3GTPH

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtpH00
3H15A 2N78A 3TEHB 5IYCH 1S72A 2PI2A 1PVOA 5IYBH 1SR3A 4DV6Q 3HOUH 1C0AA 1CKOA 2F3IA 1JE5A 2YTYA 5LMNQ 1OXVA 1L2FA 5C44H 1SLJA 2A1AA 2QGQA 3F2BA 4JI2L 3GTOH 1G6PA 3AQQA 3DM3A 5FLMG 2NVTH 4LF6Q 2WB1E 5IP7H 1C9OA 4GOPA 1XJVA 1HNXQ 3NELA 3GTGH 4DUYQ 4A3DG 2NVXH 4EX5A 4DK6C 4P74A 2OTJA 3Q8DA 2E5LQ 4XIGS 1XNRQ 1E1OA 4DV7Q 4HJ5A 1QVCA 1L0WA 3RN2A 4A93G 3KOJA 5M5WH 3PV0A 2R7ZH 3CCSA 1N32Q 3PCOB 3TREA 2VQFQ 3OW2A 2NN6G 2ZJRA 1I94L 4DR7L 3G4SA 4GNXA 4QY7A 1HH2P 1E22A 1Y1WG 3G71A 1PH7A 3HOYG 4HIOA 5JEAG 2I5LX 1DGSA 3EIVA 3A5UA 5AJ3L 3CCRA 1KQSA 1UEBA 3M3YH 4JG2A 5IP9H 3HOXG 3UDGA 4B3SL 4A3IH 4IPCA 4DR3Q 3J81c 4LF7Q 4X64L 1B8AA 1VQAA 1VQJA 3I4OA 4X66L 1HR0W 4IFDI 4LUZA 4A3KG 1EFWA 1EOVA 4P72A 3T1YQ 3KYHC 2UU9Q 3UDIA 2F4VL 4HJ8A 3JAMc 4DV0L 3GD7A 3FHWA 3NBHB 5BR8L 3HOZG 4A3GH 4MZ9A 4C3HH 1VQFA 3ULJA 3L2PA 4BY1H 2VUMH 4JI4Q 1N34L 3S2HH 2AKWB 4DAYB 2VQEL 3M4OH 5GROA 2NZHA 2R6GA 1A63A 4GKKQ 2KENA 4GLAC 2CQOA 4YCWA 4A3JH 3CCLA 2JA9A 4UP7A 3VDYA 3UE1A 4L5SA 1J6QA 3S24A 3FP9A 1XPOA 2N49A 2B63H 2GVAA 4QQBX 4RMFA 4JI5Q 5HY6A 1V43A 3K81C 1GKHA 4OONA 4LFAQ 4HIKA 1PHJA 4X6AH 1IZ6A 1YI2A 2HHHL 4DR6Q 4DR7Q 5C4XH 3AFPA 4GN5A 4OO1G 5C0XJ 2JA5G 4JI0Q 2ZM6Q 1SROA 1CKMA 2B3GA 4L5TA 1VQKA 4BY7H 1UWVA 4JBWA 3BU2A 4JOIA 2WP8J 1PH9A 4DV4Q 4OWWB 1XPUA 4DPGA 3H0GG 4JI7Q 3M4PA 4K0KL 5ELNA 1KC8C 1EIFA 3J80c 2HT1A 3F2DA 1X56A 2BA0A 3RZOH 4LF8Q 1SMXA 1BKBA 2GVBA 5LMUQ 4B3TL 3HKZG 3E9HA 3OTOQ 1JMCA 3KDFB 2KHIA 1MJCA 1I3QH 4GLVB 3WWVA 3E0EA 1PH8A 2ASBA 1HNWQ 1I5FA 3CXCA 1YJ9A 1Q82C 2E2JH 1IBMQ 4JI6L 2K5VA 4DR4Q 4JBMA 2N3SA 1KHIA 4LF5Q 4KHPQ 1FJGQ 3E9IA 3L0OA 4A3MG 3S1QH 2K50A 4JI8Q 2IX0A 4IO9A 3NENA 3MXNB 3IRBA 3RLNA 4YY3L 1Q81C 1PFSA 5IYDG 4AQYL 2ATWA 2K5HA 3PF5A 2UXCL 1PH1A 4JI1L 1VS0A 3W1GA 2RF4A 4IJHA 1HZ9A 2JA7H 4LF4Q 4A3BG 2MNAA 4HJ9A 1WCMG 1YHQA 4YCVA 3PSIA 4QL5A 4HIMA 4GN3B 2Z0SA 5J3BA 3PO2H 4BXXG 2Q2IA 1SN8A 2DGYA 4YWKA 1GD7A 4X65L 5C0XG 2IX1A 2BA1A 1JJ2A 4Y7NH 1IXRA 2JA8H 1VQCA 1JT8A 3NEMA 1N33L 3HOVG 4JI2Q 2ES2A 4IOCA 4JCVE 4DV3L 4NPSA 2BH8A 4AYBG 2A8VA 2JA6G 1KIXA 2RHSB 4IFDJ 4DV2L 5JEAJ 5LMNW 3PO3H 3PUZA 5ELOA 4GNXC 3STBD 1M1KC 1KXLA 4DUZL 2JEAI 1RIPA 3RN5A 4IOAA 1X9NA 1AE3A 3M7NA 3CC2A 1SE8A 1BBUA 2NVYH 4OX9Q 4HJ7A 3S16H 2Q2TA 3J81j 5FJ8G 2YU9H 5AJ3Q 3GTKH 4R4OA 4YHHL 3I56A 1HZCA 1VQ9A 4PZ8A 2VNUD 1Z47A 2UXDL 4X64Q 3AFQA 3BZKA 4X66Q 1XNQL 2XGTA 2WAQE 4H02A 2CWPA 4DR5L 3H0GH 1N8RC 1MJEA 1X3FA 3RR5A 4BBSH 1PYBA 2Z6KC 3K0XA 1Y14B 2HIXA 4OWTB 3U4ZA 4DV0Q 5BR8Q 1K8GA 4NB3A 3CQZH 1CUKA 3CCVA 2HIVA 2CCZA 1CKNA 4A75A 1N34Q 1XPRA 4QJFA 1QUQB 3CP0A 4BBRG 3GDEA 3ZJYC 1UE5A 1OTCA 2EIFA 2YV5A 3H3VH 1YEZA 4X62L 1FL0A 3U4VA 4DV1Q 2I0QA 3ULPA 2K14A 1QZHA 4IFDG 3LGJA 2UXBL 1NE3A 4DR1L 1I50H 1E3PA 3J7A5 1CSPA 1N36L 2MFIA 1VCIA 2E8GA 3EN2A 1YVCA 1NMGA 2AWOA 1L1OA 3KF6B 1IYJB 3MEFA 5IE8A 3S1RH 2PQAA 2UUCL 2KBNA 3UE0A 5M3FG 2JE6I 2A19A 5DLQE 1K8AC 3J81i 3W5OA 1PH4A 1ASZA 3A5ZB 3HOWG 3CC7A 2JEBI 5HGQA 1BBWA 2H5XA 1E7ZA 2ZTDA 2JJQA 2LXKA 3K80C 1IBLL 2DUDA 4KHZA 1PV4A 1Y1VG 1PYSB 3ERSX 5M5XH 2K4KA 5M3MG 2NVQH 3KF8B 1TXYA 3JAMi 3I4MG 4KLKA 2GN5A 4K0KQ 4ALPA 2KCMA 4PZ6A 1M90C 1CSQA 5IWAL 2NZOA 1TWGH 1X6OA 1B70B 3RLOA 2RHQB 4LFCL 1MIUA 4A3FG 2HHHQ 2UUBQ 4B3TQ 4DNIA 4LFBQ 4A3EG 1IBKL 3CCUA 2NN6I 4JI6Q 2R92H 1KL9A 1EIYB 2QEXA 4HIDA 4LF6L 3KFUA 4GN4B 2EXDA 4TQUS 2Y0SG 3S2DH 4DUYL 2LXJA 4YY3Q 4R4CA 4AQYQ 2UXCQ 3B6YA 4DV7L 4JI1Q 1PH2A 4B3RL 1LTLA 2R93G 1YBYA 1J5EL 3J7ZC 3HKSA 1QVFA 1VQHA 1JJCB 4A3LG 1EQQA 5C3EG 2OCEA 3GTLH 2AMCB 1YITA 2XTIA 4C3JH 4BA1I 5FLMH 1I6HH 1HZBA 4P73A 2ZJPA 1OXSC 4X65Q 1Q86C 4L5RC 4A3DH 4YCUA 3J80i 4A3CG 1N33Q 2OQKA 3FKIG 4JBJA 1A0IA 1LYLA 5IYCG 4DV3Q 3STBC 2UUAQ 4AIMA 5IYBG 4A93H 2VY3A 1Q12A 1U5KA 1HNZL 4LWCA 3HOUG 3RLFA 1W3SA 3M9BA 1K9MC 1GO3E 1NJIC 1VQ8A 4B3ML 1ASYA 1FGUA 2CKZB 1VQIA 2C35B 4O0AA 4NXNL 4DAMA 4DV2Q 1Y1WH 3HOYH 5GADC 5JJIA 4GOPB 3CCMA 4NXML 3W1BA 5IP7G 3S1MH 1X3EA 3PF4A 3HOXH 4BA2I 1Q8KA 4L5QA 1EYGA 4GKKL 4UP8A 4P71A 4POFA 3KJPA 3KF6A 1VQ4A 2IHEA 1HR0L 2WB1G 2OTLA 1VQPA 1WYDA 4J15A 5M3FH 4A3KH 3D0FA 2R7ZG 4YHHQ 1O7IA 4ME3A 1SFOH 2I5MX 1WI5A 4GOPC 4GLXA 4WJ4A 1X54A 4GNXB 3CAMA 4LFAL 1RL2A 5GAEC 3HOZH 2UXDQ 1WFQA 3G6EA 2KCTA 3T1HL 1S3OA 1XNQQ 3F1ZA 4APVA 4DR6L 4DR5Q 1LM0A 4WJ3M 1UE1A 2L15A 5IP9G 1UE6A 4JI0L 3CD6A 4KI0A 1VQEA 4A3IG 3PUWA 1GM5A 3H3VI 4LF9L 4DV5L 2JK8A 5JJKA 2CWAA 4R4QA 1HJPA 1YJNA 4DR2L 5GQOA 4A3BH 1OXTA 1NMFA 2F52A 1I94Q 3UDFA 1YHAA 4IJLA 4X62Q 2E2IH 3I4NG 4A3GG 2R7FA 3OTOL 2UXBQ 2VL6A 1X65A 3JC66 3KJOA 1VQ6A 4R4IA 4BY1G 4DR1Q 2RCNA 1A62A 2VUMG 1P16A 1HNWL 2JA5H 1IBML 3K8AA 4DKAC 3I55A 1N36Q 4B3SQ 1QZGA 2KHJA 1FJGL 4A3JG 4JV5L 1EQRA 1OXUA 3PIOA 3HKZE 3CC4A 4JI3L 2UUCQ 2B63G 2OWOA 3AYHB 4FDBA 4GKJL 1KRTA 1UE7A 1V9PA 1XMQL 1Z9FA 3K7AH 5E7NA 2F4VQ 2I5HA 1IBLQ 5M5YH 2CFMA 4LF4L 1VQDA 1YNXA 1VQMA 1PH3A 3KDFA 1VQLA 5C4XG 1K83H 3AEVA 2VQEQ 2N8NA 4R1JA 3S17H 2HQLA 5IWAQ 3S15H 1X3GA 2PNHA 4Y52H 2QA4A 2ZTCA 4JBKA 4A3MH 4LFCQ 3GTJH 4A4IA 4BY7G 1XTDA 2MO0A 3CCQA 1IBKQ 1TWAH 5IYDH 4QIWE 4LNQA 3A0JA 3TRZA 2D62A 1BVSA 1PH5A 1AH9A 3K7UC 1A8VA 1YHBA 1WCMH 2OQ0A 1VQOA 1XMOL 2VZAA 4JYAL 1G51A 1N9WA 4B3RQ 1J5EQ 4JOIC 4AYBE 3CPWA 1R9TH 2BH2A 4BXXH 1AE2A 3CCEA 4OXPA 1VQNA 4PMWA 2IHFA 2V1CC 1U0LA 4PZ7A 3I7FA 3HOVH 4OX9L 4O2DA 4POGA 2YTVA 3GTQH 2WFWA 4IPGA 1JB7A 3M85A 2K52A 1E1TA 3PGZA 4PG3A 4DV6L 1IL2A 2JA7G 4MNOA 2JA6H 1VQ7A 1YIJA 3PUYA 5LMNL 2MQHA 5FLXc 3PIPA 4IPDA 3PO2G 1GVPA 1NBWA 1HNZQ 4C2MH 1V1QA 1HNXL 4IPHA 4B3MQ 2JA8G 3I4NH 2E5LL 1PH6A 4NXNQ 1XNRL 3SGIA 1YJWA 4QGUA 2YTXA 5FJ8H 3OYYA 4NXMQ 1OXXK 2IT1A 2Z6KA 1N32L 5C4JH 1TWHH 3CMAA 3RNUA 4UP9A 2VQFL 3GTMH 1NY4A 4A76A 2PI2E 4XTCS 3PO3G 1HR0Q 3TQYA 4DV1L 2K75A 2PMZE 2MO1A 1Q1EA 5K36G 1TWFH 1EWIA 4C3IH 1B7YB 1YZ6A 3GTPH 2IY5B 4DR3L 4HJAA 4LF7L 3CF5A 3T1HQ 3D31A 4LFBL 1Q7YC 4UY8C 5EAYA 3RZDH 3G48A 3U58A 1VQ5A 2Q2UA 4BBRH 1KAWA 1QUQA 3T1YL 2UU9L 2D0OA 3TS0A 5C44G 1Q1BA 4R4TA 4LF9Q 3F8TA 4OWXB 4DV5Q 3L7ZC 2K5NA 4DUZQ 3S1NH 4JI4L 4YWLA 2EQSA 4DR2Q 4OO1I 3BJUA 4BBSG 3F2CA 5H1SE 2ALYB 1G291 1K3RA 3ER0A 2UUBL 3TS2A 1JJGA 3DLLA 1CKNB 2WAQG 1TWCH 3HOWH 1KRSA 3PUXA 3GO5A 4JI5L 1WJJA 4P75A 1X55A 3KLWA 4JV5Q 1S40A 1H95A 4JI3Q 1Y1VH 3CPFA 2JQOA 3I2ZA 1WOCA 1P8LA 2LSSA 5M3MH 3I4MH 3CW2C 4GKJQ 2B29A 1XMQQ 1KD1C 1D8LA 2ZM6L 1K73C 1L1OB 3EBEA 2Y0SE 4A3FH 4LUOA 2PQAB 4A3EH 3M4QA 1MKHA 1C7YA 4MTNA 2R7DA 1K0RA 1EUJA 4DV4L 1E24A 4JI7L 3U50C 2ID0A 3ICEA 1SRUA 2ZTEA 2D0PA 4AH6A 5JJLA 1Q46A 1LUZA 4LF8L 5LMUL 4RG1A 4DK3C 4YWMA 2AWNA 1QVGA 1L1OC 5GAGC 2AHOB 1VQGA 5GAHC 3CMEA 2ZJQA 2UUAL 2FXQA 2R93H 4UPAA 4JC0A 4DR4L 1HZAA 4EQ5A 4LF5L 4KHPL 2YYZA 5C0XI 2E2HH 4TVAB 1D7QA 4JI8L 4A3LH 5C3EH 1XMOQ 4LUVA 3BZCA 3UDXA 3CCJA 1T9HA 4JYAQ 2R92G 1FVIA 1VQBA 2VW9A 3ULLA 5IY0A 1PA6A 4LW1A 1NTGA 3A74A 4GS3A 3PUVA 3S14H 2Q2HA 4A3CH 3HFZB 1W2BA 3FKIH 2VS1A 5IT9c
chains in the Genus database with same CATH superfamily
1HA5A 1QJOA 4IUUA 2PI2A 1QNUA 1II3A 5IYBH 3S16B 2F0WA 1C0AA 4FF1A 3C3LA 1JE5A 2YTYA 1OXVA 2XSCA 1SLJA 2QGQA 3OMGA 3GTOH 5FLMG 2NVTH 1W6KA 1B53A 1K8MA 2F0PA 1TIID 1XJVA 5C5LA 3NELA 1A2TA 1ZKOA 5K5PA 1HNXQ 2NVXH 2H1EA 2E5LQ 1E1OA 3RN2A 4A93G 5KNBA 1R4QB 3CCSA 2NN6G 3OIQA 2EYHA 4CHTB 3A5UA 1KQSA 1UEBA 4OIKA 4L63B 4IPCA 3NQTA 4LF7Q 4KD3A 4IQZA 2A6EC 1ESFA 2K04A 1EOVA 4DK0A 5I2XA 1ONLA 3UDIA 4DV0L 4A3GH 3HOZG 2EOTA 5BR8L 4E6IA 4OEMB 3HOVB 2KOLA 1CZGA 1WTVA 2R6GA 4GKKQ 2KENA 4GLAC 4YCWA 4DNRB 2DY7A 3H94A 1J6QA 3S24A 3D4DA 1XPOA 2GVAA 2Q8IB 1KNEA 2TMPA 4RKLA 2EYJA 1YI2A 2Z8LA 4GN5A 1AZQA 1VF5C 2QEJC 4K5VA 1CKMA 2B3GA 3VR3A 4BY7H 1UWVA 1VMPA 1PH9A 1XPUA 4OWWB 4ID6A 1MGSA 3J80c 4FYDA 5CBEE 1V1PA 1JMCA 3KDFB 2KHIA 4GLVB 4K2LA 1HQRD 2E2JH 3CXCA 1YJ9A 1IBMQ 4N9TA 4KHPQ 4A93B 3E9IA 1HCZA 3L0OA 4A3MG 1PFSA 2UXCL 3P7JA 4JI1L 1VS0A 4EQOA 4G4KA 2F0EA 1MHWC 2BDOA 2MNAA 4HJ9A 3S1MB 4YCVA 1QWYA 2WV6D 1HUMA 4RHSA 4WJWA 2IX1A 5M3FB 5D65A 2JA8H 1WTRA 2L55A 2LS01 2ES2A 3R93A 4IOCA 2A8VA 4AYBG 4XQQA 3IAYA 4DV2L 3PUZA 2O5IC 2FMCA 3RN5A 1EY0A 1QG7A 1X9NA 3BVZA 1SE8A 2PYKA 2NVYH 2Y0SB 2YU9H 1CQVA 3GTKH 3VYRA 4X3KA 3I56A 1HZCA 1Z47A 2UXDL 4WRDA 1AW7A 3NBIA 5A2QE 5I6YA 2K05A 4FF2A 4DR5L 2B8GA 4C3IG 4BBSH 2Z6KC 3K7AB 2NBFA 1EU3A 1TKWB 3VYSA 4A75A 1K83B 1AEXA 2BE5C 3CP0A 4BBRG 2F0VA 3ZJYC 1OTCA 2YV5A 4IALA 4KKSA 4X62L 2ZXOA 4RGOS 2KJXA 3SDZA 3ULPA 1QZHA 2X6GA 2UXBL 3IFTA 1PRTF 1E3PA 3SHLA 3DMUA 3I73A 3MZ5A 4I7AA 1N36L 1VCIA 3MEFA 1YVCA 5IE8A 2K5WA 3ERQA 2KBNA 2JE6I 4DF7A 3K0YA 2EYFA 3J81i 3M7GA 3SEBA 1ILPA 5HGQA 4RGNA 1E7ZA 1JWMD 2JJQA 1LTRD 2DUDA 4KHZA 1PV4A 1Y1VG 1PYSB 1IW7D 5M3MG 2GN5A 3RMHA 2EY2A 4AYBB 1TWGH 3E5SA 4LFCL 4LFBQ 3H91A 4DA2A 4A3FG 2KQ3A 4QUCA 3CCUA 2NN6I 3DWPA 3MFYA 4JI6Q 4HIDA 4LF6L 2XRQD 4HMJA 4C2MB 1JOQA 4AQYQ 3HKSA 4TKOB 2OCEA 2XTIA 4BA1I 2XRSD 4J6HA 1Q86C 1NSNS 4A3DH 4X3TA 4C3IB 1IKLA 4JBJA 4G7OC 3CHBD 1FNVA 5IYCG 5CGKA 4DV3Q 2UUAQ 3J81E 2VY3A 3HOUG 2PMZB 3M9BA 1K9MC 1EOTA 1LT4D 4K8IA 2J0TD 4BBRB 5ELEA 2C35B 4H0LC 5DM63 1Y1WH 3HOYH 1F9RA 5JEAH 3I72A 3W1BA 4KN4C 1AFPA 3QWNA 1Q8KA 4L5QA 1KDBA 1HFGA 2CQAA 4UP8A 5BN3A 3RZOB 5DEHA 1MSHA 1E2VA 2MUYA 2IHEA 3KF6A 3KJPA 1HR0L 3A56A 2MHVA 5G3LF 2OTLA 2R7ZG 4YHHQ 4F88A 1U4MA 2F0KA 4XQJA 4KK7A 1ZEQX 4LFAL 3U9OA 1WFQA 3G6EA 1DZ1A 2A68C 1XNQQ 1Y1VB 3F1ZA 1LTSD 2FINB 3C1FA 4DR6L 1T5XD 2L15A 5IP9G 2HCIA 1UE6A 4JI0L 3CD6A 5DM73 4A3IG 3Q24A 4LF9L 4A3FB 4NW2A 5JJKA 1SNOA 2CWAA 2KEEA 4DR7Q 1PMRA 1LT6D 2R7FA 3AMUA 1HNWL 1P16A 3K6OA 3J7AV 1FJGL 1TQOA 1OXUA 4NP5A 4ZUIA 5JJZA 1IKMA 1HTPA 3AYHB 2V4DA 4FDBA 1SE3A 1XMQL 1Z9FA 4V190 2WKDA 5M5YH 1SMYD 1VQDA 3S14B 5CV8A 1VQMA 3KDFA 1JB3A 2Z4HA 2N8NA 2R3ZA 3DEOA 2NWGA 4NDXA 4Y52H 2ZTCA 2F0DA 4A4IA 5IYDH 5C44B 3A0JA 3ZYYX 1BF4A 3KBXA 4LMQD 1UEAB 3K7UC 3GTGB 1TY2A 3GQBA 4JYAL 2DN8A 1GHKA 4B3RQ 1B44D 4AYBE 2BH2A 1AE2A 4OXPA 5M5WB 3KK7A 2R7ZB 1VQNA 4O2DA 3GTQH 1JB7A 2OEOA 2JA7G 4DV6L 1DONA 2B2TA 3ND9A 3PUYA 3SK4A 3R8BA 5FLXc 4A3IB 5AFWA 4IPDA 1TS4A 4IPHA 1C48A 3D6WA 3NP8A 1XX8A 1QOHA 5FJ8H 4NXMQ 1SYDA 2A5HA 2IT1A 2Z6KA 2LMCB 3M4OB 3CMAA 5C4HA 2NUCA 1BOSA 2VQFL 3GTMH 4XTCS 3PO3G 1SJED 4DV1L 3NE5B 2PMZE 4DN4M 5DNFA 3E6ZX 3TP5A 1B7YB 4IUPA 4HJAA 3HP3A 1Q8IA 5NUCA 2RDHA 1Q7YC 2JN4A 4V0BA 1VQ5A 1JCKB 4R8IA 1PRTB 1Q1BA 1SXTA 3H6MA 3F8TA 3D4RA 4IFDH 3JAME 4DUZQ 4YWLA 1BXTA 2NZ1D 5FOBB 3BJUA 1X32A 3F2CA 1I4PA 2EYOA 1PRTC 1KLGD 1I3QB 2K1BA 3PUXA 1YNJC 3GO5A 4JI5L 1WJJA 5D14A 1O7ZA 3PMFA 2NTSA 3I4MH 5ELFA 2EXZA 2B29A 2QILA 3TSSA 1D8LA 3EBEA 2JA7B 4XT1B 4QB4A 3M4QA 3NUCA 5F2DA 1KLUD 4CJ2C 4S3SA 3MHBA 1O78A 3U50C 3ICEA 1I6VC 1DD2A 1YNNC 5LMUL 3I4LA 4DK3C 4ZYSA 5GAGC 3CMEA 2R93H 4C1NI 5KGUA 2PO4A 2YYZA 4DGZA 1D7QA 1I4HA 5C3EH 1XMOQ 4LUVA 3UDXA 3CCJA 1XTCD 2R92G 3PO3B 2VW9A 1I4XA 1JORA 2F03A 3A74A 2L1BA 3RD4A 4ZKBB 1W2BA 3FKIH 5IT9c 2E2IB 3TEHB 1F2MA 4TRDA 1SR3A 4Q0FA 1K0SA 2PZWA 1F9PA 1FNWA 4HMIA 4RCOA 1L2FA 2A1AA 1G6PA 4C3JG 3DM3A 2X6LA 3OSOA 4EQNA 4DUYQ 4EX5A 4P74A 4XIGS 5CV7A 4J8QA 4PMCA 3CQZB 1L0WA 1CA5A 1GUTA 3P1HA 2G5DA 4CDFC 4LK1C 3OW2A 2ZJRA 1I94L 4QY7A 1HH2P 1PH7A 5CV4A 5AJ3L 2EY6A 2LKVA 5IGGA 3CCRA 2K01A 3M3YH 4JG2A 1I50B 1TVXA 4B3SL 2PCFB 2HQEA 5DAUA 1VQJA 4G7ZC 4X66L 3QO2A 4IFDI 4A3KG 3T1YQ 5EKLA 2UU9Q 4HJ8A 1CHPD 1WTPA 3NBHB 3X3MA 3ULJA 4BY1H 2VUMH 1N34L 1BCPD 2NVQB 2NB0A 4KV6A 5KYLA 2NZHA 3K5OA 1J8IA 1DOLA 2G9HD 5JPMC 1CA6A 2JA9A 1H9SB 4L5SA 3FP9A 1VMCA 2R61A 1PTOD 3G7LA 4RMFA 4M1UB 3K81C 3GV3A 4OONA 4X6AH 4XYOA 2WINB 1LTAD 5C4XH 1A3UA 5C0XJ 4K2KA 4DXGA 1F2LA 3QOJA 4X3UA 1VQKA 2ZXPA 4DV4Q 5IT9L 2A6HD 5KEEA 4JI7Q 3M4PA 5ELNA 1X56A 2K7VA 4LF8Q 3VR2A 2HHHL 3E9HA 1MJCA 3WWVA 4EGVA 1I5FA 3GV6A 2K28A 1Q82C 2K5VA 4DR4Q 1Q3LA 4FXGC 4JBMA 1KHIA 3A7AB 1VDZA 3IFDA 2IX0A 3T16A 3F2UA 1Q81C 4YY3L 3PF5A 2AQ2B 3W1GA 2RF4A 3X3NA 4JVZA 2AUJD 5IODA 1CK1A 1WCMG 2QW7A 5IIFA 1PFBA 4GN3B 1G8ZD 3PO2H 4BXXG 3I91A 1HTLD 4YWKA 4X65L 4A3KB 2BA1A 1JJ2A 3HOWB 1EY5A 3NEMA 3HOVG 4QCLA 1EIHA 4NPSA 4UDUC 3LWEA 3NK9A 4GNXC 1M1KC 1KXLA 2JEAI 1RIPA 2SNMA 4ZAIA 5C3WA 4OX9Q 4HJ7A 3S16H 2Q2TA 3J81j 5I9OA 1CT1D 4R4OA 2EY5A 5EPKA 2J4XA 2K33A 2E2HB 2CWPA 4PMBA 1N8RC 1MJEA 1X3FA 4U68A 3E0JA 3K0XA 1Y14B 4DV0Q 5BR8Q 3C46A 1PFNA 3CCVA 4JK1C 5FO8B 3S17B 4M8AA 3S15B 3H3VH 1Y69U 1O7YA 2PNRC 3D8GA 3GTJB 1KDCA 3CKIB 4DR1L 4ME5A 1PZID 4WORA 3J7A5 2EYLA 3KF6B 3T53B 2CH4A 1EWHA 1DXMA 1WCMB 2UUCL 5FO7B 5M3FG 3W5OA 3CC7A 2JEBI 1BBWA 2H5XA 3K80C 2B8FA 1IBLL 1GUOA 4OHJA 3ERSX 1SBBB 3HG9A 1LTTD 1CM9A 1CSQA 5IWAL 3URYA 4K6LA 3TN2A 2UUBQ 1STEA 3MXPA 1HUNA 4A3EG 1IBKL 3K5LA 3FRPB 1EIYB 3K5MA 1MSGA 3O13A 4TQUS 3MA2B 4I65A 5EKIA 5J39A 2Y0SG 3KFUA 3QR8A 3I4NB 2UXCQ 1BUVT 4JI1Q 3TMEA 1LTLA 2J7ZA 5CV6A 1J5EL 1ZXTA 2MPMA 1QVFA 1JJCB 4B9WA 4A3LG 5C4JB 1TWHB 3SE0A 1H9KA 1D6EC 5FLMH 1STAA 3NTIA 4HTHA 1I6HH 2XNAC 2ZJPA 1B1ZA 4EQPA 1WTXA 1PFMA 4FP5D 5JPNC 1F77A 3J80i 4A3CG 3GTPB 4A93H 1U5KA 1HNZL 4LWCA 3QJYA 1QE6A 3FPUB 4PV1C 2NN6H 1VQIA 4DV2Q 4O0AA 1M8AA 1B9MA 3NWTA 5JJIA 2A6ED 4CJ1B 3CCMA 4C56C 5IP7G 3TP6A 3S1MH 1EY7A 3TP8A 4GKKL 1JICA 3GP7A 4P71A 4POFA 1VQ4A 1RJTA 5M3FH 2XWBB 4ME3A 1WI5A 4GLXA 1X54A 2EYMA 2UXDQ 1RL2A 3HOZH 3NBHA 3P20A 1S3OA 4DR5Q 2LY7A 4WJ3M 3DWQA 2O5JC 3PUWA 3H3VI 1R4PB 4DV5L 1H9SA 4A3EB 4R4QA 1YJNA 5C6AA 4HSVA 2F0GA 1HHVA 4DR2L 3R2IA 2A69C 2F52A 3MXUA 3UDFA 4ZKCB 4X62Q 2UXBQ 2L9HA 3JC66 2F0OA 4C3HG 2IWHA 4R4IA 1IBML 4DKAC 1N36Q 1QZGA 4QUFA 4A3JG 1EQRA 1IW7C 3PIOA 1HFNA 2B63G 2OWOA 1BR9A 2F0NA 4GKJL 1KRTA 3K7AH 3N52A 2F4VQ 1WTOA 1HRJA 1C4QA 2ICIA 1VQLA 1K83H 1BDOA 2VQEQ 2HQLA 4B08A 3J80L 2QA4A 4A3MH 4LFCQ 2MO0A 2IPKD 1ET9A 2B2WC 2RSNA 2D62A 1PH5A 1AH9A 1IYUA 2OQ0A 5IGFA 1N9WA 3CPWA 4OIJA 5EPLA 2V1CC 1U0LA 2KEDA 3Q22A 3T56B 3M85A 2K52A 1E1TA 3PGZA 4MNOA 4FXDA 3EA6A 1F9SA 1BBXC 3VR5A 3DWAA 4KY7A 5LMNL 3FPPA 4C2MH 1V1QA 4ZUJA 1XNRL 1TT2A 2F0IA 2YTXA 1Q90A 4C3HB 4IUQA 2Z1CA 2F0JA 3S2HB 4WFN3 4IURA 1N32L 4UP9A 5FK9C 1NY4A 4A76A 2F0SA 1HR0Q 4A3JB 1KNAA 1SAPA 3A54A 2B63B 5K36G 3MXGA 5EGTA 4C3IH 4KTAA 2BE5D 3PIP3 2IY5B 4DR3L 1WVLA 2QKIC 1EU4A 4RFBA 4BBRH 4DK1A 4RGTA 5C44G 2AUKA 4LF9Q 4OWXB 4ILWA 3L7ZC 1WD0A 4JI4L 2EQSA 2BOSA 2B2UC 1WTWA 1KAAA 1CI3M 2M00A 2D9UA 3MVVA 1G291 1H9JA 3Q6SA 3L3OC 3SK6A 1KRSA 3MTSA 3TDQA 3Q23A 2IX3A 1NR4A 5EKKA 3S1QB 1Y1VH 1H95A 2LSSA 5M3MH 1Y8OB 2K5DA 1LTBD 1XMQQ 3HOYB 1KD1C 2ZM6L 4FO2A 2Y0SE 4A3FH 2PQAB 4MTNA 1K0RA 3TZUA 3A8KE 4ABNA 4CDEC 5IGEA 2ZTEA 3BYYB 1Q46A 1E2WA 4YWMA 4KN7C 4Y7NB 2AWNA 4Z9CB 1QVGA 2AHOB 2UUAL 1EY4A 2FXQA 4UPAA 4JC0A 1B2TA 5IGDA 4LF5L 3WOEA 1O7LA 4JI8L 2B2YC 1F2ZA 1RODA 4JYAQ 1Z7TA 3BS1A 5EJWA 3KLSA 1VQBA 5I4DA 5E1FA 1NTGA 3S14H 4X3SA 3RNUA 3H15A 2EE1A 5IYCH 1PVOA 4DV6Q 3HOUH 2O4XA 1CKOA 4F8MA 1EY6A 5CV9A 2QF7A 1D5XC 5C44H 3F2BA 4JI2L 3FMCA 1EY9A 5D3IB 4HCSA 3PIO3 1S5BD 1C9OA 3GTGH 3H0GB 3Q8DA 4DV7Q 4HJ5A 2B39A 3EVQA 1QVCA 4H7BA 3KOJA 2A68D 5M5WH 4O42A 2R7ZH 4FXKC 3TREA 2VQFQ 1UUPA 4DR7L 3G4SA 1E22A 3G71A 4HIOA 2MP1A 1CTMA 2JP1A 1DGSA 1D2BA 1LO5D 4BWGB 4HSPA 5IP9H 3UDGA 3HOXG 1WTHA 4A3IH 1EYAA 4X64L 3IL8A 1B8AA 1VQAA 4A3BB 1EL0A 3I4OA 3NPPA 1SNQA 2D2CC 1HR0W 4P72A 2F0TA 1A3TA 3JAMc 3GD7A 1D1IA 4MZ9A 3EQLC 1A6XA 1ENAA 1LACA 5CBAE 5M5XB 1D5MC 2HDLA 2AKWB 5J1ZA 5EBDA 3J7YW 1QILA 5GROA 3M4OH 1A63A 3OOCA 1EQTA 2SOBA 2CQOA 2AQ1B 2F0FA 2N49A 5BN4A 1C8CA 5D3DA 1SYFA 4JI5Q 4KY6A 1V43A 3CRLC 3NSWA 1GKHA 4HIKA 1PHJA 1H9MA 3T4AC 2B2WA 3MAQA 3S2DB 3NQIA 4K14A 3AFPA 4OO1G 2Z9HA 2JA5G 1SNDA 3C2PA 1SROA 4L5TA 2KVMA 2JSOA 3BU2A 2WP8J 3GTLB 4R9WA 4DPGA 4K0KL 2F0MA 2ZT9C 2DJGC 1KC8C 1EIFA 2HT1A 1T5EA 2JYOA 2BA0A 1S5CD 3KLSX 5LMUQ 4B3TL 1L0YB 2O2LD 3OTOQ 1I3QH 2K5QA 4DFAA 2Z6BA 2CHBD 4HAEA 2N3SA 1JWSD 1M4VA 2K50A 2RCFA 3NENA 3MXNB 3IRBA 4Q5VA 2K5HA 3NTKA 2FHTA 1HZ9A 2SNSA 2JA7H 4LF4Q 2Q8RE 1ILQA 1EQVA 1ML0D 3HOXB 1DM0B 3PSIA 5J3BA 2Q2IA 5EPJA 5C0XG 4G7HC 4KJNA 2LFNA 1N33L 2B2VC 5FLXL 2HDMA 3E3XA 4JCVE 1U4PA 2BH8A 1EZ8A 5LL6S 2JA6G 3OWFA 1KIXA 2RHSB 1LABA 3HRZC 5T1IA 4IFDJ 3PO3H 3VR6A 4ZRZA 5ELOA 3STBD 4DUZL 1ENCA 3KUPA 1AE3A 3M7NA 3CC2A 3WOFA 2EYPA 1B4OA 3OWEB 3K59A 1JQYD 2E74C 1MBYA 5AJ3Q 2B2UA 5FO9B 2JA5B 1PTOB 4OL7A 4TSSA 2VNUD 1CZWA 1I4QA 1STBA 1PRTD 4X66Q 1BCPC 1V8QA 4H02A 1LT5D 1GUNA 2ENBA 3RR5A 1PYBA 2M2LA 4DNTB 2HIXA 4NB3A 1F2YA 3CQZH 1PTOC 1SDFA 4HR7B 1N34Q 1QUQB 3GDEA 4RAUC 4XYQA 2PZTA 3BZDB 3U4VA 2I0QA 2K14A 3LGJA 4U673 4FF3A 1I50H 1TWAB 3DM1A 1CSPA 1DYQA 1GJXA 3PQIA 3EN2A 2AWOA 3A8JE 3S1RH 1MI2A 1YNND 2PQAA 2Z4IA 1K8AC 5DLQE 4B9XA 2KUMA 1NR2A 3W2DA 3HOWG 2KCCA 1V1OA 4IZ8A 4QIWB 4DAVA 1R9TB 2ZTDA 2PZUA 4RGMA 2K4KA 2NVQH 2EJMA 1K3BC 5JAVA 4ALPA 4PZ6A 1M90C 2OXPA 1SNMA 5IT9E 2NZOA 1X6OA 2RHQB 1MIUA 2HHHQ 2JA6B 3M3YB 1B3AA 1GUGA 1QCBD 2R92H 2QEXA 1KDAA 4GN4B 4DUYL 1QB5D 4R4CA 4YY3Q 3W3AA 1SEBD 4HEDA 1YBYA 4IN3A 1NNXA 3J7ZC 4BY1B 1VQHA 3I90A 1EQQA 4GZYC 1YITA 4C3JH 5E4XA 4CDCC 1HZBA 4P73A 1IYVA 1OXSC 4X65Q 4L5RC 1TWFB 4K5XA 3TBIB 4YCUA 3SXHA 2OQKA 2QDBA 5G3LD 5IOCA 5IYBG 4OGQC 1Q12A 3T13A 5C4XB 3NWSA 3RLFA 1W3SA 4RCNA 3RZDB 2L12A 1GO3E 1NJIC 4B3ML 4LAAA 1ASYA 1FGUA 1GUSA 4NXNL 4CKBA 1XYIA 4GOPB 2E76C 3S1NB 4BA2I 1EYGA 4ZLTF 3V96A 4EVOA 2WB1G 1VQPA 3BG3A 4A3KH 1Y8NB 3HS0C 1TWCB 3LWUA 4XT3B 1SFOH 2I5MX 5JVH3 4GOPC 4GNXB 5HURA 1ZYRD 5GAEC 1TR5A 5ELDA 3T1HL 1TU2B 4RA8A 4APVA 1XWEA 4H44C 1LM0A 2FJ2A 2PW7A 1HPCA 1D1KA 1VQEA 4KI0A 3BDCA 4MTKA 4CGYB 3BDLA 3EROA 3CRKC 2JK8A 5COYA 1HJPA 1RDPD 4KMUC 3I4NG 3A55A 4A3GG 2OF1A 2XIWA 2VL6A 1X65A 3KJOA 4DR1Q 2RCNA 1STHA 1WTQA 1ET6A 1STYA 1PLFA 3SK5A 5T1GA 1EFID 4JV5L 4JI3L 3TZDA 2UUCQ 4I7ZC 1IHZA 4PQXA 1JOOA 2N55A 1SYBA 2I5HA 1IBLQ 1E0BA 4IUTA 1S4ZA 1TS5A 1SYEA 4R1JA 3N6RA 3S17H 5IWAQ 3S15H 2PNHA 4JBKA 3GTJH 4BY7G 4CKEA 1HXYD 1IBKQ 1GHJA 3MXNA 4QIWE 3TRZA 4N8FA 4DU9A 3GTOB 4UAIA 2NVTB 1BVSA 1J9OA 2B2VA 1WCMH 4K6DA 2EY1A 2NVXB 3BVGA 3BDOA 1G51A 1J5EQ 4JOIC 4BXXH 2WB1B 2D5DA 2IHFA 2CW0D 1SE4A 4PZ7A 3I7FA 3MEHA 5L37A 2Q8TA 4OX9L 3HOVH 1GUWA 4POGA 4XXEA 2EJGC 1IL2A 5A35A 2VB2X 2N88A 1VQ7A 2BDNA 3VA5A 2MQHA 4K8JA 2DNCA 1DCZA 3PIPA 1GVPA 1NBWA 2NYZD 1HNZQ 3H3VC 1U4RA 4RWSC 1HNXL 2JA8G 4PNYA 3I4NH 2E5LL 1PH6A 3EFXD 3SGIA 4A3GB 1YJWA 4QGUA 2IW3A 4JPBW 3AB9A 2CH4W 5C4JH 1TWHH 2L5TA 4P2CB 1EWIA 1LTID 5I6WA 1K28A 2A74C 3GTPH 4LF7L 4UY8C 3I3CA 1GOZA 1PZKD 3G48A 3OIPA 2Q2UA 1QUQA 2D0OA 1Y8PB 4H13C 1ICFB 1I4RA 2F1MA 4DV5Q 4BY7B 4DR2Q 2XVSA 4BBSG 1I6HB 5H1SE 4MHEA 5C3XA 2ALYB 2UUBL 3TS2A 1JJGA 1CKNB 2WAQG 2KCNA 2E2JB 1RD9D 4P75A 1X55A 1S40A 2MGSA 3I2ZA 1P8LA 3IKJA 2E75C 1U9RA 3CW2C 4GKJQ 1GXDC 1K73C 2WACA 4RH6A 1L1OB 4A3EH 5KNDA 2R7DA 1HA6A 2EPBA 1EUJA 3D4WA 5JVG3 1E24A 1IL8A 2DY8A 1NCVA 2M9VA 4IUVA 1S5DD 2D0PA 4AH6A 5JJLA 1LUZA 1CFMA 4RG1A 3J80E 2JA8B 1L1OC 5GAHC 3HOZB 4RKBA 2ZJQA 4KHPL 4CKCA 4A3LH 5JOBA 5E3FA 1SYCA 2VXWA 3BZCA 4KD4A 2RKSA 1EYDA 5BN5A 5IY0A 2I46A 2RDFA 4LW1A 4GS3A 3PUVA 2EZVA 4A3CH 3HFZB 2B2TC 3HZXA 2N78A 2NVYB 3DUZA 1S72A 1FR3A 5C5MA 2YU9B 1FGBD 2F3IA 3GTKB 1DOKA 5LMNQ 1FNUA 4KKTA 2BCOA 3D3RA 3AQQA 2ZXRA 2WB1E 4LF6Q 1ESRA 5IP7H 4GOPA 4A3DG 1NAPA 2OTJA 4DK6C 4BBSB 1XNRQ 1G2TA 1RCVD 3FVQA 1EZ6A 3PV0A 2C5CA 2WAQB 1N32Q 3MFGA 3PCOB 4GNXA 4A3MB 1Y1WG 3HOYG 2WIIB 5JEAG 2SEBD 2I5LX 3EIVA 1KTKA 3C1EA 4K5WA 4DR3Q 1UAPA 2A69D 1XXGA 5A2QL 3J81c 5KRUA 4LUZA 3I8ZA 1EFWA 3VYTA 2Q2HA 3KYHC 5CC4A 2F4VL 3A8IE 3FHWA 2AQ3B 4C3HH 1VQFA 3L2PA 4JI4Q 3S2HH 4DAYB 2VQEL 2C9OA 4CJ0B 4F7XA 3D6CA 3CCLA 4A3JH 1LT3D 1TWGB 4UP7A 3VDYA 3UE1A 2B63H 4QQBX 1L0XB 2K32A 1SYGA 5HY6A 3H09A 4LFAQ 4R8NA 1IZ6A 4DR6Q 1EEID 3BYTB 1BCPF 4JI0Q 2ZM6Q 2GA4B 2RDGA 1TS2A 1B3QA 4JBWA 4YIJA 4JOIA 3K58A 1PTOF 2DNEA 3H0GG 3VA7A 1D5ZC 3F2DA 3RZOH 2L11A 1SMXA 1BKBA 2GVBA 4LFBL 3HKZG 2KHSA 2HCCA 4A3DB 1PH8A 3E0EA 2ASBA 5EBCA 1I4GA 1HNWQ 4JI6L 2QCPX 3SR1A 4LF5Q 1FJGQ 3S1QH 1SMYC 1H9RA 4JI8Q 2KECA 3VR4A 3KBGA 4IO9A 3RLNA 5FKAC 5IYDG 4AQYL 4N9PA 2ATWA 1PH1A 1Y1WB 3G6JB 4IJHA 1B9NA 5LHY1 4A3BG 3P75A 3QOLA 1EIGA 1YHQA 3MC0B 4QL5A 4HIMA 2RQXA 2Z0SA 3OW7A 2SDFA 3NXWA 1SE2A 1SN8A 2DGYA 1GD7A 3OMCA 4Y7NH 1IXRA 1PXUA 1VQCA 1JT8A 2F3WA 4JI2Q 4ODGA 3J81L 4DV3L 1EY8A 5LL6X 4KY5A 5M3MB 2P5ZX 2FMMA 5KIXA 4QF4A 5EQ0A 3AU7A 1RHPA 5JEAJ 5LMNW 3DEPA 2F0QA 1RTNA 5K36H 4LJZC 4IOAA 4XQNA 1BBUA 1U4LA 3FEWX 3EJIA 3J7AF 1G91A 5I2YA 5FJ8G 2VB3X 4ZCKA 2NTTA 4YHHL 1VQ9A 4PZ8A 4X64Q 1A2UA 5HGTA 3BZKA 3AFQA 1XNQL 2XGTA 2WAQE 5ELBA 1JC7A 3H0GH 1SJHD 2F0HA 4OWTB 1K8GA 3U4ZA 1AP0A 1LV9A 2JXMB 5M5YB 1CUKA 3HKZB 2HIVA 3K57A 2CCZA 1CKNA 1JR0D 1S5FD 1XPRA 4QJFA 3OPOA 1UE5A 2RVLA 1BQQT 2EIFA 1YEZA 3HOUB 1FL0A 3Q0AA 4DV1Q 4HCEA 1BNZA 4IFDG 1NE3A 1B50A 4G57A 1TY0A 1ICWA 2E8GA 2MFIA 4A3BH 1NMGA 3MWYW 1L1OA 1IYJB 2EJFC 1O80A 3UE0A 2A19A 1PH4A 1ASZA 3A5ZB 2LXKA 1PDQA 5M5XH 2E2DC 4MN3A 3KF8B 1TXYA 3JAMi 3I4MG 4KLKA 4K0KQ 1W6JA 2KCMA 3GTQB 4KKUA 1B70B 3RLOA 4B3TQ 4DNIA 1EYCA 5CV5A 3LX0A 4ULLA 1KL9A 1JWUD 1RF2D 5M9OA 3ITPA 2EXDA 2FFKB 3S2DH 2LXJA 3ND8A 1EWCA 3B6YA 4DV7L 1PH2A 4B3RL 2R93G 2IL8A 1G2SA 5I9PA 4ZQ3A 3SK8A 1VF7A 2PW5A 5C3EG 3GTLH 2AMCB 1WD1A 3GTMB 1SSOA 4OELB 5CYUA 4J1MA 4NKLA 2ICEC 1N33Q 3FKIG 1A0IA 1LYLA 3TP7A 3STBC 3HEJA 3HGBA 4AIMA 5FLXE 1X3PA 2CVRA 5J22A 5ELCA 1VQ8A 2KA7A 2CKZB 1A3VA 3CU7A 4DAMA 5GADC 4NXML 2F4IA 1X3EA 3PF4A 3HOXH 1RKNA 2RBMA 4JW0A 4NMZA 1JE4A 1PZJD 4IUNA 1WYDA 4J15A 3D0FA 1O7IA 5CMDA 1AN8A 4WJ4A 2QDLA 2A73B 3BVMA 3CAMA 2KCTA 5KYIA 1ENFA 4KJOA 3DXJC 1OO9B 1F9QA 3I4MB 1UE1A 4O1NA 4DAYA 5E4WC 3V2TA 1FD7D 1DJRD 2XN9C 2MJ8A 3JAML 1GM5A 2HD3A 3NTHA 2PQEA 5GQOA 1OXTA 1NMFA 3QIAA 4FNFA 1BCPB 1YHAA 4IJLA 1I94Q 2E2IH 3OTOL 3M4YA 1VQ6A 4BY1G 2VUMG 4OO1H 1A62A 2DJFC 2K03A 3FDTA 2JA5H 2I07B 1PTOH 3K8AA 3I55A 2R93B 4B3SQ 2KHJA 3HKZE 3CC4A 1JOKA 4FVMA 5C3EB 1STGA 1UE7A 1V9PA 5E7NA 1TS3A 1YNJD 4N8X1 4BS9A 2CFMA 4LF4L 2EDGA 1YNXA 1PH3A 5C4XG 3AEVA 1DOMA 2IJ0A 3FKIB 1X3GA 5CORA 1LTGD 1XTDA 2WKCA 1FYCA 3CCQA 4UHVA 1TWAH 4LNQA 2OT2A 1SNCA 4QMGA 2HUGA 5CR3A 1V1PB 3VYUA 1A8VA 1YHBA 1VQOA 1XMOL 2A6HC 2VZAA 2G9DA 4DAPA 1R9TH 1KABA 2B2YA 5C0XH 3CCEA 3R3OA 4PMWA 4CBVA 3SVMA 2YTVA 3R2TA 2WFWA 4IPGA 4PG3A 2JA6H 5KNCA 1YIJA 1EEFD 2L0CA 3NHHA 3S1RB 3PO2G 2TSSA 1NUCA 4B3MQ 3UI2A 4NXNQ 4HN7A 4RHRA 3LNNA 5ISRA 3OYYA 1BO0A 1OXXK 2VUMB 2L4NA 1E2ZA 1ZYRC 3S9WA 1Z6HA 1S5ED 2PI2E 3A7LA 1A15A 3TQYA 3DHQA 2K75A 2MO1A 1Q1EA 1TWFH 2F0UA 2R92B 1RTOA 2RSOA 1SNPA 1CHQD 1YZ6A 3CF5A 3T1HQ 2K6AA 3D31A 4CDDC 2F0LA 1G6ZA 1STNA 5EAYA 3V05A 5IGBA 3RZDH 3U58A 4C1NK 1PYWD 3ONAB 1KAWA 3T1YL 2UU9L 3TS0A 4R4TA 3L9AX 4MIUA 2K5NA 3S1NH 4OO1I 4C3JB 3K5NA 4L6TB 1X3QA 2F3VA 1K8OA 1K3RA 3ER0A 3U9SA 3DLLA 1TWCH 1UNSA 3HOWH 4FF4A 4JV5Q 3KLWA 2H4OA 3KLRA 3QB3A 4JI3Q 3CPFA 2JQOA 3QG1A 1WOCA 5TSSA 4ZK9B 3KF8A 4L8JA 3OHXC 4XDXA 4LUOA 5C4ZA 5IGCA 1MKHA 1C7YA 2EVBA 4DV4L 1AZPA 4JI7L 2ID0A 1SRUA 3PO2B 4LF8L 1LLRD 1QNKA 1SFOB 1MD2D 3RUZA 1VQGA 4DR4L 1HZAA 4EQ5A 4DXFA 1HQMC 3I70A 5C0XI 4TVAB 2E2HH 2CW0C 3WDNA 4KHVA 1T9HA 1FVIA 1PA6A 3ULLA 3T51B 2X69A 4F87A 2RA4A 2XWJB 2PPBC 1CQFA 2VS1A
chains in the Genus database with same CATH topology
3H15A 2N78A 3TEHB 5IYCH 1S72A 2PI2A 1PVOA 5IYBH 1SR3A 4DV6Q 3HOUH 1C0AA 1CKOA 2F3IA 1JE5A 2YTYA 5LMNQ 1OXVA 1L2FA 5C44H 1SLJA 2A1AA 2QGQA 3F2BA 4JI2L 3GTOH 1G6PA 3AQQA 3DM3A 5FLMG 2NVTH 4LF6Q 2WB1E 5IP7H 1C9OA 4GOPA 1XJVA 1HNXQ 3NELA 3GTGH 4DUYQ 4A3DG 2NVXH 4EX5A 4DK6C 4P74A 2OTJA 3Q8DA 2E5LQ 4XIGS 1XNRQ 1E1OA 4DV7Q 4HJ5A 1QVCA 1L0WA 3RN2A 4A93G 3KOJA 5M5WH 3PV0A 2R7ZH 3CCSA 1N32Q 3PCOB 3TREA 2VQFQ 3OW2A 2NN6G 2ZJRA 1I94L 4DR7L 3G4SA 4GNXA 4QY7A 1HH2P 1E22A 1Y1WG 3G71A 1PH7A 3HOYG 4HIOA 5JEAG 2I5LX 1DGSA 3EIVA 3A5UA 5AJ3L 3CCRA 1KQSA 1UEBA 3M3YH 4JG2A 5IP9H 3HOXG 3UDGA 4B3SL 4A3IH 4IPCA 4DR3Q 3J81c 4LF7Q 4X64L 1B8AA 1VQAA 1VQJA 3I4OA 4X66L 1HR0W 4IFDI 4LUZA 4A3KG 1EFWA 1EOVA 4P72A 3T1YQ 3KYHC 2UU9Q 3UDIA 2F4VL 4HJ8A 3JAMc 4DV0L 3GD7A 3FHWA 3NBHB 5BR8L 3HOZG 4A3GH 4MZ9A 4C3HH 1VQFA 3ULJA 3L2PA 4BY1H 2VUMH 4JI4Q 1N34L 3S2HH 2AKWB 4DAYB 2VQEL 3M4OH 5GROA 2NZHA 2R6GA 1A63A 4GKKQ 2KENA 4GLAC 2CQOA 4YCWA 4A3JH 3CCLA 2JA9A 4UP7A 3VDYA 3UE1A 4L5SA 1J6QA 3S24A 3FP9A 1XPOA 2N49A 2B63H 2GVAA 4QQBX 4RMFA 4JI5Q 5HY6A 1V43A 3K81C 1GKHA 4OONA 4LFAQ 4HIKA 1PHJA 4X6AH 1IZ6A 1YI2A 2HHHL 4DR6Q 4DR7Q 5C4XH 3AFPA 4GN5A 4OO1G 5C0XJ 2JA5G 4JI0Q 2ZM6Q 1SROA 1CKMA 2B3GA 4L5TA 1VQKA 4BY7H 1UWVA 4JBWA 3BU2A 4JOIA 2WP8J 1PH9A 4DV4Q 4OWWB 1XPUA 4DPGA 3H0GG 4JI7Q 3M4PA 4K0KL 5ELNA 1KC8C 1EIFA 3J80c 2HT1A 3F2DA 1X56A 2BA0A 3RZOH 4LF8Q 1SMXA 1BKBA 2GVBA 5LMUQ 4B3TL 3HKZG 3E9HA 3OTOQ 1JMCA 3KDFB 2KHIA 1MJCA 1I3QH 4GLVB 3WWVA 3E0EA 1PH8A 2ASBA 1HNWQ 1I5FA 3CXCA 1YJ9A 1Q82C 2E2JH 1IBMQ 4JI6L 2K5VA 4DR4Q 4JBMA 2N3SA 1KHIA 4LF5Q 4KHPQ 1FJGQ 3E9IA 3L0OA 4A3MG 3S1QH 2K50A 4JI8Q 2IX0A 4IO9A 3NENA 3MXNB 3IRBA 3RLNA 4YY3L 1Q81C 1PFSA 5IYDG 4AQYL 2ATWA 2K5HA 3PF5A 2UXCL 1PH1A 4JI1L 1VS0A 3W1GA 2RF4A 4IJHA 1HZ9A 2JA7H 4LF4Q 4A3BG 2MNAA 4HJ9A 1WCMG 1YHQA 4YCVA 3PSIA 4QL5A 4HIMA 4GN3B 2Z0SA 5J3BA 3PO2H 4BXXG 2Q2IA 1SN8A 2DGYA 4YWKA 1GD7A 4X65L 5C0XG 2IX1A 2BA1A 1JJ2A 4Y7NH 1IXRA 2JA8H 1VQCA 1JT8A 3NEMA 1N33L 3HOVG 4JI2Q 2ES2A 4IOCA 4JCVE 4DV3L 4NPSA 2BH8A 4AYBG 2A8VA 2JA6G 1KIXA 2RHSB 4IFDJ 4DV2L 5JEAJ 5LMNW 3PO3H 3PUZA 5ELOA 4GNXC 3STBD 1M1KC 1KXLA 4DUZL 2JEAI 1RIPA 3RN5A 4IOAA 1X9NA 1AE3A 3M7NA 3CC2A 1SE8A 1BBUA 2NVYH 4OX9Q 4HJ7A 3S16H 2Q2TA 3J81j 5FJ8G 2YU9H 5AJ3Q 3GTKH 4R4OA 4YHHL 3I56A 1HZCA 1VQ9A 4PZ8A 2VNUD 1Z47A 2UXDL 4X64Q 3AFQA 3BZKA 4X66Q 1XNQL 2XGTA 2WAQE 4H02A 2CWPA 4DR5L 3H0GH 1N8RC 1MJEA 1X3FA 3RR5A 4BBSH 1PYBA 2Z6KC 3K0XA 1Y14B 2HIXA 4OWTB 3U4ZA 4DV0Q 5BR8Q 1K8GA 4NB3A 3CQZH 1CUKA 3CCVA 2HIVA 2CCZA 1CKNA 4A75A 1N34Q 1XPRA 4QJFA 1QUQB 3CP0A 4BBRG 3GDEA 3ZJYC 1UE5A 1OTCA 2EIFA 2YV5A 3H3VH 1YEZA 4X62L 1FL0A 3U4VA 4DV1Q 2I0QA 3ULPA 2K14A 1QZHA 4IFDG 3LGJA 2UXBL 1NE3A 4DR1L 1I50H 1E3PA 3J7A5 1CSPA 1N36L 2MFIA 1VCIA 2E8GA 3EN2A 1YVCA 1NMGA 2AWOA 1L1OA 3KF6B 1IYJB 3MEFA 5IE8A 3S1RH 2PQAA 2UUCL 2KBNA 3UE0A 5M3FG 2JE6I 2A19A 5DLQE 1K8AC 3J81i 3W5OA 1PH4A 1ASZA 3A5ZB 3HOWG 3CC7A 2JEBI 5HGQA 1BBWA 2H5XA 1E7ZA 2ZTDA 2JJQA 2LXKA 3K80C 1IBLL 2DUDA 4KHZA 1PV4A 1Y1VG 1PYSB 3ERSX 5M5XH 2K4KA 5M3MG 2NVQH 3KF8B 1TXYA 3JAMi 3I4MG 4KLKA 2GN5A 4K0KQ 4ALPA 2KCMA 4PZ6A 1M90C 1CSQA 5IWAL 2NZOA 1TWGH 1X6OA 1B70B 3RLOA 2RHQB 4LFCL 1MIUA 4A3FG 2HHHQ 2UUBQ 4B3TQ 4DNIA 4LFBQ 4A3EG 1IBKL 3CCUA 2NN6I 4JI6Q 2R92H 1KL9A 1EIYB 2QEXA 4HIDA 4LF6L 3KFUA 4GN4B 2EXDA 4TQUS 2Y0SG 3S2DH 4DUYL 2LXJA 4YY3Q 4R4CA 4AQYQ 2UXCQ 3B6YA 4DV7L 4JI1Q 1PH2A 4B3RL 1LTLA 2R93G 1YBYA 1J5EL 3J7ZC 3HKSA 1QVFA 1VQHA 1JJCB 4A3LG 1EQQA 5C3EG 2OCEA 3GTLH 2AMCB 1YITA 2XTIA 4C3JH 4BA1I 5FLMH 1I6HH 1HZBA 4P73A 2ZJPA 1OXSC 4X65Q 1Q86C 4L5RC 4A3DH 4YCUA 3J80i 4A3CG 1N33Q 2OQKA 3FKIG 4JBJA 1A0IA 1LYLA 5IYCG 4DV3Q 3STBC 2UUAQ 4AIMA 5IYBG 4A93H 2VY3A 1Q12A 1U5KA 1HNZL 4LWCA 3HOUG 3RLFA 1W3SA 3M9BA 1K9MC 1GO3E 1NJIC 1VQ8A 4B3ML 1ASYA 1FGUA 2CKZB 1VQIA 2C35B 4O0AA 4NXNL 4DAMA 4DV2Q 1Y1WH 3HOYH 5GADC 5JJIA 4GOPB 3CCMA 4NXML 3W1BA 5IP7G 3S1MH 1X3EA 3PF4A 3HOXH 4BA2I 1Q8KA 4L5QA 1EYGA 4GKKL 4UP8A 4P71A 4POFA 3KJPA 3KF6A 1VQ4A 2IHEA 1HR0L 2WB1G 2OTLA 1VQPA 1WYDA 4J15A 5M3FH 4A3KH 3D0FA 2R7ZG 4YHHQ 1O7IA 4ME3A 1SFOH 2I5MX 1WI5A 4GOPC 4GLXA 4WJ4A 1X54A 4GNXB 3CAMA 4LFAL 1RL2A 5GAEC 3HOZH 2UXDQ 1WFQA 3G6EA 2KCTA 3T1HL 1S3OA 1XNQQ 3F1ZA 4APVA 4DR6L 4DR5Q 1LM0A 4WJ3M 1UE1A 2L15A 5IP9G 1UE6A 4JI0L 3CD6A 4KI0A 1VQEA 4A3IG 3PUWA 1GM5A 3H3VI 4LF9L 4DV5L 2JK8A 5JJKA 2CWAA 4R4QA 1HJPA 1YJNA 4DR2L 5GQOA 4A3BH 1OXTA 1NMFA 2F52A 1I94Q 3UDFA 1YHAA 4IJLA 4X62Q 2E2IH 3I4NG 4A3GG 2R7FA 3OTOL 2UXBQ 2VL6A 1X65A 3JC66 3KJOA 1VQ6A 4R4IA 4BY1G 4DR1Q 2RCNA 1A62A 2VUMG 1P16A 1HNWL 2JA5H 1IBML 3K8AA 4DKAC 3I55A 1N36Q 4B3SQ 1QZGA 2KHJA 1FJGL 4A3JG 4JV5L 1EQRA 1OXUA 3PIOA 3HKZE 3CC4A 4JI3L 2UUCQ 2B63G 2OWOA 3AYHB 4FDBA 4GKJL 1KRTA 1UE7A 1V9PA 1XMQL 1Z9FA 3K7AH 5E7NA 2F4VQ 2I5HA 1IBLQ 5M5YH 2CFMA 4LF4L 1VQDA 1YNXA 1VQMA 1PH3A 3KDFA 1VQLA 5C4XG 1K83H 3AEVA 2VQEQ 2N8NA 4R1JA 3S17H 2HQLA 5IWAQ 3S15H 1X3GA 2PNHA 4Y52H 2QA4A 2ZTCA 4JBKA 4A3MH 4LFCQ 3GTJH 4A4IA 4BY7G 1XTDA 2MO0A 3CCQA 1IBKQ 1TWAH 5IYDH 4QIWE 4LNQA 3A0JA 3TRZA 2D62A 1BVSA 1PH5A 1AH9A 3K7UC 1A8VA 1YHBA 1WCMH 2OQ0A 1VQOA 1XMOL 2VZAA 4JYAL 1G51A 1N9WA 4B3RQ 1J5EQ 4JOIC 4AYBE 3CPWA 1R9TH 2BH2A 4BXXH 1AE2A 3CCEA 4OXPA 1VQNA 4PMWA 2IHFA 2V1CC 1U0LA 4PZ7A 3I7FA 3HOVH 4OX9L 4O2DA 4POGA 2YTVA 3GTQH 2WFWA 4IPGA 1JB7A 3M85A 2K52A 1E1TA 3PGZA 4PG3A 4DV6L 1IL2A 2JA7G 4MNOA 2JA6H 1VQ7A 1YIJA 3PUYA 5LMNL 2MQHA 5FLXc 3PIPA 4IPDA 3PO2G 1GVPA 1NBWA 1HNZQ 4C2MH 1V1QA 1HNXL 4IPHA 4B3MQ 2JA8G 3I4NH 2E5LL 1PH6A 4NXNQ 1XNRL 3SGIA 1YJWA 4QGUA 2YTXA 5FJ8H 3OYYA 4NXMQ 1OXXK 2IT1A 2Z6KA 1N32L 5C4JH 1TWHH 3CMAA 3RNUA 4UP9A 2VQFL 3GTMH 1NY4A 4A76A 2PI2E 4XTCS 3PO3G 1HR0Q 3TQYA 4DV1L 2K75A 2PMZE 2MO1A 1Q1EA 5K36G 1TWFH 1EWIA 4C3IH 1B7YB 1YZ6A 3GTPH 2IY5B 4DR3L 4HJAA 4LF7L 3CF5A 3T1HQ 3D31A 4LFBL 1Q7YC 4UY8C 5EAYA 3RZDH 3G48A 3U58A 1VQ5A 2Q2UA 4BBRH 1KAWA 1QUQA 3T1YL 2UU9L 2D0OA 3TS0A 5C44G 1Q1BA 4R4TA 4LF9Q 3F8TA 4OWXB 4DV5Q 3L7ZC 2K5NA 4DUZQ 3S1NH 4JI4L 4YWLA 2EQSA 4DR2Q 4OO1I 3BJUA 4BBSG 3F2CA 5H1SE 2ALYB 1G291 1K3RA 3ER0A 2UUBL 3TS2A 1JJGA 3DLLA 1CKNB 2WAQG 1TWCH 3HOWH 1KRSA 3PUXA 3GO5A 4JI5L 1WJJA 4P75A 1X55A 3KLWA 4JV5Q 1S40A 1H95A 4JI3Q 1Y1VH 3CPFA 2JQOA 3I2ZA 1WOCA 1P8LA 2LSSA 5M3MH 3I4MH 3CW2C 4GKJQ 2B29A 1XMQQ 1KD1C 1D8LA 2ZM6L 1K73C 1L1OB 3EBEA 2Y0SE 4A3FH 4LUOA 2PQAB 4A3EH 3M4QA 1MKHA 1C7YA 4MTNA 2R7DA 1K0RA 1EUJA 4DV4L 1E24A 4JI7L 3U50C 2ID0A 3ICEA 1SRUA 2ZTEA 2D0PA 4AH6A 5JJLA 1Q46A 1LUZA 4LF8L 5LMUL 4RG1A 4DK3C 4YWMA 2AWNA 1QVGA 1L1OC 5GAGC 2AHOB 1VQGA 5GAHC 3CMEA 2ZJQA 2UUAL 2FXQA 2R93H 4UPAA 4JC0A 4DR4L 1HZAA 4EQ5A 4LF5L 4KHPL 2YYZA 5C0XI 2E2HH 4TVAB 1D7QA 4JI8L 4A3LH 5C3EH 1XMOQ 4LUVA 3BZCA 3UDXA 3CCJA 1T9HA 4JYAQ 2R92G 1FVIA 1VQBA 2VW9A 3ULLA 5IY0A 1PA6A 4LW1A 1NTGA 3A74A 4GS3A 3PUVA 3S14H 2Q2HA 4A3CH 3HFZB 1W2BA 3FKIH 2VS1A 5IT9c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H15 A;  2N78 A;  3TEH B;  5IYC H;  1S72 A;  2PI2 A;  1PVO A;  5IYB H;  1SR3 A;  4DV6 Q;  3HOU H;  1C0A A;  1CKO A;  2F3I A;  1JE5 A;  2YTY A;  5LMN Q;  1OXV A;  1L2F A;  5C44 H;  1SLJ A;  2A1A A;  2QGQ A;  3F2B A;  4JI2 L;  3GTO H;  1G6P A;  3AQQ A;  3DM3 A;  5FLM G;  2NVT H;  4LF6 Q;  2WB1 E;  5IP7 H;  1C9O A;  4GOP A;  1XJV A;  1HNX Q;  3NEL A;  3GTG H;  4DUY Q;  4A3D G;  2NVX H;  4EX5 A;  4DK6 C;  4P74 A;  2OTJ A;  3Q8D A;  2E5L Q;  4XIG S;  1XNR Q;  1E1O A;  4DV7 Q;  4HJ5 A;  1QVC A;  1L0W A;  3RN2 A;  4A93 G;  3KOJ A;  5M5W H;  3PV0 A;  2R7Z H;  3CCS A;  1N32 Q;  3PCO B;  3TRE A;  2VQF Q;  3OW2 A;  2NN6 G;  2ZJR A;  1I94 L;  4DR7 L;  3G4S A;  4GNX A;  4QY7 A;  1HH2 P;  1E22 A;  1Y1W G;  3G71 A;  1PH7 A;  3HOY G;  4HIO A;  5JEA G;  2I5L X;  1DGS A;  3EIV A;  3A5U A;  5AJ3 L;  3CCR A;  1KQS A;  1UEB A;  3M3Y H;  4JG2 A;  5IP9 H;  3HOX G;  3UDG A;  4B3S L;  4A3I H;  4IPC A;  4DR3 Q;  3J81 c;  4LF7 Q;  4X64 L;  1B8A A;  1VQA A;  1VQJ A;  3I4O A;  4X66 L;  1HR0 W;  4IFD I;  4LUZ A;  4A3K G;  1EFW A;  1EOV A;  4P72 A;  3T1Y Q;  3KYH C;  2UU9 Q;  3UDI A;  2F4V L;  4HJ8 A;  3JAM c;  4DV0 L;  3GD7 A;  3FHW A;  3NBH B;  5BR8 L;  3HOZ G;  4A3G H;  4MZ9 A;  4C3H H;  1VQF A;  3ULJ A;  3L2P A;  4BY1 H;  2VUM H;  4JI4 Q;  1N34 L;  3S2H H;  2AKW B;  4DAY B;  2VQE L;  3M4O H;  5GRO A;  2NZH A;  2R6G A;  1A63 A;  4GKK Q;  2KEN A;  4GLA C;  2CQO A;  4YCW A;  4A3J H;  3CCL A;  2JA9 A;  4UP7 A;  3VDY A;  3UE1 A;  4L5S A;  1J6Q A;  3S24 A;  3FP9 A;  1XPO A;  2N49 A;  2B63 H;  2GVA A;  4QQB X;  4RMF A;  4JI5 Q;  5HY6 A;  1V43 A;  3K81 C;  1GKH A;  4OON A;  4LFA Q;  4HIK A;  1PHJ A;  4X6A H;  1IZ6 A;  1YI2 A;  2HHH L;  4DR6 Q;  4DR7 Q;  5C4X H;  3AFP A;  4GN5 A;  4OO1 G;  5C0X J;  2JA5 G;  4JI0 Q;  2ZM6 Q;  1SRO A;  1CKM A;  2B3G A;  4L5T A;  1VQK A;  4BY7 H;  1UWV A;  4JBW A;  3BU2 A;  4JOI A;  2WP8 J;  1PH9 A;  4DV4 Q;  4OWW B;  1XPU A;  4DPG A;  3H0G G;  4JI7 Q;  3M4P A;  4K0K L;  5ELN A;  1KC8 C;  1EIF A;  3J80 c;  2HT1 A;  3F2D A;  1X56 A;  2BA0 A;  3RZO H;  4LF8 Q;  1SMX A;  1BKB A;  2GVB A;  5LMU Q;  4B3T L;  3HKZ G;  3E9H A;  3OTO Q;  1JMC A;  3KDF B;  2KHI A;  1MJC A;  1I3Q H;  4GLV B;  3WWV A;  3E0E A;  1PH8 A;  2ASB A;  1HNW Q;  1I5F A;  3CXC A;  1YJ9 A;  1Q82 C;  2E2J H;  1IBM Q;  4JI6 L;  2K5V A;  4DR4 Q;  4JBM A;  2N3S A;  1KHI A;  4LF5 Q;  4KHP Q;  1FJG Q;  3E9I A;  3L0O A;  4A3M G;  3S1Q H;  2K50 A;  4JI8 Q;  2IX0 A;  4IO9 A;  3NEN A;  3MXN B;  3IRB A;  3RLN A;  4YY3 L;  1Q81 C;  1PFS A;  5IYD G;  4AQY L;  2ATW A;  2K5H A;  3PF5 A;  2UXC L;  1PH1 A;  4JI1 L;  1VS0 A;  3W1G A;  2RF4 A;  4IJH A;  1HZ9 A;  2JA7 H;  4LF4 Q;  4A3B G;  2MNA A;  4HJ9 A;  1WCM G;  1YHQ A;  4YCV A;  3PSI A;  4QL5 A;  4HIM A;  4GN3 B;  2Z0S A;  5J3B A;  3PO2 H;  4BXX G;  2Q2I A;  1SN8 A;  2DGY A;  4YWK A;  1GD7 A;  4X65 L;  5C0X G;  2IX1 A;  2BA1 A;  1JJ2 A;  4Y7N H;  1IXR A;  2JA8 H;  1VQC A;  1JT8 A;  3NEM A;  1N33 L;  3HOV G;  4JI2 Q;  2ES2 A;  4IOC A;  4JCV E;  4DV3 L;  4NPS A;  2BH8 A;  4AYB G;  2A8V A;  2JA6 G;  1KIX A;  2RHS B;  4IFD J;  4DV2 L;  5JEA J;  5LMN W;  3PO3 H;  3PUZ A;  5ELO A;  4GNX C;  3STB D;  1M1K C;  1KXL A;  4DUZ L;  2JEA I;  1RIP A;  3RN5 A;  4IOA A;  1X9N A;  1AE3 A;  3M7N A;  3CC2 A;  1SE8 A;  1BBU A;  2NVY H;  4OX9 Q;  4HJ7 A;  3S16 H;  2Q2T A;  3J81 j;  5FJ8 G;  2YU9 H;  5AJ3 Q;  3GTK H;  4R4O A;  4YHH L;  3I56 A;  1HZC A;  1VQ9 A;  4PZ8 A;  2VNU D;  1Z47 A;  2UXD L;  4X64 Q;  3AFQ A;  3BZK A;  4X66 Q;  1XNQ L;  2XGT A;  2WAQ E;  4H02 A;  2CWP A;  4DR5 L;  3H0G H;  1N8R C;  1MJE A;  1X3F A;  3RR5 A;  4BBS H;  1PYB A;  2Z6K C;  3K0X A;  1Y14 B;  2HIX A;  4OWT B;  3U4Z A;  4DV0 Q;  5BR8 Q;  1K8G A;  4NB3 A;  3CQZ H;  1CUK A;  3CCV A;  2HIV A;  2CCZ A;  1CKN A;  4A75 A;  1N34 Q;  1XPR A;  4QJF A;  1QUQ B;  3CP0 A;  4BBR G;  3GDE A;  3ZJY C;  1UE5 A;  1OTC A;  2EIF A;  2YV5 A;  3H3V H;  1YEZ A;  4X62 L;  1FL0 A;  3U4V A;  4DV1 Q;  2I0Q A;  3ULP A;  2K14 A;  1QZH A;  4IFD G;  3LGJ A;  2UXB L;  1NE3 A;  4DR1 L;  1I50 H;  1E3P A;  3J7A 5;  1CSP A;  1N36 L;  2MFI A;  1VCI A;  2E8G A;  3EN2 A;  1YVC A;  1NMG A;  2AWO A;  1L1O A;  3KF6 B;  1IYJ B;  3MEF A;  5IE8 A;  3S1R H;  2PQA A;  2UUC L;  2KBN A;  3UE0 A;  5M3F G;  2JE6 I;  2A19 A;  5DLQ E;  1K8A C;  3J81 i;  3W5O A;  1PH4 A;  1ASZ A;  3A5Z B;  3HOW G;  3CC7 A;  2JEB I;  5HGQ A;  1BBW A;  2H5X A;  1E7Z A;  2ZTD A;  2JJQ A;  2LXK A;  3K80 C;  1IBL L;  2DUD A;  4KHZ A;  1PV4 A;  1Y1V G;  1PYS B;  3ERS X;  5M5X H;  2K4K A;  5M3M G;  2NVQ H;  3KF8 B;  1TXY A;  3JAM i;  3I4M G;  4KLK A;  2GN5 A;  4K0K Q;  4ALP A;  2KCM A;  4PZ6 A;  1M90 C;  1CSQ A;  5IWA L;  2NZO A;  1TWG H;  1X6O A;  1B70 B;  3RLO A;  2RHQ B;  4LFC L;  1MIU A;  4A3F G;  2HHH Q;  2UUB Q;  4B3T Q;  4DNI A;  4LFB Q;  4A3E G;  1IBK L;  3CCU A;  2NN6 I;  4JI6 Q;  2R92 H;  1KL9 A;  1EIY B;  2QEX A;  4HID A;  4LF6 L;  3KFU A;  4GN4 B;  2EXD A;  4TQU S;  2Y0S G;  3S2D H;  4DUY L;  2LXJ A;  4YY3 Q;  4R4C A;  4AQY Q;  2UXC Q;  3B6Y A;  4DV7 L;  4JI1 Q;  1PH2 A;  4B3R L;  1LTL A;  2R93 G;  1YBY A;  1J5E L;  3J7Z C;  3HKS A;  1QVF A;  1VQH A;  1JJC B;  4A3L G;  1EQQ A;  5C3E G;  2OCE A;  3GTL H;  2AMC B;  1YIT A;  2XTI A;  4C3J H;  4BA1 I;  5FLM H;  1I6H H;  1HZB A;  4P73 A;  2ZJP A;  1OXS C;  4X65 Q;  1Q86 C;  4L5R C;  4A3D H;  4YCU A;  3J80 i;  4A3C G;  1N33 Q;  2OQK A;  3FKI G;  4JBJ A;  1A0I A;  1LYL A;  5IYC G;  4DV3 Q;  3STB C;  2UUA Q;  4AIM A;  5IYB G;  4A93 H;  2VY3 A;  1Q12 A;  1U5K A;  1HNZ L;  4LWC A;  3HOU G;  3RLF A;  1W3S A;  3M9B A;  1K9M C;  1GO3 E;  1NJI C;  1VQ8 A;  4B3M L;  1ASY A;  1FGU A;  2CKZ B;  1VQI A;  2C35 B;  4O0A A;  4NXN L;  4DAM A;  4DV2 Q;  1Y1W H;  3HOY H;  5GAD C;  5JJI A;  4GOP B;  3CCM A;  4NXM L;  3W1B A;  5IP7 G;  3S1M H;  1X3E A;  3PF4 A;  3HOX H;  4BA2 I;  1Q8K A;  4L5Q A;  1EYG A;  4GKK L;  4UP8 A;  4P71 A;  4POF A;  3KJP A;  3KF6 A;  1VQ4 A;  2IHE A;  1HR0 L;  2WB1 G;  2OTL A;  1VQP A;  1WYD A;  4J15 A;  5M3F H;  4A3K H;  3D0F A;  2R7Z G;  4YHH Q;  1O7I A;  4ME3 A;  1SFO H;  2I5M X;  1WI5 A;  4GOP C;  4GLX A;  4WJ4 A;  1X54 A;  4GNX B;  3CAM A;  4LFA L;  1RL2 A;  5GAE C;  3HOZ H;  2UXD Q;  1WFQ A;  3G6E A;  2KCT A;  3T1H L;  1S3O A;  1XNQ Q;  3F1Z A;  4APV A;  4DR6 L;  4DR5 Q;  1LM0 A;  4WJ3 M;  1UE1 A;  2L15 A;  5IP9 G;  1UE6 A;  4JI0 L;  3CD6 A;  4KI0 A;  1VQE A;  4A3I G;  3PUW A;  1GM5 A;  3H3V I;  4LF9 L;  4DV5 L;  2JK8 A;  5JJK A;  2CWA A;  4R4Q A;  1HJP A;  1YJN A;  4DR2 L;  5GQO A;  4A3B H;  1OXT A;  1NMF A;  2F52 A;  1I94 Q;  3UDF A;  1YHA A;  4IJL A;  4X62 Q;  2E2I H;  3I4N G;  4A3G G;  2R7F A;  3OTO L;  2UXB Q;  2VL6 A;  1X65 A;  3JC6 6;  3KJO A;  1VQ6 A;  4R4I A;  4BY1 G;  4DR1 Q;  2RCN A;  1A62 A;  2VUM G;  1P16 A;  1HNW L;  2JA5 H;  1IBM L;  3K8A A;  4DKA C;  3I55 A;  1N36 Q;  4B3S Q;  1QZG A;  2KHJ A;  1FJG L;  4A3J G;  4JV5 L;  1EQR A;  1OXU A;  3PIO A;  3HKZ E;  3CC4 A;  4JI3 L;  2UUC Q;  2B63 G;  2OWO A;  3AYH B;  4FDB A;  4GKJ L;  1KRT A;  1UE7 A;  1V9P A;  1XMQ L;  1Z9F A;  3K7A H;  5E7N A;  2F4V Q;  2I5H A;  1IBL Q;  5M5Y H;  2CFM A;  4LF4 L;  1VQD A;  1YNX A;  1VQM A;  1PH3 A;  3KDF A;  1VQL A;  5C4X G;  1K83 H;  3AEV A;  2VQE Q;  2N8N A;  4R1J A;  3S17 H;  2HQL A;  5IWA Q;  3S15 H;  1X3G A;  2PNH A;  4Y52 H;  2QA4 A;  2ZTC A;  4JBK A;  4A3M H;  4LFC Q;  3GTJ H;  4A4I A;  4BY7 G;  1XTD A;  2MO0 A;  3CCQ A;  1IBK Q;  1TWA H;  5IYD H;  4QIW E;  4LNQ A;  3A0J A;  3TRZ A;  2D62 A;  1BVS A;  1PH5 A;  1AH9 A;  3K7U C;  1A8V A;  1YHB A;  1WCM H;  2OQ0 A;  1VQO A;  1XMO L;  2VZA A;  4JYA L;  1G51 A;  1N9W A;  4B3R Q;  1J5E Q;  4JOI C;  4AYB E;  3CPW A;  1R9T H;  2BH2 A;  4BXX H;  1AE2 A;  3CCE A;  4OXP A;  1VQN A;  4PMW A;  2IHF A;  2V1C C;  1U0L A;  4PZ7 A;  3I7F A;  3HOV H;  4OX9 L;  4O2D A;  4POG A;  2YTV A;  3GTQ H;  2WFW A;  4IPG A;  1JB7 A;  3M85 A;  2K52 A;  1E1T A;  3PGZ A;  4PG3 A;  4DV6 L;  1IL2 A;  2JA7 G;  4MNO A;  2JA6 H;  1VQ7 A;  1YIJ A;  3PUY A;  5LMN L;  2MQH A;  5FLX c;  3PIP A;  4IPD A;  3PO2 G;  1GVP A;  1NBW A;  1HNZ Q;  4C2M H;  1V1Q A;  1HNX L;  4IPH A;  4B3M Q;  2JA8 G;  3I4N H;  2E5L L;  1PH6 A;  4NXN Q;  1XNR L;  3SGI A;  1YJW A;  4QGU A;  2YTX A;  5FJ8 H;  3OYY A;  4NXM Q;  1OXX K;  2IT1 A;  2Z6K A;  1N32 L;  5C4J H;  1TWH H;  3CMA A;  3RNU A;  4UP9 A;  2VQF L;  3GTM H;  1NY4 A;  4A76 A;  2PI2 E;  4XTC S;  3PO3 G;  1HR0 Q;  3TQY A;  4DV1 L;  2K75 A;  2PMZ E;  2MO1 A;  1Q1E A;  5K36 G;  1TWF H;  1EWI A;  4C3I H;  1B7Y B;  1YZ6 A;  3GTP H;  2IY5 B;  4DR3 L;  4HJA A;  4LF7 L;  3CF5 A;  3T1H Q;  3D31 A;  4LFB L;  1Q7Y C;  4UY8 C;  5EAY A;  3RZD H;  3G48 A;  3U58 A;  1VQ5 A;  2Q2U A;  4BBR H;  1KAW A;  1QUQ A;  3T1Y L;  2UU9 L;  2D0O A;  3TS0 A;  5C44 G;  1Q1B A;  4R4T A;  4LF9 Q;  3F8T A;  4OWX B;  4DV5 Q;  3L7Z C;  2K5N A;  4DUZ Q;  3S1N H;  4JI4 L;  4YWL A;  2EQS A;  4DR2 Q;  4OO1 I;  3BJU A;  4BBS G;  3F2C A;  5H1S E;  2ALY B;  1G29 1;  1K3R A;  3ER0 A;  2UUB L;  3TS2 A;  1JJG A;  3DLL A;  1CKN B;  2WAQ G;  1TWC H;  3HOW H;  1KRS A;  3PUX A;  3GO5 A;  4JI5 L;  1WJJ A;  4P75 A;  1X55 A;  3KLW A;  4JV5 Q;  1S40 A;  1H95 A;  4JI3 Q;  1Y1V H;  3CPF A;  2JQO A;  3I2Z A;  1WOC A;  1P8L A;  2LSS A;  5M3M H;  3I4M H;  3CW2 C;  4GKJ Q;  2B29 A;  1XMQ Q;  1KD1 C;  1D8L A;  2ZM6 L;  1K73 C;  1L1O B;  3EBE A;  2Y0S E;  4A3F H;  4LUO A;  2PQA B;  4A3E H;  3M4Q A;  1MKH A;  1C7Y A;  4MTN A;  2R7D A;  1K0R A;  1EUJ A;  4DV4 L;  1E24 A;  4JI7 L;  3U50 C;  2ID0 A;  3ICE A;  1SRU A;  2ZTE A;  2D0P A;  4AH6 A;  5JJL A;  1Q46 A;  1LUZ A;  4LF8 L;  5LMU L;  4RG1 A;  4DK3 C;  4YWM A;  2AWN A;  1QVG A;  1L1O C;  5GAG C;  2AHO B;  1VQG A;  5GAH C;  3CME A;  2ZJQ A;  2UUA L;  2FXQ A;  2R93 H;  4UPA A;  4JC0 A;  4DR4 L;  1HZA A;  4EQ5 A;  4LF5 L;  4KHP L;  2YYZ A;  5C0X I;  2E2H H;  4TVA B;  1D7Q A;  4JI8 L;  4A3L H;  5C3E H;  1XMO Q;  4LUV A;  3BZC A;  3UDX A;  3CCJ A;  1T9H A;  4JYA Q;  2R92 G;  1FVI A;  1VQB A;  2VW9 A;  3ULL A;  5IY0 A;  1PA6 A;  4LW1 A;  1NTG A;  3A74 A;  4GS3 A;  3PUV A;  3S14 H;  2Q2H A;  4A3C H;  3HFZ B;  1W2B A;  3FKI H;  2VS1 A;  5IT9 c; 
#chains in the Genus database with same CATH topology
 1HA5 A;  1QJO A;  4IUU A;  2PI2 A;  1QNU A;  1II3 A;  5IYB H;  3S16 B;  2F0W A;  1C0A A;  4FF1 A;  3C3L A;  1JE5 A;  2YTY A;  1OXV A;  2XSC A;  1SLJ A;  2QGQ A;  3OMG A;  3GTO H;  5FLM G;  2NVT H;  1W6K A;  1B53 A;  1K8M A;  2F0P A;  1TII D;  1XJV A;  5C5L A;  3NEL A;  1A2T A;  1ZKO A;  5K5P A;  1HNX Q;  2NVX H;  2H1E A;  2E5L Q;  1E1O A;  3RN2 A;  4A93 G;  5KNB A;  1R4Q B;  3CCS A;  2NN6 G;  3OIQ A;  2EYH A;  4CHT B;  3A5U A;  1KQS A;  1UEB A;  4OIK A;  4L63 B;  4IPC A;  3NQT A;  4LF7 Q;  4KD3 A;  4IQZ A;  2A6E C;  1ESF A;  2K04 A;  1EOV A;  4DK0 A;  5I2X A;  1ONL A;  3UDI A;  4DV0 L;  4A3G H;  3HOZ G;  2EOT A;  5BR8 L;  4E6I A;  4OEM B;  3HOV B;  2KOL A;  1CZG A;  1WTV A;  2R6G A;  4GKK Q;  2KEN A;  4GLA C;  4YCW A;  4DNR B;  2DY7 A;  3H94 A;  1J6Q A;  3S24 A;  3D4D A;  1XPO A;  2GVA A;  2Q8I B;  1KNE A;  2TMP A;  4RKL A;  2EYJ A;  1YI2 A;  2Z8L A;  4GN5 A;  1AZQ A;  1VF5 C;  2QEJ C;  4K5V A;  1CKM A;  2B3G A;  3VR3 A;  4BY7 H;  1UWV A;  1VMP A;  1PH9 A;  1XPU A;  4OWW B;  4ID6 A;  1MGS A;  3J80 c;  4FYD A;  5CBE E;  1V1P A;  1JMC A;  3KDF B;  2KHI A;  4GLV B;  4K2L A;  1HQR D;  2E2J H;  3CXC A;  1YJ9 A;  1IBM Q;  4N9T A;  4KHP Q;  4A93 B;  3E9I A;  1HCZ A;  3L0O A;  4A3M G;  1PFS A;  2UXC L;  3P7J A;  4JI1 L;  1VS0 A;  4EQO A;  4G4K A;  2F0E A;  1MHW C;  2BDO A;  2MNA A;  4HJ9 A;  3S1M B;  4YCV A;  1QWY A;  2WV6 D;  1HUM A;  4RHS A;  4WJW A;  2IX1 A;  5M3F B;  5D65 A;  2JA8 H;  1WTR A;  2L55 A;  2LS0 1;  2ES2 A;  3R93 A;  4IOC A;  2A8V A;  4AYB G;  4XQQ A;  3IAY A;  4DV2 L;  3PUZ A;  2O5I C;  2FMC A;  3RN5 A;  1EY0 A;  1QG7 A;  1X9N A;  3BVZ A;  1SE8 A;  2PYK A;  2NVY H;  2Y0S B;  2YU9 H;  1CQV A;  3GTK H;  3VYR A;  4X3K A;  3I56 A;  1HZC A;  1Z47 A;  2UXD L;  4WRD A;  1AW7 A;  3NBI A;  5A2Q E;  5I6Y A;  2K05 A;  4FF2 A;  4DR5 L;  2B8G A;  4C3I G;  4BBS H;  2Z6K C;  3K7A B;  2NBF A;  1EU3 A;  1TKW B;  3VYS A;  4A75 A;  1K83 B;  1AEX A;  2BE5 C;  3CP0 A;  4BBR G;  2F0V A;  3ZJY C;  1OTC A;  2YV5 A;  4IAL A;  4KKS A;  4X62 L;  2ZXO A;  4RGO S;  2KJX A;  3SDZ A;  3ULP A;  1QZH A;  2X6G A;  2UXB L;  3IFT A;  1PRT F;  1E3P A;  3SHL A;  3DMU A;  3I73 A;  3MZ5 A;  4I7A A;  1N36 L;  1VCI A;  3MEF A;  1YVC A;  5IE8 A;  2K5W A;  3ERQ A;  2KBN A;  2JE6 I;  4DF7 A;  3K0Y A;  2EYF A;  3J81 i;  3M7G A;  3SEB A;  1ILP A;  5HGQ A;  4RGN A;  1E7Z A;  1JWM D;  2JJQ A;  1LTR D;  2DUD A;  4KHZ A;  1PV4 A;  1Y1V G;  1PYS B;  1IW7 D;  5M3M G;  2GN5 A;  3RMH A;  2EY2 A;  4AYB B;  1TWG H;  3E5S A;  4LFC L;  4LFB Q;  3H91 A;  4DA2 A;  4A3F G;  2KQ3 A;  4QUC A;  3CCU A;  2NN6 I;  3DWP A;  3MFY A;  4JI6 Q;  4HID A;  4LF6 L;  2XRQ D;  4HMJ A;  4C2M B;  1JOQ A;  4AQY Q;  3HKS A;  4TKO B;  2OCE A;  2XTI A;  4BA1 I;  2XRS D;  4J6H A;  1Q86 C;  1NSN S;  4A3D H;  4X3T A;  4C3I B;  1IKL A;  4JBJ A;  4G7O C;  3CHB D;  1FNV A;  5IYC G;  5CGK A;  4DV3 Q;  2UUA Q;  3J81 E;  2VY3 A;  3HOU G;  2PMZ B;  3M9B A;  1K9M C;  1EOT A;  1LT4 D;  4K8I A;  2J0T D;  4BBR B;  5ELE A;  2C35 B;  4H0L C;  5DM6 3;  1Y1W H;  3HOY H;  1F9R A;  5JEA H;  3I72 A;  3W1B A;  4KN4 C;  1AFP A;  3QWN A;  1Q8K A;  4L5Q A;  1KDB A;  1HFG A;  2CQA A;  4UP8 A;  5BN3 A;  3RZO B;  5DEH A;  1MSH A;  1E2V A;  2MUY A;  2IHE A;  3KF6 A;  3KJP A;  1HR0 L;  3A56 A;  2MHV A;  5G3L F;  2OTL A;  2R7Z G;  4YHH Q;  4F88 A;  1U4M A;  2F0K A;  4XQJ A;  4KK7 A;  1ZEQ X;  4LFA L;  3U9O A;  1WFQ A;  3G6E A;  1DZ1 A;  2A68 C;  1XNQ Q;  1Y1V B;  3F1Z A;  1LTS D;  2FIN B;  3C1F A;  4DR6 L;  1T5X D;  2L15 A;  5IP9 G;  2HCI A;  1UE6 A;  4JI0 L;  3CD6 A;  5DM7 3;  4A3I G;  3Q24 A;  4LF9 L;  4A3F B;  4NW2 A;  5JJK A;  1SNO A;  2CWA A;  2KEE A;  4DR7 Q;  1PMR A;  1LT6 D;  2R7F A;  3AMU A;  1HNW L;  1P16 A;  3K6O A;  3J7A V;  1FJG L;  1TQO A;  1OXU A;  4NP5 A;  4ZUI A;  5JJZ A;  1IKM A;  1HTP A;  3AYH B;  2V4D A;  4FDB A;  1SE3 A;  1XMQ L;  1Z9F A;  4V19 0;  2WKD A;  5M5Y H;  1SMY D;  1VQD A;  3S14 B;  5CV8 A;  1VQM A;  3KDF A;  1JB3 A;  2Z4H A;  2N8N A;  2R3Z A;  3DEO A;  2NWG A;  4NDX A;  4Y52 H;  2ZTC A;  2F0D A;  4A4I A;  5IYD H;  5C44 B;  3A0J A;  3ZYY X;  1BF4 A;  3KBX A;  4LMQ D;  1UEA B;  3K7U C;  3GTG B;  1TY2 A;  3GQB A;  4JYA L;  2DN8 A;  1GHK A;  4B3R Q;  1B44 D;  4AYB E;  2BH2 A;  1AE2 A;  4OXP A;  5M5W B;  3KK7 A;  2R7Z B;  1VQN A;  4O2D A;  3GTQ H;  1JB7 A;  2OEO A;  2JA7 G;  4DV6 L;  1DON A;  2B2T A;  3ND9 A;  3PUY A;  3SK4 A;  3R8B A;  5FLX c;  4A3I B;  5AFW A;  4IPD A;  1TS4 A;  4IPH A;  1C48 A;  3D6W A;  3NP8 A;  1XX8 A;  1QOH A;  5FJ8 H;  4NXM Q;  1SYD A;  2A5H A;  2IT1 A;  2Z6K A;  2LMC B;  3M4O B;  3CMA A;  5C4H A;  2NUC A;  1BOS A;  2VQF L;  3GTM H;  4XTC S;  3PO3 G;  1SJE D;  4DV1 L;  3NE5 B;  2PMZ E;  4DN4 M;  5DNF A;  3E6Z X;  3TP5 A;  1B7Y B;  4IUP A;  4HJA A;  3HP3 A;  1Q8I A;  5NUC A;  2RDH A;  1Q7Y C;  2JN4 A;  4V0B A;  1VQ5 A;  1JCK B;  4R8I A;  1PRT B;  1Q1B A;  1SXT A;  3H6M A;  3F8T A;  3D4R A;  4IFD H;  3JAM E;  4DUZ Q;  4YWL A;  1BXT A;  2NZ1 D;  5FOB B;  3BJU A;  1X32 A;  3F2C A;  1I4P A;  2EYO A;  1PRT C;  1KLG D;  1I3Q B;  2K1B A;  3PUX A;  1YNJ C;  3GO5 A;  4JI5 L;  1WJJ A;  5D14 A;  1O7Z A;  3PMF A;  2NTS A;  3I4M H;  5ELF A;  2EXZ A;  2B29 A;  2QIL A;  3TSS A;  1D8L A;  3EBE A;  2JA7 B;  4XT1 B;  4QB4 A;  3M4Q A;  3NUC A;  5F2D A;  1KLU D;  4CJ2 C;  4S3S A;  3MHB A;  1O78 A;  3U50 C;  3ICE A;  1I6V C;  1DD2 A;  1YNN C;  5LMU L;  3I4L A;  4DK3 C;  4ZYS A;  5GAG C;  3CME A;  2R93 H;  4C1N I;  5KGU A;  2PO4 A;  2YYZ A;  4DGZ A;  1D7Q A;  1I4H A;  5C3E H;  1XMO Q;  4LUV A;  3UDX A;  3CCJ A;  1XTC D;  2R92 G;  3PO3 B;  2VW9 A;  1I4X A;  1JOR A;  2F03 A;  3A74 A;  2L1B A;  3RD4 A;  4ZKB B;  1W2B A;  3FKI H;  5IT9 c;  2E2I B;  3TEH B;  1F2M A;  4TRD A;  1SR3 A;  4Q0F A;  1K0S A;  2PZW A;  1F9P A;  1FNW A;  4HMI A;  4RCO A;  1L2F A;  2A1A A;  1G6P A;  4C3J G;  3DM3 A;  2X6L A;  3OSO A;  4EQN A;  4DUY Q;  4EX5 A;  4P74 A;  4XIG S;  5CV7 A;  4J8Q A;  4PMC A;  3CQZ B;  1L0W A;  1CA5 A;  1GUT A;  3P1H A;  2G5D A;  4CDF C;  4LK1 C;  3OW2 A;  2ZJR A;  1I94 L;  4QY7 A;  1HH2 P;  1PH7 A;  5CV4 A;  5AJ3 L;  2EY6 A;  2LKV A;  5IGG A;  3CCR A;  2K01 A;  3M3Y H;  4JG2 A;  1I50 B;  1TVX A;  4B3S L;  2PCF B;  2HQE A;  5DAU A;  1VQJ A;  4G7Z C;  4X66 L;  3QO2 A;  4IFD I;  4A3K G;  3T1Y Q;  5EKL A;  2UU9 Q;  4HJ8 A;  1CHP D;  1WTP A;  3NBH B;  3X3M A;  3ULJ A;  4BY1 H;  2VUM H;  1N34 L;  1BCP D;  2NVQ B;  2NB0 A;  4KV6 A;  5KYL A;  2NZH A;  3K5O A;  1J8I A;  1DOL A;  2G9H D;  5JPM C;  1CA6 A;  2JA9 A;  1H9S B;  4L5S A;  3FP9 A;  1VMC A;  2R61 A;  1PTO D;  3G7L A;  4RMF A;  4M1U B;  3K81 C;  3GV3 A;  4OON A;  4X6A H;  4XYO A;  2WIN B;  1LTA D;  5C4X H;  1A3U A;  5C0X J;  4K2K A;  4DXG A;  1F2L A;  3QOJ A;  4X3U A;  1VQK A;  2ZXP A;  4DV4 Q;  5IT9 L;  2A6H D;  5KEE A;  4JI7 Q;  3M4P A;  5ELN A;  1X56 A;  2K7V A;  4LF8 Q;  3VR2 A;  2HHH L;  3E9H A;  1MJC A;  3WWV A;  4EGV A;  1I5F A;  3GV6 A;  2K28 A;  1Q82 C;  2K5V A;  4DR4 Q;  1Q3L A;  4FXG C;  4JBM A;  1KHI A;  3A7A B;  1VDZ A;  3IFD A;  2IX0 A;  3T16 A;  3F2U A;  1Q81 C;  4YY3 L;  3PF5 A;  2AQ2 B;  3W1G A;  2RF4 A;  3X3N A;  4JVZ A;  2AUJ D;  5IOD A;  1CK1 A;  1WCM G;  2QW7 A;  5IIF A;  1PFB A;  4GN3 B;  1G8Z D;  3PO2 H;  4BXX G;  3I91 A;  1HTL D;  4YWK A;  4X65 L;  4A3K B;  2BA1 A;  1JJ2 A;  3HOW B;  1EY5 A;  3NEM A;  3HOV G;  4QCL A;  1EIH A;  4NPS A;  4UDU C;  3LWE A;  3NK9 A;  4GNX C;  1M1K C;  1KXL A;  2JEA I;  1RIP A;  2SNM A;  4ZAI A;  5C3W A;  4OX9 Q;  4HJ7 A;  3S16 H;  2Q2T A;  3J81 j;  5I9O A;  1CT1 D;  4R4O A;  2EY5 A;  5EPK A;  2J4X A;  2K33 A;  2E2H B;  2CWP A;  4PMB A;  1N8R C;  1MJE A;  1X3F A;  4U68 A;  3E0J A;  3K0X A;  1Y14 B;  4DV0 Q;  5BR8 Q;  3C46 A;  1PFN A;  3CCV A;  4JK1 C;  5FO8 B;  3S17 B;  4M8A A;  3S15 B;  3H3V H;  1Y69 U;  1O7Y A;  2PNR C;  3D8G A;  3GTJ B;  1KDC A;  3CKI B;  4DR1 L;  4ME5 A;  1PZI D;  4WOR A;  3J7A 5;  2EYL A;  3KF6 B;  3T53 B;  2CH4 A;  1EWH A;  1DXM A;  1WCM B;  2UUC L;  5FO7 B;  5M3F G;  3W5O A;  3CC7 A;  2JEB I;  1BBW A;  2H5X A;  3K80 C;  2B8F A;  1IBL L;  1GUO A;  4OHJ A;  3ERS X;  1SBB B;  3HG9 A;  1LTT D;  1CM9 A;  1CSQ A;  5IWA L;  3URY A;  4K6L A;  3TN2 A;  2UUB Q;  1STE A;  3MXP A;  1HUN A;  4A3E G;  1IBK L;  3K5L A;  3FRP B;  1EIY B;  3K5M A;  1MSG A;  3O13 A;  4TQU S;  3MA2 B;  4I65 A;  5EKI A;  5J39 A;  2Y0S G;  3KFU A;  3QR8 A;  3I4N B;  2UXC Q;  1BUV T;  4JI1 Q;  3TME A;  1LTL A;  2J7Z A;  5CV6 A;  1J5E L;  1ZXT A;  2MPM A;  1QVF A;  1JJC B;  4B9W A;  4A3L G;  5C4J B;  1TWH B;  3SE0 A;  1H9K A;  1D6E C;  5FLM H;  1STA A;  3NTI A;  4HTH A;  1I6H H;  2XNA C;  2ZJP A;  1B1Z A;  4EQP A;  1WTX A;  1PFM A;  4FP5 D;  5JPN C;  1F77 A;  3J80 i;  4A3C G;  3GTP B;  4A93 H;  1U5K A;  1HNZ L;  4LWC A;  3QJY A;  1QE6 A;  3FPU B;  4PV1 C;  2NN6 H;  1VQI A;  4DV2 Q;  4O0A A;  1M8A A;  1B9M A;  3NWT A;  5JJI A;  2A6E D;  4CJ1 B;  3CCM A;  4C56 C;  5IP7 G;  3TP6 A;  3S1M H;  1EY7 A;  3TP8 A;  4GKK L;  1JIC A;  3GP7 A;  4P71 A;  4POF A;  1VQ4 A;  1RJT A;  5M3F H;  2XWB B;  4ME3 A;  1WI5 A;  4GLX A;  1X54 A;  2EYM A;  2UXD Q;  1RL2 A;  3HOZ H;  3NBH A;  3P20 A;  1S3O A;  4DR5 Q;  2LY7 A;  4WJ3 M;  3DWQ A;  2O5J C;  3PUW A;  3H3V I;  1R4P B;  4DV5 L;  1H9S A;  4A3E B;  4R4Q A;  1YJN A;  5C6A A;  4HSV A;  2F0G A;  1HHV A;  4DR2 L;  3R2I A;  2A69 C;  2F52 A;  3MXU A;  3UDF A;  4ZKC B;  4X62 Q;  2UXB Q;  2L9H A;  3JC6 6;  2F0O A;  4C3H G;  2IWH A;  4R4I A;  1IBM L;  4DKA C;  1N36 Q;  1QZG A;  4QUF A;  4A3J G;  1EQR A;  1IW7 C;  3PIO A;  1HFN A;  2B63 G;  2OWO A;  1BR9 A;  2F0N A;  4GKJ L;  1KRT A;  3K7A H;  3N52 A;  2F4V Q;  1WTO A;  1HRJ A;  1C4Q A;  2ICI A;  1VQL A;  1K83 H;  1BDO A;  2VQE Q;  2HQL A;  4B08 A;  3J80 L;  2QA4 A;  4A3M H;  4LFC Q;  2MO0 A;  2IPK D;  1ET9 A;  2B2W C;  2RSN A;  2D62 A;  1PH5 A;  1AH9 A;  1IYU A;  2OQ0 A;  5IGF A;  1N9W A;  3CPW A;  4OIJ A;  5EPL A;  2V1C C;  1U0L A;  2KED A;  3Q22 A;  3T56 B;  3M85 A;  2K52 A;  1E1T A;  3PGZ A;  4MNO A;  4FXD A;  3EA6 A;  1F9S A;  1BBX C;  3VR5 A;  3DWA A;  4KY7 A;  5LMN L;  3FPP A;  4C2M H;  1V1Q A;  4ZUJ A;  1XNR L;  1TT2 A;  2F0I A;  2YTX A;  1Q90 A;  4C3H B;  4IUQ A;  2Z1C A;  2F0J A;  3S2H B;  4WFN 3;  4IUR A;  1N32 L;  4UP9 A;  5FK9 C;  1NY4 A;  4A76 A;  2F0S A;  1HR0 Q;  4A3J B;  1KNA A;  1SAP A;  3A54 A;  2B63 B;  5K36 G;  3MXG A;  5EGT A;  4C3I H;  4KTA A;  2BE5 D;  3PIP 3;  2IY5 B;  4DR3 L;  1WVL A;  2QKI C;  1EU4 A;  4RFB A;  4BBR H;  4DK1 A;  4RGT A;  5C44 G;  2AUK A;  4LF9 Q;  4OWX B;  4ILW A;  3L7Z C;  1WD0 A;  4JI4 L;  2EQS A;  2BOS A;  2B2U C;  1WTW A;  1KAA A;  1CI3 M;  2M00 A;  2D9U A;  3MVV A;  1G29 1;  1H9J A;  3Q6S A;  3L3O C;  3SK6 A;  1KRS A;  3MTS A;  3TDQ A;  3Q23 A;  2IX3 A;  1NR4 A;  5EKK A;  3S1Q B;  1Y1V H;  1H95 A;  2LSS A;  5M3M H;  1Y8O B;  2K5D A;  1LTB D;  1XMQ Q;  3HOY B;  1KD1 C;  2ZM6 L;  4FO2 A;  2Y0S E;  4A3F H;  2PQA B;  4MTN A;  1K0R A;  3TZU A;  3A8K E;  4ABN A;  4CDE C;  5IGE A;  2ZTE A;  3BYY B;  1Q46 A;  1E2W A;  4YWM A;  4KN7 C;  4Y7N B;  2AWN A;  4Z9C B;  1QVG A;  2AHO B;  2UUA L;  1EY4 A;  2FXQ A;  4UPA A;  4JC0 A;  1B2T A;  5IGD A;  4LF5 L;  3WOE A;  1O7L A;  4JI8 L;  2B2Y C;  1F2Z A;  1ROD A;  4JYA Q;  1Z7T A;  3BS1 A;  5EJW A;  3KLS A;  1VQB A;  5I4D A;  5E1F A;  1NTG A;  3S14 H;  4X3S A;  3RNU A;  3H15 A;  2EE1 A;  5IYC H;  1PVO A;  4DV6 Q;  3HOU H;  2O4X A;  1CKO A;  4F8M A;  1EY6 A;  5CV9 A;  2QF7 A;  1D5X C;  5C44 H;  3F2B A;  4JI2 L;  3FMC A;  1EY9 A;  5D3I B;  4HCS A;  3PIO 3;  1S5B D;  1C9O A;  3GTG H;  3H0G B;  3Q8D A;  4DV7 Q;  4HJ5 A;  2B39 A;  3EVQ A;  1QVC A;  4H7B A;  3KOJ A;  2A68 D;  5M5W H;  4O42 A;  2R7Z H;  4FXK C;  3TRE A;  2VQF Q;  1UUP A;  4DR7 L;  3G4S A;  1E22 A;  3G71 A;  4HIO A;  2MP1 A;  1CTM A;  2JP1 A;  1DGS A;  1D2B A;  1LO5 D;  4BWG B;  4HSP A;  5IP9 H;  3UDG A;  3HOX G;  1WTH A;  4A3I H;  1EYA A;  4X64 L;  3IL8 A;  1B8A A;  1VQA A;  4A3B B;  1EL0 A;  3I4O A;  3NPP A;  1SNQ A;  2D2C C;  1HR0 W;  4P72 A;  2F0T A;  1A3T A;  3JAM c;  3GD7 A;  1D1I A;  4MZ9 A;  3EQL C;  1A6X A;  1ENA A;  1LAC A;  5CBA E;  5M5X B;  1D5M C;  2HDL A;  2AKW B;  5J1Z A;  5EBD A;  3J7Y W;  1QIL A;  5GRO A;  3M4O H;  1A63 A;  3OOC A;  1EQT A;  2SOB A;  2CQO A;  2AQ1 B;  2F0F A;  2N49 A;  5BN4 A;  1C8C A;  5D3D A;  1SYF A;  4JI5 Q;  4KY6 A;  1V43 A;  3CRL C;  3NSW A;  1GKH A;  4HIK A;  1PHJ A;  1H9M A;  3T4A C;  2B2W A;  3MAQ A;  3S2D B;  3NQI A;  4K14 A;  3AFP A;  4OO1 G;  2Z9H A;  2JA5 G;  1SND A;  3C2P A;  1SRO A;  4L5T A;  2KVM A;  2JSO A;  3BU2 A;  2WP8 J;  3GTL B;  4R9W A;  4DPG A;  4K0K L;  2F0M A;  2ZT9 C;  2DJG C;  1KC8 C;  1EIF A;  2HT1 A;  1T5E A;  2JYO A;  2BA0 A;  1S5C D;  3KLS X;  5LMU Q;  4B3T L;  1L0Y B;  2O2L D;  3OTO Q;  1I3Q H;  2K5Q A;  4DFA A;  2Z6B A;  2CHB D;  4HAE A;  2N3S A;  1JWS D;  1M4V A;  2K50 A;  2RCF A;  3NEN A;  3MXN B;  3IRB A;  4Q5V A;  2K5H A;  3NTK A;  2FHT A;  1HZ9 A;  2SNS A;  2JA7 H;  4LF4 Q;  2Q8R E;  1ILQ A;  1EQV A;  1ML0 D;  3HOX B;  1DM0 B;  3PSI A;  5J3B A;  2Q2I A;  5EPJ A;  5C0X G;  4G7H C;  4KJN A;  2LFN A;  1N33 L;  2B2V C;  5FLX L;  2HDM A;  3E3X A;  4JCV E;  1U4P A;  2BH8 A;  1EZ8 A;  5LL6 S;  2JA6 G;  3OWF A;  1KIX A;  2RHS B;  1LAB A;  3HRZ C;  5T1I A;  4IFD J;  3PO3 H;  3VR6 A;  4ZRZ A;  5ELO A;  3STB D;  4DUZ L;  1ENC A;  3KUP A;  1AE3 A;  3M7N A;  3CC2 A;  3WOF A;  2EYP A;  1B4O A;  3OWE B;  3K59 A;  1JQY D;  2E74 C;  1MBY A;  5AJ3 Q;  2B2U A;  5FO9 B;  2JA5 B;  1PTO B;  4OL7 A;  4TSS A;  2VNU D;  1CZW A;  1I4Q A;  1STB A;  1PRT D;  4X66 Q;  1BCP C;  1V8Q A;  4H02 A;  1LT5 D;  1GUN A;  2ENB A;  3RR5 A;  1PYB A;  2M2L A;  4DNT B;  2HIX A;  4NB3 A;  1F2Y A;  3CQZ H;  1PTO C;  1SDF A;  4HR7 B;  1N34 Q;  1QUQ B;  3GDE A;  4RAU C;  4XYQ A;  2PZT A;  3BZD B;  3U4V A;  2I0Q A;  2K14 A;  3LGJ A;  4U67 3;  4FF3 A;  1I50 H;  1TWA B;  3DM1 A;  1CSP A;  1DYQ A;  1GJX A;  3PQI A;  3EN2 A;  2AWO A;  3A8J E;  3S1R H;  1MI2 A;  1YNN D;  2PQA A;  2Z4I A;  1K8A C;  5DLQ E;  4B9X A;  2KUM A;  1NR2 A;  3W2D A;  3HOW G;  2KCC A;  1V1O A;  4IZ8 A;  4QIW B;  4DAV A;  1R9T B;  2ZTD A;  2PZU A;  4RGM A;  2K4K A;  2NVQ H;  2EJM A;  1K3B C;  5JAV A;  4ALP A;  4PZ6 A;  1M90 C;  2OXP A;  1SNM A;  5IT9 E;  2NZO A;  1X6O A;  2RHQ B;  1MIU A;  2HHH Q;  2JA6 B;  3M3Y B;  1B3A A;  1GUG A;  1QCB D;  2R92 H;  2QEX A;  1KDA A;  4GN4 B;  4DUY L;  1QB5 D;  4R4C A;  4YY3 Q;  3W3A A;  1SEB D;  4HED A;  1YBY A;  4IN3 A;  1NNX A;  3J7Z C;  4BY1 B;  1VQH A;  3I90 A;  1EQQ A;  4GZY C;  1YIT A;  4C3J H;  5E4X A;  4CDC C;  1HZB A;  4P73 A;  1IYV A;  1OXS C;  4X65 Q;  4L5R C;  1TWF B;  4K5X A;  3TBI B;  4YCU A;  3SXH A;  2OQK A;  2QDB A;  5G3L D;  5IOC A;  5IYB G;  4OGQ C;  1Q12 A;  3T13 A;  5C4X B;  3NWS A;  3RLF A;  1W3S A;  4RCN A;  3RZD B;  2L12 A;  1GO3 E;  1NJI C;  4B3M L;  4LAA A;  1ASY A;  1FGU A;  1GUS A;  4NXN L;  4CKB A;  1XYI A;  4GOP B;  2E76 C;  3S1N B;  4BA2 I;  1EYG A;  4ZLT F;  3V96 A;  4EVO A;  2WB1 G;  1VQP A;  3BG3 A;  4A3K H;  1Y8N B;  3HS0 C;  1TWC B;  3LWU A;  4XT3 B;  1SFO H;  2I5M X;  5JVH 3;  4GOP C;  4GNX B;  5HUR A;  1ZYR D;  5GAE C;  1TR5 A;  5ELD A;  3T1H L;  1TU2 B;  4RA8 A;  4APV A;  1XWE A;  4H44 C;  1LM0 A;  2FJ2 A;  2PW7 A;  1HPC A;  1D1K A;  1VQE A;  4KI0 A;  3BDC A;  4MTK A;  4CGY B;  3BDL A;  3ERO A;  3CRK C;  2JK8 A;  5COY A;  1HJP A;  1RDP D;  4KMU C;  3I4N G;  3A55 A;  4A3G G;  2OF1 A;  2XIW A;  2VL6 A;  1X65 A;  3KJO A;  4DR1 Q;  2RCN A;  1STH A;  1WTQ A;  1ET6 A;  1STY A;  1PLF A;  3SK5 A;  5T1G A;  1EFI D;  4JV5 L;  4JI3 L;  3TZD A;  2UUC Q;  4I7Z C;  1IHZ A;  4PQX A;  1JOO A;  2N55 A;  1SYB A;  2I5H A;  1IBL Q;  1E0B A;  4IUT A;  1S4Z A;  1TS5 A;  1SYE A;  4R1J A;  3N6R A;  3S17 H;  5IWA Q;  3S15 H;  2PNH A;  4JBK A;  3GTJ H;  4BY7 G;  4CKE A;  1HXY D;  1IBK Q;  1GHJ A;  3MXN A;  4QIW E;  3TRZ A;  4N8F A;  4DU9 A;  3GTO B;  4UAI A;  2NVT B;  1BVS A;  1J9O A;  2B2V A;  1WCM H;  4K6D A;  2EY1 A;  2NVX B;  3BVG A;  3BDO A;  1G51 A;  1J5E Q;  4JOI C;  4BXX H;  2WB1 B;  2D5D A;  2IHF A;  2CW0 D;  1SE4 A;  4PZ7 A;  3I7F A;  3MEH A;  5L37 A;  2Q8T A;  4OX9 L;  3HOV H;  1GUW A;  4POG A;  4XXE A;  2EJG C;  1IL2 A;  5A35 A;  2VB2 X;  2N88 A;  1VQ7 A;  2BDN A;  3VA5 A;  2MQH A;  4K8J A;  2DNC A;  1DCZ A;  3PIP A;  1GVP A;  1NBW A;  2NYZ D;  1HNZ Q;  3H3V C;  1U4R A;  4RWS C;  1HNX L;  2JA8 G;  4PNY A;  3I4N H;  2E5L L;  1PH6 A;  3EFX D;  3SGI A;  4A3G B;  1YJW A;  4QGU A;  2IW3 A;  4JPB W;  3AB9 A;  2CH4 W;  5C4J H;  1TWH H;  2L5T A;  4P2C B;  1EWI A;  1LTI D;  5I6W A;  1K28 A;  2A74 C;  3GTP H;  4LF7 L;  4UY8 C;  3I3C A;  1GOZ A;  1PZK D;  3G48 A;  3OIP A;  2Q2U A;  1QUQ A;  2D0O A;  1Y8P B;  4H13 C;  1ICF B;  1I4R A;  2F1M A;  4DV5 Q;  4BY7 B;  4DR2 Q;  2XVS A;  4BBS G;  1I6H B;  5H1S E;  4MHE A;  5C3X A;  2ALY B;  2UUB L;  3TS2 A;  1JJG A;  1CKN B;  2WAQ G;  2KCN A;  2E2J B;  1RD9 D;  4P75 A;  1X55 A;  1S40 A;  2MGS A;  3I2Z A;  1P8L A;  3IKJ A;  2E75 C;  1U9R A;  3CW2 C;  4GKJ Q;  1GXD C;  1K73 C;  2WAC A;  4RH6 A;  1L1O B;  4A3E H;  5KND A;  2R7D A;  1HA6 A;  2EPB A;  1EUJ A;  3D4W A;  5JVG 3;  1E24 A;  1IL8 A;  2DY8 A;  1NCV A;  2M9V A;  4IUV A;  1S5D D;  2D0P A;  4AH6 A;  5JJL A;  1LUZ A;  1CFM A;  4RG1 A;  3J80 E;  2JA8 B;  1L1O C;  5GAH C;  3HOZ B;  4RKB A;  2ZJQ A;  4KHP L;  4CKC A;  4A3L H;  5JOB A;  5E3F A;  1SYC A;  2VXW A;  3BZC A;  4KD4 A;  2RKS A;  1EYD A;  5BN5 A;  5IY0 A;  2I46 A;  2RDF A;  4LW1 A;  4GS3 A;  3PUV A;  2EZV A;  4A3C H;  3HFZ B;  2B2T C;  3HZX A;  2N78 A;  2NVY B;  3DUZ A;  1S72 A;  1FR3 A;  5C5M A;  2YU9 B;  1FGB D;  2F3I A;  3GTK B;  1DOK A;  5LMN Q;  1FNU A;  4KKT A;  2BCO A;  3D3R A;  3AQQ A;  2ZXR A;  2WB1 E;  4LF6 Q;  1ESR A;  5IP7 H;  4GOP A;  4A3D G;  1NAP A;  2OTJ A;  4DK6 C;  4BBS B;  1XNR Q;  1G2T A;  1RCV D;  3FVQ A;  1EZ6 A;  3PV0 A;  2C5C A;  2WAQ B;  1N32 Q;  3MFG A;  3PCO B;  4GNX A;  4A3M B;  1Y1W G;  3HOY G;  2WII B;  5JEA G;  2SEB D;  2I5L X;  3EIV A;  1KTK A;  3C1E A;  4K5W A;  4DR3 Q;  1UAP A;  2A69 D;  1XXG A;  5A2Q L;  3J81 c;  5KRU A;  4LUZ A;  3I8Z A;  1EFW A;  3VYT A;  2Q2H A;  3KYH C;  5CC4 A;  2F4V L;  3A8I E;  3FHW A;  2AQ3 B;  4C3H H;  1VQF A;  3L2P A;  4JI4 Q;  3S2H H;  4DAY B;  2VQE L;  2C9O A;  4CJ0 B;  4F7X A;  3D6C A;  3CCL A;  4A3J H;  1LT3 D;  1TWG B;  4UP7 A;  3VDY A;  3UE1 A;  2B63 H;  4QQB X;  1L0X B;  2K32 A;  1SYG A;  5HY6 A;  3H09 A;  4LFA Q;  4R8N A;  1IZ6 A;  4DR6 Q;  1EEI D;  3BYT B;  1BCP F;  4JI0 Q;  2ZM6 Q;  2GA4 B;  2RDG A;  1TS2 A;  1B3Q A;  4JBW A;  4YIJ A;  4JOI A;  3K58 A;  1PTO F;  2DNE A;  3H0G G;  3VA7 A;  1D5Z C;  3F2D A;  3RZO H;  2L11 A;  1SMX A;  1BKB A;  2GVB A;  4LFB L;  3HKZ G;  2KHS A;  2HCC A;  4A3D B;  1PH8 A;  3E0E A;  2ASB A;  5EBC A;  1I4G A;  1HNW Q;  4JI6 L;  2QCP X;  3SR1 A;  4LF5 Q;  1FJG Q;  3S1Q H;  1SMY C;  1H9R A;  4JI8 Q;  2KEC A;  3VR4 A;  3KBG A;  4IO9 A;  3RLN A;  5FKA C;  5IYD G;  4AQY L;  4N9P A;  2ATW A;  1PH1 A;  1Y1W B;  3G6J B;  4IJH A;  1B9N A;  5LHY 1;  4A3B G;  3P75 A;  3QOL A;  1EIG A;  1YHQ A;  3MC0 B;  4QL5 A;  4HIM A;  2RQX A;  2Z0S A;  3OW7 A;  2SDF A;  3NXW A;  1SE2 A;  1SN8 A;  2DGY A;  1GD7 A;  3OMC A;  4Y7N H;  1IXR A;  1PXU A;  1VQC A;  1JT8 A;  2F3W A;  4JI2 Q;  4ODG A;  3J81 L;  4DV3 L;  1EY8 A;  5LL6 X;  4KY5 A;  5M3M B;  2P5Z X;  2FMM A;  5KIX A;  4QF4 A;  5EQ0 A;  3AU7 A;  1RHP A;  5JEA J;  5LMN W;  3DEP A;  2F0Q A;  1RTN A;  5K36 H;  4LJZ C;  4IOA A;  4XQN A;  1BBU A;  1U4L A;  3FEW X;  3EJI A;  3J7A F;  1G91 A;  5I2Y A;  5FJ8 G;  2VB3 X;  4ZCK A;  2NTT A;  4YHH L;  1VQ9 A;  4PZ8 A;  4X64 Q;  1A2U A;  5HGT A;  3BZK A;  3AFQ A;  1XNQ L;  2XGT A;  2WAQ E;  5ELB A;  1JC7 A;  3H0G H;  1SJH D;  2F0H A;  4OWT B;  1K8G A;  3U4Z A;  1AP0 A;  1LV9 A;  2JXM B;  5M5Y B;  1CUK A;  3HKZ B;  2HIV A;  3K57 A;  2CCZ A;  1CKN A;  1JR0 D;  1S5F D;  1XPR A;  4QJF A;  3OPO A;  1UE5 A;  2RVL A;  1BQQ T;  2EIF A;  1YEZ A;  3HOU B;  1FL0 A;  3Q0A A;  4DV1 Q;  4HCE A;  1BNZ A;  4IFD G;  1NE3 A;  1B50 A;  4G57 A;  1TY0 A;  1ICW A;  2E8G A;  2MFI A;  4A3B H;  1NMG A;  3MWY W;  1L1O A;  1IYJ B;  2EJF C;  1O80 A;  3UE0 A;  2A19 A;  1PH4 A;  1ASZ A;  3A5Z B;  2LXK A;  1PDQ A;  5M5X H;  2E2D C;  4MN3 A;  3KF8 B;  1TXY A;  3JAM i;  3I4M G;  4KLK A;  4K0K Q;  1W6J A;  2KCM A;  3GTQ B;  4KKU A;  1B70 B;  3RLO A;  4B3T Q;  4DNI A;  1EYC A;  5CV5 A;  3LX0 A;  4ULL A;  1KL9 A;  1JWU D;  1RF2 D;  5M9O A;  3ITP A;  2EXD A;  2FFK B;  3S2D H;  2LXJ A;  3ND8 A;  1EWC A;  3B6Y A;  4DV7 L;  1PH2 A;  4B3R L;  2R93 G;  2IL8 A;  1G2S A;  5I9P A;  4ZQ3 A;  3SK8 A;  1VF7 A;  2PW5 A;  5C3E G;  3GTL H;  2AMC B;  1WD1 A;  3GTM B;  1SSO A;  4OEL B;  5CYU A;  4J1M A;  4NKL A;  2ICE C;  1N33 Q;  3FKI G;  1A0I A;  1LYL A;  3TP7 A;  3STB C;  3HEJ A;  3HGB A;  4AIM A;  5FLX E;  1X3P A;  2CVR A;  5J22 A;  5ELC A;  1VQ8 A;  2KA7 A;  2CKZ B;  1A3V A;  3CU7 A;  4DAM A;  5GAD C;  4NXM L;  2F4I A;  1X3E A;  3PF4 A;  3HOX H;  1RKN A;  2RBM A;  4JW0 A;  4NMZ A;  1JE4 A;  1PZJ D;  4IUN A;  1WYD A;  4J15 A;  3D0F A;  1O7I A;  5CMD A;  1AN8 A;  4WJ4 A;  2QDL A;  2A73 B;  3BVM A;  3CAM A;  2KCT A;  5KYI A;  1ENF A;  4KJO A;  3DXJ C;  1OO9 B;  1F9Q A;  3I4M B;  1UE1 A;  4O1N A;  4DAY A;  5E4W C;  3V2T A;  1FD7 D;  1DJR D;  2XN9 C;  2MJ8 A;  3JAM L;  1GM5 A;  2HD3 A;  3NTH A;  2PQE A;  5GQO A;  1OXT A;  1NMF A;  3QIA A;  4FNF A;  1BCP B;  1YHA A;  4IJL A;  1I94 Q;  2E2I H;  3OTO L;  3M4Y A;  1VQ6 A;  4BY1 G;  2VUM G;  4OO1 H;  1A62 A;  2DJF C;  2K03 A;  3FDT A;  2JA5 H;  2I07 B;  1PTO H;  3K8A A;  3I55 A;  2R93 B;  4B3S Q;  2KHJ A;  3HKZ E;  3CC4 A;  1JOK A;  4FVM A;  5C3E B;  1STG A;  1UE7 A;  1V9P A;  5E7N A;  1TS3 A;  1YNJ D;  4N8X 1;  4BS9 A;  2CFM A;  4LF4 L;  2EDG A;  1YNX A;  1PH3 A;  5C4X G;  3AEV A;  1DOM A;  2IJ0 A;  3FKI B;  1X3G A;  5COR A;  1LTG D;  1XTD A;  2WKC A;  1FYC A;  3CCQ A;  4UHV A;  1TWA H;  4LNQ A;  2OT2 A;  1SNC A;  4QMG A;  2HUG A;  5CR3 A;  1V1P B;  3VYU A;  1A8V A;  1YHB A;  1VQO A;  1XMO L;  2A6H C;  2VZA A;  2G9D A;  4DAP A;  1R9T H;  1KAB A;  2B2Y A;  5C0X H;  3CCE A;  3R3O A;  4PMW A;  4CBV A;  3SVM A;  2YTV A;  3R2T A;  2WFW A;  4IPG A;  4PG3 A;  2JA6 H;  5KNC A;  1YIJ A;  1EEF D;  2L0C A;  3NHH A;  3S1R B;  3PO2 G;  2TSS A;  1NUC A;  4B3M Q;  3UI2 A;  4NXN Q;  4HN7 A;  4RHR A;  3LNN A;  5ISR A;  3OYY A;  1BO0 A;  1OXX K;  2VUM B;  2L4N A;  1E2Z A;  1ZYR C;  3S9W A;  1Z6H A;  1S5E D;  2PI2 E;  3A7L A;  1A15 A;  3TQY A;  3DHQ A;  2K75 A;  2MO1 A;  1Q1E A;  1TWF H;  2F0U A;  2R92 B;  1RTO A;  2RSO A;  1SNP A;  1CHQ D;  1YZ6 A;  3CF5 A;  3T1H Q;  2K6A A;  3D31 A;  4CDD C;  2F0L A;  1G6Z A;  1STN A;  5EAY A;  3V05 A;  5IGB A;  3RZD H;  3U58 A;  4C1N K;  1PYW D;  3ONA B;  1KAW A;  3T1Y L;  2UU9 L;  3TS0 A;  4R4T A;  3L9A X;  4MIU A;  2K5N A;  3S1N H;  4OO1 I;  4C3J B;  3K5N A;  4L6T B;  1X3Q A;  2F3V A;  1K8O A;  1K3R A;  3ER0 A;  3U9S A;  3DLL A;  1TWC H;  1UNS A;  3HOW H;  4FF4 A;  4JV5 Q;  3KLW A;  2H4O A;  3KLR A;  3QB3 A;  4JI3 Q;  3CPF A;  2JQO A;  3QG1 A;  1WOC A;  5TSS A;  4ZK9 B;  3KF8 A;  4L8J A;  3OHX C;  4XDX A;  4LUO A;  5C4Z A;  5IGC A;  1MKH A;  1C7Y A;  2EVB A;  4DV4 L;  1AZP A;  4JI7 L;  2ID0 A;  1SRU A;  3PO2 B;  4LF8 L;  1LLR D;  1QNK A;  1SFO B;  1MD2 D;  3RUZ A;  1VQG A;  4DR4 L;  1HZA A;  4EQ5 A;  4DXF A;  1HQM C;  3I70 A;  5C0X I;  4TVA B;  2E2H H;  2CW0 C;  3WDN A;  4KHV A;  1T9H A;  1FVI A;  1PA6 A;  3ULL A;  3T51 B;  2X69 A;  4F87 A;  2RA4 A;  2XWJ B;  2PPB C;  1CQF A;  2VS1 A; 
#chains in the Genus database with same CATH homology
 3H15 A;  2N78 A;  3TEH B;  5IYC H;  1S72 A;  2PI2 A;  1PVO A;  5IYB H;  1SR3 A;  4DV6 Q;  3HOU H;  1C0A A;  1CKO A;  2F3I A;  1JE5 A;  2YTY A;  5LMN Q;  1OXV A;  1L2F A;  5C44 H;  1SLJ A;  2A1A A;  2QGQ A;  3F2B A;  4JI2 L;  3GTO H;  1G6P A;  3AQQ A;  3DM3 A;  5FLM G;  2NVT H;  4LF6 Q;  2WB1 E;  5IP7 H;  1C9O A;  4GOP A;  1XJV A;  1HNX Q;  3NEL A;  3GTG H;  4DUY Q;  4A3D G;  2NVX H;  4EX5 A;  4DK6 C;  4P74 A;  2OTJ A;  3Q8D A;  2E5L Q;  4XIG S;  1XNR Q;  1E1O A;  4DV7 Q;  4HJ5 A;  1QVC A;  1L0W A;  3RN2 A;  4A93 G;  3KOJ A;  5M5W H;  3PV0 A;  2R7Z H;  3CCS A;  1N32 Q;  3PCO B;  3TRE A;  2VQF Q;  3OW2 A;  2NN6 G;  2ZJR A;  1I94 L;  4DR7 L;  3G4S A;  4GNX A;  4QY7 A;  1HH2 P;  1E22 A;  1Y1W G;  3G71 A;  1PH7 A;  3HOY G;  4HIO A;  5JEA G;  2I5L X;  1DGS A;  3EIV A;  3A5U A;  5AJ3 L;  3CCR A;  1KQS A;  1UEB A;  3M3Y H;  4JG2 A;  5IP9 H;  3HOX G;  3UDG A;  4B3S L;  4A3I H;  4IPC A;  4DR3 Q;  3J81 c;  4LF7 Q;  4X64 L;  1B8A A;  1VQA A;  1VQJ A;  3I4O A;  4X66 L;  1HR0 W;  4IFD I;  4LUZ A;  4A3K G;  1EFW A;  1EOV A;  4P72 A;  3T1Y Q;  3KYH C;  2UU9 Q;  3UDI A;  2F4V L;  4HJ8 A;  3JAM c;  4DV0 L;  3GD7 A;  3FHW A;  3NBH B;  5BR8 L;  3HOZ G;  4A3G H;  4MZ9 A;  4C3H H;  1VQF A;  3ULJ A;  3L2P A;  4BY1 H;  2VUM H;  4JI4 Q;  1N34 L;  3S2H H;  2AKW B;  4DAY B;  2VQE L;  3M4O H;  5GRO A;  2NZH A;  2R6G A;  1A63 A;  4GKK Q;  2KEN A;  4GLA C;  2CQO A;  4YCW A;  4A3J H;  3CCL A;  2JA9 A;  4UP7 A;  3VDY A;  3UE1 A;  4L5S A;  1J6Q A;  3S24 A;  3FP9 A;  1XPO A;  2N49 A;  2B63 H;  2GVA A;  4QQB X;  4RMF A;  4JI5 Q;  5HY6 A;  1V43 A;  3K81 C;  1GKH A;  4OON A;  4LFA Q;  4HIK A;  1PHJ A;  4X6A H;  1IZ6 A;  1YI2 A;  2HHH L;  4DR6 Q;  4DR7 Q;  5C4X H;  3AFP A;  4GN5 A;  4OO1 G;  5C0X J;  2JA5 G;  4JI0 Q;  2ZM6 Q;  1SRO A;  1CKM A;  2B3G A;  4L5T A;  1VQK A;  4BY7 H;  1UWV A;  4JBW A;  3BU2 A;  4JOI A;  2WP8 J;  1PH9 A;  4DV4 Q;  4OWW B;  1XPU A;  4DPG A;  3H0G G;  4JI7 Q;  3M4P A;  4K0K L;  5ELN A;  1KC8 C;  1EIF A;  3J80 c;  2HT1 A;  3F2D A;  1X56 A;  2BA0 A;  3RZO H;  4LF8 Q;  1SMX A;  1BKB A;  2GVB A;  5LMU Q;  4B3T L;  3HKZ G;  3E9H A;  3OTO Q;  1JMC A;  3KDF B;  2KHI A;  1MJC A;  1I3Q H;  4GLV B;  3WWV A;  3E0E A;  1PH8 A;  2ASB A;  1HNW Q;  1I5F A;  3CXC A;  1YJ9 A;  1Q82 C;  2E2J H;  1IBM Q;  4JI6 L;  2K5V A;  4DR4 Q;  4JBM A;  2N3S A;  1KHI A;  4LF5 Q;  4KHP Q;  1FJG Q;  3E9I A;  3L0O A;  4A3M G;  3S1Q H;  2K50 A;  4JI8 Q;  2IX0 A;  4IO9 A;  3NEN A;  3MXN B;  3IRB A;  3RLN A;  4YY3 L;  1Q81 C;  1PFS A;  5IYD G;  4AQY L;  2ATW A;  2K5H A;  3PF5 A;  2UXC L;  1PH1 A;  4JI1 L;  1VS0 A;  3W1G A;  2RF4 A;  4IJH A;  1HZ9 A;  2JA7 H;  4LF4 Q;  4A3B G;  2MNA A;  4HJ9 A;  1WCM G;  1YHQ A;  4YCV A;  3PSI A;  4QL5 A;  4HIM A;  4GN3 B;  2Z0S A;  5J3B A;  3PO2 H;  4BXX G;  2Q2I A;  1SN8 A;  2DGY A;  4YWK A;  1GD7 A;  4X65 L;  5C0X G;  2IX1 A;  2BA1 A;  1JJ2 A;  4Y7N H;  1IXR A;  2JA8 H;  1VQC A;  1JT8 A;  3NEM A;  1N33 L;  3HOV G;  4JI2 Q;  2ES2 A;  4IOC A;  4JCV E;  4DV3 L;  4NPS A;  2BH8 A;  4AYB G;  2A8V A;  2JA6 G;  1KIX A;  2RHS B;  4IFD J;  4DV2 L;  5JEA J;  5LMN W;  3PO3 H;  3PUZ A;  5ELO A;  4GNX C;  3STB D;  1M1K C;  1KXL A;  4DUZ L;  2JEA I;  1RIP A;  3RN5 A;  4IOA A;  1X9N A;  1AE3 A;  3M7N A;  3CC2 A;  1SE8 A;  1BBU A;  2NVY H;  4OX9 Q;  4HJ7 A;  3S16 H;  2Q2T A;  3J81 j;  5FJ8 G;  2YU9 H;  5AJ3 Q;  3GTK H;  4R4O A;  4YHH L;  3I56 A;  1HZC A;  1VQ9 A;  4PZ8 A;  2VNU D;  1Z47 A;  2UXD L;  4X64 Q;  3AFQ A;  3BZK A;  4X66 Q;  1XNQ L;  2XGT A;  2WAQ E;  4H02 A;  2CWP A;  4DR5 L;  3H0G H;  1N8R C;  1MJE A;  1X3F A;  3RR5 A;  4BBS H;  1PYB A;  2Z6K C;  3K0X A;  1Y14 B;  2HIX A;  4OWT B;  3U4Z A;  4DV0 Q;  5BR8 Q;  1K8G A;  4NB3 A;  3CQZ H;  1CUK A;  3CCV A;  2HIV A;  2CCZ A;  1CKN A;  4A75 A;  1N34 Q;  1XPR A;  4QJF A;  1QUQ B;  3CP0 A;  4BBR G;  3GDE A;  3ZJY C;  1UE5 A;  1OTC A;  2EIF A;  2YV5 A;  3H3V H;  1YEZ A;  4X62 L;  1FL0 A;  3U4V A;  4DV1 Q;  2I0Q A;  3ULP A;  2K14 A;  1QZH A;  4IFD G;  3LGJ A;  2UXB L;  1NE3 A;  4DR1 L;  1I50 H;  1E3P A;  3J7A 5;  1CSP A;  1N36 L;  2MFI A;  1VCI A;  2E8G A;  3EN2 A;  1YVC A;  1NMG A;  2AWO A;  1L1O A;  3KF6 B;  1IYJ B;  3MEF A;  5IE8 A;  3S1R H;  2PQA A;  2UUC L;  2KBN A;  3UE0 A;  5M3F G;  2JE6 I;  2A19 A;  5DLQ E;  1K8A C;  3J81 i;  3W5O A;  1PH4 A;  1ASZ A;  3A5Z B;  3HOW G;  3CC7 A;  2JEB I;  5HGQ A;  1BBW A;  2H5X A;  1E7Z A;  2ZTD A;  2JJQ A;  2LXK A;  3K80 C;  1IBL L;  2DUD A;  4KHZ A;  1PV4 A;  1Y1V G;  1PYS B;  3ERS X;  5M5X H;  2K4K A;  5M3M G;  2NVQ H;  3KF8 B;  1TXY A;  3JAM i;  3I4M G;  4KLK A;  2GN5 A;  4K0K Q;  4ALP A;  2KCM A;  4PZ6 A;  1M90 C;  1CSQ A;  5IWA L;  2NZO A;  1TWG H;  1X6O A;  1B70 B;  3RLO A;  2RHQ B;  4LFC L;  1MIU A;  4A3F G;  2HHH Q;  2UUB Q;  4B3T Q;  4DNI A;  4LFB Q;  4A3E G;  1IBK L;  3CCU A;  2NN6 I;  4JI6 Q;  2R92 H;  1KL9 A;  1EIY B;  2QEX A;  4HID A;  4LF6 L;  3KFU A;  4GN4 B;  2EXD A;  4TQU S;  2Y0S G;  3S2D H;  4DUY L;  2LXJ A;  4YY3 Q;  4R4C A;  4AQY Q;  2UXC Q;  3B6Y A;  4DV7 L;  4JI1 Q;  1PH2 A;  4B3R L;  1LTL A;  2R93 G;  1YBY A;  1J5E L;  3J7Z C;  3HKS A;  1QVF A;  1VQH A;  1JJC B;  4A3L G;  1EQQ A;  5C3E G;  2OCE A;  3GTL H;  2AMC B;  1YIT A;  2XTI A;  4C3J H;  4BA1 I;  5FLM H;  1I6H H;  1HZB A;  4P73 A;  2ZJP A;  1OXS C;  4X65 Q;  1Q86 C;  4L5R C;  4A3D H;  4YCU A;  3J80 i;  4A3C G;  1N33 Q;  2OQK A;  3FKI G;  4JBJ A;  1A0I A;  1LYL A;  5IYC G;  4DV3 Q;  3STB C;  2UUA Q;  4AIM A;  5IYB G;  4A93 H;  2VY3 A;  1Q12 A;  1U5K A;  1HNZ L;  4LWC A;  3HOU G;  3RLF A;  1W3S A;  3M9B A;  1K9M C;  1GO3 E;  1NJI C;  1VQ8 A;  4B3M L;  1ASY A;  1FGU A;  2CKZ B;  1VQI A;  2C35 B;  4O0A A;  4NXN L;  4DAM A;  4DV2 Q;  1Y1W H;  3HOY H;  5GAD C;  5JJI A;  4GOP B;  3CCM A;  4NXM L;  3W1B A;  5IP7 G;  3S1M H;  1X3E A;  3PF4 A;  3HOX H;  4BA2 I;  1Q8K A;  4L5Q A;  1EYG A;  4GKK L;  4UP8 A;  4P71 A;  4POF A;  3KJP A;  3KF6 A;  1VQ4 A;  2IHE A;  1HR0 L;  2WB1 G;  2OTL A;  1VQP A;  1WYD A;  4J15 A;  5M3F H;  4A3K H;  3D0F A;  2R7Z G;  4YHH Q;  1O7I A;  4ME3 A;  1SFO H;  2I5M X;  1WI5 A;  4GOP C;  4GLX A;  4WJ4 A;  1X54 A;  4GNX B;  3CAM A;  4LFA L;  1RL2 A;  5GAE C;  3HOZ H;  2UXD Q;  1WFQ A;  3G6E A;  2KCT A;  3T1H L;  1S3O A;  1XNQ Q;  3F1Z A;  4APV A;  4DR6 L;  4DR5 Q;  1LM0 A;  4WJ3 M;  1UE1 A;  2L15 A;  5IP9 G;  1UE6 A;  4JI0 L;  3CD6 A;  4KI0 A;  1VQE A;  4A3I G;  3PUW A;  1GM5 A;  3H3V I;  4LF9 L;  4DV5 L;  2JK8 A;  5JJK A;  2CWA A;  4R4Q A;  1HJP A;  1YJN A;  4DR2 L;  5GQO A;  4A3B H;  1OXT A;  1NMF A;  2F52 A;  1I94 Q;  3UDF A;  1YHA A;  4IJL A;  4X62 Q;  2E2I H;  3I4N G;  4A3G G;  2R7F A;  3OTO L;  2UXB Q;  2VL6 A;  1X65 A;  3JC6 6;  3KJO A;  1VQ6 A;  4R4I A;  4BY1 G;  4DR1 Q;  2RCN A;  1A62 A;  2VUM G;  1P16 A;  1HNW L;  2JA5 H;  1IBM L;  3K8A A;  4DKA C;  3I55 A;  1N36 Q;  4B3S Q;  1QZG A;  2KHJ A;  1FJG L;  4A3J G;  4JV5 L;  1EQR A;  1OXU A;  3PIO A;  3HKZ E;  3CC4 A;  4JI3 L;  2UUC Q;  2B63 G;  2OWO A;  3AYH B;  4FDB A;  4GKJ L;  1KRT A;  1UE7 A;  1V9P A;  1XMQ L;  1Z9F A;  3K7A H;  5E7N A;  2F4V Q;  2I5H A;  1IBL Q;  5M5Y H;  2CFM A;  4LF4 L;  1VQD A;  1YNX A;  1VQM A;  1PH3 A;  3KDF A;  1VQL A;  5C4X G;  1K83 H;  3AEV A;  2VQE Q;  2N8N A;  4R1J A;  3S17 H;  2HQL A;  5IWA Q;  3S15 H;  1X3G A;  2PNH A;  4Y52 H;  2QA4 A;  2ZTC A;  4JBK A;  4A3M H;  4LFC Q;  3GTJ H;  4A4I A;  4BY7 G;  1XTD A;  2MO0 A;  3CCQ A;  1IBK Q;  1TWA H;  5IYD H;  4QIW E;  4LNQ A;  3A0J A;  3TRZ A;  2D62 A;  1BVS A;  1PH5 A;  1AH9 A;  3K7U C;  1A8V A;  1YHB A;  1WCM H;  2OQ0 A;  1VQO A;  1XMO L;  2VZA A;  4JYA L;  1G51 A;  1N9W A;  4B3R Q;  1J5E Q;  4JOI C;  4AYB E;  3CPW A;  1R9T H;  2BH2 A;  4BXX H;  1AE2 A;  3CCE A;  4OXP A;  1VQN A;  4PMW A;  2IHF A;  2V1C C;  1U0L A;  4PZ7 A;  3I7F A;  3HOV H;  4OX9 L;  4O2D A;  4POG A;  2YTV A;  3GTQ H;  2WFW A;  4IPG A;  1JB7 A;  3M85 A;  2K52 A;  1E1T A;  3PGZ A;  4PG3 A;  4DV6 L;  1IL2 A;  2JA7 G;  4MNO A;  2JA6 H;  1VQ7 A;  1YIJ A;  3PUY A;  5LMN L;  2MQH A;  5FLX c;  3PIP A;  4IPD A;  3PO2 G;  1GVP A;  1NBW A;  1HNZ Q;  4C2M H;  1V1Q A;  1HNX L;  4IPH A;  4B3M Q;  2JA8 G;  3I4N H;  2E5L L;  1PH6 A;  4NXN Q;  1XNR L;  3SGI A;  1YJW A;  4QGU A;  2YTX A;  5FJ8 H;  3OYY A;  4NXM Q;  1OXX K;  2IT1 A;  2Z6K A;  1N32 L;  5C4J H;  1TWH H;  3CMA A;  3RNU A;  4UP9 A;  2VQF L;  3GTM H;  1NY4 A;  4A76 A;  2PI2 E;  4XTC S;  3PO3 G;  1HR0 Q;  3TQY A;  4DV1 L;  2K75 A;  2PMZ E;  2MO1 A;  1Q1E A;  5K36 G;  1TWF H;  1EWI A;  4C3I H;  1B7Y B;  1YZ6 A;  3GTP H;  2IY5 B;  4DR3 L;  4HJA A;  4LF7 L;  3CF5 A;  3T1H Q;  3D31 A;  4LFB L;  1Q7Y C;  4UY8 C;  5EAY A;  3RZD H;  3G48 A;  3U58 A;  1VQ5 A;  2Q2U A;  4BBR H;  1KAW A;  1QUQ A;  3T1Y L;  2UU9 L;  2D0O A;  3TS0 A;  5C44 G;  1Q1B A;  4R4T A;  4LF9 Q;  3F8T A;  4OWX B;  4DV5 Q;  3L7Z C;  2K5N A;  4DUZ Q;  3S1N H;  4JI4 L;  4YWL A;  2EQS A;  4DR2 Q;  4OO1 I;  3BJU A;  4BBS G;  3F2C A;  5H1S E;  2ALY B;  1G29 1;  1K3R A;  3ER0 A;  2UUB L;  3TS2 A;  1JJG A;  3DLL A;  1CKN B;  2WAQ G;  1TWC H;  3HOW H;  1KRS A;  3PUX A;  3GO5 A;  4JI5 L;  1WJJ A;  4P75 A;  1X55 A;  3KLW A;  4JV5 Q;  1S40 A;  1H95 A;  4JI3 Q;  1Y1V H;  3CPF A;  2JQO A;  3I2Z A;  1WOC A;  1P8L A;  2LSS A;  5M3M H;  3I4M H;  3CW2 C;  4GKJ Q;  2B29 A;  1XMQ Q;  1KD1 C;  1D8L A;  2ZM6 L;  1K73 C;  1L1O B;  3EBE A;  2Y0S E;  4A3F H;  4LUO A;  2PQA B;  4A3E H;  3M4Q A;  1MKH A;  1C7Y A;  4MTN A;  2R7D A;  1K0R A;  1EUJ A;  4DV4 L;  1E24 A;  4JI7 L;  3U50 C;  2ID0 A;  3ICE A;  1SRU A;  2ZTE A;  2D0P A;  4AH6 A;  5JJL A;  1Q46 A;  1LUZ A;  4LF8 L;  5LMU L;  4RG1 A;  4DK3 C;  4YWM A;  2AWN A;  1QVG A;  1L1O C;  5GAG C;  2AHO B;  1VQG A;  5GAH C;  3CME A;  2ZJQ A;  2UUA L;  2FXQ A;  2R93 H;  4UPA A;  4JC0 A;  4DR4 L;  1HZA A;  4EQ5 A;  4LF5 L;  4KHP L;  2YYZ A;  5C0X I;  2E2H H;  4TVA B;  1D7Q A;  4JI8 L;  4A3L H;  5C3E H;  1XMO Q;  4LUV A;  3BZC A;  3UDX A;  3CCJ A;  1T9H A;  4JYA Q;  2R92 G;  1FVI A;  1VQB A;  2VW9 A;  3ULL A;  5IY0 A;  1PA6 A;  4LW1 A;  1NTG A;  3A74 A;  4GS3 A;  3PUV A;  3S14 H;  2Q2H A;  4A3C H;  3HFZ B;  1W2B A;  3FKI H;  2VS1 A;  5IT9 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...