2AUKA

Structure of e. coli rna polymerase beta' g/g' insert
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
GSHMAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase beta' chain
publication title Structure and Function of Lineage-specific Sequence Insertions in the Bacterial RNA Polymerase beta' Subunit
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 189
sequence length 189
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA02
2NN6I 1H9KA 4PV1C 3L7ZC 2E75C 5BN4A 2EJGC 2IT1A 4H0LC 1CTMA 4DNRB 1GHKA 1O7LA 5K36H 2EJFC 1SMYC 1H9SA 1Q1BA 3OW7A 2PNRC 1O78A 4KKUA 2NN6G 3FMCA 4BA2I 2AWOA 1B9MA 3T56B 2EJMA 3VR3A 1Z7TA 4DNTB 5JEAG 1IW7D 2E74C 2R6GA 2DN8A 4TQUS 4KN7C 1IYVA 1OXTA 4H44C 4JBWA 2DNEA 2AUKA 3OOCA 1FR3A 1GUGA 3SDZA 1GUTA 3W3AA 2D5DA 4HR7B 3BG3A 2A6ED 2K32A 1YNJC 4IQZA 2AUJD 5KNCA 3M7NA 3AB9A 4RCNA 4KI0A 3VA7A 2PPBC 1VCIA 1VDZA 4IFDH 2KCCA 1T5EA 1IW7C 3A8KE 4OO1G 1Q90A 1DD2A 2BA1A 2D2CC 4GZYC 4G7OC 3LNNA 1GUOA 1K8MA 2E76C 2QF7A 1OXXK 3CRLC 3GQBA 3MXUA 3QJYA 3CRKC 2A68C 3IKJA 3U9SA 3VR2A 2BDOA 2B8GA 4BA1I 2V4DA 1CI3M 1LABA 3GD7A 4L8JA 4OGQC 2JEAI 1OXVA 2JE6I 3P20A 3T51B 3NE5B 4DK0A 4JK1C 2BE5D 1Y69U 1FYCA 2KA7A 2A6EC 3H94A 3I72A 1IYUA 2A68D 1YNNC 2O5JC 2NN6H 1E2VA 3ND9A 4KMUC 4I7ZC 3M85A 5JEAH 1CFMA 3EQLC 3A7AB 2A6HD 3IFTA 2K7VA 1Q1EA 3PUZA 1Q12A 1H9MA 5C0XG 1BDOA 2YYZA 1H9SB 3MFYA 1E2ZA 1Z6HA 4XIGS 3A8JE 2JEBI 5BN3A 1DCZA 3VR4A 3N6RA 1HTPA 5BN5A 2DNCA 2D62A 1EWHA 3I73A 1QJOA 1VF5C 2BE5C 1V8QA 4KKSA 3TZUA 4G7HC 1K8OA 1TU2B 1GJXA 2BA0A 3A7LA 1H9JA 1TKWB 2EVBA 2B8FA 1HPCA 5C0XH 1GHJA 3M4YA 1ZKOA 3ND8A 3KLRA 4LJZC 5KNDA 5K36G 1H9RA 2CW0C 4OO1H 2A6HC 3QG1A 1OXUA 4XTCS 1A6XA 2ZT9C 1DXMA 3PV0A 2O5IC 3LWUA 3VR6A 1OXSC 4H13C 3BDOA 5KNBA 2A69D 1V43A 4KHZA 1HCZA 3RLFA 2EDGA 3VR5A 2F1MA 3PUWA 2K33A 4DK1A 2LMCB 5A35A 1PMRA 4G7ZC 4KN4C 1GUNA 3PUXA 4LK1C 1G291 3DXJC 4TKOB 3SE0A 1HQMC 2Q8IB 3HGBA 3T53B 1LACA 1Y8OB 1ONLA 3I4LA 2L5TA 1E2WA 1Y8NB 3D4RA 3WDNA 1I6VC 2A69C 3OPOA 4KKTA 4IFDG 1GUSA 1ZYRC 3A8IE 2PCFB 1VF7A 3PUYA 3PUVA 1B9NA 3FPPA 3QIAA 2JXMB 3D31A 1Y8PB
chains in the Genus database with same CATH superfamily
2NN6I 5IYCG 2MGSA 3KLSX 4H0LC 2OF1A 2F4VQ 2QW7A 3M4OB 1SMYC 1XTCD 3HG9A 2DY8A 2IHFA 1JB3A 2ICEC 2C35B 4N9PA 1MBYA 4IJHA 4HIMA 2NN6G 1IBMQ 3P1HA 4K14A 1L0YB 1PLFA 4DAYA 3T56B 3AMUA 2GN5A 3CC7A 1DYQA 1HTLD 4JC0A 1AFPA 3CHBD 4A93H 1CHQD 1XMQQ 2R92B 1XNRL 5JJIA 2AMCB 3W3AA 1SFOB 2OTLA 2SNSA 3C3LA 3OIQA 1KRSA 2R3ZA 4JI3L 1V1QA 1EWCA 3KFUA 4ME3A 1VQ8A 3Q0AA 2D2CC 3DWAA 2N3SA 3MTSA 4K6DA 2KCNA 5M3MB 1EEFD 1QVFA 1XTDA 3PO2H 5IGEA 1PTOD 4JI6L 4P73A 3ND9A 1K0RA 3EVQA 4LF7L 4DUZL 4B3TL 1SYFA 3PUZA 3VDYA 4BBRB 1KXLA 2R93G 3IFDA 4QMGA 1IBLL 2NTTA 4ZK9B 2ZXOA 3GTPH 1VQBA 2PZTA 4OWXB 2JYOA 1ESFA 2K50A 3I8ZA 1P16A 5J1ZA 5IGDA 3FKIG 1I94Q 4H7BA 1G2SA 2NBFA 3KUPA 2KJXA 2VZAA 4LMQD 3STBD 5HGTA 4LF8L 4KHVA 3TMEA 4HJAA 2MO0A 3DEOA 3QR8A 4X6AH 3R2TA 2NZOA 5IY0A 4DU9A 2ATWA 2F0VA 1EU3A 5DEHA 1Q8KA 2VB2X 4DAPA 3HOYH 1Y8NB 5GQOA 1PDQA 3HOWB 1ML0D 3HOXH 2CQOA 2MJ8A 2JA6G 3A8IE 4DR6L 2E2IB 2Z4HA 1RKNA 1B9NA 3FPPA 1M1KC 2F4VL 2JJQA 2I07B 4RMFA 1L1OA 1CZWA 1FD7D 2WB1G 4L6TB 2E75C 3ULLA 3DLLA 2F0KA 1U9RA 5K36H 3CU7A 4DR3Q 3RLOA 1NMGA 4RKBA 4I65A 3KF6A 2PNRC 1G91A 1XMQL 1SDFA 1B9MA 1AE3A 5DNFA 3PF4A 4M8AA 5JPNC 1EOVA 3I4MB 3KDFB 4BS9A 2J4XA 5C4HA 2UUAL 2MP1A 4MTKA 1XNQL 1SRUA 1EYCA 1PFNA 4CDDC 2E2JH 1OTCA 1PRTD 2VB3X 4AYBB 4JI4L 3DUZA 2EY1A 3UE0A 4AIMA 1NTGA 3HZXA 4L5TA 1BF4A 3S1NH 1EZ8A 1J5EQ 3C1FA 1KRTA 5CR3A 4G7OC 1BQQT 2QF7A 1LTID 1XPRA 4BA1I 4EQ5A 4JI0L 5M9OA 5GAEC 3U4ZA 3T1HL 2ZTCA 5C3EH 4KV6A 1UE7A 1IYUA 5JAVA 2JP1A 3CW2C 5H1SE 3BZKA 3D8GA 4X66L 5IP9H 5I6YA 1KQSA 1B4OA 4NKLA 3MFYA 1E2ZA 5E4XA 2B63H 4OELB 3I56A 5LL6X 1X3GA 3CMEA 1QJOA 1TU2B 1PTOC 1PV4A 1VQNA 4QQBX 2EY2A 3CXCA 1V9PA 3H15A 1S5CD 3KLRA 4A3MB 4WJWA 4LWCA 5EKIA 4HJ8A 1TY2A 1HZ9A 2PZWA 5D3DA 1FGUA 5EPJA 4B9WA 2G9DA 4DR1L 4IUUA 1FNWA 1GD7A 4KD3A 4P75A 3WOEA 3ZYYX 1YI2A 1HCZA 1A3UA 2UXCQ 1HHVA 3BU2A 2F1MA 3K5OA 1C48A 1U4RA 3BYTB 2YU9B 1PHJA 4ZRZA 1GKHA 1F2ZA 2SOBA 3DXJC 1L0WA 4BY7B 2PI2E 5JPMC 3STBC 5IP7H 3BZDB 3J7YW 3K57A 3OPOA 1AE2A 4QB4A 4OEMB 3R8BA 3S1QH 3M7GA 4PG3A 1O7IA 5IGFA 1N36Q 4QCLA 1Y8PB 4LUVA 3KOJA 2LY7A 3I3CA 4FF4A 3H09A 2QGQA 1WFQA 1HA5A 4UPAA 3HS0C 5IGGA 3BVGA 1HUMA 2HIVA 1U5KA 1TS2A 2CCZA 4LFBQ 1QUQA 2JQOA 2EY6A 4X62L 5CC4A 1E1OA 4JOIC 3CAMA 2R6GA 1SYDA 3PQIA 3QOLA 4DV1Q 3GTLH 4GOPB 2F0QA 4K8IA 3OMCA 4H44C 4A93B 1QOHA 2AUKA 2K1BA 3E3XA 1IKLA 3NUCA 4F87A 1AZQA 5M5XH 2MQHA 1SNQA 2VQFQ 1FJGL 1Y1WB 1YNND 2PPBC 2EOTA 1JOOA 2F3IA 4IFDH 2Y0SB 3E0JA 5G3LF 4OO1G 3A5UA 4M1UB 3S2HH 3SEBA 4JOIA 4YWLA 3HKZB 4KHPQ 4NMZA 3IKJA 2Q2IA 2V4DA 4S3SA 2QILA 4PNYA 4FF3A 1PRTC 1CKMA 2F0SA 1NR2A 1MI2A 1JWSD 1U4LA 2XRSD 3PSIA 3DEPA 2E2DC 2HT1A 1Q12A 1LM0A 4Q5VA 1JJCB 1JMCA 3S9WA 2JEBI 1DCZA 3QO2A 1V1PB 3EIVA 1PH9A 3GTPB 2EVBA 1MGSA 2WIIB 1ZKOA 3CC4A 2IW3A 4A3DG 4A3IB 2ZT9C 5NUCA 2CWAA 4JVZA 3W1GA 2F0FA 3BDOA 1V43A 3AU7A 1AN8A 3GTKH 4B3RQ 2OT2A 3CQZH 3PUWA 4QJFA 1S5ED 1SYBA 5EKLA 4DK1A 3HOVH 2Z0SA 1TWGB 4LUZA 3S15H 1VQ4A 3PUXA 5EPKA 2XRQD 1HQMC 4UHVA 3D4DA 2R7ZB 3EROA 1DZ1A 1TXYA 1PFBA 4OL7A 1Q82C 4JBMA 1NR4A 3HOYB 3MVVA 1XPOA 2EZVA 2DY7A 2PCFB 4GN4B 1F9QA 3QIAA 3HOXB 1A62A 2EYHA 3QB3A 3D31A 4XYQA 2Q2UA 1DOKA 5ELCA 1C4QA 1SLJA 2BOSA 4CKCA 5C4XB 3K5MA 2EJFC 5D14A 4YWKA 5IYCH 3CCUA 1B1ZA 2A8VA 1BCPB 2VQEL 1EY0A 3BDLA 4C1NK 1Q8IA 3BJUA 2B2YA 2CQAA 2VUMG 2RSOA 1I50H 2AQ1B 2DNEA 4DV5L 1LTBD 3S2DH 2FXQA 2E2JB 4AH6A 1E0BA 5C44B 4F88A 1JJGA 3VA7A 4A3EG 1K3BC 2EY5A 5C3XA 4A4IA 2E76C 1PZID 3SK6A 2QKIC 1CKNB 2Z8LA 2D0OA 1IL8A 4Z9CB 4NDXA 4PQXA 2KHJA 3S1MH 1EU4A 3UDFA 4JI1Q 1YNNC 4QUFA 5C3EB 3KJPA 3ULJA 3BVZA 2E5LQ 4HSPA 2EYPA 3F2BA 3IFTA 4LF9Q 4ALPA 1STNA 4BY1G 3GV6A 4KK7A 1NAPA 2E8GA 4DN4M 4OX9Q 3I4OA 2B63B 1K8OA 3DWPA 2G9HD 3C46A 1L0XB 1WTXA 2B8FA 3HFZB 1HPCA 5JJZA 5GAHC 2I5LX 2L0CA 1HFNA 2O5IC 2VNUD 3NBHA 1E3PA 3N52A 4R9WA 1XJVA 3S1RB 4BBRH 2OTJA 3L2PA 4X65Q 3EA6A 1A0IA 1F77A 4A3GB 3F1ZA 2NVXH 2K01A 3AYHB 4JYAL 2OCEA 4BXXG 1SNOA 4DPGA 5E3FA 1HNWQ 1HNXL 3T13A 3OHXC 2E2HH 1CHPD 1E24A 2I0QA 1WTHA 3K5NA 3PUYA 1KDCA 2CH4W 4NXNQ 2EXZA 2F3WA 1BR9A 1H9KA 1EIFA 5D65A 1WTQA 1VQGA 4RGTA 4B3MQ 1A3TA 2K04A 3UDIA 5CBAE 3TP8A 1H9SA 3RUZA 3K0YA 1QNUA 1C8CA 4ZCKA 5LMNL 2VL6A 1IW7D 1HZAA 3CCVA 3RNUA 2JA7G 4TSSA 2B2TA 1S5FD 4B9XA 3T4AC 1GM5A 4FYDA 4DFAA 2F0TA 4YIJA 4EGVA 4JBWA 3GTLB 3OOCA 4P74A 3G6EA 3J80i 3FRPB 3S16H 3H3VC 1X6OA 1DD2A 2CHBD 3MXUA 4IUPA 5EBDA 2BDOA 1RCVD 2JA5G 4DV2Q 1MJEA 1OXVA 2AQ2B 4LF9L 1Z9FA 4JK1C 3IL8A 2ZM6L 2K14A 1UWVA 5C5LA 5C4JB 3H3VI 1UUPA 3TN2A 4K2KA 4P2CB 4DUYQ 1YIJA 1H9MA 2YYZA 1WVLA 1CM9A 3NWTA 4IFDI 2XVSA 1XNRQ 1KC8C 2DNCA 4DV6L 5T1IA 4XXEA 4JI3Q 1A15A 1KTKA 3TSSA 2HCCA 3HOUB 5JVH3 2F0DA 4IUNA 3J81c 5L37A 4RGMA 2RCFA 4F8MA 3DM1A 1SR3A 3I4NH 1CKOA 2N78A 2X6LA 4J1MA 4H13C 3PF5A 3GTOB 1HUNA 1UAPA 4KHZA 4XQQA 3TS0A 1AZPA 4WJ4A 1IL2A 5LMUQ 4JI6Q 3GTKB 1D1IA 2ALYB 2MHVA 4G7ZC 3HOVB 4KN4C 2DUDA 2K03A 5IYBG 4DUZQ 4B3TQ 4LF7Q 3S15B 1LACA 4HJ9A 3OTOL 4GS3A 1TVXA 1IBLQ 5IOCA 1JOQA 3PUVA 1ENCA 2R7DA 5AJ3L 3RN5A 1PTOH 3L7ZC 3EJIA 3NP8A 1K9MC 2DJFC 4R8NA 1YJWA 2IY5B 1VQFA 4FXDA 2NTSA 5CV4A 4LF8Q 4BY7H 4K6LA 4UP7A 4ZKBB 4UAIA 1RJTA 1LTRD 2E74C 2ZTDA 1R9TH 1PH2A 1YHAA 4GLVB 4LNQA 1B50A 3V2TA 2SEBD 3S14B 1EYGA 3S2DB 5I2YA 5KNCA 1M4VA 4DV2L 4DR6Q 1IW7C 1EOTA 4X3KA 1SBBB 1ESRA 4I7AA 5IIFA 3DWQA 4HCEA 4CJ1B 4DUYL 5CMDA 2SNMA 4O2DA 4WRDA 2WFWA 1RTOA 1WCMG 3S1MB 1QE6A 4Y7NH 1K8GA 2NZHA 5JEAH 1O80A 2KENA 1Y1WH 2WINB 2FHTA 3MXNB 2UUAQ 4XIGS 4A3BG 5CORA 1NNXA 5BN3A 3ERSX 1XNQQ 2M9VA 4A76A 3NELA 4JI4Q 2HCIA 1LT5D 3EFXD 1GJXA 2L12A 4B3SL 1H9JA 1HRJA 4JI7L 2R93B 1I4GA 5CGKA 5KIXA 3PIO3 4YWMA 4PZ8A 5LMUL 2OQKA 3AEVA 1F9RA 2LS01 3A54A 4JI0Q 4A3JG 5FLXL 4C56C 3T1HQ 1NY4A 2PW5A 3PO3G 4A3LG 2KHSA 3GV3A 5M5YB 1D1KA 4A3CG 2A74C 2A1AA 4P71A 2NVXB 1VQLA 1SMXA 4X66Q 1GO3E 1Y8OB 1SNCA 2KUMA 2G5DA 4MIUA 4ZQ3A 4C3JH 3CCRA 5M3FG 3I7FA 4A3IH 3NENA 3OWEB 3NK9A 1PH7A 2E2HB 4OXPA 2KVMA 2HIXA 4Q0FA 3NTIA 4JI2L 1ZEQX 3M9BA 2BDNA 1JE4A 4K5WA 3MEFA 2B2UC 1L1OC 2F0JA 4HTHA 1TWGH 4R4IA 2JA6B 1QZGA 1VQDA 2OXPA 4O42A 4DR1Q 2HUGA 3Q22A 3G48A 2R7ZH 2WB1B 4B08A 4DNTB 3NTKA 5ELNA 5K5PA 1MIUA 5C0XI 3NTHA 4HJ5A 4R1JA 1X3PA 5CYUA 5DAUA 3I55A 1UE6A 1EL0A 1FR3A 1TT2A 2B2UA 2WKCA 3UE1A 3CPWA 3GO5A 5TSSA 4DV4L 3KF6B 3S16B 4KI0A 5GROA 5C4XH 3KLSA 1VCIA 2BCOA 2NVYH 1PYSB 1RTNA 1KIXA 4GLXA 1PH6A 1G6PA 2B8GA 2F0EA 4N8X1 3OIPA 4NP5A 3U4VA 3SHLA 2UU9L 2Q8RE 4I7ZC 1VQ9A 2NYZD 4IOCA 4X62Q 2K5NA 5FLMH 1X65A 5C44H 1BKBA 2F0LA 2QEXA 1STHA 1RDPD 1FGBD 2L15A 2PI2A 2RDFA 3K5LA 3BDCA 2K05A 3RZOB 4FNFA 2ASBA 2ES2A 4K0KL 4J15A 3NQIA 1VQCA 2PYKA 2WAQG 2JN4A 3FP9A 1FJGQ 1K28A 4BY1H 1JJ2A 1W3SA 3JAMi 1KAWA 4RH6A 3KDFA 4XTCS 3D0FA 3J7A5 3VR6A 3I4NB 1NUCA 4IUTA 4DF7A 5G3LD 4DK3C 4O0AA 1S5BD 5LMNW 4EVOA 2LMCB 3K6OA 3E9IA 1N9WA 3B6YA 2L1BA 4KJNA 1ONLA 3P7JA 1B3QA 5FLXc 1LV9A 3I70A 4HJ7A 4RCOA 4CKBA 4DV0L 3MAQA 4RHRA 4RKLA 1JC7A 1SE3A 1N34Q 3S1RH 2WB1E 4JCVE 1WOCA 4DV7L 1YITA 1PTOB 1YVCA 4DNRB 1ILPA 3ONAB 4A3GH 5CV6A 1B3AA 1JCKB 3RN2A 3IRBA 4RA8A 2KEDA 5DLQE 4GNXC 1QCBD 3SXHA 3G71A 1S40A 1PFSA 3RD4A 1DONA 1R9TB 4DR7L 1DJRD 3K7UC 2RDHA 3KLWA 2NWGA 1EY8A 4IO9A 3U58A 3DM3A 2H1EA 4IQZA 4FXKC 3SR1A 4RCNA 4IUVA 1T5EA 4GNXA 1PH1A 1LTTD 1Q90A 2K5WA 2WKDA 1Y1VG 3TP7A 1IHZA 2NZ1D 2CH4A 1SYEA 1FVIA 3ERQA 4AYBE 3K58A 2HQEA 1TR5A 3K59A 2JA5H 2CFMA 5COYA 2LKVA 5I4DA 4QIWB 2L55A 1N32L 3RR5A 4IURA 4Y7NB 2VQEQ 3G7LA 3SVMA 5CV8A 4K2LA 2JA8G 3AFPA 3UDGA 4DV5Q 4LF6L 4JV5Q 4G7HC 1W2BA 1GHJA 3M4YA 4IJLA 1O7ZA 1H9RA 1ENFA 5HURA 2H5XA 4CDEC 5C4JH 5IT9L 5FJ8G 1RHPA 4GOPA 4ID6A 1CQFA 3A56A 1TWFB 3P75A 3CCQA 4A3DB 1PRTB 2XN9C 4YCUA 4OWTB 1I4HA 2MPMA 1WYDA 4CJ2C 1STAA 4ZYSA 4A3FG 3HOUH 1E2WA 1SYGA 1BBWA 1N34L 1NCVA 3K8AA 1CZGA 3BVMA 4HMJA 2IJ0A 3LGJA 4C3JB 1WI5A 4IOAA 1B2TA 2Z6BA 3HKSA 4DA2A 1I6HB 1K0SA 3BS1A 3GTOH 3D4WA 4LW1A 3CCMA 2PZUA 1H95A 2AKWB 1RIPA 3KF8B 1B7YB 4DK6C 1F2LA 4XQNA 3PO2G 5LL6S 1O78A 4KKUA 1BCPF 1I4PA 1QNKA 2K5VA 2AWOA 3I90A 4YCWA 2VW9A 1V1PA 4U68A 5FO8B 1D6EC 4C3HG 4POGA 1HZCA 1YEZA 4TQUS 1VQIA 4JYAQ 3CD6A 2F0UA 2XGTA 1GUGA 1HZBA 1JOKA 4HIKA 2B2YC 1CQVA 1SSOA 1YNJC 2F0WA 5IWAL 1SEBD 1U0LA 1HNXQ 1VDZA 1KL9A 4QY7A 2KCCA 2I5MX 2VUMB 1CA5A 3TDQA 1UNSA 1UE5A 2NVYB 3TREA 1D5XC 2A68C 4QIWE 3VR2A 2RVLA 4YY3L 1CI3M 1QILA 4FF2A 2X69A 3BZCA 4A3EB 2BE5D 1YBYA 2Y0SE 1JB7A 1EIHA 2NN6H 3S14H 5LMNQ 1VQ7A 3HKZE 1ZXTA 4JV5L 1VQJA 3TZDA 1XPUA 2K7VA 1EWIA 2RQXA 4AQYL 5KGUA 3PIOA 5AFWA 2YTXA 1BVSA 1WCMH 5HGQA 1XMOL 3N6RA 1BUVT 4IPDA 5BN5A 1Q86C 2CWPA 4KKSA 1V8QA 3CKIB 4BBSG 5I9PA 5IYDG 4BY1B 5K36G 1BBUA 1EFWA 2RBMA 1RF2D 1PYBA 3PV0A 3LWUA 4L63B 2C9OA 4OIJA 2IX1A 1XWEA 4GN3B 1CSPA 4YHHL 2JA9A 1EY6A 2LXJA 3J81L 2HHHL 3U9OA 2ZM6Q 3OW2A 1STBA 1BNZA 1KNEA 5IT9c 2PW7A 4CDCC 4A3JH 1EQVA 3T53B 3PO3H 4A3LH 1CKNA 4WJ3M 1NE3A 4L5RC 2QDBA 5T1GA 2R93H 3NWSA 4A3CH 4OONA 3R2IA 2WV6D 4DV6Q 1T9HA 2JXMB 4GKKQ 2EJGC 5M3FH 1GHKA 3FKIH 1JWMD 1MKHA 5M5YH 1CT1D 4BWGB 4CHTB 5HY6A 1B44D 5M5WB 3DHQA 3A0JA 2KBNA 5IP9G 4CJ0B 1K83B 3HEJA 1I5FA 1OXTA 1C7YA 2DGYA 2B2TC 3SDZA 1RD9D 2F0MA 1HR0L 2A6ED 1KHIA 4QUCA 5I2XA 3OTOQ 1NJIC 2JA7B 4MZ9A 1I4QA 1HNZL 2UUCQ 3CPFA 2ZJQA 2JA6H 4R4CA 4JW0A 2R61A 5CBEE 5AJ3Q 3R93A 1GUOA 2L11A 1C0AA 3KYHC 2JE6I 2Q8TA 3IAYA 1D5ZC 5C4ZA 1E2VA 4KLKA 2PMZB 2JA5B 1J8IA 3AFQA 2B29A 2F0OA 4JI5L 1F2MA 5IP7G 1Z6HA 3HRZC 5I6WA 1JQYD 1HTPA 4ODGA 2PQEA 3F2UA 1VF5C 2BE5C 3OWFA 5KRUA 3BYYB 3A7LA 1SN8A 2N8NA 3KJOA 2B3GA 1KDBA 1F2YA 2CW0C 5FK9C 5IE8A 5GADC 3TP5A 1CSQA 2LFNA 4DAVA 1VQMA 3J81j 2LXKA 4L5SA 2RKSA 4L5QA 4CDFC 1JWUD 1J9OA 1SAPA 2M00A 3RZOH 4A3KG 1G291 3HGBA 4H02A 3G6JB 1E22A 2HQLA 4GKKL 1JE5A 4IFDG 1EZ6A 4RGNA 4XT1B 2CVRA 1Y14B 2ZJRA 3H0GG 1IBKL 4B3SQ 1BXTA 4X64L 2IT1A 5DM73 2EXDA 4JI7Q 3GTJB 2QA4A 1M8AA 4KTAA 3G4SA 1EY9A 3H6MA 1Q1BA 2FINB 1CUKA 1EEID 2EYFA 2XNAC 4NXML 2A5HA 3VYUA 1I3QH 2UUBQ 3J80L 4HSVA 1VQEA 3J81E 4C3IG 1EQRA 3MFGA 2UUCL 1SE2A 1A2TA 2J0TD 3X3MA 1QVCA 2K28A 2PQAB 1YHQA 4HR7B 2UXBL 1JT8A 2K5DA 1G2TA 4LF4L 5EJWA 2IX3A 2MNAA 1MSHA 2PMZE 3LNNA 4JI2Q 1K8MA 1TWAB 3CCJA 2JEAI 3CCEA 1HJPA 3ER0A 4U673 3URYA 1SE8A 1X3FA 1FYCA 2A6EC 3HOVG 2M2LA 3K81C 3W5OA 1AP0A 3F8TA 3RZDH 4EX5A 4IN3A 3E5SA 3A7AB 4X3TA 2NVTH 1ASZA 4DR2Q 2FJ2A 4V190 2JK8A 1PA6A 2XTIA 4LF5L 1PZKD 4ZAIA 3VR4A 3TEHB 1KAAA 2YTVA 4DAYB 1WCMB 2Z1CA 2B2VA 4K5VA 1MHWC 1SE4A 2BA0A 2EYJA 5CV9A 2XWJB 4DV4Q 4UP8A 4GKJL 1HXYD 2JA8H 1NMFA 5ELOA 3CC2A 4A3BB 4OO1H 1A6XA 5DM63 1DXMA 1X3EA 2ID0A 4J6HA 4DR4L 1DOMA 1OXSC 5KNBA 4LFCL 1F9PA 1TWHH 1ZYRD 1HQRD 3J7AF 1LUZA 3HOZG 1ICFB 5FJ8H 2K33A 2UU9Q 2I46A 1EFID 3X3NA 1E1TA 3F2DA 1QZHA 4LK1C 4ZUJA 4TKOB 4A3JB 3PO3B 3D4RA 2NUCA 3WDNA 3CP0A 4WORA 4KKTA 4K0KQ 5C0XJ 3NSWA 1EIGA 4A3FH 3UDXA 4XQJA 2TSSA 1X54A 3E6ZX 3EN2A 3FEWX 2RA4A 1TWFH 4IUQA 4A3DH 2UUBL 5M3FB 4MHEA 3FKIB 3K7AH 1FNVA 1N33L 2TMPA 1LTGD 3MXNA 4RG1A 2R92G 3OW7A 1ET9A 2EIFA 4CGYB 2IL8A 1W6KA 2QEJC 1GUWA 2MO1A 1P8LA 1EY4A 2Z6KC 4X3UA 1YHBA 3K0XA 1TWCH 1I6HH 1G6ZA 1D8LA 4C3HH 4TRDA 4OIKA 2K32A 5IGBA 3PIP3 5M3MG 5C5MA 3J80c 2WP8J 2UXDL 1KABA 3V05A 1C9OA 2YV5A 3A8KE 4DV0Q 2RF4A 2BH2A 4LFAQ 4GZYC 3MXGA 3OYYA 1SNMA 3GQBA 2FFKB 4LAAA 2Z6KA 4DV7Q 4UP9A 3GD7A 3GP7A 4Y52H 2NB0A 3NE5B 4BBRG 4DR2L 1Y69U 2AHOB 3T1YQ 4R4QA 1L1OB 2A73B 3GTGH 1WTWA 3QOJA 1X9NA 3EQLC 3L0OA 4FP5D 1IYJB 4PMCA 4DR5L 3J80E 2O2LD 5EBCA 1AEXA 5C0XG 2JSOA 4DR7Q 2L4NA 3A8JE 2VUMH 3MWYW 3Q23A 4DV3Q 1EWHA 3I73A 1I4XA 1KDAA 1VS0A 4F7XA 5I9OA 2F0GA 4XDXA 2PNHA 4HIOA 1WTVA 4A3EH 5KNDA 4NPSA 2KECA 1WD1A 1OXUA 5E4WC 4KY6A 4BBSH 2PO4A 2WAQB 3I2ZA 1IBML 1Q81C 5IYDH 1AW7A 5J3BA 3NBIA 2EDGA 3M4PA 3WWVA 3HOWG 1N8RC 5JOBA 4HN7A 1MD2D 1VQHA 1GUNA 1MJCA 3SE0A 2HDMA 1N32Q 2D0PA 3D6WA 5ISRA 1PZJD 5KYLA 5IGCA 1RODA 1EY7A 1HR0W 1LT3D 1QWYA 1ZYRC 4LF6Q 4RFBA 2NVQH 3TP6A 1BO0A 2N88A 4MN3A 1PTOF 3NPPA 3UI2A 5ELEA 2KCMA 1DGSA 3I4MG 3R3OA 4ULLA 3TRZA 4IPCA 1LTLA 3E9HA 1A8VA 4K5XA 4HIDA 4AYBG 3CCSA 2CKZB 2EJMA 3VYRA 3VR3A 1Z7TA 3C1EA 1ICWA 1I3QB 1D5MC 3EBEA 5E7NA 3D6CA 1LTAD 2Z4IA 4EQNA 2YTYA 2AQ3B 2ZTEA 3PMFA 4OWWB 1LLRD 4LFAL 1GUTA 4KY7A 2D5DA 4BXXH 3BG3A 3MC0B 3M7NA 3QWNA 4UY8C 2B39A 1X3QA 3J7ZC 1TS5A 5FOBB 4DGZA 1I94L 3MXPA 2KOLA 3VYSA 1CA6A 3NXWA 4RGOS 3T1YL 2V1CC 1XX8A 3LWEA 3I4NG 1YNJD 1VQKA 2WACA 5M5WH 3GDEA 5EPLA 1OO9B 1SYCA 3OMGA 4L8JA 3L3OC 1W6JA 3NHHA 1K83H 3P20A 5FLXE 1XXGA 3M4QA 1KNAA 4YCVA 1NBWA 5EGTA 2A68D 1ET6A 5A2QL 1Y1VB 1SNPA 4DV3L 2EYMA 2IWHA 3RZDB 1CFMA 2A6HD 1PH8A 4GNXB 2JA7H 2NVTB 2ZXPA 5JEAJ 1PXUA 1BDOA 4BA2I 2FMCA 3J7AV 4A3MG 1BCPD 2K75A 5LHY1 3JAML 3GTMH 1QUQB 2WAQE 5ELDA 2D9UA 2EE1A 3CCLA 4MTNA 2ZXRA 5IWAQ 2F52A 1CK1A 5CV7A 1KLGD 1EY5A 4DR3L 1VMCA 2JA8B 1IKMA 1TY0A 2L9HA 4GLAC 1U4MA 1JR0D 1PH3A 2KEEA 3M3YH 1LT6D 5J39A 4YY3Q 5ELBA 4BY7G 1DOLA 2A69D 3OSOA 1HA6A 4IALA 1PRTF 1YZ6A 5EAYA 2K6AA 1TWHB 4C2MH 4GOPC 1FNUA 2Q8IB 4IPGA 4QF4A 1WD0A 1EYDA 1YNXA 4AQYQ 1WTPA 1X32A 2RHQB 3F2CA 2RCNA 1XMOQ 2B2WC 1LTSD 4A3KH 3H3VH 4OO1I 1J5EL 3A5ZB 4R4TA 1EQTA 3SK4A 4ZLTF 4R4OA 2F0IA 3FHWA 5CV5A 4K8JA 2RDGA 4PV1C 4A3FB 4FVMA 3C2PA 3KBXA 3ICEA 4NW2A 3DMUA 3H0GH 3K7AB 4A93G 3FMCA 4YHHQ 4V0BA 5JEAG 2B2WA 1Y1WG 2HD3A 2HHHQ 2X6GA 1TS3A 2Y0SG 3PO2B 1STYA 4C1NI 3W2DA 1TWCB 5IYBH 3KBGA 3HKZG 4JBKA 3VYTA 3GTJH 1PH5A 2Q2TA 4C3HB 4C3IH 1DM0B 4RAUC 1ILQA 4HMIA 2BA1A 3CRLC 1QB5D 2ZJPA 2I5HA 2GVBA 2GVAA 1VQAA 3GTQH 3A55A 1RL2A 2AWNA 2N55A 1QVGA 2Z9HA 2UXCL 4DK0A 2XIWA 4G57A 2K4KA 2O5JC 1MSGA 3FVQA 4DXGA 4EQOA 2EYOA 2O4XA 3M85A 4DNIA 3GTGB 3MZ5A 1LO5D 2K5QA 3S24A 4C3JG 1VMPA 1EYAA 2F03A 1B53A 4A3IG 4A75A 3KF8A 1EQQA 1TWAH 4CKEA 2VS1A 1UEBA 3TZUA 1HR0Q 1N36L 3J81i 1VQPA 1HNZQ 3ND8A 5FO7B 3NQTA 2A6HC 1LYLA 5D3IB 2LSSA 5ELFA 3CF5A 3JAMc 1BCPC 4FDBA 4HEDA 5GAGC 5IODA 4BBSB 4LFBL 2IPKD 2R7ZG 1BOSA 2CW0D 4JG2A 1GXDC 3HOYG 1GOZA 4JI8Q 4DV1L 2ENBA 1PMRA 4TVAB 3HOXG 1JORA 5A2QE 2F0NA 3S17H 1II3A 1K8AC 5J22A 2K5HA 3HOZH 5KEEA 4JI5Q 4X3SA 2VQFL 4A3BH 2SDFA 5C4XG 2A69C 1G51A 2RSNA 2EQSA 3JAME 3W1BA 5JVG3 3TQYA 2NVQB 4MNOA 1PVOA 4KHPL 5EKKA 1O7LA 3M4OH 1R4PB 3S1NB 1GVPA 2GA4B 4PZ6A 1Q3LA 1PH4A 4ILWA 2QCPX 3SK8A 5BR8Q 1TIID 3PIPA 4G4KA 5FLMG 4QGUA 4ME5A 5C44G 3MEHA 4HAEA 1X56A 1D2BA 1Q46A 2DN8A 4XYOA 3NBHB 2R92H 3SK5A 1T5XD 3O13A 1KLUD 3JC66 3ULPA 1SFOH 1VQ6A 1EUJA 3D3RA 4N8FA 1A3VA 1UE1A 4XT3B 1D7QA 5KYIA 5C3EG 1IBKQ 1PYWD 3H91A 3QJYA 3U9SA 1OXXK 1R4QB 5IT9E 4APVA 4X64Q 5M3MH 4RHSA 4OGQC 1LABA 2FMMA 5FKAC 1HH2P 3PGZA 4B3RL 2KA7A 3H94A 3MHBA 4NXMQ 3I72A 3U50C 4KMUC 1K3RA 2N49A 3K80C 2B63G 1TS4A 4OHJA 2XWBB 1NSNS 1WJJA 1H9SB 4IZ8A 2BH8A 1YJNA 3GTMB 4IFDJ 2UXBQ 1TKWB 5C0XH 1O7YA 4FO2A 4FXGC 1IXRA 2IX0A 4LJZC 4LF4Q 1KD1C 3V96A 4A3GG 4JI8L 5C6AA 1LT4D 3S1QB 3A74A 3RMHA 1SROA 3M3YB 1S4ZA 3TBIB 5C3WA 4DAMA 3RLFA 1YJ9A 2OQ0A 1PFMA 3SGIA 1XYIA 4C2MB 1Z47A 3LX0A 5A35A 4QL5A 1TQOA 3RLNA 4ZKCB 2EYLA 4GN5A 3FPUB 3I4LA 2L5TA 1SMYD 3E0EA 3HOWH 4LF5Q 2E2IH 1I6VC 1K73C 1S5DD 1GUSA 1VF7A 4PMWA 4KJOA 4A3KB 1VQOA 4UDUC 2C5CA 5BR8L 5F2DA 4GKJQ 2Q2HA 5BN4A 5M5XB 1CTMA 1QG7A 1U4PA 2OEOA 1SJHD 4ABNA 1L2FA 4PMBA 3CMAA 1A63A 1UEAB 4DR4Q 3S2HB 4JI1L 3H0GB 2F4IA 3ZJYC 4LFCQ 1G8ZD 3NEMA 2MFIA 2RHSB 4FF1A 1A2UA 3I4MH 1IZ6A 2E5LL 4CBVA 1FL0A 2OWOA 1B70B 4E6IA 4KN7C 4P72A 3PCOB 1ENAA 1IYVA 4PZ7A 1B8AA 1HFGA 2H4OA 3KK7A 4NB3A 4OX9L 1S72A 2DJGC 2HDLA 2A19A 3WOFA 1BBXC 1STEA 2K52A 4HCSA 1F9SA 4ZUIA 2AUJD 3Q6SA 4IPHA 3AB9A 1J6QA 2F3VA 4EQPA 4C3IB 2QDLA 1I4RA 2F0HA 5FO9B 3CRKC 1S3OA 4JPBW 2KHIA 1V1OA 3T51B 5E1FA 4POFA 3GTQB 1JICA 1N33Q 1X55A 2ICIA 4X65L 3HP3A 2MUYA 3AQQA 3I91A 3MA2B 3Q8DA 1Q1EA 3ITPA 1ASYA 1VQ5A 3HOUG 4KD4A 5JJLA 5EQ0A 3CQZB 1WTRA 1M90C 4N9TA 1HNWL 4RWSC 3VA5A 2D62A 4JBJA 5JJKA 3FDTA 4LUOA 3L9AX 4NXNL 1SNDA 2UXDQ 3T16A 4J8QA 1SXTA 2B2VC 4A3MH 4DXFA 4B3ML 1SJED 3QG1A 2KQ3A 3Q24A 1Y1VH 2EPBA 1AH9A 2F0PA 2VXWA 2PQAA 3VR5A 1STGA 2YU9H 3TS2A 2P5ZX 4DKAC 2XSCA 4DR5Q 2J7ZA 2R7FA 4O1NA 3S17B 4WFN3 3HOZB 2KCTA 1EIYB 1E7ZA 2IHEA 4R8IA 1WTOA 1I50B 1Q7YC 2VY3A 4KY5A
chains in the Genus database with same CATH topology
2NN6I 2MGSA 3KLSX 4H0LC 2OF1A 3M4OB 1SMYC 1XTCD 3HG9A 2DY8A 1JB3A 2ICEC 4N9PA 1MBYA 2NN6G 3P1HA 4K14A 1L0YB 1PLFA 4DAYA 3T56B 3AMUA 1DYQA 1HTLD 1AFPA 3CHBD 1CHQD 2R92B 3W3AA 1SFOB 2SNSA 3C3LA 3OIQA 2R3ZA 1EWCA 3Q0AA 2D2CC 3DWAA 3MTSA 4K6DA 2KCNA 5M3MB 1EEFD 5IGEA 1PTOD 3ND9A 3EVQA 1SYFA 3PUZA 4BBRB 3IFDA 4QMGA 2NTTA 4ZK9B 2ZXOA 2PZTA 2JYOA 1ESFA 3I8ZA 5J1ZA 5IGDA 4H7BA 1G2SA 2NBFA 3KUPA 2KJXA 4LMQD 5HGTA 4KHVA 3TMEA 3DEOA 3R2TA 4DU9A 2F0VA 1EU3A 5DEHA 2VB2X 4DAPA 1Y8NB 1PDQA 3HOWB 1ML0D 2MJ8A 2E2IB 3A8IE 2Z4HA 1RKNA 1B9NA 3FPPA 2I07B 1CZWA 1FD7D 4L6TB 2E75C 2F0KA 1U9RA 5K36H 3CU7A 4RKBA 4I65A 2PNRC 1G91A 1SDFA 1B9MA 5DNFA 4M8AA 5JPNC 3I4MB 4BS9A 2J4XA 5C4HA 2MP1A 1EYCA 1PFNA 1PRTD 2VB3X 4AYBB 3DUZA 2EY1A 3HZXA 1BF4A 1EZ8A 3C1FA 5CR3A 4G7OC 1BQQT 2QF7A 1LTID 4BA1I 5M9OA 4KV6A 1IYUA 5JAVA 2JP1A 3D8GA 5I6YA 1B4OA 4NKLA 3MFYA 1E2ZA 5E4XA 5LL6X 1QJOA 1TU2B 1PTOC 2EY2A 1S5CD 3KLRA 4A3MB 4WJWA 5EKIA 1TY2A 2PZWA 5EPJA 5D3DA 4B9WA 2G9DA 4IUUA 1FNWA 4KD3A 3WOEA 3ZYYX 1HCZA 1A3UA 1HHVA 2F1MA 3K5OA 1C48A 1U4RA 3BYTB 2YU9B 4ZRZA 1F2ZA 2SOBA 3DXJC 4BY7B 5JPMC 3BZDB 3J7YW 3K57A 3OPOA 4QB4A 3R8BA 3M7GA 5IGFA 4QCLA 1Y8PB 2LY7A 3I3CA 4FF4A 3H09A 1HA5A 3HS0C 5IGGA 3BVGA 1HUMA 1TS2A 2EY6A 5CC4A 2R6GA 1SYDA 3QOLA 2F0QA 4K8IA 3OMCA 4H44C 4A93B 1QOHA 2AUKA 2K1BA 3NUCA 1IKLA 4F87A 1AZQA 1SNQA 1Y1WB 1YNND 2PPBC 2EOTA 1JOOA 4IFDH 2Y0SB 3E0JA 5G3LF 4OO1G 4M1UB 3SEBA 3HKZB 4NMZA 3IKJA 2V4DA 4S3SA 4FF3A 2QILA 4PNYA 1PRTC 2F0SA 1NR2A 1MI2A 1JWSD 1U4LA 2XRSD 3DEPA 2E2DC 1Q12A 4Q5VA 3S9WA 2JEBI 1DCZA 3QO2A 1V1PB 3GTPB 2EVBA 1MGSA 2WIIB 1ZKOA 2IW3A 4A3IB 2ZT9C 5NUCA 2F0FA 3BDOA 1V43A 3AU7A 1AN8A 2OT2A 3PUWA 5EKLA 1S5ED 1SYBA 4DK1A 1TWGB 3PUXA 5EPKA 2XRQD 1HQMC 3D4DA 2R7ZB 3EROA 1DZ1A 1PFBA 4OL7A 1NR4A 3HOYB 3MVVA 2EZVA 2DY7A 2PCFB 3HOXB 1F9QA 3QIAA 2EYHA 3QB3A 3D31A 4XYQA 1DOKA 5ELCA 1C4QA 2BOSA 4CKCA 5C4XB 3K5MA 2EJFC 5D14A 1B1ZA 1BCPB 1EY0A 3BDLA 4C1NK 1Q8IA 2B2YA 2CQAA 2RSOA 2AQ1B 2DNEA 1LTBD 2E2JB 1E0BA 5C44B 4F88A 3VA7A 2EY5A 5C3XA 2E76C 3SK6A 1PZID 2QKIC 2Z8LA 1IL8A 4Z9CB 4NDXA 4PQXA 1EU4A 5C3EB 1YNNC 4QUFA 3BVZA 4HSPA 2EYPA 3IFTA 1STNA 3GV6A 4KK7A 1NAPA 4DN4M 2B63B 1K8OA 3DWPA 2G9HD 3C46A 1L0XB 1WTXA 2B8FA 1HPCA 5JJZA 2L0CA 1HFNA 2O5IC 2VNUD 3NBHA 3N52A 4R9WA 3S1RB 3EA6A 1F77A 4A3GB 2K01A 1SNOA 5E3FA 3T13A 3OHXC 1CHPD 3K5NA 3PUYA 1KDCA 2EXZA 2F3WA 1BR9A 1H9KA 5D65A 1WTQA 4RGTA 1A3TA 2K04A 5CBAE 3TP8A 1H9SA 3RUZA 3K0YA 1QNUA 1C8CA 1IW7D 4TSSA 2B2TA 1S5FD 4B9XA 3T4AC 4FYDA 4DFAA 2F0TA 4YIJA 4EGVA 4JBWA 3GTLB 3OOCA 3FRPB 3H3VC 1DD2A 2CHBD 3MXUA 4IUPA 5EBDA 2BDOA 1RCVD 1OXVA 2AQ2B 4JK1C 3IL8A 5C4JB 5C5LA 1UUPA 3TN2A 4K2KA 4P2CB 1H9MA 2YYZA 1WVLA 1CM9A 3NWTA 4IFDI 2XVSA 2DNCA 5T1IA 4XXEA 1A15A 1KTKA 3TSSA 2HCCA 3HOUB 5JVH3 2F0DA 4IUNA 4RGMA 4F8MA 3DM1A 2X6LA 4J1MA 4H13C 3GTOB 1HUNA 1UAPA 4KHZA 4XQQA 1AZPA 3GTKB 1D1IA 2MHVA 4G7ZC 3HOVB 4KN4C 2K03A 3S15B 1LACA 1TVXA 5IOCA 1JOQA 3PUVA 1ENCA 1PTOH 3L7ZC 3EJIA 3NP8A 4R8NA 4FXDA 2NTSA 5CV4A 4K6LA 4ZKBB 4UAIA 1RJTA 1LTRD 2E74C 1B50A 3V2TA 2SEBD 3S14B 3S2DB 5I2YA 5KNCA 1M4VA 1IW7C 1EOTA 4X3KA 1SBBB 1ESRA 5IIFA 3DWQA 4HCEA 4CJ1B 5CMDA 2SNMA 4WRDA 1RTOA 3S1MB 1QE6A 5JEAH 1O80A 2WINB 2FHTA 4XIGS 5CORA 5BN3A 2M9VA 2HCIA 1LT5D 3EFXD 1GJXA 2L12A 1H9JA 1HRJA 2R93B 1I4GA 5CGKA 5KIXA 3PIO3 1F9RA 2LS01 3A54A 5FLXL 4C56C 2PW5A 2KHSA 3GV3A 5M5YB 1D1KA 2A74C 2NVXB 1Y8OB 1SNCA 2KUMA 4MIUA 4ZQ3A 3OWEB 3NK9A 2E2HB 4Q0FA 2KVMA 3NTIA 1ZEQX 2BDNA 1JE4A 4K5WA 2B2UC 2F0JA 4HTHA 2JA6B 2OXPA 4O42A 2HUGA 3Q22A 2WB1B 4B08A 4DNTB 3NTKA 5K5PA 5C0XI 3NTHA 1X3PA 5DAUA 5CYUA 1EL0A 1FR3A 1TT2A 2B2UA 2WKCA 3GO5A 5TSSA 3S16B 4KI0A 3KLSA 1VCIA 2BCOA 1RTNA 2B8GA 2F0EA 3OIPA 4NP5A 3SHLA 2Q8RE 4I7ZC 2NYZD 2F0LA 1STHA 1RDPD 1FGBD 2RDFA 3K5LA 3BDCA 2K05A 3RZOB 4FNFA 3NQIA 2PYKA 4RH6A 4XTCS 3VR6A 3I4NB 1NUCA 4IUTA 4DF7A 5G3LD 1S5BD 4EVOA 2LMCB 3K6OA 2L1BA 4KJNA 1ONLA 3P7JA 1LV9A 3I70A 4RCOA 4CKBA 3MAQA 4RHRA 4RKLA 1JC7A 1SE3A 1PTOB 4DNRB 1ILPA 3ONAB 5CV6A 1B3AA 1JCKB 4RA8A 2KEDA 1QCBD 3SXHA 3RD4A 1DONA 1R9TB 1DJRD 2RDHA 2NWGA 1EY8A 2H1EA 4IQZA 4FXKC 3SR1A 4RCNA 4IUVA 1T5EA 1LTTD 1Q90A 2K5WA 2WKDA 3TP7A 1IHZA 2NZ1D 3K58A 1SYEA 3ERQA 2HQEA 1TR5A 3K59A 5COYA 2LKVA 5I4DA 4QIWB 2L55A 4Y7NB 4IURA 3G7LA 3SVMA 5CV8A 4K2LA 4G7HC 1GHJA 3M4YA 1O7ZA 1H9RA 1ENFA 5HURA 5IT9L 1RHPA 4ID6A 1CQFA 3A56A 1TWFB 3P75A 4A3DB 1PRTB 2XN9C 1I4HA 2MPMA 4CJ2C 1STAA 4ZYSA 1E2WA 1SYGA 1NCVA 1CZGA 3BVMA 4HMJA 2IJ0A 4C3JB 1B2TA 4DA2A 1I6HB 3BS1A 3D4WA 2PZUA 1F2LA 4XQNA 5LL6S 1O78A 4KKUA 1BCPF 1I4PA 1QNKA 2AWOA 3I90A 1V1PA 4U68A 5FO8B 1D6EC 4C3HG 4TQUS 2F0UA 1GUGA 1JOKA 2B2YC 1CQVA 1SSOA 1YNJC 2F0WA 1SEBD 1VDZA 2KCCA 2VUMB 1CA5A 3TDQA 1UNSA 2NVYB 1D5XC 2A68C 3VR2A 2RVLA 1CI3M 1QILA 4FF2A 2X69A 4A3EB 2BE5D 1EIHA 2NN6H 1ZXTA 3TZDA 2K7VA 2RQXA 5KGUA 5AFWA 3N6RA 1BUVT 5BN5A 4KKSA 1V8QA 3CKIB 5I9PA 4BY1B 5K36G 2RBMA 1RF2D 3PV0A 3LWUA 4L63B 2C9OA 4OIJA 2IX1A 1XWEA 1EY6A 3J81L 3U9OA 1STBA 1BNZA 1KNEA 2PW7A 1EQVA 3T53B 2QDBA 5T1GA 3NWSA 3R2IA 2WV6D 2JXMB 2EJGC 1GHKA 1JWMD 1CT1D 4BWGB 4CHTB 1B44D 5M5WB 3DHQA 4CJ0B 1K83B 3HEJA 1OXTA 2B2TC 3SDZA 1RD9D 2F0MA 2A6ED 4QUCA 5I2XA 2JA7B 1I4QA 2R61A 5CBEE 3R93A 1GUOA 2L11A 2JE6I 2Q8TA 3IAYA 1D5ZC 5C4ZA 1E2VA 2PMZB 2JA5B 1J8IA 2F0OA 1F2MA 1Z6HA 3HRZC 5I6WA 1JQYD 1HTPA 4ODGA 2PQEA 3F2UA 1VF5C 2BE5C 3OWFA 5KRUA 3BYYB 3A7LA 1KDBA 1F2YA 2CW0C 5FK9C 3TP5A 2LFNA 4DAVA 2RKSA 1JWUD 1J9OA 1SAPA 2M00A 1G291 3HGBA 3G6JB 4IFDG 1EZ6A 4RGNA 4XT1B 2CVRA 1BXTA 2IT1A 5DM73 3GTJB 1M8AA 4KTAA 1EY9A 1Q1BA 2FINB 2XNAC 1EEID 2EYFA 3H6MA 2A5HA 3VYUA 3J80L 4HSVA 3J81E 4C3IG 3MFGA 1SE2A 1A2TA 2J0TD 3X3MA 2K28A 4HR7B 2K5DA 1G2TA 5EJWA 2IX3A 1MSHA 3LNNA 1K8MA 1TWAB 2JEAI 4U673 3URYA 1FYCA 2A6EC 2M2LA 1AP0A 4IN3A 3E5SA 3A7AB 4X3TA 2FJ2A 4V190 1PZKD 4ZAIA 3VR4A 1KAAA 1WCMB 2Z1CA 2B2VA 4K5VA 1SE4A 2BA0A 2EYJA 5CV9A 2XWJB 1HXYD 4A3BB 4OO1H 1A6XA 5DM63 1DXMA 2ID0A 4J6HA 1DOMA 1OXSC 5KNBA 1F9PA 1ZYRD 1HQRD 3J7AF 2K33A 2I46A 1EFID 3X3NA 4LK1C 4ZUJA 4TKOB 4A3JB 3PO3B 3D4RA 2NUCA 3WDNA 4WORA 4KKTA 5C0XJ 3NSWA 1EIGA 4XQJA 2TSSA 3E6ZX 3FEWX 2RA4A 4IUQA 5M3FB 4MHEA 3FKIB 1FNVA 2TMPA 1LTGD 3MXNA 3OW7A 1ET9A 4CGYB 2IL8A 1W6KA 2QEJC 1GUWA 1EY4A 4X3UA 1G6ZA 4TRDA 4OIKA 2K32A 5IGBA 3PIP3 5C5MA 2WP8J 1KABA 3V05A 3A8KE 4GZYC 3GQBA 3MXGA 1SNMA 2FFKB 4LAAA 3GD7A 3GP7A 2NB0A 3NE5B 1Y69U 2A73B 1WTWA 3QOJA 3EQLC 4FP5D 4PMCA 3J80E 2O2LD 5EBCA 1AEXA 5C0XG 2JSOA 2L4NA 3A8JE 3MWYW 3Q23A 1EWHA 3I73A 1I4XA 1KDAA 4F7XA 5I9OA 2F0GA 4XDXA 1WTVA 5KNDA 2KECA 1WD1A 1OXUA 5E4WC 4KY6A 2PO4A 2WAQB 1AW7A 3NBIA 2EDGA 5JOBA 4HN7A 1MD2D 1GUNA 3SE0A 2HDMA 3D6WA 5ISRA 1PZJD 5KYLA 5IGCA 1RODA 1EY7A 1LT3D 1QWYA 1ZYRC 4RFBA 3TP6A 1BO0A 2N88A 4MN3A 1PTOF 3UI2A 3NPPA 5ELEA 3R3OA 4ULLA 4K5XA 2EJMA 3VYRA 3VR3A 1Z7TA 3C1EA 1ICWA 1I3QB 1D5MC 3D6CA 1LTAD 2Z4IA 4EQNA 2AQ3B 3PMFA 1LLRD 1GUTA 4KY7A 2D5DA 3BG3A 3MC0B 3M7NA 3QWNA 2B39A 1X3QA 1TS5A 5FOBB 4DGZA 3MXPA 2KOLA 3VYSA 1CA6A 3NXWA 4RGOS 1XX8A 3LWEA 1YNJD 2WACA 5EPLA 1OO9B 1SYCA 3OMGA 4L8JA 3L3OC 1W6JA 3NHHA 3P20A 5FLXE 1XXGA 1KNAA 5EGTA 2A68D 1ET6A 5A2QL 1Y1VB 1SNPA 2EYMA 2IWHA 3RZDB 1CFMA 2A6HD 2NVTB 2ZXPA 5JEAJ 1PXUA 1BDOA 4BA2I 2FMCA 3J7AV 1BCPD 5LHY1 3JAML 5ELDA 2D9UA 2EE1A 2ZXRA 1CK1A 5CV7A 1KLGD 1EY5A 1VMCA 2JA8B 1IKMA 1TY0A 2L9HA 1U4MA 1JR0D 2KEEA 1LT6D 5J39A 5ELBA 1DOLA 2A69D 3OSOA 1HA6A 4IALA 1PRTF 2K6AA 1TWHB 1FNUA 2Q8IB 4QF4A 1WD0A 1EYDA 1WTPA 1X32A 2B2WC 1LTSD 4OO1I 1EQTA 3SK4A 4ZLTF 2F0IA 5CV5A 4K8JA 2RDGA 4PV1C 4A3FB 4FVMA 3C2PA 3KBXA 4NW2A 3DMUA 3K7AB 3FMCA 4V0BA 5JEAG 2B2WA 2X6GA 1TS3A 3PO2B 1STYA 4C1NI 3W2DA 1TWCB 3KBGA 3VYTA 4C3HB 1DM0B 4RAUC 1ILQA 4HMIA 2BA1A 3CRLC 1QB5D 3A55A 2AWNA 2N55A 4DK0A 2XIWA 4G57A 2O5JC 1MSGA 3FVQA 4DXGA 4EQOA 2EYOA 2O4XA 3M85A 3GTGB 3MZ5A 1LO5D 2K5QA 4C3JG 1VMPA 1EYAA 2F03A 1B53A 3KF8A 4CKEA 3TZUA 3ND8A 5FO7B 3NQTA 2A6HC 5D3IB 5ELFA 1BCPC 4HEDA 5IODA 4BBSB 2IPKD 1BOSA 2CW0D 1GXDC 1GOZA 2ENBA 1PMRA 1JORA 5A2QE 2F0NA 1II3A 5J22A 5KEEA 4X3SA 2SDFA 2A69C 2RSNA 3JAME 5JVG3 2NVQB 5EKKA 1O7LA 1R4PB 3S1NB 2GA4B 1Q3LA 4ILWA 2QCPX 3SK8A 1TIID 4G4KA 4ME5A 3MEHA 4HAEA 1D2BA 2DN8A 4XYOA 3SK5A 1T5XD 3O13A 1KLUD 3D3RA 1A3VA 4XT3B 5KYIA 1PYWD 3H91A 3QJYA 3U9SA 1OXXK 1R4QB 5IT9E 4RHSA 4OGQC 1LABA 2FMMA 5FKAC 2KA7A 3H94A 3MHBA 3I72A 4KMUC 1TS4A 4OHJA 2XWBB 1NSNS 1H9SB 4IZ8A 3GTMB 4IFDJ 1TKWB 5C0XH 1O7YA 4FO2A 4FXGC 2IX0A 4LJZC 3V96A 5C6AA 1LT4D 3S1QB 3RMHA 3M3YB 1S4ZA 3TBIB 5C3WA 3RLFA 1PFMA 1XYIA 4C2MB 1Z47A 3LX0A 5A35A 1TQOA 4ZKCB 2EYLA 3FPUB 3I4LA 2L5TA 1SMYD 1I6VC 1S5DD 1GUSA 1VF7A 4PMWA 4KJOA 4A3KB 4UDUC 2C5CA 5F2DA 5BN4A 5M5XB 1CTMA 1QG7A 1U4PA 2OEOA 1SJHD 4ABNA 4PMBA 1UEAB 3S2HB 3H0GB 2F4IA 1G8ZD 4FF1A 1A2UA 4CBVA 4E6IA 4KN7C 1ENAA 1IYVA 3KK7A 1HFGA 2H4OA 2HDLA 3WOFA 1BBXC 1STEA 4HCSA 4ZUIA 1F9SA 2AUJD 3Q6SA 3AB9A 2F3VA 4EQPA 4C3IB 1I4RA 5FO9B 2F0HA 3CRKC 1V1OA 3T51B 5E1FA 3GTQB 1JICA 2ICIA 3HP3A 2MUYA 3I91A 3MA2B 1Q1EA 3ITPA 4KD4A 5EQ0A 3CQZB 1WTRA 4N9TA 4RWSC 3VA5A 2D62A 3FDTA 3L9AX 1SNDA 3T16A 4J8QA 1SXTA 2B2VC 4DXFA 1SJED 3QG1A 2KQ3A 3Q24A 2EPBA 2F0PA 2VXWA 3VR5A 1STGA 2XSCA 2J7ZA 4O1NA 3S17B 4WFN3 3HOZB 4R8IA 1WTOA 1I50B 4KY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 I;  1H9K A;  4PV1 C;  3L7Z C;  2E75 C;  5BN4 A;  2EJG C;  2IT1 A;  4H0L C;  1CTM A;  4DNR B;  1GHK A;  1O7L A;  5K36 H;  2EJF C;  1SMY C;  1H9S A;  1Q1B A;  3OW7 A;  2PNR C;  1O78 A;  4KKU A;  2NN6 G;  3FMC A;  4BA2 I;  2AWO A;  1B9M A;  3T56 B;  2EJM A;  3VR3 A;  1Z7T A;  4DNT B;  5JEA G;  1IW7 D;  2E74 C;  2R6G A;  2DN8 A;  4TQU S;  4KN7 C;  1IYV A;  1OXT A;  4H44 C;  4JBW A;  2DNE A;  2AUK A;  3OOC A;  1FR3 A;  1GUG A;  3SDZ A;  1GUT A;  3W3A A;  2D5D A;  4HR7 B;  3BG3 A;  2A6E D;  2K32 A;  1YNJ C;  4IQZ A;  2AUJ D;  5KNC A;  3M7N A;  3AB9 A;  4RCN A;  4KI0 A;  3VA7 A;  2PPB C;  1VCI A;  1VDZ A;  4IFD H;  2KCC A;  1T5E A;  1IW7 C;  3A8K E;  4OO1 G;  1Q90 A;  1DD2 A;  2BA1 A;  2D2C C;  4GZY C;  4G7O C;  3LNN A;  1GUO A;  1K8M A;  2E76 C;  2QF7 A;  1OXX K;  3CRL C;  3GQB A;  3MXU A;  3QJY A;  3CRK C;  2A68 C;  3IKJ A;  3U9S A;  3VR2 A;  2BDO A;  2B8G A;  4BA1 I;  2V4D A;  1CI3 M;  1LAB A;  3GD7 A;  4L8J A;  4OGQ C;  2JEA I;  1OXV A;  2JE6 I;  3P20 A;  3T51 B;  3NE5 B;  4DK0 A;  4JK1 C;  2BE5 D;  1Y69 U;  1FYC A;  2KA7 A;  2A6E C;  3H94 A;  3I72 A;  1IYU A;  2A68 D;  1YNN C;  2O5J C;  2NN6 H;  1E2V A;  3ND9 A;  4KMU C;  4I7Z C;  3M85 A;  5JEA H;  1CFM A;  3EQL C;  3A7A B;  2A6H D;  3IFT A;  2K7V A;  1Q1E A;  3PUZ A;  1Q12 A;  1H9M A;  5C0X G;  1BDO A;  2YYZ A;  1H9S B;  3MFY A;  1E2Z A;  1Z6H A;  4XIG S;  3A8J E;  2JEB I;  5BN3 A;  1DCZ A;  3VR4 A;  3N6R A;  1HTP A;  5BN5 A;  2DNC A;  2D62 A;  1EWH A;  3I73 A;  1QJO A;  1VF5 C;  2BE5 C;  1V8Q A;  4KKS A;  3TZU A;  4G7H C;  1K8O A;  1TU2 B;  1GJX A;  2BA0 A;  3A7L A;  1H9J A;  1TKW B;  2EVB A;  2B8F A;  1HPC A;  5C0X H;  1GHJ A;  3M4Y A;  1ZKO A;  3ND8 A;  3KLR A;  4LJZ C;  5KND A;  5K36 G;  1H9R A;  2CW0 C;  4OO1 H;  2A6H C;  3QG1 A;  1OXU A;  4XTC S;  1A6X A;  2ZT9 C;  1DXM A;  3PV0 A;  2O5I C;  3LWU A;  3VR6 A;  1OXS C;  4H13 C;  3BDO A;  5KNB A;  2A69 D;  1V43 A;  4KHZ A;  1HCZ A;  3RLF A;  2EDG A;  3VR5 A;  2F1M A;  3PUW A;  2K33 A;  4DK1 A;  2LMC B;  5A35 A;  1PMR A;  4G7Z C;  4KN4 C;  1GUN A;  3PUX A;  4LK1 C;  1G29 1;  3DXJ C;  4TKO B;  3SE0 A;  1HQM C;  2Q8I B;  3HGB A;  3T53 B;  1LAC A;  1Y8O B;  1ONL A;  3I4L A;  2L5T A;  1E2W A;  1Y8N B;  3D4R A;  3WDN A;  1I6V C;  2A69 C;  3OPO A;  4KKT A;  4IFD G;  1GUS A;  1ZYR C;  3A8I E;  2PCF B;  1VF7 A;  3PUY A;  3PUV A;  1B9N A;  3FPP A;  3QIA A;  2JXM B;  3D31 A;  1Y8P B; 
#chains in the Genus database with same CATH topology
 2NN6 I;  5IYC G;  2MGS A;  3KLS X;  4H0L C;  2OF1 A;  2F4V Q;  2QW7 A;  3M4O B;  1SMY C;  1XTC D;  3HG9 A;  2DY8 A;  2IHF A;  1JB3 A;  2ICE C;  2C35 B;  4N9P A;  1MBY A;  4IJH A;  4HIM A;  2NN6 G;  1IBM Q;  3P1H A;  4K14 A;  1L0Y B;  1PLF A;  4DAY A;  3T56 B;  3AMU A;  2GN5 A;  3CC7 A;  1DYQ A;  1HTL D;  4JC0 A;  1AFP A;  3CHB D;  4A93 H;  1CHQ D;  1XMQ Q;  2R92 B;  1XNR L;  5JJI A;  2AMC B;  3W3A A;  1SFO B;  2OTL A;  2SNS A;  3C3L A;  3OIQ A;  1KRS A;  2R3Z A;  4JI3 L;  1V1Q A;  1EWC A;  3KFU A;  4ME3 A;  1VQ8 A;  3Q0A A;  2D2C C;  3DWA A;  2N3S A;  3MTS A;  4K6D A;  2KCN A;  5M3M B;  1EEF D;  1QVF A;  1XTD A;  3PO2 H;  5IGE A;  1PTO D;  4JI6 L;  4P73 A;  3ND9 A;  1K0R A;  3EVQ A;  4LF7 L;  4DUZ L;  4B3T L;  1SYF A;  3PUZ A;  3VDY A;  4BBR B;  1KXL A;  2R93 G;  3IFD A;  4QMG A;  1IBL L;  2NTT A;  4ZK9 B;  2ZXO A;  3GTP H;  1VQB A;  2PZT A;  4OWX B;  2JYO A;  1ESF A;  2K50 A;  3I8Z A;  1P16 A;  5J1Z A;  5IGD A;  3FKI G;  1I94 Q;  4H7B A;  1G2S A;  2NBF A;  3KUP A;  2KJX A;  2VZA A;  4LMQ D;  3STB D;  5HGT A;  4LF8 L;  4KHV A;  3TME A;  4HJA A;  2MO0 A;  3DEO A;  3QR8 A;  4X6A H;  3R2T A;  2NZO A;  5IY0 A;  4DU9 A;  2ATW A;  2F0V A;  1EU3 A;  5DEH A;  1Q8K A;  2VB2 X;  4DAP A;  3HOY H;  1Y8N B;  5GQO A;  1PDQ A;  3HOW B;  1ML0 D;  3HOX H;  2CQO A;  2MJ8 A;  2JA6 G;  3A8I E;  4DR6 L;  2E2I B;  2Z4H A;  1RKN A;  1B9N A;  3FPP A;  1M1K C;  2F4V L;  2JJQ A;  2I07 B;  4RMF A;  1L1O A;  1CZW A;  1FD7 D;  2WB1 G;  4L6T B;  2E75 C;  3ULL A;  3DLL A;  2F0K A;  1U9R A;  5K36 H;  3CU7 A;  4DR3 Q;  3RLO A;  1NMG A;  4RKB A;  4I65 A;  3KF6 A;  2PNR C;  1G91 A;  1XMQ L;  1SDF A;  1B9M A;  1AE3 A;  5DNF A;  3PF4 A;  4M8A A;  5JPN C;  1EOV A;  3I4M B;  3KDF B;  4BS9 A;  2J4X A;  5C4H A;  2UUA L;  2MP1 A;  4MTK A;  1XNQ L;  1SRU A;  1EYC A;  1PFN A;  4CDD C;  2E2J H;  1OTC A;  1PRT D;  2VB3 X;  4AYB B;  4JI4 L;  3DUZ A;  2EY1 A;  3UE0 A;  4AIM A;  1NTG A;  3HZX A;  4L5T A;  1BF4 A;  3S1N H;  1EZ8 A;  1J5E Q;  3C1F A;  1KRT A;  5CR3 A;  4G7O C;  1BQQ T;  2QF7 A;  1LTI D;  1XPR A;  4BA1 I;  4EQ5 A;  4JI0 L;  5M9O A;  5GAE C;  3U4Z A;  3T1H L;  2ZTC A;  5C3E H;  4KV6 A;  1UE7 A;  1IYU A;  5JAV A;  2JP1 A;  3CW2 C;  5H1S E;  3BZK A;  3D8G A;  4X66 L;  5IP9 H;  5I6Y A;  1KQS A;  1B4O A;  4NKL A;  3MFY A;  1E2Z A;  5E4X A;  2B63 H;  4OEL B;  3I56 A;  5LL6 X;  1X3G A;  3CME A;  1QJO A;  1TU2 B;  1PTO C;  1PV4 A;  1VQN A;  4QQB X;  2EY2 A;  3CXC A;  1V9P A;  3H15 A;  1S5C D;  3KLR A;  4A3M B;  4WJW A;  4LWC A;  5EKI A;  4HJ8 A;  1TY2 A;  1HZ9 A;  2PZW A;  5D3D A;  1FGU A;  5EPJ A;  4B9W A;  2G9D A;  4DR1 L;  4IUU A;  1FNW A;  1GD7 A;  4KD3 A;  4P75 A;  3WOE A;  3ZYY X;  1YI2 A;  1HCZ A;  1A3U A;  2UXC Q;  1HHV A;  3BU2 A;  2F1M A;  3K5O A;  1C48 A;  1U4R A;  3BYT B;  2YU9 B;  1PHJ A;  4ZRZ A;  1GKH A;  1F2Z A;  2SOB A;  3DXJ C;  1L0W A;  4BY7 B;  2PI2 E;  5JPM C;  3STB C;  5IP7 H;  3BZD B;  3J7Y W;  3K57 A;  3OPO A;  1AE2 A;  4QB4 A;  4OEM B;  3R8B A;  3S1Q H;  3M7G A;  4PG3 A;  1O7I A;  5IGF A;  1N36 Q;  4QCL A;  1Y8P B;  4LUV A;  3KOJ A;  2LY7 A;  3I3C A;  4FF4 A;  3H09 A;  2QGQ A;  1WFQ A;  1HA5 A;  4UPA A;  3HS0 C;  5IGG A;  3BVG A;  1HUM A;  2HIV A;  1U5K A;  1TS2 A;  2CCZ A;  4LFB Q;  1QUQ A;  2JQO A;  2EY6 A;  4X62 L;  5CC4 A;  1E1O A;  4JOI C;  3CAM A;  2R6G A;  1SYD A;  3PQI A;  3QOL A;  4DV1 Q;  3GTL H;  4GOP B;  2F0Q A;  4K8I A;  3OMC A;  4H44 C;  4A93 B;  1QOH A;  2AUK A;  2K1B A;  3E3X A;  1IKL A;  3NUC A;  4F87 A;  1AZQ A;  5M5X H;  2MQH A;  1SNQ A;  2VQF Q;  1FJG L;  1Y1W B;  1YNN D;  2PPB C;  2EOT A;  1JOO A;  2F3I A;  4IFD H;  2Y0S B;  3E0J A;  5G3L F;  4OO1 G;  3A5U A;  4M1U B;  3S2H H;  3SEB A;  4JOI A;  4YWL A;  3HKZ B;  4KHP Q;  4NMZ A;  3IKJ A;  2Q2I A;  2V4D A;  4S3S A;  2QIL A;  4PNY A;  4FF3 A;  1PRT C;  1CKM A;  2F0S A;  1NR2 A;  1MI2 A;  1JWS D;  1U4L A;  2XRS D;  3PSI A;  3DEP A;  2E2D C;  2HT1 A;  1Q12 A;  1LM0 A;  4Q5V A;  1JJC B;  1JMC A;  3S9W A;  2JEB I;  1DCZ A;  3QO2 A;  1V1P B;  3EIV A;  1PH9 A;  3GTP B;  2EVB A;  1MGS A;  2WII B;  1ZKO A;  3CC4 A;  2IW3 A;  4A3D G;  4A3I B;  2ZT9 C;  5NUC A;  2CWA A;  4JVZ A;  3W1G A;  2F0F A;  3BDO A;  1V43 A;  3AU7 A;  1AN8 A;  3GTK H;  4B3R Q;  2OT2 A;  3CQZ H;  3PUW A;  4QJF A;  1S5E D;  1SYB A;  5EKL A;  4DK1 A;  3HOV H;  2Z0S A;  1TWG B;  4LUZ A;  3S15 H;  1VQ4 A;  3PUX A;  5EPK A;  2XRQ D;  1HQM C;  4UHV A;  3D4D A;  2R7Z B;  3ERO A;  1DZ1 A;  1TXY A;  1PFB A;  4OL7 A;  1Q82 C;  4JBM A;  1NR4 A;  3HOY B;  3MVV A;  1XPO A;  2EZV A;  2DY7 A;  2PCF B;  4GN4 B;  1F9Q A;  3QIA A;  3HOX B;  1A62 A;  2EYH A;  3QB3 A;  3D31 A;  4XYQ A;  2Q2U A;  1DOK A;  5ELC A;  1C4Q A;  1SLJ A;  2BOS A;  4CKC A;  5C4X B;  3K5M A;  2EJF C;  5D14 A;  4YWK A;  5IYC H;  3CCU A;  1B1Z A;  2A8V A;  1BCP B;  2VQE L;  1EY0 A;  3BDL A;  4C1N K;  1Q8I A;  3BJU A;  2B2Y A;  2CQA A;  2VUM G;  2RSO A;  1I50 H;  2AQ1 B;  2DNE A;  4DV5 L;  1LTB D;  3S2D H;  2FXQ A;  2E2J B;  4AH6 A;  1E0B A;  5C44 B;  4F88 A;  1JJG A;  3VA7 A;  4A3E G;  1K3B C;  2EY5 A;  5C3X A;  4A4I A;  2E76 C;  1PZI D;  3SK6 A;  2QKI C;  1CKN B;  2Z8L A;  2D0O A;  1IL8 A;  4Z9C B;  4NDX A;  4PQX A;  2KHJ A;  3S1M H;  1EU4 A;  3UDF A;  4JI1 Q;  1YNN C;  4QUF A;  5C3E B;  3KJP A;  3ULJ A;  3BVZ A;  2E5L Q;  4HSP A;  2EYP A;  3F2B A;  3IFT A;  4LF9 Q;  4ALP A;  1STN A;  4BY1 G;  3GV6 A;  4KK7 A;  1NAP A;  2E8G A;  4DN4 M;  4OX9 Q;  3I4O A;  2B63 B;  1K8O A;  3DWP A;  2G9H D;  3C46 A;  1L0X B;  1WTX A;  2B8F A;  3HFZ B;  1HPC A;  5JJZ A;  5GAH C;  2I5L X;  2L0C A;  1HFN A;  2O5I C;  2VNU D;  3NBH A;  1E3P A;  3N52 A;  4R9W A;  1XJV A;  3S1R B;  4BBR H;  2OTJ A;  3L2P A;  4X65 Q;  3EA6 A;  1A0I A;  1F77 A;  4A3G B;  3F1Z A;  2NVX H;  2K01 A;  3AYH B;  4JYA L;  2OCE A;  4BXX G;  1SNO A;  4DPG A;  5E3F A;  1HNW Q;  1HNX L;  3T13 A;  3OHX C;  2E2H H;  1CHP D;  1E24 A;  2I0Q A;  1WTH A;  3K5N A;  3PUY A;  1KDC A;  2CH4 W;  4NXN Q;  2EXZ A;  2F3W A;  1BR9 A;  1H9K A;  1EIF A;  5D65 A;  1WTQ A;  1VQG A;  4RGT A;  4B3M Q;  1A3T A;  2K04 A;  3UDI A;  5CBA E;  3TP8 A;  1H9S A;  3RUZ A;  3K0Y A;  1QNU A;  1C8C A;  4ZCK A;  5LMN L;  2VL6 A;  1IW7 D;  1HZA A;  3CCV A;  3RNU A;  2JA7 G;  4TSS A;  2B2T A;  1S5F D;  4B9X A;  3T4A C;  1GM5 A;  4FYD A;  4DFA A;  2F0T A;  4YIJ A;  4EGV A;  4JBW A;  3GTL B;  3OOC A;  4P74 A;  3G6E A;  3J80 i;  3FRP B;  3S16 H;  3H3V C;  1X6O A;  1DD2 A;  2CHB D;  3MXU A;  4IUP A;  5EBD A;  2BDO A;  1RCV D;  2JA5 G;  4DV2 Q;  1MJE A;  1OXV A;  2AQ2 B;  4LF9 L;  1Z9F A;  4JK1 C;  3IL8 A;  2ZM6 L;  2K14 A;  1UWV A;  5C5L A;  5C4J B;  3H3V I;  1UUP A;  3TN2 A;  4K2K A;  4P2C B;  4DUY Q;  1YIJ A;  1H9M A;  2YYZ A;  1WVL A;  1CM9 A;  3NWT A;  4IFD I;  2XVS A;  1XNR Q;  1KC8 C;  2DNC A;  4DV6 L;  5T1I A;  4XXE A;  4JI3 Q;  1A15 A;  1KTK A;  3TSS A;  2HCC A;  3HOU B;  5JVH 3;  2F0D A;  4IUN A;  3J81 c;  5L37 A;  4RGM A;  2RCF A;  4F8M A;  3DM1 A;  1SR3 A;  3I4N H;  1CKO A;  2N78 A;  2X6L A;  4J1M A;  4H13 C;  3PF5 A;  3GTO B;  1HUN A;  1UAP A;  4KHZ A;  4XQQ A;  3TS0 A;  1AZP A;  4WJ4 A;  1IL2 A;  5LMU Q;  4JI6 Q;  3GTK B;  1D1I A;  2ALY B;  2MHV A;  4G7Z C;  3HOV B;  4KN4 C;  2DUD A;  2K03 A;  5IYB G;  4DUZ Q;  4B3T Q;  4LF7 Q;  3S15 B;  1LAC A;  4HJ9 A;  3OTO L;  4GS3 A;  1TVX A;  1IBL Q;  5IOC A;  1JOQ A;  3PUV A;  1ENC A;  2R7D A;  5AJ3 L;  3RN5 A;  1PTO H;  3L7Z C;  3EJI A;  3NP8 A;  1K9M C;  2DJF C;  4R8N A;  1YJW A;  2IY5 B;  1VQF A;  4FXD A;  2NTS A;  5CV4 A;  4LF8 Q;  4BY7 H;  4K6L A;  4UP7 A;  4ZKB B;  4UAI A;  1RJT A;  1LTR D;  2E74 C;  2ZTD A;  1R9T H;  1PH2 A;  1YHA A;  4GLV B;  4LNQ A;  1B50 A;  3V2T A;  2SEB D;  3S14 B;  1EYG A;  3S2D B;  5I2Y A;  5KNC A;  1M4V A;  4DV2 L;  4DR6 Q;  1IW7 C;  1EOT A;  4X3K A;  1SBB B;  1ESR A;  4I7A A;  5IIF A;  3DWQ A;  4HCE A;  4CJ1 B;  4DUY L;  5CMD A;  2SNM A;  4O2D A;  4WRD A;  2WFW A;  1RTO A;  1WCM G;  3S1M B;  1QE6 A;  4Y7N H;  1K8G A;  2NZH A;  5JEA H;  1O80 A;  2KEN A;  1Y1W H;  2WIN B;  2FHT A;  3MXN B;  2UUA Q;  4XIG S;  4A3B G;  5COR A;  1NNX A;  5BN3 A;  3ERS X;  1XNQ Q;  2M9V A;  4A76 A;  3NEL A;  4JI4 Q;  2HCI A;  1LT5 D;  3EFX D;  1GJX A;  2L12 A;  4B3S L;  1H9J A;  1HRJ A;  4JI7 L;  2R93 B;  1I4G A;  5CGK A;  5KIX A;  3PIO 3;  4YWM A;  4PZ8 A;  5LMU L;  2OQK A;  3AEV A;  1F9R A;  2LS0 1;  3A54 A;  4JI0 Q;  4A3J G;  5FLX L;  4C56 C;  3T1H Q;  1NY4 A;  2PW5 A;  3PO3 G;  4A3L G;  2KHS A;  3GV3 A;  5M5Y B;  1D1K A;  4A3C G;  2A74 C;  2A1A A;  4P71 A;  2NVX B;  1VQL A;  1SMX A;  4X66 Q;  1GO3 E;  1Y8O B;  1SNC A;  2KUM A;  2G5D A;  4MIU A;  4ZQ3 A;  4C3J H;  3CCR A;  5M3F G;  3I7F A;  4A3I H;  3NEN A;  3OWE B;  3NK9 A;  1PH7 A;  2E2H B;  4OXP A;  2KVM A;  2HIX A;  4Q0F A;  3NTI A;  4JI2 L;  1ZEQ X;  3M9B A;  2BDN A;  1JE4 A;  4K5W A;  3MEF A;  2B2U C;  1L1O C;  2F0J A;  4HTH A;  1TWG H;  4R4I A;  2JA6 B;  1QZG A;  1VQD A;  2OXP A;  4O42 A;  4DR1 Q;  2HUG A;  3Q22 A;  3G48 A;  2R7Z H;  2WB1 B;  4B08 A;  4DNT B;  3NTK A;  5ELN A;  5K5P A;  1MIU A;  5C0X I;  3NTH A;  4HJ5 A;  4R1J A;  1X3P A;  5CYU A;  5DAU A;  3I55 A;  1UE6 A;  1EL0 A;  1FR3 A;  1TT2 A;  2B2U A;  2WKC A;  3UE1 A;  3CPW A;  3GO5 A;  5TSS A;  4DV4 L;  3KF6 B;  3S16 B;  4KI0 A;  5GRO A;  5C4X H;  3KLS A;  1VCI A;  2BCO A;  2NVY H;  1PYS B;  1RTN A;  1KIX A;  4GLX A;  1PH6 A;  1G6P A;  2B8G A;  2F0E A;  4N8X 1;  3OIP A;  4NP5 A;  3U4V A;  3SHL A;  2UU9 L;  2Q8R E;  4I7Z C;  1VQ9 A;  2NYZ D;  4IOC A;  4X62 Q;  2K5N A;  5FLM H;  1X65 A;  5C44 H;  1BKB A;  2F0L A;  2QEX A;  1STH A;  1RDP D;  1FGB D;  2L15 A;  2PI2 A;  2RDF A;  3K5L A;  3BDC A;  2K05 A;  3RZO B;  4FNF A;  2ASB A;  2ES2 A;  4K0K L;  4J15 A;  3NQI A;  1VQC A;  2PYK A;  2WAQ G;  2JN4 A;  3FP9 A;  1FJG Q;  1K28 A;  4BY1 H;  1JJ2 A;  1W3S A;  3JAM i;  1KAW A;  4RH6 A;  3KDF A;  4XTC S;  3D0F A;  3J7A 5;  3VR6 A;  3I4N B;  1NUC A;  4IUT A;  4DF7 A;  5G3L D;  4DK3 C;  4O0A A;  1S5B D;  5LMN W;  4EVO A;  2LMC B;  3K6O A;  3E9I A;  1N9W A;  3B6Y A;  2L1B A;  4KJN A;  1ONL A;  3P7J A;  1B3Q A;  5FLX c;  1LV9 A;  3I70 A;  4HJ7 A;  4RCO A;  4CKB A;  4DV0 L;  3MAQ A;  4RHR A;  4RKL A;  1JC7 A;  1SE3 A;  1N34 Q;  3S1R H;  2WB1 E;  4JCV E;  1WOC A;  4DV7 L;  1YIT A;  1PTO B;  1YVC A;  4DNR B;  1ILP A;  3ONA B;  4A3G H;  5CV6 A;  1B3A A;  1JCK B;  3RN2 A;  3IRB A;  4RA8 A;  2KED A;  5DLQ E;  4GNX C;  1QCB D;  3SXH A;  3G71 A;  1S40 A;  1PFS A;  3RD4 A;  1DON A;  1R9T B;  4DR7 L;  1DJR D;  3K7U C;  2RDH A;  3KLW A;  2NWG A;  1EY8 A;  4IO9 A;  3U58 A;  3DM3 A;  2H1E A;  4IQZ A;  4FXK C;  3SR1 A;  4RCN A;  4IUV A;  1T5E A;  4GNX A;  1PH1 A;  1LTT D;  1Q90 A;  2K5W A;  2WKD A;  1Y1V G;  3TP7 A;  1IHZ A;  2NZ1 D;  2CH4 A;  1SYE A;  1FVI A;  3ERQ A;  4AYB E;  3K58 A;  2HQE A;  1TR5 A;  3K59 A;  2JA5 H;  2CFM A;  5COY A;  2LKV A;  5I4D A;  4QIW B;  2L55 A;  1N32 L;  3RR5 A;  4IUR A;  4Y7N B;  2VQE Q;  3G7L A;  3SVM A;  5CV8 A;  4K2L A;  2JA8 G;  3AFP A;  3UDG A;  4DV5 Q;  4LF6 L;  4JV5 Q;  4G7H C;  1W2B A;  1GHJ A;  3M4Y A;  4IJL A;  1O7Z A;  1H9R A;  1ENF A;  5HUR A;  2H5X A;  4CDE C;  5C4J H;  5IT9 L;  5FJ8 G;  1RHP A;  4GOP A;  4ID6 A;  1CQF A;  3A56 A;  1TWF B;  3P75 A;  3CCQ A;  4A3D B;  1PRT B;  2XN9 C;  4YCU A;  4OWT B;  1I4H A;  2MPM A;  1WYD A;  4CJ2 C;  1STA A;  4ZYS A;  4A3F G;  3HOU H;  1E2W A;  1SYG A;  1BBW A;  1N34 L;  1NCV A;  3K8A A;  1CZG A;  3BVM A;  4HMJ A;  2IJ0 A;  3LGJ A;  4C3J B;  1WI5 A;  4IOA A;  1B2T A;  2Z6B A;  3HKS A;  4DA2 A;  1I6H B;  1K0S A;  3BS1 A;  3GTO H;  3D4W A;  4LW1 A;  3CCM A;  2PZU A;  1H95 A;  2AKW B;  1RIP A;  3KF8 B;  1B7Y B;  4DK6 C;  1F2L A;  4XQN A;  3PO2 G;  5LL6 S;  1O78 A;  4KKU A;  1BCP F;  1I4P A;  1QNK A;  2K5V A;  2AWO A;  3I90 A;  4YCW A;  2VW9 A;  1V1P A;  4U68 A;  5FO8 B;  1D6E C;  4C3H G;  4POG A;  1HZC A;  1YEZ A;  4TQU S;  1VQI A;  4JYA Q;  3CD6 A;  2F0U A;  2XGT A;  1GUG A;  1HZB A;  1JOK A;  4HIK A;  2B2Y C;  1CQV A;  1SSO A;  1YNJ C;  2F0W A;  5IWA L;  1SEB D;  1U0L A;  1HNX Q;  1VDZ A;  1KL9 A;  4QY7 A;  2KCC A;  2I5M X;  2VUM B;  1CA5 A;  3TDQ A;  1UNS A;  1UE5 A;  2NVY B;  3TRE A;  1D5X C;  2A68 C;  4QIW E;  3VR2 A;  2RVL A;  4YY3 L;  1CI3 M;  1QIL A;  4FF2 A;  2X69 A;  3BZC A;  4A3E B;  2BE5 D;  1YBY A;  2Y0S E;  1JB7 A;  1EIH A;  2NN6 H;  3S14 H;  5LMN Q;  1VQ7 A;  3HKZ E;  1ZXT A;  4JV5 L;  1VQJ A;  3TZD A;  1XPU A;  2K7V A;  1EWI A;  2RQX A;  4AQY L;  5KGU A;  3PIO A;  5AFW A;  2YTX A;  1BVS A;  1WCM H;  5HGQ A;  1XMO L;  3N6R A;  1BUV T;  4IPD A;  5BN5 A;  1Q86 C;  2CWP A;  4KKS A;  1V8Q A;  3CKI B;  4BBS G;  5I9P A;  5IYD G;  4BY1 B;  5K36 G;  1BBU A;  1EFW A;  2RBM A;  1RF2 D;  1PYB A;  3PV0 A;  3LWU A;  4L63 B;  2C9O A;  4OIJ A;  2IX1 A;  1XWE A;  4GN3 B;  1CSP A;  4YHH L;  2JA9 A;  1EY6 A;  2LXJ A;  3J81 L;  2HHH L;  3U9O A;  2ZM6 Q;  3OW2 A;  1STB A;  1BNZ A;  1KNE A;  5IT9 c;  2PW7 A;  4CDC C;  4A3J H;  1EQV A;  3T53 B;  3PO3 H;  4A3L H;  1CKN A;  4WJ3 M;  1NE3 A;  4L5R C;  2QDB A;  5T1G A;  2R93 H;  3NWS A;  4A3C H;  4OON A;  3R2I A;  2WV6 D;  4DV6 Q;  1T9H A;  2JXM B;  4GKK Q;  2EJG C;  5M3F H;  1GHK A;  3FKI H;  1JWM D;  1MKH A;  5M5Y H;  1CT1 D;  4BWG B;  4CHT B;  5HY6 A;  1B44 D;  5M5W B;  3DHQ A;  3A0J A;  2KBN A;  5IP9 G;  4CJ0 B;  1K83 B;  3HEJ A;  1I5F A;  1OXT A;  1C7Y A;  2DGY A;  2B2T C;  3SDZ A;  1RD9 D;  2F0M A;  1HR0 L;  2A6E D;  1KHI A;  4QUC A;  5I2X A;  3OTO Q;  1NJI C;  2JA7 B;  4MZ9 A;  1I4Q A;  1HNZ L;  2UUC Q;  3CPF A;  2ZJQ A;  2JA6 H;  4R4C A;  4JW0 A;  2R61 A;  5CBE E;  5AJ3 Q;  3R93 A;  1GUO A;  2L11 A;  1C0A A;  3KYH C;  2JE6 I;  2Q8T A;  3IAY A;  1D5Z C;  5C4Z A;  1E2V A;  4KLK A;  2PMZ B;  2JA5 B;  1J8I A;  3AFQ A;  2B29 A;  2F0O A;  4JI5 L;  1F2M A;  5IP7 G;  1Z6H A;  3HRZ C;  5I6W A;  1JQY D;  1HTP A;  4ODG A;  2PQE A;  3F2U A;  1VF5 C;  2BE5 C;  3OWF A;  5KRU A;  3BYY B;  3A7L A;  1SN8 A;  2N8N A;  3KJO A;  2B3G A;  1KDB A;  1F2Y A;  2CW0 C;  5FK9 C;  5IE8 A;  5GAD C;  3TP5 A;  1CSQ A;  2LFN A;  4DAV A;  1VQM A;  3J81 j;  2LXK A;  4L5S A;  2RKS A;  4L5Q A;  4CDF C;  1JWU D;  1J9O A;  1SAP A;  2M00 A;  3RZO H;  4A3K G;  1G29 1;  3HGB A;  4H02 A;  3G6J B;  1E22 A;  2HQL A;  4GKK L;  1JE5 A;  4IFD G;  1EZ6 A;  4RGN A;  4XT1 B;  2CVR A;  1Y14 B;  2ZJR A;  3H0G G;  1IBK L;  4B3S Q;  1BXT A;  4X64 L;  2IT1 A;  5DM7 3;  2EXD A;  4JI7 Q;  3GTJ B;  2QA4 A;  1M8A A;  4KTA A;  3G4S A;  1EY9 A;  3H6M A;  1Q1B A;  2FIN B;  1CUK A;  1EEI D;  2EYF A;  2XNA C;  4NXM L;  2A5H A;  3VYU A;  1I3Q H;  2UUB Q;  3J80 L;  4HSV A;  1VQE A;  3J81 E;  4C3I G;  1EQR A;  3MFG A;  2UUC L;  1SE2 A;  1A2T A;  2J0T D;  3X3M A;  1QVC A;  2K28 A;  2PQA B;  1YHQ A;  4HR7 B;  2UXB L;  1JT8 A;  2K5D A;  1G2T A;  4LF4 L;  5EJW A;  2IX3 A;  2MNA A;  1MSH A;  2PMZ E;  3LNN A;  4JI2 Q;  1K8M A;  1TWA B;  3CCJ A;  2JEA I;  3CCE A;  1HJP A;  3ER0 A;  4U67 3;  3URY A;  1SE8 A;  1X3F A;  1FYC A;  2A6E C;  3HOV G;  2M2L A;  3K81 C;  3W5O A;  1AP0 A;  3F8T A;  3RZD H;  4EX5 A;  4IN3 A;  3E5S A;  3A7A B;  4X3T A;  2NVT H;  1ASZ A;  4DR2 Q;  2FJ2 A;  4V19 0;  2JK8 A;  1PA6 A;  2XTI A;  4LF5 L;  1PZK D;  4ZAI A;  3VR4 A;  3TEH B;  1KAA A;  2YTV A;  4DAY B;  1WCM B;  2Z1C A;  2B2V A;  4K5V A;  1MHW C;  1SE4 A;  2BA0 A;  2EYJ A;  5CV9 A;  2XWJ B;  4DV4 Q;  4UP8 A;  4GKJ L;  1HXY D;  2JA8 H;  1NMF A;  5ELO A;  3CC2 A;  4A3B B;  4OO1 H;  1A6X A;  5DM6 3;  1DXM A;  1X3E A;  2ID0 A;  4J6H A;  4DR4 L;  1DOM A;  1OXS C;  5KNB A;  4LFC L;  1F9P A;  1TWH H;  1ZYR D;  1HQR D;  3J7A F;  1LUZ A;  3HOZ G;  1ICF B;  5FJ8 H;  2K33 A;  2UU9 Q;  2I46 A;  1EFI D;  3X3N A;  1E1T A;  3F2D A;  1QZH A;  4LK1 C;  4ZUJ A;  4TKO B;  4A3J B;  3PO3 B;  3D4R A;  2NUC A;  3WDN A;  3CP0 A;  4WOR A;  4KKT A;  4K0K Q;  5C0X J;  3NSW A;  1EIG A;  4A3F H;  3UDX A;  4XQJ A;  2TSS A;  1X54 A;  3E6Z X;  3EN2 A;  3FEW X;  2RA4 A;  1TWF H;  4IUQ A;  4A3D H;  2UUB L;  5M3F B;  4MHE A;  3FKI B;  3K7A H;  1FNV A;  1N33 L;  2TMP A;  1LTG D;  3MXN A;  4RG1 A;  2R92 G;  3OW7 A;  1ET9 A;  2EIF A;  4CGY B;  2IL8 A;  1W6K A;  2QEJ C;  1GUW A;  2MO1 A;  1P8L A;  1EY4 A;  2Z6K C;  4X3U A;  1YHB A;  3K0X A;  1TWC H;  1I6H H;  1G6Z A;  1D8L A;  4C3H H;  4TRD A;  4OIK A;  2K32 A;  5IGB A;  3PIP 3;  5M3M G;  5C5M A;  3J80 c;  2WP8 J;  2UXD L;  1KAB A;  3V05 A;  1C9O A;  2YV5 A;  3A8K E;  4DV0 Q;  2RF4 A;  2BH2 A;  4LFA Q;  4GZY C;  3MXG A;  3OYY A;  1SNM A;  3GQB A;  2FFK B;  4LAA A;  2Z6K A;  4DV7 Q;  4UP9 A;  3GD7 A;  3GP7 A;  4Y52 H;  2NB0 A;  3NE5 B;  4BBR G;  4DR2 L;  1Y69 U;  2AHO B;  3T1Y Q;  4R4Q A;  1L1O B;  2A73 B;  3GTG H;  1WTW A;  3QOJ A;  1X9N A;  3EQL C;  3L0O A;  4FP5 D;  1IYJ B;  4PMC A;  4DR5 L;  3J80 E;  2O2L D;  5EBC A;  1AEX A;  5C0X G;  2JSO A;  4DR7 Q;  2L4N A;  3A8J E;  2VUM H;  3MWY W;  3Q23 A;  4DV3 Q;  1EWH A;  3I73 A;  1I4X A;  1KDA A;  1VS0 A;  4F7X A;  5I9O A;  2F0G A;  4XDX A;  2PNH A;  4HIO A;  1WTV A;  4A3E H;  5KND A;  4NPS A;  2KEC A;  1WD1 A;  1OXU A;  5E4W C;  4KY6 A;  4BBS H;  2PO4 A;  2WAQ B;  3I2Z A;  1IBM L;  1Q81 C;  5IYD H;  1AW7 A;  5J3B A;  3NBI A;  2EDG A;  3M4P A;  3WWV A;  3HOW G;  1N8R C;  5JOB A;  4HN7 A;  1MD2 D;  1VQH A;  1GUN A;  1MJC A;  3SE0 A;  2HDM A;  1N32 Q;  2D0P A;  3D6W A;  5ISR A;  1PZJ D;  5KYL A;  5IGC A;  1ROD A;  1EY7 A;  1HR0 W;  1LT3 D;  1QWY A;  1ZYR C;  4LF6 Q;  4RFB A;  2NVQ H;  3TP6 A;  1BO0 A;  2N88 A;  4MN3 A;  1PTO F;  3NPP A;  3UI2 A;  5ELE A;  2KCM A;  1DGS A;  3I4M G;  3R3O A;  4ULL A;  3TRZ A;  4IPC A;  1LTL A;  3E9H A;  1A8V A;  4K5X A;  4HID A;  4AYB G;  3CCS A;  2CKZ B;  2EJM A;  3VYR A;  3VR3 A;  1Z7T A;  3C1E A;  1ICW A;  1I3Q B;  1D5M C;  3EBE A;  5E7N A;  3D6C A;  1LTA D;  2Z4I A;  4EQN A;  2YTY A;  2AQ3 B;  2ZTE A;  3PMF A;  4OWW B;  1LLR D;  4LFA L;  1GUT A;  4KY7 A;  2D5D A;  4BXX H;  3BG3 A;  3MC0 B;  3M7N A;  3QWN A;  4UY8 C;  2B39 A;  1X3Q A;  3J7Z C;  1TS5 A;  5FOB B;  4DGZ A;  1I94 L;  3MXP A;  2KOL A;  3VYS A;  1CA6 A;  3NXW A;  4RGO S;  3T1Y L;  2V1C C;  1XX8 A;  3LWE A;  3I4N G;  1YNJ D;  1VQK A;  2WAC A;  5M5W H;  3GDE A;  5EPL A;  1OO9 B;  1SYC A;  3OMG A;  4L8J A;  3L3O C;  1W6J A;  3NHH A;  1K83 H;  3P20 A;  5FLX E;  1XXG A;  3M4Q A;  1KNA A;  4YCV A;  1NBW A;  5EGT A;  2A68 D;  1ET6 A;  5A2Q L;  1Y1V B;  1SNP A;  4DV3 L;  2EYM A;  2IWH A;  3RZD B;  1CFM A;  2A6H D;  1PH8 A;  4GNX B;  2JA7 H;  2NVT B;  2ZXP A;  5JEA J;  1PXU A;  1BDO A;  4BA2 I;  2FMC A;  3J7A V;  4A3M G;  1BCP D;  2K75 A;  5LHY 1;  3JAM L;  3GTM H;  1QUQ B;  2WAQ E;  5ELD A;  2D9U A;  2EE1 A;  3CCL A;  4MTN A;  2ZXR A;  5IWA Q;  2F52 A;  1CK1 A;  5CV7 A;  1KLG D;  1EY5 A;  4DR3 L;  1VMC A;  2JA8 B;  1IKM A;  1TY0 A;  2L9H A;  4GLA C;  1U4M A;  1JR0 D;  1PH3 A;  2KEE A;  3M3Y H;  1LT6 D;  5J39 A;  4YY3 Q;  5ELB A;  4BY7 G;  1DOL A;  2A69 D;  3OSO A;  1HA6 A;  4IAL A;  1PRT F;  1YZ6 A;  5EAY A;  2K6A A;  1TWH B;  4C2M H;  4GOP C;  1FNU A;  2Q8I B;  4IPG A;  4QF4 A;  1WD0 A;  1EYD A;  1YNX A;  4AQY Q;  1WTP A;  1X32 A;  2RHQ B;  3F2C A;  2RCN A;  1XMO Q;  2B2W C;  1LTS D;  4A3K H;  3H3V H;  4OO1 I;  1J5E L;  3A5Z B;  4R4T A;  1EQT A;  3SK4 A;  4ZLT F;  4R4O A;  2F0I A;  3FHW A;  5CV5 A;  4K8J A;  2RDG A;  4PV1 C;  4A3F B;  4FVM A;  3C2P A;  3KBX A;  3ICE A;  4NW2 A;  3DMU A;  3H0G H;  3K7A B;  4A93 G;  3FMC A;  4YHH Q;  4V0B A;  5JEA G;  2B2W A;  1Y1W G;  2HD3 A;  2HHH Q;  2X6G A;  1TS3 A;  2Y0S G;  3PO2 B;  1STY A;  4C1N I;  3W2D A;  1TWC B;  5IYB H;  3KBG A;  3HKZ G;  4JBK A;  3VYT A;  3GTJ H;  1PH5 A;  2Q2T A;  4C3H B;  4C3I H;  1DM0 B;  4RAU C;  1ILQ A;  4HMI A;  2BA1 A;  3CRL C;  1QB5 D;  2ZJP A;  2I5H A;  2GVB A;  2GVA A;  1VQA A;  3GTQ H;  3A55 A;  1RL2 A;  2AWN A;  2N55 A;  1QVG A;  2Z9H A;  2UXC L;  4DK0 A;  2XIW A;  4G57 A;  2K4K A;  2O5J C;  1MSG A;  3FVQ A;  4DXG A;  4EQO A;  2EYO A;  2O4X A;  3M85 A;  4DNI A;  3GTG B;  3MZ5 A;  1LO5 D;  2K5Q A;  3S24 A;  4C3J G;  1VMP A;  1EYA A;  2F03 A;  1B53 A;  4A3I G;  4A75 A;  3KF8 A;  1EQQ A;  1TWA H;  4CKE A;  2VS1 A;  1UEB A;  3TZU A;  1HR0 Q;  1N36 L;  3J81 i;  1VQP A;  1HNZ Q;  3ND8 A;  5FO7 B;  3NQT A;  2A6H C;  1LYL A;  5D3I B;  2LSS A;  5ELF A;  3CF5 A;  3JAM c;  1BCP C;  4FDB A;  4HED A;  5GAG C;  5IOD A;  4BBS B;  4LFB L;  2IPK D;  2R7Z G;  1BOS A;  2CW0 D;  4JG2 A;  1GXD C;  3HOY G;  1GOZ A;  4JI8 Q;  4DV1 L;  2ENB A;  1PMR A;  4TVA B;  3HOX G;  1JOR A;  5A2Q E;  2F0N A;  3S17 H;  1II3 A;  1K8A C;  5J22 A;  2K5H A;  3HOZ H;  5KEE A;  4JI5 Q;  4X3S A;  2VQF L;  4A3B H;  2SDF A;  5C4X G;  2A69 C;  1G51 A;  2RSN A;  2EQS A;  3JAM E;  3W1B A;  5JVG 3;  3TQY A;  2NVQ B;  4MNO A;  1PVO A;  4KHP L;  5EKK A;  1O7L A;  3M4O H;  1R4P B;  3S1N B;  1GVP A;  2GA4 B;  4PZ6 A;  1Q3L A;  1PH4 A;  4ILW A;  2QCP X;  3SK8 A;  5BR8 Q;  1TII D;  3PIP A;  4G4K A;  5FLM G;  4QGU A;  4ME5 A;  5C44 G;  3MEH A;  4HAE A;  1X56 A;  1D2B A;  1Q46 A;  2DN8 A;  4XYO A;  3NBH B;  2R92 H;  3SK5 A;  1T5X D;  3O13 A;  1KLU D;  3JC6 6;  3ULP A;  1SFO H;  1VQ6 A;  1EUJ A;  3D3R A;  4N8F A;  1A3V A;  1UE1 A;  4XT3 B;  1D7Q A;  5KYI A;  5C3E G;  1IBK Q;  1PYW D;  3H91 A;  3QJY A;  3U9S A;  1OXX K;  1R4Q B;  5IT9 E;  4APV A;  4X64 Q;  5M3M H;  4RHS A;  4OGQ C;  1LAB A;  2FMM A;  5FKA C;  1HH2 P;  3PGZ A;  4B3R L;  2KA7 A;  3H94 A;  3MHB A;  4NXM Q;  3I72 A;  3U50 C;  4KMU C;  1K3R A;  2N49 A;  3K80 C;  2B63 G;  1TS4 A;  4OHJ A;  2XWB B;  1NSN S;  1WJJ A;  1H9S B;  4IZ8 A;  2BH8 A;  1YJN A;  3GTM B;  4IFD J;  2UXB Q;  1TKW B;  5C0X H;  1O7Y A;  4FO2 A;  4FXG C;  1IXR A;  2IX0 A;  4LJZ C;  4LF4 Q;  1KD1 C;  3V96 A;  4A3G G;  4JI8 L;  5C6A A;  1LT4 D;  3S1Q B;  3A74 A;  3RMH A;  1SRO A;  3M3Y B;  1S4Z A;  3TBI B;  5C3W A;  4DAM A;  3RLF A;  1YJ9 A;  2OQ0 A;  1PFM A;  3SGI A;  1XYI A;  4C2M B;  1Z47 A;  3LX0 A;  5A35 A;  4QL5 A;  1TQO A;  3RLN A;  4ZKC B;  2EYL A;  4GN5 A;  3FPU B;  3I4L A;  2L5T A;  1SMY D;  3E0E A;  3HOW H;  4LF5 Q;  2E2I H;  1I6V C;  1K73 C;  1S5D D;  1GUS A;  1VF7 A;  4PMW A;  4KJO A;  4A3K B;  1VQO A;  4UDU C;  2C5C A;  5BR8 L;  5F2D A;  4GKJ Q;  2Q2H A;  5BN4 A;  5M5X B;  1CTM A;  1QG7 A;  1U4P A;  2OEO A;  1SJH D;  4ABN A;  1L2F A;  4PMB A;  3CMA A;  1A63 A;  1UEA B;  4DR4 Q;  3S2H B;  4JI1 L;  3H0G B;  2F4I A;  3ZJY C;  4LFC Q;  1G8Z D;  3NEM A;  2MFI A;  2RHS B;  4FF1 A;  1A2U A;  3I4M H;  1IZ6 A;  2E5L L;  4CBV A;  1FL0 A;  2OWO A;  1B70 B;  4E6I A;  4KN7 C;  4P72 A;  3PCO B;  1ENA A;  1IYV A;  4PZ7 A;  1B8A A;  1HFG A;  2H4O A;  3KK7 A;  4NB3 A;  4OX9 L;  1S72 A;  2DJG C;  2HDL A;  2A19 A;  3WOF A;  1BBX C;  1STE A;  2K52 A;  4HCS A;  1F9S A;  4ZUI A;  2AUJ D;  3Q6S A;  4IPH A;  3AB9 A;  1J6Q A;  2F3V A;  4EQP A;  4C3I B;  2QDL A;  1I4R A;  2F0H A;  5FO9 B;  3CRK C;  1S3O A;  4JPB W;  2KHI A;  1V1O A;  3T51 B;  5E1F A;  4POF A;  3GTQ B;  1JIC A;  1N33 Q;  1X55 A;  2ICI A;  4X65 L;  3HP3 A;  2MUY A;  3AQQ A;  3I91 A;  3MA2 B;  3Q8D A;  1Q1E A;  3ITP A;  1ASY A;  1VQ5 A;  3HOU G;  4KD4 A;  5JJL A;  5EQ0 A;  3CQZ B;  1WTR A;  1M90 C;  4N9T A;  1HNW L;  4RWS C;  3VA5 A;  2D62 A;  4JBJ A;  5JJK A;  3FDT A;  4LUO A;  3L9A X;  4NXN L;  1SND A;  2UXD Q;  3T16 A;  4J8Q A;  1SXT A;  2B2V C;  4A3M H;  4DXF A;  4B3M L;  1SJE D;  3QG1 A;  2KQ3 A;  3Q24 A;  1Y1V H;  2EPB A;  1AH9 A;  2F0P A;  2VXW A;  2PQA A;  3VR5 A;  1STG A;  2YU9 H;  3TS2 A;  2P5Z X;  4DKA C;  2XSC A;  4DR5 Q;  2J7Z A;  2R7F A;  4O1N A;  3S17 B;  4WFN 3;  3HOZ B;  2KCT A;  1EIY B;  1E7Z A;  2IHE A;  4R8I A;  1WTO A;  1I50 B;  1Q7Y C;  2VY3 A;  4KY5 A; 
#chains in the Genus database with same CATH homology
 2NN6 I;  2MGS A;  3KLS X;  4H0L C;  2OF1 A;  3M4O B;  1SMY C;  1XTC D;  3HG9 A;  2DY8 A;  1JB3 A;  2ICE C;  4N9P A;  1MBY A;  2NN6 G;  3P1H A;  4K14 A;  1L0Y B;  1PLF A;  4DAY A;  3T56 B;  3AMU A;  1DYQ A;  1HTL D;  1AFP A;  3CHB D;  1CHQ D;  2R92 B;  3W3A A;  1SFO B;  2SNS A;  3C3L A;  3OIQ A;  2R3Z A;  1EWC A;  3Q0A A;  2D2C C;  3DWA A;  3MTS A;  4K6D A;  2KCN A;  5M3M B;  1EEF D;  5IGE A;  1PTO D;  3ND9 A;  3EVQ A;  1SYF A;  3PUZ A;  4BBR B;  3IFD A;  4QMG A;  2NTT A;  4ZK9 B;  2ZXO A;  2PZT A;  2JYO A;  1ESF A;  3I8Z A;  5J1Z A;  5IGD A;  4H7B A;  1G2S A;  2NBF A;  3KUP A;  2KJX A;  4LMQ D;  5HGT A;  4KHV A;  3TME A;  3DEO A;  3R2T A;  4DU9 A;  2F0V A;  1EU3 A;  5DEH A;  2VB2 X;  4DAP A;  1Y8N B;  1PDQ A;  3HOW B;  1ML0 D;  2MJ8 A;  2E2I B;  3A8I E;  2Z4H A;  1RKN A;  1B9N A;  3FPP A;  2I07 B;  1CZW A;  1FD7 D;  4L6T B;  2E75 C;  2F0K A;  1U9R A;  5K36 H;  3CU7 A;  4RKB A;  4I65 A;  2PNR C;  1G91 A;  1SDF A;  1B9M A;  5DNF A;  4M8A A;  5JPN C;  3I4M B;  4BS9 A;  2J4X A;  5C4H A;  2MP1 A;  1EYC A;  1PFN A;  1PRT D;  2VB3 X;  4AYB B;  3DUZ A;  2EY1 A;  3HZX A;  1BF4 A;  1EZ8 A;  3C1F A;  5CR3 A;  4G7O C;  1BQQ T;  2QF7 A;  1LTI D;  4BA1 I;  5M9O A;  4KV6 A;  1IYU A;  5JAV A;  2JP1 A;  3D8G A;  5I6Y A;  1B4O A;  4NKL A;  3MFY A;  1E2Z A;  5E4X A;  5LL6 X;  1QJO A;  1TU2 B;  1PTO C;  2EY2 A;  1S5C D;  3KLR A;  4A3M B;  4WJW A;  5EKI A;  1TY2 A;  2PZW A;  5EPJ A;  5D3D A;  4B9W A;  2G9D A;  4IUU A;  1FNW A;  4KD3 A;  3WOE A;  3ZYY X;  1HCZ A;  1A3U A;  1HHV A;  2F1M A;  3K5O A;  1C48 A;  1U4R A;  3BYT B;  2YU9 B;  4ZRZ A;  1F2Z A;  2SOB A;  3DXJ C;  4BY7 B;  5JPM C;  3BZD B;  3J7Y W;  3K57 A;  3OPO A;  4QB4 A;  3R8B A;  3M7G A;  5IGF A;  4QCL A;  1Y8P B;  2LY7 A;  3I3C A;  4FF4 A;  3H09 A;  1HA5 A;  3HS0 C;  5IGG A;  3BVG A;  1HUM A;  1TS2 A;  2EY6 A;  5CC4 A;  2R6G A;  1SYD A;  3QOL A;  2F0Q A;  4K8I A;  3OMC A;  4H44 C;  4A93 B;  1QOH A;  2AUK A;  2K1B A;  3NUC A;  1IKL A;  4F87 A;  1AZQ A;  1SNQ A;  1Y1W B;  1YNN D;  2PPB C;  2EOT A;  1JOO A;  4IFD H;  2Y0S B;  3E0J A;  5G3L F;  4OO1 G;  4M1U B;  3SEB A;  3HKZ B;  4NMZ A;  3IKJ A;  2V4D A;  4S3S A;  4FF3 A;  2QIL A;  4PNY A;  1PRT C;  2F0S A;  1NR2 A;  1MI2 A;  1JWS D;  1U4L A;  2XRS D;  3DEP A;  2E2D C;  1Q12 A;  4Q5V A;  3S9W A;  2JEB I;  1DCZ A;  3QO2 A;  1V1P B;  3GTP B;  2EVB A;  1MGS A;  2WII B;  1ZKO A;  2IW3 A;  4A3I B;  2ZT9 C;  5NUC A;  2F0F A;  3BDO A;  1V43 A;  3AU7 A;  1AN8 A;  2OT2 A;  3PUW A;  5EKL A;  1S5E D;  1SYB A;  4DK1 A;  1TWG B;  3PUX A;  5EPK A;  2XRQ D;  1HQM C;  3D4D A;  2R7Z B;  3ERO A;  1DZ1 A;  1PFB A;  4OL7 A;  1NR4 A;  3HOY B;  3MVV A;  2EZV A;  2DY7 A;  2PCF B;  3HOX B;  1F9Q A;  3QIA A;  2EYH A;  3QB3 A;  3D31 A;  4XYQ A;  1DOK A;  5ELC A;  1C4Q A;  2BOS A;  4CKC A;  5C4X B;  3K5M A;  2EJF C;  5D14 A;  1B1Z A;  1BCP B;  1EY0 A;  3BDL A;  4C1N K;  1Q8I A;  2B2Y A;  2CQA A;  2RSO A;  2AQ1 B;  2DNE A;  1LTB D;  2E2J B;  1E0B A;  5C44 B;  4F88 A;  3VA7 A;  2EY5 A;  5C3X A;  2E76 C;  3SK6 A;  1PZI D;  2QKI C;  2Z8L A;  1IL8 A;  4Z9C B;  4NDX A;  4PQX A;  1EU4 A;  5C3E B;  1YNN C;  4QUF A;  3BVZ A;  4HSP A;  2EYP A;  3IFT A;  1STN A;  3GV6 A;  4KK7 A;  1NAP A;  4DN4 M;  2B63 B;  1K8O A;  3DWP A;  2G9H D;  3C46 A;  1L0X B;  1WTX A;  2B8F A;  1HPC A;  5JJZ A;  2L0C A;  1HFN A;  2O5I C;  2VNU D;  3NBH A;  3N52 A;  4R9W A;  3S1R B;  3EA6 A;  1F77 A;  4A3G B;  2K01 A;  1SNO A;  5E3F A;  3T13 A;  3OHX C;  1CHP D;  3K5N A;  3PUY A;  1KDC A;  2EXZ A;  2F3W A;  1BR9 A;  1H9K A;  5D65 A;  1WTQ A;  4RGT A;  1A3T A;  2K04 A;  5CBA E;  3TP8 A;  1H9S A;  3RUZ A;  3K0Y A;  1QNU A;  1C8C A;  1IW7 D;  4TSS A;  2B2T A;  1S5F D;  4B9X A;  3T4A C;  4FYD A;  4DFA A;  2F0T A;  4YIJ A;  4EGV A;  4JBW A;  3GTL B;  3OOC A;  3FRP B;  3H3V C;  1DD2 A;  2CHB D;  3MXU A;  4IUP A;  5EBD A;  2BDO A;  1RCV D;  1OXV A;  2AQ2 B;  4JK1 C;  3IL8 A;  5C4J B;  5C5L A;  1UUP A;  3TN2 A;  4K2K A;  4P2C B;  1H9M A;  2YYZ A;  1WVL A;  1CM9 A;  3NWT A;  4IFD I;  2XVS A;  2DNC A;  5T1I A;  4XXE A;  1A15 A;  1KTK A;  3TSS A;  2HCC A;  3HOU B;  5JVH 3;  2F0D A;  4IUN A;  4RGM A;  4F8M A;  3DM1 A;  2X6L A;  4J1M A;  4H13 C;  3GTO B;  1HUN A;  1UAP A;  4KHZ A;  4XQQ A;  1AZP A;  3GTK B;  1D1I A;  2MHV A;  4G7Z C;  3HOV B;  4KN4 C;  2K03 A;  3S15 B;  1LAC A;  1TVX A;  5IOC A;  1JOQ A;  3PUV A;  1ENC A;  1PTO H;  3L7Z C;  3EJI A;  3NP8 A;  4R8N A;  4FXD A;  2NTS A;  5CV4 A;  4K6L A;  4ZKB B;  4UAI A;  1RJT A;  1LTR D;  2E74 C;  1B50 A;  3V2T A;  2SEB D;  3S14 B;  3S2D B;  5I2Y A;  5KNC A;  1M4V A;  1IW7 C;  1EOT A;  4X3K A;  1SBB B;  1ESR A;  5IIF A;  3DWQ A;  4HCE A;  4CJ1 B;  5CMD A;  2SNM A;  4WRD A;  1RTO A;  3S1M B;  1QE6 A;  5JEA H;  1O80 A;  2WIN B;  2FHT A;  4XIG S;  5COR A;  5BN3 A;  2M9V A;  2HCI A;  1LT5 D;  3EFX D;  1GJX A;  2L12 A;  1H9J A;  1HRJ A;  2R93 B;  1I4G A;  5CGK A;  5KIX A;  3PIO 3;  1F9R A;  2LS0 1;  3A54 A;  5FLX L;  4C56 C;  2PW5 A;  2KHS A;  3GV3 A;  5M5Y B;  1D1K A;  2A74 C;  2NVX B;  1Y8O B;  1SNC A;  2KUM A;  4MIU A;  4ZQ3 A;  3OWE B;  3NK9 A;  2E2H B;  4Q0F A;  2KVM A;  3NTI A;  1ZEQ X;  2BDN A;  1JE4 A;  4K5W A;  2B2U C;  2F0J A;  4HTH A;  2JA6 B;  2OXP A;  4O42 A;  2HUG A;  3Q22 A;  2WB1 B;  4B08 A;  4DNT B;  3NTK A;  5K5P A;  5C0X I;  3NTH A;  1X3P A;  5DAU A;  5CYU A;  1EL0 A;  1FR3 A;  1TT2 A;  2B2U A;  2WKC A;  3GO5 A;  5TSS A;  3S16 B;  4KI0 A;  3KLS A;  1VCI A;  2BCO A;  1RTN A;  2B8G A;  2F0E A;  3OIP A;  4NP5 A;  3SHL A;  2Q8R E;  4I7Z C;  2NYZ D;  2F0L A;  1STH A;  1RDP D;  1FGB D;  2RDF A;  3K5L A;  3BDC A;  2K05 A;  3RZO B;  4FNF A;  3NQI A;  2PYK A;  4RH6 A;  4XTC S;  3VR6 A;  3I4N B;  1NUC A;  4IUT A;  4DF7 A;  5G3L D;  1S5B D;  4EVO A;  2LMC B;  3K6O A;  2L1B A;  4KJN A;  1ONL A;  3P7J A;  1LV9 A;  3I70 A;  4RCO A;  4CKB A;  3MAQ A;  4RHR A;  4RKL A;  1JC7 A;  1SE3 A;  1PTO B;  4DNR B;  1ILP A;  3ONA B;  5CV6 A;  1B3A A;  1JCK B;  4RA8 A;  2KED A;  1QCB D;  3SXH A;  3RD4 A;  1DON A;  1R9T B;  1DJR D;  2RDH A;  2NWG A;  1EY8 A;  2H1E A;  4IQZ A;  4FXK C;  3SR1 A;  4RCN A;  4IUV A;  1T5E A;  1LTT D;  1Q90 A;  2K5W A;  2WKD A;  3TP7 A;  1IHZ A;  2NZ1 D;  3K58 A;  1SYE A;  3ERQ A;  2HQE A;  1TR5 A;  3K59 A;  5COY A;  2LKV A;  5I4D A;  4QIW B;  2L55 A;  4Y7N B;  4IUR A;  3G7L A;  3SVM A;  5CV8 A;  4K2L A;  4G7H C;  1GHJ A;  3M4Y A;  1O7Z A;  1H9R A;  1ENF A;  5HUR A;  5IT9 L;  1RHP A;  4ID6 A;  1CQF A;  3A56 A;  1TWF B;  3P75 A;  4A3D B;  1PRT B;  2XN9 C;  1I4H A;  2MPM A;  4CJ2 C;  1STA A;  4ZYS A;  1E2W A;  1SYG A;  1NCV A;  1CZG A;  3BVM A;  4HMJ A;  2IJ0 A;  4C3J B;  1B2T A;  4DA2 A;  1I6H B;  3BS1 A;  3D4W A;  2PZU A;  1F2L A;  4XQN A;  5LL6 S;  1O78 A;  4KKU A;  1BCP F;  1I4P A;  1QNK A;  2AWO A;  3I90 A;  1V1P A;  4U68 A;  5FO8 B;  1D6E C;  4C3H G;  4TQU S;  2F0U A;  1GUG A;  1JOK A;  2B2Y C;  1CQV A;  1SSO A;  1YNJ C;  2F0W A;  1SEB D;  1VDZ A;  2KCC A;  2VUM B;  1CA5 A;  3TDQ A;  1UNS A;  2NVY B;  1D5X C;  2A68 C;  3VR2 A;  2RVL A;  1CI3 M;  1QIL A;  4FF2 A;  2X69 A;  4A3E B;  2BE5 D;  1EIH A;  2NN6 H;  1ZXT A;  3TZD A;  2K7V A;  2RQX A;  5KGU A;  5AFW A;  3N6R A;  1BUV T;  5BN5 A;  4KKS A;  1V8Q A;  3CKI B;  5I9P A;  4BY1 B;  5K36 G;  2RBM A;  1RF2 D;  3PV0 A;  3LWU A;  4L63 B;  2C9O A;  4OIJ A;  2IX1 A;  1XWE A;  1EY6 A;  3J81 L;  3U9O A;  1STB A;  1BNZ A;  1KNE A;  2PW7 A;  1EQV A;  3T53 B;  2QDB A;  5T1G A;  3NWS A;  3R2I A;  2WV6 D;  2JXM B;  2EJG C;  1GHK A;  1JWM D;  1CT1 D;  4BWG B;  4CHT B;  1B44 D;  5M5W B;  3DHQ A;  4CJ0 B;  1K83 B;  3HEJ A;  1OXT A;  2B2T C;  3SDZ A;  1RD9 D;  2F0M A;  2A6E D;  4QUC A;  5I2X A;  2JA7 B;  1I4Q A;  2R61 A;  5CBE E;  3R93 A;  1GUO A;  2L11 A;  2JE6 I;  2Q8T A;  3IAY A;  1D5Z C;  5C4Z A;  1E2V A;  2PMZ B;  2JA5 B;  1J8I A;  2F0O A;  1F2M A;  1Z6H A;  3HRZ C;  5I6W A;  1JQY D;  1HTP A;  4ODG A;  2PQE A;  3F2U A;  1VF5 C;  2BE5 C;  3OWF A;  5KRU A;  3BYY B;  3A7L A;  1KDB A;  1F2Y A;  2CW0 C;  5FK9 C;  3TP5 A;  2LFN A;  4DAV A;  2RKS A;  1JWU D;  1J9O A;  1SAP A;  2M00 A;  1G29 1;  3HGB A;  3G6J B;  4IFD G;  1EZ6 A;  4RGN A;  4XT1 B;  2CVR A;  1BXT A;  2IT1 A;  5DM7 3;  3GTJ B;  1M8A A;  4KTA A;  1EY9 A;  1Q1B A;  2FIN B;  2XNA C;  1EEI D;  2EYF A;  3H6M A;  2A5H A;  3VYU A;  3J80 L;  4HSV A;  3J81 E;  4C3I G;  3MFG A;  1SE2 A;  1A2T A;  2J0T D;  3X3M A;  2K28 A;  4HR7 B;  2K5D A;  1G2T A;  5EJW A;  2IX3 A;  1MSH A;  3LNN A;  1K8M A;  1TWA B;  2JEA I;  4U67 3;  3URY A;  1FYC A;  2A6E C;  2M2L A;  1AP0 A;  4IN3 A;  3E5S A;  3A7A B;  4X3T A;  2FJ2 A;  4V19 0;  1PZK D;  4ZAI A;  3VR4 A;  1KAA A;  1WCM B;  2Z1C A;  2B2V A;  4K5V A;  1SE4 A;  2BA0 A;  2EYJ A;  5CV9 A;  2XWJ B;  1HXY D;  4A3B B;  4OO1 H;  1A6X A;  5DM6 3;  1DXM A;  2ID0 A;  4J6H A;  1DOM A;  1OXS C;  5KNB A;  1F9P A;  1ZYR D;  1HQR D;  3J7A F;  2K33 A;  2I46 A;  1EFI D;  3X3N A;  4LK1 C;  4ZUJ A;  4TKO B;  4A3J B;  3PO3 B;  3D4R A;  2NUC A;  3WDN A;  4WOR A;  4KKT A;  5C0X J;  3NSW A;  1EIG A;  4XQJ A;  2TSS A;  3E6Z X;  3FEW X;  2RA4 A;  4IUQ A;  5M3F B;  4MHE A;  3FKI B;  1FNV A;  2TMP A;  1LTG D;  3MXN A;  3OW7 A;  1ET9 A;  4CGY B;  2IL8 A;  1W6K A;  2QEJ C;  1GUW A;  1EY4 A;  4X3U A;  1G6Z A;  4TRD A;  4OIK A;  2K32 A;  5IGB A;  3PIP 3;  5C5M A;  2WP8 J;  1KAB A;  3V05 A;  3A8K E;  4GZY C;  3GQB A;  3MXG A;  1SNM A;  2FFK B;  4LAA A;  3GD7 A;  3GP7 A;  2NB0 A;  3NE5 B;  1Y69 U;  2A73 B;  1WTW A;  3QOJ A;  3EQL C;  4FP5 D;  4PMC A;  3J80 E;  2O2L D;  5EBC A;  1AEX A;  5C0X G;  2JSO A;  2L4N A;  3A8J E;  3MWY W;  3Q23 A;  1EWH A;  3I73 A;  1I4X A;  1KDA A;  4F7X A;  5I9O A;  2F0G A;  4XDX A;  1WTV A;  5KND A;  2KEC A;  1WD1 A;  1OXU A;  5E4W C;  4KY6 A;  2PO4 A;  2WAQ B;  1AW7 A;  3NBI A;  2EDG A;  5JOB A;  4HN7 A;  1MD2 D;  1GUN A;  3SE0 A;  2HDM A;  3D6W A;  5ISR A;  1PZJ D;  5KYL A;  5IGC A;  1ROD A;  1EY7 A;  1LT3 D;  1QWY A;  1ZYR C;  4RFB A;  3TP6 A;  1BO0 A;  2N88 A;  4MN3 A;  1PTO F;  3UI2 A;  3NPP A;  5ELE A;  3R3O A;  4ULL A;  4K5X A;  2EJM A;  3VYR A;  3VR3 A;  1Z7T A;  3C1E A;  1ICW A;  1I3Q B;  1D5M C;  3D6C A;  1LTA D;  2Z4I A;  4EQN A;  2AQ3 B;  3PMF A;  1LLR D;  1GUT A;  4KY7 A;  2D5D A;  3BG3 A;  3MC0 B;  3M7N A;  3QWN A;  2B39 A;  1X3Q A;  1TS5 A;  5FOB B;  4DGZ A;  3MXP A;  2KOL A;  3VYS A;  1CA6 A;  3NXW A;  4RGO S;  1XX8 A;  3LWE A;  1YNJ D;  2WAC A;  5EPL A;  1OO9 B;  1SYC A;  3OMG A;  4L8J A;  3L3O C;  1W6J A;  3NHH A;  3P20 A;  5FLX E;  1XXG A;  1KNA A;  5EGT A;  2A68 D;  1ET6 A;  5A2Q L;  1Y1V B;  1SNP A;  2EYM A;  2IWH A;  3RZD B;  1CFM A;  2A6H D;  2NVT B;  2ZXP A;  5JEA J;  1PXU A;  1BDO A;  4BA2 I;  2FMC A;  3J7A V;  1BCP D;  5LHY 1;  3JAM L;  5ELD A;  2D9U A;  2EE1 A;  2ZXR A;  1CK1 A;  5CV7 A;  1KLG D;  1EY5 A;  1VMC A;  2JA8 B;  1IKM A;  1TY0 A;  2L9H A;  1U4M A;  1JR0 D;  2KEE A;  1LT6 D;  5J39 A;  5ELB A;  1DOL A;  2A69 D;  3OSO A;  1HA6 A;  4IAL A;  1PRT F;  2K6A A;  1TWH B;  1FNU A;  2Q8I B;  4QF4 A;  1WD0 A;  1EYD A;  1WTP A;  1X32 A;  2B2W C;  1LTS D;  4OO1 I;  1EQT A;  3SK4 A;  4ZLT F;  2F0I A;  5CV5 A;  4K8J A;  2RDG A;  4PV1 C;  4A3F B;  4FVM A;  3C2P A;  3KBX A;  4NW2 A;  3DMU A;  3K7A B;  3FMC A;  4V0B A;  5JEA G;  2B2W A;  2X6G A;  1TS3 A;  3PO2 B;  1STY A;  4C1N I;  3W2D A;  1TWC B;  3KBG A;  3VYT A;  4C3H B;  1DM0 B;  4RAU C;  1ILQ A;  4HMI A;  2BA1 A;  3CRL C;  1QB5 D;  3A55 A;  2AWN A;  2N55 A;  4DK0 A;  2XIW A;  4G57 A;  2O5J C;  1MSG A;  3FVQ A;  4DXG A;  4EQO A;  2EYO A;  2O4X A;  3M85 A;  3GTG B;  3MZ5 A;  1LO5 D;  2K5Q A;  4C3J G;  1VMP A;  1EYA A;  2F03 A;  1B53 A;  3KF8 A;  4CKE A;  3TZU A;  3ND8 A;  5FO7 B;  3NQT A;  2A6H C;  5D3I B;  5ELF A;  1BCP C;  4HED A;  5IOD A;  4BBS B;  2IPK D;  1BOS A;  2CW0 D;  1GXD C;  1GOZ A;  2ENB A;  1PMR A;  1JOR A;  5A2Q E;  2F0N A;  1II3 A;  5J22 A;  5KEE A;  4X3S A;  2SDF A;  2A69 C;  2RSN A;  3JAM E;  5JVG 3;  2NVQ B;  5EKK A;  1O7L A;  1R4P B;  3S1N B;  2GA4 B;  1Q3L A;  4ILW A;  2QCP X;  3SK8 A;  1TII D;  4G4K A;  4ME5 A;  3MEH A;  4HAE A;  1D2B A;  2DN8 A;  4XYO A;  3SK5 A;  1T5X D;  3O13 A;  1KLU D;  3D3R A;  1A3V A;  4XT3 B;  5KYI A;  1PYW D;  3H91 A;  3QJY A;  3U9S A;  1OXX K;  1R4Q B;  5IT9 E;  4RHS A;  4OGQ C;  1LAB A;  2FMM A;  5FKA C;  2KA7 A;  3H94 A;  3MHB A;  3I72 A;  4KMU C;  1TS4 A;  4OHJ A;  2XWB B;  1NSN S;  1H9S B;  4IZ8 A;  3GTM B;  4IFD J;  1TKW B;  5C0X H;  1O7Y A;  4FO2 A;  4FXG C;  2IX0 A;  4LJZ C;  3V96 A;  5C6A A;  1LT4 D;  3S1Q B;  3RMH A;  3M3Y B;  1S4Z A;  3TBI B;  5C3W A;  3RLF A;  1PFM A;  1XYI A;  4C2M B;  1Z47 A;  3LX0 A;  5A35 A;  1TQO A;  4ZKC B;  2EYL A;  3FPU B;  3I4L A;  2L5T A;  1SMY D;  1I6V C;  1S5D D;  1GUS A;  1VF7 A;  4PMW A;  4KJO A;  4A3K B;  4UDU C;  2C5C A;  5F2D A;  5BN4 A;  5M5X B;  1CTM A;  1QG7 A;  1U4P A;  2OEO A;  1SJH D;  4ABN A;  4PMB A;  1UEA B;  3S2H B;  3H0G B;  2F4I A;  1G8Z D;  4FF1 A;  1A2U A;  4CBV A;  4E6I A;  4KN7 C;  1ENA A;  1IYV A;  3KK7 A;  1HFG A;  2H4O A;  2HDL A;  3WOF A;  1BBX C;  1STE A;  4HCS A;  4ZUI A;  1F9S A;  2AUJ D;  3Q6S A;  3AB9 A;  2F3V A;  4EQP A;  4C3I B;  1I4R A;  5FO9 B;  2F0H A;  3CRK C;  1V1O A;  3T51 B;  5E1F A;  3GTQ B;  1JIC A;  2ICI A;  3HP3 A;  2MUY A;  3I91 A;  3MA2 B;  1Q1E A;  3ITP A;  4KD4 A;  5EQ0 A;  3CQZ B;  1WTR A;  4N9T A;  4RWS C;  3VA5 A;  2D62 A;  3FDT A;  3L9A X;  1SND A;  3T16 A;  4J8Q A;  1SXT A;  2B2V C;  4DXF A;  1SJE D;  3QG1 A;  2KQ3 A;  3Q24 A;  2EPB A;  2F0P A;  2VXW A;  3VR5 A;  1STG A;  2XSC A;  2J7Z A;  4O1N A;  3S17 B;  4WFN 3;  3HOZ B;  4R8I A;  1WTO A;  1I50 B;  4KY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...