3GTPH

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtpH00
1OXUA 1H95A 3CCUA 4YCVA 4B3TQ 3NENA 2JA5G 2KHJA 3CCEA 3PCOB 2V1CC 4UP7A 3WWVA 2CCZA 2JA8H 3RLOA 4X66Q 4JI2L 1HZ9A 1E7ZA 2N49A 3BU2A 2JA6H 2E5LL 4XTCS 2YTXA 1YI2A 4NB3A 2Z6KA 2CFMA 4QIWE 1PH3A 4RMFA 1EWIA 2VUMH 1JB7A 1XJVA 1L1OB 1HNZQ 1WJJA 4A3MH 3TREA 2ZTEA 3HKZG 4YCUA 1I94L 4NXMQ 4BBRH 3CCLA 4LF9L 5IYDG 1JJGA 4IJLA 3A74A 1YHQA 3I4NG 4KHPL 1P8LA 4DUZL 2WFWA 3GTMH 1VQ6A 3CP0A 2UUBL 2A19A 4LFCL 5M5YH 1HNXL 2JA7H 2YTVA 3UE1A 3OYYA 2R92H 3UDIA 2RHQB 5EAYA 2Y0SG 1PH5A 3I4MH 1L1OC 4JI2Q 4YWKA 2EIFA 2YTYA 1CKNA 2JA9A 3PUYA 1SRUA 2E5LQ 1TWCH 3CC2A 3H3VH 4R1JA 4C3IH 4PZ8A 5M3FG 4X65L 2R7DA 4YCWA 1O7IA 4APVA 4LF8L 1N36L 1PHJA 4DPGA 1SN8A 3PIPA 1VQMA 4LW1A 4DV2L 3CCMA 1FVIA 2VL6A 3F8TA 4PG3A 1I94Q 1VCIA 2LXJA 2VQEL 1XPRA 4LF9Q 3S2HH 1KXLA 2I5MX 3PIOA 2NVXH 2N78A 4KHPQ 4DV0L 5C0XJ 4A3BH 2A1AA 2JEAI 3GD7A 4A3FH 2UUBQ 1V43A 1XTDA 4LFCQ 1VQNA 2OTLA 3S15H 1HNXQ 1VQ5A 5LMUL 4NXNL 3KFUA 1YBYA 3AFQA 3OW2A 2F4VL 5M3MG 4PZ7A 1X55A 3L0OA 1RIPA 1WYDA 2ES2A 3ULPA 2NN6I 2WB1E 4R4IA 4IFDI 4P71A 4A3KG 4A3DG 1HZCA 3VDYA 3HKSA 1S72A 3I7FA 4TQUS 4LUOA 3FKIG 1Q82C 2I5LX 4LF8Q 2JQOA 4X65Q 2B3GA 5C3EH 3S1NH 2IHFA 1N36Q 1Y1VG 3CAMA 1N9WA 3PUXA 1IZ6A 3A0JA 5IP7H 3TS2A 5J3BA 1VQCA 2EXDA 4IPDA 1VQDA 4DV2Q 5C4XG 4AYBG 3CMEA 4POGA 1WCMH 2VQEQ 1YIJA 3PUVA 2D0OA 1YJ9A 1EFWA 4BA2I 1I6HH 4DV0Q 2Q2IA 4DR4Q 2JA8G 1HJPA 1LTLA 2XTIA 2WAQG 3TS0A 5LMUQ 4NXNQ 4P74A 3BJUA 2JA6G 1VQ9A 1KD1C 2F4VQ 5FLMH 4LFAL 2PQAA 3J7ZC 1SROA 5HGQA 2JE6I 2E8GA 4DUYL 2VUMG 5LMNL 4DR7L 1EIYB 5JJKA 1W3SA 4A3CG 3HOWH 4A3MG 4JYAL 1QZHA 4DV1L 3A5ZB 4HJ5A 1CKMA 4BBSH 4GN4B 2I5HA 4OONA 1GVPA 3MXNB 1PH9A 2CWPA 2VQFL 2YV5A 2NZOA 3DM3A 3T1YL 2R92G 4LUVA 1K73C 1KRTA 2K75A 2E2IH 1KRSA 2JJQA 2ZTDA 4RG1A 3I4MG 3CC4A 1X6OA 4DR2L 1T9HA 2DUDA 4DR1L 2QEXA 1DGSA 1UWVA 2XGTA 5E7NA 4LFAQ 4A3LH 4L5TA 1E22A 1HR0W 4DV6Q 4DUYQ 4DR7Q 2KHIA 5LMNQ 5GAGC 3AQQA 2BA0A 1KHIA 2FXQA 2DGYA 3G48A 3KF6B 3J80c 4DV1Q 1EUJA 4HJ9A 2B63G 2PMZE 1PH7A 3FP9A 4DNIA 1E1TA 1V9PA 1E1OA 3KF6A 3CCQA 4GOPC 4A3BG 3JAMc 1Z47A 4A3FG 4A3IH 2UUAL 3S1RH 2VQFQ 4DR6L 1C7YA 3NELA 2Q2UA 4QJFA 3CCRA 3HFZB 4AQYL 2UUCL 1LM0A 3G71A 4BXXH 1N8RC 4JI3L 1I50H 2PI2E 1QUQA 2LSSA 4DR2Q 1M90C 3L7ZC 4DR1Q 4JI6L 1ASZA 4GN3B 4A76A 1BVSA 1D8LA 3F1ZA 4PMWA 4Y52H 5C3EG 3PGZA 5IP7G 3STBC 2E2JH 3RZOH 3E0EA 3KYHC 4WJ3M 3W1BA 3HOUH 2CKZB 4LFBL 4IPCA 4GOPA 1IXRA 1CSPA 1XNRL 4UPAA 3K80C 1SR3A 4JCVE 5FLXc 1OTCA 3S16H 3S2DH 1HNWQ 5H1SE 5M5WH 2NVYH 2UUAQ 3GO5A 2KCTA 3M9BA 2L15A 2BA1A 4DR6Q 4LWCA 2K52A 5JJIA 3NEMA 5IYBH 5FLMG 1QZGA 4BY1H 1A63A 4JI8L 4AQYQ 4JI7L 4IO9A 2UUCQ 4OWWB 4XIGS 4QQBX 1VQKA 4JI3Q 5M5XH 2ZJRA 4OWXB 1CKNB 4JI6Q 4GNXA 3K81C 1PVOA 4L5QA 1NMFA 4KHZA 3FHWA 4BBSG 1BBWA 4B3RL 1VQLA 1S40A 1BBUA 1PYSB 5GROA 5IT9c 2CWAA 4TVAB 4DKAC 1J5EL 1K3RA 2F52A 3J80i 1QVFA 3M7NA 1XNRQ 4LFBQ 5C0XI 5AJ3Q 1I3QH 2NN6G 2OQ0A 2ZJPA 1EYGA 4IPGA 4DAMA 1K9MC 1JJ2A 4IFDG 2R93H 4A3JH 4KLKA 2HIXA 1V1QA 4C3JH 3J81c 4HIMA 2MO1A 2OCEA 3W5OA 5FJ8H 2NVTH 1HNWL 4LF5L 2K5HA 5JEAG 3F2DA 2E2HH 4DR4L 4JI8Q 3JC66 3CCJA 4A3LG 4JI7Q 2D62A 2KBNA 2BH2A 3BZCA 1EOVA 3EN2A 2VNUD 4K0KL 4EX5A 4BY7H 1YHAA 1E3PA 1VQ8A 1HH2P 1WI5A 3CW2C 4B3RQ 2NZHA 3HOZH 1HZAA 1PH8A 4JBKA 1J5EQ 4A3IG 1FGUA 1UE5A 2KENA 2UXDL 4X62Q 3T1YQ 1VQ4A 3ULJA 4DK3C 4UY8C 3S1QH 1MKHA 1X3FA 3KF8B 3L2PA 2HHHL 1QVGA 1XNQL 4GKKL 2ZM6L 4BXXG 1XPUA 4UP9A 1VQEA 4HJAA 4LF5Q 1X3GA 5ELOA 4L5SA 1KAWA 4HIDA 1G6PA 5ELNA 1IBLL 4JC0A 2YYZA 2PQAB 2MO0A 3LGJA 3HOVH 4MTNA 2HIVA 1JJCB 1VQPA 4JI0L 4QY7A 4C3HH 1S3OA 4YWLA 3S24A 2A8VA 4K0KQ 1X65A 1CUKA 1K83H 5IP9H 4DV6L 3KJOA 3CPWA 1NBWA 1JT8A 5DLQE 4PZ6A 1PV4A 3H15A 4BBRG 1FJGL 2VY3A 1MJEA 3CCVA 2UXDQ 2ALYB 2MFIA 3PO2H 5IYBG 2WB1G 4BY1G 4P72A 1GD7A 2HHHQ 1XNQQ 5IY0A 2ASBA 1EQRA 2NVQH 3HOYH 1U0LA 2JEBI 3PUZA 2ZM6Q 4DV3L 4GKKQ 4JBWA 2IX0A 2JA7G 3J81i 3I4NH 4AH6A 1G291 3M3YH 1X9NA 5GADC 4LUZA 1IBLQ 1IBKL 1J6QA 1XMQQ 1YITA 1X3EA 3PF4A 1Q7YC 4JI0Q 1PYBA 2EQSA 3CMAA 4GKJL 2AWNA 2R6GA 2OWOA 4B3SL 4YWMA 3TRZA 4B3MQ 3GTLH 2VS1A 2VZAA 1Y1WH 2R93G 2K50A 1VQ7A 3J81j 4A3JG 1FJGQ 3CF5A 1U5KA 2ZJQA 1RL2A 4A75A 1Q8KA 1IYJB 2K14A 1QVCA 1CSQA 5FJ8G 1PFSA 2B29A 4JOIC 5C44H 3UDXA 1Q12A 1B70B 3TEHB 4AIMA 1ASYA 4LF4L 4DV3Q 2IX1A 2RCNA 1OXTA 4A93H 2LXKA 3M4QA 3CQZH 4JI5L 4DV4L 4LNQA 3B6YA 3EIVA 1QUQB 3OTOL 4DK6C 3U50C 4MZ9A 1L2FA 3UE0A 1UE6A 4P75A 3E9HA 4R4OA 3RLFA 4BY7G 1IBKQ 3ER0A 3GDEA 2RF4A 3HKZE 4Y7NH 4X64L 1UE7A 1X56A 3H0GH 3GTQH 3ZJYC 1B7YB 4GKJQ 4JI1L 4GNXC 4DR3L 1PH1A 4B3SQ 2PI2A 1Q86C 4A3KH 1NMGA 3M85A 4GOPB 1YNXA 2IT1A 4H02A 4EQ5A 4YHHL 1IBML 1GO3E 4R4QA 1X54A 3FKIH 3KDFA 1PH4A 1YEZA 3K7AH 1WCMG 4JOIA 4OO1I 5AJ3L 1B8AA 2Y0SE 2ID0A 3PF5A 4GS3A 2UXCL 4LF4Q 1GM5A 2ATWA 1SLJA 2N3SA 1OXSC 2GVBA 1VQOA 4DV7L 3HOVG 3M4OH 4DV4Q 4DR5L 1HR0L 3G4SA 4JI5Q 4GLXA 3I4OA 3OTOQ 4IJHA 3RR5A 1GKHA 4GNXB 5C0XG 4POFA 3PSIA 1VQBA 3DLLA 5IP9G 3UDGA 5IYCH 1NE3A 5HY6A 1PA6A 2QGQA 4X64Q 3HOWG 1JMCA 4ME3A 1OXVA 2Z0SA 4NPSA 4L5RC 4JI1Q 4DR3Q 1UE1A 4ALPA 4OX9L 3PO2G 3U4VA 3RN2A 4YHHQ 1IBMQ 4A3CH 2YU9H 1D7QA 3HOYG 3G6EA 3GTGH 1JE5A 4QGUA 1KL9A 1L1OA 4X62L 1K0RA 4J15A 2MQHA 1L0WA 1YZ6A 4OWTB 4DV5L 1W2BA 1N33L 2I0QA 2UXCQ 1VS0A 3JAMi 3AEVA 4DV7Q 1YVCA 3GTOH 4A3GH 1HR0Q 4DR5Q 3A5UA 1LYLA 3GTKH 4UP8A 4A3EH 1NTGA 4AYBE 1MJCA 4HJ7A 3PUWA 1Q81C 3IRBA 1SE8A 3RN5A 1I5FA 1M1KC 3HOZG 1Y1WG 4JBMA 2Q2TA 5K36G 4OX9Q 1G51A 1VQIA 3HOXH 1YJWA 3STBD 4C2MH 3GTJH 5C44G 1Q1EA 2WAQE 1YJNA 4IOAA 4O0AA 2HQLA 2HT1A 1C9OA 1YHBA 4BA1I 5BR8L 3S17H 2B63H 4JI4L 1HZBA 3EBEA 5LMNW 4A93G 5IWAL 3CCSA 4DV5Q 4LF7L 3K0XA 3RLNA 4DUZQ 3D0FA 2VW9A 1N33Q 3K7UC 1IL2A 3PO3H 2R7ZH 2UU9L 3F2CA 3H0GG 5GAEC 4YY3L 2CQOA 2GVAA 3KJPA 1XPOA 1NJIC 2OTJA 1XMQL 3E9IA 1Z9FA 2GN5A 1A62A 2JA5H 3CPFA 4JBJA 1OXXK 1VQFA 3HOUG 2N8NA 2K5NA 3CD6A 1VQGA 2ZTCA 1AE2A 1TWGH 3RZDH 4B3ML 4IOCA 4IFDJ 1TWFH 1BKBA 5BR8Q 1P16A 2WP8J 3AYHB 4JI4Q 4A4IA 3M4PA 1SFOH 5JEAJ 4WJ4A 2AHOB 5IWAQ 4HIOA 3KLWA 2AMCB 3ICEA 4LF7Q 2AWOA 4HIKA 2UU9Q 1N34L 3ULLA 1CKOA 1TWHH 2UXBL 5IYDH 5IYCG 3I55A 4R4CA 2AKWB 4O2DA 4IPHA 2QA4A 4YY3Q 3RNUA 1XMOL 1K8AC 1AE3A 4X6AH 1TXYA 3I56A 5IE8A 1NY4A 3T1HL 4HJ8A 1EIFA 2Q2HA 1VQHA 1N32L 4R4TA 1KIXA 1Y14B 4OXPA 4LF6L 3UDFA 3ERSX 1PH6A 2F3IA 3PV0A 1VQAA 1AH9A 1WFQA 1Q46A 2KCMA 5GQOA 3TQYA 4GLAC 3F2BA 5M3FH 4MNOA 1PH2A 4JV5L 4GN5A 3Q8DA 5GAHC 4A3GG 1SMXA 1UEBA 1R9TH 5JJLA 2IHEA 2IY5B 1A8VA 5C4JH 3BZKA 1N34Q 4A3EG 2UXBQ 4B3TL 2C35B 1VQJA 1WOCA 3W1GA 2H5XA 3CC7A 2K4KA 3K8AA 3U58A 4OO1G 1FL0A 4P73A 1XMOQ 4X66L 1C0AA 2D0PA 4FDBA 3HOXG 3S14H 1MIUA 1Q1BA 5M3MH 3T1HQ 4DAYB 1A0IA 1KQSA 3AFPA 1N32Q 3MEFA 3NBHB 4GLVB 2PNHA 4LF6Q 4JG2A 3I2ZA 1E24A 3KDFB 4KI0A 4A3DH 4JYAQ 3J7A5 2MNAA 1HNZL 2K5VA 2Z6KC 3CXCA 2RHSB 1KC8C 2OQKA 3PO3G 1LUZA 2BH8A 3S1MH 1EQQA 4JV5Q 2R7ZG 4NXML 3GTPH 3H3VI 3U4ZA 1Y1VH 2JK8A 3KOJA 3SGIA 3D31A 4QL5A 1K8GA 5C4XH 1TWAH 2R7FA
chains in the Genus database with same CATH superfamily
3OWEB 4K5VA 1LT3D 1Y1WB 4C3HG 2KHJA 3CCEA 4UP7A 1LTGD 3WWVA 3H91A 1K8OA 5KYIA 3I70A 2CFMA 4M8AA 3AU7A 1JB7A 1HNZQ 1L1OB 1D2BA 1VF7A 2HDLA 1LTRD 1Y8NB 4BBRH 3CCLA 4LF9L 5T1IA 3H0GB 3I4NG 1RTOA 1P8LA 3CP0A 2UUBL 4A3KB 3TP6A 1JWMD 2J4XA 5ELDA 3T56B 3K7AB 4HCEA 3GTPB 5DM73 3I4MH 4JI2Q 4YWKA 1ONLA 2EIFA 1CKNA 1TR5A 1LT5D 2JA9A 1IKMA 4AYBB 5L37A 4R1JA 4YCWA 3HS0C 1N36L 4DPGA 2F0DA 1VQMA 4DV2L 3CCMA 1LLRD 2VL6A 2VQEL 3S2HH 3RUZA 2I5MX 1K8MA 2N78A 1PZID 4A3BH 2JEAI 3ERQA 3Q0AA 3SDZA 1GJXA 4NXNL 4CKCA 3OW2A 4ZCKA 1BQQT 2A68C 3E3XA 2WB1E 4A3KG 1EEID 4TQUS 1Q82C 4DU9A 3D3RA 4A3GB 2K01A 2KCCA 1IZ6A 1HRJA 3P1HA 1CT1D 4KN7C 4AYBG 2P5ZX 4NP5A 5BN3A 1CA6A 1LABA 1I6HH 3EQLC 2PZTA 2JA8G 2FHTA 1LTLA 1SBBB 1T5EA 3P7JA 2WAQG 3H09A 2NBFA 3J7AV 1WTHA 4O42A 2JA6G 3S17B 2PQAA 3J7ZC 2L11A 2PCFB 2Q8IB 4KY5A 3R8BA 2VUMG 1SNMA 5LMNL 5LL6X 2WV6D 1W3SA 4IQZA 1HFNA 1CHPD 1EU3A 1EYCA 2CWPA 1II3A 2YV5A 2VQFL 2KECA 4KKSA 3J80E 1GUNA 3S1NB 5C3EB 3RZDB 1W6JA 2ZTDA 4FF4A 1T9HA 2DUDA 4DR1L 2QEXA 1UWVA 4LFAQ 3QJYA 4DV6Q 2FINB 4YIJA 1EIGA 2KHIA 4KY7A 4DGZA 2FXQA 4KD4A 1JORA 2PMZE 3FP9A 4RKBA 2K5QA 4DNIA 1F2YA 2EYMA 3Q22A 1UUPA 4Q5VA 4GOPC 3JAMc 5TSSA 4XYQA 1C7YA 4QJFA 1YNJC 1TY0A 5IGEA 4P2CB 2UUCL 1EYAA 2L9HA 3SK5A 2PI2E 3TP7A 2LFNA 5M3FB 3F1ZA 4L63B 4PMWA 5C3EG 1LTAD 4DFAA 1R9TB 3STBC 3SR1A 1SYDA 2CKZB 1A3UA 3J80L 3WOFA 2KUMA 5FLXc 1HNWQ 3EFXD 4CDEC 3S14B 1SDFA 1T5XD 3GO5A 2UUAQ 3VYSA 2KCTA 2K52A 3TZUA 5IYBH 4A3DB 1DONA 4HSPA 4JI7L 1VQKA 1Y8PB 3A7AB 3FDTA 3TDQA 5M5XH 1CKNB 2EXZA 1ENAA 3FHWA 3E5SA 1CZWA 5BN5A 1EQVA 1PYSB 3X3MA 5CBEE 1JOQA 4DKAC 1K3RA 1EU4A 4DAMA 1K9MC 4IFDG 2F0UA 3IAYA 1V1QA 3C2PA 1CTMA 5FJ8H 2K5HA 4JI8Q 3SEBA 5I2YA 3N6RA 5C3WA 3S16B 2BH2A 3BZCA 1BBXC 4BBRB 2VNUD 4EX5A 4IUNA 4K8JA 1E3PA 1HH2P 1WI5A 2XWJB 4B3RQ 4X62Q 1VQ4A 3I4MB 3KF8B 3L2PA 2ZM6L 2QF7A 4UP9A 3R3OA 4HJAA 2D9UA 4MHEA 1G6PA 2EY1A 1L0YB 2PQAB 3LGJA 2Z9HA 1VQPA 1MI2A 1DOMA 1NAPA 2RA4A 2RDGA 1L0XB 3KJOA 2NVTB 3KK7A 4A3BB 1Q3LA 5DLQE 4BBRG 2G9HD 1EZ8A 2MFIA 3Q6SA 1ENFA 3KLSA 4BY1G 1XNQQ 3HOYH 2NVQH 1EQRA 1BNZA 4BWGB 2JEBI 4DV3L 4H0LC 3R2TA 4AH6A 4CHTB 1SMYD 1I4GA 3PIP3 5EKKA 1J6QA 4KJNA 4JI0Q 3M4YA 3PIO3 2KQ3A 4GKJL 2G5DA 1I6HB 3K59A 1XXGA 4YWMA 1CK1A 1HCZA 5COYA 2VS1A 1ET9A 2R93G 4A3JG 3CF5A 1U5KA 2B2WC 3NXWA 2EDGA 3UDXA 2RQXA 1B53A 2B2YA 1RJTA 3CQZH 3B6YA 4EVOA 1QWYA 3OTOL 1L2FA 3UE0A 1RHPA 1SE4A 4P75A 3RLFA 4ZAIA 2FFKB 1IBKQ 2K28A 2RF4A 3PO2B 4N9PA 2SEBD 4Y7NH 1ET6A 4X64L 3K6OA 3IKJA 1UE7A 4RA8A 1B7YB 1J9OA 4GNXC 2A69D 3QOLA 3M85A 1RDPD 3NBHA 4EQ5A 1IBML 1EY8A 1GO3E 4R4QA 1X54A 3KDFA 1YEZA 4OO1I 4JOIA 1E2WA 1V1OA 5AJ3L 1B8AA 1SYFA 2F0TA 2KOLA 3T53B 1UAPA 2RCFA 1GM5A 1SLJA 2ATWA 1OXSC 3M4OH 4FXDA 1EWHA 4DV4Q 4JI5Q 3BDLA 4GLXA 2JSOA 4B9XA 3L9AX 4KN4C 4B9WA 3RR5A 4F87A 4QB4A 3U9SA 1PA6A 1X3QA 3P20A 2CH4A 2EZVA 4ME3A 3NQTA 4DF7A 1G91A 3PO2G 3HRZC 2YU9H 4RHRA 1SYCA 3G6EA 3GTGH 4RCNA 1GXDC 1KL9A 2EE1A 2H4OA 4K8IA 4DV5L 3GTQB 2I0QA 1ILPA 5I4DA 3JAMi 3KBGA 4DR5Q 1LYLA 3FEWX 3GTKH 3A8KE 4UP8A 1MJCA 1WD1A 3PUWA 1Q81C 1SE8A 1I5FA 4OO1H 4H13C 5CV9A 1I4PA 4OX9Q 1VQIA 1YJWA 5AFWA 4C2MH 5C44G 1Q1EA 4IOAA 4BA1I 2F0PA 5M5XB 2F03A 4JI4L 2B63H 3EBEA 3CCSA 5CMDA 3D8GA 1IL2A 3D0FA 2VW9A 2OT2A 3AMUA 3NK9A 1HHVA 1BCPC 3KJPA 1NJIC 2GN5A 3NE5B 1A62A 1PDQA 5CV7A 4HN7A 1VQFA 3W3AA 2N8NA 2K5NA 3AB9A 1AE2A 1ML0D 1S5BD 4B3ML 3I90A 4IOCA 3C1EA 1P16A 2NUCA 1PRTF 1SFOH 5JEAJ 4HIOA 3ULLA 1CKOA 3GTJB 3QO2A 4R4CA 2AKWB 3I55A 4IPHA 3HGBA 4YY3Q 3MHBA 1H9RA 1IHZA 3HEJA 2KVMA 3C46A 2XVSA 3T1HL 2K33A 4HJ8A 4IURA 2R7ZB 1G6ZA 1IW7D 4LF6L 3ERSX 4L6TB 1EY9A 2K5WA 1WFQA 1Q46A 2KCMA 4H44C 3F2BA 4MNOA 1EY5A 4ULLA 1UEBA 3OHXC 4WFN3 2NN6H 2IHEA 3C1FA 1O80A 2UXBQ 1BXTA 3V96A 1VQJA 4FVMA 1RCVD 4ABNA 4RAUC 3EJIA 1O78A 3HOYB 3HKZB 1CI3M 1N32Q 3NBHB 3KDFB 2EY6A 3MFGA 3EROA 2IJ0A 1KC8C 2OQKA 3S1MH 1B1ZA 2BH8A 1EQQA 2R7ZG 1ZXTA 3GTPH 2B8GA 5JVH3 3H3VI 3H6MA 1EWCA 4ZKBB 1MSHA 1K8GA 1XX8A 4HEDA 1OXUA 1H95A 3CCUA 1LTTD 5J22A 4YCVA 2R3ZA 3MXNA 5J1ZA 1QOHA 3PCOB 2V1CC 2CCZA 4XQNA 2JA8H 3RLOA 4X66Q 3DWAA 3J7YW 5CV8A 2JA6H 2E5LL 2YTXA 3D4DA 1YI2A 2Z6KA 3CQZB 1ZKOA 4I7ZC 2VUMH 1TKWB 3TREA 2VXWA 3HKZG 1I94L 4NXMQ 4Y7NB 3ONAB 5IYDG 1JJGA 1I4QA 3I91A 1YHQA 2EPBA 1LACA 4DUZL 4LFCL 4TSSA 1U4MA 1SYGA 1PTOC 4DK0A 1O7YA 5EAYA 2Y0SG 1PH5A 2YTYA 3PUYA 1SRUA 1TWCH 3CC2A 1TS3A 4IUTA 1UEAB 4LF8L 3H3VH 4X65L 5C5MA 1MHWC 2CHBD 5I6WA 3NWTA 3PIPA 1FVIA 5I2XA 2CW0C 1KXLA 5KNBA 4FYDA 3PIOA 4KHPQ 4DV0L 4XDXA 2E2DC 1XTDA 3S15H 1NNXA 1HNXQ 1VQ5A 2YU9B 1YBYA 2ZXOA 3AFQA 5M3MG 3GTGB 1RIPA 3FRPB 4R4IA 4IFDI 3VDYA 1WTWA 3HKSA 1S72A 4Z9CB 4LUOA 3G7LA 3K0YA 4XYOA 2Q8RE 5M5YB 2B3GA 5C3EH 3S1NH 3FMCA 2R92B 3TS2A 5J3BA 1VQCA 2EXDA 4IPDA 1VQDA 5C4XG 3FPPA 3CMEA 3CHBD 1WCMH 2Q8TA 2Z6BA 1SNQA 1JOKA 3PUVA 4PQXA 1YJ9A 2ICIA 2EYLA 2L12A 1GUTA 1LTBD 1PZJD 4C2MB 2XIWA 5LMUQ 1VQ9A 2F4VQ 2B63B 1O7ZA 5HGQA 3GQBA 1A6XA 2E8GA 4DUYL 4DR7L 3A8JE 1Q90A 3OIQA 5C6AA 4A3MG 4CKBA 4DXFA 3HOWH 4DV1L 3A5ZB 2FMMA 2QDLA 2PQEA 4GN4B 2BOSA 4OONA 4HMIA 5I9OA 1PH9A 1ILQA 5EBDA 2R92G 4IFDH 1U9RA 4LUVA 1KRTA 2K75A 1H9MA 1KRSA 2JJQA 1SNCA 3A56A 3LWEA 4DAPA 4DR2L 5JPMC 2XGTA 1EY4A 2O2LD 4L5TA 1FNUA 5BN4A 4K14A 3AQQA 2BA0A 3HOZH 3BYTB 2B63G 2F0FA 4G7OC 4PMCA 1E1OA 1TS5A 4OEMB 3CCQA 2HDMA 4CBVA 4A3FG 2RSOA 5JAVA 4DR6L 2Z4IA 3CCRA 4U68A 4JI3L 2LSSA 1LV9A 4G7HC 2SNSA 4Y52H 3PGZA 4X3TA 2E2JH 2VB2X 2B2WA 3HOUH 5IGBA 1Z6HA 2CVRA 2EJGC 1XNRL 3VYUA 1CSPA 2KHSA 1SR3A 4JCVE 4ZUIA 1OTCA 3S16H 3NHHA 3CU7A 4LWCA 2BDNA 3NEMA 2DJGC 5FLMG 4KKTA 1QZGA 4BY1H 1DOLA 4LMQD 4AQYQ 1HQRD 4OWWB 1D6EC 4MTKA 1SJHD 3S1MB 2RDHA 4JI6Q 4GNXA 4QCLA 1PVOA 1NR2A 4L5QA 5C4HA 3J81E 1NMFA 3NQIA 4C56C 5GROA 2F52A 3J80i 3I4LA 4LFBQ 5JJZA 4RGOS 5AJ3Q 1C8CA 2JA8B 4X3SA 2NN6G 2OQ0A 2WAQB 3EA6A 4IPGA 1JJ2A 2R93H 4A3JH 2JA6B 1K28A 4KLKA 4HIMA 2F0KA 2QCPX 2MO1A 5EPLA 3W5OA 2NVTH 4LF5L 5JEAG 4M1UB 3F2DA 2E2HH 4DR4L 3JC66 4FXGC 3T51B 2O4XA 3DWQA 2NWGA 4A3LG 2VUMB 5CBAE 1BR9A 4KK7A 3TZDA 1VQ8A 3CW2C 5EKLA 2NZHA 1I4XA 5FO7B 4ZLTF 5IT9L 4JBKA 1J5EQ 4G7ZC 4A3IG 1UE5A 2UXDL 3S1QH 4QF4A 2HHHL 1QVGA 1ESFA 2N55A 4GKKL 1TWCB 4U673 1XPUA 3J81L 3KF8A 2MPMA 1X3GA 1Q8IA 3QWNA 1SE2A 5ELNA 2ICEC 1CHQD 2WKDA 2HCCA 4QY7A 1KDAA 1S3OA 1LO5D 2A8VA 4K0KQ 4FNFA 2B39A 1AP0A 3MXPA 1EFID 4RGNA 3BG3A 3CPWA 5CGKA 4K6LA 2F0MA 3S15B 4QUCA 4PZ6A 2H1EA 2VY3A 1HTPA 1CA5A 4DXGA 3SK8A 3PO2H 2ZT9C 4P72A 2HUGA 1U0LA 3PUZA 1MSGA 1V1PA 4XT3B 2PW5A 1IBLQ 3LX0A 4NKLA 3PF4A 1WVLA 3H94A 1WCMB 2EQSA 2OWOA 5KIXA 4FF3A 3OOCA 4B3MQ 3GTLH 2MUYA 2VZAA 3HOVB 3J81j 1YNNC 5FK9C 1FJGQ 4CJ0B 2ZJQA 2K6AA 3T16A 3VA7A 4A75A 1IYJB 5C44H 1QVCA 1CSQA 4KKUA 1PFSA 2B29A 1Q12A 4LF4L 3GV3A 1RF2D 4FF1A 3EVQA 3HOWB 3MTSA 3QG1A 3U50C 1EEFD 3OMGA 2NZ1D 1PMRA 4BY7G 3MXGA 3GTQH 4CDCC 3ZJYC 4JI1L 4DR3L 1PH1A 4B3SQ 3V05A 1NMGA 1YNXA 2IT1A 2QDBA 4UHVA 1PH4A 5JPNC 4O1NA 1WCMG 1H9KA 4OIKA 4K6DA 2UXCL 4HR7B 1KLGD 4DA2A 3URYA 1GUGA 3I73A 4ZK9B 1B4OA 3HOVG 1HR0L 3MA2B 3G4SA 3HOZB 2XRQD 3I4OA 4IJHA 4GNXB 1GKHA 4POFA 3PSIA 3BS1A 5IP9G 1NE3A 3TP8A 2LY7A 3HOWG 4IZ8A 1JMCA 4OGQC 1EY6A 2Z0SA 4NPSA 2RVLA 1CM9A 3U4VA 2F0HA 4YHHQ 1D7QA 4A3CH 1TY2A 3D6WA 1JE5A 1LTSD 3CKIB 5K5PA 1W2BA 1G2TA 4CJ1B 1N33L 4TRDA 2M9VA 1I4RA 2SOBA 1ZYRC 2E2JB 2CH4W 4DV7Q 5LL6S 1GUSA 2HCIA 3HOUB 1OO9B 3A5UA 2MGSA 2PW7A 5EBCA 4HTHA 1NTGA 4AYBE 4FXKC 2HD3A 1QB5D 5D14A 3IRBA 2A6EC 1JC7A 4C1NK 4KTAA 3HOZG 3VR3A 2F3WA 4BY1B 3STBD 1AN8A 3GTJH 5CV6A 2WAQE 1YJNA 4UDUC 2HT1A 5BR8L 5LMNW 4A93G 2WKCA 5E1FA 3K0XA 3RLNA 5LHY1 2WINB 2IX3A 5M9OA 4DUZQ 2R7ZH 1JWUD 4EQNA 2B8FA 5GAEC 4QMGA 2OTJA 1KNEA 2R93B 4JBJA 4A3JB 4CGYB 3HOUG 4HAEA 2IPKD 1VQGA 2CQAA 2ZTCA 4ME5A 1TWGH 2E2HB 1WTOA 4JK1C 1BKBA 3MVVA 2WP8J 5C4ZA 3M4PA 5IWAQ 3KLWA 2AMCB 4LF7Q 1BCPB 3I3CA 2AWOA 1V1PB 2EYFA 2UU9Q 1N34L 3HOXB 1TWHH 4V0BA 5IYDH 4J1MA 2QA4A 4X6AH 1XMOL 1K8AC 1AE3A 3HZXA 3S1QB 3I56A 1VDZA 5HGTA 3PO3B 2A5HA 3SHLA 5C3XA 1EIFA 2OXPA 4R4TA 1KIXA 3ITPA 1JR0D 3DHQA 4N8X1 4GZYC 1STEA 1VQAA 3PMFA 5ISRA 5GQOA 4JV5L 1PH2A 3Q8DA 1XYIA 1HA6A 3MFYA 1EQTA 3C3LA 2MJ8A 5JJLA 5HURA 5C4JH 4A3EG 2C35B 1PYWD 1BCPF 2H5XA 3K8AA 3U58A 1B9MA 1C0AA 3HOXG 1MIUA 1Q1BA 5M3MH 5JOBA 1A0IA 1S5CD 3MEFA 4GLVB 4JG2A 4KI0A 1E24A 2KEEA 2VB3X 1HNZL 2K5VA 1QNKA 2D5DA 3PO3G 1D5MC 1F9RA 1NSNS 3QIAA 2AQ2B 3KOJA 1XWEA 4QL5A 4N9TA 5C4XH 3NTKA 1TWAH 3MXUA 3K7UC 1HFGA 4WRDA 3GTLB 1DCZA 4B3TQ 2JA5G 4JI2L 5C44B 1HZ9A 1CQFA 4CKEA 1PFNA 3MZ5A 3S9WA 4R8IA 2C5CA 1EWIA 3OWFA 4RMFA 2RKSA 2O5IC 2A74C 1WJJA 2SDFA 1A3TA 1EOTA 5A2QL 4A3MH 2ZTEA 5ELEA 1I4HA 3OPOA 2K32A 4IJLA 2MP1A 2WFWA 2A19A 5M5YH 3T4AC 2JA7H 2YTVA 1S5DD 3OYYA 2R92H 1U4PA 3OSOA 3UDIA 1TU2B 1JOOA 2F4IA 3M3YB 5DNFA 1IKLA 4PZ8A 2R7DA 1O7IA 1XTCD 1PRTB 1SE3A 4LW1A 2EY5A 3CRLC 3F8TA 1VMPA 4PG3A 1VCIA 4LF9Q 1XPRA 1STGA 1SNPA 5C0XJ 2J0TD 1CFMA 4A3FH 2UUBQ 1MD2D 4JPBW 1PLFA 3I8ZA 1C4QA 1X55A 1LTID 4H7BA 1WYDA 2ES2A 2NN6I 2XN9C 1E0BA 4P71A 1WTRA 3GTMB 3I7FA 1DYQA 2JQOA 2PPBC 1N36Q 2SNMA 3PUXA 5NUCA 4DV2Q 2XRSD 2XNAC 2VQEQ 2D0OA 4S3SA 5KGUA 4BA2I 4V190 2G9DA 2Q2IA 3BVMA 4DR4Q 2GA4B 2PZWA 1PTOF 4NXNQ 1KLUD 3BJUA 5FOBB 1KD1C 5FLMH 4LFAL 5KEEA 4IUPA 3K57A 1PFMA 1SROA 4B08A 5JJKA 1EIYB 2B2TC 2RDFA 4A3CG 1WTXA 2K05A 3BDCA 1GUWA 1LT4D 2WIIB 1STAA 2I46A 1JCKB 2NZOA 1NR4A 4QUFA 1TWGB 2E2IH 4RG1A 1U4LA 1GHKA 5JEAH 1DGSA 4C3IG 4A3LH 3GP7A 5LMNQ 4NDXA 2JP1A 1TWHB 1KHIA 3KF6B 2DGYA 3J80c 3WDNA 1PH7A 3BVGA 1E1TA 1HA5A 4KY6A 4A3IH 2UUAL 2LS01 4RH6A 1QG7A 2VQFQ 2Y0SB 3NELA 2Q2UA 3HFZB 4BBSB 4L8JA 1AZPA 1LM0A 2L5TA 2KJXA 1M90C 4DR1Q 2A6HC 1ASZA 4GN3B 4A76A 2KEDA 5CC4A 2ZXRA 2QILA 5IP7G 3E0EA 4K2LA 3Q23A 5C4JB 4WJ3M 3W1BA 2R61A 3OMCA 4GOPA 1IXRA 3K80C 3S2DH 3JAML 5M3MB 2BA1A 5JJIA 1GOZA 4JI8L 2UUCQ 1TS4A 4XIGS 2AQ3B 3A8IE 4QQBX 4OWXB 3K81C 4LK1C 2PO4A 1V8QA 4K2KA 5ELFA 3T13A 4BBSG 5C4XB 1TWAB 5EPJA 4B3RL 1BBUA 4RKLA 2CWAA 4TVAB 5CYUA 1I50B 2HQEA 1QVFA 3M7NA 1I3QH 5FLXL 4KV6A 1EYGA 4F88A 3RZOB 4FO2A 2E76C 5IGCA 2DY8A 1ESRA 4JI7Q 1FNVA 2D62A 4A3MB 3CRKC 4BS9A 2NVYB 3LWUA 4BY7H 3IFDA 1YHAA 2L4NA 5J39A 5KRUA 1HZAA 1TVXA 5I6YA 1PH8A 2JA7B 1F2ZA 4G57A 2KENA 5T1GA 1MKHA 3GV6A 1XNQL 2AQ1B 5EQ0A 4BXXG 1VQEA 1PRTD 1EYDA 4L5SA 1KAWA 3DWPA 4HIDA 4RFBA 4LJZC 3HOVH 2HIVA 1JJCB 4JI0L 4YWLA 1SNDA 2EYOA 3VYTA 3HP3A 1X65A 4NMZA 4C3JB 1K83H 5IP9H 1KNAA 1NBWA 1STYA 2DJFC 5C5LA 4A3FB 3LNNA 3CCVA 5CV5A 4X3KA 2ALYB 3D4RA 5F2DA 3ZYYX 4KMUC 2WB1G 1M4VA 1GD7A 2CW0D 2ZM6Q 2IX0A 2JA7G 3J81i 5KNCA 1LT6D 1F2MA 1G2SA 1G291 2F0LA 2B2YC 1X9NA 1DJRD 2XSCA 5ELBA 1IBKL 1AZQA 1DZ1A 1NUCA 1YITA 1X3EA 4OELB 1HTLD 2AWNA 2R6GA 1GHJA 1VMCA 1BOSA 3BZDB 1R4QB 2K50A 4OL7A 1DD2A 1RL2A 4C3JG 1K3BC 2PMZB 4JOIC 3UI2A 4AIMA 1ASYA 4DV3Q 1OXTA 4A93H 1KDBA 4DV4L 4JI5L 1ZEQX 5IODA 2BE5D 3EIVA 3J7AF 1EL0A 1Y69U 5IGFA 1BDOA 1F9QA 1UE6A 1B3QA 3GDEA 3HKZE 2F0IA 1FGBD 5G3LF 4GKJQ 3NTHA 1AEXA 1Q86C 1R4PB 4DAYA 4GOPB 2Z1CA 2EY2A 2E2IB 3FKIH 3Q24A 5D3IB 4QIWB 2Y0SE 2K1BA 3VR5A 1U4RA 2F0VA 4N8FA 1D1KA 2GVBA 3A7LA 1VQOA 3NWSA 3G6JB 5IT9E 2NTSA 4DR5L 2F0SA 3OTOQ 3K5OA 1MGSA 5C0XG 4XXEA 3DLLA 2IWHA 3UDGA 5HY6A 5EKIA 2QGQA 4X64Q 1AFPA 4A3IB 4ZRZA 4L5RC 4OX9L 1UE1A 3KUPA 5E4WC 3RN2A 3ND8A 2A73B 1IBMQ 1B44D 3PQIA 4QGUA 1K0RA 4J15A 1YZ6A 5FO9B 3K5MA 2F3VA 3AEVA 1D5ZC 2E75C 2RBMA 3GTOH 2J7ZA 2AUKA 1TT2A 1B3AA 4A3EH 4G4KA 3S2DB 2EJMA 1M1KC 2F0QA 1Y1WG 4JBMA 2EYHA 3O13A 2Q2TA 5K36G 1H9JA 3IFTA 3SK4A 3HOXH 5CR3A 4O0AA 2HQLA 3TMEA 2F1MA 1C9OA 1WD0A 1HZBA 1Z7TA 4XQQA 2M2LA 4DV5Q 3PO3H 3R93A 3SK6A 3F2CA 4X3UA 5IGDA 3H0GG 4YY3L 2CQOA 4WORA 3E9IA 1I3QB 3L3OC 1XMQL 1Z9FA 4EQOA 2JA5H 1SNOA 1OXXK 3CD6A 3BVZA 2B2UC 1TWFH 5EJWA 4KD3A 3AYHB 4JI4Q 4A4IA 1QJOA 2AHOB 4BY7B 1BF4A 2UXBL 5IYCG 1H9SA 2DY7A 4Q0FA 3RNUA 1JE4A 1TXYA 1NCVA 1EY7A 1AW7A 1B9NA 2A68D 1N32L 1Y14B 2PNRC 3UDFA 1PH6A 5ELCA 5IGGA 1F77A 2F3IA 1SXTA 3K5LA 5GAHC 4A3GG 1SMXA 1K83B 2IY5B 1A8VA 3FVQA 1WOCA 5D65A 1FL0A 4P73A 4X66L 2B2TA 2D0PA 4FDBA 4F8MA 3T1HQ 3BYYB 4DAYB 4MN3A 1KQSA 3AFPA 5G3LD 1PFBA 2PNHA 4LF6Q 1B50A 1SSOA 5EPKA 3MWYW 2MNAA 3J7A5 3D4WA 2Z6KC 3CXCA 1K0SA 3P75A 1LUZA 4NXML 2JK8A 4FF2A 2F0NA 3D31A 3M3YH 3QR8A 1L1OC 2O5JC 5FO8B 4ZKCB 4K5XA 2DNEA 3NENA 3QOJA 1RKNA 1W6KA 5E3FA 5KYLA 1E7ZA 2N49A 3BU2A 4XTCS 1PTOH 1EZ6A 4LAAA 4NB3A 4A93B 4QIWE 1PH3A 2RSNA 1XJVA 2IL8A 2L55A 4PNYA 4IN3A 4YCUA 2ENBA 1YNND 2EJFC 1SAPA 4J8QA 3A74A 4KHPL 2FJ2A 3GTMH 4RGTA 1VQ6A 1I6VC 2EOTA 2F0WA 4R9WA 1HNXL 3UE1A 3FKIB 2BCOA 1VF5C 3VR6A 1YNJD 2RHQB 2KCNA 2C9OA 1Y1VB 1WTPA 2K7VA 2E5LQ 2IX1A 4C3IH 5M3FG 4PV1C 4APVA 1PHJA 1SN8A 1HPCA 1I94Q 2LXJA 3F2UA 2NVXH 1JWSD 2QEJC 4RGMA 2A1AA 3GD7A 1SMYC 1V43A 4LFCQ 1VQNA 1DM0B 2OTLA 3KFUA 5LMUL 4OIJA 2F4VL 2F0JA 4PZ7A 2X6GA 1HQMC 3L0OA 3H3VC 3ULPA 1X32A 4A3DG 1HZCA 2E74C 3NP8A 3FKIG 2I5LX 4LF8Q 3GTOB 3SVMA 4X65Q 4DAVA 1DXMA 2IHFA 5CV4A 1Y1VG 3CAMA 1N9WA 5IP7H 3A0JA 5IIFA 5E4XA 1QE6A 4HSVA 4A3EB 4POGA 1YIJA 4RWSC 1EFWA 1O7LA 1H9SB 4DV0Q 1HJPA 1ZYRD 2XTIA 3TS0A 4P74A 3U9OA 3IL8A 4DN4M 3S2HB 3R2IA 3DEOA 2A69C 2JE6I 1DOKA 1STNA 2A6ED 4RCOA 4JYAL 5FKAC 5JVG3 1QZHA 1ICWA 4HJ5A 3NUCA 1CKMA 4BBSH 1FR3A 3KLRA 2I5HA 5DEHA 1GVPA 4ID6A 2B2VC 2JA5B 3DM3A 3T1YL 3ND9A 4UAIA 1K73C 3I4MG 4CDFC 3CC4A 5A2QE 1X6OA 1TWFB 3X3NA 3D6CA 5E7NA 3TBIB 4FP5D 1E22A 1HR0W 2EVBA 5DM63 4DUYQ 4DR7Q 5GAGC 3G48A 4HJ9A 4ZYSA 3FPUB 1EUJA 4HMJA 4DV1Q 2LMCB 1V9PA 3KF6A 2NTTA 1A3VA 4A3BG 1Z47A 2JN4A 1C48A 3S1RH 4WJWA 4ZUJA 2PYKA 4OHJA 3DM1A 4AQYL 4CJ2C 2X69A 3G71A 4BXXH 1N8RC 1I50H 1QUQA 2NB0A 4DR2Q 1B2TA 3L7ZC 4JI6L 1HUMA 2JYOA 1BVSA 1D8LA 4IUUA 1F9SA 2K03A 3DMUA 3RZOH 3KYHC 4K5WA 4LFBL 4IPCA 4UPAA 3VR2A 2X6LA 5H1SE 2JXMB 5M5WH 2NVYH 1PXUA 1RODA 3M9BA 2L15A 4DR6Q 1A63A 1X3PA 1PZKD 2FMCA 4KJOA 4IO9A 5D3DA 4JI3Q 1SJED 3TN2A 2ZJRA 4HCSA 4KHZA 3VA5A 1BBWA 1STHA 1VQLA 2F0GA 1S40A 1F9PA 5IT9c 2IW3A 1J5EL 1XNRQ 5C0XI 1E2ZA 2ZJPA 1M8AA 2F0EA 3DEPA 1TIID 2HIXA 4C3JH 1PTOB 3J81c 2OCEA 5DAUA 3I72A 3CCJA 4C1NI 2KBNA 3RD4A 1RD9D 1EOVA 3EN2A 1IW7C 4K0KL 1HXYD 2MHVA 3W2DA 2AUJD 1G8ZD 3DXJC 1FGUA 2OF1A 4EQPA 1KDCA 3ULJA 4DK3C 3HG9A 3KLSX 4UY8C 1X3FA 1ICFB 4XT1B 1WTVA 1GUOA 4C3IB 4LF5Q 5ELOA 4F7XA 3OIPA 1IL8A 4JC0A 1IBLL 2YYZA 1JB3A 2MO0A 4MTNA 4PMBA 4JVZA 3S24A 4C3HH 3BDOA 2OEOA 5C0XH 3QB3A 2NVXB 2F0OA 1CUKA 4CDDC 1QILA 4DV6L 1JT8A 2N88A 2EYPA 3K5NA 1PV4A 3H15A 4DK1A 1FJGL 1MJEA 3E6ZX 2UXDQ 4DNRB 5I9PA 5IYBG 2ASBA 1A15A 1KAAA 2HHHQ 5IY0A 4GKKQ 2Z8LA 3MEHA 1EIHA 4JBWA 1A2TA 1E2VA 3I4NH 2QW7A 4IALA 5GADC 4LUZA 1S5ED 1EY0A 3NTIA 1XMQQ 1F2LA 3A55A 3JAME 1Q7YC 5CORA 1BCPD 1PYBA 2B2UA 2XWBB 1FNWA 3CMAA 4B3SL 3TRZA 4I7AA 4KHVA 1STBA 3KBXA 1S4ZA 1Y1WH 1VQ7A 5K36H 1Q8KA 1ENCA 2K14A 5FJ8G 1HNWL 1FD7D 1B70B 3SE0A 3TEHB 3V2TA 2RCNA 2LXKA 3M4QA 4LNQA 1QUQB 3VYRA 1FYCA 4J6HA 4DK6C 4MZ9A 4R4OA 3E9HA 5FLXE 3ER0A 2NVQB 3H0GH 1X56A 2PI2A 4A3KH 4H02A 4YHHL 1CQVA 2TSSA 3M7GA 3K7AH 1IYUA 1SEBD 2ID0A 4EGVA 4GS3A 3PF5A 4LF4Q 2N3SA 4DV7L 3N52A 3NPPA 2K04A 1BO0A 1VQBA 5IYCH 1D1IA 2L1BA 3S1RB 3E0JA 1OXVA 2PZUA 4JI1Q 4DR3Q 4ALPA 3HOYG 1L1OA 2DN8A 3MC0B 4X62L 1L0WA 3MAQA 2MQHA 4OWTB 2UXCQ 1PRTC 1VS0A 1MBYA 4ZQ3A 1A2UA 4RHSA 1IYVA 1YVCA 1J8IA 4DNTB 1HR0Q 4A3GH 2QKIC 1WTQA 4HJ7A 2A6HD 3K58A 5M5WB 3RN5A 3TSSA 1QNUA 2WACA 4ILWA 3NSWA 2M00A 3M4OB 1G51A 2I07B 2WB1B 3OW7A 4JW0A 2LKVA 3S17H 1YHBA 1RTNA 1CZGA 1KTKA 5IWAL 4NW2A 2D2CC 4LF7L 1N33Q 1S5FD 2UU9L 4MIUA 5KNDA 1TS2A 2GVAA 1HUNA 1XPOA 2K5DA 2KA7A 3CPFA 1PTOD 4IUVA 4IUQA 3RZDH 1BUVT 1Y8OB 4IFDJ 3GTKB 3RMHA 2V4DA 3A54A 1JQYD 5BR8Q 2NYZD 2ZXPA 1SYEA 4WJ4A 3ICEA 5EGTA 2BE5C 4E6IA 4HIKA 2EYJA 1QCBD 1UNSA 2BDOA 4O2DA 4R8NA 2DNCA 5IE8A 1NY4A 4TKOB 3TP5A 1KABA 2Q2HA 1VQHA 4ODGA 4OXPA 5A35A 3PV0A 3SXHA 1AH9A 3TQYA 5M3FH 4GLAC 3NBIA 4GN5A 2TMPA 4C3HB 1R9TH 1TQOA 5IOCA 1SYBA 3BZKA 1N34Q 1JICA 4B3TL 3W1GA 3CC7A 2Z4HA 2K4KA 3DUZA 3WOEA 4OO1G 1XMOQ 1SFOB 3S14H 4XQJA 4I65A 4JYAQ 3I2ZA 3I4NB 4A3DH 2RHSB 2B2VA 2L0CA 4JV5Q 3VR4A 1D5XC 3U4ZA 1Y1VH 3SGIA 3T1YQ 3MXNB 2R7FA
chains in the Genus database with same CATH topology
1OXUA 1H95A 3CCUA 4YCVA 4B3TQ 3NENA 2JA5G 2KHJA 3CCEA 3PCOB 2V1CC 4UP7A 3WWVA 2CCZA 2JA8H 3RLOA 4X66Q 4JI2L 1HZ9A 1E7ZA 2N49A 3BU2A 2JA6H 2E5LL 4XTCS 2YTXA 1YI2A 4NB3A 2Z6KA 2CFMA 4QIWE 1PH3A 4RMFA 1EWIA 2VUMH 1JB7A 1XJVA 1L1OB 1HNZQ 1WJJA 4A3MH 3TREA 2ZTEA 3HKZG 4YCUA 1I94L 4NXMQ 4BBRH 3CCLA 4LF9L 5IYDG 1JJGA 4IJLA 3A74A 1YHQA 3I4NG 4KHPL 1P8LA 4DUZL 2WFWA 3GTMH 1VQ6A 3CP0A 2UUBL 2A19A 4LFCL 5M5YH 1HNXL 2JA7H 2YTVA 3UE1A 3OYYA 2R92H 3UDIA 2RHQB 5EAYA 2Y0SG 1PH5A 3I4MH 1L1OC 4JI2Q 4YWKA 2EIFA 2YTYA 1CKNA 2JA9A 3PUYA 1SRUA 2E5LQ 1TWCH 3CC2A 3H3VH 4R1JA 4C3IH 4PZ8A 5M3FG 4X65L 2R7DA 4YCWA 1O7IA 4APVA 4LF8L 1N36L 1PHJA 4DPGA 1SN8A 3PIPA 1VQMA 4LW1A 4DV2L 3CCMA 1FVIA 2VL6A 3F8TA 4PG3A 1I94Q 1VCIA 2LXJA 2VQEL 1XPRA 4LF9Q 3S2HH 1KXLA 2I5MX 3PIOA 2NVXH 2N78A 4KHPQ 4DV0L 5C0XJ 4A3BH 2A1AA 2JEAI 3GD7A 4A3FH 2UUBQ 1V43A 1XTDA 4LFCQ 1VQNA 2OTLA 3S15H 1HNXQ 1VQ5A 5LMUL 4NXNL 3KFUA 1YBYA 3AFQA 3OW2A 2F4VL 5M3MG 4PZ7A 1X55A 3L0OA 1RIPA 1WYDA 2ES2A 3ULPA 2NN6I 2WB1E 4R4IA 4IFDI 4P71A 4A3KG 4A3DG 1HZCA 3VDYA 3HKSA 1S72A 3I7FA 4TQUS 4LUOA 3FKIG 1Q82C 2I5LX 4LF8Q 2JQOA 4X65Q 2B3GA 5C3EH 3S1NH 2IHFA 1N36Q 1Y1VG 3CAMA 1N9WA 3PUXA 1IZ6A 3A0JA 5IP7H 3TS2A 5J3BA 1VQCA 2EXDA 4IPDA 1VQDA 4DV2Q 5C4XG 4AYBG 3CMEA 4POGA 1WCMH 2VQEQ 1YIJA 3PUVA 2D0OA 1YJ9A 1EFWA 4BA2I 1I6HH 4DV0Q 2Q2IA 4DR4Q 2JA8G 1HJPA 1LTLA 2XTIA 2WAQG 3TS0A 5LMUQ 4NXNQ 4P74A 3BJUA 2JA6G 1VQ9A 1KD1C 2F4VQ 5FLMH 4LFAL 2PQAA 3J7ZC 1SROA 5HGQA 2JE6I 2E8GA 4DUYL 2VUMG 5LMNL 4DR7L 1EIYB 5JJKA 1W3SA 4A3CG 3HOWH 4A3MG 4JYAL 1QZHA 4DV1L 3A5ZB 4HJ5A 1CKMA 4BBSH 4GN4B 2I5HA 4OONA 1GVPA 3MXNB 1PH9A 2CWPA 2VQFL 2YV5A 2NZOA 3DM3A 3T1YL 2R92G 4LUVA 1K73C 1KRTA 2K75A 2E2IH 1KRSA 2JJQA 2ZTDA 4RG1A 3I4MG 3CC4A 1X6OA 4DR2L 1T9HA 2DUDA 4DR1L 2QEXA 1DGSA 1UWVA 2XGTA 5E7NA 4LFAQ 4A3LH 4L5TA 1E22A 1HR0W 4DV6Q 4DUYQ 4DR7Q 2KHIA 5LMNQ 5GAGC 3AQQA 2BA0A 1KHIA 2FXQA 2DGYA 3G48A 3KF6B 3J80c 4DV1Q 1EUJA 4HJ9A 2B63G 2PMZE 1PH7A 3FP9A 4DNIA 1E1TA 1V9PA 1E1OA 3KF6A 3CCQA 4GOPC 4A3BG 3JAMc 1Z47A 4A3FG 4A3IH 2UUAL 3S1RH 2VQFQ 4DR6L 1C7YA 3NELA 2Q2UA 4QJFA 3CCRA 3HFZB 4AQYL 2UUCL 1LM0A 3G71A 4BXXH 1N8RC 4JI3L 1I50H 2PI2E 1QUQA 2LSSA 4DR2Q 1M90C 3L7ZC 4DR1Q 4JI6L 1ASZA 4GN3B 4A76A 1BVSA 1D8LA 3F1ZA 4PMWA 4Y52H 5C3EG 3PGZA 5IP7G 3STBC 2E2JH 3RZOH 3E0EA 3KYHC 4WJ3M 3W1BA 3HOUH 2CKZB 4LFBL 4IPCA 4GOPA 1IXRA 1CSPA 1XNRL 4UPAA 3K80C 1SR3A 4JCVE 5FLXc 1OTCA 3S16H 3S2DH 1HNWQ 5H1SE 5M5WH 2NVYH 2UUAQ 3GO5A 2KCTA 3M9BA 2L15A 2BA1A 4DR6Q 4LWCA 2K52A 5JJIA 3NEMA 5IYBH 5FLMG 1QZGA 4BY1H 1A63A 4JI8L 4AQYQ 4JI7L 4IO9A 2UUCQ 4OWWB 4XIGS 4QQBX 1VQKA 4JI3Q 5M5XH 2ZJRA 4OWXB 1CKNB 4JI6Q 4GNXA 3K81C 1PVOA 4L5QA 1NMFA 4KHZA 3FHWA 4BBSG 1BBWA 4B3RL 1VQLA 1S40A 1BBUA 1PYSB 5GROA 5IT9c 2CWAA 4TVAB 4DKAC 1J5EL 1K3RA 2F52A 3J80i 1QVFA 3M7NA 1XNRQ 4LFBQ 5C0XI 5AJ3Q 1I3QH 2NN6G 2OQ0A 2ZJPA 1EYGA 4IPGA 4DAMA 1K9MC 1JJ2A 4IFDG 2R93H 4A3JH 4KLKA 2HIXA 1V1QA 4C3JH 3J81c 4HIMA 2MO1A 2OCEA 3W5OA 5FJ8H 2NVTH 1HNWL 4LF5L 2K5HA 5JEAG 3F2DA 2E2HH 4DR4L 4JI8Q 3JC66 3CCJA 4A3LG 4JI7Q 2D62A 2KBNA 2BH2A 3BZCA 1EOVA 3EN2A 2VNUD 4K0KL 4EX5A 4BY7H 1YHAA 1E3PA 1VQ8A 1HH2P 1WI5A 3CW2C 4B3RQ 2NZHA 3HOZH 1HZAA 1PH8A 4JBKA 1J5EQ 4A3IG 1FGUA 1UE5A 2KENA 2UXDL 4X62Q 3T1YQ 1VQ4A 3ULJA 4DK3C 4UY8C 3S1QH 1MKHA 1X3FA 3KF8B 3L2PA 2HHHL 1QVGA 1XNQL 4GKKL 2ZM6L 4BXXG 1XPUA 4UP9A 1VQEA 4HJAA 4LF5Q 1X3GA 5ELOA 4L5SA 1KAWA 4HIDA 1G6PA 5ELNA 1IBLL 4JC0A 2YYZA 2PQAB 2MO0A 3LGJA 3HOVH 4MTNA 2HIVA 1JJCB 1VQPA 4JI0L 4QY7A 4C3HH 1S3OA 4YWLA 3S24A 2A8VA 4K0KQ 1X65A 1CUKA 1K83H 5IP9H 4DV6L 3KJOA 3CPWA 1NBWA 1JT8A 5DLQE 4PZ6A 1PV4A 3H15A 4BBRG 1FJGL 2VY3A 1MJEA 3CCVA 2UXDQ 2ALYB 2MFIA 3PO2H 5IYBG 2WB1G 4BY1G 4P72A 1GD7A 2HHHQ 1XNQQ 5IY0A 2ASBA 1EQRA 2NVQH 3HOYH 1U0LA 2JEBI 3PUZA 2ZM6Q 4DV3L 4GKKQ 4JBWA 2IX0A 2JA7G 3J81i 3I4NH 4AH6A 1G291 3M3YH 1X9NA 5GADC 4LUZA 1IBLQ 1IBKL 1J6QA 1XMQQ 1YITA 1X3EA 3PF4A 1Q7YC 4JI0Q 1PYBA 2EQSA 3CMAA 4GKJL 2AWNA 2R6GA 2OWOA 4B3SL 4YWMA 3TRZA 4B3MQ 3GTLH 2VS1A 2VZAA 1Y1WH 2R93G 2K50A 1VQ7A 3J81j 4A3JG 1FJGQ 3CF5A 1U5KA 2ZJQA 1RL2A 4A75A 1Q8KA 1IYJB 2K14A 1QVCA 1CSQA 5FJ8G 1PFSA 2B29A 4JOIC 5C44H 3UDXA 1Q12A 1B70B 3TEHB 4AIMA 1ASYA 4LF4L 4DV3Q 2IX1A 2RCNA 1OXTA 4A93H 2LXKA 3M4QA 3CQZH 4JI5L 4DV4L 4LNQA 3B6YA 3EIVA 1QUQB 3OTOL 4DK6C 3U50C 4MZ9A 1L2FA 3UE0A 1UE6A 4P75A 3E9HA 4R4OA 3RLFA 4BY7G 1IBKQ 3ER0A 3GDEA 2RF4A 3HKZE 4Y7NH 4X64L 1UE7A 1X56A 3H0GH 3GTQH 3ZJYC 1B7YB 4GKJQ 4JI1L 4GNXC 4DR3L 1PH1A 4B3SQ 2PI2A 1Q86C 4A3KH 1NMGA 3M85A 4GOPB 1YNXA 2IT1A 4H02A 4EQ5A 4YHHL 1IBML 1GO3E 4R4QA 1X54A 3FKIH 3KDFA 1PH4A 1YEZA 3K7AH 1WCMG 4JOIA 4OO1I 5AJ3L 1B8AA 2Y0SE 2ID0A 3PF5A 4GS3A 2UXCL 4LF4Q 1GM5A 2ATWA 1SLJA 2N3SA 1OXSC 2GVBA 1VQOA 4DV7L 3HOVG 3M4OH 4DV4Q 4DR5L 1HR0L 3G4SA 4JI5Q 4GLXA 3I4OA 3OTOQ 4IJHA 3RR5A 1GKHA 4GNXB 5C0XG 4POFA 3PSIA 1VQBA 3DLLA 5IP9G 3UDGA 5IYCH 1NE3A 5HY6A 1PA6A 2QGQA 4X64Q 3HOWG 1JMCA 4ME3A 1OXVA 2Z0SA 4NPSA 4L5RC 4JI1Q 4DR3Q 1UE1A 4ALPA 4OX9L 3PO2G 3U4VA 3RN2A 4YHHQ 1IBMQ 4A3CH 2YU9H 1D7QA 3HOYG 3G6EA 3GTGH 1JE5A 4QGUA 1KL9A 1L1OA 4X62L 1K0RA 4J15A 2MQHA 1L0WA 1YZ6A 4OWTB 4DV5L 1W2BA 1N33L 2I0QA 2UXCQ 1VS0A 3JAMi 3AEVA 4DV7Q 1YVCA 3GTOH 4A3GH 1HR0Q 4DR5Q 3A5UA 1LYLA 3GTKH 4UP8A 4A3EH 1NTGA 4AYBE 1MJCA 4HJ7A 3PUWA 1Q81C 3IRBA 1SE8A 3RN5A 1I5FA 1M1KC 3HOZG 1Y1WG 4JBMA 2Q2TA 5K36G 4OX9Q 1G51A 1VQIA 3HOXH 1YJWA 3STBD 4C2MH 3GTJH 5C44G 1Q1EA 2WAQE 1YJNA 4IOAA 4O0AA 2HQLA 2HT1A 1C9OA 1YHBA 4BA1I 5BR8L 3S17H 2B63H 4JI4L 1HZBA 3EBEA 5LMNW 4A93G 5IWAL 3CCSA 4DV5Q 4LF7L 3K0XA 3RLNA 4DUZQ 3D0FA 2VW9A 1N33Q 3K7UC 1IL2A 3PO3H 2R7ZH 2UU9L 3F2CA 3H0GG 5GAEC 4YY3L 2CQOA 2GVAA 3KJPA 1XPOA 1NJIC 2OTJA 1XMQL 3E9IA 1Z9FA 2GN5A 1A62A 2JA5H 3CPFA 4JBJA 1OXXK 1VQFA 3HOUG 2N8NA 2K5NA 3CD6A 1VQGA 2ZTCA 1AE2A 1TWGH 3RZDH 4B3ML 4IOCA 4IFDJ 1TWFH 1BKBA 5BR8Q 1P16A 2WP8J 3AYHB 4JI4Q 4A4IA 3M4PA 1SFOH 5JEAJ 4WJ4A 2AHOB 5IWAQ 4HIOA 3KLWA 2AMCB 3ICEA 4LF7Q 2AWOA 4HIKA 2UU9Q 1N34L 3ULLA 1CKOA 1TWHH 2UXBL 5IYDH 5IYCG 3I55A 4R4CA 2AKWB 4O2DA 4IPHA 2QA4A 4YY3Q 3RNUA 1XMOL 1K8AC 1AE3A 4X6AH 1TXYA 3I56A 5IE8A 1NY4A 3T1HL 4HJ8A 1EIFA 2Q2HA 1VQHA 1N32L 4R4TA 1KIXA 1Y14B 4OXPA 4LF6L 3UDFA 3ERSX 1PH6A 2F3IA 3PV0A 1VQAA 1AH9A 1WFQA 1Q46A 2KCMA 5GQOA 3TQYA 4GLAC 3F2BA 5M3FH 4MNOA 1PH2A 4JV5L 4GN5A 3Q8DA 5GAHC 4A3GG 1SMXA 1UEBA 1R9TH 5JJLA 2IHEA 2IY5B 1A8VA 5C4JH 3BZKA 1N34Q 4A3EG 2UXBQ 4B3TL 2C35B 1VQJA 1WOCA 3W1GA 2H5XA 3CC7A 2K4KA 3K8AA 3U58A 4OO1G 1FL0A 4P73A 1XMOQ 4X66L 1C0AA 2D0PA 4FDBA 3HOXG 3S14H 1MIUA 1Q1BA 5M3MH 3T1HQ 4DAYB 1A0IA 1KQSA 3AFPA 1N32Q 3MEFA 3NBHB 4GLVB 2PNHA 4LF6Q 4JG2A 3I2ZA 1E24A 3KDFB 4KI0A 4A3DH 4JYAQ 3J7A5 2MNAA 1HNZL 2K5VA 2Z6KC 3CXCA 2RHSB 1KC8C 2OQKA 3PO3G 1LUZA 2BH8A 3S1MH 1EQQA 4JV5Q 2R7ZG 4NXML 3GTPH 3H3VI 3U4ZA 1Y1VH 2JK8A 3KOJA 3SGIA 3D31A 4QL5A 1K8GA 5C4XH 1TWAH 2R7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXU A;  1H95 A;  3CCU A;  4YCV A;  4B3T Q;  3NEN A;  2JA5 G;  2KHJ A;  3CCE A;  3PCO B;  2V1C C;  4UP7 A;  3WWV A;  2CCZ A;  2JA8 H;  3RLO A;  4X66 Q;  4JI2 L;  1HZ9 A;  1E7Z A;  2N49 A;  3BU2 A;  2JA6 H;  2E5L L;  4XTC S;  2YTX A;  1YI2 A;  4NB3 A;  2Z6K A;  2CFM A;  4QIW E;  1PH3 A;  4RMF A;  1EWI A;  2VUM H;  1JB7 A;  1XJV A;  1L1O B;  1HNZ Q;  1WJJ A;  4A3M H;  3TRE A;  2ZTE A;  3HKZ G;  4YCU A;  1I94 L;  4NXM Q;  4BBR H;  3CCL A;  4LF9 L;  5IYD G;  1JJG A;  4IJL A;  3A74 A;  1YHQ A;  3I4N G;  4KHP L;  1P8L A;  4DUZ L;  2WFW A;  3GTM H;  1VQ6 A;  3CP0 A;  2UUB L;  2A19 A;  4LFC L;  5M5Y H;  1HNX L;  2JA7 H;  2YTV A;  3UE1 A;  3OYY A;  2R92 H;  3UDI A;  2RHQ B;  5EAY A;  2Y0S G;  1PH5 A;  3I4M H;  1L1O C;  4JI2 Q;  4YWK A;  2EIF A;  2YTY A;  1CKN A;  2JA9 A;  3PUY A;  1SRU A;  2E5L Q;  1TWC H;  3CC2 A;  3H3V H;  4R1J A;  4C3I H;  4PZ8 A;  5M3F G;  4X65 L;  2R7D A;  4YCW A;  1O7I A;  4APV A;  4LF8 L;  1N36 L;  1PHJ A;  4DPG A;  1SN8 A;  3PIP A;  1VQM A;  4LW1 A;  4DV2 L;  3CCM A;  1FVI A;  2VL6 A;  3F8T A;  4PG3 A;  1I94 Q;  1VCI A;  2LXJ A;  2VQE L;  1XPR A;  4LF9 Q;  3S2H H;  1KXL A;  2I5M X;  3PIO A;  2NVX H;  2N78 A;  4KHP Q;  4DV0 L;  5C0X J;  4A3B H;  2A1A A;  2JEA I;  3GD7 A;  4A3F H;  2UUB Q;  1V43 A;  1XTD A;  4LFC Q;  1VQN A;  2OTL A;  3S15 H;  1HNX Q;  1VQ5 A;  5LMU L;  4NXN L;  3KFU A;  1YBY A;  3AFQ A;  3OW2 A;  2F4V L;  5M3M G;  4PZ7 A;  1X55 A;  3L0O A;  1RIP A;  1WYD A;  2ES2 A;  3ULP A;  2NN6 I;  2WB1 E;  4R4I A;  4IFD I;  4P71 A;  4A3K G;  4A3D G;  1HZC A;  3VDY A;  3HKS A;  1S72 A;  3I7F A;  4TQU S;  4LUO A;  3FKI G;  1Q82 C;  2I5L X;  4LF8 Q;  2JQO A;  4X65 Q;  2B3G A;  5C3E H;  3S1N H;  2IHF A;  1N36 Q;  1Y1V G;  3CAM A;  1N9W A;  3PUX A;  1IZ6 A;  3A0J A;  5IP7 H;  3TS2 A;  5J3B A;  1VQC A;  2EXD A;  4IPD A;  1VQD A;  4DV2 Q;  5C4X G;  4AYB G;  3CME A;  4POG A;  1WCM H;  2VQE Q;  1YIJ A;  3PUV A;  2D0O A;  1YJ9 A;  1EFW A;  4BA2 I;  1I6H H;  4DV0 Q;  2Q2I A;  4DR4 Q;  2JA8 G;  1HJP A;  1LTL A;  2XTI A;  2WAQ G;  3TS0 A;  5LMU Q;  4NXN Q;  4P74 A;  3BJU A;  2JA6 G;  1VQ9 A;  1KD1 C;  2F4V Q;  5FLM H;  4LFA L;  2PQA A;  3J7Z C;  1SRO A;  5HGQ A;  2JE6 I;  2E8G A;  4DUY L;  2VUM G;  5LMN L;  4DR7 L;  1EIY B;  5JJK A;  1W3S A;  4A3C G;  3HOW H;  4A3M G;  4JYA L;  1QZH A;  4DV1 L;  3A5Z B;  4HJ5 A;  1CKM A;  4BBS H;  4GN4 B;  2I5H A;  4OON A;  1GVP A;  3MXN B;  1PH9 A;  2CWP A;  2VQF L;  2YV5 A;  2NZO A;  3DM3 A;  3T1Y L;  2R92 G;  4LUV A;  1K73 C;  1KRT A;  2K75 A;  2E2I H;  1KRS A;  2JJQ A;  2ZTD A;  4RG1 A;  3I4M G;  3CC4 A;  1X6O A;  4DR2 L;  1T9H A;  2DUD A;  4DR1 L;  2QEX A;  1DGS A;  1UWV A;  2XGT A;  5E7N A;  4LFA Q;  4A3L H;  4L5T A;  1E22 A;  1HR0 W;  4DV6 Q;  4DUY Q;  4DR7 Q;  2KHI A;  5LMN Q;  5GAG C;  3AQQ A;  2BA0 A;  1KHI A;  2FXQ A;  2DGY A;  3G48 A;  3KF6 B;  3J80 c;  4DV1 Q;  1EUJ A;  4HJ9 A;  2B63 G;  2PMZ E;  1PH7 A;  3FP9 A;  4DNI A;  1E1T A;  1V9P A;  1E1O A;  3KF6 A;  3CCQ A;  4GOP C;  4A3B G;  3JAM c;  1Z47 A;  4A3F G;  4A3I H;  2UUA L;  3S1R H;  2VQF Q;  4DR6 L;  1C7Y A;  3NEL A;  2Q2U A;  4QJF A;  3CCR A;  3HFZ B;  4AQY L;  2UUC L;  1LM0 A;  3G71 A;  4BXX H;  1N8R C;  4JI3 L;  1I50 H;  2PI2 E;  1QUQ A;  2LSS A;  4DR2 Q;  1M90 C;  3L7Z C;  4DR1 Q;  4JI6 L;  1ASZ A;  4GN3 B;  4A76 A;  1BVS A;  1D8L A;  3F1Z A;  4PMW A;  4Y52 H;  5C3E G;  3PGZ A;  5IP7 G;  3STB C;  2E2J H;  3RZO H;  3E0E A;  3KYH C;  4WJ3 M;  3W1B A;  3HOU H;  2CKZ B;  4LFB L;  4IPC A;  4GOP A;  1IXR A;  1CSP A;  1XNR L;  4UPA A;  3K80 C;  1SR3 A;  4JCV E;  5FLX c;  1OTC A;  3S16 H;  3S2D H;  1HNW Q;  5H1S E;  5M5W H;  2NVY H;  2UUA Q;  3GO5 A;  2KCT A;  3M9B A;  2L15 A;  2BA1 A;  4DR6 Q;  4LWC A;  2K52 A;  5JJI A;  3NEM A;  5IYB H;  5FLM G;  1QZG A;  4BY1 H;  1A63 A;  4JI8 L;  4AQY Q;  4JI7 L;  4IO9 A;  2UUC Q;  4OWW B;  4XIG S;  4QQB X;  1VQK A;  4JI3 Q;  5M5X H;  2ZJR A;  4OWX B;  1CKN B;  4JI6 Q;  4GNX A;  3K81 C;  1PVO A;  4L5Q A;  1NMF A;  4KHZ A;  3FHW A;  4BBS G;  1BBW A;  4B3R L;  1VQL A;  1S40 A;  1BBU A;  1PYS B;  5GRO A;  5IT9 c;  2CWA A;  4TVA B;  4DKA C;  1J5E L;  1K3R A;  2F52 A;  3J80 i;  1QVF A;  3M7N A;  1XNR Q;  4LFB Q;  5C0X I;  5AJ3 Q;  1I3Q H;  2NN6 G;  2OQ0 A;  2ZJP A;  1EYG A;  4IPG A;  4DAM A;  1K9M C;  1JJ2 A;  4IFD G;  2R93 H;  4A3J H;  4KLK A;  2HIX A;  1V1Q A;  4C3J H;  3J81 c;  4HIM A;  2MO1 A;  2OCE A;  3W5O A;  5FJ8 H;  2NVT H;  1HNW L;  4LF5 L;  2K5H A;  5JEA G;  3F2D A;  2E2H H;  4DR4 L;  4JI8 Q;  3JC6 6;  3CCJ A;  4A3L G;  4JI7 Q;  2D62 A;  2KBN A;  2BH2 A;  3BZC A;  1EOV A;  3EN2 A;  2VNU D;  4K0K L;  4EX5 A;  4BY7 H;  1YHA A;  1E3P A;  1VQ8 A;  1HH2 P;  1WI5 A;  3CW2 C;  4B3R Q;  2NZH A;  3HOZ H;  1HZA A;  1PH8 A;  4JBK A;  1J5E Q;  4A3I G;  1FGU A;  1UE5 A;  2KEN A;  2UXD L;  4X62 Q;  3T1Y Q;  1VQ4 A;  3ULJ A;  4DK3 C;  4UY8 C;  3S1Q H;  1MKH A;  1X3F A;  3KF8 B;  3L2P A;  2HHH L;  1QVG A;  1XNQ L;  4GKK L;  2ZM6 L;  4BXX G;  1XPU A;  4UP9 A;  1VQE A;  4HJA A;  4LF5 Q;  1X3G A;  5ELO A;  4L5S A;  1KAW A;  4HID A;  1G6P A;  5ELN A;  1IBL L;  4JC0 A;  2YYZ A;  2PQA B;  2MO0 A;  3LGJ A;  3HOV H;  4MTN A;  2HIV A;  1JJC B;  1VQP A;  4JI0 L;  4QY7 A;  4C3H H;  1S3O A;  4YWL A;  3S24 A;  2A8V A;  4K0K Q;  1X65 A;  1CUK A;  1K83 H;  5IP9 H;  4DV6 L;  3KJO A;  3CPW A;  1NBW A;  1JT8 A;  5DLQ E;  4PZ6 A;  1PV4 A;  3H15 A;  4BBR G;  1FJG L;  2VY3 A;  1MJE A;  3CCV A;  2UXD Q;  2ALY B;  2MFI A;  3PO2 H;  5IYB G;  2WB1 G;  4BY1 G;  4P72 A;  1GD7 A;  2HHH Q;  1XNQ Q;  5IY0 A;  2ASB A;  1EQR A;  2NVQ H;  3HOY H;  1U0L A;  2JEB I;  3PUZ A;  2ZM6 Q;  4DV3 L;  4GKK Q;  4JBW A;  2IX0 A;  2JA7 G;  3J81 i;  3I4N H;  4AH6 A;  1G29 1;  3M3Y H;  1X9N A;  5GAD C;  4LUZ A;  1IBL Q;  1IBK L;  1J6Q A;  1XMQ Q;  1YIT A;  1X3E A;  3PF4 A;  1Q7Y C;  4JI0 Q;  1PYB A;  2EQS A;  3CMA A;  4GKJ L;  2AWN A;  2R6G A;  2OWO A;  4B3S L;  4YWM A;  3TRZ A;  4B3M Q;  3GTL H;  2VS1 A;  2VZA A;  1Y1W H;  2R93 G;  2K50 A;  1VQ7 A;  3J81 j;  4A3J G;  1FJG Q;  3CF5 A;  1U5K A;  2ZJQ A;  1RL2 A;  4A75 A;  1Q8K A;  1IYJ B;  2K14 A;  1QVC A;  1CSQ A;  5FJ8 G;  1PFS A;  2B29 A;  4JOI C;  5C44 H;  3UDX A;  1Q12 A;  1B70 B;  3TEH B;  4AIM A;  1ASY A;  4LF4 L;  4DV3 Q;  2IX1 A;  2RCN A;  1OXT A;  4A93 H;  2LXK A;  3M4Q A;  3CQZ H;  4JI5 L;  4DV4 L;  4LNQ A;  3B6Y A;  3EIV A;  1QUQ B;  3OTO L;  4DK6 C;  3U50 C;  4MZ9 A;  1L2F A;  3UE0 A;  1UE6 A;  4P75 A;  3E9H A;  4R4O A;  3RLF A;  4BY7 G;  1IBK Q;  3ER0 A;  3GDE A;  2RF4 A;  3HKZ E;  4Y7N H;  4X64 L;  1UE7 A;  1X56 A;  3H0G H;  3GTQ H;  3ZJY C;  1B7Y B;  4GKJ Q;  4JI1 L;  4GNX C;  4DR3 L;  1PH1 A;  4B3S Q;  2PI2 A;  1Q86 C;  4A3K H;  1NMG A;  3M85 A;  4GOP B;  1YNX A;  2IT1 A;  4H02 A;  4EQ5 A;  4YHH L;  1IBM L;  1GO3 E;  4R4Q A;  1X54 A;  3FKI H;  3KDF A;  1PH4 A;  1YEZ A;  3K7A H;  1WCM G;  4JOI A;  4OO1 I;  5AJ3 L;  1B8A A;  2Y0S E;  2ID0 A;  3PF5 A;  4GS3 A;  2UXC L;  4LF4 Q;  1GM5 A;  2ATW A;  1SLJ A;  2N3S A;  1OXS C;  2GVB A;  1VQO A;  4DV7 L;  3HOV G;  3M4O H;  4DV4 Q;  4DR5 L;  1HR0 L;  3G4S A;  4JI5 Q;  4GLX A;  3I4O A;  3OTO Q;  4IJH A;  3RR5 A;  1GKH A;  4GNX B;  5C0X G;  4POF A;  3PSI A;  1VQB A;  3DLL A;  5IP9 G;  3UDG A;  5IYC H;  1NE3 A;  5HY6 A;  1PA6 A;  2QGQ A;  4X64 Q;  3HOW G;  1JMC A;  4ME3 A;  1OXV A;  2Z0S A;  4NPS A;  4L5R C;  4JI1 Q;  4DR3 Q;  1UE1 A;  4ALP A;  4OX9 L;  3PO2 G;  3U4V A;  3RN2 A;  4YHH Q;  1IBM Q;  4A3C H;  2YU9 H;  1D7Q A;  3HOY G;  3G6E A;  3GTG H;  1JE5 A;  4QGU A;  1KL9 A;  1L1O A;  4X62 L;  1K0R A;  4J15 A;  2MQH A;  1L0W A;  1YZ6 A;  4OWT B;  4DV5 L;  1W2B A;  1N33 L;  2I0Q A;  2UXC Q;  1VS0 A;  3JAM i;  3AEV A;  4DV7 Q;  1YVC A;  3GTO H;  4A3G H;  1HR0 Q;  4DR5 Q;  3A5U A;  1LYL A;  3GTK H;  4UP8 A;  4A3E H;  1NTG A;  4AYB E;  1MJC A;  4HJ7 A;  3PUW A;  1Q81 C;  3IRB A;  1SE8 A;  3RN5 A;  1I5F A;  1M1K C;  3HOZ G;  1Y1W G;  4JBM A;  2Q2T A;  5K36 G;  4OX9 Q;  1G51 A;  1VQI A;  3HOX H;  1YJW A;  3STB D;  4C2M H;  3GTJ H;  5C44 G;  1Q1E A;  2WAQ E;  1YJN A;  4IOA A;  4O0A A;  2HQL A;  2HT1 A;  1C9O A;  1YHB A;  4BA1 I;  5BR8 L;  3S17 H;  2B63 H;  4JI4 L;  1HZB A;  3EBE A;  5LMN W;  4A93 G;  5IWA L;  3CCS A;  4DV5 Q;  4LF7 L;  3K0X A;  3RLN A;  4DUZ Q;  3D0F A;  2VW9 A;  1N33 Q;  3K7U C;  1IL2 A;  3PO3 H;  2R7Z H;  2UU9 L;  3F2C A;  3H0G G;  5GAE C;  4YY3 L;  2CQO A;  2GVA A;  3KJP A;  1XPO A;  1NJI C;  2OTJ A;  1XMQ L;  3E9I A;  1Z9F A;  2GN5 A;  1A62 A;  2JA5 H;  3CPF A;  4JBJ A;  1OXX K;  1VQF A;  3HOU G;  2N8N A;  2K5N A;  3CD6 A;  1VQG A;  2ZTC A;  1AE2 A;  1TWG H;  3RZD H;  4B3M L;  4IOC A;  4IFD J;  1TWF H;  1BKB A;  5BR8 Q;  1P16 A;  2WP8 J;  3AYH B;  4JI4 Q;  4A4I A;  3M4P A;  1SFO H;  5JEA J;  4WJ4 A;  2AHO B;  5IWA Q;  4HIO A;  3KLW A;  2AMC B;  3ICE A;  4LF7 Q;  2AWO A;  4HIK A;  2UU9 Q;  1N34 L;  3ULL A;  1CKO A;  1TWH H;  2UXB L;  5IYD H;  5IYC G;  3I55 A;  4R4C A;  2AKW B;  4O2D A;  4IPH A;  2QA4 A;  4YY3 Q;  3RNU A;  1XMO L;  1K8A C;  1AE3 A;  4X6A H;  1TXY A;  3I56 A;  5IE8 A;  1NY4 A;  3T1H L;  4HJ8 A;  1EIF A;  2Q2H A;  1VQH A;  1N32 L;  4R4T A;  1KIX A;  1Y14 B;  4OXP A;  4LF6 L;  3UDF A;  3ERS X;  1PH6 A;  2F3I A;  3PV0 A;  1VQA A;  1AH9 A;  1WFQ A;  1Q46 A;  2KCM A;  5GQO A;  3TQY A;  4GLA C;  3F2B A;  5M3F H;  4MNO A;  1PH2 A;  4JV5 L;  4GN5 A;  3Q8D A;  5GAH C;  4A3G G;  1SMX A;  1UEB A;  1R9T H;  5JJL A;  2IHE A;  2IY5 B;  1A8V A;  5C4J H;  3BZK A;  1N34 Q;  4A3E G;  2UXB Q;  4B3T L;  2C35 B;  1VQJ A;  1WOC A;  3W1G A;  2H5X A;  3CC7 A;  2K4K A;  3K8A A;  3U58 A;  4OO1 G;  1FL0 A;  4P73 A;  1XMO Q;  4X66 L;  1C0A A;  2D0P A;  4FDB A;  3HOX G;  3S14 H;  1MIU A;  1Q1B A;  5M3M H;  3T1H Q;  4DAY B;  1A0I A;  1KQS A;  3AFP A;  1N32 Q;  3MEF A;  3NBH B;  4GLV B;  2PNH A;  4LF6 Q;  4JG2 A;  3I2Z A;  1E24 A;  3KDF B;  4KI0 A;  4A3D H;  4JYA Q;  3J7A 5;  2MNA A;  1HNZ L;  2K5V A;  2Z6K C;  3CXC A;  2RHS B;  1KC8 C;  2OQK A;  3PO3 G;  1LUZ A;  2BH8 A;  3S1M H;  1EQQ A;  4JV5 Q;  2R7Z G;  4NXM L;  3GTP H;  3H3V I;  3U4Z A;  1Y1V H;  2JK8 A;  3KOJ A;  3SGI A;  3D31 A;  4QL5 A;  1K8G A;  5C4X H;  1TWA H;  2R7F A; 
#chains in the Genus database with same CATH topology
 3OWE B;  4K5V A;  1LT3 D;  1Y1W B;  4C3H G;  2KHJ A;  3CCE A;  4UP7 A;  1LTG D;  3WWV A;  3H91 A;  1K8O A;  5KYI A;  3I70 A;  2CFM A;  4M8A A;  3AU7 A;  1JB7 A;  1HNZ Q;  1L1O B;  1D2B A;  1VF7 A;  2HDL A;  1LTR D;  1Y8N B;  4BBR H;  3CCL A;  4LF9 L;  5T1I A;  3H0G B;  3I4N G;  1RTO A;  1P8L A;  3CP0 A;  2UUB L;  4A3K B;  3TP6 A;  1JWM D;  2J4X A;  5ELD A;  3T56 B;  3K7A B;  4HCE A;  3GTP B;  5DM7 3;  3I4M H;  4JI2 Q;  4YWK A;  1ONL A;  2EIF A;  1CKN A;  1TR5 A;  1LT5 D;  2JA9 A;  1IKM A;  4AYB B;  5L37 A;  4R1J A;  4YCW A;  3HS0 C;  1N36 L;  4DPG A;  2F0D A;  1VQM A;  4DV2 L;  3CCM A;  1LLR D;  2VL6 A;  2VQE L;  3S2H H;  3RUZ A;  2I5M X;  1K8M A;  2N78 A;  1PZI D;  4A3B H;  2JEA I;  3ERQ A;  3Q0A A;  3SDZ A;  1GJX A;  4NXN L;  4CKC A;  3OW2 A;  4ZCK A;  1BQQ T;  2A68 C;  3E3X A;  2WB1 E;  4A3K G;  1EEI D;  4TQU S;  1Q82 C;  4DU9 A;  3D3R A;  4A3G B;  2K01 A;  2KCC A;  1IZ6 A;  1HRJ A;  3P1H A;  1CT1 D;  4KN7 C;  4AYB G;  2P5Z X;  4NP5 A;  5BN3 A;  1CA6 A;  1LAB A;  1I6H H;  3EQL C;  2PZT A;  2JA8 G;  2FHT A;  1LTL A;  1SBB B;  1T5E A;  3P7J A;  2WAQ G;  3H09 A;  2NBF A;  3J7A V;  1WTH A;  4O42 A;  2JA6 G;  3S17 B;  2PQA A;  3J7Z C;  2L11 A;  2PCF B;  2Q8I B;  4KY5 A;  3R8B A;  2VUM G;  1SNM A;  5LMN L;  5LL6 X;  2WV6 D;  1W3S A;  4IQZ A;  1HFN A;  1CHP D;  1EU3 A;  1EYC A;  2CWP A;  1II3 A;  2YV5 A;  2VQF L;  2KEC A;  4KKS A;  3J80 E;  1GUN A;  3S1N B;  5C3E B;  3RZD B;  1W6J A;  2ZTD A;  4FF4 A;  1T9H A;  2DUD A;  4DR1 L;  2QEX A;  1UWV A;  4LFA Q;  3QJY A;  4DV6 Q;  2FIN B;  4YIJ A;  1EIG A;  2KHI A;  4KY7 A;  4DGZ A;  2FXQ A;  4KD4 A;  1JOR A;  2PMZ E;  3FP9 A;  4RKB A;  2K5Q A;  4DNI A;  1F2Y A;  2EYM A;  3Q22 A;  1UUP A;  4Q5V A;  4GOP C;  3JAM c;  5TSS A;  4XYQ A;  1C7Y A;  4QJF A;  1YNJ C;  1TY0 A;  5IGE A;  4P2C B;  2UUC L;  1EYA A;  2L9H A;  3SK5 A;  2PI2 E;  3TP7 A;  2LFN A;  5M3F B;  3F1Z A;  4L63 B;  4PMW A;  5C3E G;  1LTA D;  4DFA A;  1R9T B;  3STB C;  3SR1 A;  1SYD A;  2CKZ B;  1A3U A;  3J80 L;  3WOF A;  2KUM A;  5FLX c;  1HNW Q;  3EFX D;  4CDE C;  3S14 B;  1SDF A;  1T5X D;  3GO5 A;  2UUA Q;  3VYS A;  2KCT A;  2K52 A;  3TZU A;  5IYB H;  4A3D B;  1DON A;  4HSP A;  4JI7 L;  1VQK A;  1Y8P B;  3A7A B;  3FDT A;  3TDQ A;  5M5X H;  1CKN B;  2EXZ A;  1ENA A;  3FHW A;  3E5S A;  1CZW A;  5BN5 A;  1EQV A;  1PYS B;  3X3M A;  5CBE E;  1JOQ A;  4DKA C;  1K3R A;  1EU4 A;  4DAM A;  1K9M C;  4IFD G;  2F0U A;  3IAY A;  1V1Q A;  3C2P A;  1CTM A;  5FJ8 H;  2K5H A;  4JI8 Q;  3SEB A;  5I2Y A;  3N6R A;  5C3W A;  3S16 B;  2BH2 A;  3BZC A;  1BBX C;  4BBR B;  2VNU D;  4EX5 A;  4IUN A;  4K8J A;  1E3P A;  1HH2 P;  1WI5 A;  2XWJ B;  4B3R Q;  4X62 Q;  1VQ4 A;  3I4M B;  3KF8 B;  3L2P A;  2ZM6 L;  2QF7 A;  4UP9 A;  3R3O A;  4HJA A;  2D9U A;  4MHE A;  1G6P A;  2EY1 A;  1L0Y B;  2PQA B;  3LGJ A;  2Z9H A;  1VQP A;  1MI2 A;  1DOM A;  1NAP A;  2RA4 A;  2RDG A;  1L0X B;  3KJO A;  2NVT B;  3KK7 A;  4A3B B;  1Q3L A;  5DLQ E;  4BBR G;  2G9H D;  1EZ8 A;  2MFI A;  3Q6S A;  1ENF A;  3KLS A;  4BY1 G;  1XNQ Q;  3HOY H;  2NVQ H;  1EQR A;  1BNZ A;  4BWG B;  2JEB I;  4DV3 L;  4H0L C;  3R2T A;  4AH6 A;  4CHT B;  1SMY D;  1I4G A;  3PIP 3;  5EKK A;  1J6Q A;  4KJN A;  4JI0 Q;  3M4Y A;  3PIO 3;  2KQ3 A;  4GKJ L;  2G5D A;  1I6H B;  3K59 A;  1XXG A;  4YWM A;  1CK1 A;  1HCZ A;  5COY A;  2VS1 A;  1ET9 A;  2R93 G;  4A3J G;  3CF5 A;  1U5K A;  2B2W C;  3NXW A;  2EDG A;  3UDX A;  2RQX A;  1B53 A;  2B2Y A;  1RJT A;  3CQZ H;  3B6Y A;  4EVO A;  1QWY A;  3OTO L;  1L2F A;  3UE0 A;  1RHP A;  1SE4 A;  4P75 A;  3RLF A;  4ZAI A;  2FFK B;  1IBK Q;  2K28 A;  2RF4 A;  3PO2 B;  4N9P A;  2SEB D;  4Y7N H;  1ET6 A;  4X64 L;  3K6O A;  3IKJ A;  1UE7 A;  4RA8 A;  1B7Y B;  1J9O A;  4GNX C;  2A69 D;  3QOL A;  3M85 A;  1RDP D;  3NBH A;  4EQ5 A;  1IBM L;  1EY8 A;  1GO3 E;  4R4Q A;  1X54 A;  3KDF A;  1YEZ A;  4OO1 I;  4JOI A;  1E2W A;  1V1O A;  5AJ3 L;  1B8A A;  1SYF A;  2F0T A;  2KOL A;  3T53 B;  1UAP A;  2RCF A;  1GM5 A;  1SLJ A;  2ATW A;  1OXS C;  3M4O H;  4FXD A;  1EWH A;  4DV4 Q;  4JI5 Q;  3BDL A;  4GLX A;  2JSO A;  4B9X A;  3L9A X;  4KN4 C;  4B9W A;  3RR5 A;  4F87 A;  4QB4 A;  3U9S A;  1PA6 A;  1X3Q A;  3P20 A;  2CH4 A;  2EZV A;  4ME3 A;  3NQT A;  4DF7 A;  1G91 A;  3PO2 G;  3HRZ C;  2YU9 H;  4RHR A;  1SYC A;  3G6E A;  3GTG H;  4RCN A;  1GXD C;  1KL9 A;  2EE1 A;  2H4O A;  4K8I A;  4DV5 L;  3GTQ B;  2I0Q A;  1ILP A;  5I4D A;  3JAM i;  3KBG A;  4DR5 Q;  1LYL A;  3FEW X;  3GTK H;  3A8K E;  4UP8 A;  1MJC A;  1WD1 A;  3PUW A;  1Q81 C;  1SE8 A;  1I5F A;  4OO1 H;  4H13 C;  5CV9 A;  1I4P A;  4OX9 Q;  1VQI A;  1YJW A;  5AFW A;  4C2M H;  5C44 G;  1Q1E A;  4IOA A;  4BA1 I;  2F0P A;  5M5X B;  2F03 A;  4JI4 L;  2B63 H;  3EBE A;  3CCS A;  5CMD A;  3D8G A;  1IL2 A;  3D0F A;  2VW9 A;  2OT2 A;  3AMU A;  3NK9 A;  1HHV A;  1BCP C;  3KJP A;  1NJI C;  2GN5 A;  3NE5 B;  1A62 A;  1PDQ A;  5CV7 A;  4HN7 A;  1VQF A;  3W3A A;  2N8N A;  2K5N A;  3AB9 A;  1AE2 A;  1ML0 D;  1S5B D;  4B3M L;  3I90 A;  4IOC A;  3C1E A;  1P16 A;  2NUC A;  1PRT F;  1SFO H;  5JEA J;  4HIO A;  3ULL A;  1CKO A;  3GTJ B;  3QO2 A;  4R4C A;  2AKW B;  3I55 A;  4IPH A;  3HGB A;  4YY3 Q;  3MHB A;  1H9R A;  1IHZ A;  3HEJ A;  2KVM A;  3C46 A;  2XVS A;  3T1H L;  2K33 A;  4HJ8 A;  4IUR A;  2R7Z B;  1G6Z A;  1IW7 D;  4LF6 L;  3ERS X;  4L6T B;  1EY9 A;  2K5W A;  1WFQ A;  1Q46 A;  2KCM A;  4H44 C;  3F2B A;  4MNO A;  1EY5 A;  4ULL A;  1UEB A;  3OHX C;  4WFN 3;  2NN6 H;  2IHE A;  3C1F A;  1O80 A;  2UXB Q;  1BXT A;  3V96 A;  1VQJ A;  4FVM A;  1RCV D;  4ABN A;  4RAU C;  3EJI A;  1O78 A;  3HOY B;  3HKZ B;  1CI3 M;  1N32 Q;  3NBH B;  3KDF B;  2EY6 A;  3MFG A;  3ERO A;  2IJ0 A;  1KC8 C;  2OQK A;  3S1M H;  1B1Z A;  2BH8 A;  1EQQ A;  2R7Z G;  1ZXT A;  3GTP H;  2B8G A;  5JVH 3;  3H3V I;  3H6M A;  1EWC A;  4ZKB B;  1MSH A;  1K8G A;  1XX8 A;  4HED A;  1OXU A;  1H95 A;  3CCU A;  1LTT D;  5J22 A;  4YCV A;  2R3Z A;  3MXN A;  5J1Z A;  1QOH A;  3PCO B;  2V1C C;  2CCZ A;  4XQN A;  2JA8 H;  3RLO A;  4X66 Q;  3DWA A;  3J7Y W;  5CV8 A;  2JA6 H;  2E5L L;  2YTX A;  3D4D A;  1YI2 A;  2Z6K A;  3CQZ B;  1ZKO A;  4I7Z C;  2VUM H;  1TKW B;  3TRE A;  2VXW A;  3HKZ G;  1I94 L;  4NXM Q;  4Y7N B;  3ONA B;  5IYD G;  1JJG A;  1I4Q A;  3I91 A;  1YHQ A;  2EPB A;  1LAC A;  4DUZ L;  4LFC L;  4TSS A;  1U4M A;  1SYG A;  1PTO C;  4DK0 A;  1O7Y A;  5EAY A;  2Y0S G;  1PH5 A;  2YTY A;  3PUY A;  1SRU A;  1TWC H;  3CC2 A;  1TS3 A;  4IUT A;  1UEA B;  4LF8 L;  3H3V H;  4X65 L;  5C5M A;  1MHW C;  2CHB D;  5I6W A;  3NWT A;  3PIP A;  1FVI A;  5I2X A;  2CW0 C;  1KXL A;  5KNB A;  4FYD A;  3PIO A;  4KHP Q;  4DV0 L;  4XDX A;  2E2D C;  1XTD A;  3S15 H;  1NNX A;  1HNX Q;  1VQ5 A;  2YU9 B;  1YBY A;  2ZXO A;  3AFQ A;  5M3M G;  3GTG B;  1RIP A;  3FRP B;  4R4I A;  4IFD I;  3VDY A;  1WTW A;  3HKS A;  1S72 A;  4Z9C B;  4LUO A;  3G7L A;  3K0Y A;  4XYO A;  2Q8R E;  5M5Y B;  2B3G A;  5C3E H;  3S1N H;  3FMC A;  2R92 B;  3TS2 A;  5J3B A;  1VQC A;  2EXD A;  4IPD A;  1VQD A;  5C4X G;  3FPP A;  3CME A;  3CHB D;  1WCM H;  2Q8T A;  2Z6B A;  1SNQ A;  1JOK A;  3PUV A;  4PQX A;  1YJ9 A;  2ICI A;  2EYL A;  2L12 A;  1GUT A;  1LTB D;  1PZJ D;  4C2M B;  2XIW A;  5LMU Q;  1VQ9 A;  2F4V Q;  2B63 B;  1O7Z A;  5HGQ A;  3GQB A;  1A6X A;  2E8G A;  4DUY L;  4DR7 L;  3A8J E;  1Q90 A;  3OIQ A;  5C6A A;  4A3M G;  4CKB A;  4DXF A;  3HOW H;  4DV1 L;  3A5Z B;  2FMM A;  2QDL A;  2PQE A;  4GN4 B;  2BOS A;  4OON A;  4HMI A;  5I9O A;  1PH9 A;  1ILQ A;  5EBD A;  2R92 G;  4IFD H;  1U9R A;  4LUV A;  1KRT A;  2K75 A;  1H9M A;  1KRS A;  2JJQ A;  1SNC A;  3A56 A;  3LWE A;  4DAP A;  4DR2 L;  5JPM C;  2XGT A;  1EY4 A;  2O2L D;  4L5T A;  1FNU A;  5BN4 A;  4K14 A;  3AQQ A;  2BA0 A;  3HOZ H;  3BYT B;  2B63 G;  2F0F A;  4G7O C;  4PMC A;  1E1O A;  1TS5 A;  4OEM B;  3CCQ A;  2HDM A;  4CBV A;  4A3F G;  2RSO A;  5JAV A;  4DR6 L;  2Z4I A;  3CCR A;  4U68 A;  4JI3 L;  2LSS A;  1LV9 A;  4G7H C;  2SNS A;  4Y52 H;  3PGZ A;  4X3T A;  2E2J H;  2VB2 X;  2B2W A;  3HOU H;  5IGB A;  1Z6H A;  2CVR A;  2EJG C;  1XNR L;  3VYU A;  1CSP A;  2KHS A;  1SR3 A;  4JCV E;  4ZUI A;  1OTC A;  3S16 H;  3NHH A;  3CU7 A;  4LWC A;  2BDN A;  3NEM A;  2DJG C;  5FLM G;  4KKT A;  1QZG A;  4BY1 H;  1DOL A;  4LMQ D;  4AQY Q;  1HQR D;  4OWW B;  1D6E C;  4MTK A;  1SJH D;  3S1M B;  2RDH A;  4JI6 Q;  4GNX A;  4QCL A;  1PVO A;  1NR2 A;  4L5Q A;  5C4H A;  3J81 E;  1NMF A;  3NQI A;  4C56 C;  5GRO A;  2F52 A;  3J80 i;  3I4L A;  4LFB Q;  5JJZ A;  4RGO S;  5AJ3 Q;  1C8C A;  2JA8 B;  4X3S A;  2NN6 G;  2OQ0 A;  2WAQ B;  3EA6 A;  4IPG A;  1JJ2 A;  2R93 H;  4A3J H;  2JA6 B;  1K28 A;  4KLK A;  4HIM A;  2F0K A;  2QCP X;  2MO1 A;  5EPL A;  3W5O A;  2NVT H;  4LF5 L;  5JEA G;  4M1U B;  3F2D A;  2E2H H;  4DR4 L;  3JC6 6;  4FXG C;  3T51 B;  2O4X A;  3DWQ A;  2NWG A;  4A3L G;  2VUM B;  5CBA E;  1BR9 A;  4KK7 A;  3TZD A;  1VQ8 A;  3CW2 C;  5EKL A;  2NZH A;  1I4X A;  5FO7 B;  4ZLT F;  5IT9 L;  4JBK A;  1J5E Q;  4G7Z C;  4A3I G;  1UE5 A;  2UXD L;  3S1Q H;  4QF4 A;  2HHH L;  1QVG A;  1ESF A;  2N55 A;  4GKK L;  1TWC B;  4U67 3;  1XPU A;  3J81 L;  3KF8 A;  2MPM A;  1X3G A;  1Q8I A;  3QWN A;  1SE2 A;  5ELN A;  2ICE C;  1CHQ D;  2WKD A;  2HCC A;  4QY7 A;  1KDA A;  1S3O A;  1LO5 D;  2A8V A;  4K0K Q;  4FNF A;  2B39 A;  1AP0 A;  3MXP A;  1EFI D;  4RGN A;  3BG3 A;  3CPW A;  5CGK A;  4K6L A;  2F0M A;  3S15 B;  4QUC A;  4PZ6 A;  2H1E A;  2VY3 A;  1HTP A;  1CA5 A;  4DXG A;  3SK8 A;  3PO2 H;  2ZT9 C;  4P72 A;  2HUG A;  1U0L A;  3PUZ A;  1MSG A;  1V1P A;  4XT3 B;  2PW5 A;  1IBL Q;  3LX0 A;  4NKL A;  3PF4 A;  1WVL A;  3H94 A;  1WCM B;  2EQS A;  2OWO A;  5KIX A;  4FF3 A;  3OOC A;  4B3M Q;  3GTL H;  2MUY A;  2VZA A;  3HOV B;  3J81 j;  1YNN C;  5FK9 C;  1FJG Q;  4CJ0 B;  2ZJQ A;  2K6A A;  3T16 A;  3VA7 A;  4A75 A;  1IYJ B;  5C44 H;  1QVC A;  1CSQ A;  4KKU A;  1PFS A;  2B29 A;  1Q12 A;  4LF4 L;  3GV3 A;  1RF2 D;  4FF1 A;  3EVQ A;  3HOW B;  3MTS A;  3QG1 A;  3U50 C;  1EEF D;  3OMG A;  2NZ1 D;  1PMR A;  4BY7 G;  3MXG A;  3GTQ H;  4CDC C;  3ZJY C;  4JI1 L;  4DR3 L;  1PH1 A;  4B3S Q;  3V05 A;  1NMG A;  1YNX A;  2IT1 A;  2QDB A;  4UHV A;  1PH4 A;  5JPN C;  4O1N A;  1WCM G;  1H9K A;  4OIK A;  4K6D A;  2UXC L;  4HR7 B;  1KLG D;  4DA2 A;  3URY A;  1GUG A;  3I73 A;  4ZK9 B;  1B4O A;  3HOV G;  1HR0 L;  3MA2 B;  3G4S A;  3HOZ B;  2XRQ D;  3I4O A;  4IJH A;  4GNX B;  1GKH A;  4POF A;  3PSI A;  3BS1 A;  5IP9 G;  1NE3 A;  3TP8 A;  2LY7 A;  3HOW G;  4IZ8 A;  1JMC A;  4OGQ C;  1EY6 A;  2Z0S A;  4NPS A;  2RVL A;  1CM9 A;  3U4V A;  2F0H A;  4YHH Q;  1D7Q A;  4A3C H;  1TY2 A;  3D6W A;  1JE5 A;  1LTS D;  3CKI B;  5K5P A;  1W2B A;  1G2T A;  4CJ1 B;  1N33 L;  4TRD A;  2M9V A;  1I4R A;  2SOB A;  1ZYR C;  2E2J B;  2CH4 W;  4DV7 Q;  5LL6 S;  1GUS A;  2HCI A;  3HOU B;  1OO9 B;  3A5U A;  2MGS A;  2PW7 A;  5EBC A;  4HTH A;  1NTG A;  4AYB E;  4FXK C;  2HD3 A;  1QB5 D;  5D14 A;  3IRB A;  2A6E C;  1JC7 A;  4C1N K;  4KTA A;  3HOZ G;  3VR3 A;  2F3W A;  4BY1 B;  3STB D;  1AN8 A;  3GTJ H;  5CV6 A;  2WAQ E;  1YJN A;  4UDU C;  2HT1 A;  5BR8 L;  5LMN W;  4A93 G;  2WKC A;  5E1F A;  3K0X A;  3RLN A;  5LHY 1;  2WIN B;  2IX3 A;  5M9O A;  4DUZ Q;  2R7Z H;  1JWU D;  4EQN A;  2B8F A;  5GAE C;  4QMG A;  2OTJ A;  1KNE A;  2R93 B;  4JBJ A;  4A3J B;  4CGY B;  3HOU G;  4HAE A;  2IPK D;  1VQG A;  2CQA A;  2ZTC A;  4ME5 A;  1TWG H;  2E2H B;  1WTO A;  4JK1 C;  1BKB A;  3MVV A;  2WP8 J;  5C4Z A;  3M4P A;  5IWA Q;  3KLW A;  2AMC B;  4LF7 Q;  1BCP B;  3I3C A;  2AWO A;  1V1P B;  2EYF A;  2UU9 Q;  1N34 L;  3HOX B;  1TWH H;  4V0B A;  5IYD H;  4J1M A;  2QA4 A;  4X6A H;  1XMO L;  1K8A C;  1AE3 A;  3HZX A;  3S1Q B;  3I56 A;  1VDZ A;  5HGT A;  3PO3 B;  2A5H A;  3SHL A;  5C3X A;  1EIF A;  2OXP A;  4R4T A;  1KIX A;  3ITP A;  1JR0 D;  3DHQ A;  4N8X 1;  4GZY C;  1STE A;  1VQA A;  3PMF A;  5ISR A;  5GQO A;  4JV5 L;  1PH2 A;  3Q8D A;  1XYI A;  1HA6 A;  3MFY A;  1EQT A;  3C3L A;  2MJ8 A;  5JJL A;  5HUR A;  5C4J H;  4A3E G;  2C35 B;  1PYW D;  1BCP F;  2H5X A;  3K8A A;  3U58 A;  1B9M A;  1C0A A;  3HOX G;  1MIU A;  1Q1B A;  5M3M H;  5JOB A;  1A0I A;  1S5C D;  3MEF A;  4GLV B;  4JG2 A;  4KI0 A;  1E24 A;  2KEE A;  2VB3 X;  1HNZ L;  2K5V A;  1QNK A;  2D5D A;  3PO3 G;  1D5M C;  1F9R A;  1NSN S;  3QIA A;  2AQ2 B;  3KOJ A;  1XWE A;  4QL5 A;  4N9T A;  5C4X H;  3NTK A;  1TWA H;  3MXU A;  3K7U C;  1HFG A;  4WRD A;  3GTL B;  1DCZ A;  4B3T Q;  2JA5 G;  4JI2 L;  5C44 B;  1HZ9 A;  1CQF A;  4CKE A;  1PFN A;  3MZ5 A;  3S9W A;  4R8I A;  2C5C A;  1EWI A;  3OWF A;  4RMF A;  2RKS A;  2O5I C;  2A74 C;  1WJJ A;  2SDF A;  1A3T A;  1EOT A;  5A2Q L;  4A3M H;  2ZTE A;  5ELE A;  1I4H A;  3OPO A;  2K32 A;  4IJL A;  2MP1 A;  2WFW A;  2A19 A;  5M5Y H;  3T4A C;  2JA7 H;  2YTV A;  1S5D D;  3OYY A;  2R92 H;  1U4P A;  3OSO A;  3UDI A;  1TU2 B;  1JOO A;  2F4I A;  3M3Y B;  5DNF A;  1IKL A;  4PZ8 A;  2R7D A;  1O7I A;  1XTC D;  1PRT B;  1SE3 A;  4LW1 A;  2EY5 A;  3CRL C;  3F8T A;  1VMP A;  4PG3 A;  1VCI A;  4LF9 Q;  1XPR A;  1STG A;  1SNP A;  5C0X J;  2J0T D;  1CFM A;  4A3F H;  2UUB Q;  1MD2 D;  4JPB W;  1PLF A;  3I8Z A;  1C4Q A;  1X55 A;  1LTI D;  4H7B A;  1WYD A;  2ES2 A;  2NN6 I;  2XN9 C;  1E0B A;  4P71 A;  1WTR A;  3GTM B;  3I7F A;  1DYQ A;  2JQO A;  2PPB C;  1N36 Q;  2SNM A;  3PUX A;  5NUC A;  4DV2 Q;  2XRS D;  2XNA C;  2VQE Q;  2D0O A;  4S3S A;  5KGU A;  4BA2 I;  4V19 0;  2G9D A;  2Q2I A;  3BVM A;  4DR4 Q;  2GA4 B;  2PZW A;  1PTO F;  4NXN Q;  1KLU D;  3BJU A;  5FOB B;  1KD1 C;  5FLM H;  4LFA L;  5KEE A;  4IUP A;  3K57 A;  1PFM A;  1SRO A;  4B08 A;  5JJK A;  1EIY B;  2B2T C;  2RDF A;  4A3C G;  1WTX A;  2K05 A;  3BDC A;  1GUW A;  1LT4 D;  2WII B;  1STA A;  2I46 A;  1JCK B;  2NZO A;  1NR4 A;  4QUF A;  1TWG B;  2E2I H;  4RG1 A;  1U4L A;  1GHK A;  5JEA H;  1DGS A;  4C3I G;  4A3L H;  3GP7 A;  5LMN Q;  4NDX A;  2JP1 A;  1TWH B;  1KHI A;  3KF6 B;  2DGY A;  3J80 c;  3WDN A;  1PH7 A;  3BVG A;  1E1T A;  1HA5 A;  4KY6 A;  4A3I H;  2UUA L;  2LS0 1;  4RH6 A;  1QG7 A;  2VQF Q;  2Y0S B;  3NEL A;  2Q2U A;  3HFZ B;  4BBS B;  4L8J A;  1AZP A;  1LM0 A;  2L5T A;  2KJX A;  1M90 C;  4DR1 Q;  2A6H C;  1ASZ A;  4GN3 B;  4A76 A;  2KED A;  5CC4 A;  2ZXR A;  2QIL A;  5IP7 G;  3E0E A;  4K2L A;  3Q23 A;  5C4J B;  4WJ3 M;  3W1B A;  2R61 A;  3OMC A;  4GOP A;  1IXR A;  3K80 C;  3S2D H;  3JAM L;  5M3M B;  2BA1 A;  5JJI A;  1GOZ A;  4JI8 L;  2UUC Q;  1TS4 A;  4XIG S;  2AQ3 B;  3A8I E;  4QQB X;  4OWX B;  3K81 C;  4LK1 C;  2PO4 A;  1V8Q A;  4K2K A;  5ELF A;  3T13 A;  4BBS G;  5C4X B;  1TWA B;  5EPJ A;  4B3R L;  1BBU A;  4RKL A;  2CWA A;  4TVA B;  5CYU A;  1I50 B;  2HQE A;  1QVF A;  3M7N A;  1I3Q H;  5FLX L;  4KV6 A;  1EYG A;  4F88 A;  3RZO B;  4FO2 A;  2E76 C;  5IGC A;  2DY8 A;  1ESR A;  4JI7 Q;  1FNV A;  2D62 A;  4A3M B;  3CRK C;  4BS9 A;  2NVY B;  3LWU A;  4BY7 H;  3IFD A;  1YHA A;  2L4N A;  5J39 A;  5KRU A;  1HZA A;  1TVX A;  5I6Y A;  1PH8 A;  2JA7 B;  1F2Z A;  4G57 A;  2KEN A;  5T1G A;  1MKH A;  3GV6 A;  1XNQ L;  2AQ1 B;  5EQ0 A;  4BXX G;  1VQE A;  1PRT D;  1EYD A;  4L5S A;  1KAW A;  3DWP A;  4HID A;  4RFB A;  4LJZ C;  3HOV H;  2HIV A;  1JJC B;  4JI0 L;  4YWL A;  1SND A;  2EYO A;  3VYT A;  3HP3 A;  1X65 A;  4NMZ A;  4C3J B;  1K83 H;  5IP9 H;  1KNA A;  1NBW A;  1STY A;  2DJF C;  5C5L A;  4A3F B;  3LNN A;  3CCV A;  5CV5 A;  4X3K A;  2ALY B;  3D4R A;  5F2D A;  3ZYY X;  4KMU C;  2WB1 G;  1M4V A;  1GD7 A;  2CW0 D;  2ZM6 Q;  2IX0 A;  2JA7 G;  3J81 i;  5KNC A;  1LT6 D;  1F2M A;  1G2S A;  1G29 1;  2F0L A;  2B2Y C;  1X9N A;  1DJR D;  2XSC A;  5ELB A;  1IBK L;  1AZQ A;  1DZ1 A;  1NUC A;  1YIT A;  1X3E A;  4OEL B;  1HTL D;  2AWN A;  2R6G A;  1GHJ A;  1VMC A;  1BOS A;  3BZD B;  1R4Q B;  2K50 A;  4OL7 A;  1DD2 A;  1RL2 A;  4C3J G;  1K3B C;  2PMZ B;  4JOI C;  3UI2 A;  4AIM A;  1ASY A;  4DV3 Q;  1OXT A;  4A93 H;  1KDB A;  4DV4 L;  4JI5 L;  1ZEQ X;  5IOD A;  2BE5 D;  3EIV A;  3J7A F;  1EL0 A;  1Y69 U;  5IGF A;  1BDO A;  1F9Q A;  1UE6 A;  1B3Q A;  3GDE A;  3HKZ E;  2F0I A;  1FGB D;  5G3L F;  4GKJ Q;  3NTH A;  1AEX A;  1Q86 C;  1R4P B;  4DAY A;  4GOP B;  2Z1C A;  2EY2 A;  2E2I B;  3FKI H;  3Q24 A;  5D3I B;  4QIW B;  2Y0S E;  2K1B A;  3VR5 A;  1U4R A;  2F0V A;  4N8F A;  1D1K A;  2GVB A;  3A7L A;  1VQO A;  3NWS A;  3G6J B;  5IT9 E;  2NTS A;  4DR5 L;  2F0S A;  3OTO Q;  3K5O A;  1MGS A;  5C0X G;  4XXE A;  3DLL A;  2IWH A;  3UDG A;  5HY6 A;  5EKI A;  2QGQ A;  4X64 Q;  1AFP A;  4A3I B;  4ZRZ A;  4L5R C;  4OX9 L;  1UE1 A;  3KUP A;  5E4W C;  3RN2 A;  3ND8 A;  2A73 B;  1IBM Q;  1B44 D;  3PQI A;  4QGU A;  1K0R A;  4J15 A;  1YZ6 A;  5FO9 B;  3K5M A;  2F3V A;  3AEV A;  1D5Z C;  2E75 C;  2RBM A;  3GTO H;  2J7Z A;  2AUK A;  1TT2 A;  1B3A A;  4A3E H;  4G4K A;  3S2D B;  2EJM A;  1M1K C;  2F0Q A;  1Y1W G;  4JBM A;  2EYH A;  3O13 A;  2Q2T A;  5K36 G;  1H9J A;  3IFT A;  3SK4 A;  3HOX H;  5CR3 A;  4O0A A;  2HQL A;  3TME A;  2F1M A;  1C9O A;  1WD0 A;  1HZB A;  1Z7T A;  4XQQ A;  2M2L A;  4DV5 Q;  3PO3 H;  3R93 A;  3SK6 A;  3F2C A;  4X3U A;  5IGD A;  3H0G G;  4YY3 L;  2CQO A;  4WOR A;  3E9I A;  1I3Q B;  3L3O C;  1XMQ L;  1Z9F A;  4EQO A;  2JA5 H;  1SNO A;  1OXX K;  3CD6 A;  3BVZ A;  2B2U C;  1TWF H;  5EJW A;  4KD3 A;  3AYH B;  4JI4 Q;  4A4I A;  1QJO A;  2AHO B;  4BY7 B;  1BF4 A;  2UXB L;  5IYC G;  1H9S A;  2DY7 A;  4Q0F A;  3RNU A;  1JE4 A;  1TXY A;  1NCV A;  1EY7 A;  1AW7 A;  1B9N A;  2A68 D;  1N32 L;  1Y14 B;  2PNR C;  3UDF A;  1PH6 A;  5ELC A;  5IGG A;  1F77 A;  2F3I A;  1SXT A;  3K5L A;  5GAH C;  4A3G G;  1SMX A;  1K83 B;  2IY5 B;  1A8V A;  3FVQ A;  1WOC A;  5D65 A;  1FL0 A;  4P73 A;  4X66 L;  2B2T A;  2D0P A;  4FDB A;  4F8M A;  3T1H Q;  3BYY B;  4DAY B;  4MN3 A;  1KQS A;  3AFP A;  5G3L D;  1PFB A;  2PNH A;  4LF6 Q;  1B50 A;  1SSO A;  5EPK A;  3MWY W;  2MNA A;  3J7A 5;  3D4W A;  2Z6K C;  3CXC A;  1K0S A;  3P75 A;  1LUZ A;  4NXM L;  2JK8 A;  4FF2 A;  2F0N A;  3D31 A;  3M3Y H;  3QR8 A;  1L1O C;  2O5J C;  5FO8 B;  4ZKC B;  4K5X A;  2DNE A;  3NEN A;  3QOJ A;  1RKN A;  1W6K A;  5E3F A;  5KYL A;  1E7Z A;  2N49 A;  3BU2 A;  4XTC S;  1PTO H;  1EZ6 A;  4LAA A;  4NB3 A;  4A93 B;  4QIW E;  1PH3 A;  2RSN A;  1XJV A;  2IL8 A;  2L55 A;  4PNY A;  4IN3 A;  4YCU A;  2ENB A;  1YNN D;  2EJF C;  1SAP A;  4J8Q A;  3A74 A;  4KHP L;  2FJ2 A;  3GTM H;  4RGT A;  1VQ6 A;  1I6V C;  2EOT A;  2F0W A;  4R9W A;  1HNX L;  3UE1 A;  3FKI B;  2BCO A;  1VF5 C;  3VR6 A;  1YNJ D;  2RHQ B;  2KCN A;  2C9O A;  1Y1V B;  1WTP A;  2K7V A;  2E5L Q;  2IX1 A;  4C3I H;  5M3F G;  4PV1 C;  4APV A;  1PHJ A;  1SN8 A;  1HPC A;  1I94 Q;  2LXJ A;  3F2U A;  2NVX H;  1JWS D;  2QEJ C;  4RGM A;  2A1A A;  3GD7 A;  1SMY C;  1V43 A;  4LFC Q;  1VQN A;  1DM0 B;  2OTL A;  3KFU A;  5LMU L;  4OIJ A;  2F4V L;  2F0J A;  4PZ7 A;  2X6G A;  1HQM C;  3L0O A;  3H3V C;  3ULP A;  1X32 A;  4A3D G;  1HZC A;  2E74 C;  3NP8 A;  3FKI G;  2I5L X;  4LF8 Q;  3GTO B;  3SVM A;  4X65 Q;  4DAV A;  1DXM A;  2IHF A;  5CV4 A;  1Y1V G;  3CAM A;  1N9W A;  5IP7 H;  3A0J A;  5IIF A;  5E4X A;  1QE6 A;  4HSV A;  4A3E B;  4POG A;  1YIJ A;  4RWS C;  1EFW A;  1O7L A;  1H9S B;  4DV0 Q;  1HJP A;  1ZYR D;  2XTI A;  3TS0 A;  4P74 A;  3U9O A;  3IL8 A;  4DN4 M;  3S2H B;  3R2I A;  3DEO A;  2A69 C;  2JE6 I;  1DOK A;  1STN A;  2A6E D;  4RCO A;  4JYA L;  5FKA C;  5JVG 3;  1QZH A;  1ICW A;  4HJ5 A;  3NUC A;  1CKM A;  4BBS H;  1FR3 A;  3KLR A;  2I5H A;  5DEH A;  1GVP A;  4ID6 A;  2B2V C;  2JA5 B;  3DM3 A;  3T1Y L;  3ND9 A;  4UAI A;  1K73 C;  3I4M G;  4CDF C;  3CC4 A;  5A2Q E;  1X6O A;  1TWF B;  3X3N A;  3D6C A;  5E7N A;  3TBI B;  4FP5 D;  1E22 A;  1HR0 W;  2EVB A;  5DM6 3;  4DUY Q;  4DR7 Q;  5GAG C;  3G48 A;  4HJ9 A;  4ZYS A;  3FPU B;  1EUJ A;  4HMJ A;  4DV1 Q;  2LMC B;  1V9P A;  3KF6 A;  2NTT A;  1A3V A;  4A3B G;  1Z47 A;  2JN4 A;  1C48 A;  3S1R H;  4WJW A;  4ZUJ A;  2PYK A;  4OHJ A;  3DM1 A;  4AQY L;  4CJ2 C;  2X69 A;  3G71 A;  4BXX H;  1N8R C;  1I50 H;  1QUQ A;  2NB0 A;  4DR2 Q;  1B2T A;  3L7Z C;  4JI6 L;  1HUM A;  2JYO A;  1BVS A;  1D8L A;  4IUU A;  1F9S A;  2K03 A;  3DMU A;  3RZO H;  3KYH C;  4K5W A;  4LFB L;  4IPC A;  4UPA A;  3VR2 A;  2X6L A;  5H1S E;  2JXM B;  5M5W H;  2NVY H;  1PXU A;  1ROD A;  3M9B A;  2L15 A;  4DR6 Q;  1A63 A;  1X3P A;  1PZK D;  2FMC A;  4KJO A;  4IO9 A;  5D3D A;  4JI3 Q;  1SJE D;  3TN2 A;  2ZJR A;  4HCS A;  4KHZ A;  3VA5 A;  1BBW A;  1STH A;  1VQL A;  2F0G A;  1S40 A;  1F9P A;  5IT9 c;  2IW3 A;  1J5E L;  1XNR Q;  5C0X I;  1E2Z A;  2ZJP A;  1M8A A;  2F0E A;  3DEP A;  1TII D;  2HIX A;  4C3J H;  1PTO B;  3J81 c;  2OCE A;  5DAU A;  3I72 A;  3CCJ A;  4C1N I;  2KBN A;  3RD4 A;  1RD9 D;  1EOV A;  3EN2 A;  1IW7 C;  4K0K L;  1HXY D;  2MHV A;  3W2D A;  2AUJ D;  1G8Z D;  3DXJ C;  1FGU A;  2OF1 A;  4EQP A;  1KDC A;  3ULJ A;  4DK3 C;  3HG9 A;  3KLS X;  4UY8 C;  1X3F A;  1ICF B;  4XT1 B;  1WTV A;  1GUO A;  4C3I B;  4LF5 Q;  5ELO A;  4F7X A;  3OIP A;  1IL8 A;  4JC0 A;  1IBL L;  2YYZ A;  1JB3 A;  2MO0 A;  4MTN A;  4PMB A;  4JVZ A;  3S24 A;  4C3H H;  3BDO A;  2OEO A;  5C0X H;  3QB3 A;  2NVX B;  2F0O A;  1CUK A;  4CDD C;  1QIL A;  4DV6 L;  1JT8 A;  2N88 A;  2EYP A;  3K5N A;  1PV4 A;  3H15 A;  4DK1 A;  1FJG L;  1MJE A;  3E6Z X;  2UXD Q;  4DNR B;  5I9P A;  5IYB G;  2ASB A;  1A15 A;  1KAA A;  2HHH Q;  5IY0 A;  4GKK Q;  2Z8L A;  3MEH A;  1EIH A;  4JBW A;  1A2T A;  1E2V A;  3I4N H;  2QW7 A;  4IAL A;  5GAD C;  4LUZ A;  1S5E D;  1EY0 A;  3NTI A;  1XMQ Q;  1F2L A;  3A55 A;  3JAM E;  1Q7Y C;  5COR A;  1BCP D;  1PYB A;  2B2U A;  2XWB B;  1FNW A;  3CMA A;  4B3S L;  3TRZ A;  4I7A A;  4KHV A;  1STB A;  3KBX A;  1S4Z A;  1Y1W H;  1VQ7 A;  5K36 H;  1Q8K A;  1ENC A;  2K14 A;  5FJ8 G;  1HNW L;  1FD7 D;  1B70 B;  3SE0 A;  3TEH B;  3V2T A;  2RCN A;  2LXK A;  3M4Q A;  4LNQ A;  1QUQ B;  3VYR A;  1FYC A;  4J6H A;  4DK6 C;  4MZ9 A;  4R4O A;  3E9H A;  5FLX E;  3ER0 A;  2NVQ B;  3H0G H;  1X56 A;  2PI2 A;  4A3K H;  4H02 A;  4YHH L;  1CQV A;  2TSS A;  3M7G A;  3K7A H;  1IYU A;  1SEB D;  2ID0 A;  4EGV A;  4GS3 A;  3PF5 A;  4LF4 Q;  2N3S A;  4DV7 L;  3N52 A;  3NPP A;  2K04 A;  1BO0 A;  1VQB A;  5IYC H;  1D1I A;  2L1B A;  3S1R B;  3E0J A;  1OXV A;  2PZU A;  4JI1 Q;  4DR3 Q;  4ALP A;  3HOY G;  1L1O A;  2DN8 A;  3MC0 B;  4X62 L;  1L0W A;  3MAQ A;  2MQH A;  4OWT B;  2UXC Q;  1PRT C;  1VS0 A;  1MBY A;  4ZQ3 A;  1A2U A;  4RHS A;  1IYV A;  1YVC A;  1J8I A;  4DNT B;  1HR0 Q;  4A3G H;  2QKI C;  1WTQ A;  4HJ7 A;  2A6H D;  3K58 A;  5M5W B;  3RN5 A;  3TSS A;  1QNU A;  2WAC A;  4ILW A;  3NSW A;  2M00 A;  3M4O B;  1G51 A;  2I07 B;  2WB1 B;  3OW7 A;  4JW0 A;  2LKV A;  3S17 H;  1YHB A;  1RTN A;  1CZG A;  1KTK A;  5IWA L;  4NW2 A;  2D2C C;  4LF7 L;  1N33 Q;  1S5F D;  2UU9 L;  4MIU A;  5KND A;  1TS2 A;  2GVA A;  1HUN A;  1XPO A;  2K5D A;  2KA7 A;  3CPF A;  1PTO D;  4IUV A;  4IUQ A;  3RZD H;  1BUV T;  1Y8O B;  4IFD J;  3GTK B;  3RMH A;  2V4D A;  3A54 A;  1JQY D;  5BR8 Q;  2NYZ D;  2ZXP A;  1SYE A;  4WJ4 A;  3ICE A;  5EGT A;  2BE5 C;  4E6I A;  4HIK A;  2EYJ A;  1QCB D;  1UNS A;  2BDO A;  4O2D A;  4R8N A;  2DNC A;  5IE8 A;  1NY4 A;  4TKO B;  3TP5 A;  1KAB A;  2Q2H A;  1VQH A;  4ODG A;  4OXP A;  5A35 A;  3PV0 A;  3SXH A;  1AH9 A;  3TQY A;  5M3F H;  4GLA C;  3NBI A;  4GN5 A;  2TMP A;  4C3H B;  1R9T H;  1TQO A;  5IOC A;  1SYB A;  3BZK A;  1N34 Q;  1JIC A;  4B3T L;  3W1G A;  3CC7 A;  2Z4H A;  2K4K A;  3DUZ A;  3WOE A;  4OO1 G;  1XMO Q;  1SFO B;  3S14 H;  4XQJ A;  4I65 A;  4JYA Q;  3I2Z A;  3I4N B;  4A3D H;  2RHS B;  2B2V A;  2L0C A;  4JV5 Q;  3VR4 A;  1D5X C;  3U4Z A;  1Y1V H;  3SGI A;  3T1Y Q;  3MXN B;  2R7F A; 
#chains in the Genus database with same CATH homology
 1OXU A;  1H95 A;  3CCU A;  4YCV A;  4B3T Q;  3NEN A;  2JA5 G;  2KHJ A;  3CCE A;  3PCO B;  2V1C C;  4UP7 A;  3WWV A;  2CCZ A;  2JA8 H;  3RLO A;  4X66 Q;  4JI2 L;  1HZ9 A;  1E7Z A;  2N49 A;  3BU2 A;  2JA6 H;  2E5L L;  4XTC S;  2YTX A;  1YI2 A;  4NB3 A;  2Z6K A;  2CFM A;  4QIW E;  1PH3 A;  4RMF A;  1EWI A;  2VUM H;  1JB7 A;  1XJV A;  1L1O B;  1HNZ Q;  1WJJ A;  4A3M H;  3TRE A;  2ZTE A;  3HKZ G;  4YCU A;  1I94 L;  4NXM Q;  4BBR H;  3CCL A;  4LF9 L;  5IYD G;  1JJG A;  4IJL A;  3A74 A;  1YHQ A;  3I4N G;  4KHP L;  1P8L A;  4DUZ L;  2WFW A;  3GTM H;  1VQ6 A;  3CP0 A;  2UUB L;  2A19 A;  4LFC L;  5M5Y H;  1HNX L;  2JA7 H;  2YTV A;  3UE1 A;  3OYY A;  2R92 H;  3UDI A;  2RHQ B;  5EAY A;  2Y0S G;  1PH5 A;  3I4M H;  1L1O C;  4JI2 Q;  4YWK A;  2EIF A;  2YTY A;  1CKN A;  2JA9 A;  3PUY A;  1SRU A;  2E5L Q;  1TWC H;  3CC2 A;  3H3V H;  4R1J A;  4C3I H;  4PZ8 A;  5M3F G;  4X65 L;  2R7D A;  4YCW A;  1O7I A;  4APV A;  4LF8 L;  1N36 L;  1PHJ A;  4DPG A;  1SN8 A;  3PIP A;  1VQM A;  4LW1 A;  4DV2 L;  3CCM A;  1FVI A;  2VL6 A;  3F8T A;  4PG3 A;  1I94 Q;  1VCI A;  2LXJ A;  2VQE L;  1XPR A;  4LF9 Q;  3S2H H;  1KXL A;  2I5M X;  3PIO A;  2NVX H;  2N78 A;  4KHP Q;  4DV0 L;  5C0X J;  4A3B H;  2A1A A;  2JEA I;  3GD7 A;  4A3F H;  2UUB Q;  1V43 A;  1XTD A;  4LFC Q;  1VQN A;  2OTL A;  3S15 H;  1HNX Q;  1VQ5 A;  5LMU L;  4NXN L;  3KFU A;  1YBY A;  3AFQ A;  3OW2 A;  2F4V L;  5M3M G;  4PZ7 A;  1X55 A;  3L0O A;  1RIP A;  1WYD A;  2ES2 A;  3ULP A;  2NN6 I;  2WB1 E;  4R4I A;  4IFD I;  4P71 A;  4A3K G;  4A3D G;  1HZC A;  3VDY A;  3HKS A;  1S72 A;  3I7F A;  4TQU S;  4LUO A;  3FKI G;  1Q82 C;  2I5L X;  4LF8 Q;  2JQO A;  4X65 Q;  2B3G A;  5C3E H;  3S1N H;  2IHF A;  1N36 Q;  1Y1V G;  3CAM A;  1N9W A;  3PUX A;  1IZ6 A;  3A0J A;  5IP7 H;  3TS2 A;  5J3B A;  1VQC A;  2EXD A;  4IPD A;  1VQD A;  4DV2 Q;  5C4X G;  4AYB G;  3CME A;  4POG A;  1WCM H;  2VQE Q;  1YIJ A;  3PUV A;  2D0O A;  1YJ9 A;  1EFW A;  4BA2 I;  1I6H H;  4DV0 Q;  2Q2I A;  4DR4 Q;  2JA8 G;  1HJP A;  1LTL A;  2XTI A;  2WAQ G;  3TS0 A;  5LMU Q;  4NXN Q;  4P74 A;  3BJU A;  2JA6 G;  1VQ9 A;  1KD1 C;  2F4V Q;  5FLM H;  4LFA L;  2PQA A;  3J7Z C;  1SRO A;  5HGQ A;  2JE6 I;  2E8G A;  4DUY L;  2VUM G;  5LMN L;  4DR7 L;  1EIY B;  5JJK A;  1W3S A;  4A3C G;  3HOW H;  4A3M G;  4JYA L;  1QZH A;  4DV1 L;  3A5Z B;  4HJ5 A;  1CKM A;  4BBS H;  4GN4 B;  2I5H A;  4OON A;  1GVP A;  3MXN B;  1PH9 A;  2CWP A;  2VQF L;  2YV5 A;  2NZO A;  3DM3 A;  3T1Y L;  2R92 G;  4LUV A;  1K73 C;  1KRT A;  2K75 A;  2E2I H;  1KRS A;  2JJQ A;  2ZTD A;  4RG1 A;  3I4M G;  3CC4 A;  1X6O A;  4DR2 L;  1T9H A;  2DUD A;  4DR1 L;  2QEX A;  1DGS A;  1UWV A;  2XGT A;  5E7N A;  4LFA Q;  4A3L H;  4L5T A;  1E22 A;  1HR0 W;  4DV6 Q;  4DUY Q;  4DR7 Q;  2KHI A;  5LMN Q;  5GAG C;  3AQQ A;  2BA0 A;  1KHI A;  2FXQ A;  2DGY A;  3G48 A;  3KF6 B;  3J80 c;  4DV1 Q;  1EUJ A;  4HJ9 A;  2B63 G;  2PMZ E;  1PH7 A;  3FP9 A;  4DNI A;  1E1T A;  1V9P A;  1E1O A;  3KF6 A;  3CCQ A;  4GOP C;  4A3B G;  3JAM c;  1Z47 A;  4A3F G;  4A3I H;  2UUA L;  3S1R H;  2VQF Q;  4DR6 L;  1C7Y A;  3NEL A;  2Q2U A;  4QJF A;  3CCR A;  3HFZ B;  4AQY L;  2UUC L;  1LM0 A;  3G71 A;  4BXX H;  1N8R C;  4JI3 L;  1I50 H;  2PI2 E;  1QUQ A;  2LSS A;  4DR2 Q;  1M90 C;  3L7Z C;  4DR1 Q;  4JI6 L;  1ASZ A;  4GN3 B;  4A76 A;  1BVS A;  1D8L A;  3F1Z A;  4PMW A;  4Y52 H;  5C3E G;  3PGZ A;  5IP7 G;  3STB C;  2E2J H;  3RZO H;  3E0E A;  3KYH C;  4WJ3 M;  3W1B A;  3HOU H;  2CKZ B;  4LFB L;  4IPC A;  4GOP A;  1IXR A;  1CSP A;  1XNR L;  4UPA A;  3K80 C;  1SR3 A;  4JCV E;  5FLX c;  1OTC A;  3S16 H;  3S2D H;  1HNW Q;  5H1S E;  5M5W H;  2NVY H;  2UUA Q;  3GO5 A;  2KCT A;  3M9B A;  2L15 A;  2BA1 A;  4DR6 Q;  4LWC A;  2K52 A;  5JJI A;  3NEM A;  5IYB H;  5FLM G;  1QZG A;  4BY1 H;  1A63 A;  4JI8 L;  4AQY Q;  4JI7 L;  4IO9 A;  2UUC Q;  4OWW B;  4XIG S;  4QQB X;  1VQK A;  4JI3 Q;  5M5X H;  2ZJR A;  4OWX B;  1CKN B;  4JI6 Q;  4GNX A;  3K81 C;  1PVO A;  4L5Q A;  1NMF A;  4KHZ A;  3FHW A;  4BBS G;  1BBW A;  4B3R L;  1VQL A;  1S40 A;  1BBU A;  1PYS B;  5GRO A;  5IT9 c;  2CWA A;  4TVA B;  4DKA C;  1J5E L;  1K3R A;  2F52 A;  3J80 i;  1QVF A;  3M7N A;  1XNR Q;  4LFB Q;  5C0X I;  5AJ3 Q;  1I3Q H;  2NN6 G;  2OQ0 A;  2ZJP A;  1EYG A;  4IPG A;  4DAM A;  1K9M C;  1JJ2 A;  4IFD G;  2R93 H;  4A3J H;  4KLK A;  2HIX A;  1V1Q A;  4C3J H;  3J81 c;  4HIM A;  2MO1 A;  2OCE A;  3W5O A;  5FJ8 H;  2NVT H;  1HNW L;  4LF5 L;  2K5H A;  5JEA G;  3F2D A;  2E2H H;  4DR4 L;  4JI8 Q;  3JC6 6;  3CCJ A;  4A3L G;  4JI7 Q;  2D62 A;  2KBN A;  2BH2 A;  3BZC A;  1EOV A;  3EN2 A;  2VNU D;  4K0K L;  4EX5 A;  4BY7 H;  1YHA A;  1E3P A;  1VQ8 A;  1HH2 P;  1WI5 A;  3CW2 C;  4B3R Q;  2NZH A;  3HOZ H;  1HZA A;  1PH8 A;  4JBK A;  1J5E Q;  4A3I G;  1FGU A;  1UE5 A;  2KEN A;  2UXD L;  4X62 Q;  3T1Y Q;  1VQ4 A;  3ULJ A;  4DK3 C;  4UY8 C;  3S1Q H;  1MKH A;  1X3F A;  3KF8 B;  3L2P A;  2HHH L;  1QVG A;  1XNQ L;  4GKK L;  2ZM6 L;  4BXX G;  1XPU A;  4UP9 A;  1VQE A;  4HJA A;  4LF5 Q;  1X3G A;  5ELO A;  4L5S A;  1KAW A;  4HID A;  1G6P A;  5ELN A;  1IBL L;  4JC0 A;  2YYZ A;  2PQA B;  2MO0 A;  3LGJ A;  3HOV H;  4MTN A;  2HIV A;  1JJC B;  1VQP A;  4JI0 L;  4QY7 A;  4C3H H;  1S3O A;  4YWL A;  3S24 A;  2A8V A;  4K0K Q;  1X65 A;  1CUK A;  1K83 H;  5IP9 H;  4DV6 L;  3KJO A;  3CPW A;  1NBW A;  1JT8 A;  5DLQ E;  4PZ6 A;  1PV4 A;  3H15 A;  4BBR G;  1FJG L;  2VY3 A;  1MJE A;  3CCV A;  2UXD Q;  2ALY B;  2MFI A;  3PO2 H;  5IYB G;  2WB1 G;  4BY1 G;  4P72 A;  1GD7 A;  2HHH Q;  1XNQ Q;  5IY0 A;  2ASB A;  1EQR A;  2NVQ H;  3HOY H;  1U0L A;  2JEB I;  3PUZ A;  2ZM6 Q;  4DV3 L;  4GKK Q;  4JBW A;  2IX0 A;  2JA7 G;  3J81 i;  3I4N H;  4AH6 A;  1G29 1;  3M3Y H;  1X9N A;  5GAD C;  4LUZ A;  1IBL Q;  1IBK L;  1J6Q A;  1XMQ Q;  1YIT A;  1X3E A;  3PF4 A;  1Q7Y C;  4JI0 Q;  1PYB A;  2EQS A;  3CMA A;  4GKJ L;  2AWN A;  2R6G A;  2OWO A;  4B3S L;  4YWM A;  3TRZ A;  4B3M Q;  3GTL H;  2VS1 A;  2VZA A;  1Y1W H;  2R93 G;  2K50 A;  1VQ7 A;  3J81 j;  4A3J G;  1FJG Q;  3CF5 A;  1U5K A;  2ZJQ A;  1RL2 A;  4A75 A;  1Q8K A;  1IYJ B;  2K14 A;  1QVC A;  1CSQ A;  5FJ8 G;  1PFS A;  2B29 A;  4JOI C;  5C44 H;  3UDX A;  1Q12 A;  1B70 B;  3TEH B;  4AIM A;  1ASY A;  4LF4 L;  4DV3 Q;  2IX1 A;  2RCN A;  1OXT A;  4A93 H;  2LXK A;  3M4Q A;  3CQZ H;  4JI5 L;  4DV4 L;  4LNQ A;  3B6Y A;  3EIV A;  1QUQ B;  3OTO L;  4DK6 C;  3U50 C;  4MZ9 A;  1L2F A;  3UE0 A;  1UE6 A;  4P75 A;  3E9H A;  4R4O A;  3RLF A;  4BY7 G;  1IBK Q;  3ER0 A;  3GDE A;  2RF4 A;  3HKZ E;  4Y7N H;  4X64 L;  1UE7 A;  1X56 A;  3H0G H;  3GTQ H;  3ZJY C;  1B7Y B;  4GKJ Q;  4JI1 L;  4GNX C;  4DR3 L;  1PH1 A;  4B3S Q;  2PI2 A;  1Q86 C;  4A3K H;  1NMG A;  3M85 A;  4GOP B;  1YNX A;  2IT1 A;  4H02 A;  4EQ5 A;  4YHH L;  1IBM L;  1GO3 E;  4R4Q A;  1X54 A;  3FKI H;  3KDF A;  1PH4 A;  1YEZ A;  3K7A H;  1WCM G;  4JOI A;  4OO1 I;  5AJ3 L;  1B8A A;  2Y0S E;  2ID0 A;  3PF5 A;  4GS3 A;  2UXC L;  4LF4 Q;  1GM5 A;  2ATW A;  1SLJ A;  2N3S A;  1OXS C;  2GVB A;  1VQO A;  4DV7 L;  3HOV G;  3M4O H;  4DV4 Q;  4DR5 L;  1HR0 L;  3G4S A;  4JI5 Q;  4GLX A;  3I4O A;  3OTO Q;  4IJH A;  3RR5 A;  1GKH A;  4GNX B;  5C0X G;  4POF A;  3PSI A;  1VQB A;  3DLL A;  5IP9 G;  3UDG A;  5IYC H;  1NE3 A;  5HY6 A;  1PA6 A;  2QGQ A;  4X64 Q;  3HOW G;  1JMC A;  4ME3 A;  1OXV A;  2Z0S A;  4NPS A;  4L5R C;  4JI1 Q;  4DR3 Q;  1UE1 A;  4ALP A;  4OX9 L;  3PO2 G;  3U4V A;  3RN2 A;  4YHH Q;  1IBM Q;  4A3C H;  2YU9 H;  1D7Q A;  3HOY G;  3G6E A;  3GTG H;  1JE5 A;  4QGU A;  1KL9 A;  1L1O A;  4X62 L;  1K0R A;  4J15 A;  2MQH A;  1L0W A;  1YZ6 A;  4OWT B;  4DV5 L;  1W2B A;  1N33 L;  2I0Q A;  2UXC Q;  1VS0 A;  3JAM i;  3AEV A;  4DV7 Q;  1YVC A;  3GTO H;  4A3G H;  1HR0 Q;  4DR5 Q;  3A5U A;  1LYL A;  3GTK H;  4UP8 A;  4A3E H;  1NTG A;  4AYB E;  1MJC A;  4HJ7 A;  3PUW A;  1Q81 C;  3IRB A;  1SE8 A;  3RN5 A;  1I5F A;  1M1K C;  3HOZ G;  1Y1W G;  4JBM A;  2Q2T A;  5K36 G;  4OX9 Q;  1G51 A;  1VQI A;  3HOX H;  1YJW A;  3STB D;  4C2M H;  3GTJ H;  5C44 G;  1Q1E A;  2WAQ E;  1YJN A;  4IOA A;  4O0A A;  2HQL A;  2HT1 A;  1C9O A;  1YHB A;  4BA1 I;  5BR8 L;  3S17 H;  2B63 H;  4JI4 L;  1HZB A;  3EBE A;  5LMN W;  4A93 G;  5IWA L;  3CCS A;  4DV5 Q;  4LF7 L;  3K0X A;  3RLN A;  4DUZ Q;  3D0F A;  2VW9 A;  1N33 Q;  3K7U C;  1IL2 A;  3PO3 H;  2R7Z H;  2UU9 L;  3F2C A;  3H0G G;  5GAE C;  4YY3 L;  2CQO A;  2GVA A;  3KJP A;  1XPO A;  1NJI C;  2OTJ A;  1XMQ L;  3E9I A;  1Z9F A;  2GN5 A;  1A62 A;  2JA5 H;  3CPF A;  4JBJ A;  1OXX K;  1VQF A;  3HOU G;  2N8N A;  2K5N A;  3CD6 A;  1VQG A;  2ZTC A;  1AE2 A;  1TWG H;  3RZD H;  4B3M L;  4IOC A;  4IFD J;  1TWF H;  1BKB A;  5BR8 Q;  1P16 A;  2WP8 J;  3AYH B;  4JI4 Q;  4A4I A;  3M4P A;  1SFO H;  5JEA J;  4WJ4 A;  2AHO B;  5IWA Q;  4HIO A;  3KLW A;  2AMC B;  3ICE A;  4LF7 Q;  2AWO A;  4HIK A;  2UU9 Q;  1N34 L;  3ULL A;  1CKO A;  1TWH H;  2UXB L;  5IYD H;  5IYC G;  3I55 A;  4R4C A;  2AKW B;  4O2D A;  4IPH A;  2QA4 A;  4YY3 Q;  3RNU A;  1XMO L;  1K8A C;  1AE3 A;  4X6A H;  1TXY A;  3I56 A;  5IE8 A;  1NY4 A;  3T1H L;  4HJ8 A;  1EIF A;  2Q2H A;  1VQH A;  1N32 L;  4R4T A;  1KIX A;  1Y14 B;  4OXP A;  4LF6 L;  3UDF A;  3ERS X;  1PH6 A;  2F3I A;  3PV0 A;  1VQA A;  1AH9 A;  1WFQ A;  1Q46 A;  2KCM A;  5GQO A;  3TQY A;  4GLA C;  3F2B A;  5M3F H;  4MNO A;  1PH2 A;  4JV5 L;  4GN5 A;  3Q8D A;  5GAH C;  4A3G G;  1SMX A;  1UEB A;  1R9T H;  5JJL A;  2IHE A;  2IY5 B;  1A8V A;  5C4J H;  3BZK A;  1N34 Q;  4A3E G;  2UXB Q;  4B3T L;  2C35 B;  1VQJ A;  1WOC A;  3W1G A;  2H5X A;  3CC7 A;  2K4K A;  3K8A A;  3U58 A;  4OO1 G;  1FL0 A;  4P73 A;  1XMO Q;  4X66 L;  1C0A A;  2D0P A;  4FDB A;  3HOX G;  3S14 H;  1MIU A;  1Q1B A;  5M3M H;  3T1H Q;  4DAY B;  1A0I A;  1KQS A;  3AFP A;  1N32 Q;  3MEF A;  3NBH B;  4GLV B;  2PNH A;  4LF6 Q;  4JG2 A;  3I2Z A;  1E24 A;  3KDF B;  4KI0 A;  4A3D H;  4JYA Q;  3J7A 5;  2MNA A;  1HNZ L;  2K5V A;  2Z6K C;  3CXC A;  2RHS B;  1KC8 C;  2OQK A;  3PO3 G;  1LUZ A;  2BH8 A;  3S1M H;  1EQQ A;  4JV5 Q;  2R7Z G;  4NXM L;  3GTP H;  3H3V I;  3U4Z A;  1Y1V H;  2JK8 A;  3KOJ A;  3SGI A;  3D31 A;  4QL5 A;  1K8G A;  5C4X H;  1TWA H;  2R7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...