4DR5L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr5L00
3JAMi 2MQHA 3I4OA 2MNAA 1D8LA 2ZM6Q 5IYBG 1XNRQ 4JBMA 1P8LA 4Y7NH 4DR1Q 2UXDQ 1AE2A 4QL5A 1WCMH 2Q2UA 2RHSB 2MO1A 2D62A 1QVGA 1PH7A 3PO3G 4A3KH 3HOYG 4KI0A 3H3VI 2E5LQ 5IP7G 3CC4A 1YEZA 3HKZE 4IPGA 2R7ZG 1I3QH 1CKOA 2KHIA 1XNRL 2JA7H 4A3LG 4A3CH 1HZCA 2VQFQ 5DLQE 4XTCS 1X6OA 3J81j 1SFOH 2UXDL 4KLKA 3STBD 5FJ8H 3PF5A 2NVXH 4JI1Q 1J6QA 4IJHA 4GN5A 2K75A 1YHBA 5JEAJ 2BH2A 2DGYA 4IPHA 3HOXH 4LWCA 1Q8KA 4RG1A 1K0RA 4JI5L 4DAMA 1LUZA 2VQFL 4HIDA 1UE6A 4LUVA 1OXXK 3B6YA 5GAEC 4A3IH 4WJ4A 3UDFA 4DV7L 1HZAA 2D0PA 1VQ8A 3J7ZC 2JA6G 4L5RC 3ZJYC 2N49A 2ALYB 3PGZA 4C3JH 1NBWA 4NXMQ 3I4MG 3PIOA 1KAWA 1Q86C 1PYBA 1UE7A 3CAMA 1YHAA 1CKNA 1OXTA 3BZCA 1OTCA 4R4IA 1E7ZA 4QIWE 2BA0A 2RCNA 3UE0A 3KJOA 2FXQA 3EBEA 3G6EA 4LFBL 5IWAQ 4JYAL 1L1OC 1M90C 1PVOA 2R7FA 3F2CA 3VDYA 4B3TQ 4NXML 3GTQH 3CCRA 5C3EG 1Y1WG 2JQOA 1VQHA 4JBKA 2Q2IA 2CWPA 4DR5Q 3PSIA 5IWAL 3TS0A 4XIGS 2E2JH 1NTGA 2OCEA 1WYDA 4JI3Q 2LXJA 4B3TL 2B3GA 2UUAQ 1YITA 1I94Q 3UDIA 1K73C 1B70B 4NXNL 1E1TA 4L5TA 4DR7Q 1AH9A 3CP0A 3ULJA 4DR5L 1L2FA 4HIMA 1VQDA 2Y0SE 5M5WH 1KXLA 3S14H 1G51A 4KHPL 5C4XH 2VQEQ 1FJGL 4IOCA 1PH9A 2UUAL 3J80i 1HZ9A 1I94L 1VQ9A 4B3RL 1HNWQ 1N36Q 3F1ZA 4LF4L 1KC8C 1Y1VG 3GTJH 3GO5A 2I5MX 4DR7L 3KF8B 1YJNA 4QY7A 1SROA 3BJUA 1PH1A 3FKIH 3AFQA 1C0AA 1GD7A 1N34Q 1N9WA 2VQEL 4A3GG 1K3RA 3W1GA 2K14A 1OXUA 2I0QA 4AYBE 3AEVA 1V1QA 4A93H 2OTLA 2A1AA 5C44H 4DAYB 1X56A 4YCVA 5IY0A 1ASZA 5C0XG 2UU9L 2I5LX 3RLOA 2V1CC 4LFAL 3UE1A 5C0XI 1L1OA 1YZ6A 1PA6A 1BBWA 2K5NA 1YI2A 1EOVA 2ES2A 1J5EQ 1IYJB 1X55A 1YNXA 3KOJA 4H02A 2N8NA 4JOIC 4R4QA 5E7NA 1NE3A 4P73A 1J5EL 3PV0A 1VQ7A 4IFDJ 4OWWB 1EWIA 2R92G 1LYLA 5H1SE 5IYBH 4X6AH 3I7FA 3S15H 2XGTA 3E9HA 3H3VH 2WAQE 2VZAA 3PO3H 3HOYH 1UE1A 3H15A 1PH4A 2PI2E 1VQJA 2GVBA 2KHJA 3PUZA 5IP7H 2R7DA 4HJAA 3Q8DA 3S1MH 4DR4Q 4LF6L 2R7ZH 4DR6Q 1D7QA 5BR8Q 1TWFH 4A3LH 3H0GG 3CPWA 5HY6A 1V43A 3U4VA 3W1BA 3MEFA 1O7IA 5HGQA 3I55A 4LF9L 3T1YQ 4DR4L 4DR6L 5IP9G 4C3IH 4YWKA 2CFMA 5BR8L 3AYHB 5IYDG 2JEBI 4JC0A 4A3DG 4AQYL 4LF8Q 3TS2A 4DKAC 3PUYA 4DV6Q 4X64L 3CMEA 3T1YL 4LW1A 2EQSA 2A8VA 2JA6H 1VQLA 4A75A 1U0LA 3NENA 1X3FA 3KF6B 1Y14B 3FP9A 1IBLQ 4JI7Q 1K8GA 2D0OA 2NN6G 5M5YH 3I4MH 4A76A 4Y52H 3HKZG 1XMQQ 5EAYA 4JOIA 4LF8L 1A62A 2H5XA 3J81c 4UP7A 2NN6I 4DV6L 2C35B 2WB1E 3MXNB 2NVTH 2IX0A 3M4OH 3F8TA 1IBLL 4JI7L 5JJIA 2EIFA 1T9HA 1X9NA 5C3EH 3WWVA 1XMQL 4JI4Q 3CD6A 4GNXB 1Y1WH 4JI6Q 2LSSA 1KIXA 4A3EG 4HIKA 3G48A 4DV0Q 1IBKQ 4JI5Q 1R9TH 1SLJA 4IJLA 4AIMA 4IFDG 4WJ3M 3HOVG 5JJKA 2E2IH 4BXXG 1VQBA 4DV7Q 4JI4L 4JI6L 1OXVA 4HJ9A 1HR0L 3K7UC 4IFDI 3CXCA 1VQPA 1WOCA 5FLXc 5GAGC 4DV0L 2WFWA 2JK8A 1IBKL 1N33L 2VW9A 1ASYA 4OX9Q 2ID0A 4P72A 2CCZA 1E3PA 3HKSA 5C0XJ 4LUZA 4LFBQ 1Y1VH 3LGJA 4JI8L 3TRZA 4JYAQ 2AWNA 3CW2C 4TQUS 4JI0L 2F52A 4OWTB 3DM3A 4B3SL 1PH2A 2EXDA 1FGUA 4A3GH 2AWOA 4OX9L 2NVQH 3L7ZC 3K8AA 2E8GA 4DR3Q 1CSPA 1M1KC 3RNUA 3ERSX 4PZ7A 3CCSA 1K83H 1VQ4A 4DUZQ 4QQBX 4KHZA 2K50A 3U4ZA 2PQAB 3AFPA 3ER0A 3UDGA 3PUWA 2AMCB 4R4TA 1VCIA 2PMZE 4BY7G 2Y0SG 4DR3L 1CSQA 3CCJA 4NXNQ 1A0IA 1HNXQ 4DUZL 4DV3Q 1W3SA 4KHPQ 1FJGQ 4YWLA 1JMCA 3BU2A 3CCUA 1E22A 5LMNQ 2ATWA 4B3RQ 5JJLA 3CC2A 4P75A 4LF4Q 4TVAB 2MFIA 1FL0A 4MNOA 1EIFA 3RLNA 1HNXL 4PZ8A 4PZ6A 1GO3E 2RHQB 1WFQA 4AYBG 4DK6C 4DV3L 1UWVA 1E24A 3GTKH 1EQQA 1XNQQ 4HIOA 2R92H 5LMNL 1UE5A 1H95A 3G4SA 2A19A 3KF6A 1DGSA 1S3OA 3RLFA 2AHOB 2VY3A 3K80C 2UU9Q 3HOWG 3ULPA 2R93G 3OYYA 1XNQL 4LFAQ 2XTIA 2RF4A 2N78A 3KLWA 4PG3A 1L0WA 3H0GH 2HIXA 1RIPA 1C9OA 3FHWA 1MJCA 1YVCA 5M3MG 3RN2A 1PH3A 1GVPA 2GVAA 3D0FA 5M5XH 2JA9A 1K8AC 5IP9H 1VQMA 3PO2G 1TXYA 3T1HL 1PH5A 4GOPB 4EX5A 4BBRG 5IYDH 1MKHA 1SRUA 3D31A 1VQAA 4X65Q 1PHJA 4QGUA 4A3FG 3M4PA 1N32L 4LNQA 1Q81C 2Z0SA 2WAQG 1EYGA 3TREA 4R4OA 4NPSA 4X65L 1EIYB 2B63G 4DV2Q 3CCMA 1KRSA 4LF6Q 1EUJA 2YYZA 3PUXA 3S24A 5GADC 1KQSA 2YU9H 4MZ9A 1XPUA 1I5FA 4J15A 1FVIA 2WP8J 1HNZL 3E0EA 1EFWA 2R6GA 3PF4A 4LF9Q 2UXCL 4DV2L 4A3EH 1AE3A 2Q2HA 4GN4B 1IL2A 1JE5A 2JA5G 4DV4Q 3TEHB 2UUBQ 4GS3A 2IX1A 1EQRA 2CKZB 4JBWA 4GOPC 4AQYQ 2JA8G 3EIVA 3HOVH 4BXXH 3KYHC 4NB3A 4A3JG 2VNUD 3KDFB 2YTYA 1X3GA 2QEXA 5GROA 4X64Q 4UPAA 3CC7A 4YHHQ 5LMUL 2YV5A 4UY8C 3K0XA 1VS0A 4P74A 2HHHQ 1BVSA 2Z6KC 4DV4L 1VQCA 2VS1A 4X66L 2UUBL 1QUQB 1CKNB 5AJ3L 3NELA 2WB1G 1PV4A 4DK3C 3DLLA 3AQQA 4OO1G 1VQEA 3TQYA 1GKHA 3OW2A 1Q7YC 4YHHL 3A74A 1XPOA 2HHHL 4OO1I 3EN2A 2NZHA 4HJ7A 2E2HH 3HOZG 2CQOA 1VQGA 2L15A 2UXBL 2ZJPA 4LFCQ 4GN3B 1K9MC 3CQZH 1Q1BA 4C3HH 1HJPA 4MTNA 1QVCA 1XPRA 2HQLA 4BY7H 4C2MH 4BBSG 4A3BG 3K81C 1HR0Q 1NJIC 4DR2Q 4LFCL 3GTPH 5IYCG 3J81i 4DV5Q 3JAMc 2IHEA 3OTOL 3F2DA 1XMOL 4A3MG 3BZKA 2OWOA 1N33Q 1QVFA 2AKWB 3A0JA 1PYSB 4POGA 3CCLA 3NBHB 5ELNA 4RMFA 3A5ZB 2DUDA 1W2BA 4DR2L 4JI8Q 4GOPA 4DV5L 3U58A 4JI0Q 2K4KA 4B3SQ 4GKKL 4DPGA 2KBNA 5FLMG 2ZTCA 3PUVA 2Z6KA 5J3BA 2GN5A 3M85A 4OWXB 1KRTA 4DV1Q 1VQNA 3HOWH 3I4NG 3GD7A 2R93H 3HOUG 1L1OB 2ZM6L 4OXPA 4IPCA 1KHIA 4DR1L 2LXKA 4GNXC 2F3IA 4JI2Q 3STBC 1WI5A 4BY1G 4O0AA 1Z47A 3SGIA 5M3MH 1TWGH 3L0OA 1HZBA 2BH8A 5C4JH 3CMAA 4DV1L 1NMGA 1X65A 4IO9A 2E5LL 1TWAH 4GLXA 1IZ6A 3S2DH 4O2DA 3PO2H 3KFUA 1S40A 4JI2L 2VUMG 4BBRH 1S72A 5IE8A 4BA1I 2UUCQ 4JI1L 1PFSA 1SN8A 3KDFA 3M4QA 3E9IA 4A3FH 1YJWA 3KJPA 5M3FG 3K7AH 4R1JA 3I2ZA 1QUQA 4IPDA 3PIPA 5LMNW 1VQKA 1XTDA 2UUCL 2B63H 4EQ5A 4LF5Q 3RZDH 3RR5A 1B7YB 2I5HA 2MO0A 3U50C 3ICEA 2B29A 3I56A 1IBML 3CPFA 1WCMG 4JG2A 2N3SA 2F4VQ 2JEAI 1VQOA 2QA4A 3GTOH 1Q1EA 3GDEA 4A3KG 4LF5L 4POFA 4AH6A 2ZTDA 3M3YH 3S17H 3S1NH 1KL9A 1SMXA 2BA1A 2KENA 3J80c 3T1HQ 1U5KA 3S1RH 4JBJA 1MJEA 2JA5H 2JA7G 4A3CG 2F4VL 5FJ8G 2JA8H 2ZJRA 4A3JH 4UP9A 4GNXA 5IT9c 3HOXG 4R4CA 1N32Q 1X54A 3GTMH 3A5UA 4JI3L 1VQFA 1QZGA 1Q12A 4A3DH 4ALPA 4A3IG 1Q46A 1JJCB 2ASBA 4LUOA 4YCUA 4PMWA 2IT1A 1RL2A 1NMFA 3HFZB 5JEAG 4B3MQ 1NY4A 2HT1A 3J7A5 4JCVE 1KD1C 1HNWL 1N36L 1HNZQ 3L2PA 2UXCQ 2K52A 3HOZH 2YTXA 2JE6I 3F2BA 2CWAA 1GM5A 1PH8A 5K36G 1N8RC 2HIVA 1TWHH 1X3EA 2PNHA 1QZHA 4IOAA 1N34L 4HJ8A 4B3ML 1P16A 4YWMA 1LM0A 2K5HA 3IRBA 4APVA 4BBSH 4FDBA 4GLVB 4A3BH 4GLAC 2KCTA 3CCEA 5IYCH 5LMUQ 1G6PA 4DUYQ 3UDXA 1E1OA 4A3MH 2PQAA 4X66Q 2IHFA 1CUKA 5AJ3Q 3RN5A 1BKBA 3M9BA 1JB7A 5GQOA 1BBUA 4L5SA 3M7NA 1CKMA 1VQ5A 4DUYL 4X62Q 2ZTEA 1VQIA 3JC66 2JJQA 1JJ2A 3S2HH 5C4XG 3GTGH 1JJGA 1YJ9A 5FLMH 1Z9FA 3GTLH 4A4IA 1MIUA 2UXBQ 4GKJQ 1JT8A 1HH2P 4P71A 3W5OA 2OQKA 2ZJQA 3FKIG 2VL6A 4X62L 2Q2TA 4JV5Q 1A63A 4LF7Q 4YY3Q 3I4NH 3PCOB 2KCMA 3HOUH 1UEBA 2QGQA 5ELOA 3S16H 4A93G 1IXRA 2OTJA 5C44G 4GKJL 2NZOA 4BY1H 1XJVA 3NEMA 3OTOQ 1PH6A 1XMOQ 3CCQA 4K0KQ 4HJ5A 4JV5L 3RZOH 4LF7L 4YY3L 4ME3A 2PI2A 4OONA 3CCVA 1TWCH 1B8AA 1Q82C 1YIJA 2YTVA 1LTLA 1OXSC 2VUMH 1VQ6A 2IY5B 4QJFA 1I6HH 1WJJA 4GKKQ 3CF5A 4K0KL 1HR0W 5GAHC 4L5QA 1I50H 3G71A 1V9PA 1SE8A 5M3FH 4BA2I 3ULLA 1IBMQ 1SR3A 2NVYH 3S1QH 2OQ0A 1YHQA 1C7YA 1YBYA 4YCWA 1A8VA 4DNIA 1G291 4UP8A 2K5VA
chains in the Genus database with same CATH superfamily
3JAMi 1D8LA 4JBMA 4Y7NH 4DR1Q 3MFGA 3VYSA 5CMDA 1PDQA 3T13A 1E0BA 2RDHA 3S1QB 3CC4A 4KKUA 4XQJA 3JAME 1HZCA 2UXDL 4XTCS 3M4YA 4KLKA 2NVXH 3NTKA 4GN5A 1WCMB 2RKSA 5L37A 1Q8KA 5C3EB 4JI5L 4DAMA 1HFNA 4TRDA 2JA7B 4IALA 3A55A 4MN3A 3MAQA 4KHVA 1ET9A 4L5RC 4R8NA 5EJWA 2ALYB 3PGZA 4C3JH 3HRZC 3CAMA 1YHAA 3BZCA 1OXTA 2K6AA 2Q8TA 4GZYC 2FXQA 3EBEA 2B2YA 2K03A 1L1OC 2A74C 1DONA 3VDYA 3E3XA 2JQOA 3C2PA 4DR5Q 2LS01 4XIGS 2E2JH 2OCEA 1WYDA 2LXJA 2B3GA 1I94Q 3UDIA 1K73C 3C1FA 4OIKA 5KNBA 2O5IC 3GTQB 2Y0SE 2EYMA 2F0GA 5CV4A 1AZQA 4B3RL 1HNWQ 2NTTA 1KABA 3VR6A 1A3VA 1RJTA 4DR7L 2B8GA 1BUVT 1SROA 1NSNS 4A3GG 1K3RA 2I07B 1V1QA 4A93H 3GTKB 2DNEA 3RMHA 4DAYB 4YCVA 2FJ2A 2Z9HA 5EKIA 2EYLA 2V1CC 3HP3A 1PA6A 5E4XA 3QO2A 1J5EQ 3J80L 1ENAA 1YNXA 3KOJA 4JPBW 4U673 2N8NA 4JOIC 3TP7A 1NE3A 2Q8RE 3ITPA 4P73A 5C4HA 3PV0A 4DGZA 4IFDJ 3E6ZX 3K5NA 4XT3B 5H1SE 5IYBH 3S15H 1ILQA 3E9HA 2WAQE 3BYYB 3PUZA 1PFBA 4DR4Q 4HJAA 3Q8DA 2KCNA 4A3LH 1H9KA 3OSOA 4LF9L 5HGQA 3I55A 3K58A 1H9RA 5ELFA 3PO3B 3AYHB 1FNWA 4LF8Q 2R7ZB 2PCFB 1TWFB 2F4IA 4DKAC 3CMEA 1DYQA 5ELBA 2NN6G 4A76A 5EAYA 2CHBD 2F3VA 2H5XA 3NQTA 3J81c 2NN6I 2A6EC 2A6ED 4DV6L 2XWJB 3KF8A 2WB1E 1PTOF 3R8BA 1EEID 3M4OH 3F8TA 4JI7L 1B9NA 1XMQL 4JI4Q 4DXGA 4B9XA 1Y1WH 4DXFA 5M5YB 3H3VC 1QJOA 4AIMA 1PZID 1G6ZA 3HOVG 4BXXG 2IJ0A 1OXVA 3CQZB 4L63B 1HR0L 2AQ1B 3CXCA 3NSWA 4DV0L 2JK8A 1T5XD 2VW9A 1ICWA 1SNOA 1WTXA 1E3PA 1S4ZA 1Y1VH 3LGJA 2AWNA 3CW2C 4JI0L 4OWTB 1FGUA 2AWOA 4OX9L 3K8AA 3BDCA 4DR3Q 1CSPA 3DM1A 4PZ7A 4DUZQ 4KHZA 2AQ3B 4PMCA 3A8JE 3TN2A 3UDGA 3PUWA 1BF4A 4BY7G 2HCCA 1GUGA 4K14A 2RA4A 3BU2A 3T4AC 1K83B 5LMNQ 5JJLA 4P75A 2MFIA 4MNOA 1HNXL 4PZ8A 4AYBG 1WFQA 1E24A 1JOQA 4C1NI 2R92H 4O42A 2A19A 1WTRA 3NE5B 3NWTA 2VY3A 3EROA 1SSOA 1B1ZA 4LFAQ 5J39A 4C56C 4NW2A 3RZDB 2B2VC 3D6CA 1MJCA 2IWHA 3NQIA 3D0FA 1PTOB 1K8AC 1K28A 3CRKC 4DA2A 4EX5A 4BBRG 1B3AA 2B2WA 2EYJA 2F0VA 1EY6A 2D9UA 1SXTA 3M4PA 2Z0SA 1UUPA 2EYHA 3BVGA 5CBEE 4A3JB 5M5XB 1RD9D 3PMFA 4NPSA 4M8AA 1AEXA 2XRQD 3EQLC 2Z4IA 1EY5A 2WB1B 5IGFA 5A2QE 4J15A 4LMQD 1FVIA 2UXCL 1EFWA 2R6GA 1EY8A 1AE3A 4GN4B 1JE5A 1I4RA 3TEHB 2EZVA 2QILA 4IFDH 3KBGA 3EIVA 1K0SA 4FO2A 4UPAA 1SNPA 3H09A 1BVSA 4DV4L 2UUBL 3NELA 4OO1G 3QOLA 1UEAB 3F2UA 3TZUA 4DNTB 5CC4A 4YHHL 3OMGA 4OO1I 2MHVA 5A35A 2L11A 3HOZG 4O1NA 2ZXOA 3IKJA 1R4PB 1EWCA 1XPRA 1QVCA 5G3LF 1S5DD 4BBSG 4A3BG 4DR2Q 4DV5Q 3J81i 2IHEA 2OWOA 3F2DA 1XMOL 4A3MG 2Z8LA 2AKWB 1LV9A 3A0JA 3A7LA 5KGUA 4POGA 1RODA 2AQ2B 5ELDA 4K5VA 1NNXA 3IAYA 1EQTA 1ENFA 3J81E 2VUMB 4CJ0B 2Z6KA 4E6IA 4OWXB 5CORA 3KBXA 1VQNA 3NUCA 3HOWH 5IOCA 3I4NG 2R93H 1ICFB 2ZM6L 3X3MA 1KHIA 3SVMA 4BS9A 2CQAA 1WI5A 4O0AA 1Z47A 3L0OA 4DV1L 1PXUA 3K5MA 2E5LL 2LKVA 5D3DA 1VF5C 1IZ6A 3S2DH 2FINB 5KNCA 3PO2H 1QILA 1S40A 4JI2L 1SN8A 4IUUA 5M3MB 1CT1D 4FNFA 3I2ZA 3NHHA 3PIPA 1JWSD 2UUCL 2B63H 3FPPA 1D5ZC 3HZXA 3RR5A 1U4MA 3ICEA 5CV7A 1IBML 2JEAI 1WCMG 3I73A 2N3SA 1GUOA 4A3FB 1VQOA 3S9WA 1IYUA 4POFA 4QB4A 3S1NH 2KVMA 1SMXA 5E3FA 4KY5A 3T1HQ 3S1RH 1U5KA 1G8ZD 3SHLA 2JA5H 2JA7G 4A3CG 5FJ8G 2JA8H 1O80A 4IQZA 1A15A 2JN4A 4HAEA 1XYIA 3S17B 2E2JB 1TS2A 1EY7A 5FO9B 2ASBA 4LUOA 4PMWA 3QR8A 3BDLA 1EQVA 5JEAG 1NY4A 1KD1C 1HNZQ 3U9SA 4MTKA 4XYQA 3LX0A 2CWAA 4UDUC 2F0NA 2HIVA 1TWHH 3TSSA 1QWYA 2XRSD 3Q6SA 4EGVA 4IOAA 4RCNA 1N34L 1J8IA 4APVA 2K5HA 4ABNA 1PTOC 1PTOD 4RHSA 1FNVA 4FF1A 4QCLA 5JPMC 1SMYC 1SMYD 1C48A 4WFN3 5AJ3Q 1IW7C 2WINB 1BBUA 2RDFA 4L5SA 3M7NA 2KQ3A 3OOCA 1JORA 4DUYL 2ZTEA 1S5ED 1S5BD 3JC66 1F9QA 4HR7B 1HTPA 2OQKA 2F0IA 4YY3Q 1LLRD 3PIP3 2EOTA 2KCMA 1AFPA 2QGQA 2OTJA 5C44G 4V190 1BOSA 2BE5C 2BE5D 2GA4B 2NZOA 3S2HB 4IUQA 1XJVA 3NEMA 1VDZA 3S15B 4HJ5A 2PQEA 1B9MA 5I6WA 2PMZB 4BWGB 1W6KA 3K5LA 4CGYB 1VQ6A 1XTCD 1TU2B 3CF5A 4K0KL 4I7ZC 1HHVA 5I9OA 1KAAA 2K01A 4KD3A 5FK9C 2NVYH 1YHQA 3FRPB 2SEBD 4YCWA 2OT2A 1P8LA 3OW7A 1TY2A 2UXDQ 4QL5A 1I50B 1YNJC 1YNJD 4ZK9B 2MO1A 3PO3G 2X6LA 4A3KH 4KI0A 1I6VC 4XQQA 2R7ZG 1XNRL 5DLQE 1SFOH 1H9JA 4Q5VA 1PFMA 4N9PA 4JI1Q 5JAVA 4FF2A 2SNMA 3H6MA 2XNAC 4FXKC 2L0CA 4LWCA 3MXPA 4Q0FA 1K0RA 1Y1WB 3D6WA 2VQFL 4HIDA 1UE6A 5GAEC 4A3IH 1I3QB 3UDFA 5IGGA 4ME5A 3J7ZC 4CDDC 3ZJYC 2DNCA 1NBWA 3MA2B 1KAWA 1Q86C 1PYBA 5FLXL 3HOXB 1CKNA 1SEBD 3KJOA 2RCNA 2WIIB 4JYAL 1STEA 1M90C 4NXML 1CQFA 1EY9A 1T5EA 4JBKA 2CWPA 5IWAL 5C5MA 5LL6S 2DY7A 4JI3Q 4ZUJA 1I4XA 4DK1A 3A56A 4NXNL 5DM63 1E1TA 4L5TA 2F0EA 4DR7Q 1AH9A 3ULJA 1KXLA 1L2FA 1I4GA 1G51A 3I70A 3S14H 4KHPL 5C4XH 1FJGL 1PH9A 2UUAL 1HZ9A 4PNYA 1N36Q 3NBHA 1WTWA 1KC8C 1PH1A 2B2TC 3AFQA 1GD7A 4KMUC 1N9WA 1X3QA 2K14A 3PQIA 1OXUA 3AEVA 2QDLA 2OTLA 1QCBD 1X56A 1JC7A 1IHZA 2R92B 1STYA 5C0XG 2UU9L 5HGTA 2A5HA 2I5LX 2C5CA 5C0XI 2DY8A 3DEOA 1YI2A 1HFGA 2MP1A 4DAPA 4R4QA 5E7NA 3N6RA 2L55A 1B50A 1Z6HA 2NWGA 1KDCA 5CR3A 4X6AH 4FXGC 3MVVA 1A2UA 1E2WA 2RCFA 5DEHA 1HQMC 4RWSC 1UE1A 5AFWA 3H15A 2PI2E 2GVBA 1LTGD 2A68D 2R7DA 3S1MH 5EPKA 1OO9B 4LF6L 1BO0A 3V96A 1F9RA 4CKBA 1GOZA 5HY6A 1V43A 3K57A 1V1PB 5C3WA 4B9WA 2CFMA 2Z6BA 1CA6A 1BXTA 4OIJA 3TS2A 4XDXA 1R4QB 2WACA 3PUYA 4DV6Q 2IW3A 3T1YL 4LW1A 2EQSA 2A8VA 4A75A 1U0LA 3NENA 3NP8A 4JI7Q 1K8GA 2D0OA 3HKZG 1XMQQ 4C3IB 4IUVA 3LNNA 2NVTH 1FR3A 2F0OA 4DN4M 1PRTF 2G9DA 4DU9A 2JA6B 3WWVA 4GNXB 1H9SB 2LSSA 3I4MB 4A3EG 1ENCA 2KEEA 4DV0Q 1O7YA 1SJHD 1R9TH 2VXWA 2PO4A 3E5SA 3SK6A 1JWMD 1VQBA 4DV7Q 4N8X1 3K7UC 4S3SA 4KN4C 1WOCA 5JJZA 4OL7A 4PV1C 5GAGC 2WFWA 5BN5A 1IBKL 1N33L 3CKIB 3TP8A 4OX9Q 4HMJA 2ID0A 4P72A 2CCZA 4LUZA 4LFBQ 4JI8L 3TRZA 3DM3A 4B3SL 1PH2A 2EXDA 4RGOS 4A3GH 2NVQH 3BYTB 3ERSX 3CCSA 4H13C 1VQ4A 1CZWA 3I91A 3T16A 1V1OA 4K5XA 3U4ZA 5E4WC 5ELEA 4C3HG 2BCOA 4LAAA 1A3UA 3TDQA 5FLXE 2RDGA 1HNXQ 5I2YA 4HTHA 3BZDB 2N88A 3V05A 2ATWA 1QOHA 4LF4Q 2XVSA 1CA5A 1GO3E 4DK6C 4DV3L 1UAPA 1TR5A 4HIOA 3G4SA 3NXWA 1S3OA 1L0YB 1K8MA 3K80C 3ULPA 1ZKOA 2XTIA 1L0WA 2B63B 2HIXA 5M3MG 3FHWA 3EFXD 5K5PA 2NUCA 3RN2A 1WD0A 1PH3A 2GVAA 2JA9A 2EYPA 3H94A 5CGKA 1DOLA 2OXPA 1SRUA 1STAA 1VQAA 4ZKBB 5EPLA 5D3IB 5TSSA 3H0GB 3SK5A 4A3FG 4EQOA 1Q81C 2EPBA 5IGBA 5IT9L 2NN6H 2LMCB 4X65L 1EIYB 2HUGA 4ZAIA 1SE2A 3PUXA 5E1FA 5KYLA 2YU9H 5COYA 1I5FA 2WP8J 1QG7A 3M7GA 2KUMA 2KOLA 2Q2HA 1F2LA 4XYOA 4DV4Q 2UUBQ 4GS3A 3TZDA 1EQRA 1XWEA 4JBWA 4P2CB 4GOPC 4AQYQ 3HOVH 4F88A 4BXXH 4N8FA 3KDFB 2QEXA 5BN3A 4X64Q 3CC7A 4YHHQ 2DN8A 1GUSA 4X66L 3AQQA 3TQYA 3OW2A 1XPOA 2J4XA 3MFYA 4K5WA 2NZHA 2CQOA 2L15A 2UXBL 2ZJPA 1MBYA 4ZQ3A 1STBA 5M9OA 2ICIA 3IL8A 2HCIA 2HQLA 4BY7H 3U9OA 1SJED 4LFCL 5IYCG 1F2YA 1QVFA 3BZKA 2E2HB 4RH6A 1F9SA 1WVLA 1QNUA 3CCLA 2DUDA 2F0TA 3MC0B 5IGDA 1W2BA 3R2TA 1HTLD 3P1HA 2K4KA 2Y0SB 2B2UC 4GKKL 3BS1A 1AN8A 2KBNA 2A6HC 2A6HD 1LTSD 2ZTCA 5EQ0A 1BQQT 2GN5A 3P20A 1RHPA 4DV1Q 1D1KA 3SE0A 3HOUG 4IPCA 4DR1L 2LXKA 4GNXC 4JI2Q 3STBC 2C9OA 2BH8A 1NMGA 1X65A 4FP5D 5EBDA 1SE4A 1TWAH 4WORA 4KY6A 1PFNA 1FD7D 3KFUA 4BBRH 4MIUA 1M8AA 5C6AA 4BA1I 5IE8A 2UUCQ 1STNA 5IGCA 1HRJA 3M4QA 4J1MA 1YJWA 3AU7A 3KJPA 1TWGB 1CZGA 1DCZA 5LMNW 1XTDA 2SDFA 1EEFD 2R3ZA 5KIXA 5I6YA 3HS0C 1EY4A 2JSOA 2WAQB 3K7AB 4LF5L 1BCPF 3RUZA 3M3YH 1S5CD 3MXNA 2KENA 2HDMA 3CRLC 3HGBA 2G9HD 2XSCA 2F0KA 3HOXG 4R4CA 3J7YW 1KDBA 3GTOB 1N32Q 5EKLA 2MPMA 1MSGA 4A3DH 1DOKA 1B3QA 1EYAA 5CV5A 5KRUA 1LTBD 1RL2A 3HFZB 3J7A5 1LTRD 4JCVE 1HNWL 1F9PA 3HOZH 3GTMB 2YTXA 2JE6I 2Z1CA 3F2BA 5C4XB 4QUFA 3J80E 2M2LA 5K36G 2G5DA 3FDTA 1KLUD 4B3ML 3FEWX 2RQXA 3SEBA 4BBSH 4A3BH 2PW5A 2KCTA 1JR0D 5LMUQ 1G6PA 4DUYQ 5C4ZA 4ZCKA 4A3MH 2PQAA 1S5FD 1CUKA 1JQYD 1PRTC 1PRTD 2E75C 2PZUA 1JB7A 2JJQA 1B53A 3GTLH 4IUTA 4A4IA 1JT8A 1HH2P 3W5OA 2ZJQA 3FKIG 2VL6A 1GXDC 4X62L 2Q2TA 3VA7A 2A73B 3I4NH 3K59A 4RGNA 1TY0A 1SYBA 3S16H 4GKJL 1EY0A 3GTGB 1YNNC 1YNND 3OTOQ 1PH6A 3I72A 1CTMA 3CCQA 4K0KQ 3RZOH 4LF7L 2D5DA 5CBAE 1TWCH 2L4NA 1B8AA 2E2DC 4RHRA 1OXSC 2IY5B 3S1MB 1BCPB 1I6HH 3IFTA 2M9VA 1G91A 3G71A 2MGSA 3MZ5A 4BY1B 4M1UB 3S1QH 2OQ0A 3DXJC 4K8IA 1A8VA 4XT1B 1G291 4JVZA 1STGA 2K5VA 2B2YC 2MQHA 4UAIA 3VYRA 2MNAA 2JXMB 4OEMB 1XNRQ 1Q3LA 1AE2A 2WKCA 1WCMH 2Q2UA 2D62A 1QVGA 5M3FB 3HOYG 2EJGC 3H3VI 2F1MA 2FMCA 5IP7G 1YEZA 4QMGA 1SNDA 4IPGA 3OWEB 1CKOA 2KHIA 4R8IA 2JA7H 4A3CH 5LHY1 2VQFQ 3J81j 5FJ8H 3PF5A 2HDLA 3OIQA 4PMBA 1J6QA 1EIGA 2K75A 1YHBA 3GQBA 4Y7NB 2M00A 2DGYA 5IGEA 5C5LA 4RG1A 4C3IG 1LUZA 4LUVA 1OXXK 3B6YA 3GV3A 2X69A 1NR4A 1HZAA 2D0PA 1VQ8A 5JVH3 2JA6G 2NVXB 2N49A 4NXMQ 3I4MG 3PIOA 1UE7A 3N52A 2NYZD 1OTCA 4ZKCB 4R4IA 4QIWE 3UE0A 2NTSA 5IWAQ 4WRDA 3C3LA 4HEDA 4IUPA 2R7FA 3GTQH 1D5XC 3CCRA 5C3EG 3ND9A 4C3JB 1E2ZA 2O2LD 3Q23A 3TS0A 2NVQB 2H4OA 2UUAQ 4B3TL 1YITA 4RGTA 1B70B 4ZYSA 1PZJD 4RKLA 3CP0A 4HIMA 5M5WH 1U4PA 5F2DA 3TP6A 2A69C 4G7HC 2E74C 4FVMA 3GTJH 3GO5A 4CJ1B 4QY7A 3BJUA 1KNEA 2EDGA 2KHSA 2VQEL 2F0SA 3W1GA 2MUYA 2I0QA 4AYBE 3ND8A 4F87A 2A1AA 5C44H 2DJGC 4X3SA 3QWNA 2DJFC 3RLOA 4LFAL 3UE1A 1L1OA 4NDXA 4JW0A 3I90A 1HUNA 1D6EC 2ES2A 4A93B 1HXYD 1V8QA 4J8QA 1HCZA 1IW7D 4H02A 5IIFA 5KNDA 1VQ7A 3TBIB 4OWWB 4KKTA 4EQNA 2EVBA 3O13A 1D1IA 1DXMA 1QE6A 3PO3H 1AP0A 4TSSA 1PH4A 3PIO3 1VQJA 1D7QA 2R7ZH 1W6JA 1TWFH 3H0GG 2Q8IB 3CPWA 3D3RA 5I4DA 3U4VA 1TT2A 3MTSA 2HQEA 5LL6X 2JYOA 3V2TA 3T1YQ 1GJXA 4DR6L 5IP9G 5BR8L 5IYDG 2JEBI 4JC0A 5D65A 3HOVB 5DNFA 1X32A 5ELCA 2F0FA 3KF6B 1Y14B 3QB3A 3R93A 5M5YH 4JOIA 4UP7A 4QIWB 2C35B 2PW7A 1O7LA 2IX0A 1Y8PB 1IBLL 5JJIA 2EIFA 1T9HA 2E76C 1KIXA 3OHXC 1JCKB 3K0YA 2FFKB 3G6JB 2O5JC 1IBKQ 4JI5Q 1SLJA 4IJLA 4WJ3M 2ZXPA 5JJKA 2E2IH 1BCPC 1BCPD 3M4OB 2K32A 4XXEA 4HJ9A 4JI6L 4DK0A 5FLXc 1DJRD 1ASYA 1RDPD 3JAML 1HPCA 4KD4A 5J22A 5I9PA 3R3OA 2KJXA 4TQUS 1Y69U 1EL0A 1FNUA 2K05A 1MD2D 4X3TA 2E8GA 3QIAA 1M1KC 4F8MA 3RNUA 1K83H 5FO8B 5JVG3 5C0XH 4NMZA 3AFPA 1Y1VB 2CH4W 3ER0A 2AMCB 1FGBD 1ET6A 1LTTD 2EE1A 2Y0SG 2B2WC 5T1IA 1A0IA 4KK7A 4DV3Q 3MWYW 1IL8A 4YWLA 1B4OA 1JMCA 3QG1A 1E22A 4WJWA 1F2ZA 4B3RQ 1CHPD 3VYUA 3CC2A 4TVAB 1EIFA 1TWAB 4PZ6A 2RHQB 1JICA 1UWVA 4BBRB 1UE5A 1H95A 2F0QA 3P75A 3DHQA 4ULLA 1DGSA 1QNKA 3D8GA 1XNQL 3KUPA 2F0MA 1UNSA 1GVPA 2KCCA 2RBMA 5M5XH 2L1BA 1H9SA 1QB5D 3RD4A 1G2SA 3CHBD 4HSPA 1VQMA 1TXYA 3T1HL 4KY7A 5I2XA 3M3YB 4GOPB 4RCOA 2SNSA 1MKHA 1FYCA 3D31A 4X65Q 1PHJA 1SDFA 1U4LA 5C3XA 2CVRA 2FMMA 2WAQG 1EYGA 2CW0C 2CW0D 2OEOA 3TREA 1LACA 1NR2A 2B39A 3W2DA 4A3DB 1KRSA 2YYZA 3S24A 1KQSA 2TMPA 1XPUA 4L8JA 4CDEC 1D5MC 1HNZL 3E0EA 4X3UA 4LF9Q 4DV2L 4A3EH 3HOZB 4NKLA 5EKKA 2CKZB 3OIPA 3KYHC 4A3JG 2VNUD 3TMEA 2B2VA 2YV5A 4UY8C 2Z6KC 2VS1A 1QUQB 1CKNB 5AJ3L 2WB1G 1PV4A 4K6DA 2XWBB 1Q7YC 1GKHA 2EYOA 1D2BA 2HHHL 1WTPA 2R61A 4FF3A 2F03A 4HJ7A 1BR9A 1VQGA 4LFCQ 3DUZA 3A8IE 1H9MA 1K9MC 2EY5A 4C3HH 1CHQD 4C2MH 3K81C 1HR0Q 3C1EA 1WTOA 3GTPH 3I4NB 4DAYA 2B8FA 3QJYA 3GP7A 3NBHB 1LABA 4RMFA 1X3PA 3D4DA 3EJIA 3A7AB 3U58A 3G7LA 4JI0Q 2K5DA 3AB9A 5FLMG 3EVQA 3PUVA 1I6HB 2VB2X 3HEJA 3GD7A 4K2LA 4OXPA 4OGQC 3LWUA 4BY1G 5M3MH 5C4JH 4ALPA 4GLXA 4O2DA 3HOWB 3I8ZA 2VUMG 1S72A 2R93B 1B2TA 4JI1L 3KDFA 2NBFA 4A3FH 1Z7TA 5M3FG 4R1JA 4G7ZC 3J7AF 3S2DB 3KLRA 4LF5Q 3PO2B 4I65A 3FPUB 2I5HA 1SE3A 5CYUA 4JG2A 2SOBA 1Q1EA 2TSSA 3GDEA 2F0UA 4AH6A 3S17H 3J80c 4FYDA 4JBJA 1MJEA 4I7AA 2F4VL 3Q24A 4FF4A 5IT9c 1X54A 3MXGA 4DF7A 1QZGA 4JI3L 1PRTB 1Q90A 1Q12A 2NB0A 3C46A 3S1NB 1Q46A 3L3OC 4ZUIA 1JJCB 2JA5B 3S1RB 2JA8B 4C3JG 3A54A 2K28A 4ZRZA 1AW7A 4B3MQ 5M5WB 1N36L 2QDBA 4FXDA 2UXCQ 1GM5A 1SYEA 1PH8A 2K1BA 1N8RC 3GTJB 4HCEA 2K5QA 4HJ8A 1P16A 1LM0A 2RSOA 4B08A 2KA7A 1LT4D 1Q8IA 4FDBA 4GLVB 4GLAC 3CCEA 2LFNA 5IYCH 3VR2A 1KDAA 3UDXA 1E1OA 5C44B 2IHFA 3T53B 5A2QL 3M9BA 1TWHB 3T56B 1G2TA 3OWFA 2F0WA 4U68A 1K8OA 4HN7A 3LWEA 1VQIA 4X62Q 1ZYRC 1ZYRD 2XN9C 1JJ2A 3S2HH 1YJ9A 4K2KA 1MIUA 4GKJQ 1EOTA 4P71A 3SK4A 4LF7Q 3HOUH 1K3BC 1UEBA 5ELOA 4A93G 3OMCA 4CDCC 4RGMA 1ILPA 3AMUA 1XMOQ 2QW7A 5KYIA 4JV5L 2PYKA 4IN3A 3CCVA 1LT3D 3W3AA 2YTVA 4XQNA 1WJJA 2BDNA 2QCPX 4NP5A 1I50H 1V9PA 1SE8A 3SR1A 4QUCA 4BA2I 3ULLA 4ILWA 4X3KA 2BOSA 1C7YA 2K33A 4DNIA 4UP8A 3A8KE 4YIJA 2EJMA 1X9NA 1NCVA 3H91A 3I4OA 2ZM6Q 5IYBG 2RHSB 3VR5A 1PH7A 1EU3A 1EZ8A 2NVYB 3WOFA 3DMUA 2E5LQ 3HKZE 1I3QH 3SXHA 3J81L 4A3LG 1I4PA 1X6OA 3STBD 4IJHA 5CV6A 5JEAJ 2BH2A 3BDOA 2F0PA 1SYDA 4IPHA 3HOXH 2PZWA 1TIID 1J9OA 4A3KB 1DM0B 2K04A 1TVXA 4WJ4A 5IODA 2KECA 4DV7L 1CQVA 3TP5A 1SFOB 5NUCA 2E2IB 1II3A 1IBMQ 4QF4A 1ESFA 1BDOA 2X6GA 1E7ZA 4K8JA 2BA0A 3G6EA 4LFBL 5K36H 4G4KA 4A3IB 1PVOA 3F2CA 4B3TQ 3P7JA 2QEJC 4RKBA 1F77A 1TS3A 2I46A 1Y1WG 1VQHA 2Q2IA 3PSIA 1EFID 1Y8NB 1NTGA 4KN7C 1RTNA 4RFBA 3BVZA 2O4XA 1C8CA 1SYCA 4DR5L 1VQDA 1VMCA 1HUMA 4N9TA 2WKDA 2VQEQ 4IOCA 1LT5D 3J80i 3ZYYX 1I94L 1VQ9A 2RSNA 3F1ZA 1SNCA 4LF4L 1PYWD 5JPNC 1Y1VG 2I5MX 4OO1H 3KF8B 1YJNA 1U4RA 3FKIH 5FO7B 1C0AA 1O78A 4CJ2C 2CH4A 1N34Q 2L5TA 2VB3X 1DD2A 2K5WA 3S14B 3ERQA 5IY0A 5BN4A 1ASZA 5IT9E 2AUKA 3CU7A 1YZ6A 1L0XB 3BG3A 1BBWA 2K5NA 3Q22A 4OHJA 1EOVA 1IYJB 1X55A 4ID6A 5D14A 1KNAA 3ONAB 1J5EL 2MJ8A 1TS4A 1LTID 3VYTA 3NPPA 1EWIA 2R92G 1LYLA 3I7FA 2XGTA 3E0JA 3K6OA 2PZTA 3H3VH 2VZAA 3QOJA 3HOYH 2IPKD 2KHJA 5IP7H 4DR6Q 2B2TA 3HKZB 5BR8Q 2ENBA 2PNRC 4DNRB 3KLSX 3K5OA 3W1BA 3MEFA 1O7IA 1DZ1A 4DR4L 1JOOA 2J0TD 5T1GA 1SAPA 3WDNA 4C3IH 4YWKA 3FVQA 4A3EB 4A3DG 1A2TA 4AQYL 1EYDA 3MXUA 4HMIA 4X64L 1ONLA 2JA6H 1VQLA 3URYA 1X3FA 5ISRA 3FP9A 1IBLQ 3I4MH 4IUNA 4F7XA 4Y52H 4LF8L 3R2IA 5JOBA 1A62A 1B44D 3MXNB 2OF1A 1EWHA 1A3TA 1F2MA 5C3EH 3CD6A 2NZ1D 2L9HA 4JI6Q 1WTVA 4HIKA 4HSVA 3G48A 1TKWB 4G57A 1JE4A 4IFDG 2NVTB 4JI4L 2EJFC 4IFDI 3D4RA 4C3HB 4C2MB 4LJZC 4KV6A 3GTPB 2XIWA 3L9AX 3HKSA 2AUJD 4C1NK 5C0XJ 1SYFA 1R9TB 4JYAQ 1PZKD 4IURA 2F52A 4HCSA 4J6HA 4Z9CB 1XX8A 5JEAH 3L7ZC 4OELB 1EYCA 2IL8A 1SNQA 4QQBX 2K50A 2PQAB 1TQOA 4R4TA 1VCIA 2PMZE 1ESRA 4DR3L 1CSQA 3CCJA 4NXNQ 5EPJA 1MI2A 4A3GB 2KEDA 4DUZL 1W3SA 2F3WA 4KHPQ 1FJGQ 1CI3M 3CCUA 4KKSA 5C4JB 5FOBB 1MSHA 1SBBB 1AZPA 1FL0A 4H44C 3RLNA 1CK1A 1NUCA 3VR4A 3GTKH 1EQQA 3I4LA 3VA5A 1XNQQ 1WTHA 5LMNL 2A69D 3J7AV 3GV6A 1CM9A 1ZXTA 3KF6A 3RLFA 2F0HA 3D4WA 2AHOB 2FHTA 1I4HA 2UU9Q 3HOWG 2R93G 3OYYA 5CV9A 1TS5A 2RF4A 1EZ6A 2N78A 3KLWA 2BDOA 4PG3A 3UI2A 3H0GH 1RIPA 2N55A 1C9OA 1YVCA 1U9RA 1M4VA 3DEPA 1LT6D 5IP9H 3PO2G 2EY6A 1PH5A 5IYDH 1MGSA 4QGUA 1N32L 4LNQA 1EIHA 3IFDA 4R4OA 2B63G 1I4QA 4DV2Q 3CCMA 4MHEA 2WV6D 4H0LC 4LF6Q 1EUJA 5GADC 1BBXC 4MZ9A 1ZEQX 1A6XA 1JOKA 3PF4A 4LK1C 1STHA 2Z4HA 1IL2A 3BVMA 2JA5G 4K6LA 2IX1A 1SNMA 1XXGA 2JA8G 1JWUD 4NB3A 2YTYA 1X3GA 2YU9B 5GROA 5LMUL 1WTQA 3K0XA 1VS0A 4P74A 5KEEA 2HHHQ 1VQCA 1VF7A 3VR3A 4DK3C 3DLLA 3KK7A 1VQEA 1NAPA 3A74A 1CFMA 3EN2A 2E2HH 1RTOA 1Y8OB 2EYFA 4G7OC 5DAUA 3SDZA 4GN3B 2ICEC 3CQZH 1Q1BA 1HJPA 4KJOA 4MTNA 1GUWA 1LTAD 1RKNA 4RAUC 4KJNA 4CBVA 1NJIC 2F0JA 3HOUB 3JAMc 3OTOL 1N33Q 2EY2A 1O7ZA 1PYSB 2K7VA 3Q0AA 5ELNA 3FMCA 3A5ZB 2V4DA 4DR2L 4JI8Q 4GOPA 4DV5L 1IYVA 4BY7B 4B3SQ 4DPGA 3MHBA 4JK1C 5J3BA 3DWAA 2EXZA 3M85A 1BNZA 1GUTA 1KRTA 2J7ZA 3NK9A 5HURA 1L1OB 4TKOB 4AYBB 2F3IA 2HT1A 3SGIA 1VQPA 1TWGH 3CMAA 1HZBA 3I3CA 2IX3A 4IO9A 1HA5A 1KLGD 4UHVA 1PFSA 1V1PA 3E9IA 4CHTB 3K7AH 1GUNA 4DAVA 1QUQA 4IPDA 1RCVD 1VQKA 5EGTA 5EBCA 3DWPA 4EQ5A 1C4QA 3RZDH 1GHKA 1WD1A 4V0BA 1B7YB 2B2UA 2MO0A 3U50C 2B29A 1PTOH 3I56A 1RF2D 2F0LA 3CPFA 2F4VQ 3GTOH 2QA4A 4A3KG 2QKIC 2ZTDA 4EVOA 1KL9A 2BA1A 3OPOA 4H7BA 2ZJRA 3T51B 4A3JH 4UP9A 4GNXA 4EQPA 1JB3A 3GTMH 1PMRA 3A5UA 1VQFA 3MEHA 4A3IG 4L6TB 2QF7A 5FKAC 2ZT9C 1HA6A 1HQRD 3HG9A 4YCUA 3X3NA 2IT1A 3SK8A 5DM73 1NMFA 4RA8A 2D2CC 4CKEA 3L2PA 2K52A 3NTIA 1QZHA 1X3EA 2PNHA 4KTAA 2ZXRA 1LO5D 2EY1A 1IKMA 4YWMA 3EA6A 3IRBA 1ML0D 1SYGA 3FKIB 5J1ZA 4DFAA 2LY7A 3NTHA 4X66Q 1VMPA 1E2VA 2RVLA 5G3LD 4CKCA 1BKBA 3RN5A 4IZ8A 5GQOA 3NBIA 3WOEA 1CKMA 1DOMA 1VQ5A 2H1EA 2HD3A 4BBSB 5C4XG 1PLFA 3GTGH 4A3BB 1JJGA 1IKLA 1Z9FA 5FLMH 3DWQA 2PPBC 4A3MB 2UXBQ 2F0DA 4R9WA 4JV5Q 1A63A 2JP1A 2A68C 3PCOB 1EU4A 1KTKA 1IXRA 4BY1H 3GTLB 4YY3L 4ME3A 2PI2A 4ODGA 4OONA 1MHWC 3HOYB 1Q82C 1YIJA 3KLSA 1LTLA 2VUMH 3NWSA 4ZLTF 4QJFA 3S16B 5CV8A 4GKKQ 1HR0W 5GAHC 4L5QA 4CDFC 5M3FH 1GHJA 1SR3A 4PQXA 1YBYA 2L12A 3RZOB 2P5ZX 1TWCB
chains in the Genus database with same CATH topology
3JAMi 2MQHA 3I4OA 2MNAA 1D8LA 2ZM6Q 5IYBG 1XNRQ 4JBMA 1P8LA 4Y7NH 4DR1Q 2UXDQ 1AE2A 4QL5A 1WCMH 2Q2UA 2RHSB 2MO1A 2D62A 1QVGA 1PH7A 3PO3G 4A3KH 3HOYG 4KI0A 3H3VI 2E5LQ 5IP7G 3CC4A 1YEZA 3HKZE 4IPGA 2R7ZG 1I3QH 1CKOA 2KHIA 1XNRL 2JA7H 4A3LG 4A3CH 1HZCA 2VQFQ 5DLQE 4XTCS 1X6OA 3J81j 1SFOH 2UXDL 4KLKA 3STBD 5FJ8H 3PF5A 2NVXH 4JI1Q 1J6QA 4IJHA 4GN5A 2K75A 1YHBA 5JEAJ 2BH2A 2DGYA 4IPHA 3HOXH 4LWCA 1Q8KA 4RG1A 1K0RA 4JI5L 4DAMA 1LUZA 2VQFL 4HIDA 1UE6A 4LUVA 1OXXK 3B6YA 5GAEC 4A3IH 4WJ4A 3UDFA 4DV7L 1HZAA 2D0PA 1VQ8A 3J7ZC 2JA6G 4L5RC 3ZJYC 2N49A 2ALYB 3PGZA 4C3JH 1NBWA 4NXMQ 3I4MG 3PIOA 1KAWA 1Q86C 1PYBA 1UE7A 3CAMA 1YHAA 1CKNA 1OXTA 3BZCA 1OTCA 4R4IA 1E7ZA 4QIWE 2BA0A 2RCNA 3UE0A 3KJOA 2FXQA 3EBEA 3G6EA 4LFBL 5IWAQ 4JYAL 1L1OC 1M90C 1PVOA 2R7FA 3F2CA 3VDYA 4B3TQ 4NXML 3GTQH 3CCRA 5C3EG 1Y1WG 2JQOA 1VQHA 4JBKA 2Q2IA 2CWPA 4DR5Q 3PSIA 5IWAL 3TS0A 4XIGS 2E2JH 1NTGA 2OCEA 1WYDA 4JI3Q 2LXJA 4B3TL 2B3GA 2UUAQ 1YITA 1I94Q 3UDIA 1K73C 1B70B 4NXNL 1E1TA 4L5TA 4DR7Q 1AH9A 3CP0A 3ULJA 4DR5L 1L2FA 4HIMA 1VQDA 2Y0SE 5M5WH 1KXLA 3S14H 1G51A 4KHPL 5C4XH 2VQEQ 1FJGL 4IOCA 1PH9A 2UUAL 3J80i 1HZ9A 1I94L 1VQ9A 4B3RL 1HNWQ 1N36Q 3F1ZA 4LF4L 1KC8C 1Y1VG 3GTJH 3GO5A 2I5MX 4DR7L 3KF8B 1YJNA 4QY7A 1SROA 3BJUA 1PH1A 3FKIH 3AFQA 1C0AA 1GD7A 1N34Q 1N9WA 2VQEL 4A3GG 1K3RA 3W1GA 2K14A 1OXUA 2I0QA 4AYBE 3AEVA 1V1QA 4A93H 2OTLA 2A1AA 5C44H 4DAYB 1X56A 4YCVA 5IY0A 1ASZA 5C0XG 2UU9L 2I5LX 3RLOA 2V1CC 4LFAL 3UE1A 5C0XI 1L1OA 1YZ6A 1PA6A 1BBWA 2K5NA 1YI2A 1EOVA 2ES2A 1J5EQ 1IYJB 1X55A 1YNXA 3KOJA 4H02A 2N8NA 4JOIC 4R4QA 5E7NA 1NE3A 4P73A 1J5EL 3PV0A 1VQ7A 4IFDJ 4OWWB 1EWIA 2R92G 1LYLA 5H1SE 5IYBH 4X6AH 3I7FA 3S15H 2XGTA 3E9HA 3H3VH 2WAQE 2VZAA 3PO3H 3HOYH 1UE1A 3H15A 1PH4A 2PI2E 1VQJA 2GVBA 2KHJA 3PUZA 5IP7H 2R7DA 4HJAA 3Q8DA 3S1MH 4DR4Q 4LF6L 2R7ZH 4DR6Q 1D7QA 5BR8Q 1TWFH 4A3LH 3H0GG 3CPWA 5HY6A 1V43A 3U4VA 3W1BA 3MEFA 1O7IA 5HGQA 3I55A 4LF9L 3T1YQ 4DR4L 4DR6L 5IP9G 4C3IH 4YWKA 2CFMA 5BR8L 3AYHB 5IYDG 2JEBI 4JC0A 4A3DG 4AQYL 4LF8Q 3TS2A 4DKAC 3PUYA 4DV6Q 4X64L 3CMEA 3T1YL 4LW1A 2EQSA 2A8VA 2JA6H 1VQLA 4A75A 1U0LA 3NENA 1X3FA 3KF6B 1Y14B 3FP9A 1IBLQ 4JI7Q 1K8GA 2D0OA 2NN6G 5M5YH 3I4MH 4A76A 4Y52H 3HKZG 1XMQQ 5EAYA 4JOIA 4LF8L 1A62A 2H5XA 3J81c 4UP7A 2NN6I 4DV6L 2C35B 2WB1E 3MXNB 2NVTH 2IX0A 3M4OH 3F8TA 1IBLL 4JI7L 5JJIA 2EIFA 1T9HA 1X9NA 5C3EH 3WWVA 1XMQL 4JI4Q 3CD6A 4GNXB 1Y1WH 4JI6Q 2LSSA 1KIXA 4A3EG 4HIKA 3G48A 4DV0Q 1IBKQ 4JI5Q 1R9TH 1SLJA 4IJLA 4AIMA 4IFDG 4WJ3M 3HOVG 5JJKA 2E2IH 4BXXG 1VQBA 4DV7Q 4JI4L 4JI6L 1OXVA 4HJ9A 1HR0L 3K7UC 4IFDI 3CXCA 1VQPA 1WOCA 5FLXc 5GAGC 4DV0L 2WFWA 2JK8A 1IBKL 1N33L 2VW9A 1ASYA 4OX9Q 2ID0A 4P72A 2CCZA 1E3PA 3HKSA 5C0XJ 4LUZA 4LFBQ 1Y1VH 3LGJA 4JI8L 3TRZA 4JYAQ 2AWNA 3CW2C 4TQUS 4JI0L 2F52A 4OWTB 3DM3A 4B3SL 1PH2A 2EXDA 1FGUA 4A3GH 2AWOA 4OX9L 2NVQH 3L7ZC 3K8AA 2E8GA 4DR3Q 1CSPA 1M1KC 3RNUA 3ERSX 4PZ7A 3CCSA 1K83H 1VQ4A 4DUZQ 4QQBX 4KHZA 2K50A 3U4ZA 2PQAB 3AFPA 3ER0A 3UDGA 3PUWA 2AMCB 4R4TA 1VCIA 2PMZE 4BY7G 2Y0SG 4DR3L 1CSQA 3CCJA 4NXNQ 1A0IA 1HNXQ 4DUZL 4DV3Q 1W3SA 4KHPQ 1FJGQ 4YWLA 1JMCA 3BU2A 3CCUA 1E22A 5LMNQ 2ATWA 4B3RQ 5JJLA 3CC2A 4P75A 4LF4Q 4TVAB 2MFIA 1FL0A 4MNOA 1EIFA 3RLNA 1HNXL 4PZ8A 4PZ6A 1GO3E 2RHQB 1WFQA 4AYBG 4DK6C 4DV3L 1UWVA 1E24A 3GTKH 1EQQA 1XNQQ 4HIOA 2R92H 5LMNL 1UE5A 1H95A 3G4SA 2A19A 3KF6A 1DGSA 1S3OA 3RLFA 2AHOB 2VY3A 3K80C 2UU9Q 3HOWG 3ULPA 2R93G 3OYYA 1XNQL 4LFAQ 2XTIA 2RF4A 2N78A 3KLWA 4PG3A 1L0WA 3H0GH 2HIXA 1RIPA 1C9OA 3FHWA 1MJCA 1YVCA 5M3MG 3RN2A 1PH3A 1GVPA 2GVAA 3D0FA 5M5XH 2JA9A 1K8AC 5IP9H 1VQMA 3PO2G 1TXYA 3T1HL 1PH5A 4GOPB 4EX5A 4BBRG 5IYDH 1MKHA 1SRUA 3D31A 1VQAA 4X65Q 1PHJA 4QGUA 4A3FG 3M4PA 1N32L 4LNQA 1Q81C 2Z0SA 2WAQG 1EYGA 3TREA 4R4OA 4NPSA 4X65L 1EIYB 2B63G 4DV2Q 3CCMA 1KRSA 4LF6Q 1EUJA 2YYZA 3PUXA 3S24A 5GADC 1KQSA 2YU9H 4MZ9A 1XPUA 1I5FA 4J15A 1FVIA 2WP8J 1HNZL 3E0EA 1EFWA 2R6GA 3PF4A 4LF9Q 2UXCL 4DV2L 4A3EH 1AE3A 2Q2HA 4GN4B 1IL2A 1JE5A 2JA5G 4DV4Q 3TEHB 2UUBQ 4GS3A 2IX1A 1EQRA 2CKZB 4JBWA 4GOPC 4AQYQ 2JA8G 3EIVA 3HOVH 4BXXH 3KYHC 4NB3A 4A3JG 2VNUD 3KDFB 2YTYA 1X3GA 2QEXA 5GROA 4X64Q 4UPAA 3CC7A 4YHHQ 5LMUL 2YV5A 4UY8C 3K0XA 1VS0A 4P74A 2HHHQ 1BVSA 2Z6KC 4DV4L 1VQCA 2VS1A 4X66L 2UUBL 1QUQB 1CKNB 5AJ3L 3NELA 2WB1G 1PV4A 4DK3C 3DLLA 3AQQA 4OO1G 1VQEA 3TQYA 1GKHA 3OW2A 1Q7YC 4YHHL 3A74A 1XPOA 2HHHL 4OO1I 3EN2A 2NZHA 4HJ7A 2E2HH 3HOZG 2CQOA 1VQGA 2L15A 2UXBL 2ZJPA 4LFCQ 4GN3B 1K9MC 3CQZH 1Q1BA 4C3HH 1HJPA 4MTNA 1QVCA 1XPRA 2HQLA 4BY7H 4C2MH 4BBSG 4A3BG 3K81C 1HR0Q 1NJIC 4DR2Q 4LFCL 3GTPH 5IYCG 3J81i 4DV5Q 3JAMc 2IHEA 3OTOL 3F2DA 1XMOL 4A3MG 3BZKA 2OWOA 1N33Q 1QVFA 2AKWB 3A0JA 1PYSB 4POGA 3CCLA 3NBHB 5ELNA 4RMFA 3A5ZB 2DUDA 1W2BA 4DR2L 4JI8Q 4GOPA 4DV5L 3U58A 4JI0Q 2K4KA 4B3SQ 4GKKL 4DPGA 2KBNA 5FLMG 2ZTCA 3PUVA 2Z6KA 5J3BA 2GN5A 3M85A 4OWXB 1KRTA 4DV1Q 1VQNA 3HOWH 3I4NG 3GD7A 2R93H 3HOUG 1L1OB 2ZM6L 4OXPA 4IPCA 1KHIA 4DR1L 2LXKA 4GNXC 2F3IA 4JI2Q 3STBC 1WI5A 4BY1G 4O0AA 1Z47A 3SGIA 5M3MH 1TWGH 3L0OA 1HZBA 2BH8A 5C4JH 3CMAA 4DV1L 1NMGA 1X65A 4IO9A 2E5LL 1TWAH 4GLXA 1IZ6A 3S2DH 4O2DA 3PO2H 3KFUA 1S40A 4JI2L 2VUMG 4BBRH 1S72A 5IE8A 4BA1I 2UUCQ 4JI1L 1PFSA 1SN8A 3KDFA 3M4QA 3E9IA 4A3FH 1YJWA 3KJPA 5M3FG 3K7AH 4R1JA 3I2ZA 1QUQA 4IPDA 3PIPA 5LMNW 1VQKA 1XTDA 2UUCL 2B63H 4EQ5A 4LF5Q 3RZDH 3RR5A 1B7YB 2I5HA 2MO0A 3U50C 3ICEA 2B29A 3I56A 1IBML 3CPFA 1WCMG 4JG2A 2N3SA 2F4VQ 2JEAI 1VQOA 2QA4A 3GTOH 1Q1EA 3GDEA 4A3KG 4LF5L 4POFA 4AH6A 2ZTDA 3M3YH 3S17H 3S1NH 1KL9A 1SMXA 2BA1A 2KENA 3J80c 3T1HQ 1U5KA 3S1RH 4JBJA 1MJEA 2JA5H 2JA7G 4A3CG 2F4VL 5FJ8G 2JA8H 2ZJRA 4A3JH 4UP9A 4GNXA 5IT9c 3HOXG 4R4CA 1N32Q 1X54A 3GTMH 3A5UA 4JI3L 1VQFA 1QZGA 1Q12A 4A3DH 4ALPA 4A3IG 1Q46A 1JJCB 2ASBA 4LUOA 4YCUA 4PMWA 2IT1A 1RL2A 1NMFA 3HFZB 5JEAG 4B3MQ 1NY4A 2HT1A 3J7A5 4JCVE 1KD1C 1HNWL 1N36L 1HNZQ 3L2PA 2UXCQ 2K52A 3HOZH 2YTXA 2JE6I 3F2BA 2CWAA 1GM5A 1PH8A 5K36G 1N8RC 2HIVA 1TWHH 1X3EA 2PNHA 1QZHA 4IOAA 1N34L 4HJ8A 4B3ML 1P16A 4YWMA 1LM0A 2K5HA 3IRBA 4APVA 4BBSH 4FDBA 4GLVB 4A3BH 4GLAC 2KCTA 3CCEA 5IYCH 5LMUQ 1G6PA 4DUYQ 3UDXA 1E1OA 4A3MH 2PQAA 4X66Q 2IHFA 1CUKA 5AJ3Q 3RN5A 1BKBA 3M9BA 1JB7A 5GQOA 1BBUA 4L5SA 3M7NA 1CKMA 1VQ5A 4DUYL 4X62Q 2ZTEA 1VQIA 3JC66 2JJQA 1JJ2A 3S2HH 5C4XG 3GTGH 1JJGA 1YJ9A 5FLMH 1Z9FA 3GTLH 4A4IA 1MIUA 2UXBQ 4GKJQ 1JT8A 1HH2P 4P71A 3W5OA 2OQKA 2ZJQA 3FKIG 2VL6A 4X62L 2Q2TA 4JV5Q 1A63A 4LF7Q 4YY3Q 3I4NH 3PCOB 2KCMA 3HOUH 1UEBA 2QGQA 5ELOA 3S16H 4A93G 1IXRA 2OTJA 5C44G 4GKJL 2NZOA 4BY1H 1XJVA 3NEMA 3OTOQ 1PH6A 1XMOQ 3CCQA 4K0KQ 4HJ5A 4JV5L 3RZOH 4LF7L 4YY3L 4ME3A 2PI2A 4OONA 3CCVA 1TWCH 1B8AA 1Q82C 1YIJA 2YTVA 1LTLA 1OXSC 2VUMH 1VQ6A 2IY5B 4QJFA 1I6HH 1WJJA 4GKKQ 3CF5A 4K0KL 1HR0W 5GAHC 4L5QA 1I50H 3G71A 1V9PA 1SE8A 5M3FH 4BA2I 3ULLA 1IBMQ 1SR3A 2NVYH 3S1QH 2OQ0A 1YHQA 1C7YA 1YBYA 4YCWA 1A8VA 4DNIA 1G291 4UP8A 2K5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM i;  2MQH A;  3I4O A;  2MNA A;  1D8L A;  2ZM6 Q;  5IYB G;  1XNR Q;  4JBM A;  1P8L A;  4Y7N H;  4DR1 Q;  2UXD Q;  1AE2 A;  4QL5 A;  1WCM H;  2Q2U A;  2RHS B;  2MO1 A;  2D62 A;  1QVG A;  1PH7 A;  3PO3 G;  4A3K H;  3HOY G;  4KI0 A;  3H3V I;  2E5L Q;  5IP7 G;  3CC4 A;  1YEZ A;  3HKZ E;  4IPG A;  2R7Z G;  1I3Q H;  1CKO A;  2KHI A;  1XNR L;  2JA7 H;  4A3L G;  4A3C H;  1HZC A;  2VQF Q;  5DLQ E;  4XTC S;  1X6O A;  3J81 j;  1SFO H;  2UXD L;  4KLK A;  3STB D;  5FJ8 H;  3PF5 A;  2NVX H;  4JI1 Q;  1J6Q A;  4IJH A;  4GN5 A;  2K75 A;  1YHB A;  5JEA J;  2BH2 A;  2DGY A;  4IPH A;  3HOX H;  4LWC A;  1Q8K A;  4RG1 A;  1K0R A;  4JI5 L;  4DAM A;  1LUZ A;  2VQF L;  4HID A;  1UE6 A;  4LUV A;  1OXX K;  3B6Y A;  5GAE C;  4A3I H;  4WJ4 A;  3UDF A;  4DV7 L;  1HZA A;  2D0P A;  1VQ8 A;  3J7Z C;  2JA6 G;  4L5R C;  3ZJY C;  2N49 A;  2ALY B;  3PGZ A;  4C3J H;  1NBW A;  4NXM Q;  3I4M G;  3PIO A;  1KAW A;  1Q86 C;  1PYB A;  1UE7 A;  3CAM A;  1YHA A;  1CKN A;  1OXT A;  3BZC A;  1OTC A;  4R4I A;  1E7Z A;  4QIW E;  2BA0 A;  2RCN A;  3UE0 A;  3KJO A;  2FXQ A;  3EBE A;  3G6E A;  4LFB L;  5IWA Q;  4JYA L;  1L1O C;  1M90 C;  1PVO A;  2R7F A;  3F2C A;  3VDY A;  4B3T Q;  4NXM L;  3GTQ H;  3CCR A;  5C3E G;  1Y1W G;  2JQO A;  1VQH A;  4JBK A;  2Q2I A;  2CWP A;  4DR5 Q;  3PSI A;  5IWA L;  3TS0 A;  4XIG S;  2E2J H;  1NTG A;  2OCE A;  1WYD A;  4JI3 Q;  2LXJ A;  4B3T L;  2B3G A;  2UUA Q;  1YIT A;  1I94 Q;  3UDI A;  1K73 C;  1B70 B;  4NXN L;  1E1T A;  4L5T A;  4DR7 Q;  1AH9 A;  3CP0 A;  3ULJ A;  4DR5 L;  1L2F A;  4HIM A;  1VQD A;  2Y0S E;  5M5W H;  1KXL A;  3S14 H;  1G51 A;  4KHP L;  5C4X H;  2VQE Q;  1FJG L;  4IOC A;  1PH9 A;  2UUA L;  3J80 i;  1HZ9 A;  1I94 L;  1VQ9 A;  4B3R L;  1HNW Q;  1N36 Q;  3F1Z A;  4LF4 L;  1KC8 C;  1Y1V G;  3GTJ H;  3GO5 A;  2I5M X;  4DR7 L;  3KF8 B;  1YJN A;  4QY7 A;  1SRO A;  3BJU A;  1PH1 A;  3FKI H;  3AFQ A;  1C0A A;  1GD7 A;  1N34 Q;  1N9W A;  2VQE L;  4A3G G;  1K3R A;  3W1G A;  2K14 A;  1OXU A;  2I0Q A;  4AYB E;  3AEV A;  1V1Q A;  4A93 H;  2OTL A;  2A1A A;  5C44 H;  4DAY B;  1X56 A;  4YCV A;  5IY0 A;  1ASZ A;  5C0X G;  2UU9 L;  2I5L X;  3RLO A;  2V1C C;  4LFA L;  3UE1 A;  5C0X I;  1L1O A;  1YZ6 A;  1PA6 A;  1BBW A;  2K5N A;  1YI2 A;  1EOV A;  2ES2 A;  1J5E Q;  1IYJ B;  1X55 A;  1YNX A;  3KOJ A;  4H02 A;  2N8N A;  4JOI C;  4R4Q A;  5E7N A;  1NE3 A;  4P73 A;  1J5E L;  3PV0 A;  1VQ7 A;  4IFD J;  4OWW B;  1EWI A;  2R92 G;  1LYL A;  5H1S E;  5IYB H;  4X6A H;  3I7F A;  3S15 H;  2XGT A;  3E9H A;  3H3V H;  2WAQ E;  2VZA A;  3PO3 H;  3HOY H;  1UE1 A;  3H15 A;  1PH4 A;  2PI2 E;  1VQJ A;  2GVB A;  2KHJ A;  3PUZ A;  5IP7 H;  2R7D A;  4HJA A;  3Q8D A;  3S1M H;  4DR4 Q;  4LF6 L;  2R7Z H;  4DR6 Q;  1D7Q A;  5BR8 Q;  1TWF H;  4A3L H;  3H0G G;  3CPW A;  5HY6 A;  1V43 A;  3U4V A;  3W1B A;  3MEF A;  1O7I A;  5HGQ A;  3I55 A;  4LF9 L;  3T1Y Q;  4DR4 L;  4DR6 L;  5IP9 G;  4C3I H;  4YWK A;  2CFM A;  5BR8 L;  3AYH B;  5IYD G;  2JEB I;  4JC0 A;  4A3D G;  4AQY L;  4LF8 Q;  3TS2 A;  4DKA C;  3PUY A;  4DV6 Q;  4X64 L;  3CME A;  3T1Y L;  4LW1 A;  2EQS A;  2A8V A;  2JA6 H;  1VQL A;  4A75 A;  1U0L A;  3NEN A;  1X3F A;  3KF6 B;  1Y14 B;  3FP9 A;  1IBL Q;  4JI7 Q;  1K8G A;  2D0O A;  2NN6 G;  5M5Y H;  3I4M H;  4A76 A;  4Y52 H;  3HKZ G;  1XMQ Q;  5EAY A;  4JOI A;  4LF8 L;  1A62 A;  2H5X A;  3J81 c;  4UP7 A;  2NN6 I;  4DV6 L;  2C35 B;  2WB1 E;  3MXN B;  2NVT H;  2IX0 A;  3M4O H;  3F8T A;  1IBL L;  4JI7 L;  5JJI A;  2EIF A;  1T9H A;  1X9N A;  5C3E H;  3WWV A;  1XMQ L;  4JI4 Q;  3CD6 A;  4GNX B;  1Y1W H;  4JI6 Q;  2LSS A;  1KIX A;  4A3E G;  4HIK A;  3G48 A;  4DV0 Q;  1IBK Q;  4JI5 Q;  1R9T H;  1SLJ A;  4IJL A;  4AIM A;  4IFD G;  4WJ3 M;  3HOV G;  5JJK A;  2E2I H;  4BXX G;  1VQB A;  4DV7 Q;  4JI4 L;  4JI6 L;  1OXV A;  4HJ9 A;  1HR0 L;  3K7U C;  4IFD I;  3CXC A;  1VQP A;  1WOC A;  5FLX c;  5GAG C;  4DV0 L;  2WFW A;  2JK8 A;  1IBK L;  1N33 L;  2VW9 A;  1ASY A;  4OX9 Q;  2ID0 A;  4P72 A;  2CCZ A;  1E3P A;  3HKS A;  5C0X J;  4LUZ A;  4LFB Q;  1Y1V H;  3LGJ A;  4JI8 L;  3TRZ A;  4JYA Q;  2AWN A;  3CW2 C;  4TQU S;  4JI0 L;  2F52 A;  4OWT B;  3DM3 A;  4B3S L;  1PH2 A;  2EXD A;  1FGU A;  4A3G H;  2AWO A;  4OX9 L;  2NVQ H;  3L7Z C;  3K8A A;  2E8G A;  4DR3 Q;  1CSP A;  1M1K C;  3RNU A;  3ERS X;  4PZ7 A;  3CCS A;  1K83 H;  1VQ4 A;  4DUZ Q;  4QQB X;  4KHZ A;  2K50 A;  3U4Z A;  2PQA B;  3AFP A;  3ER0 A;  3UDG A;  3PUW A;  2AMC B;  4R4T A;  1VCI A;  2PMZ E;  4BY7 G;  2Y0S G;  4DR3 L;  1CSQ A;  3CCJ A;  4NXN Q;  1A0I A;  1HNX Q;  4DUZ L;  4DV3 Q;  1W3S A;  4KHP Q;  1FJG Q;  4YWL A;  1JMC A;  3BU2 A;  3CCU A;  1E22 A;  5LMN Q;  2ATW A;  4B3R Q;  5JJL A;  3CC2 A;  4P75 A;  4LF4 Q;  4TVA B;  2MFI A;  1FL0 A;  4MNO A;  1EIF A;  3RLN A;  1HNX L;  4PZ8 A;  4PZ6 A;  1GO3 E;  2RHQ B;  1WFQ A;  4AYB G;  4DK6 C;  4DV3 L;  1UWV A;  1E24 A;  3GTK H;  1EQQ A;  1XNQ Q;  4HIO A;  2R92 H;  5LMN L;  1UE5 A;  1H95 A;  3G4S A;  2A19 A;  3KF6 A;  1DGS A;  1S3O A;  3RLF A;  2AHO B;  2VY3 A;  3K80 C;  2UU9 Q;  3HOW G;  3ULP A;  2R93 G;  3OYY A;  1XNQ L;  4LFA Q;  2XTI A;  2RF4 A;  2N78 A;  3KLW A;  4PG3 A;  1L0W A;  3H0G H;  2HIX A;  1RIP A;  1C9O A;  3FHW A;  1MJC A;  1YVC A;  5M3M G;  3RN2 A;  1PH3 A;  1GVP A;  2GVA A;  3D0F A;  5M5X H;  2JA9 A;  1K8A C;  5IP9 H;  1VQM A;  3PO2 G;  1TXY A;  3T1H L;  1PH5 A;  4GOP B;  4EX5 A;  4BBR G;  5IYD H;  1MKH A;  1SRU A;  3D31 A;  1VQA A;  4X65 Q;  1PHJ A;  4QGU A;  4A3F G;  3M4P A;  1N32 L;  4LNQ A;  1Q81 C;  2Z0S A;  2WAQ G;  1EYG A;  3TRE A;  4R4O A;  4NPS A;  4X65 L;  1EIY B;  2B63 G;  4DV2 Q;  3CCM A;  1KRS A;  4LF6 Q;  1EUJ A;  2YYZ A;  3PUX A;  3S24 A;  5GAD C;  1KQS A;  2YU9 H;  4MZ9 A;  1XPU A;  1I5F A;  4J15 A;  1FVI A;  2WP8 J;  1HNZ L;  3E0E A;  1EFW A;  2R6G A;  3PF4 A;  4LF9 Q;  2UXC L;  4DV2 L;  4A3E H;  1AE3 A;  2Q2H A;  4GN4 B;  1IL2 A;  1JE5 A;  2JA5 G;  4DV4 Q;  3TEH B;  2UUB Q;  4GS3 A;  2IX1 A;  1EQR A;  2CKZ B;  4JBW A;  4GOP C;  4AQY Q;  2JA8 G;  3EIV A;  3HOV H;  4BXX H;  3KYH C;  4NB3 A;  4A3J G;  2VNU D;  3KDF B;  2YTY A;  1X3G A;  2QEX A;  5GRO A;  4X64 Q;  4UPA A;  3CC7 A;  4YHH Q;  5LMU L;  2YV5 A;  4UY8 C;  3K0X A;  1VS0 A;  4P74 A;  2HHH Q;  1BVS A;  2Z6K C;  4DV4 L;  1VQC A;  2VS1 A;  4X66 L;  2UUB L;  1QUQ B;  1CKN B;  5AJ3 L;  3NEL A;  2WB1 G;  1PV4 A;  4DK3 C;  3DLL A;  3AQQ A;  4OO1 G;  1VQE A;  3TQY A;  1GKH A;  3OW2 A;  1Q7Y C;  4YHH L;  3A74 A;  1XPO A;  2HHH L;  4OO1 I;  3EN2 A;  2NZH A;  4HJ7 A;  2E2H H;  3HOZ G;  2CQO A;  1VQG A;  2L15 A;  2UXB L;  2ZJP A;  4LFC Q;  4GN3 B;  1K9M C;  3CQZ H;  1Q1B A;  4C3H H;  1HJP A;  4MTN A;  1QVC A;  1XPR A;  2HQL A;  4BY7 H;  4C2M H;  4BBS G;  4A3B G;  3K81 C;  1HR0 Q;  1NJI C;  4DR2 Q;  4LFC L;  3GTP H;  5IYC G;  3J81 i;  4DV5 Q;  3JAM c;  2IHE A;  3OTO L;  3F2D A;  1XMO L;  4A3M G;  3BZK A;  2OWO A;  1N33 Q;  1QVF A;  2AKW B;  3A0J A;  1PYS B;  4POG A;  3CCL A;  3NBH B;  5ELN A;  4RMF A;  3A5Z B;  2DUD A;  1W2B A;  4DR2 L;  4JI8 Q;  4GOP A;  4DV5 L;  3U58 A;  4JI0 Q;  2K4K A;  4B3S Q;  4GKK L;  4DPG A;  2KBN A;  5FLM G;  2ZTC A;  3PUV A;  2Z6K A;  5J3B A;  2GN5 A;  3M85 A;  4OWX B;  1KRT A;  4DV1 Q;  1VQN A;  3HOW H;  3I4N G;  3GD7 A;  2R93 H;  3HOU G;  1L1O B;  2ZM6 L;  4OXP A;  4IPC A;  1KHI A;  4DR1 L;  2LXK A;  4GNX C;  2F3I A;  4JI2 Q;  3STB C;  1WI5 A;  4BY1 G;  4O0A A;  1Z47 A;  3SGI A;  5M3M H;  1TWG H;  3L0O A;  1HZB A;  2BH8 A;  5C4J H;  3CMA A;  4DV1 L;  1NMG A;  1X65 A;  4IO9 A;  2E5L L;  1TWA H;  4GLX A;  1IZ6 A;  3S2D H;  4O2D A;  3PO2 H;  3KFU A;  1S40 A;  4JI2 L;  2VUM G;  4BBR H;  1S72 A;  5IE8 A;  4BA1 I;  2UUC Q;  4JI1 L;  1PFS A;  1SN8 A;  3KDF A;  3M4Q A;  3E9I A;  4A3F H;  1YJW A;  3KJP A;  5M3F G;  3K7A H;  4R1J A;  3I2Z A;  1QUQ A;  4IPD A;  3PIP A;  5LMN W;  1VQK A;  1XTD A;  2UUC L;  2B63 H;  4EQ5 A;  4LF5 Q;  3RZD H;  3RR5 A;  1B7Y B;  2I5H A;  2MO0 A;  3U50 C;  3ICE A;  2B29 A;  3I56 A;  1IBM L;  3CPF A;  1WCM G;  4JG2 A;  2N3S A;  2F4V Q;  2JEA I;  1VQO A;  2QA4 A;  3GTO H;  1Q1E A;  3GDE A;  4A3K G;  4LF5 L;  4POF A;  4AH6 A;  2ZTD A;  3M3Y H;  3S17 H;  3S1N H;  1KL9 A;  1SMX A;  2BA1 A;  2KEN A;  3J80 c;  3T1H Q;  1U5K A;  3S1R H;  4JBJ A;  1MJE A;  2JA5 H;  2JA7 G;  4A3C G;  2F4V L;  5FJ8 G;  2JA8 H;  2ZJR A;  4A3J H;  4UP9 A;  4GNX A;  5IT9 c;  3HOX G;  4R4C A;  1N32 Q;  1X54 A;  3GTM H;  3A5U A;  4JI3 L;  1VQF A;  1QZG A;  1Q12 A;  4A3D H;  4ALP A;  4A3I G;  1Q46 A;  1JJC B;  2ASB A;  4LUO A;  4YCU A;  4PMW A;  2IT1 A;  1RL2 A;  1NMF A;  3HFZ B;  5JEA G;  4B3M Q;  1NY4 A;  2HT1 A;  3J7A 5;  4JCV E;  1KD1 C;  1HNW L;  1N36 L;  1HNZ Q;  3L2P A;  2UXC Q;  2K52 A;  3HOZ H;  2YTX A;  2JE6 I;  3F2B A;  2CWA A;  1GM5 A;  1PH8 A;  5K36 G;  1N8R C;  2HIV A;  1TWH H;  1X3E A;  2PNH A;  1QZH A;  4IOA A;  1N34 L;  4HJ8 A;  4B3M L;  1P16 A;  4YWM A;  1LM0 A;  2K5H A;  3IRB A;  4APV A;  4BBS H;  4FDB A;  4GLV B;  4A3B H;  4GLA C;  2KCT A;  3CCE A;  5IYC H;  5LMU Q;  1G6P A;  4DUY Q;  3UDX A;  1E1O A;  4A3M H;  2PQA A;  4X66 Q;  2IHF A;  1CUK A;  5AJ3 Q;  3RN5 A;  1BKB A;  3M9B A;  1JB7 A;  5GQO A;  1BBU A;  4L5S A;  3M7N A;  1CKM A;  1VQ5 A;  4DUY L;  4X62 Q;  2ZTE A;  1VQI A;  3JC6 6;  2JJQ A;  1JJ2 A;  3S2H H;  5C4X G;  3GTG H;  1JJG A;  1YJ9 A;  5FLM H;  1Z9F A;  3GTL H;  4A4I A;  1MIU A;  2UXB Q;  4GKJ Q;  1JT8 A;  1HH2 P;  4P71 A;  3W5O A;  2OQK A;  2ZJQ A;  3FKI G;  2VL6 A;  4X62 L;  2Q2T A;  4JV5 Q;  1A63 A;  4LF7 Q;  4YY3 Q;  3I4N H;  3PCO B;  2KCM A;  3HOU H;  1UEB A;  2QGQ A;  5ELO A;  3S16 H;  4A93 G;  1IXR A;  2OTJ A;  5C44 G;  4GKJ L;  2NZO A;  4BY1 H;  1XJV A;  3NEM A;  3OTO Q;  1PH6 A;  1XMO Q;  3CCQ A;  4K0K Q;  4HJ5 A;  4JV5 L;  3RZO H;  4LF7 L;  4YY3 L;  4ME3 A;  2PI2 A;  4OON A;  3CCV A;  1TWC H;  1B8A A;  1Q82 C;  1YIJ A;  2YTV A;  1LTL A;  1OXS C;  2VUM H;  1VQ6 A;  2IY5 B;  4QJF A;  1I6H H;  1WJJ A;  4GKK Q;  3CF5 A;  4K0K L;  1HR0 W;  5GAH C;  4L5Q A;  1I50 H;  3G71 A;  1V9P A;  1SE8 A;  5M3F H;  4BA2 I;  3ULL A;  1IBM Q;  1SR3 A;  2NVY H;  3S1Q H;  2OQ0 A;  1YHQ A;  1C7Y A;  1YBY A;  4YCW A;  1A8V A;  4DNI A;  1G29 1;  4UP8 A;  2K5V A; 
#chains in the Genus database with same CATH topology
 3JAM i;  1D8L A;  4JBM A;  4Y7N H;  4DR1 Q;  3MFG A;  3VYS A;  5CMD A;  1PDQ A;  3T13 A;  1E0B A;  2RDH A;  3S1Q B;  3CC4 A;  4KKU A;  4XQJ A;  3JAM E;  1HZC A;  2UXD L;  4XTC S;  3M4Y A;  4KLK A;  2NVX H;  3NTK A;  4GN5 A;  1WCM B;  2RKS A;  5L37 A;  1Q8K A;  5C3E B;  4JI5 L;  4DAM A;  1HFN A;  4TRD A;  2JA7 B;  4IAL A;  3A55 A;  4MN3 A;  3MAQ A;  4KHV A;  1ET9 A;  4L5R C;  4R8N A;  5EJW A;  2ALY B;  3PGZ A;  4C3J H;  3HRZ C;  3CAM A;  1YHA A;  3BZC A;  1OXT A;  2K6A A;  2Q8T A;  4GZY C;  2FXQ A;  3EBE A;  2B2Y A;  2K03 A;  1L1O C;  2A74 C;  1DON A;  3VDY A;  3E3X A;  2JQO A;  3C2P A;  4DR5 Q;  2LS0 1;  4XIG S;  2E2J H;  2OCE A;  1WYD A;  2LXJ A;  2B3G A;  1I94 Q;  3UDI A;  1K73 C;  3C1F A;  4OIK A;  5KNB A;  2O5I C;  3GTQ B;  2Y0S E;  2EYM A;  2F0G A;  5CV4 A;  1AZQ A;  4B3R L;  1HNW Q;  2NTT A;  1KAB A;  3VR6 A;  1A3V A;  1RJT A;  4DR7 L;  2B8G A;  1BUV T;  1SRO A;  1NSN S;  4A3G G;  1K3R A;  2I07 B;  1V1Q A;  4A93 H;  3GTK B;  2DNE A;  3RMH A;  4DAY B;  4YCV A;  2FJ2 A;  2Z9H A;  5EKI A;  2EYL A;  2V1C C;  3HP3 A;  1PA6 A;  5E4X A;  3QO2 A;  1J5E Q;  3J80 L;  1ENA A;  1YNX A;  3KOJ A;  4JPB W;  4U67 3;  2N8N A;  4JOI C;  3TP7 A;  1NE3 A;  2Q8R E;  3ITP A;  4P73 A;  5C4H A;  3PV0 A;  4DGZ A;  4IFD J;  3E6Z X;  3K5N A;  4XT3 B;  5H1S E;  5IYB H;  3S15 H;  1ILQ A;  3E9H A;  2WAQ E;  3BYY B;  3PUZ A;  1PFB A;  4DR4 Q;  4HJA A;  3Q8D A;  2KCN A;  4A3L H;  1H9K A;  3OSO A;  4LF9 L;  5HGQ A;  3I55 A;  3K58 A;  1H9R A;  5ELF A;  3PO3 B;  3AYH B;  1FNW A;  4LF8 Q;  2R7Z B;  2PCF B;  1TWF B;  2F4I A;  4DKA C;  3CME A;  1DYQ A;  5ELB A;  2NN6 G;  4A76 A;  5EAY A;  2CHB D;  2F3V A;  2H5X A;  3NQT A;  3J81 c;  2NN6 I;  2A6E C;  2A6E D;  4DV6 L;  2XWJ B;  3KF8 A;  2WB1 E;  1PTO F;  3R8B A;  1EEI D;  3M4O H;  3F8T A;  4JI7 L;  1B9N A;  1XMQ L;  4JI4 Q;  4DXG A;  4B9X A;  1Y1W H;  4DXF A;  5M5Y B;  3H3V C;  1QJO A;  4AIM A;  1PZI D;  1G6Z A;  3HOV G;  4BXX G;  2IJ0 A;  1OXV A;  3CQZ B;  4L63 B;  1HR0 L;  2AQ1 B;  3CXC A;  3NSW A;  4DV0 L;  2JK8 A;  1T5X D;  2VW9 A;  1ICW A;  1SNO A;  1WTX A;  1E3P A;  1S4Z A;  1Y1V H;  3LGJ A;  2AWN A;  3CW2 C;  4JI0 L;  4OWT B;  1FGU A;  2AWO A;  4OX9 L;  3K8A A;  3BDC A;  4DR3 Q;  1CSP A;  3DM1 A;  4PZ7 A;  4DUZ Q;  4KHZ A;  2AQ3 B;  4PMC A;  3A8J E;  3TN2 A;  3UDG A;  3PUW A;  1BF4 A;  4BY7 G;  2HCC A;  1GUG A;  4K14 A;  2RA4 A;  3BU2 A;  3T4A C;  1K83 B;  5LMN Q;  5JJL A;  4P75 A;  2MFI A;  4MNO A;  1HNX L;  4PZ8 A;  4AYB G;  1WFQ A;  1E24 A;  1JOQ A;  4C1N I;  2R92 H;  4O42 A;  2A19 A;  1WTR A;  3NE5 B;  3NWT A;  2VY3 A;  3ERO A;  1SSO A;  1B1Z A;  4LFA Q;  5J39 A;  4C56 C;  4NW2 A;  3RZD B;  2B2V C;  3D6C A;  1MJC A;  2IWH A;  3NQI A;  3D0F A;  1PTO B;  1K8A C;  1K28 A;  3CRK C;  4DA2 A;  4EX5 A;  4BBR G;  1B3A A;  2B2W A;  2EYJ A;  2F0V A;  1EY6 A;  2D9U A;  1SXT A;  3M4P A;  2Z0S A;  1UUP A;  2EYH A;  3BVG A;  5CBE E;  4A3J B;  5M5X B;  1RD9 D;  3PMF A;  4NPS A;  4M8A A;  1AEX A;  2XRQ D;  3EQL C;  2Z4I A;  1EY5 A;  2WB1 B;  5IGF A;  5A2Q E;  4J15 A;  4LMQ D;  1FVI A;  2UXC L;  1EFW A;  2R6G A;  1EY8 A;  1AE3 A;  4GN4 B;  1JE5 A;  1I4R A;  3TEH B;  2EZV A;  2QIL A;  4IFD H;  3KBG A;  3EIV A;  1K0S A;  4FO2 A;  4UPA A;  1SNP A;  3H09 A;  1BVS A;  4DV4 L;  2UUB L;  3NEL A;  4OO1 G;  3QOL A;  1UEA B;  3F2U A;  3TZU A;  4DNT B;  5CC4 A;  4YHH L;  3OMG A;  4OO1 I;  2MHV A;  5A35 A;  2L11 A;  3HOZ G;  4O1N A;  2ZXO A;  3IKJ A;  1R4P B;  1EWC A;  1XPR A;  1QVC A;  5G3L F;  1S5D D;  4BBS G;  4A3B G;  4DR2 Q;  4DV5 Q;  3J81 i;  2IHE A;  2OWO A;  3F2D A;  1XMO L;  4A3M G;  2Z8L A;  2AKW B;  1LV9 A;  3A0J A;  3A7L A;  5KGU A;  4POG A;  1ROD A;  2AQ2 B;  5ELD A;  4K5V A;  1NNX A;  3IAY A;  1EQT A;  1ENF A;  3J81 E;  2VUM B;  4CJ0 B;  2Z6K A;  4E6I A;  4OWX B;  5COR A;  3KBX A;  1VQN A;  3NUC A;  3HOW H;  5IOC A;  3I4N G;  2R93 H;  1ICF B;  2ZM6 L;  3X3M A;  1KHI A;  3SVM A;  4BS9 A;  2CQA A;  1WI5 A;  4O0A A;  1Z47 A;  3L0O A;  4DV1 L;  1PXU A;  3K5M A;  2E5L L;  2LKV A;  5D3D A;  1VF5 C;  1IZ6 A;  3S2D H;  2FIN B;  5KNC A;  3PO2 H;  1QIL A;  1S40 A;  4JI2 L;  1SN8 A;  4IUU A;  5M3M B;  1CT1 D;  4FNF A;  3I2Z A;  3NHH A;  3PIP A;  1JWS D;  2UUC L;  2B63 H;  3FPP A;  1D5Z C;  3HZX A;  3RR5 A;  1U4M A;  3ICE A;  5CV7 A;  1IBM L;  2JEA I;  1WCM G;  3I73 A;  2N3S A;  1GUO A;  4A3F B;  1VQO A;  3S9W A;  1IYU A;  4POF A;  4QB4 A;  3S1N H;  2KVM A;  1SMX A;  5E3F A;  4KY5 A;  3T1H Q;  3S1R H;  1U5K A;  1G8Z D;  3SHL A;  2JA5 H;  2JA7 G;  4A3C G;  5FJ8 G;  2JA8 H;  1O80 A;  4IQZ A;  1A15 A;  2JN4 A;  4HAE A;  1XYI A;  3S17 B;  2E2J B;  1TS2 A;  1EY7 A;  5FO9 B;  2ASB A;  4LUO A;  4PMW A;  3QR8 A;  3BDL A;  1EQV A;  5JEA G;  1NY4 A;  1KD1 C;  1HNZ Q;  3U9S A;  4MTK A;  4XYQ A;  3LX0 A;  2CWA A;  4UDU C;  2F0N A;  2HIV A;  1TWH H;  3TSS A;  1QWY A;  2XRS D;  3Q6S A;  4EGV A;  4IOA A;  4RCN A;  1N34 L;  1J8I A;  4APV A;  2K5H A;  4ABN A;  1PTO C;  1PTO D;  4RHS A;  1FNV A;  4FF1 A;  4QCL A;  5JPM C;  1SMY C;  1SMY D;  1C48 A;  4WFN 3;  5AJ3 Q;  1IW7 C;  2WIN B;  1BBU A;  2RDF A;  4L5S A;  3M7N A;  2KQ3 A;  3OOC A;  1JOR A;  4DUY L;  2ZTE A;  1S5E D;  1S5B D;  3JC6 6;  1F9Q A;  4HR7 B;  1HTP A;  2OQK A;  2F0I A;  4YY3 Q;  1LLR D;  3PIP 3;  2EOT A;  2KCM A;  1AFP A;  2QGQ A;  2OTJ A;  5C44 G;  4V19 0;  1BOS A;  2BE5 C;  2BE5 D;  2GA4 B;  2NZO A;  3S2H B;  4IUQ A;  1XJV A;  3NEM A;  1VDZ A;  3S15 B;  4HJ5 A;  2PQE A;  1B9M A;  5I6W A;  2PMZ B;  4BWG B;  1W6K A;  3K5L A;  4CGY B;  1VQ6 A;  1XTC D;  1TU2 B;  3CF5 A;  4K0K L;  4I7Z C;  1HHV A;  5I9O A;  1KAA A;  2K01 A;  4KD3 A;  5FK9 C;  2NVY H;  1YHQ A;  3FRP B;  2SEB D;  4YCW A;  2OT2 A;  1P8L A;  3OW7 A;  1TY2 A;  2UXD Q;  4QL5 A;  1I50 B;  1YNJ C;  1YNJ D;  4ZK9 B;  2MO1 A;  3PO3 G;  2X6L A;  4A3K H;  4KI0 A;  1I6V C;  4XQQ A;  2R7Z G;  1XNR L;  5DLQ E;  1SFO H;  1H9J A;  4Q5V A;  1PFM A;  4N9P A;  4JI1 Q;  5JAV A;  4FF2 A;  2SNM A;  3H6M A;  2XNA C;  4FXK C;  2L0C A;  4LWC A;  3MXP A;  4Q0F A;  1K0R A;  1Y1W B;  3D6W A;  2VQF L;  4HID A;  1UE6 A;  5GAE C;  4A3I H;  1I3Q B;  3UDF A;  5IGG A;  4ME5 A;  3J7Z C;  4CDD C;  3ZJY C;  2DNC A;  1NBW A;  3MA2 B;  1KAW A;  1Q86 C;  1PYB A;  5FLX L;  3HOX B;  1CKN A;  1SEB D;  3KJO A;  2RCN A;  2WII B;  4JYA L;  1STE A;  1M90 C;  4NXM L;  1CQF A;  1EY9 A;  1T5E A;  4JBK A;  2CWP A;  5IWA L;  5C5M A;  5LL6 S;  2DY7 A;  4JI3 Q;  4ZUJ A;  1I4X A;  4DK1 A;  3A56 A;  4NXN L;  5DM6 3;  1E1T A;  4L5T A;  2F0E A;  4DR7 Q;  1AH9 A;  3ULJ A;  1KXL A;  1L2F A;  1I4G A;  1G51 A;  3I70 A;  3S14 H;  4KHP L;  5C4X H;  1FJG L;  1PH9 A;  2UUA L;  1HZ9 A;  4PNY A;  1N36 Q;  3NBH A;  1WTW A;  1KC8 C;  1PH1 A;  2B2T C;  3AFQ A;  1GD7 A;  4KMU C;  1N9W A;  1X3Q A;  2K14 A;  3PQI A;  1OXU A;  3AEV A;  2QDL A;  2OTL A;  1QCB D;  1X56 A;  1JC7 A;  1IHZ A;  2R92 B;  1STY A;  5C0X G;  2UU9 L;  5HGT A;  2A5H A;  2I5L X;  2C5C A;  5C0X I;  2DY8 A;  3DEO A;  1YI2 A;  1HFG A;  2MP1 A;  4DAP A;  4R4Q A;  5E7N A;  3N6R A;  2L55 A;  1B50 A;  1Z6H A;  2NWG A;  1KDC A;  5CR3 A;  4X6A H;  4FXG C;  3MVV A;  1A2U A;  1E2W A;  2RCF A;  5DEH A;  1HQM C;  4RWS C;  1UE1 A;  5AFW A;  3H15 A;  2PI2 E;  2GVB A;  1LTG D;  2A68 D;  2R7D A;  3S1M H;  5EPK A;  1OO9 B;  4LF6 L;  1BO0 A;  3V96 A;  1F9R A;  4CKB A;  1GOZ A;  5HY6 A;  1V43 A;  3K57 A;  1V1P B;  5C3W A;  4B9W A;  2CFM A;  2Z6B A;  1CA6 A;  1BXT A;  4OIJ A;  3TS2 A;  4XDX A;  1R4Q B;  2WAC A;  3PUY A;  4DV6 Q;  2IW3 A;  3T1Y L;  4LW1 A;  2EQS A;  2A8V A;  4A75 A;  1U0L A;  3NEN A;  3NP8 A;  4JI7 Q;  1K8G A;  2D0O A;  3HKZ G;  1XMQ Q;  4C3I B;  4IUV A;  3LNN A;  2NVT H;  1FR3 A;  2F0O A;  4DN4 M;  1PRT F;  2G9D A;  4DU9 A;  2JA6 B;  3WWV A;  4GNX B;  1H9S B;  2LSS A;  3I4M B;  4A3E G;  1ENC A;  2KEE A;  4DV0 Q;  1O7Y A;  1SJH D;  1R9T H;  2VXW A;  2PO4 A;  3E5S A;  3SK6 A;  1JWM D;  1VQB A;  4DV7 Q;  4N8X 1;  3K7U C;  4S3S A;  4KN4 C;  1WOC A;  5JJZ A;  4OL7 A;  4PV1 C;  5GAG C;  2WFW A;  5BN5 A;  1IBK L;  1N33 L;  3CKI B;  3TP8 A;  4OX9 Q;  4HMJ A;  2ID0 A;  4P72 A;  2CCZ A;  4LUZ A;  4LFB Q;  4JI8 L;  3TRZ A;  3DM3 A;  4B3S L;  1PH2 A;  2EXD A;  4RGO S;  4A3G H;  2NVQ H;  3BYT B;  3ERS X;  3CCS A;  4H13 C;  1VQ4 A;  1CZW A;  3I91 A;  3T16 A;  1V1O A;  4K5X A;  3U4Z A;  5E4W C;  5ELE A;  4C3H G;  2BCO A;  4LAA A;  1A3U A;  3TDQ A;  5FLX E;  2RDG A;  1HNX Q;  5I2Y A;  4HTH A;  3BZD B;  2N88 A;  3V05 A;  2ATW A;  1QOH A;  4LF4 Q;  2XVS A;  1CA5 A;  1GO3 E;  4DK6 C;  4DV3 L;  1UAP A;  1TR5 A;  4HIO A;  3G4S A;  3NXW A;  1S3O A;  1L0Y B;  1K8M A;  3K80 C;  3ULP A;  1ZKO A;  2XTI A;  1L0W A;  2B63 B;  2HIX A;  5M3M G;  3FHW A;  3EFX D;  5K5P A;  2NUC A;  3RN2 A;  1WD0 A;  1PH3 A;  2GVA A;  2JA9 A;  2EYP A;  3H94 A;  5CGK A;  1DOL A;  2OXP A;  1SRU A;  1STA A;  1VQA A;  4ZKB B;  5EPL A;  5D3I B;  5TSS A;  3H0G B;  3SK5 A;  4A3F G;  4EQO A;  1Q81 C;  2EPB A;  5IGB A;  5IT9 L;  2NN6 H;  2LMC B;  4X65 L;  1EIY B;  2HUG A;  4ZAI A;  1SE2 A;  3PUX A;  5E1F A;  5KYL A;  2YU9 H;  5COY A;  1I5F A;  2WP8 J;  1QG7 A;  3M7G A;  2KUM A;  2KOL A;  2Q2H A;  1F2L A;  4XYO A;  4DV4 Q;  2UUB Q;  4GS3 A;  3TZD A;  1EQR A;  1XWE A;  4JBW A;  4P2C B;  4GOP C;  4AQY Q;  3HOV H;  4F88 A;  4BXX H;  4N8F A;  3KDF B;  2QEX A;  5BN3 A;  4X64 Q;  3CC7 A;  4YHH Q;  2DN8 A;  1GUS A;  4X66 L;  3AQQ A;  3TQY A;  3OW2 A;  1XPO A;  2J4X A;  3MFY A;  4K5W A;  2NZH A;  2CQO A;  2L15 A;  2UXB L;  2ZJP A;  1MBY A;  4ZQ3 A;  1STB A;  5M9O A;  2ICI A;  3IL8 A;  2HCI A;  2HQL A;  4BY7 H;  3U9O A;  1SJE D;  4LFC L;  5IYC G;  1F2Y A;  1QVF A;  3BZK A;  2E2H B;  4RH6 A;  1F9S A;  1WVL A;  1QNU A;  3CCL A;  2DUD A;  2F0T A;  3MC0 B;  5IGD A;  1W2B A;  3R2T A;  1HTL D;  3P1H A;  2K4K A;  2Y0S B;  2B2U C;  4GKK L;  3BS1 A;  1AN8 A;  2KBN A;  2A6H C;  2A6H D;  1LTS D;  2ZTC A;  5EQ0 A;  1BQQ T;  2GN5 A;  3P20 A;  1RHP A;  4DV1 Q;  1D1K A;  3SE0 A;  3HOU G;  4IPC A;  4DR1 L;  2LXK A;  4GNX C;  4JI2 Q;  3STB C;  2C9O A;  2BH8 A;  1NMG A;  1X65 A;  4FP5 D;  5EBD A;  1SE4 A;  1TWA H;  4WOR A;  4KY6 A;  1PFN A;  1FD7 D;  3KFU A;  4BBR H;  4MIU A;  1M8A A;  5C6A A;  4BA1 I;  5IE8 A;  2UUC Q;  1STN A;  5IGC A;  1HRJ A;  3M4Q A;  4J1M A;  1YJW A;  3AU7 A;  3KJP A;  1TWG B;  1CZG A;  1DCZ A;  5LMN W;  1XTD A;  2SDF A;  1EEF D;  2R3Z A;  5KIX A;  5I6Y A;  3HS0 C;  1EY4 A;  2JSO A;  2WAQ B;  3K7A B;  4LF5 L;  1BCP F;  3RUZ A;  3M3Y H;  1S5C D;  3MXN A;  2KEN A;  2HDM A;  3CRL C;  3HGB A;  2G9H D;  2XSC A;  2F0K A;  3HOX G;  4R4C A;  3J7Y W;  1KDB A;  3GTO B;  1N32 Q;  5EKL A;  2MPM A;  1MSG A;  4A3D H;  1DOK A;  1B3Q A;  1EYA A;  5CV5 A;  5KRU A;  1LTB D;  1RL2 A;  3HFZ B;  3J7A 5;  1LTR D;  4JCV E;  1HNW L;  1F9P A;  3HOZ H;  3GTM B;  2YTX A;  2JE6 I;  2Z1C A;  3F2B A;  5C4X B;  4QUF A;  3J80 E;  2M2L A;  5K36 G;  2G5D A;  3FDT A;  1KLU D;  4B3M L;  3FEW X;  2RQX A;  3SEB A;  4BBS H;  4A3B H;  2PW5 A;  2KCT A;  1JR0 D;  5LMU Q;  1G6P A;  4DUY Q;  5C4Z A;  4ZCK A;  4A3M H;  2PQA A;  1S5F D;  1CUK A;  1JQY D;  1PRT C;  1PRT D;  2E75 C;  2PZU A;  1JB7 A;  2JJQ A;  1B53 A;  3GTL H;  4IUT A;  4A4I A;  1JT8 A;  1HH2 P;  3W5O A;  2ZJQ A;  3FKI G;  2VL6 A;  1GXD C;  4X62 L;  2Q2T A;  3VA7 A;  2A73 B;  3I4N H;  3K59 A;  4RGN A;  1TY0 A;  1SYB A;  3S16 H;  4GKJ L;  1EY0 A;  3GTG B;  1YNN C;  1YNN D;  3OTO Q;  1PH6 A;  3I72 A;  1CTM A;  3CCQ A;  4K0K Q;  3RZO H;  4LF7 L;  2D5D A;  5CBA E;  1TWC H;  2L4N A;  1B8A A;  2E2D C;  4RHR A;  1OXS C;  2IY5 B;  3S1M B;  1BCP B;  1I6H H;  3IFT A;  2M9V A;  1G91 A;  3G71 A;  2MGS A;  3MZ5 A;  4BY1 B;  4M1U B;  3S1Q H;  2OQ0 A;  3DXJ C;  4K8I A;  1A8V A;  4XT1 B;  1G29 1;  4JVZ A;  1STG A;  2K5V A;  2B2Y C;  2MQH A;  4UAI A;  3VYR A;  2MNA A;  2JXM B;  4OEM B;  1XNR Q;  1Q3L A;  1AE2 A;  2WKC A;  1WCM H;  2Q2U A;  2D62 A;  1QVG A;  5M3F B;  3HOY G;  2EJG C;  3H3V I;  2F1M A;  2FMC A;  5IP7 G;  1YEZ A;  4QMG A;  1SND A;  4IPG A;  3OWE B;  1CKO A;  2KHI A;  4R8I A;  2JA7 H;  4A3C H;  5LHY 1;  2VQF Q;  3J81 j;  5FJ8 H;  3PF5 A;  2HDL A;  3OIQ A;  4PMB A;  1J6Q A;  1EIG A;  2K75 A;  1YHB A;  3GQB A;  4Y7N B;  2M00 A;  2DGY A;  5IGE A;  5C5L A;  4RG1 A;  4C3I G;  1LUZ A;  4LUV A;  1OXX K;  3B6Y A;  3GV3 A;  2X69 A;  1NR4 A;  1HZA A;  2D0P A;  1VQ8 A;  5JVH 3;  2JA6 G;  2NVX B;  2N49 A;  4NXM Q;  3I4M G;  3PIO A;  1UE7 A;  3N52 A;  2NYZ D;  1OTC A;  4ZKC B;  4R4I A;  4QIW E;  3UE0 A;  2NTS A;  5IWA Q;  4WRD A;  3C3L A;  4HED A;  4IUP A;  2R7F A;  3GTQ H;  1D5X C;  3CCR A;  5C3E G;  3ND9 A;  4C3J B;  1E2Z A;  2O2L D;  3Q23 A;  3TS0 A;  2NVQ B;  2H4O A;  2UUA Q;  4B3T L;  1YIT A;  4RGT A;  1B70 B;  4ZYS A;  1PZJ D;  4RKL A;  3CP0 A;  4HIM A;  5M5W H;  1U4P A;  5F2D A;  3TP6 A;  2A69 C;  4G7H C;  2E74 C;  4FVM A;  3GTJ H;  3GO5 A;  4CJ1 B;  4QY7 A;  3BJU A;  1KNE A;  2EDG A;  2KHS A;  2VQE L;  2F0S A;  3W1G A;  2MUY A;  2I0Q A;  4AYB E;  3ND8 A;  4F87 A;  2A1A A;  5C44 H;  2DJG C;  4X3S A;  3QWN A;  2DJF C;  3RLO A;  4LFA L;  3UE1 A;  1L1O A;  4NDX A;  4JW0 A;  3I90 A;  1HUN A;  1D6E C;  2ES2 A;  4A93 B;  1HXY D;  1V8Q A;  4J8Q A;  1HCZ A;  1IW7 D;  4H02 A;  5IIF A;  5KND A;  1VQ7 A;  3TBI B;  4OWW B;  4KKT A;  4EQN A;  2EVB A;  3O13 A;  1D1I A;  1DXM A;  1QE6 A;  3PO3 H;  1AP0 A;  4TSS A;  1PH4 A;  3PIO 3;  1VQJ A;  1D7Q A;  2R7Z H;  1W6J A;  1TWF H;  3H0G G;  2Q8I B;  3CPW A;  3D3R A;  5I4D A;  3U4V A;  1TT2 A;  3MTS A;  2HQE A;  5LL6 X;  2JYO A;  3V2T A;  3T1Y Q;  1GJX A;  4DR6 L;  5IP9 G;  5BR8 L;  5IYD G;  2JEB I;  4JC0 A;  5D65 A;  3HOV B;  5DNF A;  1X32 A;  5ELC A;  2F0F A;  3KF6 B;  1Y14 B;  3QB3 A;  3R93 A;  5M5Y H;  4JOI A;  4UP7 A;  4QIW B;  2C35 B;  2PW7 A;  1O7L A;  2IX0 A;  1Y8P B;  1IBL L;  5JJI A;  2EIF A;  1T9H A;  2E76 C;  1KIX A;  3OHX C;  1JCK B;  3K0Y A;  2FFK B;  3G6J B;  2O5J C;  1IBK Q;  4JI5 Q;  1SLJ A;  4IJL A;  4WJ3 M;  2ZXP A;  5JJK A;  2E2I H;  1BCP C;  1BCP D;  3M4O B;  2K32 A;  4XXE A;  4HJ9 A;  4JI6 L;  4DK0 A;  5FLX c;  1DJR D;  1ASY A;  1RDP D;  3JAM L;  1HPC A;  4KD4 A;  5J22 A;  5I9P A;  3R3O A;  2KJX A;  4TQU S;  1Y69 U;  1EL0 A;  1FNU A;  2K05 A;  1MD2 D;  4X3T A;  2E8G A;  3QIA A;  1M1K C;  4F8M A;  3RNU A;  1K83 H;  5FO8 B;  5JVG 3;  5C0X H;  4NMZ A;  3AFP A;  1Y1V B;  2CH4 W;  3ER0 A;  2AMC B;  1FGB D;  1ET6 A;  1LTT D;  2EE1 A;  2Y0S G;  2B2W C;  5T1I A;  1A0I A;  4KK7 A;  4DV3 Q;  3MWY W;  1IL8 A;  4YWL A;  1B4O A;  1JMC A;  3QG1 A;  1E22 A;  4WJW A;  1F2Z A;  4B3R Q;  1CHP D;  3VYU A;  3CC2 A;  4TVA B;  1EIF A;  1TWA B;  4PZ6 A;  2RHQ B;  1JIC A;  1UWV A;  4BBR B;  1UE5 A;  1H95 A;  2F0Q A;  3P75 A;  3DHQ A;  4ULL A;  1DGS A;  1QNK A;  3D8G A;  1XNQ L;  3KUP A;  2F0M A;  1UNS A;  1GVP A;  2KCC A;  2RBM A;  5M5X H;  2L1B A;  1H9S A;  1QB5 D;  3RD4 A;  1G2S A;  3CHB D;  4HSP A;  1VQM A;  1TXY A;  3T1H L;  4KY7 A;  5I2X A;  3M3Y B;  4GOP B;  4RCO A;  2SNS A;  1MKH A;  1FYC A;  3D31 A;  4X65 Q;  1PHJ A;  1SDF A;  1U4L A;  5C3X A;  2CVR A;  2FMM A;  2WAQ G;  1EYG A;  2CW0 C;  2CW0 D;  2OEO A;  3TRE A;  1LAC A;  1NR2 A;  2B39 A;  3W2D A;  4A3D B;  1KRS A;  2YYZ A;  3S24 A;  1KQS A;  2TMP A;  1XPU A;  4L8J A;  4CDE C;  1D5M C;  1HNZ L;  3E0E A;  4X3U A;  4LF9 Q;  4DV2 L;  4A3E H;  3HOZ B;  4NKL A;  5EKK A;  2CKZ B;  3OIP A;  3KYH C;  4A3J G;  2VNU D;  3TME A;  2B2V A;  2YV5 A;  4UY8 C;  2Z6K C;  2VS1 A;  1QUQ B;  1CKN B;  5AJ3 L;  2WB1 G;  1PV4 A;  4K6D A;  2XWB B;  1Q7Y C;  1GKH A;  2EYO A;  1D2B A;  2HHH L;  1WTP A;  2R61 A;  4FF3 A;  2F03 A;  4HJ7 A;  1BR9 A;  1VQG A;  4LFC Q;  3DUZ A;  3A8I E;  1H9M A;  1K9M C;  2EY5 A;  4C3H H;  1CHQ D;  4C2M H;  3K81 C;  1HR0 Q;  3C1E A;  1WTO A;  3GTP H;  3I4N B;  4DAY A;  2B8F A;  3QJY A;  3GP7 A;  3NBH B;  1LAB A;  4RMF A;  1X3P A;  3D4D A;  3EJI A;  3A7A B;  3U58 A;  3G7L A;  4JI0 Q;  2K5D A;  3AB9 A;  5FLM G;  3EVQ A;  3PUV A;  1I6H B;  2VB2 X;  3HEJ A;  3GD7 A;  4K2L A;  4OXP A;  4OGQ C;  3LWU A;  4BY1 G;  5M3M H;  5C4J H;  4ALP A;  4GLX A;  4O2D A;  3HOW B;  3I8Z A;  2VUM G;  1S72 A;  2R93 B;  1B2T A;  4JI1 L;  3KDF A;  2NBF A;  4A3F H;  1Z7T A;  5M3F G;  4R1J A;  4G7Z C;  3J7A F;  3S2D B;  3KLR A;  4LF5 Q;  3PO2 B;  4I65 A;  3FPU B;  2I5H A;  1SE3 A;  5CYU A;  4JG2 A;  2SOB A;  1Q1E A;  2TSS A;  3GDE A;  2F0U A;  4AH6 A;  3S17 H;  3J80 c;  4FYD A;  4JBJ A;  1MJE A;  4I7A A;  2F4V L;  3Q24 A;  4FF4 A;  5IT9 c;  1X54 A;  3MXG A;  4DF7 A;  1QZG A;  4JI3 L;  1PRT B;  1Q90 A;  1Q12 A;  2NB0 A;  3C46 A;  3S1N B;  1Q46 A;  3L3O C;  4ZUI A;  1JJC B;  2JA5 B;  3S1R B;  2JA8 B;  4C3J G;  3A54 A;  2K28 A;  4ZRZ A;  1AW7 A;  4B3M Q;  5M5W B;  1N36 L;  2QDB A;  4FXD A;  2UXC Q;  1GM5 A;  1SYE A;  1PH8 A;  2K1B A;  1N8R C;  3GTJ B;  4HCE A;  2K5Q A;  4HJ8 A;  1P16 A;  1LM0 A;  2RSO A;  4B08 A;  2KA7 A;  1LT4 D;  1Q8I A;  4FDB A;  4GLV B;  4GLA C;  3CCE A;  2LFN A;  5IYC H;  3VR2 A;  1KDA A;  3UDX A;  1E1O A;  5C44 B;  2IHF A;  3T53 B;  5A2Q L;  3M9B A;  1TWH B;  3T56 B;  1G2T A;  3OWF A;  2F0W A;  4U68 A;  1K8O A;  4HN7 A;  3LWE A;  1VQI A;  4X62 Q;  1ZYR C;  1ZYR D;  2XN9 C;  1JJ2 A;  3S2H H;  1YJ9 A;  4K2K A;  1MIU A;  4GKJ Q;  1EOT A;  4P71 A;  3SK4 A;  4LF7 Q;  3HOU H;  1K3B C;  1UEB A;  5ELO A;  4A93 G;  3OMC A;  4CDC C;  4RGM A;  1ILP A;  3AMU A;  1XMO Q;  2QW7 A;  5KYI A;  4JV5 L;  2PYK A;  4IN3 A;  3CCV A;  1LT3 D;  3W3A A;  2YTV A;  4XQN A;  1WJJ A;  2BDN A;  2QCP X;  4NP5 A;  1I50 H;  1V9P A;  1SE8 A;  3SR1 A;  4QUC A;  4BA2 I;  3ULL A;  4ILW A;  4X3K A;  2BOS A;  1C7Y A;  2K33 A;  4DNI A;  4UP8 A;  3A8K E;  4YIJ A;  2EJM A;  1X9N A;  1NCV A;  3H91 A;  3I4O A;  2ZM6 Q;  5IYB G;  2RHS B;  3VR5 A;  1PH7 A;  1EU3 A;  1EZ8 A;  2NVY B;  3WOF A;  3DMU A;  2E5L Q;  3HKZ E;  1I3Q H;  3SXH A;  3J81 L;  4A3L G;  1I4P A;  1X6O A;  3STB D;  4IJH A;  5CV6 A;  5JEA J;  2BH2 A;  3BDO A;  2F0P A;  1SYD A;  4IPH A;  3HOX H;  2PZW A;  1TII D;  1J9O A;  4A3K B;  1DM0 B;  2K04 A;  1TVX A;  4WJ4 A;  5IOD A;  2KEC A;  4DV7 L;  1CQV A;  3TP5 A;  1SFO B;  5NUC A;  2E2I B;  1II3 A;  1IBM Q;  4QF4 A;  1ESF A;  1BDO A;  2X6G A;  1E7Z A;  4K8J A;  2BA0 A;  3G6E A;  4LFB L;  5K36 H;  4G4K A;  4A3I B;  1PVO A;  3F2C A;  4B3T Q;  3P7J A;  2QEJ C;  4RKB A;  1F77 A;  1TS3 A;  2I46 A;  1Y1W G;  1VQH A;  2Q2I A;  3PSI A;  1EFI D;  1Y8N B;  1NTG A;  4KN7 C;  1RTN A;  4RFB A;  3BVZ A;  2O4X A;  1C8C A;  1SYC A;  4DR5 L;  1VQD A;  1VMC A;  1HUM A;  4N9T A;  2WKD A;  2VQE Q;  4IOC A;  1LT5 D;  3J80 i;  3ZYY X;  1I94 L;  1VQ9 A;  2RSN A;  3F1Z A;  1SNC A;  4LF4 L;  1PYW D;  5JPN C;  1Y1V G;  2I5M X;  4OO1 H;  3KF8 B;  1YJN A;  1U4R A;  3FKI H;  5FO7 B;  1C0A A;  1O78 A;  4CJ2 C;  2CH4 A;  1N34 Q;  2L5T A;  2VB3 X;  1DD2 A;  2K5W A;  3S14 B;  3ERQ A;  5IY0 A;  5BN4 A;  1ASZ A;  5IT9 E;  2AUK A;  3CU7 A;  1YZ6 A;  1L0X B;  3BG3 A;  1BBW A;  2K5N A;  3Q22 A;  4OHJ A;  1EOV A;  1IYJ B;  1X55 A;  4ID6 A;  5D14 A;  1KNA A;  3ONA B;  1J5E L;  2MJ8 A;  1TS4 A;  1LTI D;  3VYT A;  3NPP A;  1EWI A;  2R92 G;  1LYL A;  3I7F A;  2XGT A;  3E0J A;  3K6O A;  2PZT A;  3H3V H;  2VZA A;  3QOJ A;  3HOY H;  2IPK D;  2KHJ A;  5IP7 H;  4DR6 Q;  2B2T A;  3HKZ B;  5BR8 Q;  2ENB A;  2PNR C;  4DNR B;  3KLS X;  3K5O A;  3W1B A;  3MEF A;  1O7I A;  1DZ1 A;  4DR4 L;  1JOO A;  2J0T D;  5T1G A;  1SAP A;  3WDN A;  4C3I H;  4YWK A;  3FVQ A;  4A3E B;  4A3D G;  1A2T A;  4AQY L;  1EYD A;  3MXU A;  4HMI A;  4X64 L;  1ONL A;  2JA6 H;  1VQL A;  3URY A;  1X3F A;  5ISR A;  3FP9 A;  1IBL Q;  3I4M H;  4IUN A;  4F7X A;  4Y52 H;  4LF8 L;  3R2I A;  5JOB A;  1A62 A;  1B44 D;  3MXN B;  2OF1 A;  1EWH A;  1A3T A;  1F2M A;  5C3E H;  3CD6 A;  2NZ1 D;  2L9H A;  4JI6 Q;  1WTV A;  4HIK A;  4HSV A;  3G48 A;  1TKW B;  4G57 A;  1JE4 A;  4IFD G;  2NVT B;  4JI4 L;  2EJF C;  4IFD I;  3D4R A;  4C3H B;  4C2M B;  4LJZ C;  4KV6 A;  3GTP B;  2XIW A;  3L9A X;  3HKS A;  2AUJ D;  4C1N K;  5C0X J;  1SYF A;  1R9T B;  4JYA Q;  1PZK D;  4IUR A;  2F52 A;  4HCS A;  4J6H A;  4Z9C B;  1XX8 A;  5JEA H;  3L7Z C;  4OEL B;  1EYC A;  2IL8 A;  1SNQ A;  4QQB X;  2K50 A;  2PQA B;  1TQO A;  4R4T A;  1VCI A;  2PMZ E;  1ESR A;  4DR3 L;  1CSQ A;  3CCJ A;  4NXN Q;  5EPJ A;  1MI2 A;  4A3G B;  2KED A;  4DUZ L;  1W3S A;  2F3W A;  4KHP Q;  1FJG Q;  1CI3 M;  3CCU A;  4KKS A;  5C4J B;  5FOB B;  1MSH A;  1SBB B;  1AZP A;  1FL0 A;  4H44 C;  3RLN A;  1CK1 A;  1NUC A;  3VR4 A;  3GTK H;  1EQQ A;  3I4L A;  3VA5 A;  1XNQ Q;  1WTH A;  5LMN L;  2A69 D;  3J7A V;  3GV6 A;  1CM9 A;  1ZXT A;  3KF6 A;  3RLF A;  2F0H A;  3D4W A;  2AHO B;  2FHT A;  1I4H A;  2UU9 Q;  3HOW G;  2R93 G;  3OYY A;  5CV9 A;  1TS5 A;  2RF4 A;  1EZ6 A;  2N78 A;  3KLW A;  2BDO A;  4PG3 A;  3UI2 A;  3H0G H;  1RIP A;  2N55 A;  1C9O A;  1YVC A;  1U9R A;  1M4V A;  3DEP A;  1LT6 D;  5IP9 H;  3PO2 G;  2EY6 A;  1PH5 A;  5IYD H;  1MGS A;  4QGU A;  1N32 L;  4LNQ A;  1EIH A;  3IFD A;  4R4O A;  2B63 G;  1I4Q A;  4DV2 Q;  3CCM A;  4MHE A;  2WV6 D;  4H0L C;  4LF6 Q;  1EUJ A;  5GAD C;  1BBX C;  4MZ9 A;  1ZEQ X;  1A6X A;  1JOK A;  3PF4 A;  4LK1 C;  1STH A;  2Z4H A;  1IL2 A;  3BVM A;  2JA5 G;  4K6L A;  2IX1 A;  1SNM A;  1XXG A;  2JA8 G;  1JWU D;  4NB3 A;  2YTY A;  1X3G A;  2YU9 B;  5GRO A;  5LMU L;  1WTQ A;  3K0X A;  1VS0 A;  4P74 A;  5KEE A;  2HHH Q;  1VQC A;  1VF7 A;  3VR3 A;  4DK3 C;  3DLL A;  3KK7 A;  1VQE A;  1NAP A;  3A74 A;  1CFM A;  3EN2 A;  2E2H H;  1RTO A;  1Y8O B;  2EYF A;  4G7O C;  5DAU A;  3SDZ A;  4GN3 B;  2ICE C;  3CQZ H;  1Q1B A;  1HJP A;  4KJO A;  4MTN A;  1GUW A;  1LTA D;  1RKN A;  4RAU C;  4KJN A;  4CBV A;  1NJI C;  2F0J A;  3HOU B;  3JAM c;  3OTO L;  1N33 Q;  2EY2 A;  1O7Z A;  1PYS B;  2K7V A;  3Q0A A;  5ELN A;  3FMC A;  3A5Z B;  2V4D A;  4DR2 L;  4JI8 Q;  4GOP A;  4DV5 L;  1IYV A;  4BY7 B;  4B3S Q;  4DPG A;  3MHB A;  4JK1 C;  5J3B A;  3DWA A;  2EXZ A;  3M85 A;  1BNZ A;  1GUT A;  1KRT A;  2J7Z A;  3NK9 A;  5HUR A;  1L1O B;  4TKO B;  4AYB B;  2F3I A;  2HT1 A;  3SGI A;  1VQP A;  1TWG H;  3CMA A;  1HZB A;  3I3C A;  2IX3 A;  4IO9 A;  1HA5 A;  1KLG D;  4UHV A;  1PFS A;  1V1P A;  3E9I A;  4CHT B;  3K7A H;  1GUN A;  4DAV A;  1QUQ A;  4IPD A;  1RCV D;  1VQK A;  5EGT A;  5EBC A;  3DWP A;  4EQ5 A;  1C4Q A;  3RZD H;  1GHK A;  1WD1 A;  4V0B A;  1B7Y B;  2B2U A;  2MO0 A;  3U50 C;  2B29 A;  1PTO H;  3I56 A;  1RF2 D;  2F0L A;  3CPF A;  2F4V Q;  3GTO H;  2QA4 A;  4A3K G;  2QKI C;  2ZTD A;  4EVO A;  1KL9 A;  2BA1 A;  3OPO A;  4H7B A;  2ZJR A;  3T51 B;  4A3J H;  4UP9 A;  4GNX A;  4EQP A;  1JB3 A;  3GTM H;  1PMR A;  3A5U A;  1VQF A;  3MEH A;  4A3I G;  4L6T B;  2QF7 A;  5FKA C;  2ZT9 C;  1HA6 A;  1HQR D;  3HG9 A;  4YCU A;  3X3N A;  2IT1 A;  3SK8 A;  5DM7 3;  1NMF A;  4RA8 A;  2D2C C;  4CKE A;  3L2P A;  2K52 A;  3NTI A;  1QZH A;  1X3E A;  2PNH A;  4KTA A;  2ZXR A;  1LO5 D;  2EY1 A;  1IKM A;  4YWM A;  3EA6 A;  3IRB A;  1ML0 D;  1SYG A;  3FKI B;  5J1Z A;  4DFA A;  2LY7 A;  3NTH A;  4X66 Q;  1VMP A;  1E2V A;  2RVL A;  5G3L D;  4CKC A;  1BKB A;  3RN5 A;  4IZ8 A;  5GQO A;  3NBI A;  3WOE A;  1CKM A;  1DOM A;  1VQ5 A;  2H1E A;  2HD3 A;  4BBS B;  5C4X G;  1PLF A;  3GTG H;  4A3B B;  1JJG A;  1IKL A;  1Z9F A;  5FLM H;  3DWQ A;  2PPB C;  4A3M B;  2UXB Q;  2F0D A;  4R9W A;  4JV5 Q;  1A63 A;  2JP1 A;  2A68 C;  3PCO B;  1EU4 A;  1KTK A;  1IXR A;  4BY1 H;  3GTL B;  4YY3 L;  4ME3 A;  2PI2 A;  4ODG A;  4OON A;  1MHW C;  3HOY B;  1Q82 C;  1YIJ A;  3KLS A;  1LTL A;  2VUM H;  3NWS A;  4ZLT F;  4QJF A;  3S16 B;  5CV8 A;  4GKK Q;  1HR0 W;  5GAH C;  4L5Q A;  4CDF C;  5M3F H;  1GHJ A;  1SR3 A;  4PQX A;  1YBY A;  2L12 A;  3RZO B;  2P5Z X;  1TWC B; 
#chains in the Genus database with same CATH homology
 3JAM i;  2MQH A;  3I4O A;  2MNA A;  1D8L A;  2ZM6 Q;  5IYB G;  1XNR Q;  4JBM A;  1P8L A;  4Y7N H;  4DR1 Q;  2UXD Q;  1AE2 A;  4QL5 A;  1WCM H;  2Q2U A;  2RHS B;  2MO1 A;  2D62 A;  1QVG A;  1PH7 A;  3PO3 G;  4A3K H;  3HOY G;  4KI0 A;  3H3V I;  2E5L Q;  5IP7 G;  3CC4 A;  1YEZ A;  3HKZ E;  4IPG A;  2R7Z G;  1I3Q H;  1CKO A;  2KHI A;  1XNR L;  2JA7 H;  4A3L G;  4A3C H;  1HZC A;  2VQF Q;  5DLQ E;  4XTC S;  1X6O A;  3J81 j;  1SFO H;  2UXD L;  4KLK A;  3STB D;  5FJ8 H;  3PF5 A;  2NVX H;  4JI1 Q;  1J6Q A;  4IJH A;  4GN5 A;  2K75 A;  1YHB A;  5JEA J;  2BH2 A;  2DGY A;  4IPH A;  3HOX H;  4LWC A;  1Q8K A;  4RG1 A;  1K0R A;  4JI5 L;  4DAM A;  1LUZ A;  2VQF L;  4HID A;  1UE6 A;  4LUV A;  1OXX K;  3B6Y A;  5GAE C;  4A3I H;  4WJ4 A;  3UDF A;  4DV7 L;  1HZA A;  2D0P A;  1VQ8 A;  3J7Z C;  2JA6 G;  4L5R C;  3ZJY C;  2N49 A;  2ALY B;  3PGZ A;  4C3J H;  1NBW A;  4NXM Q;  3I4M G;  3PIO A;  1KAW A;  1Q86 C;  1PYB A;  1UE7 A;  3CAM A;  1YHA A;  1CKN A;  1OXT A;  3BZC A;  1OTC A;  4R4I A;  1E7Z A;  4QIW E;  2BA0 A;  2RCN A;  3UE0 A;  3KJO A;  2FXQ A;  3EBE A;  3G6E A;  4LFB L;  5IWA Q;  4JYA L;  1L1O C;  1M90 C;  1PVO A;  2R7F A;  3F2C A;  3VDY A;  4B3T Q;  4NXM L;  3GTQ H;  3CCR A;  5C3E G;  1Y1W G;  2JQO A;  1VQH A;  4JBK A;  2Q2I A;  2CWP A;  4DR5 Q;  3PSI A;  5IWA L;  3TS0 A;  4XIG S;  2E2J H;  1NTG A;  2OCE A;  1WYD A;  4JI3 Q;  2LXJ A;  4B3T L;  2B3G A;  2UUA Q;  1YIT A;  1I94 Q;  3UDI A;  1K73 C;  1B70 B;  4NXN L;  1E1T A;  4L5T A;  4DR7 Q;  1AH9 A;  3CP0 A;  3ULJ A;  4DR5 L;  1L2F A;  4HIM A;  1VQD A;  2Y0S E;  5M5W H;  1KXL A;  3S14 H;  1G51 A;  4KHP L;  5C4X H;  2VQE Q;  1FJG L;  4IOC A;  1PH9 A;  2UUA L;  3J80 i;  1HZ9 A;  1I94 L;  1VQ9 A;  4B3R L;  1HNW Q;  1N36 Q;  3F1Z A;  4LF4 L;  1KC8 C;  1Y1V G;  3GTJ H;  3GO5 A;  2I5M X;  4DR7 L;  3KF8 B;  1YJN A;  4QY7 A;  1SRO A;  3BJU A;  1PH1 A;  3FKI H;  3AFQ A;  1C0A A;  1GD7 A;  1N34 Q;  1N9W A;  2VQE L;  4A3G G;  1K3R A;  3W1G A;  2K14 A;  1OXU A;  2I0Q A;  4AYB E;  3AEV A;  1V1Q A;  4A93 H;  2OTL A;  2A1A A;  5C44 H;  4DAY B;  1X56 A;  4YCV A;  5IY0 A;  1ASZ A;  5C0X G;  2UU9 L;  2I5L X;  3RLO A;  2V1C C;  4LFA L;  3UE1 A;  5C0X I;  1L1O A;  1YZ6 A;  1PA6 A;  1BBW A;  2K5N A;  1YI2 A;  1EOV A;  2ES2 A;  1J5E Q;  1IYJ B;  1X55 A;  1YNX A;  3KOJ A;  4H02 A;  2N8N A;  4JOI C;  4R4Q A;  5E7N A;  1NE3 A;  4P73 A;  1J5E L;  3PV0 A;  1VQ7 A;  4IFD J;  4OWW B;  1EWI A;  2R92 G;  1LYL A;  5H1S E;  5IYB H;  4X6A H;  3I7F A;  3S15 H;  2XGT A;  3E9H A;  3H3V H;  2WAQ E;  2VZA A;  3PO3 H;  3HOY H;  1UE1 A;  3H15 A;  1PH4 A;  2PI2 E;  1VQJ A;  2GVB A;  2KHJ A;  3PUZ A;  5IP7 H;  2R7D A;  4HJA A;  3Q8D A;  3S1M H;  4DR4 Q;  4LF6 L;  2R7Z H;  4DR6 Q;  1D7Q A;  5BR8 Q;  1TWF H;  4A3L H;  3H0G G;  3CPW A;  5HY6 A;  1V43 A;  3U4V A;  3W1B A;  3MEF A;  1O7I A;  5HGQ A;  3I55 A;  4LF9 L;  3T1Y Q;  4DR4 L;  4DR6 L;  5IP9 G;  4C3I H;  4YWK A;  2CFM A;  5BR8 L;  3AYH B;  5IYD G;  2JEB I;  4JC0 A;  4A3D G;  4AQY L;  4LF8 Q;  3TS2 A;  4DKA C;  3PUY A;  4DV6 Q;  4X64 L;  3CME A;  3T1Y L;  4LW1 A;  2EQS A;  2A8V A;  2JA6 H;  1VQL A;  4A75 A;  1U0L A;  3NEN A;  1X3F A;  3KF6 B;  1Y14 B;  3FP9 A;  1IBL Q;  4JI7 Q;  1K8G A;  2D0O A;  2NN6 G;  5M5Y H;  3I4M H;  4A76 A;  4Y52 H;  3HKZ G;  1XMQ Q;  5EAY A;  4JOI A;  4LF8 L;  1A62 A;  2H5X A;  3J81 c;  4UP7 A;  2NN6 I;  4DV6 L;  2C35 B;  2WB1 E;  3MXN B;  2NVT H;  2IX0 A;  3M4O H;  3F8T A;  1IBL L;  4JI7 L;  5JJI A;  2EIF A;  1T9H A;  1X9N A;  5C3E H;  3WWV A;  1XMQ L;  4JI4 Q;  3CD6 A;  4GNX B;  1Y1W H;  4JI6 Q;  2LSS A;  1KIX A;  4A3E G;  4HIK A;  3G48 A;  4DV0 Q;  1IBK Q;  4JI5 Q;  1R9T H;  1SLJ A;  4IJL A;  4AIM A;  4IFD G;  4WJ3 M;  3HOV G;  5JJK A;  2E2I H;  4BXX G;  1VQB A;  4DV7 Q;  4JI4 L;  4JI6 L;  1OXV A;  4HJ9 A;  1HR0 L;  3K7U C;  4IFD I;  3CXC A;  1VQP A;  1WOC A;  5FLX c;  5GAG C;  4DV0 L;  2WFW A;  2JK8 A;  1IBK L;  1N33 L;  2VW9 A;  1ASY A;  4OX9 Q;  2ID0 A;  4P72 A;  2CCZ A;  1E3P A;  3HKS A;  5C0X J;  4LUZ A;  4LFB Q;  1Y1V H;  3LGJ A;  4JI8 L;  3TRZ A;  4JYA Q;  2AWN A;  3CW2 C;  4TQU S;  4JI0 L;  2F52 A;  4OWT B;  3DM3 A;  4B3S L;  1PH2 A;  2EXD A;  1FGU A;  4A3G H;  2AWO A;  4OX9 L;  2NVQ H;  3L7Z C;  3K8A A;  2E8G A;  4DR3 Q;  1CSP A;  1M1K C;  3RNU A;  3ERS X;  4PZ7 A;  3CCS A;  1K83 H;  1VQ4 A;  4DUZ Q;  4QQB X;  4KHZ A;  2K50 A;  3U4Z A;  2PQA B;  3AFP A;  3ER0 A;  3UDG A;  3PUW A;  2AMC B;  4R4T A;  1VCI A;  2PMZ E;  4BY7 G;  2Y0S G;  4DR3 L;  1CSQ A;  3CCJ A;  4NXN Q;  1A0I A;  1HNX Q;  4DUZ L;  4DV3 Q;  1W3S A;  4KHP Q;  1FJG Q;  4YWL A;  1JMC A;  3BU2 A;  3CCU A;  1E22 A;  5LMN Q;  2ATW A;  4B3R Q;  5JJL A;  3CC2 A;  4P75 A;  4LF4 Q;  4TVA B;  2MFI A;  1FL0 A;  4MNO A;  1EIF A;  3RLN A;  1HNX L;  4PZ8 A;  4PZ6 A;  1GO3 E;  2RHQ B;  1WFQ A;  4AYB G;  4DK6 C;  4DV3 L;  1UWV A;  1E24 A;  3GTK H;  1EQQ A;  1XNQ Q;  4HIO A;  2R92 H;  5LMN L;  1UE5 A;  1H95 A;  3G4S A;  2A19 A;  3KF6 A;  1DGS A;  1S3O A;  3RLF A;  2AHO B;  2VY3 A;  3K80 C;  2UU9 Q;  3HOW G;  3ULP A;  2R93 G;  3OYY A;  1XNQ L;  4LFA Q;  2XTI A;  2RF4 A;  2N78 A;  3KLW A;  4PG3 A;  1L0W A;  3H0G H;  2HIX A;  1RIP A;  1C9O A;  3FHW A;  1MJC A;  1YVC A;  5M3M G;  3RN2 A;  1PH3 A;  1GVP A;  2GVA A;  3D0F A;  5M5X H;  2JA9 A;  1K8A C;  5IP9 H;  1VQM A;  3PO2 G;  1TXY A;  3T1H L;  1PH5 A;  4GOP B;  4EX5 A;  4BBR G;  5IYD H;  1MKH A;  1SRU A;  3D31 A;  1VQA A;  4X65 Q;  1PHJ A;  4QGU A;  4A3F G;  3M4P A;  1N32 L;  4LNQ A;  1Q81 C;  2Z0S A;  2WAQ G;  1EYG A;  3TRE A;  4R4O A;  4NPS A;  4X65 L;  1EIY B;  2B63 G;  4DV2 Q;  3CCM A;  1KRS A;  4LF6 Q;  1EUJ A;  2YYZ A;  3PUX A;  3S24 A;  5GAD C;  1KQS A;  2YU9 H;  4MZ9 A;  1XPU A;  1I5F A;  4J15 A;  1FVI A;  2WP8 J;  1HNZ L;  3E0E A;  1EFW A;  2R6G A;  3PF4 A;  4LF9 Q;  2UXC L;  4DV2 L;  4A3E H;  1AE3 A;  2Q2H A;  4GN4 B;  1IL2 A;  1JE5 A;  2JA5 G;  4DV4 Q;  3TEH B;  2UUB Q;  4GS3 A;  2IX1 A;  1EQR A;  2CKZ B;  4JBW A;  4GOP C;  4AQY Q;  2JA8 G;  3EIV A;  3HOV H;  4BXX H;  3KYH C;  4NB3 A;  4A3J G;  2VNU D;  3KDF B;  2YTY A;  1X3G A;  2QEX A;  5GRO A;  4X64 Q;  4UPA A;  3CC7 A;  4YHH Q;  5LMU L;  2YV5 A;  4UY8 C;  3K0X A;  1VS0 A;  4P74 A;  2HHH Q;  1BVS A;  2Z6K C;  4DV4 L;  1VQC A;  2VS1 A;  4X66 L;  2UUB L;  1QUQ B;  1CKN B;  5AJ3 L;  3NEL A;  2WB1 G;  1PV4 A;  4DK3 C;  3DLL A;  3AQQ A;  4OO1 G;  1VQE A;  3TQY A;  1GKH A;  3OW2 A;  1Q7Y C;  4YHH L;  3A74 A;  1XPO A;  2HHH L;  4OO1 I;  3EN2 A;  2NZH A;  4HJ7 A;  2E2H H;  3HOZ G;  2CQO A;  1VQG A;  2L15 A;  2UXB L;  2ZJP A;  4LFC Q;  4GN3 B;  1K9M C;  3CQZ H;  1Q1B A;  4C3H H;  1HJP A;  4MTN A;  1QVC A;  1XPR A;  2HQL A;  4BY7 H;  4C2M H;  4BBS G;  4A3B G;  3K81 C;  1HR0 Q;  1NJI C;  4DR2 Q;  4LFC L;  3GTP H;  5IYC G;  3J81 i;  4DV5 Q;  3JAM c;  2IHE A;  3OTO L;  3F2D A;  1XMO L;  4A3M G;  3BZK A;  2OWO A;  1N33 Q;  1QVF A;  2AKW B;  3A0J A;  1PYS B;  4POG A;  3CCL A;  3NBH B;  5ELN A;  4RMF A;  3A5Z B;  2DUD A;  1W2B A;  4DR2 L;  4JI8 Q;  4GOP A;  4DV5 L;  3U58 A;  4JI0 Q;  2K4K A;  4B3S Q;  4GKK L;  4DPG A;  2KBN A;  5FLM G;  2ZTC A;  3PUV A;  2Z6K A;  5J3B A;  2GN5 A;  3M85 A;  4OWX B;  1KRT A;  4DV1 Q;  1VQN A;  3HOW H;  3I4N G;  3GD7 A;  2R93 H;  3HOU G;  1L1O B;  2ZM6 L;  4OXP A;  4IPC A;  1KHI A;  4DR1 L;  2LXK A;  4GNX C;  2F3I A;  4JI2 Q;  3STB C;  1WI5 A;  4BY1 G;  4O0A A;  1Z47 A;  3SGI A;  5M3M H;  1TWG H;  3L0O A;  1HZB A;  2BH8 A;  5C4J H;  3CMA A;  4DV1 L;  1NMG A;  1X65 A;  4IO9 A;  2E5L L;  1TWA H;  4GLX A;  1IZ6 A;  3S2D H;  4O2D A;  3PO2 H;  3KFU A;  1S40 A;  4JI2 L;  2VUM G;  4BBR H;  1S72 A;  5IE8 A;  4BA1 I;  2UUC Q;  4JI1 L;  1PFS A;  1SN8 A;  3KDF A;  3M4Q A;  3E9I A;  4A3F H;  1YJW A;  3KJP A;  5M3F G;  3K7A H;  4R1J A;  3I2Z A;  1QUQ A;  4IPD A;  3PIP A;  5LMN W;  1VQK A;  1XTD A;  2UUC L;  2B63 H;  4EQ5 A;  4LF5 Q;  3RZD H;  3RR5 A;  1B7Y B;  2I5H A;  2MO0 A;  3U50 C;  3ICE A;  2B29 A;  3I56 A;  1IBM L;  3CPF A;  1WCM G;  4JG2 A;  2N3S A;  2F4V Q;  2JEA I;  1VQO A;  2QA4 A;  3GTO H;  1Q1E A;  3GDE A;  4A3K G;  4LF5 L;  4POF A;  4AH6 A;  2ZTD A;  3M3Y H;  3S17 H;  3S1N H;  1KL9 A;  1SMX A;  2BA1 A;  2KEN A;  3J80 c;  3T1H Q;  1U5K A;  3S1R H;  4JBJ A;  1MJE A;  2JA5 H;  2JA7 G;  4A3C G;  2F4V L;  5FJ8 G;  2JA8 H;  2ZJR A;  4A3J H;  4UP9 A;  4GNX A;  5IT9 c;  3HOX G;  4R4C A;  1N32 Q;  1X54 A;  3GTM H;  3A5U A;  4JI3 L;  1VQF A;  1QZG A;  1Q12 A;  4A3D H;  4ALP A;  4A3I G;  1Q46 A;  1JJC B;  2ASB A;  4LUO A;  4YCU A;  4PMW A;  2IT1 A;  1RL2 A;  1NMF A;  3HFZ B;  5JEA G;  4B3M Q;  1NY4 A;  2HT1 A;  3J7A 5;  4JCV E;  1KD1 C;  1HNW L;  1N36 L;  1HNZ Q;  3L2P A;  2UXC Q;  2K52 A;  3HOZ H;  2YTX A;  2JE6 I;  3F2B A;  2CWA A;  1GM5 A;  1PH8 A;  5K36 G;  1N8R C;  2HIV A;  1TWH H;  1X3E A;  2PNH A;  1QZH A;  4IOA A;  1N34 L;  4HJ8 A;  4B3M L;  1P16 A;  4YWM A;  1LM0 A;  2K5H A;  3IRB A;  4APV A;  4BBS H;  4FDB A;  4GLV B;  4A3B H;  4GLA C;  2KCT A;  3CCE A;  5IYC H;  5LMU Q;  1G6P A;  4DUY Q;  3UDX A;  1E1O A;  4A3M H;  2PQA A;  4X66 Q;  2IHF A;  1CUK A;  5AJ3 Q;  3RN5 A;  1BKB A;  3M9B A;  1JB7 A;  5GQO A;  1BBU A;  4L5S A;  3M7N A;  1CKM A;  1VQ5 A;  4DUY L;  4X62 Q;  2ZTE A;  1VQI A;  3JC6 6;  2JJQ A;  1JJ2 A;  3S2H H;  5C4X G;  3GTG H;  1JJG A;  1YJ9 A;  5FLM H;  1Z9F A;  3GTL H;  4A4I A;  1MIU A;  2UXB Q;  4GKJ Q;  1JT8 A;  1HH2 P;  4P71 A;  3W5O A;  2OQK A;  2ZJQ A;  3FKI G;  2VL6 A;  4X62 L;  2Q2T A;  4JV5 Q;  1A63 A;  4LF7 Q;  4YY3 Q;  3I4N H;  3PCO B;  2KCM A;  3HOU H;  1UEB A;  2QGQ A;  5ELO A;  3S16 H;  4A93 G;  1IXR A;  2OTJ A;  5C44 G;  4GKJ L;  2NZO A;  4BY1 H;  1XJV A;  3NEM A;  3OTO Q;  1PH6 A;  1XMO Q;  3CCQ A;  4K0K Q;  4HJ5 A;  4JV5 L;  3RZO H;  4LF7 L;  4YY3 L;  4ME3 A;  2PI2 A;  4OON A;  3CCV A;  1TWC H;  1B8A A;  1Q82 C;  1YIJ A;  2YTV A;  1LTL A;  1OXS C;  2VUM H;  1VQ6 A;  2IY5 B;  4QJF A;  1I6H H;  1WJJ A;  4GKK Q;  3CF5 A;  4K0K L;  1HR0 W;  5GAH C;  4L5Q A;  1I50 H;  3G71 A;  1V9P A;  1SE8 A;  5M3F H;  4BA2 I;  3ULL A;  1IBM Q;  1SR3 A;  2NVY H;  3S1Q H;  2OQ0 A;  1YHQ A;  1C7Y A;  1YBY A;  4YCW A;  1A8V A;  4DNI A;  1G29 1;  4UP8 A;  2K5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...