4DR5L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr5L00
1K3RA 4NXNQ 4P72A 1HNZL 3CMEA 2UXBL 3KYHC 2V1CC 2HT1A 1O7IA 3E9HA 4HJ9A 4GKJQ 4DR5L 2BA1A 4O2DA 3WWVA 2B3GA 1HNWQ 1VQHA 3K81C 2PMZE 3J80c 1AH9A 2EIFA 2AMCB 3F2DA 1VQ4A 1MKHA 2MO0A 1J6QA 5AJ3L 2KBNA 5M5WH 3STBC 1CKOA 5C4XG 1QUQA 4DUZQ 2AWOA 2YV5A 4JBJA 3I56A 4X65L 4AYBE 1BVSA 4DV0L 4DR1L 3RNUA 1Q1EA 1WOCA 2VQFL 1B70B 5LMUQ 1JJGA 4LF7L 5IP9H 3TQYA 2XGTA 4P75A 4B3TL 1K83H 1MJCA 4YCUA 1VQ5A 5JJIA 1VQOA 3K7UC 2Q2UA 2IY5B 5C3EH 4H02A 4GLXA 1KHIA 5C3EG 2IT1A 4APVA 1QVGA 1N33Q 1K0RA 4OO1G 5JJKA 1X3GA 3D0FA 2Z0SA 1PH6A 2UXBQ 2K14A 1I5FA 3EN2A 1HH2P 5GQOA 4LWCA 2RHSB 1XMOL 3HKZG 2GVAA 1VQLA 2MO1A 4JV5L 1E24A 4DR5Q 3HKSA 4BBRG 1HZCA 1LUZA 1X54A 2N49A 3S1RH 1YHAA 1V9PA 2Q2IA 4R4OA 1L0WA 1PA6A 4LF4L 4BY7G 2WB1G 3CP0A 3FKIH 3GTPH 3FKIG 2VNUD 1A63A 5AJ3Q 3AQQA 4DV6L 3EIVA 4JI3L 3UDFA 3CCLA 2R93H 4LUVA 3NENA 2CKZB 4X65Q 1Q8KA 1YEZA 2OCEA 4DUYL 4DR1Q 1BBUA 3HOXH 2VQFQ 2R92H 1SRUA 2R92G 2IX0A 5IYBG 2ZJQA 1NY4A 1R9TH 2H5XA 4LF7Q 1VQEA 1HJPA 3BZCA 4B3TQ 4JI6L 3PUYA 1JJ2A 3E0EA 1JE5A 3A0JA 2Y0SG 1KIXA 1NBWA 1SMXA 2K75A 4R4CA 1X3EA 2R7DA 1YHBA 4IPGA 1YHQA 3RLNA 1Y1VH 1Y1WG 4IFDJ 4HIDA 4OWXB 1XMQQ 1JB7A 4A3EH 1VQ8A 2UU9L 3TS0A 2FXQA 1A62A 1V43A 3F2BA 4HJ5A 4TVAB 1E1TA 4A3EG 1XMOQ 4JV5Q 3Q8DA 3J81j 3CCQA 4JI4Q 2AKWB 3PCOB 2RHQB 4LF4Q 1WI5A 2K52A 3U58A 4LFAL 1T9HA 1VQIA 3KDFA 2PQAA 4QGUA 4DV6Q 5M5XH 5GAEC 2Q2HA 3PO2G 1V1QA 1QVCA 1UWVA 2WAQE 4JI3Q 3OTOQ 1QUQB 1PH4A 1KD1C 2E2IH 3ICEA 2MQHA 4GN3B 3CCRA 5IYCH 4DUYQ 1OXTA 4POGA 3RR5A 3K80C 2UXDL 3I4MH 3CF5A 3S1MH 3ULLA 4DR6L 3RLOA 1OXXK 4XTCS 1YIJA 4R1JA 1W2BA 1L1OC 1N8RC 1EQRA 4L5TA 3M4OH 4BY7H 2NN6G 2Q2TA 5BR8L 4HIMA 2YTYA 4JI6Q 4C3HH 4UY8C 4UP7A 4GOPA 4IFDG 1M90C 4OX9Q 4J15A 3GTGH 1NJIC 4MTNA 5C44H 5C44G 3G71A 2EXDA 3L2PA 3S1NH 3CC4A 3M3YH 3LGJA 2ZJRA 1X65A 3A5ZB 4JI8L 5M3FH 2WB1E 2JA9A 2ZM6L 3ER0A 4BA2I 4QY7A 4LFAQ 4A3CG 4PZ7A 4JI7L 5JJLA 4X62L 3CCEA 2N8NA 1PYSB 1N34Q 1EFWA 5IT9c 4HJAA 5FJ8H 1AE3A 5FJ8G 2UXCL 1NMFA 4O0AA 1PH2A 2KCTA 4LUOA 1SFOH 1SROA 4POFA 4R4TA 1B7YB 1YJ9A 2UUBL 4DR6Q 1KC8C 4DV1L 1PH7A 1WFQA 1PFSA 3I4NG 3JC66 1GKHA 1KRSA 5IWAL 2Y0SE 5BR8Q 4A3DG 4A3DH 4LFCL 1VQCA 4Y7NH 4DAYB 3UDXA 3CD6A 2AHOB 1GD7A 3CCUA 1OXSC 4BY1H 1EIFA 3GD7A 4BY1G 1VQGA 1VQKA 3H0GG 4IJLA 5FLXc 1XNRL 1TWGH 2I5LX 3CCMA 4GNXC 3PGZA 2QA4A 2NVTH 1HNXL 4YWLA 1K8AC 1EUJA 1JJCB 4JI8Q 1ASYA 2E2HH 3L0OA 2ZM6Q 5GROA 5C4XH 4A3IG 4JI7Q 4R4IA 4IPCA 4YY3Q 3CCJA 4X62Q 5E7NA 3KDFB 1A0IA 2PQAB 4DR3L 4A3GH 4OWTB 4A3GG 1PH1A 1MIUA 2YTVA 2UXCQ 2ZTDA 3I55A 4JI2L 3CC2A 3ZJYC 2UUBQ 2K50A 4PZ8A 1EOVA 4KHZA 4X66Q 1XPUA 3NBHB 5DLQE 2ID0A 5IWAQ 3AYHB 2LXKA 1NE3A 1LTLA 2ZTCA 4IO9A 4LFCQ 3S1QH 3OYYA 2QEXA 3MXNB 5HGQA 2I5MX 3K8AA 1K9MC 3T1HL 1I94L 1A8VA 4LF9L 1HNZQ 2VUMG 4LW1A 4P74A 2KCMA 4NB3A 3H3VI 4BBRH 3K7AH 3CXCA 1VQ7A 2JK8A 1CSQA 1HNXQ 5IP7H 4UPAA 5LMNL 5IP7G 4PMWA 1M1KC 4GLVB 3HOYG 2I5HA 2JA6G 1QZHA 1FL0A 4A3KG 3A74A 3S15H 3ERSX 2N3SA 3I2ZA 1IBLL 2GVBA 3RN5A 5K36G 3KOJA 1TWHH 2ASBA 1SN8A 5GADC 4DV0Q 1VQJA 2KHJA 4AQYL 5IYBH 3DLLA 1GVPA 1VQ9A 4WJ4A 1NTGA 3H3VH 1CUKA 2NZOA 4JI0L 3S14H 1TWCH 4A3MG 2Z6KC 1TXYA 3CMAA 1GO3E 1PH8A 3PIPA 4DR4L 1TWAH 3H15A 1EQQA 3PIOA 2F4VL 2F52A 1BBWA 2DUDA 3IRBA 1L2FA 3T1HQ 1Y1WH 1I94Q 4LF9Q 1EYGA 4DV5L 1HR0L 4QQBX 4YCVA 1G291 4HJ7A 4A93H 4HIKA 4GKKL 4A93G 1SE8A 2R7FA 1CKNA 1HZ9A 5EAYA 2NN6I 1RL2A 4JOIC 5LMNQ 5FLMG 1UE5A 2VY3A 3B6YA 4MNOA 4IFDI 3W1GA 1G51A 1VQAA 1YI2A 3PO2H 1IBLQ 1K73C 1Z47A 2UUCL 5C0XJ 5GAHC 1VQNA 4C3JH 4B3RL 2NVYH 4JI0Q 1TWFH 4A3JG 1X6OA 1N9WA 4LF8L 4HIOA 1H95A 1PH3A 4P73A 3JAMi 5JEAJ 3K0XA 2ES2A 4IPDA 3DM3A 3G6EA 4BA1I 2F4VQ 2ZTEA 4C3IH 3S17H 2R7ZH 2RF4A 4EQ5A 2WP8J 3HKZE 4IPHA 2R7ZG 4Y52H 4DV5Q 1HR0Q 2NVXH 1IXRA 2UU9Q 3HOZH 3PUZA 3GTLH 3HOZG 3I7FA 1Q81C 1AE2A 3CPFA 4JCVE 3AFQA 4DNIA 4JBWA 2JA5H 1PVOA 2JA5G 4LF5L 3KF6A 1VQFA 4A3CH 2UUAL 3PV0A 3S2HH 5C0XG 1CSPA 2I0QA 3G48A 3J7ZC 3CCVA 4DV3L 4JBKA 4LFBL 5LMNW 4L5RC 3KLWA 3F8TA 2NZHA 3W5OA 2UUCQ 1VS0A 2D0OA 3HFZB 4B3SL 2ALYB 4JBMA 2JA8G 2JA8H 1KAWA 4A75A 3TEHB 4PZ6A 3HOWH 2UXDQ 3OW2A 1L1OA 1WCMG 2C35B 3BZKA 1YNXA 4JC0A 1VQ6A 1E22A 3HOWG 1SR3A 4B3RQ 4X64L 5IYDH 2GN5A 5IYDG 3I4NH 4A3LG 3PUWA 4LNQA 5JEAG 4ME3A 4RG1A 2JQOA 3PUXA 2N78A 3J81c 4OWWB 4PG3A 1UE7A 1IBML 2JA7H 4LF8Q 2JA7G 1B8AA 1X56A 2KENA 3F1ZA 4KLKA 3M4QA 1K8GA 4LUZA 1CKMA 3J80i 2OTJA 2B29A 2OTLA 3H0GH 4DUZL 1Q46A 1VQBA 4MZ9A 1N36L 2LSSA 4JI1L 3T1YL 2A1AA 1IBKL 3A5UA 4RMFA 2E2JH 1C0AA 1S40A 1C7YA 3PO3H 1I50H 1SLJA 5GAGC 3PO3G 3UDGA 1HR0W 4LF5Q 1CKNB 2QGQA 4A3IH 3CW2C 2PNHA 4R4QA 4JG2A 4OO1I 3NEMA 4OXPA 2K5NA 3S24A 4DV3Q 2PI2A 5H1SE 4LFBQ 3TREA 3MEFA 4B3SQ 1N33L 3CQZH 1VQDA 1IZ6A 3PSIA 4AIMA 1OXUA 1KXLA 1IL2A 3S16H 1X3FA 1XPOA 2DGYA 3KJPA 1QZGA 3CC7A 3F2CA 4X64Q 4DV1Q 4JI5L 2YTXA 4TQUS 2KHIA 5M5YH 2CQOA 4L5SA 1D7QA 1P8LA 1Y14B 1BKBA 3D31A 4YHHL 1IBMQ 4A3BH 1U0LA 1D8LA 3M85A 4A3BG 1X9NA 2HHHL 2LXJA 2PI2E 3M9BA 1JMCA 1G6PA 1YZ6A 4GOPB 2VUMH 4GNXA 4DV4L 3KJOA 2BH8A 2HQLA 1Q86C 1XNRQ 1UE6A 1N36Q 3J7A5 4JI1Q 3T1YQ 4B3ML 1X55A 1IBKQ 4DKAC 2WAQG 1KRTA 3UDIA 2K5VA 3BJUA 1XJVA 2VZAA 2MNAA 3HOYH 4DR7L 1S3OA 1UEBA 1Z9FA 1LYLA 5ELNA 5J3BA 2JA6H 2IX1A 3U4ZA 1QVFA 3CAMA 4A3KH 3KF6B 2VL6A 5IP9G 4K0KL 4DAMA 3RZOH 2HIVA 3E9IA 4DR3Q 4IOAA 2OQKA 1PHJA 3HOVH 2IHFA 4NPSA 3HOVG 1I3QH 2OQ0A 3GTOH 2JEAI 4X6AH 4XIGS 4JI2Q 2A19A 3CPWA 1FJGL 4EX5A 2K5HA 5C4JH 2VW9A 3AEVA 3TS2A 1L1OB 4OONA 1XMQL 1E3PA 4A3MH 4C2MH 1YBYA 2WFWA 4JI5Q 3KFUA 4IOCA 4DR2L 3KF8B 4YCWA 4UP9A 4DK6C 4JI4L 2ATWA 4DV2L 3I4OA 4YHHQ 1KQSA 2NVQH 3GO5A 1KL9A 2HHHQ 2AWNA 1Q1BA 1PYBA 2EQSA 2D62A 3PUVA 3GTMH 5IE8A 4DV4Q 4GS3A 1UE1A 3OTOL 2R93G 1VCIA 1PH5A 4B3MQ 2E8GA 1IYJB 3FP9A 4WJ3M 2OWOA 3M7NA 3HOXG 1RIPA 1YJWA 4DR7Q 5FLMH 4LF6L 3EBEA 1EWIA 4FDBA 2JJQA 1W3SA 1S72A 3PF4A 1DGSA 3RN2A 4DPGA 2L15A 4K0KQ 4YWMA 1LM0A 1WYDA 3GTJH 1VQPA 2B63H 3GTKH 2B63G 1OXVA 1FVIA 4KHPL 3M4PA 1Q7YC 4AQYQ 3W1BA 4OX9L 1XNQL 1HZAA 4GOPC 1VQMA 1PV4A 3RLFA 3ULJA 1FJGQ 1U5KA 1Y1VG 2K4KA 2Z6KA 4A3JH 4A76A 4YWKA 4P71A 3L7ZC 2HIXA 5C0XI 4DK3C 4DR2Q 3GTQH 2ZJPA 1PH9A 4DR4Q 5HY6A 2E5LL 4DV2Q 1XTDA 4DV7L 4JYAL 3TRZA 5ELOA 4NXML 4A3FH 4QIWE 4UP8A 4KI0A 4A3FG 1OTCA 1N34L 2CCZA 1EIYB 4GNXB 2XTIA 3HOUH 4JOIA 2CFMA 4AYBG 3G4SA 3HOUG 4GKKQ 5IYCG 2BH2A 1I6HH 2D0PA 3ULPA 1N32L 3I4MG 1HZBA 3U4VA 4BXXH 4BXXG 4LF6Q 4ALPA 1NMGA 2MFIA 1J5EL 1YITA 2JEBI 3NELA 1FGUA 3UE1A 4AH6A 2VQEL 2A8VA 3J81i 3RZDH 4QJFA 3FHWA 4KHPQ 1WCMH 4NXNL 1XNQQ 1E1OA 1XPRA 4A3LH 4HJ8A 4GN5A 1YJNA 2YYZA 4BBSH 4GKJL 4BBSG 2RCNA 5M3MH 2CWAA 5M3MG 5IY0A 2CWPA 3JAMc 1HNWL 3GDEA 5M3FG 1GM5A 2E5LQ 4DV7Q 4JYAQ 1MJEA 3PF5A 2R6GA 4YY3L 4A4IA 4NXMQ 2IHEA 4QL5A 1E7ZA 1P16A 2F3IA 4L5QA 4GN4B 4GLAC 1Q82C 3AFPA 1JT8A 2VS1A 5LMUL 2BA0A 3VDYA 1N32Q 1C9OA 2YU9H 3STBD 2UUAQ 1J5EQ 4X66L 4IJHA 3U50C 3SGIA 3UE0A 3BU2A 1ASZA 2VQEQ 3S2DH 1WJJA 2JE6I 3CCSA 1YVCA 1Q12A
chains in the Genus database with same CATH superfamily
4P72A 2RSNA 2SNSA 1HNZL 3VYUA 1EWCA 4UDUC 1IHZA 3WWVA 1GXDC 1XX8A 3K81C 2Z4IA 3J80c 1AH9A 3TBIB 4DU9A 2AMCB 1CI3M 3S15B 1J6QA 1CKOA 1TWHB 2YV5A 4JBJA 2MUYA 3I56A 1BVSA 4TKOB 4DR1L 2CQAA 2G9DA 2WKDA 5LMUQ 2F0KA 3J81L 1WTQA 5DM73 4M1UB 4U68A 1SNCA 3TQYA 2XGTA 5IODA 4B3TL 3J7YW 4YCUA 1MJCA 5JJIA 1GUSA 1RTOA 1F9QA 2HDMA 4DGZA 5C3EH 5C3EG 2IT1A 4OO1G 2Z0SA 3EN2A 1Y8PB 4JV5L 1DM0B 1LTAD 3HKZG 3BVZA 1MI2A 4RCNA 2IWHA 4BBRG 4R4OA 4HN7A 3DM1A 2PW7A 5FLXE 1EY4A 3I70A 2R93H 3R8BA 1SNOA 1EU4A 1TR5A 2IX0A 1NY4A 1R9TH 1HJPA 3PUYA 1D1IA 1CHPD 1TIID 2LKVA 1SMXA 2K75A 4R4CA 2R7DA 1Y1WG 1RJTA 3HOZB 2RQXA 2PZUA 1JB7A 1TKWB 3M4YA 1XMOQ 4HJ5A 3CCQA 3H3VC 2RHQB 3I4LA 3TP7A 4QGUA 3TDQA 3NXWA 1QVCA 4JI3Q 3OTOQ 3ICEA 4WJWA 2KA7A 3CCRA 3GV3A 5IYCH 1H9RA 1NR2A 4HAEA 3ULLA 4C3JG 2BE5C 1OXXK 3RLOA 3S1MH 4PMCA 1LTBD 4R1JA 3ND8A 4KKSA 1EQRA 5CV8A 3FPPA 3IKJA 2NN6H 2JA7B 2NN6G 2A6ED 4C3HH 3HEJA 4C3HG 4CBVA 3W3AA 3DWAA 1M90C 4OX9Q 2KCCA 4J15A 1PZJD 1B44D 1EY0A 1NJIC 5COYA 3BDLA 2EXDA 2K5DA 1ESRA 3ND9A 1PLFA 3LGJA 2ZJRA 5C5MA 5KNDA 1BQQT 1BBXC 3PO3B 5M3FH 3KLSX 4LFAQ 1HQMC 3D6WA 4BA2I 3J7AF 4TRDA 1N34Q 4EQNA 2X6LA 4O0AA 4LUOA 1YJ9A 2M2LA 1LT4D 1WTHA 4DV1L 2B2UA 2NYZD 1PFSA 5IWAL 4A3DH 3D4DA 4A3DG 1VQCA 1SAPA 1OXSC 1CZWA 4BY1H 1EIFA 4BY1G 2QW7A 2HCIA 1KLGD 3P20A 1RODA 1HNXL 2F0QA 4DF7A 2EYLA 5E1FA 3OWFA 5ELEA 4JI7Q 3OSOA 2IX3A 4YY3Q 4X62Q 2A69C 1GUOA 2PPBC 3TSSA 4A3GH 2F4IA 4OWTB 1CHQD 4A3GG 2KJXA 3GTOB 1MIUA 2ZTDA 1D5XC 2JXMB 3S14B 4C2MB 1HTPA 3A56A 3MXPA 2NVQB 4KJNA 2ZTCA 4LFCQ 2RSOA 4V190 2I5MX 1K9MC 1I94L 4NB3A 1GUWA 1ZYRC 2QDBA 3H3VI 4K6LA 2RDGA 2JK8A 5IP7H 5LMNL 4RAUC 4PMWA 5IP7G 2SOBA 3A8JE 4ODGA 3HOYG 2JA6G 4I65A 3C3LA 1NSNS 4A3KG 2EDGA 3S15H 1JE4A 4RFBA 1ONLA 2GVBA 5K36H 5EPLA 5K36G 1TWHH 2EYOA 1SN8A 2L55A 1LT5D 4FVMA 5C3WA 1VQJA 4AQYL 1TS4A 5IYBH 1VQ9A 1CUKA 4B9XA 4JI0L 1RF2D 3GTQB 3CMAA 1PH8A 1L0XB 1STYA 4ZKBB 1QILA 3GQBA 3A7LA 2X69A 1HR0L 4FF4A 3HOUB 1Q3LA 5BN3A 2NB0A 1SE8A 5ELDA 3S2HB 2PNRC 1NCVA 1UE5A 4DXGA 4MNOA 2XIWA 3W1GA 1WTRA 1IBLQ 1A15A 5C0XJ 1WCMB 1VQNA 5D14A 4BBSB 2TSSA 5M3MB 3BG3A 1N9WA 1H95A 5JEAJ 3DMUA 4IFDH 1PTOC 1WTVA 2L5TA 2RF4A 2WP8J 3HRZC 2UU9Q 3HOZH 1LV9A 3HOZG 3I7FA 1V8QA 1Q81C 3CPFA 3MTSA 4DK0A 4JBWA 2BOSA 5IGDA 4LF5L 3VYRA 4FF1A 2IL8A 4FP5D 4A3CH 5C0XH 5I2YA 5C0XG 1QB5D 1ZXTA 1A2TA 3W5OA 2NZHA 1VS0A 2F0FA 1YNJC 2ALYB 1KAWA 1E2ZA 1VF7A 5JOBA 3BZKA 3OW2A 1YNXA 1VQ6A 4B3RQ 1DOKA 2GN5A 3PUWA 5JEAH 4G57A 2RKSA 5JEAG 4ME3A 4RG1A 3J81c 1W6JA 2N78A 1SJHD 1UE7A 2JA7H 2OEOA 2JA7G 1PTOF 2SNMA 2B39A 3EFXD 3N6RA 1Q46A 1WTPA 4JI1L 3T1YL 4H0LC 3E6ZX 1V1PA 2E2JH 5EGTA 1S40A 1C7YA 3PO3H 3PO3G 2QGQA 1RCVD 1EZ8A 4OO1I 4FYDA 1ZYRD 2K5NA 3S24A 2PI2A 4XQQA 1HA5A 4B3SQ 1PMRA 2GA4B 1KXLA 3KJPA 4X64Q 2YTXA 2KHIA 1AW7A 2CQOA 1I4QA 1D7QA 1AFPA 2CHBD 5IGEA 2IJ0A 3FKIB 4YHHL 1H9KA 3NWSA 2HHHL 3M9BA 1I4RA 4GOPB 2HQLA 1XNRQ 4B3ML 3F2UA 1X55A 3BJUA 1D6EC 2VZAA 1S3OA 1Z9FA 4XYOA 1SBBB 4HEDA 4B9WA 3P75A 3OPOA 4ZRZA 5IP9G 2Y0SB 4HMIA 1KABA 1G6ZA 2ICIA 4DR3Q 5IGFA 1QWYA 1PHJA 5FLXL 2OQ0A 3GTOH 4JI2Q 5JAVA 1HPCA 4C2MH 2PQEA 3CRKC 4DR2L 2D5DA 1A3VA 4DV2L 3O13A 2NVQH 3GO5A 1Q1BA 2D62A 4PNYA 2KVMA 1RDPD 5IE8A 3T51B 1IYJB 3HOXG 1CA5A 1PRTC 5J39A 1EWIA 3U9SA 1S72A 3PF4A 4K0KQ 1DONA 3SDZA 1WYDA 1VQPA 5F2DA 4DNRB 1I4HA 1FVIA 3GTGB 3M4PA 4K2LA 1HZAA 3SK6A 1PV4A 1FJGQ 3S1NB 3M3YB 2AUKA 2F0HA 1Y1VG 4JVZA 3EJIA 4PV1C 3ONAB 5EKKA 5I9PA 5M9OA 1MGSA 2Q8RE 3SK4A 4KY6A 3GTQH 1YNJD 3J7AV 2BDNA 3SK5A 1SYFA 4NXML 1S5DD 1A3UA 1EIYB 1TS5A 1PFNA 1WD1A 3HOUH 2CFMA 3HOUG 1WVLA 4GKKQ 1PRTF 4FXKC 2D0PA 3ULPA 1N32L 3T53B 4BXXH 1HZBA 4BXXG 2H1EA 2MFIA 1J5EL 4KV6A 1EQVA 4Y7NB 1LTID 4ZK9B 2B2WC 5DM63 2L4NA 1VDZA 1S5ED 1WCMH 2HD3A 3MAQA 4NXNL 3SVMA 1E1OA 1BO0A 1XPRA 1Y8OB 1YJNA 4BBSH 2NVTB 4BBSG 5M3MH 2XVSA 4EQOA 1DCZA 5M3MG 2E2HB 4CDCC 1UNSA 2E5LQ 2CH4W 4DV7Q 4JYAQ 4A4IA 3SHLA 2NBFA 1G8ZD 2F0NA 4K5WA 1KDCA 5KNBA 5L37A 2LS01 1F77A 2NZ1D 2XNAC 1ENFA 3QR8A 2NUCA 3U50C 2L12A 3UE0A 2FFKB 1TS3A 3QWNA 2JE6I 1DD2A 1B2TA 1K3RA 2UXBL 3HKZB 2HT1A 1O7IA 4Q0FA 4BBRB 3K7AB 1QOHA 1HNWQ 4C1NK 2PMZE 1JWUD 2C5CA 1Z6HA 1MKHA 2MO0A 5NUCA 5AJ3L 4IURA 1QUQA 5D3IB 4X3SA 2FINB 1DOLA 4X65L 5JVG3 4AYBE 2PZTA 1Q1EA 4RHSA 1R9TB 4LF7L 1E2WA 2B2VC 1VQ5A 4H02A 1QVGA 1N33Q 1Y1WB 1PRTD 3WOEA 5CBEE 5JJKA 3VR6A 1RTNA 2KCNA 3DEOA 2ENBA 1HUMA 2GVAA 4LJZC 4KK7A 1HZCA 1X54A 1F9PA 1YHAA 1PA6A 2PW5A 1PTOB 3FKIH 3FKIG 2VNUD 3AQQA 3EIVA 4LUVA 2CKZB 4C3JB 2OCEA 3OMCA 4L8JA 4DUYL 4DR1Q 1BBUA 2NVYB 3K6OA 1F2MA 3K5NA 4X3TA 1SRUA 1ET9A 2DJGC 2LMCB 1ENCA 1VQEA 2QILA 3MXUA 3BZCA 4B3TQ 1JE5A 2A68C 2Y0SG 1KDBA 1HRJA 3QB3A 4MIUA 1X3EA 1YHBA 1YHQA 1LTRD 3RLNA 1CT1D 1AP0A 1XMQQ 3CCLA 5CYUA 1A62A 3F2BA 4JV5Q 4TVAB 3NTHA 3J81j 2AKWB 3PIP3 1WI5A 2K52A 3U58A 1T9HA 1G91A 2PQAA 4R9WA 3HP3A 2K01A 3PO2G 2QEJC 2WAQE 3NQTA 1QUQB 1HUNA 3K80C 2UXDL 3CF5A 3Q23A 4DR6L 4XTCS 1G2TA 3IFDA 1F2YA 3NBHA 3G7LA 5BR8L 4HIMA 3MXNA 4IUPA 1IKLA 4P2CB 1BCPB 1WTXA 1TU2B 3GTGH 5C44H 5C44G 3T16A 3S1NH 3CC4A 4PQXA 3L3OC 3M3YH 2L9HA 1I50B 4UHVA 4JI8L 2B8FA 2ZM6L 4J8QA 1PZKD 1EFWA 2A6EC 5FJ8H 5FJ8G 1NMFA 2KCTA 1KNEA 3GP7A 3T4AC 4WFN3 4DNTB 5E3FA 5FO8B 1PH7A 2B2WA 3JC66 3I4NG 4FXDA 4A3BB 1XWEA 4Y7NH 1GHKA 2F0GA 3CD6A 4QIWB 2F0TA 3GD7A 4IUTA 5FLXc 1K28A 4QUFA 4GNXC 2O2LD 2QA4A 2NVTH 2F0MA 2JA6B 3HOYB 4X3KA 2E2HH 4A3KB 4G7OC 2B8GA 1O7LA 3K5MA 4R4IA 2PQAB 3I8ZA 3GV6A 1D5ZC 1AEXA 1EL0A 4QUCA 4XQNA 3ZJYC 1J9OA 4PZ8A 3NPPA 2F0OA 1ESFA 4CJ1B 1XPUA 3NBHB 5DLQE 2ID0A 3MC0B 3LX0A 5IWAQ 1NE3A 4OO1H 4IO9A 3OYYA 2QEXA 4NW2A 3MXNB 3T1HL 1SJED 2VUMG 1K8OA 4LW1A 3M7GA 2KCMA 4BBRH 3K7AH 3CXCA 2O5IC 2A68D 4QF4A 1HNXQ 2J7ZA 3S9WA 2I5HA 3MZ5A 1QZHA 1KDAA 3ERSX 3A54A 4FF2A 4DV0Q 2KHJA 2MP1A 4ABNA 2B2TA 3SE0A 4FNFA 4TSSA 1NTGA 2TMPA 4N9PA 2B2VA 5TSSA 2Z6KC 1TXYA 3AU7A 3PIPA 1EQQA 3NWTA 1F9SA 4R8IA 1LLRD 2Q8IB 4A3FB 2F4VL 1Y1WH 1BBWA 2KECA 1I94Q 4QQBX 1QE6A 4YCVA 4HJ7A 1KNAA 2R7FA 5LMNQ 5EQ0A 5FLMG 1II3A 3B6YA 1PTOH 1Z47A 2UUCL 1PYWD 1STHA 4C3JH 2IW3A 4KN4C 2NVYH 4JI0Q 4DAPA 3MEHA 4A3JG 4IUQA 1X6OA 3D4WA 3NE5B 1DZ1A 3OHXC 4LF8L 2DY8A 1XTCD 4P73A 4EGVA 3DM3A 1JQYD 1XXGA 1TVXA 1F9RA 1CZGA 4IPHA 4Y52H 2E2JB 3CU7A 1HR0Q 2H4OA 3PUZA 4RKLA 3AFQA 2YU9B 1PVOA 1FGBD 1VQFA 5E4WC 1JB3A 1RKNA 3CKIB 3CCVA 2N88A 4LFBL 4HMJA 3HFZB 2D0OA 1ZEQX 1F2LA 4CKBA 2EYPA 2C35B 5IYDH 5IYDG 2WINB 5CV6A 2HDLA 1HHVA 3PUXA 1IBML 2DJFC 1BOSA 2EY2A 1B8AA 3F1ZA 4KLKA 3M4QA 4ZAIA 1CKMA 2OTJA 2B29A 5CV5A 4MZ9A 1N36L 1LTGD 1I4XA 1IBKL 1FR3A 4RMFA 1HXYD 1LT6D 2VB2X 1I50H 1SLJA 1SYBA 3E3XA 2Z1CA 4LF5Q 3NTIA 3CW2C 4R4QA 1K83B 1B3AA 4C1NI 1TS2A 3MEFA 1IZ6A 1OXUA 2DGYA 3NQIA 3CC7A 1HTLD 2Q8TA 3QG1A 4L5SA 1BKBA 2WB1B 1RHPA 4A3BH 1Y8NB 4A3BG 2F0JA 1X9NA 5IT9L 1JMCA 1LO5D 3RMHA 4GNXA 3FPUB 4DV4L 2RVLA 1ICWA 3J7A5 4JI1Q 3T1YQ 3HOXB 4DKAC 2WIIB 1KRTA 5FO7B 4BWGB 1XJVA 3C1EA 4DR7L 3HOYH 2JA6H 3D4RA 5ELNA 4F87A 1R4PB 1QVFA 2CVRA 4A3KH 2DY7A 2K05A 2VL6A 1ILPA 4DAMA 3E9IA 2HQEA 3HOVH 2LY7A 3HOVG 3A8KE 1Y1VB 4X6AH 2A19A 2Z4HA 3CPWA 3AEVA 2K5HA 4A3EB 4IUUA 3TP8A 1FD7D 3BDCA 1JWMD 2WFWA 3LWUA 3G6JB 5ELBA 4UP9A 4DK6C 3OWEB 3I4OA 4YHHQ 4LMQD 5LL6X 2HHHQ 4E6IA 5M5XB 3BS1A 4EQPA 5E4XA 2JP1A 2E2IB 1K3BC 3CRLC 3OTOL 4QCLA 4B3MQ 3NTKA 3PQIA 2OWOA 4WJ3M 3DWQA 4WRDA 4LF6L 1DJRD 2JJQA 1W3SA 1QCBD 1LM0A 2R61A 4FXGC 1OXVA 4KHPL 4OX9L 4RGMA 3W1BA 1D2BA 1U5KA 2Z6KA 4A76A 4NKLA 3C1FA 4DR2Q 4DK3C 1F2ZA 4DR4Q 4DV2Q 4K5VA 1I4PA 4KY5A 3TRZA 5KYIA 4A3FH 3KBXA 4MHEA 4A3FG 3FEWX 1OTCA 1N34L 1HQRD 4GNXB 1EZ6A 4OGQC 4L63B 4DA2A 1SFOB 3I4MG 3U4VA 1IW7C 2EXZA 1YITA 1S5BD 3NELA 4ZLTF 2VQEL 1EU3A 4UAIA 4QJFA 4ZYSA 3I90A 2WKCA 1TWGB 1H9SA 1SE2A 4KD3A 4HJ8A 4GKJL 3MVVA 2RCNA 1IL8A 2F0WA 4OELB 2KEDA 3GDEA 4Z9CB 1V1OA 3PF5A 2R6GA 4X3UA 4YY3L 4NXMQ 4QL5A 2F3IA 4L5QA 4GLAC 2Z8LA 4RGNA 1N32Q 2YU9H 1ICFB 3STBD 5D65A 2UUAQ 1J5EQ 1W6KA 3TN2A 3SGIA 3S1QB 2F3VA 3BU2A 4OIJA 3NEMA 1SNMA 4M8AA 1YVCA 4NXNQ 2BDOA 3KYHC 1B9NA 4IUVA 4DR5L 2BA1A 4O2DA 4K14A 1SNPA 1VQHA 1DXMA 1EY6A 4ZCKA 2F3WA 1IYVA 2EIFA 3F2DA 2F0VA 1STBA 2AQ2B 4KTAA 5C4XG 4DUZQ 2AWOA 5IGGA 2VQFL 4XYQA 3DWPA 1YNND 5IP9H 1STNA 2P5ZX 3DHQA 2EJMA 4P75A 1K83H 1VQOA 2EJFC 3K7UC 2Q2UA 4GLXA 2AUJD 3MFGA 4LK1C 3D3RA 1X3GA 3H91A 1PH6A 2FMCA 2UXBQ 2K14A 4ME5A 5GQOA 4LWCA 3K57A 3NUCA 1H9SB 1CQVA 1FNWA 5LL6S 3J81E 1QG7A 3HKSA 1V9PA 2Q2IA 4LF4L 2WB1G 3GTPH 3PO2B 3R2IA 5AJ3Q 4DV6L 5DEHA 1A63A 3SXHA 5A35A 3EQLC 4X65Q 1E2VA 4RKBA 4F8MA 3HOXH 1V1PB 3BVMA 2CW0C 2ZJQA 1TWFB 3VYSA 2H5XA 4LF7Q 1PDQA 2KOLA 4DAYA 2OXPA 4JI6L 1JJ2A 3E0EA 3A0JA 3BYTB 3HGBA 3S17B 1KIXA 5C44B 1SYEA 4IPGA 1IW7D 5FKAC 1Y1VH 1B1ZA 1VQ8A 2UU9L 3RD4A 4A3EH 4A3EG 1V43A 2JA5B 3Q8DA 4JI4Q 4ZUJA 2ZT9C 1VQIA 5CGKA 5M5XH 2Q2HA 2JA8B 1V1QA 1IYUA 1SEBD 1UWVA 1PH4A 2E2IH 2MQHA 3OIPA 2WACA 4DUYQ 1SNQA 1J8IA 3I4NB 1DYQA 1Z7TA 3MA2B 2EVBA 2Q2TA 2YTYA 4ZQ3A 5EJWA 1ZKOA 3DUZA 4UP7A 4NDXA 1EY8A 2XWBB 4C3IG 3G71A 5I6YA 4K8IA 1X65A 1KTKA 3A5ZB 2RDFA 3Q22A 4DAVA 1D5MC 4PZ7A 5JJLA 3CCEA 2RDHA 5IT9c 1M4VA 2IPKD 4OIKA 1AE3A 1Q8IA 2UXCL 3S16B 5JPMC 1X3QA 1SFOH 3EROA 4R4TA 1TQOA 2UUBL 4DR6Q 2EYHA 4CKEA 2Y0SE 4N8FA 4ULLA 5BR8Q 4ILWA 4DAYB 1S5FD 2VUMB 3UDXA 3OW7A 1I6VC 2AHOB 1GD7A 3CCUA 1X3PA 3H0GG 4IJLA 1XNRL 1TWGH 2I5LX 3PGZA 3I72A 1JJCB 4JI8Q 2MGSA 2E74C 3L0OA 2ZM6Q 4KD4A 5GROA 4A3IG 2EY1A 4IPCA 3VR4A 3CCJA 2QDLA 4DR3L 1A0IA 4DN4M 1I3QB 2JN4A 3D8GA 3OMGA 3I55A 4JI2L 2EYJA 4XQJA 3K58A 4GZYC 2Z9HA 2K50A 1U4MA 4KHZA 4X66Q 2O5JC 5K5PA 3AYHB 3S1QH 1VMCA 4QMGA 2D2CC 2CW0D 3K8AA 1A8VA 5DNFA 4LF9L 1HNZQ 4P74A 3T13A 4UPAA 5ELCA 4IN3A 4GLVB 1FL0A 4HSVA 4HSPA 2B63B 3GTKB 1X32A 4JK1C 3UI2A 2F0SA 3PMFA 4RA8A 1UEAB 4A3JB 3H3VH 1KAAA 3NP8A 1SE4A 1UAPA 2E2DC 4A3MG 1GO3E 2QKIC 1QJOA 3H15A 5KEEA 4O42A 1SNDA 2DUDA 3IRBA 3T1HQ 1L2FA 3EVQA 4DV5L 1BF4A 3A55A 1I6HB 4HIKA 4GKKL 1CKNA 1HZ9A 3RUZA 3EA6A 1RL2A 4JOIC 1SYCA 4IFDI 3PO2H 1YI2A 4MN3A 1PXUA 1K73C 5HGTA 1CFMA 1R4QB 3SR1A 1U4PA 2FJ2A 5LHY1 1UUPA 1WTWA 2K1BA 1TWFH 4G7HC 2K32A 3VA5A 3A8IE 4HIOA 4ID6A 3AB9A 2EYFA 1ENAA 3K59A 3G6EA 4BA1I 2F4VQ 3S17H 4B08A 1ML0D 3HKZE 4N9TA 4RGTA 3GTLH 4JCVE 3MFYA 4DNIA 2JA5H 2AQ1B 4PMBA 2JA5G 4K6DA 3PV0A 4DV3L 1BNZA 5LMNW 3K5LA 1SMYC 2JA8H 1EY5A 2UUCQ 4JBMA 2JA8G 3H09A 4PZ6A 3Q0AA 4H7BA 1M8AA 1E22A 1SR3A 2A6HC 3I4NH 3KF8A 4LNQA 4A3LG 1B50A 5KNCA 1GJXA 1GUGA 4LF8Q 1X56A 3BVGA 2OTLA 1VQBA 3TZUA 5GAGC 1HR0W 1CKNB 3P7JA 4JG2A 2KQ3A 4F88A 3NK9A 3HOVB 1U4LA 5H1SE 4LFBQ 3TREA 4CGYB 1TT2A 1N33L 1PRTB 1X3FA 3S16H 2EZVA 3F2CA 2ICEC 4JI5L 4DV1Q 4TQUS 3S1RB 4BY7B 1Y14B 3D31A 1JC7A 1IBMQ 1D8LA 2LXJA 2RA4A 3FDTA 2EOTA 1YZ6A 2VUMH 3BZDB 1Q86C 2ZXOA 5HURA 1N36Q 3FMCA 3JAME 1IBKQ 2WAQG 2K5VA 2R92B 2BCOA 2MNAA 5J3BA 1UEBA 3CAMA 5J22A 1ET6A 2C9OA 2HIVA 4G4KA 4IOAA 2IHFA 4KKUA 4IUNA 1I3QH 2JEAI 1BXTA 1HCZA 4R8NA 5BN4A 3TS2A 1SXTA 4OONA 4C56C 1XMQL 1E3PA 3KFUA 3I73A 4IOCA 4N8X1 3KF8B 2A74C 4YCWA 1T5EA 5I2XA 2ATWA 4KHVA 1KQSA 4CDEC 2AWNA 1EYAA 2EQSA 2JYOA 5CC4A 4FF3A 1EIHA 1NNXA 4DV4Q 1JWSD 2PCFB 4GS3A 1UE1A 2R93G 1CM9A 1VMPA 3FP9A 3I4MB 3J80E 1YJWA 4DR7Q 5FLMH 3NBIA 3EBEA 3M4OB 4CJ2C 1DGSA 2M00A 3RN2A 4YWMA 2B63H 3W2DA 3GTKH 2B63G 3P1HA 1Q7YC 4AQYQ 2K5QA 1XNQL 4GOPC 4A3JH 1TY2A 4YWKA 2DNEA 2NWGA 1SMYD 2HIXA 1PFMA 1C4QA 4K5XA 2E76C 5ELOA 1STGA 4QIWE 4UP8A 2A6HD 4LAAA 2CCZA 1Y69U 2XTIA 2XN9C 4JOIA 5IYCG 2BH2A 1I6HH 5EBDA 4LF6Q 4IQZA 4ALPA 3UE1A 4AH6A 3ZYYX 3J81i 2V4DA 4KHPQ 2K6AA 1NUCA 4H44C 5A2QE 2B2YC 2CWAA 5IY0A 2CWPA 2K7VA 5M3FG 5C4XB 1MJEA 5CV9A 3E5SA 3T56B 1Q82C 1SDFA 4GN4B 1T5XD 5LMUL 4RGOS 3VA7A 1C9OA 2QF7A 5J1ZA 2G9HD 2XRSD 3A7AB 1CQFA 4IJHA 1QNUA 4CDDC 1GUNA 1H9JA 2Z6BA 1SSOA 2VQEQ 4DK1A 2A73B 3S2DH 1WJJA 3TMEA 3CCSA 1QNKA 3CMEA 2V1CC 3E9HA 1EFID 4HJ9A 4GKJQ 4ZKCB 2F0EA 4ZUIA 2B3GA 3GTPB 1VQ4A 1NR4A 4KKTA 2KBNA 3URYA 3STBC 5M5WH 4RH6A 5I6WA 3DEPA 3LNNA 1B53A 4DV0L 4JW0A 3RNUA 1WOCA 5FK9C 5JPNC 1B70B 1JJGA 1SE3A 1TWCB 2SDFA 1MBYA 4KMUC 1TWAB 2KEEA 3QOLA 2IY5B 1KHIA 4APVA 1K0RA 2LFNA 3D0FA 3ITPA 3VR3A 3KK7A 1I5FA 4RHRA 1HH2P 1PFBA 4KY7A 3WOFA 1BDOA 2CH4A 2RHSB 1XMOL 1VQLA 4A93B 2MO1A 1E24A 4DR5Q 1XYIA 2ZXPA 1ILQA 1LUZA 2N49A 3S1RH 1WD0A 4BY7H 1L0WA 2I07B 4BY7G 3CP0A 1YNNC 5G3LF 3Q6SA 4JI3L 3UDFA 3AMUA 4RCOA 3NENA 2J4XA 1Q8KA 1YEZA 4XT1B 3C46A 2VQFQ 5C5LA 2R92H 2R92G 5IYBG 5KRUA 3I3CA 3V05A 4EVOA 3HG9A 1JORA 4HR7B 2XSCA 4C3IB 1NBWA 1A2UA 2PZWA 1JR0D 2BE5D 2SEBD 2R7ZB 5CR3A 2NVXB 1C8CA 2L0CA 4HIDA 4OWXB 4IFDJ 3TS0A 2FXQA 4XXEA 1E1TA 4L6TB 4O1NA 3PCOB 4LF4Q 4LFAL 3PIO3 3KDFA 3K0YA 4DV6Q 5GAEC 4WJ4A 1KD1C 4Q5VA 3HOWB 4GN3B 1OXTA 4POGA 3RR5A 3VR5A 3I4MH 3E0JA 1YIJA 3V2TA 1W2BA 1L1OC 1N8RC 4L5TA 3M4OH 4JI6Q 2L11A 2JSOA 4UY8C 1D1KA 5IIFA 1CK1A 4GOPA 4IFDG 3H0GB 4MTNA 1JOOA 4QB4A 5I9OA 3NHHA 3L2PA 2XRQD 2AQ3B 1EYCA 3D6CA 2WB1E 4A3IB 2JA9A 5CBAE 1DOMA 3ER0A 4QY7A 4A3CG 1EYDA 4JI7L 1I4GA 1GOZA 4X62L 3TP5A 2N8NA 1PYSB 3CQZB 1FNUA 4HJAA 3H6MA 1PH2A 1SROA 4POFA 3MHBA 1B7YB 1KC8C 5M5YB 4CDFC 2DNCA 1WFQA 2A69D 2I46A 5G3LD 1JCKB 1GKHA 1KRSA 4NP5A 5T1IA 1U4RA 4LFCL 2O4XA 2A5HA 1L0YB 2K33A 1VF5C 2B2YA 1VQGA 1VQKA 4KJOA 3CCMA 5DAUA 3Q24A 3R3OA 4IZ8A 4YWLA 5CORA 1K8AC 1EUJA 3KLRA 1ASYA 5JVH3 5C4HA 3SK8A 3OOCA 2HCCA 5C4XH 3RZOB 5C4ZA 4CHTB 5E7NA 3KDFB 2N55A 2FHTA 1PH1A 3WDNA 2F0DA 2YTVA 2UXCQ 1BCPC 3L9AX 4J6HA 3TZDA 3IFTA 4J1MA 5C4JB 3JAML 3CC2A 3KUPA 4A3MB 2E75C 2VB3X 2UUBQ 1EOVA 2F03A 1E0BA 1A6XA 2LXKA 1LTLA 3MWYW 3GTMB 5HGQA 2G5DA 1SYGA 1BUVT 1PZID 1FYCA 3BYYB 4S3SA 1VQ7A 4YIJA 1CSQA 1LABA 1M1KC 5JJZA 5CV7A 1O78A 3A74A 1IBLL 2N3SA 3I2ZA 3GTJB 3RN5A 3KOJA 2ASBA 2PO4A 1BCPF 5GADC 1RD9D 4RWSC 3HS0C 3DLLA 1GVPA 3V96A 2NZOA 1BR9A 3J80L 1IKMA 1JICA 1TWCH 3S14H 3QO2A 2PMZB 4XDXA 4DR4L 1TWAH 1MD2D 3PIOA 2K04A 5ISRA 1OO9B 2F52A 2KUMA 3FRPB 1FNVA 4LF9Q 3GTLB 1EYGA 2KHSA 3QJYA 4AYBB 2RBMA 1G291 2OT2A 4A93H 5C3XA 4A93G 5EAYA 3DXJC 2NN6I 1PTOD 4DFAA 1LACA 2F0UA 2VY3A 3LWEA 3R2TA 1G51A 1VQAA 4KN7C 4I7AA 5EBCA 3RZDB 1JOKA 3U9OA 5GAHC 3NSWA 4K2KA 5D3DA 5EPJA 4B3RL 1K0SA 3HZXA 1O7YA 4XT3B 3IL8A 1PH3A 3JAMi 2ES2A 3K0XA 2EYMA 1C48A 4IPDA 1K8MA 1LT3D 2NTTA 4NMZA 3BDOA 2ZTEA 4C3IH 2R7ZH 4EQ5A 2R7ZG 2J0TD 3KLSA 4DV5Q 2NVXH 1IXRA 2K03A 1B4OA 1AE2A 1WTOA 5A2QL 3H94A 3KF6A 4G7ZC 4MTKA 2UUAL 3S2HH 1CSPA 2I0QA 3G48A 3J7ZC 5T1GA 4JBKA 1TY0A 4L5RC 3KLWA 2HUGA 3F8TA 1EWHA 5KGUA 4B3SL 5EPKA 1AZQA 3TP6A 4A75A 3TEHB 3HOWH 3N52A 2UXDQ 1L1OA 1WCMG 3HOWG 4JC0A 5AFWA 4X64L 1B3QA 4JPBW 5IGBA 2JQOA 4OWWB 4PG3A 4DXFA 4HCSA 2KENA 4OHJA 4OL7A 1BCPD 2NTSA 1K8GA 2K5WA 2OF1A 1STAA 1S5CD 4LUZA 3J80i 5FO9B 5KYLA 1B9MA 3H0GH 4DUZL 4F7XA 2WAQB 2EE1A 2LSSA 1STEA 1GHJA 2A1AA 2K28A 3A5UA 1C0AA 3ERQA 2DN8A 3C2PA 2WV6D 3UDGA 2F0LA 4A3IH 2PNHA 5CV4A 4OXPA 4DV3Q 5C3EB 2EY6A 4I7ZC 3CQZH 1VQDA 3PSIA 4AIMA 2VXWA 1IL2A 4H13C 1XPOA 1QZGA 1HFNA 1MHWC 5M5YH 1P8LA 4IALA 1U0LA 3M85A 1G6PA 1LTTD 2PI2E 2R93B 2PYKA 3KJOA 2BH8A 4BS9A 1UE6A 4CJ0B 5IGCA 1G2SA 5KIXA 3UDIA 2EPBA 2XWJB 1LYLA 2B2TC 2F0IA 3U4ZA 2IX1A 3KF6B 2MHVA 3VR2A 3IAYA 4K0KL 1S4ZA 1MSHA 2L1BA 3RZOH 1EY7A 5IT9E 3OIQA 2OQKA 1EQTA 3K5OA 4NPSA 2EJGC 2F0PA 3VYTA 3X3MA 4XIGS 1HFGA 4HTHA 1CA6A 1FJGL 4EX5A 5C4JH 2VW9A 1GUTA 1U9RA 1L1OB 4A3MH 1YBYA 3X3NA 4JI5Q 1A3TA 1O7ZA 1CTMA 4JI4L 1EY9A 1KL9A 3KBGA 1PYBA 1EEFD 2X6GA 3PUVA 3GTMH 3R93A 1VCIA 1PH5A 2E8GA 3S1MB 1O80A 3M7NA 1RIPA 2ZXRA 1EEID 4FDBA 4V0BA 3SEBA 4C3HB 4DPGA 2L15A 2RCFA 3GTJH 4FO2A 3QIAA 1VQMA 1Q90A 3RLFA 1AN8A 3ULJA 2K4KA 5ELFA 2EY5A 1NAPA 4P71A 3L7ZC 1MSGA 5M3FB 5C0XI 2ZJPA 1PH9A 1AZPA 5HY6A 2E5LL 4DV7L 1XTDA 4JYAL 2FMMA 4KI0A 5EKIA 4U673 4OEMB 1HA6A 4AYBG 3G4SA 1NMGA 5CMDA 2F1MA 3I91A 2JEBI 4A3DB 2B2UC 4K8JA 1FGUA 5BN5A 3S2DB 2A8VA 3QOJA 3RZDH 4BY1B 3FHWA 5IOCA 4WORA 2M9VA 1XNQQ 2MJ8A 5FOBB 4A3LH 4GN5A 2YYZA 3MXGA 1EOTA 1EIGA 3JAMc 1SYDA 1HNWL 4HCEA 5EKLA 1GM5A 5M5WB 5C6AA 3CHBD 2MPMA 2QCPX 4A3GB 2IHEA 1E7ZA 1P16A 2R3ZA 1JOQA 1JT8A 3AFPA 2VS1A 5I4DA 2BA0A 3VDYA 1KLUD 3FVQA 2D9UA 4X66L 4CKCA 1H9MA 1ASZA 1LTSD 1Q12A
chains in the Genus database with same CATH topology
1K3RA 4NXNQ 4P72A 1HNZL 3CMEA 2UXBL 3KYHC 2V1CC 2HT1A 1O7IA 3E9HA 4HJ9A 4GKJQ 4DR5L 2BA1A 4O2DA 3WWVA 2B3GA 1HNWQ 1VQHA 3K81C 2PMZE 3J80c 1AH9A 2EIFA 2AMCB 3F2DA 1VQ4A 1MKHA 2MO0A 1J6QA 5AJ3L 2KBNA 5M5WH 3STBC 1CKOA 5C4XG 1QUQA 4DUZQ 2AWOA 2YV5A 4JBJA 3I56A 4X65L 4AYBE 1BVSA 4DV0L 4DR1L 3RNUA 1Q1EA 1WOCA 2VQFL 1B70B 5LMUQ 1JJGA 4LF7L 5IP9H 3TQYA 2XGTA 4P75A 4B3TL 1K83H 1MJCA 4YCUA 1VQ5A 5JJIA 1VQOA 3K7UC 2Q2UA 2IY5B 5C3EH 4H02A 4GLXA 1KHIA 5C3EG 2IT1A 4APVA 1QVGA 1N33Q 1K0RA 4OO1G 5JJKA 1X3GA 3D0FA 2Z0SA 1PH6A 2UXBQ 2K14A 1I5FA 3EN2A 1HH2P 5GQOA 4LWCA 2RHSB 1XMOL 3HKZG 2GVAA 1VQLA 2MO1A 4JV5L 1E24A 4DR5Q 3HKSA 4BBRG 1HZCA 1LUZA 1X54A 2N49A 3S1RH 1YHAA 1V9PA 2Q2IA 4R4OA 1L0WA 1PA6A 4LF4L 4BY7G 2WB1G 3CP0A 3FKIH 3GTPH 3FKIG 2VNUD 1A63A 5AJ3Q 3AQQA 4DV6L 3EIVA 4JI3L 3UDFA 3CCLA 2R93H 4LUVA 3NENA 2CKZB 4X65Q 1Q8KA 1YEZA 2OCEA 4DUYL 4DR1Q 1BBUA 3HOXH 2VQFQ 2R92H 1SRUA 2R92G 2IX0A 5IYBG 2ZJQA 1NY4A 1R9TH 2H5XA 4LF7Q 1VQEA 1HJPA 3BZCA 4B3TQ 4JI6L 3PUYA 1JJ2A 3E0EA 1JE5A 3A0JA 2Y0SG 1KIXA 1NBWA 1SMXA 2K75A 4R4CA 1X3EA 2R7DA 1YHBA 4IPGA 1YHQA 3RLNA 1Y1VH 1Y1WG 4IFDJ 4HIDA 4OWXB 1XMQQ 1JB7A 4A3EH 1VQ8A 2UU9L 3TS0A 2FXQA 1A62A 1V43A 3F2BA 4HJ5A 4TVAB 1E1TA 4A3EG 1XMOQ 4JV5Q 3Q8DA 3J81j 3CCQA 4JI4Q 2AKWB 3PCOB 2RHQB 4LF4Q 1WI5A 2K52A 3U58A 4LFAL 1T9HA 1VQIA 3KDFA 2PQAA 4QGUA 4DV6Q 5M5XH 5GAEC 2Q2HA 3PO2G 1V1QA 1QVCA 1UWVA 2WAQE 4JI3Q 3OTOQ 1QUQB 1PH4A 1KD1C 2E2IH 3ICEA 2MQHA 4GN3B 3CCRA 5IYCH 4DUYQ 1OXTA 4POGA 3RR5A 3K80C 2UXDL 3I4MH 3CF5A 3S1MH 3ULLA 4DR6L 3RLOA 1OXXK 4XTCS 1YIJA 4R1JA 1W2BA 1L1OC 1N8RC 1EQRA 4L5TA 3M4OH 4BY7H 2NN6G 2Q2TA 5BR8L 4HIMA 2YTYA 4JI6Q 4C3HH 4UY8C 4UP7A 4GOPA 4IFDG 1M90C 4OX9Q 4J15A 3GTGH 1NJIC 4MTNA 5C44H 5C44G 3G71A 2EXDA 3L2PA 3S1NH 3CC4A 3M3YH 3LGJA 2ZJRA 1X65A 3A5ZB 4JI8L 5M3FH 2WB1E 2JA9A 2ZM6L 3ER0A 4BA2I 4QY7A 4LFAQ 4A3CG 4PZ7A 4JI7L 5JJLA 4X62L 3CCEA 2N8NA 1PYSB 1N34Q 1EFWA 5IT9c 4HJAA 5FJ8H 1AE3A 5FJ8G 2UXCL 1NMFA 4O0AA 1PH2A 2KCTA 4LUOA 1SFOH 1SROA 4POFA 4R4TA 1B7YB 1YJ9A 2UUBL 4DR6Q 1KC8C 4DV1L 1PH7A 1WFQA 1PFSA 3I4NG 3JC66 1GKHA 1KRSA 5IWAL 2Y0SE 5BR8Q 4A3DG 4A3DH 4LFCL 1VQCA 4Y7NH 4DAYB 3UDXA 3CD6A 2AHOB 1GD7A 3CCUA 1OXSC 4BY1H 1EIFA 3GD7A 4BY1G 1VQGA 1VQKA 3H0GG 4IJLA 5FLXc 1XNRL 1TWGH 2I5LX 3CCMA 4GNXC 3PGZA 2QA4A 2NVTH 1HNXL 4YWLA 1K8AC 1EUJA 1JJCB 4JI8Q 1ASYA 2E2HH 3L0OA 2ZM6Q 5GROA 5C4XH 4A3IG 4JI7Q 4R4IA 4IPCA 4YY3Q 3CCJA 4X62Q 5E7NA 3KDFB 1A0IA 2PQAB 4DR3L 4A3GH 4OWTB 4A3GG 1PH1A 1MIUA 2YTVA 2UXCQ 2ZTDA 3I55A 4JI2L 3CC2A 3ZJYC 2UUBQ 2K50A 4PZ8A 1EOVA 4KHZA 4X66Q 1XPUA 3NBHB 5DLQE 2ID0A 5IWAQ 3AYHB 2LXKA 1NE3A 1LTLA 2ZTCA 4IO9A 4LFCQ 3S1QH 3OYYA 2QEXA 3MXNB 5HGQA 2I5MX 3K8AA 1K9MC 3T1HL 1I94L 1A8VA 4LF9L 1HNZQ 2VUMG 4LW1A 4P74A 2KCMA 4NB3A 3H3VI 4BBRH 3K7AH 3CXCA 1VQ7A 2JK8A 1CSQA 1HNXQ 5IP7H 4UPAA 5LMNL 5IP7G 4PMWA 1M1KC 4GLVB 3HOYG 2I5HA 2JA6G 1QZHA 1FL0A 4A3KG 3A74A 3S15H 3ERSX 2N3SA 3I2ZA 1IBLL 2GVBA 3RN5A 5K36G 3KOJA 1TWHH 2ASBA 1SN8A 5GADC 4DV0Q 1VQJA 2KHJA 4AQYL 5IYBH 3DLLA 1GVPA 1VQ9A 4WJ4A 1NTGA 3H3VH 1CUKA 2NZOA 4JI0L 3S14H 1TWCH 4A3MG 2Z6KC 1TXYA 3CMAA 1GO3E 1PH8A 3PIPA 4DR4L 1TWAH 3H15A 1EQQA 3PIOA 2F4VL 2F52A 1BBWA 2DUDA 3IRBA 1L2FA 3T1HQ 1Y1WH 1I94Q 4LF9Q 1EYGA 4DV5L 1HR0L 4QQBX 4YCVA 1G291 4HJ7A 4A93H 4HIKA 4GKKL 4A93G 1SE8A 2R7FA 1CKNA 1HZ9A 5EAYA 2NN6I 1RL2A 4JOIC 5LMNQ 5FLMG 1UE5A 2VY3A 3B6YA 4MNOA 4IFDI 3W1GA 1G51A 1VQAA 1YI2A 3PO2H 1IBLQ 1K73C 1Z47A 2UUCL 5C0XJ 5GAHC 1VQNA 4C3JH 4B3RL 2NVYH 4JI0Q 1TWFH 4A3JG 1X6OA 1N9WA 4LF8L 4HIOA 1H95A 1PH3A 4P73A 3JAMi 5JEAJ 3K0XA 2ES2A 4IPDA 3DM3A 3G6EA 4BA1I 2F4VQ 2ZTEA 4C3IH 3S17H 2R7ZH 2RF4A 4EQ5A 2WP8J 3HKZE 4IPHA 2R7ZG 4Y52H 4DV5Q 1HR0Q 2NVXH 1IXRA 2UU9Q 3HOZH 3PUZA 3GTLH 3HOZG 3I7FA 1Q81C 1AE2A 3CPFA 4JCVE 3AFQA 4DNIA 4JBWA 2JA5H 1PVOA 2JA5G 4LF5L 3KF6A 1VQFA 4A3CH 2UUAL 3PV0A 3S2HH 5C0XG 1CSPA 2I0QA 3G48A 3J7ZC 3CCVA 4DV3L 4JBKA 4LFBL 5LMNW 4L5RC 3KLWA 3F8TA 2NZHA 3W5OA 2UUCQ 1VS0A 2D0OA 3HFZB 4B3SL 2ALYB 4JBMA 2JA8G 2JA8H 1KAWA 4A75A 3TEHB 4PZ6A 3HOWH 2UXDQ 3OW2A 1L1OA 1WCMG 2C35B 3BZKA 1YNXA 4JC0A 1VQ6A 1E22A 3HOWG 1SR3A 4B3RQ 4X64L 5IYDH 2GN5A 5IYDG 3I4NH 4A3LG 3PUWA 4LNQA 5JEAG 4ME3A 4RG1A 2JQOA 3PUXA 2N78A 3J81c 4OWWB 4PG3A 1UE7A 1IBML 2JA7H 4LF8Q 2JA7G 1B8AA 1X56A 2KENA 3F1ZA 4KLKA 3M4QA 1K8GA 4LUZA 1CKMA 3J80i 2OTJA 2B29A 2OTLA 3H0GH 4DUZL 1Q46A 1VQBA 4MZ9A 1N36L 2LSSA 4JI1L 3T1YL 2A1AA 1IBKL 3A5UA 4RMFA 2E2JH 1C0AA 1S40A 1C7YA 3PO3H 1I50H 1SLJA 5GAGC 3PO3G 3UDGA 1HR0W 4LF5Q 1CKNB 2QGQA 4A3IH 3CW2C 2PNHA 4R4QA 4JG2A 4OO1I 3NEMA 4OXPA 2K5NA 3S24A 4DV3Q 2PI2A 5H1SE 4LFBQ 3TREA 3MEFA 4B3SQ 1N33L 3CQZH 1VQDA 1IZ6A 3PSIA 4AIMA 1OXUA 1KXLA 1IL2A 3S16H 1X3FA 1XPOA 2DGYA 3KJPA 1QZGA 3CC7A 3F2CA 4X64Q 4DV1Q 4JI5L 2YTXA 4TQUS 2KHIA 5M5YH 2CQOA 4L5SA 1D7QA 1P8LA 1Y14B 1BKBA 3D31A 4YHHL 1IBMQ 4A3BH 1U0LA 1D8LA 3M85A 4A3BG 1X9NA 2HHHL 2LXJA 2PI2E 3M9BA 1JMCA 1G6PA 1YZ6A 4GOPB 2VUMH 4GNXA 4DV4L 3KJOA 2BH8A 2HQLA 1Q86C 1XNRQ 1UE6A 1N36Q 3J7A5 4JI1Q 3T1YQ 4B3ML 1X55A 1IBKQ 4DKAC 2WAQG 1KRTA 3UDIA 2K5VA 3BJUA 1XJVA 2VZAA 2MNAA 3HOYH 4DR7L 1S3OA 1UEBA 1Z9FA 1LYLA 5ELNA 5J3BA 2JA6H 2IX1A 3U4ZA 1QVFA 3CAMA 4A3KH 3KF6B 2VL6A 5IP9G 4K0KL 4DAMA 3RZOH 2HIVA 3E9IA 4DR3Q 4IOAA 2OQKA 1PHJA 3HOVH 2IHFA 4NPSA 3HOVG 1I3QH 2OQ0A 3GTOH 2JEAI 4X6AH 4XIGS 4JI2Q 2A19A 3CPWA 1FJGL 4EX5A 2K5HA 5C4JH 2VW9A 3AEVA 3TS2A 1L1OB 4OONA 1XMQL 1E3PA 4A3MH 4C2MH 1YBYA 2WFWA 4JI5Q 3KFUA 4IOCA 4DR2L 3KF8B 4YCWA 4UP9A 4DK6C 4JI4L 2ATWA 4DV2L 3I4OA 4YHHQ 1KQSA 2NVQH 3GO5A 1KL9A 2HHHQ 2AWNA 1Q1BA 1PYBA 2EQSA 2D62A 3PUVA 3GTMH 5IE8A 4DV4Q 4GS3A 1UE1A 3OTOL 2R93G 1VCIA 1PH5A 4B3MQ 2E8GA 1IYJB 3FP9A 4WJ3M 2OWOA 3M7NA 3HOXG 1RIPA 1YJWA 4DR7Q 5FLMH 4LF6L 3EBEA 1EWIA 4FDBA 2JJQA 1W3SA 1S72A 3PF4A 1DGSA 3RN2A 4DPGA 2L15A 4K0KQ 4YWMA 1LM0A 1WYDA 3GTJH 1VQPA 2B63H 3GTKH 2B63G 1OXVA 1FVIA 4KHPL 3M4PA 1Q7YC 4AQYQ 3W1BA 4OX9L 1XNQL 1HZAA 4GOPC 1VQMA 1PV4A 3RLFA 3ULJA 1FJGQ 1U5KA 1Y1VG 2K4KA 2Z6KA 4A3JH 4A76A 4YWKA 4P71A 3L7ZC 2HIXA 5C0XI 4DK3C 4DR2Q 3GTQH 2ZJPA 1PH9A 4DR4Q 5HY6A 2E5LL 4DV2Q 1XTDA 4DV7L 4JYAL 3TRZA 5ELOA 4NXML 4A3FH 4QIWE 4UP8A 4KI0A 4A3FG 1OTCA 1N34L 2CCZA 1EIYB 4GNXB 2XTIA 3HOUH 4JOIA 2CFMA 4AYBG 3G4SA 3HOUG 4GKKQ 5IYCG 2BH2A 1I6HH 2D0PA 3ULPA 1N32L 3I4MG 1HZBA 3U4VA 4BXXH 4BXXG 4LF6Q 4ALPA 1NMGA 2MFIA 1J5EL 1YITA 2JEBI 3NELA 1FGUA 3UE1A 4AH6A 2VQEL 2A8VA 3J81i 3RZDH 4QJFA 3FHWA 4KHPQ 1WCMH 4NXNL 1XNQQ 1E1OA 1XPRA 4A3LH 4HJ8A 4GN5A 1YJNA 2YYZA 4BBSH 4GKJL 4BBSG 2RCNA 5M3MH 2CWAA 5M3MG 5IY0A 2CWPA 3JAMc 1HNWL 3GDEA 5M3FG 1GM5A 2E5LQ 4DV7Q 4JYAQ 1MJEA 3PF5A 2R6GA 4YY3L 4A4IA 4NXMQ 2IHEA 4QL5A 1E7ZA 1P16A 2F3IA 4L5QA 4GN4B 4GLAC 1Q82C 3AFPA 1JT8A 2VS1A 5LMUL 2BA0A 3VDYA 1N32Q 1C9OA 2YU9H 3STBD 2UUAQ 1J5EQ 4X66L 4IJHA 3U50C 3SGIA 3UE0A 3BU2A 1ASZA 2VQEQ 3S2DH 1WJJA 2JE6I 3CCSA 1YVCA 1Q12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  4NXN Q;  4P72 A;  1HNZ L;  3CME A;  2UXB L;  3KYH C;  2V1C C;  2HT1 A;  1O7I A;  3E9H A;  4HJ9 A;  4GKJ Q;  4DR5 L;  2BA1 A;  4O2D A;  3WWV A;  2B3G A;  1HNW Q;  1VQH A;  3K81 C;  2PMZ E;  3J80 c;  1AH9 A;  2EIF A;  2AMC B;  3F2D A;  1VQ4 A;  1MKH A;  2MO0 A;  1J6Q A;  5AJ3 L;  2KBN A;  5M5W H;  3STB C;  1CKO A;  5C4X G;  1QUQ A;  4DUZ Q;  2AWO A;  2YV5 A;  4JBJ A;  3I56 A;  4X65 L;  4AYB E;  1BVS A;  4DV0 L;  4DR1 L;  3RNU A;  1Q1E A;  1WOC A;  2VQF L;  1B70 B;  5LMU Q;  1JJG A;  4LF7 L;  5IP9 H;  3TQY A;  2XGT A;  4P75 A;  4B3T L;  1K83 H;  1MJC A;  4YCU A;  1VQ5 A;  5JJI A;  1VQO A;  3K7U C;  2Q2U A;  2IY5 B;  5C3E H;  4H02 A;  4GLX A;  1KHI A;  5C3E G;  2IT1 A;  4APV A;  1QVG A;  1N33 Q;  1K0R A;  4OO1 G;  5JJK A;  1X3G A;  3D0F A;  2Z0S A;  1PH6 A;  2UXB Q;  2K14 A;  1I5F A;  3EN2 A;  1HH2 P;  5GQO A;  4LWC A;  2RHS B;  1XMO L;  3HKZ G;  2GVA A;  1VQL A;  2MO1 A;  4JV5 L;  1E24 A;  4DR5 Q;  3HKS A;  4BBR G;  1HZC A;  1LUZ A;  1X54 A;  2N49 A;  3S1R H;  1YHA A;  1V9P A;  2Q2I A;  4R4O A;  1L0W A;  1PA6 A;  4LF4 L;  4BY7 G;  2WB1 G;  3CP0 A;  3FKI H;  3GTP H;  3FKI G;  2VNU D;  1A63 A;  5AJ3 Q;  3AQQ A;  4DV6 L;  3EIV A;  4JI3 L;  3UDF A;  3CCL A;  2R93 H;  4LUV A;  3NEN A;  2CKZ B;  4X65 Q;  1Q8K A;  1YEZ A;  2OCE A;  4DUY L;  4DR1 Q;  1BBU A;  3HOX H;  2VQF Q;  2R92 H;  1SRU A;  2R92 G;  2IX0 A;  5IYB G;  2ZJQ A;  1NY4 A;  1R9T H;  2H5X A;  4LF7 Q;  1VQE A;  1HJP A;  3BZC A;  4B3T Q;  4JI6 L;  3PUY A;  1JJ2 A;  3E0E A;  1JE5 A;  3A0J A;  2Y0S G;  1KIX A;  1NBW A;  1SMX A;  2K75 A;  4R4C A;  1X3E A;  2R7D A;  1YHB A;  4IPG A;  1YHQ A;  3RLN A;  1Y1V H;  1Y1W G;  4IFD J;  4HID A;  4OWX B;  1XMQ Q;  1JB7 A;  4A3E H;  1VQ8 A;  2UU9 L;  3TS0 A;  2FXQ A;  1A62 A;  1V43 A;  3F2B A;  4HJ5 A;  4TVA B;  1E1T A;  4A3E G;  1XMO Q;  4JV5 Q;  3Q8D A;  3J81 j;  3CCQ A;  4JI4 Q;  2AKW B;  3PCO B;  2RHQ B;  4LF4 Q;  1WI5 A;  2K52 A;  3U58 A;  4LFA L;  1T9H A;  1VQI A;  3KDF A;  2PQA A;  4QGU A;  4DV6 Q;  5M5X H;  5GAE C;  2Q2H A;  3PO2 G;  1V1Q A;  1QVC A;  1UWV A;  2WAQ E;  4JI3 Q;  3OTO Q;  1QUQ B;  1PH4 A;  1KD1 C;  2E2I H;  3ICE A;  2MQH A;  4GN3 B;  3CCR A;  5IYC H;  4DUY Q;  1OXT A;  4POG A;  3RR5 A;  3K80 C;  2UXD L;  3I4M H;  3CF5 A;  3S1M H;  3ULL A;  4DR6 L;  3RLO A;  1OXX K;  4XTC S;  1YIJ A;  4R1J A;  1W2B A;  1L1O C;  1N8R C;  1EQR A;  4L5T A;  3M4O H;  4BY7 H;  2NN6 G;  2Q2T A;  5BR8 L;  4HIM A;  2YTY A;  4JI6 Q;  4C3H H;  4UY8 C;  4UP7 A;  4GOP A;  4IFD G;  1M90 C;  4OX9 Q;  4J15 A;  3GTG H;  1NJI C;  4MTN A;  5C44 H;  5C44 G;  3G71 A;  2EXD A;  3L2P A;  3S1N H;  3CC4 A;  3M3Y H;  3LGJ A;  2ZJR A;  1X65 A;  3A5Z B;  4JI8 L;  5M3F H;  2WB1 E;  2JA9 A;  2ZM6 L;  3ER0 A;  4BA2 I;  4QY7 A;  4LFA Q;  4A3C G;  4PZ7 A;  4JI7 L;  5JJL A;  4X62 L;  3CCE A;  2N8N A;  1PYS B;  1N34 Q;  1EFW A;  5IT9 c;  4HJA A;  5FJ8 H;  1AE3 A;  5FJ8 G;  2UXC L;  1NMF A;  4O0A A;  1PH2 A;  2KCT A;  4LUO A;  1SFO H;  1SRO A;  4POF A;  4R4T A;  1B7Y B;  1YJ9 A;  2UUB L;  4DR6 Q;  1KC8 C;  4DV1 L;  1PH7 A;  1WFQ A;  1PFS A;  3I4N G;  3JC6 6;  1GKH A;  1KRS A;  5IWA L;  2Y0S E;  5BR8 Q;  4A3D G;  4A3D H;  4LFC L;  1VQC A;  4Y7N H;  4DAY B;  3UDX A;  3CD6 A;  2AHO B;  1GD7 A;  3CCU A;  1OXS C;  4BY1 H;  1EIF A;  3GD7 A;  4BY1 G;  1VQG A;  1VQK A;  3H0G G;  4IJL A;  5FLX c;  1XNR L;  1TWG H;  2I5L X;  3CCM A;  4GNX C;  3PGZ A;  2QA4 A;  2NVT H;  1HNX L;  4YWL A;  1K8A C;  1EUJ A;  1JJC B;  4JI8 Q;  1ASY A;  2E2H H;  3L0O A;  2ZM6 Q;  5GRO A;  5C4X H;  4A3I G;  4JI7 Q;  4R4I A;  4IPC A;  4YY3 Q;  3CCJ A;  4X62 Q;  5E7N A;  3KDF B;  1A0I A;  2PQA B;  4DR3 L;  4A3G H;  4OWT B;  4A3G G;  1PH1 A;  1MIU A;  2YTV A;  2UXC Q;  2ZTD A;  3I55 A;  4JI2 L;  3CC2 A;  3ZJY C;  2UUB Q;  2K50 A;  4PZ8 A;  1EOV A;  4KHZ A;  4X66 Q;  1XPU A;  3NBH B;  5DLQ E;  2ID0 A;  5IWA Q;  3AYH B;  2LXK A;  1NE3 A;  1LTL A;  2ZTC A;  4IO9 A;  4LFC Q;  3S1Q H;  3OYY A;  2QEX A;  3MXN B;  5HGQ A;  2I5M X;  3K8A A;  1K9M C;  3T1H L;  1I94 L;  1A8V A;  4LF9 L;  1HNZ Q;  2VUM G;  4LW1 A;  4P74 A;  2KCM A;  4NB3 A;  3H3V I;  4BBR H;  3K7A H;  3CXC A;  1VQ7 A;  2JK8 A;  1CSQ A;  1HNX Q;  5IP7 H;  4UPA A;  5LMN L;  5IP7 G;  4PMW A;  1M1K C;  4GLV B;  3HOY G;  2I5H A;  2JA6 G;  1QZH A;  1FL0 A;  4A3K G;  3A74 A;  3S15 H;  3ERS X;  2N3S A;  3I2Z A;  1IBL L;  2GVB A;  3RN5 A;  5K36 G;  3KOJ A;  1TWH H;  2ASB A;  1SN8 A;  5GAD C;  4DV0 Q;  1VQJ A;  2KHJ A;  4AQY L;  5IYB H;  3DLL A;  1GVP A;  1VQ9 A;  4WJ4 A;  1NTG A;  3H3V H;  1CUK A;  2NZO A;  4JI0 L;  3S14 H;  1TWC H;  4A3M G;  2Z6K C;  1TXY A;  3CMA A;  1GO3 E;  1PH8 A;  3PIP A;  4DR4 L;  1TWA H;  3H15 A;  1EQQ A;  3PIO A;  2F4V L;  2F52 A;  1BBW A;  2DUD A;  3IRB A;  1L2F A;  3T1H Q;  1Y1W H;  1I94 Q;  4LF9 Q;  1EYG A;  4DV5 L;  1HR0 L;  4QQB X;  4YCV A;  1G29 1;  4HJ7 A;  4A93 H;  4HIK A;  4GKK L;  4A93 G;  1SE8 A;  2R7F A;  1CKN A;  1HZ9 A;  5EAY A;  2NN6 I;  1RL2 A;  4JOI C;  5LMN Q;  5FLM G;  1UE5 A;  2VY3 A;  3B6Y A;  4MNO A;  4IFD I;  3W1G A;  1G51 A;  1VQA A;  1YI2 A;  3PO2 H;  1IBL Q;  1K73 C;  1Z47 A;  2UUC L;  5C0X J;  5GAH C;  1VQN A;  4C3J H;  4B3R L;  2NVY H;  4JI0 Q;  1TWF H;  4A3J G;  1X6O A;  1N9W A;  4LF8 L;  4HIO A;  1H95 A;  1PH3 A;  4P73 A;  3JAM i;  5JEA J;  3K0X A;  2ES2 A;  4IPD A;  3DM3 A;  3G6E A;  4BA1 I;  2F4V Q;  2ZTE A;  4C3I H;  3S17 H;  2R7Z H;  2RF4 A;  4EQ5 A;  2WP8 J;  3HKZ E;  4IPH A;  2R7Z G;  4Y52 H;  4DV5 Q;  1HR0 Q;  2NVX H;  1IXR A;  2UU9 Q;  3HOZ H;  3PUZ A;  3GTL H;  3HOZ G;  3I7F A;  1Q81 C;  1AE2 A;  3CPF A;  4JCV E;  3AFQ A;  4DNI A;  4JBW A;  2JA5 H;  1PVO A;  2JA5 G;  4LF5 L;  3KF6 A;  1VQF A;  4A3C H;  2UUA L;  3PV0 A;  3S2H H;  5C0X G;  1CSP A;  2I0Q A;  3G48 A;  3J7Z C;  3CCV A;  4DV3 L;  4JBK A;  4LFB L;  5LMN W;  4L5R C;  3KLW A;  3F8T A;  2NZH A;  3W5O A;  2UUC Q;  1VS0 A;  2D0O A;  3HFZ B;  4B3S L;  2ALY B;  4JBM A;  2JA8 G;  2JA8 H;  1KAW A;  4A75 A;  3TEH B;  4PZ6 A;  3HOW H;  2UXD Q;  3OW2 A;  1L1O A;  1WCM G;  2C35 B;  3BZK A;  1YNX A;  4JC0 A;  1VQ6 A;  1E22 A;  3HOW G;  1SR3 A;  4B3R Q;  4X64 L;  5IYD H;  2GN5 A;  5IYD G;  3I4N H;  4A3L G;  3PUW A;  4LNQ A;  5JEA G;  4ME3 A;  4RG1 A;  2JQO A;  3PUX A;  2N78 A;  3J81 c;  4OWW B;  4PG3 A;  1UE7 A;  1IBM L;  2JA7 H;  4LF8 Q;  2JA7 G;  1B8A A;  1X56 A;  2KEN A;  3F1Z A;  4KLK A;  3M4Q A;  1K8G A;  4LUZ A;  1CKM A;  3J80 i;  2OTJ A;  2B29 A;  2OTL A;  3H0G H;  4DUZ L;  1Q46 A;  1VQB A;  4MZ9 A;  1N36 L;  2LSS A;  4JI1 L;  3T1Y L;  2A1A A;  1IBK L;  3A5U A;  4RMF A;  2E2J H;  1C0A A;  1S40 A;  1C7Y A;  3PO3 H;  1I50 H;  1SLJ A;  5GAG C;  3PO3 G;  3UDG A;  1HR0 W;  4LF5 Q;  1CKN B;  2QGQ A;  4A3I H;  3CW2 C;  2PNH A;  4R4Q A;  4JG2 A;  4OO1 I;  3NEM A;  4OXP A;  2K5N A;  3S24 A;  4DV3 Q;  2PI2 A;  5H1S E;  4LFB Q;  3TRE A;  3MEF A;  4B3S Q;  1N33 L;  3CQZ H;  1VQD A;  1IZ6 A;  3PSI A;  4AIM A;  1OXU A;  1KXL A;  1IL2 A;  3S16 H;  1X3F A;  1XPO A;  2DGY A;  3KJP A;  1QZG A;  3CC7 A;  3F2C A;  4X64 Q;  4DV1 Q;  4JI5 L;  2YTX A;  4TQU S;  2KHI A;  5M5Y H;  2CQO A;  4L5S A;  1D7Q A;  1P8L A;  1Y14 B;  1BKB A;  3D31 A;  4YHH L;  1IBM Q;  4A3B H;  1U0L A;  1D8L A;  3M85 A;  4A3B G;  1X9N A;  2HHH L;  2LXJ A;  2PI2 E;  3M9B A;  1JMC A;  1G6P A;  1YZ6 A;  4GOP B;  2VUM H;  4GNX A;  4DV4 L;  3KJO A;  2BH8 A;  2HQL A;  1Q86 C;  1XNR Q;  1UE6 A;  1N36 Q;  3J7A 5;  4JI1 Q;  3T1Y Q;  4B3M L;  1X55 A;  1IBK Q;  4DKA C;  2WAQ G;  1KRT A;  3UDI A;  2K5V A;  3BJU A;  1XJV A;  2VZA A;  2MNA A;  3HOY H;  4DR7 L;  1S3O A;  1UEB A;  1Z9F A;  1LYL A;  5ELN A;  5J3B A;  2JA6 H;  2IX1 A;  3U4Z A;  1QVF A;  3CAM A;  4A3K H;  3KF6 B;  2VL6 A;  5IP9 G;  4K0K L;  4DAM A;  3RZO H;  2HIV A;  3E9I A;  4DR3 Q;  4IOA A;  2OQK A;  1PHJ A;  3HOV H;  2IHF A;  4NPS A;  3HOV G;  1I3Q H;  2OQ0 A;  3GTO H;  2JEA I;  4X6A H;  4XIG S;  4JI2 Q;  2A19 A;  3CPW A;  1FJG L;  4EX5 A;  2K5H A;  5C4J H;  2VW9 A;  3AEV A;  3TS2 A;  1L1O B;  4OON A;  1XMQ L;  1E3P A;  4A3M H;  4C2M H;  1YBY A;  2WFW A;  4JI5 Q;  3KFU A;  4IOC A;  4DR2 L;  3KF8 B;  4YCW A;  4UP9 A;  4DK6 C;  4JI4 L;  2ATW A;  4DV2 L;  3I4O A;  4YHH Q;  1KQS A;  2NVQ H;  3GO5 A;  1KL9 A;  2HHH Q;  2AWN A;  1Q1B A;  1PYB A;  2EQS A;  2D62 A;  3PUV A;  3GTM H;  5IE8 A;  4DV4 Q;  4GS3 A;  1UE1 A;  3OTO L;  2R93 G;  1VCI A;  1PH5 A;  4B3M Q;  2E8G A;  1IYJ B;  3FP9 A;  4WJ3 M;  2OWO A;  3M7N A;  3HOX G;  1RIP A;  1YJW A;  4DR7 Q;  5FLM H;  4LF6 L;  3EBE A;  1EWI A;  4FDB A;  2JJQ A;  1W3S A;  1S72 A;  3PF4 A;  1DGS A;  3RN2 A;  4DPG A;  2L15 A;  4K0K Q;  4YWM A;  1LM0 A;  1WYD A;  3GTJ H;  1VQP A;  2B63 H;  3GTK H;  2B63 G;  1OXV A;  1FVI A;  4KHP L;  3M4P A;  1Q7Y C;  4AQY Q;  3W1B A;  4OX9 L;  1XNQ L;  1HZA A;  4GOP C;  1VQM A;  1PV4 A;  3RLF A;  3ULJ A;  1FJG Q;  1U5K A;  1Y1V G;  2K4K A;  2Z6K A;  4A3J H;  4A76 A;  4YWK A;  4P71 A;  3L7Z C;  2HIX A;  5C0X I;  4DK3 C;  4DR2 Q;  3GTQ H;  2ZJP A;  1PH9 A;  4DR4 Q;  5HY6 A;  2E5L L;  4DV2 Q;  1XTD A;  4DV7 L;  4JYA L;  3TRZ A;  5ELO A;  4NXM L;  4A3F H;  4QIW E;  4UP8 A;  4KI0 A;  4A3F G;  1OTC A;  1N34 L;  2CCZ A;  1EIY B;  4GNX B;  2XTI A;  3HOU H;  4JOI A;  2CFM A;  4AYB G;  3G4S A;  3HOU G;  4GKK Q;  5IYC G;  2BH2 A;  1I6H H;  2D0P A;  3ULP A;  1N32 L;  3I4M G;  1HZB A;  3U4V A;  4BXX H;  4BXX G;  4LF6 Q;  4ALP A;  1NMG A;  2MFI A;  1J5E L;  1YIT A;  2JEB I;  3NEL A;  1FGU A;  3UE1 A;  4AH6 A;  2VQE L;  2A8V A;  3J81 i;  3RZD H;  4QJF A;  3FHW A;  4KHP Q;  1WCM H;  4NXN L;  1XNQ Q;  1E1O A;  1XPR A;  4A3L H;  4HJ8 A;  4GN5 A;  1YJN A;  2YYZ A;  4BBS H;  4GKJ L;  4BBS G;  2RCN A;  5M3M H;  2CWA A;  5M3M G;  5IY0 A;  2CWP A;  3JAM c;  1HNW L;  3GDE A;  5M3F G;  1GM5 A;  2E5L Q;  4DV7 Q;  4JYA Q;  1MJE A;  3PF5 A;  2R6G A;  4YY3 L;  4A4I A;  4NXM Q;  2IHE A;  4QL5 A;  1E7Z A;  1P16 A;  2F3I A;  4L5Q A;  4GN4 B;  4GLA C;  1Q82 C;  3AFP A;  1JT8 A;  2VS1 A;  5LMU L;  2BA0 A;  3VDY A;  1N32 Q;  1C9O A;  2YU9 H;  3STB D;  2UUA Q;  1J5E Q;  4X66 L;  4IJH A;  3U50 C;  3SGI A;  3UE0 A;  3BU2 A;  1ASZ A;  2VQE Q;  3S2D H;  1WJJ A;  2JE6 I;  3CCS A;  1YVC A;  1Q12 A; 
#chains in the Genus database with same CATH topology
 4P72 A;  2RSN A;  2SNS A;  1HNZ L;  3VYU A;  1EWC A;  4UDU C;  1IHZ A;  3WWV A;  1GXD C;  1XX8 A;  3K81 C;  2Z4I A;  3J80 c;  1AH9 A;  3TBI B;  4DU9 A;  2AMC B;  1CI3 M;  3S15 B;  1J6Q A;  1CKO A;  1TWH B;  2YV5 A;  4JBJ A;  2MUY A;  3I56 A;  1BVS A;  4TKO B;  4DR1 L;  2CQA A;  2G9D A;  2WKD A;  5LMU Q;  2F0K A;  3J81 L;  1WTQ A;  5DM7 3;  4M1U B;  4U68 A;  1SNC A;  3TQY A;  2XGT A;  5IOD A;  4B3T L;  3J7Y W;  4YCU A;  1MJC A;  5JJI A;  1GUS A;  1RTO A;  1F9Q A;  2HDM A;  4DGZ A;  5C3E H;  5C3E G;  2IT1 A;  4OO1 G;  2Z0S A;  3EN2 A;  1Y8P B;  4JV5 L;  1DM0 B;  1LTA D;  3HKZ G;  3BVZ A;  1MI2 A;  4RCN A;  2IWH A;  4BBR G;  4R4O A;  4HN7 A;  3DM1 A;  2PW7 A;  5FLX E;  1EY4 A;  3I70 A;  2R93 H;  3R8B A;  1SNO A;  1EU4 A;  1TR5 A;  2IX0 A;  1NY4 A;  1R9T H;  1HJP A;  3PUY A;  1D1I A;  1CHP D;  1TII D;  2LKV A;  1SMX A;  2K75 A;  4R4C A;  2R7D A;  1Y1W G;  1RJT A;  3HOZ B;  2RQX A;  2PZU A;  1JB7 A;  1TKW B;  3M4Y A;  1XMO Q;  4HJ5 A;  3CCQ A;  3H3V C;  2RHQ B;  3I4L A;  3TP7 A;  4QGU A;  3TDQ A;  3NXW A;  1QVC A;  4JI3 Q;  3OTO Q;  3ICE A;  4WJW A;  2KA7 A;  3CCR A;  3GV3 A;  5IYC H;  1H9R A;  1NR2 A;  4HAE A;  3ULL A;  4C3J G;  2BE5 C;  1OXX K;  3RLO A;  3S1M H;  4PMC A;  1LTB D;  4R1J A;  3ND8 A;  4KKS A;  1EQR A;  5CV8 A;  3FPP A;  3IKJ A;  2NN6 H;  2JA7 B;  2NN6 G;  2A6E D;  4C3H H;  3HEJ A;  4C3H G;  4CBV A;  3W3A A;  3DWA A;  1M90 C;  4OX9 Q;  2KCC A;  4J15 A;  1PZJ D;  1B44 D;  1EY0 A;  1NJI C;  5COY A;  3BDL A;  2EXD A;  2K5D A;  1ESR A;  3ND9 A;  1PLF A;  3LGJ A;  2ZJR A;  5C5M A;  5KND A;  1BQQ T;  1BBX C;  3PO3 B;  5M3F H;  3KLS X;  4LFA Q;  1HQM C;  3D6W A;  4BA2 I;  3J7A F;  4TRD A;  1N34 Q;  4EQN A;  2X6L A;  4O0A A;  4LUO A;  1YJ9 A;  2M2L A;  1LT4 D;  1WTH A;  4DV1 L;  2B2U A;  2NYZ D;  1PFS A;  5IWA L;  4A3D H;  3D4D A;  4A3D G;  1VQC A;  1SAP A;  1OXS C;  1CZW A;  4BY1 H;  1EIF A;  4BY1 G;  2QW7 A;  2HCI A;  1KLG D;  3P20 A;  1ROD A;  1HNX L;  2F0Q A;  4DF7 A;  2EYL A;  5E1F A;  3OWF A;  5ELE A;  4JI7 Q;  3OSO A;  2IX3 A;  4YY3 Q;  4X62 Q;  2A69 C;  1GUO A;  2PPB C;  3TSS A;  4A3G H;  2F4I A;  4OWT B;  1CHQ D;  4A3G G;  2KJX A;  3GTO B;  1MIU A;  2ZTD A;  1D5X C;  2JXM B;  3S14 B;  4C2M B;  1HTP A;  3A56 A;  3MXP A;  2NVQ B;  4KJN A;  2ZTC A;  4LFC Q;  2RSO A;  4V19 0;  2I5M X;  1K9M C;  1I94 L;  4NB3 A;  1GUW A;  1ZYR C;  2QDB A;  3H3V I;  4K6L A;  2RDG A;  2JK8 A;  5IP7 H;  5LMN L;  4RAU C;  4PMW A;  5IP7 G;  2SOB A;  3A8J E;  4ODG A;  3HOY G;  2JA6 G;  4I65 A;  3C3L A;  1NSN S;  4A3K G;  2EDG A;  3S15 H;  1JE4 A;  4RFB A;  1ONL A;  2GVB A;  5K36 H;  5EPL A;  5K36 G;  1TWH H;  2EYO A;  1SN8 A;  2L55 A;  1LT5 D;  4FVM A;  5C3W A;  1VQJ A;  4AQY L;  1TS4 A;  5IYB H;  1VQ9 A;  1CUK A;  4B9X A;  4JI0 L;  1RF2 D;  3GTQ B;  3CMA A;  1PH8 A;  1L0X B;  1STY A;  4ZKB B;  1QIL A;  3GQB A;  3A7L A;  2X69 A;  1HR0 L;  4FF4 A;  3HOU B;  1Q3L A;  5BN3 A;  2NB0 A;  1SE8 A;  5ELD A;  3S2H B;  2PNR C;  1NCV A;  1UE5 A;  4DXG A;  4MNO A;  2XIW A;  3W1G A;  1WTR A;  1IBL Q;  1A15 A;  5C0X J;  1WCM B;  1VQN A;  5D14 A;  4BBS B;  2TSS A;  5M3M B;  3BG3 A;  1N9W A;  1H95 A;  5JEA J;  3DMU A;  4IFD H;  1PTO C;  1WTV A;  2L5T A;  2RF4 A;  2WP8 J;  3HRZ C;  2UU9 Q;  3HOZ H;  1LV9 A;  3HOZ G;  3I7F A;  1V8Q A;  1Q81 C;  3CPF A;  3MTS A;  4DK0 A;  4JBW A;  2BOS A;  5IGD A;  4LF5 L;  3VYR A;  4FF1 A;  2IL8 A;  4FP5 D;  4A3C H;  5C0X H;  5I2Y A;  5C0X G;  1QB5 D;  1ZXT A;  1A2T A;  3W5O A;  2NZH A;  1VS0 A;  2F0F A;  1YNJ C;  2ALY B;  1KAW A;  1E2Z A;  1VF7 A;  5JOB A;  3BZK A;  3OW2 A;  1YNX A;  1VQ6 A;  4B3R Q;  1DOK A;  2GN5 A;  3PUW A;  5JEA H;  4G57 A;  2RKS A;  5JEA G;  4ME3 A;  4RG1 A;  3J81 c;  1W6J A;  2N78 A;  1SJH D;  1UE7 A;  2JA7 H;  2OEO A;  2JA7 G;  1PTO F;  2SNM A;  2B39 A;  3EFX D;  3N6R A;  1Q46 A;  1WTP A;  4JI1 L;  3T1Y L;  4H0L C;  3E6Z X;  1V1P A;  2E2J H;  5EGT A;  1S40 A;  1C7Y A;  3PO3 H;  3PO3 G;  2QGQ A;  1RCV D;  1EZ8 A;  4OO1 I;  4FYD A;  1ZYR D;  2K5N A;  3S24 A;  2PI2 A;  4XQQ A;  1HA5 A;  4B3S Q;  1PMR A;  2GA4 B;  1KXL A;  3KJP A;  4X64 Q;  2YTX A;  2KHI A;  1AW7 A;  2CQO A;  1I4Q A;  1D7Q A;  1AFP A;  2CHB D;  5IGE A;  2IJ0 A;  3FKI B;  4YHH L;  1H9K A;  3NWS A;  2HHH L;  3M9B A;  1I4R A;  4GOP B;  2HQL A;  1XNR Q;  4B3M L;  3F2U A;  1X55 A;  3BJU A;  1D6E C;  2VZA A;  1S3O A;  1Z9F A;  4XYO A;  1SBB B;  4HED A;  4B9W A;  3P75 A;  3OPO A;  4ZRZ A;  5IP9 G;  2Y0S B;  4HMI A;  1KAB A;  1G6Z A;  2ICI A;  4DR3 Q;  5IGF A;  1QWY A;  1PHJ A;  5FLX L;  2OQ0 A;  3GTO H;  4JI2 Q;  5JAV A;  1HPC A;  4C2M H;  2PQE A;  3CRK C;  4DR2 L;  2D5D A;  1A3V A;  4DV2 L;  3O13 A;  2NVQ H;  3GO5 A;  1Q1B A;  2D62 A;  4PNY A;  2KVM A;  1RDP D;  5IE8 A;  3T51 B;  1IYJ B;  3HOX G;  1CA5 A;  1PRT C;  5J39 A;  1EWI A;  3U9S A;  1S72 A;  3PF4 A;  4K0K Q;  1DON A;  3SDZ A;  1WYD A;  1VQP A;  5F2D A;  4DNR B;  1I4H A;  1FVI A;  3GTG B;  3M4P A;  4K2L A;  1HZA A;  3SK6 A;  1PV4 A;  1FJG Q;  3S1N B;  3M3Y B;  2AUK A;  2F0H A;  1Y1V G;  4JVZ A;  3EJI A;  4PV1 C;  3ONA B;  5EKK A;  5I9P A;  5M9O A;  1MGS A;  2Q8R E;  3SK4 A;  4KY6 A;  3GTQ H;  1YNJ D;  3J7A V;  2BDN A;  3SK5 A;  1SYF A;  4NXM L;  1S5D D;  1A3U A;  1EIY B;  1TS5 A;  1PFN A;  1WD1 A;  3HOU H;  2CFM A;  3HOU G;  1WVL A;  4GKK Q;  1PRT F;  4FXK C;  2D0P A;  3ULP A;  1N32 L;  3T53 B;  4BXX H;  1HZB A;  4BXX G;  2H1E A;  2MFI A;  1J5E L;  4KV6 A;  1EQV A;  4Y7N B;  1LTI D;  4ZK9 B;  2B2W C;  5DM6 3;  2L4N A;  1VDZ A;  1S5E D;  1WCM H;  2HD3 A;  3MAQ A;  4NXN L;  3SVM A;  1E1O A;  1BO0 A;  1XPR A;  1Y8O B;  1YJN A;  4BBS H;  2NVT B;  4BBS G;  5M3M H;  2XVS A;  4EQO A;  1DCZ A;  5M3M G;  2E2H B;  4CDC C;  1UNS A;  2E5L Q;  2CH4 W;  4DV7 Q;  4JYA Q;  4A4I A;  3SHL A;  2NBF A;  1G8Z D;  2F0N A;  4K5W A;  1KDC A;  5KNB A;  5L37 A;  2LS0 1;  1F77 A;  2NZ1 D;  2XNA C;  1ENF A;  3QR8 A;  2NUC A;  3U50 C;  2L12 A;  3UE0 A;  2FFK B;  1TS3 A;  3QWN A;  2JE6 I;  1DD2 A;  1B2T A;  1K3R A;  2UXB L;  3HKZ B;  2HT1 A;  1O7I A;  4Q0F A;  4BBR B;  3K7A B;  1QOH A;  1HNW Q;  4C1N K;  2PMZ E;  1JWU D;  2C5C A;  1Z6H A;  1MKH A;  2MO0 A;  5NUC A;  5AJ3 L;  4IUR A;  1QUQ A;  5D3I B;  4X3S A;  2FIN B;  1DOL A;  4X65 L;  5JVG 3;  4AYB E;  2PZT A;  1Q1E A;  4RHS A;  1R9T B;  4LF7 L;  1E2W A;  2B2V C;  1VQ5 A;  4H02 A;  1QVG A;  1N33 Q;  1Y1W B;  1PRT D;  3WOE A;  5CBE E;  5JJK A;  3VR6 A;  1RTN A;  2KCN A;  3DEO A;  2ENB A;  1HUM A;  2GVA A;  4LJZ C;  4KK7 A;  1HZC A;  1X54 A;  1F9P A;  1YHA A;  1PA6 A;  2PW5 A;  1PTO B;  3FKI H;  3FKI G;  2VNU D;  3AQQ A;  3EIV A;  4LUV A;  2CKZ B;  4C3J B;  2OCE A;  3OMC A;  4L8J A;  4DUY L;  4DR1 Q;  1BBU A;  2NVY B;  3K6O A;  1F2M A;  3K5N A;  4X3T A;  1SRU A;  1ET9 A;  2DJG C;  2LMC B;  1ENC A;  1VQE A;  2QIL A;  3MXU A;  3BZC A;  4B3T Q;  1JE5 A;  2A68 C;  2Y0S G;  1KDB A;  1HRJ A;  3QB3 A;  4MIU A;  1X3E A;  1YHB A;  1YHQ A;  1LTR D;  3RLN A;  1CT1 D;  1AP0 A;  1XMQ Q;  3CCL A;  5CYU A;  1A62 A;  3F2B A;  4JV5 Q;  4TVA B;  3NTH A;  3J81 j;  2AKW B;  3PIP 3;  1WI5 A;  2K52 A;  3U58 A;  1T9H A;  1G91 A;  2PQA A;  4R9W A;  3HP3 A;  2K01 A;  3PO2 G;  2QEJ C;  2WAQ E;  3NQT A;  1QUQ B;  1HUN A;  3K80 C;  2UXD L;  3CF5 A;  3Q23 A;  4DR6 L;  4XTC S;  1G2T A;  3IFD A;  1F2Y A;  3NBH A;  3G7L A;  5BR8 L;  4HIM A;  3MXN A;  4IUP A;  1IKL A;  4P2C B;  1BCP B;  1WTX A;  1TU2 B;  3GTG H;  5C44 H;  5C44 G;  3T16 A;  3S1N H;  3CC4 A;  4PQX A;  3L3O C;  3M3Y H;  2L9H A;  1I50 B;  4UHV A;  4JI8 L;  2B8F A;  2ZM6 L;  4J8Q A;  1PZK D;  1EFW A;  2A6E C;  5FJ8 H;  5FJ8 G;  1NMF A;  2KCT A;  1KNE A;  3GP7 A;  3T4A C;  4WFN 3;  4DNT B;  5E3F A;  5FO8 B;  1PH7 A;  2B2W A;  3JC6 6;  3I4N G;  4FXD A;  4A3B B;  1XWE A;  4Y7N H;  1GHK A;  2F0G A;  3CD6 A;  4QIW B;  2F0T A;  3GD7 A;  4IUT A;  5FLX c;  1K28 A;  4QUF A;  4GNX C;  2O2L D;  2QA4 A;  2NVT H;  2F0M A;  2JA6 B;  3HOY B;  4X3K A;  2E2H H;  4A3K B;  4G7O C;  2B8G A;  1O7L A;  3K5M A;  4R4I A;  2PQA B;  3I8Z A;  3GV6 A;  1D5Z C;  1AEX A;  1EL0 A;  4QUC A;  4XQN A;  3ZJY C;  1J9O A;  4PZ8 A;  3NPP A;  2F0O A;  1ESF A;  4CJ1 B;  1XPU A;  3NBH B;  5DLQ E;  2ID0 A;  3MC0 B;  3LX0 A;  5IWA Q;  1NE3 A;  4OO1 H;  4IO9 A;  3OYY A;  2QEX A;  4NW2 A;  3MXN B;  3T1H L;  1SJE D;  2VUM G;  1K8O A;  4LW1 A;  3M7G A;  2KCM A;  4BBR H;  3K7A H;  3CXC A;  2O5I C;  2A68 D;  4QF4 A;  1HNX Q;  2J7Z A;  3S9W A;  2I5H A;  3MZ5 A;  1QZH A;  1KDA A;  3ERS X;  3A54 A;  4FF2 A;  4DV0 Q;  2KHJ A;  2MP1 A;  4ABN A;  2B2T A;  3SE0 A;  4FNF A;  4TSS A;  1NTG A;  2TMP A;  4N9P A;  2B2V A;  5TSS A;  2Z6K C;  1TXY A;  3AU7 A;  3PIP A;  1EQQ A;  3NWT A;  1F9S A;  4R8I A;  1LLR D;  2Q8I B;  4A3F B;  2F4V L;  1Y1W H;  1BBW A;  2KEC A;  1I94 Q;  4QQB X;  1QE6 A;  4YCV A;  4HJ7 A;  1KNA A;  2R7F A;  5LMN Q;  5EQ0 A;  5FLM G;  1II3 A;  3B6Y A;  1PTO H;  1Z47 A;  2UUC L;  1PYW D;  1STH A;  4C3J H;  2IW3 A;  4KN4 C;  2NVY H;  4JI0 Q;  4DAP A;  3MEH A;  4A3J G;  4IUQ A;  1X6O A;  3D4W A;  3NE5 B;  1DZ1 A;  3OHX C;  4LF8 L;  2DY8 A;  1XTC D;  4P73 A;  4EGV A;  3DM3 A;  1JQY D;  1XXG A;  1TVX A;  1F9R A;  1CZG A;  4IPH A;  4Y52 H;  2E2J B;  3CU7 A;  1HR0 Q;  2H4O A;  3PUZ A;  4RKL A;  3AFQ A;  2YU9 B;  1PVO A;  1FGB D;  1VQF A;  5E4W C;  1JB3 A;  1RKN A;  3CKI B;  3CCV A;  2N88 A;  4LFB L;  4HMJ A;  3HFZ B;  2D0O A;  1ZEQ X;  1F2L A;  4CKB A;  2EYP A;  2C35 B;  5IYD H;  5IYD G;  2WIN B;  5CV6 A;  2HDL A;  1HHV A;  3PUX A;  1IBM L;  2DJF C;  1BOS A;  2EY2 A;  1B8A A;  3F1Z A;  4KLK A;  3M4Q A;  4ZAI A;  1CKM A;  2OTJ A;  2B29 A;  5CV5 A;  4MZ9 A;  1N36 L;  1LTG D;  1I4X A;  1IBK L;  1FR3 A;  4RMF A;  1HXY D;  1LT6 D;  2VB2 X;  1I50 H;  1SLJ A;  1SYB A;  3E3X A;  2Z1C A;  4LF5 Q;  3NTI A;  3CW2 C;  4R4Q A;  1K83 B;  1B3A A;  4C1N I;  1TS2 A;  3MEF A;  1IZ6 A;  1OXU A;  2DGY A;  3NQI A;  3CC7 A;  1HTL D;  2Q8T A;  3QG1 A;  4L5S A;  1BKB A;  2WB1 B;  1RHP A;  4A3B H;  1Y8N B;  4A3B G;  2F0J A;  1X9N A;  5IT9 L;  1JMC A;  1LO5 D;  3RMH A;  4GNX A;  3FPU B;  4DV4 L;  2RVL A;  1ICW A;  3J7A 5;  4JI1 Q;  3T1Y Q;  3HOX B;  4DKA C;  2WII B;  1KRT A;  5FO7 B;  4BWG B;  1XJV A;  3C1E A;  4DR7 L;  3HOY H;  2JA6 H;  3D4R A;  5ELN A;  4F87 A;  1R4P B;  1QVF A;  2CVR A;  4A3K H;  2DY7 A;  2K05 A;  2VL6 A;  1ILP A;  4DAM A;  3E9I A;  2HQE A;  3HOV H;  2LY7 A;  3HOV G;  3A8K E;  1Y1V B;  4X6A H;  2A19 A;  2Z4H A;  3CPW A;  3AEV A;  2K5H A;  4A3E B;  4IUU A;  3TP8 A;  1FD7 D;  3BDC A;  1JWM D;  2WFW A;  3LWU A;  3G6J B;  5ELB A;  4UP9 A;  4DK6 C;  3OWE B;  3I4O A;  4YHH Q;  4LMQ D;  5LL6 X;  2HHH Q;  4E6I A;  5M5X B;  3BS1 A;  4EQP A;  5E4X A;  2JP1 A;  2E2I B;  1K3B C;  3CRL C;  3OTO L;  4QCL A;  4B3M Q;  3NTK A;  3PQI A;  2OWO A;  4WJ3 M;  3DWQ A;  4WRD A;  4LF6 L;  1DJR D;  2JJQ A;  1W3S A;  1QCB D;  1LM0 A;  2R61 A;  4FXG C;  1OXV A;  4KHP L;  4OX9 L;  4RGM A;  3W1B A;  1D2B A;  1U5K A;  2Z6K A;  4A76 A;  4NKL A;  3C1F A;  4DR2 Q;  4DK3 C;  1F2Z A;  4DR4 Q;  4DV2 Q;  4K5V A;  1I4P A;  4KY5 A;  3TRZ A;  5KYI A;  4A3F H;  3KBX A;  4MHE A;  4A3F G;  3FEW X;  1OTC A;  1N34 L;  1HQR D;  4GNX B;  1EZ6 A;  4OGQ C;  4L63 B;  4DA2 A;  1SFO B;  3I4M G;  3U4V A;  1IW7 C;  2EXZ A;  1YIT A;  1S5B D;  3NEL A;  4ZLT F;  2VQE L;  1EU3 A;  4UAI A;  4QJF A;  4ZYS A;  3I90 A;  2WKC A;  1TWG B;  1H9S A;  1SE2 A;  4KD3 A;  4HJ8 A;  4GKJ L;  3MVV A;  2RCN A;  1IL8 A;  2F0W A;  4OEL B;  2KED A;  3GDE A;  4Z9C B;  1V1O A;  3PF5 A;  2R6G A;  4X3U A;  4YY3 L;  4NXM Q;  4QL5 A;  2F3I A;  4L5Q A;  4GLA C;  2Z8L A;  4RGN A;  1N32 Q;  2YU9 H;  1ICF B;  3STB D;  5D65 A;  2UUA Q;  1J5E Q;  1W6K A;  3TN2 A;  3SGI A;  3S1Q B;  2F3V A;  3BU2 A;  4OIJ A;  3NEM A;  1SNM A;  4M8A A;  1YVC A;  4NXN Q;  2BDO A;  3KYH C;  1B9N A;  4IUV A;  4DR5 L;  2BA1 A;  4O2D A;  4K14 A;  1SNP A;  1VQH A;  1DXM A;  1EY6 A;  4ZCK A;  2F3W A;  1IYV A;  2EIF A;  3F2D A;  2F0V A;  1STB A;  2AQ2 B;  4KTA A;  5C4X G;  4DUZ Q;  2AWO A;  5IGG A;  2VQF L;  4XYQ A;  3DWP A;  1YNN D;  5IP9 H;  1STN A;  2P5Z X;  3DHQ A;  2EJM A;  4P75 A;  1K83 H;  1VQO A;  2EJF C;  3K7U C;  2Q2U A;  4GLX A;  2AUJ D;  3MFG A;  4LK1 C;  3D3R A;  1X3G A;  3H91 A;  1PH6 A;  2FMC A;  2UXB Q;  2K14 A;  4ME5 A;  5GQO A;  4LWC A;  3K57 A;  3NUC A;  1H9S B;  1CQV A;  1FNW A;  5LL6 S;  3J81 E;  1QG7 A;  3HKS A;  1V9P A;  2Q2I A;  4LF4 L;  2WB1 G;  3GTP H;  3PO2 B;  3R2I A;  5AJ3 Q;  4DV6 L;  5DEH A;  1A63 A;  3SXH A;  5A35 A;  3EQL C;  4X65 Q;  1E2V A;  4RKB A;  4F8M A;  3HOX H;  1V1P B;  3BVM A;  2CW0 C;  2ZJQ A;  1TWF B;  3VYS A;  2H5X A;  4LF7 Q;  1PDQ A;  2KOL A;  4DAY A;  2OXP A;  4JI6 L;  1JJ2 A;  3E0E A;  3A0J A;  3BYT B;  3HGB A;  3S17 B;  1KIX A;  5C44 B;  1SYE A;  4IPG A;  1IW7 D;  5FKA C;  1Y1V H;  1B1Z A;  1VQ8 A;  2UU9 L;  3RD4 A;  4A3E H;  4A3E G;  1V43 A;  2JA5 B;  3Q8D A;  4JI4 Q;  4ZUJ A;  2ZT9 C;  1VQI A;  5CGK A;  5M5X H;  2Q2H A;  2JA8 B;  1V1Q A;  1IYU A;  1SEB D;  1UWV A;  1PH4 A;  2E2I H;  2MQH A;  3OIP A;  2WAC A;  4DUY Q;  1SNQ A;  1J8I A;  3I4N B;  1DYQ A;  1Z7T A;  3MA2 B;  2EVB A;  2Q2T A;  2YTY A;  4ZQ3 A;  5EJW A;  1ZKO A;  3DUZ A;  4UP7 A;  4NDX A;  1EY8 A;  2XWB B;  4C3I G;  3G71 A;  5I6Y A;  4K8I A;  1X65 A;  1KTK A;  3A5Z B;  2RDF A;  3Q22 A;  4DAV A;  1D5M C;  4PZ7 A;  5JJL A;  3CCE A;  2RDH A;  5IT9 c;  1M4V A;  2IPK D;  4OIK A;  1AE3 A;  1Q8I A;  2UXC L;  3S16 B;  5JPM C;  1X3Q A;  1SFO H;  3ERO A;  4R4T A;  1TQO A;  2UUB L;  4DR6 Q;  2EYH A;  4CKE A;  2Y0S E;  4N8F A;  4ULL A;  5BR8 Q;  4ILW A;  4DAY B;  1S5F D;  2VUM B;  3UDX A;  3OW7 A;  1I6V C;  2AHO B;  1GD7 A;  3CCU A;  1X3P A;  3H0G G;  4IJL A;  1XNR L;  1TWG H;  2I5L X;  3PGZ A;  3I72 A;  1JJC B;  4JI8 Q;  2MGS A;  2E74 C;  3L0O A;  2ZM6 Q;  4KD4 A;  5GRO A;  4A3I G;  2EY1 A;  4IPC A;  3VR4 A;  3CCJ A;  2QDL A;  4DR3 L;  1A0I A;  4DN4 M;  1I3Q B;  2JN4 A;  3D8G A;  3OMG A;  3I55 A;  4JI2 L;  2EYJ A;  4XQJ A;  3K58 A;  4GZY C;  2Z9H A;  2K50 A;  1U4M A;  4KHZ A;  4X66 Q;  2O5J C;  5K5P A;  3AYH B;  3S1Q H;  1VMC A;  4QMG A;  2D2C C;  2CW0 D;  3K8A A;  1A8V A;  5DNF A;  4LF9 L;  1HNZ Q;  4P74 A;  3T13 A;  4UPA A;  5ELC A;  4IN3 A;  4GLV B;  1FL0 A;  4HSV A;  4HSP A;  2B63 B;  3GTK B;  1X32 A;  4JK1 C;  3UI2 A;  2F0S A;  3PMF A;  4RA8 A;  1UEA B;  4A3J B;  3H3V H;  1KAA A;  3NP8 A;  1SE4 A;  1UAP A;  2E2D C;  4A3M G;  1GO3 E;  2QKI C;  1QJO A;  3H15 A;  5KEE A;  4O42 A;  1SND A;  2DUD A;  3IRB A;  3T1H Q;  1L2F A;  3EVQ A;  4DV5 L;  1BF4 A;  3A55 A;  1I6H B;  4HIK A;  4GKK L;  1CKN A;  1HZ9 A;  3RUZ A;  3EA6 A;  1RL2 A;  4JOI C;  1SYC A;  4IFD I;  3PO2 H;  1YI2 A;  4MN3 A;  1PXU A;  1K73 C;  5HGT A;  1CFM A;  1R4Q B;  3SR1 A;  1U4P A;  2FJ2 A;  5LHY 1;  1UUP A;  1WTW A;  2K1B A;  1TWF H;  4G7H C;  2K32 A;  3VA5 A;  3A8I E;  4HIO A;  4ID6 A;  3AB9 A;  2EYF A;  1ENA A;  3K59 A;  3G6E A;  4BA1 I;  2F4V Q;  3S17 H;  4B08 A;  1ML0 D;  3HKZ E;  4N9T A;  4RGT A;  3GTL H;  4JCV E;  3MFY A;  4DNI A;  2JA5 H;  2AQ1 B;  4PMB A;  2JA5 G;  4K6D A;  3PV0 A;  4DV3 L;  1BNZ A;  5LMN W;  3K5L A;  1SMY C;  2JA8 H;  1EY5 A;  2UUC Q;  4JBM A;  2JA8 G;  3H09 A;  4PZ6 A;  3Q0A A;  4H7B A;  1M8A A;  1E22 A;  1SR3 A;  2A6H C;  3I4N H;  3KF8 A;  4LNQ A;  4A3L G;  1B50 A;  5KNC A;  1GJX A;  1GUG A;  4LF8 Q;  1X56 A;  3BVG A;  2OTL A;  1VQB A;  3TZU A;  5GAG C;  1HR0 W;  1CKN B;  3P7J A;  4JG2 A;  2KQ3 A;  4F88 A;  3NK9 A;  3HOV B;  1U4L A;  5H1S E;  4LFB Q;  3TRE A;  4CGY B;  1TT2 A;  1N33 L;  1PRT B;  1X3F A;  3S16 H;  2EZV A;  3F2C A;  2ICE C;  4JI5 L;  4DV1 Q;  4TQU S;  3S1R B;  4BY7 B;  1Y14 B;  3D31 A;  1JC7 A;  1IBM Q;  1D8L A;  2LXJ A;  2RA4 A;  3FDT A;  2EOT A;  1YZ6 A;  2VUM H;  3BZD B;  1Q86 C;  2ZXO A;  5HUR A;  1N36 Q;  3FMC A;  3JAM E;  1IBK Q;  2WAQ G;  2K5V A;  2R92 B;  2BCO A;  2MNA A;  5J3B A;  1UEB A;  3CAM A;  5J22 A;  1ET6 A;  2C9O A;  2HIV A;  4G4K A;  4IOA A;  2IHF A;  4KKU A;  4IUN A;  1I3Q H;  2JEA I;  1BXT A;  1HCZ A;  4R8N A;  5BN4 A;  3TS2 A;  1SXT A;  4OON A;  4C56 C;  1XMQ L;  1E3P A;  3KFU A;  3I73 A;  4IOC A;  4N8X 1;  3KF8 B;  2A74 C;  4YCW A;  1T5E A;  5I2X A;  2ATW A;  4KHV A;  1KQS A;  4CDE C;  2AWN A;  1EYA A;  2EQS A;  2JYO A;  5CC4 A;  4FF3 A;  1EIH A;  1NNX A;  4DV4 Q;  1JWS D;  2PCF B;  4GS3 A;  1UE1 A;  2R93 G;  1CM9 A;  1VMP A;  3FP9 A;  3I4M B;  3J80 E;  1YJW A;  4DR7 Q;  5FLM H;  3NBI A;  3EBE A;  3M4O B;  4CJ2 C;  1DGS A;  2M00 A;  3RN2 A;  4YWM A;  2B63 H;  3W2D A;  3GTK H;  2B63 G;  3P1H A;  1Q7Y C;  4AQY Q;  2K5Q A;  1XNQ L;  4GOP C;  4A3J H;  1TY2 A;  4YWK A;  2DNE A;  2NWG A;  1SMY D;  2HIX A;  1PFM A;  1C4Q A;  4K5X A;  2E76 C;  5ELO A;  1STG A;  4QIW E;  4UP8 A;  2A6H D;  4LAA A;  2CCZ A;  1Y69 U;  2XTI A;  2XN9 C;  4JOI A;  5IYC G;  2BH2 A;  1I6H H;  5EBD A;  4LF6 Q;  4IQZ A;  4ALP A;  3UE1 A;  4AH6 A;  3ZYY X;  3J81 i;  2V4D A;  4KHP Q;  2K6A A;  1NUC A;  4H44 C;  5A2Q E;  2B2Y C;  2CWA A;  5IY0 A;  2CWP A;  2K7V A;  5M3F G;  5C4X B;  1MJE A;  5CV9 A;  3E5S A;  3T56 B;  1Q82 C;  1SDF A;  4GN4 B;  1T5X D;  5LMU L;  4RGO S;  3VA7 A;  1C9O A;  2QF7 A;  5J1Z A;  2G9H D;  2XRS D;  3A7A B;  1CQF A;  4IJH A;  1QNU A;  4CDD C;  1GUN A;  1H9J A;  2Z6B A;  1SSO A;  2VQE Q;  4DK1 A;  2A73 B;  3S2D H;  1WJJ A;  3TME A;  3CCS A;  1QNK A;  3CME A;  2V1C C;  3E9H A;  1EFI D;  4HJ9 A;  4GKJ Q;  4ZKC B;  2F0E A;  4ZUI A;  2B3G A;  3GTP B;  1VQ4 A;  1NR4 A;  4KKT A;  2KBN A;  3URY A;  3STB C;  5M5W H;  4RH6 A;  5I6W A;  3DEP A;  3LNN A;  1B53 A;  4DV0 L;  4JW0 A;  3RNU A;  1WOC A;  5FK9 C;  5JPN C;  1B70 B;  1JJG A;  1SE3 A;  1TWC B;  2SDF A;  1MBY A;  4KMU C;  1TWA B;  2KEE A;  3QOL A;  2IY5 B;  1KHI A;  4APV A;  1K0R A;  2LFN A;  3D0F A;  3ITP A;  3VR3 A;  3KK7 A;  1I5F A;  4RHR A;  1HH2 P;  1PFB A;  4KY7 A;  3WOF A;  1BDO A;  2CH4 A;  2RHS B;  1XMO L;  1VQL A;  4A93 B;  2MO1 A;  1E24 A;  4DR5 Q;  1XYI A;  2ZXP A;  1ILQ A;  1LUZ A;  2N49 A;  3S1R H;  1WD0 A;  4BY7 H;  1L0W A;  2I07 B;  4BY7 G;  3CP0 A;  1YNN C;  5G3L F;  3Q6S A;  4JI3 L;  3UDF A;  3AMU A;  4RCO A;  3NEN A;  2J4X A;  1Q8K A;  1YEZ A;  4XT1 B;  3C46 A;  2VQF Q;  5C5L A;  2R92 H;  2R92 G;  5IYB G;  5KRU A;  3I3C A;  3V05 A;  4EVO A;  3HG9 A;  1JOR A;  4HR7 B;  2XSC A;  4C3I B;  1NBW A;  1A2U A;  2PZW A;  1JR0 D;  2BE5 D;  2SEB D;  2R7Z B;  5CR3 A;  2NVX B;  1C8C A;  2L0C A;  4HID A;  4OWX B;  4IFD J;  3TS0 A;  2FXQ A;  4XXE A;  1E1T A;  4L6T B;  4O1N A;  3PCO B;  4LF4 Q;  4LFA L;  3PIO 3;  3KDF A;  3K0Y A;  4DV6 Q;  5GAE C;  4WJ4 A;  1KD1 C;  4Q5V A;  3HOW B;  4GN3 B;  1OXT A;  4POG A;  3RR5 A;  3VR5 A;  3I4M H;  3E0J A;  1YIJ A;  3V2T A;  1W2B A;  1L1O C;  1N8R C;  4L5T A;  3M4O H;  4JI6 Q;  2L11 A;  2JSO A;  4UY8 C;  1D1K A;  5IIF A;  1CK1 A;  4GOP A;  4IFD G;  3H0G B;  4MTN A;  1JOO A;  4QB4 A;  5I9O A;  3NHH A;  3L2P A;  2XRQ D;  2AQ3 B;  1EYC A;  3D6C A;  2WB1 E;  4A3I B;  2JA9 A;  5CBA E;  1DOM A;  3ER0 A;  4QY7 A;  4A3C G;  1EYD A;  4JI7 L;  1I4G A;  1GOZ A;  4X62 L;  3TP5 A;  2N8N A;  1PYS B;  3CQZ B;  1FNU A;  4HJA A;  3H6M A;  1PH2 A;  1SRO A;  4POF A;  3MHB A;  1B7Y B;  1KC8 C;  5M5Y B;  4CDF C;  2DNC A;  1WFQ A;  2A69 D;  2I46 A;  5G3L D;  1JCK B;  1GKH A;  1KRS A;  4NP5 A;  5T1I A;  1U4R A;  4LFC L;  2O4X A;  2A5H A;  1L0Y B;  2K33 A;  1VF5 C;  2B2Y A;  1VQG A;  1VQK A;  4KJO A;  3CCM A;  5DAU A;  3Q24 A;  3R3O A;  4IZ8 A;  4YWL A;  5COR A;  1K8A C;  1EUJ A;  3KLR A;  1ASY A;  5JVH 3;  5C4H A;  3SK8 A;  3OOC A;  2HCC A;  5C4X H;  3RZO B;  5C4Z A;  4CHT B;  5E7N A;  3KDF B;  2N55 A;  2FHT A;  1PH1 A;  3WDN A;  2F0D A;  2YTV A;  2UXC Q;  1BCP C;  3L9A X;  4J6H A;  3TZD A;  3IFT A;  4J1M A;  5C4J B;  3JAM L;  3CC2 A;  3KUP A;  4A3M B;  2E75 C;  2VB3 X;  2UUB Q;  1EOV A;  2F03 A;  1E0B A;  1A6X A;  2LXK A;  1LTL A;  3MWY W;  3GTM B;  5HGQ A;  2G5D A;  1SYG A;  1BUV T;  1PZI D;  1FYC A;  3BYY B;  4S3S A;  1VQ7 A;  4YIJ A;  1CSQ A;  1LAB A;  1M1K C;  5JJZ A;  5CV7 A;  1O78 A;  3A74 A;  1IBL L;  2N3S A;  3I2Z A;  3GTJ B;  3RN5 A;  3KOJ A;  2ASB A;  2PO4 A;  1BCP F;  5GAD C;  1RD9 D;  4RWS C;  3HS0 C;  3DLL A;  1GVP A;  3V96 A;  2NZO A;  1BR9 A;  3J80 L;  1IKM A;  1JIC A;  1TWC H;  3S14 H;  3QO2 A;  2PMZ B;  4XDX A;  4DR4 L;  1TWA H;  1MD2 D;  3PIO A;  2K04 A;  5ISR A;  1OO9 B;  2F52 A;  2KUM A;  3FRP B;  1FNV A;  4LF9 Q;  3GTL B;  1EYG A;  2KHS A;  3QJY A;  4AYB B;  2RBM A;  1G29 1;  2OT2 A;  4A93 H;  5C3X A;  4A93 G;  5EAY A;  3DXJ C;  2NN6 I;  1PTO D;  4DFA A;  1LAC A;  2F0U A;  2VY3 A;  3LWE A;  3R2T A;  1G51 A;  1VQA A;  4KN7 C;  4I7A A;  5EBC A;  3RZD B;  1JOK A;  3U9O A;  5GAH C;  3NSW A;  4K2K A;  5D3D A;  5EPJ A;  4B3R L;  1K0S A;  3HZX A;  1O7Y A;  4XT3 B;  3IL8 A;  1PH3 A;  3JAM i;  2ES2 A;  3K0X A;  2EYM A;  1C48 A;  4IPD A;  1K8M A;  1LT3 D;  2NTT A;  4NMZ A;  3BDO A;  2ZTE A;  4C3I H;  2R7Z H;  4EQ5 A;  2R7Z G;  2J0T D;  3KLS A;  4DV5 Q;  2NVX H;  1IXR A;  2K03 A;  1B4O A;  1AE2 A;  1WTO A;  5A2Q L;  3H94 A;  3KF6 A;  4G7Z C;  4MTK A;  2UUA L;  3S2H H;  1CSP A;  2I0Q A;  3G48 A;  3J7Z C;  5T1G A;  4JBK A;  1TY0 A;  4L5R C;  3KLW A;  2HUG A;  3F8T A;  1EWH A;  5KGU A;  4B3S L;  5EPK A;  1AZQ A;  3TP6 A;  4A75 A;  3TEH B;  3HOW H;  3N52 A;  2UXD Q;  1L1O A;  1WCM G;  3HOW G;  4JC0 A;  5AFW A;  4X64 L;  1B3Q A;  4JPB W;  5IGB A;  2JQO A;  4OWW B;  4PG3 A;  4DXF A;  4HCS A;  2KEN A;  4OHJ A;  4OL7 A;  1BCP D;  2NTS A;  1K8G A;  2K5W A;  2OF1 A;  1STA A;  1S5C D;  4LUZ A;  3J80 i;  5FO9 B;  5KYL A;  1B9M A;  3H0G H;  4DUZ L;  4F7X A;  2WAQ B;  2EE1 A;  2LSS A;  1STE A;  1GHJ A;  2A1A A;  2K28 A;  3A5U A;  1C0A A;  3ERQ A;  2DN8 A;  3C2P A;  2WV6 D;  3UDG A;  2F0L A;  4A3I H;  2PNH A;  5CV4 A;  4OXP A;  4DV3 Q;  5C3E B;  2EY6 A;  4I7Z C;  3CQZ H;  1VQD A;  3PSI A;  4AIM A;  2VXW A;  1IL2 A;  4H13 C;  1XPO A;  1QZG A;  1HFN A;  1MHW C;  5M5Y H;  1P8L A;  4IAL A;  1U0L A;  3M85 A;  1G6P A;  1LTT D;  2PI2 E;  2R93 B;  2PYK A;  3KJO A;  2BH8 A;  4BS9 A;  1UE6 A;  4CJ0 B;  5IGC A;  1G2S A;  5KIX A;  3UDI A;  2EPB A;  2XWJ B;  1LYL A;  2B2T C;  2F0I A;  3U4Z A;  2IX1 A;  3KF6 B;  2MHV A;  3VR2 A;  3IAY A;  4K0K L;  1S4Z A;  1MSH A;  2L1B A;  3RZO H;  1EY7 A;  5IT9 E;  3OIQ A;  2OQK A;  1EQT A;  3K5O A;  4NPS A;  2EJG C;  2F0P A;  3VYT A;  3X3M A;  4XIG S;  1HFG A;  4HTH A;  1CA6 A;  1FJG L;  4EX5 A;  5C4J H;  2VW9 A;  1GUT A;  1U9R A;  1L1O B;  4A3M H;  1YBY A;  3X3N A;  4JI5 Q;  1A3T A;  1O7Z A;  1CTM A;  4JI4 L;  1EY9 A;  1KL9 A;  3KBG A;  1PYB A;  1EEF D;  2X6G A;  3PUV A;  3GTM H;  3R93 A;  1VCI A;  1PH5 A;  2E8G A;  3S1M B;  1O80 A;  3M7N A;  1RIP A;  2ZXR A;  1EEI D;  4FDB A;  4V0B A;  3SEB A;  4C3H B;  4DPG A;  2L15 A;  2RCF A;  3GTJ H;  4FO2 A;  3QIA A;  1VQM A;  1Q90 A;  3RLF A;  1AN8 A;  3ULJ A;  2K4K A;  5ELF A;  2EY5 A;  1NAP A;  4P71 A;  3L7Z C;  1MSG A;  5M3F B;  5C0X I;  2ZJP A;  1PH9 A;  1AZP A;  5HY6 A;  2E5L L;  4DV7 L;  1XTD A;  4JYA L;  2FMM A;  4KI0 A;  5EKI A;  4U67 3;  4OEM B;  1HA6 A;  4AYB G;  3G4S A;  1NMG A;  5CMD A;  2F1M A;  3I91 A;  2JEB I;  4A3D B;  2B2U C;  4K8J A;  1FGU A;  5BN5 A;  3S2D B;  2A8V A;  3QOJ A;  3RZD H;  4BY1 B;  3FHW A;  5IOC A;  4WOR A;  2M9V A;  1XNQ Q;  2MJ8 A;  5FOB B;  4A3L H;  4GN5 A;  2YYZ A;  3MXG A;  1EOT A;  1EIG A;  3JAM c;  1SYD A;  1HNW L;  4HCE A;  5EKL A;  1GM5 A;  5M5W B;  5C6A A;  3CHB D;  2MPM A;  2QCP X;  4A3G B;  2IHE A;  1E7Z A;  1P16 A;  2R3Z A;  1JOQ A;  1JT8 A;  3AFP A;  2VS1 A;  5I4D A;  2BA0 A;  3VDY A;  1KLU D;  3FVQ A;  2D9U A;  4X66 L;  4CKC A;  1H9M A;  1ASZ A;  1LTS D;  1Q12 A; 
#chains in the Genus database with same CATH homology
 1K3R A;  4NXN Q;  4P72 A;  1HNZ L;  3CME A;  2UXB L;  3KYH C;  2V1C C;  2HT1 A;  1O7I A;  3E9H A;  4HJ9 A;  4GKJ Q;  4DR5 L;  2BA1 A;  4O2D A;  3WWV A;  2B3G A;  1HNW Q;  1VQH A;  3K81 C;  2PMZ E;  3J80 c;  1AH9 A;  2EIF A;  2AMC B;  3F2D A;  1VQ4 A;  1MKH A;  2MO0 A;  1J6Q A;  5AJ3 L;  2KBN A;  5M5W H;  3STB C;  1CKO A;  5C4X G;  1QUQ A;  4DUZ Q;  2AWO A;  2YV5 A;  4JBJ A;  3I56 A;  4X65 L;  4AYB E;  1BVS A;  4DV0 L;  4DR1 L;  3RNU A;  1Q1E A;  1WOC A;  2VQF L;  1B70 B;  5LMU Q;  1JJG A;  4LF7 L;  5IP9 H;  3TQY A;  2XGT A;  4P75 A;  4B3T L;  1K83 H;  1MJC A;  4YCU A;  1VQ5 A;  5JJI A;  1VQO A;  3K7U C;  2Q2U A;  2IY5 B;  5C3E H;  4H02 A;  4GLX A;  1KHI A;  5C3E G;  2IT1 A;  4APV A;  1QVG A;  1N33 Q;  1K0R A;  4OO1 G;  5JJK A;  1X3G A;  3D0F A;  2Z0S A;  1PH6 A;  2UXB Q;  2K14 A;  1I5F A;  3EN2 A;  1HH2 P;  5GQO A;  4LWC A;  2RHS B;  1XMO L;  3HKZ G;  2GVA A;  1VQL A;  2MO1 A;  4JV5 L;  1E24 A;  4DR5 Q;  3HKS A;  4BBR G;  1HZC A;  1LUZ A;  1X54 A;  2N49 A;  3S1R H;  1YHA A;  1V9P A;  2Q2I A;  4R4O A;  1L0W A;  1PA6 A;  4LF4 L;  4BY7 G;  2WB1 G;  3CP0 A;  3FKI H;  3GTP H;  3FKI G;  2VNU D;  1A63 A;  5AJ3 Q;  3AQQ A;  4DV6 L;  3EIV A;  4JI3 L;  3UDF A;  3CCL A;  2R93 H;  4LUV A;  3NEN A;  2CKZ B;  4X65 Q;  1Q8K A;  1YEZ A;  2OCE A;  4DUY L;  4DR1 Q;  1BBU A;  3HOX H;  2VQF Q;  2R92 H;  1SRU A;  2R92 G;  2IX0 A;  5IYB G;  2ZJQ A;  1NY4 A;  1R9T H;  2H5X A;  4LF7 Q;  1VQE A;  1HJP A;  3BZC A;  4B3T Q;  4JI6 L;  3PUY A;  1JJ2 A;  3E0E A;  1JE5 A;  3A0J A;  2Y0S G;  1KIX A;  1NBW A;  1SMX A;  2K75 A;  4R4C A;  1X3E A;  2R7D A;  1YHB A;  4IPG A;  1YHQ A;  3RLN A;  1Y1V H;  1Y1W G;  4IFD J;  4HID A;  4OWX B;  1XMQ Q;  1JB7 A;  4A3E H;  1VQ8 A;  2UU9 L;  3TS0 A;  2FXQ A;  1A62 A;  1V43 A;  3F2B A;  4HJ5 A;  4TVA B;  1E1T A;  4A3E G;  1XMO Q;  4JV5 Q;  3Q8D A;  3J81 j;  3CCQ A;  4JI4 Q;  2AKW B;  3PCO B;  2RHQ B;  4LF4 Q;  1WI5 A;  2K52 A;  3U58 A;  4LFA L;  1T9H A;  1VQI A;  3KDF A;  2PQA A;  4QGU A;  4DV6 Q;  5M5X H;  5GAE C;  2Q2H A;  3PO2 G;  1V1Q A;  1QVC A;  1UWV A;  2WAQ E;  4JI3 Q;  3OTO Q;  1QUQ B;  1PH4 A;  1KD1 C;  2E2I H;  3ICE A;  2MQH A;  4GN3 B;  3CCR A;  5IYC H;  4DUY Q;  1OXT A;  4POG A;  3RR5 A;  3K80 C;  2UXD L;  3I4M H;  3CF5 A;  3S1M H;  3ULL A;  4DR6 L;  3RLO A;  1OXX K;  4XTC S;  1YIJ A;  4R1J A;  1W2B A;  1L1O C;  1N8R C;  1EQR A;  4L5T A;  3M4O H;  4BY7 H;  2NN6 G;  2Q2T A;  5BR8 L;  4HIM A;  2YTY A;  4JI6 Q;  4C3H H;  4UY8 C;  4UP7 A;  4GOP A;  4IFD G;  1M90 C;  4OX9 Q;  4J15 A;  3GTG H;  1NJI C;  4MTN A;  5C44 H;  5C44 G;  3G71 A;  2EXD A;  3L2P A;  3S1N H;  3CC4 A;  3M3Y H;  3LGJ A;  2ZJR A;  1X65 A;  3A5Z B;  4JI8 L;  5M3F H;  2WB1 E;  2JA9 A;  2ZM6 L;  3ER0 A;  4BA2 I;  4QY7 A;  4LFA Q;  4A3C G;  4PZ7 A;  4JI7 L;  5JJL A;  4X62 L;  3CCE A;  2N8N A;  1PYS B;  1N34 Q;  1EFW A;  5IT9 c;  4HJA A;  5FJ8 H;  1AE3 A;  5FJ8 G;  2UXC L;  1NMF A;  4O0A A;  1PH2 A;  2KCT A;  4LUO A;  1SFO H;  1SRO A;  4POF A;  4R4T A;  1B7Y B;  1YJ9 A;  2UUB L;  4DR6 Q;  1KC8 C;  4DV1 L;  1PH7 A;  1WFQ A;  1PFS A;  3I4N G;  3JC6 6;  1GKH A;  1KRS A;  5IWA L;  2Y0S E;  5BR8 Q;  4A3D G;  4A3D H;  4LFC L;  1VQC A;  4Y7N H;  4DAY B;  3UDX A;  3CD6 A;  2AHO B;  1GD7 A;  3CCU A;  1OXS C;  4BY1 H;  1EIF A;  3GD7 A;  4BY1 G;  1VQG A;  1VQK A;  3H0G G;  4IJL A;  5FLX c;  1XNR L;  1TWG H;  2I5L X;  3CCM A;  4GNX C;  3PGZ A;  2QA4 A;  2NVT H;  1HNX L;  4YWL A;  1K8A C;  1EUJ A;  1JJC B;  4JI8 Q;  1ASY A;  2E2H H;  3L0O A;  2ZM6 Q;  5GRO A;  5C4X H;  4A3I G;  4JI7 Q;  4R4I A;  4IPC A;  4YY3 Q;  3CCJ A;  4X62 Q;  5E7N A;  3KDF B;  1A0I A;  2PQA B;  4DR3 L;  4A3G H;  4OWT B;  4A3G G;  1PH1 A;  1MIU A;  2YTV A;  2UXC Q;  2ZTD A;  3I55 A;  4JI2 L;  3CC2 A;  3ZJY C;  2UUB Q;  2K50 A;  4PZ8 A;  1EOV A;  4KHZ A;  4X66 Q;  1XPU A;  3NBH B;  5DLQ E;  2ID0 A;  5IWA Q;  3AYH B;  2LXK A;  1NE3 A;  1LTL A;  2ZTC A;  4IO9 A;  4LFC Q;  3S1Q H;  3OYY A;  2QEX A;  3MXN B;  5HGQ A;  2I5M X;  3K8A A;  1K9M C;  3T1H L;  1I94 L;  1A8V A;  4LF9 L;  1HNZ Q;  2VUM G;  4LW1 A;  4P74 A;  2KCM A;  4NB3 A;  3H3V I;  4BBR H;  3K7A H;  3CXC A;  1VQ7 A;  2JK8 A;  1CSQ A;  1HNX Q;  5IP7 H;  4UPA A;  5LMN L;  5IP7 G;  4PMW A;  1M1K C;  4GLV B;  3HOY G;  2I5H A;  2JA6 G;  1QZH A;  1FL0 A;  4A3K G;  3A74 A;  3S15 H;  3ERS X;  2N3S A;  3I2Z A;  1IBL L;  2GVB A;  3RN5 A;  5K36 G;  3KOJ A;  1TWH H;  2ASB A;  1SN8 A;  5GAD C;  4DV0 Q;  1VQJ A;  2KHJ A;  4AQY L;  5IYB H;  3DLL A;  1GVP A;  1VQ9 A;  4WJ4 A;  1NTG A;  3H3V H;  1CUK A;  2NZO A;  4JI0 L;  3S14 H;  1TWC H;  4A3M G;  2Z6K C;  1TXY A;  3CMA A;  1GO3 E;  1PH8 A;  3PIP A;  4DR4 L;  1TWA H;  3H15 A;  1EQQ A;  3PIO A;  2F4V L;  2F52 A;  1BBW A;  2DUD A;  3IRB A;  1L2F A;  3T1H Q;  1Y1W H;  1I94 Q;  4LF9 Q;  1EYG A;  4DV5 L;  1HR0 L;  4QQB X;  4YCV A;  1G29 1;  4HJ7 A;  4A93 H;  4HIK A;  4GKK L;  4A93 G;  1SE8 A;  2R7F A;  1CKN A;  1HZ9 A;  5EAY A;  2NN6 I;  1RL2 A;  4JOI C;  5LMN Q;  5FLM G;  1UE5 A;  2VY3 A;  3B6Y A;  4MNO A;  4IFD I;  3W1G A;  1G51 A;  1VQA A;  1YI2 A;  3PO2 H;  1IBL Q;  1K73 C;  1Z47 A;  2UUC L;  5C0X J;  5GAH C;  1VQN A;  4C3J H;  4B3R L;  2NVY H;  4JI0 Q;  1TWF H;  4A3J G;  1X6O A;  1N9W A;  4LF8 L;  4HIO A;  1H95 A;  1PH3 A;  4P73 A;  3JAM i;  5JEA J;  3K0X A;  2ES2 A;  4IPD A;  3DM3 A;  3G6E A;  4BA1 I;  2F4V Q;  2ZTE A;  4C3I H;  3S17 H;  2R7Z H;  2RF4 A;  4EQ5 A;  2WP8 J;  3HKZ E;  4IPH A;  2R7Z G;  4Y52 H;  4DV5 Q;  1HR0 Q;  2NVX H;  1IXR A;  2UU9 Q;  3HOZ H;  3PUZ A;  3GTL H;  3HOZ G;  3I7F A;  1Q81 C;  1AE2 A;  3CPF A;  4JCV E;  3AFQ A;  4DNI A;  4JBW A;  2JA5 H;  1PVO A;  2JA5 G;  4LF5 L;  3KF6 A;  1VQF A;  4A3C H;  2UUA L;  3PV0 A;  3S2H H;  5C0X G;  1CSP A;  2I0Q A;  3G48 A;  3J7Z C;  3CCV A;  4DV3 L;  4JBK A;  4LFB L;  5LMN W;  4L5R C;  3KLW A;  3F8T A;  2NZH A;  3W5O A;  2UUC Q;  1VS0 A;  2D0O A;  3HFZ B;  4B3S L;  2ALY B;  4JBM A;  2JA8 G;  2JA8 H;  1KAW A;  4A75 A;  3TEH B;  4PZ6 A;  3HOW H;  2UXD Q;  3OW2 A;  1L1O A;  1WCM G;  2C35 B;  3BZK A;  1YNX A;  4JC0 A;  1VQ6 A;  1E22 A;  3HOW G;  1SR3 A;  4B3R Q;  4X64 L;  5IYD H;  2GN5 A;  5IYD G;  3I4N H;  4A3L G;  3PUW A;  4LNQ A;  5JEA G;  4ME3 A;  4RG1 A;  2JQO A;  3PUX A;  2N78 A;  3J81 c;  4OWW B;  4PG3 A;  1UE7 A;  1IBM L;  2JA7 H;  4LF8 Q;  2JA7 G;  1B8A A;  1X56 A;  2KEN A;  3F1Z A;  4KLK A;  3M4Q A;  1K8G A;  4LUZ A;  1CKM A;  3J80 i;  2OTJ A;  2B29 A;  2OTL A;  3H0G H;  4DUZ L;  1Q46 A;  1VQB A;  4MZ9 A;  1N36 L;  2LSS A;  4JI1 L;  3T1Y L;  2A1A A;  1IBK L;  3A5U A;  4RMF A;  2E2J H;  1C0A A;  1S40 A;  1C7Y A;  3PO3 H;  1I50 H;  1SLJ A;  5GAG C;  3PO3 G;  3UDG A;  1HR0 W;  4LF5 Q;  1CKN B;  2QGQ A;  4A3I H;  3CW2 C;  2PNH A;  4R4Q A;  4JG2 A;  4OO1 I;  3NEM A;  4OXP A;  2K5N A;  3S24 A;  4DV3 Q;  2PI2 A;  5H1S E;  4LFB Q;  3TRE A;  3MEF A;  4B3S Q;  1N33 L;  3CQZ H;  1VQD A;  1IZ6 A;  3PSI A;  4AIM A;  1OXU A;  1KXL A;  1IL2 A;  3S16 H;  1X3F A;  1XPO A;  2DGY A;  3KJP A;  1QZG A;  3CC7 A;  3F2C A;  4X64 Q;  4DV1 Q;  4JI5 L;  2YTX A;  4TQU S;  2KHI A;  5M5Y H;  2CQO A;  4L5S A;  1D7Q A;  1P8L A;  1Y14 B;  1BKB A;  3D31 A;  4YHH L;  1IBM Q;  4A3B H;  1U0L A;  1D8L A;  3M85 A;  4A3B G;  1X9N A;  2HHH L;  2LXJ A;  2PI2 E;  3M9B A;  1JMC A;  1G6P A;  1YZ6 A;  4GOP B;  2VUM H;  4GNX A;  4DV4 L;  3KJO A;  2BH8 A;  2HQL A;  1Q86 C;  1XNR Q;  1UE6 A;  1N36 Q;  3J7A 5;  4JI1 Q;  3T1Y Q;  4B3M L;  1X55 A;  1IBK Q;  4DKA C;  2WAQ G;  1KRT A;  3UDI A;  2K5V A;  3BJU A;  1XJV A;  2VZA A;  2MNA A;  3HOY H;  4DR7 L;  1S3O A;  1UEB A;  1Z9F A;  1LYL A;  5ELN A;  5J3B A;  2JA6 H;  2IX1 A;  3U4Z A;  1QVF A;  3CAM A;  4A3K H;  3KF6 B;  2VL6 A;  5IP9 G;  4K0K L;  4DAM A;  3RZO H;  2HIV A;  3E9I A;  4DR3 Q;  4IOA A;  2OQK A;  1PHJ A;  3HOV H;  2IHF A;  4NPS A;  3HOV G;  1I3Q H;  2OQ0 A;  3GTO H;  2JEA I;  4X6A H;  4XIG S;  4JI2 Q;  2A19 A;  3CPW A;  1FJG L;  4EX5 A;  2K5H A;  5C4J H;  2VW9 A;  3AEV A;  3TS2 A;  1L1O B;  4OON A;  1XMQ L;  1E3P A;  4A3M H;  4C2M H;  1YBY A;  2WFW A;  4JI5 Q;  3KFU A;  4IOC A;  4DR2 L;  3KF8 B;  4YCW A;  4UP9 A;  4DK6 C;  4JI4 L;  2ATW A;  4DV2 L;  3I4O A;  4YHH Q;  1KQS A;  2NVQ H;  3GO5 A;  1KL9 A;  2HHH Q;  2AWN A;  1Q1B A;  1PYB A;  2EQS A;  2D62 A;  3PUV A;  3GTM H;  5IE8 A;  4DV4 Q;  4GS3 A;  1UE1 A;  3OTO L;  2R93 G;  1VCI A;  1PH5 A;  4B3M Q;  2E8G A;  1IYJ B;  3FP9 A;  4WJ3 M;  2OWO A;  3M7N A;  3HOX G;  1RIP A;  1YJW A;  4DR7 Q;  5FLM H;  4LF6 L;  3EBE A;  1EWI A;  4FDB A;  2JJQ A;  1W3S A;  1S72 A;  3PF4 A;  1DGS A;  3RN2 A;  4DPG A;  2L15 A;  4K0K Q;  4YWM A;  1LM0 A;  1WYD A;  3GTJ H;  1VQP A;  2B63 H;  3GTK H;  2B63 G;  1OXV A;  1FVI A;  4KHP L;  3M4P A;  1Q7Y C;  4AQY Q;  3W1B A;  4OX9 L;  1XNQ L;  1HZA A;  4GOP C;  1VQM A;  1PV4 A;  3RLF A;  3ULJ A;  1FJG Q;  1U5K A;  1Y1V G;  2K4K A;  2Z6K A;  4A3J H;  4A76 A;  4YWK A;  4P71 A;  3L7Z C;  2HIX A;  5C0X I;  4DK3 C;  4DR2 Q;  3GTQ H;  2ZJP A;  1PH9 A;  4DR4 Q;  5HY6 A;  2E5L L;  4DV2 Q;  1XTD A;  4DV7 L;  4JYA L;  3TRZ A;  5ELO A;  4NXM L;  4A3F H;  4QIW E;  4UP8 A;  4KI0 A;  4A3F G;  1OTC A;  1N34 L;  2CCZ A;  1EIY B;  4GNX B;  2XTI A;  3HOU H;  4JOI A;  2CFM A;  4AYB G;  3G4S A;  3HOU G;  4GKK Q;  5IYC G;  2BH2 A;  1I6H H;  2D0P A;  3ULP A;  1N32 L;  3I4M G;  1HZB A;  3U4V A;  4BXX H;  4BXX G;  4LF6 Q;  4ALP A;  1NMG A;  2MFI A;  1J5E L;  1YIT A;  2JEB I;  3NEL A;  1FGU A;  3UE1 A;  4AH6 A;  2VQE L;  2A8V A;  3J81 i;  3RZD H;  4QJF A;  3FHW A;  4KHP Q;  1WCM H;  4NXN L;  1XNQ Q;  1E1O A;  1XPR A;  4A3L H;  4HJ8 A;  4GN5 A;  1YJN A;  2YYZ A;  4BBS H;  4GKJ L;  4BBS G;  2RCN A;  5M3M H;  2CWA A;  5M3M G;  5IY0 A;  2CWP A;  3JAM c;  1HNW L;  3GDE A;  5M3F G;  1GM5 A;  2E5L Q;  4DV7 Q;  4JYA Q;  1MJE A;  3PF5 A;  2R6G A;  4YY3 L;  4A4I A;  4NXM Q;  2IHE A;  4QL5 A;  1E7Z A;  1P16 A;  2F3I A;  4L5Q A;  4GN4 B;  4GLA C;  1Q82 C;  3AFP A;  1JT8 A;  2VS1 A;  5LMU L;  2BA0 A;  3VDY A;  1N32 Q;  1C9O A;  2YU9 H;  3STB D;  2UUA Q;  1J5E Q;  4X66 L;  4IJH A;  3U50 C;  3SGI A;  3UE0 A;  3BU2 A;  1ASZ A;  2VQE Q;  3S2D H;  1WJJ A;  2JE6 I;  3CCS A;  1YVC A;  1Q12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...