2AUKA

Structure of e. coli rna polymerase beta' g/g' insert
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
189
Chain Sequence
GSHMAAAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase beta' chain
publication title Structure and Function of Lineage-specific Sequence Insertions in the Bacterial RNA Polymerase beta' Subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 40
structure length 189
sequence length 189
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2aukA02
4DNTB 3AB9A 1Z7TA 1LABA 1HQMC 3A7AB 3FMCA 4KKTA 4L8JA 4KMUC 3VR4A 1DXMA 4BA2I 3A7LA 1FYCA 1O78A 1OXUA 2L5TA 4IQZA 2K33A 1PMRA 1H9JA 1GUGA 1TU2B 3CRLC 2EJGC 3HGBA 2IT1A 4KI0A 4XIGS 1T5EA 2JXMB 3GD7A 3VA7A 1FR3A 1VF5C 1DCZA 2BA0A 4DK0A 3L7ZC 1HCZA 2A6EC 1Z6HA 2DNEA 2E74C 2PNRC 3VR6A 1Y8NB 3A8JE 1G291 3T51B 1GHJA 1ZYRC 3PV0A 5C0XG 1GUOA 2BE5D 3T56B 1LACA 3I72A 3U9SA 2NN6H 3SDZA 1H9RA 4OGQC 2BDOA 3N6RA 3GQBA 5KNBA 2EVBA 3I4LA 4BA1I 2NN6I 1E2ZA 3A8KE 2A6ED 3OOCA 1ONLA 3PUYA 3WDNA 1OXSC 2A68C 3PUXA 2JEAI 4IFDG 4IFDH 4HR7B 5K36G 1A6XA 2B8GA 2E76C 3DXJC 1CTMA 3OPOA 1IW7C 1E2WA 1BDOA 3LWUA 2A6HD 3MXUA 1EWHA 4DNRB 1V43A 4LJZC 1CI3M 2K32A 3TZUA 1YNJC 5KNDA 5JEAG 2JEBI 4I7ZC 3SE0A 2AWOA 1H9SB 2PCFB 3P20A 3PUZA 4JBWA 2QF7A 2Q8IB 5C0XH 3D31A 4GZYC 1K8OA 2LMCB 2A69C 5BN5A 4OO1G 4KKSA 1Y8PB 5KNCA 4H0LC 2F1MA 4DK1A 1IW7D 1OXXK 4KN7C 1SMYC 2AUKA 3H94A 1B9NA 2KA7A 2CW0C 1Q1EA 3EQLC 3M85A 4KHZA 2O5IC 2DNCA 4TKOB 3A8IE 2D5DA 1V8QA 5K36H 1O7LA 1IYVA 4RCNA 1Q12A 2A69D 1YNNC 3ND9A 3VR2A 1GHKA 2JE6I 3ND8A 1E2VA 2EJFC 3QIAA 3VR5A 4JK1C 4KKUA 2EJMA 2D2CC 2DN8A 3T53B 4KN4C 1QJOA 1Q90A 5JEAH 1GUTA 3FPPA 1OXVA 1VDZA 1HTPA 3W3AA 3BG3A 4PV1C 1Y69U 4OO1H 2V4DA 2A68D 3QJYA 3I73A 1Q1BA 2AUJD 3PUWA 2BE5C 1B9MA 2B8FA 1GUSA 3QG1A 3D4RA 1VF7A 1Y8OB 2EDGA 3IKJA 3MFYA 4H13C 2O5JC 3M4YA 3IFTA 2K7VA 5BN4A 4LK1C 1K8MA 1TKWB 5A35A 1GJXA 1IYUA 1VCIA 2KCCA 1HPCA 3PUVA 3CRKC 1CFMA 3KLRA 1GUNA 1H9SA 5BN3A 4G7ZC 3M7NA 1OXTA 1I6VC 2R6GA 1H9MA 4G7OC 3RLFA 3OW7A 2BA1A 2E75C 4TQUS 4XTCS 3VR3A 4G7HC 2NN6G 2D62A 2ZT9C 2A6HC 3BDOA 2PPBC 4H44C 2YYZA 3NE5B 1H9KA 3LNNA 1ZKOA 1DD2A
chains in the Genus database with same CATH superfamily
4A3JG 3AEVA 4JBJA 4K0KL 1Q8IA 2WB1B 4CJ0B 2Z0SA 1YNND 2J4XA 4C3IG 4A3CG 2UUCQ 1FR3A 3A55A 1MJCA 2WB1E 3NWSA 1NR4A 3S14B 1PH9A 4CJ2C 3SGIA 3T51B 2ES2A 2KHSA 1R9TH 1D1KA 2UU9L 2B63G 5IYBH 1TWHH 2NVYH 4KHVA 4X66Q 3GDEA 2KCMA 2NZ1D 3E6ZX 2ZJRA 1XMQQ 1SE8A 5IYCG 1QUQB 1M90C 2CWPA 1BF4A 4POFA 4IUUA 1HNWL 1JCKB 3T1HL 4JV5Q 1K83B 1VQOA 4X3TA 3TP8A 1WCMB 1HR0L 5CBAE 5DM73 5FO9B 3H91A 1XPUA 1CI3M 3NP8A 2XRQD 5GADC 3MAQA 2R93B 1J9OA 1H9SB 2Q8IB 5IT9L 2Z6BA 2Z1CA 3K59A 3MTSA 5JPMC 5LMNL 1IBLL 1STYA 3CHBD 1VQBA 3S1MH 5C3EH 2XWBB 5C4HA 1QCBD 1L1OC 4DK1A 5IE8A 1SNQA 3M9BA 4LF6L 1RKNA 1UUPA 4LAAA 1MIUA 2F0SA 4HCEA 2DNCA 1K3RA 4QUFA 3GTOB 1AN8A 2IL8A 4GKJL 4JI8Q 2CFMA 1PRTC 3S15H 2XTIA 2F03A 3K7UC 1X54A 2IPKD 3TP5A 4JI2Q 1V9PA 1L0XB 1EWCA 1PH5A 1I94Q 4JBKA 4JV5L 3OTOQ 2C35B 1KNAA 3C46A 2WAQE 3G6EA 4NXNL 2EDGA 2Z4IA 4U673 5EKKA 3GTPH 2K7VA 5EKLA 1HHVA 2VQEQ 3R2TA 4ME3A 2L15A 3NBHA 2Y0SB 1H9MA 1PH6A 5I6YA 5I4DA 3OW7A 3SK8A 4XTCS 3FVQA 1RDPD 1NCVA 1JICA 1CUKA 2FMMA 4IALA 3BDOA 2Y0SE 1L1OA 4ZKBB 5IGCA 3AB9A 4JI8L 2JA7G 1DXMA 5DNFA 3RD4A 2OTLA 1TQOA 4EQOA 3I91A 2A6EC 3OTOL 1ENFA 2B2UA 2LXKA 3CCQA 3BYYB 5E1FA 4FYDA 3DWQA 5EBDA 5KYIA 4IFDJ 3PIO3 2F4VQ 3OIQA 5C3WA 1QNKA 1BCPC 2JA5B 3H0GH 4DV2L 1UE5A 1H9RA 4IJLA 4KLKA 3N6RA 4C3HG 3JC66 4ZK9B 3DM3A 3M4OB 4BA1I 5C0XJ 3HOXH 2HUGA 3PUYA 2B39A 1I5FA 2K75A 4GN5A 4OX9L 3J7AF 4QIWE 4IFDH 2MJ8A 1VQEA 3OWFA 2B8GA 2MO1A 5HY6A 3R8BA 4NB3A 3O13A 4ME5A 1IZ6A 5CV9A 4IPCA 1RF2D 4JI1Q 1XNQL 2HT1A 2K5HA 3AYHB 4DR6Q 4B9WA 5C0XH 3S2DH 1KDBA 3OW2A 4O42A 3H3VH 4PZ6A 4KV6A 1K8GA 3A54A 4ZRZA 4MNOA 1N32Q 1VMCA 2GA4B 2NB0A 4A93B 4QQBX 3KLSX 3RZDB 2BOSA 1X3GA 4A76A 2SEBD 2F0QA 1I4QA 5FO8B 5IODA 4LF5Q 2EJFC 4DR2L 3VR5A 1PH8A 4PZ7A 1HNXQ 4MTNA 1OXVA 1TWAH 5IWAL 3W3AA 2E2HH 3HOVB 4RKLA 2QDLA 2NVTH 2PQEA 2ZTEA 5FJ8G 2LSSA 4BY1B 3VA5A 1HZBA 3U50C 5FK9C 4JI1L 3RMHA 2J7ZA 4DR7Q 1GJXA 1IYUA 1TVXA 3PUVA 4R4CA 4JI0L 3FEWX 1QWYA 1OXTA 4HSPA 3H15A 5EJWA 2K5DA 3KF8B 3RLFA 1Y1VG 5DEHA 4TQUS 2ZJQA 4JCVE 5C4ZA 3Q24A 5JVG3 3PF5A 2AMCB 5C44G 1KXLA 4DV0Q 5IYDH 2L12A 3SK5A 1FYCA 1J5EL 3BYTB 2L5TA 4HIKA 2EJGC 4KI0A 1KNEA 4JI5Q 3WWVA 2B2YC 1PXUA 4RHRA 3MVVA 4A3EB 2DNEA 4N9TA 2YTVA 1E3PA 3K5NA 2ZXPA 1JJGA 3I4NG 3TZDA 4IURA 1A2TA 4DUYQ 4QCLA 3F1ZA 1VQPA 4OGQC 4BBSG 4X65Q 4KJOA 2K28A 3FPUB 5D3DA 1E2ZA 4QY7A 4F8MA 5D65A 5JJKA 3QWNA 2JEAI 4A3IG 4LF8Q 5KGUA 5M3MG 4DR4L 2E76C 5I6WA 2HDLA 4FXGC 2B2TA 1I4HA 4DV4Q 3HOXB 3U58A 2XVSA 3JAML 1YNJC 5C4XB 1DYQA 5CV5A 3HOWB 4RGOS 3S1RB 4BXXH 2B3GA 3GV6A 2K5VA 1SN8A 1PH3A 1I4XA 1QG7A 1N9WA 1E22A 4X3UA 4CJ1B 2RSNA 1Q46A 3EQLC 3ULLA 4KHZA 5ELOA 1EY0A 2B2YA 4A3DG 3OYYA 3P7JA 5K36H 2F52A 1YEZA 2ALYB 3CP0A 5M5WH 4DV5L 2MHVA 4IFDI 3QIAA 1VQNA 3T53B 4H7BA 1XPOA 3PO3G 1PVOA 1B50A 2UXBL 1XJVA 1AZPA 3HKZG 2J0TD 3M7GA 1SMXA 2BE5C 5C0XI 2VUMG 1FL0A 1LM0A 3K7AH 1VF7A 4WFN3 2O5JC 2VL6A 2CH4A 2N49A 1PZKD 2FHTA 1GUNA 3A5ZB 1KL9A 2QDBA 3RNUA 2RVLA 1STNA 3A74A 1UE7A 1EY8A 1JT8A 1L2FA 1HA5A 1KRTA 1TWFB 2BH2A 1D8LA 2HCCA 4OEMB 3NWTA 2OWOA 1Z7TA 3VR4A 4XYOA 3M3YH 2B63B 3SEBA 2ZM6L 3L0OA 1QE6A 3ER0A 5EBCA 1DCZA 1TY2A 2NTSA 1CHPD 4KD4A 4NXML 2E74C 2N3SA 3PO2B 4OIJA 2UUAQ 1XTDA 3UE1A 1LO5D 3I72A 1C0AA 3KDFA 5IP7H 4QMGA 2PQAA 4GNXC 2NVQH 4UY8C 2WAQG 3A0JA 3CCEA 3L3OC 1PFMA 3NTKA 3K6OA 3PUXA 4GLAC 1VQ9A 1LUZA 3PGZA 3M4QA 4HR7B 1MGSA 1RHPA 1EY7A 4MN3A 3FKIB 2JJQA 2UXDL 4DNRB 3D0FA 3OHXC 4C1NI 1O7IA 2OEOA 1RODA 1K8OA 2M00A 1TXYA 3AU7A 5I9PA 2RKSA 2EOTA 4A3BB 2R7FA 1JWSD 2WIIB 4AQYL 1K3BC 1C9OA 1CKNB 2ATWA 1Y1WG 1VQAA 1EUJA 1XX8A 4C3JB 1IYVA 1B7YB 4L63B 1TWGB 2K52A 3ND9A 4LFBQ 1S5CD 5CV8A 2JA8H 1IBMQ 1HXYD 1R4PB 4ALPA 3QB3A 3SK6A 2QEXA 2YTXA 3CU7A 2ENBA 3I73A 2H5XA 5CBEE 4RGMA 2EE1A 1S3OA 1Y8OB 3ITPA 1O7YA 1CKOA 4DV6Q 2SNSA 1YNJD 5JPNC 2H1EA 3K58A 4ZAIA 3CD6A 3HS0C 2D0PA 5A2QL 1XMOL 3TDQA 5IP9G 2I0QA 2JA6G 1H9KA 4QJFA 5GAGC 4L8JA 4KKTA 5CGKA 1A8VA 3DWAA 3RR5A 4E6IA 3UDGA 4LNQA 2I5MX 2RBMA 3GTLH 1BQQT 2IT1A 1WFQA 3EFXD 1TIID 3K0XA 3HOZG 1KHIA 5FLXE 2F0JA 2RDFA 1B2TA 3L7ZC 3RLOA 4LF4L 4MHEA 1BOSA 3B6YA 4R4QA 1SNPA 1F2LA 2BE5D 2XIWA 2K01A 4EQPA 1F2MA 3CAMA 2E5LL 4DUZQ 5C3EG 2HIXA 4K2KA 4YHHL 1CK1A 2F0IA 3V96A 2JYOA 2NN6I 2OF1A 3WOEA 4CGYB 1X3EA 3S14H 1N33Q 3PF4A 2A68C 1VS0A 2L1BA 1HA6A 1E1OA 5ELEA 4ZLTF 1CTMA 5FLXc 2EYMA 1BBXC 4R4OA 4LJZC 1Q86C 5FO7B 1QUQA 5HURA 2PCFB 3CPWA 1PFBA 4UPAA 4JW0A 4IOCA 3BVZA 1HR0W 1SE3A 1K83H 4O2DA 5J3BA 1WCMH 1WTWA 5JEAJ 4IUNA 4X3KA 4O0AA 3M85A 3F2CA 1VQHA 3Q22A 2R93H 3HEJA 1EOTA 3I4MH 1S5FD 4QGUA 5AJ3Q 1CQVA 1SDFA 1EYAA 2JE6I 2PO4A 4JI4Q 4WRDA 2KQ3A 4DR1L 4WORA 4L6TB 1QJOA 1JJ2A 4YCVA 5JEAH 4KTAA 3A56A 2EZVA 5IGFA 1VDZA 1F9RA 3BVGA 3V05A 1XNRQ 4PV1C 3GTGB 2V4DA 4AYBB 4BS9A 1QVGA 1NR2A 2I07B 2K1BA 1SRUA 1W6KA 2F0NA 4YWMA 1K8MA 1S72A 1TY0A 4AYBE 1EOVA 3CRKC 1CM9A 4HMJA 1RD9D 2RF4A 3ICEA 2JN4A 4A75A 2LFNA 1A0IA 4JYAL 1LTTD 3H0GG 3GTMB 4UP9A 1NAPA 1PTOB 4R8IA 1RIPA 2ZXRA 2ICIA 1ZKOA 2G5DA 2K5WA 3DLLA 3W5OA 1U0LA 1FNWA 1VQIA 1AE2A 3A7LA 3EA6A 1H9JA 4Q0FA 3MWYW 1NSNS 2JXMB 2EYOA 3VA7A 1WTVA 3DEPA 1SNMA 2ZXOA 4J1MA 4KHPL 2JK8A 1G291 2R92B 5C0XG 4A3IB 5M3MB 2L55A 2D9UA 3NXWA 1ESFA 2Q2IA 3C2PA 1I3QB 1A62A 3G48A 3A8KE 2B2VA 4Y7NB 3AFPA 2N8NA 1QB5D 5NUCA 2JA5H 1B3AA 3OPOA 3GTKB 3KF6B 1E2WA 1Q8KA 3M4OH 3TP6A 1AE3A 1D5ZC 2E2IB 3NQTA 2K50A 2AWOA 2M2LA 1HNZQ 1MSGA 1G6ZA 1HRJA 1PFSA 1ET6A 1SBBB 1LT4D 2EY5A 4IPHA 2F1MA 4YWKA 3M4PA 1HZCA 2KEEA 3SK4A 2TSSA 4A3FB 1EQQA 1STAA 2VS1A 4X3SA 4CBVA 2C5CA 3HKZB 1I4RA 1AH9A 2NZOA 2NZHA 1EIFA 4HJ8A 1G2TA 2F0KA 3KFUA 3SVMA 1EZ6A 2MP1A 4KN4C 1AZQA 1F2ZA 2L0CA 2YV5A 5M5XB 4LMQD 4Z9CB 2A68D 3I4MB 4A93H 4GN4B 1B53A 4J15A 5IYDG 3RZDH 2UUCL 4B3MQ 3D4WA 2B8FA 3TQYA 3QG1A 4OXPA 4OO1I 5EQ0A 4NP5A 1BKBA 1R4QB 1VCIA 2F0LA 3ZJYC 3JAMi 1HNZL 4LUVA 3CPFA 2FFKB 4X66L 5C3XA 1ASZA 3HOVH 2QEJC 5L37A 2MFIA 1I6VC 1YNXA 2EY2A 3AFQA 3F2UA 2B2UC 4K6LA 1XMQL 1FGUA 3VR3A 5CV7A 4BY1H 5CV4A 4JPBW 1TR5A 1VQCA 2IX1A 1VMPA 1BO0A 3A7AB 3P75A 3KF8A 4IQZA 4JVZA 1PMRA 3CRLC 5D3IB 1WTPA 2Q2TA 3C3LA 4R9WA 4AH6A 2EYLA 3TMEA 1WTOA 1Y8NB 3OSOA 3ONAB 4RMFA 3MEHA 1GHJA 3PV0A 3T56B 4Y52H 3RZOB 4P74A 1HFGA 5ELDA 3I4LA 4A4IA 3CXCA 1I50B 4A3EH 1SYEA 1B1ZA 3H3VC 4U68A 4DAYB 1GOZA 5K5PA 1ONLA 1KLUD 1LT6D 2OQKA 5LL6S 1W2BA 5K36G 3LX0A 2DJFC 1L0YB 4RGNA 3HG9A 4JI2L 1D5MC 1I94L 1DGSA 4A3GG 5M3FB 1JQYD 3W1BA 2IW3A 3KBGA 2RQXA 3D6WA 3SE0A 2YTYA 4TVAB 2LMCB 1Y8PB 2ZTCA 5KNCA 4H0LC 1BBWA 2VQEL 4HSVA 2MO0A 1PH1A 4IUTA 1WTQA 1Q1EA 1PA6A 3PIPA 2QGQA 5C4XH 5BR8Q 3HOWH 1ZEQX 5IGBA 4DK6C 3S1RH 1N34Q 1PYWD 2VXWA 1A63A 1ET9A 1YVCA 3HOUB 1Q90A 1SE2A 3Q0AA 5FLMH 2CW0D 1HJPA 4BY7G 1EL0A 1O7ZA 4TRDA 2AUJD 2NYZD 3J81L 3NSWA 1E0BA 1YIJA 2VQFQ 4PG3A 3Q6SA 4B3SQ 2F4VL 2JA6B 1D5XC 1G8ZD 3M7NA 1WVLA 2RDHA 1G91A 2PMZB 3I4OA 4K2LA 4FF1A 1K8AC 5KRUA 2E75C 2CH4W 3HOZB 1IL8A 4DAPA 3TP7A 2A6HC 2PMZE 4K5VA 4AIMA 1SROA 5IP7G 3NE5B 3BVMA 3LNNA 3S1NB 1HQMC 4DGZA 4C56C 4L5QA 1CZGA 4CKCA 2TMPA 3MXGA 1TU2B 3CCUA 2OCEA 1D6EC 1T5EA 5TSSA 4DR6L 4A3CH 1TWFH 1Z6HA 5IT9E 3RN5A 4L5SA 2B2TC 2R7ZB 2B63H 3CC2A 1SAPA 1N32L 4GOPC 2SNMA 4M8AA 2KCNA 1MJEA 3HOYG 2L4NA 4LUOA 1EEID 1CT1D 1QVCA 3RUZA 4K5WA 3PO2H 4IPGA 3BZDB 1BUVT 5JOBA 3NQIA 1AP0A 5KIXA 2Q2HA 1OXSC 4LF5L 2I5LX 2R61A 1HNXL 1ILPA 2VW9A 2I46A 4XQQA 3MXUA 4A3KB 1EWHA 3KBXA 5IT9c 2JA8G 4IUVA 2KCTA 2K32A 3TSSA 1LTBD 2JEBI 4X64Q 4GZYC 3D4DA 1MD2D 1PFNA 1ASYA 4DR7L 2F3WA 3FRPB 1IKLA 1HUNA 1B70B 3FKIH 1RTNA 4G4KA 2AUKA 2C9OA 4K6DA 1L1OB 4JG2A 1Q3LA 1K0RA 1KAWA 3K80C 3A8IE 2D5DA 5GAHC 4HIMA 4XXEA 2KVMA 3J7AV 2A69D 1HFNA 3CCRA 4A3BH 4DV0L 1STEA 2DN8A 3LWEA 5DAUA 4GOPA 1CKNA 1N36Q 2AQ3B 1HUMA 1PRTB 1Z9FA 2M9VA 1HTPA 4K5XA 1KIXA 4JI5L 4EVOA 4C3JH 3U9OA 1VQ7A 1TWGH 2ZJPA 5EPKA 5CYUA 4DUYL 1BXTA 4YCWA 4DV1Q 4DXGA 5KYLA 2KBNA 5AFWA 4BBRB 4X65L 1C7YA 4JI6Q 2WB1G 3RLNA 1KRSA 1XPRA 1XXGA 1S5ED 4OWTB 1DD2A 4LF8L 1F9PA 1U4MA 4R8NA 2ID0A 1LABA 4UAIA 4KMUC 1JMCA 4B3TQ 1UAPA 3MEFA 3K57A 1G51A 1SFOB 4DV4L 2Z6KA 4Q5VA 3NK9A 4A3MB 3NBIA 5EKIA 1YJWA 4A3JB 4R4IA 1KTKA 2EXZA 3S16H 4C3IB 2ASBA 4C2MB 2NN6H 4LUZA 1K28A 1HTLD 1WD1A 2KOLA 1BCPB 1V1QA 2DUDA 4IUQA 1RTOA 4FF3A 1E24A 2R93G 1QZGA 4HTHA 4DN4M 4FNFA 3AQQA 2A6HD 5KEEA 4IUPA 4LFCQ 5JEAG 2OTJA 2QF7A 1FVIA 3D31A 3S1QB 3EJIA 2HQLA 4MZ9A 3FHWA 4OL7A 4IOAA 2PNHA 3CCLA 2F0DA 1CQFA 1F77A 1H95A 2HHHQ 5LMUQ 2VY3A 2E2JB 1XWEA 1PZJD 2DY8A 4KKUA 2D2CC 3T1YQ 2RHSB 1WI5A 1CSQA 1I6HB 1U5KA 4RFBA 1RCVD 4FP5D 3ULPA 3NTHA 2RHQB 2Y0SG 1GUSA 5F2DA 3J80L 3PQIA 2UUAL 1WTHA 1U4LA 3VDYA 4JI3Q 1HZAA 3CMEA 4CDFC 3GTGH 2R6GA 4HCSA 4RG1A 2QILA 4DPGA 3G4SA 4RCOA 4DFAA 1X56A 4R1JA 1IKMA 2A73B 4MIUA 4POGA 1GD7A 4OONA 1YHAA 3G7LA 4DNTB 2GN5A 2LKVA 1B3QA 2F4IA 1NBWA 4X62Q 1OXUA 3MXNB 1DOKA 2K33A 5J39A 2JA5G 3GTMH 3JAME 1PTOH 3CW2C 5E4XA 4FDBA 2Z9HA 3VR6A 1GO3E 2XGTA 2JA7B 1M4VA 3DHQA 1AEXA 1PZID 4DU9A 3C1FA 5T1GA 2KENA 5IYBG 5M5YB 4JI3L 3A5UA 4CDEC 1U4PA 5JJLA 1DM0B 4A3GB 3GP7A 4XT3B 3DUZA 3S16B 3E9HA 4LFBL 3WDNA 2R92H 1ZYRD 2DY7A 4A3IH 1IBML 5M3MH 5DM63 4C3HB 4R4TA 3JAMc 2E8GA 2F0OA 1I3QH 3DEOA 5M9OA 4RA8A 4XQNA 4ID6A 3S17B 1YJNA 1N8RC 1Y14B 2OXPA 5BN5A 4A93G 4Y7NH 4DV6L 2X6LA 1UWVA 3GTKH 4RHSA 3KF6A 3H94A 4EGVA 1A2UA 4GLXA 4GKKQ 4BY7B 2Q8TA 2E2IH 3HOVG 4LF9Q 5COYA 3PSIA 2VB3X 2IHEA 3UI2A 3VR2A 3CQZB 2K04A 3ND8A 1T9HA 1EY4A 1X6OA 4EQNA 2K5NA 2K5QA 4A3FH 4NMZA 1YHQA 1SYGA 4K8IA 1NE3A 1V1PB 2R3ZA 3L9AX 4DR3Q 4DF7A 4OO1H 1KAAA 1VQMA 1W6JA 4GN3B 2F0TA 2WINB 1YJ9A 3KDFB 1PH4A 5EPJA 1B44D 2B2WC 3OWEB 1TKWB 4DV3Q 1EFWA 1EIYB 2PQAB 1MSHA 4NDXA 1TS4A 4DKAC 1QNUA 1CHQD 1H9SA 1SYFA 2LY7A 2RCFA 3BZCA 5I2YA 5M5XH 4DUZL 4YWLA 4O1NA 1VQKA 4HAEA 2GVBA 1NMFA 2F0UA 2AHOB 2D62A 1ICFB 2Z8LA 5JAVA 1N33L 4A3EG 2UUBQ 1JR0D 5IIFA 1Y1VB 3T4AC 1PTOD 5IOCA 3P1HA 4JI7Q 5IGGA 4QB4A 2B2VC 3W1GA 5C44B 3QOJA 4ZQ3A 2FXQA 4HJ9A 3HP3A 1MI2A 4L5TA 4UP8A 3Q23A 1F9QA 1GUOA 1J8IA 1KABA 3U9SA 3CMAA 5I9OA 4DV3L 3J81i 5DLQE 4ZCKA 1EQVA 2LS01 2F0EA 3TEHB 4EX5A 3HOXG 3I4NB 2JP1A 1VQFA 3OOCA 1PLFA 5AJ3L 2B2WA 4GNXB 4JI4L 3HOWG 4IFDG 3I70A 3Q8DA 4APVA 3RZOH 4BBSB 2K03A 1BNZA 1XNRL 2PI2E 1G2SA 2JA9A 1JE5A 4L5RC 1I50H 5FLMG 1IHZA 4DAYA 2F3VA 2EYHA 1EQTA 4KY7A 4KKSA 2EYFA 3J80c 1SNCA 1F2YA 3J7YW 1LTAD 1YZ6A 5M3FH 2CW0C 1KDCA 5IGDA 3E0JA 2CQOA 4HMIA 2MUYA 4GS3A 3GO5A 5A2QE 1EY6A 5CC4A 5C4JB 1GHKA 1HNWQ 2BCOA 3OMGA 1WTRA 1PV4A 1STGA 4PMWA 4A3DB 4HN7A 2EY6A 3FPPA 4ULLA 2BH8A 3DM1A 1FNVA 1SR3A 1ICWA 2DJGC 1F9SA 4FF4A 3PUWA 1EIGA 4FXDA 2EIFA 1PTOF 2SDFA 2OT2A 3PO3B 3J81j 3MFYA 5LMNQ 3NENA 1IBLQ 2IX3A 4LK1C 4ILWA 3CF5A 3HOUH 1UNSA 1JORA 1YHBA 4LF6Q 5J1ZA 1K0SA 4RAUC 3T13A 1LTSD 1NMGA 1YI2A 2VUMB 3OMCA 1S5DD 5LL6X 3R3OA 1FNUA 1BR9A 4ZKCB 3HKZE 4G57A 1STBA 4GKJQ 2NVXB 3BZKA 3F8TA 3I8ZA 5EPLA 4H44C 5IP9H 4F87A 2JA6H 2JQOA 5ELNA 3S24A 2RA4A 3PO2G 1VQDA 2AKWB 1PH2A 1TWCB 1O78A 5I2XA 1GUGA 1SJED 1DZ1A 1VQLA 3MFGA 4B3RQ 3GD7A 1C4QA 3HOZH 4PQXA 1T5XD 3I3CA 5D14A 2F0HA 4NXNQ 4QUCA 2RSOA 3STBD 3C1EA 3S1NH 3MHBA 1I4PA 1NJIC 4A3LH 1LACA 2X69A 4MTKA 3TRZA 3SDZA 4ZUIA 2HDMA 4QF4A 3GV3A 2EXDA 4EQ5A 2EVBA 3FKIG 4JBMA 4I7AA 1QILA 1OO9B 1X55A 4WJWA 3CKIB 1CA5A 1KC8C 4PNYA 2R7ZH 2YU9B 1LTID 3EBEA 3E0EA 4A3BG 1K73C 3FP9A 3X3NA 1VQGA 1X3FA 4FVMA 2WAQB 4CKBA 4DXFA 5EAYA 5JJZA 1SNOA 4B3ML 3I7FA 4I7ZC 3J7ZC 1EEFD 2A69C 2KECA 4BXXG 4B3RL 2HD3A 4C3JG 4V190 1EYDA 3S2HB 1SE4A 1IW7D 5ISRA 4DV2Q 1KLGD 2I5HA 4A3KH 1X32A 1ML0D 2F3IA 1V1OA 2OQ0A 4TKOB 3PIOA 1V8QA 2CWAA 4YY3Q 3BS1A 1RJTA 3DWPA 1HQRD 3GTQB 4OX9Q 1Y1WB 3CCSA 4P72A 3MA2B 2X6GA 1EU4A 1Q1BA 1KQSA 3G6JB 1XNQQ 1Q82C 1B9MA 1CSPA 1SYBA 2XWJB 3IKJA 5BN4A 5A35A 3KLRA 5BN3A 4G7ZC 1HH2P 1IBKQ 1WYDA 4F7XA 1D2BA 2CVRA 1JB3A 1CZWA 4IN3A 4G7HC 2O4XA 2NN6G 2D0OA 5GAEC 3J7A5 4QIWB 4DR2Q 4YY3L 3FMCA 4IJHA 1R9TB 3MXPA 4FXKC 1TWHB 2NVYB 4BBRH 5IWAQ 1O80A 3TBIB 1FJGQ 1VF5C 2BA0A 2PW7A 5HGTA 4CKEA 2NWGA 2VNUD 3PIP3 4KY5A 1EZ8A 3PCOB 2XRSD 1X3PA 1Q7YC 5HGQA 4JI0Q 1SFOH 4P2CB 1TS5A 1UE1A 3EVQA 4A3MH 1X65A 3J80i 5BR8L 2K4KA 4A3JH 1IBKL 1N34L 3I56A 2QCPX 3S1MB 4HIOA 4C3IH 1X3QA 5C3EB 3HFZB 3V2TA 4C2MH 1J5EQ 1PYSB 4DR5Q 3R2IA 3UDXA 1ESRA 1PDQA 3TZUA 3KUPA 3MZ5A 4N8X1 2CKZB 3NELA 4YIJA 4B08A 4WJ4A 2VQFL 4TSSA 5FKAC 4BWGB 2PZWA 2CHBD 4CHTB 4B3SL 2K6AA 1FJGL 3S15B 3T16A 1TS3A 4KN7C 1J6QA 5IYCH 1S4ZA 1S5BD 4KK7A 4ABNA 4RKBA 1G6PA 2UXCQ 1P16A 1EWIA 1O7LA 2B29A 2RDGA 3S1QH 4AYBG 1JE4A 3EN2A 2E2DC 3K5LA 3GTPB 1E2VA 3QR8A 4DR4Q 3F2DA 1LT3D 1ENAA 1JWMD 2IWHA 5CR3A 3NBHB 3BG3A 4OIKA 1SSOA 1YITA 3KLSA 1PH7A 1DONA 1UEAB 3CC4A 4DR5L 2V1CC 3D4RA 2E2JH 1PRTD 3AMUA 1NUCA 4C1NK 4K8JA 1M8AA 4P73A 3NEMA 1RL2A 5E3FA 2Z6KC 2KCCA 1MKHA 1CFMA 1I6HH 3WOFA 5ELFA 1SYCA 2A5HA 4P75A 3NTIA 4YCUA 2ZT9C 3F2BA 2QW7A 4UHVA 2UXCL 1EYCA 3W2DA 3G71A 4DV5Q 2O2LD 3VYTA 3K8AA 2QKIC 4KD3A 1JWUD 3NHHA 4BA2I 3H0GB 2UXBQ 2ICEC 2R92G 1MHWC 4DAMA 3HGBA 3NPPA 4JOIC 1HZ9A 3IFDA 2P5ZX 5JVH3 4X64L 4DK0A 2KHJA 1XTCD 3KYHC 1HCZA 1W3SA 3L2PA 3A8JE 1LTGD 1NY4A 1ZYRC 2Z4HA 3MC0B 3HRZC 4GLVB 1QZHA 1GXDC 4LF7Q 3MXNA 4NPSA 5J22A 2BDOA 4IZ8A 4CDCC 4RH6A 5KNBA 1EY9A 1KDAA 1GVPA 2A6ED 2JA7H 3S2DB 1JC7A 2F0WA 1VQ4A 4NKLA 3D8GA 3UDFA 4KJNA 4LWCA 1BCPD 1N36L 1D7QA 5M5YH 4N8FA 3LWUA 1DJRD 5LHY1 2ZM6Q 4A3GH 1GUWA 1CKMA 3EROA 5C5MA 5FLXL 1LV9A 2PYKA 5CMDA 4A3FG 4UDUC 4H02A 4JBWA 3PUZA 2SOBA 2XN9C 1JB7A 4NXMQ 3J81E 4OO1G 1QVFA 2WV6D 3PMFA 2F0PA 3VYSA 3I55A 2CQAA 2AQ1B 4C3HH 1WCMG 3VYRA 4IPDA 1SEBD 1B4OA 4HJAA 4B9XA 1PRTF 4DV1L 1B9NA 3H3VI 1SNDA 2KA7A 3I90A 1TWAB 4JOIA 1NTGA 2E2HB 4JI6L 4LF7L 3S17H 1Q12A 2MQHA 2NVTB 3I4MG 4K14A 1LTRD 2PZTA 2IY5B 4DA2A 4FF2A 1SXTA 2AWNA 4IO9A 4B3TL 1UEBA 3K5OA 1CA6A 4BY7H 3IL8A 1UE6A 3KOJA 2UXDQ 4F88A 3J81c 4ODGA 3ZYYX 2WKCA 5C5LA 4ZUJA 2MGSA 4PZ8A 2WACA 1II3A 4DNIA 1GM5A 3CQZH 2MNAA 3IFTA 2H4OA 3X3MA 1VQ8A 2K05A 5GROA 3U4ZA 1ENCA 3GTJH 2HCIA 4AQYQ 1V1PA 1PTOC 2A1AA 2PZUA 5FOBB 2KHIA 2AQ2B 1JOOA 3HKSA 1DOLA 3IRBA 3KK7A 5CV6A 3BJUA 2L9HA 5FJ8H 1A3TA 4QL5A 1MBYA 2EQSA 2KJXA 4LFCL 2CCZA 1BCPF 2HQEA 3SXHA 3NUCA 4XT1B 4WJ3M 5C6AA 2RCNA 3SHLA 4PMBA 1OTCA 1ZXTA 4V0BA 1BVSA 1Y1VH 4FO2A 2MPMA 3K0YA 3HOYH 1BBUA 2XSCA 5C44H 1E7ZA 1M1KC 2HHHL 3CCVA 1EU3A 3K81C 3VYUA 5LMUL 4GOPB 5M3FG 1XMOQ 1SJHD 3IAYA 1TT2A 1C8CA 1A6XA 3T1YL 2DGYA 2KUMA 3DXJC 1C48A 2XNAC 1BDOA 3TS2A 4XDXA 2QA4A 4HIDA 1V43A 5JJIA 2IHFA 2FJ2A 3QO2A 4UP7A 1VQ6A 3I4NH 4DAVA 3P20A 2PI2A 4OWWB 2FMCA 4GNXA 4KY6A 4LF4Q 4HJ7A 3UDIA 4BBSH 4RWSC 1TS2A 5EGTA 5M5WB 1LT5D 5IY0A 1EIHA 3URYA 2IX0A 1SMYC 3E5SA 4S3SA 2E5LQ 2JSOA 3HOUG 2F0GA 2F0FA 2ZTDA 4YHHQ 2IJ0A 1VQ5A 1PHJA 1YNNC 3K7AB 3KLWA 3FDTA 1DOMA 2EJMA 2LXJA 4I65A 3D6CA 1WTXA 1NNXA 1QOHA 1VQJA 4X62L 3UE0A 4XQJA 3KJPA 2EPBA 3H09A 1Y69U 3QJYA 4OWXB 4HJ5A 1SLJA 1YBYA 1AW7A 4M1UB 1WJJA 5C4JH 1AFPA 2NTTA 3ERSX 3M4YA 1LYLA 4A3DH 4OHJA 3K5MA 3U4VA 1A3VA 4HEDA 5G3LD 3M3YB 2L11A 4G7OC 2A8VA 4A3LG 2BA1A 3PO3H 4BY1G 2WP8J 1X9NA 3TS0A 2PPBC 4P71A 3EIVA 3GTJB 3STBC 3D3RA 4DR1Q 1K9MC 5GQOA 1EY5A 2EY1A 5CORA 3RN2A 2VUMH 3BDCA 4N9PA 1D1IA 2Q8RE 2F0MA 2EYPA 2R7ZG 4XIGS 4NW2A 2N78A 2NVXH 1B8AA 1P8LA 4RGTA 2NVQB 1ILQA 1FD7D 2PNRC 3TREA 2PW5A 1JJCB 1A15A 1TWCH 2N55A 4GKKL 2A74C 3GQBA 2GVAA 1EFID 2NUCA 4JYAQ 3KJOA 4A3KG 4LF9L 1SYDA 1FGBD 5LMNW 1I4GA 3SR1A 3HOYB 3DMUA 4LFAQ 1IW7C 1U9RA 2A19A 4JC0A 4DR3L 1L0WA 4DK3C 3E9IA 2BDNA 3HZXA 1S40A 5KNDA 5T1IA 2KEDA 5H1SE 3CCJA 3OIPA 2NBFA 1EQRA 4KHPQ 3J80E 1Z47A 3H6MA 1PYBA 3CC7A 3GTOH 2YU9H 4DV7Q 1XYIA 2JA8B 1OXXK 5ELCA 2FINB 2VZAA 1IYJB 1JOQA 2O5IC 2R7DA 2G9HD 5C4XG 5E7NA 2Q2UA 3BDLA 1KD1C 4RCNA 2WFWA 3TN2A 4J6HA 5G3LF 4K0KQ 3R93A 2WKDA 4ZYSA 3S2HH 2N88A 1LTLA 1EYGA 4JK1C 2UUBL 1U4RA 3QOLA 4CDDC 1GUTA 1WD0A 4JI7L 3I2ZA 4J8QA 2F0VA 4OELB 4LFAL 3LGJA 1LLRD 4X6AH 3ERQA 4BBRG 2UU9Q 4H13C 3S9WA 3GTQH 1STHA 1GKHA 1Y1WH 4PMCA 3ULJA 1HPCA 1A3UA 1E1TA 2EYJA 3BU2A 3N52A 5E4WC 4XYQA 1IXRA 4LW1A 2G9DA 3CCMA 1Q81C 4DV7L 3E3XA 2K14A 3GTLB 1WOCA 1JOKA 2HIVA 3T1HQ 1SMYD 5ELBA 2VB2X 1IL2A 1HR0Q 2YYZA 4A3MG 5IGEA
chains in the Genus database with same CATH topology
1Q8IA 2WB1B 4CJ0B 1YNND 2J4XA 4C3IG 1FR3A 3A55A 3NWSA 1NR4A 3S14B 4CJ2C 3T51B 2KHSA 1D1KA 4KHVA 2NZ1D 3E6ZX 1BF4A 4IUUA 1JCKB 1K83B 4X3TA 3TP8A 1WCMB 5CBAE 5DM73 5FO9B 3H91A 1CI3M 3NP8A 2XRQD 3MAQA 2R93B 1J9OA 1H9SB 2Q8IB 5IT9L 2Z1CA 3K59A 3MTSA 5JPMC 1STYA 3CHBD 2XWBB 5C4HA 1QCBD 4DK1A 1SNQA 1RKNA 1UUPA 4LAAA 2F0SA 4HCEA 2DNCA 4QUFA 3GTOB 1AN8A 2IL8A 1PRTC 2F03A 2IPKD 3TP5A 1L0XB 1EWCA 1KNAA 3C46A 2EDGA 2Z4IA 4U673 5EKKA 2K7VA 5EKLA 1HHVA 3R2TA 3NBHA 2Y0SB 1H9MA 5I6YA 5I4DA 3OW7A 3SK8A 4XTCS 3FVQA 1RDPD 1NCVA 1JICA 2FMMA 4IALA 3BDOA 4ZKBB 5IGCA 3AB9A 1DXMA 5DNFA 3RD4A 1TQOA 4EQOA 3I91A 2A6EC 1ENFA 2B2UA 3BYYB 5E1FA 4FYDA 3DWQA 5EBDA 5KYIA 4IFDJ 3PIO3 3OIQA 5C3WA 1QNKA 1BCPC 2JA5B 1H9RA 3N6RA 4C3HG 4ZK9B 3M4OB 4BA1I 5C0XJ 2HUGA 3PUYA 2B39A 3J7AF 4IFDH 2MJ8A 3OWFA 2B8GA 3R8BA 3O13A 4ME5A 5CV9A 1RF2D 4B9WA 5C0XH 1KDBA 4O42A 4KV6A 3A54A 4ZRZA 1VMCA 2GA4B 2NB0A 4A93B 3KLSX 3RZDB 2BOSA 2SEBD 2F0QA 1I4QA 5FO8B 5IODA 2EJFC 3VR5A 1OXVA 3W3AA 3HOVB 4RKLA 2PQEA 4BY1B 3VA5A 5FK9C 3RMHA 2J7ZA 1GJXA 1IYUA 1TVXA 3PUVA 3FEWX 1QWYA 1OXTA 4HSPA 5EJWA 2K5DA 3RLFA 5DEHA 4TQUS 5C4ZA 3Q24A 5JVG3 2L12A 3SK5A 1FYCA 3BYTB 2L5TA 2EJGC 4KI0A 1KNEA 2B2YC 1PXUA 4RHRA 3MVVA 4A3EB 2DNEA 4N9TA 3K5NA 2ZXPA 3TZDA 4IURA 1A2TA 4QCLA 4OGQC 4KJOA 2K28A 3FPUB 5D3DA 1E2ZA 4F8MA 5D65A 3QWNA 2JEAI 5KGUA 2E76C 5I6WA 2HDLA 4FXGC 2B2TA 1I4HA 3HOXB 2XVSA 3JAML 1YNJC 5C4XB 1DYQA 5CV5A 3HOWB 4RGOS 3S1RB 3GV6A 1I4XA 1QG7A 4X3UA 4CJ1B 2RSNA 3EQLC 4KHZA 1EY0A 2B2YA 3P7JA 5K36H 2MHVA 4IFDI 3QIAA 3T53B 4H7BA 1B50A 1AZPA 2J0TD 3M7GA 2BE5C 5C0XI 1VF7A 4WFN3 2O5JC 1PZKD 2FHTA 1GUNA 2QDBA 2RVLA 1STNA 1EY8A 1HA5A 1TWFB 2HCCA 3NWTA 1Z7TA 3VR4A 4XYOA 2B63B 3SEBA 1QE6A 5EBCA 1DCZA 1TY2A 2NTSA 1CHPD 4KD4A 2E74C 3PO2B 4OIJA 1LO5D 3I72A 4QMGA 3L3OC 1PFMA 3NTKA 3K6OA 3PUXA 4HR7B 1MGSA 1RHPA 1EY7A 4MN3A 3FKIB 4DNRB 3OHXC 4C1NI 2OEOA 1RODA 1K8OA 2M00A 3AU7A 5I9PA 2RKSA 2EOTA 4A3BB 1JWSD 2WIIB 1XX8A 4C3JB 1IYVA 4L63B 1TWGB 3ND9A 1S5CD 5CV8A 1HXYD 1R4PB 3QB3A 3SK6A 3CU7A 3I73A 2ENBA 5CBEE 4RGMA 2EE1A 1Y8OB 3ITPA 1O7YA 2SNSA 1YNJD 5JPNC 2H1EA 3K58A 4ZAIA 3HS0C 5A2QL 3TDQA 1H9KA 4L8JA 4KKTA 5CGKA 3DWAA 4E6IA 2RBMA 1BQQT 2IT1A 3EFXD 1TIID 5FLXE 2F0JA 2RDFA 1B2TA 3L7ZC 4MHEA 1BOSA 1SNPA 1F2LA 2BE5D 2XIWA 2K01A 4EQPA 1F2MA 4K2KA 1CK1A 2F0IA 3V96A 2JYOA 2NN6I 2OF1A 3WOEA 4CGYB 2A68C 2L1BA 1HA6A 5ELEA 4ZLTF 1CTMA 2EYMA 1BBXC 4LJZC 5FO7B 5HURA 2PCFB 1PFBA 3BVZA 1SE3A 1WTWA 5JEAJ 4IUNA 4X3KA 3M85A 3Q22A 3HEJA 1EOTA 1S5FD 1CQVA 1SDFA 1EYAA 2JE6I 2PO4A 4WRDA 2KQ3A 4WORA 4L6TB 1QJOA 5JEAH 4KTAA 3A56A 2EZVA 5IGFA 1VDZA 1F9RA 3BVGA 3V05A 4PV1C 3GTGB 2V4DA 4AYBB 4BS9A 1NR2A 2I07B 2K1BA 1W6KA 2F0NA 1K8MA 1TY0A 3CRKC 1CM9A 4HMJA 1RD9D 2LFNA 1LTTD 3GTMB 1NAPA 1PTOB 4R8IA 2ZXRA 2ICIA 1ZKOA 2K5WA 1FNWA 3A7LA 3EA6A 1H9JA 4Q0FA 3MWYW 1NSNS 2JXMB 2EYOA 3VA7A 1WTVA 3DEPA 1SNMA 2ZXOA 4J1MA 1G291 2R92B 5C0XG 4A3IB 5M3MB 2L55A 2D9UA 3NXWA 1ESFA 3C2PA 1I3QB 3A8KE 2B2VA 4Y7NB 1QB5D 5NUCA 1B3AA 3OPOA 3GTKB 1E2WA 3TP6A 1D5ZC 2E2IB 3NQTA 2AWOA 2M2LA 1MSGA 1G6ZA 1HRJA 1ET6A 1SBBB 1LT4D 2EY5A 2F1MA 2KEEA 3SK4A 2TSSA 4A3FB 1STAA 4X3SA 4CBVA 2C5CA 3HKZB 1I4RA 1G2TA 2F0KA 3SVMA 1EZ6A 2MP1A 4KN4C 1AZQA 1F2ZA 2L0CA 5M5XB 4LMQD 4Z9CB 2A68D 3I4MB 1B53A 3D4WA 2B8FA 3QG1A 4OO1I 5EQ0A 4NP5A 1R4QB 1VCIA 2F0LA 5C3XA 2FFKB 2QEJC 1I6VC 2EY2A 3F2UA 4K6LA 2B2UC 3VR3A 5CV7A 5CV4A 1TR5A 2IX1A 1VMPA 1BO0A 3A7AB 3P75A 3KF8A 4IQZA 1PMRA 3CRLC 5D3IB 1WTPA 3C3LA 4R9WA 2EYLA 3TMEA 1WTOA 1Y8NB 3OSOA 3ONAB 3MEHA 1GHJA 3PV0A 3T56B 3RZOB 1HFGA 5ELDA 3I4LA 1I50B 1SYEA 1B1ZA 3H3VC 4U68A 1GOZA 5K5PA 1ONLA 1KLUD 1LT6D 5LL6S 5K36G 3LX0A 1L0YB 4RGNA 3HG9A 1D5MC 5M3FB 1JQYD 2IW3A 3KBGA 2RQXA 3D6WA 3SE0A 2LMCB 1Y8PB 5KNCA 4H0LC 4HSVA 4IUTA 1WTQA 1Q1EA 1ZEQX 5IGBA 1PYWD 2VXWA 1ET9A 3HOUB 1Q90A 1SE2A 3Q0AA 2CW0D 1EL0A 1O7ZA 4TRDA 2AUJD 2NYZD 3J81L 3NSWA 1E0BA 3Q6SA 2JA6B 1D5XC 1G8ZD 3M7NA 1WVLA 2RDHA 1G91A 2PMZB 4K2LA 4FF1A 5KRUA 2E75C 3HOZB 1IL8A 4DAPA 3TP7A 2A6HC 4K5VA 3NE5B 3BVMA 3LNNA 3S1NB 1HQMC 4DGZA 4C56C 1CZGA 4CKCA 2TMPA 3MXGA 1TU2B 1D6EC 1T5EA 5TSSA 1Z6HA 5IT9E 2B2TC 2R7ZB 1SAPA 2SNMA 4M8AA 2KCNA 2L4NA 1EEID 1CT1D 3RUZA 4K5WA 3BZDB 1BUVT 5JOBA 3NQIA 1AP0A 5KIXA 1OXSC 2R61A 1ILPA 2I46A 4XQQA 3MXUA 4A3KB 1EWHA 3KBXA 4IUVA 2K32A 3TSSA 1LTBD 2JEBI 4GZYC 3D4DA 1MD2D 1PFNA 2F3WA 3FRPB 1IKLA 1HUNA 1RTNA 4G4KA 2AUKA 2C9OA 4K6DA 1Q3LA 3A8IE 2D5DA 4XXEA 2KVMA 3J7AV 2A69D 1HFNA 1STEA 2DN8A 3LWEA 5DAUA 2AQ3B 1HUMA 1PRTB 2M9VA 1HTPA 4K5XA 4EVOA 3U9OA 5EPKA 5CYUA 1BXTA 4DXGA 5KYLA 5AFWA 4BBRB 1XXGA 1S5ED 1DD2A 1F9PA 1U4MA 4R8NA 2ID0A 1LABA 4UAIA 4KMUC 1UAPA 3K57A 1SFOB 4Q5VA 3NK9A 4A3MB 3NBIA 5EKIA 4A3JB 1KTKA 2EXZA 4C3IB 4C2MB 2NN6H 1HTLD 1WD1A 2KOLA 1BCPB 4IUQA 1RTOA 4FF3A 4HTHA 4DN4M 4FNFA 2A6HD 5KEEA 4IUPA 5JEAG 2QF7A 3D31A 3S1QB 3EJIA 4OL7A 2F0DA 1CQFA 1F77A 2E2JB 1XWEA 1PZJD 2DY8A 4KKUA 2D2CC 1I6HB 4RFBA 1RCVD 4FP5D 3NTHA 1GUSA 5F2DA 3J80L 1U4LA 2R6GA 4HCSA 2QILA 4RCOA 4DFAA 1IKMA 2A73B 4MIUA 3G7LA 4DNTB 2LKVA 2F4IA 1OXUA 1DOKA 2K33A 5J39A 3JAME 1PTOH 5E4XA 3VR6A 2JA7B 1M4VA 3DHQA 1AEXA 1PZID 4DU9A 3C1FA 5T1GA 5M5YB 1U4PA 1DM0B 4A3GB 3GP7A 4XT3B 3DUZA 3S16B 3WDNA 1ZYRD 2DY7A 5DM63 4C3HB 2F0OA 3DEOA 5M9OA 4RA8A 4XQNA 4ID6A 3S17B 2OXPA 5BN5A 2X6LA 4RHSA 3H94A 4EGVA 1A2UA 4BY7B 2Q8TA 5COYA 2VB3X 3UI2A 3VR2A 3CQZB 2K04A 3ND8A 1EY4A 4EQNA 2K5QA 4NMZA 1SYGA 4K8IA 1V1PB 2R3ZA 3L9AX 4DF7A 4OO1H 1KAAA 1W6JA 2F0TA 2WINB 5EPJA 1B44D 2B2WC 3OWEB 1TKWB 1MSHA 4NDXA 1TS4A 1QNUA 5I2YA 1SYFA 1CHQD 1H9SA 2LY7A 4O1NA 4HAEA 2F0UA 2D62A 2Z8LA 5JAVA 1JR0D 5IIFA 1Y1VB 3T4AC 1PTOD 5IOCA 3P1HA 5IGGA 4QB4A 2B2VC 5C44B 3QOJA 4ZQ3A 3HP3A 1MI2A 3Q23A 1F9QA 1GUOA 1J8IA 1KABA 3U9SA 5I9OA 1EQVA 2LS01 2F0EA 3I4NB 2JP1A 3OOCA 1PLFA 2B2WA 4IFDG 3I70A 4BBSB 2K03A 1BNZA 1G2SA 1IHZA 4DAYA 2F3VA 2EYHA 1EQTA 4KY7A 4KKSA 2EYFA 1SNCA 1F2YA 3J7YW 1LTAD 2CW0C 5IGDA 1KDCA 3E0JA 4HMIA 2MUYA 3GO5A 5A2QE 1EY6A 5CC4A 5C4JB 1GHKA 2BCOA 3OMGA 1WTRA 1STGA 4PMWA 4A3DB 4HN7A 2EY6A 3FPPA 4ULLA 3DM1A 1FNVA 1ICWA 1F9SA 4FF4A 3PUWA 1EIGA 4FXDA 1PTOF 2SDFA 2OT2A 3PO3B 3MFYA 2IX3A 4LK1C 4ILWA 1UNSA 1JORA 5J1ZA 4RAUC 3T13A 1LTSD 2VUMB 3OMCA 1S5DD 5LL6X 3R3OA 1FNUA 1BR9A 4ZKCB 4G57A 1STBA 2NVXB 3I8ZA 5EPLA 4H44C 4F87A 2RA4A 1TWCB 1O78A 5I2XA 1GUGA 1SJED 1DZ1A 3MFGA 3GD7A 1C4QA 4PQXA 1T5XD 3I3CA 5D14A 2F0HA 4QUCA 2RSOA 3C1EA 3MHBA 1I4PA 1LACA 2X69A 3SDZA 4ZUIA 2HDMA 4QF4A 3GV3A 2EVBA 1QILA 1OO9B 4WJWA 3CKIB 1CA5A 4PNYA 2YU9B 1LTID 3X3NA 4CKBA 4FVMA 2WAQB 4DXFA 5JJZA 1SNOA 4I7ZC 1EEFD 2A69C 2KECA 4C3JG 4V190 1EYDA 3S2HB 1SE4A 1IW7D 5ISRA 1KLGD 1X32A 1ML0D 1V1OA 4TKOB 1V8QA 3BS1A 1RJTA 3DWPA 1HQRD 3GTQB 1Y1WB 3MA2B 2X6GA 1EU4A 1Q1BA 3G6JB 1B9MA 1SYBA 2XWJB 3IKJA 5BN4A 5A35A 3KLRA 5BN3A 4G7ZC 4F7XA 1D2BA 2CVRA 1JB3A 1CZWA 4IN3A 4G7HC 2O4XA 2NN6G 4QIWB 3FMCA 1R9TB 3MXPA 4FXKC 1TWHB 2NVYB 1O80A 3TBIB 1VF5C 2BA0A 2PW7A 5HGTA 4CKEA 2NWGA 2VNUD 3PIP3 4KY5A 1EZ8A 2XRSD 1X3PA 4P2CB 1TS5A 3EVQA 2QCPX 3S1MB 5C3EB 1X3QA 3V2TA 3R2IA 1ESRA 1PDQA 3TZUA 3KUPA 3MZ5A 4YIJA 4B08A 4TSSA 5FKAC 4BWGB 2PZWA 2CHBD 4CHTB 2K6AA 3S15B 3T16A 1TS3A 4KN7C 1S4ZA 1S5BD 4KK7A 4ABNA 4RKBA 1O7LA 2RDGA 1JE4A 2E2DC 3K5LA 3GTPB 1E2VA 1LT3D 1ENAA 1JWMD 2IWHA 5CR3A 3BG3A 4OIKA 1SSOA 3KLSA 1DONA 1UEAB 3D4RA 1PRTD 3AMUA 1NUCA 4C1NK 4K8JA 1M8AA 5E3FA 2KCCA 1CFMA 3WOFA 5ELFA 1SYCA 2A5HA 3NTIA 2ZT9C 1EYCA 3W2DA 2O2LD 3VYTA 2QKIC 4KD3A 1JWUD 3NHHA 4BA2I 3H0GB 2ICEC 3HGBA 3NPPA 3IFDA 5JVH3 4DK0A 1XTCD 1HCZA 3A8JE 1LTGD 1ZYRC 2Z4HA 3MC0B 3HRZC 1GXDC 3MXNA 5J22A 2BDOA 4IZ8A 4RH6A 5KNBA 1EY9A 1KDAA 2A6ED 3S2DB 1JC7A 2F0WA 4NKLA 3D8GA 4KJNA 1BCPD 3LWUA 1DJRD 5LHY1 1GUWA 3EROA 5C5MA 5FLXL 1LV9A 2PYKA 5CMDA 4UDUC 4JBWA 3PUZA 2SOBA 2XN9C 3J81E 4OO1G 2WV6D 3PMFA 2F0PA 3VYSA 2CQAA 2AQ1B 3VYRA 1SEBD 1B4OA 4B9XA 1PRTF 1B9NA 1SNDA 2KA7A 3I90A 1TWAB 2E2HB 1Q12A 2NVTB 4K14A 1LTRD 2PZTA 4DA2A 4FF2A 1SXTA 2AWNA 3K5OA 1CA6A 3IL8A 4F88A 4ODGA 3ZYYX 2WKCA 5C5LA 4ZUJA 2MGSA 2WACA 1II3A 3IFTA 2H4OA 3X3MA 2K05A 1ENCA 2HCIA 1V1PA 1PTOC 2PZUA 5FOBB 2AQ2B 1JOOA 1DOLA 3KK7A 5CV6A 2L9HA 1A3TA 1MBYA 2KJXA 1BCPF 2HQEA 3SXHA 3NUCA 4XT1B 5C6AA 3SHLA 4PMBA 1ZXTA 4V0BA 4FO2A 2MPMA 3K0YA 2XSCA 1EU3A 3VYUA 1SJHD 3IAYA 1TT2A 1C8CA 1A6XA 2KUMA 3DXJC 1C48A 2XNAC 1BDOA 4XDXA 1V43A 2FJ2A 3QO2A 4DAVA 3P20A 2FMCA 4KY6A 4RWSC 1TS2A 5EGTA 5M5WB 1LT5D 1EIHA 3URYA 2IX0A 1SMYC 3E5SA 4S3SA 2JSOA 2F0GA 2F0FA 2IJ0A 1YNNC 3K7AB 3FDTA 1DOMA 2EJMA 4I65A 3D6CA 1WTXA 1QOHA 4XQJA 2EPBA 3H09A 1Y69U 3QJYA 1AW7A 4M1UB 1AFPA 2NTTA 3M4YA 4OHJA 3K5MA 1A3VA 4HEDA 5G3LD 3M3YB 2L11A 4G7OC 2BA1A 2WP8J 2PPBC 3GTJB 3D3RA 1EY5A 2EY1A 5CORA 3BDCA 4N9PA 1D1IA 2Q8RE 2F0MA 2EYPA 4XIGS 4NW2A 4RGTA 2NVQB 1ILQA 1FD7D 2PNRC 2PW5A 1A15A 2N55A 2A74C 3GQBA 1EFID 2NUCA 1SYDA 1FGBD 1I4GA 3SR1A 3HOYB 3DMUA 1IW7C 1U9RA 2BDNA 3HZXA 5KNDA 5T1IA 2KEDA 3OIPA 2NBFA 3J80E 1Z47A 3H6MA 1XYIA 2JA8B 1OXXK 5ELCA 2FINB 1JOQA 2O5IC 2G9HD 3BDLA 4RCNA 3TN2A 4J6HA 5G3LF 3R93A 2WKDA 4ZYSA 2N88A 4JK1C 1U4RA 3QOLA 1GUTA 1WD0A 4J8QA 2F0VA 1LLRD 3ERQA 4H13C 3S9WA 1STHA 4PMCA 1HPCA 1A3UA 2EYJA 5E4WC 3N52A 4XYQA 2G9DA 3GTLB 1JOKA 1SMYD 5ELBA 2VB2X 2YYZA 5IGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNT B;  3AB9 A;  1Z7T A;  1LAB A;  1HQM C;  3A7A B;  3FMC A;  4KKT A;  4L8J A;  4KMU C;  3VR4 A;  1DXM A;  4BA2 I;  3A7L A;  1FYC A;  1O78 A;  1OXU A;  2L5T A;  4IQZ A;  2K33 A;  1PMR A;  1H9J A;  1GUG A;  1TU2 B;  3CRL C;  2EJG C;  3HGB A;  2IT1 A;  4KI0 A;  4XIG S;  1T5E A;  2JXM B;  3GD7 A;  3VA7 A;  1FR3 A;  1VF5 C;  1DCZ A;  2BA0 A;  4DK0 A;  3L7Z C;  1HCZ A;  2A6E C;  1Z6H A;  2DNE A;  2E74 C;  2PNR C;  3VR6 A;  1Y8N B;  3A8J E;  1G29 1;  3T51 B;  1GHJ A;  1ZYR C;  3PV0 A;  5C0X G;  1GUO A;  2BE5 D;  3T56 B;  1LAC A;  3I72 A;  3U9S A;  2NN6 H;  3SDZ A;  1H9R A;  4OGQ C;  2BDO A;  3N6R A;  3GQB A;  5KNB A;  2EVB A;  3I4L A;  4BA1 I;  2NN6 I;  1E2Z A;  3A8K E;  2A6E D;  3OOC A;  1ONL A;  3PUY A;  3WDN A;  1OXS C;  2A68 C;  3PUX A;  2JEA I;  4IFD G;  4IFD H;  4HR7 B;  5K36 G;  1A6X A;  2B8G A;  2E76 C;  3DXJ C;  1CTM A;  3OPO A;  1IW7 C;  1E2W A;  1BDO A;  3LWU A;  2A6H D;  3MXU A;  1EWH A;  4DNR B;  1V43 A;  4LJZ C;  1CI3 M;  2K32 A;  3TZU A;  1YNJ C;  5KND A;  5JEA G;  2JEB I;  4I7Z C;  3SE0 A;  2AWO A;  1H9S B;  2PCF B;  3P20 A;  3PUZ A;  4JBW A;  2QF7 A;  2Q8I B;  5C0X H;  3D31 A;  4GZY C;  1K8O A;  2LMC B;  2A69 C;  5BN5 A;  4OO1 G;  4KKS A;  1Y8P B;  5KNC A;  4H0L C;  2F1M A;  4DK1 A;  1IW7 D;  1OXX K;  4KN7 C;  1SMY C;  2AUK A;  3H94 A;  1B9N A;  2KA7 A;  2CW0 C;  1Q1E A;  3EQL C;  3M85 A;  4KHZ A;  2O5I C;  2DNC A;  4TKO B;  3A8I E;  2D5D A;  1V8Q A;  5K36 H;  1O7L A;  1IYV A;  4RCN A;  1Q12 A;  2A69 D;  1YNN C;  3ND9 A;  3VR2 A;  1GHK A;  2JE6 I;  3ND8 A;  1E2V A;  2EJF C;  3QIA A;  3VR5 A;  4JK1 C;  4KKU A;  2EJM A;  2D2C C;  2DN8 A;  3T53 B;  4KN4 C;  1QJO A;  1Q90 A;  5JEA H;  1GUT A;  3FPP A;  1OXV A;  1VDZ A;  1HTP A;  3W3A A;  3BG3 A;  4PV1 C;  1Y69 U;  4OO1 H;  2V4D A;  2A68 D;  3QJY A;  3I73 A;  1Q1B A;  2AUJ D;  3PUW A;  2BE5 C;  1B9M A;  2B8F A;  1GUS A;  3QG1 A;  3D4R A;  1VF7 A;  1Y8O B;  2EDG A;  3IKJ A;  3MFY A;  4H13 C;  2O5J C;  3M4Y A;  3IFT A;  2K7V A;  5BN4 A;  4LK1 C;  1K8M A;  1TKW B;  5A35 A;  1GJX A;  1IYU A;  1VCI A;  2KCC A;  1HPC A;  3PUV A;  3CRK C;  1CFM A;  3KLR A;  1GUN A;  1H9S A;  5BN3 A;  4G7Z C;  3M7N A;  1OXT A;  1I6V C;  2R6G A;  1H9M A;  4G7O C;  3RLF A;  3OW7 A;  2BA1 A;  2E75 C;  4TQU S;  4XTC S;  3VR3 A;  4G7H C;  2NN6 G;  2D62 A;  2ZT9 C;  2A6H C;  3BDO A;  2PPB C;  4H44 C;  2YYZ A;  3NE5 B;  1H9K A;  3LNN A;  1ZKO A;  1DD2 A; 
#chains in the Genus database with same CATH topology
 4A3J G;  3AEV A;  4JBJ A;  4K0K L;  1Q8I A;  2WB1 B;  4CJ0 B;  2Z0S A;  1YNN D;  2J4X A;  4C3I G;  4A3C G;  2UUC Q;  1FR3 A;  3A55 A;  1MJC A;  2WB1 E;  3NWS A;  1NR4 A;  3S14 B;  1PH9 A;  4CJ2 C;  3SGI A;  3T51 B;  2ES2 A;  2KHS A;  1R9T H;  1D1K A;  2UU9 L;  2B63 G;  5IYB H;  1TWH H;  2NVY H;  4KHV A;  4X66 Q;  3GDE A;  2KCM A;  2NZ1 D;  3E6Z X;  2ZJR A;  1XMQ Q;  1SE8 A;  5IYC G;  1QUQ B;  1M90 C;  2CWP A;  1BF4 A;  4POF A;  4IUU A;  1HNW L;  1JCK B;  3T1H L;  4JV5 Q;  1K83 B;  1VQO A;  4X3T A;  3TP8 A;  1WCM B;  1HR0 L;  5CBA E;  5DM7 3;  5FO9 B;  3H91 A;  1XPU A;  1CI3 M;  3NP8 A;  2XRQ D;  5GAD C;  3MAQ A;  2R93 B;  1J9O A;  1H9S B;  2Q8I B;  5IT9 L;  2Z6B A;  2Z1C A;  3K59 A;  3MTS A;  5JPM C;  5LMN L;  1IBL L;  1STY A;  3CHB D;  1VQB A;  3S1M H;  5C3E H;  2XWB B;  5C4H A;  1QCB D;  1L1O C;  4DK1 A;  5IE8 A;  1SNQ A;  3M9B A;  4LF6 L;  1RKN A;  1UUP A;  4LAA A;  1MIU A;  2F0S A;  4HCE A;  2DNC A;  1K3R A;  4QUF A;  3GTO B;  1AN8 A;  2IL8 A;  4GKJ L;  4JI8 Q;  2CFM A;  1PRT C;  3S15 H;  2XTI A;  2F03 A;  3K7U C;  1X54 A;  2IPK D;  3TP5 A;  4JI2 Q;  1V9P A;  1L0X B;  1EWC A;  1PH5 A;  1I94 Q;  4JBK A;  4JV5 L;  3OTO Q;  2C35 B;  1KNA A;  3C46 A;  2WAQ E;  3G6E A;  4NXN L;  2EDG A;  2Z4I A;  4U67 3;  5EKK A;  3GTP H;  2K7V A;  5EKL A;  1HHV A;  2VQE Q;  3R2T A;  4ME3 A;  2L15 A;  3NBH A;  2Y0S B;  1H9M A;  1PH6 A;  5I6Y A;  5I4D A;  3OW7 A;  3SK8 A;  4XTC S;  3FVQ A;  1RDP D;  1NCV A;  1JIC A;  1CUK A;  2FMM A;  4IAL A;  3BDO A;  2Y0S E;  1L1O A;  4ZKB B;  5IGC A;  3AB9 A;  4JI8 L;  2JA7 G;  1DXM A;  5DNF A;  3RD4 A;  2OTL A;  1TQO A;  4EQO A;  3I91 A;  2A6E C;  3OTO L;  1ENF A;  2B2U A;  2LXK A;  3CCQ A;  3BYY B;  5E1F A;  4FYD A;  3DWQ A;  5EBD A;  5KYI A;  4IFD J;  3PIO 3;  2F4V Q;  3OIQ A;  5C3W A;  1QNK A;  1BCP C;  2JA5 B;  3H0G H;  4DV2 L;  1UE5 A;  1H9R A;  4IJL A;  4KLK A;  3N6R A;  4C3H G;  3JC6 6;  4ZK9 B;  3DM3 A;  3M4O B;  4BA1 I;  5C0X J;  3HOX H;  2HUG A;  3PUY A;  2B39 A;  1I5F A;  2K75 A;  4GN5 A;  4OX9 L;  3J7A F;  4QIW E;  4IFD H;  2MJ8 A;  1VQE A;  3OWF A;  2B8G A;  2MO1 A;  5HY6 A;  3R8B A;  4NB3 A;  3O13 A;  4ME5 A;  1IZ6 A;  5CV9 A;  4IPC A;  1RF2 D;  4JI1 Q;  1XNQ L;  2HT1 A;  2K5H A;  3AYH B;  4DR6 Q;  4B9W A;  5C0X H;  3S2D H;  1KDB A;  3OW2 A;  4O42 A;  3H3V H;  4PZ6 A;  4KV6 A;  1K8G A;  3A54 A;  4ZRZ A;  4MNO A;  1N32 Q;  1VMC A;  2GA4 B;  2NB0 A;  4A93 B;  4QQB X;  3KLS X;  3RZD B;  2BOS A;  1X3G A;  4A76 A;  2SEB D;  2F0Q A;  1I4Q A;  5FO8 B;  5IOD A;  4LF5 Q;  2EJF C;  4DR2 L;  3VR5 A;  1PH8 A;  4PZ7 A;  1HNX Q;  4MTN A;  1OXV A;  1TWA H;  5IWA L;  3W3A A;  2E2H H;  3HOV B;  4RKL A;  2QDL A;  2NVT H;  2PQE A;  2ZTE A;  5FJ8 G;  2LSS A;  4BY1 B;  3VA5 A;  1HZB A;  3U50 C;  5FK9 C;  4JI1 L;  3RMH A;  2J7Z A;  4DR7 Q;  1GJX A;  1IYU A;  1TVX A;  3PUV A;  4R4C A;  4JI0 L;  3FEW X;  1QWY A;  1OXT A;  4HSP A;  3H15 A;  5EJW A;  2K5D A;  3KF8 B;  3RLF A;  1Y1V G;  5DEH A;  4TQU S;  2ZJQ A;  4JCV E;  5C4Z A;  3Q24 A;  5JVG 3;  3PF5 A;  2AMC B;  5C44 G;  1KXL A;  4DV0 Q;  5IYD H;  2L12 A;  3SK5 A;  1FYC A;  1J5E L;  3BYT B;  2L5T A;  4HIK A;  2EJG C;  4KI0 A;  1KNE A;  4JI5 Q;  3WWV A;  2B2Y C;  1PXU A;  4RHR A;  3MVV A;  4A3E B;  2DNE A;  4N9T A;  2YTV A;  1E3P A;  3K5N A;  2ZXP A;  1JJG A;  3I4N G;  3TZD A;  4IUR A;  1A2T A;  4DUY Q;  4QCL A;  3F1Z A;  1VQP A;  4OGQ C;  4BBS G;  4X65 Q;  4KJO A;  2K28 A;  3FPU B;  5D3D A;  1E2Z A;  4QY7 A;  4F8M A;  5D65 A;  5JJK A;  3QWN A;  2JEA I;  4A3I G;  4LF8 Q;  5KGU A;  5M3M G;  4DR4 L;  2E76 C;  5I6W A;  2HDL A;  4FXG C;  2B2T A;  1I4H A;  4DV4 Q;  3HOX B;  3U58 A;  2XVS A;  3JAM L;  1YNJ C;  5C4X B;  1DYQ A;  5CV5 A;  3HOW B;  4RGO S;  3S1R B;  4BXX H;  2B3G A;  3GV6 A;  2K5V A;  1SN8 A;  1PH3 A;  1I4X A;  1QG7 A;  1N9W A;  1E22 A;  4X3U A;  4CJ1 B;  2RSN A;  1Q46 A;  3EQL C;  3ULL A;  4KHZ A;  5ELO A;  1EY0 A;  2B2Y A;  4A3D G;  3OYY A;  3P7J A;  5K36 H;  2F52 A;  1YEZ A;  2ALY B;  3CP0 A;  5M5W H;  4DV5 L;  2MHV A;  4IFD I;  3QIA A;  1VQN A;  3T53 B;  4H7B A;  1XPO A;  3PO3 G;  1PVO A;  1B50 A;  2UXB L;  1XJV A;  1AZP A;  3HKZ G;  2J0T D;  3M7G A;  1SMX A;  2BE5 C;  5C0X I;  2VUM G;  1FL0 A;  1LM0 A;  3K7A H;  1VF7 A;  4WFN 3;  2O5J C;  2VL6 A;  2CH4 A;  2N49 A;  1PZK D;  2FHT A;  1GUN A;  3A5Z B;  1KL9 A;  2QDB A;  3RNU A;  2RVL A;  1STN A;  3A74 A;  1UE7 A;  1EY8 A;  1JT8 A;  1L2F A;  1HA5 A;  1KRT A;  1TWF B;  2BH2 A;  1D8L A;  2HCC A;  4OEM B;  3NWT A;  2OWO A;  1Z7T A;  3VR4 A;  4XYO A;  3M3Y H;  2B63 B;  3SEB A;  2ZM6 L;  3L0O A;  1QE6 A;  3ER0 A;  5EBC A;  1DCZ A;  1TY2 A;  2NTS A;  1CHP D;  4KD4 A;  4NXM L;  2E74 C;  2N3S A;  3PO2 B;  4OIJ A;  2UUA Q;  1XTD A;  3UE1 A;  1LO5 D;  3I72 A;  1C0A A;  3KDF A;  5IP7 H;  4QMG A;  2PQA A;  4GNX C;  2NVQ H;  4UY8 C;  2WAQ G;  3A0J A;  3CCE A;  3L3O C;  1PFM A;  3NTK A;  3K6O A;  3PUX A;  4GLA C;  1VQ9 A;  1LUZ A;  3PGZ A;  3M4Q A;  4HR7 B;  1MGS A;  1RHP A;  1EY7 A;  4MN3 A;  3FKI B;  2JJQ A;  2UXD L;  4DNR B;  3D0F A;  3OHX C;  4C1N I;  1O7I A;  2OEO A;  1ROD A;  1K8O A;  2M00 A;  1TXY A;  3AU7 A;  5I9P A;  2RKS A;  2EOT A;  4A3B B;  2R7F A;  1JWS D;  2WII B;  4AQY L;  1K3B C;  1C9O A;  1CKN B;  2ATW A;  1Y1W G;  1VQA A;  1EUJ A;  1XX8 A;  4C3J B;  1IYV A;  1B7Y B;  4L63 B;  1TWG B;  2K52 A;  3ND9 A;  4LFB Q;  1S5C D;  5CV8 A;  2JA8 H;  1IBM Q;  1HXY D;  1R4P B;  4ALP A;  3QB3 A;  3SK6 A;  2QEX A;  2YTX A;  3CU7 A;  2ENB A;  3I73 A;  2H5X A;  5CBE E;  4RGM A;  2EE1 A;  1S3O A;  1Y8O B;  3ITP A;  1O7Y A;  1CKO A;  4DV6 Q;  2SNS A;  1YNJ D;  5JPN C;  2H1E A;  3K58 A;  4ZAI A;  3CD6 A;  3HS0 C;  2D0P A;  5A2Q L;  1XMO L;  3TDQ A;  5IP9 G;  2I0Q A;  2JA6 G;  1H9K A;  4QJF A;  5GAG C;  4L8J A;  4KKT A;  5CGK A;  1A8V A;  3DWA A;  3RR5 A;  4E6I A;  3UDG A;  4LNQ A;  2I5M X;  2RBM A;  3GTL H;  1BQQ T;  2IT1 A;  1WFQ A;  3EFX D;  1TII D;  3K0X A;  3HOZ G;  1KHI A;  5FLX E;  2F0J A;  2RDF A;  1B2T A;  3L7Z C;  3RLO A;  4LF4 L;  4MHE A;  1BOS A;  3B6Y A;  4R4Q A;  1SNP A;  1F2L A;  2BE5 D;  2XIW A;  2K01 A;  4EQP A;  1F2M A;  3CAM A;  2E5L L;  4DUZ Q;  5C3E G;  2HIX A;  4K2K A;  4YHH L;  1CK1 A;  2F0I A;  3V96 A;  2JYO A;  2NN6 I;  2OF1 A;  3WOE A;  4CGY B;  1X3E A;  3S14 H;  1N33 Q;  3PF4 A;  2A68 C;  1VS0 A;  2L1B A;  1HA6 A;  1E1O A;  5ELE A;  4ZLT F;  1CTM A;  5FLX c;  2EYM A;  1BBX C;  4R4O A;  4LJZ C;  1Q86 C;  5FO7 B;  1QUQ A;  5HUR A;  2PCF B;  3CPW A;  1PFB A;  4UPA A;  4JW0 A;  4IOC A;  3BVZ A;  1HR0 W;  1SE3 A;  1K83 H;  4O2D A;  5J3B A;  1WCM H;  1WTW A;  5JEA J;  4IUN A;  4X3K A;  4O0A A;  3M85 A;  3F2C A;  1VQH A;  3Q22 A;  2R93 H;  3HEJ A;  1EOT A;  3I4M H;  1S5F D;  4QGU A;  5AJ3 Q;  1CQV A;  1SDF A;  1EYA A;  2JE6 I;  2PO4 A;  4JI4 Q;  4WRD A;  2KQ3 A;  4DR1 L;  4WOR A;  4L6T B;  1QJO A;  1JJ2 A;  4YCV A;  5JEA H;  4KTA A;  3A56 A;  2EZV A;  5IGF A;  1VDZ A;  1F9R A;  3BVG A;  3V05 A;  1XNR Q;  4PV1 C;  3GTG B;  2V4D A;  4AYB B;  4BS9 A;  1QVG A;  1NR2 A;  2I07 B;  2K1B A;  1SRU A;  1W6K A;  2F0N A;  4YWM A;  1K8M A;  1S72 A;  1TY0 A;  4AYB E;  1EOV A;  3CRK C;  1CM9 A;  4HMJ A;  1RD9 D;  2RF4 A;  3ICE A;  2JN4 A;  4A75 A;  2LFN A;  1A0I A;  4JYA L;  1LTT D;  3H0G G;  3GTM B;  4UP9 A;  1NAP A;  1PTO B;  4R8I A;  1RIP A;  2ZXR A;  2ICI A;  1ZKO A;  2G5D A;  2K5W A;  3DLL A;  3W5O A;  1U0L A;  1FNW A;  1VQI A;  1AE2 A;  3A7L A;  3EA6 A;  1H9J A;  4Q0F A;  3MWY W;  1NSN S;  2JXM B;  2EYO A;  3VA7 A;  1WTV A;  3DEP A;  1SNM A;  2ZXO A;  4J1M A;  4KHP L;  2JK8 A;  1G29 1;  2R92 B;  5C0X G;  4A3I B;  5M3M B;  2L55 A;  2D9U A;  3NXW A;  1ESF A;  2Q2I A;  3C2P A;  1I3Q B;  1A62 A;  3G48 A;  3A8K E;  2B2V A;  4Y7N B;  3AFP A;  2N8N A;  1QB5 D;  5NUC A;  2JA5 H;  1B3A A;  3OPO A;  3GTK B;  3KF6 B;  1E2W A;  1Q8K A;  3M4O H;  3TP6 A;  1AE3 A;  1D5Z C;  2E2I B;  3NQT A;  2K50 A;  2AWO A;  2M2L A;  1HNZ Q;  1MSG A;  1G6Z A;  1HRJ A;  1PFS A;  1ET6 A;  1SBB B;  1LT4 D;  2EY5 A;  4IPH A;  2F1M A;  4YWK A;  3M4P A;  1HZC A;  2KEE A;  3SK4 A;  2TSS A;  4A3F B;  1EQQ A;  1STA A;  2VS1 A;  4X3S A;  4CBV A;  2C5C A;  3HKZ B;  1I4R A;  1AH9 A;  2NZO A;  2NZH A;  1EIF A;  4HJ8 A;  1G2T A;  2F0K A;  3KFU A;  3SVM A;  1EZ6 A;  2MP1 A;  4KN4 C;  1AZQ A;  1F2Z A;  2L0C A;  2YV5 A;  5M5X B;  4LMQ D;  4Z9C B;  2A68 D;  3I4M B;  4A93 H;  4GN4 B;  1B53 A;  4J15 A;  5IYD G;  3RZD H;  2UUC L;  4B3M Q;  3D4W A;  2B8F A;  3TQY A;  3QG1 A;  4OXP A;  4OO1 I;  5EQ0 A;  4NP5 A;  1BKB A;  1R4Q B;  1VCI A;  2F0L A;  3ZJY C;  3JAM i;  1HNZ L;  4LUV A;  3CPF A;  2FFK B;  4X66 L;  5C3X A;  1ASZ A;  3HOV H;  2QEJ C;  5L37 A;  2MFI A;  1I6V C;  1YNX A;  2EY2 A;  3AFQ A;  3F2U A;  2B2U C;  4K6L A;  1XMQ L;  1FGU A;  3VR3 A;  5CV7 A;  4BY1 H;  5CV4 A;  4JPB W;  1TR5 A;  1VQC A;  2IX1 A;  1VMP A;  1BO0 A;  3A7A B;  3P75 A;  3KF8 A;  4IQZ A;  4JVZ A;  1PMR A;  3CRL C;  5D3I B;  1WTP A;  2Q2T A;  3C3L A;  4R9W A;  4AH6 A;  2EYL A;  3TME A;  1WTO A;  1Y8N B;  3OSO A;  3ONA B;  4RMF A;  3MEH A;  1GHJ A;  3PV0 A;  3T56 B;  4Y52 H;  3RZO B;  4P74 A;  1HFG A;  5ELD A;  3I4L A;  4A4I A;  3CXC A;  1I50 B;  4A3E H;  1SYE A;  1B1Z A;  3H3V C;  4U68 A;  4DAY B;  1GOZ A;  5K5P A;  1ONL A;  1KLU D;  1LT6 D;  2OQK A;  5LL6 S;  1W2B A;  5K36 G;  3LX0 A;  2DJF C;  1L0Y B;  4RGN A;  3HG9 A;  4JI2 L;  1D5M C;  1I94 L;  1DGS A;  4A3G G;  5M3F B;  1JQY D;  3W1B A;  2IW3 A;  3KBG A;  2RQX A;  3D6W A;  3SE0 A;  2YTY A;  4TVA B;  2LMC B;  1Y8P B;  2ZTC A;  5KNC A;  4H0L C;  1BBW A;  2VQE L;  4HSV A;  2MO0 A;  1PH1 A;  4IUT A;  1WTQ A;  1Q1E A;  1PA6 A;  3PIP A;  2QGQ A;  5C4X H;  5BR8 Q;  3HOW H;  1ZEQ X;  5IGB A;  4DK6 C;  3S1R H;  1N34 Q;  1PYW D;  2VXW A;  1A63 A;  1ET9 A;  1YVC A;  3HOU B;  1Q90 A;  1SE2 A;  3Q0A A;  5FLM H;  2CW0 D;  1HJP A;  4BY7 G;  1EL0 A;  1O7Z A;  4TRD A;  2AUJ D;  2NYZ D;  3J81 L;  3NSW A;  1E0B A;  1YIJ A;  2VQF Q;  4PG3 A;  3Q6S A;  4B3S Q;  2F4V L;  2JA6 B;  1D5X C;  1G8Z D;  3M7N A;  1WVL A;  2RDH A;  1G91 A;  2PMZ B;  3I4O A;  4K2L A;  4FF1 A;  1K8A C;  5KRU A;  2E75 C;  2CH4 W;  3HOZ B;  1IL8 A;  4DAP A;  3TP7 A;  2A6H C;  2PMZ E;  4K5V A;  4AIM A;  1SRO A;  5IP7 G;  3NE5 B;  3BVM A;  3LNN A;  3S1N B;  1HQM C;  4DGZ A;  4C56 C;  4L5Q A;  1CZG A;  4CKC A;  2TMP A;  3MXG A;  1TU2 B;  3CCU A;  2OCE A;  1D6E C;  1T5E A;  5TSS A;  4DR6 L;  4A3C H;  1TWF H;  1Z6H A;  5IT9 E;  3RN5 A;  4L5S A;  2B2T C;  2R7Z B;  2B63 H;  3CC2 A;  1SAP A;  1N32 L;  4GOP C;  2SNM A;  4M8A A;  2KCN A;  1MJE A;  3HOY G;  2L4N A;  4LUO A;  1EEI D;  1CT1 D;  1QVC A;  3RUZ A;  4K5W A;  3PO2 H;  4IPG A;  3BZD B;  1BUV T;  5JOB A;  3NQI A;  1AP0 A;  5KIX A;  2Q2H A;  1OXS C;  4LF5 L;  2I5L X;  2R61 A;  1HNX L;  1ILP A;  2VW9 A;  2I46 A;  4XQQ A;  3MXU A;  4A3K B;  1EWH A;  3KBX A;  5IT9 c;  2JA8 G;  4IUV A;  2KCT A;  2K32 A;  3TSS A;  1LTB D;  2JEB I;  4X64 Q;  4GZY C;  3D4D A;  1MD2 D;  1PFN A;  1ASY A;  4DR7 L;  2F3W A;  3FRP B;  1IKL A;  1HUN A;  1B70 B;  3FKI H;  1RTN A;  4G4K A;  2AUK A;  2C9O A;  4K6D A;  1L1O B;  4JG2 A;  1Q3L A;  1K0R A;  1KAW A;  3K80 C;  3A8I E;  2D5D A;  5GAH C;  4HIM A;  4XXE A;  2KVM A;  3J7A V;  2A69 D;  1HFN A;  3CCR A;  4A3B H;  4DV0 L;  1STE A;  2DN8 A;  3LWE A;  5DAU A;  4GOP A;  1CKN A;  1N36 Q;  2AQ3 B;  1HUM A;  1PRT B;  1Z9F A;  2M9V A;  1HTP A;  4K5X A;  1KIX A;  4JI5 L;  4EVO A;  4C3J H;  3U9O A;  1VQ7 A;  1TWG H;  2ZJP A;  5EPK A;  5CYU A;  4DUY L;  1BXT A;  4YCW A;  4DV1 Q;  4DXG A;  5KYL A;  2KBN A;  5AFW A;  4BBR B;  4X65 L;  1C7Y A;  4JI6 Q;  2WB1 G;  3RLN A;  1KRS A;  1XPR A;  1XXG A;  1S5E D;  4OWT B;  1DD2 A;  4LF8 L;  1F9P A;  1U4M A;  4R8N A;  2ID0 A;  1LAB A;  4UAI A;  4KMU C;  1JMC A;  4B3T Q;  1UAP A;  3MEF A;  3K57 A;  1G51 A;  1SFO B;  4DV4 L;  2Z6K A;  4Q5V A;  3NK9 A;  4A3M B;  3NBI A;  5EKI A;  1YJW A;  4A3J B;  4R4I A;  1KTK A;  2EXZ A;  3S16 H;  4C3I B;  2ASB A;  4C2M B;  2NN6 H;  4LUZ A;  1K28 A;  1HTL D;  1WD1 A;  2KOL A;  1BCP B;  1V1Q A;  2DUD A;  4IUQ A;  1RTO A;  4FF3 A;  1E24 A;  2R93 G;  1QZG A;  4HTH A;  4DN4 M;  4FNF A;  3AQQ A;  2A6H D;  5KEE A;  4IUP A;  4LFC Q;  5JEA G;  2OTJ A;  2QF7 A;  1FVI A;  3D31 A;  3S1Q B;  3EJI A;  2HQL A;  4MZ9 A;  3FHW A;  4OL7 A;  4IOA A;  2PNH A;  3CCL A;  2F0D A;  1CQF A;  1F77 A;  1H95 A;  2HHH Q;  5LMU Q;  2VY3 A;  2E2J B;  1XWE A;  1PZJ D;  2DY8 A;  4KKU A;  2D2C C;  3T1Y Q;  2RHS B;  1WI5 A;  1CSQ A;  1I6H B;  1U5K A;  4RFB A;  1RCV D;  4FP5 D;  3ULP A;  3NTH A;  2RHQ B;  2Y0S G;  1GUS A;  5F2D A;  3J80 L;  3PQI A;  2UUA L;  1WTH A;  1U4L A;  3VDY A;  4JI3 Q;  1HZA A;  3CME A;  4CDF C;  3GTG H;  2R6G A;  4HCS A;  4RG1 A;  2QIL A;  4DPG A;  3G4S A;  4RCO A;  4DFA A;  1X56 A;  4R1J A;  1IKM A;  2A73 B;  4MIU A;  4POG A;  1GD7 A;  4OON A;  1YHA A;  3G7L A;  4DNT B;  2GN5 A;  2LKV A;  1B3Q A;  2F4I A;  1NBW A;  4X62 Q;  1OXU A;  3MXN B;  1DOK A;  2K33 A;  5J39 A;  2JA5 G;  3GTM H;  3JAM E;  1PTO H;  3CW2 C;  5E4X A;  4FDB A;  2Z9H A;  3VR6 A;  1GO3 E;  2XGT A;  2JA7 B;  1M4V A;  3DHQ A;  1AEX A;  1PZI D;  4DU9 A;  3C1F A;  5T1G A;  2KEN A;  5IYB G;  5M5Y B;  4JI3 L;  3A5U A;  4CDE C;  1U4P A;  5JJL A;  1DM0 B;  4A3G B;  3GP7 A;  4XT3 B;  3DUZ A;  3S16 B;  3E9H A;  4LFB L;  3WDN A;  2R92 H;  1ZYR D;  2DY7 A;  4A3I H;  1IBM L;  5M3M H;  5DM6 3;  4C3H B;  4R4T A;  3JAM c;  2E8G A;  2F0O A;  1I3Q H;  3DEO A;  5M9O A;  4RA8 A;  4XQN A;  4ID6 A;  3S17 B;  1YJN A;  1N8R C;  1Y14 B;  2OXP A;  5BN5 A;  4A93 G;  4Y7N H;  4DV6 L;  2X6L A;  1UWV A;  3GTK H;  4RHS A;  3KF6 A;  3H94 A;  4EGV A;  1A2U A;  4GLX A;  4GKK Q;  4BY7 B;  2Q8T A;  2E2I H;  3HOV G;  4LF9 Q;  5COY A;  3PSI A;  2VB3 X;  2IHE A;  3UI2 A;  3VR2 A;  3CQZ B;  2K04 A;  3ND8 A;  1T9H A;  1EY4 A;  1X6O A;  4EQN A;  2K5N A;  2K5Q A;  4A3F H;  4NMZ A;  1YHQ A;  1SYG A;  4K8I A;  1NE3 A;  1V1P B;  2R3Z A;  3L9A X;  4DR3 Q;  4DF7 A;  4OO1 H;  1KAA A;  1VQM A;  1W6J A;  4GN3 B;  2F0T A;  2WIN B;  1YJ9 A;  3KDF B;  1PH4 A;  5EPJ A;  1B44 D;  2B2W C;  3OWE B;  1TKW B;  4DV3 Q;  1EFW A;  1EIY B;  2PQA B;  1MSH A;  4NDX A;  1TS4 A;  4DKA C;  1QNU A;  1CHQ D;  1H9S A;  1SYF A;  2LY7 A;  2RCF A;  3BZC A;  5I2Y A;  5M5X H;  4DUZ L;  4YWL A;  4O1N A;  1VQK A;  4HAE A;  2GVB A;  1NMF A;  2F0U A;  2AHO B;  2D62 A;  1ICF B;  2Z8L A;  5JAV A;  1N33 L;  4A3E G;  2UUB Q;  1JR0 D;  5IIF A;  1Y1V B;  3T4A C;  1PTO D;  5IOC A;  3P1H A;  4JI7 Q;  5IGG A;  4QB4 A;  2B2V C;  3W1G A;  5C44 B;  3QOJ A;  4ZQ3 A;  2FXQ A;  4HJ9 A;  3HP3 A;  1MI2 A;  4L5T A;  4UP8 A;  3Q23 A;  1F9Q A;  1GUO A;  1J8I A;  1KAB A;  3U9S A;  3CMA A;  5I9O A;  4DV3 L;  3J81 i;  5DLQ E;  4ZCK A;  1EQV A;  2LS0 1;  2F0E A;  3TEH B;  4EX5 A;  3HOX G;  3I4N B;  2JP1 A;  1VQF A;  3OOC A;  1PLF A;  5AJ3 L;  2B2W A;  4GNX B;  4JI4 L;  3HOW G;  4IFD G;  3I70 A;  3Q8D A;  4APV A;  3RZO H;  4BBS B;  2K03 A;  1BNZ A;  1XNR L;  2PI2 E;  1G2S A;  2JA9 A;  1JE5 A;  4L5R C;  1I50 H;  5FLM G;  1IHZ A;  4DAY A;  2F3V A;  2EYH A;  1EQT A;  4KY7 A;  4KKS A;  2EYF A;  3J80 c;  1SNC A;  1F2Y A;  3J7Y W;  1LTA D;  1YZ6 A;  5M3F H;  2CW0 C;  1KDC A;  5IGD A;  3E0J A;  2CQO A;  4HMI A;  2MUY A;  4GS3 A;  3GO5 A;  5A2Q E;  1EY6 A;  5CC4 A;  5C4J B;  1GHK A;  1HNW Q;  2BCO A;  3OMG A;  1WTR A;  1PV4 A;  1STG A;  4PMW A;  4A3D B;  4HN7 A;  2EY6 A;  3FPP A;  4ULL A;  2BH8 A;  3DM1 A;  1FNV A;  1SR3 A;  1ICW A;  2DJG C;  1F9S A;  4FF4 A;  3PUW A;  1EIG A;  4FXD A;  2EIF A;  1PTO F;  2SDF A;  2OT2 A;  3PO3 B;  3J81 j;  3MFY A;  5LMN Q;  3NEN A;  1IBL Q;  2IX3 A;  4LK1 C;  4ILW A;  3CF5 A;  3HOU H;  1UNS A;  1JOR A;  1YHB A;  4LF6 Q;  5J1Z A;  1K0S A;  4RAU C;  3T13 A;  1LTS D;  1NMG A;  1YI2 A;  2VUM B;  3OMC A;  1S5D D;  5LL6 X;  3R3O A;  1FNU A;  1BR9 A;  4ZKC B;  3HKZ E;  4G57 A;  1STB A;  4GKJ Q;  2NVX B;  3BZK A;  3F8T A;  3I8Z A;  5EPL A;  4H44 C;  5IP9 H;  4F87 A;  2JA6 H;  2JQO A;  5ELN A;  3S24 A;  2RA4 A;  3PO2 G;  1VQD A;  2AKW B;  1PH2 A;  1TWC B;  1O78 A;  5I2X A;  1GUG A;  1SJE D;  1DZ1 A;  1VQL A;  3MFG A;  4B3R Q;  3GD7 A;  1C4Q A;  3HOZ H;  4PQX A;  1T5X D;  3I3C A;  5D14 A;  2F0H A;  4NXN Q;  4QUC A;  2RSO A;  3STB D;  3C1E A;  3S1N H;  3MHB A;  1I4P A;  1NJI C;  4A3L H;  1LAC A;  2X69 A;  4MTK A;  3TRZ A;  3SDZ A;  4ZUI A;  2HDM A;  4QF4 A;  3GV3 A;  2EXD A;  4EQ5 A;  2EVB A;  3FKI G;  4JBM A;  4I7A A;  1QIL A;  1OO9 B;  1X55 A;  4WJW A;  3CKI B;  1CA5 A;  1KC8 C;  4PNY A;  2R7Z H;  2YU9 B;  1LTI D;  3EBE A;  3E0E A;  4A3B G;  1K73 C;  3FP9 A;  3X3N A;  1VQG A;  1X3F A;  4FVM A;  2WAQ B;  4CKB A;  4DXF A;  5EAY A;  5JJZ A;  1SNO A;  4B3M L;  3I7F A;  4I7Z C;  3J7Z C;  1EEF D;  2A69 C;  2KEC A;  4BXX G;  4B3R L;  2HD3 A;  4C3J G;  4V19 0;  1EYD A;  3S2H B;  1SE4 A;  1IW7 D;  5ISR A;  4DV2 Q;  1KLG D;  2I5H A;  4A3K H;  1X32 A;  1ML0 D;  2F3I A;  1V1O A;  2OQ0 A;  4TKO B;  3PIO A;  1V8Q A;  2CWA A;  4YY3 Q;  3BS1 A;  1RJT A;  3DWP A;  1HQR D;  3GTQ B;  4OX9 Q;  1Y1W B;  3CCS A;  4P72 A;  3MA2 B;  2X6G A;  1EU4 A;  1Q1B A;  1KQS A;  3G6J B;  1XNQ Q;  1Q82 C;  1B9M A;  1CSP A;  1SYB A;  2XWJ B;  3IKJ A;  5BN4 A;  5A35 A;  3KLR A;  5BN3 A;  4G7Z C;  1HH2 P;  1IBK Q;  1WYD A;  4F7X A;  1D2B A;  2CVR A;  1JB3 A;  1CZW A;  4IN3 A;  4G7H C;  2O4X A;  2NN6 G;  2D0O A;  5GAE C;  3J7A 5;  4QIW B;  4DR2 Q;  4YY3 L;  3FMC A;  4IJH A;  1R9T B;  3MXP A;  4FXK C;  1TWH B;  2NVY B;  4BBR H;  5IWA Q;  1O80 A;  3TBI B;  1FJG Q;  1VF5 C;  2BA0 A;  2PW7 A;  5HGT A;  4CKE A;  2NWG A;  2VNU D;  3PIP 3;  4KY5 A;  1EZ8 A;  3PCO B;  2XRS D;  1X3P A;  1Q7Y C;  5HGQ A;  4JI0 Q;  1SFO H;  4P2C B;  1TS5 A;  1UE1 A;  3EVQ A;  4A3M H;  1X65 A;  3J80 i;  5BR8 L;  2K4K A;  4A3J H;  1IBK L;  1N34 L;  3I56 A;  2QCP X;  3S1M B;  4HIO A;  4C3I H;  1X3Q A;  5C3E B;  3HFZ B;  3V2T A;  4C2M H;  1J5E Q;  1PYS B;  4DR5 Q;  3R2I A;  3UDX A;  1ESR A;  1PDQ A;  3TZU A;  3KUP A;  3MZ5 A;  4N8X 1;  2CKZ B;  3NEL A;  4YIJ A;  4B08 A;  4WJ4 A;  2VQF L;  4TSS A;  5FKA C;  4BWG B;  2PZW A;  2CHB D;  4CHT B;  4B3S L;  2K6A A;  1FJG L;  3S15 B;  3T16 A;  1TS3 A;  4KN7 C;  1J6Q A;  5IYC H;  1S4Z A;  1S5B D;  4KK7 A;  4ABN A;  4RKB A;  1G6P A;  2UXC Q;  1P16 A;  1EWI A;  1O7L A;  2B29 A;  2RDG A;  3S1Q H;  4AYB G;  1JE4 A;  3EN2 A;  2E2D C;  3K5L A;  3GTP B;  1E2V A;  3QR8 A;  4DR4 Q;  3F2D A;  1LT3 D;  1ENA A;  1JWM D;  2IWH A;  5CR3 A;  3NBH B;  3BG3 A;  4OIK A;  1SSO A;  1YIT A;  3KLS A;  1PH7 A;  1DON A;  1UEA B;  3CC4 A;  4DR5 L;  2V1C C;  3D4R A;  2E2J H;  1PRT D;  3AMU A;  1NUC A;  4C1N K;  4K8J A;  1M8A A;  4P73 A;  3NEM A;  1RL2 A;  5E3F A;  2Z6K C;  2KCC A;  1MKH A;  1CFM A;  1I6H H;  3WOF A;  5ELF A;  1SYC A;  2A5H A;  4P75 A;  3NTI A;  4YCU A;  2ZT9 C;  3F2B A;  2QW7 A;  4UHV A;  2UXC L;  1EYC A;  3W2D A;  3G71 A;  4DV5 Q;  2O2L D;  3VYT A;  3K8A A;  2QKI C;  4KD3 A;  1JWU D;  3NHH A;  4BA2 I;  3H0G B;  2UXB Q;  2ICE C;  2R92 G;  1MHW C;  4DAM A;  3HGB A;  3NPP A;  4JOI C;  1HZ9 A;  3IFD A;  2P5Z X;  5JVH 3;  4X64 L;  4DK0 A;  2KHJ A;  1XTC D;  3KYH C;  1HCZ A;  1W3S A;  3L2P A;  3A8J E;  1LTG D;  1NY4 A;  1ZYR C;  2Z4H A;  3MC0 B;  3HRZ C;  4GLV B;  1QZH A;  1GXD C;  4LF7 Q;  3MXN A;  4NPS A;  5J22 A;  2BDO A;  4IZ8 A;  4CDC C;  4RH6 A;  5KNB A;  1EY9 A;  1KDA A;  1GVP A;  2A6E D;  2JA7 H;  3S2D B;  1JC7 A;  2F0W A;  1VQ4 A;  4NKL A;  3D8G A;  3UDF A;  4KJN A;  4LWC A;  1BCP D;  1N36 L;  1D7Q A;  5M5Y H;  4N8F A;  3LWU A;  1DJR D;  5LHY 1;  2ZM6 Q;  4A3G H;  1GUW A;  1CKM A;  3ERO A;  5C5M A;  5FLX L;  1LV9 A;  2PYK A;  5CMD A;  4A3F G;  4UDU C;  4H02 A;  4JBW A;  3PUZ A;  2SOB A;  2XN9 C;  1JB7 A;  4NXM Q;  3J81 E;  4OO1 G;  1QVF A;  2WV6 D;  3PMF A;  2F0P A;  3VYS A;  3I55 A;  2CQA A;  2AQ1 B;  4C3H H;  1WCM G;  3VYR A;  4IPD A;  1SEB D;  1B4O A;  4HJA A;  4B9X A;  1PRT F;  4DV1 L;  1B9N A;  3H3V I;  1SND A;  2KA7 A;  3I90 A;  1TWA B;  4JOI A;  1NTG A;  2E2H B;  4JI6 L;  4LF7 L;  3S17 H;  1Q12 A;  2MQH A;  2NVT B;  3I4M G;  4K14 A;  1LTR D;  2PZT A;  2IY5 B;  4DA2 A;  4FF2 A;  1SXT A;  2AWN A;  4IO9 A;  4B3T L;  1UEB A;  3K5O A;  1CA6 A;  4BY7 H;  3IL8 A;  1UE6 A;  3KOJ A;  2UXD Q;  4F88 A;  3J81 c;  4ODG A;  3ZYY X;  2WKC A;  5C5L A;  4ZUJ A;  2MGS A;  4PZ8 A;  2WAC A;  1II3 A;  4DNI A;  1GM5 A;  3CQZ H;  2MNA A;  3IFT A;  2H4O A;  3X3M A;  1VQ8 A;  2K05 A;  5GRO A;  3U4Z A;  1ENC A;  3GTJ H;  2HCI A;  4AQY Q;  1V1P A;  1PTO C;  2A1A A;  2PZU A;  5FOB B;  2KHI A;  2AQ2 B;  1JOO A;  3HKS A;  1DOL A;  3IRB A;  3KK7 A;  5CV6 A;  3BJU A;  2L9H A;  5FJ8 H;  1A3T A;  4QL5 A;  1MBY A;  2EQS A;  2KJX A;  4LFC L;  2CCZ A;  1BCP F;  2HQE A;  3SXH A;  3NUC A;  4XT1 B;  4WJ3 M;  5C6A A;  2RCN A;  3SHL A;  4PMB A;  1OTC A;  1ZXT A;  4V0B A;  1BVS A;  1Y1V H;  4FO2 A;  2MPM A;  3K0Y A;  3HOY H;  1BBU A;  2XSC A;  5C44 H;  1E7Z A;  1M1K C;  2HHH L;  3CCV A;  1EU3 A;  3K81 C;  3VYU A;  5LMU L;  4GOP B;  5M3F G;  1XMO Q;  1SJH D;  3IAY A;  1TT2 A;  1C8C A;  1A6X A;  3T1Y L;  2DGY A;  2KUM A;  3DXJ C;  1C48 A;  2XNA C;  1BDO A;  3TS2 A;  4XDX A;  2QA4 A;  4HID A;  1V43 A;  5JJI A;  2IHF A;  2FJ2 A;  3QO2 A;  4UP7 A;  1VQ6 A;  3I4N H;  4DAV A;  3P20 A;  2PI2 A;  4OWW B;  2FMC A;  4GNX A;  4KY6 A;  4LF4 Q;  4HJ7 A;  3UDI A;  4BBS H;  4RWS C;  1TS2 A;  5EGT A;  5M5W B;  1LT5 D;  5IY0 A;  1EIH A;  3URY A;  2IX0 A;  1SMY C;  3E5S A;  4S3S A;  2E5L Q;  2JSO A;  3HOU G;  2F0G A;  2F0F A;  2ZTD A;  4YHH Q;  2IJ0 A;  1VQ5 A;  1PHJ A;  1YNN C;  3K7A B;  3KLW A;  3FDT A;  1DOM A;  2EJM A;  2LXJ A;  4I65 A;  3D6C A;  1WTX A;  1NNX A;  1QOH A;  1VQJ A;  4X62 L;  3UE0 A;  4XQJ A;  3KJP A;  2EPB A;  3H09 A;  1Y69 U;  3QJY A;  4OWX B;  4HJ5 A;  1SLJ A;  1YBY A;  1AW7 A;  4M1U B;  1WJJ A;  5C4J H;  1AFP A;  2NTT A;  3ERS X;  3M4Y A;  1LYL A;  4A3D H;  4OHJ A;  3K5M A;  3U4V A;  1A3V A;  4HED A;  5G3L D;  3M3Y B;  2L11 A;  4G7O C;  2A8V A;  4A3L G;  2BA1 A;  3PO3 H;  4BY1 G;  2WP8 J;  1X9N A;  3TS0 A;  2PPB C;  4P71 A;  3EIV A;  3GTJ B;  3STB C;  3D3R A;  4DR1 Q;  1K9M C;  5GQO A;  1EY5 A;  2EY1 A;  5COR A;  3RN2 A;  2VUM H;  3BDC A;  4N9P A;  1D1I A;  2Q8R E;  2F0M A;  2EYP A;  2R7Z G;  4XIG S;  4NW2 A;  2N78 A;  2NVX H;  1B8A A;  1P8L A;  4RGT A;  2NVQ B;  1ILQ A;  1FD7 D;  2PNR C;  3TRE A;  2PW5 A;  1JJC B;  1A15 A;  1TWC H;  2N55 A;  4GKK L;  2A74 C;  3GQB A;  2GVA A;  1EFI D;  2NUC A;  4JYA Q;  3KJO A;  4A3K G;  4LF9 L;  1SYD A;  1FGB D;  5LMN W;  1I4G A;  3SR1 A;  3HOY B;  3DMU A;  4LFA Q;  1IW7 C;  1U9R A;  2A19 A;  4JC0 A;  4DR3 L;  1L0W A;  4DK3 C;  3E9I A;  2BDN A;  3HZX A;  1S40 A;  5KND A;  5T1I A;  2KED A;  5H1S E;  3CCJ A;  3OIP A;  2NBF A;  1EQR A;  4KHP Q;  3J80 E;  1Z47 A;  3H6M A;  1PYB A;  3CC7 A;  3GTO H;  2YU9 H;  4DV7 Q;  1XYI A;  2JA8 B;  1OXX K;  5ELC A;  2FIN B;  2VZA A;  1IYJ B;  1JOQ A;  2O5I C;  2R7D A;  2G9H D;  5C4X G;  5E7N A;  2Q2U A;  3BDL A;  1KD1 C;  4RCN A;  2WFW A;  3TN2 A;  4J6H A;  5G3L F;  4K0K Q;  3R93 A;  2WKD A;  4ZYS A;  3S2H H;  2N88 A;  1LTL A;  1EYG A;  4JK1 C;  2UUB L;  1U4R A;  3QOL A;  4CDD C;  1GUT A;  1WD0 A;  4JI7 L;  3I2Z A;  4J8Q A;  2F0V A;  4OEL B;  4LFA L;  3LGJ A;  1LLR D;  4X6A H;  3ERQ A;  4BBR G;  2UU9 Q;  4H13 C;  3S9W A;  3GTQ H;  1STH A;  1GKH A;  1Y1W H;  4PMC A;  3ULJ A;  1HPC A;  1A3U A;  1E1T A;  2EYJ A;  3BU2 A;  3N52 A;  5E4W C;  4XYQ A;  1IXR A;  4LW1 A;  2G9D A;  3CCM A;  1Q81 C;  4DV7 L;  3E3X A;  2K14 A;  3GTL B;  1WOC A;  1JOK A;  2HIV A;  3T1H Q;  1SMY D;  5ELB A;  2VB2 X;  1IL2 A;  1HR0 Q;  2YYZ A;  4A3M G;  5IGE A; 
#chains in the Genus database with same CATH homology
 1Q8I A;  2WB1 B;  4CJ0 B;  1YNN D;  2J4X A;  4C3I G;  1FR3 A;  3A55 A;  3NWS A;  1NR4 A;  3S14 B;  4CJ2 C;  3T51 B;  2KHS A;  1D1K A;  4KHV A;  2NZ1 D;  3E6Z X;  1BF4 A;  4IUU A;  1JCK B;  1K83 B;  4X3T A;  3TP8 A;  1WCM B;  5CBA E;  5DM7 3;  5FO9 B;  3H91 A;  1CI3 M;  3NP8 A;  2XRQ D;  3MAQ A;  2R93 B;  1J9O A;  1H9S B;  2Q8I B;  5IT9 L;  2Z1C A;  3K59 A;  3MTS A;  5JPM C;  1STY A;  3CHB D;  2XWB B;  5C4H A;  1QCB D;  4DK1 A;  1SNQ A;  1RKN A;  1UUP A;  4LAA A;  2F0S A;  4HCE A;  2DNC A;  4QUF A;  3GTO B;  1AN8 A;  2IL8 A;  1PRT C;  2F03 A;  2IPK D;  3TP5 A;  1L0X B;  1EWC A;  1KNA A;  3C46 A;  2EDG A;  2Z4I A;  4U67 3;  5EKK A;  2K7V A;  5EKL A;  1HHV A;  3R2T A;  3NBH A;  2Y0S B;  1H9M A;  5I6Y A;  5I4D A;  3OW7 A;  3SK8 A;  4XTC S;  3FVQ A;  1RDP D;  1NCV A;  1JIC A;  2FMM A;  4IAL A;  3BDO A;  4ZKB B;  5IGC A;  3AB9 A;  1DXM A;  5DNF A;  3RD4 A;  1TQO A;  4EQO A;  3I91 A;  2A6E C;  1ENF A;  2B2U A;  3BYY B;  5E1F A;  4FYD A;  3DWQ A;  5EBD A;  5KYI A;  4IFD J;  3PIO 3;  3OIQ A;  5C3W A;  1QNK A;  1BCP C;  2JA5 B;  1H9R A;  3N6R A;  4C3H G;  4ZK9 B;  3M4O B;  4BA1 I;  5C0X J;  2HUG A;  3PUY A;  2B39 A;  3J7A F;  4IFD H;  2MJ8 A;  3OWF A;  2B8G A;  3R8B A;  3O13 A;  4ME5 A;  5CV9 A;  1RF2 D;  4B9W A;  5C0X H;  1KDB A;  4O42 A;  4KV6 A;  3A54 A;  4ZRZ A;  1VMC A;  2GA4 B;  2NB0 A;  4A93 B;  3KLS X;  3RZD B;  2BOS A;  2SEB D;  2F0Q A;  1I4Q A;  5FO8 B;  5IOD A;  2EJF C;  3VR5 A;  1OXV A;  3W3A A;  3HOV B;  4RKL A;  2PQE A;  4BY1 B;  3VA5 A;  5FK9 C;  3RMH A;  2J7Z A;  1GJX A;  1IYU A;  1TVX A;  3PUV A;  3FEW X;  1QWY A;  1OXT A;  4HSP A;  5EJW A;  2K5D A;  3RLF A;  5DEH A;  4TQU S;  5C4Z A;  3Q24 A;  5JVG 3;  2L12 A;  3SK5 A;  1FYC A;  3BYT B;  2L5T A;  2EJG C;  4KI0 A;  1KNE A;  2B2Y C;  1PXU A;  4RHR A;  3MVV A;  4A3E B;  2DNE A;  4N9T A;  3K5N A;  2ZXP A;  3TZD A;  4IUR A;  1A2T A;  4QCL A;  4OGQ C;  4KJO A;  2K28 A;  3FPU B;  5D3D A;  1E2Z A;  4F8M A;  5D65 A;  3QWN A;  2JEA I;  5KGU A;  2E76 C;  5I6W A;  2HDL A;  4FXG C;  2B2T A;  1I4H A;  3HOX B;  2XVS A;  3JAM L;  1YNJ C;  5C4X B;  1DYQ A;  5CV5 A;  3HOW B;  4RGO S;  3S1R B;  3GV6 A;  1I4X A;  1QG7 A;  4X3U A;  4CJ1 B;  2RSN A;  3EQL C;  4KHZ A;  1EY0 A;  2B2Y A;  3P7J A;  5K36 H;  2MHV A;  4IFD I;  3QIA A;  3T53 B;  4H7B A;  1B50 A;  1AZP A;  2J0T D;  3M7G A;  2BE5 C;  5C0X I;  1VF7 A;  4WFN 3;  2O5J C;  1PZK D;  2FHT A;  1GUN A;  2QDB A;  2RVL A;  1STN A;  1EY8 A;  1HA5 A;  1TWF B;  2HCC A;  3NWT A;  1Z7T A;  3VR4 A;  4XYO A;  2B63 B;  3SEB A;  1QE6 A;  5EBC A;  1DCZ A;  1TY2 A;  2NTS A;  1CHP D;  4KD4 A;  2E74 C;  3PO2 B;  4OIJ A;  1LO5 D;  3I72 A;  4QMG A;  3L3O C;  1PFM A;  3NTK A;  3K6O A;  3PUX A;  4HR7 B;  1MGS A;  1RHP A;  1EY7 A;  4MN3 A;  3FKI B;  4DNR B;  3OHX C;  4C1N I;  2OEO A;  1ROD A;  1K8O A;  2M00 A;  3AU7 A;  5I9P A;  2RKS A;  2EOT A;  4A3B B;  1JWS D;  2WII B;  1XX8 A;  4C3J B;  1IYV A;  4L63 B;  1TWG B;  3ND9 A;  1S5C D;  5CV8 A;  1HXY D;  1R4P B;  3QB3 A;  3SK6 A;  3CU7 A;  3I73 A;  2ENB A;  5CBE E;  4RGM A;  2EE1 A;  1Y8O B;  3ITP A;  1O7Y A;  2SNS A;  1YNJ D;  5JPN C;  2H1E A;  3K58 A;  4ZAI A;  3HS0 C;  5A2Q L;  3TDQ A;  1H9K A;  4L8J A;  4KKT A;  5CGK A;  3DWA A;  4E6I A;  2RBM A;  1BQQ T;  2IT1 A;  3EFX D;  1TII D;  5FLX E;  2F0J A;  2RDF A;  1B2T A;  3L7Z C;  4MHE A;  1BOS A;  1SNP A;  1F2L A;  2BE5 D;  2XIW A;  2K01 A;  4EQP A;  1F2M A;  4K2K A;  1CK1 A;  2F0I A;  3V96 A;  2JYO A;  2NN6 I;  2OF1 A;  3WOE A;  4CGY B;  2A68 C;  2L1B A;  1HA6 A;  5ELE A;  4ZLT F;  1CTM A;  2EYM A;  1BBX C;  4LJZ C;  5FO7 B;  5HUR A;  2PCF B;  1PFB A;  3BVZ A;  1SE3 A;  1WTW A;  5JEA J;  4IUN A;  4X3K A;  3M85 A;  3Q22 A;  3HEJ A;  1EOT A;  1S5F D;  1CQV A;  1SDF A;  1EYA A;  2JE6 I;  2PO4 A;  4WRD A;  2KQ3 A;  4WOR A;  4L6T B;  1QJO A;  5JEA H;  4KTA A;  3A56 A;  2EZV A;  5IGF A;  1VDZ A;  1F9R A;  3BVG A;  3V05 A;  4PV1 C;  3GTG B;  2V4D A;  4AYB B;  4BS9 A;  1NR2 A;  2I07 B;  2K1B A;  1W6K A;  2F0N A;  1K8M A;  1TY0 A;  3CRK C;  1CM9 A;  4HMJ A;  1RD9 D;  2LFN A;  1LTT D;  3GTM B;  1NAP A;  1PTO B;  4R8I A;  2ZXR A;  2ICI A;  1ZKO A;  2K5W A;  1FNW A;  3A7L A;  3EA6 A;  1H9J A;  4Q0F A;  3MWY W;  1NSN S;  2JXM B;  2EYO A;  3VA7 A;  1WTV A;  3DEP A;  1SNM A;  2ZXO A;  4J1M A;  1G29 1;  2R92 B;  5C0X G;  4A3I B;  5M3M B;  2L55 A;  2D9U A;  3NXW A;  1ESF A;  3C2P A;  1I3Q B;  3A8K E;  2B2V A;  4Y7N B;  1QB5 D;  5NUC A;  1B3A A;  3OPO A;  3GTK B;  1E2W A;  3TP6 A;  1D5Z C;  2E2I B;  3NQT A;  2AWO A;  2M2L A;  1MSG A;  1G6Z A;  1HRJ A;  1ET6 A;  1SBB B;  1LT4 D;  2EY5 A;  2F1M A;  2KEE A;  3SK4 A;  2TSS A;  4A3F B;  1STA A;  4X3S A;  4CBV A;  2C5C A;  3HKZ B;  1I4R A;  1G2T A;  2F0K A;  3SVM A;  1EZ6 A;  2MP1 A;  4KN4 C;  1AZQ A;  1F2Z A;  2L0C A;  5M5X B;  4LMQ D;  4Z9C B;  2A68 D;  3I4M B;  1B53 A;  3D4W A;  2B8F A;  3QG1 A;  4OO1 I;  5EQ0 A;  4NP5 A;  1R4Q B;  1VCI A;  2F0L A;  5C3X A;  2FFK B;  2QEJ C;  1I6V C;  2EY2 A;  3F2U A;  4K6L A;  2B2U C;  3VR3 A;  5CV7 A;  5CV4 A;  1TR5 A;  2IX1 A;  1VMP A;  1BO0 A;  3A7A B;  3P75 A;  3KF8 A;  4IQZ A;  1PMR A;  3CRL C;  5D3I B;  1WTP A;  3C3L A;  4R9W A;  2EYL A;  3TME A;  1WTO A;  1Y8N B;  3OSO A;  3ONA B;  3MEH A;  1GHJ A;  3PV0 A;  3T56 B;  3RZO B;  1HFG A;  5ELD A;  3I4L A;  1I50 B;  1SYE A;  1B1Z A;  3H3V C;  4U68 A;  1GOZ A;  5K5P A;  1ONL A;  1KLU D;  1LT6 D;  5LL6 S;  5K36 G;  3LX0 A;  1L0Y B;  4RGN A;  3HG9 A;  1D5M C;  5M3F B;  1JQY D;  2IW3 A;  3KBG A;  2RQX A;  3D6W A;  3SE0 A;  2LMC B;  1Y8P B;  5KNC A;  4H0L C;  4HSV A;  4IUT A;  1WTQ A;  1Q1E A;  1ZEQ X;  5IGB A;  1PYW D;  2VXW A;  1ET9 A;  3HOU B;  1Q90 A;  1SE2 A;  3Q0A A;  2CW0 D;  1EL0 A;  1O7Z A;  4TRD A;  2AUJ D;  2NYZ D;  3J81 L;  3NSW A;  1E0B A;  3Q6S A;  2JA6 B;  1D5X C;  1G8Z D;  3M7N A;  1WVL A;  2RDH A;  1G91 A;  2PMZ B;  4K2L A;  4FF1 A;  5KRU A;  2E75 C;  3HOZ B;  1IL8 A;  4DAP A;  3TP7 A;  2A6H C;  4K5V A;  3NE5 B;  3BVM A;  3LNN A;  3S1N B;  1HQM C;  4DGZ A;  4C56 C;  1CZG A;  4CKC A;  2TMP A;  3MXG A;  1TU2 B;  1D6E C;  1T5E A;  5TSS A;  1Z6H A;  5IT9 E;  2B2T C;  2R7Z B;  1SAP A;  2SNM A;  4M8A A;  2KCN A;  2L4N A;  1EEI D;  1CT1 D;  3RUZ A;  4K5W A;  3BZD B;  1BUV T;  5JOB A;  3NQI A;  1AP0 A;  5KIX A;  1OXS C;  2R61 A;  1ILP A;  2I46 A;  4XQQ A;  3MXU A;  4A3K B;  1EWH A;  3KBX A;  4IUV A;  2K32 A;  3TSS A;  1LTB D;  2JEB I;  4GZY C;  3D4D A;  1MD2 D;  1PFN A;  2F3W A;  3FRP B;  1IKL A;  1HUN A;  1RTN A;  4G4K A;  2AUK A;  2C9O A;  4K6D A;  1Q3L A;  3A8I E;  2D5D A;  4XXE A;  2KVM A;  3J7A V;  2A69 D;  1HFN A;  1STE A;  2DN8 A;  3LWE A;  5DAU A;  2AQ3 B;  1HUM A;  1PRT B;  2M9V A;  1HTP A;  4K5X A;  4EVO A;  3U9O A;  5EPK A;  5CYU A;  1BXT A;  4DXG A;  5KYL A;  5AFW A;  4BBR B;  1XXG A;  1S5E D;  1DD2 A;  1F9P A;  1U4M A;  4R8N A;  2ID0 A;  1LAB A;  4UAI A;  4KMU C;  1UAP A;  3K57 A;  1SFO B;  4Q5V A;  3NK9 A;  4A3M B;  3NBI A;  5EKI A;  4A3J B;  1KTK A;  2EXZ A;  4C3I B;  4C2M B;  2NN6 H;  1HTL D;  1WD1 A;  2KOL A;  1BCP B;  4IUQ A;  1RTO A;  4FF3 A;  4HTH A;  4DN4 M;  4FNF A;  2A6H D;  5KEE A;  4IUP A;  5JEA G;  2QF7 A;  3D31 A;  3S1Q B;  3EJI A;  4OL7 A;  2F0D A;  1CQF A;  1F77 A;  2E2J B;  1XWE A;  1PZJ D;  2DY8 A;  4KKU A;  2D2C C;  1I6H B;  4RFB A;  1RCV D;  4FP5 D;  3NTH A;  1GUS A;  5F2D A;  3J80 L;  1U4L A;  2R6G A;  4HCS A;  2QIL A;  4RCO A;  4DFA A;  1IKM A;  2A73 B;  4MIU A;  3G7L A;  4DNT B;  2LKV A;  2F4I A;  1OXU A;  1DOK A;  2K33 A;  5J39 A;  3JAM E;  1PTO H;  5E4X A;  3VR6 A;  2JA7 B;  1M4V A;  3DHQ A;  1AEX A;  1PZI D;  4DU9 A;  3C1F A;  5T1G A;  5M5Y B;  1U4P A;  1DM0 B;  4A3G B;  3GP7 A;  4XT3 B;  3DUZ A;  3S16 B;  3WDN A;  1ZYR D;  2DY7 A;  5DM6 3;  4C3H B;  2F0O A;  3DEO A;  5M9O A;  4RA8 A;  4XQN A;  4ID6 A;  3S17 B;  2OXP A;  5BN5 A;  2X6L A;  4RHS A;  3H94 A;  4EGV A;  1A2U A;  4BY7 B;  2Q8T A;  5COY A;  2VB3 X;  3UI2 A;  3VR2 A;  3CQZ B;  2K04 A;  3ND8 A;  1EY4 A;  4EQN A;  2K5Q A;  4NMZ A;  1SYG A;  4K8I A;  1V1P B;  2R3Z A;  3L9A X;  4DF7 A;  4OO1 H;  1KAA A;  1W6J A;  2F0T A;  2WIN B;  5EPJ A;  1B44 D;  2B2W C;  3OWE B;  1TKW B;  1MSH A;  4NDX A;  1TS4 A;  1QNU A;  5I2Y A;  1SYF A;  1CHQ D;  1H9S A;  2LY7 A;  4O1N A;  4HAE A;  2F0U A;  2D62 A;  2Z8L A;  5JAV A;  1JR0 D;  5IIF A;  1Y1V B;  3T4A C;  1PTO D;  5IOC A;  3P1H A;  5IGG A;  4QB4 A;  2B2V C;  5C44 B;  3QOJ A;  4ZQ3 A;  3HP3 A;  1MI2 A;  3Q23 A;  1F9Q A;  1GUO A;  1J8I A;  1KAB A;  3U9S A;  5I9O A;  1EQV A;  2LS0 1;  2F0E A;  3I4N B;  2JP1 A;  3OOC A;  1PLF A;  2B2W A;  4IFD G;  3I70 A;  4BBS B;  2K03 A;  1BNZ A;  1G2S A;  1IHZ A;  4DAY A;  2F3V A;  2EYH A;  1EQT A;  4KY7 A;  4KKS A;  2EYF A;  1SNC A;  1F2Y A;  3J7Y W;  1LTA D;  2CW0 C;  5IGD A;  1KDC A;  3E0J A;  4HMI A;  2MUY A;  3GO5 A;  5A2Q E;  1EY6 A;  5CC4 A;  5C4J B;  1GHK A;  2BCO A;  3OMG A;  1WTR A;  1STG A;  4PMW A;  4A3D B;  4HN7 A;  2EY6 A;  3FPP A;  4ULL A;  3DM1 A;  1FNV A;  1ICW A;  1F9S A;  4FF4 A;  3PUW A;  1EIG A;  4FXD A;  1PTO F;  2SDF A;  2OT2 A;  3PO3 B;  3MFY A;  2IX3 A;  4LK1 C;  4ILW A;  1UNS A;  1JOR A;  5J1Z A;  4RAU C;  3T13 A;  1LTS D;  2VUM B;  3OMC A;  1S5D D;  5LL6 X;  3R3O A;  1FNU A;  1BR9 A;  4ZKC B;  4G57 A;  1STB A;  2NVX B;  3I8Z A;  5EPL A;  4H44 C;  4F87 A;  2RA4 A;  1TWC B;  1O78 A;  5I2X A;  1GUG A;  1SJE D;  1DZ1 A;  3MFG A;  3GD7 A;  1C4Q A;  4PQX A;  1T5X D;  3I3C A;  5D14 A;  2F0H A;  4QUC A;  2RSO A;  3C1E A;  3MHB A;  1I4P A;  1LAC A;  2X69 A;  3SDZ A;  4ZUI A;  2HDM A;  4QF4 A;  3GV3 A;  2EVB A;  1QIL A;  1OO9 B;  4WJW A;  3CKI B;  1CA5 A;  4PNY A;  2YU9 B;  1LTI D;  3X3N A;  4CKB A;  4FVM A;  2WAQ B;  4DXF A;  5JJZ A;  1SNO A;  4I7Z C;  1EEF D;  2A69 C;  2KEC A;  4C3J G;  4V19 0;  1EYD A;  3S2H B;  1SE4 A;  1IW7 D;  5ISR A;  1KLG D;  1X32 A;  1ML0 D;  1V1O A;  4TKO B;  1V8Q A;  3BS1 A;  1RJT A;  3DWP A;  1HQR D;  3GTQ B;  1Y1W B;  3MA2 B;  2X6G A;  1EU4 A;  1Q1B A;  3G6J B;  1B9M A;  1SYB A;  2XWJ B;  3IKJ A;  5BN4 A;  5A35 A;  3KLR A;  5BN3 A;  4G7Z C;  4F7X A;  1D2B A;  2CVR A;  1JB3 A;  1CZW A;  4IN3 A;  4G7H C;  2O4X A;  2NN6 G;  4QIW B;  3FMC A;  1R9T B;  3MXP A;  4FXK C;  1TWH B;  2NVY B;  1O80 A;  3TBI B;  1VF5 C;  2BA0 A;  2PW7 A;  5HGT A;  4CKE A;  2NWG A;  2VNU D;  3PIP 3;  4KY5 A;  1EZ8 A;  2XRS D;  1X3P A;  4P2C B;  1TS5 A;  3EVQ A;  2QCP X;  3S1M B;  5C3E B;  1X3Q A;  3V2T A;  3R2I A;  1ESR A;  1PDQ A;  3TZU A;  3KUP A;  3MZ5 A;  4YIJ A;  4B08 A;  4TSS A;  5FKA C;  4BWG B;  2PZW A;  2CHB D;  4CHT B;  2K6A A;  3S15 B;  3T16 A;  1TS3 A;  4KN7 C;  1S4Z A;  1S5B D;  4KK7 A;  4ABN A;  4RKB A;  1O7L A;  2RDG A;  1JE4 A;  2E2D C;  3K5L A;  3GTP B;  1E2V A;  1LT3 D;  1ENA A;  1JWM D;  2IWH A;  5CR3 A;  3BG3 A;  4OIK A;  1SSO A;  3KLS A;  1DON A;  1UEA B;  3D4R A;  1PRT D;  3AMU A;  1NUC A;  4C1N K;  4K8J A;  1M8A A;  5E3F A;  2KCC A;  1CFM A;  3WOF A;  5ELF A;  1SYC A;  2A5H A;  3NTI A;  2ZT9 C;  1EYC A;  3W2D A;  2O2L D;  3VYT A;  2QKI C;  4KD3 A;  1JWU D;  3NHH A;  4BA2 I;  3H0G B;  2ICE C;  3HGB A;  3NPP A;  3IFD A;  5JVH 3;  4DK0 A;  1XTC D;  1HCZ A;  3A8J E;  1LTG D;  1ZYR C;  2Z4H A;  3MC0 B;  3HRZ C;  1GXD C;  3MXN A;  5J22 A;  2BDO A;  4IZ8 A;  4RH6 A;  5KNB A;  1EY9 A;  1KDA A;  2A6E D;  3S2D B;  1JC7 A;  2F0W A;  4NKL A;  3D8G A;  4KJN A;  1BCP D;  3LWU A;  1DJR D;  5LHY 1;  1GUW A;  3ERO A;  5C5M A;  5FLX L;  1LV9 A;  2PYK A;  5CMD A;  4UDU C;  4JBW A;  3PUZ A;  2SOB A;  2XN9 C;  3J81 E;  4OO1 G;  2WV6 D;  3PMF A;  2F0P A;  3VYS A;  2CQA A;  2AQ1 B;  3VYR A;  1SEB D;  1B4O A;  4B9X A;  1PRT F;  1B9N A;  1SND A;  2KA7 A;  3I90 A;  1TWA B;  2E2H B;  1Q12 A;  2NVT B;  4K14 A;  1LTR D;  2PZT A;  4DA2 A;  4FF2 A;  1SXT A;  2AWN A;  3K5O A;  1CA6 A;  3IL8 A;  4F88 A;  4ODG A;  3ZYY X;  2WKC A;  5C5L A;  4ZUJ A;  2MGS A;  2WAC A;  1II3 A;  3IFT A;  2H4O A;  3X3M A;  2K05 A;  1ENC A;  2HCI A;  1V1P A;  1PTO C;  2PZU A;  5FOB B;  2AQ2 B;  1JOO A;  1DOL A;  3KK7 A;  5CV6 A;  2L9H A;  1A3T A;  1MBY A;  2KJX A;  1BCP F;  2HQE A;  3SXH A;  3NUC A;  4XT1 B;  5C6A A;  3SHL A;  4PMB A;  1ZXT A;  4V0B A;  4FO2 A;  2MPM A;  3K0Y A;  2XSC A;  1EU3 A;  3VYU A;  1SJH D;  3IAY A;  1TT2 A;  1C8C A;  1A6X A;  2KUM A;  3DXJ C;  1C48 A;  2XNA C;  1BDO A;  4XDX A;  1V43 A;  2FJ2 A;  3QO2 A;  4DAV A;  3P20 A;  2FMC A;  4KY6 A;  4RWS C;  1TS2 A;  5EGT A;  5M5W B;  1LT5 D;  1EIH A;  3URY A;  2IX0 A;  1SMY C;  3E5S A;  4S3S A;  2JSO A;  2F0G A;  2F0F A;  2IJ0 A;  1YNN C;  3K7A B;  3FDT A;  1DOM A;  2EJM A;  4I65 A;  3D6C A;  1WTX A;  1QOH A;  4XQJ A;  2EPB A;  3H09 A;  1Y69 U;  3QJY A;  1AW7 A;  4M1U B;  1AFP A;  2NTT A;  3M4Y A;  4OHJ A;  3K5M A;  1A3V A;  4HED A;  5G3L D;  3M3Y B;  2L11 A;  4G7O C;  2BA1 A;  2WP8 J;  2PPB C;  3GTJ B;  3D3R A;  1EY5 A;  2EY1 A;  5COR A;  3BDC A;  4N9P A;  1D1I A;  2Q8R E;  2F0M A;  2EYP A;  4XIG S;  4NW2 A;  4RGT A;  2NVQ B;  1ILQ A;  1FD7 D;  2PNR C;  2PW5 A;  1A15 A;  2N55 A;  2A74 C;  3GQB A;  1EFI D;  2NUC A;  1SYD A;  1FGB D;  1I4G A;  3SR1 A;  3HOY B;  3DMU A;  1IW7 C;  1U9R A;  2BDN A;  3HZX A;  5KND A;  5T1I A;  2KED A;  3OIP A;  2NBF A;  3J80 E;  1Z47 A;  3H6M A;  1XYI A;  2JA8 B;  1OXX K;  5ELC A;  2FIN B;  1JOQ A;  2O5I C;  2G9H D;  3BDL A;  4RCN A;  3TN2 A;  4J6H A;  5G3L F;  3R93 A;  2WKD A;  4ZYS A;  2N88 A;  4JK1 C;  1U4R A;  3QOL A;  1GUT A;  1WD0 A;  4J8Q A;  2F0V A;  1LLR D;  3ERQ A;  4H13 C;  3S9W A;  1STH A;  4PMC A;  1HPC A;  1A3U A;  2EYJ A;  5E4W C;  3N52 A;  4XYQ A;  2G9D A;  3GTL B;  1JOK A;  1SMY D;  5ELB A;  2VB2 X;  2YYZ A;  5IGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...