2F0IA

Crystal structure of staphylococcal nuclease mutant i72l
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0iA00
4DGZA 4QB4A 4KJOA 1EYAA 5CV7A 5CV6A 5KGUA 3P75A 3MVVA 3T13A 4K5XA 4KTAA 2F0QA 4NMZA 4K5VA 4DU9A 1SNPA 5CGKA 3D6CA 1KAAA 1SYDA 1KDBA 1TR5A 2NUCA 3D4DA 2KQ3A 2F0LA 1SNOA 3D4WA 5IGDA 5IODA 3S9WA 1ENCA 2LKVA 3EJIA 5M9OA 1JOOA 5ISRA 1STAA 1KABA 1EYCA 4QMGA 2SOBA 2F0SA 5I6YA 1F2MA 3C1FA 2F0UA 2F0WA 3T16A 1SYFA 4ZUIA 3U9OA 5J39A 4PMCA 2RBMA 4WORA 3TP5A 3NXWA 5IGEA 1STGA 2PW5A 3NK9A 1KDCA 3HZXA 1ENAA 1EY9A 5IOCA 2EY1A 2F0TA 5C4ZA 1SYCA 3D8GA 3NUCA 4NDXA 2M00A 5IGGA 4K6DA 4ME5A 2EYHA 3BDLA 5CV4A 3SK6A 1TQOA 3MHBA 4IZ8A 5DAUA 5C3WA 4PNYA 1EQVA 5KYLA 2SNSA 2F0VA 2F0GA 3SK4A 2EY5A 2F0FA 5C6AA 4K5WA 1JOKA 2F0OA 3LX0A 2F0NA 1U9RA 4DFAA 5CC4A 2PW7A 5JAVA 1F2YA 1SNQA 5E1FA 4HMIA 1II3A 4ZUJA 2F0DA 1EY7A 4IUNA 4RKLA 3MEHA 2ENBA 1A3TA 4I65A 4K8JA 4TRDA 4KJNA 5C5MA 3NQTA 2F0MA 5HURA 4OL7A 4KD4A 3RUZA 1SNMA 3MXPA 3QOJA 3E5SA 1A3VA 2RDFA 4LAAA 4YIJA 4EQNA 5CV5A 1RKNA 4NKLA 4F7XA 4K2KA 4K14A 4N9PA 3OSOA 3TP7A 3QOLA 3OWFA 5CV8A 4B9XA 4DF7A 4J6HA 1KDAA 2F0PA 4MIUA 2F3WA 5K5PA 5HGTA 1SYEA 4KD3A 1A2UA 4WRDA 4G57A 3DMUA 3VA5A 2PQEA 3SHLA 5C3XA 2PZWA 5IGBA 1EZ6A 5CV9A 2EXZA 4H7BA 5I9PA 5IGFA 2EY2A 5IGCA 1JORA 4R8NA 2QDBA 1AEXA 2EY6A 2EYMA 1EYDA 5KEEA 5KYIA 2PZUA 3C1EA 2EYFA 5CR3A 3SK5A 2F3VA 4HTHA 3OMGA 3MZ5A 5IIFA 2F0HA 3P1HA 4IALA 3SR1A 3ERQA 4KY7A 2F0JA 4K2LA 1JOQA 3EROA 3SXHA 4HMJA 4ZQ3A 1IHZA 4B9WA 2OXPA 3R3OA 2F0KA 2HQEA 1SYBA 4KY6A 4RKBA 5J1ZA 4EQPA 5J22A 1STYA 3NP8A 5KRUA 1STHA 3TMEA 4F8MA 1SYGA 2PYKA 1EZ8A 3NHHA 5EKLA 5F2DA 3SK8A 3TP6A 1SNCA 4PMBA 3V2TA 2EYLA 5EGTA 4EVOA 5I6WA 3TP8A 3ITPA 1A2TA 2EYJA 2EYPA 5C4HA 4S3SA 2OEOA 2SNMA 5KIXA 2OF1A 4QF4A 5I9OA 1STBA 5JOBA 2RKSA 4N9TA 1EY0A 2F0IA 3QB3A 2F0EA 2WACA 4J1MA 5C5LA 1F2ZA 1TT2A 4NP5A 1NSNS 4KY5A 2EYOA 4KHVA 2KHSA 4K8IA 5DEHA 5EKKA 3PMFA 1A3UA 1SNDA 3DHQA 4E6IA 3EVQA 4EQOA 5NUCA 1EY8A 3HEJA 5E3FA 1NUCA 1STNA 1EY5A 3H6MA 4KV6A 4ODGA 1EY6A 2PZTA 2O4XA 3BDCA 4ID6A 3OMCA 1EY4A
chains in the Genus database with same CATH superfamily
1RDPD 1WD0A 1LO5D 5CV6A 4DA2A 4RAUC 3T13A 3Q23A 4A3IG 3OYYA 3UDFA 3D4WA 1I4QA 1BR9A 4YCWA 2HHHQ 1PA6A 5IT9E 4N8X1 1S5FD 4TVAB 4GZYC 3O13A 1GHJA 1YNXA 3KK7A 5BN4A 1CKNA 1U4LA 1B7YB 2KCNA 4O0AA 1SYCA 4C3HG 2VQFL 1WOCA 1O78A 5BN3A 2D5DA 3RZDH 2N8NA 2RHSB 5GAEC 2YU9B 3GTOH 4HEDA 2JA5B 1UNSA 1F9SA 5HY6A 1EIFA 2F4IA 2Q8IB 3CC4A 2L55A 4IUNA 4A3JG 1G2SA 4GLAC 1TS3A 3KDFA 3JAML 4C3JB 3E9HA 4A3IB 1YNJC 5CV5A 1LM0A 4A76A 4LF7L 3SEBA 3K5OA 3CCJA 1Q8KA 2FXQA 1A2UA 3G7LA 4G57A 2B63G 3SHLA 3PQIA 5IGCA 1YBYA 1WTOA 4OX9L 1UEBA 4IPHA 4X65L 1NMFA 1CSQA 1PYWD 4H13C 4C3HB 3OMGA 4A3FB 1JICA 1HQMC 2ZXPA 1GM5A 1Y1VG 2HQEA 2KEDA 1I3QH 5C0XH 1XNRQ 5DNFA 4OIKA 4F8MA 1TWHH 4R1JA 4DR1Q 2E2HH 4IFDH 2AQ1B 5COYA 3CRLC 1CA5A 2X69A 2PO4A 5KNBA 1SJHD 2C5CA 4FYDA 3D31A 1Y14B 1G8ZD 3CPFA 3EFXD 3HKZG 1EIGA 1TWAH 1NNXA 1C4QA 4JI7Q 1EFWA 1PYBA 1GUWA 2VQEQ 1GVPA 2BE5D 1QVGA 4EX5A 3OPOA 1G2TA 3P20A 1KC8C 2KCMA 4KN4C 1VQDA 1IL2A 5CGKA 4K5XA 1RJTA 5IODA 2L4NA 4BBRG 1YZ6A 3GTQH 1X55A 2GVAA 5DM73 3RZDB 1WTHA 2QKIC 1YJWA 3T51B 2BA0A 3GTOB 1N34Q 2JJQA 1PH7A 1HNWQ 5AFWA 1B3AA 5CMDA 1O7IA 3TZDA 2OQKA 5DM63 2RCFA 1SNQA 4DAYB 4JI4Q 2BCOA 4TRDA 4B08A 3PO2G 3M4QA 1PXUA 4DN4M 3E5SA 4LFBQ 3A7LA 1KTKA 1PLFA 3H0GG 3F2UA 2ES2A 2WINB 3G71A 2F3WA 1XNRL 3A8KE 1YHBA 2XN9C 4DR1L 5EPLA 2R61A 4YWKA 2EYMA 4POFA 4DV4Q 1I3QB 1XNQQ 3HKZE 1TWHB 2E2HB 4KY7A 3RR5A 1B4OA 2HCCA 3W1GA 2H5XA 3M4OH 4JI7L 1K8OA 4A3LG 2VQEL 4A3MH 5LHY1 4UP9A 1PTOC 3MC0B 2D62A 3VR3A 1TWAB 5ELFA 4PMBA 2EDGA 4EVOA 1D5XC 4KMUC 4MZ9A 4DV5Q 3VR2A 4HJ9A 4YCUA 5IYCH 1EYGA 4RG1A 1DYQA 4A3KH 4TKOB 4M8AA 1PV4A 3CU7A 3LNNA 3Q8DA 2B2WA 2AHOB 3Q24A 5C4XH 4IUTA 2K5NA 4HIMA 1LTRD 1H9KA 4QQBX 3GTQB 2MP1A 4A3DG 3BDCA 4LW1A 3GTGH 1NR2A 2H1EA 1HNWL 2N78A 4B3MQ 2PNRC 3KFUA 4BXXG 3KLSX 3I55A 1XPUA 5M5XH 2F0LA 1O7YA 2HDMA 1YNND 1GJXA 5ISRA 1KABA 4CDCC 2ASBA 5JJIA 2IW3A 3HOZG 2RBMA 4JI4L 1STGA 3V96A 1KAWA 3DEOA 2HDLA 3I8ZA 4A3MG 1VQKA 1C8CA 1AFPA 1SLJA 4LFBL 1WCMH 4DUYQ 4DV3Q 1IW7D 3IFDA 5LL6S 1EEFD 1UAPA 2DY7A 5IYBH 3VYSA 1SN8A 4IUUA 3U4ZA 4A3KG 4RA8A 4ZYSA 5E1FA 1Q7YC 4DV4L 1JE5A 1TS4A 4I7AA 4AYBG 4JK1C 3QOJA 3CC7A 2A6EC 2LXJA 2AMCB 1EY4A 1VQCA 1GUSA 1QOHA 1NE3A 4L6TB 3ULJA 5E4XA 1YI2A 3M4OB 2B2UA 4R8NA 4A3MB 1GO3E 4XIGS 4DV5L 4RH6A 1UE5A 3F1ZA 2FINB 2K50A 3CRKC 3P1HA 3HOVH 1CK1A 2C35B 1LTTD 3EROA 2J0TD 1IHZA 5JJZA 1N32Q 4P74A 1C9OA 2XRQD 4KKTA 1WCMG 4A3KB 2CW0D 4X3KA 2IPKD 3NWSA 5GAGC 2R93H 3NHHA 2B8GA 1FR3A 3HGBA 1ET6A 5C4XB 4AYBB 1E1OA 3HFZB 2OEOA 5EPKA 4A93H 3MA2B 2QA4A 2E2DC 4FP5D 3QB3A 3GTGB 1IXRA 5M3FH 3V05A 1Q86C 2A6HC 2MUYA 4AIMA 5M5XB 2FMMA 1JCKB 1STNA 3S1NH 1I94Q 1FJGL 1VDZA 4L8JA 4N8FA 1WD1A 3TSSA 4DUYL 2UU9Q 2K4KA 1HXYD 1N33Q 4L5RC 5IGDA 3A56A 1ESFA 1SSOA 1PZJD 3M7GA 1RODA 4R9WA 5ELNA 1WCMB 5C0XI 3BYTB 3S17H 4IPCA 2F0WA 2ZXRA 2J4XA 4LWCA 3I3CA 4PMCA 3T53B 5IGEA 4LUOA 2KA7A 4AYBE 4IFDI 3A5ZB 5IOCA 1I6HH 3NUCA 2R93G 1PFMA 3LWUA 1Q46A 1VMCA 2NZHA 1PH6A 2XVSA 5C3WA 3WOEA 4L5SA 3CCLA 3VR5A 2JA8G 3TRZA 2JEBI 2N88A 2WAQB 3R2IA 1T9HA 4ZK9B 1V1PA 5CC4A 2I0QA 4NXNQ 4ZUJA 3PO3H 2F0MA 5M5WH 3FP9A 2XGTA 1LT6D 3MXPA 3CCMA 1QNUA 1Y1WH 5D3IB 1RKNA 1EUJA 1CQFA 3N6RA 4PMWA 3TP7A 3FDTA 1G91A 5IP9H 4LMQD 3HOVB 4FO2A 4IOAA 4MHEA 3GTMH 3AU7A 2O2LD 4L63B 3VYRA 4PG3A 1V43A 1L1OA 3UDGA 2WIIB 4JI8L 2B2VA 1W2BA 4FXDA 3J80E 2K5HA 1PRTD 4HJ8A 2R93B 2R7ZG 1UE7A 4LF5Q 2A74C 3ERQA 3SR1A 3KJPA 1TKWB 2EPBA 3VYTA 2GVBA 1AZQA 1PRTF 4A93B 4DK1A 4JYAQ 3UDXA 2A69C 3CCEA 1ILPA 1AP0A 1SEBD 4I7ZC 5J22A 1VQFA 3L0OA 2B2UC 1I94L 4IJHA 5EKLA 2E76C 3SK8A 4B3RL 5M3FB 4YWMA 3ITPA 3J7AF 1I4XA 3GTKH 4FNFA 2AQ3B 4GOPA 2UU9L 4KKSA 1R4PB 3S1NB 1N33L 1EY0A 3EIVA 2F0IA 4DUZQ 1PFBA 4JI3Q 1X3PA 4KY5A 3KLRA 1IBLQ 2Q2UA 2AWOA 1DOMA 4EQOA 4DK0A 3AFQA 4BY1G 1EY5A 4IPDA 1AW7A 1JJCB 1E2ZA 3HOXG 3K81C 1VQOA 3S17B 2ZT9C 3CW2C 1BUVT 2NTTA 2Q2HA 4A3BH 1HR0L 3ZYYX 2Z0SA 1X54A 1SNOA 1WFQA 3HG9A 3ONAB 1LUZA 5BR8Q 1EOTA 3VYUA 1I6HB 4OGQC 3VA7A 3NTKA 2E2JH 3KLWA 3CD6A 3A5UA 1SYFA 2CWPA 4NXNL 4DAVA 3ND8A 2NBFA 3H94A 1F2LA 3PO3B 4LNQA 2HQLA 5M5WB 1K83H 5L37A 3AB9A 2L9HA 3BJUA 1Y1WB 2NTSA 4UP8A 3PUVA 4C2MH 2EQSA 3HOUH 2F0OA 3M7NA 2IHEA 3KF8A 1X3EA 2MO0A 3M4PA 2ENBA 1IKLA 3NQTA 5FLXc 3GTMB 3RUZA 4XQQA 3W2DA 2UXBQ 2HT1A 2RCNA 1CHPD 2UXCQ 5JJKA 3LWEA 3OWFA 3M85A 4JYAL 3STBC 4WRDA 5E4WC 3QO2A 1OXUA 1B3QA 2VUMH 2B2TA 1ZXTA 1BCPD 5EBCA 2UUCQ 4U68A 4CDFC 3Q6SA 5KNDA 1BCPF 2F0HA 2PCFB 4P72A 5EBDA 2KHJA 1CI3M 2RSNA 1S72A 4DUZL 2PI2A 2ATWA 3GTKB 4HMJA 5EAYA 1A15A 3NSWA 5ELBA 4LFCQ 5FLMG 1TWCH 3R3OA 1QVFA 4Q0FA 1IBLL 4ZRZA 1LABA 2F0KA 1SYBA 4M1UB 3T1YQ 1PH2A 4Z9CB 1L1OC 2VB2X 3NWTA 4ZAIA 5IYDH 2B2VC 4QL5A 1VQPA 5KNCA 1XJVA 4X3SA 2PPBC 1B70B 1STBA 1AE3A 1QJOA 3GP7A 3R93A 1HNXQ 5A2QE 3E9IA 2JK8A 1NCVA 5BR8L 1VQ4A 4A3BB 3E0EA 2KHSA 4KHVA 1K0SA 5A2QL 1EY8A 1SFOH 3IAYA 3H6MA 3SGIA 1K0RA 3A0JA 2E2JB 2O4XA 4GOPC 3TS0A 4DNTB 4KJOA 4JI1L 3OTOQ 5HGQA 1XPRA 1V9PA 2KQ3A 1UEAB 4OXPA 3S9WA 4RHSA 2KECA 1XYIA 2QDLA 1EYCA 2EE1A 2SOBA 3C1FA 2VS1A 1ENFA 3MXNB 1K83B 1CM9A 1DOLA 1CKOA 1KDCA 1ENAA 2R92H 1VCIA 4C2MB 3HOUB 1H9RA 1FYCA 3GTJH 1VQ6A 4BBSH 2E74C 4LFAQ 1G6PA 1EU4A 2BDNA 2R3ZA 5IYDG 2UXCL 3IRBA 1VF7A 2CQAA 2ICIA 2K5WA 4IZ8A 4PNYA 2Q2IA 5FO7B 4C3JG 1PTOD 2XRSD 1KLGD 2VB3X 1PH4A 4K5WA 2L15A 2CWAA 1PTOF 4DAMA 1I4RA 2OT2A 2Q8TA 4RKLA 5JJLA 4JI5L 2UUCL 4KJNA 1DJRD 2VUMB 4KD4A 1C48A 2Y0SE 4YIJA 3NBHB 3NENA 3AFPA 4F7XA 5IT9L 4R4QA 5D65A 2K32A 1B44D 1VQIA 2KENA 3QOLA 4LFCL 4UY8C 4R4CA 3T1YL 3GTLH 1BBUA 1BBXC 4A3FG 4HSPA 4DR3Q 2EXZA 1BF4A 2ZJQA 1X6OA 4XT3B 3W1BA 1TWCB 3HOWH 1J5EL 1V8QA 4O42A 2K03A 1YJNA 2D9UA 3SK5A 3GTPH 1G6ZA 5IIFA 1HNXL 2F03A 2YV5A 1SE3A 2IWHA 4A3EH 1E0BA 1NTGA 1B9NA 2A68C 4NB3A 5AJ3Q 1PDQA 4JBKA 2B2TC 3R2TA 4DKAC 3TP6A 4OO1H 1PH9A 5K36G 2QW7A 3J80i 1V1PB 2G9HD 5EGTA 2EYJA 2EYPA 1FNVA 1Y8NB 4S3SA 5KIXA 4DV1Q 2E75C 1UUPA 4QF4A 1SFOB 3OTOL 1O7LA 1NR4A 3DEPA 2JA6H 2RHQB 3H09A 2OQ0A 4C3IH 2D0OA 4NPSA 5DLQE 2B29A 5IP7H 2CKZB 3DWPA 1VQ8A 3EVQA 4IO9A 3G6EA 3T4AC 2UUBQ 3HP3A 1W3SA 4A4IA 1L1OB 3MFGA 3J7A5 2A6ED 1UWVA 4LFAL 1SXTA 4KTAA 3TREA 1VQAA 3I56A 1U4PA 3D4DA 1HPCA 2NUCA 3MEFA 2R92B 2IX3A 2C9OA 3GTJB 3EJIA 4BBSB 1JOOA 1HTPA 1H95A 4LK1C 4EQ5A 2YTVA 1A6XA 2HHHL 4H44C 4AH6A 1ICWA 2JXMB 2IX0A 1WJJA 3E3XA 3D8GA 2DN8A 1UE1A 4YHHQ 4OO1G 4GOPB 1QE6A 2RDGA 1D1IA 4DR5Q 2RVLA 3MHBA 2A5HA 4DK6C 1EQVA 4CJ2C 3TBIB 5T1GA 2HUGA 3CHBD 5FKAC 2ID0A 2DNCA 3PUZA 5C6AA 2FFKB 3I4OA 3VR4A 1VF5C 1X3FA 3GTLB 5C5MA 4I65A 1PH5A 1L0XB 4OL7A 2JA7H 1IYVA 3HOWB 2OCEA 2Z6KA 5C0XG 3G48A 4K2KA 1DXMA 5I2YA 5AJ3L 3GTPB 1RL2A 5CV8A 2A6HD 3FRPB 2F0PA 3BYYB 3J81i 3K58A 1HQRD 4IFDG 1WTPA 4A3EB 3CC2A 4FF4A 1AEXA 3S14H 2YYZA 2DJFC 2BA1A 1VQLA 3MZ5A 4IURA 5C44H 3EN2A 2BH2A 3SXHA 1PH3A 1JT8A 3JAMc 4DR7Q 2JA6B 4G7HC 2L5TA 2AKWB 4C3IB 4LF9Q 1PRTB 2UUBL 3KF8B 1A2TA 1HTLD 4GKJQ 1H9JA 3Q0AA 1SE8A 2MJ8A 1EL0A 4A3CH 3BVMA 2IY5B 1RD9D 4JOIA 3M4YA 1B50A 5C5LA 3H3VH 4NP5A 2NVQH 2Z4HA 4YCVA 1ZYRC 4K8IA 4JPBW 1SNDA 3BVZA 2JA7G 1D5MC 2NWGA 4UDUC 3J7AV 3I91A 1VQ9A 1S5DD 2BDOA 2MPMA 4YHHL 1S5CD 1VQHA 4EGVA 3P75A 1Y8PB 4NMZA 1GUGA 4DR5L 1SNPA 4DK3C 1SYDA 3KUPA 2EJMA 4L5QA 2E5LQ 4RGMA 4XTCS 1EFID 1SMXA 5C44G 1QZGA 2F1MA 2MHVA 3WDNA 2FMCA 1N9WA 2A73B 1IL8A 2EY1A 3RN2A 4JC0A 5LMUQ 1RF2D 1N34L 1FVIA 1K3BC 2A69D 4GKKQ 4RGOS 2X6LA 3S1MH 5KYLA 2NB0A 3A7AB 3EA6A 2JA7B 3ND9A 2F0GA 3DUZA 1RIPA 5JEAJ 1II3A 1EY7A 1TVXA 3FPUB 3S1QH 1A3TA 3U9SA 2K7VA 2EIFA 4XT1B 4KK7A 2RDFA 4C1NI 1PZID 3CKIB 3S14B 3L3OC 2PI2E 2GA4B 4HIDA 1G291 2ZTCA 4J6HA 1Y69U 4XXEA 5C44B 1SYEA 4DR4Q 3DMUA 4CKCA 2L11A 2PQEA 4TSSA 1I5FA 1V1OA 4MN3A 4LF9L 1JORA 5IGFA 2VY3A 4HIOA 3X3MA 3G6JB 4O1NA 1YVCA 1OO9B 2DGYA 3F2CA 1EYDA 5IYCG 4LF8Q 3W3AA 1F9QA 4DXGA 2PMZB 1QILA 1S5ED 2Z6KC 3OIPA 2A1AA 1XNQL 5C4XG 1MBYA 2OXPA 4PV1C 4XYOA 4X64Q 1LTSD 5GADC 4JI2Q 3MWYW 3I4MH 1VS0A 2NVQB 3V2TA 1JWMD 1RHPA 5I4DA 2MO1A 4QCLA 2RKSA 3DLLA 1LTID 4J1MA 4FF1A 2E5LL 5DEHA 2IL8A 3ICEA 4DV2Q 1XPOA 2X6GA 4MTNA 1GKHA 1A0IA 3U4VA 3KBXA 1OXTA 1B9MA 1MGSA 1EY6A 2LFNA 3MXNA 1R4QB 1D1KA 1BOSA 3AEVA 5LMUL 4JOIC 1KL9A 3I7FA 4ZKBB 4K5VA 1FL0A 4O2DA 4GKKL 5IYBG 1XTDA 1XWEA 1P16A 2K5QA 4B3ML 3I4NH 1MHWC 2BE5C 2VL6A 4DR2Q 1I6VC 3VDYA 2K05A 3RMHA 3OW7A 4OO1I 3D3RA 3S1MB 2PW5A 1EY9A 3M3YH 2WAQG 3K7UC 1Z6HA 2G9DA 4FVMA 3I4MG 1N36Q 3S1QB 1QB5D 5CV4A 4BA1I 1SR3A 1FGBD 2K5VA 5J3BA 3NBHA 2VW9A 4DV3L 2SNSA 4IQZA 1O7ZA 5E7NA 1Q1EA 3RZOH 5G3LD 4RHRA 2B2WC 5JAVA 1F2YA 4JBJA 1EWIA 1KLUD 4UHVA 3HOVG 3S15H 2CFMA 4P2CB 5G3LF 4P75A 2Z4IA 4OHJA 2UUAQ 4HIKA 5M5YH 1SMYC 1E22A 2KJXA 4B9XA 4DF7A 1BKBA 2H4OA 5HGTA 4X64L 4JI2L 2B8FA 1TWGH 1EZ6A 4HCEA 5EKIA 4A93G 3PUXA 5KEEA 2M9VA 4K6LA 4X66Q 3C2PA 4KLKA 4NW2A 2B39A 3I4MB 1CTMA 5M3FG 1I50H 3EQLC 4K2LA 1LT4D 5ELOA 4ZQ3A 4OEMB 3CCUA 4DV2L 1P8LA 1DONA 5CORA 4LF4Q 2ZM6Q 1STHA 4HCSA 1KRTA 3CCQA 1N32L 1EZ8A 3SDZA 4BWGB 2WV6D 2MQHA 5FLXE 5C3EH 2UXDQ 3KF6B 3A74A 2K52A 1D6EC 1QUQA 4K0KQ 2Q2TA 2K33A 4N9TA 1EWHA 3CP0A 2VXWA 4PZ7A 5I2XA 3S2DH 1D5ZC 4GLXA 1GXDC 1NSNS 3X3NA 1B8AA 1CZGA 4DR2L 1X3GA 3DHQA 2Z8LA 1IBMQ 1ML0D 3J80L 1EQTA 3I2ZA 4QUCA 3I4NB 2WAQE 4ULLA 1JJ2A 1QZHA 1PFNA 3TDQA 3FKIH 1UE6A 1M4VA 1WTQA 1PMRA 5FO8B 3IL8A 4GS3A 5JEAH 3M3YB 1LTAD 2L12A 4XQJA 2Z1CA 1Q12A 3PO3G 2RQXA 5CYUA 1LTLA 5ELEA 3PF4A 4WORA 1SBBB 1BVSA 1TU2B 2OTLA 1Y1WG 3A54A 3RZOB 3A55A 1CHQD 3D4RA 3K5NA 4DR6Q 4ME5A 4QIWB 2UUAL 1M1KC 2KCCA 5IP9G 1ICFB 1YNJD 5C3EG 1H9SB 3H3VI 3S15B 2WB1B 2B2YA 2F3IA 1CT1D 4UAIA 1JOKA 5M5YB 3HRZC 2D0PA 1GUNA 1HH2P 4X66L 1ONLA 1TWGB 2DJGC 4FXKC 4Y52H 1K9MC 1IW7C 2XSCA 3K5LA 5FOBB 2KEEA 2E8GA 1WTVA 3QWNA 5K5PA 4DV6Q 4L5TA 4KD3A 2ZM6L 1I50B 5C3XA 5IGBA 3BU2A 4DPGA 2NN6H 2OWOA 3D6WA 3KYHC 2UXDL 1PZKD 3OOCA 5CR3A 3J81E 2EXDA 1YEZA 4K0KL 1HZAA 4Q5VA 3K8AA 5C3EB 1VQJA 1BDOA 4F88A 5GAHC 2IHFA 4LF5L 2YTYA 4HSVA 3OHXC 3PIO3 2QF7A 2QEXA 1C0AA 3NP8A 3S2DB 2PYKA 2JP1A 2N3SA 4A3BG 4GNXB 4BA2I 4Y7NH 3HKSA 1EIHA 3F2BA 1IYJB 4MTKA 2FJ2A 1MIUA 2WACA 1QCBD 3FKIB 1EQQA 2EYOA 4X3TA 3AMUA 3DM1A 3BZCA 5EKKA 4V190 1EWCA 1TY0A 4JI3L 3OW2A 5NUCA 5E3FA 1IKMA 3M9BA 2PZTA 2K5DA 3I73A 4ID6A 1HCZA 1HZBA 4DR6L 4B3TQ 4PZ6A 2E2IB 4HJ5A 2B3GA 1KDBA 1TR5A 3NELA 1D8LA 1PYSB 3HOUG 4TQUS 1J6QA 1STAA 2P5ZX 2MGSA 2LMCB 2F0SA 3R8BA 3U9OA 5JPMC 3HZXA 3K7AH 3S2HH 1A63A 3HOYH 4JI6Q 1XX8A 2BOSA 4X6AH 1FGUA 5FO9B 2EYHA 3EBEA 4X3UA 1SE2A 2VUMG 1LLRD 4ZCKA 1TS2A 4A75A 5BN5A 4J8QA 2EZVA 3QJYA 3PGZA 3NTIA 4GN3B 3GD7A 1K8GA 3L2PA 1JWSD 2O5IC 4APVA 3F8TA 1TIID 2CH4A 2XTIA 1G51A 2SDFA 4N9PA 2LSSA 5JVH3 1MD2D 2UXBL 1JB3A 2B2YC 4JBMA 4OX9Q 2ICEC 4X65Q 1JC7A 5CV9A 1VQNA 1WVLA 2EY6A 2PZUA 3TS2A 1MI2A 4A3JH 1B2TA 4RFBA 4Y7NB 3PIP3 1QWYA 4B9WA 4RGTA 1NJIC 1KHIA 3DWQA 4ZLTF 3A8JE 5F2DA 1CFMA 1VQEA 2EYLA 1KD1C 2B63H 4JG2A 1PRTC 3FPPA 4G7ZC 3RN5A 2SNMA 5H1SE 4OWWB 4B3TL 3NTHA 4KKUA 4DXFA 5I9OA 2ZJRA 4ILWA 2QGQA 2F0EA 5D14A 4CDDC 4E6IA 3PCOB 1Z7TA 2XWJB 4H0LC 2WFWA 2R92G 4J15A 1NUCA 1Y1VH 4U673 5M3MH 4BBSG 3C3LA 3SVMA 4JI6L 1CSPA 3L7ZC 1GHKA 1EYAA 3K7AB 3S2HB 1KNAA 3UDIA 3S24A 3JAME 1JWUD 3HOYB 1ENCA 1PH1A 3ZJYC 3PV0A 4H02A 5I6YA 2F0UA 2ZTEA 1YIJA 2ZTDA 5TSSA 1IZ6A 5CBAE 1F9PA 1XTCD 3OIQA 3D0FA 2RSOA 1HZCA 1YITA 1K3RA 2F4VQ 4K6DA 1QUQB 3BDLA 5IY0A 1SE4A 1CQVA 1QVCA 4HN7A 3GV3A 2OTJA 1GUTA 2EY5A 3HOWG 4YY3Q 2HCIA 5D3DA 4BBRH 4DFAA 2RA4A 2TMPA 1M90C 2K75A 3TP5A 3VR6A 4K8JA 5HURA 2BH8A 4XDXA 4B3SQ 1BNZA 1E3PA 3TEHB 4A3EG 4QY7A 5M3MG 1LT3D 1KXLA 3CF5A 4A3JB 1OTCA 4FXGC 4HR7B 1HFNA 2RF4A 1U4RA 4IJLA 4ABNA 3CMEA 1X3QA 2JA6G 2IX1A 1HA5A 4DR3L 4C3IG 2SEBD 4R4IA 2N49A 3PO2H 5IP7G 4LUZA 2B63B 2JE6I 3KF6A 3T1HQ 4RGNA 2EJFC 4LF6Q 5J1ZA 2Q8RE 3H0GH 2IT1A 3BZDB 1BCPC 5ELCA 5IT9c 3WOFA 3H3VC 3CCSA 3RLFA 5IWAQ 1KNEA 3TP8A 3F2DA 2CHBD 1VQBA 1Y1VB 5M3MB 2K28A 4KHPQ 4DV1L 4P73A 3SE0A 2KHIA 5LMNQ 3K57A 4CHTB 4JI0Q 4A3LH 1HJPA 3ERSX 3HEJA 1HZ9A 2NN6I 5CBEE 3IFTA 2KBNA 2M2LA 1PH8A 3HKZB 3FMCA 3OMCA 2CQOA 3E0JA 3QR8A 4DGZA 2F4VL 1GUOA 1VQ5A 1OXXK 1SMYD 3B6YA 1MSHA 2JA9A 4QJFA 2LKVA 1A62A 4CJ0B 1H9SA 4YY3L 1RTOA 2L0CA 1F2MA 4ZUIA 5J39A 3K6OA 5C4JH 2TSSA 4AQYQ 3PIOA 4CKEA 4B3SL 1FNWA 1K8AC 3U58A 1DZ1A 4BBRB 4NDXA 4DAPA 4A3DH 4ZKCB 3OWEB 2K01A 1VQGA 1H9MA 3SK6A 1K73C 4JVZA 1X56A 3I4LA 4GLVB 3MFYA 3WWVA 1NMGA 4R4TA 4BXXH 1TXYA 4OELB 3SK4A 2V4DA 2PW7A 1Z47A 1AN8A 3HOZH 3UI2A 3J81j 2DUDA 4EQNA 3ULPA 3T1HL 2QCPX 4LF6L 1PFSA 1GOZA 1U0LA 1E2WA 3TQYA 2F52A 1QNKA 3GDEA 3PO2B 2ALYB 2MNAA 4P71A 1HNZQ 5IWAL 4A3CG 2VZAA 3H0GB 1A8VA 3C1EA 2F3VA 1ET9A 3JC66 3CCRA 4GNXA 2ZJPA 5LMNW 4KHPL 2GN5A 2KUMA 5LMNL 4WJWA 1HHVA 4UPAA 4JI0L 3K0XA 1JR0D 4ME3A 1TWFH 1HRJA 4DR7L 1X32A 4IN3A 3T56B 1TY2A 5JOBA 1PTOH 4OIJA 4GKJL 4UP7A 3ER0A 1EU3A 1IBKQ 1FJGQ 1O80A 1MJCA 3S16H 1BBWA 1JJGA 4DNRB 1LTGD 4AQYL 2EVBA 4CJ1B 1BCPB 4POGA 3NQIA 3UE1A 2AUJD 1M8AA 4PQXA 4QB4A 5CV7A 5KGUA 2WP8J 5C4JB 4WJ3M 1CA6A 2F0QA 1I4HA 2JEAI 4QGUA 2NZ1D 1KQSA 2A8VA 4A3DB 2PNHA 4GN5A 4HAEA 1Q90A 3PIPA 1QG7A 1NBWA 2WKCA 3T16A 1CKMA 1E7ZA 3I90A 3PSIA 4FF3A 1K8MA 3NK9A 3I70A 2F0TA 1E2VA 3JAMi 2EJGC 2PMZE 3HOZB 1DCZA 1L2FA 4BS9A 3KOJA 1SDFA 2CH4W 5FK9C 1D7QA 2PQAA 2F0VA 1N8RC 5EPJA 3STBD 3LX0A 1AH9A 1CKNB 1U9RA 3H91A 5ELDA 2LXKA 2K04A 1HNZL 3CPWA 1BQQT 4HMIA 1BO0A 2KOLA 3MEHA 1T5XD 5FJ8H 2YTXA 1SNMA 1A3VA 4LAAA 2NVYH 4NKLA 1J8IA 3I72A 3CQZH 1KDAA 4F87A 3PUWA 1X65A 4JI8Q 3MXGA 1Z9FA 1XXGA 3KDFB 2I07B 4H7BA 1L0WA 1V1QA 2EOTA 2JQOA 2JA8H 2QDBA 3CCVA 4DR4L 1WTWA 1ESRA 1I4PA 1LYLA 3DXJC 5KYIA 1TWFB 1SRUA 4IALA 4LF8L 1JOQA 2N55A 2F0JA 1E1TA 2I5HA 3G4SA 3BG3A 4JV5Q 3UE0A 1IBKL 2J7ZA 1PTOB 3ULLA 3U50C 4B3RQ 1STYA 4LUVA 4RMFA 1B1ZA 1LACA 2KCTA 2I46A 3S16B 4KHZA 4GNXC 2NVXH 1YJ9A 3H15A 5T1IA 3I4NG 4OWTB 3BDOA 1SROA 1WTRA 2R7ZH 5FJ8G 1A3UA 4RCNA 1XMOQ 4PZ8A 3RD4A 4A3GH 1Q3LA 1IYUA 3S1RH 3FVQA 4ODGA 3W5OA 4KV6A 3C46A 4OONA 1HR0Q 1L0YB 3MXUA 1HUMA 3DM3A 1NY4A 4V0BA 3PF5A 4DU9A 1BXTA 1KAAA 3RLOA 3NPPA 1K28A 3Q22A 3NE5B 3LGJA 1KRSA 4QMGA 1T5EA 5FLXL 1JE4A 4IUPA 4X62Q 1XMQQ 1EOVA 1GD7A 2WB1G 1ILQA 3NXWA 4BY1H 1JQYD 1NAPA 3P7JA 2Z6BA 5JPNC 5C4ZA 1LT5D 1HFGA 1WYDA 3AQQA 3HOXH 1JMCA 1B53A 1ZEQX 3AYHB 1MJEA 4GN4B 4IUVA 1U5KA 1N36L 3MTSA 1FD7D 2NVYB 3QG1A 4OWXB 2F0FA 2ZXOA 2HIVA 2I5LX 1PHJA 3CQZB 2WKDA 4C1NK 1Q8IA 3TN2A 1KIXA 2LY7A 2I5MX 2XIWA 1R9TH 4A3GG 2JA8B 2E2IH 1DM0B 1ASYA 1RTNA 2XWBB 3J7YW 1EQRA 4JV5L 2KVMA 3OSOA 2NZOA 1AE2A 2G5DA 3DWAA 3A8IE 4MIUA 2R6GA 1LV9A 1OXSC 2MFIA 1YNNC 5A35A 2A68D 2NVTH 3MAQA 1DGSA 5I9PA 2EY2A 2V1CC 4NXMQ 4KI0A 1HUNA 5GROA 4JBWA 2EYFA 4DNIA 4HTHA 4RCOA 3K80C 5LL6X 3L9AX 1PVOA 2XNAC 4IUQA 4CGYB 3KLSA 2NVXB 1FNUA 3BVGA 1VQ7A 1XMOL 4RKBA 4EQPA 5JVG3 1HR0W 1S5BD 5KRUA 4R4OA 3TMEA 2DNEA 3NEMA 2R7ZB 1C7YA 3URYA 4G4KA 3FKIG 3IKJA 5I6WA 4LF4L 2VNUD 1ZKOA 3FHWA 5C4HA 4A3GB 2OF1A 5JEAG 3S1RB 2LS01 1YHQA 2AUKA 1VMPA 1LTBD 1S3OA 4QIWE 3K59A 4IOCA 4X62L 1XMQL 2WB1E 2D2CC 3PUYA 3RLNA 4DV7Q 5FLMH 4DAYA 3J81L 2R7DA 3NBIA 4CKBA 4JI1Q 4QUFA 1IBML 1ASZA 4MNOA 3KBGA 5C0XJ 4IPGA 4DV0Q 3MVVA 2CVRA 3J7ZC 3D6CA 4BY1B 4RWSC 4IFDJ 5M9OA 4WJ4A 3KJOA 1U4MA 3HOXB 4BY7H 1Y8OB 1W6KA 1W6JA 3GQBA 1EEID 4R8IA 2CW0C 3RNUA 2JN4A 2K1BA 2R7FA 3K5MA 2FHTA 3FEWX 3N52A 4WFN3 3GO5A 2M00A 5IGGA 3J80c 5EQ0A 3GV6A 1TS5A 1S4ZA 2K6AA 1TQOA 1E24A 5DAUA 1R9TB 5EJWA 4XQNA 3TZUA 1CUKA 1DOKA 2NN6G 3HS0C 4KN7C 4JI5Q 1WI5A 2NYZD 2F0NA 5IE8A 2F0DA 3CXCA 2JYOA 4NXML 2Y0SG 2NVTB 2YU9H 5GQOA 4CDEC 1JB7A 1SAPA 2JA5H 2VQFQ 4K14A 2HIXA 4FDBA 4C56C 2IJ0A 2RDHA 4G7OC 1J9OA 1J5EQ 4JCVE 2HD3A 3VA5A 2PZWA 2AWNA 1STEA 4YWLA 4C3JH 4A3IH 1F9RA 4DV6L 4FF2A 4ALPA 1VQMA 4BY7G 3BZKA 1AZPA 1DD2A 3BS1A 2JSOA 2CCZA 2Z9HA 1SJED 4LF7Q 2O5JC 3E6ZX 1D2BA 4HJAA 1S40A 4KY6A 1CZWA 1ZYRD 2PQAB 4DV7L 1X9NA 4CBVA 1WTXA 1HA6A 1SYGA 3K0YA 3CMAA 4C3HH 4A3FH 1RCVD 1SNCA 2Y0SB 4JW0A 4LJZC 4DV0L 1F77A 1YHAA 3QIAA 4XYQA 2QEJC 1Q81C 1F2ZA 1TT2A 2AQ2B 2QILA 1MSGA 3PMFA 1EIYB 2DY8A 2K14A 2JA5G 4HJ7A 3HOYG 1OXVA 1I4GA 1Q1BA 1MKHA 3J81c 1Q82C 4BY7B 2A19A 3CAMA 5K36H 2L1BA
chains in the Genus database with same CATH topology
1RDPD 1WD0A 1LO5D 5CV6A 4DA2A 4RAUC 3T13A 3Q23A 3D4WA 1I4QA 1BR9A 5IT9E 1S5FD 4GZYC 3O13A 1GHJA 3KK7A 5BN4A 1U4LA 2KCNA 1SYCA 4C3HG 1O78A 5BN3A 2D5DA 2YU9B 4HEDA 2JA5B 1UNSA 1F9SA 2F4IA 2Q8IB 2L55A 4IUNA 1G2SA 1TS3A 3JAML 4C3JB 4A3IB 1YNJC 5CV5A 3SEBA 3K5OA 1A2UA 3G7LA 4G57A 3SHLA 5IGCA 1WTOA 1PYWD 4H13C 4C3HB 3OMGA 4A3FB 1JICA 1HQMC 2ZXPA 2HQEA 2KEDA 5C0XH 5DNFA 4OIKA 4F8MA 4IFDH 2AQ1B 5COYA 3CRLC 1CA5A 2X69A 2PO4A 5KNBA 1SJHD 2C5CA 4FYDA 3D31A 1G8ZD 3EFXD 1EIGA 1C4QA 1GUWA 2BE5D 3OPOA 1G2TA 3P20A 4KN4C 5CGKA 4K5XA 1RJTA 5IODA 2L4NA 5DM73 3RZDB 2QKIC 3T51B 2BA0A 3GTOB 5AFWA 1B3AA 5CMDA 3TZDA 5DM63 1SNQA 2BCOA 4TRDA 4B08A 1PXUA 4DN4M 3E5SA 3A7LA 1KTKA 1PLFA 3F2UA 2WINB 2F3WA 3A8KE 2XN9C 5EPLA 2R61A 2EYMA 1I3QB 1TWHB 2E2HB 4KY7A 1B4OA 2HCCA 1K8OA 5LHY1 1PTOC 3MC0B 2D62A 3VR3A 1TWAB 5ELFA 4PMBA 2EDGA 4EVOA 1D5XC 4KMUC 3VR2A 1DYQA 4TKOB 4M8AA 3CU7A 3LNNA 2B2WA 3Q24A 4IUTA 1LTRD 1H9KA 3GTQB 2MP1A 3BDCA 1NR2A 2H1EA 2PNRC 3KLSX 2F0LA 1O7YA 2HDMA 1YNND 1GJXA 5ISRA 1KABA 2IW3A 2RBMA 1STGA 3V96A 3DEOA 2HDLA 3I8ZA 1C8CA 1AFPA 1IW7D 3IFDA 5LL6S 1EEFD 1UAPA 2DY7A 3VYSA 4IUUA 4RA8A 4ZYSA 5E1FA 1TS4A 4JK1C 3QOJA 2A6EC 1GUSA 1QOHA 4L6TB 5E4XA 3M4OB 2B2UA 4R8NA 4A3MB 4XIGS 4RH6A 2FINB 3CRKC 3P1HA 1CK1A 1LTTD 3EROA 2J0TD 1IHZA 5JJZA 2XRQD 4KKTA 4A3KB 2CW0D 4X3KA 2IPKD 3NWSA 3NHHA 2B8GA 1FR3A 3HGBA 1ET6A 5C4XB 4AYBB 2OEOA 5EPKA 3MA2B 2E2DC 4FP5D 3QB3A 3GTGB 3V05A 2A6HC 2MUYA 5M5XB 2FMMA 1JCKB 1STNA 1VDZA 4L8JA 1WD1A 3TSSA 1HXYD 5IGDA 3A56A 1ESFA 1SSOA 1PZJD 3M7GA 1RODA 4R9WA 1WCMB 5C0XI 3BYTB 2F0WA 2ZXRA 2J4XA 3I3CA 4PMCA 3T53B 5IGEA 2KA7A 4IFDI 5IOCA 3NUCA 1PFMA 3LWUA 1VMCA 2XVSA 5C3WA 3WOEA 3VR5A 2JEBI 2N88A 2WAQB 3R2IA 4ZK9B 1V1PA 5CC4A 4ZUJA 2F0MA 1LT6D 3MXPA 1QNUA 5D3IB 1RKNA 1CQFA 3N6RA 4PMWA 3TP7A 3FDTA 1G91A 4LMQD 3HOVB 4FO2A 4MHEA 3AU7A 2O2LD 4L63B 3VYRA 1V43A 2WIIB 2B2VA 4FXDA 3J80E 1PRTD 2R93B 2A74C 3ERQA 3SR1A 1TKWB 2EPBA 3VYTA 1AZQA 1PRTF 4A93B 4DK1A 1AP0A 2A69C 1ILPA 1SEBD 4I7ZC 5J22A 2B2UC 5EKLA 2E76C 3SK8A 5M3FB 3ITPA 3J7AF 1I4XA 4FNFA 2AQ3B 4KKSA 1R4PB 3S1NB 1EY0A 2F0IA 1PFBA 1X3PA 4KY5A 3KLRA 2AWOA 1DOMA 4EQOA 4DK0A 1EY5A 1AW7A 1E2ZA 3S17B 2ZT9C 1BUVT 2NTTA 3ZYYX 1SNOA 3HG9A 3ONAB 1EOTA 3VYUA 1I6HB 4OGQC 3VA7A 3NTKA 1SYFA 4DAVA 3ND8A 2NBFA 3H94A 1F2LA 3PO3B 5M5WB 3AB9A 2L9HA 1Y1WB 2NTSA 3PUVA 3M7NA 2F0OA 3KF8A 2ENBA 1IKLA 3NQTA 3GTMB 3RUZA 4XQQA 3W2DA 1CHPD 3LWEA 3OWFA 3M85A 4WRDA 5E4WC 3QO2A 1OXUA 2B2TA 1ZXTA 1BCPD 5EBCA 4U68A 3Q6SA 5KNDA 1BCPF 2F0HA 2PCFB 5EBDA 1CI3M 2RSNA 3GTKB 4HMJA 1A15A 3NSWA 5ELBA 3R3OA 4Q0FA 4ZRZA 1LABA 2F0KA 1SYBA 4M1UB 4Z9CB 2VB2X 3NWTA 4ZAIA 2B2VC 5KNCA 4X3SA 2PPBC 1STBA 1QJOA 3GP7A 3R93A 5A2QE 1NCVA 4A3BB 4KHVA 2KHSA 5A2QL 1EY8A 3IAYA 3H6MA 2E2JB 2O4XA 4DNTB 4KJOA 2KQ3A 1UEAB 3S9WA 4RHSA 2KECA 1XYIA 1EYCA 2EE1A 2SOBA 3C1FA 1ENFA 1K83B 1CM9A 1DOLA 1KDCA 1ENAA 1VCIA 4C2MB 3HOUB 1H9RA 1FYCA 2E74C 1EU4A 2BDNA 2R3ZA 1VF7A 2CQAA 2ICIA 2K5WA 4IZ8A 4PNYA 5FO7B 4C3JG 1PTOD 2XRSD 1KLGD 2VB3X 4K5WA 1PTOF 1I4RA 2OT2A 2Q8TA 4RKLA 4KJNA 1DJRD 2VUMB 4KD4A 1C48A 4YIJA 4F7XA 5IT9L 5D65A 2K32A 1B44D 3QOLA 1BBXC 4HSPA 2EXZA 1BF4A 4XT3B 1TWCB 1V8QA 4O42A 2K03A 2D9UA 3SK5A 1G6ZA 5IIFA 2F03A 1SE3A 2IWHA 1E0BA 1B9NA 2A68C 1PDQA 2B2TC 3R2TA 3TP6A 4OO1H 5K36G 1V1PB 2G9HD 5EGTA 2EYJA 2EYPA 1FNVA 1Y8NB 4S3SA 5KIXA 2E75C 1UUPA 4QF4A 1SFOB 1O7LA 1NR4A 3DEPA 3H09A 3DWPA 3EVQA 3T4AC 3HP3A 3MFGA 2A6ED 1SXTA 4KTAA 1U4PA 3D4DA 1HPCA 2NUCA 2R92B 2IX3A 2C9OA 3GTJB 3EJIA 4BBSB 1JOOA 1HTPA 4LK1C 1A6XA 4H44C 1ICWA 2JXMB 2IX0A 3D8GA 2DN8A 4OO1G 1QE6A 2RDGA 1D1IA 2RVLA 3MHBA 2A5HA 1EQVA 4CJ2C 3TBIB 5T1GA 2HUGA 3CHBD 5FKAC 2ID0A 2DNCA 3PUZA 5C6AA 2FFKB 3VR4A 1VF5C 3GTLB 5C5MA 4I65A 1L0XB 4OL7A 1IYVA 3HOWB 5C0XG 4K2KA 1DXMA 5I2YA 3GTPB 5CV8A 2A6HD 3FRPB 2F0PA 3BYYB 3K58A 1HQRD 4IFDG 1WTPA 4A3EB 4FF4A 1AEXA 2YYZA 2BA1A 3MZ5A 4IURA 3SXHA 2JA6B 4G7HC 2L5TA 4C3IB 1PRTB 1A2TA 1HTLD 1H9JA 3Q0AA 2MJ8A 1EL0A 3BVMA 1RD9D 1B50A 3M4YA 5C5LA 4NP5A 2Z4HA 1ZYRC 4K8IA 1SNDA 3BVZA 1D5MC 2NWGA 4UDUC 3J7AV 3I91A 1S5DD 2BDOA 2MPMA 1S5CD 4EGVA 3P75A 1Y8PB 4NMZA 1GUGA 1SNPA 1SYDA 3KUPA 2EJMA 4RGMA 4XTCS 1EFID 2F1MA 2MHVA 3WDNA 2FMCA 2A73B 1IL8A 2EY1A 1RF2D 2A69D 4RGOS 2X6LA 5KYLA 2NB0A 3A7AB 3EA6A 2JA7B 3ND9A 2F0GA 3DUZA 5JEAJ 1II3A 1EY7A 1TVXA 3FPUB 1A3TA 3U9SA 2K7VA 4XT1B 4KK7A 2RDFA 4C1NI 1PZID 3CKIB 3S14B 3L3OC 2GA4B 1G291 4J6HA 1Y69U 4XXEA 5C44B 1SYEA 3DMUA 4CKCA 2L11A 2PQEA 4TSSA 1V1OA 4MN3A 1JORA 5IGFA 3X3MA 3G6JB 4O1NA 1OO9B 1EYDA 3W3AA 1F9QA 4DXGA 2PMZB 1QILA 1S5ED 3OIPA 1MBYA 2OXPA 4PV1C 4XYOA 1LTSD 3MWYW 2NVQB 3V2TA 1JWMD 1RHPA 5I4DA 4QCLA 2RKSA 1LTID 4J1MA 4FF1A 5DEHA 2IL8A 2X6GA 3KBXA 1OXTA 1B9MA 1MGSA 1EY6A 2LFNA 3MXNA 1R4QB 1D1KA 1BOSA 4ZKBB 4K5VA 1XWEA 2K5QA 2BE5C 1I6VC 2K05A 3RMHA 3OW7A 4OO1I 3D3RA 3S1MB 2PW5A 1EY9A 1Z6HA 2G9DA 4FVMA 3S1QB 1QB5D 5CV4A 4BA1I 1FGBD 3NBHA 2SNSA 4IQZA 1O7ZA 1Q1EA 5G3LD 4RHRA 2B2WC 5JAVA 1F2YA 1KLUD 4P2CB 5G3LF 2Z4IA 4OHJA 1SMYC 2KJXA 4B9XA 4DF7A 2H4OA 5HGTA 2B8FA 1EZ6A 4HCEA 5EKIA 3PUXA 5KEEA 2M9VA 4K6LA 3C2PA 3I4MB 4NW2A 2B39A 1CTMA 3EQLC 4K2LA 1LT4D 4ZQ3A 1DONA 5CORA 1STHA 4HCSA 1EZ8A 3SDZA 4BWGB 2WV6D 5FLXE 1D6EC 2K33A 4N9TA 1EWHA 2VXWA 5I2XA 1D5ZC 1GXDC 1NSNS 3X3NA 1CZGA 3DHQA 2Z8LA 1ML0D 3J80L 1EQTA 4QUCA 3I4NB 4ULLA 1PFNA 3TDQA 1M4VA 1WTQA 1PMRA 5FO8B 3IL8A 5JEAH 3M3YB 1LTAD 2L12A 4XQJA 2Z1CA 1Q12A 2RQXA 5CYUA 5ELEA 4WORA 1SBBB 1TU2B 3A54A 3RZOB 3A55A 1CHQD 3D4RA 3K5NA 4ME5A 4QIWB 2KCCA 1YNJD 3S15B 1H9SB 2WB1B 2B2YA 1CT1D 4UAIA 1JOKA 5M5YB 3HRZC 1GUNA 1ONLA 1TWGB 4FXKC 1IW7C 2XSCA 3K5LA 5FOBB 2KEEA 1WTVA 3QWNA 5K5PA 4KD3A 1I50B 5C3XA 5IGBA 2NN6H 3D6WA 1PZKD 3OOCA 5CR3A 3J81E 4Q5VA 5C3EB 1BDOA 4F88A 4HSVA 3OHXC 3PIO3 2QF7A 3NP8A 3S2DB 2PYKA 2JP1A 4BA2I 1EIHA 2FJ2A 2WACA 1QCBD 3FKIB 3AMUA 2EYOA 4X3TA 3DM1A 5EKKA 4V190 1EWCA 1TY0A 5NUCA 5E3FA 1IKMA 2PZTA 2K5DA 3I73A 4ID6A 1HCZA 2E2IB 1KDBA 1TR5A 4TQUS 1STAA 2MGSA 2LMCB 2F0SA 3R8BA 3U9OA 5JPMC 3HZXA 1XX8A 2BOSA 5FO9B 2EYHA 4X3UA 1SE2A 1LLRD 1TS2A 5BN5A 4J8QA 2EZVA 3QJYA 3NTIA 3GD7A 1JWSD 2O5IC 1TIID 4N9PA 2SDFA 5JVH3 1MD2D 1JB3A 2B2YC 2ICEC 1JC7A 5CV9A 1WVLA 2EY6A 2PZUA 1MI2A 1B2TA 4RFBA 4Y7NB 3PIP3 1QWYA 4B9WA 4RGTA 3DWQA 4ZLTF 3A8JE 5F2DA 1CFMA 2EYLA 1PRTC 3FPPA 4G7ZC 2SNMA 3NTHA 4KKUA 4DXFA 5I9OA 4ILWA 2F0EA 5D14A 4E6IA 1Z7TA 2XWJB 4H0LC 1NUCA 4U673 3C3LA 3SVMA 3L7ZC 1GHKA 1EYAA 3K7AB 3S2HB 1KNAA 3JAME 1JWUD 3HOYB 1ENCA 3PV0A 5I6YA 2F0UA 5TSSA 5CBAE 1F9PA 1XTCD 3OIQA 2RSOA 4K6DA 3BDLA 1SE4A 1CQVA 4HN7A 3GV3A 1GUTA 2EY5A 2HCIA 5D3DA 4DFAA 2RA4A 2TMPA 3TP5A 3VR6A 4K8JA 5HURA 4XDXA 1BNZA 1LT3D 4A3JB 4FXGC 4HR7B 1HFNA 1U4RA 4ABNA 1X3QA 2IX1A 1HA5A 4C3IG 2SEBD 2B63B 2JE6I 4RGNA 2EJFC 5J1ZA 2Q8RE 2IT1A 3BZDB 1BCPC 5ELCA 3WOFA 3H3VC 3RLFA 1KNEA 3TP8A 2CHBD 1Y1VB 5M3MB 2K28A 3SE0A 3K57A 4CHTB 3HEJA 2NN6I 5CBEE 3IFTA 2M2LA 3HKZB 3FMCA 3OMCA 3E0JA 4DGZA 1GUOA 1OXXK 1SMYD 1MSHA 2LKVA 4CJ0B 1H9SA 1RTOA 2L0CA 1F2MA 4ZUIA 5J39A 3K6OA 2TSSA 4CKEA 1FNWA 1DZ1A 4BBRB 4NDXA 4DAPA 4ZKCB 3OWEB 2K01A 1H9MA 3SK6A 3I4LA 3MFYA 3SK4A 2V4DA 2PW7A 1Z47A 1AN8A 3UI2A 4EQNA 2QCPX 1GOZA 1E2WA 1QNKA 3PO2B 3H0GB 3C1EA 2F3VA 1ET9A 2KUMA 4WJWA 1HHVA 1JR0D 1HRJA 1X32A 4IN3A 3T56B 1TY2A 5JOBA 1PTOH 4OIJA 1EU3A 1O80A 4DNRB 1LTGD 2EVBA 4CJ1B 1BCPB 3NQIA 2AUJD 1M8AA 4PQXA 4QB4A 5CV7A 5KGUA 2WP8J 5C4JB 1CA6A 2F0QA 1I4HA 2JEAI 2NZ1D 4A3DB 4HAEA 1Q90A 1QG7A 2WKCA 3T16A 3I90A 4FF3A 1K8MA 3NK9A 3I70A 2F0TA 1E2VA 2EJGC 3HOZB 1DCZA 4BS9A 1SDFA 5FK9C 2F0VA 5EPJA 3LX0A 1U9RA 3H91A 5ELDA 2K04A 1BQQT 4HMIA 1BO0A 2KOLA 3MEHA 1T5XD 1SNMA 1A3VA 4LAAA 4NKLA 1J8IA 3I72A 1KDAA 4F87A 3PUWA 3MXGA 2I07B 1XXGA 4H7BA 2EOTA 2QDBA 1WTWA 1ESRA 1I4PA 3DXJC 5KYIA 1TWFB 4IALA 1JOQA 2N55A 2F0JA 3BG3A 2J7ZA 1PTOB 1STYA 1B1ZA 1LACA 2I46A 3S16B 4KHZA 5T1IA 1WTRA 3BDOA 1A3UA 4RCNA 3RD4A 1Q3LA 1IYUA 3FVQA 4ODGA 3C46A 4KV6A 1L0YB 3MXUA 1HUMA 4V0BA 4DU9A 1BXTA 1KAAA 3NPPA 3Q22A 3NE5B 4QMGA 1T5EA 5FLXL 1JE4A 4IUPA 1ILQA 3NXWA 1JQYD 1NAPA 3P7JA 5JPNC 5C4ZA 1LT5D 1HFGA 1B53A 1ZEQX 4IUVA 3MTSA 1FD7D 2NVYB 3QG1A 2F0FA 2ZXOA 3CQZB 2WKDA 4C1NK 1Q8IA 3TN2A 2LY7A 2XIWA 2JA8B 1DM0B 1RTNA 2XWBB 3J7YW 2KVMA 3OSOA 3DWAA 3A8IE 4MIUA 2R6GA 1LV9A 1OXSC 1YNNC 5A35A 2A68D 3MAQA 5I9PA 2EY2A 4KI0A 1HUNA 4JBWA 2EYFA 4HTHA 4RCOA 5LL6X 3L9AX 2XNAC 4IUQA 4CGYB 3KLSA 2NVXB 1FNUA 3BVGA 4RKBA 4EQPA 5JVG3 1S5BD 5KRUA 3TMEA 2DNEA 2R7ZB 3URYA 4G4KA 5I6WA 3IKJA 2VNUD 1ZKOA 5C4HA 4A3GB 2OF1A 5JEAG 3S1RB 2LS01 2AUKA 1VMPA 1LTBD 3K59A 2D2CC 3PUYA 4DAYA 3J81L 3NBIA 4CKBA 4QUFA 3KBGA 5C0XJ 3MVVA 2CVRA 3D6CA 4BY1B 4RWSC 4IFDJ 5M9OA 1U4MA 3HOXB 1Y8OB 1W6KA 1W6JA 3GQBA 1EEID 4R8IA 2CW0C 2K1BA 3K5MA 2FHTA 3FEWX 3N52A 4WFN3 3GO5A 2M00A 5IGGA 5EQ0A 3GV6A 1TS5A 1S4ZA 2K6AA 1TQOA 5DAUA 1R9TB 5EJWA 4XQNA 3TZUA 1DOKA 2NN6G 3HS0C 4KN7C 2NYZD 2F0NA 2F0DA 2JYOA 2NVTB 1SAPA 4K14A 4C56C 2IJ0A 2RDHA 4G7OC 1J9OA 3VA5A 2PZWA 2AWNA 1STEA 1F9RA 4FF2A 1AZPA 1DD2A 3BS1A 2JSOA 1SJED 2O5JC 3E6ZX 1D2BA 4KY6A 1CZWA 1ZYRD 1HA6A 4CBVA 1WTXA 1SYGA 3K0YA 1RCVD 1SNCA 2Y0SB 4LJZC 1F77A 3QIAA 4XYQA 2QEJC 1F2ZA 1TT2A 2AQ2B 2QILA 1MSGA 3PMFA 2DY8A 1OXVA 1I4GA 1Q1BA 4BY7B 1EY4A 5K36H 2L1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGZ A;  4QB4 A;  4KJO A;  1EYA A;  5CV7 A;  5CV6 A;  5KGU A;  3P75 A;  3MVV A;  3T13 A;  4K5X A;  4KTA A;  2F0Q A;  4NMZ A;  4K5V A;  4DU9 A;  1SNP A;  5CGK A;  3D6C A;  1KAA A;  1SYD A;  1KDB A;  1TR5 A;  2NUC A;  3D4D A;  2KQ3 A;  2F0L A;  1SNO A;  3D4W A;  5IGD A;  5IOD A;  3S9W A;  1ENC A;  2LKV A;  3EJI A;  5M9O A;  1JOO A;  5ISR A;  1STA A;  1KAB A;  1EYC A;  4QMG A;  2SOB A;  2F0S A;  5I6Y A;  1F2M A;  3C1F A;  2F0U A;  2F0W A;  3T16 A;  1SYF A;  4ZUI A;  3U9O A;  5J39 A;  4PMC A;  2RBM A;  4WOR A;  3TP5 A;  3NXW A;  5IGE A;  1STG A;  2PW5 A;  3NK9 A;  1KDC A;  3HZX A;  1ENA A;  1EY9 A;  5IOC A;  2EY1 A;  2F0T A;  5C4Z A;  1SYC A;  3D8G A;  3NUC A;  4NDX A;  2M00 A;  5IGG A;  4K6D A;  4ME5 A;  2EYH A;  3BDL A;  5CV4 A;  3SK6 A;  1TQO A;  3MHB A;  4IZ8 A;  5DAU A;  5C3W A;  4PNY A;  1EQV A;  5KYL A;  2SNS A;  2F0V A;  2F0G A;  3SK4 A;  2EY5 A;  2F0F A;  5C6A A;  4K5W A;  1JOK A;  2F0O A;  3LX0 A;  2F0N A;  1U9R A;  4DFA A;  5CC4 A;  2PW7 A;  5JAV A;  1F2Y A;  1SNQ A;  5E1F A;  4HMI A;  1II3 A;  4ZUJ A;  2F0D A;  1EY7 A;  4IUN A;  4RKL A;  3MEH A;  2ENB A;  1A3T A;  4I65 A;  4K8J A;  4TRD A;  4KJN A;  5C5M A;  3NQT A;  2F0M A;  5HUR A;  4OL7 A;  4KD4 A;  3RUZ A;  1SNM A;  3MXP A;  3QOJ A;  3E5S A;  1A3V A;  2RDF A;  4LAA A;  4YIJ A;  4EQN A;  5CV5 A;  1RKN A;  4NKL A;  4F7X A;  4K2K A;  4K14 A;  4N9P A;  3OSO A;  3TP7 A;  3QOL A;  3OWF A;  5CV8 A;  4B9X A;  4DF7 A;  4J6H A;  1KDA A;  2F0P A;  4MIU A;  2F3W A;  5K5P A;  5HGT A;  1SYE A;  4KD3 A;  1A2U A;  4WRD A;  4G57 A;  3DMU A;  3VA5 A;  2PQE A;  3SHL A;  5C3X A;  2PZW A;  5IGB A;  1EZ6 A;  5CV9 A;  2EXZ A;  4H7B A;  5I9P A;  5IGF A;  2EY2 A;  5IGC A;  1JOR A;  4R8N A;  2QDB A;  1AEX A;  2EY6 A;  2EYM A;  1EYD A;  5KEE A;  5KYI A;  2PZU A;  3C1E A;  2EYF A;  5CR3 A;  3SK5 A;  2F3V A;  4HTH A;  3OMG A;  3MZ5 A;  5IIF A;  2F0H A;  3P1H A;  4IAL A;  3SR1 A;  3ERQ A;  4KY7 A;  2F0J A;  4K2L A;  1JOQ A;  3ERO A;  3SXH A;  4HMJ A;  4ZQ3 A;  1IHZ A;  4B9W A;  2OXP A;  3R3O A;  2F0K A;  2HQE A;  1SYB A;  4KY6 A;  4RKB A;  5J1Z A;  4EQP A;  5J22 A;  1STY A;  3NP8 A;  5KRU A;  1STH A;  3TME A;  4F8M A;  1SYG A;  2PYK A;  1EZ8 A;  3NHH A;  5EKL A;  5F2D A;  3SK8 A;  3TP6 A;  1SNC A;  4PMB A;  3V2T A;  2EYL A;  5EGT A;  4EVO A;  5I6W A;  3TP8 A;  3ITP A;  1A2T A;  2EYJ A;  2EYP A;  5C4H A;  4S3S A;  2OEO A;  2SNM A;  5KIX A;  2OF1 A;  4QF4 A;  5I9O A;  1STB A;  5JOB A;  2RKS A;  4N9T A;  1EY0 A;  2F0I A;  3QB3 A;  2F0E A;  2WAC A;  4J1M A;  5C5L A;  1F2Z A;  1TT2 A;  4NP5 A;  1NSN S;  4KY5 A;  2EYO A;  4KHV A;  2KHS A;  4K8I A;  5DEH A;  5EKK A;  3PMF A;  1A3U A;  1SND A;  3DHQ A;  4E6I A;  3EVQ A;  4EQO A;  5NUC A;  1EY8 A;  3HEJ A;  5E3F A;  1NUC A;  1STN A;  1EY5 A;  3H6M A;  4KV6 A;  4ODG A;  1EY6 A;  2PZT A;  2O4X A;  3BDC A;  4ID6 A;  3OMC A;  1EY4 A; 
#chains in the Genus database with same CATH topology
 1RDP D;  1WD0 A;  1LO5 D;  5CV6 A;  4DA2 A;  4RAU C;  3T13 A;  3Q23 A;  4A3I G;  3OYY A;  3UDF A;  3D4W A;  1I4Q A;  1BR9 A;  4YCW A;  2HHH Q;  1PA6 A;  5IT9 E;  4N8X 1;  1S5F D;  4TVA B;  4GZY C;  3O13 A;  1GHJ A;  1YNX A;  3KK7 A;  5BN4 A;  1CKN A;  1U4L A;  1B7Y B;  2KCN A;  4O0A A;  1SYC A;  4C3H G;  2VQF L;  1WOC A;  1O78 A;  5BN3 A;  2D5D A;  3RZD H;  2N8N A;  2RHS B;  5GAE C;  2YU9 B;  3GTO H;  4HED A;  2JA5 B;  1UNS A;  1F9S A;  5HY6 A;  1EIF A;  2F4I A;  2Q8I B;  3CC4 A;  2L55 A;  4IUN A;  4A3J G;  1G2S A;  4GLA C;  1TS3 A;  3KDF A;  3JAM L;  4C3J B;  3E9H A;  4A3I B;  1YNJ C;  5CV5 A;  1LM0 A;  4A76 A;  4LF7 L;  3SEB A;  3K5O A;  3CCJ A;  1Q8K A;  2FXQ A;  1A2U A;  3G7L A;  4G57 A;  2B63 G;  3SHL A;  3PQI A;  5IGC A;  1YBY A;  1WTO A;  4OX9 L;  1UEB A;  4IPH A;  4X65 L;  1NMF A;  1CSQ A;  1PYW D;  4H13 C;  4C3H B;  3OMG A;  4A3F B;  1JIC A;  1HQM C;  2ZXP A;  1GM5 A;  1Y1V G;  2HQE A;  2KED A;  1I3Q H;  5C0X H;  1XNR Q;  5DNF A;  4OIK A;  4F8M A;  1TWH H;  4R1J A;  4DR1 Q;  2E2H H;  4IFD H;  2AQ1 B;  5COY A;  3CRL C;  1CA5 A;  2X69 A;  2PO4 A;  5KNB A;  1SJH D;  2C5C A;  4FYD A;  3D31 A;  1Y14 B;  1G8Z D;  3CPF A;  3EFX D;  3HKZ G;  1EIG A;  1TWA H;  1NNX A;  1C4Q A;  4JI7 Q;  1EFW A;  1PYB A;  1GUW A;  2VQE Q;  1GVP A;  2BE5 D;  1QVG A;  4EX5 A;  3OPO A;  1G2T A;  3P20 A;  1KC8 C;  2KCM A;  4KN4 C;  1VQD A;  1IL2 A;  5CGK A;  4K5X A;  1RJT A;  5IOD A;  2L4N A;  4BBR G;  1YZ6 A;  3GTQ H;  1X55 A;  2GVA A;  5DM7 3;  3RZD B;  1WTH A;  2QKI C;  1YJW A;  3T51 B;  2BA0 A;  3GTO B;  1N34 Q;  2JJQ A;  1PH7 A;  1HNW Q;  5AFW A;  1B3A A;  5CMD A;  1O7I A;  3TZD A;  2OQK A;  5DM6 3;  2RCF A;  1SNQ A;  4DAY B;  4JI4 Q;  2BCO A;  4TRD A;  4B08 A;  3PO2 G;  3M4Q A;  1PXU A;  4DN4 M;  3E5S A;  4LFB Q;  3A7L A;  1KTK A;  1PLF A;  3H0G G;  3F2U A;  2ES2 A;  2WIN B;  3G71 A;  2F3W A;  1XNR L;  3A8K E;  1YHB A;  2XN9 C;  4DR1 L;  5EPL A;  2R61 A;  4YWK A;  2EYM A;  4POF A;  4DV4 Q;  1I3Q B;  1XNQ Q;  3HKZ E;  1TWH B;  2E2H B;  4KY7 A;  3RR5 A;  1B4O A;  2HCC A;  3W1G A;  2H5X A;  3M4O H;  4JI7 L;  1K8O A;  4A3L G;  2VQE L;  4A3M H;  5LHY 1;  4UP9 A;  1PTO C;  3MC0 B;  2D62 A;  3VR3 A;  1TWA B;  5ELF A;  4PMB A;  2EDG A;  4EVO A;  1D5X C;  4KMU C;  4MZ9 A;  4DV5 Q;  3VR2 A;  4HJ9 A;  4YCU A;  5IYC H;  1EYG A;  4RG1 A;  1DYQ A;  4A3K H;  4TKO B;  4M8A A;  1PV4 A;  3CU7 A;  3LNN A;  3Q8D A;  2B2W A;  2AHO B;  3Q24 A;  5C4X H;  4IUT A;  2K5N A;  4HIM A;  1LTR D;  1H9K A;  4QQB X;  3GTQ B;  2MP1 A;  4A3D G;  3BDC A;  4LW1 A;  3GTG H;  1NR2 A;  2H1E A;  1HNW L;  2N78 A;  4B3M Q;  2PNR C;  3KFU A;  4BXX G;  3KLS X;  3I55 A;  1XPU A;  5M5X H;  2F0L A;  1O7Y A;  2HDM A;  1YNN D;  1GJX A;  5ISR A;  1KAB A;  4CDC C;  2ASB A;  5JJI A;  2IW3 A;  3HOZ G;  2RBM A;  4JI4 L;  1STG A;  3V96 A;  1KAW A;  3DEO A;  2HDL A;  3I8Z A;  4A3M G;  1VQK A;  1C8C A;  1AFP A;  1SLJ A;  4LFB L;  1WCM H;  4DUY Q;  4DV3 Q;  1IW7 D;  3IFD A;  5LL6 S;  1EEF D;  1UAP A;  2DY7 A;  5IYB H;  3VYS A;  1SN8 A;  4IUU A;  3U4Z A;  4A3K G;  4RA8 A;  4ZYS A;  5E1F A;  1Q7Y C;  4DV4 L;  1JE5 A;  1TS4 A;  4I7A A;  4AYB G;  4JK1 C;  3QOJ A;  3CC7 A;  2A6E C;  2LXJ A;  2AMC B;  1EY4 A;  1VQC A;  1GUS A;  1QOH A;  1NE3 A;  4L6T B;  3ULJ A;  5E4X A;  1YI2 A;  3M4O B;  2B2U A;  4R8N A;  4A3M B;  1GO3 E;  4XIG S;  4DV5 L;  4RH6 A;  1UE5 A;  3F1Z A;  2FIN B;  2K50 A;  3CRK C;  3P1H A;  3HOV H;  1CK1 A;  2C35 B;  1LTT D;  3ERO A;  2J0T D;  1IHZ A;  5JJZ A;  1N32 Q;  4P74 A;  1C9O A;  2XRQ D;  4KKT A;  1WCM G;  4A3K B;  2CW0 D;  4X3K A;  2IPK D;  3NWS A;  5GAG C;  2R93 H;  3NHH A;  2B8G A;  1FR3 A;  3HGB A;  1ET6 A;  5C4X B;  4AYB B;  1E1O A;  3HFZ B;  2OEO A;  5EPK A;  4A93 H;  3MA2 B;  2QA4 A;  2E2D C;  4FP5 D;  3QB3 A;  3GTG B;  1IXR A;  5M3F H;  3V05 A;  1Q86 C;  2A6H C;  2MUY A;  4AIM A;  5M5X B;  2FMM A;  1JCK B;  1STN A;  3S1N H;  1I94 Q;  1FJG L;  1VDZ A;  4L8J A;  4N8F A;  1WD1 A;  3TSS A;  4DUY L;  2UU9 Q;  2K4K A;  1HXY D;  1N33 Q;  4L5R C;  5IGD A;  3A56 A;  1ESF A;  1SSO A;  1PZJ D;  3M7G A;  1ROD A;  4R9W A;  5ELN A;  1WCM B;  5C0X I;  3BYT B;  3S17 H;  4IPC A;  2F0W A;  2ZXR A;  2J4X A;  4LWC A;  3I3C A;  4PMC A;  3T53 B;  5IGE A;  4LUO A;  2KA7 A;  4AYB E;  4IFD I;  3A5Z B;  5IOC A;  1I6H H;  3NUC A;  2R93 G;  1PFM A;  3LWU A;  1Q46 A;  1VMC A;  2NZH A;  1PH6 A;  2XVS A;  5C3W A;  3WOE A;  4L5S A;  3CCL A;  3VR5 A;  2JA8 G;  3TRZ A;  2JEB I;  2N88 A;  2WAQ B;  3R2I A;  1T9H A;  4ZK9 B;  1V1P A;  5CC4 A;  2I0Q A;  4NXN Q;  4ZUJ A;  3PO3 H;  2F0M A;  5M5W H;  3FP9 A;  2XGT A;  1LT6 D;  3MXP A;  3CCM A;  1QNU A;  1Y1W H;  5D3I B;  1RKN A;  1EUJ A;  1CQF A;  3N6R A;  4PMW A;  3TP7 A;  3FDT A;  1G91 A;  5IP9 H;  4LMQ D;  3HOV B;  4FO2 A;  4IOA A;  4MHE A;  3GTM H;  3AU7 A;  2O2L D;  4L63 B;  3VYR A;  4PG3 A;  1V43 A;  1L1O A;  3UDG A;  2WII B;  4JI8 L;  2B2V A;  1W2B A;  4FXD A;  3J80 E;  2K5H A;  1PRT D;  4HJ8 A;  2R93 B;  2R7Z G;  1UE7 A;  4LF5 Q;  2A74 C;  3ERQ A;  3SR1 A;  3KJP A;  1TKW B;  2EPB A;  3VYT A;  2GVB A;  1AZQ A;  1PRT F;  4A93 B;  4DK1 A;  4JYA Q;  3UDX A;  2A69 C;  3CCE A;  1ILP A;  1AP0 A;  1SEB D;  4I7Z C;  5J22 A;  1VQF A;  3L0O A;  2B2U C;  1I94 L;  4IJH A;  5EKL A;  2E76 C;  3SK8 A;  4B3R L;  5M3F B;  4YWM A;  3ITP A;  3J7A F;  1I4X A;  3GTK H;  4FNF A;  2AQ3 B;  4GOP A;  2UU9 L;  4KKS A;  1R4P B;  3S1N B;  1N33 L;  1EY0 A;  3EIV A;  2F0I A;  4DUZ Q;  1PFB A;  4JI3 Q;  1X3P A;  4KY5 A;  3KLR A;  1IBL Q;  2Q2U A;  2AWO A;  1DOM A;  4EQO A;  4DK0 A;  3AFQ A;  4BY1 G;  1EY5 A;  4IPD A;  1AW7 A;  1JJC B;  1E2Z A;  3HOX G;  3K81 C;  1VQO A;  3S17 B;  2ZT9 C;  3CW2 C;  1BUV T;  2NTT A;  2Q2H A;  4A3B H;  1HR0 L;  3ZYY X;  2Z0S A;  1X54 A;  1SNO A;  1WFQ A;  3HG9 A;  3ONA B;  1LUZ A;  5BR8 Q;  1EOT A;  3VYU A;  1I6H B;  4OGQ C;  3VA7 A;  3NTK A;  2E2J H;  3KLW A;  3CD6 A;  3A5U A;  1SYF A;  2CWP A;  4NXN L;  4DAV A;  3ND8 A;  2NBF A;  3H94 A;  1F2L A;  3PO3 B;  4LNQ A;  2HQL A;  5M5W B;  1K83 H;  5L37 A;  3AB9 A;  2L9H A;  3BJU A;  1Y1W B;  2NTS A;  4UP8 A;  3PUV A;  4C2M H;  2EQS A;  3HOU H;  2F0O A;  3M7N A;  2IHE A;  3KF8 A;  1X3E A;  2MO0 A;  3M4P A;  2ENB A;  1IKL A;  3NQT A;  5FLX c;  3GTM B;  3RUZ A;  4XQQ A;  3W2D A;  2UXB Q;  2HT1 A;  2RCN A;  1CHP D;  2UXC Q;  5JJK A;  3LWE A;  3OWF A;  3M85 A;  4JYA L;  3STB C;  4WRD A;  5E4W C;  3QO2 A;  1OXU A;  1B3Q A;  2VUM H;  2B2T A;  1ZXT A;  1BCP D;  5EBC A;  2UUC Q;  4U68 A;  4CDF C;  3Q6S A;  5KND A;  1BCP F;  2F0H A;  2PCF B;  4P72 A;  5EBD A;  2KHJ A;  1CI3 M;  2RSN A;  1S72 A;  4DUZ L;  2PI2 A;  2ATW A;  3GTK B;  4HMJ A;  5EAY A;  1A15 A;  3NSW A;  5ELB A;  4LFC Q;  5FLM G;  1TWC H;  3R3O A;  1QVF A;  4Q0F A;  1IBL L;  4ZRZ A;  1LAB A;  2F0K A;  1SYB A;  4M1U B;  3T1Y Q;  1PH2 A;  4Z9C B;  1L1O C;  2VB2 X;  3NWT A;  4ZAI A;  5IYD H;  2B2V C;  4QL5 A;  1VQP A;  5KNC A;  1XJV A;  4X3S A;  2PPB C;  1B70 B;  1STB A;  1AE3 A;  1QJO A;  3GP7 A;  3R93 A;  1HNX Q;  5A2Q E;  3E9I A;  2JK8 A;  1NCV A;  5BR8 L;  1VQ4 A;  4A3B B;  3E0E A;  2KHS A;  4KHV A;  1K0S A;  5A2Q L;  1EY8 A;  1SFO H;  3IAY A;  3H6M A;  3SGI A;  1K0R A;  3A0J A;  2E2J B;  2O4X A;  4GOP C;  3TS0 A;  4DNT B;  4KJO A;  4JI1 L;  3OTO Q;  5HGQ A;  1XPR A;  1V9P A;  2KQ3 A;  1UEA B;  4OXP A;  3S9W A;  4RHS A;  2KEC A;  1XYI A;  2QDL A;  1EYC A;  2EE1 A;  2SOB A;  3C1F A;  2VS1 A;  1ENF A;  3MXN B;  1K83 B;  1CM9 A;  1DOL A;  1CKO A;  1KDC A;  1ENA A;  2R92 H;  1VCI A;  4C2M B;  3HOU B;  1H9R A;  1FYC A;  3GTJ H;  1VQ6 A;  4BBS H;  2E74 C;  4LFA Q;  1G6P A;  1EU4 A;  2BDN A;  2R3Z A;  5IYD G;  2UXC L;  3IRB A;  1VF7 A;  2CQA A;  2ICI A;  2K5W A;  4IZ8 A;  4PNY A;  2Q2I A;  5FO7 B;  4C3J G;  1PTO D;  2XRS D;  1KLG D;  2VB3 X;  1PH4 A;  4K5W A;  2L15 A;  2CWA A;  1PTO F;  4DAM A;  1I4R A;  2OT2 A;  2Q8T A;  4RKL A;  5JJL A;  4JI5 L;  2UUC L;  4KJN A;  1DJR D;  2VUM B;  4KD4 A;  1C48 A;  2Y0S E;  4YIJ A;  3NBH B;  3NEN A;  3AFP A;  4F7X A;  5IT9 L;  4R4Q A;  5D65 A;  2K32 A;  1B44 D;  1VQI A;  2KEN A;  3QOL A;  4LFC L;  4UY8 C;  4R4C A;  3T1Y L;  3GTL H;  1BBU A;  1BBX C;  4A3F G;  4HSP A;  4DR3 Q;  2EXZ A;  1BF4 A;  2ZJQ A;  1X6O A;  4XT3 B;  3W1B A;  1TWC B;  3HOW H;  1J5E L;  1V8Q A;  4O42 A;  2K03 A;  1YJN A;  2D9U A;  3SK5 A;  3GTP H;  1G6Z A;  5IIF A;  1HNX L;  2F03 A;  2YV5 A;  1SE3 A;  2IWH A;  4A3E H;  1E0B A;  1NTG A;  1B9N A;  2A68 C;  4NB3 A;  5AJ3 Q;  1PDQ A;  4JBK A;  2B2T C;  3R2T A;  4DKA C;  3TP6 A;  4OO1 H;  1PH9 A;  5K36 G;  2QW7 A;  3J80 i;  1V1P B;  2G9H D;  5EGT A;  2EYJ A;  2EYP A;  1FNV A;  1Y8N B;  4S3S A;  5KIX A;  4DV1 Q;  2E75 C;  1UUP A;  4QF4 A;  1SFO B;  3OTO L;  1O7L A;  1NR4 A;  3DEP A;  2JA6 H;  2RHQ B;  3H09 A;  2OQ0 A;  4C3I H;  2D0O A;  4NPS A;  5DLQ E;  2B29 A;  5IP7 H;  2CKZ B;  3DWP A;  1VQ8 A;  3EVQ A;  4IO9 A;  3G6E A;  3T4A C;  2UUB Q;  3HP3 A;  1W3S A;  4A4I A;  1L1O B;  3MFG A;  3J7A 5;  2A6E D;  1UWV A;  4LFA L;  1SXT A;  4KTA A;  3TRE A;  1VQA A;  3I56 A;  1U4P A;  3D4D A;  1HPC A;  2NUC A;  3MEF A;  2R92 B;  2IX3 A;  2C9O A;  3GTJ B;  3EJI A;  4BBS B;  1JOO A;  1HTP A;  1H95 A;  4LK1 C;  4EQ5 A;  2YTV A;  1A6X A;  2HHH L;  4H44 C;  4AH6 A;  1ICW A;  2JXM B;  2IX0 A;  1WJJ A;  3E3X A;  3D8G A;  2DN8 A;  1UE1 A;  4YHH Q;  4OO1 G;  4GOP B;  1QE6 A;  2RDG A;  1D1I A;  4DR5 Q;  2RVL A;  3MHB A;  2A5H A;  4DK6 C;  1EQV A;  4CJ2 C;  3TBI B;  5T1G A;  2HUG A;  3CHB D;  5FKA C;  2ID0 A;  2DNC A;  3PUZ A;  5C6A A;  2FFK B;  3I4O A;  3VR4 A;  1VF5 C;  1X3F A;  3GTL B;  5C5M A;  4I65 A;  1PH5 A;  1L0X B;  4OL7 A;  2JA7 H;  1IYV A;  3HOW B;  2OCE A;  2Z6K A;  5C0X G;  3G48 A;  4K2K A;  1DXM A;  5I2Y A;  5AJ3 L;  3GTP B;  1RL2 A;  5CV8 A;  2A6H D;  3FRP B;  2F0P A;  3BYY B;  3J81 i;  3K58 A;  1HQR D;  4IFD G;  1WTP A;  4A3E B;  3CC2 A;  4FF4 A;  1AEX A;  3S14 H;  2YYZ A;  2DJF C;  2BA1 A;  1VQL A;  3MZ5 A;  4IUR A;  5C44 H;  3EN2 A;  2BH2 A;  3SXH A;  1PH3 A;  1JT8 A;  3JAM c;  4DR7 Q;  2JA6 B;  4G7H C;  2L5T A;  2AKW B;  4C3I B;  4LF9 Q;  1PRT B;  2UUB L;  3KF8 B;  1A2T A;  1HTL D;  4GKJ Q;  1H9J A;  3Q0A A;  1SE8 A;  2MJ8 A;  1EL0 A;  4A3C H;  3BVM A;  2IY5 B;  1RD9 D;  4JOI A;  3M4Y A;  1B50 A;  5C5L A;  3H3V H;  4NP5 A;  2NVQ H;  2Z4H A;  4YCV A;  1ZYR C;  4K8I A;  4JPB W;  1SND A;  3BVZ A;  2JA7 G;  1D5M C;  2NWG A;  4UDU C;  3J7A V;  3I91 A;  1VQ9 A;  1S5D D;  2BDO A;  2MPM A;  4YHH L;  1S5C D;  1VQH A;  4EGV A;  3P75 A;  1Y8P B;  4NMZ A;  1GUG A;  4DR5 L;  1SNP A;  4DK3 C;  1SYD A;  3KUP A;  2EJM A;  4L5Q A;  2E5L Q;  4RGM A;  4XTC S;  1EFI D;  1SMX A;  5C44 G;  1QZG A;  2F1M A;  2MHV A;  3WDN A;  2FMC A;  1N9W A;  2A73 B;  1IL8 A;  2EY1 A;  3RN2 A;  4JC0 A;  5LMU Q;  1RF2 D;  1N34 L;  1FVI A;  1K3B C;  2A69 D;  4GKK Q;  4RGO S;  2X6L A;  3S1M H;  5KYL A;  2NB0 A;  3A7A B;  3EA6 A;  2JA7 B;  3ND9 A;  2F0G A;  3DUZ A;  1RIP A;  5JEA J;  1II3 A;  1EY7 A;  1TVX A;  3FPU B;  3S1Q H;  1A3T A;  3U9S A;  2K7V A;  2EIF A;  4XT1 B;  4KK7 A;  2RDF A;  4C1N I;  1PZI D;  3CKI B;  3S14 B;  3L3O C;  2PI2 E;  2GA4 B;  4HID A;  1G29 1;  2ZTC A;  4J6H A;  1Y69 U;  4XXE A;  5C44 B;  1SYE A;  4DR4 Q;  3DMU A;  4CKC A;  2L11 A;  2PQE A;  4TSS A;  1I5F A;  1V1O A;  4MN3 A;  4LF9 L;  1JOR A;  5IGF A;  2VY3 A;  4HIO A;  3X3M A;  3G6J B;  4O1N A;  1YVC A;  1OO9 B;  2DGY A;  3F2C A;  1EYD A;  5IYC G;  4LF8 Q;  3W3A A;  1F9Q A;  4DXG A;  2PMZ B;  1QIL A;  1S5E D;  2Z6K C;  3OIP A;  2A1A A;  1XNQ L;  5C4X G;  1MBY A;  2OXP A;  4PV1 C;  4XYO A;  4X64 Q;  1LTS D;  5GAD C;  4JI2 Q;  3MWY W;  3I4M H;  1VS0 A;  2NVQ B;  3V2T A;  1JWM D;  1RHP A;  5I4D A;  2MO1 A;  4QCL A;  2RKS A;  3DLL A;  1LTI D;  4J1M A;  4FF1 A;  2E5L L;  5DEH A;  2IL8 A;  3ICE A;  4DV2 Q;  1XPO A;  2X6G A;  4MTN A;  1GKH A;  1A0I A;  3U4V A;  3KBX A;  1OXT A;  1B9M A;  1MGS A;  1EY6 A;  2LFN A;  3MXN A;  1R4Q B;  1D1K A;  1BOS A;  3AEV A;  5LMU L;  4JOI C;  1KL9 A;  3I7F A;  4ZKB B;  4K5V A;  1FL0 A;  4O2D A;  4GKK L;  5IYB G;  1XTD A;  1XWE A;  1P16 A;  2K5Q A;  4B3M L;  3I4N H;  1MHW C;  2BE5 C;  2VL6 A;  4DR2 Q;  1I6V C;  3VDY A;  2K05 A;  3RMH A;  3OW7 A;  4OO1 I;  3D3R A;  3S1M B;  2PW5 A;  1EY9 A;  3M3Y H;  2WAQ G;  3K7U C;  1Z6H A;  2G9D A;  4FVM A;  3I4M G;  1N36 Q;  3S1Q B;  1QB5 D;  5CV4 A;  4BA1 I;  1SR3 A;  1FGB D;  2K5V A;  5J3B A;  3NBH A;  2VW9 A;  4DV3 L;  2SNS A;  4IQZ A;  1O7Z A;  5E7N A;  1Q1E A;  3RZO H;  5G3L D;  4RHR A;  2B2W C;  5JAV A;  1F2Y A;  4JBJ A;  1EWI A;  1KLU D;  4UHV A;  3HOV G;  3S15 H;  2CFM A;  4P2C B;  5G3L F;  4P75 A;  2Z4I A;  4OHJ A;  2UUA Q;  4HIK A;  5M5Y H;  1SMY C;  1E22 A;  2KJX A;  4B9X A;  4DF7 A;  1BKB A;  2H4O A;  5HGT A;  4X64 L;  4JI2 L;  2B8F A;  1TWG H;  1EZ6 A;  4HCE A;  5EKI A;  4A93 G;  3PUX A;  5KEE A;  2M9V A;  4K6L A;  4X66 Q;  3C2P A;  4KLK A;  4NW2 A;  2B39 A;  3I4M B;  1CTM A;  5M3F G;  1I50 H;  3EQL C;  4K2L A;  1LT4 D;  5ELO A;  4ZQ3 A;  4OEM B;  3CCU A;  4DV2 L;  1P8L A;  1DON A;  5COR A;  4LF4 Q;  2ZM6 Q;  1STH A;  4HCS A;  1KRT A;  3CCQ A;  1N32 L;  1EZ8 A;  3SDZ A;  4BWG B;  2WV6 D;  2MQH A;  5FLX E;  5C3E H;  2UXD Q;  3KF6 B;  3A74 A;  2K52 A;  1D6E C;  1QUQ A;  4K0K Q;  2Q2T A;  2K33 A;  4N9T A;  1EWH A;  3CP0 A;  2VXW A;  4PZ7 A;  5I2X A;  3S2D H;  1D5Z C;  4GLX A;  1GXD C;  1NSN S;  3X3N A;  1B8A A;  1CZG A;  4DR2 L;  1X3G A;  3DHQ A;  2Z8L A;  1IBM Q;  1ML0 D;  3J80 L;  1EQT A;  3I2Z A;  4QUC A;  3I4N B;  2WAQ E;  4ULL A;  1JJ2 A;  1QZH A;  1PFN A;  3TDQ A;  3FKI H;  1UE6 A;  1M4V A;  1WTQ A;  1PMR A;  5FO8 B;  3IL8 A;  4GS3 A;  5JEA H;  3M3Y B;  1LTA D;  2L12 A;  4XQJ A;  2Z1C A;  1Q12 A;  3PO3 G;  2RQX A;  5CYU A;  1LTL A;  5ELE A;  3PF4 A;  4WOR A;  1SBB B;  1BVS A;  1TU2 B;  2OTL A;  1Y1W G;  3A54 A;  3RZO B;  3A55 A;  1CHQ D;  3D4R A;  3K5N A;  4DR6 Q;  4ME5 A;  4QIW B;  2UUA L;  1M1K C;  2KCC A;  5IP9 G;  1ICF B;  1YNJ D;  5C3E G;  1H9S B;  3H3V I;  3S15 B;  2WB1 B;  2B2Y A;  2F3I A;  1CT1 D;  4UAI A;  1JOK A;  5M5Y B;  3HRZ C;  2D0P A;  1GUN A;  1HH2 P;  4X66 L;  1ONL A;  1TWG B;  2DJG C;  4FXK C;  4Y52 H;  1K9M C;  1IW7 C;  2XSC A;  3K5L A;  5FOB B;  2KEE A;  2E8G A;  1WTV A;  3QWN A;  5K5P A;  4DV6 Q;  4L5T A;  4KD3 A;  2ZM6 L;  1I50 B;  5C3X A;  5IGB A;  3BU2 A;  4DPG A;  2NN6 H;  2OWO A;  3D6W A;  3KYH C;  2UXD L;  1PZK D;  3OOC A;  5CR3 A;  3J81 E;  2EXD A;  1YEZ A;  4K0K L;  1HZA A;  4Q5V A;  3K8A A;  5C3E B;  1VQJ A;  1BDO A;  4F88 A;  5GAH C;  2IHF A;  4LF5 L;  2YTY A;  4HSV A;  3OHX C;  3PIO 3;  2QF7 A;  2QEX A;  1C0A A;  3NP8 A;  3S2D B;  2PYK A;  2JP1 A;  2N3S A;  4A3B G;  4GNX B;  4BA2 I;  4Y7N H;  3HKS A;  1EIH A;  3F2B A;  1IYJ B;  4MTK A;  2FJ2 A;  1MIU A;  2WAC A;  1QCB D;  3FKI B;  1EQQ A;  2EYO A;  4X3T A;  3AMU A;  3DM1 A;  3BZC A;  5EKK A;  4V19 0;  1EWC A;  1TY0 A;  4JI3 L;  3OW2 A;  5NUC A;  5E3F A;  1IKM A;  3M9B A;  2PZT A;  2K5D A;  3I73 A;  4ID6 A;  1HCZ A;  1HZB A;  4DR6 L;  4B3T Q;  4PZ6 A;  2E2I B;  4HJ5 A;  2B3G A;  1KDB A;  1TR5 A;  3NEL A;  1D8L A;  1PYS B;  3HOU G;  4TQU S;  1J6Q A;  1STA A;  2P5Z X;  2MGS A;  2LMC B;  2F0S A;  3R8B A;  3U9O A;  5JPM C;  3HZX A;  3K7A H;  3S2H H;  1A63 A;  3HOY H;  4JI6 Q;  1XX8 A;  2BOS A;  4X6A H;  1FGU A;  5FO9 B;  2EYH A;  3EBE A;  4X3U A;  1SE2 A;  2VUM G;  1LLR D;  4ZCK A;  1TS2 A;  4A75 A;  5BN5 A;  4J8Q A;  2EZV A;  3QJY A;  3PGZ A;  3NTI A;  4GN3 B;  3GD7 A;  1K8G A;  3L2P A;  1JWS D;  2O5I C;  4APV A;  3F8T A;  1TII D;  2CH4 A;  2XTI A;  1G51 A;  2SDF A;  4N9P A;  2LSS A;  5JVH 3;  1MD2 D;  2UXB L;  1JB3 A;  2B2Y C;  4JBM A;  4OX9 Q;  2ICE C;  4X65 Q;  1JC7 A;  5CV9 A;  1VQN A;  1WVL A;  2EY6 A;  2PZU A;  3TS2 A;  1MI2 A;  4A3J H;  1B2T A;  4RFB A;  4Y7N B;  3PIP 3;  1QWY A;  4B9W A;  4RGT A;  1NJI C;  1KHI A;  3DWQ A;  4ZLT F;  3A8J E;  5F2D A;  1CFM A;  1VQE A;  2EYL A;  1KD1 C;  2B63 H;  4JG2 A;  1PRT C;  3FPP A;  4G7Z C;  3RN5 A;  2SNM A;  5H1S E;  4OWW B;  4B3T L;  3NTH A;  4KKU A;  4DXF A;  5I9O A;  2ZJR A;  4ILW A;  2QGQ A;  2F0E A;  5D14 A;  4CDD C;  4E6I A;  3PCO B;  1Z7T A;  2XWJ B;  4H0L C;  2WFW A;  2R92 G;  4J15 A;  1NUC A;  1Y1V H;  4U67 3;  5M3M H;  4BBS G;  3C3L A;  3SVM A;  4JI6 L;  1CSP A;  3L7Z C;  1GHK A;  1EYA A;  3K7A B;  3S2H B;  1KNA A;  3UDI A;  3S24 A;  3JAM E;  1JWU D;  3HOY B;  1ENC A;  1PH1 A;  3ZJY C;  3PV0 A;  4H02 A;  5I6Y A;  2F0U A;  2ZTE A;  1YIJ A;  2ZTD A;  5TSS A;  1IZ6 A;  5CBA E;  1F9P A;  1XTC D;  3OIQ A;  3D0F A;  2RSO A;  1HZC A;  1YIT A;  1K3R A;  2F4V Q;  4K6D A;  1QUQ B;  3BDL A;  5IY0 A;  1SE4 A;  1CQV A;  1QVC A;  4HN7 A;  3GV3 A;  2OTJ A;  1GUT A;  2EY5 A;  3HOW G;  4YY3 Q;  2HCI A;  5D3D A;  4BBR H;  4DFA A;  2RA4 A;  2TMP A;  1M90 C;  2K75 A;  3TP5 A;  3VR6 A;  4K8J A;  5HUR A;  2BH8 A;  4XDX A;  4B3S Q;  1BNZ A;  1E3P A;  3TEH B;  4A3E G;  4QY7 A;  5M3M G;  1LT3 D;  1KXL A;  3CF5 A;  4A3J B;  1OTC A;  4FXG C;  4HR7 B;  1HFN A;  2RF4 A;  1U4R A;  4IJL A;  4ABN A;  3CME A;  1X3Q A;  2JA6 G;  2IX1 A;  1HA5 A;  4DR3 L;  4C3I G;  2SEB D;  4R4I A;  2N49 A;  3PO2 H;  5IP7 G;  4LUZ A;  2B63 B;  2JE6 I;  3KF6 A;  3T1H Q;  4RGN A;  2EJF C;  4LF6 Q;  5J1Z A;  2Q8R E;  3H0G H;  2IT1 A;  3BZD B;  1BCP C;  5ELC A;  5IT9 c;  3WOF A;  3H3V C;  3CCS A;  3RLF A;  5IWA Q;  1KNE A;  3TP8 A;  3F2D A;  2CHB D;  1VQB A;  1Y1V B;  5M3M B;  2K28 A;  4KHP Q;  4DV1 L;  4P73 A;  3SE0 A;  2KHI A;  5LMN Q;  3K57 A;  4CHT B;  4JI0 Q;  4A3L H;  1HJP A;  3ERS X;  3HEJ A;  1HZ9 A;  2NN6 I;  5CBE E;  3IFT A;  2KBN A;  2M2L A;  1PH8 A;  3HKZ B;  3FMC A;  3OMC A;  2CQO A;  3E0J A;  3QR8 A;  4DGZ A;  2F4V L;  1GUO A;  1VQ5 A;  1OXX K;  1SMY D;  3B6Y A;  1MSH A;  2JA9 A;  4QJF A;  2LKV A;  1A62 A;  4CJ0 B;  1H9S A;  4YY3 L;  1RTO A;  2L0C A;  1F2M A;  4ZUI A;  5J39 A;  3K6O A;  5C4J H;  2TSS A;  4AQY Q;  3PIO A;  4CKE A;  4B3S L;  1FNW A;  1K8A C;  3U58 A;  1DZ1 A;  4BBR B;  4NDX A;  4DAP A;  4A3D H;  4ZKC B;  3OWE B;  2K01 A;  1VQG A;  1H9M A;  3SK6 A;  1K73 C;  4JVZ A;  1X56 A;  3I4L A;  4GLV B;  3MFY A;  3WWV A;  1NMG A;  4R4T A;  4BXX H;  1TXY A;  4OEL B;  3SK4 A;  2V4D A;  2PW7 A;  1Z47 A;  1AN8 A;  3HOZ H;  3UI2 A;  3J81 j;  2DUD A;  4EQN A;  3ULP A;  3T1H L;  2QCP X;  4LF6 L;  1PFS A;  1GOZ A;  1U0L A;  1E2W A;  3TQY A;  2F52 A;  1QNK A;  3GDE A;  3PO2 B;  2ALY B;  2MNA A;  4P71 A;  1HNZ Q;  5IWA L;  4A3C G;  2VZA A;  3H0G B;  1A8V A;  3C1E A;  2F3V A;  1ET9 A;  3JC6 6;  3CCR A;  4GNX A;  2ZJP A;  5LMN W;  4KHP L;  2GN5 A;  2KUM A;  5LMN L;  4WJW A;  1HHV A;  4UPA A;  4JI0 L;  3K0X A;  1JR0 D;  4ME3 A;  1TWF H;  1HRJ A;  4DR7 L;  1X32 A;  4IN3 A;  3T56 B;  1TY2 A;  5JOB A;  1PTO H;  4OIJ A;  4GKJ L;  4UP7 A;  3ER0 A;  1EU3 A;  1IBK Q;  1FJG Q;  1O80 A;  1MJC A;  3S16 H;  1BBW A;  1JJG A;  4DNR B;  1LTG D;  4AQY L;  2EVB A;  4CJ1 B;  1BCP B;  4POG A;  3NQI A;  3UE1 A;  2AUJ D;  1M8A A;  4PQX A;  4QB4 A;  5CV7 A;  5KGU A;  2WP8 J;  5C4J B;  4WJ3 M;  1CA6 A;  2F0Q A;  1I4H A;  2JEA I;  4QGU A;  2NZ1 D;  1KQS A;  2A8V A;  4A3D B;  2PNH A;  4GN5 A;  4HAE A;  1Q90 A;  3PIP A;  1QG7 A;  1NBW A;  2WKC A;  3T16 A;  1CKM A;  1E7Z A;  3I90 A;  3PSI A;  4FF3 A;  1K8M A;  3NK9 A;  3I70 A;  2F0T A;  1E2V A;  3JAM i;  2EJG C;  2PMZ E;  3HOZ B;  1DCZ A;  1L2F A;  4BS9 A;  3KOJ A;  1SDF A;  2CH4 W;  5FK9 C;  1D7Q A;  2PQA A;  2F0V A;  1N8R C;  5EPJ A;  3STB D;  3LX0 A;  1AH9 A;  1CKN B;  1U9R A;  3H91 A;  5ELD A;  2LXK A;  2K04 A;  1HNZ L;  3CPW A;  1BQQ T;  4HMI A;  1BO0 A;  2KOL A;  3MEH A;  1T5X D;  5FJ8 H;  2YTX A;  1SNM A;  1A3V A;  4LAA A;  2NVY H;  4NKL A;  1J8I A;  3I72 A;  3CQZ H;  1KDA A;  4F87 A;  3PUW A;  1X65 A;  4JI8 Q;  3MXG A;  1Z9F A;  1XXG A;  3KDF B;  2I07 B;  4H7B A;  1L0W A;  1V1Q A;  2EOT A;  2JQO A;  2JA8 H;  2QDB A;  3CCV A;  4DR4 L;  1WTW A;  1ESR A;  1I4P A;  1LYL A;  3DXJ C;  5KYI A;  1TWF B;  1SRU A;  4IAL A;  4LF8 L;  1JOQ A;  2N55 A;  2F0J A;  1E1T A;  2I5H A;  3G4S A;  3BG3 A;  4JV5 Q;  3UE0 A;  1IBK L;  2J7Z A;  1PTO B;  3ULL A;  3U50 C;  4B3R Q;  1STY A;  4LUV A;  4RMF A;  1B1Z A;  1LAC A;  2KCT A;  2I46 A;  3S16 B;  4KHZ A;  4GNX C;  2NVX H;  1YJ9 A;  3H15 A;  5T1I A;  3I4N G;  4OWT B;  3BDO A;  1SRO A;  1WTR A;  2R7Z H;  5FJ8 G;  1A3U A;  4RCN A;  1XMO Q;  4PZ8 A;  3RD4 A;  4A3G H;  1Q3L A;  1IYU A;  3S1R H;  3FVQ A;  4ODG A;  3W5O A;  4KV6 A;  3C46 A;  4OON A;  1HR0 Q;  1L0Y B;  3MXU A;  1HUM A;  3DM3 A;  1NY4 A;  4V0B A;  3PF5 A;  4DU9 A;  1BXT A;  1KAA A;  3RLO A;  3NPP A;  1K28 A;  3Q22 A;  3NE5 B;  3LGJ A;  1KRS A;  4QMG A;  1T5E A;  5FLX L;  1JE4 A;  4IUP A;  4X62 Q;  1XMQ Q;  1EOV A;  1GD7 A;  2WB1 G;  1ILQ A;  3NXW A;  4BY1 H;  1JQY D;  1NAP A;  3P7J A;  2Z6B A;  5JPN C;  5C4Z A;  1LT5 D;  1HFG A;  1WYD A;  3AQQ A;  3HOX H;  1JMC A;  1B53 A;  1ZEQ X;  3AYH B;  1MJE A;  4GN4 B;  4IUV A;  1U5K A;  1N36 L;  3MTS A;  1FD7 D;  2NVY B;  3QG1 A;  4OWX B;  2F0F A;  2ZXO A;  2HIV A;  2I5L X;  1PHJ A;  3CQZ B;  2WKD A;  4C1N K;  1Q8I A;  3TN2 A;  1KIX A;  2LY7 A;  2I5M X;  2XIW A;  1R9T H;  4A3G G;  2JA8 B;  2E2I H;  1DM0 B;  1ASY A;  1RTN A;  2XWB B;  3J7Y W;  1EQR A;  4JV5 L;  2KVM A;  3OSO A;  2NZO A;  1AE2 A;  2G5D A;  3DWA A;  3A8I E;  4MIU A;  2R6G A;  1LV9 A;  1OXS C;  2MFI A;  1YNN C;  5A35 A;  2A68 D;  2NVT H;  3MAQ A;  1DGS A;  5I9P A;  2EY2 A;  2V1C C;  4NXM Q;  4KI0 A;  1HUN A;  5GRO A;  4JBW A;  2EYF A;  4DNI A;  4HTH A;  4RCO A;  3K80 C;  5LL6 X;  3L9A X;  1PVO A;  2XNA C;  4IUQ A;  4CGY B;  3KLS A;  2NVX B;  1FNU A;  3BVG A;  1VQ7 A;  1XMO L;  4RKB A;  4EQP A;  5JVG 3;  1HR0 W;  1S5B D;  5KRU A;  4R4O A;  3TME A;  2DNE A;  3NEM A;  2R7Z B;  1C7Y A;  3URY A;  4G4K A;  3FKI G;  3IKJ A;  5I6W A;  4LF4 L;  2VNU D;  1ZKO A;  3FHW A;  5C4H A;  4A3G B;  2OF1 A;  5JEA G;  3S1R B;  2LS0 1;  1YHQ A;  2AUK A;  1VMP A;  1LTB D;  1S3O A;  4QIW E;  3K59 A;  4IOC A;  4X62 L;  1XMQ L;  2WB1 E;  2D2C C;  3PUY A;  3RLN A;  4DV7 Q;  5FLM H;  4DAY A;  3J81 L;  2R7D A;  3NBI A;  4CKB A;  4JI1 Q;  4QUF A;  1IBM L;  1ASZ A;  4MNO A;  3KBG A;  5C0X J;  4IPG A;  4DV0 Q;  3MVV A;  2CVR A;  3J7Z C;  3D6C A;  4BY1 B;  4RWS C;  4IFD J;  5M9O A;  4WJ4 A;  3KJO A;  1U4M A;  3HOX B;  4BY7 H;  1Y8O B;  1W6K A;  1W6J A;  3GQB A;  1EEI D;  4R8I A;  2CW0 C;  3RNU A;  2JN4 A;  2K1B A;  2R7F A;  3K5M A;  2FHT A;  3FEW X;  3N52 A;  4WFN 3;  3GO5 A;  2M00 A;  5IGG A;  3J80 c;  5EQ0 A;  3GV6 A;  1TS5 A;  1S4Z A;  2K6A A;  1TQO A;  1E24 A;  5DAU A;  1R9T B;  5EJW A;  4XQN A;  3TZU A;  1CUK A;  1DOK A;  2NN6 G;  3HS0 C;  4KN7 C;  4JI5 Q;  1WI5 A;  2NYZ D;  2F0N A;  5IE8 A;  2F0D A;  3CXC A;  2JYO A;  4NXM L;  2Y0S G;  2NVT B;  2YU9 H;  5GQO A;  4CDE C;  1JB7 A;  1SAP A;  2JA5 H;  2VQF Q;  4K14 A;  2HIX A;  4FDB A;  4C56 C;  2IJ0 A;  2RDH A;  4G7O C;  1J9O A;  1J5E Q;  4JCV E;  2HD3 A;  3VA5 A;  2PZW A;  2AWN A;  1STE A;  4YWL A;  4C3J H;  4A3I H;  1F9R A;  4DV6 L;  4FF2 A;  4ALP A;  1VQM A;  4BY7 G;  3BZK A;  1AZP A;  1DD2 A;  3BS1 A;  2JSO A;  2CCZ A;  2Z9H A;  1SJE D;  4LF7 Q;  2O5J C;  3E6Z X;  1D2B A;  4HJA A;  1S40 A;  4KY6 A;  1CZW A;  1ZYR D;  2PQA B;  4DV7 L;  1X9N A;  4CBV A;  1WTX A;  1HA6 A;  1SYG A;  3K0Y A;  3CMA A;  4C3H H;  4A3F H;  1RCV D;  1SNC A;  2Y0S B;  4JW0 A;  4LJZ C;  4DV0 L;  1F77 A;  1YHA A;  3QIA A;  4XYQ A;  2QEJ C;  1Q81 C;  1F2Z A;  1TT2 A;  2AQ2 B;  2QIL A;  1MSG A;  3PMF A;  1EIY B;  2DY8 A;  2K14 A;  2JA5 G;  4HJ7 A;  3HOY G;  1OXV A;  1I4G A;  1Q1B A;  1MKH A;  3J81 c;  1Q82 C;  4BY7 B;  2A19 A;  3CAM A;  5K36 H;  2L1B A; 
#chains in the Genus database with same CATH homology
 1RDP D;  1WD0 A;  1LO5 D;  5CV6 A;  4DA2 A;  4RAU C;  3T13 A;  3Q23 A;  3D4W A;  1I4Q A;  1BR9 A;  5IT9 E;  1S5F D;  4GZY C;  3O13 A;  1GHJ A;  3KK7 A;  5BN4 A;  1U4L A;  2KCN A;  1SYC A;  4C3H G;  1O78 A;  5BN3 A;  2D5D A;  2YU9 B;  4HED A;  2JA5 B;  1UNS A;  1F9S A;  2F4I A;  2Q8I B;  2L55 A;  4IUN A;  1G2S A;  1TS3 A;  3JAM L;  4C3J B;  4A3I B;  1YNJ C;  5CV5 A;  3SEB A;  3K5O A;  1A2U A;  3G7L A;  4G57 A;  3SHL A;  5IGC A;  1WTO A;  1PYW D;  4H13 C;  4C3H B;  3OMG A;  4A3F B;  1JIC A;  1HQM C;  2ZXP A;  2HQE A;  2KED A;  5C0X H;  5DNF A;  4OIK A;  4F8M A;  4IFD H;  2AQ1 B;  5COY A;  3CRL C;  1CA5 A;  2X69 A;  2PO4 A;  5KNB A;  1SJH D;  2C5C A;  4FYD A;  3D31 A;  1G8Z D;  3EFX D;  1EIG A;  1C4Q A;  1GUW A;  2BE5 D;  3OPO A;  1G2T A;  3P20 A;  4KN4 C;  5CGK A;  4K5X A;  1RJT A;  5IOD A;  2L4N A;  5DM7 3;  3RZD B;  2QKI C;  3T51 B;  2BA0 A;  3GTO B;  5AFW A;  1B3A A;  5CMD A;  3TZD A;  5DM6 3;  1SNQ A;  2BCO A;  4TRD A;  4B08 A;  1PXU A;  4DN4 M;  3E5S A;  3A7L A;  1KTK A;  1PLF A;  3F2U A;  2WIN B;  2F3W A;  3A8K E;  2XN9 C;  5EPL A;  2R61 A;  2EYM A;  1I3Q B;  1TWH B;  2E2H B;  4KY7 A;  1B4O A;  2HCC A;  1K8O A;  5LHY 1;  1PTO C;  3MC0 B;  2D62 A;  3VR3 A;  1TWA B;  5ELF A;  4PMB A;  2EDG A;  4EVO A;  1D5X C;  4KMU C;  3VR2 A;  1DYQ A;  4TKO B;  4M8A A;  3CU7 A;  3LNN A;  2B2W A;  3Q24 A;  4IUT A;  1LTR D;  1H9K A;  3GTQ B;  2MP1 A;  3BDC A;  1NR2 A;  2H1E A;  2PNR C;  3KLS X;  2F0L A;  1O7Y A;  2HDM A;  1YNN D;  1GJX A;  5ISR A;  1KAB A;  2IW3 A;  2RBM A;  1STG A;  3V96 A;  3DEO A;  2HDL A;  3I8Z A;  1C8C A;  1AFP A;  1IW7 D;  3IFD A;  5LL6 S;  1EEF D;  1UAP A;  2DY7 A;  3VYS A;  4IUU A;  4RA8 A;  4ZYS A;  5E1F A;  1TS4 A;  4JK1 C;  3QOJ A;  2A6E C;  1GUS A;  1QOH A;  4L6T B;  5E4X A;  3M4O B;  2B2U A;  4R8N A;  4A3M B;  4XIG S;  4RH6 A;  2FIN B;  3CRK C;  3P1H A;  1CK1 A;  1LTT D;  3ERO A;  2J0T D;  1IHZ A;  5JJZ A;  2XRQ D;  4KKT A;  4A3K B;  2CW0 D;  4X3K A;  2IPK D;  3NWS A;  3NHH A;  2B8G A;  1FR3 A;  3HGB A;  1ET6 A;  5C4X B;  4AYB B;  2OEO A;  5EPK A;  3MA2 B;  2E2D C;  4FP5 D;  3QB3 A;  3GTG B;  3V05 A;  2A6H C;  2MUY A;  5M5X B;  2FMM A;  1JCK B;  1STN A;  1VDZ A;  4L8J A;  1WD1 A;  3TSS A;  1HXY D;  5IGD A;  3A56 A;  1ESF A;  1SSO A;  1PZJ D;  3M7G A;  1ROD A;  4R9W A;  1WCM B;  5C0X I;  3BYT B;  2F0W A;  2ZXR A;  2J4X A;  3I3C A;  4PMC A;  3T53 B;  5IGE A;  2KA7 A;  4IFD I;  5IOC A;  3NUC A;  1PFM A;  3LWU A;  1VMC A;  2XVS A;  5C3W A;  3WOE A;  3VR5 A;  2JEB I;  2N88 A;  2WAQ B;  3R2I A;  4ZK9 B;  1V1P A;  5CC4 A;  4ZUJ A;  2F0M A;  1LT6 D;  3MXP A;  1QNU A;  5D3I B;  1RKN A;  1CQF A;  3N6R A;  4PMW A;  3TP7 A;  3FDT A;  1G91 A;  4LMQ D;  3HOV B;  4FO2 A;  4MHE A;  3AU7 A;  2O2L D;  4L63 B;  3VYR A;  1V43 A;  2WII B;  2B2V A;  4FXD A;  3J80 E;  1PRT D;  2R93 B;  2A74 C;  3ERQ A;  3SR1 A;  1TKW B;  2EPB A;  3VYT A;  1AZQ A;  1PRT F;  4A93 B;  4DK1 A;  1AP0 A;  2A69 C;  1ILP A;  1SEB D;  4I7Z C;  5J22 A;  2B2U C;  5EKL A;  2E76 C;  3SK8 A;  5M3F B;  3ITP A;  3J7A F;  1I4X A;  4FNF A;  2AQ3 B;  4KKS A;  1R4P B;  3S1N B;  1EY0 A;  2F0I A;  1PFB A;  1X3P A;  4KY5 A;  3KLR A;  2AWO A;  1DOM A;  4EQO A;  4DK0 A;  1EY5 A;  1AW7 A;  1E2Z A;  3S17 B;  2ZT9 C;  1BUV T;  2NTT A;  3ZYY X;  1SNO A;  3HG9 A;  3ONA B;  1EOT A;  3VYU A;  1I6H B;  4OGQ C;  3VA7 A;  3NTK A;  1SYF A;  4DAV A;  3ND8 A;  2NBF A;  3H94 A;  1F2L A;  3PO3 B;  5M5W B;  3AB9 A;  2L9H A;  1Y1W B;  2NTS A;  3PUV A;  3M7N A;  2F0O A;  3KF8 A;  2ENB A;  1IKL A;  3NQT A;  3GTM B;  3RUZ A;  4XQQ A;  3W2D A;  1CHP D;  3LWE A;  3OWF A;  3M85 A;  4WRD A;  5E4W C;  3QO2 A;  1OXU A;  2B2T A;  1ZXT A;  1BCP D;  5EBC A;  4U68 A;  3Q6S A;  5KND A;  1BCP F;  2F0H A;  2PCF B;  5EBD A;  1CI3 M;  2RSN A;  3GTK B;  4HMJ A;  1A15 A;  3NSW A;  5ELB A;  3R3O A;  4Q0F A;  4ZRZ A;  1LAB A;  2F0K A;  1SYB A;  4M1U B;  4Z9C B;  2VB2 X;  3NWT A;  4ZAI A;  2B2V C;  5KNC A;  4X3S A;  2PPB C;  1STB A;  1QJO A;  3GP7 A;  3R93 A;  5A2Q E;  1NCV A;  4A3B B;  4KHV A;  2KHS A;  5A2Q L;  1EY8 A;  3IAY A;  3H6M A;  2E2J B;  2O4X A;  4DNT B;  4KJO A;  2KQ3 A;  1UEA B;  3S9W A;  4RHS A;  2KEC A;  1XYI A;  1EYC A;  2EE1 A;  2SOB A;  3C1F A;  1ENF A;  1K83 B;  1CM9 A;  1DOL A;  1KDC A;  1ENA A;  1VCI A;  4C2M B;  3HOU B;  1H9R A;  1FYC A;  2E74 C;  1EU4 A;  2BDN A;  2R3Z A;  1VF7 A;  2CQA A;  2ICI A;  2K5W A;  4IZ8 A;  4PNY A;  5FO7 B;  4C3J G;  1PTO D;  2XRS D;  1KLG D;  2VB3 X;  4K5W A;  1PTO F;  1I4R A;  2OT2 A;  2Q8T A;  4RKL A;  4KJN A;  1DJR D;  2VUM B;  4KD4 A;  1C48 A;  4YIJ A;  4F7X A;  5IT9 L;  5D65 A;  2K32 A;  1B44 D;  3QOL A;  1BBX C;  4HSP A;  2EXZ A;  1BF4 A;  4XT3 B;  1TWC B;  1V8Q A;  4O42 A;  2K03 A;  2D9U A;  3SK5 A;  1G6Z A;  5IIF A;  2F03 A;  1SE3 A;  2IWH A;  1E0B A;  1B9N A;  2A68 C;  1PDQ A;  2B2T C;  3R2T A;  3TP6 A;  4OO1 H;  5K36 G;  1V1P B;  2G9H D;  5EGT A;  2EYJ A;  2EYP A;  1FNV A;  1Y8N B;  4S3S A;  5KIX A;  2E75 C;  1UUP A;  4QF4 A;  1SFO B;  1O7L A;  1NR4 A;  3DEP A;  3H09 A;  3DWP A;  3EVQ A;  3T4A C;  3HP3 A;  3MFG A;  2A6E D;  1SXT A;  4KTA A;  1U4P A;  3D4D A;  1HPC A;  2NUC A;  2R92 B;  2IX3 A;  2C9O A;  3GTJ B;  3EJI A;  4BBS B;  1JOO A;  1HTP A;  4LK1 C;  1A6X A;  4H44 C;  1ICW A;  2JXM B;  2IX0 A;  3D8G A;  2DN8 A;  4OO1 G;  1QE6 A;  2RDG A;  1D1I A;  2RVL A;  3MHB A;  2A5H A;  1EQV A;  4CJ2 C;  3TBI B;  5T1G A;  2HUG A;  3CHB D;  5FKA C;  2ID0 A;  2DNC A;  3PUZ A;  5C6A A;  2FFK B;  3VR4 A;  1VF5 C;  3GTL B;  5C5M A;  4I65 A;  1L0X B;  4OL7 A;  1IYV A;  3HOW B;  5C0X G;  4K2K A;  1DXM A;  5I2Y A;  3GTP B;  5CV8 A;  2A6H D;  3FRP B;  2F0P A;  3BYY B;  3K58 A;  1HQR D;  4IFD G;  1WTP A;  4A3E B;  4FF4 A;  1AEX A;  2YYZ A;  2BA1 A;  3MZ5 A;  4IUR A;  3SXH A;  2JA6 B;  4G7H C;  2L5T A;  4C3I B;  1PRT B;  1A2T A;  1HTL D;  1H9J A;  3Q0A A;  2MJ8 A;  1EL0 A;  3BVM A;  1RD9 D;  1B50 A;  3M4Y A;  5C5L A;  4NP5 A;  2Z4H A;  1ZYR C;  4K8I A;  1SND A;  3BVZ A;  1D5M C;  2NWG A;  4UDU C;  3J7A V;  3I91 A;  1S5D D;  2BDO A;  2MPM A;  1S5C D;  4EGV A;  3P75 A;  1Y8P B;  4NMZ A;  1GUG A;  1SNP A;  1SYD A;  3KUP A;  2EJM A;  4RGM A;  4XTC S;  1EFI D;  2F1M A;  2MHV A;  3WDN A;  2FMC A;  2A73 B;  1IL8 A;  2EY1 A;  1RF2 D;  2A69 D;  4RGO S;  2X6L A;  5KYL A;  2NB0 A;  3A7A B;  3EA6 A;  2JA7 B;  3ND9 A;  2F0G A;  3DUZ A;  5JEA J;  1II3 A;  1EY7 A;  1TVX A;  3FPU B;  1A3T A;  3U9S A;  2K7V A;  4XT1 B;  4KK7 A;  2RDF A;  4C1N I;  1PZI D;  3CKI B;  3S14 B;  3L3O C;  2GA4 B;  1G29 1;  4J6H A;  1Y69 U;  4XXE A;  5C44 B;  1SYE A;  3DMU A;  4CKC A;  2L11 A;  2PQE A;  4TSS A;  1V1O A;  4MN3 A;  1JOR A;  5IGF A;  3X3M A;  3G6J B;  4O1N A;  1OO9 B;  1EYD A;  3W3A A;  1F9Q A;  4DXG A;  2PMZ B;  1QIL A;  1S5E D;  3OIP A;  1MBY A;  2OXP A;  4PV1 C;  4XYO A;  1LTS D;  3MWY W;  2NVQ B;  3V2T A;  1JWM D;  1RHP A;  5I4D A;  4QCL A;  2RKS A;  1LTI D;  4J1M A;  4FF1 A;  5DEH A;  2IL8 A;  2X6G A;  3KBX A;  1OXT A;  1B9M A;  1MGS A;  1EY6 A;  2LFN A;  3MXN A;  1R4Q B;  1D1K A;  1BOS A;  4ZKB B;  4K5V A;  1XWE A;  2K5Q A;  2BE5 C;  1I6V C;  2K05 A;  3RMH A;  3OW7 A;  4OO1 I;  3D3R A;  3S1M B;  2PW5 A;  1EY9 A;  1Z6H A;  2G9D A;  4FVM A;  3S1Q B;  1QB5 D;  5CV4 A;  4BA1 I;  1FGB D;  3NBH A;  2SNS A;  4IQZ A;  1O7Z A;  1Q1E A;  5G3L D;  4RHR A;  2B2W C;  5JAV A;  1F2Y A;  1KLU D;  4P2C B;  5G3L F;  2Z4I A;  4OHJ A;  1SMY C;  2KJX A;  4B9X A;  4DF7 A;  2H4O A;  5HGT A;  2B8F A;  1EZ6 A;  4HCE A;  5EKI A;  3PUX A;  5KEE A;  2M9V A;  4K6L A;  3C2P A;  3I4M B;  4NW2 A;  2B39 A;  1CTM A;  3EQL C;  4K2L A;  1LT4 D;  4ZQ3 A;  1DON A;  5COR A;  1STH A;  4HCS A;  1EZ8 A;  3SDZ A;  4BWG B;  2WV6 D;  5FLX E;  1D6E C;  2K33 A;  4N9T A;  1EWH A;  2VXW A;  5I2X A;  1D5Z C;  1GXD C;  1NSN S;  3X3N A;  1CZG A;  3DHQ A;  2Z8L A;  1ML0 D;  3J80 L;  1EQT A;  4QUC A;  3I4N B;  4ULL A;  1PFN A;  3TDQ A;  1M4V A;  1WTQ A;  1PMR A;  5FO8 B;  3IL8 A;  5JEA H;  3M3Y B;  1LTA D;  2L12 A;  4XQJ A;  2Z1C A;  1Q12 A;  2RQX A;  5CYU A;  5ELE A;  4WOR A;  1SBB B;  1TU2 B;  3A54 A;  3RZO B;  3A55 A;  1CHQ D;  3D4R A;  3K5N A;  4ME5 A;  4QIW B;  2KCC A;  1YNJ D;  3S15 B;  1H9S B;  2WB1 B;  2B2Y A;  1CT1 D;  4UAI A;  1JOK A;  5M5Y B;  3HRZ C;  1GUN A;  1ONL A;  1TWG B;  4FXK C;  1IW7 C;  2XSC A;  3K5L A;  5FOB B;  2KEE A;  1WTV A;  3QWN A;  5K5P A;  4KD3 A;  1I50 B;  5C3X A;  5IGB A;  2NN6 H;  3D6W A;  1PZK D;  3OOC A;  5CR3 A;  3J81 E;  4Q5V A;  5C3E B;  1BDO A;  4F88 A;  4HSV A;  3OHX C;  3PIO 3;  2QF7 A;  3NP8 A;  3S2D B;  2PYK A;  2JP1 A;  4BA2 I;  1EIH A;  2FJ2 A;  2WAC A;  1QCB D;  3FKI B;  3AMU A;  2EYO A;  4X3T A;  3DM1 A;  5EKK A;  4V19 0;  1EWC A;  1TY0 A;  5NUC A;  5E3F A;  1IKM A;  2PZT A;  2K5D A;  3I73 A;  4ID6 A;  1HCZ A;  2E2I B;  1KDB A;  1TR5 A;  4TQU S;  1STA A;  2MGS A;  2LMC B;  2F0S A;  3R8B A;  3U9O A;  5JPM C;  3HZX A;  1XX8 A;  2BOS A;  5FO9 B;  2EYH A;  4X3U A;  1SE2 A;  1LLR D;  1TS2 A;  5BN5 A;  4J8Q A;  2EZV A;  3QJY A;  3NTI A;  3GD7 A;  1JWS D;  2O5I C;  1TII D;  4N9P A;  2SDF A;  5JVH 3;  1MD2 D;  1JB3 A;  2B2Y C;  2ICE C;  1JC7 A;  5CV9 A;  1WVL A;  2EY6 A;  2PZU A;  1MI2 A;  1B2T A;  4RFB A;  4Y7N B;  3PIP 3;  1QWY A;  4B9W A;  4RGT A;  3DWQ A;  4ZLT F;  3A8J E;  5F2D A;  1CFM A;  2EYL A;  1PRT C;  3FPP A;  4G7Z C;  2SNM A;  3NTH A;  4KKU A;  4DXF A;  5I9O A;  4ILW A;  2F0E A;  5D14 A;  4E6I A;  1Z7T A;  2XWJ B;  4H0L C;  1NUC A;  4U67 3;  3C3L A;  3SVM A;  3L7Z C;  1GHK A;  1EYA A;  3K7A B;  3S2H B;  1KNA A;  3JAM E;  1JWU D;  3HOY B;  1ENC A;  3PV0 A;  5I6Y A;  2F0U A;  5TSS A;  5CBA E;  1F9P A;  1XTC D;  3OIQ A;  2RSO A;  4K6D A;  3BDL A;  1SE4 A;  1CQV A;  4HN7 A;  3GV3 A;  1GUT A;  2EY5 A;  2HCI A;  5D3D A;  4DFA A;  2RA4 A;  2TMP A;  3TP5 A;  3VR6 A;  4K8J A;  5HUR A;  4XDX A;  1BNZ A;  1LT3 D;  4A3J B;  4FXG C;  4HR7 B;  1HFN A;  1U4R A;  4ABN A;  1X3Q A;  2IX1 A;  1HA5 A;  4C3I G;  2SEB D;  2B63 B;  2JE6 I;  4RGN A;  2EJF C;  5J1Z A;  2Q8R E;  2IT1 A;  3BZD B;  1BCP C;  5ELC A;  3WOF A;  3H3V C;  3RLF A;  1KNE A;  3TP8 A;  2CHB D;  1Y1V B;  5M3M B;  2K28 A;  3SE0 A;  3K57 A;  4CHT B;  3HEJ A;  2NN6 I;  5CBE E;  3IFT A;  2M2L A;  3HKZ B;  3FMC A;  3OMC A;  3E0J A;  4DGZ A;  1GUO A;  1OXX K;  1SMY D;  1MSH A;  2LKV A;  4CJ0 B;  1H9S A;  1RTO A;  2L0C A;  1F2M A;  4ZUI A;  5J39 A;  3K6O A;  2TSS A;  4CKE A;  1FNW A;  1DZ1 A;  4BBR B;  4NDX A;  4DAP A;  4ZKC B;  3OWE B;  2K01 A;  1H9M A;  3SK6 A;  3I4L A;  3MFY A;  3SK4 A;  2V4D A;  2PW7 A;  1Z47 A;  1AN8 A;  3UI2 A;  4EQN A;  2QCP X;  1GOZ A;  1E2W A;  1QNK A;  3PO2 B;  3H0G B;  3C1E A;  2F3V A;  1ET9 A;  2KUM A;  4WJW A;  1HHV A;  1JR0 D;  1HRJ A;  1X32 A;  4IN3 A;  3T56 B;  1TY2 A;  5JOB A;  1PTO H;  4OIJ A;  1EU3 A;  1O80 A;  4DNR B;  1LTG D;  2EVB A;  4CJ1 B;  1BCP B;  3NQI A;  2AUJ D;  1M8A A;  4PQX A;  4QB4 A;  5CV7 A;  5KGU A;  2WP8 J;  5C4J B;  1CA6 A;  2F0Q A;  1I4H A;  2JEA I;  2NZ1 D;  4A3D B;  4HAE A;  1Q90 A;  1QG7 A;  2WKC A;  3T16 A;  3I90 A;  4FF3 A;  1K8M A;  3NK9 A;  3I70 A;  2F0T A;  1E2V A;  2EJG C;  3HOZ B;  1DCZ A;  4BS9 A;  1SDF A;  5FK9 C;  2F0V A;  5EPJ A;  3LX0 A;  1U9R A;  3H91 A;  5ELD A;  2K04 A;  1BQQ T;  4HMI A;  1BO0 A;  2KOL A;  3MEH A;  1T5X D;  1SNM A;  1A3V A;  4LAA A;  4NKL A;  1J8I A;  3I72 A;  1KDA A;  4F87 A;  3PUW A;  3MXG A;  2I07 B;  1XXG A;  4H7B A;  2EOT A;  2QDB A;  1WTW A;  1ESR A;  1I4P A;  3DXJ C;  5KYI A;  1TWF B;  4IAL A;  1JOQ A;  2N55 A;  2F0J A;  3BG3 A;  2J7Z A;  1PTO B;  1STY A;  1B1Z A;  1LAC A;  2I46 A;  3S16 B;  4KHZ A;  5T1I A;  1WTR A;  3BDO A;  1A3U A;  4RCN A;  3RD4 A;  1Q3L A;  1IYU A;  3FVQ A;  4ODG A;  3C46 A;  4KV6 A;  1L0Y B;  3MXU A;  1HUM A;  4V0B A;  4DU9 A;  1BXT A;  1KAA A;  3NPP A;  3Q22 A;  3NE5 B;  4QMG A;  1T5E A;  5FLX L;  1JE4 A;  4IUP A;  1ILQ A;  3NXW A;  1JQY D;  1NAP A;  3P7J A;  5JPN C;  5C4Z A;  1LT5 D;  1HFG A;  1B53 A;  1ZEQ X;  4IUV A;  3MTS A;  1FD7 D;  2NVY B;  3QG1 A;  2F0F A;  2ZXO A;  3CQZ B;  2WKD A;  4C1N K;  1Q8I A;  3TN2 A;  2LY7 A;  2XIW A;  2JA8 B;  1DM0 B;  1RTN A;  2XWB B;  3J7Y W;  2KVM A;  3OSO A;  3DWA A;  3A8I E;  4MIU A;  2R6G A;  1LV9 A;  1OXS C;  1YNN C;  5A35 A;  2A68 D;  3MAQ A;  5I9P A;  2EY2 A;  4KI0 A;  1HUN A;  4JBW A;  2EYF A;  4HTH A;  4RCO A;  5LL6 X;  3L9A X;  2XNA C;  4IUQ A;  4CGY B;  3KLS A;  2NVX B;  1FNU A;  3BVG A;  4RKB A;  4EQP A;  5JVG 3;  1S5B D;  5KRU A;  3TME A;  2DNE A;  2R7Z B;  3URY A;  4G4K A;  5I6W A;  3IKJ A;  2VNU D;  1ZKO A;  5C4H A;  4A3G B;  2OF1 A;  5JEA G;  3S1R B;  2LS0 1;  2AUK A;  1VMP A;  1LTB D;  3K59 A;  2D2C C;  3PUY A;  4DAY A;  3J81 L;  3NBI A;  4CKB A;  4QUF A;  3KBG A;  5C0X J;  3MVV A;  2CVR A;  3D6C A;  4BY1 B;  4RWS C;  4IFD J;  5M9O A;  1U4M A;  3HOX B;  1Y8O B;  1W6K A;  1W6J A;  3GQB A;  1EEI D;  4R8I A;  2CW0 C;  2K1B A;  3K5M A;  2FHT A;  3FEW X;  3N52 A;  4WFN 3;  3GO5 A;  2M00 A;  5IGG A;  5EQ0 A;  3GV6 A;  1TS5 A;  1S4Z A;  2K6A A;  1TQO A;  5DAU A;  1R9T B;  5EJW A;  4XQN A;  3TZU A;  1DOK A;  2NN6 G;  3HS0 C;  4KN7 C;  2NYZ D;  2F0N A;  2F0D A;  2JYO A;  2NVT B;  1SAP A;  4K14 A;  4C56 C;  2IJ0 A;  2RDH A;  4G7O C;  1J9O A;  3VA5 A;  2PZW A;  2AWN A;  1STE A;  1F9R A;  4FF2 A;  1AZP A;  1DD2 A;  3BS1 A;  2JSO A;  1SJE D;  2O5J C;  3E6Z X;  1D2B A;  4KY6 A;  1CZW A;  1ZYR D;  1HA6 A;  4CBV A;  1WTX A;  1SYG A;  3K0Y A;  1RCV D;  1SNC A;  2Y0S B;  4LJZ C;  1F77 A;  3QIA A;  4XYQ A;  2QEJ C;  1F2Z A;  1TT2 A;  2AQ2 B;  2QIL A;  1MSG A;  3PMF A;  2DY8 A;  1OXV A;  1I4G A;  1Q1B A;  4BY7 B;  1EY4 A;  5K36 H;  2L1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...