2F0IA

Crystal structure of staphylococcal nuclease mutant i72l
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0iA00
2F0TA 1SNCA 4HMIA 5CV8A 2F0FA 3EJIA 4WORA 3DHQA 5E1FA 4K5XA 1II3A 1JOQA 3D4WA 3QOLA 1AEXA 4K8JA 1JORA 2NUCA 1JOKA 3OWFA 1KABA 2F0PA 5I9PA 4KV6A 5IODA 1STYA 1TT2A 2EYFA 5F2DA 4K5VA 5KRUA 2F0GA 3LX0A 1EYAA 4KJOA 5CV6A 3NXWA 4YIJA 5E3FA 2SNSA 4K5WA 4K2LA 4K2KA 1EY0A 1EY8A 2PZWA 3T16A 4F7XA 5IGDA 3D8GA 2F0VA 3RUZA 4DFAA 4KY5A 2M00A 5I6YA 4NP5A 1SYGA 4DU9A 1A3TA 3D6CA 2O4XA 3TMEA 2PQEA 5EKKA 2EXZA 4KD4A 1NUCA 4PMCA 2SOBA 5C4HA 3VA5A 2F0HA 2EY5A 2KHSA 4DF7A 1EY4A 1IHZA 3NP8A 3NUCA 4EQPA 5HURA 1EYCA 2PW5A 3OSOA 5IGGA 5KGUA 3TP6A 2F0IA 2LKVA 3HEJA 3MXPA 4H7BA 4N9PA 3TP8A 5EKLA 2RDFA 3SHLA 4E6IA 5CC4A 4NMZA 5IIFA 5J39A 2EYHA 1EZ8A 4F8MA 2F0WA 5HGTA 1U9RA 2RBMA 4KD3A 4B9WA 5M9OA 3HZXA 1F2ZA 4IUNA 4R8NA 4RKLA 5DEHA 2PZUA 1KAAA 1JOOA 1STNA 3QOJA 4K14A 4ID6A 1ENCA 3P75A 5ISRA 2WACA 2SNMA 2HQEA 5J1ZA 5KEEA 5K5PA 2F0OA 5NUCA 1SYDA 5CV7A 4ZQ3A 1KDBA 4J1MA 1RKNA 3U9OA 4LAAA 3NHHA 1SNOA 3MEHA 4KY6A 3PMFA 2EYJA 4NDXA 2F0EA 2F3WA 4QF4A 4ME5A 5KYLA 2F0KA 2F0MA 3NQTA 5C3WA 5KIXA 4IALA 3SR1A 4RKBA 1SNDA 4EQOA 3C1FA 2EY1A 5IGFA 3NK9A 1SYFA 1STBA 2F0UA 3E5SA 1A3UA 1EY5A 2F0JA 5KYIA 5JAVA 3S9WA 2OF1A 1EZ6A 2EY6A 2EYMA 3P1HA 2F0QA 1SYCA 3SK8A 2F0SA 2RKSA 1EY9A 3V2TA 4DGZA 3MVVA 5CV5A 2F0DA 5EGTA 4S3SA 4K6DA 5C6AA 2OEOA 3SK5A 1KDAA 4HMJA 1SNMA 4N9TA 4OL7A 4KTAA 4ZUJA 3C1EA 4WRDA 2ENBA 4TRDA 3BDLA 3T13A 5IOCA 1A2TA 4I65A 5IGEA 3OMGA 5I9OA 3MHBA 4G57A 5C3XA 4PNYA 4EQNA 1SYBA 3R3OA 3ITPA 3EVQA 4IZ8A 1A3VA 1EY6A 2EYOA 4KY7A 4MIUA 2EY2A 5CV9A 4B9XA 4KHVA 1KDCA 4PMBA 5C5MA 5IGCA 1STHA 1STAA 3TP7A 5I6WA 4ODGA 2EYPA 3SK6A 4K8IA 5C5LA 2F3VA 1TR5A 3ERQA 5IGBA 1EQVA 3QB3A 2EYLA 1SNQA 4EVOA 5J22A 5JOBA 1STGA 4ZUIA 3DMUA 2PW7A 3EROA 3H6MA 5CV4A 1SNPA 2F0LA 2QDBA 2F0NA 3SXHA 2PZTA 4QB4A 1F2MA 1TQOA 3TP5A 1EY7A 2PYKA 1NSNS 1ENAA 1F2YA 3BDCA 4HTHA 4QMGA 3SK4A 3MZ5A 3OMCA 5C4ZA 3D4DA 1A2UA 4KJNA 5DAUA 2KQ3A 1SYEA 4NKLA 5CGKA 1EYDA 2OXPA 4J6HA 5CR3A
chains in the Genus database with same CATH superfamily
4HMIA 5K36H 3CCUA 1PZKD 1DONA 1BVSA 1HZBA 2NUCA 4BBRH 4CKEA 3E9IA 2TMPA 1ONLA 4DAVA 5D3DA 1K3BC 1MGSA 5E4WC 1HR0L 3WOFA 3I7FA 5E3FA 3VA7A 3H15A 3VYUA 2Z4IA 1PYSB 2I0QA 1LTAD 3OTOL 3K8AA 2K50A 1PFSA 1HA5A 1A3TA 4OO1H 1L2FA 4PMCA 3OHXC 1PZID 1WTRA 1EIYB 4YY3Q 1LM0A 1IHZA 1CA5A 4DAPA 2RSNA 3GTJB 1PTOH 1UE5A 2IWHA 1PDQA 4APVA 3K5MA 2B2VA 4DR3Q 1W2BA 2EYHA 3J81L 5AFWA 1HPCA 2KEDA 1WI5A 1CTMA 2PQAA 3BG3A 1PTOF 1U9RA 3IRBA 4FDBA 1HJPA 5DEHA 1I6HB 2NVTB 4GS3A 1ENCA 3GTQH 4HIOA 5C44B 2NTTA 1KDBA 4B3RL 2K32A 3NHHA 1RTNA 1DOLA 4JI4L 2R6GA 5GAEC 1NMGA 2KHIA 3NQTA 2RCNA 4DUYL 1X6OA 5LMNQ 5ELNA 4GKJL 2BE5D 1V1PB 2RHSB 2F0JA 4BWGB 1V1QA 5JAVA 4ZK9B 4UP9A 3PIO3 4L63B 2IX3A 4DGZA 3QO2A 2F0DA 4LF5Q 2MPMA 3Q6SA 3S17H 2XRSD 2DY7A 2JK8A 1BBWA 4JOIC 1PH1A 3GTPH 1OXSC 3T13A 1K83B 5IGEA 1MKHA 1Z6HA 4JYAL 4R9WA 5C0XI 1GVPA 3BYTB 4MNOA 4DR6L 4K0KQ 1O7YA 2BOSA 4YWKA 3ULPA 4QCLA 4HIKA 2E5LL 1IW7C 1HNWL 5IGBA 2VUMG 2OCEA 4X65L 4BY7G 3CPWA 5BN5A 1MBYA 1I4RA 2PZTA 1WD0A 3L3OC 5M5WB 4B3MQ 4QIWB 2IHFA 3NTHA 4DPGA 1DOMA 5CR3A 3S24A 2Q2IA 3DHQA 1EIFA 3CXCA 2RF4A 3P20A 1A0IA 3QOLA 1AEXA 1Y1VH 3U50C 4IN3A 1F2LA 1VQFA 4AIMA 1S4ZA 4O2DA 1SBBB 1TT2A 4EX5A 1G2SA 3HOXH 3VR6A 4RH6A 4LFAQ 1QUQB 2SEBD 4OXPA 2IJ0A 1TWGH 1XMQQ 5C4XG 3ERSX 2A68D 4A4IA 2I5MX 2JA9A 3AEVA 3GTMH 2UXBL 2VQFL 5EPJA 4XXEA 1J5EQ 5LMNW 3TMEA 4KN7C 3DWQA 3FPPA 3MA2B 4FXGC 3R93A 1C8CA 3W5OA 3U58A 1AP0A 3HEJA 3ZJYC 1W6JA 2E2HH 1NAPA 4QUCA 1PRTF 4KK7A 4KN4C 1KD1C 3L2PA 2K5NA 2VQEQ 1LUZA 2WAQB 4C3IH 1JOOA 1VF5C 3IL8A 4A3EG 3GTQB 1VQEA 1EL0A 3PUZA 2TSSA 1D8LA 3U9OA 2B2TC 1TWHH 3IAYA 2ZT9C 2I07B 3BU2A 2A5HA 4Q0FA 1Z7TA 4XQQA 2EY1A 2JJQA 3JAME 4JBMA 3S2DH 4OIKA 3G71A 2I46A 1JJCB 3P1HA 3SK8A 3A5ZB 3RMHA 3BZKA 5EGTA 3DEPA 1ILPA 4K6DA 4XDXA 2NVXH 3M9BA 1B53A 2ZXPA 4IUPA 1S5CD 1TY2A 3GTPB 1BBXC 1WFQA 3I4NG 1O80A 2HIXA 2BDOA 3JC66 2F4VL 4FF2A 4PNYA 3MXUA 1HZ9A 3ITPA 3VYRA 1XPOA 4KY7A 2P5ZX 3CW2C 1STHA 3BZCA 3B6YA 5I6WA 1I50H 3SK6A 2EVBA 3GDEA 3SE0A 3J80E 4X62Q 2ZXOA 2EYLA 2WINB 2PCFB 2DY8A 2DUDA 2FINB 3NBHA 4LF9Q 2FMMA 2MP1A 5H1SE 1K8GA 1N32Q 1U0LA 3PGZA 3VDYA 1D5XC 1EYDA 3VR5A 1KQSA 1SXTA 2KCCA 1Q7YC 3RZOH 4A3EH 3KJOA 4A3IH 2ZM6L 1BCPF 3HOXB 3M4QA 2UXDQ 2DNEA 1BBUA 2QF7A 1TWFH 1Y14B 4U673 3GTMB 1K73C 2CH4A 4IPDA 4LMQD 4GLAC 4NP5A 4IFDG 2RDHA 1XXGA 2QEXA 4JCVE 1BUVT 1YITA 1BOSA 1EIGA 1EY4A 3UDXA 3AFQA 1HNZQ 5GAHC 3V05A 4XTCS 2BCOA 5J39A 4DV4L 4DV5L 1PRTD 2O2LD 2NYZD 2G9HD 2I5HA 1KLUD 3KDFB 2UU9Q 2VB3X 3J81i 1VF7A 4LW1A 4JI5L 4OIJA 2PZUA 3CCRA 1P16A 3G4SA 3WOEA 2IL8A 5BR8Q 3I3CA 1TS2A 1XMOQ 1ESFA 1WTVA 3VYSA 1TWHB 2VUMB 3M4YA 5I9PA 4KHZA 1YNND 4ME5A 4RGMA 3G6JB 3UI2A 4C2MH 4LF8L 2B2VC 4UHVA 1X32A 3S2DB 1EZ6A 2RA4A 3KF6A 2RKSA 2B63G 4UPAA 1VDZA 3NPPA 3PUXA 1E2WA 2NVXB 4DV2L 3CC4A 4RMFA 3MWYW 1A8VA 1HFGA 1A2TA 1FD7D 1HQMC 3OMGA 3J81c 1TY0A 4IPHA 3C3LA 1F9PA 3HKZB 2XRQD 2BH8A 4B9XA 5JVH3 1QJOA 1I50B 4ODGA 1B3QA 1LV9A 1PFBA 3UDFA 1E2ZA 4LF6Q 2JA5G 4EVOA 4ZYSA 4H0LC 2A8VA 5CV4A 4JI3Q 4TSSA 1F2MA 4MZ9A 3H3VC 3CCMA 4RAUC 3K7UC 4NKLA 5M5YH 1AE2A 5KYIA 4BY1H 1OXUA 3PO2G 2VB2X 1PXUA 1VQ6A 3RZOB 5D65A 4CJ2C 1WTPA 4C3HG 3MEFA 4A3EB 1KNAA 2PQAB 5DM63 1BCPD 4UP7A 4DR1L 3TS2A 1TWFB 2VS1A 4YIJA 1D1KA 4G7HC 1CQVA 1WTOA 3RUZA 3TQYA 1PH4A 3D6CA 2IY5B 1FNWA 1TWAB 1XTDA 1EUJA 4JI2L 4UP8A 3D6WA 2ES2A 2NZOA 2PW5A 3OSOA 1FGUA 3TREA 1VCIA 3I70A 3CQZB 3SGIA 4BXXH 1XNQQ 3GTOH 5C3EG 5M9OA 1NTGA 2F3IA 4K14A 1X3FA 2UUCL 3VR2A 4LFCL 4DV0L 1UWVA 4LUZA 4WJWA 1VQBA 4CJ1B 1NE3A 4J1MA 1EIHA 2Z6KC 1VQ9A 2XVSA 4HJ9A 3C46A 5FO7B 3OWEB 4DAMA 2K03A 5JJZA 1ICWA 1LTID 1Q46A 4C2MB 1VQKA 2BDNA 4PQXA 1PFMA 5IYBG 3NK9A 3S9WA 2LMCB 2AUJD 3I2ZA 3K0YA 3M4OH 3FKIG 1JCKB 1QUQA 3E0EA 1PVOA 1Z9FA 4WRDA 4A3LG 1BR9A 2H1EA 5I9OA 1B3AA 3P7JA 1TS4A 4JI1L 1U4RA 5IGCA 4A3MH 3K58A 4CDFC 1Q90A 4A3DG 3NQIA 3K7AB 3PO3H 5M3MG 1NR4A 3T1HL 3CCSA 2JA6H 2VXWA 4U68A 1SROA 2NN6H 4JV5Q 3J7AV 2C35B 3TP5A 2KCMA 1NSNS 2UUBQ 3CCJA 3MZ5A 3D4DA 5CGKA 1G6ZA 4JI7Q 2KECA 5CV8A 5ELCA 4DR4L 3CHBD 1B44D 1IKLA 3OWFA 3CCVA 3G6EA 2FJ2A 5EJWA 5M3FG 2NZ1D 5IYDH 4K2KA 2XWBB 4Y7NB 2F0VA 1SE8A 5C0XG 4A3JH 3MC0B 3A55A 5IP9H 2R92G 1ZXTA 2XTIA 4A93H 1R4PB 1N9WA 5A2QE 3FDTA 1ZYRC 2Q8RE 4B3TQ 1YNJC 3NP8A 3TSSA 2PO4A 3A8IE 3HS0C 1SMYC 5FJ8G 3R8BA 5EKLA 1IYJB 3J81j 3I4MG 3QG1A 4LF4L 4F8MA 3GTOB 2JP1A 1Q82C 1KAAA 4KHPL 5M5XH 3P75A 2R7DA 1A15A 2A69C 2J4XA 5CV7A 2ZJRA 3RNUA 2B3GA 4DUZL 1IXRA 3KBGA 2NVYH 4A3DH 2KVMA 3A0JA 4KY6A 2JA5B 2ID0A 2Z6BA 1EWHA 3CF5A 4M1UB 4A76A 3FP9A 5IGFA 4A3BG 2AUKA 3M4OB 2KBNA 1UUPA 4IQZA 1VQGA 4A3CG 3RR5A 5C6AA 2Q2HA 1I6HH 3SK5A 1CFMA 1XNRL 3NBIA 2C9OA 4HMJA 4XT3B 4FYDA 3BDLA 1DD2A 5C44H 1F9SA 1A63A 4GN5A 1LABA 3L9AX 1EY6A 2BA1A 1RCVD 4A3MB 2MQHA 5C0XH 2G5DA 4HEDA 2WFWA 2A6HC 3PO3B 1OXTA 4XYOA 3F1ZA 4R4TA 2N55A 2F0LA 1LTBD 3HKSA 3KDFA 3MAQA 1FGBD 4R4OA 1EFID 4HTHA 2JA8G 1DZ1A 3CD6A 4AYBE 1ASZA 1K83H 4DV6Q 1SFOH 3AFPA 1Y8NB 2IX0A 4IURA 5C3EB 4G7ZC 1Q1EA 2IPKD 4QL5A 4K5XA 4L5RC 2KJXA 3EQLC 2D9UA 4BS9A 2KCTA 2BA0A 2AWNA 1EYAA 1GUWA 1ET6A 2RHQB 3I72A 5CYUA 4X3KA 2PZWA 2LS01 1E1OA 3DWPA 1UNSA 1WOCA 3G7LA 4JBWA 5FO9B 3I56A 5C4HA 1X3PA 2OTJA 4DR5Q 4XIGS 1NBWA 1EYCA 4FXDA 3FKIB 3A56A 2QKIC 4DV3Q 4H44C 5J3BA 4RWSC 5JPMC 3H0GH 1CKMA 3KF6B 4A3FG 1JWMD 4C3JG 1RD9D 2F4IA 3A7AB 1F2ZA 3PSIA 2JA7G 1AH9A 5M5XB 4B3SL 2IW3A 1JJGA 1U4PA 2PI2E 5KEEA 1LT3D 5I2XA 5IYCG 3GTKB 1I6VC 3PIOA 2H4OA 1RKNA 4M8AA 4YWLA 2NVYB 1KL9A 4A3DB 1SE4A 2BE5C 2XIWA 3SEBA 5IT9c 3RLFA 3K6OA 2FFKB 2AQ1B 4V0BA 3CAMA 4X64Q 1A3UA 1EY5A 1HH2P 1V8QA 3GV3A 3F2UA 1IBMQ 3FEWX 1EY9A 2K52A 4DN4M 2XSCA 1F77A 3S1MH 1CSQA 1EWCA 3A7LA 1YJWA 5IOCA 2Z4HA 3HOZH 1N34L 2FHTA 1Y1WH 4UDUC 2YTXA 1HR0Q 3S1NH 5FLXE 1SJHD 3MXGA 1IL2A 3T56B 5IE8A 1N36L 2L55A 3CMAA 1CA6A 4R8IA 4RFBA 3HOWH 1KC8C 4XQNA 3A5UA 1TQOA 2PYKA 1F2YA 2XGTA 3S15B 2RQXA 3I90A 3LWUA 1NY4A 1SFOB 1SNCA 3EJIA 4WORA 4P72A 1A6XA 5E7NA 1JORA 1MJEA 4YCUA 1EQRA 1HZCA 1UE7A 2F0GA 2O5IC 4B3RQ 3HOYG 2ASBA 1B8AA 3K5LA 2SNSA 4HN7A 3T16A 3OW7A 2M00A 2K5WA 2NB0A 4WJ4A 2L0CA 1NUCA 3R2IA 5JVG3 4A3BB 3DXJC 2RDGA 2CCZA 3CRLC 3N52A 3S2HB 4OONA 2KHJA 4FNFA 4TKOB 4L5QA 2K01A 3M7GA 3TP8A 2OTLA 4P2CB 3SHLA 1PV4A 3H0GB 4A3GG 2HHHL 2KOLA 2Z1CA 3GTGH 3ND8A 2CHBD 4IUNA 4KKSA 1VQAA 1X3QA 1BKBA 4JYAQ 2K5VA 3R2TA 1HR0W 2A6ED 3DM3A 1EEID 2VQEL 4DR6Q 1KAWA 2E5LQ 2ZTCA 1HNWQ 4J8QA 2Z6KA 3W3AA 2EYJA 3M4PA 2F0KA 1PA6A 1NNXA 4DR7L 4DXGA 2MNAA 4NXML 4Y52H 2JA8B 1VQ8A 2HDLA 1EEFD 4HIDA 4O0AA 3MXNA 4DV1Q 4A3KG 1DXMA 1PTOD 1QCBD 2HIVA 3S1MB 4ZUJA 3PIP3 4ZKBB 4OX9L 5JJKA 3HOZB 1A62A 1G91A 3RD4A 2YU9H 1Y1WB 2VUMH 3R3OA 2CWAA 3HOYH 2BH2A 3S1NB 4BY7H 5LL6S 1IBLL 1E2VA 3CP0A 3TP7A 1PYWD 2UXBQ 1HCZA 3UDGA 1LT6D 3TN2A 1XJVA 1RIPA 3HFZB 1FR3A 4R4CA 5JOBA 2IHEA 3HOWB 3EROA 3ONAB 3ER0A 5G3LF 4QB4A 3JAMi 1HTLD 4DK0A 5E4XA 1A2UA 4ME3A 1E24A 2ZTDA 4LFBL 2G9DA 5GQOA 1P8LA 2CW0D 5C4XH 2MGSA 2QW7A 4GN4B 2AQ3B 1E3PA 5IODA 3S1RH 4KV6A 4IUTA 1X3GA 4R1JA 1PH8A 2EDGA 4IUQA 3J80i 2EOTA 1E0BA 3S1QH 1B9NA 3DLLA 3H91A 2XNAC 3VA5A 4JI0L 2A19A 4ULLA 4DF7A 3TS0A 1PZJD 5IGGA 4O1NA 1BO0A 2LKVA 3JAMc 1CZGA 4E6IA 1U4LA 2J7ZA 2Q2UA 2ZJQA 4N8X1 1I4GA 3F2CA 5JEAJ 1N33L 2MO1A 1S3OA 2F4VQ 1Z47A 2RBMA 3E3XA 3GTGB 4RKLA 1JWSD 4DR2L 3QOJA 3LGJA 2CFMA 3Q8DA 2PI2A 3A8JE 4HJ8A 1LTSD 4JVZA 3M3YH 3NENA 4DV7Q 1YNNC 1SYDA 2B8GA 1TWAH 1VQJA 5GAGC 4IPCA 1FL0A 4DK3C 4JBJA 3SR1A 3J80c 1E1TA 4AQYL 1SYFA 2L11A 3CQZH 2VZAA 1BF4A 3I4NH 2ZTEA 3BVMA 4RGTA 1HTPA 1EU3A 2WB1G 2JEBI 3H3VH 1CT1D 1H95A 4I65A 2K5HA 1XWEA 2ZM6Q 1YIJA 4ZAIA 4G57A 2YU9B 2PMZE 1SMXA 4EQNA 1RL2A 3TDQA 4IZ8A 3HOYB 1L1OA 4GNXC 4HJ7A 4BY7B 2B2WA 3OOCA 3KLSX 2EYPA 3E9HA 3ERQA 1JQYD 4X3SA 1K8OA 3VR4A 3DMUA 2JYOA 2DJFC 3Q24A 3EA6A 1VQIA 4NXNL 1PHJA 3DEOA 1B7YB 1ENAA 2NVQH 5GROA 4KJNA 1I5FA 4DV4Q 4J6HA 5ELBA 1KRTA 4P75A 4V190 4DK1A 1TS3A 3KBXA 4AYBG 3RZDH 4JI5Q 3UE1A 4IO9A 5C4XB 1JJ2A 2E2DC 2K5QA 1JOKA 3S1RB 2WKDA 2ZXRA 1EQQA 1PLFA 3GO5A 1STYA 2EYFA 4LJZC 1HRJA 2HT1A 4IFDH 3KYHC 3K7AH 2FMCA 1IYVA 1YVCA 5AJ3L 4TQUS 4HAEA 3LWEA 2UXCQ 2HCIA 1V43A 3F8TA 3V96A 3X3MA 4DFAA 2K4KA 3BVGA 3SDZA 3A54A 3S1QB 1JICA 1K8AC 4LF8Q 3K0XA 2PQEA 5DM73 3STBD 4GNXB 3HOVG 3O13A 3PCOB 3HGBA 2EY5A 1CKNA 2F0IA 3M85A 4OEMB 2JSOA 4DV2Q 4GLXA 3KFUA 1EZ8A 3D0FA 4I7ZC 1SSOA 3S14H 1HUMA 3AYHB 1S40A 2X6LA 4KD3A 1HNXL 4R8NA 4KKTA 5IT9L 1W3SA 3CMEA 1CHPD 2WACA 4Y7NH 3M3YB 4JW0A 4MTNA 3TBIB 2F0OA 5EPLA 4RCNA 4ZQ3A 4X66L 3PQIA 1EWIA 1B1ZA 3TZUA 3QIAA 2B63H 4NB3A 3H94A 5EKIA 4EQOA 3C1FA 1EYGA 1STBA 1KIXA 1VQDA 3I4NB 2EPBA 3KLSA 1K0RA 1UE1A 1B50A 1KDAA 1SNMA 4OL7A 1R9TH 4GKKL 3VYTA 3S16H 1RF2D 1K3RA 4DR1Q 2JA5H 2KENA 2IT1A 1BDOA 1IBKL 3HKZE 4WJ3M 2A73B 1YJNA 3C2PA 1UAPA 2O5JC 1FJGL 1W6KA 1TR5A 1EQVA 1SDFA 1MJCA 3A74A 1DGSA 3E6ZX 5FOBB 2L1BA 1ENFA 2B39A 4JI6L 2RCFA 2QDBA 2B2YC 1AE3A 2L4NA 4JI8L 3PO2H 4XYQA 4BA1I 2NVQB 4XQJA 2PNHA 4C3HH 5DAUA 3RN5A 1BXTA 4ALPA 4JV5L 2K28A 2Q8IB 3RZDB 1LT4D 3AU7A 4IPGA 1JOQA 3CCQA 4LFCQ 1TWCH 4DV0Q 3NSWA 5HGQA 3MFGA 4CGYB 1DYQA 1SAPA 3OPOA 1HHVA 2RSOA 2WP8J 1PYBA 1EY0A 1X56A 1PFNA 1T5EA 4YHHL 2GVAA 4IJHA 1CSPA 4DU9A 3M7NA 2QEJC 2EXZA 1E7ZA 1J9OA 5EQ0A 5IWAQ 1C4QA 4GOPC 3NUCA 5HURA 3IFTA 2HD3A 5C3EH 3Q0AA 1S5DD 1XPUA 3U4VA 4NMZA 3MXNB 4IOCA 3S14B 4ZRZA 3K57A 1WCMG 4HCSA 2R7ZG 2H5XA 4ID6A 4JI1Q 3QJYA 3UDIA 4FP5D 5IYBH 3T1YL 3EFXD 1VMCA 4QUFA 4QF4A 3PMFA 3I55A 4K6LA 2SDFA 2B63B 2E2JH 3FKIH 4LUVA 2F0UA 3E5SA 2M9VA 4A3LH 2K14A 1S72A 3AB9A 3CRKC 1SLJA 2UUAL 3PUWA 1GOZA 2N8NA 4DR4Q 3ULJA 2CQAA 4AYBB 1GM5A 2YTVA 1V9PA 3HOUG 2IX1A 4RGOS 2E2IB 3GTKH 1R9TB 2QILA 4ABNA 1JT8A 2HDMA 4GOPB 3J7ZC 3G48A 3S16B 3KLWA 1I94L 5M3MH 2R7FA 5C5MA 3DUZA 2QCPX 1STAA 1JE5A 2AKWB 3VR3A 2CH4W 4K8IA 5C5LA 4DNTB 3W1GA 3PF4A 4DAYA 2WB1E 5J22A 4WFN3 4C1NI 1DOKA 3KF8A 1MSHA 3KUPA 2EJMA 3PO2B 1BQQT 3I4OA 3KJPA 4UAIA 3NEMA 4C3HB 3OMCA 1CHQD 1I3QB 2VY3A 1KXLA 4LF4Q 1L1OC 2K05A 1VQHA 1ICFB 5IP7G 3BYYB 2GA4B 2B2WC 1ZYRD 5M3FH 4KHPQ 1TWCB 4HJAA 1KABA 1SMYD 2F0PA 4DV6L 3OIQA 4G4KA 4DUZQ 2WIIB 5K36G 1ESRA 2R92H 4LF7L 4BBRG 1EY8A 1LACA 3CPFA 1JC7A 4F7XA 4ILWA 3JAML 4KY5A 3RLOA 5I6YA 5FJ8H 1WYDA 2D62A 3KK7A 1AZPA 1XTCD 5LMUQ 3S15H 4FF4A 3I4MH 2A69D 1K28A 1LYLA 5D3IB 4LK1C 4EQPA 5KGUA 3TRZA 1CUKA 4KLKA 4N9PA 4OO1G 1H9SA 1XNRQ 1YJ9A 1VQPA 3HOUH 1DJRD 3NTIA 4PV1C 2Y0SE 3T53B 4BA2I 1QNKA 3EN2A 3DWAA 2WV6D 5JPNC 1LTRD 5JJLA 1QOHA 2OWOA 5ISRA 3J80L 4G7OC 5J1ZA 1M90C 2MUYA 4IJLA 3K5NA 1L1OB 2V1CC 1D2BA 5ELFA 4A3BH 1SNOA 2F3WA 1PH7A 4DKAC 3S2HH 1GUOA 2E2JB 2R3ZA 4A3CH 1H9RA 1EU4A 2NN6I 5D14A 1O7LA 2OF1A 1G51A 2EYMA 4YY3L 1Q81C 2D5DA 2ALYB 1MD2D 4S3SA 4H02A 1QILA 3EBEA 4DR3L 1EQTA 2ENBA 1K9MC 5CBEE 4CBVA 1RTOA 3KLRA 1WTWA 4KI0A 4J15A 5M3MB 2EYOA 3KOJA 4GNXA 4PMBA 4CJ0B 3HP3A 1VMPA 3NELA 3BDOA 2JA8H 5KNDA 1STGA 5LMNL 4IFDJ 3GD7A 5T1GA 3T4AC 5C4ZA 2E76C 1CKNB 3MTSA 2LXKA 1EFWA 2K04A 1STEA 1NR2A 4CDEC 4LF5L 5I2YA 1FNVA 1WCMB 1II3A 2R7ZB 4EQ5A 5M3FB 2DN8A 4K8JA 1I4QA 1VQLA 4B3SQ 1Y69U 1GUGA 4RG1A 3OTOQ 1HA6A 5KRUA 3OW2A 3NXWA 2F03A 2R92B 2OQ0A 1Y1VG 4K0KL 2LFNA 3D8GA 3PUVA 1L0WA 4R4IA 3HOXG 3BVZA 2L9HA 1SYGA 2QDLA 5EPKA 2Z0SA 1I4PA 4KD4A 1TXYA 2B2UA 3I4MB 4A3FH 2HCCA 4RHSA 4C3JH 1LLRD 1AN8A 1CM9A 3SVMA 1IL8A 3RN2A 1OTCA 3K5OA 4X3UA 4B3ML 2JA7H 1CZWA 4L6TB 3HOUB 1LTGD 2JQOA 5IYCH 2A68C 2DNCA 3K80C 5HY6A 4P74A 5HGTA 3CCLA 4B9WA 1N34Q 2A6EC 4RCOA 4L5SA 1RDPD 4LUOA 1XX8A 4JI4Q 3GP7A 5NUCA 4DUYQ 1SE2A 4LFAL 4GKJQ 3J7YW 1IYUA 4C3IG 3QWNA 1XMQL 1N36Q 4JC0A 1M1KC 2XN9C 1WD1A 1OXXK 3PIPA 5FLXc 1QVGA 5TSSA 2EQSA 4ZCKA 4IALA 4PMWA 4RKBA 1J5EL 4FF3A 2LY7A 3W2DA 1PTOC 1OXVA 3OIPA 4BBSG 4JK1C 3MVVA 2PPBC 3I4LA 4N9TA 4KTAA 2R93G 5FK9C 2OT2A 3GQBA 4GLVB 5EBCA 2N88A 1B2TA 4FF1A 4DV1L 1G291 4TVAB 1V1OA 2HUGA 3MHBA 2K7VA 4CKCA 2KCNA 1Q3LA 4X65Q 1A3VA 2R61A 1D7QA 2EY2A 2X6GA 1KDCA 2M2LA 1ZEQX 4BBRB 5IY0A 4OWXB 3HKZG 1TS5A 4L8JA 1RJTA 3E0JA 1IW7D 1TIID 1YNXA 3L7ZC 5FO8B 2E8GA 2F0NA 3IKJA 2B2YA 4QMGA 1B70B 1Q86C 1BNZA 2VL6A 3SK4A 1MIUA 2K5DA 2CW0C 4B08A 2K1BA 4MHEA 5IIFA 3K59A 3CCEA 2HHHQ 4C56C 1U5KA 1CQFA 1YHQA 1D6EC 2L5TA 1AZQA 1PTOB 1FVIA 2VNUD 1YZ6A 3D4WA 4HSPA 1QZGA 1SRUA 4DNRB 1KLGD 2Z9HA 2VQFQ 5F2DA 1PH2A 1O7IA 4K5VA 1MSGA 3LX0A 1LT5D 3IFDA 3F2DA 2FXQA 1X3EA 4JPBW 4OO1I 4A3IG 5KNCA 2NTSA 3F2BA 4X62L 4DR7Q 1ASYA 1YBYA 5EKKA 5ELEA 4A3FB 4A3GH 4C3JB 4NXMQ 4QIWE 3T51B 4LF9L 4BBSH 4JBKA 5LL6X 4OGQC 4QQBX 2N3SA 4GOPA 3MXPA 2JA7B 1N32L 5CC4A 1L0YB 1Q1BA 2R93H 3ICEA 4OX9Q 1O7ZA 4RA8A 2A1AA 5EBDA 3S17B 5GADC 5C4JH 4KKUA 4HSVA 2SNMA 2HQEA 4RHRA 1IBLQ 2PMZB 2UXDL 3TZDA 1TVXA 2D0PA 3D3RA 5KYLA 2L15A 2Q2TA 2F0EA 2F0MA 1PRTC 5KIXA 4DV7L 4A3KH 2XWJB 1SNDA 1KNEA 1D5ZC 4DAYB 1NCVA 1VQNA 2QA4A 3KF8B 1PMRA 2EY6A 1X54A 1K0SA 3TEHB 1HNZL 1GUNA 5CV5A 4LFBQ 2CQOA 4FVMA 2WAQE 1FYCA 4PZ6A 1S5BD 4P73A 3I91A 4LWCA 2UU9L 4C1NK 1T9HA 1EOTA 1SYBA 1JB7A 1CI3M 5BR8L 4YCWA 4KHVA 1B4OA 1Y1VB 1NMFA 3U9SA 5BN3A 1XMOL 5A2QL 1N8RC 1M4VA 3QB3A 1TWGB 4ZUIA 1VQ5A 4JI0Q 5C0XJ 1WVLA 1ET9A 3BDCA 1D5MC 1DCZA 2LXJA 1GHKA 5DNFA 5KNBA 2OXPA 2ZJPA 1PRTB 1N33Q 5EAYA 4PZ7A 1H9SB 3J81E 3CKIB 4DR2Q 2E2HB 5T1IA 3QR8A 1GXDC 4BY1G 2ICIA 3ZYYX 1GD7A 1JB3A 1QB5D 4DK6C 4LNQA 2L12A 2NBFA 4C3IB 5CV6A 1G8ZD 3FHWA 1H9JA 4O42A 3STBC 2QGQA 5G3LD 2AWOA 1G2TA 1KRSA 3W1BA 1CKOA 1VS0A 1M8AA 2YTYA 1YHAA 5FLMG 1B9MA 4CDCC 5CORA 4AQYQ 4LF6L 3K81C 4YWMA 5ELDA 4DV5Q 4A3GB 2UXCL 1H9MA 4BBSB 4JI3L 1VQCA 2OQKA 1C9OA 1YHBA 4PG3A 1BCPC 4ZLTF 2RDFA 2R93B 1SEBD 2DGYA 2VW9A 5BN4A 1HXYD 2F0WA 4DNIA 1PH9A 3PF5A 3NE5B 2Y0SG 2HQLA 3GTLH 5ELOA 5C4JB 3CC2A 3DM1A 4EGVA 4BXXG 1SR3A 1KTKA 1X55A 2B2UC 4LAAA 1TU2B 4NDXA 1VQ4A 1GUSA 1AW7A 1O78A 5C3WA 2JXMB 4A3KB 2NWGA 4NXNQ 1LTTD 4JG2A 2ATWA 1C0AA 4Z9CB 2F0QA 3Q22A 2A74C 4X6AH 2K6AA 2RVLA 2EIFA 1XNQL 3X3NA 1Q12A 4OWWB 3D31A 4H13C 1BCPB 4OELB 3EVQA 1AFPA 5CV9A 5AJ3Q 5FKAC 2NZHA 2MO0A 1U4MA 1IZ6A 2KA7A 3RLNA 4L5TA 4A3IB 1PH3A 4RGNA 4F87A 2PNRC 5FLMH 1RODA 1GKHA 1SNQA 1V1PA 4MN3A 1H9KA 2JE6I 5L37A 4A3MG 3H6MA 4N8FA 1SNPA 3SXHA 2MHVA 1GO3E 2CVRA 3WWVA 1VQOA 3BS1A 3PO3G 4CKBA 3AQQA 1QZHA 2E2IH 2KEEA 4QGUA 2JA6G 1DM0B 2E74C 2NN6G 2F0TA 2B29A 1SN8A 5E1FA 1HNXQ 2N49A 1S5FD 1UEBA 3GV6A 1YEZA 1XYIA 1QWYA 2D2CC 1WTHA 4KJOA 4X66Q 4K5WA 4JI2Q 3HOVH 2EXDA 5IGDA 4POGA 3FRPB 1L0XB 2O4XA 1I3QH 5IYDG 2F0HA 1Y8OB 4A3JG 3HRZC 4GZYC 1MHWC 4H7BA 2UUBL 5IP9G 3NWTA 1GJXA 2UUCQ 5CMDA 4A93G 4JI7L 5IWAL 1SE3A 3H3VI 1LO5D 4GKKQ 1UEAB 4IOAA 5FLXL 3GTLB 1Q8IA 3A8KE 2K75A 2WKCA 5DLQE 1IBKQ 1HUNA 4JOIA 3H09A 1CK1A 1VQ7A 1S5ED 1FJGQ 3MEHA 1Q8KA 4P71A 4FXKC 3MFYA 4JI6Q 2CWPA 1GHJA 3CU7A 4GN3B 4JI8Q 2WB1B 1WJJA 3U4ZA 4B3TL 1SYCA 2F0SA 3V2TA 3I8ZA 5JEAG 1WTQA 4ZKCB 2OEOA 4OHJA 2AMCB 3C1EA 2C5CA 1QVCA 4TRDA 3J7A5 2LSSA 3BJUA 4CDDC 3HG9A 5M5YB 4BY1B 2EZVA 3BZDB 3CC7A 1I4HA 4MIUA 1WTXA 2J0TD 1C48A 3T1HQ 4AH6A 4IFDI 5C44G 1ML0D 4YHHQ 1X65A 2F3VA 3I73A 2ICEC 1F9RA 4POFA 1E22A 4NPSA 1JR0D 2Q8TA 2PW7A 3NTKA 1QG7A 4F88A 4FO2A 4HJ5A 2D0OA 1QE6A 4A75A 4CHTB 1J8IA 1RHPA 2N78A 1SYEA 1OO9B 4DXFA 1SJED 1ILQA 2JN4A 1K8MA 2F0FA 2YYZA 2MFIA 2Y0SB 4YCVA 1X9NA 4R4QA 1Y8PB 1C7YA 3T1YQ 3HOVB 4K2LA 2F1MA 1KHIA 2Z8LA 1TKWB 1PH6A 1NJIC 2EE1A 4IUUA 2B2TA 2SOBA 3URYA 1T5XD 4NW2A 4DA2A 2KHSA 3OYYA 2CKZB 5JEAH 2UUAQ 1WCMH 3TP6A 3GTJH 2R7ZH 5LMUL 2X69A 3FPUB 1D1IA 1YNJD 4OWTB 3NBHB 4KMUC 2K33A 3AMUA 2I5LX 3ULLA 4HR7B 1HZAA 3HZXA 5LHY1 1XPRA 1STNA 3NWSA 2NVTH 1I94Q 3H0GG 2KUMA 3WDNA 1ZKOA 1UE6A 2DJGC 3ND9A 5K5PA 3D4RA 1G6PA 4QJFA 2YV5A 1YI2A 4HCEA 1QNUA 3L0OA 3FVQA 2AQ2B 4MTKA 4QY7A 1JWUD 2GN5A 4DR5L 3PV0A 2JA6B 3EIVA 2GVBA 1I4XA 1HQRD 5A35A 1PH5A 4DV3L 4I7AA 3LNNA 1JMCA 5JJIA 3PUYA 4IUVA 1VQMA 1J6QA 2WAQG 3N6RA 5C3XA 2B8FA 5COYA 4XT1B 5I4DA 5CBAE 4X3TA 2AHOB 1JE4A 1R4QB 2EJGC 4LF7Q 3HOZG 5IT9E 1FNUA 1QVFA 1LTLA 4UY8C 1GUTA 1Y1WG 1F9QA 2MJ8A 2E75C 4Q5VA 1IKMA 2V4DA 1HFNA 2A6HD 2EJFC 4A3JB 5M5WH 4X64L 1EY7A 2JEAI 3Q23A 3J7AF 5IP7H 2F52A 1EOVA 4PZ8A 3UE0A 1IBML 4A93B 2KQ3A 1MI2A 4HIMA 3HOWG 3FMCA
chains in the Genus database with same CATH topology
4HMIA 5K36H 1PZKD 1DONA 2NUCA 4CKEA 2TMPA 1ONLA 4DAVA 5D3DA 1MGSA 5E4WC 3WOFA 5E3FA 3VA7A 3VYUA 2Z4IA 1LTAD 1HA5A 1A3TA 4OO1H 4PMCA 3OHXC 1PZID 1WTRA 1IHZA 1CA5A 4DAPA 2RSNA 3GTJB 1PTOH 2IWHA 1PDQA 3K5MA 2B2VA 2EYHA 3J81L 5AFWA 1HPCA 2KEDA 1CTMA 3BG3A 1PTOF 1U9RA 5DEHA 1I6HB 2NVTB 1ENCA 5C44B 2NTTA 1KDBA 2K32A 3NHHA 1RTNA 1DOLA 2R6GA 3NQTA 2BE5D 1V1PB 2F0JA 4BWGB 5JAVA 4ZK9B 3PIO3 4L63B 2IX3A 4DGZA 3QO2A 2F0DA 2MPMA 3Q6SA 2XRSD 2DY7A 1OXSC 3T13A 1K83B 5IGEA 1Z6HA 4R9WA 5C0XI 3BYTB 1O7YA 2BOSA 4QCLA 1IW7C 5IGBA 5BN5A 1MBYA 1I4RA 2PZTA 1WD0A 3L3OC 5M5WB 4QIWB 3NTHA 1DOMA 5CR3A 3DHQA 3P20A 3QOLA 1AEXA 4IN3A 1F2LA 1S4ZA 1SBBB 1TT2A 1G2SA 3VR6A 4RH6A 2SEBD 2IJ0A 2A68D 5EPJA 4XXEA 3TMEA 4KN7C 3DWQA 3FPPA 3MA2B 4FXGC 3R93A 1C8CA 1AP0A 3HEJA 1W6JA 1NAPA 4QUCA 1PRTF 4KK7A 4KN4C 2WAQB 1JOOA 1VF5C 3IL8A 3GTQB 1EL0A 3PUZA 2TSSA 3U9OA 2B2TC 3IAYA 2ZT9C 2I07B 2A5HA 4Q0FA 1Z7TA 4XQQA 2EY1A 3JAME 4OIKA 2I46A 3P1HA 3SK8A 3RMHA 5EGTA 3DEPA 1ILPA 4K6DA 4XDXA 1B53A 2ZXPA 4IUPA 1S5CD 1TY2A 3GTPB 1BBXC 1O80A 2BDOA 4FF2A 4PNYA 3MXUA 3ITPA 3VYRA 4KY7A 1STHA 5I6WA 3SK6A 2EVBA 3SE0A 3J80E 2ZXOA 2EYLA 2WINB 2PCFB 2DY8A 2FINB 3NBHA 2FMMA 2MP1A 1D5XC 1EYDA 3VR5A 1SXTA 2KCCA 1BCPF 3HOXB 2DNEA 2QF7A 4U673 3GTMB 4LMQD 4NP5A 4IFDG 2RDHA 1XXGA 1BUVT 1BOSA 1EIGA 1EY4A 3V05A 4XTCS 2BCOA 5J39A 1PRTD 2O2LD 2NYZD 2G9HD 1KLUD 2VB3X 1VF7A 4OIJA 2PZUA 3WOEA 2IL8A 3I3CA 1TS2A 1ESFA 1WTVA 3VYSA 1TWHB 2VUMB 3M4YA 5I9PA 4KHZA 1YNND 4ME5A 4RGMA 3G6JB 3UI2A 2B2VC 1X32A 3S2DB 1EZ6A 2RA4A 2RKSA 1VDZA 3NPPA 3PUXA 1E2WA 2NVXB 3MWYW 1HFGA 1A2TA 1FD7D 1HQMC 3OMGA 1TY0A 3C3LA 1F9PA 3HKZB 2XRQD 4B9XA 5JVH3 1QJOA 1I50B 4ODGA 1LV9A 1PFBA 1E2ZA 4EVOA 4ZYSA 4H0LC 5CV4A 4TSSA 1F2MA 3H3VC 4RAUC 4NKLA 5KYIA 1OXUA 2VB2X 1PXUA 3RZOB 5D65A 4CJ2C 1WTPA 4C3HG 4A3EB 1KNAA 5DM63 1BCPD 1TWFB 4YIJA 1D1KA 4G7HC 1CQVA 1WTOA 3RUZA 3D6CA 1FNWA 1TWAB 3D6WA 2PW5A 3OSOA 1VCIA 3I70A 3CQZB 5M9OA 4K14A 3VR2A 4WJWA 4CJ1B 4J1MA 1EIHA 2XVSA 3C46A 5FO7B 3OWEB 2K03A 5JJZA 1ICWA 1LTID 4C2MB 2BDNA 4PQXA 1PFMA 3NK9A 3S9WA 2LMCB 2AUJD 3K0YA 1JCKB 4WRDA 5I9OA 1BR9A 2H1EA 1B3AA 3P7JA 1TS4A 1U4RA 5IGCA 3K58A 1Q90A 3NQIA 3K7AB 1NR4A 2VXWA 4U68A 2NN6H 3J7AV 3TP5A 1NSNS 3MZ5A 3D4DA 5CGKA 1G6ZA 2KECA 5CV8A 5ELCA 3CHBD 1B44D 1IKLA 3OWFA 2FJ2A 5EJWA 2NZ1D 4K2KA 2XWBB 4Y7NB 2F0VA 5C0XG 3MC0B 3A55A 1ZXTA 1R4PB 5A2QE 3FDTA 1ZYRC 2Q8RE 1YNJC 3NP8A 3TSSA 2PO4A 3A8IE 3HS0C 1SMYC 3R8BA 5EKLA 3QG1A 4F8MA 3GTOB 2JP1A 1KAAA 3P75A 1A15A 2A69C 2J4XA 5CV7A 3KBGA 2KVMA 4KY6A 2JA5B 2ID0A 1EWHA 4M1UB 5IGFA 2AUKA 3M4OB 1UUPA 4IQZA 5C6AA 3SK5A 1CFMA 3NBIA 2C9OA 4HMJA 4XT3B 4FYDA 3BDLA 1DD2A 1F9SA 1LABA 3L9AX 1EY6A 2BA1A 1RCVD 4A3MB 5C0XH 4HEDA 2A6HC 3PO3B 1OXTA 4XYOA 2N55A 2F0LA 1LTBD 3MAQA 1FGBD 1EFID 4HTHA 1DZ1A 1Y8NB 2IX0A 4IURA 5C3EB 4G7ZC 1Q1EA 2IPKD 4K5XA 2KJXA 3EQLC 2D9UA 4BS9A 2BA0A 2AWNA 1EYAA 1GUWA 1ET6A 3I72A 5CYUA 4X3KA 2LS01 2PZWA 3DWPA 1UNSA 3G7LA 4JBWA 5FO9B 5C4HA 1X3PA 4XIGS 1EYCA 4FXDA 3FKIB 3A56A 2QKIC 4H44C 4RWSC 5JPMC 1JWMD 4C3JG 1RD9D 2F4IA 3A7AB 1F2ZA 5M5XB 2IW3A 1U4PA 5KEEA 1LT3D 5I2XA 3GTKB 1I6VC 2H4OA 1RKNA 4M8AA 2NVYB 4A3DB 1SE4A 2BE5C 2XIWA 3SEBA 3RLFA 3K6OA 2FFKB 2AQ1B 4V0BA 1A3UA 1EY5A 1V8QA 3GV3A 3F2UA 3FEWX 1EY9A 4DN4M 2XSCA 1F77A 1EWCA 3A7LA 5IOCA 2Z4HA 2FHTA 4UDUC 5FLXE 1SJHD 3MXGA 3T56B 2L55A 1CA6A 4R8IA 4RFBA 4XQNA 1TQOA 2PYKA 1F2YA 3S15B 2RQXA 3I90A 3LWUA 1SFOB 1SNCA 3EJIA 4WORA 1A6XA 1JORA 2F0GA 2O5IC 3K5LA 2SNSA 4HN7A 3T16A 3OW7A 2M00A 2K5WA 2NB0A 2L0CA 1NUCA 3R2IA 5JVG3 4A3BB 3DXJC 2RDGA 3CRLC 3N52A 3S2HB 4FNFA 4TKOB 2K01A 3M7GA 3TP8A 4P2CB 3SHLA 3H0GB 2KOLA 2Z1CA 3ND8A 2CHBD 4IUNA 4KKSA 1X3QA 3R2TA 2A6ED 1EEID 4J8QA 3W3AA 2EYJA 2F0KA 4DXGA 2JA8B 2HDLA 1EEFD 3MXNA 1DXMA 1PTOD 1QCBD 3S1MB 4ZUJA 3PIP3 4ZKBB 3HOZB 1G91A 3RD4A 1Y1WB 3R3OA 3S1NB 5LL6S 1E2VA 3TP7A 1PYWD 1HCZA 1LT6D 3TN2A 5JOBA 1FR3A 3HOWB 3EROA 3ONAB 5G3LF 4QB4A 1HTLD 4DK0A 5E4XA 1A2UA 2G9DA 2CW0D 2MGSA 2AQ3B 5IODA 4KV6A 4IUTA 2EDGA 4IUQA 2EOTA 1E0BA 1B9NA 3H91A 2XNAC 3VA5A 4ULLA 4DF7A 1PZJD 5IGGA 4O1NA 1BO0A 2LKVA 1CZGA 4E6IA 1U4LA 2J7ZA 1I4GA 5JEAJ 1Z47A 2RBMA 3GTGB 4RKLA 1JWSD 3QOJA 3A8JE 1LTSD 1YNNC 1SYDA 2B8GA 3SR1A 1SYFA 2L11A 1BF4A 3BVMA 4RGTA 1HTPA 1EU3A 2JEBI 1CT1D 4I65A 1XWEA 4ZAIA 4G57A 2YU9B 4EQNA 3TDQA 4IZ8A 3HOYB 4BY7B 2B2WA 3OOCA 3KLSX 2EYPA 3ERQA 1JQYD 4X3SA 1K8OA 3VR4A 3DMUA 2JYOA 3Q24A 3EA6A 3DEOA 1ENAA 4KJNA 4J6HA 5ELBA 4V190 4DK1A 1TS3A 3KBXA 5C4XB 2E2DC 2K5QA 1JOKA 3S1RB 2WKDA 2ZXRA 1PLFA 3GO5A 1STYA 2EYFA 4LJZC 1HRJA 4IFDH 2FMCA 1IYVA 4TQUS 4HAEA 3LWEA 2HCIA 1V43A 3V96A 3X3MA 4DFAA 3SDZA 3BVGA 3A54A 3S1QB 1JICA 2PQEA 5DM73 3O13A 3HGBA 2EY5A 2F0IA 3M85A 2JSOA 1EZ8A 4I7ZC 1SSOA 1HUMA 2X6LA 4KD3A 4R8NA 4KKTA 5IT9L 1CHPD 2WACA 3M3YB 3TBIB 2F0OA 5EPLA 4RCNA 4ZQ3A 3TZUA 1B1ZA 3QIAA 3H94A 5EKIA 4EQOA 3C1FA 1STBA 3I4NB 2EPBA 3KLSA 1B50A 1KDAA 1SNMA 4OL7A 3VYTA 1RF2D 2IT1A 1BDOA 2A73B 3C2PA 1UAPA 2O5JC 1W6KA 1TR5A 1EQVA 1SDFA 3E6ZX 5FOBB 2L1BA 1ENFA 2B39A 2QDBA 2B2YC 2L4NA 4XYQA 4BA1I 2NVQB 4XQJA 5DAUA 1BXTA 2K28A 2Q8IB 3RZDB 1LT4D 3AU7A 1JOQA 3NSWA 3MFGA 4CGYB 1DYQA 1SAPA 3OPOA 1HHVA 2RSOA 2WP8J 1EY0A 1PFNA 1T5EA 4DU9A 3M7NA 2QEJC 2EXZA 1J9OA 5EQ0A 1C4QA 3NUCA 5HURA 3IFTA 3Q0AA 1S5DD 4NMZA 3S14B 4ZRZA 3K57A 4HCSA 4ID6A 3QJYA 4FP5D 3EFXD 1VMCA 4QUFA 4QF4A 3PMFA 4K6LA 2SDFA 2B63B 2F0UA 3E5SA 2M9VA 3AB9A 3CRKC 3PUWA 1GOZA 2CQAA 4AYBB 2IX1A 4RGOS 2E2IB 1R9TB 2QILA 4ABNA 2HDMA 3S16B 5C5MA 3DUZA 2QCPX 1STAA 3VR3A 4K8IA 5C5LA 4DNTB 4DAYA 5J22A 4WFN3 4C1NI 1DOKA 3KF8A 1MSHA 3KUPA 2EJMA 3PO2B 1BQQT 4UAIA 4C3HB 3OMCA 1CHQD 1I3QB 2K05A 3BYYB 2GA4B 2B2WC 1ZYRD 1TWCB 1KABA 1SMYD 2F0PA 3OIQA 4G4KA 2WIIB 5K36G 1ESRA 3JAML 1EY8A 1LACA 4F7XA 1JC7A 4ILWA 4KY5A 5I6YA 2D62A 3KK7A 1AZPA 1XTCD 4FF4A 2A69D 5D3IB 4LK1C 4EQPA 5KGUA 4N9PA 4OO1G 1H9SA 1DJRD 3NTIA 4PV1C 3T53B 4BA2I 1QNKA 3DWAA 2WV6D 5JPNC 1LTRD 1QOHA 5ISRA 3J80L 4G7OC 5J1ZA 2MUYA 3K5NA 1D2BA 5ELFA 1SNOA 2F3WA 1GUOA 2E2JB 2R3ZA 1H9RA 1EU4A 2NN6I 5D14A 1O7LA 2OF1A 2EYMA 2D5DA 1MD2D 4S3SA 1QILA 1EQTA 2ENBA 5CBEE 4CBVA 1RTOA 3KLRA 1WTWA 4KI0A 5M3MB 2EYOA 4PMBA 4CJ0B 3HP3A 1VMPA 3BDOA 5KNDA 1STGA 4IFDJ 3GD7A 5T1GA 3T4AC 5C4ZA 2E76C 3MTSA 2K04A 1STEA 1NR2A 5I2YA 1FNVA 1WCMB 1II3A 2R7ZB 5M3FB 2DN8A 4K8JA 1I4QA 1Y69U 1GUGA 1HA6A 5KRUA 3NXWA 2F03A 2R92B 2LFNA 3D8GA 3PUVA 3BVZA 2L9HA 1SYGA 5EPKA 1I4PA 4KD4A 2B2UA 3I4MB 2HCCA 4RHSA 1LLRD 1AN8A 1CM9A 3SVMA 1IL8A 3K5OA 4X3UA 1CZWA 4L6TB 3HOUB 1LTGD 2A68C 2DNCA 5HGTA 4B9WA 2A6EC 4RCOA 1RDPD 1XX8A 3GP7A 5NUCA 1SE2A 3J7YW 1IYUA 4C3IG 3QWNA 2XN9C 1WD1A 1OXXK 5TSSA 4IALA 4PMWA 4RKBA 4FF3A 2LY7A 3W2DA 1PTOC 1OXVA 3OIPA 4JK1C 3MVVA 2PPBC 3I4LA 4N9TA 4KTAA 5FK9C 2OT2A 3GQBA 5EBCA 1B2TA 2N88A 4FF1A 1G291 1V1OA 2HUGA 3MHBA 2K7VA 4CKCA 2KCNA 1Q3LA 1A3VA 2R61A 2EY2A 2X6GA 1KDCA 2M2LA 1ZEQX 4BBRB 1TS5A 4L8JA 1RJTA 3E0JA 1IW7D 1TIID 5FO8B 3L7ZC 2F0NA 3IKJA 2B2YA 4QMGA 1BNZA 3SK4A 2K5DA 2CW0C 4B08A 2K1BA 4MHEA 5IIFA 3K59A 4C56C 1CQFA 1D6EC 2L5TA 1AZQA 1PTOB 2VNUD 3D4WA 4HSPA 4DNRB 1KLGD 5F2DA 4K5VA 1MSGA 3LX0A 1LT5D 3IFDA 4OO1I 5KNCA 2NTSA 5EKKA 5ELEA 4A3FB 4C3JB 3T51B 5LL6X 4OGQC 3MXPA 2JA7B 5CC4A 1L0YB 1Q1BA 1O7ZA 4RA8A 3S17B 5EBDA 4KKUA 4HSVA 2SNMA 2HQEA 4RHRA 2PMZB 3TZDA 1TVXA 3D3RA 5KYLA 2F0EA 2F0MA 1PRTC 5KIXA 2XWJB 1SNDA 1KNEA 1D5ZC 1NCVA 1PMRA 2EY6A 1GUNA 5CV5A 4FVMA 1FYCA 1S5BD 3I91A 4C1NK 1EOTA 1SYBA 1CI3M 4KHVA 1B4OA 1Y1VB 3U9SA 5BN3A 5A2QL 1M4VA 3QB3A 1TWGB 4ZUIA 5C0XJ 1WVLA 1ET9A 3BDCA 1D5MC 1DCZA 1GHKA 5DNFA 5KNBA 2OXPA 1PRTB 1H9SB 3J81E 3CKIB 2E2HB 5T1IA 1GXDC 2ICIA 3ZYYX 1JB3A 1QB5D 2L12A 2NBFA 4C3IB 5CV6A 1G8ZD 1H9JA 4O42A 5G3LD 2AWOA 1G2TA 1M8AA 1B9MA 5CORA 5ELDA 4A3GB 1H9MA 4BBSB 1BCPC 4ZLTF 2RDFA 2R93B 1SEBD 5BN4A 1HXYD 2F0WA 3NE5B 5C4JB 3DM1A 4EGVA 1KTKA 2B2UC 4LAAA 1TU2B 4NDXA 1GUSA 1AW7A 1O78A 5C3WA 2JXMB 4A3KB 2NWGA 1LTTD 4Z9CB 2F0QA 3Q22A 2A74C 2K6AA 2RVLA 3X3NA 1Q12A 3D31A 4H13C 1BCPB 3EVQA 1AFPA 5CV9A 5FKAC 1U4MA 2KA7A 4A3IB 4RGNA 4F87A 2PNRC 1RODA 1V1PA 1SNQA 4MN3A 1H9KA 2JE6I 3H6MA 1SNPA 3SXHA 2MHVA 2CVRA 3BS1A 4CKBA 2KEEA 1DM0B 2E74C 2NN6G 2F0TA 5E1FA 1S5FD 3GV6A 1XYIA 1QWYA 2D2CC 4KJOA 4K5WA 5IGDA 3FRPB 1L0XB 2O4XA 2F0HA 1Y8OB 3HRZC 4GZYC 4H7BA 3NWTA 1GJXA 5CMDA 1SE3A 1LO5D 1UEAB 5FLXL 3GTLB 1Q8IA 3A8KE 2WKCA 1HUNA 3H09A 1CK1A 1S5ED 3MEHA 4FXKC 3MFYA 1GHJA 3CU7A 2WB1B 1SYCA 2F0SA 3V2TA 3I8ZA 5JEAG 1WTQA 4ZKCB 2OEOA 4OHJA 3C1EA 2C5CA 4TRDA 3HG9A 5M5YB 4BY1B 2EZVA 3BZDB 1I4HA 4MIUA 1WTXA 2J0TD 1C48A 4IFDI 1ML0D 2F3VA 3I73A 2ICEC 1F9RA 1JR0D 2Q8TA 2PW7A 3NTKA 1QG7A 4F88A 4FO2A 1QE6A 4CHTB 1J8IA 1RHPA 1SYEA 1OO9B 4DXFA 1SJED 1ILQA 1K8MA 2F0FA 2YYZA 2Y0SB 1Y8PB 3HOVB 4K2LA 2F1MA 2Z8LA 1TKWB 2EE1A 4IUUA 2B2TA 2SOBA 3URYA 1T5XD 4NW2A 4DA2A 2KHSA 5JEAH 3TP6A 2X69A 3FPUB 1D1IA 1YNJD 4KMUC 2K33A 3AMUA 4HR7B 3HZXA 5LHY1 1STNA 3NWSA 2KUMA 3WDNA 1ZKOA 5K5PA 3ND9A 3D4RA 4HCEA 1QNUA 3FVQA 2AQ2B 1JWUD 3PV0A 2JA6B 1I4XA 1HQRD 5A35A 3LNNA 3PUYA 4IUVA 3N6RA 5C3XA 2B8FA 5COYA 4XT1B 5I4DA 5CBAE 4X3TA 1JE4A 1R4QB 2EJGC 5IT9E 1FNUA 1GUTA 1F9QA 2MJ8A 2E75C 4Q5VA 1IKMA 2V4DA 1HFNA 2A6HD 2EJFC 4A3JB 1EY7A 2JEAI 3Q23A 3J7AF 4A93B 2KQ3A 1MI2A 3FMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0T A;  1SNC A;  4HMI A;  5CV8 A;  2F0F A;  3EJI A;  4WOR A;  3DHQ A;  5E1F A;  4K5X A;  1II3 A;  1JOQ A;  3D4W A;  3QOL A;  1AEX A;  4K8J A;  1JOR A;  2NUC A;  1JOK A;  3OWF A;  1KAB A;  2F0P A;  5I9P A;  4KV6 A;  5IOD A;  1STY A;  1TT2 A;  2EYF A;  5F2D A;  4K5V A;  5KRU A;  2F0G A;  3LX0 A;  1EYA A;  4KJO A;  5CV6 A;  3NXW A;  4YIJ A;  5E3F A;  2SNS A;  4K5W A;  4K2L A;  4K2K A;  1EY0 A;  1EY8 A;  2PZW A;  3T16 A;  4F7X A;  5IGD A;  3D8G A;  2F0V A;  3RUZ A;  4DFA A;  4KY5 A;  2M00 A;  5I6Y A;  4NP5 A;  1SYG A;  4DU9 A;  1A3T A;  3D6C A;  2O4X A;  3TME A;  2PQE A;  5EKK A;  2EXZ A;  4KD4 A;  1NUC A;  4PMC A;  2SOB A;  5C4H A;  3VA5 A;  2F0H A;  2EY5 A;  2KHS A;  4DF7 A;  1EY4 A;  1IHZ A;  3NP8 A;  3NUC A;  4EQP A;  5HUR A;  1EYC A;  2PW5 A;  3OSO A;  5IGG A;  5KGU A;  3TP6 A;  2F0I A;  2LKV A;  3HEJ A;  3MXP A;  4H7B A;  4N9P A;  3TP8 A;  5EKL A;  2RDF A;  3SHL A;  4E6I A;  5CC4 A;  4NMZ A;  5IIF A;  5J39 A;  2EYH A;  1EZ8 A;  4F8M A;  2F0W A;  5HGT A;  1U9R A;  2RBM A;  4KD3 A;  4B9W A;  5M9O A;  3HZX A;  1F2Z A;  4IUN A;  4R8N A;  4RKL A;  5DEH A;  2PZU A;  1KAA A;  1JOO A;  1STN A;  3QOJ A;  4K14 A;  4ID6 A;  1ENC A;  3P75 A;  5ISR A;  2WAC A;  2SNM A;  2HQE A;  5J1Z A;  5KEE A;  5K5P A;  2F0O A;  5NUC A;  1SYD A;  5CV7 A;  4ZQ3 A;  1KDB A;  4J1M A;  1RKN A;  3U9O A;  4LAA A;  3NHH A;  1SNO A;  3MEH A;  4KY6 A;  3PMF A;  2EYJ A;  4NDX A;  2F0E A;  2F3W A;  4QF4 A;  4ME5 A;  5KYL A;  2F0K A;  2F0M A;  3NQT A;  5C3W A;  5KIX A;  4IAL A;  3SR1 A;  4RKB A;  1SND A;  4EQO A;  3C1F A;  2EY1 A;  5IGF A;  3NK9 A;  1SYF A;  1STB A;  2F0U A;  3E5S A;  1A3U A;  1EY5 A;  2F0J A;  5KYI A;  5JAV A;  3S9W A;  2OF1 A;  1EZ6 A;  2EY6 A;  2EYM A;  3P1H A;  2F0Q A;  1SYC A;  3SK8 A;  2F0S A;  2RKS A;  1EY9 A;  3V2T A;  4DGZ A;  3MVV A;  5CV5 A;  2F0D A;  5EGT A;  4S3S A;  4K6D A;  5C6A A;  2OEO A;  3SK5 A;  1KDA A;  4HMJ A;  1SNM A;  4N9T A;  4OL7 A;  4KTA A;  4ZUJ A;  3C1E A;  4WRD A;  2ENB A;  4TRD A;  3BDL A;  3T13 A;  5IOC A;  1A2T A;  4I65 A;  5IGE A;  3OMG A;  5I9O A;  3MHB A;  4G57 A;  5C3X A;  4PNY A;  4EQN A;  1SYB A;  3R3O A;  3ITP A;  3EVQ A;  4IZ8 A;  1A3V A;  1EY6 A;  2EYO A;  4KY7 A;  4MIU A;  2EY2 A;  5CV9 A;  4B9X A;  4KHV A;  1KDC A;  4PMB A;  5C5M A;  5IGC A;  1STH A;  1STA A;  3TP7 A;  5I6W A;  4ODG A;  2EYP A;  3SK6 A;  4K8I A;  5C5L A;  2F3V A;  1TR5 A;  3ERQ A;  5IGB A;  1EQV A;  3QB3 A;  2EYL A;  1SNQ A;  4EVO A;  5J22 A;  5JOB A;  1STG A;  4ZUI A;  3DMU A;  2PW7 A;  3ERO A;  3H6M A;  5CV4 A;  1SNP A;  2F0L A;  2QDB A;  2F0N A;  3SXH A;  2PZT A;  4QB4 A;  1F2M A;  1TQO A;  3TP5 A;  1EY7 A;  2PYK A;  1NSN S;  1ENA A;  1F2Y A;  3BDC A;  4HTH A;  4QMG A;  3SK4 A;  3MZ5 A;  3OMC A;  5C4Z A;  3D4D A;  1A2U A;  4KJN A;  5DAU A;  2KQ3 A;  1SYE A;  4NKL A;  5CGK A;  1EYD A;  2OXP A;  4J6H A;  5CR3 A; 
#chains in the Genus database with same CATH topology
 4HMI A;  5K36 H;  3CCU A;  1PZK D;  1DON A;  1BVS A;  1HZB A;  2NUC A;  4BBR H;  4CKE A;  3E9I A;  2TMP A;  1ONL A;  4DAV A;  5D3D A;  1K3B C;  1MGS A;  5E4W C;  1HR0 L;  3WOF A;  3I7F A;  5E3F A;  3VA7 A;  3H15 A;  3VYU A;  2Z4I A;  1PYS B;  2I0Q A;  1LTA D;  3OTO L;  3K8A A;  2K50 A;  1PFS A;  1HA5 A;  1A3T A;  4OO1 H;  1L2F A;  4PMC A;  3OHX C;  1PZI D;  1WTR A;  1EIY B;  4YY3 Q;  1LM0 A;  1IHZ A;  1CA5 A;  4DAP A;  2RSN A;  3GTJ B;  1PTO H;  1UE5 A;  2IWH A;  1PDQ A;  4APV A;  3K5M A;  2B2V A;  4DR3 Q;  1W2B A;  2EYH A;  3J81 L;  5AFW A;  1HPC A;  2KED A;  1WI5 A;  1CTM A;  2PQA A;  3BG3 A;  1PTO F;  1U9R A;  3IRB A;  4FDB A;  1HJP A;  5DEH A;  1I6H B;  2NVT B;  4GS3 A;  1ENC A;  3GTQ H;  4HIO A;  5C44 B;  2NTT A;  1KDB A;  4B3R L;  2K32 A;  3NHH A;  1RTN A;  1DOL A;  4JI4 L;  2R6G A;  5GAE C;  1NMG A;  2KHI A;  3NQT A;  2RCN A;  4DUY L;  1X6O A;  5LMN Q;  5ELN A;  4GKJ L;  2BE5 D;  1V1P B;  2RHS B;  2F0J A;  4BWG B;  1V1Q A;  5JAV A;  4ZK9 B;  4UP9 A;  3PIO 3;  4L63 B;  2IX3 A;  4DGZ A;  3QO2 A;  2F0D A;  4LF5 Q;  2MPM A;  3Q6S A;  3S17 H;  2XRS D;  2DY7 A;  2JK8 A;  1BBW A;  4JOI C;  1PH1 A;  3GTP H;  1OXS C;  3T13 A;  1K83 B;  5IGE A;  1MKH A;  1Z6H A;  4JYA L;  4R9W A;  5C0X I;  1GVP A;  3BYT B;  4MNO A;  4DR6 L;  4K0K Q;  1O7Y A;  2BOS A;  4YWK A;  3ULP A;  4QCL A;  4HIK A;  2E5L L;  1IW7 C;  1HNW L;  5IGB A;  2VUM G;  2OCE A;  4X65 L;  4BY7 G;  3CPW A;  5BN5 A;  1MBY A;  1I4R A;  2PZT A;  1WD0 A;  3L3O C;  5M5W B;  4B3M Q;  4QIW B;  2IHF A;  3NTH A;  4DPG A;  1DOM A;  5CR3 A;  3S24 A;  2Q2I A;  3DHQ A;  1EIF A;  3CXC A;  2RF4 A;  3P20 A;  1A0I A;  3QOL A;  1AEX A;  1Y1V H;  3U50 C;  4IN3 A;  1F2L A;  1VQF A;  4AIM A;  1S4Z A;  4O2D A;  1SBB B;  1TT2 A;  4EX5 A;  1G2S A;  3HOX H;  3VR6 A;  4RH6 A;  4LFA Q;  1QUQ B;  2SEB D;  4OXP A;  2IJ0 A;  1TWG H;  1XMQ Q;  5C4X G;  3ERS X;  2A68 D;  4A4I A;  2I5M X;  2JA9 A;  3AEV A;  3GTM H;  2UXB L;  2VQF L;  5EPJ A;  4XXE A;  1J5E Q;  5LMN W;  3TME A;  4KN7 C;  3DWQ A;  3FPP A;  3MA2 B;  4FXG C;  3R93 A;  1C8C A;  3W5O A;  3U58 A;  1AP0 A;  3HEJ A;  3ZJY C;  1W6J A;  2E2H H;  1NAP A;  4QUC A;  1PRT F;  4KK7 A;  4KN4 C;  1KD1 C;  3L2P A;  2K5N A;  2VQE Q;  1LUZ A;  2WAQ B;  4C3I H;  1JOO A;  1VF5 C;  3IL8 A;  4A3E G;  3GTQ B;  1VQE A;  1EL0 A;  3PUZ A;  2TSS A;  1D8L A;  3U9O A;  2B2T C;  1TWH H;  3IAY A;  2ZT9 C;  2I07 B;  3BU2 A;  2A5H A;  4Q0F A;  1Z7T A;  4XQQ A;  2EY1 A;  2JJQ A;  3JAM E;  4JBM A;  3S2D H;  4OIK A;  3G71 A;  2I46 A;  1JJC B;  3P1H A;  3SK8 A;  3A5Z B;  3RMH A;  3BZK A;  5EGT A;  3DEP A;  1ILP A;  4K6D A;  4XDX A;  2NVX H;  3M9B A;  1B53 A;  2ZXP A;  4IUP A;  1S5C D;  1TY2 A;  3GTP B;  1BBX C;  1WFQ A;  3I4N G;  1O80 A;  2HIX A;  2BDO A;  3JC6 6;  2F4V L;  4FF2 A;  4PNY A;  3MXU A;  1HZ9 A;  3ITP A;  3VYR A;  1XPO A;  4KY7 A;  2P5Z X;  3CW2 C;  1STH A;  3BZC A;  3B6Y A;  5I6W A;  1I50 H;  3SK6 A;  2EVB A;  3GDE A;  3SE0 A;  3J80 E;  4X62 Q;  2ZXO A;  2EYL A;  2WIN B;  2PCF B;  2DY8 A;  2DUD A;  2FIN B;  3NBH A;  4LF9 Q;  2FMM A;  2MP1 A;  5H1S E;  1K8G A;  1N32 Q;  1U0L A;  3PGZ A;  3VDY A;  1D5X C;  1EYD A;  3VR5 A;  1KQS A;  1SXT A;  2KCC A;  1Q7Y C;  3RZO H;  4A3E H;  3KJO A;  4A3I H;  2ZM6 L;  1BCP F;  3HOX B;  3M4Q A;  2UXD Q;  2DNE A;  1BBU A;  2QF7 A;  1TWF H;  1Y14 B;  4U67 3;  3GTM B;  1K73 C;  2CH4 A;  4IPD A;  4LMQ D;  4GLA C;  4NP5 A;  4IFD G;  2RDH A;  1XXG A;  2QEX A;  4JCV E;  1BUV T;  1YIT A;  1BOS A;  1EIG A;  1EY4 A;  3UDX A;  3AFQ A;  1HNZ Q;  5GAH C;  3V05 A;  4XTC S;  2BCO A;  5J39 A;  4DV4 L;  4DV5 L;  1PRT D;  2O2L D;  2NYZ D;  2G9H D;  2I5H A;  1KLU D;  3KDF B;  2UU9 Q;  2VB3 X;  3J81 i;  1VF7 A;  4LW1 A;  4JI5 L;  4OIJ A;  2PZU A;  3CCR A;  1P16 A;  3G4S A;  3WOE A;  2IL8 A;  5BR8 Q;  3I3C A;  1TS2 A;  1XMO Q;  1ESF A;  1WTV A;  3VYS A;  1TWH B;  2VUM B;  3M4Y A;  5I9P A;  4KHZ A;  1YNN D;  4ME5 A;  4RGM A;  3G6J B;  3UI2 A;  4C2M H;  4LF8 L;  2B2V C;  4UHV A;  1X32 A;  3S2D B;  1EZ6 A;  2RA4 A;  3KF6 A;  2RKS A;  2B63 G;  4UPA A;  1VDZ A;  3NPP A;  3PUX A;  1E2W A;  2NVX B;  4DV2 L;  3CC4 A;  4RMF A;  3MWY W;  1A8V A;  1HFG A;  1A2T A;  1FD7 D;  1HQM C;  3OMG A;  3J81 c;  1TY0 A;  4IPH A;  3C3L A;  1F9P A;  3HKZ B;  2XRQ D;  2BH8 A;  4B9X A;  5JVH 3;  1QJO A;  1I50 B;  4ODG A;  1B3Q A;  1LV9 A;  1PFB A;  3UDF A;  1E2Z A;  4LF6 Q;  2JA5 G;  4EVO A;  4ZYS A;  4H0L C;  2A8V A;  5CV4 A;  4JI3 Q;  4TSS A;  1F2M A;  4MZ9 A;  3H3V C;  3CCM A;  4RAU C;  3K7U C;  4NKL A;  5M5Y H;  1AE2 A;  5KYI A;  4BY1 H;  1OXU A;  3PO2 G;  2VB2 X;  1PXU A;  1VQ6 A;  3RZO B;  5D65 A;  4CJ2 C;  1WTP A;  4C3H G;  3MEF A;  4A3E B;  1KNA A;  2PQA B;  5DM6 3;  1BCP D;  4UP7 A;  4DR1 L;  3TS2 A;  1TWF B;  2VS1 A;  4YIJ A;  1D1K A;  4G7H C;  1CQV A;  1WTO A;  3RUZ A;  3TQY A;  1PH4 A;  3D6C A;  2IY5 B;  1FNW A;  1TWA B;  1XTD A;  1EUJ A;  4JI2 L;  4UP8 A;  3D6W A;  2ES2 A;  2NZO A;  2PW5 A;  3OSO A;  1FGU A;  3TRE A;  1VCI A;  3I70 A;  3CQZ B;  3SGI A;  4BXX H;  1XNQ Q;  3GTO H;  5C3E G;  5M9O A;  1NTG A;  2F3I A;  4K14 A;  1X3F A;  2UUC L;  3VR2 A;  4LFC L;  4DV0 L;  1UWV A;  4LUZ A;  4WJW A;  1VQB A;  4CJ1 B;  1NE3 A;  4J1M A;  1EIH A;  2Z6K C;  1VQ9 A;  2XVS A;  4HJ9 A;  3C46 A;  5FO7 B;  3OWE B;  4DAM A;  2K03 A;  5JJZ A;  1ICW A;  1LTI D;  1Q46 A;  4C2M B;  1VQK A;  2BDN A;  4PQX A;  1PFM A;  5IYB G;  3NK9 A;  3S9W A;  2LMC B;  2AUJ D;  3I2Z A;  3K0Y A;  3M4O H;  3FKI G;  1JCK B;  1QUQ A;  3E0E A;  1PVO A;  1Z9F A;  4WRD A;  4A3L G;  1BR9 A;  2H1E A;  5I9O A;  1B3A A;  3P7J A;  1TS4 A;  4JI1 L;  1U4R A;  5IGC A;  4A3M H;  3K58 A;  4CDF C;  1Q90 A;  4A3D G;  3NQI A;  3K7A B;  3PO3 H;  5M3M G;  1NR4 A;  3T1H L;  3CCS A;  2JA6 H;  2VXW A;  4U68 A;  1SRO A;  2NN6 H;  4JV5 Q;  3J7A V;  2C35 B;  3TP5 A;  2KCM A;  1NSN S;  2UUB Q;  3CCJ A;  3MZ5 A;  3D4D A;  5CGK A;  1G6Z A;  4JI7 Q;  2KEC A;  5CV8 A;  5ELC A;  4DR4 L;  3CHB D;  1B44 D;  1IKL A;  3OWF A;  3CCV A;  3G6E A;  2FJ2 A;  5EJW A;  5M3F G;  2NZ1 D;  5IYD H;  4K2K A;  2XWB B;  4Y7N B;  2F0V A;  1SE8 A;  5C0X G;  4A3J H;  3MC0 B;  3A55 A;  5IP9 H;  2R92 G;  1ZXT A;  2XTI A;  4A93 H;  1R4P B;  1N9W A;  5A2Q E;  3FDT A;  1ZYR C;  2Q8R E;  4B3T Q;  1YNJ C;  3NP8 A;  3TSS A;  2PO4 A;  3A8I E;  3HS0 C;  1SMY C;  5FJ8 G;  3R8B A;  5EKL A;  1IYJ B;  3J81 j;  3I4M G;  3QG1 A;  4LF4 L;  4F8M A;  3GTO B;  2JP1 A;  1Q82 C;  1KAA A;  4KHP L;  5M5X H;  3P75 A;  2R7D A;  1A15 A;  2A69 C;  2J4X A;  5CV7 A;  2ZJR A;  3RNU A;  2B3G A;  4DUZ L;  1IXR A;  3KBG A;  2NVY H;  4A3D H;  2KVM A;  3A0J A;  4KY6 A;  2JA5 B;  2ID0 A;  2Z6B A;  1EWH A;  3CF5 A;  4M1U B;  4A76 A;  3FP9 A;  5IGF A;  4A3B G;  2AUK A;  3M4O B;  2KBN A;  1UUP A;  4IQZ A;  1VQG A;  4A3C G;  3RR5 A;  5C6A A;  2Q2H A;  1I6H H;  3SK5 A;  1CFM A;  1XNR L;  3NBI A;  2C9O A;  4HMJ A;  4XT3 B;  4FYD A;  3BDL A;  1DD2 A;  5C44 H;  1F9S A;  1A63 A;  4GN5 A;  1LAB A;  3L9A X;  1EY6 A;  2BA1 A;  1RCV D;  4A3M B;  2MQH A;  5C0X H;  2G5D A;  4HED A;  2WFW A;  2A6H C;  3PO3 B;  1OXT A;  4XYO A;  3F1Z A;  4R4T A;  2N55 A;  2F0L A;  1LTB D;  3HKS A;  3KDF A;  3MAQ A;  1FGB D;  4R4O A;  1EFI D;  4HTH A;  2JA8 G;  1DZ1 A;  3CD6 A;  4AYB E;  1ASZ A;  1K83 H;  4DV6 Q;  1SFO H;  3AFP A;  1Y8N B;  2IX0 A;  4IUR A;  5C3E B;  4G7Z C;  1Q1E A;  2IPK D;  4QL5 A;  4K5X A;  4L5R C;  2KJX A;  3EQL C;  2D9U A;  4BS9 A;  2KCT A;  2BA0 A;  2AWN A;  1EYA A;  1GUW A;  1ET6 A;  2RHQ B;  3I72 A;  5CYU A;  4X3K A;  2PZW A;  2LS0 1;  1E1O A;  3DWP A;  1UNS A;  1WOC A;  3G7L A;  4JBW A;  5FO9 B;  3I56 A;  5C4H A;  1X3P A;  2OTJ A;  4DR5 Q;  4XIG S;  1NBW A;  1EYC A;  4FXD A;  3FKI B;  3A56 A;  2QKI C;  4DV3 Q;  4H44 C;  5J3B A;  4RWS C;  5JPM C;  3H0G H;  1CKM A;  3KF6 B;  4A3F G;  1JWM D;  4C3J G;  1RD9 D;  2F4I A;  3A7A B;  1F2Z A;  3PSI A;  2JA7 G;  1AH9 A;  5M5X B;  4B3S L;  2IW3 A;  1JJG A;  1U4P A;  2PI2 E;  5KEE A;  1LT3 D;  5I2X A;  5IYC G;  3GTK B;  1I6V C;  3PIO A;  2H4O A;  1RKN A;  4M8A A;  4YWL A;  2NVY B;  1KL9 A;  4A3D B;  1SE4 A;  2BE5 C;  2XIW A;  3SEB A;  5IT9 c;  3RLF A;  3K6O A;  2FFK B;  2AQ1 B;  4V0B A;  3CAM A;  4X64 Q;  1A3U A;  1EY5 A;  1HH2 P;  1V8Q A;  3GV3 A;  3F2U A;  1IBM Q;  3FEW X;  1EY9 A;  2K52 A;  4DN4 M;  2XSC A;  1F77 A;  3S1M H;  1CSQ A;  1EWC A;  3A7L A;  1YJW A;  5IOC A;  2Z4H A;  3HOZ H;  1N34 L;  2FHT A;  1Y1W H;  4UDU C;  2YTX A;  1HR0 Q;  3S1N H;  5FLX E;  1SJH D;  3MXG A;  1IL2 A;  3T56 B;  5IE8 A;  1N36 L;  2L55 A;  3CMA A;  1CA6 A;  4R8I A;  4RFB A;  3HOW H;  1KC8 C;  4XQN A;  3A5U A;  1TQO A;  2PYK A;  1F2Y A;  2XGT A;  3S15 B;  2RQX A;  3I90 A;  3LWU A;  1NY4 A;  1SFO B;  1SNC A;  3EJI A;  4WOR A;  4P72 A;  1A6X A;  5E7N A;  1JOR A;  1MJE A;  4YCU A;  1EQR A;  1HZC A;  1UE7 A;  2F0G A;  2O5I C;  4B3R Q;  3HOY G;  2ASB A;  1B8A A;  3K5L A;  2SNS A;  4HN7 A;  3T16 A;  3OW7 A;  2M00 A;  2K5W A;  2NB0 A;  4WJ4 A;  2L0C A;  1NUC A;  3R2I A;  5JVG 3;  4A3B B;  3DXJ C;  2RDG A;  2CCZ A;  3CRL C;  3N52 A;  3S2H B;  4OON A;  2KHJ A;  4FNF A;  4TKO B;  4L5Q A;  2K01 A;  3M7G A;  3TP8 A;  2OTL A;  4P2C B;  3SHL A;  1PV4 A;  3H0G B;  4A3G G;  2HHH L;  2KOL A;  2Z1C A;  3GTG H;  3ND8 A;  2CHB D;  4IUN A;  4KKS A;  1VQA A;  1X3Q A;  1BKB A;  4JYA Q;  2K5V A;  3R2T A;  1HR0 W;  2A6E D;  3DM3 A;  1EEI D;  2VQE L;  4DR6 Q;  1KAW A;  2E5L Q;  2ZTC A;  1HNW Q;  4J8Q A;  2Z6K A;  3W3A A;  2EYJ A;  3M4P A;  2F0K A;  1PA6 A;  1NNX A;  4DR7 L;  4DXG A;  2MNA A;  4NXM L;  4Y52 H;  2JA8 B;  1VQ8 A;  2HDL A;  1EEF D;  4HID A;  4O0A A;  3MXN A;  4DV1 Q;  4A3K G;  1DXM A;  1PTO D;  1QCB D;  2HIV A;  3S1M B;  4ZUJ A;  3PIP 3;  4ZKB B;  4OX9 L;  5JJK A;  3HOZ B;  1A62 A;  1G91 A;  3RD4 A;  2YU9 H;  1Y1W B;  2VUM H;  3R3O A;  2CWA A;  3HOY H;  2BH2 A;  3S1N B;  4BY7 H;  5LL6 S;  1IBL L;  1E2V A;  3CP0 A;  3TP7 A;  1PYW D;  2UXB Q;  1HCZ A;  3UDG A;  1LT6 D;  3TN2 A;  1XJV A;  1RIP A;  3HFZ B;  1FR3 A;  4R4C A;  5JOB A;  2IHE A;  3HOW B;  3ERO A;  3ONA B;  3ER0 A;  5G3L F;  4QB4 A;  3JAM i;  1HTL D;  4DK0 A;  5E4X A;  1A2U A;  4ME3 A;  1E24 A;  2ZTD A;  4LFB L;  2G9D A;  5GQO A;  1P8L A;  2CW0 D;  5C4X H;  2MGS A;  2QW7 A;  4GN4 B;  2AQ3 B;  1E3P A;  5IOD A;  3S1R H;  4KV6 A;  4IUT A;  1X3G A;  4R1J A;  1PH8 A;  2EDG A;  4IUQ A;  3J80 i;  2EOT A;  1E0B A;  3S1Q H;  1B9N A;  3DLL A;  3H91 A;  2XNA C;  3VA5 A;  4JI0 L;  2A19 A;  4ULL A;  4DF7 A;  3TS0 A;  1PZJ D;  5IGG A;  4O1N A;  1BO0 A;  2LKV A;  3JAM c;  1CZG A;  4E6I A;  1U4L A;  2J7Z A;  2Q2U A;  2ZJQ A;  4N8X 1;  1I4G A;  3F2C A;  5JEA J;  1N33 L;  2MO1 A;  1S3O A;  2F4V Q;  1Z47 A;  2RBM A;  3E3X A;  3GTG B;  4RKL A;  1JWS D;  4DR2 L;  3QOJ A;  3LGJ A;  2CFM A;  3Q8D A;  2PI2 A;  3A8J E;  4HJ8 A;  1LTS D;  4JVZ A;  3M3Y H;  3NEN A;  4DV7 Q;  1YNN C;  1SYD A;  2B8G A;  1TWA H;  1VQJ A;  5GAG C;  4IPC A;  1FL0 A;  4DK3 C;  4JBJ A;  3SR1 A;  3J80 c;  1E1T A;  4AQY L;  1SYF A;  2L11 A;  3CQZ H;  2VZA A;  1BF4 A;  3I4N H;  2ZTE A;  3BVM A;  4RGT A;  1HTP A;  1EU3 A;  2WB1 G;  2JEB I;  3H3V H;  1CT1 D;  1H95 A;  4I65 A;  2K5H A;  1XWE A;  2ZM6 Q;  1YIJ A;  4ZAI A;  4G57 A;  2YU9 B;  2PMZ E;  1SMX A;  4EQN A;  1RL2 A;  3TDQ A;  4IZ8 A;  3HOY B;  1L1O A;  4GNX C;  4HJ7 A;  4BY7 B;  2B2W A;  3OOC A;  3KLS X;  2EYP A;  3E9H A;  3ERQ A;  1JQY D;  4X3S A;  1K8O A;  3VR4 A;  3DMU A;  2JYO A;  2DJF C;  3Q24 A;  3EA6 A;  1VQI A;  4NXN L;  1PHJ A;  3DEO A;  1B7Y B;  1ENA A;  2NVQ H;  5GRO A;  4KJN A;  1I5F A;  4DV4 Q;  4J6H A;  5ELB A;  1KRT A;  4P75 A;  4V19 0;  4DK1 A;  1TS3 A;  3KBX A;  4AYB G;  3RZD H;  4JI5 Q;  3UE1 A;  4IO9 A;  5C4X B;  1JJ2 A;  2E2D C;  2K5Q A;  1JOK A;  3S1R B;  2WKD A;  2ZXR A;  1EQQ A;  1PLF A;  3GO5 A;  1STY A;  2EYF A;  4LJZ C;  1HRJ A;  2HT1 A;  4IFD H;  3KYH C;  3K7A H;  2FMC A;  1IYV A;  1YVC A;  5AJ3 L;  4TQU S;  4HAE A;  3LWE A;  2UXC Q;  2HCI A;  1V43 A;  3F8T A;  3V96 A;  3X3M A;  4DFA A;  2K4K A;  3BVG A;  3SDZ A;  3A54 A;  3S1Q B;  1JIC A;  1K8A C;  4LF8 Q;  3K0X A;  2PQE A;  5DM7 3;  3STB D;  4GNX B;  3HOV G;  3O13 A;  3PCO B;  3HGB A;  2EY5 A;  1CKN A;  2F0I A;  3M85 A;  4OEM B;  2JSO A;  4DV2 Q;  4GLX A;  3KFU A;  1EZ8 A;  3D0F A;  4I7Z C;  1SSO A;  3S14 H;  1HUM A;  3AYH B;  1S40 A;  2X6L A;  4KD3 A;  1HNX L;  4R8N A;  4KKT A;  5IT9 L;  1W3S A;  3CME A;  1CHP D;  2WAC A;  4Y7N H;  3M3Y B;  4JW0 A;  4MTN A;  3TBI B;  2F0O A;  5EPL A;  4RCN A;  4ZQ3 A;  4X66 L;  3PQI A;  1EWI A;  1B1Z A;  3TZU A;  3QIA A;  2B63 H;  4NB3 A;  3H94 A;  5EKI A;  4EQO A;  3C1F A;  1EYG A;  1STB A;  1KIX A;  1VQD A;  3I4N B;  2EPB A;  3KLS A;  1K0R A;  1UE1 A;  1B50 A;  1KDA A;  1SNM A;  4OL7 A;  1R9T H;  4GKK L;  3VYT A;  3S16 H;  1RF2 D;  1K3R A;  4DR1 Q;  2JA5 H;  2KEN A;  2IT1 A;  1BDO A;  1IBK L;  3HKZ E;  4WJ3 M;  2A73 B;  1YJN A;  3C2P A;  1UAP A;  2O5J C;  1FJG L;  1W6K A;  1TR5 A;  1EQV A;  1SDF A;  1MJC A;  3A74 A;  1DGS A;  3E6Z X;  5FOB B;  2L1B A;  1ENF A;  2B39 A;  4JI6 L;  2RCF A;  2QDB A;  2B2Y C;  1AE3 A;  2L4N A;  4JI8 L;  3PO2 H;  4XYQ A;  4BA1 I;  2NVQ B;  4XQJ A;  2PNH A;  4C3H H;  5DAU A;  3RN5 A;  1BXT A;  4ALP A;  4JV5 L;  2K28 A;  2Q8I B;  3RZD B;  1LT4 D;  3AU7 A;  4IPG A;  1JOQ A;  3CCQ A;  4LFC Q;  1TWC H;  4DV0 Q;  3NSW A;  5HGQ A;  3MFG A;  4CGY B;  1DYQ A;  1SAP A;  3OPO A;  1HHV A;  2RSO A;  2WP8 J;  1PYB A;  1EY0 A;  1X56 A;  1PFN A;  1T5E A;  4YHH L;  2GVA A;  4IJH A;  1CSP A;  4DU9 A;  3M7N A;  2QEJ C;  2EXZ A;  1E7Z A;  1J9O A;  5EQ0 A;  5IWA Q;  1C4Q A;  4GOP C;  3NUC A;  5HUR A;  3IFT A;  2HD3 A;  5C3E H;  3Q0A A;  1S5D D;  1XPU A;  3U4V A;  4NMZ A;  3MXN B;  4IOC A;  3S14 B;  4ZRZ A;  3K57 A;  1WCM G;  4HCS A;  2R7Z G;  2H5X A;  4ID6 A;  4JI1 Q;  3QJY A;  3UDI A;  4FP5 D;  5IYB H;  3T1Y L;  3EFX D;  1VMC A;  4QUF A;  4QF4 A;  3PMF A;  3I55 A;  4K6L A;  2SDF A;  2B63 B;  2E2J H;  3FKI H;  4LUV A;  2F0U A;  3E5S A;  2M9V A;  4A3L H;  2K14 A;  1S72 A;  3AB9 A;  3CRK C;  1SLJ A;  2UUA L;  3PUW A;  1GOZ A;  2N8N A;  4DR4 Q;  3ULJ A;  2CQA A;  4AYB B;  1GM5 A;  2YTV A;  1V9P A;  3HOU G;  2IX1 A;  4RGO S;  2E2I B;  3GTK H;  1R9T B;  2QIL A;  4ABN A;  1JT8 A;  2HDM A;  4GOP B;  3J7Z C;  3G48 A;  3S16 B;  3KLW A;  1I94 L;  5M3M H;  2R7F A;  5C5M A;  3DUZ A;  2QCP X;  1STA A;  1JE5 A;  2AKW B;  3VR3 A;  2CH4 W;  4K8I A;  5C5L A;  4DNT B;  3W1G A;  3PF4 A;  4DAY A;  2WB1 E;  5J22 A;  4WFN 3;  4C1N I;  1DOK A;  3KF8 A;  1MSH A;  3KUP A;  2EJM A;  3PO2 B;  1BQQ T;  3I4O A;  3KJP A;  4UAI A;  3NEM A;  4C3H B;  3OMC A;  1CHQ D;  1I3Q B;  2VY3 A;  1KXL A;  4LF4 Q;  1L1O C;  2K05 A;  1VQH A;  1ICF B;  5IP7 G;  3BYY B;  2GA4 B;  2B2W C;  1ZYR D;  5M3F H;  4KHP Q;  1TWC B;  4HJA A;  1KAB A;  1SMY D;  2F0P A;  4DV6 L;  3OIQ A;  4G4K A;  4DUZ Q;  2WII B;  5K36 G;  1ESR A;  2R92 H;  4LF7 L;  4BBR G;  1EY8 A;  1LAC A;  3CPF A;  1JC7 A;  4F7X A;  4ILW A;  3JAM L;  4KY5 A;  3RLO A;  5I6Y A;  5FJ8 H;  1WYD A;  2D62 A;  3KK7 A;  1AZP A;  1XTC D;  5LMU Q;  3S15 H;  4FF4 A;  3I4M H;  2A69 D;  1K28 A;  1LYL A;  5D3I B;  4LK1 C;  4EQP A;  5KGU A;  3TRZ A;  1CUK A;  4KLK A;  4N9P A;  4OO1 G;  1H9S A;  1XNR Q;  1YJ9 A;  1VQP A;  3HOU H;  1DJR D;  3NTI A;  4PV1 C;  2Y0S E;  3T53 B;  4BA2 I;  1QNK A;  3EN2 A;  3DWA A;  2WV6 D;  5JPN C;  1LTR D;  5JJL A;  1QOH A;  2OWO A;  5ISR A;  3J80 L;  4G7O C;  5J1Z A;  1M90 C;  2MUY A;  4IJL A;  3K5N A;  1L1O B;  2V1C C;  1D2B A;  5ELF A;  4A3B H;  1SNO A;  2F3W A;  1PH7 A;  4DKA C;  3S2H H;  1GUO A;  2E2J B;  2R3Z A;  4A3C H;  1H9R A;  1EU4 A;  2NN6 I;  5D14 A;  1O7L A;  2OF1 A;  1G51 A;  2EYM A;  4YY3 L;  1Q81 C;  2D5D A;  2ALY B;  1MD2 D;  4S3S A;  4H02 A;  1QIL A;  3EBE A;  4DR3 L;  1EQT A;  2ENB A;  1K9M C;  5CBE E;  4CBV A;  1RTO A;  3KLR A;  1WTW A;  4KI0 A;  4J15 A;  5M3M B;  2EYO A;  3KOJ A;  4GNX A;  4PMB A;  4CJ0 B;  3HP3 A;  1VMP A;  3NEL A;  3BDO A;  2JA8 H;  5KND A;  1STG A;  5LMN L;  4IFD J;  3GD7 A;  5T1G A;  3T4A C;  5C4Z A;  2E76 C;  1CKN B;  3MTS A;  2LXK A;  1EFW A;  2K04 A;  1STE A;  1NR2 A;  4CDE C;  4LF5 L;  5I2Y A;  1FNV A;  1WCM B;  1II3 A;  2R7Z B;  4EQ5 A;  5M3F B;  2DN8 A;  4K8J A;  1I4Q A;  1VQL A;  4B3S Q;  1Y69 U;  1GUG A;  4RG1 A;  3OTO Q;  1HA6 A;  5KRU A;  3OW2 A;  3NXW A;  2F03 A;  2R92 B;  2OQ0 A;  1Y1V G;  4K0K L;  2LFN A;  3D8G A;  3PUV A;  1L0W A;  4R4I A;  3HOX G;  3BVZ A;  2L9H A;  1SYG A;  2QDL A;  5EPK A;  2Z0S A;  1I4P A;  4KD4 A;  1TXY A;  2B2U A;  3I4M B;  4A3F H;  2HCC A;  4RHS A;  4C3J H;  1LLR D;  1AN8 A;  1CM9 A;  3SVM A;  1IL8 A;  3RN2 A;  1OTC A;  3K5O A;  4X3U A;  4B3M L;  2JA7 H;  1CZW A;  4L6T B;  3HOU B;  1LTG D;  2JQO A;  5IYC H;  2A68 C;  2DNC A;  3K80 C;  5HY6 A;  4P74 A;  5HGT A;  3CCL A;  4B9W A;  1N34 Q;  2A6E C;  4RCO A;  4L5S A;  1RDP D;  4LUO A;  1XX8 A;  4JI4 Q;  3GP7 A;  5NUC A;  4DUY Q;  1SE2 A;  4LFA L;  4GKJ Q;  3J7Y W;  1IYU A;  4C3I G;  3QWN A;  1XMQ L;  1N36 Q;  4JC0 A;  1M1K C;  2XN9 C;  1WD1 A;  1OXX K;  3PIP A;  5FLX c;  1QVG A;  5TSS A;  2EQS A;  4ZCK A;  4IAL A;  4PMW A;  4RKB A;  1J5E L;  4FF3 A;  2LY7 A;  3W2D A;  1PTO C;  1OXV A;  3OIP A;  4BBS G;  4JK1 C;  3MVV A;  2PPB C;  3I4L A;  4N9T A;  4KTA A;  2R93 G;  5FK9 C;  2OT2 A;  3GQB A;  4GLV B;  5EBC A;  2N88 A;  1B2T A;  4FF1 A;  4DV1 L;  1G29 1;  4TVA B;  1V1O A;  2HUG A;  3MHB A;  2K7V A;  4CKC A;  2KCN A;  1Q3L A;  4X65 Q;  1A3V A;  2R61 A;  1D7Q A;  2EY2 A;  2X6G A;  1KDC A;  2M2L A;  1ZEQ X;  4BBR B;  5IY0 A;  4OWX B;  3HKZ G;  1TS5 A;  4L8J A;  1RJT A;  3E0J A;  1IW7 D;  1TII D;  1YNX A;  3L7Z C;  5FO8 B;  2E8G A;  2F0N A;  3IKJ A;  2B2Y A;  4QMG A;  1B70 B;  1Q86 C;  1BNZ A;  2VL6 A;  3SK4 A;  1MIU A;  2K5D A;  2CW0 C;  4B08 A;  2K1B A;  4MHE A;  5IIF A;  3K59 A;  3CCE A;  2HHH Q;  4C56 C;  1U5K A;  1CQF A;  1YHQ A;  1D6E C;  2L5T A;  1AZQ A;  1PTO B;  1FVI A;  2VNU D;  1YZ6 A;  3D4W A;  4HSP A;  1QZG A;  1SRU A;  4DNR B;  1KLG D;  2Z9H A;  2VQF Q;  5F2D A;  1PH2 A;  1O7I A;  4K5V A;  1MSG A;  3LX0 A;  1LT5 D;  3IFD A;  3F2D A;  2FXQ A;  1X3E A;  4JPB W;  4OO1 I;  4A3I G;  5KNC A;  2NTS A;  3F2B A;  4X62 L;  4DR7 Q;  1ASY A;  1YBY A;  5EKK A;  5ELE A;  4A3F B;  4A3G H;  4C3J B;  4NXM Q;  4QIW E;  3T51 B;  4LF9 L;  4BBS H;  4JBK A;  5LL6 X;  4OGQ C;  4QQB X;  2N3S A;  4GOP A;  3MXP A;  2JA7 B;  1N32 L;  5CC4 A;  1L0Y B;  1Q1B A;  2R93 H;  3ICE A;  4OX9 Q;  1O7Z A;  4RA8 A;  2A1A A;  5EBD A;  3S17 B;  5GAD C;  5C4J H;  4KKU A;  4HSV A;  2SNM A;  2HQE A;  4RHR A;  1IBL Q;  2PMZ B;  2UXD L;  3TZD A;  1TVX A;  2D0P A;  3D3R A;  5KYL A;  2L15 A;  2Q2T A;  2F0E A;  2F0M A;  1PRT C;  5KIX A;  4DV7 L;  4A3K H;  2XWJ B;  1SND A;  1KNE A;  1D5Z C;  4DAY B;  1NCV A;  1VQN A;  2QA4 A;  3KF8 B;  1PMR A;  2EY6 A;  1X54 A;  1K0S A;  3TEH B;  1HNZ L;  1GUN A;  5CV5 A;  4LFB Q;  2CQO A;  4FVM A;  2WAQ E;  1FYC A;  4PZ6 A;  1S5B D;  4P73 A;  3I91 A;  4LWC A;  2UU9 L;  4C1N K;  1T9H A;  1EOT A;  1SYB A;  1JB7 A;  1CI3 M;  5BR8 L;  4YCW A;  4KHV A;  1B4O A;  1Y1V B;  1NMF A;  3U9S A;  5BN3 A;  1XMO L;  5A2Q L;  1N8R C;  1M4V A;  3QB3 A;  1TWG B;  4ZUI A;  1VQ5 A;  4JI0 Q;  5C0X J;  1WVL A;  1ET9 A;  3BDC A;  1D5M C;  1DCZ A;  2LXJ A;  1GHK A;  5DNF A;  5KNB A;  2OXP A;  2ZJP A;  1PRT B;  1N33 Q;  5EAY A;  4PZ7 A;  1H9S B;  3J81 E;  3CKI B;  4DR2 Q;  2E2H B;  5T1I A;  3QR8 A;  1GXD C;  4BY1 G;  2ICI A;  3ZYY X;  1GD7 A;  1JB3 A;  1QB5 D;  4DK6 C;  4LNQ A;  2L12 A;  2NBF A;  4C3I B;  5CV6 A;  1G8Z D;  3FHW A;  1H9J A;  4O42 A;  3STB C;  2QGQ A;  5G3L D;  2AWO A;  1G2T A;  1KRS A;  3W1B A;  1CKO A;  1VS0 A;  1M8A A;  2YTY A;  1YHA A;  5FLM G;  1B9M A;  4CDC C;  5COR A;  4AQY Q;  4LF6 L;  3K81 C;  4YWM A;  5ELD A;  4DV5 Q;  4A3G B;  2UXC L;  1H9M A;  4BBS B;  4JI3 L;  1VQC A;  2OQK A;  1C9O A;  1YHB A;  4PG3 A;  1BCP C;  4ZLT F;  2RDF A;  2R93 B;  1SEB D;  2DGY A;  2VW9 A;  5BN4 A;  1HXY D;  2F0W A;  4DNI A;  1PH9 A;  3PF5 A;  3NE5 B;  2Y0S G;  2HQL A;  3GTL H;  5ELO A;  5C4J B;  3CC2 A;  3DM1 A;  4EGV A;  4BXX G;  1SR3 A;  1KTK A;  1X55 A;  2B2U C;  4LAA A;  1TU2 B;  4NDX A;  1VQ4 A;  1GUS A;  1AW7 A;  1O78 A;  5C3W A;  2JXM B;  4A3K B;  2NWG A;  4NXN Q;  1LTT D;  4JG2 A;  2ATW A;  1C0A A;  4Z9C B;  2F0Q A;  3Q22 A;  2A74 C;  4X6A H;  2K6A A;  2RVL A;  2EIF A;  1XNQ L;  3X3N A;  1Q12 A;  4OWW B;  3D31 A;  4H13 C;  1BCP B;  4OEL B;  3EVQ A;  1AFP A;  5CV9 A;  5AJ3 Q;  5FKA C;  2NZH A;  2MO0 A;  1U4M A;  1IZ6 A;  2KA7 A;  3RLN A;  4L5T A;  4A3I B;  1PH3 A;  4RGN A;  4F87 A;  2PNR C;  5FLM H;  1ROD A;  1GKH A;  1SNQ A;  1V1P A;  4MN3 A;  1H9K A;  2JE6 I;  5L37 A;  4A3M G;  3H6M A;  4N8F A;  1SNP A;  3SXH A;  2MHV A;  1GO3 E;  2CVR A;  3WWV A;  1VQO A;  3BS1 A;  3PO3 G;  4CKB A;  3AQQ A;  1QZH A;  2E2I H;  2KEE A;  4QGU A;  2JA6 G;  1DM0 B;  2E74 C;  2NN6 G;  2F0T A;  2B29 A;  1SN8 A;  5E1F A;  1HNX Q;  2N49 A;  1S5F D;  1UEB A;  3GV6 A;  1YEZ A;  1XYI A;  1QWY A;  2D2C C;  1WTH A;  4KJO A;  4X66 Q;  4K5W A;  4JI2 Q;  3HOV H;  2EXD A;  5IGD A;  4POG A;  3FRP B;  1L0X B;  2O4X A;  1I3Q H;  5IYD G;  2F0H A;  1Y8O B;  4A3J G;  3HRZ C;  4GZY C;  1MHW C;  4H7B A;  2UUB L;  5IP9 G;  3NWT A;  1GJX A;  2UUC Q;  5CMD A;  4A93 G;  4JI7 L;  5IWA L;  1SE3 A;  3H3V I;  1LO5 D;  4GKK Q;  1UEA B;  4IOA A;  5FLX L;  3GTL B;  1Q8I A;  3A8K E;  2K75 A;  2WKC A;  5DLQ E;  1IBK Q;  1HUN A;  4JOI A;  3H09 A;  1CK1 A;  1VQ7 A;  1S5E D;  1FJG Q;  3MEH A;  1Q8K A;  4P71 A;  4FXK C;  3MFY A;  4JI6 Q;  2CWP A;  1GHJ A;  3CU7 A;  4GN3 B;  4JI8 Q;  2WB1 B;  1WJJ A;  3U4Z A;  4B3T L;  1SYC A;  2F0S A;  3V2T A;  3I8Z A;  5JEA G;  1WTQ A;  4ZKC B;  2OEO A;  4OHJ A;  2AMC B;  3C1E A;  2C5C A;  1QVC A;  4TRD A;  3J7A 5;  2LSS A;  3BJU A;  4CDD C;  3HG9 A;  5M5Y B;  4BY1 B;  2EZV A;  3BZD B;  3CC7 A;  1I4H A;  4MIU A;  1WTX A;  2J0T D;  1C48 A;  3T1H Q;  4AH6 A;  4IFD I;  5C44 G;  1ML0 D;  4YHH Q;  1X65 A;  2F3V A;  3I73 A;  2ICE C;  1F9R A;  4POF A;  1E22 A;  4NPS A;  1JR0 D;  2Q8T A;  2PW7 A;  3NTK A;  1QG7 A;  4F88 A;  4FO2 A;  4HJ5 A;  2D0O A;  1QE6 A;  4A75 A;  4CHT B;  1J8I A;  1RHP A;  2N78 A;  1SYE A;  1OO9 B;  4DXF A;  1SJE D;  1ILQ A;  2JN4 A;  1K8M A;  2F0F A;  2YYZ A;  2MFI A;  2Y0S B;  4YCV A;  1X9N A;  4R4Q A;  1Y8P B;  1C7Y A;  3T1Y Q;  3HOV B;  4K2L A;  2F1M A;  1KHI A;  2Z8L A;  1TKW B;  1PH6 A;  1NJI C;  2EE1 A;  4IUU A;  2B2T A;  2SOB A;  3URY A;  1T5X D;  4NW2 A;  4DA2 A;  2KHS A;  3OYY A;  2CKZ B;  5JEA H;  2UUA Q;  1WCM H;  3TP6 A;  3GTJ H;  2R7Z H;  5LMU L;  2X69 A;  3FPU B;  1D1I A;  1YNJ D;  4OWT B;  3NBH B;  4KMU C;  2K33 A;  3AMU A;  2I5L X;  3ULL A;  4HR7 B;  1HZA A;  3HZX A;  5LHY 1;  1XPR A;  1STN A;  3NWS A;  2NVT H;  1I94 Q;  3H0G G;  2KUM A;  3WDN A;  1ZKO A;  1UE6 A;  2DJG C;  3ND9 A;  5K5P A;  3D4R A;  1G6P A;  4QJF A;  2YV5 A;  1YI2 A;  4HCE A;  1QNU A;  3L0O A;  3FVQ A;  2AQ2 B;  4MTK A;  4QY7 A;  1JWU D;  2GN5 A;  4DR5 L;  3PV0 A;  2JA6 B;  3EIV A;  2GVB A;  1I4X A;  1HQR D;  5A35 A;  1PH5 A;  4DV3 L;  4I7A A;  3LNN A;  1JMC A;  5JJI A;  3PUY A;  4IUV A;  1VQM A;  1J6Q A;  2WAQ G;  3N6R A;  5C3X A;  2B8F A;  5COY A;  4XT1 B;  5I4D A;  5CBA E;  4X3T A;  2AHO B;  1JE4 A;  1R4Q B;  2EJG C;  4LF7 Q;  3HOZ G;  5IT9 E;  1FNU A;  1QVF A;  1LTL A;  4UY8 C;  1GUT A;  1Y1W G;  1F9Q A;  2MJ8 A;  2E75 C;  4Q5V A;  1IKM A;  2V4D A;  1HFN A;  2A6H D;  2EJF C;  4A3J B;  5M5W H;  4X64 L;  1EY7 A;  2JEA I;  3Q23 A;  3J7A F;  5IP7 H;  2F52 A;  1EOV A;  4PZ8 A;  3UE0 A;  1IBM L;  4A93 B;  2KQ3 A;  1MI2 A;  4HIM A;  3HOW G;  3FMC A; 
#chains in the Genus database with same CATH homology
 4HMI A;  5K36 H;  1PZK D;  1DON A;  2NUC A;  4CKE A;  2TMP A;  1ONL A;  4DAV A;  5D3D A;  1MGS A;  5E4W C;  3WOF A;  5E3F A;  3VA7 A;  3VYU A;  2Z4I A;  1LTA D;  1HA5 A;  1A3T A;  4OO1 H;  4PMC A;  3OHX C;  1PZI D;  1WTR A;  1IHZ A;  1CA5 A;  4DAP A;  2RSN A;  3GTJ B;  1PTO H;  2IWH A;  1PDQ A;  3K5M A;  2B2V A;  2EYH A;  3J81 L;  5AFW A;  1HPC A;  2KED A;  1CTM A;  3BG3 A;  1PTO F;  1U9R A;  5DEH A;  1I6H B;  2NVT B;  1ENC A;  5C44 B;  2NTT A;  1KDB A;  2K32 A;  3NHH A;  1RTN A;  1DOL A;  2R6G A;  3NQT A;  2BE5 D;  1V1P B;  2F0J A;  4BWG B;  5JAV A;  4ZK9 B;  3PIO 3;  4L63 B;  2IX3 A;  4DGZ A;  3QO2 A;  2F0D A;  2MPM A;  3Q6S A;  2XRS D;  2DY7 A;  1OXS C;  3T13 A;  1K83 B;  5IGE A;  1Z6H A;  4R9W A;  5C0X I;  3BYT B;  1O7Y A;  2BOS A;  4QCL A;  1IW7 C;  5IGB A;  5BN5 A;  1MBY A;  1I4R A;  2PZT A;  1WD0 A;  3L3O C;  5M5W B;  4QIW B;  3NTH A;  1DOM A;  5CR3 A;  3DHQ A;  3P20 A;  3QOL A;  1AEX A;  4IN3 A;  1F2L A;  1S4Z A;  1SBB B;  1TT2 A;  1G2S A;  3VR6 A;  4RH6 A;  2SEB D;  2IJ0 A;  2A68 D;  5EPJ A;  4XXE A;  3TME A;  4KN7 C;  3DWQ A;  3FPP A;  3MA2 B;  4FXG C;  3R93 A;  1C8C A;  1AP0 A;  3HEJ A;  1W6J A;  1NAP A;  4QUC A;  1PRT F;  4KK7 A;  4KN4 C;  2WAQ B;  1JOO A;  1VF5 C;  3IL8 A;  3GTQ B;  1EL0 A;  3PUZ A;  2TSS A;  3U9O A;  2B2T C;  3IAY A;  2ZT9 C;  2I07 B;  2A5H A;  4Q0F A;  1Z7T A;  4XQQ A;  2EY1 A;  3JAM E;  4OIK A;  2I46 A;  3P1H A;  3SK8 A;  3RMH A;  5EGT A;  3DEP A;  1ILP A;  4K6D A;  4XDX A;  1B53 A;  2ZXP A;  4IUP A;  1S5C D;  1TY2 A;  3GTP B;  1BBX C;  1O80 A;  2BDO A;  4FF2 A;  4PNY A;  3MXU A;  3ITP A;  3VYR A;  4KY7 A;  1STH A;  5I6W A;  3SK6 A;  2EVB A;  3SE0 A;  3J80 E;  2ZXO A;  2EYL A;  2WIN B;  2PCF B;  2DY8 A;  2FIN B;  3NBH A;  2FMM A;  2MP1 A;  1D5X C;  1EYD A;  3VR5 A;  1SXT A;  2KCC A;  1BCP F;  3HOX B;  2DNE A;  2QF7 A;  4U67 3;  3GTM B;  4LMQ D;  4NP5 A;  4IFD G;  2RDH A;  1XXG A;  1BUV T;  1BOS A;  1EIG A;  1EY4 A;  3V05 A;  4XTC S;  2BCO A;  5J39 A;  1PRT D;  2O2L D;  2NYZ D;  2G9H D;  1KLU D;  2VB3 X;  1VF7 A;  4OIJ A;  2PZU A;  3WOE A;  2IL8 A;  3I3C A;  1TS2 A;  1ESF A;  1WTV A;  3VYS A;  1TWH B;  2VUM B;  3M4Y A;  5I9P A;  4KHZ A;  1YNN D;  4ME5 A;  4RGM A;  3G6J B;  3UI2 A;  2B2V C;  1X32 A;  3S2D B;  1EZ6 A;  2RA4 A;  2RKS A;  1VDZ A;  3NPP A;  3PUX A;  1E2W A;  2NVX B;  3MWY W;  1HFG A;  1A2T A;  1FD7 D;  1HQM C;  3OMG A;  1TY0 A;  3C3L A;  1F9P A;  3HKZ B;  2XRQ D;  4B9X A;  5JVH 3;  1QJO A;  1I50 B;  4ODG A;  1LV9 A;  1PFB A;  1E2Z A;  4EVO A;  4ZYS A;  4H0L C;  5CV4 A;  4TSS A;  1F2M A;  3H3V C;  4RAU C;  4NKL A;  5KYI A;  1OXU A;  2VB2 X;  1PXU A;  3RZO B;  5D65 A;  4CJ2 C;  1WTP A;  4C3H G;  4A3E B;  1KNA A;  5DM6 3;  1BCP D;  1TWF B;  4YIJ A;  1D1K A;  4G7H C;  1CQV A;  1WTO A;  3RUZ A;  3D6C A;  1FNW A;  1TWA B;  3D6W A;  2PW5 A;  3OSO A;  1VCI A;  3I70 A;  3CQZ B;  5M9O A;  4K14 A;  3VR2 A;  4WJW A;  4CJ1 B;  4J1M A;  1EIH A;  2XVS A;  3C46 A;  5FO7 B;  3OWE B;  2K03 A;  5JJZ A;  1ICW A;  1LTI D;  4C2M B;  2BDN A;  4PQX A;  1PFM A;  3NK9 A;  3S9W A;  2LMC B;  2AUJ D;  3K0Y A;  1JCK B;  4WRD A;  5I9O A;  1BR9 A;  2H1E A;  1B3A A;  3P7J A;  1TS4 A;  1U4R A;  5IGC A;  3K58 A;  1Q90 A;  3NQI A;  3K7A B;  1NR4 A;  2VXW A;  4U68 A;  2NN6 H;  3J7A V;  3TP5 A;  1NSN S;  3MZ5 A;  3D4D A;  5CGK A;  1G6Z A;  2KEC A;  5CV8 A;  5ELC A;  3CHB D;  1B44 D;  1IKL A;  3OWF A;  2FJ2 A;  5EJW A;  2NZ1 D;  4K2K A;  2XWB B;  4Y7N B;  2F0V A;  5C0X G;  3MC0 B;  3A55 A;  1ZXT A;  1R4P B;  5A2Q E;  3FDT A;  1ZYR C;  2Q8R E;  1YNJ C;  3NP8 A;  3TSS A;  2PO4 A;  3A8I E;  3HS0 C;  1SMY C;  3R8B A;  5EKL A;  3QG1 A;  4F8M A;  3GTO B;  2JP1 A;  1KAA A;  3P75 A;  1A15 A;  2A69 C;  2J4X A;  5CV7 A;  3KBG A;  2KVM A;  4KY6 A;  2JA5 B;  2ID0 A;  1EWH A;  4M1U B;  5IGF A;  2AUK A;  3M4O B;  1UUP A;  4IQZ A;  5C6A A;  3SK5 A;  1CFM A;  3NBI A;  2C9O A;  4HMJ A;  4XT3 B;  4FYD A;  3BDL A;  1DD2 A;  1F9S A;  1LAB A;  3L9A X;  1EY6 A;  2BA1 A;  1RCV D;  4A3M B;  5C0X H;  4HED A;  2A6H C;  3PO3 B;  1OXT A;  4XYO A;  2N55 A;  2F0L A;  1LTB D;  3MAQ A;  1FGB D;  1EFI D;  4HTH A;  1DZ1 A;  1Y8N B;  2IX0 A;  4IUR A;  5C3E B;  4G7Z C;  1Q1E A;  2IPK D;  4K5X A;  2KJX A;  3EQL C;  2D9U A;  4BS9 A;  2BA0 A;  2AWN A;  1EYA A;  1GUW A;  1ET6 A;  3I72 A;  5CYU A;  4X3K A;  2LS0 1;  2PZW A;  3DWP A;  1UNS A;  3G7L A;  4JBW A;  5FO9 B;  5C4H A;  1X3P A;  4XIG S;  1EYC A;  4FXD A;  3FKI B;  3A56 A;  2QKI C;  4H44 C;  4RWS C;  5JPM C;  1JWM D;  4C3J G;  1RD9 D;  2F4I A;  3A7A B;  1F2Z A;  5M5X B;  2IW3 A;  1U4P A;  5KEE A;  1LT3 D;  5I2X A;  3GTK B;  1I6V C;  2H4O A;  1RKN A;  4M8A A;  2NVY B;  4A3D B;  1SE4 A;  2BE5 C;  2XIW A;  3SEB A;  3RLF A;  3K6O A;  2FFK B;  2AQ1 B;  4V0B A;  1A3U A;  1EY5 A;  1V8Q A;  3GV3 A;  3F2U A;  3FEW X;  1EY9 A;  4DN4 M;  2XSC A;  1F77 A;  1EWC A;  3A7L A;  5IOC A;  2Z4H A;  2FHT A;  4UDU C;  5FLX E;  1SJH D;  3MXG A;  3T56 B;  2L55 A;  1CA6 A;  4R8I A;  4RFB A;  4XQN A;  1TQO A;  2PYK A;  1F2Y A;  3S15 B;  2RQX A;  3I90 A;  3LWU A;  1SFO B;  1SNC A;  3EJI A;  4WOR A;  1A6X A;  1JOR A;  2F0G A;  2O5I C;  3K5L A;  2SNS A;  4HN7 A;  3T16 A;  3OW7 A;  2M00 A;  2K5W A;  2NB0 A;  2L0C A;  1NUC A;  3R2I A;  5JVG 3;  4A3B B;  3DXJ C;  2RDG A;  3CRL C;  3N52 A;  3S2H B;  4FNF A;  4TKO B;  2K01 A;  3M7G A;  3TP8 A;  4P2C B;  3SHL A;  3H0G B;  2KOL A;  2Z1C A;  3ND8 A;  2CHB D;  4IUN A;  4KKS A;  1X3Q A;  3R2T A;  2A6E D;  1EEI D;  4J8Q A;  3W3A A;  2EYJ A;  2F0K A;  4DXG A;  2JA8 B;  2HDL A;  1EEF D;  3MXN A;  1DXM A;  1PTO D;  1QCB D;  3S1M B;  4ZUJ A;  3PIP 3;  4ZKB B;  3HOZ B;  1G91 A;  3RD4 A;  1Y1W B;  3R3O A;  3S1N B;  5LL6 S;  1E2V A;  3TP7 A;  1PYW D;  1HCZ A;  1LT6 D;  3TN2 A;  5JOB A;  1FR3 A;  3HOW B;  3ERO A;  3ONA B;  5G3L F;  4QB4 A;  1HTL D;  4DK0 A;  5E4X A;  1A2U A;  2G9D A;  2CW0 D;  2MGS A;  2AQ3 B;  5IOD A;  4KV6 A;  4IUT A;  2EDG A;  4IUQ A;  2EOT A;  1E0B A;  1B9N A;  3H91 A;  2XNA C;  3VA5 A;  4ULL A;  4DF7 A;  1PZJ D;  5IGG A;  4O1N A;  1BO0 A;  2LKV A;  1CZG A;  4E6I A;  1U4L A;  2J7Z A;  1I4G A;  5JEA J;  1Z47 A;  2RBM A;  3GTG B;  4RKL A;  1JWS D;  3QOJ A;  3A8J E;  1LTS D;  1YNN C;  1SYD A;  2B8G A;  3SR1 A;  1SYF A;  2L11 A;  1BF4 A;  3BVM A;  4RGT A;  1HTP A;  1EU3 A;  2JEB I;  1CT1 D;  4I65 A;  1XWE A;  4ZAI A;  4G57 A;  2YU9 B;  4EQN A;  3TDQ A;  4IZ8 A;  3HOY B;  4BY7 B;  2B2W A;  3OOC A;  3KLS X;  2EYP A;  3ERQ A;  1JQY D;  4X3S A;  1K8O A;  3VR4 A;  3DMU A;  2JYO A;  3Q24 A;  3EA6 A;  3DEO A;  1ENA A;  4KJN A;  4J6H A;  5ELB A;  4V19 0;  4DK1 A;  1TS3 A;  3KBX A;  5C4X B;  2E2D C;  2K5Q A;  1JOK A;  3S1R B;  2WKD A;  2ZXR A;  1PLF A;  3GO5 A;  1STY A;  2EYF A;  4LJZ C;  1HRJ A;  4IFD H;  2FMC A;  1IYV A;  4TQU S;  4HAE A;  3LWE A;  2HCI A;  1V43 A;  3V96 A;  3X3M A;  4DFA A;  3SDZ A;  3BVG A;  3A54 A;  3S1Q B;  1JIC A;  2PQE A;  5DM7 3;  3O13 A;  3HGB A;  2EY5 A;  2F0I A;  3M85 A;  2JSO A;  1EZ8 A;  4I7Z C;  1SSO A;  1HUM A;  2X6L A;  4KD3 A;  4R8N A;  4KKT A;  5IT9 L;  1CHP D;  2WAC A;  3M3Y B;  3TBI B;  2F0O A;  5EPL A;  4RCN A;  4ZQ3 A;  3TZU A;  1B1Z A;  3QIA A;  3H94 A;  5EKI A;  4EQO A;  3C1F A;  1STB A;  3I4N B;  2EPB A;  3KLS A;  1B50 A;  1KDA A;  1SNM A;  4OL7 A;  3VYT A;  1RF2 D;  2IT1 A;  1BDO A;  2A73 B;  3C2P A;  1UAP A;  2O5J C;  1W6K A;  1TR5 A;  1EQV A;  1SDF A;  3E6Z X;  5FOB B;  2L1B A;  1ENF A;  2B39 A;  2QDB A;  2B2Y C;  2L4N A;  4XYQ A;  4BA1 I;  2NVQ B;  4XQJ A;  5DAU A;  1BXT A;  2K28 A;  2Q8I B;  3RZD B;  1LT4 D;  3AU7 A;  1JOQ A;  3NSW A;  3MFG A;  4CGY B;  1DYQ A;  1SAP A;  3OPO A;  1HHV A;  2RSO A;  2WP8 J;  1EY0 A;  1PFN A;  1T5E A;  4DU9 A;  3M7N A;  2QEJ C;  2EXZ A;  1J9O A;  5EQ0 A;  1C4Q A;  3NUC A;  5HUR A;  3IFT A;  3Q0A A;  1S5D D;  4NMZ A;  3S14 B;  4ZRZ A;  3K57 A;  4HCS A;  4ID6 A;  3QJY A;  4FP5 D;  3EFX D;  1VMC A;  4QUF A;  4QF4 A;  3PMF A;  4K6L A;  2SDF A;  2B63 B;  2F0U A;  3E5S A;  2M9V A;  3AB9 A;  3CRK C;  3PUW A;  1GOZ A;  2CQA A;  4AYB B;  2IX1 A;  4RGO S;  2E2I B;  1R9T B;  2QIL A;  4ABN A;  2HDM A;  3S16 B;  5C5M A;  3DUZ A;  2QCP X;  1STA A;  3VR3 A;  4K8I A;  5C5L A;  4DNT B;  4DAY A;  5J22 A;  4WFN 3;  4C1N I;  1DOK A;  3KF8 A;  1MSH A;  3KUP A;  2EJM A;  3PO2 B;  1BQQ T;  4UAI A;  4C3H B;  3OMC A;  1CHQ D;  1I3Q B;  2K05 A;  3BYY B;  2GA4 B;  2B2W C;  1ZYR D;  1TWC B;  1KAB A;  1SMY D;  2F0P A;  3OIQ A;  4G4K A;  2WII B;  5K36 G;  1ESR A;  3JAM L;  1EY8 A;  1LAC A;  4F7X A;  1JC7 A;  4ILW A;  4KY5 A;  5I6Y A;  2D62 A;  3KK7 A;  1AZP A;  1XTC D;  4FF4 A;  2A69 D;  5D3I B;  4LK1 C;  4EQP A;  5KGU A;  4N9P A;  4OO1 G;  1H9S A;  1DJR D;  3NTI A;  4PV1 C;  3T53 B;  4BA2 I;  1QNK A;  3DWA A;  2WV6 D;  5JPN C;  1LTR D;  1QOH A;  5ISR A;  3J80 L;  4G7O C;  5J1Z A;  2MUY A;  3K5N A;  1D2B A;  5ELF A;  1SNO A;  2F3W A;  1GUO A;  2E2J B;  2R3Z A;  1H9R A;  1EU4 A;  2NN6 I;  5D14 A;  1O7L A;  2OF1 A;  2EYM A;  2D5D A;  1MD2 D;  4S3S A;  1QIL A;  1EQT A;  2ENB A;  5CBE E;  4CBV A;  1RTO A;  3KLR A;  1WTW A;  4KI0 A;  5M3M B;  2EYO A;  4PMB A;  4CJ0 B;  3HP3 A;  1VMP A;  3BDO A;  5KND A;  1STG A;  4IFD J;  3GD7 A;  5T1G A;  3T4A C;  5C4Z A;  2E76 C;  3MTS A;  2K04 A;  1STE A;  1NR2 A;  5I2Y A;  1FNV A;  1WCM B;  1II3 A;  2R7Z B;  5M3F B;  2DN8 A;  4K8J A;  1I4Q A;  1Y69 U;  1GUG A;  1HA6 A;  5KRU A;  3NXW A;  2F03 A;  2R92 B;  2LFN A;  3D8G A;  3PUV A;  3BVZ A;  2L9H A;  1SYG A;  5EPK A;  1I4P A;  4KD4 A;  2B2U A;  3I4M B;  2HCC A;  4RHS A;  1LLR D;  1AN8 A;  1CM9 A;  3SVM A;  1IL8 A;  3K5O A;  4X3U A;  1CZW A;  4L6T B;  3HOU B;  1LTG D;  2A68 C;  2DNC A;  5HGT A;  4B9W A;  2A6E C;  4RCO A;  1RDP D;  1XX8 A;  3GP7 A;  5NUC A;  1SE2 A;  3J7Y W;  1IYU A;  4C3I G;  3QWN A;  2XN9 C;  1WD1 A;  1OXX K;  5TSS A;  4IAL A;  4PMW A;  4RKB A;  4FF3 A;  2LY7 A;  3W2D A;  1PTO C;  1OXV A;  3OIP A;  4JK1 C;  3MVV A;  2PPB C;  3I4L A;  4N9T A;  4KTA A;  5FK9 C;  2OT2 A;  3GQB A;  5EBC A;  1B2T A;  2N88 A;  4FF1 A;  1G29 1;  1V1O A;  2HUG A;  3MHB A;  2K7V A;  4CKC A;  2KCN A;  1Q3L A;  1A3V A;  2R61 A;  2EY2 A;  2X6G A;  1KDC A;  2M2L A;  1ZEQ X;  4BBR B;  1TS5 A;  4L8J A;  1RJT A;  3E0J A;  1IW7 D;  1TII D;  5FO8 B;  3L7Z C;  2F0N A;  3IKJ A;  2B2Y A;  4QMG A;  1BNZ A;  3SK4 A;  2K5D A;  2CW0 C;  4B08 A;  2K1B A;  4MHE A;  5IIF A;  3K59 A;  4C56 C;  1CQF A;  1D6E C;  2L5T A;  1AZQ A;  1PTO B;  2VNU D;  3D4W A;  4HSP A;  4DNR B;  1KLG D;  5F2D A;  4K5V A;  1MSG A;  3LX0 A;  1LT5 D;  3IFD A;  4OO1 I;  5KNC A;  2NTS A;  5EKK A;  5ELE A;  4A3F B;  4C3J B;  3T51 B;  5LL6 X;  4OGQ C;  3MXP A;  2JA7 B;  5CC4 A;  1L0Y B;  1Q1B A;  1O7Z A;  4RA8 A;  3S17 B;  5EBD A;  4KKU A;  4HSV A;  2SNM A;  2HQE A;  4RHR A;  2PMZ B;  3TZD A;  1TVX A;  3D3R A;  5KYL A;  2F0E A;  2F0M A;  1PRT C;  5KIX A;  2XWJ B;  1SND A;  1KNE A;  1D5Z C;  1NCV A;  1PMR A;  2EY6 A;  1GUN A;  5CV5 A;  4FVM A;  1FYC A;  1S5B D;  3I91 A;  4C1N K;  1EOT A;  1SYB A;  1CI3 M;  4KHV A;  1B4O A;  1Y1V B;  3U9S A;  5BN3 A;  5A2Q L;  1M4V A;  3QB3 A;  1TWG B;  4ZUI A;  5C0X J;  1WVL A;  1ET9 A;  3BDC A;  1D5M C;  1DCZ A;  1GHK A;  5DNF A;  5KNB A;  2OXP A;  1PRT B;  1H9S B;  3J81 E;  3CKI B;  2E2H B;  5T1I A;  1GXD C;  2ICI A;  3ZYY X;  1JB3 A;  1QB5 D;  2L12 A;  2NBF A;  4C3I B;  5CV6 A;  1G8Z D;  1H9J A;  4O42 A;  5G3L D;  2AWO A;  1G2T A;  1M8A A;  1B9M A;  5COR A;  5ELD A;  4A3G B;  1H9M A;  4BBS B;  1BCP C;  4ZLT F;  2RDF A;  2R93 B;  1SEB D;  5BN4 A;  1HXY D;  2F0W A;  3NE5 B;  5C4J B;  3DM1 A;  4EGV A;  1KTK A;  2B2U C;  4LAA A;  1TU2 B;  4NDX A;  1GUS A;  1AW7 A;  1O78 A;  5C3W A;  2JXM B;  4A3K B;  2NWG A;  1LTT D;  4Z9C B;  2F0Q A;  3Q22 A;  2A74 C;  2K6A A;  2RVL A;  3X3N A;  1Q12 A;  3D31 A;  4H13 C;  1BCP B;  3EVQ A;  1AFP A;  5CV9 A;  5FKA C;  1U4M A;  2KA7 A;  4A3I B;  4RGN A;  4F87 A;  2PNR C;  1ROD A;  1V1P A;  1SNQ A;  4MN3 A;  1H9K A;  2JE6 I;  3H6M A;  1SNP A;  3SXH A;  2MHV A;  2CVR A;  3BS1 A;  4CKB A;  2KEE A;  1DM0 B;  2E74 C;  2NN6 G;  2F0T A;  5E1F A;  1S5F D;  3GV6 A;  1XYI A;  1QWY A;  2D2C C;  4KJO A;  4K5W A;  5IGD A;  3FRP B;  1L0X B;  2O4X A;  2F0H A;  1Y8O B;  3HRZ C;  4GZY C;  4H7B A;  3NWT A;  1GJX A;  5CMD A;  1SE3 A;  1LO5 D;  1UEA B;  5FLX L;  3GTL B;  1Q8I A;  3A8K E;  2WKC A;  1HUN A;  3H09 A;  1CK1 A;  1S5E D;  3MEH A;  4FXK C;  3MFY A;  1GHJ A;  3CU7 A;  2WB1 B;  1SYC A;  2F0S A;  3V2T A;  3I8Z A;  5JEA G;  1WTQ A;  4ZKC B;  2OEO A;  4OHJ A;  3C1E A;  2C5C A;  4TRD A;  3HG9 A;  5M5Y B;  4BY1 B;  2EZV A;  3BZD B;  1I4H A;  4MIU A;  1WTX A;  2J0T D;  1C48 A;  4IFD I;  1ML0 D;  2F3V A;  3I73 A;  2ICE C;  1F9R A;  1JR0 D;  2Q8T A;  2PW7 A;  3NTK A;  1QG7 A;  4F88 A;  4FO2 A;  1QE6 A;  4CHT B;  1J8I A;  1RHP A;  1SYE A;  1OO9 B;  4DXF A;  1SJE D;  1ILQ A;  1K8M A;  2F0F A;  2YYZ A;  2Y0S B;  1Y8P B;  3HOV B;  4K2L A;  2F1M A;  2Z8L A;  1TKW B;  2EE1 A;  4IUU A;  2B2T A;  2SOB A;  3URY A;  1T5X D;  4NW2 A;  4DA2 A;  2KHS A;  5JEA H;  3TP6 A;  2X69 A;  3FPU B;  1D1I A;  1YNJ D;  4KMU C;  2K33 A;  3AMU A;  4HR7 B;  3HZX A;  5LHY 1;  1STN A;  3NWS A;  2KUM A;  3WDN A;  1ZKO A;  5K5P A;  3ND9 A;  3D4R A;  4HCE A;  1QNU A;  3FVQ A;  2AQ2 B;  1JWU D;  3PV0 A;  2JA6 B;  1I4X A;  1HQR D;  5A35 A;  3LNN A;  3PUY A;  4IUV A;  3N6R A;  5C3X A;  2B8F A;  5COY A;  4XT1 B;  5I4D A;  5CBA E;  4X3T A;  1JE4 A;  1R4Q B;  2EJG C;  5IT9 E;  1FNU A;  1GUT A;  1F9Q A;  2MJ8 A;  2E75 C;  4Q5V A;  1IKM A;  2V4D A;  1HFN A;  2A6H D;  2EJF C;  4A3J B;  1EY7 A;  2JEA I;  3Q23 A;  3J7A F;  4A93 B;  2KQ3 A;  1MI2 A;  3FMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...