1HHVA

Solution structure of virus chemokine vmip-ii
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
74
structure length
74
Chain Sequence
GDTLGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords VIRUS CHEMOKINE VMIP-II
publication title CCR2 and CCR5 receptor-binding properties of herpesvirus-8 vMIP-II based on sequence analysis and its solution structure
pubmed doi rcsb
total genus 6
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1998-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hhvA00
1F9RA 3N52A 1WTWA 2EPBA 1WTRA 2JP1A 1B53A 3F2UA 1LV9A 1HUMA 5EQ0A 3DEOA 4OIKA 3SVMA 5EPJA 1ESRA 2N88A 2X69A 1WD0A 1IKLA 2DY8A 1BBXC 1JICA 2KOLA 2KUMA 5T1GA 1HFNA 1PFNA 4OIJA 3LWEA 1DONA 1PFMA 5EPKA 2NZ1D 1SAPA 1CA6A 3R93A 1GUWA 1DZ1A 3KUPA 1AP0A 1U4PA 3H91A 1QG7A 1SDFA 2JYOA 2XIWA 1HRJA 1PDQA 2K28A 2J7ZA 2FHTA 1AZPA 3MTSA 4IUQA 1QE6A 1A15A 1SSOA 3HP3A 3I8ZA 4MHEA 2SDFA 1O7ZA 2Q8TA 1S4ZA 1M8AA 2D9UA 2K01A 1WD1A 1E0BA 1VMCA 2L12A 3D6WA 3IL8A 2FINB 1XYIA 1HUNA 5DNFA 3DM1A 1BF4A 2IL8A 2FJ2A 4XT1B 3G7LA 2B2TA 4NW2A 4IUPA 1Q3LA 2X6GA 4R8IA 1AZQA 3ONAB 1PFBA 1WTOA 1ZXTA 4HAEA 2NWGA 4LMQD 2L4NA 1WVLA 2MGSA 3DEPA 1RTNA 3P7JA 2DY7A 2EE1A 4R9WA 3GV6A 1RHPA 1F9QA 4MN3A 2K1BA 1DOLA 3UI2A 1EIGA 1U4LA 2VXWA 4ZKCB 1JE4A 4RAUC 1ILPA 1RTOA 2EOTA 1U4RA 5E4WC 2Q8RE 3GV3A 5CBEE 1NCVA 3FDTA 4QUFA 1X3QA 2RSNA 3MWYW 2B2YC 4CJ0B 2B2WA 2HDMA 4RA8A 1U4MA 1NR2A 2B2TC 1NR4A 4X3TA 3I3CA 1F2LA 1F9SA 1MGSA 1X32A 2N55A 3IFDA 5EJWA 1G2TA 1G6ZA 4ZK9B 4IUVA 2M2LA 2L1BA 2B2YA 2RVLA 4HCSA 3FPUB 3TN2A 2KEDA 5JJZA 2NYZD 4CJ1B 4UAIA 4ZLTF 4IUTA 1EL0A 1IKMA 1MSHA 2K03A 2HUGA 2MJ8A 3TZDA 1J8IA 4QUCA 1ML0D 1CA5A 2FMMA 1F9PA 2B2VA 4O42A 1WTVA 4ZAIA 1B50A 2KEEA 1NAPA 2B2WC 2MP1A 2HCCA 1QNKA 4RWSC 1EIHA 4XDXA 1O80A 2HDLA 2FFKB 1G91A 1J9OA 1TVXA 5D14A 3QO2A 2X6LA 5AFWA 5CMDA 4X3SA 3Q6SA 2BDNA 5COYA 4IUUA 1C8CA 5EKIA 5CORA 4DN4M 1MSGA 1B2TA 5CBAE 1G2SA 2KECA 4CJ2C 1HA6A 1RJTA 1DOKA 2B2UC 1WTPA 2MPMA 5T1IA 1KNEA 4HEDA 1EQTA 1DOMA 1O7YA 2B2VC 4ZKBB 1ILQA 2H1EA 1BNZA 1IL8A 1B3AA 1VMPA 2K04A 1X3PA 1B4OA 1MI2A 2B2UA 2K05A 1WTXA 1CM9A 3I90A 2R3ZA 2CVRA 2L11A 4X3KA 4XT3B 1BO0A 5E4XA 1WTQA 4X3UA 1KNAA 2RSOA 2KVMA 1HFGA 1XX8A 4HSVA 3I91A 1ICWA 1RODA 3KBXA 5EPLA 1HHVA 1EOTA 2RA4A 1PLFA 5D65A 4U68A 4IURA 2L9HA 2HCIA
chains in the Genus database with same CATH superfamily
3RUZA 5IYBG 4X65L 2JA6B 1HTPA 1KDAA 4DR6Q 4JPBW 1IKLA 3CCMA 3CKIB 4QIWB 3S2HH 4K6DA 3STBC 1SAPA 1STNA 1K0RA 1U4PA 1QG7A 1VQBA 3T51B 1H9MA 1J8IA 5IT9L 2K5WA 2D9UA 2LS01 3D6WA 3IL8A 1XYIA 3HOWB 2R61A 4FF2A 4P72A 5EKKA 5ELNA 4C3HG 4OWTB 1GD7A 5IYCG 3K57A 4KHPL 2IY5B 1T9HA 3H0GB 2KENA 1OXUA 3DWQA 3DEPA 1TWAH 3HKZG 5DEHA 3U9OA 1PH9A 2ES2A 1LYLA 2CFMA 1EY7A 2EOTA 1KL9A 3I4NB 1BDOA 3TP7A 3D4DA 5CBEE 2KCCA 3A8KE 5C0XI 3GTGH 3KF6A 2B2TC 4JI6L 4K5XA 4DV3Q 4A3GB 3MVVA 5LMNL 1IBKL 4YWLA 1MIUA 2KJXA 2UUAL 5FJ8G 1VQDA 2YU9B 3M3YH 3HZXA 2VZAA 3VR2A 3D3RA 3BS1A 2EYFA 1H95A 1EZ6A 1PMRA 2R93H 5HURA 5GROA 4AQYQ 1NAPA 5CC4A 4RWSC 2DJGC 4BBRH 1SNMA 2YTYA 3FPPA 3CD6A 1FGUA 2E2HB 1PFSA 2PQEA 5COYA 5A2QL 3K5NA 1TY0A 1V43A 5HY6A 3FKIG 4H0LC 2B2VC 4HCEA 5C3EH 2EVBA 1SLJA 3K7AB 1ZEQX 5C44H 3HOWG 5LMUL 4BBSG 3OW7A 2F0JA 5HGTA 3S1QB 4DNTB 3TEHB 3F2BA 3Q8DA 4GN3B 1HHVA 1JMCA 3I4LA 1SNDA 2AWNA 2RA4A 4KLKA 1D8LA 2K50A 3CP0A 4B3SQ 2JA8G 3S2DH 2PPBC 1MKHA 4RKBA 4LF8Q 4A93B 3CCRA 3A7AB 4OWWB 1TY2A 3S24A 4OIJA 4C3JG 3R93A 1NNXA 4FXKC 5IE8A 4KHZA 1SNCA 1D2BA 4G7ZC 1TWHH 1QVGA 1YNND 4XQNA 4JI0L 2LMCB 2B63B 2ZJRA 1VCIA 1VQ6A 2I5MX 4CKBA 4B3ML 1EY5A 2FJ2A 4CDDC 3DXJC 4ME5A 1Y69U 1WTOA 3L3OC 3DUZA 3FEWX 4DU9A 5M5YH 1JT8A 2AWOA 1V1PB 1FJGQ 3DWAA 1A62A 3A5ZB 1EWIA 1JE4A 2M00A 2ID0A 1LTID 3PIP3 1EU3A 3S17B 2RSNA 5M5XH 4CJ0B 1SE8A 5C0XJ 2E2DC 2PI2E 2VUMG 1OXTA 2PZTA 3NTKA 2IX0A 2K33A 1DCZA 3RLFA 2HQLA 5IP9H 4A3JH 4DR4L 4TRDA 3JAMc 3NUCA 1HCZA 4BS9A 2WKDA 4DKAC 4LJZC 4ZLTF 4O0AA 1X3GA 4A93G 2Y0SB 1F2MA 1X54A 2F1MA 3CCSA 5JPNC 3R3OA 5GAGC 3CAMA 1VQPA 2B8GA 3OMGA 3ZYYX 2MUYA 1J9OA 1TVXA 1LTAD 1KAWA 3J81j 4DV7Q 4L8JA 5EGTA 3MEFA 2A1AA 1FVIA 1CI3M 1Q8KA 1IZ6A 1OXSC 3RLNA 2R92G 1YVCA 3MFYA 1PVOA 3C2PA 2VQEQ 4R4OA 3OYYA 1QILA 1MI2A 1OTCA 3CRLC 1NE3A 1EEFD 3V96A 3I90A 2JA9A 4JI8Q 2JEAI 1FNWA 1P16A 1S5ED 4CDEC 2I5LX 2F3VA 1HNXL 3HOVH 5EBCA 2A6HD 1I6HB 3KK7A 3IFTA 2OCEA 2L9HA 4UY8C 1B1ZA 2Q2HA 5J1ZA 4DV1Q 1CKOA 4HJ7A 1ZYRD 3PUYA 1PTOB 1STGA 2EPBA 2PW7A 3DHQA 3F2UA 2BA0A 2CKZB 5IOCA 1W3SA 1ET9A 2VS1A 4OWXB 1BBXC 2ASBA 4BY7G 3H94A 1LT6D 2YTXA 1XXGA 4KMUC 3C46A 1QUQA 2NZ1D 2Z0SA 4ZUJA 4A3LH 4X66L 4JV5L 2KCNA 3GTMH 3VR6A 4OX9Q 2Y0SG 1O7IA 2EYJA 1N34L 1YHAA 1Z9FA 3HP3A 4H02A 3E6ZX 1PTOD 2DN8A 1WD1A 2L12A 5IY0A 5H1SE 4XQJA 4FO2A 3A54A 5DAUA 5G3LD 3DMUA 4HTHA 3TSSA 4MTNA 3U9SA 1XNQL 4E6IA 2HQEA 2DY7A 4QQBX 3PQIA 1Q1BA 2NB0A 2VY3A 3U50C 1K73C 3CU7A 2EZVA 1P8LA 1SBBB 1JORA 1U4RA 2RDHA 1SYEA 1KTKA 1SEBD 2PW5A 2C35B 4M1UB 4NXNQ 1FL0A 2NVTH 1G2TA 3J7AF 2E5LQ 2UUCQ 4JI1Q 2M2LA 5KYIA 3TN2A 3W3AA 1EL0A 4X62Q 3TZDA 1CTMA 1G8ZD 1XTCD 5CV7A 4JBMA 1U9RA 2E2JH 1HZCA 1X65A 3ZJYC 1EEID 2R7DA 4K0KQ 3M4OB 2EIFA 2TSSA 4YCUA 3PO2B 3HKZE 1A3UA 5D14A 4IJLA 3SEBA 2F0UA 4IUUA 4JYAL 4MNOA 3BDLA 3J81E 1IL2A 1TXYA 1G2SA 1AW7A 4CJ2C 1HA6A 3RN5A 2KCTA 1X56A 2IW3A 1K8MA 2BE5D 2NBFA 1O7YA 3EQLC 4C2MH 1IHZA 2IWHA 3ULPA 1Y1VG 1XPRA 1BQQT 4F87A 1CSPA 1YJNA 4NKLA 5CV4A 5EPLA 1H9SB 2A73B 2WFWA 2F0MA 2EDGA 4RH6A 2D62A 1WCMG 1SR3A 1HR0Q 1XMQL 1EQRA 4LF7L 3N52A 3T1YL 3FMCA 4PZ6A 4OELB 5EPJA 4RFBA 1KAAA 2DY8A 1K8OA 2KUMA 5T1GA 1TS5A 3H3VI 3A55A 2WB1G 4HJAA 3BYTB 1LTSD 5FOBB 5IYBH 2NN6I 5GADC 1VDZA 4PMBA 1O78A 1KLGD 3NXWA 5A35A 4OEMB 5J39A 2MO1A 3V2TA 3CPWA 5CV6A 1PH8A 1E0BA 4LNQA 3PO2G 1ICFB 1BCPD 4PZ8A 3LX0A 1X55A 4A3BB 2OF1A 4CGYB 1R4QB 3G7LA 2NVXB 5C6AA 2F0TA 2JA7G 2A68D 1ZXTA 3GTQB 2Q8IB 4UP8A 4GNXB 1KDCA 1Y8NB 1SXTA 1PH1A 3EN2A 2EJGC 3A0JA 3L2PA 3GV6A 3UI2A 1DOLA 1WJJA 2ICEC 1JJ2A 3NTHA 1B3QA 4MTKA 4B9XA 4AYBG 2HD3A 2MO0A 4C3HH 4H13C 4KN7C 3EA6A 1IW7D 1F2LA 1YIJA 3S9WA 4KKSA 3GO5A 2B39A 4K2LA 4DAVA 2F0DA 5KGUA 4DNRB 2KEDA 4ULLA 4R4CA 4DV2Q 3M4YA 4X65Q 4TQUS 4KN4C 2F0NA 3K7UC 4ZAIA 1YNJC 2TMPA 4FF4A 3MEHA 1H9JA 5IP7G 3T1HL 5FJ8H 1L2FA 1SE3A 4DV0L 1K3RA 4J15A 2LKVA 3MHBA 2BDNA 3GTKH 2PZUA 5C0XG 1VQ9A 5C4ZA 1SNPA 2EY2A 3A74A 5M3FB 3VYTA 4JCVE 4RCOA 1B4OA 3ULJA 1EUJA 2JA5G 2K05A 3TMEA 3L0OA 4FVMA 1JR0D 3CCVA 3BZCA 5E4XA 3FKIH 2SOBA 1SFOB 3KF8B 1LT4D 3C3LA 1WFQA 4LUVA 4JI3L 1K3BC 1GKHA 5IT9c 3HOWH 2RDFA 4A76A 4GOPB 4YWMA 4BBSH 1Q8IA 4IZ8A 3DEOA 3H0GH 2UU9L 3HOYB 4JW0A 3CHBD 4DUYQ 2F0PA 2RHQB 1ASZA 4XYQA 2KHJA 2JA8H 2JYOA 1E22A 1I6HH 1YZ6A 1S5CD 1GVPA 2VL6A 1VF5C 4LFCL 4A3GH 4GLXA 5GAHC 3VYUA 1Q1EA 1KC8C 2D2CC 2SEBD 5JJKA 1M4VA 5GAEC 4C3JH 3NP8A 1D5XC 5BN5A 1GHJA 3PIO3 1CT1D 3GP7A 4A4IA 4LF6Q 1GUGA 3QWNA 1F9QA 2PNHA 5M9OA 1ILPA 1Y14B 4F8MA 1AE3A 4ZCKA 3GV3A 4B9WA 3U4ZA 4DV4L 3TS0A 3SR1A 3RNUA 1I4HA 2B2YC 2B2WA 3BVZA 1VS0A 2ZTCA 1NR2A 3I73A 5I2YA 1F9SA 1PZJD 1KABA 1QVFA 2JEBI 1FNUA 3MFGA 3U58A 4FDBA 4QUCA 5FLMG 3BDOA 4BY1B 1F9PA 3TQYA 2VUMH 1YNXA 2QCPX 4X64L 4C3IG 3CXCA 1XNRQ 4XDXA 3Q22A 5JJLA 2WIIB 1W6KA 4PQXA 1QB5D 1L1OB 1UE7A 1DD2A 4DR3Q 4A93H 4RG1A 4HEDA 4WRDA 1I50B 2XVSA 1TIID 1OXVA 2IHEA 1U5KA 4N8FA 1H9RA 1HXYD 1SROA 2RCFA 2AQ3B 1JE5A 3X3MA 4KV6A 4C56C 5JVG3 1PRTB 4BA2I 4IFDJ 4RKLA 1A8VA 2G5DA 1Q90A 2R92H 2RBMA 2F0KA 4JI5Q 1SJHD 1KRSA 1LM0A 1VQEA 2JP1A 4IOAA 2XRSD 4OIKA 4A3DB 4XXEA 3Q24A 5AJ3Q 1I3QB 1D5ZC 3OMCA 3QB3A 3GTJB 2AQ2B 1PFNA 1AE2A 5M3MB 2M9VA 1CA6A 1TWCB 3BU2A 1GUWA 2ZJQA 3C1EA 4JBWA 2ENBA 3H91A 1NSNS 2XIWA 1EYCA 1PDQA 1XPUA 3S1MB 2E74C 1LT5D 3VR5A 2SDFA 4BY7H 1VMCA 4DR5Q 4JG2A 4DR1L 1EWHA 4LF4Q 3ERQA 1MJEA 4P71A 3DM3A 4NW2A 5IIFA 1Q3LA 4R8IA 3E9IA 5F2DA 5ISRA 2WV6D 1K8AC 2NVYB 3TREA 3RZDB 3KLSX 2K1BA 3T13A 1EIGA 3BVMA 4RAUC 1V1PA 3HOZB 5IGGA 1C4QA 4HMIA 1FYCA 3MWYW 3CCLA 2EXDA 3PO3G 1YI2A 3HS0C 3OIPA 1U4MA 4PV1C 3P20A 2F0HA 3EIVA 1IYJB 4DGZA 1IXRA 1LTTD 4DR7Q 2WAQG 2N49A 3GTPB 5DLQE 1N33Q 3FPUB 1BBWA 4UHVA 4A3FB 4A3DG 4O42A 5DM63 2B2WC 1Y1WB 4R4IA 1QJOA 1R9TB 4PZ7A 4JI4Q 5M3MG 5C4HA 1PV4A 4KI0A 1XMOL 5CORA 3HOXG 1B9MA 2EYPA 1C48A 1JJCB 1RJTA 4AYBE 2C5CA 4POGA 3H3VC 2PCFB 3NBHB 3P1HA 3K81C 4IPDA 1VQFA 1GM5A 4FXDA 1SMYC 2B8FA 4OXPA 2JA6G 1W2BA 1WTXA 1DGSA 2UXBQ 2L11A 2WACA 5C4XB 1STHA 4LFAL 2GN5A 5BR8L 3I91A 4G7OC 1EFWA 3HKSA 5EAYA 1TT2A 3HOZG 1Y1VH 4OL7A 1HR0W 1GUSA 2QKIC 1VQ7A 4HSPA 4KJOA 4DF7A 1WD0A 4YY3L 3HOUB 2KOLA 2DGYA 1V1QA 3VA7A 1WCMH 1W6JA 4CBVA 3A56A 5EPKA 5IWAQ 2V4DA 3KUPA 3H0GG 4Y7NB 2NVQB 1K8GA 1VQKA 1Q12A 1YNNC 2J7ZA 3MTSA 1R4PB 3I4NG 2FINB 3NELA 4WFN3 2EYMA 2R7ZB 2AQ1B 3CW2C 1J5EL 1VQNA 4A3GG 1QNUA 4ZUIA 3RMHA 3S16B 1RHPA 3SHLA 3PO2H 4C1NK 1UE6A 4POFA 2K4KA 3S1RH 3TP8A 2NN6G 1TWGB 1QWYA 2N3SA 1K83B 2JA7H 2JQOA 4GKKQ 1YHBA 3CMEA 1IYUA 4JI7L 4CHTB 4IUVA 3CPFA 3ICEA 4R1JA 2PO4A 1VF7A 5IGEA 2UXCL 1WOCA 1E2ZA 1Z47A 4DR2Q 4B3RL 1IBMQ 3CQZB 4ZQ3A 3S15H 3WOFA 3O13A 4RGOS 4LF5Q 3BVGA 3C1FA 4RGTA 1BBUA 2ZXRA 2XN9C 4DUZQ 3MZ5A 1I4RA 4BXXG 4NXML 2OEOA 3DWPA 1HNZL 1N36L 3J7AV 2UUBQ 5IP7H 4R4TA 2B29A 1HNWL 1L0YB 2R7ZG 1BKBA 1STYA 4YCWA 4X3KA 4JI2L 2E76C 5C0XH 3EJIA 3NQIA 4OGQC 5IT9E 3K5LA 2A6HC 1EIFA 2KBNA 1JB7A 4U68A 1H9SA 1ZYRC 2F0IA 2HHHL 2JA5H 3GTLH 1HZBA 3SXHA 4ZRZA 2UXDQ 4OO1I 1LTGD 4B3TQ 1I4PA 4Z9CB 2X69A 2B63G 1CKNB 3NEMA 3F1ZA 4EGVA 1XTDA 2KHSA 4KD4A 1SE2A 3RR5A 3S2HB 1STBA 4QL5A 4Q0FA 2YTVA 3KF6B 4HIDA 1HRJA 4DR6L 4QB4A 5J22A 1S5BD 4PNYA 1GXDC 3I56A 4H44C 1PTOC 5K5PA 1UNSA 2VW9A 1T5EA 3KDFB 4P73A 2K75A 3TDQA 2E8GA 2QF7A 1KIXA 3RLOA 5DM73 3KLRA 1AZQA 5C3WA 4A3CG 1XJVA 3SE0A 1WVLA 4IUNA 3P7JA 4KK7A 1TWAB 5CMDA 1CFMA 2IX1A 1EOVA 3H6MA 5I6WA 4JOIA 5I9PA 2H4OA 5A2QE 4H7BA 4DK6C 1PH5A 4K14A 2I5HA 1ENCA 3CCUA 3NPPA 1NR4A 5EJWA 4Q5VA 2CQAA 1TWFH 4EX5A 5LHY1 4JVZA 3K80C 3LWUA 4JI3Q 1Q7YC 2F4VQ 4CJ1B 1L0WA 2EQSA 2HUGA 2NZHA 1FNVA 3E9HA 4L5TA 4YIJA 2R93B 4DV3L 3NSWA 3TRZA 1SFOH 2O2LD 1SJED 3BDCA 4BBRB 4RGMA 3OIQA 3K5MA 3OOCA 2F0FA 2E2IH 3V05A 4I65A 3Q6SA 1GHKA 4HJ9A 4RHSA 1SYFA 5FLMH 3TZUA 4YCVA 2BE5C 4C3IH 5I6YA 2H1EA 1HA5A 1VMPA 1IBLQ 4NDXA 4CDCC 5C44B 4IOCA 5ELCA 3SK4A 1A0IA 1N32Q 3PMFA 1WTQA 5D3DA 1JQYD 2L5TA 2ICIA 1SMXA 3AU7A 3LGJA 4N9PA 2IT1A 2DJFC 2ZM6L 2EYHA 5ELFA 2A6ED 2HCIA 1YITA 1WTWA 2XGTA 3S2DB 1A6XA 1B53A 4RCNA 1B44D 1EY0A 1LV9A 4XTCS 5M5WH 1YJWA 4L5RC 4FF3A 2N88A 4GOPA 1D5MC 1C7YA 5EKLA 4K5VA 4DV6Q 4AIMA 1DONA 1OO9B 4B3SL 1QOHA 4LF8L 2QW7A 4LF9Q 4K2KA 1D1KA 5NUCA 3FHWA 3VDYA 1AZPA 1TWHB 4IUQA 1A15A 2Z6KA 4QCLA 1HUNA 4QIWE 3WWVA 1BUVT 1LTLA 3K0XA 3IRBA 3DM1A 4F7XA 4YHHQ 2GA4B 4XT1B 4AH6A 1F2YA 4J8QA 1BCPB 4IPHA 3NWSA 1CHPD 1H9KA 1I94Q 2QEJC 3S14B 2L4NA 2N8NA 1G6PA 2EE1A 5M5YB 1C8CA 3CRKC 3KLWA 4ZKCB 2ATWA 1U4LA 3ULLA 2CH4W 4IQZA 5GQOA 4U673 5M5XB 1S72A 4R8NA 5CYUA 4X3TA 4DAYB 1FJGL 3KLSA 1TR5A 4DXFA 2QGQA 3MXNA 1T5XD 1DXMA 2B2YA 4A3JB 4BWGB 2QEXA 3NE5B 2NYZD 1PYWD 4GNXC 2L0CA 1KRTA 2VQFQ 4JOIC 4HIKA 2K03A 3PO3H 2DNEA 1I4QA 1B9NA 3J80L 4GKJQ 3T4AC 4X6AH 2CHBD 2HCCA 1HZ9A 2Z4HA 2FFKB 2Q2UA 4LFBQ 2OQ0A 3S1NH 3M9BA 4EQPA 5AFWA 1JJGA 3NENA 4A3DH 2D0OA 2ZT9C 1L1OA 5CV9A 3UDGA 1QUQB 2Z9HA 3NHHA 1X3PA 3M4QA 2VNUD 5M3MH 4HN7A 4A3EB 4DV7L 1TWCH 5FKAC 1JC7A 2Q2TA 3HOXH 3H09A 1NMFA 3S1MH 2KVMA 2CCZA 1ICWA 3HOVB 1E1TA 2VQEL 1F77A 1V1OA 4DAMA 5LL6S 1VQ8A 1TU2B 2JA6H 1GUOA 1JCKB 3E0EA 1M1KC 5FLXL 4JI8L 1EQQA 4A3KB 1CQFA 4YWKA 3PUWA 4IN3A 3TBIB 2EYLA 1PH2A 1HFNA 1SRUA 3R2TA 4A3BG 1PH6A 4DV1L 3HOZH 1PZKD 4LAAA 4KHVA 4IFDI 4KHPQ 2FHTA 1E2WA 2K01A 4GOPC 3E0JA 2AKWB 1CSQA 5BN4A 3R8BA 3PF5A 3OSOA 3K6OA 1CZWA 4A3FH 1CKMA 2OTJA 4OX9L 2H5XA 3PUVA 4HAEA 1L0XB 1N9WA 4JI6Q 4BA1I 1YNJD 5LMNQ 4MN3A 1IBKQ 3UDXA 1Z7TA 2Z6KC 2VXWA 3I4NH 1RTOA 2UUAQ 5IGCA 1NCVA 2FXQA 1EFID 2K5QA 3ITPA 1G51A 3PUXA 2D5DA 2A74C 5KYLA 4EQOA 1V9PA 4EVOA 2NTSA 1STEA 3H3VH 2YU9H 2SNMA 1JOKA 3I4MB 1Q81C 4IJHA 4A3IB 2NN6H 1GO3E 4A3KG 1EYDA 1IKMA 4L63B 4GN5A 4IPCA 4ODGA 3J7ZC 5M3FG 2E5LL 2UUCL 4JI1L 4KTAA 2E2HH 5JEAJ 2BOSA 3VR3A 1RF2D 2A5HA 5LMUQ 3D6CA 4X62L 3A7LA 3OTOL 1PRTF 1JB3A 5JOBA 5JVH3 4N9TA 2B2UC 3M7NA 2Y0SE 3MC0B 4K0KL 4XYOA 3K7AH 3QG1A 4C2MB 2CH4A 2EJFC 3NBHA 1PH4A 2N78A 4DXGA 5C4JB 4QY7A 2MHVA 3S1QH 4Y7NH 4BXXH 5ELOA 3HOYG 4ALPA 1B70B 3VYRA 4NB3A 1E3PA 5D65A 1HTLD 1L1OC 5L37A 4DAPA 2CW0D 3HGBA 3NTIA 2F0QA 1E1OA 3M7GA 1JWUD 2R7ZH 1FD7D 1KHIA 3AFQA 2A19A 1I4XA 3SVMA 2BCOA 4JI0Q 1EY4A 3RZOB 3NK9A 1S5DD 2XSCA 1HR0L 1EY8A 3K0YA 1PRTC 4A3IG 4B3MQ 1K9MC 3AQQA 1RL2A 1AP0A 2F0OA 2K28A 1C0AA 1MHWC 2ZTEA 2B63H 4B3RQ 2P5ZX 1E2VA 3W1BA 1UEBA 1S4ZA 4FXGC 3CMAA 1EIYB 1EQVA 4OO1G 4IUPA 3KOJA 4IFDH 5IODA 5K36G 3G4SA 1HNZQ 1N36Q 4UPAA 3E5SA 2EJMA 4DR4Q 3AMUA 3S17H 4PG3A 4WJ4A 3N6RA 1PA6A 2Q2IA 2F03A 4BY1G 4GLAC 3K5OA 3PSIA 1K0SA 4C3HB 2PNRC 1GOZA 4A3CH 3MXUA 2EY1A 3I4OA 1VQIA 4ZK9B 1E24A 3D4WA 5IGFA 3HKZB 2L1BA 1HH2P 2WP8J 5JJZA 1HQRD 2G9DA 1VQ4A 2NZOA 2JE6I 2MP1A 1Q46A 1QNKA 1D1IA 4NMZA 5FO8B 4MIUA 3UE1A 1A3VA 3CCJA 3QO2A 3EROA 3PGZA 2WB1E 4K6LA 4DV2L 4L6TB 2Z8LA 3GTKB 4GLVB 1EYGA 5T1IA 1S3OA 1KNEA 1PYBA 1EQTA 1PXUA 3ERSX 2A69D 1HNXQ 3T53B 3JAMi 4DK3C 1KQSA 4PMCA 2K04A 5FO9B 4HIMA 4I7ZC 4FNFA 2K5NA 3ND9A 1NTGA 1SYCA 3J80i 1XX8A 3FKIB 3E3XA 1LTRD 1TKWB 2O4XA 2XRQD 1SNQA 1A2UA 1PTOH 1EYAA 1XPOA 2C9OA 4X66Q 4JV5Q 1UAPA 2K14A 4BBSB 1QVCA 4K8IA 1N34Q 4OHJA 1JICA 2IHFA 1CKNA 3MAQA 3STBD 2AUJD 2XWJB 2J0TD 3U4VA 3QIAA 1ENAA 1DZ1A 2JA8B 1SDFA 4ID6A 5LL6X 3BG3A 4IALA 4NP5A 3K58A 1VQJA 1S40A 2Q8TA 3I8ZA 2R6GA 4DUYL 1XNQQ 1M8AA 1WI5A 3PIPA 3JC66 3A5UA 2BDOA 5D3IB 3A8IE 1D6EC 3KDFA 3X3NA 3SK8A 4C3JB 2Z1CA 3EVQA 4K5WA 4P2CB 1UUPA 5C5MA 4GZYC 1RTNA 1CUKA 4V0BA 4O1NA 2BA1A 5E3FA 3AFPA 5I9OA 2F0WA 2Q8RE 4A3FG 1F2ZA 1GUNA 5FK9C 2I46A 4EQNA 2PQAB 1Y1WG 2HDMA 3QOLA 4RA8A 4LF6L 1X32A 2IPKD 2MNAA 3TS2A 1LACA 2JXMB 2K5DA 3HEJA 1SMYD 2ZM6Q 2RDGA 3TP6A 2NUCA 4S3SA 3QOJA 4JYAQ 1MSHA 5FO7B 2MJ8A 4KJNA 4QMGA 4QF4A 1VQOA 2BH2A 2EXZA 1ASYA 3MXGA 2KEEA 3M4OH 1LLRD 2VUMB 4HMJA 2KHIA 5IGDA 1O80A 4R4QA 4WORA 1X3EA 5C4XG 4DN4M 1MJCA 5KIXA 5CBAE 3BYYB 1DJRD 2MPMA 1XNRL 3GTOB 4FYDA 3UE0A 4A3MB 1PHJA 3KBGA 1J6QA 1XMQQ 4LF7Q 1X6OA 3T1YQ 4DR3L 2CQOA 3HOUG 5JPMC 4XT3B 4G7HC 3J7A5 4NPSA 4A75A 4TSSA 1WTHA 3I2ZA 1SE4A 1MBYA 3KBXA 5JEAG 1TS4A 2R92B 2JN4A 1A63A 2AUKA 1RIPA 4DV5L 1SNOA 1HQMC 1RDPD 1WTRA 2Z6BA 3J81L 1NMGA 3S14H 1RKNA 3NWTA 2HIVA 2K52A 2K5VA 1PTOF 1FGBD 4JI5L 4RGNA 3UDIA 5CR3A 5G3LF 3SDZA 3VYSA 4IPGA 2MQHA 1CK1A 5AJ3L 4B08A 1JWMD 4BY7B 2E75C 3D31A 4A3BH 1SN8A 4PMWA 2NVXH 4LUZA 4UP9A 3GTQH 4KY5A 1CQVA 2YYZA 2NWGA 4LMQD 2O5IC 2MGSA 4LK1C 4DR5L 4A3MG 3J80c 4LF4L 3FVQA 1PYSB 3EBEA 4FP5D 2KQ3A 5E4WC 3MXPA 4LUOA 5LMNW 3H15A 3K59A 3DLLA 3W5OA 3FDTA 1II3A 1NJIC 4QJFA 2D0PA 4IFDG 3G48A 5JJIA 2N55A 1Z6HA 4DAYA 5IYDG 3T1HQ 4HCSA 4G57A 4DV0Q 4A3EH 1AEXA 3F2CA 1M90C 4IUTA 1EZ8A 1MD2D 2K5HA 1AN8A 2PYKA 5E7NA 1WTVA 1V8QA 3B6YA 2RQXA 4DR7L 1NY4A 4RHRA 2HDLA 4GNXA 2OTLA 3OHXC 3NQTA 1YBYA 1N33L 5KRUA 4HJ5A 1N8RC 2QA4A 1B7YB 3TP5A 1SYBA 2EY5A 1EWCA 1MSGA 2F3WA 4A3KH 2KECA 3SGIA 1WTPA 3GTGB 2K6AA 3BZDB 5FLXc 5M3FH 4M8AA 4ZKBB 1ILQA 1NBWA 2DUDA 1DYQA 4JI4L 3M3YB 2FMCA 3SK5A 3L9AX 3L7ZC 4L5QA 4XQQA 2YV5A 4DA2A 1HFGA 4HSVA 1RODA 2UU9Q 1KDBA 1YHQA 2QDLA 1EOTA 1PLFA 5C3XA 3KYHC 3OPOA 2A6EC 5I2XA 3RD4A 3QJYA 1F9RA 5IGBA 3OWEB 2UXBL 2AMCB 2ZXPA 4AQYL 1Y1VB 1SYDA 1HUMA 5EQ0A 1ESRA 3HOYH 2RHSB 1HZAA 4LFCQ 5C3EB 5CV5A 2AHOB 2WAQE 2EY6A 1JOOA 3LWEA 3NBIA 2JJQA 1PFMA 1BCPF 5KNCA 3D8GA 1WCMB 3W1GA 3HG9A 1EY6A 2GVBA 1VQ5A 1G6ZA 3ER0A 2HT1A 1LT3D 2KCMA 3KF8A 3M4PA 5IWAL 3I4MH 1D7QA 4A3IH 2WB1B 3KFUA 4DV4Q 4OONA 2X6GA 1PFBA 2NTTA 2PMZE 3OTOQ 1LTBD 1YJ9A 1VQLA 2PI2A 4G4KA 1FR3A 2CWAA 1G291 2I07B 3HFZB 1GJXA 3GD7A 1UE1A 4I7AA 4QUFA 1STAA 2RKSA 5KEEA 3S1RB 1X3QA 4OO1H 4ILWA 5KNBA 5J3BA 1TS2A 2R93G 1HJPA 2IX3A 3RN2A 2JA7B 3I3CA 4X64Q 3IFDA 4BBRG 5K36H 2OQKA 1BCPC 2L55A 3GDEA 2F4IA 2ZJPA 2QILA 4UAIA 2A68C 5C4JH 4Y52H 4BY1H 4AYBB 1AFPA 1VQGA 2LY7A 4GKKL 2FMMA 4V190 1B50A 3VR4A 2F3IA 3I70A 2F0LA 1BXTA 1EIHA 5C3EG 1QZGA 1CZGA 3WDNA 1IYVA 3S15B 2JK8A 3LNNA 3UDFA 4L5SA 4HJ8A 5E1FA 5C44G 2JSOA 3I7FA 5CV8A 2V1CC 5ELDA 4X3SA 5CGKA 2L15A 4DR2L 1B2TA 1IBML 2HIXA 1TS3A 1IW7C 3T16A 2LXKA 1DOKA 4K8JA 5C5LA 1I50H 3JAML 4N8X1 3Q23A 2OXPA 2A8VA 3RZOH 1UE5A 4LF5L 3WOEA 1IL8A 1B3AA 1VQHA 4DUZL 2WKCA 1Y8PB 2B2UA 4KD3A 4JC0A 4HIOA 3Q0AA 1BO0A 4TVAB 1ENFA 2UUBL 3D0FA 1ET6A 4IURA 3F8TA 1VQCA 1UWVA 4KKUA 1K28A 1QCBD 2JA5B 4DK1A 3GTLB 1GUTA 2F0GA 5TSSA 4ME3A 2IJ0A 1I3QH 3FP9A 3GTJH 4MZ9A 2I0QA 4KY6A 1CHQD 4C1NI 1B8AA 4DR1Q 4UDUC 3R2IA 4KY7A 1X9NA 2UXDL 3PIOA 5EBDA 1I6VC 4B3TL 1ESFA 4JK1C 1ONLA 5IYCH 4MHEA 3G6EA 1E7ZA 4IO9A 2LSSA 3EFXD 3KJPA 2K7VA 1RCVD 2OWOA 3MA2B 2RCNA 2WINB 3J81i 3D4RA 1VQMA 3OW2A 2F0SA 2NVYH 3RZDH 5IP9G 4P75A 5ELEA 1DM0B 2Z4IA 4A3JG 1OXXK 4GS3A 3QR8A 3GTMB 2F52A 2OT2A 4GN4B 2VB2X 3AEVA 3GTPH 1LABA 1Q82C 3OWFA 3CCEA 3G6JB 1TWFB 2RVLA 2ZTDA 2KA7A 1Y8OB 1XMOQ 4J6HA 1EU4A 4EQ5A 1Y1WH 1I4GA 4WJWA 4WJ3M 1NUCA 1R9TH 3AB9A 3M85A 4A3EG 4P74A 4LWCA 3SK6A 1G91A 3PF4A 2MFIA 2F4VL 1SYGA 2X6LA 2E2IB 2QDBA 3AYHB 4CKEA 2RF4A 5BN3A 2B3GA 4LFAQ 2NVTB 3HOVG 1DOMA 5I4DA 1VQAA 5BR8Q 1RD9D 4C3IB 5HGQA 3KJOA 1BNZA 4HR7B 3I55A 2XTIA 1CM9A 1U0LA 4JBKA 5C4XH 4NXNL 3W2DA 2CVRA 3VA5A 2F0EA 3CCQA 2ZXOA 1C9OA 2RSOA 2E2JB 4YY3Q 2J4XA 2CWPA 4QGUA 2XNAC 3URYA 4KKTA 1IBLL 3IKJA 4DNIA 2CW0C 5KNDA 4A3LG 2BH8A 1N32L 1JWSD 1TQOA 2GVAA 3HOUH 5M5WB 5JEAH 1EY9A 2DNCA 2O5JC 1YEZA 3FRPB 2NVQH 4RMFA 1BR9A 1J5EQ 4UP7A 1QE6A 3MXNB 1SSOA 3JAME 1O7ZA 1BVSA 3CC7A 1LO5D 1PZID 3BJUA 4DV6L 2LXJA 1PH7A 5JAVA 5DNFA 1BF4A 2F0VA 2IL8A 3PV0A 1O7LA 4LF9L 2PZWA 2B2TA 3F2DA 3J80E 3P75A 3ONAB 3S16H 1WYDA 2VB3X 4JI7Q 4R9WA 1X3FA 3I4MG 4XIGS 2SNSA 3ND8A 1TWGH 4YHHL 1LUZA 1A2TA 1K83H 4CDFC 2UXCQ 4ABNA 1S5FD 1I94L 4DFAA 4DK0A 1MGSA 2XWBB 3GTOH 4JBJA 4J1MA 3BZKA 3HRZC 4CKCA 3PCOB 2PQAA 1Q86C 4A3MH 3CF5A 1PH3A 1KLUD 2G9HD 1AH9A 3CQZH 3PUZA 2R7FA 4DV5Q 1ML0D 1CA5A 4ZYSA 3PO3B 2B2VA 1ZKOA 4NXMQ 4FF1A 1BOSA 2WAQB 4O2DA 5IYDH 1KD1C 3S1NB 3A8JE 1KXLA 4TKOB 5FLXE 2VQFL 1HNWQ 5EKIA 5ELBA 4DPGA 1I5FA 1JOQA 4JI2Q 2ALYB 4GKJL 3T56B 2LFNA 1XWEA 2A69C 4LFBL 3J81c 1QZHA 3CC4A 4LW1A 3J7YW 3CC2A 2EYOA 1PRTD 2HHHQ 4F88A 1HPCA 2R3ZA 3GQBA 3I72A 4APVA 4X3UA 3HOXB 2PMZB 1KNAA 1A3TA 2K32A 3IAYA 3G71A 3K8AA 1UEAB
chains in the Genus database with same CATH topology
3RUZA 2JA6B 1HTPA 1KDAA 1IKLA 3CKIB 4QIWB 4K6DA 1SAPA 1STNA 1U4PA 1QG7A 3T51B 1H9MA 1J8IA 5IT9L 2K5WA 2D9UA 2LS01 3D6WA 3IL8A 1XYIA 3HOWB 2R61A 4FF2A 5EKKA 4C3HG 3K57A 3H0GB 1OXUA 3DWQA 3DEPA 3U9OA 5DEHA 1EY7A 2EOTA 3I4NB 1BDOA 3TP7A 3D4DA 5CBEE 2KCCA 3A8KE 5C0XI 2B2TC 4K5XA 4A3GB 3MVVA 2KJXA 2YU9B 3HZXA 3VR2A 3D3RA 3BS1A 2EYFA 1EZ6A 1PMRA 5HURA 1NAPA 5CC4A 4RWSC 1SNMA 3FPPA 2E2HB 2PQEA 5COYA 5A2QL 3K5NA 1TY0A 1V43A 4H0LC 2B2VC 4HCEA 2EVBA 3K7AB 1ZEQX 3OW7A 2F0JA 5HGTA 3S1QB 4DNTB 1HHVA 3I4LA 1SNDA 2AWNA 2RA4A 2PPBC 4RKBA 4A93B 3A7AB 1TY2A 4OIJA 4C3JG 3R93A 4FXKC 4KHZA 1SNCA 1D2BA 4G7ZC 1YNND 4XQNA 2LMCB 2B63B 1VCIA 4CKBA 1EY5A 2FJ2A 3DXJC 4ME5A 1Y69U 1WTOA 3L3OC 3DUZA 3FEWX 4DU9A 2AWOA 1V1PB 3DWAA 1JE4A 2M00A 2ID0A 1LTID 3PIP3 1EU3A 3S17B 2RSNA 4CJ0B 5C0XJ 2E2DC 1OXTA 2PZTA 3NTKA 2IX0A 2K33A 1DCZA 3RLFA 4TRDA 3NUCA 1HCZA 4BS9A 2WKDA 4LJZC 4ZLTF 2Y0SB 1F2MA 2F1MA 5JPNC 3R3OA 2B8GA 3OMGA 3ZYYX 2MUYA 1J9OA 1TVXA 1LTAD 4L8JA 5EGTA 1CI3M 1OXSC 3MFYA 3C2PA 1QILA 1MI2A 3CRLC 1EEFD 3V96A 3I90A 2JEAI 1FNWA 1S5ED 2F3VA 5EBCA 2A6HD 3KK7A 3IFTA 2L9HA 1B1ZA 5J1ZA 1ZYRD 3PUYA 1PTOB 1STGA 2EPBA 2PW7A 3DHQA 3F2UA 2BA0A 5IOCA 1ET9A 1BBXC 3H94A 1LT6D 3C46A 1XXGA 4KMUC 2NZ1D 4ZUJA 2KCNA 3VR6A 2EYJA 3HP3A 3E6ZX 1PTOD 2DN8A 1WD1A 2L12A 4XQJA 4FO2A 3A54A 5DAUA 5G3LD 3DMUA 4HTHA 3TSSA 3U9SA 4E6IA 2HQEA 2DY7A 1Q1BA 2NB0A 1JORA 3CU7A 2EZVA 1SBBB 1U4RA 2RDHA 1SYEA 1KTKA 1SEBD 2PW5A 4M1UB 1G2TA 3J7AF 2M2LA 5KYIA 3TN2A 3W3AA 1EL0A 3TZDA 1CTMA 1G8ZD 1XTCD 5CV7A 1U9RA 1EEID 3M4OB 2TSSA 3PO2B 1A3UA 5D14A 3SEBA 2F0UA 4IUUA 3BDLA 3J81E 1G2SA 1AW7A 4CJ2C 1HA6A 2IW3A 1K8MA 2BE5D 2NBFA 1O7YA 3EQLC 1IHZA 2IWHA 1BQQT 4F87A 4NKLA 5CV4A 5EPLA 1H9SB 2A73B 2F0MA 2EDGA 4RH6A 2D62A 3N52A 3FMCA 5EPJA 4RFBA 1KAAA 2DY8A 1K8OA 2KUMA 5T1GA 1TS5A 3A55A 3BYTB 1LTSD 5FOBB 2NN6I 1VDZA 4PMBA 1O78A 1KLGD 3NXWA 5A35A 5J39A 3V2TA 5CV6A 1E0BA 1BCPD 3LX0A 4A3BB 2OF1A 4CGYB 1R4QB 3G7LA 2NVXB 5C6AA 2F0TA 2A68D 1ZXTA 3GTQB 2Q8IB 1KDCA 1Y8NB 1SXTA 2EJGC 3GV6A 3UI2A 1DOLA 2ICEC 3NTHA 4B9XA 4H13C 4KN7C 3EA6A 1IW7D 1F2LA 3S9WA 4KKSA 3GO5A 2B39A 4K2LA 4DAVA 2F0DA 5KGUA 4DNRB 2KEDA 4ULLA 3M4YA 4TQUS 4KN4C 2F0NA 4ZAIA 1YNJC 2TMPA 4FF4A 3MEHA 1H9JA 1SE3A 2LKVA 3MHBA 2BDNA 2PZUA 5C0XG 5C4ZA 1SNPA 2EY2A 5M3FB 3VYTA 4RCOA 1B4OA 2K05A 3TMEA 4FVMA 1JR0D 5E4XA 2SOBA 1SFOB 1LT4D 3C3LA 2RDFA 1Q8IA 4IZ8A 3DEOA 3HOYB 3CHBD 2F0PA 4XYQA 2JYOA 1S5CD 1VF5C 3VYUA 1Q1EA 2D2CC 2SEBD 1M4VA 3NP8A 1D5XC 5BN5A 1GHJA 3PIO3 1CT1D 3GP7A 1GUGA 3QWNA 1F9QA 5M9OA 1ILPA 4F8MA 3GV3A 4B9WA 3SR1A 1I4HA 2B2YC 2B2WA 3BVZA 1NR2A 3I73A 5I2YA 1F9SA 1PZJD 1KABA 2JEBI 1FNUA 3MFGA 4QUCA 3BDOA 4BY1B 1F9PA 2QCPX 4C3IG 4XDXA 3Q22A 2WIIB 1W6KA 4PQXA 1QB5D 1DD2A 4HEDA 4WRDA 1I50B 2XVSA 1TIID 1OXVA 1H9RA 1HXYD 2AQ3B 3X3MA 4KV6A 4C56C 5JVG3 1PRTB 4BA2I 4IFDJ 4RKLA 1Q90A 2RBMA 2F0KA 1SJHD 2JP1A 2XRSD 4OIKA 4A3DB 4XXEA 3Q24A 1I3QB 1D5ZC 3OMCA 3QB3A 3GTJB 2AQ2B 1PFNA 5M3MB 2M9VA 1CA6A 1TWCB 1GUWA 3C1EA 4JBWA 2ENBA 3H91A 1NSNS 2XIWA 1EYCA 1PDQA 3S1MB 2E74C 1LT5D 3VR5A 2SDFA 1VMCA 1EWHA 3ERQA 4NW2A 5IIFA 1Q3LA 4R8IA 5F2DA 5ISRA 2WV6D 2NVYB 3RZDB 3KLSX 2K1BA 3T13A 1EIGA 3BVMA 4RAUC 1V1PA 3HOZB 5IGGA 1C4QA 4HMIA 1FYCA 3MWYW 3HS0C 3OIPA 1U4MA 4PV1C 3P20A 2F0HA 4DGZA 1LTTD 3GTPB 3FPUB 4A3FB 4O42A 5DM63 2B2WC 1Y1WB 1QJOA 1R9TB 5C4HA 4KI0A 5CORA 1B9MA 2EYPA 1C48A 1RJTA 3H3VC 2C5CA 2PCFB 3P1HA 4FXDA 1SMYC 2B8FA 1WTXA 2L11A 2WACA 5C4XB 1STHA 3I91A 4G7OC 1TT2A 4OL7A 1GUSA 2QKIC 4HSPA 4KJOA 4DF7A 1WD0A 3HOUB 2KOLA 3VA7A 1W6JA 4CBVA 3A56A 5EPKA 2V4DA 3KUPA 4Y7NB 2NVQB 1Q12A 1YNNC 2J7ZA 3MTSA 1R4PB 2FINB 4WFN3 2EYMA 2R7ZB 2AQ1B 1QNUA 4ZUIA 3RMHA 3S16B 1RHPA 3SHLA 4C1NK 3TP8A 2NN6G 1TWGB 1QWYA 1K83B 1IYUA 4CHTB 4IUVA 2PO4A 1VF7A 5IGEA 1E2ZA 1Z47A 3CQZB 4ZQ3A 3WOFA 3O13A 4RGOS 3BVGA 3C1FA 4RGTA 2ZXRA 2XN9C 3MZ5A 1I4RA 2OEOA 3DWPA 3J7AV 1L0YB 1STYA 4X3KA 2E76C 5C0XH 3EJIA 3NQIA 4OGQC 5IT9E 3K5LA 2A6HC 4U68A 1H9SA 1ZYRC 2F0IA 3SXHA 4ZRZA 4OO1I 1LTGD 1I4PA 4Z9CB 2X69A 4EGVA 2KHSA 4KD4A 1SE2A 3S2HB 1STBA 4Q0FA 1HRJA 4QB4A 5J22A 1S5BD 4PNYA 1GXDC 4H44C 1PTOC 5K5PA 1UNSA 1T5EA 3TDQA 2QF7A 5DM73 3KLRA 1AZQA 5C3WA 3SE0A 1WVLA 4IUNA 3P7JA 4KK7A 1TWAB 5CMDA 1CFMA 2IX1A 3H6MA 5I6WA 5I9PA 2H4OA 5A2QE 4H7BA 4K14A 1ENCA 3NPPA 1NR4A 5EJWA 4Q5VA 2CQAA 5LHY1 3LWUA 4CJ1B 2HUGA 1FNVA 4YIJA 2R93B 3NSWA 2O2LD 1SJED 3BDCA 4BBRB 4RGMA 3OIQA 3K5MA 3OOCA 2F0FA 3V05A 4I65A 3Q6SA 1GHKA 4RHSA 1SYFA 3TZUA 2BE5C 5I6YA 2H1EA 1HA5A 1VMPA 4NDXA 5C44B 5ELCA 3SK4A 3PMFA 1WTQA 5D3DA 1JQYD 2L5TA 2ICIA 3AU7A 4N9PA 2IT1A 2EYHA 5ELFA 2A6ED 2HCIA 1WTWA 3S2DB 1A6XA 1B53A 4RCNA 1B44D 1EY0A 1LV9A 4XTCS 4FF3A 2N88A 1D5MC 5EKLA 4K5VA 1DONA 1OO9B 1QOHA 4K2KA 1D1KA 5NUCA 1AZPA 1TWHB 4IUQA 1A15A 4QCLA 1HUNA 1BUVT 3DM1A 4F7XA 2GA4B 4XT1B 1F2YA 4J8QA 1BCPB 3NWSA 1CHPD 1H9KA 2QEJC 3S14B 2L4NA 2EE1A 5M5YB 1C8CA 3CRKC 4ZKCB 1U4LA 4IQZA 4U673 5M5XB 4R8NA 5CYUA 4X3TA 3KLSA 1TR5A 4DXFA 3MXNA 1T5XD 1DXMA 2B2YA 4A3JB 4BWGB 3NE5B 2NYZD 1PYWD 2L0CA 2K03A 2DNEA 1I4QA 1B9NA 3J80L 3T4AC 2CHBD 2HCCA 2Z4HA 2FFKB 4EQPA 5AFWA 2ZT9C 5CV9A 3NHHA 1X3PA 2VNUD 4HN7A 4A3EB 5FKAC 1JC7A 3H09A 2KVMA 1ICWA 3HOVB 1F77A 1V1OA 5LL6S 1TU2B 1GUOA 1JCKB 5FLXL 4A3KB 1CQFA 3PUWA 4IN3A 3TBIB 2EYLA 1HFNA 3R2TA 1PZKD 4LAAA 4KHVA 4IFDI 2FHTA 1E2WA 2K01A 3E0JA 5BN4A 3R8BA 3OSOA 3K6OA 1CZWA 3PUVA 4HAEA 1L0XB 4BA1I 1YNJD 4MN3A 1Z7TA 2VXWA 1RTOA 5IGCA 1NCVA 1EFID 2K5QA 3ITPA 3PUXA 2D5DA 2A74C 5KYLA 4EQOA 4EVOA 2NTSA 1STEA 2SNMA 1JOKA 3I4MB 4A3IB 2NN6H 1EYDA 1IKMA 4L63B 4ODGA 4KTAA 5JEAJ 2BOSA 3VR3A 1RF2D 2A5HA 3D6CA 3A7LA 1PRTF 1JB3A 5JOBA 5JVH3 4N9TA 2B2UC 3M7NA 3MC0B 4XYOA 3QG1A 4C2MB 2EJFC 3NBHA 4DXGA 5C4JB 2MHVA 3VYRA 5D65A 1HTLD 4DAPA 2CW0D 3HGBA 3NTIA 2F0QA 3M7GA 1JWUD 1FD7D 1I4XA 3SVMA 2BCOA 1EY4A 3RZOB 3NK9A 1S5DD 2XSCA 1EY8A 3K0YA 1PRTC 1AP0A 2F0OA 2K28A 1E2VA 1S4ZA 4FXGC 1EQVA 4OO1G 4IUPA 4IFDH 5IODA 5K36G 3E5SA 2EJMA 3AMUA 3N6RA 2F03A 3K5OA 4C3HB 2PNRC 1GOZA 3MXUA 2EY1A 4ZK9B 3D4WA 5IGFA 3HKZB 2L1BA 2WP8J 5JJZA 1HQRD 2G9DA 2JE6I 2MP1A 1QNKA 4NMZA 1D1IA 5FO8B 4MIUA 1A3VA 3QO2A 3EROA 4K6LA 4L6TB 2Z8LA 3GTKB 5T1IA 1KNEA 1EQTA 1PXUA 2A69D 3T53B 4PMCA 2K04A 5FO9B 4I7ZC 4FNFA 3ND9A 1SYCA 1XX8A 3FKIB 1LTRD 1TKWB 2O4XA 2XRQD 1SNQA 1A2UA 1PTOH 1EYAA 2C9OA 1UAPA 4BBSB 4K8IA 4OHJA 1JICA 3MAQA 2AUJD 2XWJB 2J0TD 3QIAA 1ENAA 1DZ1A 2JA8B 1SDFA 4ID6A 5LL6X 3BG3A 4IALA 4NP5A 3K58A 1I6HB 2Q8TA 3I8ZA 2R6GA 1M8AA 2BDOA 5D3IB 3A8IE 1D6EC 3X3NA 3SK8A 4C3JB 2Z1CA 3EVQA 4K5WA 4P2CB 1UUPA 5C5MA 4GZYC 1RTNA 4V0BA 4O1NA 2BA1A 5E3FA 5I9OA 2F0WA 2Q8RE 1F2ZA 1GUNA 5FK9C 2I46A 4EQNA 2HDMA 3QOLA 4RA8A 1X32A 2IPKD 1LACA 2JXMB 2K5DA 3HEJA 1SMYD 2RDGA 3TP6A 2NUCA 4S3SA 3QOJA 1MSHA 5FO7B 2MJ8A 4KJNA 4QMGA 4QF4A 2EXZA 3MXGA 2KEEA 1LLRD 2VUMB 4HMJA 5IGDA 1O80A 4WORA 4DN4M 5KIXA 5CBAE 3BYYB 1DJRD 2MPMA 3GTOB 4FYDA 4A3MB 3KBGA 5JPMC 4XT3B 4G7HC 4TSSA 1SE4A 1MBYA 3KBXA 5JEAG 1TS4A 2R92B 2AUKA 1SNOA 1HQMC 1RDPD 1WTRA 3J81L 1RKNA 3NWTA 1PTOF 1FGBD 4RGNA 5CR3A 5G3LF 3SDZA 3VYSA 1CK1A 4B08A 1JWMD 4BY7B 2E75C 3D31A 4PMWA 4KY5A 1CQVA 2YYZA 2NWGA 4LMQD 2O5IC 2MGSA 4LK1C 3FVQA 4FP5D 2KQ3A 5E4WC 3MXPA 3K59A 3FDTA 1II3A 4IFDG 2N55A 1Z6HA 4DAYA 4HCSA 4G57A 1AEXA 4IUTA 1EZ8A 1MD2D 1AN8A 2PYKA 1WTVA 1V8QA 2RQXA 4RHRA 2HDLA 3OHXC 3NQTA 5KRUA 3TP5A 1SYBA 2EY5A 1EWCA 1MSGA 2F3WA 2KECA 1WTPA 3GTGB 2K6AA 3BZDB 4M8AA 4ZKBB 1ILQA 1DYQA 3M3YB 2FMCA 3SK5A 3L9AX 3L7ZC 4XQQA 4DA2A 1HFGA 4HSVA 1RODA 1KDBA 1EOTA 1PLFA 5C3XA 3OPOA 2A6EC 5I2XA 3RD4A 3QJYA 1F9RA 5IGBA 3OWEB 2ZXPA 1Y1VB 1SYDA 1HUMA 5EQ0A 1ESRA 5C3EB 5CV5A 2EY6A 1JOOA 3LWEA 3NBIA 1PFMA 1BCPF 5KNCA 3D8GA 1WCMB 3HG9A 1EY6A 1G6ZA 1LT3D 3KF8A 2WB1B 2X6GA 1PFBA 2NTTA 1LTBD 4G4KA 1FR3A 1G291 2I07B 1GJXA 3GD7A 4QUFA 1STAA 2RKSA 5KEEA 3S1RB 1X3QA 4OO1H 4ILWA 5KNBA 1TS2A 2IX3A 2JA7B 3I3CA 3IFDA 5K36H 1BCPC 2L55A 2F4IA 2QILA 4UAIA 2A68C 4AYBB 1AFPA 2LY7A 2FMMA 4V190 1B50A 3VR4A 3I70A 2F0LA 1BXTA 1EIHA 1CZGA 3WDNA 1IYVA 3S15B 3LNNA 5E1FA 2JSOA 5CV8A 5ELDA 4X3SA 5CGKA 1B2TA 1TS3A 1IW7C 3T16A 4K8JA 1DOKA 5C5LA 3JAML 3Q23A 2OXPA 3WOEA 1IL8A 1B3AA 2WKCA 1Y8PB 2B2UA 4KD3A 3Q0AA 1BO0A 1ENFA 1ET6A 4IURA 4KKUA 1QCBD 2JA5B 4DK1A 3GTLB 1GUTA 2F0GA 5TSSA 2IJ0A 4KY6A 1CHQD 4C1NI 4UDUC 3R2IA 4KY7A 5EBDA 1I6VC 1ESFA 4JK1C 1ONLA 4MHEA 3EFXD 2K7VA 1RCVD 3MA2B 2WINB 3D4RA 2F0SA 5ELEA 1DM0B 2Z4IA 1OXXK 3GTMB 2OT2A 2VB2X 1LABA 3OWFA 3G6JB 1TWFB 2RVLA 2KA7A 1Y8OB 4J6HA 1EU4A 1I4GA 4WJWA 1NUCA 3AB9A 3M85A 1G91A 3SK6A 1SYGA 2X6LA 2E2IB 2QDBA 4CKEA 5BN3A 2NVTB 1DOMA 5I4DA 1RD9D 4C3IB 1BNZA 4HR7B 1CM9A 3W2DA 2CVRA 3VA5A 2F0EA 2ZXOA 2E2JB 2RSOA 2J4XA 2XNAC 3URYA 4KKTA 3IKJA 2CW0C 5KNDA 1JWSD 1TQOA 5M5WB 5JEAH 1EY9A 2DNCA 2O5JC 3FRPB 1BR9A 1QE6A 1SSOA 3JAME 1O7ZA 1LO5D 1PZID 5JAVA 5DNFA 1BF4A 2F0VA 2IL8A 3PV0A 1O7LA 2PZWA 2B2TA 3J80E 3P75A 3ONAB 2VB3X 4R9WA 4XIGS 2SNSA 3ND8A 1A2TA 4ABNA 1S5FD 4DFAA 4DK0A 1MGSA 2XWBB 4J1MA 3HRZC 4CKCA 1KLUD 2G9HD 3PUZA 1ML0D 1CA5A 4ZYSA 3PO3B 2B2VA 1ZKOA 4FF1A 1BOSA 2WAQB 3S1NB 3A8JE 4TKOB 5FLXE 5EKIA 5ELBA 1JOQA 3T56B 2LFNA 1XWEA 2A69C 3J7YW 2EYOA 1PRTD 4F88A 1HPCA 2R3ZA 3GQBA 3I72A 4X3UA 3HOXB 1KNAA 2PMZB 1A3TA 2K32A 3IAYA 1UEAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9R A;  3N52 A;  1WTW A;  2EPB A;  1WTR A;  2JP1 A;  1B53 A;  3F2U A;  1LV9 A;  1HUM A;  5EQ0 A;  3DEO A;  4OIK A;  3SVM A;  5EPJ A;  1ESR A;  2N88 A;  2X69 A;  1WD0 A;  1IKL A;  2DY8 A;  1BBX C;  1JIC A;  2KOL A;  2KUM A;  5T1G A;  1HFN A;  1PFN A;  4OIJ A;  3LWE A;  1DON A;  1PFM A;  5EPK A;  2NZ1 D;  1SAP A;  1CA6 A;  3R93 A;  1GUW A;  1DZ1 A;  3KUP A;  1AP0 A;  1U4P A;  3H91 A;  1QG7 A;  1SDF A;  2JYO A;  2XIW A;  1HRJ A;  1PDQ A;  2K28 A;  2J7Z A;  2FHT A;  1AZP A;  3MTS A;  4IUQ A;  1QE6 A;  1A15 A;  1SSO A;  3HP3 A;  3I8Z A;  4MHE A;  2SDF A;  1O7Z A;  2Q8T A;  1S4Z A;  1M8A A;  2D9U A;  2K01 A;  1WD1 A;  1E0B A;  1VMC A;  2L12 A;  3D6W A;  3IL8 A;  2FIN B;  1XYI A;  1HUN A;  5DNF A;  3DM1 A;  1BF4 A;  2IL8 A;  2FJ2 A;  4XT1 B;  3G7L A;  2B2T A;  4NW2 A;  4IUP A;  1Q3L A;  2X6G A;  4R8I A;  1AZQ A;  3ONA B;  1PFB A;  1WTO A;  1ZXT A;  4HAE A;  2NWG A;  4LMQ D;  2L4N A;  1WVL A;  2MGS A;  3DEP A;  1RTN A;  3P7J A;  2DY7 A;  2EE1 A;  4R9W A;  3GV6 A;  1RHP A;  1F9Q A;  4MN3 A;  2K1B A;  1DOL A;  3UI2 A;  1EIG A;  1U4L A;  2VXW A;  4ZKC B;  1JE4 A;  4RAU C;  1ILP A;  1RTO A;  2EOT A;  1U4R A;  5E4W C;  2Q8R E;  3GV3 A;  5CBE E;  1NCV A;  3FDT A;  4QUF A;  1X3Q A;  2RSN A;  3MWY W;  2B2Y C;  4CJ0 B;  2B2W A;  2HDM A;  4RA8 A;  1U4M A;  1NR2 A;  2B2T C;  1NR4 A;  4X3T A;  3I3C A;  1F2L A;  1F9S A;  1MGS A;  1X32 A;  2N55 A;  3IFD A;  5EJW A;  1G2T A;  1G6Z A;  4ZK9 B;  4IUV A;  2M2L A;  2L1B A;  2B2Y A;  2RVL A;  4HCS A;  3FPU B;  3TN2 A;  2KED A;  5JJZ A;  2NYZ D;  4CJ1 B;  4UAI A;  4ZLT F;  4IUT A;  1EL0 A;  1IKM A;  1MSH A;  2K03 A;  2HUG A;  2MJ8 A;  3TZD A;  1J8I A;  4QUC A;  1ML0 D;  1CA5 A;  2FMM A;  1F9P A;  2B2V A;  4O42 A;  1WTV A;  4ZAI A;  1B50 A;  2KEE A;  1NAP A;  2B2W C;  2MP1 A;  2HCC A;  1QNK A;  4RWS C;  1EIH A;  4XDX A;  1O80 A;  2HDL A;  2FFK B;  1G91 A;  1J9O A;  1TVX A;  5D14 A;  3QO2 A;  2X6L A;  5AFW A;  5CMD A;  4X3S A;  3Q6S A;  2BDN A;  5COY A;  4IUU A;  1C8C A;  5EKI A;  5COR A;  4DN4 M;  1MSG A;  1B2T A;  5CBA E;  1G2S A;  2KEC A;  4CJ2 C;  1HA6 A;  1RJT A;  1DOK A;  2B2U C;  1WTP A;  2MPM A;  5T1I A;  1KNE A;  4HED A;  1EQT A;  1DOM A;  1O7Y A;  2B2V C;  4ZKB B;  1ILQ A;  2H1E A;  1BNZ A;  1IL8 A;  1B3A A;  1VMP A;  2K04 A;  1X3P A;  1B4O A;  1MI2 A;  2B2U A;  2K05 A;  1WTX A;  1CM9 A;  3I90 A;  2R3Z A;  2CVR A;  2L11 A;  4X3K A;  4XT3 B;  1BO0 A;  5E4X A;  1WTQ A;  4X3U A;  1KNA A;  2RSO A;  2KVM A;  1HFG A;  1XX8 A;  4HSV A;  3I91 A;  1ICW A;  1ROD A;  3KBX A;  5EPL A;  1HHV A;  1EOT A;  2RA4 A;  1PLF A;  5D65 A;  4U68 A;  4IUR A;  2L9H A;  2HCI A; 
#chains in the Genus database with same CATH topology
 3RUZ A;  5IYB G;  4X65 L;  2JA6 B;  1HTP A;  1KDA A;  4DR6 Q;  4JPB W;  1IKL A;  3CCM A;  3CKI B;  4QIW B;  3S2H H;  4K6D A;  3STB C;  1SAP A;  1STN A;  1K0R A;  1U4P A;  1QG7 A;  1VQB A;  3T51 B;  1H9M A;  1J8I A;  5IT9 L;  2K5W A;  2D9U A;  2LS0 1;  3D6W A;  3IL8 A;  1XYI A;  3HOW B;  2R61 A;  4FF2 A;  4P72 A;  5EKK A;  5ELN A;  4C3H G;  4OWT B;  1GD7 A;  5IYC G;  3K57 A;  4KHP L;  2IY5 B;  1T9H A;  3H0G B;  2KEN A;  1OXU A;  3DWQ A;  3DEP A;  1TWA H;  3HKZ G;  5DEH A;  3U9O A;  1PH9 A;  2ES2 A;  1LYL A;  2CFM A;  1EY7 A;  2EOT A;  1KL9 A;  3I4N B;  1BDO A;  3TP7 A;  3D4D A;  5CBE E;  2KCC A;  3A8K E;  5C0X I;  3GTG H;  3KF6 A;  2B2T C;  4JI6 L;  4K5X A;  4DV3 Q;  4A3G B;  3MVV A;  5LMN L;  1IBK L;  4YWL A;  1MIU A;  2KJX A;  2UUA L;  5FJ8 G;  1VQD A;  2YU9 B;  3M3Y H;  3HZX A;  2VZA A;  3VR2 A;  3D3R A;  3BS1 A;  2EYF A;  1H95 A;  1EZ6 A;  1PMR A;  2R93 H;  5HUR A;  5GRO A;  4AQY Q;  1NAP A;  5CC4 A;  4RWS C;  2DJG C;  4BBR H;  1SNM A;  2YTY A;  3FPP A;  3CD6 A;  1FGU A;  2E2H B;  1PFS A;  2PQE A;  5COY A;  5A2Q L;  3K5N A;  1TY0 A;  1V43 A;  5HY6 A;  3FKI G;  4H0L C;  2B2V C;  4HCE A;  5C3E H;  2EVB A;  1SLJ A;  3K7A B;  1ZEQ X;  5C44 H;  3HOW G;  5LMU L;  4BBS G;  3OW7 A;  2F0J A;  5HGT A;  3S1Q B;  4DNT B;  3TEH B;  3F2B A;  3Q8D A;  4GN3 B;  1HHV A;  1JMC A;  3I4L A;  1SND A;  2AWN A;  2RA4 A;  4KLK A;  1D8L A;  2K50 A;  3CP0 A;  4B3S Q;  2JA8 G;  3S2D H;  2PPB C;  1MKH A;  4RKB A;  4LF8 Q;  4A93 B;  3CCR A;  3A7A B;  4OWW B;  1TY2 A;  3S24 A;  4OIJ A;  4C3J G;  3R93 A;  1NNX A;  4FXK C;  5IE8 A;  4KHZ A;  1SNC A;  1D2B A;  4G7Z C;  1TWH H;  1QVG A;  1YNN D;  4XQN A;  4JI0 L;  2LMC B;  2B63 B;  2ZJR A;  1VCI A;  1VQ6 A;  2I5M X;  4CKB A;  4B3M L;  1EY5 A;  2FJ2 A;  4CDD C;  3DXJ C;  4ME5 A;  1Y69 U;  1WTO A;  3L3O C;  3DUZ A;  3FEW X;  4DU9 A;  5M5Y H;  1JT8 A;  2AWO A;  1V1P B;  1FJG Q;  3DWA A;  1A62 A;  3A5Z B;  1EWI A;  1JE4 A;  2M00 A;  2ID0 A;  1LTI D;  3PIP 3;  1EU3 A;  3S17 B;  2RSN A;  5M5X H;  4CJ0 B;  1SE8 A;  5C0X J;  2E2D C;  2PI2 E;  2VUM G;  1OXT A;  2PZT A;  3NTK A;  2IX0 A;  2K33 A;  1DCZ A;  3RLF A;  2HQL A;  5IP9 H;  4A3J H;  4DR4 L;  4TRD A;  3JAM c;  3NUC A;  1HCZ A;  4BS9 A;  2WKD A;  4DKA C;  4LJZ C;  4ZLT F;  4O0A A;  1X3G A;  4A93 G;  2Y0S B;  1F2M A;  1X54 A;  2F1M A;  3CCS A;  5JPN C;  3R3O A;  5GAG C;  3CAM A;  1VQP A;  2B8G A;  3OMG A;  3ZYY X;  2MUY A;  1J9O A;  1TVX A;  1LTA D;  1KAW A;  3J81 j;  4DV7 Q;  4L8J A;  5EGT A;  3MEF A;  2A1A A;  1FVI A;  1CI3 M;  1Q8K A;  1IZ6 A;  1OXS C;  3RLN A;  2R92 G;  1YVC A;  3MFY A;  1PVO A;  3C2P A;  2VQE Q;  4R4O A;  3OYY A;  1QIL A;  1MI2 A;  1OTC A;  3CRL C;  1NE3 A;  1EEF D;  3V96 A;  3I90 A;  2JA9 A;  4JI8 Q;  2JEA I;  1FNW A;  1P16 A;  1S5E D;  4CDE C;  2I5L X;  2F3V A;  1HNX L;  3HOV H;  5EBC A;  2A6H D;  1I6H B;  3KK7 A;  3IFT A;  2OCE A;  2L9H A;  4UY8 C;  1B1Z A;  2Q2H A;  5J1Z A;  4DV1 Q;  1CKO A;  4HJ7 A;  1ZYR D;  3PUY A;  1PTO B;  1STG A;  2EPB A;  2PW7 A;  3DHQ A;  3F2U A;  2BA0 A;  2CKZ B;  5IOC A;  1W3S A;  1ET9 A;  2VS1 A;  4OWX B;  1BBX C;  2ASB A;  4BY7 G;  3H94 A;  1LT6 D;  2YTX A;  1XXG A;  4KMU C;  3C46 A;  1QUQ A;  2NZ1 D;  2Z0S A;  4ZUJ A;  4A3L H;  4X66 L;  4JV5 L;  2KCN A;  3GTM H;  3VR6 A;  4OX9 Q;  2Y0S G;  1O7I A;  2EYJ A;  1N34 L;  1YHA A;  1Z9F A;  3HP3 A;  4H02 A;  3E6Z X;  1PTO D;  2DN8 A;  1WD1 A;  2L12 A;  5IY0 A;  5H1S E;  4XQJ A;  4FO2 A;  3A54 A;  5DAU A;  5G3L D;  3DMU A;  4HTH A;  3TSS A;  4MTN A;  3U9S A;  1XNQ L;  4E6I A;  2HQE A;  2DY7 A;  4QQB X;  3PQI A;  1Q1B A;  2NB0 A;  2VY3 A;  3U50 C;  1K73 C;  3CU7 A;  2EZV A;  1P8L A;  1SBB B;  1JOR A;  1U4R A;  2RDH A;  1SYE A;  1KTK A;  1SEB D;  2PW5 A;  2C35 B;  4M1U B;  4NXN Q;  1FL0 A;  2NVT H;  1G2T A;  3J7A F;  2E5L Q;  2UUC Q;  4JI1 Q;  2M2L A;  5KYI A;  3TN2 A;  3W3A A;  1EL0 A;  4X62 Q;  3TZD A;  1CTM A;  1G8Z D;  1XTC D;  5CV7 A;  4JBM A;  1U9R A;  2E2J H;  1HZC A;  1X65 A;  3ZJY C;  1EEI D;  2R7D A;  4K0K Q;  3M4O B;  2EIF A;  2TSS A;  4YCU A;  3PO2 B;  3HKZ E;  1A3U A;  5D14 A;  4IJL A;  3SEB A;  2F0U A;  4IUU A;  4JYA L;  4MNO A;  3BDL A;  3J81 E;  1IL2 A;  1TXY A;  1G2S A;  1AW7 A;  4CJ2 C;  1HA6 A;  3RN5 A;  2KCT A;  1X56 A;  2IW3 A;  1K8M A;  2BE5 D;  2NBF A;  1O7Y A;  3EQL C;  4C2M H;  1IHZ A;  2IWH A;  3ULP A;  1Y1V G;  1XPR A;  1BQQ T;  4F87 A;  1CSP A;  1YJN A;  4NKL A;  5CV4 A;  5EPL A;  1H9S B;  2A73 B;  2WFW A;  2F0M A;  2EDG A;  4RH6 A;  2D62 A;  1WCM G;  1SR3 A;  1HR0 Q;  1XMQ L;  1EQR A;  4LF7 L;  3N52 A;  3T1Y L;  3FMC A;  4PZ6 A;  4OEL B;  5EPJ A;  4RFB A;  1KAA A;  2DY8 A;  1K8O A;  2KUM A;  5T1G A;  1TS5 A;  3H3V I;  3A55 A;  2WB1 G;  4HJA A;  3BYT B;  1LTS D;  5FOB B;  5IYB H;  2NN6 I;  5GAD C;  1VDZ A;  4PMB A;  1O78 A;  1KLG D;  3NXW A;  5A35 A;  4OEM B;  5J39 A;  2MO1 A;  3V2T A;  3CPW A;  5CV6 A;  1PH8 A;  1E0B A;  4LNQ A;  3PO2 G;  1ICF B;  1BCP D;  4PZ8 A;  3LX0 A;  1X55 A;  4A3B B;  2OF1 A;  4CGY B;  1R4Q B;  3G7L A;  2NVX B;  5C6A A;  2F0T A;  2JA7 G;  2A68 D;  1ZXT A;  3GTQ B;  2Q8I B;  4UP8 A;  4GNX B;  1KDC A;  1Y8N B;  1SXT A;  1PH1 A;  3EN2 A;  2EJG C;  3A0J A;  3L2P A;  3GV6 A;  3UI2 A;  1DOL A;  1WJJ A;  2ICE C;  1JJ2 A;  3NTH A;  1B3Q A;  4MTK A;  4B9X A;  4AYB G;  2HD3 A;  2MO0 A;  4C3H H;  4H13 C;  4KN7 C;  3EA6 A;  1IW7 D;  1F2L A;  1YIJ A;  3S9W A;  4KKS A;  3GO5 A;  2B39 A;  4K2L A;  4DAV A;  2F0D A;  5KGU A;  4DNR B;  2KED A;  4ULL A;  4R4C A;  4DV2 Q;  3M4Y A;  4X65 Q;  4TQU S;  4KN4 C;  2F0N A;  3K7U C;  4ZAI A;  1YNJ C;  2TMP A;  4FF4 A;  3MEH A;  1H9J A;  5IP7 G;  3T1H L;  5FJ8 H;  1L2F A;  1SE3 A;  4DV0 L;  1K3R A;  4J15 A;  2LKV A;  3MHB A;  2BDN A;  3GTK H;  2PZU A;  5C0X G;  1VQ9 A;  5C4Z A;  1SNP A;  2EY2 A;  3A74 A;  5M3F B;  3VYT A;  4JCV E;  4RCO A;  1B4O A;  3ULJ A;  1EUJ A;  2JA5 G;  2K05 A;  3TME A;  3L0O A;  4FVM A;  1JR0 D;  3CCV A;  3BZC A;  5E4X A;  3FKI H;  2SOB A;  1SFO B;  3KF8 B;  1LT4 D;  3C3L A;  1WFQ A;  4LUV A;  4JI3 L;  1K3B C;  1GKH A;  5IT9 c;  3HOW H;  2RDF A;  4A76 A;  4GOP B;  4YWM A;  4BBS H;  1Q8I A;  4IZ8 A;  3DEO A;  3H0G H;  2UU9 L;  3HOY B;  4JW0 A;  3CHB D;  4DUY Q;  2F0P A;  2RHQ B;  1ASZ A;  4XYQ A;  2KHJ A;  2JA8 H;  2JYO A;  1E22 A;  1I6H H;  1YZ6 A;  1S5C D;  1GVP A;  2VL6 A;  1VF5 C;  4LFC L;  4A3G H;  4GLX A;  5GAH C;  3VYU A;  1Q1E A;  1KC8 C;  2D2C C;  2SEB D;  5JJK A;  1M4V A;  5GAE C;  4C3J H;  3NP8 A;  1D5X C;  5BN5 A;  1GHJ A;  3PIO 3;  1CT1 D;  3GP7 A;  4A4I A;  4LF6 Q;  1GUG A;  3QWN A;  1F9Q A;  2PNH A;  5M9O A;  1ILP A;  1Y14 B;  4F8M A;  1AE3 A;  4ZCK A;  3GV3 A;  4B9W A;  3U4Z A;  4DV4 L;  3TS0 A;  3SR1 A;  3RNU A;  1I4H A;  2B2Y C;  2B2W A;  3BVZ A;  1VS0 A;  2ZTC A;  1NR2 A;  3I73 A;  5I2Y A;  1F9S A;  1PZJ D;  1KAB A;  1QVF A;  2JEB I;  1FNU A;  3MFG A;  3U58 A;  4FDB A;  4QUC A;  5FLM G;  3BDO A;  4BY1 B;  1F9P A;  3TQY A;  2VUM H;  1YNX A;  2QCP X;  4X64 L;  4C3I G;  3CXC A;  1XNR Q;  4XDX A;  3Q22 A;  5JJL A;  2WII B;  1W6K A;  4PQX A;  1QB5 D;  1L1O B;  1UE7 A;  1DD2 A;  4DR3 Q;  4A93 H;  4RG1 A;  4HED A;  4WRD A;  1I50 B;  2XVS A;  1TII D;  1OXV A;  2IHE A;  1U5K A;  4N8F A;  1H9R A;  1HXY D;  1SRO A;  2RCF A;  2AQ3 B;  1JE5 A;  3X3M A;  4KV6 A;  4C56 C;  5JVG 3;  1PRT B;  4BA2 I;  4IFD J;  4RKL A;  1A8V A;  2G5D A;  1Q90 A;  2R92 H;  2RBM A;  2F0K A;  4JI5 Q;  1SJH D;  1KRS A;  1LM0 A;  1VQE A;  2JP1 A;  4IOA A;  2XRS D;  4OIK A;  4A3D B;  4XXE A;  3Q24 A;  5AJ3 Q;  1I3Q B;  1D5Z C;  3OMC A;  3QB3 A;  3GTJ B;  2AQ2 B;  1PFN A;  1AE2 A;  5M3M B;  2M9V A;  1CA6 A;  1TWC B;  3BU2 A;  1GUW A;  2ZJQ A;  3C1E A;  4JBW A;  2ENB A;  3H91 A;  1NSN S;  2XIW A;  1EYC A;  1PDQ A;  1XPU A;  3S1M B;  2E74 C;  1LT5 D;  3VR5 A;  2SDF A;  4BY7 H;  1VMC A;  4DR5 Q;  4JG2 A;  4DR1 L;  1EWH A;  4LF4 Q;  3ERQ A;  1MJE A;  4P71 A;  3DM3 A;  4NW2 A;  5IIF A;  1Q3L A;  4R8I A;  3E9I A;  5F2D A;  5ISR A;  2WV6 D;  1K8A C;  2NVY B;  3TRE A;  3RZD B;  3KLS X;  2K1B A;  3T13 A;  1EIG A;  3BVM A;  4RAU C;  1V1P A;  3HOZ B;  5IGG A;  1C4Q A;  4HMI A;  1FYC A;  3MWY W;  3CCL A;  2EXD A;  3PO3 G;  1YI2 A;  3HS0 C;  3OIP A;  1U4M A;  4PV1 C;  3P20 A;  2F0H A;  3EIV A;  1IYJ B;  4DGZ A;  1IXR A;  1LTT D;  4DR7 Q;  2WAQ G;  2N49 A;  3GTP B;  5DLQ E;  1N33 Q;  3FPU B;  1BBW A;  4UHV A;  4A3F B;  4A3D G;  4O42 A;  5DM6 3;  2B2W C;  1Y1W B;  4R4I A;  1QJO A;  1R9T B;  4PZ7 A;  4JI4 Q;  5M3M G;  5C4H A;  1PV4 A;  4KI0 A;  1XMO L;  5COR A;  3HOX G;  1B9M A;  2EYP A;  1C48 A;  1JJC B;  1RJT A;  4AYB E;  2C5C A;  4POG A;  3H3V C;  2PCF B;  3NBH B;  3P1H A;  3K81 C;  4IPD A;  1VQF A;  1GM5 A;  4FXD A;  1SMY C;  2B8F A;  4OXP A;  2JA6 G;  1W2B A;  1WTX A;  1DGS A;  2UXB Q;  2L11 A;  2WAC A;  5C4X B;  1STH A;  4LFA L;  2GN5 A;  5BR8 L;  3I91 A;  4G7O C;  1EFW A;  3HKS A;  5EAY A;  1TT2 A;  3HOZ G;  1Y1V H;  4OL7 A;  1HR0 W;  1GUS A;  2QKI C;  1VQ7 A;  4HSP A;  4KJO A;  4DF7 A;  1WD0 A;  4YY3 L;  3HOU B;  2KOL A;  2DGY A;  1V1Q A;  3VA7 A;  1WCM H;  1W6J A;  4CBV A;  3A56 A;  5EPK A;  5IWA Q;  2V4D A;  3KUP A;  3H0G G;  4Y7N B;  2NVQ B;  1K8G A;  1VQK A;  1Q12 A;  1YNN C;  2J7Z A;  3MTS A;  1R4P B;  3I4N G;  2FIN B;  3NEL A;  4WFN 3;  2EYM A;  2R7Z B;  2AQ1 B;  3CW2 C;  1J5E L;  1VQN A;  4A3G G;  1QNU A;  4ZUI A;  3RMH A;  3S16 B;  1RHP A;  3SHL A;  3PO2 H;  4C1N K;  1UE6 A;  4POF A;  2K4K A;  3S1R H;  3TP8 A;  2NN6 G;  1TWG B;  1QWY A;  2N3S A;  1K83 B;  2JA7 H;  2JQO A;  4GKK Q;  1YHB A;  3CME A;  1IYU A;  4JI7 L;  4CHT B;  4IUV A;  3CPF A;  3ICE A;  4R1J A;  2PO4 A;  1VF7 A;  5IGE A;  2UXC L;  1WOC A;  1E2Z A;  1Z47 A;  4DR2 Q;  4B3R L;  1IBM Q;  3CQZ B;  4ZQ3 A;  3S15 H;  3WOF A;  3O13 A;  4RGO S;  4LF5 Q;  3BVG A;  3C1F A;  4RGT A;  1BBU A;  2ZXR A;  2XN9 C;  4DUZ Q;  3MZ5 A;  1I4R A;  4BXX G;  4NXM L;  2OEO A;  3DWP A;  1HNZ L;  1N36 L;  3J7A V;  2UUB Q;  5IP7 H;  4R4T A;  2B29 A;  1HNW L;  1L0Y B;  2R7Z G;  1BKB A;  1STY A;  4YCW A;  4X3K A;  4JI2 L;  2E76 C;  5C0X H;  3EJI A;  3NQI A;  4OGQ C;  5IT9 E;  3K5L A;  2A6H C;  1EIF A;  2KBN A;  1JB7 A;  4U68 A;  1H9S A;  1ZYR C;  2F0I A;  2HHH L;  2JA5 H;  3GTL H;  1HZB A;  3SXH A;  4ZRZ A;  2UXD Q;  4OO1 I;  1LTG D;  4B3T Q;  1I4P A;  4Z9C B;  2X69 A;  2B63 G;  1CKN B;  3NEM A;  3F1Z A;  4EGV A;  1XTD A;  2KHS A;  4KD4 A;  1SE2 A;  3RR5 A;  3S2H B;  1STB A;  4QL5 A;  4Q0F A;  2YTV A;  3KF6 B;  4HID A;  1HRJ A;  4DR6 L;  4QB4 A;  5J22 A;  1S5B D;  4PNY A;  1GXD C;  3I56 A;  4H44 C;  1PTO C;  5K5P A;  1UNS A;  2VW9 A;  1T5E A;  3KDF B;  4P73 A;  2K75 A;  3TDQ A;  2E8G A;  2QF7 A;  1KIX A;  3RLO A;  5DM7 3;  3KLR A;  1AZQ A;  5C3W A;  4A3C G;  1XJV A;  3SE0 A;  1WVL A;  4IUN A;  3P7J A;  4KK7 A;  1TWA B;  5CMD A;  1CFM A;  2IX1 A;  1EOV A;  3H6M A;  5I6W A;  4JOI A;  5I9P A;  2H4O A;  5A2Q E;  4H7B A;  4DK6 C;  1PH5 A;  4K14 A;  2I5H A;  1ENC A;  3CCU A;  3NPP A;  1NR4 A;  5EJW A;  4Q5V A;  2CQA A;  1TWF H;  4EX5 A;  5LHY 1;  4JVZ A;  3K80 C;  3LWU A;  4JI3 Q;  1Q7Y C;  2F4V Q;  4CJ1 B;  1L0W A;  2EQS A;  2HUG A;  2NZH A;  1FNV A;  3E9H A;  4L5T A;  4YIJ A;  2R93 B;  4DV3 L;  3NSW A;  3TRZ A;  1SFO H;  2O2L D;  1SJE D;  3BDC A;  4BBR B;  4RGM A;  3OIQ A;  3K5M A;  3OOC A;  2F0F A;  2E2I H;  3V05 A;  4I65 A;  3Q6S A;  1GHK A;  4HJ9 A;  4RHS A;  1SYF A;  5FLM H;  3TZU A;  4YCV A;  2BE5 C;  4C3I H;  5I6Y A;  2H1E A;  1HA5 A;  1VMP A;  1IBL Q;  4NDX A;  4CDC C;  5C44 B;  4IOC A;  5ELC A;  3SK4 A;  1A0I A;  1N32 Q;  3PMF A;  1WTQ A;  5D3D A;  1JQY D;  2L5T A;  2ICI A;  1SMX A;  3AU7 A;  3LGJ A;  4N9P A;  2IT1 A;  2DJF C;  2ZM6 L;  2EYH A;  5ELF A;  2A6E D;  2HCI A;  1YIT A;  1WTW A;  2XGT A;  3S2D B;  1A6X A;  1B53 A;  4RCN A;  1B44 D;  1EY0 A;  1LV9 A;  4XTC S;  5M5W H;  1YJW A;  4L5R C;  4FF3 A;  2N88 A;  4GOP A;  1D5M C;  1C7Y A;  5EKL A;  4K5V A;  4DV6 Q;  4AIM A;  1DON A;  1OO9 B;  4B3S L;  1QOH A;  4LF8 L;  2QW7 A;  4LF9 Q;  4K2K A;  1D1K A;  5NUC A;  3FHW A;  3VDY A;  1AZP A;  1TWH B;  4IUQ A;  1A15 A;  2Z6K A;  4QCL A;  1HUN A;  4QIW E;  3WWV A;  1BUV T;  1LTL A;  3K0X A;  3IRB A;  3DM1 A;  4F7X A;  4YHH Q;  2GA4 B;  4XT1 B;  4AH6 A;  1F2Y A;  4J8Q A;  1BCP B;  4IPH A;  3NWS A;  1CHP D;  1H9K A;  1I94 Q;  2QEJ C;  3S14 B;  2L4N A;  2N8N A;  1G6P A;  2EE1 A;  5M5Y B;  1C8C A;  3CRK C;  3KLW A;  4ZKC B;  2ATW A;  1U4L A;  3ULL A;  2CH4 W;  4IQZ A;  5GQO A;  4U67 3;  5M5X B;  1S72 A;  4R8N A;  5CYU A;  4X3T A;  4DAY B;  1FJG L;  3KLS A;  1TR5 A;  4DXF A;  2QGQ A;  3MXN A;  1T5X D;  1DXM A;  2B2Y A;  4A3J B;  4BWG B;  2QEX A;  3NE5 B;  2NYZ D;  1PYW D;  4GNX C;  2L0C A;  1KRT A;  2VQF Q;  4JOI C;  4HIK A;  2K03 A;  3PO3 H;  2DNE A;  1I4Q A;  1B9N A;  3J80 L;  4GKJ Q;  3T4A C;  4X6A H;  2CHB D;  2HCC A;  1HZ9 A;  2Z4H A;  2FFK B;  2Q2U A;  4LFB Q;  2OQ0 A;  3S1N H;  3M9B A;  4EQP A;  5AFW A;  1JJG A;  3NEN A;  4A3D H;  2D0O A;  2ZT9 C;  1L1O A;  5CV9 A;  3UDG A;  1QUQ B;  2Z9H A;  3NHH A;  1X3P A;  3M4Q A;  2VNU D;  5M3M H;  4HN7 A;  4A3E B;  4DV7 L;  1TWC H;  5FKA C;  1JC7 A;  2Q2T A;  3HOX H;  3H09 A;  1NMF A;  3S1M H;  2KVM A;  2CCZ A;  1ICW A;  3HOV B;  1E1T A;  2VQE L;  1F77 A;  1V1O A;  4DAM A;  5LL6 S;  1VQ8 A;  1TU2 B;  2JA6 H;  1GUO A;  1JCK B;  3E0E A;  1M1K C;  5FLX L;  4JI8 L;  1EQQ A;  4A3K B;  1CQF A;  4YWK A;  3PUW A;  4IN3 A;  3TBI B;  2EYL A;  1PH2 A;  1HFN A;  1SRU A;  3R2T A;  4A3B G;  1PH6 A;  4DV1 L;  3HOZ H;  1PZK D;  4LAA A;  4KHV A;  4IFD I;  4KHP Q;  2FHT A;  1E2W A;  2K01 A;  4GOP C;  3E0J A;  2AKW B;  1CSQ A;  5BN4 A;  3R8B A;  3PF5 A;  3OSO A;  3K6O A;  1CZW A;  4A3F H;  1CKM A;  2OTJ A;  4OX9 L;  2H5X A;  3PUV A;  4HAE A;  1L0X B;  1N9W A;  4JI6 Q;  4BA1 I;  1YNJ D;  5LMN Q;  4MN3 A;  1IBK Q;  3UDX A;  1Z7T A;  2Z6K C;  2VXW A;  3I4N H;  1RTO A;  2UUA Q;  5IGC A;  1NCV A;  2FXQ A;  1EFI D;  2K5Q A;  3ITP A;  1G51 A;  3PUX A;  2D5D A;  2A74 C;  5KYL A;  4EQO A;  1V9P A;  4EVO A;  2NTS A;  1STE A;  3H3V H;  2YU9 H;  2SNM A;  1JOK A;  3I4M B;  1Q81 C;  4IJH A;  4A3I B;  2NN6 H;  1GO3 E;  4A3K G;  1EYD A;  1IKM A;  4L63 B;  4GN5 A;  4IPC A;  4ODG A;  3J7Z C;  5M3F G;  2E5L L;  2UUC L;  4JI1 L;  4KTA A;  2E2H H;  5JEA J;  2BOS A;  3VR3 A;  1RF2 D;  2A5H A;  5LMU Q;  3D6C A;  4X62 L;  3A7L A;  3OTO L;  1PRT F;  1JB3 A;  5JOB A;  5JVH 3;  4N9T A;  2B2U C;  3M7N A;  2Y0S E;  3MC0 B;  4K0K L;  4XYO A;  3K7A H;  3QG1 A;  4C2M B;  2CH4 A;  2EJF C;  3NBH A;  1PH4 A;  2N78 A;  4DXG A;  5C4J B;  4QY7 A;  2MHV A;  3S1Q H;  4Y7N H;  4BXX H;  5ELO A;  3HOY G;  4ALP A;  1B70 B;  3VYR A;  4NB3 A;  1E3P A;  5D65 A;  1HTL D;  1L1O C;  5L37 A;  4DAP A;  2CW0 D;  3HGB A;  3NTI A;  2F0Q A;  1E1O A;  3M7G A;  1JWU D;  2R7Z H;  1FD7 D;  1KHI A;  3AFQ A;  2A19 A;  1I4X A;  3SVM A;  2BCO A;  4JI0 Q;  1EY4 A;  3RZO B;  3NK9 A;  1S5D D;  2XSC A;  1HR0 L;  1EY8 A;  3K0Y A;  1PRT C;  4A3I G;  4B3M Q;  1K9M C;  3AQQ A;  1RL2 A;  1AP0 A;  2F0O A;  2K28 A;  1C0A A;  1MHW C;  2ZTE A;  2B63 H;  4B3R Q;  2P5Z X;  1E2V A;  3W1B A;  1UEB A;  1S4Z A;  4FXG C;  3CMA A;  1EIY B;  1EQV A;  4OO1 G;  4IUP A;  3KOJ A;  4IFD H;  5IOD A;  5K36 G;  3G4S A;  1HNZ Q;  1N36 Q;  4UPA A;  3E5S A;  2EJM A;  4DR4 Q;  3AMU A;  3S17 H;  4PG3 A;  4WJ4 A;  3N6R A;  1PA6 A;  2Q2I A;  2F03 A;  4BY1 G;  4GLA C;  3K5O A;  3PSI A;  1K0S A;  4C3H B;  2PNR C;  1GOZ A;  4A3C H;  3MXU A;  2EY1 A;  3I4O A;  1VQI A;  4ZK9 B;  1E24 A;  3D4W A;  5IGF A;  3HKZ B;  2L1B A;  1HH2 P;  2WP8 J;  5JJZ A;  1HQR D;  2G9D A;  1VQ4 A;  2NZO A;  2JE6 I;  2MP1 A;  1Q46 A;  1QNK A;  1D1I A;  4NMZ A;  5FO8 B;  4MIU A;  3UE1 A;  1A3V A;  3CCJ A;  3QO2 A;  3ERO A;  3PGZ A;  2WB1 E;  4K6L A;  4DV2 L;  4L6T B;  2Z8L A;  3GTK B;  4GLV B;  1EYG A;  5T1I A;  1S3O A;  1KNE A;  1PYB A;  1EQT A;  1PXU A;  3ERS X;  2A69 D;  1HNX Q;  3T53 B;  3JAM i;  4DK3 C;  1KQS A;  4PMC A;  2K04 A;  5FO9 B;  4HIM A;  4I7Z C;  4FNF A;  2K5N A;  3ND9 A;  1NTG A;  1SYC A;  3J80 i;  1XX8 A;  3FKI B;  3E3X A;  1LTR D;  1TKW B;  2O4X A;  2XRQ D;  1SNQ A;  1A2U A;  1PTO H;  1EYA A;  1XPO A;  2C9O A;  4X66 Q;  4JV5 Q;  1UAP A;  2K14 A;  4BBS B;  1QVC A;  4K8I A;  1N34 Q;  4OHJ A;  1JIC A;  2IHF A;  1CKN A;  3MAQ A;  3STB D;  2AUJ D;  2XWJ B;  2J0T D;  3U4V A;  3QIA A;  1ENA A;  1DZ1 A;  2JA8 B;  1SDF A;  4ID6 A;  5LL6 X;  3BG3 A;  4IAL A;  4NP5 A;  3K58 A;  1VQJ A;  1S40 A;  2Q8T A;  3I8Z A;  2R6G A;  4DUY L;  1XNQ Q;  1M8A A;  1WI5 A;  3PIP A;  3JC6 6;  3A5U A;  2BDO A;  5D3I B;  3A8I E;  1D6E C;  3KDF A;  3X3N A;  3SK8 A;  4C3J B;  2Z1C A;  3EVQ A;  4K5W A;  4P2C B;  1UUP A;  5C5M A;  4GZY C;  1RTN A;  1CUK A;  4V0B A;  4O1N A;  2BA1 A;  5E3F A;  3AFP A;  5I9O A;  2F0W A;  2Q8R E;  4A3F G;  1F2Z A;  1GUN A;  5FK9 C;  2I46 A;  4EQN A;  2PQA B;  1Y1W G;  2HDM A;  3QOL A;  4RA8 A;  4LF6 L;  1X32 A;  2IPK D;  2MNA A;  3TS2 A;  1LAC A;  2JXM B;  2K5D A;  3HEJ A;  1SMY D;  2ZM6 Q;  2RDG A;  3TP6 A;  2NUC A;  4S3S A;  3QOJ A;  4JYA Q;  1MSH A;  5FO7 B;  2MJ8 A;  4KJN A;  4QMG A;  4QF4 A;  1VQO A;  2BH2 A;  2EXZ A;  1ASY A;  3MXG A;  2KEE A;  3M4O H;  1LLR D;  2VUM B;  4HMJ A;  2KHI A;  5IGD A;  1O80 A;  4R4Q A;  4WOR A;  1X3E A;  5C4X G;  4DN4 M;  1MJC A;  5KIX A;  5CBA E;  3BYY B;  1DJR D;  2MPM A;  1XNR L;  3GTO B;  4FYD A;  3UE0 A;  4A3M B;  1PHJ A;  3KBG A;  1J6Q A;  1XMQ Q;  4LF7 Q;  1X6O A;  3T1Y Q;  4DR3 L;  2CQO A;  3HOU G;  5JPM C;  4XT3 B;  4G7H C;  3J7A 5;  4NPS A;  4A75 A;  4TSS A;  1WTH A;  3I2Z A;  1SE4 A;  1MBY A;  3KBX A;  5JEA G;  1TS4 A;  2R92 B;  2JN4 A;  1A63 A;  2AUK A;  1RIP A;  4DV5 L;  1SNO A;  1HQM C;  1RDP D;  1WTR A;  2Z6B A;  3J81 L;  1NMG A;  3S14 H;  1RKN A;  3NWT A;  2HIV A;  2K52 A;  2K5V A;  1PTO F;  1FGB D;  4JI5 L;  4RGN A;  3UDI A;  5CR3 A;  5G3L F;  3SDZ A;  3VYS A;  4IPG A;  2MQH A;  1CK1 A;  5AJ3 L;  4B08 A;  1JWM D;  4BY7 B;  2E75 C;  3D31 A;  4A3B H;  1SN8 A;  4PMW A;  2NVX H;  4LUZ A;  4UP9 A;  3GTQ H;  4KY5 A;  1CQV A;  2YYZ A;  2NWG A;  4LMQ D;  2O5I C;  2MGS A;  4LK1 C;  4DR5 L;  4A3M G;  3J80 c;  4LF4 L;  3FVQ A;  1PYS B;  3EBE A;  4FP5 D;  2KQ3 A;  5E4W C;  3MXP A;  4LUO A;  5LMN W;  3H15 A;  3K59 A;  3DLL A;  3W5O A;  3FDT A;  1II3 A;  1NJI C;  4QJF A;  2D0P A;  4IFD G;  3G48 A;  5JJI A;  2N55 A;  1Z6H A;  4DAY A;  5IYD G;  3T1H Q;  4HCS A;  4G57 A;  4DV0 Q;  4A3E H;  1AEX A;  3F2C A;  1M90 C;  4IUT A;  1EZ8 A;  1MD2 D;  2K5H A;  1AN8 A;  2PYK A;  5E7N A;  1WTV A;  1V8Q A;  3B6Y A;  2RQX A;  4DR7 L;  1NY4 A;  4RHR A;  2HDL A;  4GNX A;  2OTL A;  3OHX C;  3NQT A;  1YBY A;  1N33 L;  5KRU A;  4HJ5 A;  1N8R C;  2QA4 A;  1B7Y B;  3TP5 A;  1SYB A;  2EY5 A;  1EWC A;  1MSG A;  2F3W A;  4A3K H;  2KEC A;  3SGI A;  1WTP A;  3GTG B;  2K6A A;  3BZD B;  5FLX c;  5M3F H;  4M8A A;  4ZKB B;  1ILQ A;  1NBW A;  2DUD A;  1DYQ A;  4JI4 L;  3M3Y B;  2FMC A;  3SK5 A;  3L9A X;  3L7Z C;  4L5Q A;  4XQQ A;  2YV5 A;  4DA2 A;  1HFG A;  4HSV A;  1ROD A;  2UU9 Q;  1KDB A;  1YHQ A;  2QDL A;  1EOT A;  1PLF A;  5C3X A;  3KYH C;  3OPO A;  2A6E C;  5I2X A;  3RD4 A;  3QJY A;  1F9R A;  5IGB A;  3OWE B;  2UXB L;  2AMC B;  2ZXP A;  4AQY L;  1Y1V B;  1SYD A;  1HUM A;  5EQ0 A;  1ESR A;  3HOY H;  2RHS B;  1HZA A;  4LFC Q;  5C3E B;  5CV5 A;  2AHO B;  2WAQ E;  2EY6 A;  1JOO A;  3LWE A;  3NBI A;  2JJQ A;  1PFM A;  1BCP F;  5KNC A;  3D8G A;  1WCM B;  3W1G A;  3HG9 A;  1EY6 A;  2GVB A;  1VQ5 A;  1G6Z A;  3ER0 A;  2HT1 A;  1LT3 D;  2KCM A;  3KF8 A;  3M4P A;  5IWA L;  3I4M H;  1D7Q A;  4A3I H;  2WB1 B;  3KFU A;  4DV4 Q;  4OON A;  2X6G A;  1PFB A;  2NTT A;  2PMZ E;  3OTO Q;  1LTB D;  1YJ9 A;  1VQL A;  2PI2 A;  4G4K A;  1FR3 A;  2CWA A;  1G29 1;  2I07 B;  3HFZ B;  1GJX A;  3GD7 A;  1UE1 A;  4I7A A;  4QUF A;  1STA A;  2RKS A;  5KEE A;  3S1R B;  1X3Q A;  4OO1 H;  4ILW A;  5KNB A;  5J3B A;  1TS2 A;  2R93 G;  1HJP A;  2IX3 A;  3RN2 A;  2JA7 B;  3I3C A;  4X64 Q;  3IFD A;  4BBR G;  5K36 H;  2OQK A;  1BCP C;  2L55 A;  3GDE A;  2F4I A;  2ZJP A;  2QIL A;  4UAI A;  2A68 C;  5C4J H;  4Y52 H;  4BY1 H;  4AYB B;  1AFP A;  1VQG A;  2LY7 A;  4GKK L;  2FMM A;  4V19 0;  1B50 A;  3VR4 A;  2F3I A;  3I70 A;  2F0L A;  1BXT A;  1EIH A;  5C3E G;  1QZG A;  1CZG A;  3WDN A;  1IYV A;  3S15 B;  2JK8 A;  3LNN A;  3UDF A;  4L5S A;  4HJ8 A;  5E1F A;  5C44 G;  2JSO A;  3I7F A;  5CV8 A;  2V1C C;  5ELD A;  4X3S A;  5CGK A;  2L15 A;  4DR2 L;  1B2T A;  1IBM L;  2HIX A;  1TS3 A;  1IW7 C;  3T16 A;  2LXK A;  1DOK A;  4K8J A;  5C5L A;  1I50 H;  3JAM L;  4N8X 1;  3Q23 A;  2OXP A;  2A8V A;  3RZO H;  1UE5 A;  4LF5 L;  3WOE A;  1IL8 A;  1B3A A;  1VQH A;  4DUZ L;  2WKC A;  1Y8P B;  2B2U A;  4KD3 A;  4JC0 A;  4HIO A;  3Q0A A;  1BO0 A;  4TVA B;  1ENF A;  2UUB L;  3D0F A;  1ET6 A;  4IUR A;  3F8T A;  1VQC A;  1UWV A;  4KKU A;  1K28 A;  1QCB D;  2JA5 B;  4DK1 A;  3GTL B;  1GUT A;  2F0G A;  5TSS A;  4ME3 A;  2IJ0 A;  1I3Q H;  3FP9 A;  3GTJ H;  4MZ9 A;  2I0Q A;  4KY6 A;  1CHQ D;  4C1N I;  1B8A A;  4DR1 Q;  4UDU C;  3R2I A;  4KY7 A;  1X9N A;  2UXD L;  3PIO A;  5EBD A;  1I6V C;  4B3T L;  1ESF A;  4JK1 C;  1ONL A;  5IYC H;  4MHE A;  3G6E A;  1E7Z A;  4IO9 A;  2LSS A;  3EFX D;  3KJP A;  2K7V A;  1RCV D;  2OWO A;  3MA2 B;  2RCN A;  2WIN B;  3J81 i;  3D4R A;  1VQM A;  3OW2 A;  2F0S A;  2NVY H;  3RZD H;  5IP9 G;  4P75 A;  5ELE A;  1DM0 B;  2Z4I A;  4A3J G;  1OXX K;  4GS3 A;  3QR8 A;  3GTM B;  2F52 A;  2OT2 A;  4GN4 B;  2VB2 X;  3AEV A;  3GTP H;  1LAB A;  1Q82 C;  3OWF A;  3CCE A;  3G6J B;  1TWF B;  2RVL A;  2ZTD A;  2KA7 A;  1Y8O B;  1XMO Q;  4J6H A;  1EU4 A;  4EQ5 A;  1Y1W H;  1I4G A;  4WJW A;  4WJ3 M;  1NUC A;  1R9T H;  3AB9 A;  3M85 A;  4A3E G;  4P74 A;  4LWC A;  3SK6 A;  1G91 A;  3PF4 A;  2MFI A;  2F4V L;  1SYG A;  2X6L A;  2E2I B;  2QDB A;  3AYH B;  4CKE A;  2RF4 A;  5BN3 A;  2B3G A;  4LFA Q;  2NVT B;  3HOV G;  1DOM A;  5I4D A;  1VQA A;  5BR8 Q;  1RD9 D;  4C3I B;  5HGQ A;  3KJO A;  1BNZ A;  4HR7 B;  3I55 A;  2XTI A;  1CM9 A;  1U0L A;  4JBK A;  5C4X H;  4NXN L;  3W2D A;  2CVR A;  3VA5 A;  2F0E A;  3CCQ A;  2ZXO A;  1C9O A;  2RSO A;  2E2J B;  4YY3 Q;  2J4X A;  2CWP A;  4QGU A;  2XNA C;  3URY A;  4KKT A;  1IBL L;  3IKJ A;  4DNI A;  2CW0 C;  5KND A;  4A3L G;  2BH8 A;  1N32 L;  1JWS D;  1TQO A;  2GVA A;  3HOU H;  5M5W B;  5JEA H;  1EY9 A;  2DNC A;  2O5J C;  1YEZ A;  3FRP B;  2NVQ H;  4RMF A;  1BR9 A;  1J5E Q;  4UP7 A;  1QE6 A;  3MXN B;  1SSO A;  3JAM E;  1O7Z A;  1BVS A;  3CC7 A;  1LO5 D;  1PZI D;  3BJU A;  4DV6 L;  2LXJ A;  1PH7 A;  5JAV A;  5DNF A;  1BF4 A;  2F0V A;  2IL8 A;  3PV0 A;  1O7L A;  4LF9 L;  2PZW A;  2B2T A;  3F2D A;  3J80 E;  3P75 A;  3ONA B;  3S16 H;  1WYD A;  2VB3 X;  4JI7 Q;  4R9W A;  1X3F A;  3I4M G;  4XIG S;  2SNS A;  3ND8 A;  1TWG H;  4YHH L;  1LUZ A;  1A2T A;  1K83 H;  4CDF C;  2UXC Q;  4ABN A;  1S5F D;  1I94 L;  4DFA A;  4DK0 A;  1MGS A;  2XWB B;  3GTO H;  4JBJ A;  4J1M A;  3BZK A;  3HRZ C;  4CKC A;  3PCO B;  2PQA A;  1Q86 C;  4A3M H;  3CF5 A;  1PH3 A;  1KLU D;  2G9H D;  1AH9 A;  3CQZ H;  3PUZ A;  2R7F A;  4DV5 Q;  1ML0 D;  1CA5 A;  4ZYS A;  3PO3 B;  2B2V A;  1ZKO A;  4NXM Q;  4FF1 A;  1BOS A;  2WAQ B;  4O2D A;  5IYD H;  1KD1 C;  3S1N B;  3A8J E;  1KXL A;  4TKO B;  5FLX E;  2VQF L;  1HNW Q;  5EKI A;  5ELB A;  4DPG A;  1I5F A;  1JOQ A;  4JI2 Q;  2ALY B;  4GKJ L;  3T56 B;  2LFN A;  1XWE A;  2A69 C;  4LFB L;  3J81 c;  1QZH A;  3CC4 A;  4LW1 A;  3J7Y W;  3CC2 A;  2EYO A;  1PRT D;  2HHH Q;  4F88 A;  1HPC A;  2R3Z A;  3GQB A;  3I72 A;  4APV A;  4X3U A;  3HOX B;  2PMZ B;  1KNA A;  1A3T A;  2K32 A;  3IAY A;  3G71 A;  3K8A A;  1UEA B; 
#chains in the Genus database with same CATH homology
 3RUZ A;  2JA6 B;  1HTP A;  1KDA A;  1IKL A;  3CKI B;  4QIW B;  4K6D A;  1SAP A;  1STN A;  1U4P A;  1QG7 A;  3T51 B;  1H9M A;  1J8I A;  5IT9 L;  2K5W A;  2D9U A;  2LS0 1;  3D6W A;  3IL8 A;  1XYI A;  3HOW B;  2R61 A;  4FF2 A;  5EKK A;  4C3H G;  3K57 A;  3H0G B;  1OXU A;  3DWQ A;  3DEP A;  3U9O A;  5DEH A;  1EY7 A;  2EOT A;  3I4N B;  1BDO A;  3TP7 A;  3D4D A;  5CBE E;  2KCC A;  3A8K E;  5C0X I;  2B2T C;  4K5X A;  4A3G B;  3MVV A;  2KJX A;  2YU9 B;  3HZX A;  3VR2 A;  3D3R A;  3BS1 A;  2EYF A;  1EZ6 A;  1PMR A;  5HUR A;  1NAP A;  5CC4 A;  4RWS C;  1SNM A;  3FPP A;  2E2H B;  2PQE A;  5COY A;  5A2Q L;  3K5N A;  1TY0 A;  1V43 A;  4H0L C;  2B2V C;  4HCE A;  2EVB A;  3K7A B;  1ZEQ X;  3OW7 A;  2F0J A;  5HGT A;  3S1Q B;  4DNT B;  1HHV A;  3I4L A;  1SND A;  2AWN A;  2RA4 A;  2PPB C;  4RKB A;  4A93 B;  3A7A B;  1TY2 A;  4OIJ A;  4C3J G;  3R93 A;  4FXK C;  4KHZ A;  1SNC A;  1D2B A;  4G7Z C;  1YNN D;  4XQN A;  2LMC B;  2B63 B;  1VCI A;  4CKB A;  1EY5 A;  2FJ2 A;  3DXJ C;  4ME5 A;  1Y69 U;  1WTO A;  3L3O C;  3DUZ A;  3FEW X;  4DU9 A;  2AWO A;  1V1P B;  3DWA A;  1JE4 A;  2M00 A;  2ID0 A;  1LTI D;  3PIP 3;  1EU3 A;  3S17 B;  2RSN A;  4CJ0 B;  5C0X J;  2E2D C;  1OXT A;  2PZT A;  3NTK A;  2IX0 A;  2K33 A;  1DCZ A;  3RLF A;  4TRD A;  3NUC A;  1HCZ A;  4BS9 A;  2WKD A;  4LJZ C;  4ZLT F;  2Y0S B;  1F2M A;  2F1M A;  5JPN C;  3R3O A;  2B8G A;  3OMG A;  3ZYY X;  2MUY A;  1J9O A;  1TVX A;  1LTA D;  4L8J A;  5EGT A;  1CI3 M;  1OXS C;  3MFY A;  3C2P A;  1QIL A;  1MI2 A;  3CRL C;  1EEF D;  3V96 A;  3I90 A;  2JEA I;  1FNW A;  1S5E D;  2F3V A;  5EBC A;  2A6H D;  3KK7 A;  3IFT A;  2L9H A;  1B1Z A;  5J1Z A;  1ZYR D;  3PUY A;  1PTO B;  1STG A;  2EPB A;  2PW7 A;  3DHQ A;  3F2U A;  2BA0 A;  5IOC A;  1ET9 A;  1BBX C;  3H94 A;  1LT6 D;  3C46 A;  1XXG A;  4KMU C;  2NZ1 D;  4ZUJ A;  2KCN A;  3VR6 A;  2EYJ A;  3HP3 A;  3E6Z X;  1PTO D;  2DN8 A;  1WD1 A;  2L12 A;  4XQJ A;  4FO2 A;  3A54 A;  5DAU A;  5G3L D;  3DMU A;  4HTH A;  3TSS A;  3U9S A;  4E6I A;  2HQE A;  2DY7 A;  1Q1B A;  2NB0 A;  1JOR A;  3CU7 A;  2EZV A;  1SBB B;  1U4R A;  2RDH A;  1SYE A;  1KTK A;  1SEB D;  2PW5 A;  4M1U B;  1G2T A;  3J7A F;  2M2L A;  5KYI A;  3TN2 A;  3W3A A;  1EL0 A;  3TZD A;  1CTM A;  1G8Z D;  1XTC D;  5CV7 A;  1U9R A;  1EEI D;  3M4O B;  2TSS A;  3PO2 B;  1A3U A;  5D14 A;  3SEB A;  2F0U A;  4IUU A;  3BDL A;  3J81 E;  1G2S A;  1AW7 A;  4CJ2 C;  1HA6 A;  2IW3 A;  1K8M A;  2BE5 D;  2NBF A;  1O7Y A;  3EQL C;  1IHZ A;  2IWH A;  1BQQ T;  4F87 A;  4NKL A;  5CV4 A;  5EPL A;  1H9S B;  2A73 B;  2F0M A;  2EDG A;  4RH6 A;  2D62 A;  3N52 A;  3FMC A;  5EPJ A;  4RFB A;  1KAA A;  2DY8 A;  1K8O A;  2KUM A;  5T1G A;  1TS5 A;  3A55 A;  3BYT B;  1LTS D;  5FOB B;  2NN6 I;  1VDZ A;  4PMB A;  1O78 A;  1KLG D;  3NXW A;  5A35 A;  5J39 A;  3V2T A;  5CV6 A;  1E0B A;  1BCP D;  3LX0 A;  4A3B B;  2OF1 A;  4CGY B;  1R4Q B;  3G7L A;  2NVX B;  5C6A A;  2F0T A;  2A68 D;  1ZXT A;  3GTQ B;  2Q8I B;  1KDC A;  1Y8N B;  1SXT A;  2EJG C;  3GV6 A;  3UI2 A;  1DOL A;  2ICE C;  3NTH A;  4B9X A;  4H13 C;  4KN7 C;  3EA6 A;  1IW7 D;  1F2L A;  3S9W A;  4KKS A;  3GO5 A;  2B39 A;  4K2L A;  4DAV A;  2F0D A;  5KGU A;  4DNR B;  2KED A;  4ULL A;  3M4Y A;  4TQU S;  4KN4 C;  2F0N A;  4ZAI A;  1YNJ C;  2TMP A;  4FF4 A;  3MEH A;  1H9J A;  1SE3 A;  2LKV A;  3MHB A;  2BDN A;  2PZU A;  5C0X G;  5C4Z A;  1SNP A;  2EY2 A;  5M3F B;  3VYT A;  4RCO A;  1B4O A;  2K05 A;  3TME A;  4FVM A;  1JR0 D;  5E4X A;  2SOB A;  1SFO B;  1LT4 D;  3C3L A;  2RDF A;  1Q8I A;  4IZ8 A;  3DEO A;  3HOY B;  3CHB D;  2F0P A;  4XYQ A;  2JYO A;  1S5C D;  1VF5 C;  3VYU A;  1Q1E A;  2D2C C;  2SEB D;  1M4V A;  3NP8 A;  1D5X C;  5BN5 A;  1GHJ A;  3PIO 3;  1CT1 D;  3GP7 A;  1GUG A;  3QWN A;  1F9Q A;  5M9O A;  1ILP A;  4F8M A;  3GV3 A;  4B9W A;  3SR1 A;  1I4H A;  2B2Y C;  2B2W A;  3BVZ A;  1NR2 A;  3I73 A;  5I2Y A;  1F9S A;  1PZJ D;  1KAB A;  2JEB I;  1FNU A;  3MFG A;  4QUC A;  3BDO A;  4BY1 B;  1F9P A;  2QCP X;  4C3I G;  4XDX A;  3Q22 A;  2WII B;  1W6K A;  4PQX A;  1QB5 D;  1DD2 A;  4HED A;  4WRD A;  1I50 B;  2XVS A;  1TII D;  1OXV A;  1H9R A;  1HXY D;  2AQ3 B;  3X3M A;  4KV6 A;  4C56 C;  5JVG 3;  1PRT B;  4BA2 I;  4IFD J;  4RKL A;  1Q90 A;  2RBM A;  2F0K A;  1SJH D;  2JP1 A;  2XRS D;  4OIK A;  4A3D B;  4XXE A;  3Q24 A;  1I3Q B;  1D5Z C;  3OMC A;  3QB3 A;  3GTJ B;  2AQ2 B;  1PFN A;  5M3M B;  2M9V A;  1CA6 A;  1TWC B;  1GUW A;  3C1E A;  4JBW A;  2ENB A;  3H91 A;  1NSN S;  2XIW A;  1EYC A;  1PDQ A;  3S1M B;  2E74 C;  1LT5 D;  3VR5 A;  2SDF A;  1VMC A;  1EWH A;  3ERQ A;  4NW2 A;  5IIF A;  1Q3L A;  4R8I A;  5F2D A;  5ISR A;  2WV6 D;  2NVY B;  3RZD B;  3KLS X;  2K1B A;  3T13 A;  1EIG A;  3BVM A;  4RAU C;  1V1P A;  3HOZ B;  5IGG A;  1C4Q A;  4HMI A;  1FYC A;  3MWY W;  3HS0 C;  3OIP A;  1U4M A;  4PV1 C;  3P20 A;  2F0H A;  4DGZ A;  1LTT D;  3GTP B;  3FPU B;  4A3F B;  4O42 A;  5DM6 3;  2B2W C;  1Y1W B;  1QJO A;  1R9T B;  5C4H A;  4KI0 A;  5COR A;  1B9M A;  2EYP A;  1C48 A;  1RJT A;  3H3V C;  2C5C A;  2PCF B;  3P1H A;  4FXD A;  1SMY C;  2B8F A;  1WTX A;  2L11 A;  2WAC A;  5C4X B;  1STH A;  3I91 A;  4G7O C;  1TT2 A;  4OL7 A;  1GUS A;  2QKI C;  4HSP A;  4KJO A;  4DF7 A;  1WD0 A;  3HOU B;  2KOL A;  3VA7 A;  1W6J A;  4CBV A;  3A56 A;  5EPK A;  2V4D A;  3KUP A;  4Y7N B;  2NVQ B;  1Q12 A;  1YNN C;  2J7Z A;  3MTS A;  1R4P B;  2FIN B;  4WFN 3;  2EYM A;  2R7Z B;  2AQ1 B;  1QNU A;  4ZUI A;  3RMH A;  3S16 B;  1RHP A;  3SHL A;  4C1N K;  3TP8 A;  2NN6 G;  1TWG B;  1QWY A;  1K83 B;  1IYU A;  4CHT B;  4IUV A;  2PO4 A;  1VF7 A;  5IGE A;  1E2Z A;  1Z47 A;  3CQZ B;  4ZQ3 A;  3WOF A;  3O13 A;  4RGO S;  3BVG A;  3C1F A;  4RGT A;  2ZXR A;  2XN9 C;  3MZ5 A;  1I4R A;  2OEO A;  3DWP A;  3J7A V;  1L0Y B;  1STY A;  4X3K A;  2E76 C;  5C0X H;  3EJI A;  3NQI A;  4OGQ C;  5IT9 E;  3K5L A;  2A6H C;  4U68 A;  1H9S A;  1ZYR C;  2F0I A;  3SXH A;  4ZRZ A;  4OO1 I;  1LTG D;  1I4P A;  4Z9C B;  2X69 A;  4EGV A;  2KHS A;  4KD4 A;  1SE2 A;  3S2H B;  1STB A;  4Q0F A;  1HRJ A;  4QB4 A;  5J22 A;  1S5B D;  4PNY A;  1GXD C;  4H44 C;  1PTO C;  5K5P A;  1UNS A;  1T5E A;  3TDQ A;  2QF7 A;  5DM7 3;  3KLR A;  1AZQ A;  5C3W A;  3SE0 A;  1WVL A;  4IUN A;  3P7J A;  4KK7 A;  1TWA B;  5CMD A;  1CFM A;  2IX1 A;  3H6M A;  5I6W A;  5I9P A;  2H4O A;  5A2Q E;  4H7B A;  4K14 A;  1ENC A;  3NPP A;  1NR4 A;  5EJW A;  4Q5V A;  2CQA A;  5LHY 1;  3LWU A;  4CJ1 B;  2HUG A;  1FNV A;  4YIJ A;  2R93 B;  3NSW A;  2O2L D;  1SJE D;  3BDC A;  4BBR B;  4RGM A;  3OIQ A;  3K5M A;  3OOC A;  2F0F A;  3V05 A;  4I65 A;  3Q6S A;  1GHK A;  4RHS A;  1SYF A;  3TZU A;  2BE5 C;  5I6Y A;  2H1E A;  1HA5 A;  1VMP A;  4NDX A;  5C44 B;  5ELC A;  3SK4 A;  3PMF A;  1WTQ A;  5D3D A;  1JQY D;  2L5T A;  2ICI A;  3AU7 A;  4N9P A;  2IT1 A;  2EYH A;  5ELF A;  2A6E D;  2HCI A;  1WTW A;  3S2D B;  1A6X A;  1B53 A;  4RCN A;  1B44 D;  1EY0 A;  1LV9 A;  4XTC S;  4FF3 A;  2N88 A;  1D5M C;  5EKL A;  4K5V A;  1DON A;  1OO9 B;  1QOH A;  4K2K A;  1D1K A;  5NUC A;  1AZP A;  1TWH B;  4IUQ A;  1A15 A;  4QCL A;  1HUN A;  1BUV T;  3DM1 A;  4F7X A;  2GA4 B;  4XT1 B;  1F2Y A;  4J8Q A;  1BCP B;  3NWS A;  1CHP D;  1H9K A;  2QEJ C;  3S14 B;  2L4N A;  2EE1 A;  5M5Y B;  1C8C A;  3CRK C;  4ZKC B;  1U4L A;  4IQZ A;  4U67 3;  5M5X B;  4R8N A;  5CYU A;  4X3T A;  3KLS A;  1TR5 A;  4DXF A;  3MXN A;  1T5X D;  1DXM A;  2B2Y A;  4A3J B;  4BWG B;  3NE5 B;  2NYZ D;  1PYW D;  2L0C A;  2K03 A;  2DNE A;  1I4Q A;  1B9N A;  3J80 L;  3T4A C;  2CHB D;  2HCC A;  2Z4H A;  2FFK B;  4EQP A;  5AFW A;  2ZT9 C;  5CV9 A;  3NHH A;  1X3P A;  2VNU D;  4HN7 A;  4A3E B;  5FKA C;  1JC7 A;  3H09 A;  2KVM A;  1ICW A;  3HOV B;  1F77 A;  1V1O A;  5LL6 S;  1TU2 B;  1GUO A;  1JCK B;  5FLX L;  4A3K B;  1CQF A;  3PUW A;  4IN3 A;  3TBI B;  2EYL A;  1HFN A;  3R2T A;  1PZK D;  4LAA A;  4KHV A;  4IFD I;  2FHT A;  1E2W A;  2K01 A;  3E0J A;  5BN4 A;  3R8B A;  3OSO A;  3K6O A;  1CZW A;  3PUV A;  4HAE A;  1L0X B;  4BA1 I;  1YNJ D;  4MN3 A;  1Z7T A;  2VXW A;  1RTO A;  5IGC A;  1NCV A;  1EFI D;  2K5Q A;  3ITP A;  3PUX A;  2D5D A;  2A74 C;  5KYL A;  4EQO A;  4EVO A;  2NTS A;  1STE A;  2SNM A;  1JOK A;  3I4M B;  4A3I B;  2NN6 H;  1EYD A;  1IKM A;  4L63 B;  4ODG A;  4KTA A;  5JEA J;  2BOS A;  3VR3 A;  1RF2 D;  2A5H A;  3D6C A;  3A7L A;  1PRT F;  1JB3 A;  5JOB A;  5JVH 3;  4N9T A;  2B2U C;  3M7N A;  3MC0 B;  4XYO A;  3QG1 A;  4C2M B;  2EJF C;  3NBH A;  4DXG A;  5C4J B;  2MHV A;  3VYR A;  5D65 A;  1HTL D;  4DAP A;  2CW0 D;  3HGB A;  3NTI A;  2F0Q A;  3M7G A;  1JWU D;  1FD7 D;  1I4X A;  3SVM A;  2BCO A;  1EY4 A;  3RZO B;  3NK9 A;  1S5D D;  2XSC A;  1EY8 A;  3K0Y A;  1PRT C;  1AP0 A;  2F0O A;  2K28 A;  1E2V A;  1S4Z A;  4FXG C;  1EQV A;  4OO1 G;  4IUP A;  4IFD H;  5IOD A;  5K36 G;  3E5S A;  2EJM A;  3AMU A;  3N6R A;  2F03 A;  3K5O A;  4C3H B;  2PNR C;  1GOZ A;  3MXU A;  2EY1 A;  4ZK9 B;  3D4W A;  5IGF A;  3HKZ B;  2L1B A;  2WP8 J;  5JJZ A;  1HQR D;  2G9D A;  2JE6 I;  2MP1 A;  1QNK A;  4NMZ A;  1D1I A;  5FO8 B;  4MIU A;  1A3V A;  3QO2 A;  3ERO A;  4K6L A;  4L6T B;  2Z8L A;  3GTK B;  5T1I A;  1KNE A;  1EQT A;  1PXU A;  2A69 D;  3T53 B;  4PMC A;  2K04 A;  5FO9 B;  4I7Z C;  4FNF A;  3ND9 A;  1SYC A;  1XX8 A;  3FKI B;  1LTR D;  1TKW B;  2O4X A;  2XRQ D;  1SNQ A;  1A2U A;  1PTO H;  1EYA A;  2C9O A;  1UAP A;  4BBS B;  4K8I A;  4OHJ A;  1JIC A;  3MAQ A;  2AUJ D;  2XWJ B;  2J0T D;  3QIA A;  1ENA A;  1DZ1 A;  2JA8 B;  1SDF A;  4ID6 A;  5LL6 X;  3BG3 A;  4IAL A;  4NP5 A;  3K58 A;  1I6H B;  2Q8T A;  3I8Z A;  2R6G A;  1M8A A;  2BDO A;  5D3I B;  3A8I E;  1D6E C;  3X3N A;  3SK8 A;  4C3J B;  2Z1C A;  3EVQ A;  4K5W A;  4P2C B;  1UUP A;  5C5M A;  4GZY C;  1RTN A;  4V0B A;  4O1N A;  2BA1 A;  5E3F A;  5I9O A;  2F0W A;  2Q8R E;  1F2Z A;  1GUN A;  5FK9 C;  2I46 A;  4EQN A;  2HDM A;  3QOL A;  4RA8 A;  1X32 A;  2IPK D;  1LAC A;  2JXM B;  2K5D A;  3HEJ A;  1SMY D;  2RDG A;  3TP6 A;  2NUC A;  4S3S A;  3QOJ A;  1MSH A;  5FO7 B;  2MJ8 A;  4KJN A;  4QMG A;  4QF4 A;  2EXZ A;  3MXG A;  2KEE A;  1LLR D;  2VUM B;  4HMJ A;  5IGD A;  1O80 A;  4WOR A;  4DN4 M;  5KIX A;  5CBA E;  3BYY B;  1DJR D;  2MPM A;  3GTO B;  4FYD A;  4A3M B;  3KBG A;  5JPM C;  4XT3 B;  4G7H C;  4TSS A;  1SE4 A;  1MBY A;  3KBX A;  5JEA G;  1TS4 A;  2R92 B;  2AUK A;  1SNO A;  1HQM C;  1RDP D;  1WTR A;  3J81 L;  1RKN A;  3NWT A;  1PTO F;  1FGB D;  4RGN A;  5CR3 A;  5G3L F;  3SDZ A;  3VYS A;  1CK1 A;  4B08 A;  1JWM D;  4BY7 B;  2E75 C;  3D31 A;  4PMW A;  4KY5 A;  1CQV A;  2YYZ A;  2NWG A;  4LMQ D;  2O5I C;  2MGS A;  4LK1 C;  3FVQ A;  4FP5 D;  2KQ3 A;  5E4W C;  3MXP A;  3K59 A;  3FDT A;  1II3 A;  4IFD G;  2N55 A;  1Z6H A;  4DAY A;  4HCS A;  4G57 A;  1AEX A;  4IUT A;  1EZ8 A;  1MD2 D;  1AN8 A;  2PYK A;  1WTV A;  1V8Q A;  2RQX A;  4RHR A;  2HDL A;  3OHX C;  3NQT A;  5KRU A;  3TP5 A;  1SYB A;  2EY5 A;  1EWC A;  1MSG A;  2F3W A;  2KEC A;  1WTP A;  3GTG B;  2K6A A;  3BZD B;  4M8A A;  4ZKB B;  1ILQ A;  1DYQ A;  3M3Y B;  2FMC A;  3SK5 A;  3L9A X;  3L7Z C;  4XQQ A;  4DA2 A;  1HFG A;  4HSV A;  1ROD A;  1KDB A;  1EOT A;  1PLF A;  5C3X A;  3OPO A;  2A6E C;  5I2X A;  3RD4 A;  3QJY A;  1F9R A;  5IGB A;  3OWE B;  2ZXP A;  1Y1V B;  1SYD A;  1HUM A;  5EQ0 A;  1ESR A;  5C3E B;  5CV5 A;  2EY6 A;  1JOO A;  3LWE A;  3NBI A;  1PFM A;  1BCP F;  5KNC A;  3D8G A;  1WCM B;  3HG9 A;  1EY6 A;  1G6Z A;  1LT3 D;  3KF8 A;  2WB1 B;  2X6G A;  1PFB A;  2NTT A;  1LTB D;  4G4K A;  1FR3 A;  1G29 1;  2I07 B;  1GJX A;  3GD7 A;  4QUF A;  1STA A;  2RKS A;  5KEE A;  3S1R B;  1X3Q A;  4OO1 H;  4ILW A;  5KNB A;  1TS2 A;  2IX3 A;  2JA7 B;  3I3C A;  3IFD A;  5K36 H;  1BCP C;  2L55 A;  2F4I A;  2QIL A;  4UAI A;  2A68 C;  4AYB B;  1AFP A;  2LY7 A;  2FMM A;  4V19 0;  1B50 A;  3VR4 A;  3I70 A;  2F0L A;  1BXT A;  1EIH A;  1CZG A;  3WDN A;  1IYV A;  3S15 B;  3LNN A;  5E1F A;  2JSO A;  5CV8 A;  5ELD A;  4X3S A;  5CGK A;  1B2T A;  1TS3 A;  1IW7 C;  3T16 A;  4K8J A;  1DOK A;  5C5L A;  3JAM L;  3Q23 A;  2OXP A;  3WOE A;  1IL8 A;  1B3A A;  2WKC A;  1Y8P B;  2B2U A;  4KD3 A;  3Q0A A;  1BO0 A;  1ENF A;  1ET6 A;  4IUR A;  4KKU A;  1QCB D;  2JA5 B;  4DK1 A;  3GTL B;  1GUT A;  2F0G A;  5TSS A;  2IJ0 A;  4KY6 A;  1CHQ D;  4C1N I;  4UDU C;  3R2I A;  4KY7 A;  5EBD A;  1I6V C;  1ESF A;  4JK1 C;  1ONL A;  4MHE A;  3EFX D;  2K7V A;  1RCV D;  3MA2 B;  2WIN B;  3D4R A;  2F0S A;  5ELE A;  1DM0 B;  2Z4I A;  1OXX K;  3GTM B;  2OT2 A;  2VB2 X;  1LAB A;  3OWF A;  3G6J B;  1TWF B;  2RVL A;  2KA7 A;  1Y8O B;  4J6H A;  1EU4 A;  1I4G A;  4WJW A;  1NUC A;  3AB9 A;  3M85 A;  1G91 A;  3SK6 A;  1SYG A;  2X6L A;  2E2I B;  2QDB A;  4CKE A;  5BN3 A;  2NVT B;  1DOM A;  5I4D A;  1RD9 D;  4C3I B;  1BNZ A;  4HR7 B;  1CM9 A;  3W2D A;  2CVR A;  3VA5 A;  2F0E A;  2ZXO A;  2E2J B;  2RSO A;  2J4X A;  2XNA C;  3URY A;  4KKT A;  3IKJ A;  2CW0 C;  5KND A;  1JWS D;  1TQO A;  5M5W B;  5JEA H;  1EY9 A;  2DNC A;  2O5J C;  3FRP B;  1BR9 A;  1QE6 A;  1SSO A;  3JAM E;  1O7Z A;  1LO5 D;  1PZI D;  5JAV A;  5DNF A;  1BF4 A;  2F0V A;  2IL8 A;  3PV0 A;  1O7L A;  2PZW A;  2B2T A;  3J80 E;  3P75 A;  3ONA B;  2VB3 X;  4R9W A;  4XIG S;  2SNS A;  3ND8 A;  1A2T A;  4ABN A;  1S5F D;  4DFA A;  4DK0 A;  1MGS A;  2XWB B;  4J1M A;  3HRZ C;  4CKC A;  1KLU D;  2G9H D;  3PUZ A;  1ML0 D;  1CA5 A;  4ZYS A;  3PO3 B;  2B2V A;  1ZKO A;  4FF1 A;  1BOS A;  2WAQ B;  3S1N B;  3A8J E;  4TKO B;  5FLX E;  5EKI A;  5ELB A;  1JOQ A;  3T56 B;  2LFN A;  1XWE A;  2A69 C;  3J7Y W;  2EYO A;  1PRT D;  4F88 A;  1HPC A;  2R3Z A;  3GQB A;  3I72 A;  4X3U A;  3HOX B;  1KNA A;  2PMZ B;  1A3T A;  2K32 A;  3IAY A;  1UEA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...