 3G7LA 3GTKB 4DFAA 5CV6A 3DWQA 5C44B 4L63B 2R6GA 3O13A 3T16A 1J8IA 2K32A 1RTNA 1C4QA 1LT3D 1ZEQX 1WTRA 3S1NB 5JEAG 3J81E 1DCZA 1MGSA 3DM1A 2IPKD 4RH6A 1FNWA 5ELFA 3GTOB 3CQZB 4H7BA 5A2QE 4DAYA 1JOKA 1EU4A 1SNMA 4FF4A 2EYHA 4K5WA 3BZDB 4B9WA 4OIKA 4J1MA 3I90A 1TWHB 3TZUA 3VYTA 2C5CA 1QJOA 3W2DA 4KV6A 3ITPA 5G3LF 1RODA 2DY8A 2EY5A 3FRPB 1C48A 1ESFA 2NN6G 4FXDA 4RA8A 1PTOF 3G6JB 4H44C 1SYGA 3NTKA 2NVXB 2B8FA 2A68C 2X6LA 5CV7A 2L12A 3F2UA 4CKEA 1BR9A 1DJRD 1S5BD 3HS0C 4XYOA 4DK1A 1ICWA 1K8OA 4K5VA 1TU2B 3RZOB 1Q8IA 3TN2A 4IFDH 2F0QA 4BA1I 4ABNA 1LTID 1BF4A 1SYBA 3IFTA 3JAML 1QG7A 3C1FA 2E75C 4XQNA 4YIJA 3LNNA 2H1EA 1SNDA 2QILA 1EIHA 3EVQA 3PUVA 2IL8A 2B2VA 5DEHA 1AZPA 5IOCA 2ENBA 3GV3A 1KDCA 1TS5A 4ZKBB 4LJZC 1X32A 5EJWA 4ZLTF 3MWYW 4IUUA 2PO4A 1O7ZA 2CQAA 2HCCA 2PPBC 2EY1A 5F2DA 1DYQA 1SMYD 2B2WA 5KNCA 3TP8A 4C1NK 5IODA 3HOWB 2A6HC 5DM63 4X3UA 1SFOB 3Q6SA 1WTPA 2JXMB 3BDLA 4TSSA 4BBSB 2KEDA 2A6ED 4V190 1OXSC 5FOBB 1KAAA 2E2IB 4DNRB 4M1UB 4FXGC 5M3MB 2M00A 3VYRA 1ONLA 2EYMA 3TZDA 1U4MA 2K01A 1LTTD 1ILPA 2KOLA 3DHQA 3FDTA 3X3MA 4DXGA 5C0XI 4JK1C 2CW0C 1IL8A 5J1ZA 4KHZA 1K8MA 1IKMA 4DF7A 3GV6A 1LTSD 1SNCA 1EY4A 4MHEA 3I4MB 3PV0A 5CV4A 4IUQA 4Q5VA 3S1QB 4IZ8A 4FF1A 2CHBD 2WINB 1PTOC 3DXJC 4KKUA 1GUOA 3FPUB 1RF2D 3X3NA 1IYVA 1WD0A 5IGEA 1VF5C 3J80L 3VR6A 4LMQD 3BVMA 1BBXC 5T1GA 3GQBA 3LWEA 4PQXA 1G91A 4HN7A 1BCPB 4J8QA 5K5PA 3J81L 4QIWB 3K5OA 1WD1A 1AEXA 3CRKC 3DMUA 5C3EB 4F7XA 3IKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L12 A;  4XT3 B;  4CJ2 C;  4X3S A;  3F2U A;  3P7J A;  1EQT A;  4XDX A;  2B2T C;  1NR2 A;  2X69 A;  4RAU C;  4HSV A;  2XIW A;  1ICW A;  1EOT A;  1B2T A;  5COR A;  3G7L A;  5EPJ A;  1G2S A;  2B2T A;  1B50 A;  4CJ1 B;  1NCV A;  2K03 A;  4IUV A;  4DN4 M;  4RWS C;  1M8A A;  1HFG A;  3TN2 A;  4R9W A;  3I8Z A;  3TZD A;  1U4M A;  2KVM A;  2KEE A;  2X6G A;  1MI2 A;  1NAP A;  1RJT A;  2K01 A;  3DEP A;  1WVL A;  1WTO A;  1J8I A;  1ML0 D;  1ILP A;  2KOL A;  4MN3 A;  1RTN A;  2SDF A;  2DY7 A;  1BF4 A;  3FDT A;  1DOL A;  1DOM A;  1ESR A;  4ZKC B;  4XT1 B;  2NZ1 D;  1U4R A;  1QG7 A;  2HDL A;  2NWG A;  2L9H A;  2K28 A;  2Q8R E;  2NYZ D;  1EIG A;  2RSN A;  3I91 A;  5D65 A;  1RHP A;  1NR4 A;  1PFN A;  2BDN A;  2EPB A;  2MGS A;  4ZAI A;  1DZ1 A;  1S4Z A;  4HAE A;  1F2L A;  3HP3 A;  1IL8 A;  4NW2 A;  4ZK9 B;  5CBE E;  1AP0 A;  1E0B A;  1QNK A;  1MGS A;  2H1E A;  1CA5 A;  2L1B A;  1X3Q A;  4X3K A;  2K05 A;  1HUM A;  2HUG A;  3DM1 A;  1WTW A;  3D6W A;  1IKM A;  1DON A;  4X3T A;  3QO2 A;  4HCS A;  4IUP A;  1QE6 A;  4OIJ A;  2EE1 A;  5EKI A;  1EIH A;  4CJ0 B;  1KNE A;  1U4P A;  2MJ8 A;  2N88 A;  2HDM A;  3GV6 A;  5D14 A;  1Q3L A;  5T1I A;  4U68 A;  1TVX A;  2IL8 A;  5COY A;  2B2V A;  4IUR A;  4QUF A;  1G2T A;  4MHE A;  1CM9 A;  1U4L A;  4UAI A;  2MPM A;  3DEO A;  4IUT A;  1AZP A;  2L11 A;  3H91 A;  3IL8 A;  2EOT A;  4OIK A;  1SSO A;  1F9S A;  3GV3 A;  4IUQ A;  1EL0 A;  1B3A A;  1BO0 A;  1PFM A;  4ZKB B;  5CMD A;  3I90 A;  1J9O A;  2J7Z A;  2JP1 A;  2Q8T A;  1XYI A;  1B4O A;  3I3C A;  2HCI A;  1X32 A;  2RA4 A;  5EJW A;  1JIC A;  4ZLT F;  1F9Q A;  3MWY W;  4IUU A;  3FPU B;  3IFD A;  3N52 A;  2CVR A;  1VMC A;  1O7Y A;  5E4X A;  1O7Z A;  1WD0 A;  1VMP A;  1DOK A;  2D9U A;  2FFK B;  2HCC A;  2RVL A;  1IKL A;  2VXW A;  3MTS A;  4R8I A;  2B2V C;  3UI2 A;  3KUP A;  1WTR A;  5EQ0 A;  1PDQ A;  4LMQ D;  5CBA E;  2B2W C;  1ROD A;  1SDF A;  1F9P A;  2DY8 A;  5JJZ A;  2FIN B;  1MSG A;  2B2Y A;  1PLF A;  2N55 A;  1HA6 A;  1ILQ A;  1MSH A;  3KBX A;  1BBX C;  1A15 A;  3SVM A;  5EPK A;  2B2W A;  5T1G A;  1C8C A;  3LWE A;  2FHT A;  5DNF A;  2KEC A;  1G91 A;  1SAP A;  4RA8 A;  1ZXT A;  2K04 A;  1G6Z A;  1PFB A;  4HED A;  4X3U A;  1AZQ A;  1HUN A;  2KUM A;  1WTX A;  1WTV A;  2R3Z A;  1RTO A;  3R93 A;  1HFN A;  1F9R A;  3Q6S A;  1WTP A;  1HHV A;  4O42 A;  2B2U C;  4QUC A;  2JYO A;  5E4W C;  2FMM A;  1WTQ A;  2MP1 A;  1KNA A;  1LV9 A;  1JE4 A;  1X3P A;  1WD1 A;  2RSO A;  1O80 A;  2B2Y C;  2B2U A;  1XX8 A;  2L4N A;  1B53 A;  2KED A;  1CA6 A;  1HRJ A;  1GUW A;  3ONA B;  2K1B A;  2M2L A;  1BNZ A;  5AFW A;  5EPL A;  2X6L A;  2FJ2 A; 
#chains in the Genus database with same CATH topology
 3TSS A;  2NN6 I;  2Y0S E;  3T13 A;  4DR2 Q;  1GHJ A;  2LKV A;  3VA5 A;  1G8Z D;  2EDG A;  2B2T A;  1B50 A;  2K03 A;  2M9V A;  5C3E G;  4ILW A;  1HFG A;  2SOB A;  4DAV A;  2WAQ E;  3NTH A;  4RKL A;  2F0O A;  5FO8 B;  3SE0 A;  1WVL A;  2SDF A;  2DY7 A;  1OO9 B;  1YNN D;  3MVV A;  1Y1V B;  2NZ1 D;  3HRZ C;  5D65 A;  2K5D A;  4GKJ L;  2MGS A;  1DZ1 A;  2G9D A;  1A3T A;  4PNY A;  2PI2 A;  4LF9 Q;  2K52 A;  4A3B B;  5JPN C;  2HQE A;  4X3T A;  3UE1 A;  1Y1V G;  4K2K A;  2EE1 A;  5KYI A;  1M4V A;  4O1N A;  4DV6 L;  3BDC A;  5LMN Q;  1TKW B;  3EBE A;  1K83 H;  1FL0 A;  4OWT B;  2BCO A;  5IYC G;  4NKL A;  5LL6 X;  1A3U A;  4X62 L;  4A3B G;  5C0X J;  5I2Y A;  1BBU A;  1EY9 A;  4V0B A;  4EGV A;  1OXV A;  1QZH A;  4JI7 Q;  2A8V A;  4HJ5 A;  2F52 A;  4FP5 D;  1LYL A;  3PIO 3;  3M7G A;  3KF8 B;  4POG A;  1F9Q A;  4C2M H;  3KDF B;  2CVR A;  4HID A;  2EVB A;  2JK8 A;  2EY2 A;  4I65 A;  1UAP A;  4KJN A;  4JI8 L;  3STB D;  1FJG Q;  2HHH Q;  2PI2 E;  1F9P A;  2B2Y A;  1PLF A;  1A2T A;  2VS1 A;  1GXD C;  3E0E A;  2JEB I;  1BDO A;  1MSH A;  5BR8 L;  1N36 L;  1EY8 A;  1TS4 A;  1PH2 A;  5JEA J;  2KHI A;  1EYG A;  5D3I B;  1S5D D;  2FHT A;  4LUV A;  4E6I A;  5I4D A;  1EY6 A;  3HOZ G;  1D1I A;  1S5C D;  1IW7 C;  1EWH A;  1XMO L;  4HCE A;  5DLQ E;  2ES2 A;  3K7U C;  5EKK A;  3JAM E;  4RHR A;  2NTT A;  1VQ9 A;  2EXZ A;  4GN4 B;  1VQC A;  1B7Y B;  3EA6 A;  2B2U A;  4ZQ3 A;  1VQL A;  1QOH A;  4KY5 A;  2WFW A;  1GUW A;  1QCB D;  1MD2 D;  1VS0 A;  1JC7 A;  2RHQ B;  2QF7 A;  3NQT A;  4YCV A;  3TS2 A;  1A3V A;  1VQA A;  3H0G H;  4KI0 A;  1TS3 A;  3MFG A;  4B3T L;  5JVH 3;  3NUC A;  4RGT A;  3MXG A;  2BDO A;  3E5S A;  4DUZ Q;  1TWA H;  2PQE A;  5C4Z A;  4X64 Q;  3CD6 A;  3VR2 A;  4BBR B;  3K7A H;  2A1A A;  2UU9 Q;  2CWP A;  1NR4 A;  1IBM L;  2A6E C;  5KNB A;  5J22 A;  3QWN A;  1TXY A;  1SNP A;  2F3V A;  4KN4 C;  3KF6 A;  5ELD A;  3F2C A;  1STB A;  3M7N A;  3ERQ A;  4BBR G;  1FNV A;  2YV5 A;  1QVF A;  1ASZ A;  4K0K L;  5IT9 L;  3ZYY X;  4OX9 Q;  3FKI B;  1J6Q A;  1D5M C;  4C3J B;  1QWY A;  1XNR Q;  1HA5 A;  5GAG C;  4JBJ A;  2F0T A;  2Q8I B;  1KTK A;  1G51 A;  2JEA I;  2F0E A;  2UXD L;  5I2X A;  2MO1 A;  3H3V C;  2ZM6 Q;  4IOA A;  3QOJ A;  4KMU C;  3FKI G;  3S2D H;  3H09 A;  2KCC A;  4C3J G;  4AYB E;  4A3K B;  4BXX H;  4ODG A;  3ICE A;  1P16 A;  2R93 H;  5E4X A;  4OWW B;  1ZKO A;  4U67 3;  2BA1 A;  1D2B A;  2F0J A;  3M4Y A;  4FF3 A;  3RZD H;  5BN5 A;  3BJU A;  1VQ4 A;  3H6M A;  4GN5 A;  4PMC A;  4MZ9 A;  4O2D A;  2PCF B;  5JJZ A;  1TII D;  1JOQ A;  2XSC A;  1HA6 A;  5M5W B;  4A3K G;  3W1G A;  2CH4 A;  1TWC H;  4B08 A;  1SAP A;  3L2P A;  2F4V L;  1V1P B;  4K8I A;  1PFB A;  3CC7 A;  1Z6H A;  5FJ8 G;  2B63 H;  3S17 H;  4LUO A;  1I6H H;  1HUN A;  4JI4 Q;  2R3Z A;  1RTO A;  1L1O A;  1TQO A;  5IGF A;  1R9T B;  1OXU A;  1PYS B;  4A93 B;  2JA5 B;  1YJ9 A;  1L0W A;  3UDF A;  1Y8P B;  2ICI A;  3OTO L;  1HRJ A;  4KJO A;  1KLU D;  1SJH D;  2MQH A;  2F0V A;  3ONA B;  1PXU A;  2M2L A;  3I4L A;  2FJ2 A;  1XJV A;  2NVT B;  3T1Y L;  2O2L D;  4DV1 Q;  1OXT A;  1SE4 A;  5I9P A;  2X69 A;  2IT1 A;  2YTX A;  4A93 G;  3K80 C;  2JA5 G;  2N78 A;  5FO7 B;  4JBM A;  3PO2 B;  3R2T A;  1B2T A;  4ZUI A;  5C4H A;  2K33 A;  1VQP A;  1H95 A;  2R7Z H;  3MA2 B;  3CP0 A;  5IYB G;  2RBM A;  1LT4 D;  1XXG A;  3D31 A;  2WII B;  1WTH A;  1S5E D;  1HXY D;  3PO2 G;  4CDE C;  2NYZ D;  1EIG A;  3HOV B;  2I46 A;  4DNT B;  1I94 L;  4ZK9 B;  5EBD A;  5IWA L;  2ZJP A;  5IP7 G;  4JI3 L;  1G29 1;  2JA6 H;  1FGB D;  2VQE L;  2D5D A;  2LS0 1;  4BWG B;  1FR3 A;  4K2L A;  4IUP A;  4RHS A;  4LFA L;  2O5I C;  1C9O A;  3HOU H;  1J5E L;  4DR2 L;  1BOS A;  3SK4 A;  3HKS A;  2IX0 A;  2VQF Q;  3HOV G;  4HJ7 A;  2A73 B;  4UPA A;  4A3F H;  3I4N B;  2F0D A;  4IPH A;  1U4L A;  1TWG H;  3H91 A;  3IL8 A;  2NVY H;  2YU9 H;  4KD4 A;  5A35 A;  1YNN C;  1UUP A;  1EL0 A;  2J7Z A;  4A3C G;  1JIC A;  5G3L D;  4R1J A;  1UEB A;  2F0K A;  3GTG B;  3I4N G;  3SGI A;  1BCP C;  3TRZ A;  2VXW A;  4R8I A;  4A75 A;  4NMZ A;  1B9N A;  4KKS A;  2PMZ E;  5K36 H;  1BQQ T;  1Q86 C;  2F0G A;  3K59 A;  4GKK L;  1WCM H;  1ILQ A;  2SEB D;  4LF9 L;  3S2H H;  1SYF A;  3CHB D;  5EBC A;  4A3D B;  2KEC A;  3H94 A;  3CPW A;  1YIT A;  1JWM D;  1W6J A;  4HIO A;  3IAY A;  3HOY B;  3PUZ A;  4HED A;  4R4Q A;  3FP9 A;  5M5X H;  2E2H B;  1T5E A;  4FF2 A;  4BA2 I;  1YHQ A;  2RDH A;  3W1B A;  1WTQ A;  2F0F A;  2EYP A;  4A3D G;  2GA4 B;  1XX8 A;  3KLW A;  3HOY G;  5I6Y A;  5AFW A;  1DD2 A;  4IQZ A;  3I56 A;  2EZV A;  4EQP A;  3STB C;  2PW5 A;  2CCZ A;  3HOZ H;  2XNA C;  4HR7 B;  3UDI A;  3NP8 A;  2LXJ A;  1R4Q B;  2IW3 A;  4GZY C;  3BS1 A;  1FJG L;  2HHH L;  4GKJ Q;  2CKZ B;  3PQI A;  4KY6 A;  1GM5 A;  2EIF A;  2F0W A;  5EAY A;  2AQ2 B;  1RDP D;  2X6G A;  3QB3 A;  1MJE A;  5FLX c;  2OWO A;  2E8G A;  1ZYR D;  1PMR A;  1CZG A;  3AFQ A;  3RLF A;  1SN8 A;  4A3J H;  1EY0 A;  1YJN A;  1YJW A;  4ZAI A;  1SNO A;  4ID6 A;  4BY1 H;  5CBE E;  4M8A A;  2Q2H A;  5ELC A;  1TR5 A;  2L1B A;  2G9H D;  5EKL A;  4JBK A;  4X62 Q;  1VDZ A;  2BOS A;  4N9P A;  4R8N A;  4DGZ A;  4QQB X;  1LT6 D;  4LW1 A;  2SNM A;  1E2Z A;  2V1C C;  4YWK A;  3Q22 A;  3URY A;  2MJ8 A;  3S9W A;  1NBW A;  2HDM A;  3GTL H;  2XRS D;  4JOI C;  3Q24 A;  1K0S A;  5ISR A;  3CU7 A;  4RCN A;  2GVA A;  3KBG A;  2NVQ B;  4IUT A;  5JJL A;  2E76 C;  1PZI D;  3QJY A;  4OO1 G;  3A55 A;  4WJW A;  4KK7 A;  3VR3 A;  2EJF C;  2ZXO A;  1WFQ A;  4KKT A;  2R61 A;  2ZJR A;  3HOX B;  1PV4 A;  4IFD I;  4K14 A;  1W6K A;  2FFK B;  3D6C A;  2VUM B;  5AJ3 Q;  1QIL A;  1PDQ A;  4B3R Q;  4YY3 L;  3PIP 3;  2Y0S B;  3EJI A;  2CQO A;  3SVM A;  3A8J E;  3GTM B;  1I4R A;  3A7L A;  1LTA D;  1RKN A;  3HOX G;  4ZUJ A;  4R4O A;  2VUM G;  1EEI D;  5LMU Q;  4OX9 L;  1SYE A;  3PCO B;  2JA8 B;  2OCE A;  1VQB A;  2WAQ B;  3QOL A;  3UE0 A;  2AUJ D;  2FMM A;  4DAP A;  1K8A C;  2R92 H;  3PF4 A;  3DWP A;  1KDB A;  1O80 A;  2VNU D;  5GAD C;  4B3T Q;  4H13 C;  2IX3 A;  1VQ8 A;  3RNU A;  4DK3 C;  2JA8 G;  1EQR A;  1VCI A;  1EIY B;  1HZC A;  4JI1 Q;  1LT5 D;  4RAU C;  5IT9 E;  4IAL A;  1PRT B;  3R8B A;  4MTK A;  4Q0F A;  2QDL A;  4XXE A;  4CJ1 B;  4IUV A;  2H4O A;  5FO9 B;  3PMF A;  1IBM Q;  1F2M A;  1NMF A;  2QA4 A;  1IZ6 A;  3DEP A;  4WJ4 A;  1HQM C;  2EYJ A;  3G6E A;  3OWE B;  3NXW A;  4AH6 A;  2I5L X;  4DR6 Q;  3GD7 A;  1DOM A;  2HDL A;  1B44 D;  3UDG A;  1JMC A;  3RD4 A;  1PFN A;  1YNJ D;  4JI4 L;  3CMA A;  4IPD A;  1F2L A;  3TRE A;  2KCM A;  3PO3 H;  5IIF A;  3D4W A;  3AMU A;  2DNE A;  3E6Z X;  2ATW A;  3ND9 A;  2K7V A;  1PTO H;  5IYB H;  1X54 A;  4A3L H;  2K50 A;  4LF6 Q;  3DM3 A;  3CME A;  1D6E C;  1W2B A;  1VQM A;  5CR3 A;  4CJ0 B;  2EY6 A;  2E5L Q;  4L5R C;  3B6Y A;  1U0L A;  3A7A B;  3J80 i;  4DV1 L;  4LF4 L;  4YCU A;  5C0X H;  1ENC A;  4K5X A;  1HH2 P;  2OEO A;  3K0Y A;  2BH2 A;  2EOT A;  3A54 A;  1F9S A;  4B3S L;  2ID0 A;  3I7F A;  1VQ5 A;  2KJX A;  1NNX A;  1PRT D;  1CSP A;  2NB0 A;  2F0I A;  2F4V Q;  2D9U A;  3GTK H;  2PZT A;  1Z7T A;  5EQ0 A;  5C44 H;  3NWS A;  3L9A X;  5JEA H;  3A8I E;  3J80 c;  4L5S A;  3WWV A;  3D0F A;  5EPK A;  1IBL Q;  3G4S A;  2AQ1 B;  3K0X A;  3OTO Q;  4NB3 A;  1HQR D;  2N49 A;  2IHE A;  5C5L A;  1LTR D;  2RF4 A;  3CCM A;  2VQF L;  3S1N H;  3SXH A;  1ENA A;  2OQK A;  4NXM L;  3ERS X;  1D1K A;  1KRT A;  1T5X D;  2JYO A;  2A5H A;  4LF5 Q;  3I4M G;  4C56 C;  3BVG A;  1JE4 A;  3N6R A;  1IL2 A;  4K8J A;  2IY5 B;  1SNQ A;  1CZW A;  2L4N A;  1B53 A;  5E1F A;  4GLX A;  3GTO H;  4IUN A;  5CMD A;  1H9K A;  2AWN A;  2TSS A;  3J81 c;  1I6H B;  3CQZ H;  3MHB A;  5I6W A;  2ZTE A;  4R4T A;  3OW2 A;  3P7J A;  1X3E A;  1SXT A;  1I5F A;  2MNA A;  1V8Q A;  2ZT9 C;  2XIW A;  1X65 A;  3KLS A;  1TY0 A;  1FNU A;  5EPJ A;  4YCW A;  4C1N I;  2EYO A;  1NCV A;  4GNX A;  4JW0 A;  4G4K A;  1XTC D;  1L0X B;  1TWH H;  4JI3 Q;  4ME3 A;  5C6A A;  3QG1 A;  1A62 A;  2NN6 H;  4L8J A;  4LFA Q;  2CWA A;  1J5E Q;  2EPB A;  1I4G A;  2C9O A;  1BKB A;  1YVC A;  1SE8 A;  4HAE A;  2YTY A;  4NP5 A;  3PSI A;  2RDF A;  1Q81 C;  1CA5 A;  3Q23 A;  4X3K A;  3M85 A;  1PH3 A;  1GKH A;  1MHW C;  5ELB A;  4DAM A;  3P1H A;  3P20 A;  4S3S A;  4CGY B;  1Q3L A;  3RR5 A;  4C3I B;  4DV5 L;  2F3W A;  4U68 A;  5T1I A;  4A4I A;  3KF6 B;  2D0P A;  5M3F B;  1X3F A;  1KAW A;  3EIV A;  2WV6 D;  1G2T A;  1HCZ A;  1PYW D;  3GTP B;  2MO0 A;  1ZYR C;  2NVX H;  3M3Y B;  4GLA C;  2IHF A;  3D8G A;  4A3G B;  2KBN A;  4GKK Q;  4C3I G;  5M3F G;  5KGU A;  3TQY A;  4GN3 B;  3N52 A;  3S1M B;  4DV3 Q;  4JG2 A;  1VMP A;  1DOK A;  4DV4 Q;  1SEB D;  1IKL A;  1UE7 A;  3RZO H;  1EWI A;  1VF7 A;  4YWL A;  1WI5 A;  2B2W C;  1I50 B;  1BBW A;  4A3G G;  2FIN B;  1MSG A;  2LXK A;  4PMB A;  1QUQ A;  3GO5 A;  4IPC A;  3KFU A;  5JPM C;  2RHS B;  1HTL D;  4OO1 I;  3BZK A;  2PNR C;  3LWU A;  1ZXT A;  4HIM A;  2K4K A;  3S24 A;  3BYY B;  3NTI A;  2JA9 A;  4IO9 A;  1YEZ A;  3UDX A;  1H9M A;  4XQJ A;  3S2H B;  4QB4 A;  2VL6 A;  5IP9 H;  5FLM H;  4PV1 C;  5KIX A;  5DM7 3;  3I73 A;  2WB1 B;  1XMQ Q;  4FDB A;  1JJG A;  4FVM A;  1MIU A;  5JVG 3;  3NPP A;  4XDX A;  4JI2 L;  2Z4I A;  5JOB A;  2F0L A;  5HY6 A;  1Q12 A;  3HGB A;  1G2S A;  1NE3 A;  5AJ3 L;  1E1T A;  4IOC A;  3S14 B;  1NUC A;  4DN4 M;  5KYL A;  4B3R L;  3L3O C;  1I6V C;  1BCP F;  2KVM A;  3AB9 A;  2WB1 G;  1KL9 A;  3EFX D;  4DV7 Q;  2LMC B;  4NPS A;  1YNX A;  1AH9 A;  3V05 A;  2PQA B;  1KHI A;  5IGB A;  1DOL A;  1ET9 A;  1PHJ A;  5C4X B;  2Q8R E;  3BYT B;  4RGM A;  5JJI A;  2L15 A;  4HMJ A;  3TP5 A;  5LMU L;  3P75 A;  3H3V H;  1JCK B;  3HP3 A;  3A5U A;  1IYU A;  3PIO A;  1EYD A;  2Q2I A;  1I4H A;  1X3Q A;  2AWO A;  4Z9C B;  1HUM A;  2HUG A;  1SMY C;  1VQ7 A;  3PUX A;  3SK8 A;  3QO2 A;  5C4X G;  2LFN A;  3NBH A;  3HOW H;  3PGZ A;  2IWH A;  2Z4H A;  3ZJY C;  4A3M B;  2N88 A;  2ICE C;  3M4O B;  4F8M A;  1SFO H;  1O7L A;  1MKH A;  2EJG C;  4JI1 L;  4IN3 A;  1D5Z C;  2Z6K A;  4BBS H;  4RFB A;  3L7Z C;  1IHZ A;  1BO0 A;  4QMG A;  1PFM A;  4YY3 Q;  2E2J B;  4A3M G;  1CKO A;  3BVZ A;  1YNJ C;  2E2I H;  3BU2 A;  3U9O A;  4BY7 B;  4DR6 L;  1IXR A;  1EIF A;  5LHY 1;  4JV5 L;  4LK1 C;  1VMC A;  4LAA A;  5M3M H;  1E2V A;  3MTS A;  3WDN A;  4IFD G;  1GUT A;  1TWF B;  3TP6 A;  1CQV A;  3MXU A;  4UP8 A;  4Y7N B;  1VQE A;  1XPO A;  5M5Y B;  1Q90 A;  3I72 A;  1P8L A;  5IYD H;  4LF6 L;  2VY3 A;  2K04 A;  4LUZ A;  2DN8 A;  5CGK A;  1LUZ A;  2UXC Q;  2E5L L;  4DAY B;  3NEL A;  1N33 Q;  2BA0 A;  1I3Q B;  1CFM A;  3U9S A;  4QIW E;  1KNA A;  2D2C C;  1PRT C;  4TRD A;  2EXD A;  1Y1W B;  1DXM A;  2PYK A;  4K6D A;  2AKW B;  3I70 A;  3VDY A;  2KCT A;  5CV5 A;  4CKB A;  1HNZ Q;  2VB2 X;  1VQ6 A;  3OIP A;  2XGT A;  1JT8 A;  3MEH A;  2B2T C;  4H02 A;  1ICF B;  1EY7 A;  5NUC A;  5COR A;  4PG3 A;  3OMC A;  2QW7 A;  4EQ5 A;  3I4M H;  1Y1W G;  3SR1 A;  1LTL A;  4IPG A;  4GOP A;  3GTQ B;  4FNF A;  4DR3 Q;  3S1Q H;  1HR0 W;  1PH4 A;  4AQY Q;  1LO5 D;  1NAP A;  1I4X A;  1RD9 D;  1IBL L;  1H9R A;  4JBW A;  2A6H D;  4JOI A;  4AIM A;  1YI2 A;  2L5T A;  2LY7 A;  5BN3 A;  4DNI A;  1S4Z A;  4MTN A;  4LF4 Q;  3Q8D A;  4LF5 L;  1A0I A;  3J7A 5;  4C3H B;  3CW2 C;  1QB5 D;  3MXN A;  4B3S Q;  5GAE C;  2WKC A;  4R4I A;  2P5Z X;  1JJ2 A;  5D14 A;  2NZO A;  3S16 B;  4FO2 A;  1TVX A;  1CKM A;  1DM0 B;  2EJM A;  1V1O A;  4C3H G;  2RKS A;  4P71 A;  2B39 A;  1NSN S;  5C3E H;  1GO3 E;  2MHV A;  2Q8T A;  3I3C A;  3WOF A;  5J3B A;  3LGJ A;  3F1Z A;  3GTJ B;  4DR1 Q;  3KLR A;  4A3E B;  2JQO A;  1VQD A;  5HGT A;  2CW0 D;  2AUK A;  4NXM Q;  1RL2 A;  1B8A A;  1G6P A;  2N55 A;  4ZRZ A;  5D3D A;  3NWT A;  4ZYS A;  1G6Z A;  4K6L A;  2KHS A;  1PYB A;  4G7O C;  3W3A A;  1V1Q A;  1Y1V H;  3GDE A;  4WOR A;  1WTX A;  3R93 A;  1A8V A;  3QIA A;  2B2U C;  5E3F A;  3V2T A;  2MP1 A;  1CKN B;  2Z9H A;  1Q82 C;  5IYC H;  4JI6 Q;  2QDB A;  3KJP A;  1GUS A;  4A3B H;  1STE A;  1U5K A;  1B70 B;  2F0N A;  3T56 B;  2I5H A;  1PTO D;  3S1R B;  3MZ5 A;  3J81 j;  4DV3 L;  4DV4 L;  2J0T D;  3KLS X;  1EEF D;  3S15 B;  1GUG A;  1E22 A;  1AW7 A;  4OEM B;  4RMF A;  1WTO A;  3OIQ A;  1CT1 D;  2K6A A;  3ULL A;  3F8T A;  4MN3 A;  1X3G A;  5LL6 S;  3T51 B;  5C4J B;  1U4R A;  2Z8L A;  2HD3 A;  4J6H A;  2A74 C;  3SDZ A;  3A56 A;  4DXF A;  3JAM i;  1TY2 A;  2JA7 B;  1S3O A;  4DV5 Q;  4LF8 L;  4LF7 Q;  3AU7 A;  2Z1C A;  4F87 A;  1WYD A;  2K05 A;  4IJL A;  1DON A;  4EVO A;  4A3I B;  2Q2T A;  1TT2 A;  3J7A F;  3CPF A;  2JA7 G;  1XMQ L;  1V1P A;  4QY7 A;  2K5N A;  3C2P A;  2C35 B;  4N9T A;  4QUF A;  3VYS A;  4G57 A;  4A3I G;  1SSO A;  1NY4 A;  1Z9F A;  3E3X A;  3W5O A;  3V96 A;  1TS2 A;  1SRO A;  3JAM c;  1Q7Y C;  1B4O A;  2VB3 X;  4DV7 L;  2DGY A;  4ZCK A;  2F4I A;  2AQ3 B;  5HGQ A;  2PW7 A;  3UI2 A;  4HJA A;  3KBX A;  5LMN W;  3WOE A;  5CV8 A;  2NZH A;  1H9S A;  1KAB A;  2V4D A;  1CQF A;  1C8C A;  5DNF A;  3BG3 A;  3HKZ B;  3D4R A;  3DUZ A;  4BBR H;  5FLX L;  1K83 B;  1HFN A;  4DR7 Q;  1HHV A;  3FEW X;  2VZA A;  4JI2 Q;  4QUC A;  4WRD A;  4EQN A;  1B9M A;  1LV9 A;  4HMI A;  3PUW A;  3ERO A;  3HKZ G;  1CA6 A;  2XN9 C;  1BNZ A;  5ELE A;  2OTL A;  4X66 L;  1EYA A;  4OL7 A;  2L0C A;  4CJ2 C;  2F03 A;  3VR4 A;  4X3S A;  1A63 A;  3FKI H;  1EOV A;  4C2M B;  1PH7 A;  4C3J H;  3R2I A;  1S5F D;  2E2D C;  1LM0 A;  4KY7 A;  3OHX C;  5M9O A;  1GJX A;  3GP7 A;  1Q8K A;  1N32 Q;  4RWS C;  5TSS A;  3R3O A;  4R9W A;  2KEE A;  2Y0S G;  2KCN A;  1M90 C;  1MI2 A;  1RJT A;  4I7Z C;  5JAV A;  4A3K H;  5GRO A;  1PH5 A;  2Q2U A;  1HZB A;  4DUY L;  4GNX B;  2NWG A;  2UXC L;  2VW9 A;  5FJ8 H;  1E24 A;  1IW7 D;  4TQU S;  1N33 L;  2WAQ G;  1STH A;  3OPO A;  4DR4 Q;  3M4P A;  5M5W H;  1AFP A;  4MIU A;  5ELO A;  4LNQ A;  2AMC B;  4OIJ A;  1BUV T;  4X65 L;  1E2W A;  5CYU A;  1HNZ L;  3PIP A;  3KJO A;  4XQQ A;  1F2Y A;  3H0G B;  4JV5 Q;  4IUR A;  1Y8O B;  1CHQ D;  1R9T H;  1PA6 A;  1SYC A;  4UAI A;  4A93 H;  2JA5 H;  2L11 A;  1F2Z A;  1AN8 A;  2I07 B;  4DR3 L;  4RCO A;  5KRU A;  1HR0 Q;  4AQY L;  3CCE A;  1Q46 A;  2K5V A;  1TWA B;  5IGC A;  2HCI A;  1LTG D;  3NEM A;  1SE3 A;  3H0G G;  2NVT H;  2H5X A;  3FVQ A;  3K7A B;  5BN4 A;  3D4D A;  4P73 A;  3CCL A;  3CKI B;  3PO2 H;  2UXB L;  2RVL A;  1D7Q A;  2WP8 J;  2MFI A;  3NEN A;  1VQF A;  3PUY A;  4NXN Q;  3JC6 6;  2N3S A;  1K3B C;  3DLL A;  2NTS A;  2CFM A;  1K73 C;  2JE6 I;  5IP7 H;  3VA7 A;  3K81 C;  1BXT A;  4H0L C;  3SHL A;  3K5M A;  3NQI A;  1E1O A;  2O4X A;  3HG9 A;  3SK5 A;  1QUQ B;  2QEJ C;  2KUM A;  1WTV A;  2K14 A;  4DU9 A;  1F9R A;  3HOV H;  3K5N A;  2R7D A;  4KN7 C;  1E7Z A;  1X3P A;  5CC4 A;  3CCS A;  3MXP A;  2R7F A;  4XIG S;  3J81 i;  1GVP A;  1EY5 A;  1V43 A;  2K1B A;  1Q1E A;  3OWF A;  4XT3 B;  2RDG A;  4HIK A;  3S2D B;  2TMP A;  2J4X A;  1JQY D;  1PZK D;  1F77 A;  2BE5 D;  1EQT A;  5IE8 A;  4A3C H;  2R93 B;  4PZ6 A;  4F88 A;  1O78 A;  5GQO A;  4DR1 L;  4LFB L;  3RZD B;  2AHO B;  2XVS A;  2RQX A;  3I4N H;  2RCF A;  3CCU A;  3T1H Q;  4YHH Q;  2DUD A;  1PH8 A;  4IFD J;  2KHJ A;  2EYF A;  3ULP A;  2R93 G;  1TWC B;  1GOZ A;  1L0Y B;  3HZX A;  3CRL C;  2K5H A;  4CKC A;  3GTG H;  4HTH A;  5GAH C;  1ESR A;  2EYL A;  4XT1 B;  2JSO A;  2B63 B;  3S17 B;  2DNC A;  3I91 A;  3K57 A;  1GHK A;  3C1E A;  4B3M L;  1SRU A;  2XRQ D;  4NW2 A;  3AFP A;  1PH1 A;  1PVO A;  1QNK A;  5L37 A;  4QCL A;  3NBI A;  4JI6 L;  4N8X 1;  2XWB B;  1PFS A;  4NDX A;  1Y8N B;  4HCS A;  4A3D H;  3BZC A;  4DA2 A;  2B63 G;  1PRT F;  3HOY H;  1KNE A;  1MBY A;  1UE1 A;  1XNQ Q;  1QVC A;  2OT2 A;  2F0S A;  3T53 B;  2E2H H;  1VQI A;  1FD7 D;  5COY A;  4TKO B;  3TBI B;  1CM9 A;  3VR5 A;  1M1K C;  4KTA A;  4IJH A;  1SE2 A;  3U58 A;  3Q0A A;  2A69 D;  4WFN 3;  1B3A A;  1W3S A;  2F0M A;  1EZ8 A;  4TVA B;  2R7Z B;  1J9O A;  3NE5 B;  4I7A A;  4EQO A;  1CI3 M;  1JR0 D;  1XYI A;  1VQN A;  2RA4 A;  4AYB B;  4QL5 A;  1SJE D;  3IFD A;  3K5L A;  5FK9 C;  2CH4 W;  1SR3 A;  3NSW A;  2K75 A;  2B8G A;  3SK6 A;  3D3R A;  4G7H C;  1JWU D;  1STG A;  2B2V C;  1CHP D;  3KUP A;  1VQO A;  2K5W A;  4LF7 L;  1SDF A;  2R7Z G;  1N34 L;  2NUC A;  2Z6B A;  3EN2 A;  2JA6 B;  3OSO A;  4AYB G;  4OGQ C;  1HNX Q;  5KEE A;  2QEX A;  1Z47 A;  3HOU B;  5A2Q L;  1X56 A;  4FXK C;  2OF1 A;  4R4C A;  2ZXP A;  1LTB D;  2JJQ A;  4DV2 L;  5FKA C;  1OXX K;  4XTC S;  4A3F B;  2JA6 G;  2DJG C;  1TWG B;  2NVY B;  2YU9 B;  3MC0 B;  2IX1 A;  3EQL C;  3OMG A;  3RMH A;  3HOU G;  4UDU C;  2UUA L;  1EWC A;  5EPL A;  1K0R A;  2I0Q A;  1JOR A;  1AE3 A;  4OO1 H;  4RKB A;  1D5X C;  4A3F G;  5HUR A;  3A0J A;  1A2U A;  1BCP D;  1LLR D;  2NVQ H;  4JI0 Q;  1KIX A;  4UP7 A;  4LF8 Q;  1WCM B;  1KXL A;  2F0P A;  1U9R A;  1XWE A;  5C3W A;  3AEV A;  1SLJ A;  2A19 A;  4O0A A;  4PMW A;  3TME A;  5IGD A;  1UWV A;  2KA7 A;  4ZKC B;  4GOP B;  3HOX H;  5M5X B;  1FGU A;  1L1O B;  5K36 G;  2BDN A;  2VUM H;  2WKD A;  3CXC A;  2QCP X;  4DR7 L;  2G5D A;  1WCM G;  4P75 A;  4G7Z C;  4OHJ A;  4JYA Q;  1JWS D;  4QF4 A;  3TP7 A;  1JB3 A;  3GTM H;  3VYU A;  1QE6 A;  1A6X A;  2O5J C;  1RCV D;  1DGS A;  3T4A C;  3HOZ B;  4DR5 Q;  2JA8 H;  4APV A;  5I9O A;  5FLX E;  2XWJ B;  3MXN B;  5C5M A;  3E0J A;  1R4P B;  3IRB A;  4A76 A;  4FYD A;  1N32 L;  3J7A V;  1K9M C;  1KDA A;  1LAB A;  2JP1 A;  3I55 A;  1XPR A;  2ZJQ A;  4ME5 A;  1PH9 A;  1CK1 A;  3E9H A;  2Z0S A;  3C3L A;  1EU3 A;  2MUY A;  2HQL A;  3C46 A;  1O7Y A;  1K3R A;  4A3J B;  2A68 D;  4DV0 Q;  2RCN A;  1CTM A;  2UUC L;  4BY1 B;  2PMZ B;  1GUN A;  2PZU A;  1NTG A;  4DR4 L;  1Y69 U;  1IBK L;  1UE6 A;  5IT9 c;  1A15 A;  3MAQ A;  4KHV A;  5J39 A;  2K5Q A;  4OWX B;  3H3V I;  4A3J G;  1X55 A;  4X66 Q;  1SBB B;  3GTL B;  5IGG A;  3RUZ A;  4BY1 G;  1O7I A;  1EZ6 A;  5E7N A;  1Q1B A;  4O42 A;  4OEL B;  1YBY A;  4KD3 A;  4ALP A;  2SNS A;  1YIJ A;  2RSO A;  3K58 A;  1OTC A;  5DAU A;  1UNS A;  3H15 A;  1HR0 L;  1WTW A;  1EFI D;  3TDQ A;  4BY7 G;  4JVZ A;  4OON A;  1EOT A;  4DUY Q;  1CUK A;  1FYC A;  4GNX C;  3MFY A;  4L6T B;  1M8A A;  5KND A;  3I8Z A;  3K6O A;  4NXN L;  2YYZ A;  4L5Q A;  2UUB Q;  1PZJ D;  3LX0 A;  3J7Y W;  1ML0 D;  2GVB A;  1EUJ A;  2D62 A;  3M9B A;  3M4Q A;  1QNU A;  4YWM A;  1II3 A;  3I4O A;  4X65 Q;  2F1M A;  2K28 A;  2L9H A;  2RSN A;  2GN5 A;  4DK0 A;  1RHP A;  5IY0 A;  2HIX A;  4ULL A;  2OXP A;  3U4V A;  1AP0 A;  1E0B A;  1EQV A;  2R92 B;  4EX5 A;  1H9J A;  1ENF A;  3I2Z A;  4CDF C;  2BE5 C;  3A8K E;  3D6W A;  3HEJ A;  3FMC A;  2F3I A;  5EKI A;  1U4P A;  4DPG A;  3DWA A;  5CV9 A;  4N8F A;  4P2C B;  1STA A;  2R92 G;  4Y52 H;  3NK9 A;  3NHH A;  3KF8 A;  2MPM A;  3DEO A;  2UXB Q;  1KRS A;  3KDF A;  3OW7 A;  3T1H L;  1I4P A;  3KK7 A;  4YHH L;  3G48 A;  1HPC A;  5C3X A;  2FMC A;  2NBF A;  4CBV A;  2F0U A;  1EFW A;  3RLO A;  4B9X A;  2B3G A;  3OOC A;  2ZTD A;  3FPP A;  4RGO S;  1KLG D;  1EYC A;  1B1Z A;  1VQJ A;  4PZ7 A;  4RGN A;  4UY8 C;  2N8N A;  4HSP A;  3AYH B;  5CBA E;  3PO3 B;  3SEB A;  1WOC A;  2I5M X;  1JOO A;  2L55 A;  1PTO B;  4CHT B;  4GLV B;  2E74 C;  1HNW Q;  4KHP Q;  1LAC A;  4BS9 A;  1XNQ L;  1HTP A;  5EGT A;  2PQA A;  2BH8 A;  1AZQ A;  3FHW A;  2A69 C;  4XYQ A;  2IJ0 A;  3PO3 G;  1H9S B;  3F2B A;  1STY A;  4HJ9 A;  2EQS A;  5E4W C;  3ND8 A;  4LFC Q;  1SYD A;  3K8A A;  2ZXR A;  1ET6 A;  4LFB Q;  4A3L G;  4JI5 L;  4UHV A;  2XTI A;  2B2Y C;  2F0H A;  4JPB W;  1I4Q A;  2QKI C;  1STN A;  2WAC A;  1MJC A;  1UEA B;  3BDO A;  2WB1 E;  5C0X G;  2KQ3 A;  4C3I H;  5M3F H;  1NR2 A;  3J80 E;  4UP9 A;  4HSV A;  2PZW A;  1HZA A;  4A3E G;  5H1S E;  1EQQ A;  3G7L A;  3GTP H;  3GTK B;  4DFA A;  5CV6 A;  3DWQ A;  3M3Y H;  5C44 B;  4L63 B;  4B3M Q;  1RIP A;  4A3G H;  2R6G A;  3O13 A;  3T16 A;  4CDC C;  1HNX L;  4WJ3 M;  2K32 A;  1J8I A;  2KEN A;  1RTN A;  1C4Q A;  3S1M H;  1LT3 D;  3A5Z B;  1ZEQ X;  1WTR A;  3S1N B;  5C44 G;  5JEA G;  3J81 E;  3RN5 A;  1I50 H;  1DCZ A;  1MGS A;  3DM1 A;  1NMG A;  2IPK D;  4RH6 A;  1FNW A;  5ELF A;  3GTO B;  3CQZ B;  4H7B A;  1N9W A;  3KOJ A;  4GS3 A;  5A2Q E;  1JOK A;  2Z6K C;  1EU4 A;  4DAY A;  1SNM A;  3CAM A;  2EYH A;  4FF4 A;  4K5W A;  3BZD B;  4JI0 L;  4B9W A;  4OIK A;  3QR8 A;  1YHB A;  4J1M A;  3I90 A;  1N34 Q;  1SMX A;  1TWH B;  5LMN L;  3TZU A;  3VYT A;  2C5C A;  3PF5 A;  1YHA A;  1VQK A;  1QJO A;  1UE5 A;  3W2D A;  4KV6 A;  4HJ8 A;  3ITP A;  4MNO A;  2D0O A;  5G3L F;  3OYY A;  4DV2 Q;  2OTJ A;  3S14 H;  1ROD A;  4JI7 L;  2DY8 A;  2YTV A;  2EY5 A;  4JYA L;  3FRP B;  1C48 A;  1ESF A;  2NN6 G;  4FXD A;  1C7Y A;  4RA8 A;  1PTO F;  1D8L A;  2UUA Q;  5C4X H;  2B29 A;  3CCQ A;  2LSS A;  3G6J B;  4H44 C;  2HIV A;  3CCR A;  4DR5 L;  1B3Q A;  1SYG A;  3NTK A;  2NVX B;  3CCV A;  3TEH B;  2B8F A;  1GD7 A;  2A68 C;  2X6L A;  5CV7 A;  2L12 A;  2HT1 A;  4DV6 Q;  1S72 A;  3F2U A;  4CKE A;  4A3M H;  3M4O H;  1BR9 A;  1DJR D;  3HS0 C;  1S5B D;  4XYO A;  4PZ8 A;  4DK1 A;  4GOP C;  1ICW A;  1K8O A;  1L1O C;  1TU2 B;  4K5V A;  3U50 C;  4DV0 L;  3RZO B;  3AQQ A;  1Q8I A;  3MEF A;  1C0A A;  1JE5 A;  3TN2 A;  4IFD H;  2F0Q A;  1QZG A;  4BA1 I;  2E2J H;  1XPU A;  4ABN A;  1LTI D;  4BY7 H;  1BF4 A;  1SYB A;  3IFT A;  3JAM L;  4X6A H;  1QG7 A;  1V9P A;  4JI8 Q;  3C1F A;  2ALY B;  2E75 C;  1TWF H;  4XQN A;  4YIJ A;  3LNN A;  3L0O A;  4Y7N H;  3ER0 A;  5M5Y H;  2H1E A;  1SND A;  4LWC A;  5BR8 Q;  4DUZ L;  1N36 Q;  4X64 L;  2FXQ A;  2UU9 L;  2QIL A;  1BVS A;  1EIH A;  3EVQ A;  3PUV A;  4QGU A;  4DK6 C;  1XMO Q;  2ZTC A;  2IL8 A;  1KD1 C;  2B2V A;  1I3Q H;  5IP9 G;  5DEH A;  1AZP A;  3TS0 A;  5IOC A;  5FLM G;  2ENB A;  5JJK A;  3GV3 A;  1CKN A;  1KDC A;  1Y1W H;  2UUC Q;  1CSQ A;  2JN4 A;  1TS5 A;  4ZKB B;  1VQG A;  3KYH C;  2UUB L;  4LJZ C;  1IBK Q;  1X32 A;  5EJW A;  3G71 A;  1XNR L;  4ZLT F;  1T9H A;  3MWY W;  4IUU A;  2PO4 A;  1O7Z A;  2CQA A;  2HCC A;  2PPB C;  2ZM6 L;  4RG1 A;  1WJJ A;  1Y14 B;  2EY1 A;  3GTQ H;  5F2D A;  1NJI C;  1JJC B;  4POF A;  1DYQ A;  1SMY D;  2B2W A;  5KNC A;  3TP8 A;  4C1N K;  5IOD A;  3HOW B;  2A6H C;  3CC4 A;  1E3P A;  1K8G A;  5DM6 3;  4X3U A;  1SFO B;  1KQS A;  3Q6S A;  1WTP A;  2JXM B;  3BDL A;  4TSS A;  4C3H H;  4BBS B;  3HOW G;  1KC8 C;  2KED A;  1JB7 A;  2A6E D;  4K0K Q;  4V19 0;  1OXS C;  1K28 A;  5FOB B;  3A74 A;  1L2F A;  1KAA A;  2E2I B;  4DNR B;  1PH6 A;  1IYJ B;  1FVI A;  4M1U B;  3S16 H;  4FXG C;  1VQH A;  5M3M B;  1AE2 A;  2M00 A;  2UXD Q;  1HZ9 A;  4BBS G;  3VYR A;  1ONL A;  2EYM A;  3TZD A;  1QVG A;  1XTD A;  1U4M A;  4DKA C;  4QJF A;  2K01 A;  1LTT D;  2ASB A;  1ILP A;  2KOL A;  1HNW L;  5M3M G;  3DHQ A;  3FDT A;  4KHP L;  3X3M A;  4DXG A;  3GTJ H;  5C0X I;  4A3E H;  2PNH A;  3CF5 A;  4JK1 C;  2CW0 C;  1IL8 A;  4JC0 A;  3F2D A;  5J1Z A;  4LFC L;  1X9N A;  4KHZ A;  1K8M A;  5IYD G;  1S40 A;  4OXP A;  1X6O A;  1IKM A;  4DF7 A;  4BXX G;  3GV6 A;  4P74 A;  1LTS D;  1SNC A;  1EY4 A;  4MHE A;  3RN2 A;  3I4M B;  3PV0 A;  5CV4 A;  3J7Z C;  2DJF C;  4IUQ A;  4Q5V A;  3S1Q B;  2OQ0 A;  3HFZ B;  4IZ8 A;  4FF1 A;  4KLK A;  1HJP A;  2CHB D;  2WIN B;  3U4Z A;  1PTO C;  3DXJ C;  4KKU A;  1GUO A;  3T1Y Q;  3E9I A;  3FPU B;  3S1R H;  1RF2 D;  3X3N A;  1IYV A;  5ELN A;  5IGE A;  1WD0 A;  1VF5 C;  4P72 A;  3J80 L;  3RLN A;  3VR6 A;  4L5T A;  4CDD C;  4LMQ D;  3S15 H;  3CCJ A;  3BVM A;  3ULJ A;  1BBX C;  3NBH B;  4J15 A;  4JI5 Q;  2QGQ A;  5T1G A;  3GQB A;  3LWE A;  4PQX A;  1ASY A;  1G91 A;  3HKZ E;  4HN7 A;  5C4J H;  1BCP B;  4J8Q A;  5K5P A;  1I94 Q;  2JA7 H;  5IWA Q;  3J81 L;  4QIW B;  2VQE Q;  1N8R C;  3K5O A;  1WD1 A;  1AEX A;  4JCV E;  3CRK C;  3CC2 A;  1YZ6 A;  3DMU A;  5C3E B;  4A3I H;  4F7X A;  3IKJ A; 
#chains in the Genus database with same CATH homology
 3TSS A;  2NN6 I;  3T13 A;  1GHJ A;  2LKV A;  3VA5 A;  1G8Z D;  2EDG A;  2B2T A;  1B50 A;  2K03 A;  2M9V A;  4ILW A;  1HFG A;  2SOB A;  4DAV A;  3NTH A;  4RKL A;  2F0O A;  5FO8 B;  3SE0 A;  1WVL A;  2SDF A;  2DY7 A;  1OO9 B;  1YNN D;  3MVV A;  1Y1V B;  2NZ1 D;  3HRZ C;  5D65 A;  2K5D A;  2MGS A;  1DZ1 A;  2G9D A;  1A3T A;  4PNY A;  4A3B B;  5JPN C;  2HQE A;  4X3T A;  4K2K A;  2EE1 A;  5KYI A;  1M4V A;  4O1N A;  3BDC A;  1TKW B;  2BCO A;  4NKL A;  5LL6 X;  1A3U A;  5C0X J;  5I2Y A;  1EY9 A;  4V0B A;  4EGV A;  1OXV A;  4FP5 D;  3PIO 3;  3M7G A;  1F9Q A;  2CVR A;  2EVB A;  2EY2 A;  4I65 A;  1UAP A;  4KJN A;  1F9P A;  2B2Y A;  1PLF A;  1A2T A;  1GXD C;  2JEB I;  1BDO A;  1MSH A;  1EY8 A;  1TS4 A;  5JEA J;  5D3I B;  1S5D D;  2FHT A;  4E6I A;  5I4D A;  1EY6 A;  1D1I A;  1S5C D;  1IW7 C;  1EWH A;  4HCE A;  5EKK A;  3JAM E;  4RHR A;  2NTT A;  2EXZ A;  3EA6 A;  2B2U A;  4ZQ3 A;  1QOH A;  4KY5 A;  1GUW A;  1QCB D;  1MD2 D;  1JC7 A;  2QF7 A;  3NQT A;  1A3V A;  4KI0 A;  1TS3 A;  3MFG A;  5JVH 3;  3NUC A;  4RGT A;  3MXG A;  2BDO A;  3E5S A;  2PQE A;  5C4Z A;  3VR2 A;  4BBR B;  1NR4 A;  2A6E C;  5KNB A;  5J22 A;  3QWN A;  1SNP A;  2F3V A;  4KN4 C;  5ELD A;  1STB A;  3M7N A;  3ERQ A;  1FNV A;  5IT9 L;  3ZYY X;  3FKI B;  1D5M C;  4C3J B;  1QWY A;  1HA5 A;  2F0T A;  2Q8I B;  1KTK A;  2JEA I;  2F0E A;  5I2X A;  3H3V C;  3QOJ A;  4KMU C;  3H09 A;  2KCC A;  4C3J G;  4A3K B;  4ODG A;  5E4X A;  1ZKO A;  4U67 3;  2BA1 A;  1D2B A;  2F0J A;  3M4Y A;  4FF3 A;  5BN5 A;  3H6M A;  4PMC A;  2PCF B;  5JJZ A;  1TII D;  1JOQ A;  2XSC A;  1HA6 A;  5M5W B;  4B08 A;  1SAP A;  1V1P B;  4K8I A;  1PFB A;  1Z6H A;  1HUN A;  2R3Z A;  1RTO A;  5IGF A;  1TQO A;  1R9T B;  1OXU A;  4A93 B;  2JA5 B;  1Y8P B;  2ICI A;  1HRJ A;  4KJO A;  1KLU D;  1SJH D;  2F0V A;  3ONA B;  1PXU A;  2M2L A;  3I4L A;  2FJ2 A;  2NVT B;  2O2L D;  1OXT A;  1SE4 A;  5I9P A;  2X69 A;  2IT1 A;  5FO7 B;  3PO2 B;  3R2T A;  1B2T A;  4ZUI A;  5C4H A;  2K33 A;  3MA2 B;  2RBM A;  1LT4 D;  1XXG A;  3D31 A;  2WII B;  1S5E D;  1HXY D;  2NYZ D;  1EIG A;  3HOV B;  2I46 A;  4DNT B;  4ZK9 B;  5EBD A;  1G29 1;  1FGB D;  2D5D A;  2LS0 1;  4BWG B;  1FR3 A;  4K2L A;  4IUP A;  4RHS A;  2O5I C;  1BOS A;  3SK4 A;  2IX0 A;  2A73 B;  3I4N B;  2F0D A;  1U4L A;  3H91 A;  3IL8 A;  4KD4 A;  5A35 A;  1YNN C;  1UUP A;  1EL0 A;  2J7Z A;  1JIC A;  5G3L D;  2F0K A;  3GTG B;  1BCP C;  2VXW A;  4R8I A;  4NMZ A;  1B9N A;  4KKS A;  5K36 H;  1BQQ T;  2F0G A;  3K59 A;  1ILQ A;  2SEB D;  1SYF A;  3CHB D;  5EBC A;  4A3D B;  2KEC A;  3H94 A;  3HOY B;  1JWM D;  1W6J A;  3IAY A;  3PUZ A;  4HED A;  2E2H B;  1T5E A;  4FF2 A;  4BA2 I;  2RDH A;  1WTQ A;  2F0F A;  2EYP A;  2GA4 B;  1XX8 A;  5I6Y A;  5AFW A;  1DD2 A;  4IQZ A;  2EZV A;  4EQP A;  2PW5 A;  2XNA C;  4HR7 B;  3NP8 A;  1R4Q B;  2IW3 A;  4GZY C;  3BS1 A;  4KY6 A;  2F0W A;  2AQ2 B;  1RDP D;  2X6G A;  3QB3 A;  1ZYR D;  1PMR A;  1CZG A;  3RLF A;  1EY0 A;  4ZAI A;  1SNO A;  4ID6 A;  5CBE E;  4M8A A;  5ELC A;  1TR5 A;  2L1B A;  2G9H D;  5EKL A;  1VDZ A;  2BOS A;  4N9P A;  4R8N A;  4DGZ A;  1LT6 D;  2SNM A;  1E2Z A;  3Q22 A;  3URY A;  2MJ8 A;  3S9W A;  2HDM A;  2XRS D;  3Q24 A;  5ISR A;  3CU7 A;  4RCN A;  3KBG A;  2NVQ B;  4IUT A;  2E76 C;  1PZI D;  3QJY A;  4OO1 G;  3A55 A;  4WJW A;  4KK7 A;  3VR3 A;  2EJF C;  2ZXO A;  4KKT A;  2R61 A;  4IFD I;  3HOX B;  4K14 A;  1W6K A;  2FFK B;  3D6C A;  2VUM B;  1QIL A;  1PDQ A;  3PIP 3;  2Y0S B;  3EJI A;  3SVM A;  3A8J E;  3GTM B;  1I4R A;  3A7L A;  1LTA D;  1RKN A;  4ZUJ A;  1EEI D;  1SYE A;  2JA8 B;  2WAQ B;  3QOL A;  2AUJ D;  2FMM A;  4DAP A;  3DWP A;  1KDB A;  1O80 A;  2VNU D;  4H13 C;  2IX3 A;  1VCI A;  5IT9 E;  1LT5 D;  4RAU C;  4IAL A;  1PRT B;  3R8B A;  4Q0F A;  4XXE A;  4CJ1 B;  4IUV A;  2H4O A;  5FO9 B;  3PMF A;  1F2M A;  3DEP A;  1HQM C;  2EYJ A;  3OWE B;  3NXW A;  3GD7 A;  1DOM A;  2HDL A;  1B44 D;  3RD4 A;  1PFN A;  1YNJ D;  1F2L A;  5IIF A;  3D4W A;  3AMU A;  2DNE A;  3E6Z X;  3ND9 A;  2K7V A;  1PTO H;  1D6E C;  5CR3 A;  4CJ0 B;  2EY6 A;  3A7A B;  5C0X H;  1ENC A;  4K5X A;  2OEO A;  3K0Y A;  2EOT A;  3A54 A;  1F9S A;  2ID0 A;  2KJX A;  1PRT D;  2NB0 A;  2F0I A;  2D9U A;  2PZT A;  1Z7T A;  5EQ0 A;  3NWS A;  3L9A X;  5JEA H;  3A8I E;  5EPK A;  2AQ1 B;  1HQR D;  5C5L A;  1LTR D;  3SXH A;  1ENA A;  1D1K A;  1T5X D;  2JYO A;  2A5H A;  4C56 C;  3BVG A;  1JE4 A;  3N6R A;  4K8J A;  1SNQ A;  1CZW A;  2L4N A;  1B53 A;  5E1F A;  4IUN A;  5CMD A;  1H9K A;  2AWN A;  2TSS A;  1I6H B;  3MHB A;  5I6W A;  3P7J A;  1SXT A;  1V8Q A;  2ZT9 C;  2XIW A;  3KLS A;  1TY0 A;  1FNU A;  5EPJ A;  4C1N I;  2EYO A;  1NCV A;  4G4K A;  1XTC D;  1L0X B;  5C6A A;  3QG1 A;  2NN6 H;  4L8J A;  2EPB A;  1I4G A;  2C9O A;  4HAE A;  4NP5 A;  2RDF A;  1CA5 A;  3Q23 A;  4X3K A;  3M85 A;  5ELB A;  3P1H A;  3P20 A;  4S3S A;  4CGY B;  1Q3L A;  4C3I B;  5M3F B;  2F3W A;  4U68 A;  5T1I A;  2WV6 D;  1G2T A;  1HCZ A;  1PYW D;  3GTP B;  1ZYR C;  3M3Y B;  3D8G A;  4A3G B;  4C3I G;  5KGU A;  3N52 A;  3S1M B;  1VMP A;  1DOK A;  1SEB D;  1IKL A;  1VF7 A;  2B2W C;  1I50 B;  2FIN B;  1MSG A;  4PMB A;  3GO5 A;  5JPM C;  1HTL D;  4OO1 I;  2PNR C;  3LWU A;  1ZXT A;  3BYY B;  3NTI A;  1H9M A;  4XQJ A;  3S2H B;  4QB4 A;  4PV1 C;  5KIX A;  5DM7 3;  3I73 A;  2WB1 B;  4FVM A;  5JVG 3;  3NPP A;  4XDX A;  2Z4I A;  5JOB A;  2F0L A;  1Q12 A;  3HGB A;  1G2S A;  3S14 B;  1NUC A;  4DN4 M;  5KYL A;  3L3O C;  1I6V C;  1BCP F;  2KVM A;  3AB9 A;  3EFX D;  2LMC B;  3V05 A;  5IGB A;  1DOL A;  1ET9 A;  5C4X B;  2Q8R E;  3BYT B;  4RGM A;  4HMJ A;  3TP5 A;  3P75 A;  1JCK B;  3HP3 A;  1IYU A;  1EYD A;  1I4H A;  1X3Q A;  2AWO A;  4Z9C B;  1HUM A;  2HUG A;  1SMY C;  3PUX A;  3SK8 A;  3QO2 A;  2LFN A;  3NBH A;  2IWH A;  2Z4H A;  4A3M B;  2N88 A;  2ICE C;  3M4O B;  4F8M A;  1O7L A;  2EJG C;  4IN3 A;  1D5Z C;  4RFB A;  1IHZ A;  3L7Z C;  1BO0 A;  4QMG A;  1PFM A;  2E2J B;  3BVZ A;  1YNJ C;  3U9O A;  4BY7 B;  5LHY 1;  4LK1 C;  1VMC A;  4LAA A;  1E2V A;  3MTS A;  3WDN A;  4IFD G;  1GUT A;  1TWF B;  3TP6 A;  1CQV A;  3MXU A;  4Y7N B;  5M5Y B;  1Q90 A;  3I72 A;  2K04 A;  2DN8 A;  5CGK A;  2BA0 A;  1I3Q B;  1CFM A;  3U9S A;  1KNA A;  2D2C C;  1PRT C;  4TRD A;  1Y1W B;  1DXM A;  2PYK A;  4K6D A;  3I70 A;  5CV5 A;  4CKB A;  2VB2 X;  3OIP A;  3MEH A;  2B2T C;  1EY7 A;  5NUC A;  5COR A;  3OMC A;  3SR1 A;  3GTQ B;  4FNF A;  1LO5 D;  1NAP A;  1I4X A;  1RD9 D;  1H9R A;  4JBW A;  2A6H D;  2L5T A;  2LY7 A;  5BN3 A;  1S4Z A;  4C3H B;  1QB5 D;  3MXN A;  2WKC A;  5D14 A;  3S16 B;  4FO2 A;  1TVX A;  1DM0 B;  2EJM A;  1V1O A;  4C3H G;  2RKS A;  2B39 A;  1NSN S;  2MHV A;  2Q8T A;  3I3C A;  3WOF A;  3GTJ B;  3KLR A;  4A3E B;  5HGT A;  2CW0 D;  2AUK A;  2N55 A;  4ZRZ A;  5D3D A;  3NWT A;  4ZYS A;  1G6Z A;  4K6L A;  2KHS A;  4G7O C;  3W3A A;  4WOR A;  1WTX A;  3R93 A;  3QIA A;  2B2U C;  5E3F A;  3V2T A;  2MP1 A;  2QDB A;  1GUS A;  1STE A;  2F0N A;  3T56 B;  1PTO D;  3S1R B;  3MZ5 A;  2J0T D;  3KLS X;  1EEF D;  3S15 B;  1GUG A;  1AW7 A;  1WTO A;  3OIQ A;  1CT1 D;  2K6A A;  4MN3 A;  5LL6 S;  3T51 B;  5C4J B;  1U4R A;  2Z8L A;  4J6H A;  2A74 C;  3SDZ A;  3A56 A;  4DXF A;  1TY2 A;  2JA7 B;  3AU7 A;  2Z1C A;  4F87 A;  2K05 A;  1DON A;  4EVO A;  4A3I B;  1TT2 A;  3J7A F;  1V1P A;  3C2P A;  4N9T A;  4QUF A;  3VYS A;  4G57 A;  1SSO A;  3V96 A;  1TS2 A;  1B4O A;  2VB3 X;  2F4I A;  2AQ3 B;  2PW7 A;  3UI2 A;  3KBX A;  3WOE A;  5CV8 A;  1H9S A;  1KAB A;  2V4D A;  1CQF A;  1C8C A;  5DNF A;  3BG3 A;  3HKZ B;  3D4R A;  3DUZ A;  5FLX L;  1K83 B;  1HFN A;  1HHV A;  3FEW X;  4QUC A;  4WRD A;  4EQN A;  1B9M A;  1LV9 A;  4HMI A;  3PUW A;  3ERO A;  1CA6 A;  2XN9 C;  1BNZ A;  5ELE A;  1EYA A;  4OL7 A;  2L0C A;  4CJ2 C;  2F03 A;  3VR4 A;  4X3S A;  4C2M B;  3R2I A;  1S5F D;  2E2D C;  4KY7 A;  3OHX C;  5M9O A;  1GJX A;  3GP7 A;  4RWS C;  5TSS A;  3R3O A;  4R9W A;  2KEE A;  2KCN A;  1MI2 A;  1RJT A;  4I7Z C;  5JAV A;  2NWG A;  1IW7 D;  4TQU S;  1STH A;  3OPO A;  1AFP A;  4MIU A;  4OIJ A;  1BUV T;  1E2W A;  5CYU A;  4XQQ A;  1F2Y A;  3H0G B;  4IUR A;  1Y8O B;  1CHQ D;  1SYC A;  4UAI A;  2L11 A;  1F2Z A;  1AN8 A;  2I07 B;  4RCO A;  5KRU A;  5IGC A;  1TWA B;  2HCI A;  1LTG D;  1SE3 A;  3FVQ A;  3K7A B;  5BN4 A;  3D4D A;  3CKI B;  2RVL A;  2WP8 J;  3PUY A;  2NTS A;  2JE6 I;  3VA7 A;  1BXT A;  4H0L C;  3SHL A;  3K5M A;  3NQI A;  2O4X A;  3HG9 A;  3SK5 A;  2QEJ C;  2KUM A;  1WTV A;  4DU9 A;  1F9R A;  3K5N A;  4KN7 C;  1X3P A;  5CC4 A;  3MXP A;  4XIG S;  1EY5 A;  1V43 A;  2K1B A;  1Q1E A;  3OWF A;  4XT3 B;  2RDG A;  3S2D B;  2TMP A;  2J4X A;  1JQY D;  1PZK D;  1F77 A;  2BE5 D;  1EQT A;  2R93 B;  4F88 A;  1O78 A;  3RZD B;  2XVS A;  2RQX A;  4IFD J;  2EYF A;  1TWC B;  1GOZ A;  1L0Y B;  3HZX A;  3CRL C;  4CKC A;  4HTH A;  1ESR A;  2EYL A;  4XT1 B;  2JSO A;  2B63 B;  3S17 B;  2DNC A;  3I91 A;  3K57 A;  1GHK A;  3C1E A;  2XRQ D;  4NW2 A;  1QNK A;  4QCL A;  3NBI A;  2XWB B;  4NDX A;  1Y8N B;  4HCS A;  4DA2 A;  1PRT F;  1KNE A;  1MBY A;  2OT2 A;  2F0S A;  3T53 B;  1FD7 D;  5COY A;  4TKO B;  3TBI B;  1CM9 A;  3VR5 A;  4KTA A;  1SE2 A;  3Q0A A;  2A69 D;  4WFN 3;  1B3A A;  2F0M A;  1EZ8 A;  2R7Z B;  1J9O A;  3NE5 B;  4EQO A;  1CI3 M;  1JR0 D;  1XYI A;  2RA4 A;  4AYB B;  1SJE D;  3IFD A;  3K5L A;  5FK9 C;  3NSW A;  2B8G A;  3SK6 A;  3D3R A;  4G7H C;  1JWU D;  1STG A;  2B2V C;  1CHP D;  3KUP A;  2K5W A;  1SDF A;  2NUC A;  2JA6 B;  3OSO A;  4OGQ C;  5KEE A;  1Z47 A;  3HOU B;  5A2Q L;  4FXK C;  2OF1 A;  2ZXP A;  1LTB D;  5FKA C;  1OXX K;  4XTC S;  4A3F B;  1TWG B;  2NVY B;  2YU9 B;  3MC0 B;  2IX1 A;  3EQL C;  3OMG A;  3RMH A;  4UDU C;  1EWC A;  5EPL A;  1JOR A;  4OO1 H;  4RKB A;  1D5X C;  5HUR A;  1A2U A;  1BCP D;  1LLR D;  1WCM B;  2F0P A;  1U9R A;  1XWE A;  5C3W A;  4PMW A;  3TME A;  5IGD A;  2KA7 A;  4ZKC B;  5M5X B;  5K36 G;  2BDN A;  2WKD A;  2QCP X;  4G7Z C;  4OHJ A;  1JWS D;  4QF4 A;  3TP7 A;  1JB3 A;  3VYU A;  1QE6 A;  1A6X A;  2O5J C;  1RCV D;  3T4A C;  3HOZ B;  5I9O A;  5FLX E;  2XWJ B;  5C5M A;  3E0J A;  1R4P B;  4FYD A;  3J7A V;  1KDA A;  1LAB A;  2JP1 A;  4ME5 A;  1CK1 A;  3C3L A;  1EU3 A;  2MUY A;  3C46 A;  1O7Y A;  4A3J B;  2A68 D;  1CTM A;  4BY1 B;  2PMZ B;  1GUN A;  2PZU A;  1Y69 U;  1A15 A;  3MAQ A;  4KHV A;  5J39 A;  2K5Q A;  1SBB B;  3GTL B;  5IGG A;  3RUZ A;  1EZ6 A;  1Q1B A;  4O42 A;  4KD3 A;  2SNS A;  2RSO A;  3K58 A;  5DAU A;  1UNS A;  1WTW A;  1EFI D;  3TDQ A;  1EOT A;  1FYC A;  3MFY A;  4L6T B;  1M8A A;  5KND A;  3I8Z A;  3K6O A;  2YYZ A;  1PZJ D;  3LX0 A;  3J7Y W;  1ML0 D;  2D62 A;  1QNU A;  1II3 A;  2F1M A;  2K28 A;  2L9H A;  2RSN A;  4DK0 A;  1RHP A;  4ULL A;  2OXP A;  1AP0 A;  1E0B A;  1EQV A;  2R92 B;  1H9J A;  1ENF A;  2BE5 C;  3A8K E;  3D6W A;  3HEJ A;  3FMC A;  5EKI A;  1U4P A;  3DWA A;  5CV9 A;  4P2C B;  1STA A;  3NK9 A;  3NHH A;  3KF8 A;  2MPM A;  3DEO A;  3OW7 A;  1I4P A;  3KK7 A;  1HPC A;  5C3X A;  2FMC A;  2NBF A;  4CBV A;  2F0U A;  4B9X A;  3OOC A;  3FPP A;  4RGO S;  1KLG D;  1EYC A;  1B1Z A;  4RGN A;  4HSP A;  5CBA E;  3PO3 B;  3SEB A;  1JOO A;  2L55 A;  1PTO B;  4CHT B;  2E74 C;  1LAC A;  4BS9 A;  1HTP A;  5EGT A;  1AZQ A;  2A69 C;  4XYQ A;  2IJ0 A;  1H9S B;  1STY A;  5E4W C;  3ND8 A;  1SYD A;  2ZXR A;  1ET6 A;  2B2Y C;  2F0H A;  1I4Q A;  2QKI C;  1STN A;  2WAC A;  1UEA B;  3BDO A;  5C0X G;  2KQ3 A;  1NR2 A;  3J80 E;  4HSV A;  2PZW A;  3G7L A;  3GTK B;  4DFA A;  5CV6 A;  3DWQ A;  5C44 B;  4L63 B;  2R6G A;  3O13 A;  3T16 A;  1J8I A;  2K32 A;  1RTN A;  1C4Q A;  1LT3 D;  1ZEQ X;  1WTR A;  3S1N B;  5JEA G;  3J81 E;  1DCZ A;  1MGS A;  3DM1 A;  2IPK D;  4RH6 A;  1FNW A;  5ELF A;  3GTO B;  3CQZ B;  4H7B A;  5A2Q E;  4DAY A;  1JOK A;  1EU4 A;  1SNM A;  4FF4 A;  2EYH A;  4K5W A;  3BZD B;  4B9W A;  4OIK A;  4J1M A;  3I90 A;  1TWH B;  3TZU A;  3VYT A;  2C5C A;  1QJO A;  3W2D A;  4KV6 A;  3ITP A;  5G3L F;  1ROD A;  2DY8 A;  2EY5 A;  3FRP B;  1C48 A;  1ESF A;  2NN6 G;  4FXD A;  4RA8 A;  1PTO F;  3G6J B;  4H44 C;  1SYG A;  3NTK A;  2NVX B;  2B8F A;  2A68 C;  2X6L A;  5CV7 A;  2L12 A;  3F2U A;  4CKE A;  1BR9 A;  1DJR D;  1S5B D;  3HS0 C;  4XYO A;  4DK1 A;  1ICW A;  1K8O A;  4K5V A;  1TU2 B;  3RZO B;  1Q8I A;  3TN2 A;  4IFD H;  2F0Q A;  4BA1 I;  4ABN A;  1LTI D;  1BF4 A;  1SYB A;  3IFT A;  3JAM L;  1QG7 A;  3C1F A;  2E75 C;  4XQN A;  4YIJ A;  3LNN A;  2H1E A;  1SND A;  2QIL A;  1EIH A;  3EVQ A;  3PUV A;  2IL8 A;  2B2V A;  5DEH A;  1AZP A;  5IOC A;  2ENB A;  3GV3 A;  1KDC A;  1TS5 A;  4ZKB B;  4LJZ C;  1X32 A;  5EJW A;  4ZLT F;  3MWY W;  4IUU A;  2PO4 A;  1O7Z A;  2CQA A;  2HCC A;  2PPB C;  2EY1 A;  5F2D A;  1DYQ A;  1SMY D;  2B2W A;  5KNC A;  3TP8 A;  4C1N K;  5IOD A;  3HOW B;  2A6H C;  5DM6 3;  4X3U A;  1SFO B;  3Q6S A;  1WTP A;  2JXM B;  3BDL A;  4TSS A;  4BBS B;  2KED A;  2A6E D;  4V19 0;  1OXS C;  5FOB B;  1KAA A;  2E2I B;  4DNR B;  4M1U B;  4FXG C;  5M3M B;  2M00 A;  3VYR A;  1ONL A;  2EYM A;  3TZD A;  1U4M A;  2K01 A;  1LTT D;  1ILP A;  2KOL A;  3DHQ A;  3FDT A;  3X3M A;  4DXG A;  5C0X I;  4JK1 C;  2CW0 C;  1IL8 A;  5J1Z A;  4KHZ A;  1K8M A;  1IKM A;  4DF7 A;  3GV6 A;  1LTS D;  1SNC A;  1EY4 A;  4MHE A;  3I4M B;  3PV0 A;  5CV4 A;  4IUQ A;  4Q5V A;  3S1Q B;  4IZ8 A;  4FF1 A;  2CHB D;  2WIN B;  1PTO C;  3DXJ C;  4KKU A;  1GUO A;  3FPU B;  1RF2 D;  3X3N A;  1IYV A;  1WD0 A;  5IGE A;  1VF5 C;  3J80 L;  3VR6 A;  4LMQ D;  3BVM A;  1BBX C;  5T1G A;  3GQB A;  3LWE A;  4PQX A;  1G91 A;  4HN7 A;  1BCP B;  4J8Q A;  5K5P A;  3J81 L;  4QIW B;  3K5O A;  1WD1 A;  1AEX A;  3CRK C;  3DMU A;  5C3E B;  4F7X A;  3IKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...