4DR5L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr5L00
3KLWA 4C3JH 2ZM6Q 2YV5A 4X64Q 1E24A 4JI7Q 4PG3A 3TEHB 5GAHC 1VQLA 4A3MG 2K5NA 3HKSA 2K52A 2JA6H 2CCZA 1XMQQ 2CKZB 3HKZG 3FKIG 2A1AA 4BXXH 2IT1A 3PUYA 4YCVA 4JCVE 2NVYH 2GN5A 3CC7A 4B3RL 4JV5Q 3GDEA 4X66Q 1CKNA 1Q12A 4PZ6A 4K0KL 1Q46A 2MNAA 4JI3Q 3FHWA 1CKMA 3RR5A 4A3KG 4WJ3M 2AWNA 1X9NA 4GKKL 2BH8A 2BA1A 1BBUA 4O0AA 1PFSA 1WJJA 3FKIH 1VQBA 1TWGH 3J81i 4JI5L 1SROA 1HZAA 3UDIA 2AWOA 2UUAL 4X65Q 1KC8C 3L2PA 1YITA 4DV0L 1FJGL 4DR5Q 1HR0L 4A3KH 1HNZL 2E5LQ 5ELNA 4LFCQ 3CD6A 3WWVA 1VQNA 1X65A 3M4QA 3K8AA 4OWXB 3MXNB 2Z6KC 2WB1E 1UWVA 4JI0L 1SLJA 5HY6A 4IFDI 1J6QA 1XTDA 3PUXA 2UXBL 3STBC 4R4CA 2HHHQ 1SMXA 1XPRA 1HZCA 2VQFQ 3RZOH 3T1YL 4QIWE 4JI1Q 1Q1BA 4DR1L 1VQOA 3BZCA 3E9IA 1A62A 2XTIA 3KF6A 4X62Q 3KJOA 4OWWB 3AFQA 1E1TA 2R92G 1PA6A 1J5EQ 3CC4A 2UXDL 2OCEA 4UP9A 2UU9L 1XPUA 4JYAL 4DV7L 3AYHB 3M7NA 3ERSX 1PVOA 4LF8L 1SR3A 3HOVG 1KL9A 2MO1A 3CAMA 1NBWA 4A76A 2AHOB 3K81C 1PH9A 1K0RA 4DV5Q 1VQ5A 4B3ML 1IBKQ 2QEXA 2E2IH 2UXCL 4BY7G 1WCMG 3KDFB 5M3FG 4YCUA 5JJIA 2K75A 1P8LA 3CMEA 3CP0A 3VDYA 2R92H 3G4SA 4JBWA 3KOJA 4POFA 1Q81C 1GM5A 4C3HH 3HOVH 1YIJA 1KQSA 3AQQA 1HZ9A 1VQGA 3OTOL 2XGTA 4BY7H 1WCMH 5M3FH 3ULLA 2IHFA 1UE7A 2OQ0A 5GROA 2OTJA 2HIXA 3ICEA 2VQEL 1IZ6A 4JI8L 1Q86C 4DUYQ 2PI2E 3J80i 4DV2L 3ER0A 1PH5A 1OXVA 2N3SA 4UY8C 4YWLA 2L15A 3S24A 5IP7G 4BY1G 3JAMi 3RNUA 4C3IH 4AYBG 1IYJB 3TREA 4BBSG 4DAYB 1N34L 1IBMQ 3HOYG 1UE1A 2JA7G 3GTGH 4GLVB 4BBRG 1AH9A 3I4OA 1UE5A 2PI2A 2CWPA 4LF7L 1N36Q 3T1HL 3D31A 1N33Q 2A8VA 3K7AH 3L0OA 4OO1G 5C4XG 4DUZQ 4LW1A 4LUZA 5IP7H 1GKHA 5FLMG 4HIDA 2DUDA 1OTCA 4BY1H 3KF8B 4BBSH 2HQLA 1K8AC 4JI4L 1E7ZA 3HOYH 4IPCA 3PUWA 4R1JA 2WAQG 1I5FA 4DV3L 3PO3G 4BBRH 3CCMA 1X3EA 4EQ5A 3RLFA 1I50H 1BVSA 5C4XH 3PIOA 3DLLA 4Y7NH 3Q8DA 5ELOA 1VQ6A 5M5YH 3CF5A 5FLMH 1HNXL 1LTLA 1TWCH 1BKBA 2IHEA 4GKJL 2JK8A 4A3GG 3PF5A 4DR3L 1V1QA 3PO2H 3PO3H 1HNWQ 4JBKA 1NTGA 5LMUQ 1RIPA 4DNIA 3F2CA 2JA5G 3AEVA 1SRUA 5IYBH 5JJLA 2NZHA 1A8VA 3I4NG 5AJ3Q 4A3GH 4P72A 1PYBA 3OW2A 3NEMA 4GNXB 3SGIA 4H02A 4GN3B 1YEZA 3A74A 4DR6L 4P71A 4GN5A 1R9TH 1IL2A 3H3VH 3F2DA 4DR2L 1SN8A 2NVXH 4LF4Q 3CCRA 1KRSA 5DLQE 1IBLQ 1PH8A 3UDFA 3PIPA 1VQ4A 3I55A 1BBWA 2IY5B 2ZM6L 5C0XI 4X64L 4QJFA 1ASZA 4JI7L 4LF5Q 4LFBQ 3J81j 1PHJA 1NMFA 2ZJQA 1EWIA 2Z0SA 1V43A 4NXMQ 1JB7A 2RF4A 4OWTB 3UE1A 1FGUA 4B3TQ 1K9MC 1LYLA 3PSIA 4YY3Q 1YJ9A 4JV5L 1VQEA 4X66L 2MFIA 2RHSB 5LMNW 2NN6G 1QVCA 4JI3L 4A3MH 4KI0A 2ZJPA 2YU9H 2Q2HA 3HFZB 4EX5A 3RN2A 2YTYA 2E2HH 3U50C 4YCWA 4L5RC 2HT1A 5JJKA 1Q1EA 2I5LX 4QGUA 1CUKA 4DV6Q 3BZKA 3PF4A 4LWCA 4X65L 4PZ8A 4O2DA 4LF6Q 2B63G 1N32Q 1Z47A 3UDGA 1QUQB 4DR5L 2R7FA 2WB1G 4UP7A 4C2MH 4AQYQ 3G71A 4R4IA 2EIFA 1XNRQ 2F4VQ 4KLKA 4YHHQ 3CCQA 2B63H 2I0QA 3EN2A 1VQDA 3HOUG 2HHHL 4JI6L 2VQFL 1YNXA 2KENA 4OXPA 3EBEA 2VUMG 3KDFA 1NE3A 4JI1L 2OTLA 2Q2TA 5H1SE 1YI2A 4X62L 3KYHC 4L5TA 3BU2A 2UUCQ 1RL2A 3CQZH 1L1OA 1XPOA 2Q2IA 4IPHA 3U4VA 2LSSA 2DGYA 1M90C 4BA2I 4DV1Q 4A3CG 1E22A 2IX1A 1B8AA 2VUMH 1IBKL 1X3FA 4LF9Q 3A5UA 1V9PA 1HZBA 5M3MG 1L1OB 2D0PA 4A3FG 4JBMA 2JA9A 1VQ7A 1XJVA 3CCVA 3S1NH 4A3CH 3CCLA 3HOZG 1KAWA 3GTKH 3PGZA 2UXDQ 3S1QH 4Y52H 1JE5A 4AH6A 5LMNQ 4LFAL 4JI2Q 4GOPB 5M3MH 4OX9Q 4A3FH 2ES2A 4DUYL 4FDBA 3TS2A 3PUZA 4IPDA 2YYZA 3HOZH 1Y14B 4HJ8A 1PH7A 4ME3A 4OO1I 5C0XJ 1IBML 1CKOA 4A93G 1S3OA 4PZ7A 2CQOA 4R4QA 1L0WA 5FJ8G 3J81c 4MZ9A 3S2HH 1N36L 1N33L 4QY7A 4QL5A 4MNOA 1Y1WG 3CCJA 4DUZL 5E7NA 2GVAA 4QQBX 4JBJA 1X6OA 5JEAJ 3W1GA 2JA7H 1Q8KA 2YTVA 3HOXG 5FJ8H 4XIGS 5GAGC 3U58A 3J7ZC 1B7YB 1SE8A 3K0XA 2NVQH 1X54A 3CXCA 2UUBQ 4TVAB 5M5WH 2R7DA 3I4MG 3HOWG 1VQJA 4HIOA 1Y1WH 1XNQQ 1YVCA 5IYCG 1G6PA 2KHJA 5IWAQ 4DAMA 1I94Q 3CPWA 5IE8A 2ZJRA 3T1HQ 4DK6C 3H3VI 4A4IA 2WP8J 3S15H 2AKWB 1LM0A 1UEBA 5C3EG 1YJWA 4GNXA 3AFPA 3HOXH 4B3SQ 1HNWL 5LMUL 1LUZA 1O7IA 1KXLA 1VS0A 1XMOQ 3HOWH 1JJCB 4IFDJ 5IYCH 3ULPA 4RG1A 3RLNA 1YBYA 1Z9FA 1AE2A 1WYDA 5HGQA 1QVFA 1HH2P 1HJPA 1X56A 2VL6A 2K5VA 2MO0A 1VQCA 1PH6A 1OXTA 3F8TA 5C3EH 5AJ3L 3ULJA 3A5ZB 3RZDH 1KRTA 3S1RH 1D7QA 2KBNA 4IO9A 1HNXQ 4DR4Q 3M85A 1Y1VG 5BR8Q 3JC66 2NZOA 2JA5H 4A3LG 4KHPQ 5EAYA 2RCNA 2N78A 4DV4Q 4HJ5A 3TS0A 3RN5A 4LF4L 3EIVA 3I4NH 1TWHH 4DR7Q 3KJPA 4TQUS 2OQKA 1EFWA 1B70B 1G51A 1VQ9A 2ID0A 2Z6KA 4NXNQ 3H0GG 1OXXK 4HIMA 3F1ZA 1Y1VH 4LFBL 4HIKA 3CPFA 2LXKA 3DM3A 4L5QA 3J80c 1XMQL 5GAEC 2NN6I 1GD7A 2Y0SE 3K80C 3M4PA 4NXML 1SFOH 1PH4A 4B3TL 1T9HA 1YHBA 3CW2C 4BA1I 2JA6G 4YY3L 1QUQA 2CWAA 4UPAA 5IP9G 4GLXA 2ZTEA 3UDXA 4IOCA 3BJUA 1K73C 2EQSA 1AE3A 4JOIA 1KHIA 1I3QH 3OYYA 3B6YA 3GO5A 5M5XH 4HJ9A 2NVTH 2Q2UA 1WI5A 4DV6L 3S14H 4LF6L 1CSPA 1EIYB 1N32L 5GQOA 2JQOA 5IP9H 4B3RQ 4GNXC 1PYSB 1U5KA 4YWKA 5C0XG 2E5LL 4AQYL 4DK3C 2K4KA 4LFCL 1D8LA 1NY4A 1FVIA 3HKZE 2R93G 3A0JA 4K0KQ 2YTXA 3PV0A 1QZGA 2R7ZG 2MQHA 5J3BA 1NJIC 5IY0A 1XNRL 2F4VL 4GKKQ 4X6AH 4YHHL 4A3JG 2KHIA 1K8GA 4APVA 3GTLH 3TRZA 1N9WA 1X55A 1P16A 4JI5Q 1C7YA 4J15A 3G48A 5C44G 2UUAQ 1VQFA 1A0IA 3ZJYC 5JEAG 2ATWA 1K83H 1YHAA 4DV0Q 3IRBA 2R93H 2K14A 1MJEA 1FJGQ 1CKNB 3I2ZA 2JA8G 1PH2A 1HR0Q 2R7ZH 2PMZE 3GTOH 1HNZQ 2UUCL 2C35B 1JJ2A 1JJGA 1J5EL 1VQHA 2JE6I 4A3JH 2HIVA 2KCMA 2B29A 3GTPH 3HOUH 4DV1L 2N8NA 4JI0Q 4HJAA 2OWOA 4DV5L 5C44H 4PMWA 1Q7YC 1CSQA 2LXJA 2VZAA 2UXBQ 1WFQA 4IJHA 3E9HA 2JA8H 4GOPA 4LF9L 2B3GA 3I7FA 1K3RA 3LGJA 4GS3A 3T1YQ 1PH1A 4JI6Q 4DR1Q 3U4ZA 2VNUD 2KCTA 4WJ4A 3GD7A 2JEBI 1PH3A 4IFDG 2QA4A 3GTJH 1QZHA 2VS1A 1A63A 5GADC 1EYGA 3PUVA 2UU9Q 4XTCS 4JYAQ 1I6HH 4DV7Q 4HJ7A 2EXDA 5FLXc 1YZ6A 4LF8Q 5LMNL 1L2FA 4B3MQ 4IJLA 4P74A 4JI2L 4POGA 4JOIC 4LUVA 3L7ZC 2UXCQ 1H95A 4OX9L 3F2BA 1S72A 1KD1C 2CFMA 3KF6B 3M9BA 2A19A 3FP9A 1GO3E 3MEFA 3H15A 2N49A 1U0LA 2ZTCA 5K36G 1VQAA 1MJCA 1VQMA 3GTMH 4LUOA 1EIFA 4MTNA 2E2JH 3OTOQ 4JG2A 1TWAH 3CCUA 4GN4B 1W3SA 2JJQA 2VY3A 4LFAQ 1GVPA 3PCOB 2VQEQ 4JI8Q 1YHQA 1TXYA 4NPSA 3G6EA 1C9OA 1WOCA 2D0OA 4DV2Q 1KIXA 4A93H 2JEAI 4OONA 4ALPA 1E1OA 1IXRA 2I5HA 4R4TA 3M3YH 2F3IA 1M1KC 3TQYA 1N34Q 4A3BG 4DKAC 1L1OC 3CC2A 2ALYB 2UUBL 1E3PA 2PNHA 1JMCA 3S17H 3GTQH 1C0AA 2K5HA 1Q82C 2QGQA 1DGSA 1XNQL 4AYBE 3CCSA 1EQQA 4LF7Q 5IWAL 1S40A 1TWFH 2ASBA 2K50A 2BH2A 1I94L 3CCEA 4IOAA 2E8GA 4A75A 3S16H 3RLOA 4NB3A 1NMGA 3NENA 4GOPC 4JI4Q 3E0EA 4B3SL 4A3BH 2IX0A 4A3EG 3I4MH 2RHQB 4DV3Q 1W2BA 3M4OH 4A3DG 1XMOL 3NBHB 1MKHA 2AMCB 3PO2G 1X3GA 4UP8A 3CMAA 4JC0A 4DPGA 4R4OA 4A3IG 2BA0A 2WAQE 2PQAA 4L5SA 1HR0W 4LNQA 5IYBG 3S1MH 1VCIA 4DR4L 5IYDG 3UE0A 1EOVA 4A3EH 4DR3Q 5BR8L 4P75A 1EUJA 1FL0A 1N8RC 1VQKA 1QVGA 2D62A 1VQIA 4A3DH 4KHPL 4GLAC 3D0FA 4IPGA 1G291 2ZTDA 1YJNA 4P73A 4AIMA 5C4JH 4DV4L 2H5XA 1OXUA 1IBLL 4A3IH 4DR7L 5IT9c 2PQAB 2Y0SG 2FXQA 3K7UC 1OXSC 4NXNL 3KFUA 3W5OA 4LF5L 4KHZA 2WFWA 1EQRA 1ASYA 3W1BA 4A3LH 1MIUA 5IYDH 2VW9A 3I56A 1JT8A 2GVBA 4YWMA 4RMFA 3JAMc 1PV4A 4DR6Q 2F52A 3STBD 3NELA 3J7A5 4DR2Q 1VQ8A 1UE6A 2R6GA 4BXXG 4GKJQ 3H0GH 1VQPA 3S2DH 2V1CC 2I5MX
chains in the Genus database with same CATH superfamily
1CK1A 1KNAA 3TEHB 1VQLA 2L4NA 4K14A 3HKSA 5CBEE 2JA6H 2A1AA 2F0FA 3PUYA 3S1RB 1ZYRD 5CV4A 3MWYW 3J81L 3K5MA 4K0KL 1Q46A 1W6KA 3FHWA 1CKMA 2EOTA 2FHTA 4A3KG 2AWNA 2RBMA 3G7LA 1PTOC 3FKIH 3J81i 3OMGA 1SROA 1CHQD 3N52A 3UDIA 5C0XH 2UUAL 1JOQA 1AN8A 4NP5A 5KRUA 1FJGL 4CBVA 1LTAD 4XDXA 3CD6A 3WDNA 2BDNA 2R61A 2RKSA 2WB1E 4JI0L 4IFDI 2UXBL 2XWBB 3T1YL 5I9OA 5JAVA 1SEBD 3J7AF 2NYZD 4JI1Q 1Q1BA 1HUMA 2XWJB 3BZCA 1VQOA 3ND8A 1PFBA 3CC4A 1ZKOA 4JYAL 2MJ8A 4ZCKA 4LF8L 3HOVG 5JVH3 4B3ML 4DV5Q 2QEXA 2WACA 1WCMG 3SE0A 3M4YA 4RHSA 1ZYRC 1P8LA 5J22A 3VDYA 2WB1B 3G4SA 2X6LA 3BVMA 3HZXA 2R93B 4C3IG 3SR1A 3AQQA 3OTOL 4K5WA 2OTJA 5GROA 2FMCA 3SVMA 1Q86C 4DUYQ 3ER0A 2N3SA 4YWLA 1J9OA 1CHPD 1IBMQ 3HOYG 5C3XA 4MN3A 2JA7G 3MC0B 5DAUA 3NBHA 4GLVB 3FEWX 3A8JE 3BDLA 1UE5A 3T1HL 4K8JA 3TSSA 1EY4A 4LW1A 1OTCA 4BBSH 1XWEA 1K8AC 4JI4L 1M8AA 2K5DA 2IWHA 4IPCA 1CTMA 4R1JA 1I5FA 3PO3G 1V1PA 3PIOA 4ODGA 5ELOA 3GTMB 2HD3A 3X3NA 3IKJA 1LTLA 1RDPD 1BKBA 1TWAB 1AW7A 5EGTA 4DR3L 1SNCA 1HA6A 4JBKA 1NTGA 2XNAC 4KTAA 4DA2A 4A93B 3AEVA 2DNEA 1SRUA 5IYBH 3FVQA 1D6EC 3KK7A 5JJZA 5AJ3Q 4A3GH 4B08A 4GNXB 3SGIA 4DR6L 1YEZA 4X3UA 4DK1A 2E2DC 2HCIA 4DR2L 3HOXB 4LF4Q 3CCRA 1V8QA 1UUPA 2XIWA 5DLQE 1IBLQ 2IY5B 3I55A 2LS01 2OEOA 4QJFA 1ASZA 3QIAA 3K5LA 1NMFA 3WOFA 3AU7A 2ZJQA 1EWIA 1E2WA 4NXMQ 1SDFA 3UE1A 4ZQ3A 3D3RA 4BS9A 5LMNW 4A3DB 1QVCA 3TP5A 4A3MH 1SYFA 5KNBA 3NWTA 2ZJPA 4H13C 4EX5A 2HT1A 4N9TA 1D5ZC 2F0TA 1Z47A 2EVBA 2E74C 2WB1G 1KLGD 4UHVA 3G71A 4R4IA 2N88A 2B63H 2I0QA 1VQDA 4JI6L 5M9OA 4GZYC 2AUJD 2O5JC 4OXPA 2F0UA 4JI1L 2JP1A 2G9DA 2JA6B 2RDGA 4L5TA 3BU2A 4IPHA 1DOKA 2LSSA 3DMUA 4O42A 1JICA 4L8JA 1EY5A 1JWMD 5HGTA 2KCCA 1CA5A 4IUVA 3HKZB 1AZPA 1HZBA 3FKIB 1STBA 5L37A 2BE5D 2L55A 4X3SA 1F9QA 3CCVA 3GTOB 4DAYA 2C5CA 4AH6A 4Y52H 4IUUA 1EEID 4OX9Q 2EJFC 3NBIA 2ES2A 4O1NA 4DUYL 4KKTA 5ELDA 1ICFB 4IPDA 2YYZA 1WD1A 4ME3A 5DEHA 4A93G 2IPKD 1IBML 1S3OA 1X3PA 1Z7TA 4U68A 4E6IA 3D4WA 5JVG3 2F0WA 1DOMA 5ELFA 1Y1WG 1X6OA 3QR8A 2E76C 2M00A 1EZ8A 1SBBB 1Q8KA 2YTVA 3HOXG 4XIGS 1WTQA 1HFNA 4JPBW 2UUBQ 1H9RA 4TVAB 3RUZA 2NB0A 4HIOA 3J7AV 5IWAQ 2LY7A 4DAMA 2BE5C 1JB3A 2ZJRA 2AKWB 4XT1B 5C3EG 1YJWA 3VR5A 1H9KA 3VA5A 4B3SQ 5CV9A 5KNCA 1O7IA 4FVMA 3HOWH 1JJCB 3K6OA 5KEEA 1Z9FA 1WYDA 1VQCA 1OXTA 3F8TA 1EQTA 5AJ3L 3A5ZB 3M7GA 4IO9A 1F9SA 4OHJA 1HNXQ 2EYPA 2NTSA 1E0BA 2WV6D 3WOEA 5EAYA 5C4ZA 1T5XD 2RCNA 1S5DD 1RCVD 4HJ5A 1HCZA 2NUCA 4LF4L 1ENAA 3EIVA 4BBSB 3M4OB 4HAEA 4TQUS 2L11A 2Z6KA 1VQ9A 4NXNQ 2I07B 4KKUA 5CR3A 3F1ZA 1Y1VH 2B2WC 4HMJA 4EQPA 1AZQA 4NXML 1PH4A 5A2QE 1T9HA 4A3EB 1RTOA 3T13A 4FYDA 2JA6G 1QOHA 2EYOA 5IP9G 5C4JB 4GLXA 3BJUA 2JXMB 2Q2UA 3N6RA 4KJOA 4A3GB 5J39A 1CSPA 3A54A 3DEOA 4GNXC 1PYSB 4YWKA 5C0XG 4LFCL 4LAAA 2TSSA 2YTXA 3PIP3 3P20A 5J3BA 4KD3A 1BNZA 2LFNA 5NUCA 2QKIC 3GTLH 3I73A 2J7ZA 4APVA 1P16A 2H1EA 5E4XA 4J15A 1VQFA 1A0IA 4G57A 3SK4A 5JEAG 2ZT9C 2K32A 1A2TA 1SE4A 5HURA 3I3CA 2C35B 3T16A 4A3JH 3T56B 3KLRA 3MZ5A 2EE1A 3NE5B 1WTRA 4FXDA 5C44H 4A3MB 1HUNA 1Q7YC 1CSQA 2LXJA 1WFQA 2MGSA 4GOPA 2B3GA 1BCPB 3LGJA 4GS3A 3K5NA 3GD7A 2ENBA 1VF7A 1QZHA 5GADC 5EKKA 2F0SA 4DV7Q 4CKBA 5FLXc 4KY5A 4EVOA 1L2FA 4JOIC 3L7ZC 5I2XA 3HGBA 2DJGC 4FO2A 4OX9L 1KD1C 1JR0D 2B63B 3M9BA 2BOSA 1I4GA 3MEFA 3H15A 1U0LA 1MJCA 1EIFA 4MTNA 5I9PA 3NTHA 1H9SA 3A8KE 4S3SA 1QNUA 2JJQA 4HR7B 2VQEQ 4JI8Q 4MHEA 5E4WC 2D0OA 4DV2Q 2A68D 3DEPA 3K57A 2I5HA 3NTIA 2F3IA 2O4XA 3HRZC 1WVLA 3CC2A 3MFYA 2A5HA 4IURA 4K5VA 2UUBL 1E3PA 1JMCA 3S17H 2KCNA 3NSWA 1DGSA 1LTRD 5C4HA 4EQNA 5IWAL 4BY7B 4IOAA 3S16H 4Q0FA 4B3SL 3E0JA 4A3BH 4A3EG 1S5ED 4IQZA 3BVZA 3HP3A 4DPGA 4R4OA 4CJ2C 2BA0A 4L5SA 1U9RA 5EPKA 5IYBG 1LTID 3MFGA 1EOVA 1EUJA 1FL0A 4XYOA 1F2MA 2D62A 4BY1B 3GV6A 1OXUA 3Q23A 2K6AA 1RF2D 3SK5A 1OXSC 4NXNL 3W5OA 1ASYA 4A3LH 3S9WA 2VW9A 2A68C 3FRPB 4YIJA 1JT8A 1ZEQX 1GUSA 2GVBA 2Q8TA 1G91A 3EFXD 2K28A 4RMFA 1IYVA 1EYDA 4I7ZC 1VQ8A 2B2UA 4BXXG 1B4OA 3S2DH 2VB3X 3QOJA 4IZ8A 4FNFA 3KLWA 4C3JH 4X64Q 5GAHC 4A3MG 1SNOA 2CKZB 1GUTA 2IT1A 4JCVE 1QCBD 4RGTA 2F0OA 1R9TB 1CKNA 1XYIA 4PZ6A 5T1GA 2MNAA 3RR5A 1STAA 4ABNA 1X9NA 2BH8A 1DYQA 4HTHA 4LMQD 4O0AA 4TSSA 1WJJA 2EY5A 5D3DA 1Y1VB 1D1KA 2LKVA 1KC8C 1YITA 1EEFD 1HFGA 2E5LQ 2EYMA 5ELNA 3WWVA 1NR4A 1VQNA 1BCPD 1X65A 3M4QA 3K8AA 4KY6A 3MXNB 2Z6KC 1SLJA 1J6QA 1SNMA 1LO5D 3PUXA 2HHHQ 1SMXA 5COYA 2VQFQ 3RZOH 4PMCA 3IFTA 3E9IA 3KF6A 2O5IC 3AFQA 1E1TA 2R92G 1J5EQ 1XPUA 4DV7L 3AYHB 3ERSX 3IFDA 3GP7A 1SR3A 1TR5A 4K6LA 2J4XA 2AHOB 1VQ5A 1K0RA 4BY7G 5KYLA 3GTLB 1LACA 1R4PB 2F0KA 4PNYA 2GA4B 3BDCA 2F0PA 1JWSD 1ILPA 3OWFA 1EU3A 1GM5A 1B2TA 3T4AC 3OHXC 1YIJA 1KQSA 1VQGA 4A3JB 2XGTA 3V05A 1C48A 5M3FH 1UE7A 2OQ0A 1UNSA 3ICEA 1QNKA 4JI8L 1JCKB 2VQEL 5C44B 1SNDA 4DV2L 4ZKCB 4UY8C 3S24A 4BY1G 1BCPC 3AMUA 3KF8A 2CVRA 3TREA 5K5PA 5TSSA 1BF4A 1QJOA 3GTGH 2AQ1B 3GTKB 4H0LC 2CWPA 1N36Q 2A8VA 4IUPA 3L0OA 1ET6A 4OO1G 5IP7H 4HIDA 5FLMG 1GKHA 5M3MB 2DUDA 3KF8B 2HQLA 1E7ZA 1PFNA 2RSNA 5FO8B 1TS3A 1PMRA 4BBRH 3CCMA 4EQ5A 1Z6HA 2KOLA 3RLFA 5C4XH 2MP1A 3Q8DA 1GHJA 3PF5A 1A2UA 1KDBA 3I4LA 3PO2H 1B53A 4V0BA 1HNWQ 4CDDC 2Z1CA 1F77A 2XRQD 1SJHD 5JJLA 2D2CC 3S17B 5LHY1 1MBYA 1IKLA 3QG1A 5EQ0A 1KAAA 4P71A 1LT6D 1UAPA 1SNQA 4F8MA 4KV6A 3S16B 5FLXE 2B39A 4A3BB 1RD9D 2B8FA 1MHWC 3UDFA 1BBWA 4X64L 2ZXPA 1PHJA 5IODA 1V43A 1MSGA 1II3A 1JOKA 4OELB 4OWTB 1ONLA 3J81E 1EY6A 4YY3Q 1YJ9A 2RDHA 2NN6G 4XQQA 5T1IA 2KEDA 2D5DA 1HQMC 2YU9H 2Q2HA 3RN2A 2PW7A 2QF7A 2YTYA 4L5RC 3U50C 4YCWA 2B2YA 1Q1EA 1Y8OB 5G3LF 1VMCA 4HMIA 4DV6Q 3PF4A 4PZ8A 4O2DA 4MIUA 1N32Q 1QUQB 1TS5A 2R7FA 4XXEA 4UP7A 3VR4A 2Z6BA 5DNFA 2F03A 2EIFA 3HG9A 4KLKA 2ZXRA 1WD0A 3S2DB 1VMPA 2QCPX 2J0TD 3CCQA 2A6ED 2WKDA 1NCVA 4C3JB 2CH4A 2HHHL 2VQFL 4RH6A 2VUMG 2ZXOA 3NP8A 1NE3A 3KYHC 1ESRA 2B2UC 2UUCQ 1RL2A 2Z4IA 1M90C 1CZWA 4BA2I 2K33A 3H3VC 4A3CG 2PYKA 1EYCA 1B8AA 1BXTA 3BZDB 4ZK9B 5M3MG 4A3FG 1PDQA 4JBMA 2JA9A 1VQ7A 1GJXA 3S1NH 2FMMA 2EJMA 4TKOB 1KAWA 3PGZA 2UXDQ 3Q0AA 1EWHA 4V190 4ULLA 3GTPB 4LJZC 2PZTA 1FNVA 2CQAA 5CV7A 1LTBD 4FDBA 3PUZA 3VYSA 3HOZH 3RZOB 2Z4HA 4HJ8A 1PH7A 4CDCC 4OO1I 2A6EC 5EBCA 4CGYB 1I6HB 2B2WA 1FNUA 1N36L 4QY7A 3CCJA 5E7NA 3SK6A 2GVAA 4C1NI 4N8FA 1CZGA 5FJ8H 5ELBA 5GAGC 3U58A 1SNPA 3K58A 2B2VA 4F87A 5M5WH 4DXGA 1VQJA 2G9HD 1G6PA 1YVCA 5IYCG 1PRTB 4XQJA 1I94Q 5IE8A 3H3VI 1UEBA 4GNXA 3AFPA 1PYWD 1HNWL 1LUZA 4FXGC 1K28A 3R2IA 3EVQA 3TBIB 2WINB 3ULPA 1STNA 1PXUA 1HJPA 2MO0A 1PH6A 4KKSA 4L63B 3ULJA 1EFID 3GTGB 1KRTA 2KBNA 4DR4Q 3M85A 3JC66 2JA5H 4A3LG 4K6DA 4DV4Q 3TS0A 2Q8RE 1TWHH 4OL7A 2OQKA 2H4OA 1G51A 2ID0A 5IGFA 2I46A 1OXXK 3GQBA 1NNXA 4HIMA 2LMCB 5CGKA 3DM3A 4ZYSA 2NN6I 2Y0SE 3K80C 5IIFA 1SFOH 1JWUD 2HDLA 4YY3L 3PO2B 2ZTEA 1M4VA 4A3IB 1K73C 2K03A 3NUCA 1EIHA 4JOIA 3X3MA 1I3QH 1L0YB 3B6YA 2NVTH 1J8IA 4DV6L 3S14H 1WTHA 2F0HA 1N32L 4B3RQ 1MSHA 1EWCA 5C3WA 2R93G 3OOCA 1FVIA 3HKZE 2Y0SB 1QZGA 3VYTA 1I4XA 1VDZA 4GKKQ 2KHIA 1K8GA 1PRTF 4JI5Q 1ML0D 3G48A 3ZJYC 1B9MA 1K83H 3MA2B 3I2ZA 4RHRA 1HR0Q 2R7ZH 2UUCL 1JJ2A 1VQHA 4DU9A 3HOUH 1BUVT 4QF4A 4DV5L 4ZKBB 2VZAA 3E9HA 3FPUB 2JA8H 4DR1Q 1GXDC 1CQVA 2JEBI 1L0XB 2K7VA 2QA4A 1EYGA 4G7ZC 1ILQA 2UU9Q 1YZ6A 4IJLA 2B2YC 2UXCQ 1H95A 3C1EA 1ZXTA 3F2BA 1S72A 3VR6A 4IFDH 3I8ZA 2A19A 3FP9A 5IGDA 2X69A 2MPMA 4DNTB 1VQMA 1WTVA 3MTSA 4JG2A 4QIWB 1UEAB 4CDFC 4GN4B 3R93A 4LFAQ 2DNCA 3PCOB 3Q22A 4NKLA 4NPSA 1C9OA 3I72A 1KIXA 2KECA 5K36H 4R4TA 3M3YH 4DGZA 5EPLA 1RTNA 1STGA 4CKCA 4DKAC 1TU2B 4H44C 1U4MA 1C0AA 3GTQH 1W6JA 4LF7Q 2ASBA 2ICIA 2TMPA 4J8QA 1I94L 2AUKA 4DK0A 1Q90A 4KK7A 3LNNA 3QO2A 3I4MH 2RHQB 1PTOH 4DV3Q 1G6ZA 4A3DG 3HOZB 1MKHA 2AMCB 3PO2G 1X3GA 1A3VA 2K1BA 4A3IG 2N55A 1HQRD 4LNQA 2CH4W 3S1MH 2P5ZX 4DR4L 4GKJQ 3UE0A 1N8RC 1CI3M 3NXWA 4CDEC 1QVGA 1VQIA 3D0FA 1G291 2ZTDA 4DV4L 1X3QA 2L0CA 4DN4M 1IBLL 4KN7C 5LL6X 1JQYD 3E5SA 4JK1C 2Y0SG 3KFUA 4KHZA 1EQRA 5IYDH 1PV4A 2DJFC 4HEDA 1AP0A 1UE6A 3H0GH 1VQPA 2V1CC 2I5MX 2B2VC 4RCNA 2YV5A 4JI7Q 4PG3A 2K52A 2CCZA 1XMQQ 3A8IE 3HKZG 3FKIG 4YCVA 2A6HD 2EPBA 2NVYH 2GN5A 3OSOA 4B3RL 4NMZA 4JV5Q 3GDEA 2IL8A 2JA5B 5KGUA 4JI3Q 4FF2A 4WJ3M 4GKKL 1TWHB 1R4QB 2EZVA 2EJGC 4JI5L 1HZAA 5BN5A 2AWOA 4ID6A 1PLFA 2KHSA 1ENCA 2A69D 1PZJD 3OMCA 4UDUC 4DR5Q 1CT1D 1SFOB 4A3KH 1HR0L 4IN3A 3ZYYX 1EY7A 1RODA 4F88A 2SNMA 4H7BA 4R4CA 1XPRA 1HZCA 1I3QB 4P2CB 2NVTB 4DR1L 4X62Q 3S14B 3BDOA 1PA6A 5IGCA 4UP9A 2UU9L 1NAPA 1PVOA 1LV9A 2F0EA 3M7NA 1KL9A 1PH9A 4A76A 1NBWA 2IJ0A 2UXCL 2A6HC 1IBKQ 2E2IH 2Z8LA 1FR3A 3KDFB 2SEBD 3C1FA 3NQIA 5F2DA 2EY2A 1X32A 4Z9CB 5IGBA 2EYHA 3CP0A 4JBWA 1D1IA 1K83B 4POFA 1Q81C 3P75A 3HOVH 2F0DA 3URYA 4CHTB 3BYYB 3TDQA 1HZ9A 1FNWA 3C3LA 1WCMH 3ULLA 4FF4A 3JAML 2HIXA 3EQLC 4UAIA 2A69C 3HOUB 1CM9A 1PH5A 4N8X1 2L15A 2JA8B 3JAMi 3RNUA 5D3IB 4C3IH 4BBSG 1F2ZA 1Q3LA 5KNDA 3T51B 3I4OA 3UI2A 2WKCA 3OWEB 4LF7L 1N33Q 3K7AH 2JYOA 1KTKA 2FINB 3ERQA 3HOYH 3W3AA 4KHVA 4DV3L 1X3EA 2PO4A 5EBDA 3DLLA 2JSOA 4Y7NH 1VQ6A 5M5YH 3CF5A 1HNXL 2IHEA 1KLUD 4A3GG 4GKJL 3KLSX 1V1QA 3PO3H 3R2TA 1F2YA 4HN7A 1RIPA 1QE6A 2F0LA 2HDMA 4DNIA 1SXTA 3F2CA 2JA5G 3M3YB 1EZ6A 2NWGA 4ZUIA 2NZHA 1S5FD 4P72A 1PYBA 3GTQB 3IAYA 3NEMA 3A74A 4HSPA 3KLSA 4GN5A 3BS1A 3F2DA 4K2LA 2NVXH 2PZUA 4FF1A 1EY9A 4RKBA 3I4MB 1PH8A 3PIPA 3HOWB 2F0NA 5C0XI 2XVSA 5E1FA 4JI7L 4LF5Q 1LTSD 4LFBQ 4K8IA 3VR2A 4ILWA 4B3TQ 1FGUA 4DF7A 1K9MC 3S1MB 1PZID 1LYLA 4RGOS 4JV5L 4ME5A 1VQEA 1PZKD 4JI3L 5DM73 4KI0A 3HFZB 5JJKA 2E2HH 1HHVA 3MXNA 2K05A 3FPPA 1WTPA 2EY1A 2B63G 3BYTB 1JE4A 4DR5L 1T5EA 1XNRQ 3H0GB 3HOUG 1FD7D 1TIID 3R8BA 1SE3A 1YNXA 3EBEA 4RCOA 2OTLA 2Q2TA 5H1SE 1YI2A 4X62L 1GHKA 3LWEA 3D8GA 4OEMB 4RA8A 2NVYB 3CQZH 2Q2IA 2VXWA 2DGYA 3SXHA 4DV1Q 1E22A 5DM63 1KDCA 2XN9C 1IBKL 1STEA 2DY7A 3A5UA 1HRJA 2QDBA 3CKIB 1KABA 2D0PA 4OIKA 1ENFA 3CCLA 1Y8PB 2RSOA 4FF3A 1PTOF 3S1QH 1PFMA 2SNSA 1ESFA 1JORA 1HTPA 1LT5D 1Y14B 1CKOA 2CQOA 2E75C 1RJTA 4MZ9A 3MVVA 3S2HH 2IW3A 1N33L 1DJRD 1A6XA 1SYEA 1B9NA 1K8MA 2HCCA 4K5XA 4CJ1B 4QQBX 2E2IB 3J7YW 1TT2A 3OIQA 1DONA 1U4RA 2NVQH 1X54A 3DWQA 1EU4A 2R7DA 3I4MG 2A73B 4PQXA 3HOWG 3HOVB 1Y1WH 1XNQQ 2KHJA 5I4DA 3CPWA 1RHPA 3T1HQ 4A4IA 2WP8J 1WCMB 1LM0A 5CC4A 3HOXH 3MXGA 1VS0A 4IFDJ 4RG1A 1YBYA 1QVFA 1AE2A 1MI2A 5HGQA 1X56A 3TP8A 2QW7A 5C3EH 3DWAA 1CFMA 3RZDH 2SOBA 1D7QA 2RQXA 1Y1VG 3VYRA 5CV8A 2NZOA 3K7AB 4KHPQ 3OIPA 2F1MA 2N78A 2PQEA 3QB3A 4X3TA 3I4NH 3HOYB 3KJPA 3PIO3 1F2LA 1B70B 1SSOA 5FO7B 3H0GG 4LFBL 4HIKA 3CPFA 4FXKC 4L5QA 3J80c 5LL6S 1GD7A 5M5YB 1BQQT 4B3TL 3CW2C 4BA1I 1QUQA 2CWAA 1XX8A 1GUNA 3PO3B 3TZDA 1QG7A 2MUYA 4OIJA 3UDXA 5KYIA 2EQSA 1KHIA 3OYYA 1QB5D 5M5XH 4I7AA 4HJ9A 1WI5A 5CYUA 1EY8A 5IP9H 3D6WA 1U5KA 2K5WA 3CRKC 2E5LL 4DK3C 3A0JA 3PV0A 2MQHA 1XNRL 2NVXB 4X6AH 4A3JG 4MTKA 3C2PA 3TRZA 1N9WA 1X55A 1G2TA 4WORA 4RFBA 1C7YA 5I6YA 5C44G 5C5MA 4G7OC 1YHAA 4DV0Q 3IRBA 2AQ3B 2EY6A 2K14A 1MJEA 2B8GA 1PH2A 3G6JB 2PMZE 3GTOH 1HNZQ 1LABA 1J5EL 3KBXA 3A56A 1ET9A 2HIVA 2B29A 1A15A 5EKLA 4DV1L 1EOTA 2RDFA 3GV3A 3EA6A 5JEAH 2R3ZA 4EGVA 2E2HB 1KXLA 3I7FA 1K3RA 1PH1A 2CW0D 5JPNC 5EPJA 4JI6Q 4WJ4A 2KCTA 1PH3A 2OXPA 3GTJH 3H09A 2VS1A 4HJ7A 2EXDA 3MAQA 4RKLA 4DFAA 3H94A 4P74A 2PMZB 2WIIB 5FOBB 3C46A 1EY0A 2NTTA 3DM1A 2CFMA 4XQNA 2F0JA 5G3LD 1GO3E 4ZUJA 4RGNA 2N49A 2ZTCA 3P7JA 1B50A 1VQAA 1EIGA 3H91A 4IUQA 4B9XA 3CQZB 3Q6SA 2E2JH 4QMGA 3CCUA 1GUGA 2VY3A 3NQTA 4IUTA 3MHBA 3PMFA 4OONA 5IOCA 1E1OA 1IXRA 1G2SA 4ZLTF 1N34Q 1IKMA 4KMUC 4A3BG 2DY8A 2ALYB 3LX0A 2K5HA 1DXMA 4EQOA 2QGQA 4K2KA 4F7XA 4RWSC 4AYBE 3CCSA 1XNQL 2CW0C 1TWFH 3S1QB 2K50A 5M3FB 3CCEA 4LK1C 4A75A 3RLOA 2BDOA 4NB3A 1NMGA 1SYGA 3CRLC 4DAVA 2IX0A 2XRSD 1RKNA 3M4OH 3NBHB 1NUCA 3D4DA 4UP8A 3CMAA 2K5QA 4J6HA 5EJWA 4JC0A 2KQ3A 2WAQE 4BWGB 1BR9A 3S2HB 4A3EH 4P75A 1VQKA 4KHPL 4AYBB 5C4JH 1V1PB 5CORA 3A7LA 4BBRB 3VA7A 5IT9c 2FXQA 2NVQB 2WFWA 5C4XB 3W1BA 4C3JG 2F0MA 1DCZA 3I56A 4IUNA 1Y1WB 5A35A 5C6AA 3JAMc 4X3KA 3STBD 3MXUA 3J7A5 2WAQB 1TVXA 2R6GA 3QWNA 4M1UB 1FYCA 1DM0B 2ZM6Q 1E24A 4KD4A 2K5NA 5FKAC 5C3EB 4BXXH 2Z9HA 3V96A 3RZDB 3I90A 1GUWA 3CC7A 2B2TA 2NZ1D 3SDZA 4X66Q 1GUOA 1ICWA 1Q12A 3RMHA 5BN4A 3V2TA 2BA1A 3I4NB 1BBUA 5FK9C 1QILA 1PFSA 1VQBA 1TWGH 3MEHA 1Y69U 4X65Q 1B1ZA 3L2PA 4DV0L 1MGSA 1HNZL 4LFCQ 4WRDA 4OWXB 4U673 3SEBA 3TN2A 1UWVA 3K5OA 2YU9B 5HY6A 1XTDA 3VR3A 3STBC 4FP5D 1A3UA 2OF1A 5M5XB 4QIWE 1A62A 2XTIA 1S5CD 3KJOA 3DWPA 4OWWB 1DZ1A 2HUGA 2UXDL 2OCEA 1CQFA 2V4DA 2MO1A 3CAMA 1U4LA 3K81C 1EYAA 5M3FG 4YCUA 5JJIA 2K75A 3CMEA 1V1OA 2R92H 3KOJA 5EKIA 4C3HH 3J80E 3J80L 4BY7H 2IHFA 5D65A 1SE2A 3A7AB 2D9UA 1IZ6A 1B44D 2PI2E 3J80i 1OXVA 3BVGA 1PRTD 5IP7G 3CHBD 1IYJB 4AYBG 4XT3B 4DAYB 1N34L 1H9JA 3S1NB 1KDAA 1UE1A 1VF5C 2EYLA 4HSVA 4BBRG 3GTJB 1AH9A 3TP7A 2PW5A 2PI2A 3O13A 3D31A 3ND9A 1SYDA 5C4XG 4DUZQ 2PZWA 4LUZA 1JOOA 4BY1H 5CBAE 3DUZA 3PUWA 2WAQG 2ICEC 1STYA 1I50H 1I4QA 1BVSA 4OO1H 5KIXA 3LWUA 5FLMH 2E2JB 1TWCH 3QJYA 2JK8A 2OT2A 2RA4A 5LMUQ 4NW2A 1TKWB 2AQ2B 4DXFA 1C4QA 5M5WB 1SYCA 1A8VA 3I4NG 3U9OA 5FO9B 3OW2A 1BOSA 1PRTC 4H02A 4GN3B 1TWFB 1NSNS 1R9TH 1IL2A 3H3VH 1WTOA 1SN8A 3Q24A 1KRSA 1VQ4A 1JC7A 3NK9A 4CJ0B 2ZM6L 3EJIA 4PV1C 1WTXA 1OO9B 1SAPA 1S4ZA 3NPPA 4HCSA 5ELEA 3J81j 2FFKB 2Z0SA 1S5BD 2IX3A 2RF4A 1JB7A 1TY2A 3PSIA 5A2QL 2F0IA 4X66L 2MFIA 2RHSB 4JVZA 1K0SA 1IL8A 2I5LX 3L3OC 4QGUA 1CUKA 1B3QA 3BZKA 4LWCA 4X65L 4LF6Q 1IW7D 3SHLA 3UDGA 1O80A 1U4PA 4JW0A 2NN6H 5I2YA 4AQYQ 4C2MH 1F9RA 2F4VQ 5C5LA 2K04A 3H6MA 2F0GA 4YHHQ 4TRDA 3P1HA 4WJWA 5I6WA 1IYUA 3EN2A 1O7LA 5E3FA 4QCLA 2KENA 3KDFA 5CV5A 2SDFA 1L1OA 1XPOA 1GOZA 3U4VA 4RAUC 4ZAIA 1AEXA 2IX1A 2VUMH 4B9WA 2QILA 1X3FA 4LF9Q 1V9PA 1TWGB 1L1OB 5IT9E 5IT9L 4KJNA 1SMYD 1HPCA 1XJVA 2B2TC 4A3CH 3A55A 3HOZG 1B3AA 2R7ZB 3GTKH 2A74C 3JAME 1JE5A 4PMBA 4XYQA 5LMNQ 4LFAL 4JI2Q 4GOPB 1BBXC 1YNJD 1IW7C 5D14A 5M3MH 3OPOA 4A3FH 2DN8A 2PCFB 3TS2A 4G4KA 3AB9A 1I4PA 5C0XJ 4PZ7A 4R4QA 1I4RA 1L0WA 5FJ8G 1D5MC 2F0QA 3TZUA 3J81c 2QEJC 1DOLA 2EYFA 3D6CA 4QL5A 4MNOA 5CMDA 4DUZL 4JBJA 1KNEA 2HQEA 5JEAJ 3W1GA 2JA7H 1EQVA 2F0VA 2FJ2A 3J7ZC 1B7YB 1SE8A 2M9VA 3K0XA 4R8NA 3W2DA 3CXCA 2R92B 1TQOA 1H9SB 3MXPA 3BG3A 4C3HB 1LTGD 2L9HA 5BN3A 4DK6C 3S15H 1SMYC 2KA7A 4J1MA 4RGMA 2Q8IB 3E3XA 5LMUL 1O7ZA 2EYJA 3DHQA 1XMOQ 1NR2A 3FMCA 5IYCH 1DD2A 3RLNA 1HA5A 1YNJC 1HH2P 2VL6A 2XSCA 2K5VA 3I70A 3ITPA 1D2BA 3S1RH 1FGBD 2EXZA 4CKEA 4M8AA 5BR8Q 3VYUA 1BCPF 1STHA 5JPMC 4OGQC 3RN5A 1PTOB 4DR7Q 4I65A 1EFWA 1LT3D 1WTWA 4QUCA 1K3BC 3SK8A 5J1ZA 1I50B 2LXKA 4KY7A 1XMQL 5GAEC 3M4PA 5IGEA 5IGGA 3EROA 1D5XC 1TWCB 1YHBA 1QWYA 4UPAA 4IOCA 1AE3A 3NWSA 3OW7A 4HCEA 1XXGA 3GO5A 2BCOA 2L5TA 2M2LA 2K01A 2KUMA 1EIYB 4LF6L 4Q5VA 2L1BA 5GQOA 2JQOA 3TP6A 3IL8A 2KJXA 3TMEA 4AQYL 2K4KA 1D8LA 1NY4A 2CHBD 4K0KQ 2R7ZG 2F4VL 1NJIC 5IY0A 4YHHL 2PNRC 4ZRZA 2F4IA 1MD2D 2UUAQ 4C56C 2ATWA 4WFN3 3R3OA 2R93H 2JA8G 1FJGQ 2F3WA 1CKNB 2RCFA 3I91A 1JJGA 1H9MA 1CA6A 2JE6I 5JOBA 2KCMA 3GTPH 2KVMA 5ELCA 4G7HC 2N8NA 4JI0Q 4HJAA 2OWOA 4PMWA 2UXBQ 4IJHA 1AFPA 4LF9L 3T1YQ 1TS2A 3U4ZA 2VNUD 3QOLA 2RVLA 2KEEA 4DNRB 3K0YA 4IFDG 4NDXA 1A63A 5AFWA 4A3KB 3PUVA 1I6HH 2X6GA 4XTCS 4JYAQ 4C2MB 3FDTA 1G8ZD 4LF8Q 1O7YA 3U9SA 5LMNL 1LTTD 4B3MQ 4C3HG 4JI2L 4POGA 2C9OA 4LUVA 3ONAB 2O2LD 3KF6B 1HTLD 3HEJA 2QDLA 1YNND 1O78A 5K36G 1E2ZA 3GTMH 1IHZA 4LUOA 5ISRA 3OTOQ 1BDOA 2VB2X 1TWAH 3CU7A 1HXYD 3D4RA 1W3SA 1GVPA 5CV6A 1YHQA 1TY0A 1TXYA 2F3VA 3G6EA 1WOCA 2VUMB 2MHVA 4A93H 2JEAI 1EL0A 4ALPA 1LT4D 1M1KC 3TQYA 3KBGA 1A3TA 1L1OC 2L12A 4QB4A 1I6VC 2PNHA 3NTKA 1Q82C 2PPBC 1XTCD 2G5DA 1EQQA 1I4HA 1S40A 2BH2A 1Q8IA 2E8GA 3NENA 3E6ZX 3PQIA 4GOPC 4JI4Q 3E0EA 4A3FB 1F9PA 4L6TB 1W2BA 1XMOL 4C3IB 4R8IA 1SYBA 1TS4A 4KN4C 2PQAA 1HR0W 1VCIA 1PTOD 5IYDG 1YNNC 4DR3Q 5BR8L 3NHHA 3T53B 2EDGA 3DXJC 3K59A 4A3DH 4GLAC 4N9PA 4IPGA 4C1NK 1YJNA 4P73A 4AIMA 1LLRD 1C8CA 1K8OA 1BO0A 2H5XA 2JA7B 4A3IH 2NBFA 4DR7L 2PQAB 3K7UC 4DAPA 1SJED 1Y8NB 3KUPA 4LF5L 1MIUA 2JN4A 4Y7NB 4R9WA 3L9AX 3RD4A 4YWMA 3F2UA 4QUFA 4DR6Q 2F52A 3HS0C 3NELA 1E2VA 4DR2Q 3S15B 4IALA 5FLXL
chains in the Genus database with same CATH topology
3KLWA 4C3JH 2ZM6Q 2YV5A 4X64Q 1E24A 4JI7Q 4PG3A 3TEHB 5GAHC 1VQLA 4A3MG 2K5NA 3HKSA 2K52A 2JA6H 2CCZA 1XMQQ 2CKZB 3HKZG 3FKIG 2A1AA 4BXXH 2IT1A 3PUYA 4YCVA 4JCVE 2NVYH 2GN5A 3CC7A 4B3RL 4JV5Q 3GDEA 4X66Q 1CKNA 1Q12A 4PZ6A 4K0KL 1Q46A 2MNAA 4JI3Q 3FHWA 1CKMA 3RR5A 4A3KG 4WJ3M 2AWNA 1X9NA 4GKKL 2BH8A 2BA1A 1BBUA 4O0AA 1PFSA 1WJJA 3FKIH 1VQBA 1TWGH 3J81i 4JI5L 1SROA 1HZAA 3UDIA 2AWOA 2UUAL 4X65Q 1KC8C 3L2PA 1YITA 4DV0L 1FJGL 4DR5Q 1HR0L 4A3KH 1HNZL 2E5LQ 5ELNA 4LFCQ 3CD6A 3WWVA 1VQNA 1X65A 3M4QA 3K8AA 4OWXB 3MXNB 2Z6KC 2WB1E 1UWVA 4JI0L 1SLJA 5HY6A 4IFDI 1J6QA 1XTDA 3PUXA 2UXBL 3STBC 4R4CA 2HHHQ 1SMXA 1XPRA 1HZCA 2VQFQ 3RZOH 3T1YL 4QIWE 4JI1Q 1Q1BA 4DR1L 1VQOA 3BZCA 3E9IA 1A62A 2XTIA 3KF6A 4X62Q 3KJOA 4OWWB 3AFQA 1E1TA 2R92G 1PA6A 1J5EQ 3CC4A 2UXDL 2OCEA 4UP9A 2UU9L 1XPUA 4JYAL 4DV7L 3AYHB 3M7NA 3ERSX 1PVOA 4LF8L 1SR3A 3HOVG 1KL9A 2MO1A 3CAMA 1NBWA 4A76A 2AHOB 3K81C 1PH9A 1K0RA 4DV5Q 1VQ5A 4B3ML 1IBKQ 2QEXA 2E2IH 2UXCL 4BY7G 1WCMG 3KDFB 5M3FG 4YCUA 5JJIA 2K75A 1P8LA 3CMEA 3CP0A 3VDYA 2R92H 3G4SA 4JBWA 3KOJA 4POFA 1Q81C 1GM5A 4C3HH 3HOVH 1YIJA 1KQSA 3AQQA 1HZ9A 1VQGA 3OTOL 2XGTA 4BY7H 1WCMH 5M3FH 3ULLA 2IHFA 1UE7A 2OQ0A 5GROA 2OTJA 2HIXA 3ICEA 2VQEL 1IZ6A 4JI8L 1Q86C 4DUYQ 2PI2E 3J80i 4DV2L 3ER0A 1PH5A 1OXVA 2N3SA 4UY8C 4YWLA 2L15A 3S24A 5IP7G 4BY1G 3JAMi 3RNUA 4C3IH 4AYBG 1IYJB 3TREA 4BBSG 4DAYB 1N34L 1IBMQ 3HOYG 1UE1A 2JA7G 3GTGH 4GLVB 4BBRG 1AH9A 3I4OA 1UE5A 2PI2A 2CWPA 4LF7L 1N36Q 3T1HL 3D31A 1N33Q 2A8VA 3K7AH 3L0OA 4OO1G 5C4XG 4DUZQ 4LW1A 4LUZA 5IP7H 1GKHA 5FLMG 4HIDA 2DUDA 1OTCA 4BY1H 3KF8B 4BBSH 2HQLA 1K8AC 4JI4L 1E7ZA 3HOYH 4IPCA 3PUWA 4R1JA 2WAQG 1I5FA 4DV3L 3PO3G 4BBRH 3CCMA 1X3EA 4EQ5A 3RLFA 1I50H 1BVSA 5C4XH 3PIOA 3DLLA 4Y7NH 3Q8DA 5ELOA 1VQ6A 5M5YH 3CF5A 5FLMH 1HNXL 1LTLA 1TWCH 1BKBA 2IHEA 4GKJL 2JK8A 4A3GG 3PF5A 4DR3L 1V1QA 3PO2H 3PO3H 1HNWQ 4JBKA 1NTGA 5LMUQ 1RIPA 4DNIA 3F2CA 2JA5G 3AEVA 1SRUA 5IYBH 5JJLA 2NZHA 1A8VA 3I4NG 5AJ3Q 4A3GH 4P72A 1PYBA 3OW2A 3NEMA 4GNXB 3SGIA 4H02A 4GN3B 1YEZA 3A74A 4DR6L 4P71A 4GN5A 1R9TH 1IL2A 3H3VH 3F2DA 4DR2L 1SN8A 2NVXH 4LF4Q 3CCRA 1KRSA 5DLQE 1IBLQ 1PH8A 3UDFA 3PIPA 1VQ4A 3I55A 1BBWA 2IY5B 2ZM6L 5C0XI 4X64L 4QJFA 1ASZA 4JI7L 4LF5Q 4LFBQ 3J81j 1PHJA 1NMFA 2ZJQA 1EWIA 2Z0SA 1V43A 4NXMQ 1JB7A 2RF4A 4OWTB 3UE1A 1FGUA 4B3TQ 1K9MC 1LYLA 3PSIA 4YY3Q 1YJ9A 4JV5L 1VQEA 4X66L 2MFIA 2RHSB 5LMNW 2NN6G 1QVCA 4JI3L 4A3MH 4KI0A 2ZJPA 2YU9H 2Q2HA 3HFZB 4EX5A 3RN2A 2YTYA 2E2HH 3U50C 4YCWA 4L5RC 2HT1A 5JJKA 1Q1EA 2I5LX 4QGUA 1CUKA 4DV6Q 3BZKA 3PF4A 4LWCA 4X65L 4PZ8A 4O2DA 4LF6Q 2B63G 1N32Q 1Z47A 3UDGA 1QUQB 4DR5L 2R7FA 2WB1G 4UP7A 4C2MH 4AQYQ 3G71A 4R4IA 2EIFA 1XNRQ 2F4VQ 4KLKA 4YHHQ 3CCQA 2B63H 2I0QA 3EN2A 1VQDA 3HOUG 2HHHL 4JI6L 2VQFL 1YNXA 2KENA 4OXPA 3EBEA 2VUMG 3KDFA 1NE3A 4JI1L 2OTLA 2Q2TA 5H1SE 1YI2A 4X62L 3KYHC 4L5TA 3BU2A 2UUCQ 1RL2A 3CQZH 1L1OA 1XPOA 2Q2IA 4IPHA 3U4VA 2LSSA 2DGYA 1M90C 4BA2I 4DV1Q 4A3CG 1E22A 2IX1A 1B8AA 2VUMH 1IBKL 1X3FA 4LF9Q 3A5UA 1V9PA 1HZBA 5M3MG 1L1OB 2D0PA 4A3FG 4JBMA 2JA9A 1VQ7A 1XJVA 3CCVA 3S1NH 4A3CH 3CCLA 3HOZG 1KAWA 3GTKH 3PGZA 2UXDQ 3S1QH 4Y52H 1JE5A 4AH6A 5LMNQ 4LFAL 4JI2Q 4GOPB 5M3MH 4OX9Q 4A3FH 2ES2A 4DUYL 4FDBA 3TS2A 3PUZA 4IPDA 2YYZA 3HOZH 1Y14B 4HJ8A 1PH7A 4ME3A 4OO1I 5C0XJ 1IBML 1CKOA 4A93G 1S3OA 4PZ7A 2CQOA 4R4QA 1L0WA 5FJ8G 3J81c 4MZ9A 3S2HH 1N36L 1N33L 4QY7A 4QL5A 4MNOA 1Y1WG 3CCJA 4DUZL 5E7NA 2GVAA 4QQBX 4JBJA 1X6OA 5JEAJ 3W1GA 2JA7H 1Q8KA 2YTVA 3HOXG 5FJ8H 4XIGS 5GAGC 3U58A 3J7ZC 1B7YB 1SE8A 3K0XA 2NVQH 1X54A 3CXCA 2UUBQ 4TVAB 5M5WH 2R7DA 3I4MG 3HOWG 1VQJA 4HIOA 1Y1WH 1XNQQ 1YVCA 5IYCG 1G6PA 2KHJA 5IWAQ 4DAMA 1I94Q 3CPWA 5IE8A 2ZJRA 3T1HQ 4DK6C 3H3VI 4A4IA 2WP8J 3S15H 2AKWB 1LM0A 1UEBA 5C3EG 1YJWA 4GNXA 3AFPA 3HOXH 4B3SQ 1HNWL 5LMUL 1LUZA 1O7IA 1KXLA 1VS0A 1XMOQ 3HOWH 1JJCB 4IFDJ 5IYCH 3ULPA 4RG1A 3RLNA 1YBYA 1Z9FA 1AE2A 1WYDA 5HGQA 1QVFA 1HH2P 1HJPA 1X56A 2VL6A 2K5VA 2MO0A 1VQCA 1PH6A 1OXTA 3F8TA 5C3EH 5AJ3L 3ULJA 3A5ZB 3RZDH 1KRTA 3S1RH 1D7QA 2KBNA 4IO9A 1HNXQ 4DR4Q 3M85A 1Y1VG 5BR8Q 3JC66 2NZOA 2JA5H 4A3LG 4KHPQ 5EAYA 2RCNA 2N78A 4DV4Q 4HJ5A 3TS0A 3RN5A 4LF4L 3EIVA 3I4NH 1TWHH 4DR7Q 3KJPA 4TQUS 2OQKA 1EFWA 1B70B 1G51A 1VQ9A 2ID0A 2Z6KA 4NXNQ 3H0GG 1OXXK 4HIMA 3F1ZA 1Y1VH 4LFBL 4HIKA 3CPFA 2LXKA 3DM3A 4L5QA 3J80c 1XMQL 5GAEC 2NN6I 1GD7A 2Y0SE 3K80C 3M4PA 4NXML 1SFOH 1PH4A 4B3TL 1T9HA 1YHBA 3CW2C 4BA1I 2JA6G 4YY3L 1QUQA 2CWAA 4UPAA 5IP9G 4GLXA 2ZTEA 3UDXA 4IOCA 3BJUA 1K73C 2EQSA 1AE3A 4JOIA 1KHIA 1I3QH 3OYYA 3B6YA 3GO5A 5M5XH 4HJ9A 2NVTH 2Q2UA 1WI5A 4DV6L 3S14H 4LF6L 1CSPA 1EIYB 1N32L 5GQOA 2JQOA 5IP9H 4B3RQ 4GNXC 1PYSB 1U5KA 4YWKA 5C0XG 2E5LL 4AQYL 4DK3C 2K4KA 4LFCL 1D8LA 1NY4A 1FVIA 3HKZE 2R93G 3A0JA 4K0KQ 2YTXA 3PV0A 1QZGA 2R7ZG 2MQHA 5J3BA 1NJIC 5IY0A 1XNRL 2F4VL 4GKKQ 4X6AH 4YHHL 4A3JG 2KHIA 1K8GA 4APVA 3GTLH 3TRZA 1N9WA 1X55A 1P16A 4JI5Q 1C7YA 4J15A 3G48A 5C44G 2UUAQ 1VQFA 1A0IA 3ZJYC 5JEAG 2ATWA 1K83H 1YHAA 4DV0Q 3IRBA 2R93H 2K14A 1MJEA 1FJGQ 1CKNB 3I2ZA 2JA8G 1PH2A 1HR0Q 2R7ZH 2PMZE 3GTOH 1HNZQ 2UUCL 2C35B 1JJ2A 1JJGA 1J5EL 1VQHA 2JE6I 4A3JH 2HIVA 2KCMA 2B29A 3GTPH 3HOUH 4DV1L 2N8NA 4JI0Q 4HJAA 2OWOA 4DV5L 5C44H 4PMWA 1Q7YC 1CSQA 2LXJA 2VZAA 2UXBQ 1WFQA 4IJHA 3E9HA 2JA8H 4GOPA 4LF9L 2B3GA 3I7FA 1K3RA 3LGJA 4GS3A 3T1YQ 1PH1A 4JI6Q 4DR1Q 3U4ZA 2VNUD 2KCTA 4WJ4A 3GD7A 2JEBI 1PH3A 4IFDG 2QA4A 3GTJH 1QZHA 2VS1A 1A63A 5GADC 1EYGA 3PUVA 2UU9Q 4XTCS 4JYAQ 1I6HH 4DV7Q 4HJ7A 2EXDA 5FLXc 1YZ6A 4LF8Q 5LMNL 1L2FA 4B3MQ 4IJLA 4P74A 4JI2L 4POGA 4JOIC 4LUVA 3L7ZC 2UXCQ 1H95A 4OX9L 3F2BA 1S72A 1KD1C 2CFMA 3KF6B 3M9BA 2A19A 3FP9A 1GO3E 3MEFA 3H15A 2N49A 1U0LA 2ZTCA 5K36G 1VQAA 1MJCA 1VQMA 3GTMH 4LUOA 1EIFA 4MTNA 2E2JH 3OTOQ 4JG2A 1TWAH 3CCUA 4GN4B 1W3SA 2JJQA 2VY3A 4LFAQ 1GVPA 3PCOB 2VQEQ 4JI8Q 1YHQA 1TXYA 4NPSA 3G6EA 1C9OA 1WOCA 2D0OA 4DV2Q 1KIXA 4A93H 2JEAI 4OONA 4ALPA 1E1OA 1IXRA 2I5HA 4R4TA 3M3YH 2F3IA 1M1KC 3TQYA 1N34Q 4A3BG 4DKAC 1L1OC 3CC2A 2ALYB 2UUBL 1E3PA 2PNHA 1JMCA 3S17H 3GTQH 1C0AA 2K5HA 1Q82C 2QGQA 1DGSA 1XNQL 4AYBE 3CCSA 1EQQA 4LF7Q 5IWAL 1S40A 1TWFH 2ASBA 2K50A 2BH2A 1I94L 3CCEA 4IOAA 2E8GA 4A75A 3S16H 3RLOA 4NB3A 1NMGA 3NENA 4GOPC 4JI4Q 3E0EA 4B3SL 4A3BH 2IX0A 4A3EG 3I4MH 2RHQB 4DV3Q 1W2BA 3M4OH 4A3DG 1XMOL 3NBHB 1MKHA 2AMCB 3PO2G 1X3GA 4UP8A 3CMAA 4JC0A 4DPGA 4R4OA 4A3IG 2BA0A 2WAQE 2PQAA 4L5SA 1HR0W 4LNQA 5IYBG 3S1MH 1VCIA 4DR4L 5IYDG 3UE0A 1EOVA 4A3EH 4DR3Q 5BR8L 4P75A 1EUJA 1FL0A 1N8RC 1VQKA 1QVGA 2D62A 1VQIA 4A3DH 4KHPL 4GLAC 3D0FA 4IPGA 1G291 2ZTDA 1YJNA 4P73A 4AIMA 5C4JH 4DV4L 2H5XA 1OXUA 1IBLL 4A3IH 4DR7L 5IT9c 2PQAB 2Y0SG 2FXQA 3K7UC 1OXSC 4NXNL 3KFUA 3W5OA 4LF5L 4KHZA 2WFWA 1EQRA 1ASYA 3W1BA 4A3LH 1MIUA 5IYDH 2VW9A 3I56A 1JT8A 2GVBA 4YWMA 4RMFA 3JAMc 1PV4A 4DR6Q 2F52A 3STBD 3NELA 3J7A5 4DR2Q 1VQ8A 1UE6A 2R6GA 4BXXG 4GKJQ 3H0GH 1VQPA 3S2DH 2V1CC 2I5MX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLW A;  4C3J H;  2ZM6 Q;  2YV5 A;  4X64 Q;  1E24 A;  4JI7 Q;  4PG3 A;  3TEH B;  5GAH C;  1VQL A;  4A3M G;  2K5N A;  3HKS A;  2K52 A;  2JA6 H;  2CCZ A;  1XMQ Q;  2CKZ B;  3HKZ G;  3FKI G;  2A1A A;  4BXX H;  2IT1 A;  3PUY A;  4YCV A;  4JCV E;  2NVY H;  2GN5 A;  3CC7 A;  4B3R L;  4JV5 Q;  3GDE A;  4X66 Q;  1CKN A;  1Q12 A;  4PZ6 A;  4K0K L;  1Q46 A;  2MNA A;  4JI3 Q;  3FHW A;  1CKM A;  3RR5 A;  4A3K G;  4WJ3 M;  2AWN A;  1X9N A;  4GKK L;  2BH8 A;  2BA1 A;  1BBU A;  4O0A A;  1PFS A;  1WJJ A;  3FKI H;  1VQB A;  1TWG H;  3J81 i;  4JI5 L;  1SRO A;  1HZA A;  3UDI A;  2AWO A;  2UUA L;  4X65 Q;  1KC8 C;  3L2P A;  1YIT A;  4DV0 L;  1FJG L;  4DR5 Q;  1HR0 L;  4A3K H;  1HNZ L;  2E5L Q;  5ELN A;  4LFC Q;  3CD6 A;  3WWV A;  1VQN A;  1X65 A;  3M4Q A;  3K8A A;  4OWX B;  3MXN B;  2Z6K C;  2WB1 E;  1UWV A;  4JI0 L;  1SLJ A;  5HY6 A;  4IFD I;  1J6Q A;  1XTD A;  3PUX A;  2UXB L;  3STB C;  4R4C A;  2HHH Q;  1SMX A;  1XPR A;  1HZC A;  2VQF Q;  3RZO H;  3T1Y L;  4QIW E;  4JI1 Q;  1Q1B A;  4DR1 L;  1VQO A;  3BZC A;  3E9I A;  1A62 A;  2XTI A;  3KF6 A;  4X62 Q;  3KJO A;  4OWW B;  3AFQ A;  1E1T A;  2R92 G;  1PA6 A;  1J5E Q;  3CC4 A;  2UXD L;  2OCE A;  4UP9 A;  2UU9 L;  1XPU A;  4JYA L;  4DV7 L;  3AYH B;  3M7N A;  3ERS X;  1PVO A;  4LF8 L;  1SR3 A;  3HOV G;  1KL9 A;  2MO1 A;  3CAM A;  1NBW A;  4A76 A;  2AHO B;  3K81 C;  1PH9 A;  1K0R A;  4DV5 Q;  1VQ5 A;  4B3M L;  1IBK Q;  2QEX A;  2E2I H;  2UXC L;  4BY7 G;  1WCM G;  3KDF B;  5M3F G;  4YCU A;  5JJI A;  2K75 A;  1P8L A;  3CME A;  3CP0 A;  3VDY A;  2R92 H;  3G4S A;  4JBW A;  3KOJ A;  4POF A;  1Q81 C;  1GM5 A;  4C3H H;  3HOV H;  1YIJ A;  1KQS A;  3AQQ A;  1HZ9 A;  1VQG A;  3OTO L;  2XGT A;  4BY7 H;  1WCM H;  5M3F H;  3ULL A;  2IHF A;  1UE7 A;  2OQ0 A;  5GRO A;  2OTJ A;  2HIX A;  3ICE A;  2VQE L;  1IZ6 A;  4JI8 L;  1Q86 C;  4DUY Q;  2PI2 E;  3J80 i;  4DV2 L;  3ER0 A;  1PH5 A;  1OXV A;  2N3S A;  4UY8 C;  4YWL A;  2L15 A;  3S24 A;  5IP7 G;  4BY1 G;  3JAM i;  3RNU A;  4C3I H;  4AYB G;  1IYJ B;  3TRE A;  4BBS G;  4DAY B;  1N34 L;  1IBM Q;  3HOY G;  1UE1 A;  2JA7 G;  3GTG H;  4GLV B;  4BBR G;  1AH9 A;  3I4O A;  1UE5 A;  2PI2 A;  2CWP A;  4LF7 L;  1N36 Q;  3T1H L;  3D31 A;  1N33 Q;  2A8V A;  3K7A H;  3L0O A;  4OO1 G;  5C4X G;  4DUZ Q;  4LW1 A;  4LUZ A;  5IP7 H;  1GKH A;  5FLM G;  4HID A;  2DUD A;  1OTC A;  4BY1 H;  3KF8 B;  4BBS H;  2HQL A;  1K8A C;  4JI4 L;  1E7Z A;  3HOY H;  4IPC A;  3PUW A;  4R1J A;  2WAQ G;  1I5F A;  4DV3 L;  3PO3 G;  4BBR H;  3CCM A;  1X3E A;  4EQ5 A;  3RLF A;  1I50 H;  1BVS A;  5C4X H;  3PIO A;  3DLL A;  4Y7N H;  3Q8D A;  5ELO A;  1VQ6 A;  5M5Y H;  3CF5 A;  5FLM H;  1HNX L;  1LTL A;  1TWC H;  1BKB A;  2IHE A;  4GKJ L;  2JK8 A;  4A3G G;  3PF5 A;  4DR3 L;  1V1Q A;  3PO2 H;  3PO3 H;  1HNW Q;  4JBK A;  1NTG A;  5LMU Q;  1RIP A;  4DNI A;  3F2C A;  2JA5 G;  3AEV A;  1SRU A;  5IYB H;  5JJL A;  2NZH A;  1A8V A;  3I4N G;  5AJ3 Q;  4A3G H;  4P72 A;  1PYB A;  3OW2 A;  3NEM A;  4GNX B;  3SGI A;  4H02 A;  4GN3 B;  1YEZ A;  3A74 A;  4DR6 L;  4P71 A;  4GN5 A;  1R9T H;  1IL2 A;  3H3V H;  3F2D A;  4DR2 L;  1SN8 A;  2NVX H;  4LF4 Q;  3CCR A;  1KRS A;  5DLQ E;  1IBL Q;  1PH8 A;  3UDF A;  3PIP A;  1VQ4 A;  3I55 A;  1BBW A;  2IY5 B;  2ZM6 L;  5C0X I;  4X64 L;  4QJF A;  1ASZ A;  4JI7 L;  4LF5 Q;  4LFB Q;  3J81 j;  1PHJ A;  1NMF A;  2ZJQ A;  1EWI A;  2Z0S A;  1V43 A;  4NXM Q;  1JB7 A;  2RF4 A;  4OWT B;  3UE1 A;  1FGU A;  4B3T Q;  1K9M C;  1LYL A;  3PSI A;  4YY3 Q;  1YJ9 A;  4JV5 L;  1VQE A;  4X66 L;  2MFI A;  2RHS B;  5LMN W;  2NN6 G;  1QVC A;  4JI3 L;  4A3M H;  4KI0 A;  2ZJP A;  2YU9 H;  2Q2H A;  3HFZ B;  4EX5 A;  3RN2 A;  2YTY A;  2E2H H;  3U50 C;  4YCW A;  4L5R C;  2HT1 A;  5JJK A;  1Q1E A;  2I5L X;  4QGU A;  1CUK A;  4DV6 Q;  3BZK A;  3PF4 A;  4LWC A;  4X65 L;  4PZ8 A;  4O2D A;  4LF6 Q;  2B63 G;  1N32 Q;  1Z47 A;  3UDG A;  1QUQ B;  4DR5 L;  2R7F A;  2WB1 G;  4UP7 A;  4C2M H;  4AQY Q;  3G71 A;  4R4I A;  2EIF A;  1XNR Q;  2F4V Q;  4KLK A;  4YHH Q;  3CCQ A;  2B63 H;  2I0Q A;  3EN2 A;  1VQD A;  3HOU G;  2HHH L;  4JI6 L;  2VQF L;  1YNX A;  2KEN A;  4OXP A;  3EBE A;  2VUM G;  3KDF A;  1NE3 A;  4JI1 L;  2OTL A;  2Q2T A;  5H1S E;  1YI2 A;  4X62 L;  3KYH C;  4L5T A;  3BU2 A;  2UUC Q;  1RL2 A;  3CQZ H;  1L1O A;  1XPO A;  2Q2I A;  4IPH A;  3U4V A;  2LSS A;  2DGY A;  1M90 C;  4BA2 I;  4DV1 Q;  4A3C G;  1E22 A;  2IX1 A;  1B8A A;  2VUM H;  1IBK L;  1X3F A;  4LF9 Q;  3A5U A;  1V9P A;  1HZB A;  5M3M G;  1L1O B;  2D0P A;  4A3F G;  4JBM A;  2JA9 A;  1VQ7 A;  1XJV A;  3CCV A;  3S1N H;  4A3C H;  3CCL A;  3HOZ G;  1KAW A;  3GTK H;  3PGZ A;  2UXD Q;  3S1Q H;  4Y52 H;  1JE5 A;  4AH6 A;  5LMN Q;  4LFA L;  4JI2 Q;  4GOP B;  5M3M H;  4OX9 Q;  4A3F H;  2ES2 A;  4DUY L;  4FDB A;  3TS2 A;  3PUZ A;  4IPD A;  2YYZ A;  3HOZ H;  1Y14 B;  4HJ8 A;  1PH7 A;  4ME3 A;  4OO1 I;  5C0X J;  1IBM L;  1CKO A;  4A93 G;  1S3O A;  4PZ7 A;  2CQO A;  4R4Q A;  1L0W A;  5FJ8 G;  3J81 c;  4MZ9 A;  3S2H H;  1N36 L;  1N33 L;  4QY7 A;  4QL5 A;  4MNO A;  1Y1W G;  3CCJ A;  4DUZ L;  5E7N A;  2GVA A;  4QQB X;  4JBJ A;  1X6O A;  5JEA J;  3W1G A;  2JA7 H;  1Q8K A;  2YTV A;  3HOX G;  5FJ8 H;  4XIG S;  5GAG C;  3U58 A;  3J7Z C;  1B7Y B;  1SE8 A;  3K0X A;  2NVQ H;  1X54 A;  3CXC A;  2UUB Q;  4TVA B;  5M5W H;  2R7D A;  3I4M G;  3HOW G;  1VQJ A;  4HIO A;  1Y1W H;  1XNQ Q;  1YVC A;  5IYC G;  1G6P A;  2KHJ A;  5IWA Q;  4DAM A;  1I94 Q;  3CPW A;  5IE8 A;  2ZJR A;  3T1H Q;  4DK6 C;  3H3V I;  4A4I A;  2WP8 J;  3S15 H;  2AKW B;  1LM0 A;  1UEB A;  5C3E G;  1YJW A;  4GNX A;  3AFP A;  3HOX H;  4B3S Q;  1HNW L;  5LMU L;  1LUZ A;  1O7I A;  1KXL A;  1VS0 A;  1XMO Q;  3HOW H;  1JJC B;  4IFD J;  5IYC H;  3ULP A;  4RG1 A;  3RLN A;  1YBY A;  1Z9F A;  1AE2 A;  1WYD A;  5HGQ A;  1QVF A;  1HH2 P;  1HJP A;  1X56 A;  2VL6 A;  2K5V A;  2MO0 A;  1VQC A;  1PH6 A;  1OXT A;  3F8T A;  5C3E H;  5AJ3 L;  3ULJ A;  3A5Z B;  3RZD H;  1KRT A;  3S1R H;  1D7Q A;  2KBN A;  4IO9 A;  1HNX Q;  4DR4 Q;  3M85 A;  1Y1V G;  5BR8 Q;  3JC6 6;  2NZO A;  2JA5 H;  4A3L G;  4KHP Q;  5EAY A;  2RCN A;  2N78 A;  4DV4 Q;  4HJ5 A;  3TS0 A;  3RN5 A;  4LF4 L;  3EIV A;  3I4N H;  1TWH H;  4DR7 Q;  3KJP A;  4TQU S;  2OQK A;  1EFW A;  1B70 B;  1G51 A;  1VQ9 A;  2ID0 A;  2Z6K A;  4NXN Q;  3H0G G;  1OXX K;  4HIM A;  3F1Z A;  1Y1V H;  4LFB L;  4HIK A;  3CPF A;  2LXK A;  3DM3 A;  4L5Q A;  3J80 c;  1XMQ L;  5GAE C;  2NN6 I;  1GD7 A;  2Y0S E;  3K80 C;  3M4P A;  4NXM L;  1SFO H;  1PH4 A;  4B3T L;  1T9H A;  1YHB A;  3CW2 C;  4BA1 I;  2JA6 G;  4YY3 L;  1QUQ A;  2CWA A;  4UPA A;  5IP9 G;  4GLX A;  2ZTE A;  3UDX A;  4IOC A;  3BJU A;  1K73 C;  2EQS A;  1AE3 A;  4JOI A;  1KHI A;  1I3Q H;  3OYY A;  3B6Y A;  3GO5 A;  5M5X H;  4HJ9 A;  2NVT H;  2Q2U A;  1WI5 A;  4DV6 L;  3S14 H;  4LF6 L;  1CSP A;  1EIY B;  1N32 L;  5GQO A;  2JQO A;  5IP9 H;  4B3R Q;  4GNX C;  1PYS B;  1U5K A;  4YWK A;  5C0X G;  2E5L L;  4AQY L;  4DK3 C;  2K4K A;  4LFC L;  1D8L A;  1NY4 A;  1FVI A;  3HKZ E;  2R93 G;  3A0J A;  4K0K Q;  2YTX A;  3PV0 A;  1QZG A;  2R7Z G;  2MQH A;  5J3B A;  1NJI C;  5IY0 A;  1XNR L;  2F4V L;  4GKK Q;  4X6A H;  4YHH L;  4A3J G;  2KHI A;  1K8G A;  4APV A;  3GTL H;  3TRZ A;  1N9W A;  1X55 A;  1P16 A;  4JI5 Q;  1C7Y A;  4J15 A;  3G48 A;  5C44 G;  2UUA Q;  1VQF A;  1A0I A;  3ZJY C;  5JEA G;  2ATW A;  1K83 H;  1YHA A;  4DV0 Q;  3IRB A;  2R93 H;  2K14 A;  1MJE A;  1FJG Q;  1CKN B;  3I2Z A;  2JA8 G;  1PH2 A;  1HR0 Q;  2R7Z H;  2PMZ E;  3GTO H;  1HNZ Q;  2UUC L;  2C35 B;  1JJ2 A;  1JJG A;  1J5E L;  1VQH A;  2JE6 I;  4A3J H;  2HIV A;  2KCM A;  2B29 A;  3GTP H;  3HOU H;  4DV1 L;  2N8N A;  4JI0 Q;  4HJA A;  2OWO A;  4DV5 L;  5C44 H;  4PMW A;  1Q7Y C;  1CSQ A;  2LXJ A;  2VZA A;  2UXB Q;  1WFQ A;  4IJH A;  3E9H A;  2JA8 H;  4GOP A;  4LF9 L;  2B3G A;  3I7F A;  1K3R A;  3LGJ A;  4GS3 A;  3T1Y Q;  1PH1 A;  4JI6 Q;  4DR1 Q;  3U4Z A;  2VNU D;  2KCT A;  4WJ4 A;  3GD7 A;  2JEB I;  1PH3 A;  4IFD G;  2QA4 A;  3GTJ H;  1QZH A;  2VS1 A;  1A63 A;  5GAD C;  1EYG A;  3PUV A;  2UU9 Q;  4XTC S;  4JYA Q;  1I6H H;  4DV7 Q;  4HJ7 A;  2EXD A;  5FLX c;  1YZ6 A;  4LF8 Q;  5LMN L;  1L2F A;  4B3M Q;  4IJL A;  4P74 A;  4JI2 L;  4POG A;  4JOI C;  4LUV A;  3L7Z C;  2UXC Q;  1H95 A;  4OX9 L;  3F2B A;  1S72 A;  1KD1 C;  2CFM A;  3KF6 B;  3M9B A;  2A19 A;  3FP9 A;  1GO3 E;  3MEF A;  3H15 A;  2N49 A;  1U0L A;  2ZTC A;  5K36 G;  1VQA A;  1MJC A;  1VQM A;  3GTM H;  4LUO A;  1EIF A;  4MTN A;  2E2J H;  3OTO Q;  4JG2 A;  1TWA H;  3CCU A;  4GN4 B;  1W3S A;  2JJQ A;  2VY3 A;  4LFA Q;  1GVP A;  3PCO B;  2VQE Q;  4JI8 Q;  1YHQ A;  1TXY A;  4NPS A;  3G6E A;  1C9O A;  1WOC A;  2D0O A;  4DV2 Q;  1KIX A;  4A93 H;  2JEA I;  4OON A;  4ALP A;  1E1O A;  1IXR A;  2I5H A;  4R4T A;  3M3Y H;  2F3I A;  1M1K C;  3TQY A;  1N34 Q;  4A3B G;  4DKA C;  1L1O C;  3CC2 A;  2ALY B;  2UUB L;  1E3P A;  2PNH A;  1JMC A;  3S17 H;  3GTQ H;  1C0A A;  2K5H A;  1Q82 C;  2QGQ A;  1DGS A;  1XNQ L;  4AYB E;  3CCS A;  1EQQ A;  4LF7 Q;  5IWA L;  1S40 A;  1TWF H;  2ASB A;  2K50 A;  2BH2 A;  1I94 L;  3CCE A;  4IOA A;  2E8G A;  4A75 A;  3S16 H;  3RLO A;  4NB3 A;  1NMG A;  3NEN A;  4GOP C;  4JI4 Q;  3E0E A;  4B3S L;  4A3B H;  2IX0 A;  4A3E G;  3I4M H;  2RHQ B;  4DV3 Q;  1W2B A;  3M4O H;  4A3D G;  1XMO L;  3NBH B;  1MKH A;  2AMC B;  3PO2 G;  1X3G A;  4UP8 A;  3CMA A;  4JC0 A;  4DPG A;  4R4O A;  4A3I G;  2BA0 A;  2WAQ E;  2PQA A;  4L5S A;  1HR0 W;  4LNQ A;  5IYB G;  3S1M H;  1VCI A;  4DR4 L;  5IYD G;  3UE0 A;  1EOV A;  4A3E H;  4DR3 Q;  5BR8 L;  4P75 A;  1EUJ A;  1FL0 A;  1N8R C;  1VQK A;  1QVG A;  2D62 A;  1VQI A;  4A3D H;  4KHP L;  4GLA C;  3D0F A;  4IPG A;  1G29 1;  2ZTD A;  1YJN A;  4P73 A;  4AIM A;  5C4J H;  4DV4 L;  2H5X A;  1OXU A;  1IBL L;  4A3I H;  4DR7 L;  5IT9 c;  2PQA B;  2Y0S G;  2FXQ A;  3K7U C;  1OXS C;  4NXN L;  3KFU A;  3W5O A;  4LF5 L;  4KHZ A;  2WFW A;  1EQR A;  1ASY A;  3W1B A;  4A3L H;  1MIU A;  5IYD H;  2VW9 A;  3I56 A;  1JT8 A;  2GVB A;  4YWM A;  4RMF A;  3JAM c;  1PV4 A;  4DR6 Q;  2F52 A;  3STB D;  3NEL A;  3J7A 5;  4DR2 Q;  1VQ8 A;  1UE6 A;  2R6G A;  4BXX G;  4GKJ Q;  3H0G H;  1VQP A;  3S2D H;  2V1C C;  2I5M X; 
#chains in the Genus database with same CATH topology
 1CK1 A;  1KNA A;  3TEH B;  1VQL A;  2L4N A;  4K14 A;  3HKS A;  5CBE E;  2JA6 H;  2A1A A;  2F0F A;  3PUY A;  3S1R B;  1ZYR D;  5CV4 A;  3MWY W;  3J81 L;  3K5M A;  4K0K L;  1Q46 A;  1W6K A;  3FHW A;  1CKM A;  2EOT A;  2FHT A;  4A3K G;  2AWN A;  2RBM A;  3G7L A;  1PTO C;  3FKI H;  3J81 i;  3OMG A;  1SRO A;  1CHQ D;  3N52 A;  3UDI A;  5C0X H;  2UUA L;  1JOQ A;  1AN8 A;  4NP5 A;  5KRU A;  1FJG L;  4CBV A;  1LTA D;  4XDX A;  3CD6 A;  3WDN A;  2BDN A;  2R61 A;  2RKS A;  2WB1 E;  4JI0 L;  4IFD I;  2UXB L;  2XWB B;  3T1Y L;  5I9O A;  5JAV A;  1SEB D;  3J7A F;  2NYZ D;  4JI1 Q;  1Q1B A;  1HUM A;  2XWJ B;  3BZC A;  1VQO A;  3ND8 A;  1PFB A;  3CC4 A;  1ZKO A;  4JYA L;  2MJ8 A;  4ZCK A;  4LF8 L;  3HOV G;  5JVH 3;  4B3M L;  4DV5 Q;  2QEX A;  2WAC A;  1WCM G;  3SE0 A;  3M4Y A;  4RHS A;  1ZYR C;  1P8L A;  5J22 A;  3VDY A;  2WB1 B;  3G4S A;  2X6L A;  3BVM A;  3HZX A;  2R93 B;  4C3I G;  3SR1 A;  3AQQ A;  3OTO L;  4K5W A;  2OTJ A;  5GRO A;  2FMC A;  3SVM A;  1Q86 C;  4DUY Q;  3ER0 A;  2N3S A;  4YWL A;  1J9O A;  1CHP D;  1IBM Q;  3HOY G;  5C3X A;  4MN3 A;  2JA7 G;  3MC0 B;  5DAU A;  3NBH A;  4GLV B;  3FEW X;  3A8J E;  3BDL A;  1UE5 A;  3T1H L;  4K8J A;  3TSS A;  1EY4 A;  4LW1 A;  1OTC A;  4BBS H;  1XWE A;  1K8A C;  4JI4 L;  1M8A A;  2K5D A;  2IWH A;  4IPC A;  1CTM A;  4R1J A;  1I5F A;  3PO3 G;  1V1P A;  3PIO A;  4ODG A;  5ELO A;  3GTM B;  2HD3 A;  3X3N A;  3IKJ A;  1LTL A;  1RDP D;  1BKB A;  1TWA B;  1AW7 A;  5EGT A;  4DR3 L;  1SNC A;  1HA6 A;  4JBK A;  1NTG A;  2XNA C;  4KTA A;  4DA2 A;  4A93 B;  3AEV A;  2DNE A;  1SRU A;  5IYB H;  3FVQ A;  1D6E C;  3KK7 A;  5JJZ A;  5AJ3 Q;  4A3G H;  4B08 A;  4GNX B;  3SGI A;  4DR6 L;  1YEZ A;  4X3U A;  4DK1 A;  2E2D C;  2HCI A;  4DR2 L;  3HOX B;  4LF4 Q;  3CCR A;  1V8Q A;  1UUP A;  2XIW A;  5DLQ E;  1IBL Q;  2IY5 B;  3I55 A;  2LS0 1;  2OEO A;  4QJF A;  1ASZ A;  3QIA A;  3K5L A;  1NMF A;  3WOF A;  3AU7 A;  2ZJQ A;  1EWI A;  1E2W A;  4NXM Q;  1SDF A;  3UE1 A;  4ZQ3 A;  3D3R A;  4BS9 A;  5LMN W;  4A3D B;  1QVC A;  3TP5 A;  4A3M H;  1SYF A;  5KNB A;  3NWT A;  2ZJP A;  4H13 C;  4EX5 A;  2HT1 A;  4N9T A;  1D5Z C;  2F0T A;  1Z47 A;  2EVB A;  2E74 C;  2WB1 G;  1KLG D;  4UHV A;  3G71 A;  4R4I A;  2N88 A;  2B63 H;  2I0Q A;  1VQD A;  4JI6 L;  5M9O A;  4GZY C;  2AUJ D;  2O5J C;  4OXP A;  2F0U A;  4JI1 L;  2JP1 A;  2G9D A;  2JA6 B;  2RDG A;  4L5T A;  3BU2 A;  4IPH A;  1DOK A;  2LSS A;  3DMU A;  4O42 A;  1JIC A;  4L8J A;  1EY5 A;  1JWM D;  5HGT A;  2KCC A;  1CA5 A;  4IUV A;  3HKZ B;  1AZP A;  1HZB A;  3FKI B;  1STB A;  5L37 A;  2BE5 D;  2L55 A;  4X3S A;  1F9Q A;  3CCV A;  3GTO B;  4DAY A;  2C5C A;  4AH6 A;  4Y52 H;  4IUU A;  1EEI D;  4OX9 Q;  2EJF C;  3NBI A;  2ES2 A;  4O1N A;  4DUY L;  4KKT A;  5ELD A;  1ICF B;  4IPD A;  2YYZ A;  1WD1 A;  4ME3 A;  5DEH A;  4A93 G;  2IPK D;  1IBM L;  1S3O A;  1X3P A;  1Z7T A;  4U68 A;  4E6I A;  3D4W A;  5JVG 3;  2F0W A;  1DOM A;  5ELF A;  1Y1W G;  1X6O A;  3QR8 A;  2E76 C;  2M00 A;  1EZ8 A;  1SBB B;  1Q8K A;  2YTV A;  3HOX G;  4XIG S;  1WTQ A;  1HFN A;  4JPB W;  2UUB Q;  1H9R A;  4TVA B;  3RUZ A;  2NB0 A;  4HIO A;  3J7A V;  5IWA Q;  2LY7 A;  4DAM A;  2BE5 C;  1JB3 A;  2ZJR A;  2AKW B;  4XT1 B;  5C3E G;  1YJW A;  3VR5 A;  1H9K A;  3VA5 A;  4B3S Q;  5CV9 A;  5KNC A;  1O7I A;  4FVM A;  3HOW H;  1JJC B;  3K6O A;  5KEE A;  1Z9F A;  1WYD A;  1VQC A;  1OXT A;  3F8T A;  1EQT A;  5AJ3 L;  3A5Z B;  3M7G A;  4IO9 A;  1F9S A;  4OHJ A;  1HNX Q;  2EYP A;  2NTS A;  1E0B A;  2WV6 D;  3WOE A;  5EAY A;  5C4Z A;  1T5X D;  2RCN A;  1S5D D;  1RCV D;  4HJ5 A;  1HCZ A;  2NUC A;  4LF4 L;  1ENA A;  3EIV A;  4BBS B;  3M4O B;  4HAE A;  4TQU S;  2L11 A;  2Z6K A;  1VQ9 A;  4NXN Q;  2I07 B;  4KKU A;  5CR3 A;  3F1Z A;  1Y1V H;  2B2W C;  4HMJ A;  4EQP A;  1AZQ A;  4NXM L;  1PH4 A;  5A2Q E;  1T9H A;  4A3E B;  1RTO A;  3T13 A;  4FYD A;  2JA6 G;  1QOH A;  2EYO A;  5IP9 G;  5C4J B;  4GLX A;  3BJU A;  2JXM B;  2Q2U A;  3N6R A;  4KJO A;  4A3G B;  5J39 A;  1CSP A;  3A54 A;  3DEO A;  4GNX C;  1PYS B;  4YWK A;  5C0X G;  4LFC L;  4LAA A;  2TSS A;  2YTX A;  3PIP 3;  3P20 A;  5J3B A;  4KD3 A;  1BNZ A;  2LFN A;  5NUC A;  2QKI C;  3GTL H;  3I73 A;  2J7Z A;  4APV A;  1P16 A;  2H1E A;  5E4X A;  4J15 A;  1VQF A;  1A0I A;  4G57 A;  3SK4 A;  5JEA G;  2ZT9 C;  2K32 A;  1A2T A;  1SE4 A;  5HUR A;  3I3C A;  2C35 B;  3T16 A;  4A3J H;  3T56 B;  3KLR A;  3MZ5 A;  2EE1 A;  3NE5 B;  1WTR A;  4FXD A;  5C44 H;  4A3M B;  1HUN A;  1Q7Y C;  1CSQ A;  2LXJ A;  1WFQ A;  2MGS A;  4GOP A;  2B3G A;  1BCP B;  3LGJ A;  4GS3 A;  3K5N A;  3GD7 A;  2ENB A;  1VF7 A;  1QZH A;  5GAD C;  5EKK A;  2F0S A;  4DV7 Q;  4CKB A;  5FLX c;  4KY5 A;  4EVO A;  1L2F A;  4JOI C;  3L7Z C;  5I2X A;  3HGB A;  2DJG C;  4FO2 A;  4OX9 L;  1KD1 C;  1JR0 D;  2B63 B;  3M9B A;  2BOS A;  1I4G A;  3MEF A;  3H15 A;  1U0L A;  1MJC A;  1EIF A;  4MTN A;  5I9P A;  3NTH A;  1H9S A;  3A8K E;  4S3S A;  1QNU A;  2JJQ A;  4HR7 B;  2VQE Q;  4JI8 Q;  4MHE A;  5E4W C;  2D0O A;  4DV2 Q;  2A68 D;  3DEP A;  3K57 A;  2I5H A;  3NTI A;  2F3I A;  2O4X A;  3HRZ C;  1WVL A;  3CC2 A;  3MFY A;  2A5H A;  4IUR A;  4K5V A;  2UUB L;  1E3P A;  1JMC A;  3S17 H;  2KCN A;  3NSW A;  1DGS A;  1LTR D;  5C4H A;  4EQN A;  5IWA L;  4BY7 B;  4IOA A;  3S16 H;  4Q0F A;  4B3S L;  3E0J A;  4A3B H;  4A3E G;  1S5E D;  4IQZ A;  3BVZ A;  3HP3 A;  4DPG A;  4R4O A;  4CJ2 C;  2BA0 A;  4L5S A;  1U9R A;  5EPK A;  5IYB G;  1LTI D;  3MFG A;  1EOV A;  1EUJ A;  1FL0 A;  4XYO A;  1F2M A;  2D62 A;  4BY1 B;  3GV6 A;  1OXU A;  3Q23 A;  2K6A A;  1RF2 D;  3SK5 A;  1OXS C;  4NXN L;  3W5O A;  1ASY A;  4A3L H;  3S9W A;  2VW9 A;  2A68 C;  3FRP B;  4YIJ A;  1JT8 A;  1ZEQ X;  1GUS A;  2GVB A;  2Q8T A;  1G91 A;  3EFX D;  2K28 A;  4RMF A;  1IYV A;  1EYD A;  4I7Z C;  1VQ8 A;  2B2U A;  4BXX G;  1B4O A;  3S2D H;  2VB3 X;  3QOJ A;  4IZ8 A;  4FNF A;  3KLW A;  4C3J H;  4X64 Q;  5GAH C;  4A3M G;  1SNO A;  2CKZ B;  1GUT A;  2IT1 A;  4JCV E;  1QCB D;  4RGT A;  2F0O A;  1R9T B;  1CKN A;  1XYI A;  4PZ6 A;  5T1G A;  2MNA A;  3RR5 A;  1STA A;  4ABN A;  1X9N A;  2BH8 A;  1DYQ A;  4HTH A;  4LMQ D;  4O0A A;  4TSS A;  1WJJ A;  2EY5 A;  5D3D A;  1Y1V B;  1D1K A;  2LKV A;  1KC8 C;  1YIT A;  1EEF D;  1HFG A;  2E5L Q;  2EYM A;  5ELN A;  3WWV A;  1NR4 A;  1VQN A;  1BCP D;  1X65 A;  3M4Q A;  3K8A A;  4KY6 A;  3MXN B;  2Z6K C;  1SLJ A;  1J6Q A;  1SNM A;  1LO5 D;  3PUX A;  2HHH Q;  1SMX A;  5COY A;  2VQF Q;  3RZO H;  4PMC A;  3IFT A;  3E9I A;  3KF6 A;  2O5I C;  3AFQ A;  1E1T A;  2R92 G;  1J5E Q;  1XPU A;  4DV7 L;  3AYH B;  3ERS X;  3IFD A;  3GP7 A;  1SR3 A;  1TR5 A;  4K6L A;  2J4X A;  2AHO B;  1VQ5 A;  1K0R A;  4BY7 G;  5KYL A;  3GTL B;  1LAC A;  1R4P B;  2F0K A;  4PNY A;  2GA4 B;  3BDC A;  2F0P A;  1JWS D;  1ILP A;  3OWF A;  1EU3 A;  1GM5 A;  1B2T A;  3T4A C;  3OHX C;  1YIJ A;  1KQS A;  1VQG A;  4A3J B;  2XGT A;  3V05 A;  1C48 A;  5M3F H;  1UE7 A;  2OQ0 A;  1UNS A;  3ICE A;  1QNK A;  4JI8 L;  1JCK B;  2VQE L;  5C44 B;  1SND A;  4DV2 L;  4ZKC B;  4UY8 C;  3S24 A;  4BY1 G;  1BCP C;  3AMU A;  3KF8 A;  2CVR A;  3TRE A;  5K5P A;  5TSS A;  1BF4 A;  1QJO A;  3GTG H;  2AQ1 B;  3GTK B;  4H0L C;  2CWP A;  1N36 Q;  2A8V A;  4IUP A;  3L0O A;  1ET6 A;  4OO1 G;  5IP7 H;  4HID A;  5FLM G;  1GKH A;  5M3M B;  2DUD A;  3KF8 B;  2HQL A;  1E7Z A;  1PFN A;  2RSN A;  5FO8 B;  1TS3 A;  1PMR A;  4BBR H;  3CCM A;  4EQ5 A;  1Z6H A;  2KOL A;  3RLF A;  5C4X H;  2MP1 A;  3Q8D A;  1GHJ A;  3PF5 A;  1A2U A;  1KDB A;  3I4L A;  3PO2 H;  1B53 A;  4V0B A;  1HNW Q;  4CDD C;  2Z1C A;  1F77 A;  2XRQ D;  1SJH D;  5JJL A;  2D2C C;  3S17 B;  5LHY 1;  1MBY A;  1IKL A;  3QG1 A;  5EQ0 A;  1KAA A;  4P71 A;  1LT6 D;  1UAP A;  1SNQ A;  4F8M A;  4KV6 A;  3S16 B;  5FLX E;  2B39 A;  4A3B B;  1RD9 D;  2B8F A;  1MHW C;  3UDF A;  1BBW A;  4X64 L;  2ZXP A;  1PHJ A;  5IOD A;  1V43 A;  1MSG A;  1II3 A;  1JOK A;  4OEL B;  4OWT B;  1ONL A;  3J81 E;  1EY6 A;  4YY3 Q;  1YJ9 A;  2RDH A;  2NN6 G;  4XQQ A;  5T1I A;  2KED A;  2D5D A;  1HQM C;  2YU9 H;  2Q2H A;  3RN2 A;  2PW7 A;  2QF7 A;  2YTY A;  4L5R C;  3U50 C;  4YCW A;  2B2Y A;  1Q1E A;  1Y8O B;  5G3L F;  1VMC A;  4HMI A;  4DV6 Q;  3PF4 A;  4PZ8 A;  4O2D A;  4MIU A;  1N32 Q;  1QUQ B;  1TS5 A;  2R7F A;  4XXE A;  4UP7 A;  3VR4 A;  2Z6B A;  5DNF A;  2F03 A;  2EIF A;  3HG9 A;  4KLK A;  2ZXR A;  1WD0 A;  3S2D B;  1VMP A;  2QCP X;  2J0T D;  3CCQ A;  2A6E D;  2WKD A;  1NCV A;  4C3J B;  2CH4 A;  2HHH L;  2VQF L;  4RH6 A;  2VUM G;  2ZXO A;  3NP8 A;  1NE3 A;  3KYH C;  1ESR A;  2B2U C;  2UUC Q;  1RL2 A;  2Z4I A;  1M90 C;  1CZW A;  4BA2 I;  2K33 A;  3H3V C;  4A3C G;  2PYK A;  1EYC A;  1B8A A;  1BXT A;  3BZD B;  4ZK9 B;  5M3M G;  4A3F G;  1PDQ A;  4JBM A;  2JA9 A;  1VQ7 A;  1GJX A;  3S1N H;  2FMM A;  2EJM A;  4TKO B;  1KAW A;  3PGZ A;  2UXD Q;  3Q0A A;  1EWH A;  4V19 0;  4ULL A;  3GTP B;  4LJZ C;  2PZT A;  1FNV A;  2CQA A;  5CV7 A;  1LTB D;  4FDB A;  3PUZ A;  3VYS A;  3HOZ H;  3RZO B;  2Z4H A;  4HJ8 A;  1PH7 A;  4CDC C;  4OO1 I;  2A6E C;  5EBC A;  4CGY B;  1I6H B;  2B2W A;  1FNU A;  1N36 L;  4QY7 A;  3CCJ A;  5E7N A;  3SK6 A;  2GVA A;  4C1N I;  4N8F A;  1CZG A;  5FJ8 H;  5ELB A;  5GAG C;  3U58 A;  1SNP A;  3K58 A;  2B2V A;  4F87 A;  5M5W H;  4DXG A;  1VQJ A;  2G9H D;  1G6P A;  1YVC A;  5IYC G;  1PRT B;  4XQJ A;  1I94 Q;  5IE8 A;  3H3V I;  1UEB A;  4GNX A;  3AFP A;  1PYW D;  1HNW L;  1LUZ A;  4FXG C;  1K28 A;  3R2I A;  3EVQ A;  3TBI B;  2WIN B;  3ULP A;  1STN A;  1PXU A;  1HJP A;  2MO0 A;  1PH6 A;  4KKS A;  4L63 B;  3ULJ A;  1EFI D;  3GTG B;  1KRT A;  2KBN A;  4DR4 Q;  3M85 A;  3JC6 6;  2JA5 H;  4A3L G;  4K6D A;  4DV4 Q;  3TS0 A;  2Q8R E;  1TWH H;  4OL7 A;  2OQK A;  2H4O A;  1G51 A;  2ID0 A;  5IGF A;  2I46 A;  1OXX K;  3GQB A;  1NNX A;  4HIM A;  2LMC B;  5CGK A;  3DM3 A;  4ZYS A;  2NN6 I;  2Y0S E;  3K80 C;  5IIF A;  1SFO H;  1JWU D;  2HDL A;  4YY3 L;  3PO2 B;  2ZTE A;  1M4V A;  4A3I B;  1K73 C;  2K03 A;  3NUC A;  1EIH A;  4JOI A;  3X3M A;  1I3Q H;  1L0Y B;  3B6Y A;  2NVT H;  1J8I A;  4DV6 L;  3S14 H;  1WTH A;  2F0H A;  1N32 L;  4B3R Q;  1MSH A;  1EWC A;  5C3W A;  2R93 G;  3OOC A;  1FVI A;  3HKZ E;  2Y0S B;  1QZG A;  3VYT A;  1I4X A;  1VDZ A;  4GKK Q;  2KHI A;  1K8G A;  1PRT F;  4JI5 Q;  1ML0 D;  3G48 A;  3ZJY C;  1B9M A;  1K83 H;  3MA2 B;  3I2Z A;  4RHR A;  1HR0 Q;  2R7Z H;  2UUC L;  1JJ2 A;  1VQH A;  4DU9 A;  3HOU H;  1BUV T;  4QF4 A;  4DV5 L;  4ZKB B;  2VZA A;  3E9H A;  3FPU B;  2JA8 H;  4DR1 Q;  1GXD C;  1CQV A;  2JEB I;  1L0X B;  2K7V A;  2QA4 A;  1EYG A;  4G7Z C;  1ILQ A;  2UU9 Q;  1YZ6 A;  4IJL A;  2B2Y C;  2UXC Q;  1H95 A;  3C1E A;  1ZXT A;  3F2B A;  1S72 A;  3VR6 A;  4IFD H;  3I8Z A;  2A19 A;  3FP9 A;  5IGD A;  2X69 A;  2MPM A;  4DNT B;  1VQM A;  1WTV A;  3MTS A;  4JG2 A;  4QIW B;  1UEA B;  4CDF C;  4GN4 B;  3R93 A;  4LFA Q;  2DNC A;  3PCO B;  3Q22 A;  4NKL A;  4NPS A;  1C9O A;  3I72 A;  1KIX A;  2KEC A;  5K36 H;  4R4T A;  3M3Y H;  4DGZ A;  5EPL A;  1RTN A;  1STG A;  4CKC A;  4DKA C;  1TU2 B;  4H44 C;  1U4M A;  1C0A A;  3GTQ H;  1W6J A;  4LF7 Q;  2ASB A;  2ICI A;  2TMP A;  4J8Q A;  1I94 L;  2AUK A;  4DK0 A;  1Q90 A;  4KK7 A;  3LNN A;  3QO2 A;  3I4M H;  2RHQ B;  1PTO H;  4DV3 Q;  1G6Z A;  4A3D G;  3HOZ B;  1MKH A;  2AMC B;  3PO2 G;  1X3G A;  1A3V A;  2K1B A;  4A3I G;  2N55 A;  1HQR D;  4LNQ A;  2CH4 W;  3S1M H;  2P5Z X;  4DR4 L;  4GKJ Q;  3UE0 A;  1N8R C;  1CI3 M;  3NXW A;  4CDE C;  1QVG A;  1VQI A;  3D0F A;  1G29 1;  2ZTD A;  4DV4 L;  1X3Q A;  2L0C A;  4DN4 M;  1IBL L;  4KN7 C;  5LL6 X;  1JQY D;  3E5S A;  4JK1 C;  2Y0S G;  3KFU A;  4KHZ A;  1EQR A;  5IYD H;  1PV4 A;  2DJF C;  4HED A;  1AP0 A;  1UE6 A;  3H0G H;  1VQP A;  2V1C C;  2I5M X;  2B2V C;  4RCN A;  2YV5 A;  4JI7 Q;  4PG3 A;  2K52 A;  2CCZ A;  1XMQ Q;  3A8I E;  3HKZ G;  3FKI G;  4YCV A;  2A6H D;  2EPB A;  2NVY H;  2GN5 A;  3OSO A;  4B3R L;  4NMZ A;  4JV5 Q;  3GDE A;  2IL8 A;  2JA5 B;  5KGU A;  4JI3 Q;  4FF2 A;  4WJ3 M;  4GKK L;  1TWH B;  1R4Q B;  2EZV A;  2EJG C;  4JI5 L;  1HZA A;  5BN5 A;  2AWO A;  4ID6 A;  1PLF A;  2KHS A;  1ENC A;  2A69 D;  1PZJ D;  3OMC A;  4UDU C;  4DR5 Q;  1CT1 D;  1SFO B;  4A3K H;  1HR0 L;  4IN3 A;  3ZYY X;  1EY7 A;  1ROD A;  4F88 A;  2SNM A;  4H7B A;  4R4C A;  1XPR A;  1HZC A;  1I3Q B;  4P2C B;  2NVT B;  4DR1 L;  4X62 Q;  3S14 B;  3BDO A;  1PA6 A;  5IGC A;  4UP9 A;  2UU9 L;  1NAP A;  1PVO A;  1LV9 A;  2F0E A;  3M7N A;  1KL9 A;  1PH9 A;  4A76 A;  1NBW A;  2IJ0 A;  2UXC L;  2A6H C;  1IBK Q;  2E2I H;  2Z8L A;  1FR3 A;  3KDF B;  2SEB D;  3C1F A;  3NQI A;  5F2D A;  2EY2 A;  1X32 A;  4Z9C B;  5IGB A;  2EYH A;  3CP0 A;  4JBW A;  1D1I A;  1K83 B;  4POF A;  1Q81 C;  3P75 A;  3HOV H;  2F0D A;  3URY A;  4CHT B;  3BYY B;  3TDQ A;  1HZ9 A;  1FNW A;  3C3L A;  1WCM H;  3ULL A;  4FF4 A;  3JAM L;  2HIX A;  3EQL C;  4UAI A;  2A69 C;  3HOU B;  1CM9 A;  1PH5 A;  4N8X 1;  2L15 A;  2JA8 B;  3JAM i;  3RNU A;  5D3I B;  4C3I H;  4BBS G;  1F2Z A;  1Q3L A;  5KND A;  3T51 B;  3I4O A;  3UI2 A;  2WKC A;  3OWE B;  4LF7 L;  1N33 Q;  3K7A H;  2JYO A;  1KTK A;  2FIN B;  3ERQ A;  3HOY H;  3W3A A;  4KHV A;  4DV3 L;  1X3E A;  2PO4 A;  5EBD A;  3DLL A;  2JSO A;  4Y7N H;  1VQ6 A;  5M5Y H;  3CF5 A;  1HNX L;  2IHE A;  1KLU D;  4A3G G;  4GKJ L;  3KLS X;  1V1Q A;  3PO3 H;  3R2T A;  1F2Y A;  4HN7 A;  1RIP A;  1QE6 A;  2F0L A;  2HDM A;  4DNI A;  1SXT A;  3F2C A;  2JA5 G;  3M3Y B;  1EZ6 A;  2NWG A;  4ZUI A;  2NZH A;  1S5F D;  4P72 A;  1PYB A;  3GTQ B;  3IAY A;  3NEM A;  3A74 A;  4HSP A;  3KLS A;  4GN5 A;  3BS1 A;  3F2D A;  4K2L A;  2NVX H;  2PZU A;  4FF1 A;  1EY9 A;  4RKB A;  3I4M B;  1PH8 A;  3PIP A;  3HOW B;  2F0N A;  5C0X I;  2XVS A;  5E1F A;  4JI7 L;  4LF5 Q;  1LTS D;  4LFB Q;  4K8I A;  3VR2 A;  4ILW A;  4B3T Q;  1FGU A;  4DF7 A;  1K9M C;  3S1M B;  1PZI D;  1LYL A;  4RGO S;  4JV5 L;  4ME5 A;  1VQE A;  1PZK D;  4JI3 L;  5DM7 3;  4KI0 A;  3HFZ B;  5JJK A;  2E2H H;  1HHV A;  3MXN A;  2K05 A;  3FPP A;  1WTP A;  2EY1 A;  2B63 G;  3BYT B;  1JE4 A;  4DR5 L;  1T5E A;  1XNR Q;  3H0G B;  3HOU G;  1FD7 D;  1TII D;  3R8B A;  1SE3 A;  1YNX A;  3EBE A;  4RCO A;  2OTL A;  2Q2T A;  5H1S E;  1YI2 A;  4X62 L;  1GHK A;  3LWE A;  3D8G A;  4OEM B;  4RA8 A;  2NVY B;  3CQZ H;  2Q2I A;  2VXW A;  2DGY A;  3SXH A;  4DV1 Q;  1E22 A;  5DM6 3;  1KDC A;  2XN9 C;  1IBK L;  1STE A;  2DY7 A;  3A5U A;  1HRJ A;  2QDB A;  3CKI B;  1KAB A;  2D0P A;  4OIK A;  1ENF A;  3CCL A;  1Y8P B;  2RSO A;  4FF3 A;  1PTO F;  3S1Q H;  1PFM A;  2SNS A;  1ESF A;  1JOR A;  1HTP A;  1LT5 D;  1Y14 B;  1CKO A;  2CQO A;  2E75 C;  1RJT A;  4MZ9 A;  3MVV A;  3S2H H;  2IW3 A;  1N33 L;  1DJR D;  1A6X A;  1SYE A;  1B9N A;  1K8M A;  2HCC A;  4K5X A;  4CJ1 B;  4QQB X;  2E2I B;  3J7Y W;  1TT2 A;  3OIQ A;  1DON A;  1U4R A;  2NVQ H;  1X54 A;  3DWQ A;  1EU4 A;  2R7D A;  3I4M G;  2A73 B;  4PQX A;  3HOW G;  3HOV B;  1Y1W H;  1XNQ Q;  2KHJ A;  5I4D A;  3CPW A;  1RHP A;  3T1H Q;  4A4I A;  2WP8 J;  1WCM B;  1LM0 A;  5CC4 A;  3HOX H;  3MXG A;  1VS0 A;  4IFD J;  4RG1 A;  1YBY A;  1QVF A;  1AE2 A;  1MI2 A;  5HGQ A;  1X56 A;  3TP8 A;  2QW7 A;  5C3E H;  3DWA A;  1CFM A;  3RZD H;  2SOB A;  1D7Q A;  2RQX A;  1Y1V G;  3VYR A;  5CV8 A;  2NZO A;  3K7A B;  4KHP Q;  3OIP A;  2F1M A;  2N78 A;  2PQE A;  3QB3 A;  4X3T A;  3I4N H;  3HOY B;  3KJP A;  3PIO 3;  1F2L A;  1B70 B;  1SSO A;  5FO7 B;  3H0G G;  4LFB L;  4HIK A;  3CPF A;  4FXK C;  4L5Q A;  3J80 c;  5LL6 S;  1GD7 A;  5M5Y B;  1BQQ T;  4B3T L;  3CW2 C;  4BA1 I;  1QUQ A;  2CWA A;  1XX8 A;  1GUN A;  3PO3 B;  3TZD A;  1QG7 A;  2MUY A;  4OIJ A;  3UDX A;  5KYI A;  2EQS A;  1KHI A;  3OYY A;  1QB5 D;  5M5X H;  4I7A A;  4HJ9 A;  1WI5 A;  5CYU A;  1EY8 A;  5IP9 H;  3D6W A;  1U5K A;  2K5W A;  3CRK C;  2E5L L;  4DK3 C;  3A0J A;  3PV0 A;  2MQH A;  1XNR L;  2NVX B;  4X6A H;  4A3J G;  4MTK A;  3C2P A;  3TRZ A;  1N9W A;  1X55 A;  1G2T A;  4WOR A;  4RFB A;  1C7Y A;  5I6Y A;  5C44 G;  5C5M A;  4G7O C;  1YHA A;  4DV0 Q;  3IRB A;  2AQ3 B;  2EY6 A;  2K14 A;  1MJE A;  2B8G A;  1PH2 A;  3G6J B;  2PMZ E;  3GTO H;  1HNZ Q;  1LAB A;  1J5E L;  3KBX A;  3A56 A;  1ET9 A;  2HIV A;  2B29 A;  1A15 A;  5EKL A;  4DV1 L;  1EOT A;  2RDF A;  3GV3 A;  3EA6 A;  5JEA H;  2R3Z A;  4EGV A;  2E2H B;  1KXL A;  3I7F A;  1K3R A;  1PH1 A;  2CW0 D;  5JPN C;  5EPJ A;  4JI6 Q;  4WJ4 A;  2KCT A;  1PH3 A;  2OXP A;  3GTJ H;  3H09 A;  2VS1 A;  4HJ7 A;  2EXD A;  3MAQ A;  4RKL A;  4DFA A;  3H94 A;  4P74 A;  2PMZ B;  2WII B;  5FOB B;  3C46 A;  1EY0 A;  2NTT A;  3DM1 A;  2CFM A;  4XQN A;  2F0J A;  5G3L D;  1GO3 E;  4ZUJ A;  4RGN A;  2N49 A;  2ZTC A;  3P7J A;  1B50 A;  1VQA A;  1EIG A;  3H91 A;  4IUQ A;  4B9X A;  3CQZ B;  3Q6S A;  2E2J H;  4QMG A;  3CCU A;  1GUG A;  2VY3 A;  3NQT A;  4IUT A;  3MHB A;  3PMF A;  4OON A;  5IOC A;  1E1O A;  1IXR A;  1G2S A;  4ZLT F;  1N34 Q;  1IKM A;  4KMU C;  4A3B G;  2DY8 A;  2ALY B;  3LX0 A;  2K5H A;  1DXM A;  4EQO A;  2QGQ A;  4K2K A;  4F7X A;  4RWS C;  4AYB E;  3CCS A;  1XNQ L;  2CW0 C;  1TWF H;  3S1Q B;  2K50 A;  5M3F B;  3CCE A;  4LK1 C;  4A75 A;  3RLO A;  2BDO A;  4NB3 A;  1NMG A;  1SYG A;  3CRL C;  4DAV A;  2IX0 A;  2XRS D;  1RKN A;  3M4O H;  3NBH B;  1NUC A;  3D4D A;  4UP8 A;  3CMA A;  2K5Q A;  4J6H A;  5EJW A;  4JC0 A;  2KQ3 A;  2WAQ E;  4BWG B;  1BR9 A;  3S2H B;  4A3E H;  4P75 A;  1VQK A;  4KHP L;  4AYB B;  5C4J H;  1V1P B;  5COR A;  3A7L A;  4BBR B;  3VA7 A;  5IT9 c;  2FXQ A;  2NVQ B;  2WFW A;  5C4X B;  3W1B A;  4C3J G;  2F0M A;  1DCZ A;  3I56 A;  4IUN A;  1Y1W B;  5A35 A;  5C6A A;  3JAM c;  4X3K A;  3STB D;  3MXU A;  3J7A 5;  2WAQ B;  1TVX A;  2R6G A;  3QWN A;  4M1U B;  1FYC A;  1DM0 B;  2ZM6 Q;  1E24 A;  4KD4 A;  2K5N A;  5FKA C;  5C3E B;  4BXX H;  2Z9H A;  3V96 A;  3RZD B;  3I90 A;  1GUW A;  3CC7 A;  2B2T A;  2NZ1 D;  3SDZ A;  4X66 Q;  1GUO A;  1ICW A;  1Q12 A;  3RMH A;  5BN4 A;  3V2T A;  2BA1 A;  3I4N B;  1BBU A;  5FK9 C;  1QIL A;  1PFS A;  1VQB A;  1TWG H;  3MEH A;  1Y69 U;  4X65 Q;  1B1Z A;  3L2P A;  4DV0 L;  1MGS A;  1HNZ L;  4LFC Q;  4WRD A;  4OWX B;  4U67 3;  3SEB A;  3TN2 A;  1UWV A;  3K5O A;  2YU9 B;  5HY6 A;  1XTD A;  3VR3 A;  3STB C;  4FP5 D;  1A3U A;  2OF1 A;  5M5X B;  4QIW E;  1A62 A;  2XTI A;  1S5C D;  3KJO A;  3DWP A;  4OWW B;  1DZ1 A;  2HUG A;  2UXD L;  2OCE A;  1CQF A;  2V4D A;  2MO1 A;  3CAM A;  1U4L A;  3K81 C;  1EYA A;  5M3F G;  4YCU A;  5JJI A;  2K75 A;  3CME A;  1V1O A;  2R92 H;  3KOJ A;  5EKI A;  4C3H H;  3J80 E;  3J80 L;  4BY7 H;  2IHF A;  5D65 A;  1SE2 A;  3A7A B;  2D9U A;  1IZ6 A;  1B44 D;  2PI2 E;  3J80 i;  1OXV A;  3BVG A;  1PRT D;  5IP7 G;  3CHB D;  1IYJ B;  4AYB G;  4XT3 B;  4DAY B;  1N34 L;  1H9J A;  3S1N B;  1KDA A;  1UE1 A;  1VF5 C;  2EYL A;  4HSV A;  4BBR G;  3GTJ B;  1AH9 A;  3TP7 A;  2PW5 A;  2PI2 A;  3O13 A;  3D31 A;  3ND9 A;  1SYD A;  5C4X G;  4DUZ Q;  2PZW A;  4LUZ A;  1JOO A;  4BY1 H;  5CBA E;  3DUZ A;  3PUW A;  2WAQ G;  2ICE C;  1STY A;  1I50 H;  1I4Q A;  1BVS A;  4OO1 H;  5KIX A;  3LWU A;  5FLM H;  2E2J B;  1TWC H;  3QJY A;  2JK8 A;  2OT2 A;  2RA4 A;  5LMU Q;  4NW2 A;  1TKW B;  2AQ2 B;  4DXF A;  1C4Q A;  5M5W B;  1SYC A;  1A8V A;  3I4N G;  3U9O A;  5FO9 B;  3OW2 A;  1BOS A;  1PRT C;  4H02 A;  4GN3 B;  1TWF B;  1NSN S;  1R9T H;  1IL2 A;  3H3V H;  1WTO A;  1SN8 A;  3Q24 A;  1KRS A;  1VQ4 A;  1JC7 A;  3NK9 A;  4CJ0 B;  2ZM6 L;  3EJI A;  4PV1 C;  1WTX A;  1OO9 B;  1SAP A;  1S4Z A;  3NPP A;  4HCS A;  5ELE A;  3J81 j;  2FFK B;  2Z0S A;  1S5B D;  2IX3 A;  2RF4 A;  1JB7 A;  1TY2 A;  3PSI A;  5A2Q L;  2F0I A;  4X66 L;  2MFI A;  2RHS B;  4JVZ A;  1K0S A;  1IL8 A;  2I5L X;  3L3O C;  4QGU A;  1CUK A;  1B3Q A;  3BZK A;  4LWC A;  4X65 L;  4LF6 Q;  1IW7 D;  3SHL A;  3UDG A;  1O80 A;  1U4P A;  4JW0 A;  2NN6 H;  5I2Y A;  4AQY Q;  4C2M H;  1F9R A;  2F4V Q;  5C5L A;  2K04 A;  3H6M A;  2F0G A;  4YHH Q;  4TRD A;  3P1H A;  4WJW A;  5I6W A;  1IYU A;  3EN2 A;  1O7L A;  5E3F A;  4QCL A;  2KEN A;  3KDF A;  5CV5 A;  2SDF A;  1L1O A;  1XPO A;  1GOZ A;  3U4V A;  4RAU C;  4ZAI A;  1AEX A;  2IX1 A;  2VUM H;  4B9W A;  2QIL A;  1X3F A;  4LF9 Q;  1V9P A;  1TWG B;  1L1O B;  5IT9 E;  5IT9 L;  4KJN A;  1SMY D;  1HPC A;  1XJV A;  2B2T C;  4A3C H;  3A55 A;  3HOZ G;  1B3A A;  2R7Z B;  3GTK H;  2A74 C;  3JAM E;  1JE5 A;  4PMB A;  4XYQ A;  5LMN Q;  4LFA L;  4JI2 Q;  4GOP B;  1BBX C;  1YNJ D;  1IW7 C;  5D14 A;  5M3M H;  3OPO A;  4A3F H;  2DN8 A;  2PCF B;  3TS2 A;  4G4K A;  3AB9 A;  1I4P A;  5C0X J;  4PZ7 A;  4R4Q A;  1I4R A;  1L0W A;  5FJ8 G;  1D5M C;  2F0Q A;  3TZU A;  3J81 c;  2QEJ C;  1DOL A;  2EYF A;  3D6C A;  4QL5 A;  4MNO A;  5CMD A;  4DUZ L;  4JBJ A;  1KNE A;  2HQE A;  5JEA J;  3W1G A;  2JA7 H;  1EQV A;  2F0V A;  2FJ2 A;  3J7Z C;  1B7Y B;  1SE8 A;  2M9V A;  3K0X A;  4R8N A;  3W2D A;  3CXC A;  2R92 B;  1TQO A;  1H9S B;  3MXP A;  3BG3 A;  4C3H B;  1LTG D;  2L9H A;  5BN3 A;  4DK6 C;  3S15 H;  1SMY C;  2KA7 A;  4J1M A;  4RGM A;  2Q8I B;  3E3X A;  5LMU L;  1O7Z A;  2EYJ A;  3DHQ A;  1XMO Q;  1NR2 A;  3FMC A;  5IYC H;  1DD2 A;  3RLN A;  1HA5 A;  1YNJ C;  1HH2 P;  2VL6 A;  2XSC A;  2K5V A;  3I70 A;  3ITP A;  1D2B A;  3S1R H;  1FGB D;  2EXZ A;  4CKE A;  4M8A A;  5BR8 Q;  3VYU A;  1BCP F;  1STH A;  5JPM C;  4OGQ C;  3RN5 A;  1PTO B;  4DR7 Q;  4I65 A;  1EFW A;  1LT3 D;  1WTW A;  4QUC A;  1K3B C;  3SK8 A;  5J1Z A;  1I50 B;  2LXK A;  4KY7 A;  1XMQ L;  5GAE C;  3M4P A;  5IGE A;  5IGG A;  3ERO A;  1D5X C;  1TWC B;  1YHB A;  1QWY A;  4UPA A;  4IOC A;  1AE3 A;  3NWS A;  3OW7 A;  4HCE A;  1XXG A;  3GO5 A;  2BCO A;  2L5T A;  2M2L A;  2K01 A;  2KUM A;  1EIY B;  4LF6 L;  4Q5V A;  2L1B A;  5GQO A;  2JQO A;  3TP6 A;  3IL8 A;  2KJX A;  3TME A;  4AQY L;  2K4K A;  1D8L A;  1NY4 A;  2CHB D;  4K0K Q;  2R7Z G;  2F4V L;  1NJI C;  5IY0 A;  4YHH L;  2PNR C;  4ZRZ A;  2F4I A;  1MD2 D;  2UUA Q;  4C56 C;  2ATW A;  4WFN 3;  3R3O A;  2R93 H;  2JA8 G;  1FJG Q;  2F3W A;  1CKN B;  2RCF A;  3I91 A;  1JJG A;  1H9M A;  1CA6 A;  2JE6 I;  5JOB A;  2KCM A;  3GTP H;  2KVM A;  5ELC A;  4G7H C;  2N8N A;  4JI0 Q;  4HJA A;  2OWO A;  4PMW A;  2UXB Q;  4IJH A;  1AFP A;  4LF9 L;  3T1Y Q;  1TS2 A;  3U4Z A;  2VNU D;  3QOL A;  2RVL A;  2KEE A;  4DNR B;  3K0Y A;  4IFD G;  4NDX A;  1A63 A;  5AFW A;  4A3K B;  3PUV A;  1I6H H;  2X6G A;  4XTC S;  4JYA Q;  4C2M B;  3FDT A;  1G8Z D;  4LF8 Q;  1O7Y A;  3U9S A;  5LMN L;  1LTT D;  4B3M Q;  4C3H G;  4JI2 L;  4POG A;  2C9O A;  4LUV A;  3ONA B;  2O2L D;  3KF6 B;  1HTL D;  3HEJ A;  2QDL A;  1YNN D;  1O78 A;  5K36 G;  1E2Z A;  3GTM H;  1IHZ A;  4LUO A;  5ISR A;  3OTO Q;  1BDO A;  2VB2 X;  1TWA H;  3CU7 A;  1HXY D;  3D4R A;  1W3S A;  1GVP A;  5CV6 A;  1YHQ A;  1TY0 A;  1TXY A;  2F3V A;  3G6E A;  1WOC A;  2VUM B;  2MHV A;  4A93 H;  2JEA I;  1EL0 A;  4ALP A;  1LT4 D;  1M1K C;  3TQY A;  3KBG A;  1A3T A;  1L1O C;  2L12 A;  4QB4 A;  1I6V C;  2PNH A;  3NTK A;  1Q82 C;  2PPB C;  1XTC D;  2G5D A;  1EQQ A;  1I4H A;  1S40 A;  2BH2 A;  1Q8I A;  2E8G A;  3NEN A;  3E6Z X;  3PQI A;  4GOP C;  4JI4 Q;  3E0E A;  4A3F B;  1F9P A;  4L6T B;  1W2B A;  1XMO L;  4C3I B;  4R8I A;  1SYB A;  1TS4 A;  4KN4 C;  2PQA A;  1HR0 W;  1VCI A;  1PTO D;  5IYD G;  1YNN C;  4DR3 Q;  5BR8 L;  3NHH A;  3T53 B;  2EDG A;  3DXJ C;  3K59 A;  4A3D H;  4GLA C;  4N9P A;  4IPG A;  4C1N K;  1YJN A;  4P73 A;  4AIM A;  1LLR D;  1C8C A;  1K8O A;  1BO0 A;  2H5X A;  2JA7 B;  4A3I H;  2NBF A;  4DR7 L;  2PQA B;  3K7U C;  4DAP A;  1SJE D;  1Y8N B;  3KUP A;  4LF5 L;  1MIU A;  2JN4 A;  4Y7N B;  4R9W A;  3L9A X;  3RD4 A;  4YWM A;  3F2U A;  4QUF A;  4DR6 Q;  2F52 A;  3HS0 C;  3NEL A;  1E2V A;  4DR2 Q;  3S15 B;  4IAL A;  5FLX L; 
#chains in the Genus database with same CATH homology
 3KLW A;  4C3J H;  2ZM6 Q;  2YV5 A;  4X64 Q;  1E24 A;  4JI7 Q;  4PG3 A;  3TEH B;  5GAH C;  1VQL A;  4A3M G;  2K5N A;  3HKS A;  2K52 A;  2JA6 H;  2CCZ A;  1XMQ Q;  2CKZ B;  3HKZ G;  3FKI G;  2A1A A;  4BXX H;  2IT1 A;  3PUY A;  4YCV A;  4JCV E;  2NVY H;  2GN5 A;  3CC7 A;  4B3R L;  4JV5 Q;  3GDE A;  4X66 Q;  1CKN A;  1Q12 A;  4PZ6 A;  4K0K L;  1Q46 A;  2MNA A;  4JI3 Q;  3FHW A;  1CKM A;  3RR5 A;  4A3K G;  4WJ3 M;  2AWN A;  1X9N A;  4GKK L;  2BH8 A;  2BA1 A;  1BBU A;  4O0A A;  1PFS A;  1WJJ A;  3FKI H;  1VQB A;  1TWG H;  3J81 i;  4JI5 L;  1SRO A;  1HZA A;  3UDI A;  2AWO A;  2UUA L;  4X65 Q;  1KC8 C;  3L2P A;  1YIT A;  4DV0 L;  1FJG L;  4DR5 Q;  1HR0 L;  4A3K H;  1HNZ L;  2E5L Q;  5ELN A;  4LFC Q;  3CD6 A;  3WWV A;  1VQN A;  1X65 A;  3M4Q A;  3K8A A;  4OWX B;  3MXN B;  2Z6K C;  2WB1 E;  1UWV A;  4JI0 L;  1SLJ A;  5HY6 A;  4IFD I;  1J6Q A;  1XTD A;  3PUX A;  2UXB L;  3STB C;  4R4C A;  2HHH Q;  1SMX A;  1XPR A;  1HZC A;  2VQF Q;  3RZO H;  3T1Y L;  4QIW E;  4JI1 Q;  1Q1B A;  4DR1 L;  1VQO A;  3BZC A;  3E9I A;  1A62 A;  2XTI A;  3KF6 A;  4X62 Q;  3KJO A;  4OWW B;  3AFQ A;  1E1T A;  2R92 G;  1PA6 A;  1J5E Q;  3CC4 A;  2UXD L;  2OCE A;  4UP9 A;  2UU9 L;  1XPU A;  4JYA L;  4DV7 L;  3AYH B;  3M7N A;  3ERS X;  1PVO A;  4LF8 L;  1SR3 A;  3HOV G;  1KL9 A;  2MO1 A;  3CAM A;  1NBW A;  4A76 A;  2AHO B;  3K81 C;  1PH9 A;  1K0R A;  4DV5 Q;  1VQ5 A;  4B3M L;  1IBK Q;  2QEX A;  2E2I H;  2UXC L;  4BY7 G;  1WCM G;  3KDF B;  5M3F G;  4YCU A;  5JJI A;  2K75 A;  1P8L A;  3CME A;  3CP0 A;  3VDY A;  2R92 H;  3G4S A;  4JBW A;  3KOJ A;  4POF A;  1Q81 C;  1GM5 A;  4C3H H;  3HOV H;  1YIJ A;  1KQS A;  3AQQ A;  1HZ9 A;  1VQG A;  3OTO L;  2XGT A;  4BY7 H;  1WCM H;  5M3F H;  3ULL A;  2IHF A;  1UE7 A;  2OQ0 A;  5GRO A;  2OTJ A;  2HIX A;  3ICE A;  2VQE L;  1IZ6 A;  4JI8 L;  1Q86 C;  4DUY Q;  2PI2 E;  3J80 i;  4DV2 L;  3ER0 A;  1PH5 A;  1OXV A;  2N3S A;  4UY8 C;  4YWL A;  2L15 A;  3S24 A;  5IP7 G;  4BY1 G;  3JAM i;  3RNU A;  4C3I H;  4AYB G;  1IYJ B;  3TRE A;  4BBS G;  4DAY B;  1N34 L;  1IBM Q;  3HOY G;  1UE1 A;  2JA7 G;  3GTG H;  4GLV B;  4BBR G;  1AH9 A;  3I4O A;  1UE5 A;  2PI2 A;  2CWP A;  4LF7 L;  1N36 Q;  3T1H L;  3D31 A;  1N33 Q;  2A8V A;  3K7A H;  3L0O A;  4OO1 G;  5C4X G;  4DUZ Q;  4LW1 A;  4LUZ A;  5IP7 H;  1GKH A;  5FLM G;  4HID A;  2DUD A;  1OTC A;  4BY1 H;  3KF8 B;  4BBS H;  2HQL A;  1K8A C;  4JI4 L;  1E7Z A;  3HOY H;  4IPC A;  3PUW A;  4R1J A;  2WAQ G;  1I5F A;  4DV3 L;  3PO3 G;  4BBR H;  3CCM A;  1X3E A;  4EQ5 A;  3RLF A;  1I50 H;  1BVS A;  5C4X H;  3PIO A;  3DLL A;  4Y7N H;  3Q8D A;  5ELO A;  1VQ6 A;  5M5Y H;  3CF5 A;  5FLM H;  1HNX L;  1LTL A;  1TWC H;  1BKB A;  2IHE A;  4GKJ L;  2JK8 A;  4A3G G;  3PF5 A;  4DR3 L;  1V1Q A;  3PO2 H;  3PO3 H;  1HNW Q;  4JBK A;  1NTG A;  5LMU Q;  1RIP A;  4DNI A;  3F2C A;  2JA5 G;  3AEV A;  1SRU A;  5IYB H;  5JJL A;  2NZH A;  1A8V A;  3I4N G;  5AJ3 Q;  4A3G H;  4P72 A;  1PYB A;  3OW2 A;  3NEM A;  4GNX B;  3SGI A;  4H02 A;  4GN3 B;  1YEZ A;  3A74 A;  4DR6 L;  4P71 A;  4GN5 A;  1R9T H;  1IL2 A;  3H3V H;  3F2D A;  4DR2 L;  1SN8 A;  2NVX H;  4LF4 Q;  3CCR A;  1KRS A;  5DLQ E;  1IBL Q;  1PH8 A;  3UDF A;  3PIP A;  1VQ4 A;  3I55 A;  1BBW A;  2IY5 B;  2ZM6 L;  5C0X I;  4X64 L;  4QJF A;  1ASZ A;  4JI7 L;  4LF5 Q;  4LFB Q;  3J81 j;  1PHJ A;  1NMF A;  2ZJQ A;  1EWI A;  2Z0S A;  1V43 A;  4NXM Q;  1JB7 A;  2RF4 A;  4OWT B;  3UE1 A;  1FGU A;  4B3T Q;  1K9M C;  1LYL A;  3PSI A;  4YY3 Q;  1YJ9 A;  4JV5 L;  1VQE A;  4X66 L;  2MFI A;  2RHS B;  5LMN W;  2NN6 G;  1QVC A;  4JI3 L;  4A3M H;  4KI0 A;  2ZJP A;  2YU9 H;  2Q2H A;  3HFZ B;  4EX5 A;  3RN2 A;  2YTY A;  2E2H H;  3U50 C;  4YCW A;  4L5R C;  2HT1 A;  5JJK A;  1Q1E A;  2I5L X;  4QGU A;  1CUK A;  4DV6 Q;  3BZK A;  3PF4 A;  4LWC A;  4X65 L;  4PZ8 A;  4O2D A;  4LF6 Q;  2B63 G;  1N32 Q;  1Z47 A;  3UDG A;  1QUQ B;  4DR5 L;  2R7F A;  2WB1 G;  4UP7 A;  4C2M H;  4AQY Q;  3G71 A;  4R4I A;  2EIF A;  1XNR Q;  2F4V Q;  4KLK A;  4YHH Q;  3CCQ A;  2B63 H;  2I0Q A;  3EN2 A;  1VQD A;  3HOU G;  2HHH L;  4JI6 L;  2VQF L;  1YNX A;  2KEN A;  4OXP A;  3EBE A;  2VUM G;  3KDF A;  1NE3 A;  4JI1 L;  2OTL A;  2Q2T A;  5H1S E;  1YI2 A;  4X62 L;  3KYH C;  4L5T A;  3BU2 A;  2UUC Q;  1RL2 A;  3CQZ H;  1L1O A;  1XPO A;  2Q2I A;  4IPH A;  3U4V A;  2LSS A;  2DGY A;  1M90 C;  4BA2 I;  4DV1 Q;  4A3C G;  1E22 A;  2IX1 A;  1B8A A;  2VUM H;  1IBK L;  1X3F A;  4LF9 Q;  3A5U A;  1V9P A;  1HZB A;  5M3M G;  1L1O B;  2D0P A;  4A3F G;  4JBM A;  2JA9 A;  1VQ7 A;  1XJV A;  3CCV A;  3S1N H;  4A3C H;  3CCL A;  3HOZ G;  1KAW A;  3GTK H;  3PGZ A;  2UXD Q;  3S1Q H;  4Y52 H;  1JE5 A;  4AH6 A;  5LMN Q;  4LFA L;  4JI2 Q;  4GOP B;  5M3M H;  4OX9 Q;  4A3F H;  2ES2 A;  4DUY L;  4FDB A;  3TS2 A;  3PUZ A;  4IPD A;  2YYZ A;  3HOZ H;  1Y14 B;  4HJ8 A;  1PH7 A;  4ME3 A;  4OO1 I;  5C0X J;  1IBM L;  1CKO A;  4A93 G;  1S3O A;  4PZ7 A;  2CQO A;  4R4Q A;  1L0W A;  5FJ8 G;  3J81 c;  4MZ9 A;  3S2H H;  1N36 L;  1N33 L;  4QY7 A;  4QL5 A;  4MNO A;  1Y1W G;  3CCJ A;  4DUZ L;  5E7N A;  2GVA A;  4QQB X;  4JBJ A;  1X6O A;  5JEA J;  3W1G A;  2JA7 H;  1Q8K A;  2YTV A;  3HOX G;  5FJ8 H;  4XIG S;  5GAG C;  3U58 A;  3J7Z C;  1B7Y B;  1SE8 A;  3K0X A;  2NVQ H;  1X54 A;  3CXC A;  2UUB Q;  4TVA B;  5M5W H;  2R7D A;  3I4M G;  3HOW G;  1VQJ A;  4HIO A;  1Y1W H;  1XNQ Q;  1YVC A;  5IYC G;  1G6P A;  2KHJ A;  5IWA Q;  4DAM A;  1I94 Q;  3CPW A;  5IE8 A;  2ZJR A;  3T1H Q;  4DK6 C;  3H3V I;  4A4I A;  2WP8 J;  3S15 H;  2AKW B;  1LM0 A;  1UEB A;  5C3E G;  1YJW A;  4GNX A;  3AFP A;  3HOX H;  4B3S Q;  1HNW L;  5LMU L;  1LUZ A;  1O7I A;  1KXL A;  1VS0 A;  1XMO Q;  3HOW H;  1JJC B;  4IFD J;  5IYC H;  3ULP A;  4RG1 A;  3RLN A;  1YBY A;  1Z9F A;  1AE2 A;  1WYD A;  5HGQ A;  1QVF A;  1HH2 P;  1HJP A;  1X56 A;  2VL6 A;  2K5V A;  2MO0 A;  1VQC A;  1PH6 A;  1OXT A;  3F8T A;  5C3E H;  5AJ3 L;  3ULJ A;  3A5Z B;  3RZD H;  1KRT A;  3S1R H;  1D7Q A;  2KBN A;  4IO9 A;  1HNX Q;  4DR4 Q;  3M85 A;  1Y1V G;  5BR8 Q;  3JC6 6;  2NZO A;  2JA5 H;  4A3L G;  4KHP Q;  5EAY A;  2RCN A;  2N78 A;  4DV4 Q;  4HJ5 A;  3TS0 A;  3RN5 A;  4LF4 L;  3EIV A;  3I4N H;  1TWH H;  4DR7 Q;  3KJP A;  4TQU S;  2OQK A;  1EFW A;  1B70 B;  1G51 A;  1VQ9 A;  2ID0 A;  2Z6K A;  4NXN Q;  3H0G G;  1OXX K;  4HIM A;  3F1Z A;  1Y1V H;  4LFB L;  4HIK A;  3CPF A;  2LXK A;  3DM3 A;  4L5Q A;  3J80 c;  1XMQ L;  5GAE C;  2NN6 I;  1GD7 A;  2Y0S E;  3K80 C;  3M4P A;  4NXM L;  1SFO H;  1PH4 A;  4B3T L;  1T9H A;  1YHB A;  3CW2 C;  4BA1 I;  2JA6 G;  4YY3 L;  1QUQ A;  2CWA A;  4UPA A;  5IP9 G;  4GLX A;  2ZTE A;  3UDX A;  4IOC A;  3BJU A;  1K73 C;  2EQS A;  1AE3 A;  4JOI A;  1KHI A;  1I3Q H;  3OYY A;  3B6Y A;  3GO5 A;  5M5X H;  4HJ9 A;  2NVT H;  2Q2U A;  1WI5 A;  4DV6 L;  3S14 H;  4LF6 L;  1CSP A;  1EIY B;  1N32 L;  5GQO A;  2JQO A;  5IP9 H;  4B3R Q;  4GNX C;  1PYS B;  1U5K A;  4YWK A;  5C0X G;  2E5L L;  4AQY L;  4DK3 C;  2K4K A;  4LFC L;  1D8L A;  1NY4 A;  1FVI A;  3HKZ E;  2R93 G;  3A0J A;  4K0K Q;  2YTX A;  3PV0 A;  1QZG A;  2R7Z G;  2MQH A;  5J3B A;  1NJI C;  5IY0 A;  1XNR L;  2F4V L;  4GKK Q;  4X6A H;  4YHH L;  4A3J G;  2KHI A;  1K8G A;  4APV A;  3GTL H;  3TRZ A;  1N9W A;  1X55 A;  1P16 A;  4JI5 Q;  1C7Y A;  4J15 A;  3G48 A;  5C44 G;  2UUA Q;  1VQF A;  1A0I A;  3ZJY C;  5JEA G;  2ATW A;  1K83 H;  1YHA A;  4DV0 Q;  3IRB A;  2R93 H;  2K14 A;  1MJE A;  1FJG Q;  1CKN B;  3I2Z A;  2JA8 G;  1PH2 A;  1HR0 Q;  2R7Z H;  2PMZ E;  3GTO H;  1HNZ Q;  2UUC L;  2C35 B;  1JJ2 A;  1JJG A;  1J5E L;  1VQH A;  2JE6 I;  4A3J H;  2HIV A;  2KCM A;  2B29 A;  3GTP H;  3HOU H;  4DV1 L;  2N8N A;  4JI0 Q;  4HJA A;  2OWO A;  4DV5 L;  5C44 H;  4PMW A;  1Q7Y C;  1CSQ A;  2LXJ A;  2VZA A;  2UXB Q;  1WFQ A;  4IJH A;  3E9H A;  2JA8 H;  4GOP A;  4LF9 L;  2B3G A;  3I7F A;  1K3R A;  3LGJ A;  4GS3 A;  3T1Y Q;  1PH1 A;  4JI6 Q;  4DR1 Q;  3U4Z A;  2VNU D;  2KCT A;  4WJ4 A;  3GD7 A;  2JEB I;  1PH3 A;  4IFD G;  2QA4 A;  3GTJ H;  1QZH A;  2VS1 A;  1A63 A;  5GAD C;  1EYG A;  3PUV A;  2UU9 Q;  4XTC S;  4JYA Q;  1I6H H;  4DV7 Q;  4HJ7 A;  2EXD A;  5FLX c;  1YZ6 A;  4LF8 Q;  5LMN L;  1L2F A;  4B3M Q;  4IJL A;  4P74 A;  4JI2 L;  4POG A;  4JOI C;  4LUV A;  3L7Z C;  2UXC Q;  1H95 A;  4OX9 L;  3F2B A;  1S72 A;  1KD1 C;  2CFM A;  3KF6 B;  3M9B A;  2A19 A;  3FP9 A;  1GO3 E;  3MEF A;  3H15 A;  2N49 A;  1U0L A;  2ZTC A;  5K36 G;  1VQA A;  1MJC A;  1VQM A;  3GTM H;  4LUO A;  1EIF A;  4MTN A;  2E2J H;  3OTO Q;  4JG2 A;  1TWA H;  3CCU A;  4GN4 B;  1W3S A;  2JJQ A;  2VY3 A;  4LFA Q;  1GVP A;  3PCO B;  2VQE Q;  4JI8 Q;  1YHQ A;  1TXY A;  4NPS A;  3G6E A;  1C9O A;  1WOC A;  2D0O A;  4DV2 Q;  1KIX A;  4A93 H;  2JEA I;  4OON A;  4ALP A;  1E1O A;  1IXR A;  2I5H A;  4R4T A;  3M3Y H;  2F3I A;  1M1K C;  3TQY A;  1N34 Q;  4A3B G;  4DKA C;  1L1O C;  3CC2 A;  2ALY B;  2UUB L;  1E3P A;  2PNH A;  1JMC A;  3S17 H;  3GTQ H;  1C0A A;  2K5H A;  1Q82 C;  2QGQ A;  1DGS A;  1XNQ L;  4AYB E;  3CCS A;  1EQQ A;  4LF7 Q;  5IWA L;  1S40 A;  1TWF H;  2ASB A;  2K50 A;  2BH2 A;  1I94 L;  3CCE A;  4IOA A;  2E8G A;  4A75 A;  3S16 H;  3RLO A;  4NB3 A;  1NMG A;  3NEN A;  4GOP C;  4JI4 Q;  3E0E A;  4B3S L;  4A3B H;  2IX0 A;  4A3E G;  3I4M H;  2RHQ B;  4DV3 Q;  1W2B A;  3M4O H;  4A3D G;  1XMO L;  3NBH B;  1MKH A;  2AMC B;  3PO2 G;  1X3G A;  4UP8 A;  3CMA A;  4JC0 A;  4DPG A;  4R4O A;  4A3I G;  2BA0 A;  2WAQ E;  2PQA A;  4L5S A;  1HR0 W;  4LNQ A;  5IYB G;  3S1M H;  1VCI A;  4DR4 L;  5IYD G;  3UE0 A;  1EOV A;  4A3E H;  4DR3 Q;  5BR8 L;  4P75 A;  1EUJ A;  1FL0 A;  1N8R C;  1VQK A;  1QVG A;  2D62 A;  1VQI A;  4A3D H;  4KHP L;  4GLA C;  3D0F A;  4IPG A;  1G29 1;  2ZTD A;  1YJN A;  4P73 A;  4AIM A;  5C4J H;  4DV4 L;  2H5X A;  1OXU A;  1IBL L;  4A3I H;  4DR7 L;  5IT9 c;  2PQA B;  2Y0S G;  2FXQ A;  3K7U C;  1OXS C;  4NXN L;  3KFU A;  3W5O A;  4LF5 L;  4KHZ A;  2WFW A;  1EQR A;  1ASY A;  3W1B A;  4A3L H;  1MIU A;  5IYD H;  2VW9 A;  3I56 A;  1JT8 A;  2GVB A;  4YWM A;  4RMF A;  3JAM c;  1PV4 A;  4DR6 Q;  2F52 A;  3STB D;  3NEL A;  3J7A 5;  4DR2 Q;  1VQ8 A;  1UE6 A;  2R6G A;  4BXX G;  4GKJ Q;  3H0G H;  1VQP A;  3S2D H;  2V1C C;  2I5M X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...