2VQEL

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqeL00
3W1GA 1C7YA 4R1JA 2OTLA 3PGZA 3OW2A 4JI6Q 3UDFA 1VS0A 2E5LQ 1IBLL 3HKSA 4A3BG 4JI3L 4YY3Q 2R7ZH 4DR4L 1N8RC 1R9TH 5GROA 1BKBA 4IPHA 2MNAA 1S40A 3NEMA 2OTJA 5IE8A 1XMOQ 5HY6A 3HOYH 4JI7L 3GTPH 4KHZA 3UE1A 4DV4Q 4HJAA 3VDYA 4LW1A 2JE6I 4YCUA 3S1QH 3KJOA 2AHOB 3K81C 1PH2A 2R92H 4DV7L 1NJIC 3UDIA 2ZM6L 3PO2G 3PO2H 3TQYA 1SROA 4JI4L 2FXQA 1IBML 4X64Q 4A3FG 1W2BA 3TRZA 4B3SL 1PVOA 2UUCQ 3HOWG 4BBSH 2I5LX 3KF6B 3S24A 2RF4A 1HZBA 4JI5Q 4BXXG 4JYAL 4KHPQ 3EN2A 5M3FG 2LXKA 1UEBA 3Q8DA 2QEXA 1QUQA 1SE8A 1UWVA 1HNZQ 5GAEC 2Q2HA 4YHHL 2LXJA 2JA6G 1QUQB 3M9BA 1OXSC 3OTOQ 2IT1A 4A3LG 4HJ9A 2VUMH 1T9HA 5C4XG 4YWMA 1PV4A 4AYBG 2IY5B 3AQQA 4AQYL 1QVCA 1L1OB 2WAQG 3KOJA 3RZDH 1LUZA 3BZCA 1UE6A 4O0AA 3F2BA 1YBYA 1GVPA 5M5WH 4QGUA 3CMEA 4A3KG 1M1KC 3CF5A 1IYJB 4L5QA 1VQKA 1OXVA 3KJPA 1HR0Q 1W3SA 5C3EH 2VQFQ 2R93H 4NXML 3ULJA 2F52A 1P16A 1TXYA 4A4IA 1PFSA 3D31A 1EYGA 4JI8Q 1KAWA 1HNWL 1VQPA 4LF9Q 3RNUA 4JI8L 1IBKQ 3G6EA 4UP9A 1SRUA 3A74A 3F2DA 1Q12A 4JBMA 3F2CA 4A3IH 3PUZA 2ZJRA 3M4OH 3JAMi 4A93H 1I50H 2DUDA 1CSPA 2YTYA 4UPAA 4DR5L 1JT8A 5IT9c 5FLMH 3H0GG 4JBWA 4RMFA 5HGQA 3CMAA 5FLMG 3WWVA 4DR3L 3H3VH 2DGYA 3PUVA 4R4CA 4LF8L 5IYDG 1IZ6A 4GLAC 5ELOA 3OTOL 4XTCS 3UDGA 5C0XG 2CQOA 1KC8C 2HIVA 4QIWE 2ZTCA 1Q7YC 3T1YQ 1JJ2A 3GTOH 1QVFA 3NENA 5IWAL 3J7ZC 1NMFA 2OQKA 4DR2L 2ES2A 3S15H 2VQEQ 2H5XA 3I4OA 4YWKA 3TS2A 3SGIA 4IOCA 1RL2A 1IL2A 3I4MH 2BA1A 4DR7Q 2OQ0A 3L7ZC 2AKWB 1UE1A 4DV3L 5FLXc 4BY7H 1AE2A 1GO3E 4JOIA 4EX5A 4DV2Q 1GD7A 1Z47A 4DV5Q 1X9NA 1J5EQ 3GTQH 2ALYB 1I94L 4B3TL 2ZJQA 4LF9L 2D62A 1HNWQ 3RR5A 2UXCL 3M7NA 4OO1I 3I4NH 2UXDL 4JC0A 4XIGS 1N34Q 1VCIA 5IP9H 4GS3A 1K83H 1P8LA 3J80i 1C9OA 1HR0L 1KL9A 5JEAJ 4HIKA 2Q2TA 3J80c 5ELNA 1CKNB 3L0OA 3PUWA 1N36L 2UUBL 2A19A 1OTCA 4HJ7A 1VQFA 4JI0Q 2UXDQ 4AYBE 4BY1H 5E7NA 4A3EG 5IYDH 1HJPA 2RHSB 4QY7A 5LMUQ 4DV5L 4C3HH 1YJWA 4DR4Q 1Y1VH 3HOUH 4B3RL 4EQ5A 4O2DA 2E5LL 5AJ3Q 1X3EA 1VQNA 1YNXA 4DAMA 3ICEA 3U4ZA 4X66L 1E7ZA 2GN5A 4DK3C 4BA1I 5IWAQ 2VY3A 3AFPA 1Z9FA 5M5XH 3RN5A 2IX1A 1V9PA 2NVTH 4KHPL 4JBJA 4UP8A 4P72A 4C2MH 3CP0A 3KDFA 4GLXA 2E2IH 2I5HA 1EIYB 4PMWA 4B3RQ 4GKJQ 2Q2IA 4A75A 2UUCL 4JI2L 1UE7A 3STBD 2HT1A 4IFDJ 4MTNA 4DV0L 1IBMQ 4B3MQ 3K8AA 3W5OA 2JEAI 2AMCB 3RZOH 4LFCL 4LF6Q 4GOPC 2Q2UA 3GO5A 4GKKQ 3HKZE 4OO1G 1AE3A 4GN4B 4X62L 3G48A 3PV0A 3S1MH 2UUBQ 3A5ZB 3S2DH 2WFWA 4DV0Q 1VQ5A 2IHEA 4DUZL 1MIUA 2MFIA 4Y7NH 3HOVH 4QL5A 1S72A 2WP8J 3CAMA 1EQQA 4DV6Q 3MEFA 4OONA 4DR6L 3KF8B 5GADC 3AYHB 4JI7Q 1OXUA 1X3GA 5GQOA 1PH9A 4GNXB 3G71A 2Y0SG 3S17H 4GOPB 2N8NA 3MXNB 1HH2P 3BJUA 4A3JH 3CC7A 3NELA 1EIFA 4PZ6A 5AJ3L 1J5EL 1FL0A 2YTXA 4L5TA 5C0XI 4DV3Q 5JJIA 4A3GG 3S14H 4L5SA 1SMXA 2VQFL 5C0XJ 3IRBA 3AFQA 2LSSA 3CPFA 3KYHC 3PF4A 2AWOA 5C4XH 2VUMG 2KCTA 1EUJA 1VQIA 2NN6I 3KDFB 3I4MG 4DPGA 4DV1L 4JI0L 4WJ4A 1CKNA 3STBC 2V1CC 3CCEA 4LFBQ 1KXLA 2GVAA 4DV6L 2PI2A 4DR6Q 1JJGA 2E2JH 2EIFA 5GAHC 4NXNL 2NZOA 4DUZQ 1Q46A 3F8TA 4LNQA 2VNUD 2K75A 3U4VA 2OCEA 4X62Q 1Y1WG 4A3MH 2C35B 5IYBH 4DR5Q 1N33L 3CD6A 2UXCQ 4IPCA 3S1RH 4X65L 4A3JG 5JEAG 1N9WA 1I94Q 2N78A 3CCRA 2B29A 1TWFH 1I3QH 2JA5H 1WJJA 4GKJL 1K8GA 1XTDA 4JI1L 3PF5A 4UY8C 4DR7L 3S2HH 2A1AA 4A3IG 4X64L 4QQBX 4WJ3M 1VQOA 1HNXL 1BVSA 1MJCA 1MKHA 3G4SA 3D0FA 2PMZE 1JE5A 4X66Q 2WAQE 1QZHA 2RCNA 4R4OA 1X3FA 3K7UC 1PH7A 1N32Q 1I5FA 1V43A 3ULLA 1NY4A 3JAMc 3H0GH 3KLWA 4HIDA 3S16H 2JA7H 1Q82C 5LMUL 3GTGH 3TS0A 4KI0A 3CCUA 4IFDI 3NBHB 1Q86C 2B63G 4P73A 2QA4A 1KRTA 3K7AH 1VQBA 4LFBL 3CCSA 4DR1Q 4DV1Q 1VQ7A 4JOIC 1N36Q 3EIVA 1LYLA 1G51A 5IP7G 4IJHA 4HJ8A 4A3FH 3J81c 2UU9L 1PHJA 1B70B 1NBWA 5J3BA 3H15A 2NVXH 1X55A 2AWNA 2XTIA 3CC2A 2OWOA 1EQRA 2K5HA 3FP9A 1YJ9A 4LUOA 4JI6L 3H3VI 1N32L 4MNOA 1CKMA 1HNZL 3E9HA 1YI2A 1AH9A 2WB1E 2ZTEA 2F4VQ 1B7YB 3FKIG 4BBRH 1Q1EA 1EFWA 1WOCA 2JA8G 2R7FA 3CCQA 4A3BH 3CCJA 2Z6KC 5EAYA 3RN2A 1VQGA 2PQAB 1G291 3AEVA 4AH6A 1E1TA 4LF5L 2R6GA 2PNHA 3I55A 1YJNA 1N33Q 4LF7L 1VQJA 4HIOA 1FJGQ 4LF6L 4LFCQ 4GKKL 3PO3G 4Y52H 1PYSB 2YTVA 1A62A 4OWXB 3CC4A 2MQHA 3TREA 4NXNQ 3CW2C 4JI2Q 2JA7G 1B8AA 3GTMH 4L5RC 2R92G 3PUXA 1VQ9A 1E3PA 1KRSA 4BY7G 4NB3A 5M3FH 5FJ8H 3GTKH 3PIOA 1PYBA 1WI5A 3T1HQ 2CCZA 2HHHQ 4POGA 4GNXA 2GVBA 4BBSG 2BH2A 1Q1BA 2QGQA 4IO9A 4C3IH 4GOPA 3RLOA 3EBEA 1HZAA 4OWWB 3KFUA 3CQZH 3U50C 1X65A 4JV5Q 4A93G 1XNRL 3HOZG 3S1NH 5C44G 2PI2E 3FKIH 1BBUA 4TVAB 4BBRG 2K4KA 2D0OA 3M85A 4A3EH 4BY1G 1HZ9A 1LM0A 1WFQA 1UE5A 4IPGA 5IY0A 1PH4A 4NXMQ 1QVGA 2IX0A 2K5VA 4A3LH 4GN3B 1E24A 1VQAA 1Y1VG 3HOUG 3M3YH 2UUAL 1NTGA 2JEBI 5M3MG 1OXTA 4J15A 1XPOA 1HZCA 3J81i 4JBKA 1YEZA 4K0KL 4B3TQ 2BA0A 1CSQA 1VQMA 1MJEA 2KBNA 4R4IA 3ERSX 2ZJPA 4ME3A 1A8VA 2NVYH 3K0XA 1IBLQ 2NN6G 1WYDA 4DUYL 1PH6A 2YU9H 4YHHQ 2NZHA 4LWCA 5H1SE 5C4JH 1PA6A 1E1OA 2HHHL 1S3OA 2PQAA 5M3MH 3T1HL 2HIXA 4IOAA 1XMQL 1TWCH 1SN8A 4DUYQ 3LGJA 1YVCA 4LF4Q 2YYZA 4PZ8A 5LMNL 1VQDA 3HOVG 2KENA 1CKOA 1KHIA 2HQLA 4LF8Q 4IFDG 2EXDA 1FGUA 1X56A 1PH1A 4JI4Q 4K0KQ 4DR3Q 4JG2A 1XNQL 1V1QA 2NVQH 4LF7Q 1TWAH 2JA6H 3HOYG 3FHWA 2UXBQ 3UDXA 3I4NG 1X54A 2JA9A 3ULPA 1ASYA 1XPUA 3DM3A 4YCVA 2VL6A 3PIPA 1PH5A 4GN5A 1KQSA 1JB7A 1QZGA 2K14A 4DKAC 1N34L 3I2ZA 1TWGH 1XPRA 1IBKL 1K8AC 3CCMA 2F4VL 3GDEA 1XNRQ 1VQEA 5LMNW 1YHAA 4RG1A 3UE0A 5BR8Q 3ZJYC 4YCWA 2K52A 3RLFA 2CKZB 2KHJA 4DV2L 1BBWA 1PH8A 2K50A 2R7DA 3PO3H 2YV5A 5IYCG 2E2HH 1I6HH 5JJKA 2VQEL 2KHIA 1EOVA 3A5UA 4OXPA 5C44H 4DR2Q 1U0LA 4LFAQ 1NE3A 5IYBG 1D8LA 4OWTB 4TQUS 4DR1L 4FDBA 1G6PA 3T1YL 4APVA 2B3GA 4DNIA 2WB1G 2N3SA 3E0EA 4A3DG 3HFZB 4MZ9A 4A3DH 4OX9Q 1Q8KA 2I5MX 3PSIA 4P74A 3CPWA 4OX9L 2MO0A 4H02A 2CWPA 1HR0W 2D0PA 3HOWH 3HOZH 1JMCA 4DAYB 1H95A 2ATWA 4LFAL 3OYYA 3GTJH 5JJLA 1RIPA 4R4QA 1WCMG 3HOXH 1VQHA 4A3CG 1FVIA 4A3GH 4JYAQ 4YWLA 2VZAA 1U5KA 2ZTDA 2JA5G 1SR3A 3RLNA 5IYCH 3A0JA 4B3SQ 2RHQB 1VQ8A 4PG3A 2XGTA 4AIMA 2KCMA 4GLVB 1KD1C 2I0QA 1GM5A 3GTLH 1YHQA 1D7QA 3ER0A 3GD7A 2BH8A 1XJVA 1GKHA 1VQLA 1A0IA 1WCMH 3HOXG 3M4QA 3J81j 1Q81C 2UUAQ 2MO1A 2F3IA 2CWAA 2IHFA 2EQSA 2ID0A 1L1OA 2UU9Q 2VS1A 1PH3A 1JJCB 5M5YH 5GAGC 4A3MG 2ASBA 3M4PA 5IP9G 1YZ6A 4R4TA 2CFMA 3I56A 4AQYQ 1IXRA 2JQOA 4ALPA 1M90C 3K80C 4A3CH 3J7A5 1L0WA 5DLQE 1CUKA 2N49A 3E9IA 3F1ZA 2L15A 4YY3L 4JI3Q 4POFA 4LF4L 1E22A 3PCOB 3BU2A 2K5NA 5BR8L 4HIMA 1VQCA 1Y1WH 1XMQQ 2A8VA 2Y0SE 2Z6KA 1YIJA 1X6OA 3CXCA 4A3KH 1SFOH 1HNXQ 1OXXK 3KF6A 4LUZA 4HJ5A 4JI5L 4JI1Q 4JCVE 2JA8H 1NMGA 1KIXA 3TEHB 2R7ZG 1Y14B 3DLLA 2JK8A 3CCVA 3B6YA 1LTLA 1YHBA 4X65Q 1DGSA 1YITA 4IPDA 1K0RA 4C3JH 5FJ8G 1FJGL 2UXBL 2ZM6Q 5K36G 4GNXC 4P71A 4QJFA 5IP7H 4X6AH 4DV7Q 1ASZA 1SLJA 4NPSA 1VQ4A 3L2PA 3PUYA 4LF5Q 1XNQQ 4B3ML 1J6QA 1A63A 4P75A 4PZ7A 1VQ6A 3BZKA 4IJLA 3I7FA 5LMNQ 4UP7A 4DK6C 1K3RA 5C3EG 4DV4L 1K73C 1K9MC 2R93G 1C0AA 4KLKA 3W1BA 4BXXH 3HKZG 1L1OC 2E8GA 2VW9A 1XMOL 2B63H 3CCLA 1TWHH 3JC66 4LUVA 1L2FA 2Z0SA 4A76A 3U58A 4BA2I 2JJQA 1EWIA 4JV5L 1O7IA
chains in the Genus database with same CATH superfamily
3W1GA 5AFWA 3NQTA 1BDOA 4ZKCB 2F0QA 2F3WA 4YY3Q 2CHBD 1ET6A 2JXMB 3R3OA 4K2KA 1XX8A 4M8AA 2Q8TA 4IPHA 2MNAA 1WD1A 5TSSA 1XMOQ 4EQPA 4N8X1 1S5FD 1VF7A 4DV4Q 3VDYA 2JE6I 1LTRD 5LHY1 2R92H 2ZM6L 1JORA 1KNEA 1EIHA 5I9OA 2FXQA 3TRZA 3S1NB 1PVOA 1L0YB 3HOWG 2R61A 1EZ6A 5C44B 1QNUA 3S1MB 1TS2A 4BXXG 2RF4A 3C1EA 1WTHA 4EGVA 1DCZA 2Q2HA 1I4XA 4IURA 4N9PA 1F2MA 1W6JA 3L3OC 4ME5A 1KAAA 4A3LG 1T9HA 1EYAA 1CHPD 2KA7A 4AYBG 5KIXA 4AQYL 3MFGA 2NVYB 2WAQG 4KKUA 3KOJA 4HMJA 1UE6A 1LTGD 1K8OA 4XDXA 1YBYA 1VQKA 1RF2D 2A68C 4NXML 3BDOA 1EY0A 2FMMA 4Q0FA 1PFSA 3D31A 3W3AA 1NSNS 1EYGA 4C3JG 1SRUA 3F2DA 3D4WA 3P7JA 3Q22A 1PRTB 5C4ZA 3A55A 4A3IH 1G2TA 3PUZA 2ZJRA 2Q8RE 5T1GA 1CSPA 1MHWC 2F0UA 1ZEQX 3DWPA 2RVLA 5IT9c 3H3VH 1SE4A 2RKSA 3PUVA 4R4CA 3LX0A 4YIJA 5IYDG 5C4JB 3OTOL 3WDNA 3Q24A 1PRTF 3IKJA 3NENA 5KGUA 5IWAL 5EKKA 1NNXA 2H5XA 3SGIA 3I4MH 4DR7Q 2OQ0A 3L7ZC 3A8IE 5CV9A 3SR1A 3TN2A 5FLXc 3GTQH 1GD7A 4DV5Q 1I94L 1A2UA 5IGDA 4B3TL 2ZJQA 4LF9L 5CV7A 2D62A 3M7NA 2WACA 3TBIB 1T5EA 3Q6SA 4B08A 1N34Q 3P1HA 3D4DA 4GS3A 1P8LA 3NBHA 2MGSA 2Q2TA 4CHTB 1O7LA 2EYFA 2IL8A 3PUWA 1N36L 1OTCA 4HJ7A 3SK6A 1FD7D 2X69A 5E7NA 2RHSB 4DV5L 4DR4Q 3MXNA 4B3RL 3NE5B 1ILQA 2AQ3B 1VQNA 5D65A 1PTOB 1PRTD 2H4OA 4KHPL 1SYCA 5CYUA 2I5HA 3SK8A 3LNNA 5IGCA 4IFDJ 4MTNA 1IBMQ 4GKKQ 3HKZE 1AE3A 1TVXA 3PV0A 4BY7B 4FO2A 4AYBB 2IHEA 1LT3D 1MIUA 3J81L 4QL5A 4HCEA 2WP8J 3CAMA 1A2TA 1IL8A 3S17H 1PTOF 4A3JH 4O42A 3CC7A 1EWHA 3HOZB 1FL0A 3JAML 3S14H 5C3XA 3NPPA 3VR4A 3VA5A 5C0XJ 5IGEA 3KYHC 3PF4A 5C4XH 1Q90A 1ZXTA 3QOJA 1Y8NB 5C3EB 4WJ4A 3I72A 2V1CC 1KXLA 2GVAA 3DM1A 4NXNL 4LNQA 3L9AX 1HCZA 3FRPB 2KCNA 2K75A 3U4VA 3H3VC 4A3MH 4A3BB 5IYBH 2EY6A 2R3ZA 2SNMA 3CD6A 1R9TB 1BBXC 4XYQA 2F0SA 1Y69U 1WJJA 3PF5A 4UY8C 2A1AA 2WKCA 4JW0A 2EVBA 4QUCA 1MKHA 1MJCA 3G4SA 3D0FA 3V05A 2L4NA 4PNYA 1X3FA 4MTKA 2AQ2B 1KLUD 1CTMA 3JAMc 3FVQA 3S16H 3PO2B 2Z4IA 3GTGH 3G7LA 3QWNA 3TS0A 4XQQA 1Q86C 5C0XH 1I3QB 4P73A 2QA4A 3A8JE 3K7AH 3T16A 1X32A 1LYLA 4NDXA 4HJ8A 4IJHA 4A3FH 2D9UA 2UU9L 1QNKA 1B70B 1PTOC 3M7GA 2WINB 2AWNA 4KV6A 4LUOA 3H3VI 4ZLTF 1CKMA 2O4XA 1HNZL 1WTPA 5JEAH 3T53B 1WOCA 2R7FA 1WTXA 2Z6KC 1SE3A 4G7ZC 3AEVA 1G291 1HTLD 4R8NA 3H6MA 3URYA 1E1TA 3MC0B 4LF5L 2PNHA 3I55A 2KEDA 4LF7L 1FNVA 1VQJA 1SYFA 1FJGQ 1PZID 4NP5A 4LF6L 4IUPA 1A62A 3CW2C 4C1NK 3PUXA 1VQ9A 4DAVA 2PNRC 1XXGA 3I4LA 1PYBA 4FF4A 2PW7A 1VF5C 4POGA 2CH4A 5CGKA 3OMCA 1XWEA 2XN9C 4V0BA 4FXDA 5I6WA 3TMEA 2M2LA 4JV5Q 2FMCA 1XNRL 2PI2E 3FKIH 4TVAB 4BBRG 4KD4A 2D0OA 1L0XB 1ILPA 1UE5A 5IY0A 1PH4A 5G3LF 1QVGA 1EY4A 1VDZA 1E24A 1KLGD 1VQAA 3M3YH 5M3MG 1O7YA 1I6HB 3CHBD 5C4XB 1B44D 1STHA 1V8QA 3KK7A 3OMGA 4R4IA 1IBLQ 3TP6A 2KJXA 3TDQA 1X3PA 4KY7A 2L55A 2SDFA 1S3OA 3T1HL 2HIXA 1XMQL 3QO2A 5CMDA 3AU7A 4DUYQ 1WTOA 3EJIA 5LMNL 3HOVG 2HQLA 1FGUA 4K0KQ 4JG2A 2J0TD 2QW7A 2OXPA 1V1QA 2NVQH 4KTAA 1TWAH 2O5IC 3HOYG 4LAAA 4CJ0B 1G8ZD 2B2TA 4CDDC 2ZXPA 3J7AF 2JA9A 3HP3A 3ULPA 4RAUC 2VL6A 3TP5A 4GN5A 3A7AB 3I2ZA 5ELEA 1K8AC 4I7AA 4IZ8A 3GDEA 1XNRQ 4P2CB 1KDCA 4QMGA 1ENCA 4HN7A 2K50A 2YV5A 5IYCG 5JJKA 1A3TA 2VQEL 1SDFA 3A5UA 4K5WA 4DR2Q 1U0LA 1AZQA 1D8LA 4FDBA 5KNDA 3T1YL 4A3DG 4A3DH 4OX9Q 1DONA 1J8IA 1HR0W 2D0PA 3MA2B 5EQ0A 5JVH3 1H95A 4WFN3 4LFAL 1FVIA 2F0HA 4OGQC 4JYAQ 2ZTDA 2RHQB 5LL6X 3D6CA 2K32A 5CBEE 1BUVT 2NTTA 3GTJB 2EQSA 1L1OA 2UU9Q 5EJWA 1CZWA 4H44C 5GAGC 1HFGA 5DAUA 4NKLA 5CORA 3DEOA 2JQOA 2PYKA 4WORA 3J7A5 4JI3Q 3VR6A 1D5XC 3BZDB 1TS3A 5BR8L 4HIMA 2Y0SE 3A56A 1YIJA 1SFOH 2DJFC 1CA5A 3S9WA 2F0FA 4FF2A 2JA8H 3TEHB 4KY5A 1AZPA 5HURA 5FJ8G 5K36G 5FOBB 4P71A 1D6EC 1ASZA 1VQ4A 2PO4A 5EPJA 1J6QA 1U4MA 4PZ7A 4EQOA 4IJLA 3I7FA 4RHSA 5C3EG 1C0AA 2H1EA 3W1BA 1L1OC 3CCLA 3T56B 1ESRA 2AUKA 5IP9H 1EWIA 5IP7G 5ELCA 2PZTA 1O7IA 2OTJA 1C7YA 2NBFA 4JI6Q 3UDFA 1VS0A 2K05A 2E5LQ 2NVQB 1IBLL 4QCLA 2EPBA 3S2DB 2R7ZH 4TKOB 5EBDA 1N8RC 1BKBA 1K0SA 3FEWX 3HRZC 5FLXL 5M5WB 3K5LA 4DGZA 5EPKA 2NVXB 5HY6A 4JI7L 2EYLA 2LY7A 2B63B 4HMIA 4HJAA 1I4QA 1SYEA 1STAA 4YCUA 5JAVA 4UDUC 5M5XB 4E6IA 1TS4A 3S1QH 3KJOA 2AHOB 1PH2A 2NN6H 1NJIC 3UDIA 5K36H 3QJYA 2X6LA 3TQYA 2JA7B 4X64Q 4A93B 4RHRA 5I9PA 2UUCQ 4BBSH 2I5LX 4RGNA 4KHPQ 5M3FG 1I4HA 3Q8DA 1BCPD 1QUQA 1B9MA 1SE8A 4K8IA 5GAEC 4CDFC 5HGTA 3U9SA 2L11A 3PIP3 2VUMH 2IY5B 1QVCA 1V1PA 3BZCA 2Q8IB 4O0AA 1GUSA 4A3IB 1GVPA 5L37A 1M1KC 4A3KG 1STBA 1YNJD 3CF5A 1NAPA 5FK9C 1OXVA 3KLRA 1HR0Q 2R93H 3HEJA 1IW7C 2J4XA 1P16A 4ZCKA 1JWMD 1D5ZC 1KAWA 3NP8A 2EJFC 3E6ZX 3G6EA 1Q12A 4HCSA 3F2CA 1UNSA 2RDGA 2PZUA 2DUDA 2YTYA 4DR5L 1V1OA 2O5JC 5FLMH 4DR3L 3RUZA 4RMFA 5FLMG 3WWVA 4NMZA 1WTWA 1GUOA 4GLAC 1QCBD 4XTCS 3UDGA 5EKIA 3R93A 1KC8C 2QEJC 3T1YQ 5CV5A 1SAPA 1JJ2A 2E2DC 2OQKA 1QE6A 3I4OA 1RL2A 4WJWA 2F0KA 2AKWB 4DV3L 4BY7H 4JOIA 1J5EQ 1X9NA 1Z47A 1I4GA 2ALYB 1WVLA 1EWCA 2UXCL 2UXDL 3SXHA 4JC0A 1BR9A 3BG3A 5IIFA 1EEID 5EBCA 1C9OA 2XRSD 1HR0L 1KL9A 2KCCA 3J80c 2F0IA 2UUBL 2A19A 2Z9HA 4JI0Q 1ONLA 5C5MA 4BY1H 1IHZA 4C3HH 3ZYYX 5EGTA 4O2DA 1HXYD 2E5LL 5AJ3Q 5FO7B 2EJGC 1YNXA 3ICEA 3E0JA 1E7ZA 4BA1I 3IAYA 1Z9FA 4P72A 1EIYB 2OF1A 2P5ZX 4HR7B 4A75A 3KBGA 2UUCL 1UE7A 3GTOB 4ZK9B 3W5OA 2JEAI 3HOXB 3GO5A 4OO1G 1C4QA 4GN4B 3BYYB 3GP7A 3S1MH 2UUBQ 3S2DH 1TS5A 3HOVH 1GUNA 4CJ2C 1NR4A 4MIUA 1S72A 4DR6L 3MEFA 2LKVA 4OONA 1DZ1A 3AYHB 4JI7Q 1OXUA 4LK1C 2L0CA 2Y0SG 3UI2A 2N8NA 1HH2P 2DN8A 5AJ3L 1J5EL 2YTXA 4L5TA 5C0XI 1CI3M 4L5SA 2VQFL 4LMQD 1X3QA 2LSSA 3D8GA 5EPLA 1SNPA 4Y7NB 2KCTA 2PZWA 3I4MG 4DV1L 1TY2A 4RWSC 4JI0L 3HOUB 1CKNA 4R9WA 2MPMA 1TWGB 4DV6L 4Q5VA 5GAHC 2NZOA 1HA6A 1ENAA 2NUCA 4X62Q 2UXCQ 1SYBA 4DN4M 4X65L 2B8GA 5ELFA 5T1IA 5JEAG 1I94Q 3CCRA 2B29A 1TWFH 1I3QH 1EU3A 4GKJL 1XTDA 1AEXA 2Z4HA 1LO5D 4B9WA 4DR7L 3S2HH 4A3IG 4WJ3M 1VQOA 5CV4A 5BN3A 1HNXL 2B8FA 3BYTB 2WAQE 4R4OA 1PH7A 1V43A 1CA6A 3KLWA 4OHJA 4FF1A 3R8BA 5LMUL 1EY8A 2CW0C 1SNCA 1VQBA 3CCSA 1N36Q 3EIVA 1RCVD 3J81c 1ET9A 2C5CA 4IALA 3H15A 2IPKD 5J3BA 5JPNC 4DF7A 3D4RA 5ELBA 3CC2A 2K5HA 2K6AA 4MNOA 4ABNA 2A68D 3E9HA 1YI2A 1CHQD 2WB1E 3HOWB 2F4VQ 1B7YB 3FKIG 4BBRH 1Q1EA 2JA8G 4FYDA 4ODGA 3CCJA 4AH6A 1HQMC 1F2LA 4C3HB 5FO8B 1YJNA 4LFCQ 1KDAA 4C56C 3PO3G 4Y52H 2YTVA 3HGBA 1IKMA 1TR5A 3MAQA 2MQHA 2I46A 3I91A 3NSWA 3TREA 4NXNQ 4JI2Q 2CVRA 5K5PA 1B8AA 2R92G 1PYWD 1WCMB 3EROA 4IUQA 3F2UA 4BY7G 2HDLA 1MGSA 3VA7A 1LTSD 5FJ8H 2KHSA 2IJ0A 4K2LA 3KLSX 2HHHQ 4GNXA 2BH2A 1Q1BA 1LABA 4GOPA 3EBEA 4K14A 3NHHA 4IUTA 2EYJA 2JYOA 3CKIB 1H9KA 3HOZG 3S1NH 5C44G 2K5DA 2EE1A 2K4KA 4A3EH 2LFNA 4BY1G 1HZ9A 1LM0A 4NXMQ 4IPGA 1M8AA 5M9OA 2K5VA 1ICFB 4GN3B 5A2QE 3PIO3 2NWGA 2JEBI 1PXUA 1OXTA 4J15A 5C6AA 3J81i 5CBAE 2A6HD 4K0KL 1CSQA 1EOTA 1EY5A 5FLXE 3ERSX 4C3JB 2NVYH 1EY6A 5IT9L 1IYUA 2NN6G 4DUYL 2BDOA 3I8ZA 2KECA 1GHKA 4YHHQ 5C4JH 2HHHL 1E1OA 1LT5D 3HG9A 5M3MH 2FHTA 2F0MA 1TWCH 4LF4Q 3VR5A 1XTCD 1CT1D 4PZ8A 5DNFA 1KHIA 1SNDA 4J8QA 4LF8Q 4IFDG 1UEAB 1X56A 1JWSD 5IGFA 1RODA 4LF7Q 2UXBQ 3I4NG 1TU2B 4DAYA 1A15A 3QR8A 3PIPA 2EZVA 1KQSA 2RBMA 4C2MB 1I4PA 1TWGH 1IBKL 2F4VL 1IW7D 1VQEA 3OPOA 3UE0A 1GJXA 5BR8Q 3ZJYC 3J80E 2XIWA 4QF4A 4YCWA 1II3A 4FXGC 2KHJA 3N6RA 2K01A 1EOVA 1B2TA 4OWTB 3FMCA 4TSSA 4QUFA 4DNIA 3E0EA 2N3SA 1PTOH 1SFOB 4L6TB 4ULLA 4EVOA 3MXGA 4FF3A 4P74A 2SOBA 2BE5C 1QB5D 2MO0A 2CWPA 2G5DA 1HUNA 2NVTB 4K8JA 3PO3B 3GTJH 5JJLA 3A7LA 3FDTA 1SJHD 1ZKOA 4A3GH 5A35A 3O13A 2IW3A 3NTHA 3MVVA 1KTKA 4PG3A 2XGTA 4AIMA 1KD1C 1UUPA 2JP1A 2CW0D 1YHQA 1D7QA 3IL8A 3GD7A 2BH8A 4XT1B 1GKHA 4KKTA 1LACA 3J81j 4ZKBB 1Q81C 2MO1A 2UUAQ 2F3IA 3TZUA 2OEOA 1TWHB 1H9JA 3J81E 4BBRB 3WOEA 1HPCA 1YNND 5IP9G 2A6HC 3I56A 4ILWA 4A3CH 3M4OB 5DLQE 2N49A 3E9IA 2D2CC 4LF4L 2SEBD 2K5NA 1C48A 5IGBA 4DU9A 1H9MA 4JCVE 1B4OA 1SXTA 2R7ZG 1Y14B 3S17B 3CCVA 3S15B 1YHBA 4BBSB 2LS01 1FNUA 1K0RA 4IUVA 4C3JH 2AUJD 5NUCA 4X6AH 1DXMA 1ENFA 1Y1WB 1A63A 4FXKC 5LMNQ 4UP7A 4DK6C 4DK0A 1PTOD 3I90A 5D14A 2K1BA 4DV4L 1K73C 1EL0A 2B2YC 2QILA 3I4NB 4BXXH 2VW9A 1NUCA 2F0EA 2B63H 4A76A 3U58A 3ITPA 2JJQA 2FINB 4R1JA 3FPPA 4KD3A 2OTLA 3PGZA 4MHEA 4UAIA 3OW2A 1EY7A 1VMPA 1BCPB 1EYDA 3HKSA 4A3BG 1F77A 4JI3L 3SK5A 1R9TH 1S40A 3QG1A 4JVZA 2CH4W 2ICEC 4DNTB 1JICA 4IUNA 3MWYW 3HOYH 1HTPA 3GTPH 5E1FA 4X3KA 1DD2A 2QF7A 3K81C 4X3SA 4DV7L 5D3IB 3J7YW 1HA5A 2I07B 3PO2G 3PO2H 3S16B 3GV3A 1IBML 2VUMB 4A3FG 3NTKA 5KNBA 3KF6B 4JYAL 1HZBA 4UHVA 2LXKA 1UEBA 4IFDH 2QEXA 1OO9B 2LXJA 1OXSC 1K3BC 3M4YA 2IT1A 1JOQA 4HJ9A 4YWMA 1PV4A 1GXDC 5D3DA 3RZDH 2ZT9C 4F87A 3F2BA 1QOHA 4QGUA 4L5QA 3DWQA 3K5NA 1W3SA 3ULJA 1FR3A 4ZQ3A 1MSHA 4N9TA 1HNWL 1VQPA 4LF9Q 2RDHA 2R92B 1IBKQ 4XQNA 4UP9A 3A74A 3S1RB 4JBMA 1Q3LA 1QILA 2X6GA 3M4OH 4F7XA 3JAMi 1I50H 2HCCA 2PPBC 4PMBA 1E2ZA 1RKNA 4UPAA 1GUWA 4ZRZA 3H0GG 4JBWA 5HGQA 2VNUD 2DGYA 4LF8L 4XYOA 1IZ6A 1V1PB 1SBBB 1D5MC 3RMHA 4QIWE 3GTOH 3MEHA 3J7ZC 1NMFA 4DR2L 2ES2A 4RA8A 3S15H 2VQEQ 2QKIC 3TS2A 4U68A 2BA1A 3VYTA 1AE2A 4DV2Q 2WB1B 1GUTA 1BQQT 5EKLA 4NW2A 4KJNA 2NTSA 4OO1I 3I4NH 4XIGS 5BN4A 1RJTA 3GTKB 1K83H 2O2LD 5ELNA 3VYRA 1CKNB 1TT2A 3SK4A 4GZYC 5JJZA 2UXDQ 3OHXC 1T5XD 3T4AC 5IYDH 3HOUH 2DNEA 3HOYB 2F0VA 1MI2A 4DAMA 4X66L 2GN5A 4DK3C 3I3CA 3AFPA 5M5XH 2IX1A 1V9PA 3CP0A 3KDFA 4MN3A 2E2IH 4PMWA 5M3FB 2Q2IA 4JI2L 2HT1A 1GUGA 1LLRD 4DV0L 4B3MQ 3K8AA 4LFCL 2Q2UA 3BDLA 4KMUC 2ZXRA 1LTTD 4OIKA 1A3UA 3A5ZB 2L5TA 4B9XA 4QB4A 1SEBD 1VQ5A 3NUCA 4DUZL 4Y7NH 3KF8B 5GADC 1PH9A 1X3GA 5GQOA 2B2YA 1MD2D 4G57A 4GOPB 4V190 3MXNB 2RSOA 2K28A 3NELA 1EIFA 4PZ6A 2B39A 5JJIA 4DV3Q 2FFKB 3AFQA 4XQJA 2VUMG 1EUJA 1VQIA 2E76C 4DPGA 2R93B 1Y1VB 3G6JB 1CZGA 3STBC 5DEHA 1MBYA 2EIFA 2XSCA 5DM73 3F8TA 2NZ1D 2OCEA 2HD3A 4DR5Q 1QJOA 5J39A 4A3JG 2B2WC 3NQIA 1G91A 3RZOB 3K6OA 4JI1L 4HEDA 2QDBA 1H9SA 2E2JB 4X64L 1BVSA 5I6YA 1D2BA 2A69D 2PMZE 1BO0A 1AN8A 3ULLA 4L8JA 3MHBA 3K58A 4HIDA 4HAEA 5F2DA 3TSSA 1Q82C 3C46A 4KI0A 4IFDI 2B63G 3U9OA 3LWUA 4DV1Q 1DJRD 1VQ7A 1D1KA 3KF8A 2E2HB 4JOIC 2CQAA 4ZUIA 5KNCA 1NBWA 2NVXH 1QWYA 1X55A 1BXTA 1S4ZA 3OW7A 3VYSA 3NWTA 2DY8A 1N32L 3H0GB 3SHLA 2ZTEA 2KEEA 3LWEA 1EFWA 4WRDA 1FNWA 1EEFD 4DNRB 4DXFA 4A3MB 4A3BH 1VQGA 2EY1A 4RCOA 5CV8A 3T13A 3VYUA 3DUZA 2R6GA 1EFID 5COYA 1SSOA 5A2QL 2E74C 2JA7G 2J7ZA 4CBVA 4L5RC 1DM0B 1E3PA 1PZKD 4K6DA 1S5ED 5M3FH 2F0JA 3OSOA 2EJMA 3GTKH 1WI5A 3T1HQ 2GVBA 4BBSG 2QGQA 1JB3A 4CKCA 3H09A 1HZAA 4OWWB 2A74C 2Y0SB 1PZJD 2EYPA 3A54A 3CQZH 3U50C 4A93G 1S5CD 2MUYA 2VB2X 4G7HC 1BBUA 2EOTA 3SEBA 3M85A 4JPBW 1JR0D 1KABA 2IX0A 4A3LH 3V96A 4A3KB 3HOUG 1TWCB 2UUAL 1U4PA 1XPOA 2L1BA 1SMYC 4JBKA 1YEZA 5IOCA 1IKLA 2BA0A 1SYDA 1SNOA 1BCPF 2ZJPA 4ME3A 1A8VA 3K0XA 3EFXD 1PH6A 2YU9H 1B50A 4LWCA 5H1SE 4FVMA 1WD0A 3WOFA 2B2WA 1DOMA 4IOAA 2XWBB 2IX3A 1SN8A 3LGJA 1YVCA 5E3FA 2B2TC 2YYZA 1VQDA 1CKOA 1DOLA 2KENA 2EXDA 4JI4Q 4DR3Q 1XNQL 5JOBA 3E3XA 3UDXA 2N88A 3H91A 3S2HB 1JOKA 1PFBA 1I4RA 3BVZA 3DM3A 1ASYA 2AQ1B 2A6ED 1PH5A 1XPUA 2HDMA 4J6HA 1JB7A 1QZGA 4DKAC 2E75C 1N34L 1XPRA 2NB0A 3CCMA 3AMUA 2TSSA 5LMNW 1YHAA 4RG1A 3M3YB 2K5QA 2BDNA 1LT6D 3NXWA 2K52A 2HCIA 1R4PB 2CKZB 3RLFA 4FNFA 4OEMB 2EXZA 3Q23A 2R7DA 3PO3H 3NTIA 2B2VC 1I6VC 2B2UC 2B2VA 2Z1CA 1RTNA 1EU4A 2KHIA 1E2VA 2BOSA 5C44H 4LFAQ 3R2TA 5IYBG 1K28A 1G6PA 4APVA 2B3GA 1JWUD 1NCVA 3DHQA 3HFZB 1SYGA 3P20A 3I70A 4OX9L 4H02A 3HOWH 3HOZH 1RTOA 1JMCA 4DAYB 4KN4C 5CV6A 3OYYA 4HSPA 2RCFA 1RIPA 4RKLA 1WCMG 3HOXH 1VQHA 4A3CG 1ZYRD 3MTSA 5JVG3 5J1ZA 1F9RA 5I4DA 4YWLA 1SR3A 5IYCH 2JA6B 1LT4D 4FP5D 1VQLA 1F9PA 1A0IA 1WCMH 3HOXG 1HRJA 2EDGA 5IGGA 2MJ8A 1F9QA 2IHFA 4H0LC 5ISRA 2VS1A 4CDCC 4A3MG 3I73A 2F03A 2ASBA 1B1ZA 1YZ6A 4R4TA 4AQYQ 1IXRA 1STGA 1SNMA 1CUKA 4BWGB 4YY3L 4POFA 2L9HA 1E22A 4DFAA 3PCOB 3BU2A 5C4HA 1VQCA 4PMCA 2PW5A 1CQFA 1JQYD 1K8MA 2K33A 1Y1WH 3NBIA 1XMQQ 5ELDA 1X6OA 4A3KH 3TZDA 1OXXK 3KF6A 4LUZA 2F4IA 4IN3A 4OIJA 4JI1Q 2XNAC 1NMGA 1U9RA 3GV6A 3DLLA 1LTLA 3PMFA 1DGSA 4F8MA 4IPDA 1EYCA 4CGYB 2ZM6Q 1FJGL 2HUGA 2A73B 3D6WA 4NPSA 3L2PA 3PUYA 5KEEA 5DM63 3BZKA 4KHVA 1K3RA 2R93G 3HZXA 3BDCA 1GOZA 1HFNA 4KLKA 2E8GA 3HKZG 1XMOL 3V2TA 3GTPB 3JC66 4ZAIA 4LUVA 4BA2I 2Z0SA 1JOOA 5ELOA 4JV5L 5BN5A 4KN7C 4DR4L 5GROA 3NEMA 5IE8A 1TWFB 4KHZA 3UE1A 4IUUA 4LW1A 2DJGC 1SE2A 1JE4A 1PRTC 1KDBA 5G3LD 1EQVA 1SROA 4JI4L 2MHVA 2G9HD 3NWSA 1W2BA 1C8CA 4B3SL 4JK1C 3FKIB 3MXPA 2C9OA 3S24A 1S5DD 4JI5Q 3EN2A 1TQOA 1Y8PB 1UWVA 1HNZQ 4C3HG 3TP7A 4YHHL 2JA6G 1QUQB 3M9BA 2EYOA 2EYMA 3OTOQ 2JN4A 3J7AV 4A3JB 2D5DA 5C4XG 1BOSA 3AQQA 4U673 1L1OB 4H13C 1AP0A 1LUZA 3MZ5A 1FGBD 3CMEA 5M5WH 3QOLA 1IYJB 3HS0C 3KJPA 5C3EH 2VQFQ 2F52A 5I2YA 1TXYA 4A4IA 4OO1H 4JI8Q 1HUMA 2WV6D 3RNUA 4JI8L 3MXUA 1TWAB 2L12A 2XRQD 4X3UA 1R4QB 4BY1B 4A93H 2K7VA 4XT3B 3N52A 1VMCA 2N55A 1JT8A 1PFNA 4DXGA 2JA5B 2F0OA 3H94A 4H7BA 3CMAA 5M3MB 1Y8OB 1TKWB 5C0XG 1CM9A 2CQOA 2HIVA 3RD4A 2GA4B 2ZTCA 2G9DA 1U4RA 1Q7YC 4K6LA 1QVFA 3GTGB 1HHVA 3NK9A 4KKSA 4CKEA 4DA2A 4YWKA 4IOCA 4KK7A 3CU7A 2VXWA 1H9SB 1U4LA 1IL2A 1UE1A 1A3VA 4EX5A 1GO3E 3QIAA 4A3DB 1E0BA 1MSGA 1HNWQ 3RR5A 5IODA 3W2DA 1VCIA 3AB9A 4G7OC 3J80i 1PMRA 1SJED 3DWAA 2RDFA 2B2UA 5JEAJ 4HIKA 2HQEA 3L0OA 5FKAC 2F0NA 1WTQA 3GTQB 1VQFA 2TMPA 2XWJB 1KNAA 3X3MA 4QIWB 2F0LA 2KOLA 4AYBE 3P75A 2E2IB 3FPUB 4A3EG 1HJPA 5E4WC 4QY7A 5LMUQ 1YJWA 1Y1VH 4EQ5A 1X3EA 1XYIA 2K5WA 2PQEA 3KBXA 3U4ZA 2A5HA 5IWAQ 2VY3A 1STEA 3RN5A 3C1FA 2RA4A 2NVTH 4JBJA 4UP8A 4C2MH 3K5MA 4GLXA 4KJOA 4B3RQ 4GKJQ 3STBD 4RFBA 2AMCB 3EVQA 4LF6Q 3RZOH 4GOPC 4X62L 1F2ZA 3G48A 4RGOS 4PQXA 3IFDA 1WTRA 2WFWA 4DV0Q 3SE0A 2MFIA 2QDLA 1EQQA 4DV6Q 3K0YA 3X3NA 4GNXB 1WTVA 3G71A 3BJUA 1NR2A 5E4XA 2F0PA 5CR3A 4A3GG 2LMCB 1SMXA 4EQNA 5C5LA 2K03A 3IRBA 3CPFA 2AWOA 2ZXOA 4ZYSA 2ENBA 4CDEC 2NN6I 3BS1A 3KDFB 3ONAB 3ERQA 3CCEA 4LFBQ 1GHJA 3ND9A 3CRKC 4DR6Q 2PI2A 3K57A 2E2JH 1JJGA 1E2WA 2FJ2A 4S3SA 4DUZQ 1Q46A 3S14B 2WKDA 1Y1WG 2C35B 1N33L 3CRLC 4IPCA 3ND8A 3S1RH 1DYQA 1N9WA 2N78A 3OIPA 2Z8LA 3D3RA 2JA5H 1K8GA 3JAME 4QQBX 4HTHA 3QB3A 5J22A 1STNA 3HOVB 1Q8IA 3A8KE 3S1QB 5CC4A 1JE5A 4X66Q 1QZHA 2RCNA 3K7UC 1N32Q 1I5FA 4RGTA 4RKBA 4XXEA 1NY4A 3H0GH 1LTAD 1JC7A 2JA7H 4I7ZC 1STYA 3CCUA 3NBHB 1KRTA 4LFBL 1AW7A 1J9OA 4RH6A 4DR1Q 1ML0D 3GTLB 2R7ZB 1G51A 3CQZB 1EY9A 1PHJA 2F0GA 2XTIA 2OWOA 1EQRA 3FP9A 4J1MA 1YJ9A 4JI6L 4A3EB 2M00A 1SMYD 1AH9A 5M5YB 3K7AB 2NYZD 2PMZB 3CCQA 2WAQB 3RN2A 5EAYA 2PQAB 2SNSA 1O78A 1Z7TA 5KRUA 1N33Q 4CKBA 4HIOA 1ZYRC 4GKKL 2M9VA 1PYSB 4OWXB 5I2XA 3CC4A 3GTMH 3OWEB 1KRSA 4NB3A 1BNZA 4I65A 1F2YA 2EY5A 2KQ3A 1PFMA 3PIOA 3VR3A 2CCZA 4ID6A 3J80L 2F3VA 1B53A 1O7ZA 3RZDB 4IO9A 4C3IH 3RLOA 2DNCA 2XVSA 4C3IG 1EIGA 3KFUA 1G6ZA 2V4DA 4A3FB 5LL6S 1X65A 4O1NA 3HKZB 2IWHA 2YU9B 1WFQA 3OOCA 4HSVA 4K5VA 1Y1VG 2JSOA 2F0WA 1B3QA 1NTGA 2F0TA 1EZ8A 4DK1A 2A6EC 1HZCA 1YNJC 3KLSA 4B3TQ 1VQMA 1MJEA 1CK1A 2KBNA 1LTBD 4DAPA 4N8FA 1WYDA 1LV9A 4LJZC 4X3TA 3T51B 2Z6BA 2RQXA 2NZHA 1CFMA 1PA6A 2K04A 2PQAA 1ESFA 2BCOA 3EA6A 2OT2A 1UAPA 1BCPC 5KYLA 1PH1A 5JPMC 2JA6H 4A3GB 2A69C 1ICWA 3FHWA 1X54A 5FO9B 1TIID 3K5OA 1I50B 1B3AA 4OELB 4YCVA 2F1MA 2K14A 4G4KA 1K83B 3BVGA 1PLFA 3KUPA 1H9RA 1RDPD 1BF4A 4DV2L 1BBWA 3GQBA 4F88A 5C3WA 2KVMA 1PH8A 2VB3X 4C1NI 2E2HH 3PQIA 1I6HH 4TRDA 1B9NA 2PCFB 4OXPA 3VR2A 1NE3A 4DR1L 4TQUS 4M1UB 1O80A 2WB1G 4CJ1B 4MZ9A 1Q8KA 2I5MX 3PSIA 3CPWA 3OIQA 3TP8A 3SVMA 2EY2A 4R8IA 4L63B 4BS9A 2ATWA 1Z6HA 4R4QA 1AFPA 3Q0AA 4RGMA 2EYHA 3OWFA 2VZAA 1U5KA 2JA5G 4PV1C 3RLNA 5IT9E 2BE5D 3A0JA 4B3SQ 1VQ8A 3GTLH 2KCMA 4GLVB 4KY6A 2I0QA 1GM5A 1F9SA 3EQLC 2F0DA 3ER0A 3K59A 1TY0A 3SDZA 1XJVA 1PDQA 1DOKA 2KUMA 2RSNA 3M4QA 4Z9CB 3DXJC 2CWAA 1JCKB 2ID0A 3IFTA 3I4MB 1PH3A 1JJCB 5M5YH 1HQRD 1RHPA 2MP1A 3M4PA 4IQZA 2DY7A 2CFMA 4ALPA 1M90C 3K80C 1L0WA 1IYVA 3F1ZA 2L15A 2QCPX 3DEPA 4OL7A 2WIIB 4RCNA 2A8VA 2Z6KA 3CXCA 1YNNC 1HNXQ 4K5XA 3GTMB 1A6XA 2ICIA 4HJ5A 1RD9D 1LTID 1W6KA 5KYIA 4JI5L 3DMUA 1M4VA 3MFYA 1KIXA 4ZUJA 2JK8A 1D1IA 3B6YA 1YITA 3BVMA 4X65Q 2UXBL 4C3IB 4GNXC 4QJFA 5IP7H 1S5BD 4DV7Q 1SLJA 1XNQQ 4LF5Q 4B3ML 4P75A 3C2PA 1VQ6A 1CQVA 1G2SA 3E5SA 1K9MC 1QG7A 2JA8B 3C3LA 1FYCA 3R2IA 1TWHH 1L2FA 1EQTA 1SNQA
chains in the Genus database with same CATH topology
3W1GA 1C7YA 4R1JA 2OTLA 3PGZA 3OW2A 4JI6Q 3UDFA 1VS0A 2E5LQ 1IBLL 3HKSA 4A3BG 4JI3L 4YY3Q 2R7ZH 4DR4L 1N8RC 1R9TH 5GROA 1BKBA 4IPHA 2MNAA 1S40A 3NEMA 2OTJA 5IE8A 1XMOQ 5HY6A 3HOYH 4JI7L 3GTPH 4KHZA 3UE1A 4DV4Q 4HJAA 3VDYA 4LW1A 2JE6I 4YCUA 3S1QH 3KJOA 2AHOB 3K81C 1PH2A 2R92H 4DV7L 1NJIC 3UDIA 2ZM6L 3PO2G 3PO2H 3TQYA 1SROA 4JI4L 2FXQA 1IBML 4X64Q 4A3FG 1W2BA 3TRZA 4B3SL 1PVOA 2UUCQ 3HOWG 4BBSH 2I5LX 3KF6B 3S24A 2RF4A 1HZBA 4JI5Q 4BXXG 4JYAL 4KHPQ 3EN2A 5M3FG 2LXKA 1UEBA 3Q8DA 2QEXA 1QUQA 1SE8A 1UWVA 1HNZQ 5GAEC 2Q2HA 4YHHL 2LXJA 2JA6G 1QUQB 3M9BA 1OXSC 3OTOQ 2IT1A 4A3LG 4HJ9A 2VUMH 1T9HA 5C4XG 4YWMA 1PV4A 4AYBG 2IY5B 3AQQA 4AQYL 1QVCA 1L1OB 2WAQG 3KOJA 3RZDH 1LUZA 3BZCA 1UE6A 4O0AA 3F2BA 1YBYA 1GVPA 5M5WH 4QGUA 3CMEA 4A3KG 1M1KC 3CF5A 1IYJB 4L5QA 1VQKA 1OXVA 3KJPA 1HR0Q 1W3SA 5C3EH 2VQFQ 2R93H 4NXML 3ULJA 2F52A 1P16A 1TXYA 4A4IA 1PFSA 3D31A 1EYGA 4JI8Q 1KAWA 1HNWL 1VQPA 4LF9Q 3RNUA 4JI8L 1IBKQ 3G6EA 4UP9A 1SRUA 3A74A 3F2DA 1Q12A 4JBMA 3F2CA 4A3IH 3PUZA 2ZJRA 3M4OH 3JAMi 4A93H 1I50H 2DUDA 1CSPA 2YTYA 4UPAA 4DR5L 1JT8A 5IT9c 5FLMH 3H0GG 4JBWA 4RMFA 5HGQA 3CMAA 5FLMG 3WWVA 4DR3L 3H3VH 2DGYA 3PUVA 4R4CA 4LF8L 5IYDG 1IZ6A 4GLAC 5ELOA 3OTOL 4XTCS 3UDGA 5C0XG 2CQOA 1KC8C 2HIVA 4QIWE 2ZTCA 1Q7YC 3T1YQ 1JJ2A 3GTOH 1QVFA 3NENA 5IWAL 3J7ZC 1NMFA 2OQKA 4DR2L 2ES2A 3S15H 2VQEQ 2H5XA 3I4OA 4YWKA 3TS2A 3SGIA 4IOCA 1RL2A 1IL2A 3I4MH 2BA1A 4DR7Q 2OQ0A 3L7ZC 2AKWB 1UE1A 4DV3L 5FLXc 4BY7H 1AE2A 1GO3E 4JOIA 4EX5A 4DV2Q 1GD7A 1Z47A 4DV5Q 1X9NA 1J5EQ 3GTQH 2ALYB 1I94L 4B3TL 2ZJQA 4LF9L 2D62A 1HNWQ 3RR5A 2UXCL 3M7NA 4OO1I 3I4NH 2UXDL 4JC0A 4XIGS 1N34Q 1VCIA 5IP9H 4GS3A 1K83H 1P8LA 3J80i 1C9OA 1HR0L 1KL9A 5JEAJ 4HIKA 2Q2TA 3J80c 5ELNA 1CKNB 3L0OA 3PUWA 1N36L 2UUBL 2A19A 1OTCA 4HJ7A 1VQFA 4JI0Q 2UXDQ 4AYBE 4BY1H 5E7NA 4A3EG 5IYDH 1HJPA 2RHSB 4QY7A 5LMUQ 4DV5L 4C3HH 1YJWA 4DR4Q 1Y1VH 3HOUH 4B3RL 4EQ5A 4O2DA 2E5LL 5AJ3Q 1X3EA 1VQNA 1YNXA 4DAMA 3ICEA 3U4ZA 4X66L 1E7ZA 2GN5A 4DK3C 4BA1I 5IWAQ 2VY3A 3AFPA 1Z9FA 5M5XH 3RN5A 2IX1A 1V9PA 2NVTH 4KHPL 4JBJA 4UP8A 4P72A 4C2MH 3CP0A 3KDFA 4GLXA 2E2IH 2I5HA 1EIYB 4PMWA 4B3RQ 4GKJQ 2Q2IA 4A75A 2UUCL 4JI2L 1UE7A 3STBD 2HT1A 4IFDJ 4MTNA 4DV0L 1IBMQ 4B3MQ 3K8AA 3W5OA 2JEAI 2AMCB 3RZOH 4LFCL 4LF6Q 4GOPC 2Q2UA 3GO5A 4GKKQ 3HKZE 4OO1G 1AE3A 4GN4B 4X62L 3G48A 3PV0A 3S1MH 2UUBQ 3A5ZB 3S2DH 2WFWA 4DV0Q 1VQ5A 2IHEA 4DUZL 1MIUA 2MFIA 4Y7NH 3HOVH 4QL5A 1S72A 2WP8J 3CAMA 1EQQA 4DV6Q 3MEFA 4OONA 4DR6L 3KF8B 5GADC 3AYHB 4JI7Q 1OXUA 1X3GA 5GQOA 1PH9A 4GNXB 3G71A 2Y0SG 3S17H 4GOPB 2N8NA 3MXNB 1HH2P 3BJUA 4A3JH 3CC7A 3NELA 1EIFA 4PZ6A 5AJ3L 1J5EL 1FL0A 2YTXA 4L5TA 5C0XI 4DV3Q 5JJIA 4A3GG 3S14H 4L5SA 1SMXA 2VQFL 5C0XJ 3IRBA 3AFQA 2LSSA 3CPFA 3KYHC 3PF4A 2AWOA 5C4XH 2VUMG 2KCTA 1EUJA 1VQIA 2NN6I 3KDFB 3I4MG 4DPGA 4DV1L 4JI0L 4WJ4A 1CKNA 3STBC 2V1CC 3CCEA 4LFBQ 1KXLA 2GVAA 4DV6L 2PI2A 4DR6Q 1JJGA 2E2JH 2EIFA 5GAHC 4NXNL 2NZOA 4DUZQ 1Q46A 3F8TA 4LNQA 2VNUD 2K75A 3U4VA 2OCEA 4X62Q 1Y1WG 4A3MH 2C35B 5IYBH 4DR5Q 1N33L 3CD6A 2UXCQ 4IPCA 3S1RH 4X65L 4A3JG 5JEAG 1N9WA 1I94Q 2N78A 3CCRA 2B29A 1TWFH 1I3QH 2JA5H 1WJJA 4GKJL 1K8GA 1XTDA 4JI1L 3PF5A 4UY8C 4DR7L 3S2HH 2A1AA 4A3IG 4X64L 4QQBX 4WJ3M 1VQOA 1HNXL 1BVSA 1MJCA 1MKHA 3G4SA 3D0FA 2PMZE 1JE5A 4X66Q 2WAQE 1QZHA 2RCNA 4R4OA 1X3FA 3K7UC 1PH7A 1N32Q 1I5FA 1V43A 3ULLA 1NY4A 3JAMc 3H0GH 3KLWA 4HIDA 3S16H 2JA7H 1Q82C 5LMUL 3GTGH 3TS0A 4KI0A 3CCUA 4IFDI 3NBHB 1Q86C 2B63G 4P73A 2QA4A 1KRTA 3K7AH 1VQBA 4LFBL 3CCSA 4DR1Q 4DV1Q 1VQ7A 4JOIC 1N36Q 3EIVA 1LYLA 1G51A 5IP7G 4IJHA 4HJ8A 4A3FH 3J81c 2UU9L 1PHJA 1B70B 1NBWA 5J3BA 3H15A 2NVXH 1X55A 2AWNA 2XTIA 3CC2A 2OWOA 1EQRA 2K5HA 3FP9A 1YJ9A 4LUOA 4JI6L 3H3VI 1N32L 4MNOA 1CKMA 1HNZL 3E9HA 1YI2A 1AH9A 2WB1E 2ZTEA 2F4VQ 1B7YB 3FKIG 4BBRH 1Q1EA 1EFWA 1WOCA 2JA8G 2R7FA 3CCQA 4A3BH 3CCJA 2Z6KC 5EAYA 3RN2A 1VQGA 2PQAB 1G291 3AEVA 4AH6A 1E1TA 4LF5L 2R6GA 2PNHA 3I55A 1YJNA 1N33Q 4LF7L 1VQJA 4HIOA 1FJGQ 4LF6L 4LFCQ 4GKKL 3PO3G 4Y52H 1PYSB 2YTVA 1A62A 4OWXB 3CC4A 2MQHA 3TREA 4NXNQ 3CW2C 4JI2Q 2JA7G 1B8AA 3GTMH 4L5RC 2R92G 3PUXA 1VQ9A 1E3PA 1KRSA 4BY7G 4NB3A 5M3FH 5FJ8H 3GTKH 3PIOA 1PYBA 1WI5A 3T1HQ 2CCZA 2HHHQ 4POGA 4GNXA 2GVBA 4BBSG 2BH2A 1Q1BA 2QGQA 4IO9A 4C3IH 4GOPA 3RLOA 3EBEA 1HZAA 4OWWB 3KFUA 3CQZH 3U50C 1X65A 4JV5Q 4A93G 1XNRL 3HOZG 3S1NH 5C44G 2PI2E 3FKIH 1BBUA 4TVAB 4BBRG 2K4KA 2D0OA 3M85A 4A3EH 4BY1G 1HZ9A 1LM0A 1WFQA 1UE5A 4IPGA 5IY0A 1PH4A 4NXMQ 1QVGA 2IX0A 2K5VA 4A3LH 4GN3B 1E24A 1VQAA 1Y1VG 3HOUG 3M3YH 2UUAL 1NTGA 2JEBI 5M3MG 1OXTA 4J15A 1XPOA 1HZCA 3J81i 4JBKA 1YEZA 4K0KL 4B3TQ 2BA0A 1CSQA 1VQMA 1MJEA 2KBNA 4R4IA 3ERSX 2ZJPA 4ME3A 1A8VA 2NVYH 3K0XA 1IBLQ 2NN6G 1WYDA 4DUYL 1PH6A 2YU9H 4YHHQ 2NZHA 4LWCA 5H1SE 5C4JH 1PA6A 1E1OA 2HHHL 1S3OA 2PQAA 5M3MH 3T1HL 2HIXA 4IOAA 1XMQL 1TWCH 1SN8A 4DUYQ 3LGJA 1YVCA 4LF4Q 2YYZA 4PZ8A 5LMNL 1VQDA 3HOVG 2KENA 1CKOA 1KHIA 2HQLA 4LF8Q 4IFDG 2EXDA 1FGUA 1X56A 1PH1A 4JI4Q 4K0KQ 4DR3Q 4JG2A 1XNQL 1V1QA 2NVQH 4LF7Q 1TWAH 2JA6H 3HOYG 3FHWA 2UXBQ 3UDXA 3I4NG 1X54A 2JA9A 3ULPA 1ASYA 1XPUA 3DM3A 4YCVA 2VL6A 3PIPA 1PH5A 4GN5A 1KQSA 1JB7A 1QZGA 2K14A 4DKAC 1N34L 3I2ZA 1TWGH 1XPRA 1IBKL 1K8AC 3CCMA 2F4VL 3GDEA 1XNRQ 1VQEA 5LMNW 1YHAA 4RG1A 3UE0A 5BR8Q 3ZJYC 4YCWA 2K52A 3RLFA 2CKZB 2KHJA 4DV2L 1BBWA 1PH8A 2K50A 2R7DA 3PO3H 2YV5A 5IYCG 2E2HH 1I6HH 5JJKA 2VQEL 2KHIA 1EOVA 3A5UA 4OXPA 5C44H 4DR2Q 1U0LA 4LFAQ 1NE3A 5IYBG 1D8LA 4OWTB 4TQUS 4DR1L 4FDBA 1G6PA 3T1YL 4APVA 2B3GA 4DNIA 2WB1G 2N3SA 3E0EA 4A3DG 3HFZB 4MZ9A 4A3DH 4OX9Q 1Q8KA 2I5MX 3PSIA 4P74A 3CPWA 4OX9L 2MO0A 4H02A 2CWPA 1HR0W 2D0PA 3HOWH 3HOZH 1JMCA 4DAYB 1H95A 2ATWA 4LFAL 3OYYA 3GTJH 5JJLA 1RIPA 4R4QA 1WCMG 3HOXH 1VQHA 4A3CG 1FVIA 4A3GH 4JYAQ 4YWLA 2VZAA 1U5KA 2ZTDA 2JA5G 1SR3A 3RLNA 5IYCH 3A0JA 4B3SQ 2RHQB 1VQ8A 4PG3A 2XGTA 4AIMA 2KCMA 4GLVB 1KD1C 2I0QA 1GM5A 3GTLH 1YHQA 1D7QA 3ER0A 3GD7A 2BH8A 1XJVA 1GKHA 1VQLA 1A0IA 1WCMH 3HOXG 3M4QA 3J81j 1Q81C 2UUAQ 2MO1A 2F3IA 2CWAA 2IHFA 2EQSA 2ID0A 1L1OA 2UU9Q 2VS1A 1PH3A 1JJCB 5M5YH 5GAGC 4A3MG 2ASBA 3M4PA 5IP9G 1YZ6A 4R4TA 2CFMA 3I56A 4AQYQ 1IXRA 2JQOA 4ALPA 1M90C 3K80C 4A3CH 3J7A5 1L0WA 5DLQE 1CUKA 2N49A 3E9IA 3F1ZA 2L15A 4YY3L 4JI3Q 4POFA 4LF4L 1E22A 3PCOB 3BU2A 2K5NA 5BR8L 4HIMA 1VQCA 1Y1WH 1XMQQ 2A8VA 2Y0SE 2Z6KA 1YIJA 1X6OA 3CXCA 4A3KH 1SFOH 1HNXQ 1OXXK 3KF6A 4LUZA 4HJ5A 4JI5L 4JI1Q 4JCVE 2JA8H 1NMGA 1KIXA 3TEHB 2R7ZG 1Y14B 3DLLA 2JK8A 3CCVA 3B6YA 1LTLA 1YHBA 4X65Q 1DGSA 1YITA 4IPDA 1K0RA 4C3JH 5FJ8G 1FJGL 2UXBL 2ZM6Q 5K36G 4GNXC 4P71A 4QJFA 5IP7H 4X6AH 4DV7Q 1ASZA 1SLJA 4NPSA 1VQ4A 3L2PA 3PUYA 4LF5Q 1XNQQ 4B3ML 1J6QA 1A63A 4P75A 4PZ7A 1VQ6A 3BZKA 4IJLA 3I7FA 5LMNQ 4UP7A 4DK6C 1K3RA 5C3EG 4DV4L 1K73C 1K9MC 2R93G 1C0AA 4KLKA 3W1BA 4BXXH 3HKZG 1L1OC 2E8GA 2VW9A 1XMOL 2B63H 3CCLA 1TWHH 3JC66 4LUVA 1L2FA 2Z0SA 4A76A 3U58A 4BA2I 2JJQA 1EWIA 4JV5L 1O7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1G A;  1C7Y A;  4R1J A;  2OTL A;  3PGZ A;  3OW2 A;  4JI6 Q;  3UDF A;  1VS0 A;  2E5L Q;  1IBL L;  3HKS A;  4A3B G;  4JI3 L;  4YY3 Q;  2R7Z H;  4DR4 L;  1N8R C;  1R9T H;  5GRO A;  1BKB A;  4IPH A;  2MNA A;  1S40 A;  3NEM A;  2OTJ A;  5IE8 A;  1XMO Q;  5HY6 A;  3HOY H;  4JI7 L;  3GTP H;  4KHZ A;  3UE1 A;  4DV4 Q;  4HJA A;  3VDY A;  4LW1 A;  2JE6 I;  4YCU A;  3S1Q H;  3KJO A;  2AHO B;  3K81 C;  1PH2 A;  2R92 H;  4DV7 L;  1NJI C;  3UDI A;  2ZM6 L;  3PO2 G;  3PO2 H;  3TQY A;  1SRO A;  4JI4 L;  2FXQ A;  1IBM L;  4X64 Q;  4A3F G;  1W2B A;  3TRZ A;  4B3S L;  1PVO A;  2UUC Q;  3HOW G;  4BBS H;  2I5L X;  3KF6 B;  3S24 A;  2RF4 A;  1HZB A;  4JI5 Q;  4BXX G;  4JYA L;  4KHP Q;  3EN2 A;  5M3F G;  2LXK A;  1UEB A;  3Q8D A;  2QEX A;  1QUQ A;  1SE8 A;  1UWV A;  1HNZ Q;  5GAE C;  2Q2H A;  4YHH L;  2LXJ A;  2JA6 G;  1QUQ B;  3M9B A;  1OXS C;  3OTO Q;  2IT1 A;  4A3L G;  4HJ9 A;  2VUM H;  1T9H A;  5C4X G;  4YWM A;  1PV4 A;  4AYB G;  2IY5 B;  3AQQ A;  4AQY L;  1QVC A;  1L1O B;  2WAQ G;  3KOJ A;  3RZD H;  1LUZ A;  3BZC A;  1UE6 A;  4O0A A;  3F2B A;  1YBY A;  1GVP A;  5M5W H;  4QGU A;  3CME A;  4A3K G;  1M1K C;  3CF5 A;  1IYJ B;  4L5Q A;  1VQK A;  1OXV A;  3KJP A;  1HR0 Q;  1W3S A;  5C3E H;  2VQF Q;  2R93 H;  4NXM L;  3ULJ A;  2F52 A;  1P16 A;  1TXY A;  4A4I A;  1PFS A;  3D31 A;  1EYG A;  4JI8 Q;  1KAW A;  1HNW L;  1VQP A;  4LF9 Q;  3RNU A;  4JI8 L;  1IBK Q;  3G6E A;  4UP9 A;  1SRU A;  3A74 A;  3F2D A;  1Q12 A;  4JBM A;  3F2C A;  4A3I H;  3PUZ A;  2ZJR A;  3M4O H;  3JAM i;  4A93 H;  1I50 H;  2DUD A;  1CSP A;  2YTY A;  4UPA A;  4DR5 L;  1JT8 A;  5IT9 c;  5FLM H;  3H0G G;  4JBW A;  4RMF A;  5HGQ A;  3CMA A;  5FLM G;  3WWV A;  4DR3 L;  3H3V H;  2DGY A;  3PUV A;  4R4C A;  4LF8 L;  5IYD G;  1IZ6 A;  4GLA C;  5ELO A;  3OTO L;  4XTC S;  3UDG A;  5C0X G;  2CQO A;  1KC8 C;  2HIV A;  4QIW E;  2ZTC A;  1Q7Y C;  3T1Y Q;  1JJ2 A;  3GTO H;  1QVF A;  3NEN A;  5IWA L;  3J7Z C;  1NMF A;  2OQK A;  4DR2 L;  2ES2 A;  3S15 H;  2VQE Q;  2H5X A;  3I4O A;  4YWK A;  3TS2 A;  3SGI A;  4IOC A;  1RL2 A;  1IL2 A;  3I4M H;  2BA1 A;  4DR7 Q;  2OQ0 A;  3L7Z C;  2AKW B;  1UE1 A;  4DV3 L;  5FLX c;  4BY7 H;  1AE2 A;  1GO3 E;  4JOI A;  4EX5 A;  4DV2 Q;  1GD7 A;  1Z47 A;  4DV5 Q;  1X9N A;  1J5E Q;  3GTQ H;  2ALY B;  1I94 L;  4B3T L;  2ZJQ A;  4LF9 L;  2D62 A;  1HNW Q;  3RR5 A;  2UXC L;  3M7N A;  4OO1 I;  3I4N H;  2UXD L;  4JC0 A;  4XIG S;  1N34 Q;  1VCI A;  5IP9 H;  4GS3 A;  1K83 H;  1P8L A;  3J80 i;  1C9O A;  1HR0 L;  1KL9 A;  5JEA J;  4HIK A;  2Q2T A;  3J80 c;  5ELN A;  1CKN B;  3L0O A;  3PUW A;  1N36 L;  2UUB L;  2A19 A;  1OTC A;  4HJ7 A;  1VQF A;  4JI0 Q;  2UXD Q;  4AYB E;  4BY1 H;  5E7N A;  4A3E G;  5IYD H;  1HJP A;  2RHS B;  4QY7 A;  5LMU Q;  4DV5 L;  4C3H H;  1YJW A;  4DR4 Q;  1Y1V H;  3HOU H;  4B3R L;  4EQ5 A;  4O2D A;  2E5L L;  5AJ3 Q;  1X3E A;  1VQN A;  1YNX A;  4DAM A;  3ICE A;  3U4Z A;  4X66 L;  1E7Z A;  2GN5 A;  4DK3 C;  4BA1 I;  5IWA Q;  2VY3 A;  3AFP A;  1Z9F A;  5M5X H;  3RN5 A;  2IX1 A;  1V9P A;  2NVT H;  4KHP L;  4JBJ A;  4UP8 A;  4P72 A;  4C2M H;  3CP0 A;  3KDF A;  4GLX A;  2E2I H;  2I5H A;  1EIY B;  4PMW A;  4B3R Q;  4GKJ Q;  2Q2I A;  4A75 A;  2UUC L;  4JI2 L;  1UE7 A;  3STB D;  2HT1 A;  4IFD J;  4MTN A;  4DV0 L;  1IBM Q;  4B3M Q;  3K8A A;  3W5O A;  2JEA I;  2AMC B;  3RZO H;  4LFC L;  4LF6 Q;  4GOP C;  2Q2U A;  3GO5 A;  4GKK Q;  3HKZ E;  4OO1 G;  1AE3 A;  4GN4 B;  4X62 L;  3G48 A;  3PV0 A;  3S1M H;  2UUB Q;  3A5Z B;  3S2D H;  2WFW A;  4DV0 Q;  1VQ5 A;  2IHE A;  4DUZ L;  1MIU A;  2MFI A;  4Y7N H;  3HOV H;  4QL5 A;  1S72 A;  2WP8 J;  3CAM A;  1EQQ A;  4DV6 Q;  3MEF A;  4OON A;  4DR6 L;  3KF8 B;  5GAD C;  3AYH B;  4JI7 Q;  1OXU A;  1X3G A;  5GQO A;  1PH9 A;  4GNX B;  3G71 A;  2Y0S G;  3S17 H;  4GOP B;  2N8N A;  3MXN B;  1HH2 P;  3BJU A;  4A3J H;  3CC7 A;  3NEL A;  1EIF A;  4PZ6 A;  5AJ3 L;  1J5E L;  1FL0 A;  2YTX A;  4L5T A;  5C0X I;  4DV3 Q;  5JJI A;  4A3G G;  3S14 H;  4L5S A;  1SMX A;  2VQF L;  5C0X J;  3IRB A;  3AFQ A;  2LSS A;  3CPF A;  3KYH C;  3PF4 A;  2AWO A;  5C4X H;  2VUM G;  2KCT A;  1EUJ A;  1VQI A;  2NN6 I;  3KDF B;  3I4M G;  4DPG A;  4DV1 L;  4JI0 L;  4WJ4 A;  1CKN A;  3STB C;  2V1C C;  3CCE A;  4LFB Q;  1KXL A;  2GVA A;  4DV6 L;  2PI2 A;  4DR6 Q;  1JJG A;  2E2J H;  2EIF A;  5GAH C;  4NXN L;  2NZO A;  4DUZ Q;  1Q46 A;  3F8T A;  4LNQ A;  2VNU D;  2K75 A;  3U4V A;  2OCE A;  4X62 Q;  1Y1W G;  4A3M H;  2C35 B;  5IYB H;  4DR5 Q;  1N33 L;  3CD6 A;  2UXC Q;  4IPC A;  3S1R H;  4X65 L;  4A3J G;  5JEA G;  1N9W A;  1I94 Q;  2N78 A;  3CCR A;  2B29 A;  1TWF H;  1I3Q H;  2JA5 H;  1WJJ A;  4GKJ L;  1K8G A;  1XTD A;  4JI1 L;  3PF5 A;  4UY8 C;  4DR7 L;  3S2H H;  2A1A A;  4A3I G;  4X64 L;  4QQB X;  4WJ3 M;  1VQO A;  1HNX L;  1BVS A;  1MJC A;  1MKH A;  3G4S A;  3D0F A;  2PMZ E;  1JE5 A;  4X66 Q;  2WAQ E;  1QZH A;  2RCN A;  4R4O A;  1X3F A;  3K7U C;  1PH7 A;  1N32 Q;  1I5F A;  1V43 A;  3ULL A;  1NY4 A;  3JAM c;  3H0G H;  3KLW A;  4HID A;  3S16 H;  2JA7 H;  1Q82 C;  5LMU L;  3GTG H;  3TS0 A;  4KI0 A;  3CCU A;  4IFD I;  3NBH B;  1Q86 C;  2B63 G;  4P73 A;  2QA4 A;  1KRT A;  3K7A H;  1VQB A;  4LFB L;  3CCS A;  4DR1 Q;  4DV1 Q;  1VQ7 A;  4JOI C;  1N36 Q;  3EIV A;  1LYL A;  1G51 A;  5IP7 G;  4IJH A;  4HJ8 A;  4A3F H;  3J81 c;  2UU9 L;  1PHJ A;  1B70 B;  1NBW A;  5J3B A;  3H15 A;  2NVX H;  1X55 A;  2AWN A;  2XTI A;  3CC2 A;  2OWO A;  1EQR A;  2K5H A;  3FP9 A;  1YJ9 A;  4LUO A;  4JI6 L;  3H3V I;  1N32 L;  4MNO A;  1CKM A;  1HNZ L;  3E9H A;  1YI2 A;  1AH9 A;  2WB1 E;  2ZTE A;  2F4V Q;  1B7Y B;  3FKI G;  4BBR H;  1Q1E A;  1EFW A;  1WOC A;  2JA8 G;  2R7F A;  3CCQ A;  4A3B H;  3CCJ A;  2Z6K C;  5EAY A;  3RN2 A;  1VQG A;  2PQA B;  1G29 1;  3AEV A;  4AH6 A;  1E1T A;  4LF5 L;  2R6G A;  2PNH A;  3I55 A;  1YJN A;  1N33 Q;  4LF7 L;  1VQJ A;  4HIO A;  1FJG Q;  4LF6 L;  4LFC Q;  4GKK L;  3PO3 G;  4Y52 H;  1PYS B;  2YTV A;  1A62 A;  4OWX B;  3CC4 A;  2MQH A;  3TRE A;  4NXN Q;  3CW2 C;  4JI2 Q;  2JA7 G;  1B8A A;  3GTM H;  4L5R C;  2R92 G;  3PUX A;  1VQ9 A;  1E3P A;  1KRS A;  4BY7 G;  4NB3 A;  5M3F H;  5FJ8 H;  3GTK H;  3PIO A;  1PYB A;  1WI5 A;  3T1H Q;  2CCZ A;  2HHH Q;  4POG A;  4GNX A;  2GVB A;  4BBS G;  2BH2 A;  1Q1B A;  2QGQ A;  4IO9 A;  4C3I H;  4GOP A;  3RLO A;  3EBE A;  1HZA A;  4OWW B;  3KFU A;  3CQZ H;  3U50 C;  1X65 A;  4JV5 Q;  4A93 G;  1XNR L;  3HOZ G;  3S1N H;  5C44 G;  2PI2 E;  3FKI H;  1BBU A;  4TVA B;  4BBR G;  2K4K A;  2D0O A;  3M85 A;  4A3E H;  4BY1 G;  1HZ9 A;  1LM0 A;  1WFQ A;  1UE5 A;  4IPG A;  5IY0 A;  1PH4 A;  4NXM Q;  1QVG A;  2IX0 A;  2K5V A;  4A3L H;  4GN3 B;  1E24 A;  1VQA A;  1Y1V G;  3HOU G;  3M3Y H;  2UUA L;  1NTG A;  2JEB I;  5M3M G;  1OXT A;  4J15 A;  1XPO A;  1HZC A;  3J81 i;  4JBK A;  1YEZ A;  4K0K L;  4B3T Q;  2BA0 A;  1CSQ A;  1VQM A;  1MJE A;  2KBN A;  4R4I A;  3ERS X;  2ZJP A;  4ME3 A;  1A8V A;  2NVY H;  3K0X A;  1IBL Q;  2NN6 G;  1WYD A;  4DUY L;  1PH6 A;  2YU9 H;  4YHH Q;  2NZH A;  4LWC A;  5H1S E;  5C4J H;  1PA6 A;  1E1O A;  2HHH L;  1S3O A;  2PQA A;  5M3M H;  3T1H L;  2HIX A;  4IOA A;  1XMQ L;  1TWC H;  1SN8 A;  4DUY Q;  3LGJ A;  1YVC A;  4LF4 Q;  2YYZ A;  4PZ8 A;  5LMN L;  1VQD A;  3HOV G;  2KEN A;  1CKO A;  1KHI A;  2HQL A;  4LF8 Q;  4IFD G;  2EXD A;  1FGU A;  1X56 A;  1PH1 A;  4JI4 Q;  4K0K Q;  4DR3 Q;  4JG2 A;  1XNQ L;  1V1Q A;  2NVQ H;  4LF7 Q;  1TWA H;  2JA6 H;  3HOY G;  3FHW A;  2UXB Q;  3UDX A;  3I4N G;  1X54 A;  2JA9 A;  3ULP A;  1ASY A;  1XPU A;  3DM3 A;  4YCV A;  2VL6 A;  3PIP A;  1PH5 A;  4GN5 A;  1KQS A;  1JB7 A;  1QZG A;  2K14 A;  4DKA C;  1N34 L;  3I2Z A;  1TWG H;  1XPR A;  1IBK L;  1K8A C;  3CCM A;  2F4V L;  3GDE A;  1XNR Q;  1VQE A;  5LMN W;  1YHA A;  4RG1 A;  3UE0 A;  5BR8 Q;  3ZJY C;  4YCW A;  2K52 A;  3RLF A;  2CKZ B;  2KHJ A;  4DV2 L;  1BBW A;  1PH8 A;  2K50 A;  2R7D A;  3PO3 H;  2YV5 A;  5IYC G;  2E2H H;  1I6H H;  5JJK A;  2VQE L;  2KHI A;  1EOV A;  3A5U A;  4OXP A;  5C44 H;  4DR2 Q;  1U0L A;  4LFA Q;  1NE3 A;  5IYB G;  1D8L A;  4OWT B;  4TQU S;  4DR1 L;  4FDB A;  1G6P A;  3T1Y L;  4APV A;  2B3G A;  4DNI A;  2WB1 G;  2N3S A;  3E0E A;  4A3D G;  3HFZ B;  4MZ9 A;  4A3D H;  4OX9 Q;  1Q8K A;  2I5M X;  3PSI A;  4P74 A;  3CPW A;  4OX9 L;  2MO0 A;  4H02 A;  2CWP A;  1HR0 W;  2D0P A;  3HOW H;  3HOZ H;  1JMC A;  4DAY B;  1H95 A;  2ATW A;  4LFA L;  3OYY A;  3GTJ H;  5JJL A;  1RIP A;  4R4Q A;  1WCM G;  3HOX H;  1VQH A;  4A3C G;  1FVI A;  4A3G H;  4JYA Q;  4YWL A;  2VZA A;  1U5K A;  2ZTD A;  2JA5 G;  1SR3 A;  3RLN A;  5IYC H;  3A0J A;  4B3S Q;  2RHQ B;  1VQ8 A;  4PG3 A;  2XGT A;  4AIM A;  2KCM A;  4GLV B;  1KD1 C;  2I0Q A;  1GM5 A;  3GTL H;  1YHQ A;  1D7Q A;  3ER0 A;  3GD7 A;  2BH8 A;  1XJV A;  1GKH A;  1VQL A;  1A0I A;  1WCM H;  3HOX G;  3M4Q A;  3J81 j;  1Q81 C;  2UUA Q;  2MO1 A;  2F3I A;  2CWA A;  2IHF A;  2EQS A;  2ID0 A;  1L1O A;  2UU9 Q;  2VS1 A;  1PH3 A;  1JJC B;  5M5Y H;  5GAG C;  4A3M G;  2ASB A;  3M4P A;  5IP9 G;  1YZ6 A;  4R4T A;  2CFM A;  3I56 A;  4AQY Q;  1IXR A;  2JQO A;  4ALP A;  1M90 C;  3K80 C;  4A3C H;  3J7A 5;  1L0W A;  5DLQ E;  1CUK A;  2N49 A;  3E9I A;  3F1Z A;  2L15 A;  4YY3 L;  4JI3 Q;  4POF A;  4LF4 L;  1E22 A;  3PCO B;  3BU2 A;  2K5N A;  5BR8 L;  4HIM A;  1VQC A;  1Y1W H;  1XMQ Q;  2A8V A;  2Y0S E;  2Z6K A;  1YIJ A;  1X6O A;  3CXC A;  4A3K H;  1SFO H;  1HNX Q;  1OXX K;  3KF6 A;  4LUZ A;  4HJ5 A;  4JI5 L;  4JI1 Q;  4JCV E;  2JA8 H;  1NMG A;  1KIX A;  3TEH B;  2R7Z G;  1Y14 B;  3DLL A;  2JK8 A;  3CCV A;  3B6Y A;  1LTL A;  1YHB A;  4X65 Q;  1DGS A;  1YIT A;  4IPD A;  1K0R A;  4C3J H;  5FJ8 G;  1FJG L;  2UXB L;  2ZM6 Q;  5K36 G;  4GNX C;  4P71 A;  4QJF A;  5IP7 H;  4X6A H;  4DV7 Q;  1ASZ A;  1SLJ A;  4NPS A;  1VQ4 A;  3L2P A;  3PUY A;  4LF5 Q;  1XNQ Q;  4B3M L;  1J6Q A;  1A63 A;  4P75 A;  4PZ7 A;  1VQ6 A;  3BZK A;  4IJL A;  3I7F A;  5LMN Q;  4UP7 A;  4DK6 C;  1K3R A;  5C3E G;  4DV4 L;  1K73 C;  1K9M C;  2R93 G;  1C0A A;  4KLK A;  3W1B A;  4BXX H;  3HKZ G;  1L1O C;  2E8G A;  2VW9 A;  1XMO L;  2B63 H;  3CCL A;  1TWH H;  3JC6 6;  4LUV A;  1L2F A;  2Z0S A;  4A76 A;  3U58 A;  4BA2 I;  2JJQ A;  1EWI A;  4JV5 L;  1O7I A; 
#chains in the Genus database with same CATH topology
 3W1G A;  5AFW A;  3NQT A;  1BDO A;  4ZKC B;  2F0Q A;  2F3W A;  4YY3 Q;  2CHB D;  1ET6 A;  2JXM B;  3R3O A;  4K2K A;  1XX8 A;  4M8A A;  2Q8T A;  4IPH A;  2MNA A;  1WD1 A;  5TSS A;  1XMO Q;  4EQP A;  4N8X 1;  1S5F D;  1VF7 A;  4DV4 Q;  3VDY A;  2JE6 I;  1LTR D;  5LHY 1;  2R92 H;  2ZM6 L;  1JOR A;  1KNE A;  1EIH A;  5I9O A;  2FXQ A;  3TRZ A;  3S1N B;  1PVO A;  1L0Y B;  3HOW G;  2R61 A;  1EZ6 A;  5C44 B;  1QNU A;  3S1M B;  1TS2 A;  4BXX G;  2RF4 A;  3C1E A;  1WTH A;  4EGV A;  1DCZ A;  2Q2H A;  1I4X A;  4IUR A;  4N9P A;  1F2M A;  1W6J A;  3L3O C;  4ME5 A;  1KAA A;  4A3L G;  1T9H A;  1EYA A;  1CHP D;  2KA7 A;  4AYB G;  5KIX A;  4AQY L;  3MFG A;  2NVY B;  2WAQ G;  4KKU A;  3KOJ A;  4HMJ A;  1UE6 A;  1LTG D;  1K8O A;  4XDX A;  1YBY A;  1VQK A;  1RF2 D;  2A68 C;  4NXM L;  3BDO A;  1EY0 A;  2FMM A;  4Q0F A;  1PFS A;  3D31 A;  3W3A A;  1NSN S;  1EYG A;  4C3J G;  1SRU A;  3F2D A;  3D4W A;  3P7J A;  3Q22 A;  1PRT B;  5C4Z A;  3A55 A;  4A3I H;  1G2T A;  3PUZ A;  2ZJR A;  2Q8R E;  5T1G A;  1CSP A;  1MHW C;  2F0U A;  1ZEQ X;  3DWP A;  2RVL A;  5IT9 c;  3H3V H;  1SE4 A;  2RKS A;  3PUV A;  4R4C A;  3LX0 A;  4YIJ A;  5IYD G;  5C4J B;  3OTO L;  3WDN A;  3Q24 A;  1PRT F;  3IKJ A;  3NEN A;  5KGU A;  5IWA L;  5EKK A;  1NNX A;  2H5X A;  3SGI A;  3I4M H;  4DR7 Q;  2OQ0 A;  3L7Z C;  3A8I E;  5CV9 A;  3SR1 A;  3TN2 A;  5FLX c;  3GTQ H;  1GD7 A;  4DV5 Q;  1I94 L;  1A2U A;  5IGD A;  4B3T L;  2ZJQ A;  4LF9 L;  5CV7 A;  2D62 A;  3M7N A;  2WAC A;  3TBI B;  1T5E A;  3Q6S A;  4B08 A;  1N34 Q;  3P1H A;  3D4D A;  4GS3 A;  1P8L A;  3NBH A;  2MGS A;  2Q2T A;  4CHT B;  1O7L A;  2EYF A;  2IL8 A;  3PUW A;  1N36 L;  1OTC A;  4HJ7 A;  3SK6 A;  1FD7 D;  2X69 A;  5E7N A;  2RHS B;  4DV5 L;  4DR4 Q;  3MXN A;  4B3R L;  3NE5 B;  1ILQ A;  2AQ3 B;  1VQN A;  5D65 A;  1PTO B;  1PRT D;  2H4O A;  4KHP L;  1SYC A;  5CYU A;  2I5H A;  3SK8 A;  3LNN A;  5IGC A;  4IFD J;  4MTN A;  1IBM Q;  4GKK Q;  3HKZ E;  1AE3 A;  1TVX A;  3PV0 A;  4BY7 B;  4FO2 A;  4AYB B;  2IHE A;  1LT3 D;  1MIU A;  3J81 L;  4QL5 A;  4HCE A;  2WP8 J;  3CAM A;  1A2T A;  1IL8 A;  3S17 H;  1PTO F;  4A3J H;  4O42 A;  3CC7 A;  1EWH A;  3HOZ B;  1FL0 A;  3JAM L;  3S14 H;  5C3X A;  3NPP A;  3VR4 A;  3VA5 A;  5C0X J;  5IGE A;  3KYH C;  3PF4 A;  5C4X H;  1Q90 A;  1ZXT A;  3QOJ A;  1Y8N B;  5C3E B;  4WJ4 A;  3I72 A;  2V1C C;  1KXL A;  2GVA A;  3DM1 A;  4NXN L;  4LNQ A;  3L9A X;  1HCZ A;  3FRP B;  2KCN A;  2K75 A;  3U4V A;  3H3V C;  4A3M H;  4A3B B;  5IYB H;  2EY6 A;  2R3Z A;  2SNM A;  3CD6 A;  1R9T B;  1BBX C;  4XYQ A;  2F0S A;  1Y69 U;  1WJJ A;  3PF5 A;  4UY8 C;  2A1A A;  2WKC A;  4JW0 A;  2EVB A;  4QUC A;  1MKH A;  1MJC A;  3G4S A;  3D0F A;  3V05 A;  2L4N A;  4PNY A;  1X3F A;  4MTK A;  2AQ2 B;  1KLU D;  1CTM A;  3JAM c;  3FVQ A;  3S16 H;  3PO2 B;  2Z4I A;  3GTG H;  3G7L A;  3QWN A;  3TS0 A;  4XQQ A;  1Q86 C;  5C0X H;  1I3Q B;  4P73 A;  2QA4 A;  3A8J E;  3K7A H;  3T16 A;  1X32 A;  1LYL A;  4NDX A;  4HJ8 A;  4IJH A;  4A3F H;  2D9U A;  2UU9 L;  1QNK A;  1B70 B;  1PTO C;  3M7G A;  2WIN B;  2AWN A;  4KV6 A;  4LUO A;  3H3V I;  4ZLT F;  1CKM A;  2O4X A;  1HNZ L;  1WTP A;  5JEA H;  3T53 B;  1WOC A;  2R7F A;  1WTX A;  2Z6K C;  1SE3 A;  4G7Z C;  3AEV A;  1G29 1;  1HTL D;  4R8N A;  3H6M A;  3URY A;  1E1T A;  3MC0 B;  4LF5 L;  2PNH A;  3I55 A;  2KED A;  4LF7 L;  1FNV A;  1VQJ A;  1SYF A;  1FJG Q;  1PZI D;  4NP5 A;  4LF6 L;  4IUP A;  1A62 A;  3CW2 C;  4C1N K;  3PUX A;  1VQ9 A;  4DAV A;  2PNR C;  1XXG A;  3I4L A;  1PYB A;  4FF4 A;  2PW7 A;  1VF5 C;  4POG A;  2CH4 A;  5CGK A;  3OMC A;  1XWE A;  2XN9 C;  4V0B A;  4FXD A;  5I6W A;  3TME A;  2M2L A;  4JV5 Q;  2FMC A;  1XNR L;  2PI2 E;  3FKI H;  4TVA B;  4BBR G;  4KD4 A;  2D0O A;  1L0X B;  1ILP A;  1UE5 A;  5IY0 A;  1PH4 A;  5G3L F;  1QVG A;  1EY4 A;  1VDZ A;  1E24 A;  1KLG D;  1VQA A;  3M3Y H;  5M3M G;  1O7Y A;  1I6H B;  3CHB D;  5C4X B;  1B44 D;  1STH A;  1V8Q A;  3KK7 A;  3OMG A;  4R4I A;  1IBL Q;  3TP6 A;  2KJX A;  3TDQ A;  1X3P A;  4KY7 A;  2L55 A;  2SDF A;  1S3O A;  3T1H L;  2HIX A;  1XMQ L;  3QO2 A;  5CMD A;  3AU7 A;  4DUY Q;  1WTO A;  3EJI A;  5LMN L;  3HOV G;  2HQL A;  1FGU A;  4K0K Q;  4JG2 A;  2J0T D;  2QW7 A;  2OXP A;  1V1Q A;  2NVQ H;  4KTA A;  1TWA H;  2O5I C;  3HOY G;  4LAA A;  4CJ0 B;  1G8Z D;  2B2T A;  4CDD C;  2ZXP A;  3J7A F;  2JA9 A;  3HP3 A;  3ULP A;  4RAU C;  2VL6 A;  3TP5 A;  4GN5 A;  3A7A B;  3I2Z A;  5ELE A;  1K8A C;  4I7A A;  4IZ8 A;  3GDE A;  1XNR Q;  4P2C B;  1KDC A;  4QMG A;  1ENC A;  4HN7 A;  2K50 A;  2YV5 A;  5IYC G;  5JJK A;  1A3T A;  2VQE L;  1SDF A;  3A5U A;  4K5W A;  4DR2 Q;  1U0L A;  1AZQ A;  1D8L A;  4FDB A;  5KND A;  3T1Y L;  4A3D G;  4A3D H;  4OX9 Q;  1DON A;  1J8I A;  1HR0 W;  2D0P A;  3MA2 B;  5EQ0 A;  5JVH 3;  1H95 A;  4WFN 3;  4LFA L;  1FVI A;  2F0H A;  4OGQ C;  4JYA Q;  2ZTD A;  2RHQ B;  5LL6 X;  3D6C A;  2K32 A;  5CBE E;  1BUV T;  2NTT A;  3GTJ B;  2EQS A;  1L1O A;  2UU9 Q;  5EJW A;  1CZW A;  4H44 C;  5GAG C;  1HFG A;  5DAU A;  4NKL A;  5COR A;  3DEO A;  2JQO A;  2PYK A;  4WOR A;  3J7A 5;  4JI3 Q;  3VR6 A;  1D5X C;  3BZD B;  1TS3 A;  5BR8 L;  4HIM A;  2Y0S E;  3A56 A;  1YIJ A;  1SFO H;  2DJF C;  1CA5 A;  3S9W A;  2F0F A;  4FF2 A;  2JA8 H;  3TEH B;  4KY5 A;  1AZP A;  5HUR A;  5FJ8 G;  5K36 G;  5FOB B;  4P71 A;  1D6E C;  1ASZ A;  1VQ4 A;  2PO4 A;  5EPJ A;  1J6Q A;  1U4M A;  4PZ7 A;  4EQO A;  4IJL A;  3I7F A;  4RHS A;  5C3E G;  1C0A A;  2H1E A;  3W1B A;  1L1O C;  3CCL A;  3T56 B;  1ESR A;  2AUK A;  5IP9 H;  1EWI A;  5IP7 G;  5ELC A;  2PZT A;  1O7I A;  2OTJ A;  1C7Y A;  2NBF A;  4JI6 Q;  3UDF A;  1VS0 A;  2K05 A;  2E5L Q;  2NVQ B;  1IBL L;  4QCL A;  2EPB A;  3S2D B;  2R7Z H;  4TKO B;  5EBD A;  1N8R C;  1BKB A;  1K0S A;  3FEW X;  3HRZ C;  5FLX L;  5M5W B;  3K5L A;  4DGZ A;  5EPK A;  2NVX B;  5HY6 A;  4JI7 L;  2EYL A;  2LY7 A;  2B63 B;  4HMI A;  4HJA A;  1I4Q A;  1SYE A;  1STA A;  4YCU A;  5JAV A;  4UDU C;  5M5X B;  4E6I A;  1TS4 A;  3S1Q H;  3KJO A;  2AHO B;  1PH2 A;  2NN6 H;  1NJI C;  3UDI A;  5K36 H;  3QJY A;  2X6L A;  3TQY A;  2JA7 B;  4X64 Q;  4A93 B;  4RHR A;  5I9P A;  2UUC Q;  4BBS H;  2I5L X;  4RGN A;  4KHP Q;  5M3F G;  1I4H A;  3Q8D A;  1BCP D;  1QUQ A;  1B9M A;  1SE8 A;  4K8I A;  5GAE C;  4CDF C;  5HGT A;  3U9S A;  2L11 A;  3PIP 3;  2VUM H;  2IY5 B;  1QVC A;  1V1P A;  3BZC A;  2Q8I B;  4O0A A;  1GUS A;  4A3I B;  1GVP A;  5L37 A;  1M1K C;  4A3K G;  1STB A;  1YNJ D;  3CF5 A;  1NAP A;  5FK9 C;  1OXV A;  3KLR A;  1HR0 Q;  2R93 H;  3HEJ A;  1IW7 C;  2J4X A;  1P16 A;  4ZCK A;  1JWM D;  1D5Z C;  1KAW A;  3NP8 A;  2EJF C;  3E6Z X;  3G6E A;  1Q12 A;  4HCS A;  3F2C A;  1UNS A;  2RDG A;  2PZU A;  2DUD A;  2YTY A;  4DR5 L;  1V1O A;  2O5J C;  5FLM H;  4DR3 L;  3RUZ A;  4RMF A;  5FLM G;  3WWV A;  4NMZ A;  1WTW A;  1GUO A;  4GLA C;  1QCB D;  4XTC S;  3UDG A;  5EKI A;  3R93 A;  1KC8 C;  2QEJ C;  3T1Y Q;  5CV5 A;  1SAP A;  1JJ2 A;  2E2D C;  2OQK A;  1QE6 A;  3I4O A;  1RL2 A;  4WJW A;  2F0K A;  2AKW B;  4DV3 L;  4BY7 H;  4JOI A;  1J5E Q;  1X9N A;  1Z47 A;  1I4G A;  2ALY B;  1WVL A;  1EWC A;  2UXC L;  2UXD L;  3SXH A;  4JC0 A;  1BR9 A;  3BG3 A;  5IIF A;  1EEI D;  5EBC A;  1C9O A;  2XRS D;  1HR0 L;  1KL9 A;  2KCC A;  3J80 c;  2F0I A;  2UUB L;  2A19 A;  2Z9H A;  4JI0 Q;  1ONL A;  5C5M A;  4BY1 H;  1IHZ A;  4C3H H;  3ZYY X;  5EGT A;  4O2D A;  1HXY D;  2E5L L;  5AJ3 Q;  5FO7 B;  2EJG C;  1YNX A;  3ICE A;  3E0J A;  1E7Z A;  4BA1 I;  3IAY A;  1Z9F A;  4P72 A;  1EIY B;  2OF1 A;  2P5Z X;  4HR7 B;  4A75 A;  3KBG A;  2UUC L;  1UE7 A;  3GTO B;  4ZK9 B;  3W5O A;  2JEA I;  3HOX B;  3GO5 A;  4OO1 G;  1C4Q A;  4GN4 B;  3BYY B;  3GP7 A;  3S1M H;  2UUB Q;  3S2D H;  1TS5 A;  3HOV H;  1GUN A;  4CJ2 C;  1NR4 A;  4MIU A;  1S72 A;  4DR6 L;  3MEF A;  2LKV A;  4OON A;  1DZ1 A;  3AYH B;  4JI7 Q;  1OXU A;  4LK1 C;  2L0C A;  2Y0S G;  3UI2 A;  2N8N A;  1HH2 P;  2DN8 A;  5AJ3 L;  1J5E L;  2YTX A;  4L5T A;  5C0X I;  1CI3 M;  4L5S A;  2VQF L;  4LMQ D;  1X3Q A;  2LSS A;  3D8G A;  5EPL A;  1SNP A;  4Y7N B;  2KCT A;  2PZW A;  3I4M G;  4DV1 L;  1TY2 A;  4RWS C;  4JI0 L;  3HOU B;  1CKN A;  4R9W A;  2MPM A;  1TWG B;  4DV6 L;  4Q5V A;  5GAH C;  2NZO A;  1HA6 A;  1ENA A;  2NUC A;  4X62 Q;  2UXC Q;  1SYB A;  4DN4 M;  4X65 L;  2B8G A;  5ELF A;  5T1I A;  5JEA G;  1I94 Q;  3CCR A;  2B29 A;  1TWF H;  1I3Q H;  1EU3 A;  4GKJ L;  1XTD A;  1AEX A;  2Z4H A;  1LO5 D;  4B9W A;  4DR7 L;  3S2H H;  4A3I G;  4WJ3 M;  1VQO A;  5CV4 A;  5BN3 A;  1HNX L;  2B8F A;  3BYT B;  2WAQ E;  4R4O A;  1PH7 A;  1V43 A;  1CA6 A;  3KLW A;  4OHJ A;  4FF1 A;  3R8B A;  5LMU L;  1EY8 A;  2CW0 C;  1SNC A;  1VQB A;  3CCS A;  1N36 Q;  3EIV A;  1RCV D;  3J81 c;  1ET9 A;  2C5C A;  4IAL A;  3H15 A;  2IPK D;  5J3B A;  5JPN C;  4DF7 A;  3D4R A;  5ELB A;  3CC2 A;  2K5H A;  2K6A A;  4MNO A;  4ABN A;  2A68 D;  3E9H A;  1YI2 A;  1CHQ D;  2WB1 E;  3HOW B;  2F4V Q;  1B7Y B;  3FKI G;  4BBR H;  1Q1E A;  2JA8 G;  4FYD A;  4ODG A;  3CCJ A;  4AH6 A;  1HQM C;  1F2L A;  4C3H B;  5FO8 B;  1YJN A;  4LFC Q;  1KDA A;  4C56 C;  3PO3 G;  4Y52 H;  2YTV A;  3HGB A;  1IKM A;  1TR5 A;  3MAQ A;  2MQH A;  2I46 A;  3I91 A;  3NSW A;  3TRE A;  4NXN Q;  4JI2 Q;  2CVR A;  5K5P A;  1B8A A;  2R92 G;  1PYW D;  1WCM B;  3ERO A;  4IUQ A;  3F2U A;  4BY7 G;  2HDL A;  1MGS A;  3VA7 A;  1LTS D;  5FJ8 H;  2KHS A;  2IJ0 A;  4K2L A;  3KLS X;  2HHH Q;  4GNX A;  2BH2 A;  1Q1B A;  1LAB A;  4GOP A;  3EBE A;  4K14 A;  3NHH A;  4IUT A;  2EYJ A;  2JYO A;  3CKI B;  1H9K A;  3HOZ G;  3S1N H;  5C44 G;  2K5D A;  2EE1 A;  2K4K A;  4A3E H;  2LFN A;  4BY1 G;  1HZ9 A;  1LM0 A;  4NXM Q;  4IPG A;  1M8A A;  5M9O A;  2K5V A;  1ICF B;  4GN3 B;  5A2Q E;  3PIO 3;  2NWG A;  2JEB I;  1PXU A;  1OXT A;  4J15 A;  5C6A A;  3J81 i;  5CBA E;  2A6H D;  4K0K L;  1CSQ A;  1EOT A;  1EY5 A;  5FLX E;  3ERS X;  4C3J B;  2NVY H;  1EY6 A;  5IT9 L;  1IYU A;  2NN6 G;  4DUY L;  2BDO A;  3I8Z A;  2KEC A;  1GHK A;  4YHH Q;  5C4J H;  2HHH L;  1E1O A;  1LT5 D;  3HG9 A;  5M3M H;  2FHT A;  2F0M A;  1TWC H;  4LF4 Q;  3VR5 A;  1XTC D;  1CT1 D;  4PZ8 A;  5DNF A;  1KHI A;  1SND A;  4J8Q A;  4LF8 Q;  4IFD G;  1UEA B;  1X56 A;  1JWS D;  5IGF A;  1ROD A;  4LF7 Q;  2UXB Q;  3I4N G;  1TU2 B;  4DAY A;  1A15 A;  3QR8 A;  3PIP A;  2EZV A;  1KQS A;  2RBM A;  4C2M B;  1I4P A;  1TWG H;  1IBK L;  2F4V L;  1IW7 D;  1VQE A;  3OPO A;  3UE0 A;  1GJX A;  5BR8 Q;  3ZJY C;  3J80 E;  2XIW A;  4QF4 A;  4YCW A;  1II3 A;  4FXG C;  2KHJ A;  3N6R A;  2K01 A;  1EOV A;  1B2T A;  4OWT B;  3FMC A;  4TSS A;  4QUF A;  4DNI A;  3E0E A;  2N3S A;  1PTO H;  1SFO B;  4L6T B;  4ULL A;  4EVO A;  3MXG A;  4FF3 A;  4P74 A;  2SOB A;  2BE5 C;  1QB5 D;  2MO0 A;  2CWP A;  2G5D A;  1HUN A;  2NVT B;  4K8J A;  3PO3 B;  3GTJ H;  5JJL A;  3A7L A;  3FDT A;  1SJH D;  1ZKO A;  4A3G H;  5A35 A;  3O13 A;  2IW3 A;  3NTH A;  3MVV A;  1KTK A;  4PG3 A;  2XGT A;  4AIM A;  1KD1 C;  1UUP A;  2JP1 A;  2CW0 D;  1YHQ A;  1D7Q A;  3IL8 A;  3GD7 A;  2BH8 A;  4XT1 B;  1GKH A;  4KKT A;  1LAC A;  3J81 j;  4ZKB B;  1Q81 C;  2MO1 A;  2UUA Q;  2F3I A;  3TZU A;  2OEO A;  1TWH B;  1H9J A;  3J81 E;  4BBR B;  3WOE A;  1HPC A;  1YNN D;  5IP9 G;  2A6H C;  3I56 A;  4ILW A;  4A3C H;  3M4O B;  5DLQ E;  2N49 A;  3E9I A;  2D2C C;  4LF4 L;  2SEB D;  2K5N A;  1C48 A;  5IGB A;  4DU9 A;  1H9M A;  4JCV E;  1B4O A;  1SXT A;  2R7Z G;  1Y14 B;  3S17 B;  3CCV A;  3S15 B;  1YHB A;  4BBS B;  2LS0 1;  1FNU A;  1K0R A;  4IUV A;  4C3J H;  2AUJ D;  5NUC A;  4X6A H;  1DXM A;  1ENF A;  1Y1W B;  1A63 A;  4FXK C;  5LMN Q;  4UP7 A;  4DK6 C;  4DK0 A;  1PTO D;  3I90 A;  5D14 A;  2K1B A;  4DV4 L;  1K73 C;  1EL0 A;  2B2Y C;  2QIL A;  3I4N B;  4BXX H;  2VW9 A;  1NUC A;  2F0E A;  2B63 H;  4A76 A;  3U58 A;  3ITP A;  2JJQ A;  2FIN B;  4R1J A;  3FPP A;  4KD3 A;  2OTL A;  3PGZ A;  4MHE A;  4UAI A;  3OW2 A;  1EY7 A;  1VMP A;  1BCP B;  1EYD A;  3HKS A;  4A3B G;  1F77 A;  4JI3 L;  3SK5 A;  1R9T H;  1S40 A;  3QG1 A;  4JVZ A;  2CH4 W;  2ICE C;  4DNT B;  1JIC A;  4IUN A;  3MWY W;  3HOY H;  1HTP A;  3GTP H;  5E1F A;  4X3K A;  1DD2 A;  2QF7 A;  3K81 C;  4X3S A;  4DV7 L;  5D3I B;  3J7Y W;  1HA5 A;  2I07 B;  3PO2 G;  3PO2 H;  3S16 B;  3GV3 A;  1IBM L;  2VUM B;  4A3F G;  3NTK A;  5KNB A;  3KF6 B;  4JYA L;  1HZB A;  4UHV A;  2LXK A;  1UEB A;  4IFD H;  2QEX A;  1OO9 B;  2LXJ A;  1OXS C;  1K3B C;  3M4Y A;  2IT1 A;  1JOQ A;  4HJ9 A;  4YWM A;  1PV4 A;  1GXD C;  5D3D A;  3RZD H;  2ZT9 C;  4F87 A;  3F2B A;  1QOH A;  4QGU A;  4L5Q A;  3DWQ A;  3K5N A;  1W3S A;  3ULJ A;  1FR3 A;  4ZQ3 A;  1MSH A;  4N9T A;  1HNW L;  1VQP A;  4LF9 Q;  2RDH A;  2R92 B;  1IBK Q;  4XQN A;  4UP9 A;  3A74 A;  3S1R B;  4JBM A;  1Q3L A;  1QIL A;  2X6G A;  3M4O H;  4F7X A;  3JAM i;  1I50 H;  2HCC A;  2PPB C;  4PMB A;  1E2Z A;  1RKN A;  4UPA A;  1GUW A;  4ZRZ A;  3H0G G;  4JBW A;  5HGQ A;  2VNU D;  2DGY A;  4LF8 L;  4XYO A;  1IZ6 A;  1V1P B;  1SBB B;  1D5M C;  3RMH A;  4QIW E;  3GTO H;  3MEH A;  3J7Z C;  1NMF A;  4DR2 L;  2ES2 A;  4RA8 A;  3S15 H;  2VQE Q;  2QKI C;  3TS2 A;  4U68 A;  2BA1 A;  3VYT A;  1AE2 A;  4DV2 Q;  2WB1 B;  1GUT A;  1BQQ T;  5EKL A;  4NW2 A;  4KJN A;  2NTS A;  4OO1 I;  3I4N H;  4XIG S;  5BN4 A;  1RJT A;  3GTK B;  1K83 H;  2O2L D;  5ELN A;  3VYR A;  1CKN B;  1TT2 A;  3SK4 A;  4GZY C;  5JJZ A;  2UXD Q;  3OHX C;  1T5X D;  3T4A C;  5IYD H;  3HOU H;  2DNE A;  3HOY B;  2F0V A;  1MI2 A;  4DAM A;  4X66 L;  2GN5 A;  4DK3 C;  3I3C A;  3AFP A;  5M5X H;  2IX1 A;  1V9P A;  3CP0 A;  3KDF A;  4MN3 A;  2E2I H;  4PMW A;  5M3F B;  2Q2I A;  4JI2 L;  2HT1 A;  1GUG A;  1LLR D;  4DV0 L;  4B3M Q;  3K8A A;  4LFC L;  2Q2U A;  3BDL A;  4KMU C;  2ZXR A;  1LTT D;  4OIK A;  1A3U A;  3A5Z B;  2L5T A;  4B9X A;  4QB4 A;  1SEB D;  1VQ5 A;  3NUC A;  4DUZ L;  4Y7N H;  3KF8 B;  5GAD C;  1PH9 A;  1X3G A;  5GQO A;  2B2Y A;  1MD2 D;  4G57 A;  4GOP B;  4V19 0;  3MXN B;  2RSO A;  2K28 A;  3NEL A;  1EIF A;  4PZ6 A;  2B39 A;  5JJI A;  4DV3 Q;  2FFK B;  3AFQ A;  4XQJ A;  2VUM G;  1EUJ A;  1VQI A;  2E76 C;  4DPG A;  2R93 B;  1Y1V B;  3G6J B;  1CZG A;  3STB C;  5DEH A;  1MBY A;  2EIF A;  2XSC A;  5DM7 3;  3F8T A;  2NZ1 D;  2OCE A;  2HD3 A;  4DR5 Q;  1QJO A;  5J39 A;  4A3J G;  2B2W C;  3NQI A;  1G91 A;  3RZO B;  3K6O A;  4JI1 L;  4HED A;  2QDB A;  1H9S A;  2E2J B;  4X64 L;  1BVS A;  5I6Y A;  1D2B A;  2A69 D;  2PMZ E;  1BO0 A;  1AN8 A;  3ULL A;  4L8J A;  3MHB A;  3K58 A;  4HID A;  4HAE A;  5F2D A;  3TSS A;  1Q82 C;  3C46 A;  4KI0 A;  4IFD I;  2B63 G;  3U9O A;  3LWU A;  4DV1 Q;  1DJR D;  1VQ7 A;  1D1K A;  3KF8 A;  2E2H B;  4JOI C;  2CQA A;  4ZUI A;  5KNC A;  1NBW A;  2NVX H;  1QWY A;  1X55 A;  1BXT A;  1S4Z A;  3OW7 A;  3VYS A;  3NWT A;  2DY8 A;  1N32 L;  3H0G B;  3SHL A;  2ZTE A;  2KEE A;  3LWE A;  1EFW A;  4WRD A;  1FNW A;  1EEF D;  4DNR B;  4DXF A;  4A3M B;  4A3B H;  1VQG A;  2EY1 A;  4RCO A;  5CV8 A;  3T13 A;  3VYU A;  3DUZ A;  2R6G A;  1EFI D;  5COY A;  1SSO A;  5A2Q L;  2E74 C;  2JA7 G;  2J7Z A;  4CBV A;  4L5R C;  1DM0 B;  1E3P A;  1PZK D;  4K6D A;  1S5E D;  5M3F H;  2F0J A;  3OSO A;  2EJM A;  3GTK H;  1WI5 A;  3T1H Q;  2GVB A;  4BBS G;  2QGQ A;  1JB3 A;  4CKC A;  3H09 A;  1HZA A;  4OWW B;  2A74 C;  2Y0S B;  1PZJ D;  2EYP A;  3A54 A;  3CQZ H;  3U50 C;  4A93 G;  1S5C D;  2MUY A;  2VB2 X;  4G7H C;  1BBU A;  2EOT A;  3SEB A;  3M85 A;  4JPB W;  1JR0 D;  1KAB A;  2IX0 A;  4A3L H;  3V96 A;  4A3K B;  3HOU G;  1TWC B;  2UUA L;  1U4P A;  1XPO A;  2L1B A;  1SMY C;  4JBK A;  1YEZ A;  5IOC A;  1IKL A;  2BA0 A;  1SYD A;  1SNO A;  1BCP F;  2ZJP A;  4ME3 A;  1A8V A;  3K0X A;  3EFX D;  1PH6 A;  2YU9 H;  1B50 A;  4LWC A;  5H1S E;  4FVM A;  1WD0 A;  3WOF A;  2B2W A;  1DOM A;  4IOA A;  2XWB B;  2IX3 A;  1SN8 A;  3LGJ A;  1YVC A;  5E3F A;  2B2T C;  2YYZ A;  1VQD A;  1CKO A;  1DOL A;  2KEN A;  2EXD A;  4JI4 Q;  4DR3 Q;  1XNQ L;  5JOB A;  3E3X A;  3UDX A;  2N88 A;  3H91 A;  3S2H B;  1JOK A;  1PFB A;  1I4R A;  3BVZ A;  3DM3 A;  1ASY A;  2AQ1 B;  2A6E D;  1PH5 A;  1XPU A;  2HDM A;  4J6H A;  1JB7 A;  1QZG A;  4DKA C;  2E75 C;  1N34 L;  1XPR A;  2NB0 A;  3CCM A;  3AMU A;  2TSS A;  5LMN W;  1YHA A;  4RG1 A;  3M3Y B;  2K5Q A;  2BDN A;  1LT6 D;  3NXW A;  2K52 A;  2HCI A;  1R4P B;  2CKZ B;  3RLF A;  4FNF A;  4OEM B;  2EXZ A;  3Q23 A;  2R7D A;  3PO3 H;  3NTI A;  2B2V C;  1I6V C;  2B2U C;  2B2V A;  2Z1C A;  1RTN A;  1EU4 A;  2KHI A;  1E2V A;  2BOS A;  5C44 H;  4LFA Q;  3R2T A;  5IYB G;  1K28 A;  1G6P A;  4APV A;  2B3G A;  1JWU D;  1NCV A;  3DHQ A;  3HFZ B;  1SYG A;  3P20 A;  3I70 A;  4OX9 L;  4H02 A;  3HOW H;  3HOZ H;  1RTO A;  1JMC A;  4DAY B;  4KN4 C;  5CV6 A;  3OYY A;  4HSP A;  2RCF A;  1RIP A;  4RKL A;  1WCM G;  3HOX H;  1VQH A;  4A3C G;  1ZYR D;  3MTS A;  5JVG 3;  5J1Z A;  1F9R A;  5I4D A;  4YWL A;  1SR3 A;  5IYC H;  2JA6 B;  1LT4 D;  4FP5 D;  1VQL A;  1F9P A;  1A0I A;  1WCM H;  3HOX G;  1HRJ A;  2EDG A;  5IGG A;  2MJ8 A;  1F9Q A;  2IHF A;  4H0L C;  5ISR A;  2VS1 A;  4CDC C;  4A3M G;  3I73 A;  2F03 A;  2ASB A;  1B1Z A;  1YZ6 A;  4R4T A;  4AQY Q;  1IXR A;  1STG A;  1SNM A;  1CUK A;  4BWG B;  4YY3 L;  4POF A;  2L9H A;  1E22 A;  4DFA A;  3PCO B;  3BU2 A;  5C4H A;  1VQC A;  4PMC A;  2PW5 A;  1CQF A;  1JQY D;  1K8M A;  2K33 A;  1Y1W H;  3NBI A;  1XMQ Q;  5ELD A;  1X6O A;  4A3K H;  3TZD A;  1OXX K;  3KF6 A;  4LUZ A;  2F4I A;  4IN3 A;  4OIJ A;  4JI1 Q;  2XNA C;  1NMG A;  1U9R A;  3GV6 A;  3DLL A;  1LTL A;  3PMF A;  1DGS A;  4F8M A;  4IPD A;  1EYC A;  4CGY B;  2ZM6 Q;  1FJG L;  2HUG A;  2A73 B;  3D6W A;  4NPS A;  3L2P A;  3PUY A;  5KEE A;  5DM6 3;  3BZK A;  4KHV A;  1K3R A;  2R93 G;  3HZX A;  3BDC A;  1GOZ A;  1HFN A;  4KLK A;  2E8G A;  3HKZ G;  1XMO L;  3V2T A;  3GTP B;  3JC6 6;  4ZAI A;  4LUV A;  4BA2 I;  2Z0S A;  1JOO A;  5ELO A;  4JV5 L;  5BN5 A;  4KN7 C;  4DR4 L;  5GRO A;  3NEM A;  5IE8 A;  1TWF B;  4KHZ A;  3UE1 A;  4IUU A;  4LW1 A;  2DJG C;  1SE2 A;  1JE4 A;  1PRT C;  1KDB A;  5G3L D;  1EQV A;  1SRO A;  4JI4 L;  2MHV A;  2G9H D;  3NWS A;  1W2B A;  1C8C A;  4B3S L;  4JK1 C;  3FKI B;  3MXP A;  2C9O A;  3S24 A;  1S5D D;  4JI5 Q;  3EN2 A;  1TQO A;  1Y8P B;  1UWV A;  1HNZ Q;  4C3H G;  3TP7 A;  4YHH L;  2JA6 G;  1QUQ B;  3M9B A;  2EYO A;  2EYM A;  3OTO Q;  2JN4 A;  3J7A V;  4A3J B;  2D5D A;  5C4X G;  1BOS A;  3AQQ A;  4U67 3;  1L1O B;  4H13 C;  1AP0 A;  1LUZ A;  3MZ5 A;  1FGB D;  3CME A;  5M5W H;  3QOL A;  1IYJ B;  3HS0 C;  3KJP A;  5C3E H;  2VQF Q;  2F52 A;  5I2Y A;  1TXY A;  4A4I A;  4OO1 H;  4JI8 Q;  1HUM A;  2WV6 D;  3RNU A;  4JI8 L;  3MXU A;  1TWA B;  2L12 A;  2XRQ D;  4X3U A;  1R4Q B;  4BY1 B;  4A93 H;  2K7V A;  4XT3 B;  3N52 A;  1VMC A;  2N55 A;  1JT8 A;  1PFN A;  4DXG A;  2JA5 B;  2F0O A;  3H94 A;  4H7B A;  3CMA A;  5M3M B;  1Y8O B;  1TKW B;  5C0X G;  1CM9 A;  2CQO A;  2HIV A;  3RD4 A;  2GA4 B;  2ZTC A;  2G9D A;  1U4R A;  1Q7Y C;  4K6L A;  1QVF A;  3GTG B;  1HHV A;  3NK9 A;  4KKS A;  4CKE A;  4DA2 A;  4YWK A;  4IOC A;  4KK7 A;  3CU7 A;  2VXW A;  1H9S B;  1U4L A;  1IL2 A;  1UE1 A;  1A3V A;  4EX5 A;  1GO3 E;  3QIA A;  4A3D B;  1E0B A;  1MSG A;  1HNW Q;  3RR5 A;  5IOD A;  3W2D A;  1VCI A;  3AB9 A;  4G7O C;  3J80 i;  1PMR A;  1SJE D;  3DWA A;  2RDF A;  2B2U A;  5JEA J;  4HIK A;  2HQE A;  3L0O A;  5FKA C;  2F0N A;  1WTQ A;  3GTQ B;  1VQF A;  2TMP A;  2XWJ B;  1KNA A;  3X3M A;  4QIW B;  2F0L A;  2KOL A;  4AYB E;  3P75 A;  2E2I B;  3FPU B;  4A3E G;  1HJP A;  5E4W C;  4QY7 A;  5LMU Q;  1YJW A;  1Y1V H;  4EQ5 A;  1X3E A;  1XYI A;  2K5W A;  2PQE A;  3KBX A;  3U4Z A;  2A5H A;  5IWA Q;  2VY3 A;  1STE A;  3RN5 A;  3C1F A;  2RA4 A;  2NVT H;  4JBJ A;  4UP8 A;  4C2M H;  3K5M A;  4GLX A;  4KJO A;  4B3R Q;  4GKJ Q;  3STB D;  4RFB A;  2AMC B;  3EVQ A;  4LF6 Q;  3RZO H;  4GOP C;  4X62 L;  1F2Z A;  3G48 A;  4RGO S;  4PQX A;  3IFD A;  1WTR A;  2WFW A;  4DV0 Q;  3SE0 A;  2MFI A;  2QDL A;  1EQQ A;  4DV6 Q;  3K0Y A;  3X3N A;  4GNX B;  1WTV A;  3G71 A;  3BJU A;  1NR2 A;  5E4X A;  2F0P A;  5CR3 A;  4A3G G;  2LMC B;  1SMX A;  4EQN A;  5C5L A;  2K03 A;  3IRB A;  3CPF A;  2AWO A;  2ZXO A;  4ZYS A;  2ENB A;  4CDE C;  2NN6 I;  3BS1 A;  3KDF B;  3ONA B;  3ERQ A;  3CCE A;  4LFB Q;  1GHJ A;  3ND9 A;  3CRK C;  4DR6 Q;  2PI2 A;  3K57 A;  2E2J H;  1JJG A;  1E2W A;  2FJ2 A;  4S3S A;  4DUZ Q;  1Q46 A;  3S14 B;  2WKD A;  1Y1W G;  2C35 B;  1N33 L;  3CRL C;  4IPC A;  3ND8 A;  3S1R H;  1DYQ A;  1N9W A;  2N78 A;  3OIP A;  2Z8L A;  3D3R A;  2JA5 H;  1K8G A;  3JAM E;  4QQB X;  4HTH A;  3QB3 A;  5J22 A;  1STN A;  3HOV B;  1Q8I A;  3A8K E;  3S1Q B;  5CC4 A;  1JE5 A;  4X66 Q;  1QZH A;  2RCN A;  3K7U C;  1N32 Q;  1I5F A;  4RGT A;  4RKB A;  4XXE A;  1NY4 A;  3H0G H;  1LTA D;  1JC7 A;  2JA7 H;  4I7Z C;  1STY A;  3CCU A;  3NBH B;  1KRT A;  4LFB L;  1AW7 A;  1J9O A;  4RH6 A;  4DR1 Q;  1ML0 D;  3GTL B;  2R7Z B;  1G51 A;  3CQZ B;  1EY9 A;  1PHJ A;  2F0G A;  2XTI A;  2OWO A;  1EQR A;  3FP9 A;  4J1M A;  1YJ9 A;  4JI6 L;  4A3E B;  2M00 A;  1SMY D;  1AH9 A;  5M5Y B;  3K7A B;  2NYZ D;  2PMZ B;  3CCQ A;  2WAQ B;  3RN2 A;  5EAY A;  2PQA B;  2SNS A;  1O78 A;  1Z7T A;  5KRU A;  1N33 Q;  4CKB A;  4HIO A;  1ZYR C;  4GKK L;  2M9V A;  1PYS B;  4OWX B;  5I2X A;  3CC4 A;  3GTM H;  3OWE B;  1KRS A;  4NB3 A;  1BNZ A;  4I65 A;  1F2Y A;  2EY5 A;  2KQ3 A;  1PFM A;  3PIO A;  3VR3 A;  2CCZ A;  4ID6 A;  3J80 L;  2F3V A;  1B53 A;  1O7Z A;  3RZD B;  4IO9 A;  4C3I H;  3RLO A;  2DNC A;  2XVS A;  4C3I G;  1EIG A;  3KFU A;  1G6Z A;  2V4D A;  4A3F B;  5LL6 S;  1X65 A;  4O1N A;  3HKZ B;  2IWH A;  2YU9 B;  1WFQ A;  3OOC A;  4HSV A;  4K5V A;  1Y1V G;  2JSO A;  2F0W A;  1B3Q A;  1NTG A;  2F0T A;  1EZ8 A;  4DK1 A;  2A6E C;  1HZC A;  1YNJ C;  3KLS A;  4B3T Q;  1VQM A;  1MJE A;  1CK1 A;  2KBN A;  1LTB D;  4DAP A;  4N8F A;  1WYD A;  1LV9 A;  4LJZ C;  4X3T A;  3T51 B;  2Z6B A;  2RQX A;  2NZH A;  1CFM A;  1PA6 A;  2K04 A;  2PQA A;  1ESF A;  2BCO A;  3EA6 A;  2OT2 A;  1UAP A;  1BCP C;  5KYL A;  1PH1 A;  5JPM C;  2JA6 H;  4A3G B;  2A69 C;  1ICW A;  3FHW A;  1X54 A;  5FO9 B;  1TII D;  3K5O A;  1I50 B;  1B3A A;  4OEL B;  4YCV A;  2F1M A;  2K14 A;  4G4K A;  1K83 B;  3BVG A;  1PLF A;  3KUP A;  1H9R A;  1RDP D;  1BF4 A;  4DV2 L;  1BBW A;  3GQB A;  4F88 A;  5C3W A;  2KVM A;  1PH8 A;  2VB3 X;  4C1N I;  2E2H H;  3PQI A;  1I6H H;  4TRD A;  1B9N A;  2PCF B;  4OXP A;  3VR2 A;  1NE3 A;  4DR1 L;  4TQU S;  4M1U B;  1O80 A;  2WB1 G;  4CJ1 B;  4MZ9 A;  1Q8K A;  2I5M X;  3PSI A;  3CPW A;  3OIQ A;  3TP8 A;  3SVM A;  2EY2 A;  4R8I A;  4L63 B;  4BS9 A;  2ATW A;  1Z6H A;  4R4Q A;  1AFP A;  3Q0A A;  4RGM A;  2EYH A;  3OWF A;  2VZA A;  1U5K A;  2JA5 G;  4PV1 C;  3RLN A;  5IT9 E;  2BE5 D;  3A0J A;  4B3S Q;  1VQ8 A;  3GTL H;  2KCM A;  4GLV B;  4KY6 A;  2I0Q A;  1GM5 A;  1F9S A;  3EQL C;  2F0D A;  3ER0 A;  3K59 A;  1TY0 A;  3SDZ A;  1XJV A;  1PDQ A;  1DOK A;  2KUM A;  2RSN A;  3M4Q A;  4Z9C B;  3DXJ C;  2CWA A;  1JCK B;  2ID0 A;  3IFT A;  3I4M B;  1PH3 A;  1JJC B;  5M5Y H;  1HQR D;  1RHP A;  2MP1 A;  3M4P A;  4IQZ A;  2DY7 A;  2CFM A;  4ALP A;  1M90 C;  3K80 C;  1L0W A;  1IYV A;  3F1Z A;  2L15 A;  2QCP X;  3DEP A;  4OL7 A;  2WII B;  4RCN A;  2A8V A;  2Z6K A;  3CXC A;  1YNN C;  1HNX Q;  4K5X A;  3GTM B;  1A6X A;  2ICI A;  4HJ5 A;  1RD9 D;  1LTI D;  1W6K A;  5KYI A;  4JI5 L;  3DMU A;  1M4V A;  3MFY A;  1KIX A;  4ZUJ A;  2JK8 A;  1D1I A;  3B6Y A;  1YIT A;  3BVM A;  4X65 Q;  2UXB L;  4C3I B;  4GNX C;  4QJF A;  5IP7 H;  1S5B D;  4DV7 Q;  1SLJ A;  1XNQ Q;  4LF5 Q;  4B3M L;  4P75 A;  3C2P A;  1VQ6 A;  1CQV A;  1G2S A;  3E5S A;  1K9M C;  1QG7 A;  2JA8 B;  3C3L A;  1FYC A;  3R2I A;  1TWH H;  1L2F A;  1EQT A;  1SNQ A; 
#chains in the Genus database with same CATH homology
 3W1G A;  1C7Y A;  4R1J A;  2OTL A;  3PGZ A;  3OW2 A;  4JI6 Q;  3UDF A;  1VS0 A;  2E5L Q;  1IBL L;  3HKS A;  4A3B G;  4JI3 L;  4YY3 Q;  2R7Z H;  4DR4 L;  1N8R C;  1R9T H;  5GRO A;  1BKB A;  4IPH A;  2MNA A;  1S40 A;  3NEM A;  2OTJ A;  5IE8 A;  1XMO Q;  5HY6 A;  3HOY H;  4JI7 L;  3GTP H;  4KHZ A;  3UE1 A;  4DV4 Q;  4HJA A;  3VDY A;  4LW1 A;  2JE6 I;  4YCU A;  3S1Q H;  3KJO A;  2AHO B;  3K81 C;  1PH2 A;  2R92 H;  4DV7 L;  1NJI C;  3UDI A;  2ZM6 L;  3PO2 G;  3PO2 H;  3TQY A;  1SRO A;  4JI4 L;  2FXQ A;  1IBM L;  4X64 Q;  4A3F G;  1W2B A;  3TRZ A;  4B3S L;  1PVO A;  2UUC Q;  3HOW G;  4BBS H;  2I5L X;  3KF6 B;  3S24 A;  2RF4 A;  1HZB A;  4JI5 Q;  4BXX G;  4JYA L;  4KHP Q;  3EN2 A;  5M3F G;  2LXK A;  1UEB A;  3Q8D A;  2QEX A;  1QUQ A;  1SE8 A;  1UWV A;  1HNZ Q;  5GAE C;  2Q2H A;  4YHH L;  2LXJ A;  2JA6 G;  1QUQ B;  3M9B A;  1OXS C;  3OTO Q;  2IT1 A;  4A3L G;  4HJ9 A;  2VUM H;  1T9H A;  5C4X G;  4YWM A;  1PV4 A;  4AYB G;  2IY5 B;  3AQQ A;  4AQY L;  1QVC A;  1L1O B;  2WAQ G;  3KOJ A;  3RZD H;  1LUZ A;  3BZC A;  1UE6 A;  4O0A A;  3F2B A;  1YBY A;  1GVP A;  5M5W H;  4QGU A;  3CME A;  4A3K G;  1M1K C;  3CF5 A;  1IYJ B;  4L5Q A;  1VQK A;  1OXV A;  3KJP A;  1HR0 Q;  1W3S A;  5C3E H;  2VQF Q;  2R93 H;  4NXM L;  3ULJ A;  2F52 A;  1P16 A;  1TXY A;  4A4I A;  1PFS A;  3D31 A;  1EYG A;  4JI8 Q;  1KAW A;  1HNW L;  1VQP A;  4LF9 Q;  3RNU A;  4JI8 L;  1IBK Q;  3G6E A;  4UP9 A;  1SRU A;  3A74 A;  3F2D A;  1Q12 A;  4JBM A;  3F2C A;  4A3I H;  3PUZ A;  2ZJR A;  3M4O H;  3JAM i;  4A93 H;  1I50 H;  2DUD A;  1CSP A;  2YTY A;  4UPA A;  4DR5 L;  1JT8 A;  5IT9 c;  5FLM H;  3H0G G;  4JBW A;  4RMF A;  5HGQ A;  3CMA A;  5FLM G;  3WWV A;  4DR3 L;  3H3V H;  2DGY A;  3PUV A;  4R4C A;  4LF8 L;  5IYD G;  1IZ6 A;  4GLA C;  5ELO A;  3OTO L;  4XTC S;  3UDG A;  5C0X G;  2CQO A;  1KC8 C;  2HIV A;  4QIW E;  2ZTC A;  1Q7Y C;  3T1Y Q;  1JJ2 A;  3GTO H;  1QVF A;  3NEN A;  5IWA L;  3J7Z C;  1NMF A;  2OQK A;  4DR2 L;  2ES2 A;  3S15 H;  2VQE Q;  2H5X A;  3I4O A;  4YWK A;  3TS2 A;  3SGI A;  4IOC A;  1RL2 A;  1IL2 A;  3I4M H;  2BA1 A;  4DR7 Q;  2OQ0 A;  3L7Z C;  2AKW B;  1UE1 A;  4DV3 L;  5FLX c;  4BY7 H;  1AE2 A;  1GO3 E;  4JOI A;  4EX5 A;  4DV2 Q;  1GD7 A;  1Z47 A;  4DV5 Q;  1X9N A;  1J5E Q;  3GTQ H;  2ALY B;  1I94 L;  4B3T L;  2ZJQ A;  4LF9 L;  2D62 A;  1HNW Q;  3RR5 A;  2UXC L;  3M7N A;  4OO1 I;  3I4N H;  2UXD L;  4JC0 A;  4XIG S;  1N34 Q;  1VCI A;  5IP9 H;  4GS3 A;  1K83 H;  1P8L A;  3J80 i;  1C9O A;  1HR0 L;  1KL9 A;  5JEA J;  4HIK A;  2Q2T A;  3J80 c;  5ELN A;  1CKN B;  3L0O A;  3PUW A;  1N36 L;  2UUB L;  2A19 A;  1OTC A;  4HJ7 A;  1VQF A;  4JI0 Q;  2UXD Q;  4AYB E;  4BY1 H;  5E7N A;  4A3E G;  5IYD H;  1HJP A;  2RHS B;  4QY7 A;  5LMU Q;  4DV5 L;  4C3H H;  1YJW A;  4DR4 Q;  1Y1V H;  3HOU H;  4B3R L;  4EQ5 A;  4O2D A;  2E5L L;  5AJ3 Q;  1X3E A;  1VQN A;  1YNX A;  4DAM A;  3ICE A;  3U4Z A;  4X66 L;  1E7Z A;  2GN5 A;  4DK3 C;  4BA1 I;  5IWA Q;  2VY3 A;  3AFP A;  1Z9F A;  5M5X H;  3RN5 A;  2IX1 A;  1V9P A;  2NVT H;  4KHP L;  4JBJ A;  4UP8 A;  4P72 A;  4C2M H;  3CP0 A;  3KDF A;  4GLX A;  2E2I H;  2I5H A;  1EIY B;  4PMW A;  4B3R Q;  4GKJ Q;  2Q2I A;  4A75 A;  2UUC L;  4JI2 L;  1UE7 A;  3STB D;  2HT1 A;  4IFD J;  4MTN A;  4DV0 L;  1IBM Q;  4B3M Q;  3K8A A;  3W5O A;  2JEA I;  2AMC B;  3RZO H;  4LFC L;  4LF6 Q;  4GOP C;  2Q2U A;  3GO5 A;  4GKK Q;  3HKZ E;  4OO1 G;  1AE3 A;  4GN4 B;  4X62 L;  3G48 A;  3PV0 A;  3S1M H;  2UUB Q;  3A5Z B;  3S2D H;  2WFW A;  4DV0 Q;  1VQ5 A;  2IHE A;  4DUZ L;  1MIU A;  2MFI A;  4Y7N H;  3HOV H;  4QL5 A;  1S72 A;  2WP8 J;  3CAM A;  1EQQ A;  4DV6 Q;  3MEF A;  4OON A;  4DR6 L;  3KF8 B;  5GAD C;  3AYH B;  4JI7 Q;  1OXU A;  1X3G A;  5GQO A;  1PH9 A;  4GNX B;  3G71 A;  2Y0S G;  3S17 H;  4GOP B;  2N8N A;  3MXN B;  1HH2 P;  3BJU A;  4A3J H;  3CC7 A;  3NEL A;  1EIF A;  4PZ6 A;  5AJ3 L;  1J5E L;  1FL0 A;  2YTX A;  4L5T A;  5C0X I;  4DV3 Q;  5JJI A;  4A3G G;  3S14 H;  4L5S A;  1SMX A;  2VQF L;  5C0X J;  3IRB A;  3AFQ A;  2LSS A;  3CPF A;  3KYH C;  3PF4 A;  2AWO A;  5C4X H;  2VUM G;  2KCT A;  1EUJ A;  1VQI A;  2NN6 I;  3KDF B;  3I4M G;  4DPG A;  4DV1 L;  4JI0 L;  4WJ4 A;  1CKN A;  3STB C;  2V1C C;  3CCE A;  4LFB Q;  1KXL A;  2GVA A;  4DV6 L;  2PI2 A;  4DR6 Q;  1JJG A;  2E2J H;  2EIF A;  5GAH C;  4NXN L;  2NZO A;  4DUZ Q;  1Q46 A;  3F8T A;  4LNQ A;  2VNU D;  2K75 A;  3U4V A;  2OCE A;  4X62 Q;  1Y1W G;  4A3M H;  2C35 B;  5IYB H;  4DR5 Q;  1N33 L;  3CD6 A;  2UXC Q;  4IPC A;  3S1R H;  4X65 L;  4A3J G;  5JEA G;  1N9W A;  1I94 Q;  2N78 A;  3CCR A;  2B29 A;  1TWF H;  1I3Q H;  2JA5 H;  1WJJ A;  4GKJ L;  1K8G A;  1XTD A;  4JI1 L;  3PF5 A;  4UY8 C;  4DR7 L;  3S2H H;  2A1A A;  4A3I G;  4X64 L;  4QQB X;  4WJ3 M;  1VQO A;  1HNX L;  1BVS A;  1MJC A;  1MKH A;  3G4S A;  3D0F A;  2PMZ E;  1JE5 A;  4X66 Q;  2WAQ E;  1QZH A;  2RCN A;  4R4O A;  1X3F A;  3K7U C;  1PH7 A;  1N32 Q;  1I5F A;  1V43 A;  3ULL A;  1NY4 A;  3JAM c;  3H0G H;  3KLW A;  4HID A;  3S16 H;  2JA7 H;  1Q82 C;  5LMU L;  3GTG H;  3TS0 A;  4KI0 A;  3CCU A;  4IFD I;  3NBH B;  1Q86 C;  2B63 G;  4P73 A;  2QA4 A;  1KRT A;  3K7A H;  1VQB A;  4LFB L;  3CCS A;  4DR1 Q;  4DV1 Q;  1VQ7 A;  4JOI C;  1N36 Q;  3EIV A;  1LYL A;  1G51 A;  5IP7 G;  4IJH A;  4HJ8 A;  4A3F H;  3J81 c;  2UU9 L;  1PHJ A;  1B70 B;  1NBW A;  5J3B A;  3H15 A;  2NVX H;  1X55 A;  2AWN A;  2XTI A;  3CC2 A;  2OWO A;  1EQR A;  2K5H A;  3FP9 A;  1YJ9 A;  4LUO A;  4JI6 L;  3H3V I;  1N32 L;  4MNO A;  1CKM A;  1HNZ L;  3E9H A;  1YI2 A;  1AH9 A;  2WB1 E;  2ZTE A;  2F4V Q;  1B7Y B;  3FKI G;  4BBR H;  1Q1E A;  1EFW A;  1WOC A;  2JA8 G;  2R7F A;  3CCQ A;  4A3B H;  3CCJ A;  2Z6K C;  5EAY A;  3RN2 A;  1VQG A;  2PQA B;  1G29 1;  3AEV A;  4AH6 A;  1E1T A;  4LF5 L;  2R6G A;  2PNH A;  3I55 A;  1YJN A;  1N33 Q;  4LF7 L;  1VQJ A;  4HIO A;  1FJG Q;  4LF6 L;  4LFC Q;  4GKK L;  3PO3 G;  4Y52 H;  1PYS B;  2YTV A;  1A62 A;  4OWX B;  3CC4 A;  2MQH A;  3TRE A;  4NXN Q;  3CW2 C;  4JI2 Q;  2JA7 G;  1B8A A;  3GTM H;  4L5R C;  2R92 G;  3PUX A;  1VQ9 A;  1E3P A;  1KRS A;  4BY7 G;  4NB3 A;  5M3F H;  5FJ8 H;  3GTK H;  3PIO A;  1PYB A;  1WI5 A;  3T1H Q;  2CCZ A;  2HHH Q;  4POG A;  4GNX A;  2GVB A;  4BBS G;  2BH2 A;  1Q1B A;  2QGQ A;  4IO9 A;  4C3I H;  4GOP A;  3RLO A;  3EBE A;  1HZA A;  4OWW B;  3KFU A;  3CQZ H;  3U50 C;  1X65 A;  4JV5 Q;  4A93 G;  1XNR L;  3HOZ G;  3S1N H;  5C44 G;  2PI2 E;  3FKI H;  1BBU A;  4TVA B;  4BBR G;  2K4K A;  2D0O A;  3M85 A;  4A3E H;  4BY1 G;  1HZ9 A;  1LM0 A;  1WFQ A;  1UE5 A;  4IPG A;  5IY0 A;  1PH4 A;  4NXM Q;  1QVG A;  2IX0 A;  2K5V A;  4A3L H;  4GN3 B;  1E24 A;  1VQA A;  1Y1V G;  3HOU G;  3M3Y H;  2UUA L;  1NTG A;  2JEB I;  5M3M G;  1OXT A;  4J15 A;  1XPO A;  1HZC A;  3J81 i;  4JBK A;  1YEZ A;  4K0K L;  4B3T Q;  2BA0 A;  1CSQ A;  1VQM A;  1MJE A;  2KBN A;  4R4I A;  3ERS X;  2ZJP A;  4ME3 A;  1A8V A;  2NVY H;  3K0X A;  1IBL Q;  2NN6 G;  1WYD A;  4DUY L;  1PH6 A;  2YU9 H;  4YHH Q;  2NZH A;  4LWC A;  5H1S E;  5C4J H;  1PA6 A;  1E1O A;  2HHH L;  1S3O A;  2PQA A;  5M3M H;  3T1H L;  2HIX A;  4IOA A;  1XMQ L;  1TWC H;  1SN8 A;  4DUY Q;  3LGJ A;  1YVC A;  4LF4 Q;  2YYZ A;  4PZ8 A;  5LMN L;  1VQD A;  3HOV G;  2KEN A;  1CKO A;  1KHI A;  2HQL A;  4LF8 Q;  4IFD G;  2EXD A;  1FGU A;  1X56 A;  1PH1 A;  4JI4 Q;  4K0K Q;  4DR3 Q;  4JG2 A;  1XNQ L;  1V1Q A;  2NVQ H;  4LF7 Q;  1TWA H;  2JA6 H;  3HOY G;  3FHW A;  2UXB Q;  3UDX A;  3I4N G;  1X54 A;  2JA9 A;  3ULP A;  1ASY A;  1XPU A;  3DM3 A;  4YCV A;  2VL6 A;  3PIP A;  1PH5 A;  4GN5 A;  1KQS A;  1JB7 A;  1QZG A;  2K14 A;  4DKA C;  1N34 L;  3I2Z A;  1TWG H;  1XPR A;  1IBK L;  1K8A C;  3CCM A;  2F4V L;  3GDE A;  1XNR Q;  1VQE A;  5LMN W;  1YHA A;  4RG1 A;  3UE0 A;  5BR8 Q;  3ZJY C;  4YCW A;  2K52 A;  3RLF A;  2CKZ B;  2KHJ A;  4DV2 L;  1BBW A;  1PH8 A;  2K50 A;  2R7D A;  3PO3 H;  2YV5 A;  5IYC G;  2E2H H;  1I6H H;  5JJK A;  2VQE L;  2KHI A;  1EOV A;  3A5U A;  4OXP A;  5C44 H;  4DR2 Q;  1U0L A;  4LFA Q;  1NE3 A;  5IYB G;  1D8L A;  4OWT B;  4TQU S;  4DR1 L;  4FDB A;  1G6P A;  3T1Y L;  4APV A;  2B3G A;  4DNI A;  2WB1 G;  2N3S A;  3E0E A;  4A3D G;  3HFZ B;  4MZ9 A;  4A3D H;  4OX9 Q;  1Q8K A;  2I5M X;  3PSI A;  4P74 A;  3CPW A;  4OX9 L;  2MO0 A;  4H02 A;  2CWP A;  1HR0 W;  2D0P A;  3HOW H;  3HOZ H;  1JMC A;  4DAY B;  1H95 A;  2ATW A;  4LFA L;  3OYY A;  3GTJ H;  5JJL A;  1RIP A;  4R4Q A;  1WCM G;  3HOX H;  1VQH A;  4A3C G;  1FVI A;  4A3G H;  4JYA Q;  4YWL A;  2VZA A;  1U5K A;  2ZTD A;  2JA5 G;  1SR3 A;  3RLN A;  5IYC H;  3A0J A;  4B3S Q;  2RHQ B;  1VQ8 A;  4PG3 A;  2XGT A;  4AIM A;  2KCM A;  4GLV B;  1KD1 C;  2I0Q A;  1GM5 A;  3GTL H;  1YHQ A;  1D7Q A;  3ER0 A;  3GD7 A;  2BH8 A;  1XJV A;  1GKH A;  1VQL A;  1A0I A;  1WCM H;  3HOX G;  3M4Q A;  3J81 j;  1Q81 C;  2UUA Q;  2MO1 A;  2F3I A;  2CWA A;  2IHF A;  2EQS A;  2ID0 A;  1L1O A;  2UU9 Q;  2VS1 A;  1PH3 A;  1JJC B;  5M5Y H;  5GAG C;  4A3M G;  2ASB A;  3M4P A;  5IP9 G;  1YZ6 A;  4R4T A;  2CFM A;  3I56 A;  4AQY Q;  1IXR A;  2JQO A;  4ALP A;  1M90 C;  3K80 C;  4A3C H;  3J7A 5;  1L0W A;  5DLQ E;  1CUK A;  2N49 A;  3E9I A;  3F1Z A;  2L15 A;  4YY3 L;  4JI3 Q;  4POF A;  4LF4 L;  1E22 A;  3PCO B;  3BU2 A;  2K5N A;  5BR8 L;  4HIM A;  1VQC A;  1Y1W H;  1XMQ Q;  2A8V A;  2Y0S E;  2Z6K A;  1YIJ A;  1X6O A;  3CXC A;  4A3K H;  1SFO H;  1HNX Q;  1OXX K;  3KF6 A;  4LUZ A;  4HJ5 A;  4JI5 L;  4JI1 Q;  4JCV E;  2JA8 H;  1NMG A;  1KIX A;  3TEH B;  2R7Z G;  1Y14 B;  3DLL A;  2JK8 A;  3CCV A;  3B6Y A;  1LTL A;  1YHB A;  4X65 Q;  1DGS A;  1YIT A;  4IPD A;  1K0R A;  4C3J H;  5FJ8 G;  1FJG L;  2UXB L;  2ZM6 Q;  5K36 G;  4GNX C;  4P71 A;  4QJF A;  5IP7 H;  4X6A H;  4DV7 Q;  1ASZ A;  1SLJ A;  4NPS A;  1VQ4 A;  3L2P A;  3PUY A;  4LF5 Q;  1XNQ Q;  4B3M L;  1J6Q A;  1A63 A;  4P75 A;  4PZ7 A;  1VQ6 A;  3BZK A;  4IJL A;  3I7F A;  5LMN Q;  4UP7 A;  4DK6 C;  1K3R A;  5C3E G;  4DV4 L;  1K73 C;  1K9M C;  2R93 G;  1C0A A;  4KLK A;  3W1B A;  4BXX H;  3HKZ G;  1L1O C;  2E8G A;  2VW9 A;  1XMO L;  2B63 H;  3CCL A;  1TWH H;  3JC6 6;  4LUV A;  1L2F A;  2Z0S A;  4A76 A;  3U58 A;  4BA2 I;  2JJQ A;  1EWI A;  4JV5 L;  1O7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...