2VQEL

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqeL00
2VQFQ 4YHHQ 1OTCA 2BH8A 2QGQA 2MFIA 1PH2A 1P16A 4A3BH 4X6AH 2NZHA 3RR5A 3T1YQ 3M3YH 1J5EQ 5IP9G 1UE5A 2LXKA 1VQ6A 2F4VL 3KLWA 4LUZA 4MTNA 4A3IG 1GD7A 3I4MG 2Q2UA 3S14H 1M90C 2JA7H 3PUWA 4MZ9A 2JEAI 4A4IA 2NVTH 2IHFA 4DAMA 3HOWG 2VQFL 2NN6I 2UUAQ 4LF9L 3NENA 4OXPA 1YNXA 3T1HL 1I6HH 4DPGA 4DR7L 4PZ7A 3CCVA 2NN6G 2DUDA 1HNXQ 1L1OC 2GVAA 2WFWA 4LF5L 4X64L 3I4NH 2GVBA 1A63A 4K0KQ 1U0LA 1I5FA 1IZ6A 1X3EA 3KFUA 4UY8C 3UDGA 1EOVA 1Q1BA 4IOAA 1PVOA 1D8LA 4IFDJ 2ZJRA 4JV5Q 1MIUA 4GLVB 2CQOA 1LYLA 1HNZL 2E2IH 2ZTCA 5C3EG 4GS3A 4IOCA 4PZ6A 4AYBG 1L1OA 4A75A 1LM0A 3ULLA 1VQLA 1Q12A 1CKOA 1K3RA 3RLFA 4A3LH 1XNRL 1S72A 4UPAA 4JI3L 1EQRA 5IE8A 4ALPA 5IY0A 1HNWQ 4HIKA 3NELA 3S2DH 1PH6A 3HOXH 1JMCA 2K52A 1VQKA 1AH9A 4DV0Q 1BBWA 4TQUS 3U4ZA 4A3FG 1VQ8A 4KLKA 1S3OA 4HJ5A 3M4QA 5HGQA 5FLMH 1Q86C 3KF8B 1YEZA 2IX1A 3G48A 4P73A 3CCMA 3G6EA 2Y0SG 4JI3Q 2HIVA 2UXCQ 4LF4Q 4AQYQ 1IBML 3RNUA 2ALYB 2BH2A 3DM3A 4C2MH 1K8GA 1SLJA 1XNRQ 5IYCG 1TWCH 1WYDA 1QZHA 4A93H 1W3SA 1V9PA 2F3IA 3OTOQ 4YCUA 2Q2IA 1E3PA 2AWNA 4DV3Q 4B3SL 3HOVH 3KJPA 1YHAA 2CWPA 1K0RA 3TREA 5DLQE 3RN2A 3GTOH 2Z6KC 2UUBQ 4A3CH 3CMEA 3RLOA 3FKIH 2MO1A 3E9IA 1BBUA 3H0GH 2ES2A 4LF7Q 4A3GG 4DR2Q 3D0FA 2RHQB 4B3TL 2R7DA 3NBHB 5AJ3Q 3PIPA 4A3KH 1HZ9A 2N49A 2VL6A 2CCZA 2HIXA 1KHIA 3K8AA 4JI1L 3H3VI 4DR7Q 2UXBL 4L5TA 1TWGH 4GOPC 1KAWA 3STBC 4C3JH 4DAYB 4P71A 5GAEC 5FJ8G 3T1HQ 1H95A 5GADC 1P8LA 3G71A 2GN5A 2KCMA 5ELOA 2I5MX 3M4PA 1XMQQ 2Q2TA 4OONA 3S24A 1HZAA 4LF7L 1FVIA 1CSQA 2B29A 3HOZG 2Q2HA 3E9HA 3HFZB 4QJFA 4IJHA 3BZCA 3KDFB 4LF8Q 2Z0SA 2RCNA 5LMUL 4BBRH 3S16H 1L2FA 3ZJYC 3PO3H 2UXDL 4JOIC 2R7FA 2K14A 1VQBA 1G291 3OTOL 3CPWA 2AMCB 3PUVA 4YHHL 3I56A 4A3EH 3CC2A 1EIFA 1Y14B 4LFCQ 2VS1A 1VQCA 3HOYH 2IY5B 2QEXA 4XTCS 1CKNB 1MKHA 3PO3G 4JBJA 4EQ5A 4HIMA 1K9MC 4POGA 3S17H 2Y0SE 4DUYQ 2QA4A 3M7NA 4DR4Q 1Q1EA 4JI5L 4JG2A 4DK3C 1KD1C 2UUCL 2YU9H 5LMUQ 3PF4A 5AJ3L 1YHQA 3HOZH 1N33Q 2AHOB 4NB3A 2ZTDA 1WI5A 1Z9FA 4L5SA 2UU9Q 1N34Q 2NVYH 3CMAA 1YITA 1SRUA 5IP7H 3L2PA 4LF5Q 4QL5A 1I3QH 1DGSA 2CWAA 2HQLA 4LF6Q 4HJ8A 1XPUA 3I4OA 1CSPA 1NBWA 5LMNQ 3Q8DA 1FJGQ 3W1GA 1HR0Q 2VY3A 3PUXA 1XNQQ 4GKKL 3H3VH 2MQHA 1JE5A 1IYJB 1OXSC 3H0GG 4OWXB 4JYAQ 1PYBA 3CCJA 2WP8J 3NEMA 1EYGA 3GTQH 3HOUG 2AWOA 3M85A 1VQEA 3KYHC 1LUZA 1QUQB 3AFQA 4DV2Q 2PI2A 3F2BA 1IBLQ 3HKSA 4P75A 1KQSA 1QVFA 1OXXK 2WB1G 4APVA 3E0EA 4RG1A 1X6OA 2K50A 4GOPB 1XMQL 1XMOL 1HR0W 1OXVA 3TS2A 2YTVA 1C9OA 3UDXA 1VQHA 3W1BA 2A8VA 5GROA 1LTLA 2FXQA 4YWMA 5M3MH 5LMNL 4BY7H 4JC0A 4TVAB 3TEHB 4LFAQ 1PH9A 1PHJA 1I50H 4GLXA 1VQDA 1VQMA 1XTDA 4DV4Q 1BKBA 2PQAB 1WFQA 2IHEA 4O2DA 4P72A 4DR5L 4JBWA 4PMWA 1SN8A 4BY1G 1EQQA 1YZ6A 3HOXG 3S1NH 4BBSG 1FGUA 1IXRA 3KF6B 1JJ2A 2OTLA 4LFBL 3CCRA 3F8TA 2WAQG 5EAYA 4DV6L 2RHSB 2E5LQ 3H15A 5C4JH 3OYYA 5JEAG 2VUMH 4R4CA 1N36Q 4A3LG 3B6YA 4DR1Q 5C44G 2I5LX 2LXJA 3EN2A 3FP9A 3S15H 3ERSX 5C3EH 2RF4A 1PH1A 3K81C 1YI2A 4LF4L 3KDFA 1Q46A 1AE2A 3JC66 5M5YH 1C7YA 1PFSA 3MXNB 4JI0L 3J81j 4JI4L 3HKZG 1ASYA 4XIGS 3I4NG 4YY3L 4OX9L 3GDEA 3CXCA 3J81c 1ASZA 3G4SA 1N8RC 1AE3A 4DV4L 4PZ8A 1X9NA 3J80i 4LNQA 2JQOA 1HH2P 1A8VA 3JAMi 1HNXL 3HOWH 3FHWA 3TQYA 5GAGC 2NVQH 2JA7G 1MJEA 4RMFA 1PH3A 4QQBX 1VQ7A 3I4MH 3M4OH 1NE3A 4AH6A 1K8AC 4YY3Q 4OX9Q 4JOIA 2OTJA 2UXDQ 3A5ZB 2H5XA 2XGTA 3MEFA 5C44H 2ASBA 4A3BG 2F4VQ 4JI6Q 2VUMG 4B3MQ 3T1YL 4DR6L 3CCUA 4X66Q 1VQOA 4IPCA 3STBD 1GVPA 4X64Q 1YJWA 1SE8A 4BBSH 4BY1H 5JJLA 4AQYL 1IBMQ 4HIOA 4J15A 5BR8L 2KBNA 3CC7A 4HIDA 4DR1L 4IO9A 2E2HH 2ZM6Q 1N32Q 1YBYA 2PI2E 1VQNA 4LWCA 3PO2H 4LW1A 1KC8C 2ATWA 4BY7G 4JI8Q 5M3MG 4DR6Q 1A62A 2CFMA 2K5VA 1CUKA 4DUZL 4B3ML 3HKZE 1TWFH 1X54A 1VQIA 2JA8G 1N33L 1UEBA 3CC4A 2NVXH 4OO1G 1WOCA 4HJ7A 3UDFA 5BR8Q 1L0WA 3HOUH 1Y1VG 2N3SA 3IRBA 5HY6A 4X62L 4IJLA 2ZJPA 3S1RH 1Q81C 4NXMQ 3VDYA 3TRZA 2R93H 3S1QH 1JJCB 4A3JH 1JJGA 2YTXA 3AEVA 1PYSB 3J7A5 1WJJA 4WJ3M 1SROA 4EX5A 2OQ0A 2WAQE 4A3MH 1RIPA 1OXTA 3PF5A 1YHBA 5IP7G 3U4VA 4JI7L 5ELNA 5M5WH 4DV5Q 4DR5Q 4BA2I 3I2ZA 4NXNL 3GTMH 1B70B 3CP0A 3PIOA 4JI2Q 1KIXA 2N78A 4UP7A 1WCMG 3ULJA 2JK8A 2D62A 1E1TA 3W5OA 4DR2L 5J3BA 2JA9A 4GN5A 4QGUA 1N34L 2E2JH 4R4OA 3HOYG 4GKJL 1M1KC 4JV5L 4PG3A 4A3EG 2OWOA 2WB1E 1Q7YC 1D7QA 3GTGH 2R7ZH 4B3SQ 2A1AA 4C3IH 4DKAC 2HHHQ 4BBRG 1W2BA 4UP8A 1Y1WG 3GTPH 1K73C 1VS0A 3K0XA 1C0AA 1O7IA 4JYAL 4R1JA 4FDBA 4DV1Q 2JJQA 4R4QA 1B7YB 3CQZH 4KHZA 5GAHC 1HR0L 1XNQL 2V1CC 3AYHB 5FJ8H 4GN3B 2ZJQA 2IT1A 4BXXH 1IBKQ 3UE0A 1PH7A 2BA0A 2EQSA 4DV5L 1VQ9A 3KJOA 4L5RC 4NXNQ 1XPRA 3K80C 4A3KG 2JA5G 3I55A 3RZDH 3K7UC 3K7AH 4JI0Q 4JI8L 3FKIG 4A3GH 3U58A 4A3CG 1JB7A 1U5KA 1HZBA 1E1OA 3LGJA 1SMXA 2PNHA 1HJPA 3RZOH 4LFAL 2YYZA 3PSIA 1YJ9A 2OCEA 1MJCA 3ICEA 4Y7NH 3S1MH 3HOVG 4IFDG 4DV1L 4LFBQ 5IYDH 3F1ZA 4R4IA 2B63H 4A93G 3UE1A 4X62Q 4QY7A 1J6QA 4LFCL 1HNWL 5E7NA 5IYCH 4A3DH 1QVGA 4L5QA 1NY4A 3BU2A 3A74A 1EIYB 4DV6Q 3BZKA 4DK6C 4DV7L 4DR3Q 4B3RL 2KHJA 3CCQA 1G6PA 2EIFA 2D0OA 5C4XG 1GO3E 1L1OB 1UE1A 4K0KL 5JJKA 3CW2C 1FL0A 5FLMG 3JAMc 5C0XG 2PMZE 2DGYA 4DV0L 1PH8A 4IPHA 4A3FH 1TWAH 1Z47A 4Y52H 1KRTA 5IYBH 3J80c 3I7FA 1EFWA 4POFA 1N32L 4GNXA 2EXDA 5M5XH 2R6GA 4LUOA 5C0XI 3GTJH 3J81i 4YCVA 4JI2L 5IYBG 3SGIA 5JJIA 1A0IA 4LF6L 1XPOA 4BA1I 1KL9A 1VQGA 5C4XH 3CF5A 3ER0A 5GQOA 1JT8A 1YVCA 4UP9A 5K36G 3PUZA 3CPFA 1OXUA 3PUYA 4OO1I 4A3DG 2B3GA 3L7ZC 4GNXB 5JEAJ 4C3HH 5H1SE 2B63G 5IWAQ 4DNIA 5IYDG 4NXML 1Q82C 1G51A 3S2HH 4OWWB 1PH4A 3CD6A 5LMNW 1EUJA 1KRSA 1RL2A 3TS0A 3F2CA 1QZGA 2UXCL 4R4TA 1X3FA 2KENA 1GKHA 3GD7A 3PGZA 4HJ9A 2JA5H 3GTLH 3J7ZC 2VQEL 1TWHH 4NPSA 4X66L 2UU9L 3EIVA 2UUBL 2JE6I 4B3RQ 3A5UA 4P74A 1N9WA 4BXXG 4KHPL 4YWKA 4A3IH 1I94Q 1SR3A 3RLNA 3M9BA 4YCWA 3RN5A 1XJVA 4JI4Q 5IP9H 4JI5Q 2HT1A 4O0AA 4WJ4A 3L0OA 1T9HA 2C35B 4JI1Q 2K5HA 2UXBQ 1VCIA 1X65A 4GKKQ 2PQAA 1Y1WH 4B3TQ 1QVCA 5IT9c 4OWTB 4AYBE 2R7ZG 1V43A 1S40A 1HNZQ 5M3FG 2F52A 5IWAL 1X56A 4IPDA 1NTGA 2HHHL 3PV0A 1XMOQ 2KHIA 4GLAC 3AFPA 4GKJQ 2IX0A 1I94L 2A19A 4DUZQ 4LF8L 1VQFA 3GO5A 4H02A 2N8NA 4X65Q 2I5HA 2MO0A 4ME3A 2MNAA 4KHPQ 2VNUD 1YIJA 1WCMH 1CKNA 2K5NA 1Q8KA 2ZTEA 4AIMA 1IBKL 2JEBI 1VQAA 4QIWE 2OQKA 5C0XJ 2VW9A 1VQPA 1QUQA 3F2DA 1UE7A 4JBKA 3CCEA 1X3GA 2R92H 2JA6G 1KXLA 3KOJA 1X55A 1CKMA 4A76A 1PV4A 4GNXC 1SFOH 3PCOB 4JCVE 1NMFA 3U50C 4A3MG 4IPGA 4X65L 2LSSA 1VQ4A 3BJUA 1IL2A 2AKWB 4JI6L 4GN4B 4DV3L 1E22A 2YV5A 4A3JG 4DV2L 2R93G 3GTKH 1E7ZA 4IFDI 1R9TH 1Y1VH 2E8GA 2KCTA 1PA6A 3UDIA 4LUVA 3WWVA 4YWLA 3CCSA 4JBMA 4MNOA 1FJGL 3OW2A 1EWIA 3KF6A 1UWVA 2K75A 1VQ5A 2CKZB 3DLLA 2ZM6L 2JA8H 1GM5A 1HZCA 1TXYA 3AQQA 3A0JA 2E5LL 2K4KA 2JA6H 1N36L 2R92G 2VZAA 1YJNA 2UUAL 3D31A 2NZOA 1E24A 1NMGA 2BA1A 4LF9Q 2ID0A 1VQJA 1NJIC 4KI0A 1V1QA 4JI7Q 2Z6KA 3CCLA 1B8AA 1BVSA 2VQEQ 3PO2G 1J5EL 1PH5A 2YTYA 2XTIA 2D0PA 5FLXc 1IBLL 4DR4L 1K83H 3ULPA 2UUCQ 3CAMA 2L15A 4DV7Q 4DR3L 4HJAA 2I0QA 4DUYL 4GOPA 1UE6A 5M3FH 3EBEA
chains in the Genus database with same CATH superfamily
2LFNA 1GUNA 1VMPA 5C44B 4KY6A 3M3YH 4HSPA 5D65A 3GV3A 2LXKA 5KGUA 1PRTB 2F4VL 3KLWA 1F2LA 3BZDB 3I4MG 3PUWA 4MZ9A 2PW7A 4DAMA 3KBGA 2Z1CA 3KBXA 5LL6S 4A3KB 3HOWG 1WVLA 2K04A 3NENA 2JA6B 4L6TB 4DR7L 4FXKC 2ZXPA 1A3UA 1LTSD 2AQ3B 2WFWA 4UHVA 4PNYA 3VYTA 2DJFC 3HG9A 1A63A 1HHVA 3VYRA 1X3EA 1EOVA 4IFDJ 2ZJRA 3AU7A 4GLVB 1LYLA 3OMGA 1PFBA 2E2IH 1X32A 4GS3A 3IFDA 3K7AB 1VQLA 4ID6A 1VDZA 2M2LA 1S72A 4JI3L 2A69D 1SXTA 1HNWQ 4HIKA 3S2DH 1AH9A 1SNOA 1JMCA 1VQKA 3P20A 4TQUS 1I50B 3NK9A 2Q8TA 4KLKA 5DM63 5FLMH 2F0FA 1B2TA 4R8IA 1YEZA 3E6ZX 4P73A 3NQTA 5EKKA 2RA4A 5IYCG 1UAPA 1BO0A 1QZHA 1V9PA 3OTOQ 1PFMA 2AWNA 2WINB 2CWPA 3K57A 1B3QA 3HOWB 3RN2A 2PW5A 3FKIH 3H0GH 3E9IA 1BBUA 4RCOA 2RHQB 3LWEA 3NBHB 3PIPA 5ELBA 2N49A 2JSOA 1IYUA 1RCVD 1KAWA 1G2SA 3STBC 1H9SA 4DXGA 3VA7A 5C3XA 5I9PA 4P2CB 2I5MX 1XMQQ 4XT1B 1HZAA 5TSSA 4BBSB 3HOZG 2B29A 1BQQT 1KLGD 2D5DA 3BZCA 1Y8OB 2Z0SA 5IGEA 1A15A 3S16H 3PO3H 2VUMB 4A3BB 4LAAA 3CPWA 1SBBB 4A3EH 3CC2A 1EIFA 1S5ED 3HOYH 4XTCS 2KVMA 2RCFA 4EQ5A 1K9MC 3T53B 2Y0SE 3M7NA 4DR4Q 2SNMA 1Y1WB 1KD1C 4LFBQ 1IL8A 2DY7A 5LMUQ 1EEFD 4KTAA 2AHOB 1N33Q 2ZTDA 1WI5A 4BBRB 1Z9FA 1N34Q 2NVYH 1TWHB 3L3OC 3CMAA 1A2TA 1SRUA 5IP7H 4UAIA 1K3BC 4FF2A 4LF5Q 2MP1A 3NTHA 4ZK9B 1I3QH 4IURA 5FKAC 4LF6Q 3C3LA 1LV9A 2EYPA 1NBWA 4I7ZC 4NMZA 5LMNQ 1TKWB 1XNQQ 3PUXA 3U9SA 4GKKL 1JE5A 4RHRA 4JYAQ 4OWXB 1JOKA 1BNZA 1PYBA 1L0YB 2AWOA 4ULLA 1VQEA 1QUQB 2F0KA 3AFQA 3W2DA 4DV2Q 2PI2A 1KQSA 1QG7A 4P75A 1U4MA 1OXXK 4RG1A 3IKJA 1XMQL 1CTMA 4K14A 3HKZB 3W1BA 5KNDA 2F0HA 3G6JB 2J0TD 4TVAB 3TEHB 4V0BA 4DFAA 4DA2A 1VQMA 1BKBA 1KDBA 2PQAB 2IHEA 4O2DA 5CBEE 4JBWA 2BDNA 4WJWA 3I70A 4BY1G 4NW2A 3HOXG 1HCZA 5IGCA 2JA8B 1C8CA 3KF6B 4DV6L 3K59A 2E5LQ 1E2ZA 3H15A 5C4JH 5JEAG 4A3LG 3K58A 1N36Q 3KLSA 3URYA 2LXJA 2E2JB 2WKDA 2BDOA 2Z4IA 3GTGB 2RF4A 1ENFA 5FLXL 1YI2A 3S1QB 1MD2D 4JPBW 1F2YA 2F0MA 1Q46A 2AUJD 3J81j 3T4AC 3HKZG 3K5NA 3A7LA 1EEID 4XIGS 3I4NG 4YY3L 4OX9L 5M3MB 1D5XC 1PRTD 4C3JB 3J81c 1N8RC 3C1FA 1B1ZA 4LNQA 1X9NA 3J80i 2B2YA 1HNXL 1RHPA 2FFKB 2HD3A 3N6RA 2K1BA 2NVTB 3DWQA 3TQYA 1E0BA 2NVQH 1MJEA 4QQBX 4FNFA 4DXFA 1K8AC 2OTJA 2JP1A 3A5ZB 1NR2A 5JOBA 5CV5A 4A3BG 3SE0A 3J81E 1TVXA 2VUMG 5KYIA 3DM1A 1GVPA 2RDGA 2K6AA 2A68D 2R92B 2EJMA 3I90A 1SE8A 2SDFA 1STYA 4AQYL 1IBMQ 1TS4A 4HIDA 1CI3M 1DXMA 1YBYA 4N9PA 1VQNA 1B53A 3HRZC 1SE4A 2HCCA 4B3ML 4KD4A 4BY1B 1X54A 1VQIA 2DY8A 4ZKBB 1N33L 2JA8G 3CC4A 3BS1A 2NBFA 4OO1G 2EZVA 3NUCA 4CKBA 3UDFA 1L0WA 1GUWA 2FMMA 3HOUH 3IRBA 4NXMQ 1JJGA 3S1QH 4A3JH 4DK0A 1TS5A 4OEMB 3HOVB 1PYSB 4XDXA 4EX5A 1C4QA 4QCLA 2WAQE 3J7AV 4DNTB 1ICFB 5M5WH 2RDHA 3ULJA 5E4WC 2JK8A 2D62A 1O80A 3NTIA 2JA9A 1TR5A 4GN5A 5C4JB 4R4OA 1QWYA 2R7ZH 3DUZA 2HHHQ 5HURA 1Y1WG 1K73C 1VS0A 3K0XA 2LMCB 4JYAL 4R1JA 5DEHA 1SYEA 4DV1Q 3CQZH 1XNQL 4KHZA 5CV9A 5KEEA 4CDEC 2IT1A 4BXXH 4RA8A 1IBKQ 3UE0A 3OWEB 2NTSA 1H9RA 4NXNQ 3I4NB 5M5WB 2PYKA 1I4HA 1SMYC 1RTNA 2JA7B 1E1OA 3LGJA 3SK4A 3S2HB 1HNWL 3PSIA 4O1NA 2OCEA 1MJCA 4Y7NH 3HOVG 1QOHA 4DV1L 5I6YA 1EYAA 2F3VA 1J6QA 4LFCL 1K0SA 3T51B 5KYLA 1RTOA 3NP8A 1DONA 4CDFC 5J39A 1CA5A 1B4OA 2DGYA 4A3FH 1TWAH 2I07B 1EY6A 3I7FA 4ZRZA 5IGFA 4GNXA 5M5XH 3GTJH 1SYDA 4F87A 5IYBG 4EVOA 3FRPB 4BA1I 1B44D 1Z7TA 2Y0SB 4F88A 1YVCA 4EQOA 2SEBD 4IUPA 5AFWA 4OO1I 3MEHA 1S5FD 3L7ZC 3BVZA 4DNRB 4GNXB 5EPJA 2B63G 5IWAQ 4DNIA 2EYMA 3A55A 4NXML 1G51A 1U4LA 2F0JA 5FOBB 4IFDH 4FP5D 4HMIA 1PH4A 3CD6A 3RZOB 1ET9A 1PTOD 2WV6D 1TQOA 1RL2A 3F2CA 1QZGA 3GD7A 3PGZA 5JAVA 5EBCA 2WB1B 2JA5H 1QJOA 2KHSA 3OOCA 1VF7A 2TMPA 4G4KA 1SFOB 4K6DA 2K5QA 1CHQD 1EYCA 2UUBL 3A5UA 3CU7A 4LMQD 4YWKA 5KNCA 1I94Q 1SR3A 2MJ8A 2HT1A 1TWAB 2RSNA 2K5HA 4JI1Q 2J4XA 5CMDA 5IOCA 5IT9c 2K28A 2EYOA 1F9SA 5ELEA 1X56A 1NTGA 4MIUA 3NWTA 2NZ1D 3AFPA 1I94L 2A19A 3BVGA 2CVRA 3GO5A 4G7ZC 1CQFA 1LT4D 2K5NA 4AIMA 1VQAA 1D1IA 4ME5A 2VW9A 1VQPA 3H3VC 4KKTA 1UE7A 2KECA 2JA6G 2RSOA 3KOJA 3LWUA 4A76A 3K5MA 1WTVA 2P5ZX 2F0SA 2BE5D 1SNCA 3U50C 4X65L 4M8AA 1MSHA 5C4ZA 3Q22A 4JI6L 3DEPA 4GN4B 4XQQA 4IZ8A 1R9TH 2K33A 2E8GA 2IL8A 1HPCA 5C4HA 3CCSA 4MNOA 2HDMA 1UWVA 3FVQA 2XWJB 3DLLA 3L9AX 5I4DA 1KAAA 1GM5A 1WTXA 2E5LL 2CHBD 3S9WA 4S3SA 2VZAA 4LF9Q 1ENCA 2ID0A 3DWAA 3GV6A 4JI7Q 2Z6KA 3S1NB 3FEWX 1TY0A 2VQEQ 4V190 2YTYA 2RVLA 2I0QA 5EQ0A 4GOPA 3TP7A 2K7VA 4X6AH 1P16A 3PIP3 1J5EQ 4E6IA 3NBHA 5IP9G 1UE5A 5IGDA 1F77A 1SE3A 2QEJC 5I2XA 4A3IG 2Q2UA 2VB3X 1M90C 3MXPA 2JA7H 3P1HA 2NTTA 2JEAI 3VA5A 2IHFA 2VQFL 4C56C 1YNXA 1YNJD 4PV1C 3T1HL 4CJ2C 2NN6G 1PTOH 4LF5L 1NNXA 3ERQA 3S14B 1STHA 1IZ6A 3UDGA 3AB9A 2R7ZB 3SK6A 4G57A 4J1MA 4IOCA 4AYBG 1BCPF 3QO2A 1Q12A 1K3RA 1XNRL 5ELCA 5IE8A 2F0WA 2KQ3A 2L4NA 2K52A 3QIAA 4IQZA 4EGVA 3U4ZA 2ICIA 1S3OA 3M4QA 3KF8B 4OHJA 3G48A 3VR2A 2Y0SG 2ALYB 2BH2A 1K8GA 1TWCH 3Q0AA 2C9OA 5F2DA 1U4PA 4A93H 1NR4A 2F3IA 1R4PB 3J80E 2B63B 1BCPD 2XSCA 4LK1C 3GTOH 3CMEA 1SSOA 2PZUA 1PYWD 4KY7A 2MO1A 4A3GG 1L0XB 3E5SA 4DR2Q 4B3TL 5AJ3Q 2CCZA 1HZ9A 2VL6A 2HIXA 3K8AA 2UXBL 4L5TA 1TWGH 1HUMA 5FJ8G 2QKIC 3G71A 4KY5A 2OXPA 2HQEA 5ELOA 4LF7L 3WOEA 3HFZB 4BBRH 1L2FA 4JOIC 2WIIB 2K14A 1G291 2R61A 4K8JA 1JORA 3M3YB 4YHHL 3I56A 1QNKA 4LFCQ 2F0UA 4BS9A 2Q8IB 4A93B 1QCBD 2EYLA 4JBJA 2A73B 4DUYQ 1IKLA 4IUUA 4DK3C 4JG2A 1Q3LA 4KKSA 1ZEQX 2UUCL 3PF4A 1DZ1A 2A6ED 5AJ3L 3QR8A 4CGYB 4KN4C 1II3A 3M4YA 1EY0A 4CHTB 4K6LA 2CWAA 2HQLA 4HJ8A 1XPUA 5E4XA 3Q8DA 1FJGQ 3J81L 1STEA 1OXSC 2MPMA 2WP8J 3NEMA 4PQXA 5JPNC 5JPMC 3KYHC 1LUZA 4MTKA 1QVFA 2G9HD 1MHWC 1G8ZD 3DXJC 3SK5A 3QOLA 3Q23A 1HR0W 3TS2A 2YTVA 3UDXA 2A8VA 5GROA 4XQJA 1LTLA 4NKLA 1F9RA 1SDFA 4LFAQ 3T16A 1NCVA 5HGTA 2IWHA 2RKSA 1S4ZA 4QUCA 4DN4M 4P72A 3A56A 4DR5L 3DWPA 3ONAB 3EFXD 1SN8A 2F0LA 1I4GA 1YZ6A 5CV6A 5FLXE 4BBSG 1HA6A 1AEXA 1FGUA 1PZID 2OTLA 3CCRA 3F8TA 2RHSB 2PZWA 1EY5A 3TP6A 3B6YA 4CBVA 3NQIA 3ERSX 5FK9C 2F0TA 3SVMA 3E0JA 1FYCA 4JI4L 1EY9A 3H6MA 5CV7A 5JVG3 2BCOA 3GDEA 4RFBA 2NN6H 4PZ8A 4DV4L 2DNEA 1HH2P 2B2UA 5C5MA 1XTCD 2JA7G 3HGBA 1VQ7A 1EL0A 2E2HB 4JOIA 1PLFA 2WACA 1R9TB 3TP5A 4DR6L 1YJWA 4IPCA 3STBD 4X64Q 2RDFA 2CW0D 4BBSH 4J15A 2KBNA 4KK7A 4X3UA 1YNND 3M4OB 1H9SB 1GUTA 3EJIA 4LWCA 2LY7A 4LW1A 4LJZC 1RKNA 3V2TA 5ELDA 4DR6Q 2CFMA 2K5VA 3VYSA 4DUZL 1Q8IA 1JC7A 3HKZE 3FKIB 1UEBA 5EKLA 3FDTA 5IT9L 1RODA 4TRDA 1WOCA 1EYDA 3IAYA 1EY4A 4HJ7A 4AYBB 5BR8Q 1A6XA 4X62L 2K5WA 4RGNA 3PMFA 3AEVA 5IGGA 3I91A 1WJJA 3FPUB 4TKOB 1U9RA 4K2LA 4K2KA 5FO9B 1RIPA 2EPBA 3PF5A 3F2UA 3U4VA 4RGOS 4RWSC 1I6HB 1B70B 3CP0A 4UP7A 1ENAA 4QGUA 2E2JH 5BN4A 1M1KC 1RJTA 3JAME 3TBIB 4DKAC 1EIGA 4BBRG 1W2BA 4UP8A 1KNEA 1W6KA 3V05A 3O13A 1ESRA 3FPPA 4FDBA 4R4QA 2E76C 1B7YB 1JWUD 2X69A 5FJ8H 1ESFA 3BDLA 1VQ9A 5D3IB 3KJOA 1XPRA 3W3AA 2ICEC 2KUMA 2JA5G 4RH6A 3RZDH 4JI8L 4A3GH 5T1GA 3U58A 5CV4A 1U5KA 5I6WA 3S1MH 4GKJQ 1FNUA 4IFDG 1SMYD 1CZGA 3F1ZA 4R4IA 2B63H 3C46A 4A93G 4X62Q 4KJOA 2FINB 1WTPA 1JICA 5E7NA 4L5QA 3BU2A 1EIYB 4DV6Q 1DJRD 4B3RL 2Z6BA 4K0KL 3JAMc 1Z47A 5CV8A 2DNCA 1KRTA 5IYBH 1EFWA 5C0XI 4LUOA 5C3WA 1KL9A 2PZTA 3V96A 2WAQB 1VQGA 3CF5A 3ER0A 3WOFA 4UP9A 2A5HA 1SNQA 1KABA 5JEAJ 1ZKOA 5IODA 2N88A 4F7XA 4ODGA 3S2HH 5NUCA 1RD9D 2OEOA 1KRSA 2Z9HA 1EFID 1GKHA 4G7HC 4HJ9A 2CH4A 4OGQC 1IW7C 1LT6D 3ND9A 3GTLH 3I72A 4NPSA 3OMCA 4X66L 1E2VA 1I3QB 1E2WA 3H94A 4P74A 4BXXG 4KHPL 2B2WC 4A3IH 3RLNA 4FVMA 1XJVA 4JI4Q 5IP9H 4O0AA 3OIPA 3L0OA 1STNA 2IX3A 4K5WA 1EU3A 1Y1WH 1QVCA 4OWTB 2QDLA 4XYOA 3MWYW 3TP8A 5JVH3 1S40A 2R7ZG 1U4RA 3RUZA 2HHHL 3GTPB 3D4DA 2EOTA 4H0LC 4DUZQ 3KLSX 1HXYD 2MHVA 1YIJA 3PO3B 2JEBI 1HRJA 1JQYD 1GHJA 4RKLA 3BYTB 3BDCA 1SFOH 4JCVE 1AFPA 2K01A 1TY2A 4XQNA 1O7YA 2LSSA 2QW7A 4IALA 2LS01 4A3JG 4DV2L 1E7ZA 4IFDI 2FMCA 2EYJA 1BR9A 4DK1A 3WWVA 5J22A 1FJGL 4X3TA 2L0CA 2JA8H 4A3GB 3C1EA 4WRDA 3A0JA 2JA6H 1N36L 1YJNA 2L1BA 2UUAL 1E24A 2BA1A 1PTOF 1VQJA 4ZKCB 4KI0A 1FGBD 5D14A 1B8AA 1J5EL 4F8MA 1IBLL 1AN8A 5FLXc 1EY7A 4RHSA 1LTRD 2UUCQ 3LNNA 4FF1A 4DV7Q 2L15A 4DR3L 2B2VC 4DUYL 1UE6A 3EBEA 2AUKA 3G4SA 1UUPA 4YIJA 4DAYA 4YHHQ 1OTCA 3S17B 2BH8A 1S5BD 1PH2A 2K05A 4A3BH 2NZHA 2A68C 2B39A 5CGKA 4LUZA 4MTNA 3Q24A 3SDZA 1MSGA 2NVTH 1TS3A 3KLRA 2NN6I 2UUAQ 1I6HH 1MI2A 1CZWA 4PZ7A 2DUDA 1HNXQ 2BE5C 2X6GA 3I4NH 4GZYC 2G5DA 4KN7C 4K0KQ 2F0VA 1I5FA 2IW3A 4UY8C 3S2DB 2F4IA 2A69C 3KF8A 1I4PA 4JV5Q 1MIUA 2CQOA 1HNZL 1T5XD 2ZTCA 3EQLC 4PZ6A 1PMRA 2QDBA 1L1OA 1LM0A 3ULLA 4A3LH 4UPAA 1F9QA 2EJGC 1ML0D 4ZUIA 2PNRC 1A3VA 4ALPA 5IY0A 3NELA 3HOXH 1ICWA 4A3FG 4MN3A 3T56B 4A3FB 2KEEA 2DJGC 3CCMA 3G6EA 4FXGC 4JI3Q 2UXCQ 4FO2A 4LF4Q 5EKIA 3RNUA 4C2MH 1SLJA 1XNRQ 2PPBC 3S1MB 1YNNC 2E2DC 4DV3Q 4B3SL 1E3PA 2EY1A 3HOVH 3MXUA 1K0RA 3MC0B 3R2IA 3I3CA 3FMCA 1BXTA 2O4XA 4LF7Q 2ES2A 3R2TA 3D0FA 4JBKA 1CQVA 1KHIA 4U673 3MA2B 2B2VA 3KK7A 2F0GA 4P71A 4K5XA 3T1HQ 1H95A 1XX8A 2GN5A 2Q2TA 3DEOA 4OONA 3S24A 1FVIA 1SYGA 3DHQA 5BN3A 2Q2HA 1DOMA 4QJFA 4LF8Q 5LMUL 3ZJYC 4QF4A 2V4DA 4HEDA 3EROA 1VQBA 3S17H 4IUTA 1C48A 1Y14B 2VS1A 1BUVT 1MKHA 1CKNB 3PO3G 4HIMA 1Z6HA 1NUCA 1I4RA 4POGA 1Y8PB 4JI5L 3HOZH 1BCPB 3D3RA 4ZQ3A 3HOXB 2YU9B 3HEJA 1SYFA 4DF7A 2F1MA 1YITA 4MHEA 3I73A 5M5XB 3L2PA 3GTJB 2A6HC 1AZPA 1JWSD 4QL5A 3SR1A 2ZT9C 4DAVA 1DGSA 4I7AA 1EU4A 3NSWA 4HN7A 2QCPX 3VR5A 1JWMD 3W1GA 1HR0Q 1W6JA 3H3VH 2F0QA 2MQHA 5IGBA 3H0GG 1IYJB 3A54A 1SYCA 2KCNA 1EYGA 3HOUG 2BOSA 5C3EB 3M85A 1KTKA 1HQMC 5IIFA 4OO1H 3E0EA 1X6OA 1XMOL 5DNFA 1AW7A 2Q8RE 4ZYSA 2ZXOA 4N9TA 1TS2A 3IFTA 4YWMA 3QG1A 1A3TA 4JC0A 1GXDC 2E75C 5J1ZA 1PHJA 1VQDA 3OPOA 1XTDA 1ONLA 3SHLA 2EJFC 1V1PB 1EQQA 3GTMB 3S1NH 1IYVA 5KIXA 1QE6A 2EY2A 3CQZB 1IXRA 1JJ2A 2WAQG 3K5OA 3OYYA 4QIWB 4R4CA 2VUMH 3VR3A 3ZYYX 1PZJD 3EN2A 1R4QB 3ND8A 3SK8A 1LACA 3X3NA 4JW0A 1WTWA 1PH1A 3K81C 1S5DD 3EVQA 3KDFA 4KD3A 4NDXA 3JC66 5M5YH 2NVQB 1I6VC 1PFSA 3MXNB 4K5VA 1M8AA 1WD0A 4CKCA 2NYZD 3I4LA 1ASZA 4QB4A 2L55A 1DD2A 2FHTA 3HOWH 2DN8A 2KJXA 5GAGC 1I4QA 1PH3A 3I4MH 3RMHA 4YY3Q 4OX9Q 2UXDQ 2H5XA 2XGTA 1V1OA 2ASBA 3D8GA 2F4VQ 5JEAH 4TSSA 2OF1A 3CCUA 2A74C 2GA4B 5CORA 4BY1H 5JJLA 4HIOA 5BR8L 1FD7D 4IO9A 2H1EA 2ZM6Q 2PI2E 1HA5A 1VMCA 3PO2H 3MFYA 2K03A 4WFN3 3P75A 2XIWA 2ENBA 1A62A 3MZ5A 4Z9CB 3CHBD 1NSNS 1CUKA 1EIHA 4CDDC 1TWFH 1HFNA 5COYA 2NVXH 4RCNA 4CJ1B 2PMZB 2N55A 1B3AA 1CK1A 1Y1VG 3BG3A 2ZJPA 3S1RH 1DYQA 3VDYA 3TRZA 2R93H 4KV6A 2YTXA 3J7A5 4WJ3M 5EBDA 3X3MA 1OXTA 5ISRA 1BBXC 1YHBA 5IP7G 5ELNA 4BA2I 3D4WA 4NXNL 3GTMH 1UEAB 4JI2Q 4B9XA 1KIXA 5ELFA 1WCMG 3MXNA 4DR2L 1LTTD 1N34L 3HOYG 1TWCB 3NHHA 4PG3A 4QUFA 4A3EG 2OWOA 3GTGH 4B3SQ 3N52A 5L37A 1WTHA 1O7IA 5E1FA 2JJQA 1HR0L 5GAHC 1GUOA 2ZJQA 1PH7A 4DV5L 2EQSA 4L5RC 1EZ8A 1JCKB 2KCCA 5EJWA 5A2QE 3I55A 4JI0Q 3FKIG 1B9NA 1JB7A 1ILQA 3RZOH 5M5YB 1SMXA 1WD1A 4LFAL 3ICEA 1BOSA 4IUNA 5IYDH 3OW7A 3UE1A 4KJNA 3HS0C 3MTSA 2B2UC 5IYCH 4A3DH 1QVGA 1D5ZC 3A74A 2CQAA 4FF4A 1H9JA 5K36H 4DK6C 2XRQD 1OO9B 2KHJA 5C4XB 5C4XG 1GO3E 2AQ2B 1G2TA 1WTOA 5JJKA 5FLMG 1FL0A 5C0XG 4Q5VA 1PH8A 1LLRD 3HZXA 4POFA 2R6GA 5DM73 4JI2L 3SGIA 1A0IA 2CW0C 3QWNA 3A8KE 5GQOA 2Z8LA 2SNSA 1JT8A 3PIO3 3VR4A 3PUZA 3NPPA 2B3GA 1PDQA 4FXDA 4A3EB 1STBA 1GOZA 4HAEA 1XYIA 1Q82C 3GP7A 2F0EA 1G6ZA 5LMNW 1EUJA 1VF5C 2UXCL 1AZQA 1MBYA 1J9OA 3J7ZC 1GJXA 1TWHH 2F0IA 2NWGA 1LT3D 3EIVA 3QB3A 4ZUJA 2JE6I 4B3RQ 1IKMA 1KDCA 2EE1A 3M9BA 1T5EA 3A8JE 3JAML 2UXBQ 2PQAA 4B3TQ 4C3IB 1H9MA 2MGSA 4HTHA 4AYBE 4C3IG 3D6WA 3OWFA 4HCSA 1V43A 2XRSD 1EQTA 5IWAL 4IPDA 2H4OA 1XMOQ 4N8X1 4GLAC 2IX0A 1VQFA 4X65Q 2I5HA 2MO0A 4ME3A 2VNUD 1Q8KA 4RAUC 5G3LF 4XXEA 4QIWE 2OQKA 1QUQA 2L9HA 3CCEA 4C1NK 2Z4HA 5D3DA 1X55A 1CKMA 1PV4A 5K5PA 4GNXC 1NMFA 2EY5A 1V8QA 4A3MG 2B2TC 3NTKA 3QJYA 1XXGA 4N8FA 3BDOA 4U68A 3GTKH 3S15B 2F0PA 1GUGA 2KCTA 3D6CA 4FF3A 4LUVA 4YWLA 4JBMA 3J7AF 3S1RB 1EWIA 4L8JA 4XYQA 1HZCA 1D5MC 4UDUC 1A2UA 1J8IA 3MXGA 2R92G 3G7LA 1NJIC 1V1QA 1BVSA 4HMJA 1PH5A 2QF7A 2XTIA 2D0PA 4DR4L 1K83H 1IHZA 3CAMA 2XWBB 4ZAIA 2JYOA 5M3FH 1SJED 1CHPD 3S16B 2VQFQ 1I4XA 1Y8NB 2M9VA 2QGQA 2MFIA 3NXWA 3OIQA 3RR5A 3T1YQ 1H9KA 2R93B 1VQ6A 5KRUA 1GD7A 1K28A 3S14H 1QNUA 2K5DA 4A4IA 2RQXA 1RDPD 4LF9L 4OXPA 1ILPA 4DPGA 1TWGB 1F2MA 3CCVA 2VXWA 4H7BA 1L1OC 5M9OA 2EVBA 1SAPA 2GVAA 3Q6SA 1GUSA 3IL8A 4X64L 1LTID 4RGTA 2GVBA 2FJ2A 1U0LA 5DAUA 3GTOB 3KFUA 3MAQA 1Q1BA 2D2CC 4C3HG 4IOAA 1D8LA 1PVOA 2F0OA 2OT2A 3HOUB 5C3EG 4R8NA 3TZUA 2EDGA 3HOYB 3E3XA 4A75A 1CKOA 3RLFA 1STAA 1EQRA 1FR3A 3H91A 2HCIA 1JOQA 4OELB 3SXHA 2PO4A 5IT9E 1PH6A 2X6LA 3SEBA 4DV0Q 1BBWA 1D1KA 1VQ8A 4HJ5A 5HGQA 1Q86C 3R8BA 2IX1A 3K6OA 4K8IA 2HIVA 4JK1C 4AQYQ 1IBML 2F0DA 3DM3A 2SOBA 3RD4A 1EWCA 4Y7NB 3CRKC 1CM9A 1WYDA 3TN2A 1Y1VB 1W3SA 2EYHA 4YCUA 2Q2IA 1JE4A 4NP5A 5FO7B 3KJPA 1YHAA 2KA7A 3PQIA 3MVVA 3TREA 5DLQE 2F03A 2Z6KC 2UUBQ 4A3CH 3RLOA 1TWFB 1K8OA 2NB0A 2A6HD 1DCZA 2R7DA 4A3KH 2XN9C 3GTQB 2IJ0A 4JI1L 3H3VI 4DR7Q 4GOPC 3A8IE 1HFGA 4KMUC 4C3JH 1X3QA 4DAYB 5GAEC 2B2YC 5GADC 1P8LA 2KCMA 3M4PA 3DMUA 1CSQA 4OL7A 1CT1D 3HP3A 3E9HA 4IJHA 1ZYRD 3KDFB 2RCNA 3OSOA 2UXDL 2J7ZA 2R7FA 1UNSA 2L11A 3UI2A 1M4VA 1KDAA 3OTOL 2AMCB 3ITPA 3PUVA 1BDOA 1VQCA 3J7YW 3D4RA 2QEXA 2IY5B 4B9WA 5LL6X 2QA4A 1Q1EA 1SEBD 3R3OA 1YHQA 4NB3A 1PTOC 5C6AA 4L5SA 2UU9Q 4C3JG 3TDQA 4HSVA 4ZLTF 3I4OA 1CSPA 4A3MB 2A6EC 2VY3A 1O7LA 2ZXRA 5G3LD 3CCJA 1ZXTA 2O5JC 5I9OA 2B2WA 4ABNA 1X3PA 3F2BA 1IBLQ 3HKSA 2O2LD 1LTBD 2WB1G 4APVA 2K50A 4GOPB 1PTOB 4G7OC 1OXVA 4R9WA 5C5LA 1C9OA 1VQHA 2FXQA 1V1PA 4EQPA 5M3MH 5LMNL 1EY8A 4BY7H 1WCMB 3BVMA 1DOLA 2CH4W 4H13C 4ZCKA 3K5LA 1PH9A 5CYUA 1I50H 4GLXA 2O5IC 4DV4Q 2NVYB 1WFQA 1WTRA 4I65A 2EY6A 4PMWA 1SJHD 1JOOA 2K32A 1WTQA 4LFBL 1NAPA 5EAYA 4BY7B 3NE5B 4DU9A 4RKBA 4B08A 4DR1Q 5C44G 2I5LX 3T13A 1BCPC 3FP9A 3S15H 3GTKB 1JB3A 5C3EH 2NUCA 1K8MA 1KNAA 4CDCC 4BWGB 4LF4L 1IW7D 1AE2A 1C7YA 4CJ0B 1SE2A 4JI0L 3QOJA 2TSSA 5I2YA 3WDNA 5EGTA 1ASYA 4C2MB 3CXCA 1BF4A 1AE3A 4O42A 1DM0B 2JQOA 4KHVA 1A8VA 3M7GA 3JAMi 4DAPA 3FHWA 3H0GB 4RMFA 4XT3B 1NE3A 4AH6A 3M4OH 4J6HA 2B8FA 2B8GA 3MEFA 1PZKD 5C44H 4JI6Q 1EOTA 4B3MQ 3T1YL 2I46A 4A3DB 1VQOA 4X66Q 3AMUA 5CBAE 4H44C 3BYYB 3CC7A 4DR1L 2HDLA 2E2HH 1N32Q 1QB5D 5CR3A 1KC8C 2ATWA 4BY7G 4JI8Q 1YNJC 4IN3A 4OIKA 5M3MG 4IUVA 4PMCA 1TU2B 1LTAD 1LO5D 2JA5B 2L5TA 3I8ZA 3R93A 3TMEA 2E2IB 2N3SA 5HY6A 1Q81C 4IJLA 2AQ1B 1JJCB 1FNVA 4C3HB 3VYUA 1PRTF 1SROA 2OQ0A 2WKCA 4QMGA 4A3MH 1S5CD 1STGA 4Q0FA 2XNAC 4JI7L 1GHKA 4DV5Q 4DR5Q 3I2ZA 3PIOA 3TSSA 5FO8B 2N78A 3CRLC 4HR7B 2JN4A 4DGZA 2VB2X 5A2QL 1XWEA 1HTLD 1E1TA 2MUYA 3W5OA 5J3BA 4GKJL 1G91A 4JV5L 2WB1E 1Q7YC 1D7QA 2A1AA 4C3IH 5E3FA 3GTPH 1HUNA 1C0AA 3P7JA 2V1CC 3AYHB 4GN3B 3A7AB 2BA0A 4RGMA 2LKVA 3K80C 2JXMB 4A3KG 1MGSA 2XVSA 3K7UC 3K7AH 3NWSA 4A3CG 1HZBA 1CFMA 3MFGA 2PNHA 1HJPA 2YYZA 2G9DA 1YJ9A 1PRTC 4QY7A 1B9MA 1TT2A 2EXZA 2PQEA 1NY4A 3C2PA 1LABA 3BZKA 4DV7L 4DR3Q 5EPKA 3CCQA 1G6PA 2RBMA 2EIFA 2D0OA 1L1OB 1UE1A 5M3FB 3I4MB 3CW2C 3EA6A 4DV0L 2PMZE 2YU9H 4Y52H 4IPHA 4ILWA 2C5CA 3J80c 5LHY1 1N32L 1FNWA 2EXDA 1F9PA 1ZYRC 3J81i 4YCVA 4C1NI 5JJIA 4LF6L 1XPOA 3K0YA 2L12A 4KKUA 5C0XH 5C4XH 3OHXC 5K36G 1Y69U 4X3SA 3CPFA 1OXUA 3PUYA 4IUQA 4CKEA 4A3DG 1SNMA 2PCFB 2B2TA 1LT5D 2KEDA 5H1SE 4C3HH 3H09A 2QILA 5A35A 4JVZA 5IYDG 4X3KA 4OWWB 5EPLA 3GQBA 1PFNA 3TS0A 3J80L 4R4TA 1X3FA 2KENA 3MHBA 5CC4A 1SYBA 2VQEL 5JJZA 1DOKA 1RF2D 5BN5A 2UU9L 1KLUD 4A3JB 1N9WA 4JI5Q 4YCWA 3RN5A 4WJ4A 1T9HA 2C35B 1VCIA 1X65A 4GKKQ 4OIJA 4FYDA 1TIID 1HNZQ 2M00A 2F52A 3KUPA 5M3FG 3PV0A 1CA6A 2KHIA 1SNDA 1PXUA 4LF8L 1Q90A 4A3IB 2MNAA 4H02A 4KHPQ 2N8NA 2IPKD 3CKIB 1B50A 1WCMH 1CKNA 2ZTEA 1IBKL 1ET6A 5C0XJ 1AP0A 4PMBA 3F2DA 1EQVA 1SNPA 5T1IA 3GTLB 1LTGD 1X3GA 2F3WA 3RZDB 2R92H 1KXLA 3PCOB 2E74C 1HTPA 4IPGA 1VQ4A 3BJUA 1EZ6A 1IL2A 2AKWB 4EQNA 4WORA 2F0NA 1E22A 2YV5A 4DV3L 2HUGA 2R93G 1HQRD 2EYFA 4M1UB 1QILA 1Y1VH 1D2BA 4J8QA 4L63B 1F2ZA 2R3ZA 1PA6A 3UDIA 2NVXB 3OW2A 3KF6A 1JR0D 1K83B 2K75A 1VQ5A 2CKZB 2ZM6L 1O78A 1TXYA 3AQQA 2D9UA 2K4KA 3GTQH 3D31A 2NZOA 1NMGA 1D6EC 3LX0A 3CCLA 3PO2B 1O7ZA 3PO2G 3VR6A 3NBIA 3U9OA 2KOLA 4HCEA 3ULPA 3TZDA 3HOZB 1EWHA 4HJAA 5KNBA
chains in the Genus database with same CATH topology
2VQFQ 4YHHQ 1OTCA 2BH8A 2QGQA 2MFIA 1PH2A 1P16A 4A3BH 4X6AH 2NZHA 3RR5A 3T1YQ 3M3YH 1J5EQ 5IP9G 1UE5A 2LXKA 1VQ6A 2F4VL 3KLWA 4LUZA 4MTNA 4A3IG 1GD7A 3I4MG 2Q2UA 3S14H 1M90C 2JA7H 3PUWA 4MZ9A 2JEAI 4A4IA 2NVTH 2IHFA 4DAMA 3HOWG 2VQFL 2NN6I 2UUAQ 4LF9L 3NENA 4OXPA 1YNXA 3T1HL 1I6HH 4DPGA 4DR7L 4PZ7A 3CCVA 2NN6G 2DUDA 1HNXQ 1L1OC 2GVAA 2WFWA 4LF5L 4X64L 3I4NH 2GVBA 1A63A 4K0KQ 1U0LA 1I5FA 1IZ6A 1X3EA 3KFUA 4UY8C 3UDGA 1EOVA 1Q1BA 4IOAA 1PVOA 1D8LA 4IFDJ 2ZJRA 4JV5Q 1MIUA 4GLVB 2CQOA 1LYLA 1HNZL 2E2IH 2ZTCA 5C3EG 4GS3A 4IOCA 4PZ6A 4AYBG 1L1OA 4A75A 1LM0A 3ULLA 1VQLA 1Q12A 1CKOA 1K3RA 3RLFA 4A3LH 1XNRL 1S72A 4UPAA 4JI3L 1EQRA 5IE8A 4ALPA 5IY0A 1HNWQ 4HIKA 3NELA 3S2DH 1PH6A 3HOXH 1JMCA 2K52A 1VQKA 1AH9A 4DV0Q 1BBWA 4TQUS 3U4ZA 4A3FG 1VQ8A 4KLKA 1S3OA 4HJ5A 3M4QA 5HGQA 5FLMH 1Q86C 3KF8B 1YEZA 2IX1A 3G48A 4P73A 3CCMA 3G6EA 2Y0SG 4JI3Q 2HIVA 2UXCQ 4LF4Q 4AQYQ 1IBML 3RNUA 2ALYB 2BH2A 3DM3A 4C2MH 1K8GA 1SLJA 1XNRQ 5IYCG 1TWCH 1WYDA 1QZHA 4A93H 1W3SA 1V9PA 2F3IA 3OTOQ 4YCUA 2Q2IA 1E3PA 2AWNA 4DV3Q 4B3SL 3HOVH 3KJPA 1YHAA 2CWPA 1K0RA 3TREA 5DLQE 3RN2A 3GTOH 2Z6KC 2UUBQ 4A3CH 3CMEA 3RLOA 3FKIH 2MO1A 3E9IA 1BBUA 3H0GH 2ES2A 4LF7Q 4A3GG 4DR2Q 3D0FA 2RHQB 4B3TL 2R7DA 3NBHB 5AJ3Q 3PIPA 4A3KH 1HZ9A 2N49A 2VL6A 2CCZA 2HIXA 1KHIA 3K8AA 4JI1L 3H3VI 4DR7Q 2UXBL 4L5TA 1TWGH 4GOPC 1KAWA 3STBC 4C3JH 4DAYB 4P71A 5GAEC 5FJ8G 3T1HQ 1H95A 5GADC 1P8LA 3G71A 2GN5A 2KCMA 5ELOA 2I5MX 3M4PA 1XMQQ 2Q2TA 4OONA 3S24A 1HZAA 4LF7L 1FVIA 1CSQA 2B29A 3HOZG 2Q2HA 3E9HA 3HFZB 4QJFA 4IJHA 3BZCA 3KDFB 4LF8Q 2Z0SA 2RCNA 5LMUL 4BBRH 3S16H 1L2FA 3ZJYC 3PO3H 2UXDL 4JOIC 2R7FA 2K14A 1VQBA 1G291 3OTOL 3CPWA 2AMCB 3PUVA 4YHHL 3I56A 4A3EH 3CC2A 1EIFA 1Y14B 4LFCQ 2VS1A 1VQCA 3HOYH 2IY5B 2QEXA 4XTCS 1CKNB 1MKHA 3PO3G 4JBJA 4EQ5A 4HIMA 1K9MC 4POGA 3S17H 2Y0SE 4DUYQ 2QA4A 3M7NA 4DR4Q 1Q1EA 4JI5L 4JG2A 4DK3C 1KD1C 2UUCL 2YU9H 5LMUQ 3PF4A 5AJ3L 1YHQA 3HOZH 1N33Q 2AHOB 4NB3A 2ZTDA 1WI5A 1Z9FA 4L5SA 2UU9Q 1N34Q 2NVYH 3CMAA 1YITA 1SRUA 5IP7H 3L2PA 4LF5Q 4QL5A 1I3QH 1DGSA 2CWAA 2HQLA 4LF6Q 4HJ8A 1XPUA 3I4OA 1CSPA 1NBWA 5LMNQ 3Q8DA 1FJGQ 3W1GA 1HR0Q 2VY3A 3PUXA 1XNQQ 4GKKL 3H3VH 2MQHA 1JE5A 1IYJB 1OXSC 3H0GG 4OWXB 4JYAQ 1PYBA 3CCJA 2WP8J 3NEMA 1EYGA 3GTQH 3HOUG 2AWOA 3M85A 1VQEA 3KYHC 1LUZA 1QUQB 3AFQA 4DV2Q 2PI2A 3F2BA 1IBLQ 3HKSA 4P75A 1KQSA 1QVFA 1OXXK 2WB1G 4APVA 3E0EA 4RG1A 1X6OA 2K50A 4GOPB 1XMQL 1XMOL 1HR0W 1OXVA 3TS2A 2YTVA 1C9OA 3UDXA 1VQHA 3W1BA 2A8VA 5GROA 1LTLA 2FXQA 4YWMA 5M3MH 5LMNL 4BY7H 4JC0A 4TVAB 3TEHB 4LFAQ 1PH9A 1PHJA 1I50H 4GLXA 1VQDA 1VQMA 1XTDA 4DV4Q 1BKBA 2PQAB 1WFQA 2IHEA 4O2DA 4P72A 4DR5L 4JBWA 4PMWA 1SN8A 4BY1G 1EQQA 1YZ6A 3HOXG 3S1NH 4BBSG 1FGUA 1IXRA 3KF6B 1JJ2A 2OTLA 4LFBL 3CCRA 3F8TA 2WAQG 5EAYA 4DV6L 2RHSB 2E5LQ 3H15A 5C4JH 3OYYA 5JEAG 2VUMH 4R4CA 1N36Q 4A3LG 3B6YA 4DR1Q 5C44G 2I5LX 2LXJA 3EN2A 3FP9A 3S15H 3ERSX 5C3EH 2RF4A 1PH1A 3K81C 1YI2A 4LF4L 3KDFA 1Q46A 1AE2A 3JC66 5M5YH 1C7YA 1PFSA 3MXNB 4JI0L 3J81j 4JI4L 3HKZG 1ASYA 4XIGS 3I4NG 4YY3L 4OX9L 3GDEA 3CXCA 3J81c 1ASZA 3G4SA 1N8RC 1AE3A 4DV4L 4PZ8A 1X9NA 3J80i 4LNQA 2JQOA 1HH2P 1A8VA 3JAMi 1HNXL 3HOWH 3FHWA 3TQYA 5GAGC 2NVQH 2JA7G 1MJEA 4RMFA 1PH3A 4QQBX 1VQ7A 3I4MH 3M4OH 1NE3A 4AH6A 1K8AC 4YY3Q 4OX9Q 4JOIA 2OTJA 2UXDQ 3A5ZB 2H5XA 2XGTA 3MEFA 5C44H 2ASBA 4A3BG 2F4VQ 4JI6Q 2VUMG 4B3MQ 3T1YL 4DR6L 3CCUA 4X66Q 1VQOA 4IPCA 3STBD 1GVPA 4X64Q 1YJWA 1SE8A 4BBSH 4BY1H 5JJLA 4AQYL 1IBMQ 4HIOA 4J15A 5BR8L 2KBNA 3CC7A 4HIDA 4DR1L 4IO9A 2E2HH 2ZM6Q 1N32Q 1YBYA 2PI2E 1VQNA 4LWCA 3PO2H 4LW1A 1KC8C 2ATWA 4BY7G 4JI8Q 5M3MG 4DR6Q 1A62A 2CFMA 2K5VA 1CUKA 4DUZL 4B3ML 3HKZE 1TWFH 1X54A 1VQIA 2JA8G 1N33L 1UEBA 3CC4A 2NVXH 4OO1G 1WOCA 4HJ7A 3UDFA 5BR8Q 1L0WA 3HOUH 1Y1VG 2N3SA 3IRBA 5HY6A 4X62L 4IJLA 2ZJPA 3S1RH 1Q81C 4NXMQ 3VDYA 3TRZA 2R93H 3S1QH 1JJCB 4A3JH 1JJGA 2YTXA 3AEVA 1PYSB 3J7A5 1WJJA 4WJ3M 1SROA 4EX5A 2OQ0A 2WAQE 4A3MH 1RIPA 1OXTA 3PF5A 1YHBA 5IP7G 3U4VA 4JI7L 5ELNA 5M5WH 4DV5Q 4DR5Q 4BA2I 3I2ZA 4NXNL 3GTMH 1B70B 3CP0A 3PIOA 4JI2Q 1KIXA 2N78A 4UP7A 1WCMG 3ULJA 2JK8A 2D62A 1E1TA 3W5OA 4DR2L 5J3BA 2JA9A 4GN5A 4QGUA 1N34L 2E2JH 4R4OA 3HOYG 4GKJL 1M1KC 4JV5L 4PG3A 4A3EG 2OWOA 2WB1E 1Q7YC 1D7QA 3GTGH 2R7ZH 4B3SQ 2A1AA 4C3IH 4DKAC 2HHHQ 4BBRG 1W2BA 4UP8A 1Y1WG 3GTPH 1K73C 1VS0A 3K0XA 1C0AA 1O7IA 4JYAL 4R1JA 4FDBA 4DV1Q 2JJQA 4R4QA 1B7YB 3CQZH 4KHZA 5GAHC 1HR0L 1XNQL 2V1CC 3AYHB 5FJ8H 4GN3B 2ZJQA 2IT1A 4BXXH 1IBKQ 3UE0A 1PH7A 2BA0A 2EQSA 4DV5L 1VQ9A 3KJOA 4L5RC 4NXNQ 1XPRA 3K80C 4A3KG 2JA5G 3I55A 3RZDH 3K7UC 3K7AH 4JI0Q 4JI8L 3FKIG 4A3GH 3U58A 4A3CG 1JB7A 1U5KA 1HZBA 1E1OA 3LGJA 1SMXA 2PNHA 1HJPA 3RZOH 4LFAL 2YYZA 3PSIA 1YJ9A 2OCEA 1MJCA 3ICEA 4Y7NH 3S1MH 3HOVG 4IFDG 4DV1L 4LFBQ 5IYDH 3F1ZA 4R4IA 2B63H 4A93G 3UE1A 4X62Q 4QY7A 1J6QA 4LFCL 1HNWL 5E7NA 5IYCH 4A3DH 1QVGA 4L5QA 1NY4A 3BU2A 3A74A 1EIYB 4DV6Q 3BZKA 4DK6C 4DV7L 4DR3Q 4B3RL 2KHJA 3CCQA 1G6PA 2EIFA 2D0OA 5C4XG 1GO3E 1L1OB 1UE1A 4K0KL 5JJKA 3CW2C 1FL0A 5FLMG 3JAMc 5C0XG 2PMZE 2DGYA 4DV0L 1PH8A 4IPHA 4A3FH 1TWAH 1Z47A 4Y52H 1KRTA 5IYBH 3J80c 3I7FA 1EFWA 4POFA 1N32L 4GNXA 2EXDA 5M5XH 2R6GA 4LUOA 5C0XI 3GTJH 3J81i 4YCVA 4JI2L 5IYBG 3SGIA 5JJIA 1A0IA 4LF6L 1XPOA 4BA1I 1KL9A 1VQGA 5C4XH 3CF5A 3ER0A 5GQOA 1JT8A 1YVCA 4UP9A 5K36G 3PUZA 3CPFA 1OXUA 3PUYA 4OO1I 4A3DG 2B3GA 3L7ZC 4GNXB 5JEAJ 4C3HH 5H1SE 2B63G 5IWAQ 4DNIA 5IYDG 4NXML 1Q82C 1G51A 3S2HH 4OWWB 1PH4A 3CD6A 5LMNW 1EUJA 1KRSA 1RL2A 3TS0A 3F2CA 1QZGA 2UXCL 4R4TA 1X3FA 2KENA 1GKHA 3GD7A 3PGZA 4HJ9A 2JA5H 3GTLH 3J7ZC 2VQEL 1TWHH 4NPSA 4X66L 2UU9L 3EIVA 2UUBL 2JE6I 4B3RQ 3A5UA 4P74A 1N9WA 4BXXG 4KHPL 4YWKA 4A3IH 1I94Q 1SR3A 3RLNA 3M9BA 4YCWA 3RN5A 1XJVA 4JI4Q 5IP9H 4JI5Q 2HT1A 4O0AA 4WJ4A 3L0OA 1T9HA 2C35B 4JI1Q 2K5HA 2UXBQ 1VCIA 1X65A 4GKKQ 2PQAA 1Y1WH 4B3TQ 1QVCA 5IT9c 4OWTB 4AYBE 2R7ZG 1V43A 1S40A 1HNZQ 5M3FG 2F52A 5IWAL 1X56A 4IPDA 1NTGA 2HHHL 3PV0A 1XMOQ 2KHIA 4GLAC 3AFPA 4GKJQ 2IX0A 1I94L 2A19A 4DUZQ 4LF8L 1VQFA 3GO5A 4H02A 2N8NA 4X65Q 2I5HA 2MO0A 4ME3A 2MNAA 4KHPQ 2VNUD 1YIJA 1WCMH 1CKNA 2K5NA 1Q8KA 2ZTEA 4AIMA 1IBKL 2JEBI 1VQAA 4QIWE 2OQKA 5C0XJ 2VW9A 1VQPA 1QUQA 3F2DA 1UE7A 4JBKA 3CCEA 1X3GA 2R92H 2JA6G 1KXLA 3KOJA 1X55A 1CKMA 4A76A 1PV4A 4GNXC 1SFOH 3PCOB 4JCVE 1NMFA 3U50C 4A3MG 4IPGA 4X65L 2LSSA 1VQ4A 3BJUA 1IL2A 2AKWB 4JI6L 4GN4B 4DV3L 1E22A 2YV5A 4A3JG 4DV2L 2R93G 3GTKH 1E7ZA 4IFDI 1R9TH 1Y1VH 2E8GA 2KCTA 1PA6A 3UDIA 4LUVA 3WWVA 4YWLA 3CCSA 4JBMA 4MNOA 1FJGL 3OW2A 1EWIA 3KF6A 1UWVA 2K75A 1VQ5A 2CKZB 3DLLA 2ZM6L 2JA8H 1GM5A 1HZCA 1TXYA 3AQQA 3A0JA 2E5LL 2K4KA 2JA6H 1N36L 2R92G 2VZAA 1YJNA 2UUAL 3D31A 2NZOA 1E24A 1NMGA 2BA1A 4LF9Q 2ID0A 1VQJA 1NJIC 4KI0A 1V1QA 4JI7Q 2Z6KA 3CCLA 1B8AA 1BVSA 2VQEQ 3PO2G 1J5EL 1PH5A 2YTYA 2XTIA 2D0PA 5FLXc 1IBLL 4DR4L 1K83H 3ULPA 2UUCQ 3CAMA 2L15A 4DV7Q 4DR3L 4HJAA 2I0QA 4DUYL 4GOPA 1UE6A 5M3FH 3EBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF Q;  4YHH Q;  1OTC A;  2BH8 A;  2QGQ A;  2MFI A;  1PH2 A;  1P16 A;  4A3B H;  4X6A H;  2NZH A;  3RR5 A;  3T1Y Q;  3M3Y H;  1J5E Q;  5IP9 G;  1UE5 A;  2LXK A;  1VQ6 A;  2F4V L;  3KLW A;  4LUZ A;  4MTN A;  4A3I G;  1GD7 A;  3I4M G;  2Q2U A;  3S14 H;  1M90 C;  2JA7 H;  3PUW A;  4MZ9 A;  2JEA I;  4A4I A;  2NVT H;  2IHF A;  4DAM A;  3HOW G;  2VQF L;  2NN6 I;  2UUA Q;  4LF9 L;  3NEN A;  4OXP A;  1YNX A;  3T1H L;  1I6H H;  4DPG A;  4DR7 L;  4PZ7 A;  3CCV A;  2NN6 G;  2DUD A;  1HNX Q;  1L1O C;  2GVA A;  2WFW A;  4LF5 L;  4X64 L;  3I4N H;  2GVB A;  1A63 A;  4K0K Q;  1U0L A;  1I5F A;  1IZ6 A;  1X3E A;  3KFU A;  4UY8 C;  3UDG A;  1EOV A;  1Q1B A;  4IOA A;  1PVO A;  1D8L A;  4IFD J;  2ZJR A;  4JV5 Q;  1MIU A;  4GLV B;  2CQO A;  1LYL A;  1HNZ L;  2E2I H;  2ZTC A;  5C3E G;  4GS3 A;  4IOC A;  4PZ6 A;  4AYB G;  1L1O A;  4A75 A;  1LM0 A;  3ULL A;  1VQL A;  1Q12 A;  1CKO A;  1K3R A;  3RLF A;  4A3L H;  1XNR L;  1S72 A;  4UPA A;  4JI3 L;  1EQR A;  5IE8 A;  4ALP A;  5IY0 A;  1HNW Q;  4HIK A;  3NEL A;  3S2D H;  1PH6 A;  3HOX H;  1JMC A;  2K52 A;  1VQK A;  1AH9 A;  4DV0 Q;  1BBW A;  4TQU S;  3U4Z A;  4A3F G;  1VQ8 A;  4KLK A;  1S3O A;  4HJ5 A;  3M4Q A;  5HGQ A;  5FLM H;  1Q86 C;  3KF8 B;  1YEZ A;  2IX1 A;  3G48 A;  4P73 A;  3CCM A;  3G6E A;  2Y0S G;  4JI3 Q;  2HIV A;  2UXC Q;  4LF4 Q;  4AQY Q;  1IBM L;  3RNU A;  2ALY B;  2BH2 A;  3DM3 A;  4C2M H;  1K8G A;  1SLJ A;  1XNR Q;  5IYC G;  1TWC H;  1WYD A;  1QZH A;  4A93 H;  1W3S A;  1V9P A;  2F3I A;  3OTO Q;  4YCU A;  2Q2I A;  1E3P A;  2AWN A;  4DV3 Q;  4B3S L;  3HOV H;  3KJP A;  1YHA A;  2CWP A;  1K0R A;  3TRE A;  5DLQ E;  3RN2 A;  3GTO H;  2Z6K C;  2UUB Q;  4A3C H;  3CME A;  3RLO A;  3FKI H;  2MO1 A;  3E9I A;  1BBU A;  3H0G H;  2ES2 A;  4LF7 Q;  4A3G G;  4DR2 Q;  3D0F A;  2RHQ B;  4B3T L;  2R7D A;  3NBH B;  5AJ3 Q;  3PIP A;  4A3K H;  1HZ9 A;  2N49 A;  2VL6 A;  2CCZ A;  2HIX A;  1KHI A;  3K8A A;  4JI1 L;  3H3V I;  4DR7 Q;  2UXB L;  4L5T A;  1TWG H;  4GOP C;  1KAW A;  3STB C;  4C3J H;  4DAY B;  4P71 A;  5GAE C;  5FJ8 G;  3T1H Q;  1H95 A;  5GAD C;  1P8L A;  3G71 A;  2GN5 A;  2KCM A;  5ELO A;  2I5M X;  3M4P A;  1XMQ Q;  2Q2T A;  4OON A;  3S24 A;  1HZA A;  4LF7 L;  1FVI A;  1CSQ A;  2B29 A;  3HOZ G;  2Q2H A;  3E9H A;  3HFZ B;  4QJF A;  4IJH A;  3BZC A;  3KDF B;  4LF8 Q;  2Z0S A;  2RCN A;  5LMU L;  4BBR H;  3S16 H;  1L2F A;  3ZJY C;  3PO3 H;  2UXD L;  4JOI C;  2R7F A;  2K14 A;  1VQB A;  1G29 1;  3OTO L;  3CPW A;  2AMC B;  3PUV A;  4YHH L;  3I56 A;  4A3E H;  3CC2 A;  1EIF A;  1Y14 B;  4LFC Q;  2VS1 A;  1VQC A;  3HOY H;  2IY5 B;  2QEX A;  4XTC S;  1CKN B;  1MKH A;  3PO3 G;  4JBJ A;  4EQ5 A;  4HIM A;  1K9M C;  4POG A;  3S17 H;  2Y0S E;  4DUY Q;  2QA4 A;  3M7N A;  4DR4 Q;  1Q1E A;  4JI5 L;  4JG2 A;  4DK3 C;  1KD1 C;  2UUC L;  2YU9 H;  5LMU Q;  3PF4 A;  5AJ3 L;  1YHQ A;  3HOZ H;  1N33 Q;  2AHO B;  4NB3 A;  2ZTD A;  1WI5 A;  1Z9F A;  4L5S A;  2UU9 Q;  1N34 Q;  2NVY H;  3CMA A;  1YIT A;  1SRU A;  5IP7 H;  3L2P A;  4LF5 Q;  4QL5 A;  1I3Q H;  1DGS A;  2CWA A;  2HQL A;  4LF6 Q;  4HJ8 A;  1XPU A;  3I4O A;  1CSP A;  1NBW A;  5LMN Q;  3Q8D A;  1FJG Q;  3W1G A;  1HR0 Q;  2VY3 A;  3PUX A;  1XNQ Q;  4GKK L;  3H3V H;  2MQH A;  1JE5 A;  1IYJ B;  1OXS C;  3H0G G;  4OWX B;  4JYA Q;  1PYB A;  3CCJ A;  2WP8 J;  3NEM A;  1EYG A;  3GTQ H;  3HOU G;  2AWO A;  3M85 A;  1VQE A;  3KYH C;  1LUZ A;  1QUQ B;  3AFQ A;  4DV2 Q;  2PI2 A;  3F2B A;  1IBL Q;  3HKS A;  4P75 A;  1KQS A;  1QVF A;  1OXX K;  2WB1 G;  4APV A;  3E0E A;  4RG1 A;  1X6O A;  2K50 A;  4GOP B;  1XMQ L;  1XMO L;  1HR0 W;  1OXV A;  3TS2 A;  2YTV A;  1C9O A;  3UDX A;  1VQH A;  3W1B A;  2A8V A;  5GRO A;  1LTL A;  2FXQ A;  4YWM A;  5M3M H;  5LMN L;  4BY7 H;  4JC0 A;  4TVA B;  3TEH B;  4LFA Q;  1PH9 A;  1PHJ A;  1I50 H;  4GLX A;  1VQD A;  1VQM A;  1XTD A;  4DV4 Q;  1BKB A;  2PQA B;  1WFQ A;  2IHE A;  4O2D A;  4P72 A;  4DR5 L;  4JBW A;  4PMW A;  1SN8 A;  4BY1 G;  1EQQ A;  1YZ6 A;  3HOX G;  3S1N H;  4BBS G;  1FGU A;  1IXR A;  3KF6 B;  1JJ2 A;  2OTL A;  4LFB L;  3CCR A;  3F8T A;  2WAQ G;  5EAY A;  4DV6 L;  2RHS B;  2E5L Q;  3H15 A;  5C4J H;  3OYY A;  5JEA G;  2VUM H;  4R4C A;  1N36 Q;  4A3L G;  3B6Y A;  4DR1 Q;  5C44 G;  2I5L X;  2LXJ A;  3EN2 A;  3FP9 A;  3S15 H;  3ERS X;  5C3E H;  2RF4 A;  1PH1 A;  3K81 C;  1YI2 A;  4LF4 L;  3KDF A;  1Q46 A;  1AE2 A;  3JC6 6;  5M5Y H;  1C7Y A;  1PFS A;  3MXN B;  4JI0 L;  3J81 j;  4JI4 L;  3HKZ G;  1ASY A;  4XIG S;  3I4N G;  4YY3 L;  4OX9 L;  3GDE A;  3CXC A;  3J81 c;  1ASZ A;  3G4S A;  1N8R C;  1AE3 A;  4DV4 L;  4PZ8 A;  1X9N A;  3J80 i;  4LNQ A;  2JQO A;  1HH2 P;  1A8V A;  3JAM i;  1HNX L;  3HOW H;  3FHW A;  3TQY A;  5GAG C;  2NVQ H;  2JA7 G;  1MJE A;  4RMF A;  1PH3 A;  4QQB X;  1VQ7 A;  3I4M H;  3M4O H;  1NE3 A;  4AH6 A;  1K8A C;  4YY3 Q;  4OX9 Q;  4JOI A;  2OTJ A;  2UXD Q;  3A5Z B;  2H5X A;  2XGT A;  3MEF A;  5C44 H;  2ASB A;  4A3B G;  2F4V Q;  4JI6 Q;  2VUM G;  4B3M Q;  3T1Y L;  4DR6 L;  3CCU A;  4X66 Q;  1VQO A;  4IPC A;  3STB D;  1GVP A;  4X64 Q;  1YJW A;  1SE8 A;  4BBS H;  4BY1 H;  5JJL A;  4AQY L;  1IBM Q;  4HIO A;  4J15 A;  5BR8 L;  2KBN A;  3CC7 A;  4HID A;  4DR1 L;  4IO9 A;  2E2H H;  2ZM6 Q;  1N32 Q;  1YBY A;  2PI2 E;  1VQN A;  4LWC A;  3PO2 H;  4LW1 A;  1KC8 C;  2ATW A;  4BY7 G;  4JI8 Q;  5M3M G;  4DR6 Q;  1A62 A;  2CFM A;  2K5V A;  1CUK A;  4DUZ L;  4B3M L;  3HKZ E;  1TWF H;  1X54 A;  1VQI A;  2JA8 G;  1N33 L;  1UEB A;  3CC4 A;  2NVX H;  4OO1 G;  1WOC A;  4HJ7 A;  3UDF A;  5BR8 Q;  1L0W A;  3HOU H;  1Y1V G;  2N3S A;  3IRB A;  5HY6 A;  4X62 L;  4IJL A;  2ZJP A;  3S1R H;  1Q81 C;  4NXM Q;  3VDY A;  3TRZ A;  2R93 H;  3S1Q H;  1JJC B;  4A3J H;  1JJG A;  2YTX A;  3AEV A;  1PYS B;  3J7A 5;  1WJJ A;  4WJ3 M;  1SRO A;  4EX5 A;  2OQ0 A;  2WAQ E;  4A3M H;  1RIP A;  1OXT A;  3PF5 A;  1YHB A;  5IP7 G;  3U4V A;  4JI7 L;  5ELN A;  5M5W H;  4DV5 Q;  4DR5 Q;  4BA2 I;  3I2Z A;  4NXN L;  3GTM H;  1B70 B;  3CP0 A;  3PIO A;  4JI2 Q;  1KIX A;  2N78 A;  4UP7 A;  1WCM G;  3ULJ A;  2JK8 A;  2D62 A;  1E1T A;  3W5O A;  4DR2 L;  5J3B A;  2JA9 A;  4GN5 A;  4QGU A;  1N34 L;  2E2J H;  4R4O A;  3HOY G;  4GKJ L;  1M1K C;  4JV5 L;  4PG3 A;  4A3E G;  2OWO A;  2WB1 E;  1Q7Y C;  1D7Q A;  3GTG H;  2R7Z H;  4B3S Q;  2A1A A;  4C3I H;  4DKA C;  2HHH Q;  4BBR G;  1W2B A;  4UP8 A;  1Y1W G;  3GTP H;  1K73 C;  1VS0 A;  3K0X A;  1C0A A;  1O7I A;  4JYA L;  4R1J A;  4FDB A;  4DV1 Q;  2JJQ A;  4R4Q A;  1B7Y B;  3CQZ H;  4KHZ A;  5GAH C;  1HR0 L;  1XNQ L;  2V1C C;  3AYH B;  5FJ8 H;  4GN3 B;  2ZJQ A;  2IT1 A;  4BXX H;  1IBK Q;  3UE0 A;  1PH7 A;  2BA0 A;  2EQS A;  4DV5 L;  1VQ9 A;  3KJO A;  4L5R C;  4NXN Q;  1XPR A;  3K80 C;  4A3K G;  2JA5 G;  3I55 A;  3RZD H;  3K7U C;  3K7A H;  4JI0 Q;  4JI8 L;  3FKI G;  4A3G H;  3U58 A;  4A3C G;  1JB7 A;  1U5K A;  1HZB A;  1E1O A;  3LGJ A;  1SMX A;  2PNH A;  1HJP A;  3RZO H;  4LFA L;  2YYZ A;  3PSI A;  1YJ9 A;  2OCE A;  1MJC A;  3ICE A;  4Y7N H;  3S1M H;  3HOV G;  4IFD G;  4DV1 L;  4LFB Q;  5IYD H;  3F1Z A;  4R4I A;  2B63 H;  4A93 G;  3UE1 A;  4X62 Q;  4QY7 A;  1J6Q A;  4LFC L;  1HNW L;  5E7N A;  5IYC H;  4A3D H;  1QVG A;  4L5Q A;  1NY4 A;  3BU2 A;  3A74 A;  1EIY B;  4DV6 Q;  3BZK A;  4DK6 C;  4DV7 L;  4DR3 Q;  4B3R L;  2KHJ A;  3CCQ A;  1G6P A;  2EIF A;  2D0O A;  5C4X G;  1GO3 E;  1L1O B;  1UE1 A;  4K0K L;  5JJK A;  3CW2 C;  1FL0 A;  5FLM G;  3JAM c;  5C0X G;  2PMZ E;  2DGY A;  4DV0 L;  1PH8 A;  4IPH A;  4A3F H;  1TWA H;  1Z47 A;  4Y52 H;  1KRT A;  5IYB H;  3J80 c;  3I7F A;  1EFW A;  4POF A;  1N32 L;  4GNX A;  2EXD A;  5M5X H;  2R6G A;  4LUO A;  5C0X I;  3GTJ H;  3J81 i;  4YCV A;  4JI2 L;  5IYB G;  3SGI A;  5JJI A;  1A0I A;  4LF6 L;  1XPO A;  4BA1 I;  1KL9 A;  1VQG A;  5C4X H;  3CF5 A;  3ER0 A;  5GQO A;  1JT8 A;  1YVC A;  4UP9 A;  5K36 G;  3PUZ A;  3CPF A;  1OXU A;  3PUY A;  4OO1 I;  4A3D G;  2B3G A;  3L7Z C;  4GNX B;  5JEA J;  4C3H H;  5H1S E;  2B63 G;  5IWA Q;  4DNI A;  5IYD G;  4NXM L;  1Q82 C;  1G51 A;  3S2H H;  4OWW B;  1PH4 A;  3CD6 A;  5LMN W;  1EUJ A;  1KRS A;  1RL2 A;  3TS0 A;  3F2C A;  1QZG A;  2UXC L;  4R4T A;  1X3F A;  2KEN A;  1GKH A;  3GD7 A;  3PGZ A;  4HJ9 A;  2JA5 H;  3GTL H;  3J7Z C;  2VQE L;  1TWH H;  4NPS A;  4X66 L;  2UU9 L;  3EIV A;  2UUB L;  2JE6 I;  4B3R Q;  3A5U A;  4P74 A;  1N9W A;  4BXX G;  4KHP L;  4YWK A;  4A3I H;  1I94 Q;  1SR3 A;  3RLN A;  3M9B A;  4YCW A;  3RN5 A;  1XJV A;  4JI4 Q;  5IP9 H;  4JI5 Q;  2HT1 A;  4O0A A;  4WJ4 A;  3L0O A;  1T9H A;  2C35 B;  4JI1 Q;  2K5H A;  2UXB Q;  1VCI A;  1X65 A;  4GKK Q;  2PQA A;  1Y1W H;  4B3T Q;  1QVC A;  5IT9 c;  4OWT B;  4AYB E;  2R7Z G;  1V43 A;  1S40 A;  1HNZ Q;  5M3F G;  2F52 A;  5IWA L;  1X56 A;  4IPD A;  1NTG A;  2HHH L;  3PV0 A;  1XMO Q;  2KHI A;  4GLA C;  3AFP A;  4GKJ Q;  2IX0 A;  1I94 L;  2A19 A;  4DUZ Q;  4LF8 L;  1VQF A;  3GO5 A;  4H02 A;  2N8N A;  4X65 Q;  2I5H A;  2MO0 A;  4ME3 A;  2MNA A;  4KHP Q;  2VNU D;  1YIJ A;  1WCM H;  1CKN A;  2K5N A;  1Q8K A;  2ZTE A;  4AIM A;  1IBK L;  2JEB I;  1VQA A;  4QIW E;  2OQK A;  5C0X J;  2VW9 A;  1VQP A;  1QUQ A;  3F2D A;  1UE7 A;  4JBK A;  3CCE A;  1X3G A;  2R92 H;  2JA6 G;  1KXL A;  3KOJ A;  1X55 A;  1CKM A;  4A76 A;  1PV4 A;  4GNX C;  1SFO H;  3PCO B;  4JCV E;  1NMF A;  3U50 C;  4A3M G;  4IPG A;  4X65 L;  2LSS A;  1VQ4 A;  3BJU A;  1IL2 A;  2AKW B;  4JI6 L;  4GN4 B;  4DV3 L;  1E22 A;  2YV5 A;  4A3J G;  4DV2 L;  2R93 G;  3GTK H;  1E7Z A;  4IFD I;  1R9T H;  1Y1V H;  2E8G A;  2KCT A;  1PA6 A;  3UDI A;  4LUV A;  3WWV A;  4YWL A;  3CCS A;  4JBM A;  4MNO A;  1FJG L;  3OW2 A;  1EWI A;  3KF6 A;  1UWV A;  2K75 A;  1VQ5 A;  2CKZ B;  3DLL A;  2ZM6 L;  2JA8 H;  1GM5 A;  1HZC A;  1TXY A;  3AQQ A;  3A0J A;  2E5L L;  2K4K A;  2JA6 H;  1N36 L;  2R92 G;  2VZA A;  1YJN A;  2UUA L;  3D31 A;  2NZO A;  1E24 A;  1NMG A;  2BA1 A;  4LF9 Q;  2ID0 A;  1VQJ A;  1NJI C;  4KI0 A;  1V1Q A;  4JI7 Q;  2Z6K A;  3CCL A;  1B8A A;  1BVS A;  2VQE Q;  3PO2 G;  1J5E L;  1PH5 A;  2YTY A;  2XTI A;  2D0P A;  5FLX c;  1IBL L;  4DR4 L;  1K83 H;  3ULP A;  2UUC Q;  3CAM A;  2L15 A;  4DV7 Q;  4DR3 L;  4HJA A;  2I0Q A;  4DUY L;  4GOP A;  1UE6 A;  5M3F H;  3EBE A; 
#chains in the Genus database with same CATH topology
 2LFN A;  1GUN A;  1VMP A;  5C44 B;  4KY6 A;  3M3Y H;  4HSP A;  5D65 A;  3GV3 A;  2LXK A;  5KGU A;  1PRT B;  2F4V L;  3KLW A;  1F2L A;  3BZD B;  3I4M G;  3PUW A;  4MZ9 A;  2PW7 A;  4DAM A;  3KBG A;  2Z1C A;  3KBX A;  5LL6 S;  4A3K B;  3HOW G;  1WVL A;  2K04 A;  3NEN A;  2JA6 B;  4L6T B;  4DR7 L;  4FXK C;  2ZXP A;  1A3U A;  1LTS D;  2AQ3 B;  2WFW A;  4UHV A;  4PNY A;  3VYT A;  2DJF C;  3HG9 A;  1A63 A;  1HHV A;  3VYR A;  1X3E A;  1EOV A;  4IFD J;  2ZJR A;  3AU7 A;  4GLV B;  1LYL A;  3OMG A;  1PFB A;  2E2I H;  1X32 A;  4GS3 A;  3IFD A;  3K7A B;  1VQL A;  4ID6 A;  1VDZ A;  2M2L A;  1S72 A;  4JI3 L;  2A69 D;  1SXT A;  1HNW Q;  4HIK A;  3S2D H;  1AH9 A;  1SNO A;  1JMC A;  1VQK A;  3P20 A;  4TQU S;  1I50 B;  3NK9 A;  2Q8T A;  4KLK A;  5DM6 3;  5FLM H;  2F0F A;  1B2T A;  4R8I A;  1YEZ A;  3E6Z X;  4P73 A;  3NQT A;  5EKK A;  2RA4 A;  5IYC G;  1UAP A;  1BO0 A;  1QZH A;  1V9P A;  3OTO Q;  1PFM A;  2AWN A;  2WIN B;  2CWP A;  3K57 A;  1B3Q A;  3HOW B;  3RN2 A;  2PW5 A;  3FKI H;  3H0G H;  3E9I A;  1BBU A;  4RCO A;  2RHQ B;  3LWE A;  3NBH B;  3PIP A;  5ELB A;  2N49 A;  2JSO A;  1IYU A;  1RCV D;  1KAW A;  1G2S A;  3STB C;  1H9S A;  4DXG A;  3VA7 A;  5C3X A;  5I9P A;  4P2C B;  2I5M X;  1XMQ Q;  4XT1 B;  1HZA A;  5TSS A;  4BBS B;  3HOZ G;  2B29 A;  1BQQ T;  1KLG D;  2D5D A;  3BZC A;  1Y8O B;  2Z0S A;  5IGE A;  1A15 A;  3S16 H;  3PO3 H;  2VUM B;  4A3B B;  4LAA A;  3CPW A;  1SBB B;  4A3E H;  3CC2 A;  1EIF A;  1S5E D;  3HOY H;  4XTC S;  2KVM A;  2RCF A;  4EQ5 A;  1K9M C;  3T53 B;  2Y0S E;  3M7N A;  4DR4 Q;  2SNM A;  1Y1W B;  1KD1 C;  4LFB Q;  1IL8 A;  2DY7 A;  5LMU Q;  1EEF D;  4KTA A;  2AHO B;  1N33 Q;  2ZTD A;  1WI5 A;  4BBR B;  1Z9F A;  1N34 Q;  2NVY H;  1TWH B;  3L3O C;  3CMA A;  1A2T A;  1SRU A;  5IP7 H;  4UAI A;  1K3B C;  4FF2 A;  4LF5 Q;  2MP1 A;  3NTH A;  4ZK9 B;  1I3Q H;  4IUR A;  5FKA C;  4LF6 Q;  3C3L A;  1LV9 A;  2EYP A;  1NBW A;  4I7Z C;  4NMZ A;  5LMN Q;  1TKW B;  1XNQ Q;  3PUX A;  3U9S A;  4GKK L;  1JE5 A;  4RHR A;  4JYA Q;  4OWX B;  1JOK A;  1BNZ A;  1PYB A;  1L0Y B;  2AWO A;  4ULL A;  1VQE A;  1QUQ B;  2F0K A;  3AFQ A;  3W2D A;  4DV2 Q;  2PI2 A;  1KQS A;  1QG7 A;  4P75 A;  1U4M A;  1OXX K;  4RG1 A;  3IKJ A;  1XMQ L;  1CTM A;  4K14 A;  3HKZ B;  3W1B A;  5KND A;  2F0H A;  3G6J B;  2J0T D;  4TVA B;  3TEH B;  4V0B A;  4DFA A;  4DA2 A;  1VQM A;  1BKB A;  1KDB A;  2PQA B;  2IHE A;  4O2D A;  5CBE E;  4JBW A;  2BDN A;  4WJW A;  3I70 A;  4BY1 G;  4NW2 A;  3HOX G;  1HCZ A;  5IGC A;  2JA8 B;  1C8C A;  3KF6 B;  4DV6 L;  3K59 A;  2E5L Q;  1E2Z A;  3H15 A;  5C4J H;  5JEA G;  4A3L G;  3K58 A;  1N36 Q;  3KLS A;  3URY A;  2LXJ A;  2E2J B;  2WKD A;  2BDO A;  2Z4I A;  3GTG B;  2RF4 A;  1ENF A;  5FLX L;  1YI2 A;  3S1Q B;  1MD2 D;  4JPB W;  1F2Y A;  2F0M A;  1Q46 A;  2AUJ D;  3J81 j;  3T4A C;  3HKZ G;  3K5N A;  3A7L A;  1EEI D;  4XIG S;  3I4N G;  4YY3 L;  4OX9 L;  5M3M B;  1D5X C;  1PRT D;  4C3J B;  3J81 c;  1N8R C;  3C1F A;  1B1Z A;  4LNQ A;  1X9N A;  3J80 i;  2B2Y A;  1HNX L;  1RHP A;  2FFK B;  2HD3 A;  3N6R A;  2K1B A;  2NVT B;  3DWQ A;  3TQY A;  1E0B A;  2NVQ H;  1MJE A;  4QQB X;  4FNF A;  4DXF A;  1K8A C;  2OTJ A;  2JP1 A;  3A5Z B;  1NR2 A;  5JOB A;  5CV5 A;  4A3B G;  3SE0 A;  3J81 E;  1TVX A;  2VUM G;  5KYI A;  3DM1 A;  1GVP A;  2RDG A;  2K6A A;  2A68 D;  2R92 B;  2EJM A;  3I90 A;  1SE8 A;  2SDF A;  1STY A;  4AQY L;  1IBM Q;  1TS4 A;  4HID A;  1CI3 M;  1DXM A;  1YBY A;  4N9P A;  1VQN A;  1B53 A;  3HRZ C;  1SE4 A;  2HCC A;  4B3M L;  4KD4 A;  4BY1 B;  1X54 A;  1VQI A;  2DY8 A;  4ZKB B;  1N33 L;  2JA8 G;  3CC4 A;  3BS1 A;  2NBF A;  4OO1 G;  2EZV A;  3NUC A;  4CKB A;  3UDF A;  1L0W A;  1GUW A;  2FMM A;  3HOU H;  3IRB A;  4NXM Q;  1JJG A;  3S1Q H;  4A3J H;  4DK0 A;  1TS5 A;  4OEM B;  3HOV B;  1PYS B;  4XDX A;  4EX5 A;  1C4Q A;  4QCL A;  2WAQ E;  3J7A V;  4DNT B;  1ICF B;  5M5W H;  2RDH A;  3ULJ A;  5E4W C;  2JK8 A;  2D62 A;  1O80 A;  3NTI A;  2JA9 A;  1TR5 A;  4GN5 A;  5C4J B;  4R4O A;  1QWY A;  2R7Z H;  3DUZ A;  2HHH Q;  5HUR A;  1Y1W G;  1K73 C;  1VS0 A;  3K0X A;  2LMC B;  4JYA L;  4R1J A;  5DEH A;  1SYE A;  4DV1 Q;  3CQZ H;  1XNQ L;  4KHZ A;  5CV9 A;  5KEE A;  4CDE C;  2IT1 A;  4BXX H;  4RA8 A;  1IBK Q;  3UE0 A;  3OWE B;  2NTS A;  1H9R A;  4NXN Q;  3I4N B;  5M5W B;  2PYK A;  1I4H A;  1SMY C;  1RTN A;  2JA7 B;  1E1O A;  3LGJ A;  3SK4 A;  3S2H B;  1HNW L;  3PSI A;  4O1N A;  2OCE A;  1MJC A;  4Y7N H;  3HOV G;  1QOH A;  4DV1 L;  5I6Y A;  1EYA A;  2F3V A;  1J6Q A;  4LFC L;  1K0S A;  3T51 B;  5KYL A;  1RTO A;  3NP8 A;  1DON A;  4CDF C;  5J39 A;  1CA5 A;  1B4O A;  2DGY A;  4A3F H;  1TWA H;  2I07 B;  1EY6 A;  3I7F A;  4ZRZ A;  5IGF A;  4GNX A;  5M5X H;  3GTJ H;  1SYD A;  4F87 A;  5IYB G;  4EVO A;  3FRP B;  4BA1 I;  1B44 D;  1Z7T A;  2Y0S B;  4F88 A;  1YVC A;  4EQO A;  2SEB D;  4IUP A;  5AFW A;  4OO1 I;  3MEH A;  1S5F D;  3L7Z C;  3BVZ A;  4DNR B;  4GNX B;  5EPJ A;  2B63 G;  5IWA Q;  4DNI A;  2EYM A;  3A55 A;  4NXM L;  1G51 A;  1U4L A;  2F0J A;  5FOB B;  4IFD H;  4FP5 D;  4HMI A;  1PH4 A;  3CD6 A;  3RZO B;  1ET9 A;  1PTO D;  2WV6 D;  1TQO A;  1RL2 A;  3F2C A;  1QZG A;  3GD7 A;  3PGZ A;  5JAV A;  5EBC A;  2WB1 B;  2JA5 H;  1QJO A;  2KHS A;  3OOC A;  1VF7 A;  2TMP A;  4G4K A;  1SFO B;  4K6D A;  2K5Q A;  1CHQ D;  1EYC A;  2UUB L;  3A5U A;  3CU7 A;  4LMQ D;  4YWK A;  5KNC A;  1I94 Q;  1SR3 A;  2MJ8 A;  2HT1 A;  1TWA B;  2RSN A;  2K5H A;  4JI1 Q;  2J4X A;  5CMD A;  5IOC A;  5IT9 c;  2K28 A;  2EYO A;  1F9S A;  5ELE A;  1X56 A;  1NTG A;  4MIU A;  3NWT A;  2NZ1 D;  3AFP A;  1I94 L;  2A19 A;  3BVG A;  2CVR A;  3GO5 A;  4G7Z C;  1CQF A;  1LT4 D;  2K5N A;  4AIM A;  1VQA A;  1D1I A;  4ME5 A;  2VW9 A;  1VQP A;  3H3V C;  4KKT A;  1UE7 A;  2KEC A;  2JA6 G;  2RSO A;  3KOJ A;  3LWU A;  4A76 A;  3K5M A;  1WTV A;  2P5Z X;  2F0S A;  2BE5 D;  1SNC A;  3U50 C;  4X65 L;  4M8A A;  1MSH A;  5C4Z A;  3Q22 A;  4JI6 L;  3DEP A;  4GN4 B;  4XQQ A;  4IZ8 A;  1R9T H;  2K33 A;  2E8G A;  2IL8 A;  1HPC A;  5C4H A;  3CCS A;  4MNO A;  2HDM A;  1UWV A;  3FVQ A;  2XWJ B;  3DLL A;  3L9A X;  5I4D A;  1KAA A;  1GM5 A;  1WTX A;  2E5L L;  2CHB D;  3S9W A;  4S3S A;  2VZA A;  4LF9 Q;  1ENC A;  2ID0 A;  3DWA A;  3GV6 A;  4JI7 Q;  2Z6K A;  3S1N B;  3FEW X;  1TY0 A;  2VQE Q;  4V19 0;  2YTY A;  2RVL A;  2I0Q A;  5EQ0 A;  4GOP A;  3TP7 A;  2K7V A;  4X6A H;  1P16 A;  3PIP 3;  1J5E Q;  4E6I A;  3NBH A;  5IP9 G;  1UE5 A;  5IGD A;  1F77 A;  1SE3 A;  2QEJ C;  5I2X A;  4A3I G;  2Q2U A;  2VB3 X;  1M90 C;  3MXP A;  2JA7 H;  3P1H A;  2NTT A;  2JEA I;  3VA5 A;  2IHF A;  2VQF L;  4C56 C;  1YNX A;  1YNJ D;  4PV1 C;  3T1H L;  4CJ2 C;  2NN6 G;  1PTO H;  4LF5 L;  1NNX A;  3ERQ A;  3S14 B;  1STH A;  1IZ6 A;  3UDG A;  3AB9 A;  2R7Z B;  3SK6 A;  4G57 A;  4J1M A;  4IOC A;  4AYB G;  1BCP F;  3QO2 A;  1Q12 A;  1K3R A;  1XNR L;  5ELC A;  5IE8 A;  2F0W A;  2KQ3 A;  2L4N A;  2K52 A;  3QIA A;  4IQZ A;  4EGV A;  3U4Z A;  2ICI A;  1S3O A;  3M4Q A;  3KF8 B;  4OHJ A;  3G48 A;  3VR2 A;  2Y0S G;  2ALY B;  2BH2 A;  1K8G A;  1TWC H;  3Q0A A;  2C9O A;  5F2D A;  1U4P A;  4A93 H;  1NR4 A;  2F3I A;  1R4P B;  3J80 E;  2B63 B;  1BCP D;  2XSC A;  4LK1 C;  3GTO H;  3CME A;  1SSO A;  2PZU A;  1PYW D;  4KY7 A;  2MO1 A;  4A3G G;  1L0X B;  3E5S A;  4DR2 Q;  4B3T L;  5AJ3 Q;  2CCZ A;  1HZ9 A;  2VL6 A;  2HIX A;  3K8A A;  2UXB L;  4L5T A;  1TWG H;  1HUM A;  5FJ8 G;  2QKI C;  3G71 A;  4KY5 A;  2OXP A;  2HQE A;  5ELO A;  4LF7 L;  3WOE A;  3HFZ B;  4BBR H;  1L2F A;  4JOI C;  2WII B;  2K14 A;  1G29 1;  2R61 A;  4K8J A;  1JOR A;  3M3Y B;  4YHH L;  3I56 A;  1QNK A;  4LFC Q;  2F0U A;  4BS9 A;  2Q8I B;  4A93 B;  1QCB D;  2EYL A;  4JBJ A;  2A73 B;  4DUY Q;  1IKL A;  4IUU A;  4DK3 C;  4JG2 A;  1Q3L A;  4KKS A;  1ZEQ X;  2UUC L;  3PF4 A;  1DZ1 A;  2A6E D;  5AJ3 L;  3QR8 A;  4CGY B;  4KN4 C;  1II3 A;  3M4Y A;  1EY0 A;  4CHT B;  4K6L A;  2CWA A;  2HQL A;  4HJ8 A;  1XPU A;  5E4X A;  3Q8D A;  1FJG Q;  3J81 L;  1STE A;  1OXS C;  2MPM A;  2WP8 J;  3NEM A;  4PQX A;  5JPN C;  5JPM C;  3KYH C;  1LUZ A;  4MTK A;  1QVF A;  2G9H D;  1MHW C;  1G8Z D;  3DXJ C;  3SK5 A;  3QOL A;  3Q23 A;  1HR0 W;  3TS2 A;  2YTV A;  3UDX A;  2A8V A;  5GRO A;  4XQJ A;  1LTL A;  4NKL A;  1F9R A;  1SDF A;  4LFA Q;  3T16 A;  1NCV A;  5HGT A;  2IWH A;  2RKS A;  1S4Z A;  4QUC A;  4DN4 M;  4P72 A;  3A56 A;  4DR5 L;  3DWP A;  3ONA B;  3EFX D;  1SN8 A;  2F0L A;  1I4G A;  1YZ6 A;  5CV6 A;  5FLX E;  4BBS G;  1HA6 A;  1AEX A;  1FGU A;  1PZI D;  2OTL A;  3CCR A;  3F8T A;  2RHS B;  2PZW A;  1EY5 A;  3TP6 A;  3B6Y A;  4CBV A;  3NQI A;  3ERS X;  5FK9 C;  2F0T A;  3SVM A;  3E0J A;  1FYC A;  4JI4 L;  1EY9 A;  3H6M A;  5CV7 A;  5JVG 3;  2BCO A;  3GDE A;  4RFB A;  2NN6 H;  4PZ8 A;  4DV4 L;  2DNE A;  1HH2 P;  2B2U A;  5C5M A;  1XTC D;  2JA7 G;  3HGB A;  1VQ7 A;  1EL0 A;  2E2H B;  4JOI A;  1PLF A;  2WAC A;  1R9T B;  3TP5 A;  4DR6 L;  1YJW A;  4IPC A;  3STB D;  4X64 Q;  2RDF A;  2CW0 D;  4BBS H;  4J15 A;  2KBN A;  4KK7 A;  4X3U A;  1YNN D;  3M4O B;  1H9S B;  1GUT A;  3EJI A;  4LWC A;  2LY7 A;  4LW1 A;  4LJZ C;  1RKN A;  3V2T A;  5ELD A;  4DR6 Q;  2CFM A;  2K5V A;  3VYS A;  4DUZ L;  1Q8I A;  1JC7 A;  3HKZ E;  3FKI B;  1UEB A;  5EKL A;  3FDT A;  5IT9 L;  1ROD A;  4TRD A;  1WOC A;  1EYD A;  3IAY A;  1EY4 A;  4HJ7 A;  4AYB B;  5BR8 Q;  1A6X A;  4X62 L;  2K5W A;  4RGN A;  3PMF A;  3AEV A;  5IGG A;  3I91 A;  1WJJ A;  3FPU B;  4TKO B;  1U9R A;  4K2L A;  4K2K A;  5FO9 B;  1RIP A;  2EPB A;  3PF5 A;  3F2U A;  3U4V A;  4RGO S;  4RWS C;  1I6H B;  1B70 B;  3CP0 A;  4UP7 A;  1ENA A;  4QGU A;  2E2J H;  5BN4 A;  1M1K C;  1RJT A;  3JAM E;  3TBI B;  4DKA C;  1EIG A;  4BBR G;  1W2B A;  4UP8 A;  1KNE A;  1W6K A;  3V05 A;  3O13 A;  1ESR A;  3FPP A;  4FDB A;  4R4Q A;  2E76 C;  1B7Y B;  1JWU D;  2X69 A;  5FJ8 H;  1ESF A;  3BDL A;  1VQ9 A;  5D3I B;  3KJO A;  1XPR A;  3W3A A;  2ICE C;  2KUM A;  2JA5 G;  4RH6 A;  3RZD H;  4JI8 L;  4A3G H;  5T1G A;  3U58 A;  5CV4 A;  1U5K A;  5I6W A;  3S1M H;  4GKJ Q;  1FNU A;  4IFD G;  1SMY D;  1CZG A;  3F1Z A;  4R4I A;  2B63 H;  3C46 A;  4A93 G;  4X62 Q;  4KJO A;  2FIN B;  1WTP A;  1JIC A;  5E7N A;  4L5Q A;  3BU2 A;  1EIY B;  4DV6 Q;  1DJR D;  4B3R L;  2Z6B A;  4K0K L;  3JAM c;  1Z47 A;  5CV8 A;  2DNC A;  1KRT A;  5IYB H;  1EFW A;  5C0X I;  4LUO A;  5C3W A;  1KL9 A;  2PZT A;  3V96 A;  2WAQ B;  1VQG A;  3CF5 A;  3ER0 A;  3WOF A;  4UP9 A;  2A5H A;  1SNQ A;  1KAB A;  5JEA J;  1ZKO A;  5IOD A;  2N88 A;  4F7X A;  4ODG A;  3S2H H;  5NUC A;  1RD9 D;  2OEO A;  1KRS A;  2Z9H A;  1EFI D;  1GKH A;  4G7H C;  4HJ9 A;  2CH4 A;  4OGQ C;  1IW7 C;  1LT6 D;  3ND9 A;  3GTL H;  3I72 A;  4NPS A;  3OMC A;  4X66 L;  1E2V A;  1I3Q B;  1E2W A;  3H94 A;  4P74 A;  4BXX G;  4KHP L;  2B2W C;  4A3I H;  3RLN A;  4FVM A;  1XJV A;  4JI4 Q;  5IP9 H;  4O0A A;  3OIP A;  3L0O A;  1STN A;  2IX3 A;  4K5W A;  1EU3 A;  1Y1W H;  1QVC A;  4OWT B;  2QDL A;  4XYO A;  3MWY W;  3TP8 A;  5JVH 3;  1S40 A;  2R7Z G;  1U4R A;  3RUZ A;  2HHH L;  3GTP B;  3D4D A;  2EOT A;  4H0L C;  4DUZ Q;  3KLS X;  1HXY D;  2MHV A;  1YIJ A;  3PO3 B;  2JEB I;  1HRJ A;  1JQY D;  1GHJ A;  4RKL A;  3BYT B;  3BDC A;  1SFO H;  4JCV E;  1AFP A;  2K01 A;  1TY2 A;  4XQN A;  1O7Y A;  2LSS A;  2QW7 A;  4IAL A;  2LS0 1;  4A3J G;  4DV2 L;  1E7Z A;  4IFD I;  2FMC A;  2EYJ A;  1BR9 A;  4DK1 A;  3WWV A;  5J22 A;  1FJG L;  4X3T A;  2L0C A;  2JA8 H;  4A3G B;  3C1E A;  4WRD A;  3A0J A;  2JA6 H;  1N36 L;  1YJN A;  2L1B A;  2UUA L;  1E24 A;  2BA1 A;  1PTO F;  1VQJ A;  4ZKC B;  4KI0 A;  1FGB D;  5D14 A;  1B8A A;  1J5E L;  4F8M A;  1IBL L;  1AN8 A;  5FLX c;  1EY7 A;  4RHS A;  1LTR D;  2UUC Q;  3LNN A;  4FF1 A;  4DV7 Q;  2L15 A;  4DR3 L;  2B2V C;  4DUY L;  1UE6 A;  3EBE A;  2AUK A;  3G4S A;  1UUP A;  4YIJ A;  4DAY A;  4YHH Q;  1OTC A;  3S17 B;  2BH8 A;  1S5B D;  1PH2 A;  2K05 A;  4A3B H;  2NZH A;  2A68 C;  2B39 A;  5CGK A;  4LUZ A;  4MTN A;  3Q24 A;  3SDZ A;  1MSG A;  2NVT H;  1TS3 A;  3KLR A;  2NN6 I;  2UUA Q;  1I6H H;  1MI2 A;  1CZW A;  4PZ7 A;  2DUD A;  1HNX Q;  2BE5 C;  2X6G A;  3I4N H;  4GZY C;  2G5D A;  4KN7 C;  4K0K Q;  2F0V A;  1I5F A;  2IW3 A;  4UY8 C;  3S2D B;  2F4I A;  2A69 C;  3KF8 A;  1I4P A;  4JV5 Q;  1MIU A;  2CQO A;  1HNZ L;  1T5X D;  2ZTC A;  3EQL C;  4PZ6 A;  1PMR A;  2QDB A;  1L1O A;  1LM0 A;  3ULL A;  4A3L H;  4UPA A;  1F9Q A;  2EJG C;  1ML0 D;  4ZUI A;  2PNR C;  1A3V A;  4ALP A;  5IY0 A;  3NEL A;  3HOX H;  1ICW A;  4A3F G;  4MN3 A;  3T56 B;  4A3F B;  2KEE A;  2DJG C;  3CCM A;  3G6E A;  4FXG C;  4JI3 Q;  2UXC Q;  4FO2 A;  4LF4 Q;  5EKI A;  3RNU A;  4C2M H;  1SLJ A;  1XNR Q;  2PPB C;  3S1M B;  1YNN C;  2E2D C;  4DV3 Q;  4B3S L;  1E3P A;  2EY1 A;  3HOV H;  3MXU A;  1K0R A;  3MC0 B;  3R2I A;  3I3C A;  3FMC A;  1BXT A;  2O4X A;  4LF7 Q;  2ES2 A;  3R2T A;  3D0F A;  4JBK A;  1CQV A;  1KHI A;  4U67 3;  3MA2 B;  2B2V A;  3KK7 A;  2F0G A;  4P71 A;  4K5X A;  3T1H Q;  1H95 A;  1XX8 A;  2GN5 A;  2Q2T A;  3DEO A;  4OON A;  3S24 A;  1FVI A;  1SYG A;  3DHQ A;  5BN3 A;  2Q2H A;  1DOM A;  4QJF A;  4LF8 Q;  5LMU L;  3ZJY C;  4QF4 A;  2V4D A;  4HED A;  3ERO A;  1VQB A;  3S17 H;  4IUT A;  1C48 A;  1Y14 B;  2VS1 A;  1BUV T;  1MKH A;  1CKN B;  3PO3 G;  4HIM A;  1Z6H A;  1NUC A;  1I4R A;  4POG A;  1Y8P B;  4JI5 L;  3HOZ H;  1BCP B;  3D3R A;  4ZQ3 A;  3HOX B;  2YU9 B;  3HEJ A;  1SYF A;  4DF7 A;  2F1M A;  1YIT A;  4MHE A;  3I73 A;  5M5X B;  3L2P A;  3GTJ B;  2A6H C;  1AZP A;  1JWS D;  4QL5 A;  3SR1 A;  2ZT9 C;  4DAV A;  1DGS A;  4I7A A;  1EU4 A;  3NSW A;  4HN7 A;  2QCP X;  3VR5 A;  1JWM D;  3W1G A;  1HR0 Q;  1W6J A;  3H3V H;  2F0Q A;  2MQH A;  5IGB A;  3H0G G;  1IYJ B;  3A54 A;  1SYC A;  2KCN A;  1EYG A;  3HOU G;  2BOS A;  5C3E B;  3M85 A;  1KTK A;  1HQM C;  5IIF A;  4OO1 H;  3E0E A;  1X6O A;  1XMO L;  5DNF A;  1AW7 A;  2Q8R E;  4ZYS A;  2ZXO A;  4N9T A;  1TS2 A;  3IFT A;  4YWM A;  3QG1 A;  1A3T A;  4JC0 A;  1GXD C;  2E75 C;  5J1Z A;  1PHJ A;  1VQD A;  3OPO A;  1XTD A;  1ONL A;  3SHL A;  2EJF C;  1V1P B;  1EQQ A;  3GTM B;  3S1N H;  1IYV A;  5KIX A;  1QE6 A;  2EY2 A;  3CQZ B;  1IXR A;  1JJ2 A;  2WAQ G;  3K5O A;  3OYY A;  4QIW B;  4R4C A;  2VUM H;  3VR3 A;  3ZYY X;  1PZJ D;  3EN2 A;  1R4Q B;  3ND8 A;  3SK8 A;  1LAC A;  3X3N A;  4JW0 A;  1WTW A;  1PH1 A;  3K81 C;  1S5D D;  3EVQ A;  3KDF A;  4KD3 A;  4NDX A;  3JC6 6;  5M5Y H;  2NVQ B;  1I6V C;  1PFS A;  3MXN B;  4K5V A;  1M8A A;  1WD0 A;  4CKC A;  2NYZ D;  3I4L A;  1ASZ A;  4QB4 A;  2L55 A;  1DD2 A;  2FHT A;  3HOW H;  2DN8 A;  2KJX A;  5GAG C;  1I4Q A;  1PH3 A;  3I4M H;  3RMH A;  4YY3 Q;  4OX9 Q;  2UXD Q;  2H5X A;  2XGT A;  1V1O A;  2ASB A;  3D8G A;  2F4V Q;  5JEA H;  4TSS A;  2OF1 A;  3CCU A;  2A74 C;  2GA4 B;  5COR A;  4BY1 H;  5JJL A;  4HIO A;  5BR8 L;  1FD7 D;  4IO9 A;  2H1E A;  2ZM6 Q;  2PI2 E;  1HA5 A;  1VMC A;  3PO2 H;  3MFY A;  2K03 A;  4WFN 3;  3P75 A;  2XIW A;  2ENB A;  1A62 A;  3MZ5 A;  4Z9C B;  3CHB D;  1NSN S;  1CUK A;  1EIH A;  4CDD C;  1TWF H;  1HFN A;  5COY A;  2NVX H;  4RCN A;  4CJ1 B;  2PMZ B;  2N55 A;  1B3A A;  1CK1 A;  1Y1V G;  3BG3 A;  2ZJP A;  3S1R H;  1DYQ A;  3VDY A;  3TRZ A;  2R93 H;  4KV6 A;  2YTX A;  3J7A 5;  4WJ3 M;  5EBD A;  3X3M A;  1OXT A;  5ISR A;  1BBX C;  1YHB A;  5IP7 G;  5ELN A;  4BA2 I;  3D4W A;  4NXN L;  3GTM H;  1UEA B;  4JI2 Q;  4B9X A;  1KIX A;  5ELF A;  1WCM G;  3MXN A;  4DR2 L;  1LTT D;  1N34 L;  3HOY G;  1TWC B;  3NHH A;  4PG3 A;  4QUF A;  4A3E G;  2OWO A;  3GTG H;  4B3S Q;  3N52 A;  5L37 A;  1WTH A;  1O7I A;  5E1F A;  2JJQ A;  1HR0 L;  5GAH C;  1GUO A;  2ZJQ A;  1PH7 A;  4DV5 L;  2EQS A;  4L5R C;  1EZ8 A;  1JCK B;  2KCC A;  5EJW A;  5A2Q E;  3I55 A;  4JI0 Q;  3FKI G;  1B9N A;  1JB7 A;  1ILQ A;  3RZO H;  5M5Y B;  1SMX A;  1WD1 A;  4LFA L;  3ICE A;  1BOS A;  4IUN A;  5IYD H;  3OW7 A;  3UE1 A;  4KJN A;  3HS0 C;  3MTS A;  2B2U C;  5IYC H;  4A3D H;  1QVG A;  1D5Z C;  3A74 A;  2CQA A;  4FF4 A;  1H9J A;  5K36 H;  4DK6 C;  2XRQ D;  1OO9 B;  2KHJ A;  5C4X B;  5C4X G;  1GO3 E;  2AQ2 B;  1G2T A;  1WTO A;  5JJK A;  5FLM G;  1FL0 A;  5C0X G;  4Q5V A;  1PH8 A;  1LLR D;  3HZX A;  4POF A;  2R6G A;  5DM7 3;  4JI2 L;  3SGI A;  1A0I A;  2CW0 C;  3QWN A;  3A8K E;  5GQO A;  2Z8L A;  2SNS A;  1JT8 A;  3PIO 3;  3VR4 A;  3PUZ A;  3NPP A;  2B3G A;  1PDQ A;  4FXD A;  4A3E B;  1STB A;  1GOZ A;  4HAE A;  1XYI A;  1Q82 C;  3GP7 A;  2F0E A;  1G6Z A;  5LMN W;  1EUJ A;  1VF5 C;  2UXC L;  1AZQ A;  1MBY A;  1J9O A;  3J7Z C;  1GJX A;  1TWH H;  2F0I A;  2NWG A;  1LT3 D;  3EIV A;  3QB3 A;  4ZUJ A;  2JE6 I;  4B3R Q;  1IKM A;  1KDC A;  2EE1 A;  3M9B A;  1T5E A;  3A8J E;  3JAM L;  2UXB Q;  2PQA A;  4B3T Q;  4C3I B;  1H9M A;  2MGS A;  4HTH A;  4AYB E;  4C3I G;  3D6W A;  3OWF A;  4HCS A;  1V43 A;  2XRS D;  1EQT A;  5IWA L;  4IPD A;  2H4O A;  1XMO Q;  4N8X 1;  4GLA C;  2IX0 A;  1VQF A;  4X65 Q;  2I5H A;  2MO0 A;  4ME3 A;  2VNU D;  1Q8K A;  4RAU C;  5G3L F;  4XXE A;  4QIW E;  2OQK A;  1QUQ A;  2L9H A;  3CCE A;  4C1N K;  2Z4H A;  5D3D A;  1X55 A;  1CKM A;  1PV4 A;  5K5P A;  4GNX C;  1NMF A;  2EY5 A;  1V8Q A;  4A3M G;  2B2T C;  3NTK A;  3QJY A;  1XXG A;  4N8F A;  3BDO A;  4U68 A;  3GTK H;  3S15 B;  2F0P A;  1GUG A;  2KCT A;  3D6C A;  4FF3 A;  4LUV A;  4YWL A;  4JBM A;  3J7A F;  3S1R B;  1EWI A;  4L8J A;  4XYQ A;  1HZC A;  1D5M C;  4UDU C;  1A2U A;  1J8I A;  3MXG A;  2R92 G;  3G7L A;  1NJI C;  1V1Q A;  1BVS A;  4HMJ A;  1PH5 A;  2QF7 A;  2XTI A;  2D0P A;  4DR4 L;  1K83 H;  1IHZ A;  3CAM A;  2XWB B;  4ZAI A;  2JYO A;  5M3F H;  1SJE D;  1CHP D;  3S16 B;  2VQF Q;  1I4X A;  1Y8N B;  2M9V A;  2QGQ A;  2MFI A;  3NXW A;  3OIQ A;  3RR5 A;  3T1Y Q;  1H9K A;  2R93 B;  1VQ6 A;  5KRU A;  1GD7 A;  1K28 A;  3S14 H;  1QNU A;  2K5D A;  4A4I A;  2RQX A;  1RDP D;  4LF9 L;  4OXP A;  1ILP A;  4DPG A;  1TWG B;  1F2M A;  3CCV A;  2VXW A;  4H7B A;  1L1O C;  5M9O A;  2EVB A;  1SAP A;  2GVA A;  3Q6S A;  1GUS A;  3IL8 A;  4X64 L;  1LTI D;  4RGT A;  2GVB A;  2FJ2 A;  1U0L A;  5DAU A;  3GTO B;  3KFU A;  3MAQ A;  1Q1B A;  2D2C C;  4C3H G;  4IOA A;  1D8L A;  1PVO A;  2F0O A;  2OT2 A;  3HOU B;  5C3E G;  4R8N A;  3TZU A;  2EDG A;  3HOY B;  3E3X A;  4A75 A;  1CKO A;  3RLF A;  1STA A;  1EQR A;  1FR3 A;  3H91 A;  2HCI A;  1JOQ A;  4OEL B;  3SXH A;  2PO4 A;  5IT9 E;  1PH6 A;  2X6L A;  3SEB A;  4DV0 Q;  1BBW A;  1D1K A;  1VQ8 A;  4HJ5 A;  5HGQ A;  1Q86 C;  3R8B A;  2IX1 A;  3K6O A;  4K8I A;  2HIV A;  4JK1 C;  4AQY Q;  1IBM L;  2F0D A;  3DM3 A;  2SOB A;  3RD4 A;  1EWC A;  4Y7N B;  3CRK C;  1CM9 A;  1WYD A;  3TN2 A;  1Y1V B;  1W3S A;  2EYH A;  4YCU A;  2Q2I A;  1JE4 A;  4NP5 A;  5FO7 B;  3KJP A;  1YHA A;  2KA7 A;  3PQI A;  3MVV A;  3TRE A;  5DLQ E;  2F03 A;  2Z6K C;  2UUB Q;  4A3C H;  3RLO A;  1TWF B;  1K8O A;  2NB0 A;  2A6H D;  1DCZ A;  2R7D A;  4A3K H;  2XN9 C;  3GTQ B;  2IJ0 A;  4JI1 L;  3H3V I;  4DR7 Q;  4GOP C;  3A8I E;  1HFG A;  4KMU C;  4C3J H;  1X3Q A;  4DAY B;  5GAE C;  2B2Y C;  5GAD C;  1P8L A;  2KCM A;  3M4P A;  3DMU A;  1CSQ A;  4OL7 A;  1CT1 D;  3HP3 A;  3E9H A;  4IJH A;  1ZYR D;  3KDF B;  2RCN A;  3OSO A;  2UXD L;  2J7Z A;  2R7F A;  1UNS A;  2L11 A;  3UI2 A;  1M4V A;  1KDA A;  3OTO L;  2AMC B;  3ITP A;  3PUV A;  1BDO A;  1VQC A;  3J7Y W;  3D4R A;  2QEX A;  2IY5 B;  4B9W A;  5LL6 X;  2QA4 A;  1Q1E A;  1SEB D;  3R3O A;  1YHQ A;  4NB3 A;  1PTO C;  5C6A A;  4L5S A;  2UU9 Q;  4C3J G;  3TDQ A;  4HSV A;  4ZLT F;  3I4O A;  1CSP A;  4A3M B;  2A6E C;  2VY3 A;  1O7L A;  2ZXR A;  5G3L D;  3CCJ A;  1ZXT A;  2O5J C;  5I9O A;  2B2W A;  4ABN A;  1X3P A;  3F2B A;  1IBL Q;  3HKS A;  2O2L D;  1LTB D;  2WB1 G;  4APV A;  2K50 A;  4GOP B;  1PTO B;  4G7O C;  1OXV A;  4R9W A;  5C5L A;  1C9O A;  1VQH A;  2FXQ A;  1V1P A;  4EQP A;  5M3M H;  5LMN L;  1EY8 A;  4BY7 H;  1WCM B;  3BVM A;  1DOL A;  2CH4 W;  4H13 C;  4ZCK A;  3K5L A;  1PH9 A;  5CYU A;  1I50 H;  4GLX A;  2O5I C;  4DV4 Q;  2NVY B;  1WFQ A;  1WTR A;  4I65 A;  2EY6 A;  4PMW A;  1SJH D;  1JOO A;  2K32 A;  1WTQ A;  4LFB L;  1NAP A;  5EAY A;  4BY7 B;  3NE5 B;  4DU9 A;  4RKB A;  4B08 A;  4DR1 Q;  5C44 G;  2I5L X;  3T13 A;  1BCP C;  3FP9 A;  3S15 H;  3GTK B;  1JB3 A;  5C3E H;  2NUC A;  1K8M A;  1KNA A;  4CDC C;  4BWG B;  4LF4 L;  1IW7 D;  1AE2 A;  1C7Y A;  4CJ0 B;  1SE2 A;  4JI0 L;  3QOJ A;  2TSS A;  5I2Y A;  3WDN A;  5EGT A;  1ASY A;  4C2M B;  3CXC A;  1BF4 A;  1AE3 A;  4O42 A;  1DM0 B;  2JQO A;  4KHV A;  1A8V A;  3M7G A;  3JAM i;  4DAP A;  3FHW A;  3H0G B;  4RMF A;  4XT3 B;  1NE3 A;  4AH6 A;  3M4O H;  4J6H A;  2B8F A;  2B8G A;  3MEF A;  1PZK D;  5C44 H;  4JI6 Q;  1EOT A;  4B3M Q;  3T1Y L;  2I46 A;  4A3D B;  1VQO A;  4X66 Q;  3AMU A;  5CBA E;  4H44 C;  3BYY B;  3CC7 A;  4DR1 L;  2HDL A;  2E2H H;  1N32 Q;  1QB5 D;  5CR3 A;  1KC8 C;  2ATW A;  4BY7 G;  4JI8 Q;  1YNJ C;  4IN3 A;  4OIK A;  5M3M G;  4IUV A;  4PMC A;  1TU2 B;  1LTA D;  1LO5 D;  2JA5 B;  2L5T A;  3I8Z A;  3R93 A;  3TME A;  2E2I B;  2N3S A;  5HY6 A;  1Q81 C;  4IJL A;  2AQ1 B;  1JJC B;  1FNV A;  4C3H B;  3VYU A;  1PRT F;  1SRO A;  2OQ0 A;  2WKC A;  4QMG A;  4A3M H;  1S5C D;  1STG A;  4Q0F A;  2XNA C;  4JI7 L;  1GHK A;  4DV5 Q;  4DR5 Q;  3I2Z A;  3PIO A;  3TSS A;  5FO8 B;  2N78 A;  3CRL C;  4HR7 B;  2JN4 A;  4DGZ A;  2VB2 X;  5A2Q L;  1XWE A;  1HTL D;  1E1T A;  2MUY A;  3W5O A;  5J3B A;  4GKJ L;  1G91 A;  4JV5 L;  2WB1 E;  1Q7Y C;  1D7Q A;  2A1A A;  4C3I H;  5E3F A;  3GTP H;  1HUN A;  1C0A A;  3P7J A;  2V1C C;  3AYH B;  4GN3 B;  3A7A B;  2BA0 A;  4RGM A;  2LKV A;  3K80 C;  2JXM B;  4A3K G;  1MGS A;  2XVS A;  3K7U C;  3K7A H;  3NWS A;  4A3C G;  1HZB A;  1CFM A;  3MFG A;  2PNH A;  1HJP A;  2YYZ A;  2G9D A;  1YJ9 A;  1PRT C;  4QY7 A;  1B9M A;  1TT2 A;  2EXZ A;  2PQE A;  1NY4 A;  3C2P A;  1LAB A;  3BZK A;  4DV7 L;  4DR3 Q;  5EPK A;  3CCQ A;  1G6P A;  2RBM A;  2EIF A;  2D0O A;  1L1O B;  1UE1 A;  5M3F B;  3I4M B;  3CW2 C;  3EA6 A;  4DV0 L;  2PMZ E;  2YU9 H;  4Y52 H;  4IPH A;  4ILW A;  2C5C A;  3J80 c;  5LHY 1;  1N32 L;  1FNW A;  2EXD A;  1F9P A;  1ZYR C;  3J81 i;  4YCV A;  4C1N I;  5JJI A;  4LF6 L;  1XPO A;  3K0Y A;  2L12 A;  4KKU A;  5C0X H;  5C4X H;  3OHX C;  5K36 G;  1Y69 U;  4X3S A;  3CPF A;  1OXU A;  3PUY A;  4IUQ A;  4CKE A;  4A3D G;  1SNM A;  2PCF B;  2B2T A;  1LT5 D;  2KED A;  5H1S E;  4C3H H;  3H09 A;  2QIL A;  5A35 A;  4JVZ A;  5IYD G;  4X3K A;  4OWW B;  5EPL A;  3GQB A;  1PFN A;  3TS0 A;  3J80 L;  4R4T A;  1X3F A;  2KEN A;  3MHB A;  5CC4 A;  1SYB A;  2VQE L;  5JJZ A;  1DOK A;  1RF2 D;  5BN5 A;  2UU9 L;  1KLU D;  4A3J B;  1N9W A;  4JI5 Q;  4YCW A;  3RN5 A;  4WJ4 A;  1T9H A;  2C35 B;  1VCI A;  1X65 A;  4GKK Q;  4OIJ A;  4FYD A;  1TII D;  1HNZ Q;  2M00 A;  2F52 A;  3KUP A;  5M3F G;  3PV0 A;  1CA6 A;  2KHI A;  1SND A;  1PXU A;  4LF8 L;  1Q90 A;  4A3I B;  2MNA A;  4H02 A;  4KHP Q;  2N8N A;  2IPK D;  3CKI B;  1B50 A;  1WCM H;  1CKN A;  2ZTE A;  1IBK L;  1ET6 A;  5C0X J;  1AP0 A;  4PMB A;  3F2D A;  1EQV A;  1SNP A;  5T1I A;  3GTL B;  1LTG D;  1X3G A;  2F3W A;  3RZD B;  2R92 H;  1KXL A;  3PCO B;  2E74 C;  1HTP A;  4IPG A;  1VQ4 A;  3BJU A;  1EZ6 A;  1IL2 A;  2AKW B;  4EQN A;  4WOR A;  2F0N A;  1E22 A;  2YV5 A;  4DV3 L;  2HUG A;  2R93 G;  1HQR D;  2EYF A;  4M1U B;  1QIL A;  1Y1V H;  1D2B A;  4J8Q A;  4L63 B;  1F2Z A;  2R3Z A;  1PA6 A;  3UDI A;  2NVX B;  3OW2 A;  3KF6 A;  1JR0 D;  1K83 B;  2K75 A;  1VQ5 A;  2CKZ B;  2ZM6 L;  1O78 A;  1TXY A;  3AQQ A;  2D9U A;  2K4K A;  3GTQ H;  3D31 A;  2NZO A;  1NMG A;  1D6E C;  3LX0 A;  3CCL A;  3PO2 B;  1O7Z A;  3PO2 G;  3VR6 A;  3NBI A;  3U9O A;  2KOL A;  4HCE A;  3ULP A;  3TZD A;  3HOZ B;  1EWH A;  4HJA A;  5KNB A; 
#chains in the Genus database with same CATH homology
 2VQF Q;  4YHH Q;  1OTC A;  2BH8 A;  2QGQ A;  2MFI A;  1PH2 A;  1P16 A;  4A3B H;  4X6A H;  2NZH A;  3RR5 A;  3T1Y Q;  3M3Y H;  1J5E Q;  5IP9 G;  1UE5 A;  2LXK A;  1VQ6 A;  2F4V L;  3KLW A;  4LUZ A;  4MTN A;  4A3I G;  1GD7 A;  3I4M G;  2Q2U A;  3S14 H;  1M90 C;  2JA7 H;  3PUW A;  4MZ9 A;  2JEA I;  4A4I A;  2NVT H;  2IHF A;  4DAM A;  3HOW G;  2VQF L;  2NN6 I;  2UUA Q;  4LF9 L;  3NEN A;  4OXP A;  1YNX A;  3T1H L;  1I6H H;  4DPG A;  4DR7 L;  4PZ7 A;  3CCV A;  2NN6 G;  2DUD A;  1HNX Q;  1L1O C;  2GVA A;  2WFW A;  4LF5 L;  4X64 L;  3I4N H;  2GVB A;  1A63 A;  4K0K Q;  1U0L A;  1I5F A;  1IZ6 A;  1X3E A;  3KFU A;  4UY8 C;  3UDG A;  1EOV A;  1Q1B A;  4IOA A;  1PVO A;  1D8L A;  4IFD J;  2ZJR A;  4JV5 Q;  1MIU A;  4GLV B;  2CQO A;  1LYL A;  1HNZ L;  2E2I H;  2ZTC A;  5C3E G;  4GS3 A;  4IOC A;  4PZ6 A;  4AYB G;  1L1O A;  4A75 A;  1LM0 A;  3ULL A;  1VQL A;  1Q12 A;  1CKO A;  1K3R A;  3RLF A;  4A3L H;  1XNR L;  1S72 A;  4UPA A;  4JI3 L;  1EQR A;  5IE8 A;  4ALP A;  5IY0 A;  1HNW Q;  4HIK A;  3NEL A;  3S2D H;  1PH6 A;  3HOX H;  1JMC A;  2K52 A;  1VQK A;  1AH9 A;  4DV0 Q;  1BBW A;  4TQU S;  3U4Z A;  4A3F G;  1VQ8 A;  4KLK A;  1S3O A;  4HJ5 A;  3M4Q A;  5HGQ A;  5FLM H;  1Q86 C;  3KF8 B;  1YEZ A;  2IX1 A;  3G48 A;  4P73 A;  3CCM A;  3G6E A;  2Y0S G;  4JI3 Q;  2HIV A;  2UXC Q;  4LF4 Q;  4AQY Q;  1IBM L;  3RNU A;  2ALY B;  2BH2 A;  3DM3 A;  4C2M H;  1K8G A;  1SLJ A;  1XNR Q;  5IYC G;  1TWC H;  1WYD A;  1QZH A;  4A93 H;  1W3S A;  1V9P A;  2F3I A;  3OTO Q;  4YCU A;  2Q2I A;  1E3P A;  2AWN A;  4DV3 Q;  4B3S L;  3HOV H;  3KJP A;  1YHA A;  2CWP A;  1K0R A;  3TRE A;  5DLQ E;  3RN2 A;  3GTO H;  2Z6K C;  2UUB Q;  4A3C H;  3CME A;  3RLO A;  3FKI H;  2MO1 A;  3E9I A;  1BBU A;  3H0G H;  2ES2 A;  4LF7 Q;  4A3G G;  4DR2 Q;  3D0F A;  2RHQ B;  4B3T L;  2R7D A;  3NBH B;  5AJ3 Q;  3PIP A;  4A3K H;  1HZ9 A;  2N49 A;  2VL6 A;  2CCZ A;  2HIX A;  1KHI A;  3K8A A;  4JI1 L;  3H3V I;  4DR7 Q;  2UXB L;  4L5T A;  1TWG H;  4GOP C;  1KAW A;  3STB C;  4C3J H;  4DAY B;  4P71 A;  5GAE C;  5FJ8 G;  3T1H Q;  1H95 A;  5GAD C;  1P8L A;  3G71 A;  2GN5 A;  2KCM A;  5ELO A;  2I5M X;  3M4P A;  1XMQ Q;  2Q2T A;  4OON A;  3S24 A;  1HZA A;  4LF7 L;  1FVI A;  1CSQ A;  2B29 A;  3HOZ G;  2Q2H A;  3E9H A;  3HFZ B;  4QJF A;  4IJH A;  3BZC A;  3KDF B;  4LF8 Q;  2Z0S A;  2RCN A;  5LMU L;  4BBR H;  3S16 H;  1L2F A;  3ZJY C;  3PO3 H;  2UXD L;  4JOI C;  2R7F A;  2K14 A;  1VQB A;  1G29 1;  3OTO L;  3CPW A;  2AMC B;  3PUV A;  4YHH L;  3I56 A;  4A3E H;  3CC2 A;  1EIF A;  1Y14 B;  4LFC Q;  2VS1 A;  1VQC A;  3HOY H;  2IY5 B;  2QEX A;  4XTC S;  1CKN B;  1MKH A;  3PO3 G;  4JBJ A;  4EQ5 A;  4HIM A;  1K9M C;  4POG A;  3S17 H;  2Y0S E;  4DUY Q;  2QA4 A;  3M7N A;  4DR4 Q;  1Q1E A;  4JI5 L;  4JG2 A;  4DK3 C;  1KD1 C;  2UUC L;  2YU9 H;  5LMU Q;  3PF4 A;  5AJ3 L;  1YHQ A;  3HOZ H;  1N33 Q;  2AHO B;  4NB3 A;  2ZTD A;  1WI5 A;  1Z9F A;  4L5S A;  2UU9 Q;  1N34 Q;  2NVY H;  3CMA A;  1YIT A;  1SRU A;  5IP7 H;  3L2P A;  4LF5 Q;  4QL5 A;  1I3Q H;  1DGS A;  2CWA A;  2HQL A;  4LF6 Q;  4HJ8 A;  1XPU A;  3I4O A;  1CSP A;  1NBW A;  5LMN Q;  3Q8D A;  1FJG Q;  3W1G A;  1HR0 Q;  2VY3 A;  3PUX A;  1XNQ Q;  4GKK L;  3H3V H;  2MQH A;  1JE5 A;  1IYJ B;  1OXS C;  3H0G G;  4OWX B;  4JYA Q;  1PYB A;  3CCJ A;  2WP8 J;  3NEM A;  1EYG A;  3GTQ H;  3HOU G;  2AWO A;  3M85 A;  1VQE A;  3KYH C;  1LUZ A;  1QUQ B;  3AFQ A;  4DV2 Q;  2PI2 A;  3F2B A;  1IBL Q;  3HKS A;  4P75 A;  1KQS A;  1QVF A;  1OXX K;  2WB1 G;  4APV A;  3E0E A;  4RG1 A;  1X6O A;  2K50 A;  4GOP B;  1XMQ L;  1XMO L;  1HR0 W;  1OXV A;  3TS2 A;  2YTV A;  1C9O A;  3UDX A;  1VQH A;  3W1B A;  2A8V A;  5GRO A;  1LTL A;  2FXQ A;  4YWM A;  5M3M H;  5LMN L;  4BY7 H;  4JC0 A;  4TVA B;  3TEH B;  4LFA Q;  1PH9 A;  1PHJ A;  1I50 H;  4GLX A;  1VQD A;  1VQM A;  1XTD A;  4DV4 Q;  1BKB A;  2PQA B;  1WFQ A;  2IHE A;  4O2D A;  4P72 A;  4DR5 L;  4JBW A;  4PMW A;  1SN8 A;  4BY1 G;  1EQQ A;  1YZ6 A;  3HOX G;  3S1N H;  4BBS G;  1FGU A;  1IXR A;  3KF6 B;  1JJ2 A;  2OTL A;  4LFB L;  3CCR A;  3F8T A;  2WAQ G;  5EAY A;  4DV6 L;  2RHS B;  2E5L Q;  3H15 A;  5C4J H;  3OYY A;  5JEA G;  2VUM H;  4R4C A;  1N36 Q;  4A3L G;  3B6Y A;  4DR1 Q;  5C44 G;  2I5L X;  2LXJ A;  3EN2 A;  3FP9 A;  3S15 H;  3ERS X;  5C3E H;  2RF4 A;  1PH1 A;  3K81 C;  1YI2 A;  4LF4 L;  3KDF A;  1Q46 A;  1AE2 A;  3JC6 6;  5M5Y H;  1C7Y A;  1PFS A;  3MXN B;  4JI0 L;  3J81 j;  4JI4 L;  3HKZ G;  1ASY A;  4XIG S;  3I4N G;  4YY3 L;  4OX9 L;  3GDE A;  3CXC A;  3J81 c;  1ASZ A;  3G4S A;  1N8R C;  1AE3 A;  4DV4 L;  4PZ8 A;  1X9N A;  3J80 i;  4LNQ A;  2JQO A;  1HH2 P;  1A8V A;  3JAM i;  1HNX L;  3HOW H;  3FHW A;  3TQY A;  5GAG C;  2NVQ H;  2JA7 G;  1MJE A;  4RMF A;  1PH3 A;  4QQB X;  1VQ7 A;  3I4M H;  3M4O H;  1NE3 A;  4AH6 A;  1K8A C;  4YY3 Q;  4OX9 Q;  4JOI A;  2OTJ A;  2UXD Q;  3A5Z B;  2H5X A;  2XGT A;  3MEF A;  5C44 H;  2ASB A;  4A3B G;  2F4V Q;  4JI6 Q;  2VUM G;  4B3M Q;  3T1Y L;  4DR6 L;  3CCU A;  4X66 Q;  1VQO A;  4IPC A;  3STB D;  1GVP A;  4X64 Q;  1YJW A;  1SE8 A;  4BBS H;  4BY1 H;  5JJL A;  4AQY L;  1IBM Q;  4HIO A;  4J15 A;  5BR8 L;  2KBN A;  3CC7 A;  4HID A;  4DR1 L;  4IO9 A;  2E2H H;  2ZM6 Q;  1N32 Q;  1YBY A;  2PI2 E;  1VQN A;  4LWC A;  3PO2 H;  4LW1 A;  1KC8 C;  2ATW A;  4BY7 G;  4JI8 Q;  5M3M G;  4DR6 Q;  1A62 A;  2CFM A;  2K5V A;  1CUK A;  4DUZ L;  4B3M L;  3HKZ E;  1TWF H;  1X54 A;  1VQI A;  2JA8 G;  1N33 L;  1UEB A;  3CC4 A;  2NVX H;  4OO1 G;  1WOC A;  4HJ7 A;  3UDF A;  5BR8 Q;  1L0W A;  3HOU H;  1Y1V G;  2N3S A;  3IRB A;  5HY6 A;  4X62 L;  4IJL A;  2ZJP A;  3S1R H;  1Q81 C;  4NXM Q;  3VDY A;  3TRZ A;  2R93 H;  3S1Q H;  1JJC B;  4A3J H;  1JJG A;  2YTX A;  3AEV A;  1PYS B;  3J7A 5;  1WJJ A;  4WJ3 M;  1SRO A;  4EX5 A;  2OQ0 A;  2WAQ E;  4A3M H;  1RIP A;  1OXT A;  3PF5 A;  1YHB A;  5IP7 G;  3U4V A;  4JI7 L;  5ELN A;  5M5W H;  4DV5 Q;  4DR5 Q;  4BA2 I;  3I2Z A;  4NXN L;  3GTM H;  1B70 B;  3CP0 A;  3PIO A;  4JI2 Q;  1KIX A;  2N78 A;  4UP7 A;  1WCM G;  3ULJ A;  2JK8 A;  2D62 A;  1E1T A;  3W5O A;  4DR2 L;  5J3B A;  2JA9 A;  4GN5 A;  4QGU A;  1N34 L;  2E2J H;  4R4O A;  3HOY G;  4GKJ L;  1M1K C;  4JV5 L;  4PG3 A;  4A3E G;  2OWO A;  2WB1 E;  1Q7Y C;  1D7Q A;  3GTG H;  2R7Z H;  4B3S Q;  2A1A A;  4C3I H;  4DKA C;  2HHH Q;  4BBR G;  1W2B A;  4UP8 A;  1Y1W G;  3GTP H;  1K73 C;  1VS0 A;  3K0X A;  1C0A A;  1O7I A;  4JYA L;  4R1J A;  4FDB A;  4DV1 Q;  2JJQ A;  4R4Q A;  1B7Y B;  3CQZ H;  4KHZ A;  5GAH C;  1HR0 L;  1XNQ L;  2V1C C;  3AYH B;  5FJ8 H;  4GN3 B;  2ZJQ A;  2IT1 A;  4BXX H;  1IBK Q;  3UE0 A;  1PH7 A;  2BA0 A;  2EQS A;  4DV5 L;  1VQ9 A;  3KJO A;  4L5R C;  4NXN Q;  1XPR A;  3K80 C;  4A3K G;  2JA5 G;  3I55 A;  3RZD H;  3K7U C;  3K7A H;  4JI0 Q;  4JI8 L;  3FKI G;  4A3G H;  3U58 A;  4A3C G;  1JB7 A;  1U5K A;  1HZB A;  1E1O A;  3LGJ A;  1SMX A;  2PNH A;  1HJP A;  3RZO H;  4LFA L;  2YYZ A;  3PSI A;  1YJ9 A;  2OCE A;  1MJC A;  3ICE A;  4Y7N H;  3S1M H;  3HOV G;  4IFD G;  4DV1 L;  4LFB Q;  5IYD H;  3F1Z A;  4R4I A;  2B63 H;  4A93 G;  3UE1 A;  4X62 Q;  4QY7 A;  1J6Q A;  4LFC L;  1HNW L;  5E7N A;  5IYC H;  4A3D H;  1QVG A;  4L5Q A;  1NY4 A;  3BU2 A;  3A74 A;  1EIY B;  4DV6 Q;  3BZK A;  4DK6 C;  4DV7 L;  4DR3 Q;  4B3R L;  2KHJ A;  3CCQ A;  1G6P A;  2EIF A;  2D0O A;  5C4X G;  1GO3 E;  1L1O B;  1UE1 A;  4K0K L;  5JJK A;  3CW2 C;  1FL0 A;  5FLM G;  3JAM c;  5C0X G;  2PMZ E;  2DGY A;  4DV0 L;  1PH8 A;  4IPH A;  4A3F H;  1TWA H;  1Z47 A;  4Y52 H;  1KRT A;  5IYB H;  3J80 c;  3I7F A;  1EFW A;  4POF A;  1N32 L;  4GNX A;  2EXD A;  5M5X H;  2R6G A;  4LUO A;  5C0X I;  3GTJ H;  3J81 i;  4YCV A;  4JI2 L;  5IYB G;  3SGI A;  5JJI A;  1A0I A;  4LF6 L;  1XPO A;  4BA1 I;  1KL9 A;  1VQG A;  5C4X H;  3CF5 A;  3ER0 A;  5GQO A;  1JT8 A;  1YVC A;  4UP9 A;  5K36 G;  3PUZ A;  3CPF A;  1OXU A;  3PUY A;  4OO1 I;  4A3D G;  2B3G A;  3L7Z C;  4GNX B;  5JEA J;  4C3H H;  5H1S E;  2B63 G;  5IWA Q;  4DNI A;  5IYD G;  4NXM L;  1Q82 C;  1G51 A;  3S2H H;  4OWW B;  1PH4 A;  3CD6 A;  5LMN W;  1EUJ A;  1KRS A;  1RL2 A;  3TS0 A;  3F2C A;  1QZG A;  2UXC L;  4R4T A;  1X3F A;  2KEN A;  1GKH A;  3GD7 A;  3PGZ A;  4HJ9 A;  2JA5 H;  3GTL H;  3J7Z C;  2VQE L;  1TWH H;  4NPS A;  4X66 L;  2UU9 L;  3EIV A;  2UUB L;  2JE6 I;  4B3R Q;  3A5U A;  4P74 A;  1N9W A;  4BXX G;  4KHP L;  4YWK A;  4A3I H;  1I94 Q;  1SR3 A;  3RLN A;  3M9B A;  4YCW A;  3RN5 A;  1XJV A;  4JI4 Q;  5IP9 H;  4JI5 Q;  2HT1 A;  4O0A A;  4WJ4 A;  3L0O A;  1T9H A;  2C35 B;  4JI1 Q;  2K5H A;  2UXB Q;  1VCI A;  1X65 A;  4GKK Q;  2PQA A;  1Y1W H;  4B3T Q;  1QVC A;  5IT9 c;  4OWT B;  4AYB E;  2R7Z G;  1V43 A;  1S40 A;  1HNZ Q;  5M3F G;  2F52 A;  5IWA L;  1X56 A;  4IPD A;  1NTG A;  2HHH L;  3PV0 A;  1XMO Q;  2KHI A;  4GLA C;  3AFP A;  4GKJ Q;  2IX0 A;  1I94 L;  2A19 A;  4DUZ Q;  4LF8 L;  1VQF A;  3GO5 A;  4H02 A;  2N8N A;  4X65 Q;  2I5H A;  2MO0 A;  4ME3 A;  2MNA A;  4KHP Q;  2VNU D;  1YIJ A;  1WCM H;  1CKN A;  2K5N A;  1Q8K A;  2ZTE A;  4AIM A;  1IBK L;  2JEB I;  1VQA A;  4QIW E;  2OQK A;  5C0X J;  2VW9 A;  1VQP A;  1QUQ A;  3F2D A;  1UE7 A;  4JBK A;  3CCE A;  1X3G A;  2R92 H;  2JA6 G;  1KXL A;  3KOJ A;  1X55 A;  1CKM A;  4A76 A;  1PV4 A;  4GNX C;  1SFO H;  3PCO B;  4JCV E;  1NMF A;  3U50 C;  4A3M G;  4IPG A;  4X65 L;  2LSS A;  1VQ4 A;  3BJU A;  1IL2 A;  2AKW B;  4JI6 L;  4GN4 B;  4DV3 L;  1E22 A;  2YV5 A;  4A3J G;  4DV2 L;  2R93 G;  3GTK H;  1E7Z A;  4IFD I;  1R9T H;  1Y1V H;  2E8G A;  2KCT A;  1PA6 A;  3UDI A;  4LUV A;  3WWV A;  4YWL A;  3CCS A;  4JBM A;  4MNO A;  1FJG L;  3OW2 A;  1EWI A;  3KF6 A;  1UWV A;  2K75 A;  1VQ5 A;  2CKZ B;  3DLL A;  2ZM6 L;  2JA8 H;  1GM5 A;  1HZC A;  1TXY A;  3AQQ A;  3A0J A;  2E5L L;  2K4K A;  2JA6 H;  1N36 L;  2R92 G;  2VZA A;  1YJN A;  2UUA L;  3D31 A;  2NZO A;  1E24 A;  1NMG A;  2BA1 A;  4LF9 Q;  2ID0 A;  1VQJ A;  1NJI C;  4KI0 A;  1V1Q A;  4JI7 Q;  2Z6K A;  3CCL A;  1B8A A;  1BVS A;  2VQE Q;  3PO2 G;  1J5E L;  1PH5 A;  2YTY A;  2XTI A;  2D0P A;  5FLX c;  1IBL L;  4DR4 L;  1K83 H;  3ULP A;  2UUC Q;  3CAM A;  2L15 A;  4DV7 Q;  4DR3 L;  4HJA A;  2I0Q A;  4DUY L;  4GOP A;  1UE6 A;  5M3F H;  3EBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...