1FL0A

Crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
164
structure length
164
Chain Sequence
IDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
publication title Structure of the EMAPII domain of human aminoacyl-tRNA synthetase complex reveals evolutionary dimer mimicry.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fl0A00
1E3PA 2UUBL 1L1OC 1E7ZA 3RR5A 3CCUA 4KHPQ 2IHEA 1HZ9A 2WP8J 4LFCL 4A3JH 4BA2I 1L2FA 3KOJA 5DLQE 5IE8A 4JI1Q 1Y1VH 3A5ZB 4X62L 5C44G 3J81i 3HOWH 1XPUA 4B3TQ 3S24A 4A3BH 3S16H 2OTJA 4DR4Q 4OONA 2A19A 4RG1A 1GM5A 3HOVH 5GQOA 2K50A 5GROA 2CCZA 2VQEQ 5FJ8H 2HT1A 4A3IH 2ZJRA 5M3MH 2NVYH 3ICEA 4NB3A 1X9NA 1S40A 1M90C 1VQCA 2WB1E 1RL2A 2D0OA 4IPGA 3J80i 2K14A 4GNXA 1MKHA 2A8VA 3NELA 1G51A 5GAEC 3CC4A 4UPAA 1YHQA 1VQ5A 1V1QA 3RZDH 1V9PA 2YU9H 1WI5A 2ZTCA 2EIFA 4A3EH 2ALYB 3MEFA 3FKIG 1YJNA 2HIVA 4X66L 1YHBA 1HNZL 3T1YL 4JI6L 1XNRL 3I4MH 4JYAQ 2UXCQ 2XTIA 4HIMA 4YWMA 4RMFA 3PUVA 1VQNA 4HJ9A 2MO1A 3AFQA 3TS0A 4X64L 2Q2HA 1VQEA 4UP7A 2NN6G 3KF6B 2RF4A 4LF9L 3H0GH 1GD7A 1SLJA 2MO0A 2MNAA 5LMNL 1IBKQ 3W1GA 2B63G 1VQPA 3CCMA 3L0OA 1PH7A 4UY8C 5IWAQ 3VDYA 3IRBA 1EIFA 1SRUA 1UE6A 3CF5A 4JI8Q 1NBWA 5LMUL 3Q8DA 1XJVA 3GTLH 3KDFB 3PUXA 4OX9L 2VL6A 3S17H 4GOPB 4B3ML 2VUMH 3J81j 4X65Q 1Q1EA 3PO3H 2KHIA 2NN6I 4A3LH 3KFUA 2E2JH 1LYLA 4APVA 5JEAG 3TRZA 3PO2G 5C4XG 3A74A 4JBMA 1Q1BA 3J7A5 4DV3L 3EN2A 1YJ9A 2JA9A 3D31A 3F2CA 2UU9L 4H02A 2CWPA 4YY3Q 5M5YH 1I94L 1XPOA 4NPSA 3UDXA 5M5XH 3HOXG 3S1QH 2K75A 2NVQH 1MIUA 1EOVA 5IP9G 2UUCQ 1W3SA 1BBWA 4JV5L 3M7NA 2JA5H 4LUZA 5ELNA 2F4VL 4JOIA 4P73A 1KC8C 1VQHA 4QL5A 1IBML 4KHZA 1CKNB 4IPCA 4A3KH 4AQYL 1XNQQ 4DR2Q 1YHAA 3HKSA 4DAMA 1N32Q 4YCUA 2QEXA 2ATWA 3CCEA 4DV1Q 4BBSH 1NTGA 4KI0A 3CXCA 1VCIA 3MXNB 4A4IA 4TQUS 5IYCH 3H3VI 3EIVA 3I2ZA 3U4ZA 4A3IG 1PA6A 1HR0L 5H1SE 4OO1I 1Q8KA 4AIMA 2VQFQ 2F3IA 1D7QA 4YHHL 4LF4Q 3GTMH 4JI5Q 4A75A 1KRTA 1UE7A 2E5LL 4NXMQ 3M85A 2OQ0A 3GTGH 1BVSA 2R93H 2JEBI 1OXUA 4WJ3M 4DV7Q 2FXQA 4DV5Q 4KHPL 4A93G 3CPFA 4LW1A 1Q7YC 2JJQA 4IOAA 1KD1C 4JI1L 2B29A 2UUAQ 4B3TL 5C3EH 1PH5A 3NEMA 4DR4L 2PI2A 3K81C 2OTLA 1YEZA 1HZBA 4ME3A 1X6OA 4YCWA 1Q86C 3M4OH 4IFDJ 2VQEL 4HJ7A 4IPDA 2MFIA 3HOZG 3RZOH 2OQKA 4JI2Q 3CPWA 4GLVB 2NVTH 3I4NH 4MZ9A 2R92G 1IL2A 2GN5A 4HJAA 3U4VA 1YVCA 4DK3C 4DUYQ 4A3CG 1X65A 1K83H 2BA1A 3M9BA 1YITA 5FLMH 1S3OA 1PYBA 4JI4Q 4MNOA 3E9IA 4LF6Q 1UWVA 4B3SL 5HY6A 4JYAL 1K73C 2UXCL 2KENA 1CKOA 1N34Q 3PO3G 4A3LG 1FJGL 3GTJH 4HIOA 1KIXA 1VQ8A 2JK8A 1EFWA 1PHJA 1PV4A 2IY5B 2ZM6Q 5JJKA 2YTVA 1AH9A 4DR5Q 3PIOA 1K0RA 1B8AA 2JA7G 3NBHB 4BY1H 5IYDH 4L5QA 1D8LA 4AYBG 4DR1Q 3I55A 3OTOQ 5AJ3Q 4PZ8A 1IBKL 1Y14B 2NVXH 4DR3Q 2PMZE 1HZAA 2CQOA 1K8AC 2YTYA 1EIYB 3KDFA 1WOCA 5IWAL 2HHHQ 4OWTB 4GOPA 3RN5A 2HQLA 4BY7G 4JI8L 4YWLA 1OTCA 2JEAI 1V43A 3G71A 1IBLQ 4B3RQ 2CKZB 4R1JA 4FDBA 1JMCA 4LF5Q 2R6GA 4DAYB 2E8GA 2R7ZG 1LM0A 4X65L 1PH3A 1XMQL 3S2DH 4DUZQ 2V1CC 4QIWE 2D62A 1GKHA 4XTCS 2PI2E 3ULLA 3ULJA 2AMCB 1X54A 2Q2IA 1YZ6A 1QVGA 4LFBQ 4LFAQ 1OXTA 2Y0SG 5LMNW 4BBRH 4YY3L 2QA4A 4AH6A 4JI0Q 4UP9A 4A3FH 4C3HH 1QVFA 4A3GH 3CCQA 2VS1A 3U50C 4GOPC 1CKNA 3G48A 4X6AH 4HJ5A 1VQ7A 2UUCL 4JCVE 4R4OA 1VQ4A 4XIGS 3KJPA 1PYSB 2IT1A 5IYBH 5M3FG 4OXPA 1YJWA 2RCNA 1XNQL 1L1OB 1JE5A 2Z6KA 3NENA 4GNXC 1S72A 1KXLA 1SMXA 3LGJA 1L0WA 2EXDA 4DR2L 2N3SA 1N32L 3ULPA 5JEAJ 4DPGA 3K80C 5M5WH 3G4SA 4DV1L 4OWXB 4A3MG 4K0KQ 1WCMH 4DV0Q 3TREA 5J3BA 4DR6Q 3GTKH 1XMOQ 2UXDQ 4GKKL 2OWOA 2YTXA 1R9TH 1EQQA 2VQFL 1HJPA 1AE2A 4YCVA 4LF4L 2VW9A 4BXXH 2JA8H 2JA6G 1C7YA 3HOYG 3J7ZC 4NXML 4LFCQ 2ZJQA 1PVOA 3T1HQ 3HOUH 1OXVA 3K8AA 1HZCA 5FLXc 1X3FA 4R4TA 4DV5L 3KYHC 4DV7L 1T9HA 2Z6KC 3K7UC 3RN2A 2JE6I 4X62Q 4HIDA 4PG3A 2N49A 2D0PA 3S15H 1KRSA 1E1TA 3TQYA 1FGUA 1J5EQ 2I5MX 1N8RC 2UUAL 4OO1G 1A8VA 3CMEA 3CD6A 1C0AA 5E7NA 3AQQA 5IP7H 1IXRA 3A0JA 4NXNQ 2IX0A 5GADC 4A3JG 1PH4A 1FL0A 2KCTA 3JAMc 1HR0W 4JI2L 3HFZB 1Y1VG 1LUZA 3HOWG 1I6HH 1HNWQ 4DV6Q 4A3BG 1N33Q 3FHWA 3HKZG 2I0QA 4LWCA 4DUYL 3HOVG 1KQSA 3ERSX 5FJ8G 2KHJA 4IO9A 4JI4L 5GAHC 3F2BA 4P71A 5M3MG 5C0XI 1C9OA 1VQDA 3OYYA 4P72A 5C44H 3KJOA 1SE8A 4LF6L 1UEBA 4C3IH 1Q12A 1VQ6A 1YI2A 3UE0A 2RHSB 1KAWA 4JBWA 4PZ6A 3UDIA 1MJCA 2BH8A 1O7IA 2R7DA 2KCMA 4JOIC 3STBC 2ZM6L 1SROA 4A3EG 1QZHA 2PQAB 4DR1L 3I4MG 3OTOL 3S1NH 3PF4A 1A62A 2AHOB 4DR3L 1NMGA 2Q2UA 5GAGC 4P75A 1VQ9A 5BR8Q 2HHHL 4OWWB 5IY0A 1W2BA 3FKIH 1Z47A 4IOCA 2JQOA 3DLLA 3CCSA 1IBLL 1J6QA 3H0GG 4B3RL 1DGSA 3W5OA 4LF5L 3M4PA 1BKBA 1I5FA 3I56A 2BH2A 1Q82C 4DK6C 3M3YH 4GN4B 4JC0A 1MJEA 3W1BA 1VQFA 4DUZL 3KF8B 5C4JH 3PUZA 1PH9A 1WCMG 1TWAH 4IJHA 4L5RC 4A3DH 4JI7Q 2YYZA 2LXKA 2B63H 2ID0A 1PH6A 4LFAL 2VUMG 5JJLA 3E0EA 3J81c 1KHIA 2K5NA 4JI0L 3FP9A 3KF6A 4BXXG 3L7ZC 3GDEA 2ZJPA 4HIKA 4GN3B 1Y1WH 1GO3E 4A76A 1KL9A 1E22A 1RIPA 2VNUD 1TWFH 3J80c 2N8NA 4R4QA 4GS3A 1JJ2A 3PIPA 4KLKA 1M1KC 3BJUA 2DUDA 3CC7A 1AE3A 4GLXA 2VZAA 1P16A 2I5HA 1EQRA 1ASYA 5IP7G 2I5LX 4DV0L 2JA5G 1UE1A 2KBNA 4DR6L 4DR7Q 2RHQB 1X3EA 3SGIA 4A3KG 1XMOL 1HNXQ 3HOXH 3ER0A 4LF8Q 1OXSC 4O2DA 2DGYA 2E5LQ 4LF7Q 1YIJA 4EX5A 5IP9H 2N78A 1NE3A 1WFQA 2LXJA 3AFPA 3E9HA 2GVBA 4BBSG 3GTPH 1CUKA 4DV2Q 5IYCG 3T1HL 2BA0A 3BZKA 3CQZH 4LNQA 1U5KA 4GKJQ 3JC66 2UXBQ 1G291 4AYBE 2GVAA 4PZ7A 3S1RH 3AYHB 4IFDI 1QZGA 2A1AA 3RLFA 4DNIA 4WJ4A 4QY7A 1J5EL 4TVAB 3PF5A 1TWHH 1N36Q 2K4KA 2R93G 4R4CA 1N9WA 1FVIA 2NZOA 4NXNL 1G6PA 2WAQG 4MTNA 4J15A 3KLWA 4Y7NH 3CW2C 1SR3A 1EUJA 2F52A 2E2HH 4JI3Q 2IX1A 1ASZA 2IHFA 1HNWL 2ZTDA 1A0IA 3DM3A 4R4IA 5C3EG 1OXXK 5EAYA 4DV6L 3F1ZA 1JB7A 1N33L 4EQ5A 1WYDA 2CFMA 2AWOA 2L15A 4A93H 4DV4Q 4UP8A 4B3SQ 3RLNA 1HH2P 2C35B 3BU2A 2LSSA 2E2IH 3CCLA 1FJGQ 3I4NG 1K3RA 2Y0SE 3TEHB 1QUQB 5C0XJ 3UDGA 2UUBQ 5ELOA 4JBJA 4JG2A 4YWKA 4JI5L 1SFOH 2PQAA 3S14H 1SN8A 3PUYA 1VQGA 3HOZH 1X55A 5FLMG 4L5SA 4A3DG 1PH8A 1VQJA 3WWVA 4Y52H 5K36G 4QGUA 3CMAA 2WAQE 1X56A 2R92H 1UE5A 4LUVA 5C0XG 2AWNA 4A3CH 3M4QA 1VS0A 2ZTEA 5BR8L 1YNXA 2K5VA 4GN5A 4JBKA 3PGZA 3I4OA 1Y1WG 4POGA 5IYDG 4BY1G 4O0AA 1XMQQ 1WJJA 1I3QH 3CP0A 1U0LA 1IZ6A 1YBYA 4GNXB 2QGQA 2JA7H 1JT8A 1HNZQ 4DKAC 1Q46A 1XTDA 2B3GA 1P8LA 4L5TA 1CSPA 3RLOA 4X66Q 3T1YQ 4JI6Q 2Q2TA 4JI7L 2ASBA 1XNRQ 2MQHA 1VQIA 1VQAA 3RNUA 2YV5A 1PH2A 2PNHA 4X64Q 4BY7H 3ZJYC 1N34L 1NJIC 4ALPA 1I50H 3GO5A 3I7FA 4LF9Q 5LMNQ 1H95A 4DR5L 1NMFA 3S2HH 1VQMA 2R7ZH 4POFA 1A63A 3H15A 5AJ3L 1Q81C 1EWIA 4BBRG 1B70B 4PMWA 3TS2A 3CCJA 4QQBX 3CAMA 3PSIA 4A3FG 2VY3A 3OW2A 4A3GG 5LMUQ 2NZHA 3GTOH 3PV0A 1NY4A 3G6EA 3UDFA 4OX9Q 3HKZE 1VQLA 1CSQA 1PFSA 4GKKQ 4B3MQ 4DR7L 3GD7A 1VQBA 5IYBG 3JAMi 1Z9FA 1TWCH 1HNXL 1LTLA 1BBUA 3BZCA 3D0FA 4LF8L 4LF7L 1E24A 1CKMA 5IT9c 5JJIA 4DV3Q 3PCOB 2WFWA 2EQSA 2OCEA 3U58A 2R7FA 2H5XA 4DV2L 5M3FH 4QJFA 3K7AH 2UU9Q 1K8GA 4HJ8A 3CC2A 1I94Q 3S1MH 4GLAC 4GKJL 2UXBL 2ES2A 1PH1A 4LFBL 1QVCA 4IJLA 3F2DA 4P74A 2HIXA 3EBEA 2CWAA 4JV5Q 3L2PA 4A3MH 2JA8G 2F4VQ 1L1OA 1IBMQ 1N36L 3HOUG 1IYJB 1B7YB 4AQYQ 1VQOA 1EYGA 2K5HA 3CCRA 3GTQH 1VQKA 1E1OA 3PUWA 1GVPA 4C3JH 3HOYH 1JJCB 2JA6H 4JI3L 3PO2H 5C4XH 3CCVA 2Z0SA 4LUOA 1XPRA 4IPHA 4C2MH 1TXYA 1HR0Q 3K0XA 3A5UA 4IFDG 4K0KL 5HGQA 1JJGA 2AKWB 1QUQA 4DV4L 2WB1G 3STBD 4BA1I 3H3VH 2UXDL 2K52A 4YHHQ 3UE1A 1K9MC 3B6YA 3F8TA 2XGTA 1X3GA 1TWGH 3AEVA
chains in the Genus database with same CATH superfamily
1X32A 4K8IA 4KKUA 3T53B 2IHEA 4LFCL 1K8MA 4X62L 3QOJA 2KVMA 3D6WA 4B3TQ 3S24A 2OTJA 1ILPA 4RG1A 4XQNA 3HOVH 5GQOA 2XN9C 4A3IH 3P20A 2B2WC 2WB1E 4IPGA 2K14A 3GV6A 2A8VA 5GAEC 5M9OA 2XWBB 3MC0B 3RZDH 2YU9H 1SYBA 2ALYB 3MEFA 3I4MH 1YHBA 2UXCQ 1RODA 1SNCA 2D9UA 2J0TD 2JSOA 3S2HB 2XWJB 1U4PA 4UP7A 4X3UA 3KLSA 3BYYB 2XRQD 1GD7A 2MO0A 5LMNL 1BQQT 2IX3A 1YNND 2RDFA 3IRBA 1UE6A 1TS3A 4JI8Q 4CDEC 1B53A 1NBWA 4RGOS 1PTOH 4OX9L 3S17H 4GOPB 4NDXA 1AW7A 4X65Q 3KBXA 4JVZA 1UNSA 3PO2G 5C4XG 3A74A 2F0UA 3R8BA 3D31A 1HA5A 2CWPA 1EU4A 4A3MB 1XPOA 3HOXG 2NVQH 5BN3A 1DXMA 1QWYA 2UUCQ 5J1ZA 1BBWA 2JA5H 1KC8C 4A3KH 2QEJC 2JA6B 1MI2A 1Y8OB 4MHEA 1WTQA 4YCUA 1H9JA 1EEID 4DV1Q 1NTGA 3BDLA 1VCIA 3MXNB 4TQUS 3NXWA 3DWQA 3I2ZA 3DXJC 3MWYW 1TY0A 2VQFQ 4YHHL 4JI5Q 1KRTA 1UE7A 4N9PA 2B2YA 3GTGH 5FK9C 1BVSA 2JEBI 2SEBD 1Y1VB 3HOWB 1BF4A 3CPFA 1KLGD 2JJQA 2PQEA 4IOAA 4QCLA 4K6DA 4JI1L 2RDHA 3TSSA 3WOFA 2B29A 5M3MB 3QB3A 3R2TA 2PI2A 1GUWA 1YEZA 3M4OH 4IFDJ 1Q86C 4HJ7A 3NQTA 1I4GA 4DAPA 4TKOB 1EIHA 4JI2Q 2A68C 5C4ZA 4GLVB 1IL2A 2PW5A 3NK9A 3PMFA 4JW0A 5CV6A 4DUYQ 1PYBA 5K36H 1RCVD 1UWVA 2L0CA 1CKOA 3PO3G 5C0XH 3H0GB 1VQ8A 3TP8A 1PHJA 1SE3A 2ZM6Q 1AH9A 2EY1A 4DR5Q 1B8AA 3SE0A 1D8LA 1BR9A 3OTOQ 1IBKL 1AFPA 5EGTA 2CQOA 1WOCA 2B2TA 2Z8LA 2VUMB 4YWLA 3RUZA 2E2JB 4LF5Q 1E2VA 1AN8A 5JAVA 2IJ0A 4XTCS 1EEFD 3ULLA 2ZXOA 2Q2IA 5KRUA 1JC7A 4X3TA 5IGBA 1I6VC 2QA4A 4JI0Q 2E76C 4DGZA 2VS1A 3BZDB 5E4XA 1B2TA 1VQ7A 4XXEA 3KJPA 1DOKA 1YJWA 2QDBA 1XNQL 4GNXC 1TU2B 1S72A 5KNCA 4G7OC 1SMYD 1N32L 3ULPA 5M5WH 3M4YA 4I7AA 4A3MG 1WCMH 3TREA 5F2DA 2UXDQ 2ZXPA 3FPUB 1NUCA 2WKDA 1AE2A 5ELBA 2VW9A 5I2YA 2KHSA 2WAQB 2JA6G 1C7YA 4NXML 1FD7D 5T1GA 3LX0A 1OXVA 3K8AA 4R4TA 1CTMA 3KYHC 1T9HA 2Z6KC 3RN2A 4HIDA 1I4QA 3S15H 1N8RC 2VB2X 2UUAL 3CMEA 1EIGA 3RZOB 3RD4A 4IFDH 2NVTB 2EY5A 1IXRA 4CDCC 2KCTA 3X3NA 3C1EA 1Y1VG 1LUZA 4PMCA 3HOWG 2HCIA 3T4AC 3FHWA 3BVGA 1KQSA 3ERSX 1RJTA 2KHJA 4UDUC 4DXFA 5M3MG 4LF6L 1SE8A 3SHLA 2LKVA 3UE0A 4PZ6A 1PFBA 1ENAA 2KCMA 3STBC 2F0MA 1SROA 2L9HA 5FLXL 5KNBA 4DR1L 3S1NH 1A6XA 1A62A 1VQ9A 5BR8Q 2HHHL 1W2BA 1F2YA 3FKIH 3CCSA 1IBLL 3BVZA 3H0GG 2WACA 3NPPA 3W5OA 3GTPB 3I56A 1I5FA 1RTOA 2FFKB 1F9SA 3JAML 5FO7B 4DUZL 3CRLC 5C4JH 1LTBD 1PH9A 4BBRB 4IUPA 1D1KA 3U9OA 4A3DH 4JI7Q 2Q8IB 1KTKA 1S5ED 2LXKA 4A3GB 3C3LA 4LFAL 2VUMG 1PLFA 2NTSA 3NE5B 5EPKA 2KCCA 1MHWC 2A6EC 1SEBD 3L7ZC 3GDEA 4GN3B 4A76A 2K04A 1F9PA 1TWFH 2N8NA 1JJ2A 4KLKA 3CC7A 3NWTA 4GLXA 1KLUD 2RA4A 1ASYA 5IP7G 2KBNA 1X3EA 1HNXQ 2JA8B 4LF8Q 1OXSC 1EFID 4O2DA 2E5LQ 2ICEC 1NE3A 2E2DC 2PMZB 3TMEA 1SNPA 3T1HL 2BA0A 2AUJD 3CQZH 5CORA 4LNQA 1EL0A 2K6AA 2K32A 3JC66 1G291 5G3LF 4PZ7A 1SYFA 2G5DA 3AYHB 2EY6A 2X69A 2A68D 5D65A 4LJZC 5A2QL 1J5EL 4K5WA 3PF5A 1LACA 3AB9A 1PYWD 4R8NA 1N36Q 4QIWB 4R4CA 1FVIA 1I6HB 2WAQG 4MTNA 1D5XC 3CW2C 1STNA 2OXPA 4PV1C 3NUCA 1OXXK 2K05A 3ERQA 1JB7A 4KJNA 1AEXA 4C3IB 4FP5D 1EYAA 1LT3D 4DV4Q 4ZAIA 5BN5A 1SDFA 4B08A 5IGDA 1G8ZD 4ZQ3A 1FJGQ 1SYCA 1K3RA 1QUQB 3VR4A 5I6WA 5ELOA 1SFOH 4JI5L 2PQAA 3S14H 1SN8A 1K8OA 4UAIA 1CA5A 2OF1A 1RKNA 4OIJA 1G2SA 2WAQE 2R92H 1FNVA 4OELB 1UE5A 5D3DA 2RCFA 4GN5A 2K5VA 4JBKA 1UAPA 1SAPA 3K5LA 1Y69U 1U0LA 4ID6A 2F03A 2B63B 2K01A 1T5EA 2JA7H 4DKAC 3RLOA 2Q2TA 2MQHA 1GHJA 1F2LA 1VQAA 1PH2A 3OMCA 1Y1WB 5IGEA 4BY7H 3ZJYC 1JE4A 3GO5A 5LMNQ 1H95A 4DR5L 1HRJA 4KMUC 1NMFA 2QW7A 4WORA 4E6IA 4POFA 2R7ZH 4QUCA 1Q81C 4BBRG 1LLRD 3TS2A 4QQBX 1H9SA 4A3GG 4RGTA 3GTOH 1NY4A 5L37A 3UDFA 4OX9Q 3GD7A 2RDGA 1VQBA 1D5MC 1TWCH 3HEJA 2BDOA 1LTLA 1ZYRC 3NBIA 4NW2A 3U58A 2EQSA 2OCEA 2WFWA 3Q0AA 4HEDA 4GKJL 2ES2A 1WVLA 2AUKA 4A3IB 3AMUA 1V8QA 4P74A 2HIXA 3EBEA 1LT4D 3L2PA 2JA8G 1A3VA 1L1OA 1KAAA 3KLRA 2K5HA 2ZT9C 3PIP3 3QO2A 3MXGA 2Z9HA 3I73A 4C2MH 4P2CB 3K0XA 1JJGA 2E2IB 4Z9CB 2CHBD 3STBD 2UXDL 4YHHQ 4IUTA 3D8GA 3F8TA 3HRZC 5I6YA 3AEVA 3HOZB 1E3PA 4V0BA 1E7ZA 4CDFC 1HTPA 2WP8J 5IT9L 4A3JH 3KOJA 5IE8A 4JI1Q 1E0BA 4C3IG 2ICIA 2F3WA 2FHTA 2K50A 5C5LA 2PCFB 4ZKCB 2BOSA 1TIID 1I3QB 3ICEA 1X9NA 1VQCA 1RL2A 2D0OA 1HXYD 4GNXA 2XVSA 4WFN3 1MKHA 1G51A 1YHQA 1V9PA 2F0LA 2EIFA 2LFNA 2A6ED 4A3EH 4QUFA 2NVQB 2NWGA 2HIVA 1XNRL 3T1YL 4ZRZA 3TP7A 1CZGA 1LTRD 4N8X1 4FXDA 2Q2HA 4B9WA 2NN6G 3KF6B 1SSOA 2MNAA 1IBKQ 2B63G 2X6LA 1VQPA 2K1BA 1PH7A 4CBVA 3VDYA 1EIFA 1SRUA 1ONLA 4L63B 1E2WA 2SNSA 3Q8DA 3U9SA 4IUNA 1A15A 3PUXA 1SJHD 5DAUA 4L8JA 1Q1EA 4XDXA 5M3FB 3TRZA 3OW7A 3N52A 4JBMA 1Q1BA 5CBEE 3J7A5 4KN4C 3EN2A 1YJ9A 2UU9L 5M5YH 4MN3A 5M5XH 3UDXA 4PMBA 4V190 1MIUA 2IWHA 1VQHA 4QL5A 4KHZA 4IPCA 2QF7A 1XNQQ 1SYDA 1ICFB 3HOYB 5C4XB 1YHAA 4DAMA 1N32Q 3CCEA 5IGGA 3CXCA 3H3VI 1RDPD 1UUPA 3EIVA 4A3IG 1PA6A 3H91A 4AIMA 1LT6D 2F0VA 1D7QA 3IAYA 3R93A 3GTMH 3DM1A 2E5LL 4NXMQ 3M7GA 4KY5A 3M85A 4FYDA 2R93H 4KHPL 1DONA 3P1HA 4A3BB 1JICA 1BCPF 1YNJC 5LHY1 2UUAQ 3I91A 5C3EH 3KK7A 4H7BA 2NVYB 3NEMA 4DR4L 3K81C 4YCWA 2VQEL 3HOZG 1Q90A 1IL8A 2GN5A 1GHKA 3U4VA 4DK3C 1LTAD 4A3CG 1X65A 1K83H 2BA1A 5FLMH 1S3OA 1KDCA 3FDTA 4MNOA 3E9IA 4LF6Q 3NP8A 4JYAL 2N88A 1N34Q 1IYUA 1FJGL 3GTJH 1KIXA 1TS2A 2IY5B 1PV4A 1E2ZA 1XTCD 1QCBD 4L5QA 4DR1Q 3I55A 1V1OA 4PZ8A 1Y14B 1NR2A 1K8AC 3GTLB 2F0FA 3SEBA 2HHHQ 3P7JA 4GOPA 1ZYRD 4F88A 1IBLQ 5IIFA 3PO3B 5T1IA 4RKBA 2R6GA 2A6HC 2E8GA 1STAA 2PO4A 1PH3A 4DUZQ 2V1CC 1MSGA 1GKHA 5BN4A 3ULJA 3S1QB 1NNXA 3A7LA 4LFAQ 4BWGB 5LMNW 4YY3L 1WTHA 4AH6A 1WTRA 4UP9A 1IHZA 4X6AH 2EYJA 4HJ5A 2F1MA 1F2MA 4R4OA 1PYSB 2IT1A 1B1ZA 3DEOA 4DA2A 5M3FG 1PFMA 2RCNA 4BBSB 3NENA 3MXNA 3VYSA 2I07B 4DPGA 3EA6A 2O4XA 3D4WA 4HSVA 5J3BA 4L6TB 2L5TA 2F0KA 2YTXA 1EQQA 4YCVA 4LF4L 4BXXH 3HOYG 1JWUD 1EZ8A 2QCPX 2ZJQA 2E75C 4ABNA 1RF2D 3T1HQ 3HOUH 2AQ2B 4DV7L 3S16H 3NTKA 3H6MA 3K7UC 2N49A 2D0PA 4MTKA 1UEAB 2CH4A 1E1TA 4NKLA 1FGUA 5EKKA 1J5EQ 2I5MX 4OO1G 1A8VA 3CD6A 1EY9A 1GUTA 3I4NB 4X3SA 2IX0A 2PYKA 1LTSD 1PH4A 1FL0A 2IL8A 1QB5D 3I3CA 2P5ZX 4A3BG 1PRTB 4R9WA 5G3LD 2BE5C 5FJ8G 5GAHC 4P71A 4J8QA 1C9OA 4P72A 3OYYA 3KJOA 1WTOA 1UEBA 2O2LD 1JOKA 4XT1B 4HMJA 4BY1B 4C1NK 1KAWA 4JBWA 1V1PB 2NVXB 5FKAC 4CJ1B 1O7IA 4XYQA 4JOIC 1WTXA 3A56A 1NAPA 4C56C 1SYGA 3E3XA 5C6AA 5CGKA 4DR3L 3PF4A 1OO9B 4FNFA 1DOMA 2C9OA 4EQNA 4WJWA 3S2DB 2JQOA 1B4OA 4B3RL 4GZYC 1DGSA 5I4DA 4JC0A 1J8IA 3W1BA 1H9KA 3K5NA 1WCMG 1PTOC 2Q8RE 1TWAH 4L5RC 3F2UA 3EROA 3VR5A 4A3FB 4C3HB 2YYZA 1B3QA 5JJLA 3A54A 4HCEA 2K5NA 4IUUA 1BCPC 2EYLA 3DWAA 1II3A 3OPOA 1NCVA 1QNKA 2MP1A 2ZJPA 4HCSA 2VNUD 3J80c 1LTTD 3PIPA 3GTKB 3OWEB 2DUDA 3WDNA 1MSHA 1P16A 3VYUA 2I5LX 4IALA 1UE1A 4DR6L 3HOXH 1DZ1A 2EYPA 3ER0A 4N9TA 1WFQA 2LXJA 5DEHA 2GVBA 4BBSG 1YNJD 1CUKA 5IGFA 5IYCG 1CFMA 3BZKA 1GUOA 5EJWA 4GKJQ 3S1RH 1STBA 5ELFA 4QY7A 1ZEQX 2MHVA 4ZUIA 4OIKA 1HFNA 2FJ2A 5EBCA 1PRTF 3HGBA 4NXNL 2Z1CA 1B9NA 4J15A 1GUGA 1SR3A 2IX1A 2KCNA 1HNWL 1I4XA 4R4IA 4DV6L 1N33L 5C44B 4K8JA 5LL6S 4FF3A 2L15A 5COYA 2B2VA 4UP8A 1HH2P 2C35B 1CHPD 2LSSA 3I4NG 2EJFC 3TEHB 2EYHA 4DN4M 3UDGA 4CDDC 4YWKA 3EJIA 1JR0D 3D4RA 4JK1C 3SK5A 4A3DG 1X55A 4L5SA 3SK6A 3WWVA 4QGUA 3CMAA 1X56A 2A6HD 1M8AA 4LUVA 1F77A 1TWCB 4CKEA 2F0IA 2EOTA 3H94A 1PZKD 3ZYYX 3I4OA 3M3YB 1WTWA 5IYDG 4BY1G 2A74C 2LS01 4FXGC 4DK1A 4L5TA 1XNRQ 1CSPA 1PXUA 4RFBA 3T1YQ 1S5DD 1QOHA 1WD0A 3IFTA 3MEHA 3NBHA 1N34L 2XSCA 4QMGA 1NJIC 4K14A 3N6RA 4ALPA 2G9HD 3I7FA 3OIQA 5NUCA 3S2HH 1VQMA 2PPBC 1A63A 4K2KA 2HDLA 2Z4IA 1LO5D 4A3FG 4C3HG 1J9OA 4GKKQ 5IYBG 4EQPA 1KNEA 3VR6A 4LF7L 1QNUA 4DNTB 1E24A 1CKMA 3AU7A 5JJIA 4ULLA 1FNWA 1L0XB 2R7FA 2H5XA 4DV2L 1IKLA 2UU9Q 4GLAC 3SK4A 1TWHB 1QVCA 3J80E 4A3MH 3OMGA 1K28A 1IYJB 1B7YB 4Y7NB 1EYGA 2XNAC 2R3ZA 2E2HB 2AQ1B 1VDZA 4RKLA 4A93B 3GQBA 4I65A 2JA6H 3SVMA 3E6ZX 1SNMA 3CCVA 4LUOA 4IPHA 5ISRA 5HGQA 1QUQA 2VB3X 3H3VH 2B2WA 3QOLA 3RR5A 4KHPQ 2TMPA 3FEWX 1HZ9A 1JCKB 4DFAA 3W2DA 1L2FA 2MUYA 5JVG3 5DLQE 5IGCA 1STYA 1D1IA 1Y1VH 5C44G 3HOWH 4DXGA 2F0PA 4DR4Q 4OONA 2A19A 5GROA 2EYFA 2VQEQ 2HT1A 2ZJRA 5M3MH 3UI2A 2RBMA 4NB3A 1PTOD 1S40A 4EQOA 1M90C 2IPKD 3J80i 3T51B 2I46A 2EVBA 4AYBB 1VQ5A 5E3FA 1WI5A 5M5YB 2F0QA 1BCPD 1TS5A 4HTHA 2RSOA 4IUVA 1YJNA 4JYAQ 4JI6L 2Q8TA 2XTIA 2CQAA 5LL6X 4HIMA 1I50B 1VQNA 2MO1A 3AFQA 1HCZA 4LMQD 1VQEA 2RF4A 3H0GH 1SLJA 1X3QA 1TKWB 1QILA 1PRTC 3W1GA 3CCMA 1EQTA 3L0OA 4H13C 4UY8C 3O13A 3DMUA 1ESFA 2Y0SB 1XJVA 3ND8A 3KDFB 4B3ML 1S5BD 3J81j 3KLSX 3OHXC 2VUMH 2KEEA 4G4KA 3IL8A 4A3LH 2M2LA 3KFUA 2E2JH 1LYLA 4B9XA 3K7AB 3VA5A 5JEAG 3S1MB 2JA9A 1ENCA 4H02A 1EY7A 4YY3Q 1G6ZA 2DJGC 4NPSA 2K75A 1SNQA 5EBDA 5IP9G 4ZKBB 3GTQB 1W3SA 3FMCA 3TZDA 1BDOA 5ELNA 2F4VL 4JOIA 1U4MA 4P73A 1IBML 1CKNB 4C3JB 4AQYL 3HKSA 3NSWA 2QEXA 2ATWA 3TBIB 3MTSA 2CVRA 3U4ZA 2K33A 3K59A 1HR0L 4OO1I 1TWGB 1HHVA 1XX8A 3MXUA 2JP1A 4LF4Q 4A75A 1CA6A 4J1MA 1OXUA 2JYOA 4DV7Q 2FXQA 2KJXA 3HP3A 1I4PA 4A93G 4H0LC 4LW1A 1B3AA 3HKZB 3HOVB 1PZID 5I2XA 1ZXTA 1PH5A 1X6OA 1EOTA 2PNRC 3VA7A 1AZQA 5KEEA 3RZOH 2F4IA 3CPWA 3RZDB 2YU9B 2NVTH 4MZ9A 2J4XA 4XQJA 4HJAA 2B2YC 4O1NA 3I4MB 1YVCA 1H9MA 3M9BA 3K5MA 1SNOA 2LMCB 4Q5VA 1G2TA 4ZUJA 4Q0FA 2NYZD 3NTIA 1LTID 2KENA 5JOBA 5EKLA 2L12A 4HIOA 3T16A 1SYEA 4KV6A 1GXDC 2K28A 3PIOA 4FF4A 1EYDA 4AYBG 4DR3Q 2PMZE 2D2CC 1HZAA 1EIYB 1PTOB 3FPPA 3L9AX 5IWAL 4OWTB 3RN5A 3S17B 2HQLA 1OTCA 2JEAI 3G71A 4B3RQ 4R1JA 1BCPB 5CV5A 4DAYB 4CJ0B 1DM0B 5EPJA 4QIWE 1EY0A 2F3VA 2F0GA 3I90A 1QVGA 1QG7A 3ONAB 1OXTA 2Y0SG 4BBRH 2JA5B 4A3GH 1FR3A 4HMIA 4A3KB 5HURA 5IODA 2F0HA 4HAEA 1VQ4A 2ZXRA 4ILWA 4OXPA 1L1OB 1JE5A 2Z6KA 3V2TA 4KD3A 1KXLA 1L0WA 4DR2L 4BS9A 1DD2A 1BBXC 1BUVT 3TDQA 2B8GA 4DR6Q 2BDNA 2G9DA 4GKKL 3GTGB 1R9TH 1HJPA 2EJGC 4C3JG 2JA8H 2F0TA 1PVOA 3A8IE 4N8FA 5FLXc 4DV5L 4OEMB 1D5ZC 3SDZA 5CC4A 3CRKC 1KRSA 1PDQA 3CHBD 3M4OB 5CV8A 1G91A 1XWEA 5E7NA 3AQQA 3A0JA 3Q23A 4NXNQ 5GADC 2DY7A 1VMPA 3JAMc 3V05A 1BXTA 1HNWQ 1I6HH 1HUNA 5J39A 4DV6Q 1N33Q 3HKZG 1I4RA 3K6OA 4LWCA 4ZK9B 3HOVG 3K58A 3QJYA 4JI4L 3LWUA 2B8FA 3F2BA 1PFNA 2SOBA 3QWNA 1VQDA 3VR2A 2F0DA 4C3IH 1Q12A 4RWSC 1VQ6A 1PRTD 3Q22A 1YI2A 2RHSB 1VF5C 2BH8A 5CYUA 1PTOF 2R7DA 2NB0A 1CT1D 3K57A 1QZHA 3I4MG 2AHOB 3BDOA 1NMGA 1R4PB 5GAGC 4P75A 1L0YB 4OWWB 1JQYD 4FF2A 4J6HA 2F0WA 3LNNA 2F0JA 1J6QA 1DYQA 1IKMA 1BKBA 4MIUA 3SXHA 2J7ZA 1Q82C 1VQFA 3KF8B 3PUZA 1K3BC 4IJHA 1STHA 2B63H 3MFYA 1EYCA 3E0EA 3J81c 1KHIA 3FP9A 4BXXG 2RSNA 2BCOA 1Y1WH 1GO3E 2LY7A 1LV9A 1KL9A 5M5WB 2EXZA 1WCMB 2K03A 4R4QA 4GS3A 1M1KC 4YIJA 4KD4A 1AE3A 2VZAA 2I5HA 2JA5G 4DV0L 4OHJA 3GV3A 4A3KG 1XMOL 4G57A 4LF7Q 5IOCA 1YIJA 3E9HA 3AFPA 1I4HA 4KKTA 4DV2Q 3S15B 4M1UB 1KNAA 3BYTB 4DNRB 1SBBB 1U5KA 2K5QA 4KN7C 2GVAA 4K5XA 2F0EA 3VYTA 1U9RA 3RLFA 4DNIA 1O7LA 2PZTA 1Y8PB 2KQ3A 3TZUA 2K4KA 1N9WA 2EYOA 2NZOA 1A3TA 4ZYSA 1G6PA 4ODGA 3KLWA 1EUJA 2ZTDA 1DCZA 2FMMA 4EQ5A 2CFMA 5FLXE 4B3SQ 1PZJD 1SNDA 1STGA 1V1PA 1QJOA 2E2IH 3CCLA 2NUCA 5C0XJ 5J22A 4JG2A 5JJZA 3S1NB 3MVVA 1NR4A 1VQGA 3HOZH 1VQJA 5K36G 1ILQA 4WRDA 4HSPA 2Z6BA 3JAME 3FKIB 3K5OA 5C0XG 1C8CA 4A3CH 1HQRD 2ZTEA 3MHBA 3M4QA 5CR3A 3PGZA 4UHVA 1X3PA 4POGA 5CV7A 1XMQQ 5C4JB 1WJJA 1I3QH 4F7XA 4A3DB 4IZ8A 2MGSA 1IZ6A 2QGQA 1XXGA 1Q46A 3X3MA 1P8LA 2ASBA 4JI6Q 2WV6D 2RQXA 3A8JE 1VQIA 1SJED 5EQ0A 1WTPA 3EFXD 2B2UC 3EQLC 3T13A 1B44D 2KECA 3J7YW 3OWFA 1TWFB 1F2ZA 3D4DA 4K5VA 1B70B 3CCJA 3E0JA 3PSIA 3MXPA 2NZHA 1JOQA 2HCCA 1IW7C 2RVLA 3G6EA 1LTGD 4B3MQ 3R2IA 4DR7L 3JAMi 3BZCA 3BDCA 5A2QE 4R8IA 2EYMA 3J81E 3CQZB 5IT9c 1GUNA 4DK0A 1EQVA 5M3FH 2UXBL 3I70A 4PQXA 4IJLA 3QR8A 2CW0C 2CWAA 2A73B 3PIO3 2F4VQ 5CMDA 3RMHA 1IBMQ 1MGSA 3C46A 3ND9A 4AQYQ 1VQOA 3CCRA 1VQKA 1AP0A 1A3UA 4U673 1CM9A 3HOYH 4JI3L 3PO2H 5I9PA 5C4XH 2Z0SA 3MAQA 1XPRA 1TY2A 1ENFA 2K7VA 1HR0Q 4IFDG 3A5UA 1W6JA 4PNYA 3TP5A 1SFOB 3UE1A 3S14B 1X3GA 4OO1H 2UUBL 1L1OC 1T5XD 3CCUA 3DHQA 3I8ZA 1RTNA 2R92B 4BA2I 4TSSA 1GUSA 2JN4A 3A5ZB 3J81i 5E1FA 1XPUA 3A7AB 4A3BH 5FO9B 2H4OA 4RH6A 2WINB 4FO2A 1LT5D 4KTAA 1GM5A 2QKIC 2CCZA 5FJ8H 1ML0D 1B9MA 2NVYH 2KUMA 1CQFA 2SNMA 2JA7B 2MJ8A 2A69C 3NELA 3CC4A 4UPAA 1CQVA 1V1QA 2ENBA 2ZTCA 5TSSA 1TS4A 3NHHA 1HNZL 3FKIG 4X66L 4BY7B 4RHSA 1Z6HA 4ZCKA 2B39A 4IURA 4YWMA 4RMFA 3PUVA 4HJ9A 3TS0A 2F0NA 4X64L 2R7ZB 4RGMA 4LF9L 3P75A 5FOBB 5I9OA 4KK7A 3GTOB 3OIPA 4OGQC 5IWAQ 3CF5A 5JVH3 4C1NI 5LMUL 5KNDA 3GTLH 2VL6A 3TN2A 4ZLTF 1JOOA 4RCOA 2F0OA 4XQQA 3PO3H 2KHIA 2NN6I 3A8KE 4APVA 2QDLA 5CV9A 4DV3L 4TRDA 1ICWA 3F2CA 2Z4HA 1I94L 3S1QH 2F0SA 2EE1A 1S5FD 1EOVA 2C5CA 2OEOA 1JWSD 4JV5L 3M7NA 2XRSD 4LUZA 1CI3M 4QB4A 1AZPA 5C5MA 1GJXA 4IN3A 2M00A 4K6LA 4DR2Q 5D14A 4C2MB 4RA8A 4BBSH 3NQIA 2MPMA 4KI0A 4A4IA 1DOLA 5IYCH 5IT9E 4KY7A 1U4LA 1CZWA 5H1SE 1Q8KA 3HG9A 1U4RA 2KEDA 2F3IA 1WD1A 4IUQA 2PZUA 4A3JB 2OQ0A 2L4NA 4WJ3M 4DV5Q 1KDBA 1Q7YC 1Q3LA 1KD1C 4CHTB 4B3TL 3I4LA 2OTLA 5K5PA 1HZBA 4ME3A 4IPDA 2MFIA 3J7AV 2OQKA 1Z7TA 1EY4A 2BE5D 1MD2D 3I4NH 3HS0C 2R92G 4A3EB 2D5DA 1EY5A 3MA2B 1YITA 4JI4Q 5KIXA 5JPNC 1HTLD 1ET6A 4LK1C 1ZKOA 3I72A 1H9RA 4B3SL 4CKCA 5HY6A 3EVQA 1K73C 2UXCL 3IKJA 4A3LG 3BS1A 5JJKA 2JK8A 4RCNA 2YTVA 1K0RA 3A55A 2JA7G 3NBHB 4BY1H 5IYDH 5AJ3Q 2GA4B 2NVXH 1IW7D 3VR3A 3S9WA 2YTYA 3MFGA 3KDFA 1O78A 4BY7G 4JI8L 5DM63 2VXWA 1EWCA 1FGBD 1V43A 1R9TB 1TVXA 2CKZB 2NBFA 2NTTA 4FDBA 4O42A 1JMCA 3C1FA 2R7ZG 1LM0A 4X65L 3S2DH 1XMQL 3OOCA 2R61A 3BVMA 4OL7A 2D62A 3D3RA 2KOLA 2CW0D 2PI2E 5M5XB 2AMCB 2X6GA 2XIWA 1X54A 2EZVA 4XT3B 3Q24A 1YZ6A 3R3OA 4LFBQ 1BNZA 4QF4A 4A3FH 4C3HH 1RHPA 2L1BA 4DU9A 3CCQA 3U50C 4GOPC 3J81L 1QVFA 1CKNA 3G48A 3OSOA 2HUGA 2UUCL 1ESRA 4JCVE 3SK8A 4XIGS 5IYBH 4KY6A 3G7LA 1HFGA 5KYIA 1C4QA 1EY8A 1SMXA 3LGJA 3VYRA 2EXDA 2N3SA 3DUZA 3KBGA 5JEAJ 1JORA 3K80C 3G4SA 4DV1L 4OWXB 1FYCA 4K0KQ 4DV0Q 4FF1A 3GTKH 1XMOQ 3GTMB 2OWOA 1EZ6A 2R93B 2VQFL 2AQ3B 2H1EA 5A35A 3J7ZC 3BG3A 3Q6SA 4LFCQ 1QE6A 1W6KA 2DY8A 4F87A 1HZCA 1X3FA 4CGYB 3D6CA 1HPCA 2JE6I 5ELCA 1HUMA 4PG3A 4X62Q 5C3EB 3H3VC 4EVOA 2FMCA 3MZ5A 3TQYA 3J7AF 3E5SA 2B2UA 2V4DA 3QIAA 2A69D 1C0AA 1TR5A 5IP7H 1O80A 4A3JG 3DWPA 1HQMC 1HR0W 4I7ZC 4JI2L 3HFZB 1K83B 5C3WA 3C2PA 4FXKC 2FINB 1C48A 2I0QA 4DUYL 2DNCA 3SR1A 1A2TA 4IO9A 4G7ZC 5C0XI 2O5JC 3GTJB 5C44H 1FNUA 4FVMA 1O7YA 1Y8NB 3NTHA 3WOEA 2PW7A 3UDIA 3HZXA 1MJCA 4NMZA 2NZ1D 2ZM6L 3H09A 2HDMA 4A3EG 3W3AA 2PQAB 1VMCA 2EJMA 3OTOL 1WTVA 1D2BA 2Q2UA 2TSSA 3V96A 5ELDA 4DAYA 5IY0A 2N55A 1Z47A 4IOCA 3DLLA 4LF5L 3M4PA 1SE2A 2BH2A 3M3YH 4DK6C 4GN4B 3K0YA 1MJEA 3IFDA 2K5WA 5CV4A 3FVQA 1TQOA 2A5HA 2ID0A 1PH6A 3GP7A 4JPBW 4DF7A 4JI0L 3TP6A 3KF6A 4NP5A 4G7HC 4HIKA 1EY6A 4M8AA 1MBYA 1E22A 1RIPA 1EU3A 1F9QA 5JEAH 3LWEA 1S4ZA 3BJUA 1Q8IA 1S5CD 2JXMB 4KKSA 1CK1A 1EQRA 4DR7Q 1H9SB 1YNNC 5ELEA 1ET9A 1R4QB 2RHQB 3SGIA 1K0SA 2OT2A 2DGYA 2L11A 2KA7A 5C4HA 4EX5A 5IP9H 2N78A 3HOUB 3G6JB 3S16B 3GTPH 2CH4W 2SDFA 3KUPA 5D3IB 1NSNS 1O7ZA 2M9VA 2UXBQ 4AYBE 3URYA 1STEA 3T56B 1QZGA 2A1AA 2B2TC 4KHVA 4IFDI 5C3XA 4WJ4A 3QG1A 2WB1B 4TVAB 1TWHH 1GOZA 5DNFA 2R93G 4IQZA 2L55A 4Y7NH 4RHRA 4EGVA 2F52A 2E2HH 4JI3Q 1ASZA 2IHFA 3J80L 1A0IA 3DM3A 1SE4A 1KABA 5C3EG 5EAYA 3F1ZA 1WYDA 4A93H 2AWOA 2HQEA 1A2UA 4S3SA 3RLNA 1EWHA 3BU2A 1M4VA 2Y0SE 5AFWA 4KJOA 2UUBQ 4JBJA 1DJRD 1F9RA 3PUYA 1IYVA 2EDGA 1B50A 5FLMG 4Y52H 1PH8A 1BOSA 2RKSA 4DAVA 2E74C 2AWNA 5BR8L 1VS0A 1YNXA 2B2VC 3ITPA 1Y1WG 4O0AA 2EY2A 3KF8A 2WKCA 5KGUA 1RD9D 4ME5A 5JPMC 1SXTA 1TWAB 3CP0A 1D6EC 1YBYA 5EPLA 4GNXB 1JT8A 1HNZQ 1EFWA 1XTDA 2B3GA 2PZWA 4X66Q 4JI7L 3RNUA 4K2LA 2DNEA 2YV5A 5E4WC 2PNHA 5KYLA 4X64Q 1BO0A 3DEPA 1I50H 4LF9Q 1TT2A 4H44C 3PO2B 5CBAE 3PQIA 4HN7A 2K5DA 5AJ3L 3H15A 1EWIA 4PMWA 3CAMA 2VY3A 3OW2A 5LMUQ 4CJ2C 1CHQD 3PV0A 3HOXB 2IW3A 2O5IC 3HKZE 1VQLA 1CSQA 1PFSA 3L3OC 1KDAA 4RGNA 1Z9FA 2EPBA 2DJFC 1HNXL 1BBUA 3D0FA 4LF8L 1JB3A 5HGTA 2DN8A 1HA6A 4RAUC 4DV3Q 3PCOB 5DM73 2HD3A 2NN6H 3S1RB 4X3KA 4QJFA 3K7AH 1K8GA 4HJ8A 3CC2A 3CKIB 1I94Q 3S1MH 3FRPB 5FO8B 1PH1A 1VF7A 4LFBL 4HR7B 3F2DA 4JV5Q 1PMRA 4F8MA 1N36L 3HOUG 1JWMD 3GTQH 3NWSA 4U68A 1E1OA 3PUWA 1GVPA 4XYOA 1XYIA 4C3JH 1JJCB 2QILA 4CKBA 1TXYA 3CU7A 4K0KL 2AKWB 1SMYC 2WB1G 4LAAA 4DV4L 4BA1I 2K52A 5EKIA 1K9MC 3B6YA 2XGTA 1LABA 2WIIB 1TWGH
chains in the Genus database with same CATH topology
1E3PA 2UUBL 1L1OC 1E7ZA 3RR5A 3CCUA 4KHPQ 2IHEA 1HZ9A 2WP8J 4LFCL 4A3JH 4BA2I 1L2FA 3KOJA 5DLQE 5IE8A 4JI1Q 1Y1VH 3A5ZB 4X62L 5C44G 3J81i 3HOWH 1XPUA 4B3TQ 3S24A 4A3BH 3S16H 2OTJA 4DR4Q 4OONA 2A19A 4RG1A 1GM5A 3HOVH 5GQOA 2K50A 5GROA 2CCZA 2VQEQ 5FJ8H 2HT1A 4A3IH 2ZJRA 5M3MH 2NVYH 3ICEA 4NB3A 1X9NA 1S40A 1M90C 1VQCA 2WB1E 1RL2A 2D0OA 4IPGA 3J80i 2K14A 4GNXA 1MKHA 2A8VA 3NELA 1G51A 5GAEC 3CC4A 4UPAA 1YHQA 1VQ5A 1V1QA 3RZDH 1V9PA 2YU9H 1WI5A 2ZTCA 2EIFA 4A3EH 2ALYB 3MEFA 3FKIG 1YJNA 2HIVA 4X66L 1YHBA 1HNZL 3T1YL 4JI6L 1XNRL 3I4MH 4JYAQ 2UXCQ 2XTIA 4HIMA 4YWMA 4RMFA 3PUVA 1VQNA 4HJ9A 2MO1A 3AFQA 3TS0A 4X64L 2Q2HA 1VQEA 4UP7A 2NN6G 3KF6B 2RF4A 4LF9L 3H0GH 1GD7A 1SLJA 2MO0A 2MNAA 5LMNL 1IBKQ 3W1GA 2B63G 1VQPA 3CCMA 3L0OA 1PH7A 4UY8C 5IWAQ 3VDYA 3IRBA 1EIFA 1SRUA 1UE6A 3CF5A 4JI8Q 1NBWA 5LMUL 3Q8DA 1XJVA 3GTLH 3KDFB 3PUXA 4OX9L 2VL6A 3S17H 4GOPB 4B3ML 2VUMH 3J81j 4X65Q 1Q1EA 3PO3H 2KHIA 2NN6I 4A3LH 3KFUA 2E2JH 1LYLA 4APVA 5JEAG 3TRZA 3PO2G 5C4XG 3A74A 4JBMA 1Q1BA 3J7A5 4DV3L 3EN2A 1YJ9A 2JA9A 3D31A 3F2CA 2UU9L 4H02A 2CWPA 4YY3Q 5M5YH 1I94L 1XPOA 4NPSA 3UDXA 5M5XH 3HOXG 3S1QH 2K75A 2NVQH 1MIUA 1EOVA 5IP9G 2UUCQ 1W3SA 1BBWA 4JV5L 3M7NA 2JA5H 4LUZA 5ELNA 2F4VL 4JOIA 4P73A 1KC8C 1VQHA 4QL5A 1IBML 4KHZA 1CKNB 4IPCA 4A3KH 4AQYL 1XNQQ 4DR2Q 1YHAA 3HKSA 4DAMA 1N32Q 4YCUA 2QEXA 2ATWA 3CCEA 4DV1Q 4BBSH 1NTGA 4KI0A 3CXCA 1VCIA 3MXNB 4A4IA 4TQUS 5IYCH 3H3VI 3EIVA 3I2ZA 3U4ZA 4A3IG 1PA6A 1HR0L 5H1SE 4OO1I 1Q8KA 4AIMA 2VQFQ 2F3IA 1D7QA 4YHHL 4LF4Q 3GTMH 4JI5Q 4A75A 1KRTA 1UE7A 2E5LL 4NXMQ 3M85A 2OQ0A 3GTGH 1BVSA 2R93H 2JEBI 1OXUA 4WJ3M 4DV7Q 2FXQA 4DV5Q 4KHPL 4A93G 3CPFA 4LW1A 1Q7YC 2JJQA 4IOAA 1KD1C 4JI1L 2B29A 2UUAQ 4B3TL 5C3EH 1PH5A 3NEMA 4DR4L 2PI2A 3K81C 2OTLA 1YEZA 1HZBA 4ME3A 1X6OA 4YCWA 1Q86C 3M4OH 4IFDJ 2VQEL 4HJ7A 4IPDA 2MFIA 3HOZG 3RZOH 2OQKA 4JI2Q 3CPWA 4GLVB 2NVTH 3I4NH 4MZ9A 2R92G 1IL2A 2GN5A 4HJAA 3U4VA 1YVCA 4DK3C 4DUYQ 4A3CG 1X65A 1K83H 2BA1A 3M9BA 1YITA 5FLMH 1S3OA 1PYBA 4JI4Q 4MNOA 3E9IA 4LF6Q 1UWVA 4B3SL 5HY6A 4JYAL 1K73C 2UXCL 2KENA 1CKOA 1N34Q 3PO3G 4A3LG 1FJGL 3GTJH 4HIOA 1KIXA 1VQ8A 2JK8A 1EFWA 1PHJA 1PV4A 2IY5B 2ZM6Q 5JJKA 2YTVA 1AH9A 4DR5Q 3PIOA 1K0RA 1B8AA 2JA7G 3NBHB 4BY1H 5IYDH 4L5QA 1D8LA 4AYBG 4DR1Q 3I55A 3OTOQ 5AJ3Q 4PZ8A 1IBKL 1Y14B 2NVXH 4DR3Q 2PMZE 1HZAA 2CQOA 1K8AC 2YTYA 1EIYB 3KDFA 1WOCA 5IWAL 2HHHQ 4OWTB 4GOPA 3RN5A 2HQLA 4BY7G 4JI8L 4YWLA 1OTCA 2JEAI 1V43A 3G71A 1IBLQ 4B3RQ 2CKZB 4R1JA 4FDBA 1JMCA 4LF5Q 2R6GA 4DAYB 2E8GA 2R7ZG 1LM0A 4X65L 1PH3A 1XMQL 3S2DH 4DUZQ 2V1CC 4QIWE 2D62A 1GKHA 4XTCS 2PI2E 3ULLA 3ULJA 2AMCB 1X54A 2Q2IA 1YZ6A 1QVGA 4LFBQ 4LFAQ 1OXTA 2Y0SG 5LMNW 4BBRH 4YY3L 2QA4A 4AH6A 4JI0Q 4UP9A 4A3FH 4C3HH 1QVFA 4A3GH 3CCQA 2VS1A 3U50C 4GOPC 1CKNA 3G48A 4X6AH 4HJ5A 1VQ7A 2UUCL 4JCVE 4R4OA 1VQ4A 4XIGS 3KJPA 1PYSB 2IT1A 5IYBH 5M3FG 4OXPA 1YJWA 2RCNA 1XNQL 1L1OB 1JE5A 2Z6KA 3NENA 4GNXC 1S72A 1KXLA 1SMXA 3LGJA 1L0WA 2EXDA 4DR2L 2N3SA 1N32L 3ULPA 5JEAJ 4DPGA 3K80C 5M5WH 3G4SA 4DV1L 4OWXB 4A3MG 4K0KQ 1WCMH 4DV0Q 3TREA 5J3BA 4DR6Q 3GTKH 1XMOQ 2UXDQ 4GKKL 2OWOA 2YTXA 1R9TH 1EQQA 2VQFL 1HJPA 1AE2A 4YCVA 4LF4L 2VW9A 4BXXH 2JA8H 2JA6G 1C7YA 3HOYG 3J7ZC 4NXML 4LFCQ 2ZJQA 1PVOA 3T1HQ 3HOUH 1OXVA 3K8AA 1HZCA 5FLXc 1X3FA 4R4TA 4DV5L 3KYHC 4DV7L 1T9HA 2Z6KC 3K7UC 3RN2A 2JE6I 4X62Q 4HIDA 4PG3A 2N49A 2D0PA 3S15H 1KRSA 1E1TA 3TQYA 1FGUA 1J5EQ 2I5MX 1N8RC 2UUAL 4OO1G 1A8VA 3CMEA 3CD6A 1C0AA 5E7NA 3AQQA 5IP7H 1IXRA 3A0JA 4NXNQ 2IX0A 5GADC 4A3JG 1PH4A 1FL0A 2KCTA 3JAMc 1HR0W 4JI2L 3HFZB 1Y1VG 1LUZA 3HOWG 1I6HH 1HNWQ 4DV6Q 4A3BG 1N33Q 3FHWA 3HKZG 2I0QA 4LWCA 4DUYL 3HOVG 1KQSA 3ERSX 5FJ8G 2KHJA 4IO9A 4JI4L 5GAHC 3F2BA 4P71A 5M3MG 5C0XI 1C9OA 1VQDA 3OYYA 4P72A 5C44H 3KJOA 1SE8A 4LF6L 1UEBA 4C3IH 1Q12A 1VQ6A 1YI2A 3UE0A 2RHSB 1KAWA 4JBWA 4PZ6A 3UDIA 1MJCA 2BH8A 1O7IA 2R7DA 2KCMA 4JOIC 3STBC 2ZM6L 1SROA 4A3EG 1QZHA 2PQAB 4DR1L 3I4MG 3OTOL 3S1NH 3PF4A 1A62A 2AHOB 4DR3L 1NMGA 2Q2UA 5GAGC 4P75A 1VQ9A 5BR8Q 2HHHL 4OWWB 5IY0A 1W2BA 3FKIH 1Z47A 4IOCA 2JQOA 3DLLA 3CCSA 1IBLL 1J6QA 3H0GG 4B3RL 1DGSA 3W5OA 4LF5L 3M4PA 1BKBA 1I5FA 3I56A 2BH2A 1Q82C 4DK6C 3M3YH 4GN4B 4JC0A 1MJEA 3W1BA 1VQFA 4DUZL 3KF8B 5C4JH 3PUZA 1PH9A 1WCMG 1TWAH 4IJHA 4L5RC 4A3DH 4JI7Q 2YYZA 2LXKA 2B63H 2ID0A 1PH6A 4LFAL 2VUMG 5JJLA 3E0EA 3J81c 1KHIA 2K5NA 4JI0L 3FP9A 3KF6A 4BXXG 3L7ZC 3GDEA 2ZJPA 4HIKA 4GN3B 1Y1WH 1GO3E 4A76A 1KL9A 1E22A 1RIPA 2VNUD 1TWFH 3J80c 2N8NA 4R4QA 4GS3A 1JJ2A 3PIPA 4KLKA 1M1KC 3BJUA 2DUDA 3CC7A 1AE3A 4GLXA 2VZAA 1P16A 2I5HA 1EQRA 1ASYA 5IP7G 2I5LX 4DV0L 2JA5G 1UE1A 2KBNA 4DR6L 4DR7Q 2RHQB 1X3EA 3SGIA 4A3KG 1XMOL 1HNXQ 3HOXH 3ER0A 4LF8Q 1OXSC 4O2DA 2DGYA 2E5LQ 4LF7Q 1YIJA 4EX5A 5IP9H 2N78A 1NE3A 1WFQA 2LXJA 3AFPA 3E9HA 2GVBA 4BBSG 3GTPH 1CUKA 4DV2Q 5IYCG 3T1HL 2BA0A 3BZKA 3CQZH 4LNQA 1U5KA 4GKJQ 3JC66 2UXBQ 1G291 4AYBE 2GVAA 4PZ7A 3S1RH 3AYHB 4IFDI 1QZGA 2A1AA 3RLFA 4DNIA 4WJ4A 4QY7A 1J5EL 4TVAB 3PF5A 1TWHH 1N36Q 2K4KA 2R93G 4R4CA 1N9WA 1FVIA 2NZOA 4NXNL 1G6PA 2WAQG 4MTNA 4J15A 3KLWA 4Y7NH 3CW2C 1SR3A 1EUJA 2F52A 2E2HH 4JI3Q 2IX1A 1ASZA 2IHFA 1HNWL 2ZTDA 1A0IA 3DM3A 4R4IA 5C3EG 1OXXK 5EAYA 4DV6L 3F1ZA 1JB7A 1N33L 4EQ5A 1WYDA 2CFMA 2AWOA 2L15A 4A93H 4DV4Q 4UP8A 4B3SQ 3RLNA 1HH2P 2C35B 3BU2A 2LSSA 2E2IH 3CCLA 1FJGQ 3I4NG 1K3RA 2Y0SE 3TEHB 1QUQB 5C0XJ 3UDGA 2UUBQ 5ELOA 4JBJA 4JG2A 4YWKA 4JI5L 1SFOH 2PQAA 3S14H 1SN8A 3PUYA 1VQGA 3HOZH 1X55A 5FLMG 4L5SA 4A3DG 1PH8A 1VQJA 3WWVA 4Y52H 5K36G 4QGUA 3CMAA 2WAQE 1X56A 2R92H 1UE5A 4LUVA 5C0XG 2AWNA 4A3CH 3M4QA 1VS0A 2ZTEA 5BR8L 1YNXA 2K5VA 4GN5A 4JBKA 3PGZA 3I4OA 1Y1WG 4POGA 5IYDG 4BY1G 4O0AA 1XMQQ 1WJJA 1I3QH 3CP0A 1U0LA 1IZ6A 1YBYA 4GNXB 2QGQA 2JA7H 1JT8A 1HNZQ 4DKAC 1Q46A 1XTDA 2B3GA 1P8LA 4L5TA 1CSPA 3RLOA 4X66Q 3T1YQ 4JI6Q 2Q2TA 4JI7L 2ASBA 1XNRQ 2MQHA 1VQIA 1VQAA 3RNUA 2YV5A 1PH2A 2PNHA 4X64Q 4BY7H 3ZJYC 1N34L 1NJIC 4ALPA 1I50H 3GO5A 3I7FA 4LF9Q 5LMNQ 1H95A 4DR5L 1NMFA 3S2HH 1VQMA 2R7ZH 4POFA 1A63A 3H15A 5AJ3L 1Q81C 1EWIA 4BBRG 1B70B 4PMWA 3TS2A 3CCJA 4QQBX 3CAMA 3PSIA 4A3FG 2VY3A 3OW2A 4A3GG 5LMUQ 2NZHA 3GTOH 3PV0A 1NY4A 3G6EA 3UDFA 4OX9Q 3HKZE 1VQLA 1CSQA 1PFSA 4GKKQ 4B3MQ 4DR7L 3GD7A 1VQBA 5IYBG 3JAMi 1Z9FA 1TWCH 1HNXL 1LTLA 1BBUA 3BZCA 3D0FA 4LF8L 4LF7L 1E24A 1CKMA 5IT9c 5JJIA 4DV3Q 3PCOB 2WFWA 2EQSA 2OCEA 3U58A 2R7FA 2H5XA 4DV2L 5M3FH 4QJFA 3K7AH 2UU9Q 1K8GA 4HJ8A 3CC2A 1I94Q 3S1MH 4GLAC 4GKJL 2UXBL 2ES2A 1PH1A 4LFBL 1QVCA 4IJLA 3F2DA 4P74A 2HIXA 3EBEA 2CWAA 4JV5Q 3L2PA 4A3MH 2JA8G 2F4VQ 1L1OA 1IBMQ 1N36L 3HOUG 1IYJB 1B7YB 4AQYQ 1VQOA 1EYGA 2K5HA 3CCRA 3GTQH 1VQKA 1E1OA 3PUWA 1GVPA 4C3JH 3HOYH 1JJCB 2JA6H 4JI3L 3PO2H 5C4XH 3CCVA 2Z0SA 4LUOA 1XPRA 4IPHA 4C2MH 1TXYA 1HR0Q 3K0XA 3A5UA 4IFDG 4K0KL 5HGQA 1JJGA 2AKWB 1QUQA 4DV4L 2WB1G 3STBD 4BA1I 3H3VH 2UXDL 2K52A 4YHHQ 3UE1A 1K9MC 3B6YA 3F8TA 2XGTA 1X3GA 1TWGH 3AEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  2UUB L;  1L1O C;  1E7Z A;  3RR5 A;  3CCU A;  4KHP Q;  2IHE A;  1HZ9 A;  2WP8 J;  4LFC L;  4A3J H;  4BA2 I;  1L2F A;  3KOJ A;  5DLQ E;  5IE8 A;  4JI1 Q;  1Y1V H;  3A5Z B;  4X62 L;  5C44 G;  3J81 i;  3HOW H;  1XPU A;  4B3T Q;  3S24 A;  4A3B H;  3S16 H;  2OTJ A;  4DR4 Q;  4OON A;  2A19 A;  4RG1 A;  1GM5 A;  3HOV H;  5GQO A;  2K50 A;  5GRO A;  2CCZ A;  2VQE Q;  5FJ8 H;  2HT1 A;  4A3I H;  2ZJR A;  5M3M H;  2NVY H;  3ICE A;  4NB3 A;  1X9N A;  1S40 A;  1M90 C;  1VQC A;  2WB1 E;  1RL2 A;  2D0O A;  4IPG A;  3J80 i;  2K14 A;  4GNX A;  1MKH A;  2A8V A;  3NEL A;  1G51 A;  5GAE C;  3CC4 A;  4UPA A;  1YHQ A;  1VQ5 A;  1V1Q A;  3RZD H;  1V9P A;  2YU9 H;  1WI5 A;  2ZTC A;  2EIF A;  4A3E H;  2ALY B;  3MEF A;  3FKI G;  1YJN A;  2HIV A;  4X66 L;  1YHB A;  1HNZ L;  3T1Y L;  4JI6 L;  1XNR L;  3I4M H;  4JYA Q;  2UXC Q;  2XTI A;  4HIM A;  4YWM A;  4RMF A;  3PUV A;  1VQN A;  4HJ9 A;  2MO1 A;  3AFQ A;  3TS0 A;  4X64 L;  2Q2H A;  1VQE A;  4UP7 A;  2NN6 G;  3KF6 B;  2RF4 A;  4LF9 L;  3H0G H;  1GD7 A;  1SLJ A;  2MO0 A;  2MNA A;  5LMN L;  1IBK Q;  3W1G A;  2B63 G;  1VQP A;  3CCM A;  3L0O A;  1PH7 A;  4UY8 C;  5IWA Q;  3VDY A;  3IRB A;  1EIF A;  1SRU A;  1UE6 A;  3CF5 A;  4JI8 Q;  1NBW A;  5LMU L;  3Q8D A;  1XJV A;  3GTL H;  3KDF B;  3PUX A;  4OX9 L;  2VL6 A;  3S17 H;  4GOP B;  4B3M L;  2VUM H;  3J81 j;  4X65 Q;  1Q1E A;  3PO3 H;  2KHI A;  2NN6 I;  4A3L H;  3KFU A;  2E2J H;  1LYL A;  4APV A;  5JEA G;  3TRZ A;  3PO2 G;  5C4X G;  3A74 A;  4JBM A;  1Q1B A;  3J7A 5;  4DV3 L;  3EN2 A;  1YJ9 A;  2JA9 A;  3D31 A;  3F2C A;  2UU9 L;  4H02 A;  2CWP A;  4YY3 Q;  5M5Y H;  1I94 L;  1XPO A;  4NPS A;  3UDX A;  5M5X H;  3HOX G;  3S1Q H;  2K75 A;  2NVQ H;  1MIU A;  1EOV A;  5IP9 G;  2UUC Q;  1W3S A;  1BBW A;  4JV5 L;  3M7N A;  2JA5 H;  4LUZ A;  5ELN A;  2F4V L;  4JOI A;  4P73 A;  1KC8 C;  1VQH A;  4QL5 A;  1IBM L;  4KHZ A;  1CKN B;  4IPC A;  4A3K H;  4AQY L;  1XNQ Q;  4DR2 Q;  1YHA A;  3HKS A;  4DAM A;  1N32 Q;  4YCU A;  2QEX A;  2ATW A;  3CCE A;  4DV1 Q;  4BBS H;  1NTG A;  4KI0 A;  3CXC A;  1VCI A;  3MXN B;  4A4I A;  4TQU S;  5IYC H;  3H3V I;  3EIV A;  3I2Z A;  3U4Z A;  4A3I G;  1PA6 A;  1HR0 L;  5H1S E;  4OO1 I;  1Q8K A;  4AIM A;  2VQF Q;  2F3I A;  1D7Q A;  4YHH L;  4LF4 Q;  3GTM H;  4JI5 Q;  4A75 A;  1KRT A;  1UE7 A;  2E5L L;  4NXM Q;  3M85 A;  2OQ0 A;  3GTG H;  1BVS A;  2R93 H;  2JEB I;  1OXU A;  4WJ3 M;  4DV7 Q;  2FXQ A;  4DV5 Q;  4KHP L;  4A93 G;  3CPF A;  4LW1 A;  1Q7Y C;  2JJQ A;  4IOA A;  1KD1 C;  4JI1 L;  2B29 A;  2UUA Q;  4B3T L;  5C3E H;  1PH5 A;  3NEM A;  4DR4 L;  2PI2 A;  3K81 C;  2OTL A;  1YEZ A;  1HZB A;  4ME3 A;  1X6O A;  4YCW A;  1Q86 C;  3M4O H;  4IFD J;  2VQE L;  4HJ7 A;  4IPD A;  2MFI A;  3HOZ G;  3RZO H;  2OQK A;  4JI2 Q;  3CPW A;  4GLV B;  2NVT H;  3I4N H;  4MZ9 A;  2R92 G;  1IL2 A;  2GN5 A;  4HJA A;  3U4V A;  1YVC A;  4DK3 C;  4DUY Q;  4A3C G;  1X65 A;  1K83 H;  2BA1 A;  3M9B A;  1YIT A;  5FLM H;  1S3O A;  1PYB A;  4JI4 Q;  4MNO A;  3E9I A;  4LF6 Q;  1UWV A;  4B3S L;  5HY6 A;  4JYA L;  1K73 C;  2UXC L;  2KEN A;  1CKO A;  1N34 Q;  3PO3 G;  4A3L G;  1FJG L;  3GTJ H;  4HIO A;  1KIX A;  1VQ8 A;  2JK8 A;  1EFW A;  1PHJ A;  1PV4 A;  2IY5 B;  2ZM6 Q;  5JJK A;  2YTV A;  1AH9 A;  4DR5 Q;  3PIO A;  1K0R A;  1B8A A;  2JA7 G;  3NBH B;  4BY1 H;  5IYD H;  4L5Q A;  1D8L A;  4AYB G;  4DR1 Q;  3I55 A;  3OTO Q;  5AJ3 Q;  4PZ8 A;  1IBK L;  1Y14 B;  2NVX H;  4DR3 Q;  2PMZ E;  1HZA A;  2CQO A;  1K8A C;  2YTY A;  1EIY B;  3KDF A;  1WOC A;  5IWA L;  2HHH Q;  4OWT B;  4GOP A;  3RN5 A;  2HQL A;  4BY7 G;  4JI8 L;  4YWL A;  1OTC A;  2JEA I;  1V43 A;  3G71 A;  1IBL Q;  4B3R Q;  2CKZ B;  4R1J A;  4FDB A;  1JMC A;  4LF5 Q;  2R6G A;  4DAY B;  2E8G A;  2R7Z G;  1LM0 A;  4X65 L;  1PH3 A;  1XMQ L;  3S2D H;  4DUZ Q;  2V1C C;  4QIW E;  2D62 A;  1GKH A;  4XTC S;  2PI2 E;  3ULL A;  3ULJ A;  2AMC B;  1X54 A;  2Q2I A;  1YZ6 A;  1QVG A;  4LFB Q;  4LFA Q;  1OXT A;  2Y0S G;  5LMN W;  4BBR H;  4YY3 L;  2QA4 A;  4AH6 A;  4JI0 Q;  4UP9 A;  4A3F H;  4C3H H;  1QVF A;  4A3G H;  3CCQ A;  2VS1 A;  3U50 C;  4GOP C;  1CKN A;  3G48 A;  4X6A H;  4HJ5 A;  1VQ7 A;  2UUC L;  4JCV E;  4R4O A;  1VQ4 A;  4XIG S;  3KJP A;  1PYS B;  2IT1 A;  5IYB H;  5M3F G;  4OXP A;  1YJW A;  2RCN A;  1XNQ L;  1L1O B;  1JE5 A;  2Z6K A;  3NEN A;  4GNX C;  1S72 A;  1KXL A;  1SMX A;  3LGJ A;  1L0W A;  2EXD A;  4DR2 L;  2N3S A;  1N32 L;  3ULP A;  5JEA J;  4DPG A;  3K80 C;  5M5W H;  3G4S A;  4DV1 L;  4OWX B;  4A3M G;  4K0K Q;  1WCM H;  4DV0 Q;  3TRE A;  5J3B A;  4DR6 Q;  3GTK H;  1XMO Q;  2UXD Q;  4GKK L;  2OWO A;  2YTX A;  1R9T H;  1EQQ A;  2VQF L;  1HJP A;  1AE2 A;  4YCV A;  4LF4 L;  2VW9 A;  4BXX H;  2JA8 H;  2JA6 G;  1C7Y A;  3HOY G;  3J7Z C;  4NXM L;  4LFC Q;  2ZJQ A;  1PVO A;  3T1H Q;  3HOU H;  1OXV A;  3K8A A;  1HZC A;  5FLX c;  1X3F A;  4R4T A;  4DV5 L;  3KYH C;  4DV7 L;  1T9H A;  2Z6K C;  3K7U C;  3RN2 A;  2JE6 I;  4X62 Q;  4HID A;  4PG3 A;  2N49 A;  2D0P A;  3S15 H;  1KRS A;  1E1T A;  3TQY A;  1FGU A;  1J5E Q;  2I5M X;  1N8R C;  2UUA L;  4OO1 G;  1A8V A;  3CME A;  3CD6 A;  1C0A A;  5E7N A;  3AQQ A;  5IP7 H;  1IXR A;  3A0J A;  4NXN Q;  2IX0 A;  5GAD C;  4A3J G;  1PH4 A;  1FL0 A;  2KCT A;  3JAM c;  1HR0 W;  4JI2 L;  3HFZ B;  1Y1V G;  1LUZ A;  3HOW G;  1I6H H;  1HNW Q;  4DV6 Q;  4A3B G;  1N33 Q;  3FHW A;  3HKZ G;  2I0Q A;  4LWC A;  4DUY L;  3HOV G;  1KQS A;  3ERS X;  5FJ8 G;  2KHJ A;  4IO9 A;  4JI4 L;  5GAH C;  3F2B A;  4P71 A;  5M3M G;  5C0X I;  1C9O A;  1VQD A;  3OYY A;  4P72 A;  5C44 H;  3KJO A;  1SE8 A;  4LF6 L;  1UEB A;  4C3I H;  1Q12 A;  1VQ6 A;  1YI2 A;  3UE0 A;  2RHS B;  1KAW A;  4JBW A;  4PZ6 A;  3UDI A;  1MJC A;  2BH8 A;  1O7I A;  2R7D A;  2KCM A;  4JOI C;  3STB C;  2ZM6 L;  1SRO A;  4A3E G;  1QZH A;  2PQA B;  4DR1 L;  3I4M G;  3OTO L;  3S1N H;  3PF4 A;  1A62 A;  2AHO B;  4DR3 L;  1NMG A;  2Q2U A;  5GAG C;  4P75 A;  1VQ9 A;  5BR8 Q;  2HHH L;  4OWW B;  5IY0 A;  1W2B A;  3FKI H;  1Z47 A;  4IOC A;  2JQO A;  3DLL A;  3CCS A;  1IBL L;  1J6Q A;  3H0G G;  4B3R L;  1DGS A;  3W5O A;  4LF5 L;  3M4P A;  1BKB A;  1I5F A;  3I56 A;  2BH2 A;  1Q82 C;  4DK6 C;  3M3Y H;  4GN4 B;  4JC0 A;  1MJE A;  3W1B A;  1VQF A;  4DUZ L;  3KF8 B;  5C4J H;  3PUZ A;  1PH9 A;  1WCM G;  1TWA H;  4IJH A;  4L5R C;  4A3D H;  4JI7 Q;  2YYZ A;  2LXK A;  2B63 H;  2ID0 A;  1PH6 A;  4LFA L;  2VUM G;  5JJL A;  3E0E A;  3J81 c;  1KHI A;  2K5N A;  4JI0 L;  3FP9 A;  3KF6 A;  4BXX G;  3L7Z C;  3GDE A;  2ZJP A;  4HIK A;  4GN3 B;  1Y1W H;  1GO3 E;  4A76 A;  1KL9 A;  1E22 A;  1RIP A;  2VNU D;  1TWF H;  3J80 c;  2N8N A;  4R4Q A;  4GS3 A;  1JJ2 A;  3PIP A;  4KLK A;  1M1K C;  3BJU A;  2DUD A;  3CC7 A;  1AE3 A;  4GLX A;  2VZA A;  1P16 A;  2I5H A;  1EQR A;  1ASY A;  5IP7 G;  2I5L X;  4DV0 L;  2JA5 G;  1UE1 A;  2KBN A;  4DR6 L;  4DR7 Q;  2RHQ B;  1X3E A;  3SGI A;  4A3K G;  1XMO L;  1HNX Q;  3HOX H;  3ER0 A;  4LF8 Q;  1OXS C;  4O2D A;  2DGY A;  2E5L Q;  4LF7 Q;  1YIJ A;  4EX5 A;  5IP9 H;  2N78 A;  1NE3 A;  1WFQ A;  2LXJ A;  3AFP A;  3E9H A;  2GVB A;  4BBS G;  3GTP H;  1CUK A;  4DV2 Q;  5IYC G;  3T1H L;  2BA0 A;  3BZK A;  3CQZ H;  4LNQ A;  1U5K A;  4GKJ Q;  3JC6 6;  2UXB Q;  1G29 1;  4AYB E;  2GVA A;  4PZ7 A;  3S1R H;  3AYH B;  4IFD I;  1QZG A;  2A1A A;  3RLF A;  4DNI A;  4WJ4 A;  4QY7 A;  1J5E L;  4TVA B;  3PF5 A;  1TWH H;  1N36 Q;  2K4K A;  2R93 G;  4R4C A;  1N9W A;  1FVI A;  2NZO A;  4NXN L;  1G6P A;  2WAQ G;  4MTN A;  4J15 A;  3KLW A;  4Y7N H;  3CW2 C;  1SR3 A;  1EUJ A;  2F52 A;  2E2H H;  4JI3 Q;  2IX1 A;  1ASZ A;  2IHF A;  1HNW L;  2ZTD A;  1A0I A;  3DM3 A;  4R4I A;  5C3E G;  1OXX K;  5EAY A;  4DV6 L;  3F1Z A;  1JB7 A;  1N33 L;  4EQ5 A;  1WYD A;  2CFM A;  2AWO A;  2L15 A;  4A93 H;  4DV4 Q;  4UP8 A;  4B3S Q;  3RLN A;  1HH2 P;  2C35 B;  3BU2 A;  2LSS A;  2E2I H;  3CCL A;  1FJG Q;  3I4N G;  1K3R A;  2Y0S E;  3TEH B;  1QUQ B;  5C0X J;  3UDG A;  2UUB Q;  5ELO A;  4JBJ A;  4JG2 A;  4YWK A;  4JI5 L;  1SFO H;  2PQA A;  3S14 H;  1SN8 A;  3PUY A;  1VQG A;  3HOZ H;  1X55 A;  5FLM G;  4L5S A;  4A3D G;  1PH8 A;  1VQJ A;  3WWV A;  4Y52 H;  5K36 G;  4QGU A;  3CMA A;  2WAQ E;  1X56 A;  2R92 H;  1UE5 A;  4LUV A;  5C0X G;  2AWN A;  4A3C H;  3M4Q A;  1VS0 A;  2ZTE A;  5BR8 L;  1YNX A;  2K5V A;  4GN5 A;  4JBK A;  3PGZ A;  3I4O A;  1Y1W G;  4POG A;  5IYD G;  4BY1 G;  4O0A A;  1XMQ Q;  1WJJ A;  1I3Q H;  3CP0 A;  1U0L A;  1IZ6 A;  1YBY A;  4GNX B;  2QGQ A;  2JA7 H;  1JT8 A;  1HNZ Q;  4DKA C;  1Q46 A;  1XTD A;  2B3G A;  1P8L A;  4L5T A;  1CSP A;  3RLO A;  4X66 Q;  3T1Y Q;  4JI6 Q;  2Q2T A;  4JI7 L;  2ASB A;  1XNR Q;  2MQH A;  1VQI A;  1VQA A;  3RNU A;  2YV5 A;  1PH2 A;  2PNH A;  4X64 Q;  4BY7 H;  3ZJY C;  1N34 L;  1NJI C;  4ALP A;  1I50 H;  3GO5 A;  3I7F A;  4LF9 Q;  5LMN Q;  1H95 A;  4DR5 L;  1NMF A;  3S2H H;  1VQM A;  2R7Z H;  4POF A;  1A63 A;  3H15 A;  5AJ3 L;  1Q81 C;  1EWI A;  4BBR G;  1B70 B;  4PMW A;  3TS2 A;  3CCJ A;  4QQB X;  3CAM A;  3PSI A;  4A3F G;  2VY3 A;  3OW2 A;  4A3G G;  5LMU Q;  2NZH A;  3GTO H;  3PV0 A;  1NY4 A;  3G6E A;  3UDF A;  4OX9 Q;  3HKZ E;  1VQL A;  1CSQ A;  1PFS A;  4GKK Q;  4B3M Q;  4DR7 L;  3GD7 A;  1VQB A;  5IYB G;  3JAM i;  1Z9F A;  1TWC H;  1HNX L;  1LTL A;  1BBU A;  3BZC A;  3D0F A;  4LF8 L;  4LF7 L;  1E24 A;  1CKM A;  5IT9 c;  5JJI A;  4DV3 Q;  3PCO B;  2WFW A;  2EQS A;  2OCE A;  3U58 A;  2R7F A;  2H5X A;  4DV2 L;  5M3F H;  4QJF A;  3K7A H;  2UU9 Q;  1K8G A;  4HJ8 A;  3CC2 A;  1I94 Q;  3S1M H;  4GLA C;  4GKJ L;  2UXB L;  2ES2 A;  1PH1 A;  4LFB L;  1QVC A;  4IJL A;  3F2D A;  4P74 A;  2HIX A;  3EBE A;  2CWA A;  4JV5 Q;  3L2P A;  4A3M H;  2JA8 G;  2F4V Q;  1L1O A;  1IBM Q;  1N36 L;  3HOU G;  1IYJ B;  1B7Y B;  4AQY Q;  1VQO A;  1EYG A;  2K5H A;  3CCR A;  3GTQ H;  1VQK A;  1E1O A;  3PUW A;  1GVP A;  4C3J H;  3HOY H;  1JJC B;  2JA6 H;  4JI3 L;  3PO2 H;  5C4X H;  3CCV A;  2Z0S A;  4LUO A;  1XPR A;  4IPH A;  4C2M H;  1TXY A;  1HR0 Q;  3K0X A;  3A5U A;  4IFD G;  4K0K L;  5HGQ A;  1JJG A;  2AKW B;  1QUQ A;  4DV4 L;  2WB1 G;  3STB D;  4BA1 I;  3H3V H;  2UXD L;  2K52 A;  4YHH Q;  3UE1 A;  1K9M C;  3B6Y A;  3F8T A;  2XGT A;  1X3G A;  1TWG H;  3AEV A; 
#chains in the Genus database with same CATH topology
 1X32 A;  4K8I A;  4KKU A;  3T53 B;  2IHE A;  4LFC L;  1K8M A;  4X62 L;  3QOJ A;  2KVM A;  3D6W A;  4B3T Q;  3S24 A;  2OTJ A;  1ILP A;  4RG1 A;  4XQN A;  3HOV H;  5GQO A;  2XN9 C;  4A3I H;  3P20 A;  2B2W C;  2WB1 E;  4IPG A;  2K14 A;  3GV6 A;  2A8V A;  5GAE C;  5M9O A;  2XWB B;  3MC0 B;  3RZD H;  2YU9 H;  1SYB A;  2ALY B;  3MEF A;  3I4M H;  1YHB A;  2UXC Q;  1ROD A;  1SNC A;  2D9U A;  2J0T D;  2JSO A;  3S2H B;  2XWJ B;  1U4P A;  4UP7 A;  4X3U A;  3KLS A;  3BYY B;  2XRQ D;  1GD7 A;  2MO0 A;  5LMN L;  1BQQ T;  2IX3 A;  1YNN D;  2RDF A;  3IRB A;  1UE6 A;  1TS3 A;  4JI8 Q;  4CDE C;  1B53 A;  1NBW A;  4RGO S;  1PTO H;  4OX9 L;  3S17 H;  4GOP B;  4NDX A;  1AW7 A;  4X65 Q;  3KBX A;  4JVZ A;  1UNS A;  3PO2 G;  5C4X G;  3A74 A;  2F0U A;  3R8B A;  3D31 A;  1HA5 A;  2CWP A;  1EU4 A;  4A3M B;  1XPO A;  3HOX G;  2NVQ H;  5BN3 A;  1DXM A;  1QWY A;  2UUC Q;  5J1Z A;  1BBW A;  2JA5 H;  1KC8 C;  4A3K H;  2QEJ C;  2JA6 B;  1MI2 A;  1Y8O B;  4MHE A;  1WTQ A;  4YCU A;  1H9J A;  1EEI D;  4DV1 Q;  1NTG A;  3BDL A;  1VCI A;  3MXN B;  4TQU S;  3NXW A;  3DWQ A;  3I2Z A;  3DXJ C;  3MWY W;  1TY0 A;  2VQF Q;  4YHH L;  4JI5 Q;  1KRT A;  1UE7 A;  4N9P A;  2B2Y A;  3GTG H;  5FK9 C;  1BVS A;  2JEB I;  2SEB D;  1Y1V B;  3HOW B;  1BF4 A;  3CPF A;  1KLG D;  2JJQ A;  2PQE A;  4IOA A;  4QCL A;  4K6D A;  4JI1 L;  2RDH A;  3TSS A;  3WOF A;  2B29 A;  5M3M B;  3QB3 A;  3R2T A;  2PI2 A;  1GUW A;  1YEZ A;  3M4O H;  4IFD J;  1Q86 C;  4HJ7 A;  3NQT A;  1I4G A;  4DAP A;  4TKO B;  1EIH A;  4JI2 Q;  2A68 C;  5C4Z A;  4GLV B;  1IL2 A;  2PW5 A;  3NK9 A;  3PMF A;  4JW0 A;  5CV6 A;  4DUY Q;  1PYB A;  5K36 H;  1RCV D;  1UWV A;  2L0C A;  1CKO A;  3PO3 G;  5C0X H;  3H0G B;  1VQ8 A;  3TP8 A;  1PHJ A;  1SE3 A;  2ZM6 Q;  1AH9 A;  2EY1 A;  4DR5 Q;  1B8A A;  3SE0 A;  1D8L A;  1BR9 A;  3OTO Q;  1IBK L;  1AFP A;  5EGT A;  2CQO A;  1WOC A;  2B2T A;  2Z8L A;  2VUM B;  4YWL A;  3RUZ A;  2E2J B;  4LF5 Q;  1E2V A;  1AN8 A;  5JAV A;  2IJ0 A;  4XTC S;  1EEF D;  3ULL A;  2ZXO A;  2Q2I A;  5KRU A;  1JC7 A;  4X3T A;  5IGB A;  1I6V C;  2QA4 A;  4JI0 Q;  2E76 C;  4DGZ A;  2VS1 A;  3BZD B;  5E4X A;  1B2T A;  1VQ7 A;  4XXE A;  3KJP A;  1DOK A;  1YJW A;  2QDB A;  1XNQ L;  4GNX C;  1TU2 B;  1S72 A;  5KNC A;  4G7O C;  1SMY D;  1N32 L;  3ULP A;  5M5W H;  3M4Y A;  4I7A A;  4A3M G;  1WCM H;  3TRE A;  5F2D A;  2UXD Q;  2ZXP A;  3FPU B;  1NUC A;  2WKD A;  1AE2 A;  5ELB A;  2VW9 A;  5I2Y A;  2KHS A;  2WAQ B;  2JA6 G;  1C7Y A;  4NXM L;  1FD7 D;  5T1G A;  3LX0 A;  1OXV A;  3K8A A;  4R4T A;  1CTM A;  3KYH C;  1T9H A;  2Z6K C;  3RN2 A;  4HID A;  1I4Q A;  3S15 H;  1N8R C;  2VB2 X;  2UUA L;  3CME A;  1EIG A;  3RZO B;  3RD4 A;  4IFD H;  2NVT B;  2EY5 A;  1IXR A;  4CDC C;  2KCT A;  3X3N A;  3C1E A;  1Y1V G;  1LUZ A;  4PMC A;  3HOW G;  2HCI A;  3T4A C;  3FHW A;  3BVG A;  1KQS A;  3ERS X;  1RJT A;  2KHJ A;  4UDU C;  4DXF A;  5M3M G;  4LF6 L;  1SE8 A;  3SHL A;  2LKV A;  3UE0 A;  4PZ6 A;  1PFB A;  1ENA A;  2KCM A;  3STB C;  2F0M A;  1SRO A;  2L9H A;  5FLX L;  5KNB A;  4DR1 L;  3S1N H;  1A6X A;  1A62 A;  1VQ9 A;  5BR8 Q;  2HHH L;  1W2B A;  1F2Y A;  3FKI H;  3CCS A;  1IBL L;  3BVZ A;  3H0G G;  2WAC A;  3NPP A;  3W5O A;  3GTP B;  3I56 A;  1I5F A;  1RTO A;  2FFK B;  1F9S A;  3JAM L;  5FO7 B;  4DUZ L;  3CRL C;  5C4J H;  1LTB D;  1PH9 A;  4BBR B;  4IUP A;  1D1K A;  3U9O A;  4A3D H;  4JI7 Q;  2Q8I B;  1KTK A;  1S5E D;  2LXK A;  4A3G B;  3C3L A;  4LFA L;  2VUM G;  1PLF A;  2NTS A;  3NE5 B;  5EPK A;  2KCC A;  1MHW C;  2A6E C;  1SEB D;  3L7Z C;  3GDE A;  4GN3 B;  4A76 A;  2K04 A;  1F9P A;  1TWF H;  2N8N A;  1JJ2 A;  4KLK A;  3CC7 A;  3NWT A;  4GLX A;  1KLU D;  2RA4 A;  1ASY A;  5IP7 G;  2KBN A;  1X3E A;  1HNX Q;  2JA8 B;  4LF8 Q;  1OXS C;  1EFI D;  4O2D A;  2E5L Q;  2ICE C;  1NE3 A;  2E2D C;  2PMZ B;  3TME A;  1SNP A;  3T1H L;  2BA0 A;  2AUJ D;  3CQZ H;  5COR A;  4LNQ A;  1EL0 A;  2K6A A;  2K32 A;  3JC6 6;  1G29 1;  5G3L F;  4PZ7 A;  1SYF A;  2G5D A;  3AYH B;  2EY6 A;  2X69 A;  2A68 D;  5D65 A;  4LJZ C;  5A2Q L;  1J5E L;  4K5W A;  3PF5 A;  1LAC A;  3AB9 A;  1PYW D;  4R8N A;  1N36 Q;  4QIW B;  4R4C A;  1FVI A;  1I6H B;  2WAQ G;  4MTN A;  1D5X C;  3CW2 C;  1STN A;  2OXP A;  4PV1 C;  3NUC A;  1OXX K;  2K05 A;  3ERQ A;  1JB7 A;  4KJN A;  1AEX A;  4C3I B;  4FP5 D;  1EYA A;  1LT3 D;  4DV4 Q;  4ZAI A;  5BN5 A;  1SDF A;  4B08 A;  5IGD A;  1G8Z D;  4ZQ3 A;  1FJG Q;  1SYC A;  1K3R A;  1QUQ B;  3VR4 A;  5I6W A;  5ELO A;  1SFO H;  4JI5 L;  2PQA A;  3S14 H;  1SN8 A;  1K8O A;  4UAI A;  1CA5 A;  2OF1 A;  1RKN A;  4OIJ A;  1G2S A;  2WAQ E;  2R92 H;  1FNV A;  4OEL B;  1UE5 A;  5D3D A;  2RCF A;  4GN5 A;  2K5V A;  4JBK A;  1UAP A;  1SAP A;  3K5L A;  1Y69 U;  1U0L A;  4ID6 A;  2F03 A;  2B63 B;  2K01 A;  1T5E A;  2JA7 H;  4DKA C;  3RLO A;  2Q2T A;  2MQH A;  1GHJ A;  1F2L A;  1VQA A;  1PH2 A;  3OMC A;  1Y1W B;  5IGE A;  4BY7 H;  3ZJY C;  1JE4 A;  3GO5 A;  5LMN Q;  1H95 A;  4DR5 L;  1HRJ A;  4KMU C;  1NMF A;  2QW7 A;  4WOR A;  4E6I A;  4POF A;  2R7Z H;  4QUC A;  1Q81 C;  4BBR G;  1LLR D;  3TS2 A;  4QQB X;  1H9S A;  4A3G G;  4RGT A;  3GTO H;  1NY4 A;  5L37 A;  3UDF A;  4OX9 Q;  3GD7 A;  2RDG A;  1VQB A;  1D5M C;  1TWC H;  3HEJ A;  2BDO A;  1LTL A;  1ZYR C;  3NBI A;  4NW2 A;  3U58 A;  2EQS A;  2OCE A;  2WFW A;  3Q0A A;  4HED A;  4GKJ L;  2ES2 A;  1WVL A;  2AUK A;  4A3I B;  3AMU A;  1V8Q A;  4P74 A;  2HIX A;  3EBE A;  1LT4 D;  3L2P A;  2JA8 G;  1A3V A;  1L1O A;  1KAA A;  3KLR A;  2K5H A;  2ZT9 C;  3PIP 3;  3QO2 A;  3MXG A;  2Z9H A;  3I73 A;  4C2M H;  4P2C B;  3K0X A;  1JJG A;  2E2I B;  4Z9C B;  2CHB D;  3STB D;  2UXD L;  4YHH Q;  4IUT A;  3D8G A;  3F8T A;  3HRZ C;  5I6Y A;  3AEV A;  3HOZ B;  1E3P A;  4V0B A;  1E7Z A;  4CDF C;  1HTP A;  2WP8 J;  5IT9 L;  4A3J H;  3KOJ A;  5IE8 A;  4JI1 Q;  1E0B A;  4C3I G;  2ICI A;  2F3W A;  2FHT A;  2K50 A;  5C5L A;  2PCF B;  4ZKC B;  2BOS A;  1TII D;  1I3Q B;  3ICE A;  1X9N A;  1VQC A;  1RL2 A;  2D0O A;  1HXY D;  4GNX A;  2XVS A;  4WFN 3;  1MKH A;  1G51 A;  1YHQ A;  1V9P A;  2F0L A;  2EIF A;  2LFN A;  2A6E D;  4A3E H;  4QUF A;  2NVQ B;  2NWG A;  2HIV A;  1XNR L;  3T1Y L;  4ZRZ A;  3TP7 A;  1CZG A;  1LTR D;  4N8X 1;  4FXD A;  2Q2H A;  4B9W A;  2NN6 G;  3KF6 B;  1SSO A;  2MNA A;  1IBK Q;  2B63 G;  2X6L A;  1VQP A;  2K1B A;  1PH7 A;  4CBV A;  3VDY A;  1EIF A;  1SRU A;  1ONL A;  4L63 B;  1E2W A;  2SNS A;  3Q8D A;  3U9S A;  4IUN A;  1A15 A;  3PUX A;  1SJH D;  5DAU A;  4L8J A;  1Q1E A;  4XDX A;  5M3F B;  3TRZ A;  3OW7 A;  3N52 A;  4JBM A;  1Q1B A;  5CBE E;  3J7A 5;  4KN4 C;  3EN2 A;  1YJ9 A;  2UU9 L;  5M5Y H;  4MN3 A;  5M5X H;  3UDX A;  4PMB A;  4V19 0;  1MIU A;  2IWH A;  1VQH A;  4QL5 A;  4KHZ A;  4IPC A;  2QF7 A;  1XNQ Q;  1SYD A;  1ICF B;  3HOY B;  5C4X B;  1YHA A;  4DAM A;  1N32 Q;  3CCE A;  5IGG A;  3CXC A;  3H3V I;  1RDP D;  1UUP A;  3EIV A;  4A3I G;  1PA6 A;  3H91 A;  4AIM A;  1LT6 D;  2F0V A;  1D7Q A;  3IAY A;  3R93 A;  3GTM H;  3DM1 A;  2E5L L;  4NXM Q;  3M7G A;  4KY5 A;  3M85 A;  4FYD A;  2R93 H;  4KHP L;  1DON A;  3P1H A;  4A3B B;  1JIC A;  1BCP F;  1YNJ C;  5LHY 1;  2UUA Q;  3I91 A;  5C3E H;  3KK7 A;  4H7B A;  2NVY B;  3NEM A;  4DR4 L;  3K81 C;  4YCW A;  2VQE L;  3HOZ G;  1Q90 A;  1IL8 A;  2GN5 A;  1GHK A;  3U4V A;  4DK3 C;  1LTA D;  4A3C G;  1X65 A;  1K83 H;  2BA1 A;  5FLM H;  1S3O A;  1KDC A;  3FDT A;  4MNO A;  3E9I A;  4LF6 Q;  3NP8 A;  4JYA L;  2N88 A;  1N34 Q;  1IYU A;  1FJG L;  3GTJ H;  1KIX A;  1TS2 A;  2IY5 B;  1PV4 A;  1E2Z A;  1XTC D;  1QCB D;  4L5Q A;  4DR1 Q;  3I55 A;  1V1O A;  4PZ8 A;  1Y14 B;  1NR2 A;  1K8A C;  3GTL B;  2F0F A;  3SEB A;  2HHH Q;  3P7J A;  4GOP A;  1ZYR D;  4F88 A;  1IBL Q;  5IIF A;  3PO3 B;  5T1I A;  4RKB A;  2R6G A;  2A6H C;  2E8G A;  1STA A;  2PO4 A;  1PH3 A;  4DUZ Q;  2V1C C;  1MSG A;  1GKH A;  5BN4 A;  3ULJ A;  3S1Q B;  1NNX A;  3A7L A;  4LFA Q;  4BWG B;  5LMN W;  4YY3 L;  1WTH A;  4AH6 A;  1WTR A;  4UP9 A;  1IHZ A;  4X6A H;  2EYJ A;  4HJ5 A;  2F1M A;  1F2M A;  4R4O A;  1PYS B;  2IT1 A;  1B1Z A;  3DEO A;  4DA2 A;  5M3F G;  1PFM A;  2RCN A;  4BBS B;  3NEN A;  3MXN A;  3VYS A;  2I07 B;  4DPG A;  3EA6 A;  2O4X A;  3D4W A;  4HSV A;  5J3B A;  4L6T B;  2L5T A;  2F0K A;  2YTX A;  1EQQ A;  4YCV A;  4LF4 L;  4BXX H;  3HOY G;  1JWU D;  1EZ8 A;  2QCP X;  2ZJQ A;  2E75 C;  4ABN A;  1RF2 D;  3T1H Q;  3HOU H;  2AQ2 B;  4DV7 L;  3S16 H;  3NTK A;  3H6M A;  3K7U C;  2N49 A;  2D0P A;  4MTK A;  1UEA B;  2CH4 A;  1E1T A;  4NKL A;  1FGU A;  5EKK A;  1J5E Q;  2I5M X;  4OO1 G;  1A8V A;  3CD6 A;  1EY9 A;  1GUT A;  3I4N B;  4X3S A;  2IX0 A;  2PYK A;  1LTS D;  1PH4 A;  1FL0 A;  2IL8 A;  1QB5 D;  3I3C A;  2P5Z X;  4A3B G;  1PRT B;  4R9W A;  5G3L D;  2BE5 C;  5FJ8 G;  5GAH C;  4P71 A;  4J8Q A;  1C9O A;  4P72 A;  3OYY A;  3KJO A;  1WTO A;  1UEB A;  2O2L D;  1JOK A;  4XT1 B;  4HMJ A;  4BY1 B;  4C1N K;  1KAW A;  4JBW A;  1V1P B;  2NVX B;  5FKA C;  4CJ1 B;  1O7I A;  4XYQ A;  4JOI C;  1WTX A;  3A56 A;  1NAP A;  4C56 C;  1SYG A;  3E3X A;  5C6A A;  5CGK A;  4DR3 L;  3PF4 A;  1OO9 B;  4FNF A;  1DOM A;  2C9O A;  4EQN A;  4WJW A;  3S2D B;  2JQO A;  1B4O A;  4B3R L;  4GZY C;  1DGS A;  5I4D A;  4JC0 A;  1J8I A;  3W1B A;  1H9K A;  3K5N A;  1WCM G;  1PTO C;  2Q8R E;  1TWA H;  4L5R C;  3F2U A;  3ERO A;  3VR5 A;  4A3F B;  4C3H B;  2YYZ A;  1B3Q A;  5JJL A;  3A54 A;  4HCE A;  2K5N A;  4IUU A;  1BCP C;  2EYL A;  3DWA A;  1II3 A;  3OPO A;  1NCV A;  1QNK A;  2MP1 A;  2ZJP A;  4HCS A;  2VNU D;  3J80 c;  1LTT D;  3PIP A;  3GTK B;  3OWE B;  2DUD A;  3WDN A;  1MSH A;  1P16 A;  3VYU A;  2I5L X;  4IAL A;  1UE1 A;  4DR6 L;  3HOX H;  1DZ1 A;  2EYP A;  3ER0 A;  4N9T A;  1WFQ A;  2LXJ A;  5DEH A;  2GVB A;  4BBS G;  1YNJ D;  1CUK A;  5IGF A;  5IYC G;  1CFM A;  3BZK A;  1GUO A;  5EJW A;  4GKJ Q;  3S1R H;  1STB A;  5ELF A;  4QY7 A;  1ZEQ X;  2MHV A;  4ZUI A;  4OIK A;  1HFN A;  2FJ2 A;  5EBC A;  1PRT F;  3HGB A;  4NXN L;  2Z1C A;  1B9N A;  4J15 A;  1GUG A;  1SR3 A;  2IX1 A;  2KCN A;  1HNW L;  1I4X A;  4R4I A;  4DV6 L;  1N33 L;  5C44 B;  4K8J A;  5LL6 S;  4FF3 A;  2L15 A;  5COY A;  2B2V A;  4UP8 A;  1HH2 P;  2C35 B;  1CHP D;  2LSS A;  3I4N G;  2EJF C;  3TEH B;  2EYH A;  4DN4 M;  3UDG A;  4CDD C;  4YWK A;  3EJI A;  1JR0 D;  3D4R A;  4JK1 C;  3SK5 A;  4A3D G;  1X55 A;  4L5S A;  3SK6 A;  3WWV A;  4QGU A;  3CMA A;  1X56 A;  2A6H D;  1M8A A;  4LUV A;  1F77 A;  1TWC B;  4CKE A;  2F0I A;  2EOT A;  3H94 A;  1PZK D;  3ZYY X;  3I4O A;  3M3Y B;  1WTW A;  5IYD G;  4BY1 G;  2A74 C;  2LS0 1;  4FXG C;  4DK1 A;  4L5T A;  1XNR Q;  1CSP A;  1PXU A;  4RFB A;  3T1Y Q;  1S5D D;  1QOH A;  1WD0 A;  3IFT A;  3MEH A;  3NBH A;  1N34 L;  2XSC A;  4QMG A;  1NJI C;  4K14 A;  3N6R A;  4ALP A;  2G9H D;  3I7F A;  3OIQ A;  5NUC A;  3S2H H;  1VQM A;  2PPB C;  1A63 A;  4K2K A;  2HDL A;  2Z4I A;  1LO5 D;  4A3F G;  4C3H G;  1J9O A;  4GKK Q;  5IYB G;  4EQP A;  1KNE A;  3VR6 A;  4LF7 L;  1QNU A;  4DNT B;  1E24 A;  1CKM A;  3AU7 A;  5JJI A;  4ULL A;  1FNW A;  1L0X B;  2R7F A;  2H5X A;  4DV2 L;  1IKL A;  2UU9 Q;  4GLA C;  3SK4 A;  1TWH B;  1QVC A;  3J80 E;  4A3M H;  3OMG A;  1K28 A;  1IYJ B;  1B7Y B;  4Y7N B;  1EYG A;  2XNA C;  2R3Z A;  2E2H B;  2AQ1 B;  1VDZ A;  4RKL A;  4A93 B;  3GQB A;  4I65 A;  2JA6 H;  3SVM A;  3E6Z X;  1SNM A;  3CCV A;  4LUO A;  4IPH A;  5ISR A;  5HGQ A;  1QUQ A;  2VB3 X;  3H3V H;  2B2W A;  3QOL A;  3RR5 A;  4KHP Q;  2TMP A;  3FEW X;  1HZ9 A;  1JCK B;  4DFA A;  3W2D A;  1L2F A;  2MUY A;  5JVG 3;  5DLQ E;  5IGC A;  1STY A;  1D1I A;  1Y1V H;  5C44 G;  3HOW H;  4DXG A;  2F0P A;  4DR4 Q;  4OON A;  2A19 A;  5GRO A;  2EYF A;  2VQE Q;  2HT1 A;  2ZJR A;  5M3M H;  3UI2 A;  2RBM A;  4NB3 A;  1PTO D;  1S40 A;  4EQO A;  1M90 C;  2IPK D;  3J80 i;  3T51 B;  2I46 A;  2EVB A;  4AYB B;  1VQ5 A;  5E3F A;  1WI5 A;  5M5Y B;  2F0Q A;  1BCP D;  1TS5 A;  4HTH A;  2RSO A;  4IUV A;  1YJN A;  4JYA Q;  4JI6 L;  2Q8T A;  2XTI A;  2CQA A;  5LL6 X;  4HIM A;  1I50 B;  1VQN A;  2MO1 A;  3AFQ A;  1HCZ A;  4LMQ D;  1VQE A;  2RF4 A;  3H0G H;  1SLJ A;  1X3Q A;  1TKW B;  1QIL A;  1PRT C;  3W1G A;  3CCM A;  1EQT A;  3L0O A;  4H13 C;  4UY8 C;  3O13 A;  3DMU A;  1ESF A;  2Y0S B;  1XJV A;  3ND8 A;  3KDF B;  4B3M L;  1S5B D;  3J81 j;  3KLS X;  3OHX C;  2VUM H;  2KEE A;  4G4K A;  3IL8 A;  4A3L H;  2M2L A;  3KFU A;  2E2J H;  1LYL A;  4B9X A;  3K7A B;  3VA5 A;  5JEA G;  3S1M B;  2JA9 A;  1ENC A;  4H02 A;  1EY7 A;  4YY3 Q;  1G6Z A;  2DJG C;  4NPS A;  2K75 A;  1SNQ A;  5EBD A;  5IP9 G;  4ZKB B;  3GTQ B;  1W3S A;  3FMC A;  3TZD A;  1BDO A;  5ELN A;  2F4V L;  4JOI A;  1U4M A;  4P73 A;  1IBM L;  1CKN B;  4C3J B;  4AQY L;  3HKS A;  3NSW A;  2QEX A;  2ATW A;  3TBI B;  3MTS A;  2CVR A;  3U4Z A;  2K33 A;  3K59 A;  1HR0 L;  4OO1 I;  1TWG B;  1HHV A;  1XX8 A;  3MXU A;  2JP1 A;  4LF4 Q;  4A75 A;  1CA6 A;  4J1M A;  1OXU A;  2JYO A;  4DV7 Q;  2FXQ A;  2KJX A;  3HP3 A;  1I4P A;  4A93 G;  4H0L C;  4LW1 A;  1B3A A;  3HKZ B;  3HOV B;  1PZI D;  5I2X A;  1ZXT A;  1PH5 A;  1X6O A;  1EOT A;  2PNR C;  3VA7 A;  1AZQ A;  5KEE A;  3RZO H;  2F4I A;  3CPW A;  3RZD B;  2YU9 B;  2NVT H;  4MZ9 A;  2J4X A;  4XQJ A;  4HJA A;  2B2Y C;  4O1N A;  3I4M B;  1YVC A;  1H9M A;  3M9B A;  3K5M A;  1SNO A;  2LMC B;  4Q5V A;  1G2T A;  4ZUJ A;  4Q0F A;  2NYZ D;  3NTI A;  1LTI D;  2KEN A;  5JOB A;  5EKL A;  2L12 A;  4HIO A;  3T16 A;  1SYE A;  4KV6 A;  1GXD C;  2K28 A;  3PIO A;  4FF4 A;  1EYD A;  4AYB G;  4DR3 Q;  2PMZ E;  2D2C C;  1HZA A;  1EIY B;  1PTO B;  3FPP A;  3L9A X;  5IWA L;  4OWT B;  3RN5 A;  3S17 B;  2HQL A;  1OTC A;  2JEA I;  3G71 A;  4B3R Q;  4R1J A;  1BCP B;  5CV5 A;  4DAY B;  4CJ0 B;  1DM0 B;  5EPJ A;  4QIW E;  1EY0 A;  2F3V A;  2F0G A;  3I90 A;  1QVG A;  1QG7 A;  3ONA B;  1OXT A;  2Y0S G;  4BBR H;  2JA5 B;  4A3G H;  1FR3 A;  4HMI A;  4A3K B;  5HUR A;  5IOD A;  2F0H A;  4HAE A;  1VQ4 A;  2ZXR A;  4ILW A;  4OXP A;  1L1O B;  1JE5 A;  2Z6K A;  3V2T A;  4KD3 A;  1KXL A;  1L0W A;  4DR2 L;  4BS9 A;  1DD2 A;  1BBX C;  1BUV T;  3TDQ A;  2B8G A;  4DR6 Q;  2BDN A;  2G9D A;  4GKK L;  3GTG B;  1R9T H;  1HJP A;  2EJG C;  4C3J G;  2JA8 H;  2F0T A;  1PVO A;  3A8I E;  4N8F A;  5FLX c;  4DV5 L;  4OEM B;  1D5Z C;  3SDZ A;  5CC4 A;  3CRK C;  1KRS A;  1PDQ A;  3CHB D;  3M4O B;  5CV8 A;  1G91 A;  1XWE A;  5E7N A;  3AQQ A;  3A0J A;  3Q23 A;  4NXN Q;  5GAD C;  2DY7 A;  1VMP A;  3JAM c;  3V05 A;  1BXT A;  1HNW Q;  1I6H H;  1HUN A;  5J39 A;  4DV6 Q;  1N33 Q;  3HKZ G;  1I4R A;  3K6O A;  4LWC A;  4ZK9 B;  3HOV G;  3K58 A;  3QJY A;  4JI4 L;  3LWU A;  2B8F A;  3F2B A;  1PFN A;  2SOB A;  3QWN A;  1VQD A;  3VR2 A;  2F0D A;  4C3I H;  1Q12 A;  4RWS C;  1VQ6 A;  1PRT D;  3Q22 A;  1YI2 A;  2RHS B;  1VF5 C;  2BH8 A;  5CYU A;  1PTO F;  2R7D A;  2NB0 A;  1CT1 D;  3K57 A;  1QZH A;  3I4M G;  2AHO B;  3BDO A;  1NMG A;  1R4P B;  5GAG C;  4P75 A;  1L0Y B;  4OWW B;  1JQY D;  4FF2 A;  4J6H A;  2F0W A;  3LNN A;  2F0J A;  1J6Q A;  1DYQ A;  1IKM A;  1BKB A;  4MIU A;  3SXH A;  2J7Z A;  1Q82 C;  1VQF A;  3KF8 B;  3PUZ A;  1K3B C;  4IJH A;  1STH A;  2B63 H;  3MFY A;  1EYC A;  3E0E A;  3J81 c;  1KHI A;  3FP9 A;  4BXX G;  2RSN A;  2BCO A;  1Y1W H;  1GO3 E;  2LY7 A;  1LV9 A;  1KL9 A;  5M5W B;  2EXZ A;  1WCM B;  2K03 A;  4R4Q A;  4GS3 A;  1M1K C;  4YIJ A;  4KD4 A;  1AE3 A;  2VZA A;  2I5H A;  2JA5 G;  4DV0 L;  4OHJ A;  3GV3 A;  4A3K G;  1XMO L;  4G57 A;  4LF7 Q;  5IOC A;  1YIJ A;  3E9H A;  3AFP A;  1I4H A;  4KKT A;  4DV2 Q;  3S15 B;  4M1U B;  1KNA A;  3BYT B;  4DNR B;  1SBB B;  1U5K A;  2K5Q A;  4KN7 C;  2GVA A;  4K5X A;  2F0E A;  3VYT A;  1U9R A;  3RLF A;  4DNI A;  1O7L A;  2PZT A;  1Y8P B;  2KQ3 A;  3TZU A;  2K4K A;  1N9W A;  2EYO A;  2NZO A;  1A3T A;  4ZYS A;  1G6P A;  4ODG A;  3KLW A;  1EUJ A;  2ZTD A;  1DCZ A;  2FMM A;  4EQ5 A;  2CFM A;  5FLX E;  4B3S Q;  1PZJ D;  1SND A;  1STG A;  1V1P A;  1QJO A;  2E2I H;  3CCL A;  2NUC A;  5C0X J;  5J22 A;  4JG2 A;  5JJZ A;  3S1N B;  3MVV A;  1NR4 A;  1VQG A;  3HOZ H;  1VQJ A;  5K36 G;  1ILQ A;  4WRD A;  4HSP A;  2Z6B A;  3JAM E;  3FKI B;  3K5O A;  5C0X G;  1C8C A;  4A3C H;  1HQR D;  2ZTE A;  3MHB A;  3M4Q A;  5CR3 A;  3PGZ A;  4UHV A;  1X3P A;  4POG A;  5CV7 A;  1XMQ Q;  5C4J B;  1WJJ A;  1I3Q H;  4F7X A;  4A3D B;  4IZ8 A;  2MGS A;  1IZ6 A;  2QGQ A;  1XXG A;  1Q46 A;  3X3M A;  1P8L A;  2ASB A;  4JI6 Q;  2WV6 D;  2RQX A;  3A8J E;  1VQI A;  1SJE D;  5EQ0 A;  1WTP A;  3EFX D;  2B2U C;  3EQL C;  3T13 A;  1B44 D;  2KEC A;  3J7Y W;  3OWF A;  1TWF B;  1F2Z A;  3D4D A;  4K5V A;  1B70 B;  3CCJ A;  3E0J A;  3PSI A;  3MXP A;  2NZH A;  1JOQ A;  2HCC A;  1IW7 C;  2RVL A;  3G6E A;  1LTG D;  4B3M Q;  3R2I A;  4DR7 L;  3JAM i;  3BZC A;  3BDC A;  5A2Q E;  4R8I A;  2EYM A;  3J81 E;  3CQZ B;  5IT9 c;  1GUN A;  4DK0 A;  1EQV A;  5M3F H;  2UXB L;  3I70 A;  4PQX A;  4IJL A;  3QR8 A;  2CW0 C;  2CWA A;  2A73 B;  3PIO 3;  2F4V Q;  5CMD A;  3RMH A;  1IBM Q;  1MGS A;  3C46 A;  3ND9 A;  4AQY Q;  1VQO A;  3CCR A;  1VQK A;  1AP0 A;  1A3U A;  4U67 3;  1CM9 A;  3HOY H;  4JI3 L;  3PO2 H;  5I9P A;  5C4X H;  2Z0S A;  3MAQ A;  1XPR A;  1TY2 A;  1ENF A;  2K7V A;  1HR0 Q;  4IFD G;  3A5U A;  1W6J A;  4PNY A;  3TP5 A;  1SFO B;  3UE1 A;  3S14 B;  1X3G A;  4OO1 H;  2UUB L;  1L1O C;  1T5X D;  3CCU A;  3DHQ A;  3I8Z A;  1RTN A;  2R92 B;  4BA2 I;  4TSS A;  1GUS A;  2JN4 A;  3A5Z B;  3J81 i;  5E1F A;  1XPU A;  3A7A B;  4A3B H;  5FO9 B;  2H4O A;  4RH6 A;  2WIN B;  4FO2 A;  1LT5 D;  4KTA A;  1GM5 A;  2QKI C;  2CCZ A;  5FJ8 H;  1ML0 D;  1B9M A;  2NVY H;  2KUM A;  1CQF A;  2SNM A;  2JA7 B;  2MJ8 A;  2A69 C;  3NEL A;  3CC4 A;  4UPA A;  1CQV A;  1V1Q A;  2ENB A;  2ZTC A;  5TSS A;  1TS4 A;  3NHH A;  1HNZ L;  3FKI G;  4X66 L;  4BY7 B;  4RHS A;  1Z6H A;  4ZCK A;  2B39 A;  4IUR A;  4YWM A;  4RMF A;  3PUV A;  4HJ9 A;  3TS0 A;  2F0N A;  4X64 L;  2R7Z B;  4RGM A;  4LF9 L;  3P75 A;  5FOB B;  5I9O A;  4KK7 A;  3GTO B;  3OIP A;  4OGQ C;  5IWA Q;  3CF5 A;  5JVH 3;  4C1N I;  5LMU L;  5KND A;  3GTL H;  2VL6 A;  3TN2 A;  4ZLT F;  1JOO A;  4RCO A;  2F0O A;  4XQQ A;  3PO3 H;  2KHI A;  2NN6 I;  3A8K E;  4APV A;  2QDL A;  5CV9 A;  4DV3 L;  4TRD A;  1ICW A;  3F2C A;  2Z4H A;  1I94 L;  3S1Q H;  2F0S A;  2EE1 A;  1S5F D;  1EOV A;  2C5C A;  2OEO A;  1JWS D;  4JV5 L;  3M7N A;  2XRS D;  4LUZ A;  1CI3 M;  4QB4 A;  1AZP A;  5C5M A;  1GJX A;  4IN3 A;  2M00 A;  4K6L A;  4DR2 Q;  5D14 A;  4C2M B;  4RA8 A;  4BBS H;  3NQI A;  2MPM A;  4KI0 A;  4A4I A;  1DOL A;  5IYC H;  5IT9 E;  4KY7 A;  1U4L A;  1CZW A;  5H1S E;  1Q8K A;  3HG9 A;  1U4R A;  2KED A;  2F3I A;  1WD1 A;  4IUQ A;  2PZU A;  4A3J B;  2OQ0 A;  2L4N A;  4WJ3 M;  4DV5 Q;  1KDB A;  1Q7Y C;  1Q3L A;  1KD1 C;  4CHT B;  4B3T L;  3I4L A;  2OTL A;  5K5P A;  1HZB A;  4ME3 A;  4IPD A;  2MFI A;  3J7A V;  2OQK A;  1Z7T A;  1EY4 A;  2BE5 D;  1MD2 D;  3I4N H;  3HS0 C;  2R92 G;  4A3E B;  2D5D A;  1EY5 A;  3MA2 B;  1YIT A;  4JI4 Q;  5KIX A;  5JPN C;  1HTL D;  1ET6 A;  4LK1 C;  1ZKO A;  3I72 A;  1H9R A;  4B3S L;  4CKC A;  5HY6 A;  3EVQ A;  1K73 C;  2UXC L;  3IKJ A;  4A3L G;  3BS1 A;  5JJK A;  2JK8 A;  4RCN A;  2YTV A;  1K0R A;  3A55 A;  2JA7 G;  3NBH B;  4BY1 H;  5IYD H;  5AJ3 Q;  2GA4 B;  2NVX H;  1IW7 D;  3VR3 A;  3S9W A;  2YTY A;  3MFG A;  3KDF A;  1O78 A;  4BY7 G;  4JI8 L;  5DM6 3;  2VXW A;  1EWC A;  1FGB D;  1V43 A;  1R9T B;  1TVX A;  2CKZ B;  2NBF A;  2NTT A;  4FDB A;  4O42 A;  1JMC A;  3C1F A;  2R7Z G;  1LM0 A;  4X65 L;  3S2D H;  1XMQ L;  3OOC A;  2R61 A;  3BVM A;  4OL7 A;  2D62 A;  3D3R A;  2KOL A;  2CW0 D;  2PI2 E;  5M5X B;  2AMC B;  2X6G A;  2XIW A;  1X54 A;  2EZV A;  4XT3 B;  3Q24 A;  1YZ6 A;  3R3O A;  4LFB Q;  1BNZ A;  4QF4 A;  4A3F H;  4C3H H;  1RHP A;  2L1B A;  4DU9 A;  3CCQ A;  3U50 C;  4GOP C;  3J81 L;  1QVF A;  1CKN A;  3G48 A;  3OSO A;  2HUG A;  2UUC L;  1ESR A;  4JCV E;  3SK8 A;  4XIG S;  5IYB H;  4KY6 A;  3G7L A;  1HFG A;  5KYI A;  1C4Q A;  1EY8 A;  1SMX A;  3LGJ A;  3VYR A;  2EXD A;  2N3S A;  3DUZ A;  3KBG A;  5JEA J;  1JOR A;  3K80 C;  3G4S A;  4DV1 L;  4OWX B;  1FYC A;  4K0K Q;  4DV0 Q;  4FF1 A;  3GTK H;  1XMO Q;  3GTM B;  2OWO A;  1EZ6 A;  2R93 B;  2VQF L;  2AQ3 B;  2H1E A;  5A35 A;  3J7Z C;  3BG3 A;  3Q6S A;  4LFC Q;  1QE6 A;  1W6K A;  2DY8 A;  4F87 A;  1HZC A;  1X3F A;  4CGY B;  3D6C A;  1HPC A;  2JE6 I;  5ELC A;  1HUM A;  4PG3 A;  4X62 Q;  5C3E B;  3H3V C;  4EVO A;  2FMC A;  3MZ5 A;  3TQY A;  3J7A F;  3E5S A;  2B2U A;  2V4D A;  3QIA A;  2A69 D;  1C0A A;  1TR5 A;  5IP7 H;  1O80 A;  4A3J G;  3DWP A;  1HQM C;  1HR0 W;  4I7Z C;  4JI2 L;  3HFZ B;  1K83 B;  5C3W A;  3C2P A;  4FXK C;  2FIN B;  1C48 A;  2I0Q A;  4DUY L;  2DNC A;  3SR1 A;  1A2T A;  4IO9 A;  4G7Z C;  5C0X I;  2O5J C;  3GTJ B;  5C44 H;  1FNU A;  4FVM A;  1O7Y A;  1Y8N B;  3NTH A;  3WOE A;  2PW7 A;  3UDI A;  3HZX A;  1MJC A;  4NMZ A;  2NZ1 D;  2ZM6 L;  3H09 A;  2HDM A;  4A3E G;  3W3A A;  2PQA B;  1VMC A;  2EJM A;  3OTO L;  1WTV A;  1D2B A;  2Q2U A;  2TSS A;  3V96 A;  5ELD A;  4DAY A;  5IY0 A;  2N55 A;  1Z47 A;  4IOC A;  3DLL A;  4LF5 L;  3M4P A;  1SE2 A;  2BH2 A;  3M3Y H;  4DK6 C;  4GN4 B;  3K0Y A;  1MJE A;  3IFD A;  2K5W A;  5CV4 A;  3FVQ A;  1TQO A;  2A5H A;  2ID0 A;  1PH6 A;  3GP7 A;  4JPB W;  4DF7 A;  4JI0 L;  3TP6 A;  3KF6 A;  4NP5 A;  4G7H C;  4HIK A;  1EY6 A;  4M8A A;  1MBY A;  1E22 A;  1RIP A;  1EU3 A;  1F9Q A;  5JEA H;  3LWE A;  1S4Z A;  3BJU A;  1Q8I A;  1S5C D;  2JXM B;  4KKS A;  1CK1 A;  1EQR A;  4DR7 Q;  1H9S B;  1YNN C;  5ELE A;  1ET9 A;  1R4Q B;  2RHQ B;  3SGI A;  1K0S A;  2OT2 A;  2DGY A;  2L11 A;  2KA7 A;  5C4H A;  4EX5 A;  5IP9 H;  2N78 A;  3HOU B;  3G6J B;  3S16 B;  3GTP H;  2CH4 W;  2SDF A;  3KUP A;  5D3I B;  1NSN S;  1O7Z A;  2M9V A;  2UXB Q;  4AYB E;  3URY A;  1STE A;  3T56 B;  1QZG A;  2A1A A;  2B2T C;  4KHV A;  4IFD I;  5C3X A;  4WJ4 A;  3QG1 A;  2WB1 B;  4TVA B;  1TWH H;  1GOZ A;  5DNF A;  2R93 G;  4IQZ A;  2L55 A;  4Y7N H;  4RHR A;  4EGV A;  2F52 A;  2E2H H;  4JI3 Q;  1ASZ A;  2IHF A;  3J80 L;  1A0I A;  3DM3 A;  1SE4 A;  1KAB A;  5C3E G;  5EAY A;  3F1Z A;  1WYD A;  4A93 H;  2AWO A;  2HQE A;  1A2U A;  4S3S A;  3RLN A;  1EWH A;  3BU2 A;  1M4V A;  2Y0S E;  5AFW A;  4KJO A;  2UUB Q;  4JBJ A;  1DJR D;  1F9R A;  3PUY A;  1IYV A;  2EDG A;  1B50 A;  5FLM G;  4Y52 H;  1PH8 A;  1BOS A;  2RKS A;  4DAV A;  2E74 C;  2AWN A;  5BR8 L;  1VS0 A;  1YNX A;  2B2V C;  3ITP A;  1Y1W G;  4O0A A;  2EY2 A;  3KF8 A;  2WKC A;  5KGU A;  1RD9 D;  4ME5 A;  5JPM C;  1SXT A;  1TWA B;  3CP0 A;  1D6E C;  1YBY A;  5EPL A;  4GNX B;  1JT8 A;  1HNZ Q;  1EFW A;  1XTD A;  2B3G A;  2PZW A;  4X66 Q;  4JI7 L;  3RNU A;  4K2L A;  2DNE A;  2YV5 A;  5E4W C;  2PNH A;  5KYL A;  4X64 Q;  1BO0 A;  3DEP A;  1I50 H;  4LF9 Q;  1TT2 A;  4H44 C;  3PO2 B;  5CBA E;  3PQI A;  4HN7 A;  2K5D A;  5AJ3 L;  3H15 A;  1EWI A;  4PMW A;  3CAM A;  2VY3 A;  3OW2 A;  5LMU Q;  4CJ2 C;  1CHQ D;  3PV0 A;  3HOX B;  2IW3 A;  2O5I C;  3HKZ E;  1VQL A;  1CSQ A;  1PFS A;  3L3O C;  1KDA A;  4RGN A;  1Z9F A;  2EPB A;  2DJF C;  1HNX L;  1BBU A;  3D0F A;  4LF8 L;  1JB3 A;  5HGT A;  2DN8 A;  1HA6 A;  4RAU C;  4DV3 Q;  3PCO B;  5DM7 3;  2HD3 A;  2NN6 H;  3S1R B;  4X3K A;  4QJF A;  3K7A H;  1K8G A;  4HJ8 A;  3CC2 A;  3CKI B;  1I94 Q;  3S1M H;  3FRP B;  5FO8 B;  1PH1 A;  1VF7 A;  4LFB L;  4HR7 B;  3F2D A;  4JV5 Q;  1PMR A;  4F8M A;  1N36 L;  3HOU G;  1JWM D;  3GTQ H;  3NWS A;  4U68 A;  1E1O A;  3PUW A;  1GVP A;  4XYO A;  1XYI A;  4C3J H;  1JJC B;  2QIL A;  4CKB A;  1TXY A;  3CU7 A;  4K0K L;  2AKW B;  1SMY C;  2WB1 G;  4LAA A;  4DV4 L;  4BA1 I;  2K52 A;  5EKI A;  1K9M C;  3B6Y A;  2XGT A;  1LAB A;  2WII B;  1TWG H; 
#chains in the Genus database with same CATH homology
 1E3P A;  2UUB L;  1L1O C;  1E7Z A;  3RR5 A;  3CCU A;  4KHP Q;  2IHE A;  1HZ9 A;  2WP8 J;  4LFC L;  4A3J H;  4BA2 I;  1L2F A;  3KOJ A;  5DLQ E;  5IE8 A;  4JI1 Q;  1Y1V H;  3A5Z B;  4X62 L;  5C44 G;  3J81 i;  3HOW H;  1XPU A;  4B3T Q;  3S24 A;  4A3B H;  3S16 H;  2OTJ A;  4DR4 Q;  4OON A;  2A19 A;  4RG1 A;  1GM5 A;  3HOV H;  5GQO A;  2K50 A;  5GRO A;  2CCZ A;  2VQE Q;  5FJ8 H;  2HT1 A;  4A3I H;  2ZJR A;  5M3M H;  2NVY H;  3ICE A;  4NB3 A;  1X9N A;  1S40 A;  1M90 C;  1VQC A;  2WB1 E;  1RL2 A;  2D0O A;  4IPG A;  3J80 i;  2K14 A;  4GNX A;  1MKH A;  2A8V A;  3NEL A;  1G51 A;  5GAE C;  3CC4 A;  4UPA A;  1YHQ A;  1VQ5 A;  1V1Q A;  3RZD H;  1V9P A;  2YU9 H;  1WI5 A;  2ZTC A;  2EIF A;  4A3E H;  2ALY B;  3MEF A;  3FKI G;  1YJN A;  2HIV A;  4X66 L;  1YHB A;  1HNZ L;  3T1Y L;  4JI6 L;  1XNR L;  3I4M H;  4JYA Q;  2UXC Q;  2XTI A;  4HIM A;  4YWM A;  4RMF A;  3PUV A;  1VQN A;  4HJ9 A;  2MO1 A;  3AFQ A;  3TS0 A;  4X64 L;  2Q2H A;  1VQE A;  4UP7 A;  2NN6 G;  3KF6 B;  2RF4 A;  4LF9 L;  3H0G H;  1GD7 A;  1SLJ A;  2MO0 A;  2MNA A;  5LMN L;  1IBK Q;  3W1G A;  2B63 G;  1VQP A;  3CCM A;  3L0O A;  1PH7 A;  4UY8 C;  5IWA Q;  3VDY A;  3IRB A;  1EIF A;  1SRU A;  1UE6 A;  3CF5 A;  4JI8 Q;  1NBW A;  5LMU L;  3Q8D A;  1XJV A;  3GTL H;  3KDF B;  3PUX A;  4OX9 L;  2VL6 A;  3S17 H;  4GOP B;  4B3M L;  2VUM H;  3J81 j;  4X65 Q;  1Q1E A;  3PO3 H;  2KHI A;  2NN6 I;  4A3L H;  3KFU A;  2E2J H;  1LYL A;  4APV A;  5JEA G;  3TRZ A;  3PO2 G;  5C4X G;  3A74 A;  4JBM A;  1Q1B A;  3J7A 5;  4DV3 L;  3EN2 A;  1YJ9 A;  2JA9 A;  3D31 A;  3F2C A;  2UU9 L;  4H02 A;  2CWP A;  4YY3 Q;  5M5Y H;  1I94 L;  1XPO A;  4NPS A;  3UDX A;  5M5X H;  3HOX G;  3S1Q H;  2K75 A;  2NVQ H;  1MIU A;  1EOV A;  5IP9 G;  2UUC Q;  1W3S A;  1BBW A;  4JV5 L;  3M7N A;  2JA5 H;  4LUZ A;  5ELN A;  2F4V L;  4JOI A;  4P73 A;  1KC8 C;  1VQH A;  4QL5 A;  1IBM L;  4KHZ A;  1CKN B;  4IPC A;  4A3K H;  4AQY L;  1XNQ Q;  4DR2 Q;  1YHA A;  3HKS A;  4DAM A;  1N32 Q;  4YCU A;  2QEX A;  2ATW A;  3CCE A;  4DV1 Q;  4BBS H;  1NTG A;  4KI0 A;  3CXC A;  1VCI A;  3MXN B;  4A4I A;  4TQU S;  5IYC H;  3H3V I;  3EIV A;  3I2Z A;  3U4Z A;  4A3I G;  1PA6 A;  1HR0 L;  5H1S E;  4OO1 I;  1Q8K A;  4AIM A;  2VQF Q;  2F3I A;  1D7Q A;  4YHH L;  4LF4 Q;  3GTM H;  4JI5 Q;  4A75 A;  1KRT A;  1UE7 A;  2E5L L;  4NXM Q;  3M85 A;  2OQ0 A;  3GTG H;  1BVS A;  2R93 H;  2JEB I;  1OXU A;  4WJ3 M;  4DV7 Q;  2FXQ A;  4DV5 Q;  4KHP L;  4A93 G;  3CPF A;  4LW1 A;  1Q7Y C;  2JJQ A;  4IOA A;  1KD1 C;  4JI1 L;  2B29 A;  2UUA Q;  4B3T L;  5C3E H;  1PH5 A;  3NEM A;  4DR4 L;  2PI2 A;  3K81 C;  2OTL A;  1YEZ A;  1HZB A;  4ME3 A;  1X6O A;  4YCW A;  1Q86 C;  3M4O H;  4IFD J;  2VQE L;  4HJ7 A;  4IPD A;  2MFI A;  3HOZ G;  3RZO H;  2OQK A;  4JI2 Q;  3CPW A;  4GLV B;  2NVT H;  3I4N H;  4MZ9 A;  2R92 G;  1IL2 A;  2GN5 A;  4HJA A;  3U4V A;  1YVC A;  4DK3 C;  4DUY Q;  4A3C G;  1X65 A;  1K83 H;  2BA1 A;  3M9B A;  1YIT A;  5FLM H;  1S3O A;  1PYB A;  4JI4 Q;  4MNO A;  3E9I A;  4LF6 Q;  1UWV A;  4B3S L;  5HY6 A;  4JYA L;  1K73 C;  2UXC L;  2KEN A;  1CKO A;  1N34 Q;  3PO3 G;  4A3L G;  1FJG L;  3GTJ H;  4HIO A;  1KIX A;  1VQ8 A;  2JK8 A;  1EFW A;  1PHJ A;  1PV4 A;  2IY5 B;  2ZM6 Q;  5JJK A;  2YTV A;  1AH9 A;  4DR5 Q;  3PIO A;  1K0R A;  1B8A A;  2JA7 G;  3NBH B;  4BY1 H;  5IYD H;  4L5Q A;  1D8L A;  4AYB G;  4DR1 Q;  3I55 A;  3OTO Q;  5AJ3 Q;  4PZ8 A;  1IBK L;  1Y14 B;  2NVX H;  4DR3 Q;  2PMZ E;  1HZA A;  2CQO A;  1K8A C;  2YTY A;  1EIY B;  3KDF A;  1WOC A;  5IWA L;  2HHH Q;  4OWT B;  4GOP A;  3RN5 A;  2HQL A;  4BY7 G;  4JI8 L;  4YWL A;  1OTC A;  2JEA I;  1V43 A;  3G71 A;  1IBL Q;  4B3R Q;  2CKZ B;  4R1J A;  4FDB A;  1JMC A;  4LF5 Q;  2R6G A;  4DAY B;  2E8G A;  2R7Z G;  1LM0 A;  4X65 L;  1PH3 A;  1XMQ L;  3S2D H;  4DUZ Q;  2V1C C;  4QIW E;  2D62 A;  1GKH A;  4XTC S;  2PI2 E;  3ULL A;  3ULJ A;  2AMC B;  1X54 A;  2Q2I A;  1YZ6 A;  1QVG A;  4LFB Q;  4LFA Q;  1OXT A;  2Y0S G;  5LMN W;  4BBR H;  4YY3 L;  2QA4 A;  4AH6 A;  4JI0 Q;  4UP9 A;  4A3F H;  4C3H H;  1QVF A;  4A3G H;  3CCQ A;  2VS1 A;  3U50 C;  4GOP C;  1CKN A;  3G48 A;  4X6A H;  4HJ5 A;  1VQ7 A;  2UUC L;  4JCV E;  4R4O A;  1VQ4 A;  4XIG S;  3KJP A;  1PYS B;  2IT1 A;  5IYB H;  5M3F G;  4OXP A;  1YJW A;  2RCN A;  1XNQ L;  1L1O B;  1JE5 A;  2Z6K A;  3NEN A;  4GNX C;  1S72 A;  1KXL A;  1SMX A;  3LGJ A;  1L0W A;  2EXD A;  4DR2 L;  2N3S A;  1N32 L;  3ULP A;  5JEA J;  4DPG A;  3K80 C;  5M5W H;  3G4S A;  4DV1 L;  4OWX B;  4A3M G;  4K0K Q;  1WCM H;  4DV0 Q;  3TRE A;  5J3B A;  4DR6 Q;  3GTK H;  1XMO Q;  2UXD Q;  4GKK L;  2OWO A;  2YTX A;  1R9T H;  1EQQ A;  2VQF L;  1HJP A;  1AE2 A;  4YCV A;  4LF4 L;  2VW9 A;  4BXX H;  2JA8 H;  2JA6 G;  1C7Y A;  3HOY G;  3J7Z C;  4NXM L;  4LFC Q;  2ZJQ A;  1PVO A;  3T1H Q;  3HOU H;  1OXV A;  3K8A A;  1HZC A;  5FLX c;  1X3F A;  4R4T A;  4DV5 L;  3KYH C;  4DV7 L;  1T9H A;  2Z6K C;  3K7U C;  3RN2 A;  2JE6 I;  4X62 Q;  4HID A;  4PG3 A;  2N49 A;  2D0P A;  3S15 H;  1KRS A;  1E1T A;  3TQY A;  1FGU A;  1J5E Q;  2I5M X;  1N8R C;  2UUA L;  4OO1 G;  1A8V A;  3CME A;  3CD6 A;  1C0A A;  5E7N A;  3AQQ A;  5IP7 H;  1IXR A;  3A0J A;  4NXN Q;  2IX0 A;  5GAD C;  4A3J G;  1PH4 A;  1FL0 A;  2KCT A;  3JAM c;  1HR0 W;  4JI2 L;  3HFZ B;  1Y1V G;  1LUZ A;  3HOW G;  1I6H H;  1HNW Q;  4DV6 Q;  4A3B G;  1N33 Q;  3FHW A;  3HKZ G;  2I0Q A;  4LWC A;  4DUY L;  3HOV G;  1KQS A;  3ERS X;  5FJ8 G;  2KHJ A;  4IO9 A;  4JI4 L;  5GAH C;  3F2B A;  4P71 A;  5M3M G;  5C0X I;  1C9O A;  1VQD A;  3OYY A;  4P72 A;  5C44 H;  3KJO A;  1SE8 A;  4LF6 L;  1UEB A;  4C3I H;  1Q12 A;  1VQ6 A;  1YI2 A;  3UE0 A;  2RHS B;  1KAW A;  4JBW A;  4PZ6 A;  3UDI A;  1MJC A;  2BH8 A;  1O7I A;  2R7D A;  2KCM A;  4JOI C;  3STB C;  2ZM6 L;  1SRO A;  4A3E G;  1QZH A;  2PQA B;  4DR1 L;  3I4M G;  3OTO L;  3S1N H;  3PF4 A;  1A62 A;  2AHO B;  4DR3 L;  1NMG A;  2Q2U A;  5GAG C;  4P75 A;  1VQ9 A;  5BR8 Q;  2HHH L;  4OWW B;  5IY0 A;  1W2B A;  3FKI H;  1Z47 A;  4IOC A;  2JQO A;  3DLL A;  3CCS A;  1IBL L;  1J6Q A;  3H0G G;  4B3R L;  1DGS A;  3W5O A;  4LF5 L;  3M4P A;  1BKB A;  1I5F A;  3I56 A;  2BH2 A;  1Q82 C;  4DK6 C;  3M3Y H;  4GN4 B;  4JC0 A;  1MJE A;  3W1B A;  1VQF A;  4DUZ L;  3KF8 B;  5C4J H;  3PUZ A;  1PH9 A;  1WCM G;  1TWA H;  4IJH A;  4L5R C;  4A3D H;  4JI7 Q;  2YYZ A;  2LXK A;  2B63 H;  2ID0 A;  1PH6 A;  4LFA L;  2VUM G;  5JJL A;  3E0E A;  3J81 c;  1KHI A;  2K5N A;  4JI0 L;  3FP9 A;  3KF6 A;  4BXX G;  3L7Z C;  3GDE A;  2ZJP A;  4HIK A;  4GN3 B;  1Y1W H;  1GO3 E;  4A76 A;  1KL9 A;  1E22 A;  1RIP A;  2VNU D;  1TWF H;  3J80 c;  2N8N A;  4R4Q A;  4GS3 A;  1JJ2 A;  3PIP A;  4KLK A;  1M1K C;  3BJU A;  2DUD A;  3CC7 A;  1AE3 A;  4GLX A;  2VZA A;  1P16 A;  2I5H A;  1EQR A;  1ASY A;  5IP7 G;  2I5L X;  4DV0 L;  2JA5 G;  1UE1 A;  2KBN A;  4DR6 L;  4DR7 Q;  2RHQ B;  1X3E A;  3SGI A;  4A3K G;  1XMO L;  1HNX Q;  3HOX H;  3ER0 A;  4LF8 Q;  1OXS C;  4O2D A;  2DGY A;  2E5L Q;  4LF7 Q;  1YIJ A;  4EX5 A;  5IP9 H;  2N78 A;  1NE3 A;  1WFQ A;  2LXJ A;  3AFP A;  3E9H A;  2GVB A;  4BBS G;  3GTP H;  1CUK A;  4DV2 Q;  5IYC G;  3T1H L;  2BA0 A;  3BZK A;  3CQZ H;  4LNQ A;  1U5K A;  4GKJ Q;  3JC6 6;  2UXB Q;  1G29 1;  4AYB E;  2GVA A;  4PZ7 A;  3S1R H;  3AYH B;  4IFD I;  1QZG A;  2A1A A;  3RLF A;  4DNI A;  4WJ4 A;  4QY7 A;  1J5E L;  4TVA B;  3PF5 A;  1TWH H;  1N36 Q;  2K4K A;  2R93 G;  4R4C A;  1N9W A;  1FVI A;  2NZO A;  4NXN L;  1G6P A;  2WAQ G;  4MTN A;  4J15 A;  3KLW A;  4Y7N H;  3CW2 C;  1SR3 A;  1EUJ A;  2F52 A;  2E2H H;  4JI3 Q;  2IX1 A;  1ASZ A;  2IHF A;  1HNW L;  2ZTD A;  1A0I A;  3DM3 A;  4R4I A;  5C3E G;  1OXX K;  5EAY A;  4DV6 L;  3F1Z A;  1JB7 A;  1N33 L;  4EQ5 A;  1WYD A;  2CFM A;  2AWO A;  2L15 A;  4A93 H;  4DV4 Q;  4UP8 A;  4B3S Q;  3RLN A;  1HH2 P;  2C35 B;  3BU2 A;  2LSS A;  2E2I H;  3CCL A;  1FJG Q;  3I4N G;  1K3R A;  2Y0S E;  3TEH B;  1QUQ B;  5C0X J;  3UDG A;  2UUB Q;  5ELO A;  4JBJ A;  4JG2 A;  4YWK A;  4JI5 L;  1SFO H;  2PQA A;  3S14 H;  1SN8 A;  3PUY A;  1VQG A;  3HOZ H;  1X55 A;  5FLM G;  4L5S A;  4A3D G;  1PH8 A;  1VQJ A;  3WWV A;  4Y52 H;  5K36 G;  4QGU A;  3CMA A;  2WAQ E;  1X56 A;  2R92 H;  1UE5 A;  4LUV A;  5C0X G;  2AWN A;  4A3C H;  3M4Q A;  1VS0 A;  2ZTE A;  5BR8 L;  1YNX A;  2K5V A;  4GN5 A;  4JBK A;  3PGZ A;  3I4O A;  1Y1W G;  4POG A;  5IYD G;  4BY1 G;  4O0A A;  1XMQ Q;  1WJJ A;  1I3Q H;  3CP0 A;  1U0L A;  1IZ6 A;  1YBY A;  4GNX B;  2QGQ A;  2JA7 H;  1JT8 A;  1HNZ Q;  4DKA C;  1Q46 A;  1XTD A;  2B3G A;  1P8L A;  4L5T A;  1CSP A;  3RLO A;  4X66 Q;  3T1Y Q;  4JI6 Q;  2Q2T A;  4JI7 L;  2ASB A;  1XNR Q;  2MQH A;  1VQI A;  1VQA A;  3RNU A;  2YV5 A;  1PH2 A;  2PNH A;  4X64 Q;  4BY7 H;  3ZJY C;  1N34 L;  1NJI C;  4ALP A;  1I50 H;  3GO5 A;  3I7F A;  4LF9 Q;  5LMN Q;  1H95 A;  4DR5 L;  1NMF A;  3S2H H;  1VQM A;  2R7Z H;  4POF A;  1A63 A;  3H15 A;  5AJ3 L;  1Q81 C;  1EWI A;  4BBR G;  1B70 B;  4PMW A;  3TS2 A;  3CCJ A;  4QQB X;  3CAM A;  3PSI A;  4A3F G;  2VY3 A;  3OW2 A;  4A3G G;  5LMU Q;  2NZH A;  3GTO H;  3PV0 A;  1NY4 A;  3G6E A;  3UDF A;  4OX9 Q;  3HKZ E;  1VQL A;  1CSQ A;  1PFS A;  4GKK Q;  4B3M Q;  4DR7 L;  3GD7 A;  1VQB A;  5IYB G;  3JAM i;  1Z9F A;  1TWC H;  1HNX L;  1LTL A;  1BBU A;  3BZC A;  3D0F A;  4LF8 L;  4LF7 L;  1E24 A;  1CKM A;  5IT9 c;  5JJI A;  4DV3 Q;  3PCO B;  2WFW A;  2EQS A;  2OCE A;  3U58 A;  2R7F A;  2H5X A;  4DV2 L;  5M3F H;  4QJF A;  3K7A H;  2UU9 Q;  1K8G A;  4HJ8 A;  3CC2 A;  1I94 Q;  3S1M H;  4GLA C;  4GKJ L;  2UXB L;  2ES2 A;  1PH1 A;  4LFB L;  1QVC A;  4IJL A;  3F2D A;  4P74 A;  2HIX A;  3EBE A;  2CWA A;  4JV5 Q;  3L2P A;  4A3M H;  2JA8 G;  2F4V Q;  1L1O A;  1IBM Q;  1N36 L;  3HOU G;  1IYJ B;  1B7Y B;  4AQY Q;  1VQO A;  1EYG A;  2K5H A;  3CCR A;  3GTQ H;  1VQK A;  1E1O A;  3PUW A;  1GVP A;  4C3J H;  3HOY H;  1JJC B;  2JA6 H;  4JI3 L;  3PO2 H;  5C4X H;  3CCV A;  2Z0S A;  4LUO A;  1XPR A;  4IPH A;  4C2M H;  1TXY A;  1HR0 Q;  3K0X A;  3A5U A;  4IFD G;  4K0K L;  5HGQ A;  1JJG A;  2AKW B;  1QUQ A;  4DV4 L;  2WB1 G;  3STB D;  4BA1 I;  3H3V H;  2UXD L;  2K52 A;  4YHH Q;  3UE1 A;  1K9M C;  3B6Y A;  3F8T A;  2XGT A;  1X3G A;  1TWG H;  3AEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...