1NSNS

The crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
TKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG FAB (IGG1, KAPPA)
publication title The crystal structure of the antibody N10-staphylococcal nuclease complex at 2.9 A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Complex (immunoglobulin/hydrolase)
total genus 34
structure length 138
sequence length 138
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1995-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nsnS00
5C3XA 5HURA 3D4WA 1EY0A 3D8GA 4KJNA 5CV4A 3SXHA 4K6DA 4DGZA 4F8MA 5E1FA 2F0DA 5CV5A 3MVVA 1JORA 3NUCA 4ZUIA 3T13A 4K8JA 3SK4A 2PZTA 2EYHA 2F0IA 2RBMA 3QB3A 2RKSA 2SNSA 3DMUA 2F0SA 4IALA 4QF4A 2F0QA 4S3SA 5K5PA 2OEOA 3C1FA 5C5MA 3S9WA 2KHSA 4KY5A 1STBA 2F0EA 3HEJA 5J22A 2F0NA 1RKNA 2EY5A 5F2DA 5C4HA 2M00A 4B9XA 2SNMA 1TQOA 5ISRA 1F2MA 5JAVA 4K2LA 5CGKA 1EYDA 5NUCA 3SK6A 1SNCA 4EVOA 1STAA 2EXZA 1F2YA 1F2ZA 3P1HA 4TRDA 5CV9A 3P75A 2F3VA 3H6MA 3D6CA 3E5SA 2F0TA 4K14A 1TT2A 2EYFA 1A3TA 2KQ3A 2OF1A 3OMGA 4KJOA 4NKLA 1SYDA 4R8NA 5IGBA 2PZUA 1A3UA 1JOQA 5EGTA 4I65A 4EQNA 1ENCA 1EY6A 3TP6A 1NSNS 5IGCA 3D4DA 3OMCA 3RUZA 5IGFA 4HMJA 5C3WA 1A3VA 4OL7A 3C1EA 5I6YA 2EY6A 1STNA 5I9PA 1KDAA 4G57A 4K5WA 3MHBA 4NP5A 2EYLA 1KABA 1ENAA 4J1MA 2F0VA 1JOKA 2HQEA 4ZQ3A 3SK8A 1A2UA 2EYPA 4J6HA 1SYCA 2F0HA 3ERQA 3R3OA 4ODGA 5C5LA 5IOCA 2F0OA 4RKLA 5IGGA 1EZ6A 2PQEA 4ME5A 3EVQA 2F0GA 5CV6A 5IIFA 2NUCA 4PMCA 4EQOA 5EKKA 2RDFA 4QMGA 5IODA 4WORA 1KDBA 2OXPA 3BDCA 3NQTA 1EY4A 4RKBA 4KHVA 1SYEA 3QOLA 4F7XA 1KDCA 3MXPA 4K5VA 5DAUA 1STHA 2F0MA 4PMBA 3HZXA 4KY7A 4B9WA 5I9OA 1AEXA 5CV7A 4YIJA 4N9TA 5KIXA 5CV8A 3BDLA 4PNYA 4NMZA 3T16A 4N9PA 5EKLA 4WRDA 3VA5A 5I6WA 4EQPA 1SNMA 3PMFA 4E6IA 2PZWA 5M9OA 1II3A 1U9RA 3OSOA 4K8IA 4KTAA 4NDXA 5DEHA 5C6AA 1SYGA 2F0JA 4LAAA 5JOBA 1EZ8A 1EY8A 2F0KA 2ENBA 2PW5A 3ITPA 4KV6A 1STYA 1A2TA 2QDBA 3NK9A 1EYCA 3TMEA 3U9OA 3OWFA 1EY9A 1EY7A 4ZUJA 4H7BA 3EJIA 4DF7A 2EY2A 4DFAA 5CC4A 2PW7A 1SNOA 4DU9A 2F0WA 4IUNA 1SYBA 4HTHA 4KD4A 4QB4A 5CR3A 1IHZA 5C4ZA 2F0UA 3SR1A 3QOJA 2PYKA 3TP5A 1EQVA 2O4XA 4K2KA 4MIUA 1SNQA 2EYMA 3EROA 1SNDA 4HMIA 4KY6A 5J39A 5IGEA 2WACA 5IGDA 1STGA 2F0LA 3NP8A 1TR5A 2EYJA 3NHHA 3TP7A 2F3WA 4IZ8A 3SHLA 5KGUA 3V2TA 1KAAA 5KYIA 3LX0A 2EYOA 3MEHA 1EYAA 5E3FA 4KD3A 3DHQA 3NXWA 2SOBA 3SK5A 1NUCA 4ID6A 1EY5A 5KRUA 5KEEA 4K5XA 2EY1A 5KYLA 5J1ZA 3MZ5A 3TP8A 2F0FA 2F0PA 1JOOA 5HGTA 1SYFA 1SNPA 2LKVA
chains in the Genus database with same CATH superfamily
5C3XA 2UUCQ 4K6DA 3ZJYC 1TY0A 3D3RA 4POFA 5C0XG 1X6OA 2YTXA 1ESRA 1M1KC 1UWVA 3E6ZX 1WCMH 3DMUA 4XT1B 3W2DA 2ASBA 3CCJA 4ZAIA 1I4XA 3HOWG 2NVYB 1TWAB 4G4KA 2RSOA 3J7ZC 2HHHQ 1CKNB 2KEEA 3KJOA 4R1JA 4GKJL 1F2MA 1SROA 3H15A 1HNZL 1GJXA 1HZCA 1PRTF 2EXZA 4GN4B 1X65A 1Y1WH 1Y8OB 1SYDA 2PZUA 2KBNA 2VXWA 4HJ8A 3D4DA 1I4QA 1QZHA 4DV3L 2YYZA 3GTPB 1BBUA 5I9PA 4G57A 1YJWA 5LL6X 4MHEA 2IWHA 2HQEA 4JI3L 2DJFC 2EYPA 4J6HA 1DGSA 2O5JC 4ZKCB 1IYUA 1AE2A 1HR0W 1D1IA 2ZM6Q 2K5WA 1PYWD 1ZKOA 3PUVA 3D4RA 4LUOA 5JPNC 1F9SA 5IT9E 1WTQA 5M5YB 3C46A 3I73A 1N32L 2NWGA 3QOLA 4K5VA 4X64L 3A5UA 1PTOD 4CJ1B 4GOPB 1VQPA 2BH8A 4A3FG 3F2DA 4RMFA 3T16A 1V9PA 4JI7L 1BXTA 3K7AB 4HN7A 1PTOB 4A3CH 5C6AA 3GTQB 2A73B 3DWPA 3ER0A 3ND8A 5M3MH 5KNDA 4YY3Q 1BO0A 1TWFB 3U4ZA 2B2YC 1IW7D 2EPBA 4X3SA 3MXGA 3KUPA 1R4PB 1PH7A 4DV5L 4DFAA 3DWAA 4QB4A 3AB9A 1FL0A 4R4CA 3MA2B 2HCIA 1CM9A 4LW1A 1VQBA 2BDOA 1G2TA 2UUAQ 2K03A 1SMYC 5IGDA 3K59A 3GTGH 4JYAQ 2EYJA 4P71A 5IYCH 1Z6HA 4BBSH 3SHLA 2EJFC 3UE1A 4IFDJ 3NQIA 3NBIA 4A3FB 3NTIA 1A62A 5JVH3 4DXFA 3CCMA 2D5DA 2B2TC 4JI5L 3C2PA 4QMGA 2F4IA 3D8GA 3M9BA 2UUCL 1O7YA 4Q5VA 1GVPA 2E2HH 1S3OA 2QCPX 2JA7G 2I46A 3E0EA 3KLWA 2PQAA 1UEAB 1PH2A 1K8OA 2QA4A 3P20A 3ERSX 5G3LD 1VMPA 2HHHL 4B3RQ 2L15A 3H0GH 2P5ZX 5T1GA 3QJYA 1HCZA 2MO1A 1VS0A 5TSSA 2B63H 3S1NB 3PF5A 1OXUA 4EVOA 2D0OA 3PO3B 1B1ZA 2G5DA 2JJQA 1PMRA 3W1GA 3ULLA 2FJ2A 1G6ZA 1E2ZA 3HP3A 1YJ9A 4O1NA 1NY4A 1QUQB 1HTPA 3Q24A 4R8NA 2RF4A 3IFDA 1N34Q 1X3FA 1ILQA 2E74C 2WIIB 4OGQC 3C1EA 5IP9G 1YITA 1JJCB 3G7LA 3TEHB 2EYLA 3SK8A 4DNTB 2JA7B 2VNUD 2C35B 4DV2Q 3F8TA 1WCMB 4ME5A 5M3FH 1B8AA 2K28A 2NUCA 3ND9A 1EIFA 2ZM6L 1BBWA 3RLOA 5C4XG 3BU2A 1KDCA 4RHRA 2O5IC 2KECA 2MQHA 2F03A 1PTOC 4CKCA 1TIID 3HOYG 2X69A 4NMZA 4IFDG 2H4OA 4CJ0B 1HNWQ 1II3A 5DEHA 3CPFA 4KKSA 3I7FA 3ITPA 1U0LA 4YY3L 1JWSD 1IW7C 2AQ3B 2IHEA 1D8LA 2WAQG 1IKMA 2XNAC 3VYTA 5K36H 1JJ2A 1R4QB 1PTOF 3PUZA 2F0UA 4IJHA 3HS0C 4MIUA 3CRKC 4HMIA 1CA5A 2JP1A 3U4VA 5C4XB 2UUAL 1L1OA 2JN4A 3NP8A 1X3QA 4JPBW 4JYAL 1SSOA 1SXTA 3J80c 3KOJA 1JQYD 3MEHA 3I56A 3HOYB 2K52A 2LMCB 2M9VA 2F4VQ 3KF6A 3HFZB 5GROA 3I91A 2R93G 4YCUA 1LUZA 1WTWA 5JVG3 1WI5A 5FKAC 1YNND 2LS01 2WV6D 5FO8B 3NPPA 1LTBD 5M3MB 2WAQB 4C3IH 1KNAA 2B39A 1VQ6A 3HOZH 4A3KH 2OEOA 1C7YA 4KY5A 3CCRA 1V1OA 1RKNA 1MHWC 4B3RL 4HJAA 5JAVA 1VQGA 3JC66 1EWCA 5NUCA 3K5LA 1QVGA 1F2ZA 2XRQD 1K73C 3P75A 1I3QH 4BBSB 3KF8A 2ZJRA 1H9RA 1NE3A 1TT2A 2A68C 4YCVA 4KJOA 4WFN3 3FDTA 1A3UA 2E2IH 3Q0AA 2HQLA 1GM5A 4FXKC 1N34L 1LT5D 5LMNW 2WB1G 1VQJA 4K5WA 2E2HB 3PGZA 5A35A 2QKIC 4C3JG 4DV2L 1X3PA 3N6RA 4DR5Q 1B70B 2R7DA 1E3PA 3NQTA 3S2HH 1B3QA 1J8IA 3H0GB 3K5MA 4H13C 3JAMi 1AN8A 2IPKD 2K6AA 1KRTA 4G7OC 4P72A 1S5FD 4K6LA 1U4RA 2A69D 4E6IA 1E0BA 1DOKA 1HNWL 4L5TA 1EIGA 3OIQA 2LFNA 3J80E 2WB1B 2RQXA 2TMPA 1CQFA 1XMOQ 1EY7A 2CQAA 2OQ0A 4C3JB 2EY2A 3K0XA 4FP5D 2PW7A 1SYBA 5C44H 1AE3A 5ELBA 2PYKA 3DWQA 3KDFB 3G71A 5AJ3Q 2F3IA 3OIPA 4PV1C 1H9SA 5COYA 4C3HH 3G4SA 4U68A 1S40A 4N8FA 3PV0A 1VQKA 3NXWA 1K8GA 2V4DA 1EQRA 2EY1A 2F4VL 1H9JA 1UAPA 3PO2G 3TP8A 2Q8RE 1JOOA 1BF4A 1PYSB 3A7LA 1K3RA 3S15H 4IPDA 1SJHD 4RCOA 1IL2A 2CVRA 4IO9A 3BYTB 3V96A 1Y69U 1WFQA 3QB3A 1PFNA 2SNSA 5ELFA 2F0SA 5JJLA 5K5PA 2PMZB 3C1FA 2BA1A 2ES2A 4C3IG 2PNHA 2MJ8A 2NVTH 2L55A 2R7ZG 1SFOH 1BUVT 2QF7A 4U673 4JK1C 3IRBA 1L0YB 3UE0A 3H6MA 4KI0A 1BCPC 4RGOS 1MSHA 3BVGA 2KQ3A 5A2QL 2QILA 1DZ1A 3RZDH 4KK7A 1EY6A 1WTXA 3S1RH 4RFBA 1STNA 4KN4C 1MGSA 2Z8LA 4FVMA 1XPUA 1KABA 4ZQ3A 4DR3Q 4OO1I 1B4OA 1F2LA 2JA6H 4C3IB 1QNKA 4C2MH 5IGGA 3HOVG 3I90A 4DR5L 3R2IA 1S72A 2K05A 2I07B 4RKBA 1DD2A 3VR3A 4JI1Q 1W2BA 1ET6A 2F0MA 4HSPA 2IX1A 2IY5B 1JICA 1K83H 3G6EA 3MXUA 1YI2A 3ICEA 1HHVA 3TS0A 1I3QB 1U4MA 4I7AA 3M4PA 1PH6A 2HIVA 2F0JA 4LAAA 5JOBA 1TY2A 2E2IB 1P8LA 3WOEA 2K7VA 1EY9A 1XMOL 4L8JA 4BBRG 1CHPD 3T4AC 4A93G 1G6PA 1GKHA 4NB3A 1BR9A 1CFMA 2RA4A 1PYBA 4FF2A 3JAMc 5J39A 2K75A 4KY6A 5AJ3L 4HJ7A 2Z4HA 1TS4A 3S2HB 1VQ8A 3MFGA 1FJGQ 1W3SA 2SOBA 2UXDQ 2Z6KC 4A76A 2B2YA 4ZUIA 2NVQH 3I4OA 2K5DA 3D4WA 4LF7Q 1NR2A 1TWAH 2B8FA 2BE5C 4B3MQ 1QOHA 2EJMA 4R4QA 3FEWX 4YHHQ 2F0IA 1BNZA 1VQ7A 4DPGA 3S9WA 3I4MH 2N78A 1MJCA 2EY5A 4R8IA 3UDIA 1SR3A 4K2LA 4YCWA 1IYJB 1UE1A 1C8CA 1KLGD 2B2TA 3OTOQ 3J81j 3D6CA 5C0XH 4IUVA 4C3HB 1PRTD 2EYFA 1A3TA 2G9DA 1WVLA 2EJGC 2Y0SG 4DNRB 4I65A 4IOAA 2MPMA 4NXNQ 2LY7A 1CKNA 1TXYA 4LFAQ 4POGA 4DV6Q 1PRTB 1VQOA 3HOWH 4JBWA 3PUXA 3S15B 1KDAA 3OWEB 4DR3L 3VYRA 3MWYW 2D62A 2FMCA 3S14H 2XTIA 5EKKA 2NVTB 1KNEA 4KHVA 4CHTB 2YU9H 4GKKQ 4JI1L 1JB7A 3GTQH 3TSSA 3FKIH 2K5NA 1TWFH 1CUKA 2DGYA 3HKZG 1JMCA 3DEOA 2Y0SB 1NAPA 3JAME 4R4IA 1SYGA 4DN4M 3S1RB 5EAYA 4O0AA 2A5HA 2MO0A 1PH8A 3L0OA 5I2YA 1ICFB 3NTHA 4GOPA 4AYBG 2NZHA 5C4ZA 1D1KA 4X6AH 1NMGA 2VQEQ 1Q8IA 2JA6B 1JR0D 4C2MB 1V43A 4FF3A 3EROA 1XX8A 2E5LQ 4JI7Q 2F3WA 2K01A 1FJGL 2YV5A 3CCEA 3HKZB 2UXDL 1HA5A 2E76C 2JA9A 1K83B 2AWNA 1SNPA 2UUBQ 4LF7L 3HOXG 3MVVA 4B3ML 2DNCA 2Z4IA 4PZ7A 4LFBQ 4L63B 3S1NH 3RN2A 1TWGB 1SN8A 2YTVA 4LF9Q 3S1MH 5JJIA 1CSPA 2KEDA 5KNCA 2F0NA 5D65A 4H02A 4A3LG 5F2DA 3HGBA 4JI6Q 1PFMA 3LWEA 3T1YQ 5LL6S 3OTOL 4IOCA 2ID0A 4HCEA 1PRTC 2HDMA 2Z0SA 5AFWA 4IPHA 1JOQA 4A3MG 2JA7H 4NXNL 2RHQB 4LFAL 3H09A 2N49A 4DV6L 2NVQB 4OWWB 4ABNA 2R3ZA 4KHZA 2KCMA 2HUGA 4XYQA 5DLQE 4AYBE 4J1MA 1Q90A 1JOKA 2FXQA 4UY8C 1E2VA 1GHKA 1AFPA 1SYCA 2PI2A 3R3OA 4JVZA 1QUQA 4DNIA 2ZTCA 1TVXA 1EEFD 5IP7G 4EQOA 3I4MB 3J7AV 4XQNA 4TKOB 2E75C 2EZVA 2CW0C 4GKKL 4ZRZA 3MXNB 5I9OA 3VYSA 5L37A 3EIVA 4DR7Q 1ESFA 3HOUG 5IP9H 2VB3X 3CPWA 2AHOB 3FKIG 1SEBD 4R9WA 2VUMG 1EQQA 2Q8IB 1FYCA 1N33Q 4HIKA 4RH6A 2XWJB 1B2TA 1G2SA 2CWPA 1I4HA 5FLXE 2WFWA 2A8VA 3HOWB 5C4XH 2A6ED 4DV1Q 3I3CA 1VF5C 5DM73 4KD4A 4XXEA 1IL8A 4Q0FA 2VQEL 1UE5A 3HOYH 4X3TA 1PH5A 1FVIA 4IFDH 3S16H 3S14B 2E5LL 3OOCA 1O7IA 2F0LA 3J80i 4F88A 4CDEC 5KYIA 2YU9B 3HOUB 2NZOA 2EOTA 1CSQA 1SAPA 2R61A 3RNUA 2OTJA 4OX9L 4DR2Q 3FKIB 3S24A 1EIYB 2J4XA 3MZ5A 2F0PA 4L5QA 1KD1C 2PZWA 4K8IA 3E9HA 2UUBL 1GD7A 1FNWA 2D2CC 3ULPA 4QCLA 1VQMA 3GQBA 4QUFA 1ASZA 4LFBL 1N36Q 1I4GA 4LF9L 3QG1A 1K8MA 3GTMH 4BA1I 4WJ4A 1Q81C 1W6JA 4UDUC 4JI6L 3T1YL 2R93H 1TS3A 1SNCA 3MTSA 1QILA 1UE7A 1YHQA 3NELA 5IWAQ 1DOLA 3E5SA 1XMQQ 2RCFA 1L0WA 3M7NA 2OF1A 3OMGA 2HIXA 4YWKA 5GADC 1AZQA 4XDXA 4IUUA 4EQNA 2NB0A 1PH3A 1YNJD 4JI0Q 2QW7A 1E7ZA 2PNRC 4F87A 1HRJA 2LXKA 4B3SQ 4A3DG 1GHJA 1KC8C 3CAMA 3UDGA 3O13A 5C5LA 4DKAC 3I8ZA 2F0OA 2NBFA 2D0PA 1NMFA 2H1EA 2MFIA 1VMCA 5IYDG 4PMCA 3S1MB 3TBIB 5HY6A 4Y52H 3BDCA 3SDZA 3J81c 3CF5A 4RA8A 2IX3A 1VQ4A 3MFYA 5DAUA 2L4NA 2E2JH 4DR7L 1O7ZA 2F1MA 3PF4A 1Y1VG 1CZWA 2L0CA 2IJ0A 1SNMA 1HR0Q 3PMFA 3OHXC 4C3JH 5IYBG 3TS2A 3M4OH 1EY8A 1N33L 3TMEA 5I2XA 1M4VA 1H95A 1VQLA 2N3SA 2A74C 4A3DB 4XQJA 4DV1L 2ZTEA 4GOPC 3TREA 1EU3A 2GVBA 1S5BD 1E22A 3NENA 3CCQA 3HKSA 1Y8NB 4C56C 3RN5A 5FJ8H 1SNDA 1LT4D 1SDFA 3HG9A 4GZYC 4P73A 5KGUA 1VQ9A 4JBJA 3V2TA 1XNQQ 3AQQA 2EYOA 4MZ9A 4DR1Q 4ID6A 1EY5A 3TN2A 2FHTA 2RHSB 4K5XA 3ULJA 4HIOA 4DR2L 1O7LA 3K57A 3KDFA 2PI2E 5E1FA 1EOTA 1HFNA 2AQ1B 3EN2A 4OWXB 4DR4Q 2JEAI 3SK4A 4X66Q 2LSSA 1FNUA 1N36L 2KCTA 3GDEA 1VQDA 3EQLC 5FOBB 1HNXQ 1TQOA 4EX5A 3LWUA 3F2CA 3PO2H 2R92G 1PZKD 3GV6A 3OW2A 3S16B 4ZCKA 2ZJQA 3OPOA 2OCEA 2Z6KA 4G7HC 5IWAL 4A3BG 1LABA 3R2TA 1XMQL 2FMMA 3IKJA 3AFQA 3CC7A 1Q3LA 4GN5A 3TP6A 1LTID 1YNJC 1D7QA 1GUSA 1Q46A 3J81E 4JI0L 2R7ZH 1V8QA 2I5HA 3I4LA 1HQRD 2JYOA 5IT9L 3H3VC 1B9NA 1WTRA 4X62Q 1TWHB 4B3SL 3G6JB 3BZCA 2B8GA 1GXDC 5KNBA 4M1UB 2KVMA 3GTMB 2N55A 3RZOH 2Q2TA 3FMCA 2R92B 3A8IE 2A6HD 4HSVA 5E4WC 5EBCA 4FXDA 2R93B 5CV7A 4YIJA 1IBLQ 4CDDC 4JBKA 4MTNA 1XNRQ 3BS1A 1SE3A 3T1HQ 1HR0L 4XQQA 3CMAA 2PQAB 1HA6A 1ZYRD 3HOVH 5KEEA 1MSGA 2QDBA 3U9OA 1O78A 3OWFA 1RTOA 4C1NI 3KLRA 3SGIA 4H7BA 5FK9C 5CC4A 1X32A 2F0WA 4HTHA 3CP0A 4ZLTF 2AMCB 2NN6I 4MNOA 3CCUA 3QOJA 5H1SE 1QE6A 1GUGA 1J6QA 1RODA 4R4OA 3A55A 2AWOA 3TP7A 5FJ8G 2SDFA 1U4LA 1U5KA 4LWCA 1LTSD 1XNQL 3W3AA 3BVMA 4DR1L 4GNXB 2O2LD 2E2JB 4BBRH 1CTMA 1IKLA 1I6VC 4A93H 1PH9A 4F8MA 1ICWA 5CV4A 3SXHA 1DONA 4V190 2LXJA 1X55A 2KENA 4ZYSA 4DR4L 3T13A 1YEZA 3M4OB 1PV4A 2RKSA 1XYIA 1XTCD 4X66L 4GS3A 3OYYA 1STBA 1OO9B 4GLXA 3W1BA 3C3LA 1S4ZA 3L9AX 4GLAC 1HNXL 2K14A 1K3BC 1EQTA 4DUZQ 1UUPA 1F2YA 3CHBD 4NW2A 4TRDA 4BWGB 1IBMQ 1S5ED 3QIAA 1YNNC 5LMUQ 3NBHB 3H94A 4DK3C 1PDQA 3RUZA 5M5WB 1H9KA 1QG7A 4Z9CB 4JI4Q 1HTLD 4N8X1 1MKHA 4X62L 3AEVA 1VDZA 1L1OB 3U9SA 4ODGA 3FRPB 2XRSD 1VQNA 1ML0D 4DV7Q 5IIFA 3Q6SA 1CQVA 4JOIA 4XT3B 3EA6A 3VR2A 4HCSA 4IUPA 1I5FA 5C3EH 2A6HC 5LMNQ 1OXSC 3Q8DA 3UI2A 3HZXA 4WJWA 5JEAJ 5JJKA 3PO2B 2CWAA 3I4NG 4WJ3M 4XIGS 3DEPA 3BDLA 1IBLL 4FF1A 2JSOA 5ELEA 1XNRL 3PCOB 1XJVA 1L2FA 1X9NA 3T1HL 1PFBA 5ELNA 1U9RA 1EZ8A 2PW5A 2WKCA 4DK1A 3LNNA 3GTKH 1EYGA 2R7ZB 1JE4A 3CKIB 1WYDA 2IHFA 3FHWA 4CBVA 2H5XA 4CKEA 4BY7G 2K5QA 3X3NA 2CCZA 3K5NA 1VCIA 3SR1A 2C5CA 3KF8B 2O4XA 1SNQA 3T56B 4GNXC 1TR5A 2K50A 5C0XI 3RZOB 2L5TA 1SJED 3I72A 2A69C 3I4NB 5GQOA 4MTKA 2NZ1D 1EYAA 5E3FA 5FLMH 4QIWE 2PCFB 1BVSA 1DOMA 1CK1A 1RDPD 2KCCA 3E9IA 2NTTA 1WTPA 2DY7A 1SMXA 1FGUA 1TWGH 3E3XA 3STBD 1WJJA 2VW9A 1JORA 4FNFA 3L7ZC 2RCNA 3HOVB 2JQOA 3TDQA 2B29A 3I70A 2F0QA 3KK7A 4RAUC 5J22A 2VQFQ 1YJNA 1ET9A 5EBDA 4A3EG 1VQFA 1YHAA 2QGQA 1EOVA 3MEFA 1NBWA 2CH4A 4Y7NH 4DUZL 4UP8A 1VF7A 1F9PA 2Q2HA 4IPGA 3HOXH 2XGTA 5JEAG 1IBML 5GAEC 4K14A 1L0XB 5LMUL 4L5RC 1RIPA 5IGBA 3GTOH 2DNEA 1XPRA 4PZ8A 3KBGA 3VDYA 4BBRB 1X3GA 4A93B 4JI4L 3TRZA 3U58A 4A3LH 2KOLA 4DR6Q 2DUDA 3AU7A 2BA0A 1A2UA 1I50H 1QCBD 4OEMB 3A56A 4DV7L 4OONA 2RDFA 1NTGA 3IFTA 4A3EB 1EL0A 2OXPA 4DAYB 4OO1H 1SYEA 4A3MH 1RF2D 3J7AF 3MXPA 3RLNA 5LMNL 4PMBA 4YWMA 5C3EG 1PZID 3J80L 1D6EC 1XXGA 5EKLA 4A3JG 1DXMA 2AQ2B 4JI2Q 1Q82C 3OSOA 4LK1C 3DUZA 5EJWA 2X6GA 2NN6G 1LYLA 2ENBA 5IP7H 1JE5A 1STYA 4JCVE 2Z9HA 3H3VI 3A8JE 3AYHB 4ZUJA 3GP7A 1QJOA 2J0TD 4DU9A 4IUTA 3Q22A 2OQKA 1EFWA 2KJXA 3HOUH 4UP9A 4BY1H 1KIXA 1E1TA 1WD1A 2RVLA 2ZXOA 5IGEA 2B3GA 2VB2X 5DM63 4A3IG 1GUTA 2VUMH 1HZAA 5D3DA 5C3EB 4DAPA 1LTGD 3BYYB 4KD3A 3SK5A 4A3JB 5FLMG 2Z1CA 1OXVA 2F3VA 1SYFA 1TU2B 1R9TB 1Z7TA 1NJIC 4ME3A 1H9MA 2R7FA 5IE8A 2F0DA 2KUMA 3GO5A 4CDCC 1BOSA 1OXTA 3GTJH 2RBMA 4APVA 3GTKB 1N9WA 3K7UC 2RDGA 1V1PB 2KHSA 3KYHC 1AH9A 1QVCA 3CXCA 2ATWA 2VQFL 2BH2A 1Y14B 5FLXc 1K0SA 1KHIA 2SNMA 5ISRA 4IPCA 4LF6Q 4OX9Q 2JE6I 1RL2A 3K8AA 5CV9A 1E1OA 1LACA 2V1CC 4XYOA 4IUQA 2K5VA 4MN3A 1UE6A 2IT1A 2JK8A 4NKLA 4RGMA 5CYUA 2UU9Q 5IGCA 4UPAA 1K9MC 4AYBB 2EY6A 3KLSA 3L2PA 1BQQT 1YVCA 2ZXPA 2Z6BA 4DR6L 1M8AA 4LJZC 4V0BA 4QGUA 4LF5Q 2F0HA 3ERQA 2GA4B 3EVQA 5CV6A 1AZPA 2XWBB 2XN9C 1C4QA 4LMQD 4JOIC 4WORA 3J81i 1VQAA 1EY4A 1HZ9A 5BR8Q 3J7A5 4OO1G 2ICIA 1C9OA 2B2WA 4Y7NB 1SMYD 3K5OA 4FDBA 3HOXB 4A3DH 5M9OA 1HUNA 4JI2L 3MAQA 3GTOB 3PIPA 2NYZD 1CHQD 4LUZA 5IYDH 1WD0A 5JJZA 1EEID 4PZ6A 3BDOA 2QEJC 1K0RA 4OELB 4BS9A 1I50B 5ELCA 3SVMA 1B7YB 3BG3A 2JA5G 4HAEA 4NPSA 4OHJA 1Y1VH 1Q12A 4OWTB 4BY1G 2WACA 1MBYA 5IYBH 2I5MX 4A3MB 5D3IB 2VZAA 1YNXA 1D5XC 3RR5A 5KRUA 2PPBC 2LKVA 1T9HA 4FF4A 3M85A 3AFPA 4JC0A 3P7JA 1YBYA 4HIMA 2VL6A 4K8JA 2EYHA 3HRZC 4IALA 1MIUA 2OWOA 4I7ZC 1GOZA 3HEJA 1TS5A 1A0IA 4PG3A 3M3YB 1EUJA 2DN8A 2M00A 1EWHA 2JA5B 4LFCQ 1FD7D 5LHY1 4BXXG 3CU7A 4BY1B 1LM0A 4LF6L 4P2CB 2TSSA 3WOFA 5M5XH 3DXJC 3DM1A 1WTOA 2VUMB 3GTLH 1TWHH 3FPPA 1RHPA 2UU9L 3S1QH 3K81C 1K28A 1A3VA 2EDGA 3A5ZB 3UDXA 3MHBA 3MC0B 4HIDA 5C4JB 2DJGC 4TVAB 2R92H 1EIHA 4LF5L 3GTJB 2G9HD 4P74A 1Q86C 1LT6D 1CI3M 4RG1A 2QEXA 4A3BH 4G7ZC 1I94Q 5IODA 3DLLA 1KDBA 1TWCB 3T51B 4BA2I 3JAML 5BR8L 2Q2UA 4F7XA 3BZDB 2VS1A 4KY7A 4QUCA 1DJRD 4X3KA 1A8VA 2D9UA 4A3GH 1CT1D 5DNFA 3PIOA 3PO3G 2JA8G 1G51A 4ZKBB 1G91A 2N88A 3NSWA 4FO2A 2ZJPA 2K33A 1FR3A 4ZK9B 4OIJA 4GLVB 4DF7A 3VR5A 2F52A 1IHZA 1A6XA 1PXUA 2FINB 2GVAA 3IL8A 5GAHC 2EYMA 3PQIA 1K8AC 1WCMG 2Q2IA 1SBBB 1STGA 1HXYD 3DHQA 1A15A 2ZXRA 3BJUA 4JG2A 1LTRD 2JA8B 1BKBA 1S5DD 2MGSA 2CKZB 2A6EC 5HURA 2A68D 2MUYA 3PUYA 1Y1WG 4DA2A 5FO9B 1J5EQ 3TZUA 4GNXA 1OXXK 1M90C 3X3MA 4DV0Q 1B50A 3KBXA 1JJGA 4TSSA 4QJFA 4LFCL 5J3BA 1Y1VB 5M5WH 3GV3A 1B53A 4DK6C 3NTKA 1JC7A 1LLRD 4LNQA 2C9OA 1KL9A 4QL5A 2R6GA 4LF8Q 3KJPA 3CCSA 1NSNS 1AP0A 5C3WA 3QWNA 4OL7A 4DV4Q 1JT8A 2Q8TA 1Y1WB 2JXMB 3CCVA 4QY7A 5A2QE 3IAYA 2CQOA 4A3CG 1MI2A 3CD6A 2F0GA 3TQYA 3NBHA 5M3MG 5HGQA 2BOSA 4IURA 4O42A 1I94L 3F1ZA 4HJ5A 1NCVA 1LTLA 2B2WC 4N9TA 5FLXL 1XTDA 5M5XB 4JI8Q 1HZBA 3UDFA 4A3GG 1Y8PB 4KMUC 3GTLB 1PH4A 4KTAA 5IYCG 4BBSG 3LGJA 4C1NK 3S1QB 3GD7A 1KAWA 3KLSX 1A2TA 1EYCA 1ENFA 1HH2P 3RLFA 4OIKA 3L3OC 4UP7A 1PLFA 5EPLA 3RD4A 2XIWA 1VQIA 1T5XD 4IUNA 1DM0B 2OTLA 3I4NH 1RD9D 2NTSA 1KRSA 2NVXH 3TP5A 4K0KQ 3D0FA 4A3BB 3OW7A 1ZEQX 1E24A 3WDNA 3RMHA 4HJ9A 1RJTA 1YIJA 5EPKA 4H0LC 1DYQA 1KAAA 2ALYB 3LX0A 5CBAE 3FP9A 1D5MC 2HD3A 3H0GG 3S17H 1IXRA 4A3GB 2B63G 1LT3D 4X65Q 3GTGB 4P75A 3BVZA 2IW3A 1VQEA 1EY0A 5D14A 1BCPD 4B08A 4LF4Q 1J9OA 4BY7H 4LUVA 3E0JA 5G3LF 1BCPB 4ILWA 4PMWA 2WAQE 1HQMC 1J5EL 2ZT9C 4NXMQ 1WTVA 2EVBA 5FO7B 1LTTD 2F0EA 1C0AA 3ONAB 4CKBA 1G8ZD 1B9MA 4DV0L 4B9XA 3VYUA 3N52A 2KHIA 4KN7C 5CGKA 1A63A 1SE2A 3I55A 2J7ZA 2SEBD 3CCLA 2UXBQ 3FVQA 1TS2A 4RGNA 2I5LX 5M3FG 4KHPQ 3KFUA 1PVOA 2BDNA 3PSIA 1EU4A 2B63B 3J7YW 5JPMC 3FPUB 4L5SA 4LF8L 1CZGA 3OMCA 4HMJA 2MNAA 3BZKA 4RGTA 3ZYYX 4DUYQ 4DV4L 2B2VA 1SE4A 4A3EH 4KLKA 3CQZH 4KKUA 3PIP3 3R93A 3W5OA 3K80C 5JEAH 1LV9A 1P16A 2M2LA 4DXGA 1HFGA 1QWYA 5BN5A 2A1AA 1F9RA 1S5CD 2UXCQ 5K36G 3U50C 1STHA 4B9WA 1B3AA 1EFID 1AEXA 5M3FB 1T5EA 4AH6A 2K4KA 2HCCA 4CDFC 4JI8L 1PFSA 3CC2A 4NDXA 4KV6A 4DAYA 3NK9A 1FGBD 2I0QA 2AUJD 2WB1E 4EQ5A 3K58A 5CORA 3NEMA 3EJIA 4X3UA 1ASYA 2BCOA 2BE5D 1I4RA 1UEBA 3KF6B 1HPCA 5CR3A 5CBEE 4HEDA 3A54A 3URYA 3A0JA 4K0KL 4A3JH 3WWVA 2CFMA 3M7GA 3HOZG 4A3KG 1R9TH 2NN6H 2B2UA 3S2DH 2FFKB 4QIWB 3SE0A 1DCZA 1ZYRC 2HDLA 2DY8A 1OTCA 4IN3A 5J1ZA 3D31A 1YZ6A 2F0FA 4X65L 5HGTA 2N8NA 4KJNA 4DGZA 3EFXD 2A19A 4LF4L 5CV5A 4JBMA 3NUCA 1F9QA 4A4IA 1W6KA 5ELDA 4A3IH 4S3SA 5EQ0A 3TZDA 5C5MA 3R8BA 3VA7A 4NXML 2HT1A 2K32A 2PMZE 4GN3B 3CMEA 5C4HA 1EWIA 4XTCS 2PO4A 1VQCA 4PQXA 5GAGC 2NVXB 2L11A 3AMUA 3F2UA 4A3KB 3HOZB 2UXBL 1BCPF 1STAA 1U4PA 3J81L 2AKWB 4KHPL 1D2BA 2EIFA 2MHVA 1TKWB 2KHJA 1I6HH 3CRLC 3CW2C 1V1PA 2L12A 1GO3E 3S17B 1ENCA 1IBKQ 5I6YA 1PH1A 1D5ZC 1JWUD 4DUYL 1HUMA 4NP5A 3PIO3 2F0VA 4BY7B 1HJPA 2GN5A 2JEBI 1LTAD 1WTHA 2E2DC 5I4DA 3A8KE 2YTYA 3K0YA 1EZ6A 1BDOA 4JV5Q 2OT2A 4KKTA 4J8QA 1Z47A 4AQYQ 1Q1EA 2UXCL 1QVFA 5C44G 3NE5B 4B3TQ 5EPJA 1MJEA 5KIXA 3H91A 4PNYA 1L1OC 4N9PA 1ONLA 5ELOA 4YWLA 3VA5A 4EQPA 4A75A 2EQSA 4FYDA 4C3HG 2QDLA 2VY3A 4HR7B 1JB3A 2L1BA 1CKMA 5E7NA 1KQSA 1H9SB 1JCKB 1IZ6A 1XWEA 1LO5D 1SLJA 2ICEC 2NVYH 4O2DA 1KTKA 1UNSA 1N8RC 3A74A 3QR8A 1XPOA 3PUWA 4M8AA 3CQZB 1EQVA 4K2KA 1GUNA 2XSCA 3VR4A 3Q23A 4IQZA 2KCNA 5C44B 2XVSA 3D6WA 4FXGC 3B6YA 1NUCA 3M4QA 1WOCA 4UHVA 3NHHA 3GTPH 1CKOA 2KA7A 3MXNA 3CC4A 4DK0A 1SRUA 2WINB 3M3YH 2JA5H 2WP8J 2PZTA 4L6TB 5IY0A 4TQUS 1PHJA 1F77A 4QF4A 3V05A 1B44D 3QO2A 4IJLA 3VR6A 1AW7A 2RSNA 4RCNA 5M5YH 2EXDA 1G291 2K1BA 3G48A 1ZXTA 4GKJQ 3NWSA 1HNZQ 1QNUA 4UAIA 2IL8A 4ULLA 2WKDA 1SE8A 1EYDA 3SK6A 1Q7YC 1QZGA 2JA6G 3P1HA 3M4YA 1SFOB 1X54A 2F0TA 3STBC 3K7AH 1GUWA 1ILPA 2CW0D 1FNVA 1PTOH 3S2DB 1NR4A 5C4JH 4EGVA 5EGTA 1JWMD 5IGFA 5C0XJ 4DV3Q 3A7AB 4H44C 1IBKL 3T53B 1YHBA 4RWSC 1ENAA 2B2VC 4QQBX 4BXXH 1TWCH 4JI3Q 3NWTA 2AUKA 3RZDB 1RTNA 5IOCA 3I2ZA 4RKLA 2PQEA 4A3IB 1PZJD 5CMDA 3SEBA 4J15A 2IX0A 2E8GA 2EE1A 4JV5L 1STEA 4ALPA 1N32Q 1GUOA 4AQYL 1PA6A 1IYVA 4X64Q 4CGYB 1CA6A 4A3FH 1KXLA 1Z9FA 4B3TL 4CJ2C 5CV8A 4AIMA 2CHBD 4WRDA 5I6WA 1I4PA 4DAVA 1I6HB 2RDHA 2Y0SE 5T1IA 5IT9c 2F0KA 1VQ5A 5BN4A 1O80A 1RCVD 4IFDI 3K6OA 2CH4W 4JW0A 4DV5Q 5E4XA 1SNOA 1VQHA 2K5HA 1V1QA 3EBEA 1MD2D 2ZTDA 4YHHL 1Q8KA 5EKIA 1BBXC 4R4TA 3H3VH 3PO3H 4OXPA 2JA8H 1Q1BA 1KLUD 2X6LA 1C48A 4IZ8A 3I4MG 4DAMA 1QB5D 2B2UC 5BN3A 1X56A 1E2WA 5KYLA 3F2BA 1X3EA 2L9HA 3DM3A 2K04A 3HKZE 2MP1A 4JI5Q 1NNXA 4RHSA
chains in the Genus database with same CATH topology
5C3XA 4K6DA 1TY0A 3D3RA 5C0XG 1ESRA 3E6ZX 3DMUA 4XT1B 3W2DA 4ZAIA 1I4XA 2NVYB 1TWAB 4G4KA 2RSOA 2KEEA 1F2MA 1GJXA 1PRTF 2EXZA 1Y8OB 1SYDA 2PZUA 2VXWA 3D4DA 1I4QA 2YYZA 3GTPB 5I9PA 4G57A 5LL6X 4MHEA 2IWHA 2HQEA 2EYPA 4J6HA 2O5JC 4ZKCB 1IYUA 1D1IA 2K5WA 1PYWD 1ZKOA 3PUVA 3D4RA 5JPNC 1F9SA 5IT9E 1WTQA 5M5YB 3C46A 3I73A 2NWGA 3QOLA 4K5VA 1PTOD 4CJ1B 3T16A 1BXTA 3K7AB 4HN7A 1PTOB 5C6AA 3GTQB 2A73B 3DWPA 3ND8A 5KNDA 1BO0A 1TWFB 2B2YC 1IW7D 2EPBA 4X3SA 3MXGA 3KUPA 1R4PB 4DFAA 3DWAA 4QB4A 3AB9A 3MA2B 2HCIA 1CM9A 2BDOA 1G2TA 2K03A 1SMYC 5IGDA 3K59A 2EYJA 1Z6HA 3SHLA 2EJFC 4IFDJ 3NQIA 3NBIA 4A3FB 3NTIA 5JVH3 4DXFA 2D5DA 2B2TC 3C2PA 4QMGA 2F4IA 3D8GA 1O7YA 4Q5VA 2QCPX 2I46A 1UEAB 1K8OA 3P20A 5G3LD 1VMPA 5T1GA 3QJYA 1HCZA 5TSSA 3S1NB 1OXUA 4EVOA 3PO3B 1B1ZA 1PMRA 2FJ2A 1G6ZA 1E2ZA 3HP3A 4O1NA 1HTPA 3Q24A 4R8NA 3IFDA 1ILQA 2E74C 2WIIB 4OGQC 3C1EA 3G7LA 2EYLA 3SK8A 4DNTB 2JA7B 2VNUD 1WCMB 4ME5A 2K28A 2NUCA 3ND9A 1KDCA 4RHRA 2O5IC 2KECA 2F03A 1PTOC 4CKCA 1TIID 2X69A 4NMZA 4IFDG 2H4OA 4CJ0B 1II3A 5DEHA 4KKSA 3ITPA 1JWSD 1IW7C 2AQ3B 1IKMA 2XNAC 3VYTA 5K36H 1R4QB 1PTOF 3PUZA 2F0UA 3HS0C 4MIUA 3CRKC 4HMIA 1CA5A 2JP1A 5C4XB 3NP8A 1X3QA 1SSOA 1SXTA 1JQYD 3MEHA 3HOYB 2LMCB 2M9VA 3I91A 1WTWA 5JVG3 5FKAC 1YNND 2LS01 2WV6D 5FO8B 3NPPA 1LTBD 5M3MB 2WAQB 1KNAA 2B39A 2OEOA 4KY5A 1V1OA 1RKNA 5JAVA 1EWCA 5NUCA 3K5LA 1F2ZA 2XRQD 3P75A 4BBSB 3KF8A 1H9RA 1TT2A 2A68C 4WFN3 4KJOA 3FDTA 1A3UA 3Q0AA 4FXKC 1LT5D 4K5WA 2E2HB 5A35A 2QKIC 4C3JG 1X3PA 3N6RA 3NQTA 1J8IA 3H0GB 3K5MA 4H13C 1AN8A 2IPKD 2K6AA 4G7OC 1S5FD 4K6LA 1U4RA 2A69D 4E6IA 1E0BA 1DOKA 1EIGA 3OIQA 2LFNA 3J80E 2WB1B 2RQXA 2TMPA 1CQFA 1EY7A 2CQAA 4C3JB 2EY2A 4FP5D 2PW7A 1SYBA 5ELBA 2PYKA 3DWQA 3OIPA 4PV1C 1H9SA 5COYA 4U68A 3PV0A 3NXWA 2V4DA 2EY1A 1H9JA 1UAPA 3TP8A 2Q8RE 1JOOA 1BF4A 3A7LA 1SJHD 4RCOA 2CVRA 3BYTB 3V96A 1Y69U 3QB3A 1PFNA 2SNSA 5ELFA 2F0SA 5K5PA 2PMZB 3C1FA 2BA1A 4C3IG 2MJ8A 2L55A 1BUVT 2QF7A 4U673 4JK1C 1L0YB 3H6MA 4KI0A 1BCPC 4RGOS 1MSHA 3BVGA 2KQ3A 5A2QL 2QILA 1DZ1A 4KK7A 1EY6A 1WTXA 4RFBA 1STNA 4KN4C 1MGSA 2Z8LA 4FVMA 1KABA 4ZQ3A 4OO1I 1B4OA 1F2LA 4C3IB 1QNKA 5IGGA 3I90A 3R2IA 2K05A 2I07B 4RKBA 1DD2A 3VR3A 1ET6A 2F0MA 4HSPA 2IX1A 1JICA 3MXUA 1HHVA 1I3QB 1U4MA 2F0JA 4LAAA 5JOBA 1TY2A 2E2IB 3WOEA 2K7VA 1EY9A 4L8JA 1CHPD 3T4AC 1BR9A 1CFMA 2RA4A 4FF2A 5J39A 4KY6A 2Z4HA 1TS4A 3S2HB 3MFGA 2SOBA 2B2YA 4ZUIA 2K5DA 3D4WA 1NR2A 2B8FA 2BE5C 1QOHA 2EJMA 3FEWX 2F0IA 1BNZA 3S9WA 2EY5A 4R8IA 4K2LA 1C8CA 1KLGD 2B2TA 3D6CA 5C0XH 4IUVA 4C3HB 1PRTD 2EYFA 1A3TA 2G9DA 1WVLA 2EJGC 4DNRB 4I65A 2MPMA 2LY7A 1PRTB 4JBWA 3PUXA 3S15B 1KDAA 3OWEB 3VYRA 3MWYW 2D62A 2FMCA 5EKKA 2NVTB 1KNEA 4KHVA 4CHTB 3TSSA 3DEOA 2Y0SB 1NAPA 3JAME 1SYGA 4DN4M 3S1RB 2A5HA 5I2YA 3NTHA 5C4ZA 1D1KA 1Q8IA 2JA6B 1JR0D 4C2MB 1V43A 4FF3A 3EROA 1XX8A 2F3WA 2K01A 3HKZB 1HA5A 2E76C 1K83B 2AWNA 1SNPA 3MVVA 2DNCA 2Z4IA 4L63B 1TWGB 2KEDA 5KNCA 2F0NA 5D65A 5F2DA 3HGBA 1PFMA 3LWEA 5LL6S 2ID0A 4HCEA 1PRTC 2HDMA 5AFWA 1JOQA 3H09A 2NVQB 4ABNA 2R3ZA 4KHZA 2HUGA 4XYQA 4J1MA 1Q90A 1JOKA 1E2VA 1GHKA 1AFPA 1SYCA 3R3OA 1TVXA 1EEFD 4EQOA 3I4MB 3J7AV 4XQNA 4TKOB 2E75C 2EZVA 2CW0C 4ZRZA 5I9OA 3VYSA 1ESFA 2VB3X 1SEBD 4R9WA 2Q8IB 1FYCA 4RH6A 2XWJB 1B2TA 1G2SA 5FLXE 1I4HA 3HOWB 2A6ED 3I3CA 1VF5C 5DM73 4KD4A 4XXEA 1IL8A 4Q0FA 4X3TA 4IFDH 3S14B 3OOCA 2F0LA 4F88A 5KYIA 2YU9B 3HOUB 2EOTA 1SAPA 2R61A 3FKIB 2J4XA 3MZ5A 2F0PA 2PZWA 4K8IA 1FNWA 2D2CC 4QCLA 3GQBA 4QUFA 1I4GA 3QG1A 1K8MA 4BA1I 1W6JA 4UDUC 1TS3A 1SNCA 3MTSA 1QILA 1DOLA 3E5SA 3M7NA 2OF1A 3OMGA 1AZQA 4XDXA 4IUUA 4EQNA 2NB0A 1YNJD 2PNRC 4F87A 1HRJA 1GHJA 3O13A 5C5LA 3I8ZA 2F0OA 2NBFA 2H1EA 1VMCA 3S1MB 4PMCA 3TBIB 3BDCA 3SDZA 4RA8A 2IX3A 3MFYA 5DAUA 2L4NA 1O7ZA 2F1MA 1CZWA 2L0CA 2IJ0A 1SNMA 3PMFA 3OHXC 1EY8A 3TMEA 5I2XA 1M4VA 4A3DB 2A74C 4XQJA 1EU3A 1S5BD 1Y8NB 4C56C 1SNDA 1LT4D 1SDFA 3HG9A 4GZYC 5KGUA 3V2TA 2EYOA 4ID6A 1EY5A 3TN2A 2FHTA 4K5XA 1O7LA 3K57A 5E1FA 1EOTA 1HFNA 2AQ1B 2JEAI 3SK4A 1FNUA 3EQLC 5FOBB 1TQOA 3LWUA 1PZKD 3GV6A 3S16B 3OPOA 4G7HC 1LABA 3R2TA 2FMMA 3IKJA 1Q3LA 3TP6A 1LTID 1YNJC 1GUSA 3J81E 1V8QA 3I4LA 1HQRD 2JYOA 5IT9L 3H3VC 1B9NA 1WTRA 1TWHB 3G6JB 2B8GA 1GXDC 5KNBA 4M1UB 2KVMA 3GTMB 2N55A 3FMCA 2R92B 3A8IE 2A6HD 4HSVA 5E4WC 5EBCA 4FXDA 2R93B 5CV7A 4YIJA 3BS1A 1SE3A 4XQQA 1HA6A 1ZYRD 5KEEA 1MSGA 2QDBA 3U9OA 1O78A 3OWFA 1RTOA 4C1NI 3KLRA 4H7BA 5FK9C 5CC4A 1X32A 2F0WA 4HTHA 4ZLTF 2NN6I 3QOJA 1QE6A 1GUGA 1RODA 3A55A 2AWOA 3TP7A 2SDFA 1U4LA 1LTSD 3W3AA 3BVMA 2E2JB 2O2LD 1CTMA 1IKLA 1I6VC 4F8MA 1ICWA 5CV4A 3SXHA 1DONA 4V190 4ZYSA 3T13A 3M4OB 2RKSA 1XYIA 1XTCD 1STBA 1OO9B 3C3LA 1S4ZA 3L9AX 1EQTA 1UUPA 1F2YA 3CHBD 4NW2A 4TRDA 4BWGB 1S5ED 3QIAA 1YNNC 3H94A 1PDQA 3RUZA 5M5WB 1H9KA 1QG7A 4Z9CB 1HTLD 1VDZA 3U9SA 4ODGA 3FRPB 2XRSD 1ML0D 5IIFA 3Q6SA 1CQVA 4XT3B 3EA6A 3VR2A 4HCSA 4IUPA 2A6HC 1OXSC 3UI2A 3HZXA 4WJWA 5JEAJ 3PO2B 4XIGS 3DEPA 3BDLA 4FF1A 2JSOA 5ELEA 1PFBA 1U9RA 1EZ8A 2PW5A 2WKCA 4DK1A 3LNNA 2R7ZB 1JE4A 3CKIB 4CBVA 4CKEA 2K5QA 3X3NA 3K5NA 1VCIA 3SR1A 2C5CA 2O4XA 1SNQA 3T56B 1TR5A 5C0XI 3RZOB 2L5TA 1SJED 3I72A 2A69C 3I4NB 2NZ1D 1EYAA 5E3FA 2PCFB 1DOMA 1CK1A 1RDPD 2KCCA 1WTPA 2NTTA 2DY7A 1JORA 4FNFA 3L7ZC 3HOVB 3TDQA 3I70A 2F0QA 3KK7A 4RAUC 5J22A 1ET9A 5EBDA 1VF7A 1F9PA 5JEAG 4K14A 1L0XB 5IGBA 2DNEA 3KBGA 4BBRB 4A93B 2KOLA 3AU7A 2BA0A 1A2UA 1QCBD 3A56A 2RDFA 3IFTA 4A3EB 1EL0A 2OXPA 4OO1H 1SYEA 1RF2D 3J7AF 3MXPA 4PMBA 1PZID 3J80L 1D6EC 1XXGA 5EKLA 1DXMA 2AQ2B 3OSOA 4LK1C 3DUZA 5EJWA 2X6GA 2NN6G 2ENBA 1STYA 3A8JE 4ZUJA 3GP7A 1QJOA 2J0TD 4DU9A 4IUTA 3Q22A 2KJXA 1WD1A 2RVLA 2ZXOA 5IGEA 2VB2X 5DM63 1GUTA 5D3DA 5C3EB 4DAPA 1LTGD 3BYYB 4KD3A 3SK5A 4A3JB 2Z1CA 1OXVA 2F3VA 1SYFA 1TU2B 1R9TB 1Z7TA 1H9MA 2F0DA 2KUMA 3GO5A 1BOSA 1OXTA 2RBMA 3GTKB 2RDGA 1V1PB 2KHSA 2SNMA 5ISRA 2JE6I 5CV9A 1LACA 4XYOA 4IUQA 4MN3A 2IT1A 5CYUA 4NKLA 4RGMA 5IGCA 4AYBB 2EY6A 3KLSA 1BQQT 2ZXPA 1M8AA 4LJZC 4V0BA 2F0HA 3ERQA 2GA4B 3EVQA 5CV6A 1AZPA 2XWBB 2XN9C 1C4QA 4LMQD 4WORA 1EY4A 4OO1G 2ICIA 2B2WA 4Y7NB 1SMYD 3K5OA 3HOXB 5M9OA 1HUNA 3MAQA 3GTOB 2NYZD 1CHQD 1WD0A 5JJZA 1EEID 3BDOA 2QEJC 4BS9A 1I50B 5ELCA 3SVMA 3BG3A 4HAEA 4OHJA 1Q12A 2WACA 1MBYA 4A3MB 5D3IB 1D5XC 5KRUA 2PPBC 2LKVA 4FF4A 3M85A 3P7JA 4K8JA 2EYHA 3HRZC 4IALA 4I7ZC 1GOZA 3HEJA 1TS5A 3M3YB 2DN8A 2JA5B 2M00A 1EWHA 1FD7D 5LHY1 3CU7A 4BY1B 4P2CB 2TSSA 3WOFA 3DXJC 3DM1A 1WTOA 2VUMB 3FPPA 1RHPA 1A3VA 2EDGA 3MHBA 3MC0B 5C4JB 1EIHA 3GTJB 2G9HD 1LT6D 1CI3M 4G7ZC 5IODA 1KDBA 1TWCB 3T51B 4BA2I 3JAML 4F7XA 3BZDB 4KY7A 4QUCA 1DJRD 4X3KA 2D9UA 1CT1D 5DNFA 1G91A 4ZKBB 2N88A 3NSWA 4FO2A 2K33A 1FR3A 4ZK9B 4OIJA 4DF7A 3VR5A 1A6XA 1IHZA 1PXUA 2FINB 3IL8A 2EYMA 1SBBB 1STGA 1HXYD 3DHQA 1A15A 2ZXRA 1LTRD 2JA8B 1S5DD 2MGSA 2A6EC 5HURA 2A68D 2MUYA 3PUYA 4DA2A 5FO9B 3TZUA 1OXXK 3X3MA 1B50A 3KBXA 4TSSA 1Y1VB 3GV3A 1B53A 3NTKA 1JC7A 1LLRD 2C9OA 2R6GA 1NSNS 1AP0A 5C3WA 3QWNA 4OL7A 2Q8TA 1Y1WB 2JXMB 5A2QE 3IAYA 1MI2A 2F0GA 3NBHA 2BOSA 4IURA 4O42A 1NCVA 2B2WC 4N9TA 5FLXL 5M5XB 1Y8PB 4KMUC 3GTLB 4KTAA 4C1NK 3S1QB 3GD7A 3KLSX 1A2TA 1EYCA 1ENFA 3RLFA 4OIKA 3L3OC 5EPLA 1PLFA 3RD4A 2XIWA 1T5XD 4IUNA 1DM0B 1RD9D 2NTSA 3TP5A 4A3BB 3OW7A 1ZEQX 3WDNA 3RMHA 1RJTA 5EPKA 4H0LC 1DYQA 1KAAA 3LX0A 5CBAE 1D5MC 4A3GB 1LT3D 3GTGB 3BVZA 2IW3A 5D14A 1EY0A 1BCPD 4B08A 1J9OA 3E0JA 5G3LF 1BCPB 4ILWA 4PMWA 1HQMC 2ZT9C 1WTVA 2EVBA 5FO7B 1LTTD 2F0EA 3ONAB 4CKBA 1G8ZD 1B9MA 4B9XA 3VYUA 3N52A 4KN7C 5CGKA 1SE2A 2J7ZA 2SEBD 3FVQA 1TS2A 4RGNA 2BDNA 1EU4A 2B63B 3J7YW 5JPMC 3FPUB 1CZGA 3OMCA 4HMJA 4RGTA 3ZYYX 2B2VA 1SE4A 4KKUA 3PIP3 3R93A 5JEAH 1LV9A 2M2LA 4DXGA 1HFGA 1QWYA 5BN5A 1F9RA 1S5CD 5K36G 1STHA 4B9WA 1B3AA 1EFID 1AEXA 5M3FB 1T5EA 2HCCA 4NDXA 4KV6A 4DAYA 3NK9A 1FGBD 2AUJD 3K58A 5CORA 3EJIA 4X3UA 2BCOA 2BE5D 1I4RA 1HPCA 5CR3A 5CBEE 4HEDA 3A54A 3URYA 3M7GA 2NN6H 2B2UA 2FFKB 4QIWB 3SE0A 1DCZA 1ZYRC 2HDLA 2DY8A 4IN3A 5J1ZA 3D31A 2F0FA 5HGTA 4KJNA 4DGZA 3EFXD 5CV5A 3NUCA 1F9QA 1W6KA 5ELDA 4S3SA 5EQ0A 3TZDA 5C5MA 3R8BA 3VA7A 2K32A 5C4HA 4XTCS 2PO4A 4PQXA 2NVXB 2L11A 3AMUA 3F2UA 4A3KB 3HOZB 1BCPF 1STAA 1U4PA 3J81L 1D2BA 2MHVA 1TKWB 3CRLC 1V1PA 2L12A 3S17B 1ENCA 5I6YA 1D5ZC 1JWUD 1HUMA 4NP5A 3PIO3 2F0VA 4BY7B 2JEBI 1LTAD 2E2DC 5I4DA 3A8KE 3K0YA 1EZ6A 1BDOA 2OT2A 4KKTA 4J8QA 1Z47A 1Q1EA 3NE5B 5EPJA 5KIXA 3H91A 4PNYA 4N9PA 1ONLA 3VA5A 4EQPA 4FYDA 4C3HG 4HR7B 1JB3A 2L1BA 1H9SB 1JCKB 1XWEA 1LO5D 2ICEC 1KTKA 1UNSA 3PUWA 4M8AA 3CQZB 1EQVA 4K2KA 1GUNA 2XSCA 3VR4A 3Q23A 4IQZA 2KCNA 5C44B 2XVSA 3D6WA 4FXGC 1NUCA 3NHHA 2KA7A 3MXNA 4DK0A 2WINB 2WP8J 2PZTA 4L6TB 4TQUS 1F77A 4QF4A 3V05A 1B44D 3QO2A 3VR6A 1AW7A 2RSNA 4RCNA 1G291 2K1BA 1ZXTA 3NWSA 1QNUA 4UAIA 2IL8A 4ULLA 2WKDA 1EYDA 3SK6A 3P1HA 3M4YA 1SFOB 2F0TA 1GUWA 1ILPA 2CW0D 1FNVA 1PTOH 3S2DB 1NR4A 4EGVA 5EGTA 1JWMD 5IGFA 5C0XJ 3A7AB 4H44C 3T53B 4RWSC 1ENAA 2B2VC 3NWTA 2AUKA 3RZDB 1RTNA 5IOCA 4RKLA 2PQEA 4A3IB 1PZJD 5CMDA 3SEBA 2IX0A 2EE1A 1STEA 1GUOA 1IYVA 4CGYB 1CA6A 4CJ2C 5CV8A 2CHBD 4WRDA 5I6WA 1I4PA 4DAVA 1I6HB 2RDHA 5T1IA 2F0KA 5BN4A 1O80A 1RCVD 4IFDI 3K6OA 5E4XA 1SNOA 1MD2D 5EKIA 1BBXC 1Q1BA 1KLUD 2X6LA 1C48A 4IZ8A 1QB5D 2B2UC 5BN3A 1E2WA 5KYLA 2L9HA 2K04A 2MP1A 4RHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3X A;  5HUR A;  3D4W A;  1EY0 A;  3D8G A;  4KJN A;  5CV4 A;  3SXH A;  4K6D A;  4DGZ A;  4F8M A;  5E1F A;  2F0D A;  5CV5 A;  3MVV A;  1JOR A;  3NUC A;  4ZUI A;  3T13 A;  4K8J A;  3SK4 A;  2PZT A;  2EYH A;  2F0I A;  2RBM A;  3QB3 A;  2RKS A;  2SNS A;  3DMU A;  2F0S A;  4IAL A;  4QF4 A;  2F0Q A;  4S3S A;  5K5P A;  2OEO A;  3C1F A;  5C5M A;  3S9W A;  2KHS A;  4KY5 A;  1STB A;  2F0E A;  3HEJ A;  5J22 A;  2F0N A;  1RKN A;  2EY5 A;  5F2D A;  5C4H A;  2M00 A;  4B9X A;  2SNM A;  1TQO A;  5ISR A;  1F2M A;  5JAV A;  4K2L A;  5CGK A;  1EYD A;  5NUC A;  3SK6 A;  1SNC A;  4EVO A;  1STA A;  2EXZ A;  1F2Y A;  1F2Z A;  3P1H A;  4TRD A;  5CV9 A;  3P75 A;  2F3V A;  3H6M A;  3D6C A;  3E5S A;  2F0T A;  4K14 A;  1TT2 A;  2EYF A;  1A3T A;  2KQ3 A;  2OF1 A;  3OMG A;  4KJO A;  4NKL A;  1SYD A;  4R8N A;  5IGB A;  2PZU A;  1A3U A;  1JOQ A;  5EGT A;  4I65 A;  4EQN A;  1ENC A;  1EY6 A;  3TP6 A;  1NSN S;  5IGC A;  3D4D A;  3OMC A;  3RUZ A;  5IGF A;  4HMJ A;  5C3W A;  1A3V A;  4OL7 A;  3C1E A;  5I6Y A;  2EY6 A;  1STN A;  5I9P A;  1KDA A;  4G57 A;  4K5W A;  3MHB A;  4NP5 A;  2EYL A;  1KAB A;  1ENA A;  4J1M A;  2F0V A;  1JOK A;  2HQE A;  4ZQ3 A;  3SK8 A;  1A2U A;  2EYP A;  4J6H A;  1SYC A;  2F0H A;  3ERQ A;  3R3O A;  4ODG A;  5C5L A;  5IOC A;  2F0O A;  4RKL A;  5IGG A;  1EZ6 A;  2PQE A;  4ME5 A;  3EVQ A;  2F0G A;  5CV6 A;  5IIF A;  2NUC A;  4PMC A;  4EQO A;  5EKK A;  2RDF A;  4QMG A;  5IOD A;  4WOR A;  1KDB A;  2OXP A;  3BDC A;  3NQT A;  1EY4 A;  4RKB A;  4KHV A;  1SYE A;  3QOL A;  4F7X A;  1KDC A;  3MXP A;  4K5V A;  5DAU A;  1STH A;  2F0M A;  4PMB A;  3HZX A;  4KY7 A;  4B9W A;  5I9O A;  1AEX A;  5CV7 A;  4YIJ A;  4N9T A;  5KIX A;  5CV8 A;  3BDL A;  4PNY A;  4NMZ A;  3T16 A;  4N9P A;  5EKL A;  4WRD A;  3VA5 A;  5I6W A;  4EQP A;  1SNM A;  3PMF A;  4E6I A;  2PZW A;  5M9O A;  1II3 A;  1U9R A;  3OSO A;  4K8I A;  4KTA A;  4NDX A;  5DEH A;  5C6A A;  1SYG A;  2F0J A;  4LAA A;  5JOB A;  1EZ8 A;  1EY8 A;  2F0K A;  2ENB A;  2PW5 A;  3ITP A;  4KV6 A;  1STY A;  1A2T A;  2QDB A;  3NK9 A;  1EYC A;  3TME A;  3U9O A;  3OWF A;  1EY9 A;  1EY7 A;  4ZUJ A;  4H7B A;  3EJI A;  4DF7 A;  2EY2 A;  4DFA A;  5CC4 A;  2PW7 A;  1SNO A;  4DU9 A;  2F0W A;  4IUN A;  1SYB A;  4HTH A;  4KD4 A;  4QB4 A;  5CR3 A;  1IHZ A;  5C4Z A;  2F0U A;  3SR1 A;  3QOJ A;  2PYK A;  3TP5 A;  1EQV A;  2O4X A;  4K2K A;  4MIU A;  1SNQ A;  2EYM A;  3ERO A;  1SND A;  4HMI A;  4KY6 A;  5J39 A;  5IGE A;  2WAC A;  5IGD A;  1STG A;  2F0L A;  3NP8 A;  1TR5 A;  2EYJ A;  3NHH A;  3TP7 A;  2F3W A;  4IZ8 A;  3SHL A;  5KGU A;  3V2T A;  1KAA A;  5KYI A;  3LX0 A;  2EYO A;  3MEH A;  1EYA A;  5E3F A;  4KD3 A;  3DHQ A;  3NXW A;  2SOB A;  3SK5 A;  1NUC A;  4ID6 A;  1EY5 A;  5KRU A;  5KEE A;  4K5X A;  2EY1 A;  5KYL A;  5J1Z A;  3MZ5 A;  3TP8 A;  2F0F A;  2F0P A;  1JOO A;  5HGT A;  1SYF A;  1SNP A;  2LKV A; 
#chains in the Genus database with same CATH topology
 5C3X A;  2UUC Q;  4K6D A;  3ZJY C;  1TY0 A;  3D3R A;  4POF A;  5C0X G;  1X6O A;  2YTX A;  1ESR A;  1M1K C;  1UWV A;  3E6Z X;  1WCM H;  3DMU A;  4XT1 B;  3W2D A;  2ASB A;  3CCJ A;  4ZAI A;  1I4X A;  3HOW G;  2NVY B;  1TWA B;  4G4K A;  2RSO A;  3J7Z C;  2HHH Q;  1CKN B;  2KEE A;  3KJO A;  4R1J A;  4GKJ L;  1F2M A;  1SRO A;  3H15 A;  1HNZ L;  1GJX A;  1HZC A;  1PRT F;  2EXZ A;  4GN4 B;  1X65 A;  1Y1W H;  1Y8O B;  1SYD A;  2PZU A;  2KBN A;  2VXW A;  4HJ8 A;  3D4D A;  1I4Q A;  1QZH A;  4DV3 L;  2YYZ A;  3GTP B;  1BBU A;  5I9P A;  4G57 A;  1YJW A;  5LL6 X;  4MHE A;  2IWH A;  2HQE A;  4JI3 L;  2DJF C;  2EYP A;  4J6H A;  1DGS A;  2O5J C;  4ZKC B;  1IYU A;  1AE2 A;  1HR0 W;  1D1I A;  2ZM6 Q;  2K5W A;  1PYW D;  1ZKO A;  3PUV A;  3D4R A;  4LUO A;  5JPN C;  1F9S A;  5IT9 E;  1WTQ A;  5M5Y B;  3C46 A;  3I73 A;  1N32 L;  2NWG A;  3QOL A;  4K5V A;  4X64 L;  3A5U A;  1PTO D;  4CJ1 B;  4GOP B;  1VQP A;  2BH8 A;  4A3F G;  3F2D A;  4RMF A;  3T16 A;  1V9P A;  4JI7 L;  1BXT A;  3K7A B;  4HN7 A;  1PTO B;  4A3C H;  5C6A A;  3GTQ B;  2A73 B;  3DWP A;  3ER0 A;  3ND8 A;  5M3M H;  5KND A;  4YY3 Q;  1BO0 A;  1TWF B;  3U4Z A;  2B2Y C;  1IW7 D;  2EPB A;  4X3S A;  3MXG A;  3KUP A;  1R4P B;  1PH7 A;  4DV5 L;  4DFA A;  3DWA A;  4QB4 A;  3AB9 A;  1FL0 A;  4R4C A;  3MA2 B;  2HCI A;  1CM9 A;  4LW1 A;  1VQB A;  2BDO A;  1G2T A;  2UUA Q;  2K03 A;  1SMY C;  5IGD A;  3K59 A;  3GTG H;  4JYA Q;  2EYJ A;  4P71 A;  5IYC H;  1Z6H A;  4BBS H;  3SHL A;  2EJF C;  3UE1 A;  4IFD J;  3NQI A;  3NBI A;  4A3F B;  3NTI A;  1A62 A;  5JVH 3;  4DXF A;  3CCM A;  2D5D A;  2B2T C;  4JI5 L;  3C2P A;  4QMG A;  2F4I A;  3D8G A;  3M9B A;  2UUC L;  1O7Y A;  4Q5V A;  1GVP A;  2E2H H;  1S3O A;  2QCP X;  2JA7 G;  2I46 A;  3E0E A;  3KLW A;  2PQA A;  1UEA B;  1PH2 A;  1K8O A;  2QA4 A;  3P20 A;  3ERS X;  5G3L D;  1VMP A;  2HHH L;  4B3R Q;  2L15 A;  3H0G H;  2P5Z X;  5T1G A;  3QJY A;  1HCZ A;  2MO1 A;  1VS0 A;  5TSS A;  2B63 H;  3S1N B;  3PF5 A;  1OXU A;  4EVO A;  2D0O A;  3PO3 B;  1B1Z A;  2G5D A;  2JJQ A;  1PMR A;  3W1G A;  3ULL A;  2FJ2 A;  1G6Z A;  1E2Z A;  3HP3 A;  1YJ9 A;  4O1N A;  1NY4 A;  1QUQ B;  1HTP A;  3Q24 A;  4R8N A;  2RF4 A;  3IFD A;  1N34 Q;  1X3F A;  1ILQ A;  2E74 C;  2WII B;  4OGQ C;  3C1E A;  5IP9 G;  1YIT A;  1JJC B;  3G7L A;  3TEH B;  2EYL A;  3SK8 A;  4DNT B;  2JA7 B;  2VNU D;  2C35 B;  4DV2 Q;  3F8T A;  1WCM B;  4ME5 A;  5M3F H;  1B8A A;  2K28 A;  2NUC A;  3ND9 A;  1EIF A;  2ZM6 L;  1BBW A;  3RLO A;  5C4X G;  3BU2 A;  1KDC A;  4RHR A;  2O5I C;  2KEC A;  2MQH A;  2F03 A;  1PTO C;  4CKC A;  1TII D;  3HOY G;  2X69 A;  4NMZ A;  4IFD G;  2H4O A;  4CJ0 B;  1HNW Q;  1II3 A;  5DEH A;  3CPF A;  4KKS A;  3I7F A;  3ITP A;  1U0L A;  4YY3 L;  1JWS D;  1IW7 C;  2AQ3 B;  2IHE A;  1D8L A;  2WAQ G;  1IKM A;  2XNA C;  3VYT A;  5K36 H;  1JJ2 A;  1R4Q B;  1PTO F;  3PUZ A;  2F0U A;  4IJH A;  3HS0 C;  4MIU A;  3CRK C;  4HMI A;  1CA5 A;  2JP1 A;  3U4V A;  5C4X B;  2UUA L;  1L1O A;  2JN4 A;  3NP8 A;  1X3Q A;  4JPB W;  4JYA L;  1SSO A;  1SXT A;  3J80 c;  3KOJ A;  1JQY D;  3MEH A;  3I56 A;  3HOY B;  2K52 A;  2LMC B;  2M9V A;  2F4V Q;  3KF6 A;  3HFZ B;  5GRO A;  3I91 A;  2R93 G;  4YCU A;  1LUZ A;  1WTW A;  5JVG 3;  1WI5 A;  5FKA C;  1YNN D;  2LS0 1;  2WV6 D;  5FO8 B;  3NPP A;  1LTB D;  5M3M B;  2WAQ B;  4C3I H;  1KNA A;  2B39 A;  1VQ6 A;  3HOZ H;  4A3K H;  2OEO A;  1C7Y A;  4KY5 A;  3CCR A;  1V1O A;  1RKN A;  1MHW C;  4B3R L;  4HJA A;  5JAV A;  1VQG A;  3JC6 6;  1EWC A;  5NUC A;  3K5L A;  1QVG A;  1F2Z A;  2XRQ D;  1K73 C;  3P75 A;  1I3Q H;  4BBS B;  3KF8 A;  2ZJR A;  1H9R A;  1NE3 A;  1TT2 A;  2A68 C;  4YCV A;  4KJO A;  4WFN 3;  3FDT A;  1A3U A;  2E2I H;  3Q0A A;  2HQL A;  1GM5 A;  4FXK C;  1N34 L;  1LT5 D;  5LMN W;  2WB1 G;  1VQJ A;  4K5W A;  2E2H B;  3PGZ A;  5A35 A;  2QKI C;  4C3J G;  4DV2 L;  1X3P A;  3N6R A;  4DR5 Q;  1B70 B;  2R7D A;  1E3P A;  3NQT A;  3S2H H;  1B3Q A;  1J8I A;  3H0G B;  3K5M A;  4H13 C;  3JAM i;  1AN8 A;  2IPK D;  2K6A A;  1KRT A;  4G7O C;  4P72 A;  1S5F D;  4K6L A;  1U4R A;  2A69 D;  4E6I A;  1E0B A;  1DOK A;  1HNW L;  4L5T A;  1EIG A;  3OIQ A;  2LFN A;  3J80 E;  2WB1 B;  2RQX A;  2TMP A;  1CQF A;  1XMO Q;  1EY7 A;  2CQA A;  2OQ0 A;  4C3J B;  2EY2 A;  3K0X A;  4FP5 D;  2PW7 A;  1SYB A;  5C44 H;  1AE3 A;  5ELB A;  2PYK A;  3DWQ A;  3KDF B;  3G71 A;  5AJ3 Q;  2F3I A;  3OIP A;  4PV1 C;  1H9S A;  5COY A;  4C3H H;  3G4S A;  4U68 A;  1S40 A;  4N8F A;  3PV0 A;  1VQK A;  3NXW A;  1K8G A;  2V4D A;  1EQR A;  2EY1 A;  2F4V L;  1H9J A;  1UAP A;  3PO2 G;  3TP8 A;  2Q8R E;  1JOO A;  1BF4 A;  1PYS B;  3A7L A;  1K3R A;  3S15 H;  4IPD A;  1SJH D;  4RCO A;  1IL2 A;  2CVR A;  4IO9 A;  3BYT B;  3V96 A;  1Y69 U;  1WFQ A;  3QB3 A;  1PFN A;  2SNS A;  5ELF A;  2F0S A;  5JJL A;  5K5P A;  2PMZ B;  3C1F A;  2BA1 A;  2ES2 A;  4C3I G;  2PNH A;  2MJ8 A;  2NVT H;  2L55 A;  2R7Z G;  1SFO H;  1BUV T;  2QF7 A;  4U67 3;  4JK1 C;  3IRB A;  1L0Y B;  3UE0 A;  3H6M A;  4KI0 A;  1BCP C;  4RGO S;  1MSH A;  3BVG A;  2KQ3 A;  5A2Q L;  2QIL A;  1DZ1 A;  3RZD H;  4KK7 A;  1EY6 A;  1WTX A;  3S1R H;  4RFB A;  1STN A;  4KN4 C;  1MGS A;  2Z8L A;  4FVM A;  1XPU A;  1KAB A;  4ZQ3 A;  4DR3 Q;  4OO1 I;  1B4O A;  1F2L A;  2JA6 H;  4C3I B;  1QNK A;  4C2M H;  5IGG A;  3HOV G;  3I90 A;  4DR5 L;  3R2I A;  1S72 A;  2K05 A;  2I07 B;  4RKB A;  1DD2 A;  3VR3 A;  4JI1 Q;  1W2B A;  1ET6 A;  2F0M A;  4HSP A;  2IX1 A;  2IY5 B;  1JIC A;  1K83 H;  3G6E A;  3MXU A;  1YI2 A;  3ICE A;  1HHV A;  3TS0 A;  1I3Q B;  1U4M A;  4I7A A;  3M4P A;  1PH6 A;  2HIV A;  2F0J A;  4LAA A;  5JOB A;  1TY2 A;  2E2I B;  1P8L A;  3WOE A;  2K7V A;  1EY9 A;  1XMO L;  4L8J A;  4BBR G;  1CHP D;  3T4A C;  4A93 G;  1G6P A;  1GKH A;  4NB3 A;  1BR9 A;  1CFM A;  2RA4 A;  1PYB A;  4FF2 A;  3JAM c;  5J39 A;  2K75 A;  4KY6 A;  5AJ3 L;  4HJ7 A;  2Z4H A;  1TS4 A;  3S2H B;  1VQ8 A;  3MFG A;  1FJG Q;  1W3S A;  2SOB A;  2UXD Q;  2Z6K C;  4A76 A;  2B2Y A;  4ZUI A;  2NVQ H;  3I4O A;  2K5D A;  3D4W A;  4LF7 Q;  1NR2 A;  1TWA H;  2B8F A;  2BE5 C;  4B3M Q;  1QOH A;  2EJM A;  4R4Q A;  3FEW X;  4YHH Q;  2F0I A;  1BNZ A;  1VQ7 A;  4DPG A;  3S9W A;  3I4M H;  2N78 A;  1MJC A;  2EY5 A;  4R8I A;  3UDI A;  1SR3 A;  4K2L A;  4YCW A;  1IYJ B;  1UE1 A;  1C8C A;  1KLG D;  2B2T A;  3OTO Q;  3J81 j;  3D6C A;  5C0X H;  4IUV A;  4C3H B;  1PRT D;  2EYF A;  1A3T A;  2G9D A;  1WVL A;  2EJG C;  2Y0S G;  4DNR B;  4I65 A;  4IOA A;  2MPM A;  4NXN Q;  2LY7 A;  1CKN A;  1TXY A;  4LFA Q;  4POG A;  4DV6 Q;  1PRT B;  1VQO A;  3HOW H;  4JBW A;  3PUX A;  3S15 B;  1KDA A;  3OWE B;  4DR3 L;  3VYR A;  3MWY W;  2D62 A;  2FMC A;  3S14 H;  2XTI A;  5EKK A;  2NVT B;  1KNE A;  4KHV A;  4CHT B;  2YU9 H;  4GKK Q;  4JI1 L;  1JB7 A;  3GTQ H;  3TSS A;  3FKI H;  2K5N A;  1TWF H;  1CUK A;  2DGY A;  3HKZ G;  1JMC A;  3DEO A;  2Y0S B;  1NAP A;  3JAM E;  4R4I A;  1SYG A;  4DN4 M;  3S1R B;  5EAY A;  4O0A A;  2A5H A;  2MO0 A;  1PH8 A;  3L0O A;  5I2Y A;  1ICF B;  3NTH A;  4GOP A;  4AYB G;  2NZH A;  5C4Z A;  1D1K A;  4X6A H;  1NMG A;  2VQE Q;  1Q8I A;  2JA6 B;  1JR0 D;  4C2M B;  1V43 A;  4FF3 A;  3ERO A;  1XX8 A;  2E5L Q;  4JI7 Q;  2F3W A;  2K01 A;  1FJG L;  2YV5 A;  3CCE A;  3HKZ B;  2UXD L;  1HA5 A;  2E76 C;  2JA9 A;  1K83 B;  2AWN A;  1SNP A;  2UUB Q;  4LF7 L;  3HOX G;  3MVV A;  4B3M L;  2DNC A;  2Z4I A;  4PZ7 A;  4LFB Q;  4L63 B;  3S1N H;  3RN2 A;  1TWG B;  1SN8 A;  2YTV A;  4LF9 Q;  3S1M H;  5JJI A;  1CSP A;  2KED A;  5KNC A;  2F0N A;  5D65 A;  4H02 A;  4A3L G;  5F2D A;  3HGB A;  4JI6 Q;  1PFM A;  3LWE A;  3T1Y Q;  5LL6 S;  3OTO L;  4IOC A;  2ID0 A;  4HCE A;  1PRT C;  2HDM A;  2Z0S A;  5AFW A;  4IPH A;  1JOQ A;  4A3M G;  2JA7 H;  4NXN L;  2RHQ B;  4LFA L;  3H09 A;  2N49 A;  4DV6 L;  2NVQ B;  4OWW B;  4ABN A;  2R3Z A;  4KHZ A;  2KCM A;  2HUG A;  4XYQ A;  5DLQ E;  4AYB E;  4J1M A;  1Q90 A;  1JOK A;  2FXQ A;  4UY8 C;  1E2V A;  1GHK A;  1AFP A;  1SYC A;  2PI2 A;  3R3O A;  4JVZ A;  1QUQ A;  4DNI A;  2ZTC A;  1TVX A;  1EEF D;  5IP7 G;  4EQO A;  3I4M B;  3J7A V;  4XQN A;  4TKO B;  2E75 C;  2EZV A;  2CW0 C;  4GKK L;  4ZRZ A;  3MXN B;  5I9O A;  3VYS A;  5L37 A;  3EIV A;  4DR7 Q;  1ESF A;  3HOU G;  5IP9 H;  2VB3 X;  3CPW A;  2AHO B;  3FKI G;  1SEB D;  4R9W A;  2VUM G;  1EQQ A;  2Q8I B;  1FYC A;  1N33 Q;  4HIK A;  4RH6 A;  2XWJ B;  1B2T A;  1G2S A;  2CWP A;  1I4H A;  5FLX E;  2WFW A;  2A8V A;  3HOW B;  5C4X H;  2A6E D;  4DV1 Q;  3I3C A;  1VF5 C;  5DM7 3;  4KD4 A;  4XXE A;  1IL8 A;  4Q0F A;  2VQE L;  1UE5 A;  3HOY H;  4X3T A;  1PH5 A;  1FVI A;  4IFD H;  3S16 H;  3S14 B;  2E5L L;  3OOC A;  1O7I A;  2F0L A;  3J80 i;  4F88 A;  4CDE C;  5KYI A;  2YU9 B;  3HOU B;  2NZO A;  2EOT A;  1CSQ A;  1SAP A;  2R61 A;  3RNU A;  2OTJ A;  4OX9 L;  4DR2 Q;  3FKI B;  3S24 A;  1EIY B;  2J4X A;  3MZ5 A;  2F0P A;  4L5Q A;  1KD1 C;  2PZW A;  4K8I A;  3E9H A;  2UUB L;  1GD7 A;  1FNW A;  2D2C C;  3ULP A;  4QCL A;  1VQM A;  3GQB A;  4QUF A;  1ASZ A;  4LFB L;  1N36 Q;  1I4G A;  4LF9 L;  3QG1 A;  1K8M A;  3GTM H;  4BA1 I;  4WJ4 A;  1Q81 C;  1W6J A;  4UDU C;  4JI6 L;  3T1Y L;  2R93 H;  1TS3 A;  1SNC A;  3MTS A;  1QIL A;  1UE7 A;  1YHQ A;  3NEL A;  5IWA Q;  1DOL A;  3E5S A;  1XMQ Q;  2RCF A;  1L0W A;  3M7N A;  2OF1 A;  3OMG A;  2HIX A;  4YWK A;  5GAD C;  1AZQ A;  4XDX A;  4IUU A;  4EQN A;  2NB0 A;  1PH3 A;  1YNJ D;  4JI0 Q;  2QW7 A;  1E7Z A;  2PNR C;  4F87 A;  1HRJ A;  2LXK A;  4B3S Q;  4A3D G;  1GHJ A;  1KC8 C;  3CAM A;  3UDG A;  3O13 A;  5C5L A;  4DKA C;  3I8Z A;  2F0O A;  2NBF A;  2D0P A;  1NMF A;  2H1E A;  2MFI A;  1VMC A;  5IYD G;  4PMC A;  3S1M B;  3TBI B;  5HY6 A;  4Y52 H;  3BDC A;  3SDZ A;  3J81 c;  3CF5 A;  4RA8 A;  2IX3 A;  1VQ4 A;  3MFY A;  5DAU A;  2L4N A;  2E2J H;  4DR7 L;  1O7Z A;  2F1M A;  3PF4 A;  1Y1V G;  1CZW A;  2L0C A;  2IJ0 A;  1SNM A;  1HR0 Q;  3PMF A;  3OHX C;  4C3J H;  5IYB G;  3TS2 A;  3M4O H;  1EY8 A;  1N33 L;  3TME A;  5I2X A;  1M4V A;  1H95 A;  1VQL A;  2N3S A;  2A74 C;  4A3D B;  4XQJ A;  4DV1 L;  2ZTE A;  4GOP C;  3TRE A;  1EU3 A;  2GVB A;  1S5B D;  1E22 A;  3NEN A;  3CCQ A;  3HKS A;  1Y8N B;  4C56 C;  3RN5 A;  5FJ8 H;  1SND A;  1LT4 D;  1SDF A;  3HG9 A;  4GZY C;  4P73 A;  5KGU A;  1VQ9 A;  4JBJ A;  3V2T A;  1XNQ Q;  3AQQ A;  2EYO A;  4MZ9 A;  4DR1 Q;  4ID6 A;  1EY5 A;  3TN2 A;  2FHT A;  2RHS B;  4K5X A;  3ULJ A;  4HIO A;  4DR2 L;  1O7L A;  3K57 A;  3KDF A;  2PI2 E;  5E1F A;  1EOT A;  1HFN A;  2AQ1 B;  3EN2 A;  4OWX B;  4DR4 Q;  2JEA I;  3SK4 A;  4X66 Q;  2LSS A;  1FNU A;  1N36 L;  2KCT A;  3GDE A;  1VQD A;  3EQL C;  5FOB B;  1HNX Q;  1TQO A;  4EX5 A;  3LWU A;  3F2C A;  3PO2 H;  2R92 G;  1PZK D;  3GV6 A;  3OW2 A;  3S16 B;  4ZCK A;  2ZJQ A;  3OPO A;  2OCE A;  2Z6K A;  4G7H C;  5IWA L;  4A3B G;  1LAB A;  3R2T A;  1XMQ L;  2FMM A;  3IKJ A;  3AFQ A;  3CC7 A;  1Q3L A;  4GN5 A;  3TP6 A;  1LTI D;  1YNJ C;  1D7Q A;  1GUS A;  1Q46 A;  3J81 E;  4JI0 L;  2R7Z H;  1V8Q A;  2I5H A;  3I4L A;  1HQR D;  2JYO A;  5IT9 L;  3H3V C;  1B9N A;  1WTR A;  4X62 Q;  1TWH B;  4B3S L;  3G6J B;  3BZC A;  2B8G A;  1GXD C;  5KNB A;  4M1U B;  2KVM A;  3GTM B;  2N55 A;  3RZO H;  2Q2T A;  3FMC A;  2R92 B;  3A8I E;  2A6H D;  4HSV A;  5E4W C;  5EBC A;  4FXD A;  2R93 B;  5CV7 A;  4YIJ A;  1IBL Q;  4CDD C;  4JBK A;  4MTN A;  1XNR Q;  3BS1 A;  1SE3 A;  3T1H Q;  1HR0 L;  4XQQ A;  3CMA A;  2PQA B;  1HA6 A;  1ZYR D;  3HOV H;  5KEE A;  1MSG A;  2QDB A;  3U9O A;  1O78 A;  3OWF A;  1RTO A;  4C1N I;  3KLR A;  3SGI A;  4H7B A;  5FK9 C;  5CC4 A;  1X32 A;  2F0W A;  4HTH A;  3CP0 A;  4ZLT F;  2AMC B;  2NN6 I;  4MNO A;  3CCU A;  3QOJ A;  5H1S E;  1QE6 A;  1GUG A;  1J6Q A;  1ROD A;  4R4O A;  3A55 A;  2AWO A;  3TP7 A;  5FJ8 G;  2SDF A;  1U4L A;  1U5K A;  4LWC A;  1LTS D;  1XNQ L;  3W3A A;  3BVM A;  4DR1 L;  4GNX B;  2O2L D;  2E2J B;  4BBR H;  1CTM A;  1IKL A;  1I6V C;  4A93 H;  1PH9 A;  4F8M A;  1ICW A;  5CV4 A;  3SXH A;  1DON A;  4V19 0;  2LXJ A;  1X55 A;  2KEN A;  4ZYS A;  4DR4 L;  3T13 A;  1YEZ A;  3M4O B;  1PV4 A;  2RKS A;  1XYI A;  1XTC D;  4X66 L;  4GS3 A;  3OYY A;  1STB A;  1OO9 B;  4GLX A;  3W1B A;  3C3L A;  1S4Z A;  3L9A X;  4GLA C;  1HNX L;  2K14 A;  1K3B C;  1EQT A;  4DUZ Q;  1UUP A;  1F2Y A;  3CHB D;  4NW2 A;  4TRD A;  4BWG B;  1IBM Q;  1S5E D;  3QIA A;  1YNN C;  5LMU Q;  3NBH B;  3H94 A;  4DK3 C;  1PDQ A;  3RUZ A;  5M5W B;  1H9K A;  1QG7 A;  4Z9C B;  4JI4 Q;  1HTL D;  4N8X 1;  1MKH A;  4X62 L;  3AEV A;  1VDZ A;  1L1O B;  3U9S A;  4ODG A;  3FRP B;  2XRS D;  1VQN A;  1ML0 D;  4DV7 Q;  5IIF A;  3Q6S A;  1CQV A;  4JOI A;  4XT3 B;  3EA6 A;  3VR2 A;  4HCS A;  4IUP A;  1I5F A;  5C3E H;  2A6H C;  5LMN Q;  1OXS C;  3Q8D A;  3UI2 A;  3HZX A;  4WJW A;  5JEA J;  5JJK A;  3PO2 B;  2CWA A;  3I4N G;  4WJ3 M;  4XIG S;  3DEP A;  3BDL A;  1IBL L;  4FF1 A;  2JSO A;  5ELE A;  1XNR L;  3PCO B;  1XJV A;  1L2F A;  1X9N A;  3T1H L;  1PFB A;  5ELN A;  1U9R A;  1EZ8 A;  2PW5 A;  2WKC A;  4DK1 A;  3LNN A;  3GTK H;  1EYG A;  2R7Z B;  1JE4 A;  3CKI B;  1WYD A;  2IHF A;  3FHW A;  4CBV A;  2H5X A;  4CKE A;  4BY7 G;  2K5Q A;  3X3N A;  2CCZ A;  3K5N A;  1VCI A;  3SR1 A;  2C5C A;  3KF8 B;  2O4X A;  1SNQ A;  3T56 B;  4GNX C;  1TR5 A;  2K50 A;  5C0X I;  3RZO B;  2L5T A;  1SJE D;  3I72 A;  2A69 C;  3I4N B;  5GQO A;  4MTK A;  2NZ1 D;  1EYA A;  5E3F A;  5FLM H;  4QIW E;  2PCF B;  1BVS A;  1DOM A;  1CK1 A;  1RDP D;  2KCC A;  3E9I A;  2NTT A;  1WTP A;  2DY7 A;  1SMX A;  1FGU A;  1TWG H;  3E3X A;  3STB D;  1WJJ A;  2VW9 A;  1JOR A;  4FNF A;  3L7Z C;  2RCN A;  3HOV B;  2JQO A;  3TDQ A;  2B29 A;  3I70 A;  2F0Q A;  3KK7 A;  4RAU C;  5J22 A;  2VQF Q;  1YJN A;  1ET9 A;  5EBD A;  4A3E G;  1VQF A;  1YHA A;  2QGQ A;  1EOV A;  3MEF A;  1NBW A;  2CH4 A;  4Y7N H;  4DUZ L;  4UP8 A;  1VF7 A;  1F9P A;  2Q2H A;  4IPG A;  3HOX H;  2XGT A;  5JEA G;  1IBM L;  5GAE C;  4K14 A;  1L0X B;  5LMU L;  4L5R C;  1RIP A;  5IGB A;  3GTO H;  2DNE A;  1XPR A;  4PZ8 A;  3KBG A;  3VDY A;  4BBR B;  1X3G A;  4A93 B;  4JI4 L;  3TRZ A;  3U58 A;  4A3L H;  2KOL A;  4DR6 Q;  2DUD A;  3AU7 A;  2BA0 A;  1A2U A;  1I50 H;  1QCB D;  4OEM B;  3A56 A;  4DV7 L;  4OON A;  2RDF A;  1NTG A;  3IFT A;  4A3E B;  1EL0 A;  2OXP A;  4DAY B;  4OO1 H;  1SYE A;  4A3M H;  1RF2 D;  3J7A F;  3MXP A;  3RLN A;  5LMN L;  4PMB A;  4YWM A;  5C3E G;  1PZI D;  3J80 L;  1D6E C;  1XXG A;  5EKL A;  4A3J G;  1DXM A;  2AQ2 B;  4JI2 Q;  1Q82 C;  3OSO A;  4LK1 C;  3DUZ A;  5EJW A;  2X6G A;  2NN6 G;  1LYL A;  2ENB A;  5IP7 H;  1JE5 A;  1STY A;  4JCV E;  2Z9H A;  3H3V I;  3A8J E;  3AYH B;  4ZUJ A;  3GP7 A;  1QJO A;  2J0T D;  4DU9 A;  4IUT A;  3Q22 A;  2OQK A;  1EFW A;  2KJX A;  3HOU H;  4UP9 A;  4BY1 H;  1KIX A;  1E1T A;  1WD1 A;  2RVL A;  2ZXO A;  5IGE A;  2B3G A;  2VB2 X;  5DM6 3;  4A3I G;  1GUT A;  2VUM H;  1HZA A;  5D3D A;  5C3E B;  4DAP A;  1LTG D;  3BYY B;  4KD3 A;  3SK5 A;  4A3J B;  5FLM G;  2Z1C A;  1OXV A;  2F3V A;  1SYF A;  1TU2 B;  1R9T B;  1Z7T A;  1NJI C;  4ME3 A;  1H9M A;  2R7F A;  5IE8 A;  2F0D A;  2KUM A;  3GO5 A;  4CDC C;  1BOS A;  1OXT A;  3GTJ H;  2RBM A;  4APV A;  3GTK B;  1N9W A;  3K7U C;  2RDG A;  1V1P B;  2KHS A;  3KYH C;  1AH9 A;  1QVC A;  3CXC A;  2ATW A;  2VQF L;  2BH2 A;  1Y14 B;  5FLX c;  1K0S A;  1KHI A;  2SNM A;  5ISR A;  4IPC A;  4LF6 Q;  4OX9 Q;  2JE6 I;  1RL2 A;  3K8A A;  5CV9 A;  1E1O A;  1LAC A;  2V1C C;  4XYO A;  4IUQ A;  2K5V A;  4MN3 A;  1UE6 A;  2IT1 A;  2JK8 A;  4NKL A;  4RGM A;  5CYU A;  2UU9 Q;  5IGC A;  4UPA A;  1K9M C;  4AYB B;  2EY6 A;  3KLS A;  3L2P A;  1BQQ T;  1YVC A;  2ZXP A;  2Z6B A;  4DR6 L;  1M8A A;  4LJZ C;  4V0B A;  4QGU A;  4LF5 Q;  2F0H A;  3ERQ A;  2GA4 B;  3EVQ A;  5CV6 A;  1AZP A;  2XWB B;  2XN9 C;  1C4Q A;  4LMQ D;  4JOI C;  4WOR A;  3J81 i;  1VQA A;  1EY4 A;  1HZ9 A;  5BR8 Q;  3J7A 5;  4OO1 G;  2ICI A;  1C9O A;  2B2W A;  4Y7N B;  1SMY D;  3K5O A;  4FDB A;  3HOX B;  4A3D H;  5M9O A;  1HUN A;  4JI2 L;  3MAQ A;  3GTO B;  3PIP A;  2NYZ D;  1CHQ D;  4LUZ A;  5IYD H;  1WD0 A;  5JJZ A;  1EEI D;  4PZ6 A;  3BDO A;  2QEJ C;  1K0R A;  4OEL B;  4BS9 A;  1I50 B;  5ELC A;  3SVM A;  1B7Y B;  3BG3 A;  2JA5 G;  4HAE A;  4NPS A;  4OHJ A;  1Y1V H;  1Q12 A;  4OWT B;  4BY1 G;  2WAC A;  1MBY A;  5IYB H;  2I5M X;  4A3M B;  5D3I B;  2VZA A;  1YNX A;  1D5X C;  3RR5 A;  5KRU A;  2PPB C;  2LKV A;  1T9H A;  4FF4 A;  3M85 A;  3AFP A;  4JC0 A;  3P7J A;  1YBY A;  4HIM A;  2VL6 A;  4K8J A;  2EYH A;  3HRZ C;  4IAL A;  1MIU A;  2OWO A;  4I7Z C;  1GOZ A;  3HEJ A;  1TS5 A;  1A0I A;  4PG3 A;  3M3Y B;  1EUJ A;  2DN8 A;  2M00 A;  1EWH A;  2JA5 B;  4LFC Q;  1FD7 D;  5LHY 1;  4BXX G;  3CU7 A;  4BY1 B;  1LM0 A;  4LF6 L;  4P2C B;  2TSS A;  3WOF A;  5M5X H;  3DXJ C;  3DM1 A;  1WTO A;  2VUM B;  3GTL H;  1TWH H;  3FPP A;  1RHP A;  2UU9 L;  3S1Q H;  3K81 C;  1K28 A;  1A3V A;  2EDG A;  3A5Z B;  3UDX A;  3MHB A;  3MC0 B;  4HID A;  5C4J B;  2DJG C;  4TVA B;  2R92 H;  1EIH A;  4LF5 L;  3GTJ B;  2G9H D;  4P74 A;  1Q86 C;  1LT6 D;  1CI3 M;  4RG1 A;  2QEX A;  4A3B H;  4G7Z C;  1I94 Q;  5IOD A;  3DLL A;  1KDB A;  1TWC B;  3T51 B;  4BA2 I;  3JAM L;  5BR8 L;  2Q2U A;  4F7X A;  3BZD B;  2VS1 A;  4KY7 A;  4QUC A;  1DJR D;  4X3K A;  1A8V A;  2D9U A;  4A3G H;  1CT1 D;  5DNF A;  3PIO A;  3PO3 G;  2JA8 G;  1G51 A;  4ZKB B;  1G91 A;  2N88 A;  3NSW A;  4FO2 A;  2ZJP A;  2K33 A;  1FR3 A;  4ZK9 B;  4OIJ A;  4GLV B;  4DF7 A;  3VR5 A;  2F52 A;  1IHZ A;  1A6X A;  1PXU A;  2FIN B;  2GVA A;  3IL8 A;  5GAH C;  2EYM A;  3PQI A;  1K8A C;  1WCM G;  2Q2I A;  1SBB B;  1STG A;  1HXY D;  3DHQ A;  1A15 A;  2ZXR A;  3BJU A;  4JG2 A;  1LTR D;  2JA8 B;  1BKB A;  1S5D D;  2MGS A;  2CKZ B;  2A6E C;  5HUR A;  2A68 D;  2MUY A;  3PUY A;  1Y1W G;  4DA2 A;  5FO9 B;  1J5E Q;  3TZU A;  4GNX A;  1OXX K;  1M90 C;  3X3M A;  4DV0 Q;  1B50 A;  3KBX A;  1JJG A;  4TSS A;  4QJF A;  4LFC L;  5J3B A;  1Y1V B;  5M5W H;  3GV3 A;  1B53 A;  4DK6 C;  3NTK A;  1JC7 A;  1LLR D;  4LNQ A;  2C9O A;  1KL9 A;  4QL5 A;  2R6G A;  4LF8 Q;  3KJP A;  3CCS A;  1NSN S;  1AP0 A;  5C3W A;  3QWN A;  4OL7 A;  4DV4 Q;  1JT8 A;  2Q8T A;  1Y1W B;  2JXM B;  3CCV A;  4QY7 A;  5A2Q E;  3IAY A;  2CQO A;  4A3C G;  1MI2 A;  3CD6 A;  2F0G A;  3TQY A;  3NBH A;  5M3M G;  5HGQ A;  2BOS A;  4IUR A;  4O42 A;  1I94 L;  3F1Z A;  4HJ5 A;  1NCV A;  1LTL A;  2B2W C;  4N9T A;  5FLX L;  1XTD A;  5M5X B;  4JI8 Q;  1HZB A;  3UDF A;  4A3G G;  1Y8P B;  4KMU C;  3GTL B;  1PH4 A;  4KTA A;  5IYC G;  4BBS G;  3LGJ A;  4C1N K;  3S1Q B;  3GD7 A;  1KAW A;  3KLS X;  1A2T A;  1EYC A;  1ENF A;  1HH2 P;  3RLF A;  4OIK A;  3L3O C;  4UP7 A;  1PLF A;  5EPL A;  3RD4 A;  2XIW A;  1VQI A;  1T5X D;  4IUN A;  1DM0 B;  2OTL A;  3I4N H;  1RD9 D;  2NTS A;  1KRS A;  2NVX H;  3TP5 A;  4K0K Q;  3D0F A;  4A3B B;  3OW7 A;  1ZEQ X;  1E24 A;  3WDN A;  3RMH A;  4HJ9 A;  1RJT A;  1YIJ A;  5EPK A;  4H0L C;  1DYQ A;  1KAA A;  2ALY B;  3LX0 A;  5CBA E;  3FP9 A;  1D5M C;  2HD3 A;  3H0G G;  3S17 H;  1IXR A;  4A3G B;  2B63 G;  1LT3 D;  4X65 Q;  3GTG B;  4P75 A;  3BVZ A;  2IW3 A;  1VQE A;  1EY0 A;  5D14 A;  1BCP D;  4B08 A;  4LF4 Q;  1J9O A;  4BY7 H;  4LUV A;  3E0J A;  5G3L F;  1BCP B;  4ILW A;  4PMW A;  2WAQ E;  1HQM C;  1J5E L;  2ZT9 C;  4NXM Q;  1WTV A;  2EVB A;  5FO7 B;  1LTT D;  2F0E A;  1C0A A;  3ONA B;  4CKB A;  1G8Z D;  1B9M A;  4DV0 L;  4B9X A;  3VYU A;  3N52 A;  2KHI A;  4KN7 C;  5CGK A;  1A63 A;  1SE2 A;  3I55 A;  2J7Z A;  2SEB D;  3CCL A;  2UXB Q;  3FVQ A;  1TS2 A;  4RGN A;  2I5L X;  5M3F G;  4KHP Q;  3KFU A;  1PVO A;  2BDN A;  3PSI A;  1EU4 A;  2B63 B;  3J7Y W;  5JPM C;  3FPU B;  4L5S A;  4LF8 L;  1CZG A;  3OMC A;  4HMJ A;  2MNA A;  3BZK A;  4RGT A;  3ZYY X;  4DUY Q;  4DV4 L;  2B2V A;  1SE4 A;  4A3E H;  4KLK A;  3CQZ H;  4KKU A;  3PIP 3;  3R93 A;  3W5O A;  3K80 C;  5JEA H;  1LV9 A;  1P16 A;  2M2L A;  4DXG A;  1HFG A;  1QWY A;  5BN5 A;  2A1A A;  1F9R A;  1S5C D;  2UXC Q;  5K36 G;  3U50 C;  1STH A;  4B9W A;  1B3A A;  1EFI D;  1AEX A;  5M3F B;  1T5E A;  4AH6 A;  2K4K A;  2HCC A;  4CDF C;  4JI8 L;  1PFS A;  3CC2 A;  4NDX A;  4KV6 A;  4DAY A;  3NK9 A;  1FGB D;  2I0Q A;  2AUJ D;  2WB1 E;  4EQ5 A;  3K58 A;  5COR A;  3NEM A;  3EJI A;  4X3U A;  1ASY A;  2BCO A;  2BE5 D;  1I4R A;  1UEB A;  3KF6 B;  1HPC A;  5CR3 A;  5CBE E;  4HED A;  3A54 A;  3URY A;  3A0J A;  4K0K L;  4A3J H;  3WWV A;  2CFM A;  3M7G A;  3HOZ G;  4A3K G;  1R9T H;  2NN6 H;  2B2U A;  3S2D H;  2FFK B;  4QIW B;  3SE0 A;  1DCZ A;  1ZYR C;  2HDL A;  2DY8 A;  1OTC A;  4IN3 A;  5J1Z A;  3D31 A;  1YZ6 A;  2F0F A;  4X65 L;  5HGT A;  2N8N A;  4KJN A;  4DGZ A;  3EFX D;  2A19 A;  4LF4 L;  5CV5 A;  4JBM A;  3NUC A;  1F9Q A;  4A4I A;  1W6K A;  5ELD A;  4A3I H;  4S3S A;  5EQ0 A;  3TZD A;  5C5M A;  3R8B A;  3VA7 A;  4NXM L;  2HT1 A;  2K32 A;  2PMZ E;  4GN3 B;  3CME A;  5C4H A;  1EWI A;  4XTC S;  2PO4 A;  1VQC A;  4PQX A;  5GAG C;  2NVX B;  2L11 A;  3AMU A;  3F2U A;  4A3K B;  3HOZ B;  2UXB L;  1BCP F;  1STA A;  1U4P A;  3J81 L;  2AKW B;  4KHP L;  1D2B A;  2EIF A;  2MHV A;  1TKW B;  2KHJ A;  1I6H H;  3CRL C;  3CW2 C;  1V1P A;  2L12 A;  1GO3 E;  3S17 B;  1ENC A;  1IBK Q;  5I6Y A;  1PH1 A;  1D5Z C;  1JWU D;  4DUY L;  1HUM A;  4NP5 A;  3PIO 3;  2F0V A;  4BY7 B;  1HJP A;  2GN5 A;  2JEB I;  1LTA D;  1WTH A;  2E2D C;  5I4D A;  3A8K E;  2YTY A;  3K0Y A;  1EZ6 A;  1BDO A;  4JV5 Q;  2OT2 A;  4KKT A;  4J8Q A;  1Z47 A;  4AQY Q;  1Q1E A;  2UXC L;  1QVF A;  5C44 G;  3NE5 B;  4B3T Q;  5EPJ A;  1MJE A;  5KIX A;  3H91 A;  4PNY A;  1L1O C;  4N9P A;  1ONL A;  5ELO A;  4YWL A;  3VA5 A;  4EQP A;  4A75 A;  2EQS A;  4FYD A;  4C3H G;  2QDL A;  2VY3 A;  4HR7 B;  1JB3 A;  2L1B A;  1CKM A;  5E7N A;  1KQS A;  1H9S B;  1JCK B;  1IZ6 A;  1XWE A;  1LO5 D;  1SLJ A;  2ICE C;  2NVY H;  4O2D A;  1KTK A;  1UNS A;  1N8R C;  3A74 A;  3QR8 A;  1XPO A;  3PUW A;  4M8A A;  3CQZ B;  1EQV A;  4K2K A;  1GUN A;  2XSC A;  3VR4 A;  3Q23 A;  4IQZ A;  2KCN A;  5C44 B;  2XVS A;  3D6W A;  4FXG C;  3B6Y A;  1NUC A;  3M4Q A;  1WOC A;  4UHV A;  3NHH A;  3GTP H;  1CKO A;  2KA7 A;  3MXN A;  3CC4 A;  4DK0 A;  1SRU A;  2WIN B;  3M3Y H;  2JA5 H;  2WP8 J;  2PZT A;  4L6T B;  5IY0 A;  4TQU S;  1PHJ A;  1F77 A;  4QF4 A;  3V05 A;  1B44 D;  3QO2 A;  4IJL A;  3VR6 A;  1AW7 A;  2RSN A;  4RCN A;  5M5Y H;  2EXD A;  1G29 1;  2K1B A;  3G48 A;  1ZXT A;  4GKJ Q;  3NWS A;  1HNZ Q;  1QNU A;  4UAI A;  2IL8 A;  4ULL A;  2WKD A;  1SE8 A;  1EYD A;  3SK6 A;  1Q7Y C;  1QZG A;  2JA6 G;  3P1H A;  3M4Y A;  1SFO B;  1X54 A;  2F0T A;  3STB C;  3K7A H;  1GUW A;  1ILP A;  2CW0 D;  1FNV A;  1PTO H;  3S2D B;  1NR4 A;  5C4J H;  4EGV A;  5EGT A;  1JWM D;  5IGF A;  5C0X J;  4DV3 Q;  3A7A B;  4H44 C;  1IBK L;  3T53 B;  1YHB A;  4RWS C;  1ENA A;  2B2V C;  4QQB X;  4BXX H;  1TWC H;  4JI3 Q;  3NWT A;  2AUK A;  3RZD B;  1RTN A;  5IOC A;  3I2Z A;  4RKL A;  2PQE A;  4A3I B;  1PZJ D;  5CMD A;  3SEB A;  4J15 A;  2IX0 A;  2E8G A;  2EE1 A;  4JV5 L;  1STE A;  4ALP A;  1N32 Q;  1GUO A;  4AQY L;  1PA6 A;  1IYV A;  4X64 Q;  4CGY B;  1CA6 A;  4A3F H;  1KXL A;  1Z9F A;  4B3T L;  4CJ2 C;  5CV8 A;  4AIM A;  2CHB D;  4WRD A;  5I6W A;  1I4P A;  4DAV A;  1I6H B;  2RDH A;  2Y0S E;  5T1I A;  5IT9 c;  2F0K A;  1VQ5 A;  5BN4 A;  1O80 A;  1RCV D;  4IFD I;  3K6O A;  2CH4 W;  4JW0 A;  4DV5 Q;  5E4X A;  1SNO A;  1VQH A;  2K5H A;  1V1Q A;  3EBE A;  1MD2 D;  2ZTD A;  4YHH L;  1Q8K A;  5EKI A;  1BBX C;  4R4T A;  3H3V H;  3PO3 H;  4OXP A;  2JA8 H;  1Q1B A;  1KLU D;  2X6L A;  1C48 A;  4IZ8 A;  3I4M G;  4DAM A;  1QB5 D;  2B2U C;  5BN3 A;  1X56 A;  1E2W A;  5KYL A;  3F2B A;  1X3E A;  2L9H A;  3DM3 A;  2K04 A;  3HKZ E;  2MP1 A;  4JI5 Q;  1NNX A;  4RHS A; 
#chains in the Genus database with same CATH homology
 5C3X A;  4K6D A;  1TY0 A;  3D3R A;  5C0X G;  1ESR A;  3E6Z X;  3DMU A;  4XT1 B;  3W2D A;  4ZAI A;  1I4X A;  2NVY B;  1TWA B;  4G4K A;  2RSO A;  2KEE A;  1F2M A;  1GJX A;  1PRT F;  2EXZ A;  1Y8O B;  1SYD A;  2PZU A;  2VXW A;  3D4D A;  1I4Q A;  2YYZ A;  3GTP B;  5I9P A;  4G57 A;  5LL6 X;  4MHE A;  2IWH A;  2HQE A;  2EYP A;  4J6H A;  2O5J C;  4ZKC B;  1IYU A;  1D1I A;  2K5W A;  1PYW D;  1ZKO A;  3PUV A;  3D4R A;  5JPN C;  1F9S A;  5IT9 E;  1WTQ A;  5M5Y B;  3C46 A;  3I73 A;  2NWG A;  3QOL A;  4K5V A;  1PTO D;  4CJ1 B;  3T16 A;  1BXT A;  3K7A B;  4HN7 A;  1PTO B;  5C6A A;  3GTQ B;  2A73 B;  3DWP A;  3ND8 A;  5KND A;  1BO0 A;  1TWF B;  2B2Y C;  1IW7 D;  2EPB A;  4X3S A;  3MXG A;  3KUP A;  1R4P B;  4DFA A;  3DWA A;  4QB4 A;  3AB9 A;  3MA2 B;  2HCI A;  1CM9 A;  2BDO A;  1G2T A;  2K03 A;  1SMY C;  5IGD A;  3K59 A;  2EYJ A;  1Z6H A;  3SHL A;  2EJF C;  4IFD J;  3NQI A;  3NBI A;  4A3F B;  3NTI A;  5JVH 3;  4DXF A;  2D5D A;  2B2T C;  3C2P A;  4QMG A;  2F4I A;  3D8G A;  1O7Y A;  4Q5V A;  2QCP X;  2I46 A;  1UEA B;  1K8O A;  3P20 A;  5G3L D;  1VMP A;  5T1G A;  3QJY A;  1HCZ A;  5TSS A;  3S1N B;  1OXU A;  4EVO A;  3PO3 B;  1B1Z A;  1PMR A;  2FJ2 A;  1G6Z A;  1E2Z A;  3HP3 A;  4O1N A;  1HTP A;  3Q24 A;  4R8N A;  3IFD A;  1ILQ A;  2E74 C;  2WII B;  4OGQ C;  3C1E A;  3G7L A;  2EYL A;  3SK8 A;  4DNT B;  2JA7 B;  2VNU D;  1WCM B;  4ME5 A;  2K28 A;  2NUC A;  3ND9 A;  1KDC A;  4RHR A;  2O5I C;  2KEC A;  2F03 A;  1PTO C;  4CKC A;  1TII D;  2X69 A;  4NMZ A;  4IFD G;  2H4O A;  4CJ0 B;  1II3 A;  5DEH A;  4KKS A;  3ITP A;  1JWS D;  1IW7 C;  2AQ3 B;  1IKM A;  2XNA C;  3VYT A;  5K36 H;  1R4Q B;  1PTO F;  3PUZ A;  2F0U A;  3HS0 C;  4MIU A;  3CRK C;  4HMI A;  1CA5 A;  2JP1 A;  5C4X B;  3NP8 A;  1X3Q A;  1SSO A;  1SXT A;  1JQY D;  3MEH A;  3HOY B;  2LMC B;  2M9V A;  3I91 A;  1WTW A;  5JVG 3;  5FKA C;  1YNN D;  2LS0 1;  2WV6 D;  5FO8 B;  3NPP A;  1LTB D;  5M3M B;  2WAQ B;  1KNA A;  2B39 A;  2OEO A;  4KY5 A;  1V1O A;  1RKN A;  5JAV A;  1EWC A;  5NUC A;  3K5L A;  1F2Z A;  2XRQ D;  3P75 A;  4BBS B;  3KF8 A;  1H9R A;  1TT2 A;  2A68 C;  4WFN 3;  4KJO A;  3FDT A;  1A3U A;  3Q0A A;  4FXK C;  1LT5 D;  4K5W A;  2E2H B;  5A35 A;  2QKI C;  4C3J G;  1X3P A;  3N6R A;  3NQT A;  1J8I A;  3H0G B;  3K5M A;  4H13 C;  1AN8 A;  2IPK D;  2K6A A;  4G7O C;  1S5F D;  4K6L A;  1U4R A;  2A69 D;  4E6I A;  1E0B A;  1DOK A;  1EIG A;  3OIQ A;  2LFN A;  3J80 E;  2WB1 B;  2RQX A;  2TMP A;  1CQF A;  1EY7 A;  2CQA A;  4C3J B;  2EY2 A;  4FP5 D;  2PW7 A;  1SYB A;  5ELB A;  2PYK A;  3DWQ A;  3OIP A;  4PV1 C;  1H9S A;  5COY A;  4U68 A;  3PV0 A;  3NXW A;  2V4D A;  2EY1 A;  1H9J A;  1UAP A;  3TP8 A;  2Q8R E;  1JOO A;  1BF4 A;  3A7L A;  1SJH D;  4RCO A;  2CVR A;  3BYT B;  3V96 A;  1Y69 U;  3QB3 A;  1PFN A;  2SNS A;  5ELF A;  2F0S A;  5K5P A;  2PMZ B;  3C1F A;  2BA1 A;  4C3I G;  2MJ8 A;  2L55 A;  1BUV T;  2QF7 A;  4U67 3;  4JK1 C;  1L0Y B;  3H6M A;  4KI0 A;  1BCP C;  4RGO S;  1MSH A;  3BVG A;  2KQ3 A;  5A2Q L;  2QIL A;  1DZ1 A;  4KK7 A;  1EY6 A;  1WTX A;  4RFB A;  1STN A;  4KN4 C;  1MGS A;  2Z8L A;  4FVM A;  1KAB A;  4ZQ3 A;  4OO1 I;  1B4O A;  1F2L A;  4C3I B;  1QNK A;  5IGG A;  3I90 A;  3R2I A;  2K05 A;  2I07 B;  4RKB A;  1DD2 A;  3VR3 A;  1ET6 A;  2F0M A;  4HSP A;  2IX1 A;  1JIC A;  3MXU A;  1HHV A;  1I3Q B;  1U4M A;  2F0J A;  4LAA A;  5JOB A;  1TY2 A;  2E2I B;  3WOE A;  2K7V A;  1EY9 A;  4L8J A;  1CHP D;  3T4A C;  1BR9 A;  1CFM A;  2RA4 A;  4FF2 A;  5J39 A;  4KY6 A;  2Z4H A;  1TS4 A;  3S2H B;  3MFG A;  2SOB A;  2B2Y A;  4ZUI A;  2K5D A;  3D4W A;  1NR2 A;  2B8F A;  2BE5 C;  1QOH A;  2EJM A;  3FEW X;  2F0I A;  1BNZ A;  3S9W A;  2EY5 A;  4R8I A;  4K2L A;  1C8C A;  1KLG D;  2B2T A;  3D6C A;  5C0X H;  4IUV A;  4C3H B;  1PRT D;  2EYF A;  1A3T A;  2G9D A;  1WVL A;  2EJG C;  4DNR B;  4I65 A;  2MPM A;  2LY7 A;  1PRT B;  4JBW A;  3PUX A;  3S15 B;  1KDA A;  3OWE B;  3VYR A;  3MWY W;  2D62 A;  2FMC A;  5EKK A;  2NVT B;  1KNE A;  4KHV A;  4CHT B;  3TSS A;  3DEO A;  2Y0S B;  1NAP A;  3JAM E;  1SYG A;  4DN4 M;  3S1R B;  2A5H A;  5I2Y A;  3NTH A;  5C4Z A;  1D1K A;  1Q8I A;  2JA6 B;  1JR0 D;  4C2M B;  1V43 A;  4FF3 A;  3ERO A;  1XX8 A;  2F3W A;  2K01 A;  3HKZ B;  1HA5 A;  2E76 C;  1K83 B;  2AWN A;  1SNP A;  3MVV A;  2DNC A;  2Z4I A;  4L63 B;  1TWG B;  2KED A;  5KNC A;  2F0N A;  5D65 A;  5F2D A;  3HGB A;  1PFM A;  3LWE A;  5LL6 S;  2ID0 A;  4HCE A;  1PRT C;  2HDM A;  5AFW A;  1JOQ A;  3H09 A;  2NVQ B;  4ABN A;  2R3Z A;  4KHZ A;  2HUG A;  4XYQ A;  4J1M A;  1Q90 A;  1JOK A;  1E2V A;  1GHK A;  1AFP A;  1SYC A;  3R3O A;  1TVX A;  1EEF D;  4EQO A;  3I4M B;  3J7A V;  4XQN A;  4TKO B;  2E75 C;  2EZV A;  2CW0 C;  4ZRZ A;  5I9O A;  3VYS A;  1ESF A;  2VB3 X;  1SEB D;  4R9W A;  2Q8I B;  1FYC A;  4RH6 A;  2XWJ B;  1B2T A;  1G2S A;  5FLX E;  1I4H A;  3HOW B;  2A6E D;  3I3C A;  1VF5 C;  5DM7 3;  4KD4 A;  4XXE A;  1IL8 A;  4Q0F A;  4X3T A;  4IFD H;  3S14 B;  3OOC A;  2F0L A;  4F88 A;  5KYI A;  2YU9 B;  3HOU B;  2EOT A;  1SAP A;  2R61 A;  3FKI B;  2J4X A;  3MZ5 A;  2F0P A;  2PZW A;  4K8I A;  1FNW A;  2D2C C;  4QCL A;  3GQB A;  4QUF A;  1I4G A;  3QG1 A;  1K8M A;  4BA1 I;  1W6J A;  4UDU C;  1TS3 A;  1SNC A;  3MTS A;  1QIL A;  1DOL A;  3E5S A;  3M7N A;  2OF1 A;  3OMG A;  1AZQ A;  4XDX A;  4IUU A;  4EQN A;  2NB0 A;  1YNJ D;  2PNR C;  4F87 A;  1HRJ A;  1GHJ A;  3O13 A;  5C5L A;  3I8Z A;  2F0O A;  2NBF A;  2H1E A;  1VMC A;  3S1M B;  4PMC A;  3TBI B;  3BDC A;  3SDZ A;  4RA8 A;  2IX3 A;  3MFY A;  5DAU A;  2L4N A;  1O7Z A;  2F1M A;  1CZW A;  2L0C A;  2IJ0 A;  1SNM A;  3PMF A;  3OHX C;  1EY8 A;  3TME A;  5I2X A;  1M4V A;  4A3D B;  2A74 C;  4XQJ A;  1EU3 A;  1S5B D;  1Y8N B;  4C56 C;  1SND A;  1LT4 D;  1SDF A;  3HG9 A;  4GZY C;  5KGU A;  3V2T A;  2EYO A;  4ID6 A;  1EY5 A;  3TN2 A;  2FHT A;  4K5X A;  1O7L A;  3K57 A;  5E1F A;  1EOT A;  1HFN A;  2AQ1 B;  2JEA I;  3SK4 A;  1FNU A;  3EQL C;  5FOB B;  1TQO A;  3LWU A;  1PZK D;  3GV6 A;  3S16 B;  3OPO A;  4G7H C;  1LAB A;  3R2T A;  2FMM A;  3IKJ A;  1Q3L A;  3TP6 A;  1LTI D;  1YNJ C;  1GUS A;  3J81 E;  1V8Q A;  3I4L A;  1HQR D;  2JYO A;  5IT9 L;  3H3V C;  1B9N A;  1WTR A;  1TWH B;  3G6J B;  2B8G A;  1GXD C;  5KNB A;  4M1U B;  2KVM A;  3GTM B;  2N55 A;  3FMC A;  2R92 B;  3A8I E;  2A6H D;  4HSV A;  5E4W C;  5EBC A;  4FXD A;  2R93 B;  5CV7 A;  4YIJ A;  3BS1 A;  1SE3 A;  4XQQ A;  1HA6 A;  1ZYR D;  5KEE A;  1MSG A;  2QDB A;  3U9O A;  1O78 A;  3OWF A;  1RTO A;  4C1N I;  3KLR A;  4H7B A;  5FK9 C;  5CC4 A;  1X32 A;  2F0W A;  4HTH A;  4ZLT F;  2NN6 I;  3QOJ A;  1QE6 A;  1GUG A;  1ROD A;  3A55 A;  2AWO A;  3TP7 A;  2SDF A;  1U4L A;  1LTS D;  3W3A A;  3BVM A;  2E2J B;  2O2L D;  1CTM A;  1IKL A;  1I6V C;  4F8M A;  1ICW A;  5CV4 A;  3SXH A;  1DON A;  4V19 0;  4ZYS A;  3T13 A;  3M4O B;  2RKS A;  1XYI A;  1XTC D;  1STB A;  1OO9 B;  3C3L A;  1S4Z A;  3L9A X;  1EQT A;  1UUP A;  1F2Y A;  3CHB D;  4NW2 A;  4TRD A;  4BWG B;  1S5E D;  3QIA A;  1YNN C;  3H94 A;  1PDQ A;  3RUZ A;  5M5W B;  1H9K A;  1QG7 A;  4Z9C B;  1HTL D;  1VDZ A;  3U9S A;  4ODG A;  3FRP B;  2XRS D;  1ML0 D;  5IIF A;  3Q6S A;  1CQV A;  4XT3 B;  3EA6 A;  3VR2 A;  4HCS A;  4IUP A;  2A6H C;  1OXS C;  3UI2 A;  3HZX A;  4WJW A;  5JEA J;  3PO2 B;  4XIG S;  3DEP A;  3BDL A;  4FF1 A;  2JSO A;  5ELE A;  1PFB A;  1U9R A;  1EZ8 A;  2PW5 A;  2WKC A;  4DK1 A;  3LNN A;  2R7Z B;  1JE4 A;  3CKI B;  4CBV A;  4CKE A;  2K5Q A;  3X3N A;  3K5N A;  1VCI A;  3SR1 A;  2C5C A;  2O4X A;  1SNQ A;  3T56 B;  1TR5 A;  5C0X I;  3RZO B;  2L5T A;  1SJE D;  3I72 A;  2A69 C;  3I4N B;  2NZ1 D;  1EYA A;  5E3F A;  2PCF B;  1DOM A;  1CK1 A;  1RDP D;  2KCC A;  1WTP A;  2NTT A;  2DY7 A;  1JOR A;  4FNF A;  3L7Z C;  3HOV B;  3TDQ A;  3I70 A;  2F0Q A;  3KK7 A;  4RAU C;  5J22 A;  1ET9 A;  5EBD A;  1VF7 A;  1F9P A;  5JEA G;  4K14 A;  1L0X B;  5IGB A;  2DNE A;  3KBG A;  4BBR B;  4A93 B;  2KOL A;  3AU7 A;  2BA0 A;  1A2U A;  1QCB D;  3A56 A;  2RDF A;  3IFT A;  4A3E B;  1EL0 A;  2OXP A;  4OO1 H;  1SYE A;  1RF2 D;  3J7A F;  3MXP A;  4PMB A;  1PZI D;  3J80 L;  1D6E C;  1XXG A;  5EKL A;  1DXM A;  2AQ2 B;  3OSO A;  4LK1 C;  3DUZ A;  5EJW A;  2X6G A;  2NN6 G;  2ENB A;  1STY A;  3A8J E;  4ZUJ A;  3GP7 A;  1QJO A;  2J0T D;  4DU9 A;  4IUT A;  3Q22 A;  2KJX A;  1WD1 A;  2RVL A;  2ZXO A;  5IGE A;  2VB2 X;  5DM6 3;  1GUT A;  5D3D A;  5C3E B;  4DAP A;  1LTG D;  3BYY B;  4KD3 A;  3SK5 A;  4A3J B;  2Z1C A;  1OXV A;  2F3V A;  1SYF A;  1TU2 B;  1R9T B;  1Z7T A;  1H9M A;  2F0D A;  2KUM A;  3GO5 A;  1BOS A;  1OXT A;  2RBM A;  3GTK B;  2RDG A;  1V1P B;  2KHS A;  2SNM A;  5ISR A;  2JE6 I;  5CV9 A;  1LAC A;  4XYO A;  4IUQ A;  4MN3 A;  2IT1 A;  5CYU A;  4NKL A;  4RGM A;  5IGC A;  4AYB B;  2EY6 A;  3KLS A;  1BQQ T;  2ZXP A;  1M8A A;  4LJZ C;  4V0B A;  2F0H A;  3ERQ A;  2GA4 B;  3EVQ A;  5CV6 A;  1AZP A;  2XWB B;  2XN9 C;  1C4Q A;  4LMQ D;  4WOR A;  1EY4 A;  4OO1 G;  2ICI A;  2B2W A;  4Y7N B;  1SMY D;  3K5O A;  3HOX B;  5M9O A;  1HUN A;  3MAQ A;  3GTO B;  2NYZ D;  1CHQ D;  1WD0 A;  5JJZ A;  1EEI D;  3BDO A;  2QEJ C;  4BS9 A;  1I50 B;  5ELC A;  3SVM A;  3BG3 A;  4HAE A;  4OHJ A;  1Q12 A;  2WAC A;  1MBY A;  4A3M B;  5D3I B;  1D5X C;  5KRU A;  2PPB C;  2LKV A;  4FF4 A;  3M85 A;  3P7J A;  4K8J A;  2EYH A;  3HRZ C;  4IAL A;  4I7Z C;  1GOZ A;  3HEJ A;  1TS5 A;  3M3Y B;  2DN8 A;  2JA5 B;  2M00 A;  1EWH A;  1FD7 D;  5LHY 1;  3CU7 A;  4BY1 B;  4P2C B;  2TSS A;  3WOF A;  3DXJ C;  3DM1 A;  1WTO A;  2VUM B;  3FPP A;  1RHP A;  1A3V A;  2EDG A;  3MHB A;  3MC0 B;  5C4J B;  1EIH A;  3GTJ B;  2G9H D;  1LT6 D;  1CI3 M;  4G7Z C;  5IOD A;  1KDB A;  1TWC B;  3T51 B;  4BA2 I;  3JAM L;  4F7X A;  3BZD B;  4KY7 A;  4QUC A;  1DJR D;  4X3K A;  2D9U A;  1CT1 D;  5DNF A;  1G91 A;  4ZKB B;  2N88 A;  3NSW A;  4FO2 A;  2K33 A;  1FR3 A;  4ZK9 B;  4OIJ A;  4DF7 A;  3VR5 A;  1A6X A;  1IHZ A;  1PXU A;  2FIN B;  3IL8 A;  2EYM A;  1SBB B;  1STG A;  1HXY D;  3DHQ A;  1A15 A;  2ZXR A;  1LTR D;  2JA8 B;  1S5D D;  2MGS A;  2A6E C;  5HUR A;  2A68 D;  2MUY A;  3PUY A;  4DA2 A;  5FO9 B;  3TZU A;  1OXX K;  3X3M A;  1B50 A;  3KBX A;  4TSS A;  1Y1V B;  3GV3 A;  1B53 A;  3NTK A;  1JC7 A;  1LLR D;  2C9O A;  2R6G A;  1NSN S;  1AP0 A;  5C3W A;  3QWN A;  4OL7 A;  2Q8T A;  1Y1W B;  2JXM B;  5A2Q E;  3IAY A;  1MI2 A;  2F0G A;  3NBH A;  2BOS A;  4IUR A;  4O42 A;  1NCV A;  2B2W C;  4N9T A;  5FLX L;  5M5X B;  1Y8P B;  4KMU C;  3GTL B;  4KTA A;  4C1N K;  3S1Q B;  3GD7 A;  3KLS X;  1A2T A;  1EYC A;  1ENF A;  3RLF A;  4OIK A;  3L3O C;  5EPL A;  1PLF A;  3RD4 A;  2XIW A;  1T5X D;  4IUN A;  1DM0 B;  1RD9 D;  2NTS A;  3TP5 A;  4A3B B;  3OW7 A;  1ZEQ X;  3WDN A;  3RMH A;  1RJT A;  5EPK A;  4H0L C;  1DYQ A;  1KAA A;  3LX0 A;  5CBA E;  1D5M C;  4A3G B;  1LT3 D;  3GTG B;  3BVZ A;  2IW3 A;  5D14 A;  1EY0 A;  1BCP D;  4B08 A;  1J9O A;  3E0J A;  5G3L F;  1BCP B;  4ILW A;  4PMW A;  1HQM C;  2ZT9 C;  1WTV A;  2EVB A;  5FO7 B;  1LTT D;  2F0E A;  3ONA B;  4CKB A;  1G8Z D;  1B9M A;  4B9X A;  3VYU A;  3N52 A;  4KN7 C;  5CGK A;  1SE2 A;  2J7Z A;  2SEB D;  3FVQ A;  1TS2 A;  4RGN A;  2BDN A;  1EU4 A;  2B63 B;  3J7Y W;  5JPM C;  3FPU B;  1CZG A;  3OMC A;  4HMJ A;  4RGT A;  3ZYY X;  2B2V A;  1SE4 A;  4KKU A;  3PIP 3;  3R93 A;  5JEA H;  1LV9 A;  2M2L A;  4DXG A;  1HFG A;  1QWY A;  5BN5 A;  1F9R A;  1S5C D;  5K36 G;  1STH A;  4B9W A;  1B3A A;  1EFI D;  1AEX A;  5M3F B;  1T5E A;  2HCC A;  4NDX A;  4KV6 A;  4DAY A;  3NK9 A;  1FGB D;  2AUJ D;  3K58 A;  5COR A;  3EJI A;  4X3U A;  2BCO A;  2BE5 D;  1I4R A;  1HPC A;  5CR3 A;  5CBE E;  4HED A;  3A54 A;  3URY A;  3M7G A;  2NN6 H;  2B2U A;  2FFK B;  4QIW B;  3SE0 A;  1DCZ A;  1ZYR C;  2HDL A;  2DY8 A;  4IN3 A;  5J1Z A;  3D31 A;  2F0F A;  5HGT A;  4KJN A;  4DGZ A;  3EFX D;  5CV5 A;  3NUC A;  1F9Q A;  1W6K A;  5ELD A;  4S3S A;  5EQ0 A;  3TZD A;  5C5M A;  3R8B A;  3VA7 A;  2K32 A;  5C4H A;  4XTC S;  2PO4 A;  4PQX A;  2NVX B;  2L11 A;  3AMU A;  3F2U A;  4A3K B;  3HOZ B;  1BCP F;  1STA A;  1U4P A;  3J81 L;  1D2B A;  2MHV A;  1TKW B;  3CRL C;  1V1P A;  2L12 A;  3S17 B;  1ENC A;  5I6Y A;  1D5Z C;  1JWU D;  1HUM A;  4NP5 A;  3PIO 3;  2F0V A;  4BY7 B;  2JEB I;  1LTA D;  2E2D C;  5I4D A;  3A8K E;  3K0Y A;  1EZ6 A;  1BDO A;  2OT2 A;  4KKT A;  4J8Q A;  1Z47 A;  1Q1E A;  3NE5 B;  5EPJ A;  5KIX A;  3H91 A;  4PNY A;  4N9P A;  1ONL A;  3VA5 A;  4EQP A;  4FYD A;  4C3H G;  4HR7 B;  1JB3 A;  2L1B A;  1H9S B;  1JCK B;  1XWE A;  1LO5 D;  2ICE C;  1KTK A;  1UNS A;  3PUW A;  4M8A A;  3CQZ B;  1EQV A;  4K2K A;  1GUN A;  2XSC A;  3VR4 A;  3Q23 A;  4IQZ A;  2KCN A;  5C44 B;  2XVS A;  3D6W A;  4FXG C;  1NUC A;  3NHH A;  2KA7 A;  3MXN A;  4DK0 A;  2WIN B;  2WP8 J;  2PZT A;  4L6T B;  4TQU S;  1F77 A;  4QF4 A;  3V05 A;  1B44 D;  3QO2 A;  3VR6 A;  1AW7 A;  2RSN A;  4RCN A;  1G29 1;  2K1B A;  1ZXT A;  3NWS A;  1QNU A;  4UAI A;  2IL8 A;  4ULL A;  2WKD A;  1EYD A;  3SK6 A;  3P1H A;  3M4Y A;  1SFO B;  2F0T A;  1GUW A;  1ILP A;  2CW0 D;  1FNV A;  1PTO H;  3S2D B;  1NR4 A;  4EGV A;  5EGT A;  1JWM D;  5IGF A;  5C0X J;  3A7A B;  4H44 C;  3T53 B;  4RWS C;  1ENA A;  2B2V C;  3NWT A;  2AUK A;  3RZD B;  1RTN A;  5IOC A;  4RKL A;  2PQE A;  4A3I B;  1PZJ D;  5CMD A;  3SEB A;  2IX0 A;  2EE1 A;  1STE A;  1GUO A;  1IYV A;  4CGY B;  1CA6 A;  4CJ2 C;  5CV8 A;  2CHB D;  4WRD A;  5I6W A;  1I4P A;  4DAV A;  1I6H B;  2RDH A;  5T1I A;  2F0K A;  5BN4 A;  1O80 A;  1RCV D;  4IFD I;  3K6O A;  5E4X A;  1SNO A;  1MD2 D;  5EKI A;  1BBX C;  1Q1B A;  1KLU D;  2X6L A;  1C48 A;  4IZ8 A;  1QB5 D;  2B2U C;  5BN3 A;  1E2W A;  5KYL A;  2L9H A;  2K04 A;  2MP1 A;  4RHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...