1HHVA

Solution structure of virus chemokine vmip-ii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
GDTLGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRUS CHEMOKINE VMIP-II
publication title CCR2 and CCR5 receptor-binding properties of herpesvirus-8 vMIP-II based on sequence analysis and its solution structure
pubmed doi rcsb
molecule tags Viral protein
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1998-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hhvA00
1EIHA 2NZ1D 3GV3A 2HUGA 2K04A 3TN2A 5EKIA 1HRJA 3DEOA 1SSOA 2RVLA 1WTXA 1KNEA 1G2TA 2B2WC 1B4OA 1DONA 1EOTA 2B2UA 4IUPA 2Q8TA 1HUNA 2R3ZA 1HFNA 1AZQA 1O7ZA 4HAEA 1A15A 2IL8A 2B2UC 3N52A 1EL0A 4RA8A 3TZDA 2L1BA 1WTRA 4CJ0B 1SDFA 2RSOA 3I8ZA 2FINB 1M8AA 1AP0A 1VMPA 1G6ZA 4UAIA 5D14A 4OIJA 2KVMA 5CMDA 1RHPA 5COYA 2M2LA 3ONAB 1J8IA 1PFMA 2B2YC 1WTOA 2KEDA 3I91A 4NW2A 2MP1A 2NWGA 4R9WA 4X3UA 5CBEE 1F9SA 2B2VA 3I90A 3KBXA 4IURA 1B3AA 3MWYW 4X3SA 4DN4M 3LWEA 2L12A 4QUFA 1U4MA 1DOLA 2B2VC 3P7JA 4ZKCB 4IUUA 5EQ0A 1F9RA 2N55A 1BBXC 1ILPA 1NR2A 3QO2A 4ZKBB 2J7ZA 1U4LA 1WTQA 2JYOA 1XX8A 2X6LA 1J9OA 1MGSA 1F2LA 2KOLA 1RTOA 2K01A 1DOKA 1JICA 2EPBA 2K1BA 3G7LA 2HDMA 1C8CA 2FHTA 2K03A 1ILQA 2CVRA 4X3KA 1WD0A 1ESRA 2NYZD 3I3CA 1CA6A 4XT3B 2EE1A 2HCCA 2HDLA 1HHVA 1IKLA 1Q3LA 5T1IA 2KEEA 1O80A 1E0BA 2SDFA 3KUPA 1BNZA 2X69A 1ML0D 2B2TA 1NAPA 1U4RA 1RJTA 1ICWA 2MGSA 5EPLA 1U4PA 1WD1A 3MTSA 1CA5A 4X3TA 1G91A 2X6GA 1MSGA 2B2TC 2JP1A 1LV9A 2EOTA 3D6WA 3F2UA 5DNFA 4ZAIA 1JE4A 3DEPA 3H91A 2HCIA 4XDXA 1B53A 1EQTA 1BO0A 4MHEA 5EPKA 1F9PA 5E4WC 3IL8A 1DZ1A 1B2TA 2Q8RE 2RSNA 4ZLTF 1VMCA 5E4XA 4CJ1B 5CORA 1G2SA 2MPMA 1B50A 4HEDA 1DOMA 1S4ZA 1HFGA 3SVMA 4U68A 4MN3A 1TVXA 1HA6A 1HUMA 1QNKA 3FPUB 2L11A 4ZK9B 1O7YA 5JJZA 4OIKA 3R93A 2L4NA 1PDQA 1MI2A 1IKMA 1BF4A 1WTWA 2DY7A 1RTNA 2B2WA 3UI2A 3HP3A 1SAPA 1ZXTA 4CJ2C 1GUWA 2FMMA 1PFNA 4QUCA 3Q6SA 1EIGA 2KUMA 5D65A 1MSHA 2FJ2A 2BDNA 1KNAA 4XT1B 5CBAE 1NR4A 5EPJA 2D9UA 2FFKB 2N88A 1F9QA 3IFDA 4O42A 2K05A 2K28A 1NCVA 4HSVA 4RAUC 1PFBA 1WTVA 1QG7A 1CM9A 4HCSA 1X3QA 2XIWA 1WVLA 4IUQA 4LMQD 1AZPA 1RODA 3GV6A 1XYIA 1X3PA 2B2YA 2KECA 1IL8A 5EJWA 2VXWA 3FDTA 2H1EA 1QE6A 4R8IA 4RWSC 1WTPA 4IUTA 4IUVA 2L9HA 1PLFA 2RA4A 5T1GA 1X32A 2DY8A 2MJ8A 5AFWA 3DM1A
chains in the Genus database with same CATH superfamily
4C3HH 2VQFQ 1EQQA 1VQNA 4GLVB 3S14B 2F0SA 2F0LA 1NJIC 4GNXA 2EJMA 4KK7A 3NENA 3SK6A 3FEWX 2B2UC 4BXXH 1OO9B 1V1PA 4F7XA 1YIJA 3PO3B 1NUCA 2F4VQ 1E2VA 4V190 1HQMC 2FXQA 4KJOA 5TSSA 5K36H 2KHJA 1AP0A 3L2PA 3HOUG 1NNXA 2XGTA 2QILA 2NWGA 1XMQL 1ET9A 1PYWD 3I90A 1X65A 4A3FB 3CC4A 4DK1A 3LWEA 3BZDB 1H9JA 4OX9Q 1EY5A 4ZKCB 3C2PA 3QB3A 1J9OA 1PZKD 2PYKA 3MEFA 3GTKB 1I4RA 4A3KB 4IO9A 2WKDA 4C3IG 3LGJA 3UDGA 2D62A 2V1CC 4BBSG 1TKWB 1LTGD 1FNUA 4PG3A 1BQQT 3H94A 1TY2A 1VF7A 1EUJA 3CQZH 3T53B 5LMNL 1N33Q 4B08A 3VDYA 1BOSA 3DEPA 1ONLA 2WAQG 2N78A 1IBLL 1T5EA 1AEXA 2JK8A 5I9PA 1N9WA 1QNUA 4OEMB 2K75A 1BCPF 2YU9H 4OONA 4R1JA 2WB1B 5FOBB 5J39A 3T1HQ 3R93A 4P71A 5IYCH 1TWGB 1PH5A 2CFMA 1JMCA 4A3FG 1Y8OB 2VS1A 4LK1C 4QIWE 1BCPC 1SJED 1L0WA 5BN5A 1E3PA 1I94Q 1HCZA 3P1HA 5LMUL 4AH6A 3L7ZC 2AQ1B 2PNHA 2UUBL 1RODA 1A62A 4LFAQ 3TP5A 4A3KG 3BDCA 3K0YA 1QE6A 2NUCA 1EY4A 2C9OA 5ELFA 2L9HA 1PLFA 4HN7A 5IE8A 1EU3A 5ELOA 4YWLA 5L37A 4LW1A 1HNXQ 4GKKL 1LTBD 2E2JH 5C4XB 2PI2E 5M5WH 1VDZA 2I5LX 4ID6A 4DAPA 2KJXA 2E2HH 5H1SE 2XVSA 5GAGC 1PYSB 1G8ZD 3TZDA 3HOWG 2JA7G 1AFPA 4DK0A 1BCPD 3OW2A 1VQKA 2EYOA 1NMGA 1YEZA 4UAIA 1XJVA 2VNUD 1TWCB 4C3JH 1S3OA 5LL6S 4GLAC 2NBFA 4A3EH 1IBKL 1QVFA 3DMUA 3I73A 3CXCA 5DAUA 4DN4M 5M3MB 2O5JC 4YY3Q 3JAME 3CP0A 3VR3A 3P7JA 1WFQA 3BVMA 2ZJPA 1JORA 4PNYA 1EYGA 4FF2A 3H3VI 1I50B 3K7UC 2A19A 5E7NA 3HOYH 1ILQA 5GAEC 1WD0A 1LT6D 5C4JB 2EE1A 3HGBA 1Q3LA 3VR2A 5FJ8H 5JPMC 2KEEA 4L5QA 2HHHQ 3URYA 2OQKA 4OL7A 5EPLA 4X3TA 1MSGA 5EBCA 5ELCA 3BVGA 1Z6HA 4A3MG 3IL8A 3RZDH 1RF2D 3QR8A 1CKNA 1LTSD 1PTOF 4Y7NB 1Y1WH 5GAHC 2L15A 1HA6A 1TU2B 3QG1A 3ND9A 3T1YQ 4EQPA 2KQ3A 1HR0W 1PTOC 3GTJH 1EWIA 1EY7A 1LTTD 5ELBA 4K0KL 5CBAE 1F9QA 1K28A 1VQGA 4RMFA 4J8QA 4FXGC 5JJKA 4PZ7A 4R4IA 1E1TA 3OPOA 3DWAA 3HKZG 1EFID 2RA4A 4J1MA 1SE4A 4KI0A 4QY7A 3GTMH 2A5HA 1JCKB 2BH2A 2K5DA 2VQEQ 4F8MA 1B9MA 1PH7A 3UE1A 3TRZA 1HFNA 1K3RA 2ICEC 1PTOD 5KNBA 4XQNA 3K59A 4DR6Q 5JJLA 2L1BA 3OWEB 1SBBB 3GTPB 1BXTA 3VYTA 1C4QA 3PO2B 2KHIA 3DM3A 2F0TA 5HGTA 4M1UB 1X9NA 1HNWL 1BKBA 1UE5A 4NPSA 1Z7TA 5CC4A 2WACA 2KCNA 1MIUA 5EQ0A 1VQ4A 5M5XH 1K8MA 2N55A 1UE6A 1NR2A 4RGNA 1VQBA 1D5XC 1SROA 4ALPA 1PH9A 1MGSA 2WFWA 3E9HA 3I55A 3JAMc 5G3LF 1K3BC 1XXGA 2DGYA 4FF4A 5IT9c 3I4MG 4RCOA 3S17H 1DM0B 3D0FA 5C44B 1S5FD 5BN3A 3HOVH 4IQZA 3WWVA 5C3WA 1D6EC 1CKOA 3NUCA 4BY1G 3F2BA 5DNFA 1Q46A 3PQIA 2Z6KA 1K0SA 1XPOA 1SE2A 2AUJD 2IY5B 4I7AA 3RZOH 2F0QA 2DNEA 5CORA 2JA8B 3I70A 4XQQA 3TQYA 2F0UA 1TVXA 3PO2G 3SDZA 5LMNW 3CCJA 4OIKA 1EOVA 3S1NH 2KCMA 1AE3A 1EIGA 4QCLA 4B3SL 1HZBA 5AJ3L 3G6JB 4YIJA 2N88A 3BZCA 4CHTB 5G3LD 4LF8L 1PFBA 2K5HA 3EIVA 4C2MB 2PZTA 4LMQD 2NTSA 4ZCKA 3KJPA 4JI6Q 3S15B 1GUNA 4R8IA 4DV2Q 2EYFA 3K5MA 3TP8A 4DV4L 2K04A 4JBJA 1CT1D 1J6QA 2RVLA 1QZHA 2B2WC 5FLMG 1ASYA 2L0CA 2UXCQ 3O13A 4UP7A 2JA8G 1B9NA 5D3IB 2RSOA 3PGZA 3CMAA 3K8AA 5C4XH 2LSSA 2ID0A 1YHQA 1A63A 4NKLA 4IOCA 4POFA 4UY8C 2F03A 2JA9A 1VQ7A 3EVQA 4JI4Q 3KBXA 1DCZA 2K5QA 2H5XA 1V9PA 3MZ5A 5IYDG 3ER0A 2BA0A 3AB9A 1ILPA 3ZJYC 1F2ZA 2PNRC 3QO2A 4ZKBB 3CHBD 1O78A 4DUYL 4NXNQ 5FO8B 1VCIA 3D4DA 5JJIA 3CCQA 4K8IA 2K4KA 5M3MH 4XYQA 2CVRA 1HTLD 3I2ZA 2M9VA 4RGMA 4RHRA 3KBGA 2F0MA 3U9SA 1TS3A 1H9SA 5IOCA 5C0XJ 1SFOB 4JPBW 1E0BA 1MKHA 3KUPA 4RHSA 2OT2A 1QWYA 3MVVA 2X69A 5IIFA 4IFDH 2EIFA 2YTXA 1G91A 4FF3A 4BBRH 2ZTDA 4DV2L 3I4NG 1FYCA 4YWMA 3E0JA 4PMCA 1KRTA 1F9PA 4K5VA 2RQXA 2XRQD 2JA5G 2PPBC 1D1KA 3M3YH 1KHIA 4IPHA 1BDOA 3SVMA 1EEID 2V4DA 1SMYC 2RF4A 2L11A 4A3BB 3BVZA 3SGIA 4GZYC 2ES2A 2E2IH 1EYCA 4J6HA 2ALYB 3MXGA 1E22A 4JI3L 1ZXTA 1TS4A 5C5LA 2PZWA 1PFNA 4JI2L 1EZ8A 4ME3A 4OO1H 1XMOL 3D8GA 4KD4A 2K28A 1ENFA 4JI4L 4HSVA 3H0GH 4HCSA 2N3SA 1XYIA 4LF7Q 4K6DA 4IPCA 4BXXG 3VR4A 5IP9H 4HIMA 2RHQB 5A35A 3Q8DA 2HUGA 3K6OA 4B3TL 1E2ZA 1I4GA 1HZAA 1SMYD 3FMCA 1KC8C 4KHZA 2UXDL 3R8BA 4L6TB 3G71A 4RA8A 2Y0SE 4A3GH 1IZ6A 4E6IA 4LF4L 1I4HA 3HZXA 1Q1EA 1A3UA 1K83B 2E75C 1F77A 2R61A 3MA2B 3ICEA 2NVXB 2N49A 1NY4A 4KKUA 4JI0L 1P16A 4ULLA 1VS0A 3OW7A 3ERQA 1YITA 3FKIB 3NSWA 3VR6A 1I4QA 1Q86C 3QWNA 2RKSA 1RCVD 1UAPA 2B2VA 4B9WA 4AYBE 3PSIA 4RGOS 2OCEA 5M3FG 4MTKA 5DM73 1V43A 2I5HA 1N32L 2EY5A 5D3DA 3U58A 1SRUA 3HKSA 1JB3A 5EKLA 3EJIA 3W1GA 4DV5L 1N36L 2EPBA 1XNQL 1C8CA 3ULPA 2EQSA 1ZKOA 3J7YW 4JBMA 3UDFA 1STNA 5E1FA 2CWPA 1R9TB 4NXMQ 1TY0A 3JAML 1II3A 3CPFA 1EZ6A 1OXUA 5IT9L 1OXSC 3A8IE 3A8JE 1PH1A 4IZ8A 1SYFA 2JSOA 3G4SA 1STAA 5C44H 1PH6A 1SYDA 3BU2A 4IJHA 3TZUA 1SNMA 1LYLA 4LWCA 3TREA 1FVIA 2JA6H 1PH3A 3HKZE 1QUQB 2VW9A 3ULJA 2Q2IA 4QF4A 2IW3A 2E5LQ 1MI2A 2R92H 1BF4A 1HA5A 4CDFC 3CAMA 1D5MC 2D5DA 1HZCA 4QUCA 4X62L 3SR1A 2Q2HA 3HOZB 1MSHA 5KYIA 4DNTB 4L63B 4O42A 3E6ZX 4BWGB 4P2CB 1Q8KA 3D31A 3DLLA 1Q81C 2XIWA 2I0QA 1R4PB 1GVPA 3P75A 4OXPA 4DAYB 3T4AC 1STYA 1LO5D 2EYJA 2ENBA 2PQEA 2XSCA 4GKJL 1I6HH 3HOUB 3GO5A 2C35B 3M7NA 2VUMG 2JE6I 3SK5A 3NQTA 1B4OA 3MXNB 3SK4A 1QJOA 3N52A 3VYUA 3NXWA 4S3SA 3A7AB 4DR4Q 1LT3D 3RNUA 4X66L 3QOLA 2B8FA 5JEAH 1TWAH 4H13C 1EY0A 4DPGA 3J80E 3T16A 4LF5Q 5DEHA 2CW0D 1W6KA 3KF6B 4C3IB 3HOYG 4RCNA 4JI7Q 4IURA 5IODA 2MNAA 3PIO3 1MHWC 3RN2A 3HOZG 4JYAQ 4R4TA 4C1NK 5FK9C 4FP5D 4ZUIA 4TVAB 2A6EC 1MBYA 1D1IA 4DV6L 1SE8A 2LY7A 2WAQB 4FXDA 2HIVA 3L3OC 2R93G 3G48A 2HDMA 1I5FA 1QUQA 1CA6A 5HURA 4JV5Q 1M4VA 1YNJD 1J5EL 1AN8A 1F2MA 3I4OA 5T1IA 3A74A 1DYQA 1U4RA 2R7ZG 2MGSA 4TRDA 2ICIA 3MTSA 3M7GA 2X6GA 4UP8A 2JXMB 3EROA 3PUZA 4JI1L 1B53A 4K5XA 2OEOA 2EYLA 4AIMA 2NVTB 3LX0A 5E4WC 3S1QB 1XWEA 4HJ5A 1LTLA 4C56C 2UXBQ 3GQBA 3K80C 1I4XA 1CSPA 1HUMA 1QNKA 2A6ED 5IGFA 4DAYA 2AHOB 5JAVA 4L5RC 2L4NA 1PDQA 4MZ9A 2EZVA 4RG1A 2PMZE 4BS9A 1MJEA 1HNZQ 2CQAA 5IGCA 1LABA 3K57A 2FJ2A 4XT1B 4PMWA 2F4IA 2XWBB 3HOXH 1KAAA 4A3BH 1NCVA 3MXNA 1WTVA 1A8VA 2AKWB 2VQFL 2F0EA 4EQ5A 4IUQA 1JWUD 3HOWB 2JA7B 3S24A 4KY7A 5JOBA 4JC0A 2B63G 2RDGA 1EIYB 3NWTA 4CDDC 3GV3A 2CQOA 2ATWA 2F4VL 3Q23A 4RKBA 4X64Q 1GJXA 2RDHA 4LUOA 1FGBD 2B3GA 3C1EA 1LT4D 2P5ZX 4ME5A 3GTQH 4F87A 4GS3A 3JAMi 3W1BA 1PH4A 4OX9L 4WFN3 4TKOB 4IFDI 4WRDA 3A5UA 1JOQA 4WJWA 1J8IA 5C0XI 1PFMA 4I7ZC 3OOCA 2KEDA 3GTOH 3TSSA 4O2DA 2B39A 4B9XA 1B3AA 1U9RA 3LNNA 3J80c 2L12A 1FJGQ 1LM0A 2AQ3B 4DFAA 2NVXH 5C4ZA 4KHVA 1D5ZC 3DXJC 1A3TA 2X6LA 3FKIH 3HS0C 3MXUA 4PQXA 5C3EH 2KOLA 4A3MB 1HNZL 3PV0A 2H4OA 1OTCA 3SHLA 1PA6A 1N33L 4DR1Q 1Y69U 1GUOA 3U9OA 2M00A 5IGGA 3CCMA 2F0OA 3NELA 1B7YB 3AFQA 3EQLC 1Y8PB 1YJNA 3C1FA 1TT2A 4BY7B 4OELB 5FO9B 2B2TC 2JP1A 4IJLA 2EOTA 2RDFA 3M4OH 1GUSA 2B8GA 3T1HL 3SEBA 1EQTA 3J81L 2K32A 1AW7A 2ZXPA 1SYCA 2RSNA 4X64L 3PIP3 2G9HD 4DV7Q 4A3DH 2CHBD 4U673 1I94L 3I56A 2QF7A 1N34Q 2F0FA 3D4RA 2Y0SG 4DR7Q 2PO4A 1U5KA 5IGDA 1SLJA 1WTWA 3HKZB 2B2WA 2D0PA 3R2IA 4FYDA 4LFAL 3F1ZA 1IBMQ 3Q6SA 1IHZA 1RL2A 4LAAA 2JEAI 4XQJA 1TWHB 3AMUA 4AYBG 4RAUC 2MUYA 1HNXL 1LTID 2PQAB 1FJGL 2YTVA 5HY6A 2LXJA 1A3VA 1PRTF 4A75A 1MD2D 2EYHA 1L1OC 1HZ9A 2IWHA 1RD9D 4P73A 4HR7B 5AFWA 4FNFA 2IHFA 4R4QA 4DR1L 4BY7G 4RKLA 2NVQH 1Y1VG 1G6PA 3GTLH 4A93B 3GD7A 1C7YA 1EQVA 2F0VA 4GNXC 2BH8A 3HOUH 3BYTB 4ZQ3A 1GM5A 2Z8LA 3S1RH 4YY3L 4A3IH 1M8AA 3I4MB 1B70B 2CWAA 1RHPA 3V05A 1TWFB 4QJFA 1YJ9A 1CKMA 3K7AB 5C5MA 3S16B 1I3QB 5CBEE 2QA4A 2Q2TA 2K52A 2QDLA 3E3XA 4Z9CB 4A3JG 1JJ2A 1YBYA 4EGVA 4A76A 1NSNS 4BY1B 4MIUA 2UUAQ 2AMCB 2CKZB 4LF9Q 1PV4A 4P75A 2HHHL 4IFDG 3NTHA 5IYBG 4BBSH 3F2CA 3S2HH 2OQ0A 3A54A 3A5ZB 1PRTD 3D3RA 3SK8A 5C0XG 1IBML 3NBIA 4LNQA 4BBRG 2K03A 5IY0A 3S14H 2JEBI 3VR5A 5CV4A 2JQOA 3K81C 4YCVA 1VQEA 1JC7A 4HIKA 1BNZA 3BYYB 2O2LD 3CF5A 1VQPA 1JT8A 2J0TD 3PO3H 2GVBA 1CA5A 1L2FA 3D6WA 4ABNA 4DV0Q 4A93G 3IRBA 3T1YL 2D0OA 3K0XA 2VL6A 3KYHC 2NZOA 4CJ1B 2F0JA 1QCBD 4JW0A 2MPMA 1HXYD 4A3FH 2PQAA 4K6LA 2NN6I 4XIGS 1DXMA 1IXRA 3CKIB 3H0GG 3NTIA 5JJZA 3TS0A 1GO3E 1SYEA 2A69C 1SR3A 2DY7A 1YNXA 1XNRQ 1QOHA 1GUWA 1SAPA 4L5SA 5FO7B 2K5WA 3P20A 3GTKH 3QOJA 2KA7A 4A3KH 3GP7A 4DV3Q 4UHVA 3GTGB 4G7OC 3HG9A 4L8JA 3VA7A 1PMRA 4HMIA 1CM9A 1AZPA 2IHEA 2VQEL 4IUTA 1P8LA 4A3GG 1E2WA 4DR6L 2RCFA 5EKIA 2IJ0A 1I6VC 1JOOA 1WCMG 2A69D 2K50A 1O7ZA 1V1QA 3OMCA 1VQFA 1FL0A 1TWGH 1WI5A 3KLSX 4CJ0B 4QIWB 2RBMA 2ZM6Q 2A1AA 2L55A 1W2BA 3L0OA 1X3EA 4KY5A 3AFPA 1KRSA 2ZTCA 2B2YC 4X3UA 3J81i 4R9WA 1K8GA 3NHHA 3FHWA 5LL6X 1SYBA 4IOAA 4APVA 5A2QL 4CKBA 1IL2A 3I4NB 1XTDA 2EXDA 1XNRL 3C46A 2BE5D 1DOKA 3G7LA 2D2CC 5DLQE 5ELNA 2FHTA 1LACA 1Z9FA 3AYHB 1WJJA 4X3KA 2JA5B 5C4HA 4FF1A 2E8GA 2XTIA 1E1OA 1C48A 1VQJA 1Q7YC 2JA6G 2HIXA 3QJYA 1TQOA 2UUCQ 3ULLA 1GUGA 3PIOA 3WDNA 1ENAA 4ZAIA 3CRKC 3M85A 4AQYQ 3E5SA 4EVOA 5IGEA 5I4DA 1Q1BA 1TWCH 4KMUC 4GN3B 5JVG3 4C3HB 5E4XA 2K5VA 4CDCC 1PXUA 4QGUA 4U68A 4MN3A 3A55A 3AU7A 4IFDJ 4PZ6A 3KJOA 3I7FA 3RLNA 4KV6A 3UI2A 2Z4IA 3EA6A 1I50H 4UPAA 4CJ2C 2ZM6L 2K5NA 3TDQA 3K5NA 4JOIA 1CI3M 4JI6L 4GN5A 3A56A 5C4JH 2NN6G 4YWKA 1QG7A 3CCVA 1GOZA 1WVLA 5M5YB 1AE2A 1SE3A 3FP9A 2K14A 4A3LH 3EN2A 3HRZC 1K73C 3M4PA 2KECA 1YNNC 2VZAA 3KFUA 3IFTA 2CH4A 2UXCL 1BCPB 4KHPQ 2MHVA 3DM1A 1UEBA 5JEAG 4CBVA 1ZEQX 3RUZA 1K9MC 4Y7NH 1SSOA 2KCCA 4QMGA 3VYSA 2B2UA 3L9AX 1BBWA 4MNOA 5M3FB 4OWWB 2FMCA 3X3MA 2O4XA 1FNVA 4C3HG 1S5CD 3PF5A 2G5DA 5JVH3 1EYAA 2FINB 2XN9C 4AQYL 2E74C 2PI2A 3EFXD 1O7IA 3J81j 4NXNL 1KL9A 2MP1A 2Z0SA 3B6YA 4LF6Q 3PUYA 5K36G 1YNND 2YU9B 3I4MH 2HQEA 5LHY1 1JJGA 1F9RA 2WB1E 3K7AH 4B3RQ 1XX8A 1F2LA 3M9BA 1GD7A 4DA2A 1JICA 2QGQA 3H3VH 4DR3Q 4IN3A 2R7DA 2N8NA 1FNWA 1CZGA 1HHVA 1IKLA 3BG3A 1O80A 2QEXA 4IPGA 1B3QA 1Z47A 3CC2A 3GTPH 3W2DA 3MHBA 1C0AA 4LFCQ 5CV5A 1LV9A 3U4VA 3PO2H 4TQUS 2XRSD 2A6HC 4KHPL 1IYVA 3NPPA 2Z6KC 2K7VA 1DD2A 2BA1A 1LTAD 3OIQA 4KJNA 2E2JB 3KLWA 3HOXG 4DF7A 5M5WB 2ZJQA 2E2HB 4DGZA 4GOPC 1KLGD 1HR0Q 1ESFA 3CCEA 3HP3A 2FMMA 3KDFB 4N9TA 1RDPD 1IW7D 2VUMB 4LF7L 5CV8A 1KNAA 3BS1A 5EPJA 1IYJB 1AH9A 2R6GA 2BOSA 5IYCG 4A3EB 5C3XA 4LF6L 1XTCD 4JI5Q 1X3QA 1VQ8A 4HJ7A 1YZ6A 1ENCA 4Q0FA 2LXKA 3PIPA 1XPRA 4DXFA 1PTOB 2A6HD 2DNCA 5EJWA 5FLXE 4DUZQ 2NB0A 1WTPA 3LWUA 2LFNA 4DR2Q 2L5TA 1SXTA 3I72A 1X32A 2KENA 1DGSA 2ASBA 4GNXB 1EEFD 1OXXK 3HOYB 2AWOA 4DR3L 4JI8Q 2JA8H 2LS01 3J7AF 3DEOA 2PW5A 1HUNA 1V1PB 2R3ZA 1F2YA 4B3MQ 2IL8A 5GROA 1EL0A 2CW0C 1WTRA 2EYPA 1X3GA 3I8ZA 2R93B 4CKEA 1B8AA 4POGA 2IT1A 5D14A 5IYDH 2M2LA 5C3EG 2EJFC 4ZYSA 5CR3A 3RZDB 1HTPA 2LMCB 2NVYB 1RIPA 3H09A 4C2MH 4X3SA 2R7ZB 1U4MA 3CC7A 1EY6A 3S15H 4C3JG 4NXML 1SNOA 1QVGA 4A3EG 5JEAJ 4DV1Q 1HPCA 1YNJC 1PZJD 1XMQQ 3GTJB 2MO1A 2EXZA 4HMJA 1BUVT 2NYZD 3J7A5 2WINB 1FGUA 2SDFA 1ML0D 3MFYA 1RJTA 4A3CH 2CCZA 4HJ8A 2JA5H 3F2UA 3KDFA 4PZ8A 4DR2L 3R3OA 4JVZA 4LJZC 4XDXA 5FJ8G 1QZGA 2E5LL 1YHAA 2SNMA 3STBC 5IP7H 2HT1A 4HEDA 4PMBA 4EQNA 4BA2I 1ET6A 2LKVA 5LMNQ 4DR5Q 4B3ML 4GN4B 1GKHA 5I9OA 2B63B 5IGBA 1CSQA 1IBLQ 1VQCA 3ND8A 1X54A 1Y1WG 1JQYD 2F0NA 1KDAA 4FO2A 3FPPA 1Q90A 2TMPA 3Q22A 4GLXA 3IFDA 4IUNA 2K05A 4G7ZC 2PW7A 1I4PA 1SFOH 5K5PA 3PF4A 1TS5A 3OIPA 3GDEA 4CDEC 1Y14B 1Q82C 2R7FA 5M5XB 2VXWA 4NDXA 4FXKC 4DV1L 4HCEA 2F0HA 3STBD 5LMUQ 2MJ8A 4UP9A 4A3IG 4DR4L 5M5YH 2QW7A 1ASZA 1LLRD 1L0YB 5FLXc 3S17B 2UUBQ 1HRJA 4H0LC 1KNEA 4LF5L 1AZQA 3HOVB 1A15A 4JI7L 4LFBQ 2HD3A 1PYBA 4JYAL 4GKKQ 4F88A 4OIJA 5M3FH 1UE1A 4DNIA 1ZYRC 2DJFC 3I91A 5FKAC 3RZOB 2OTJA 4RFBA 1PFSA 3KF6A 5CV9A 1S5BD 2F3VA 4DR5L 2B2VC 4JV5L 1BBXC 3PUWA 3S1NB 3OTOQ 2J7ZA 2B29A 3PO3G 1IBKQ 3KF8B 2EVBA 5I2XA 3KOJA 2Q8IB 2CH4W 1EWCA 1NTGA 1PVOA 2Y0SB 1JWSD 4M8AA 1VQ6A 3BZKA 1KIXA 4OWXB 1NE3A 4LUZA 3R2TA 2UXBL 1SMXA 4I65A 1K83H 3MXPA 1N8RC 1ZYRD 1X55A 1CKNB 4V0BA 3HOVG 1JB7A 2AQ2B 2HQLA 1DZ1A 2Q8RE 4ZLTF 4AYBB 3T56B 5KEEA 1VQ9A 4XTCS 1G51A 4Y52H 3ITPA 2EY1A 1OXTA 2VB2X 4G57A 1SNPA 2GA4B 4RGTA 1CHPD 4OO1I 4DU9A 2KUMA 3RLFA 3DWPA 5CV7A 5KGUA 2K33A 3S9WA 3H6MA 2Z9HA 1Y1VB 1D2BA 1R9TH 3NQIA 3RMHA 5GADC 1SEBD 2VUMH 2B2YA 4JBWA 3VYRA 2WB1G 4K0KQ 3OTOL 3V96A 1LUZA 4RWSC 4C1NI 1K0RA 5IWAQ 3OMGA 1BBUA 1EIHA 1UE7A 4N8X1 1UNSA 1CQFA 2RCNA 1H9MA 1WTXA 5IT9E 1PTOH 4A3JB 4Q5VA 2BDOA 4IUPA 3S2DB 1CZWA 4ZRZA 4RH6A 2QDBA 2ZTEA 1YI2A 2NTTA 1W6JA 3S1MB 2BCOA 3EBEA 4BBRB 3KF8A 1G6ZA 2F3WA 3IAYA 3HOZH 2I46A 1PH8A 5KRUA 1FD7D 1K8AC 1F9SA 1CHQD 3M3YB 5C4XG 3D4WA 4ODGA 2R93H 4G7HC 3K5OA 1PRTC 1QVCA 5CGKA 5KNCA 2E2DC 3KLRA 4UDUC 2E2IB 1KDBA 2JYOA 2MFIA 5NUCA 4BA1I 2WP8J 2NVYH 1HNWQ 2JJQA 1JE5A 1EQRA 2JN4A 2R7ZH 1GUTA 3NBHB 1YVCA 4ZUJA 4FVMA 4H02A 2I5MX 1GHKA 3H0GB 1KTKA 1Y8NB 4H7BA 3NEMA 4X65Q 4DV7L 2A74C 5M3MG 1STHA 1U4PA 3SXHA 1QB5D 1N34L 1M1KC 5IWAL 4DR7L 2HCIA 1Q12A 1KXLA 1BO0A 5EPKA 4C3IH 4GOPB 2NZHA 4EX5A 2IPKD 4WORA 5I6WA 1A2UA 1S4ZA 3KLSA 2J4XA 3QIAA 1KAWA 2A68C 2G9DA 4QB4A 3BDLA 4KN4C 4ZK9B 3OWFA 1A0IA 1IKMA 1OXVA 1RTNA 4A3GB 3DUZA 4A3LG 1A2TA 4WJ3M 2OXPA 3RR5A 4O0AA 5ISRA 5J3BA 4NP5A 1D8LA 3AQQA 1CFMA 2FFKB 1WCMB 4K2KA 4OHJA 1TR5A 2B63H 1JWMD 1VQAA 4X6AH 1H95A 3GV6A 4QQBX 5KIXA 2EDGA 3NTKA 4OO1G 1VQ5A 4B3SQ 5AJ3Q 5BN4A 2NVTH 4LF8Q 3S1QH 2NZ1D 4XYOA 4HIDA 2A68D 3M4QA 2SEBD 2ZJRA 2Q8TA 5IP9G 3IKJA 2QEJC 4X65L 4HAEA 3AEVA 2UU9Q 2PMZB 4HTHA 2F0DA 5FLXL 3PCOB 4DV4Q 4PV1C 3DHQA 1SDFA 3OHXC 2UUAL 5CMDA 4LF9L 5COYA 5C6AA 4DAVA 3FRPB 1VQDA 3NBHA 4KLKA 4LFBL 1A6XA 2JA6B 5JPNC 2BE5C 1GXDC 3ERSX 3CRLC 2JA7H 3HOWH 3WOFA 1XPUA 3Q0AA 2R92B 1YHBA 2Z1CA 1EY9A 1STBA 4GOPA 1H9SB 4DV0L 3V2TA 4XT3B 1E7ZA 4KKTA 1D7QA 2A8VA 2QCPX 2YV5A 1BR9A 2Q2UA 4DUYQ 3W5OA 1ICWA 5KYLA 5EBDA 1VQHA 1Q8IA 1I6HB 2SNSA 3J80L 4N8FA 1G2SA 3M4YA 4HJ9A 1DOMA 1VF5C 2F0PA 3HFZB 3UE0A 5C44G 3PUVA 5GQOA 1NMFA 1RKNA 4DV3L 2UU9L 1O7YA 2DJGC 1SNDA 3PMFA 2YYZA 3RLOA 3I4LA 3TS2A 1H9RA 5J1ZA 4A3MH 2TSSA 3FVQA 1UEAB 1TWAB 3F8TA 5D65A 1M90C 2D9UA 2R92G 3MFGA 5ELEA 4P72A 3CPWA 4JI3Q 2Z4HA 2E76C 4A4IA 3UDIA 1EY8A 4JI2Q 1CUKA 4BY7H 3FDTA 1KDCA 5EAYA 2H1EA 1Y1VH 1XMOQ 1IYUA 4IALA 2F52A 5T1GA 2DY8A 1NBWA 3MEHA 2Z6BA 2WAQE 4R4CA 2IX0A 2C5CA 1SN8A 4K2LA 4JBKA 1STEA 1G2TA 2WKCA 4R8NA 5M9OA 3G6EA 1EOTA 3TP7A 4FDBA 3ZYYX 2AWNA 2XNAC 3TBIB 3J81E 1KABA 1HQRD 4B3TQ 3F2DA 1YJWA 4R4OA 2QKIC 1V8QA 1C9OA 4A3JH 2KVMA 3S2DH 1VQLA 1TWHH 2UXDQ 1GHJA 1LTRD 3CMEA 4NW2A 1W3SA 1X3FA 5IYBH 3U4ZA 2OTLA 3S1MH 3MWYW 3BJUA 5C0XH 3UDXA 4JK1C 4YHHQ 3K58A 4LF4Q 4QL5A 1G291 3X3NA 1DJRD 2PZUA 1UUPA 5CV6A 1S5DD 2IX3A 4K14A 2KCTA 4JI0Q 1BVSA 3J7AV 4A3CG 1H9KA 3CCRA 1B44D 2K01A 2UUCL 2RHSB 2XWJB 3VA5A 3TMEA 1CTMA 3CQZB 4OWTB 3HOXB 2HDLA 1N32Q 4A93H 5IP7G 3MC0B 2F0GA 1ICFB 5I6YA 4HSPA 4JG2A 1NAPA 4DV5Q 4KY6A 4HJAA 1N36Q 4ILWA 1XNQQ 2IX1A 2DN8A 1T5XD 2I07B 1JE4A 2SOBA 1X56A 3W3AA 1TWFH 2ZXRA 4MHEA 1E24A 1LT5D 1S5ED 3S16H 1VMCA 1I3QH 1SYGA 5EKKA 1U0LA 1EWHA 1HFGA 3CCLA 4DKAC 1VQIA 5KNDA 3OSOA 1IW7C 4BY1H 2EYMA 3GTQB 1JR0D 1JJCB 1K8OA 1SNCA 4WJ4A 4YCUA 2DUDA 3CCSA 4EQOA 1PHJA 1PZID 1NR4A 2F0KA 3D6CA 3RN5A 3SE0A 3GTOB 2MO0A 4G4KA 4YHHL 3MAQA 2OWOA 2GVAA 3JC66 4X62Q 4P74A 4DXGA 3A0JA 1X3PA 1EFWA 1WOCA 4A3BG 1X6OA 3RD4A 1WCMH 4H44C 1TS2A 2K6AA 5C3EB 3TP6A 1HH2P 4KD3A 3T51B 3DWQA 3TN2A 1VQMA 1HJPA 3H15A 4OGQC 2VB3X 2KBNA 1DONA 2F3IA 1O7LA 3BDOA 3HEJA 3KK7A 4N9PA 4C3JB 5HGQA 1CQVA 3NWSA 2PCFB 4GKJQ 2MQHA 4NB3A 1L1OB 3H3VC 1PH2A 1KLUD 2KHSA 1TXYA 1VMPA 2ZT9C 3N6RA 3M4OB 3C3LA 4DK6C 1STGA 3ONAB 4KKSA 1PRTB 1EYDA 4B3RL 3A7LA 1WTOA 5FLMH 3J81c 3GTGH 4DK3C 5J22A 5F2DA 4A3DB 2EY2A 5E3FA 3J80i 5BR8Q 4QUFA 3TEHB 4DNRB 4X66Q 1DOLA 1QILA 2A73B 3WOEA 4IUUA 4CGYB 2F1MA 4KN7C 4DAMA 2OF1A 1U4LA 4K5WA 3U50C 1WTQA 2EY6A 5CYUA 1RTOA 4NMZA 1UWVA 2K1BA 4LFCL 1ESRA 2ZXOA 3I3CA 3OYYA 2HCCA 3PUXA 5I2YA 4J15A 3FKIG 4DV6Q 4CKCA 3A8KE 2B2TA 3K5LA 4HIOA 3CD6A 3CU7A 1WD1A 5ELDA 1MJCA 1Y1WB 3NP8A 1TIID 3H91A 1HR0L 3CW2C 2YTYA 4YCWA 1J5EQ 2VY3A 1KQSA 1B2TA 2F0WA 3NE5B 1B50A 1T9HA 1SNQA 2GN5A 2WIIB 2NVQB 1SJHD 1VQOA 3E9IA 2WV6D 3GTLB 3FPUB 2O5IC 1V1OA 4LUVA 4JI1Q 5DM63 1L0XB 3I4NH 1B1ZA 4JI5L 2NN6H 1FR3A 2AUKA 3S1RB 4MTNA 4A3DG 4JCVE 4A3IB 4KTAA 1JOKA 1EIFA 4O1NA 4DUZL 1CK1A 4L5TA 2F0IA 2BDNA 4JOIC 4XXEA 4TSSA 1WYDA 5A2QE 5EGTA 3NK9A 5BR8L 1S40A 4JI8L 3GTMB 1S72A 3CCUA 1L1OA 1EU4A 1KD1C 4K8JA 3Q24A 3T13A 1IL8A 3J7ZC 1R4QB 1WTHA 4IUVA 3E0EA 3S2HB 4BBSB 2EJGC 4IPDA
chains in the Genus database with same CATH topology
3S14B 2F0SA 2F0LA 2EJMA 4KK7A 3SK6A 3FEWX 2B2UC 1OO9B 1V1PA 4F7XA 3PO3B 1NUCA 1E2VA 4V190 1HQMC 4KJOA 5TSSA 5K36H 1AP0A 2QILA 2NWGA 1ET9A 1PYWD 3I90A 4A3FB 4DK1A 3LWEA 3BZDB 1H9JA 1EY5A 4ZKCB 3C2PA 3QB3A 1J9OA 1PZKD 2PYKA 3GTKB 1I4RA 4A3KB 2WKDA 4C3IG 2D62A 1TKWB 1LTGD 1FNUA 1BQQT 3H94A 1TY2A 1VF7A 3T53B 4B08A 1BOSA 3DEPA 1ONLA 1T5EA 1AEXA 5I9PA 1QNUA 1BCPF 2WB1B 5FOBB 5J39A 3R93A 1TWGB 1Y8OB 4LK1C 1BCPC 1SJED 5BN5A 1HCZA 3P1HA 3L7ZC 2AQ1B 1RODA 3TP5A 3BDCA 3K0YA 1QE6A 2NUCA 1EY4A 2C9OA 5ELFA 2L9HA 1PLFA 4HN7A 1EU3A 1LTBD 5C4XB 1VDZA 4ID6A 4DAPA 2KJXA 2XVSA 1G8ZD 3TZDA 1AFPA 4DK0A 1BCPD 2EYOA 4UAIA 2VNUD 1TWCB 5LL6S 2NBFA 3DMUA 3I73A 5DAUA 4DN4M 5M3MB 2O5JC 3JAME 3VR3A 3P7JA 3BVMA 1JORA 4PNYA 4FF2A 1I50B 1ILQA 1WD0A 1LT6D 5C4JB 2EE1A 3HGBA 1Q3LA 3VR2A 5JPMC 2KEEA 3URYA 4OL7A 5EPLA 4X3TA 1MSGA 5EBCA 5ELCA 3BVGA 1Z6HA 3IL8A 1RF2D 1LTSD 1PTOF 4Y7NB 1HA6A 1TU2B 3QG1A 3ND9A 4EQPA 2KQ3A 1PTOC 1EY7A 1LTTD 5ELBA 5CBAE 1F9QA 4J8QA 4FXGC 3OPOA 3DWAA 1EFID 2RA4A 4J1MA 1SE4A 4KI0A 2A5HA 1JCKB 2K5DA 4F8MA 1B9MA 1HFNA 2ICEC 1PTOD 5KNBA 4XQNA 3K59A 2L1BA 3OWEB 1SBBB 3GTPB 1BXTA 3VYTA 1C4QA 3PO2B 2F0TA 5HGTA 4M1UB 1Z7TA 5CC4A 2WACA 2KCNA 5EQ0A 1K8MA 2N55A 1NR2A 4RGNA 1D5XC 1MGSA 5G3LF 1XXGA 4FF4A 4RCOA 1DM0B 5C44B 1S5FD 5BN3A 4IQZA 5C3WA 1D6EC 3NUCA 5DNFA 1SE2A 2AUJD 2F0QA 2DNEA 5CORA 2JA8B 3I70A 4XQQA 2F0UA 1TVXA 3SDZA 4OIKA 1EIGA 4QCLA 3G6JB 4YIJA 2N88A 4CHTB 5G3LD 1PFBA 4C2MB 2PZTA 4LMQD 2NTSA 3S15B 1GUNA 4R8IA 2EYFA 3K5MA 3TP8A 2K04A 1CT1D 2RVLA 2B2WC 2L0CA 3O13A 1B9NA 5D3IB 2RSOA 2ID0A 4NKLA 2F03A 3EVQA 3KBXA 1DCZA 2K5QA 3MZ5A 2BA0A 3AB9A 1ILPA 1F2ZA 2PNRC 3QO2A 4ZKBB 3CHBD 1O78A 5FO8B 1VCIA 3D4DA 4K8IA 4XYQA 2CVRA 1HTLD 2M9VA 4RGMA 4RHRA 3KBGA 2F0MA 3U9SA 1TS3A 1H9SA 5IOCA 5C0XJ 1SFOB 1E0BA 3KUPA 4RHSA 2OT2A 1QWYA 3MVVA 2X69A 5IIFA 4IFDH 1G91A 4FF3A 1FYCA 3E0JA 4PMCA 1F9PA 4K5VA 2RQXA 2XRQD 2PPBC 1D1KA 3SVMA 1BDOA 1EEID 2V4DA 1SMYC 2L11A 4A3BB 3BVZA 4GZYC 1EYCA 4J6HA 3MXGA 1ZXTA 1TS4A 5C5LA 2PZWA 1PFNA 1EZ8A 4OO1H 3D8GA 4KD4A 2K28A 1ENFA 4HSVA 4HCSA 1XYIA 4K6DA 3VR4A 5A35A 2HUGA 3K6OA 1E2ZA 1I4GA 1SMYD 3FMCA 4KHZA 3R8BA 4L6TB 4RA8A 4E6IA 1I4HA 3HZXA 1Q1EA 1A3UA 1K83B 2E75C 1F77A 2R61A 3MA2B 2NVXB 4KKUA 4ULLA 3OW7A 3ERQA 3FKIB 3NSWA 3VR6A 1I4QA 3QWNA 2RKSA 1RCVD 1UAPA 2B2VA 4B9WA 4RGOS 5DM73 1V43A 2EY5A 5D3DA 1JB3A 5EKLA 3EJIA 2EPBA 1C8CA 1ZKOA 3J7YW 1STNA 5E1FA 1R9TB 1TY0A 3JAML 1II3A 1EZ6A 1OXUA 5IT9L 1OXSC 3A8IE 3A8JE 4IZ8A 1SYFA 2JSOA 1STAA 1SYDA 3TZUA 1SNMA 4QF4A 2IW3A 1MI2A 1BF4A 1HA5A 1D5MC 2D5DA 4QUCA 3SR1A 3HOZB 1MSHA 5KYIA 4DNTB 4L63B 4O42A 3E6ZX 4BWGB 4P2CB 3D31A 2XIWA 1R4PB 3P75A 3T4AC 1STYA 1LO5D 2EYJA 2ENBA 2PQEA 2XSCA 3HOUB 3GO5A 3M7NA 2JE6I 3SK5A 3NQTA 1B4OA 3SK4A 1QJOA 3N52A 3VYUA 3NXWA 4S3SA 3A7AB 1LT3D 3QOLA 2B8FA 5JEAH 4H13C 1EY0A 3J80E 3T16A 5DEHA 2CW0D 1W6KA 4C3IB 4RCNA 4IURA 5IODA 3PIO3 4C1NK 5FK9C 4FP5D 4ZUIA 2A6EC 1MBYA 1D1IA 2LY7A 2WAQB 4FXDA 3L3OC 2HDMA 1CA6A 5HURA 1M4VA 1YNJD 1AN8A 1F2MA 5T1IA 1DYQA 1U4RA 2MGSA 4TRDA 2ICIA 3MTSA 3M7GA 2X6GA 2JXMB 3EROA 3PUZA 1B53A 4K5XA 2OEOA 2EYLA 2NVTB 3LX0A 5E4WC 3S1QB 1XWEA 4C56C 3GQBA 1I4XA 1HUMA 1QNKA 2A6ED 5IGFA 4DAYA 5JAVA 2L4NA 1PDQA 2EZVA 4BS9A 2CQAA 5IGCA 1LABA 3K57A 2FJ2A 4XT1B 4PMWA 2F4IA 2XWBB 1KAAA 1NCVA 3MXNA 1WTVA 2F0EA 4IUQA 1JWUD 3HOWB 2JA7B 4KY7A 5JOBA 2RDGA 3NWTA 3GV3A 3Q23A 4RKBA 1GJXA 2RDHA 1FGBD 3C1EA 1LT4D 4ME5A 4F87A 4WFN3 4TKOB 4IFDI 4WRDA 1JOQA 4WJWA 1J8IA 5C0XI 1PFMA 4I7ZC 3OOCA 2KEDA 3TSSA 2B39A 4B9XA 1B3AA 1U9RA 3LNNA 2L12A 2AQ3B 4DFAA 5C4ZA 4KHVA 1D5ZC 3DXJC 1A3TA 2X6LA 3HS0C 3MXUA 4PQXA 4A3MB 2KOLA 3PV0A 2H4OA 3SHLA 1Y69U 1GUOA 3U9OA 2M00A 5IGGA 2F0OA 3EQLC 1Y8PB 3C1FA 1TT2A 4BY7B 5FO9B 2B2TC 2JP1A 2EOTA 2RDFA 1GUSA 2B8GA 3SEBA 1EQTA 3J81L 2K32A 1AW7A 2ZXPA 1SYCA 2RSNA 3PIP3 2G9HD 2CHBD 4U673 2QF7A 2F0FA 3D4RA 2PO4A 5IGDA 1WTWA 3HKZB 2B2WA 3R2IA 4FYDA 3Q6SA 1IHZA 4LAAA 2JEAI 4XQJA 1TWHB 3AMUA 4RAUC 2MUYA 1LTID 1A3VA 1PRTF 1MD2D 2EYHA 2IWHA 1RD9D 4HR7B 5AFWA 4FNFA 4RKLA 4A93B 3GD7A 1EQVA 2F0VA 3BYTB 4ZQ3A 2Z8LA 1M8AA 3I4MB 1RHPA 3V05A 1TWFB 3K7AB 5C5MA 3S16B 1I3QB 5CBEE 4Z9CB 4EGVA 1NSNS 4BY1B 4MIUA 4IFDG 3NTHA 3D3RA 3A54A 3SK8A 1PRTD 5C0XG 3NBIA 2K03A 2JEBI 3VR5A 5CV4A 1JC7A 1BNZA 3BYYB 2O2LD 2J0TD 1CA5A 3D6WA 4ABNA 4CJ1B 2F0JA 1QCBD 2MPMA 1HXYD 4K6LA 2NN6I 4XIGS 1DXMA 3CKIB 3NTIA 5JJZA 1SYEA 2A69C 2DY7A 1QOHA 1GUWA 1SAPA 5FO7B 2K5WA 3P20A 3QOJA 2KA7A 3GP7A 3GTGB 4G7OC 3HG9A 4L8JA 3VA7A 1PMRA 4HMIA 1CM9A 1AZPA 4IUTA 1E2WA 5EKIA 2IJ0A 1I6VC 1JOOA 2A69D 1O7ZA 3OMCA 3KLSX 4CJ0B 4QIWB 2RBMA 2L55A 4KY5A 2B2YC 4X3UA 4R9WA 3NHHA 5LL6X 1SYBA 5A2QL 4CKBA 3I4NB 3C46A 2BE5D 1DOKA 3G7LA 2D2CC 2FHTA 1LACA 4X3KA 2JA5B 5C4HA 4FF1A 1C48A 3QJYA 1TQOA 1GUGA 3WDNA 1ENAA 4ZAIA 3CRKC 3M85A 3E5SA 4EVOA 5IGEA 5I4DA 1Q1BA 4KMUC 5JVG3 4C3HB 5E4XA 1PXUA 4U68A 4MN3A 3A55A 3AU7A 4IFDJ 4KV6A 3UI2A 2Z4IA 3EA6A 4CJ2C 3K5NA 3TDQA 1CI3M 3A56A 2NN6G 1QG7A 1GOZA 1WVLA 5M5YB 1SE3A 3HRZC 2KECA 1YNNC 3IFTA 1BCPB 2MHVA 3DM1A 5JEAG 4CBVA 1ZEQX 3RUZA 1SSOA 2KCCA 4QMGA 3VYSA 2B2UA 3L9AX 5M3FB 2FMCA 3X3MA 2O4XA 1FNVA 4C3HG 1S5CD 5JVH3 1EYAA 2FINB 2XN9C 2E74C 3EFXD 2MP1A 3PUYA 5K36G 1YNND 2YU9B 2HQEA 5LHY1 1F9RA 1XX8A 1F2LA 4DA2A 1JICA 4IN3A 1FNWA 1CZGA 1HHVA 1IKLA 3BG3A 1O80A 1Z47A 3W2DA 3MHBA 5CV5A 1LV9A 4TQUS 2XRSD 2A6HC 1IYVA 3NPPA 2K7VA 1DD2A 2BA1A 1LTAD 3OIQA 4KJNA 2E2JB 4DF7A 5M5WB 2E2HB 4DGZA 1KLGD 1ESFA 3HP3A 2FMMA 4N9TA 1RDPD 1IW7D 2VUMB 5CV8A 1KNAA 3BS1A 5EPJA 2R6GA 2BOSA 4A3EB 5C3XA 1XTCD 1X3QA 1ENCA 4Q0FA 4DXFA 1PTOB 2A6HD 2DNCA 5EJWA 5FLXE 2NB0A 1WTPA 3LWUA 2LFNA 2L5TA 1SXTA 3I72A 1X32A 1EEFD 1OXXK 3HOYB 2AWOA 3J7AF 2LS01 3DEOA 2PW5A 1HUNA 1V1PB 2R3ZA 1F2YA 2IL8A 1EL0A 2CW0C 1WTRA 2EYPA 3I8ZA 2R93B 4CKEA 2IT1A 5D14A 2M2LA 2EJFC 4ZYSA 5CR3A 3RZDB 1HTPA 2LMCB 2NVYB 3H09A 4X3SA 2R7ZB 1U4MA 1EY6A 4C3JG 1SNOA 5JEAJ 1HPCA 1YNJC 1PZJD 3GTJB 2EXZA 4HMJA 1BUVT 2NYZD 2WINB 2SDFA 1ML0D 3MFYA 1RJTA 3F2UA 3R3OA 4LJZC 4XDXA 2SNMA 4HEDA 4PMBA 4EQNA 4BA2I 1ET6A 2LKVA 5I9OA 2B63B 5IGBA 3ND8A 1JQYD 2F0NA 1KDAA 4FO2A 3FPPA 1Q90A 2TMPA 3Q22A 3IFDA 4IUNA 2K05A 4G7ZC 2PW7A 1I4PA 5K5PA 1TS5A 3OIPA 5M5XB 2VXWA 4NDXA 4FXKC 4HCEA 2F0HA 2MJ8A 1LLRD 1L0YB 3S17B 1HRJA 4H0LC 1KNEA 1AZQA 3HOVB 1A15A 4F88A 4OIJA 1ZYRC 3I91A 5FKAC 3RZOB 4RFBA 5CV9A 1S5BD 2F3VA 2B2VC 1BBXC 3PUWA 3S1NB 2J7ZA 2EVBA 5I2XA 2Q8IB 1EWCA 2Y0SB 1JWSD 4M8AA 3R2TA 4I65A 3MXPA 1ZYRD 4V0BA 2AQ2B 1DZ1A 2Q8RE 4ZLTF 4AYBB 3T56B 5KEEA 4XTCS 3ITPA 2EY1A 1OXTA 2VB2X 4G57A 1SNPA 2GA4B 4RGTA 1CHPD 4OO1I 4DU9A 2KUMA 3RLFA 3DWPA 5CV7A 5KGUA 2K33A 3S9WA 3H6MA 1Y1VB 1D2BA 3NQIA 3RMHA 1SEBD 2B2YA 4JBWA 3VYRA 3V96A 4RWSC 4C1NI 3OMGA 1EIHA 1UNSA 1CQFA 1H9MA 1WTXA 5IT9E 1PTOH 4A3JB 4Q5VA 2BDOA 4IUPA 3S2DB 1CZWA 4ZRZA 4RH6A 2QDBA 2NTTA 1W6JA 3S1MB 2BCOA 4BBRB 3KF8A 1G6ZA 2F3WA 3IAYA 2I46A 5KRUA 1FD7D 1F9SA 1CHQD 3M3YB 3D4WA 4ODGA 4G7HC 3K5OA 1PRTC 5CGKA 5KNCA 2E2DC 3KLRA 4UDUC 2E2IB 1KDBA 2JYOA 5NUCA 4BA1I 2WP8J 1GUTA 4ZUJA 4FVMA 1GHKA 3H0GB 1KTKA 1Y8NB 4H7BA 2A74C 1STHA 1U4PA 3SXHA 1QB5D 2HCIA 1Q12A 1BO0A 5EPKA 2IPKD 4WORA 5I6WA 1A2UA 1S4ZA 3KLSA 2J4XA 3QIAA 2A68C 2G9DA 4QB4A 3BDLA 4KN4C 4ZK9B 3OWFA 1IKMA 1OXVA 1RTNA 4A3GB 3DUZA 1A2TA 2OXPA 5ISRA 4NP5A 1CFMA 2FFKB 1WCMB 4K2KA 4OHJA 1TR5A 1JWMD 3GV6A 5KIXA 2EDGA 3NTKA 4OO1G 5BN4A 2NZ1D 4XYOA 2A68D 2SEBD 2Q8TA 3IKJA 2QEJC 4HAEA 2PMZB 4HTHA 2F0DA 5FLXL 4PV1C 3DHQA 1SDFA 3OHXC 5CMDA 5COYA 5C6AA 4DAVA 3FRPB 3NBHA 1A6XA 2JA6B 5JPNC 2BE5C 1GXDC 3CRLC 3WOFA 3Q0AA 2R92B 2Z1CA 1EY9A 1STBA 1H9SB 3V2TA 4XT3B 4KKTA 2QCPX 1BR9A 1ICWA 5KYLA 5EBDA 1Q8IA 1I6HB 2SNSA 3J80L 1G2SA 3M4YA 1DOMA 1VF5C 2F0PA 3PUVA 1RKNA 1O7YA 1SNDA 3PMFA 2YYZA 3I4LA 1H9RA 5J1ZA 2TSSA 3FVQA 1UEAB 1TWAB 5D65A 2D9UA 3MFGA 5ELEA 2Z4HA 2E76C 1EY8A 3FDTA 1KDCA 2H1EA 1IYUA 4IALA 5T1GA 2DY8A 3MEHA 2IX0A 2C5CA 4K2LA 1STEA 1G2TA 2WKCA 4R8NA 5M9OA 1EOTA 3TP7A 3ZYYX 2AWNA 2XNAC 3TBIB 3J81E 1KABA 1HQRD 2QKIC 1V8QA 2KVMA 1GHJA 1LTRD 4NW2A 3MWYW 5C0XH 4JK1C 3K58A 1G291 3X3NA 1DJRD 2PZUA 1UUPA 5CV6A 1S5DD 2IX3A 4K14A 3J7AV 1H9KA 1B44D 2K01A 2XWJB 3VA5A 3TMEA 1CTMA 3CQZB 3HOXB 2HDLA 3MC0B 2F0GA 5I6YA 4HSPA 1NAPA 4KY6A 4ILWA 2IX1A 2DN8A 1T5XD 2I07B 1JE4A 2SOBA 3W3AA 2ZXRA 4MHEA 1LT5D 1S5ED 1VMCA 1SYGA 5EKKA 1EWHA 1HFGA 5KNDA 3OSOA 1IW7C 2EYMA 3GTQB 1JR0D 1K8OA 1SNCA 4EQOA 1PZID 1NR4A 2F0KA 3D6CA 3SE0A 3GTOB 4G4KA 3MAQA 4DXGA 1X3PA 3RD4A 4H44C 1TS2A 2K6AA 5C3EB 3TP6A 4KD3A 3T51B 3DWQA 3TN2A 4OGQC 2VB3X 1DONA 1O7LA 3BDOA 3HEJA 3KK7A 4N9PA 4C3JB 1CQVA 3NWSA 2PCFB 3H3VC 1KLUD 2KHSA 1VMPA 2ZT9C 3N6RA 3M4OB 3C3LA 1STGA 3ONAB 4KKSA 1PRTB 1EYDA 3A7LA 1WTOA 5J22A 5F2DA 4A3DB 2EY2A 5E3FA 4QUFA 4DNRB 1DOLA 1QILA 2A73B 3WOEA 4IUUA 4CGYB 2F1MA 4KN7C 2OF1A 1U4LA 4K5WA 1WTQA 2EY6A 5CYUA 1RTOA 4NMZA 2K1BA 1ESRA 2ZXOA 3I3CA 2HCCA 3PUXA 5I2YA 4CKCA 3A8KE 2B2TA 3K5LA 3CU7A 1WD1A 5ELDA 1Y1WB 3NP8A 1TIID 3H91A 1B2TA 2F0WA 3NE5B 1B50A 1SNQA 2WIIB 2NVQB 1SJHD 2WV6D 3GTLB 3FPUB 2O5IC 1V1OA 5DM63 1L0XB 1B1ZA 2NN6H 1FR3A 2AUKA 3S1RB 4A3IB 4KTAA 1JOKA 4O1NA 1CK1A 2F0IA 2BDNA 4XXEA 4TSSA 5A2QE 5EGTA 3NK9A 3GTMB 1EU4A 4K8JA 3Q24A 3T13A 1IL8A 1R4QB 4IUVA 3S2HB 4BBSB 2EJGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIH A;  2NZ1 D;  3GV3 A;  2HUG A;  2K04 A;  3TN2 A;  5EKI A;  1HRJ A;  3DEO A;  1SSO A;  2RVL A;  1WTX A;  1KNE A;  1G2T A;  2B2W C;  1B4O A;  1DON A;  1EOT A;  2B2U A;  4IUP A;  2Q8T A;  1HUN A;  2R3Z A;  1HFN A;  1AZQ A;  1O7Z A;  4HAE A;  1A15 A;  2IL8 A;  2B2U C;  3N52 A;  1EL0 A;  4RA8 A;  3TZD A;  2L1B A;  1WTR A;  4CJ0 B;  1SDF A;  2RSO A;  3I8Z A;  2FIN B;  1M8A A;  1AP0 A;  1VMP A;  1G6Z A;  4UAI A;  5D14 A;  4OIJ A;  2KVM A;  5CMD A;  1RHP A;  5COY A;  2M2L A;  3ONA B;  1J8I A;  1PFM A;  2B2Y C;  1WTO A;  2KED A;  3I91 A;  4NW2 A;  2MP1 A;  2NWG A;  4R9W A;  4X3U A;  5CBE E;  1F9S A;  2B2V A;  3I90 A;  3KBX A;  4IUR A;  1B3A A;  3MWY W;  4X3S A;  4DN4 M;  3LWE A;  2L12 A;  4QUF A;  1U4M A;  1DOL A;  2B2V C;  3P7J A;  4ZKC B;  4IUU A;  5EQ0 A;  1F9R A;  2N55 A;  1BBX C;  1ILP A;  1NR2 A;  3QO2 A;  4ZKB B;  2J7Z A;  1U4L A;  1WTQ A;  2JYO A;  1XX8 A;  2X6L A;  1J9O A;  1MGS A;  1F2L A;  2KOL A;  1RTO A;  2K01 A;  1DOK A;  1JIC A;  2EPB A;  2K1B A;  3G7L A;  2HDM A;  1C8C A;  2FHT A;  2K03 A;  1ILQ A;  2CVR A;  4X3K A;  1WD0 A;  1ESR A;  2NYZ D;  3I3C A;  1CA6 A;  4XT3 B;  2EE1 A;  2HCC A;  2HDL A;  1HHV A;  1IKL A;  1Q3L A;  5T1I A;  2KEE A;  1O80 A;  1E0B A;  2SDF A;  3KUP A;  1BNZ A;  2X69 A;  1ML0 D;  2B2T A;  1NAP A;  1U4R A;  1RJT A;  1ICW A;  2MGS A;  5EPL A;  1U4P A;  1WD1 A;  3MTS A;  1CA5 A;  4X3T A;  1G91 A;  2X6G A;  1MSG A;  2B2T C;  2JP1 A;  1LV9 A;  2EOT A;  3D6W A;  3F2U A;  5DNF A;  4ZAI A;  1JE4 A;  3DEP A;  3H91 A;  2HCI A;  4XDX A;  1B53 A;  1EQT A;  1BO0 A;  4MHE A;  5EPK A;  1F9P A;  5E4W C;  3IL8 A;  1DZ1 A;  1B2T A;  2Q8R E;  2RSN A;  4ZLT F;  1VMC A;  5E4X A;  4CJ1 B;  5COR A;  1G2S A;  2MPM A;  1B50 A;  4HED A;  1DOM A;  1S4Z A;  1HFG A;  3SVM A;  4U68 A;  4MN3 A;  1TVX A;  1HA6 A;  1HUM A;  1QNK A;  3FPU B;  2L11 A;  4ZK9 B;  1O7Y A;  5JJZ A;  4OIK A;  3R93 A;  2L4N A;  1PDQ A;  1MI2 A;  1IKM A;  1BF4 A;  1WTW A;  2DY7 A;  1RTN A;  2B2W A;  3UI2 A;  3HP3 A;  1SAP A;  1ZXT A;  4CJ2 C;  1GUW A;  2FMM A;  1PFN A;  4QUC A;  3Q6S A;  1EIG A;  2KUM A;  5D65 A;  1MSH A;  2FJ2 A;  2BDN A;  1KNA A;  4XT1 B;  5CBA E;  1NR4 A;  5EPJ A;  2D9U A;  2FFK B;  2N88 A;  1F9Q A;  3IFD A;  4O42 A;  2K05 A;  2K28 A;  1NCV A;  4HSV A;  4RAU C;  1PFB A;  1WTV A;  1QG7 A;  1CM9 A;  4HCS A;  1X3Q A;  2XIW A;  1WVL A;  4IUQ A;  4LMQ D;  1AZP A;  1ROD A;  3GV6 A;  1XYI A;  1X3P A;  2B2Y A;  2KEC A;  1IL8 A;  5EJW A;  2VXW A;  3FDT A;  2H1E A;  1QE6 A;  4R8I A;  4RWS C;  1WTP A;  4IUT A;  4IUV A;  2L9H A;  1PLF A;  2RA4 A;  5T1G A;  1X32 A;  2DY8 A;  2MJ8 A;  5AFW A;  3DM1 A; 
#chains in the Genus database with same CATH topology
 4C3H H;  2VQF Q;  1EQQ A;  1VQN A;  4GLV B;  3S14 B;  2F0S A;  2F0L A;  1NJI C;  4GNX A;  2EJM A;  4KK7 A;  3NEN A;  3SK6 A;  3FEW X;  2B2U C;  4BXX H;  1OO9 B;  1V1P A;  4F7X A;  1YIJ A;  3PO3 B;  1NUC A;  2F4V Q;  1E2V A;  4V19 0;  1HQM C;  2FXQ A;  4KJO A;  5TSS A;  5K36 H;  2KHJ A;  1AP0 A;  3L2P A;  3HOU G;  1NNX A;  2XGT A;  2QIL A;  2NWG A;  1XMQ L;  1ET9 A;  1PYW D;  3I90 A;  1X65 A;  4A3F B;  3CC4 A;  4DK1 A;  3LWE A;  3BZD B;  1H9J A;  4OX9 Q;  1EY5 A;  4ZKC B;  3C2P A;  3QB3 A;  1J9O A;  1PZK D;  2PYK A;  3MEF A;  3GTK B;  1I4R A;  4A3K B;  4IO9 A;  2WKD A;  4C3I G;  3LGJ A;  3UDG A;  2D62 A;  2V1C C;  4BBS G;  1TKW B;  1LTG D;  1FNU A;  4PG3 A;  1BQQ T;  3H94 A;  1TY2 A;  1VF7 A;  1EUJ A;  3CQZ H;  3T53 B;  5LMN L;  1N33 Q;  4B08 A;  3VDY A;  1BOS A;  3DEP A;  1ONL A;  2WAQ G;  2N78 A;  1IBL L;  1T5E A;  1AEX A;  2JK8 A;  5I9P A;  1N9W A;  1QNU A;  4OEM B;  2K75 A;  1BCP F;  2YU9 H;  4OON A;  4R1J A;  2WB1 B;  5FOB B;  5J39 A;  3T1H Q;  3R93 A;  4P71 A;  5IYC H;  1TWG B;  1PH5 A;  2CFM A;  1JMC A;  4A3F G;  1Y8O B;  2VS1 A;  4LK1 C;  4QIW E;  1BCP C;  1SJE D;  1L0W A;  5BN5 A;  1E3P A;  1I94 Q;  1HCZ A;  3P1H A;  5LMU L;  4AH6 A;  3L7Z C;  2AQ1 B;  2PNH A;  2UUB L;  1ROD A;  1A62 A;  4LFA Q;  3TP5 A;  4A3K G;  3BDC A;  3K0Y A;  1QE6 A;  2NUC A;  1EY4 A;  2C9O A;  5ELF A;  2L9H A;  1PLF A;  4HN7 A;  5IE8 A;  1EU3 A;  5ELO A;  4YWL A;  5L37 A;  4LW1 A;  1HNX Q;  4GKK L;  1LTB D;  2E2J H;  5C4X B;  2PI2 E;  5M5W H;  1VDZ A;  2I5L X;  4ID6 A;  4DAP A;  2KJX A;  2E2H H;  5H1S E;  2XVS A;  5GAG C;  1PYS B;  1G8Z D;  3TZD A;  3HOW G;  2JA7 G;  1AFP A;  4DK0 A;  1BCP D;  3OW2 A;  1VQK A;  2EYO A;  1NMG A;  1YEZ A;  4UAI A;  1XJV A;  2VNU D;  1TWC B;  4C3J H;  1S3O A;  5LL6 S;  4GLA C;  2NBF A;  4A3E H;  1IBK L;  1QVF A;  3DMU A;  3I73 A;  3CXC A;  5DAU A;  4DN4 M;  5M3M B;  2O5J C;  4YY3 Q;  3JAM E;  3CP0 A;  3VR3 A;  3P7J A;  1WFQ A;  3BVM A;  2ZJP A;  1JOR A;  4PNY A;  1EYG A;  4FF2 A;  3H3V I;  1I50 B;  3K7U C;  2A19 A;  5E7N A;  3HOY H;  1ILQ A;  5GAE C;  1WD0 A;  1LT6 D;  5C4J B;  2EE1 A;  3HGB A;  1Q3L A;  3VR2 A;  5FJ8 H;  5JPM C;  2KEE A;  4L5Q A;  2HHH Q;  3URY A;  2OQK A;  4OL7 A;  5EPL A;  4X3T A;  1MSG A;  5EBC A;  5ELC A;  3BVG A;  1Z6H A;  4A3M G;  3IL8 A;  3RZD H;  1RF2 D;  3QR8 A;  1CKN A;  1LTS D;  1PTO F;  4Y7N B;  1Y1W H;  5GAH C;  2L15 A;  1HA6 A;  1TU2 B;  3QG1 A;  3ND9 A;  3T1Y Q;  4EQP A;  2KQ3 A;  1HR0 W;  1PTO C;  3GTJ H;  1EWI A;  1EY7 A;  1LTT D;  5ELB A;  4K0K L;  5CBA E;  1F9Q A;  1K28 A;  1VQG A;  4RMF A;  4J8Q A;  4FXG C;  5JJK A;  4PZ7 A;  4R4I A;  1E1T A;  3OPO A;  3DWA A;  3HKZ G;  1EFI D;  2RA4 A;  4J1M A;  1SE4 A;  4KI0 A;  4QY7 A;  3GTM H;  2A5H A;  1JCK B;  2BH2 A;  2K5D A;  2VQE Q;  4F8M A;  1B9M A;  1PH7 A;  3UE1 A;  3TRZ A;  1HFN A;  1K3R A;  2ICE C;  1PTO D;  5KNB A;  4XQN A;  3K59 A;  4DR6 Q;  5JJL A;  2L1B A;  3OWE B;  1SBB B;  3GTP B;  1BXT A;  3VYT A;  1C4Q A;  3PO2 B;  2KHI A;  3DM3 A;  2F0T A;  5HGT A;  4M1U B;  1X9N A;  1HNW L;  1BKB A;  1UE5 A;  4NPS A;  1Z7T A;  5CC4 A;  2WAC A;  2KCN A;  1MIU A;  5EQ0 A;  1VQ4 A;  5M5X H;  1K8M A;  2N55 A;  1UE6 A;  1NR2 A;  4RGN A;  1VQB A;  1D5X C;  1SRO A;  4ALP A;  1PH9 A;  1MGS A;  2WFW A;  3E9H A;  3I55 A;  3JAM c;  5G3L F;  1K3B C;  1XXG A;  2DGY A;  4FF4 A;  5IT9 c;  3I4M G;  4RCO A;  3S17 H;  1DM0 B;  3D0F A;  5C44 B;  1S5F D;  5BN3 A;  3HOV H;  4IQZ A;  3WWV A;  5C3W A;  1D6E C;  1CKO A;  3NUC A;  4BY1 G;  3F2B A;  5DNF A;  1Q46 A;  3PQI A;  2Z6K A;  1K0S A;  1XPO A;  1SE2 A;  2AUJ D;  2IY5 B;  4I7A A;  3RZO H;  2F0Q A;  2DNE A;  5COR A;  2JA8 B;  3I70 A;  4XQQ A;  3TQY A;  2F0U A;  1TVX A;  3PO2 G;  3SDZ A;  5LMN W;  3CCJ A;  4OIK A;  1EOV A;  3S1N H;  2KCM A;  1AE3 A;  1EIG A;  4QCL A;  4B3S L;  1HZB A;  5AJ3 L;  3G6J B;  4YIJ A;  2N88 A;  3BZC A;  4CHT B;  5G3L D;  4LF8 L;  1PFB A;  2K5H A;  3EIV A;  4C2M B;  2PZT A;  4LMQ D;  2NTS A;  4ZCK A;  3KJP A;  4JI6 Q;  3S15 B;  1GUN A;  4R8I A;  4DV2 Q;  2EYF A;  3K5M A;  3TP8 A;  4DV4 L;  2K04 A;  4JBJ A;  1CT1 D;  1J6Q A;  2RVL A;  1QZH A;  2B2W C;  5FLM G;  1ASY A;  2L0C A;  2UXC Q;  3O13 A;  4UP7 A;  2JA8 G;  1B9N A;  5D3I B;  2RSO A;  3PGZ A;  3CMA A;  3K8A A;  5C4X H;  2LSS A;  2ID0 A;  1YHQ A;  1A63 A;  4NKL A;  4IOC A;  4POF A;  4UY8 C;  2F03 A;  2JA9 A;  1VQ7 A;  3EVQ A;  4JI4 Q;  3KBX A;  1DCZ A;  2K5Q A;  2H5X A;  1V9P A;  3MZ5 A;  5IYD G;  3ER0 A;  2BA0 A;  3AB9 A;  1ILP A;  3ZJY C;  1F2Z A;  2PNR C;  3QO2 A;  4ZKB B;  3CHB D;  1O78 A;  4DUY L;  4NXN Q;  5FO8 B;  1VCI A;  3D4D A;  5JJI A;  3CCQ A;  4K8I A;  2K4K A;  5M3M H;  4XYQ A;  2CVR A;  1HTL D;  3I2Z A;  2M9V A;  4RGM A;  4RHR A;  3KBG A;  2F0M A;  3U9S A;  1TS3 A;  1H9S A;  5IOC A;  5C0X J;  1SFO B;  4JPB W;  1E0B A;  1MKH A;  3KUP A;  4RHS A;  2OT2 A;  1QWY A;  3MVV A;  2X69 A;  5IIF A;  4IFD H;  2EIF A;  2YTX A;  1G91 A;  4FF3 A;  4BBR H;  2ZTD A;  4DV2 L;  3I4N G;  1FYC A;  4YWM A;  3E0J A;  4PMC A;  1KRT A;  1F9P A;  4K5V A;  2RQX A;  2XRQ D;  2JA5 G;  2PPB C;  1D1K A;  3M3Y H;  1KHI A;  4IPH A;  1BDO A;  3SVM A;  1EEI D;  2V4D A;  1SMY C;  2RF4 A;  2L11 A;  4A3B B;  3BVZ A;  3SGI A;  4GZY C;  2ES2 A;  2E2I H;  1EYC A;  4J6H A;  2ALY B;  3MXG A;  1E22 A;  4JI3 L;  1ZXT A;  1TS4 A;  5C5L A;  2PZW A;  1PFN A;  4JI2 L;  1EZ8 A;  4ME3 A;  4OO1 H;  1XMO L;  3D8G A;  4KD4 A;  2K28 A;  1ENF A;  4JI4 L;  4HSV A;  3H0G H;  4HCS A;  2N3S A;  1XYI A;  4LF7 Q;  4K6D A;  4IPC A;  4BXX G;  3VR4 A;  5IP9 H;  4HIM A;  2RHQ B;  5A35 A;  3Q8D A;  2HUG A;  3K6O A;  4B3T L;  1E2Z A;  1I4G A;  1HZA A;  1SMY D;  3FMC A;  1KC8 C;  4KHZ A;  2UXD L;  3R8B A;  4L6T B;  3G71 A;  4RA8 A;  2Y0S E;  4A3G H;  1IZ6 A;  4E6I A;  4LF4 L;  1I4H A;  3HZX A;  1Q1E A;  1A3U A;  1K83 B;  2E75 C;  1F77 A;  2R61 A;  3MA2 B;  3ICE A;  2NVX B;  2N49 A;  1NY4 A;  4KKU A;  4JI0 L;  1P16 A;  4ULL A;  1VS0 A;  3OW7 A;  3ERQ A;  1YIT A;  3FKI B;  3NSW A;  3VR6 A;  1I4Q A;  1Q86 C;  3QWN A;  2RKS A;  1RCV D;  1UAP A;  2B2V A;  4B9W A;  4AYB E;  3PSI A;  4RGO S;  2OCE A;  5M3F G;  4MTK A;  5DM7 3;  1V43 A;  2I5H A;  1N32 L;  2EY5 A;  5D3D A;  3U58 A;  1SRU A;  3HKS A;  1JB3 A;  5EKL A;  3EJI A;  3W1G A;  4DV5 L;  1N36 L;  2EPB A;  1XNQ L;  1C8C A;  3ULP A;  2EQS A;  1ZKO A;  3J7Y W;  4JBM A;  3UDF A;  1STN A;  5E1F A;  2CWP A;  1R9T B;  4NXM Q;  1TY0 A;  3JAM L;  1II3 A;  3CPF A;  1EZ6 A;  1OXU A;  5IT9 L;  1OXS C;  3A8I E;  3A8J E;  1PH1 A;  4IZ8 A;  1SYF A;  2JSO A;  3G4S A;  1STA A;  5C44 H;  1PH6 A;  1SYD A;  3BU2 A;  4IJH A;  3TZU A;  1SNM A;  1LYL A;  4LWC A;  3TRE A;  1FVI A;  2JA6 H;  1PH3 A;  3HKZ E;  1QUQ B;  2VW9 A;  3ULJ A;  2Q2I A;  4QF4 A;  2IW3 A;  2E5L Q;  1MI2 A;  2R92 H;  1BF4 A;  1HA5 A;  4CDF C;  3CAM A;  1D5M C;  2D5D A;  1HZC A;  4QUC A;  4X62 L;  3SR1 A;  2Q2H A;  3HOZ B;  1MSH A;  5KYI A;  4DNT B;  4L63 B;  4O42 A;  3E6Z X;  4BWG B;  4P2C B;  1Q8K A;  3D31 A;  3DLL A;  1Q81 C;  2XIW A;  2I0Q A;  1R4P B;  1GVP A;  3P75 A;  4OXP A;  4DAY B;  3T4A C;  1STY A;  1LO5 D;  2EYJ A;  2ENB A;  2PQE A;  2XSC A;  4GKJ L;  1I6H H;  3HOU B;  3GO5 A;  2C35 B;  3M7N A;  2VUM G;  2JE6 I;  3SK5 A;  3NQT A;  1B4O A;  3MXN B;  3SK4 A;  1QJO A;  3N52 A;  3VYU A;  3NXW A;  4S3S A;  3A7A B;  4DR4 Q;  1LT3 D;  3RNU A;  4X66 L;  3QOL A;  2B8F A;  5JEA H;  1TWA H;  4H13 C;  1EY0 A;  4DPG A;  3J80 E;  3T16 A;  4LF5 Q;  5DEH A;  2CW0 D;  1W6K A;  3KF6 B;  4C3I B;  3HOY G;  4RCN A;  4JI7 Q;  4IUR A;  5IOD A;  2MNA A;  3PIO 3;  1MHW C;  3RN2 A;  3HOZ G;  4JYA Q;  4R4T A;  4C1N K;  5FK9 C;  4FP5 D;  4ZUI A;  4TVA B;  2A6E C;  1MBY A;  1D1I A;  4DV6 L;  1SE8 A;  2LY7 A;  2WAQ B;  4FXD A;  2HIV A;  3L3O C;  2R93 G;  3G48 A;  2HDM A;  1I5F A;  1QUQ A;  1CA6 A;  5HUR A;  4JV5 Q;  1M4V A;  1YNJ D;  1J5E L;  1AN8 A;  1F2M A;  3I4O A;  5T1I A;  3A74 A;  1DYQ A;  1U4R A;  2R7Z G;  2MGS A;  4TRD A;  2ICI A;  3MTS A;  3M7G A;  2X6G A;  4UP8 A;  2JXM B;  3ERO A;  3PUZ A;  4JI1 L;  1B53 A;  4K5X A;  2OEO A;  2EYL A;  4AIM A;  2NVT B;  3LX0 A;  5E4W C;  3S1Q B;  1XWE A;  4HJ5 A;  1LTL A;  4C56 C;  2UXB Q;  3GQB A;  3K80 C;  1I4X A;  1CSP A;  1HUM A;  1QNK A;  2A6E D;  5IGF A;  4DAY A;  2AHO B;  5JAV A;  4L5R C;  2L4N A;  1PDQ A;  4MZ9 A;  2EZV A;  4RG1 A;  2PMZ E;  4BS9 A;  1MJE A;  1HNZ Q;  2CQA A;  5IGC A;  1LAB A;  3K57 A;  2FJ2 A;  4XT1 B;  4PMW A;  2F4I A;  2XWB B;  3HOX H;  1KAA A;  4A3B H;  1NCV A;  3MXN A;  1WTV A;  1A8V A;  2AKW B;  2VQF L;  2F0E A;  4EQ5 A;  4IUQ A;  1JWU D;  3HOW B;  2JA7 B;  3S24 A;  4KY7 A;  5JOB A;  4JC0 A;  2B63 G;  2RDG A;  1EIY B;  3NWT A;  4CDD C;  3GV3 A;  2CQO A;  2ATW A;  2F4V L;  3Q23 A;  4RKB A;  4X64 Q;  1GJX A;  2RDH A;  4LUO A;  1FGB D;  2B3G A;  3C1E A;  1LT4 D;  2P5Z X;  4ME5 A;  3GTQ H;  4F87 A;  4GS3 A;  3JAM i;  3W1B A;  1PH4 A;  4OX9 L;  4WFN 3;  4TKO B;  4IFD I;  4WRD A;  3A5U A;  1JOQ A;  4WJW A;  1J8I A;  5C0X I;  1PFM A;  4I7Z C;  3OOC A;  2KED A;  3GTO H;  3TSS A;  4O2D A;  2B39 A;  4B9X A;  1B3A A;  1U9R A;  3LNN A;  3J80 c;  2L12 A;  1FJG Q;  1LM0 A;  2AQ3 B;  4DFA A;  2NVX H;  5C4Z A;  4KHV A;  1D5Z C;  3DXJ C;  1A3T A;  2X6L A;  3FKI H;  3HS0 C;  3MXU A;  4PQX A;  5C3E H;  2KOL A;  4A3M B;  1HNZ L;  3PV0 A;  2H4O A;  1OTC A;  3SHL A;  1PA6 A;  1N33 L;  4DR1 Q;  1Y69 U;  1GUO A;  3U9O A;  2M00 A;  5IGG A;  3CCM A;  2F0O A;  3NEL A;  1B7Y B;  3AFQ A;  3EQL C;  1Y8P B;  1YJN A;  3C1F A;  1TT2 A;  4BY7 B;  4OEL B;  5FO9 B;  2B2T C;  2JP1 A;  4IJL A;  2EOT A;  2RDF A;  3M4O H;  1GUS A;  2B8G A;  3T1H L;  3SEB A;  1EQT A;  3J81 L;  2K32 A;  1AW7 A;  2ZXP A;  1SYC A;  2RSN A;  4X64 L;  3PIP 3;  2G9H D;  4DV7 Q;  4A3D H;  2CHB D;  4U67 3;  1I94 L;  3I56 A;  2QF7 A;  1N34 Q;  2F0F A;  3D4R A;  2Y0S G;  4DR7 Q;  2PO4 A;  1U5K A;  5IGD A;  1SLJ A;  1WTW A;  3HKZ B;  2B2W A;  2D0P A;  3R2I A;  4FYD A;  4LFA L;  3F1Z A;  1IBM Q;  3Q6S A;  1IHZ A;  1RL2 A;  4LAA A;  2JEA I;  4XQJ A;  1TWH B;  3AMU A;  4AYB G;  4RAU C;  2MUY A;  1HNX L;  1LTI D;  2PQA B;  1FJG L;  2YTV A;  5HY6 A;  2LXJ A;  1A3V A;  1PRT F;  4A75 A;  1MD2 D;  2EYH A;  1L1O C;  1HZ9 A;  2IWH A;  1RD9 D;  4P73 A;  4HR7 B;  5AFW A;  4FNF A;  2IHF A;  4R4Q A;  4DR1 L;  4BY7 G;  4RKL A;  2NVQ H;  1Y1V G;  1G6P A;  3GTL H;  4A93 B;  3GD7 A;  1C7Y A;  1EQV A;  2F0V A;  4GNX C;  2BH8 A;  3HOU H;  3BYT B;  4ZQ3 A;  1GM5 A;  2Z8L A;  3S1R H;  4YY3 L;  4A3I H;  1M8A A;  3I4M B;  1B70 B;  2CWA A;  1RHP A;  3V05 A;  1TWF B;  4QJF A;  1YJ9 A;  1CKM A;  3K7A B;  5C5M A;  3S16 B;  1I3Q B;  5CBE E;  2QA4 A;  2Q2T A;  2K52 A;  2QDL A;  3E3X A;  4Z9C B;  4A3J G;  1JJ2 A;  1YBY A;  4EGV A;  4A76 A;  1NSN S;  4BY1 B;  4MIU A;  2UUA Q;  2AMC B;  2CKZ B;  4LF9 Q;  1PV4 A;  4P75 A;  2HHH L;  4IFD G;  3NTH A;  5IYB G;  4BBS H;  3F2C A;  3S2H H;  2OQ0 A;  3A54 A;  3A5Z B;  1PRT D;  3D3R A;  3SK8 A;  5C0X G;  1IBM L;  3NBI A;  4LNQ A;  4BBR G;  2K03 A;  5IY0 A;  3S14 H;  2JEB I;  3VR5 A;  5CV4 A;  2JQO A;  3K81 C;  4YCV A;  1VQE A;  1JC7 A;  4HIK A;  1BNZ A;  3BYY B;  2O2L D;  3CF5 A;  1VQP A;  1JT8 A;  2J0T D;  3PO3 H;  2GVB A;  1CA5 A;  1L2F A;  3D6W A;  4ABN A;  4DV0 Q;  4A93 G;  3IRB A;  3T1Y L;  2D0O A;  3K0X A;  2VL6 A;  3KYH C;  2NZO A;  4CJ1 B;  2F0J A;  1QCB D;  4JW0 A;  2MPM A;  1HXY D;  4A3F H;  2PQA A;  4K6L A;  2NN6 I;  4XIG S;  1DXM A;  1IXR A;  3CKI B;  3H0G G;  3NTI A;  5JJZ A;  3TS0 A;  1GO3 E;  1SYE A;  2A69 C;  1SR3 A;  2DY7 A;  1YNX A;  1XNR Q;  1QOH A;  1GUW A;  1SAP A;  4L5S A;  5FO7 B;  2K5W A;  3P20 A;  3GTK H;  3QOJ A;  2KA7 A;  4A3K H;  3GP7 A;  4DV3 Q;  4UHV A;  3GTG B;  4G7O C;  3HG9 A;  4L8J A;  3VA7 A;  1PMR A;  4HMI A;  1CM9 A;  1AZP A;  2IHE A;  2VQE L;  4IUT A;  1P8L A;  4A3G G;  1E2W A;  4DR6 L;  2RCF A;  5EKI A;  2IJ0 A;  1I6V C;  1JOO A;  1WCM G;  2A69 D;  2K50 A;  1O7Z A;  1V1Q A;  3OMC A;  1VQF A;  1FL0 A;  1TWG H;  1WI5 A;  3KLS X;  4CJ0 B;  4QIW B;  2RBM A;  2ZM6 Q;  2A1A A;  2L55 A;  1W2B A;  3L0O A;  1X3E A;  4KY5 A;  3AFP A;  1KRS A;  2ZTC A;  2B2Y C;  4X3U A;  3J81 i;  4R9W A;  1K8G A;  3NHH A;  3FHW A;  5LL6 X;  1SYB A;  4IOA A;  4APV A;  5A2Q L;  4CKB A;  1IL2 A;  3I4N B;  1XTD A;  2EXD A;  1XNR L;  3C46 A;  2BE5 D;  1DOK A;  3G7L A;  2D2C C;  5DLQ E;  5ELN A;  2FHT A;  1LAC A;  1Z9F A;  3AYH B;  1WJJ A;  4X3K A;  2JA5 B;  5C4H A;  4FF1 A;  2E8G A;  2XTI A;  1E1O A;  1C48 A;  1VQJ A;  1Q7Y C;  2JA6 G;  2HIX A;  3QJY A;  1TQO A;  2UUC Q;  3ULL A;  1GUG A;  3PIO A;  3WDN A;  1ENA A;  4ZAI A;  3CRK C;  3M85 A;  4AQY Q;  3E5S A;  4EVO A;  5IGE A;  5I4D A;  1Q1B A;  1TWC H;  4KMU C;  4GN3 B;  5JVG 3;  4C3H B;  5E4X A;  2K5V A;  4CDC C;  1PXU A;  4QGU A;  4U68 A;  4MN3 A;  3A55 A;  3AU7 A;  4IFD J;  4PZ6 A;  3KJO A;  3I7F A;  3RLN A;  4KV6 A;  3UI2 A;  2Z4I A;  3EA6 A;  1I50 H;  4UPA A;  4CJ2 C;  2ZM6 L;  2K5N A;  3TDQ A;  3K5N A;  4JOI A;  1CI3 M;  4JI6 L;  4GN5 A;  3A56 A;  5C4J H;  2NN6 G;  4YWK A;  1QG7 A;  3CCV A;  1GOZ A;  1WVL A;  5M5Y B;  1AE2 A;  1SE3 A;  3FP9 A;  2K14 A;  4A3L H;  3EN2 A;  3HRZ C;  1K73 C;  3M4P A;  2KEC A;  1YNN C;  2VZA A;  3KFU A;  3IFT A;  2CH4 A;  2UXC L;  1BCP B;  4KHP Q;  2MHV A;  3DM1 A;  1UEB A;  5JEA G;  4CBV A;  1ZEQ X;  3RUZ A;  1K9M C;  4Y7N H;  1SSO A;  2KCC A;  4QMG A;  3VYS A;  2B2U A;  3L9A X;  1BBW A;  4MNO A;  5M3F B;  4OWW B;  2FMC A;  3X3M A;  2O4X A;  1FNV A;  4C3H G;  1S5C D;  3PF5 A;  2G5D A;  5JVH 3;  1EYA A;  2FIN B;  2XN9 C;  4AQY L;  2E74 C;  2PI2 A;  3EFX D;  1O7I A;  3J81 j;  4NXN L;  1KL9 A;  2MP1 A;  2Z0S A;  3B6Y A;  4LF6 Q;  3PUY A;  5K36 G;  1YNN D;  2YU9 B;  3I4M H;  2HQE A;  5LHY 1;  1JJG A;  1F9R A;  2WB1 E;  3K7A H;  4B3R Q;  1XX8 A;  1F2L A;  3M9B A;  1GD7 A;  4DA2 A;  1JIC A;  2QGQ A;  3H3V H;  4DR3 Q;  4IN3 A;  2R7D A;  2N8N A;  1FNW A;  1CZG A;  1HHV A;  1IKL A;  3BG3 A;  1O80 A;  2QEX A;  4IPG A;  1B3Q A;  1Z47 A;  3CC2 A;  3GTP H;  3W2D A;  3MHB A;  1C0A A;  4LFC Q;  5CV5 A;  1LV9 A;  3U4V A;  3PO2 H;  4TQU S;  2XRS D;  2A6H C;  4KHP L;  1IYV A;  3NPP A;  2Z6K C;  2K7V A;  1DD2 A;  2BA1 A;  1LTA D;  3OIQ A;  4KJN A;  2E2J B;  3KLW A;  3HOX G;  4DF7 A;  5M5W B;  2ZJQ A;  2E2H B;  4DGZ A;  4GOP C;  1KLG D;  1HR0 Q;  1ESF A;  3CCE A;  3HP3 A;  2FMM A;  3KDF B;  4N9T A;  1RDP D;  1IW7 D;  2VUM B;  4LF7 L;  5CV8 A;  1KNA A;  3BS1 A;  5EPJ A;  1IYJ B;  1AH9 A;  2R6G A;  2BOS A;  5IYC G;  4A3E B;  5C3X A;  4LF6 L;  1XTC D;  4JI5 Q;  1X3Q A;  1VQ8 A;  4HJ7 A;  1YZ6 A;  1ENC A;  4Q0F A;  2LXK A;  3PIP A;  1XPR A;  4DXF A;  1PTO B;  2A6H D;  2DNC A;  5EJW A;  5FLX E;  4DUZ Q;  2NB0 A;  1WTP A;  3LWU A;  2LFN A;  4DR2 Q;  2L5T A;  1SXT A;  3I72 A;  1X32 A;  2KEN A;  1DGS A;  2ASB A;  4GNX B;  1EEF D;  1OXX K;  3HOY B;  2AWO A;  4DR3 L;  4JI8 Q;  2JA8 H;  2LS0 1;  3J7A F;  3DEO A;  2PW5 A;  1HUN A;  1V1P B;  2R3Z A;  1F2Y A;  4B3M Q;  2IL8 A;  5GRO A;  1EL0 A;  2CW0 C;  1WTR A;  2EYP A;  1X3G A;  3I8Z A;  2R93 B;  4CKE A;  1B8A A;  4POG A;  2IT1 A;  5D14 A;  5IYD H;  2M2L A;  5C3E G;  2EJF C;  4ZYS A;  5CR3 A;  3RZD B;  1HTP A;  2LMC B;  2NVY B;  1RIP A;  3H09 A;  4C2M H;  4X3S A;  2R7Z B;  1U4M A;  3CC7 A;  1EY6 A;  3S15 H;  4C3J G;  4NXM L;  1SNO A;  1QVG A;  4A3E G;  5JEA J;  4DV1 Q;  1HPC A;  1YNJ C;  1PZJ D;  1XMQ Q;  3GTJ B;  2MO1 A;  2EXZ A;  4HMJ A;  1BUV T;  2NYZ D;  3J7A 5;  2WIN B;  1FGU A;  2SDF A;  1ML0 D;  3MFY A;  1RJT A;  4A3C H;  2CCZ A;  4HJ8 A;  2JA5 H;  3F2U A;  3KDF A;  4PZ8 A;  4DR2 L;  3R3O A;  4JVZ A;  4LJZ C;  4XDX A;  5FJ8 G;  1QZG A;  2E5L L;  1YHA A;  2SNM A;  3STB C;  5IP7 H;  2HT1 A;  4HED A;  4PMB A;  4EQN A;  4BA2 I;  1ET6 A;  2LKV A;  5LMN Q;  4DR5 Q;  4B3M L;  4GN4 B;  1GKH A;  5I9O A;  2B63 B;  5IGB A;  1CSQ A;  1IBL Q;  1VQC A;  3ND8 A;  1X54 A;  1Y1W G;  1JQY D;  2F0N A;  1KDA A;  4FO2 A;  3FPP A;  1Q90 A;  2TMP A;  3Q22 A;  4GLX A;  3IFD A;  4IUN A;  2K05 A;  4G7Z C;  2PW7 A;  1I4P A;  1SFO H;  5K5P A;  3PF4 A;  1TS5 A;  3OIP A;  3GDE A;  4CDE C;  1Y14 B;  1Q82 C;  2R7F A;  5M5X B;  2VXW A;  4NDX A;  4FXK C;  4DV1 L;  4HCE A;  2F0H A;  3STB D;  5LMU Q;  2MJ8 A;  4UP9 A;  4A3I G;  4DR4 L;  5M5Y H;  2QW7 A;  1ASZ A;  1LLR D;  1L0Y B;  5FLX c;  3S17 B;  2UUB Q;  1HRJ A;  4H0L C;  1KNE A;  4LF5 L;  1AZQ A;  3HOV B;  1A15 A;  4JI7 L;  4LFB Q;  2HD3 A;  1PYB A;  4JYA L;  4GKK Q;  4F88 A;  4OIJ A;  5M3F H;  1UE1 A;  4DNI A;  1ZYR C;  2DJF C;  3I91 A;  5FKA C;  3RZO B;  2OTJ A;  4RFB A;  1PFS A;  3KF6 A;  5CV9 A;  1S5B D;  2F3V A;  4DR5 L;  2B2V C;  4JV5 L;  1BBX C;  3PUW A;  3S1N B;  3OTO Q;  2J7Z A;  2B29 A;  3PO3 G;  1IBK Q;  3KF8 B;  2EVB A;  5I2X A;  3KOJ A;  2Q8I B;  2CH4 W;  1EWC A;  1NTG A;  1PVO A;  2Y0S B;  1JWS D;  4M8A A;  1VQ6 A;  3BZK A;  1KIX A;  4OWX B;  1NE3 A;  4LUZ A;  3R2T A;  2UXB L;  1SMX A;  4I65 A;  1K83 H;  3MXP A;  1N8R C;  1ZYR D;  1X55 A;  1CKN B;  4V0B A;  3HOV G;  1JB7 A;  2AQ2 B;  2HQL A;  1DZ1 A;  2Q8R E;  4ZLT F;  4AYB B;  3T56 B;  5KEE A;  1VQ9 A;  4XTC S;  1G51 A;  4Y52 H;  3ITP A;  2EY1 A;  1OXT A;  2VB2 X;  4G57 A;  1SNP A;  2GA4 B;  4RGT A;  1CHP D;  4OO1 I;  4DU9 A;  2KUM A;  3RLF A;  3DWP A;  5CV7 A;  5KGU A;  2K33 A;  3S9W A;  3H6M A;  2Z9H A;  1Y1V B;  1D2B A;  1R9T H;  3NQI A;  3RMH A;  5GAD C;  1SEB D;  2VUM H;  2B2Y A;  4JBW A;  3VYR A;  2WB1 G;  4K0K Q;  3OTO L;  3V96 A;  1LUZ A;  4RWS C;  4C1N I;  1K0R A;  5IWA Q;  3OMG A;  1BBU A;  1EIH A;  1UE7 A;  4N8X 1;  1UNS A;  1CQF A;  2RCN A;  1H9M A;  1WTX A;  5IT9 E;  1PTO H;  4A3J B;  4Q5V A;  2BDO A;  4IUP A;  3S2D B;  1CZW A;  4ZRZ A;  4RH6 A;  2QDB A;  2ZTE A;  1YI2 A;  2NTT A;  1W6J A;  3S1M B;  2BCO A;  3EBE A;  4BBR B;  3KF8 A;  1G6Z A;  2F3W A;  3IAY A;  3HOZ H;  2I46 A;  1PH8 A;  5KRU A;  1FD7 D;  1K8A C;  1F9S A;  1CHQ D;  3M3Y B;  5C4X G;  3D4W A;  4ODG A;  2R93 H;  4G7H C;  3K5O A;  1PRT C;  1QVC A;  5CGK A;  5KNC A;  2E2D C;  3KLR A;  4UDU C;  2E2I B;  1KDB A;  2JYO A;  2MFI A;  5NUC A;  4BA1 I;  2WP8 J;  2NVY H;  1HNW Q;  2JJQ A;  1JE5 A;  1EQR A;  2JN4 A;  2R7Z H;  1GUT A;  3NBH B;  1YVC A;  4ZUJ A;  4FVM A;  4H02 A;  2I5M X;  1GHK A;  3H0G B;  1KTK A;  1Y8N B;  4H7B A;  3NEM A;  4X65 Q;  4DV7 L;  2A74 C;  5M3M G;  1STH A;  1U4P A;  3SXH A;  1QB5 D;  1N34 L;  1M1K C;  5IWA L;  4DR7 L;  2HCI A;  1Q12 A;  1KXL A;  1BO0 A;  5EPK A;  4C3I H;  4GOP B;  2NZH A;  4EX5 A;  2IPK D;  4WOR A;  5I6W A;  1A2U A;  1S4Z A;  3KLS A;  2J4X A;  3QIA A;  1KAW A;  2A68 C;  2G9D A;  4QB4 A;  3BDL A;  4KN4 C;  4ZK9 B;  3OWF A;  1A0I A;  1IKM A;  1OXV A;  1RTN A;  4A3G B;  3DUZ A;  4A3L G;  1A2T A;  4WJ3 M;  2OXP A;  3RR5 A;  4O0A A;  5ISR A;  5J3B A;  4NP5 A;  1D8L A;  3AQQ A;  1CFM A;  2FFK B;  1WCM B;  4K2K A;  4OHJ A;  1TR5 A;  2B63 H;  1JWM D;  1VQA A;  4X6A H;  1H95 A;  3GV6 A;  4QQB X;  5KIX A;  2EDG A;  3NTK A;  4OO1 G;  1VQ5 A;  4B3S Q;  5AJ3 Q;  5BN4 A;  2NVT H;  4LF8 Q;  3S1Q H;  2NZ1 D;  4XYO A;  4HID A;  2A68 D;  3M4Q A;  2SEB D;  2ZJR A;  2Q8T A;  5IP9 G;  3IKJ A;  2QEJ C;  4X65 L;  4HAE A;  3AEV A;  2UU9 Q;  2PMZ B;  4HTH A;  2F0D A;  5FLX L;  3PCO B;  4DV4 Q;  4PV1 C;  3DHQ A;  1SDF A;  3OHX C;  2UUA L;  5CMD A;  4LF9 L;  5COY A;  5C6A A;  4DAV A;  3FRP B;  1VQD A;  3NBH A;  4KLK A;  4LFB L;  1A6X A;  2JA6 B;  5JPN C;  2BE5 C;  1GXD C;  3ERS X;  3CRL C;  2JA7 H;  3HOW H;  3WOF A;  1XPU A;  3Q0A A;  2R92 B;  1YHB A;  2Z1C A;  1EY9 A;  1STB A;  4GOP A;  1H9S B;  4DV0 L;  3V2T A;  4XT3 B;  1E7Z A;  4KKT A;  1D7Q A;  2A8V A;  2QCP X;  2YV5 A;  1BR9 A;  2Q2U A;  4DUY Q;  3W5O A;  1ICW A;  5KYL A;  5EBD A;  1VQH A;  1Q8I A;  1I6H B;  2SNS A;  3J80 L;  4N8F A;  1G2S A;  3M4Y A;  4HJ9 A;  1DOM A;  1VF5 C;  2F0P A;  3HFZ B;  3UE0 A;  5C44 G;  3PUV A;  5GQO A;  1NMF A;  1RKN A;  4DV3 L;  2UU9 L;  1O7Y A;  2DJG C;  1SND A;  3PMF A;  2YYZ A;  3RLO A;  3I4L A;  3TS2 A;  1H9R A;  5J1Z A;  4A3M H;  2TSS A;  3FVQ A;  1UEA B;  1TWA B;  3F8T A;  5D65 A;  1M90 C;  2D9U A;  2R92 G;  3MFG A;  5ELE A;  4P72 A;  3CPW A;  4JI3 Q;  2Z4H A;  2E76 C;  4A4I A;  3UDI A;  1EY8 A;  4JI2 Q;  1CUK A;  4BY7 H;  3FDT A;  1KDC A;  5EAY A;  2H1E A;  1Y1V H;  1XMO Q;  1IYU A;  4IAL A;  2F52 A;  5T1G A;  2DY8 A;  1NBW A;  3MEH A;  2Z6B A;  2WAQ E;  4R4C A;  2IX0 A;  2C5C A;  1SN8 A;  4K2L A;  4JBK A;  1STE A;  1G2T A;  2WKC A;  4R8N A;  5M9O A;  3G6E A;  1EOT A;  3TP7 A;  4FDB A;  3ZYY X;  2AWN A;  2XNA C;  3TBI B;  3J81 E;  1KAB A;  1HQR D;  4B3T Q;  3F2D A;  1YJW A;  4R4O A;  2QKI C;  1V8Q A;  1C9O A;  4A3J H;  2KVM A;  3S2D H;  1VQL A;  1TWH H;  2UXD Q;  1GHJ A;  1LTR D;  3CME A;  4NW2 A;  1W3S A;  1X3F A;  5IYB H;  3U4Z A;  2OTL A;  3S1M H;  3MWY W;  3BJU A;  5C0X H;  3UDX A;  4JK1 C;  4YHH Q;  3K58 A;  4LF4 Q;  4QL5 A;  1G29 1;  3X3N A;  1DJR D;  2PZU A;  1UUP A;  5CV6 A;  1S5D D;  2IX3 A;  4K14 A;  2KCT A;  4JI0 Q;  1BVS A;  3J7A V;  4A3C G;  1H9K A;  3CCR A;  1B44 D;  2K01 A;  2UUC L;  2RHS B;  2XWJ B;  3VA5 A;  3TME A;  1CTM A;  3CQZ B;  4OWT B;  3HOX B;  2HDL A;  1N32 Q;  4A93 H;  5IP7 G;  3MC0 B;  2F0G A;  1ICF B;  5I6Y A;  4HSP A;  4JG2 A;  1NAP A;  4DV5 Q;  4KY6 A;  4HJA A;  1N36 Q;  4ILW A;  1XNQ Q;  2IX1 A;  2DN8 A;  1T5X D;  2I07 B;  1JE4 A;  2SOB A;  1X56 A;  3W3A A;  1TWF H;  2ZXR A;  4MHE A;  1E24 A;  1LT5 D;  1S5E D;  3S16 H;  1VMC A;  1I3Q H;  1SYG A;  5EKK A;  1U0L A;  1EWH A;  1HFG A;  3CCL A;  4DKA C;  1VQI A;  5KND A;  3OSO A;  1IW7 C;  4BY1 H;  2EYM A;  3GTQ B;  1JR0 D;  1JJC B;  1K8O A;  1SNC A;  4WJ4 A;  4YCU A;  2DUD A;  3CCS A;  4EQO A;  1PHJ A;  1PZI D;  1NR4 A;  2F0K A;  3D6C A;  3RN5 A;  3SE0 A;  3GTO B;  2MO0 A;  4G4K A;  4YHH L;  3MAQ A;  2OWO A;  2GVA A;  3JC6 6;  4X62 Q;  4P74 A;  4DXG A;  3A0J A;  1X3P A;  1EFW A;  1WOC A;  4A3B G;  1X6O A;  3RD4 A;  1WCM H;  4H44 C;  1TS2 A;  2K6A A;  5C3E B;  3TP6 A;  1HH2 P;  4KD3 A;  3T51 B;  3DWQ A;  3TN2 A;  1VQM A;  1HJP A;  3H15 A;  4OGQ C;  2VB3 X;  2KBN A;  1DON A;  2F3I A;  1O7L A;  3BDO A;  3HEJ A;  3KK7 A;  4N9P A;  4C3J B;  5HGQ A;  1CQV A;  3NWS A;  2PCF B;  4GKJ Q;  2MQH A;  4NB3 A;  1L1O B;  3H3V C;  1PH2 A;  1KLU D;  2KHS A;  1TXY A;  1VMP A;  2ZT9 C;  3N6R A;  3M4O B;  3C3L A;  4DK6 C;  1STG A;  3ONA B;  4KKS A;  1PRT B;  1EYD A;  4B3R L;  3A7L A;  1WTO A;  5FLM H;  3J81 c;  3GTG H;  4DK3 C;  5J22 A;  5F2D A;  4A3D B;  2EY2 A;  5E3F A;  3J80 i;  5BR8 Q;  4QUF A;  3TEH B;  4DNR B;  4X66 Q;  1DOL A;  1QIL A;  2A73 B;  3WOE A;  4IUU A;  4CGY B;  2F1M A;  4KN7 C;  4DAM A;  2OF1 A;  1U4L A;  4K5W A;  3U50 C;  1WTQ A;  2EY6 A;  5CYU A;  1RTO A;  4NMZ A;  1UWV A;  2K1B A;  4LFC L;  1ESR A;  2ZXO A;  3I3C A;  3OYY A;  2HCC A;  3PUX A;  5I2Y A;  4J15 A;  3FKI G;  4DV6 Q;  4CKC A;  3A8K E;  2B2T A;  3K5L A;  4HIO A;  3CD6 A;  3CU7 A;  1WD1 A;  5ELD A;  1MJC A;  1Y1W B;  3NP8 A;  1TII D;  3H91 A;  1HR0 L;  3CW2 C;  2YTY A;  4YCW A;  1J5E Q;  2VY3 A;  1KQS A;  1B2T A;  2F0W A;  3NE5 B;  1B50 A;  1T9H A;  1SNQ A;  2GN5 A;  2WII B;  2NVQ B;  1SJH D;  1VQO A;  3E9I A;  2WV6 D;  3GTL B;  3FPU B;  2O5I C;  1V1O A;  4LUV A;  4JI1 Q;  5DM6 3;  1L0X B;  3I4N H;  1B1Z A;  4JI5 L;  2NN6 H;  1FR3 A;  2AUK A;  3S1R B;  4MTN A;  4A3D G;  4JCV E;  4A3I B;  4KTA A;  1JOK A;  1EIF A;  4O1N A;  4DUZ L;  1CK1 A;  4L5T A;  2F0I A;  2BDN A;  4JOI C;  4XXE A;  4TSS A;  1WYD A;  5A2Q E;  5EGT A;  3NK9 A;  5BR8 L;  1S40 A;  4JI8 L;  3GTM B;  1S72 A;  3CCU A;  1L1O A;  1EU4 A;  1KD1 C;  4K8J A;  3Q24 A;  3T13 A;  1IL8 A;  3J7Z C;  1R4Q B;  1WTH A;  4IUV A;  3E0E A;  3S2H B;  4BBS B;  2EJG C;  4IPD A; 
#chains in the Genus database with same CATH homology
 3S14 B;  2F0S A;  2F0L A;  2EJM A;  4KK7 A;  3SK6 A;  3FEW X;  2B2U C;  1OO9 B;  1V1P A;  4F7X A;  3PO3 B;  1NUC A;  1E2V A;  4V19 0;  1HQM C;  4KJO A;  5TSS A;  5K36 H;  1AP0 A;  2QIL A;  2NWG A;  1ET9 A;  1PYW D;  3I90 A;  4A3F B;  4DK1 A;  3LWE A;  3BZD B;  1H9J A;  1EY5 A;  4ZKC B;  3C2P A;  3QB3 A;  1J9O A;  1PZK D;  2PYK A;  3GTK B;  1I4R A;  4A3K B;  2WKD A;  4C3I G;  2D62 A;  1TKW B;  1LTG D;  1FNU A;  1BQQ T;  3H94 A;  1TY2 A;  1VF7 A;  3T53 B;  4B08 A;  1BOS A;  3DEP A;  1ONL A;  1T5E A;  1AEX A;  5I9P A;  1QNU A;  1BCP F;  2WB1 B;  5FOB B;  5J39 A;  3R93 A;  1TWG B;  1Y8O B;  4LK1 C;  1BCP C;  1SJE D;  5BN5 A;  1HCZ A;  3P1H A;  3L7Z C;  2AQ1 B;  1ROD A;  3TP5 A;  3BDC A;  3K0Y A;  1QE6 A;  2NUC A;  1EY4 A;  2C9O A;  5ELF A;  2L9H A;  1PLF A;  4HN7 A;  1EU3 A;  1LTB D;  5C4X B;  1VDZ A;  4ID6 A;  4DAP A;  2KJX A;  2XVS A;  1G8Z D;  3TZD A;  1AFP A;  4DK0 A;  1BCP D;  2EYO A;  4UAI A;  2VNU D;  1TWC B;  5LL6 S;  2NBF A;  3DMU A;  3I73 A;  5DAU A;  4DN4 M;  5M3M B;  2O5J C;  3JAM E;  3VR3 A;  3P7J A;  3BVM A;  1JOR A;  4PNY A;  4FF2 A;  1I50 B;  1ILQ A;  1WD0 A;  1LT6 D;  5C4J B;  2EE1 A;  3HGB A;  1Q3L A;  3VR2 A;  5JPM C;  2KEE A;  3URY A;  4OL7 A;  5EPL A;  4X3T A;  1MSG A;  5EBC A;  5ELC A;  3BVG A;  1Z6H A;  3IL8 A;  1RF2 D;  1LTS D;  1PTO F;  4Y7N B;  1HA6 A;  1TU2 B;  3QG1 A;  3ND9 A;  4EQP A;  2KQ3 A;  1PTO C;  1EY7 A;  1LTT D;  5ELB A;  5CBA E;  1F9Q A;  4J8Q A;  4FXG C;  3OPO A;  3DWA A;  1EFI D;  2RA4 A;  4J1M A;  1SE4 A;  4KI0 A;  2A5H A;  1JCK B;  2K5D A;  4F8M A;  1B9M A;  1HFN A;  2ICE C;  1PTO D;  5KNB A;  4XQN A;  3K59 A;  2L1B A;  3OWE B;  1SBB B;  3GTP B;  1BXT A;  3VYT A;  1C4Q A;  3PO2 B;  2F0T A;  5HGT A;  4M1U B;  1Z7T A;  5CC4 A;  2WAC A;  2KCN A;  5EQ0 A;  1K8M A;  2N55 A;  1NR2 A;  4RGN A;  1D5X C;  1MGS A;  5G3L F;  1XXG A;  4FF4 A;  4RCO A;  1DM0 B;  5C44 B;  1S5F D;  5BN3 A;  4IQZ A;  5C3W A;  1D6E C;  3NUC A;  5DNF A;  1SE2 A;  2AUJ D;  2F0Q A;  2DNE A;  5COR A;  2JA8 B;  3I70 A;  4XQQ A;  2F0U A;  1TVX A;  3SDZ A;  4OIK A;  1EIG A;  4QCL A;  3G6J B;  4YIJ A;  2N88 A;  4CHT B;  5G3L D;  1PFB A;  4C2M B;  2PZT A;  4LMQ D;  2NTS A;  3S15 B;  1GUN A;  4R8I A;  2EYF A;  3K5M A;  3TP8 A;  2K04 A;  1CT1 D;  2RVL A;  2B2W C;  2L0C A;  3O13 A;  1B9N A;  5D3I B;  2RSO A;  2ID0 A;  4NKL A;  2F03 A;  3EVQ A;  3KBX A;  1DCZ A;  2K5Q A;  3MZ5 A;  2BA0 A;  3AB9 A;  1ILP A;  1F2Z A;  2PNR C;  3QO2 A;  4ZKB B;  3CHB D;  1O78 A;  5FO8 B;  1VCI A;  3D4D A;  4K8I A;  4XYQ A;  2CVR A;  1HTL D;  2M9V A;  4RGM A;  4RHR A;  3KBG A;  2F0M A;  3U9S A;  1TS3 A;  1H9S A;  5IOC A;  5C0X J;  1SFO B;  1E0B A;  3KUP A;  4RHS A;  2OT2 A;  1QWY A;  3MVV A;  2X69 A;  5IIF A;  4IFD H;  1G91 A;  4FF3 A;  1FYC A;  3E0J A;  4PMC A;  1F9P A;  4K5V A;  2RQX A;  2XRQ D;  2PPB C;  1D1K A;  3SVM A;  1BDO A;  1EEI D;  2V4D A;  1SMY C;  2L11 A;  4A3B B;  3BVZ A;  4GZY C;  1EYC A;  4J6H A;  3MXG A;  1ZXT A;  1TS4 A;  5C5L A;  2PZW A;  1PFN A;  1EZ8 A;  4OO1 H;  3D8G A;  4KD4 A;  2K28 A;  1ENF A;  4HSV A;  4HCS A;  1XYI A;  4K6D A;  3VR4 A;  5A35 A;  2HUG A;  3K6O A;  1E2Z A;  1I4G A;  1SMY D;  3FMC A;  4KHZ A;  3R8B A;  4L6T B;  4RA8 A;  4E6I A;  1I4H A;  3HZX A;  1Q1E A;  1A3U A;  1K83 B;  2E75 C;  1F77 A;  2R61 A;  3MA2 B;  2NVX B;  4KKU A;  4ULL A;  3OW7 A;  3ERQ A;  3FKI B;  3NSW A;  3VR6 A;  1I4Q A;  3QWN A;  2RKS A;  1RCV D;  1UAP A;  2B2V A;  4B9W A;  4RGO S;  5DM7 3;  1V43 A;  2EY5 A;  5D3D A;  1JB3 A;  5EKL A;  3EJI A;  2EPB A;  1C8C A;  1ZKO A;  3J7Y W;  1STN A;  5E1F A;  1R9T B;  1TY0 A;  3JAM L;  1II3 A;  1EZ6 A;  1OXU A;  5IT9 L;  1OXS C;  3A8I E;  3A8J E;  4IZ8 A;  1SYF A;  2JSO A;  1STA A;  1SYD A;  3TZU A;  1SNM A;  4QF4 A;  2IW3 A;  1MI2 A;  1BF4 A;  1HA5 A;  1D5M C;  2D5D A;  4QUC A;  3SR1 A;  3HOZ B;  1MSH A;  5KYI A;  4DNT B;  4L63 B;  4O42 A;  3E6Z X;  4BWG B;  4P2C B;  3D31 A;  2XIW A;  1R4P B;  3P75 A;  3T4A C;  1STY A;  1LO5 D;  2EYJ A;  2ENB A;  2PQE A;  2XSC A;  3HOU B;  3GO5 A;  3M7N A;  2JE6 I;  3SK5 A;  3NQT A;  1B4O A;  3SK4 A;  1QJO A;  3N52 A;  3VYU A;  3NXW A;  4S3S A;  3A7A B;  1LT3 D;  3QOL A;  2B8F A;  5JEA H;  4H13 C;  1EY0 A;  3J80 E;  3T16 A;  5DEH A;  2CW0 D;  1W6K A;  4C3I B;  4RCN A;  4IUR A;  5IOD A;  3PIO 3;  4C1N K;  5FK9 C;  4FP5 D;  4ZUI A;  2A6E C;  1MBY A;  1D1I A;  2LY7 A;  2WAQ B;  4FXD A;  3L3O C;  2HDM A;  1CA6 A;  5HUR A;  1M4V A;  1YNJ D;  1AN8 A;  1F2M A;  5T1I A;  1DYQ A;  1U4R A;  2MGS A;  4TRD A;  2ICI A;  3MTS A;  3M7G A;  2X6G A;  2JXM B;  3ERO A;  3PUZ A;  1B53 A;  4K5X A;  2OEO A;  2EYL A;  2NVT B;  3LX0 A;  5E4W C;  3S1Q B;  1XWE A;  4C56 C;  3GQB A;  1I4X A;  1HUM A;  1QNK A;  2A6E D;  5IGF A;  4DAY A;  5JAV A;  2L4N A;  1PDQ A;  2EZV A;  4BS9 A;  2CQA A;  5IGC A;  1LAB A;  3K57 A;  2FJ2 A;  4XT1 B;  4PMW A;  2F4I A;  2XWB B;  1KAA A;  1NCV A;  3MXN A;  1WTV A;  2F0E A;  4IUQ A;  1JWU D;  3HOW B;  2JA7 B;  4KY7 A;  5JOB A;  2RDG A;  3NWT A;  3GV3 A;  3Q23 A;  4RKB A;  1GJX A;  2RDH A;  1FGB D;  3C1E A;  1LT4 D;  4ME5 A;  4F87 A;  4WFN 3;  4TKO B;  4IFD I;  4WRD A;  1JOQ A;  4WJW A;  1J8I A;  5C0X I;  1PFM A;  4I7Z C;  3OOC A;  2KED A;  3TSS A;  2B39 A;  4B9X A;  1B3A A;  1U9R A;  3LNN A;  2L12 A;  2AQ3 B;  4DFA A;  5C4Z A;  4KHV A;  1D5Z C;  3DXJ C;  1A3T A;  2X6L A;  3HS0 C;  3MXU A;  4PQX A;  4A3M B;  2KOL A;  3PV0 A;  2H4O A;  3SHL A;  1Y69 U;  1GUO A;  3U9O A;  2M00 A;  5IGG A;  2F0O A;  3EQL C;  1Y8P B;  3C1F A;  1TT2 A;  4BY7 B;  5FO9 B;  2B2T C;  2JP1 A;  2EOT A;  2RDF A;  1GUS A;  2B8G A;  3SEB A;  1EQT A;  3J81 L;  2K32 A;  1AW7 A;  2ZXP A;  1SYC A;  2RSN A;  3PIP 3;  2G9H D;  2CHB D;  4U67 3;  2QF7 A;  2F0F A;  3D4R A;  2PO4 A;  5IGD A;  1WTW A;  3HKZ B;  2B2W A;  3R2I A;  4FYD A;  3Q6S A;  1IHZ A;  4LAA A;  2JEA I;  4XQJ A;  1TWH B;  3AMU A;  4RAU C;  2MUY A;  1LTI D;  1A3V A;  1PRT F;  1MD2 D;  2EYH A;  2IWH A;  1RD9 D;  4HR7 B;  5AFW A;  4FNF A;  4RKL A;  4A93 B;  3GD7 A;  1EQV A;  2F0V A;  3BYT B;  4ZQ3 A;  2Z8L A;  1M8A A;  3I4M B;  1RHP A;  3V05 A;  1TWF B;  3K7A B;  5C5M A;  3S16 B;  1I3Q B;  5CBE E;  4Z9C B;  4EGV A;  1NSN S;  4BY1 B;  4MIU A;  4IFD G;  3NTH A;  3D3R A;  3A54 A;  3SK8 A;  1PRT D;  5C0X G;  3NBI A;  2K03 A;  2JEB I;  3VR5 A;  5CV4 A;  1JC7 A;  1BNZ A;  3BYY B;  2O2L D;  2J0T D;  1CA5 A;  3D6W A;  4ABN A;  4CJ1 B;  2F0J A;  1QCB D;  2MPM A;  1HXY D;  4K6L A;  2NN6 I;  4XIG S;  1DXM A;  3CKI B;  3NTI A;  5JJZ A;  1SYE A;  2A69 C;  2DY7 A;  1QOH A;  1GUW A;  1SAP A;  5FO7 B;  2K5W A;  3P20 A;  3QOJ A;  2KA7 A;  3GP7 A;  3GTG B;  4G7O C;  3HG9 A;  4L8J A;  3VA7 A;  1PMR A;  4HMI A;  1CM9 A;  1AZP A;  4IUT A;  1E2W A;  5EKI A;  2IJ0 A;  1I6V C;  1JOO A;  2A69 D;  1O7Z A;  3OMC A;  3KLS X;  4CJ0 B;  4QIW B;  2RBM A;  2L55 A;  4KY5 A;  2B2Y C;  4X3U A;  4R9W A;  3NHH A;  5LL6 X;  1SYB A;  5A2Q L;  4CKB A;  3I4N B;  3C46 A;  2BE5 D;  1DOK A;  3G7L A;  2D2C C;  2FHT A;  1LAC A;  4X3K A;  2JA5 B;  5C4H A;  4FF1 A;  1C48 A;  3QJY A;  1TQO A;  1GUG A;  3WDN A;  1ENA A;  4ZAI A;  3CRK C;  3M85 A;  3E5S A;  4EVO A;  5IGE A;  5I4D A;  1Q1B A;  4KMU C;  5JVG 3;  4C3H B;  5E4X A;  1PXU A;  4U68 A;  4MN3 A;  3A55 A;  3AU7 A;  4IFD J;  4KV6 A;  3UI2 A;  2Z4I A;  3EA6 A;  4CJ2 C;  3K5N A;  3TDQ A;  1CI3 M;  3A56 A;  2NN6 G;  1QG7 A;  1GOZ A;  1WVL A;  5M5Y B;  1SE3 A;  3HRZ C;  2KEC A;  1YNN C;  3IFT A;  1BCP B;  2MHV A;  3DM1 A;  5JEA G;  4CBV A;  1ZEQ X;  3RUZ A;  1SSO A;  2KCC A;  4QMG A;  3VYS A;  2B2U A;  3L9A X;  5M3F B;  2FMC A;  3X3M A;  2O4X A;  1FNV A;  4C3H G;  1S5C D;  5JVH 3;  1EYA A;  2FIN B;  2XN9 C;  2E74 C;  3EFX D;  2MP1 A;  3PUY A;  5K36 G;  1YNN D;  2YU9 B;  2HQE A;  5LHY 1;  1F9R A;  1XX8 A;  1F2L A;  4DA2 A;  1JIC A;  4IN3 A;  1FNW A;  1CZG A;  1HHV A;  1IKL A;  3BG3 A;  1O80 A;  1Z47 A;  3W2D A;  3MHB A;  5CV5 A;  1LV9 A;  4TQU S;  2XRS D;  2A6H C;  1IYV A;  3NPP A;  2K7V A;  1DD2 A;  2BA1 A;  1LTA D;  3OIQ A;  4KJN A;  2E2J B;  4DF7 A;  5M5W B;  2E2H B;  4DGZ A;  1KLG D;  1ESF A;  3HP3 A;  2FMM A;  4N9T A;  1RDP D;  1IW7 D;  2VUM B;  5CV8 A;  1KNA A;  3BS1 A;  5EPJ A;  2R6G A;  2BOS A;  4A3E B;  5C3X A;  1XTC D;  1X3Q A;  1ENC A;  4Q0F A;  4DXF A;  1PTO B;  2A6H D;  2DNC A;  5EJW A;  5FLX E;  2NB0 A;  1WTP A;  3LWU A;  2LFN A;  2L5T A;  1SXT A;  3I72 A;  1X32 A;  1EEF D;  1OXX K;  3HOY B;  2AWO A;  3J7A F;  2LS0 1;  3DEO A;  2PW5 A;  1HUN A;  1V1P B;  2R3Z A;  1F2Y A;  2IL8 A;  1EL0 A;  2CW0 C;  1WTR A;  2EYP A;  3I8Z A;  2R93 B;  4CKE A;  2IT1 A;  5D14 A;  2M2L A;  2EJF C;  4ZYS A;  5CR3 A;  3RZD B;  1HTP A;  2LMC B;  2NVY B;  3H09 A;  4X3S A;  2R7Z B;  1U4M A;  1EY6 A;  4C3J G;  1SNO A;  5JEA J;  1HPC A;  1YNJ C;  1PZJ D;  3GTJ B;  2EXZ A;  4HMJ A;  1BUV T;  2NYZ D;  2WIN B;  2SDF A;  1ML0 D;  3MFY A;  1RJT A;  3F2U A;  3R3O A;  4LJZ C;  4XDX A;  2SNM A;  4HED A;  4PMB A;  4EQN A;  4BA2 I;  1ET6 A;  2LKV A;  5I9O A;  2B63 B;  5IGB A;  3ND8 A;  1JQY D;  2F0N A;  1KDA A;  4FO2 A;  3FPP A;  1Q90 A;  2TMP A;  3Q22 A;  3IFD A;  4IUN A;  2K05 A;  4G7Z C;  2PW7 A;  1I4P A;  5K5P A;  1TS5 A;  3OIP A;  5M5X B;  2VXW A;  4NDX A;  4FXK C;  4HCE A;  2F0H A;  2MJ8 A;  1LLR D;  1L0Y B;  3S17 B;  1HRJ A;  4H0L C;  1KNE A;  1AZQ A;  3HOV B;  1A15 A;  4F88 A;  4OIJ A;  1ZYR C;  3I91 A;  5FKA C;  3RZO B;  4RFB A;  5CV9 A;  1S5B D;  2F3V A;  2B2V C;  1BBX C;  3PUW A;  3S1N B;  2J7Z A;  2EVB A;  5I2X A;  2Q8I B;  1EWC A;  2Y0S B;  1JWS D;  4M8A A;  3R2T A;  4I65 A;  3MXP A;  1ZYR D;  4V0B A;  2AQ2 B;  1DZ1 A;  2Q8R E;  4ZLT F;  4AYB B;  3T56 B;  5KEE A;  4XTC S;  3ITP A;  2EY1 A;  1OXT A;  2VB2 X;  4G57 A;  1SNP A;  2GA4 B;  4RGT A;  1CHP D;  4OO1 I;  4DU9 A;  2KUM A;  3RLF A;  3DWP A;  5CV7 A;  5KGU A;  2K33 A;  3S9W A;  3H6M A;  1Y1V B;  1D2B A;  3NQI A;  3RMH A;  1SEB D;  2B2Y A;  4JBW A;  3VYR A;  3V96 A;  4RWS C;  4C1N I;  3OMG A;  1EIH A;  1UNS A;  1CQF A;  1H9M A;  1WTX A;  5IT9 E;  1PTO H;  4A3J B;  4Q5V A;  2BDO A;  4IUP A;  3S2D B;  1CZW A;  4ZRZ A;  4RH6 A;  2QDB A;  2NTT A;  1W6J A;  3S1M B;  2BCO A;  4BBR B;  3KF8 A;  1G6Z A;  2F3W A;  3IAY A;  2I46 A;  5KRU A;  1FD7 D;  1F9S A;  1CHQ D;  3M3Y B;  3D4W A;  4ODG A;  4G7H C;  3K5O A;  1PRT C;  5CGK A;  5KNC A;  2E2D C;  3KLR A;  4UDU C;  2E2I B;  1KDB A;  2JYO A;  5NUC A;  4BA1 I;  2WP8 J;  1GUT A;  4ZUJ A;  4FVM A;  1GHK A;  3H0G B;  1KTK A;  1Y8N B;  4H7B A;  2A74 C;  1STH A;  1U4P A;  3SXH A;  1QB5 D;  2HCI A;  1Q12 A;  1BO0 A;  5EPK A;  2IPK D;  4WOR A;  5I6W A;  1A2U A;  1S4Z A;  3KLS A;  2J4X A;  3QIA A;  2A68 C;  2G9D A;  4QB4 A;  3BDL A;  4KN4 C;  4ZK9 B;  3OWF A;  1IKM A;  1OXV A;  1RTN A;  4A3G B;  3DUZ A;  1A2T A;  2OXP A;  5ISR A;  4NP5 A;  1CFM A;  2FFK B;  1WCM B;  4K2K A;  4OHJ A;  1TR5 A;  1JWM D;  3GV6 A;  5KIX A;  2EDG A;  3NTK A;  4OO1 G;  5BN4 A;  2NZ1 D;  4XYO A;  2A68 D;  2SEB D;  2Q8T A;  3IKJ A;  2QEJ C;  4HAE A;  2PMZ B;  4HTH A;  2F0D A;  5FLX L;  4PV1 C;  3DHQ A;  1SDF A;  3OHX C;  5CMD A;  5COY A;  5C6A A;  4DAV A;  3FRP B;  3NBH A;  1A6X A;  2JA6 B;  5JPN C;  2BE5 C;  1GXD C;  3CRL C;  3WOF A;  3Q0A A;  2R92 B;  2Z1C A;  1EY9 A;  1STB A;  1H9S B;  3V2T A;  4XT3 B;  4KKT A;  2QCP X;  1BR9 A;  1ICW A;  5KYL A;  5EBD A;  1Q8I A;  1I6H B;  2SNS A;  3J80 L;  1G2S A;  3M4Y A;  1DOM A;  1VF5 C;  2F0P A;  3PUV A;  1RKN A;  1O7Y A;  1SND A;  3PMF A;  2YYZ A;  3I4L A;  1H9R A;  5J1Z A;  2TSS A;  3FVQ A;  1UEA B;  1TWA B;  5D65 A;  2D9U A;  3MFG A;  5ELE A;  2Z4H A;  2E76 C;  1EY8 A;  3FDT A;  1KDC A;  2H1E A;  1IYU A;  4IAL A;  5T1G A;  2DY8 A;  3MEH A;  2IX0 A;  2C5C A;  4K2L A;  1STE A;  1G2T A;  2WKC A;  4R8N A;  5M9O A;  1EOT A;  3TP7 A;  3ZYY X;  2AWN A;  2XNA C;  3TBI B;  3J81 E;  1KAB A;  1HQR D;  2QKI C;  1V8Q A;  2KVM A;  1GHJ A;  1LTR D;  4NW2 A;  3MWY W;  5C0X H;  4JK1 C;  3K58 A;  1G29 1;  3X3N A;  1DJR D;  2PZU A;  1UUP A;  5CV6 A;  1S5D D;  2IX3 A;  4K14 A;  3J7A V;  1H9K A;  1B44 D;  2K01 A;  2XWJ B;  3VA5 A;  3TME A;  1CTM A;  3CQZ B;  3HOX B;  2HDL A;  3MC0 B;  2F0G A;  5I6Y A;  4HSP A;  1NAP A;  4KY6 A;  4ILW A;  2IX1 A;  2DN8 A;  1T5X D;  2I07 B;  1JE4 A;  2SOB A;  3W3A A;  2ZXR A;  4MHE A;  1LT5 D;  1S5E D;  1VMC A;  1SYG A;  5EKK A;  1EWH A;  1HFG A;  5KND A;  3OSO A;  1IW7 C;  2EYM A;  3GTQ B;  1JR0 D;  1K8O A;  1SNC A;  4EQO A;  1PZI D;  1NR4 A;  2F0K A;  3D6C A;  3SE0 A;  3GTO B;  4G4K A;  3MAQ A;  4DXG A;  1X3P A;  3RD4 A;  4H44 C;  1TS2 A;  2K6A A;  5C3E B;  3TP6 A;  4KD3 A;  3T51 B;  3DWQ A;  3TN2 A;  4OGQ C;  2VB3 X;  1DON A;  1O7L A;  3BDO A;  3HEJ A;  3KK7 A;  4N9P A;  4C3J B;  1CQV A;  3NWS A;  2PCF B;  3H3V C;  1KLU D;  2KHS A;  1VMP A;  2ZT9 C;  3N6R A;  3M4O B;  3C3L A;  1STG A;  3ONA B;  4KKS A;  1PRT B;  1EYD A;  3A7L A;  1WTO A;  5J22 A;  5F2D A;  4A3D B;  2EY2 A;  5E3F A;  4QUF A;  4DNR B;  1DOL A;  1QIL A;  2A73 B;  3WOE A;  4IUU A;  4CGY B;  2F1M A;  4KN7 C;  2OF1 A;  1U4L A;  4K5W A;  1WTQ A;  2EY6 A;  5CYU A;  1RTO A;  4NMZ A;  2K1B A;  1ESR A;  2ZXO A;  3I3C A;  2HCC A;  3PUX A;  5I2Y A;  4CKC A;  3A8K E;  2B2T A;  3K5L A;  3CU7 A;  1WD1 A;  5ELD A;  1Y1W B;  3NP8 A;  1TII D;  3H91 A;  1B2T A;  2F0W A;  3NE5 B;  1B50 A;  1SNQ A;  2WII B;  2NVQ B;  1SJH D;  2WV6 D;  3GTL B;  3FPU B;  2O5I C;  1V1O A;  5DM6 3;  1L0X B;  1B1Z A;  2NN6 H;  1FR3 A;  2AUK A;  3S1R B;  4A3I B;  4KTA A;  1JOK A;  4O1N A;  1CK1 A;  2F0I A;  2BDN A;  4XXE A;  4TSS A;  5A2Q E;  5EGT A;  3NK9 A;  3GTM B;  1EU4 A;  4K8J A;  3Q24 A;  3T13 A;  1IL8 A;  1R4Q B;  4IUV A;  3S2H B;  4BBS B;  2EJG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...