3GTPH

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtpH00
4K0KL 5ELOA 4L5QA 3UDXA 2E2IH 4LF5L 1JE5A 2WAQG 2QEXA 4JI0L 1O7IA 1V9PA 4GOPA 1KIXA 2F4VL 5IP7H 3J80c 1KAWA 4PMWA 1JB7A 1NTGA 4DV7Q 3G4SA 3M7NA 1T9HA 4LUZA 1FVIA 1E7ZA 4QL5A 1AE2A 1QVGA 4A3GH 3CCRA 1VS0A 4DV3Q 2NVTH 4A75A 1Q1BA 3U4VA 2ZJRA 1I94L 2K75A 1E22A 4B3TQ 4POGA 4OX9L 2OTLA 4B3TL 4GOPB 1E1OA 1X3FA 4C3JH 2VY3A 3T1HQ 1VQNA 3KFUA 4DNIA 2BH8A 1H95A 4OWTB 3F2CA 1VQIA 1EQRA 4GNXB 1X56A 4IOCA 4DR2L 1VQPA 2KCMA 1QVFA 1YJWA 2IX0A 1L2FA 2RHSB 2Q2TA 3H0GH 4QY7A 3FHWA 4A3MH 3KJOA 1JJCB 1GKHA 3VDYA 1OXVA 4P75A 3UDGA 2UU9Q 4DUZL 4HIMA 3HKZE 4IPDA 5IT9c 1OTCA 4NXMQ 4KHPQ 1Z9FA 5JJIA 4J15A 5C44G 2MO1A 1G6PA 1UE5A 4DR6Q 3EBEA 4A3FH 2GVAA 3T1YQ 1UE6A 4QIWE 1MJCA 3HOUH 3DLLA 1PVOA 3I2ZA 1YITA 4GN5A 1Q7YC 1VQBA 2N3SA 5FJ8G 4LF6Q 1YI2A 1IBML 5IWAQ 1GD7A 1LTLA 2JK8A 3PSIA 1IXRA 2JQOA 5GQOA 3HOYH 2LXJA 4A3GG 4AQYL 1TWGH 1CKNA 2KHIA 4Y7NH 1N33L 3CD6A 1N34Q 3GTMH 1D8LA 2R7DA 1YEZA 3RNUA 2XGTA 1HNWL 1N33Q 2VW9A 3HOZG 5ELNA 4BY7H 2UXDQ 1TWFH 1X65A 2KCTA 5M3FG 5C3EG 5FLXc 1V1QA 1X9NA 4YWKA 3HOWG 4JI8L 3S16H 4B3MQ 1PHJA 3NBHB 2VQFL 4DV2Q 3M4OH 4A3DG 3GDEA 3K8AA 1HZCA 1MKHA 1VQLA 2K52A 1MIUA 4BBSH 3CCUA 2OTJA 1I6HH 1Z47A 4RG1A 3S1QH 2C35B 2UXDL 1KL9A 1LM0A 3S14H 1I50H 4HJ5A 4A76A 2UXBL 4KHPL 3K0XA 3KF6A 3PF5A 4NXML 3W1GA 3HKZG 2JA5H 4JI6L 2JA9A 1I3QH 3CW2C 4YHHQ 1A8VA 4A93H 4JI5L 5IP9G 5GROA 1HR0L 4BXXG 1Q82C 4BA2I 4KLKA 2JEBI 4X64Q 4HIDA 3I4MH 3S24A 3T1HL 1L1OB 3PO2H 3KF6B 3SGIA 3OTOQ 2JE6I 2JEAI 3UE1A 3S1MH 4QQBX 3AFPA 4LF7L 3U50C 4B3RL 3TS2A 3CF5A 3MXNB 1G51A 4JI6Q 2UXCQ 2VL6A 1A63A 1K73C 3E9HA 2K5VA 3JC66 3ULLA 3J81c 5AJ3L 2I5MX 1E24A 2GN5A 3K81C 1L1OA 3E0EA 5C0XG 3PV0A 4RMFA 2N78A 1VQ4A 1XMQL 1KQSA 3CMEA 2HT1A 1PH9A 3PUYA 1WJJA 2RF4A 2I5HA 2NN6G 1PA6A 1JJ2A 2WB1G 2UUCQ 2PQAB 1Y1WH 2ZJPA 3U58A 3G6EA 1PV4A 1HJPA 4PZ7A 3TQYA 5GAEC 3GTLH 2Q2IA 3STBC 2KHJA 3CMAA 1PH8A 1NE3A 2NZOA 4YWMA 4KI0A 4C2MH 5IYDH 1VQ6A 4X6AH 4JCVE 4DK3C 4A3FG 3PUXA 2NVYH 1AH9A 4LUVA 2IY5B 2Z6KC 4GKJQ 5C0XJ 1B8AA 1S72A 4R4IA 5C4XH 2JJQA 5EAYA 4LF8L 1YZ6A 2FXQA 1TWCH 2V1CC 3AQQA 1RIPA 1L0WA 3WWVA 1J6QA 2A8VA 2CWAA 3GTQH 1TWHH 5IE8A 3J81i 3HOWH 4DR6L 5C3EH 4A3JG 2OWOA 1W3SA 5M3MH 4IJLA 2HQLA 1XNRL 3BZKA 4GNXC 2CQOA 1K9MC 1IBKQ 1S3OA 1Q8KA 4DR1L 2Q2UA 1D7QA 2ZTEA 5IP9H 4B3RQ 2F52A 4FDBA 4R4QA 3W5OA 3J7A5 2K5HA 1QUQA 2VUMH 1CSQA 3RLOA 2JA5G 1FL0A 5GAHC 3GD7A 1C7YA 1NY4A 1YHAA 1EWIA 1E3PA 3ER0A 2CCZA 2E5LL 1BBUA 1PH2A 3S2DH 3CC7A 3J7ZC 1W2BA 4UY8C 2PI2A 4NPSA 4OX9Q 2UUAL 3KOJA 1K83H 2UUCL 3ULPA 3S17H 2JA6G 1C9OA 3M9BA 4DV0Q 5IYCG 4DR1Q 2K50A 2I5LX 4BA1I 1JT8A 4L5TA 2EXDA 3NENA 1PH5A 2HIVA 1XNRQ 3H0GG 3RN2A 1ASYA 3CQZH 1X3EA 2AWOA 1YJNA 2ID0A 4QJFA 3TRZA 1Q46A 2EIFA 4LWCA 1K8AC 3FKIH 2Z6KA 1VCIA 1U0LA 3OW2A 5JJLA 4LFBQ 3M3YH 4JOIA 3PUZA 4A3CG 4BY1G 4GKKQ 3GTKH 4P74A 4IJHA 1CUKA 3M85A 1VQ8A 1TXYA 4DPGA 2R93G 1OXUA 4X66Q 1XPOA 1VQMA 3HOUG 4DR4Q 5LMNL 4GLVB 2UUBQ 1SE8A 4H02A 1EQQA 4LF4L 3CAMA 5IP7G 1YBYA 2YTVA 1K0RA 1VQJA 2IHEA 4JBJA 4JI1Q 3K7AH 1I5FA 4JC0A 3L2PA 4JV5Q 4A4IA 1IBMQ 2WFWA 4IO9A 5M5WH 1SLJA 4POFA 1HNZQ 1UE7A 1HNZL 1Y14B 1X54A 5JEAG 1XMQQ 4PZ6A 2PQAA 1P8LA 1UWVA 2QGQA 1IBLL 4P73A 4DUZQ 1MJEA 4JI8Q 3I55A 1S40A 2LXKA 1V43A 2VZAA 5E7NA 4JI1L 2B63G 1B7YB 2A1AA 2B3GA 3CCVA 2Z0SA 3AYHB 3J80i 3PIOA 1A0IA 4LF4Q 2AHOB 3OTOL 1SN8A 4YCWA 2ZJQA 2CFMA 1N34L 4DR4L 1KC8C 4JG2A 5M3MG 2ZM6L 4P72A 3UDFA 5IWAL 4OWWB 2IX1A 1WFQA 3CCMA 2R6GA 2K4KA 4DAYB 2ES2A 4A3IG 1CKOA 1X55A 4GOPC 1HNXL 1XNQQ 5C4XG 2KENA 2CWPA 1HR0W 3GO5A 1XJVA 2N49A 3G71A 2NVQH 2R7ZH 1HZBA 1OXTA 4A3LG 1SR3A 5LMNW 2UU9L 3JAMi 4LF5Q 3RLFA 1XNQL 4GLAC 4JI3L 5M3FH 5BR8Q 4BY7G 4DR5L 2YTYA 3GTPH 1IZ6A 2JA8G 4DV5Q 3PIPA 4YWLA 4IFDI 3U4ZA 1ASZA 4R4TA 1K8GA 4L5SA 4X64L 2NVXH 1WI5A 1QVCA 1NMGA 3CXCA 2ZTCA 4A3BH 4B3SQ 3D31A 1SFOH 1AE3A 2QA4A 4OO1G 3HOXG 3EN2A 1XMOQ 2NN6I 4AQYQ 4UP8A 1QZGA 1HZ9A 4YY3Q 2HHHQ 4A3BG 4A3LH 2E8GA 2E2HH 4JBWA 3KYHC 3KLWA 3PO2G 4O2DA 2MO0A 1IBLQ 2VQEQ 4HJ9A 4ME3A 5IYBG 1WCMG 2D0OA 3A74A 1TWAH 3I4OA 3ULJA 3T1YL 4R1JA 4DUYQ 1VQ5A 1WYDA 2JA8H 3ICEA 2BH2A 3S1NH 1N32L 4WJ4A 3G48A 1EFWA 4EX5A 4LF8Q 2D62A 4DV2L 5M5XH 1L1OC 2VQFQ 3RN5A 4O0AA 1VQ7A 4X65L 1N36L 2EQSA 3CCJA 2L15A 3ERSX 1SROA 2GVBA 4IFDJ 4X62Q 2HIXA 1PH3A 4AIMA 4L5RC 1HNWQ 1HZAA 3FP9A 4YY3L 2DGYA 2HHHL 3S2HH 4R4OA 3BZCA 3GTGH 5LMNQ 4EQ5A 1XMOL 3PO3H 2ASBA 1SMXA 1YHQA 4P71A 1CSPA 4MZ9A 2IT1A 4BBRG 1DGSA 2R92G 4AYBG 1OXXK 4OXPA 2BA0A 4GN3B 4UP9A 2CKZB 3HOXH 1VQHA 2R7FA 3DM3A 1J5EL 4JI2L 3S15H 4LFBL 4DV5L 4HIOA 2JA7H 4QGUA 4DV1L 4YCVA 1YJ9A 3RZDH 3BJUA 2Q2HA 1VQAA 5BR8L 3GTOH 3HKSA 5AJ3Q 1M90C 2JA6H 2F4VQ 2IHFA 4LUOA 1WOCA 4C3IH 5HGQA 2B63H 4IOAA 4A93G 1Y1WG 3TREA 5C0XI 3CCQA 4ALPA 3A0JA 4GN4B 1PH1A 2R92H 1CKNB 3BU2A 3F1ZA 3RLNA 3F8TA 1YNXA 2BA1A 1R9TH 3CCSA 2OQKA 1EUJA 2WAQE 4DR2Q 1BKBA 4YCUA 3HOVG 2N8NA 3D0FA 1PH6A 1VQOA 4WJ3M 2R93H 4JI7Q 4LF9Q 3AEVA 1GO3E 3TS0A 2YTXA 4LFCL 1Q86C 2Y0SE 1NMFA 4JI4L 4BY1H 2ZM6Q 1I94Q 2PI2E 2K14A 1VQKA 4DV3L 1XPRA 2I0QA 4XTCS 3L7ZC 3I56A 4JI5Q 3I4NG 3KF8B 2PMZE 4YHHL 1A62A 1OXSC 4MTNA 3E9IA 1IBKL 2YYZA 4AYBE 1VQ9A 4X62L 1GVPA 2WP8J 3CCLA 2UXBQ 3L0OA 1PYBA 2RHQB 4NB3A 5IYBH 4BXXH 2NZHA 1EOVA 2VS1A 1N36Q 3NEMA 4X65Q 4HJ8A 1NBWA 4LFAQ 4Y52H 3PF4A 4DR7L 5FJ8H 2YV5A 4GKJL 1XTDA 4LW1A 1LUZA 3UDIA 3W1BA 5FLMH 1N32Q 4UPAA 5JEAJ 1K3RA 2WB1E 1Q81C 1JMCA 4OWXB 3F2BA 2F3IA 3I4MG 3OYYA 4JBMA 1KRTA 1FJGQ 2RCNA 1PH4A 2MFIA 3LGJA 2ATWA 1QZHA 1X3GA 5H1SE 4JYAQ 3PGZA 3CCEA 5K36G 4B3SL 1UE1A 4R4CA 3H15A 2YU9H 4TQUS 2UUBL 1YIJA 1XPUA 1FJGL 5C4JH 4GLXA 4IFDG 1HH2P 2Y0SG 3HOZH 4JI7L 4LF9L 4X66L 4LF6L 1KD1C 3Q8DA 4HJAA 3B6YA 4HJ7A 1N9WA 3KDFA 2JA7G 1Y1VG 5IY0A 1RL2A 4GKKL 3PCOB 4GNXA 3CC4A 4DR3Q 3AFQA 3NELA 2AMCB 4IPHA 3K80C 4DV6L 4HIKA 3S1RH 4JI3Q 4LFAL 4C3HH 4A3IH 1KHIA 3KJPA 5M5YH 1JJGA 1SRUA 1EIYB 1EIFA 3MEFA 3F2DA 2UXCL 5FLMG 1VQDA 3JAMc 1IYJB 4DV6Q 4DR3L 4DAMA 4DV1Q 4MNOA 3RZOH 2OQ0A 4LF7Q 4A3JH 3CPFA 1PFSA 1HNXQ 1P16A 1QUQB 4DV0L 3TEHB 5GAGC 1FGUA 4DV4Q 2DUDA 2H5XA 1J5EQ 3CC2A 2D0PA 4IPGA 4AH6A 4UP7A 4DK6C 2UUAQ 1LYLA 4JI4Q 4LFCQ 2MQHA 4A3MG 1EYGA 3A5UA 1KRSA 4OONA 1PH7A 4A3EH 1HR0Q 5J3BA 4LNQA 4OO1I 3K7UC 4DV4L 2E5LQ 2XTIA 1NJIC 1WCMH 4GS3A 2B29A 1N8RC 1IL2A 4DV7L 2AWNA 4IPCA 1E1TA 2PNHA 5GADC 1VQGA 2ZTDA 1M1KC 2E2JH 3UE0A 4XIGS 1YHBA 5C44H 3HOVH 4A3DH 1B70B 1C0AA 3EIVA 1U5KA 2A19A 4JI0Q 4JBKA 2VUMG 1X6OA 3H3VI 2K5NA 1BVSA 3KDFB 4APVA 2ALYB 3HFZB 4DR7Q 4K0KQ 2LSSA 1PYSB 4A3EG 4DUYL 3PUWA 3ZJYC 4B3ML 3H3VH 3A5ZB 1KXLA 2KBNA 3STBD 1YVCA 3CP0A 3RR5A 3I4NH 4JI2Q 1G291 2VQEL 4PG3A 3M4QA 4TVAB 3J81j 4PZ8A 5LMUL 5IYCH 1UEBA 2AKWB 3HOYG 4A3KH 4JV5L 2VNUD 5JJKA 2R7ZG 4NXNL 1VQFA 4JYAL 4NXNQ 4A3CH 2MNAA 1VQEA 4DKAC 4BBRH 5HY6A 3M4PA 5LMUQ 3FKIG 3CPWA 1Q12A 3IRBA 2OCEA 1BBWA 3I7FA 3PO3G 1Q1EA 4JOIC 1CKMA 3PUVA 4KHZA 5IYDG 1GM5A 1Y1VH 4BBSG 3GTJH 4DR5Q 1VQCA 5DLQE 4A3KG
chains in the Genus database with same CATH superfamily
4FF1A 4L5QA 3NBIA 2WAQG 4GOPA 1KIXA 2F4VL 4LJZC 1PTOH 1SEBD 1F2LA 4LUZA 4QIWB 2VB2X 1AE2A 2RSOA 2NVTH 5NUCA 1SNDA 3T1HQ 1E1OA 1X3FA 3MWYW 2VY3A 4FO2A 3KFUA 2BH8A 4FF3A 4OWTB 1VQIA 2F0HA 4KN4C 1HA5A 3K5LA 2K33A 2RHSB 3X3NA 1CA6A 1GKHA 2M2LA 2SEBD 3VDYA 1OXVA 2UU9Q 2JA7B 2F0EA 1G6PA 1UE5A 4DR6Q 1LTGD 1MJCA 2F03A 1YITA 1Q3LA 1VQBA 5IGEA 4LF6Q 4HCSA 1IBML 5IWAQ 1SNCA 1LTLA 3RZDB 3HOYH 4A3GG 2LXJA 4CHTB 1TWGH 2KHIA 5JVH3 1LACA 3CD6A 4OELB 3D8GA 2MUYA 4CDEC 3D4WA 1HNWL 1BO0A 1X65A 4A3FB 5M3FG 1CZGA 4RGTA 1X9NA 3MFYA 1PHJA 3NBHB 2R93B 2LMCB 2R7ZB 1VQLA 1MKHA 1YNND 1C4QA 3WOFA 4BBSH 5BN5A 1I6HH 1Z47A 2F0VA 4JK1C 2C35B 5EQ0A 1PLFA 3A55A 2F0NA 3K0XA 3PF5A 4NXML 1GUGA 3NP8A 4N9PA 1K28A 1LT4D 5J39A 4JI6L 4YHHQ 1I4RA 2O5JC 1K0SA 1DONA 4K5VA 4X3SA 5D3IB 3EJIA 4KMUC 3NPPA 4KLKA 4A3JB 4F8MA 1DOLA 1WCMB 3GQBA 5BN3A 2NZ1D 1JOKA 2YU9B 4LF7L 3TS2A 3NQTA 2F0OA 2RCFA 2WINB 4J6HA 3E9HA 2K5VA 3JC66 3ONAB 4RHSA 1I4PA 5ELBA 1E24A 1ET9A 4HMJA 2N78A 1VF5C 5C3WA 2F0IA 2RF4A 2EY5A 2I5HA 3R93A 2UUCQ 2ENBA 4ULLA 1TWHB 4OL7A 4WRDA 3K59A 1HJPA 2A68C 4IUUA 4PZ7A 5GAEC 3K58A 3STBC 2KHJA 1NE3A 2NZOA 4C2MH 3H3VC 4JCVE 3H6MA 4A3FG 5DAUA 3PUXA 4A3EB 4PMCA 1AH9A 4LUVA 4GKJQ 1II3A 2JJQA 5C3XA 2FXQA 2V1CC 3I91A 1RIPA 4DAYA 2A8VA 2EJFC 2CWAA 5IE8A 3E5SA 2F0GA 4KY6A 3Q0AA 2JA5B 2L5TA 4RAUC 1TS4A 5KIXA 4IJLA 1XNRL 3S17B 4PQXA 2RKSA 3HEJA 1D7QA 2ZTEA 1QCBD 3NE5B 3GD7A 1YHAA 1EWIA 3J81E 1BBUA 1SJED 1PH2A 1SYBA 3S2DH 4HSVA 3J7ZC 1W2BA 4UY8C 1DOMA 1A3VA 3DWQA 3QO2A 5I4DA 3CHBD 2WIIB 4BA1I 4ME5A 1XNRQ 1H9RA 2AWOA 3EA6A 2RVLA 2Z6KA 5C5MA 5EBCA 4WORA 1T5EA 3V96A 3TZDA 1TXYA 4PNYA 4DPGA 1ENAA 2R93G 1VQMA 3HOUG 2UUBQ 1SMYC 2SNSA 4OIJA 1YBYA 2YTVA 1AZPA 1I5FA 3QIAA 1WTWA 1PXUA 1PZID 3P75A 4A4IA 4H0LC 4IO9A 1U4MA 2KUMA 1ILQA 4QUCA 1HNZQ 5JEAG 4B08A 2V4DA 4DNTB 2PQAA 2I07B 3OIPA 1IBLL 1UWVA 4P73A 2DNCA 2XWJB 3G7LA 4XYOA 2LXKA 1V43A 5E7NA 1MI2A 2B63G 2KCNA 2A1AA 3CCVA 3MXUA 3PIOA 1A0IA 5LL6S 2ZJQA 1SN8A 4NDXA 4YCWA 5I6WA 4NW2A 1KC8C 5ELEA 5M3MG 2B39A 2KA7A 2RQXA 4OWWB 1WFQA 2K4KA 4LK1C 2NYZD 4TKOB 4GOPC 3TBIB 1XNQQ 2WV6D 2KENA 3MEHA 3KF8A 5IOCA 1TWCB 1TWGB 1HR0W 3RLFA 1DCZA 4IUVA 5G3LF 4DR5L 2YTYA 1IZ6A 2XNAC 3T13A 1LT3D 2K5DA 1PRTB 4R4TA 2K6AA 4L5SA 4X64L 1WI5A 1NMGA 2ZTCA 2E2JB 1W6KA 3HOXG 3EN2A 4UP8A 4YY3Q 4A3LH 4A3BG 2E2HH 4JBWA 2G9HD 1EYDA 3PO2G 2EY2A 2K01A 1WTQA 3T1YL 3I4OA 4R1JA 1WYDA 1ZYRD 1EFWA 3HOXB 3V2TA 1VQ7A 1AN8A 1N36L 2MJ8A 2EQSA 3CCJA 4FF2A 3MA2B 5CGKA 4X62Q 1DXMA 2HIXA 5FLXL 2ZT9C 1EY4A 3S2HH 3FRPB 4R4OA 5AFWA 1SE3A 2A73B 3SE0A 2KCCA 2KOLA 2IT1A 3P1HA 4BBRG 4CKEA 4AYBG 1OXXK 4OXPA 2A69D 4GN3B 1A3UA 2R3ZA 1GUOA 3S15H 1BCPD 1B53A 3M7GA 4YCVA 3RZDH 4KY7A 1AW7A 2B2TC 1E2WA 3HKSA 1JWUD 3FDTA 4N9TA 3W3AA 2IHFA 2F4VQ 4IOAA 5JPMC 1Y1WG 4ALPA 3CCQA 5IT9L 1CKNB 2HDLA 2E75C 1DD2A 5M5YB 3N6RA 2WAQE 1ONLA 2PW7A 2R93H 1STAA 3OIQA 1D1IA 5HURA 3TS0A 5DM63 1Q86C 1EY9A 5IGGA 2Z4IA 1VQKA 2NBFA 4XTCS 3L7ZC 1A62A 1D6EC 2R92B 4MTNA 1IBKL 3CCLA 1B1ZA 2EYLA 5L37A 1EOVA 3PF4A 2G9DA 1TS2A 1XTDA 3W1BA 1LUZA 1NCVA 5ELCA 4A3GB 3OYYA 4JBMA 1KRTA 1A6XA 1FNWA 3LGJA 2ATWA 3IFTA 1QZHA 1X3GA 3ITPA 4ZKCB 2HDMA 3MZ5A 3RZOB 1DOKA 1HCZA 2EZVA 4LF9L 1HUNA 1MBYA 3Q23A 2L12A 4HJAA 1SXTA 1LABA 2JA7G 4KD3A 1Y1VG 3DWPA 4GNXA 3CC4A 4X3KA 1UEAB 3MEFA 3F2DA 4DXFA 3JAMc 1VQDA 1VF7A 1RF2D 4DR3L 2NVYB 1PRTF 4DV1Q 2OQ0A 4LF7Q 4A3JH 4FXKC 1JICA 3CPFA 4G7HC 1HNXQ 4MTKA 1EQVA 3P7JA 1H9KA 4DV4Q 1G6ZA 5CV7A 3ND9A 2E74C 3VR6A 4KJNA 3PIO3 4JI4Q 1CQFA 4PMBA 1YNJC 2PNRC 5ELFA 1PFNA 4DV4L 1AFPA 3H91A 4NKLA 2A74C 3I70A 3LWUA 3PO2B 1QNKA 5GADC 1VQGA 1CI3M 4A3BB 1TWAB 1C0AA 1YHBA 4A3DH 3K57A 4JBKA 1CFMA 4K0KQ 1DYQA 4A3EG 4DUYL 4CDCC 3PUWA 4M1UB 3TZUA 3H09A 3EFXD 3RR5A 2K5WA 4JI2Q 1L0XB 4PG3A 4TVAB 3J81j 4PZ8A 5LMUL 1UEBA 3A7AB 4JV5L 4A3DB 4NXNL 1VQFA 4JYAL 4A3CH 4RA8A 4BBRH 5HY6A 5LMUQ 2IPKD 5T1GA 1EEFD 1Q1EA 4JOIC 1QE6A 1CKMA 5C3EB 3QWNA 4BBSG 2Q8TA 3GTJH 2QCPX 1VQCA 5DLQE 4A3KG 1G2TA 5ELOA 2DY7A 2EE1A 1S5BD 1Y8OB 1JE5A 1RDPD 4DK0A 4WJWA 4DF7A 4DK1A 5FO9B 1KAWA 1JCKB 3T56B 1NTGA 5EKIA 4DV7Q 3G4SA 1E7ZA 2B63B 1ESFA 4A3GH 2IL8A 1ICWA 1H9JA 1RKNA 3CCRA 4DV3Q 4A75A 1Q1BA 4RGOS 2K75A 1E22A 1GUTA 2OTLA 4HTHA 1LTRD 4GOPB 1H95A 1B3AA 1X56A 3LNNA 3MXGA 4IOCA 2Q2TA 2VB3X 1O80A 1QJOA 1WD1A 4HIMA 1OTCA 5JJIA 2NTTA 5C44G 4C1NK 3NTKA 4QIWE 4EGVA 3DLLA 1TS5A 3OW7A 3FVQA 4O42A 2JK8A 5GQOA 1N33L 4Y7NH 3GTMH 1MD2D 1XX8A 4RFBA 5IIFA 1PDQA 2XGTA 2IX3A 1N33Q 4BY7H 1ZXTA 1V1QA 1K8OA 4YWKA 1ZEQX 3HOWG 3PO3B 3T4AC 4UDUC 4B3MQ 5K36H 2VQFL 1K8MA 3M4OH 1HZCA 5I2YA 3HOYB 2BOSA 3N52A 4K5XA 1KL9A 1LM0A 3S14H 1I50H 1R4PB 1PTOF 3HKZG 2ICEC 2HQEA 5FOBB 1CK1A 3EROA 4BXXG 4K8JA 4FYDA 3M4OB 2C9OA 3I4MH 2LFNA 3C1FA 2JE6I 5A2QL 1A15A 1I4GA 1QOHA 4C3IB 3U50C 2J0TD 4MIUA 1UUPA 3A54A 1JB3A 5C0XG 3K81C 3E0EA 3A8JE 3PV0A 4RMFA 1WTOA 5E4XA 3VA5A 4ZCKA 3PUYA 1WJJA 4HMIA 1SNQA 2NN6G 1JJ2A 3K5MA 3LWEA 2NWGA 3U58A 3OMGA 2Z1CA 2NN6H 4DNRB 3GTLH 1E2ZA 2E2HB 3SDZA 1XWEA 4XQJA 1VQ6A 1NNXA 5JOBA 4DK3C 1GOZA 2NVYH 2IY5B 2Z6KC 2WKCA 3S1NB 1B8AA 5C4XH 1L0YB 1D5MC 1F2YA 5M9OA 1JE4A 4RKLA 5C3EH 3BZKA 2CQOA 4PV1C 2L4NA 2Q2UA 4I7ZC 4ZRZA 1CT1D 2F52A 3W5OA 3TN2A 5C4XB 1NY4A 1E3PA 1O78A 3ER0A 2CCZA 4BS9A 4RCOA 2F0SA 1PTOC 4NPSA 2QKIC 1K83H 2F0LA 2JA6G 1C9OA 5IYCG 1LV9A 2K50A 2L55A 3ERQA 2HIVA 3H0GG 3RN2A 1J9OA 3CQZH 3QB3A 4CDFC 3T51B 1Q46A 3TRZA 3S14B 4XQNA 1EY8A 5T1IA 4IUPA 4LFBQ 5JJLA 3PUZA 4A3CG 4BY1B 1B50A 4IJHA 3MC0B 2EDGA 2RA4A 1CA5A 3GTGB 3QOLA 1XPOA 2RBMA 5LMNL 4F87A 1SE8A 4H02A 1EQQA 2A6HD 1F9PA 5IP7G 1VQJA 1EWCA 4JI1Q 3L2PA 4JC0A 1CQVA 3FKIB 3GTMB 3NUCA 2FMMA 2WFWA 4POFA 3Q24A 1UE7A 4CDDC 2QEJC 4LAAA 2CH4W 2QGQA 4M8AA 3I4LA 1MJEA 2O4XA 2VZAA 2H4OA 5KYIA 2F0FA 4JI1L 2B2WA 1B7YB 4L8JA 2Z0SA 3J80i 2XVSA 3EQLC 3JAME 3HP3A 2AHOB 2K1BA 2F0JA 3OTOL 1BBXC 4Q0FA 2LS01 3UDFA 5KRUA 1X55A 1YNNC 1OO9B 4X3UA 1B9MA 1X32A 1XJVA 1VMPA 4A3LG 5LMNW 2CH4A 1CM9A 2UU9L 4HEDA 1A2UA 5BR8Q 4KV6A 1SYFA 2JA8G 3KUPA 4DV5Q 2J4XA 3PIPA 3DM1A 4IFDI 4DFAA 1H9SA 2NVXH 4H7BA 4B3SQ 3D31A 1LLRD 2QA4A 1E0BA 5D14A 1A3TA 1QZGA 1IYVA 2RDHA 3KYHC 3KLWA 4HJ9A 4ME3A 3S1RB 1EZ8A 3A74A 1EY0A 4DUYQ 3S1NH 2JA8H 1B4OA 2BH2A 2D62A 4DV2L 5M5XH 1L1OC 4JPBW 4C1NI 3ERSX 1SROA 1SSOA 2EYFA 2GVBA 4L5RC 1PH3A 1HA6A 2PPBC 2M9VA 3BZCA 2WAQB 4EQ5A 2IJ0A 2BDNA 2PMZB 2ASBA 1SMXA 2A68D 1YHQA 1CSPA 1DGSA 2R92G 3K5OA 1H9SB 3HOXH 1NUCA 2R7FA 4JI2L 4LFBL 2JA7H 4DAVA 4QGUA 1YJ9A 3GTLB 1VQAA 3MHBA 5AJ3Q 1M90C 3S2HB 3MTSA 1CZWA 3NHHA 4C3IH 4A93G 2F3VA 2R61A 1STNA 3A0JA 4GN4B 3IFDA 5CORA 1PH1A 3BU2A 1KABA 1YNXA 2BA1A 5FO7B 3CCSA 4DR2Q 4J1MA 2BDOA 2EJMA 3KLRA 3D0FA 1PH6A 2SDFA 4F7XA 4JI7Q 1TKWB 2RSNA 1GO3E 3AEVA 3GTQB 3CU7A 2E2DC 2YTXA 1QB5D 1NMFA 1G2SA 1I94Q 2K14A 1XPRA 1I50B 3VYRA 2TSSA 5CV8A 3I4NG 1ILPA 2EVBA 3E9IA 1BF4A 1PYBA 4NB3A 4BXXH 1N36Q 2SNMA 4XT3B 1ML0D 4DR7L 5FJ8H 1N32Q 1SMYD 4LW1A 3UDIA 3BG3A 4ZK9B 4UPAA 4N8X1 1WTRA 1HXYD 1GHKA 2WB1E 4MHEA 1Q81C 2JYOA 3HGBA 2MFIA 2F0TA 3QR8A 3E6ZX 3HZXA 5H1SE 2X6GA 5CYUA 5K36G 4B3SL 2YU9H 4TQUS 1TU2B 2B8FA 1IW7D 4GLXA 2Y0SG 3HOZH 4X66L 1HRJA 4HJ7A 3S1QB 2JA6B 1RL2A 1BQQT 4R8IA 2K7VA 4DR3Q 3AFQA 3S1RH 4IPHA 1KHIA 4DGZA 5M5YH 2QW7A 1SRUA 2CHBD 4RKBA 1V1PA 3SK4A 5TSSA 1I6HB 1VDZA 1ET6A 3E0JA 4DAMA 1G91A 3RZOH 2BE5C 4Z9CB 1PFSA 3D6CA 4OGQC 1GUSA 4FF4A 1PTOD 5M5WB 3CC2A 1LYLA 3SXHA 4A3MG 3TP8A 3A5UA 4OONA 4K2KA 1HR0Q 5EGTA 4LNQA 3K7UC 2E5LQ 4OIKA 4BY7B 2FHTA 1SYEA 2XTIA 1HHVA 1NJIC 2F3WA 5ELDA 3TMEA 1IL2A 3K5NA 4DV7L 4IPCA 4R9WA 2ZTDA 2K04A 2X6LA 4A3KB 1WD0A 4OO1H 4XIGS 4KHVA 3HOVH 3EIVA 1U5KA 4XDXA 1X6OA 2K5NA 4A3MB 1BVSA 2LSSA 1PYSB 5EPKA 1KXLA 1V8QA 2PW5A 3STBD 3I4NH 3SHLA 1EWHA 1FNUA 1G291 5D65A 3M4QA 2JA8B 1PYWD 2WB1B 3I90A 5CV4A 5CBAE 1HQRD 1PRTC 1FR3A 2NB0A 2R7ZG 2PCFB 4DKAC 3BDCA 3NSWA 1HFGA 1Q12A 3CPWA 5M3FB 3IRBA 1Y8NB 2D5DA 4QMGA 3PUVA 4KHZA 1GM5A 3VR3A 4K14A 4LF8L 2BE5D 1STYA 2A6ED 5EPJA 2F0MA 2MPMA 4JI0L 2EXZA 3RUZA 1V9PA 4RWSC 1MSGA 5IP7H 3J80c 4R8NA 1Y8PB 3BVZA 1ICFB 4ID6A 3M7NA 1IHZA 1T9HA 1FVIA 1PRTD 4EVOA 4QL5A 3M4YA 1QVGA 2FFKB 1TVXA 1Y1VB 3AU7A 3I8ZA 2ZJRA 1B2TA 2H1EA 3SEBA 4POGA 5LHY1 4B3TL 1VQNA 4C3JH 1D1KA 3DXJC 4DNIA 1BCPB 4DR2L 1VQPA 2KCMA 3S2DB 1TIID 2Z4HA 3H0GH 5FLXE 3FHWA 2NVXB 4A3MH 1HUMA 4P75A 3UDGA 3D4DA 3HKZE 1HTLD 5IT9c 5D3DA 4NXMQ 1Z9FA 4J15A 5EBDA 2EY6A 3NQIA 1GXDC 2MO1A 2A5HA 3EBEA 4A3FH 1SYGA 2GVAA 3T1YQ 1UE6A 3OSOA 3Q6SA 4C3JB 3HOUH 4AYBB 1PVOA 3I2ZA 1Q7YC 3SVMA 2N3SA 3GV6A 1IXRA 2JQOA 1CKNA 2OT2A 1YEZA 2XWBB 3HOZG 2VW9A 5ELNA 2KCTA 5FLXc 2RDGA 4JI8L 4ZYSA 3S16H 1GUNA 1K3BC 4DV2Q 1SJHD 1WTXA 4KKTA 3GDEA 2KQ3A 2K52A 3BVGA 5DEHA 3CCUA 2CW0D 2OTJA 2KJXA 4RG1A 2UXDL 1SAPA 4HJ5A 2UXBL 3KF6A 4IQZA 3W1GA 2JA5H 1NSNS 2D9UA 1I3QH 3CW2C 1A8VA 3U9SA 4JI5L 5GROA 4ILWA 4BA2I 4X64Q 3OWFA 1L1OB 3NK9A 3SGIA 4BBRB 3OTOQ 2JEAI 2PYKA 3UE1A 3S1MH 2A6HC 3MAQA 2PZTA 3DWAA 2UXCQ 2AQ1B 2VL6A 2AQ2B 1K73C 3VA7A 4TSSA 3ULLA 5AJ3L 2UXDQ 2GN5A 1JR0D 3AB9A 5C4HA 1RCVD 1VQ4A 4XXEA 2PZWA 4KTAA 5CMDA 1EFID 2ZXRA 2PQAB 1LTAD 1F9SA 1PZKD 1I4XA 1YNJD 2Q2IA 3K0YA 3CMAA 4YWMA 1TWFB 5IYDH 1XXGA 4X6AH 2DNEA 4U68A 2J7ZA 5KNCA 4KN7C 5C0XJ 1S72A 2MHVA 4R4IA 1PFMA 4B9WA 5EAYA 3AQQA 1TWCH 1L0WA 3GTQH 3J81i 3HOWH 2DY8A 3KLSX 4DR6L 2OWOA 1W3SA 3VYTA 1TR5A 1O7LA 1S5CD 1V1PB 4GNXC 1JC7A 4CKBA 1Q8KA 3TSSA 5FK9C 5IP9H 4FDBA 4R4QA 2K5HA 1KAAA 2VUMH 5GAHC 1C7YA 1F2MA 1EU3A 5IGDA 3CC7A 1W6JA 2PI2A 3NBHA 4OX9Q 2UUAL 3KLSA 1GUWA 3ULPA 3RMHA 5A35A 3S17H 1BCPF 4DV0Q 2IWHA 1IKMA 2I5LX 1JT8A 2G5DA 3NENA 1PH5A 3MVVA 2Q8IB 1X3EA 2ID0A 3BDLA 4K6DA 2EIFA 1K8AC 3FKIH 4I65A 1U0LA 3OW2A 5EPLA 2SOBA 4BY1G 3J7AV 4GKKQ 2XRQD 4P74A 2EYHA 1CUKA 3M85A 4C2MB 5COYA 4X66Q 1DZ1A 4DR4Q 5C44B 3OHXC 3IL8A 3HOZB 3CAMA 4Q5VA 4RH6A 4JBJA 2IHEA 4JV5Q 3S1MB 5HGTA 1EIGA 2Z6BA 2NVTB 3GTOB 3I72A 3JAML 4IUNA 1Y14B 3DHQA 4XQQA 4KD4A 1EY6A 3MFGA 1P8LA 4DUZQ 4JI8Q 3I55A 1S40A 5J22A 1JORA 3IAYA 3AYHB 3NTHA 2M00A 1EY7A 4DR4L 3TP5A 1VMCA 2HD3A 1F2ZA 3W2DA 4K8IA 4ZUIA 1GJXA 4P72A 5KGUA 2L1BA 2IX1A 3EVQA 2R6GA 1SNPA 5JVG3 4EQPA 2F0KA 2LKVA 1JWSD 4DAYB 3A7LA 4A3IG 4G7ZC 3G6JB 1ZYRC 1TY0A 1WTVA 2N49A 3G71A 2R7ZH 1HZBA 1OXTA 4TRDA 1SR3A 3JAMi 4NP5A 4GLAC 1O7ZA 3QJYA 1SE4A 3E3XA 2NUCA 4JI3L 5M3FH 4BY7G 3GTPH 3OMCA 4QUFA 1Z7TA 5F2DA 3L9AX 1K8GA 2KVMA 2CVRA 1O7YA 4A3BH 4OO1G 3VR5A 2NN6I 4AQYQ 4ODGA 1B3QA 4WFN3 3DUZA 2MO0A 2VQEQ 5IYBG 5CR3A 1EL0A 1EZ6A 3VR4A 2ICIA 3R8BA 4WJ4A 1N32L 4LF8Q 5KNBA 2VQFQ 1S5FD 1S5ED 2L15A 1M8AA 3HKZB 1Z6HA 1HNWQ 1RODA 2HHHL 2DGYA 2DJFC 3O13A 1MGSA 1CHQD 1TQOA 4P71A 3C2PA 1LTBD 1DM0B 5EKLA 4DU9A 2OXPA 1J5EL 3DM3A 4CJ0B 4S3SA 4HIOA 2QDBA 5BR8L 2B2WC 1I3QB 2JA6H 3FMCA 4LUOA 2MP1A 1LT6D 3P20A 4HAEA 3F1ZA 1STBA 5M3MB 3I4NB 3F8TA 1U9RA 1R9TH 2OQKA 4K2LA 2F0DA 1EUJA 1BKBA 5C0XH 1VQOA 3BS1A 4LF9Q 1JOOA 3HG9A 4LFCL 3H0GB 2PI2E 3GTKB 5IODA 2I0QA 1NR4A 4B9XA 3I56A 3KF8B 4YHHL 4C3IG 5FO8B 2F0QA 1F9QA 4AYBE 4X62L 4IZ8A 1GVPA 1EEID 3J7YW 1JOQA 2VS1A 3J80L 3NEMA 4X65Q 4HJ8A 1I4HA 4LFAQ 4BWGB 2YV5A 3WDNA 5FLMH 4C3JG 3BDOA 3FEWX 3A56A 1EYCA 4C3HG 1T5XD 3SK8A 1JMCA 4RHRA 1FJGQ 2RCNA 1PH4A 4CJ1B 4DN4M 1IL8A 1C48A 4MN3A 4R4CA 2UUBL 1DJRD 1X3PA 1YIJA 1FJGL 4IFDG 3T53B 4FVMA 4JW0A 4BBSB 1KD1C 3B6YA 1N9WA 3KDFA 4K6LA 3R2TA 4KKSA 3PCOB 3WOEA 3TP6A 3NELA 4DV6L 4LFAL 3VYUA 4C3HH 2XSCA 4HN7A 2L9HA 1EIYB 2UXCL 2KECA 5I9PA 1U4RA 4DV6Q 2QDLA 3VYSA 3X3MA 2B2UC 1P16A 1HTPA 1QUQB 3TEHB 5GAGC 5IGBA 2DUDA 2H5XA 2D0PA 4IPGA 2UUAQ 4UP7A 5CV5A 4QF4A 2B2UA 1EYGA 1KRSA 3J7AF 4A3EH 5J3BA 4OO1I 2FJ2A 1WCMH 1N8RC 2B29A 2AWNA 1E1TA 4LMQD 2E2JH 3UE0A 2MGSA 3KDFB 4APVA 2ALYB 4DR7Q 1B9NA 4F88A 3ZJYC 4B3ML 1PMRA 3A5ZB 3H3VH 2F0PA 2KBNA 3CP0A 2VQEL 1BOSA 2VUMB 3PMFA 5IYCH 5I2XA 2JXMB 3HOYG 4A3KH 2VNUD 5JJKA 4V0BA 2MNAA 2PQEA 1BR9A 3SK6A 3M4PA 3FKIG 1SFOB 3I7FA 3PO3G 3HOWB 5JEAH 2ZXPA 1AP0A 5IYDG 1IYUA 4A3IB 2HCIA 2JSOA 4DR5Q 5ISRA 4K0KL 1SYDA 3UDXA 3CKIB 2E2IH 4LF5L 3S16B 1XYIA 1EQTA 2QEXA 1O7IA 5IGFA 1ENFA 4PMWA 1JB7A 2EYMA 3ND8A 4P2CB 5DM73 3OPOA 2F0WA 5C5LA 1VS0A 1CTMA 3U4VA 1I94L 4OX9L 2EYPA 4B3TQ 1RJTA 2Y0SB 5M5XB 1XTCD 3F2CA 4FP5D 1EQRA 4GNXB 1QVFA 2KEDA 2IX0A 1L2FA 1YJWA 1D2BA 1FNVA 4QY7A 3KJOA 1JJCB 4Y7NB 4G57A 4DUZL 4IPDA 3T16A 1EIHA 4KHPQ 2B2TA 1BUVT 2QILA 5JAVA 2B2VA 1TT2A 4GN5A 5FJ8G 1YI2A 1EYAA 1GD7A 4GKJL 3PSIA 4NMZA 3KK7A 4AQYL 3NWSA 1Y1WB 4K5WA 2PO4A 1AZQA 1N34Q 1D8LA 2R7DA 5C4ZA 5IT9E 2OEOA 3RNUA 2HCCA 2EYJA 1STGA 1TWFH 1JQYD 5C3EG 1KNAA 3K6OA 2F0UA 4A3DG 3K8AA 3PQIA 1MIUA 4L6TB 3S1QH 1QNUA 2PZUA 4A76A 4KHPL 3S9WA 2I46A 2L0CA 1FGBD 4C3HB 2JA9A 2HUGA 5FKAC 5A2QE 4A93H 5IP9G 3J80E 2FINB 3BYYB 1HR0L 2K03A 1Q82C 2JEBI 4HIDA 4CJ2C 2EYOA 3S24A 3U9OA 3T1HL 3PO2H 3KF6B 4QQBX 5C4JB 3AFPA 4B3RL 3CF5A 3MXNB 3A8IE 3A8KE 1G51A 2JN4A 1Y69U 4JI6Q 4OEMB 1LTSD 1A63A 1J8IA 2F4IA 1KDCA 3J81c 1KTKA 2I5MX 3C3LA 4DA2A 1L1OA 1KQSA 1XMQL 2HT1A 3CMEA 5G3LD 1PH9A 3TDQA 1PFBA 2AUKA 1PA6A 2WB1G 1Y1WH 2ZJPA 4GZYC 1MSHA 3CRKC 3G6EA 1PV4A 3TQYA 1IW7C 1PH8A 2DN8A 1RTNA 4KI0A 1SNMA 1STEA 4G7OC 4KY5A 4FXGC 4ZQ3A 2XRSD 3DEPA 5K5PA 3SR1A 5IGCA 1YZ6A 3C1EA 3WWVA 2P5ZX 3FPUB 1J6QA 1TWHH 2VXWA 3MXNA 4A3JG 5M3MH 5LL6X 2HQLA 1K9MC 1IBKQ 1S3OA 4H13C 4DR1L 1RHPA 1SE2A 4XT1B 4B3RQ 3J7A5 1QUQA 1CSQA 3RLOA 2JA5G 1FL0A 2B2YC 1FD7D 3SK5A 1I4QA 2E5LL 1SNOA 4IALA 3KOJA 2K32A 4U673 2UUCL 5J1ZA 1FYCA 4I7AA 3M9BA 4DR1Q 2DJGC 4L5TA 2EXDA 1CHPD 1M4VA 1ASYA 3HOUB 1YJNA 4QJFA 3K7AB 4LWCA 3FPPA 2KEEA 3R3OA 1VCIA 4L63B 2AUJD 3M3YH 4JOIA 3GTKH 4UAIA 1VQ8A 4E6IA 3GP7A 4ZLTF 1OXUA 5I9OA 4GLVB 4LF4L 5BN4A 4QCLA 1JWMD 1KDBA 1K0RA 3K7AH 4ZAIA 3KBXA 1IBMQ 2ZXOA 3L3OC 1LTID 1U4PA 4FNFA 2A6EC 5M5WH 1SLJA 5DNFA 1F77A 1HNZL 1LO5D 4N8FA 1X54A 1XMQQ 4PZ6A 4HCEA 5KNDA 3I3CA 4IUTA 4HSPA 3QG1A 3LX0A 2B3GA 1NR2A 2NVQB 3HOVB 4LF4Q 3Q22A 3OOCA 2WKDA 1LT5D 2CFMA 1N34L 1K83B 4JG2A 2ZM6L 4X3TA 4A93B 4O1NA 5IWAL 3CCMA 1BNZA 1HFNA 2D2CC 2ES2A 1CKOA 1TS3A 1HNXL 5C4XG 5KEEA 2CWPA 1HPCA 1RD9D 3GO5A 2JP1A 1BDOA 4IURA 2NVQH 4EQNA 2B8GA 5KYLA 4LF5Q 1XNQL 3BYTB 3GV3A 1MHWC 5JPNC 2X69A 1UNSA 3NTIA 2A69C 4YWLA 3U4ZA 1ZKOA 5C6AA 1ASZA 4RCNA 1QVCA 3CXCA 3TP7A 2O5IC 1SFOH 2NTSA 1AE3A 2Q8RE 1XMOQ 4C56C 4JVZA 5CC4A 3MXPA 1HZ9A 2HHHQ 2E8GA 5E3FA 4O2DA 1IBLQ 3D4RA 2B2VC 1WVLA 2K05A 4KJOA 1WCMG 2D0OA 3ULJA 1TWAH 1VQ5A 5E1FA 1D5ZC 4HR7B 3ICEA 3G48A 3V05A 4EX5A 1PTOB 3RN5A 4O0AA 2AQ3B 4X65L 3PIP3 1EOTA 3F2UA 3ZYYX 2XN9C 1E2VA 4IFDJ 2EPBA 4AIMA 1HZAA 3FP9A 1RTOA 4YY3L 2TMPA 5LMNQ 3GTGH 5E4WC 1XMOL 3PO3H 2WACA 2F1MA 1EY5A 3GTJB 3OWEB 4KK7A 4MZ9A 2BA0A 4UP9A 2CKZB 1VQHA 1V1OA 4DV5L 2N55A 4DV1L 3BJUA 2KHSA 2Q2HA 3GTOH 1KNEA 2RDFA 1WOCA 5HGQA 5EKKA 2B63H 3M3YB 1AEXA 3TREA 5C0XI 2R92H 3RLNA 1GHJA 1R4QB 1X3QA 3HRZC 3NXWA 4YCUA 3HOVG 1D5XC 2N8NA 4WJ3M 3RD4A 4IN3A 1H9MA 2E76C 4JI4L 2Y0SE 4ZKBB 4BY1H 2ZM6Q 4DV3L 3AMUA 4JI5Q 1NAPA 3CRLC 2PMZE 1OXSC 1UAPA 2EOTA 2YYZA 1VQ9A 2WP8J 1QWYA 2UXBQ 1A2TA 3L0OA 2RHQB 1S5DD 4QB4A 5IYBH 2EY1A 2NZHA 5CV9A 2CW0C 4CGYB 1STHA 1NBWA 4Y52H 1SDFA 2C5CA 3DMUA 1BCPC 1KDAA 2QF7A 3D6WA 5JEAJ 1K3RA 2GA4B 4YIJA 4OWXB 3F2BA 2F3IA 3I4MG 2XIWA 2Z9HA 2EJGC 5EJWA 3VR2A 1SBBB 4JYAQ 3PGZA 1U4LA 3CCEA 1UE1A 5I6YA 3URYA 3H15A 1XPUA 5C4JH 1HH2P 3BVMA 4JI7L 4LF6L 2B2YA 3Q8DA 1C8CA 1TY2A 5JJZA 5IY0A 1SYCA 4GKKL 3HS0C 3DEOA 4KKUA 4FXDA 4RGMA 1PZJD 2AMCB 2Z8LA 3K80C 4HIKA 4JI3Q 4DXGA 4CBVA 4A3IH 3KJPA 4EQOA 1R9TB 1JJGA 4G4KA 1WTPA 1EIFA 3GTPB 5FLMG 1IYJB 1KLGD 2K28A 4V190 4MNOA 4H44C 3I4MB 4XYQA 3CQZB 4DV0L 1FGUA 1Q90A 2O2LD 1J5EQ 3NWTA 1EU4A 4AH6A 3KBGA 4UHVA 4DK6C 1G8ZD 4OHJA 4LFCQ 2MQHA 5CBEE 1I6VC 1PH7A 3R2IA 2BCOA 3D3RA 1QILA 2IW3A 1F9RA 1Q8IA 4GS3A 4J8QA 4IUQA 2PNHA 4ZUJA 1M1KC 5C44H 3BZDB 1LTTD 1B70B 2FMCA 4JI0Q 2A19A 1KLUD 3H3VI 2VUMG 4ABNA 3UI2A 3IKJA 3HFZB 3J81L 3I73A 2N88A 1YVCA 4DAPA 1BXTA 2E2IB 2AKWB 2L11A 2CQAA 4CKCA 4NXNQ 4RGNA 1VQEA 1ESRA 1S4ZA 2OF1A 3S15B 1IKLA 1QG7A 1WTHA 1ENCA 2OCEA 1BBWA 2K5QA 3QOJA 2LY7A 3H94A 1HQMC 3C46A 1Y1VH 4IFDH 1B44D 5CV6A
chains in the Genus database with same CATH topology
4K0KL 5ELOA 4L5QA 3UDXA 2E2IH 4LF5L 1JE5A 2WAQG 2QEXA 4JI0L 1O7IA 1V9PA 4GOPA 1KIXA 2F4VL 5IP7H 3J80c 1KAWA 4PMWA 1JB7A 1NTGA 4DV7Q 3G4SA 3M7NA 1T9HA 4LUZA 1FVIA 1E7ZA 4QL5A 1AE2A 1QVGA 4A3GH 3CCRA 1VS0A 4DV3Q 2NVTH 4A75A 1Q1BA 3U4VA 2ZJRA 1I94L 2K75A 1E22A 4B3TQ 4POGA 4OX9L 2OTLA 4B3TL 4GOPB 1E1OA 1X3FA 4C3JH 2VY3A 3T1HQ 1VQNA 3KFUA 4DNIA 2BH8A 1H95A 4OWTB 3F2CA 1VQIA 1EQRA 4GNXB 1X56A 4IOCA 4DR2L 1VQPA 2KCMA 1QVFA 1YJWA 2IX0A 1L2FA 2RHSB 2Q2TA 3H0GH 4QY7A 3FHWA 4A3MH 3KJOA 1JJCB 1GKHA 3VDYA 1OXVA 4P75A 3UDGA 2UU9Q 4DUZL 4HIMA 3HKZE 4IPDA 5IT9c 1OTCA 4NXMQ 4KHPQ 1Z9FA 5JJIA 4J15A 5C44G 2MO1A 1G6PA 1UE5A 4DR6Q 3EBEA 4A3FH 2GVAA 3T1YQ 1UE6A 4QIWE 1MJCA 3HOUH 3DLLA 1PVOA 3I2ZA 1YITA 4GN5A 1Q7YC 1VQBA 2N3SA 5FJ8G 4LF6Q 1YI2A 1IBML 5IWAQ 1GD7A 1LTLA 2JK8A 3PSIA 1IXRA 2JQOA 5GQOA 3HOYH 2LXJA 4A3GG 4AQYL 1TWGH 1CKNA 2KHIA 4Y7NH 1N33L 3CD6A 1N34Q 3GTMH 1D8LA 2R7DA 1YEZA 3RNUA 2XGTA 1HNWL 1N33Q 2VW9A 3HOZG 5ELNA 4BY7H 2UXDQ 1TWFH 1X65A 2KCTA 5M3FG 5C3EG 5FLXc 1V1QA 1X9NA 4YWKA 3HOWG 4JI8L 3S16H 4B3MQ 1PHJA 3NBHB 2VQFL 4DV2Q 3M4OH 4A3DG 3GDEA 3K8AA 1HZCA 1MKHA 1VQLA 2K52A 1MIUA 4BBSH 3CCUA 2OTJA 1I6HH 1Z47A 4RG1A 3S1QH 2C35B 2UXDL 1KL9A 1LM0A 3S14H 1I50H 4HJ5A 4A76A 2UXBL 4KHPL 3K0XA 3KF6A 3PF5A 4NXML 3W1GA 3HKZG 2JA5H 4JI6L 2JA9A 1I3QH 3CW2C 4YHHQ 1A8VA 4A93H 4JI5L 5IP9G 5GROA 1HR0L 4BXXG 1Q82C 4BA2I 4KLKA 2JEBI 4X64Q 4HIDA 3I4MH 3S24A 3T1HL 1L1OB 3PO2H 3KF6B 3SGIA 3OTOQ 2JE6I 2JEAI 3UE1A 3S1MH 4QQBX 3AFPA 4LF7L 3U50C 4B3RL 3TS2A 3CF5A 3MXNB 1G51A 4JI6Q 2UXCQ 2VL6A 1A63A 1K73C 3E9HA 2K5VA 3JC66 3ULLA 3J81c 5AJ3L 2I5MX 1E24A 2GN5A 3K81C 1L1OA 3E0EA 5C0XG 3PV0A 4RMFA 2N78A 1VQ4A 1XMQL 1KQSA 3CMEA 2HT1A 1PH9A 3PUYA 1WJJA 2RF4A 2I5HA 2NN6G 1PA6A 1JJ2A 2WB1G 2UUCQ 2PQAB 1Y1WH 2ZJPA 3U58A 3G6EA 1PV4A 1HJPA 4PZ7A 3TQYA 5GAEC 3GTLH 2Q2IA 3STBC 2KHJA 3CMAA 1PH8A 1NE3A 2NZOA 4YWMA 4KI0A 4C2MH 5IYDH 1VQ6A 4X6AH 4JCVE 4DK3C 4A3FG 3PUXA 2NVYH 1AH9A 4LUVA 2IY5B 2Z6KC 4GKJQ 5C0XJ 1B8AA 1S72A 4R4IA 5C4XH 2JJQA 5EAYA 4LF8L 1YZ6A 2FXQA 1TWCH 2V1CC 3AQQA 1RIPA 1L0WA 3WWVA 1J6QA 2A8VA 2CWAA 3GTQH 1TWHH 5IE8A 3J81i 3HOWH 4DR6L 5C3EH 4A3JG 2OWOA 1W3SA 5M3MH 4IJLA 2HQLA 1XNRL 3BZKA 4GNXC 2CQOA 1K9MC 1IBKQ 1S3OA 1Q8KA 4DR1L 2Q2UA 1D7QA 2ZTEA 5IP9H 4B3RQ 2F52A 4FDBA 4R4QA 3W5OA 3J7A5 2K5HA 1QUQA 2VUMH 1CSQA 3RLOA 2JA5G 1FL0A 5GAHC 3GD7A 1C7YA 1NY4A 1YHAA 1EWIA 1E3PA 3ER0A 2CCZA 2E5LL 1BBUA 1PH2A 3S2DH 3CC7A 3J7ZC 1W2BA 4UY8C 2PI2A 4NPSA 4OX9Q 2UUAL 3KOJA 1K83H 2UUCL 3ULPA 3S17H 2JA6G 1C9OA 3M9BA 4DV0Q 5IYCG 4DR1Q 2K50A 2I5LX 4BA1I 1JT8A 4L5TA 2EXDA 3NENA 1PH5A 2HIVA 1XNRQ 3H0GG 3RN2A 1ASYA 3CQZH 1X3EA 2AWOA 1YJNA 2ID0A 4QJFA 3TRZA 1Q46A 2EIFA 4LWCA 1K8AC 3FKIH 2Z6KA 1VCIA 1U0LA 3OW2A 5JJLA 4LFBQ 3M3YH 4JOIA 3PUZA 4A3CG 4BY1G 4GKKQ 3GTKH 4P74A 4IJHA 1CUKA 3M85A 1VQ8A 1TXYA 4DPGA 2R93G 1OXUA 4X66Q 1XPOA 1VQMA 3HOUG 4DR4Q 5LMNL 4GLVB 2UUBQ 1SE8A 4H02A 1EQQA 4LF4L 3CAMA 5IP7G 1YBYA 2YTVA 1K0RA 1VQJA 2IHEA 4JBJA 4JI1Q 3K7AH 1I5FA 4JC0A 3L2PA 4JV5Q 4A4IA 1IBMQ 2WFWA 4IO9A 5M5WH 1SLJA 4POFA 1HNZQ 1UE7A 1HNZL 1Y14B 1X54A 5JEAG 1XMQQ 4PZ6A 2PQAA 1P8LA 1UWVA 2QGQA 1IBLL 4P73A 4DUZQ 1MJEA 4JI8Q 3I55A 1S40A 2LXKA 1V43A 2VZAA 5E7NA 4JI1L 2B63G 1B7YB 2A1AA 2B3GA 3CCVA 2Z0SA 3AYHB 3J80i 3PIOA 1A0IA 4LF4Q 2AHOB 3OTOL 1SN8A 4YCWA 2ZJQA 2CFMA 1N34L 4DR4L 1KC8C 4JG2A 5M3MG 2ZM6L 4P72A 3UDFA 5IWAL 4OWWB 2IX1A 1WFQA 3CCMA 2R6GA 2K4KA 4DAYB 2ES2A 4A3IG 1CKOA 1X55A 4GOPC 1HNXL 1XNQQ 5C4XG 2KENA 2CWPA 1HR0W 3GO5A 1XJVA 2N49A 3G71A 2NVQH 2R7ZH 1HZBA 1OXTA 4A3LG 1SR3A 5LMNW 2UU9L 3JAMi 4LF5Q 3RLFA 1XNQL 4GLAC 4JI3L 5M3FH 5BR8Q 4BY7G 4DR5L 2YTYA 3GTPH 1IZ6A 2JA8G 4DV5Q 3PIPA 4YWLA 4IFDI 3U4ZA 1ASZA 4R4TA 1K8GA 4L5SA 4X64L 2NVXH 1WI5A 1QVCA 1NMGA 3CXCA 2ZTCA 4A3BH 4B3SQ 3D31A 1SFOH 1AE3A 2QA4A 4OO1G 3HOXG 3EN2A 1XMOQ 2NN6I 4AQYQ 4UP8A 1QZGA 1HZ9A 4YY3Q 2HHHQ 4A3BG 4A3LH 2E8GA 2E2HH 4JBWA 3KYHC 3KLWA 3PO2G 4O2DA 2MO0A 1IBLQ 2VQEQ 4HJ9A 4ME3A 5IYBG 1WCMG 2D0OA 3A74A 1TWAH 3I4OA 3ULJA 3T1YL 4R1JA 4DUYQ 1VQ5A 1WYDA 2JA8H 3ICEA 2BH2A 3S1NH 1N32L 4WJ4A 3G48A 1EFWA 4EX5A 4LF8Q 2D62A 4DV2L 5M5XH 1L1OC 2VQFQ 3RN5A 4O0AA 1VQ7A 4X65L 1N36L 2EQSA 3CCJA 2L15A 3ERSX 1SROA 2GVBA 4IFDJ 4X62Q 2HIXA 1PH3A 4AIMA 4L5RC 1HNWQ 1HZAA 3FP9A 4YY3L 2DGYA 2HHHL 3S2HH 4R4OA 3BZCA 3GTGH 5LMNQ 4EQ5A 1XMOL 3PO3H 2ASBA 1SMXA 1YHQA 4P71A 1CSPA 4MZ9A 2IT1A 4BBRG 1DGSA 2R92G 4AYBG 1OXXK 4OXPA 2BA0A 4GN3B 4UP9A 2CKZB 3HOXH 1VQHA 2R7FA 3DM3A 1J5EL 4JI2L 3S15H 4LFBL 4DV5L 4HIOA 2JA7H 4QGUA 4DV1L 4YCVA 1YJ9A 3RZDH 3BJUA 2Q2HA 1VQAA 5BR8L 3GTOH 3HKSA 5AJ3Q 1M90C 2JA6H 2F4VQ 2IHFA 4LUOA 1WOCA 4C3IH 5HGQA 2B63H 4IOAA 4A93G 1Y1WG 3TREA 5C0XI 3CCQA 4ALPA 3A0JA 4GN4B 1PH1A 2R92H 1CKNB 3BU2A 3F1ZA 3RLNA 3F8TA 1YNXA 2BA1A 1R9TH 3CCSA 2OQKA 1EUJA 2WAQE 4DR2Q 1BKBA 4YCUA 3HOVG 2N8NA 3D0FA 1PH6A 1VQOA 4WJ3M 2R93H 4JI7Q 4LF9Q 3AEVA 1GO3E 3TS0A 2YTXA 4LFCL 1Q86C 2Y0SE 1NMFA 4JI4L 4BY1H 2ZM6Q 1I94Q 2PI2E 2K14A 1VQKA 4DV3L 1XPRA 2I0QA 4XTCS 3L7ZC 3I56A 4JI5Q 3I4NG 3KF8B 2PMZE 4YHHL 1A62A 1OXSC 4MTNA 3E9IA 1IBKL 2YYZA 4AYBE 1VQ9A 4X62L 1GVPA 2WP8J 3CCLA 2UXBQ 3L0OA 1PYBA 2RHQB 4NB3A 5IYBH 4BXXH 2NZHA 1EOVA 2VS1A 1N36Q 3NEMA 4X65Q 4HJ8A 1NBWA 4LFAQ 4Y52H 3PF4A 4DR7L 5FJ8H 2YV5A 4GKJL 1XTDA 4LW1A 1LUZA 3UDIA 3W1BA 5FLMH 1N32Q 4UPAA 5JEAJ 1K3RA 2WB1E 1Q81C 1JMCA 4OWXB 3F2BA 2F3IA 3I4MG 3OYYA 4JBMA 1KRTA 1FJGQ 2RCNA 1PH4A 2MFIA 3LGJA 2ATWA 1QZHA 1X3GA 5H1SE 4JYAQ 3PGZA 3CCEA 5K36G 4B3SL 1UE1A 4R4CA 3H15A 2YU9H 4TQUS 2UUBL 1YIJA 1XPUA 1FJGL 5C4JH 4GLXA 4IFDG 1HH2P 2Y0SG 3HOZH 4JI7L 4LF9L 4X66L 4LF6L 1KD1C 3Q8DA 4HJAA 3B6YA 4HJ7A 1N9WA 3KDFA 2JA7G 1Y1VG 5IY0A 1RL2A 4GKKL 3PCOB 4GNXA 3CC4A 4DR3Q 3AFQA 3NELA 2AMCB 4IPHA 3K80C 4DV6L 4HIKA 3S1RH 4JI3Q 4LFAL 4C3HH 4A3IH 1KHIA 3KJPA 5M5YH 1JJGA 1SRUA 1EIYB 1EIFA 3MEFA 3F2DA 2UXCL 5FLMG 1VQDA 3JAMc 1IYJB 4DV6Q 4DR3L 4DAMA 4DV1Q 4MNOA 3RZOH 2OQ0A 4LF7Q 4A3JH 3CPFA 1PFSA 1HNXQ 1P16A 1QUQB 4DV0L 3TEHB 5GAGC 1FGUA 4DV4Q 2DUDA 2H5XA 1J5EQ 3CC2A 2D0PA 4IPGA 4AH6A 4UP7A 4DK6C 2UUAQ 1LYLA 4JI4Q 4LFCQ 2MQHA 4A3MG 1EYGA 3A5UA 1KRSA 4OONA 1PH7A 4A3EH 1HR0Q 5J3BA 4LNQA 4OO1I 3K7UC 4DV4L 2E5LQ 2XTIA 1NJIC 1WCMH 4GS3A 2B29A 1N8RC 1IL2A 4DV7L 2AWNA 4IPCA 1E1TA 2PNHA 5GADC 1VQGA 2ZTDA 1M1KC 2E2JH 3UE0A 4XIGS 1YHBA 5C44H 3HOVH 4A3DH 1B70B 1C0AA 3EIVA 1U5KA 2A19A 4JI0Q 4JBKA 2VUMG 1X6OA 3H3VI 2K5NA 1BVSA 3KDFB 4APVA 2ALYB 3HFZB 4DR7Q 4K0KQ 2LSSA 1PYSB 4A3EG 4DUYL 3PUWA 3ZJYC 4B3ML 3H3VH 3A5ZB 1KXLA 2KBNA 3STBD 1YVCA 3CP0A 3RR5A 3I4NH 4JI2Q 1G291 2VQEL 4PG3A 3M4QA 4TVAB 3J81j 4PZ8A 5LMUL 5IYCH 1UEBA 2AKWB 3HOYG 4A3KH 4JV5L 2VNUD 5JJKA 2R7ZG 4NXNL 1VQFA 4JYAL 4NXNQ 4A3CH 2MNAA 1VQEA 4DKAC 4BBRH 5HY6A 3M4PA 5LMUQ 3FKIG 3CPWA 1Q12A 3IRBA 2OCEA 1BBWA 3I7FA 3PO3G 1Q1EA 4JOIC 1CKMA 3PUVA 4KHZA 5IYDG 1GM5A 1Y1VH 4BBSG 3GTJH 4DR5Q 1VQCA 5DLQE 4A3KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K L;  5ELO A;  4L5Q A;  3UDX A;  2E2I H;  4LF5 L;  1JE5 A;  2WAQ G;  2QEX A;  4JI0 L;  1O7I A;  1V9P A;  4GOP A;  1KIX A;  2F4V L;  5IP7 H;  3J80 c;  1KAW A;  4PMW A;  1JB7 A;  1NTG A;  4DV7 Q;  3G4S A;  3M7N A;  1T9H A;  4LUZ A;  1FVI A;  1E7Z A;  4QL5 A;  1AE2 A;  1QVG A;  4A3G H;  3CCR A;  1VS0 A;  4DV3 Q;  2NVT H;  4A75 A;  1Q1B A;  3U4V A;  2ZJR A;  1I94 L;  2K75 A;  1E22 A;  4B3T Q;  4POG A;  4OX9 L;  2OTL A;  4B3T L;  4GOP B;  1E1O A;  1X3F A;  4C3J H;  2VY3 A;  3T1H Q;  1VQN A;  3KFU A;  4DNI A;  2BH8 A;  1H95 A;  4OWT B;  3F2C A;  1VQI A;  1EQR A;  4GNX B;  1X56 A;  4IOC A;  4DR2 L;  1VQP A;  2KCM A;  1QVF A;  1YJW A;  2IX0 A;  1L2F A;  2RHS B;  2Q2T A;  3H0G H;  4QY7 A;  3FHW A;  4A3M H;  3KJO A;  1JJC B;  1GKH A;  3VDY A;  1OXV A;  4P75 A;  3UDG A;  2UU9 Q;  4DUZ L;  4HIM A;  3HKZ E;  4IPD A;  5IT9 c;  1OTC A;  4NXM Q;  4KHP Q;  1Z9F A;  5JJI A;  4J15 A;  5C44 G;  2MO1 A;  1G6P A;  1UE5 A;  4DR6 Q;  3EBE A;  4A3F H;  2GVA A;  3T1Y Q;  1UE6 A;  4QIW E;  1MJC A;  3HOU H;  3DLL A;  1PVO A;  3I2Z A;  1YIT A;  4GN5 A;  1Q7Y C;  1VQB A;  2N3S A;  5FJ8 G;  4LF6 Q;  1YI2 A;  1IBM L;  5IWA Q;  1GD7 A;  1LTL A;  2JK8 A;  3PSI A;  1IXR A;  2JQO A;  5GQO A;  3HOY H;  2LXJ A;  4A3G G;  4AQY L;  1TWG H;  1CKN A;  2KHI A;  4Y7N H;  1N33 L;  3CD6 A;  1N34 Q;  3GTM H;  1D8L A;  2R7D A;  1YEZ A;  3RNU A;  2XGT A;  1HNW L;  1N33 Q;  2VW9 A;  3HOZ G;  5ELN A;  4BY7 H;  2UXD Q;  1TWF H;  1X65 A;  2KCT A;  5M3F G;  5C3E G;  5FLX c;  1V1Q A;  1X9N A;  4YWK A;  3HOW G;  4JI8 L;  3S16 H;  4B3M Q;  1PHJ A;  3NBH B;  2VQF L;  4DV2 Q;  3M4O H;  4A3D G;  3GDE A;  3K8A A;  1HZC A;  1MKH A;  1VQL A;  2K52 A;  1MIU A;  4BBS H;  3CCU A;  2OTJ A;  1I6H H;  1Z47 A;  4RG1 A;  3S1Q H;  2C35 B;  2UXD L;  1KL9 A;  1LM0 A;  3S14 H;  1I50 H;  4HJ5 A;  4A76 A;  2UXB L;  4KHP L;  3K0X A;  3KF6 A;  3PF5 A;  4NXM L;  3W1G A;  3HKZ G;  2JA5 H;  4JI6 L;  2JA9 A;  1I3Q H;  3CW2 C;  4YHH Q;  1A8V A;  4A93 H;  4JI5 L;  5IP9 G;  5GRO A;  1HR0 L;  4BXX G;  1Q82 C;  4BA2 I;  4KLK A;  2JEB I;  4X64 Q;  4HID A;  3I4M H;  3S24 A;  3T1H L;  1L1O B;  3PO2 H;  3KF6 B;  3SGI A;  3OTO Q;  2JE6 I;  2JEA I;  3UE1 A;  3S1M H;  4QQB X;  3AFP A;  4LF7 L;  3U50 C;  4B3R L;  3TS2 A;  3CF5 A;  3MXN B;  1G51 A;  4JI6 Q;  2UXC Q;  2VL6 A;  1A63 A;  1K73 C;  3E9H A;  2K5V A;  3JC6 6;  3ULL A;  3J81 c;  5AJ3 L;  2I5M X;  1E24 A;  2GN5 A;  3K81 C;  1L1O A;  3E0E A;  5C0X G;  3PV0 A;  4RMF A;  2N78 A;  1VQ4 A;  1XMQ L;  1KQS A;  3CME A;  2HT1 A;  1PH9 A;  3PUY A;  1WJJ A;  2RF4 A;  2I5H A;  2NN6 G;  1PA6 A;  1JJ2 A;  2WB1 G;  2UUC Q;  2PQA B;  1Y1W H;  2ZJP A;  3U58 A;  3G6E A;  1PV4 A;  1HJP A;  4PZ7 A;  3TQY A;  5GAE C;  3GTL H;  2Q2I A;  3STB C;  2KHJ A;  3CMA A;  1PH8 A;  1NE3 A;  2NZO A;  4YWM A;  4KI0 A;  4C2M H;  5IYD H;  1VQ6 A;  4X6A H;  4JCV E;  4DK3 C;  4A3F G;  3PUX A;  2NVY H;  1AH9 A;  4LUV A;  2IY5 B;  2Z6K C;  4GKJ Q;  5C0X J;  1B8A A;  1S72 A;  4R4I A;  5C4X H;  2JJQ A;  5EAY A;  4LF8 L;  1YZ6 A;  2FXQ A;  1TWC H;  2V1C C;  3AQQ A;  1RIP A;  1L0W A;  3WWV A;  1J6Q A;  2A8V A;  2CWA A;  3GTQ H;  1TWH H;  5IE8 A;  3J81 i;  3HOW H;  4DR6 L;  5C3E H;  4A3J G;  2OWO A;  1W3S A;  5M3M H;  4IJL A;  2HQL A;  1XNR L;  3BZK A;  4GNX C;  2CQO A;  1K9M C;  1IBK Q;  1S3O A;  1Q8K A;  4DR1 L;  2Q2U A;  1D7Q A;  2ZTE A;  5IP9 H;  4B3R Q;  2F52 A;  4FDB A;  4R4Q A;  3W5O A;  3J7A 5;  2K5H A;  1QUQ A;  2VUM H;  1CSQ A;  3RLO A;  2JA5 G;  1FL0 A;  5GAH C;  3GD7 A;  1C7Y A;  1NY4 A;  1YHA A;  1EWI A;  1E3P A;  3ER0 A;  2CCZ A;  2E5L L;  1BBU A;  1PH2 A;  3S2D H;  3CC7 A;  3J7Z C;  1W2B A;  4UY8 C;  2PI2 A;  4NPS A;  4OX9 Q;  2UUA L;  3KOJ A;  1K83 H;  2UUC L;  3ULP A;  3S17 H;  2JA6 G;  1C9O A;  3M9B A;  4DV0 Q;  5IYC G;  4DR1 Q;  2K50 A;  2I5L X;  4BA1 I;  1JT8 A;  4L5T A;  2EXD A;  3NEN A;  1PH5 A;  2HIV A;  1XNR Q;  3H0G G;  3RN2 A;  1ASY A;  3CQZ H;  1X3E A;  2AWO A;  1YJN A;  2ID0 A;  4QJF A;  3TRZ A;  1Q46 A;  2EIF A;  4LWC A;  1K8A C;  3FKI H;  2Z6K A;  1VCI A;  1U0L A;  3OW2 A;  5JJL A;  4LFB Q;  3M3Y H;  4JOI A;  3PUZ A;  4A3C G;  4BY1 G;  4GKK Q;  3GTK H;  4P74 A;  4IJH A;  1CUK A;  3M85 A;  1VQ8 A;  1TXY A;  4DPG A;  2R93 G;  1OXU A;  4X66 Q;  1XPO A;  1VQM A;  3HOU G;  4DR4 Q;  5LMN L;  4GLV B;  2UUB Q;  1SE8 A;  4H02 A;  1EQQ A;  4LF4 L;  3CAM A;  5IP7 G;  1YBY A;  2YTV A;  1K0R A;  1VQJ A;  2IHE A;  4JBJ A;  4JI1 Q;  3K7A H;  1I5F A;  4JC0 A;  3L2P A;  4JV5 Q;  4A4I A;  1IBM Q;  2WFW A;  4IO9 A;  5M5W H;  1SLJ A;  4POF A;  1HNZ Q;  1UE7 A;  1HNZ L;  1Y14 B;  1X54 A;  5JEA G;  1XMQ Q;  4PZ6 A;  2PQA A;  1P8L A;  1UWV A;  2QGQ A;  1IBL L;  4P73 A;  4DUZ Q;  1MJE A;  4JI8 Q;  3I55 A;  1S40 A;  2LXK A;  1V43 A;  2VZA A;  5E7N A;  4JI1 L;  2B63 G;  1B7Y B;  2A1A A;  2B3G A;  3CCV A;  2Z0S A;  3AYH B;  3J80 i;  3PIO A;  1A0I A;  4LF4 Q;  2AHO B;  3OTO L;  1SN8 A;  4YCW A;  2ZJQ A;  2CFM A;  1N34 L;  4DR4 L;  1KC8 C;  4JG2 A;  5M3M G;  2ZM6 L;  4P72 A;  3UDF A;  5IWA L;  4OWW B;  2IX1 A;  1WFQ A;  3CCM A;  2R6G A;  2K4K A;  4DAY B;  2ES2 A;  4A3I G;  1CKO A;  1X55 A;  4GOP C;  1HNX L;  1XNQ Q;  5C4X G;  2KEN A;  2CWP A;  1HR0 W;  3GO5 A;  1XJV A;  2N49 A;  3G71 A;  2NVQ H;  2R7Z H;  1HZB A;  1OXT A;  4A3L G;  1SR3 A;  5LMN W;  2UU9 L;  3JAM i;  4LF5 Q;  3RLF A;  1XNQ L;  4GLA C;  4JI3 L;  5M3F H;  5BR8 Q;  4BY7 G;  4DR5 L;  2YTY A;  3GTP H;  1IZ6 A;  2JA8 G;  4DV5 Q;  3PIP A;  4YWL A;  4IFD I;  3U4Z A;  1ASZ A;  4R4T A;  1K8G A;  4L5S A;  4X64 L;  2NVX H;  1WI5 A;  1QVC A;  1NMG A;  3CXC A;  2ZTC A;  4A3B H;  4B3S Q;  3D31 A;  1SFO H;  1AE3 A;  2QA4 A;  4OO1 G;  3HOX G;  3EN2 A;  1XMO Q;  2NN6 I;  4AQY Q;  4UP8 A;  1QZG A;  1HZ9 A;  4YY3 Q;  2HHH Q;  4A3B G;  4A3L H;  2E8G A;  2E2H H;  4JBW A;  3KYH C;  3KLW A;  3PO2 G;  4O2D A;  2MO0 A;  1IBL Q;  2VQE Q;  4HJ9 A;  4ME3 A;  5IYB G;  1WCM G;  2D0O A;  3A74 A;  1TWA H;  3I4O A;  3ULJ A;  3T1Y L;  4R1J A;  4DUY Q;  1VQ5 A;  1WYD A;  2JA8 H;  3ICE A;  2BH2 A;  3S1N H;  1N32 L;  4WJ4 A;  3G48 A;  1EFW A;  4EX5 A;  4LF8 Q;  2D62 A;  4DV2 L;  5M5X H;  1L1O C;  2VQF Q;  3RN5 A;  4O0A A;  1VQ7 A;  4X65 L;  1N36 L;  2EQS A;  3CCJ A;  2L15 A;  3ERS X;  1SRO A;  2GVB A;  4IFD J;  4X62 Q;  2HIX A;  1PH3 A;  4AIM A;  4L5R C;  1HNW Q;  1HZA A;  3FP9 A;  4YY3 L;  2DGY A;  2HHH L;  3S2H H;  4R4O A;  3BZC A;  3GTG H;  5LMN Q;  4EQ5 A;  1XMO L;  3PO3 H;  2ASB A;  1SMX A;  1YHQ A;  4P71 A;  1CSP A;  4MZ9 A;  2IT1 A;  4BBR G;  1DGS A;  2R92 G;  4AYB G;  1OXX K;  4OXP A;  2BA0 A;  4GN3 B;  4UP9 A;  2CKZ B;  3HOX H;  1VQH A;  2R7F A;  3DM3 A;  1J5E L;  4JI2 L;  3S15 H;  4LFB L;  4DV5 L;  4HIO A;  2JA7 H;  4QGU A;  4DV1 L;  4YCV A;  1YJ9 A;  3RZD H;  3BJU A;  2Q2H A;  1VQA A;  5BR8 L;  3GTO H;  3HKS A;  5AJ3 Q;  1M90 C;  2JA6 H;  2F4V Q;  2IHF A;  4LUO A;  1WOC A;  4C3I H;  5HGQ A;  2B63 H;  4IOA A;  4A93 G;  1Y1W G;  3TRE A;  5C0X I;  3CCQ A;  4ALP A;  3A0J A;  4GN4 B;  1PH1 A;  2R92 H;  1CKN B;  3BU2 A;  3F1Z A;  3RLN A;  3F8T A;  1YNX A;  2BA1 A;  1R9T H;  3CCS A;  2OQK A;  1EUJ A;  2WAQ E;  4DR2 Q;  1BKB A;  4YCU A;  3HOV G;  2N8N A;  3D0F A;  1PH6 A;  1VQO A;  4WJ3 M;  2R93 H;  4JI7 Q;  4LF9 Q;  3AEV A;  1GO3 E;  3TS0 A;  2YTX A;  4LFC L;  1Q86 C;  2Y0S E;  1NMF A;  4JI4 L;  4BY1 H;  2ZM6 Q;  1I94 Q;  2PI2 E;  2K14 A;  1VQK A;  4DV3 L;  1XPR A;  2I0Q A;  4XTC S;  3L7Z C;  3I56 A;  4JI5 Q;  3I4N G;  3KF8 B;  2PMZ E;  4YHH L;  1A62 A;  1OXS C;  4MTN A;  3E9I A;  1IBK L;  2YYZ A;  4AYB E;  1VQ9 A;  4X62 L;  1GVP A;  2WP8 J;  3CCL A;  2UXB Q;  3L0O A;  1PYB A;  2RHQ B;  4NB3 A;  5IYB H;  4BXX H;  2NZH A;  1EOV A;  2VS1 A;  1N36 Q;  3NEM A;  4X65 Q;  4HJ8 A;  1NBW A;  4LFA Q;  4Y52 H;  3PF4 A;  4DR7 L;  5FJ8 H;  2YV5 A;  4GKJ L;  1XTD A;  4LW1 A;  1LUZ A;  3UDI A;  3W1B A;  5FLM H;  1N32 Q;  4UPA A;  5JEA J;  1K3R A;  2WB1 E;  1Q81 C;  1JMC A;  4OWX B;  3F2B A;  2F3I A;  3I4M G;  3OYY A;  4JBM A;  1KRT A;  1FJG Q;  2RCN A;  1PH4 A;  2MFI A;  3LGJ A;  2ATW A;  1QZH A;  1X3G A;  5H1S E;  4JYA Q;  3PGZ A;  3CCE A;  5K36 G;  4B3S L;  1UE1 A;  4R4C A;  3H15 A;  2YU9 H;  4TQU S;  2UUB L;  1YIJ A;  1XPU A;  1FJG L;  5C4J H;  4GLX A;  4IFD G;  1HH2 P;  2Y0S G;  3HOZ H;  4JI7 L;  4LF9 L;  4X66 L;  4LF6 L;  1KD1 C;  3Q8D A;  4HJA A;  3B6Y A;  4HJ7 A;  1N9W A;  3KDF A;  2JA7 G;  1Y1V G;  5IY0 A;  1RL2 A;  4GKK L;  3PCO B;  4GNX A;  3CC4 A;  4DR3 Q;  3AFQ A;  3NEL A;  2AMC B;  4IPH A;  3K80 C;  4DV6 L;  4HIK A;  3S1R H;  4JI3 Q;  4LFA L;  4C3H H;  4A3I H;  1KHI A;  3KJP A;  5M5Y H;  1JJG A;  1SRU A;  1EIY B;  1EIF A;  3MEF A;  3F2D A;  2UXC L;  5FLM G;  1VQD A;  3JAM c;  1IYJ B;  4DV6 Q;  4DR3 L;  4DAM A;  4DV1 Q;  4MNO A;  3RZO H;  2OQ0 A;  4LF7 Q;  4A3J H;  3CPF A;  1PFS A;  1HNX Q;  1P16 A;  1QUQ B;  4DV0 L;  3TEH B;  5GAG C;  1FGU A;  4DV4 Q;  2DUD A;  2H5X A;  1J5E Q;  3CC2 A;  2D0P A;  4IPG A;  4AH6 A;  4UP7 A;  4DK6 C;  2UUA Q;  1LYL A;  4JI4 Q;  4LFC Q;  2MQH A;  4A3M G;  1EYG A;  3A5U A;  1KRS A;  4OON A;  1PH7 A;  4A3E H;  1HR0 Q;  5J3B A;  4LNQ A;  4OO1 I;  3K7U C;  4DV4 L;  2E5L Q;  2XTI A;  1NJI C;  1WCM H;  4GS3 A;  2B29 A;  1N8R C;  1IL2 A;  4DV7 L;  2AWN A;  4IPC A;  1E1T A;  2PNH A;  5GAD C;  1VQG A;  2ZTD A;  1M1K C;  2E2J H;  3UE0 A;  4XIG S;  1YHB A;  5C44 H;  3HOV H;  4A3D H;  1B70 B;  1C0A A;  3EIV A;  1U5K A;  2A19 A;  4JI0 Q;  4JBK A;  2VUM G;  1X6O A;  3H3V I;  2K5N A;  1BVS A;  3KDF B;  4APV A;  2ALY B;  3HFZ B;  4DR7 Q;  4K0K Q;  2LSS A;  1PYS B;  4A3E G;  4DUY L;  3PUW A;  3ZJY C;  4B3M L;  3H3V H;  3A5Z B;  1KXL A;  2KBN A;  3STB D;  1YVC A;  3CP0 A;  3RR5 A;  3I4N H;  4JI2 Q;  1G29 1;  2VQE L;  4PG3 A;  3M4Q A;  4TVA B;  3J81 j;  4PZ8 A;  5LMU L;  5IYC H;  1UEB A;  2AKW B;  3HOY G;  4A3K H;  4JV5 L;  2VNU D;  5JJK A;  2R7Z G;  4NXN L;  1VQF A;  4JYA L;  4NXN Q;  4A3C H;  2MNA A;  1VQE A;  4DKA C;  4BBR H;  5HY6 A;  3M4P A;  5LMU Q;  3FKI G;  3CPW A;  1Q12 A;  3IRB A;  2OCE A;  1BBW A;  3I7F A;  3PO3 G;  1Q1E A;  4JOI C;  1CKM A;  3PUV A;  4KHZ A;  5IYD G;  1GM5 A;  1Y1V H;  4BBS G;  3GTJ H;  4DR5 Q;  1VQC A;  5DLQ E;  4A3K G; 
#chains in the Genus database with same CATH topology
 4FF1 A;  4L5Q A;  3NBI A;  2WAQ G;  4GOP A;  1KIX A;  2F4V L;  4LJZ C;  1PTO H;  1SEB D;  1F2L A;  4LUZ A;  4QIW B;  2VB2 X;  1AE2 A;  2RSO A;  2NVT H;  5NUC A;  1SND A;  3T1H Q;  1E1O A;  1X3F A;  3MWY W;  2VY3 A;  4FO2 A;  3KFU A;  2BH8 A;  4FF3 A;  4OWT B;  1VQI A;  2F0H A;  4KN4 C;  1HA5 A;  3K5L A;  2K33 A;  2RHS B;  3X3N A;  1CA6 A;  1GKH A;  2M2L A;  2SEB D;  3VDY A;  1OXV A;  2UU9 Q;  2JA7 B;  2F0E A;  1G6P A;  1UE5 A;  4DR6 Q;  1LTG D;  1MJC A;  2F03 A;  1YIT A;  1Q3L A;  1VQB A;  5IGE A;  4LF6 Q;  4HCS A;  1IBM L;  5IWA Q;  1SNC A;  1LTL A;  3RZD B;  3HOY H;  4A3G G;  2LXJ A;  4CHT B;  1TWG H;  2KHI A;  5JVH 3;  1LAC A;  3CD6 A;  4OEL B;  3D8G A;  2MUY A;  4CDE C;  3D4W A;  1HNW L;  1BO0 A;  1X65 A;  4A3F B;  5M3F G;  1CZG A;  4RGT A;  1X9N A;  3MFY A;  1PHJ A;  3NBH B;  2R93 B;  2LMC B;  2R7Z B;  1VQL A;  1MKH A;  1YNN D;  1C4Q A;  3WOF A;  4BBS H;  5BN5 A;  1I6H H;  1Z47 A;  2F0V A;  4JK1 C;  2C35 B;  5EQ0 A;  1PLF A;  3A55 A;  2F0N A;  3K0X A;  3PF5 A;  4NXM L;  1GUG A;  3NP8 A;  4N9P A;  1K28 A;  1LT4 D;  5J39 A;  4JI6 L;  4YHH Q;  1I4R A;  2O5J C;  1K0S A;  1DON A;  4K5V A;  4X3S A;  5D3I B;  3EJI A;  4KMU C;  3NPP A;  4KLK A;  4A3J B;  4F8M A;  1DOL A;  1WCM B;  3GQB A;  5BN3 A;  2NZ1 D;  1JOK A;  2YU9 B;  4LF7 L;  3TS2 A;  3NQT A;  2F0O A;  2RCF A;  2WIN B;  4J6H A;  3E9H A;  2K5V A;  3JC6 6;  3ONA B;  4RHS A;  1I4P A;  5ELB A;  1E24 A;  1ET9 A;  4HMJ A;  2N78 A;  1VF5 C;  5C3W A;  2F0I A;  2RF4 A;  2EY5 A;  2I5H A;  3R93 A;  2UUC Q;  2ENB A;  4ULL A;  1TWH B;  4OL7 A;  4WRD A;  3K59 A;  1HJP A;  2A68 C;  4IUU A;  4PZ7 A;  5GAE C;  3K58 A;  3STB C;  2KHJ A;  1NE3 A;  2NZO A;  4C2M H;  3H3V C;  4JCV E;  3H6M A;  4A3F G;  5DAU A;  3PUX A;  4A3E B;  4PMC A;  1AH9 A;  4LUV A;  4GKJ Q;  1II3 A;  2JJQ A;  5C3X A;  2FXQ A;  2V1C C;  3I91 A;  1RIP A;  4DAY A;  2A8V A;  2EJF C;  2CWA A;  5IE8 A;  3E5S A;  2F0G A;  4KY6 A;  3Q0A A;  2JA5 B;  2L5T A;  4RAU C;  1TS4 A;  5KIX A;  4IJL A;  1XNR L;  3S17 B;  4PQX A;  2RKS A;  3HEJ A;  1D7Q A;  2ZTE A;  1QCB D;  3NE5 B;  3GD7 A;  1YHA A;  1EWI A;  3J81 E;  1BBU A;  1SJE D;  1PH2 A;  1SYB A;  3S2D H;  4HSV A;  3J7Z C;  1W2B A;  4UY8 C;  1DOM A;  1A3V A;  3DWQ A;  3QO2 A;  5I4D A;  3CHB D;  2WII B;  4BA1 I;  4ME5 A;  1XNR Q;  1H9R A;  2AWO A;  3EA6 A;  2RVL A;  2Z6K A;  5C5M A;  5EBC A;  4WOR A;  1T5E A;  3V96 A;  3TZD A;  1TXY A;  4PNY A;  4DPG A;  1ENA A;  2R93 G;  1VQM A;  3HOU G;  2UUB Q;  1SMY C;  2SNS A;  4OIJ A;  1YBY A;  2YTV A;  1AZP A;  1I5F A;  3QIA A;  1WTW A;  1PXU A;  1PZI D;  3P75 A;  4A4I A;  4H0L C;  4IO9 A;  1U4M A;  2KUM A;  1ILQ A;  4QUC A;  1HNZ Q;  5JEA G;  4B08 A;  2V4D A;  4DNT B;  2PQA A;  2I07 B;  3OIP A;  1IBL L;  1UWV A;  4P73 A;  2DNC A;  2XWJ B;  3G7L A;  4XYO A;  2LXK A;  1V43 A;  5E7N A;  1MI2 A;  2B63 G;  2KCN A;  2A1A A;  3CCV A;  3MXU A;  3PIO A;  1A0I A;  5LL6 S;  2ZJQ A;  1SN8 A;  4NDX A;  4YCW A;  5I6W A;  4NW2 A;  1KC8 C;  5ELE A;  5M3M G;  2B39 A;  2KA7 A;  2RQX A;  4OWW B;  1WFQ A;  2K4K A;  4LK1 C;  2NYZ D;  4TKO B;  4GOP C;  3TBI B;  1XNQ Q;  2WV6 D;  2KEN A;  3MEH A;  3KF8 A;  5IOC A;  1TWC B;  1TWG B;  1HR0 W;  3RLF A;  1DCZ A;  4IUV A;  5G3L F;  4DR5 L;  2YTY A;  1IZ6 A;  2XNA C;  3T13 A;  1LT3 D;  2K5D A;  1PRT B;  4R4T A;  2K6A A;  4L5S A;  4X64 L;  1WI5 A;  1NMG A;  2ZTC A;  2E2J B;  1W6K A;  3HOX G;  3EN2 A;  4UP8 A;  4YY3 Q;  4A3L H;  4A3B G;  2E2H H;  4JBW A;  2G9H D;  1EYD A;  3PO2 G;  2EY2 A;  2K01 A;  1WTQ A;  3T1Y L;  3I4O A;  4R1J A;  1WYD A;  1ZYR D;  1EFW A;  3HOX B;  3V2T A;  1VQ7 A;  1AN8 A;  1N36 L;  2MJ8 A;  2EQS A;  3CCJ A;  4FF2 A;  3MA2 B;  5CGK A;  4X62 Q;  1DXM A;  2HIX A;  5FLX L;  2ZT9 C;  1EY4 A;  3S2H H;  3FRP B;  4R4O A;  5AFW A;  1SE3 A;  2A73 B;  3SE0 A;  2KCC A;  2KOL A;  2IT1 A;  3P1H A;  4BBR G;  4CKE A;  4AYB G;  1OXX K;  4OXP A;  2A69 D;  4GN3 B;  1A3U A;  2R3Z A;  1GUO A;  3S15 H;  1BCP D;  1B53 A;  3M7G A;  4YCV A;  3RZD H;  4KY7 A;  1AW7 A;  2B2T C;  1E2W A;  3HKS A;  1JWU D;  3FDT A;  4N9T A;  3W3A A;  2IHF A;  2F4V Q;  4IOA A;  5JPM C;  1Y1W G;  4ALP A;  3CCQ A;  5IT9 L;  1CKN B;  2HDL A;  2E75 C;  1DD2 A;  5M5Y B;  3N6R A;  2WAQ E;  1ONL A;  2PW7 A;  2R93 H;  1STA A;  3OIQ A;  1D1I A;  5HUR A;  3TS0 A;  5DM6 3;  1Q86 C;  1EY9 A;  5IGG A;  2Z4I A;  1VQK A;  2NBF A;  4XTC S;  3L7Z C;  1A62 A;  1D6E C;  2R92 B;  4MTN A;  1IBK L;  3CCL A;  1B1Z A;  2EYL A;  5L37 A;  1EOV A;  3PF4 A;  2G9D A;  1TS2 A;  1XTD A;  3W1B A;  1LUZ A;  1NCV A;  5ELC A;  4A3G B;  3OYY A;  4JBM A;  1KRT A;  1A6X A;  1FNW A;  3LGJ A;  2ATW A;  3IFT A;  1QZH A;  1X3G A;  3ITP A;  4ZKC B;  2HDM A;  3MZ5 A;  3RZO B;  1DOK A;  1HCZ A;  2EZV A;  4LF9 L;  1HUN A;  1MBY A;  3Q23 A;  2L12 A;  4HJA A;  1SXT A;  1LAB A;  2JA7 G;  4KD3 A;  1Y1V G;  3DWP A;  4GNX A;  3CC4 A;  4X3K A;  1UEA B;  3MEF A;  3F2D A;  4DXF A;  3JAM c;  1VQD A;  1VF7 A;  1RF2 D;  4DR3 L;  2NVY B;  1PRT F;  4DV1 Q;  2OQ0 A;  4LF7 Q;  4A3J H;  4FXK C;  1JIC A;  3CPF A;  4G7H C;  1HNX Q;  4MTK A;  1EQV A;  3P7J A;  1H9K A;  4DV4 Q;  1G6Z A;  5CV7 A;  3ND9 A;  2E74 C;  3VR6 A;  4KJN A;  3PIO 3;  4JI4 Q;  1CQF A;  4PMB A;  1YNJ C;  2PNR C;  5ELF A;  1PFN A;  4DV4 L;  1AFP A;  3H91 A;  4NKL A;  2A74 C;  3I70 A;  3LWU A;  3PO2 B;  1QNK A;  5GAD C;  1VQG A;  1CI3 M;  4A3B B;  1TWA B;  1C0A A;  1YHB A;  4A3D H;  3K57 A;  4JBK A;  1CFM A;  4K0K Q;  1DYQ A;  4A3E G;  4DUY L;  4CDC C;  3PUW A;  4M1U B;  3TZU A;  3H09 A;  3EFX D;  3RR5 A;  2K5W A;  4JI2 Q;  1L0X B;  4PG3 A;  4TVA B;  3J81 j;  4PZ8 A;  5LMU L;  1UEB A;  3A7A B;  4JV5 L;  4A3D B;  4NXN L;  1VQF A;  4JYA L;  4A3C H;  4RA8 A;  4BBR H;  5HY6 A;  5LMU Q;  2IPK D;  5T1G A;  1EEF D;  1Q1E A;  4JOI C;  1QE6 A;  1CKM A;  5C3E B;  3QWN A;  4BBS G;  2Q8T A;  3GTJ H;  2QCP X;  1VQC A;  5DLQ E;  4A3K G;  1G2T A;  5ELO A;  2DY7 A;  2EE1 A;  1S5B D;  1Y8O B;  1JE5 A;  1RDP D;  4DK0 A;  4WJW A;  4DF7 A;  4DK1 A;  5FO9 B;  1KAW A;  1JCK B;  3T56 B;  1NTG A;  5EKI A;  4DV7 Q;  3G4S A;  1E7Z A;  2B63 B;  1ESF A;  4A3G H;  2IL8 A;  1ICW A;  1H9J A;  1RKN A;  3CCR A;  4DV3 Q;  4A75 A;  1Q1B A;  4RGO S;  2K75 A;  1E22 A;  1GUT A;  2OTL A;  4HTH A;  1LTR D;  4GOP B;  1H95 A;  1B3A A;  1X56 A;  3LNN A;  3MXG A;  4IOC A;  2Q2T A;  2VB3 X;  1O80 A;  1QJO A;  1WD1 A;  4HIM A;  1OTC A;  5JJI A;  2NTT A;  5C44 G;  4C1N K;  3NTK A;  4QIW E;  4EGV A;  3DLL A;  1TS5 A;  3OW7 A;  3FVQ A;  4O42 A;  2JK8 A;  5GQO A;  1N33 L;  4Y7N H;  3GTM H;  1MD2 D;  1XX8 A;  4RFB A;  5IIF A;  1PDQ A;  2XGT A;  2IX3 A;  1N33 Q;  4BY7 H;  1ZXT A;  1V1Q A;  1K8O A;  4YWK A;  1ZEQ X;  3HOW G;  3PO3 B;  3T4A C;  4UDU C;  4B3M Q;  5K36 H;  2VQF L;  1K8M A;  3M4O H;  1HZC A;  5I2Y A;  3HOY B;  2BOS A;  3N52 A;  4K5X A;  1KL9 A;  1LM0 A;  3S14 H;  1I50 H;  1R4P B;  1PTO F;  3HKZ G;  2ICE C;  2HQE A;  5FOB B;  1CK1 A;  3ERO A;  4BXX G;  4K8J A;  4FYD A;  3M4O B;  2C9O A;  3I4M H;  2LFN A;  3C1F A;  2JE6 I;  5A2Q L;  1A15 A;  1I4G A;  1QOH A;  4C3I B;  3U50 C;  2J0T D;  4MIU A;  1UUP A;  3A54 A;  1JB3 A;  5C0X G;  3K81 C;  3E0E A;  3A8J E;  3PV0 A;  4RMF A;  1WTO A;  5E4X A;  3VA5 A;  4ZCK A;  3PUY A;  1WJJ A;  4HMI A;  1SNQ A;  2NN6 G;  1JJ2 A;  3K5M A;  3LWE A;  2NWG A;  3U58 A;  3OMG A;  2Z1C A;  2NN6 H;  4DNR B;  3GTL H;  1E2Z A;  2E2H B;  3SDZ A;  1XWE A;  4XQJ A;  1VQ6 A;  1NNX A;  5JOB A;  4DK3 C;  1GOZ A;  2NVY H;  2IY5 B;  2Z6K C;  2WKC A;  3S1N B;  1B8A A;  5C4X H;  1L0Y B;  1D5M C;  1F2Y A;  5M9O A;  1JE4 A;  4RKL A;  5C3E H;  3BZK A;  2CQO A;  4PV1 C;  2L4N A;  2Q2U A;  4I7Z C;  4ZRZ A;  1CT1 D;  2F52 A;  3W5O A;  3TN2 A;  5C4X B;  1NY4 A;  1E3P A;  1O78 A;  3ER0 A;  2CCZ A;  4BS9 A;  4RCO A;  2F0S A;  1PTO C;  4NPS A;  2QKI C;  1K83 H;  2F0L A;  2JA6 G;  1C9O A;  5IYC G;  1LV9 A;  2K50 A;  2L55 A;  3ERQ A;  2HIV A;  3H0G G;  3RN2 A;  1J9O A;  3CQZ H;  3QB3 A;  4CDF C;  3T51 B;  1Q46 A;  3TRZ A;  3S14 B;  4XQN A;  1EY8 A;  5T1I A;  4IUP A;  4LFB Q;  5JJL A;  3PUZ A;  4A3C G;  4BY1 B;  1B50 A;  4IJH A;  3MC0 B;  2EDG A;  2RA4 A;  1CA5 A;  3GTG B;  3QOL A;  1XPO A;  2RBM A;  5LMN L;  4F87 A;  1SE8 A;  4H02 A;  1EQQ A;  2A6H D;  1F9P A;  5IP7 G;  1VQJ A;  1EWC A;  4JI1 Q;  3L2P A;  4JC0 A;  1CQV A;  3FKI B;  3GTM B;  3NUC A;  2FMM A;  2WFW A;  4POF A;  3Q24 A;  1UE7 A;  4CDD C;  2QEJ C;  4LAA A;  2CH4 W;  2QGQ A;  4M8A A;  3I4L A;  1MJE A;  2O4X A;  2VZA A;  2H4O A;  5KYI A;  2F0F A;  4JI1 L;  2B2W A;  1B7Y B;  4L8J A;  2Z0S A;  3J80 i;  2XVS A;  3EQL C;  3JAM E;  3HP3 A;  2AHO B;  2K1B A;  2F0J A;  3OTO L;  1BBX C;  4Q0F A;  2LS0 1;  3UDF A;  5KRU A;  1X55 A;  1YNN C;  1OO9 B;  4X3U A;  1B9M A;  1X32 A;  1XJV A;  1VMP A;  4A3L G;  5LMN W;  2CH4 A;  1CM9 A;  2UU9 L;  4HED A;  1A2U A;  5BR8 Q;  4KV6 A;  1SYF A;  2JA8 G;  3KUP A;  4DV5 Q;  2J4X A;  3PIP A;  3DM1 A;  4IFD I;  4DFA A;  1H9S A;  2NVX H;  4H7B A;  4B3S Q;  3D31 A;  1LLR D;  2QA4 A;  1E0B A;  5D14 A;  1A3T A;  1QZG A;  1IYV A;  2RDH A;  3KYH C;  3KLW A;  4HJ9 A;  4ME3 A;  3S1R B;  1EZ8 A;  3A74 A;  1EY0 A;  4DUY Q;  3S1N H;  2JA8 H;  1B4O A;  2BH2 A;  2D62 A;  4DV2 L;  5M5X H;  1L1O C;  4JPB W;  4C1N I;  3ERS X;  1SRO A;  1SSO A;  2EYF A;  2GVB A;  4L5R C;  1PH3 A;  1HA6 A;  2PPB C;  2M9V A;  3BZC A;  2WAQ B;  4EQ5 A;  2IJ0 A;  2BDN A;  2PMZ B;  2ASB A;  1SMX A;  2A68 D;  1YHQ A;  1CSP A;  1DGS A;  2R92 G;  3K5O A;  1H9S B;  3HOX H;  1NUC A;  2R7F A;  4JI2 L;  4LFB L;  2JA7 H;  4DAV A;  4QGU A;  1YJ9 A;  3GTL B;  1VQA A;  3MHB A;  5AJ3 Q;  1M90 C;  3S2H B;  3MTS A;  1CZW A;  3NHH A;  4C3I H;  4A93 G;  2F3V A;  2R61 A;  1STN A;  3A0J A;  4GN4 B;  3IFD A;  5COR A;  1PH1 A;  3BU2 A;  1KAB A;  1YNX A;  2BA1 A;  5FO7 B;  3CCS A;  4DR2 Q;  4J1M A;  2BDO A;  2EJM A;  3KLR A;  3D0F A;  1PH6 A;  2SDF A;  4F7X A;  4JI7 Q;  1TKW B;  2RSN A;  1GO3 E;  3AEV A;  3GTQ B;  3CU7 A;  2E2D C;  2YTX A;  1QB5 D;  1NMF A;  1G2S A;  1I94 Q;  2K14 A;  1XPR A;  1I50 B;  3VYR A;  2TSS A;  5CV8 A;  3I4N G;  1ILP A;  2EVB A;  3E9I A;  1BF4 A;  1PYB A;  4NB3 A;  4BXX H;  1N36 Q;  2SNM A;  4XT3 B;  1ML0 D;  4DR7 L;  5FJ8 H;  1N32 Q;  1SMY D;  4LW1 A;  3UDI A;  3BG3 A;  4ZK9 B;  4UPA A;  4N8X 1;  1WTR A;  1HXY D;  1GHK A;  2WB1 E;  4MHE A;  1Q81 C;  2JYO A;  3HGB A;  2MFI A;  2F0T A;  3QR8 A;  3E6Z X;  3HZX A;  5H1S E;  2X6G A;  5CYU A;  5K36 G;  4B3S L;  2YU9 H;  4TQU S;  1TU2 B;  2B8F A;  1IW7 D;  4GLX A;  2Y0S G;  3HOZ H;  4X66 L;  1HRJ A;  4HJ7 A;  3S1Q B;  2JA6 B;  1RL2 A;  1BQQ T;  4R8I A;  2K7V A;  4DR3 Q;  3AFQ A;  3S1R H;  4IPH A;  1KHI A;  4DGZ A;  5M5Y H;  2QW7 A;  1SRU A;  2CHB D;  4RKB A;  1V1P A;  3SK4 A;  5TSS A;  1I6H B;  1VDZ A;  1ET6 A;  3E0J A;  4DAM A;  1G91 A;  3RZO H;  2BE5 C;  4Z9C B;  1PFS A;  3D6C A;  4OGQ C;  1GUS A;  4FF4 A;  1PTO D;  5M5W B;  3CC2 A;  1LYL A;  3SXH A;  4A3M G;  3TP8 A;  3A5U A;  4OON A;  4K2K A;  1HR0 Q;  5EGT A;  4LNQ A;  3K7U C;  2E5L Q;  4OIK A;  4BY7 B;  2FHT A;  1SYE A;  2XTI A;  1HHV A;  1NJI C;  2F3W A;  5ELD A;  3TME A;  1IL2 A;  3K5N A;  4DV7 L;  4IPC A;  4R9W A;  2ZTD A;  2K04 A;  2X6L A;  4A3K B;  1WD0 A;  4OO1 H;  4XIG S;  4KHV A;  3HOV H;  3EIV A;  1U5K A;  4XDX A;  1X6O A;  2K5N A;  4A3M B;  1BVS A;  2LSS A;  1PYS B;  5EPK A;  1KXL A;  1V8Q A;  2PW5 A;  3STB D;  3I4N H;  3SHL A;  1EWH A;  1FNU A;  1G29 1;  5D65 A;  3M4Q A;  2JA8 B;  1PYW D;  2WB1 B;  3I90 A;  5CV4 A;  5CBA E;  1HQR D;  1PRT C;  1FR3 A;  2NB0 A;  2R7Z G;  2PCF B;  4DKA C;  3BDC A;  3NSW A;  1HFG A;  1Q12 A;  3CPW A;  5M3F B;  3IRB A;  1Y8N B;  2D5D A;  4QMG A;  3PUV A;  4KHZ A;  1GM5 A;  3VR3 A;  4K14 A;  4LF8 L;  2BE5 D;  1STY A;  2A6E D;  5EPJ A;  2F0M A;  2MPM A;  4JI0 L;  2EXZ A;  3RUZ A;  1V9P A;  4RWS C;  1MSG A;  5IP7 H;  3J80 c;  4R8N A;  1Y8P B;  3BVZ A;  1ICF B;  4ID6 A;  3M7N A;  1IHZ A;  1T9H A;  1FVI A;  1PRT D;  4EVO A;  4QL5 A;  3M4Y A;  1QVG A;  2FFK B;  1TVX A;  1Y1V B;  3AU7 A;  3I8Z A;  2ZJR A;  1B2T A;  2H1E A;  3SEB A;  4POG A;  5LHY 1;  4B3T L;  1VQN A;  4C3J H;  1D1K A;  3DXJ C;  4DNI A;  1BCP B;  4DR2 L;  1VQP A;  2KCM A;  3S2D B;  1TII D;  2Z4H A;  3H0G H;  5FLX E;  3FHW A;  2NVX B;  4A3M H;  1HUM A;  4P75 A;  3UDG A;  3D4D A;  3HKZ E;  1HTL D;  5IT9 c;  5D3D A;  4NXM Q;  1Z9F A;  4J15 A;  5EBD A;  2EY6 A;  3NQI A;  1GXD C;  2MO1 A;  2A5H A;  3EBE A;  4A3F H;  1SYG A;  2GVA A;  3T1Y Q;  1UE6 A;  3OSO A;  3Q6S A;  4C3J B;  3HOU H;  4AYB B;  1PVO A;  3I2Z A;  1Q7Y C;  3SVM A;  2N3S A;  3GV6 A;  1IXR A;  2JQO A;  1CKN A;  2OT2 A;  1YEZ A;  2XWB B;  3HOZ G;  2VW9 A;  5ELN A;  2KCT A;  5FLX c;  2RDG A;  4JI8 L;  4ZYS A;  3S16 H;  1GUN A;  1K3B C;  4DV2 Q;  1SJH D;  1WTX A;  4KKT A;  3GDE A;  2KQ3 A;  2K52 A;  3BVG A;  5DEH A;  3CCU A;  2CW0 D;  2OTJ A;  2KJX A;  4RG1 A;  2UXD L;  1SAP A;  4HJ5 A;  2UXB L;  3KF6 A;  4IQZ A;  3W1G A;  2JA5 H;  1NSN S;  2D9U A;  1I3Q H;  3CW2 C;  1A8V A;  3U9S A;  4JI5 L;  5GRO A;  4ILW A;  4BA2 I;  4X64 Q;  3OWF A;  1L1O B;  3NK9 A;  3SGI A;  4BBR B;  3OTO Q;  2JEA I;  2PYK A;  3UE1 A;  3S1M H;  2A6H C;  3MAQ A;  2PZT A;  3DWA A;  2UXC Q;  2AQ1 B;  2VL6 A;  2AQ2 B;  1K73 C;  3VA7 A;  4TSS A;  3ULL A;  5AJ3 L;  2UXD Q;  2GN5 A;  1JR0 D;  3AB9 A;  5C4H A;  1RCV D;  1VQ4 A;  4XXE A;  2PZW A;  4KTA A;  5CMD A;  1EFI D;  2ZXR A;  2PQA B;  1LTA D;  1F9S A;  1PZK D;  1I4X A;  1YNJ D;  2Q2I A;  3K0Y A;  3CMA A;  4YWM A;  1TWF B;  5IYD H;  1XXG A;  4X6A H;  2DNE A;  4U68 A;  2J7Z A;  5KNC A;  4KN7 C;  5C0X J;  1S72 A;  2MHV A;  4R4I A;  1PFM A;  4B9W A;  5EAY A;  3AQQ A;  1TWC H;  1L0W A;  3GTQ H;  3J81 i;  3HOW H;  2DY8 A;  3KLS X;  4DR6 L;  2OWO A;  1W3S A;  3VYT A;  1TR5 A;  1O7L A;  1S5C D;  1V1P B;  4GNX C;  1JC7 A;  4CKB A;  1Q8K A;  3TSS A;  5FK9 C;  5IP9 H;  4FDB A;  4R4Q A;  2K5H A;  1KAA A;  2VUM H;  5GAH C;  1C7Y A;  1F2M A;  1EU3 A;  5IGD A;  3CC7 A;  1W6J A;  2PI2 A;  3NBH A;  4OX9 Q;  2UUA L;  3KLS A;  1GUW A;  3ULP A;  3RMH A;  5A35 A;  3S17 H;  1BCP F;  4DV0 Q;  2IWH A;  1IKM A;  2I5L X;  1JT8 A;  2G5D A;  3NEN A;  1PH5 A;  3MVV A;  2Q8I B;  1X3E A;  2ID0 A;  3BDL A;  4K6D A;  2EIF A;  1K8A C;  3FKI H;  4I65 A;  1U0L A;  3OW2 A;  5EPL A;  2SOB A;  4BY1 G;  3J7A V;  4GKK Q;  2XRQ D;  4P74 A;  2EYH A;  1CUK A;  3M85 A;  4C2M B;  5COY A;  4X66 Q;  1DZ1 A;  4DR4 Q;  5C44 B;  3OHX C;  3IL8 A;  3HOZ B;  3CAM A;  4Q5V A;  4RH6 A;  4JBJ A;  2IHE A;  4JV5 Q;  3S1M B;  5HGT A;  1EIG A;  2Z6B A;  2NVT B;  3GTO B;  3I72 A;  3JAM L;  4IUN A;  1Y14 B;  3DHQ A;  4XQQ A;  4KD4 A;  1EY6 A;  3MFG A;  1P8L A;  4DUZ Q;  4JI8 Q;  3I55 A;  1S40 A;  5J22 A;  1JOR A;  3IAY A;  3AYH B;  3NTH A;  2M00 A;  1EY7 A;  4DR4 L;  3TP5 A;  1VMC A;  2HD3 A;  1F2Z A;  3W2D A;  4K8I A;  4ZUI A;  1GJX A;  4P72 A;  5KGU A;  2L1B A;  2IX1 A;  3EVQ A;  2R6G A;  1SNP A;  5JVG 3;  4EQP A;  2F0K A;  2LKV A;  1JWS D;  4DAY B;  3A7L A;  4A3I G;  4G7Z C;  3G6J B;  1ZYR C;  1TY0 A;  1WTV A;  2N49 A;  3G71 A;  2R7Z H;  1HZB A;  1OXT A;  4TRD A;  1SR3 A;  3JAM i;  4NP5 A;  4GLA C;  1O7Z A;  3QJY A;  1SE4 A;  3E3X A;  2NUC A;  4JI3 L;  5M3F H;  4BY7 G;  3GTP H;  3OMC A;  4QUF A;  1Z7T A;  5F2D A;  3L9A X;  1K8G A;  2KVM A;  2CVR A;  1O7Y A;  4A3B H;  4OO1 G;  3VR5 A;  2NN6 I;  4AQY Q;  4ODG A;  1B3Q A;  4WFN 3;  3DUZ A;  2MO0 A;  2VQE Q;  5IYB G;  5CR3 A;  1EL0 A;  1EZ6 A;  3VR4 A;  2ICI A;  3R8B A;  4WJ4 A;  1N32 L;  4LF8 Q;  5KNB A;  2VQF Q;  1S5F D;  1S5E D;  2L15 A;  1M8A A;  3HKZ B;  1Z6H A;  1HNW Q;  1ROD A;  2HHH L;  2DGY A;  2DJF C;  3O13 A;  1MGS A;  1CHQ D;  1TQO A;  4P71 A;  3C2P A;  1LTB D;  1DM0 B;  5EKL A;  4DU9 A;  2OXP A;  1J5E L;  3DM3 A;  4CJ0 B;  4S3S A;  4HIO A;  2QDB A;  5BR8 L;  2B2W C;  1I3Q B;  2JA6 H;  3FMC A;  4LUO A;  2MP1 A;  1LT6 D;  3P20 A;  4HAE A;  3F1Z A;  1STB A;  5M3M B;  3I4N B;  3F8T A;  1U9R A;  1R9T H;  2OQK A;  4K2L A;  2F0D A;  1EUJ A;  1BKB A;  5C0X H;  1VQO A;  3BS1 A;  4LF9 Q;  1JOO A;  3HG9 A;  4LFC L;  3H0G B;  2PI2 E;  3GTK B;  5IOD A;  2I0Q A;  1NR4 A;  4B9X A;  3I56 A;  3KF8 B;  4YHH L;  4C3I G;  5FO8 B;  2F0Q A;  1F9Q A;  4AYB E;  4X62 L;  4IZ8 A;  1GVP A;  1EEI D;  3J7Y W;  1JOQ A;  2VS1 A;  3J80 L;  3NEM A;  4X65 Q;  4HJ8 A;  1I4H A;  4LFA Q;  4BWG B;  2YV5 A;  3WDN A;  5FLM H;  4C3J G;  3BDO A;  3FEW X;  3A56 A;  1EYC A;  4C3H G;  1T5X D;  3SK8 A;  1JMC A;  4RHR A;  1FJG Q;  2RCN A;  1PH4 A;  4CJ1 B;  4DN4 M;  1IL8 A;  1C48 A;  4MN3 A;  4R4C A;  2UUB L;  1DJR D;  1X3P A;  1YIJ A;  1FJG L;  4IFD G;  3T53 B;  4FVM A;  4JW0 A;  4BBS B;  1KD1 C;  3B6Y A;  1N9W A;  3KDF A;  4K6L A;  3R2T A;  4KKS A;  3PCO B;  3WOE A;  3TP6 A;  3NEL A;  4DV6 L;  4LFA L;  3VYU A;  4C3H H;  2XSC A;  4HN7 A;  2L9H A;  1EIY B;  2UXC L;  2KEC A;  5I9P A;  1U4R A;  4DV6 Q;  2QDL A;  3VYS A;  3X3M A;  2B2U C;  1P16 A;  1HTP A;  1QUQ B;  3TEH B;  5GAG C;  5IGB A;  2DUD A;  2H5X A;  2D0P A;  4IPG A;  2UUA Q;  4UP7 A;  5CV5 A;  4QF4 A;  2B2U A;  1EYG A;  1KRS A;  3J7A F;  4A3E H;  5J3B A;  4OO1 I;  2FJ2 A;  1WCM H;  1N8R C;  2B29 A;  2AWN A;  1E1T A;  4LMQ D;  2E2J H;  3UE0 A;  2MGS A;  3KDF B;  4APV A;  2ALY B;  4DR7 Q;  1B9N A;  4F88 A;  3ZJY C;  4B3M L;  1PMR A;  3A5Z B;  3H3V H;  2F0P A;  2KBN A;  3CP0 A;  2VQE L;  1BOS A;  2VUM B;  3PMF A;  5IYC H;  5I2X A;  2JXM B;  3HOY G;  4A3K H;  2VNU D;  5JJK A;  4V0B A;  2MNA A;  2PQE A;  1BR9 A;  3SK6 A;  3M4P A;  3FKI G;  1SFO B;  3I7F A;  3PO3 G;  3HOW B;  5JEA H;  2ZXP A;  1AP0 A;  5IYD G;  1IYU A;  4A3I B;  2HCI A;  2JSO A;  4DR5 Q;  5ISR A;  4K0K L;  1SYD A;  3UDX A;  3CKI B;  2E2I H;  4LF5 L;  3S16 B;  1XYI A;  1EQT A;  2QEX A;  1O7I A;  5IGF A;  1ENF A;  4PMW A;  1JB7 A;  2EYM A;  3ND8 A;  4P2C B;  5DM7 3;  3OPO A;  2F0W A;  5C5L A;  1VS0 A;  1CTM A;  3U4V A;  1I94 L;  4OX9 L;  2EYP A;  4B3T Q;  1RJT A;  2Y0S B;  5M5X B;  1XTC D;  3F2C A;  4FP5 D;  1EQR A;  4GNX B;  1QVF A;  2KED A;  2IX0 A;  1L2F A;  1YJW A;  1D2B A;  1FNV A;  4QY7 A;  3KJO A;  1JJC B;  4Y7N B;  4G57 A;  4DUZ L;  4IPD A;  3T16 A;  1EIH A;  4KHP Q;  2B2T A;  1BUV T;  2QIL A;  5JAV A;  2B2V A;  1TT2 A;  4GN5 A;  5FJ8 G;  1YI2 A;  1EYA A;  1GD7 A;  4GKJ L;  3PSI A;  4NMZ A;  3KK7 A;  4AQY L;  3NWS A;  1Y1W B;  4K5W A;  2PO4 A;  1AZQ A;  1N34 Q;  1D8L A;  2R7D A;  5C4Z A;  5IT9 E;  2OEO A;  3RNU A;  2HCC A;  2EYJ A;  1STG A;  1TWF H;  1JQY D;  5C3E G;  1KNA A;  3K6O A;  2F0U A;  4A3D G;  3K8A A;  3PQI A;  1MIU A;  4L6T B;  3S1Q H;  1QNU A;  2PZU A;  4A76 A;  4KHP L;  3S9W A;  2I46 A;  2L0C A;  1FGB D;  4C3H B;  2JA9 A;  2HUG A;  5FKA C;  5A2Q E;  4A93 H;  5IP9 G;  3J80 E;  2FIN B;  3BYY B;  1HR0 L;  2K03 A;  1Q82 C;  2JEB I;  4HID A;  4CJ2 C;  2EYO A;  3S24 A;  3U9O A;  3T1H L;  3PO2 H;  3KF6 B;  4QQB X;  5C4J B;  3AFP A;  4B3R L;  3CF5 A;  3MXN B;  3A8I E;  3A8K E;  1G51 A;  2JN4 A;  1Y69 U;  4JI6 Q;  4OEM B;  1LTS D;  1A63 A;  1J8I A;  2F4I A;  1KDC A;  3J81 c;  1KTK A;  2I5M X;  3C3L A;  4DA2 A;  1L1O A;  1KQS A;  1XMQ L;  2HT1 A;  3CME A;  5G3L D;  1PH9 A;  3TDQ A;  1PFB A;  2AUK A;  1PA6 A;  2WB1 G;  1Y1W H;  2ZJP A;  4GZY C;  1MSH A;  3CRK C;  3G6E A;  1PV4 A;  3TQY A;  1IW7 C;  1PH8 A;  2DN8 A;  1RTN A;  4KI0 A;  1SNM A;  1STE A;  4G7O C;  4KY5 A;  4FXG C;  4ZQ3 A;  2XRS D;  3DEP A;  5K5P A;  3SR1 A;  5IGC A;  1YZ6 A;  3C1E A;  3WWV A;  2P5Z X;  3FPU B;  1J6Q A;  1TWH H;  2VXW A;  3MXN A;  4A3J G;  5M3M H;  5LL6 X;  2HQL A;  1K9M C;  1IBK Q;  1S3O A;  4H13 C;  4DR1 L;  1RHP A;  1SE2 A;  4XT1 B;  4B3R Q;  3J7A 5;  1QUQ A;  1CSQ A;  3RLO A;  2JA5 G;  1FL0 A;  2B2Y C;  1FD7 D;  3SK5 A;  1I4Q A;  2E5L L;  1SNO A;  4IAL A;  3KOJ A;  2K32 A;  4U67 3;  2UUC L;  5J1Z A;  1FYC A;  4I7A A;  3M9B A;  4DR1 Q;  2DJG C;  4L5T A;  2EXD A;  1CHP D;  1M4V A;  1ASY A;  3HOU B;  1YJN A;  4QJF A;  3K7A B;  4LWC A;  3FPP A;  2KEE A;  3R3O A;  1VCI A;  4L63 B;  2AUJ D;  3M3Y H;  4JOI A;  3GTK H;  4UAI A;  1VQ8 A;  4E6I A;  3GP7 A;  4ZLT F;  1OXU A;  5I9O A;  4GLV B;  4LF4 L;  5BN4 A;  4QCL A;  1JWM D;  1KDB A;  1K0R A;  3K7A H;  4ZAI A;  3KBX A;  1IBM Q;  2ZXO A;  3L3O C;  1LTI D;  1U4P A;  4FNF A;  2A6E C;  5M5W H;  1SLJ A;  5DNF A;  1F77 A;  1HNZ L;  1LO5 D;  4N8F A;  1X54 A;  1XMQ Q;  4PZ6 A;  4HCE A;  5KND A;  3I3C A;  4IUT A;  4HSP A;  3QG1 A;  3LX0 A;  2B3G A;  1NR2 A;  2NVQ B;  3HOV B;  4LF4 Q;  3Q22 A;  3OOC A;  2WKD A;  1LT5 D;  2CFM A;  1N34 L;  1K83 B;  4JG2 A;  2ZM6 L;  4X3T A;  4A93 B;  4O1N A;  5IWA L;  3CCM A;  1BNZ A;  1HFN A;  2D2C C;  2ES2 A;  1CKO A;  1TS3 A;  1HNX L;  5C4X G;  5KEE A;  2CWP A;  1HPC A;  1RD9 D;  3GO5 A;  2JP1 A;  1BDO A;  4IUR A;  2NVQ H;  4EQN A;  2B8G A;  5KYL A;  4LF5 Q;  1XNQ L;  3BYT B;  3GV3 A;  1MHW C;  5JPN C;  2X69 A;  1UNS A;  3NTI A;  2A69 C;  4YWL A;  3U4Z A;  1ZKO A;  5C6A A;  1ASZ A;  4RCN A;  1QVC A;  3CXC A;  3TP7 A;  2O5I C;  1SFO H;  2NTS A;  1AE3 A;  2Q8R E;  1XMO Q;  4C56 C;  4JVZ A;  5CC4 A;  3MXP A;  1HZ9 A;  2HHH Q;  2E8G A;  5E3F A;  4O2D A;  1IBL Q;  3D4R A;  2B2V C;  1WVL A;  2K05 A;  4KJO A;  1WCM G;  2D0O A;  3ULJ A;  1TWA H;  1VQ5 A;  5E1F A;  1D5Z C;  4HR7 B;  3ICE A;  3G48 A;  3V05 A;  4EX5 A;  1PTO B;  3RN5 A;  4O0A A;  2AQ3 B;  4X65 L;  3PIP 3;  1EOT A;  3F2U A;  3ZYY X;  2XN9 C;  1E2V A;  4IFD J;  2EPB A;  4AIM A;  1HZA A;  3FP9 A;  1RTO A;  4YY3 L;  2TMP A;  5LMN Q;  3GTG H;  5E4W C;  1XMO L;  3PO3 H;  2WAC A;  2F1M A;  1EY5 A;  3GTJ B;  3OWE B;  4KK7 A;  4MZ9 A;  2BA0 A;  4UP9 A;  2CKZ B;  1VQH A;  1V1O A;  4DV5 L;  2N55 A;  4DV1 L;  3BJU A;  2KHS A;  2Q2H A;  3GTO H;  1KNE A;  2RDF A;  1WOC A;  5HGQ A;  5EKK A;  2B63 H;  3M3Y B;  1AEX A;  3TRE A;  5C0X I;  2R92 H;  3RLN A;  1GHJ A;  1R4Q B;  1X3Q A;  3HRZ C;  3NXW A;  4YCU A;  3HOV G;  1D5X C;  2N8N A;  4WJ3 M;  3RD4 A;  4IN3 A;  1H9M A;  2E76 C;  4JI4 L;  2Y0S E;  4ZKB B;  4BY1 H;  2ZM6 Q;  4DV3 L;  3AMU A;  4JI5 Q;  1NAP A;  3CRL C;  2PMZ E;  1OXS C;  1UAP A;  2EOT A;  2YYZ A;  1VQ9 A;  2WP8 J;  1QWY A;  2UXB Q;  1A2T A;  3L0O A;  2RHQ B;  1S5D D;  4QB4 A;  5IYB H;  2EY1 A;  2NZH A;  5CV9 A;  2CW0 C;  4CGY B;  1STH A;  1NBW A;  4Y52 H;  1SDF A;  2C5C A;  3DMU A;  1BCP C;  1KDA A;  2QF7 A;  3D6W A;  5JEA J;  1K3R A;  2GA4 B;  4YIJ A;  4OWX B;  3F2B A;  2F3I A;  3I4M G;  2XIW A;  2Z9H A;  2EJG C;  5EJW A;  3VR2 A;  1SBB B;  4JYA Q;  3PGZ A;  1U4L A;  3CCE A;  1UE1 A;  5I6Y A;  3URY A;  3H15 A;  1XPU A;  5C4J H;  1HH2 P;  3BVM A;  4JI7 L;  4LF6 L;  2B2Y A;  3Q8D A;  1C8C A;  1TY2 A;  5JJZ A;  5IY0 A;  1SYC A;  4GKK L;  3HS0 C;  3DEO A;  4KKU A;  4FXD A;  4RGM A;  1PZJ D;  2AMC B;  2Z8L A;  3K80 C;  4HIK A;  4JI3 Q;  4DXG A;  4CBV A;  4A3I H;  3KJP A;  4EQO A;  1R9T B;  1JJG A;  4G4K A;  1WTP A;  1EIF A;  3GTP B;  5FLM G;  1IYJ B;  1KLG D;  2K28 A;  4V19 0;  4MNO A;  4H44 C;  3I4M B;  4XYQ A;  3CQZ B;  4DV0 L;  1FGU A;  1Q90 A;  2O2L D;  1J5E Q;  3NWT A;  1EU4 A;  4AH6 A;  3KBG A;  4UHV A;  4DK6 C;  1G8Z D;  4OHJ A;  4LFC Q;  2MQH A;  5CBE E;  1I6V C;  1PH7 A;  3R2I A;  2BCO A;  3D3R A;  1QIL A;  2IW3 A;  1F9R A;  1Q8I A;  4GS3 A;  4J8Q A;  4IUQ A;  2PNH A;  4ZUJ A;  1M1K C;  5C44 H;  3BZD B;  1LTT D;  1B70 B;  2FMC A;  4JI0 Q;  2A19 A;  1KLU D;  3H3V I;  2VUM G;  4ABN A;  3UI2 A;  3IKJ A;  3HFZ B;  3J81 L;  3I73 A;  2N88 A;  1YVC A;  4DAP A;  1BXT A;  2E2I B;  2AKW B;  2L11 A;  2CQA A;  4CKC A;  4NXN Q;  4RGN A;  1VQE A;  1ESR A;  1S4Z A;  2OF1 A;  3S15 B;  1IKL A;  1QG7 A;  1WTH A;  1ENC A;  2OCE A;  1BBW A;  2K5Q A;  3QOJ A;  2LY7 A;  3H94 A;  1HQM C;  3C46 A;  1Y1V H;  4IFD H;  1B44 D;  5CV6 A; 
#chains in the Genus database with same CATH homology
 4K0K L;  5ELO A;  4L5Q A;  3UDX A;  2E2I H;  4LF5 L;  1JE5 A;  2WAQ G;  2QEX A;  4JI0 L;  1O7I A;  1V9P A;  4GOP A;  1KIX A;  2F4V L;  5IP7 H;  3J80 c;  1KAW A;  4PMW A;  1JB7 A;  1NTG A;  4DV7 Q;  3G4S A;  3M7N A;  1T9H A;  4LUZ A;  1FVI A;  1E7Z A;  4QL5 A;  1AE2 A;  1QVG A;  4A3G H;  3CCR A;  1VS0 A;  4DV3 Q;  2NVT H;  4A75 A;  1Q1B A;  3U4V A;  2ZJR A;  1I94 L;  2K75 A;  1E22 A;  4B3T Q;  4POG A;  4OX9 L;  2OTL A;  4B3T L;  4GOP B;  1E1O A;  1X3F A;  4C3J H;  2VY3 A;  3T1H Q;  1VQN A;  3KFU A;  4DNI A;  2BH8 A;  1H95 A;  4OWT B;  3F2C A;  1VQI A;  1EQR A;  4GNX B;  1X56 A;  4IOC A;  4DR2 L;  1VQP A;  2KCM A;  1QVF A;  1YJW A;  2IX0 A;  1L2F A;  2RHS B;  2Q2T A;  3H0G H;  4QY7 A;  3FHW A;  4A3M H;  3KJO A;  1JJC B;  1GKH A;  3VDY A;  1OXV A;  4P75 A;  3UDG A;  2UU9 Q;  4DUZ L;  4HIM A;  3HKZ E;  4IPD A;  5IT9 c;  1OTC A;  4NXM Q;  4KHP Q;  1Z9F A;  5JJI A;  4J15 A;  5C44 G;  2MO1 A;  1G6P A;  1UE5 A;  4DR6 Q;  3EBE A;  4A3F H;  2GVA A;  3T1Y Q;  1UE6 A;  4QIW E;  1MJC A;  3HOU H;  3DLL A;  1PVO A;  3I2Z A;  1YIT A;  4GN5 A;  1Q7Y C;  1VQB A;  2N3S A;  5FJ8 G;  4LF6 Q;  1YI2 A;  1IBM L;  5IWA Q;  1GD7 A;  1LTL A;  2JK8 A;  3PSI A;  1IXR A;  2JQO A;  5GQO A;  3HOY H;  2LXJ A;  4A3G G;  4AQY L;  1TWG H;  1CKN A;  2KHI A;  4Y7N H;  1N33 L;  3CD6 A;  1N34 Q;  3GTM H;  1D8L A;  2R7D A;  1YEZ A;  3RNU A;  2XGT A;  1HNW L;  1N33 Q;  2VW9 A;  3HOZ G;  5ELN A;  4BY7 H;  2UXD Q;  1TWF H;  1X65 A;  2KCT A;  5M3F G;  5C3E G;  5FLX c;  1V1Q A;  1X9N A;  4YWK A;  3HOW G;  4JI8 L;  3S16 H;  4B3M Q;  1PHJ A;  3NBH B;  2VQF L;  4DV2 Q;  3M4O H;  4A3D G;  3GDE A;  3K8A A;  1HZC A;  1MKH A;  1VQL A;  2K52 A;  1MIU A;  4BBS H;  3CCU A;  2OTJ A;  1I6H H;  1Z47 A;  4RG1 A;  3S1Q H;  2C35 B;  2UXD L;  1KL9 A;  1LM0 A;  3S14 H;  1I50 H;  4HJ5 A;  4A76 A;  2UXB L;  4KHP L;  3K0X A;  3KF6 A;  3PF5 A;  4NXM L;  3W1G A;  3HKZ G;  2JA5 H;  4JI6 L;  2JA9 A;  1I3Q H;  3CW2 C;  4YHH Q;  1A8V A;  4A93 H;  4JI5 L;  5IP9 G;  5GRO A;  1HR0 L;  4BXX G;  1Q82 C;  4BA2 I;  4KLK A;  2JEB I;  4X64 Q;  4HID A;  3I4M H;  3S24 A;  3T1H L;  1L1O B;  3PO2 H;  3KF6 B;  3SGI A;  3OTO Q;  2JE6 I;  2JEA I;  3UE1 A;  3S1M H;  4QQB X;  3AFP A;  4LF7 L;  3U50 C;  4B3R L;  3TS2 A;  3CF5 A;  3MXN B;  1G51 A;  4JI6 Q;  2UXC Q;  2VL6 A;  1A63 A;  1K73 C;  3E9H A;  2K5V A;  3JC6 6;  3ULL A;  3J81 c;  5AJ3 L;  2I5M X;  1E24 A;  2GN5 A;  3K81 C;  1L1O A;  3E0E A;  5C0X G;  3PV0 A;  4RMF A;  2N78 A;  1VQ4 A;  1XMQ L;  1KQS A;  3CME A;  2HT1 A;  1PH9 A;  3PUY A;  1WJJ A;  2RF4 A;  2I5H A;  2NN6 G;  1PA6 A;  1JJ2 A;  2WB1 G;  2UUC Q;  2PQA B;  1Y1W H;  2ZJP A;  3U58 A;  3G6E A;  1PV4 A;  1HJP A;  4PZ7 A;  3TQY A;  5GAE C;  3GTL H;  2Q2I A;  3STB C;  2KHJ A;  3CMA A;  1PH8 A;  1NE3 A;  2NZO A;  4YWM A;  4KI0 A;  4C2M H;  5IYD H;  1VQ6 A;  4X6A H;  4JCV E;  4DK3 C;  4A3F G;  3PUX A;  2NVY H;  1AH9 A;  4LUV A;  2IY5 B;  2Z6K C;  4GKJ Q;  5C0X J;  1B8A A;  1S72 A;  4R4I A;  5C4X H;  2JJQ A;  5EAY A;  4LF8 L;  1YZ6 A;  2FXQ A;  1TWC H;  2V1C C;  3AQQ A;  1RIP A;  1L0W A;  3WWV A;  1J6Q A;  2A8V A;  2CWA A;  3GTQ H;  1TWH H;  5IE8 A;  3J81 i;  3HOW H;  4DR6 L;  5C3E H;  4A3J G;  2OWO A;  1W3S A;  5M3M H;  4IJL A;  2HQL A;  1XNR L;  3BZK A;  4GNX C;  2CQO A;  1K9M C;  1IBK Q;  1S3O A;  1Q8K A;  4DR1 L;  2Q2U A;  1D7Q A;  2ZTE A;  5IP9 H;  4B3R Q;  2F52 A;  4FDB A;  4R4Q A;  3W5O A;  3J7A 5;  2K5H A;  1QUQ A;  2VUM H;  1CSQ A;  3RLO A;  2JA5 G;  1FL0 A;  5GAH C;  3GD7 A;  1C7Y A;  1NY4 A;  1YHA A;  1EWI A;  1E3P A;  3ER0 A;  2CCZ A;  2E5L L;  1BBU A;  1PH2 A;  3S2D H;  3CC7 A;  3J7Z C;  1W2B A;  4UY8 C;  2PI2 A;  4NPS A;  4OX9 Q;  2UUA L;  3KOJ A;  1K83 H;  2UUC L;  3ULP A;  3S17 H;  2JA6 G;  1C9O A;  3M9B A;  4DV0 Q;  5IYC G;  4DR1 Q;  2K50 A;  2I5L X;  4BA1 I;  1JT8 A;  4L5T A;  2EXD A;  3NEN A;  1PH5 A;  2HIV A;  1XNR Q;  3H0G G;  3RN2 A;  1ASY A;  3CQZ H;  1X3E A;  2AWO A;  1YJN A;  2ID0 A;  4QJF A;  3TRZ A;  1Q46 A;  2EIF A;  4LWC A;  1K8A C;  3FKI H;  2Z6K A;  1VCI A;  1U0L A;  3OW2 A;  5JJL A;  4LFB Q;  3M3Y H;  4JOI A;  3PUZ A;  4A3C G;  4BY1 G;  4GKK Q;  3GTK H;  4P74 A;  4IJH A;  1CUK A;  3M85 A;  1VQ8 A;  1TXY A;  4DPG A;  2R93 G;  1OXU A;  4X66 Q;  1XPO A;  1VQM A;  3HOU G;  4DR4 Q;  5LMN L;  4GLV B;  2UUB Q;  1SE8 A;  4H02 A;  1EQQ A;  4LF4 L;  3CAM A;  5IP7 G;  1YBY A;  2YTV A;  1K0R A;  1VQJ A;  2IHE A;  4JBJ A;  4JI1 Q;  3K7A H;  1I5F A;  4JC0 A;  3L2P A;  4JV5 Q;  4A4I A;  1IBM Q;  2WFW A;  4IO9 A;  5M5W H;  1SLJ A;  4POF A;  1HNZ Q;  1UE7 A;  1HNZ L;  1Y14 B;  1X54 A;  5JEA G;  1XMQ Q;  4PZ6 A;  2PQA A;  1P8L A;  1UWV A;  2QGQ A;  1IBL L;  4P73 A;  4DUZ Q;  1MJE A;  4JI8 Q;  3I55 A;  1S40 A;  2LXK A;  1V43 A;  2VZA A;  5E7N A;  4JI1 L;  2B63 G;  1B7Y B;  2A1A A;  2B3G A;  3CCV A;  2Z0S A;  3AYH B;  3J80 i;  3PIO A;  1A0I A;  4LF4 Q;  2AHO B;  3OTO L;  1SN8 A;  4YCW A;  2ZJQ A;  2CFM A;  1N34 L;  4DR4 L;  1KC8 C;  4JG2 A;  5M3M G;  2ZM6 L;  4P72 A;  3UDF A;  5IWA L;  4OWW B;  2IX1 A;  1WFQ A;  3CCM A;  2R6G A;  2K4K A;  4DAY B;  2ES2 A;  4A3I G;  1CKO A;  1X55 A;  4GOP C;  1HNX L;  1XNQ Q;  5C4X G;  2KEN A;  2CWP A;  1HR0 W;  3GO5 A;  1XJV A;  2N49 A;  3G71 A;  2NVQ H;  2R7Z H;  1HZB A;  1OXT A;  4A3L G;  1SR3 A;  5LMN W;  2UU9 L;  3JAM i;  4LF5 Q;  3RLF A;  1XNQ L;  4GLA C;  4JI3 L;  5M3F H;  5BR8 Q;  4BY7 G;  4DR5 L;  2YTY A;  3GTP H;  1IZ6 A;  2JA8 G;  4DV5 Q;  3PIP A;  4YWL A;  4IFD I;  3U4Z A;  1ASZ A;  4R4T A;  1K8G A;  4L5S A;  4X64 L;  2NVX H;  1WI5 A;  1QVC A;  1NMG A;  3CXC A;  2ZTC A;  4A3B H;  4B3S Q;  3D31 A;  1SFO H;  1AE3 A;  2QA4 A;  4OO1 G;  3HOX G;  3EN2 A;  1XMO Q;  2NN6 I;  4AQY Q;  4UP8 A;  1QZG A;  1HZ9 A;  4YY3 Q;  2HHH Q;  4A3B G;  4A3L H;  2E8G A;  2E2H H;  4JBW A;  3KYH C;  3KLW A;  3PO2 G;  4O2D A;  2MO0 A;  1IBL Q;  2VQE Q;  4HJ9 A;  4ME3 A;  5IYB G;  1WCM G;  2D0O A;  3A74 A;  1TWA H;  3I4O A;  3ULJ A;  3T1Y L;  4R1J A;  4DUY Q;  1VQ5 A;  1WYD A;  2JA8 H;  3ICE A;  2BH2 A;  3S1N H;  1N32 L;  4WJ4 A;  3G48 A;  1EFW A;  4EX5 A;  4LF8 Q;  2D62 A;  4DV2 L;  5M5X H;  1L1O C;  2VQF Q;  3RN5 A;  4O0A A;  1VQ7 A;  4X65 L;  1N36 L;  2EQS A;  3CCJ A;  2L15 A;  3ERS X;  1SRO A;  2GVB A;  4IFD J;  4X62 Q;  2HIX A;  1PH3 A;  4AIM A;  4L5R C;  1HNW Q;  1HZA A;  3FP9 A;  4YY3 L;  2DGY A;  2HHH L;  3S2H H;  4R4O A;  3BZC A;  3GTG H;  5LMN Q;  4EQ5 A;  1XMO L;  3PO3 H;  2ASB A;  1SMX A;  1YHQ A;  4P71 A;  1CSP A;  4MZ9 A;  2IT1 A;  4BBR G;  1DGS A;  2R92 G;  4AYB G;  1OXX K;  4OXP A;  2BA0 A;  4GN3 B;  4UP9 A;  2CKZ B;  3HOX H;  1VQH A;  2R7F A;  3DM3 A;  1J5E L;  4JI2 L;  3S15 H;  4LFB L;  4DV5 L;  4HIO A;  2JA7 H;  4QGU A;  4DV1 L;  4YCV A;  1YJ9 A;  3RZD H;  3BJU A;  2Q2H A;  1VQA A;  5BR8 L;  3GTO H;  3HKS A;  5AJ3 Q;  1M90 C;  2JA6 H;  2F4V Q;  2IHF A;  4LUO A;  1WOC A;  4C3I H;  5HGQ A;  2B63 H;  4IOA A;  4A93 G;  1Y1W G;  3TRE A;  5C0X I;  3CCQ A;  4ALP A;  3A0J A;  4GN4 B;  1PH1 A;  2R92 H;  1CKN B;  3BU2 A;  3F1Z A;  3RLN A;  3F8T A;  1YNX A;  2BA1 A;  1R9T H;  3CCS A;  2OQK A;  1EUJ A;  2WAQ E;  4DR2 Q;  1BKB A;  4YCU A;  3HOV G;  2N8N A;  3D0F A;  1PH6 A;  1VQO A;  4WJ3 M;  2R93 H;  4JI7 Q;  4LF9 Q;  3AEV A;  1GO3 E;  3TS0 A;  2YTX A;  4LFC L;  1Q86 C;  2Y0S E;  1NMF A;  4JI4 L;  4BY1 H;  2ZM6 Q;  1I94 Q;  2PI2 E;  2K14 A;  1VQK A;  4DV3 L;  1XPR A;  2I0Q A;  4XTC S;  3L7Z C;  3I56 A;  4JI5 Q;  3I4N G;  3KF8 B;  2PMZ E;  4YHH L;  1A62 A;  1OXS C;  4MTN A;  3E9I A;  1IBK L;  2YYZ A;  4AYB E;  1VQ9 A;  4X62 L;  1GVP A;  2WP8 J;  3CCL A;  2UXB Q;  3L0O A;  1PYB A;  2RHQ B;  4NB3 A;  5IYB H;  4BXX H;  2NZH A;  1EOV A;  2VS1 A;  1N36 Q;  3NEM A;  4X65 Q;  4HJ8 A;  1NBW A;  4LFA Q;  4Y52 H;  3PF4 A;  4DR7 L;  5FJ8 H;  2YV5 A;  4GKJ L;  1XTD A;  4LW1 A;  1LUZ A;  3UDI A;  3W1B A;  5FLM H;  1N32 Q;  4UPA A;  5JEA J;  1K3R A;  2WB1 E;  1Q81 C;  1JMC A;  4OWX B;  3F2B A;  2F3I A;  3I4M G;  3OYY A;  4JBM A;  1KRT A;  1FJG Q;  2RCN A;  1PH4 A;  2MFI A;  3LGJ A;  2ATW A;  1QZH A;  1X3G A;  5H1S E;  4JYA Q;  3PGZ A;  3CCE A;  5K36 G;  4B3S L;  1UE1 A;  4R4C A;  3H15 A;  2YU9 H;  4TQU S;  2UUB L;  1YIJ A;  1XPU A;  1FJG L;  5C4J H;  4GLX A;  4IFD G;  1HH2 P;  2Y0S G;  3HOZ H;  4JI7 L;  4LF9 L;  4X66 L;  4LF6 L;  1KD1 C;  3Q8D A;  4HJA A;  3B6Y A;  4HJ7 A;  1N9W A;  3KDF A;  2JA7 G;  1Y1V G;  5IY0 A;  1RL2 A;  4GKK L;  3PCO B;  4GNX A;  3CC4 A;  4DR3 Q;  3AFQ A;  3NEL A;  2AMC B;  4IPH A;  3K80 C;  4DV6 L;  4HIK A;  3S1R H;  4JI3 Q;  4LFA L;  4C3H H;  4A3I H;  1KHI A;  3KJP A;  5M5Y H;  1JJG A;  1SRU A;  1EIY B;  1EIF A;  3MEF A;  3F2D A;  2UXC L;  5FLM G;  1VQD A;  3JAM c;  1IYJ B;  4DV6 Q;  4DR3 L;  4DAM A;  4DV1 Q;  4MNO A;  3RZO H;  2OQ0 A;  4LF7 Q;  4A3J H;  3CPF A;  1PFS A;  1HNX Q;  1P16 A;  1QUQ B;  4DV0 L;  3TEH B;  5GAG C;  1FGU A;  4DV4 Q;  2DUD A;  2H5X A;  1J5E Q;  3CC2 A;  2D0P A;  4IPG A;  4AH6 A;  4UP7 A;  4DK6 C;  2UUA Q;  1LYL A;  4JI4 Q;  4LFC Q;  2MQH A;  4A3M G;  1EYG A;  3A5U A;  1KRS A;  4OON A;  1PH7 A;  4A3E H;  1HR0 Q;  5J3B A;  4LNQ A;  4OO1 I;  3K7U C;  4DV4 L;  2E5L Q;  2XTI A;  1NJI C;  1WCM H;  4GS3 A;  2B29 A;  1N8R C;  1IL2 A;  4DV7 L;  2AWN A;  4IPC A;  1E1T A;  2PNH A;  5GAD C;  1VQG A;  2ZTD A;  1M1K C;  2E2J H;  3UE0 A;  4XIG S;  1YHB A;  5C44 H;  3HOV H;  4A3D H;  1B70 B;  1C0A A;  3EIV A;  1U5K A;  2A19 A;  4JI0 Q;  4JBK A;  2VUM G;  1X6O A;  3H3V I;  2K5N A;  1BVS A;  3KDF B;  4APV A;  2ALY B;  3HFZ B;  4DR7 Q;  4K0K Q;  2LSS A;  1PYS B;  4A3E G;  4DUY L;  3PUW A;  3ZJY C;  4B3M L;  3H3V H;  3A5Z B;  1KXL A;  2KBN A;  3STB D;  1YVC A;  3CP0 A;  3RR5 A;  3I4N H;  4JI2 Q;  1G29 1;  2VQE L;  4PG3 A;  3M4Q A;  4TVA B;  3J81 j;  4PZ8 A;  5LMU L;  5IYC H;  1UEB A;  2AKW B;  3HOY G;  4A3K H;  4JV5 L;  2VNU D;  5JJK A;  2R7Z G;  4NXN L;  1VQF A;  4JYA L;  4NXN Q;  4A3C H;  2MNA A;  1VQE A;  4DKA C;  4BBR H;  5HY6 A;  3M4P A;  5LMU Q;  3FKI G;  3CPW A;  1Q12 A;  3IRB A;  2OCE A;  1BBW A;  3I7F A;  3PO3 G;  1Q1E A;  4JOI C;  1CKM A;  3PUV A;  4KHZ A;  5IYD G;  1GM5 A;  1Y1V H;  4BBS G;  3GTJ H;  4DR5 Q;  1VQC A;  5DLQ E;  4A3K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...