2AUKA

Structure of e. coli rna polymerase beta' g/g' insert
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
GSHMAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Lineage-specific Sequence Insertions in the Bacterial RNA Polymerase beta' Subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase beta' chain
total genus 40
structure length 189
sequence length 189
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA02
4G7HC 3PV0A 1V43A 2D5DA 2EJFC 3D31A 3RLFA 3VR3A 1DXMA 1PMRA 2DN8A 4IFDH 4BA2I 3OPOA 3A7LA 1GJXA 1OXSC 1E2VA 4BA1I 1GUOA 2A6HD 1TU2B 2E76C 2EJGC 3EQLC 2A68D 1OXUA 3PUXA 3M7NA 4DNRB 4KKSA 1YNJC 2ZT9C 2A6EC 1Y8PB 4H44C 4PV1C 2F1MA 1LABA 3D4RA 3I4LA 3MFYA 1LACA 1E2WA 2AUJD 4JBWA 5K36G 1HCZA 3CRKC 2BDOA 5JEAG 2KCCA 2PPBC 3A8JE 1VF7A 1G291 2NN6I 3IKJA 3HGBA 4GZYC 1H9SA 3T51B 1FR3A 2A6HC 1HTPA 3LWUA 1GUSA 1DCZA 2BE5C 2R6GA 4KN4C 3KLRA 4G7ZC 3TZUA 1V8QA 4RCNA 2A69C 3T53B 4LJZC 1DD2A 2BE5D 1OXTA 3AB9A 1HPCA 4IFDG 3VR6A 1O7LA 5A35A 1EWHA 1ONLA 4XIGS 3T56B 2NN6G 1ZYRC 2YYZA 3NE5B 2BA1A 1OXVA 1Y8OB 1Q1BA 1GUNA 4HR7B 1H9KA 3QIAA 4TQUS 5KNBA 4TKOB 2O5IC 2O5JC 3BDOA 2IT1A 1T5EA 3PUWA 1VF5C 3QJYA 1VDZA 4KN7C 3VA7A 5K36H 1K8OA 3M4YA 3PUZA 4KHZA 2LMCB 4DNTB 1CTMA 1QJOA 1Y69U 2QF7A 2Q8IB 4OO1H 4KKTA 2JE6I 5C0XH 1SMYC 1H9RA 2PNRC 1I6VC 2AUKA 3N6RA 4L8JA 4OGQC 5KNCA 4OO1G 3IFTA 1H9JA 4IQZA 5JEAH 1Q12A 3A7AB 4I7ZC 3L7ZC 3OOCA 4H0LC 3WDNA 5KNDA 3PUYA 2L5TA 4H13C 4XTCS 3FMCA 3SDZA 1O78A 2DNEA 1IW7C 3U9SA 1IYUA 3W3AA 2D62A 1E2ZA 1GUTA 1OXXK 1Q90A 1B9NA 4JK1C 2BA0A 2E74C 3BG3A 1Q1EA 3GD7A 3P20A 3SE0A 3VR2A 1VCIA 3PUVA 1Z7TA 2B8FA 2NN6H 3OW7A 1Y8NB 3FPPA 1CI3M 1H9MA 3GQBA 2CW0C 1BDOA 4KKUA 3VR5A 5BN3A 2EVBA 2A69D 4G7OC 1GHJA 2K33A 2KA7A 1CFMA 3H94A 5C0XG 2B8GA 3I72A 1IYVA 3ND8A 4DK0A 3A8KE 2V4DA 4KMUC 1GUGA 2EDGA 2K7VA 3DXJC 4KI0A 3M85A 2D2CC 1Z6HA 5BN5A 3MXUA 2K32A 3QG1A 1A6XA 3I73A 2DNCA 1IW7D 3CRLC 1GHKA 1H9SB 1ZKOA 1K8MA 5BN4A 2PCFB 2EJMA 2A68C 3A8IE 1B9MA 3VR4A 3LNNA 4LK1C 3ND9A 2JEAI 2JXMB 2JEBI 2AWOA 1YNNC 4DK1A 2A6ED 1HQMC 2E75C 1FYCA 1TKWB
chains in the Genus database with same CATH superfamily
3NENA 1CKMA 4BY7B 1L1OA 2OT2A 4HEDA 5IP7G 1TS3A 2ID0A 2J0TD 1O7ZA 3TBIB 1U4RA 3QWNA 1OXUA 5L37A 3M7NA 1LT4D 2B2TA 4OEMB 4QGUA 1YNJC 5C44H 2KCMA 5I2YA 1LLRD 1CSQA 2F1MA 4DV3Q 2AUJD 4B3SL 4B3RQ 2UXCQ 2E2IH 1VQHA 1BCPB 2PQAB 4LF7Q 1PH2A 3M3YH 3MEFA 2IX1A 4H7BA 1UWVA 3H0GG 4J6HA 2MGSA 1SR3A 2A69C 4PMBA 5LMUL 1EYDA 4C3JG 1N34Q 2Z4IA 3K7AB 5IP7H 3T56B 1EWIA 2F3WA 4JI4Q 1AFPA 1ZYRC 4ABNA 1F2MA 1EU4A 4RKBA 4RMFA 4DR4Q 5M5YH 4KHPL 3PUWA 2R7DA 1PRTB 1VF5C 4A3EG 4A3GH 3DWPA 3HRZC 1EUJA 3OSOA 3OWFA 5M3FB 3HOYH 1QZGA 3NBIA 4RFBA 4WRDA 2OWOA 3ULPA 1QVFA 3N6RA 1STHA 4ULLA 2A1AA 3T4AC 2WIIB 4DXFA 1IYUA 1I94Q 1GUTA 3L0OA 1B9NA 1S40A 1KRSA 3RD4A 1YIJA 1SYBA 1VQBA 1VMCA 1ENCA 3MHBA 4C56C 1F77A 1VQAA 5ELDA 3HEJA 4BBRH 1WTPA 3M85A 3DM1A 4KI0A 4B3RL 2UXCL 1VQLA 2NYZD 1KRTA 2E2JB 2F3VA 3UDXA 1GHKA 5BN4A 1ML0D 3PO3G 1B9MA 1PYWD 1RHPA 4DR7L 2JEBI 2AWOA 1TWAB 4P75A 2D5DA 4F87A 4C3JH 1YJ9A 2HHHL 2I0QA 1ZXTA 2CQOA 1CA6A 1SFOB 2PMZE 4DR5Q 3DWQA 2YU9H 1EL0A 5I6YA 3S1RB 4WJ3M 1M8AA 2Z6KA 1YNXA 2B2UA 1CKOA 2B2VC 1G51A 4KHPQ 2F0GA 4K5XA 3SGIA 4NB3A 1X3PA 2B3GA 5M5WH 1N36L 2N55A 2IY5B 2K5WA 4ZLTF 4O42A 4QQBX 4K5VA 4HSPA 1DOLA 4R1JA 5CYUA 3NHHA 2B39A 2VUMB 3G7LA 1HTPA 4NKLA 2K5VA 2RDHA 5EKIA 3PO3B 1IBLL 4FF3A 3FPUB 1EQTA 3R2TA 1X6OA 4RGMA 4EQOA 1BCPC 3AB9A 3URYA 3R93A 1CKNB 1O80A 2R61A 2N78A 2AQ1B 2C5CA 5DNFA 3GV6A 1B3QA 3Q24A 3S2HB 1XYIA 3GDEA 3KOJA 1PLFA 2K05A 2Y0SB 1QB5D 3JAMi 5ELCA 1YEZA 1IXRA 1Q7YC 4KN7C 4HCSA 3OMGA 3KJPA 4C3HH 3CPWA 1XPRA 4DV2L 4JV5L 1KDBA 2F0SA 4J15A 5IY0A 1QOHA 4MTKA 4PZ7A 4BS9A 1I6VC 3V05A 3MTSA 4FF1A 1SNQA 3GTGH 5JJIA 1MKHA 2ES2A 1CHQD 4H0LC 3E6ZX 3OIPA 4OELB 2L5TA 3S9WA 2HHHQ 3U9SA 1ET6A 1F2LA 1OXXK 1U5KA 2RHQB 4DR5L 5ELNA 2E2HH 2E74C 1BOSA 3R8BA 1IKLA 1VCIA 2XRSD 4DAPA 4FXGC 2B2YA 4HTHA 1LTGD 4MNOA 3VYUA 1WTRA 4K0KL 3J81c 3KBGA 3JAML 1KLGD 1L0YB 1N36Q 3KLSA 2F0PA 2K7VA 4OIJA 2D2CC 1XJVA 3CMAA 3QG1A 4Y7NB 4LAAA 1OTCA 3CRLC 3CMEA 3GTLB 4K6DA 5LMNL 3VDYA 1I4XA 2I07B 3E9IA 3CCUA 3BVGA 3ND9A 1DZ1A 2JXMB 3R3OA 1YNNC 2A6ED 2HT1A 3CC2A 1X65A 1IBLQ 1XXGA 2PO4A 2LXJA 1TWFH 2KCNA 2DJGC 2EYMA 3SK4A 1VQPA 5C4XG 3T13A 2EJGC 2M2LA 3SVMA 1D8LA 3CAMA 3TQYA 3A56A 3F2UA 3HP3A 4AIMA 3WOEA 5JPNC 1LO5D 1SAPA 1HTLD 1EOVA 3MFYA 2EXZA 4U673 3CU7A 3EJIA 3KF8B 1RODA 4DV2Q 4LFBL 2RVLA 1JWSD 2KQ3A 1S5FD 4R8IA 2HCIA 4RH6A 1H9SA 3M4OH 3UDFA 2WAQG 1CSPA 5E3FA 3J7YW 4A3FG 2LXKA 2Q2HA 1CT1D 1O7LA 4A3BB 3U58A 2GVAA 3N52A 1Z9FA 3VYRA 2A74C 1L1OB 3PQIA 2O5IC 2E8GA 2F0QA 3RMHA 1Q46A 2QCPX 1VDZA 3VA7A 1HA5A 3I70A 2F0LA 3K59A 1QNKA 3TDQA 5LMNQ 2A73B 1TIID 2Z4HA 5EAYA 4BXXH 4CJ2C 1XTDA 1IBKL 1DYQA 1I3QB 2NVTB 3KDFA 4XQQA 5KNCA 2NBFA 4B3ML 3HOVH 1H9JA 4I7ZC 2HDLA 1RDPD 5KNDA 4HJ8A 3K6OA 1LV9A 4C3HB 4UP8A 3H0GB 4LNQA 3BYTB 3GD7A 4IJHA 1PV4A 4N9PA 3I4MH 1Z7TA 4C3IG 3JAMc 4IFDI 3DEOA 2EVBA 1AEXA 3I90A 4M8AA 2QKIC 2BCOA 3CQZB 4ODGA 5IYBG 1GKHA 3V2TA 4HJAA 3NTHA 4LFBQ 1EQVA 4GLXA 2PCFB 3TP7A 4PMCA 3VR4A 3HKZE 1AE3A 2R93H 3MVVA 3RLNA 2IWHA 4DK1A 4JYAL 1I50H 3GTPB 2WAQB 4G7HC 2WKDA 2ZTCA 1PA6A 4IO9A 3CCRA 4O2DA 4Y7NH 1EZ8A 4DV1Q 3KUPA 3J7AF 2OXPA 3ZJYC 3NQTA 3A7LA 3P7JA 1D5MC 4HIKA 1TU2B 2IJ0A 4XQNA 3QR8A 1QCBD 3D6CA 3R2IA 3TP5A 4AQYL 3D4WA 4A3EH 3I4LA 1MSGA 2FMCA 1IYJB 5J22A 3GV3A 3DEPA 2TSSA 4GNXB 3KBXA 2KCCA 2L0CA 5JJZA 4ZKCB 4B3MQ 3PIPA 4MTNA 2AKWB 1LT5D 5CV4A 4EQNA 4YY3Q 2BE5C 2NTSA 2NVQH 4KN4C 3MA2B 4KV6A 4RCNA 1F9PA 3K58A 3Q0AA 2AMCB 5LHY1 3X3NA 5ELEA 3RLOA 4K2KA 5FLXc 1SJED 2NVYH 4FXDA 1EQQA 5GAHC 1HNZQ 2IW3A 2UXBL 2ZXPA 2O5JC 5FO9B 4DR1L 1A2UA 5IYDH 2UXDQ 2XN9C 4DNTB 5KRUA 1QJOA 4Y52H 1Q86C 3G6JB 1PXUA 4LMQD 1SXTA 1Y1WB 1TWGB 2I46A 2BH8A 3A5UA 1U0LA 1V9PA 1TR5A 3F1ZA 2JA8B 4IPCA 3G6EA 4IUTA 1G2TA 2EY6A 3I55A 1TWCH 1YNJD 1STGA 2F52A 5A2QL 2HUGA 5EPLA 1CK1A 3K80C 3VR2A 4PNYA 5JVH3 2FXQA 3HFZB 3TP6A 2MJ8A 4A3FH 2KA7A 2IHEA 2PZTA 3NQIA 1JB7A 2E2HB 3A8KE 4YHHQ 1GUGA 1R4PB 3FKIG 4A4IA 1SRUA 3L9AX 4B9WA 1UE7A 4KK7A 4C3JB 3HOUH 1IW7D 1GXDC 5EGTA 2RCFA 3H91A 4L5SA 4L5RC 1PRTD 2A68C 2EY2A 4YY3L 4DR2Q 2CQAA 3D3RA 2CHBD 4OWXB 4A93H 2IX0A 4BA1I 4JI0L 2A5HA 1V43A 3BZDB 3KYHC 1TT2A 3VA5A 2HDMA 5C4XH 3A74A 1F9SA 1TWCB 1U4LA 1PMRA 1NBWA 3WOFA 4C2MB 1FL0A 4HSVA 3AFPA 4M1UB 1HNZL 2K01A 1Q8KA 4PMWA 4UPAA 2R93B 2UXBQ 2BDNA 3Q6SA 1I50B 2OTLA 4KKSA 3GTMB 2TMPA 2UXDL 5IYDG 3CCMA 2CH4W 2C9OA 1HQRD 1EY5A 3CCLA 2PNHA 1BBUA 4O0AA 1G8ZD 4GKKL 5IWAL 4DF7A 4BY1B 5EBDA 3HOYG 2NWGA 5AJ3Q 1KNEA 1VQ7A 2JA5G 3J81j 2WAQE 1HNWQ 3NTKA 1A3VA 1PFMA 1WI5A 3BDCA 1TQOA 1RJTA 3HKZB 1VQNA 2UUBQ 4G4KA 4DV3L 3D6WA 3PMFA 1JOKA 2MUYA 2C35B 3W1BA 1Q1BA 3PO2G 5C0XJ 3OW2A 3QJYA 4R9WA 3RN5A 4LF7L 1H95A 1CTMA 2OQ0A 2D0PA 4CHTB 1LTLA 2F0VA 1BKBA 2ZXOA 1WTXA 1N32Q 5LMUQ 1N34L 3CPFA 2WINB 4POFA 1EY4A 1AW7A 1SFOH 4ZUJA 3TSSA 1NNXA 3L2PA 1TS4A 3CC4A 1NY4A 4DV7Q 2D62A 1E0BA 5ELFA 1Q1EA 2JA5B 3NSWA 1Y8NB 3GQBA 1CI3M 2VQEL 3IRBA 4G7OC 1KNAA 2F0EA 5EBCA 5A2QE 2NZ1D 1V1PA 4NXNQ 4A3DB 1II3A 4G57A 3BYYB 1CZGA 3I4NG 1BBXC 1TS5A 5IWAQ 1ENAA 1SYFA 1STEA 4A3FB 1E1TA 1B53A 3E3XA 4IZ8A 1XMQL 3GTQH 1J5EQ 5AJ3L 3UE0A 1TVXA 3HOYB 2AHOB 2R3ZA 3J80E 1PH1A 4FP5D 1VQ5A 1TKWB 1HNWL 3C3LA 1Y14B 1C0AA 3A5ZB 2K52A 4FYDA 5EPJA 1KTKA 3HOVG 2JN4A 3K8AA 2RQXA 2BOSA 1GUOA 5J39A 1STAA 1SNOA 2E76C 3PUXA 2XRQD 5JAVA 2EY5A 5GAEC 3S1QB 1A15A 1LABA 1ILQA 5E1FA 4RGTA 2UUCL 1JJ2A 4DR7Q 2XNAC 3LWEA 3D8GA 3I2ZA 5CV8A 2Z1CA 1EFID 3IKJA 4GZYC 3S17H 1ICFB 4DAMA 4DV4Q 3KLRA 3E0EA 1LT3D 2HD3A 2R7ZB 1OXTA 4IURA 1HPCA 4JI1L 1UUPA 5IGGA 3D4DA 2PW7A 3PSIA 4DV0L 3HOZG 1OXVA 2AQ2B 1QZHA 1DOKA 5GROA 3C2PA 5M3FG 2PI2A 1A8VA 2ALYB 1WTOA 5CMDA 3OIQA 4N9TA 1KXLA 5BR8Q 1XMQQ 2GVBA 4DR3L 1HZAA 4GLVB 4JI7Q 1LTBD 2X6GA 4RG1A 3ULLA 1PH6A 2XGTA 2QGQA 3PO2H 4N8X1 4XXEA 2EYHA 3T1YQ 2Q2TA 1CHPD 1Y1VG 2L12A 3BG3A 3SE0A 3PO3H 1ET9A 3MAQA 3MC0B 3HOWB 2VS1A 3DWAA 1KC8C 3ERSX 4DAYA 2KJXA 4IALA 1WTVA 4R4QA 4JV5Q 3MZ5A 1ICWA 3HKZG 4F88A 1A6XA 2ZTEA 2Y0SE 2DNCA 2JP1A 4IUQA 5EPKA 5I6WA 4A3KB 1YVCA 1D1IA 2EJMA 1RD9D 2MHVA 4OWWB 3FDTA 1HNXL 3FVQA 2ATWA 5JJLA 2RBMA 1SNCA 2LFNA 4RHSA 1C7YA 1HR0W 1RL2A 1TS2A 4NXML 1MJEA 4GS3A 1DXMA 2RKSA 1N33L 1M4VA 4FVMA 4N8FA 1J9OA 1OXSC 4DAYB 1XMOL 2H4OA 1EYCA 3TREA 3EQLC 4IJLA 4DV0Q 1BNZA 5HGQA 5HURA 2WB1G 5IGFA 2A6EC 3M3YB 2Q2UA 2R93G 2K4KA 1K28A 1Q81C 2Z6KC 4HAEA 5BR8L 1JICA 5EQ0A 3T16A 4BBSH 4K6LA 2NVTH 1KQSA 2MP1A 4JI7L 2O4XA 1GOZA 1YHAA 1A2TA 2N8NA 3FKIH 2PMZB 3EBEA 3I4OA 2K1BA 2MO1A 1DCZA 4K14A 3TS0A 1XX8A 3MXNA 5M3MB 2B63G 1VQMA 1I5FA 2FMMA 3NBHA 1MIUA 3PF4A 2BE5D 3BS1A 2B29A 3GP7A 3I4MG 5KYLA 4HR7B 2DGYA 1T5EA 4X3KA 1C48A 1HRJA 1EY7A 4L5QA 1PDQA 4OIKA 2KBNA 2JYOA 1Y69U 1VQ8A 2J4XA 2QF7A 1EIYB 4QL5A 3S2HH 3C1FA 1HNXQ 5C0XH 4LF4Q 2PNRC 1S4ZA 4A3GB 4L8JA 2RHSB 2F0NA 5CBEE 4A93G 3RZOB 4BBSG 3SR1A 1X3EA 3SDZA 2F0OA 1O78A 5IT9E 1B1ZA 4UAIA 3ULJA 4JK1C 1XMOQ 2R7ZG 2BA0A 2ICIA 3OHXC 1UEBA 5CBAE 4DV6Q 2I5MX 2JK8A 5BN3A 2JA6B 1EIGA 4DK0A 4FXKC 4JI8L 2MO0A 1JE4A 2VXWA 1B3AA 4NP5A 2SDFA 1HA6A 4CBVA 3E9HA 5FLMG 3I7FA 3A8IE 2LSSA 3K0YA 2D0OA 2DY8A 4A76A 2YU9B 2H1EA 3KK7A 2KHJA 3PV0A 4DUYQ 2KHSA 2NVYB 4X66L 5IE8A 1A0IA 5FO8B 2DN8A 4V190 2EPBA 3CC7A 2FINB 2NVXH 1K3BC 2LS01 1ASZA 3NELA 3P75A 3CCEA 1KLUD 4A3JH 3K5NA 2E5LQ 4KY5A 2ASBA 1YHBA 4H02A 3PIP3 1Y8PB 4PV1C 2WB1B 2IL8A 1E2WA 4CKCA 1I6HB 2PZWA 2JA6H 1X3QA 4LF5Q 3EROA 1L1OC 1JWMD 4JYAQ 4LF4L 1VF7A 4TRDA 2DUDA 2JA8H 5DM63 2NB0A 1B8AA 1WCMH 1F9QA 5C3WA 3H3VC 5JOBA 3S1MB 2DY7A 4CDCC 1QUQA 3LX0A 3RZDH 1D6EC 4U68A 4DV6L 1DD2A 2IHFA 2VW9A 1BCPF 4A3DG 1EWHA 1HZCA 3HS0C 1PZJD 3S2DB 2CWAA 4AQYQ 1YBYA 2I5HA 4JI2L 3KLWA 3SHLA 4JI8Q 1H9KA 3QIAA 5KNBA 2RSOA 5T1GA 3EA6A 1O7IA 4E6IA 2G5DA 3PUZA 1XPOA 2LMCB 4ZUIA 4KHVA 4KKTA 5C3EH 1JORA 2A19A 2WV6D 1EY8A 1VQCA 1VQ6A 3S15H 4C3HG 4EQ5A 3CCVA 1WCMB 5JEAH 4IPHA 2OEOA 3L7ZC 2KCTA 3OOCA 4DUYL 4C2MH 4X66Q 1BXTA 3V96A 1RTNA 3H6MA 3MXPA 3FHWA 3GTGB 3TN2A 4APVA 4QMGA 3J7ZC 1CA5A 1WTQA 3E5SA 4MZ9A 3GTMH 1H9MA 4DK3C 2CWPA 3F2BA 5C0XG 4R4TA 2K5QA 1L2FA 4BY1G 2E2IB 1K73C 3H0GH 1PTOB 1QVGA 3P1HA 4AYBE 4ILWA 2KENA 2PQEA 1NJIC 4R4IA 5C5LA 1ILPA 5C3EB 1BQQT 4TSSA 1JOQA 1VQIA 3TRZA 4CDDC 4JPBW 4PG3A 3MEHA 1KHIA 3UDGA 4QCLA 2K28A 2EJFC 2YTVA 2EYPA 4BA2I 2XSCA 2HQEA 5HGTA 4QB4A 2A6HD 3ERQA 4JI2Q 4YHHL 1EY6A 1EYAA 2VZAA 4QF4A 1LYLA 2F0KA 4JBMA 5M3FH 3D4RA 3KDFB 1W6KA 5K36G 2Z0SA 3EIVA 3K5LA 3CF5A 3ITPA 2JSOA 3T1HQ 1PYBA 3M4PA 2D9UA 1HH2P 5M5XB 4A3BH 1GUSA 2R6GA 1X3GA 1F9RA 3CCSA 1B70B 1S5BD 1JJGA 1K3RA 3F8TA 4A3LH 5IGDA 4JI5Q 2IPKD 1UEAB 3I4NB 2KECA 3CW2C 4ME3A 3HOXB 3AYHB 4DU9A 4BY7G 1PTOD 3S1MH 1B2TA 4BBRB 3RZDB 4OHJA 3I56A 2R92B 2XIWA 3MXNB 2F0TA 1L0XB 4IUPA 2L4NA 1BF4A 1BCPD 4X3TA 2HCCA 2WACA 3HOZB 1S5ED 2Z6BA 1EQRA 3OYYA 4IQZA 5JPMC 1TWAH 3ONAB 2UUBL 2K75A 4JI6Q 3QOLA 1HJPA 4YCWA 5EKLA 3W3AA 2EYLA 4DXGA 1L0WA 1Y1WH 4JG2A 2IX3A 1X32A 4UP9A 3KLSX 4QIWB 3TEHB 5LMNW 3H15A 2FHTA 1GVPA 4KJOA 3CD6A 2ZTDA 2MNAA 4A3JG 3I4NH 4RGNA 5G3LF 3S1NH 1G2SA 1IKMA 1DGSA 1N32L 3S14H 1F2ZA 4DUZQ 3A54A 4IPGA 5IT9c 2B63B 1RF2D 2K5DA 5JVG3 1A63A 1B44D 3PIOA 1I4RA 3CCJA 4DV7L 4ALPA 3DMUA 4JVZA 4A3MB 4YIJA 1VQJA 2K14A 5G3LD 1KD1C 4A3JB 1PTOC 4CKEA 1G6PA 2DJFC 3G71A 4HMIA 3NWSA 5T1IA 4JI5L 5FK9C 1FGUA 1HZBA 2VQEQ 1EU3A 1UNSA 3UE1A 1V1PB 3CP0A 1S5DD 1HZ9A 4K8IA 4L6TB 1SNMA 3STBD 1JMCA 2I5LX 4NXNL 1EOTA 5KGUA 1JT8A 4GKJL 1WTWA 2K50A 1JR0D 2JA5H 4DFAA 2CFMA 2F0MA 2OQKA 1PFNA 3OWEB 1B7YB 2PW5A 4GLAC 5FOBB 1VQOA 1J5EL 1VQKA 2EXDA 1Q3LA 3PCOB 3A8JE 1TXYA 3KF6B 3RR5A 4QY7A 1SDFA 4XDXA 3EN2A 4JI6L 3TZUA 3T53B 1HR0Q 1R9TB 4A3KG 3IL8A 3U9OA 5E4XA 1KIXA 1ONLA 4DV5L 1I3QH 3FRPB 1LTID 1J6QA 2UUCQ 1GUNA 2Z8LA 3S15B 1RTOA 3BDOA 3S24A 1KAAA 3SK6A 4DUZL 2LKVA 4YWLA 3BDLA 5C44G 4EVOA 2BH2A 5M5WB 3TMEA 4ZAIA 4DV4L 3NEMA 3X3MA 1Q8IA 1T9HA 2F4IA 1FJGQ 1VQGA 2R7FA 3STBC 1SYCA 4JI1Q 3M4QA 1ENFA 3MWYW 2YV5A 4HJ7A 3NUCA 1Q90A 1PH9A 3K81C 1KAWA 3HOZH 4GKJQ 4UDUC 1BDOA 1AZQA 4BBRG 4MN3A 1UE5A 2VB3X 3EFXD 4RGOS 4C1NK 1IYVA 4GN4B 2JA7G 4WORA 4DR3Q 1FD7D 4IUUA 2UUAL 4KJNA 3KJOA 5K5PA 5KYIA 5D14A 3AQQA 5M3MH 2JEAI 3T1YL 4DN4M 1X54A 3HGBA 1WVLA 2MQHA 1NR4A 2Y0SG 4HJ5A 1NCVA 1X3FA 3ZYYX 3SEBA 4QUCA 1E2VA 3GTQB 4X65L 2ZT9C 1NUCA 2QDLA 1LT6D 1NMFA 3W1GA 1YI2A 1GUWA 5HY6A 4ZQ3A 2VUMG 2RDGA 4I7AA 4CKBA 1K83B 3T51B 4NXMQ 3GTLH 1N33Q 2PQAA 2LY7A 1VS0A 4G7ZC 1V8QA 1ZEQX 2PZUA 4LJZC 4B08A 2X6LA 3RNUA 4IFDG 1EFWA 3J81E 1UAPA 1U4MA 4GN3B 1K8GA 1SNPA 3BVZA 4X3SA 1YJNA 5JEAJ 3HKSA 3OMCA 4RA8A 1TWHB 2UUAQ 2KUMA 4KHZA 1NAPA 2R92G 4OO1H 4MIUA 1SYDA 4BBSB 4NW2A 4LWCA 2L1BA 1C4QA 2L55A 1QNUA 3WDNA 2F4VL 1I4QA 1S5CD 2N49A 4XYOA 5IGEA 3U4ZA 4X65Q 1A3UA 1XNRL 1Y1VH 1ZYRD 2EYOA 4RAUC 5CV7A 4DNIA 4WFN3 5FLXE 5I9OA 4PZ8A 2EY1A 1GHJA 1SE4A 1YNND 2K33A 2E2JH 2ZM6L 4OX9Q 5CV5A 3J80c 4K8JA 3OTOL 2Q8RE 4PZ6A 1WYDA 2YTXA 3I73A 4BY7H 4RCOA 5KIXA 5ISRA 3AMUA 2NVQB 3H3VH 4LF9Q 4GKKQ 1EY0A 5GQOA 2F0UA 1W6JA 2A8VA 1PH7A 2VB2X 5J3BA 1PH5A 3HOVB 1K0SA 1HQMC 2OTJA 2FJ2A 4NPSA 5IYCG 2XVSA 1A62A 4IFDH 3PGZA 3J81i 3S2DH 4Q5VA 4Z9CB 4KTAA 4NMZA 1MBYA 4RKLA 2A68D 1A3TA 1W2BA 1O7YA 1MJCA 1RKNA 3ICEA 2CKZB 2CH4A 1TY2A 1HCZA 3BJUA 3CRKC 3CQZH 4R8NA 1G291 4X62Q 1PFBA 5CV9A 1SYGA 1JOOA 1S3OA 4DR6L 1DONA 4C3IB 2F4VQ 5I9PA 1CQFA 1M1KC 4KY7A 1EWCA 4B3TQ 3CKIB 2E5LL 1BUVT 4A3IG 5CC4A 5C4JB 4JI3L 1K83H 4FDBA 3FKIB 4P2CB 2KOLA 2YYZA 3NE5B 3M4OB 3HOUG 4AH6A 3AFQA 3OTOQ 4LF5L 3DM3A 5GADC 1K8OA 3M4YA 1JCKB 2O2LD 1AN8A 3PO2B 2F0HA 3DLLA 4LF9L 4LUOA 5COYA 4LUVA 3U50C 1PVOA 2XTIA 3ER0A 4A93B 5IT9L 3JAME 2CVRA 2L9HA 4LW1A 4LFCQ 5IYCH 1I4GA 3K5MA 1NSNS 3JC66 1E3PA 4B9XA 1VQ9A 3Q23A 4A3GG 5DAUA 3K0XA 3Q22A 1PZID 5FKAC 4WJWA 1R4QB 3CXCA 1PRTF 5CGKA 5IOCA 3FPPA 2ICEC 2CW0C 1JQYD 4UY8C 2JQOA 5C6AA 4A3KH 1CFMA 3H94A 3IFDA 2B8GA 4HN7A 4YWMA 2EE1A 2SNSA 5FLXL 4AYBB 3BVMA 1OO9B 2HQLA 2RCNA 4L5TA 3TZDA 2RDFA 4X62L 1H9SB 1W3SA 4GN5A 1LTAD 1K8MA 4DKAC 2ZJRA 2KVMA 4B3SQ 4KY6A 1TWGH 4DR6Q 3E0JA 3F2CA 1NMGA 2X69A 4S3SA 1FVIA 2K5NA 4B3TL 1S72A 4LFAQ 1WTHA 3HOXH 2WKCA 2F03A 1AH9A 1GJXA 4OO1I 5IP9H 3VYSA 2RF4A 5M5YB 3G4SA 1D1KA 4JI4L 3A55A 2F0FA 1AZPA 4NDXA 4L63B 4JBWA 4OL7A 4DR4L 1CUKA 2BDOA 5JEAG 2K04A 2WP8J 1PTOH 3S16B 1QVCA 1P8LA 1EIFA 1N9WA 2QILA 1CZWA 2B2YC 3NP8A 4LFCL 1MSHA 1RIPA 2K03A 2CW0D 3K5OA 3BU2A 3NWTA 4DAVA 3HOXG 3HG9A 1EZ6A 5FO7B 5TSSA 3H3VI 1I94L 1Y1WG 3KF8A 4TQUS 3AU7A 4TKOB 5FJ8G 2IT1A 5C44B 3T1HL 5F2DA 1MHWC 4X3UA 5I2XA 1NR2A 1SMYD 2MPMA 4MHEA 1CQVA 2H5XA 2Q8IB 1P16A 1PYSB 4IUVA 4OXPA 4FF4A 4QUFA 4CGYB 4HIOA 1LTRD 1PHJA 1WCMG 4BY1H 3I4MB 1Q12A 2SEBD 5C5MA 4JW0A 5C4HA 3FMCA 2YTYA 4LFAL 1SBBB 1GO3E 1LTTD 1E2ZA 1ESFA 5AFWA 4ZRZA 3RZOH 1WFQA 1IZ6A 5IODA 1GD7A 3GTJB 5ELBA 4A3IH 1IL2A 4CJ0B 4ZYSA 5BN5A 5GAGC 5E4WC 1BO0A 3S17B 2KEEA 5C3EG 1DM0B 1XNQL 3J7AV 5C3XA 2B2VA 2B2UC 3MFGA 1D5XC 1R9TH 1JB3A 1HHVA 5FLMH 1SSOA 1X9NA 2E75C 4IN3A 3VR6A 4A3CG 1HFGA 2FFKB 3HOUB 1SEBD 3VR3A 5IP9G 4FF2A 5IGBA 4QJFA 4YCUA 4ZK9B 1B50A 3K57A 4KLKA 1QUQB 1SE8A 4IFDJ 1J8IA 1X56A 3DHQA 4P72A 1YJWA 3C46A 2JA9A 2KEDA 1XPUA 1U9RA 4C1NI 1STYA 3CHBD 4CJ1B 1CKNA 1D5ZC 3GTOH 1D2BA 2NVXB 1T5XD 1UE1A 3BZKA 3KF6A 5E7NA 1N8RC 5C4XB 2G9HD 1LM0A 4CDFC 1KDCA 3HOWG 3S14B 1PH4A 1AP0A 5M9OA 1XWEA 4DPGA 2JA6G 4Q0FA 1FR3A 2A6HC 1VMPA 1RCVD 2N88A 2M9VA 3QO2A 4A3MH 5NUCA 4ME5A 2MFIA 3L3OC 2RSNA 3S16H 1SLJA 2SNMA 4IUNA 3FEWX 2F3IA 3M7GA 1KL9A 4LUZA 2Q8TA 4C3IH 3FP9A 4CDEC 5C4ZA 2JA7B 3O13A 5M5XH 1NE3A 2ENBA 3Q8DA 1JC7A 1F2YA 3J81L 1SNDA 2Z9HA 1DJRD 1QWYA 3MXGA 3LGJA 4K0KQ 3GTOB 2EYFA 4HIMA 4LF6Q 1XNQQ 1V1QA 1PZKD 2JA8G 4XT1B 1PFSA 2P5ZX 4R4CA 1HR0L 2E2DC 2VUMH 3A7AB 5JJKA 1SE2A 1YZ6A 4A3CH 3I91A 4DV5Q 1MD2D 1WD0A 5LL6X 2F0IA 3SK8A 3PUVA 2B8FA 2QEJC 1DOMA 2NN6H 3OW7A 2R7ZH 3M9BA 3VR5A 2JA7H 2WFWA 2VY3A 3PIO3 3J7A5 2V4DA 3GTPH 1NTGA 2EDGA 2L11A 1HUNA 1Z6HA 1STNA 3MXUA 2K32A 1C8CA 2G9DA 2UU9Q 2EYJA 5M3MG 5H1SE 2VL6A 2XWBB 1Q82C 1FJGL 2B2TC 2F0JA 1K8AC 1WOCA 1QE6A 5D3IB 4LK1C 1LUZA 4OWTB 1E1OA 4A3LG 4JBJA 4XYQA 4A3DH 3QOJA 1EIHA 3A0JA 2F0DA 2EOTA 1MI2A 5CV6A 2JJQA 1FGBD 2NUCA 3RLFA 1E22A 4DA2A 5IYBH 4WJ4A 2WB1E 3OPOA 5J1ZA 3I3CA 4A75A 2VNUD 1VQDA 4H44C 3VYTA 1SMXA 1TWHH 3D0FA 3NBHB 4V0BA 1LACA 4LF6L 5CR3A 2Q2IA 1FNWA 2EIFA 2PPBC 3S1RH 3TS2A 1CM9A 4P73A 1PTOF 3W2DA 1K9MC 3SK5A 1D7QA 3S1QH 4A3MG 4J8QA 1IBKQ 3SXHA 5LL6S 2QDBA 2L15A 1Y1VB 4FO2A 3TP8A 1BBWA 1Z47A 1FNVA 1SE3A 5A35A 4OONA 2NN6G 1VQEA 4TVAB 4GOPC 1QG7A 1KDAA 4XQJA 2M00A 5I4DA 2J7ZA 4AYBG 1WJJA 3J80i 5IGCA 1KABA 5K36H 3K7UC 3H09A 3UI2A 2UU9L 2NZHA 3AEVA 4X64Q 4QIWE 2EQSA 1H9RA 2R92H 2AUKA 2B2WC 3U4VA 1IBML 4OO1G 1JE5A 2ZXRA 2HIVA 3IFTA 4HIDA 3PF5A 1WD1A 1QILA 4BWGB 1MGSA 1JJCB 3NXWA 3PUYA 4H13C 2EZVA 2DNEA 1IW7C 4HJ9A 3GTJH 2CCZA 2OCEA 1HFNA 3P20A 1YITA 3G48A 1STBA 5D65A 3S1NB 1U4PA 2QEXA 4DV1L 2NTTA 2QA4A 1XTCD 1I6HH 1FNUA 1YHQA 3I72A 4I65A 2OF1A 1TY0A 3NK9A 5D3DA 4BXXG 1VQ4A 2GN5A 4K5WA 3C1EA 5DEHA 5C0XI 1EY9A 1ZKOA 4A3IB 1E24A 4EQPA 4GOPB 4X6AH 4LF8Q 2K6AA 1SJHD 1UE6A 4ZCKA 4GNXA 3LNNA 5EKKA 2NZOA 4JC0A 1G6ZA 2ZJQA 1JWUD 3QB3A 4FNFA 4P71A 4JOIA 4P74A 3D31A 1XNRQ 2SOBA 1PH3A 4DK6C 4JOIC 2F0WA 4IOAA 4DGZA 3RN2A 1HXYD 1I4HA 2VQFQ 4GNXC 2N3SA 2ZM6Q 4OX9L 1M90C 2AQ3B 4DNRB 1ASYA 1LTSD 1EEFD 1TWFB 3HZXA 2QW7A 1SN8A 3KFUA 4ID6A 4X64L 3W5OA 4IOCA 4DR1Q 1ESRA 3K7AH 4K2LA 1IBMQ 1IHZA 2AWNA 4PQXA 5KEEA 2NN6I 5IIFA 4KD4A 2PYKA 1SYEA 3LWUA 3GTKB 1G91A 2PI2E 5CORA 4EGVA 1V1OA 4POGA 3EVQA 2HIXA 3I8ZA 4RWSC 4XIGS 5ELOA 1E7ZA 1BVSA 1IL8A 2B2WA 2BA1A 1Y8OB 4F8MA 1SROA 3UDIA 5DM73 5EJWA 1X55A 1AE2A 3B6YA 4A3EB 3DUZA 1PH8A 4KD3A 2V1CC 1I4PA 1B4OA 1VQFA 4LF8L 2JE6I 1SMYC 4JCVE 4OGQC 4JBKA 4GOPA 1EEID 3NPPA 2XWJB 4ZKBB 4XTCS 1HUMA 4DR2L 4J1MA 4JI3Q 5FJ8H 1K0RA 4UP7A 4R4OA 2VQFL 3GTKH 4JI0Q 2KHIA 1PRTC 4F7XA 3BZCA 4KKUA 4IPDA 5DLQE 2ZJPA 2B63H 2A69D 1BR9A 4XT3B 3WWVA 5C4JH 4YWKA 3ND8A 3GO5A 4KMUC 3DXJC 3IAYA 1C9OA 2GA4B 1GM5A 4YCVA 4A3BG 4HCEA 4O1NA 3HOWH 1EYGA 3NTIA 3J80L 4EX5A 3CCQA 4RHRA 2RA4A 4HMJA 2K5HA 4UHVA 3RUZA 3F2DA 1FYCA
chains in the Genus database with same CATH topology
4BY7B 2OT2A 4HEDA 1TS3A 2ID0A 2J0TD 1O7ZA 3TBIB 1U4RA 3QWNA 1OXUA 3M7NA 1LT4D 2B2TA 1YNJC 5I2YA 1LLRD 2F1MA 2AUJD 1BCPB 2IX1A 4H7BA 4J6HA 2MGSA 2A69C 4PMBA 1EYDA 4C3JG 2Z4IA 3K7AB 3T56B 2F3WA 1AFPA 1ZYRC 4ABNA 1F2MA 1EU4A 4RKBA 3PUWA 1PRTB 1VF5C 3DWPA 3HRZC 3OSOA 3OWFA 5M3FB 3NBIA 4RFBA 4WRDA 3N6RA 1STHA 4ULLA 3T4AC 2WIIB 4DXFA 1IYUA 1GUTA 1B9NA 3RD4A 1SYBA 1VMCA 1ENCA 3MHBA 4C56C 1F77A 5ELDA 3HEJA 1WTPA 3M85A 3DM1A 4KI0A 2NYZD 2E2JB 2F3VA 1GHKA 5BN4A 1ML0D 1B9MA 1PYWD 1RHPA 2JEBI 2AWOA 1TWAB 2D5DA 4F87A 1ZXTA 1CA6A 1SFOB 3DWQA 1EL0A 5I6YA 3S1RB 1M8AA 2B2UA 2B2VC 2F0GA 4K5XA 1X3PA 2N55A 2K5WA 4ZLTF 4O42A 4K5VA 4HSPA 1DOLA 5CYUA 3NHHA 2B39A 2VUMB 3G7LA 1HTPA 4NKLA 2RDHA 5EKIA 3PO3B 4FF3A 3FPUB 1EQTA 3R2TA 4RGMA 4EQOA 1BCPC 3AB9A 3URYA 3R93A 1O80A 2R61A 2AQ1B 2C5CA 5DNFA 3GV6A 3Q24A 3S2HB 1XYIA 1PLFA 2K05A 2Y0SB 1QB5D 5ELCA 4KN7C 4HCSA 3OMGA 1KDBA 2F0SA 1QOHA 4BS9A 1I6VC 3V05A 3MTSA 4FF1A 1SNQA 1CHQD 4H0LC 3E6ZX 3OIPA 2L5TA 3S9WA 3U9SA 1ET6A 1F2LA 1OXXK 2E74C 1BOSA 3R8BA 1IKLA 1VCIA 2XRSD 4DAPA 4FXGC 2B2YA 4HTHA 1LTGD 3VYUA 1WTRA 3KBGA 3JAML 1KLGD 1L0YB 3KLSA 2F0PA 2K7VA 4OIJA 2D2CC 3QG1A 4Y7NB 4LAAA 3CRLC 3GTLB 4K6DA 1I4XA 2I07B 3BVGA 3ND9A 1DZ1A 2JXMB 3R3OA 1YNNC 2A6ED 1XXGA 2PO4A 2KCNA 2EYMA 3SK4A 3T13A 2EJGC 2M2LA 3SVMA 3A56A 3F2UA 3HP3A 3WOEA 5JPNC 1LO5D 1SAPA 1HTLD 3MFYA 2EXZA 4U673 3CU7A 3EJIA 1RODA 2RVLA 1JWSD 2KQ3A 1S5FD 4R8IA 2HCIA 4RH6A 1H9SA 5E3FA 3J7YW 1CT1D 1O7LA 4A3BB 3N52A 3VYRA 2A74C 2O5IC 2F0QA 3RMHA 2QCPX 1VDZA 3VA7A 1HA5A 3I70A 2F0LA 3K59A 1QNKA 3TDQA 2A73B 1TIID 2Z4HA 4CJ2C 1DYQA 1I3QB 2NVTB 4XQQA 5KNCA 2NBFA 1H9JA 4I7ZC 2HDLA 1RDPD 5KNDA 3K6OA 1LV9A 4C3HB 3H0GB 3BYTB 3GD7A 4N9PA 1Z7TA 4C3IG 4IFDI 3DEOA 2EVBA 1AEXA 3I90A 4M8AA 2QKIC 2BCOA 3CQZB 4ODGA 3V2TA 3NTHA 1EQVA 2PCFB 3TP7A 4PMCA 3VR4A 3MVVA 2IWHA 4DK1A 3GTPB 2WAQB 4G7HC 2WKDA 1EZ8A 3KUPA 3J7AF 2OXPA 3NQTA 3A7LA 3P7JA 1D5MC 1TU2B 2IJ0A 4XQNA 1QCBD 3D6CA 3R2IA 3TP5A 3D4WA 3I4LA 1MSGA 2FMCA 5J22A 3GV3A 3DEPA 2TSSA 3KBXA 2KCCA 2L0CA 5JJZA 4ZKCB 1LT5D 5CV4A 4EQNA 2BE5C 2NTSA 4KN4C 3MA2B 4KV6A 4RCNA 1F9PA 3K58A 3Q0AA 5LHY1 3X3NA 5ELEA 4K2KA 1SJED 4FXDA 2IW3A 2O5JC 2ZXPA 5FO9B 1A2UA 2XN9C 4DNTB 5KRUA 1QJOA 3G6JB 1PXUA 4LMQD 1SXTA 1Y1WB 1TWGB 2I46A 1TR5A 2JA8B 4IUTA 1G2TA 2EY6A 1YNJD 1STGA 5A2QL 2HUGA 5EPLA 1CK1A 5JVH3 4PNYA 3VR2A 3TP6A 2MJ8A 2KA7A 2PZTA 3NQIA 2E2HB 3A8KE 1GUGA 1R4PB 3L9AX 4B9WA 4KK7A 4C3JB 1IW7D 1GXDC 5EGTA 3H91A 1PRTD 2A68C 2EY2A 2CQAA 3D3RA 2CHBD 4BA1I 2IX0A 2A5HA 1V43A 3BZDB 1TT2A 3VA5A 2HDMA 1F9SA 1TWCB 1U4LA 1PMRA 3WOFA 4C2MB 4HSVA 4M1UB 2K01A 4PMWA 2R93B 2BDNA 3Q6SA 1I50B 4KKSA 3GTMB 2TMPA 2C9OA 1HQRD 1EY5A 1G8ZD 4DF7A 4BY1B 5EBDA 2NWGA 1KNEA 3NTKA 1A3VA 1PFMA 3BDCA 1TQOA 1RJTA 3HKZB 4G4KA 3D6WA 3PMFA 1JOKA 2MUYA 1Q1BA 5C0XJ 3QJYA 4R9WA 1CTMA 4CHTB 2F0VA 2ZXOA 1WTXA 2WINB 1EY4A 1AW7A 4ZUJA 3TSSA 1TS4A 2D62A 1E0BA 5ELFA 1Q1EA 2JA5B 3NSWA 1Y8NB 3GQBA 1CI3M 4G7OC 1KNAA 2F0EA 5EBCA 5A2QE 2NZ1D 1V1PA 4A3DB 1II3A 4G57A 3BYYB 1CZGA 1BBXC 1TS5A 1ENAA 1SYFA 1STEA 4A3FB 1B53A 4IZ8A 1TVXA 3HOYB 2R3ZA 3J80E 4FP5D 1TKWB 3C3LA 4FYDA 5EPJA 1KTKA 2RQXA 2BOSA 1GUOA 5J39A 1STAA 1SNOA 2E76C 3PUXA 2XRQD 5JAVA 2EY5A 3S1QB 1A15A 1LABA 1ILQA 5E1FA 4RGTA 2XNAC 3LWEA 3D8GA 5CV8A 2Z1CA 1EFID 3IKJA 4GZYC 3KLRA 1LT3D 2R7ZB 1OXTA 4IURA 1HPCA 1UUPA 5IGGA 3D4DA 2PW7A 1OXVA 2AQ2B 1DOKA 3C2PA 1WTOA 5CMDA 3OIQA 4N9TA 1LTBD 2X6GA 4XXEA 2EYHA 1CHPD 2L12A 3BG3A 3SE0A 1ET9A 3MAQA 3MC0B 3HOWB 3DWAA 4DAYA 2KJXA 4IALA 1WTVA 3MZ5A 1ICWA 4F88A 1A6XA 2DNCA 2JP1A 4IUQA 5EPKA 5I6WA 4A3KB 1D1IA 2EJMA 1RD9D 2MHVA 3FDTA 3FVQA 2RBMA 1SNCA 2LFNA 4RHSA 1TS2A 1DXMA 2RKSA 1M4VA 4FVMA 1J9OA 1OXSC 2H4OA 1EYCA 3EQLC 1BNZA 5HURA 5IGFA 2A6EC 3M3YB 4HAEA 1JICA 5EQ0A 3T16A 4K6LA 2MP1A 2O4XA 1GOZA 1A2TA 2PMZB 2K1BA 1DCZA 4K14A 1XX8A 3MXNA 5M3MB 3NBHA 2FMMA 2BE5D 3BS1A 3GP7A 5KYLA 4HR7B 1T5EA 4X3KA 1C48A 1HRJA 1EY7A 1PDQA 4OIKA 2JYOA 1Y69U 2J4XA 2QF7A 3C1FA 5C0XH 2PNRC 1S4ZA 4A3GB 4L8JA 2F0NA 5CBEE 3RZOB 3SR1A 3SDZA 2F0OA 1O78A 5IT9E 1B1ZA 4UAIA 4JK1C 2BA0A 2ICIA 3OHXC 5CBAE 5BN3A 2JA6B 1EIGA 4DK0A 4FXKC 1JE4A 2VXWA 1B3AA 4NP5A 2SDFA 1HA6A 4CBVA 3A8IE 3K0YA 2DY8A 2YU9B 2H1EA 3KK7A 3PV0A 2KHSA 2NVYB 5FO8B 2DN8A 4V190 2EPBA 2FINB 2LS01 3P75A 1KLUD 3K5NA 4KY5A 3PIP3 1Y8PB 4PV1C 2WB1B 2IL8A 1E2WA 4CKCA 1I6HB 2PZWA 1X3QA 3EROA 1JWMD 1VF7A 4TRDA 5DM63 2NB0A 1F9QA 5C3WA 3H3VC 5JOBA 3S1MB 2DY7A 3LX0A 1D6EC 4U68A 1DD2A 1BCPF 1EWHA 3HS0C 1PZJD 3S2DB 3SHLA 1H9KA 3QIAA 5KNBA 2RSOA 5T1GA 3EA6A 4E6IA 3PUZA 2LMCB 4ZUIA 4KHVA 4KKTA 1JORA 2WV6D 1EY8A 4C3HG 1WCMB 5JEAH 2OEOA 3L7ZC 3OOCA 1BXTA 3V96A 1RTNA 3H6MA 3MXPA 3GTGB 3TN2A 4QMGA 1CA5A 1WTQA 3E5SA 1H9MA 5C0XG 2K5QA 2E2IB 1PTOB 3P1HA 4ILWA 2PQEA 5C5LA 1ILPA 5C3EB 1BQQT 4TSSA 1JOQA 3MEHA 4QCLA 2K28A 2EJFC 2EYPA 4BA2I 2XSCA 2HQEA 5HGTA 4QB4A 2A6HD 3ERQA 1EY6A 1EYAA 4QF4A 2F0KA 3D4RA 1W6KA 5K36G 3K5LA 3ITPA 2JSOA 2D9UA 5M5XB 1GUSA 2R6GA 1F9RA 1S5BD 5IGDA 2IPKD 1UEAB 3I4NB 2KECA 3HOXB 4DU9A 1PTOD 1B2TA 4BBRB 3RZDB 4OHJA 2R92B 2XIWA 2F0TA 1L0XB 4IUPA 2L4NA 1BF4A 1BCPD 4X3TA 2HCCA 2WACA 3HOZB 1S5ED 4IQZA 5JPMC 3ONAB 3QOLA 5EKLA 3W3AA 2EYLA 4DXGA 2IX3A 1X32A 3KLSX 4QIWB 2FHTA 4KJOA 4RGNA 5G3LF 1G2SA 1IKMA 1F2ZA 3A54A 2B63B 1RF2D 2K5DA 5JVG3 1B44D 1I4RA 3DMUA 4A3MB 4YIJA 5G3LD 4A3JB 1PTOC 4CKEA 4HMIA 3NWSA 5T1IA 5FK9C 1EU3A 1UNSA 1V1PB 1S5DD 4K8IA 4L6TB 1SNMA 1EOTA 5KGUA 1WTWA 1JR0D 4DFAA 2F0MA 1PFNA 3OWEB 2PW5A 5FOBB 1Q3LA 3A8JE 1SDFA 4XDXA 3TZUA 3T53B 1R9TB 3IL8A 3U9OA 5E4XA 1ONLA 3FRPB 1LTID 1GUNA 2Z8LA 3S15B 1RTOA 3BDOA 1KAAA 3SK6A 2LKVA 3BDLA 4EVOA 5M5WB 3TMEA 4ZAIA 3X3MA 1Q8IA 2F4IA 1SYCA 1ENFA 3MWYW 3NUCA 1Q90A 4UDUC 1BDOA 1AZQA 4MN3A 2VB3X 3EFXD 4RGOS 4C1NK 1IYVA 4WORA 1FD7D 4IUUA 4KJNA 5K5PA 5KYIA 5D14A 2JEAI 4DN4M 3HGBA 1WVLA 1NR4A 1NCVA 3ZYYX 3SEBA 4QUCA 1E2VA 3GTQB 2ZT9C 1NUCA 1LT6D 1GUWA 4ZQ3A 2RDGA 4CKBA 1K83B 3T51B 2LY7A 4G7ZC 1V8QA 1ZEQX 2PZUA 4LJZC 4B08A 2X6LA 4IFDG 3J81E 1UAPA 1U4MA 1SNPA 3BVZA 4X3SA 5JEAJ 3OMCA 4RA8A 1TWHB 2KUMA 4KHZA 1NAPA 4OO1H 4MIUA 1SYDA 4BBSB 4NW2A 2L1BA 1C4QA 2L55A 1QNUA 3WDNA 1I4QA 1S5CD 4XYOA 5IGEA 1A3UA 1ZYRD 2EYOA 4RAUC 5CV7A 4WFN3 5FLXE 5I9OA 2EY1A 1GHJA 1SE4A 1YNND 2K33A 5CV5A 4K8JA 2Q8RE 3I73A 4RCOA 5KIXA 5ISRA 3AMUA 2NVQB 1EY0A 2F0UA 1W6JA 2VB2X 3HOVB 1HQMC 2FJ2A 2XVSA 4IFDH 4Q5VA 4Z9CB 4KTAA 4NMZA 1MBYA 4RKLA 2A68D 1A3TA 1O7YA 1RKNA 1TY2A 1HCZA 3CRKC 4R8NA 1G291 1PFBA 5CV9A 1SYGA 1JOOA 1DONA 4C3IB 5I9PA 1CQFA 4KY7A 1EWCA 3CKIB 1BUVT 5CC4A 5C4JB 4P2CB 3FKIB 2KOLA 2YYZA 3NE5B 3M4OB 1K8OA 3M4YA 1JCKB 2O2LD 1AN8A 3PO2B 2F0HA 5COYA 4A93B 5IT9L 3JAME 2CVRA 2L9HA 1I4GA 3K5MA 1NSNS 4B9XA 3Q23A 5DAUA 3Q22A 1PZID 5FKAC 4WJWA 1R4QB 1PRTF 5CGKA 5IOCA 3FPPA 2ICEC 2CW0C 1JQYD 5C6AA 1CFMA 3H94A 3IFDA 2B8GA 4HN7A 2EE1A 2SNSA 5FLXL 4AYBB 3BVMA 1OO9B 3TZDA 2RDFA 1H9SB 1LTAD 1K8MA 2KVMA 4KY6A 3E0JA 2X69A 4S3SA 2F03A 2WKCA 1GJXA 4OO1I 3VYSA 5M5YB 1D1KA 3A55A 2F0FA 1AZPA 4NDXA 4L63B 4JBWA 4OL7A 2BDOA 5JEAG 2K04A 2WP8J 1PTOH 3S16B 2QILA 1CZWA 2B2YC 3NP8A 1MSHA 2K03A 2CW0D 3K5OA 3NWTA 4DAVA 3HG9A 1EZ6A 5FO7B 5TSSA 3KF8A 4TQUS 3AU7A 4TKOB 2IT1A 5C44B 5F2DA 4X3UA 5I2XA 1NR2A 1SMYD 2MPMA 4MHEA 1CQVA 2Q8IB 4IUVA 4FF4A 4QUFA 4CGYB 1LTRD 3I4MB 1Q12A 2SEBD 5C5MA 5C4HA 3FMCA 1SBBB 1LTTD 1E2ZA 1ESFA 5AFWA 4ZRZA 5IODA 3GTJB 5ELBA 4CJ0B 4ZYSA 5BN5A 5E4WC 1BO0A 3S17B 2KEEA 1DM0B 3J7AV 5C3XA 2B2VA 2B2UC 3MFGA 1D5XC 1JB3A 1HHVA 1SSOA 2E75C 4IN3A 3VR6A 1HFGA 2FFKB 3HOUB 1SEBD 3VR3A 4FF2A 5IGBA 1B50A 4ZK9B 3K57A 4IFDJ 1J8IA 3DHQA 3C46A 2KEDA 1U9RA 4C1NI 1STYA 3CHBD 4CJ1B 1D5ZC 1D2BA 2NVXB 1T5XD 5C4XB 2G9HD 1KDCA 3S14B 1AP0A 5M9OA 1XWEA 4Q0FA 1FR3A 2A6HC 1VMPA 1RCVD 2N88A 2M9VA 3QO2A 5NUCA 4ME5A 3L3OC 2RSNA 2SNMA 4IUNA 3FEWX 3M7GA 2Q8TA 5C4ZA 2JA7B 3O13A 2ENBA 1JC7A 1F2YA 3J81L 1SNDA 1DJRD 1QWYA 3MXGA 3GTOB 2EYFA 1PZKD 4XT1B 2E2DC 3A7AB 1SE2A 3I91A 1MD2D 1WD0A 5LL6X 2F0IA 3SK8A 3PUVA 2B8FA 2QEJC 1DOMA 2NN6H 3OW7A 3VR5A 3PIO3 2V4DA 2EDGA 2L11A 1HUNA 1Z6HA 1STNA 3MXUA 2K32A 1C8CA 2G9DA 2EYJA 2XWBB 2B2TC 2F0JA 1QE6A 5D3IB 4LK1C 4XYQA 1EIHA 3QOJA 2F0DA 2EOTA 1MI2A 5CV6A 1FGBD 2NUCA 3RLFA 4DA2A 3OPOA 5J1ZA 3I3CA 2VNUD 4H44C 3VYTA 4V0BA 1LACA 5CR3A 1FNWA 2PPBC 1CM9A 1PTOF 3W2DA 3SK5A 4J8QA 3SXHA 5LL6S 2QDBA 1Y1VB 4FO2A 3TP8A 1Z47A 1FNVA 1SE3A 5A35A 2NN6G 1QG7A 1KDAA 4XQJA 2M00A 5I4DA 2J7ZA 5IGCA 1KABA 5K36H 3H09A 3UI2A 1H9RA 2AUKA 2B2WC 4OO1G 2ZXRA 3IFTA 1WD1A 1QILA 4BWGB 1MGSA 3NXWA 3PUYA 4H13C 2EZVA 2DNEA 1IW7C 1HFNA 3P20A 1STBA 5D65A 3S1NB 1U4PA 2NTTA 1XTCD 1FNUA 3I72A 4I65A 2OF1A 1TY0A 3NK9A 5D3DA 4K5WA 3C1EA 5DEHA 5C0XI 1EY9A 1ZKOA 4A3IB 4EQPA 2K6AA 1SJHD 3LNNA 5EKKA 1G6ZA 1JWUD 3QB3A 4FNFA 3D31A 2SOBA 2F0WA 4DGZA 1HXYD 1I4HA 2AQ3B 4DNRB 1LTSD 1EEFD 1TWFB 3HZXA 4ID6A 1ESRA 4K2LA 1IHZA 2AWNA 4PQXA 5KEEA 2NN6I 5IIFA 2PYKA 4KD4A 1SYEA 3LWUA 3GTKB 1G91A 5CORA 4EGVA 1V1OA 3EVQA 3I8ZA 4RWSC 4XIGS 1IL8A 2B2WA 2BA1A 1Y8OB 4F8MA 5DM73 5EJWA 4A3EB 3DUZA 4KD3A 1I4PA 1B4OA 2JE6I 1SMYC 4OGQC 1EEID 3NPPA 2XWJB 4ZKBB 4XTCS 1HUMA 4J1MA 1PRTC 4F7XA 4KKUA 2A69D 1BR9A 4XT3B 3ND8A 3GO5A 4KMUC 3DXJC 3IAYA 2GA4B 4HCEA 4O1NA 3NTIA 3J80L 4RHRA 2RA4A 4HMJA 3RUZA 1FYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7H C;  3PV0 A;  1V43 A;  2D5D A;  2EJF C;  3D31 A;  3RLF A;  3VR3 A;  1DXM A;  1PMR A;  2DN8 A;  4IFD H;  4BA2 I;  3OPO A;  3A7L A;  1GJX A;  1OXS C;  1E2V A;  4BA1 I;  1GUO A;  2A6H D;  1TU2 B;  2E76 C;  2EJG C;  3EQL C;  2A68 D;  1OXU A;  3PUX A;  3M7N A;  4DNR B;  4KKS A;  1YNJ C;  2ZT9 C;  2A6E C;  1Y8P B;  4H44 C;  4PV1 C;  2F1M A;  1LAB A;  3D4R A;  3I4L A;  3MFY A;  1LAC A;  1E2W A;  2AUJ D;  4JBW A;  5K36 G;  1HCZ A;  3CRK C;  2BDO A;  5JEA G;  2KCC A;  2PPB C;  3A8J E;  1VF7 A;  1G29 1;  2NN6 I;  3IKJ A;  3HGB A;  4GZY C;  1H9S A;  3T51 B;  1FR3 A;  2A6H C;  1HTP A;  3LWU A;  1GUS A;  1DCZ A;  2BE5 C;  2R6G A;  4KN4 C;  3KLR A;  4G7Z C;  3TZU A;  1V8Q A;  4RCN A;  2A69 C;  3T53 B;  4LJZ C;  1DD2 A;  2BE5 D;  1OXT A;  3AB9 A;  1HPC A;  4IFD G;  3VR6 A;  1O7L A;  5A35 A;  1EWH A;  1ONL A;  4XIG S;  3T56 B;  2NN6 G;  1ZYR C;  2YYZ A;  3NE5 B;  2BA1 A;  1OXV A;  1Y8O B;  1Q1B A;  1GUN A;  4HR7 B;  1H9K A;  3QIA A;  4TQU S;  5KNB A;  4TKO B;  2O5I C;  2O5J C;  3BDO A;  2IT1 A;  1T5E A;  3PUW A;  1VF5 C;  3QJY A;  1VDZ A;  4KN7 C;  3VA7 A;  5K36 H;  1K8O A;  3M4Y A;  3PUZ A;  4KHZ A;  2LMC B;  4DNT B;  1CTM A;  1QJO A;  1Y69 U;  2QF7 A;  2Q8I B;  4OO1 H;  4KKT A;  2JE6 I;  5C0X H;  1SMY C;  1H9R A;  2PNR C;  1I6V C;  2AUK A;  3N6R A;  4L8J A;  4OGQ C;  5KNC A;  4OO1 G;  3IFT A;  1H9J A;  4IQZ A;  5JEA H;  1Q12 A;  3A7A B;  4I7Z C;  3L7Z C;  3OOC A;  4H0L C;  3WDN A;  5KND A;  3PUY A;  2L5T A;  4H13 C;  4XTC S;  3FMC A;  3SDZ A;  1O78 A;  2DNE A;  1IW7 C;  3U9S A;  1IYU A;  3W3A A;  2D62 A;  1E2Z A;  1GUT A;  1OXX K;  1Q90 A;  1B9N A;  4JK1 C;  2BA0 A;  2E74 C;  3BG3 A;  1Q1E A;  3GD7 A;  3P20 A;  3SE0 A;  3VR2 A;  1VCI A;  3PUV A;  1Z7T A;  2B8F A;  2NN6 H;  3OW7 A;  1Y8N B;  3FPP A;  1CI3 M;  1H9M A;  3GQB A;  2CW0 C;  1BDO A;  4KKU A;  3VR5 A;  5BN3 A;  2EVB A;  2A69 D;  4G7O C;  1GHJ A;  2K33 A;  2KA7 A;  1CFM A;  3H94 A;  5C0X G;  2B8G A;  3I72 A;  1IYV A;  3ND8 A;  4DK0 A;  3A8K E;  2V4D A;  4KMU C;  1GUG A;  2EDG A;  2K7V A;  3DXJ C;  4KI0 A;  3M85 A;  2D2C C;  1Z6H A;  5BN5 A;  3MXU A;  2K32 A;  3QG1 A;  1A6X A;  3I73 A;  2DNC A;  1IW7 D;  3CRL C;  1GHK A;  1H9S B;  1ZKO A;  1K8M A;  5BN4 A;  2PCF B;  2EJM A;  2A68 C;  3A8I E;  1B9M A;  3VR4 A;  3LNN A;  4LK1 C;  3ND9 A;  2JEA I;  2JXM B;  2JEB I;  2AWO A;  1YNN C;  4DK1 A;  2A6E D;  1HQM C;  2E75 C;  1FYC A;  1TKW B; 
#chains in the Genus database with same CATH topology
 3NEN A;  1CKM A;  4BY7 B;  1L1O A;  2OT2 A;  4HED A;  5IP7 G;  1TS3 A;  2ID0 A;  2J0T D;  1O7Z A;  3TBI B;  1U4R A;  3QWN A;  1OXU A;  5L37 A;  3M7N A;  1LT4 D;  2B2T A;  4OEM B;  4QGU A;  1YNJ C;  5C44 H;  2KCM A;  5I2Y A;  1LLR D;  1CSQ A;  2F1M A;  4DV3 Q;  2AUJ D;  4B3S L;  4B3R Q;  2UXC Q;  2E2I H;  1VQH A;  1BCP B;  2PQA B;  4LF7 Q;  1PH2 A;  3M3Y H;  3MEF A;  2IX1 A;  4H7B A;  1UWV A;  3H0G G;  4J6H A;  2MGS A;  1SR3 A;  2A69 C;  4PMB A;  5LMU L;  1EYD A;  4C3J G;  1N34 Q;  2Z4I A;  3K7A B;  5IP7 H;  3T56 B;  1EWI A;  2F3W A;  4JI4 Q;  1AFP A;  1ZYR C;  4ABN A;  1F2M A;  1EU4 A;  4RKB A;  4RMF A;  4DR4 Q;  5M5Y H;  4KHP L;  3PUW A;  2R7D A;  1PRT B;  1VF5 C;  4A3E G;  4A3G H;  3DWP A;  3HRZ C;  1EUJ A;  3OSO A;  3OWF A;  5M3F B;  3HOY H;  1QZG A;  3NBI A;  4RFB A;  4WRD A;  2OWO A;  3ULP A;  1QVF A;  3N6R A;  1STH A;  4ULL A;  2A1A A;  3T4A C;  2WII B;  4DXF A;  1IYU A;  1I94 Q;  1GUT A;  3L0O A;  1B9N A;  1S40 A;  1KRS A;  3RD4 A;  1YIJ A;  1SYB A;  1VQB A;  1VMC A;  1ENC A;  3MHB A;  4C56 C;  1F77 A;  1VQA A;  5ELD A;  3HEJ A;  4BBR H;  1WTP A;  3M85 A;  3DM1 A;  4KI0 A;  4B3R L;  2UXC L;  1VQL A;  2NYZ D;  1KRT A;  2E2J B;  2F3V A;  3UDX A;  1GHK A;  5BN4 A;  1ML0 D;  3PO3 G;  1B9M A;  1PYW D;  1RHP A;  4DR7 L;  2JEB I;  2AWO A;  1TWA B;  4P75 A;  2D5D A;  4F87 A;  4C3J H;  1YJ9 A;  2HHH L;  2I0Q A;  1ZXT A;  2CQO A;  1CA6 A;  1SFO B;  2PMZ E;  4DR5 Q;  3DWQ A;  2YU9 H;  1EL0 A;  5I6Y A;  3S1R B;  4WJ3 M;  1M8A A;  2Z6K A;  1YNX A;  2B2U A;  1CKO A;  2B2V C;  1G51 A;  4KHP Q;  2F0G A;  4K5X A;  3SGI A;  4NB3 A;  1X3P A;  2B3G A;  5M5W H;  1N36 L;  2N55 A;  2IY5 B;  2K5W A;  4ZLT F;  4O42 A;  4QQB X;  4K5V A;  4HSP A;  1DOL A;  4R1J A;  5CYU A;  3NHH A;  2B39 A;  2VUM B;  3G7L A;  1HTP A;  4NKL A;  2K5V A;  2RDH A;  5EKI A;  3PO3 B;  1IBL L;  4FF3 A;  3FPU B;  1EQT A;  3R2T A;  1X6O A;  4RGM A;  4EQO A;  1BCP C;  3AB9 A;  3URY A;  3R93 A;  1CKN B;  1O80 A;  2R61 A;  2N78 A;  2AQ1 B;  2C5C A;  5DNF A;  3GV6 A;  1B3Q A;  3Q24 A;  3S2H B;  1XYI A;  3GDE A;  3KOJ A;  1PLF A;  2K05 A;  2Y0S B;  1QB5 D;  3JAM i;  5ELC A;  1YEZ A;  1IXR A;  1Q7Y C;  4KN7 C;  4HCS A;  3OMG A;  3KJP A;  4C3H H;  3CPW A;  1XPR A;  4DV2 L;  4JV5 L;  1KDB A;  2F0S A;  4J15 A;  5IY0 A;  1QOH A;  4MTK A;  4PZ7 A;  4BS9 A;  1I6V C;  3V05 A;  3MTS A;  4FF1 A;  1SNQ A;  3GTG H;  5JJI A;  1MKH A;  2ES2 A;  1CHQ D;  4H0L C;  3E6Z X;  3OIP A;  4OEL B;  2L5T A;  3S9W A;  2HHH Q;  3U9S A;  1ET6 A;  1F2L A;  1OXX K;  1U5K A;  2RHQ B;  4DR5 L;  5ELN A;  2E2H H;  2E74 C;  1BOS A;  3R8B A;  1IKL A;  1VCI A;  2XRS D;  4DAP A;  4FXG C;  2B2Y A;  4HTH A;  1LTG D;  4MNO A;  3VYU A;  1WTR A;  4K0K L;  3J81 c;  3KBG A;  3JAM L;  1KLG D;  1L0Y B;  1N36 Q;  3KLS A;  2F0P A;  2K7V A;  4OIJ A;  2D2C C;  1XJV A;  3CMA A;  3QG1 A;  4Y7N B;  4LAA A;  1OTC A;  3CRL C;  3CME A;  3GTL B;  4K6D A;  5LMN L;  3VDY A;  1I4X A;  2I07 B;  3E9I A;  3CCU A;  3BVG A;  3ND9 A;  1DZ1 A;  2JXM B;  3R3O A;  1YNN C;  2A6E D;  2HT1 A;  3CC2 A;  1X65 A;  1IBL Q;  1XXG A;  2PO4 A;  2LXJ A;  1TWF H;  2KCN A;  2DJG C;  2EYM A;  3SK4 A;  1VQP A;  5C4X G;  3T13 A;  2EJG C;  2M2L A;  3SVM A;  1D8L A;  3CAM A;  3TQY A;  3A56 A;  3F2U A;  3HP3 A;  4AIM A;  3WOE A;  5JPN C;  1LO5 D;  1SAP A;  1HTL D;  1EOV A;  3MFY A;  2EXZ A;  4U67 3;  3CU7 A;  3EJI A;  3KF8 B;  1ROD A;  4DV2 Q;  4LFB L;  2RVL A;  1JWS D;  2KQ3 A;  1S5F D;  4R8I A;  2HCI A;  4RH6 A;  1H9S A;  3M4O H;  3UDF A;  2WAQ G;  1CSP A;  5E3F A;  3J7Y W;  4A3F G;  2LXK A;  2Q2H A;  1CT1 D;  1O7L A;  4A3B B;  3U58 A;  2GVA A;  3N52 A;  1Z9F A;  3VYR A;  2A74 C;  1L1O B;  3PQI A;  2O5I C;  2E8G A;  2F0Q A;  3RMH A;  1Q46 A;  2QCP X;  1VDZ A;  3VA7 A;  1HA5 A;  3I70 A;  2F0L A;  3K59 A;  1QNK A;  3TDQ A;  5LMN Q;  2A73 B;  1TII D;  2Z4H A;  5EAY A;  4BXX H;  4CJ2 C;  1XTD A;  1IBK L;  1DYQ A;  1I3Q B;  2NVT B;  3KDF A;  4XQQ A;  5KNC A;  2NBF A;  4B3M L;  3HOV H;  1H9J A;  4I7Z C;  2HDL A;  1RDP D;  5KND A;  4HJ8 A;  3K6O A;  1LV9 A;  4C3H B;  4UP8 A;  3H0G B;  4LNQ A;  3BYT B;  3GD7 A;  4IJH A;  1PV4 A;  4N9P A;  3I4M H;  1Z7T A;  4C3I G;  3JAM c;  4IFD I;  3DEO A;  2EVB A;  1AEX A;  3I90 A;  4M8A A;  2QKI C;  2BCO A;  3CQZ B;  4ODG A;  5IYB G;  1GKH A;  3V2T A;  4HJA A;  3NTH A;  4LFB Q;  1EQV A;  4GLX A;  2PCF B;  3TP7 A;  4PMC A;  3VR4 A;  3HKZ E;  1AE3 A;  2R93 H;  3MVV A;  3RLN A;  2IWH A;  4DK1 A;  4JYA L;  1I50 H;  3GTP B;  2WAQ B;  4G7H C;  2WKD A;  2ZTC A;  1PA6 A;  4IO9 A;  3CCR A;  4O2D A;  4Y7N H;  1EZ8 A;  4DV1 Q;  3KUP A;  3J7A F;  2OXP A;  3ZJY C;  3NQT A;  3A7L A;  3P7J A;  1D5M C;  4HIK A;  1TU2 B;  2IJ0 A;  4XQN A;  3QR8 A;  1QCB D;  3D6C A;  3R2I A;  3TP5 A;  4AQY L;  3D4W A;  4A3E H;  3I4L A;  1MSG A;  2FMC A;  1IYJ B;  5J22 A;  3GV3 A;  3DEP A;  2TSS A;  4GNX B;  3KBX A;  2KCC A;  2L0C A;  5JJZ A;  4ZKC B;  4B3M Q;  3PIP A;  4MTN A;  2AKW B;  1LT5 D;  5CV4 A;  4EQN A;  4YY3 Q;  2BE5 C;  2NTS A;  2NVQ H;  4KN4 C;  3MA2 B;  4KV6 A;  4RCN A;  1F9P A;  3K58 A;  3Q0A A;  2AMC B;  5LHY 1;  3X3N A;  5ELE A;  3RLO A;  4K2K A;  5FLX c;  1SJE D;  2NVY H;  4FXD A;  1EQQ A;  5GAH C;  1HNZ Q;  2IW3 A;  2UXB L;  2ZXP A;  2O5J C;  5FO9 B;  4DR1 L;  1A2U A;  5IYD H;  2UXD Q;  2XN9 C;  4DNT B;  5KRU A;  1QJO A;  4Y52 H;  1Q86 C;  3G6J B;  1PXU A;  4LMQ D;  1SXT A;  1Y1W B;  1TWG B;  2I46 A;  2BH8 A;  3A5U A;  1U0L A;  1V9P A;  1TR5 A;  3F1Z A;  2JA8 B;  4IPC A;  3G6E A;  4IUT A;  1G2T A;  2EY6 A;  3I55 A;  1TWC H;  1YNJ D;  1STG A;  2F52 A;  5A2Q L;  2HUG A;  5EPL A;  1CK1 A;  3K80 C;  3VR2 A;  4PNY A;  5JVH 3;  2FXQ A;  3HFZ B;  3TP6 A;  2MJ8 A;  4A3F H;  2KA7 A;  2IHE A;  2PZT A;  3NQI A;  1JB7 A;  2E2H B;  3A8K E;  4YHH Q;  1GUG A;  1R4P B;  3FKI G;  4A4I A;  1SRU A;  3L9A X;  4B9W A;  1UE7 A;  4KK7 A;  4C3J B;  3HOU H;  1IW7 D;  1GXD C;  5EGT A;  2RCF A;  3H91 A;  4L5S A;  4L5R C;  1PRT D;  2A68 C;  2EY2 A;  4YY3 L;  4DR2 Q;  2CQA A;  3D3R A;  2CHB D;  4OWX B;  4A93 H;  2IX0 A;  4BA1 I;  4JI0 L;  2A5H A;  1V43 A;  3BZD B;  3KYH C;  1TT2 A;  3VA5 A;  2HDM A;  5C4X H;  3A74 A;  1F9S A;  1TWC B;  1U4L A;  1PMR A;  1NBW A;  3WOF A;  4C2M B;  1FL0 A;  4HSV A;  3AFP A;  4M1U B;  1HNZ L;  2K01 A;  1Q8K A;  4PMW A;  4UPA A;  2R93 B;  2UXB Q;  2BDN A;  3Q6S A;  1I50 B;  2OTL A;  4KKS A;  3GTM B;  2TMP A;  2UXD L;  5IYD G;  3CCM A;  2CH4 W;  2C9O A;  1HQR D;  1EY5 A;  3CCL A;  2PNH A;  1BBU A;  4O0A A;  1G8Z D;  4GKK L;  5IWA L;  4DF7 A;  4BY1 B;  5EBD A;  3HOY G;  2NWG A;  5AJ3 Q;  1KNE A;  1VQ7 A;  2JA5 G;  3J81 j;  2WAQ E;  1HNW Q;  3NTK A;  1A3V A;  1PFM A;  1WI5 A;  3BDC A;  1TQO A;  1RJT A;  3HKZ B;  1VQN A;  2UUB Q;  4G4K A;  4DV3 L;  3D6W A;  3PMF A;  1JOK A;  2MUY A;  2C35 B;  3W1B A;  1Q1B A;  3PO2 G;  5C0X J;  3OW2 A;  3QJY A;  4R9W A;  3RN5 A;  4LF7 L;  1H95 A;  1CTM A;  2OQ0 A;  2D0P A;  4CHT B;  1LTL A;  2F0V A;  1BKB A;  2ZXO A;  1WTX A;  1N32 Q;  5LMU Q;  1N34 L;  3CPF A;  2WIN B;  4POF A;  1EY4 A;  1AW7 A;  1SFO H;  4ZUJ A;  3TSS A;  1NNX A;  3L2P A;  1TS4 A;  3CC4 A;  1NY4 A;  4DV7 Q;  2D62 A;  1E0B A;  5ELF A;  1Q1E A;  2JA5 B;  3NSW A;  1Y8N B;  3GQB A;  1CI3 M;  2VQE L;  3IRB A;  4G7O C;  1KNA A;  2F0E A;  5EBC A;  5A2Q E;  2NZ1 D;  1V1P A;  4NXN Q;  4A3D B;  1II3 A;  4G57 A;  3BYY B;  1CZG A;  3I4N G;  1BBX C;  1TS5 A;  5IWA Q;  1ENA A;  1SYF A;  1STE A;  4A3F B;  1E1T A;  1B53 A;  3E3X A;  4IZ8 A;  1XMQ L;  3GTQ H;  1J5E Q;  5AJ3 L;  3UE0 A;  1TVX A;  3HOY B;  2AHO B;  2R3Z A;  3J80 E;  1PH1 A;  4FP5 D;  1VQ5 A;  1TKW B;  1HNW L;  3C3L A;  1Y14 B;  1C0A A;  3A5Z B;  2K52 A;  4FYD A;  5EPJ A;  1KTK A;  3HOV G;  2JN4 A;  3K8A A;  2RQX A;  2BOS A;  1GUO A;  5J39 A;  1STA A;  1SNO A;  2E76 C;  3PUX A;  2XRQ D;  5JAV A;  2EY5 A;  5GAE C;  3S1Q B;  1A15 A;  1LAB A;  1ILQ A;  5E1F A;  4RGT A;  2UUC L;  1JJ2 A;  4DR7 Q;  2XNA C;  3LWE A;  3D8G A;  3I2Z A;  5CV8 A;  2Z1C A;  1EFI D;  3IKJ A;  4GZY C;  3S17 H;  1ICF B;  4DAM A;  4DV4 Q;  3KLR A;  3E0E A;  1LT3 D;  2HD3 A;  2R7Z B;  1OXT A;  4IUR A;  1HPC A;  4JI1 L;  1UUP A;  5IGG A;  3D4D A;  2PW7 A;  3PSI A;  4DV0 L;  3HOZ G;  1OXV A;  2AQ2 B;  1QZH A;  1DOK A;  5GRO A;  3C2P A;  5M3F G;  2PI2 A;  1A8V A;  2ALY B;  1WTO A;  5CMD A;  3OIQ A;  4N9T A;  1KXL A;  5BR8 Q;  1XMQ Q;  2GVB A;  4DR3 L;  1HZA A;  4GLV B;  4JI7 Q;  1LTB D;  2X6G A;  4RG1 A;  3ULL A;  1PH6 A;  2XGT A;  2QGQ A;  3PO2 H;  4N8X 1;  4XXE A;  2EYH A;  3T1Y Q;  2Q2T A;  1CHP D;  1Y1V G;  2L12 A;  3BG3 A;  3SE0 A;  3PO3 H;  1ET9 A;  3MAQ A;  3MC0 B;  3HOW B;  2VS1 A;  3DWA A;  1KC8 C;  3ERS X;  4DAY A;  2KJX A;  4IAL A;  1WTV A;  4R4Q A;  4JV5 Q;  3MZ5 A;  1ICW A;  3HKZ G;  4F88 A;  1A6X A;  2ZTE A;  2Y0S E;  2DNC A;  2JP1 A;  4IUQ A;  5EPK A;  5I6W A;  4A3K B;  1YVC A;  1D1I A;  2EJM A;  1RD9 D;  2MHV A;  4OWW B;  3FDT A;  1HNX L;  3FVQ A;  2ATW A;  5JJL A;  2RBM A;  1SNC A;  2LFN A;  4RHS A;  1C7Y A;  1HR0 W;  1RL2 A;  1TS2 A;  4NXM L;  1MJE A;  4GS3 A;  1DXM A;  2RKS A;  1N33 L;  1M4V A;  4FVM A;  4N8F A;  1J9O A;  1OXS C;  4DAY B;  1XMO L;  2H4O A;  1EYC A;  3TRE A;  3EQL C;  4IJL A;  4DV0 Q;  1BNZ A;  5HGQ A;  5HUR A;  2WB1 G;  5IGF A;  2A6E C;  3M3Y B;  2Q2U A;  2R93 G;  2K4K A;  1K28 A;  1Q81 C;  2Z6K C;  4HAE A;  5BR8 L;  1JIC A;  5EQ0 A;  3T16 A;  4BBS H;  4K6L A;  2NVT H;  1KQS A;  2MP1 A;  4JI7 L;  2O4X A;  1GOZ A;  1YHA A;  1A2T A;  2N8N A;  3FKI H;  2PMZ B;  3EBE A;  3I4O A;  2K1B A;  2MO1 A;  1DCZ A;  4K14 A;  3TS0 A;  1XX8 A;  3MXN A;  5M3M B;  2B63 G;  1VQM A;  1I5F A;  2FMM A;  3NBH A;  1MIU A;  3PF4 A;  2BE5 D;  3BS1 A;  2B29 A;  3GP7 A;  3I4M G;  5KYL A;  4HR7 B;  2DGY A;  1T5E A;  4X3K A;  1C48 A;  1HRJ A;  1EY7 A;  4L5Q A;  1PDQ A;  4OIK A;  2KBN A;  2JYO A;  1Y69 U;  1VQ8 A;  2J4X A;  2QF7 A;  1EIY B;  4QL5 A;  3S2H H;  3C1F A;  1HNX Q;  5C0X H;  4LF4 Q;  2PNR C;  1S4Z A;  4A3G B;  4L8J A;  2RHS B;  2F0N A;  5CBE E;  4A93 G;  3RZO B;  4BBS G;  3SR1 A;  1X3E A;  3SDZ A;  2F0O A;  1O78 A;  5IT9 E;  1B1Z A;  4UAI A;  3ULJ A;  4JK1 C;  1XMO Q;  2R7Z G;  2BA0 A;  2ICI A;  3OHX C;  1UEB A;  5CBA E;  4DV6 Q;  2I5M X;  2JK8 A;  5BN3 A;  2JA6 B;  1EIG A;  4DK0 A;  4FXK C;  4JI8 L;  2MO0 A;  1JE4 A;  2VXW A;  1B3A A;  4NP5 A;  2SDF A;  1HA6 A;  4CBV A;  3E9H A;  5FLM G;  3I7F A;  3A8I E;  2LSS A;  3K0Y A;  2D0O A;  2DY8 A;  4A76 A;  2YU9 B;  2H1E A;  3KK7 A;  2KHJ A;  3PV0 A;  4DUY Q;  2KHS A;  2NVY B;  4X66 L;  5IE8 A;  1A0I A;  5FO8 B;  2DN8 A;  4V19 0;  2EPB A;  3CC7 A;  2FIN B;  2NVX H;  1K3B C;  2LS0 1;  1ASZ A;  3NEL A;  3P75 A;  3CCE A;  1KLU D;  4A3J H;  3K5N A;  2E5L Q;  4KY5 A;  2ASB A;  1YHB A;  4H02 A;  3PIP 3;  1Y8P B;  4PV1 C;  2WB1 B;  2IL8 A;  1E2W A;  4CKC A;  1I6H B;  2PZW A;  2JA6 H;  1X3Q A;  4LF5 Q;  3ERO A;  1L1O C;  1JWM D;  4JYA Q;  4LF4 L;  1VF7 A;  4TRD A;  2DUD A;  2JA8 H;  5DM6 3;  2NB0 A;  1B8A A;  1WCM H;  1F9Q A;  5C3W A;  3H3V C;  5JOB A;  3S1M B;  2DY7 A;  4CDC C;  1QUQ A;  3LX0 A;  3RZD H;  1D6E C;  4U68 A;  4DV6 L;  1DD2 A;  2IHF A;  2VW9 A;  1BCP F;  4A3D G;  1EWH A;  1HZC A;  3HS0 C;  1PZJ D;  3S2D B;  2CWA A;  4AQY Q;  1YBY A;  2I5H A;  4JI2 L;  3KLW A;  3SHL A;  4JI8 Q;  1H9K A;  3QIA A;  5KNB A;  2RSO A;  5T1G A;  3EA6 A;  1O7I A;  4E6I A;  2G5D A;  3PUZ A;  1XPO A;  2LMC B;  4ZUI A;  4KHV A;  4KKT A;  5C3E H;  1JOR A;  2A19 A;  2WV6 D;  1EY8 A;  1VQC A;  1VQ6 A;  3S15 H;  4C3H G;  4EQ5 A;  3CCV A;  1WCM B;  5JEA H;  4IPH A;  2OEO A;  3L7Z C;  2KCT A;  3OOC A;  4DUY L;  4C2M H;  4X66 Q;  1BXT A;  3V96 A;  1RTN A;  3H6M A;  3MXP A;  3FHW A;  3GTG B;  3TN2 A;  4APV A;  4QMG A;  3J7Z C;  1CA5 A;  1WTQ A;  3E5S A;  4MZ9 A;  3GTM H;  1H9M A;  4DK3 C;  2CWP A;  3F2B A;  5C0X G;  4R4T A;  2K5Q A;  1L2F A;  4BY1 G;  2E2I B;  1K73 C;  3H0G H;  1PTO B;  1QVG A;  3P1H A;  4AYB E;  4ILW A;  2KEN A;  2PQE A;  1NJI C;  4R4I A;  5C5L A;  1ILP A;  5C3E B;  1BQQ T;  4TSS A;  1JOQ A;  1VQI A;  3TRZ A;  4CDD C;  4JPB W;  4PG3 A;  3MEH A;  1KHI A;  3UDG A;  4QCL A;  2K28 A;  2EJF C;  2YTV A;  2EYP A;  4BA2 I;  2XSC A;  2HQE A;  5HGT A;  4QB4 A;  2A6H D;  3ERQ A;  4JI2 Q;  4YHH L;  1EY6 A;  1EYA A;  2VZA A;  4QF4 A;  1LYL A;  2F0K A;  4JBM A;  5M3F H;  3D4R A;  3KDF B;  1W6K A;  5K36 G;  2Z0S A;  3EIV A;  3K5L A;  3CF5 A;  3ITP A;  2JSO A;  3T1H Q;  1PYB A;  3M4P A;  2D9U A;  1HH2 P;  5M5X B;  4A3B H;  1GUS A;  2R6G A;  1X3G A;  1F9R A;  3CCS A;  1B70 B;  1S5B D;  1JJG A;  1K3R A;  3F8T A;  4A3L H;  5IGD A;  4JI5 Q;  2IPK D;  1UEA B;  3I4N B;  2KEC A;  3CW2 C;  4ME3 A;  3HOX B;  3AYH B;  4DU9 A;  4BY7 G;  1PTO D;  3S1M H;  1B2T A;  4BBR B;  3RZD B;  4OHJ A;  3I56 A;  2R92 B;  2XIW A;  3MXN B;  2F0T A;  1L0X B;  4IUP A;  2L4N A;  1BF4 A;  1BCP D;  4X3T A;  2HCC A;  2WAC A;  3HOZ B;  1S5E D;  2Z6B A;  1EQR A;  3OYY A;  4IQZ A;  5JPM C;  1TWA H;  3ONA B;  2UUB L;  2K75 A;  4JI6 Q;  3QOL A;  1HJP A;  4YCW A;  5EKL A;  3W3A A;  2EYL A;  4DXG A;  1L0W A;  1Y1W H;  4JG2 A;  2IX3 A;  1X32 A;  4UP9 A;  3KLS X;  4QIW B;  3TEH B;  5LMN W;  3H15 A;  2FHT A;  1GVP A;  4KJO A;  3CD6 A;  2ZTD A;  2MNA A;  4A3J G;  3I4N H;  4RGN A;  5G3L F;  3S1N H;  1G2S A;  1IKM A;  1DGS A;  1N32 L;  3S14 H;  1F2Z A;  4DUZ Q;  3A54 A;  4IPG A;  5IT9 c;  2B63 B;  1RF2 D;  2K5D A;  5JVG 3;  1A63 A;  1B44 D;  3PIO A;  1I4R A;  3CCJ A;  4DV7 L;  4ALP A;  3DMU A;  4JVZ A;  4A3M B;  4YIJ A;  1VQJ A;  2K14 A;  5G3L D;  1KD1 C;  4A3J B;  1PTO C;  4CKE A;  1G6P A;  2DJF C;  3G71 A;  4HMI A;  3NWS A;  5T1I A;  4JI5 L;  5FK9 C;  1FGU A;  1HZB A;  2VQE Q;  1EU3 A;  1UNS A;  3UE1 A;  1V1P B;  3CP0 A;  1S5D D;  1HZ9 A;  4K8I A;  4L6T B;  1SNM A;  3STB D;  1JMC A;  2I5L X;  4NXN L;  1EOT A;  5KGU A;  1JT8 A;  4GKJ L;  1WTW A;  2K50 A;  1JR0 D;  2JA5 H;  4DFA A;  2CFM A;  2F0M A;  2OQK A;  1PFN A;  3OWE B;  1B7Y B;  2PW5 A;  4GLA C;  5FOB B;  1VQO A;  1J5E L;  1VQK A;  2EXD A;  1Q3L A;  3PCO B;  3A8J E;  1TXY A;  3KF6 B;  3RR5 A;  4QY7 A;  1SDF A;  4XDX A;  3EN2 A;  4JI6 L;  3TZU A;  3T53 B;  1HR0 Q;  1R9T B;  4A3K G;  3IL8 A;  3U9O A;  5E4X A;  1KIX A;  1ONL A;  4DV5 L;  1I3Q H;  3FRP B;  1LTI D;  1J6Q A;  2UUC Q;  1GUN A;  2Z8L A;  3S15 B;  1RTO A;  3BDO A;  3S24 A;  1KAA A;  3SK6 A;  4DUZ L;  2LKV A;  4YWL A;  3BDL A;  5C44 G;  4EVO A;  2BH2 A;  5M5W B;  3TME A;  4ZAI A;  4DV4 L;  3NEM A;  3X3M A;  1Q8I A;  1T9H A;  2F4I A;  1FJG Q;  1VQG A;  2R7F A;  3STB C;  1SYC A;  4JI1 Q;  3M4Q A;  1ENF A;  3MWY W;  2YV5 A;  4HJ7 A;  3NUC A;  1Q90 A;  1PH9 A;  3K81 C;  1KAW A;  3HOZ H;  4GKJ Q;  4UDU C;  1BDO A;  1AZQ A;  4BBR G;  4MN3 A;  1UE5 A;  2VB3 X;  3EFX D;  4RGO S;  4C1N K;  1IYV A;  4GN4 B;  2JA7 G;  4WOR A;  4DR3 Q;  1FD7 D;  4IUU A;  2UUA L;  4KJN A;  3KJO A;  5K5P A;  5KYI A;  5D14 A;  3AQQ A;  5M3M H;  2JEA I;  3T1Y L;  4DN4 M;  1X54 A;  3HGB A;  1WVL A;  2MQH A;  1NR4 A;  2Y0S G;  4HJ5 A;  1NCV A;  1X3F A;  3ZYY X;  3SEB A;  4QUC A;  1E2V A;  3GTQ B;  4X65 L;  2ZT9 C;  1NUC A;  2QDL A;  1LT6 D;  1NMF A;  3W1G A;  1YI2 A;  1GUW A;  5HY6 A;  4ZQ3 A;  2VUM G;  2RDG A;  4I7A A;  4CKB A;  1K83 B;  3T51 B;  4NXM Q;  3GTL H;  1N33 Q;  2PQA A;  2LY7 A;  1VS0 A;  4G7Z C;  1V8Q A;  1ZEQ X;  2PZU A;  4LJZ C;  4B08 A;  2X6L A;  3RNU A;  4IFD G;  1EFW A;  3J81 E;  1UAP A;  1U4M A;  4GN3 B;  1K8G A;  1SNP A;  3BVZ A;  4X3S A;  1YJN A;  5JEA J;  3HKS A;  3OMC A;  4RA8 A;  1TWH B;  2UUA Q;  2KUM A;  4KHZ A;  1NAP A;  2R92 G;  4OO1 H;  4MIU A;  1SYD A;  4BBS B;  4NW2 A;  4LWC A;  2L1B A;  1C4Q A;  2L55 A;  1QNU A;  3WDN A;  2F4V L;  1I4Q A;  1S5C D;  2N49 A;  4XYO A;  5IGE A;  3U4Z A;  4X65 Q;  1A3U A;  1XNR L;  1Y1V H;  1ZYR D;  2EYO A;  4RAU C;  5CV7 A;  4DNI A;  4WFN 3;  5FLX E;  5I9O A;  4PZ8 A;  2EY1 A;  1GHJ A;  1SE4 A;  1YNN D;  2K33 A;  2E2J H;  2ZM6 L;  4OX9 Q;  5CV5 A;  3J80 c;  4K8J A;  3OTO L;  2Q8R E;  4PZ6 A;  1WYD A;  2YTX A;  3I73 A;  4BY7 H;  4RCO A;  5KIX A;  5ISR A;  3AMU A;  2NVQ B;  3H3V H;  4LF9 Q;  4GKK Q;  1EY0 A;  5GQO A;  2F0U A;  1W6J A;  2A8V A;  1PH7 A;  2VB2 X;  5J3B A;  1PH5 A;  3HOV B;  1K0S A;  1HQM C;  2OTJ A;  2FJ2 A;  4NPS A;  5IYC G;  2XVS A;  1A62 A;  4IFD H;  3PGZ A;  3J81 i;  3S2D H;  4Q5V A;  4Z9C B;  4KTA A;  4NMZ A;  1MBY A;  4RKL A;  2A68 D;  1A3T A;  1W2B A;  1O7Y A;  1MJC A;  1RKN A;  3ICE A;  2CKZ B;  2CH4 A;  1TY2 A;  1HCZ A;  3BJU A;  3CRK C;  3CQZ H;  4R8N A;  1G29 1;  4X62 Q;  1PFB A;  5CV9 A;  1SYG A;  1JOO A;  1S3O A;  4DR6 L;  1DON A;  4C3I B;  2F4V Q;  5I9P A;  1CQF A;  1M1K C;  4KY7 A;  1EWC A;  4B3T Q;  3CKI B;  2E5L L;  1BUV T;  4A3I G;  5CC4 A;  5C4J B;  4JI3 L;  1K83 H;  4FDB A;  3FKI B;  4P2C B;  2KOL A;  2YYZ A;  3NE5 B;  3M4O B;  3HOU G;  4AH6 A;  3AFQ A;  3OTO Q;  4LF5 L;  3DM3 A;  5GAD C;  1K8O A;  3M4Y A;  1JCK B;  2O2L D;  1AN8 A;  3PO2 B;  2F0H A;  3DLL A;  4LF9 L;  4LUO A;  5COY A;  4LUV A;  3U50 C;  1PVO A;  2XTI A;  3ER0 A;  4A93 B;  5IT9 L;  3JAM E;  2CVR A;  2L9H A;  4LW1 A;  4LFC Q;  5IYC H;  1I4G A;  3K5M A;  1NSN S;  3JC6 6;  1E3P A;  4B9X A;  1VQ9 A;  3Q23 A;  4A3G G;  5DAU A;  3K0X A;  3Q22 A;  1PZI D;  5FKA C;  4WJW A;  1R4Q B;  3CXC A;  1PRT F;  5CGK A;  5IOC A;  3FPP A;  2ICE C;  2CW0 C;  1JQY D;  4UY8 C;  2JQO A;  5C6A A;  4A3K H;  1CFM A;  3H94 A;  3IFD A;  2B8G A;  4HN7 A;  4YWM A;  2EE1 A;  2SNS A;  5FLX L;  4AYB B;  3BVM A;  1OO9 B;  2HQL A;  2RCN A;  4L5T A;  3TZD A;  2RDF A;  4X62 L;  1H9S B;  1W3S A;  4GN5 A;  1LTA D;  1K8M A;  4DKA C;  2ZJR A;  2KVM A;  4B3S Q;  4KY6 A;  1TWG H;  4DR6 Q;  3E0J A;  3F2C A;  1NMG A;  2X69 A;  4S3S A;  1FVI A;  2K5N A;  4B3T L;  1S72 A;  4LFA Q;  1WTH A;  3HOX H;  2WKC A;  2F03 A;  1AH9 A;  1GJX A;  4OO1 I;  5IP9 H;  3VYS A;  2RF4 A;  5M5Y B;  3G4S A;  1D1K A;  4JI4 L;  3A55 A;  2F0F A;  1AZP A;  4NDX A;  4L63 B;  4JBW A;  4OL7 A;  4DR4 L;  1CUK A;  2BDO A;  5JEA G;  2K04 A;  2WP8 J;  1PTO H;  3S16 B;  1QVC A;  1P8L A;  1EIF A;  1N9W A;  2QIL A;  1CZW A;  2B2Y C;  3NP8 A;  4LFC L;  1MSH A;  1RIP A;  2K03 A;  2CW0 D;  3K5O A;  3BU2 A;  3NWT A;  4DAV A;  3HOX G;  3HG9 A;  1EZ6 A;  5FO7 B;  5TSS A;  3H3V I;  1I94 L;  1Y1W G;  3KF8 A;  4TQU S;  3AU7 A;  4TKO B;  5FJ8 G;  2IT1 A;  5C44 B;  3T1H L;  5F2D A;  1MHW C;  4X3U A;  5I2X A;  1NR2 A;  1SMY D;  2MPM A;  4MHE A;  1CQV A;  2H5X A;  2Q8I B;  1P16 A;  1PYS B;  4IUV A;  4OXP A;  4FF4 A;  4QUF A;  4CGY B;  4HIO A;  1LTR D;  1PHJ A;  1WCM G;  4BY1 H;  3I4M B;  1Q12 A;  2SEB D;  5C5M A;  4JW0 A;  5C4H A;  3FMC A;  2YTY A;  4LFA L;  1SBB B;  1GO3 E;  1LTT D;  1E2Z A;  1ESF A;  5AFW A;  4ZRZ A;  3RZO H;  1WFQ A;  1IZ6 A;  5IOD A;  1GD7 A;  3GTJ B;  5ELB A;  4A3I H;  1IL2 A;  4CJ0 B;  4ZYS A;  5BN5 A;  5GAG C;  5E4W C;  1BO0 A;  3S17 B;  2KEE A;  5C3E G;  1DM0 B;  1XNQ L;  3J7A V;  5C3X A;  2B2V A;  2B2U C;  3MFG A;  1D5X C;  1R9T H;  1JB3 A;  1HHV A;  5FLM H;  1SSO A;  1X9N A;  2E75 C;  4IN3 A;  3VR6 A;  4A3C G;  1HFG A;  2FFK B;  3HOU B;  1SEB D;  3VR3 A;  5IP9 G;  4FF2 A;  5IGB A;  4QJF A;  4YCU A;  4ZK9 B;  1B50 A;  3K57 A;  4KLK A;  1QUQ B;  1SE8 A;  4IFD J;  1J8I A;  1X56 A;  3DHQ A;  4P72 A;  1YJW A;  3C46 A;  2JA9 A;  2KED A;  1XPU A;  1U9R A;  4C1N I;  1STY A;  3CHB D;  4CJ1 B;  1CKN A;  1D5Z C;  3GTO H;  1D2B A;  2NVX B;  1T5X D;  1UE1 A;  3BZK A;  3KF6 A;  5E7N A;  1N8R C;  5C4X B;  2G9H D;  1LM0 A;  4CDF C;  1KDC A;  3HOW G;  3S14 B;  1PH4 A;  1AP0 A;  5M9O A;  1XWE A;  4DPG A;  2JA6 G;  4Q0F A;  1FR3 A;  2A6H C;  1VMP A;  1RCV D;  2N88 A;  2M9V A;  3QO2 A;  4A3M H;  5NUC A;  4ME5 A;  2MFI A;  3L3O C;  2RSN A;  3S16 H;  1SLJ A;  2SNM A;  4IUN A;  3FEW X;  2F3I A;  3M7G A;  1KL9 A;  4LUZ A;  2Q8T A;  4C3I H;  3FP9 A;  4CDE C;  5C4Z A;  2JA7 B;  3O13 A;  5M5X H;  1NE3 A;  2ENB A;  3Q8D A;  1JC7 A;  1F2Y A;  3J81 L;  1SND A;  2Z9H A;  1DJR D;  1QWY A;  3MXG A;  3LGJ A;  4K0K Q;  3GTO B;  2EYF A;  4HIM A;  4LF6 Q;  1XNQ Q;  1V1Q A;  1PZK D;  2JA8 G;  4XT1 B;  1PFS A;  2P5Z X;  4R4C A;  1HR0 L;  2E2D C;  2VUM H;  3A7A B;  5JJK A;  1SE2 A;  1YZ6 A;  4A3C H;  3I91 A;  4DV5 Q;  1MD2 D;  1WD0 A;  5LL6 X;  2F0I A;  3SK8 A;  3PUV A;  2B8F A;  2QEJ C;  1DOM A;  2NN6 H;  3OW7 A;  2R7Z H;  3M9B A;  3VR5 A;  2JA7 H;  2WFW A;  2VY3 A;  3PIO 3;  3J7A 5;  2V4D A;  3GTP H;  1NTG A;  2EDG A;  2L11 A;  1HUN A;  1Z6H A;  1STN A;  3MXU A;  2K32 A;  1C8C A;  2G9D A;  2UU9 Q;  2EYJ A;  5M3M G;  5H1S E;  2VL6 A;  2XWB B;  1Q82 C;  1FJG L;  2B2T C;  2F0J A;  1K8A C;  1WOC A;  1QE6 A;  5D3I B;  4LK1 C;  1LUZ A;  4OWT B;  1E1O A;  4A3L G;  4JBJ A;  4XYQ A;  4A3D H;  3QOJ A;  1EIH A;  3A0J A;  2F0D A;  2EOT A;  1MI2 A;  5CV6 A;  2JJQ A;  1FGB D;  2NUC A;  3RLF A;  1E22 A;  4DA2 A;  5IYB H;  4WJ4 A;  2WB1 E;  3OPO A;  5J1Z A;  3I3C A;  4A75 A;  2VNU D;  1VQD A;  4H44 C;  3VYT A;  1SMX A;  1TWH H;  3D0F A;  3NBH B;  4V0B A;  1LAC A;  4LF6 L;  5CR3 A;  2Q2I A;  1FNW A;  2EIF A;  2PPB C;  3S1R H;  3TS2 A;  1CM9 A;  4P73 A;  1PTO F;  3W2D A;  1K9M C;  3SK5 A;  1D7Q A;  3S1Q H;  4A3M G;  4J8Q A;  1IBK Q;  3SXH A;  5LL6 S;  2QDB A;  2L15 A;  1Y1V B;  4FO2 A;  3TP8 A;  1BBW A;  1Z47 A;  1FNV A;  1SE3 A;  5A35 A;  4OON A;  2NN6 G;  1VQE A;  4TVA B;  4GOP C;  1QG7 A;  1KDA A;  4XQJ A;  2M00 A;  5I4D A;  2J7Z A;  4AYB G;  1WJJ A;  3J80 i;  5IGC A;  1KAB A;  5K36 H;  3K7U C;  3H09 A;  3UI2 A;  2UU9 L;  2NZH A;  3AEV A;  4X64 Q;  4QIW E;  2EQS A;  1H9R A;  2R92 H;  2AUK A;  2B2W C;  3U4V A;  1IBM L;  4OO1 G;  1JE5 A;  2ZXR A;  2HIV A;  3IFT A;  4HID A;  3PF5 A;  1WD1 A;  1QIL A;  4BWG B;  1MGS A;  1JJC B;  3NXW A;  3PUY A;  4H13 C;  2EZV A;  2DNE A;  1IW7 C;  4HJ9 A;  3GTJ H;  2CCZ A;  2OCE A;  1HFN A;  3P20 A;  1YIT A;  3G48 A;  1STB A;  5D65 A;  3S1N B;  1U4P A;  2QEX A;  4DV1 L;  2NTT A;  2QA4 A;  1XTC D;  1I6H H;  1FNU A;  1YHQ A;  3I72 A;  4I65 A;  2OF1 A;  1TY0 A;  3NK9 A;  5D3D A;  4BXX G;  1VQ4 A;  2GN5 A;  4K5W A;  3C1E A;  5DEH A;  5C0X I;  1EY9 A;  1ZKO A;  4A3I B;  1E24 A;  4EQP A;  4GOP B;  4X6A H;  4LF8 Q;  2K6A A;  1SJH D;  1UE6 A;  4ZCK A;  4GNX A;  3LNN A;  5EKK A;  2NZO A;  4JC0 A;  1G6Z A;  2ZJQ A;  1JWU D;  3QB3 A;  4FNF A;  4P71 A;  4JOI A;  4P74 A;  3D31 A;  1XNR Q;  2SOB A;  1PH3 A;  4DK6 C;  4JOI C;  2F0W A;  4IOA A;  4DGZ A;  3RN2 A;  1HXY D;  1I4H A;  2VQF Q;  4GNX C;  2N3S A;  2ZM6 Q;  4OX9 L;  1M90 C;  2AQ3 B;  4DNR B;  1ASY A;  1LTS D;  1EEF D;  1TWF B;  3HZX A;  2QW7 A;  1SN8 A;  3KFU A;  4ID6 A;  4X64 L;  3W5O A;  4IOC A;  4DR1 Q;  1ESR A;  3K7A H;  4K2L A;  1IBM Q;  1IHZ A;  2AWN A;  4PQX A;  5KEE A;  2NN6 I;  5IIF A;  4KD4 A;  2PYK A;  1SYE A;  3LWU A;  3GTK B;  1G91 A;  2PI2 E;  5COR A;  4EGV A;  1V1O A;  4POG A;  3EVQ A;  2HIX A;  3I8Z A;  4RWS C;  4XIG S;  5ELO A;  1E7Z A;  1BVS A;  1IL8 A;  2B2W A;  2BA1 A;  1Y8O B;  4F8M A;  1SRO A;  3UDI A;  5DM7 3;  5EJW A;  1X55 A;  1AE2 A;  3B6Y A;  4A3E B;  3DUZ A;  1PH8 A;  4KD3 A;  2V1C C;  1I4P A;  1B4O A;  1VQF A;  4LF8 L;  2JE6 I;  1SMY C;  4JCV E;  4OGQ C;  4JBK A;  4GOP A;  1EEI D;  3NPP A;  2XWJ B;  4ZKB B;  4XTC S;  1HUM A;  4DR2 L;  4J1M A;  4JI3 Q;  5FJ8 H;  1K0R A;  4UP7 A;  4R4O A;  2VQF L;  3GTK H;  4JI0 Q;  2KHI A;  1PRT C;  4F7X A;  3BZC A;  4KKU A;  4IPD A;  5DLQ E;  2ZJP A;  2B63 H;  2A69 D;  1BR9 A;  4XT3 B;  3WWV A;  5C4J H;  4YWK A;  3ND8 A;  3GO5 A;  4KMU C;  3DXJ C;  3IAY A;  1C9O A;  2GA4 B;  1GM5 A;  4YCV A;  4A3B G;  4HCE A;  4O1N A;  3HOW H;  1EYG A;  3NTI A;  3J80 L;  4EX5 A;  3CCQ A;  4RHR A;  2RA4 A;  4HMJ A;  2K5H A;  4UHV A;  3RUZ A;  3F2D A;  1FYC A; 
#chains in the Genus database with same CATH homology
 4BY7 B;  2OT2 A;  4HED A;  1TS3 A;  2ID0 A;  2J0T D;  1O7Z A;  3TBI B;  1U4R A;  3QWN A;  1OXU A;  3M7N A;  1LT4 D;  2B2T A;  1YNJ C;  5I2Y A;  1LLR D;  2F1M A;  2AUJ D;  1BCP B;  2IX1 A;  4H7B A;  4J6H A;  2MGS A;  2A69 C;  4PMB A;  1EYD A;  4C3J G;  2Z4I A;  3K7A B;  3T56 B;  2F3W A;  1AFP A;  1ZYR C;  4ABN A;  1F2M A;  1EU4 A;  4RKB A;  3PUW A;  1PRT B;  1VF5 C;  3DWP A;  3HRZ C;  3OSO A;  3OWF A;  5M3F B;  3NBI A;  4RFB A;  4WRD A;  3N6R A;  1STH A;  4ULL A;  3T4A C;  2WII B;  4DXF A;  1IYU A;  1GUT A;  1B9N A;  3RD4 A;  1SYB A;  1VMC A;  1ENC A;  3MHB A;  4C56 C;  1F77 A;  5ELD A;  3HEJ A;  1WTP A;  3M85 A;  3DM1 A;  4KI0 A;  2NYZ D;  2E2J B;  2F3V A;  1GHK A;  5BN4 A;  1ML0 D;  1B9M A;  1PYW D;  1RHP A;  2JEB I;  2AWO A;  1TWA B;  2D5D A;  4F87 A;  1ZXT A;  1CA6 A;  1SFO B;  3DWQ A;  1EL0 A;  5I6Y A;  3S1R B;  1M8A A;  2B2U A;  2B2V C;  2F0G A;  4K5X A;  1X3P A;  2N55 A;  2K5W A;  4ZLT F;  4O42 A;  4K5V A;  4HSP A;  1DOL A;  5CYU A;  3NHH A;  2B39 A;  2VUM B;  3G7L A;  1HTP A;  4NKL A;  2RDH A;  5EKI A;  3PO3 B;  4FF3 A;  3FPU B;  1EQT A;  3R2T A;  4RGM A;  4EQO A;  1BCP C;  3AB9 A;  3URY A;  3R93 A;  1O80 A;  2R61 A;  2AQ1 B;  2C5C A;  5DNF A;  3GV6 A;  3Q24 A;  3S2H B;  1XYI A;  1PLF A;  2K05 A;  2Y0S B;  1QB5 D;  5ELC A;  4KN7 C;  4HCS A;  3OMG A;  1KDB A;  2F0S A;  1QOH A;  4BS9 A;  1I6V C;  3V05 A;  3MTS A;  4FF1 A;  1SNQ A;  1CHQ D;  4H0L C;  3E6Z X;  3OIP A;  2L5T A;  3S9W A;  3U9S A;  1ET6 A;  1F2L A;  1OXX K;  2E74 C;  1BOS A;  3R8B A;  1IKL A;  1VCI A;  2XRS D;  4DAP A;  4FXG C;  2B2Y A;  4HTH A;  1LTG D;  3VYU A;  1WTR A;  3KBG A;  3JAM L;  1KLG D;  1L0Y B;  3KLS A;  2F0P A;  2K7V A;  4OIJ A;  2D2C C;  3QG1 A;  4Y7N B;  4LAA A;  3CRL C;  3GTL B;  4K6D A;  1I4X A;  2I07 B;  3BVG A;  3ND9 A;  1DZ1 A;  2JXM B;  3R3O A;  1YNN C;  2A6E D;  1XXG A;  2PO4 A;  2KCN A;  2EYM A;  3SK4 A;  3T13 A;  2EJG C;  2M2L A;  3SVM A;  3A56 A;  3F2U A;  3HP3 A;  3WOE A;  5JPN C;  1LO5 D;  1SAP A;  1HTL D;  3MFY A;  2EXZ A;  4U67 3;  3CU7 A;  3EJI A;  1ROD A;  2RVL A;  1JWS D;  2KQ3 A;  1S5F D;  4R8I A;  2HCI A;  4RH6 A;  1H9S A;  5E3F A;  3J7Y W;  1CT1 D;  1O7L A;  4A3B B;  3N52 A;  3VYR A;  2A74 C;  2O5I C;  2F0Q A;  3RMH A;  2QCP X;  1VDZ A;  3VA7 A;  1HA5 A;  3I70 A;  2F0L A;  3K59 A;  1QNK A;  3TDQ A;  2A73 B;  1TII D;  2Z4H A;  4CJ2 C;  1DYQ A;  1I3Q B;  2NVT B;  4XQQ A;  5KNC A;  2NBF A;  1H9J A;  4I7Z C;  2HDL A;  1RDP D;  5KND A;  3K6O A;  1LV9 A;  4C3H B;  3H0G B;  3BYT B;  3GD7 A;  4N9P A;  1Z7T A;  4C3I G;  4IFD I;  3DEO A;  2EVB A;  1AEX A;  3I90 A;  4M8A A;  2QKI C;  2BCO A;  3CQZ B;  4ODG A;  3V2T A;  3NTH A;  1EQV A;  2PCF B;  3TP7 A;  4PMC A;  3VR4 A;  3MVV A;  2IWH A;  4DK1 A;  3GTP B;  2WAQ B;  4G7H C;  2WKD A;  1EZ8 A;  3KUP A;  3J7A F;  2OXP A;  3NQT A;  3A7L A;  3P7J A;  1D5M C;  1TU2 B;  2IJ0 A;  4XQN A;  1QCB D;  3D6C A;  3R2I A;  3TP5 A;  3D4W A;  3I4L A;  1MSG A;  2FMC A;  5J22 A;  3GV3 A;  3DEP A;  2TSS A;  3KBX A;  2KCC A;  2L0C A;  5JJZ A;  4ZKC B;  1LT5 D;  5CV4 A;  4EQN A;  2BE5 C;  2NTS A;  4KN4 C;  3MA2 B;  4KV6 A;  4RCN A;  1F9P A;  3K58 A;  3Q0A A;  5LHY 1;  3X3N A;  5ELE A;  4K2K A;  1SJE D;  4FXD A;  2IW3 A;  2O5J C;  2ZXP A;  5FO9 B;  1A2U A;  2XN9 C;  4DNT B;  5KRU A;  1QJO A;  3G6J B;  1PXU A;  4LMQ D;  1SXT A;  1Y1W B;  1TWG B;  2I46 A;  1TR5 A;  2JA8 B;  4IUT A;  1G2T A;  2EY6 A;  1YNJ D;  1STG A;  5A2Q L;  2HUG A;  5EPL A;  1CK1 A;  5JVH 3;  4PNY A;  3VR2 A;  3TP6 A;  2MJ8 A;  2KA7 A;  2PZT A;  3NQI A;  2E2H B;  3A8K E;  1GUG A;  1R4P B;  3L9A X;  4B9W A;  4KK7 A;  4C3J B;  1IW7 D;  1GXD C;  5EGT A;  3H91 A;  1PRT D;  2A68 C;  2EY2 A;  2CQA A;  3D3R A;  2CHB D;  4BA1 I;  2IX0 A;  2A5H A;  1V43 A;  3BZD B;  1TT2 A;  3VA5 A;  2HDM A;  1F9S A;  1TWC B;  1U4L A;  1PMR A;  3WOF A;  4C2M B;  4HSV A;  4M1U B;  2K01 A;  4PMW A;  2R93 B;  2BDN A;  3Q6S A;  1I50 B;  4KKS A;  3GTM B;  2TMP A;  2C9O A;  1HQR D;  1EY5 A;  1G8Z D;  4DF7 A;  4BY1 B;  5EBD A;  2NWG A;  1KNE A;  3NTK A;  1A3V A;  1PFM A;  3BDC A;  1TQO A;  1RJT A;  3HKZ B;  4G4K A;  3D6W A;  3PMF A;  1JOK A;  2MUY A;  1Q1B A;  5C0X J;  3QJY A;  4R9W A;  1CTM A;  4CHT B;  2F0V A;  2ZXO A;  1WTX A;  2WIN B;  1EY4 A;  1AW7 A;  4ZUJ A;  3TSS A;  1TS4 A;  2D62 A;  1E0B A;  5ELF A;  1Q1E A;  2JA5 B;  3NSW A;  1Y8N B;  3GQB A;  1CI3 M;  4G7O C;  1KNA A;  2F0E A;  5EBC A;  5A2Q E;  2NZ1 D;  1V1P A;  4A3D B;  1II3 A;  4G57 A;  3BYY B;  1CZG A;  1BBX C;  1TS5 A;  1ENA A;  1SYF A;  1STE A;  4A3F B;  1B53 A;  4IZ8 A;  1TVX A;  3HOY B;  2R3Z A;  3J80 E;  4FP5 D;  1TKW B;  3C3L A;  4FYD A;  5EPJ A;  1KTK A;  2RQX A;  2BOS A;  1GUO A;  5J39 A;  1STA A;  1SNO A;  2E76 C;  3PUX A;  2XRQ D;  5JAV A;  2EY5 A;  3S1Q B;  1A15 A;  1LAB A;  1ILQ A;  5E1F A;  4RGT A;  2XNA C;  3LWE A;  3D8G A;  5CV8 A;  2Z1C A;  1EFI D;  3IKJ A;  4GZY C;  3KLR A;  1LT3 D;  2R7Z B;  1OXT A;  4IUR A;  1HPC A;  1UUP A;  5IGG A;  3D4D A;  2PW7 A;  1OXV A;  2AQ2 B;  1DOK A;  3C2P A;  1WTO A;  5CMD A;  3OIQ A;  4N9T A;  1LTB D;  2X6G A;  4XXE A;  2EYH A;  1CHP D;  2L12 A;  3BG3 A;  3SE0 A;  1ET9 A;  3MAQ A;  3MC0 B;  3HOW B;  3DWA A;  4DAY A;  2KJX A;  4IAL A;  1WTV A;  3MZ5 A;  1ICW A;  4F88 A;  1A6X A;  2DNC A;  2JP1 A;  4IUQ A;  5EPK A;  5I6W A;  4A3K B;  1D1I A;  2EJM A;  1RD9 D;  2MHV A;  3FDT A;  3FVQ A;  2RBM A;  1SNC A;  2LFN A;  4RHS A;  1TS2 A;  1DXM A;  2RKS A;  1M4V A;  4FVM A;  1J9O A;  1OXS C;  2H4O A;  1EYC A;  3EQL C;  1BNZ A;  5HUR A;  5IGF A;  2A6E C;  3M3Y B;  4HAE A;  1JIC A;  5EQ0 A;  3T16 A;  4K6L A;  2MP1 A;  2O4X A;  1GOZ A;  1A2T A;  2PMZ B;  2K1B A;  1DCZ A;  4K14 A;  1XX8 A;  3MXN A;  5M3M B;  3NBH A;  2FMM A;  2BE5 D;  3BS1 A;  3GP7 A;  5KYL A;  4HR7 B;  1T5E A;  4X3K A;  1C48 A;  1HRJ A;  1EY7 A;  1PDQ A;  4OIK A;  2JYO A;  1Y69 U;  2J4X A;  2QF7 A;  3C1F A;  5C0X H;  2PNR C;  1S4Z A;  4A3G B;  4L8J A;  2F0N A;  5CBE E;  3RZO B;  3SR1 A;  3SDZ A;  2F0O A;  1O78 A;  5IT9 E;  1B1Z A;  4UAI A;  4JK1 C;  2BA0 A;  2ICI A;  3OHX C;  5CBA E;  5BN3 A;  2JA6 B;  1EIG A;  4DK0 A;  4FXK C;  1JE4 A;  2VXW A;  1B3A A;  4NP5 A;  2SDF A;  1HA6 A;  4CBV A;  3A8I E;  3K0Y A;  2DY8 A;  2YU9 B;  2H1E A;  3KK7 A;  3PV0 A;  2KHS A;  2NVY B;  5FO8 B;  2DN8 A;  4V19 0;  2EPB A;  2FIN B;  2LS0 1;  3P75 A;  1KLU D;  3K5N A;  4KY5 A;  3PIP 3;  1Y8P B;  4PV1 C;  2WB1 B;  2IL8 A;  1E2W A;  4CKC A;  1I6H B;  2PZW A;  1X3Q A;  3ERO A;  1JWM D;  1VF7 A;  4TRD A;  5DM6 3;  2NB0 A;  1F9Q A;  5C3W A;  3H3V C;  5JOB A;  3S1M B;  2DY7 A;  3LX0 A;  1D6E C;  4U68 A;  1DD2 A;  1BCP F;  1EWH A;  3HS0 C;  1PZJ D;  3S2D B;  3SHL A;  1H9K A;  3QIA A;  5KNB A;  2RSO A;  5T1G A;  3EA6 A;  4E6I A;  3PUZ A;  2LMC B;  4ZUI A;  4KHV A;  4KKT A;  1JOR A;  2WV6 D;  1EY8 A;  4C3H G;  1WCM B;  5JEA H;  2OEO A;  3L7Z C;  3OOC A;  1BXT A;  3V96 A;  1RTN A;  3H6M A;  3MXP A;  3GTG B;  3TN2 A;  4QMG A;  1CA5 A;  1WTQ A;  3E5S A;  1H9M A;  5C0X G;  2K5Q A;  2E2I B;  1PTO B;  3P1H A;  4ILW A;  2PQE A;  5C5L A;  1ILP A;  5C3E B;  1BQQ T;  4TSS A;  1JOQ A;  3MEH A;  4QCL A;  2K28 A;  2EJF C;  2EYP A;  4BA2 I;  2XSC A;  2HQE A;  5HGT A;  4QB4 A;  2A6H D;  3ERQ A;  1EY6 A;  1EYA A;  4QF4 A;  2F0K A;  3D4R A;  1W6K A;  5K36 G;  3K5L A;  3ITP A;  2JSO A;  2D9U A;  5M5X B;  1GUS A;  2R6G A;  1F9R A;  1S5B D;  5IGD A;  2IPK D;  1UEA B;  3I4N B;  2KEC A;  3HOX B;  4DU9 A;  1PTO D;  1B2T A;  4BBR B;  3RZD B;  4OHJ A;  2R92 B;  2XIW A;  2F0T A;  1L0X B;  4IUP A;  2L4N A;  1BF4 A;  1BCP D;  4X3T A;  2HCC A;  2WAC A;  3HOZ B;  1S5E D;  4IQZ A;  5JPM C;  3ONA B;  3QOL A;  5EKL A;  3W3A A;  2EYL A;  4DXG A;  2IX3 A;  1X32 A;  3KLS X;  4QIW B;  2FHT A;  4KJO A;  4RGN A;  5G3L F;  1G2S A;  1IKM A;  1F2Z A;  3A54 A;  2B63 B;  1RF2 D;  2K5D A;  5JVG 3;  1B44 D;  1I4R A;  3DMU A;  4A3M B;  4YIJ A;  5G3L D;  4A3J B;  1PTO C;  4CKE A;  4HMI A;  3NWS A;  5T1I A;  5FK9 C;  1EU3 A;  1UNS A;  1V1P B;  1S5D D;  4K8I A;  4L6T B;  1SNM A;  1EOT A;  5KGU A;  1WTW A;  1JR0 D;  4DFA A;  2F0M A;  1PFN A;  3OWE B;  2PW5 A;  5FOB B;  1Q3L A;  3A8J E;  1SDF A;  4XDX A;  3TZU A;  3T53 B;  1R9T B;  3IL8 A;  3U9O A;  5E4X A;  1ONL A;  3FRP B;  1LTI D;  1GUN A;  2Z8L A;  3S15 B;  1RTO A;  3BDO A;  1KAA A;  3SK6 A;  2LKV A;  3BDL A;  4EVO A;  5M5W B;  3TME A;  4ZAI A;  3X3M A;  1Q8I A;  2F4I A;  1SYC A;  1ENF A;  3MWY W;  3NUC A;  1Q90 A;  4UDU C;  1BDO A;  1AZQ A;  4MN3 A;  2VB3 X;  3EFX D;  4RGO S;  4C1N K;  1IYV A;  4WOR A;  1FD7 D;  4IUU A;  4KJN A;  5K5P A;  5KYI A;  5D14 A;  2JEA I;  4DN4 M;  3HGB A;  1WVL A;  1NR4 A;  1NCV A;  3ZYY X;  3SEB A;  4QUC A;  1E2V A;  3GTQ B;  2ZT9 C;  1NUC A;  1LT6 D;  1GUW A;  4ZQ3 A;  2RDG A;  4CKB A;  1K83 B;  3T51 B;  2LY7 A;  4G7Z C;  1V8Q A;  1ZEQ X;  2PZU A;  4LJZ C;  4B08 A;  2X6L A;  4IFD G;  3J81 E;  1UAP A;  1U4M A;  1SNP A;  3BVZ A;  4X3S A;  5JEA J;  3OMC A;  4RA8 A;  1TWH B;  2KUM A;  4KHZ A;  1NAP A;  4OO1 H;  4MIU A;  1SYD A;  4BBS B;  4NW2 A;  2L1B A;  1C4Q A;  2L55 A;  1QNU A;  3WDN A;  1I4Q A;  1S5C D;  4XYO A;  5IGE A;  1A3U A;  1ZYR D;  2EYO A;  4RAU C;  5CV7 A;  4WFN 3;  5FLX E;  5I9O A;  2EY1 A;  1GHJ A;  1SE4 A;  1YNN D;  2K33 A;  5CV5 A;  4K8J A;  2Q8R E;  3I73 A;  4RCO A;  5KIX A;  5ISR A;  3AMU A;  2NVQ B;  1EY0 A;  2F0U A;  1W6J A;  2VB2 X;  3HOV B;  1HQM C;  2FJ2 A;  2XVS A;  4IFD H;  4Q5V A;  4Z9C B;  4KTA A;  4NMZ A;  1MBY A;  4RKL A;  2A68 D;  1A3T A;  1O7Y A;  1RKN A;  1TY2 A;  1HCZ A;  3CRK C;  4R8N A;  1G29 1;  1PFB A;  5CV9 A;  1SYG A;  1JOO A;  1DON A;  4C3I B;  5I9P A;  1CQF A;  4KY7 A;  1EWC A;  3CKI B;  1BUV T;  5CC4 A;  5C4J B;  4P2C B;  3FKI B;  2KOL A;  2YYZ A;  3NE5 B;  3M4O B;  1K8O A;  3M4Y A;  1JCK B;  2O2L D;  1AN8 A;  3PO2 B;  2F0H A;  5COY A;  4A93 B;  5IT9 L;  3JAM E;  2CVR A;  2L9H A;  1I4G A;  3K5M A;  1NSN S;  4B9X A;  3Q23 A;  5DAU A;  3Q22 A;  1PZI D;  5FKA C;  4WJW A;  1R4Q B;  1PRT F;  5CGK A;  5IOC A;  3FPP A;  2ICE C;  2CW0 C;  1JQY D;  5C6A A;  1CFM A;  3H94 A;  3IFD A;  2B8G A;  4HN7 A;  2EE1 A;  2SNS A;  5FLX L;  4AYB B;  3BVM A;  1OO9 B;  3TZD A;  2RDF A;  1H9S B;  1LTA D;  1K8M A;  2KVM A;  4KY6 A;  3E0J A;  2X69 A;  4S3S A;  2F03 A;  2WKC A;  1GJX A;  4OO1 I;  3VYS A;  5M5Y B;  1D1K A;  3A55 A;  2F0F A;  1AZP A;  4NDX A;  4L63 B;  4JBW A;  4OL7 A;  2BDO A;  5JEA G;  2K04 A;  2WP8 J;  1PTO H;  3S16 B;  2QIL A;  1CZW A;  2B2Y C;  3NP8 A;  1MSH A;  2K03 A;  2CW0 D;  3K5O A;  3NWT A;  4DAV A;  3HG9 A;  1EZ6 A;  5FO7 B;  5TSS A;  3KF8 A;  4TQU S;  3AU7 A;  4TKO B;  2IT1 A;  5C44 B;  5F2D A;  4X3U A;  5I2X A;  1NR2 A;  1SMY D;  2MPM A;  4MHE A;  1CQV A;  2Q8I B;  4IUV A;  4FF4 A;  4QUF A;  4CGY B;  1LTR D;  3I4M B;  1Q12 A;  2SEB D;  5C5M A;  5C4H A;  3FMC A;  1SBB B;  1LTT D;  1E2Z A;  1ESF A;  5AFW A;  4ZRZ A;  5IOD A;  3GTJ B;  5ELB A;  4CJ0 B;  4ZYS A;  5BN5 A;  5E4W C;  1BO0 A;  3S17 B;  2KEE A;  1DM0 B;  3J7A V;  5C3X A;  2B2V A;  2B2U C;  3MFG A;  1D5X C;  1JB3 A;  1HHV A;  1SSO A;  2E75 C;  4IN3 A;  3VR6 A;  1HFG A;  2FFK B;  3HOU B;  1SEB D;  3VR3 A;  4FF2 A;  5IGB A;  1B50 A;  4ZK9 B;  3K57 A;  4IFD J;  1J8I A;  3DHQ A;  3C46 A;  2KED A;  1U9R A;  4C1N I;  1STY A;  3CHB D;  4CJ1 B;  1D5Z C;  1D2B A;  2NVX B;  1T5X D;  5C4X B;  2G9H D;  1KDC A;  3S14 B;  1AP0 A;  5M9O A;  1XWE A;  4Q0F A;  1FR3 A;  2A6H C;  1VMP A;  1RCV D;  2N88 A;  2M9V A;  3QO2 A;  5NUC A;  4ME5 A;  3L3O C;  2RSN A;  2SNM A;  4IUN A;  3FEW X;  3M7G A;  2Q8T A;  5C4Z A;  2JA7 B;  3O13 A;  2ENB A;  1JC7 A;  1F2Y A;  3J81 L;  1SND A;  1DJR D;  1QWY A;  3MXG A;  3GTO B;  2EYF A;  1PZK D;  4XT1 B;  2E2D C;  3A7A B;  1SE2 A;  3I91 A;  1MD2 D;  1WD0 A;  5LL6 X;  2F0I A;  3SK8 A;  3PUV A;  2B8F A;  2QEJ C;  1DOM A;  2NN6 H;  3OW7 A;  3VR5 A;  3PIO 3;  2V4D A;  2EDG A;  2L11 A;  1HUN A;  1Z6H A;  1STN A;  3MXU A;  2K32 A;  1C8C A;  2G9D A;  2EYJ A;  2XWB B;  2B2T C;  2F0J A;  1QE6 A;  5D3I B;  4LK1 C;  4XYQ A;  1EIH A;  3QOJ A;  2F0D A;  2EOT A;  1MI2 A;  5CV6 A;  1FGB D;  2NUC A;  3RLF A;  4DA2 A;  3OPO A;  5J1Z A;  3I3C A;  2VNU D;  4H44 C;  3VYT A;  4V0B A;  1LAC A;  5CR3 A;  1FNW A;  2PPB C;  1CM9 A;  1PTO F;  3W2D A;  3SK5 A;  4J8Q A;  3SXH A;  5LL6 S;  2QDB A;  1Y1V B;  4FO2 A;  3TP8 A;  1Z47 A;  1FNV A;  1SE3 A;  5A35 A;  2NN6 G;  1QG7 A;  1KDA A;  4XQJ A;  2M00 A;  5I4D A;  2J7Z A;  5IGC A;  1KAB A;  5K36 H;  3H09 A;  3UI2 A;  1H9R A;  2AUK A;  2B2W C;  4OO1 G;  2ZXR A;  3IFT A;  1WD1 A;  1QIL A;  4BWG B;  1MGS A;  3NXW A;  3PUY A;  4H13 C;  2EZV A;  2DNE A;  1IW7 C;  1HFN A;  3P20 A;  1STB A;  5D65 A;  3S1N B;  1U4P A;  2NTT A;  1XTC D;  1FNU A;  3I72 A;  4I65 A;  2OF1 A;  1TY0 A;  3NK9 A;  5D3D A;  4K5W A;  3C1E A;  5DEH A;  5C0X I;  1EY9 A;  1ZKO A;  4A3I B;  4EQP A;  2K6A A;  1SJH D;  3LNN A;  5EKK A;  1G6Z A;  1JWU D;  3QB3 A;  4FNF A;  3D31 A;  2SOB A;  2F0W A;  4DGZ A;  1HXY D;  1I4H A;  2AQ3 B;  4DNR B;  1LTS D;  1EEF D;  1TWF B;  3HZX A;  4ID6 A;  1ESR A;  4K2L A;  1IHZ A;  2AWN A;  4PQX A;  5KEE A;  2NN6 I;  5IIF A;  2PYK A;  4KD4 A;  1SYE A;  3LWU A;  3GTK B;  1G91 A;  5COR A;  4EGV A;  1V1O A;  3EVQ A;  3I8Z A;  4RWS C;  4XIG S;  1IL8 A;  2B2W A;  2BA1 A;  1Y8O B;  4F8M A;  5DM7 3;  5EJW A;  4A3E B;  3DUZ A;  4KD3 A;  1I4P A;  1B4O A;  2JE6 I;  1SMY C;  4OGQ C;  1EEI D;  3NPP A;  2XWJ B;  4ZKB B;  4XTC S;  1HUM A;  4J1M A;  1PRT C;  4F7X A;  4KKU A;  2A69 D;  1BR9 A;  4XT3 B;  3ND8 A;  3GO5 A;  4KMU C;  3DXJ C;  3IAY A;  2GA4 B;  4HCE A;  4O1N A;  3NTI A;  3J80 L;  4RHR A;  2RA4 A;  4HMJ A;  3RUZ A;  1FYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...