2VQEL

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqeL00
4C3HH 4DK6C 1IZ6A 4JOIA 3H3VH 1XMQL 4BA1I 3RZOH 3I4NH 2KCMA 1N9WA 5IWAQ 4UP7A 2N3SA 1K73C 3E9IA 3K7UC 1OXXK 2NVXH 4GS3A 2ZJRA 4FDBA 2K5VA 1CUKA 2KENA 1Y1WH 1XMQQ 2JA6H 5C0XI 2KCTA 3HFZB 2R7DA 1VQ7A 3PUWA 3KF6B 2JA8H 3KFUA 1QUQB 1YITA 4YWLA 1OTCA 2UUCL 2IY5B 5FJ8G 1NY4A 1P16A 2ALYB 2CCZA 3J81i 5AJ3L 3ER0A 4BA2I 2JK8A 1CKOA 2VS1A 1KHIA 2HHHL 3S1NH 4HIMA 4X65L 1VQOA 4R4QA 4NB3A 2UUCQ 1S3OA 3AFPA 1ASZA 5AJ3Q 4A3LH 4K0KL 2EXDA 3OTOL 3AQQA 2AWOA 2NN6I 1PH6A 4NPSA 2HHHQ 4XTCS 4GN5A 4X65Q 1KQSA 1YHBA 3CCLA 4A3JH 1I50H 2IX0A 1MKHA 1LUZA 3H3VI 1X3GA 4DK3C 2AWNA 3GTPH 1YHQA 1IBKL 3I4NG 4K0KQ 2F52A 2UUAL 3S16H 3A5UA 3I4MH 1VQFA 2HIXA 2RCNA 3CW2C 1TWHH 2QEXA 4JYAL 4YY3Q 1C0AA 2RHQB 3UDGA 4DR2Q 1Y1WG 1IBKQ 1NMFA 2UUAQ 1GVPA 4UP8A 1VQCA 4JYAQ 2JA8G 1YJWA 4MTNA 2VUMH 2YYZA 3J81j 3GTQH 1IYJB 3U58A 4A3KG 4LF4L 2Z6KA 1VQHA 4IFDI 3CC2A 1YJNA 2NVYH 4GN4B 2JA9A 4BBRG 1EIFA 1KXLA 4JI0Q 5LMUL 4GNXC 4A3IG 1PH2A 3B6YA 2K5HA 5LMNQ 4OO1I 4IPHA 4JI4L 1A63A 4OO1G 1WI5A 4JOIC 4A3LG 2C35B 4IOAA 3S1RH 4A3BH 2OCEA 3DM3A 5LMUQ 5C44G 1E22A 2ID0A 3GTJH 4DV0L 4LFAL 3GTMH 2PQAB 1U0LA 3PUYA 3RLOA 2CKZB 1RL2A 3I4MG 5IP9H 1D8LA 4PZ7A 3G6EA 3AFQA 3M3YH 4DV0Q 5HY6A 4WJ4A 1X54A 2D0PA 2JA5H 4LFAQ 5C4JH 4LUVA 1HNXQ 1L1OA 4ME3A 5EAYA 3PIPA 5C4XG 4L5SA 2R6GA 3K7AH 4AYBE 3CCEA 1E24A 1W3SA 3PUZA 3PSIA 1TWCH 1PV4A 2VUMG 5M3MG 3GTGH 4C3IH 1SE8A 3PV0A 4AH6A 2K75A 3K0XA 2ZTDA 3TS0A 3EN2A 3S1QH 5JJIA 3ULLA 5IYBG 1TWAH 3L7ZC 4YCWA 2CWAA 3U50C 4LUZA 5IY0A 1A62A 3CCMA 3NENA 2XGTA 4JBMA 2Y0SG 4GOPC 2UXCL 2MO1A 3K80C 1K3RA 1Q82C 5JJKA 3M4QA 1T9HA 1X3EA 4QGUA 4OWXB 3HOXH 4HIDA 2K5NA 4IJHA 4P72A 1V9PA 1YEZA 2F3IA 3E0EA 1YI2A 1N36Q 1XNRL 2UXCQ 3EIVA 1EOVA 4O0AA 2GVBA 4A3MH 4X66L 5IP9G 4DKAC 4DV3L 4BBSH 3PO3H 4YWMA 5FLMH 4IOCA 2JA5G 2B3GA 3Q8DA 4PMWA 3IRBA 2Q2UA 3LGJA 1DGSA 3AEVA 3FP9A 3KF8B 4X66Q 1VQPA 2ZJQA 2IX1A 3U4ZA 4DV3Q 1PA6A 4LW1A 4R4CA 2R93H 3TRZA 1B7YB 3RNUA 2UXDL 1PFSA 1M90C 4A4IA 2E2HH 3BZCA 4DR1L 3M85A 4P73A 4RG1A 1E7ZA 2Z0SA 2UXDQ 3STBD 1XMOL 4LF9L 2Y0SE 1MJCA 1CKNB 5IYCH 3RN2A 1N34L 4LF7L 2IT1A 5IYDH 1EQRA 3HOXG 3S14H 1VQBA 3F1ZA 1XMOQ 1YZ6A 4LF9Q 1L1OC 3K81C 4HJ8A 2VQFL 3F2BA 4A3MG 4JI2L 2EQSA 3WWVA 1N34Q 1JE5A 1I94L 4LF7Q 3BU2A 1PH1A 2JE6I 4BBSG 3K8AA 2ZM6L 4A75A 1Z47A 5FLMG 1KD1C 3PO3G 5DLQE 3CD6A 2OQKA 4MNOA 1HNWL 1VQEA 4JI2Q 5C0XG 3TEHB 3KF6A 4YHHL 2VQFQ 4HJAA 3J7A5 1I94Q 4A3DH 3RR5A 4DR4Q 2ZM6Q 4GNXB 2R93G 1WCMH 2YTXA 3TQYA 4R1JA 1YJ9A 1HNWQ 4YHHQ 1K8GA 1VQ4A 2E2JH 4A3GH 2GVAA 1I6HH 4EX5A 2IHFA 4BY1H 4IPDA 4YWKA 1G51A 2OTLA 1KL9A 1LTLA 1A0IA 1XTDA 1PVOA 4A93H 2NZHA 2LXKA 3DLLA 3KLWA 4R4TA 2NN6G 1Y14B 3PF5A 4YY3L 1EIYB 5M3FH 2HQLA 3HOZH 3L0OA 3W1GA 4UPAA 2WFWA 1GM5A 4DR2L 4LF6L 4DV4L 3GDEA 4DR7Q 2NVTH 4IJLA 3HKZG 3VDYA 4KHPL 2E5LL 1EFWA 3KOJA 3PCOB 4GLVB 1HJPA 4JBJA 5GQOA 4X62L 2VQEL 2UU9L 3PF4A 4LF6Q 4JI1L 4DV4Q 1U5KA 2PMZE 5C0XJ 2JA6G 4A76A 4LNQA 3CCSA 4POFA 4JI0L 1XPOA 2E5LQ 4KHPQ 4GN3B 1LM0A 2UU9Q 2VQEQ 4X6AH 4X62Q 1WYDA 4OWTB 1VQDA 5LMNL 4A3DG 2IHEA 4JI1Q 1Q8KA 1WCMG 4IPGA 4YCVA 3HOYH 5ELOA 1UE5A 4IFDG 1LYLA 5LMNW 1X55A 1KIXA 2MQHA 1IBML 4A3GG 2LSSA 2WB1G 5M5YH 2ZJPA 4GOPB 1BBWA 1VQNA 4QIWE 3ULJA 4TQUS 4A93G 4JI6L 3GD7A 3I4OA 1FVIA 1IBMQ 2A19A 4BY7H 4NXML 3CPFA 4A3JG 5M3FG 3HOZG 2ZTEA 4HIKA 1SR3A 2V1CC 5JJLA 4OX9L 4JI8L 1HNXL 1VQJA 4JI6Q 2PNHA 2B63H 4NXMQ 2ATWA 4YCUA 3W1BA 2NVQH 4JI5L 3CCVA 1X6OA 2CWPA 4DAYB 4OX9Q 4UY8C 3D31A 1Q1EA 4RMFA 4JI8Q 3L2PA 1OXVA 5GAGC 1HZ9A 3KDFA 4HJ9A 3S1MH 4IO9A 3HOUH 1VQIA 1FGUA 1HZBA 4C3JH 4JI5Q 1YHAA 1HZCA 4B3SL 1V1QA 4IFDJ 3MEFA 1YNXA 1VCIA 3I7FA 1KAWA 3M9BA 1KC8C 4B3TQ 1XPUA 3BZKA 1YVCA 3H15A 1UE7A 1V43A 1TXYA 3HOYG 1QZGA 2EIFA 4O2DA 2VL6A 1YIJA 4B3SQ 3J7ZC 1SLJA 1TWFH 2Q2TA 1WFQA 4JG2A 2AKWB 1N36L 3ICEA 5HGQA 1VQLA 4A3BG 1G291 4PZ8A 1X65A 1EYGA 4DV7L 1HR0L 1CSQA 1RIPA 4JC0A 1L1OB 3UDIA 2NZOA 2B29A 5GAHC 1NJIC 1HR0W 1IL2A 1Q1BA 1GKHA 4P74A 4KLKA 5M5XH 1PHJA 3GTKH 2Q2HA 1HR0Q 3TREA 4DV7Q 1VQ5A 3F8TA 2B63G 1X3FA 1XPRA 3OW2A 3A74A 5JEAG 1X56A 1Q81C 1X9NA 3D0FA 2Z6KC 3FHWA 3MXNB 3HOUG 2FXQA 2ES2A 4BXXH 2GN5A 1N32Q 4P75A 1VQAA 2LXJA 1UE1A 2N78A 2H5XA 4H02A 3W5OA 2JJQA 2KBNA 2YV5A 2ZTCA 2R7ZH 1AE2A 3PGZA 2YU9H 4R4IA 4HJ7A 4LFBL 1Q46A 4KI0A 5IP7H 2R92H 3I2ZA 3CCUA 2WP8J 2CFMA 1K0RA 1CKNA 1QVCA 4DR6L 2KHJA 2BH8A 4DV5L 4LFBQ 3UE1A 2D0OA 4C2MH 1N8RC 4X64L 1K9MC 4DPGA 3CAMA 2OWOA 4AIMA 3S15H 3S24A 1NE3A 5FJ8H 3ULPA 4DUYL 3RZDH 1JJ2A 4DR6Q 3JAMc 1UE6A 4DV5Q 4X64Q 4DR4L 2K14A 1IBLL 1PYSB 3HOVH 4JCVE 2KHIA 4A3CH 4DNIA 3ERSX 2CQOA 3A5ZB 3G4SA 4POGA 3M7NA 4DUYQ 3J80c 5J3BA 4R4OA 2RHSB 1QUQA 4BXXG 1JJGA 4NXNL 2BA0A 4GNXA 1IBLQ 2L15A 2RF4A 3H0GH 1HZAA 2UUBQ 3HOWH 2R7ZG 3CMAA 2WAQG 4NXNQ 4OONA 4DV2L 4Y7NH 4A3FH 4JBKA 2K52A 4WJ3M 1VS0A 5IP7G 2R92G 1GD7A 1Y1VH 1EUJA 3RLFA 5IYCG 4GKKL 1UWVA 1KRTA 1D7QA 3RLNA 5IYDG 4DV2Q 5IT9c 1VQKA 1B8AA 1S40A 2DUDA 4QJFA 4A3KH 2DGYA 3CC4A 4GKKQ 4XIGS 1B70B 2E2IH 2N8NA 4GLAC 1UEBA 4BBRH 1PH9A 3HOVG 4A3IH 4A3CG 3CPWA 3F2CA 5H1SE 2JA7H 1PH3A 3S2DH 1SN8A 5BR8L 1VQGA 3PIOA 1C7YA 1SROA 4EQ5A 2JEBI 5C44H 3H0GG 1L0WA 1SFOH 1SMXA 2I5MX 3HOWG 1A8VA 5BR8Q 3CCJA 1XJVA 2WAQE 3PO2H 4BY1G 3CXCA 3OTOQ 2VW9A 3CCRA 3KYHC 4GOPA 4AQYL 4KHZA 5GAEC 3NEMA 2BA1A 4A3FG 2AHOB 3JC66 3GTLH 4JBWA 4L5RC 4DR7L 3S17H 5K36G 1P8LA 1Y1VG 1E1TA 4DAMA 1PYBA 3SGIA 1HH2P 4AQYQ 1PH7A 1PH4A 4APVA 1O7IA 3CP0A 5C4XH 1R9TH 1PH8A 2PQAA 3HKSA 1G6PA 3PUXA 5GROA 4AYBG 5C3EH 1JMCA 3HKZE 1QZHA 4LF5L 4LF8L 1C9OA 1CKMA 1OXUA 5M3MH 1EQQA 4L5QA 2A8VA 2VNUD 2HT1A 4QQBX 4GLXA 1WJJA 1MJEA 2K50A 2YTYA 3E9HA 4LFCL 3KJOA 4B3TL 2I5LX 5IYBH 4LF8Q 4LF5Q 1QVFA 1E3PA 1VQ6A 4PZ6A 2JA7G 1EWIA 5GADC 3T1HL 4LF4Q 3G71A 4DV6L 2I5HA 2YTVA 2I0QA 1OXTA 4LFCQ 1JT8A 3UDFA 2VZAA 2MO0A 3J81c 1QVGA 4JI4Q 1I3QH 1GO3E 2JQOA 3T1HQ 4B3ML 1L2FA 2N49A 1VQ9A 1BBUA 1OXSC 2WB1E 4DV6Q 1S72A 3CCQA 3T1YL 3PO2G 1AE3A 3RN5A 5E7NA 1NMGA 3JAMi 1E1OA 1FJGL 2VY3A 4UP9A 2BH2A 5IE8A 4B3MQ 4IPCA 1YBYA 3A0JA 4BY7G 1Z9FA 1H95A 3T1YQ 3KDFB 3S2HH 3CMEA 3J80i 5ELNA 4GKJL 1W2BA 1FJGQ 1Q7YC 1VQ8A 1CSPA 3G48A 2OTJA 5C3EG 3ZJYC 1FL0A 4LUOA 4ALPA 2Q2IA 2PI2A 3FKIH 1N32L 4GKJQ 3AYHB 4HIOA 1N33L 3I55A 2ASBA 2QA4A 4JV5L 2JEAI 2UXBL 2K4KA 3STBC 4OWWB 3BJUA 4Y52H 4A3EH 3CC7A 1M1KC 4DV1L 1NTGA 1N33Q 4DR3L 4JV5Q 1JJCB 2UXBQ 4QY7A 4DR5L 1SRUA 1J5EL 1VQMA 1IXRA 5FLXc 4DV1Q 1I5FA 2AMCB 1WOCA 1XNQL 2MNAA 4DR3Q 4LWCA 1Q12A 3I56A 2R7FA 4DR5Q 4P71A 4HJ5A 1J5EQ 4JI7L 4MZ9A 3U4VA 1XNQQ 4QL5A 1XNRQ 3OYYA 1ASYA 3TS2A 3EBEA 3NBHB 1NBWA 2E8GA 2XTIA 3CF5A 4B3RL 3M4PA 1K83H 1TWGH 2PI2E 2A1AA 4OXPA 1KRSA 4JI3L 1JB7A 5JEAJ 4JI7Q 3GTOH 1AH9A 1HNZL 3NELA 2MFIA 2OQ0A 3FKIG 3M4OH 2D62A 4L5TA 1MIUA 3F2DA 1BVSA 2UUBL 1K8AC 4PG3A 4B3RQ 4DUZL 3UDXA 5M5WH 2F4VL 3CQZH 3KJPA 1PH5A 4JI3Q 1Q86C 1BKBA 1HNZQ 3PUVA 2QGQA 5IWAL 4A3EG 1J6QA 4J15A 3GO5A 4DR1Q 3UE0A 2HIVA 4DUZQ 2F4VQ 4TVAB
chains in the Genus database with same CATH superfamily
4DK6C 3RZOH 1XMQL 2A6HC 2LMCB 1XTCD 3E9IA 1OXXK 2NVXH 1LABA 2ZJRA 1Y1WH 2PMZB 3HFZB 1S5BD 4PV1C 3KF6B 3KFUA 4EVOA 5LL6S 1NY4A 2ALYB 2O4XA 4RCNA 3G7LA 1BCPB 4DXGA 1KHIA 3S1NH 2XIWA 3AFPA 4F87A 3VYUA 2EE1A 2AWOA 4RAUC 3EVQA 4GN5A 3CCLA 4A3JH 2A68D 1UNSA 1G8ZD 4IQZA 2UUAL 1WTOA 2RCNA 1TWHH 4JYAL 1RJTA 1C0AA 2RHQB 4ZRZA 1EU4A 5T1IA 3UDGA 4DR2Q 1L0YB 1B53A 1IBKQ 2L11A 2JA8G 1YJWA 3TZDA 3WOFA 3PQIA 3J81j 3CC2A 3K6OA 2MGSA 2JA9A 4BBRG 1WCMB 3DWQA 1EIFA 4JI0Q 5D14A 5ISRA 2K5HA 1HHVA 2QKIC 4A3GB 1NAPA 4JI4L 1I6HB 5KYIA 4K2LA 4XQNA 1WI5A 2XVSA 4A3BH 5LMUQ 1LTSD 4A93B 2ID0A 5ELBA 3X3NA 3HOZB 4K5WA 1RL2A 3I4MG 3G6EA 4WJ4A 1L1OA 3NUCA 1AN8A 2K33A 5EAYA 5I9OA 3CCEA 2A74C 3OSOA 2L1BA 1AFPA 1SYEA 4ZLTF 1SE8A 2CH4W 3EN2A 3AU7A 5JJIA 3ULLA 5IT9E 4HN7A 1JWSD 3UI2A 1II3A 4YCWA 1AP0A 2F0LA 4WFN3 4QGUA 4HIDA 2F0TA 4IJHA 4P72A 3EIVA 4O0AA 2KQ3A 4DV3L 3PO3H 5FLMH 2JA5G 1EL0A 3Q8DA 3IRBA 1NNXA 3QR8A 3AEVA 3FP9A 4X66Q 1VQPA 1PA6A 3J80L 4RKLA 5CBEE 1PTOH 1QNUA 4A4IA 1CA6A 1G2TA 2J7ZA 3M85A 3AB9A 5DM63 5EBDA 3ND8A 2EYOA 2B2UA 3STBD 1XMOL 2Y0SE 3BDOA 4KKSA 3NHHA 5IYCH 3SHLA 2IT1A 3PIP3 5IYDH 3WDNA 1PDQA 1VQBA 3F1ZA 1YZ6A 1PYWD 2VQFL 3GTKB 5IIFA 1N34Q 1JE5A 4LF7Q 2ZM6L 4KV6A 2EJFC 1DONA 4RGOS 5C0XG 4HJAA 3KF6A 3J7A5 3OMGA 4FF4A 1HNWQ 1PXUA 2OT2A 2A6ED 3WOEA 3Q23A 4EX5A 1G51A 2PCFB 1KL9A 1LTLA 1VMCA 4J1MA 1XTDA 1H9KA 5E3FA 2SOBA 5JPMC 3U9OA 2R92B 5M3FH 1HTPA 4Q5VA 4UPAA 1JE4A 3TZUA 4DR2L 4LF6L 3GDEA 3S14B 1EY6A 4KHPL 2E5LL 2F0EA 2UU9L 4GLVB 1HJPA 5GQOA 4L63B 1ZXTA 4JI1L 3E5SA 1U5KA 4DV4Q 4A76A 1F2LA 1CHPD 1SMYD 4JI0L 3T16A 2VQEQ 2AUJD 1O80A 4O42A 1VQDA 3TSSA 1WCMG 2FINB 4IPGA 5ELOA 4IFDG 1LYLA 5LMNW 2QDBA 1X55A 2XNAC 4A3GG 2LSSA 5M5YH 5IODA 3NQIA 1ESFA 4TQUS 4A93G 1LLRD 4Y7NB 3GD7A 4JI6L 4BY7H 2A19A 4NXML 3NWTA 2BCOA 3HOZG 1VF7A 1EY4A 4OX9L 1KDCA 4JI8L 1BCPF 2PZTA 4MN3A 2B63H 2ATWA 2NVQH 3CCVA 4DAYB 1YNJD 2F0IA 1WD1A 3BYTB 3BVGA 4KY6A 3KDFA 3DEPA 3DWPA 3T56B 5BN5A 3MFGA 3S2DB 4B3SL 1A3VA 1V1QA 3I7FA 1KAWA 1YVCA 3CRKC 3NE5B 1MSHA 5HGTA 2D9UA 4R8IA 3SEBA 2Q2TA 3PO2B 1K8MA 4JG2A 1G291 1EYGA 5EPLA 1ZEQX 1RIPA 4JC0A 3GQBA 1PHJA 5M5XH 3VA7A 3I73A 1GUTA 2IWHA 3TREA 1HR0Q 1SYDA 1VQ5A 1X3FA 2WV6D 4I7ZC 1ICWA 3A74A 1X56A 1Q81C 4IUVA 3FHWA 2F3VA 2ES2A 3AMUA 2GN5A 3M7GA 4IUUA 2N78A 4H7BA 1HXYD 2ZTCA 2NVTB 5DAUA 1R4PB 5FO9B 4DAPA 1X3QA 1F9RA 1QVCA 3IFDA 1A2UA 1ENCA 2KHJA 1N8RC 3S2HB 2F03A 3S15H 2MHVA 3S24A 2PO4A 3J81E 4DV5Q 4X64Q 1PYSB 5KYLA 3HOVH 4A3CH 4DNIA 3ERSX 2HUGA 3A8KE 2RSNA 2RHSB 1Y8NB 4BXXG 4KN4C 3K59A 1HFNA 2RF4A 2OF1A 2PZUA 3CMAA 2LFNA 4OONA 4A3FH 2YU9B 2K52A 1EFID 2Z1CA 4WJ3M 3TP8A 1EYDA 2R92G 2JN4A 4RA8A 4DAVA 4GKKL 5COYA 1TY2A 2HDMA 1WTVA 5IT9c 1VQKA 3CC4A 2DGYA 4KTAA 2E2IH 2N8NA 4GLAC 4BBRH 3RZDB 1PH9A 3GTOB 3R93A 2A69C 1DM0B 1BO0A 1M8AA 1WTRA 4ZUIA 2CVRA 2NUCA 4K5VA 4EQ5A 4X3UA 1T5XD 1SFOH 1IKLA 1SMXA 2PW5A 1A8VA 1XJVA 4C3HB 3CCRA 5DM73 3KYHC 4X3KA 1RTNA 1JOQA 3H91A 3GTLH 4JBWA 3TMEA 3S17H 1LO5D 1IKMA 1E1TA 3HG9A 3ND9A 3SGIA 3HKSA 3L9AX 3PUXA 1SYCA 4I65A 3HKZE 1QZHA 4DR7Q 4TSSA 1EQQA 2VNUD 4DF7A 4QQBX 1VMPA 4H0LC 4A3KB 1WJJA 4DAYA 2AQ3B 3MXGA 2I5LX 4LF5Q 1J8IA 1E3PA 4A3IB 1VQ6A 1DOKA 1EWIA 4CDFC 5GADC 2L9HA 2KEDA 3BDLA 2I0QA 2VZAA 3LX0A 3NK9A 5E4WC 1I3QH 2KOLA 1I50B 2N49A 2L0CA 1OXSC 3VR4A 3CCQA 3PO2G 5CMDA 3GTPB 1AE3A 5CV7A 3RN5A 2RSOA 1KABA 1VDZA 2XWBB 3A0JA 5ELNA 1Q7YC 1X32A 1CSPA 2DN8A 1EEID 2EXZA 3A56A 5AFWA 4DK0A 3SK4A 3NBIA 4XQQA 4M8AA 2NVYB 2ASBA 2QA4A 2JEAI 2ENBA 3KF8A 4OWWB 2ZXOA 1C4QA 1EQVA 1IYVA 4A3EH 3CC7A 2K01A 1N33Q 4JV5Q 1JJCB 4HAEA 1SRUA 3GTJB 1IXRA 1ENFA 1XYIA 2AMCB 1WOCA 1EYAA 1BUVT 4DNTB 2MNAA 4FYDA 4LWCA 4DR5Q 3M3YB 1A3UA 4QL5A 5IGEA 1K0SA 5C4JB 1S5CD 1SJHD 3EBEA 3NBHB 3IFTA 1MBYA 2XTIA 1TKWB 5CYUA 3K7AB 3M4PA 2OEOA 4OXPA 3DHQA 1C8CA 1SYFA 2HD3A 5I2XA 5ELDA 3NSWA 3VR5A 1BVSA 1Z7TA 4N8FA 1K8AC 4JI3Q 3KJPA 1S5FD 1Q86C 3R8BA 2QGQA 2R3ZA 4RH6A 3UE0A 4JOIA 5I6WA 1BF4A 2CH4A 3J7AF 3I4NH 2F0SA 2N3SA 4ZK9B 1H9MA 3HOXB 2Q8IB 1B3AA 4MTKA 1IL8A 1WTXA 3RMHA 4GS3A 1XMQQ 2KENA 4XYQA 4EQPA 1VQ7A 4C56C 4JVZA 1OTCA 3GV6A 2UUCL 2IY5B 1P16A 3J81i 2R93B 5FK9C 1WTHA 2M9VA 2HHHL 4X65L 2B8GA 2EY6A 1K3BC 4CDEC 1S3OA 4OO1H 1ASZA 3Q0AA 4A3LH 4K0KL 1PH6A 4XTCS 1YHBA 5CV8A 4G4KA 3K5MA 3H3VI 4C3HG 3X3MA 5DEHA 1QNKA 5KEEA 3A7AB 3P75A 3HKZB 4CBVA 2IJ0A 2F0PA 1CQVA 1DOMA 5A35A 2UUAQ 1B9MA 3C1FA 4JYAQ 1JOKA 2VUMH 4Q0FA 4A3KG 4A3DB 2NYZD 4GN4B 5L37A 2B2WC 2PPBC 4GNXC 4A3IG 3VA5A 4HMJA 3LWUA 1WD0A 2F0HA 1TY0A 5ELEA 3S1RH 4DV0L 3J80E 3KLRA 1HUMA 2RVLA 3GTMH 3PUYA 3MVVA 3RLOA 1RODA 4PZ7A 3OIPA 3C3LA 2D0PA 1TS2A 2KCNA 4FF3A 3V96A 2QF7A 4ME3A 5CV9A 4TRDA 1STEA 2R6GA 1TWCH 3GTGH 4C3IH 4AH6A 3K0XA 4DK1A 4RGTA 4RGMA 3I70A 1RF2D 2K03A 1IYUA 1TWAH 1BBXC 2CWAA 3H09A 1TQOA 1B4OA 1CZGA 4JBMA 1BCPD 5E1FA 2MO1A 3M4QA 3L3OC 1T9HA 4MIUA 2K5NA 1V9PA 1N36Q 4ZQ3A 1ET6A 1EOVA 4ZCKA 2GVBA 4A3MH 5IP9G 4BBSH 3C46A 1TIID 2JSOA 3JAML 4YWMA 4LJZC 2KJXA 2QDLA 1KDBA 3LGJA 2G9DA 2IX1A 3U4ZA 4DV3Q 1NR4A 3MA2B 2KCCA 2R61A 3VR3A 3DM1A 1MJCA 1OO9B 2HCCA 3HOXG 3S14H 1QJOA 1T5EA 1XMOQ 1GUWA 4JPBW 3K81C 4HJ8A 4JI2L 2EQSA 2K7VA 1I94L 5CC4A 2P5ZX 3BU2A 1PH1A 1DZ1A 5CR3A 2SDFA 1VQEA 4YHHL 2VQFQ 4DR4Q 2ZM6Q 2A68C 4GNXB 2R93G 4NMZA 1YJ9A 3MEHA 1K8GA 1VQ4A 4N9TA 2E2JH 5A2QL 4IPDA 2R7ZB 2OTLA 4G7ZC 1BR9A 4CDCC 3KLWA 5C3XA 2HQLA 3L0OA 3W1GA 1L0XB 1JWMD 2NB0A 3HKZG 2BOSA 1EFWA 3FPPA 1HTLD 2K5WA 4LF6Q 5C0XJ 4LNQA 3CCSA 4KHPQ 1XPOA 2E5LQ 4X6AH 4GN3B 1LM0A 2UU9Q 4CKCA 1WYDA 4OWTB 4A3DG 1M4VA 4JI1Q 3V05A 3HOYH 3BS1A 1UE5A 3H0GB 3DWAA 1HQRD 2AQ2B 2MQHA 3HOWB 4I7AA 2QW7A 4OIJA 4MHEA 5KNCA 4KY7A 3ULJA 4ODGA 1H9RA 4C1NI 3FDTA 1FVIA 1LT6D 5EKIA 1SR3A 1ICFB 4N8X1 2M00A 1VQJA 4JI6Q 2F0QA 4NXMQ 1EU3A 1GJXA 4YCUA 3W1BA 1CHQD 2K6AA 3TBIB 1F77A 5JEAH 4OX9Q 1Q1EA 4JI8Q 4HJ9A 4RKBA 5GAGC 3S1MH 1SAPA 4IO9A 3HOUH 1VQIA 2F3WA 1FGUA 1HZBA 2K1BA 2J0TD 4CGYB 4IFDJ 2NVTH 1XPUA 1TXYA 2EIFA 4O2DA 2VL6A 1YIJA 4B3SQ 1WFQA 2AKWB 1N36L 1AZQA 3ICEA 5HGQA 3K58A 1VQLA 4HEDA 3DXJC 1HR0W 1Q1BA 1R9TB 4WRDA 5TSSA 2PZWA 1LACA 1A6XA 4IUNA 3MXNB 2FXQA 3BVMA 1CT1D 2LXJA 4C3JB 2H5XA 4XT1B 4ZKCB 2KBNA 2YV5A 1QILA 1AE2A 3PGZA 2YU9H 4R4IA 5IP7H 1TWFB 4RGNA 1F9SA 4DR6L 4X3SA 3UE1A 4C2MH 1K9MC 3CAMA 2OWOA 2M2LA 1UEAB 1NE3A 3SK8A 3ULPA 4DUYL 3RZDH 1EZ6A 4DR4L 3FEWX 1IBLL 1EWCA 2KHIA 3HEJA 2ICIA 3FKIB 2CQOA 3J80c 1C48A 4GNXA 2BA0A 2UUBQ 3CRLC 3QG1A 4PQXA 2R7ZG 3R3OA 2F0GA 2C9OA 5K36H 3OWEB 1Y1VH 1EUJA 3RLFA 1UWVA 4KMUC 2QEJC 1LTTD 1B8AA 1S40A 1SE4A 5EKLA 1XX8A 4CKEA 4A3KH 2DNCA 4GKKQ 4Z9CB 1JCKB 1K83B 1UEBA 1TWGB 5DNFA 2Z4IA 4A3IH 5G3LF 3M4OB 4F88A 5C4ZA 3F2CA 2JA7H 1ESRA 2NWGA 1ENAA 5M5WB 1VQGA 3MZ5A 2JEBI 1EY8A 3H0GG 1L0WA 1W6JA 2I5MX 4HCEA 3HOWG 3CCJA 2WAQE 2A73B 3OTOQ 1RHPA 3CXCA 4AQYL 2Z4HA 4KHZA 2F0VA 3NEMA 3JC66 2BE5C 1PRTC 4L5RC 1GHJA 2NVXB 1P8LA 1B9NA 3EA6A 1Y1WB 4ME5A 1V1PB 1GUGA 1O7IA 4G7HC 1G6PA 4XYOA 3MAQA 5C3EH 1F9PA 4LF8L 1BDOA 4KJOA 4L5QA 4DXFA 4GLXA 1MJEA 2K50A 3FPUB 4LFCL 2ZXRA 3S1NB 1LV9A 4FXDA 3SDZA 1PTOC 3T1HL 2B2VC 3G71A 4HSVA 2JXMB 1EYCA 2FFKB 4HR7B 2XSCA 5C44B 1GO3E 2RBMA 3BVZA 3T1YL 1FJGL 4UP9A 3ONAB 5IGDA 1Y8OB 2BDOA 1TWHB 4R8NA 5JOBA 3H3VC 2G9HD 3NTIA 4IPCA 1SYGA 4QUCA 1W2BA 1VQ8A 3LNNA 2OTJA 5C4XB 1UUPA 4LUOA 1JC7A 3K57A 2Q2IA 5M3MB 2PI2A 4H13C 1KTKA 5C5MA 2K4KA 5D3IB 4NDXA 1HA5A 1TU2B 2Z6BA 4C3JG 4DV1L 1KNEA 4DR3L 2Y0SB 1NR2A 2V4DA 4QY7A 1RCVD 1XNQL 4GZYC 1ZYRC 2KUMA 5K5PA 2R7FA 1RTOA 4HMIA 1I4QA 2KEEA 3TS2A 2X6LA 1STGA 1NBWA 5EGTA 3IAYA 4B3RL 2KHSA 2A1AA 4IUPA 5JEAJ 2MFIA 2OQ0A 3FKIG 1S4ZA 3DUZA 2EYFA 1MIUA 2UUBL 4DUZL 3UDXA 1CI3M 5J1ZA 3PUVA 5IWAL 4J15A 3KK7A 1K28A 2HIVA 3GP7A 4TVAB 2MPMA 1IZ6A 2FMCA 1PRTB 4IUQA 4UP7A 3KLSX 1RKNA 4ZYSA 4FDBA 3BDCA 3PO3B 2KCTA 4G57A 2JA8H 3PUWA 1DJRD 1QUQB 1YITA 2EY2A 2CCZA 2SNMA 5AJ3L 1PTOB 3ER0A 4BA2I 2JK8A 2VS1A 4HIMA 1YNNC 2UUCQ 4NB3A 1DD2A 5HURA 2EZVA 4XDXA 4ID6A 3OTOL 3AQQA 2NN6I 4NPSA 2HHHQ 4X65Q 4BS9A 4KJNA 1BQQT 1IW7D 1X3GA 5EKKA 2AWNA 2C5CA 3C1EA 5E4XA 4DK3C 1YHQA 4K0KQ 3S16H 3A5UA 3I4MH 1VQFA 2HIXA 2QEXA 1U4MA 2LY7A 1D2BA 1W6KA 1Y1WG 2VXWA 1GVPA 2JA6B 4UP8A 2HDLA 2F0OA 4LK1C 3GTQH 1VQHA 3E3XA 1KXLA 1Q8IA 1PH2A 3I8ZA 4DU9A 5BN3A 5LMNQ 4IPHA 2A69D 2C35B 3S9WA 4K14A 5FOBB 2OCEA 5I9PA 5C44G 1E22A 3J7YW 5M3FB 4LFAL 1D1IA 2PQAB 3D6WA 2CKZB 1FYCA 4CJ2C 1D8LA 2F0FA 4DV0Q 1O7ZA 2JA5H 4LUVA 3BYYB 3MXPA 2B2TC 5C4XG 1TVXA 1E24A 4KN7C 5M3MG 3PV0A 3S1QH 2ZTDA 2E76C 5KNDA 5IYBG 1A2TA 3L7ZC 3U50C 1STHA 4CJ0B 5M5YB 4LUZA 5IY0A 1TT2A 3CCMA 4HCSA 2Y0SG 4GOPC 2F0WA 2UXCL 3K80C 1Q82C 5JJKA 3NP8A 1X3EA 1EWHA 1YEZA 2F3IA 3E0EA 5CGKA 1B2TA 2H1EA 1G2SA 2J4XA 4K6DA 4YIJA 4DKAC 2B63B 4RCOA 4IOCA 5A2QE 2NVQB 2B3GA 4CKBA 5C0XH 4PMCA 4C1NK 2K5DA 4IZ8A 4LW1A 4R4CA 3RD4A 4QCLA 1B3QA 1B7YB 1X3PA 3RNUA 2UXDL 1PFSA 1M90C 3K5NA 3QWNA 4RG1A 3SK6A 1JICA 1TS4A 3QOLA 2Z0SA 4LF9L 3CKIB 1EY9A 1CKNB 2WKDA 3QIAA 2LS01 1EQRA 1G91A 5KNBA 2H4OA 2F0JA 1L1OC 5M5XB 3WWVA 4EQOA 1HQMC 1V1OA 2L4NA 3PO3G 1Z47A 5FLMG 1KD1C 3CD6A 4KD3A 2OQKA 4MNOA 4JI2Q 3TEHB 1WTPA 2GA4B 1I94Q 4PMBA 3RR5A 5I4DA 1WCMH 2YTXA 3TQYA 4IFDH 4R1JA 3G6JB 4YHHQ 4ILWA 2QCPX 1BOSA 2IX3A 4EQNA 4A3GH 2E2HB 1SSOA 2GVAA 3GV3A 1I6HH 2XRQD 4A93H 2NZHA 3EROA 3DLLA 4R4TA 1Y14B 1EIYB 3HOZH 1GM5A 2WFWA 1QE6A 2WIIB 5ELCA 4K8IA 3QJYA 3MTSA 3S15B 3KOJA 3PCOB 3PF4A 5KIXA 4X62L 3ZYYX 2F0NA 2PMZE 2JA6G 3HOVB 1D1KA 2F0KA 1STNA 5LMNL 3H94A 1PRTF 3OW7A 1Q8KA 1TS5A 2B2UC 1KIXA 1IBML 3W2DA 2ZJPA 4GOPB 3D4WA 4BY1B 3LWEA 4QIWE 2WKCA 2RA4A 4A3FB 3I4OA 3KBXA 2O5JC 3CPFA 5M3FG 3D4RA 2ZTEA 4HIKA 1DYQA 2E2DC 4K6LA 5JJLA 1PTOF 1CA5A 1PFBA 4L8JA 5G3LD 4ZKBB 2Z9HA 3HS0C 3ERQA 4JI5L 1A3TA 5CBAE 1X6OA 2L12A 4UY8C 2E2IB 3D31A 4RMFA 3NPPA 2RQXA 1MD2D 3K5OA 4C3JH 3TDQA 1YHAA 4PNYA 2RDFA 2CW0D 4B3TQ 3BZKA 1V43A 1SFOB 5FLXL 3CHBD 1TWFH 2TSSA 2TMPA 3NTHA 3R2IA 3OOCA 4G7OC 1HPCA 4DV7L 3GTLB 1CSQA 2X69A 1L1OB 3S17B 4DA2A 1BNZA 2B29A 1AW7A 1IL2A 1GKHA 4P74A 4TKOB 3GTKH 2HCIA 2Q2HA 3HRZC 4NP5A 4BWGB 5FO8B 2B63G 1XPRA 5C3WA 3OW2A 1LTID 3D0FA 2Z6KC 3TN2A 3SE0A 2F1MA 3NBHA 4BXXH 1N32Q 2EYJA 1UE1A 3OWFA 4H02A 1STBA 5KGUA 1J9OA 2PNRC 1I3QB 5EPKA 1HA6A 3MFYA 3C2PA 4LFBL 1I4HA 4HJ7A 2ZXPA 3A8IE 1SJED 1Q46A 4FVMA 4K2KA 4KI0A 2R92H 2IW3A 2WP8J 1K0RA 1CKNA 1I4GA 4WORA 1S5DD 1MSGA 1EY0A 1HUNA 1STYA 1JJ2A 4DR6Q 3JAMc 3NXWA 2K14A 1H9SB 3G4SA 4POGA 4DUYQ 4R4OA 5CV4A 2Q8RE 4NXNL 1IBLQ 4A3EB 1HZAA 3A8JE 4NKLA 5JVG3 1EQTA 1CTMA 2VB3X 4DV2L 4Y7NH 4JBKA 1VS0A 2RDGA 2X6GA 1JOOA 1E2WA 1KRTA 1D7QA 3MWYW 1SYBA 1NSNS 2DUDA 2A6HD 4XIGS 1B70B 2B2TA 2SEBD 3A54A 1U4LA 4RWSC 3EFXD 4HSPA 5C5LA 3HOVG 4A3CG 3CPWA 4H44C 5H1SE 2CHBD 2RCFA 1PH3A 3S2DH 1SN8A 5BR8L 3PIOA 4QIWB 3TP7A 2D2CC 5C44H 1IHZA 3D4DA 2LKVA 4JW0A 1CM9A 1Y8PB 2ZT9C 1QWYA 2EYHA 3PO2H 4BY1G 4GOPA 2VW9A 1PZID 3I4NB 3SK5A 4A3FG 2AHOB 3OPOA 4B9WA 1QCBD 1HH2P 4AQYQ 1PH7A 4APVA 3NQTA 3CP0A 5C4XH 1PH8A 4KD4A 5GROA 3FVQA 1C9OA 5M3MH 3T4AC 2A8VA 1MI2A 2AQ1B 2K28A 2AUKA 1U4PA 1GUSA 3KJOA 4B3TL 5IYBH 4LF8Q 1QVFA 1SNQA 4LF4Q 2NZ1D 4DV6L 2YTVA 3P20A 4LFCQ 3UDFA 4UHVA 1QVGA 2JQOA 3T1HQ 4B3ML 4U673 1BBUA 1LTBD 2WB1E 1S72A 5EQ0A 4QMGA 3QB3A 1NMGA 1E1OA 1XWEA 5IE8A 2DNEA 1YBYA 2IL8A 1H95A 1Z9FA 3URYA 3T1YQ 3KDFB 3S2HH 1O7YA 3CMEA 3J80i 4GKJL 1EY7A 1FJGQ 3ZJYC 1MGSA 4ALPA 3HZXA 2VUMB 1N32L 1KNAA 3AYHB 4J8QA 3I55A 1F9QA 1NUCA 2UXBL 3STBC 2DJFC 3BJUA 4Y52H 3I72A 3S1RB 1JB3A 1GHKA 4DNRB 1K8OA 1J5EL 3D3RA 4RFBA 5D3DA 1VQMA 1R4QB 4DV1Q 1I5FA 3GTMB 5FKAC 4DR3Q 3I56A 1Q12A 2KVMA 3MC0B 4QB4A 4JI7L 5JJZA 1XNQQ 1XNRQ 4LAAA 4P2CB 1Q90A 5KRUA 2E8GA 2XN9C 1CFMA 1D5XC 1E2ZA 1AH9A 1SNMA 2A6EC 1KRSA 1TWCB 1JB7A 1EIHA 3GTOH 1HNZL 3MXUA 3GTGB 5J39A 4C3IB 2D62A 4L5TA 1JR0D 2K5QA 2EY1A 1H9SA 1HFGA 4OELB 4B3RQ 2F4VL 1KDAA 2E75C 5JAVA 5J22A 1TWAB 2B2WA 4OHJA 2F4IA 4A3EG 3Q6SA 4DR1Q 1TS3A 4DUZQ 4C3HH 3DEOA 4V0BA 3H3VH 4BA1I 4J6HA 2CQAA 2KCMA 1N9WA 5IWAQ 1K73C 1PZKD 3K7UC 2NBFA 1O78A 2L5TA 4A3MB 2K5VA 1CUKA 3RUZA 4BBSB 1SMYC 2JA6H 1B50A 5C0XI 4IALA 3TP6A 4OIKA 2R7DA 1GOZA 1ET9A 3O13A 4YWLA 4QUFA 1SXTA 3ITPA 3T53B 5FJ8G 4DGZA 1CKOA 1VQOA 5LL6X 4R4QA 1LTRD 4DN4M 5AJ3Q 2EXDA 3CQZB 4XT3B 1I4XA 1DCZA 1MHWC 1KQSA 1I50H 2IX0A 1MKHA 1LUZA 3TP5A 5NUCA 2FJ2A 3GTPH 1WVLA 1IBKL 3I4NG 2F52A 3RZOB 4FF2A 2EYLA 3CW2C 1DXMA 1YNJC 4R9WA 2D5DA 5IGBA 3KLSA 5IOCA 4YY3Q 1NMFA 2B39A 3W3AA 5EPJA 1VQCA 4CDDC 1LTAD 4MTNA 2YYZA 4XQJA 1IYJB 1SEBD 3V2TA 3U58A 3SVMA 2Z6KA 4LF4L 4ULLA 4IFDI 1YJNA 3T13A 2NVYH 1KAAA 5LMUL 2I46A 3B6YA 4OO1I 2HQEA 2E2JB 2WB1B 1LTGD 1A63A 4OO1G 2N55A 5C4HA 4JOIC 4A3LG 4IOAA 4QF4A 3SR1A 2MUYA 3DM3A 3GTJH 4A3JB 2A5HA 1U0LA 3K5LA 2MP1A 5IP9H 5BN4A 3AFQA 3M3YH 5HY6A 1X54A 4LFAQ 3N52A 5C4JH 2BE5D 1HNXQ 1PRTD 2PW7A 2N88A 3CU7A 3PIPA 3D8GA 1Y69U 4L5SA 3K7AH 4AYBE 1W3SA 1GXDC 3PUZA 3PSIA 2VUMG 1PV4A 2E74C 2JYOA 3TS0A 2K75A 3KBGA 3EJIA 4DFAA 3HOYB 1KLUD 1EOTA 3E0JA 1I6VC 3MXNA 1A62A 1CQFA 1PTOD 2XGTA 3NENA 4KKUA 4F8MA 1G6ZA 1SE2A 1K3RA 4K8JA 1VF5C 1GUOA 2OXPA 4M1UB 2O5IC 3NWSA 4ZUJA 1KLGD 4A3BB 2JP1A 4OWXB 3HOXH 1YI2A 4HTHA 1XNRL 2NTTA 2UXCQ 4X66L 3A55A 1FNWA 1ML0D 4PMWA 4XXEA 1SNDA 2Q2UA 1DGSA 3KF8B 2ZJQA 3S1MB 3E6ZX 3HOUB 2R93H 3TRZA 2DY7A 4S3SA 4C3IG 2EPBA 1ILPA 4UAIA 3BZCA 2E2HH 4FXGC 4DR1L 4P73A 1A15A 1E7ZA 2UXDQ 1F2YA 3K0YA 3T51B 3OHXC 3RN2A 1JWUD 1N34L 5LHY1 4LF7L 1GUNA 2IPKD 4LF9Q 5IT9L 4V190 3VYTA 4A3MG 3F2BA 2B2YC 4BBSG 1ZYRD 2JE6I 3K8AA 4A75A 5DLQE 2EVBA 1NCVA 1HNWL 1PLFA 4A3DH 4LMQD 1IW7C 5I6YA 2RKSA 1ONLA 2IHFA 5ELFA 4YWKA 1LT5D 4BY1H 1A0IA 2WAQB 1PVOA 4RHSA 2LXKA 4IUTA 2NN6G 2O2LD 3PF5A 2EJMA 4YY3L 2EYPA 1SNOA 4DV4L 4C2MB 4IJLA 3I90A 3I3CA 5IGGA 3VDYA 4JBJA 2VQEL 2BDNA 1SNPA 5EBCA 5FLXE 4X3TA 1V1PA 1RDPD 1O7LA 4POFA 3A7LA 4X62Q 2IHEA 2WINB 4YCVA 5I2YA 3P7JA 4OGQC 1SE3A 2WB1G 4CJ1B 5IGFA 2WACA 3VYSA 1E0BA 1BBWA 1VQNA 3JAME 1YNND 3Q24A 1I4PA 1IBMQ 2EYMA 4A3JG 2B8FA 1PMRA 1Y1VB 5JVH3 2V1CC 3U9SA 4N9PA 1HNXL 2Z8LA 4B08A 4F7XA 4AYBB 2PNHA 3IL8A 2CWPA 3J7AV 3OMCA 1FNVA 4IURA 3L2PA 1QOHA 1OXVA 1HZ9A 5CV5A 1AZPA 2I07B 2ICEC 2JA7B 4JI5Q 1HZCA 4FF1A 5T1GA 3Q22A 3MEFA 1YNXA 1VCIA 3M9BA 1KC8C 3H15A 3HOYG 1UE7A 1FR3A 1QZGA 1CZWA 3VR2A 4UDUC 3J7ZC 1SLJA 4FNFA 2PYKA 1SBBB 3QOJA 4A3BG 4PZ8A 1HR0L 1X65A 3UDIA 4BY7B 2NZOA 5GAHC 1PFNA 3IKJA 1JQYD 2FMMA 3SXHA 1NJIC 2SNSA 2K05A 4KLKA 5C3EB 4DV7Q 1D5ZC 3F8TA 1PZJD 1XXGA 4CHTB 3OIQA 2EY5A 2XWJB 5JEAG 1X9NA 4FP5D 3HOUG 3I4LA 1LT3D 4P75A 1VQAA 1ILQA 3W5OA 2JJQA 1EEFD 3MHBA 2R7ZH 4WJWA 5M9OA 1EY5A 4FXKC 4L6TB 3HGBA 3BZDB 3PMFA 1AEXA 1RD9D 3I2ZA 3CCUA 1BXTA 2CFMA 2F0UA 2BH8A 4DV5L 4LFBQ 2D0OA 4X64L 4DPGA 3HP3A 1JORA 4AIMA 1D6EC 5FJ8H 1UE6A 4RHRA 4O1NA 2F0MA 3M4YA 4JCVE 3A5ZB 2DJGC 3DMUA 3M7NA 5J3BA 1SDFA 1QUQA 1JJGA 2L15A 3H0GH 2B2VA 3HOWH 4K5XA 1B44D 5JPNC 2Q8TA 2WAQG 3H6MA 4NXNQ 5IP7G 1GD7A 5IYCG 3RLNA 5IYDG 4DV2Q 1EIGA 1FNUA 4QJFA 1Q3LA 1STAA 2EDGA 2PQEA 4JK1C 2K32A 1S5ED 2L55A 1D5MC 2DY8A 1Z6HA 1UAPA 1H9JA 1C7YA 1SROA 2F0DA 2EOTA 3J81L 5BR8Q 5D65A 4ABNA 3VYRA 5GAEC 1SNCA 2BA1A 2VB2X 1U4RA 4DR7L 5K36G 1Y1VG 1F2MA 3R2TA 4DAMA 1PYBA 3I91A 5IGCA 1PH4A 2KECA 1R9TH 2PQAA 5EJWA 4AYBG 2CW0C 3EQLC 1QB5D 1JMCA 1FGBD 4LF5L 1CKMA 1OXUA 2JA8B 4KKTA 4OL7A 2HT1A 5F2DA 1V8QA 3P1HA 2YTYA 3E9HA 4BBRB 3BG3A 4B9XA 4PZ6A 2JA7G 1BCPC 2XRSD 2I5HA 3FRPB 1OXTA 1U9RA 1JT8A 3D6CA 3KUPA 4KHVA 3VR6A 2MO0A 3J81c 1HCZA 4JI4Q 1L2FA 2NTSA 1VQ9A 4DV6Q 4FO2A 3QO2A 5E7NA 3JAMi 2EJGC 2VY3A 3S16B 2BH2A 3I4MB 4B3MQ 5C6AA 4BY7G 1WTWA 4U68A 2K04A 5CORA 2B2YA 1CK1A 3G48A 5C3EG 3PIO3 2FHTA 1FL0A 2KA7A 4ZAIA 4IN3A 1LT4D 3GTQB 1PFMA 3FKIH 1HRJA 4GKJQ 2QILA 3FMCA 4HIOA 1N33L 4JV5L 5CV6A 1EZ8A 4E6IA 1M1KC 1DOLA 1NTGA 2UXBQ 1I4RA 3NTKA 4DR5L 4EGVA 2MJ8A 4KK7A 5FLXc 2G5DA 1B1ZA 3N6RA 4P71A 4HJ5A 3F2UA 1J5EQ 4MZ9A 2JA5B 3U4VA 1QG7A 3OYYA 1ASYA 4OEMB 4KY5A 3CF5A 1F2ZA 1WTQA 1K83H 1TWGH 2PI2E 5FO7B 4JI3L 4JI7Q 3NELA 3M4OH 3F2DA 3S1QB 1TR5A 4PG3A 5M5WH 1FD7D 3CQZH 1PH5A 4NW2A 1BKBA 1HNZQ 1J6QA 2RDHA 1E2VA 2NN6H 3GO5A 1ZKOA 2F4VQ
chains in the Genus database with same CATH topology
4C3HH 4DK6C 1IZ6A 4JOIA 3H3VH 1XMQL 4BA1I 3RZOH 3I4NH 2KCMA 1N9WA 5IWAQ 4UP7A 2N3SA 1K73C 3E9IA 3K7UC 1OXXK 2NVXH 4GS3A 2ZJRA 4FDBA 2K5VA 1CUKA 2KENA 1Y1WH 1XMQQ 2JA6H 5C0XI 2KCTA 3HFZB 2R7DA 1VQ7A 3PUWA 3KF6B 2JA8H 3KFUA 1QUQB 1YITA 4YWLA 1OTCA 2UUCL 2IY5B 5FJ8G 1NY4A 1P16A 2ALYB 2CCZA 3J81i 5AJ3L 3ER0A 4BA2I 2JK8A 1CKOA 2VS1A 1KHIA 2HHHL 3S1NH 4HIMA 4X65L 1VQOA 4R4QA 4NB3A 2UUCQ 1S3OA 3AFPA 1ASZA 5AJ3Q 4A3LH 4K0KL 2EXDA 3OTOL 3AQQA 2AWOA 2NN6I 1PH6A 4NPSA 2HHHQ 4XTCS 4GN5A 4X65Q 1KQSA 1YHBA 3CCLA 4A3JH 1I50H 2IX0A 1MKHA 1LUZA 3H3VI 1X3GA 4DK3C 2AWNA 3GTPH 1YHQA 1IBKL 3I4NG 4K0KQ 2F52A 2UUAL 3S16H 3A5UA 3I4MH 1VQFA 2HIXA 2RCNA 3CW2C 1TWHH 2QEXA 4JYAL 4YY3Q 1C0AA 2RHQB 3UDGA 4DR2Q 1Y1WG 1IBKQ 1NMFA 2UUAQ 1GVPA 4UP8A 1VQCA 4JYAQ 2JA8G 1YJWA 4MTNA 2VUMH 2YYZA 3J81j 3GTQH 1IYJB 3U58A 4A3KG 4LF4L 2Z6KA 1VQHA 4IFDI 3CC2A 1YJNA 2NVYH 4GN4B 2JA9A 4BBRG 1EIFA 1KXLA 4JI0Q 5LMUL 4GNXC 4A3IG 1PH2A 3B6YA 2K5HA 5LMNQ 4OO1I 4IPHA 4JI4L 1A63A 4OO1G 1WI5A 4JOIC 4A3LG 2C35B 4IOAA 3S1RH 4A3BH 2OCEA 3DM3A 5LMUQ 5C44G 1E22A 2ID0A 3GTJH 4DV0L 4LFAL 3GTMH 2PQAB 1U0LA 3PUYA 3RLOA 2CKZB 1RL2A 3I4MG 5IP9H 1D8LA 4PZ7A 3G6EA 3AFQA 3M3YH 4DV0Q 5HY6A 4WJ4A 1X54A 2D0PA 2JA5H 4LFAQ 5C4JH 4LUVA 1HNXQ 1L1OA 4ME3A 5EAYA 3PIPA 5C4XG 4L5SA 2R6GA 3K7AH 4AYBE 3CCEA 1E24A 1W3SA 3PUZA 3PSIA 1TWCH 1PV4A 2VUMG 5M3MG 3GTGH 4C3IH 1SE8A 3PV0A 4AH6A 2K75A 3K0XA 2ZTDA 3TS0A 3EN2A 3S1QH 5JJIA 3ULLA 5IYBG 1TWAH 3L7ZC 4YCWA 2CWAA 3U50C 4LUZA 5IY0A 1A62A 3CCMA 3NENA 2XGTA 4JBMA 2Y0SG 4GOPC 2UXCL 2MO1A 3K80C 1K3RA 1Q82C 5JJKA 3M4QA 1T9HA 1X3EA 4QGUA 4OWXB 3HOXH 4HIDA 2K5NA 4IJHA 4P72A 1V9PA 1YEZA 2F3IA 3E0EA 1YI2A 1N36Q 1XNRL 2UXCQ 3EIVA 1EOVA 4O0AA 2GVBA 4A3MH 4X66L 5IP9G 4DKAC 4DV3L 4BBSH 3PO3H 4YWMA 5FLMH 4IOCA 2JA5G 2B3GA 3Q8DA 4PMWA 3IRBA 2Q2UA 3LGJA 1DGSA 3AEVA 3FP9A 3KF8B 4X66Q 1VQPA 2ZJQA 2IX1A 3U4ZA 4DV3Q 1PA6A 4LW1A 4R4CA 2R93H 3TRZA 1B7YB 3RNUA 2UXDL 1PFSA 1M90C 4A4IA 2E2HH 3BZCA 4DR1L 3M85A 4P73A 4RG1A 1E7ZA 2Z0SA 2UXDQ 3STBD 1XMOL 4LF9L 2Y0SE 1MJCA 1CKNB 5IYCH 3RN2A 1N34L 4LF7L 2IT1A 5IYDH 1EQRA 3HOXG 3S14H 1VQBA 3F1ZA 1XMOQ 1YZ6A 4LF9Q 1L1OC 3K81C 4HJ8A 2VQFL 3F2BA 4A3MG 4JI2L 2EQSA 3WWVA 1N34Q 1JE5A 1I94L 4LF7Q 3BU2A 1PH1A 2JE6I 4BBSG 3K8AA 2ZM6L 4A75A 1Z47A 5FLMG 1KD1C 3PO3G 5DLQE 3CD6A 2OQKA 4MNOA 1HNWL 1VQEA 4JI2Q 5C0XG 3TEHB 3KF6A 4YHHL 2VQFQ 4HJAA 3J7A5 1I94Q 4A3DH 3RR5A 4DR4Q 2ZM6Q 4GNXB 2R93G 1WCMH 2YTXA 3TQYA 4R1JA 1YJ9A 1HNWQ 4YHHQ 1K8GA 1VQ4A 2E2JH 4A3GH 2GVAA 1I6HH 4EX5A 2IHFA 4BY1H 4IPDA 4YWKA 1G51A 2OTLA 1KL9A 1LTLA 1A0IA 1XTDA 1PVOA 4A93H 2NZHA 2LXKA 3DLLA 3KLWA 4R4TA 2NN6G 1Y14B 3PF5A 4YY3L 1EIYB 5M3FH 2HQLA 3HOZH 3L0OA 3W1GA 4UPAA 2WFWA 1GM5A 4DR2L 4LF6L 4DV4L 3GDEA 4DR7Q 2NVTH 4IJLA 3HKZG 3VDYA 4KHPL 2E5LL 1EFWA 3KOJA 3PCOB 4GLVB 1HJPA 4JBJA 5GQOA 4X62L 2VQEL 2UU9L 3PF4A 4LF6Q 4JI1L 4DV4Q 1U5KA 2PMZE 5C0XJ 2JA6G 4A76A 4LNQA 3CCSA 4POFA 4JI0L 1XPOA 2E5LQ 4KHPQ 4GN3B 1LM0A 2UU9Q 2VQEQ 4X6AH 4X62Q 1WYDA 4OWTB 1VQDA 5LMNL 4A3DG 2IHEA 4JI1Q 1Q8KA 1WCMG 4IPGA 4YCVA 3HOYH 5ELOA 1UE5A 4IFDG 1LYLA 5LMNW 1X55A 1KIXA 2MQHA 1IBML 4A3GG 2LSSA 2WB1G 5M5YH 2ZJPA 4GOPB 1BBWA 1VQNA 4QIWE 3ULJA 4TQUS 4A93G 4JI6L 3GD7A 3I4OA 1FVIA 1IBMQ 2A19A 4BY7H 4NXML 3CPFA 4A3JG 5M3FG 3HOZG 2ZTEA 4HIKA 1SR3A 2V1CC 5JJLA 4OX9L 4JI8L 1HNXL 1VQJA 4JI6Q 2PNHA 2B63H 4NXMQ 2ATWA 4YCUA 3W1BA 2NVQH 4JI5L 3CCVA 1X6OA 2CWPA 4DAYB 4OX9Q 4UY8C 3D31A 1Q1EA 4RMFA 4JI8Q 3L2PA 1OXVA 5GAGC 1HZ9A 3KDFA 4HJ9A 3S1MH 4IO9A 3HOUH 1VQIA 1FGUA 1HZBA 4C3JH 4JI5Q 1YHAA 1HZCA 4B3SL 1V1QA 4IFDJ 3MEFA 1YNXA 1VCIA 3I7FA 1KAWA 3M9BA 1KC8C 4B3TQ 1XPUA 3BZKA 1YVCA 3H15A 1UE7A 1V43A 1TXYA 3HOYG 1QZGA 2EIFA 4O2DA 2VL6A 1YIJA 4B3SQ 3J7ZC 1SLJA 1TWFH 2Q2TA 1WFQA 4JG2A 2AKWB 1N36L 3ICEA 5HGQA 1VQLA 4A3BG 1G291 4PZ8A 1X65A 1EYGA 4DV7L 1HR0L 1CSQA 1RIPA 4JC0A 1L1OB 3UDIA 2NZOA 2B29A 5GAHC 1NJIC 1HR0W 1IL2A 1Q1BA 1GKHA 4P74A 4KLKA 5M5XH 1PHJA 3GTKH 2Q2HA 1HR0Q 3TREA 4DV7Q 1VQ5A 3F8TA 2B63G 1X3FA 1XPRA 3OW2A 3A74A 5JEAG 1X56A 1Q81C 1X9NA 3D0FA 2Z6KC 3FHWA 3MXNB 3HOUG 2FXQA 2ES2A 4BXXH 2GN5A 1N32Q 4P75A 1VQAA 2LXJA 1UE1A 2N78A 2H5XA 4H02A 3W5OA 2JJQA 2KBNA 2YV5A 2ZTCA 2R7ZH 1AE2A 3PGZA 2YU9H 4R4IA 4HJ7A 4LFBL 1Q46A 4KI0A 5IP7H 2R92H 3I2ZA 3CCUA 2WP8J 2CFMA 1K0RA 1CKNA 1QVCA 4DR6L 2KHJA 2BH8A 4DV5L 4LFBQ 3UE1A 2D0OA 4C2MH 1N8RC 4X64L 1K9MC 4DPGA 3CAMA 2OWOA 4AIMA 3S15H 3S24A 1NE3A 5FJ8H 3ULPA 4DUYL 3RZDH 1JJ2A 4DR6Q 3JAMc 1UE6A 4DV5Q 4X64Q 4DR4L 2K14A 1IBLL 1PYSB 3HOVH 4JCVE 2KHIA 4A3CH 4DNIA 3ERSX 2CQOA 3A5ZB 3G4SA 4POGA 3M7NA 4DUYQ 3J80c 5J3BA 4R4OA 2RHSB 1QUQA 4BXXG 1JJGA 4NXNL 2BA0A 4GNXA 1IBLQ 2L15A 2RF4A 3H0GH 1HZAA 2UUBQ 3HOWH 2R7ZG 3CMAA 2WAQG 4NXNQ 4OONA 4DV2L 4Y7NH 4A3FH 4JBKA 2K52A 4WJ3M 1VS0A 5IP7G 2R92G 1GD7A 1Y1VH 1EUJA 3RLFA 5IYCG 4GKKL 1UWVA 1KRTA 1D7QA 3RLNA 5IYDG 4DV2Q 5IT9c 1VQKA 1B8AA 1S40A 2DUDA 4QJFA 4A3KH 2DGYA 3CC4A 4GKKQ 4XIGS 1B70B 2E2IH 2N8NA 4GLAC 1UEBA 4BBRH 1PH9A 3HOVG 4A3IH 4A3CG 3CPWA 3F2CA 5H1SE 2JA7H 1PH3A 3S2DH 1SN8A 5BR8L 1VQGA 3PIOA 1C7YA 1SROA 4EQ5A 2JEBI 5C44H 3H0GG 1L0WA 1SFOH 1SMXA 2I5MX 3HOWG 1A8VA 5BR8Q 3CCJA 1XJVA 2WAQE 3PO2H 4BY1G 3CXCA 3OTOQ 2VW9A 3CCRA 3KYHC 4GOPA 4AQYL 4KHZA 5GAEC 3NEMA 2BA1A 4A3FG 2AHOB 3JC66 3GTLH 4JBWA 4L5RC 4DR7L 3S17H 5K36G 1P8LA 1Y1VG 1E1TA 4DAMA 1PYBA 3SGIA 1HH2P 4AQYQ 1PH7A 1PH4A 4APVA 1O7IA 3CP0A 5C4XH 1R9TH 1PH8A 2PQAA 3HKSA 1G6PA 3PUXA 5GROA 4AYBG 5C3EH 1JMCA 3HKZE 1QZHA 4LF5L 4LF8L 1C9OA 1CKMA 1OXUA 5M3MH 1EQQA 4L5QA 2A8VA 2VNUD 2HT1A 4QQBX 4GLXA 1WJJA 1MJEA 2K50A 2YTYA 3E9HA 4LFCL 3KJOA 4B3TL 2I5LX 5IYBH 4LF8Q 4LF5Q 1QVFA 1E3PA 1VQ6A 4PZ6A 2JA7G 1EWIA 5GADC 3T1HL 4LF4Q 3G71A 4DV6L 2I5HA 2YTVA 2I0QA 1OXTA 4LFCQ 1JT8A 3UDFA 2VZAA 2MO0A 3J81c 1QVGA 4JI4Q 1I3QH 1GO3E 2JQOA 3T1HQ 4B3ML 1L2FA 2N49A 1VQ9A 1BBUA 1OXSC 2WB1E 4DV6Q 1S72A 3CCQA 3T1YL 3PO2G 1AE3A 3RN5A 5E7NA 1NMGA 3JAMi 1E1OA 1FJGL 2VY3A 4UP9A 2BH2A 5IE8A 4B3MQ 4IPCA 1YBYA 3A0JA 4BY7G 1Z9FA 1H95A 3T1YQ 3KDFB 3S2HH 3CMEA 3J80i 5ELNA 4GKJL 1W2BA 1FJGQ 1Q7YC 1VQ8A 1CSPA 3G48A 2OTJA 5C3EG 3ZJYC 1FL0A 4LUOA 4ALPA 2Q2IA 2PI2A 3FKIH 1N32L 4GKJQ 3AYHB 4HIOA 1N33L 3I55A 2ASBA 2QA4A 4JV5L 2JEAI 2UXBL 2K4KA 3STBC 4OWWB 3BJUA 4Y52H 4A3EH 3CC7A 1M1KC 4DV1L 1NTGA 1N33Q 4DR3L 4JV5Q 1JJCB 2UXBQ 4QY7A 4DR5L 1SRUA 1J5EL 1VQMA 1IXRA 5FLXc 4DV1Q 1I5FA 2AMCB 1WOCA 1XNQL 2MNAA 4DR3Q 4LWCA 1Q12A 3I56A 2R7FA 4DR5Q 4P71A 4HJ5A 1J5EQ 4JI7L 4MZ9A 3U4VA 1XNQQ 4QL5A 1XNRQ 3OYYA 1ASYA 3TS2A 3EBEA 3NBHB 1NBWA 2E8GA 2XTIA 3CF5A 4B3RL 3M4PA 1K83H 1TWGH 2PI2E 2A1AA 4OXPA 1KRSA 4JI3L 1JB7A 5JEAJ 4JI7Q 3GTOH 1AH9A 1HNZL 3NELA 2MFIA 2OQ0A 3FKIG 3M4OH 2D62A 4L5TA 1MIUA 3F2DA 1BVSA 2UUBL 1K8AC 4PG3A 4B3RQ 4DUZL 3UDXA 5M5WH 2F4VL 3CQZH 3KJPA 1PH5A 4JI3Q 1Q86C 1BKBA 1HNZQ 3PUVA 2QGQA 5IWAL 4A3EG 1J6QA 4J15A 3GO5A 4DR1Q 3UE0A 2HIVA 4DUZQ 2F4VQ 4TVAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H H;  4DK6 C;  1IZ6 A;  4JOI A;  3H3V H;  1XMQ L;  4BA1 I;  3RZO H;  3I4N H;  2KCM A;  1N9W A;  5IWA Q;  4UP7 A;  2N3S A;  1K73 C;  3E9I A;  3K7U C;  1OXX K;  2NVX H;  4GS3 A;  2ZJR A;  4FDB A;  2K5V A;  1CUK A;  2KEN A;  1Y1W H;  1XMQ Q;  2JA6 H;  5C0X I;  2KCT A;  3HFZ B;  2R7D A;  1VQ7 A;  3PUW A;  3KF6 B;  2JA8 H;  3KFU A;  1QUQ B;  1YIT A;  4YWL A;  1OTC A;  2UUC L;  2IY5 B;  5FJ8 G;  1NY4 A;  1P16 A;  2ALY B;  2CCZ A;  3J81 i;  5AJ3 L;  3ER0 A;  4BA2 I;  2JK8 A;  1CKO A;  2VS1 A;  1KHI A;  2HHH L;  3S1N H;  4HIM A;  4X65 L;  1VQO A;  4R4Q A;  4NB3 A;  2UUC Q;  1S3O A;  3AFP A;  1ASZ A;  5AJ3 Q;  4A3L H;  4K0K L;  2EXD A;  3OTO L;  3AQQ A;  2AWO A;  2NN6 I;  1PH6 A;  4NPS A;  2HHH Q;  4XTC S;  4GN5 A;  4X65 Q;  1KQS A;  1YHB A;  3CCL A;  4A3J H;  1I50 H;  2IX0 A;  1MKH A;  1LUZ A;  3H3V I;  1X3G A;  4DK3 C;  2AWN A;  3GTP H;  1YHQ A;  1IBK L;  3I4N G;  4K0K Q;  2F52 A;  2UUA L;  3S16 H;  3A5U A;  3I4M H;  1VQF A;  2HIX A;  2RCN A;  3CW2 C;  1TWH H;  2QEX A;  4JYA L;  4YY3 Q;  1C0A A;  2RHQ B;  3UDG A;  4DR2 Q;  1Y1W G;  1IBK Q;  1NMF A;  2UUA Q;  1GVP A;  4UP8 A;  1VQC A;  4JYA Q;  2JA8 G;  1YJW A;  4MTN A;  2VUM H;  2YYZ A;  3J81 j;  3GTQ H;  1IYJ B;  3U58 A;  4A3K G;  4LF4 L;  2Z6K A;  1VQH A;  4IFD I;  3CC2 A;  1YJN A;  2NVY H;  4GN4 B;  2JA9 A;  4BBR G;  1EIF A;  1KXL A;  4JI0 Q;  5LMU L;  4GNX C;  4A3I G;  1PH2 A;  3B6Y A;  2K5H A;  5LMN Q;  4OO1 I;  4IPH A;  4JI4 L;  1A63 A;  4OO1 G;  1WI5 A;  4JOI C;  4A3L G;  2C35 B;  4IOA A;  3S1R H;  4A3B H;  2OCE A;  3DM3 A;  5LMU Q;  5C44 G;  1E22 A;  2ID0 A;  3GTJ H;  4DV0 L;  4LFA L;  3GTM H;  2PQA B;  1U0L A;  3PUY A;  3RLO A;  2CKZ B;  1RL2 A;  3I4M G;  5IP9 H;  1D8L A;  4PZ7 A;  3G6E A;  3AFQ A;  3M3Y H;  4DV0 Q;  5HY6 A;  4WJ4 A;  1X54 A;  2D0P A;  2JA5 H;  4LFA Q;  5C4J H;  4LUV A;  1HNX Q;  1L1O A;  4ME3 A;  5EAY A;  3PIP A;  5C4X G;  4L5S A;  2R6G A;  3K7A H;  4AYB E;  3CCE A;  1E24 A;  1W3S A;  3PUZ A;  3PSI A;  1TWC H;  1PV4 A;  2VUM G;  5M3M G;  3GTG H;  4C3I H;  1SE8 A;  3PV0 A;  4AH6 A;  2K75 A;  3K0X A;  2ZTD A;  3TS0 A;  3EN2 A;  3S1Q H;  5JJI A;  3ULL A;  5IYB G;  1TWA H;  3L7Z C;  4YCW A;  2CWA A;  3U50 C;  4LUZ A;  5IY0 A;  1A62 A;  3CCM A;  3NEN A;  2XGT A;  4JBM A;  2Y0S G;  4GOP C;  2UXC L;  2MO1 A;  3K80 C;  1K3R A;  1Q82 C;  5JJK A;  3M4Q A;  1T9H A;  1X3E A;  4QGU A;  4OWX B;  3HOX H;  4HID A;  2K5N A;  4IJH A;  4P72 A;  1V9P A;  1YEZ A;  2F3I A;  3E0E A;  1YI2 A;  1N36 Q;  1XNR L;  2UXC Q;  3EIV A;  1EOV A;  4O0A A;  2GVB A;  4A3M H;  4X66 L;  5IP9 G;  4DKA C;  4DV3 L;  4BBS H;  3PO3 H;  4YWM A;  5FLM H;  4IOC A;  2JA5 G;  2B3G A;  3Q8D A;  4PMW A;  3IRB A;  2Q2U A;  3LGJ A;  1DGS A;  3AEV A;  3FP9 A;  3KF8 B;  4X66 Q;  1VQP A;  2ZJQ A;  2IX1 A;  3U4Z A;  4DV3 Q;  1PA6 A;  4LW1 A;  4R4C A;  2R93 H;  3TRZ A;  1B7Y B;  3RNU A;  2UXD L;  1PFS A;  1M90 C;  4A4I A;  2E2H H;  3BZC A;  4DR1 L;  3M85 A;  4P73 A;  4RG1 A;  1E7Z A;  2Z0S A;  2UXD Q;  3STB D;  1XMO L;  4LF9 L;  2Y0S E;  1MJC A;  1CKN B;  5IYC H;  3RN2 A;  1N34 L;  4LF7 L;  2IT1 A;  5IYD H;  1EQR A;  3HOX G;  3S14 H;  1VQB A;  3F1Z A;  1XMO Q;  1YZ6 A;  4LF9 Q;  1L1O C;  3K81 C;  4HJ8 A;  2VQF L;  3F2B A;  4A3M G;  4JI2 L;  2EQS A;  3WWV A;  1N34 Q;  1JE5 A;  1I94 L;  4LF7 Q;  3BU2 A;  1PH1 A;  2JE6 I;  4BBS G;  3K8A A;  2ZM6 L;  4A75 A;  1Z47 A;  5FLM G;  1KD1 C;  3PO3 G;  5DLQ E;  3CD6 A;  2OQK A;  4MNO A;  1HNW L;  1VQE A;  4JI2 Q;  5C0X G;  3TEH B;  3KF6 A;  4YHH L;  2VQF Q;  4HJA A;  3J7A 5;  1I94 Q;  4A3D H;  3RR5 A;  4DR4 Q;  2ZM6 Q;  4GNX B;  2R93 G;  1WCM H;  2YTX A;  3TQY A;  4R1J A;  1YJ9 A;  1HNW Q;  4YHH Q;  1K8G A;  1VQ4 A;  2E2J H;  4A3G H;  2GVA A;  1I6H H;  4EX5 A;  2IHF A;  4BY1 H;  4IPD A;  4YWK A;  1G51 A;  2OTL A;  1KL9 A;  1LTL A;  1A0I A;  1XTD A;  1PVO A;  4A93 H;  2NZH A;  2LXK A;  3DLL A;  3KLW A;  4R4T A;  2NN6 G;  1Y14 B;  3PF5 A;  4YY3 L;  1EIY B;  5M3F H;  2HQL A;  3HOZ H;  3L0O A;  3W1G A;  4UPA A;  2WFW A;  1GM5 A;  4DR2 L;  4LF6 L;  4DV4 L;  3GDE A;  4DR7 Q;  2NVT H;  4IJL A;  3HKZ G;  3VDY A;  4KHP L;  2E5L L;  1EFW A;  3KOJ A;  3PCO B;  4GLV B;  1HJP A;  4JBJ A;  5GQO A;  4X62 L;  2VQE L;  2UU9 L;  3PF4 A;  4LF6 Q;  4JI1 L;  4DV4 Q;  1U5K A;  2PMZ E;  5C0X J;  2JA6 G;  4A76 A;  4LNQ A;  3CCS A;  4POF A;  4JI0 L;  1XPO A;  2E5L Q;  4KHP Q;  4GN3 B;  1LM0 A;  2UU9 Q;  2VQE Q;  4X6A H;  4X62 Q;  1WYD A;  4OWT B;  1VQD A;  5LMN L;  4A3D G;  2IHE A;  4JI1 Q;  1Q8K A;  1WCM G;  4IPG A;  4YCV A;  3HOY H;  5ELO A;  1UE5 A;  4IFD G;  1LYL A;  5LMN W;  1X55 A;  1KIX A;  2MQH A;  1IBM L;  4A3G G;  2LSS A;  2WB1 G;  5M5Y H;  2ZJP A;  4GOP B;  1BBW A;  1VQN A;  4QIW E;  3ULJ A;  4TQU S;  4A93 G;  4JI6 L;  3GD7 A;  3I4O A;  1FVI A;  1IBM Q;  2A19 A;  4BY7 H;  4NXM L;  3CPF A;  4A3J G;  5M3F G;  3HOZ G;  2ZTE A;  4HIK A;  1SR3 A;  2V1C C;  5JJL A;  4OX9 L;  4JI8 L;  1HNX L;  1VQJ A;  4JI6 Q;  2PNH A;  2B63 H;  4NXM Q;  2ATW A;  4YCU A;  3W1B A;  2NVQ H;  4JI5 L;  3CCV A;  1X6O A;  2CWP A;  4DAY B;  4OX9 Q;  4UY8 C;  3D31 A;  1Q1E A;  4RMF A;  4JI8 Q;  3L2P A;  1OXV A;  5GAG C;  1HZ9 A;  3KDF A;  4HJ9 A;  3S1M H;  4IO9 A;  3HOU H;  1VQI A;  1FGU A;  1HZB A;  4C3J H;  4JI5 Q;  1YHA A;  1HZC A;  4B3S L;  1V1Q A;  4IFD J;  3MEF A;  1YNX A;  1VCI A;  3I7F A;  1KAW A;  3M9B A;  1KC8 C;  4B3T Q;  1XPU A;  3BZK A;  1YVC A;  3H15 A;  1UE7 A;  1V43 A;  1TXY A;  3HOY G;  1QZG A;  2EIF A;  4O2D A;  2VL6 A;  1YIJ A;  4B3S Q;  3J7Z C;  1SLJ A;  1TWF H;  2Q2T A;  1WFQ A;  4JG2 A;  2AKW B;  1N36 L;  3ICE A;  5HGQ A;  1VQL A;  4A3B G;  1G29 1;  4PZ8 A;  1X65 A;  1EYG A;  4DV7 L;  1HR0 L;  1CSQ A;  1RIP A;  4JC0 A;  1L1O B;  3UDI A;  2NZO A;  2B29 A;  5GAH C;  1NJI C;  1HR0 W;  1IL2 A;  1Q1B A;  1GKH A;  4P74 A;  4KLK A;  5M5X H;  1PHJ A;  3GTK H;  2Q2H A;  1HR0 Q;  3TRE A;  4DV7 Q;  1VQ5 A;  3F8T A;  2B63 G;  1X3F A;  1XPR A;  3OW2 A;  3A74 A;  5JEA G;  1X56 A;  1Q81 C;  1X9N A;  3D0F A;  2Z6K C;  3FHW A;  3MXN B;  3HOU G;  2FXQ A;  2ES2 A;  4BXX H;  2GN5 A;  1N32 Q;  4P75 A;  1VQA A;  2LXJ A;  1UE1 A;  2N78 A;  2H5X A;  4H02 A;  3W5O A;  2JJQ A;  2KBN A;  2YV5 A;  2ZTC A;  2R7Z H;  1AE2 A;  3PGZ A;  2YU9 H;  4R4I A;  4HJ7 A;  4LFB L;  1Q46 A;  4KI0 A;  5IP7 H;  2R92 H;  3I2Z A;  3CCU A;  2WP8 J;  2CFM A;  1K0R A;  1CKN A;  1QVC A;  4DR6 L;  2KHJ A;  2BH8 A;  4DV5 L;  4LFB Q;  3UE1 A;  2D0O A;  4C2M H;  1N8R C;  4X64 L;  1K9M C;  4DPG A;  3CAM A;  2OWO A;  4AIM A;  3S15 H;  3S24 A;  1NE3 A;  5FJ8 H;  3ULP A;  4DUY L;  3RZD H;  1JJ2 A;  4DR6 Q;  3JAM c;  1UE6 A;  4DV5 Q;  4X64 Q;  4DR4 L;  2K14 A;  1IBL L;  1PYS B;  3HOV H;  4JCV E;  2KHI A;  4A3C H;  4DNI A;  3ERS X;  2CQO A;  3A5Z B;  3G4S A;  4POG A;  3M7N A;  4DUY Q;  3J80 c;  5J3B A;  4R4O A;  2RHS B;  1QUQ A;  4BXX G;  1JJG A;  4NXN L;  2BA0 A;  4GNX A;  1IBL Q;  2L15 A;  2RF4 A;  3H0G H;  1HZA A;  2UUB Q;  3HOW H;  2R7Z G;  3CMA A;  2WAQ G;  4NXN Q;  4OON A;  4DV2 L;  4Y7N H;  4A3F H;  4JBK A;  2K52 A;  4WJ3 M;  1VS0 A;  5IP7 G;  2R92 G;  1GD7 A;  1Y1V H;  1EUJ A;  3RLF A;  5IYC G;  4GKK L;  1UWV A;  1KRT A;  1D7Q A;  3RLN A;  5IYD G;  4DV2 Q;  5IT9 c;  1VQK A;  1B8A A;  1S40 A;  2DUD A;  4QJF A;  4A3K H;  2DGY A;  3CC4 A;  4GKK Q;  4XIG S;  1B70 B;  2E2I H;  2N8N A;  4GLA C;  1UEB A;  4BBR H;  1PH9 A;  3HOV G;  4A3I H;  4A3C G;  3CPW A;  3F2C A;  5H1S E;  2JA7 H;  1PH3 A;  3S2D H;  1SN8 A;  5BR8 L;  1VQG A;  3PIO A;  1C7Y A;  1SRO A;  4EQ5 A;  2JEB I;  5C44 H;  3H0G G;  1L0W A;  1SFO H;  1SMX A;  2I5M X;  3HOW G;  1A8V A;  5BR8 Q;  3CCJ A;  1XJV A;  2WAQ E;  3PO2 H;  4BY1 G;  3CXC A;  3OTO Q;  2VW9 A;  3CCR A;  3KYH C;  4GOP A;  4AQY L;  4KHZ A;  5GAE C;  3NEM A;  2BA1 A;  4A3F G;  2AHO B;  3JC6 6;  3GTL H;  4JBW A;  4L5R C;  4DR7 L;  3S17 H;  5K36 G;  1P8L A;  1Y1V G;  1E1T A;  4DAM A;  1PYB A;  3SGI A;  1HH2 P;  4AQY Q;  1PH7 A;  1PH4 A;  4APV A;  1O7I A;  3CP0 A;  5C4X H;  1R9T H;  1PH8 A;  2PQA A;  3HKS A;  1G6P A;  3PUX A;  5GRO A;  4AYB G;  5C3E H;  1JMC A;  3HKZ E;  1QZH A;  4LF5 L;  4LF8 L;  1C9O A;  1CKM A;  1OXU A;  5M3M H;  1EQQ A;  4L5Q A;  2A8V A;  2VNU D;  2HT1 A;  4QQB X;  4GLX A;  1WJJ A;  1MJE A;  2K50 A;  2YTY A;  3E9H A;  4LFC L;  3KJO A;  4B3T L;  2I5L X;  5IYB H;  4LF8 Q;  4LF5 Q;  1QVF A;  1E3P A;  1VQ6 A;  4PZ6 A;  2JA7 G;  1EWI A;  5GAD C;  3T1H L;  4LF4 Q;  3G71 A;  4DV6 L;  2I5H A;  2YTV A;  2I0Q A;  1OXT A;  4LFC Q;  1JT8 A;  3UDF A;  2VZA A;  2MO0 A;  3J81 c;  1QVG A;  4JI4 Q;  1I3Q H;  1GO3 E;  2JQO A;  3T1H Q;  4B3M L;  1L2F A;  2N49 A;  1VQ9 A;  1BBU A;  1OXS C;  2WB1 E;  4DV6 Q;  1S72 A;  3CCQ A;  3T1Y L;  3PO2 G;  1AE3 A;  3RN5 A;  5E7N A;  1NMG A;  3JAM i;  1E1O A;  1FJG L;  2VY3 A;  4UP9 A;  2BH2 A;  5IE8 A;  4B3M Q;  4IPC A;  1YBY A;  3A0J A;  4BY7 G;  1Z9F A;  1H95 A;  3T1Y Q;  3KDF B;  3S2H H;  3CME A;  3J80 i;  5ELN A;  4GKJ L;  1W2B A;  1FJG Q;  1Q7Y C;  1VQ8 A;  1CSP A;  3G48 A;  2OTJ A;  5C3E G;  3ZJY C;  1FL0 A;  4LUO A;  4ALP A;  2Q2I A;  2PI2 A;  3FKI H;  1N32 L;  4GKJ Q;  3AYH B;  4HIO A;  1N33 L;  3I55 A;  2ASB A;  2QA4 A;  4JV5 L;  2JEA I;  2UXB L;  2K4K A;  3STB C;  4OWW B;  3BJU A;  4Y52 H;  4A3E H;  3CC7 A;  1M1K C;  4DV1 L;  1NTG A;  1N33 Q;  4DR3 L;  4JV5 Q;  1JJC B;  2UXB Q;  4QY7 A;  4DR5 L;  1SRU A;  1J5E L;  1VQM A;  1IXR A;  5FLX c;  4DV1 Q;  1I5F A;  2AMC B;  1WOC A;  1XNQ L;  2MNA A;  4DR3 Q;  4LWC A;  1Q12 A;  3I56 A;  2R7F A;  4DR5 Q;  4P71 A;  4HJ5 A;  1J5E Q;  4JI7 L;  4MZ9 A;  3U4V A;  1XNQ Q;  4QL5 A;  1XNR Q;  3OYY A;  1ASY A;  3TS2 A;  3EBE A;  3NBH B;  1NBW A;  2E8G A;  2XTI A;  3CF5 A;  4B3R L;  3M4P A;  1K83 H;  1TWG H;  2PI2 E;  2A1A A;  4OXP A;  1KRS A;  4JI3 L;  1JB7 A;  5JEA J;  4JI7 Q;  3GTO H;  1AH9 A;  1HNZ L;  3NEL A;  2MFI A;  2OQ0 A;  3FKI G;  3M4O H;  2D62 A;  4L5T A;  1MIU A;  3F2D A;  1BVS A;  2UUB L;  1K8A C;  4PG3 A;  4B3R Q;  4DUZ L;  3UDX A;  5M5W H;  2F4V L;  3CQZ H;  3KJP A;  1PH5 A;  4JI3 Q;  1Q86 C;  1BKB A;  1HNZ Q;  3PUV A;  2QGQ A;  5IWA L;  4A3E G;  1J6Q A;  4J15 A;  3GO5 A;  4DR1 Q;  3UE0 A;  2HIV A;  4DUZ Q;  2F4V Q;  4TVA B; 
#chains in the Genus database with same CATH topology
 4DK6 C;  3RZO H;  1XMQ L;  2A6H C;  2LMC B;  1XTC D;  3E9I A;  1OXX K;  2NVX H;  1LAB A;  2ZJR A;  1Y1W H;  2PMZ B;  3HFZ B;  1S5B D;  4PV1 C;  3KF6 B;  3KFU A;  4EVO A;  5LL6 S;  1NY4 A;  2ALY B;  2O4X A;  4RCN A;  3G7L A;  1BCP B;  4DXG A;  1KHI A;  3S1N H;  2XIW A;  3AFP A;  4F87 A;  3VYU A;  2EE1 A;  2AWO A;  4RAU C;  3EVQ A;  4GN5 A;  3CCL A;  4A3J H;  2A68 D;  1UNS A;  1G8Z D;  4IQZ A;  2UUA L;  1WTO A;  2RCN A;  1TWH H;  4JYA L;  1RJT A;  1C0A A;  2RHQ B;  4ZRZ A;  1EU4 A;  5T1I A;  3UDG A;  4DR2 Q;  1L0Y B;  1B53 A;  1IBK Q;  2L11 A;  2JA8 G;  1YJW A;  3TZD A;  3WOF A;  3PQI A;  3J81 j;  3CC2 A;  3K6O A;  2MGS A;  2JA9 A;  4BBR G;  1WCM B;  3DWQ A;  1EIF A;  4JI0 Q;  5D14 A;  5ISR A;  2K5H A;  1HHV A;  2QKI C;  4A3G B;  1NAP A;  4JI4 L;  1I6H B;  5KYI A;  4K2L A;  4XQN A;  1WI5 A;  2XVS A;  4A3B H;  5LMU Q;  1LTS D;  4A93 B;  2ID0 A;  5ELB A;  3X3N A;  3HOZ B;  4K5W A;  1RL2 A;  3I4M G;  3G6E A;  4WJ4 A;  1L1O A;  3NUC A;  1AN8 A;  2K33 A;  5EAY A;  5I9O A;  3CCE A;  2A74 C;  3OSO A;  2L1B A;  1AFP A;  1SYE A;  4ZLT F;  1SE8 A;  2CH4 W;  3EN2 A;  3AU7 A;  5JJI A;  3ULL A;  5IT9 E;  4HN7 A;  1JWS D;  3UI2 A;  1II3 A;  4YCW A;  1AP0 A;  2F0L A;  4WFN 3;  4QGU A;  4HID A;  2F0T A;  4IJH A;  4P72 A;  3EIV A;  4O0A A;  2KQ3 A;  4DV3 L;  3PO3 H;  5FLM H;  2JA5 G;  1EL0 A;  3Q8D A;  3IRB A;  1NNX A;  3QR8 A;  3AEV A;  3FP9 A;  4X66 Q;  1VQP A;  1PA6 A;  3J80 L;  4RKL A;  5CBE E;  1PTO H;  1QNU A;  4A4I A;  1CA6 A;  1G2T A;  2J7Z A;  3M85 A;  3AB9 A;  5DM6 3;  5EBD A;  3ND8 A;  2EYO A;  2B2U A;  3STB D;  1XMO L;  2Y0S E;  3BDO A;  4KKS A;  3NHH A;  5IYC H;  3SHL A;  2IT1 A;  3PIP 3;  5IYD H;  3WDN A;  1PDQ A;  1VQB A;  3F1Z A;  1YZ6 A;  1PYW D;  2VQF L;  3GTK B;  5IIF A;  1N34 Q;  1JE5 A;  4LF7 Q;  2ZM6 L;  4KV6 A;  2EJF C;  1DON A;  4RGO S;  5C0X G;  4HJA A;  3KF6 A;  3J7A 5;  3OMG A;  4FF4 A;  1HNW Q;  1PXU A;  2OT2 A;  2A6E D;  3WOE A;  3Q23 A;  4EX5 A;  1G51 A;  2PCF B;  1KL9 A;  1LTL A;  1VMC A;  4J1M A;  1XTD A;  1H9K A;  5E3F A;  2SOB A;  5JPM C;  3U9O A;  2R92 B;  5M3F H;  1HTP A;  4Q5V A;  4UPA A;  1JE4 A;  3TZU A;  4DR2 L;  4LF6 L;  3GDE A;  3S14 B;  1EY6 A;  4KHP L;  2E5L L;  2F0E A;  2UU9 L;  4GLV B;  1HJP A;  5GQO A;  4L63 B;  1ZXT A;  4JI1 L;  3E5S A;  1U5K A;  4DV4 Q;  4A76 A;  1F2L A;  1CHP D;  1SMY D;  4JI0 L;  3T16 A;  2VQE Q;  2AUJ D;  1O80 A;  4O42 A;  1VQD A;  3TSS A;  1WCM G;  2FIN B;  4IPG A;  5ELO A;  4IFD G;  1LYL A;  5LMN W;  2QDB A;  1X55 A;  2XNA C;  4A3G G;  2LSS A;  5M5Y H;  5IOD A;  3NQI A;  1ESF A;  4TQU S;  4A93 G;  1LLR D;  4Y7N B;  3GD7 A;  4JI6 L;  4BY7 H;  2A19 A;  4NXM L;  3NWT A;  2BCO A;  3HOZ G;  1VF7 A;  1EY4 A;  4OX9 L;  1KDC A;  4JI8 L;  1BCP F;  2PZT A;  4MN3 A;  2B63 H;  2ATW A;  2NVQ H;  3CCV A;  4DAY B;  1YNJ D;  2F0I A;  1WD1 A;  3BYT B;  3BVG A;  4KY6 A;  3KDF A;  3DEP A;  3DWP A;  3T56 B;  5BN5 A;  3MFG A;  3S2D B;  4B3S L;  1A3V A;  1V1Q A;  3I7F A;  1KAW A;  1YVC A;  3CRK C;  3NE5 B;  1MSH A;  5HGT A;  2D9U A;  4R8I A;  3SEB A;  2Q2T A;  3PO2 B;  1K8M A;  4JG2 A;  1G29 1;  1EYG A;  5EPL A;  1ZEQ X;  1RIP A;  4JC0 A;  3GQB A;  1PHJ A;  5M5X H;  3VA7 A;  3I73 A;  1GUT A;  2IWH A;  3TRE A;  1HR0 Q;  1SYD A;  1VQ5 A;  1X3F A;  2WV6 D;  4I7Z C;  1ICW A;  3A74 A;  1X56 A;  1Q81 C;  4IUV A;  3FHW A;  2F3V A;  2ES2 A;  3AMU A;  2GN5 A;  3M7G A;  4IUU A;  2N78 A;  4H7B A;  1HXY D;  2ZTC A;  2NVT B;  5DAU A;  1R4P B;  5FO9 B;  4DAP A;  1X3Q A;  1F9R A;  1QVC A;  3IFD A;  1A2U A;  1ENC A;  2KHJ A;  1N8R C;  3S2H B;  2F03 A;  3S15 H;  2MHV A;  3S24 A;  2PO4 A;  3J81 E;  4DV5 Q;  4X64 Q;  1PYS B;  5KYL A;  3HOV H;  4A3C H;  4DNI A;  3ERS X;  2HUG A;  3A8K E;  2RSN A;  2RHS B;  1Y8N B;  4BXX G;  4KN4 C;  3K59 A;  1HFN A;  2RF4 A;  2OF1 A;  2PZU A;  3CMA A;  2LFN A;  4OON A;  4A3F H;  2YU9 B;  2K52 A;  1EFI D;  2Z1C A;  4WJ3 M;  3TP8 A;  1EYD A;  2R92 G;  2JN4 A;  4RA8 A;  4DAV A;  4GKK L;  5COY A;  1TY2 A;  2HDM A;  1WTV A;  5IT9 c;  1VQK A;  3CC4 A;  2DGY A;  4KTA A;  2E2I H;  2N8N A;  4GLA C;  4BBR H;  3RZD B;  1PH9 A;  3GTO B;  3R93 A;  2A69 C;  1DM0 B;  1BO0 A;  1M8A A;  1WTR A;  4ZUI A;  2CVR A;  2NUC A;  4K5V A;  4EQ5 A;  4X3U A;  1T5X D;  1SFO H;  1IKL A;  1SMX A;  2PW5 A;  1A8V A;  1XJV A;  4C3H B;  3CCR A;  5DM7 3;  3KYH C;  4X3K A;  1RTN A;  1JOQ A;  3H91 A;  3GTL H;  4JBW A;  3TME A;  3S17 H;  1LO5 D;  1IKM A;  1E1T A;  3HG9 A;  3ND9 A;  3SGI A;  3HKS A;  3L9A X;  3PUX A;  1SYC A;  4I65 A;  3HKZ E;  1QZH A;  4DR7 Q;  4TSS A;  1EQQ A;  2VNU D;  4DF7 A;  4QQB X;  1VMP A;  4H0L C;  4A3K B;  1WJJ A;  4DAY A;  2AQ3 B;  3MXG A;  2I5L X;  4LF5 Q;  1J8I A;  1E3P A;  4A3I B;  1VQ6 A;  1DOK A;  1EWI A;  4CDF C;  5GAD C;  2L9H A;  2KED A;  3BDL A;  2I0Q A;  2VZA A;  3LX0 A;  3NK9 A;  5E4W C;  1I3Q H;  2KOL A;  1I50 B;  2N49 A;  2L0C A;  1OXS C;  3VR4 A;  3CCQ A;  3PO2 G;  5CMD A;  3GTP B;  1AE3 A;  5CV7 A;  3RN5 A;  2RSO A;  1KAB A;  1VDZ A;  2XWB B;  3A0J A;  5ELN A;  1Q7Y C;  1X32 A;  1CSP A;  2DN8 A;  1EEI D;  2EXZ A;  3A56 A;  5AFW A;  4DK0 A;  3SK4 A;  3NBI A;  4XQQ A;  4M8A A;  2NVY B;  2ASB A;  2QA4 A;  2JEA I;  2ENB A;  3KF8 A;  4OWW B;  2ZXO A;  1C4Q A;  1EQV A;  1IYV A;  4A3E H;  3CC7 A;  2K01 A;  1N33 Q;  4JV5 Q;  1JJC B;  4HAE A;  1SRU A;  3GTJ B;  1IXR A;  1ENF A;  1XYI A;  2AMC B;  1WOC A;  1EYA A;  1BUV T;  4DNT B;  2MNA A;  4FYD A;  4LWC A;  4DR5 Q;  3M3Y B;  1A3U A;  4QL5 A;  5IGE A;  1K0S A;  5C4J B;  1S5C D;  1SJH D;  3EBE A;  3NBH B;  3IFT A;  1MBY A;  2XTI A;  1TKW B;  5CYU A;  3K7A B;  3M4P A;  2OEO A;  4OXP A;  3DHQ A;  1C8C A;  1SYF A;  2HD3 A;  5I2X A;  5ELD A;  3NSW A;  3VR5 A;  1BVS A;  1Z7T A;  4N8F A;  1K8A C;  4JI3 Q;  3KJP A;  1S5F D;  1Q86 C;  3R8B A;  2QGQ A;  2R3Z A;  4RH6 A;  3UE0 A;  4JOI A;  5I6W A;  1BF4 A;  2CH4 A;  3J7A F;  3I4N H;  2F0S A;  2N3S A;  4ZK9 B;  1H9M A;  3HOX B;  2Q8I B;  1B3A A;  4MTK A;  1IL8 A;  1WTX A;  3RMH A;  4GS3 A;  1XMQ Q;  2KEN A;  4XYQ A;  4EQP A;  1VQ7 A;  4C56 C;  4JVZ A;  1OTC A;  3GV6 A;  2UUC L;  2IY5 B;  1P16 A;  3J81 i;  2R93 B;  5FK9 C;  1WTH A;  2M9V A;  2HHH L;  4X65 L;  2B8G A;  2EY6 A;  1K3B C;  4CDE C;  1S3O A;  4OO1 H;  1ASZ A;  3Q0A A;  4A3L H;  4K0K L;  1PH6 A;  4XTC S;  1YHB A;  5CV8 A;  4G4K A;  3K5M A;  3H3V I;  4C3H G;  3X3M A;  5DEH A;  1QNK A;  5KEE A;  3A7A B;  3P75 A;  3HKZ B;  4CBV A;  2IJ0 A;  2F0P A;  1CQV A;  1DOM A;  5A35 A;  2UUA Q;  1B9M A;  3C1F A;  4JYA Q;  1JOK A;  2VUM H;  4Q0F A;  4A3K G;  4A3D B;  2NYZ D;  4GN4 B;  5L37 A;  2B2W C;  2PPB C;  4GNX C;  4A3I G;  3VA5 A;  4HMJ A;  3LWU A;  1WD0 A;  2F0H A;  1TY0 A;  5ELE A;  3S1R H;  4DV0 L;  3J80 E;  3KLR A;  1HUM A;  2RVL A;  3GTM H;  3PUY A;  3MVV A;  3RLO A;  1ROD A;  4PZ7 A;  3OIP A;  3C3L A;  2D0P A;  1TS2 A;  2KCN A;  4FF3 A;  3V96 A;  2QF7 A;  4ME3 A;  5CV9 A;  4TRD A;  1STE A;  2R6G A;  1TWC H;  3GTG H;  4C3I H;  4AH6 A;  3K0X A;  4DK1 A;  4RGT A;  4RGM A;  3I70 A;  1RF2 D;  2K03 A;  1IYU A;  1TWA H;  1BBX C;  2CWA A;  3H09 A;  1TQO A;  1B4O A;  1CZG A;  4JBM A;  1BCP D;  5E1F A;  2MO1 A;  3M4Q A;  3L3O C;  1T9H A;  4MIU A;  2K5N A;  1V9P A;  1N36 Q;  4ZQ3 A;  1ET6 A;  1EOV A;  4ZCK A;  2GVB A;  4A3M H;  5IP9 G;  4BBS H;  3C46 A;  1TII D;  2JSO A;  3JAM L;  4YWM A;  4LJZ C;  2KJX A;  2QDL A;  1KDB A;  3LGJ A;  2G9D A;  2IX1 A;  3U4Z A;  4DV3 Q;  1NR4 A;  3MA2 B;  2KCC A;  2R61 A;  3VR3 A;  3DM1 A;  1MJC A;  1OO9 B;  2HCC A;  3HOX G;  3S14 H;  1QJO A;  1T5E A;  1XMO Q;  1GUW A;  4JPB W;  3K81 C;  4HJ8 A;  4JI2 L;  2EQS A;  2K7V A;  1I94 L;  5CC4 A;  2P5Z X;  3BU2 A;  1PH1 A;  1DZ1 A;  5CR3 A;  2SDF A;  1VQE A;  4YHH L;  2VQF Q;  4DR4 Q;  2ZM6 Q;  2A68 C;  4GNX B;  2R93 G;  4NMZ A;  1YJ9 A;  3MEH A;  1K8G A;  1VQ4 A;  4N9T A;  2E2J H;  5A2Q L;  4IPD A;  2R7Z B;  2OTL A;  4G7Z C;  1BR9 A;  4CDC C;  3KLW A;  5C3X A;  2HQL A;  3L0O A;  3W1G A;  1L0X B;  1JWM D;  2NB0 A;  3HKZ G;  2BOS A;  1EFW A;  3FPP A;  1HTL D;  2K5W A;  4LF6 Q;  5C0X J;  4LNQ A;  3CCS A;  4KHP Q;  1XPO A;  2E5L Q;  4X6A H;  4GN3 B;  1LM0 A;  2UU9 Q;  4CKC A;  1WYD A;  4OWT B;  4A3D G;  1M4V A;  4JI1 Q;  3V05 A;  3HOY H;  3BS1 A;  1UE5 A;  3H0G B;  3DWA A;  1HQR D;  2AQ2 B;  2MQH A;  3HOW B;  4I7A A;  2QW7 A;  4OIJ A;  4MHE A;  5KNC A;  4KY7 A;  3ULJ A;  4ODG A;  1H9R A;  4C1N I;  3FDT A;  1FVI A;  1LT6 D;  5EKI A;  1SR3 A;  1ICF B;  4N8X 1;  2M00 A;  1VQJ A;  4JI6 Q;  2F0Q A;  4NXM Q;  1EU3 A;  1GJX A;  4YCU A;  3W1B A;  1CHQ D;  2K6A A;  3TBI B;  1F77 A;  5JEA H;  4OX9 Q;  1Q1E A;  4JI8 Q;  4HJ9 A;  4RKB A;  5GAG C;  3S1M H;  1SAP A;  4IO9 A;  3HOU H;  1VQI A;  2F3W A;  1FGU A;  1HZB A;  2K1B A;  2J0T D;  4CGY B;  4IFD J;  2NVT H;  1XPU A;  1TXY A;  2EIF A;  4O2D A;  2VL6 A;  1YIJ A;  4B3S Q;  1WFQ A;  2AKW B;  1N36 L;  1AZQ A;  3ICE A;  5HGQ A;  3K58 A;  1VQL A;  4HED A;  3DXJ C;  1HR0 W;  1Q1B A;  1R9T B;  4WRD A;  5TSS A;  2PZW A;  1LAC A;  1A6X A;  4IUN A;  3MXN B;  2FXQ A;  3BVM A;  1CT1 D;  2LXJ A;  4C3J B;  2H5X A;  4XT1 B;  4ZKC B;  2KBN A;  2YV5 A;  1QIL A;  1AE2 A;  3PGZ A;  2YU9 H;  4R4I A;  5IP7 H;  1TWF B;  4RGN A;  1F9S A;  4DR6 L;  4X3S A;  3UE1 A;  4C2M H;  1K9M C;  3CAM A;  2OWO A;  2M2L A;  1UEA B;  1NE3 A;  3SK8 A;  3ULP A;  4DUY L;  3RZD H;  1EZ6 A;  4DR4 L;  3FEW X;  1IBL L;  1EWC A;  2KHI A;  3HEJ A;  2ICI A;  3FKI B;  2CQO A;  3J80 c;  1C48 A;  4GNX A;  2BA0 A;  2UUB Q;  3CRL C;  3QG1 A;  4PQX A;  2R7Z G;  3R3O A;  2F0G A;  2C9O A;  5K36 H;  3OWE B;  1Y1V H;  1EUJ A;  3RLF A;  1UWV A;  4KMU C;  2QEJ C;  1LTT D;  1B8A A;  1S40 A;  1SE4 A;  5EKL A;  1XX8 A;  4CKE A;  4A3K H;  2DNC A;  4GKK Q;  4Z9C B;  1JCK B;  1K83 B;  1UEB A;  1TWG B;  5DNF A;  2Z4I A;  4A3I H;  5G3L F;  3M4O B;  4F88 A;  5C4Z A;  3F2C A;  2JA7 H;  1ESR A;  2NWG A;  1ENA A;  5M5W B;  1VQG A;  3MZ5 A;  2JEB I;  1EY8 A;  3H0G G;  1L0W A;  1W6J A;  2I5M X;  4HCE A;  3HOW G;  3CCJ A;  2WAQ E;  2A73 B;  3OTO Q;  1RHP A;  3CXC A;  4AQY L;  2Z4H A;  4KHZ A;  2F0V A;  3NEM A;  3JC6 6;  2BE5 C;  1PRT C;  4L5R C;  1GHJ A;  2NVX B;  1P8L A;  1B9N A;  3EA6 A;  1Y1W B;  4ME5 A;  1V1P B;  1GUG A;  1O7I A;  4G7H C;  1G6P A;  4XYO A;  3MAQ A;  5C3E H;  1F9P A;  4LF8 L;  1BDO A;  4KJO A;  4L5Q A;  4DXF A;  4GLX A;  1MJE A;  2K50 A;  3FPU B;  4LFC L;  2ZXR A;  3S1N B;  1LV9 A;  4FXD A;  3SDZ A;  1PTO C;  3T1H L;  2B2V C;  3G71 A;  4HSV A;  2JXM B;  1EYC A;  2FFK B;  4HR7 B;  2XSC A;  5C44 B;  1GO3 E;  2RBM A;  3BVZ A;  3T1Y L;  1FJG L;  4UP9 A;  3ONA B;  5IGD A;  1Y8O B;  2BDO A;  1TWH B;  4R8N A;  5JOB A;  3H3V C;  2G9H D;  3NTI A;  4IPC A;  1SYG A;  4QUC A;  1W2B A;  1VQ8 A;  3LNN A;  2OTJ A;  5C4X B;  1UUP A;  4LUO A;  1JC7 A;  3K57 A;  2Q2I A;  5M3M B;  2PI2 A;  4H13 C;  1KTK A;  5C5M A;  2K4K A;  5D3I B;  4NDX A;  1HA5 A;  1TU2 B;  2Z6B A;  4C3J G;  4DV1 L;  1KNE A;  4DR3 L;  2Y0S B;  1NR2 A;  2V4D A;  4QY7 A;  1RCV D;  1XNQ L;  4GZY C;  1ZYR C;  2KUM A;  5K5P A;  2R7F A;  1RTO A;  4HMI A;  1I4Q A;  2KEE A;  3TS2 A;  2X6L A;  1STG A;  1NBW A;  5EGT A;  3IAY A;  4B3R L;  2KHS A;  2A1A A;  4IUP A;  5JEA J;  2MFI A;  2OQ0 A;  3FKI G;  1S4Z A;  3DUZ A;  2EYF A;  1MIU A;  2UUB L;  4DUZ L;  3UDX A;  1CI3 M;  5J1Z A;  3PUV A;  5IWA L;  4J15 A;  3KK7 A;  1K28 A;  2HIV A;  3GP7 A;  4TVA B;  2MPM A;  1IZ6 A;  2FMC A;  1PRT B;  4IUQ A;  4UP7 A;  3KLS X;  1RKN A;  4ZYS A;  4FDB A;  3BDC A;  3PO3 B;  2KCT A;  4G57 A;  2JA8 H;  3PUW A;  1DJR D;  1QUQ B;  1YIT A;  2EY2 A;  2CCZ A;  2SNM A;  5AJ3 L;  1PTO B;  3ER0 A;  4BA2 I;  2JK8 A;  2VS1 A;  4HIM A;  1YNN C;  2UUC Q;  4NB3 A;  1DD2 A;  5HUR A;  2EZV A;  4XDX A;  4ID6 A;  3OTO L;  3AQQ A;  2NN6 I;  4NPS A;  2HHH Q;  4X65 Q;  4BS9 A;  4KJN A;  1BQQ T;  1IW7 D;  1X3G A;  5EKK A;  2AWN A;  2C5C A;  3C1E A;  5E4X A;  4DK3 C;  1YHQ A;  4K0K Q;  3S16 H;  3A5U A;  3I4M H;  1VQF A;  2HIX A;  2QEX A;  1U4M A;  2LY7 A;  1D2B A;  1W6K A;  1Y1W G;  2VXW A;  1GVP A;  2JA6 B;  4UP8 A;  2HDL A;  2F0O A;  4LK1 C;  3GTQ H;  1VQH A;  3E3X A;  1KXL A;  1Q8I A;  1PH2 A;  3I8Z A;  4DU9 A;  5BN3 A;  5LMN Q;  4IPH A;  2A69 D;  2C35 B;  3S9W A;  4K14 A;  5FOB B;  2OCE A;  5I9P A;  5C44 G;  1E22 A;  3J7Y W;  5M3F B;  4LFA L;  1D1I A;  2PQA B;  3D6W A;  2CKZ B;  1FYC A;  4CJ2 C;  1D8L A;  2F0F A;  4DV0 Q;  1O7Z A;  2JA5 H;  4LUV A;  3BYY B;  3MXP A;  2B2T C;  5C4X G;  1TVX A;  1E24 A;  4KN7 C;  5M3M G;  3PV0 A;  3S1Q H;  2ZTD A;  2E76 C;  5KND A;  5IYB G;  1A2T A;  3L7Z C;  3U50 C;  1STH A;  4CJ0 B;  5M5Y B;  4LUZ A;  5IY0 A;  1TT2 A;  3CCM A;  4HCS A;  2Y0S G;  4GOP C;  2F0W A;  2UXC L;  3K80 C;  1Q82 C;  5JJK A;  3NP8 A;  1X3E A;  1EWH A;  1YEZ A;  2F3I A;  3E0E A;  5CGK A;  1B2T A;  2H1E A;  1G2S A;  2J4X A;  4K6D A;  4YIJ A;  4DKA C;  2B63 B;  4RCO A;  4IOC A;  5A2Q E;  2NVQ B;  2B3G A;  4CKB A;  5C0X H;  4PMC A;  4C1N K;  2K5D A;  4IZ8 A;  4LW1 A;  4R4C A;  3RD4 A;  4QCL A;  1B3Q A;  1B7Y B;  1X3P A;  3RNU A;  2UXD L;  1PFS A;  1M90 C;  3K5N A;  3QWN A;  4RG1 A;  3SK6 A;  1JIC A;  1TS4 A;  3QOL A;  2Z0S A;  4LF9 L;  3CKI B;  1EY9 A;  1CKN B;  2WKD A;  3QIA A;  2LS0 1;  1EQR A;  1G91 A;  5KNB A;  2H4O A;  2F0J A;  1L1O C;  5M5X B;  3WWV A;  4EQO A;  1HQM C;  1V1O A;  2L4N A;  3PO3 G;  1Z47 A;  5FLM G;  1KD1 C;  3CD6 A;  4KD3 A;  2OQK A;  4MNO A;  4JI2 Q;  3TEH B;  1WTP A;  2GA4 B;  1I94 Q;  4PMB A;  3RR5 A;  5I4D A;  1WCM H;  2YTX A;  3TQY A;  4IFD H;  4R1J A;  3G6J B;  4YHH Q;  4ILW A;  2QCP X;  1BOS A;  2IX3 A;  4EQN A;  4A3G H;  2E2H B;  1SSO A;  2GVA A;  3GV3 A;  1I6H H;  2XRQ D;  4A93 H;  2NZH A;  3ERO A;  3DLL A;  4R4T A;  1Y14 B;  1EIY B;  3HOZ H;  1GM5 A;  2WFW A;  1QE6 A;  2WII B;  5ELC A;  4K8I A;  3QJY A;  3MTS A;  3S15 B;  3KOJ A;  3PCO B;  3PF4 A;  5KIX A;  4X62 L;  3ZYY X;  2F0N A;  2PMZ E;  2JA6 G;  3HOV B;  1D1K A;  2F0K A;  1STN A;  5LMN L;  3H94 A;  1PRT F;  3OW7 A;  1Q8K A;  1TS5 A;  2B2U C;  1KIX A;  1IBM L;  3W2D A;  2ZJP A;  4GOP B;  3D4W A;  4BY1 B;  3LWE A;  4QIW E;  2WKC A;  2RA4 A;  4A3F B;  3I4O A;  3KBX A;  2O5J C;  3CPF A;  5M3F G;  3D4R A;  2ZTE A;  4HIK A;  1DYQ A;  2E2D C;  4K6L A;  5JJL A;  1PTO F;  1CA5 A;  1PFB A;  4L8J A;  5G3L D;  4ZKB B;  2Z9H A;  3HS0 C;  3ERQ A;  4JI5 L;  1A3T A;  5CBA E;  1X6O A;  2L12 A;  4UY8 C;  2E2I B;  3D31 A;  4RMF A;  3NPP A;  2RQX A;  1MD2 D;  3K5O A;  4C3J H;  3TDQ A;  1YHA A;  4PNY A;  2RDF A;  2CW0 D;  4B3T Q;  3BZK A;  1V43 A;  1SFO B;  5FLX L;  3CHB D;  1TWF H;  2TSS A;  2TMP A;  3NTH A;  3R2I A;  3OOC A;  4G7O C;  1HPC A;  4DV7 L;  3GTL B;  1CSQ A;  2X69 A;  1L1O B;  3S17 B;  4DA2 A;  1BNZ A;  2B29 A;  1AW7 A;  1IL2 A;  1GKH A;  4P74 A;  4TKO B;  3GTK H;  2HCI A;  2Q2H A;  3HRZ C;  4NP5 A;  4BWG B;  5FO8 B;  2B63 G;  1XPR A;  5C3W A;  3OW2 A;  1LTI D;  3D0F A;  2Z6K C;  3TN2 A;  3SE0 A;  2F1M A;  3NBH A;  4BXX H;  1N32 Q;  2EYJ A;  1UE1 A;  3OWF A;  4H02 A;  1STB A;  5KGU A;  1J9O A;  2PNR C;  1I3Q B;  5EPK A;  1HA6 A;  3MFY A;  3C2P A;  4LFB L;  1I4H A;  4HJ7 A;  2ZXP A;  3A8I E;  1SJE D;  1Q46 A;  4FVM A;  4K2K A;  4KI0 A;  2R92 H;  2IW3 A;  2WP8 J;  1K0R A;  1CKN A;  1I4G A;  4WOR A;  1S5D D;  1MSG A;  1EY0 A;  1HUN A;  1STY A;  1JJ2 A;  4DR6 Q;  3JAM c;  3NXW A;  2K14 A;  1H9S B;  3G4S A;  4POG A;  4DUY Q;  4R4O A;  5CV4 A;  2Q8R E;  4NXN L;  1IBL Q;  4A3E B;  1HZA A;  3A8J E;  4NKL A;  5JVG 3;  1EQT A;  1CTM A;  2VB3 X;  4DV2 L;  4Y7N H;  4JBK A;  1VS0 A;  2RDG A;  2X6G A;  1JOO A;  1E2W A;  1KRT A;  1D7Q A;  3MWY W;  1SYB A;  1NSN S;  2DUD A;  2A6H D;  4XIG S;  1B70 B;  2B2T A;  2SEB D;  3A54 A;  1U4L A;  4RWS C;  3EFX D;  4HSP A;  5C5L A;  3HOV G;  4A3C G;  3CPW A;  4H44 C;  5H1S E;  2CHB D;  2RCF A;  1PH3 A;  3S2D H;  1SN8 A;  5BR8 L;  3PIO A;  4QIW B;  3TP7 A;  2D2C C;  5C44 H;  1IHZ A;  3D4D A;  2LKV A;  4JW0 A;  1CM9 A;  1Y8P B;  2ZT9 C;  1QWY A;  2EYH A;  3PO2 H;  4BY1 G;  4GOP A;  2VW9 A;  1PZI D;  3I4N B;  3SK5 A;  4A3F G;  2AHO B;  3OPO A;  4B9W A;  1QCB D;  1HH2 P;  4AQY Q;  1PH7 A;  4APV A;  3NQT A;  3CP0 A;  5C4X H;  1PH8 A;  4KD4 A;  5GRO A;  3FVQ A;  1C9O A;  5M3M H;  3T4A C;  2A8V A;  1MI2 A;  2AQ1 B;  2K28 A;  2AUK A;  1U4P A;  1GUS A;  3KJO A;  4B3T L;  5IYB H;  4LF8 Q;  1QVF A;  1SNQ A;  4LF4 Q;  2NZ1 D;  4DV6 L;  2YTV A;  3P20 A;  4LFC Q;  3UDF A;  4UHV A;  1QVG A;  2JQO A;  3T1H Q;  4B3M L;  4U67 3;  1BBU A;  1LTB D;  2WB1 E;  1S72 A;  5EQ0 A;  4QMG A;  3QB3 A;  1NMG A;  1E1O A;  1XWE A;  5IE8 A;  2DNE A;  1YBY A;  2IL8 A;  1H95 A;  1Z9F A;  3URY A;  3T1Y Q;  3KDF B;  3S2H H;  1O7Y A;  3CME A;  3J80 i;  4GKJ L;  1EY7 A;  1FJG Q;  3ZJY C;  1MGS A;  4ALP A;  3HZX A;  2VUM B;  1N32 L;  1KNA A;  3AYH B;  4J8Q A;  3I55 A;  1F9Q A;  1NUC A;  2UXB L;  3STB C;  2DJF C;  3BJU A;  4Y52 H;  3I72 A;  3S1R B;  1JB3 A;  1GHK A;  4DNR B;  1K8O A;  1J5E L;  3D3R A;  4RFB A;  5D3D A;  1VQM A;  1R4Q B;  4DV1 Q;  1I5F A;  3GTM B;  5FKA C;  4DR3 Q;  3I56 A;  1Q12 A;  2KVM A;  3MC0 B;  4QB4 A;  4JI7 L;  5JJZ A;  1XNQ Q;  1XNR Q;  4LAA A;  4P2C B;  1Q90 A;  5KRU A;  2E8G A;  2XN9 C;  1CFM A;  1D5X C;  1E2Z A;  1AH9 A;  1SNM A;  2A6E C;  1KRS A;  1TWC B;  1JB7 A;  1EIH A;  3GTO H;  1HNZ L;  3MXU A;  3GTG B;  5J39 A;  4C3I B;  2D62 A;  4L5T A;  1JR0 D;  2K5Q A;  2EY1 A;  1H9S A;  1HFG A;  4OEL B;  4B3R Q;  2F4V L;  1KDA A;  2E75 C;  5JAV A;  5J22 A;  1TWA B;  2B2W A;  4OHJ A;  2F4I A;  4A3E G;  3Q6S A;  4DR1 Q;  1TS3 A;  4DUZ Q;  4C3H H;  3DEO A;  4V0B A;  3H3V H;  4BA1 I;  4J6H A;  2CQA A;  2KCM A;  1N9W A;  5IWA Q;  1K73 C;  1PZK D;  3K7U C;  2NBF A;  1O78 A;  2L5T A;  4A3M B;  2K5V A;  1CUK A;  3RUZ A;  4BBS B;  1SMY C;  2JA6 H;  1B50 A;  5C0X I;  4IAL A;  3TP6 A;  4OIK A;  2R7D A;  1GOZ A;  1ET9 A;  3O13 A;  4YWL A;  4QUF A;  1SXT A;  3ITP A;  3T53 B;  5FJ8 G;  4DGZ A;  1CKO A;  1VQO A;  5LL6 X;  4R4Q A;  1LTR D;  4DN4 M;  5AJ3 Q;  2EXD A;  3CQZ B;  4XT3 B;  1I4X A;  1DCZ A;  1MHW C;  1KQS A;  1I50 H;  2IX0 A;  1MKH A;  1LUZ A;  3TP5 A;  5NUC A;  2FJ2 A;  3GTP H;  1WVL A;  1IBK L;  3I4N G;  2F52 A;  3RZO B;  4FF2 A;  2EYL A;  3CW2 C;  1DXM A;  1YNJ C;  4R9W A;  2D5D A;  5IGB A;  3KLS A;  5IOC A;  4YY3 Q;  1NMF A;  2B39 A;  3W3A A;  5EPJ A;  1VQC A;  4CDD C;  1LTA D;  4MTN A;  2YYZ A;  4XQJ A;  1IYJ B;  1SEB D;  3V2T A;  3U58 A;  3SVM A;  2Z6K A;  4LF4 L;  4ULL A;  4IFD I;  1YJN A;  3T13 A;  2NVY H;  1KAA A;  5LMU L;  2I46 A;  3B6Y A;  4OO1 I;  2HQE A;  2E2J B;  2WB1 B;  1LTG D;  1A63 A;  4OO1 G;  2N55 A;  5C4H A;  4JOI C;  4A3L G;  4IOA A;  4QF4 A;  3SR1 A;  2MUY A;  3DM3 A;  3GTJ H;  4A3J B;  2A5H A;  1U0L A;  3K5L A;  2MP1 A;  5IP9 H;  5BN4 A;  3AFQ A;  3M3Y H;  5HY6 A;  1X54 A;  4LFA Q;  3N52 A;  5C4J H;  2BE5 D;  1HNX Q;  1PRT D;  2PW7 A;  2N88 A;  3CU7 A;  3PIP A;  3D8G A;  1Y69 U;  4L5S A;  3K7A H;  4AYB E;  1W3S A;  1GXD C;  3PUZ A;  3PSI A;  2VUM G;  1PV4 A;  2E74 C;  2JYO A;  3TS0 A;  2K75 A;  3KBG A;  3EJI A;  4DFA A;  3HOY B;  1KLU D;  1EOT A;  3E0J A;  1I6V C;  3MXN A;  1A62 A;  1CQF A;  1PTO D;  2XGT A;  3NEN A;  4KKU A;  4F8M A;  1G6Z A;  1SE2 A;  1K3R A;  4K8J A;  1VF5 C;  1GUO A;  2OXP A;  4M1U B;  2O5I C;  3NWS A;  4ZUJ A;  1KLG D;  4A3B B;  2JP1 A;  4OWX B;  3HOX H;  1YI2 A;  4HTH A;  1XNR L;  2NTT A;  2UXC Q;  4X66 L;  3A55 A;  1FNW A;  1ML0 D;  4PMW A;  4XXE A;  1SND A;  2Q2U A;  1DGS A;  3KF8 B;  2ZJQ A;  3S1M B;  3E6Z X;  3HOU B;  2R93 H;  3TRZ A;  2DY7 A;  4S3S A;  4C3I G;  2EPB A;  1ILP A;  4UAI A;  3BZC A;  2E2H H;  4FXG C;  4DR1 L;  4P73 A;  1A15 A;  1E7Z A;  2UXD Q;  1F2Y A;  3K0Y A;  3T51 B;  3OHX C;  3RN2 A;  1JWU D;  1N34 L;  5LHY 1;  4LF7 L;  1GUN A;  2IPK D;  4LF9 Q;  5IT9 L;  4V19 0;  3VYT A;  4A3M G;  3F2B A;  2B2Y C;  4BBS G;  1ZYR D;  2JE6 I;  3K8A A;  4A75 A;  5DLQ E;  2EVB A;  1NCV A;  1HNW L;  1PLF A;  4A3D H;  4LMQ D;  1IW7 C;  5I6Y A;  2RKS A;  1ONL A;  2IHF A;  5ELF A;  4YWK A;  1LT5 D;  4BY1 H;  1A0I A;  2WAQ B;  1PVO A;  4RHS A;  2LXK A;  4IUT A;  2NN6 G;  2O2L D;  3PF5 A;  2EJM A;  4YY3 L;  2EYP A;  1SNO A;  4DV4 L;  4C2M B;  4IJL A;  3I90 A;  3I3C A;  5IGG A;  3VDY A;  4JBJ A;  2VQE L;  2BDN A;  1SNP A;  5EBC A;  5FLX E;  4X3T A;  1V1P A;  1RDP D;  1O7L A;  4POF A;  3A7L A;  4X62 Q;  2IHE A;  2WIN B;  4YCV A;  5I2Y A;  3P7J A;  4OGQ C;  1SE3 A;  2WB1 G;  4CJ1 B;  5IGF A;  2WAC A;  3VYS A;  1E0B A;  1BBW A;  1VQN A;  3JAM E;  1YNN D;  3Q24 A;  1I4P A;  1IBM Q;  2EYM A;  4A3J G;  2B8F A;  1PMR A;  1Y1V B;  5JVH 3;  2V1C C;  3U9S A;  4N9P A;  1HNX L;  2Z8L A;  4B08 A;  4F7X A;  4AYB B;  2PNH A;  3IL8 A;  2CWP A;  3J7A V;  3OMC A;  1FNV A;  4IUR A;  3L2P A;  1QOH A;  1OXV A;  1HZ9 A;  5CV5 A;  1AZP A;  2I07 B;  2ICE C;  2JA7 B;  4JI5 Q;  1HZC A;  4FF1 A;  5T1G A;  3Q22 A;  3MEF A;  1YNX A;  1VCI A;  3M9B A;  1KC8 C;  3H15 A;  3HOY G;  1UE7 A;  1FR3 A;  1QZG A;  1CZW A;  3VR2 A;  4UDU C;  3J7Z C;  1SLJ A;  4FNF A;  2PYK A;  1SBB B;  3QOJ A;  4A3B G;  4PZ8 A;  1HR0 L;  1X65 A;  3UDI A;  4BY7 B;  2NZO A;  5GAH C;  1PFN A;  3IKJ A;  1JQY D;  2FMM A;  3SXH A;  1NJI C;  2SNS A;  2K05 A;  4KLK A;  5C3E B;  4DV7 Q;  1D5Z C;  3F8T A;  1PZJ D;  1XXG A;  4CHT B;  3OIQ A;  2EY5 A;  2XWJ B;  5JEA G;  1X9N A;  4FP5 D;  3HOU G;  3I4L A;  1LT3 D;  4P75 A;  1VQA A;  1ILQ A;  3W5O A;  2JJQ A;  1EEF D;  3MHB A;  2R7Z H;  4WJW A;  5M9O A;  1EY5 A;  4FXK C;  4L6T B;  3HGB A;  3BZD B;  3PMF A;  1AEX A;  1RD9 D;  3I2Z A;  3CCU A;  1BXT A;  2CFM A;  2F0U A;  2BH8 A;  4DV5 L;  4LFB Q;  2D0O A;  4X64 L;  4DPG A;  3HP3 A;  1JOR A;  4AIM A;  1D6E C;  5FJ8 H;  1UE6 A;  4RHR A;  4O1N A;  2F0M A;  3M4Y A;  4JCV E;  3A5Z B;  2DJG C;  3DMU A;  3M7N A;  5J3B A;  1SDF A;  1QUQ A;  1JJG A;  2L15 A;  3H0G H;  2B2V A;  3HOW H;  4K5X A;  1B44 D;  5JPN C;  2Q8T A;  2WAQ G;  3H6M A;  4NXN Q;  5IP7 G;  1GD7 A;  5IYC G;  3RLN A;  5IYD G;  4DV2 Q;  1EIG A;  1FNU A;  4QJF A;  1Q3L A;  1STA A;  2EDG A;  2PQE A;  4JK1 C;  2K32 A;  1S5E D;  2L55 A;  1D5M C;  2DY8 A;  1Z6H A;  1UAP A;  1H9J A;  1C7Y A;  1SRO A;  2F0D A;  2EOT A;  3J81 L;  5BR8 Q;  5D65 A;  4ABN A;  3VYR A;  5GAE C;  1SNC A;  2BA1 A;  2VB2 X;  1U4R A;  4DR7 L;  5K36 G;  1Y1V G;  1F2M A;  3R2T A;  4DAM A;  1PYB A;  3I91 A;  5IGC A;  1PH4 A;  2KEC A;  1R9T H;  2PQA A;  5EJW A;  4AYB G;  2CW0 C;  3EQL C;  1QB5 D;  1JMC A;  1FGB D;  4LF5 L;  1CKM A;  1OXU A;  2JA8 B;  4KKT A;  4OL7 A;  2HT1 A;  5F2D A;  1V8Q A;  3P1H A;  2YTY A;  3E9H A;  4BBR B;  3BG3 A;  4B9X A;  4PZ6 A;  2JA7 G;  1BCP C;  2XRS D;  2I5H A;  3FRP B;  1OXT A;  1U9R A;  1JT8 A;  3D6C A;  3KUP A;  4KHV A;  3VR6 A;  2MO0 A;  3J81 c;  1HCZ A;  4JI4 Q;  1L2F A;  2NTS A;  1VQ9 A;  4DV6 Q;  4FO2 A;  3QO2 A;  5E7N A;  3JAM i;  2EJG C;  2VY3 A;  3S16 B;  2BH2 A;  3I4M B;  4B3M Q;  5C6A A;  4BY7 G;  1WTW A;  4U68 A;  2K04 A;  5COR A;  2B2Y A;  1CK1 A;  3G48 A;  5C3E G;  3PIO 3;  2FHT A;  1FL0 A;  2KA7 A;  4ZAI A;  4IN3 A;  1LT4 D;  3GTQ B;  1PFM A;  3FKI H;  1HRJ A;  4GKJ Q;  2QIL A;  3FMC A;  4HIO A;  1N33 L;  4JV5 L;  5CV6 A;  1EZ8 A;  4E6I A;  1M1K C;  1DOL A;  1NTG A;  2UXB Q;  1I4R A;  3NTK A;  4DR5 L;  4EGV A;  2MJ8 A;  4KK7 A;  5FLX c;  2G5D A;  1B1Z A;  3N6R A;  4P71 A;  4HJ5 A;  3F2U A;  1J5E Q;  4MZ9 A;  2JA5 B;  3U4V A;  1QG7 A;  3OYY A;  1ASY A;  4OEM B;  4KY5 A;  3CF5 A;  1F2Z A;  1WTQ A;  1K83 H;  1TWG H;  2PI2 E;  5FO7 B;  4JI3 L;  4JI7 Q;  3NEL A;  3M4O H;  3F2D A;  3S1Q B;  1TR5 A;  4PG3 A;  5M5W H;  1FD7 D;  3CQZ H;  1PH5 A;  4NW2 A;  1BKB A;  1HNZ Q;  1J6Q A;  2RDH A;  1E2V A;  2NN6 H;  3GO5 A;  1ZKO A;  2F4V Q; 
#chains in the Genus database with same CATH homology
 4C3H H;  4DK6 C;  1IZ6 A;  4JOI A;  3H3V H;  1XMQ L;  4BA1 I;  3RZO H;  3I4N H;  2KCM A;  1N9W A;  5IWA Q;  4UP7 A;  2N3S A;  1K73 C;  3E9I A;  3K7U C;  1OXX K;  2NVX H;  4GS3 A;  2ZJR A;  4FDB A;  2K5V A;  1CUK A;  2KEN A;  1Y1W H;  1XMQ Q;  2JA6 H;  5C0X I;  2KCT A;  3HFZ B;  2R7D A;  1VQ7 A;  3PUW A;  3KF6 B;  2JA8 H;  3KFU A;  1QUQ B;  1YIT A;  4YWL A;  1OTC A;  2UUC L;  2IY5 B;  5FJ8 G;  1NY4 A;  1P16 A;  2ALY B;  2CCZ A;  3J81 i;  5AJ3 L;  3ER0 A;  4BA2 I;  2JK8 A;  1CKO A;  2VS1 A;  1KHI A;  2HHH L;  3S1N H;  4HIM A;  4X65 L;  1VQO A;  4R4Q A;  4NB3 A;  2UUC Q;  1S3O A;  3AFP A;  1ASZ A;  5AJ3 Q;  4A3L H;  4K0K L;  2EXD A;  3OTO L;  3AQQ A;  2AWO A;  2NN6 I;  1PH6 A;  4NPS A;  2HHH Q;  4XTC S;  4GN5 A;  4X65 Q;  1KQS A;  1YHB A;  3CCL A;  4A3J H;  1I50 H;  2IX0 A;  1MKH A;  1LUZ A;  3H3V I;  1X3G A;  4DK3 C;  2AWN A;  3GTP H;  1YHQ A;  1IBK L;  3I4N G;  4K0K Q;  2F52 A;  2UUA L;  3S16 H;  3A5U A;  3I4M H;  1VQF A;  2HIX A;  2RCN A;  3CW2 C;  1TWH H;  2QEX A;  4JYA L;  4YY3 Q;  1C0A A;  2RHQ B;  3UDG A;  4DR2 Q;  1Y1W G;  1IBK Q;  1NMF A;  2UUA Q;  1GVP A;  4UP8 A;  1VQC A;  4JYA Q;  2JA8 G;  1YJW A;  4MTN A;  2VUM H;  2YYZ A;  3J81 j;  3GTQ H;  1IYJ B;  3U58 A;  4A3K G;  4LF4 L;  2Z6K A;  1VQH A;  4IFD I;  3CC2 A;  1YJN A;  2NVY H;  4GN4 B;  2JA9 A;  4BBR G;  1EIF A;  1KXL A;  4JI0 Q;  5LMU L;  4GNX C;  4A3I G;  1PH2 A;  3B6Y A;  2K5H A;  5LMN Q;  4OO1 I;  4IPH A;  4JI4 L;  1A63 A;  4OO1 G;  1WI5 A;  4JOI C;  4A3L G;  2C35 B;  4IOA A;  3S1R H;  4A3B H;  2OCE A;  3DM3 A;  5LMU Q;  5C44 G;  1E22 A;  2ID0 A;  3GTJ H;  4DV0 L;  4LFA L;  3GTM H;  2PQA B;  1U0L A;  3PUY A;  3RLO A;  2CKZ B;  1RL2 A;  3I4M G;  5IP9 H;  1D8L A;  4PZ7 A;  3G6E A;  3AFQ A;  3M3Y H;  4DV0 Q;  5HY6 A;  4WJ4 A;  1X54 A;  2D0P A;  2JA5 H;  4LFA Q;  5C4J H;  4LUV A;  1HNX Q;  1L1O A;  4ME3 A;  5EAY A;  3PIP A;  5C4X G;  4L5S A;  2R6G A;  3K7A H;  4AYB E;  3CCE A;  1E24 A;  1W3S A;  3PUZ A;  3PSI A;  1TWC H;  1PV4 A;  2VUM G;  5M3M G;  3GTG H;  4C3I H;  1SE8 A;  3PV0 A;  4AH6 A;  2K75 A;  3K0X A;  2ZTD A;  3TS0 A;  3EN2 A;  3S1Q H;  5JJI A;  3ULL A;  5IYB G;  1TWA H;  3L7Z C;  4YCW A;  2CWA A;  3U50 C;  4LUZ A;  5IY0 A;  1A62 A;  3CCM A;  3NEN A;  2XGT A;  4JBM A;  2Y0S G;  4GOP C;  2UXC L;  2MO1 A;  3K80 C;  1K3R A;  1Q82 C;  5JJK A;  3M4Q A;  1T9H A;  1X3E A;  4QGU A;  4OWX B;  3HOX H;  4HID A;  2K5N A;  4IJH A;  4P72 A;  1V9P A;  1YEZ A;  2F3I A;  3E0E A;  1YI2 A;  1N36 Q;  1XNR L;  2UXC Q;  3EIV A;  1EOV A;  4O0A A;  2GVB A;  4A3M H;  4X66 L;  5IP9 G;  4DKA C;  4DV3 L;  4BBS H;  3PO3 H;  4YWM A;  5FLM H;  4IOC A;  2JA5 G;  2B3G A;  3Q8D A;  4PMW A;  3IRB A;  2Q2U A;  3LGJ A;  1DGS A;  3AEV A;  3FP9 A;  3KF8 B;  4X66 Q;  1VQP A;  2ZJQ A;  2IX1 A;  3U4Z A;  4DV3 Q;  1PA6 A;  4LW1 A;  4R4C A;  2R93 H;  3TRZ A;  1B7Y B;  3RNU A;  2UXD L;  1PFS A;  1M90 C;  4A4I A;  2E2H H;  3BZC A;  4DR1 L;  3M85 A;  4P73 A;  4RG1 A;  1E7Z A;  2Z0S A;  2UXD Q;  3STB D;  1XMO L;  4LF9 L;  2Y0S E;  1MJC A;  1CKN B;  5IYC H;  3RN2 A;  1N34 L;  4LF7 L;  2IT1 A;  5IYD H;  1EQR A;  3HOX G;  3S14 H;  1VQB A;  3F1Z A;  1XMO Q;  1YZ6 A;  4LF9 Q;  1L1O C;  3K81 C;  4HJ8 A;  2VQF L;  3F2B A;  4A3M G;  4JI2 L;  2EQS A;  3WWV A;  1N34 Q;  1JE5 A;  1I94 L;  4LF7 Q;  3BU2 A;  1PH1 A;  2JE6 I;  4BBS G;  3K8A A;  2ZM6 L;  4A75 A;  1Z47 A;  5FLM G;  1KD1 C;  3PO3 G;  5DLQ E;  3CD6 A;  2OQK A;  4MNO A;  1HNW L;  1VQE A;  4JI2 Q;  5C0X G;  3TEH B;  3KF6 A;  4YHH L;  2VQF Q;  4HJA A;  3J7A 5;  1I94 Q;  4A3D H;  3RR5 A;  4DR4 Q;  2ZM6 Q;  4GNX B;  2R93 G;  1WCM H;  2YTX A;  3TQY A;  4R1J A;  1YJ9 A;  1HNW Q;  4YHH Q;  1K8G A;  1VQ4 A;  2E2J H;  4A3G H;  2GVA A;  1I6H H;  4EX5 A;  2IHF A;  4BY1 H;  4IPD A;  4YWK A;  1G51 A;  2OTL A;  1KL9 A;  1LTL A;  1A0I A;  1XTD A;  1PVO A;  4A93 H;  2NZH A;  2LXK A;  3DLL A;  3KLW A;  4R4T A;  2NN6 G;  1Y14 B;  3PF5 A;  4YY3 L;  1EIY B;  5M3F H;  2HQL A;  3HOZ H;  3L0O A;  3W1G A;  4UPA A;  2WFW A;  1GM5 A;  4DR2 L;  4LF6 L;  4DV4 L;  3GDE A;  4DR7 Q;  2NVT H;  4IJL A;  3HKZ G;  3VDY A;  4KHP L;  2E5L L;  1EFW A;  3KOJ A;  3PCO B;  4GLV B;  1HJP A;  4JBJ A;  5GQO A;  4X62 L;  2VQE L;  2UU9 L;  3PF4 A;  4LF6 Q;  4JI1 L;  4DV4 Q;  1U5K A;  2PMZ E;  5C0X J;  2JA6 G;  4A76 A;  4LNQ A;  3CCS A;  4POF A;  4JI0 L;  1XPO A;  2E5L Q;  4KHP Q;  4GN3 B;  1LM0 A;  2UU9 Q;  2VQE Q;  4X6A H;  4X62 Q;  1WYD A;  4OWT B;  1VQD A;  5LMN L;  4A3D G;  2IHE A;  4JI1 Q;  1Q8K A;  1WCM G;  4IPG A;  4YCV A;  3HOY H;  5ELO A;  1UE5 A;  4IFD G;  1LYL A;  5LMN W;  1X55 A;  1KIX A;  2MQH A;  1IBM L;  4A3G G;  2LSS A;  2WB1 G;  5M5Y H;  2ZJP A;  4GOP B;  1BBW A;  1VQN A;  4QIW E;  3ULJ A;  4TQU S;  4A93 G;  4JI6 L;  3GD7 A;  3I4O A;  1FVI A;  1IBM Q;  2A19 A;  4BY7 H;  4NXM L;  3CPF A;  4A3J G;  5M3F G;  3HOZ G;  2ZTE A;  4HIK A;  1SR3 A;  2V1C C;  5JJL A;  4OX9 L;  4JI8 L;  1HNX L;  1VQJ A;  4JI6 Q;  2PNH A;  2B63 H;  4NXM Q;  2ATW A;  4YCU A;  3W1B A;  2NVQ H;  4JI5 L;  3CCV A;  1X6O A;  2CWP A;  4DAY B;  4OX9 Q;  4UY8 C;  3D31 A;  1Q1E A;  4RMF A;  4JI8 Q;  3L2P A;  1OXV A;  5GAG C;  1HZ9 A;  3KDF A;  4HJ9 A;  3S1M H;  4IO9 A;  3HOU H;  1VQI A;  1FGU A;  1HZB A;  4C3J H;  4JI5 Q;  1YHA A;  1HZC A;  4B3S L;  1V1Q A;  4IFD J;  3MEF A;  1YNX A;  1VCI A;  3I7F A;  1KAW A;  3M9B A;  1KC8 C;  4B3T Q;  1XPU A;  3BZK A;  1YVC A;  3H15 A;  1UE7 A;  1V43 A;  1TXY A;  3HOY G;  1QZG A;  2EIF A;  4O2D A;  2VL6 A;  1YIJ A;  4B3S Q;  3J7Z C;  1SLJ A;  1TWF H;  2Q2T A;  1WFQ A;  4JG2 A;  2AKW B;  1N36 L;  3ICE A;  5HGQ A;  1VQL A;  4A3B G;  1G29 1;  4PZ8 A;  1X65 A;  1EYG A;  4DV7 L;  1HR0 L;  1CSQ A;  1RIP A;  4JC0 A;  1L1O B;  3UDI A;  2NZO A;  2B29 A;  5GAH C;  1NJI C;  1HR0 W;  1IL2 A;  1Q1B A;  1GKH A;  4P74 A;  4KLK A;  5M5X H;  1PHJ A;  3GTK H;  2Q2H A;  1HR0 Q;  3TRE A;  4DV7 Q;  1VQ5 A;  3F8T A;  2B63 G;  1X3F A;  1XPR A;  3OW2 A;  3A74 A;  5JEA G;  1X56 A;  1Q81 C;  1X9N A;  3D0F A;  2Z6K C;  3FHW A;  3MXN B;  3HOU G;  2FXQ A;  2ES2 A;  4BXX H;  2GN5 A;  1N32 Q;  4P75 A;  1VQA A;  2LXJ A;  1UE1 A;  2N78 A;  2H5X A;  4H02 A;  3W5O A;  2JJQ A;  2KBN A;  2YV5 A;  2ZTC A;  2R7Z H;  1AE2 A;  3PGZ A;  2YU9 H;  4R4I A;  4HJ7 A;  4LFB L;  1Q46 A;  4KI0 A;  5IP7 H;  2R92 H;  3I2Z A;  3CCU A;  2WP8 J;  2CFM A;  1K0R A;  1CKN A;  1QVC A;  4DR6 L;  2KHJ A;  2BH8 A;  4DV5 L;  4LFB Q;  3UE1 A;  2D0O A;  4C2M H;  1N8R C;  4X64 L;  1K9M C;  4DPG A;  3CAM A;  2OWO A;  4AIM A;  3S15 H;  3S24 A;  1NE3 A;  5FJ8 H;  3ULP A;  4DUY L;  3RZD H;  1JJ2 A;  4DR6 Q;  3JAM c;  1UE6 A;  4DV5 Q;  4X64 Q;  4DR4 L;  2K14 A;  1IBL L;  1PYS B;  3HOV H;  4JCV E;  2KHI A;  4A3C H;  4DNI A;  3ERS X;  2CQO A;  3A5Z B;  3G4S A;  4POG A;  3M7N A;  4DUY Q;  3J80 c;  5J3B A;  4R4O A;  2RHS B;  1QUQ A;  4BXX G;  1JJG A;  4NXN L;  2BA0 A;  4GNX A;  1IBL Q;  2L15 A;  2RF4 A;  3H0G H;  1HZA A;  2UUB Q;  3HOW H;  2R7Z G;  3CMA A;  2WAQ G;  4NXN Q;  4OON A;  4DV2 L;  4Y7N H;  4A3F H;  4JBK A;  2K52 A;  4WJ3 M;  1VS0 A;  5IP7 G;  2R92 G;  1GD7 A;  1Y1V H;  1EUJ A;  3RLF A;  5IYC G;  4GKK L;  1UWV A;  1KRT A;  1D7Q A;  3RLN A;  5IYD G;  4DV2 Q;  5IT9 c;  1VQK A;  1B8A A;  1S40 A;  2DUD A;  4QJF A;  4A3K H;  2DGY A;  3CC4 A;  4GKK Q;  4XIG S;  1B70 B;  2E2I H;  2N8N A;  4GLA C;  1UEB A;  4BBR H;  1PH9 A;  3HOV G;  4A3I H;  4A3C G;  3CPW A;  3F2C A;  5H1S E;  2JA7 H;  1PH3 A;  3S2D H;  1SN8 A;  5BR8 L;  1VQG A;  3PIO A;  1C7Y A;  1SRO A;  4EQ5 A;  2JEB I;  5C44 H;  3H0G G;  1L0W A;  1SFO H;  1SMX A;  2I5M X;  3HOW G;  1A8V A;  5BR8 Q;  3CCJ A;  1XJV A;  2WAQ E;  3PO2 H;  4BY1 G;  3CXC A;  3OTO Q;  2VW9 A;  3CCR A;  3KYH C;  4GOP A;  4AQY L;  4KHZ A;  5GAE C;  3NEM A;  2BA1 A;  4A3F G;  2AHO B;  3JC6 6;  3GTL H;  4JBW A;  4L5R C;  4DR7 L;  3S17 H;  5K36 G;  1P8L A;  1Y1V G;  1E1T A;  4DAM A;  1PYB A;  3SGI A;  1HH2 P;  4AQY Q;  1PH7 A;  1PH4 A;  4APV A;  1O7I A;  3CP0 A;  5C4X H;  1R9T H;  1PH8 A;  2PQA A;  3HKS A;  1G6P A;  3PUX A;  5GRO A;  4AYB G;  5C3E H;  1JMC A;  3HKZ E;  1QZH A;  4LF5 L;  4LF8 L;  1C9O A;  1CKM A;  1OXU A;  5M3M H;  1EQQ A;  4L5Q A;  2A8V A;  2VNU D;  2HT1 A;  4QQB X;  4GLX A;  1WJJ A;  1MJE A;  2K50 A;  2YTY A;  3E9H A;  4LFC L;  3KJO A;  4B3T L;  2I5L X;  5IYB H;  4LF8 Q;  4LF5 Q;  1QVF A;  1E3P A;  1VQ6 A;  4PZ6 A;  2JA7 G;  1EWI A;  5GAD C;  3T1H L;  4LF4 Q;  3G71 A;  4DV6 L;  2I5H A;  2YTV A;  2I0Q A;  1OXT A;  4LFC Q;  1JT8 A;  3UDF A;  2VZA A;  2MO0 A;  3J81 c;  1QVG A;  4JI4 Q;  1I3Q H;  1GO3 E;  2JQO A;  3T1H Q;  4B3M L;  1L2F A;  2N49 A;  1VQ9 A;  1BBU A;  1OXS C;  2WB1 E;  4DV6 Q;  1S72 A;  3CCQ A;  3T1Y L;  3PO2 G;  1AE3 A;  3RN5 A;  5E7N A;  1NMG A;  3JAM i;  1E1O A;  1FJG L;  2VY3 A;  4UP9 A;  2BH2 A;  5IE8 A;  4B3M Q;  4IPC A;  1YBY A;  3A0J A;  4BY7 G;  1Z9F A;  1H95 A;  3T1Y Q;  3KDF B;  3S2H H;  3CME A;  3J80 i;  5ELN A;  4GKJ L;  1W2B A;  1FJG Q;  1Q7Y C;  1VQ8 A;  1CSP A;  3G48 A;  2OTJ A;  5C3E G;  3ZJY C;  1FL0 A;  4LUO A;  4ALP A;  2Q2I A;  2PI2 A;  3FKI H;  1N32 L;  4GKJ Q;  3AYH B;  4HIO A;  1N33 L;  3I55 A;  2ASB A;  2QA4 A;  4JV5 L;  2JEA I;  2UXB L;  2K4K A;  3STB C;  4OWW B;  3BJU A;  4Y52 H;  4A3E H;  3CC7 A;  1M1K C;  4DV1 L;  1NTG A;  1N33 Q;  4DR3 L;  4JV5 Q;  1JJC B;  2UXB Q;  4QY7 A;  4DR5 L;  1SRU A;  1J5E L;  1VQM A;  1IXR A;  5FLX c;  4DV1 Q;  1I5F A;  2AMC B;  1WOC A;  1XNQ L;  2MNA A;  4DR3 Q;  4LWC A;  1Q12 A;  3I56 A;  2R7F A;  4DR5 Q;  4P71 A;  4HJ5 A;  1J5E Q;  4JI7 L;  4MZ9 A;  3U4V A;  1XNQ Q;  4QL5 A;  1XNR Q;  3OYY A;  1ASY A;  3TS2 A;  3EBE A;  3NBH B;  1NBW A;  2E8G A;  2XTI A;  3CF5 A;  4B3R L;  3M4P A;  1K83 H;  1TWG H;  2PI2 E;  2A1A A;  4OXP A;  1KRS A;  4JI3 L;  1JB7 A;  5JEA J;  4JI7 Q;  3GTO H;  1AH9 A;  1HNZ L;  3NEL A;  2MFI A;  2OQ0 A;  3FKI G;  3M4O H;  2D62 A;  4L5T A;  1MIU A;  3F2D A;  1BVS A;  2UUB L;  1K8A C;  4PG3 A;  4B3R Q;  4DUZ L;  3UDX A;  5M5W H;  2F4V L;  3CQZ H;  3KJP A;  1PH5 A;  4JI3 Q;  1Q86 C;  1BKB A;  1HNZ Q;  3PUV A;  2QGQ A;  5IWA L;  4A3E G;  1J6Q A;  4J15 A;  3GO5 A;  4DR1 Q;  3UE0 A;  2HIV A;  4DUZ Q;  2F4V Q;  4TVA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...