2AUKA

Structure of e. coli rna polymerase beta' g/g' insert
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
GSHMAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Lineage-specific Sequence Insertions in the Bacterial RNA Polymerase beta' Subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase beta' chain
total genus 40
structure length 189
sequence length 189
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA02
1HTPA 3A8IE 5BN4A 2R6GA 1VCIA 5JEAH 4LJZC 1V43A 1HPCA 1OXUA 3MXUA 3PV0A 3SE0A 4BA1I 1A6XA 3SDZA 3N6RA 3VR6A 2V4DA 1YNJC 2EJGC 3ND8A 1K8MA 3H94A 2A6EC 3M85A 1CTMA 2DNEA 1FR3A 2K32A 1B9NA 1ZKOA 1CI3M 1GUNA 2O5IC 1Q1EA 3GD7A 3T51B 1IW7C 1Z7TA 2BDOA 1E2VA 1OXSC 2JE6I 2DNCA 2JXMB 4TQUS 1LACA 2F1MA 4I7ZC 1TKWB 1HQMC 3NE5B 1GHKA 2LMCB 3I72A 4IFDH 2YYZA 2A6ED 2PPBC 1H9SB 1H9MA 3PUZA 2A69D 2E75C 1E2WA 3A8KE 3L7ZC 3AB9A 4KI0A 3VA7A 2JEBI 4XIGS 1DCZA 1IYUA 3VR4A 1VF5C 1SMYC 4KKSA 2NN6I 3HGBA 1TU2B 3DXJC 4KHZA 1CFMA 3ND9A 2EDGA 3VR5A 5JEAG 4KKTA 4L8JA 1Y8PB 1O78A 2B8GA 3LWUA 3QIAA 4PV1C 1H9RA 4G7OC 5K36H 1GUGA 4OGQC 3WDNA 5A35A 4DK1A 4DNRB 1LABA 3OOCA 4BA2I 2E76C 3D31A 4G7ZC 3CRKC 3CRLC 2AWOA 4H0LC 2B8FA 3LNNA 1Y69U 3I4LA 4H44C 1GJXA 4HR7B 3FMCA 4G7HC 3M4YA 1FYCA 1E2ZA 4JK1C 2EVBA 1Y8OB 3BDOA 3PUVA 2QF7A 2D5DA 1H9KA 1ZYRC 4DNTB 2ZT9C 1Q1BA 2AUJD 2BA0A 2DN8A 2A6HC 2KA7A 1BDOA 1I6VC 1K8OA 1H9SA 1GHJA 3RLFA 3MFYA 3U9SA 3M7NA 2KCCA 1ONLA 2AUKA 2K7VA 3VR3A 1G291 5C0XH 2BE5D 4H13C 2EJMA 1O7LA 3A7LA 1Y8NB 5KNBA 4KKUA 3QJYA 4GZYC 2L5TA 3PUYA 1Q12A 3EQLC 2PCFB 2JEAI 3PUWA 3IKJA 3TZUA 3FPPA 2D2CC 2BE5C 3PUXA 4OO1G 2BA1A 1DD2A 3D4RA 2PNRC 5KNCA 1OXTA 1Q90A 1EWHA 1QJOA 4KMUC 4RCNA 3T53B 3A8JE 4KN7C 1B9MA 1T5EA 2CW0C 3OW7A 3T56B 2A68D 4KN4C 1VF7A 1OXVA 1V8QA 1Z6HA 4DK0A 1IYVA 1VDZA 2O5JC 2NN6H 3BG3A 4LK1C 4TKOB 3GQBA 5K36G 1DXMA 1OXXK 1GUTA 2D62A 2Q8IB 2A68C 4OO1H 2NN6G 1IW7D 1PMRA 4IQZA 4XTCS 1GUOA 1HCZA 3VR2A 5BN3A 5C0XG 4IFDG 2K33A 1H9JA 2E74C 4JBWA 5BN5A 2A6HD 3P20A 3W3AA 3A7AB 3QG1A 2EJFC 1GUSA 3OPOA 5KNDA 3I73A 1YNNC 3KLRA 2IT1A 2A69C 3IFTA
chains in the Genus database with same CATH superfamily
1L0WA 1NNXA 4IUQA 4DR4Q 1HPCA 4BA1I 1CKNB 1JB7A 5BR8L 3NTKA 2GVAA 1CUKA 2VB2X 2J4XA 2JA8H 4DV6L 2E2HH 4R4QA 2Q8RE 3WOEA 1AEXA 2R92G 1SMXA 4A3GH 3PMFA 4A75A 5LHY1 4C56C 2Z8LA 1VQOA 1R4QB 1BBXC 4A3GG 2A1AA 1SNDA 5T1GA 2ID0A 3VR4A 3S1NH 3FKIH 4B08A 1TVXA 1SMYC 3F8TA 3DM3A 3J81L 2KCMA 5C3WA 2NTSA 5IP7G 1RJTA 4DV6Q 5CV4A 4NXML 1O78A 3J7AV 4JVZA 5DNFA 4NMZA 2Z6BA 1SNMA 4G7ZC 3CRLC 4OONA 1JWSD 1BCPC 1B70B 4A3BB 1O7YA 2EOTA 2KECA 4A3CG 3HKZB 3I3CA 3M4YA 2KEEA 3I4NG 1B3AA 1ICFB 1H9KA 4IUPA 1BO0A 2O2LD 3D8GA 5CBEE 3RZOH 2BA0A 3BVZA 1E7ZA 4GOPC 4OEMB 1H9SA 2AQ3B 3PCOB 4OWTB 3QR8A 5C4XH 3S17B 1JB3A 1O7LA 2F0SA 1TS5A 1AZPA 3L2PA 1EOTA 4JI1Q 5FJ8H 4GS3A 5EPKA 4JI4Q 1UEAB 1HRJA 1TIID 3D6CA 1YI2A 4ME3A 1EY8A 1FVIA 3F2CA 3S2HB 3EROA 4IUVA 3MAQA 4JG2A 4JI6L 2BCOA 3A0JA 1U5KA 1UWVA 2RDFA 4JI1L 4DPGA 1IL8A 2B2VA 2NN6G 4K5VA 5IP7H 4V190 1NAPA 5C4HA 4F87A 2PW5A 3DEOA 2YU9B 2VUMG 2JA7B 1BQQT 2K4KA 2RBMA 2SNSA 2OTJA 2F3VA 1EY7A 5KNDA 1HTPA 2B2WA 1CK1A 1KRSA 1KQSA 1LT6D 3D0FA 3DEPA 1YNJC 2NVYH 3W2DA 4ZCKA 5ISRA 3CCVA 3NBHB 2F0VA 2UUCL 5I6YA 4CKEA 4IPDA 2Z6KC 1WTRA 3S1NB 2H4OA 3E0EA 4XT3B 1CZWA 4C3JH 1LTRD 2VZAA 3J80L 3TRZA 3HOYG 4AQYQ 3NUCA 3GTMB 3DLLA 3I4MB 4KHPQ 2XN9C 1HQRD 1N34L 1I5FA 2UU9L 5KYLA 3GTQH 5IYDG 1UEBA 1PH9A 4DFAA 1JJCB 4LF6Q 4A3EB 4J8QA 1H9RA 1DOMA 3EN2A 4RKBA 1GUGA 3FPUB 4YCVA 5EAYA 5A35A 3NQIA 1LABA 2B3GA 2NTTA 2ZJRA 1WOCA 1HH2P 2MFIA 1PRTC 2PMZB 3KYHC 2R3ZA 2AQ1B 3BDOA 2SDFA 4A3DH 4N9PA 4DV4L 1IZ6A 2G9DA 1PLFA 4L5TA 3BDLA 2KHSA 4CDFC 3CHBD 2E2JB 1BDOA 3RLFA 4DF7A 3U9SA 1VQGA 1JE4A 2N78A 5C44G 2XRQD 3GTJB 1SEBD 2B2YC 1KD1C 4JI4L 1SRUA 1EYDA 2FXQA 4LNQA 1KABA 2OF1A 4L63B 4JOIC 4U68A 4C3IB 5IIFA 5KIXA 3MXNA 4V0BA 5IGFA 5LMNL 2YU9H 3QOJA 4BY7G 4HIDA 3UDXA 1EQVA 4RHSA 4GN4B 4JI6Q 5JEAJ 4LFAL 2D0PA 1G8ZD 2IL8A 4ZKBB 4EQPA 4J1MA 4MIUA 3H0GG 4NDXA 4DR7L 3TEHB 1PZKD 5K36G 3F2DA 1I4HA 1EFWA 2NZOA 4A3IG 4B9WA 2EY1A 4R8IA 3C2PA 1EWIA 1F2ZA 2O4XA 4HIMA 3QG1A 3TP8A 1RIPA 4FXGC 1O7IA 1STNA 2E2IH 4GOPA 3C46A 1Y1VB 2R6GA 5C4XG 3PV0A 2K5HA 3R8BA 1C9OA 2TMPA 3RZDH 3PQIA 1Y1VG 3UDFA 2K32A 1IBKQ 1PH4A 1BUVT 4MTKA 4B3SQ 4IJHA 4NP5A 3OWFA 3GTMH 1OXSC 1J6QA 3ICEA 1F9QA 3OTOL 4GNXA 2Q2TA 4DAMA 3PUZA 3GV6A 3M4PA 4GLXA 3TQYA 4DR1L 1QILA 3AB9A 5I6WA 2PZUA 3RN2A 2HHHL 1IYUA 2UUAQ 3U4ZA 2CWPA 2H5XA 1II3A 4FO2A 2VUMB 5C3EG 4DNIA 2VQFQ 3MC0B 5GADC 3D4DA 4BA2I 1IKLA 4JI5Q 4F8MA 3LGJA 1PV4A 3FMCA 1FYCA 1YIJA 1S5ED 4XQNA 1LLRD 1BBWA 1QNKA 1Q1BA 4CJ2C 1I6VC 1E22A 3MEFA 3H91A 2K01A 2IHFA 4H13C 3T1HL 1KTKA 3HOWH 4DV7L 4BS9A 1R9TH 4K8JA 1QUQB 2KCNA 3ULPA 3AQQA 4JV5L 4BWGB 3UI2A 1NR4A 3J7YW 1QCBD 2L11A 3G48A 4HTHA 2OEOA 2VQEL 1GOZA 3D4RA 3J80E 5IP9H 4L5QA 1XTCD 1EEFD 2X6GA 3T1HQ 3S1RH 1VF7A 3G4SA 2DJGC 2ZM6Q 3HKZG 4RGTA 3F2UA 3I7FA 3LWEA 1HXYD 1DOLA 4JI7L 3AFPA 2CWAA 4A4IA 2JP1A 3C1EA 2K14A 4BY1G 1GUSA 3J81E 2HIXA 4X64Q 2A69C 4GN3B 3IFTA 1HUNA 4GOPB 3DUZA 5IGCA 3UE0A 3K5LA 1K83H 1VQCA 2SEBD 1C4QA 2EJGC 1EIYB 3R2IA 1U4MA 5DM63 3D6WA 4XXEA 1HA6A 1VQLA 1FR3A 1VQKA 1BKBA 1TXYA 5G3LF 4P72A 5HGTA 5EKIA 5M9OA 4QB4A 1X9NA 1HTLD 1T9HA 1Q8IA 1WTHA 3VYSA 1TT2A 2F1MA 1TKWB 4O0AA 1PYSB 2EYOA 3PO3G 3OMGA 3MZ5A 2JEBI 4RG1A 4A3MH 1PH3A 2I5LX 5I2XA 5GAEC 3TN2A 3PO3B 4DR6L 1AE2A 4A3JB 3NPPA 1GVPA 4A3LH 2RDHA 3MWYW 1XNRQ 3DHQA 1UE6A 1U4PA 4DK1A 3J7ZC 4ME5A 2AWOA 2WAQG 2Y0SB 5E4WC 3ITPA 4DU9A 1RHPA 3KJOA 4HR7B 2ZTDA 5IP9G 4FXDA 2EYJA 1SR3A 1Y8OB 3S1RB 4ZAIA 1SJHD 5M3MH 2ZT9C 1D5ZC 4DV3L 1YJ9A 5GROA 4BBSB 1NSNS 5TSSA 1MGSA 4IO9A 1XX8A 1J5EQ 1IBLQ 2NZ1D 5ELEA 4X65Q 4IZ8A 3Q0AA 1EU4A 1S5DD 4GZYC 1NY4A 2L5TA 5IGEA 2UXDL 1VQHA 2K75A 3NQTA 3PUXA 4DR2L 2WKDA 4PMBA 2UXBQ 3TP7A 2GA4B 5IE8A 1DD2A 1PH7A 2A73B 3G6JB 3A54A 1JMCA 4IPCA 1L1OB 4F88A 1ET9A 3GTOH 1PTOF 2IW3A 1U4LA 4A3MG 2JA7G 3OMCA 3D3RA 4DV1L 2Q8IB 3T1YQ 1IBML 4UP7A 2E8GA 1GM5A 1IW7D 1PMRA 5BN3A 1GUOA 3M3YB 2AKWB 3CPFA 1EYAA 2VUMH 1TWHH 2A6HD 3KF8B 2X69A 4DAYA 2VXWA 1DYQA 1TR5A 2F0NA 3KLRA 2SOBA 1B4OA 2RCNA 3E6ZX 4DA2A 4JYAL 2F0GA 4IOCA 1PH1A 1AW7A 1B1ZA 1ASYA 5C4ZA 2CKZB 1VQ7A 1L2FA 2NBFA 4ID6A 4B3RL 1WCMB 4GLVB 1JQYD 1SYCA 2O5IC 3GD7A 3SK6A 3STBD 2HUGA 2WKCA 4HJAA 3TREA 2WV6D 5IT9c 2KVMA 1SAPA 2L9HA 4TSSA 1VQMA 4OXPA 3J7AF 4LF8L 4R8NA 1E2WA 2RSOA 5BR8Q 2R7ZH 1PVOA 1G2TA 1WD0A 1QOHA 3SXHA 1SYFA 1I3QB 5IYBG 5EPLA 2JA9A 4OX9Q 3I4NH 4CKBA 4R4TA 2WACA 1X32A 2E76C 4ZQ3A 1CQVA 2PZWA 5G3LD 4H0LC 3I91A 4HSPA 3HS0C 5LMUQ 5JJKA 3WOFA 5CC4A 1SNPA 4A3FB 4R9WA 3MVVA 3T4AC 2NVQH 4ZLTF 1LUZA 2HCIA 4F7XA 1Y14B 1M90C 1HR0L 1G6ZA 4CJ1B 3JAMc 2P5ZX 3TS0A 2HCCA 2AUKA 4FDBA 2Y0SE 1PTOH 2BE5D 2IPKD 1MIUA 2D9UA 4HJ5A 2B2WC 5I2YA 2JSOA 1WTQA 2OQKA 3FP9A 1IYJB 3RLNA 5IT9E 3R3OA 3R2TA 2IX1A 4QIWB 2JEAI 1NCVA 3AU7A 1HR0Q 1BBUA 5I9OA 4PMCA 1HHVA 2OT2A 4K5XA 1VQDA 4R1JA 1EY6A 3G6EA 2LSSA 1Y1WH 2B2TA 3K80C 2DUDA 4HJ7A 3V2TA 4C3HB 3L0OA 2HIVA 3OTOQ 1CKMA 2BH2A 2G5DA 4XQJA 3E9HA 3GTOB 4JYAQ 1LT4D 5A2QE 1N36Q 2RF4A 1K3BC 5ELOA 2EJFC 4P74A 3I73A 1GKHA 2QGQA 3I56A 4DV2Q 1IKMA 3A8IE 5BN4A 1VCIA 2HD3A 5C5MA 1OXUA 2QEJC 3QOLA 1FJGL 5C5LA 2F0TA 3ND8A 2RHQB 3E0JA 1XMQQ 2K05A 2LY7A 1NR2A 3H94A 1LTAD 4QUCA 2JA5H 1ZKOA 1S5FD 4C2MB 1SYEA 4R4IA 3HOYH 3RR5A 3H0GH 1Z7TA 1WVLA 5DLQE 5E1FA 5JPMC 4LF5Q 4TQUS 3HP3A 2XRSD 2F0IA 3S15B 1CM9A 1C7YA 1EQQA 4XYQA 1PRTD 3Q6SA 5ELCA 3L7ZC 3CCEA 4CHTB 2KQ3A 4PZ6A 3AYHB 1S5BD 1A15A 2HHHQ 2K5WA 4K6DA 1AE3A 3KUPA 4GN5A 2VY3A 1KC8C 4X62L 3H15A 5KGUA 4AQYL 3I4LA 1FNVA 1QWYA 1STEA 5LL6X 3CCJA 2UU9Q 4A3KH 2A5HA 1QE6A 2E2IB 1PFSA 4DUZQ 4C2MH 2FMMA 1L1OA 4HJ8A 3NELA 3QO2A 3MFYA 1XYIA 3CC2A 4QJFA 2HQEA 4Y7NB 4N8FA 2JA5B 2G9HD 3H3VH 5J22A 3Q22A 4A3GB 5CV7A 2NVXB 3SVMA 4LFBQ 2F0EA 4RMFA 2QCPX 1OXTA 2CFMA 3JAMi 5D3IB 2KHJA 1PXUA 3CPWA 3WWVA 2YV5A 1KLUD 2K52A 1Y1WG 1TWGH 3X3NA 3J81c 4JOIA 4DV5L 1TWAH 1BF4A 4LAAA 1K28A 1N36L 2ZM6L 1U9RA 4UDUC 4C3JG 1Y1WB 1K9MC 4LF6L 4FP5D 1F2MA 4UP9A 3HOUB 1H9JA 3IL8A 3D4WA 4BBSH 3P20A 3KBXA 1WTOA 3S9WA 2IT1A 4P2CB 2M00A 2KBNA 3H6MA 4J6HA 2A74C 5JEAH 2NYZD 3ZJYC 4DV5Q 3SE0A 4JBMA 1CQFA 4B3TL 1FGBD 1SYBA 3BZKA 3CC7A 2RDGA 2A6EC 3M85A 2B2YA 4I65A 4AIMA 3HOZB 3HOVB 3NENA 1HNZL 1WI5A 2OTLA 3P7JA 3H3VI 2DNCA 3RZDB 1X56A 2ZXPA 2JA6B 5M3FB 3NE5B 4P71A 2YYZA 1VMPA 3H0GB 1VQ8A 4XDXA 4OWWB 2HT1A 5IYBH 4MZ9A 4YWLA 3A5ZB 4FVMA 5CGKA 1IBKL 2VL6A 4KTAA 5IGDA 4IALA 4DR3Q 4YY3L 1I6HB 1KDCA 4LF7Q 1Y8PB 1GO3E 4K0KQ 3K5OA 4G7OC 2WB1E 1BCPF 3PF4A 3RUZA 3OIPA 4OHJA 2ZJQA 3LNNA 1Y69U 3KLWA 1D5MC 3O13A 4JI0Q 4JI2L 2R93B 2EVBA 3MXGA 2QF7A 4PNYA 4ZUJA 4RA8A 1X6OA 4U673 3K7AB 1WCMH 4JI3L 1HR0W 1VQ9A 5H1SE 1ESRA 2QKIC 5IGGA 3MFGA 3HRZC 1B44D 2K1BA 1W6JA 4KKUA 5KNBA 3S14H 3GTJH 3MXNB 3BDCA 4A3KG 1YHQA 3MEHA 4POGA 2NVTH 3PUYA 5LMNQ 1N33Q 3GTGH 5IODA 3EIVA 1SLJA 2D2CC 4TVAB 5EKKA 1PH2A 3HFZB 4HIOA 1JICA 1ENCA 3M4OB 5FLXc 3A8JE 2CCZA 1TS2A 1VQFA 2CW0C 3OW7A 2CQAA 3OSOA 3T56B 4DR7Q 3K7UC 2I5HA 1TWGB 1I94Q 1YZ6A 5EPJA 3NK9A 4A3FG 4QMGA 2NN6H 3VA5A 4RWSC 1SNCA 4LF9Q 1RD9D 3OIQA 1LTID 2A68C 4LFCQ 3S2DB 1WYDA 1F9RA 3VR2A 4IFDG 2UUBL 1I50H 1QUQA 1EU3A 2VQEQ 2HDMA 2K33A 2JA8B 4JBWA 3VYUA 1I4QA 5C44B 4PZ8A 3SHLA 1QVCA 2VNUD 4YHHQ 1JWMD 2JA5G 3SR1A 4C3HH 4LUOA 3N6RA 4RGNA 2V4DA 1MHWC 3BVGA 2FMCA 5IWAL 4GKJQ 2B2UC 2R92B 3FRPB 5M5WH 3AEVA 1E0BA 1B9NA 1VS0A 1A3TA 4EQOA 4UAIA 5M3MG 3HKZE 4XYOA 3AMUA 4HN7A 4G57A 1Q1EA 1MD2D 4Y52H 4DK6C 1YNJD 1ML0D 3H3VC 5M5WB 4I7ZC 1F2LA 2F0KA 4X3KA 3E3XA 2A6ED 1F9SA 2A69D 4EQNA 3I55A 4RFBA 3VA7A 1JOKA 4XIGS 2F0QA 1C48A 4KY5A 3TZDA 2I07B 3A56A 4LUVA 1LT3D 1I4PA 1YNND 3K7AH 3CXCA 3ND9A 1B50A 2KEDA 2EY6A 3S2DH 5FK9C 1UE5A 3T16A 4KV6A 1EIFA 1GJXA 4M8AA 1STHA 3KDFB 2WAQE 3S24A 3QWNA 2ZXOA 1XMOQ 4DKAC 3U58A 1SROA 5NUCA 1LO5D 4L6TB 1G291 3S1MB 4NKLA 1YEZA 5C0XH 1XTDA 1UUPA 2A8VA 1WFQA 1AZQA 1V1PA 3G71A 1HA5A 5GAGC 1XPUA 3TZUA 1C0AA 3CCQA 4BXXG 2YTYA 3RMHA 1HFGA 4DK3C 4FF3A 5KNCA 3NWTA 2XGTA 2B39A 4A3JG 4DV0Q 1S3OA 3GV3A 2ZJPA 4KLKA 1R4PB 5D65A 5I9PA 1QB5D 4P73A 3K58A 4N9TA 2N55A 2EIFA 1OXXK 2EYFA 5CV9A 3SK8A 4B9XA 3CC4A 1TWHB 3GTKB 4KHPL 4OWXB 2RKSA 3PGZA 5JJIA 5E7NA 1Q8KA 3OPOA 1YNNC 4A93H 3C3LA 3J81i 2J7ZA 1UNSA 4WJWA 3M7GA 4NPSA 1B53A 2DGYA 4MNOA 1XXGA 4C1NI 3R93A 1A8VA 1R9TB 1K8MA 1GXDC 1WJJA 3BS1A 2MUYA 4FF2A 1GUNA 1J5EL 1DM0B 4QIWE 1IW7C 1SXTA 4A3FH 3H09A 5C0XI 2PO4A 3CCMA 2N49A 4IFDH 2PZTA 3DWQA 4UP8A 2PQAB 2E75C 3CCLA 4KI0A 1QG7A 1EY0A 1MJCA 1LTBD 4FYDA 3EJIA 4X64L 1PFNA 3NTIA 1XNRL 4GNXC 5CR3A 2I46A 4KJNA 5FKAC 1DZ1A 3W1BA 1X3PA 1K83B 1HNXQ 3CCSA 2JA8G 3NHHA 1CKNA 1OO9B 3RNUA 2R7ZB 2F3IA 3LWUA 3OOCA 5C0XJ 4DR5L 4IN3A 3CRKC 4OL7A 3ERQA 1IL2A 4FF4A 3SEBA 4PQXA 4G7HC 3HOVG 3HOZG 4X3UA 1E2ZA 1UAPA 5JVG3 3PO2G 2OQ0A 3RD4A 3EVQA 1LV9A 5CV5A 4B3ML 2JA6G 1PFBA 5CMDA 4DV4Q 1I4XA 2MGSA 1S72A 4L5SA 5KYIA 1KDAA 4LF4Q 4H02A 1BCPB 1JJ2A 4QUFA 5HGQA 2EZVA 3GO5A 4RH6A 4Y7NH 5IY0A 3FPPA 1ET6A 2Z4HA 5EQ0A 2GN5A 1KAAA 1N9WA 2WFWA 3OYYA 3MTSA 1EIGA 1QJOA 4RCNA 4PMWA 2F0DA 5CBAE 2JN4A 3JAML 1F2YA 1MSHA 1IYVA 4DGZA 5JJLA 4KK7A 4TKOB 1CZGA 3HOWG 2PQEA 3DMUA 5C4XB 5C0XG 3I4OA 1H95A 5F2DA 4K2LA 1N32L 4CGYB 1JCKB 4EX5A 4QF4A 5J1ZA 3IAYA 4MHEA 4OELB 4KD4A 3PSIA 2JA7H 3MXUA 4A3BH 2HDLA 4K0KL 1JJGA 3X3MA 5FO7B 2F4VQ 1KNEA 2LXKA 3CW2C 1KNAA 4RKLA 4HCEA 2KHIA 5JPNC 2JE6I 3K59A 1HQMC 2LMCB 5C4JB 3I72A 2F0WA 2PPBC 4JCVE 2IWHA 1FJGQ 2FINB 2RHSB 2L0CA 1BVSA 4M1UB 2F4VL 4POFA 5M3FH 1X55A 2NUCA 1MSGA 4KJOA 1I50B 2EDGA 2F0HA 1O80A 2UUAL 1X3EA 5AFWA 2B8GA 4C1NK 3LX0A 5LMUL 4ZUIA 2F3WA 3J7A5 3TBIB 1PDQA 3EA6A 1Y1VH 2QEXA 3D31A 3RZOB 1YHAA 2HQLA 2FFKB 4LMQD 1ILQA 3NBHA 5COYA 1FL0A 5HY6A 3NTHA 5IYCG 4I7AA 5EJWA 3PO2H 1J9OA 1SE4A 3M7NA 1V9PA 4A3BG 2PI2A 2Z4IA 1X65A 2JQOA 2EE1A 2E5LL 1SNOA 1Y8NB 5CORA 1PTOD 3QJYA 2L12A 2N8NA 4ZK9B 3KK7A 2QW7A 3EQLC 1PTOB 1RCVD 1BOSA 3NXWA 4C3IH 1RF2D 2UUCQ 1CHPD 1JWUD 1Q46A 4DR5Q 4AH6A 5IT9L 3K5NA 1KXLA 5J3BA 3T53B 3FEWX 4GKJL 3A74A 2R93H 1T5EA 1B2TA 1V8QA 3KF6A 4CJ0B 5EGTA 1M8AA 2PMZE 4DXGA 1D1IA 3V96A 4ZYSA 4A93G 1WD1A 2F03A 3S1MH 3PO2B 1HCZA 4UY8C 4YCUA 2K28A 4O1NA 1V1PB 1PH8A 5DAUA 1JT8A 1L1OC 3TSSA 2IHEA 1V43A 1A6XA 4S3SA 1LTGD 2EY2A 1STGA 3CP0A 1EWCA 4YHHL 1ZXTA 2K6AA 2KENA 3NBIA 4LW1A 2RA4A 1A0IA 1ICWA 4LWCA 1X3QA 1HZ9A 5A2QL 4DR3L 1CHQD 2E5LQ 2WIIB 2J0TD 2KJXA 3U9OA 2MP1A 1CA5A 3U4VA 3Q8DA 3S1QH 4A76A 1X3GA 4O2DA 1K3RA 1I94L 1V1OA 3ER0A 3FDTA 1XNQQ 4JI0L 4JI8Q 1MBYA 2XSCA 5IGBA 1S5CD 2EQSA 3CD6A 3EFXD 2EPBA 3E9IA 2R93G 1NUCA 2IY5B 3PF5A 4L8JA 3F2BA 3QIAA 1KAWA 1HNWL 5ELNA 4DNRB 3M3YH 4DR1Q 2B8FA 3GTPH 1EYCA 2MO1A 3TMEA 2Q2UA 4YWKA 5FLMH 5ELBA 3STBC 2E2HB 3MHBA 2DY7A 3VR3A 4DV3Q 2L55A 1C8CA 4OIJA 5E4XA 2EXZA 1HZCA 4QQBX 4QCLA 1LTLA 3SK5A 2UXCL 2TSSA 1TS3A 1EIHA 4DN4M 1BCPD 4LFCL 2K50A 3HZXA 1ENAA 3K81C 2BE5C 2NB0A 3NSWA 2UXDQ 1VQJA 1PHJA 1VQ4A 2CHBD 1AN8A 3K6OA 3HOXB 2M9VA 4JV5Q 1B7YB 2R61A 4ULLA 2Z9HA 4OO1H 4BXXH 1RTNA 4X3TA 4AYBE 3CQZH 1TWCH 2IX0A 2DY8A 4ALPA 5C6AA 2RQXA 1A3UA 3EBEA 2LKVA 4B3TQ 4X66L 2AHOB 4LFBL 1VQNA 4YIJA 4NXMQ 3SDZA 1A63A 2OCEA 5JVH3 1RODA 1WTWA 2NVXH 1FNWA 3DM1A 4FXKC 1K73C 4X3SA 4DUYL 2Q2IA 4MN3A 1XPRA 4CDEC 4CDDC 1I4RA 1SE2A 1EY5A 2M2LA 4DR2Q 4QGUA 4FF1A 2NWGA 5D3DA 1BNZA 1GHKA 1CA6A 1H9SB 1H9MA 3HOWB 1Q86C 2K5VA 2N3SA 2FHTA 4HMJA 4DV1Q 3HG9A 1KLGD 2C9OA 3CQZB 1BXTA 4Z9CB 3VR5A 4KKTA 4EVOA 3TS2A 3ULJA 4CKCA 4OGQC 5AJ3L 4JI2Q 2MO0A 1U0LA 3B6YA 1T5XD 5M5XH 5JOBA 4H44C 4DAYB 2ICIA 1EEID 1DGSA 4AYBG 1XPOA 3OWEB 4DNTB 3HOXH 2DJFC 5M3MB 2RSNA 2B2UA 2ICEC 4RAUC 1IXRA 2Z1CA 1VQBA 2F0MA 2K7VA 5CV6A 2UXCQ 2ATWA 1YHBA 3CF5A 3QB3A 1QVFA 1N32Q 5IWAQ 3M4QA 3W5OA 2N88A 4IPHA 1PYWD 4MTNA 4LF4L 4RCOA 4NB3A 4PZ7A 4BBRB 4C3HG 2XWJB 1XMOL 4J15A 2B2VC 4YWMA 1L0XB 2KUMA 3FVQA 4A3EH 3PO3H 3PIO3 1XMQL 5M5YB 2PYKA 4DAVA 1OXVA 1Z6HA 4BBRH 2XVSA 1D7QA 1VDZA 2YTXA 4CBVA 2BDNA 1DONA 1GUWA 5FLMG 4LK1C 2L4NA 3NP8A 4K5WA 1GUTA 5KRUA 5IOCA 1EFID 4H7BA 4QL5A 1RKNA 4WFN3 1PH5A 1QNUA 5BN5A 1TY0A 3M4OH 3W3AA 4DV0L 1CKOA 1N34Q 1SDFA 4GNXB 4B3MQ 1M4VA 4A3EG 4A3KB 1JOQA 4KY6A 2B2TC 1PRTF 4LJZC 2B63G 2LXJA 1EY9A 2BH8A 3UE1A 1TQOA 3IFDA 2Q2HA 1CTMA 3DWPA 1Z47A 3T13A 4X65L 4BY1H 4R4OA 5FO9B 3K57A 2R7DA 1VQ6A 2WINB 1ZEQX 4DR4L 4JI7Q 1HFNA 3GTLH 1RTOA 3A8KE 1F9PA 4IJLA 1NMFA 1K0SA 1L0YB 1EYGA 3PIOA 1VF5C 4PG3A 3KOJA 3G7LA 3A5UA 2MQHA 1HUMA 4EGVA 4OO1I 5FLXL 1CFMA 4ILWA 1V1QA 2F0PA 4RGOS 1RDPD 1STAA 5K36H 3WDNA 2F0LA 1D5XC 4A3CH 5JJZA 1E1TA 1VQIA 5HURA 2MNAA 3BZDB 2AQ2B 1QVGA 1VMCA 2X6LA 4JW0A 1KIXA 3GP7A 3CKIB 2V1CC 3AFQA 3MA2B 4XT1B 5E3FA 3RLOA 2PQAA 4IUUA 4JK1C 4LFAQ 4GKKQ 3S17H 3RN5A 1ZYRC 1XJVA 3KJPA 2CW0D 3SK4A 3CMEA 2KA7A 2WAQB 2Y0SG 1G91A 4K2KA 1B8AA 1CSQA 3A7LA 1S40A 3ZYYX 3KLSX 2ZXRA 4BBSG 1VQEA 5FOBB 4B3RQ 3U50C 4UHVA 2EY5A 5EKLA 1TS4A 3S16H 1JE5A 2PI2E 4JC0A 2RVLA 1EY4A 1EWHA 4KMUC 1KRTA 5I4DA 5IYCH 1SFOH 1WTXA 4LF8Q 2ENBA 3BYYB 1HNZQ 3J80i 3HOYB 3K0YA 3S1QB 2K5QA 3GQBA 4RGMA 4L5RC 2AMCB 3VYRA 3KLSA 1JC7A 5FJ8G 2XNAC 5IYDH 1PYBA 2L15A 1TWFH 5L37A 1I4GA 4Q0FA 1NE3A 2CVRA 4A3MB 1BR9A 3IRBA 2JYOA 5C3EB 2EYLA 2WP8J 5FO8B 1PZID 5M3FG 2QDBA 5LL6S 4A3IH 2DNEA 4DXFA 1LYLA 2XIWA 1WTVA 1CI3M 3P1HA 1SE3A 1PH6A 4IFDJ 3GTKH 1ZYRD 1LACA 1EZ6A 3HEJA 1D2BA 1RL2A 3BYTB 4HSVA 1YJWA 3S16B 1Q3LA 1P8LA 2F0JA 3N52A 1P16A 1SN8A 1DCZA 5KEEA 2Q8TA 4YCWA 1HNXL 4WJ4A 4C3IG 4FNFA 1X54A 2AWNA 1TU2B 2YTVA 2LS01 3OHXC 3Q23A 3VDYA 4O42A 4APVA 4JI8L 5JEAG 1HJPA 2CH4W 1N33L 3MXPA 2F0UA 4PV1C 3KF8A 4IFDI 1KHIA 2CH4A 2EYHA 4YY3Q 1KDBA 1X3FA 2CQOA 1VQAA 4HMIA 3BVMA 1E3PA 1EL0A 3KDFA 2I5MX 1SE8A 3VYTA 2AUJD 1LTSD 4ZKCB 2A6HC 3JC66 1A2UA 4B3SL 1D8LA 1GHJA 3OW2A 2KCCA 1ONLA 3I4NB 4A3DB 1ILPA 2MHVA 1MKHA 2JK8A 1S4ZA 3URYA 1YVCA 1Q12A 3I8ZA 1W3SA 5DM73 3ERSX 3PUWA 3IKJA 4Q5VA 2JA6H 1O7ZA 5ELDA 4K8IA 4DUZL 4KD3A 3HOXG 2R7ZG 1DJRD 4UPAA 4LF5L 4QY7A 2BA1A 1SBBB 2PNRC 1Q90A 1FD7D 3GTPB 3I90A 2IX3A 4DUYQ 4DK0A 1M1KC 1F77A 2VB3X 2NZHA 2C5CA 3CU7A 4IURA 1TY2A 3CCUA 1K8AC 1PTOC 1SFOB 3SGIA 4KHVA 1LTTD 3C1FA 4XTCS 1SJED 1SYDA 2QILA 5D14A 4DV2L 5EBCA 2E2JH 4G4KA 4GLAC 4JBJA 3FKIB 2L1BA 2ASBA 1STBA 1SNQA 3VR6A 2F0OA 4NXNQ 4RHRA 3FKIG 1XNQL 3TP5A 3P75A 1EUJA 2VS1A 2XTIA 1EZ8A 1Q7YC 3T51B 1A2TA 1MI2A 1PA6A 2WB1B 1G6PA 4WJ3M 4LF7L 2BDOA 1VQ5A 2JXMB 4P75A 1LT5D 2VQFL 2EXDA 1D1KA 3JAME 3GTQB 3S15H 5JAVA 1XWEA 1EOVA 5CV8A 3CCRA 2A19A 3UDGA 4IPGA 2K04A 4A93B 5C4JH 1GD7A 4KKSA 2NN6I 3I2ZA 3DXJC 1UE7A 2F4IA 2RCFA 2KCTA 1NTGA 4X62Q 1G51A 5K5PA 2OWOA 4AYBB 2I0QA 4HIKA 4N8X1 4X66Q 1WTPA 4DV7Q 3TP6A 1ASZA 1TWFB 2NVTB 3PIPA 1YNXA 1EQTA 4A3LG 3Q24A 2VW9A 4IUNA 3HOVH 3HOZH 2DN8A 1TWCB 3I70A 1E24A 2Z6KA 4DAPA 4BY1B 3J81j 3BJUA 2B29A 3T1YL 1W6KA 1IBMQ 1HZBA 4K6LA 4ABNA 4NXNL 4WRDA 3K0XA 1IHZA 1NMGA 3E5SA 5DEHA 1U4RA 2QDLA 4XQQA 2PCFB 3W1GA 2K03A 1AFPA 1EQRA 3F1ZA 3PIP3 1QZHA 3KFUA 1YITA 2XWBB 2UUBQ 5LMNW 2ES2A 1I6HH 4KN7C 2R92H 2Z0SA 4EQ5A 2A68D 4KN4C 1SSOA 1K8GA 1NBWA 4K14A 1UE1A 1QZGA 4BY7B 3HKSA 1N8RC 3KBGA 4TRDA 1JR0D 3BG3A 1HZAA 1DXMA 4KY7A 5M5YH 5C44H 5C3EH 4IQZA 3I4MG 3TDQA 4E6IA 2B63B 4WORA 4ODGA 2E74C 2ZTCA 1YJNA 3A7AB 1JOOA 2R7FA 2BOSA 4A3DG 1CT1D 1E1OA 2FJ2A 4C3JB 1PZJD 5T1IA 1A62A 1SYGA 3L9AX 3HOUG 4JI3Q 4HJ9A 3M9BA 3UDIA 1FNUA 1YBYA 3K5MA 4ZRZA 3NEMA 2ZTEA 1STYA 1E2VA 2SNMA 2UXBL 3GTGB 2NVYB 4GKKL 2EYMA 3L3OC 1JORA 1NJIC 4NW2A 5M5XB 3S14B 2LFNA 2H1EA 3ULLA 1TWAB 1Z9FA 5EBDA 2JJQA 4CDCC 2F0FA 3HGBA 1HNWQ 2B63H 4KHZA 4JPBW 3K8AA 3CMAA 2K5DA 4A3JH 2MPMA 1IBLL 4HAEA 5J39A 1D6EC 4JBKA 2NVQB 4IUTA 4IOAA 2EYPA 1ESFA 4OX9L 4HEDA 3I4MH 1B3QA 1A3VA 3PUVA 1AH9A 2D5DA 1CSPA 4BY7H 5GQOA 3KF6B 1I3QH 2ALYB 4LUZA 2PW7A 2QA4A 5CYUA 1K8OA 1Q82C 4A3IB 4BBRG 2WB1G 3DWAA 3V05A 2C35B 3BU2A 5FLXE 1LM0A 1PRTB 2EJMA 5ELFA 2MJ8A 3A55A 3GTLB 2D0OA 2IJ0A 1K0RA 1OTCA 3BZCA 1Q81C 1PFMA 1WCMG 3NWSA 2KOLA 4OO1G 4JI5L 1DOKA 3CAMA 1MJEA 1B9MA 4X6AH 2K5NA 1G2SA 5GAHC 1ENFA 4LF9L 3GDEA 4HCSA 2E2DC 1FGUA 4OIKA 2O5JC 2GVBA 1VQPA 2D62A 1J8IA 1AP0A 2PNHA 1KL9A 4DR6Q 4R4CA 5C3XA 3HOUH 2F52A 1SMYD 3ONAB 5AJ3Q 3S2HH 2OXPA 3J80c 3FHWA 1W2BA
chains in the Genus database with same CATH topology
4IUQA 1HPCA 4BA1I 3NTKA 2VB2X 2J4XA 2Q8RE 3WOEA 1AEXA 3PMFA 5LHY1 4C56C 2Z8LA 1R4QB 1BBXC 5T1GA 1SNDA 2ID0A 3VR4A 4B08A 1TVXA 1SMYC 3J81L 5C3WA 2NTSA 1RJTA 5CV4A 1O78A 3J7AV 5DNFA 4NMZA 1SNMA 4G7ZC 3CRLC 1JWSD 1BCPC 4A3BB 1O7YA 2EOTA 2KECA 3HKZB 3I3CA 3M4YA 2KEEA 1B3AA 1H9KA 4IUPA 1BO0A 2O2LD 3D8GA 5CBEE 2BA0A 3BVZA 1H9SA 2AQ3B 3S17B 1JB3A 1O7LA 2F0SA 1TS5A 1AZPA 1EOTA 5EPKA 1UEAB 1HRJA 1TIID 3D6CA 1EY8A 3S2HB 3EROA 4IUVA 3MAQA 2BCOA 2RDFA 1IL8A 2B2VA 2NN6G 4K5VA 4V190 1NAPA 5C4HA 4F87A 2PW5A 3DEOA 2YU9B 2JA7B 1BQQT 2RBMA 2SNSA 2F3VA 1EY7A 5KNDA 1HTPA 2B2WA 1CK1A 1LT6D 3DEPA 1YNJC 3W2DA 5ISRA 2F0VA 5I6YA 4CKEA 1WTRA 3S1NB 2H4OA 4XT3B 1CZWA 1LTRD 3J80L 3GTMB 3NUCA 3I4MB 2XN9C 1HQRD 5KYLA 4DFAA 4A3EB 4J8QA 1H9RA 1DOMA 4RKBA 1GUGA 3FPUB 5A35A 1LABA 3NQIA 2NTTA 1PRTC 2PMZB 2R3ZA 2AQ1B 3BDOA 2SDFA 4N9PA 2G9DA 1PLFA 3BDLA 2KHSA 3CHBD 2E2JB 1BDOA 3RLFA 4DF7A 3U9SA 1JE4A 2XRQD 3GTJB 1SEBD 2B2YC 1EYDA 1KABA 2OF1A 4L63B 4U68A 4C3IB 5IIFA 5KIXA 3MXNA 4V0BA 5IGFA 3QOJA 1EQVA 4RHSA 5JEAJ 1G8ZD 2IL8A 4ZKBB 4EQPA 4J1MA 4MIUA 4NDXA 5K36G 1PZKD 1I4HA 4B9WA 2EY1A 4R8IA 3C2PA 2O4XA 1F2ZA 3QG1A 3TP8A 4FXGC 1STNA 3C46A 1Y1VB 2R6GA 3PV0A 3R8BA 2TMPA 2K32A 1BUVT 4NP5A 3OWFA 1OXSC 1F9QA 3PUZA 3GV6A 1QILA 3AB9A 5I6WA 2PZUA 1IYUA 1II3A 4FO2A 2VUMB 3MC0B 3D4DA 4BA2I 1IKLA 4F8MA 3FMCA 1FYCA 1S5ED 4XQNA 1LLRD 1QNKA 1Q1BA 4CJ2C 1I6VC 3H91A 2K01A 4H13C 1KTKA 4BS9A 4K8JA 2KCNA 4BWGB 3UI2A 1NR4A 3J7YW 1QCBD 2L11A 4HTHA 2OEOA 1GOZA 3D4RA 3J80E 1XTCD 1EEFD 2X6GA 1VF7A 4RGTA 3F2UA 3LWEA 1HXYD 1DOLA 2JP1A 3C1EA 1GUSA 3J81E 2A69C 3IFTA 1HUNA 3DUZA 5IGCA 3K5LA 2SEBD 1C4QA 2EJGC 3R2IA 5DM63 1U4MA 3D6WA 4XXEA 1HA6A 1FR3A 5G3LF 5HGTA 5EKIA 5M9OA 4QB4A 1HTLD 1Q8IA 3VYSA 1TT2A 2F1MA 1TKWB 2EYOA 3OMGA 3MZ5A 2JEBI 5I2XA 3TN2A 3PO3B 4A3JB 3NPPA 2RDHA 3MWYW 3DHQA 1U4PA 4DK1A 4ME5A 2AWOA 2Y0SB 5E4WC 3ITPA 4DU9A 1RHPA 4HR7B 4FXDA 2EYJA 3S1RB 1Y8OB 4ZAIA 1SJHD 2ZT9C 1D5ZC 4BBSB 1NSNS 5TSSA 1MGSA 1XX8A 2NZ1D 5ELEA 4IZ8A 3Q0AA 1EU4A 1S5DD 4GZYC 2L5TA 5IGEA 3NQTA 3PUXA 2WKDA 4PMBA 3TP7A 2GA4B 1DD2A 2A73B 3G6JB 3A54A 4F88A 1ET9A 1PTOF 2IW3A 1U4LA 3OMCA 3D3RA 2Q8IB 1IW7D 1PMRA 5BN3A 1GUOA 3M3YB 1EYAA 2A6HD 2X69A 4DAYA 2VXWA 1DYQA 1TR5A 2F0NA 3KLRA 2SOBA 4DA2A 1B4OA 3E6ZX 2F0GA 1AW7A 1B1ZA 5C4ZA 2NBFA 4ID6A 1WCMB 1JQYD 1SYCA 2O5IC 3GD7A 3SK6A 2HUGA 2WKCA 2WV6D 2KVMA 1SAPA 2L9HA 4TSSA 3J7AF 4R8NA 1E2WA 2RSOA 1G2TA 1WD0A 1QOHA 3SXHA 1SYFA 1I3QB 5EPLA 4CKBA 2WACA 1X32A 2E76C 4ZQ3A 1CQVA 2PZWA 5G3LD 4H0LC 3I91A 4HSPA 3HS0C 3WOFA 5CC4A 1SNPA 4A3FB 4R9WA 3MVVA 3T4AC 4ZLTF 2HCIA 4F7XA 1G6ZA 4CJ1B 2HCCA 2AUKA 1PTOH 2BE5D 2IPKD 2D9UA 2B2WC 5I2YA 2JSOA 1WTQA 5IT9E 3R3OA 3R2TA 2IX1A 4QIWB 2JEAI 1NCVA 3AU7A 5I9OA 4PMCA 1HHVA 2OT2A 4K5XA 1EY6A 2B2TA 3V2TA 4C3HB 4XQJA 3GTOB 1LT4D 5A2QE 2EJFC 3I73A 1IKMA 3A8IE 5BN4A 1VCIA 5C5MA 1OXUA 2QEJC 3QOLA 5C5LA 2F0TA 3ND8A 3E0JA 2K05A 2LY7A 1NR2A 3H94A 1LTAD 4QUCA 1ZKOA 1S5FD 4C2MB 1SYEA 1Z7TA 1WVLA 5E1FA 5JPMC 4TQUS 3HP3A 2XRSD 2F0IA 3S15B 1CM9A 4XYQA 1PRTD 3Q6SA 5ELCA 3L7ZC 4CHTB 2KQ3A 1S5BD 1A15A 2K5WA 4K6DA 3KUPA 5KGUA 3I4LA 1FNVA 1QWYA 1STEA 5LL6X 2A5HA 1QE6A 2E2IB 2FMMA 3QO2A 3MFYA 1XYIA 2HQEA 4Y7NB 2JA5B 2G9HD 5J22A 3Q22A 4A3GB 5CV7A 2NVXB 3SVMA 2F0EA 2QCPX 1OXTA 5D3IB 1PXUA 1KLUD 3X3NA 1BF4A 4LAAA 1U9RA 4UDUC 4C3JG 1Y1WB 4FP5D 1F2MA 3HOUB 1H9JA 3IL8A 3D4WA 3P20A 3KBXA 1WTOA 3S9WA 2IT1A 4P2CB 2M00A 3H6MA 4J6HA 2A74C 5JEAH 2NYZD 3SE0A 1CQFA 1FGBD 1SYBA 2RDGA 2A6EC 3M85A 2B2YA 4I65A 3HOZB 3HOVB 3P7JA 2DNCA 3RZDB 2ZXPA 2JA6B 5M3FB 3NE5B 2YYZA 1VMPA 3H0GB 4XDXA 4FVMA 5CGKA 4KTAA 5IGDA 4IALA 1I6HB 1KDCA 1Y8PB 3K5OA 4G7OC 1BCPF 3RUZA 3OIPA 4OHJA 3LNNA 1Y69U 1D5MC 3O13A 2R93B 2EVBA 3MXGA 2QF7A 4PNYA 4ZUJA 4RA8A 4U673 3K7AB 1ESRA 2QKIC 5IGGA 3MFGA 3HRZC 1B44D 2K1BA 1W6JA 4KKUA 5KNBA 3BDCA 3MEHA 3PUYA 5IODA 2D2CC 5EKKA 1JICA 1ENCA 3M4OB 3A8JE 1TS2A 2CW0C 3OW7A 3T56B 2CQAA 3OSOA 1TWGB 5EPJA 3NK9A 4QMGA 2NN6H 3VA5A 4RWSC 1SNCA 1RD9D 3OIQA 1LTID 2A68C 3S2DB 1F9RA 3VR2A 4IFDG 1EU3A 2HDMA 2K33A 2JA8B 4JBWA 3VYUA 1I4QA 5C44B 3SHLA 2VNUD 1JWMD 3SR1A 3N6RA 4RGNA 2V4DA 3BVGA 2FMCA 2R92B 2B2UC 3FRPB 1E0BA 1B9NA 4EQOA 1A3TA 4UAIA 4XYOA 3AMUA 4HN7A 4G57A 1Q1EA 1MD2D 3H3VC 1YNJD 1ML0D 5M5WB 4I7ZC 1F2LA 2F0KA 4X3KA 2A6ED 1F9SA 2A69D 4EQNA 4RFBA 3VA7A 1JOKA 4XIGS 2F0QA 1C48A 4KY5A 3TZDA 2I07B 3A56A 1LT3D 1I4PA 1YNND 3ND9A 1B50A 2KEDA 2EY6A 5FK9C 3T16A 4KV6A 1GJXA 4M8AA 1STHA 3QWNA 2ZXOA 5NUCA 1LO5D 4L6TB 1G291 3S1MB 4NKLA 5C0XH 1UUPA 1AZQA 1V1PA 1HA5A 3TZUA 3RMHA 1HFGA 4FF3A 5KNCA 3NWTA 2B39A 3GV3A 1R4PB 5D65A 5I9PA 1QB5D 3K58A 4N9TA 2N55A 1OXXK 2EYFA 5CV9A 3SK8A 4B9XA 1TWHB 3GTKB 2RKSA 3OPOA 1YNNC 3C3LA 4WJWA 2J7ZA 1UNSA 3M7GA 1B53A 1XXGA 4C1NI 3R93A 1R9TB 1K8MA 1GXDC 3BS1A 2MUYA 4FF2A 1GUNA 1DM0B 1IW7C 1SXTA 3H09A 5C0XI 2PO4A 4IFDH 2PZTA 3DWQA 2E75C 4KI0A 1QG7A 1EY0A 1LTBD 4FYDA 3EJIA 1PFNA 3NTIA 5CR3A 2I46A 4KJNA 5FKAC 1DZ1A 1X3PA 1K83B 3NHHA 1OO9B 2R7ZB 3LWUA 3OOCA 5C0XJ 4IN3A 3CRKC 4OL7A 3ERQA 4FF4A 3SEBA 4PQXA 4G7HC 4X3UA 1E2ZA 1UAPA 5JVG3 3RD4A 3EVQA 1LV9A 5CV5A 1PFBA 5CMDA 1I4XA 2MGSA 5KYIA 1KDAA 1BCPB 4QUFA 2EZVA 3GO5A 4RH6A 3FPPA 1ET6A 2Z4HA 5EQ0A 1KAAA 3MTSA 1EIGA 1QJOA 4RCNA 4PMWA 2F0DA 5CBAE 3JAML 1F2YA 1MSHA 1IYVA 4DGZA 4KK7A 4TKOB 1CZGA 2PQEA 3DMUA 5C4XB 5C0XG 5F2DA 4K2LA 4CGYB 1JCKB 4QF4A 5J1ZA 3IAYA 4MHEA 4KD4A 3MXUA 2HDLA 3X3MA 5FO7B 1KNEA 1KNAA 4RKLA 4HCEA 5JPNC 2JE6I 3K59A 1HQMC 2LMCB 5C4JB 3I72A 2F0WA 2PPBC 2IWHA 2FINB 2L0CA 4M1UB 2NUCA 1MSGA 4KJOA 1I50B 2EDGA 2F0HA 1O80A 5AFWA 2B8GA 4C1NK 3LX0A 4ZUIA 2F3WA 3TBIB 1PDQA 3EA6A 3D31A 3RZOB 2FFKB 4LMQD 1ILQA 3NBHA 5COYA 3NTHA 5EJWA 1J9OA 1SE4A 3M7NA 2Z4IA 2EE1A 1SNOA 1Y8NB 5CORA 1PTOD 3QJYA 2L12A 4ZK9B 3KK7A 3EQLC 1PTOB 1RCVD 1BOSA 3NXWA 1RF2D 1CHPD 1JWUD 5IT9L 3K5NA 3T53B 3FEWX 1T5EA 1B2TA 1V8QA 4CJ0B 5EGTA 1M8AA 4DXGA 1D1IA 3V96A 4ZYSA 1WD1A 2F03A 3PO2B 1HCZA 2K28A 4O1NA 1V1PB 5DAUA 3TSSA 1V43A 1A6XA 4S3SA 1LTGD 2EY2A 1STGA 1EWCA 1ZXTA 2K6AA 3NBIA 2RA4A 1ICWA 1X3QA 5A2QL 1CHQD 2WIIB 2J0TD 2KJXA 3U9OA 2MP1A 1CA5A 1V1OA 3FDTA 1MBYA 2XSCA 5IGBA 1S5CD 3EFXD 2EPBA 1NUCA 4L8JA 3QIAA 4DNRB 2B8FA 1EYCA 3TMEA 5ELBA 2E2HB 3MHBA 2DY7A 3VR3A 2L55A 1C8CA 4OIJA 5E4XA 2EXZA 4QCLA 3SK5A 2TSSA 1TS3A 1EIHA 4DN4M 1BCPD 3HZXA 1ENAA 2BE5C 2NB0A 3NSWA 2CHBD 1AN8A 3K6OA 3HOXB 2M9VA 2R61A 4ULLA 4OO1H 1RTNA 4X3TA 2IX0A 2DY8A 5C6AA 2RQXA 1A3UA 2LKVA 4YIJA 3SDZA 5JVH3 1RODA 1WTWA 1FNWA 3DM1A 4FXKC 4X3SA 4MN3A 1I4RA 1SE2A 1EY5A 2M2LA 4FF1A 2NWGA 5D3DA 1BNZA 1GHKA 1CA6A 1H9SB 1H9MA 3HOWB 2FHTA 4HMJA 3HG9A 1KLGD 2C9OA 3CQZB 1BXTA 4Z9CB 3VR5A 4KKTA 4EVOA 4CKCA 4OGQC 1T5XD 5JOBA 4H44C 2ICIA 1EEID 3OWEB 4DNTB 5M3MB 2RSNA 2B2UA 2ICEC 4RAUC 2Z1CA 2F0MA 2K7VA 5CV6A 3QB3A 2N88A 1PYWD 4RCOA 4BBRB 4C3HG 2XWJB 2B2VC 1L0XB 2KUMA 3FVQA 3PIO3 5M5YB 2PYKA 4DAVA 1OXVA 1Z6HA 2XVSA 1VDZA 4CBVA 2BDNA 1DONA 1GUWA 4LK1C 2L4NA 3NP8A 4K5WA 1GUTA 5KRUA 5IOCA 1EFID 4H7BA 1RKNA 4WFN3 1QNUA 5BN5A 1TY0A 3W3AA 1SDFA 1M4VA 4A3KB 1JOQA 4KY6A 2B2TC 1PRTF 4LJZC 1EY9A 1TQOA 3IFDA 1CTMA 3DWPA 1Z47A 3T13A 5FO9B 3K57A 2WINB 1ZEQX 1HFNA 1RTOA 3A8KE 1F9PA 1L0YB 1VF5C 3G7LA 1HUMA 4EGVA 4OO1I 5FLXL 1CFMA 4ILWA 2F0PA 4RGOS 1RDPD 1STAA 5K36H 3WDNA 2F0LA 1D5XC 5JJZA 5HURA 3BZDB 2AQ2B 1VMCA 2X6LA 3GP7A 3CKIB 3MA2B 4XT1B 5E3FA 4IUUA 4JK1C 1ZYRC 2CW0D 3SK4A 2KA7A 2WAQB 1G91A 4K2KA 3A7LA 3ZYYX 3KLSX 2ZXRA 5FOBB 2EY5A 5EKLA 1TS4A 2RVLA 1EY4A 1EWHA 4KMUC 5I4DA 1WTXA 2ENBA 3BYYB 3HOYB 3K0YA 3S1QB 2K5QA 3GQBA 4RGMA 3VYRA 3KLSA 1JC7A 2XNAC 1I4GA 4Q0FA 2CVRA 4A3MB 1BR9A 2JYOA 5C3EB 2EYLA 2WP8J 5FO8B 1PZID 2QDBA 5LL6S 2DNEA 4DXFA 1WTVA 2XIWA 1CI3M 3P1HA 1SE3A 4IFDJ 1ZYRD 1LACA 1EZ6A 3HEJA 1D2BA 3BYTB 4HSVA 3S16B 1Q3LA 3N52A 2F0JA 1DCZA 5KEEA 2Q8TA 4C3IG 4FNFA 2AWNA 1TU2B 2LS01 3OHXC 3Q23A 4O42A 5JEAG 3MXPA 2F0UA 4PV1C 3KF8A 4IFDI 2EYHA 1KDBA 4HMIA 3BVMA 1EL0A 3VYTA 2AUJD 1LTSD 4ZKCB 2A6HC 1A2UA 1GHJA 2KCCA 1ONLA 3I4NB 4A3DB 1ILPA 2MHVA 1S4ZA 3URYA 1Q12A 3I8ZA 5DM73 3PUWA 3IKJA 4Q5VA 1O7ZA 5ELDA 4K8IA 4KD3A 1DJRD 2BA1A 1SBBB 2PNRC 1Q90A 1FD7D 3GTPB 3I90A 2IX3A 4DK0A 1F77A 2VB3X 2C5CA 3CU7A 4IURA 1TY2A 1PTOC 1SFOB 4KHVA 1LTTD 3C1FA 4XTCS 1SJED 1SYDA 2QILA 5D14A 5EBCA 4G4KA 3FKIB 2L1BA 1STBA 1SNQA 3VR6A 2F0OA 4RHRA 3TP5A 3P75A 1EZ8A 3T51B 1A2TA 1MI2A 2WB1B 2BDOA 2JXMB 1LT5D 1D1KA 3JAME 3GTQB 5JAVA 1XWEA 5CV8A 2K04A 4A93B 4KKSA 2NN6I 3DXJC 2F4IA 5K5PA 4AYBB 1WTPA 3TP6A 2NVTB 1TWFB 1EQTA 3Q24A 4IUNA 2DN8A 1TWCB 3I70A 4DAPA 4BY1B 1W6KA 4K6LA 4ABNA 4WRDA 1IHZA 5DEHA 3E5SA 1U4RA 4XQQA 2PCFB 2K03A 1AFPA 3PIP3 2XWBB 4KN7C 2A68D 4KN4C 1SSOA 4K14A 4BY7B 3KBGA 4TRDA 1JR0D 3BG3A 1DXMA 4KY7A 4IQZA 3TDQA 4E6IA 2B63B 4WORA 4ODGA 2E74C 3A7AB 1JOOA 2BOSA 1CT1D 2FJ2A 4C3JB 1PZJD 5T1IA 1SYGA 3L9AX 1FNUA 3K5MA 4ZRZA 1STYA 1E2VA 2SNMA 3GTGB 2NVYB 1JORA 2EYMA 3L3OC 4NW2A 5M5XB 3S14B 2LFNA 2H1EA 1TWAB 5EBDA 2F0FA 3HGBA 4KHZA 2K5DA 2MPMA 4HAEA 5J39A 1D6EC 2NVQB 4IUTA 2EYPA 1ESFA 4HEDA 1A3VA 3PUVA 2D5DA 2PW7A 1K8OA 5CYUA 4A3IB 3DWAA 3V05A 5FLXE 1PRTB 2EJMA 5ELFA 2MJ8A 3A55A 3GTLB 2IJ0A 1PFMA 3NWSA 2KOLA 4OO1G 1DOKA 1B9MA 1G2SA 1ENFA 4HCSA 2E2DC 4OIKA 2O5JC 2D62A 1J8IA 1AP0A 5C3XA 1SMYD 3ONAB 2OXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTP A;  3A8I E;  5BN4 A;  2R6G A;  1VCI A;  5JEA H;  4LJZ C;  1V43 A;  1HPC A;  1OXU A;  3MXU A;  3PV0 A;  3SE0 A;  4BA1 I;  1A6X A;  3SDZ A;  3N6R A;  3VR6 A;  2V4D A;  1YNJ C;  2EJG C;  3ND8 A;  1K8M A;  3H94 A;  2A6E C;  3M85 A;  1CTM A;  2DNE A;  1FR3 A;  2K32 A;  1B9N A;  1ZKO A;  1CI3 M;  1GUN A;  2O5I C;  1Q1E A;  3GD7 A;  3T51 B;  1IW7 C;  1Z7T A;  2BDO A;  1E2V A;  1OXS C;  2JE6 I;  2DNC A;  2JXM B;  4TQU S;  1LAC A;  2F1M A;  4I7Z C;  1TKW B;  1HQM C;  3NE5 B;  1GHK A;  2LMC B;  3I72 A;  4IFD H;  2YYZ A;  2A6E D;  2PPB C;  1H9S B;  1H9M A;  3PUZ A;  2A69 D;  2E75 C;  1E2W A;  3A8K E;  3L7Z C;  3AB9 A;  4KI0 A;  3VA7 A;  2JEB I;  4XIG S;  1DCZ A;  1IYU A;  3VR4 A;  1VF5 C;  1SMY C;  4KKS A;  2NN6 I;  3HGB A;  1TU2 B;  3DXJ C;  4KHZ A;  1CFM A;  3ND9 A;  2EDG A;  3VR5 A;  5JEA G;  4KKT A;  4L8J A;  1Y8P B;  1O78 A;  2B8G A;  3LWU A;  3QIA A;  4PV1 C;  1H9R A;  4G7O C;  5K36 H;  1GUG A;  4OGQ C;  3WDN A;  5A35 A;  4DK1 A;  4DNR B;  1LAB A;  3OOC A;  4BA2 I;  2E76 C;  3D31 A;  4G7Z C;  3CRK C;  3CRL C;  2AWO A;  4H0L C;  2B8F A;  3LNN A;  1Y69 U;  3I4L A;  4H44 C;  1GJX A;  4HR7 B;  3FMC A;  4G7H C;  3M4Y A;  1FYC A;  1E2Z A;  4JK1 C;  2EVB A;  1Y8O B;  3BDO A;  3PUV A;  2QF7 A;  2D5D A;  1H9K A;  1ZYR C;  4DNT B;  2ZT9 C;  1Q1B A;  2AUJ D;  2BA0 A;  2DN8 A;  2A6H C;  2KA7 A;  1BDO A;  1I6V C;  1K8O A;  1H9S A;  1GHJ A;  3RLF A;  3MFY A;  3U9S A;  3M7N A;  2KCC A;  1ONL A;  2AUK A;  2K7V A;  3VR3 A;  1G29 1;  5C0X H;  2BE5 D;  4H13 C;  2EJM A;  1O7L A;  3A7L A;  1Y8N B;  5KNB A;  4KKU A;  3QJY A;  4GZY C;  2L5T A;  3PUY A;  1Q12 A;  3EQL C;  2PCF B;  2JEA I;  3PUW A;  3IKJ A;  3TZU A;  3FPP A;  2D2C C;  2BE5 C;  3PUX A;  4OO1 G;  2BA1 A;  1DD2 A;  3D4R A;  2PNR C;  5KNC A;  1OXT A;  1Q90 A;  1EWH A;  1QJO A;  4KMU C;  4RCN A;  3T53 B;  3A8J E;  4KN7 C;  1B9M A;  1T5E A;  2CW0 C;  3OW7 A;  3T56 B;  2A68 D;  4KN4 C;  1VF7 A;  1OXV A;  1V8Q A;  1Z6H A;  4DK0 A;  1IYV A;  1VDZ A;  2O5J C;  2NN6 H;  3BG3 A;  4LK1 C;  4TKO B;  3GQB A;  5K36 G;  1DXM A;  1OXX K;  1GUT A;  2D62 A;  2Q8I B;  2A68 C;  4OO1 H;  2NN6 G;  1IW7 D;  1PMR A;  4IQZ A;  4XTC S;  1GUO A;  1HCZ A;  3VR2 A;  5BN3 A;  5C0X G;  4IFD G;  2K33 A;  1H9J A;  2E74 C;  4JBW A;  5BN5 A;  2A6H D;  3P20 A;  3W3A A;  3A7A B;  3QG1 A;  2EJF C;  1GUS A;  3OPO A;  5KND A;  3I73 A;  1YNN C;  3KLR A;  2IT1 A;  2A69 C;  3IFT A; 
#chains in the Genus database with same CATH topology
 1L0W A;  1NNX A;  4IUQ A;  4DR4 Q;  1HPC A;  4BA1 I;  1CKN B;  1JB7 A;  5BR8 L;  3NTK A;  2GVA A;  1CUK A;  2VB2 X;  2J4X A;  2JA8 H;  4DV6 L;  2E2H H;  4R4Q A;  2Q8R E;  3WOE A;  1AEX A;  2R92 G;  1SMX A;  4A3G H;  3PMF A;  4A75 A;  5LHY 1;  4C56 C;  2Z8L A;  1VQO A;  1R4Q B;  1BBX C;  4A3G G;  2A1A A;  1SND A;  5T1G A;  2ID0 A;  3VR4 A;  3S1N H;  3FKI H;  4B08 A;  1TVX A;  1SMY C;  3F8T A;  3DM3 A;  3J81 L;  2KCM A;  5C3W A;  2NTS A;  5IP7 G;  1RJT A;  4DV6 Q;  5CV4 A;  4NXM L;  1O78 A;  3J7A V;  4JVZ A;  5DNF A;  4NMZ A;  2Z6B A;  1SNM A;  4G7Z C;  3CRL C;  4OON A;  1JWS D;  1BCP C;  1B70 B;  4A3B B;  1O7Y A;  2EOT A;  2KEC A;  4A3C G;  3HKZ B;  3I3C A;  3M4Y A;  2KEE A;  3I4N G;  1B3A A;  1ICF B;  1H9K A;  4IUP A;  1BO0 A;  2O2L D;  3D8G A;  5CBE E;  3RZO H;  2BA0 A;  3BVZ A;  1E7Z A;  4GOP C;  4OEM B;  1H9S A;  2AQ3 B;  3PCO B;  4OWT B;  3QR8 A;  5C4X H;  3S17 B;  1JB3 A;  1O7L A;  2F0S A;  1TS5 A;  1AZP A;  3L2P A;  1EOT A;  4JI1 Q;  5FJ8 H;  4GS3 A;  5EPK A;  4JI4 Q;  1UEA B;  1HRJ A;  1TII D;  3D6C A;  1YI2 A;  4ME3 A;  1EY8 A;  1FVI A;  3F2C A;  3S2H B;  3ERO A;  4IUV A;  3MAQ A;  4JG2 A;  4JI6 L;  2BCO A;  3A0J A;  1U5K A;  1UWV A;  2RDF A;  4JI1 L;  4DPG A;  1IL8 A;  2B2V A;  2NN6 G;  4K5V A;  5IP7 H;  4V19 0;  1NAP A;  5C4H A;  4F87 A;  2PW5 A;  3DEO A;  2YU9 B;  2VUM G;  2JA7 B;  1BQQ T;  2K4K A;  2RBM A;  2SNS A;  2OTJ A;  2F3V A;  1EY7 A;  5KND A;  1HTP A;  2B2W A;  1CK1 A;  1KRS A;  1KQS A;  1LT6 D;  3D0F A;  3DEP A;  1YNJ C;  2NVY H;  3W2D A;  4ZCK A;  5ISR A;  3CCV A;  3NBH B;  2F0V A;  2UUC L;  5I6Y A;  4CKE A;  4IPD A;  2Z6K C;  1WTR A;  3S1N B;  2H4O A;  3E0E A;  4XT3 B;  1CZW A;  4C3J H;  1LTR D;  2VZA A;  3J80 L;  3TRZ A;  3HOY G;  4AQY Q;  3NUC A;  3GTM B;  3DLL A;  3I4M B;  4KHP Q;  2XN9 C;  1HQR D;  1N34 L;  1I5F A;  2UU9 L;  5KYL A;  3GTQ H;  5IYD G;  1UEB A;  1PH9 A;  4DFA A;  1JJC B;  4LF6 Q;  4A3E B;  4J8Q A;  1H9R A;  1DOM A;  3EN2 A;  4RKB A;  1GUG A;  3FPU B;  4YCV A;  5EAY A;  5A35 A;  3NQI A;  1LAB A;  2B3G A;  2NTT A;  2ZJR A;  1WOC A;  1HH2 P;  2MFI A;  1PRT C;  2PMZ B;  3KYH C;  2R3Z A;  2AQ1 B;  3BDO A;  2SDF A;  4A3D H;  4N9P A;  4DV4 L;  1IZ6 A;  2G9D A;  1PLF A;  4L5T A;  3BDL A;  2KHS A;  4CDF C;  3CHB D;  2E2J B;  1BDO A;  3RLF A;  4DF7 A;  3U9S A;  1VQG A;  1JE4 A;  2N78 A;  5C44 G;  2XRQ D;  3GTJ B;  1SEB D;  2B2Y C;  1KD1 C;  4JI4 L;  1SRU A;  1EYD A;  2FXQ A;  4LNQ A;  1KAB A;  2OF1 A;  4L63 B;  4JOI C;  4U68 A;  4C3I B;  5IIF A;  5KIX A;  3MXN A;  4V0B A;  5IGF A;  5LMN L;  2YU9 H;  3QOJ A;  4BY7 G;  4HID A;  3UDX A;  1EQV A;  4RHS A;  4GN4 B;  4JI6 Q;  5JEA J;  4LFA L;  2D0P A;  1G8Z D;  2IL8 A;  4ZKB B;  4EQP A;  4J1M A;  4MIU A;  3H0G G;  4NDX A;  4DR7 L;  3TEH B;  1PZK D;  5K36 G;  3F2D A;  1I4H A;  1EFW A;  2NZO A;  4A3I G;  4B9W A;  2EY1 A;  4R8I A;  3C2P A;  1EWI A;  1F2Z A;  2O4X A;  4HIM A;  3QG1 A;  3TP8 A;  1RIP A;  4FXG C;  1O7I A;  1STN A;  2E2I H;  4GOP A;  3C46 A;  1Y1V B;  2R6G A;  5C4X G;  3PV0 A;  2K5H A;  3R8B A;  1C9O A;  2TMP A;  3RZD H;  3PQI A;  1Y1V G;  3UDF A;  2K32 A;  1IBK Q;  1PH4 A;  1BUV T;  4MTK A;  4B3S Q;  4IJH A;  4NP5 A;  3OWF A;  3GTM H;  1OXS C;  1J6Q A;  3ICE A;  1F9Q A;  3OTO L;  4GNX A;  2Q2T A;  4DAM A;  3PUZ A;  3GV6 A;  3M4P A;  4GLX A;  3TQY A;  4DR1 L;  1QIL A;  3AB9 A;  5I6W A;  2PZU A;  3RN2 A;  2HHH L;  1IYU A;  2UUA Q;  3U4Z A;  2CWP A;  2H5X A;  1II3 A;  4FO2 A;  2VUM B;  5C3E G;  4DNI A;  2VQF Q;  3MC0 B;  5GAD C;  3D4D A;  4BA2 I;  1IKL A;  4JI5 Q;  4F8M A;  3LGJ A;  1PV4 A;  3FMC A;  1FYC A;  1YIJ A;  1S5E D;  4XQN A;  1LLR D;  1BBW A;  1QNK A;  1Q1B A;  4CJ2 C;  1I6V C;  1E22 A;  3MEF A;  3H91 A;  2K01 A;  2IHF A;  4H13 C;  3T1H L;  1KTK A;  3HOW H;  4DV7 L;  4BS9 A;  1R9T H;  4K8J A;  1QUQ B;  2KCN A;  3ULP A;  3AQQ A;  4JV5 L;  4BWG B;  3UI2 A;  1NR4 A;  3J7Y W;  1QCB D;  2L11 A;  3G48 A;  4HTH A;  2OEO A;  2VQE L;  1GOZ A;  3D4R A;  3J80 E;  5IP9 H;  4L5Q A;  1XTC D;  1EEF D;  2X6G A;  3T1H Q;  3S1R H;  1VF7 A;  3G4S A;  2DJG C;  2ZM6 Q;  3HKZ G;  4RGT A;  3F2U A;  3I7F A;  3LWE A;  1HXY D;  1DOL A;  4JI7 L;  3AFP A;  2CWA A;  4A4I A;  2JP1 A;  3C1E A;  2K14 A;  4BY1 G;  1GUS A;  3J81 E;  2HIX A;  4X64 Q;  2A69 C;  4GN3 B;  3IFT A;  1HUN A;  4GOP B;  3DUZ A;  5IGC A;  3UE0 A;  3K5L A;  1K83 H;  1VQC A;  2SEB D;  1C4Q A;  2EJG C;  1EIY B;  3R2I A;  1U4M A;  5DM6 3;  3D6W A;  4XXE A;  1HA6 A;  1VQL A;  1FR3 A;  1VQK A;  1BKB A;  1TXY A;  5G3L F;  4P72 A;  5HGT A;  5EKI A;  5M9O A;  4QB4 A;  1X9N A;  1HTL D;  1T9H A;  1Q8I A;  1WTH A;  3VYS A;  1TT2 A;  2F1M A;  1TKW B;  4O0A A;  1PYS B;  2EYO A;  3PO3 G;  3OMG A;  3MZ5 A;  2JEB I;  4RG1 A;  4A3M H;  1PH3 A;  2I5L X;  5I2X A;  5GAE C;  3TN2 A;  3PO3 B;  4DR6 L;  1AE2 A;  4A3J B;  3NPP A;  1GVP A;  4A3L H;  2RDH A;  3MWY W;  1XNR Q;  3DHQ A;  1UE6 A;  1U4P A;  4DK1 A;  3J7Z C;  4ME5 A;  2AWO A;  2WAQ G;  2Y0S B;  5E4W C;  3ITP A;  4DU9 A;  1RHP A;  3KJO A;  4HR7 B;  2ZTD A;  5IP9 G;  4FXD A;  2EYJ A;  1SR3 A;  1Y8O B;  3S1R B;  4ZAI A;  1SJH D;  5M3M H;  2ZT9 C;  1D5Z C;  4DV3 L;  1YJ9 A;  5GRO A;  4BBS B;  1NSN S;  5TSS A;  1MGS A;  4IO9 A;  1XX8 A;  1J5E Q;  1IBL Q;  2NZ1 D;  5ELE A;  4X65 Q;  4IZ8 A;  3Q0A A;  1EU4 A;  1S5D D;  4GZY C;  1NY4 A;  2L5T A;  5IGE A;  2UXD L;  1VQH A;  2K75 A;  3NQT A;  3PUX A;  4DR2 L;  2WKD A;  4PMB A;  2UXB Q;  3TP7 A;  2GA4 B;  5IE8 A;  1DD2 A;  1PH7 A;  2A73 B;  3G6J B;  3A54 A;  1JMC A;  4IPC A;  1L1O B;  4F88 A;  1ET9 A;  3GTO H;  1PTO F;  2IW3 A;  1U4L A;  4A3M G;  2JA7 G;  3OMC A;  3D3R A;  4DV1 L;  2Q8I B;  3T1Y Q;  1IBM L;  4UP7 A;  2E8G A;  1GM5 A;  1IW7 D;  1PMR A;  5BN3 A;  1GUO A;  3M3Y B;  2AKW B;  3CPF A;  1EYA A;  2VUM H;  1TWH H;  2A6H D;  3KF8 B;  2X69 A;  4DAY A;  2VXW A;  1DYQ A;  1TR5 A;  2F0N A;  3KLR A;  2SOB A;  1B4O A;  2RCN A;  3E6Z X;  4DA2 A;  4JYA L;  2F0G A;  4IOC A;  1PH1 A;  1AW7 A;  1B1Z A;  1ASY A;  5C4Z A;  2CKZ B;  1VQ7 A;  1L2F A;  2NBF A;  4ID6 A;  4B3R L;  1WCM B;  4GLV B;  1JQY D;  1SYC A;  2O5I C;  3GD7 A;  3SK6 A;  3STB D;  2HUG A;  2WKC A;  4HJA A;  3TRE A;  2WV6 D;  5IT9 c;  2KVM A;  1SAP A;  2L9H A;  4TSS A;  1VQM A;  4OXP A;  3J7A F;  4LF8 L;  4R8N A;  1E2W A;  2RSO A;  5BR8 Q;  2R7Z H;  1PVO A;  1G2T A;  1WD0 A;  1QOH A;  3SXH A;  1SYF A;  1I3Q B;  5IYB G;  5EPL A;  2JA9 A;  4OX9 Q;  3I4N H;  4CKB A;  4R4T A;  2WAC A;  1X32 A;  2E76 C;  4ZQ3 A;  1CQV A;  2PZW A;  5G3L D;  4H0L C;  3I91 A;  4HSP A;  3HS0 C;  5LMU Q;  5JJK A;  3WOF A;  5CC4 A;  1SNP A;  4A3F B;  4R9W A;  3MVV A;  3T4A C;  2NVQ H;  4ZLT F;  1LUZ A;  2HCI A;  4F7X A;  1Y14 B;  1M90 C;  1HR0 L;  1G6Z A;  4CJ1 B;  3JAM c;  2P5Z X;  3TS0 A;  2HCC A;  2AUK A;  4FDB A;  2Y0S E;  1PTO H;  2BE5 D;  2IPK D;  1MIU A;  2D9U A;  4HJ5 A;  2B2W C;  5I2Y A;  2JSO A;  1WTQ A;  2OQK A;  3FP9 A;  1IYJ B;  3RLN A;  5IT9 E;  3R3O A;  3R2T A;  2IX1 A;  4QIW B;  2JEA I;  1NCV A;  3AU7 A;  1HR0 Q;  1BBU A;  5I9O A;  4PMC A;  1HHV A;  2OT2 A;  4K5X A;  1VQD A;  4R1J A;  1EY6 A;  3G6E A;  2LSS A;  1Y1W H;  2B2T A;  3K80 C;  2DUD A;  4HJ7 A;  3V2T A;  4C3H B;  3L0O A;  2HIV A;  3OTO Q;  1CKM A;  2BH2 A;  2G5D A;  4XQJ A;  3E9H A;  3GTO B;  4JYA Q;  1LT4 D;  5A2Q E;  1N36 Q;  2RF4 A;  1K3B C;  5ELO A;  2EJF C;  4P74 A;  3I73 A;  1GKH A;  2QGQ A;  3I56 A;  4DV2 Q;  1IKM A;  3A8I E;  5BN4 A;  1VCI A;  2HD3 A;  5C5M A;  1OXU A;  2QEJ C;  3QOL A;  1FJG L;  5C5L A;  2F0T A;  3ND8 A;  2RHQ B;  3E0J A;  1XMQ Q;  2K05 A;  2LY7 A;  1NR2 A;  3H94 A;  1LTA D;  4QUC A;  2JA5 H;  1ZKO A;  1S5F D;  4C2M B;  1SYE A;  4R4I A;  3HOY H;  3RR5 A;  3H0G H;  1Z7T A;  1WVL A;  5DLQ E;  5E1F A;  5JPM C;  4LF5 Q;  4TQU S;  3HP3 A;  2XRS D;  2F0I A;  3S15 B;  1CM9 A;  1C7Y A;  1EQQ A;  4XYQ A;  1PRT D;  3Q6S A;  5ELC A;  3L7Z C;  3CCE A;  4CHT B;  2KQ3 A;  4PZ6 A;  3AYH B;  1S5B D;  1A15 A;  2HHH Q;  2K5W A;  4K6D A;  1AE3 A;  3KUP A;  4GN5 A;  2VY3 A;  1KC8 C;  4X62 L;  3H15 A;  5KGU A;  4AQY L;  3I4L A;  1FNV A;  1QWY A;  1STE A;  5LL6 X;  3CCJ A;  2UU9 Q;  4A3K H;  2A5H A;  1QE6 A;  2E2I B;  1PFS A;  4DUZ Q;  4C2M H;  2FMM A;  1L1O A;  4HJ8 A;  3NEL A;  3QO2 A;  3MFY A;  1XYI A;  3CC2 A;  4QJF A;  2HQE A;  4Y7N B;  4N8F A;  2JA5 B;  2G9H D;  3H3V H;  5J22 A;  3Q22 A;  4A3G B;  5CV7 A;  2NVX B;  3SVM A;  4LFB Q;  2F0E A;  4RMF A;  2QCP X;  1OXT A;  2CFM A;  3JAM i;  5D3I B;  2KHJ A;  1PXU A;  3CPW A;  3WWV A;  2YV5 A;  1KLU D;  2K52 A;  1Y1W G;  1TWG H;  3X3N A;  3J81 c;  4JOI A;  4DV5 L;  1TWA H;  1BF4 A;  4LAA A;  1K28 A;  1N36 L;  2ZM6 L;  1U9R A;  4UDU C;  4C3J G;  1Y1W B;  1K9M C;  4LF6 L;  4FP5 D;  1F2M A;  4UP9 A;  3HOU B;  1H9J A;  3IL8 A;  3D4W A;  4BBS H;  3P20 A;  3KBX A;  1WTO A;  3S9W A;  2IT1 A;  4P2C B;  2M00 A;  2KBN A;  3H6M A;  4J6H A;  2A74 C;  5JEA H;  2NYZ D;  3ZJY C;  4DV5 Q;  3SE0 A;  4JBM A;  1CQF A;  4B3T L;  1FGB D;  1SYB A;  3BZK A;  3CC7 A;  2RDG A;  2A6E C;  3M85 A;  2B2Y A;  4I65 A;  4AIM A;  3HOZ B;  3HOV B;  3NEN A;  1HNZ L;  1WI5 A;  2OTL A;  3P7J A;  3H3V I;  2DNC A;  3RZD B;  1X56 A;  2ZXP A;  2JA6 B;  5M3F B;  3NE5 B;  4P71 A;  2YYZ A;  1VMP A;  3H0G B;  1VQ8 A;  4XDX A;  4OWW B;  2HT1 A;  5IYB H;  4MZ9 A;  4YWL A;  3A5Z B;  4FVM A;  5CGK A;  1IBK L;  2VL6 A;  4KTA A;  5IGD A;  4IAL A;  4DR3 Q;  4YY3 L;  1I6H B;  1KDC A;  4LF7 Q;  1Y8P B;  1GO3 E;  4K0K Q;  3K5O A;  4G7O C;  2WB1 E;  1BCP F;  3PF4 A;  3RUZ A;  3OIP A;  4OHJ A;  2ZJQ A;  3LNN A;  1Y69 U;  3KLW A;  1D5M C;  3O13 A;  4JI0 Q;  4JI2 L;  2R93 B;  2EVB A;  3MXG A;  2QF7 A;  4PNY A;  4ZUJ A;  4RA8 A;  1X6O A;  4U67 3;  3K7A B;  1WCM H;  4JI3 L;  1HR0 W;  1VQ9 A;  5H1S E;  1ESR A;  2QKI C;  5IGG A;  3MFG A;  3HRZ C;  1B44 D;  2K1B A;  1W6J A;  4KKU A;  5KNB A;  3S14 H;  3GTJ H;  3MXN B;  3BDC A;  4A3K G;  1YHQ A;  3MEH A;  4POG A;  2NVT H;  3PUY A;  5LMN Q;  1N33 Q;  3GTG H;  5IOD A;  3EIV A;  1SLJ A;  2D2C C;  4TVA B;  5EKK A;  1PH2 A;  3HFZ B;  4HIO A;  1JIC A;  1ENC A;  3M4O B;  5FLX c;  3A8J E;  2CCZ A;  1TS2 A;  1VQF A;  2CW0 C;  3OW7 A;  2CQA A;  3OSO A;  3T56 B;  4DR7 Q;  3K7U C;  2I5H A;  1TWG B;  1I94 Q;  1YZ6 A;  5EPJ A;  3NK9 A;  4A3F G;  4QMG A;  2NN6 H;  3VA5 A;  4RWS C;  1SNC A;  4LF9 Q;  1RD9 D;  3OIQ A;  1LTI D;  2A68 C;  4LFC Q;  3S2D B;  1WYD A;  1F9R A;  3VR2 A;  4IFD G;  2UUB L;  1I50 H;  1QUQ A;  1EU3 A;  2VQE Q;  2HDM A;  2K33 A;  2JA8 B;  4JBW A;  3VYU A;  1I4Q A;  5C44 B;  4PZ8 A;  3SHL A;  1QVC A;  2VNU D;  4YHH Q;  1JWM D;  2JA5 G;  3SR1 A;  4C3H H;  4LUO A;  3N6R A;  4RGN A;  2V4D A;  1MHW C;  3BVG A;  2FMC A;  5IWA L;  4GKJ Q;  2B2U C;  2R92 B;  3FRP B;  5M5W H;  3AEV A;  1E0B A;  1B9N A;  1VS0 A;  1A3T A;  4EQO A;  4UAI A;  5M3M G;  3HKZ E;  4XYO A;  3AMU A;  4HN7 A;  4G57 A;  1Q1E A;  1MD2 D;  4Y52 H;  4DK6 C;  1YNJ D;  1ML0 D;  3H3V C;  5M5W B;  4I7Z C;  1F2L A;  2F0K A;  4X3K A;  3E3X A;  2A6E D;  1F9S A;  2A69 D;  4EQN A;  3I55 A;  4RFB A;  3VA7 A;  1JOK A;  4XIG S;  2F0Q A;  1C48 A;  4KY5 A;  3TZD A;  2I07 B;  3A56 A;  4LUV A;  1LT3 D;  1I4P A;  1YNN D;  3K7A H;  3CXC A;  3ND9 A;  1B50 A;  2KED A;  2EY6 A;  3S2D H;  5FK9 C;  1UE5 A;  3T16 A;  4KV6 A;  1EIF A;  1GJX A;  4M8A A;  1STH A;  3KDF B;  2WAQ E;  3S24 A;  3QWN A;  2ZXO A;  1XMO Q;  4DKA C;  3U58 A;  1SRO A;  5NUC A;  1LO5 D;  4L6T B;  1G29 1;  3S1M B;  4NKL A;  1YEZ A;  5C0X H;  1XTD A;  1UUP A;  2A8V A;  1WFQ A;  1AZQ A;  1V1P A;  3G71 A;  1HA5 A;  5GAG C;  1XPU A;  3TZU A;  1C0A A;  3CCQ A;  4BXX G;  2YTY A;  3RMH A;  1HFG A;  4DK3 C;  4FF3 A;  5KNC A;  3NWT A;  2XGT A;  2B39 A;  4A3J G;  4DV0 Q;  1S3O A;  3GV3 A;  2ZJP A;  4KLK A;  1R4P B;  5D65 A;  5I9P A;  1QB5 D;  4P73 A;  3K58 A;  4N9T A;  2N55 A;  2EIF A;  1OXX K;  2EYF A;  5CV9 A;  3SK8 A;  4B9X A;  3CC4 A;  1TWH B;  3GTK B;  4KHP L;  4OWX B;  2RKS A;  3PGZ A;  5JJI A;  5E7N A;  1Q8K A;  3OPO A;  1YNN C;  4A93 H;  3C3L A;  3J81 i;  2J7Z A;  1UNS A;  4WJW A;  3M7G A;  4NPS A;  1B53 A;  2DGY A;  4MNO A;  1XXG A;  4C1N I;  3R93 A;  1A8V A;  1R9T B;  1K8M A;  1GXD C;  1WJJ A;  3BS1 A;  2MUY A;  4FF2 A;  1GUN A;  1J5E L;  1DM0 B;  4QIW E;  1IW7 C;  1SXT A;  4A3F H;  3H09 A;  5C0X I;  2PO4 A;  3CCM A;  2N49 A;  4IFD H;  2PZT A;  3DWQ A;  4UP8 A;  2PQA B;  2E75 C;  3CCL A;  4KI0 A;  1QG7 A;  1EY0 A;  1MJC A;  1LTB D;  4FYD A;  3EJI A;  4X64 L;  1PFN A;  3NTI A;  1XNR L;  4GNX C;  5CR3 A;  2I46 A;  4KJN A;  5FKA C;  1DZ1 A;  3W1B A;  1X3P A;  1K83 B;  1HNX Q;  3CCS A;  2JA8 G;  3NHH A;  1CKN A;  1OO9 B;  3RNU A;  2R7Z B;  2F3I A;  3LWU A;  3OOC A;  5C0X J;  4DR5 L;  4IN3 A;  3CRK C;  4OL7 A;  3ERQ A;  1IL2 A;  4FF4 A;  3SEB A;  4PQX A;  4G7H C;  3HOV G;  3HOZ G;  4X3U A;  1E2Z A;  1UAP A;  5JVG 3;  3PO2 G;  2OQ0 A;  3RD4 A;  3EVQ A;  1LV9 A;  5CV5 A;  4B3M L;  2JA6 G;  1PFB A;  5CMD A;  4DV4 Q;  1I4X A;  2MGS A;  1S72 A;  4L5S A;  5KYI A;  1KDA A;  4LF4 Q;  4H02 A;  1BCP B;  1JJ2 A;  4QUF A;  5HGQ A;  2EZV A;  3GO5 A;  4RH6 A;  4Y7N H;  5IY0 A;  3FPP A;  1ET6 A;  2Z4H A;  5EQ0 A;  2GN5 A;  1KAA A;  1N9W A;  2WFW A;  3OYY A;  3MTS A;  1EIG A;  1QJO A;  4RCN A;  4PMW A;  2F0D A;  5CBA E;  2JN4 A;  3JAM L;  1F2Y A;  1MSH A;  1IYV A;  4DGZ A;  5JJL A;  4KK7 A;  4TKO B;  1CZG A;  3HOW G;  2PQE A;  3DMU A;  5C4X B;  5C0X G;  3I4O A;  1H95 A;  5F2D A;  4K2L A;  1N32 L;  4CGY B;  1JCK B;  4EX5 A;  4QF4 A;  5J1Z A;  3IAY A;  4MHE A;  4OEL B;  4KD4 A;  3PSI A;  2JA7 H;  3MXU A;  4A3B H;  2HDL A;  4K0K L;  1JJG A;  3X3M A;  5FO7 B;  2F4V Q;  1KNE A;  2LXK A;  3CW2 C;  1KNA A;  4RKL A;  4HCE A;  2KHI A;  5JPN C;  2JE6 I;  3K59 A;  1HQM C;  2LMC B;  5C4J B;  3I72 A;  2F0W A;  2PPB C;  4JCV E;  2IWH A;  1FJG Q;  2FIN B;  2RHS B;  2L0C A;  1BVS A;  4M1U B;  2F4V L;  4POF A;  5M3F H;  1X55 A;  2NUC A;  1MSG A;  4KJO A;  1I50 B;  2EDG A;  2F0H A;  1O80 A;  2UUA L;  1X3E A;  5AFW A;  2B8G A;  4C1N K;  3LX0 A;  5LMU L;  4ZUI A;  2F3W A;  3J7A 5;  3TBI B;  1PDQ A;  3EA6 A;  1Y1V H;  2QEX A;  3D31 A;  3RZO B;  1YHA A;  2HQL A;  2FFK B;  4LMQ D;  1ILQ A;  3NBH A;  5COY A;  1FL0 A;  5HY6 A;  3NTH A;  5IYC G;  4I7A A;  5EJW A;  3PO2 H;  1J9O A;  1SE4 A;  3M7N A;  1V9P A;  4A3B G;  2PI2 A;  2Z4I A;  1X65 A;  2JQO A;  2EE1 A;  2E5L L;  1SNO A;  1Y8N B;  5COR A;  1PTO D;  3QJY A;  2L12 A;  2N8N A;  4ZK9 B;  3KK7 A;  2QW7 A;  3EQL C;  1PTO B;  1RCV D;  1BOS A;  3NXW A;  4C3I H;  1RF2 D;  2UUC Q;  1CHP D;  1JWU D;  1Q46 A;  4DR5 Q;  4AH6 A;  5IT9 L;  3K5N A;  1KXL A;  5J3B A;  3T53 B;  3FEW X;  4GKJ L;  3A74 A;  2R93 H;  1T5E A;  1B2T A;  1V8Q A;  3KF6 A;  4CJ0 B;  5EGT A;  1M8A A;  2PMZ E;  4DXG A;  1D1I A;  3V96 A;  4ZYS A;  4A93 G;  1WD1 A;  2F03 A;  3S1M H;  3PO2 B;  1HCZ A;  4UY8 C;  4YCU A;  2K28 A;  4O1N A;  1V1P B;  1PH8 A;  5DAU A;  1JT8 A;  1L1O C;  3TSS A;  2IHE A;  1V43 A;  1A6X A;  4S3S A;  1LTG D;  2EY2 A;  1STG A;  3CP0 A;  1EWC A;  4YHH L;  1ZXT A;  2K6A A;  2KEN A;  3NBI A;  4LW1 A;  2RA4 A;  1A0I A;  1ICW A;  4LWC A;  1X3Q A;  1HZ9 A;  5A2Q L;  4DR3 L;  1CHQ D;  2E5L Q;  2WII B;  2J0T D;  2KJX A;  3U9O A;  2MP1 A;  1CA5 A;  3U4V A;  3Q8D A;  3S1Q H;  4A76 A;  1X3G A;  4O2D A;  1K3R A;  1I94 L;  1V1O A;  3ER0 A;  3FDT A;  1XNQ Q;  4JI0 L;  4JI8 Q;  1MBY A;  2XSC A;  5IGB A;  1S5C D;  2EQS A;  3CD6 A;  3EFX D;  2EPB A;  3E9I A;  2R93 G;  1NUC A;  2IY5 B;  3PF5 A;  4L8J A;  3F2B A;  3QIA A;  1KAW A;  1HNW L;  5ELN A;  4DNR B;  3M3Y H;  4DR1 Q;  2B8F A;  3GTP H;  1EYC A;  2MO1 A;  3TME A;  2Q2U A;  4YWK A;  5FLM H;  5ELB A;  3STB C;  2E2H B;  3MHB A;  2DY7 A;  3VR3 A;  4DV3 Q;  2L55 A;  1C8C A;  4OIJ A;  5E4X A;  2EXZ A;  1HZC A;  4QQB X;  4QCL A;  1LTL A;  3SK5 A;  2UXC L;  2TSS A;  1TS3 A;  1EIH A;  4DN4 M;  1BCP D;  4LFC L;  2K50 A;  3HZX A;  1ENA A;  3K81 C;  2BE5 C;  2NB0 A;  3NSW A;  2UXD Q;  1VQJ A;  1PHJ A;  1VQ4 A;  2CHB D;  1AN8 A;  3K6O A;  3HOX B;  2M9V A;  4JV5 Q;  1B7Y B;  2R61 A;  4ULL A;  2Z9H A;  4OO1 H;  4BXX H;  1RTN A;  4X3T A;  4AYB E;  3CQZ H;  1TWC H;  2IX0 A;  2DY8 A;  4ALP A;  5C6A A;  2RQX A;  1A3U A;  3EBE A;  2LKV A;  4B3T Q;  4X66 L;  2AHO B;  4LFB L;  1VQN A;  4YIJ A;  4NXM Q;  3SDZ A;  1A63 A;  2OCE A;  5JVH 3;  1ROD A;  1WTW A;  2NVX H;  1FNW A;  3DM1 A;  4FXK C;  1K73 C;  4X3S A;  4DUY L;  2Q2I A;  4MN3 A;  1XPR A;  4CDE C;  4CDD C;  1I4R A;  1SE2 A;  1EY5 A;  2M2L A;  4DR2 Q;  4QGU A;  4FF1 A;  2NWG A;  5D3D A;  1BNZ A;  1GHK A;  1CA6 A;  1H9S B;  1H9M A;  3HOW B;  1Q86 C;  2K5V A;  2N3S A;  2FHT A;  4HMJ A;  4DV1 Q;  3HG9 A;  1KLG D;  2C9O A;  3CQZ B;  1BXT A;  4Z9C B;  3VR5 A;  4KKT A;  4EVO A;  3TS2 A;  3ULJ A;  4CKC A;  4OGQ C;  5AJ3 L;  4JI2 Q;  2MO0 A;  1U0L A;  3B6Y A;  1T5X D;  5M5X H;  5JOB A;  4H44 C;  4DAY B;  2ICI A;  1EEI D;  1DGS A;  4AYB G;  1XPO A;  3OWE B;  4DNT B;  3HOX H;  2DJF C;  5M3M B;  2RSN A;  2B2U A;  2ICE C;  4RAU C;  1IXR A;  2Z1C A;  1VQB A;  2F0M A;  2K7V A;  5CV6 A;  2UXC Q;  2ATW A;  1YHB A;  3CF5 A;  3QB3 A;  1QVF A;  1N32 Q;  5IWA Q;  3M4Q A;  3W5O A;  2N88 A;  4IPH A;  1PYW D;  4MTN A;  4LF4 L;  4RCO A;  4NB3 A;  4PZ7 A;  4BBR B;  4C3H G;  2XWJ B;  1XMO L;  4J15 A;  2B2V C;  4YWM A;  1L0X B;  2KUM A;  3FVQ A;  4A3E H;  3PO3 H;  3PIO 3;  1XMQ L;  5M5Y B;  2PYK A;  4DAV A;  1OXV A;  1Z6H A;  4BBR H;  2XVS A;  1D7Q A;  1VDZ A;  2YTX A;  4CBV A;  2BDN A;  1DON A;  1GUW A;  5FLM G;  4LK1 C;  2L4N A;  3NP8 A;  4K5W A;  1GUT A;  5KRU A;  5IOC A;  1EFI D;  4H7B A;  4QL5 A;  1RKN A;  4WFN 3;  1PH5 A;  1QNU A;  5BN5 A;  1TY0 A;  3M4O H;  3W3A A;  4DV0 L;  1CKO A;  1N34 Q;  1SDF A;  4GNX B;  4B3M Q;  1M4V A;  4A3E G;  4A3K B;  1JOQ A;  4KY6 A;  2B2T C;  1PRT F;  4LJZ C;  2B63 G;  2LXJ A;  1EY9 A;  2BH8 A;  3UE1 A;  1TQO A;  3IFD A;  2Q2H A;  1CTM A;  3DWP A;  1Z47 A;  3T13 A;  4X65 L;  4BY1 H;  4R4O A;  5FO9 B;  3K57 A;  2R7D A;  1VQ6 A;  2WIN B;  1ZEQ X;  4DR4 L;  4JI7 Q;  1HFN A;  3GTL H;  1RTO A;  3A8K E;  1F9P A;  4IJL A;  1NMF A;  1K0S A;  1L0Y B;  1EYG A;  3PIO A;  1VF5 C;  4PG3 A;  3KOJ A;  3G7L A;  3A5U A;  2MQH A;  1HUM A;  4EGV A;  4OO1 I;  5FLX L;  1CFM A;  4ILW A;  1V1Q A;  2F0P A;  4RGO S;  1RDP D;  1STA A;  5K36 H;  3WDN A;  2F0L A;  1D5X C;  4A3C H;  5JJZ A;  1E1T A;  1VQI A;  5HUR A;  2MNA A;  3BZD B;  2AQ2 B;  1QVG A;  1VMC A;  2X6L A;  4JW0 A;  1KIX A;  3GP7 A;  3CKI B;  2V1C C;  3AFQ A;  3MA2 B;  4XT1 B;  5E3F A;  3RLO A;  2PQA A;  4IUU A;  4JK1 C;  4LFA Q;  4GKK Q;  3S17 H;  3RN5 A;  1ZYR C;  1XJV A;  3KJP A;  2CW0 D;  3SK4 A;  3CME A;  2KA7 A;  2WAQ B;  2Y0S G;  1G91 A;  4K2K A;  1B8A A;  1CSQ A;  3A7L A;  1S40 A;  3ZYY X;  3KLS X;  2ZXR A;  4BBS G;  1VQE A;  5FOB B;  4B3R Q;  3U50 C;  4UHV A;  2EY5 A;  5EKL A;  1TS4 A;  3S16 H;  1JE5 A;  2PI2 E;  4JC0 A;  2RVL A;  1EY4 A;  1EWH A;  4KMU C;  1KRT A;  5I4D A;  5IYC H;  1SFO H;  1WTX A;  4LF8 Q;  2ENB A;  3BYY B;  1HNZ Q;  3J80 i;  3HOY B;  3K0Y A;  3S1Q B;  2K5Q A;  3GQB A;  4RGM A;  4L5R C;  2AMC B;  3VYR A;  3KLS A;  1JC7 A;  5FJ8 G;  2XNA C;  5IYD H;  1PYB A;  2L15 A;  1TWF H;  5L37 A;  1I4G A;  4Q0F A;  1NE3 A;  2CVR A;  4A3M B;  1BR9 A;  3IRB A;  2JYO A;  5C3E B;  2EYL A;  2WP8 J;  5FO8 B;  1PZI D;  5M3F G;  2QDB A;  5LL6 S;  4A3I H;  2DNE A;  4DXF A;  1LYL A;  2XIW A;  1WTV A;  1CI3 M;  3P1H A;  1SE3 A;  1PH6 A;  4IFD J;  3GTK H;  1ZYR D;  1LAC A;  1EZ6 A;  3HEJ A;  1D2B A;  1RL2 A;  3BYT B;  4HSV A;  1YJW A;  3S16 B;  1Q3L A;  1P8L A;  2F0J A;  3N52 A;  1P16 A;  1SN8 A;  1DCZ A;  5KEE A;  2Q8T A;  4YCW A;  1HNX L;  4WJ4 A;  4C3I G;  4FNF A;  1X54 A;  2AWN A;  1TU2 B;  2YTV A;  2LS0 1;  3OHX C;  3Q23 A;  3VDY A;  4O42 A;  4APV A;  4JI8 L;  5JEA G;  1HJP A;  2CH4 W;  1N33 L;  3MXP A;  2F0U A;  4PV1 C;  3KF8 A;  4IFD I;  1KHI A;  2CH4 A;  2EYH A;  4YY3 Q;  1KDB A;  1X3F A;  2CQO A;  1VQA A;  4HMI A;  3BVM A;  1E3P A;  1EL0 A;  3KDF A;  2I5M X;  1SE8 A;  3VYT A;  2AUJ D;  1LTS D;  4ZKC B;  2A6H C;  3JC6 6;  1A2U A;  4B3S L;  1D8L A;  1GHJ A;  3OW2 A;  2KCC A;  1ONL A;  3I4N B;  4A3D B;  1ILP A;  2MHV A;  1MKH A;  2JK8 A;  1S4Z A;  3URY A;  1YVC A;  1Q12 A;  3I8Z A;  1W3S A;  5DM7 3;  3ERS X;  3PUW A;  3IKJ A;  4Q5V A;  2JA6 H;  1O7Z A;  5ELD A;  4K8I A;  4DUZ L;  4KD3 A;  3HOX G;  2R7Z G;  1DJR D;  4UPA A;  4LF5 L;  4QY7 A;  2BA1 A;  1SBB B;  2PNR C;  1Q90 A;  1FD7 D;  3GTP B;  3I90 A;  2IX3 A;  4DUY Q;  4DK0 A;  1M1K C;  1F77 A;  2VB3 X;  2NZH A;  2C5C A;  3CU7 A;  4IUR A;  1TY2 A;  3CCU A;  1K8A C;  1PTO C;  1SFO B;  3SGI A;  4KHV A;  1LTT D;  3C1F A;  4XTC S;  1SJE D;  1SYD A;  2QIL A;  5D14 A;  4DV2 L;  5EBC A;  2E2J H;  4G4K A;  4GLA C;  4JBJ A;  3FKI B;  2L1B A;  2ASB A;  1STB A;  1SNQ A;  3VR6 A;  2F0O A;  4NXN Q;  4RHR A;  3FKI G;  1XNQ L;  3TP5 A;  3P75 A;  1EUJ A;  2VS1 A;  2XTI A;  1EZ8 A;  1Q7Y C;  3T51 B;  1A2T A;  1MI2 A;  1PA6 A;  2WB1 B;  1G6P A;  4WJ3 M;  4LF7 L;  2BDO A;  1VQ5 A;  2JXM B;  4P75 A;  1LT5 D;  2VQF L;  2EXD A;  1D1K A;  3JAM E;  3GTQ B;  3S15 H;  5JAV A;  1XWE A;  1EOV A;  5CV8 A;  3CCR A;  2A19 A;  3UDG A;  4IPG A;  2K04 A;  4A93 B;  5C4J H;  1GD7 A;  4KKS A;  2NN6 I;  3I2Z A;  3DXJ C;  1UE7 A;  2F4I A;  2RCF A;  2KCT A;  1NTG A;  4X62 Q;  1G51 A;  5K5P A;  2OWO A;  4AYB B;  2I0Q A;  4HIK A;  4N8X 1;  4X66 Q;  1WTP A;  4DV7 Q;  3TP6 A;  1ASZ A;  1TWF B;  2NVT B;  3PIP A;  1YNX A;  1EQT A;  4A3L G;  3Q24 A;  2VW9 A;  4IUN A;  3HOV H;  3HOZ H;  2DN8 A;  1TWC B;  3I70 A;  1E24 A;  2Z6K A;  4DAP A;  4BY1 B;  3J81 j;  3BJU A;  2B29 A;  3T1Y L;  1W6K A;  1IBM Q;  1HZB A;  4K6L A;  4ABN A;  4NXN L;  4WRD A;  3K0X A;  1IHZ A;  1NMG A;  3E5S A;  5DEH A;  1U4R A;  2QDL A;  4XQQ A;  2PCF B;  3W1G A;  2K03 A;  1AFP A;  1EQR A;  3F1Z A;  3PIP 3;  1QZH A;  3KFU A;  1YIT A;  2XWB B;  2UUB Q;  5LMN W;  2ES2 A;  1I6H H;  4KN7 C;  2R92 H;  2Z0S A;  4EQ5 A;  2A68 D;  4KN4 C;  1SSO A;  1K8G A;  1NBW A;  4K14 A;  1UE1 A;  1QZG A;  4BY7 B;  3HKS A;  1N8R C;  3KBG A;  4TRD A;  1JR0 D;  3BG3 A;  1HZA A;  1DXM A;  4KY7 A;  5M5Y H;  5C44 H;  5C3E H;  4IQZ A;  3I4M G;  3TDQ A;  4E6I A;  2B63 B;  4WOR A;  4ODG A;  2E74 C;  2ZTC A;  1YJN A;  3A7A B;  1JOO A;  2R7F A;  2BOS A;  4A3D G;  1CT1 D;  1E1O A;  2FJ2 A;  4C3J B;  1PZJ D;  5T1I A;  1A62 A;  1SYG A;  3L9A X;  3HOU G;  4JI3 Q;  4HJ9 A;  3M9B A;  3UDI A;  1FNU A;  1YBY A;  3K5M A;  4ZRZ A;  3NEM A;  2ZTE A;  1STY A;  1E2V A;  2SNM A;  2UXB L;  3GTG B;  2NVY B;  4GKK L;  2EYM A;  3L3O C;  1JOR A;  1NJI C;  4NW2 A;  5M5X B;  3S14 B;  2LFN A;  2H1E A;  3ULL A;  1TWA B;  1Z9F A;  5EBD A;  2JJQ A;  4CDC C;  2F0F A;  3HGB A;  1HNW Q;  2B63 H;  4KHZ A;  4JPB W;  3K8A A;  3CMA A;  2K5D A;  4A3J H;  2MPM A;  1IBL L;  4HAE A;  5J39 A;  1D6E C;  4JBK A;  2NVQ B;  4IUT A;  4IOA A;  2EYP A;  1ESF A;  4OX9 L;  4HED A;  3I4M H;  1B3Q A;  1A3V A;  3PUV A;  1AH9 A;  2D5D A;  1CSP A;  4BY7 H;  5GQO A;  3KF6 B;  1I3Q H;  2ALY B;  4LUZ A;  2PW7 A;  2QA4 A;  5CYU A;  1K8O A;  1Q82 C;  4A3I B;  4BBR G;  2WB1 G;  3DWA A;  3V05 A;  2C35 B;  3BU2 A;  5FLX E;  1LM0 A;  1PRT B;  2EJM A;  5ELF A;  2MJ8 A;  3A55 A;  3GTL B;  2D0O A;  2IJ0 A;  1K0R A;  1OTC A;  3BZC A;  1Q81 C;  1PFM A;  1WCM G;  3NWS A;  2KOL A;  4OO1 G;  4JI5 L;  1DOK A;  3CAM A;  1MJE A;  1B9M A;  4X6A H;  2K5N A;  1G2S A;  5GAH C;  1ENF A;  4LF9 L;  3GDE A;  4HCS A;  2E2D C;  1FGU A;  4OIK A;  2O5J C;  2GVB A;  1VQP A;  2D62 A;  1J8I A;  1AP0 A;  2PNH A;  1KL9 A;  4DR6 Q;  4R4C A;  5C3X A;  3HOU H;  2F52 A;  1SMY D;  3ONA B;  5AJ3 Q;  3S2H H;  2OXP A;  3J80 c;  3FHW A;  1W2B A; 
#chains in the Genus database with same CATH homology
 4IUQ A;  1HPC A;  4BA1 I;  3NTK A;  2VB2 X;  2J4X A;  2Q8R E;  3WOE A;  1AEX A;  3PMF A;  5LHY 1;  4C56 C;  2Z8L A;  1R4Q B;  1BBX C;  5T1G A;  1SND A;  2ID0 A;  3VR4 A;  4B08 A;  1TVX A;  1SMY C;  3J81 L;  5C3W A;  2NTS A;  1RJT A;  5CV4 A;  1O78 A;  3J7A V;  5DNF A;  4NMZ A;  1SNM A;  4G7Z C;  3CRL C;  1JWS D;  1BCP C;  4A3B B;  1O7Y A;  2EOT A;  2KEC A;  3HKZ B;  3I3C A;  3M4Y A;  2KEE A;  1B3A A;  1H9K A;  4IUP A;  1BO0 A;  2O2L D;  3D8G A;  5CBE E;  2BA0 A;  3BVZ A;  1H9S A;  2AQ3 B;  3S17 B;  1JB3 A;  1O7L A;  2F0S A;  1TS5 A;  1AZP A;  1EOT A;  5EPK A;  1UEA B;  1HRJ A;  1TII D;  3D6C A;  1EY8 A;  3S2H B;  3ERO A;  4IUV A;  3MAQ A;  2BCO A;  2RDF A;  1IL8 A;  2B2V A;  2NN6 G;  4K5V A;  4V19 0;  1NAP A;  5C4H A;  4F87 A;  2PW5 A;  3DEO A;  2YU9 B;  2JA7 B;  1BQQ T;  2RBM A;  2SNS A;  2F3V A;  1EY7 A;  5KND A;  1HTP A;  2B2W A;  1CK1 A;  1LT6 D;  3DEP A;  1YNJ C;  3W2D A;  5ISR A;  2F0V A;  5I6Y A;  4CKE A;  1WTR A;  3S1N B;  2H4O A;  4XT3 B;  1CZW A;  1LTR D;  3J80 L;  3GTM B;  3NUC A;  3I4M B;  2XN9 C;  1HQR D;  5KYL A;  4DFA A;  4A3E B;  4J8Q A;  1H9R A;  1DOM A;  4RKB A;  1GUG A;  3FPU B;  5A35 A;  1LAB A;  3NQI A;  2NTT A;  1PRT C;  2PMZ B;  2R3Z A;  2AQ1 B;  3BDO A;  2SDF A;  4N9P A;  2G9D A;  1PLF A;  3BDL A;  2KHS A;  3CHB D;  2E2J B;  1BDO A;  3RLF A;  4DF7 A;  3U9S A;  1JE4 A;  2XRQ D;  3GTJ B;  1SEB D;  2B2Y C;  1EYD A;  1KAB A;  2OF1 A;  4L63 B;  4U68 A;  4C3I B;  5IIF A;  5KIX A;  3MXN A;  4V0B A;  5IGF A;  3QOJ A;  1EQV A;  4RHS A;  5JEA J;  1G8Z D;  2IL8 A;  4ZKB B;  4EQP A;  4J1M A;  4MIU A;  4NDX A;  5K36 G;  1PZK D;  1I4H A;  4B9W A;  2EY1 A;  4R8I A;  3C2P A;  2O4X A;  1F2Z A;  3QG1 A;  3TP8 A;  4FXG C;  1STN A;  3C46 A;  1Y1V B;  2R6G A;  3PV0 A;  3R8B A;  2TMP A;  2K32 A;  1BUV T;  4NP5 A;  3OWF A;  1OXS C;  1F9Q A;  3PUZ A;  3GV6 A;  1QIL A;  3AB9 A;  5I6W A;  2PZU A;  1IYU A;  1II3 A;  4FO2 A;  2VUM B;  3MC0 B;  3D4D A;  4BA2 I;  1IKL A;  4F8M A;  3FMC A;  1FYC A;  1S5E D;  4XQN A;  1LLR D;  1QNK A;  1Q1B A;  4CJ2 C;  1I6V C;  3H91 A;  2K01 A;  4H13 C;  1KTK A;  4BS9 A;  4K8J A;  2KCN A;  4BWG B;  3UI2 A;  1NR4 A;  3J7Y W;  1QCB D;  2L11 A;  4HTH A;  2OEO A;  1GOZ A;  3D4R A;  3J80 E;  1XTC D;  1EEF D;  2X6G A;  1VF7 A;  4RGT A;  3F2U A;  3LWE A;  1HXY D;  1DOL A;  2JP1 A;  3C1E A;  1GUS A;  3J81 E;  2A69 C;  3IFT A;  1HUN A;  3DUZ A;  5IGC A;  3K5L A;  2SEB D;  1C4Q A;  2EJG C;  3R2I A;  5DM6 3;  1U4M A;  3D6W A;  4XXE A;  1HA6 A;  1FR3 A;  5G3L F;  5HGT A;  5EKI A;  5M9O A;  4QB4 A;  1HTL D;  1Q8I A;  3VYS A;  1TT2 A;  2F1M A;  1TKW B;  2EYO A;  3OMG A;  3MZ5 A;  2JEB I;  5I2X A;  3TN2 A;  3PO3 B;  4A3J B;  3NPP A;  2RDH A;  3MWY W;  3DHQ A;  1U4P A;  4DK1 A;  4ME5 A;  2AWO A;  2Y0S B;  5E4W C;  3ITP A;  4DU9 A;  1RHP A;  4HR7 B;  4FXD A;  2EYJ A;  3S1R B;  1Y8O B;  4ZAI A;  1SJH D;  2ZT9 C;  1D5Z C;  4BBS B;  1NSN S;  5TSS A;  1MGS A;  1XX8 A;  2NZ1 D;  5ELE A;  4IZ8 A;  3Q0A A;  1EU4 A;  1S5D D;  4GZY C;  2L5T A;  5IGE A;  3NQT A;  3PUX A;  2WKD A;  4PMB A;  3TP7 A;  2GA4 B;  1DD2 A;  2A73 B;  3G6J B;  3A54 A;  4F88 A;  1ET9 A;  1PTO F;  2IW3 A;  1U4L A;  3OMC A;  3D3R A;  2Q8I B;  1IW7 D;  1PMR A;  5BN3 A;  1GUO A;  3M3Y B;  1EYA A;  2A6H D;  2X69 A;  4DAY A;  2VXW A;  1DYQ A;  1TR5 A;  2F0N A;  3KLR A;  2SOB A;  4DA2 A;  1B4O A;  3E6Z X;  2F0G A;  1AW7 A;  1B1Z A;  5C4Z A;  2NBF A;  4ID6 A;  1WCM B;  1JQY D;  1SYC A;  2O5I C;  3GD7 A;  3SK6 A;  2HUG A;  2WKC A;  2WV6 D;  2KVM A;  1SAP A;  2L9H A;  4TSS A;  3J7A F;  4R8N A;  1E2W A;  2RSO A;  1G2T A;  1WD0 A;  1QOH A;  3SXH A;  1SYF A;  1I3Q B;  5EPL A;  4CKB A;  2WAC A;  1X32 A;  2E76 C;  4ZQ3 A;  1CQV A;  2PZW A;  5G3L D;  4H0L C;  3I91 A;  4HSP A;  3HS0 C;  3WOF A;  5CC4 A;  1SNP A;  4A3F B;  4R9W A;  3MVV A;  3T4A C;  4ZLT F;  2HCI A;  4F7X A;  1G6Z A;  4CJ1 B;  2HCC A;  2AUK A;  1PTO H;  2BE5 D;  2IPK D;  2D9U A;  2B2W C;  5I2Y A;  2JSO A;  1WTQ A;  5IT9 E;  3R3O A;  3R2T A;  2IX1 A;  4QIW B;  2JEA I;  1NCV A;  3AU7 A;  5I9O A;  4PMC A;  1HHV A;  2OT2 A;  4K5X A;  1EY6 A;  2B2T A;  3V2T A;  4C3H B;  4XQJ A;  3GTO B;  1LT4 D;  5A2Q E;  2EJF C;  3I73 A;  1IKM A;  3A8I E;  5BN4 A;  1VCI A;  5C5M A;  1OXU A;  2QEJ C;  3QOL A;  5C5L A;  2F0T A;  3ND8 A;  3E0J A;  2K05 A;  2LY7 A;  1NR2 A;  3H94 A;  1LTA D;  4QUC A;  1ZKO A;  1S5F D;  4C2M B;  1SYE A;  1Z7T A;  1WVL A;  5E1F A;  5JPM C;  4TQU S;  3HP3 A;  2XRS D;  2F0I A;  3S15 B;  1CM9 A;  4XYQ A;  1PRT D;  3Q6S A;  5ELC A;  3L7Z C;  4CHT B;  2KQ3 A;  1S5B D;  1A15 A;  2K5W A;  4K6D A;  3KUP A;  5KGU A;  3I4L A;  1FNV A;  1QWY A;  1STE A;  5LL6 X;  2A5H A;  1QE6 A;  2E2I B;  2FMM A;  3QO2 A;  3MFY A;  1XYI A;  2HQE A;  4Y7N B;  2JA5 B;  2G9H D;  5J22 A;  3Q22 A;  4A3G B;  5CV7 A;  2NVX B;  3SVM A;  2F0E A;  2QCP X;  1OXT A;  5D3I B;  1PXU A;  1KLU D;  3X3N A;  1BF4 A;  4LAA A;  1U9R A;  4UDU C;  4C3J G;  1Y1W B;  4FP5 D;  1F2M A;  3HOU B;  1H9J A;  3IL8 A;  3D4W A;  3P20 A;  3KBX A;  1WTO A;  3S9W A;  2IT1 A;  4P2C B;  2M00 A;  3H6M A;  4J6H A;  2A74 C;  5JEA H;  2NYZ D;  3SE0 A;  1CQF A;  1FGB D;  1SYB A;  2RDG A;  2A6E C;  3M85 A;  2B2Y A;  4I65 A;  3HOZ B;  3HOV B;  3P7J A;  2DNC A;  3RZD B;  2ZXP A;  2JA6 B;  5M3F B;  3NE5 B;  2YYZ A;  1VMP A;  3H0G B;  4XDX A;  4FVM A;  5CGK A;  4KTA A;  5IGD A;  4IAL A;  1I6H B;  1KDC A;  1Y8P B;  3K5O A;  4G7O C;  1BCP F;  3RUZ A;  3OIP A;  4OHJ A;  3LNN A;  1Y69 U;  1D5M C;  3O13 A;  2R93 B;  2EVB A;  3MXG A;  2QF7 A;  4PNY A;  4ZUJ A;  4RA8 A;  4U67 3;  3K7A B;  1ESR A;  2QKI C;  5IGG A;  3MFG A;  3HRZ C;  1B44 D;  2K1B A;  1W6J A;  4KKU A;  5KNB A;  3BDC A;  3MEH A;  3PUY A;  5IOD A;  2D2C C;  5EKK A;  1JIC A;  1ENC A;  3M4O B;  3A8J E;  1TS2 A;  2CW0 C;  3OW7 A;  3T56 B;  2CQA A;  3OSO A;  1TWG B;  5EPJ A;  3NK9 A;  4QMG A;  2NN6 H;  3VA5 A;  4RWS C;  1SNC A;  1RD9 D;  3OIQ A;  1LTI D;  2A68 C;  3S2D B;  1F9R A;  3VR2 A;  4IFD G;  1EU3 A;  2HDM A;  2K33 A;  2JA8 B;  4JBW A;  3VYU A;  1I4Q A;  5C44 B;  3SHL A;  2VNU D;  1JWM D;  3SR1 A;  3N6R A;  4RGN A;  2V4D A;  3BVG A;  2FMC A;  2R92 B;  2B2U C;  3FRP B;  1E0B A;  1B9N A;  4EQO A;  1A3T A;  4UAI A;  4XYO A;  3AMU A;  4HN7 A;  4G57 A;  1Q1E A;  1MD2 D;  3H3V C;  1YNJ D;  1ML0 D;  5M5W B;  4I7Z C;  1F2L A;  2F0K A;  4X3K A;  2A6E D;  1F9S A;  2A69 D;  4EQN A;  4RFB A;  3VA7 A;  1JOK A;  4XIG S;  2F0Q A;  1C48 A;  4KY5 A;  3TZD A;  2I07 B;  3A56 A;  1LT3 D;  1I4P A;  1YNN D;  3ND9 A;  1B50 A;  2KED A;  2EY6 A;  5FK9 C;  3T16 A;  4KV6 A;  1GJX A;  4M8A A;  1STH A;  3QWN A;  2ZXO A;  5NUC A;  1LO5 D;  4L6T B;  1G29 1;  3S1M B;  4NKL A;  5C0X H;  1UUP A;  1AZQ A;  1V1P A;  1HA5 A;  3TZU A;  3RMH A;  1HFG A;  4FF3 A;  5KNC A;  3NWT A;  2B39 A;  3GV3 A;  1R4P B;  5D65 A;  5I9P A;  1QB5 D;  3K58 A;  4N9T A;  2N55 A;  1OXX K;  2EYF A;  5CV9 A;  3SK8 A;  4B9X A;  1TWH B;  3GTK B;  2RKS A;  3OPO A;  1YNN C;  3C3L A;  4WJW A;  2J7Z A;  1UNS A;  3M7G A;  1B53 A;  1XXG A;  4C1N I;  3R93 A;  1R9T B;  1K8M A;  1GXD C;  3BS1 A;  2MUY A;  4FF2 A;  1GUN A;  1DM0 B;  1IW7 C;  1SXT A;  3H09 A;  5C0X I;  2PO4 A;  4IFD H;  2PZT A;  3DWQ A;  2E75 C;  4KI0 A;  1QG7 A;  1EY0 A;  1LTB D;  4FYD A;  3EJI A;  1PFN A;  3NTI A;  5CR3 A;  2I46 A;  4KJN A;  5FKA C;  1DZ1 A;  1X3P A;  1K83 B;  3NHH A;  1OO9 B;  2R7Z B;  3LWU A;  3OOC A;  5C0X J;  4IN3 A;  3CRK C;  4OL7 A;  3ERQ A;  4FF4 A;  3SEB A;  4PQX A;  4G7H C;  4X3U A;  1E2Z A;  1UAP A;  5JVG 3;  3RD4 A;  3EVQ A;  1LV9 A;  5CV5 A;  1PFB A;  5CMD A;  1I4X A;  2MGS A;  5KYI A;  1KDA A;  1BCP B;  4QUF A;  2EZV A;  3GO5 A;  4RH6 A;  3FPP A;  1ET6 A;  2Z4H A;  5EQ0 A;  1KAA A;  3MTS A;  1EIG A;  1QJO A;  4RCN A;  4PMW A;  2F0D A;  5CBA E;  3JAM L;  1F2Y A;  1MSH A;  1IYV A;  4DGZ A;  4KK7 A;  4TKO B;  1CZG A;  2PQE A;  3DMU A;  5C4X B;  5C0X G;  5F2D A;  4K2L A;  4CGY B;  1JCK B;  4QF4 A;  5J1Z A;  3IAY A;  4MHE A;  4KD4 A;  3MXU A;  2HDL A;  3X3M A;  5FO7 B;  1KNE A;  1KNA A;  4RKL A;  4HCE A;  5JPN C;  2JE6 I;  3K59 A;  1HQM C;  2LMC B;  5C4J B;  3I72 A;  2F0W A;  2PPB C;  2IWH A;  2FIN B;  2L0C A;  4M1U B;  2NUC A;  1MSG A;  4KJO A;  1I50 B;  2EDG A;  2F0H A;  1O80 A;  5AFW A;  2B8G A;  4C1N K;  3LX0 A;  4ZUI A;  2F3W A;  3TBI B;  1PDQ A;  3EA6 A;  3D31 A;  3RZO B;  2FFK B;  4LMQ D;  1ILQ A;  3NBH A;  5COY A;  3NTH A;  5EJW A;  1J9O A;  1SE4 A;  3M7N A;  2Z4I A;  2EE1 A;  1SNO A;  1Y8N B;  5COR A;  1PTO D;  3QJY A;  2L12 A;  4ZK9 B;  3KK7 A;  3EQL C;  1PTO B;  1RCV D;  1BOS A;  3NXW A;  1RF2 D;  1CHP D;  1JWU D;  5IT9 L;  3K5N A;  3T53 B;  3FEW X;  1T5E A;  1B2T A;  1V8Q A;  4CJ0 B;  5EGT A;  1M8A A;  4DXG A;  1D1I A;  3V96 A;  4ZYS A;  1WD1 A;  2F03 A;  3PO2 B;  1HCZ A;  2K28 A;  4O1N A;  1V1P B;  5DAU A;  3TSS A;  1V43 A;  1A6X A;  4S3S A;  1LTG D;  2EY2 A;  1STG A;  1EWC A;  1ZXT A;  2K6A A;  3NBI A;  2RA4 A;  1ICW A;  1X3Q A;  5A2Q L;  1CHQ D;  2WII B;  2J0T D;  2KJX A;  3U9O A;  2MP1 A;  1CA5 A;  1V1O A;  3FDT A;  1MBY A;  2XSC A;  5IGB A;  1S5C D;  3EFX D;  2EPB A;  1NUC A;  4L8J A;  3QIA A;  4DNR B;  2B8F A;  1EYC A;  3TME A;  5ELB A;  2E2H B;  3MHB A;  2DY7 A;  3VR3 A;  2L55 A;  1C8C A;  4OIJ A;  5E4X A;  2EXZ A;  4QCL A;  3SK5 A;  2TSS A;  1TS3 A;  1EIH A;  4DN4 M;  1BCP D;  3HZX A;  1ENA A;  2BE5 C;  2NB0 A;  3NSW A;  2CHB D;  1AN8 A;  3K6O A;  3HOX B;  2M9V A;  2R61 A;  4ULL A;  4OO1 H;  1RTN A;  4X3T A;  2IX0 A;  2DY8 A;  5C6A A;  2RQX A;  1A3U A;  2LKV A;  4YIJ A;  3SDZ A;  5JVH 3;  1ROD A;  1WTW A;  1FNW A;  3DM1 A;  4FXK C;  4X3S A;  4MN3 A;  1I4R A;  1SE2 A;  1EY5 A;  2M2L A;  4FF1 A;  2NWG A;  5D3D A;  1BNZ A;  1GHK A;  1CA6 A;  1H9S B;  1H9M A;  3HOW B;  2FHT A;  4HMJ A;  3HG9 A;  1KLG D;  2C9O A;  3CQZ B;  1BXT A;  4Z9C B;  3VR5 A;  4KKT A;  4EVO A;  4CKC A;  4OGQ C;  1T5X D;  5JOB A;  4H44 C;  2ICI A;  1EEI D;  3OWE B;  4DNT B;  5M3M B;  2RSN A;  2B2U A;  2ICE C;  4RAU C;  2Z1C A;  2F0M A;  2K7V A;  5CV6 A;  3QB3 A;  2N88 A;  1PYW D;  4RCO A;  4BBR B;  4C3H G;  2XWJ B;  2B2V C;  1L0X B;  2KUM A;  3FVQ A;  3PIO 3;  5M5Y B;  2PYK A;  4DAV A;  1OXV A;  1Z6H A;  2XVS A;  1VDZ A;  4CBV A;  2BDN A;  1DON A;  1GUW A;  4LK1 C;  2L4N A;  3NP8 A;  4K5W A;  1GUT A;  5KRU A;  5IOC A;  1EFI D;  4H7B A;  1RKN A;  4WFN 3;  1QNU A;  5BN5 A;  1TY0 A;  3W3A A;  1SDF A;  1M4V A;  4A3K B;  1JOQ A;  4KY6 A;  2B2T C;  1PRT F;  4LJZ C;  1EY9 A;  1TQO A;  3IFD A;  1CTM A;  3DWP A;  1Z47 A;  3T13 A;  5FO9 B;  3K57 A;  2WIN B;  1ZEQ X;  1HFN A;  1RTO A;  3A8K E;  1F9P A;  1L0Y B;  1VF5 C;  3G7L A;  1HUM A;  4EGV A;  4OO1 I;  5FLX L;  1CFM A;  4ILW A;  2F0P A;  4RGO S;  1RDP D;  1STA A;  5K36 H;  3WDN A;  2F0L A;  1D5X C;  5JJZ A;  5HUR A;  3BZD B;  2AQ2 B;  1VMC A;  2X6L A;  3GP7 A;  3CKI B;  3MA2 B;  4XT1 B;  5E3F A;  4IUU A;  4JK1 C;  1ZYR C;  2CW0 D;  3SK4 A;  2KA7 A;  2WAQ B;  1G91 A;  4K2K A;  3A7L A;  3ZYY X;  3KLS X;  2ZXR A;  5FOB B;  2EY5 A;  5EKL A;  1TS4 A;  2RVL A;  1EY4 A;  1EWH A;  4KMU C;  5I4D A;  1WTX A;  2ENB A;  3BYY B;  3HOY B;  3K0Y A;  3S1Q B;  2K5Q A;  3GQB A;  4RGM A;  3VYR A;  3KLS A;  1JC7 A;  2XNA C;  1I4G A;  4Q0F A;  2CVR A;  4A3M B;  1BR9 A;  2JYO A;  5C3E B;  2EYL A;  2WP8 J;  5FO8 B;  1PZI D;  2QDB A;  5LL6 S;  2DNE A;  4DXF A;  1WTV A;  2XIW A;  1CI3 M;  3P1H A;  1SE3 A;  4IFD J;  1ZYR D;  1LAC A;  1EZ6 A;  3HEJ A;  1D2B A;  3BYT B;  4HSV A;  3S16 B;  1Q3L A;  3N52 A;  2F0J A;  1DCZ A;  5KEE A;  2Q8T A;  4C3I G;  4FNF A;  2AWN A;  1TU2 B;  2LS0 1;  3OHX C;  3Q23 A;  4O42 A;  5JEA G;  3MXP A;  2F0U A;  4PV1 C;  3KF8 A;  4IFD I;  2EYH A;  1KDB A;  4HMI A;  3BVM A;  1EL0 A;  3VYT A;  2AUJ D;  1LTS D;  4ZKC B;  2A6H C;  1A2U A;  1GHJ A;  2KCC A;  1ONL A;  3I4N B;  4A3D B;  1ILP A;  2MHV A;  1S4Z A;  3URY A;  1Q12 A;  3I8Z A;  5DM7 3;  3PUW A;  3IKJ A;  4Q5V A;  1O7Z A;  5ELD A;  4K8I A;  4KD3 A;  1DJR D;  2BA1 A;  1SBB B;  2PNR C;  1Q90 A;  1FD7 D;  3GTP B;  3I90 A;  2IX3 A;  4DK0 A;  1F77 A;  2VB3 X;  2C5C A;  3CU7 A;  4IUR A;  1TY2 A;  1PTO C;  1SFO B;  4KHV A;  1LTT D;  3C1F A;  4XTC S;  1SJE D;  1SYD A;  2QIL A;  5D14 A;  5EBC A;  4G4K A;  3FKI B;  2L1B A;  1STB A;  1SNQ A;  3VR6 A;  2F0O A;  4RHR A;  3TP5 A;  3P75 A;  1EZ8 A;  3T51 B;  1A2T A;  1MI2 A;  2WB1 B;  2BDO A;  2JXM B;  1LT5 D;  1D1K A;  3JAM E;  3GTQ B;  5JAV A;  1XWE A;  5CV8 A;  2K04 A;  4A93 B;  4KKS A;  2NN6 I;  3DXJ C;  2F4I A;  5K5P A;  4AYB B;  1WTP A;  3TP6 A;  2NVT B;  1TWF B;  1EQT A;  3Q24 A;  4IUN A;  2DN8 A;  1TWC B;  3I70 A;  4DAP A;  4BY1 B;  1W6K A;  4K6L A;  4ABN A;  4WRD A;  1IHZ A;  5DEH A;  3E5S A;  1U4R A;  4XQQ A;  2PCF B;  2K03 A;  1AFP A;  3PIP 3;  2XWB B;  4KN7 C;  2A68 D;  4KN4 C;  1SSO A;  4K14 A;  4BY7 B;  3KBG A;  4TRD A;  1JR0 D;  3BG3 A;  1DXM A;  4KY7 A;  4IQZ A;  3TDQ A;  4E6I A;  2B63 B;  4WOR A;  4ODG A;  2E74 C;  3A7A B;  1JOO A;  2BOS A;  1CT1 D;  2FJ2 A;  4C3J B;  1PZJ D;  5T1I A;  1SYG A;  3L9A X;  1FNU A;  3K5M A;  4ZRZ A;  1STY A;  1E2V A;  2SNM A;  3GTG B;  2NVY B;  1JOR A;  2EYM A;  3L3O C;  4NW2 A;  5M5X B;  3S14 B;  2LFN A;  2H1E A;  1TWA B;  5EBD A;  2F0F A;  3HGB A;  4KHZ A;  2K5D A;  2MPM A;  4HAE A;  5J39 A;  1D6E C;  2NVQ B;  4IUT A;  2EYP A;  1ESF A;  4HED A;  1A3V A;  3PUV A;  2D5D A;  2PW7 A;  1K8O A;  5CYU A;  4A3I B;  3DWA A;  3V05 A;  5FLX E;  1PRT B;  2EJM A;  5ELF A;  2MJ8 A;  3A55 A;  3GTL B;  2IJ0 A;  1PFM A;  3NWS A;  2KOL A;  4OO1 G;  1DOK A;  1B9M A;  1G2S A;  1ENF A;  4HCS A;  2E2D C;  4OIK A;  2O5J C;  2D62 A;  1J8I A;  1AP0 A;  5C3X A;  1SMY D;  3ONA B;  2OXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...