2VQEL

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqeL00
1OTCA 3F2CA 1P16A 2KBNA 4X65L 4DV3Q 4ALPA 1M90C 1VQ4A 1XPOA 2LXJA 1EYGA 4DR5Q 5J3BA 4JOIC 3HOVG 1EUJA 1TWAH 1X65A 2HQLA 5M3FH 2R7DA 4B3RL 2RCNA 2V1CC 3NENA 4IPGA 1I94L 4BY7G 3G48A 2NZOA 2ZJQA 1IBLL 1I3QH 2ATWA 3EIVA 4JCVE 1WCMG 2IHEA 4DV7Q 3STBC 2UXDQ 1K9MC 1X3FA 1VQDA 2QEXA 2UUBQ 4A3BG 1Q1BA 1HNXQ 4A3CG 2VQEL 2A19A 1YVCA 4DV4L 4NXMQ 1IBMQ 4X64Q 1N36L 2ZJRA 2WAQG 4B3SQ 1A63A 4LF4Q 3G4SA 2MO1A 2I5HA 4XIGS 1B8AA 3T1HL 2VL6A 5JJLA 1SLJA 2UXBL 2NVXH 3PO3H 3LGJA 3TQYA 1QUQA 1Y1WH 1J5EL 3T1YL 3TS2A 1PH1A 3AQQA 3HOUG 4RMFA 1KRSA 3RLOA 4OO1I 1LTLA 2JA9A 3HOWH 1BBWA 4H02A 4JI5Q 4A3FG 1XMOL 3H0GH 4GOPB 4A3KH 4OWXB 2I0QA 1U0LA 4JBJA 4KI0A 3PO2H 4LFBQ 1FJGQ 1NE3A 1PH7A 4J15A 4X62L 3G6EA 4DV6L 5IYBH 1PYBA 4JI7L 4KHPQ 1Q7YC 2QGQA 4YY3Q 1FL0A 2ALYB 1E7ZA 1JE5A 3L0OA 2JQOA 3PIPA 3DLLA 1HNWL 1KHIA 4GKJL 2R7ZH 4B3MQ 4LF6L 3TRZA 3ER0A 5JEAG 1CSQA 4A76A 1FVIA 1SMXA 4A4IA 4K0KQ 4L5QA 4HJ7A 2E2IH 4IFDJ 4HJAA 1IXRA 2OTLA 2JA7H 2UUCL 3S14H 2LXKA 4JBWA 3RLFA 1SRUA 1HZAA 1HH2P 1E24A 3BJUA 3KF8B 3ULLA 3W1BA 3DM3A 1VQ5A 3ULPA 1VQJA 4X66Q 1VQNA 1YJNA 1XJVA 3M4QA 2KCMA 3GDEA 3KF6A 1KQSA 5LMNW 1KL9A 3ICEA 2B3GA 1TWGH 4KLKA 2E2JH 5K36G 4DV7L 2EQSA 1G6PA 4GOPC 4BBSG 3KJPA 2UUBL 1XPUA 2KHIA 1VQIA 2JA6G 4OWWB 2RF4A 5C44H 3FKIG 4OO1G 4HIOA 2NZHA 5IP9G 5JJKA 1PFSA 2WB1E 2AWNA 4LF4L 1YITA 1HNZQ 1N33L 4DR6Q 4R4IA 4AYBE 1YNXA 5C3EH 4LF8Q 4BY1H 1VCIA 2HHHQ 2DGYA 3UDXA 4GKKL 4GN3B 5IY0A 1XNRL 4NPSA 1M1KC 3ERSX 2C35B 2VY3A 2PI2A 4LFCQ 3MXNB 1VQ7A 4A3GH 4DV2Q 1YEZA 2WP8J 4JI8L 5M3FG 3JC66 3E9HA 2PQAB 2EIFA 1VQOA 3FP9A 1VQLA 3HKZG 2B29A 2OQ0A 2PI2E 4DV1L 4A3DG 3KDFB 3RZDH 5C4XG 3OTOQ 1K8GA 2YU9H 3TS0A 4A3LG 5GAGC 3S15H 4RG1A 3M3YH 3PUWA 4A3MG 2JA5G 2NVYH 3K0XA 4XTCS 3H15A 3HOYH 2UUAQ 2Z6KC 1YHAA 1ASYA 1G291 2IX0A 1W2BA 5IP7H 1E1TA 2YTYA 4AIMA 1Q86C 2XGTA 1V43A 3H3VH 2L15A 2E8GA 1X54A 4OWTB 3SGIA 3F2BA 4LF5Q 3F2DA 1D7QA 4EX5A 4IOCA 4DR7L 1NTGA 5IWAQ 3PO3G 2LSSA 1L1OB 4L5RC 1MKHA 1EQRA 2WB1G 3I7FA 1WOCA 1Y1VH 1QVCA 4JI4L 1XNQL 4AYBG 3HOWG 4P71A 4DR3Q 2KCTA 2K75A 2Z0SA 4PZ8A 4DV5Q 1A8VA 2JE6I 2VUMH 3H0GG 4A3KG 1JJ2A 1CSPA 4JI0Q 3PO2G 3Q8DA 2D62A 1YIJA 3J7A5 1R9TH 1TXYA 4LFAQ 4BBRH 2JJQA 3HOXG 3PUYA 1Q8KA 5GAHC 5HGQA 5IYBG 1AH9A 5IYDG 4JV5L 5JJIA 3RNUA 1XPRA 2BA0A 2KENA 3BZCA 4OXPA 3JAMi 3J81i 1Q82C 1IBKL 2ZM6Q 1JT8A 3PUVA 5C0XI 3U50C 2N78A 1N9WA 4QL5A 4LF8L 4LF9L 4DAMA 2HHHL 2EXDA 1PH6A 3CQZH 2ZTCA 1EOVA 4JI1L 4IFDG 4B3TL 2PMZE 4DV0Q 3WWVA 2R92H 4DV2L 1NJIC 1L1OC 3JAMc 3CCEA 1SFOH 1B70B 4L5SA 3U58A 1S72A 1HJPA 1VQMA 1JJGA 1TWFH 3GD7A 3KYHC 1ASZA 5GADC 1QZHA 2HIVA 3I4MH 4JOIA 3H3VI 2K4KA 1E3PA 2VZAA 4O2DA 4R4CA 3I4NH 2NN6I 4A93H 1Q81C 4JYAL 3S1NH 2YTVA 2JEAI 5ELOA 2WFWA 1CKNA 3IRBA 1N34Q 5FJ8G 3CCSA 1V9PA 2Y0SE 1PHJA 1MJEA 3UE1A 2FXQA 3FHWA 4JBKA 2JA8H 2AWOA 2H5XA 4OX9L 5C4JH 5C3EG 1HR0W 4QIWE 4DUZQ 2N3SA 4R1JA 1NMFA 3HOZH 4P72A 1YZ6A 3CP0A 1P8LA 3J81j 1I5FA 3VDYA 1EIYB 4LUVA 1EWIA 4UP9A 2CCZA 4HJ5A 1XMQQ 4DPGA 4A3GG 1RIPA 3PSIA 4POGA 4DR4Q 5FLMH 4JI3Q 4IOAA 4YHHQ 4DR3L 3CC2A 3E0EA 2GVAA 4AQYQ 3PUZA 1HR0Q 2Q2TA 2UXCL 3AEVA 2VNUD 2D0PA 2QA4A 4JI2Q 4HIMA 3PF4A 2IY5B 1I50H 3HKZE 1WFQA 5M3MH 4DV3L 1SROA 4C3HH 3F1ZA 1HZ9A 3GTGH 3TREA 4DR5L 3GTQH 2HT1A 1N32Q 1YHQA 2VQFQ 4A3JH 1YHBA 1EIFA 2F4VQ 4BXXG 4DK3C 5LMUQ 2OTJA 1PH3A 1OXUA 3ULJA 4LF7Q 1J6QA 3CD6A 5IE8A 2UXDL 1G51A 4MZ9A 4APVA 1SN8A 2Q2HA 1IYJB 2CQOA 1HNXL 3A5ZB 2Y0SG 1Q46A 4NXML 1IBML 1Z47A 4X64L 1Y1VG 4B3SL 5BR8Q 5LMNQ 1VQHA 1WCMH 4LUZA 4DAYB 4DR1Q 4UP7A 1OXSC 1TWHH 2XTIA 4BA1I 1B7YB 1TWCH 2MFIA 4IO9A 2VUMG 4MTNA 4C3JH 4A3BH 1AE3A 4DUYQ 3UDFA 4DR2Q 2YV5A 4TVAB 1NMGA 3U4ZA 1SR3A 4BBRG 1OXXK 4PZ6A 4A3EG 2K50A 1VQBA 1YI2A 2K5HA 2N49A 2RHSB 5H1SE 3J80i 4GOPA 5C0XJ 2CWPA 3M85A 1UE1A 5IYCH 4ME3A 4IPDA 4JI5L 3GTMH 4P75A 2K5VA 4GNXB 1VQPA 2A1AA 4LFBL 1VQKA 5GAEC 4X65Q 1FJGL 2A8VA 4R4TA 3CCJA 4HJ9A 4AH6A 3G71A 3HOUH 3S1MH 1OXVA 3KOJA 4YWLA 3OW2A 4YCWA 1N8RC 3S2HH 3I56A 3W1GA 2IX1A 2R92G 4KHPL 2ASBA 1LUZA 4YY3L 4YHHL 3J80c 4B3RQ 1I94Q 1UEBA 4B3ML 3OYYA 1QZGA 2CFMA 4LNQA 2R7FA 2DUDA 4UY8C 3I4MG 1QVGA 3M7NA 1H95A 4K0KL 2ZTEA 3KJOA 3PGZA 1X3GA 1PH9A 4BA2I 1V1QA 2VQEQ 4DV4Q 3CCMA 1UWVA 1WJJA 3CCUA 3D0FA 1EQQA 1Y1WG 1N36Q 1N32L 3S24A 3CMAA 1PYSB 2YYZA 2MO0A 2CWAA 4X66L 1PH5A 2JA8G 1YJWA 3T1HQ 1K83H 1X56A 2Z6KA 4WJ3M 4GNXC 2UXBQ 3E9IA 1C9OA 1AE2A 1X9NA 1J5EQ 3GTPH 1GM5A 2E2HH 4A3IH 3NELA 1GKHA 3UDGA 1NBWA 1A62A 2AKWB 1L0WA 1LM0A 1OXTA 1QUQB 3L7ZC 4POFA 5FLMG 2ZJPA 4DR1L 4DR6L 1XMOQ 1HNZL 4BBSH 3KFUA 2R7ZG 1JB7A 2JA6H 1K3RA 1Q12A 1CKOA 1UE7A 2RHQB 4X62Q 1KD1C 2R93H 1VQFA 2K5NA 1FGUA 4IPCA 5IT9c 3J7ZC 4DV6Q 4JI7Q 5M3MG 5IP9H 4QGUA 2PQAA 3HKSA 4JI6Q 3AYHB 2JA7G 4LFCL 3CAMA 3M4OH 1HNWQ 4GKJQ 3KDFA 1MJCA 5AJ3Q 4LF6Q 1O7IA 3CCQA 1DGSA 4A75A 5M5YH 3GTLH 1I6HH 1KAWA 4R4QA 3J81c 3S17H 4GN5A 1PH2A 1GO3E 1WYDA 5M5WH 1BBUA 4GLVB 3OTOL 2KHJA 1HZBA 3AFPA 1IZ6A 4TQUS 2UUCQ 2MQHA 1MIUA 4HIDA 1VS0A 2UUAL 3M9BA 4OONA 3RLNA 4A3DH 3U4VA 5C44G 2MNAA 5C4XH 3STBD 4YWKA 1VQEA 1CUKA 4A3LH 4JI6L 2GVBA 4A3MH 2JA5H 4LF5L 1L1OA 3KF6B 4UPAA 4BY1G 1Z9FA 2F3IA 1CKMA 5IWAL 3PF5A 1VQGA 3KLWA 1SE8A 4QJFA 2IHFA 4GN4B 1X3EA 2GN5A 3M4PA 5E7NA 2BH8A 1N33Q 5C0XG 1GVPA 4PG3A 5IYCG 3S2DH 4DK6C 4WJ4A 2Q2IA 4DV5L 4GKKQ 4PZ7A 4IJLA 2BA1A 1BVSA 4JI0L 3TEHB 1XNRQ 2B63H 4LFAL 1LYLA 1VQ9A 3HOYG 3K8AA 2YTXA 4JI8Q 2BH2A 4NXNL 1PH8A 1VQ6A 4JBMA 1PV4A 3UE0A 2ZM6L 4DV1Q 2R6GA 4DKAC 3CMEA 1VQCA 5IP7G 3RN2A 1PH4A 1E22A 3HOXH 3RN5A 3CPFA 1GD7A 4DNIA 1K0RA 5IYDH 1C7YA 1BKBA 2NN6G 3UDIA 3CPWA 3HOVH 4DV0L 1Q1EA 5AJ3L 1PVOA 1UE5A 3GTJH 2VS1A 2UU9Q 4BY7H 1E1OA 2ES2A 1K8AC 3PIOA 4YWMA 4PMWA 1S40A 4DR7Q 5GROA 1EFWA 4FDBA 4GLAC 2IT1A 4LW1A 4QY7A 1KRTA 3CC7A 3RZOH 4C2MH 4JC0A 4A3CH 4HIKA 4HJ8A 1VQAA 1XNQQ 1A0IA 4JG2A 4A3IG 4JI4Q 1QVFA 3CCVA 3RR5A 3GTKH 3GTOH 1N34L 2AHOB 3HFZB 3CXCA 2NVQH 2PNHA 4R4OA 2E5LQ 2JK8A 3CW2C 2OWOA 3K81C 3NEMA 4MNOA 5ELNA 3S1RH 1JJCB 4Y52H 3CCLA 4DUZL 4L5TA 1U5KA 1T9HA 2R93G 4GLXA 5FJ8H 4NXNQ 4GS3A 4EQ5A 4JV5Q 1XMQL 3PUXA 4X6AH 5EAYA 1IBKQ 2AMCB 2HIXA 4DR4L 4JI3L 4A3FH 3I55A 4LF9Q 3F8TA 1X6OA 4YCUA 4C3IH 3L2PA 4AQYL 1HR0L 1IBLQ 3ZJYC 2D0OA 3S1QH 4JI2L 4QQBX 2VW9A 3BZKA 4JI1Q 2CKZB 2ID0A 4B3TQ 2ZTDA 1PA6A 3I4NG 4A93G 2I5MX 2I5LX 1HZCA 3MEFA 3K7UC 3A0JA 3EBEA 3NBHB 2VQFL 5JEAJ 3CCRA 1C0AA 2OCEA 4LWCA 2F4VL 3EN2A 1XTDA 3W5OA 5LMUL 5HY6A 1X55A 2K52A 2N8NA 1JMCA 5GQOA 1Y14B 4IJHA 4NB3A 4LF7L 4YCVA 1W3SA 4JYAQ 3PCOB 4O0AA 4P74A 4IFDI 2K14A 1RL2A 3I4OA 1YJ9A 1D8LA 1NY4A 3T1YQ 2NVTH 2UU9L 3HOZG 1WI5A 3CC4A 1L2FA 1UE6A 3D31A 4BXXH 3GO5A 3CF5A 5BR8L 4OX9Q 5LMNL 2WAQE 5M5XH 1CKNB 3B6YA 2JEBI 1IL2A 1KC8C 1YBYA 1K73C 3K7AH 1S3OA 3I2ZA 1VQ8A 4DUYL 4DR2L 4IPHA 2F52A 3K80C 3A5UA 3FKIH 5DLQE 1KIXA 2B63G 5FLXc 3S16H 1KXLA 2OQKA 4UP8A 4GNXA 3BU2A 3A74A 4LUOA 2E5LL 3AFQA 2UXCQ 4KHZA 4P73A 4Y7NH 2Q2UA 4A3JG 3PV0A 4A3EH
chains in the Genus database with same CATH superfamily
1STEA 2KBNA 3I73A 4JK1C 4X65L 1M90C 4EQPA 2WV6D 4E6IA 1EY7A 3NSWA 4CDCC 5M3FH 1TWAH 3VR4A 4B3RL 1SE2A 4H13C 3D6WA 4DNRB 2ZJQA 1FGBD 1WCMG 1X3FA 4CGYB 1YVCA 4B9WA 2F0VA 1A63A 2WAQG 3GQBA 3SEBA 5JJZA 5KEEA 2JA8B 2HQEA 1ZYRC 5JJLA 3LGJA 1D5MC 3TQYA 1QUQA 4OELB 4RMFA 1OO9B 2AQ1B 1MSHA 1LTBD 4GOPB 2M9VA 2A6HC 4KI0A 4C3IG 3NTHA 1EYCA 3FEWX 3ND8A 2L55A 1PYBA 4CBVA 2QGQA 1KABA 4JI6L 1JE5A 4CDEC 4GKJL 4B3MQ 1B53A 2ZXPA 1CHQD 2QDBA 5JEAG 4A76A 3TP8A 2Z1CA 2B2VC 2Z9HA 3NUCA 4A4IA 4L5QA 3OW7A 2KCCA 4HJ7A 2JA7H 4IFDH 2UUCL 2CH4A 3S14H 4FP5D 1JC7A 1HH2P 1E24A 1IL8A 3DM3A 1YJNA 3M4QA 1TWGH 5K36G 1QJOA 1I4QA 1SEBD 4GOPC 3N52A 3CRKC 3CRLC 1TWCB 4DK1A 2HD3A 2UUBL 1XPUA 1RTOA 3I70A 1HA6A 2QKIC 5NUCA 1TS2A 3DM1A 2F0PA 2F0JA 1PFNA 1PFSA 1FNWA 2WB1E 1YITA 3QWNA 3FVQA 4R4IA 4AYBE 5HGTA 4BY1H 2OEOA 3UDXA 4ULLA 4DNTB 1JR0D 1QWYA 2E74C 3KK7A 3S15B 5CV5A 1VQ7A 3NP8A 5C0XH 3HOYB 1YEZA 3E9HA 1SJED 1LTRD 3KDFB 3OTOQ 1AN8A 1E0BA 2YU9H 4DK0A 1HUNA 1PTOH 3H15A 2Z6KC 1YHAA 1ASYA 1XX8A 2DN8A 5EPLA 2NN6H 4LF5Q 1IW7C 1EWHA 5IWAQ 2NWGA 2EYMA 4CKBA 4L5RC 1R9TB 2WB1G 1Y1VH 4JI4L 4AYBG 1T5XD 4XT3B 3HOWG 1KLGD 1JOOA 2Z0SA 3I90A 2JE6I 3H0GG 1IHZA 1CSPA 5M9OA 3J7A5 1HA5A 3MTSA 4KJNA 4LFAQ 2R93B 2JJQA 3PUYA 2VXWA 4FXKC 1AH9A 4KTAA 4JV5L 3HP3A 2BA0A 3M4OB 2R92B 1JT8A 1YNND 1N9WA 5E1FA 3S17B 1CK1A 5M5WB 4R8NA 1QNUA 2WINB 4XT1B 1EOVA 4NMZA 4B3TL 3NXWA 2L9HA 2FMMA 3U58A 1S72A 1MSGA 1HJPA 2I46A 4G57A 1JJGA 1ASZA 4G7HC 2HIVA 3I4MH 3FDTA 2VZAA 4R4CA 1Q81C 1WTOA 5JPNC 3HOZB 1V9PA 2JA8H 3UE1A 1B3AA 5ISRA 3C2PA 4OHJA 1HR0W 4QIWE 1DOMA 4R1JA 1BDOA 3VDYA 3CP0A 1P8LA 4LUVA 1EWIA 1M4VA 4UP9A 1S5FD 4DPGA 4A3GG 3PSIA 4DR4Q 1TR5A 4YHHQ 5D3IB 3CC2A 4RCNA 4AQYQ 3PUZA 4DXFA 2UXCL 2F0UA 2VNUD 2D0PA 5CORA 4JI2Q 2IY5B 5FK9C 2XN9C 5IGEA 4ILWA 5FOBB 4X3TA 3EROA 4MHEA 2HT1A 4A3JH 2KUMA 3A56A 2F4VQ 1ET6A 4BXXG 1B2TA 5LMUQ 2A74C 1OXUA 1WCMB 3DWAA 1WTQA 3A55A 1SN8A 1HNXL 4R8IA 4WORA 2B2VA 1Z47A 1IBML 4IUNA 2WAQB 5BR8Q 1VQHA 2A5HA 4LUZA 4DR1Q 2F3WA 1OXSC 2XTIA 2A6EC 1TWCH 2MFIA 2KOLA 3T53B 4DUYQ 2VB2X 3DMUA 3HRZC 2K5HA 4IURA 3S1MB 2PYKA 4GOPA 2CWPA 1CQVA 2IL8A 2B8FA 5EGTA 4XDXA 5IYCH 1Y8NB 1HHVA 4LFBL 1VQKA 2L0CA 1LT3D 4YWLA 1N8RC 3I56A 3W1GA 3BYTB 1GUNA 2IX1A 2CVRA 4YY3L 1K28A 4FF3A 1UEBA 3KBGA 3OYYA 4LNQA 2DUDA 2JXMB 1A15A 3Q6SA 3M7NA 1K83B 1PH9A 4K8JA 1UWVA 5ELFA 3D0FA 1EQQA 2E2HB 1SYCA 1PYSB 5KNBA 5IT9L 3T1HQ 2Z6KA 1PFMA 1C9OA 1UEAB 2DNEA 3D4DA 1X9NA 2PPBC 4A3IH 2R3ZA 1A62A 2AKWB 4JPBW 4N8X1 1L0WA 1JWSD 1XMOQ 1HCZA 1JQYD 3KFUA 3GTLB 2RHQB 1K3RA 1Q12A 1UE7A 1KD1C 3A8JE 1I6HB 1SNCA 3BZDB 2WIIB 2R93H 1JORA 3ERQA 4IPCA 4JI7Q 4FNFA 3VA5A 4RGMA 5IP9H 5C4ZA 2JA7G 4LFCL 3M4OH 1SYEA 3KDFA 5I2XA 3QOLA 1DGSA 3NBIA 3E6ZX 3S17H 1PH2A 1GO3E 5M5WH 3VA7A 2KHJA 5T1IA 2M2LA 3SK5A 3M9BA 5ELEA 4OONA 1O7YA 3MXUA 1SE3A 2K28A 1CUKA 5CBEE 4BY1G 2F3IA 1I4RA 1LTSD 1VQGA 3O13A 1VMCA 3KLWA 2IHFA 4GN4B 2WB1B 4ZCKA 2K5QA 1W6JA 4AYBB 5C0XG 4PG3A 2G9DA 3D4WA 2BE5C 4HSPA 1XNRQ 1BVSA 1SJHD 3TEHB 2A69D 2AQ2B 1LYLA 5KYLA 3TP7A 5IOCA 4K2KA 1LTTD 1RODA 3UE0A 1RHPA 2IW3A 2R6GA 4DV1Q 1PRTD 4H44C 1E22A 1PH4A 4CJ2C 1GD7A 2RA4A 1A3VA 5IYDH 1C7YA 2NN6G 4U68A 1SSOA 3CPWA 3W3AA 4DV0L 3RZOB 3TSSA 4C2MB 1HFNA 1MBYA 2VS1A 2ES2A 3GTKB 1K8AC 4OIJA 2K7VA 4PMWA 3MXPA 4GLAC 4QF4A 3CC7A 4JC0A 2FINB 2NZ1D 4HJ8A 1XNQQ 1QVFA 4JG2A 3GTOH 3CCVA 2EJFC 1H9MA 2AHOB 2IPKD 5DEHA 4TRDA 2LMCB 3MVVA 1S5DD 5FO9B 4A3FB 2RSOA 2QEJC 5ELNA 3K5OA 5DNFA 5KNCA 4DUZL 4KKUA 2RKSA 4LMQD 5D65A 5FJ8H 3RUZA 4EQNA 1EQTA 3I3CA 1XMQL 4JI3L 3F8TA 4C3IH 3ZJYC 2NYZD 3OWEB 2B2YC 4JI1Q 3U9OA 2ZTDA 1ZXTA 2I5LX 1TQOA 1HZCA 1YNJD 2KECA 4RA8A 2VQFL 3EBEA 3NBHB 1F2LA 2OCEA 5FLXL 3CU7A 5HY6A 2F0LA 2FFKB 5GQOA 5M5XB 2K03A 3PCOB 4P74A 4IFDI 4DAVA 1DD2A 4FXGC 3U9SA 4HSVA 3CF5A 4OX9Q 5LMNL 5K36H 1CKNB 3B6YA 4QIWB 4ZYSA 3C3LA 1KC8C 1YBYA 1K73C 1G91A 3T56B 1AZPA 1F2YA 3AB9A 5FO7B 3A5UA 2B63G 1QB5D 1WTRA 1KIXA 1B44D 1KXLA 1PZJD 2HCCA 2PCFB 3J7YW 1BXTA 3WOFA 3P20A 2E5LL 4N9TA 1NCVA 1WD0A 2F4IA 1TWAB 5M3FB 4A3JG 3OHXC 3H3VC 1OTCA 4F8MA 2LXJA 4WJWA 1EYGA 4JOIC 1EUJA 2HQLA 1CT1D 1TT2A 2SOBA 1I94L 2ZXRA 2RVLA 1IBLL 4G7ZC 1JCKB 4JCVE 1LT4D 1PZKD 2IHEA 3STBC 3SVMA 1I4HA 4ZUJA 2QEXA 1A3TA 2FHTA 2H4OA 1ESFA 2VQEL 2XSCA 4DV4L 4NXMQ 4QCLA 1WTHA 4X64Q 3QIAA 1N36L 5I4DA 4HN7A 3HZXA 4RAUC 4KKTA 1BBXC 3DHQA 3P7JA 3T16A 3SDZA 1S5BD 2F0EA 1Y1WH 1SYBA 1J5EL 3T1YL 1KRSA 4OO1I 2JA9A 3HOWH 4F88A 3ONAB 1ZEQX 3H0GH 2QILA 1FJGQ 1NE3A 1PH7A 3G6EA 4DV6L 1XTCD 4KHPQ 1F9SA 2JA7B 1HNWL 1E7ZA 3S14B 3PIPA 2R7ZH 5C4HA 1XXGA 1SMXA 1TWGB 1STGA 1NUCA 3D6CA 1HZAA 2K04A 3W1BA 1VQ5A 3X3MA 3SR1A 1VQNA 2V4DA 3M4YA 3SK8A 3ICEA 3MFGA 3FPPA 4KLKA 3P75A 1G8ZD 4ZRZA 1RCVD 2CQAA 3SHLA 1VQIA 3A54A 4BY1B 1RJTA 1TS3A 5C44H 5LL6X 1ENCA 4HIOA 2K32A 2PNRC 2NZHA 5BN3A 5IP9G 4DR6Q 2AWNA 1N33L 1YNXA 1U4MA 4LF8Q 1SYGA 1VCIA 2HHHQ 1EY4A 4GKKL 4GN3B 5IY0A 4KMUC 3URYA 2YU9B 5CV6A 4A3GH 1EU3A 1PTOB 2WP8J 2OF1A 1A3UA 4ZLTF 2EIFA 1VQOA 2F0HA 1SE4A 2OQ0A 2PI2E 2VB3X 3DWPA 4RHRA 2B2TC 5G3LD 3OPOA 2EYJA 1D1KA 1EOTA 1H9JA 1G291 2CW0D 2IX0A 3NWSA 1W2BA 2B2YA 1B9MA 1H9RA 3H3VH 1V43A 1Y1VB 2XGTA 4OWTB 2E8GA 3SGIA 3F2BA 2Z4IA 3CKIB 1D7QA 3F2DA 2D2CC 4DR7L 2EJMA 3R8BA 4BS9A 1K3BC 1KTKA 1EIGA 1WOCA 2ENBA 1PTOC 4P71A 4DR3Q 2KCTA 4DV5Q 2EXZA 4A3KG 3G6JB 3PO2G 2D62A 3JAML 1TXYA 4X3SA 5HGQA 5IYDG 3MHBA 1JWMD 4IUVA 3BZCA 3PUVA 1H9KA 2N78A 4LF9L 5FKAC 3H94A 1RDPD 4ZKCB 3NWTA 3I4MB 1M8AA 3NBHA 3WWVA 2K05A 3K5NA 1NJIC 1H9SB 1SFOH 3A8KE 4L5SA 1TWFH 1QZHA 3V96A 4JOIA 2K4KA 1RF2D 3AMUA 3I4NH 1SMYD 3MFYA 4A93H 4DA2A 4JYAL 2O4XA 3S1NH 2XVSA 2WFWA 1CKNA 3IRBA 1N34Q 5FJ8G 5TSSA 3QJYA 3Q24A 3CCSA 1PTOF 1MJEA 2FXQA 3FHWA 2O5IC 2EYFA 1JE4A 5C4JH 5C3EG 5HURA 4ZQ3A 2HCIA 2N3SA 1V1OA 1YZ6A 4HJ5A 4G4KA 4POGA 4EGVA 2QF7A 3HGBA 4XQNA 3AEVA 4A3JB 3GP7A 3PF4A 4DV3L 3KLSX 3E5SA 2B2UC 4C3HH 1HZ9A 3GTGH 4DR5L 3TP5A 3GTQH 5I6YA 2FMCA 1SNMA 1EIFA 4DK3C 1PLFA 4LF7Q 2UXDL 5AFWA 1IYJB 2A68D 2CQOA 1Q46A 2F0QA 3GV3A 4KN7C 4B3SL 4CDFC 4BA1I 4LK1C 2VUMG 4A3BH 4C3JH 4ZUIA 1Z7TA 4DN4M 4BBRG 1UNSA 4PZ6A 2BDOA 2RHSB 3J80i 5C5LA 4JI5L 3R93A 5EJWA 3GTMH 2O5JC 4GNXB 2K5VA 2A1AA 5GAEC 4X65Q 3BDOA 3CCJA 3HOUH 1EEFD 4AH6A 3G71A 1GHKA 1EQVA 4YCWA 3S2HH 2ASBA 3J80c 4YHHL 4B3RQ 5DM63 4IZ8A 1QZGA 5EKIA 2KJXA 1JOKA 4MIUA 1ET9A 2B39A 4K0KL 1O7ZA 3T4AC 1X3GA 2ICIA 1UUPA 1WJJA 3CCUA 1S5ED 1QNKA 1Y1WG 5EBCA 3S24A 5CV8A 2NVTB 4A3IB 4X66L 1YJWA 1X56A 2HDLA 4GNXC 4P2CB 1BCPD 1AE2A 3K7AB 4JVZA 3GTPH 3J81L 1G2SA 1NBWA 5E4WC 3L7ZC 4B08A 2RQXA 5FLMG 4DR1L 1O7LA 1HNZL 1GHJA 4BBSH 5EQ0A 2R7ZG 1JB7A 2JA6H 1BO0A 1CKOA 1I4GA 2IWHA 1YNNC 1C4QA 1QE6A 4PQXA 3NHHA 3I91A 5M3MG 2Z6BA 4OL7A 3HKSA 4JI6Q 4CKCA 3CAMA 4CJ0B 4GKJQ 1MJCA 2K33A 5AJ3Q 3CCQA 1STNA 3A8IE 4ZAIA 5IT9E 1WYDA 2LKVA 1BBUA 5ELCA 1FNVA 1HZBA 1MGSA 3AFPA 4TQUS 2UUCQ 2MQHA 4ZK9B 4HIDA 3T51B 2UUAL 4QB4A 4A3DH 5C44G 4YIJA 3OWFA 4YWKA 4RKLA 1VMPA 2GVBA 1JICA 2EY5A 4CKEA 3KF6B 3A7LA 1Z9FA 2K01A 1QG7A 2F0NA 1PXUA 2BH8A 2J4XA 3S2DH 2Q2IA 2B2WC 4K8IA 4A3KB 2EVBA 4PZ7A 3PO2B 4JI0L 2BA1A 3G7LA 4HAEA 2B63H 1AZQA 4EQOA 1EY9A 3E3XA 1W6KA 2YTXA 3OOCA 5E3FA 4HR7B 4NXNL 1Y8PB 2ZM6L 3CMEA 4RGOS 2F0GA 3HOXH 4DNIA 3VR6A 1K0RA 1R4QB 5I2YA 1H9SA 1NNXA 3UDIA 2B8GA 1STHA 1Q1EA 2EYLA 1ICWA 3GTJH 2UU9Q 4M8AA 2F0KA 3GTOB 4YWMA 1S40A 5GROA 1EFWA 1IYVA 2EY6A 1KRTA 2EPBA 4JI4Q 3RR5A 2XIWA 3HFZB 3CXCA 3ND9A 3FMCA 2PNHA 4R4OA 5I9PA 2JK8A 2BDNA 2OWOA 4KJOA 3K0YA 5A2QL 1VF7A 4C3IB 2RBMA 5D3DA 4GLXA 4GS3A 4JV5Q 4RCOA 3PUXA 4HMIA 2HIXA 1STAA 2X6GA 4UHVA 4YCUA 3K59A 1HR0L 3EQLC 3MC0B 2R61A 3S1QH 5EKKA 4PV1C 1ICFB 2CKZB 3J80E 4B3TQ 1MHWC 3I4NG 4A93G 1SNDA 2I5MX 4WRDA 5M5YB 1D1IA 3K7UC 1K0SA 3CCRA 1C0AA 2PW7A 4LWCA 2RCFA 4K5XA 1DOLA 1Y14B 4NB3A 5J39A 4YCVA 4O0AA 2EYPA 1L0XB 1D8LA 2EDGA 2NVTH 3CC4A 1GUTA 1L2FA 3ZYYX 3GO5A 5A35A 4DXGA 2L12A 1STBA 2WKDA 1IL2A 2JEBI 1RTNA 4XYQA 2VUMB 1U4PA 3K7AH 4ID6A 3K5MA 3I2ZA 4DR2L 3IAYA 4IPHA 2AQ3B 5DLQE 2KQ3A 3S16H 1IKMA 4GNXA 4C3HG 1CZWA 3TZUA 4LUOA 3QB3A 3BS1A 4NW2A 2UXCQ 4KHZA 4S3SA 3PV0A 4A3EH 1I6VC 1P16A 1UAPA 4ALPA 1XPOA 1ILQA 3MAQA 5J3BA 1V1PB 1X65A 2R7DA 3NENA 4IPGA 5C3XA 3R3OA 4BY7G 4LAAA 1I3QH 4DV7Q 1K9MC 1PRTB 1VQDA 4A3BG 1C8CA 1F2MA 1Q1BA 4C3JG 1HNXQ 2A19A 2G9HD 1IBMQ 1Y1WB 3NQIA 1EZ8A 4LF4Q 1LT6D 3G4SA 2XRSD 2I5HA 4RFBA 2PZTA 3HOWB 2VL6A 2UXBL 2NVXH 3H0GB 1PH1A 3AQQA 3HOUG 1MI2A 4DGZA 2A69C 1R4PB 3NTKA 1Q3LA 3RD4A 4A3KH 4LFBQ 4OWXB 3PO2H 2R7ZB 4BWGB 1QILA 4J15A 4X62L 4F87A 4F7XA 1CA6A 1PRTC 2BE5D 1Q7YC 2B2WA 4YY3Q 1FL0A 2ALYB 1KHIA 3A7AB 3S9WA 4LF6L 4DF7A 2QCPX 2F0FA 3ER0A 4UDUC 2F0SA 1CSQA 1EFID 1FVIA 2K5DA 2DY8A 2E2IH 4IFDJ 2LY7A 2OTLA 1EIHA 4JBWA 4L63B 3VYSA 1SRUA 5IGDA 2XWBB 3BJUA 3ULLA 4XYOA 1VDZA 5C44B 3GDEA 1NSNS 3KF6A 5LMNW 2AUKA 5CR3A 2E2JH 2EQSA 1WD1A 1Z6HA 4BBSG 3KJPA 3QG1A 2JA6G 1EZ6A 4FVMA 1FD7D 2EOTA 3IFTA 4Q0FA 3FKIG 4OO1G 1HQRD 5JJKA 4A3GB 1TVXA 3WOEA 1HUMA 5I6WA 5C3EH 5IGFA 1TS5A 4KV6A 2KVMA 4NPSA 4KD4A 1PRTF 3ERSX 2PI2A 4LFCQ 3ITPA 4FF2A 4DV2Q 4JI8L 1GJXA 1B3QA 1WTPA 3HKZG 4A3DG 4I7ZC 1V8QA 3RZDH 1YNJC 4XQQA 1EU4A 3TS0A 1K8GA 1F2ZA 4RG1A 3M3YH 2NVYH 3K0XA 4XTCS 4KN4C 4RGTA 1PDQA 1LLRD 4KY7A 2YTYA 2HUGA 2L15A 5CBAE 1X54A 5CV4A 4EX5A 4IOCA 1CA5A 5EPJA 1NTGA 4X3UA 3PO3G 2LSSA 1NAPA 1MKHA 1EQRA 3VYUA 1GUWA 1O80A 3SK6A 1LTAD 4PZ8A 4QMGA 1TY2A 3E0JA 4ABNA 2VUMH 3Q8DA 1SNPA 1II3A 4BBRH 3H6MA 3HOXG 4ODGA 3QR8A 5GAHC 5IYBG 1XPRA 2KENA 3V05A 3J81i 2KEDA 1IBKL 5C0XI 2NBFA 2Z8LA 4QL5A 4LF8L 1SFOB 2HHHL 1HRJA 1PH6A 1CFMA 1TWFB 2ZTCA 4RWSC 2PW5A 2M00A 4DV0Q 2WKCA 3KLSA 3I4NB 4A93B 1TU2B 4DAPA 3CCEA 3S1NB 1EY5A 1VQMA 3KYHC 3HS0C 5GADC 3MEHA 4O2DA 5C4JB 2NN6I 2JEAI 2PO4A 5ELOA 2PZWA 4FXDA 3Q23A 1PHJA 2AWOA 4J6HA 5KNDA 2OT2A 5CYUA 4DUZQ 1X32A 1NMFA 2JYOA 3TMEA 3BVGA 1EIYB 1XMQQ 1RIPA 1DONA 1DOKA 2F0DA 2QDLA 3DEPA 4C3HB 5C3WA 5FLMH 4DR3L 4JI3Q 3GTGB 2GVAA 3GTQB 1SDFA 2QA4A 4HIMA 4MTKA 4M1UB 1V1PA 1I50H 5M3MH 1SROA 4JW0A 1A6XA 3D4RA 1LT5D 1N32Q 4L8JA 2PQEA 2VQFQ 1STYA 4H0LC 2OXPA 1GUSA 3ULJA 2EY2A 1J6QA 1LTID 5IE8A 3VR3A 1G51A 4APVA 4A3BB 2EE1A 4C3JB 1HTLD 3A5ZB 1PZID 5LMNQ 1SNOA 4DAYB 1J8IA 1TWHH 1B7YB 1AE3A 3GTMB 2YV5A 1NMGA 4A3EG 3WDNA 1VQBA 3HOUB 1ZKOA 3EJIA 3S2HB 4IPDA 5JAVA 4TSSA 1VQPA 4L6TB 2N88A 5D14A 2A8VA 3LX0A 4R4TA 1D6EC 1OXVA 3KOJA 1ONLA 3OW2A 1TKWB 2R92G 1LUZA 1I94Q 3DEOA 4EVOA 4B3ML 3K57A 2CFMA 2F0OA 2R7FA 4UY8C 2CW0C 4TKOB 2PMZB 1QVGA 2ZTEA 5IIFA 2I07B 2F3VA 3I4LA 1V1QA 2VQEQ 4DV4Q 3CCMA 4C1NI 1N36Q 3GTPB 3Q22A 2YYZA 1PH5A 4QUFA 4WFN3 1KNEA 4K6LA 3EVQA 1X3QA 2NB0A 3E9IA 4BBSB 3D3RA 1J5EQ 2JA6B 1GM5A 2O2LD 3BDLA 1LM0A 1OXTA 1WTXA 1B9NA 2E2DC 1I4PA 1VQFA 4DV6Q 5IT9c 1E2WA 1HNWQ 1AEXA 4KK7A 5G3LF 2SDFA 1O7IA 1FNUA 1D2BA 1KAWA 4GN5A 3HKZB 1SBBB 4A3DB 1NR4A 4GLVB 1ENAA 2ICEC 3OTOL 1BUVT 3BVMA 3J81E 1A2TA 1SMYC 2JN4A 2SNMA 3RLNA 2MNAA 5C4XH 1VQEA 4A3LH 4A3MH 2JA5H 4OEMB 4LF5L 3PIO3 2MUYA 3S2DB 1CKMA 5IWAL 3PF5A 3PO3B 2TSSA 4QJFA 1SE8A 2B63B 2EYHA 1ZYRD 5E7NA 5DM73 1N33Q 2MJ8A 3TBIB 4WJ4A 1TIID 4GKKQ 3MWYW 4IJLA 4LFAL 3K5LA 3HOXB 3C46A 1CTMA 2A6HD 1CQFA 2BH2A 5CC4A 4JBMA 1PV4A 1GXDC 3TDQA 3GTJB 3BDCA 1HFGA 1EEID 3PQIA 2H1EA 3CPFA 5IGGA 2XRQD 4K2LA 3LWEA 5AJ3L 1PVOA 1UE5A 4BY7H 2A68C 3KLRA 3PIOA 1DZ1A 4DR7Q 1GUGA 2RDFA 2PZUA 4HIKA 1CZGA 3MZ5A 1HQMC 3QO2A 2NVQH 2F0MA 2KCNA 4HCEA 1U9RA 3K81C 3NEMA 4MNOA 3VYRA 1JJCB 1XWEA 3S1RH 3VYTA 3CCLA 4Y52H 1U5KA 1T9HA 5ELDA 2KA7A 3S1QB 2A73B 1BCPB 3K58A 4RKBA 1K8MA 3L3OC 4X6AH 4NP5A 5EAYA 2AMCB 4DR4L 4IUUA 3I55A 4LF9Q 1X6OA 3L2PA 4AQYL 2DJGC 2D0OA 3IL8A 3OSOA 5C5MA 5F2DA 4JI2L 5J22A 3F2UA 4UAIA 3OMCA 1LV9A 5JVH3 3MEFA 1GOZA 4HMJA 2B2TA 2MPMA 5JEAJ 5E4XA 1KLUD 2G5DA 1XTDA 2K5WA 3W5OA 5LMUL 2F4VL 2KEEA 1X55A 5A2QE 2N8NA 1JMCA 1JB3A 3MXGA 4JYAQ 1W3SA 2K14A 1RL2A 3I4OA 3FPUB 4DAYA 2UU9L 1BCPC 1S5CD 1WI5A 3HEJA 4HTHA 3S16B 4KKSA 1EY6A 1GUOA 1IW7D 5BR8L 5EKLA 4N8FA 1RD9D 3HG9A 1VQ8A 4R9WA 4DUYL 1J9OA 3FKIH 4A3EB 4OO1H 5FLXc 3Q0AA 3A74A 1LO5D 3OMGA 4P73A 1I4XA 4Y7NH 3P1HA 2Q2UA 3L9AX 3F2CA 4DV3Q 1I3QB 3CQZB 3SE0A 1VQ4A 1SXTA 2WACA 2C9OA 4DR5Q 1Q90A 3HOVG 2RCNA 2V1CC 3G48A 2NZOA 2ATWA 3EIVA 1WTVA 4QUCA 4RGNA 2UXDQ 2UUBQ 2Q8IB 1Y69U 4A3CG 2NVXB 5JOBA 4RH6A 1BCPF 2ZJRA 4B3SQ 5IGBA 3TN2A 1G6ZA 2MO1A 4XIGS 1B8AA 3T1HL 1SLJA 3PO3H 4DU9A 3DUZA 3TS2A 1JOQA 1C48A 1S4ZA 3RLOA 1LTLA 2IX3A 5JPMC 1BBWA 3NE5B 4H02A 4JI5Q 4A3FG 1TS4A 4IUPA 4IUTA 1XMOL 2I0QA 1BQQT 1U0LA 4JBJA 2JSOA 1ILPA 1BR9A 5IYBH 5IGCA 4JI7L 2F0IA 2E2IB 2XNAC 2L4NA 3L0OA 2FJ2A 3DLLA 2JQOA 2ZT9C 4K6DA 3TRZA 3NK9A 3N6RA 2B2UA 4O42A 4K0KQ 3I72A 2E2JB 4HJAA 1IXRA 1KDAA 1EYAA 2LXKA 3RLFA 4V190 2E76C 3KF8B 4Z9CB 3NTIA 4NDXA 3ULPA 1VQJA 4X66Q 1XJVA 1KQSA 2KCMA 3SK4A 1KL9A 1Y8OB 2B3GA 4DV7L 1D5XC 1G6PA 1O78A 5C3EB 1BNZA 2KHIA 1Q8IA 4OWWB 1AFPA 2RF4A 1CHPD 5CMDA 5ELBA 2A6ED 4LF4L 4XQJA 1HNZQ 2IJ0A 5L37A 3VR2A 4IALA 5LL6S 5T1GA 2DGYA 4I7AA 2LFNA 3X3NA 1XNRL 3RZDB 3K6OA 2ZXOA 1M1KC 2C35B 2VY3A 3MXNB 3M3YB 2XWJB 4NKLA 2NVYB 3IFDA 5M3FG 3JC66 1EY8A 2PQAB 3FP9A 1VQLA 2B29A 4DV1L 4FO2A 5C4XG 2X69A 4A3LG 5I9OA 5GAGC 3S15H 3IKJA 3PUWA 4A3MG 2JA5G 5COYA 3HOYH 4HEDA 2P5ZX 2UUAQ 2L5TA 5CV9A 2CHBD 5IP7H 1E1TA 2BCOA 4AIMA 1Q86C 1ML0D 5IODA 4DFAA 5J1ZA 2AUJD 2LS01 1L1OB 4BBRB 3I7FA 1XNQL 1QVCA 2TMPA 2CH4W 4MN3A 4IQZA 2K75A 1A8VA 3MA2B 2NTSA 1JJ2A 4JI0Q 5FLXE 5KRUA 1YIJA 1E2VA 3UI2A 1R9TH 1B50A 1Q8KA 2F1MA 5JJIA 3RNUA 1Q82C 3JAMi 4NXNQ 4OXPA 2ZM6Q 3U50C 4ZKBB 1AP0A 4DAMA 2EXDA 3AU7A 3M7GA 1DYQA 4XXEA 2Q8RE 3C1FA 3CQZH 1EL0A 4JI1L 4IFDG 1B1ZA 2R92H 2PMZE 4V0BA 4DV2L 1L1OC 4PNYA 1PFBA 3JAMc 1B70B 1KAAA 5C6AA 1HTPA 3GD7A 2JP1A 1LACA 3H3VI 1E3PA 2DNCA 4KY5A 1U4LA 1E2ZA 2YTVA 4KD3A 2F0WA 1KDCA 4CJ1B 3H91A 2Y0SE 4JBKA 1L0YB 1U4RA 2H5XA 4OX9L 1SNQA 1PYWD 1IYUA 3J7AV 3R2TA 1WTWA 3HOZH 4P72A 3J81j 1I5FA 2CCZA 1EWCA 1I50B 5M3MB 1SAPA 4KHVA 4IOAA 1RKNA 3EA6A 3E0EA 3QOJA 1HR0Q 2Q2TA 5CGKA 3C1EA 3HKZE 1ENFA 1WFQA 5KYIA 5FO8B 3F1ZA 4U673 3RMHA 3TREA 3HOVB 1YHQA 1YHBA 3H09A 1VF5C 2OTJA 1PH3A 5KGUA 3J7AF 3CD6A 1TWHB 4MZ9A 2EY1A 2Q2HA 2Y0SG 4Q5VA 4NXML 4X64L 1Y1VG 1D5ZC 1WCMH 5EBDA 4UP7A 1F9RA 2C5CA 4IO9A 1SYDA 4MTNA 3J80L 2DJFC 2D9UA 4TVAB 3UDFA 4DR2Q 3U4ZA 1SR3A 1OXXK 2K50A 1YI2A 2N49A 3BYYB 1JWUD 5H1SE 5C0XJ 4I65A 3M85A 1UE1A 2X6LA 2RSNA 4ME3A 4HCSA 4P75A 4PMBA 1FJGL 4HJ9A 3S1MH 2J0TD 3KBXA 4KHPL 1BF4A 2DY7A 1XYIA 2HDMA 3I4MG 1H95A 3KF8A 3KJOA 3PGZA 2K6AA 4BA2I 3KUPA 1N32L 4C56C 3CMAA 4J8QA 5JEAH 2MO0A 2CWAA 2JA8G 1K83H 2Q8TA 4WJ3M 2NTTA 2UXBQ 2K1BA 4KY6A 1ESRA 1NR2A 2QW7A 2E2HH 3FRPB 3V2TA 2E75C 4C1NK 3NELA 1GKHA 3BVZA 3EFXD 4PMCA 1CM9A 3UDGA 1QUQB 4POFA 2ZJPA 1DXMA 4DR6L 1TY0A 3BG3A 1A2UA 4K5WA 3SXHA 4X62Q 4FF4A 3MXNA 1F9QA 2K5NA 3J7ZC 1FGUA 4QGUA 2PQAA 3AYHB 1QCBD 5KIXA 4LF6Q 4A75A 3GTLH 1CI3M 3NQTA 5M5YH 1I6HH 4R4QA 3J81c 1LTGD 1SYFA 3DWQA 5C4XB 3W2DA 1G2TA 1DCZA 1IZ6A 1MIUA 4A3MB 3JAME 2JA5B 1VS0A 4IN3A 1LABA 3U4VA 5LHY1 3OIPA 3PIP3 2SEBD 3STBD 4X3KA 3DXJC 1L1OA 2MP1A 4UPAA 3T13A 3R2IA 3PMFA 3M4PA 1X3EA 2GN5A 1KDBA 2D5DA 2N55A 1GVPA 5IYCG 4OIKA 4DK6C 4CHTB 5BN5A 5K5PA 4DV5L 4FF1A 5JVG3 1K8OA 2EJGC 1VQ9A 1IKLA 5CV7A 3K8AA 4JI8Q 3HOYG 1B4OA 1PH8A 1VQ6A 5BN4A 4H7BA 4DKAC 3GV6A 1EYDA 1VQCA 5IP7G 3RN2A 4BY7B 3RN5A 1BKBA 1FR3A 1DM0B 3HOVH 1DJRD 4N9PA 2NUCA 1E1OA 2SNSA 2NVQB 2Z4HA 4FDBA 2IT1A 4LW1A 4QY7A 4CDDC 2MHVA 3OIQA 3RZOH 4C2MH 1F9PA 4A3CH 3S1RB 1VQAA 2F0TA 1A0IA 3D8GA 4A3IG 3GTKH 1N34L 1KNAA 2E5LQ 3CW2C 5DAUA 2MGSA 4FYDA 4L5TA 4GZYC 2F03A 2R93G 4G7OC 4B9XA 4EQ5A 4ME5A 5EPKA 1IBKQ 3TP6A 4A3FH 1F77A 1IBLQ 1PMRA 4LJZC 2RDGA 4QQBX 2BOSA 2VW9A 3VR5A 3BZKA 1EY0A 2ID0A 1PA6A 4J1MA 2EYOA 3LNNA 4IUQA 3A0JA 3EN2A 2L1BA 2K52A 4LF7L 4IJHA 1QOHA 1HPCA 1YJ9A 1NY4A 3T1YQ 3HOZG 2Y0SB 1MD2D 3FKIB 1UE6A 3D31A 4BXXH 1BOSA 1FYCA 2WAQE 1HXYD 2KHSA 5M5XH 3CHBD 1T5EA 2GA4B 1WVLA 1X3PA 2RDHA 4RHSA 4O1NA 1S3OA 2J7ZA 4K14A 4Y7NB 2L11A 2F52A 1PTOD 3K80C 3LWUA 3NPPA 2OQKA 1AW7A 4UP8A 2EZVA 3BU2A 3I8ZA 3AFQA 3TZDA 4OGQC 4K5VA
chains in the Genus database with same CATH topology
1OTCA 3F2CA 1P16A 2KBNA 4X65L 4DV3Q 4ALPA 1M90C 1VQ4A 1XPOA 2LXJA 1EYGA 4DR5Q 5J3BA 4JOIC 3HOVG 1EUJA 1TWAH 1X65A 2HQLA 5M3FH 2R7DA 4B3RL 2RCNA 2V1CC 3NENA 4IPGA 1I94L 4BY7G 3G48A 2NZOA 2ZJQA 1IBLL 1I3QH 2ATWA 3EIVA 4JCVE 1WCMG 2IHEA 4DV7Q 3STBC 2UXDQ 1K9MC 1X3FA 1VQDA 2QEXA 2UUBQ 4A3BG 1Q1BA 1HNXQ 4A3CG 2VQEL 2A19A 1YVCA 4DV4L 4NXMQ 1IBMQ 4X64Q 1N36L 2ZJRA 2WAQG 4B3SQ 1A63A 4LF4Q 3G4SA 2MO1A 2I5HA 4XIGS 1B8AA 3T1HL 2VL6A 5JJLA 1SLJA 2UXBL 2NVXH 3PO3H 3LGJA 3TQYA 1QUQA 1Y1WH 1J5EL 3T1YL 3TS2A 1PH1A 3AQQA 3HOUG 4RMFA 1KRSA 3RLOA 4OO1I 1LTLA 2JA9A 3HOWH 1BBWA 4H02A 4JI5Q 4A3FG 1XMOL 3H0GH 4GOPB 4A3KH 4OWXB 2I0QA 1U0LA 4JBJA 4KI0A 3PO2H 4LFBQ 1FJGQ 1NE3A 1PH7A 4J15A 4X62L 3G6EA 4DV6L 5IYBH 1PYBA 4JI7L 4KHPQ 1Q7YC 2QGQA 4YY3Q 1FL0A 2ALYB 1E7ZA 1JE5A 3L0OA 2JQOA 3PIPA 3DLLA 1HNWL 1KHIA 4GKJL 2R7ZH 4B3MQ 4LF6L 3TRZA 3ER0A 5JEAG 1CSQA 4A76A 1FVIA 1SMXA 4A4IA 4K0KQ 4L5QA 4HJ7A 2E2IH 4IFDJ 4HJAA 1IXRA 2OTLA 2JA7H 2UUCL 3S14H 2LXKA 4JBWA 3RLFA 1SRUA 1HZAA 1HH2P 1E24A 3BJUA 3KF8B 3ULLA 3W1BA 3DM3A 1VQ5A 3ULPA 1VQJA 4X66Q 1VQNA 1YJNA 1XJVA 3M4QA 2KCMA 3GDEA 3KF6A 1KQSA 5LMNW 1KL9A 3ICEA 2B3GA 1TWGH 4KLKA 2E2JH 5K36G 4DV7L 2EQSA 1G6PA 4GOPC 4BBSG 3KJPA 2UUBL 1XPUA 2KHIA 1VQIA 2JA6G 4OWWB 2RF4A 5C44H 3FKIG 4OO1G 4HIOA 2NZHA 5IP9G 5JJKA 1PFSA 2WB1E 2AWNA 4LF4L 1YITA 1HNZQ 1N33L 4DR6Q 4R4IA 4AYBE 1YNXA 5C3EH 4LF8Q 4BY1H 1VCIA 2HHHQ 2DGYA 3UDXA 4GKKL 4GN3B 5IY0A 1XNRL 4NPSA 1M1KC 3ERSX 2C35B 2VY3A 2PI2A 4LFCQ 3MXNB 1VQ7A 4A3GH 4DV2Q 1YEZA 2WP8J 4JI8L 5M3FG 3JC66 3E9HA 2PQAB 2EIFA 1VQOA 3FP9A 1VQLA 3HKZG 2B29A 2OQ0A 2PI2E 4DV1L 4A3DG 3KDFB 3RZDH 5C4XG 3OTOQ 1K8GA 2YU9H 3TS0A 4A3LG 5GAGC 3S15H 4RG1A 3M3YH 3PUWA 4A3MG 2JA5G 2NVYH 3K0XA 4XTCS 3H15A 3HOYH 2UUAQ 2Z6KC 1YHAA 1ASYA 1G291 2IX0A 1W2BA 5IP7H 1E1TA 2YTYA 4AIMA 1Q86C 2XGTA 1V43A 3H3VH 2L15A 2E8GA 1X54A 4OWTB 3SGIA 3F2BA 4LF5Q 3F2DA 1D7QA 4EX5A 4IOCA 4DR7L 1NTGA 5IWAQ 3PO3G 2LSSA 1L1OB 4L5RC 1MKHA 1EQRA 2WB1G 3I7FA 1WOCA 1Y1VH 1QVCA 4JI4L 1XNQL 4AYBG 3HOWG 4P71A 4DR3Q 2KCTA 2K75A 2Z0SA 4PZ8A 4DV5Q 1A8VA 2JE6I 2VUMH 3H0GG 4A3KG 1JJ2A 1CSPA 4JI0Q 3PO2G 3Q8DA 2D62A 1YIJA 3J7A5 1R9TH 1TXYA 4LFAQ 4BBRH 2JJQA 3HOXG 3PUYA 1Q8KA 5GAHC 5HGQA 5IYBG 1AH9A 5IYDG 4JV5L 5JJIA 3RNUA 1XPRA 2BA0A 2KENA 3BZCA 4OXPA 3JAMi 3J81i 1Q82C 1IBKL 2ZM6Q 1JT8A 3PUVA 5C0XI 3U50C 2N78A 1N9WA 4QL5A 4LF8L 4LF9L 4DAMA 2HHHL 2EXDA 1PH6A 3CQZH 2ZTCA 1EOVA 4JI1L 4IFDG 4B3TL 2PMZE 4DV0Q 3WWVA 2R92H 4DV2L 1NJIC 1L1OC 3JAMc 3CCEA 1SFOH 1B70B 4L5SA 3U58A 1S72A 1HJPA 1VQMA 1JJGA 1TWFH 3GD7A 3KYHC 1ASZA 5GADC 1QZHA 2HIVA 3I4MH 4JOIA 3H3VI 2K4KA 1E3PA 2VZAA 4O2DA 4R4CA 3I4NH 2NN6I 4A93H 1Q81C 4JYAL 3S1NH 2YTVA 2JEAI 5ELOA 2WFWA 1CKNA 3IRBA 1N34Q 5FJ8G 3CCSA 1V9PA 2Y0SE 1PHJA 1MJEA 3UE1A 2FXQA 3FHWA 4JBKA 2JA8H 2AWOA 2H5XA 4OX9L 5C4JH 5C3EG 1HR0W 4QIWE 4DUZQ 2N3SA 4R1JA 1NMFA 3HOZH 4P72A 1YZ6A 3CP0A 1P8LA 3J81j 1I5FA 3VDYA 1EIYB 4LUVA 1EWIA 4UP9A 2CCZA 4HJ5A 1XMQQ 4DPGA 4A3GG 1RIPA 3PSIA 4POGA 4DR4Q 5FLMH 4JI3Q 4IOAA 4YHHQ 4DR3L 3CC2A 3E0EA 2GVAA 4AQYQ 3PUZA 1HR0Q 2Q2TA 2UXCL 3AEVA 2VNUD 2D0PA 2QA4A 4JI2Q 4HIMA 3PF4A 2IY5B 1I50H 3HKZE 1WFQA 5M3MH 4DV3L 1SROA 4C3HH 3F1ZA 1HZ9A 3GTGH 3TREA 4DR5L 3GTQH 2HT1A 1N32Q 1YHQA 2VQFQ 4A3JH 1YHBA 1EIFA 2F4VQ 4BXXG 4DK3C 5LMUQ 2OTJA 1PH3A 1OXUA 3ULJA 4LF7Q 1J6QA 3CD6A 5IE8A 2UXDL 1G51A 4MZ9A 4APVA 1SN8A 2Q2HA 1IYJB 2CQOA 1HNXL 3A5ZB 2Y0SG 1Q46A 4NXML 1IBML 1Z47A 4X64L 1Y1VG 4B3SL 5BR8Q 5LMNQ 1VQHA 1WCMH 4LUZA 4DAYB 4DR1Q 4UP7A 1OXSC 1TWHH 2XTIA 4BA1I 1B7YB 1TWCH 2MFIA 4IO9A 2VUMG 4MTNA 4C3JH 4A3BH 1AE3A 4DUYQ 3UDFA 4DR2Q 2YV5A 4TVAB 1NMGA 3U4ZA 1SR3A 4BBRG 1OXXK 4PZ6A 4A3EG 2K50A 1VQBA 1YI2A 2K5HA 2N49A 2RHSB 5H1SE 3J80i 4GOPA 5C0XJ 2CWPA 3M85A 1UE1A 5IYCH 4ME3A 4IPDA 4JI5L 3GTMH 4P75A 2K5VA 4GNXB 1VQPA 2A1AA 4LFBL 1VQKA 5GAEC 4X65Q 1FJGL 2A8VA 4R4TA 3CCJA 4HJ9A 4AH6A 3G71A 3HOUH 3S1MH 1OXVA 3KOJA 4YWLA 3OW2A 4YCWA 1N8RC 3S2HH 3I56A 3W1GA 2IX1A 2R92G 4KHPL 2ASBA 1LUZA 4YY3L 4YHHL 3J80c 4B3RQ 1I94Q 1UEBA 4B3ML 3OYYA 1QZGA 2CFMA 4LNQA 2R7FA 2DUDA 4UY8C 3I4MG 1QVGA 3M7NA 1H95A 4K0KL 2ZTEA 3KJOA 3PGZA 1X3GA 1PH9A 4BA2I 1V1QA 2VQEQ 4DV4Q 3CCMA 1UWVA 1WJJA 3CCUA 3D0FA 1EQQA 1Y1WG 1N36Q 1N32L 3S24A 3CMAA 1PYSB 2YYZA 2MO0A 2CWAA 4X66L 1PH5A 2JA8G 1YJWA 3T1HQ 1K83H 1X56A 2Z6KA 4WJ3M 4GNXC 2UXBQ 3E9IA 1C9OA 1AE2A 1X9NA 1J5EQ 3GTPH 1GM5A 2E2HH 4A3IH 3NELA 1GKHA 3UDGA 1NBWA 1A62A 2AKWB 1L0WA 1LM0A 1OXTA 1QUQB 3L7ZC 4POFA 5FLMG 2ZJPA 4DR1L 4DR6L 1XMOQ 1HNZL 4BBSH 3KFUA 2R7ZG 1JB7A 2JA6H 1K3RA 1Q12A 1CKOA 1UE7A 2RHQB 4X62Q 1KD1C 2R93H 1VQFA 2K5NA 1FGUA 4IPCA 5IT9c 3J7ZC 4DV6Q 4JI7Q 5M3MG 5IP9H 4QGUA 2PQAA 3HKSA 4JI6Q 3AYHB 2JA7G 4LFCL 3CAMA 3M4OH 1HNWQ 4GKJQ 3KDFA 1MJCA 5AJ3Q 4LF6Q 1O7IA 3CCQA 1DGSA 4A75A 5M5YH 3GTLH 1I6HH 1KAWA 4R4QA 3J81c 3S17H 4GN5A 1PH2A 1GO3E 1WYDA 5M5WH 1BBUA 4GLVB 3OTOL 2KHJA 1HZBA 3AFPA 1IZ6A 4TQUS 2UUCQ 2MQHA 1MIUA 4HIDA 1VS0A 2UUAL 3M9BA 4OONA 3RLNA 4A3DH 3U4VA 5C44G 2MNAA 5C4XH 3STBD 4YWKA 1VQEA 1CUKA 4A3LH 4JI6L 2GVBA 4A3MH 2JA5H 4LF5L 1L1OA 3KF6B 4UPAA 4BY1G 1Z9FA 2F3IA 1CKMA 5IWAL 3PF5A 1VQGA 3KLWA 1SE8A 4QJFA 2IHFA 4GN4B 1X3EA 2GN5A 3M4PA 5E7NA 2BH8A 1N33Q 5C0XG 1GVPA 4PG3A 5IYCG 3S2DH 4DK6C 4WJ4A 2Q2IA 4DV5L 4GKKQ 4PZ7A 4IJLA 2BA1A 1BVSA 4JI0L 3TEHB 1XNRQ 2B63H 4LFAL 1LYLA 1VQ9A 3HOYG 3K8AA 2YTXA 4JI8Q 2BH2A 4NXNL 1PH8A 1VQ6A 4JBMA 1PV4A 3UE0A 2ZM6L 4DV1Q 2R6GA 4DKAC 3CMEA 1VQCA 5IP7G 3RN2A 1PH4A 1E22A 3HOXH 3RN5A 3CPFA 1GD7A 4DNIA 1K0RA 5IYDH 1C7YA 1BKBA 2NN6G 3UDIA 3CPWA 3HOVH 4DV0L 1Q1EA 5AJ3L 1PVOA 1UE5A 3GTJH 2VS1A 2UU9Q 4BY7H 1E1OA 2ES2A 1K8AC 3PIOA 4YWMA 4PMWA 1S40A 4DR7Q 5GROA 1EFWA 4FDBA 4GLAC 2IT1A 4LW1A 4QY7A 1KRTA 3CC7A 3RZOH 4C2MH 4JC0A 4A3CH 4HIKA 4HJ8A 1VQAA 1XNQQ 1A0IA 4JG2A 4A3IG 4JI4Q 1QVFA 3CCVA 3RR5A 3GTKH 3GTOH 1N34L 2AHOB 3HFZB 3CXCA 2NVQH 2PNHA 4R4OA 2E5LQ 2JK8A 3CW2C 2OWOA 3K81C 3NEMA 4MNOA 5ELNA 3S1RH 1JJCB 4Y52H 3CCLA 4DUZL 4L5TA 1U5KA 1T9HA 2R93G 4GLXA 5FJ8H 4NXNQ 4GS3A 4EQ5A 4JV5Q 1XMQL 3PUXA 4X6AH 5EAYA 1IBKQ 2AMCB 2HIXA 4DR4L 4JI3L 4A3FH 3I55A 4LF9Q 3F8TA 1X6OA 4YCUA 4C3IH 3L2PA 4AQYL 1HR0L 1IBLQ 3ZJYC 2D0OA 3S1QH 4JI2L 4QQBX 2VW9A 3BZKA 4JI1Q 2CKZB 2ID0A 4B3TQ 2ZTDA 1PA6A 3I4NG 4A93G 2I5MX 2I5LX 1HZCA 3MEFA 3K7UC 3A0JA 3EBEA 3NBHB 2VQFL 5JEAJ 3CCRA 1C0AA 2OCEA 4LWCA 2F4VL 3EN2A 1XTDA 3W5OA 5LMUL 5HY6A 1X55A 2K52A 2N8NA 1JMCA 5GQOA 1Y14B 4IJHA 4NB3A 4LF7L 4YCVA 1W3SA 4JYAQ 3PCOB 4O0AA 4P74A 4IFDI 2K14A 1RL2A 3I4OA 1YJ9A 1D8LA 1NY4A 3T1YQ 2NVTH 2UU9L 3HOZG 1WI5A 3CC4A 1L2FA 1UE6A 3D31A 4BXXH 3GO5A 3CF5A 5BR8L 4OX9Q 5LMNL 2WAQE 5M5XH 1CKNB 3B6YA 2JEBI 1IL2A 1KC8C 1YBYA 1K73C 3K7AH 1S3OA 3I2ZA 1VQ8A 4DUYL 4DR2L 4IPHA 2F52A 3K80C 3A5UA 3FKIH 5DLQE 1KIXA 2B63G 5FLXc 3S16H 1KXLA 2OQKA 4UP8A 4GNXA 3BU2A 3A74A 4LUOA 2E5LL 3AFQA 2UXCQ 4KHZA 4P73A 4Y7NH 2Q2UA 4A3JG 3PV0A 4A3EH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTC A;  3F2C A;  1P16 A;  2KBN A;  4X65 L;  4DV3 Q;  4ALP A;  1M90 C;  1VQ4 A;  1XPO A;  2LXJ A;  1EYG A;  4DR5 Q;  5J3B A;  4JOI C;  3HOV G;  1EUJ A;  1TWA H;  1X65 A;  2HQL A;  5M3F H;  2R7D A;  4B3R L;  2RCN A;  2V1C C;  3NEN A;  4IPG A;  1I94 L;  4BY7 G;  3G48 A;  2NZO A;  2ZJQ A;  1IBL L;  1I3Q H;  2ATW A;  3EIV A;  4JCV E;  1WCM G;  2IHE A;  4DV7 Q;  3STB C;  2UXD Q;  1K9M C;  1X3F A;  1VQD A;  2QEX A;  2UUB Q;  4A3B G;  1Q1B A;  1HNX Q;  4A3C G;  2VQE L;  2A19 A;  1YVC A;  4DV4 L;  4NXM Q;  1IBM Q;  4X64 Q;  1N36 L;  2ZJR A;  2WAQ G;  4B3S Q;  1A63 A;  4LF4 Q;  3G4S A;  2MO1 A;  2I5H A;  4XIG S;  1B8A A;  3T1H L;  2VL6 A;  5JJL A;  1SLJ A;  2UXB L;  2NVX H;  3PO3 H;  3LGJ A;  3TQY A;  1QUQ A;  1Y1W H;  1J5E L;  3T1Y L;  3TS2 A;  1PH1 A;  3AQQ A;  3HOU G;  4RMF A;  1KRS A;  3RLO A;  4OO1 I;  1LTL A;  2JA9 A;  3HOW H;  1BBW A;  4H02 A;  4JI5 Q;  4A3F G;  1XMO L;  3H0G H;  4GOP B;  4A3K H;  4OWX B;  2I0Q A;  1U0L A;  4JBJ A;  4KI0 A;  3PO2 H;  4LFB Q;  1FJG Q;  1NE3 A;  1PH7 A;  4J15 A;  4X62 L;  3G6E A;  4DV6 L;  5IYB H;  1PYB A;  4JI7 L;  4KHP Q;  1Q7Y C;  2QGQ A;  4YY3 Q;  1FL0 A;  2ALY B;  1E7Z A;  1JE5 A;  3L0O A;  2JQO A;  3PIP A;  3DLL A;  1HNW L;  1KHI A;  4GKJ L;  2R7Z H;  4B3M Q;  4LF6 L;  3TRZ A;  3ER0 A;  5JEA G;  1CSQ A;  4A76 A;  1FVI A;  1SMX A;  4A4I A;  4K0K Q;  4L5Q A;  4HJ7 A;  2E2I H;  4IFD J;  4HJA A;  1IXR A;  2OTL A;  2JA7 H;  2UUC L;  3S14 H;  2LXK A;  4JBW A;  3RLF A;  1SRU A;  1HZA A;  1HH2 P;  1E24 A;  3BJU A;  3KF8 B;  3ULL A;  3W1B A;  3DM3 A;  1VQ5 A;  3ULP A;  1VQJ A;  4X66 Q;  1VQN A;  1YJN A;  1XJV A;  3M4Q A;  2KCM A;  3GDE A;  3KF6 A;  1KQS A;  5LMN W;  1KL9 A;  3ICE A;  2B3G A;  1TWG H;  4KLK A;  2E2J H;  5K36 G;  4DV7 L;  2EQS A;  1G6P A;  4GOP C;  4BBS G;  3KJP A;  2UUB L;  1XPU A;  2KHI A;  1VQI A;  2JA6 G;  4OWW B;  2RF4 A;  5C44 H;  3FKI G;  4OO1 G;  4HIO A;  2NZH A;  5IP9 G;  5JJK A;  1PFS A;  2WB1 E;  2AWN A;  4LF4 L;  1YIT A;  1HNZ Q;  1N33 L;  4DR6 Q;  4R4I A;  4AYB E;  1YNX A;  5C3E H;  4LF8 Q;  4BY1 H;  1VCI A;  2HHH Q;  2DGY A;  3UDX A;  4GKK L;  4GN3 B;  5IY0 A;  1XNR L;  4NPS A;  1M1K C;  3ERS X;  2C35 B;  2VY3 A;  2PI2 A;  4LFC Q;  3MXN B;  1VQ7 A;  4A3G H;  4DV2 Q;  1YEZ A;  2WP8 J;  4JI8 L;  5M3F G;  3JC6 6;  3E9H A;  2PQA B;  2EIF A;  1VQO A;  3FP9 A;  1VQL A;  3HKZ G;  2B29 A;  2OQ0 A;  2PI2 E;  4DV1 L;  4A3D G;  3KDF B;  3RZD H;  5C4X G;  3OTO Q;  1K8G A;  2YU9 H;  3TS0 A;  4A3L G;  5GAG C;  3S15 H;  4RG1 A;  3M3Y H;  3PUW A;  4A3M G;  2JA5 G;  2NVY H;  3K0X A;  4XTC S;  3H15 A;  3HOY H;  2UUA Q;  2Z6K C;  1YHA A;  1ASY A;  1G29 1;  2IX0 A;  1W2B A;  5IP7 H;  1E1T A;  2YTY A;  4AIM A;  1Q86 C;  2XGT A;  1V43 A;  3H3V H;  2L15 A;  2E8G A;  1X54 A;  4OWT B;  3SGI A;  3F2B A;  4LF5 Q;  3F2D A;  1D7Q A;  4EX5 A;  4IOC A;  4DR7 L;  1NTG A;  5IWA Q;  3PO3 G;  2LSS A;  1L1O B;  4L5R C;  1MKH A;  1EQR A;  2WB1 G;  3I7F A;  1WOC A;  1Y1V H;  1QVC A;  4JI4 L;  1XNQ L;  4AYB G;  3HOW G;  4P71 A;  4DR3 Q;  2KCT A;  2K75 A;  2Z0S A;  4PZ8 A;  4DV5 Q;  1A8V A;  2JE6 I;  2VUM H;  3H0G G;  4A3K G;  1JJ2 A;  1CSP A;  4JI0 Q;  3PO2 G;  3Q8D A;  2D62 A;  1YIJ A;  3J7A 5;  1R9T H;  1TXY A;  4LFA Q;  4BBR H;  2JJQ A;  3HOX G;  3PUY A;  1Q8K A;  5GAH C;  5HGQ A;  5IYB G;  1AH9 A;  5IYD G;  4JV5 L;  5JJI A;  3RNU A;  1XPR A;  2BA0 A;  2KEN A;  3BZC A;  4OXP A;  3JAM i;  3J81 i;  1Q82 C;  1IBK L;  2ZM6 Q;  1JT8 A;  3PUV A;  5C0X I;  3U50 C;  2N78 A;  1N9W A;  4QL5 A;  4LF8 L;  4LF9 L;  4DAM A;  2HHH L;  2EXD A;  1PH6 A;  3CQZ H;  2ZTC A;  1EOV A;  4JI1 L;  4IFD G;  4B3T L;  2PMZ E;  4DV0 Q;  3WWV A;  2R92 H;  4DV2 L;  1NJI C;  1L1O C;  3JAM c;  3CCE A;  1SFO H;  1B70 B;  4L5S A;  3U58 A;  1S72 A;  1HJP A;  1VQM A;  1JJG A;  1TWF H;  3GD7 A;  3KYH C;  1ASZ A;  5GAD C;  1QZH A;  2HIV A;  3I4M H;  4JOI A;  3H3V I;  2K4K A;  1E3P A;  2VZA A;  4O2D A;  4R4C A;  3I4N H;  2NN6 I;  4A93 H;  1Q81 C;  4JYA L;  3S1N H;  2YTV A;  2JEA I;  5ELO A;  2WFW A;  1CKN A;  3IRB A;  1N34 Q;  5FJ8 G;  3CCS A;  1V9P A;  2Y0S E;  1PHJ A;  1MJE A;  3UE1 A;  2FXQ A;  3FHW A;  4JBK A;  2JA8 H;  2AWO A;  2H5X A;  4OX9 L;  5C4J H;  5C3E G;  1HR0 W;  4QIW E;  4DUZ Q;  2N3S A;  4R1J A;  1NMF A;  3HOZ H;  4P72 A;  1YZ6 A;  3CP0 A;  1P8L A;  3J81 j;  1I5F A;  3VDY A;  1EIY B;  4LUV A;  1EWI A;  4UP9 A;  2CCZ A;  4HJ5 A;  1XMQ Q;  4DPG A;  4A3G G;  1RIP A;  3PSI A;  4POG A;  4DR4 Q;  5FLM H;  4JI3 Q;  4IOA A;  4YHH Q;  4DR3 L;  3CC2 A;  3E0E A;  2GVA A;  4AQY Q;  3PUZ A;  1HR0 Q;  2Q2T A;  2UXC L;  3AEV A;  2VNU D;  2D0P A;  2QA4 A;  4JI2 Q;  4HIM A;  3PF4 A;  2IY5 B;  1I50 H;  3HKZ E;  1WFQ A;  5M3M H;  4DV3 L;  1SRO A;  4C3H H;  3F1Z A;  1HZ9 A;  3GTG H;  3TRE A;  4DR5 L;  3GTQ H;  2HT1 A;  1N32 Q;  1YHQ A;  2VQF Q;  4A3J H;  1YHB A;  1EIF A;  2F4V Q;  4BXX G;  4DK3 C;  5LMU Q;  2OTJ A;  1PH3 A;  1OXU A;  3ULJ A;  4LF7 Q;  1J6Q A;  3CD6 A;  5IE8 A;  2UXD L;  1G51 A;  4MZ9 A;  4APV A;  1SN8 A;  2Q2H A;  1IYJ B;  2CQO A;  1HNX L;  3A5Z B;  2Y0S G;  1Q46 A;  4NXM L;  1IBM L;  1Z47 A;  4X64 L;  1Y1V G;  4B3S L;  5BR8 Q;  5LMN Q;  1VQH A;  1WCM H;  4LUZ A;  4DAY B;  4DR1 Q;  4UP7 A;  1OXS C;  1TWH H;  2XTI A;  4BA1 I;  1B7Y B;  1TWC H;  2MFI A;  4IO9 A;  2VUM G;  4MTN A;  4C3J H;  4A3B H;  1AE3 A;  4DUY Q;  3UDF A;  4DR2 Q;  2YV5 A;  4TVA B;  1NMG A;  3U4Z A;  1SR3 A;  4BBR G;  1OXX K;  4PZ6 A;  4A3E G;  2K50 A;  1VQB A;  1YI2 A;  2K5H A;  2N49 A;  2RHS B;  5H1S E;  3J80 i;  4GOP A;  5C0X J;  2CWP A;  3M85 A;  1UE1 A;  5IYC H;  4ME3 A;  4IPD A;  4JI5 L;  3GTM H;  4P75 A;  2K5V A;  4GNX B;  1VQP A;  2A1A A;  4LFB L;  1VQK A;  5GAE C;  4X65 Q;  1FJG L;  2A8V A;  4R4T A;  3CCJ A;  4HJ9 A;  4AH6 A;  3G71 A;  3HOU H;  3S1M H;  1OXV A;  3KOJ A;  4YWL A;  3OW2 A;  4YCW A;  1N8R C;  3S2H H;  3I56 A;  3W1G A;  2IX1 A;  2R92 G;  4KHP L;  2ASB A;  1LUZ A;  4YY3 L;  4YHH L;  3J80 c;  4B3R Q;  1I94 Q;  1UEB A;  4B3M L;  3OYY A;  1QZG A;  2CFM A;  4LNQ A;  2R7F A;  2DUD A;  4UY8 C;  3I4M G;  1QVG A;  3M7N A;  1H95 A;  4K0K L;  2ZTE A;  3KJO A;  3PGZ A;  1X3G A;  1PH9 A;  4BA2 I;  1V1Q A;  2VQE Q;  4DV4 Q;  3CCM A;  1UWV A;  1WJJ A;  3CCU A;  3D0F A;  1EQQ A;  1Y1W G;  1N36 Q;  1N32 L;  3S24 A;  3CMA A;  1PYS B;  2YYZ A;  2MO0 A;  2CWA A;  4X66 L;  1PH5 A;  2JA8 G;  1YJW A;  3T1H Q;  1K83 H;  1X56 A;  2Z6K A;  4WJ3 M;  4GNX C;  2UXB Q;  3E9I A;  1C9O A;  1AE2 A;  1X9N A;  1J5E Q;  3GTP H;  1GM5 A;  2E2H H;  4A3I H;  3NEL A;  1GKH A;  3UDG A;  1NBW A;  1A62 A;  2AKW B;  1L0W A;  1LM0 A;  1OXT A;  1QUQ B;  3L7Z C;  4POF A;  5FLM G;  2ZJP A;  4DR1 L;  4DR6 L;  1XMO Q;  1HNZ L;  4BBS H;  3KFU A;  2R7Z G;  1JB7 A;  2JA6 H;  1K3R A;  1Q12 A;  1CKO A;  1UE7 A;  2RHQ B;  4X62 Q;  1KD1 C;  2R93 H;  1VQF A;  2K5N A;  1FGU A;  4IPC A;  5IT9 c;  3J7Z C;  4DV6 Q;  4JI7 Q;  5M3M G;  5IP9 H;  4QGU A;  2PQA A;  3HKS A;  4JI6 Q;  3AYH B;  2JA7 G;  4LFC L;  3CAM A;  3M4O H;  1HNW Q;  4GKJ Q;  3KDF A;  1MJC A;  5AJ3 Q;  4LF6 Q;  1O7I A;  3CCQ A;  1DGS A;  4A75 A;  5M5Y H;  3GTL H;  1I6H H;  1KAW A;  4R4Q A;  3J81 c;  3S17 H;  4GN5 A;  1PH2 A;  1GO3 E;  1WYD A;  5M5W H;  1BBU A;  4GLV B;  3OTO L;  2KHJ A;  1HZB A;  3AFP A;  1IZ6 A;  4TQU S;  2UUC Q;  2MQH A;  1MIU A;  4HID A;  1VS0 A;  2UUA L;  3M9B A;  4OON A;  3RLN A;  4A3D H;  3U4V A;  5C44 G;  2MNA A;  5C4X H;  3STB D;  4YWK A;  1VQE A;  1CUK A;  4A3L H;  4JI6 L;  2GVB A;  4A3M H;  2JA5 H;  4LF5 L;  1L1O A;  3KF6 B;  4UPA A;  4BY1 G;  1Z9F A;  2F3I A;  1CKM A;  5IWA L;  3PF5 A;  1VQG A;  3KLW A;  1SE8 A;  4QJF A;  2IHF A;  4GN4 B;  1X3E A;  2GN5 A;  3M4P A;  5E7N A;  2BH8 A;  1N33 Q;  5C0X G;  1GVP A;  4PG3 A;  5IYC G;  3S2D H;  4DK6 C;  4WJ4 A;  2Q2I A;  4DV5 L;  4GKK Q;  4PZ7 A;  4IJL A;  2BA1 A;  1BVS A;  4JI0 L;  3TEH B;  1XNR Q;  2B63 H;  4LFA L;  1LYL A;  1VQ9 A;  3HOY G;  3K8A A;  2YTX A;  4JI8 Q;  2BH2 A;  4NXN L;  1PH8 A;  1VQ6 A;  4JBM A;  1PV4 A;  3UE0 A;  2ZM6 L;  4DV1 Q;  2R6G A;  4DKA C;  3CME A;  1VQC A;  5IP7 G;  3RN2 A;  1PH4 A;  1E22 A;  3HOX H;  3RN5 A;  3CPF A;  1GD7 A;  4DNI A;  1K0R A;  5IYD H;  1C7Y A;  1BKB A;  2NN6 G;  3UDI A;  3CPW A;  3HOV H;  4DV0 L;  1Q1E A;  5AJ3 L;  1PVO A;  1UE5 A;  3GTJ H;  2VS1 A;  2UU9 Q;  4BY7 H;  1E1O A;  2ES2 A;  1K8A C;  3PIO A;  4YWM A;  4PMW A;  1S40 A;  4DR7 Q;  5GRO A;  1EFW A;  4FDB A;  4GLA C;  2IT1 A;  4LW1 A;  4QY7 A;  1KRT A;  3CC7 A;  3RZO H;  4C2M H;  4JC0 A;  4A3C H;  4HIK A;  4HJ8 A;  1VQA A;  1XNQ Q;  1A0I A;  4JG2 A;  4A3I G;  4JI4 Q;  1QVF A;  3CCV A;  3RR5 A;  3GTK H;  3GTO H;  1N34 L;  2AHO B;  3HFZ B;  3CXC A;  2NVQ H;  2PNH A;  4R4O A;  2E5L Q;  2JK8 A;  3CW2 C;  2OWO A;  3K81 C;  3NEM A;  4MNO A;  5ELN A;  3S1R H;  1JJC B;  4Y52 H;  3CCL A;  4DUZ L;  4L5T A;  1U5K A;  1T9H A;  2R93 G;  4GLX A;  5FJ8 H;  4NXN Q;  4GS3 A;  4EQ5 A;  4JV5 Q;  1XMQ L;  3PUX A;  4X6A H;  5EAY A;  1IBK Q;  2AMC B;  2HIX A;  4DR4 L;  4JI3 L;  4A3F H;  3I55 A;  4LF9 Q;  3F8T A;  1X6O A;  4YCU A;  4C3I H;  3L2P A;  4AQY L;  1HR0 L;  1IBL Q;  3ZJY C;  2D0O A;  3S1Q H;  4JI2 L;  4QQB X;  2VW9 A;  3BZK A;  4JI1 Q;  2CKZ B;  2ID0 A;  4B3T Q;  2ZTD A;  1PA6 A;  3I4N G;  4A93 G;  2I5M X;  2I5L X;  1HZC A;  3MEF A;  3K7U C;  3A0J A;  3EBE A;  3NBH B;  2VQF L;  5JEA J;  3CCR A;  1C0A A;  2OCE A;  4LWC A;  2F4V L;  3EN2 A;  1XTD A;  3W5O A;  5LMU L;  5HY6 A;  1X55 A;  2K52 A;  2N8N A;  1JMC A;  5GQO A;  1Y14 B;  4IJH A;  4NB3 A;  4LF7 L;  4YCV A;  1W3S A;  4JYA Q;  3PCO B;  4O0A A;  4P74 A;  4IFD I;  2K14 A;  1RL2 A;  3I4O A;  1YJ9 A;  1D8L A;  1NY4 A;  3T1Y Q;  2NVT H;  2UU9 L;  3HOZ G;  1WI5 A;  3CC4 A;  1L2F A;  1UE6 A;  3D31 A;  4BXX H;  3GO5 A;  3CF5 A;  5BR8 L;  4OX9 Q;  5LMN L;  2WAQ E;  5M5X H;  1CKN B;  3B6Y A;  2JEB I;  1IL2 A;  1KC8 C;  1YBY A;  1K73 C;  3K7A H;  1S3O A;  3I2Z A;  1VQ8 A;  4DUY L;  4DR2 L;  4IPH A;  2F52 A;  3K80 C;  3A5U A;  3FKI H;  5DLQ E;  1KIX A;  2B63 G;  5FLX c;  3S16 H;  1KXL A;  2OQK A;  4UP8 A;  4GNX A;  3BU2 A;  3A74 A;  4LUO A;  2E5L L;  3AFQ A;  2UXC Q;  4KHZ A;  4P73 A;  4Y7N H;  2Q2U A;  4A3J G;  3PV0 A;  4A3E H; 
#chains in the Genus database with same CATH topology
 1STE A;  2KBN A;  3I73 A;  4JK1 C;  4X65 L;  1M90 C;  4EQP A;  2WV6 D;  4E6I A;  1EY7 A;  3NSW A;  4CDC C;  5M3F H;  1TWA H;  3VR4 A;  4B3R L;  1SE2 A;  4H13 C;  3D6W A;  4DNR B;  2ZJQ A;  1FGB D;  1WCM G;  1X3F A;  4CGY B;  1YVC A;  4B9W A;  2F0V A;  1A63 A;  2WAQ G;  3GQB A;  3SEB A;  5JJZ A;  5KEE A;  2JA8 B;  2HQE A;  1ZYR C;  5JJL A;  3LGJ A;  1D5M C;  3TQY A;  1QUQ A;  4OEL B;  4RMF A;  1OO9 B;  2AQ1 B;  1MSH A;  1LTB D;  4GOP B;  2M9V A;  2A6H C;  4KI0 A;  4C3I G;  3NTH A;  1EYC A;  3FEW X;  3ND8 A;  2L55 A;  1PYB A;  4CBV A;  2QGQ A;  1KAB A;  4JI6 L;  1JE5 A;  4CDE C;  4GKJ L;  4B3M Q;  1B53 A;  2ZXP A;  1CHQ D;  2QDB A;  5JEA G;  4A76 A;  3TP8 A;  2Z1C A;  2B2V C;  2Z9H A;  3NUC A;  4A4I A;  4L5Q A;  3OW7 A;  2KCC A;  4HJ7 A;  2JA7 H;  4IFD H;  2UUC L;  2CH4 A;  3S14 H;  4FP5 D;  1JC7 A;  1HH2 P;  1E24 A;  1IL8 A;  3DM3 A;  1YJN A;  3M4Q A;  1TWG H;  5K36 G;  1QJO A;  1I4Q A;  1SEB D;  4GOP C;  3N52 A;  3CRK C;  3CRL C;  1TWC B;  4DK1 A;  2HD3 A;  2UUB L;  1XPU A;  1RTO A;  3I70 A;  1HA6 A;  2QKI C;  5NUC A;  1TS2 A;  3DM1 A;  2F0P A;  2F0J A;  1PFN A;  1PFS A;  1FNW A;  2WB1 E;  1YIT A;  3QWN A;  3FVQ A;  4R4I A;  4AYB E;  5HGT A;  4BY1 H;  2OEO A;  3UDX A;  4ULL A;  4DNT B;  1JR0 D;  1QWY A;  2E74 C;  3KK7 A;  3S15 B;  5CV5 A;  1VQ7 A;  3NP8 A;  5C0X H;  3HOY B;  1YEZ A;  3E9H A;  1SJE D;  1LTR D;  3KDF B;  3OTO Q;  1AN8 A;  1E0B A;  2YU9 H;  4DK0 A;  1HUN A;  1PTO H;  3H15 A;  2Z6K C;  1YHA A;  1ASY A;  1XX8 A;  2DN8 A;  5EPL A;  2NN6 H;  4LF5 Q;  1IW7 C;  1EWH A;  5IWA Q;  2NWG A;  2EYM A;  4CKB A;  4L5R C;  1R9T B;  2WB1 G;  1Y1V H;  4JI4 L;  4AYB G;  1T5X D;  4XT3 B;  3HOW G;  1KLG D;  1JOO A;  2Z0S A;  3I90 A;  2JE6 I;  3H0G G;  1IHZ A;  1CSP A;  5M9O A;  3J7A 5;  1HA5 A;  3MTS A;  4KJN A;  4LFA Q;  2R93 B;  2JJQ A;  3PUY A;  2VXW A;  4FXK C;  1AH9 A;  4KTA A;  4JV5 L;  3HP3 A;  2BA0 A;  3M4O B;  2R92 B;  1JT8 A;  1YNN D;  1N9W A;  5E1F A;  3S17 B;  1CK1 A;  5M5W B;  4R8N A;  1QNU A;  2WIN B;  4XT1 B;  1EOV A;  4NMZ A;  4B3T L;  3NXW A;  2L9H A;  2FMM A;  3U58 A;  1S72 A;  1MSG A;  1HJP A;  2I46 A;  4G57 A;  1JJG A;  1ASZ A;  4G7H C;  2HIV A;  3I4M H;  3FDT A;  2VZA A;  4R4C A;  1Q81 C;  1WTO A;  5JPN C;  3HOZ B;  1V9P A;  2JA8 H;  3UE1 A;  1B3A A;  5ISR A;  3C2P A;  4OHJ A;  1HR0 W;  4QIW E;  1DOM A;  4R1J A;  1BDO A;  3VDY A;  3CP0 A;  1P8L A;  4LUV A;  1EWI A;  1M4V A;  4UP9 A;  1S5F D;  4DPG A;  4A3G G;  3PSI A;  4DR4 Q;  1TR5 A;  4YHH Q;  5D3I B;  3CC2 A;  4RCN A;  4AQY Q;  3PUZ A;  4DXF A;  2UXC L;  2F0U A;  2VNU D;  2D0P A;  5COR A;  4JI2 Q;  2IY5 B;  5FK9 C;  2XN9 C;  5IGE A;  4ILW A;  5FOB B;  4X3T A;  3ERO A;  4MHE A;  2HT1 A;  4A3J H;  2KUM A;  3A56 A;  2F4V Q;  1ET6 A;  4BXX G;  1B2T A;  5LMU Q;  2A74 C;  1OXU A;  1WCM B;  3DWA A;  1WTQ A;  3A55 A;  1SN8 A;  1HNX L;  4R8I A;  4WOR A;  2B2V A;  1Z47 A;  1IBM L;  4IUN A;  2WAQ B;  5BR8 Q;  1VQH A;  2A5H A;  4LUZ A;  4DR1 Q;  2F3W A;  1OXS C;  2XTI A;  2A6E C;  1TWC H;  2MFI A;  2KOL A;  3T53 B;  4DUY Q;  2VB2 X;  3DMU A;  3HRZ C;  2K5H A;  4IUR A;  3S1M B;  2PYK A;  4GOP A;  2CWP A;  1CQV A;  2IL8 A;  2B8F A;  5EGT A;  4XDX A;  5IYC H;  1Y8N B;  1HHV A;  4LFB L;  1VQK A;  2L0C A;  1LT3 D;  4YWL A;  1N8R C;  3I56 A;  3W1G A;  3BYT B;  1GUN A;  2IX1 A;  2CVR A;  4YY3 L;  1K28 A;  4FF3 A;  1UEB A;  3KBG A;  3OYY A;  4LNQ A;  2DUD A;  2JXM B;  1A15 A;  3Q6S A;  3M7N A;  1K83 B;  1PH9 A;  4K8J A;  1UWV A;  5ELF A;  3D0F A;  1EQQ A;  2E2H B;  1SYC A;  1PYS B;  5KNB A;  5IT9 L;  3T1H Q;  2Z6K A;  1PFM A;  1C9O A;  1UEA B;  2DNE A;  3D4D A;  1X9N A;  2PPB C;  4A3I H;  2R3Z A;  1A62 A;  2AKW B;  4JPB W;  4N8X 1;  1L0W A;  1JWS D;  1XMO Q;  1HCZ A;  1JQY D;  3KFU A;  3GTL B;  2RHQ B;  1K3R A;  1Q12 A;  1UE7 A;  1KD1 C;  3A8J E;  1I6H B;  1SNC A;  3BZD B;  2WII B;  2R93 H;  1JOR A;  3ERQ A;  4IPC A;  4JI7 Q;  4FNF A;  3VA5 A;  4RGM A;  5IP9 H;  5C4Z A;  2JA7 G;  4LFC L;  3M4O H;  1SYE A;  3KDF A;  5I2X A;  3QOL A;  1DGS A;  3NBI A;  3E6Z X;  3S17 H;  1PH2 A;  1GO3 E;  5M5W H;  3VA7 A;  2KHJ A;  5T1I A;  2M2L A;  3SK5 A;  3M9B A;  5ELE A;  4OON A;  1O7Y A;  3MXU A;  1SE3 A;  2K28 A;  1CUK A;  5CBE E;  4BY1 G;  2F3I A;  1I4R A;  1LTS D;  1VQG A;  3O13 A;  1VMC A;  3KLW A;  2IHF A;  4GN4 B;  2WB1 B;  4ZCK A;  2K5Q A;  1W6J A;  4AYB B;  5C0X G;  4PG3 A;  2G9D A;  3D4W A;  2BE5 C;  4HSP A;  1XNR Q;  1BVS A;  1SJH D;  3TEH B;  2A69 D;  2AQ2 B;  1LYL A;  5KYL A;  3TP7 A;  5IOC A;  4K2K A;  1LTT D;  1ROD A;  3UE0 A;  1RHP A;  2IW3 A;  2R6G A;  4DV1 Q;  1PRT D;  4H44 C;  1E22 A;  1PH4 A;  4CJ2 C;  1GD7 A;  2RA4 A;  1A3V A;  5IYD H;  1C7Y A;  2NN6 G;  4U68 A;  1SSO A;  3CPW A;  3W3A A;  4DV0 L;  3RZO B;  3TSS A;  4C2M B;  1HFN A;  1MBY A;  2VS1 A;  2ES2 A;  3GTK B;  1K8A C;  4OIJ A;  2K7V A;  4PMW A;  3MXP A;  4GLA C;  4QF4 A;  3CC7 A;  4JC0 A;  2FIN B;  2NZ1 D;  4HJ8 A;  1XNQ Q;  1QVF A;  4JG2 A;  3GTO H;  3CCV A;  2EJF C;  1H9M A;  2AHO B;  2IPK D;  5DEH A;  4TRD A;  2LMC B;  3MVV A;  1S5D D;  5FO9 B;  4A3F B;  2RSO A;  2QEJ C;  5ELN A;  3K5O A;  5DNF A;  5KNC A;  4DUZ L;  4KKU A;  2RKS A;  4LMQ D;  5D65 A;  5FJ8 H;  3RUZ A;  4EQN A;  1EQT A;  3I3C A;  1XMQ L;  4JI3 L;  3F8T A;  4C3I H;  3ZJY C;  2NYZ D;  3OWE B;  2B2Y C;  4JI1 Q;  3U9O A;  2ZTD A;  1ZXT A;  2I5L X;  1TQO A;  1HZC A;  1YNJ D;  2KEC A;  4RA8 A;  2VQF L;  3EBE A;  3NBH B;  1F2L A;  2OCE A;  5FLX L;  3CU7 A;  5HY6 A;  2F0L A;  2FFK B;  5GQO A;  5M5X B;  2K03 A;  3PCO B;  4P74 A;  4IFD I;  4DAV A;  1DD2 A;  4FXG C;  3U9S A;  4HSV A;  3CF5 A;  4OX9 Q;  5LMN L;  5K36 H;  1CKN B;  3B6Y A;  4QIW B;  4ZYS A;  3C3L A;  1KC8 C;  1YBY A;  1K73 C;  1G91 A;  3T56 B;  1AZP A;  1F2Y A;  3AB9 A;  5FO7 B;  3A5U A;  2B63 G;  1QB5 D;  1WTR A;  1KIX A;  1B44 D;  1KXL A;  1PZJ D;  2HCC A;  2PCF B;  3J7Y W;  1BXT A;  3WOF A;  3P20 A;  2E5L L;  4N9T A;  1NCV A;  1WD0 A;  2F4I A;  1TWA B;  5M3F B;  4A3J G;  3OHX C;  3H3V C;  1OTC A;  4F8M A;  2LXJ A;  4WJW A;  1EYG A;  4JOI C;  1EUJ A;  2HQL A;  1CT1 D;  1TT2 A;  2SOB A;  1I94 L;  2ZXR A;  2RVL A;  1IBL L;  4G7Z C;  1JCK B;  4JCV E;  1LT4 D;  1PZK D;  2IHE A;  3STB C;  3SVM A;  1I4H A;  4ZUJ A;  2QEX A;  1A3T A;  2FHT A;  2H4O A;  1ESF A;  2VQE L;  2XSC A;  4DV4 L;  4NXM Q;  4QCL A;  1WTH A;  4X64 Q;  3QIA A;  1N36 L;  5I4D A;  4HN7 A;  3HZX A;  4RAU C;  4KKT A;  1BBX C;  3DHQ A;  3P7J A;  3T16 A;  3SDZ A;  1S5B D;  2F0E A;  1Y1W H;  1SYB A;  1J5E L;  3T1Y L;  1KRS A;  4OO1 I;  2JA9 A;  3HOW H;  4F88 A;  3ONA B;  1ZEQ X;  3H0G H;  2QIL A;  1FJG Q;  1NE3 A;  1PH7 A;  3G6E A;  4DV6 L;  1XTC D;  4KHP Q;  1F9S A;  2JA7 B;  1HNW L;  1E7Z A;  3S14 B;  3PIP A;  2R7Z H;  5C4H A;  1XXG A;  1SMX A;  1TWG B;  1STG A;  1NUC A;  3D6C A;  1HZA A;  2K04 A;  3W1B A;  1VQ5 A;  3X3M A;  3SR1 A;  1VQN A;  2V4D A;  3M4Y A;  3SK8 A;  3ICE A;  3MFG A;  3FPP A;  4KLK A;  3P75 A;  1G8Z D;  4ZRZ A;  1RCV D;  2CQA A;  3SHL A;  1VQI A;  3A54 A;  4BY1 B;  1RJT A;  1TS3 A;  5C44 H;  5LL6 X;  1ENC A;  4HIO A;  2K32 A;  2PNR C;  2NZH A;  5BN3 A;  5IP9 G;  4DR6 Q;  2AWN A;  1N33 L;  1YNX A;  1U4M A;  4LF8 Q;  1SYG A;  1VCI A;  2HHH Q;  1EY4 A;  4GKK L;  4GN3 B;  5IY0 A;  4KMU C;  3URY A;  2YU9 B;  5CV6 A;  4A3G H;  1EU3 A;  1PTO B;  2WP8 J;  2OF1 A;  1A3U A;  4ZLT F;  2EIF A;  1VQO A;  2F0H A;  1SE4 A;  2OQ0 A;  2PI2 E;  2VB3 X;  3DWP A;  4RHR A;  2B2T C;  5G3L D;  3OPO A;  2EYJ A;  1D1K A;  1EOT A;  1H9J A;  1G29 1;  2CW0 D;  2IX0 A;  3NWS A;  1W2B A;  2B2Y A;  1B9M A;  1H9R A;  3H3V H;  1V43 A;  1Y1V B;  2XGT A;  4OWT B;  2E8G A;  3SGI A;  3F2B A;  2Z4I A;  3CKI B;  1D7Q A;  3F2D A;  2D2C C;  4DR7 L;  2EJM A;  3R8B A;  4BS9 A;  1K3B C;  1KTK A;  1EIG A;  1WOC A;  2ENB A;  1PTO C;  4P71 A;  4DR3 Q;  2KCT A;  4DV5 Q;  2EXZ A;  4A3K G;  3G6J B;  3PO2 G;  2D62 A;  3JAM L;  1TXY A;  4X3S A;  5HGQ A;  5IYD G;  3MHB A;  1JWM D;  4IUV A;  3BZC A;  3PUV A;  1H9K A;  2N78 A;  4LF9 L;  5FKA C;  3H94 A;  1RDP D;  4ZKC B;  3NWT A;  3I4M B;  1M8A A;  3NBH A;  3WWV A;  2K05 A;  3K5N A;  1NJI C;  1H9S B;  1SFO H;  3A8K E;  4L5S A;  1TWF H;  1QZH A;  3V96 A;  4JOI A;  2K4K A;  1RF2 D;  3AMU A;  3I4N H;  1SMY D;  3MFY A;  4A93 H;  4DA2 A;  4JYA L;  2O4X A;  3S1N H;  2XVS A;  2WFW A;  1CKN A;  3IRB A;  1N34 Q;  5FJ8 G;  5TSS A;  3QJY A;  3Q24 A;  3CCS A;  1PTO F;  1MJE A;  2FXQ A;  3FHW A;  2O5I C;  2EYF A;  1JE4 A;  5C4J H;  5C3E G;  5HUR A;  4ZQ3 A;  2HCI A;  2N3S A;  1V1O A;  1YZ6 A;  4HJ5 A;  4G4K A;  4POG A;  4EGV A;  2QF7 A;  3HGB A;  4XQN A;  3AEV A;  4A3J B;  3GP7 A;  3PF4 A;  4DV3 L;  3KLS X;  3E5S A;  2B2U C;  4C3H H;  1HZ9 A;  3GTG H;  4DR5 L;  3TP5 A;  3GTQ H;  5I6Y A;  2FMC A;  1SNM A;  1EIF A;  4DK3 C;  1PLF A;  4LF7 Q;  2UXD L;  5AFW A;  1IYJ B;  2A68 D;  2CQO A;  1Q46 A;  2F0Q A;  3GV3 A;  4KN7 C;  4B3S L;  4CDF C;  4BA1 I;  4LK1 C;  2VUM G;  4A3B H;  4C3J H;  4ZUI A;  1Z7T A;  4DN4 M;  4BBR G;  1UNS A;  4PZ6 A;  2BDO A;  2RHS B;  3J80 i;  5C5L A;  4JI5 L;  3R93 A;  5EJW A;  3GTM H;  2O5J C;  4GNX B;  2K5V A;  2A1A A;  5GAE C;  4X65 Q;  3BDO A;  3CCJ A;  3HOU H;  1EEF D;  4AH6 A;  3G71 A;  1GHK A;  1EQV A;  4YCW A;  3S2H H;  2ASB A;  3J80 c;  4YHH L;  4B3R Q;  5DM6 3;  4IZ8 A;  1QZG A;  5EKI A;  2KJX A;  1JOK A;  4MIU A;  1ET9 A;  2B39 A;  4K0K L;  1O7Z A;  3T4A C;  1X3G A;  2ICI A;  1UUP A;  1WJJ A;  3CCU A;  1S5E D;  1QNK A;  1Y1W G;  5EBC A;  3S24 A;  5CV8 A;  2NVT B;  4A3I B;  4X66 L;  1YJW A;  1X56 A;  2HDL A;  4GNX C;  4P2C B;  1BCP D;  1AE2 A;  3K7A B;  4JVZ A;  3GTP H;  3J81 L;  1G2S A;  1NBW A;  5E4W C;  3L7Z C;  4B08 A;  2RQX A;  5FLM G;  4DR1 L;  1O7L A;  1HNZ L;  1GHJ A;  4BBS H;  5EQ0 A;  2R7Z G;  1JB7 A;  2JA6 H;  1BO0 A;  1CKO A;  1I4G A;  2IWH A;  1YNN C;  1C4Q A;  1QE6 A;  4PQX A;  3NHH A;  3I91 A;  5M3M G;  2Z6B A;  4OL7 A;  3HKS A;  4JI6 Q;  4CKC A;  3CAM A;  4CJ0 B;  4GKJ Q;  1MJC A;  2K33 A;  5AJ3 Q;  3CCQ A;  1STN A;  3A8I E;  4ZAI A;  5IT9 E;  1WYD A;  2LKV A;  1BBU A;  5ELC A;  1FNV A;  1HZB A;  1MGS A;  3AFP A;  4TQU S;  2UUC Q;  2MQH A;  4ZK9 B;  4HID A;  3T51 B;  2UUA L;  4QB4 A;  4A3D H;  5C44 G;  4YIJ A;  3OWF A;  4YWK A;  4RKL A;  1VMP A;  2GVB A;  1JIC A;  2EY5 A;  4CKE A;  3KF6 B;  3A7L A;  1Z9F A;  2K01 A;  1QG7 A;  2F0N A;  1PXU A;  2BH8 A;  2J4X A;  3S2D H;  2Q2I A;  2B2W C;  4K8I A;  4A3K B;  2EVB A;  4PZ7 A;  3PO2 B;  4JI0 L;  2BA1 A;  3G7L A;  4HAE A;  2B63 H;  1AZQ A;  4EQO A;  1EY9 A;  3E3X A;  1W6K A;  2YTX A;  3OOC A;  5E3F A;  4HR7 B;  4NXN L;  1Y8P B;  2ZM6 L;  3CME A;  4RGO S;  2F0G A;  3HOX H;  4DNI A;  3VR6 A;  1K0R A;  1R4Q B;  5I2Y A;  1H9S A;  1NNX A;  3UDI A;  2B8G A;  1STH A;  1Q1E A;  2EYL A;  1ICW A;  3GTJ H;  2UU9 Q;  4M8A A;  2F0K A;  3GTO B;  4YWM A;  1S40 A;  5GRO A;  1EFW A;  1IYV A;  2EY6 A;  1KRT A;  2EPB A;  4JI4 Q;  3RR5 A;  2XIW A;  3HFZ B;  3CXC A;  3ND9 A;  3FMC A;  2PNH A;  4R4O A;  5I9P A;  2JK8 A;  2BDN A;  2OWO A;  4KJO A;  3K0Y A;  5A2Q L;  1VF7 A;  4C3I B;  2RBM A;  5D3D A;  4GLX A;  4GS3 A;  4JV5 Q;  4RCO A;  3PUX A;  4HMI A;  2HIX A;  1STA A;  2X6G A;  4UHV A;  4YCU A;  3K59 A;  1HR0 L;  3EQL C;  3MC0 B;  2R61 A;  3S1Q H;  5EKK A;  4PV1 C;  1ICF B;  2CKZ B;  3J80 E;  4B3T Q;  1MHW C;  3I4N G;  4A93 G;  1SND A;  2I5M X;  4WRD A;  5M5Y B;  1D1I A;  3K7U C;  1K0S A;  3CCR A;  1C0A A;  2PW7 A;  4LWC A;  2RCF A;  4K5X A;  1DOL A;  1Y14 B;  4NB3 A;  5J39 A;  4YCV A;  4O0A A;  2EYP A;  1L0X B;  1D8L A;  2EDG A;  2NVT H;  3CC4 A;  1GUT A;  1L2F A;  3ZYY X;  3GO5 A;  5A35 A;  4DXG A;  2L12 A;  1STB A;  2WKD A;  1IL2 A;  2JEB I;  1RTN A;  4XYQ A;  2VUM B;  1U4P A;  3K7A H;  4ID6 A;  3K5M A;  3I2Z A;  4DR2 L;  3IAY A;  4IPH A;  2AQ3 B;  5DLQ E;  2KQ3 A;  3S16 H;  1IKM A;  4GNX A;  4C3H G;  1CZW A;  3TZU A;  4LUO A;  3QB3 A;  3BS1 A;  4NW2 A;  2UXC Q;  4KHZ A;  4S3S A;  3PV0 A;  4A3E H;  1I6V C;  1P16 A;  1UAP A;  4ALP A;  1XPO A;  1ILQ A;  3MAQ A;  5J3B A;  1V1P B;  1X65 A;  2R7D A;  3NEN A;  4IPG A;  5C3X A;  3R3O A;  4BY7 G;  4LAA A;  1I3Q H;  4DV7 Q;  1K9M C;  1PRT B;  1VQD A;  4A3B G;  1C8C A;  1F2M A;  1Q1B A;  4C3J G;  1HNX Q;  2A19 A;  2G9H D;  1IBM Q;  1Y1W B;  3NQI A;  1EZ8 A;  4LF4 Q;  1LT6 D;  3G4S A;  2XRS D;  2I5H A;  4RFB A;  2PZT A;  3HOW B;  2VL6 A;  2UXB L;  2NVX H;  3H0G B;  1PH1 A;  3AQQ A;  3HOU G;  1MI2 A;  4DGZ A;  2A69 C;  1R4P B;  3NTK A;  1Q3L A;  3RD4 A;  4A3K H;  4LFB Q;  4OWX B;  3PO2 H;  2R7Z B;  4BWG B;  1QIL A;  4J15 A;  4X62 L;  4F87 A;  4F7X A;  1CA6 A;  1PRT C;  2BE5 D;  1Q7Y C;  2B2W A;  4YY3 Q;  1FL0 A;  2ALY B;  1KHI A;  3A7A B;  3S9W A;  4LF6 L;  4DF7 A;  2QCP X;  2F0F A;  3ER0 A;  4UDU C;  2F0S A;  1CSQ A;  1EFI D;  1FVI A;  2K5D A;  2DY8 A;  2E2I H;  4IFD J;  2LY7 A;  2OTL A;  1EIH A;  4JBW A;  4L63 B;  3VYS A;  1SRU A;  5IGD A;  2XWB B;  3BJU A;  3ULL A;  4XYO A;  1VDZ A;  5C44 B;  3GDE A;  1NSN S;  3KF6 A;  5LMN W;  2AUK A;  5CR3 A;  2E2J H;  2EQS A;  1WD1 A;  1Z6H A;  4BBS G;  3KJP A;  3QG1 A;  2JA6 G;  1EZ6 A;  4FVM A;  1FD7 D;  2EOT A;  3IFT A;  4Q0F A;  3FKI G;  4OO1 G;  1HQR D;  5JJK A;  4A3G B;  1TVX A;  3WOE A;  1HUM A;  5I6W A;  5C3E H;  5IGF A;  1TS5 A;  4KV6 A;  2KVM A;  4NPS A;  4KD4 A;  1PRT F;  3ERS X;  2PI2 A;  4LFC Q;  3ITP A;  4FF2 A;  4DV2 Q;  4JI8 L;  1GJX A;  1B3Q A;  1WTP A;  3HKZ G;  4A3D G;  4I7Z C;  1V8Q A;  3RZD H;  1YNJ C;  4XQQ A;  1EU4 A;  3TS0 A;  1K8G A;  1F2Z A;  4RG1 A;  3M3Y H;  2NVY H;  3K0X A;  4XTC S;  4KN4 C;  4RGT A;  1PDQ A;  1LLR D;  4KY7 A;  2YTY A;  2HUG A;  2L15 A;  5CBA E;  1X54 A;  5CV4 A;  4EX5 A;  4IOC A;  1CA5 A;  5EPJ A;  1NTG A;  4X3U A;  3PO3 G;  2LSS A;  1NAP A;  1MKH A;  1EQR A;  3VYU A;  1GUW A;  1O80 A;  3SK6 A;  1LTA D;  4PZ8 A;  4QMG A;  1TY2 A;  3E0J A;  4ABN A;  2VUM H;  3Q8D A;  1SNP A;  1II3 A;  4BBR H;  3H6M A;  3HOX G;  4ODG A;  3QR8 A;  5GAH C;  5IYB G;  1XPR A;  2KEN A;  3V05 A;  3J81 i;  2KED A;  1IBK L;  5C0X I;  2NBF A;  2Z8L A;  4QL5 A;  4LF8 L;  1SFO B;  2HHH L;  1HRJ A;  1PH6 A;  1CFM A;  1TWF B;  2ZTC A;  4RWS C;  2PW5 A;  2M00 A;  4DV0 Q;  2WKC A;  3KLS A;  3I4N B;  4A93 B;  1TU2 B;  4DAP A;  3CCE A;  3S1N B;  1EY5 A;  1VQM A;  3KYH C;  3HS0 C;  5GAD C;  3MEH A;  4O2D A;  5C4J B;  2NN6 I;  2JEA I;  2PO4 A;  5ELO A;  2PZW A;  4FXD A;  3Q23 A;  1PHJ A;  2AWO A;  4J6H A;  5KND A;  2OT2 A;  5CYU A;  4DUZ Q;  1X32 A;  1NMF A;  2JYO A;  3TME A;  3BVG A;  1EIY B;  1XMQ Q;  1RIP A;  1DON A;  1DOK A;  2F0D A;  2QDL A;  3DEP A;  4C3H B;  5C3W A;  5FLM H;  4DR3 L;  4JI3 Q;  3GTG B;  2GVA A;  3GTQ B;  1SDF A;  2QA4 A;  4HIM A;  4MTK A;  4M1U B;  1V1P A;  1I50 H;  5M3M H;  1SRO A;  4JW0 A;  1A6X A;  3D4R A;  1LT5 D;  1N32 Q;  4L8J A;  2PQE A;  2VQF Q;  1STY A;  4H0L C;  2OXP A;  1GUS A;  3ULJ A;  2EY2 A;  1J6Q A;  1LTI D;  5IE8 A;  3VR3 A;  1G51 A;  4APV A;  4A3B B;  2EE1 A;  4C3J B;  1HTL D;  3A5Z B;  1PZI D;  5LMN Q;  1SNO A;  4DAY B;  1J8I A;  1TWH H;  1B7Y B;  1AE3 A;  3GTM B;  2YV5 A;  1NMG A;  4A3E G;  3WDN A;  1VQB A;  3HOU B;  1ZKO A;  3EJI A;  3S2H B;  4IPD A;  5JAV A;  4TSS A;  1VQP A;  4L6T B;  2N88 A;  5D14 A;  2A8V A;  3LX0 A;  4R4T A;  1D6E C;  1OXV A;  3KOJ A;  1ONL A;  3OW2 A;  1TKW B;  2R92 G;  1LUZ A;  1I94 Q;  3DEO A;  4EVO A;  4B3M L;  3K57 A;  2CFM A;  2F0O A;  2R7F A;  4UY8 C;  2CW0 C;  4TKO B;  2PMZ B;  1QVG A;  2ZTE A;  5IIF A;  2I07 B;  2F3V A;  3I4L A;  1V1Q A;  2VQE Q;  4DV4 Q;  3CCM A;  4C1N I;  1N36 Q;  3GTP B;  3Q22 A;  2YYZ A;  1PH5 A;  4QUF A;  4WFN 3;  1KNE A;  4K6L A;  3EVQ A;  1X3Q A;  2NB0 A;  3E9I A;  4BBS B;  3D3R A;  1J5E Q;  2JA6 B;  1GM5 A;  2O2L D;  3BDL A;  1LM0 A;  1OXT A;  1WTX A;  1B9N A;  2E2D C;  1I4P A;  1VQF A;  4DV6 Q;  5IT9 c;  1E2W A;  1HNW Q;  1AEX A;  4KK7 A;  5G3L F;  2SDF A;  1O7I A;  1FNU A;  1D2B A;  1KAW A;  4GN5 A;  3HKZ B;  1SBB B;  4A3D B;  1NR4 A;  4GLV B;  1ENA A;  2ICE C;  3OTO L;  1BUV T;  3BVM A;  3J81 E;  1A2T A;  1SMY C;  2JN4 A;  2SNM A;  3RLN A;  2MNA A;  5C4X H;  1VQE A;  4A3L H;  4A3M H;  2JA5 H;  4OEM B;  4LF5 L;  3PIO 3;  2MUY A;  3S2D B;  1CKM A;  5IWA L;  3PF5 A;  3PO3 B;  2TSS A;  4QJF A;  1SE8 A;  2B63 B;  2EYH A;  1ZYR D;  5E7N A;  5DM7 3;  1N33 Q;  2MJ8 A;  3TBI B;  4WJ4 A;  1TII D;  4GKK Q;  3MWY W;  4IJL A;  4LFA L;  3K5L A;  3HOX B;  3C46 A;  1CTM A;  2A6H D;  1CQF A;  2BH2 A;  5CC4 A;  4JBM A;  1PV4 A;  1GXD C;  3TDQ A;  3GTJ B;  3BDC A;  1HFG A;  1EEI D;  3PQI A;  2H1E A;  3CPF A;  5IGG A;  2XRQ D;  4K2L A;  3LWE A;  5AJ3 L;  1PVO A;  1UE5 A;  4BY7 H;  2A68 C;  3KLR A;  3PIO A;  1DZ1 A;  4DR7 Q;  1GUG A;  2RDF A;  2PZU A;  4HIK A;  1CZG A;  3MZ5 A;  1HQM C;  3QO2 A;  2NVQ H;  2F0M A;  2KCN A;  4HCE A;  1U9R A;  3K81 C;  3NEM A;  4MNO A;  3VYR A;  1JJC B;  1XWE A;  3S1R H;  3VYT A;  3CCL A;  4Y52 H;  1U5K A;  1T9H A;  5ELD A;  2KA7 A;  3S1Q B;  2A73 B;  1BCP B;  3K58 A;  4RKB A;  1K8M A;  3L3O C;  4X6A H;  4NP5 A;  5EAY A;  2AMC B;  4DR4 L;  4IUU A;  3I55 A;  4LF9 Q;  1X6O A;  3L2P A;  4AQY L;  2DJG C;  2D0O A;  3IL8 A;  3OSO A;  5C5M A;  5F2D A;  4JI2 L;  5J22 A;  3F2U A;  4UAI A;  3OMC A;  1LV9 A;  5JVH 3;  3MEF A;  1GOZ A;  4HMJ A;  2B2T A;  2MPM A;  5JEA J;  5E4X A;  1KLU D;  2G5D A;  1XTD A;  2K5W A;  3W5O A;  5LMU L;  2F4V L;  2KEE A;  1X55 A;  5A2Q E;  2N8N A;  1JMC A;  1JB3 A;  3MXG A;  4JYA Q;  1W3S A;  2K14 A;  1RL2 A;  3I4O A;  3FPU B;  4DAY A;  2UU9 L;  1BCP C;  1S5C D;  1WI5 A;  3HEJ A;  4HTH A;  3S16 B;  4KKS A;  1EY6 A;  1GUO A;  1IW7 D;  5BR8 L;  5EKL A;  4N8F A;  1RD9 D;  3HG9 A;  1VQ8 A;  4R9W A;  4DUY L;  1J9O A;  3FKI H;  4A3E B;  4OO1 H;  5FLX c;  3Q0A A;  3A74 A;  1LO5 D;  3OMG A;  4P73 A;  1I4X A;  4Y7N H;  3P1H A;  2Q2U A;  3L9A X;  3F2C A;  4DV3 Q;  1I3Q B;  3CQZ B;  3SE0 A;  1VQ4 A;  1SXT A;  2WAC A;  2C9O A;  4DR5 Q;  1Q90 A;  3HOV G;  2RCN A;  2V1C C;  3G48 A;  2NZO A;  2ATW A;  3EIV A;  1WTV A;  4QUC A;  4RGN A;  2UXD Q;  2UUB Q;  2Q8I B;  1Y69 U;  4A3C G;  2NVX B;  5JOB A;  4RH6 A;  1BCP F;  2ZJR A;  4B3S Q;  5IGB A;  3TN2 A;  1G6Z A;  2MO1 A;  4XIG S;  1B8A A;  3T1H L;  1SLJ A;  3PO3 H;  4DU9 A;  3DUZ A;  3TS2 A;  1JOQ A;  1C48 A;  1S4Z A;  3RLO A;  1LTL A;  2IX3 A;  5JPM C;  1BBW A;  3NE5 B;  4H02 A;  4JI5 Q;  4A3F G;  1TS4 A;  4IUP A;  4IUT A;  1XMO L;  2I0Q A;  1BQQ T;  1U0L A;  4JBJ A;  2JSO A;  1ILP A;  1BR9 A;  5IYB H;  5IGC A;  4JI7 L;  2F0I A;  2E2I B;  2XNA C;  2L4N A;  3L0O A;  2FJ2 A;  3DLL A;  2JQO A;  2ZT9 C;  4K6D A;  3TRZ A;  3NK9 A;  3N6R A;  2B2U A;  4O42 A;  4K0K Q;  3I72 A;  2E2J B;  4HJA A;  1IXR A;  1KDA A;  1EYA A;  2LXK A;  3RLF A;  4V19 0;  2E76 C;  3KF8 B;  4Z9C B;  3NTI A;  4NDX A;  3ULP A;  1VQJ A;  4X66 Q;  1XJV A;  1KQS A;  2KCM A;  3SK4 A;  1KL9 A;  1Y8O B;  2B3G A;  4DV7 L;  1D5X C;  1G6P A;  1O78 A;  5C3E B;  1BNZ A;  2KHI A;  1Q8I A;  4OWW B;  1AFP A;  2RF4 A;  1CHP D;  5CMD A;  5ELB A;  2A6E D;  4LF4 L;  4XQJ A;  1HNZ Q;  2IJ0 A;  5L37 A;  3VR2 A;  4IAL A;  5LL6 S;  5T1G A;  2DGY A;  4I7A A;  2LFN A;  3X3N A;  1XNR L;  3RZD B;  3K6O A;  2ZXO A;  1M1K C;  2C35 B;  2VY3 A;  3MXN B;  3M3Y B;  2XWJ B;  4NKL A;  2NVY B;  3IFD A;  5M3F G;  3JC6 6;  1EY8 A;  2PQA B;  3FP9 A;  1VQL A;  2B29 A;  4DV1 L;  4FO2 A;  5C4X G;  2X69 A;  4A3L G;  5I9O A;  5GAG C;  3S15 H;  3IKJ A;  3PUW A;  4A3M G;  2JA5 G;  5COY A;  3HOY H;  4HED A;  2P5Z X;  2UUA Q;  2L5T A;  5CV9 A;  2CHB D;  5IP7 H;  1E1T A;  2BCO A;  4AIM A;  1Q86 C;  1ML0 D;  5IOD A;  4DFA A;  5J1Z A;  2AUJ D;  2LS0 1;  1L1O B;  4BBR B;  3I7F A;  1XNQ L;  1QVC A;  2TMP A;  2CH4 W;  4MN3 A;  4IQZ A;  2K75 A;  1A8V A;  3MA2 B;  2NTS A;  1JJ2 A;  4JI0 Q;  5FLX E;  5KRU A;  1YIJ A;  1E2V A;  3UI2 A;  1R9T H;  1B50 A;  1Q8K A;  2F1M A;  5JJI A;  3RNU A;  1Q82 C;  3JAM i;  4NXN Q;  4OXP A;  2ZM6 Q;  3U50 C;  4ZKB B;  1AP0 A;  4DAM A;  2EXD A;  3AU7 A;  3M7G A;  1DYQ A;  4XXE A;  2Q8R E;  3C1F A;  3CQZ H;  1EL0 A;  4JI1 L;  4IFD G;  1B1Z A;  2R92 H;  2PMZ E;  4V0B A;  4DV2 L;  1L1O C;  4PNY A;  1PFB A;  3JAM c;  1B70 B;  1KAA A;  5C6A A;  1HTP A;  3GD7 A;  2JP1 A;  1LAC A;  3H3V I;  1E3P A;  2DNC A;  4KY5 A;  1U4L A;  1E2Z A;  2YTV A;  4KD3 A;  2F0W A;  1KDC A;  4CJ1 B;  3H91 A;  2Y0S E;  4JBK A;  1L0Y B;  1U4R A;  2H5X A;  4OX9 L;  1SNQ A;  1PYW D;  1IYU A;  3J7A V;  3R2T A;  1WTW A;  3HOZ H;  4P72 A;  3J81 j;  1I5F A;  2CCZ A;  1EWC A;  1I50 B;  5M3M B;  1SAP A;  4KHV A;  4IOA A;  1RKN A;  3EA6 A;  3E0E A;  3QOJ A;  1HR0 Q;  2Q2T A;  5CGK A;  3C1E A;  3HKZ E;  1ENF A;  1WFQ A;  5KYI A;  5FO8 B;  3F1Z A;  4U67 3;  3RMH A;  3TRE A;  3HOV B;  1YHQ A;  1YHB A;  3H09 A;  1VF5 C;  2OTJ A;  1PH3 A;  5KGU A;  3J7A F;  3CD6 A;  1TWH B;  4MZ9 A;  2EY1 A;  2Q2H A;  2Y0S G;  4Q5V A;  4NXM L;  4X64 L;  1Y1V G;  1D5Z C;  1WCM H;  5EBD A;  4UP7 A;  1F9R A;  2C5C A;  4IO9 A;  1SYD A;  4MTN A;  3J80 L;  2DJF C;  2D9U A;  4TVA B;  3UDF A;  4DR2 Q;  3U4Z A;  1SR3 A;  1OXX K;  2K50 A;  1YI2 A;  2N49 A;  3BYY B;  1JWU D;  5H1S E;  5C0X J;  4I65 A;  3M85 A;  1UE1 A;  2X6L A;  2RSN A;  4ME3 A;  4HCS A;  4P75 A;  4PMB A;  1FJG L;  4HJ9 A;  3S1M H;  2J0T D;  3KBX A;  4KHP L;  1BF4 A;  2DY7 A;  1XYI A;  2HDM A;  3I4M G;  1H95 A;  3KF8 A;  3KJO A;  3PGZ A;  2K6A A;  4BA2 I;  3KUP A;  1N32 L;  4C56 C;  3CMA A;  4J8Q A;  5JEA H;  2MO0 A;  2CWA A;  2JA8 G;  1K83 H;  2Q8T A;  4WJ3 M;  2NTT A;  2UXB Q;  2K1B A;  4KY6 A;  1ESR A;  1NR2 A;  2QW7 A;  2E2H H;  3FRP B;  3V2T A;  2E75 C;  4C1N K;  3NEL A;  1GKH A;  3BVZ A;  3EFX D;  4PMC A;  1CM9 A;  3UDG A;  1QUQ B;  4POF A;  2ZJP A;  1DXM A;  4DR6 L;  1TY0 A;  3BG3 A;  1A2U A;  4K5W A;  3SXH A;  4X62 Q;  4FF4 A;  3MXN A;  1F9Q A;  2K5N A;  3J7Z C;  1FGU A;  4QGU A;  2PQA A;  3AYH B;  1QCB D;  5KIX A;  4LF6 Q;  4A75 A;  3GTL H;  1CI3 M;  3NQT A;  5M5Y H;  1I6H H;  4R4Q A;  3J81 c;  1LTG D;  1SYF A;  3DWQ A;  5C4X B;  3W2D A;  1G2T A;  1DCZ A;  1IZ6 A;  1MIU A;  4A3M B;  3JAM E;  2JA5 B;  1VS0 A;  4IN3 A;  1LAB A;  3U4V A;  5LHY 1;  3OIP A;  3PIP 3;  2SEB D;  3STB D;  4X3K A;  3DXJ C;  1L1O A;  2MP1 A;  4UPA A;  3T13 A;  3R2I A;  3PMF A;  3M4P A;  1X3E A;  2GN5 A;  1KDB A;  2D5D A;  2N55 A;  1GVP A;  5IYC G;  4OIK A;  4DK6 C;  4CHT B;  5BN5 A;  5K5P A;  4DV5 L;  4FF1 A;  5JVG 3;  1K8O A;  2EJG C;  1VQ9 A;  1IKL A;  5CV7 A;  3K8A A;  4JI8 Q;  3HOY G;  1B4O A;  1PH8 A;  1VQ6 A;  5BN4 A;  4H7B A;  4DKA C;  3GV6 A;  1EYD A;  1VQC A;  5IP7 G;  3RN2 A;  4BY7 B;  3RN5 A;  1BKB A;  1FR3 A;  1DM0 B;  3HOV H;  1DJR D;  4N9P A;  2NUC A;  1E1O A;  2SNS A;  2NVQ B;  2Z4H A;  4FDB A;  2IT1 A;  4LW1 A;  4QY7 A;  4CDD C;  2MHV A;  3OIQ A;  3RZO H;  4C2M H;  1F9P A;  4A3C H;  3S1R B;  1VQA A;  2F0T A;  1A0I A;  3D8G A;  4A3I G;  3GTK H;  1N34 L;  1KNA A;  2E5L Q;  3CW2 C;  5DAU A;  2MGS A;  4FYD A;  4L5T A;  4GZY C;  2F03 A;  2R93 G;  4G7O C;  4B9X A;  4EQ5 A;  4ME5 A;  5EPK A;  1IBK Q;  3TP6 A;  4A3F H;  1F77 A;  1IBL Q;  1PMR A;  4LJZ C;  2RDG A;  4QQB X;  2BOS A;  2VW9 A;  3VR5 A;  3BZK A;  1EY0 A;  2ID0 A;  1PA6 A;  4J1M A;  2EYO A;  3LNN A;  4IUQ A;  3A0J A;  3EN2 A;  2L1B A;  2K52 A;  4LF7 L;  4IJH A;  1QOH A;  1HPC A;  1YJ9 A;  1NY4 A;  3T1Y Q;  3HOZ G;  2Y0S B;  1MD2 D;  3FKI B;  1UE6 A;  3D31 A;  4BXX H;  1BOS A;  1FYC A;  2WAQ E;  1HXY D;  2KHS A;  5M5X H;  3CHB D;  1T5E A;  2GA4 B;  1WVL A;  1X3P A;  2RDH A;  4RHS A;  4O1N A;  1S3O A;  2J7Z A;  4K14 A;  4Y7N B;  2L11 A;  2F52 A;  1PTO D;  3K80 C;  3LWU A;  3NPP A;  2OQK A;  1AW7 A;  4UP8 A;  2EZV A;  3BU2 A;  3I8Z A;  3AFQ A;  3TZD A;  4OGQ C;  4K5V A; 
#chains in the Genus database with same CATH homology
 1OTC A;  3F2C A;  1P16 A;  2KBN A;  4X65 L;  4DV3 Q;  4ALP A;  1M90 C;  1VQ4 A;  1XPO A;  2LXJ A;  1EYG A;  4DR5 Q;  5J3B A;  4JOI C;  3HOV G;  1EUJ A;  1TWA H;  1X65 A;  2HQL A;  5M3F H;  2R7D A;  4B3R L;  2RCN A;  2V1C C;  3NEN A;  4IPG A;  1I94 L;  4BY7 G;  3G48 A;  2NZO A;  2ZJQ A;  1IBL L;  1I3Q H;  2ATW A;  3EIV A;  4JCV E;  1WCM G;  2IHE A;  4DV7 Q;  3STB C;  2UXD Q;  1K9M C;  1X3F A;  1VQD A;  2QEX A;  2UUB Q;  4A3B G;  1Q1B A;  1HNX Q;  4A3C G;  2VQE L;  2A19 A;  1YVC A;  4DV4 L;  4NXM Q;  1IBM Q;  4X64 Q;  1N36 L;  2ZJR A;  2WAQ G;  4B3S Q;  1A63 A;  4LF4 Q;  3G4S A;  2MO1 A;  2I5H A;  4XIG S;  1B8A A;  3T1H L;  2VL6 A;  5JJL A;  1SLJ A;  2UXB L;  2NVX H;  3PO3 H;  3LGJ A;  3TQY A;  1QUQ A;  1Y1W H;  1J5E L;  3T1Y L;  3TS2 A;  1PH1 A;  3AQQ A;  3HOU G;  4RMF A;  1KRS A;  3RLO A;  4OO1 I;  1LTL A;  2JA9 A;  3HOW H;  1BBW A;  4H02 A;  4JI5 Q;  4A3F G;  1XMO L;  3H0G H;  4GOP B;  4A3K H;  4OWX B;  2I0Q A;  1U0L A;  4JBJ A;  4KI0 A;  3PO2 H;  4LFB Q;  1FJG Q;  1NE3 A;  1PH7 A;  4J15 A;  4X62 L;  3G6E A;  4DV6 L;  5IYB H;  1PYB A;  4JI7 L;  4KHP Q;  1Q7Y C;  2QGQ A;  4YY3 Q;  1FL0 A;  2ALY B;  1E7Z A;  1JE5 A;  3L0O A;  2JQO A;  3PIP A;  3DLL A;  1HNW L;  1KHI A;  4GKJ L;  2R7Z H;  4B3M Q;  4LF6 L;  3TRZ A;  3ER0 A;  5JEA G;  1CSQ A;  4A76 A;  1FVI A;  1SMX A;  4A4I A;  4K0K Q;  4L5Q A;  4HJ7 A;  2E2I H;  4IFD J;  4HJA A;  1IXR A;  2OTL A;  2JA7 H;  2UUC L;  3S14 H;  2LXK A;  4JBW A;  3RLF A;  1SRU A;  1HZA A;  1HH2 P;  1E24 A;  3BJU A;  3KF8 B;  3ULL A;  3W1B A;  3DM3 A;  1VQ5 A;  3ULP A;  1VQJ A;  4X66 Q;  1VQN A;  1YJN A;  1XJV A;  3M4Q A;  2KCM A;  3GDE A;  3KF6 A;  1KQS A;  5LMN W;  1KL9 A;  3ICE A;  2B3G A;  1TWG H;  4KLK A;  2E2J H;  5K36 G;  4DV7 L;  2EQS A;  1G6P A;  4GOP C;  4BBS G;  3KJP A;  2UUB L;  1XPU A;  2KHI A;  1VQI A;  2JA6 G;  4OWW B;  2RF4 A;  5C44 H;  3FKI G;  4OO1 G;  4HIO A;  2NZH A;  5IP9 G;  5JJK A;  1PFS A;  2WB1 E;  2AWN A;  4LF4 L;  1YIT A;  1HNZ Q;  1N33 L;  4DR6 Q;  4R4I A;  4AYB E;  1YNX A;  5C3E H;  4LF8 Q;  4BY1 H;  1VCI A;  2HHH Q;  2DGY A;  3UDX A;  4GKK L;  4GN3 B;  5IY0 A;  1XNR L;  4NPS A;  1M1K C;  3ERS X;  2C35 B;  2VY3 A;  2PI2 A;  4LFC Q;  3MXN B;  1VQ7 A;  4A3G H;  4DV2 Q;  1YEZ A;  2WP8 J;  4JI8 L;  5M3F G;  3JC6 6;  3E9H A;  2PQA B;  2EIF A;  1VQO A;  3FP9 A;  1VQL A;  3HKZ G;  2B29 A;  2OQ0 A;  2PI2 E;  4DV1 L;  4A3D G;  3KDF B;  3RZD H;  5C4X G;  3OTO Q;  1K8G A;  2YU9 H;  3TS0 A;  4A3L G;  5GAG C;  3S15 H;  4RG1 A;  3M3Y H;  3PUW A;  4A3M G;  2JA5 G;  2NVY H;  3K0X A;  4XTC S;  3H15 A;  3HOY H;  2UUA Q;  2Z6K C;  1YHA A;  1ASY A;  1G29 1;  2IX0 A;  1W2B A;  5IP7 H;  1E1T A;  2YTY A;  4AIM A;  1Q86 C;  2XGT A;  1V43 A;  3H3V H;  2L15 A;  2E8G A;  1X54 A;  4OWT B;  3SGI A;  3F2B A;  4LF5 Q;  3F2D A;  1D7Q A;  4EX5 A;  4IOC A;  4DR7 L;  1NTG A;  5IWA Q;  3PO3 G;  2LSS A;  1L1O B;  4L5R C;  1MKH A;  1EQR A;  2WB1 G;  3I7F A;  1WOC A;  1Y1V H;  1QVC A;  4JI4 L;  1XNQ L;  4AYB G;  3HOW G;  4P71 A;  4DR3 Q;  2KCT A;  2K75 A;  2Z0S A;  4PZ8 A;  4DV5 Q;  1A8V A;  2JE6 I;  2VUM H;  3H0G G;  4A3K G;  1JJ2 A;  1CSP A;  4JI0 Q;  3PO2 G;  3Q8D A;  2D62 A;  1YIJ A;  3J7A 5;  1R9T H;  1TXY A;  4LFA Q;  4BBR H;  2JJQ A;  3HOX G;  3PUY A;  1Q8K A;  5GAH C;  5HGQ A;  5IYB G;  1AH9 A;  5IYD G;  4JV5 L;  5JJI A;  3RNU A;  1XPR A;  2BA0 A;  2KEN A;  3BZC A;  4OXP A;  3JAM i;  3J81 i;  1Q82 C;  1IBK L;  2ZM6 Q;  1JT8 A;  3PUV A;  5C0X I;  3U50 C;  2N78 A;  1N9W A;  4QL5 A;  4LF8 L;  4LF9 L;  4DAM A;  2HHH L;  2EXD A;  1PH6 A;  3CQZ H;  2ZTC A;  1EOV A;  4JI1 L;  4IFD G;  4B3T L;  2PMZ E;  4DV0 Q;  3WWV A;  2R92 H;  4DV2 L;  1NJI C;  1L1O C;  3JAM c;  3CCE A;  1SFO H;  1B70 B;  4L5S A;  3U58 A;  1S72 A;  1HJP A;  1VQM A;  1JJG A;  1TWF H;  3GD7 A;  3KYH C;  1ASZ A;  5GAD C;  1QZH A;  2HIV A;  3I4M H;  4JOI A;  3H3V I;  2K4K A;  1E3P A;  2VZA A;  4O2D A;  4R4C A;  3I4N H;  2NN6 I;  4A93 H;  1Q81 C;  4JYA L;  3S1N H;  2YTV A;  2JEA I;  5ELO A;  2WFW A;  1CKN A;  3IRB A;  1N34 Q;  5FJ8 G;  3CCS A;  1V9P A;  2Y0S E;  1PHJ A;  1MJE A;  3UE1 A;  2FXQ A;  3FHW A;  4JBK A;  2JA8 H;  2AWO A;  2H5X A;  4OX9 L;  5C4J H;  5C3E G;  1HR0 W;  4QIW E;  4DUZ Q;  2N3S A;  4R1J A;  1NMF A;  3HOZ H;  4P72 A;  1YZ6 A;  3CP0 A;  1P8L A;  3J81 j;  1I5F A;  3VDY A;  1EIY B;  4LUV A;  1EWI A;  4UP9 A;  2CCZ A;  4HJ5 A;  1XMQ Q;  4DPG A;  4A3G G;  1RIP A;  3PSI A;  4POG A;  4DR4 Q;  5FLM H;  4JI3 Q;  4IOA A;  4YHH Q;  4DR3 L;  3CC2 A;  3E0E A;  2GVA A;  4AQY Q;  3PUZ A;  1HR0 Q;  2Q2T A;  2UXC L;  3AEV A;  2VNU D;  2D0P A;  2QA4 A;  4JI2 Q;  4HIM A;  3PF4 A;  2IY5 B;  1I50 H;  3HKZ E;  1WFQ A;  5M3M H;  4DV3 L;  1SRO A;  4C3H H;  3F1Z A;  1HZ9 A;  3GTG H;  3TRE A;  4DR5 L;  3GTQ H;  2HT1 A;  1N32 Q;  1YHQ A;  2VQF Q;  4A3J H;  1YHB A;  1EIF A;  2F4V Q;  4BXX G;  4DK3 C;  5LMU Q;  2OTJ A;  1PH3 A;  1OXU A;  3ULJ A;  4LF7 Q;  1J6Q A;  3CD6 A;  5IE8 A;  2UXD L;  1G51 A;  4MZ9 A;  4APV A;  1SN8 A;  2Q2H A;  1IYJ B;  2CQO A;  1HNX L;  3A5Z B;  2Y0S G;  1Q46 A;  4NXM L;  1IBM L;  1Z47 A;  4X64 L;  1Y1V G;  4B3S L;  5BR8 Q;  5LMN Q;  1VQH A;  1WCM H;  4LUZ A;  4DAY B;  4DR1 Q;  4UP7 A;  1OXS C;  1TWH H;  2XTI A;  4BA1 I;  1B7Y B;  1TWC H;  2MFI A;  4IO9 A;  2VUM G;  4MTN A;  4C3J H;  4A3B H;  1AE3 A;  4DUY Q;  3UDF A;  4DR2 Q;  2YV5 A;  4TVA B;  1NMG A;  3U4Z A;  1SR3 A;  4BBR G;  1OXX K;  4PZ6 A;  4A3E G;  2K50 A;  1VQB A;  1YI2 A;  2K5H A;  2N49 A;  2RHS B;  5H1S E;  3J80 i;  4GOP A;  5C0X J;  2CWP A;  3M85 A;  1UE1 A;  5IYC H;  4ME3 A;  4IPD A;  4JI5 L;  3GTM H;  4P75 A;  2K5V A;  4GNX B;  1VQP A;  2A1A A;  4LFB L;  1VQK A;  5GAE C;  4X65 Q;  1FJG L;  2A8V A;  4R4T A;  3CCJ A;  4HJ9 A;  4AH6 A;  3G71 A;  3HOU H;  3S1M H;  1OXV A;  3KOJ A;  4YWL A;  3OW2 A;  4YCW A;  1N8R C;  3S2H H;  3I56 A;  3W1G A;  2IX1 A;  2R92 G;  4KHP L;  2ASB A;  1LUZ A;  4YY3 L;  4YHH L;  3J80 c;  4B3R Q;  1I94 Q;  1UEB A;  4B3M L;  3OYY A;  1QZG A;  2CFM A;  4LNQ A;  2R7F A;  2DUD A;  4UY8 C;  3I4M G;  1QVG A;  3M7N A;  1H95 A;  4K0K L;  2ZTE A;  3KJO A;  3PGZ A;  1X3G A;  1PH9 A;  4BA2 I;  1V1Q A;  2VQE Q;  4DV4 Q;  3CCM A;  1UWV A;  1WJJ A;  3CCU A;  3D0F A;  1EQQ A;  1Y1W G;  1N36 Q;  1N32 L;  3S24 A;  3CMA A;  1PYS B;  2YYZ A;  2MO0 A;  2CWA A;  4X66 L;  1PH5 A;  2JA8 G;  1YJW A;  3T1H Q;  1K83 H;  1X56 A;  2Z6K A;  4WJ3 M;  4GNX C;  2UXB Q;  3E9I A;  1C9O A;  1AE2 A;  1X9N A;  1J5E Q;  3GTP H;  1GM5 A;  2E2H H;  4A3I H;  3NEL A;  1GKH A;  3UDG A;  1NBW A;  1A62 A;  2AKW B;  1L0W A;  1LM0 A;  1OXT A;  1QUQ B;  3L7Z C;  4POF A;  5FLM G;  2ZJP A;  4DR1 L;  4DR6 L;  1XMO Q;  1HNZ L;  4BBS H;  3KFU A;  2R7Z G;  1JB7 A;  2JA6 H;  1K3R A;  1Q12 A;  1CKO A;  1UE7 A;  2RHQ B;  4X62 Q;  1KD1 C;  2R93 H;  1VQF A;  2K5N A;  1FGU A;  4IPC A;  5IT9 c;  3J7Z C;  4DV6 Q;  4JI7 Q;  5M3M G;  5IP9 H;  4QGU A;  2PQA A;  3HKS A;  4JI6 Q;  3AYH B;  2JA7 G;  4LFC L;  3CAM A;  3M4O H;  1HNW Q;  4GKJ Q;  3KDF A;  1MJC A;  5AJ3 Q;  4LF6 Q;  1O7I A;  3CCQ A;  1DGS A;  4A75 A;  5M5Y H;  3GTL H;  1I6H H;  1KAW A;  4R4Q A;  3J81 c;  3S17 H;  4GN5 A;  1PH2 A;  1GO3 E;  1WYD A;  5M5W H;  1BBU A;  4GLV B;  3OTO L;  2KHJ A;  1HZB A;  3AFP A;  1IZ6 A;  4TQU S;  2UUC Q;  2MQH A;  1MIU A;  4HID A;  1VS0 A;  2UUA L;  3M9B A;  4OON A;  3RLN A;  4A3D H;  3U4V A;  5C44 G;  2MNA A;  5C4X H;  3STB D;  4YWK A;  1VQE A;  1CUK A;  4A3L H;  4JI6 L;  2GVB A;  4A3M H;  2JA5 H;  4LF5 L;  1L1O A;  3KF6 B;  4UPA A;  4BY1 G;  1Z9F A;  2F3I A;  1CKM A;  5IWA L;  3PF5 A;  1VQG A;  3KLW A;  1SE8 A;  4QJF A;  2IHF A;  4GN4 B;  1X3E A;  2GN5 A;  3M4P A;  5E7N A;  2BH8 A;  1N33 Q;  5C0X G;  1GVP A;  4PG3 A;  5IYC G;  3S2D H;  4DK6 C;  4WJ4 A;  2Q2I A;  4DV5 L;  4GKK Q;  4PZ7 A;  4IJL A;  2BA1 A;  1BVS A;  4JI0 L;  3TEH B;  1XNR Q;  2B63 H;  4LFA L;  1LYL A;  1VQ9 A;  3HOY G;  3K8A A;  2YTX A;  4JI8 Q;  2BH2 A;  4NXN L;  1PH8 A;  1VQ6 A;  4JBM A;  1PV4 A;  3UE0 A;  2ZM6 L;  4DV1 Q;  2R6G A;  4DKA C;  3CME A;  1VQC A;  5IP7 G;  3RN2 A;  1PH4 A;  1E22 A;  3HOX H;  3RN5 A;  3CPF A;  1GD7 A;  4DNI A;  1K0R A;  5IYD H;  1C7Y A;  1BKB A;  2NN6 G;  3UDI A;  3CPW A;  3HOV H;  4DV0 L;  1Q1E A;  5AJ3 L;  1PVO A;  1UE5 A;  3GTJ H;  2VS1 A;  2UU9 Q;  4BY7 H;  1E1O A;  2ES2 A;  1K8A C;  3PIO A;  4YWM A;  4PMW A;  1S40 A;  4DR7 Q;  5GRO A;  1EFW A;  4FDB A;  4GLA C;  2IT1 A;  4LW1 A;  4QY7 A;  1KRT A;  3CC7 A;  3RZO H;  4C2M H;  4JC0 A;  4A3C H;  4HIK A;  4HJ8 A;  1VQA A;  1XNQ Q;  1A0I A;  4JG2 A;  4A3I G;  4JI4 Q;  1QVF A;  3CCV A;  3RR5 A;  3GTK H;  3GTO H;  1N34 L;  2AHO B;  3HFZ B;  3CXC A;  2NVQ H;  2PNH A;  4R4O A;  2E5L Q;  2JK8 A;  3CW2 C;  2OWO A;  3K81 C;  3NEM A;  4MNO A;  5ELN A;  3S1R H;  1JJC B;  4Y52 H;  3CCL A;  4DUZ L;  4L5T A;  1U5K A;  1T9H A;  2R93 G;  4GLX A;  5FJ8 H;  4NXN Q;  4GS3 A;  4EQ5 A;  4JV5 Q;  1XMQ L;  3PUX A;  4X6A H;  5EAY A;  1IBK Q;  2AMC B;  2HIX A;  4DR4 L;  4JI3 L;  4A3F H;  3I55 A;  4LF9 Q;  3F8T A;  1X6O A;  4YCU A;  4C3I H;  3L2P A;  4AQY L;  1HR0 L;  1IBL Q;  3ZJY C;  2D0O A;  3S1Q H;  4JI2 L;  4QQB X;  2VW9 A;  3BZK A;  4JI1 Q;  2CKZ B;  2ID0 A;  4B3T Q;  2ZTD A;  1PA6 A;  3I4N G;  4A93 G;  2I5M X;  2I5L X;  1HZC A;  3MEF A;  3K7U C;  3A0J A;  3EBE A;  3NBH B;  2VQF L;  5JEA J;  3CCR A;  1C0A A;  2OCE A;  4LWC A;  2F4V L;  3EN2 A;  1XTD A;  3W5O A;  5LMU L;  5HY6 A;  1X55 A;  2K52 A;  2N8N A;  1JMC A;  5GQO A;  1Y14 B;  4IJH A;  4NB3 A;  4LF7 L;  4YCV A;  1W3S A;  4JYA Q;  3PCO B;  4O0A A;  4P74 A;  4IFD I;  2K14 A;  1RL2 A;  3I4O A;  1YJ9 A;  1D8L A;  1NY4 A;  3T1Y Q;  2NVT H;  2UU9 L;  3HOZ G;  1WI5 A;  3CC4 A;  1L2F A;  1UE6 A;  3D31 A;  4BXX H;  3GO5 A;  3CF5 A;  5BR8 L;  4OX9 Q;  5LMN L;  2WAQ E;  5M5X H;  1CKN B;  3B6Y A;  2JEB I;  1IL2 A;  1KC8 C;  1YBY A;  1K73 C;  3K7A H;  1S3O A;  3I2Z A;  1VQ8 A;  4DUY L;  4DR2 L;  4IPH A;  2F52 A;  3K80 C;  3A5U A;  3FKI H;  5DLQ E;  1KIX A;  2B63 G;  5FLX c;  3S16 H;  1KXL A;  2OQK A;  4UP8 A;  4GNX A;  3BU2 A;  3A74 A;  4LUO A;  2E5L L;  3AFQ A;  2UXC Q;  4KHZ A;  4P73 A;  4Y7N H;  2Q2U A;  4A3J G;  3PV0 A;  4A3E H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...