2RKSA

Crystal structure of staphylococcal nuclease variant phs l38k at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLKVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title A buried lysine that titrates with a normal pKa: role of conformational flexibility at the protein-water interface as a determinant of pKa values.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rksA00
2F0WA 4TRDA 4PMCA 1SNOA 3ERQA 3HZXA 3QOJA 5KGUA 5J1ZA 2RKSA 4PNYA 5JOBA 1STHA 4G57A 2F0TA 1EYCA 1A3VA 4KJOA 2F3WA 3SK6A 4R8NA 1SYGA 1A2UA 1EZ8A 3C1EA 2F0OA 4H7BA 5M9OA 2PZTA 4EQOA 1AEXA 3VA5A 2EY5A 1SYEA 2NUCA 2EXZA 2SOBA 4ODGA 4OL7A 2F0NA 3DMUA 2EY1A 2O4XA 3BDCA 1SYCA 1EYDA 3NXWA 1U9RA 2RDFA 3MEHA 5CV8A 4K5XA 3PMFA 4QB4A 5CV7A 2F0KA 4KHVA 4K2LA 2PW7A 4KD4A 4HMIA 4DF7A 3RUZA 2F0JA 2PZWA 4ME5A 5CV5A 5I9PA 1KDAA 5IIFA 4KV6A 1STNA 5C4ZA 1II3A 2PZUA 4KY5A 5C4HA 1TQOA 5IGBA 1EZ6A 2KQ3A 3QOLA 1SYDA 5CV4A 3OMCA 3NUCA 2QDBA 1A3UA 2EY6A 2F0EA 2PYKA 3D4DA 3D4WA 4B9WA 2F0SA 4LAAA 1RKNA 5DEHA 3TP6A 2EYJA 2ENBA 5IOCA 2EYMA 3EVQA 5KYLA 5EKLA 1SYFA 3V2TA 2OEOA 3NQTA 5J39A 5KYIA 3P75A 1ENAA 4K6DA 1JORA 3OWFA 1IHZA 4N9TA 4QF4A 4YIJA 5IGFA 5IGCA 5CC4A 4RKBA 1JOOA 4KY7A 4EQPA 1SYBA 5CGKA 2F0QA 3TP7A 4J1MA 4ZQ3A 2WACA 3HEJA 3LX0A 3H6MA 3TP8A 4IALA 3OSOA 3SHLA 2F0FA 2SNSA 3C1FA 3SK8A 2OXPA 5KIXA 1A2TA 3S9WA 2KHSA 1SNDA 1STBA 5EGTA 1EY6A 5CV9A 2EY2A 1JOQA 3NK9A 4KY6A 5NUCA 1EQVA 1EY0A 4EVOA 1SNQA 5E3FA 3TMEA 3R3OA 4F7XA 5I6YA 5C3WA 4MIUA 5JAVA 4J6HA 5IGEA 4K5WA 4I65A 5C6AA 3SR1A 2EYOA 4N9PA 3D6CA 1EY4A 3MZ5A 3SK5A 5CV6A 5ISRA 4RKLA 1SNPA 2F0IA 4K2KA 4ZUIA 1F2ZA 3SXHA 5HGTA 1ENCA 5K5PA 1KDCA 4DU9A 3BDLA 5C5LA 5C3XA 2PW5A 5I9OA 2EYFA 4K8IA 3NP8A 2F0UA 4HMJA 1STGA 2OF1A 3NHHA 5E1FA 5HURA 5IGDA 4IUNA 3T13A 1TT2A 2F0PA 3E5SA 4ID6A 2F0VA 1NSNS 1EYAA 2PQEA 2M00A 4K8JA 4WRDA 4EQNA 5KEEA 5J22A 2SNMA 3P1HA 3T16A 1F2MA 3OMGA 1STAA 3EJIA 5KRUA 3ITPA 2RBMA 1EY5A 1SNMA 5IODA 1A3TA 1TR5A 5F2DA 2F0DA 1KABA 4NKLA 2F0HA 4K5VA 1F2YA 5C5MA 2EYLA 2F0GA 3EROA 3DHQA 4IZ8A 3MHBA 5DAUA 3SK4A 1NUCA 4KTAA 4QMGA 4NMZA 5CR3A 4S3SA 1SNCA 2EYHA 2EYPA 1EY7A 1JOKA 2LKVA 5IGGA 3D8GA 1STYA 1KAAA 4HTHA 4KD3A 4PMBA 5I6WA 4NDXA 4WORA 4DFAA 4NP5A 3QB3A 2HQEA 4B9XA 4F8MA 2F0MA 4KJNA 4DGZA 2F0LA 4K14A 3MVVA 2F3VA 3U9OA 1KDBA 4E6IA 5EKKA 1EY9A 3MXPA 4ZUJA 3TP5A 1EY8A
chains in the Genus database with same CATH superfamily
2IX0A 4C3JB 3VR5A 1PH3A 3NQIA 2UUCL 3S17B 3K8AA 2A6HC 1TXYA 3PV0A 2ZTEA 3EFXD 4A3IB 1RIPA 1PH9A 1KHIA 3ULJA 1UAPA 1UWVA 1GOZA 1WTOA 1A6XA 2XRSD 1VQ8A 1SYEA 2JQOA 4FXKC 3K5MA 3H0GH 2Q2UA 3DUZA 1DXMA 3MAQA 4DR4Q 2QGQA 4UPAA 4DV3L 2ZJQA 5CV5A 4OONA 3W1BA 3HOUB 3BS1A 1BF4A 1PV4A 5D3DA 3AEVA 3J7YW 4KK7A 2X6LA 4LAAA 5DEHA 3GTJH 4DAPA 3CD6A 1VMPA 2VUMB 3P75A 1ENAA 3URYA 3KLSX 3OWFA 5I4DA 4N9TA 4QF4A 3KF6B 4G4KA 3K81C 1QOHA 4TSSA 1F9PA 1X65A 1WCMH 4IUUA 4C3HG 2JA6G 1IXRA 3KF8A 1O7YA 4P73A 2OCEA 1EQVA 1I3QB 1A0IA 2OQKA 1WTHA 1DCZA 3FKIH 4K0KQ 4BY7B 1M4VA 4LFBL 4MN3A 3RLNA 1SNPA 2NVYB 4K2KA 4OWTB 3SXHA 1G51A 3FMCA 2IL8A 1NBWA 5C5LA 3G4SA 4JI6L 4FNFA 1PTOB 3GTKH 4NXML 1Q1EA 2QEJC 2WB1G 1V1PB 2F0PA 2F0VA 4HJ8A 3PO2B 3BVMA 4C3IB 4JVZA 3TQYA 2K75A 1VQPA 3OTOL 3S1QB 1G291 1KABA 2YU9H 1LTID 1PFMA 3NEMA 3PIOA 2CVRA 1LACA 3GO5A 1LUZA 3A7AB 1KAAA 4NXNQ 1PZKD 2E2HH 1VQEA 5E7NA 2FXQA 4O1NA 4UP8A 2F3VA 3RLOA 1TS3A 5EKKA 4ZUJA 1QNKA 4PZ7A 5CYUA 1S5ED 2I07B 1X55A 4M8AA 2KHJA 3ERQA 2NVQB 1CM9A 1RF2D 5KGUA 3CCMA 2VB3X 4C2MH 3VYSA 1SE8A 1VQAA 4QL5A 3HOXB 4LW1A 3KLWA 2KCCA 1Q8IA 1A2UA 1ZYRC 3RN5A 1K9MC 1YHAA 4F87A 4DV0L 1PTOF 1N9WA 2J7ZA 3MXNB 2E2JB 4IOAA 4JV5Q 3DMUA 2WAQG 5C0XI 4DUYL 2B8FA 5GAGC 1EYDA 4JI3L 1T9HA 3F1ZA 3VR6A 4QB4A 5EBCA 4DF7A 4JI1Q 3RUZA 4L5TA 1EUJA 2A5HA 4XXEA 3CU7A 1HZAA 2PNHA 4WFN3 1HTLD 1N8RC 1N32Q 2BH8A 3IRBA 4A3JB 5GROA 1M1KC 4AQYL 1VQNA 5IGCA 1GD7A 3H0GG 4IN3A 4JW0A 4HR7B 4HIDA 1LTGD 1IBKQ 3HEJA 2PPBC 2NYZD 3J81c 2F0FA 1VQBA 2UUCQ 3ER0A 1STBA 4CDEC 2ID0A 2X6GA 1I4HA 1RL2A 5NUCA 2ZTDA 1S72A 4DR7L 5DLQE 1PRTC 1F2ZA 2AWOA 3M4OH 3J80i 2KVMA 1Q12A 2CFMA 1WCMG 4DV3Q 2M00A 4QY7A 4ZYSA 2UUAL 3MXGA 4IUVA 1HXYD 3GP7A 3NSWA 2MHVA 4ZK9B 4POGA 2O5JC 1TWHB 2F0HA 3C3LA 2F0GA 3EROA 4A3KH 3FKIG 3NWSA 4CGYB 1HPCA 5FLMG 3L7ZC 4YCWA 3I72A 2JK8A 5IGGA 1KD1C 2IJ0A 2HQEA 4N8X1 1KDBA 4DAYB 1PYWD 2DY7A 1KRTA 1CUKA 1VMCA 1VF5C 2BE5D 2F0WA 2AMCB 2DUDA 1HR0Q 1X9NA 4BXXG 4PMCA 1I50H 3QOJA 4JI7Q 1FR3A 1UE1A 2A74C 3K7UC 2NN6H 2H1EA 3RZDH 5JOBA 5DNFA 4DNIA 1EIFA 3T1HQ 1GM5A 2F0TA 2EZVA 4LFBQ 3PCOB 3C1EA 3TRZA 4NXMQ 1VQ6A 1B2TA 3QWNA 1UE6A 1JWUD 2MPMA 4DR1Q 2QILA 2YYZA 1STEA 1GXDC 1CTMA 2PZWA 3U9SA 1SE2A 5TSSA 2D2CC 4YCVA 1I4RA 1Y1WH 1SEBD 3G6JB 1K28A 4IUTA 4PQXA 5KYLA 1K0SA 4JI8L 1FGBD 1M8AA 5C4XH 1J5EQ 1PYBA 2E2DC 2Z6BA 2QW7A 4NB3A 4RGMA 4JBMA 1PTOD 1SLJA 1CKMA 3D3RA 3HRZC 2JA7B 1EWCA 3IFTA 4DV4L 1XNRL 1A2TA 4JBJA 1K83H 1KTKA 1FL0A 3CCQA 4ZRZA 3M3YB 4J6HA 2WB1E 4QUFA 5C6AA 2XGTA 2EDGA 1LTSD 3MZ5A 3DM3A 4DV0Q 1SBBB 5EAYA 4DUYQ 1FYCA 2VXWA 4JI3Q 1LO5D 1U4PA 1L1OA 3RLFA 4KMUC 5KRUA 1PLFA 1VQOA 2B8GA 1R4PB 2B2WA 2D9UA 3NBHA 1V9PA 3NWTA 3DHQA 1KNAA 3SK4A 4BBSB 4GOPC 4AYBG 2EYHA 1LTRD 1STYA 2WP8J 1SJED 4IUQA 5ELOA 4BBRB 1TWGB 2R6GA 4LFCL 4X65Q 3I4NG 3QB3A 1NCVA 2DJFC 1EY8A 2MO0A 1UEBA 1YITA 3KK7A 1BKBA 1GJXA 2N88A 4CJ2C 3E9IA 3U4ZA 3STBD 3FVQA 2RKSA 3N6RA 4DK0A 4A3KG 2WAQE 1JICA 3AB9A 1HQRD 1SROA 3RZOH 3BZDB 3H09A 4RG1A 2XTIA 4EQOA 4O42A 4DK1A 4G7ZC 4R4TA 3R8BA 1TS2A 1SYCA 2R93H 3T56B 4CDDC 1HUMA 1V1QA 2X69A 5CV8A 3MEHA 4K5XA 5M5XB 2UUAQ 3HOVB 4HMIA 1TWCB 3I7FA 1HJPA 2NN6G 2Y0SG 1Q3LA 4B9WA 1HNWL 3DEPA 3GTMB 4CJ0B 4H02A 4Z9CB 5A35A 1Z9FA 1I4GA 2PI2A 1MSGA 1CQFA 1YJ9A 4JI0Q 2PNRC 3B6YA 4KY7A 2HCIA 3A5UA 3CRKC 1XPUA 5FO8B 1Q46A 1SNDA 1AFPA 1Y8PB 5CV9A 1Y1WG 1NY4A 2QCPX 3M4YA 1PHJA 2C9OA 1DYQA 2HT1A 1SNQA 3VYRA 4R4IA 5IGEA 4HIKA 4A3LH 5M3MH 2O2LD 5C4XG 2PI2E 3BVZA 1ENCA 4A3EG 2E74C 5C3XA 2C5CA 2F0UA 2OF1A 2D5DA 3S1RB 4ID6A 3U4VA 5KEEA 3I8ZA 1WTQA 1SRUA 4ZAIA 3CCLA 2EIFA 2BE5C 3J7AF 3HG9A 2K5QA 4IQZA 5LMUQ 3HOZH 3H91A 2EJFC 5JPMC 1SXTA 1F2YA 4RH6A 3PIP3 1B9MA 5DAUA 4JI8Q 4OXPA 4NMZA 5CR3A 4AIMA 5JJIA 3MWYW 4LNQA 1A62A 1CKNA 2BH2A 1F9SA 4IJLA 3SGIA 4U673 1D1IA 1S4ZA 1YIJA 1ASZA 4O0AA 3TEHB 4DV4Q 1OXSC 1KNEA 1T5XD 1HNZL 1EY9A 4A76A 3JAME 3TDQA 4FXDA 1H9RA 3RN2A 4DR4L 3DWAA 4QQBX 5EKIA 3GV3A 5COYA 3S1NH 2JP1A 4KJOA 1C9OA 3W2DA 3PSIA 4OGQC 4JI4Q 2ZXPA 2EY5A 1UEAB 1PTOC 5D65A 1R9TB 1HZBA 2XVSA 2B63B 1C0AA 3JC66 1LTBD 4KV6A 2UU9Q 1XMOL 3VA7A 1Q86C 2K03A 3CRLC 1NJIC 1I6HB 5GAHC 1RKNA 3TP6A 3S24A 4DV1L 4XT3B 3OPOA 3NQTA 3PUYA 5J39A 3S1MH 4LFCQ 1ONLA 1YJNA 2K33A 4NW2A 4K0KL 2Z6KA 1OXTA 3NBIA 3S14B 3V05A 5M5YH 2FMCA 1D5XC 1J8IA 2ZJRA 4GLAC 1TWFH 4GS3A 4LF6L 4IALA 4KN4C 3SHLA 1PYSB 2RHSB 4A3FB 4DR3L 1SE3A 2VB2X 3ND8A 3PIO3 3DM1A 4GNXA 1K8OA 3WWVA 1E24A 2E2IH 3GTGH 5IYCH 1MIUA 2B2YA 3SR1A 3JAMc 4JBKA 5KNCA 3PGZA 3I55A 4X3UA 5IYBH 4RA8A 4KHPQ 5E1FA 2AQ1B 4M1UB 3T13A 2ICIA 3SVMA 4C3HB 2JA6B 3NPPA 2BOSA 5C44B 4AYBE 2BA0A 2TSSA 4FF1A 2A6ED 3STBC 4R4CA 3W1GA 4L63B 3K5LA 4A3LG 3E0JA 2KECA 3BG3A 5M3MG 2L55A 4XQNA 2EYPA 2MQHA 1SFOH 1WTPA 4HTHA 4RWSC 3K0YA 4DAMA 1W3SA 3MFGA 1X3GA 4B08A 2WB1B 4F8MA 1MGSA 5LMNQ 3CCEA 2CCZA 2UUBL 1BBWA 1H9SA 3EA6A 3GTLH 2E76C 3HOZG 2D0PA 2AQ3B 1WTVA 3L3OC 4OHJA 2R92B 3CQZH 4DR6L 1B8AA 4Y7NB 2OTLA 3KFUA 4NPSA 4GKKQ 1JCKB 1N34L 4DUZQ 1G91A 1X3FA 1N32L 3WOEA 1AEXA 2EPBA 2IPKD 2Y0SE 4FDBA 2FFKB 2PQAB 3CF5A 1VQFA 1E2VA 3OOCA 1IL2A 1DOKA 4A3GH 4KD4A 5I9PA 4MHEA 4C3JH 4I7AA 2K01A 1VQLA 3MEFA 3K7AH 3KJPA 1A3UA 2F0EA 3D4DA 3CCSA 1DD2A 2DGYA 3UDGA 3CC4A 1J6QA 1Y14B 4FXGC 1P8LA 1CHPD 4FVMA 3NBHB 3OWEB 2K52A 1PH7A 3PIPA 2P5ZX 4U68A 4YIJA 2WAQB 1W2BA 1JOOA 1HNZQ 2IT1A 2LMCB 4J1MA 1MSHA 4LMQD 2E75C 2HCCA 1JMCA 3GTPB 1GHJA 4DR2L 3NELA 2VL6A 4CKCA 4IO9A 1AN8A 3PF4A 2RDHA 1IW7D 5IP9H 5HGTA 1BO0A 2VUMH 1U4LA 3H0GB 1STGA 5FLXE 4WRDA 1EYAA 1RD9D 1QUQA 1YNJD 3A55A 4RGNA 1XMOQ 5JJKA 5ELEA 3DXJC 2EQSA 1AH9A 4B3RL 2IW3A 1HR0L 3GTJB 1D8LA 1O7IA 5IYCG 2LXKA 4NKLA 2RHQB 4HSPA 3UE1A 4JI7L 4DV1Q 1I3QH 3NTKA 2NZ1D 1GUSA 1YI2A 4X6AH 4X3KA 3TBIB 5L37A 4YY3L 3T1HL 4L6TB 4BY7H 5IYBG 3J80L 5FLMH 2ASBA 4R8IA 2EOTA 1Y69U 3PQIA 2I46A 2LXJA 4LF6Q 1WCMB 2F0MA 1F9QA 1TVXA 4DR3Q 1VQIA 4N9PA 4ULLA 2AWNA 4GN5A 4DR1L 1NE3A 4BWGB 3PO2H 2K05A 2Z9HA 4BXXH 1A15A 3S15H 2N3SA 3S16H 1BBUA 1KXLA 2DN8A 3FKIB 3S1QH 1E1TA 3DWQA 1PZJD 3A8JE 2K5HA 3KLRA 2K50A 4R8NA 1S5DD 3J81E 2G5DA 3GTQB 3GTKB 2WFWA 2XN9C 1TY0A 3VA5A 1J5EL 1QJOA 4XQQA 2A1AA 1C7YA 4A3MH 3PUZA 3PO3B 2QDLA 4DA2A 2RDGA 1IKLA 1KDAA 4LWCA 5C4ZA 3UDFA 2PZUA 1Y8NB 2YU9B 3H3VI 3QOLA 1SAPA 4YCUA 3CCVA 3P7JA 3D4WA 3I56A 3E0EA 3KUPA 5FLXc 5GAEC 3CMAA 4FYDA 5CBAE 5FOBB 3KBXA 2Z1CA 1X3EA 2R7FA 2NTSA 1KLGD 4MNOA 1VQKA 5EKLA 3AU7A 3HOXH 3CCRA 1B50A 2E2HB 3CP0A 1JWMD 1YJWA 5CC4A 5ELFA 2UUBQ 3IAYA 4CHTB 1CKNB 2RA4A 4A3GG 2WACA 2AKWB 2KOLA 3K80C 1Q8KA 4C3JG 2CHBD 4C2MB 2KHSA 3K5NA 2WKDA 2N78A 2MGSA 1AP0A 2A6EC 4QIWB 4IOCA 5EJWA 1EY0A 4QCLA 4DR6Q 4UY8C 2CWAA 2B2TC 1N34Q 3JAMi 1MD2D 1TKWB 3T1YQ 1U4MA 2F03A 4ZUIA 3D0FA 1KDCA 2A68D 2D62A 4DU9A 4A3CH 3AYHB 3GTOH 2ZTCA 3ULLA 2NBFA 4K8JA 4X65L 2H4OA 1F2MA 1XXGA 3QJYA 4IFDH 1QB5D 2KENA 1BNZA 3A8KE 3W5OA 1Z7TA 4Q0FA 3CPWA 4LF7L 3U50C 4KI0A 5IP9G 4HJAA 1I4QA 4GLVB 4YHHQ 2FINB 2LKVA 1YBYA 4CJ1B 2VUMG 5BN4A 3D8GA 4PMBA 4NP5A 1L2FA 2I5HA 2UXBL 3BZCA 3I4NH 5FO7B 2ATWA 4DR2Q 1LLRD 2TMPA 2RF4A 4DV7L 5J1ZA 1ZXTA 4DK6C 4YWLA 1Z6HA 4PNYA 5FJ8H 5M5WH 2JA8H 4AYBB 4BY7G 3M4OB 4POFA 3QO2A 2XWJB 5M3FB 3K0XA 4OIKA 1IBMQ 4JI0L 2Z0SA 1CZWA 1TU2B 1VCIA 3NE5B 2B39A 2PW7A 2QA4A 3PO2G 2F0JA 2AUKA 2VQFQ 4B3RQ 1TQOA 1SYDA 2Z8LA 4A3KB 3A7LA 1BCPB 4RCOA 2N8NA 3FRPB 4YY3Q 3EVQA 2KCTA 1IW7C 4X64Q 4B3SL 1YHQA 1L0XB 1UUPA 3Q8DA 4A3MG 1SYBA 1VQ4A 2HIXA 2HUGA 5JEAH 3M7GA 5BR8Q 4GOPA 1YNJC 4HN7A 2Y0SB 1QCBD 3RZDB 1E2ZA 4UDUC 5KNDA 3TZDA 4EVOA 5LMUL 1J9OA 3D4RA 3R3OA 5JAVA 1JE4A 4KKTA 4A75A 4HIOA 2EYOA 3HOXG 4V190 1EIYB 4UAIA 1L0WA 4MTKA 5LL6X 2F0IA 1PH6A 1PH2A 3CC7A 4LK1C 1V8QA 3RD4A 2PW5A 2FHTA 1AE2A 2XRQD 1BR9A 3NHHA 4A3EH 1QWYA 3J81L 3HKSA 3KOJA 4X62Q 1NSNS 3EN2A 2SNMA 2KHIA 2JA7H 1G2SA 2K5WA 1EEID 2JXMB 4ME3A 1BCPF 3M3YH 5C5MA 4H44C 1E22A 4IZ8A 1JJ2A 5C4XB 5C4JH 3I4MB 1OO9B 2CH4W 4A3CG 4FP5D 5C3EB 1F2LA 1Y1VH 4QJFA 4JI4L 4B9XA 1DONA 3AQQA 4DXFA 3UDXA 1Q81C 3R93A 2DNEA 1I94Q 1K83B 4BY1B 4IFDG 4P75A 5E4WC 2ZT9C 3W3AA 2MJ8A 3BYYB 2UU9L 1AW7A 1L0YB 2IHFA 2E5LQ 2JA5H 2QF7A 4XT1B 4BBSH 1CSQA 2F0OA 1IYUA 1RHPA 2F4VL 3I70A 4APVA 1WOCA 5JVH3 3BDCA 4BBRH 1TWGH 3HGBA 1OXVA 2EVBA 1D5MC 3MTSA 5CV7A 1JC7A 3F8TA 2KQ3A 2R3ZA 5CV4A 3EQLC 3OMCA 3NUCA 3T16A 4LF7Q 5KNBA 1ET9A 5FJ8G 4LUZA 2JA8G 2F3IA 3KF8B 1HZCA 2EYJA 5E4XA 2JN4A 2EYMA 2A69D 4O2DA 2HHHL 4IJHA 4Q5VA 4YWKA 2OEOA 1DZ1A 1NTGA 1IHZA 2V1CC 1SMYD 2A68C 4FO2A 4R1JA 4JK1C 2UXBQ 2LY7A 1I6VC 4KHPL 1VQ9A 4C1NI 3LX0A 5J22A 4PG3A 1PMRA 2SNSA 2OXPA 4DV7Q 1XPOA 3FHWA 3BDOA 1EQTA 3RZOB 1WI5A 3CKIB 1K3BC 4BS9A 4A3DB 1E0BA 3OIPA 4LFAQ 3E3XA 4HIMA 4BA2I 1HH2P 5K5PA 4L5SA 1Y8OB 1FD7D 2R93B 3FPUB 4OX9L 4R4QA 2J0TD 4YWMA 5JEAG 4X66L 3HOYH 4DXGA 2HQLA 1IZ6A 1X54A 5EPLA 3J81i 3OMGA 5LMNL 4A4IA 4DV2Q 3ITPA 2RBMA 5IODA 3I90A 3X3MA 2RCNA 3PF5A 1A8VA 5FK9C 5EPJA 3S2DH 1V1PA 4B3SQ 3IL8A 4LF9L 1EY7A 5AJ3L 4GKKL 1SMXA 1MJCA 4A93B 3GDEA 4DUZL 5ELDA 1EYGA 1BQQT 1EWHA 3MVVA 1KQSA 2JA7G 2XNAC 5GQOA 1LM0A 3OYYA 1SNOA 1XPRA 3AFPA 3GQBA 1YNND 4EGVA 3EBEA 2K7VA 5M3MB 4KLKA 1GO3E 1VQJA 3A5ZB 3PUXA 2NVXH 1BCPD 4V0BA 1HA5A 3SK6A 4L5RC 4L8JA 4GZYC 1EZ8A 2QKIC 1I4PA 1Y1VG 3OIQA 3TREA 4F88A 4ODGA 4OL7A 5IYDH 2B2VC 4FF2A 5LHY1 2RDFA 1HFGA 3PMFA 3BJUA 1MBYA 1B1ZA 1B4OA 1HQMC 1STNA 1EU3A 1I5FA 3HOWB 1PXUA 1MKHA 1V43A 2EY6A 2JA5G 2Q2HA 1UE7A 3MXNA 4BBSG 1B3AA 3QG1A 4JI2L 1EWIA 2KEEA 5CORA 5KYIA 2OWOA 5I2XA 2UXDL 4A3BB 1ICWA 4BBRG 1CKOA 1E1OA 2NWGA 4HJ7A 2SDFA 2ZJPA 4EQPA 2M9VA 3TP7A 4LF8Q 4IFDJ 2HIVA 2FMMA 1EOTA 1VDZA 2B63H 5CBEE 5EGTA 1EY6A 2VZAA 2JEAI 2KBNA 3VR2A 2NVTB 3S1NB 2XWBB 5C3WA 1E7ZA 4HEDA 4JOIC 3K59A 4RGOS 3CCUA 2OTJA 3D6CA 2F4VQ 2IWHA 1DGSA 4OO1H 4OWWB 3BDLA 1A63A 4ALPA 4IUNA 1ILPA 1F77A 3P20A 3BZKA 4DAVA 1PZID 1CZGA 1TR5A 1HA6A 1PH8A 3S2HH 3E6ZX 3WOFA 3G48A 1O80A 2HHHQ 1NUCA 3S1MB 1EFID 2CWPA 2WV6D 5M5YB 5I6WA 2H5XA 1RJTA 1GUNA 2K1BA 1TWFB 3HOYG 3T51B 4E6IA 2K5VA 3BYTB 3U9OA 1EFWA 1TWAB 3A8IE 3D6WA 2Q8RE 3O13A 1OTCA 3FP9A 5C44H 4IPHA 2YV5A 4J15A 3CW2C 3IKJA 2JEBI 3VYUA 3HFZB 2B2UC 1Z47A 2PMZE 3M85A 2QEXA 1ML0D 2V4DA 3HS0C 1CFMA 2A69C 1VS0A 3KYHC 1AE3A 4DAYA 3V96A 4OX9Q 1W6KA 2SOBA 1SMYC 3G7LA 4GN4B 4X66Q 5T1IA 2CH4A 2O4XA 5JEAJ 3L2PA 1YZ6A 3NXWA 2RCFA 1PA6A 4HSVA 2GN5A 5IP7H 1BVSA 4K2LA 4HJ9A 2AHOB 3T4AC 5IIFA 2ZXRA 3A0JA 5IGBA 1G2TA 3A56A 4WJ4A 3CPFA 2CQOA 4P72A 1OXXK 2ES2A 1SFOB 2EJMA 2XSCA 4LF9Q 2R92H 3X3NA 3ZYYX 5AJ3Q 1K8GA 3QR8A 5IYDG 1BBXC 4DR5L 5IGFA 1SN8A 1GUOA 3T1YL 3ICEA 5EPKA 4ZQ3A 3TP8A 4LF4L 2R7ZH 4K6LA 3VDYA 4EQ5A 1JOQA 1L1OB 1C4QA 1FJGL 1TS5A 3CQZB 4FF3A 2BDOA 3I4OA 3DEOA 3S17H 1KIXA 1LYLA 1EEFD 2MNAA 1E3PA 4A3IH 1U4RA 2K28A 5ISRA 4XIGS 3GD7A 2VQEQ 3UI2A 2MUYA 2IHEA 2RSNA 4YHHL 4IFDI 1HNXL 5C0XJ 4A3GB 1W6JA 4CDFC 2B63G 3K7AB 1S40A 1XJVA 3EJIA 1Q90A 3GTPH 5F2DA 1YNNC 5BN3A 3CXCA 3TS0A 2CQAA 1ZKOA 2G9HD 4XDXA 2N49A 3JAML 1QZGA 3HOUH 1IYJB 4MTNA 4UHVA 2VNUD 4JI2Q 4KTAA 1WYDA 2IX1A 1BCPC 4OO1G 2HDMA 2ZM6Q 2UXDQ 4S3SA 2VS1A 3DWPA 1P16A 3IFDA 4PMWA 5IY0A 4HAEA 4K14A 4DK3C 4JYAL 1GHKA 4A3FG 1IBML 3HZXA 1X6OA 4KHZA 5JJLA 1JR0D 2VQFL 1PDQA 1CI3M 1STHA 2A8VA 1PH1A 1A3VA 1N36L 5FKAC 1WTXA 2KJXA 1BOSA 2NZHA 5ELBA 2NVYH 4MZ9A 4R9WA 4X64L 2R61A 1PTOH 1U9RA 2B2TA 2NTTA 2F0KA 3NTIA 2NN6I 1K8AC 5C44G 1II3A 1O7LA 3I3CA 1CQVA 5BR8L 3J81j 3J7ZC 3DLLA 4C3IH 1HRJA 1H9JA 3VR4A 3CHBD 2J4XA 1SR3A 3H3VC 1EOVA 3V2TA 2LFNA 3G71A 4K6DA 1IBLQ 3OW7A 3GTQH 1CT1D 1O78A 2L12A 4RKBA 4JCVE 3HKZG 4X3TA 3MC0B 1LV9A 5IP7G 1XYIA 4RMFA 2RVLA 1EQRA 4DV5L 4UP7A 4XYQA 3PO3H 1LT6D 3S9WA 4X62L 3S15B 3S16B 1MJEA 3NK9A 2NVQH 3TMEA 2R92G 4L5QA 2GVAA 1DJRD 1EY4A 3K57A 4JI5Q 2CW0D 4K8IA 4HMJA 1WD0A 4DNTB 4A3MB 1ZEQX 2Q8IB 2E2JH 4IPCA 3E5SA 2G9DA 4WJWA 4PV1C 1CA6A 2R7ZG 2O5IC 1STAA 1I94L 4DPGA 4TKOB 1SNMA 2Q2IA 5J3BA 1A3TA 1QE6A 4B3TL 1SDFA 1HUNA 2RSOA 4GKJL 1B3QA 5LL6S 4A3IG 2XIWA 1WFQA 3KDFA 5JPNC 3H15A 2E5LL 4DR5Q 4RAUC 2IY5B 1YVCA 4DFAA 4A3JH 1FNVA 1NAPA 1O7ZA 4OEMB 4LF4Q 5ELCA 4UP9A 3MXPA 3TP5A 4C1NK 5CMDA 2K32A 1FJGQ 3HOUG 2PO4A 1GVPA 1NR2A 1ET6A 1QG7A 3CMEA 2WKCA 4ZKBB 1EYCA 4J8QA 5EQ0A 5G3LF 1NMGA 1X32A 1KLUD 3M4QA 5M9OA 3T53B 2MFIA 3GTOB 2EXZA 1HNXQ 3M7NA 1JJCB 1JQYD 2EY1A 2OQ0A 4DKAC 1B53A 4LF5L 3NENA 4OELB 4CKBA 1HFNA 3RNUA 2B29A 2QDBA 1EU4A 3KBGA 1LTAD 1XX8A 4JC0A 3ND9A 3SE0A 5IOCA 1TWHH 1IKMA 1B9NA 4GNXB 3K6OA 3TN2A 3R2IA 5A2QE 1RTOA 4TVAB 5IWAL 1KC8C 3L0OA 2PMZB 2IX3A 4LFAL 4IPGA 4RFBA 3EIVA 3I4NB 1HR0W 5M3FH 4JYAQ 2K04A 4EX5A 5FLXL 4C3IG 1S5CD 2EY2A 2GVBA 4KY6A 1FNWA 5M5WB 4F7XA 2JA8B 1N36Q 4DV2L 2DJGC 4I65A 1CHQD 1D5ZC 2KCNA 5FO9B 4JBWA 3SK5A 2M2LA 5CV6A 3MXUA 3NP8A 1H95A 4P71A 2EXDA 2K5DA 1H9KA 4N8FA 4ZCKA 4CKEA 3PO3G 3WDNA 1QVCA 1I50B 1JE5A 2EE1A 1EY5A 3HP3A 3UE0A 4HJ5A 1H9SB 1ESRA 3VYTA 4IPDA 3TZUA 2L4NA 4JI6Q 1JB3A 1SNCA 4AH6A 5D3IB 4XYOA 4XTCS 3F2DA 1FGUA 4KJNA 4DV5Q 2F0LA 4PZ6A 1V1OA 2BDNA 5AFWA 3OW2A 1AZPA 2LSSA 4B3ML 3OTOQ 3RR5A 3CCJA 4TRDA 1QNUA 2B3GA 4XQJA 3F2CA 1DM0B 1Y1WB 2K6AA 1HHVA 4ABNA 1UE5A 1OXUA 3ULPA 1RODA 3H3VH 2GA4B 2A19A 3F2BA 4RHSA 2EJGC 2K5NA 3I4MH 4A3JG 3A54A 4A3EB 5C3EH 4BA1I 2I5LX 1BUVT 3J7AV 1IYVA 3UDIA 1PH5A 1B44D 4BY1H 4ME5A 5C0XH 1TS4A 1WTWA 4B3TQ 1DOMA 1XTCD 2K14A 4DV6L 4LF8L 1F9RA 2F4IA 2I5MX 3FDTA 4GKJQ 1X56A 3BU2A 4FF4A 3LWUA 2KCMA 5C4JB 3HKZE 1RDPD 2ENBA 1D2BA 1GUWA 1SSOA 3CAMA 4ZLTF 1LT4D 2PQAA 1VQDA 1Y1VB 3AFQA 4KN7C 3FEWX 2CW0C 5G3LD 2KA7A 1VQ7A 1KRSA 3PUVA 1T5EA 2F0QA 1DOLA 2YTYA 3KJOA 3OSOA 5KIXA 3M4PA 4CBVA 4X3SA 1U5KA 2JA5B 2CKZB 4OO1I 1QUQB 4MIUA 1KAWA 2L5TA 4GLXA 4AQYQ 4LUOA 5IGDA 5M3FG 1B70B 4QGUA 3VR3A 1PFSA 3MFYA 1TT2A 4LF5Q 5EBDA 2PQEA 1G6PA 2KEDA 5ELNA 3AMUA 2L9HA 4R4OA 5M5XH 1JJGA 2UXCL 3LWEA 3HOVH 2N55A 1TWCH 3J7A5 4DR7Q 2F0DA 2B2VA 2K4KA 1XMQL 4A3DH 1NNXA 3I73A 2I0QA 3KF6A 5IWAQ 2HDLA 1IL8A 1JOKA 3GTMH 1YHBA 4WORA 1QILA 2BA1A 2E8GA 2Z4IA 4JPBW 4WJ3M 5A2QL 1LT5D 4DGZA 2L1BA 4TQUS 4G7HC 3BVGA 3G6EA 1C48A 1RTNA 4IUPA 5IT9E 5GADC 2VY3A 3H94A 3L9AX 4KKSA 1KL9A 3Q22A 3CC2A 4G57A 1L1OC 1PRTB 5D14A 2NB0A 2F3WA 1N33L 1U0LA 2PZTA 2HD3A 3Q23A 3U58A 3C46A 1PVOA 2F0NA 2B2WC 3HOYB 4OWXB 4A93H 2F1MA 2JJQA 4JOIA 1CK1A 1PFBA 1ICFB 1WVLA 3S1RH 4KHVA 1Q7YC 1LABA 2L0CA 4KY5A 5C4HA 1EZ6A 3FPPA 1EIGA 2RQXA 4PZ8A 2JE6I 2PYKA 2A6HD 1YNXA 3OHXC 3S2DB 3GV6A 3I4MG 1SYFA 1LTLA 5C3EG 1QVFA 1EL0A 1XNQL 1JORA 1K73C 1D1KA 1VF7A 2A73B 3C2PA 1S3OA 1EIHA 3KDFB 3PUWA 2VQEL 2MO1A 4B3MQ 4BY1G 5C0XG 1X3PA 3H6MA 3C1FA 3HOZB 4HCSA 1BXTA 1FNUA 2L15A 4KKUA 4LUVA 2NVXB 5E3FA 3HOWH 3R2TA 1PRTF 3Q24A 3K58A 1K0RA 4H0LC 2MP1A 2LS01 1R4QB 5IT9c 4RKLA 5IE8A 1S5FD 4G7OC 5JVG3 2L11A 1C8CA 5I9OA 2ZM6L 2EYFA 3F2UA 1FVIA 4I7ZC 2B2UA 4A3BH 5HY6A 1XNRQ 1S5BD 4EQNA 2R7DA 1GKHA 5K36H 1TIID 4DV6Q 1JT8A 4ZKCB 1HTPA 2YTXA 1R9TH 1WTRA 1XTDA 1LT3D 4IURA 3LNNA 1G6ZA 1ILQA 2EYLA 2NVTH 3MHBA 4QMGA 1I6HH 3LGJA 1Q1BA 3SDZA 5JJZA 4HCEA 1JB7A 1PH4A 3TS2A 1HCZA 2BCOA 4KD3A 3KLSA 2D0OA 4NDXA 1QVGA 4QIWE 1YEZA 2ALYB 3M9BA 3S14H 1I4XA 2F52A 1E2WA 3HOVG 4DN4M 1BDOA 2DY8A 2KUMA 4ILWA 4A3FH 1MHWC 4LJZC 3J80E 4A3DG 2JA9A 3I91A 4JG2A 1VQGA 3A74A 1SYGA 4H7BA 1MI2A 1PFNA 1X3QA 1EQQA 4H13C 2OT2A 2R93G 2DNCA 2NUCA 5H1SE 5I2YA 3N52A 3ONAB 5BN5A 1ESFA 4RHRA 1QZHA 1IBLL 1WJJA 3D31A 4OIJA 3K5OA 2UXCQ 1ENFA 1TWAH 3RMHA 2AUJD 4C3HH 3S2HB 2JA6H 2ZXOA 1VQMA 2E2IB 3I2ZA 2PCFB 1G8ZD 1VQCA 3GTGB 2Z4HA 1XMQQ 1VQHA 4GOPB 2F0SA 2AQ2B 3ERSX 3QIAA 1ZYRD 4RGTA 1K3RA 1NMFA 1GUTA 1GUGA 2ICEC 5LMNW 4A93G 4NXNL 1RCVD 4JI5L 5CGKA 1WD1A 1SE4A 2C35B 1Q82C 2FJ2A 1B7YB 3SK8A 4QUCA 4P2CB 2Q8TA 1AZQA 4DNRB 2JSOA 2YTVA 3ZJYC 1HNWQ 3SEBA 3E9HA 4P74A 1JWSD 5DM73 5I6YA 1CA5A 5IT9L 5HGQA 1N33Q 4K5WA 1VQ5A 3Q0AA 4Y7NH 1CSPA 3HKZB 1UNSA 3I4LA 5HURA 3J80c 4JV5L 1XWEA 1D7QA 3GTLB 4Y52H 3P1HA 1TY2A 3Q6SA 3NTHA 2NZOA 4JI1L 1M90C 3HOWG 2Z6KC 4C56C 2Q2TA 5DM63 4RCNA 4K5VA 1ASYA 4CDCC 2VW9A 1H9MA 2WINB 2JYOA 2WIIB 3TSSA 4GN3B 1XNQQ 1PRTD 3MA2B 1HZ9A 1NR4A 1D6EC 4GNXC 4A3BG 5K36G 2SEBD 2R7ZB 1K8MA 5T1GA 1LTTD 1SJHD 2B2YC 1IBKL
chains in the Genus database with same CATH topology
2IX0A 4C3JB 3VR5A 3NQIA 3S17B 2A6HC 3PV0A 3EFXD 4A3IB 1UAPA 1WTOA 1GOZA 1A6XA 2XRSD 1SYEA 4FXKC 3K5MA 3DUZA 1DXMA 3MAQA 5CV5A 3HOUB 3BS1A 1BF4A 5D3DA 3J7YW 4KK7A 2X6LA 4LAAA 5DEHA 4DAPA 1VMPA 2VUMB 3P75A 1ENAA 3URYA 3KLSX 3OWFA 5I4DA 4N9TA 4QF4A 4G4KA 1QOHA 4TSSA 1F9PA 4IUUA 4C3HG 3KF8A 1O7YA 1EQVA 1I3QB 1DCZA 4BY7B 1M4VA 4MN3A 1SNPA 2NVYB 4K2KA 3SXHA 3FMCA 2IL8A 5C5LA 4FNFA 1PTOB 1Q1EA 2QEJC 1V1PB 2F0PA 2F0VA 3PO2B 3BVMA 4C3IB 3S1QB 1G291 1KABA 1LTID 1PFMA 2CVRA 1LACA 3GO5A 3A7AB 1KAAA 1PZKD 4O1NA 2F3VA 1TS3A 5EKKA 4ZUJA 1QNKA 5CYUA 1S5ED 2I07B 4M8AA 3ERQA 2NVQB 1CM9A 1RF2D 5KGUA 2VB3X 3VYSA 3HOXB 2KCCA 1Q8IA 1A2UA 1ZYRC 4F87A 1PTOF 2J7ZA 2E2JB 3DMUA 5C0XI 2B8FA 1EYDA 3VR6A 4QB4A 5EBCA 4DF7A 3RUZA 2A5HA 4XXEA 3CU7A 4WFN3 1HTLD 4A3JB 5IGCA 4IN3A 4HR7B 1LTGD 3HEJA 2PPBC 2NYZD 2F0FA 1STBA 2ID0A 2X6GA 1I4HA 5NUCA 1PRTC 1F2ZA 2AWOA 2KVMA 1Q12A 2M00A 4ZYSA 3MXGA 4IUVA 1HXYD 3GP7A 3NSWA 2MHVA 4ZK9B 2O5JC 1TWHB 2F0HA 3C3LA 2F0GA 3EROA 3NWSA 4CGYB 1HPCA 3L7ZC 3I72A 5IGGA 2IJ0A 2HQEA 1KDBA 1PYWD 2DY7A 1VMCA 2BE5D 1VF5C 1K8OA 2F0WA 4PMCA 3QOJA 1FR3A 2A74C 2NN6H 2H1EA 5JOBA 5DNFA 2F0TA 2EZVA 3C1EA 1B2TA 3QWNA 1JWUD 2MPMA 2QILA 2YYZA 1STEA 1GXDC 1CTMA 2PZWA 3U9SA 5TSSA 1SE2A 2D2CC 1I4RA 1SEBD 3G6JB 4IUTA 4PQXA 5KYLA 1FGBD 1M8AA 2E2DC 4RGMA 1PTOD 3D3RA 3HRZC 2JA7B 1EWCA 3IFTA 1A2TA 1KTKA 4ZRZA 3M3YB 4J6HA 4QUFA 5C6AA 2EDGA 1LTSD 3MZ5A 1SBBB 1FYCA 2VXWA 1LO5D 1U4PA 3RLFA 4KMUC 5KRUA 1PLFA 2B8GA 1R4PB 2B2WA 2D9UA 3NBHA 3NWTA 3DHQA 1KNAA 3SK4A 4BBSB 2EYHA 1LTRD 1STYA 2WP8J 1SJED 4IUQA 4BBRB 1TWGB 2R6GA 3QB3A 1NCVA 1EY8A 3KK7A 1GJXA 2N88A 4CJ2C 3FVQA 2RKSA 3N6RA 4DK0A 1JICA 3AB9A 1HQRD 3BZDB 3H09A 4EQOA 4O42A 4DK1A 4G7ZC 3R8BA 1TS2A 1SYCA 3T56B 1HUMA 2X69A 5CV8A 3MEHA 4K5XA 5M5XB 3HOVB 4HMIA 1TWCB 2NN6G 1Q3LA 4B9WA 3DEPA 3GTMB 4CJ0B 4Z9CB 5A35A 1I4GA 1MSGA 1CQFA 2PNRC 4KY7A 2HCIA 3CRKC 5FO8B 1SNDA 1AFPA 1Y8PB 5CV9A 2QCPX 3M4YA 2C9OA 1DYQA 1SNQA 3VYRA 5IGEA 2O2LD 3BVZA 1ENCA 2E74C 5C3XA 2C5CA 2F0UA 2OF1A 2D5DA 3S1RB 4ID6A 5KEEA 3I8ZA 1WTQA 4ZAIA 2BE5C 3J7AF 3HG9A 2K5QA 4IQZA 3H91A 2EJFC 5JPMC 1SXTA 1F2YA 4RH6A 3PIP3 1B9MA 5DAUA 4NMZA 5CR3A 3MWYW 1F9SA 4U673 1D1IA 1S4ZA 1T5XD 1KNEA 1OXSC 1EY9A 3JAME 3TDQA 4FXDA 1H9RA 3DWAA 5EKIA 3GV3A 5COYA 2JP1A 4KJOA 3W2DA 4OGQC 2ZXPA 2EY5A 1UEAB 1PTOC 5D65A 1R9TB 2XVSA 2B63B 1LTBD 4KV6A 3VA7A 2K03A 3CRLC 1I6HB 1RKNA 3TP6A 4XT3B 3OPOA 3NQTA 3PUYA 5J39A 1ONLA 2K33A 4NW2A 1OXTA 3NBIA 3S14B 3V05A 2FMCA 1D5XC 1J8IA 4IALA 4KN4C 3SHLA 4A3FB 1SE3A 2VB2X 3ND8A 3PIO3 3DM1A 2B2YA 3SR1A 5KNCA 4X3UA 4RA8A 5E1FA 2AQ1B 4M1UB 3T13A 2ICIA 3SVMA 4C3HB 2JA6B 3NPPA 2BOSA 5C44B 2BA0A 2TSSA 4FF1A 2A6ED 4L63B 3K5LA 3E0JA 2KECA 3BG3A 2L55A 4XQNA 2EYPA 1WTPA 4HTHA 4RWSC 3K0YA 3MFGA 4B08A 2WB1B 4F8MA 1MGSA 1H9SA 3EA6A 2E76C 2AQ3B 1WTVA 3L3OC 4OHJA 2R92B 4Y7NB 1JCKB 1G91A 3WOEA 1AEXA 2EPBA 2IPKD 2FFKB 1E2VA 3OOCA 1DOKA 4KD4A 5I9PA 4MHEA 2K01A 1A3UA 2F0EA 3D4DA 1DD2A 4FXGC 1CHPD 4FVMA 3OWEB 4U68A 4YIJA 2WAQB 1JOOA 2IT1A 2LMCB 4J1MA 1MSHA 4LMQD 2E75C 2HCCA 3GTPB 1GHJA 4CKCA 1AN8A 2RDHA 1IW7D 5HGTA 1BO0A 1U4LA 3H0GB 1STGA 5FLXE 4WRDA 1EYAA 1RD9D 1YNJD 3A55A 4RGNA 5ELEA 3DXJC 2IW3A 3GTJB 4NKLA 4HSPA 3NTKA 2NZ1D 1GUSA 4X3KA 3TBIB 4L6TB 3J80L 4R8IA 2EOTA 1Y69U 2I46A 1WCMB 2F0MA 1F9QA 1TVXA 4N9PA 4ULLA 2AWNA 4BWGB 2K05A 1A15A 2DN8A 3FKIB 3DWQA 1PZJD 3A8JE 3KLRA 4R8NA 1S5DD 3J81E 3GTQB 3GTKB 2XN9C 1TY0A 3VA5A 1QJOA 4XQQA 3PUZA 3PO3B 4DA2A 2RDGA 1IKLA 1KDAA 5C4ZA 2PZUA 1Y8NB 2YU9B 3QOLA 1SAPA 3P7JA 3D4WA 3KUPA 4FYDA 5CBAE 5FOBB 3KBXA 2Z1CA 2NTSA 1KLGD 1B50A 5EKLA 3AU7A 2E2HB 1JWMD 5CC4A 5ELFA 3IAYA 4CHTB 2RA4A 2WACA 2KOLA 4C3JG 2CHBD 4C2MB 2KHSA 3K5NA 2WKDA 2MGSA 1AP0A 2A6EC 4QIWB 5EJWA 1EY0A 4QCLA 2B2TC 1MD2D 1TKWB 2F03A 1U4MA 4ZUIA 1KDCA 2A68D 2D62A 4DU9A 2NBFA 4K8JA 2H4OA 1F2MA 1XXGA 3QJYA 4IFDH 1QB5D 1BNZA 3A8KE 1Z7TA 4Q0FA 4KI0A 1I4QA 2FINB 2LKVA 4CJ1B 5BN4A 3D8GA 4PMBA 4NP5A 5FO7B 1LLRD 2TMPA 5J1ZA 1ZXTA 1Z6HA 4PNYA 4AYBB 3M4OB 3QO2A 2XWJB 5M3FB 4OIKA 1CZWA 1TU2B 1VCIA 2PW7A 2B39A 3NE5B 2F0JA 2AUKA 1TQOA 1SYDA 2Z8LA 4A3KB 3A7LA 1BCPB 4RCOA 3FRPB 3EVQA 1IW7C 1L0XB 1UUPA 1SYBA 2HUGA 5JEAH 3M7GA 1YNJC 4HN7A 2Y0SB 1QCBD 3RZDB 1E2ZA 4UDUC 5KNDA 3TZDA 4EVOA 1J9OA 3D4RA 3R3OA 5JAVA 1JE4A 4KKTA 2EYOA 4V190 4UAIA 5LL6X 2F0IA 4LK1C 1V8QA 3RD4A 2PW5A 2FHTA 2XRQD 1BR9A 3NHHA 1QWYA 3J81L 1NSNS 2SNMA 1G2SA 2K5WA 1EEID 2JXMB 1BCPF 5C5MA 4H44C 4IZ8A 5C4XB 3I4MB 1OO9B 4FP5D 5C3EB 1F2LA 4B9XA 1DONA 4DXFA 3R93A 2DNEA 4BY1B 1K83B 4IFDG 5E4WC 2ZT9C 3W3AA 2MJ8A 3BYYB 1AW7A 1L0YB 2QF7A 4XT1B 2F0OA 1IYUA 1RHPA 3I70A 5JVH3 3BDCA 3HGBA 1OXVA 2EVBA 1D5MC 3MTSA 5CV7A 1JC7A 2KQ3A 2R3ZA 5CV4A 3EQLC 3OMCA 3NUCA 3T16A 5KNBA 1ET9A 2EYJA 5E4XA 2EYMA 2A69D 4Q5VA 2OEOA 1DZ1A 1IHZA 1SMYD 2A68C 4FO2A 4JK1C 2LY7A 1I6VC 4C1NI 3LX0A 5J22A 1PMRA 2SNSA 2OXPA 3BDOA 1EQTA 3RZOB 3CKIB 4A3DB 4BS9A 1E0BA 3OIPA 4BA2I 5K5PA 2R93B 1Y8OB 1FD7D 3FPUB 2J0TD 5JEAG 4DXGA 5EPLA 3OMGA 3ITPA 2RBMA 5IODA 3I90A 3X3MA 5FK9C 5EPJA 1V1PA 3IL8A 1EY7A 4A93B 5ELDA 1BQQT 1EWHA 3MVVA 2XNAC 1SNOA 3GQBA 1YNND 4EGVA 2K7VA 5M3MB 3PUXA 1BCPD 4V0BA 1HA5A 3SK6A 4L8JA 4GZYC 1EZ8A 2QKIC 1I4PA 3OIQA 4F88A 4ODGA 4OL7A 2B2VC 4FF2A 5LHY1 2RDFA 1HFGA 3PMFA 1MBYA 1B1ZA 1B4OA 1HQMC 1STNA 1EU3A 3HOWB 1PXUA 1V43A 2EY6A 3MXNA 1B3AA 3QG1A 2KEEA 5CORA 5KYIA 5I2XA 4A3BB 1ICWA 2NWGA 2SDFA 4EQPA 2M9VA 3TP7A 4IFDJ 2FMMA 1EOTA 1VDZA 5CBEE 5EGTA 1EY6A 2JEAI 3VR2A 2NVTB 3S1NB 2XWBB 5C3WA 4HEDA 3K59A 4RGOS 3D6CA 2IWHA 4OO1H 3BDLA 1ILPA 4IUNA 1F77A 3P20A 4DAVA 1PZID 1CZGA 1TR5A 1HA6A 3E6ZX 3WOFA 1O80A 1NUCA 3S1MB 1EFID 2WV6D 5M5YB 5I6WA 1RJTA 1GUNA 2K1BA 1TWFB 3T51B 4E6IA 3BYTB 3U9OA 1TWAB 3A8IE 3D6WA 2Q8RE 3O13A 3IKJA 2JEBI 3VYUA 2B2UC 1Z47A 3M85A 1ML0D 2V4DA 3HS0C 1CFMA 2A69C 4DAYA 3V96A 1W6KA 2SOBA 1SMYC 3G7LA 5T1IA 2O4XA 5JEAJ 3NXWA 4HSVA 4K2LA 3T4AC 5IIFA 2ZXRA 5IGBA 1G2TA 3A56A 1OXXK 1SFOB 2EJMA 2XSCA 3X3NA 3ZYYX 1BBXC 5IGFA 1GUOA 5EPKA 4ZQ3A 3TP8A 4K6LA 1JOQA 1C4QA 1TS5A 3CQZB 4FF3A 2BDOA 3DEOA 1EEFD 1U4RA 2K28A 5ISRA 4XIGS 3GD7A 3UI2A 2MUYA 2RSNA 4IFDI 4A3GB 5C0XJ 1W6JA 3K7AB 3EJIA 1Q90A 5F2DA 1YNNC 5BN3A 2CQAA 1ZKOA 2G9HD 4XDXA 3JAML 2VNUD 4KTAA 2IX1A 1BCPC 4OO1G 2HDMA 4S3SA 3DWPA 3IFDA 4PMWA 4HAEA 4K14A 1GHKA 3HZXA 4KHZA 1JR0D 1PDQA 1CI3M 1STHA 1A3VA 5FKAC 1WTXA 2KJXA 1BOSA 5ELBA 4R9WA 2R61A 1PTOH 1U9RA 2B2TA 2NTTA 2F0KA 3NTIA 2NN6I 1II3A 1O7LA 3I3CA 1CQVA 1HRJA 1H9JA 3VR4A 3CHBD 2J4XA 3H3VC 3V2TA 2LFNA 4K6DA 3OW7A 1CT1D 1O78A 2L12A 4RKBA 4X3TA 3MC0B 1LV9A 1XYIA 2RVLA 4XYQA 1LT6D 3S9WA 3S15B 3S16B 3NK9A 3TMEA 1DJRD 1EY4A 3K57A 2CW0D 4K8IA 4HMJA 1WD0A 4DNTB 4A3MB 1ZEQX 2Q8IB 3E5SA 2G9DA 4WJWA 4PV1C 1CA6A 2O5IC 1STAA 4TKOB 1SNMA 1A3TA 1QE6A 1SDFA 1HUNA 2RSOA 5LL6S 2XIWA 5JPNC 4RAUC 4DFAA 1FNVA 1NAPA 1O7ZA 5ELCA 3MXPA 3TP5A 4C1NK 5CMDA 2K32A 2PO4A 1NR2A 1ET6A 1QG7A 2WKCA 4ZKBB 1EYCA 4J8QA 5EQ0A 5G3LF 1X32A 1KLUD 5M9OA 3T53B 3GTOB 2EXZA 3M7NA 1JQYD 2EY1A 1B53A 4CKBA 1HFNA 2QDBA 1EU4A 3KBGA 1LTAD 1XX8A 3ND9A 3SE0A 5IOCA 1IKMA 1B9NA 3K6OA 3TN2A 3R2IA 5A2QE 1RTOA 2PMZB 2IX3A 4RFBA 3I4NB 2K04A 5FLXL 4C3IG 1S5CD 2EY2A 4KY6A 1FNWA 5M5WB 4F7XA 2JA8B 4I65A 1CHQD 1D5ZC 2KCNA 5FO9B 4JBWA 3SK5A 2M2LA 5CV6A 3MXUA 3NP8A 2K5DA 1H9KA 4CKEA 3WDNA 1I50B 2EE1A 1EY5A 3HP3A 1H9SB 1ESRA 3VYTA 3TZUA 2L4NA 1JB3A 1SNCA 5D3IB 4XYOA 4XTCS 4KJNA 2F0LA 1V1OA 2BDNA 5AFWA 1AZPA 4TRDA 1QNUA 4XQJA 1DM0B 1Y1WB 2K6AA 1HHVA 4ABNA 1OXUA 1RODA 2GA4B 4RHSA 2EJGC 3A54A 4A3EB 4BA1I 1BUVT 3J7AV 1IYVA 1B44D 4ME5A 5C0XH 1TS4A 1WTWA 1DOMA 1XTCD 1F9RA 2F4IA 3FDTA 4FF4A 3LWUA 5C4JB 1RDPD 2ENBA 1D2BA 1GUWA 1SSOA 4ZLTF 1LT4D 1Y1VB 4KN7C 3FEWX 2CW0C 5G3LD 2KA7A 3PUVA 1T5EA 2F0QA 1DOLA 3OSOA 5KIXA 4CBVA 4X3SA 2JA5B 4OO1I 4MIUA 2L5TA 5IGDA 3VR3A 3MFYA 1TT2A 5EBDA 2PQEA 2KEDA 3AMUA 2L9HA 3LWEA 2N55A 2F0DA 2B2VA 3I73A 2HDLA 1IL8A 1JOKA 4WORA 1QILA 2BA1A 2Z4IA 5A2QL 1LT5D 4DGZA 2L1BA 4TQUS 4G7HC 3BVGA 1C48A 1RTNA 4IUPA 5IT9E 3H94A 3L9AX 4KKSA 3Q22A 4G57A 5D14A 1PRTB 2NB0A 2F3WA 2PZTA 3Q23A 3C46A 2F0NA 2B2WC 3HOYB 2F1MA 1CK1A 1PFBA 1WVLA 4KHVA 1LABA 2L0CA 4KY5A 5C4HA 1EZ6A 1EIGA 3FPPA 2RQXA 2JE6I 2PYKA 2A6HD 3OHXC 3S2DB 3GV6A 1SYFA 1EL0A 1JORA 1D1KA 1VF7A 2A73B 3C2PA 1EIHA 3PUWA 5C0XG 1X3PA 3H6MA 3C1FA 3HOZB 4HCSA 1BXTA 1FNUA 4KKUA 2NVXB 5E3FA 3R2TA 1PRTF 3Q24A 3K58A 4H0LC 2MP1A 2LS01 1R4QB 4RKLA 1S5FD 4G7OC 5JVG3 2L11A 1C8CA 5I9OA 2EYFA 3F2UA 4I7ZC 2B2UA 1S5BD 4EQNA 5K36H 1TIID 4ZKCB 1HTPA 1WTRA 1LT3D 4IURA 3LNNA 1G6ZA 1ILQA 2EYLA 3MHBA 4QMGA 1Q1BA 3SDZA 5JJZA 4HCEA 1HCZA 2BCOA 4KD3A 3KLSA 4NDXA 1I4XA 1E2WA 4DN4M 1BDOA 2DY8A 2KUMA 4ILWA 4LJZC 3J80E 3I91A 1SYGA 4H7BA 1MI2A 1PFNA 1X3QA 4H13C 2OT2A 2DNCA 2NUCA 5I2YA 3N52A 3ONAB 5BN5A 1ESFA 4RHRA 3D31A 4OIJA 3K5OA 1ENFA 3RMHA 2AUJD 3S2HB 2ZXOA 2E2IB 2PCFB 1G8ZD 3GTGB 2Z4HA 2F0SA 2AQ2B 3QIAA 1ZYRD 4RGTA 1GUTA 1GUGA 2ICEC 1RCVD 5CGKA 1WD1A 1SE4A 2FJ2A 3SK8A 4QUCA 4P2CB 2Q8TA 1AZQA 4DNRB 2JSOA 3SEBA 1JWSD 5DM73 5I6YA 1CA5A 5IT9L 4K5WA 3Q0AA 3HKZB 5HURA 1UNSA 3I4LA 1XWEA 3GTLB 3P1HA 1TY2A 3Q6SA 3NTHA 4C56C 5DM63 4RCNA 4K5VA 1H9MA 2WINB 2JYOA 2WIIB 3TSSA 1PRTD 3MA2B 1NR4A 1D6EC 5K36G 2SEBD 2R7ZB 1K8MA 5T1GA 1LTTD 1SJHD 2B2YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0W A;  4TRD A;  4PMC A;  1SNO A;  3ERQ A;  3HZX A;  3QOJ A;  5KGU A;  5J1Z A;  2RKS A;  4PNY A;  5JOB A;  1STH A;  4G57 A;  2F0T A;  1EYC A;  1A3V A;  4KJO A;  2F3W A;  3SK6 A;  4R8N A;  1SYG A;  1A2U A;  1EZ8 A;  3C1E A;  2F0O A;  4H7B A;  5M9O A;  2PZT A;  4EQO A;  1AEX A;  3VA5 A;  2EY5 A;  1SYE A;  2NUC A;  2EXZ A;  2SOB A;  4ODG A;  4OL7 A;  2F0N A;  3DMU A;  2EY1 A;  2O4X A;  3BDC A;  1SYC A;  1EYD A;  3NXW A;  1U9R A;  2RDF A;  3MEH A;  5CV8 A;  4K5X A;  3PMF A;  4QB4 A;  5CV7 A;  2F0K A;  4KHV A;  4K2L A;  2PW7 A;  4KD4 A;  4HMI A;  4DF7 A;  3RUZ A;  2F0J A;  2PZW A;  4ME5 A;  5CV5 A;  5I9P A;  1KDA A;  5IIF A;  4KV6 A;  1STN A;  5C4Z A;  1II3 A;  2PZU A;  4KY5 A;  5C4H A;  1TQO A;  5IGB A;  1EZ6 A;  2KQ3 A;  3QOL A;  1SYD A;  5CV4 A;  3OMC A;  3NUC A;  2QDB A;  1A3U A;  2EY6 A;  2F0E A;  2PYK A;  3D4D A;  3D4W A;  4B9W A;  2F0S A;  4LAA A;  1RKN A;  5DEH A;  3TP6 A;  2EYJ A;  2ENB A;  5IOC A;  2EYM A;  3EVQ A;  5KYL A;  5EKL A;  1SYF A;  3V2T A;  2OEO A;  3NQT A;  5J39 A;  5KYI A;  3P75 A;  1ENA A;  4K6D A;  1JOR A;  3OWF A;  1IHZ A;  4N9T A;  4QF4 A;  4YIJ A;  5IGF A;  5IGC A;  5CC4 A;  4RKB A;  1JOO A;  4KY7 A;  4EQP A;  1SYB A;  5CGK A;  2F0Q A;  3TP7 A;  4J1M A;  4ZQ3 A;  2WAC A;  3HEJ A;  3LX0 A;  3H6M A;  3TP8 A;  4IAL A;  3OSO A;  3SHL A;  2F0F A;  2SNS A;  3C1F A;  3SK8 A;  2OXP A;  5KIX A;  1A2T A;  3S9W A;  2KHS A;  1SND A;  1STB A;  5EGT A;  1EY6 A;  5CV9 A;  2EY2 A;  1JOQ A;  3NK9 A;  4KY6 A;  5NUC A;  1EQV A;  1EY0 A;  4EVO A;  1SNQ A;  5E3F A;  3TME A;  3R3O A;  4F7X A;  5I6Y A;  5C3W A;  4MIU A;  5JAV A;  4J6H A;  5IGE A;  4K5W A;  4I65 A;  5C6A A;  3SR1 A;  2EYO A;  4N9P A;  3D6C A;  1EY4 A;  3MZ5 A;  3SK5 A;  5CV6 A;  5ISR A;  4RKL A;  1SNP A;  2F0I A;  4K2K A;  4ZUI A;  1F2Z A;  3SXH A;  5HGT A;  1ENC A;  5K5P A;  1KDC A;  4DU9 A;  3BDL A;  5C5L A;  5C3X A;  2PW5 A;  5I9O A;  2EYF A;  4K8I A;  3NP8 A;  2F0U A;  4HMJ A;  1STG A;  2OF1 A;  3NHH A;  5E1F A;  5HUR A;  5IGD A;  4IUN A;  3T13 A;  1TT2 A;  2F0P A;  3E5S A;  4ID6 A;  2F0V A;  1NSN S;  1EYA A;  2PQE A;  2M00 A;  4K8J A;  4WRD A;  4EQN A;  5KEE A;  5J22 A;  2SNM A;  3P1H A;  3T16 A;  1F2M A;  3OMG A;  1STA A;  3EJI A;  5KRU A;  3ITP A;  2RBM A;  1EY5 A;  1SNM A;  5IOD A;  1A3T A;  1TR5 A;  5F2D A;  2F0D A;  1KAB A;  4NKL A;  2F0H A;  4K5V A;  1F2Y A;  5C5M A;  2EYL A;  2F0G A;  3ERO A;  3DHQ A;  4IZ8 A;  3MHB A;  5DAU A;  3SK4 A;  1NUC A;  4KTA A;  4QMG A;  4NMZ A;  5CR3 A;  4S3S A;  1SNC A;  2EYH A;  2EYP A;  1EY7 A;  1JOK A;  2LKV A;  5IGG A;  3D8G A;  1STY A;  1KAA A;  4HTH A;  4KD3 A;  4PMB A;  5I6W A;  4NDX A;  4WOR A;  4DFA A;  4NP5 A;  3QB3 A;  2HQE A;  4B9X A;  4F8M A;  2F0M A;  4KJN A;  4DGZ A;  2F0L A;  4K14 A;  3MVV A;  2F3V A;  3U9O A;  1KDB A;  4E6I A;  5EKK A;  1EY9 A;  3MXP A;  4ZUJ A;  3TP5 A;  1EY8 A; 
#chains in the Genus database with same CATH topology
 2IX0 A;  4C3J B;  3VR5 A;  1PH3 A;  3NQI A;  2UUC L;  3S17 B;  3K8A A;  2A6H C;  1TXY A;  3PV0 A;  2ZTE A;  3EFX D;  4A3I B;  1RIP A;  1PH9 A;  1KHI A;  3ULJ A;  1UAP A;  1UWV A;  1GOZ A;  1WTO A;  1A6X A;  2XRS D;  1VQ8 A;  1SYE A;  2JQO A;  4FXK C;  3K5M A;  3H0G H;  2Q2U A;  3DUZ A;  1DXM A;  3MAQ A;  4DR4 Q;  2QGQ A;  4UPA A;  4DV3 L;  2ZJQ A;  5CV5 A;  4OON A;  3W1B A;  3HOU B;  3BS1 A;  1BF4 A;  1PV4 A;  5D3D A;  3AEV A;  3J7Y W;  4KK7 A;  2X6L A;  4LAA A;  5DEH A;  3GTJ H;  4DAP A;  3CD6 A;  1VMP A;  2VUM B;  3P75 A;  1ENA A;  3URY A;  3KLS X;  3OWF A;  5I4D A;  4N9T A;  4QF4 A;  3KF6 B;  4G4K A;  3K81 C;  1QOH A;  4TSS A;  1F9P A;  1X65 A;  1WCM H;  4IUU A;  4C3H G;  2JA6 G;  1IXR A;  3KF8 A;  1O7Y A;  4P73 A;  2OCE A;  1EQV A;  1I3Q B;  1A0I A;  2OQK A;  1WTH A;  1DCZ A;  3FKI H;  4K0K Q;  4BY7 B;  1M4V A;  4LFB L;  4MN3 A;  3RLN A;  1SNP A;  2NVY B;  4K2K A;  4OWT B;  3SXH A;  1G51 A;  3FMC A;  2IL8 A;  1NBW A;  5C5L A;  3G4S A;  4JI6 L;  4FNF A;  1PTO B;  3GTK H;  4NXM L;  1Q1E A;  2QEJ C;  2WB1 G;  1V1P B;  2F0P A;  2F0V A;  4HJ8 A;  3PO2 B;  3BVM A;  4C3I B;  4JVZ A;  3TQY A;  2K75 A;  1VQP A;  3OTO L;  3S1Q B;  1G29 1;  1KAB A;  2YU9 H;  1LTI D;  1PFM A;  3NEM A;  3PIO A;  2CVR A;  1LAC A;  3GO5 A;  1LUZ A;  3A7A B;  1KAA A;  4NXN Q;  1PZK D;  2E2H H;  1VQE A;  5E7N A;  2FXQ A;  4O1N A;  4UP8 A;  2F3V A;  3RLO A;  1TS3 A;  5EKK A;  4ZUJ A;  1QNK A;  4PZ7 A;  5CYU A;  1S5E D;  2I07 B;  1X55 A;  4M8A A;  2KHJ A;  3ERQ A;  2NVQ B;  1CM9 A;  1RF2 D;  5KGU A;  3CCM A;  2VB3 X;  4C2M H;  3VYS A;  1SE8 A;  1VQA A;  4QL5 A;  3HOX B;  4LW1 A;  3KLW A;  2KCC A;  1Q8I A;  1A2U A;  1ZYR C;  3RN5 A;  1K9M C;  1YHA A;  4F87 A;  4DV0 L;  1PTO F;  1N9W A;  2J7Z A;  3MXN B;  2E2J B;  4IOA A;  4JV5 Q;  3DMU A;  2WAQ G;  5C0X I;  4DUY L;  2B8F A;  5GAG C;  1EYD A;  4JI3 L;  1T9H A;  3F1Z A;  3VR6 A;  4QB4 A;  5EBC A;  4DF7 A;  4JI1 Q;  3RUZ A;  4L5T A;  1EUJ A;  2A5H A;  4XXE A;  3CU7 A;  1HZA A;  2PNH A;  4WFN 3;  1HTL D;  1N8R C;  1N32 Q;  2BH8 A;  3IRB A;  4A3J B;  5GRO A;  1M1K C;  4AQY L;  1VQN A;  5IGC A;  1GD7 A;  3H0G G;  4IN3 A;  4JW0 A;  4HR7 B;  4HID A;  1LTG D;  1IBK Q;  3HEJ A;  2PPB C;  2NYZ D;  3J81 c;  2F0F A;  1VQB A;  2UUC Q;  3ER0 A;  1STB A;  4CDE C;  2ID0 A;  2X6G A;  1I4H A;  1RL2 A;  5NUC A;  2ZTD A;  1S72 A;  4DR7 L;  5DLQ E;  1PRT C;  1F2Z A;  2AWO A;  3M4O H;  3J80 i;  2KVM A;  1Q12 A;  2CFM A;  1WCM G;  4DV3 Q;  2M00 A;  4QY7 A;  4ZYS A;  2UUA L;  3MXG A;  4IUV A;  1HXY D;  3GP7 A;  3NSW A;  2MHV A;  4ZK9 B;  4POG A;  2O5J C;  1TWH B;  2F0H A;  3C3L A;  2F0G A;  3ERO A;  4A3K H;  3FKI G;  3NWS A;  4CGY B;  1HPC A;  5FLM G;  3L7Z C;  4YCW A;  3I72 A;  2JK8 A;  5IGG A;  1KD1 C;  2IJ0 A;  2HQE A;  4N8X 1;  1KDB A;  4DAY B;  1PYW D;  2DY7 A;  1KRT A;  1CUK A;  1VMC A;  1VF5 C;  2BE5 D;  2F0W A;  2AMC B;  2DUD A;  1HR0 Q;  1X9N A;  4BXX G;  4PMC A;  1I50 H;  3QOJ A;  4JI7 Q;  1FR3 A;  1UE1 A;  2A74 C;  3K7U C;  2NN6 H;  2H1E A;  3RZD H;  5JOB A;  5DNF A;  4DNI A;  1EIF A;  3T1H Q;  1GM5 A;  2F0T A;  2EZV A;  4LFB Q;  3PCO B;  3C1E A;  3TRZ A;  4NXM Q;  1VQ6 A;  1B2T A;  3QWN A;  1UE6 A;  1JWU D;  2MPM A;  4DR1 Q;  2QIL A;  2YYZ A;  1STE A;  1GXD C;  1CTM A;  2PZW A;  3U9S A;  1SE2 A;  5TSS A;  2D2C C;  4YCV A;  1I4R A;  1Y1W H;  1SEB D;  3G6J B;  1K28 A;  4IUT A;  4PQX A;  5KYL A;  1K0S A;  4JI8 L;  1FGB D;  1M8A A;  5C4X H;  1J5E Q;  1PYB A;  2E2D C;  2Z6B A;  2QW7 A;  4NB3 A;  4RGM A;  4JBM A;  1PTO D;  1SLJ A;  1CKM A;  3D3R A;  3HRZ C;  2JA7 B;  1EWC A;  3IFT A;  4DV4 L;  1XNR L;  1A2T A;  4JBJ A;  1K83 H;  1KTK A;  1FL0 A;  3CCQ A;  4ZRZ A;  3M3Y B;  4J6H A;  2WB1 E;  4QUF A;  5C6A A;  2XGT A;  2EDG A;  1LTS D;  3MZ5 A;  3DM3 A;  4DV0 Q;  1SBB B;  5EAY A;  4DUY Q;  1FYC A;  2VXW A;  4JI3 Q;  1LO5 D;  1U4P A;  1L1O A;  3RLF A;  4KMU C;  5KRU A;  1PLF A;  1VQO A;  2B8G A;  1R4P B;  2B2W A;  2D9U A;  3NBH A;  1V9P A;  3NWT A;  3DHQ A;  1KNA A;  3SK4 A;  4BBS B;  4GOP C;  4AYB G;  2EYH A;  1LTR D;  1STY A;  2WP8 J;  1SJE D;  4IUQ A;  5ELO A;  4BBR B;  1TWG B;  2R6G A;  4LFC L;  4X65 Q;  3I4N G;  3QB3 A;  1NCV A;  2DJF C;  1EY8 A;  2MO0 A;  1UEB A;  1YIT A;  3KK7 A;  1BKB A;  1GJX A;  2N88 A;  4CJ2 C;  3E9I A;  3U4Z A;  3STB D;  3FVQ A;  2RKS A;  3N6R A;  4DK0 A;  4A3K G;  2WAQ E;  1JIC A;  3AB9 A;  1HQR D;  1SRO A;  3RZO H;  3BZD B;  3H09 A;  4RG1 A;  2XTI A;  4EQO A;  4O42 A;  4DK1 A;  4G7Z C;  4R4T A;  3R8B A;  1TS2 A;  1SYC A;  2R93 H;  3T56 B;  4CDD C;  1HUM A;  1V1Q A;  2X69 A;  5CV8 A;  3MEH A;  4K5X A;  5M5X B;  2UUA Q;  3HOV B;  4HMI A;  1TWC B;  3I7F A;  1HJP A;  2NN6 G;  2Y0S G;  1Q3L A;  4B9W A;  1HNW L;  3DEP A;  3GTM B;  4CJ0 B;  4H02 A;  4Z9C B;  5A35 A;  1Z9F A;  1I4G A;  2PI2 A;  1MSG A;  1CQF A;  1YJ9 A;  4JI0 Q;  2PNR C;  3B6Y A;  4KY7 A;  2HCI A;  3A5U A;  3CRK C;  1XPU A;  5FO8 B;  1Q46 A;  1SND A;  1AFP A;  1Y8P B;  5CV9 A;  1Y1W G;  1NY4 A;  2QCP X;  3M4Y A;  1PHJ A;  2C9O A;  1DYQ A;  2HT1 A;  1SNQ A;  3VYR A;  4R4I A;  5IGE A;  4HIK A;  4A3L H;  5M3M H;  2O2L D;  5C4X G;  2PI2 E;  3BVZ A;  1ENC A;  4A3E G;  2E74 C;  5C3X A;  2C5C A;  2F0U A;  2OF1 A;  2D5D A;  3S1R B;  4ID6 A;  3U4V A;  5KEE A;  3I8Z A;  1WTQ A;  1SRU A;  4ZAI A;  3CCL A;  2EIF A;  2BE5 C;  3J7A F;  3HG9 A;  2K5Q A;  4IQZ A;  5LMU Q;  3HOZ H;  3H91 A;  2EJF C;  5JPM C;  1SXT A;  1F2Y A;  4RH6 A;  3PIP 3;  1B9M A;  5DAU A;  4JI8 Q;  4OXP A;  4NMZ A;  5CR3 A;  4AIM A;  5JJI A;  3MWY W;  4LNQ A;  1A62 A;  1CKN A;  2BH2 A;  1F9S A;  4IJL A;  3SGI A;  4U67 3;  1D1I A;  1S4Z A;  1YIJ A;  1ASZ A;  4O0A A;  3TEH B;  4DV4 Q;  1OXS C;  1KNE A;  1T5X D;  1HNZ L;  1EY9 A;  4A76 A;  3JAM E;  3TDQ A;  4FXD A;  1H9R A;  3RN2 A;  4DR4 L;  3DWA A;  4QQB X;  5EKI A;  3GV3 A;  5COY A;  3S1N H;  2JP1 A;  4KJO A;  1C9O A;  3W2D A;  3PSI A;  4OGQ C;  4JI4 Q;  2ZXP A;  2EY5 A;  1UEA B;  1PTO C;  5D65 A;  1R9T B;  1HZB A;  2XVS A;  2B63 B;  1C0A A;  3JC6 6;  1LTB D;  4KV6 A;  2UU9 Q;  1XMO L;  3VA7 A;  1Q86 C;  2K03 A;  3CRL C;  1NJI C;  1I6H B;  5GAH C;  1RKN A;  3TP6 A;  3S24 A;  4DV1 L;  4XT3 B;  3OPO A;  3NQT A;  3PUY A;  5J39 A;  3S1M H;  4LFC Q;  1ONL A;  1YJN A;  2K33 A;  4NW2 A;  4K0K L;  2Z6K A;  1OXT A;  3NBI A;  3S14 B;  3V05 A;  5M5Y H;  2FMC A;  1D5X C;  1J8I A;  2ZJR A;  4GLA C;  1TWF H;  4GS3 A;  4LF6 L;  4IAL A;  4KN4 C;  3SHL A;  1PYS B;  2RHS B;  4A3F B;  4DR3 L;  1SE3 A;  2VB2 X;  3ND8 A;  3PIO 3;  3DM1 A;  4GNX A;  1K8O A;  3WWV A;  1E24 A;  2E2I H;  3GTG H;  5IYC H;  1MIU A;  2B2Y A;  3SR1 A;  3JAM c;  4JBK A;  5KNC A;  3PGZ A;  3I55 A;  4X3U A;  5IYB H;  4RA8 A;  4KHP Q;  5E1F A;  2AQ1 B;  4M1U B;  3T13 A;  2ICI A;  3SVM A;  4C3H B;  2JA6 B;  3NPP A;  2BOS A;  5C44 B;  4AYB E;  2BA0 A;  2TSS A;  4FF1 A;  2A6E D;  3STB C;  4R4C A;  3W1G A;  4L63 B;  3K5L A;  4A3L G;  3E0J A;  2KEC A;  3BG3 A;  5M3M G;  2L55 A;  4XQN A;  2EYP A;  2MQH A;  1SFO H;  1WTP A;  4HTH A;  4RWS C;  3K0Y A;  4DAM A;  1W3S A;  3MFG A;  1X3G A;  4B08 A;  2WB1 B;  4F8M A;  1MGS A;  5LMN Q;  3CCE A;  2CCZ A;  2UUB L;  1BBW A;  1H9S A;  3EA6 A;  3GTL H;  2E76 C;  3HOZ G;  2D0P A;  2AQ3 B;  1WTV A;  3L3O C;  4OHJ A;  2R92 B;  3CQZ H;  4DR6 L;  1B8A A;  4Y7N B;  2OTL A;  3KFU A;  4NPS A;  4GKK Q;  1JCK B;  1N34 L;  4DUZ Q;  1G91 A;  1X3F A;  1N32 L;  3WOE A;  1AEX A;  2EPB A;  2IPK D;  2Y0S E;  4FDB A;  2FFK B;  2PQA B;  3CF5 A;  1VQF A;  1E2V A;  3OOC A;  1IL2 A;  1DOK A;  4A3G H;  4KD4 A;  5I9P A;  4MHE A;  4C3J H;  4I7A A;  2K01 A;  1VQL A;  3MEF A;  3K7A H;  3KJP A;  1A3U A;  2F0E A;  3D4D A;  3CCS A;  1DD2 A;  2DGY A;  3UDG A;  3CC4 A;  1J6Q A;  1Y14 B;  4FXG C;  1P8L A;  1CHP D;  4FVM A;  3NBH B;  3OWE B;  2K52 A;  1PH7 A;  3PIP A;  2P5Z X;  4U68 A;  4YIJ A;  2WAQ B;  1W2B A;  1JOO A;  1HNZ Q;  2IT1 A;  2LMC B;  4J1M A;  1MSH A;  4LMQ D;  2E75 C;  2HCC A;  1JMC A;  3GTP B;  1GHJ A;  4DR2 L;  3NEL A;  2VL6 A;  4CKC A;  4IO9 A;  1AN8 A;  3PF4 A;  2RDH A;  1IW7 D;  5IP9 H;  5HGT A;  1BO0 A;  2VUM H;  1U4L A;  3H0G B;  1STG A;  5FLX E;  4WRD A;  1EYA A;  1RD9 D;  1QUQ A;  1YNJ D;  3A55 A;  4RGN A;  1XMO Q;  5JJK A;  5ELE A;  3DXJ C;  2EQS A;  1AH9 A;  4B3R L;  2IW3 A;  1HR0 L;  3GTJ B;  1D8L A;  1O7I A;  5IYC G;  2LXK A;  4NKL A;  2RHQ B;  4HSP A;  3UE1 A;  4JI7 L;  4DV1 Q;  1I3Q H;  3NTK A;  2NZ1 D;  1GUS A;  1YI2 A;  4X6A H;  4X3K A;  3TBI B;  5L37 A;  4YY3 L;  3T1H L;  4L6T B;  4BY7 H;  5IYB G;  3J80 L;  5FLM H;  2ASB A;  4R8I A;  2EOT A;  1Y69 U;  3PQI A;  2I46 A;  2LXJ A;  4LF6 Q;  1WCM B;  2F0M A;  1F9Q A;  1TVX A;  4DR3 Q;  1VQI A;  4N9P A;  4ULL A;  2AWN A;  4GN5 A;  4DR1 L;  1NE3 A;  4BWG B;  3PO2 H;  2K05 A;  2Z9H A;  4BXX H;  1A15 A;  3S15 H;  2N3S A;  3S16 H;  1BBU A;  1KXL A;  2DN8 A;  3FKI B;  3S1Q H;  1E1T A;  3DWQ A;  1PZJ D;  3A8J E;  2K5H A;  3KLR A;  2K50 A;  4R8N A;  1S5D D;  3J81 E;  2G5D A;  3GTQ B;  3GTK B;  2WFW A;  2XN9 C;  1TY0 A;  3VA5 A;  1J5E L;  1QJO A;  4XQQ A;  2A1A A;  1C7Y A;  4A3M H;  3PUZ A;  3PO3 B;  2QDL A;  4DA2 A;  2RDG A;  1IKL A;  1KDA A;  4LWC A;  5C4Z A;  3UDF A;  2PZU A;  1Y8N B;  2YU9 B;  3H3V I;  3QOL A;  1SAP A;  4YCU A;  3CCV A;  3P7J A;  3D4W A;  3I56 A;  3E0E A;  3KUP A;  5FLX c;  5GAE C;  3CMA A;  4FYD A;  5CBA E;  5FOB B;  3KBX A;  2Z1C A;  1X3E A;  2R7F A;  2NTS A;  1KLG D;  4MNO A;  1VQK A;  5EKL A;  3AU7 A;  3HOX H;  3CCR A;  1B50 A;  2E2H B;  3CP0 A;  1JWM D;  1YJW A;  5CC4 A;  5ELF A;  2UUB Q;  3IAY A;  4CHT B;  1CKN B;  2RA4 A;  4A3G G;  2WAC A;  2AKW B;  2KOL A;  3K80 C;  1Q8K A;  4C3J G;  2CHB D;  4C2M B;  2KHS A;  3K5N A;  2WKD A;  2N78 A;  2MGS A;  1AP0 A;  2A6E C;  4QIW B;  4IOC A;  5EJW A;  1EY0 A;  4QCL A;  4DR6 Q;  4UY8 C;  2CWA A;  2B2T C;  1N34 Q;  3JAM i;  1MD2 D;  1TKW B;  3T1Y Q;  1U4M A;  2F03 A;  4ZUI A;  3D0F A;  1KDC A;  2A68 D;  2D62 A;  4DU9 A;  4A3C H;  3AYH B;  3GTO H;  2ZTC A;  3ULL A;  2NBF A;  4K8J A;  4X65 L;  2H4O A;  1F2M A;  1XXG A;  3QJY A;  4IFD H;  1QB5 D;  2KEN A;  1BNZ A;  3A8K E;  3W5O A;  1Z7T A;  4Q0F A;  3CPW A;  4LF7 L;  3U50 C;  4KI0 A;  5IP9 G;  4HJA A;  1I4Q A;  4GLV B;  4YHH Q;  2FIN B;  2LKV A;  1YBY A;  4CJ1 B;  2VUM G;  5BN4 A;  3D8G A;  4PMB A;  4NP5 A;  1L2F A;  2I5H A;  2UXB L;  3BZC A;  3I4N H;  5FO7 B;  2ATW A;  4DR2 Q;  1LLR D;  2TMP A;  2RF4 A;  4DV7 L;  5J1Z A;  1ZXT A;  4DK6 C;  4YWL A;  1Z6H A;  4PNY A;  5FJ8 H;  5M5W H;  2JA8 H;  4AYB B;  4BY7 G;  3M4O B;  4POF A;  3QO2 A;  2XWJ B;  5M3F B;  3K0X A;  4OIK A;  1IBM Q;  4JI0 L;  2Z0S A;  1CZW A;  1TU2 B;  1VCI A;  3NE5 B;  2B39 A;  2PW7 A;  2QA4 A;  3PO2 G;  2F0J A;  2AUK A;  2VQF Q;  4B3R Q;  1TQO A;  1SYD A;  2Z8L A;  4A3K B;  3A7L A;  1BCP B;  4RCO A;  2N8N A;  3FRP B;  4YY3 Q;  3EVQ A;  2KCT A;  1IW7 C;  4X64 Q;  4B3S L;  1YHQ A;  1L0X B;  1UUP A;  3Q8D A;  4A3M G;  1SYB A;  1VQ4 A;  2HIX A;  2HUG A;  5JEA H;  3M7G A;  5BR8 Q;  4GOP A;  1YNJ C;  4HN7 A;  2Y0S B;  1QCB D;  3RZD B;  1E2Z A;  4UDU C;  5KND A;  3TZD A;  4EVO A;  5LMU L;  1J9O A;  3D4R A;  3R3O A;  5JAV A;  1JE4 A;  4KKT A;  4A75 A;  4HIO A;  2EYO A;  3HOX G;  4V19 0;  1EIY B;  4UAI A;  1L0W A;  4MTK A;  5LL6 X;  2F0I A;  1PH6 A;  1PH2 A;  3CC7 A;  4LK1 C;  1V8Q A;  3RD4 A;  2PW5 A;  2FHT A;  1AE2 A;  2XRQ D;  1BR9 A;  3NHH A;  4A3E H;  1QWY A;  3J81 L;  3HKS A;  3KOJ A;  4X62 Q;  1NSN S;  3EN2 A;  2SNM A;  2KHI A;  2JA7 H;  1G2S A;  2K5W A;  1EEI D;  2JXM B;  4ME3 A;  1BCP F;  3M3Y H;  5C5M A;  4H44 C;  1E22 A;  4IZ8 A;  1JJ2 A;  5C4X B;  5C4J H;  3I4M B;  1OO9 B;  2CH4 W;  4A3C G;  4FP5 D;  5C3E B;  1F2L A;  1Y1V H;  4QJF A;  4JI4 L;  4B9X A;  1DON A;  3AQQ A;  4DXF A;  3UDX A;  1Q81 C;  3R93 A;  2DNE A;  1I94 Q;  1K83 B;  4BY1 B;  4IFD G;  4P75 A;  5E4W C;  2ZT9 C;  3W3A A;  2MJ8 A;  3BYY B;  2UU9 L;  1AW7 A;  1L0Y B;  2IHF A;  2E5L Q;  2JA5 H;  2QF7 A;  4XT1 B;  4BBS H;  1CSQ A;  2F0O A;  1IYU A;  1RHP A;  2F4V L;  3I70 A;  4APV A;  1WOC A;  5JVH 3;  3BDC A;  4BBR H;  1TWG H;  3HGB A;  1OXV A;  2EVB A;  1D5M C;  3MTS A;  5CV7 A;  1JC7 A;  3F8T A;  2KQ3 A;  2R3Z A;  5CV4 A;  3EQL C;  3OMC A;  3NUC A;  3T16 A;  4LF7 Q;  5KNB A;  1ET9 A;  5FJ8 G;  4LUZ A;  2JA8 G;  2F3I A;  3KF8 B;  1HZC A;  2EYJ A;  5E4X A;  2JN4 A;  2EYM A;  2A69 D;  4O2D A;  2HHH L;  4IJH A;  4Q5V A;  4YWK A;  2OEO A;  1DZ1 A;  1NTG A;  1IHZ A;  2V1C C;  1SMY D;  2A68 C;  4FO2 A;  4R1J A;  4JK1 C;  2UXB Q;  2LY7 A;  1I6V C;  4KHP L;  1VQ9 A;  4C1N I;  3LX0 A;  5J22 A;  4PG3 A;  1PMR A;  2SNS A;  2OXP A;  4DV7 Q;  1XPO A;  3FHW A;  3BDO A;  1EQT A;  3RZO B;  1WI5 A;  3CKI B;  1K3B C;  4BS9 A;  4A3D B;  1E0B A;  3OIP A;  4LFA Q;  3E3X A;  4HIM A;  4BA2 I;  1HH2 P;  5K5P A;  4L5S A;  1Y8O B;  1FD7 D;  2R93 B;  3FPU B;  4OX9 L;  4R4Q A;  2J0T D;  4YWM A;  5JEA G;  4X66 L;  3HOY H;  4DXG A;  2HQL A;  1IZ6 A;  1X54 A;  5EPL A;  3J81 i;  3OMG A;  5LMN L;  4A4I A;  4DV2 Q;  3ITP A;  2RBM A;  5IOD A;  3I90 A;  3X3M A;  2RCN A;  3PF5 A;  1A8V A;  5FK9 C;  5EPJ A;  3S2D H;  1V1P A;  4B3S Q;  3IL8 A;  4LF9 L;  1EY7 A;  5AJ3 L;  4GKK L;  1SMX A;  1MJC A;  4A93 B;  3GDE A;  4DUZ L;  5ELD A;  1EYG A;  1BQQ T;  1EWH A;  3MVV A;  1KQS A;  2JA7 G;  2XNA C;  5GQO A;  1LM0 A;  3OYY A;  1SNO A;  1XPR A;  3AFP A;  3GQB A;  1YNN D;  4EGV A;  3EBE A;  2K7V A;  5M3M B;  4KLK A;  1GO3 E;  1VQJ A;  3A5Z B;  3PUX A;  2NVX H;  1BCP D;  4V0B A;  1HA5 A;  3SK6 A;  4L5R C;  4L8J A;  4GZY C;  1EZ8 A;  2QKI C;  1I4P A;  1Y1V G;  3OIQ A;  3TRE A;  4F88 A;  4ODG A;  4OL7 A;  5IYD H;  2B2V C;  4FF2 A;  5LHY 1;  2RDF A;  1HFG A;  3PMF A;  3BJU A;  1MBY A;  1B1Z A;  1B4O A;  1HQM C;  1STN A;  1EU3 A;  1I5F A;  3HOW B;  1PXU A;  1MKH A;  1V43 A;  2EY6 A;  2JA5 G;  2Q2H A;  1UE7 A;  3MXN A;  4BBS G;  1B3A A;  3QG1 A;  4JI2 L;  1EWI A;  2KEE A;  5COR A;  5KYI A;  2OWO A;  5I2X A;  2UXD L;  4A3B B;  1ICW A;  4BBR G;  1CKO A;  1E1O A;  2NWG A;  4HJ7 A;  2SDF A;  2ZJP A;  4EQP A;  2M9V A;  3TP7 A;  4LF8 Q;  4IFD J;  2HIV A;  2FMM A;  1EOT A;  1VDZ A;  2B63 H;  5CBE E;  5EGT A;  1EY6 A;  2VZA A;  2JEA I;  2KBN A;  3VR2 A;  2NVT B;  3S1N B;  2XWB B;  5C3W A;  1E7Z A;  4HED A;  4JOI C;  3K59 A;  4RGO S;  3CCU A;  2OTJ A;  3D6C A;  2F4V Q;  2IWH A;  1DGS A;  4OO1 H;  4OWW B;  3BDL A;  1A63 A;  4ALP A;  4IUN A;  1ILP A;  1F77 A;  3P20 A;  3BZK A;  4DAV A;  1PZI D;  1CZG A;  1TR5 A;  1HA6 A;  1PH8 A;  3S2H H;  3E6Z X;  3WOF A;  3G48 A;  1O80 A;  2HHH Q;  1NUC A;  3S1M B;  1EFI D;  2CWP A;  2WV6 D;  5M5Y B;  5I6W A;  2H5X A;  1RJT A;  1GUN A;  2K1B A;  1TWF B;  3HOY G;  3T51 B;  4E6I A;  2K5V A;  3BYT B;  3U9O A;  1EFW A;  1TWA B;  3A8I E;  3D6W A;  2Q8R E;  3O13 A;  1OTC A;  3FP9 A;  5C44 H;  4IPH A;  2YV5 A;  4J15 A;  3CW2 C;  3IKJ A;  2JEB I;  3VYU A;  3HFZ B;  2B2U C;  1Z47 A;  2PMZ E;  3M85 A;  2QEX A;  1ML0 D;  2V4D A;  3HS0 C;  1CFM A;  2A69 C;  1VS0 A;  3KYH C;  1AE3 A;  4DAY A;  3V96 A;  4OX9 Q;  1W6K A;  2SOB A;  1SMY C;  3G7L A;  4GN4 B;  4X66 Q;  5T1I A;  2CH4 A;  2O4X A;  5JEA J;  3L2P A;  1YZ6 A;  3NXW A;  2RCF A;  1PA6 A;  4HSV A;  2GN5 A;  5IP7 H;  1BVS A;  4K2L A;  4HJ9 A;  2AHO B;  3T4A C;  5IIF A;  2ZXR A;  3A0J A;  5IGB A;  1G2T A;  3A56 A;  4WJ4 A;  3CPF A;  2CQO A;  4P72 A;  1OXX K;  2ES2 A;  1SFO B;  2EJM A;  2XSC A;  4LF9 Q;  2R92 H;  3X3N A;  3ZYY X;  5AJ3 Q;  1K8G A;  3QR8 A;  5IYD G;  1BBX C;  4DR5 L;  5IGF A;  1SN8 A;  1GUO A;  3T1Y L;  3ICE A;  5EPK A;  4ZQ3 A;  3TP8 A;  4LF4 L;  2R7Z H;  4K6L A;  3VDY A;  4EQ5 A;  1JOQ A;  1L1O B;  1C4Q A;  1FJG L;  1TS5 A;  3CQZ B;  4FF3 A;  2BDO A;  3I4O A;  3DEO A;  3S17 H;  1KIX A;  1LYL A;  1EEF D;  2MNA A;  1E3P A;  4A3I H;  1U4R A;  2K28 A;  5ISR A;  4XIG S;  3GD7 A;  2VQE Q;  3UI2 A;  2MUY A;  2IHE A;  2RSN A;  4YHH L;  4IFD I;  1HNX L;  5C0X J;  4A3G B;  1W6J A;  4CDF C;  2B63 G;  3K7A B;  1S40 A;  1XJV A;  3EJI A;  1Q90 A;  3GTP H;  5F2D A;  1YNN C;  5BN3 A;  3CXC A;  3TS0 A;  2CQA A;  1ZKO A;  2G9H D;  4XDX A;  2N49 A;  3JAM L;  1QZG A;  3HOU H;  1IYJ B;  4MTN A;  4UHV A;  2VNU D;  4JI2 Q;  4KTA A;  1WYD A;  2IX1 A;  1BCP C;  4OO1 G;  2HDM A;  2ZM6 Q;  2UXD Q;  4S3S A;  2VS1 A;  3DWP A;  1P16 A;  3IFD A;  4PMW A;  5IY0 A;  4HAE A;  4K14 A;  4DK3 C;  4JYA L;  1GHK A;  4A3F G;  1IBM L;  3HZX A;  1X6O A;  4KHZ A;  5JJL A;  1JR0 D;  2VQF L;  1PDQ A;  1CI3 M;  1STH A;  2A8V A;  1PH1 A;  1A3V A;  1N36 L;  5FKA C;  1WTX A;  2KJX A;  1BOS A;  2NZH A;  5ELB A;  2NVY H;  4MZ9 A;  4R9W A;  4X64 L;  2R61 A;  1PTO H;  1U9R A;  2B2T A;  2NTT A;  2F0K A;  3NTI A;  2NN6 I;  1K8A C;  5C44 G;  1II3 A;  1O7L A;  3I3C A;  1CQV A;  5BR8 L;  3J81 j;  3J7Z C;  3DLL A;  4C3I H;  1HRJ A;  1H9J A;  3VR4 A;  3CHB D;  2J4X A;  1SR3 A;  3H3V C;  1EOV A;  3V2T A;  2LFN A;  3G71 A;  4K6D A;  1IBL Q;  3OW7 A;  3GTQ H;  1CT1 D;  1O78 A;  2L12 A;  4RKB A;  4JCV E;  3HKZ G;  4X3T A;  3MC0 B;  1LV9 A;  5IP7 G;  1XYI A;  4RMF A;  2RVL A;  1EQR A;  4DV5 L;  4UP7 A;  4XYQ A;  3PO3 H;  1LT6 D;  3S9W A;  4X62 L;  3S15 B;  3S16 B;  1MJE A;  3NK9 A;  2NVQ H;  3TME A;  2R92 G;  4L5Q A;  2GVA A;  1DJR D;  1EY4 A;  3K57 A;  4JI5 Q;  2CW0 D;  4K8I A;  4HMJ A;  1WD0 A;  4DNT B;  4A3M B;  1ZEQ X;  2Q8I B;  2E2J H;  4IPC A;  3E5S A;  2G9D A;  4WJW A;  4PV1 C;  1CA6 A;  2R7Z G;  2O5I C;  1STA A;  1I94 L;  4DPG A;  4TKO B;  1SNM A;  2Q2I A;  5J3B A;  1A3T A;  1QE6 A;  4B3T L;  1SDF A;  1HUN A;  2RSO A;  4GKJ L;  1B3Q A;  5LL6 S;  4A3I G;  2XIW A;  1WFQ A;  3KDF A;  5JPN C;  3H15 A;  2E5L L;  4DR5 Q;  4RAU C;  2IY5 B;  1YVC A;  4DFA A;  4A3J H;  1FNV A;  1NAP A;  1O7Z A;  4OEM B;  4LF4 Q;  5ELC A;  4UP9 A;  3MXP A;  3TP5 A;  4C1N K;  5CMD A;  2K32 A;  1FJG Q;  3HOU G;  2PO4 A;  1GVP A;  1NR2 A;  1ET6 A;  1QG7 A;  3CME A;  2WKC A;  4ZKB B;  1EYC A;  4J8Q A;  5EQ0 A;  5G3L F;  1NMG A;  1X32 A;  1KLU D;  3M4Q A;  5M9O A;  3T53 B;  2MFI A;  3GTO B;  2EXZ A;  1HNX Q;  3M7N A;  1JJC B;  1JQY D;  2EY1 A;  2OQ0 A;  4DKA C;  1B53 A;  4LF5 L;  3NEN A;  4OEL B;  4CKB A;  1HFN A;  3RNU A;  2B29 A;  2QDB A;  1EU4 A;  3KBG A;  1LTA D;  1XX8 A;  4JC0 A;  3ND9 A;  3SE0 A;  5IOC A;  1TWH H;  1IKM A;  1B9N A;  4GNX B;  3K6O A;  3TN2 A;  3R2I A;  5A2Q E;  1RTO A;  4TVA B;  5IWA L;  1KC8 C;  3L0O A;  2PMZ B;  2IX3 A;  4LFA L;  4IPG A;  4RFB A;  3EIV A;  3I4N B;  1HR0 W;  5M3F H;  4JYA Q;  2K04 A;  4EX5 A;  5FLX L;  4C3I G;  1S5C D;  2EY2 A;  2GVB A;  4KY6 A;  1FNW A;  5M5W B;  4F7X A;  2JA8 B;  1N36 Q;  4DV2 L;  2DJG C;  4I65 A;  1CHQ D;  1D5Z C;  2KCN A;  5FO9 B;  4JBW A;  3SK5 A;  2M2L A;  5CV6 A;  3MXU A;  3NP8 A;  1H95 A;  4P71 A;  2EXD A;  2K5D A;  1H9K A;  4N8F A;  4ZCK A;  4CKE A;  3PO3 G;  3WDN A;  1QVC A;  1I50 B;  1JE5 A;  2EE1 A;  1EY5 A;  3HP3 A;  3UE0 A;  4HJ5 A;  1H9S B;  1ESR A;  3VYT A;  4IPD A;  3TZU A;  2L4N A;  4JI6 Q;  1JB3 A;  1SNC A;  4AH6 A;  5D3I B;  4XYO A;  4XTC S;  3F2D A;  1FGU A;  4KJN A;  4DV5 Q;  2F0L A;  4PZ6 A;  1V1O A;  2BDN A;  5AFW A;  3OW2 A;  1AZP A;  2LSS A;  4B3M L;  3OTO Q;  3RR5 A;  3CCJ A;  4TRD A;  1QNU A;  2B3G A;  4XQJ A;  3F2C A;  1DM0 B;  1Y1W B;  2K6A A;  1HHV A;  4ABN A;  1UE5 A;  1OXU A;  3ULP A;  1ROD A;  3H3V H;  2GA4 B;  2A19 A;  3F2B A;  4RHS A;  2EJG C;  2K5N A;  3I4M H;  4A3J G;  3A54 A;  4A3E B;  5C3E H;  4BA1 I;  2I5L X;  1BUV T;  3J7A V;  1IYV A;  3UDI A;  1PH5 A;  1B44 D;  4BY1 H;  4ME5 A;  5C0X H;  1TS4 A;  1WTW A;  4B3T Q;  1DOM A;  1XTC D;  2K14 A;  4DV6 L;  4LF8 L;  1F9R A;  2F4I A;  2I5M X;  3FDT A;  4GKJ Q;  1X56 A;  3BU2 A;  4FF4 A;  3LWU A;  2KCM A;  5C4J B;  3HKZ E;  1RDP D;  2ENB A;  1D2B A;  1GUW A;  1SSO A;  3CAM A;  4ZLT F;  1LT4 D;  2PQA A;  1VQD A;  1Y1V B;  3AFQ A;  4KN7 C;  3FEW X;  2CW0 C;  5G3L D;  2KA7 A;  1VQ7 A;  1KRS A;  3PUV A;  1T5E A;  2F0Q A;  1DOL A;  2YTY A;  3KJO A;  3OSO A;  5KIX A;  3M4P A;  4CBV A;  4X3S A;  1U5K A;  2JA5 B;  2CKZ B;  4OO1 I;  1QUQ B;  4MIU A;  1KAW A;  2L5T A;  4GLX A;  4AQY Q;  4LUO A;  5IGD A;  5M3F G;  1B70 B;  4QGU A;  3VR3 A;  1PFS A;  3MFY A;  1TT2 A;  4LF5 Q;  5EBD A;  2PQE A;  1G6P A;  2KED A;  5ELN A;  3AMU A;  2L9H A;  4R4O A;  5M5X H;  1JJG A;  2UXC L;  3LWE A;  3HOV H;  2N55 A;  1TWC H;  3J7A 5;  4DR7 Q;  2F0D A;  2B2V A;  2K4K A;  1XMQ L;  4A3D H;  1NNX A;  3I73 A;  2I0Q A;  3KF6 A;  5IWA Q;  2HDL A;  1IL8 A;  1JOK A;  3GTM H;  1YHB A;  4WOR A;  1QIL A;  2BA1 A;  2E8G A;  2Z4I A;  4JPB W;  4WJ3 M;  5A2Q L;  1LT5 D;  4DGZ A;  2L1B A;  4TQU S;  4G7H C;  3BVG A;  3G6E A;  1C48 A;  1RTN A;  4IUP A;  5IT9 E;  5GAD C;  2VY3 A;  3H94 A;  3L9A X;  4KKS A;  1KL9 A;  3Q22 A;  3CC2 A;  4G57 A;  1L1O C;  1PRT B;  5D14 A;  2NB0 A;  2F3W A;  1N33 L;  1U0L A;  2PZT A;  2HD3 A;  3Q23 A;  3U58 A;  3C46 A;  1PVO A;  2F0N A;  2B2W C;  3HOY B;  4OWX B;  4A93 H;  2F1M A;  2JJQ A;  4JOI A;  1CK1 A;  1PFB A;  1ICF B;  1WVL A;  3S1R H;  4KHV A;  1Q7Y C;  1LAB A;  2L0C A;  4KY5 A;  5C4H A;  1EZ6 A;  3FPP A;  1EIG A;  2RQX A;  4PZ8 A;  2JE6 I;  2PYK A;  2A6H D;  1YNX A;  3OHX C;  3S2D B;  3GV6 A;  3I4M G;  1SYF A;  1LTL A;  5C3E G;  1QVF A;  1EL0 A;  1XNQ L;  1JOR A;  1K73 C;  1D1K A;  1VF7 A;  2A73 B;  3C2P A;  1S3O A;  1EIH A;  3KDF B;  3PUW A;  2VQE L;  2MO1 A;  4B3M Q;  4BY1 G;  5C0X G;  1X3P A;  3H6M A;  3C1F A;  3HOZ B;  4HCS A;  1BXT A;  1FNU A;  2L15 A;  4KKU A;  4LUV A;  2NVX B;  5E3F A;  3HOW H;  3R2T A;  1PRT F;  3Q24 A;  3K58 A;  1K0R A;  4H0L C;  2MP1 A;  2LS0 1;  1R4Q B;  5IT9 c;  4RKL A;  5IE8 A;  1S5F D;  4G7O C;  5JVG 3;  2L11 A;  1C8C A;  5I9O A;  2ZM6 L;  2EYF A;  3F2U A;  1FVI A;  4I7Z C;  2B2U A;  4A3B H;  5HY6 A;  1XNR Q;  1S5B D;  4EQN A;  2R7D A;  1GKH A;  5K36 H;  1TII D;  4DV6 Q;  1JT8 A;  4ZKC B;  1HTP A;  2YTX A;  1R9T H;  1WTR A;  1XTD A;  1LT3 D;  4IUR A;  3LNN A;  1G6Z A;  1ILQ A;  2EYL A;  2NVT H;  3MHB A;  4QMG A;  1I6H H;  3LGJ A;  1Q1B A;  3SDZ A;  5JJZ A;  4HCE A;  1JB7 A;  1PH4 A;  3TS2 A;  1HCZ A;  2BCO A;  4KD3 A;  3KLS A;  2D0O A;  4NDX A;  1QVG A;  4QIW E;  1YEZ A;  2ALY B;  3M9B A;  3S14 H;  1I4X A;  2F52 A;  1E2W A;  3HOV G;  4DN4 M;  1BDO A;  2DY8 A;  2KUM A;  4ILW A;  4A3F H;  1MHW C;  4LJZ C;  3J80 E;  4A3D G;  2JA9 A;  3I91 A;  4JG2 A;  1VQG A;  3A74 A;  1SYG A;  4H7B A;  1MI2 A;  1PFN A;  1X3Q A;  1EQQ A;  4H13 C;  2OT2 A;  2R93 G;  2DNC A;  2NUC A;  5H1S E;  5I2Y A;  3N52 A;  3ONA B;  5BN5 A;  1ESF A;  4RHR A;  1QZH A;  1IBL L;  1WJJ A;  3D31 A;  4OIJ A;  3K5O A;  2UXC Q;  1ENF A;  1TWA H;  3RMH A;  2AUJ D;  4C3H H;  3S2H B;  2JA6 H;  2ZXO A;  1VQM A;  2E2I B;  3I2Z A;  2PCF B;  1G8Z D;  1VQC A;  3GTG B;  2Z4H A;  1XMQ Q;  1VQH A;  4GOP B;  2F0S A;  2AQ2 B;  3ERS X;  3QIA A;  1ZYR D;  4RGT A;  1K3R A;  1NMF A;  1GUT A;  1GUG A;  2ICE C;  5LMN W;  4A93 G;  4NXN L;  1RCV D;  4JI5 L;  5CGK A;  1WD1 A;  1SE4 A;  2C35 B;  1Q82 C;  2FJ2 A;  1B7Y B;  3SK8 A;  4QUC A;  4P2C B;  2Q8T A;  1AZQ A;  4DNR B;  2JSO A;  2YTV A;  3ZJY C;  1HNW Q;  3SEB A;  3E9H A;  4P74 A;  1JWS D;  5DM7 3;  5I6Y A;  1CA5 A;  5IT9 L;  5HGQ A;  1N33 Q;  4K5W A;  1VQ5 A;  3Q0A A;  4Y7N H;  1CSP A;  3HKZ B;  1UNS A;  3I4L A;  5HUR A;  3J80 c;  4JV5 L;  1XWE A;  1D7Q A;  3GTL B;  4Y52 H;  3P1H A;  1TY2 A;  3Q6S A;  3NTH A;  2NZO A;  4JI1 L;  1M90 C;  3HOW G;  2Z6K C;  4C56 C;  2Q2T A;  5DM6 3;  4RCN A;  4K5V A;  1ASY A;  4CDC C;  2VW9 A;  1H9M A;  2WIN B;  2JYO A;  2WII B;  3TSS A;  4GN3 B;  1XNQ Q;  1PRT D;  3MA2 B;  1HZ9 A;  1NR4 A;  1D6E C;  4GNX C;  4A3B G;  5K36 G;  2SEB D;  2R7Z B;  1K8M A;  5T1G A;  1LTT D;  1SJH D;  2B2Y C;  1IBK L; 
#chains in the Genus database with same CATH homology
 2IX0 A;  4C3J B;  3VR5 A;  3NQI A;  3S17 B;  2A6H C;  3PV0 A;  3EFX D;  4A3I B;  1UAP A;  1WTO A;  1GOZ A;  1A6X A;  2XRS D;  1SYE A;  4FXK C;  3K5M A;  3DUZ A;  1DXM A;  3MAQ A;  5CV5 A;  3HOU B;  3BS1 A;  1BF4 A;  5D3D A;  3J7Y W;  4KK7 A;  2X6L A;  4LAA A;  5DEH A;  4DAP A;  1VMP A;  2VUM B;  3P75 A;  1ENA A;  3URY A;  3KLS X;  3OWF A;  5I4D A;  4N9T A;  4QF4 A;  4G4K A;  1QOH A;  4TSS A;  1F9P A;  4IUU A;  4C3H G;  3KF8 A;  1O7Y A;  1EQV A;  1I3Q B;  1DCZ A;  4BY7 B;  1M4V A;  4MN3 A;  1SNP A;  2NVY B;  4K2K A;  3SXH A;  3FMC A;  2IL8 A;  5C5L A;  4FNF A;  1PTO B;  1Q1E A;  2QEJ C;  1V1P B;  2F0P A;  2F0V A;  3PO2 B;  3BVM A;  4C3I B;  3S1Q B;  1G29 1;  1KAB A;  1LTI D;  1PFM A;  2CVR A;  1LAC A;  3GO5 A;  3A7A B;  1KAA A;  1PZK D;  4O1N A;  2F3V A;  1TS3 A;  5EKK A;  4ZUJ A;  1QNK A;  5CYU A;  1S5E D;  2I07 B;  4M8A A;  3ERQ A;  2NVQ B;  1CM9 A;  1RF2 D;  5KGU A;  2VB3 X;  3VYS A;  3HOX B;  2KCC A;  1Q8I A;  1A2U A;  1ZYR C;  4F87 A;  1PTO F;  2J7Z A;  2E2J B;  3DMU A;  5C0X I;  2B8F A;  1EYD A;  3VR6 A;  4QB4 A;  5EBC A;  4DF7 A;  3RUZ A;  2A5H A;  4XXE A;  3CU7 A;  4WFN 3;  1HTL D;  4A3J B;  5IGC A;  4IN3 A;  4HR7 B;  1LTG D;  3HEJ A;  2PPB C;  2NYZ D;  2F0F A;  1STB A;  2ID0 A;  2X6G A;  1I4H A;  5NUC A;  1PRT C;  1F2Z A;  2AWO A;  2KVM A;  1Q12 A;  2M00 A;  4ZYS A;  3MXG A;  4IUV A;  1HXY D;  3GP7 A;  3NSW A;  2MHV A;  4ZK9 B;  2O5J C;  1TWH B;  2F0H A;  3C3L A;  2F0G A;  3ERO A;  3NWS A;  4CGY B;  1HPC A;  3L7Z C;  3I72 A;  5IGG A;  2IJ0 A;  2HQE A;  1KDB A;  1PYW D;  2DY7 A;  1VMC A;  2BE5 D;  1VF5 C;  1K8O A;  2F0W A;  4PMC A;  3QOJ A;  1FR3 A;  2A74 C;  2NN6 H;  2H1E A;  5JOB A;  5DNF A;  2F0T A;  2EZV A;  3C1E A;  1B2T A;  3QWN A;  1JWU D;  2MPM A;  2QIL A;  2YYZ A;  1STE A;  1GXD C;  1CTM A;  2PZW A;  3U9S A;  5TSS A;  1SE2 A;  2D2C C;  1I4R A;  1SEB D;  3G6J B;  4IUT A;  4PQX A;  5KYL A;  1FGB D;  1M8A A;  2E2D C;  4RGM A;  1PTO D;  3D3R A;  3HRZ C;  2JA7 B;  1EWC A;  3IFT A;  1A2T A;  1KTK A;  4ZRZ A;  3M3Y B;  4J6H A;  4QUF A;  5C6A A;  2EDG A;  1LTS D;  3MZ5 A;  1SBB B;  1FYC A;  2VXW A;  1LO5 D;  1U4P A;  3RLF A;  4KMU C;  5KRU A;  1PLF A;  2B8G A;  1R4P B;  2B2W A;  2D9U A;  3NBH A;  3NWT A;  3DHQ A;  1KNA A;  3SK4 A;  4BBS B;  2EYH A;  1LTR D;  1STY A;  2WP8 J;  1SJE D;  4IUQ A;  4BBR B;  1TWG B;  2R6G A;  3QB3 A;  1NCV A;  1EY8 A;  3KK7 A;  1GJX A;  2N88 A;  4CJ2 C;  3FVQ A;  2RKS A;  3N6R A;  4DK0 A;  1JIC A;  3AB9 A;  1HQR D;  3BZD B;  3H09 A;  4EQO A;  4O42 A;  4DK1 A;  4G7Z C;  3R8B A;  1TS2 A;  1SYC A;  3T56 B;  1HUM A;  2X69 A;  5CV8 A;  3MEH A;  4K5X A;  5M5X B;  3HOV B;  4HMI A;  1TWC B;  2NN6 G;  1Q3L A;  4B9W A;  3DEP A;  3GTM B;  4CJ0 B;  4Z9C B;  5A35 A;  1I4G A;  1MSG A;  1CQF A;  2PNR C;  4KY7 A;  2HCI A;  3CRK C;  5FO8 B;  1SND A;  1AFP A;  1Y8P B;  5CV9 A;  2QCP X;  3M4Y A;  2C9O A;  1DYQ A;  1SNQ A;  3VYR A;  5IGE A;  2O2L D;  3BVZ A;  1ENC A;  2E74 C;  5C3X A;  2C5C A;  2F0U A;  2OF1 A;  2D5D A;  3S1R B;  4ID6 A;  5KEE A;  3I8Z A;  1WTQ A;  4ZAI A;  2BE5 C;  3J7A F;  3HG9 A;  2K5Q A;  4IQZ A;  3H91 A;  2EJF C;  5JPM C;  1SXT A;  1F2Y A;  4RH6 A;  3PIP 3;  1B9M A;  5DAU A;  4NMZ A;  5CR3 A;  3MWY W;  1F9S A;  4U67 3;  1D1I A;  1S4Z A;  1T5X D;  1KNE A;  1OXS C;  1EY9 A;  3JAM E;  3TDQ A;  4FXD A;  1H9R A;  3DWA A;  5EKI A;  3GV3 A;  5COY A;  2JP1 A;  4KJO A;  3W2D A;  4OGQ C;  2ZXP A;  2EY5 A;  1UEA B;  1PTO C;  5D65 A;  1R9T B;  2XVS A;  2B63 B;  1LTB D;  4KV6 A;  3VA7 A;  2K03 A;  3CRL C;  1I6H B;  1RKN A;  3TP6 A;  4XT3 B;  3OPO A;  3NQT A;  3PUY A;  5J39 A;  1ONL A;  2K33 A;  4NW2 A;  1OXT A;  3NBI A;  3S14 B;  3V05 A;  2FMC A;  1D5X C;  1J8I A;  4IAL A;  4KN4 C;  3SHL A;  4A3F B;  1SE3 A;  2VB2 X;  3ND8 A;  3PIO 3;  3DM1 A;  2B2Y A;  3SR1 A;  5KNC A;  4X3U A;  4RA8 A;  5E1F A;  2AQ1 B;  4M1U B;  3T13 A;  2ICI A;  3SVM A;  4C3H B;  2JA6 B;  3NPP A;  2BOS A;  5C44 B;  2BA0 A;  2TSS A;  4FF1 A;  2A6E D;  4L63 B;  3K5L A;  3E0J A;  2KEC A;  3BG3 A;  2L55 A;  4XQN A;  2EYP A;  1WTP A;  4HTH A;  4RWS C;  3K0Y A;  3MFG A;  4B08 A;  2WB1 B;  4F8M A;  1MGS A;  1H9S A;  3EA6 A;  2E76 C;  2AQ3 B;  1WTV A;  3L3O C;  4OHJ A;  2R92 B;  4Y7N B;  1JCK B;  1G91 A;  3WOE A;  1AEX A;  2EPB A;  2IPK D;  2FFK B;  1E2V A;  3OOC A;  1DOK A;  4KD4 A;  5I9P A;  4MHE A;  2K01 A;  1A3U A;  2F0E A;  3D4D A;  1DD2 A;  4FXG C;  1CHP D;  4FVM A;  3OWE B;  4U68 A;  4YIJ A;  2WAQ B;  1JOO A;  2IT1 A;  2LMC B;  4J1M A;  1MSH A;  4LMQ D;  2E75 C;  2HCC A;  3GTP B;  1GHJ A;  4CKC A;  1AN8 A;  2RDH A;  1IW7 D;  5HGT A;  1BO0 A;  1U4L A;  3H0G B;  1STG A;  5FLX E;  4WRD A;  1EYA A;  1RD9 D;  1YNJ D;  3A55 A;  4RGN A;  5ELE A;  3DXJ C;  2IW3 A;  3GTJ B;  4NKL A;  4HSP A;  3NTK A;  2NZ1 D;  1GUS A;  4X3K A;  3TBI B;  4L6T B;  3J80 L;  4R8I A;  2EOT A;  1Y69 U;  2I46 A;  1WCM B;  2F0M A;  1F9Q A;  1TVX A;  4N9P A;  4ULL A;  2AWN A;  4BWG B;  2K05 A;  1A15 A;  2DN8 A;  3FKI B;  3DWQ A;  1PZJ D;  3A8J E;  3KLR A;  4R8N A;  1S5D D;  3J81 E;  3GTQ B;  3GTK B;  2XN9 C;  1TY0 A;  3VA5 A;  1QJO A;  4XQQ A;  3PUZ A;  3PO3 B;  4DA2 A;  2RDG A;  1IKL A;  1KDA A;  5C4Z A;  2PZU A;  1Y8N B;  2YU9 B;  3QOL A;  1SAP A;  3P7J A;  3D4W A;  3KUP A;  4FYD A;  5CBA E;  5FOB B;  3KBX A;  2Z1C A;  2NTS A;  1KLG D;  1B50 A;  5EKL A;  3AU7 A;  2E2H B;  1JWM D;  5CC4 A;  5ELF A;  3IAY A;  4CHT B;  2RA4 A;  2WAC A;  2KOL A;  4C3J G;  2CHB D;  4C2M B;  2KHS A;  3K5N A;  2WKD A;  2MGS A;  1AP0 A;  2A6E C;  4QIW B;  5EJW A;  1EY0 A;  4QCL A;  2B2T C;  1MD2 D;  1TKW B;  2F03 A;  1U4M A;  4ZUI A;  1KDC A;  2A68 D;  2D62 A;  4DU9 A;  2NBF A;  4K8J A;  2H4O A;  1F2M A;  1XXG A;  3QJY A;  4IFD H;  1QB5 D;  1BNZ A;  3A8K E;  1Z7T A;  4Q0F A;  4KI0 A;  1I4Q A;  2FIN B;  2LKV A;  4CJ1 B;  5BN4 A;  3D8G A;  4PMB A;  4NP5 A;  5FO7 B;  1LLR D;  2TMP A;  5J1Z A;  1ZXT A;  1Z6H A;  4PNY A;  4AYB B;  3M4O B;  3QO2 A;  2XWJ B;  5M3F B;  4OIK A;  1CZW A;  1TU2 B;  1VCI A;  2PW7 A;  2B39 A;  3NE5 B;  2F0J A;  2AUK A;  1TQO A;  1SYD A;  2Z8L A;  4A3K B;  3A7L A;  1BCP B;  4RCO A;  3FRP B;  3EVQ A;  1IW7 C;  1L0X B;  1UUP A;  1SYB A;  2HUG A;  5JEA H;  3M7G A;  1YNJ C;  4HN7 A;  2Y0S B;  1QCB D;  3RZD B;  1E2Z A;  4UDU C;  5KND A;  3TZD A;  4EVO A;  1J9O A;  3D4R A;  3R3O A;  5JAV A;  1JE4 A;  4KKT A;  2EYO A;  4V19 0;  4UAI A;  5LL6 X;  2F0I A;  4LK1 C;  1V8Q A;  3RD4 A;  2PW5 A;  2FHT A;  2XRQ D;  1BR9 A;  3NHH A;  1QWY A;  3J81 L;  1NSN S;  2SNM A;  1G2S A;  2K5W A;  1EEI D;  2JXM B;  1BCP F;  5C5M A;  4H44 C;  4IZ8 A;  5C4X B;  3I4M B;  1OO9 B;  4FP5 D;  5C3E B;  1F2L A;  4B9X A;  1DON A;  4DXF A;  3R93 A;  2DNE A;  4BY1 B;  1K83 B;  4IFD G;  5E4W C;  2ZT9 C;  3W3A A;  2MJ8 A;  3BYY B;  1AW7 A;  1L0Y B;  2QF7 A;  4XT1 B;  2F0O A;  1IYU A;  1RHP A;  3I70 A;  5JVH 3;  3BDC A;  3HGB A;  1OXV A;  2EVB A;  1D5M C;  3MTS A;  5CV7 A;  1JC7 A;  2KQ3 A;  2R3Z A;  5CV4 A;  3EQL C;  3OMC A;  3NUC A;  3T16 A;  5KNB A;  1ET9 A;  2EYJ A;  5E4X A;  2EYM A;  2A69 D;  4Q5V A;  2OEO A;  1DZ1 A;  1IHZ A;  1SMY D;  2A68 C;  4FO2 A;  4JK1 C;  2LY7 A;  1I6V C;  4C1N I;  3LX0 A;  5J22 A;  1PMR A;  2SNS A;  2OXP A;  3BDO A;  1EQT A;  3RZO B;  3CKI B;  4A3D B;  4BS9 A;  1E0B A;  3OIP A;  4BA2 I;  5K5P A;  2R93 B;  1Y8O B;  1FD7 D;  3FPU B;  2J0T D;  5JEA G;  4DXG A;  5EPL A;  3OMG A;  3ITP A;  2RBM A;  5IOD A;  3I90 A;  3X3M A;  5FK9 C;  5EPJ A;  1V1P A;  3IL8 A;  1EY7 A;  4A93 B;  5ELD A;  1BQQ T;  1EWH A;  3MVV A;  2XNA C;  1SNO A;  3GQB A;  1YNN D;  4EGV A;  2K7V A;  5M3M B;  3PUX A;  1BCP D;  4V0B A;  1HA5 A;  3SK6 A;  4L8J A;  4GZY C;  1EZ8 A;  2QKI C;  1I4P A;  3OIQ A;  4F88 A;  4ODG A;  4OL7 A;  2B2V C;  4FF2 A;  5LHY 1;  2RDF A;  1HFG A;  3PMF A;  1MBY A;  1B1Z A;  1B4O A;  1HQM C;  1STN A;  1EU3 A;  3HOW B;  1PXU A;  1V43 A;  2EY6 A;  3MXN A;  1B3A A;  3QG1 A;  2KEE A;  5COR A;  5KYI A;  5I2X A;  4A3B B;  1ICW A;  2NWG A;  2SDF A;  4EQP A;  2M9V A;  3TP7 A;  4IFD J;  2FMM A;  1EOT A;  1VDZ A;  5CBE E;  5EGT A;  1EY6 A;  2JEA I;  3VR2 A;  2NVT B;  3S1N B;  2XWB B;  5C3W A;  4HED A;  3K59 A;  4RGO S;  3D6C A;  2IWH A;  4OO1 H;  3BDL A;  1ILP A;  4IUN A;  1F77 A;  3P20 A;  4DAV A;  1PZI D;  1CZG A;  1TR5 A;  1HA6 A;  3E6Z X;  3WOF A;  1O80 A;  1NUC A;  3S1M B;  1EFI D;  2WV6 D;  5M5Y B;  5I6W A;  1RJT A;  1GUN A;  2K1B A;  1TWF B;  3T51 B;  4E6I A;  3BYT B;  3U9O A;  1TWA B;  3A8I E;  3D6W A;  2Q8R E;  3O13 A;  3IKJ A;  2JEB I;  3VYU A;  2B2U C;  1Z47 A;  3M85 A;  1ML0 D;  2V4D A;  3HS0 C;  1CFM A;  2A69 C;  4DAY A;  3V96 A;  1W6K A;  2SOB A;  1SMY C;  3G7L A;  5T1I A;  2O4X A;  5JEA J;  3NXW A;  4HSV A;  4K2L A;  3T4A C;  5IIF A;  2ZXR A;  5IGB A;  1G2T A;  3A56 A;  1OXX K;  1SFO B;  2EJM A;  2XSC A;  3X3N A;  3ZYY X;  1BBX C;  5IGF A;  1GUO A;  5EPK A;  4ZQ3 A;  3TP8 A;  4K6L A;  1JOQ A;  1C4Q A;  1TS5 A;  3CQZ B;  4FF3 A;  2BDO A;  3DEO A;  1EEF D;  1U4R A;  2K28 A;  5ISR A;  4XIG S;  3GD7 A;  3UI2 A;  2MUY A;  2RSN A;  4IFD I;  4A3G B;  5C0X J;  1W6J A;  3K7A B;  3EJI A;  1Q90 A;  5F2D A;  1YNN C;  5BN3 A;  2CQA A;  1ZKO A;  2G9H D;  4XDX A;  3JAM L;  2VNU D;  4KTA A;  2IX1 A;  1BCP C;  4OO1 G;  2HDM A;  4S3S A;  3DWP A;  3IFD A;  4PMW A;  4HAE A;  4K14 A;  1GHK A;  3HZX A;  4KHZ A;  1JR0 D;  1PDQ A;  1CI3 M;  1STH A;  1A3V A;  5FKA C;  1WTX A;  2KJX A;  1BOS A;  5ELB A;  4R9W A;  2R61 A;  1PTO H;  1U9R A;  2B2T A;  2NTT A;  2F0K A;  3NTI A;  2NN6 I;  1II3 A;  1O7L A;  3I3C A;  1CQV A;  1HRJ A;  1H9J A;  3VR4 A;  3CHB D;  2J4X A;  3H3V C;  3V2T A;  2LFN A;  4K6D A;  3OW7 A;  1CT1 D;  1O78 A;  2L12 A;  4RKB A;  4X3T A;  3MC0 B;  1LV9 A;  1XYI A;  2RVL A;  4XYQ A;  1LT6 D;  3S9W A;  3S15 B;  3S16 B;  3NK9 A;  3TME A;  1DJR D;  1EY4 A;  3K57 A;  2CW0 D;  4K8I A;  4HMJ A;  1WD0 A;  4DNT B;  4A3M B;  1ZEQ X;  2Q8I B;  3E5S A;  2G9D A;  4WJW A;  4PV1 C;  1CA6 A;  2O5I C;  1STA A;  4TKO B;  1SNM A;  1A3T A;  1QE6 A;  1SDF A;  1HUN A;  2RSO A;  5LL6 S;  2XIW A;  5JPN C;  4RAU C;  4DFA A;  1FNV A;  1NAP A;  1O7Z A;  5ELC A;  3MXP A;  3TP5 A;  4C1N K;  5CMD A;  2K32 A;  2PO4 A;  1NR2 A;  1ET6 A;  1QG7 A;  2WKC A;  4ZKB B;  1EYC A;  4J8Q A;  5EQ0 A;  5G3L F;  1X32 A;  1KLU D;  5M9O A;  3T53 B;  3GTO B;  2EXZ A;  3M7N A;  1JQY D;  2EY1 A;  1B53 A;  4CKB A;  1HFN A;  2QDB A;  1EU4 A;  3KBG A;  1LTA D;  1XX8 A;  3ND9 A;  3SE0 A;  5IOC A;  1IKM A;  1B9N A;  3K6O A;  3TN2 A;  3R2I A;  5A2Q E;  1RTO A;  2PMZ B;  2IX3 A;  4RFB A;  3I4N B;  2K04 A;  5FLX L;  4C3I G;  1S5C D;  2EY2 A;  4KY6 A;  1FNW A;  5M5W B;  4F7X A;  2JA8 B;  4I65 A;  1CHQ D;  1D5Z C;  2KCN A;  5FO9 B;  4JBW A;  3SK5 A;  2M2L A;  5CV6 A;  3MXU A;  3NP8 A;  2K5D A;  1H9K A;  4CKE A;  3WDN A;  1I50 B;  2EE1 A;  1EY5 A;  3HP3 A;  1H9S B;  1ESR A;  3VYT A;  3TZU A;  2L4N A;  1JB3 A;  1SNC A;  5D3I B;  4XYO A;  4XTC S;  4KJN A;  2F0L A;  1V1O A;  2BDN A;  5AFW A;  1AZP A;  4TRD A;  1QNU A;  4XQJ A;  1DM0 B;  1Y1W B;  2K6A A;  1HHV A;  4ABN A;  1OXU A;  1ROD A;  2GA4 B;  4RHS A;  2EJG C;  3A54 A;  4A3E B;  4BA1 I;  1BUV T;  3J7A V;  1IYV A;  1B44 D;  4ME5 A;  5C0X H;  1TS4 A;  1WTW A;  1DOM A;  1XTC D;  1F9R A;  2F4I A;  3FDT A;  4FF4 A;  3LWU A;  5C4J B;  1RDP D;  2ENB A;  1D2B A;  1GUW A;  1SSO A;  4ZLT F;  1LT4 D;  1Y1V B;  4KN7 C;  3FEW X;  2CW0 C;  5G3L D;  2KA7 A;  3PUV A;  1T5E A;  2F0Q A;  1DOL A;  3OSO A;  5KIX A;  4CBV A;  4X3S A;  2JA5 B;  4OO1 I;  4MIU A;  2L5T A;  5IGD A;  3VR3 A;  3MFY A;  1TT2 A;  5EBD A;  2PQE A;  2KED A;  3AMU A;  2L9H A;  3LWE A;  2N55 A;  2F0D A;  2B2V A;  3I73 A;  2HDL A;  1IL8 A;  1JOK A;  4WOR A;  1QIL A;  2BA1 A;  2Z4I A;  5A2Q L;  1LT5 D;  4DGZ A;  2L1B A;  4TQU S;  4G7H C;  3BVG A;  1C48 A;  1RTN A;  4IUP A;  5IT9 E;  3H94 A;  3L9A X;  4KKS A;  3Q22 A;  4G57 A;  5D14 A;  1PRT B;  2NB0 A;  2F3W A;  2PZT A;  3Q23 A;  3C46 A;  2F0N A;  2B2W C;  3HOY B;  2F1M A;  1CK1 A;  1PFB A;  1WVL A;  4KHV A;  1LAB A;  2L0C A;  4KY5 A;  5C4H A;  1EZ6 A;  1EIG A;  3FPP A;  2RQX A;  2JE6 I;  2PYK A;  2A6H D;  3OHX C;  3S2D B;  3GV6 A;  1SYF A;  1EL0 A;  1JOR A;  1D1K A;  1VF7 A;  2A73 B;  3C2P A;  1EIH A;  3PUW A;  5C0X G;  1X3P A;  3H6M A;  3C1F A;  3HOZ B;  4HCS A;  1BXT A;  1FNU A;  4KKU A;  2NVX B;  5E3F A;  3R2T A;  1PRT F;  3Q24 A;  3K58 A;  4H0L C;  2MP1 A;  2LS0 1;  1R4Q B;  4RKL A;  1S5F D;  4G7O C;  5JVG 3;  2L11 A;  1C8C A;  5I9O A;  2EYF A;  3F2U A;  4I7Z C;  2B2U A;  1S5B D;  4EQN A;  5K36 H;  1TII D;  4ZKC B;  1HTP A;  1WTR A;  1LT3 D;  4IUR A;  3LNN A;  1G6Z A;  1ILQ A;  2EYL A;  3MHB A;  4QMG A;  1Q1B A;  3SDZ A;  5JJZ A;  4HCE A;  1HCZ A;  2BCO A;  4KD3 A;  3KLS A;  4NDX A;  1I4X A;  1E2W A;  4DN4 M;  1BDO A;  2DY8 A;  2KUM A;  4ILW A;  4LJZ C;  3J80 E;  3I91 A;  1SYG A;  4H7B A;  1MI2 A;  1PFN A;  1X3Q A;  4H13 C;  2OT2 A;  2DNC A;  2NUC A;  5I2Y A;  3N52 A;  3ONA B;  5BN5 A;  1ESF A;  4RHR A;  3D31 A;  4OIJ A;  3K5O A;  1ENF A;  3RMH A;  2AUJ D;  3S2H B;  2ZXO A;  2E2I B;  2PCF B;  1G8Z D;  3GTG B;  2Z4H A;  2F0S A;  2AQ2 B;  3QIA A;  1ZYR D;  4RGT A;  1GUT A;  1GUG A;  2ICE C;  1RCV D;  5CGK A;  1WD1 A;  1SE4 A;  2FJ2 A;  3SK8 A;  4QUC A;  4P2C B;  2Q8T A;  1AZQ A;  4DNR B;  2JSO A;  3SEB A;  1JWS D;  5DM7 3;  5I6Y A;  1CA5 A;  5IT9 L;  4K5W A;  3Q0A A;  3HKZ B;  5HUR A;  1UNS A;  3I4L A;  1XWE A;  3GTL B;  3P1H A;  1TY2 A;  3Q6S A;  3NTH A;  4C56 C;  5DM6 3;  4RCN A;  4K5V A;  1H9M A;  2WIN B;  2JYO A;  2WII B;  3TSS A;  1PRT D;  3MA2 B;  1NR4 A;  1D6E C;  5K36 G;  2SEB D;  2R7Z B;  1K8M A;  5T1G A;  1LTT D;  1SJH D;  2B2Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...