1NSNS

The crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
TKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (immunoglobulin/hydrolase)
molecule keywords IGG FAB (IGG1, KAPPA)
publication title The crystal structure of the antibody N10-staphylococcal nuclease complex at 2.9 A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 34
structure length 138
sequence length 138
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1995-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nsnS00
1KAAA 1F2MA 2F0WA 2NUCA 4J1MA 5CV9A 5F2DA 3C1FA 5CV4A 3P1HA 1II3A 3DHQA 4WRDA 4WORA 1F2ZA 1KDBA 4I65A 4IALA 1STYA 4K2LA 5CR3A 5C3XA 5I9OA 4R8NA 2F0QA 1NSNS 1STHA 1ENCA 1EY7A 2F3WA 2LKVA 5HGTA 5C5LA 3PMFA 3NHHA 2SNSA 4DF7A 1EYCA 1JOOA 5I6YA 2EYLA 2EYFA 3D4WA 4IUNA 2F0HA 2F0NA 1SNQA 3U9OA 5M9OA 4MIUA 4HTHA 4ODGA 4PMBA 3SHLA 2EY6A 2EYMA 4RKBA 2RBMA 1SYFA 2PQEA 5IGBA 1SYEA 5DAUA 3P75A 4IZ8A 1EY4A 2PZUA 3S9WA 1ENAA 1EY5A 4NMZA 1EY6A 3HEJA 3VA5A 1SYBA 4NP5A 4B9WA 5NUCA 2PW5A 3E5SA 4EQPA 4KTAA 2HQEA 4QMGA 2KHSA 1STAA 3QOLA 5EGTA 1SYDA 3V2TA 2EY5A 4H7BA 3TMEA 4DGZA 5I9PA 3BDLA 2F0EA 3SK4A 4B9XA 5I6WA 2F0IA 1EY9A 1A3VA 2PYKA 2F0GA 4EQNA 4EVOA 3C1EA 5IGCA 5E3FA 4F7XA 4YIJA 1KDCA 2RKSA 3QOJA 2O4XA 4G57A 5CV8A 5EKLA 3MEHA 5J22A 4N9TA 4N9PA 2F0JA 4RKLA 2SOBA 3SXHA 4E6IA 4KJNA 5IGFA 2F0PA 5KYIA 1A3UA 2F0FA 5CV5A 2F0SA 2QDBA 4K5VA 5CV7A 2PZTA 2EYPA 2F0KA 3EROA 3RUZA 4KY6A 1TQOA 4ZQ3A 5CC4A 4PNYA 3QB3A 5EKKA 4HMIA 5IGEA 3H6MA 4DU9A 4DFAA 4OL7A 5J39A 1KABA 1NUCA 1STGA 4KV6A 2EYHA 5C6AA 5ISRA 4KY7A 4QB4A 1TR5A 5C5MA 5IGDA 1EY0A 3T16A 4K6DA 5CV6A 3BDCA 3LX0A 1JORA 2ENBA 3OSOA 3TP5A 2PW7A 3SK8A 2SNMA 5K5PA 1KDAA 3NXWA 2OXPA 4K2KA 4ZUJA 3TP7A 2F0LA 5IIFA 5DEHA 1F2YA 2EYJA 2F3VA 2WACA 4NKLA 1A3TA 5C4ZA 5HURA 5KEEA 1JOQA 5J1ZA 1RKNA 3R3OA 1STBA 4K8IA 4PMCA 1JOKA 2EY2A 1SNPA 4KHVA 4F8MA 5IGGA 3NK9A 3MZ5A 3EJIA 3MXPA 4ZUIA 3SK5A 1SNMA 3EVQA 4K14A 3NP8A 1EYDA 2EYOA 1SYCA 5JOBA 1EQVA 3D6CA 5KGUA 2F0UA 5CGKA 4HMJA 2M00A 3OMGA 1EZ8A 1AEXA 4TRDA 5C3WA 3ITPA 3TP6A 5KIXA 3D8GA 3MHBA 4KD3A 2F0DA 2F0OA 1EZ6A 2F0VA 2F0TA 1A2UA 3T13A 5IOCA 3MVVA 1EYAA 1TT2A 1U9RA 4ME5A 4KJOA 2EXZA 4S3SA 5C4HA 5IODA 5KYLA 2F0MA 3TP8A 3HZXA 4QF4A 2OF1A 2KQ3A 2PZWA 3ERQA 3SR1A 4EQOA 2EY1A 4LAAA 3OWFA 1SNOA 4K8JA 5JAVA 4ID6A 4K5XA 4KD4A 1IHZA 1EY8A 1STNA 1SNCA 4K5WA 1A2TA 3OMCA 4KY5A 3NUCA 2RDFA 5KRUA 2OEOA 3NQTA 3D4DA 3DMUA 1SNDA 1SYGA 4J6HA 5E1FA 4NDXA 3SK6A
chains in the Genus database with same CATH superfamily
2ASBA 4DNTB 1H9MA 1BR9A 3H0GB 4UHVA 1FGBD 1SBBB 3C1FA 2R6GA 3K80C 3EA6A 4K2LA 1K83B 1LTSD 2H5XA 1J5EL 2O5IC 5IYDH 3A0JA 1X6OA 1Q8KA 1F9RA 4LFCQ 2IT1A 4B3TQ 1N33L 4DV2Q 1K3BC 2KOLA 3D0FA 1Q46A 1WOCA 2A68C 3HS0C 1HH2P 2F0HA 3MFYA 5IT9c 3DWAA 2UUAL 5LMNL 2EPBA 1CUKA 3J7AV 4AYBG 5C44B 5A2QE 3S9WA 3J81L 2ZM6Q 3NBHA 1K8MA 3I56A 1OO9B 3A8IE 4HR7B 3ONAB 3PO3G 1YNJC 3T51B 2K05A 1BF4A 5DM73 3OIQA 4CKCA 1TY2A 3ZJYC 5C3EH 1XPOA 3A74A 4DR6Q 2NVXB 2RVLA 1QNKA 1QVCA 2WAQB 4A3GG 2KHIA 4F7XA 3QOJA 4G57A 5IY0A 1HTPA 3NWSA 2I5LX 1VQJA 5CV7A 3EROA 5FKAC 4HJ5A 2KCNA 1VDZA 4Y7NB 4DUYL 3U4ZA 4HMIA 4BBSH 5J39A 3K0YA 1KLUD 2R7ZB 1Y1VB 3GQBA 1Q3LA 5EPLA 1WTVA 3FKIH 1A0IA 3W3AA 4IPCA 4JV5L 1EFID 3I7FA 5BR8L 1S5DD 4JBKA 2NTTA 4A3JB 4LF8L 2F3VA 4P75A 4G7ZC 1KAWA 3L2PA 1UNSA 2C9OA 4DKAC 2FXQA 2E75C 3CW2C 3CCVA 2EYOA 2B39A 1PHJA 4HMJA 4AQYQ 3K57A 4FXGC 3TBIB 2NB0A 2Z8LA 3J81i 1V1OA 2BE5D 3PQIA 2K5HA 1RJTA 2JEBI 1XTCD 1BBUA 5E4WC 2Q8RE 1JWSD 1L0XB 2AUJD 1VQGA 2B8GA 4HIKA 1QVGA 1C9OA 2B2WA 1K3RA 1UE1A 1NSNS 2B8FA 2NYZD 5IP7G 1PA6A 4DF7A 1EYCA 3D4WA 4IUNA 1CKNB 4IO9A 3W2DA 2R93B 1I4RA 5EJWA 4A3BH 3S1RH 4HSPA 3K8AA 3L0OA 2HT1A 1RIPA 2DY7A 5EBCA 4JYAL 3ULPA 1FNVA 5JJIA 1EY5A 4BXXH 2R3ZA 4GN4B 4DR4Q 3VA5A 2PW5A 2B3GA 1VQ5A 1SYDA 2WB1G 1DOKA 5EBDA 2A19A 2IWHA 5I6WA 1YEZA 4JCVE 3DXJC 3FRPB 4H0LC 2F4VL 4LF7L 4DAYA 2SOBA 1PZID 4L6TB 3Q6SA 3ND8A 3G6JB 3H15A 1PLFA 1PH1A 3J7YW 1BCPD 4POGA 5EKKA 4DK6C 1CZGA 1C0AA 3GTJH 4BY7G 3JAML 2K33A 2CCZA 3CKIB 4TVAB 1HQRD 2A6HD 4QL5A 1B3AA 4RG1A 4XIGS 2DNCA 3H09A 4JI1L 4LUOA 1HNXL 2YTXA 3VYTA 3D31A 3PO2B 4KN7C 1XWEA 1KTKA 2VY3A 5JOBA 3CPFA 3G48A 1PTOB 3G7LA 2WAQE 3ITPA 3LGJA 1M4VA 2ZT9C 2F0TA 2XWBB 3J80L 2K1BA 2FHTA 3HZXA 4WJWA 2E2IB 1SE3A 1MKHA 2OCEA 3PUXA 1JICA 2NVYH 3KBXA 4A3CG 4BA1I 4DAMA 3NELA 2CQOA 1SAPA 1TVXA 1ONLA 1UE5A 2QEXA 5FK9C 5JPNC 1IBLQ 2K04A 4BWGB 5CR3A 2JA5B 2ZTDA 2DNEA 2L5TA 1STHA 1D5ZC 2KCMA 2I07B 5C5LA 3PMFA 4B3SQ 3S15H 2VNUD 3G4SA 3KK7A 4CKEA 4DNIA 2VUMB 4MIUA 1DD2A 2H1EA 3FPPA 4JI0Q 3HOXH 3EBEA 1N36L 2G9HD 1EQQA 4JC0A 2D0OA 2X6LA 2CWPA 1G2TA 3IKJA 4B9WA 1TWHB 4H02A 1VMCA 4QIWB 5ELEA 1PH8A 1Q1BA 4GS3A 3TMEA 1LTGD 1I50B 3TN2A 4C3JB 2H4OA 3J7A5 2JEAI 3DM1A 3S1NH 1I6HB 3MEHA 1CM9A 2MJ8A 1AZQA 3GTOH 4CJ0B 4KJNA 4FF2A 1F9PA 3OPOA 5ELDA 2F0FA 1VQFA 1K83H 1S5CD 4F87A 4DUZQ 5JPMC 1XJVA 1IYJB 1WTRA 3ULLA 4PZ6A 4X3SA 2QA4A 3HG9A 1PTOC 3VR2A 1JWMD 1N34Q 3CD6A 4C2MB 3A54A 5CV6A 1NBWA 4Z9CB 3ND9A 3BDCA 4GLXA 4DV5L 2AHOB 1JORA 3I8ZA 3VR3A 5C44H 4K2KA 3TP7A 5JEAG 1FR3A 2NWGA 4OIKA 4R4QA 1MIUA 3IFDA 5LMUQ 3R2IA 4A3FG 1UEBA 1DYQA 1RDPD 4A3GB 3FEWX 5EPJA 1HUMA 1EQVA 2NVXH 3I4NB 1V1QA 1A15A 2FMCA 2MO0A 2WV6D 1Y69U 1PH4A 1HFGA 3VA7A 2JSOA 1BO0A 1BUVT 4LFAL 1UWVA 1G6ZA 4B3MQ 5K36H 3KF6B 3OWFA 4Y7NH 1SNOA 2A69C 3NE5B 4C3IH 4LJZC 3A5UA 4DV1Q 2JA7G 2JN4A 1Y1VH 2IL8A 1BDOA 1HNZQ 2M9VA 1Y8NB 2PMZB 1E7ZA 1TWFB 2IJ0A 3GP7A 1I4QA 1OXSC 2O5JC 1KL9A 3UE0A 2BCOA 4JPBW 3V96A 4HTHA 4P73A 1VF5C 1H9RA 4RA8A 2RBMA 2C35B 2GN5A 1B44D 1KXLA 1VS0A 1R4PB 1EY6A 3GTPB 2L15A 4QMGA 2AWNA 3QOLA 3RZDH 2NN6G 4ILWA 3MEFA 3OW2A 2PYKA 2F0GA 1HA6A 4RGNA 5CV8A 4L63B 4X65Q 4MTKA 4RKLA 1PXUA 1N32L 3FKIB 3T1YQ 1CSPA 4XYQA 2XSCA 4OONA 1E22A 3MXNA 4BS9A 4GZYC 4ME3A 2UUBL 4ZCKA 1IL8A 2UUCQ 1JJ2A 4A75A 2CVRA 1DCZA 2K52A 4KKUA 3DWPA 1CZWA 4DV6L 3L3OC 1JE5A 1NY4A 2YV5A 1TS2A 3PIP3 4ZUJA 5DEHA 1F2YA 2EYJA 5H1SE 4RGOS 3ICEA 1JWUD 3MWYW 5FLXc 2K03A 4IN3A 4DUYQ 2WINB 2WB1B 2M2LA 3IL8A 4DXGA 4OIJA 3GO5A 3CU7A 3HRZC 3NK9A 3CCUA 1CA5A 3CCLA 4EQ5A 2EIFA 1HPCA 2MHVA 4QIWE 3NP8A 2DJGC 1ZEQX 1QCBD 1GVPA 3F1ZA 1V1PA 3MA2B 1X3EA 1VQ9A 1AEXA 4IQZA 5COYA 4UPAA 5BR8Q 4CDDC 4HJ7A 2F4IA 2EJMA 1B70B 2F0VA 4LF4L 1QWYA 1WD1A 2EDGA 5C4HA 1E0BA 2PZWA 1OXTA 2LXKA 3DEOA 3STBC 2UXDL 1B4OA 3KDFA 4K8JA 2NVTH 1SNCA 1ET6A 1FL0A 5IP9G 1EEID 4A3DG 3NQTA 2Q8TA 1VQ4A 3E6ZX 1W6JA 1ICWA 2OQ0A 4A76A 1LT4D 1EIGA 1G2SA 1TWCH 4IALA 1MI2A 1ML0D 1TY0A 1YNNC 1PH2A 2BH8A 1D1IA 2TSSA 1RD9D 4C3HH 2OT2A 1JOOA 5I6YA 4OO1G 1UEAB 3TS0A 2B2YA 4WFN3 4H44C 4YCVA 4RKBA 3MTSA 4NXNQ 5D14A 3J81j 5IGBA 1SYEA 1NNXA 1PTOH 2J4XA 1S5ED 2RCFA 4Q0FA 4R9WA 2N88A 1MBYA 1O78A 1PZJD 1KHIA 2CH4W 1U4MA 5D3IB 3HKZB 3I70A 2Q2HA 3T1HL 1R4QB 1WTOA 2K5WA 3VYSA 1I3QH 4X66Q 2OTJA 1VF7A 3NBHB 4EQNA 3GTJB 3KLWA 3NTHA 1GJXA 1U5KA 5A2QL 2MNAA 1RCVD 1X55A 4YHHL 2P5ZX 1WTHA 3MFGA 3DEPA 4M8AA 1F9SA 4UP9A 5A35A 1PH3A 4IFDH 5M3MG 4EX5A 1N34L 5IGEA 1ILQA 4MNOA 1NUCA 5C6AA 3BZDB 2QGQA 2VUMH 5C4JB 3IAYA 3SK8A 4A4IA 2JA8H 3NXWA 2KVMA 4DV0L 5IIFA 3MC0B 2UXCQ 3S1QB 2A5HA 1STBA 4UAIA 1ZYRC 2I0QA 1JOKA 1CQFA 2CFMA 3EJIA 3PIPA 1PTOD 1F2LA 1I50H 2K32A 4C3JH 4A3EH 2E8GA 5G3LF 3DLLA 1EZ8A 4JG2A 1STEA 5D65A 1FGUA 1GO3E 4DR7L 1U4PA 4QGUA 2QILA 1HCZA 3T13A 4XT3B 1LTID 1NAPA 5KYLA 2ZJRA 1MJCA 1LO5D 4GKJL 4LAAA 2HQLA 2Z4HA 1IW7C 3OOCA 1X3QA 4ID6A 1K73C 3S15B 3KLRA 4JBWA 2EVBA 3X3NA 1U4RA 1SMYC 5F2DA 4CKBA 1HFNA 3K81C 2CWAA 1ENCA 1CI3M 1EY7A 3AYHB 5BN3A 3PO3H 1W3SA 3KLSX 4FF4A 1Y1WG 2F1MA 4AIMA 4R4CA 4HJ8A 4RCOA 5IE8A 4MTNA 2WB1E 2XN9C 4A3GH 3I72A 2VXWA 1A8VA 3WOFA 2EYMA 1Y14B 1B50A 1I4GA 1WCMG 1SYFA 1WTXA 4IZ8A 5DLQE 4PZ8A 1IYVA 4ZK9B 3S1NB 1G6PA 2KENA 4GKKL 3PV0A 1QZHA 3GTOB 2KUMA 3I4LA 3GV6A 4EQPA 4X3KA 3SE0A 4DR3Q 1TS3A 3HOYG 4L5RC 1X54A 1X9NA 1H9SA 1C7YA 2K14A 3K0XA 2JA7B 3Q22A 1GHKA 2UXBQ 3C1EA 3SGIA 4DK3C 5I2YA 3CMAA 1KDCA 4GOPA 3UE1A 1V43A 2XIWA 3F2CA 5FO8B 4JI5L 5IGFA 1QNUA 2F0PA 2WIIB 4PV1C 1KIXA 4K5VA 4YWLA 2XVSA 1IBMQ 1KLGD 1IKLA 1TWFH 4PNYA 3CC2A 1ICFB 4DV3Q 4DU9A 3GTGH 1K8OA 2ZTEA 1STGA 2EYHA 4DAYB 1FYCA 1V9PA 2MQHA 4QB4A 3NTKA 2UU9L 2ZXRA 1N9WA 5HY6A 4Y52H 1NTGA 1JJCB 3BVZA 2DJFC 4YY3L 2PCFB 2N55A 4WJ3M 2Y0SG 1JOQA 3EIVA 1O7ZA 2VB3X 3GTPH 2BA0A 3W5OA 1SNPA 3HKZE 3IFTA 1IKMA 3OTOL 3D6CA 4C1NI 2EZVA 5AJ3Q 1HNWQ 1GUTA 4ZLTF 4C3IB 5KIXA 3D8GA 3MXGA 4KD3A 1HHVA 4X62L 1VQ8A 2PI2A 1M8AA 3MVVA 1U9RA 3U9SA 1PFSA 5AFWA 2F0MA 5IP7H 1U0LA 4QF4A 1SE8A 2B2WC 5M3FG 3KBGA 2BH2A 3I4MG 1CFMA 2NZOA 4DV7Q 1CKOA 4XQJA 2DUDA 2HHHL 1BKBA 2KHJA 2RF4A 3ERSX 2NUCA 5CV9A 2ICIA 1SN8A 5I2XA 1PH5A 5C0XG 5C3XA 1MHWC 5M5YB 3J81c 3AB9A 1PTOF 1UE7A 1Q82C 2K6AA 5IT9E 3PUZA 1S4ZA 2MGSA 3RZDB 4OX9Q 2EXDA 2JXMB 1ESRA 3EN2A 2K28A 2CH4A 2A6EC 3KLSA 4LF9L 3A7AB 1L2FA 4JI3Q 3HEJA 5CYUA 5NUCA 1YNXA 3S17B 3C2PA 4IFDI 4B3RQ 3T4AC 2KHSA 1SJHD 2VZAA 3KJOA 3GTLB 4GNXC 1YJNA 5EQ0A 4LF6L 4RH6A 1AZPA 1RTNA 2YTYA 2J7ZA 4DR2L 1HRJA 4A93G 2F3IA 2O4XA 2YU9H 2L1BA 1C48A 1QILA 1JC7A 1LACA 4I7ZC 1QOHA 4BBSG 1EIHA 1EQTA 2LXJA 4QY7A 3S2DB 1XNQQ 1BBXC 1VQNA 1CHQD 1Q8IA 2VW9A 1QZGA 4A3KG 3M7GA 3I2ZA 1YITA 1Z47A 5IGDA 3RZOB 1ZKOA 3QIAA 1VQIA 3TP5A 2PW7A 3CC7A 3BYTB 1XMQQ 2OXPA 3JC66 4NXML 3RLNA 2QF7A 5HURA 4A3LG 3Q23A 2E5LL 2VS1A 4BBRG 4CBVA 3FHWA 4GNXA 4A3CH 1M1KC 4IUVA 2NVTB 1X3PA 1HR0Q 4UDUC 3A5ZB 2J0TD 2M00A 3WOEA 1B53A 4FF3A 3S1MB 1Q7YC 4OGQC 4RGMA 1TWCB 4RHSA 3TP8A 1E2VA 4NB3A 4J8QA 1FD7D 4CDCC 1MJEA 4C3HB 1DXMA 1A2TA 3NUCA 3OIPA 4FXDA 1AE3A 4DR5Q 5M9OA 5C4ZA 1LLRD 3UDGA 1KNAA 5C4JH 4BY1G 1A6XA 1IBKQ 1QUQA 3M85A 3DHQA 1XNRL 1UAPA 3FPUB 2AQ1B 4GN3B 1ESFA 3KOJA 4QJFA 1YZ6A 3S1QH 2MPMA 3GV3A 2A73B 1H95A 1E3PA 1IW7D 1E2ZA 2ATWA 2F0NA 1DJRD 4ODGA 4DV4L 4P2CB 3G71A 2GVAA 4BXXG 1I3QB 1SMYD 1BVSA 2VQFL 2RDHA 3PF4A 1CSQA 3CRLC 4X3UA 3E0JA 2V4DA 2K5NA 1D8LA 4R4OA 1T5EA 5BN4A 3V2TA 4KHPL 2D0PA 1CK1A 4QUFA 4DAVA 3I55A 4DK0A 2OTLA 1R9TB 1PH7A 3QR8A 2RKSA 4JOIA 2IY5B 4K0KQ 3JAMc 2CW0C 2D5DA 3B6YA 5JEAH 1S72A 1PH9A 3JAMi 5CORA 1Y1WB 2JA8B 1T5XD 4P71A 2Q2TA 2E2HH 4A3FH 3CHBD 4A3IG 5FJ8G 3H3VC 1KABA 4V190 3RLOA 5M5WB 4RAUC 5IWAQ 2A68D 3H91A 3MXNB 4A3EB 1D7QA 2L11A 1Q12A 4NW2A 1PYSB 2JYOA 4LFCL 4X64Q 2F0LA 4B3TL 5GADC 4HEDA 4DV2L 3VR6A 2G9DA 3J80c 4HSVA 3GD7A 3V05A 3J80i 4R1JA 1YNJD 4G7OC 1EYDA 3BVGA 3KJPA 2F0UA 3HOVG 1JJGA 2JA7H 3OMGA 4JI6Q 4JI2Q 3CQZH 4JI4Q 1GUWA 2XNAC 2ZM6L 3EQLC 4AYBB 2F0DA 2F0OA 3WWVA 4POFA 3CRKC 4KJOA 1PDQA 2RA4A 4BA2I 4DR6L 4EQOA 1V1PB 1HR0W 3PO3B 3SDZA 1WTWA 3HOZG 4L5QA 1SROA 3SHLA 1O80A 4HCEA 4A3MG 2KEEA 1SE2A 3GDEA 1KDBA 3KDFB 1STYA 3A8JE 4HIOA 4HCSA 3I4OA 5L37A 4MZ9A 1GUOA 2VQEQ 1WYDA 1A63A 4DR1Q 2EYFA 2NN6H 3A8KE 3W1BA 1HZ9A 3HOXG 4DA2A 4TKOB 4NPSA 4ZYSA 2I46A 4JI8Q 3BG3A 1XMOQ 1HXYD 2Z9HA 1EEFD 3HKSA 2FINB 3HOUG 1LT3D 3R8BA 1K28A 1XXGA 1K8AC 2FFKB 2K75A 1XX8A 1UE6A 1VQ6A 5CBEE 1E24A 3P7JA 4AQYL 4QQBX 2F0IA 1Q1EA 4I7AA 3H0GG 2NVQH 3GTGB 1LT6D 3DUZA 3K58A 1VQ7A 2R7FA 2A6ED 3M4YA 1ET9A 4IUPA 4LFBQ 2EOTA 3CCSA 2QDBA 1BXTA 3SEBA 3K7AB 3RUZA 4DPGA 5M5YH 1J5EQ 3Q8DA 1FNUA 1X56A 1YHBA 4IFDJ 1N33Q 3UI2A 4ALPA 2I5MX 4M1UB 1XPUA 2V1CC 1RF2D 5C44G 1AN8A 2UUAQ 5LMNQ 3GTQH 1E1OA 3PGZA 4OHJA 4HN7A 1ENFA 3K5NA 3M4QA 1DOMA 4OELB 4HIDA 3S17H 5G3LD 2MP1A 2WAQG 3SK5A 5IP9H 3GTLH 2SDFA 3S14B 1SFOH 4V0BA 1UUPA 1NE3A 2IHFA 4OWXB 1FVIA 1VQPA 4FF1A 2LFNA 4DR4L 1BBWA 1A2UA 4RFBA 1U4LA 5IODA 4IURA 1K0RA 3BZCA 3SR1A 3HOWG 4OO1H 4LWCA 1VQKA 3PUYA 3P20A 2BA1A 3S2DH 2MUYA 2R7ZG 4ZAIA 4J6HA 4F8MA 3SK6A 3RZOH 1KAAA 4J1MA 3Q24A 1H9KA 2B2TC 4JK1C 4A3JG 2B2YC 3PUWA 4WRDA 2K5QA 4BBRB 2NZ1D 4KN4C 4JV5Q 2LY7A 1KC8C 3I73A 2PPBC 2L4NA 4LF8Q 2EYLA 1B2TA 1TWGB 1DONA 1WVLA 2BOSA 3U9OA 1WTQA 1Z9FA 5KNBA 3PIOA 2N78A 3M7NA 2HDMA 3H3VH 4IOCA 4BY7B 2YTVA 1CTMA 2JJQA 2KEDA 4ZKBB 2KJXA 2YU9B 3S1MH 4AYBE 5M3MH 3K7UC 1PYBA 2B2UC 1STAA 1L0YB 1GUNA 1Q86C 1B9NA 1HZAA 2QW7A 2VL6A 4BY1B 2ZJPA 1B9MA 2DY8A 1JQYD 4OXPA 5T1IA 1DM0B 2B2TA 1I4PA 3F2DA 5J22A 3N6RA 1TIID 3SXHA 3E9IA 1EWIA 1H9SB 2RSNA 5DM63 2F0SA 4PMWA 2PZTA 2HCIA 2JA9A 4U68A 4YCUA 1EFWA 1SRUA 2R93G 4GOPB 4OL7A 4QUCA 4ZRZA 2N3SA 2JA6G 5DNFA 1FJGL 1QG7A 4K6LA 4JBMA 1SR3A 2RSOA 1S5FD 5FLMG 2ENBA 5T1GA 1RHPA 2CW0D 4JYAQ 5FLXE 4NKLA 1A3TA 4RCNA 3BYYB 1E1TA 4PMCA 4KMUC 2B2UA 3L9AX 4DK1A 4L8JA 3QG1A 5LMNW 4JI0L 1SNMA 1CA6A 4K14A 1LABA 2JP1A 1VQCA 4PQXA 5KNCA 4CJ1B 1R9TH 2B63G 3NEMA 3DM3A 3OWEB 2AKWB 1G91A 3J7ZC 2F4VQ 4LF7Q 1Y1WH 1PV4A 3MAQA 1EOVA 3ERQA 5IYBG 2PQAA 1NR2A 1X32A 2EE1A 1EY8A 2NN6I 3OMCA 3I3CA 3D4DA 3DMUA 1SNDA 5M5WH 5KGUA 3K6OA 3TZUA 1YJ9A 2G5DA 3RNUA 4C56C 2XWJB 1BCPC 5I9OA 1M90C 2K4KA 1OTCA 4DUZL 4R8NA 4F88A 3U50C 1FNWA 3PO2G 3CP0A 5J3BA 2SNSA 4JI1Q 3HOYH 1HNXQ 2D9UA 3T53B 5IYCG 2DGYA 1KNEA 1YBYA 2HCCA 1BOSA 4RWSC 4ULLA 1WTPA 3HOVB 1PH6A 3E3XA 5BN5A 3G6EA 2AMCB 1NMGA 3M3YB 1PRTB 3P75A 2L0CA 3FP9A 1D1KA 2WKCA 5LMUL 1VMPA 1Y8OB 3RN5A 1VQDA 4GOPC 2BDOA 5IT9L 4H7BA 1HUNA 2E2HB 4A3FB 1K0SA 3SK4A 4DV4Q 4B9XA 1EY9A 4KI0A 2ICEC 2JE6I 5IGCA 2A69D 2IX0A 2JA5G 2HIXA 4JI7L 1GKHA 4B3ML 4XDXA 5GROA 1SSOA 3GTMH 5EPKA 2EYPA 2AWOA 5C4XG 4GLAC 4ZQ3A 4C1NK 1A62A 4KHPQ 4FXKC 3CF5A 5JVG3 1NR4A 2XRQD 5ELOA 4DV1L 1I6VC 4R4IA 1I94L 3VDYA 3LX0A 3A55A 3QJYA 4IUUA 3CQZB 2PNHA 3KF8A 1N36Q 4LW1A 2ZXOA 1JCKB 4X6AH 5M3FH 5J1ZA 2RHQB 1BNZA 3SVMA 3R93A 3I4MH 4OO1I 2CQAA 2R92G 4ZUIA 2MO1A 4GN5A 2RHSB 2WKDA 2D2CC 1X3FA 2A8VA 1H9JA 5C0XH 3AEVA 4DAPA 4GNXB 1QVFA 3CCRA 1VQMA 3M4PA 3RR5A 2KCCA 3TZDA 1EU3A 1XTDA 1C4QA 2EJFC 1PFNA 3K7AH 3HFZB 1TS4A 3U58A 5KRUA 4KY5A 2AUKA 1YJWA 1SEBD 1K8GA 1PRTC 1O7YA 5E1FA 4X65L 3T1YL 4L5TA 4R4TA 3H3VI 2EQSA 2RCNA 1CT1D 1Z7TA 1NCVA 4DV5Q 2LSSA 1EL0A 2UUCL 3NHHA 3RN2A 1LT5D 1QUQB 3I4NG 4O1NA 1V8QA 4LUZA 2C5CA 1I5FA 1PZKD 4KK7A 3S16H 3J7AF 4A93H 3U4VA 3S14H 1KRTA 2NVQB 4XYOA 3K59A 3HOWB 1E2WA 3NSWA 5IYDG 1WJJA 4NP5A 3E5SA 4LFAQ 3BS1A 2EY5A 4DGZA 4A3KH 5JJKA 3STBD 2D62A 1EWCA 4EVOA 4EGVA 1ASZA 2PI2E 3KUPA 1D2BA 2CHBD 3BDOA 3GTQB 3RD4A 4A3LH 3OHXC 2ZTCA 1A3UA 5JVH3 5DAUA 4R8IA 4BBRH 5EKIA 2F0KA 4RGTA 4FP5D 5HGQA 1YNND 5JEAJ 1AE2A 3VR4A 4LNQA 5C3EG 1PYWD 5JJZA 2FMMA 1O7LA 1VQOA 1L0WA 1TWGH 1VQBA 3CCMA 1TR5A 5C5MA 1ZXTA 2XTIA 4K6DA 4A3DB 4AH6A 1SFOB 1IXRA 2SNMA 4BY7H 4KHZA 3ER0A 5KEEA 1MGSA 1VQEA 4K8IA 3R2TA 3AMUA 2SEBD 2IHEA 5E7NA 3EVQA 4IUTA 4PG3A 4NXNL 1SYCA 3CCEA 1Q90A 5CGKA 3CPWA 3TRZA 4BY1H 1Z6HA 3HGBA 3FKIG 1VQAA 4S3SA 2L12A 4OEMB 1SMXA 1JB3A 1N32Q 2KQ3A 1TWAH 2EY1A 3TSSA 1LTBD 4X66L 2JA6B 3LWEA 2UUBQ 1PFBA 1W2BA 1SJED 4L5SA 2RDGA 4WORA 1CHPD 4I65A 1SLJA 3LWUA 3RLFA 4DV6Q 3J81E 1T9HA 5HGTA 3NWTA 2Z6BA 4FVMA 4DXFA 5M3MB 3K5LA 4HJAA 3FVQA 4YWMA 1WD0A 4LMQD 1J6QA 1ZYRD 4KKSA 4PMBA 2O2LD 2B63B 1B3QA 1SXTA 1AP0A 2UXCL 3Q0AA 1EY4A 3VYRA 2Q2UA 2F03A 4JOIC 1LYLA 4LF4Q 4A3IH 1X65A 5FJ8H 5EGTA 2UXDQ 1O7IA 4A3BG 1JT8A 1XYIA 4G7HC 4YIJA 3WDNA 4MHEA 5EKLA 5M5XH 4OWTB 5KYIA 3NENA 2B29A 5CV5A 4CDEC 1ASYA 2A1AA 2ID0A 4KV6A 5KNDA 3HOVH 1BQQT 4KY7A 4FYDA 4YCWA 1P8LA 3T16A 2XGTA 2E76C 2Z1CA 3D6WA 1VCIA 4CGYB 1GOZA 1B1ZA 3M3YH 1KDAA 3GTKH 3F8TA 5C0XI 3VYUA 2WACA 3HKZG 1ILPA 1EYGA 1RKNA 1RL2A 3OW7A 2RQXA 1JR0D 4RMFA 2NZHA 3HOZH 4OWWB 1FJGQ 4GLVB 2AQ3B 3T1HQ 4LF5L 2HDLA 3L7ZC 4A3MH 3UDIA 2Z6KC 3MHBA 2X69A 1EUJA 1WCMB 3F2UA 5C4XB 1HJPA 4JVZA 2EXZA 1HTLD 4DR3L 4YHHQ 4CJ2C 3M4OH 4U673 1YHQA 4LK1C 4KD4A 1IHZA 1STNA 3PUVA 2UXBL 3HOYB 3S2HH 1PFMA 4XXEA 1B7YB 1CKNA 3M9BA 1WI5A 3HOUH 1F2ZA 1IBML 1MSHA 4FO2A 2F0QA 2F3WA 5ELFA 2B2VC 4DV3L 4DV0Q 2R92B 1YHAA 2F52A 1J9OA 3H0GH 1PRTD 5LHY1 2NTSA 2Z6KA 1GD7A 4DR7Q 2E2JB 4XT1B 1KD1C 3GTMB 1P16A 2Y0SB 2HQEA 1AFPA 4YWKA 1MD2D 1EU4A 3QO2A 3UDFA 1OXUA 3PIO3 4HIMA 3BDLA 5AJ3L 4GKJQ 1HNWL 2XRSD 4MN3A 1A3VA 1KQSA 1QJOA 1NJIC 2IX1A 4FNFA 4N8FA 3JAME 3D3RA 2WP8J 2E74C 1C8CA 1F9QA 1YI2A 3TS2A 2ZXPA 2B2VA 2Q2IA 5GQOA 3CMEA 1GXDC 1TQOA 3AQQA 1RTOA 1LTRD 5GAEC 3NQIA 4DV7L 4DFAA 5M3FB 1L1OB 4WJ4A 1EIFA 1Y8PB 3I4MB 5ISRA 1BCPF 1EY0A 3MXUA 4KKTA 4JI7Q 2ALYB 3A56A 1IL2A 2JK8A 5FO9B 2NBFA 3X3MA 5CMDA 1LUZA 2L55A 2K7VA 3AFQA 1HZCA 3J80E 3HOWH 5GAGC 4GKKQ 3C3LA 2EY2A 3KFUA 4P72A 3MZ5A 2Q8IB 3C46A 4OX9L 3MXPA 2R7ZH 2FJ2A 5ELBA 1KRSA 1I94Q 1IZ6A 3PCOB 1J8IA 4JI3L 5FO7B 3TP6A 4A3JH 2HD3A 3NTIA 2YYZA 5FLXL 5IOCA 1EYAA 1G291 1TT2A 2L9HA 2R61A 4B3RL 5C3EB 4JI5Q 5ELNA 1S40A 3CCJA 5JAVA 3BU2A 4O2DA 3HP3A 3RMHA 2OEOA 1S5BD 1SYGA 3O13A 2K5VA 5CBAE 3S16B 1F77A 3AU7A 4A3DH 4XQNA 4A93B 2PQAB 3P1HA 1II3A 2UU9Q 4UP8A 1XNQL 3DWQA 5K36G 4YY3Q 1AW7A 4BBSB 1D5MC 5LL6S 1TXYA 3NBIA 4CDFC 3I90A 1GHJA 1RODA 4A3KB 2EY6A 2IW3A 4C3IG 1XMQL 3OTOQ 4HAEA 1EIYB 1Y1VG 1LTAD 2GA4B 4NMZA 2VB2X 1HQMC 3A7LA 4TQUS 1SYBA 4X3TA 4X62Q 1L1OC 3OYYA 2A74C 1W6KA 4KTAA 2JQOA 2ES2A 2R93H 2EJGC 1VQHA 5I9PA 1MSGA 1G51A 1NMFA 1HR0L 2F0EA 2JA6H 2BDNA 1D5XC 4IPHA 5E3FA 3IRBA 5FLMH 4IUQA 3URYA 1DGSA 2HHHQ 1EQRA 2F0JA 4E6IA 3E9HA 3BVMA 1AH9A 4LUVA 1PRTF 2HIVA 4XTCS 3QB3A 4J15A 4ABNA 1SDFA 4RHRA 3H6MA 1LTLA 4DR5L 2QKIC 1XPRA 1BCPB 3CAMA 3QWNA 1IBKL 3PF5A 3W1GA 4G4KA 2B63H 3OSOA 5EAYA 5ELCA 2OWOA 2N8NA 5GAHC 4LF9Q 3BZKA 1L1OA 2BE5C 5IYBH 3R3OA 5LL6X 1D6EC 5IGGA 2Z0SA 3FDTA 1JB7A 4A3BB 3S1RB 1JMCA 1HZBA 1TWAB 2Y0SE 3KF8B 2KA7A 1K9MC 4LF6Q 3FMCA 3KF6A 4P74A 2MFIA 4TRDA 5C3WA 3CC4A 1I4HA 4DR2Q 1IBLL 1EZ6A 3T56B 1PMRA 4DN4M 3PO2H 4CHTB 5C0XJ 4B3SL 3TDQA 5IYCH 1EWHA 4K5XA 4ZKCB 1DZ1A 2RDFA 2GVBA 2HUGA 1YVCA 4K0KL 2K5DA 3TEHB 1F2MA 2F0WA 1VQLA 1QB5D 3D4RA 5CV4A 1X3GA 4H13C 2WFWA 4IPDA 1LV9A 2PNRC 2LS01 3K5MA 2E2IH 2LKVA 1JE4A 4NXMQ 4DNRB 4TSSA 1S3OA 3N52A 4JBJA 4O42A 1GUGA 3BJUA 2TMPA 2E5LQ 4A3IB 3I91A 5IWAL 1SNQA 2Z4IA 1OXVA 3ULJA 1B8AA 1DOLA 2JA5H 4X64L 2PQEA 1LTTD 3AFPA 2PZUA 3NPPA 2QDLA 1ENAA 1G8ZD 1TU2B 4FDBA 1WCMH 2PMZE 4JW0A 5M5XB 3EFXD 5C4XH 2AQ2B 5E4XA 2E2DC 3LNNA 1OXXK 4APVA 4PZ7A 4C3HG 2OQKA 2PO4A 2I5HA 2KBNA 4JI6L 4JI2L 3ZYYX 4JI4L 4KLKA 1PVOA 4HJ9A 2KCTA 3CCQA 3K5OA 4UP7A 4B08A 1LM0A 1HA5A 2DN8A 2QEJC 2X6GA 2A6HC 4N9PA 4N9TA 1TWHH 1EOTA 1CQVA 1TS5A 1TKWB 1XNRQ 1YIJA 3GTKB 4KY6A 2K01A 5CC4A 4IOAA 5TSSA 2K50A 2R92H 2LMCB 2NVYB 2IPKD 1N8RC 3CXCA 1GUSA 1I6HH 3HOZB 1IYUA 2KECA 2N49A 4N8X1 2VQEL 5K5PA 4A3MB 4IPGA 3KYHC 4DR1L 3S24A 2VQFQ 4IFDG 2E2JH 4KHVA 1I4XA 3H94A 3TREA 1SE4A 4XQQA 4C2MH 2IX3A 4IJLA 2QCPX 3M4OB 4JI8L 2CKZB 1WFQA 2R7DA 1XMOL 5I4DA 2ZJQA 3HOXB 3F2BA 5FOBB 3VR5A 2VUMG 3S2HB 4QCLA 3TQYA 3E0EA 5D3DA 2JA8G 4ME5A 1CKMA 3HOUB 1HNZL 1GM5A 2OF1A 3PSIA 3UDXA 4O0AA 3I4NH 5JJLA 4K5WA 1Q81C 1QE6A 4IJHA 4LF5Q 4C3JG 4Q5VA 4UY8C 4A3EG 4NDXA 4LFBL
chains in the Genus database with same CATH topology
4DNTB 1H9MA 1BR9A 3H0GB 1FGBD 1SBBB 3C1FA 2R6GA 4K2LA 3EA6A 1K83B 1LTSD 2O5IC 1F9RA 2IT1A 2KOLA 2A68C 3HS0C 2F0HA 3MFYA 3DWAA 2EPBA 3J7AV 5C44B 5A2QE 3S9WA 3J81L 3NBHA 1K8MA 1OO9B 3A8IE 4HR7B 3ONAB 1YNJC 3T51B 2K05A 1BF4A 5DM73 3OIQA 4CKCA 1TY2A 2NVXB 2RVLA 1QNKA 2WAQB 4F7XA 3QOJA 4G57A 1HTPA 3NWSA 5CV7A 3EROA 5FKAC 2KCNA 1VDZA 4Y7NB 4HMIA 5J39A 3K0YA 1KLUD 2R7ZB 1Y1VB 3GQBA 1Q3LA 5EPLA 1WTVA 3W3AA 1EFID 1S5DD 2NTTA 4A3JB 2F3VA 4G7ZC 1UNSA 2C9OA 2E75C 2EYOA 2B39A 4HMJA 3K57A 4FXGC 3TBIB 2NB0A 2Z8LA 1V1OA 2BE5D 1RJTA 2JEBI 1XTCD 5E4WC 2Q8RE 1JWSD 1L0XB 2AUJD 2B8GA 2B2WA 1NSNS 2B8FA 2NYZD 4DF7A 1EYCA 3D4WA 4IUNA 3W2DA 2R93B 1I4RA 5EJWA 4HSPA 2DY7A 5EBCA 1FNVA 1EY5A 2R3ZA 3VA5A 2PW5A 1SYDA 1DOKA 5EBDA 2IWHA 5I6WA 3DXJC 3FRPB 4H0LC 4DAYA 2SOBA 1PZID 4L6TB 3Q6SA 3ND8A 3G6JB 1PLFA 3J7YW 1BCPD 5EKKA 1CZGA 3JAML 2K33A 3CKIB 1HQRD 2A6HD 1B3AA 4XIGS 2DNCA 3H09A 3VYTA 3D31A 3PO2B 4KN7C 1XWEA 1KTKA 5JOBA 1PTOB 3G7LA 3ITPA 1M4VA 2ZT9C 2F0TA 2XWBB 3J80L 2K1BA 2FHTA 3HZXA 4WJWA 2E2IB 1SE3A 3PUXA 1JICA 3KBXA 4BA1I 1SAPA 1TVXA 1ONLA 5FK9C 5JPNC 2K04A 4BWGB 5CR3A 2JA5B 2DNEA 2L5TA 1STHA 1D5ZC 2I07B 5C5LA 3PMFA 2VNUD 3KK7A 4CKEA 2VUMB 4MIUA 1DD2A 2H1EA 3FPPA 2G9HD 2X6LA 1G2TA 3IKJA 4B9WA 1TWHB 1VMCA 4QIWB 5ELEA 1Q1BA 3TMEA 1LTGD 1I50B 3TN2A 4C3JB 2H4OA 2JEAI 3DM1A 1I6HB 3MEHA 1CM9A 2MJ8A 1AZQA 4CJ0B 4KJNA 4FF2A 1F9PA 3OPOA 5ELDA 2F0FA 1S5CD 4F87A 5JPMC 1WTRA 4X3SA 3HG9A 1PTOC 3VR2A 1JWMD 4C2MB 3A54A 5CV6A 4Z9CB 3ND9A 3BDCA 1JORA 3I8ZA 3VR3A 4K2KA 3TP7A 5JEAG 1FR3A 2NWGA 4OIKA 3IFDA 3R2IA 1DYQA 1RDPD 4A3GB 3FEWX 5EPJA 1HUMA 1EQVA 3I4NB 1A15A 2FMCA 2WV6D 1Y69U 1HFGA 3VA7A 2JSOA 1BO0A 1BUVT 1G6ZA 5K36H 3OWFA 1SNOA 2A69C 3NE5B 4LJZC 2IL8A 1BDOA 2M9VA 1Y8NB 2PMZB 1TWFB 2IJ0A 3GP7A 1I4QA 1OXSC 2O5JC 2BCOA 3V96A 4HTHA 1VF5C 1H9RA 4RA8A 2RBMA 1B44D 1R4PB 1EY6A 3GTPB 4QMGA 2AWNA 3QOLA 2NN6G 4ILWA 2PYKA 2F0GA 1HA6A 4RGNA 5CV8A 4L63B 4RKLA 1PXUA 3FKIB 4XYQA 2XSCA 4GZYC 3MXNA 4BS9A 1IL8A 2CVRA 1DCZA 4KKUA 3DWPA 1CZWA 3L3OC 3PIP3 1TS2A 4ZUJA 5DEHA 1F2YA 2EYJA 4RGOS 1JWUD 3MWYW 2K03A 4IN3A 2WINB 2WB1B 2M2LA 3IL8A 4DXGA 4OIJA 3GO5A 3CU7A 3HRZC 3NK9A 1CA5A 1HPCA 2MHVA 3NP8A 1ZEQX 1QCBD 1V1PA 3MA2B 1AEXA 4IQZA 5COYA 2F4IA 2EJMA 2F0VA 1QWYA 1WD1A 2EDGA 5C4HA 1E0BA 2PZWA 1OXTA 3DEOA 1B4OA 4K8JA 1SNCA 1ET6A 1EEID 3NQTA 2Q8TA 3E6ZX 1W6JA 1ICWA 1LT4D 1EIGA 1G2SA 4IALA 1MI2A 1ML0D 1TY0A 1YNNC 1D1IA 2TSSA 1RD9D 2OT2A 1JOOA 5I6YA 4OO1G 1UEAB 2B2YA 4WFN3 4H44C 4RKBA 3MTSA 5D14A 5IGBA 1SYEA 1PTOH 2J4XA 1S5ED 4Q0FA 4R9WA 2N88A 1MBYA 1O78A 1PZJD 1U4MA 5D3IB 3HKZB 3I70A 1R4QB 1WTOA 2K5WA 3VYSA 1VF7A 4EQNA 3GTJB 3NTHA 1GJXA 5A2QL 1RCVD 3MFGA 4M8AA 5A35A 3DEPA 4IFDH 1F9SA 5IGEA 1ILQA 1NUCA 5C6AA 3BZDB 5C4JB 3IAYA 3SK8A 3NXWA 2KVMA 5IIFA 3MC0B 3S1QB 2A5HA 1STBA 4UAIA 1ZYRC 1JOKA 1CQFA 3EJIA 1PTOD 1F2LA 2K32A 5G3LF 1EZ8A 1STEA 5D65A 1U4PA 2QILA 1HCZA 3T13A 4XT3B 1LTID 1NAPA 5KYLA 1LO5D 4LAAA 2Z4HA 1IW7C 3OOCA 1X3QA 4ID6A 3S15B 3KLRA 4JBWA 2EVBA 3X3NA 1U4RA 1SMYC 5F2DA 4CKBA 1HFNA 1ENCA 1CI3M 1EY7A 5BN3A 3KLSX 4FF4A 2F1MA 4RCOA 2XN9C 3I72A 2VXWA 3WOFA 2EYMA 1B50A 1I4GA 1SYFA 1WTXA 4IZ8A 1IYVA 4ZK9B 3S1NB 3PV0A 3GTOB 2KUMA 3I4LA 3GV6A 4EQPA 4X3KA 3SE0A 1TS3A 1H9SA 2JA7B 3Q22A 1GHKA 3C1EA 5I2YA 1KDCA 1V43A 2XIWA 5FO8B 5IGFA 1QNUA 2F0PA 2WIIB 4PV1C 4K5VA 2XVSA 1KLGD 1IKLA 4PNYA 4DU9A 1K8OA 1STGA 2EYHA 1FYCA 4QB4A 3NTKA 2ZXRA 3BVZA 2PCFB 2N55A 1JOQA 1O7ZA 2VB3X 2BA0A 1SNPA 3IFTA 1IKMA 3D6CA 4C1NI 2EZVA 1GUTA 4ZLTF 4C3IB 5KIXA 3D8GA 3MXGA 4KD3A 1HHVA 1M8AA 3MVVA 1U9RA 3U9SA 5AFWA 2F0MA 4QF4A 2B2WC 3KBGA 1CFMA 4XQJA 2NUCA 5CV9A 2ICIA 5I2XA 5C0XG 5C3XA 5M5YB 3AB9A 1PTOF 2K6AA 5IT9E 3PUZA 1S4ZA 2MGSA 3RZDB 2JXMB 1ESRA 2K28A 2A6EC 3KLSA 3A7AB 3HEJA 5CYUA 5NUCA 3S17B 3C2PA 4IFDI 3T4AC 2KHSA 1SJHD 3GTLB 5EQ0A 4RH6A 1AZPA 1RTNA 2J7ZA 1HRJA 2O4XA 2L1BA 1C48A 1QILA 1JC7A 1LACA 4I7ZC 1QOHA 1EIHA 1EQTA 3S2DB 1BBXC 1CHQD 1Q8IA 3M7GA 1Z47A 5IGDA 3RZOB 1ZKOA 3QIAA 3TP5A 2PW7A 3BYTB 2OXPA 2QF7A 5HURA 3Q23A 4CBVA 4IUVA 2NVTB 1X3PA 4UDUC 2J0TD 2M00A 3WOEA 1B53A 4FF3A 3S1MB 4OGQC 4RGMA 1TWCB 4RHSA 3TP8A 1E2VA 4J8QA 1FD7D 4C3HB 1DXMA 1A2TA 3NUCA 3OIPA 4FXDA 5M9OA 5C4ZA 1LLRD 1KNAA 1A6XA 3M85A 3DHQA 1UAPA 3FPUB 2AQ1B 1ESFA 2MPMA 3GV3A 2A73B 1IW7D 1E2ZA 2F0NA 1DJRD 4ODGA 4P2CB 1I3QB 1SMYD 2RDHA 3CRLC 4X3UA 3E0JA 2V4DA 5BN4A 1T5EA 3V2TA 1CK1A 4QUFA 4DAVA 4DK0A 1R9TB 2RKSA 2CW0C 2D5DA 5JEAH 5CORA 1Y1WB 2JA8B 1T5XD 3CHBD 3H3VC 1KABA 4V190 5M5WB 4RAUC 2A68D 3H91A 4A3EB 2L11A 1Q12A 4NW2A 2JYOA 2F0LA 4HEDA 3VR6A 2G9DA 4HSVA 3GD7A 3V05A 1YNJD 4G7OC 1EYDA 3BVGA 2F0UA 3OMGA 1GUWA 2XNAC 3EQLC 4AYBB 2F0DA 2F0OA 3CRKC 4KJOA 1PDQA 2RA4A 4BA2I 4EQOA 1V1PB 3PO3B 3SDZA 1WTWA 3SHLA 1O80A 4HCEA 2KEEA 1SE2A 1KDBA 1STYA 3A8JE 4HCSA 1GUOA 2EYFA 2NN6H 3A8KE 4DA2A 4TKOB 4ZYSA 2I46A 3BG3A 1HXYD 1EEFD 2FINB 1LT3D 3R8BA 1XXGA 2FFKB 1XX8A 5CBEE 3P7JA 2F0IA 1Q1EA 3GTGB 1LT6D 3DUZA 3K58A 2A6ED 3M4YA 1ET9A 4IUPA 2EOTA 2QDBA 1BXTA 3SEBA 3K7AB 3RUZA 1FNUA 4IFDJ 3UI2A 4M1UB 1RF2D 1AN8A 4OHJA 4HN7A 1ENFA 3K5NA 1DOMA 5G3LD 2MP1A 3SK5A 2SDFA 3S14B 4V0BA 1UUPA 4FF1A 2LFNA 1A2UA 4RFBA 1U4LA 5IODA 4IURA 3SR1A 4OO1H 3PUYA 3P20A 2BA1A 2MUYA 4ZAIA 4J6HA 4F8MA 3SK6A 1KAAA 4J1MA 3Q24A 1H9KA 2B2TC 4JK1C 2B2YC 3PUWA 4WRDA 2K5QA 4BBRB 2NZ1D 4KN4C 2LY7A 3I73A 2PPBC 2L4NA 2EYLA 1B2TA 1TWGB 1DONA 1WVLA 2BOSA 3U9OA 1WTQA 5KNBA 3M7NA 2HDMA 4BY7B 1CTMA 2KEDA 4ZKBB 2KJXA 2YU9B 2B2UC 1STAA 1L0YB 1GUNA 1B9NA 4BY1B 1B9MA 2DY8A 1JQYD 5T1IA 1DM0B 2B2TA 1I4PA 5J22A 3N6RA 1TIID 3SXHA 2RSNA 1H9SB 5DM63 2F0SA 4PMWA 2PZTA 2HCIA 4U68A 4OL7A 4QUCA 4ZRZA 5DNFA 1QG7A 4K6LA 2RSOA 1S5FD 2ENBA 5T1GA 1RHPA 2CW0D 5FLXE 4NKLA 1A3TA 4RCNA 3BYYB 4PMCA 4KMUC 2B2UA 3L9AX 4DK1A 4L8JA 3QG1A 1SNMA 1CA6A 4K14A 1LABA 2JP1A 4PQXA 5KNCA 4CJ1B 3OWEB 1G91A 3MAQA 3ERQA 1NR2A 1X32A 2EE1A 1EY8A 2NN6I 3OMCA 3I3CA 3D4DA 3DMUA 1SNDA 5KGUA 3K6OA 3TZUA 4C56C 2XWJB 1BCPC 5I9OA 4R8NA 4F88A 1FNWA 2SNSA 2D9UA 3T53B 4ULLA 1KNEA 2HCCA 3HOVB 1BOSA 4RWSC 1WTPA 5BN5A 3M3YB 1PRTB 3P75A 2L0CA 1D1KA 2WKCA 1VMPA 1Y8OB 2BDOA 5IT9L 4H7BA 1HUNA 2E2HB 4A3FB 3SK4A 4B9XA 1EY9A 4KI0A 2ICEC 2JE6I 5IGCA 2A69D 2IX0A 4XDXA 1SSOA 5EPKA 2EYPA 2AWOA 4ZQ3A 4C1NK 4FXKC 5JVG3 1NR4A 2XRQD 1I6VC 3LX0A 3A55A 3QJYA 4IUUA 3CQZB 3KF8A 2ZXOA 1JCKB 5J1ZA 1BNZA 3SVMA 3R93A 4OO1I 2CQAA 4ZUIA 2WKDA 2D2CC 1H9JA 5C0XH 4DAPA 2KCCA 3TZDA 1EU3A 1C4QA 2EJFC 1PFNA 1TS4A 5KRUA 4KY5A 2AUKA 1SEBD 1PRTC 1O7YA 5E1FA 1CT1D 1Z7TA 1NCVA 1EL0A 3NHHA 1LT5D 4O1NA 1V8QA 2C5CA 4KK7A 1PZKD 3J7AF 2NVQB 4XYOA 3K59A 3HOWB 1E2WA 3NSWA 4NP5A 3E5SA 3BS1A 2EY5A 4DGZA 2D62A 1EWCA 4EVOA 4EGVA 3KUPA 1D2BA 2CHBD 3BDOA 3GTQB 3RD4A 3OHXC 1A3UA 5JVH3 5DAUA 4R8IA 5EKIA 2F0KA 4RGTA 4FP5D 1YNND 5JEAJ 3VR4A 1PYWD 5JJZA 2FMMA 1O7LA 1TR5A 5C5MA 1ZXTA 4K6DA 4A3DB 1SFOB 2SNMA 4KHZA 5KEEA 1MGSA 4K8IA 3R2TA 3AMUA 2SEBD 3EVQA 4IUTA 1SYCA 1Q90A 5CGKA 1Z6HA 3HGBA 4S3SA 2L12A 1JB3A 2KQ3A 2EY1A 3TSSA 1LTBD 2JA6B 3LWEA 1PFBA 1SJED 2RDGA 4WORA 1CHPD 4I65A 3LWUA 3RLFA 3J81E 5HGTA 3NWTA 4FVMA 4DXFA 5M3MB 3K5LA 3FVQA 1WD0A 4LMQD 1ZYRD 4KKSA 4PMBA 2O2LD 2B63B 1SXTA 1AP0A 3Q0AA 1EY4A 3VYRA 2F03A 5EGTA 1XYIA 4G7HC 4YIJA 3WDNA 4MHEA 5EKLA 5KYIA 5CV5A 2ID0A 4KV6A 5KNDA 1BQQT 4KY7A 4FYDA 3T16A 2E76C 2Z1CA 3D6WA 1VCIA 4CGYB 1GOZA 1B1ZA 1KDAA 5C0XI 3VYUA 2WACA 1ILPA 1RKNA 3OW7A 2RQXA 1JR0D 2AQ3B 2HDLA 3L7ZC 3MHBA 2X69A 1WCMB 3F2UA 5C4XB 2EXZA 1HTLD 4CJ2C 4U673 4LK1C 4KD4A 1IHZA 1STNA 3PUVA 3HOYB 1PFMA 4XXEA 1F2ZA 1MSHA 4FO2A 2F0QA 2F3WA 5ELFA 2B2VC 2R92B 1J9OA 1PRTD 5LHY1 2NTSA 2E2JB 4XT1B 3GTMB 2Y0SB 2HQEA 1AFPA 1MD2D 1EU4A 3QO2A 3PIO3 1OXUA 3BDLA 2XRSD 4MN3A 1A3VA 1QJOA 2IX1A 4FNFA 3JAME 3D3RA 2WP8J 2E74C 1C8CA 1F9QA 2ZXPA 2B2VA 1GXDC 1TQOA 1RTOA 1LTRD 3NQIA 5M3FB 4DFAA 1Y8PB 3I4MB 5ISRA 1BCPF 1EY0A 3MXUA 4KKTA 3A56A 5FO9B 2NBFA 3X3MA 5CMDA 2L55A 2K7VA 3J80E 3C3LA 2EY2A 3MZ5A 2Q8IB 3C46A 3MXPA 2FJ2A 5ELBA 1J8IA 3TP6A 5FO7B 3NTIA 2YYZA 5FLXL 5IOCA 1EYAA 1G291 1TT2A 2L9HA 2R61A 5C3EB 5JAVA 3HP3A 3RMHA 2OEOA 1S5BD 1SYGA 3O13A 5CBAE 3S16B 1F77A 3AU7A 4XQNA 4A93B 3P1HA 1II3A 3DWQA 5K36G 1AW7A 4BBSB 1D5MC 5LL6S 3NBIA 3I90A 1GHJA 1RODA 4A3KB 2EY6A 2IW3A 4C3IG 4HAEA 1LTAD 2GA4B 4NMZA 2VB2X 1HQMC 3A7LA 4TQUS 1SYBA 4X3TA 2A74C 1W6KA 4KTAA 2EJGC 5I9PA 1MSGA 2F0EA 2BDNA 1D5XC 5E3FA 4IUQA 3URYA 2F0JA 4E6IA 3BVMA 1PRTF 4XTCS 3QB3A 4ABNA 1SDFA 4RHRA 3H6MA 2QKIC 1BCPB 3QWNA 4G4KA 3OSOA 5ELCA 2BE5C 3R3OA 5LL6X 1D6EC 5IGGA 3FDTA 4A3BB 3S1RB 1TWAB 2KA7A 3FMCA 4TRDA 5C3WA 1I4HA 1EZ6A 3T56B 1PMRA 4DN4M 4CHTB 5C0XJ 3TDQA 1EWHA 4K5XA 4ZKCB 1DZ1A 2RDFA 2HUGA 2K5DA 1F2MA 2F0WA 1QB5D 3D4RA 5CV4A 4H13C 1LV9A 2PNRC 2LS01 3K5MA 2LKVA 1JE4A 4DNRB 4TSSA 3N52A 4O42A 1GUGA 2TMPA 4A3IB 3I91A 1SNQA 2Z4IA 1OXVA 1DOLA 2PQEA 1LTTD 2PZUA 3NPPA 1ENAA 1G8ZD 1TU2B 5M5XB 3EFXD 2AQ2B 5E4XA 2E2DC 3LNNA 1OXXK 4C3HG 2PO4A 3ZYYX 3K5OA 4B08A 1HA5A 2DN8A 2QEJC 2X6GA 2A6HC 4N9PA 4N9TA 1EOTA 1CQVA 1TS5A 1TKWB 3GTKB 4KY6A 2K01A 5CC4A 5TSSA 2LMCB 2NVYB 2IPKD 1GUSA 3HOZB 1IYUA 2KECA 5K5PA 4A3MB 4IFDG 4KHVA 1I4XA 3H94A 1SE4A 4XQQA 2IX3A 3M4OB 2QCPX 3HOXB 5I4DA 5FOBB 3VR5A 3S2HB 4QCLA 5D3DA 4ME5A 3HOUB 2OF1A 4K5WA 1QE6A 4C3JG 4Q5VA 4NDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAA A;  1F2M A;  2F0W A;  2NUC A;  4J1M A;  5CV9 A;  5F2D A;  3C1F A;  5CV4 A;  3P1H A;  1II3 A;  3DHQ A;  4WRD A;  4WOR A;  1F2Z A;  1KDB A;  4I65 A;  4IAL A;  1STY A;  4K2L A;  5CR3 A;  5C3X A;  5I9O A;  4R8N A;  2F0Q A;  1NSN S;  1STH A;  1ENC A;  1EY7 A;  2F3W A;  2LKV A;  5HGT A;  5C5L A;  3PMF A;  3NHH A;  2SNS A;  4DF7 A;  1EYC A;  1JOO A;  5I6Y A;  2EYL A;  2EYF A;  3D4W A;  4IUN A;  2F0H A;  2F0N A;  1SNQ A;  3U9O A;  5M9O A;  4MIU A;  4HTH A;  4ODG A;  4PMB A;  3SHL A;  2EY6 A;  2EYM A;  4RKB A;  2RBM A;  1SYF A;  2PQE A;  5IGB A;  1SYE A;  5DAU A;  3P75 A;  4IZ8 A;  1EY4 A;  2PZU A;  3S9W A;  1ENA A;  1EY5 A;  4NMZ A;  1EY6 A;  3HEJ A;  3VA5 A;  1SYB A;  4NP5 A;  4B9W A;  5NUC A;  2PW5 A;  3E5S A;  4EQP A;  4KTA A;  2HQE A;  4QMG A;  2KHS A;  1STA A;  3QOL A;  5EGT A;  1SYD A;  3V2T A;  2EY5 A;  4H7B A;  3TME A;  4DGZ A;  5I9P A;  3BDL A;  2F0E A;  3SK4 A;  4B9X A;  5I6W A;  2F0I A;  1EY9 A;  1A3V A;  2PYK A;  2F0G A;  4EQN A;  4EVO A;  3C1E A;  5IGC A;  5E3F A;  4F7X A;  4YIJ A;  1KDC A;  2RKS A;  3QOJ A;  2O4X A;  4G57 A;  5CV8 A;  5EKL A;  3MEH A;  5J22 A;  4N9T A;  4N9P A;  2F0J A;  4RKL A;  2SOB A;  3SXH A;  4E6I A;  4KJN A;  5IGF A;  2F0P A;  5KYI A;  1A3U A;  2F0F A;  5CV5 A;  2F0S A;  2QDB A;  4K5V A;  5CV7 A;  2PZT A;  2EYP A;  2F0K A;  3ERO A;  3RUZ A;  4KY6 A;  1TQO A;  4ZQ3 A;  5CC4 A;  4PNY A;  3QB3 A;  5EKK A;  4HMI A;  5IGE A;  3H6M A;  4DU9 A;  4DFA A;  4OL7 A;  5J39 A;  1KAB A;  1NUC A;  1STG A;  4KV6 A;  2EYH A;  5C6A A;  5ISR A;  4KY7 A;  4QB4 A;  1TR5 A;  5C5M A;  5IGD A;  1EY0 A;  3T16 A;  4K6D A;  5CV6 A;  3BDC A;  3LX0 A;  1JOR A;  2ENB A;  3OSO A;  3TP5 A;  2PW7 A;  3SK8 A;  2SNM A;  5K5P A;  1KDA A;  3NXW A;  2OXP A;  4K2K A;  4ZUJ A;  3TP7 A;  2F0L A;  5IIF A;  5DEH A;  1F2Y A;  2EYJ A;  2F3V A;  2WAC A;  4NKL A;  1A3T A;  5C4Z A;  5HUR A;  5KEE A;  1JOQ A;  5J1Z A;  1RKN A;  3R3O A;  1STB A;  4K8I A;  4PMC A;  1JOK A;  2EY2 A;  1SNP A;  4KHV A;  4F8M A;  5IGG A;  3NK9 A;  3MZ5 A;  3EJI A;  3MXP A;  4ZUI A;  3SK5 A;  1SNM A;  3EVQ A;  4K14 A;  3NP8 A;  1EYD A;  2EYO A;  1SYC A;  5JOB A;  1EQV A;  3D6C A;  5KGU A;  2F0U A;  5CGK A;  4HMJ A;  2M00 A;  3OMG A;  1EZ8 A;  1AEX A;  4TRD A;  5C3W A;  3ITP A;  3TP6 A;  5KIX A;  3D8G A;  3MHB A;  4KD3 A;  2F0D A;  2F0O A;  1EZ6 A;  2F0V A;  2F0T A;  1A2U A;  3T13 A;  5IOC A;  3MVV A;  1EYA A;  1TT2 A;  1U9R A;  4ME5 A;  4KJO A;  2EXZ A;  4S3S A;  5C4H A;  5IOD A;  5KYL A;  2F0M A;  3TP8 A;  3HZX A;  4QF4 A;  2OF1 A;  2KQ3 A;  2PZW A;  3ERQ A;  3SR1 A;  4EQO A;  2EY1 A;  4LAA A;  3OWF A;  1SNO A;  4K8J A;  5JAV A;  4ID6 A;  4K5X A;  4KD4 A;  1IHZ A;  1EY8 A;  1STN A;  1SNC A;  4K5W A;  1A2T A;  3OMC A;  4KY5 A;  3NUC A;  2RDF A;  5KRU A;  2OEO A;  3NQT A;  3D4D A;  3DMU A;  1SND A;  1SYG A;  4J6H A;  5E1F A;  4NDX A;  3SK6 A; 
#chains in the Genus database with same CATH topology
 2ASB A;  4DNT B;  1H9M A;  1BR9 A;  3H0G B;  4UHV A;  1FGB D;  1SBB B;  3C1F A;  2R6G A;  3K80 C;  3EA6 A;  4K2L A;  1K83 B;  1LTS D;  2H5X A;  1J5E L;  2O5I C;  5IYD H;  3A0J A;  1X6O A;  1Q8K A;  1F9R A;  4LFC Q;  2IT1 A;  4B3T Q;  1N33 L;  4DV2 Q;  1K3B C;  2KOL A;  3D0F A;  1Q46 A;  1WOC A;  2A68 C;  3HS0 C;  1HH2 P;  2F0H A;  3MFY A;  5IT9 c;  3DWA A;  2UUA L;  5LMN L;  2EPB A;  1CUK A;  3J7A V;  4AYB G;  5C44 B;  5A2Q E;  3S9W A;  3J81 L;  2ZM6 Q;  3NBH A;  1K8M A;  3I56 A;  1OO9 B;  3A8I E;  4HR7 B;  3ONA B;  3PO3 G;  1YNJ C;  3T51 B;  2K05 A;  1BF4 A;  5DM7 3;  3OIQ A;  4CKC A;  1TY2 A;  3ZJY C;  5C3E H;  1XPO A;  3A74 A;  4DR6 Q;  2NVX B;  2RVL A;  1QNK A;  1QVC A;  2WAQ B;  4A3G G;  2KHI A;  4F7X A;  3QOJ A;  4G57 A;  5IY0 A;  1HTP A;  3NWS A;  2I5L X;  1VQJ A;  5CV7 A;  3ERO A;  5FKA C;  4HJ5 A;  2KCN A;  1VDZ A;  4Y7N B;  4DUY L;  3U4Z A;  4HMI A;  4BBS H;  5J39 A;  3K0Y A;  1KLU D;  2R7Z B;  1Y1V B;  3GQB A;  1Q3L A;  5EPL A;  1WTV A;  3FKI H;  1A0I A;  3W3A A;  4IPC A;  4JV5 L;  1EFI D;  3I7F A;  5BR8 L;  1S5D D;  4JBK A;  2NTT A;  4A3J B;  4LF8 L;  2F3V A;  4P75 A;  4G7Z C;  1KAW A;  3L2P A;  1UNS A;  2C9O A;  4DKA C;  2FXQ A;  2E75 C;  3CW2 C;  3CCV A;  2EYO A;  2B39 A;  1PHJ A;  4HMJ A;  4AQY Q;  3K57 A;  4FXG C;  3TBI B;  2NB0 A;  2Z8L A;  3J81 i;  1V1O A;  2BE5 D;  3PQI A;  2K5H A;  1RJT A;  2JEB I;  1XTC D;  1BBU A;  5E4W C;  2Q8R E;  1JWS D;  1L0X B;  2AUJ D;  1VQG A;  2B8G A;  4HIK A;  1QVG A;  1C9O A;  2B2W A;  1K3R A;  1UE1 A;  1NSN S;  2B8F A;  2NYZ D;  5IP7 G;  1PA6 A;  4DF7 A;  1EYC A;  3D4W A;  4IUN A;  1CKN B;  4IO9 A;  3W2D A;  2R93 B;  1I4R A;  5EJW A;  4A3B H;  3S1R H;  4HSP A;  3K8A A;  3L0O A;  2HT1 A;  1RIP A;  2DY7 A;  5EBC A;  4JYA L;  3ULP A;  1FNV A;  5JJI A;  1EY5 A;  4BXX H;  2R3Z A;  4GN4 B;  4DR4 Q;  3VA5 A;  2PW5 A;  2B3G A;  1VQ5 A;  1SYD A;  2WB1 G;  1DOK A;  5EBD A;  2A19 A;  2IWH A;  5I6W A;  1YEZ A;  4JCV E;  3DXJ C;  3FRP B;  4H0L C;  2F4V L;  4LF7 L;  4DAY A;  2SOB A;  1PZI D;  4L6T B;  3Q6S A;  3ND8 A;  3G6J B;  3H15 A;  1PLF A;  1PH1 A;  3J7Y W;  1BCP D;  4POG A;  5EKK A;  4DK6 C;  1CZG A;  1C0A A;  3GTJ H;  4BY7 G;  3JAM L;  2K33 A;  2CCZ A;  3CKI B;  4TVA B;  1HQR D;  2A6H D;  4QL5 A;  1B3A A;  4RG1 A;  4XIG S;  2DNC A;  3H09 A;  4JI1 L;  4LUO A;  1HNX L;  2YTX A;  3VYT A;  3D31 A;  3PO2 B;  4KN7 C;  1XWE A;  1KTK A;  2VY3 A;  5JOB A;  3CPF A;  3G48 A;  1PTO B;  3G7L A;  2WAQ E;  3ITP A;  3LGJ A;  1M4V A;  2ZT9 C;  2F0T A;  2XWB B;  3J80 L;  2K1B A;  2FHT A;  3HZX A;  4WJW A;  2E2I B;  1SE3 A;  1MKH A;  2OCE A;  3PUX A;  1JIC A;  2NVY H;  3KBX A;  4A3C G;  4BA1 I;  4DAM A;  3NEL A;  2CQO A;  1SAP A;  1TVX A;  1ONL A;  1UE5 A;  2QEX A;  5FK9 C;  5JPN C;  1IBL Q;  2K04 A;  4BWG B;  5CR3 A;  2JA5 B;  2ZTD A;  2DNE A;  2L5T A;  1STH A;  1D5Z C;  2KCM A;  2I07 B;  5C5L A;  3PMF A;  4B3S Q;  3S15 H;  2VNU D;  3G4S A;  3KK7 A;  4CKE A;  4DNI A;  2VUM B;  4MIU A;  1DD2 A;  2H1E A;  3FPP A;  4JI0 Q;  3HOX H;  3EBE A;  1N36 L;  2G9H D;  1EQQ A;  4JC0 A;  2D0O A;  2X6L A;  2CWP A;  1G2T A;  3IKJ A;  4B9W A;  1TWH B;  4H02 A;  1VMC A;  4QIW B;  5ELE A;  1PH8 A;  1Q1B A;  4GS3 A;  3TME A;  1LTG D;  1I50 B;  3TN2 A;  4C3J B;  2H4O A;  3J7A 5;  2JEA I;  3DM1 A;  3S1N H;  1I6H B;  3MEH A;  1CM9 A;  2MJ8 A;  1AZQ A;  3GTO H;  4CJ0 B;  4KJN A;  4FF2 A;  1F9P A;  3OPO A;  5ELD A;  2F0F A;  1VQF A;  1K83 H;  1S5C D;  4F87 A;  4DUZ Q;  5JPM C;  1XJV A;  1IYJ B;  1WTR A;  3ULL A;  4PZ6 A;  4X3S A;  2QA4 A;  3HG9 A;  1PTO C;  3VR2 A;  1JWM D;  1N34 Q;  3CD6 A;  4C2M B;  3A54 A;  5CV6 A;  1NBW A;  4Z9C B;  3ND9 A;  3BDC A;  4GLX A;  4DV5 L;  2AHO B;  1JOR A;  3I8Z A;  3VR3 A;  5C44 H;  4K2K A;  3TP7 A;  5JEA G;  1FR3 A;  2NWG A;  4OIK A;  4R4Q A;  1MIU A;  3IFD A;  5LMU Q;  3R2I A;  4A3F G;  1UEB A;  1DYQ A;  1RDP D;  4A3G B;  3FEW X;  5EPJ A;  1HUM A;  1EQV A;  2NVX H;  3I4N B;  1V1Q A;  1A15 A;  2FMC A;  2MO0 A;  2WV6 D;  1Y69 U;  1PH4 A;  1HFG A;  3VA7 A;  2JSO A;  1BO0 A;  1BUV T;  4LFA L;  1UWV A;  1G6Z A;  4B3M Q;  5K36 H;  3KF6 B;  3OWF A;  4Y7N H;  1SNO A;  2A69 C;  3NE5 B;  4C3I H;  4LJZ C;  3A5U A;  4DV1 Q;  2JA7 G;  2JN4 A;  1Y1V H;  2IL8 A;  1BDO A;  1HNZ Q;  2M9V A;  1Y8N B;  2PMZ B;  1E7Z A;  1TWF B;  2IJ0 A;  3GP7 A;  1I4Q A;  1OXS C;  2O5J C;  1KL9 A;  3UE0 A;  2BCO A;  4JPB W;  3V96 A;  4HTH A;  4P73 A;  1VF5 C;  1H9R A;  4RA8 A;  2RBM A;  2C35 B;  2GN5 A;  1B44 D;  1KXL A;  1VS0 A;  1R4P B;  1EY6 A;  3GTP B;  2L15 A;  4QMG A;  2AWN A;  3QOL A;  3RZD H;  2NN6 G;  4ILW A;  3MEF A;  3OW2 A;  2PYK A;  2F0G A;  1HA6 A;  4RGN A;  5CV8 A;  4L63 B;  4X65 Q;  4MTK A;  4RKL A;  1PXU A;  1N32 L;  3FKI B;  3T1Y Q;  1CSP A;  4XYQ A;  2XSC A;  4OON A;  1E22 A;  3MXN A;  4BS9 A;  4GZY C;  4ME3 A;  2UUB L;  4ZCK A;  1IL8 A;  2UUC Q;  1JJ2 A;  4A75 A;  2CVR A;  1DCZ A;  2K52 A;  4KKU A;  3DWP A;  1CZW A;  4DV6 L;  3L3O C;  1JE5 A;  1NY4 A;  2YV5 A;  1TS2 A;  3PIP 3;  4ZUJ A;  5DEH A;  1F2Y A;  2EYJ A;  5H1S E;  4RGO S;  3ICE A;  1JWU D;  3MWY W;  5FLX c;  2K03 A;  4IN3 A;  4DUY Q;  2WIN B;  2WB1 B;  2M2L A;  3IL8 A;  4DXG A;  4OIJ A;  3GO5 A;  3CU7 A;  3HRZ C;  3NK9 A;  3CCU A;  1CA5 A;  3CCL A;  4EQ5 A;  2EIF A;  1HPC A;  2MHV A;  4QIW E;  3NP8 A;  2DJG C;  1ZEQ X;  1QCB D;  1GVP A;  3F1Z A;  1V1P A;  3MA2 B;  1X3E A;  1VQ9 A;  1AEX A;  4IQZ A;  5COY A;  4UPA A;  5BR8 Q;  4CDD C;  4HJ7 A;  2F4I A;  2EJM A;  1B70 B;  2F0V A;  4LF4 L;  1QWY A;  1WD1 A;  2EDG A;  5C4H A;  1E0B A;  2PZW A;  1OXT A;  2LXK A;  3DEO A;  3STB C;  2UXD L;  1B4O A;  3KDF A;  4K8J A;  2NVT H;  1SNC A;  1ET6 A;  1FL0 A;  5IP9 G;  1EEI D;  4A3D G;  3NQT A;  2Q8T A;  1VQ4 A;  3E6Z X;  1W6J A;  1ICW A;  2OQ0 A;  4A76 A;  1LT4 D;  1EIG A;  1G2S A;  1TWC H;  4IAL A;  1MI2 A;  1ML0 D;  1TY0 A;  1YNN C;  1PH2 A;  2BH8 A;  1D1I A;  2TSS A;  1RD9 D;  4C3H H;  2OT2 A;  1JOO A;  5I6Y A;  4OO1 G;  1UEA B;  3TS0 A;  2B2Y A;  4WFN 3;  4H44 C;  4YCV A;  4RKB A;  3MTS A;  4NXN Q;  5D14 A;  3J81 j;  5IGB A;  1SYE A;  1NNX A;  1PTO H;  2J4X A;  1S5E D;  2RCF A;  4Q0F A;  4R9W A;  2N88 A;  1MBY A;  1O78 A;  1PZJ D;  1KHI A;  2CH4 W;  1U4M A;  5D3I B;  3HKZ B;  3I70 A;  2Q2H A;  3T1H L;  1R4Q B;  1WTO A;  2K5W A;  3VYS A;  1I3Q H;  4X66 Q;  2OTJ A;  1VF7 A;  3NBH B;  4EQN A;  3GTJ B;  3KLW A;  3NTH A;  1GJX A;  1U5K A;  5A2Q L;  2MNA A;  1RCV D;  1X55 A;  4YHH L;  2P5Z X;  1WTH A;  3MFG A;  3DEP A;  4M8A A;  1F9S A;  4UP9 A;  5A35 A;  1PH3 A;  4IFD H;  5M3M G;  4EX5 A;  1N34 L;  5IGE A;  1ILQ A;  4MNO A;  1NUC A;  5C6A A;  3BZD B;  2QGQ A;  2VUM H;  5C4J B;  3IAY A;  3SK8 A;  4A4I A;  2JA8 H;  3NXW A;  2KVM A;  4DV0 L;  5IIF A;  3MC0 B;  2UXC Q;  3S1Q B;  2A5H A;  1STB A;  4UAI A;  1ZYR C;  2I0Q A;  1JOK A;  1CQF A;  2CFM A;  3EJI A;  3PIP A;  1PTO D;  1F2L A;  1I50 H;  2K32 A;  4C3J H;  4A3E H;  2E8G A;  5G3L F;  3DLL A;  1EZ8 A;  4JG2 A;  1STE A;  5D65 A;  1FGU A;  1GO3 E;  4DR7 L;  1U4P A;  4QGU A;  2QIL A;  1HCZ A;  3T13 A;  4XT3 B;  1LTI D;  1NAP A;  5KYL A;  2ZJR A;  1MJC A;  1LO5 D;  4GKJ L;  4LAA A;  2HQL A;  2Z4H A;  1IW7 C;  3OOC A;  1X3Q A;  4ID6 A;  1K73 C;  3S15 B;  3KLR A;  4JBW A;  2EVB A;  3X3N A;  1U4R A;  1SMY C;  5F2D A;  4CKB A;  1HFN A;  3K81 C;  2CWA A;  1ENC A;  1CI3 M;  1EY7 A;  3AYH B;  5BN3 A;  3PO3 H;  1W3S A;  3KLS X;  4FF4 A;  1Y1W G;  2F1M A;  4AIM A;  4R4C A;  4HJ8 A;  4RCO A;  5IE8 A;  4MTN A;  2WB1 E;  2XN9 C;  4A3G H;  3I72 A;  2VXW A;  1A8V A;  3WOF A;  2EYM A;  1Y14 B;  1B50 A;  1I4G A;  1WCM G;  1SYF A;  1WTX A;  4IZ8 A;  5DLQ E;  4PZ8 A;  1IYV A;  4ZK9 B;  3S1N B;  1G6P A;  2KEN A;  4GKK L;  3PV0 A;  1QZH A;  3GTO B;  2KUM A;  3I4L A;  3GV6 A;  4EQP A;  4X3K A;  3SE0 A;  4DR3 Q;  1TS3 A;  3HOY G;  4L5R C;  1X54 A;  1X9N A;  1H9S A;  1C7Y A;  2K14 A;  3K0X A;  2JA7 B;  3Q22 A;  1GHK A;  2UXB Q;  3C1E A;  3SGI A;  4DK3 C;  5I2Y A;  3CMA A;  1KDC A;  4GOP A;  3UE1 A;  1V43 A;  2XIW A;  3F2C A;  5FO8 B;  4JI5 L;  5IGF A;  1QNU A;  2F0P A;  2WII B;  4PV1 C;  1KIX A;  4K5V A;  4YWL A;  2XVS A;  1IBM Q;  1KLG D;  1IKL A;  1TWF H;  4PNY A;  3CC2 A;  1ICF B;  4DV3 Q;  4DU9 A;  3GTG H;  1K8O A;  2ZTE A;  1STG A;  2EYH A;  4DAY B;  1FYC A;  1V9P A;  2MQH A;  4QB4 A;  3NTK A;  2UU9 L;  2ZXR A;  1N9W A;  5HY6 A;  4Y52 H;  1NTG A;  1JJC B;  3BVZ A;  2DJF C;  4YY3 L;  2PCF B;  2N55 A;  4WJ3 M;  2Y0S G;  1JOQ A;  3EIV A;  1O7Z A;  2VB3 X;  3GTP H;  2BA0 A;  3W5O A;  1SNP A;  3HKZ E;  3IFT A;  1IKM A;  3OTO L;  3D6C A;  4C1N I;  2EZV A;  5AJ3 Q;  1HNW Q;  1GUT A;  4ZLT F;  4C3I B;  5KIX A;  3D8G A;  3MXG A;  4KD3 A;  1HHV A;  4X62 L;  1VQ8 A;  2PI2 A;  1M8A A;  3MVV A;  1U9R A;  3U9S A;  1PFS A;  5AFW A;  2F0M A;  5IP7 H;  1U0L A;  4QF4 A;  1SE8 A;  2B2W C;  5M3F G;  3KBG A;  2BH2 A;  3I4M G;  1CFM A;  2NZO A;  4DV7 Q;  1CKO A;  4XQJ A;  2DUD A;  2HHH L;  1BKB A;  2KHJ A;  2RF4 A;  3ERS X;  2NUC A;  5CV9 A;  2ICI A;  1SN8 A;  5I2X A;  1PH5 A;  5C0X G;  5C3X A;  1MHW C;  5M5Y B;  3J81 c;  3AB9 A;  1PTO F;  1UE7 A;  1Q82 C;  2K6A A;  5IT9 E;  3PUZ A;  1S4Z A;  2MGS A;  3RZD B;  4OX9 Q;  2EXD A;  2JXM B;  1ESR A;  3EN2 A;  2K28 A;  2CH4 A;  2A6E C;  3KLS A;  4LF9 L;  3A7A B;  1L2F A;  4JI3 Q;  3HEJ A;  5CYU A;  5NUC A;  1YNX A;  3S17 B;  3C2P A;  4IFD I;  4B3R Q;  3T4A C;  2KHS A;  1SJH D;  2VZA A;  3KJO A;  3GTL B;  4GNX C;  1YJN A;  5EQ0 A;  4LF6 L;  4RH6 A;  1AZP A;  1RTN A;  2YTY A;  2J7Z A;  4DR2 L;  1HRJ A;  4A93 G;  2F3I A;  2O4X A;  2YU9 H;  2L1B A;  1C48 A;  1QIL A;  1JC7 A;  1LAC A;  4I7Z C;  1QOH A;  4BBS G;  1EIH A;  1EQT A;  2LXJ A;  4QY7 A;  3S2D B;  1XNQ Q;  1BBX C;  1VQN A;  1CHQ D;  1Q8I A;  2VW9 A;  1QZG A;  4A3K G;  3M7G A;  3I2Z A;  1YIT A;  1Z47 A;  5IGD A;  3RZO B;  1ZKO A;  3QIA A;  1VQI A;  3TP5 A;  2PW7 A;  3CC7 A;  3BYT B;  1XMQ Q;  2OXP A;  3JC6 6;  4NXM L;  3RLN A;  2QF7 A;  5HUR A;  4A3L G;  3Q23 A;  2E5L L;  2VS1 A;  4BBR G;  4CBV A;  3FHW A;  4GNX A;  4A3C H;  1M1K C;  4IUV A;  2NVT B;  1X3P A;  1HR0 Q;  4UDU C;  3A5Z B;  2J0T D;  2M00 A;  3WOE A;  1B53 A;  4FF3 A;  3S1M B;  1Q7Y C;  4OGQ C;  4RGM A;  1TWC B;  4RHS A;  3TP8 A;  1E2V A;  4NB3 A;  4J8Q A;  1FD7 D;  4CDC C;  1MJE A;  4C3H B;  1DXM A;  1A2T A;  3NUC A;  3OIP A;  4FXD A;  1AE3 A;  4DR5 Q;  5M9O A;  5C4Z A;  1LLR D;  3UDG A;  1KNA A;  5C4J H;  4BY1 G;  1A6X A;  1IBK Q;  1QUQ A;  3M85 A;  3DHQ A;  1XNR L;  1UAP A;  3FPU B;  2AQ1 B;  4GN3 B;  1ESF A;  3KOJ A;  4QJF A;  1YZ6 A;  3S1Q H;  2MPM A;  3GV3 A;  2A73 B;  1H95 A;  1E3P A;  1IW7 D;  1E2Z A;  2ATW A;  2F0N A;  1DJR D;  4ODG A;  4DV4 L;  4P2C B;  3G71 A;  2GVA A;  4BXX G;  1I3Q B;  1SMY D;  1BVS A;  2VQF L;  2RDH A;  3PF4 A;  1CSQ A;  3CRL C;  4X3U A;  3E0J A;  2V4D A;  2K5N A;  1D8L A;  4R4O A;  1T5E A;  5BN4 A;  3V2T A;  4KHP L;  2D0P A;  1CK1 A;  4QUF A;  4DAV A;  3I55 A;  4DK0 A;  2OTL A;  1R9T B;  1PH7 A;  3QR8 A;  2RKS A;  4JOI A;  2IY5 B;  4K0K Q;  3JAM c;  2CW0 C;  2D5D A;  3B6Y A;  5JEA H;  1S72 A;  1PH9 A;  3JAM i;  5COR A;  1Y1W B;  2JA8 B;  1T5X D;  4P71 A;  2Q2T A;  2E2H H;  4A3F H;  3CHB D;  4A3I G;  5FJ8 G;  3H3V C;  1KAB A;  4V19 0;  3RLO A;  5M5W B;  4RAU C;  5IWA Q;  2A68 D;  3H91 A;  3MXN B;  4A3E B;  1D7Q A;  2L11 A;  1Q12 A;  4NW2 A;  1PYS B;  2JYO A;  4LFC L;  4X64 Q;  2F0L A;  4B3T L;  5GAD C;  4HED A;  4DV2 L;  3VR6 A;  2G9D A;  3J80 c;  4HSV A;  3GD7 A;  3V05 A;  3J80 i;  4R1J A;  1YNJ D;  4G7O C;  1EYD A;  3BVG A;  3KJP A;  2F0U A;  3HOV G;  1JJG A;  2JA7 H;  3OMG A;  4JI6 Q;  4JI2 Q;  3CQZ H;  4JI4 Q;  1GUW A;  2XNA C;  2ZM6 L;  3EQL C;  4AYB B;  2F0D A;  2F0O A;  3WWV A;  4POF A;  3CRK C;  4KJO A;  1PDQ A;  2RA4 A;  4BA2 I;  4DR6 L;  4EQO A;  1V1P B;  1HR0 W;  3PO3 B;  3SDZ A;  1WTW A;  3HOZ G;  4L5Q A;  1SRO A;  3SHL A;  1O80 A;  4HCE A;  4A3M G;  2KEE A;  1SE2 A;  3GDE A;  1KDB A;  3KDF B;  1STY A;  3A8J E;  4HIO A;  4HCS A;  3I4O A;  5L37 A;  4MZ9 A;  1GUO A;  2VQE Q;  1WYD A;  1A63 A;  4DR1 Q;  2EYF A;  2NN6 H;  3A8K E;  3W1B A;  1HZ9 A;  3HOX G;  4DA2 A;  4TKO B;  4NPS A;  4ZYS A;  2I46 A;  4JI8 Q;  3BG3 A;  1XMO Q;  1HXY D;  2Z9H A;  1EEF D;  3HKS A;  2FIN B;  3HOU G;  1LT3 D;  3R8B A;  1K28 A;  1XXG A;  1K8A C;  2FFK B;  2K75 A;  1XX8 A;  1UE6 A;  1VQ6 A;  5CBE E;  1E24 A;  3P7J A;  4AQY L;  4QQB X;  2F0I A;  1Q1E A;  4I7A A;  3H0G G;  2NVQ H;  3GTG B;  1LT6 D;  3DUZ A;  3K58 A;  1VQ7 A;  2R7F A;  2A6E D;  3M4Y A;  1ET9 A;  4IUP A;  4LFB Q;  2EOT A;  3CCS A;  2QDB A;  1BXT A;  3SEB A;  3K7A B;  3RUZ A;  4DPG A;  5M5Y H;  1J5E Q;  3Q8D A;  1FNU A;  1X56 A;  1YHB A;  4IFD J;  1N33 Q;  3UI2 A;  4ALP A;  2I5M X;  4M1U B;  1XPU A;  2V1C C;  1RF2 D;  5C44 G;  1AN8 A;  2UUA Q;  5LMN Q;  3GTQ H;  1E1O A;  3PGZ A;  4OHJ A;  4HN7 A;  1ENF A;  3K5N A;  3M4Q A;  1DOM A;  4OEL B;  4HID A;  3S17 H;  5G3L D;  2MP1 A;  2WAQ G;  3SK5 A;  5IP9 H;  3GTL H;  2SDF A;  3S14 B;  1SFO H;  4V0B A;  1UUP A;  1NE3 A;  2IHF A;  4OWX B;  1FVI A;  1VQP A;  4FF1 A;  2LFN A;  4DR4 L;  1BBW A;  1A2U A;  4RFB A;  1U4L A;  5IOD A;  4IUR A;  1K0R A;  3BZC A;  3SR1 A;  3HOW G;  4OO1 H;  4LWC A;  1VQK A;  3PUY A;  3P20 A;  2BA1 A;  3S2D H;  2MUY A;  2R7Z G;  4ZAI A;  4J6H A;  4F8M A;  3SK6 A;  3RZO H;  1KAA A;  4J1M A;  3Q24 A;  1H9K A;  2B2T C;  4JK1 C;  4A3J G;  2B2Y C;  3PUW A;  4WRD A;  2K5Q A;  4BBR B;  2NZ1 D;  4KN4 C;  4JV5 Q;  2LY7 A;  1KC8 C;  3I73 A;  2PPB C;  2L4N A;  4LF8 Q;  2EYL A;  1B2T A;  1TWG B;  1DON A;  1WVL A;  2BOS A;  3U9O A;  1WTQ A;  1Z9F A;  5KNB A;  3PIO A;  2N78 A;  3M7N A;  2HDM A;  3H3V H;  4IOC A;  4BY7 B;  2YTV A;  1CTM A;  2JJQ A;  2KED A;  4ZKB B;  2KJX A;  2YU9 B;  3S1M H;  4AYB E;  5M3M H;  3K7U C;  1PYB A;  2B2U C;  1STA A;  1L0Y B;  1GUN A;  1Q86 C;  1B9N A;  1HZA A;  2QW7 A;  2VL6 A;  4BY1 B;  2ZJP A;  1B9M A;  2DY8 A;  1JQY D;  4OXP A;  5T1I A;  1DM0 B;  2B2T A;  1I4P A;  3F2D A;  5J22 A;  3N6R A;  1TII D;  3SXH A;  3E9I A;  1EWI A;  1H9S B;  2RSN A;  5DM6 3;  2F0S A;  4PMW A;  2PZT A;  2HCI A;  2JA9 A;  4U68 A;  4YCU A;  1EFW A;  1SRU A;  2R93 G;  4GOP B;  4OL7 A;  4QUC A;  4ZRZ A;  2N3S A;  2JA6 G;  5DNF A;  1FJG L;  1QG7 A;  4K6L A;  4JBM A;  1SR3 A;  2RSO A;  1S5F D;  5FLM G;  2ENB A;  5T1G A;  1RHP A;  2CW0 D;  4JYA Q;  5FLX E;  4NKL A;  1A3T A;  4RCN A;  3BYY B;  1E1T A;  4PMC A;  4KMU C;  2B2U A;  3L9A X;  4DK1 A;  4L8J A;  3QG1 A;  5LMN W;  4JI0 L;  1SNM A;  1CA6 A;  4K14 A;  1LAB A;  2JP1 A;  1VQC A;  4PQX A;  5KNC A;  4CJ1 B;  1R9T H;  2B63 G;  3NEM A;  3DM3 A;  3OWE B;  2AKW B;  1G91 A;  3J7Z C;  2F4V Q;  4LF7 Q;  1Y1W H;  1PV4 A;  3MAQ A;  1EOV A;  3ERQ A;  5IYB G;  2PQA A;  1NR2 A;  1X32 A;  2EE1 A;  1EY8 A;  2NN6 I;  3OMC A;  3I3C A;  3D4D A;  3DMU A;  1SND A;  5M5W H;  5KGU A;  3K6O A;  3TZU A;  1YJ9 A;  2G5D A;  3RNU A;  4C56 C;  2XWJ B;  1BCP C;  5I9O A;  1M90 C;  2K4K A;  1OTC A;  4DUZ L;  4R8N A;  4F88 A;  3U50 C;  1FNW A;  3PO2 G;  3CP0 A;  5J3B A;  2SNS A;  4JI1 Q;  3HOY H;  1HNX Q;  2D9U A;  3T53 B;  5IYC G;  2DGY A;  1KNE A;  1YBY A;  2HCC A;  1BOS A;  4RWS C;  4ULL A;  1WTP A;  3HOV B;  1PH6 A;  3E3X A;  5BN5 A;  3G6E A;  2AMC B;  1NMG A;  3M3Y B;  1PRT B;  3P75 A;  2L0C A;  3FP9 A;  1D1K A;  2WKC A;  5LMU L;  1VMP A;  1Y8O B;  3RN5 A;  1VQD A;  4GOP C;  2BDO A;  5IT9 L;  4H7B A;  1HUN A;  2E2H B;  4A3F B;  1K0S A;  3SK4 A;  4DV4 Q;  4B9X A;  1EY9 A;  4KI0 A;  2ICE C;  2JE6 I;  5IGC A;  2A69 D;  2IX0 A;  2JA5 G;  2HIX A;  4JI7 L;  1GKH A;  4B3M L;  4XDX A;  5GRO A;  1SSO A;  3GTM H;  5EPK A;  2EYP A;  2AWO A;  5C4X G;  4GLA C;  4ZQ3 A;  4C1N K;  1A62 A;  4KHP Q;  4FXK C;  3CF5 A;  5JVG 3;  1NR4 A;  2XRQ D;  5ELO A;  4DV1 L;  1I6V C;  4R4I A;  1I94 L;  3VDY A;  3LX0 A;  3A55 A;  3QJY A;  4IUU A;  3CQZ B;  2PNH A;  3KF8 A;  1N36 Q;  4LW1 A;  2ZXO A;  1JCK B;  4X6A H;  5M3F H;  5J1Z A;  2RHQ B;  1BNZ A;  3SVM A;  3R93 A;  3I4M H;  4OO1 I;  2CQA A;  2R92 G;  4ZUI A;  2MO1 A;  4GN5 A;  2RHS B;  2WKD A;  2D2C C;  1X3F A;  2A8V A;  1H9J A;  5C0X H;  3AEV A;  4DAP A;  4GNX B;  1QVF A;  3CCR A;  1VQM A;  3M4P A;  3RR5 A;  2KCC A;  3TZD A;  1EU3 A;  1XTD A;  1C4Q A;  2EJF C;  1PFN A;  3K7A H;  3HFZ B;  1TS4 A;  3U58 A;  5KRU A;  4KY5 A;  2AUK A;  1YJW A;  1SEB D;  1K8G A;  1PRT C;  1O7Y A;  5E1F A;  4X65 L;  3T1Y L;  4L5T A;  4R4T A;  3H3V I;  2EQS A;  2RCN A;  1CT1 D;  1Z7T A;  1NCV A;  4DV5 Q;  2LSS A;  1EL0 A;  2UUC L;  3NHH A;  3RN2 A;  1LT5 D;  1QUQ B;  3I4N G;  4O1N A;  1V8Q A;  4LUZ A;  2C5C A;  1I5F A;  1PZK D;  4KK7 A;  3S16 H;  3J7A F;  4A93 H;  3U4V A;  3S14 H;  1KRT A;  2NVQ B;  4XYO A;  3K59 A;  3HOW B;  1E2W A;  3NSW A;  5IYD G;  1WJJ A;  4NP5 A;  3E5S A;  4LFA Q;  3BS1 A;  2EY5 A;  4DGZ A;  4A3K H;  5JJK A;  3STB D;  2D62 A;  1EWC A;  4EVO A;  4EGV A;  1ASZ A;  2PI2 E;  3KUP A;  1D2B A;  2CHB D;  3BDO A;  3GTQ B;  3RD4 A;  4A3L H;  3OHX C;  2ZTC A;  1A3U A;  5JVH 3;  5DAU A;  4R8I A;  4BBR H;  5EKI A;  2F0K A;  4RGT A;  4FP5 D;  5HGQ A;  1YNN D;  5JEA J;  1AE2 A;  3VR4 A;  4LNQ A;  5C3E G;  1PYW D;  5JJZ A;  2FMM A;  1O7L A;  1VQO A;  1L0W A;  1TWG H;  1VQB A;  3CCM A;  1TR5 A;  5C5M A;  1ZXT A;  2XTI A;  4K6D A;  4A3D B;  4AH6 A;  1SFO B;  1IXR A;  2SNM A;  4BY7 H;  4KHZ A;  3ER0 A;  5KEE A;  1MGS A;  1VQE A;  4K8I A;  3R2T A;  3AMU A;  2SEB D;  2IHE A;  5E7N A;  3EVQ A;  4IUT A;  4PG3 A;  4NXN L;  1SYC A;  3CCE A;  1Q90 A;  5CGK A;  3CPW A;  3TRZ A;  4BY1 H;  1Z6H A;  3HGB A;  3FKI G;  1VQA A;  4S3S A;  2L12 A;  4OEM B;  1SMX A;  1JB3 A;  1N32 Q;  2KQ3 A;  1TWA H;  2EY1 A;  3TSS A;  1LTB D;  4X66 L;  2JA6 B;  3LWE A;  2UUB Q;  1PFB A;  1W2B A;  1SJE D;  4L5S A;  2RDG A;  4WOR A;  1CHP D;  4I65 A;  1SLJ A;  3LWU A;  3RLF A;  4DV6 Q;  3J81 E;  1T9H A;  5HGT A;  3NWT A;  2Z6B A;  4FVM A;  4DXF A;  5M3M B;  3K5L A;  4HJA A;  3FVQ A;  4YWM A;  1WD0 A;  4LMQ D;  1J6Q A;  1ZYR D;  4KKS A;  4PMB A;  2O2L D;  2B63 B;  1B3Q A;  1SXT A;  1AP0 A;  2UXC L;  3Q0A A;  1EY4 A;  3VYR A;  2Q2U A;  2F03 A;  4JOI C;  1LYL A;  4LF4 Q;  4A3I H;  1X65 A;  5FJ8 H;  5EGT A;  2UXD Q;  1O7I A;  4A3B G;  1JT8 A;  1XYI A;  4G7H C;  4YIJ A;  3WDN A;  4MHE A;  5EKL A;  5M5X H;  4OWT B;  5KYI A;  3NEN A;  2B29 A;  5CV5 A;  4CDE C;  1ASY A;  2A1A A;  2ID0 A;  4KV6 A;  5KND A;  3HOV H;  1BQQ T;  4KY7 A;  4FYD A;  4YCW A;  1P8L A;  3T16 A;  2XGT A;  2E76 C;  2Z1C A;  3D6W A;  1VCI A;  4CGY B;  1GOZ A;  1B1Z A;  3M3Y H;  1KDA A;  3GTK H;  3F8T A;  5C0X I;  3VYU A;  2WAC A;  3HKZ G;  1ILP A;  1EYG A;  1RKN A;  1RL2 A;  3OW7 A;  2RQX A;  1JR0 D;  4RMF A;  2NZH A;  3HOZ H;  4OWW B;  1FJG Q;  4GLV B;  2AQ3 B;  3T1H Q;  4LF5 L;  2HDL A;  3L7Z C;  4A3M H;  3UDI A;  2Z6K C;  3MHB A;  2X69 A;  1EUJ A;  1WCM B;  3F2U A;  5C4X B;  1HJP A;  4JVZ A;  2EXZ A;  1HTL D;  4DR3 L;  4YHH Q;  4CJ2 C;  3M4O H;  4U67 3;  1YHQ A;  4LK1 C;  4KD4 A;  1IHZ A;  1STN A;  3PUV A;  2UXB L;  3HOY B;  3S2H H;  1PFM A;  4XXE A;  1B7Y B;  1CKN A;  3M9B A;  1WI5 A;  3HOU H;  1F2Z A;  1IBM L;  1MSH A;  4FO2 A;  2F0Q A;  2F3W A;  5ELF A;  2B2V C;  4DV3 L;  4DV0 Q;  2R92 B;  1YHA A;  2F52 A;  1J9O A;  3H0G H;  1PRT D;  5LHY 1;  2NTS A;  2Z6K A;  1GD7 A;  4DR7 Q;  2E2J B;  4XT1 B;  1KD1 C;  3GTM B;  1P16 A;  2Y0S B;  2HQE A;  1AFP A;  4YWK A;  1MD2 D;  1EU4 A;  3QO2 A;  3UDF A;  1OXU A;  3PIO 3;  4HIM A;  3BDL A;  5AJ3 L;  4GKJ Q;  1HNW L;  2XRS D;  4MN3 A;  1A3V A;  1KQS A;  1QJO A;  1NJI C;  2IX1 A;  4FNF A;  4N8F A;  3JAM E;  3D3R A;  2WP8 J;  2E74 C;  1C8C A;  1F9Q A;  1YI2 A;  3TS2 A;  2ZXP A;  2B2V A;  2Q2I A;  5GQO A;  3CME A;  1GXD C;  1TQO A;  3AQQ A;  1RTO A;  1LTR D;  5GAE C;  3NQI A;  4DV7 L;  4DFA A;  5M3F B;  1L1O B;  4WJ4 A;  1EIF A;  1Y8P B;  3I4M B;  5ISR A;  1BCP F;  1EY0 A;  3MXU A;  4KKT A;  4JI7 Q;  2ALY B;  3A56 A;  1IL2 A;  2JK8 A;  5FO9 B;  2NBF A;  3X3M A;  5CMD A;  1LUZ A;  2L55 A;  2K7V A;  3AFQ A;  1HZC A;  3J80 E;  3HOW H;  5GAG C;  4GKK Q;  3C3L A;  2EY2 A;  3KFU A;  4P72 A;  3MZ5 A;  2Q8I B;  3C46 A;  4OX9 L;  3MXP A;  2R7Z H;  2FJ2 A;  5ELB A;  1KRS A;  1I94 Q;  1IZ6 A;  3PCO B;  1J8I A;  4JI3 L;  5FO7 B;  3TP6 A;  4A3J H;  2HD3 A;  3NTI A;  2YYZ A;  5FLX L;  5IOC A;  1EYA A;  1G29 1;  1TT2 A;  2L9H A;  2R61 A;  4B3R L;  5C3E B;  4JI5 Q;  5ELN A;  1S40 A;  3CCJ A;  5JAV A;  3BU2 A;  4O2D A;  3HP3 A;  3RMH A;  2OEO A;  1S5B D;  1SYG A;  3O13 A;  2K5V A;  5CBA E;  3S16 B;  1F77 A;  3AU7 A;  4A3D H;  4XQN A;  4A93 B;  2PQA B;  3P1H A;  1II3 A;  2UU9 Q;  4UP8 A;  1XNQ L;  3DWQ A;  5K36 G;  4YY3 Q;  1AW7 A;  4BBS B;  1D5M C;  5LL6 S;  1TXY A;  3NBI A;  4CDF C;  3I90 A;  1GHJ A;  1ROD A;  4A3K B;  2EY6 A;  2IW3 A;  4C3I G;  1XMQ L;  3OTO Q;  4HAE A;  1EIY B;  1Y1V G;  1LTA D;  2GA4 B;  4NMZ A;  2VB2 X;  1HQM C;  3A7L A;  4TQU S;  1SYB A;  4X3T A;  4X62 Q;  1L1O C;  3OYY A;  2A74 C;  1W6K A;  4KTA A;  2JQO A;  2ES2 A;  2R93 H;  2EJG C;  1VQH A;  5I9P A;  1MSG A;  1G51 A;  1NMF A;  1HR0 L;  2F0E A;  2JA6 H;  2BDN A;  1D5X C;  4IPH A;  5E3F A;  3IRB A;  5FLM H;  4IUQ A;  3URY A;  1DGS A;  2HHH Q;  1EQR A;  2F0J A;  4E6I A;  3E9H A;  3BVM A;  1AH9 A;  4LUV A;  1PRT F;  2HIV A;  4XTC S;  3QB3 A;  4J15 A;  4ABN A;  1SDF A;  4RHR A;  3H6M A;  1LTL A;  4DR5 L;  2QKI C;  1XPR A;  1BCP B;  3CAM A;  3QWN A;  1IBK L;  3PF5 A;  3W1G A;  4G4K A;  2B63 H;  3OSO A;  5EAY A;  5ELC A;  2OWO A;  2N8N A;  5GAH C;  4LF9 Q;  3BZK A;  1L1O A;  2BE5 C;  5IYB H;  3R3O A;  5LL6 X;  1D6E C;  5IGG A;  2Z0S A;  3FDT A;  1JB7 A;  4A3B B;  3S1R B;  1JMC A;  1HZB A;  1TWA B;  2Y0S E;  3KF8 B;  2KA7 A;  1K9M C;  4LF6 Q;  3FMC A;  3KF6 A;  4P74 A;  2MFI A;  4TRD A;  5C3W A;  3CC4 A;  1I4H A;  4DR2 Q;  1IBL L;  1EZ6 A;  3T56 B;  1PMR A;  4DN4 M;  3PO2 H;  4CHT B;  5C0X J;  4B3S L;  3TDQ A;  5IYC H;  1EWH A;  4K5X A;  4ZKC B;  1DZ1 A;  2RDF A;  2GVB A;  2HUG A;  1YVC A;  4K0K L;  2K5D A;  3TEH B;  1F2M A;  2F0W A;  1VQL A;  1QB5 D;  3D4R A;  5CV4 A;  1X3G A;  4H13 C;  2WFW A;  4IPD A;  1LV9 A;  2PNR C;  2LS0 1;  3K5M A;  2E2I H;  2LKV A;  1JE4 A;  4NXM Q;  4DNR B;  4TSS A;  1S3O A;  3N52 A;  4JBJ A;  4O42 A;  1GUG A;  3BJU A;  2TMP A;  2E5L Q;  4A3I B;  3I91 A;  5IWA L;  1SNQ A;  2Z4I A;  1OXV A;  3ULJ A;  1B8A A;  1DOL A;  2JA5 H;  4X64 L;  2PQE A;  1LTT D;  3AFP A;  2PZU A;  3NPP A;  2QDL A;  1ENA A;  1G8Z D;  1TU2 B;  4FDB A;  1WCM H;  2PMZ E;  4JW0 A;  5M5X B;  3EFX D;  5C4X H;  2AQ2 B;  5E4X A;  2E2D C;  3LNN A;  1OXX K;  4APV A;  4PZ7 A;  4C3H G;  2OQK A;  2PO4 A;  2I5H A;  2KBN A;  4JI6 L;  4JI2 L;  3ZYY X;  4JI4 L;  4KLK A;  1PVO A;  4HJ9 A;  2KCT A;  3CCQ A;  3K5O A;  4UP7 A;  4B08 A;  1LM0 A;  1HA5 A;  2DN8 A;  2QEJ C;  2X6G A;  2A6H C;  4N9P A;  4N9T A;  1TWH H;  1EOT A;  1CQV A;  1TS5 A;  1TKW B;  1XNR Q;  1YIJ A;  3GTK B;  4KY6 A;  2K01 A;  5CC4 A;  4IOA A;  5TSS A;  2K50 A;  2R92 H;  2LMC B;  2NVY B;  2IPK D;  1N8R C;  3CXC A;  1GUS A;  1I6H H;  3HOZ B;  1IYU A;  2KEC A;  2N49 A;  4N8X 1;  2VQE L;  5K5P A;  4A3M B;  4IPG A;  3KYH C;  4DR1 L;  3S24 A;  2VQF Q;  4IFD G;  2E2J H;  4KHV A;  1I4X A;  3H94 A;  3TRE A;  1SE4 A;  4XQQ A;  4C2M H;  2IX3 A;  4IJL A;  2QCP X;  3M4O B;  4JI8 L;  2CKZ B;  1WFQ A;  2R7D A;  1XMO L;  5I4D A;  2ZJQ A;  3HOX B;  3F2B A;  5FOB B;  3VR5 A;  2VUM G;  3S2H B;  4QCL A;  3TQY A;  3E0E A;  5D3D A;  2JA8 G;  4ME5 A;  1CKM A;  3HOU B;  1HNZ L;  1GM5 A;  2OF1 A;  3PSI A;  3UDX A;  4O0A A;  3I4N H;  5JJL A;  4K5W A;  1Q81 C;  1QE6 A;  4IJH A;  4LF5 Q;  4C3J G;  4Q5V A;  4UY8 C;  4A3E G;  4NDX A;  4LFB L; 
#chains in the Genus database with same CATH homology
 4DNT B;  1H9M A;  1BR9 A;  3H0G B;  1FGB D;  1SBB B;  3C1F A;  2R6G A;  4K2L A;  3EA6 A;  1K83 B;  1LTS D;  2O5I C;  1F9R A;  2IT1 A;  2KOL A;  2A68 C;  3HS0 C;  2F0H A;  3MFY A;  3DWA A;  2EPB A;  3J7A V;  5C44 B;  5A2Q E;  3S9W A;  3J81 L;  3NBH A;  1K8M A;  1OO9 B;  3A8I E;  4HR7 B;  3ONA B;  1YNJ C;  3T51 B;  2K05 A;  1BF4 A;  5DM7 3;  3OIQ A;  4CKC A;  1TY2 A;  2NVX B;  2RVL A;  1QNK A;  2WAQ B;  4F7X A;  3QOJ A;  4G57 A;  1HTP A;  3NWS A;  5CV7 A;  3ERO A;  5FKA C;  2KCN A;  1VDZ A;  4Y7N B;  4HMI A;  5J39 A;  3K0Y A;  1KLU D;  2R7Z B;  1Y1V B;  3GQB A;  1Q3L A;  5EPL A;  1WTV A;  3W3A A;  1EFI D;  1S5D D;  2NTT A;  4A3J B;  2F3V A;  4G7Z C;  1UNS A;  2C9O A;  2E75 C;  2EYO A;  2B39 A;  4HMJ A;  3K57 A;  4FXG C;  3TBI B;  2NB0 A;  2Z8L A;  1V1O A;  2BE5 D;  1RJT A;  2JEB I;  1XTC D;  5E4W C;  2Q8R E;  1JWS D;  1L0X B;  2AUJ D;  2B8G A;  2B2W A;  1NSN S;  2B8F A;  2NYZ D;  4DF7 A;  1EYC A;  3D4W A;  4IUN A;  3W2D A;  2R93 B;  1I4R A;  5EJW A;  4HSP A;  2DY7 A;  5EBC A;  1FNV A;  1EY5 A;  2R3Z A;  3VA5 A;  2PW5 A;  1SYD A;  1DOK A;  5EBD A;  2IWH A;  5I6W A;  3DXJ C;  3FRP B;  4H0L C;  4DAY A;  2SOB A;  1PZI D;  4L6T B;  3Q6S A;  3ND8 A;  3G6J B;  1PLF A;  3J7Y W;  1BCP D;  5EKK A;  1CZG A;  3JAM L;  2K33 A;  3CKI B;  1HQR D;  2A6H D;  1B3A A;  4XIG S;  2DNC A;  3H09 A;  3VYT A;  3D31 A;  3PO2 B;  4KN7 C;  1XWE A;  1KTK A;  5JOB A;  1PTO B;  3G7L A;  3ITP A;  1M4V A;  2ZT9 C;  2F0T A;  2XWB B;  3J80 L;  2K1B A;  2FHT A;  3HZX A;  4WJW A;  2E2I B;  1SE3 A;  3PUX A;  1JIC A;  3KBX A;  4BA1 I;  1SAP A;  1TVX A;  1ONL A;  5FK9 C;  5JPN C;  2K04 A;  4BWG B;  5CR3 A;  2JA5 B;  2DNE A;  2L5T A;  1STH A;  1D5Z C;  2I07 B;  5C5L A;  3PMF A;  2VNU D;  3KK7 A;  4CKE A;  2VUM B;  4MIU A;  1DD2 A;  2H1E A;  3FPP A;  2G9H D;  2X6L A;  1G2T A;  3IKJ A;  4B9W A;  1TWH B;  1VMC A;  4QIW B;  5ELE A;  1Q1B A;  3TME A;  1LTG D;  1I50 B;  3TN2 A;  4C3J B;  2H4O A;  2JEA I;  3DM1 A;  1I6H B;  3MEH A;  1CM9 A;  2MJ8 A;  1AZQ A;  4CJ0 B;  4KJN A;  4FF2 A;  1F9P A;  3OPO A;  5ELD A;  2F0F A;  1S5C D;  4F87 A;  5JPM C;  1WTR A;  4X3S A;  3HG9 A;  1PTO C;  3VR2 A;  1JWM D;  4C2M B;  3A54 A;  5CV6 A;  4Z9C B;  3ND9 A;  3BDC A;  1JOR A;  3I8Z A;  3VR3 A;  4K2K A;  3TP7 A;  5JEA G;  1FR3 A;  2NWG A;  4OIK A;  3IFD A;  3R2I A;  1DYQ A;  1RDP D;  4A3G B;  3FEW X;  5EPJ A;  1HUM A;  1EQV A;  3I4N B;  1A15 A;  2FMC A;  2WV6 D;  1Y69 U;  1HFG A;  3VA7 A;  2JSO A;  1BO0 A;  1BUV T;  1G6Z A;  5K36 H;  3OWF A;  1SNO A;  2A69 C;  3NE5 B;  4LJZ C;  2IL8 A;  1BDO A;  2M9V A;  1Y8N B;  2PMZ B;  1TWF B;  2IJ0 A;  3GP7 A;  1I4Q A;  1OXS C;  2O5J C;  2BCO A;  3V96 A;  4HTH A;  1VF5 C;  1H9R A;  4RA8 A;  2RBM A;  1B44 D;  1R4P B;  1EY6 A;  3GTP B;  4QMG A;  2AWN A;  3QOL A;  2NN6 G;  4ILW A;  2PYK A;  2F0G A;  1HA6 A;  4RGN A;  5CV8 A;  4L63 B;  4RKL A;  1PXU A;  3FKI B;  4XYQ A;  2XSC A;  4GZY C;  3MXN A;  4BS9 A;  1IL8 A;  2CVR A;  1DCZ A;  4KKU A;  3DWP A;  1CZW A;  3L3O C;  3PIP 3;  1TS2 A;  4ZUJ A;  5DEH A;  1F2Y A;  2EYJ A;  4RGO S;  1JWU D;  3MWY W;  2K03 A;  4IN3 A;  2WIN B;  2WB1 B;  2M2L A;  3IL8 A;  4DXG A;  4OIJ A;  3GO5 A;  3CU7 A;  3HRZ C;  3NK9 A;  1CA5 A;  1HPC A;  2MHV A;  3NP8 A;  1ZEQ X;  1QCB D;  1V1P A;  3MA2 B;  1AEX A;  4IQZ A;  5COY A;  2F4I A;  2EJM A;  2F0V A;  1QWY A;  1WD1 A;  2EDG A;  5C4H A;  1E0B A;  2PZW A;  1OXT A;  3DEO A;  1B4O A;  4K8J A;  1SNC A;  1ET6 A;  1EEI D;  3NQT A;  2Q8T A;  3E6Z X;  1W6J A;  1ICW A;  1LT4 D;  1EIG A;  1G2S A;  4IAL A;  1MI2 A;  1ML0 D;  1TY0 A;  1YNN C;  1D1I A;  2TSS A;  1RD9 D;  2OT2 A;  1JOO A;  5I6Y A;  4OO1 G;  1UEA B;  2B2Y A;  4WFN 3;  4H44 C;  4RKB A;  3MTS A;  5D14 A;  5IGB A;  1SYE A;  1PTO H;  2J4X A;  1S5E D;  4Q0F A;  4R9W A;  2N88 A;  1MBY A;  1O78 A;  1PZJ D;  1U4M A;  5D3I B;  3HKZ B;  3I70 A;  1R4Q B;  1WTO A;  2K5W A;  3VYS A;  1VF7 A;  4EQN A;  3GTJ B;  3NTH A;  1GJX A;  5A2Q L;  1RCV D;  3MFG A;  4M8A A;  5A35 A;  3DEP A;  4IFD H;  1F9S A;  5IGE A;  1ILQ A;  1NUC A;  5C6A A;  3BZD B;  5C4J B;  3IAY A;  3SK8 A;  3NXW A;  2KVM A;  5IIF A;  3MC0 B;  3S1Q B;  2A5H A;  1STB A;  4UAI A;  1ZYR C;  1JOK A;  1CQF A;  3EJI A;  1PTO D;  1F2L A;  2K32 A;  5G3L F;  1EZ8 A;  1STE A;  5D65 A;  1U4P A;  2QIL A;  1HCZ A;  3T13 A;  4XT3 B;  1LTI D;  1NAP A;  5KYL A;  1LO5 D;  4LAA A;  2Z4H A;  1IW7 C;  3OOC A;  1X3Q A;  4ID6 A;  3S15 B;  3KLR A;  4JBW A;  2EVB A;  3X3N A;  1U4R A;  1SMY C;  5F2D A;  4CKB A;  1HFN A;  1ENC A;  1CI3 M;  1EY7 A;  5BN3 A;  3KLS X;  4FF4 A;  2F1M A;  4RCO A;  2XN9 C;  3I72 A;  2VXW A;  3WOF A;  2EYM A;  1B50 A;  1I4G A;  1SYF A;  1WTX A;  4IZ8 A;  1IYV A;  4ZK9 B;  3S1N B;  3PV0 A;  3GTO B;  2KUM A;  3I4L A;  3GV6 A;  4EQP A;  4X3K A;  3SE0 A;  1TS3 A;  1H9S A;  2JA7 B;  3Q22 A;  1GHK A;  3C1E A;  5I2Y A;  1KDC A;  1V43 A;  2XIW A;  5FO8 B;  5IGF A;  1QNU A;  2F0P A;  2WII B;  4PV1 C;  4K5V A;  2XVS A;  1KLG D;  1IKL A;  4PNY A;  4DU9 A;  1K8O A;  1STG A;  2EYH A;  1FYC A;  4QB4 A;  3NTK A;  2ZXR A;  3BVZ A;  2PCF B;  2N55 A;  1JOQ A;  1O7Z A;  2VB3 X;  2BA0 A;  1SNP A;  3IFT A;  1IKM A;  3D6C A;  4C1N I;  2EZV A;  1GUT A;  4ZLT F;  4C3I B;  5KIX A;  3D8G A;  3MXG A;  4KD3 A;  1HHV A;  1M8A A;  3MVV A;  1U9R A;  3U9S A;  5AFW A;  2F0M A;  4QF4 A;  2B2W C;  3KBG A;  1CFM A;  4XQJ A;  2NUC A;  5CV9 A;  2ICI A;  5I2X A;  5C0X G;  5C3X A;  5M5Y B;  3AB9 A;  1PTO F;  2K6A A;  5IT9 E;  3PUZ A;  1S4Z A;  2MGS A;  3RZD B;  2JXM B;  1ESR A;  2K28 A;  2A6E C;  3KLS A;  3A7A B;  3HEJ A;  5CYU A;  5NUC A;  3S17 B;  3C2P A;  4IFD I;  3T4A C;  2KHS A;  1SJH D;  3GTL B;  5EQ0 A;  4RH6 A;  1AZP A;  1RTN A;  2J7Z A;  1HRJ A;  2O4X A;  2L1B A;  1C48 A;  1QIL A;  1JC7 A;  1LAC A;  4I7Z C;  1QOH A;  1EIH A;  1EQT A;  3S2D B;  1BBX C;  1CHQ D;  1Q8I A;  3M7G A;  1Z47 A;  5IGD A;  3RZO B;  1ZKO A;  3QIA A;  3TP5 A;  2PW7 A;  3BYT B;  2OXP A;  2QF7 A;  5HUR A;  3Q23 A;  4CBV A;  4IUV A;  2NVT B;  1X3P A;  4UDU C;  2J0T D;  2M00 A;  3WOE A;  1B53 A;  4FF3 A;  3S1M B;  4OGQ C;  4RGM A;  1TWC B;  4RHS A;  3TP8 A;  1E2V A;  4J8Q A;  1FD7 D;  4C3H B;  1DXM A;  1A2T A;  3NUC A;  3OIP A;  4FXD A;  5M9O A;  5C4Z A;  1LLR D;  1KNA A;  1A6X A;  3M85 A;  3DHQ A;  1UAP A;  3FPU B;  2AQ1 B;  1ESF A;  2MPM A;  3GV3 A;  2A73 B;  1IW7 D;  1E2Z A;  2F0N A;  1DJR D;  4ODG A;  4P2C B;  1I3Q B;  1SMY D;  2RDH A;  3CRL C;  4X3U A;  3E0J A;  2V4D A;  5BN4 A;  1T5E A;  3V2T A;  1CK1 A;  4QUF A;  4DAV A;  4DK0 A;  1R9T B;  2RKS A;  2CW0 C;  2D5D A;  5JEA H;  5COR A;  1Y1W B;  2JA8 B;  1T5X D;  3CHB D;  3H3V C;  1KAB A;  4V19 0;  5M5W B;  4RAU C;  2A68 D;  3H91 A;  4A3E B;  2L11 A;  1Q12 A;  4NW2 A;  2JYO A;  2F0L A;  4HED A;  3VR6 A;  2G9D A;  4HSV A;  3GD7 A;  3V05 A;  1YNJ D;  4G7O C;  1EYD A;  3BVG A;  2F0U A;  3OMG A;  1GUW A;  2XNA C;  3EQL C;  4AYB B;  2F0D A;  2F0O A;  3CRK C;  4KJO A;  1PDQ A;  2RA4 A;  4BA2 I;  4EQO A;  1V1P B;  3PO3 B;  3SDZ A;  1WTW A;  3SHL A;  1O80 A;  4HCE A;  2KEE A;  1SE2 A;  1KDB A;  1STY A;  3A8J E;  4HCS A;  1GUO A;  2EYF A;  2NN6 H;  3A8K E;  4DA2 A;  4TKO B;  4ZYS A;  2I46 A;  3BG3 A;  1HXY D;  1EEF D;  2FIN B;  1LT3 D;  3R8B A;  1XXG A;  2FFK B;  1XX8 A;  5CBE E;  3P7J A;  2F0I A;  1Q1E A;  3GTG B;  1LT6 D;  3DUZ A;  3K58 A;  2A6E D;  3M4Y A;  1ET9 A;  4IUP A;  2EOT A;  2QDB A;  1BXT A;  3SEB A;  3K7A B;  3RUZ A;  1FNU A;  4IFD J;  3UI2 A;  4M1U B;  1RF2 D;  1AN8 A;  4OHJ A;  4HN7 A;  1ENF A;  3K5N A;  1DOM A;  5G3L D;  2MP1 A;  3SK5 A;  2SDF A;  3S14 B;  4V0B A;  1UUP A;  4FF1 A;  2LFN A;  1A2U A;  4RFB A;  1U4L A;  5IOD A;  4IUR A;  3SR1 A;  4OO1 H;  3PUY A;  3P20 A;  2BA1 A;  2MUY A;  4ZAI A;  4J6H A;  4F8M A;  3SK6 A;  1KAA A;  4J1M A;  3Q24 A;  1H9K A;  2B2T C;  4JK1 C;  2B2Y C;  3PUW A;  4WRD A;  2K5Q A;  4BBR B;  2NZ1 D;  4KN4 C;  2LY7 A;  3I73 A;  2PPB C;  2L4N A;  2EYL A;  1B2T A;  1TWG B;  1DON A;  1WVL A;  2BOS A;  3U9O A;  1WTQ A;  5KNB A;  3M7N A;  2HDM A;  4BY7 B;  1CTM A;  2KED A;  4ZKB B;  2KJX A;  2YU9 B;  2B2U C;  1STA A;  1L0Y B;  1GUN A;  1B9N A;  4BY1 B;  1B9M A;  2DY8 A;  1JQY D;  5T1I A;  1DM0 B;  2B2T A;  1I4P A;  5J22 A;  3N6R A;  1TII D;  3SXH A;  2RSN A;  1H9S B;  5DM6 3;  2F0S A;  4PMW A;  2PZT A;  2HCI A;  4U68 A;  4OL7 A;  4QUC A;  4ZRZ A;  5DNF A;  1QG7 A;  4K6L A;  2RSO A;  1S5F D;  2ENB A;  5T1G A;  1RHP A;  2CW0 D;  5FLX E;  4NKL A;  1A3T A;  4RCN A;  3BYY B;  4PMC A;  4KMU C;  2B2U A;  3L9A X;  4DK1 A;  4L8J A;  3QG1 A;  1SNM A;  1CA6 A;  4K14 A;  1LAB A;  2JP1 A;  4PQX A;  5KNC A;  4CJ1 B;  3OWE B;  1G91 A;  3MAQ A;  3ERQ A;  1NR2 A;  1X32 A;  2EE1 A;  1EY8 A;  2NN6 I;  3OMC A;  3I3C A;  3D4D A;  3DMU A;  1SND A;  5KGU A;  3K6O A;  3TZU A;  4C56 C;  2XWJ B;  1BCP C;  5I9O A;  4R8N A;  4F88 A;  1FNW A;  2SNS A;  2D9U A;  3T53 B;  4ULL A;  1KNE A;  2HCC A;  3HOV B;  1BOS A;  4RWS C;  1WTP A;  5BN5 A;  3M3Y B;  1PRT B;  3P75 A;  2L0C A;  1D1K A;  2WKC A;  1VMP A;  1Y8O B;  2BDO A;  5IT9 L;  4H7B A;  1HUN A;  2E2H B;  4A3F B;  3SK4 A;  4B9X A;  1EY9 A;  4KI0 A;  2ICE C;  2JE6 I;  5IGC A;  2A69 D;  2IX0 A;  4XDX A;  1SSO A;  5EPK A;  2EYP A;  2AWO A;  4ZQ3 A;  4C1N K;  4FXK C;  5JVG 3;  1NR4 A;  2XRQ D;  1I6V C;  3LX0 A;  3A55 A;  3QJY A;  4IUU A;  3CQZ B;  3KF8 A;  2ZXO A;  1JCK B;  5J1Z A;  1BNZ A;  3SVM A;  3R93 A;  4OO1 I;  2CQA A;  4ZUI A;  2WKD A;  2D2C C;  1H9J A;  5C0X H;  4DAP A;  2KCC A;  3TZD A;  1EU3 A;  1C4Q A;  2EJF C;  1PFN A;  1TS4 A;  5KRU A;  4KY5 A;  2AUK A;  1SEB D;  1PRT C;  1O7Y A;  5E1F A;  1CT1 D;  1Z7T A;  1NCV A;  1EL0 A;  3NHH A;  1LT5 D;  4O1N A;  1V8Q A;  2C5C A;  4KK7 A;  1PZK D;  3J7A F;  2NVQ B;  4XYO A;  3K59 A;  3HOW B;  1E2W A;  3NSW A;  4NP5 A;  3E5S A;  3BS1 A;  2EY5 A;  4DGZ A;  2D62 A;  1EWC A;  4EVO A;  4EGV A;  3KUP A;  1D2B A;  2CHB D;  3BDO A;  3GTQ B;  3RD4 A;  3OHX C;  1A3U A;  5JVH 3;  5DAU A;  4R8I A;  5EKI A;  2F0K A;  4RGT A;  4FP5 D;  1YNN D;  5JEA J;  3VR4 A;  1PYW D;  5JJZ A;  2FMM A;  1O7L A;  1TR5 A;  5C5M A;  1ZXT A;  4K6D A;  4A3D B;  1SFO B;  2SNM A;  4KHZ A;  5KEE A;  1MGS A;  4K8I A;  3R2T A;  3AMU A;  2SEB D;  3EVQ A;  4IUT A;  1SYC A;  1Q90 A;  5CGK A;  1Z6H A;  3HGB A;  4S3S A;  2L12 A;  1JB3 A;  2KQ3 A;  2EY1 A;  3TSS A;  1LTB D;  2JA6 B;  3LWE A;  1PFB A;  1SJE D;  2RDG A;  4WOR A;  1CHP D;  4I65 A;  3LWU A;  3RLF A;  3J81 E;  5HGT A;  3NWT A;  4FVM A;  4DXF A;  5M3M B;  3K5L A;  3FVQ A;  1WD0 A;  4LMQ D;  1ZYR D;  4KKS A;  4PMB A;  2O2L D;  2B63 B;  1SXT A;  1AP0 A;  3Q0A A;  1EY4 A;  3VYR A;  2F03 A;  5EGT A;  1XYI A;  4G7H C;  4YIJ A;  3WDN A;  4MHE A;  5EKL A;  5KYI A;  5CV5 A;  2ID0 A;  4KV6 A;  5KND A;  1BQQ T;  4KY7 A;  4FYD A;  3T16 A;  2E76 C;  2Z1C A;  3D6W A;  1VCI A;  4CGY B;  1GOZ A;  1B1Z A;  1KDA A;  5C0X I;  3VYU A;  2WAC A;  1ILP A;  1RKN A;  3OW7 A;  2RQX A;  1JR0 D;  2AQ3 B;  2HDL A;  3L7Z C;  3MHB A;  2X69 A;  1WCM B;  3F2U A;  5C4X B;  2EXZ A;  1HTL D;  4CJ2 C;  4U67 3;  4LK1 C;  4KD4 A;  1IHZ A;  1STN A;  3PUV A;  3HOY B;  1PFM A;  4XXE A;  1F2Z A;  1MSH A;  4FO2 A;  2F0Q A;  2F3W A;  5ELF A;  2B2V C;  2R92 B;  1J9O A;  1PRT D;  5LHY 1;  2NTS A;  2E2J B;  4XT1 B;  3GTM B;  2Y0S B;  2HQE A;  1AFP A;  1MD2 D;  1EU4 A;  3QO2 A;  3PIO 3;  1OXU A;  3BDL A;  2XRS D;  4MN3 A;  1A3V A;  1QJO A;  2IX1 A;  4FNF A;  3JAM E;  3D3R A;  2WP8 J;  2E74 C;  1C8C A;  1F9Q A;  2ZXP A;  2B2V A;  1GXD C;  1TQO A;  1RTO A;  1LTR D;  3NQI A;  5M3F B;  4DFA A;  1Y8P B;  3I4M B;  5ISR A;  1BCP F;  1EY0 A;  3MXU A;  4KKT A;  3A56 A;  5FO9 B;  2NBF A;  3X3M A;  5CMD A;  2L55 A;  2K7V A;  3J80 E;  3C3L A;  2EY2 A;  3MZ5 A;  2Q8I B;  3C46 A;  3MXP A;  2FJ2 A;  5ELB A;  1J8I A;  3TP6 A;  5FO7 B;  3NTI A;  2YYZ A;  5FLX L;  5IOC A;  1EYA A;  1G29 1;  1TT2 A;  2L9H A;  2R61 A;  5C3E B;  5JAV A;  3HP3 A;  3RMH A;  2OEO A;  1S5B D;  1SYG A;  3O13 A;  5CBA E;  3S16 B;  1F77 A;  3AU7 A;  4XQN A;  4A93 B;  3P1H A;  1II3 A;  3DWQ A;  5K36 G;  1AW7 A;  4BBS B;  1D5M C;  5LL6 S;  3NBI A;  3I90 A;  1GHJ A;  1ROD A;  4A3K B;  2EY6 A;  2IW3 A;  4C3I G;  4HAE A;  1LTA D;  2GA4 B;  4NMZ A;  2VB2 X;  1HQM C;  3A7L A;  4TQU S;  1SYB A;  4X3T A;  2A74 C;  1W6K A;  4KTA A;  2EJG C;  5I9P A;  1MSG A;  2F0E A;  2BDN A;  1D5X C;  5E3F A;  4IUQ A;  3URY A;  2F0J A;  4E6I A;  3BVM A;  1PRT F;  4XTC S;  3QB3 A;  4ABN A;  1SDF A;  4RHR A;  3H6M A;  2QKI C;  1BCP B;  3QWN A;  4G4K A;  3OSO A;  5ELC A;  2BE5 C;  3R3O A;  5LL6 X;  1D6E C;  5IGG A;  3FDT A;  4A3B B;  3S1R B;  1TWA B;  2KA7 A;  3FMC A;  4TRD A;  5C3W A;  1I4H A;  1EZ6 A;  3T56 B;  1PMR A;  4DN4 M;  4CHT B;  5C0X J;  3TDQ A;  1EWH A;  4K5X A;  4ZKC B;  1DZ1 A;  2RDF A;  2HUG A;  2K5D A;  1F2M A;  2F0W A;  1QB5 D;  3D4R A;  5CV4 A;  4H13 C;  1LV9 A;  2PNR C;  2LS0 1;  3K5M A;  2LKV A;  1JE4 A;  4DNR B;  4TSS A;  3N52 A;  4O42 A;  1GUG A;  2TMP A;  4A3I B;  3I91 A;  1SNQ A;  2Z4I A;  1OXV A;  1DOL A;  2PQE A;  1LTT D;  2PZU A;  3NPP A;  1ENA A;  1G8Z D;  1TU2 B;  5M5X B;  3EFX D;  2AQ2 B;  5E4X A;  2E2D C;  3LNN A;  1OXX K;  4C3H G;  2PO4 A;  3ZYY X;  3K5O A;  4B08 A;  1HA5 A;  2DN8 A;  2QEJ C;  2X6G A;  2A6H C;  4N9P A;  4N9T A;  1EOT A;  1CQV A;  1TS5 A;  1TKW B;  3GTK B;  4KY6 A;  2K01 A;  5CC4 A;  5TSS A;  2LMC B;  2NVY B;  2IPK D;  1GUS A;  3HOZ B;  1IYU A;  2KEC A;  5K5P A;  4A3M B;  4IFD G;  4KHV A;  1I4X A;  3H94 A;  1SE4 A;  4XQQ A;  2IX3 A;  3M4O B;  2QCP X;  3HOX B;  5I4D A;  5FOB B;  3VR5 A;  3S2H B;  4QCL A;  5D3D A;  4ME5 A;  3HOU B;  2OF1 A;  4K5W A;  1QE6 A;  4C3J G;  4Q5V A;  4NDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...