4GLVB

Obody am3l09 bound to hen egg-white lysozyme
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
molecule keywords Lysozyme C
total genus 23
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glvB00
3CPWA 1SN8A 1BKBA 1FJGQ 3TS2A 4GKJQ 4JI2Q 5IWAQ 4HJ7A 1ASYA 3RN5A 2UXDQ 2A19A 1X3GA 4OXPA 4JV5L 4A3KH 1CKMA 3JAMi 1NMGA 2VW9A 2E8GA 3HOXG 4LFCQ 3I56A 2VUMH 4R1JA 2Z6KA 1VQEA 5FLXc 1G6PA 1LUZA 2KHIA 1TWCH 2VZAA 1VQLA 4GN5A 4LF5Q 1OXSC 4A3IH 3STBD 2RHQB 3EBEA 4YWLA 2GVBA 1XMOL 4BY1G 1U0LA 4B3RQ 4GLXA 2KBNA 3PUWA 5M5WH 3D31A 1AE3A 4R4QA 4IPHA 4NXML 4BXXH 5JEAG 2IX0A 2JEBI 3HOVG 2Q2HA 1K8GA 1YNXA 2VY3A 5M3FG 2XGTA 4X62L 2A8VA 4LF8Q 2UUBQ 1PFSA 3KF8B 4AQYQ 5C4JH 4LNQA 4A3CH 1HNWL 1JT8A 3OTOQ 3M9BA 1D8LA 1MJCA 1HH2P 3WWVA 1BBUA 1IBKL 1O7IA 1XTDA 4NPSA 4JI8Q 1PYSB 1HNZL 1K9MC 1CKNA 2YYZA 4DV4Q 2E2JH 1HR0W 2UXBL 4YCVA 2WB1G 4NXMQ 4DR3L 2AWNA 2ASBA 4TVAB 4YY3L 2RF4A 5M3MH 5M5XH 1XMOQ 2L15A 4AIMA 4DR7L 3I2ZA 3AFPA 4LUVA 3LGJA 1KL9A 1GVPA 4C2MH 2EXDA 5JJIA 3K81C 2UU9Q 4BY7H 2MFIA 3OTOL 3S1NH 2JA6G 2NVYH 1HZCA 3RLNA 4JOIA 1KAWA 1SROA 2JA7G 4X64Q 1PYBA 4LFCL 4A3GG 3NEMA 1LM0A 2YTXA 4RG1A 1HR0Q 2HT1A 2NN6I 2HHHQ 1XNQQ 4OO1I 1JJCB 1VQ7A 2Y0SG 3A0JA 2DGYA 2HHHL 1D7QA 1L2FA 5IT9c 3CF5A 1YITA 1PA6A 1XNRL 1XPRA 2E5LL 1TWAH 3GD7A 1MIUA 4LF5L 1KQSA 1Q8KA 4GLAC 2ZJQA 3CMAA 3PO3H 4DAYB 2K5VA 1OXVA 1GKHA 2OCEA 3S2DH 3S1MH 3HFZB 3AFQA 2N78A 1EFWA 1YI2A 4JV5Q 2R7ZG 5IYBH 3F2DA 2UXCL 4GNXC 1HZ9A 4RMFA 1X9NA 2NZOA 1WI5A 3CC4A 4GKJL 3KDFA 3PUXA 2LXJA 2VQEL 3RN2A 1WOCA 2KCMA 4B3TQ 4OX9L 4C3HH 1VQIA 3S15H 1BBWA 1TWHH 1UWVA 1VQ5A 3L0OA 1VQ6A 4KHPQ 2PI2A 5JJKA 3PF5A 1JJGA 5HY6A 1VQKA 3U58A 1HNXQ 4JYAL 4A3JH 1X56A 4X65Q 1N9WA 2JA9A 3RLOA 1N33L 3H3VI 5LMNL 1Y1VG 4X62Q 1EOVA 4UPAA 1I94Q 4L5TA 4NB3A 3HKZE 1KIXA 1Z9FA 3IRBA 1C7YA 1IBML 4LF9L 1L1OC 2NZHA 3M3YH 4A3CG 2CQOA 4DKAC 3GDEA 3EIVA 1UEBA 1YVCA 1UE6A 4A3IG 2F3IA 3DLLA 4HJ8A 3KYHC 3CAMA 4B3TL 4NXNQ 3U4ZA 2WFWA 3EN2A 1IL2A 4LFBL 4JBMA 3J81c 2AMCB 2N8NA 4P72A 1YZ6A 5C44G 1VQHA 5JJLA 3NBHB 3NENA 1J6QA 5LMNW 2CFMA 4QY7A 4DV0L 1WCMH 4DV3L 3A74A 4AH6A 3ULPA 1YEZA 4A3EG 1V9PA 1YJWA 2UXDL 4LUOA 2HIXA 3PGZA 5IWAL 4BBRG 1M90C 3CP0A 2MO1A 1FJGL 2JA7H 4LUZA 2K50A 4DV7L 4HIDA 1I3QH 1E24A 3S2HH 3BZCA 3HOWH 3TRZA 3K7AH 4UY8C 2MO0A 3PCOB 1KHIA 1PH7A 4C3IH 2JJQA 5GAHC 3JAMc 3PUVA 1VS0A 3PV0A 4JBWA 1VQOA 1PH2A 1IBMQ 4OO1G 1NJIC 3TQYA 1JE5A 4BBRH 5C4XH 3F2BA 4DPGA 1K73C 1J5EL 3ULJA 1I94L 3HKZG 4IPCA 3HOXH 2OTLA 1MJEA 5C0XJ 5FJ8G 1N33Q 2VQFL 3GO5A 3AQQA 4MTNA 5AJ3Q 4J15A 4DR6Q 3PUYA 1EQRA 1TXYA 3J7A5 2I5HA 1X3FA 3E9IA 1WJJA 4JI1Q 2ZTEA 4OX9Q 3I4MH 1NMFA 4YY3Q 4DV2Q 2VQEQ 3A5ZB 4IOCA 2OQKA 3F2CA 3U50C 4HIOA 1QVGA 4IPGA 2R92G 3F8TA 1N36L 3PO2H 1VQ9A 4PZ7A 4TQUS 4A3BG 4B3MQ 1OXXK 2IHEA 1PH8A 1A8VA 4GOPB 1PVOA 5C0XI 3ZJYC 4MZ9A 4JI4L 3PIOA 3PO3G 1YHQA 2AHOB 2JA8G 2JA6H 1VQFA 4LF4L 4LF8L 5C4XG 2JA5G 4BY1H 3GTLH 3AYHB 1B70B 4YCUA 5IY0A 5IYDG 1N34L 4PZ6A 2UUCQ 4GKKL 4K0KQ 1TWGH 4DV5L 1EUJA 3GTKH 4LFAQ 3CC7A 4UP8A 4A3FH 4DR1L 4YWMA 2IY5B 3CXCA 1HR0L 3H15A 2V1CC 2R7DA 3KDFB 4L5SA 3GTQH 2CWAA 1Q7YC 3BU2A 4P74A 4IO9A 4BY7G 4OONA 4LF7Q 3CCLA 1Q81C 2R93H 3T1HL 3BZKA 4A3JG 4DUZQ 3RZDH 2NVTH 3CCMA 2YU9H 2GN5A 3PF4A 1JJ2A 3CD6A 4DV6L 4A3LG 2QEXA 2ATWA 1I5FA 3HOYH 1S3OA 4DR5Q 1IBLQ 2F52A 2OTJA 4DR2Q 4LF6L 2R93G 3GTMH 1SE8A 5ELOA 5BR8L 2BH8A 4JI0Q 1CSPA 1LTLA 4JI6L 3HOZG 1VQAA 1EWIA 2DUDA 5LMUQ 1KXLA 2WAQG 4JOIC 1E7ZA 1P8LA 4WJ4A 4Y52H 2RCNA 2WB1E 4A3MH 3STBC 5DLQE 1M1KC 4DR5L 1IBLL 2Q2TA 1E1OA 4YCWA 1VCIA 4DK6C 3CCJA 2D62A 3D0FA 1JB7A 4GOPA 2PMZE 3RZOH 1MKHA 1OXUA 3U4VA 1YBYA 1V43A 4BA2I 2XTIA 3HOWG 2ZTDA 1G51A 1I6HH 1N32L 2H5XA 1J5EQ 5FLMH 3KLWA 2FXQA 4O2DA 5ELNA 3G6EA 4GOPC 1DGSA 4JI7L 2Y0SE 2LSSA 3RLFA 4A93G 4BBSH 5C3EH 1FVIA 2K5HA 2PQAB 1P16A 1NE3A 4OWXB 2K4KA 4EX5A 4ALPA 1PH5A 3HOZH 2B63G 1CKOA 3GTOH 4A3BH 3W1BA 4HIKA 1CUKA 3G4SA 1PH4A 5C0XG 2I0QA 1FGUA 3KOJA 4FDBA 3M4QA 3HOVH 3I4NG 3S1RH 3PIPA 2ZM6L 2B63H 1Q82C 4A3DH 5M5YH 4P75A 1PH3A 3KFUA 1PHJA 4JI7Q 4JI5Q 1YHAA 1Y1WG 4NXNL 3PUZA 3TREA 1QUQB 1N32Q 2ES2A 2NVXH 2BA0A 3KF6B 1SR3A 2CWPA 2PI2E 4QQBX 4JCVE 3T1YQ 1K8AC 3K7UC 4LW1A 4IFDI 2UUAL 5M3FH 5J3BA 4DK3C 1HZAA 2WP8J 5M3MG 4AYBG 1Y1WH 4X65L 3UDIA 4QGUA 4JI5L 2D0OA 1X3EA 3UDGA 2CCZA 5LMUL 1XPOA 4KHPL 1PH1A 3M7NA 1RL2A 3ULLA 3CCEA 1VQNA 1UE5A 5IYCH 1A0IA 3S24A 1JMCA 1KRSA 2K5NA 2B29A 2AKWB 4GLVB 4P73A 3VDYA 3T1YL 1OTCA 3GTJH 5JEAJ 5GQOA 4JI3L 1SFOH 2E2IH 2OWOA 4IOAA 1TWFH 1HJPA 4PMWA 4JBJA 3K80C 1EQQA 2UXCQ 2GVAA 1VQ8A 1XJVA 4B3SL 4R4IA 4HIMA 4OWTB 1YIJA 1IYJB 4IJHA 3CCQA 1VQBA 2AWOA 3H3VH 4POGA 4DUZL 2ZJPA 4JG2A 1XMQL 4LF7L 4IFDJ 4DR4L 1NBWA 3L2PA 3L7ZC 1XNRQ 4GS3A 2OQ0A 2Z6KC 1HZBA 2N3SA 4A3EH 2E2HH 4LFAL 5H1SE 4DV5Q 4LF9Q 4A4IA 3J7ZC 1CKNB 1EIYB 4BXXG 1SLJA 1CSQA 3W1GA 1VQGA 4YHHL 1Q12A 3FP9A 1X6OA 5LMNQ 1S40A 4LF4Q 1Q86C 1KC8C 5IP7H 4JC0A 4X6AH 4GN4B 1NTGA 3CQZH 3CPFA 3CCVA 2UU9L 4EQ5A 4R4OA 3CCRA 3UE0A 5EAYA 4B3ML 4Y7NH 3SGIA 3GTGH 3OW2A 3I4NH 3FKIH 4GNXA 5GADC 1QZHA 1LYLA 1C0AA 4IJLA 1IZ6A 4R4TA 4DR2L 4LF6Q 5GAGC 5IP9H 4DV2L 4JI1L 3KJOA 4A3LH 1E22A 3E9HA 4JI8L 4A3KG 1FL0A 1IBKQ 4L5QA 3KF6A 4KI0A 4R4CA 1HNWQ 2Q2UA 2ALYB 3J80i 3NELA 4JBKA 3CCUA 1K0RA 2K52A 3G71A 2E5LQ 4JI6Q 2JE6I 4A3GH 1L1OB 2IHFA 1V1QA 5BR8Q 4DUYL 1OXTA 2YTYA 3I55A 1L1OA 1VQDA 1PH9A 2JA8H 4B3RL 1A63A 1XNQL 4A93H 5HGQA 1X55A 2QGQA 4C3JH 3A5UA 4DV6Q 3AEVA 4PG3A 1YHBA 1E1TA 1L0WA 2CKZB 1A62A 2I5MX 4XTCS 2VS1A 4LWCA 3M4OH 1U5KA 4KLKA 2IT1A 5IE8A 2ZJRA 2PQAA 3K0XA 4DUYQ 1EIFA 1QVFA 4POFA 1WCMG 3MEFA 4DR4Q 3RR5A 1X65A 2D0PA 4UP7A 3M85A 1XMQQ 3ICEA 2IX1A 4DR7Q 5FJ8H 4GNXB 2C35B 1VQJA 3G48A 4JI2L 4BBSG 4DR3Q 2UUCL 1N34Q 4GKKQ 4K0KL 3E0EA 2QA4A 3S14H 2Z0SA 1KRTA 2UXBQ 2WAQE 3TEHB 3HOYG 2R7FA 4MNOA 5GROA 1QVCA 3M4PA 1HNZQ 4KHZA 3J81i 2EIFA 2I5LX 3ERSX 2EQSA 4PZ8A 4JI3Q 4DR6L 4DAMA 1VQMA 2VUMG 4JI4Q 5AJ3L 1KD1C 2KHJA 4QL5A 4AQYL 3JC66 2MNAA 2KENA 5GAEC 3PSIA 4UP9A 4WJ3M 1VQCA 1N36Q 1W2BA 4X66L 1VQPA 4A3MG 4L5RC 3HOUH 2A1AA 4IPDA 1W3SA 1X54A 1GD7A 4P71A 3B6YA 1UE7A 4OWWB 1VQ4A 3I4MG 2UUAQ 3FHWA 4YHHQ 1I50H 3Q8DA 4DV7Q 5IYCG 1SMXA 1IXRA 4O0AA 3CC2A 3S16H 3J81j 3RNUA 3S17H 3I7FA 5C44H 3HKSA 4GN3B 5IP9G 3T1HQ 4A3FG 3HOUG 2F4VL 1B7YB 2ID0A 2NN6G 2VL6A 1T9HA 4DV0Q 3CW2C 1R9TH 5IP7G 1Z47A 2RHSB 3KJPA 4DNIA 4DR1Q 2JEAI 2HQLA 2KCTA 1S72A 5C3EG 1K83H 1WYDA 5IYDH 2JK8A 4B3SQ 2LXKA 2NVQH 4APVA 2PNHA 4DV1L 1Q1EA 3ER0A 4HJ5A 3K8AA 1Y14B 3H0GH 4DV3Q 4AYBE 2BH2A 3J80c 2R7ZH 4HJ9A 1N8RC 5K36G 2JQOA 1Q1BA 2K75A 4BA1I 2F4VQ 1AE2A 4A3DG 4X64L 1YJ9A 4IFDG 1H95A 2BA1A 1NY4A 2YTVA 1PH6A 1QUQA 4LFBQ 3CCSA 2YV5A 1K3RA 2B3GA 3F1ZA 4A76A 2VNUD 1WFQA 4ME3A 2Q2IA 3I4OA 3OYYA 1GO3E 2ZTCA 1XPUA 3S1QH 1RIPA 5E7NA 4X66Q 2MQHA 2R92H 3PO2G 4QIWE 1Q46A 2K14A 1Y1VH 2VQFQ 2N49A 1BVSA 1UE1A 4YWKA 4DV4L 4H02A 4HJAA 3MXNB 3BJUA 1PV4A 1AH9A 3W5OA 5FLMG 5IYBG 1EYGA 1HNXL 4JYAQ 1YJNA 3GTPH 1C9OA 1G291 4A75A 3TS0A 1QZGA 1E3PA 3CMEA 1GM5A 3H0GG 4QJFA 1ASZA 2UUBL 3DM3A 2HIVA 4DV1Q 3UDFA 3UE1A 2JA5H 2ZM6Q 4XIGS 3FKIG 4JI0L 2R6GA 1SRUA 3UDXA 1B8AA
chains in the Genus database with same CATH superfamily
1QOHA 3CPWA 1GUGA 1BKBA 3TS2A 1A2TA 4GKJQ 2B2UC 2CHBD 4JI2Q 5IWAQ 2XRSD 4A3GB 1H9SA 2EDGA 2Y0SB 2B8GA 3GV6A 1D5XC 5FLXc 5I4DA 1G6PA 4LF5Q 1TWCH 1TIID 3E5SA 2SEBD 2RHQB 1EY8A 3PUWA 4NXML 4IPHA 3MXGA 2IX0A 2JEBI 4ZAIA 4XQQA 3KLSX 3KF8B 5C4JH 2CW0C 2ZXOA 1O7IA 4JI8Q 2KJXA 1EYDA 1HR0W 2EXZA 1FNVA 2NWGA 4QUFA 3PMFA 1B1ZA 2RF4A 4YY3L 5HURA 4DR7L 3I2ZA 4LUVA 1D6EC 3LGJA 4I7ZC 2EXDA 2R92B 2UU9Q 3TSSA 2MFIA 3OTOL 2EZVA 1J8IA 1CI3M 4H13C 1R9TB 2ZT9C 5FK9C 1KAWA 1SROA 1SNPA 3A7AB 1X32A 4A3GG 1PLFA 1VDZA 2NN6I 3H94A 2HHHQ 4KD4A 2Y0SG 2DGYA 1EZ8A 4TRDA 4WJWA 3WDNA 2EYFA 5KIXA 2N88A 4LF5L 2F0OA 4QB4A 1OXVA 1GKHA 5I2XA 3S1MH 1EFWA 1KLUD 4IUVA 2YU9B 4HCSA 4H44C 4GKJL 2F0IA 1AZPA 4C3HH 2RKSA 1BBWA 1TWHH 2VB3X 1VQ6A 1JJGA 1SE4A 3NWTA 5CGKA 4A3JH 1N9WA 3RLOA 1HFNA 5LMNL 1DOKA 1S5DD 1Y1VG 1EOVA 2ICIA 1I94Q 1IYUA 1Z9FA 1NR2A 1L1OC 4NMZA 4A3CG 3GDEA 2K05A 4J8QA 3QOJA 3X3NA 1BCPC 3DLLA 4HJ8A 4K2KA 3FVQA 4DNTB 2M00A 1IL2A 2KUMA 2SOBA 2L9HA 4JBMA 4LFBL 4KHVA 1AFPA 5JJLA 1EY9A 4FXGC 3NENA 1ESRA 3T16A 1SXTA 2G9DA 3OPOA 3A74A 4A3EG 4XXEA 2UXDL 1K3BC 2EY2A 2B63B 3CP0A 2K50A 3MZ5A 4L8JA 1KHIA 3FDTA 3H6MA 2JJQA 5IODA 3C2PA 3PV0A 5JJZA 1PH2A 2LY7A 1ZEQX 3F2BA 1I94L 2X6GA 3HOXH 1MJEA 5C0XJ 1N33Q 2AQ2B 2NZ1D 4H7BA 1R4PB 2WB1B 3C1FA 4IZ8A 1WJJA 3I4MH 4DV2Q 2VQEQ 2B8FA 2OQKA 1QVGA 5A35A 1G2TA 3F8TA 4ABNA 4PZ7A 2JA7B 2IHEA 3EFXD 4GOPB 1PH8A 4JI4L 3PIOA 2AHOB 3CKIB 5C4ZA 3MAQA 2JA5G 5LHY1 5J1ZA 1Y1VB 3R2TA 1TWGH 1EUJA 5EKLA 4A3FH 4I65A 1EY0A 3KDFB 4L5SA 3FPUB 2Q8IB 3QWNA 1CM9A 1Q7YC 4BY7G 1B4OA 1FNWA 3E0JA 4OONA 4X3KA 4LF7Q 5IGGA 3MA2B 3D3RA 1A3VA 5KGUA 1VF7A 2YU9H 2GN5A 3CD6A 1JE4A 4DV6L 4DR5Q 4MIUA 5C5LA 4LF6L 2R93G 5G3LD 2BDNA 5ELOA 2FFKB 3HP3A 1CSPA 3NQTA 2DUDA 2FJ2A 5LMUQ 2RSOA 1P8LA 4WJ4A 4Y52H 1C4QA 2L5TA 4A3MH 3STBC 1IW7D 2E76C 1M1KC 5A2QL 1VCIA 1ENCA 1D1KA 4DK6C 2R61A 5CV9A 5CV7A 3U4VA 2MPMA 1BR9A 5KYLA 1CA5A 3DEPA 2NVXB 2ZTDA 1G51A 4RWSC 2H5XA 5FOBB 4CDEC 1PDQA 1MHWC 1PTOB 4BBSH 3NPPA 2M2LA 1P16A 1F9PA 4A3BH 2K4KA 2K03A 3GTOH 1CUKA 1V8QA 3G4SA 1PH4A 5C0XG 1FGUA 2EYPA 3BS1A 5K36H 4ZRZA 4C1NI 2DNCA 2IWHA 1PH3A 1BQQT 4JI7Q 3T53B 5D65A 1Y1WG 3I72A 3TREA 1N32Q 1QUQB 2ES2A 5JVH3 2PNRC 2F0SA 1NR4A 1SJHD 2XWJB 3LWUA 1CHQD 4ODGA 4IFDI 4OHJA 5J3BA 1AEXA 4C3IG 2D0OA 1X3EA 2O4XA 4N8FA 1XPOA 2JA8B 4K5VA 1JMCA 2AKWB 1OTCA 1I6VC 5EJWA 4IOAA 1BUVT 5GQOA 1LT6D 1EQQA 4B3SL 1TY2A 3CCQA 3QIAA 2AWOA 3K6OA 4RKBA 4POGA 1CTMA 1GUWA 1XMQL 4DR4L 1NBWA 2NYZD 1DD2A 3L7ZC 2K04A 1HZBA 2N3SA 4A3EH 2E2HH 4LFAL 3GTGB 5H1SE 1RCVD 5E4WC 4A4IA 1CKNB 2LMCB 1EFID 1VQGA 1WTQA 1S40A 5IP7H 4JC0A 3CQZH 2UU9L 1TWAB 2IW3A 1EEFD 1HA6A 4B3ML 4Y7NH 1H9RA 3GTGH 3I4NH 4JK1C 4F8MA 5GADC 2Z4HA 1LYLA 1C0AA 3BDLA 4R4TA 4DR2L 3EVQA 5IP9H 2OT2A 4A3LH 4DU9A 3U9OA 4V190 4L5QA 1F2ZA 2ALYB 2PMZB 2ZXPA 1TT2A 1YNNC 4C3JG 3C1EA 5ELFA 2A69C 2E5LQ 4JI6Q 3PO3B 2K32A 1EOTA 1V1QA 2IHFA 3T13A 1B3QA 1PZID 1L1OA 1VQDA 1PH9A 1XNQL 4HAEA 4IUQA 1X55A 3AEVA 3KK7A 4O42A 1ILQA 3J81E 1QNUA 3M4OH 1HRJA 3I90A 2EJMA 3A56A 4G7ZC 2IT1A 5IE8A 2ZJRA 2PZUA 4DUYQ 3TP5A 1JOOA 1EIFA 2PPBC 4A3JB 4DR4Q 1X65A 2F0FA 4UP7A 2IX1A 5FJ8H 3BG3A 4GKKQ 4K0KL 2Z0SA 2WAQE 3HOYG 1PXUA 4EGVA 1HNZQ 4HMJA 2EIFA 2I5LX 3ERSX 4DAMA 2VUMG 2CVRA 1GOZA 1LLRD 3JC66 4AQYL 2KENA 1CQFA 4BY1B 2JA6B 1ICFB 5E4XA 4CKEA 4IURA 4A3MG 1O7ZA 1WVLA 4RA8A 2NTTA 4P71A 3B6YA 1UE7A 2F0NA 5FO9B 3FHWA 2A6ED 4LAAA 1IXRA 3GTMB 3S16H 3S17H 3NQIA 3LNNA 1WTRA 3CRLC 2F4VL 3W3AA 3H3VC 4DV0Q 2A74C 1R9TH 3OW7A 4PMBA 4DNIA 4DR1Q 2KCTA 5EBDA 1WYDA 3A8KE 5IYDH 2JK8A 1B9MA 3C46A 3NXWA 4C56C 2QF7A 1TS2A 4HJ9A 4DFAA 1Q1BA 4BA1I 1YJ9A 1JORA 2YV5A 1XTCD 4H0LC 2K1BA 1WFQA 1ILPA 3OYYA 3I4OA 1EY4A 5E7NA 2EY5A 3PO2G 2Z8LA 2A6EC 2N49A 4OIKA 3KF8A 1PV4A 4GZYC 4A3BB 1TY0A 2F0HA 5IYBG 5FLMG 3GTPH 3IKJA 1QZGA 1E3PA 1GM5A 4QJFA 2B2TA 5DNFA 3UDFA 5CORA 1LTGD 2R6GA 3UDXA 2FMMA 2DN8A 1FJGQ 5IT9E 1WCMB 4KMUC 2A19A 3SE0A 1UEAB 5KNDA 1FD7D 4A3KH 2EYHA 3K0YA 5ELBA 1HFGA 3HOXG 3I56A 2VUMH 1VQEA 4XYOA 4KJNA 5JEAH 1VQLA 1E2ZA 2Q8TA 5FLXL 4A3IH 1SFOB 2CH4W 3ITPA 3EBEA 4X3SA 4BY1G 1Z7TA 4GLXA 4R9WA 4OEMB 2KBNA 5M5WH 1GXDC 4R4QA 3GP7A 3OIQA 1SE3A 1YNXA 3DWQA 2TSSA 2XGTA 2A8VA 3JAML 4UHVA 4LNQA 4A3CH 1D2BA 4UY8C 1IBKL 1BBUA 1F9SA 1HNZL 2F0PA 1BBXC 3L9AX 2YYZA 4P2CB 3PO2B 3ND9A 3IFTA 5E1FA 4NXMQ 4X3UA 1YNJC 2A6HC 3E3XA 2PZWA 3VR3A 2ASBA 4TVAB 2D2CC 1KL9A 3K81C 3HOUB 4BY7H 4A3IB 3P1HA 2NVYH 2KVMA 3RLNA 2JA7G 4MHEA 4X64Q 5C44B 4QMGA 1HR0Q 3VR2A 4KTAA 5BN4A 1XNQQ 2J7ZA 3A0JA 4HSPA 1D7QA 1MI2A 2EJFC 1U4PA 5I9OA 1WD0A 4GLAC 2JN4A 3HOZB 2EOTA 2OCEA 5IGCA 1S5BD 3HFZB 1LTID 3J7AF 2F3WA 1TS5A 1O78A 4RMFA 2NZOA 1DONA 1WI5A 3BVGA 3CC4A 3I4MB 4CHTB 1Q3LA 2LXJA 2QDLA 3RN2A 2KCMA 4OX9L 2OF1A 2J4XA 1SAPA 1UWVA 1BNZA 5JJKA 3IFDA 2QEJC 3VR6A 4HMIA 2LFNA 5LL6S 4X65Q 2D5DA 2JA9A 2KCCA 3H3VI 3J80E 4RHRA 4X62Q 5IT9L 1WTVA 3A7LA 4NB3A 3HKZE 3IRBA 1SJED 3TN2A 5IGFA 5M3FB 1C7YA 4A3IG 5I2YA 3HG9A 2WACA 3U4ZA 4TKOB 2VB2X 5M3MB 3J81c 4P72A 1VQHA 4DF7A 3T4AC 1JQYD 5LMNW 3H0GB 1WCMH 4AH6A 1V9PA 3ERQA 1YJWA 2B2UA 3FKIB 4LUOA 2HIXA 4PQXA 3RD4A 1GUNA 2EVBA 4LUZA 2I07B 3BZCA 1K0SA 3TRZA 1SDFA 2HD3A 1CFMA 1TQOA 2WV6D 3D4WA 1PH7A 2ENBA 3VYUA 1IBMQ 1U4LA 1JE5A 1J5EL 1HA5A 5C4XH 1FNUA 4UAIA 4A3DB 3ULJA 4CGYB 4CDDC 1KABA 4DAVA 1JC7A 1CZWA 5FJ8G 1PRTD 2VQFL 3AQQA 1Y1WB 4DR6Q 4ZKBB 1M8AA 2Z9HA 2E74C 3J7A5 2I5HA 3E9IA 1RDPD 1MSHA 4OX9Q 1A6XA 1NMFA 4YY3Q 3HEJA 3F2CA 2BDOA 4HIOA 1YNJD 2A6HD 2JXMB 3PO2H 1ET9A 1DYQA 4RCOA 1A8VA 1T5EA 4NP5A 1DJRD 2JA8G 5FKAC 5C4XG 3AYHB 3JAME 1O7LA 1N34L 2UUCQ 1JOQA 1L0XB 3GTKH 4DA2A 3CC7A 1IL8A 3H91A 4YWMA 2IY5B 4A3EB 1CHPD 1HR0L 4QIWB 2CWAA 4IO9A 1YNND 4HCEA 2R93H 1SYCA 3RZDH 3BYYB 5EQ0A 3CCMA 1RF2D 4A3LG 2QEXA 2ATWA 2FMCA 1F2LA 1IBLQ 2F3VA 1SYEA 3GTMH 1SE8A 1VMPA 2BH8A 1RODA 2EYJA 1EWIA 1I6HB 3BDOA 4ZK9B 4JOIC 1E7ZA 4KY5A 4G57A 5EPJA 4K2LA 1PZKD 4DR5L 1E1OA 4YCWA 2D62A 4GOPA 3PQIA 1Y69U 1MKHA 3RZOH 1SBBB 2EE1A 1A3TA 1Z6HA 1K28A 5F2DA 1J5EQ 5FLMH 3SDZA 1ENAA 4JI7L 1J9OA 4LJZC 4RFBA 2LSSA 3RLFA 1D5MC 4A93G 5M5YB 3L3OC 2K5HA 1D5ZC 5C3EH 3M4OB 1S5ED 3HOZH 1GJXA 1JWMD 1I4HA 3QG1A 1LTAD 1U4MA 4KKSA 3M4YA 1STNA 3M4QA 5I9PA 3HOVH 4FYDA 3S1RH 3PIPA 4BBRB 5M5YH 2PW7A 2DJFC 2JSOA 1YHAA 3RZOB 4KV6A 5C0XH 4NXNL 3PUZA 2NVTB 3KF6B 2KEDA 2C9OA 3NK9A 2CWPA 1PRTC 1C8CA 2D9UA 1K8AC 4LW1A 2ICEC 2UUAL 4DK3C 2WP8J 1SNCA 1Y1WH 5M5WB 1BCPD 3UDIA 2HCCA 2CCZA 5LMUL 3M7NA 1RL2A 2KOLA 3CCEA 1PYWD 1A0IA 3S24A 5IYCH 4P73A 2B29A 3CQZB 1B44D 3VDYA 2XN9C 1SFOH 1TWFH 1HJPA 3KBXA 3VR4A 3K80C 3AMUA 2UXCQ 1VQ8A 2DJGC 1XJVA 4K14A 1EU4A 1EQTA 4IJHA 3H3VH 4DUZL 2ZJPA 3SEBA 4LF7L 3RZDB 1H9MA 1A2UA 3DMUA 4DV5Q 3J7AV 3CHBD 1EIYB 4XQNA 3W1GA 4FO2A 5CV6A 3QR8A 4UDUC 3FP9A 4C3HG 5LMNQ 1Q86C 3A8IE 4PMCA 2JYOA 1KC8C 1LO5D 3I73A 4R4OA 3P7JA 4XT3B 1QZHA 4FF2A 4IJLA 5GAGC 1WTHA 1E22A 1LTRD 4IUPA 4A3KG 1FL0A 1STAA 3OMGA 4U673 1AW7A 2Q2UA 4JBKA 4IUNA 2DY7A 1ENFA 4FXDA 1G2SA 4A3GH 3OOCA 3TP8A 4DUYL 4QUCA 2O2LD 3Q24A 2YTYA 4IUTA 3I55A 4OL7A 1JWUD 4B3RL 2PQEA 2A68D 2PW5A 4A93H 4C3JH 4M8AA 4DV6Q 4HN7A 1YHBA 1PTOH 2CKZB 3S14B 1HUMA 5C3EB 4XTCS 1U5KA 3QJYA 2NTSA 1E2WA 4POFA 1WCMG 3MEFA 2IL8A 4FNFA 3RR5A 4DR7Q 3ICEA 2IJ0A 3FPPA 4GNXB 2C35B 2BOSA 4BBSG 1AP0A 3MFYA 3OHXC 2QA4A 3AU7A 1F9QA 2R7FA 4ZCKA 3M4PA 5C3XA 4N8X1 4C1NK 2EPBA 1TR5A 4PZ8A 4DR6L 1VQMA 4JI4Q 5AJ3L 1KD1C 5GAEC 1QG7A 1W2BA 2A1AA 1VQ4A 2UUAQ 4DV7Q 1F9RA 1SMXA 3I7FA 4GN3B 4DAYA 2L55A 3HOUG 1B7YB 1LABA 1BO0A 2VL6A 1QE6A 3MC0B 3NBHA 1Z47A 3UI2A 2RHSB 3KJPA 4R8NA 3HOVB 2QILA 1CT1D 5D3IB 5C3EG 2L11A 2WKDA 5C4HA 2LXKA 2NVQH 2PNHA 4DV1L 2TMPA 2C5CA 3K8AA 3D8GA 4DV3Q 4AYBE 2BH2A 1MGSA 5T1IA 4F7XA 4IQZA 1AE2A 1NY4A 1PFBA 2YTVA 1AN8A 3MVVA 1PH6A 3HS0C 4LFBQ 3CCSA 1K3RA 1QILA 2B3GA 2XWBB 1L0YB 2Q2IA 1GO3E 4X66Q 2OEOA 2MQHA 1M4VA 4Y7NB 2K6AA 3ZYYX 2E2IB 1W6KA 2M9VA 4DV4L 1EQVA 4IUUA 2XNAC 4JYAQ 1C9OA 4BWGB 4A75A 3S1NH 4DV1Q 5CC4A 3BDCA 5CV8A 4XIGS 3FKIG 5KRUA 1IYVA 4IFDH 2RDGA 5FLXE 1SN8A 4KKTA 4HJ7A 1ASYA 3RN5A 1O80A 4QF4A 3BVMA 4JV5L 1H9JA 3JAMi 2VW9A 2E8GA 4LFCQ 2Z6KA 2RQXA 1EEID 4N9TA 1LUZA 2KHIA 2VZAA 2AUKA 3BYTB 4GN5A 2F1MA 1TWGB 4PV1C 4MTKA 2G9HD 2P5ZX 4YWLA 2K5QA 3WOFA 3D31A 2XSCA 2FINB 4BXXH 5JEAG 2Z4IA 1K8GA 1KLGD 1G8ZD 2VY3A 3HOVG 5M3FG 4X62L 3OIPA 2UUBQ 2NBFA 1HCZA 3VA7A 1HNWL 1JT8A 3OTOQ 3M9BA 1D8LA 1MJCA 3WWVA 1XTDA 4KJOA 4NPSA 5IIFA 3RUZA 1K9MC 1CKNA 4DV4Q 2UXBL 5ELEA 3NP8A 4O1NA 2G5DA 4YCVA 2F0GA 3IL8A 2WB1G 4DR3L 2AWNA 2XRQD 1ZYRC 1CZGA 1XMOQ 2L15A 2X6LA 4AIMA 1EY5A 1GVPA 1BOSA 3R2IA 3Q22A 4S3SA 3J81L 3S9WA 1CQVA 3FRPB 3TBIB 1HZCA 4HSVA 3S1MB 3I4LA 5KEEA 1STGA 2YTXA 4OO1I 2EYLA 3NTIA 2JA5B 1JJCB 4XT1B 1VQ7A 1L2FA 2DNEA 5BN5A 5IT9c 1E0BA 1YITA 2EYOA 3R3OA 1RTOA 3GD7A 1MIUA 1KQSA 5NUCA 3GQBA 3CMAA 3PO3H 4I7AA 4DAYB 3TDQA 3S2DH 1QJOA 4L6TB 2R93B 4JV5Q 5TSSA 4GNXC 5EGTA 2HCIA 1X9NA 1GUTA 3A55A 1K8MA 3KDFA 2AQ3B 4EQPA 1PRTF 2VQEL 1WOCA 4Q0FA 4B3TQ 2XVSA 3S15H 3L0OA 4KHPQ 2PI2A 3VR5A 3K58A 1STBA 2F0VA 3U58A 4OELB 4JYAL 1X56A 1N33L 4UPAA 1QWYA 4FF4A 3QO2A 5I6YA 2MHVA 4LF9L 2NZHA 3M3YH 3EIVA 1YVCA 1UE6A 2F3IA 3KYHC 3CAMA 2B2YA 5D3DA 2KHSA 1UNSA 2AMCB 2QW7A 1YZ6A 3D6WA 5C44G 2CH4A 3NBHB 4DV0L 4DV3L 2O5JC 4RGTA 4NW2A 2RDHA 3PGZA 1FJGL 2JA7H 1U4RA 3OSOA 3HOWH 1S4ZA 5COYA 3K7AH 5IGBA 2MO0A 2ZXRA 4HR7B 5GAHC 3JAMc 1KTKA 4OO1G 1VQOA 1MD2D 2BE5C 1SEBD 4BBRH 4NDXA 4DPGA 2PO4A 4IPCA 5DM63 2OTLA 1B50A 5JPNC 3GO5A 2A5HA 3I70A 3VYRA 3PUYA 1EQRA 1TXYA 4DK1A 1X3FA 5HGTA 2ZTEA 3VYTA 1JWSD 4RGNA 1ONLA 1N36L 4WORA 1VQ9A 4TQUS 2GA4B 2B39A 1TWFB 1OXXK 2O5IC 3GTQB 1H9KA 4OIJA 1PVOA 5C0XI 3PO3G 1STHA 1YHQA 4LF8L 1XWEA 4XDXA 3GTLH 3MXUA 2K01A 1B70B 4YCUA 3WOEA 5K5PA 5IYDG 1EY6A 1EIHA 2MUYA 1PZJD 4DV5L 1TS4A 5LL6X 4DR1L 3GTQH 3H15A 2V1CC 4K8JA 4MN3A 1TVXA 1STYA 1Q81C 1ICWA 2B2YC 3T1HL 4A3JG 4DUZQ 2NVTH 4RH6A 3PF4A 1JJ2A 1XYIA 3T56B 3HOYH 1S3OA 3T51B 2OTJA 1GHJA 4DR2Q 4FP5D 4A3KB 3NHHA 3K7AB 4JI0Q 1LTLA 4B9WA 1KXLA 3E6ZX 2WAQG 2RCNA 2WB1E 4C3HB 5IOCA 1JCKB 3SK5A 1SSOA 5DLQE 1IBLL 2F0TA 3D0FA 1PFMA 2PMZE 4KN4C 3SK6A 4CKCA 5ELCA 1OXUA 1V1OA 1YBYA 3HOWG 4K6LA 3NSWA 4O2DA 3G6EA 3DWPA 3V96A 2Y0SE 1JOKA 1R4QB 3R93A 1PH5A 1NE3A 4ALPA 1WTWA 4WFN3 2B63G 1CKOA 3W1BA 3KUPA 3MWYW 1Q90A 2QDBA 4L63B 1G6ZA 2KQ3A 4FDBA 3GTJB 5M9OA 4A3DH 4P75A 4DK0A 3KFUA 4JI5Q 1F77A 3Q6SA 2VUMB 2NVXH 3V2TA 4RCNA 3QB3A 1SR3A 1JICA 3HOYB 3ONAB 4JCVE 4DGZA 5M3MG 5M3FH 5C6AA 4ME5A 4AYBG 4G7OC 1SMYC 3Q0AA 4J1MA 5L37A 4ULLA 4JI5L 1LTSD 4LMQD 1MBYA 4KHPL 3NTHA 1DOMA 1NCVA 1PH1A 3ULLA 1LV9A 1VQNA 1UE5A 4A3MB 3T1YL 2E2IH 1NNXA 1QCBD 3NUCA 4PMWA 4JBJA 2GVAA 1ZKOA 4R4IA 4HIMA 2A68C 1FGBD 4CKBA 2BE5D 2N55A 1PMRA 4JG2A 1B53A 4C2MB 4IFDJ 1SYDA 1K8OA 2Z6KC 5KNBA 2LKVA 2CQAA 3K57A 3J7ZC 1SLJA 2LS01 1Y8PB 4YHHL 5JAVA 4LF4Q 3D4RA 4X6AH 3LWEA 3CPFA 5JOBA 2L0CA 4EQ5A 1I4GA 2K7VA 5EAYA 3OW2A 3FKIH 3TMEA 1ZXTA 4GNXA 3MFGA 4LK1C 1WTPA 2E75C 2K28A 5EKIA 4AYBB 4LF6Q 5D14A 2QCPX 1KDCA 1BCPF 4JI1L 2NN6H 4KN7C 4JI8L 4Q5VA 3GV3A 1EWCA 1HNWQ 2FHTA 3CCUA 3HOXB 2K52A 3LX0A 1ESFA 3G71A 1HTLD 2JE6I 1DOLA 5E3FA 4CJ0B 3N52A 2F0UA 5BR8Q 2VXWA 4ZQ3A 3VYSA 1II3A 5CV4A 5HGQA 1RJTA 1TU2B 2A69D 3A5UA 1L0WA 2I5MX 3G6JB 4LWCA 3V05A 3S15B 2F0DA 3PIO3 2HDLA 3K0XA 2SNSA 1QVFA 4HEDA 3NBIA 1T5XD 3HGBA 1HQMC 1I4QA 2D0PA 2F0EA 1XMQQ 4IN3A 4JI2L 2UUCL 2WKCA 3DXJC 1N34Q 4G7HC 4ZKCB 3S14H 2Z1CA 3EROA 3TEHB 3SK8A 4MNOA 2EYMA 3S2DB 3J81i 2CW0D 2EQSA 3SK4A 2KHJA 4QL5A 1RKNA 2SDFA 2MNAA 2NVQB 4CDFC 4K8IA 4K5WA 3SHLA 4X66L 1VQPA 4L5RC 3HOUH 4IPDA 3J7YW 1GUOA 1GD7A 2L1BA 1S5CD 3I4MG 2L12A 4KY6A 3CC2A 3J81j 1AZQA 1WD1A 3T1HQ 1E2VA 2ID0A 3QOLA 1IKMA 3CW2C 1KNEA 5IP7G 1DM0B 2HQLA 1K83H 1Q1EA 2WIIB 5I6WA 4HJ5A 1Y14B 2X69A 3H0GH 4RGOS 3R8BA 3J80c 2R7ZH 1N8RC 1EYAA 2E2HB 1TKWB 2DY8A 2JQOA 2K75A 3P75A 5K36G 4A3DG 4X64L 4YIJA 1H95A 3SR1A 3I91A 1WTXA 1QUQA 1I4XA 3GTOB 3F1ZA 2SNMA 2VNUD 3S17B 4PNYA 4RKLA 2EY1A 2F0KA 2ZTCA 1XPUA 1RIPA 3PIP3 2R7ZB 2R92H 4QIWE 1BVSA 3W2DA 4H02A 2PZTA 3MXNB 1AH9A 2WINB 1HNXL 3G7LA 1EWHA 1G291 4BY1H 4KY7A 4NKLA 3H0GG 1ASZA 3DM3A 3UE1A 2PYKA 2ZM6Q 5CYUA 4JI0L 1ML0D 5DEHA 1B8AA 2RDFA 3DHQA 1KAAA 2UXDQ 4G4KA 2EY6A 1X3GA 4XQJA 4OXPA 3BZDB 2B2VC 1CKMA 1NMGA 1O7YA 4R1JA 5FO8B 4RGMA 2J0TD 3N6RA 3IAYA 1QNKA 3TZUA 1OXSC 5JPMC 2HQEA 3STBD 4A3FB 5C4XB 2E2JB 2GVBA 3J80L 1XMOL 1U0LA 4B3RQ 3SVMA 1AE3A 5ELDA 2B2TC 4DAPA 2Q2HA 3H09A 4LF8Q 1PFSA 4AQYQ 2JP1A 2AUJD 4BY7B 4ZUJA 3VA5A 1HH2P 1PYSB 1TS3A 2E2JH 1PTOD 2RCFA 4U68A 2OXPA 5M3MH 5M5XH 3AFPA 4RHSA 4C2MH 1LACA 5JJIA 3GTLB 1EY7A 4WRDA 4EVOA 2JA6G 2EJGC 4JOIA 1G91A 1PYBA 4LFCL 2IX3A 2E2DC 1C48A 3Q23A 1HHVA 4BS9A 3NEMA 1LM0A 1VMCA 4RG1A 2HT1A 2HHHL 3CF5A 3FEWX 1PA6A 1XNRL 2H4OA 1XPRA 4CJ1B 1LTTD 2E5LL 1TWAH 1K83B 1Q8KA 2ZJQA 2K5VA 3AFQA 1DXMA 2N78A 1YI2A 2R7ZG 1IW7C 5IYBH 5ISRA 3F2DA 2UXCL 4FXKC 2K33A 1NSNS 1HZ9A 2B2VA 3BVZA 4FF3A 3PUXA 3SXHA 4F88A 2F0LA 1VQIA 2I46A 1VQ5A 2RSNA 3PF5A 1HPCA 2MP1A 3D6CA 5HY6A 1A3UA 1I50B 1VQKA 1HNXQ 4E6IA 1STEA 3K5OA 4A93B 4L5TA 2KEEA 1KIXA 1IBML 3DM1A 1I4RA 2CQOA 4DKAC 1UEBA 1TWHB 2WAQB 1LT4D 1HTPA 4B3TL 4NXNQ 2H1EA 2WFWA 3EN2A 4IALA 2N8NA 2A73B 1ET6A 1J6QA 2CFMA 4QY7A 3X3MA 3EQLC 3ULPA 1YEZA 5EKKA 4Z9CB 1SNDA 4J6HA 5IWAL 4BBRG 1M90C 3AB9A 5KNCA 2MO1A 1BF4A 4DV7L 4HIDA 1I3QH 1E24A 3CRKC 1HQRD 4KD3A 3PCOB 4C3IH 2B2WA 1SYFA 1VS0A 3PUVA 4JBWA 1I6HH 1NJIC 3TQYA 1K73C 4CJ2C 3HKZG 5BN3A 1XXGA 1EZ6A 5EBCA 4MTNA 3NTKA 5AJ3Q 4J15A 4FF1A 1Y8OB 5AFWA 3F2UA 4JI1Q 4M1UB 4IOCA 3A5ZB 1F2YA 1A15A 3U50C 4IPGA 4EQOA 2R92G 1EL0A 5IGDA 1NAPA 1KDAA 4A3BG 4B3MQ 4K6DA 4HTHA 3I8ZA 3ZJYC 4MZ9A 3A54A 2JA6H 1VQFA 4LF4L 2QKIC 5IY0A 5EPLA 3TZDA 5JVG3 1V1PB 3NWSA 4GKKL 4PZ6A 4K0KQ 2F0WA 4LFAQ 3TP7A 4UP8A 5EPKA 3OMCA 3CXCA 2R7DA 1BDOA 3BU2A 4P74A 4ZUIA 3CCLA 3MHBA 5CMDA 1JB3A 3BZKA 1IKLA 4B08A 1F2MA 4R8IA 2Z6BA 1I5FA 2F52A 3ND8A 2XIWA 3NE5B 2BCOA 5BR8L 3S2HB 3D4DA 3HOZG 4JI6L 4CBVA 1VQAA 3KLSA 3A8JE 2K5DA 2Q2TA 4BBSB 3CCJA 1JB7A 2IPKD 3HKZB 3HZXA 4ILWA 1V43A 2F03A 4BA2I 2XTIA 3S1QB 1N32L 5T1GA 3OWFA 3KLWA 2FXQA 1CK1A 5ELNA 4GOPC 1DGSA 1SYGA 4TSSA 1XX8A 3RMHA 4K5XA 2PQAB 1FVIA 1VF5C 4OWXB 4EX5A 1EU3A 4HIKA 5CR3A 5DAUA 3MEHA 2B2WC 4KKUA 2I0QA 3KOJA 5C4JB 3I4NG 5CBEE 2B63H 2ZM6L 1Q82C 1KDBA 1PHJA 4RAUC 5G3LF 2BA0A 4EQNA 1TWCB 1FYCA 2HDMA 2PI2E 4QQBX 3T1YQ 3K7UC 1RHPA 1HZAA 4OGQC 5C3WA 4X65L 4DXGA 4QGUA 1KNAA 4ZYSA 2MJ8A 3U9SA 1ZYRD 3KLRA 1LT5D 1EIGA 3UDGA 3K5NA 1V1PA 3EA6A 2Q8RE 1KRSA 2K5NA 4GLVB 4C3JB 1MSGA 5JEAJ 4JI3L 3GTJH 2OWOA 1RTNA 1BCPB 3CU7A 1U9RA 5CV5A 3GTPB 1CA6A 4OWTB 1YIJA 1W6JA 1IYJB 1VQBA 3KBGA 3P20A 3C3LA 5KYIA 5A2QE 1HXYD 2L4NA 3L2PA 1NUCA 1XNRQ 4GS3A 2AQ1B 2OQ0A 3M3YB 3I4NB 2NUCA 4LF9Q 1PTOC 4BXXG 1CSQA 1JR0D 1SYBA 1Q12A 3K59A 1X6OA 1DCZA 5FO7B 4B9XA 4GN4B 1NTGA 1DZ1A 3CCVA 2MGSA 3DWAA 3CCRA 3UE0A 3SGIA 4JPBW 5C5MA 2V4DA 1IZ6A 4QCLA 4DNRB 1BXTA 4DV2L 1PTOF 3S16B 3KJOA 3E9HA 1RD9D 1S5FD 1IBKQ 4X3TA 3KF6A 4KI0A 4R4CA 5DM73 3J80i 3NELA 4ID6A 2F0QA 1K0RA 1H9SB 3K5MA 2RA4A 1L1OB 1I3QB 3S1NB 5CBAE 1OXTA 1Q8IA 3MXPA 2JA8H 2RBMA 1A63A 2KECA 4C3IB 2QGQA 4ZLTF 4PG3A 1E1TA 1X3PA 1A62A 2VS1A 4FVMA 3MXNA 4KLKA 2RVLA 2PQAA 4V0BA 4F87A 4OO1H 1I4PA 1IHZA 4DN4M 3M85A 1VQJA 3G48A 4DR3Q 1UUPA 3E0EA 3FMCA 1KRTA 2UXBQ 1QB5D 4N9PA 5GROA 1QVCA 4KHZA 3O13A 1B2TA 3DUZA 4JI3Q 4JW0A 1B9NA 5J22A 3PSIA 4UP9A 4WJ3M 1VQCA 1N36Q 2HUGA 2F0JA 1SNMA 1W3SA 1X54A 2NVYB 4OWWB 1SMYD 2K5WA 1D1IA 1I50H 2NB0A 3Q8DA 4JVZA 3TP6A 5IYCG 4YHHQ 2KA7A 4O0AA 3I3CA 3HOWB 5J39A 3RNUA 4CDCC 5C44H 1SNQA 2F4IA 3HKSA 5IP9G 4A3FG 1PFNA 2NN6G 1T9HA 4KK7A 2PCFB 2JEAI 5IGEA 1S72A 3EJIA 1LT3D 1PRTB 4DXFA 4B3SQ 4APVA 3ER0A 3OWEB 1Y8NB 3M7GA 1SE2A 1SNOA 2R3ZA 2F4VQ 1WTOA 3DEOA 3HRZC 4IFDG 3K5LA 2BA1A 4A76A 1UAPA 1FR3A 1OO9B 1HUNA 4ME3A 5M5XB 1GUSA 3S1QH 1Q46A 2K14A 4XYQA 1Y1VH 3S1RB 2VQFQ 3GTKB 1UE1A 4YWKA 4HJAA 2KCNA 3BJUA 3W5OA 1LTBD 1EYGA 1YJNA 3TS0A 3S2HH 3MTSA 1B3AA 3CMEA 1GHKA 2UUBL 2HIVA 2JA5H 1EYCA 3URYA 1SRUA 2F0MA 1X3QA
chains in the Genus database with same CATH topology
3CPWA 1SN8A 1BKBA 1FJGQ 3TS2A 4GKJQ 4JI2Q 5IWAQ 4HJ7A 1ASYA 3RN5A 2UXDQ 2A19A 1X3GA 4OXPA 4JV5L 4A3KH 1CKMA 3JAMi 1NMGA 2VW9A 2E8GA 3HOXG 4LFCQ 3I56A 2VUMH 4R1JA 2Z6KA 1VQEA 5FLXc 1G6PA 1LUZA 2KHIA 1TWCH 2VZAA 1VQLA 4GN5A 4LF5Q 1OXSC 4A3IH 3STBD 2RHQB 3EBEA 4YWLA 2GVBA 1XMOL 4BY1G 1U0LA 4B3RQ 4GLXA 2KBNA 3PUWA 5M5WH 3D31A 1AE3A 4R4QA 4IPHA 4NXML 4BXXH 5JEAG 2IX0A 2JEBI 3HOVG 2Q2HA 1K8GA 1YNXA 2VY3A 5M3FG 2XGTA 4X62L 2A8VA 4LF8Q 2UUBQ 1PFSA 3KF8B 4AQYQ 5C4JH 4LNQA 4A3CH 1HNWL 1JT8A 3OTOQ 3M9BA 1D8LA 1MJCA 1HH2P 3WWVA 1BBUA 1IBKL 1O7IA 1XTDA 4NPSA 4JI8Q 1PYSB 1HNZL 1K9MC 1CKNA 2YYZA 4DV4Q 2E2JH 1HR0W 2UXBL 4YCVA 2WB1G 4NXMQ 4DR3L 2AWNA 2ASBA 4TVAB 4YY3L 2RF4A 5M3MH 5M5XH 1XMOQ 2L15A 4AIMA 4DR7L 3I2ZA 3AFPA 4LUVA 3LGJA 1KL9A 1GVPA 4C2MH 2EXDA 5JJIA 3K81C 2UU9Q 4BY7H 2MFIA 3OTOL 3S1NH 2JA6G 2NVYH 1HZCA 3RLNA 4JOIA 1KAWA 1SROA 2JA7G 4X64Q 1PYBA 4LFCL 4A3GG 3NEMA 1LM0A 2YTXA 4RG1A 1HR0Q 2HT1A 2NN6I 2HHHQ 1XNQQ 4OO1I 1JJCB 1VQ7A 2Y0SG 3A0JA 2DGYA 2HHHL 1D7QA 1L2FA 5IT9c 3CF5A 1YITA 1PA6A 1XNRL 1XPRA 2E5LL 1TWAH 3GD7A 1MIUA 4LF5L 1KQSA 1Q8KA 4GLAC 2ZJQA 3CMAA 3PO3H 4DAYB 2K5VA 1OXVA 1GKHA 2OCEA 3S2DH 3S1MH 3HFZB 3AFQA 2N78A 1EFWA 1YI2A 4JV5Q 2R7ZG 5IYBH 3F2DA 2UXCL 4GNXC 1HZ9A 4RMFA 1X9NA 2NZOA 1WI5A 3CC4A 4GKJL 3KDFA 3PUXA 2LXJA 2VQEL 3RN2A 1WOCA 2KCMA 4B3TQ 4OX9L 4C3HH 1VQIA 3S15H 1BBWA 1TWHH 1UWVA 1VQ5A 3L0OA 1VQ6A 4KHPQ 2PI2A 5JJKA 3PF5A 1JJGA 5HY6A 1VQKA 3U58A 1HNXQ 4JYAL 4A3JH 1X56A 4X65Q 1N9WA 2JA9A 3RLOA 1N33L 3H3VI 5LMNL 1Y1VG 4X62Q 1EOVA 4UPAA 1I94Q 4L5TA 4NB3A 3HKZE 1KIXA 1Z9FA 3IRBA 1C7YA 1IBML 4LF9L 1L1OC 2NZHA 3M3YH 4A3CG 2CQOA 4DKAC 3GDEA 3EIVA 1UEBA 1YVCA 1UE6A 4A3IG 2F3IA 3DLLA 4HJ8A 3KYHC 3CAMA 4B3TL 4NXNQ 3U4ZA 2WFWA 3EN2A 1IL2A 4LFBL 4JBMA 3J81c 2AMCB 2N8NA 4P72A 1YZ6A 5C44G 1VQHA 5JJLA 3NBHB 3NENA 1J6QA 5LMNW 2CFMA 4QY7A 4DV0L 1WCMH 4DV3L 3A74A 4AH6A 3ULPA 1YEZA 4A3EG 1V9PA 1YJWA 2UXDL 4LUOA 2HIXA 3PGZA 5IWAL 4BBRG 1M90C 3CP0A 2MO1A 1FJGL 2JA7H 4LUZA 2K50A 4DV7L 4HIDA 1I3QH 1E24A 3S2HH 3BZCA 3HOWH 3TRZA 3K7AH 4UY8C 2MO0A 3PCOB 1KHIA 1PH7A 4C3IH 2JJQA 5GAHC 3JAMc 3PUVA 1VS0A 3PV0A 4JBWA 1VQOA 1PH2A 1IBMQ 4OO1G 1NJIC 3TQYA 1JE5A 4BBRH 5C4XH 3F2BA 4DPGA 1K73C 1J5EL 3ULJA 1I94L 3HKZG 4IPCA 3HOXH 2OTLA 1MJEA 5C0XJ 5FJ8G 1N33Q 2VQFL 3GO5A 3AQQA 4MTNA 5AJ3Q 4J15A 4DR6Q 3PUYA 1EQRA 1TXYA 3J7A5 2I5HA 1X3FA 3E9IA 1WJJA 4JI1Q 2ZTEA 4OX9Q 3I4MH 1NMFA 4YY3Q 4DV2Q 2VQEQ 3A5ZB 4IOCA 2OQKA 3F2CA 3U50C 4HIOA 1QVGA 4IPGA 2R92G 3F8TA 1N36L 3PO2H 1VQ9A 4PZ7A 4TQUS 4A3BG 4B3MQ 1OXXK 2IHEA 1PH8A 1A8VA 4GOPB 1PVOA 5C0XI 3ZJYC 4MZ9A 4JI4L 3PIOA 3PO3G 1YHQA 2AHOB 2JA8G 2JA6H 1VQFA 4LF4L 4LF8L 5C4XG 2JA5G 4BY1H 3GTLH 3AYHB 1B70B 4YCUA 5IY0A 5IYDG 1N34L 4PZ6A 2UUCQ 4GKKL 4K0KQ 1TWGH 4DV5L 1EUJA 3GTKH 4LFAQ 3CC7A 4UP8A 4A3FH 4DR1L 4YWMA 2IY5B 3CXCA 1HR0L 3H15A 2V1CC 2R7DA 3KDFB 4L5SA 3GTQH 2CWAA 1Q7YC 3BU2A 4P74A 4IO9A 4BY7G 4OONA 4LF7Q 3CCLA 1Q81C 2R93H 3T1HL 3BZKA 4A3JG 4DUZQ 3RZDH 2NVTH 3CCMA 2YU9H 2GN5A 3PF4A 1JJ2A 3CD6A 4DV6L 4A3LG 2QEXA 2ATWA 1I5FA 3HOYH 1S3OA 4DR5Q 1IBLQ 2F52A 2OTJA 4DR2Q 4LF6L 2R93G 3GTMH 1SE8A 5ELOA 5BR8L 2BH8A 4JI0Q 1CSPA 1LTLA 4JI6L 3HOZG 1VQAA 1EWIA 2DUDA 5LMUQ 1KXLA 2WAQG 4JOIC 1E7ZA 1P8LA 4WJ4A 4Y52H 2RCNA 2WB1E 4A3MH 3STBC 5DLQE 1M1KC 4DR5L 1IBLL 2Q2TA 1E1OA 4YCWA 1VCIA 4DK6C 3CCJA 2D62A 3D0FA 1JB7A 4GOPA 2PMZE 3RZOH 1MKHA 1OXUA 3U4VA 1YBYA 1V43A 4BA2I 2XTIA 3HOWG 2ZTDA 1G51A 1I6HH 1N32L 2H5XA 1J5EQ 5FLMH 3KLWA 2FXQA 4O2DA 5ELNA 3G6EA 4GOPC 1DGSA 4JI7L 2Y0SE 2LSSA 3RLFA 4A93G 4BBSH 5C3EH 1FVIA 2K5HA 2PQAB 1P16A 1NE3A 4OWXB 2K4KA 4EX5A 4ALPA 1PH5A 3HOZH 2B63G 1CKOA 3GTOH 4A3BH 3W1BA 4HIKA 1CUKA 3G4SA 1PH4A 5C0XG 2I0QA 1FGUA 3KOJA 4FDBA 3M4QA 3HOVH 3I4NG 3S1RH 3PIPA 2ZM6L 2B63H 1Q82C 4A3DH 5M5YH 4P75A 1PH3A 3KFUA 1PHJA 4JI7Q 4JI5Q 1YHAA 1Y1WG 4NXNL 3PUZA 3TREA 1QUQB 1N32Q 2ES2A 2NVXH 2BA0A 3KF6B 1SR3A 2CWPA 2PI2E 4QQBX 4JCVE 3T1YQ 1K8AC 3K7UC 4LW1A 4IFDI 2UUAL 5M3FH 5J3BA 4DK3C 1HZAA 2WP8J 5M3MG 4AYBG 1Y1WH 4X65L 3UDIA 4QGUA 4JI5L 2D0OA 1X3EA 3UDGA 2CCZA 5LMUL 1XPOA 4KHPL 1PH1A 3M7NA 1RL2A 3ULLA 3CCEA 1VQNA 1UE5A 5IYCH 1A0IA 3S24A 1JMCA 1KRSA 2K5NA 2B29A 2AKWB 4GLVB 4P73A 3VDYA 3T1YL 1OTCA 3GTJH 5JEAJ 5GQOA 4JI3L 1SFOH 2E2IH 2OWOA 4IOAA 1TWFH 1HJPA 4PMWA 4JBJA 3K80C 1EQQA 2UXCQ 2GVAA 1VQ8A 1XJVA 4B3SL 4R4IA 4HIMA 4OWTB 1YIJA 1IYJB 4IJHA 3CCQA 1VQBA 2AWOA 3H3VH 4POGA 4DUZL 2ZJPA 4JG2A 1XMQL 4LF7L 4IFDJ 4DR4L 1NBWA 3L2PA 3L7ZC 1XNRQ 4GS3A 2OQ0A 2Z6KC 1HZBA 2N3SA 4A3EH 2E2HH 4LFAL 5H1SE 4DV5Q 4LF9Q 4A4IA 3J7ZC 1CKNB 1EIYB 4BXXG 1SLJA 1CSQA 3W1GA 1VQGA 4YHHL 1Q12A 3FP9A 1X6OA 5LMNQ 1S40A 4LF4Q 1Q86C 1KC8C 5IP7H 4JC0A 4X6AH 4GN4B 1NTGA 3CQZH 3CPFA 3CCVA 2UU9L 4EQ5A 4R4OA 3CCRA 3UE0A 5EAYA 4B3ML 4Y7NH 3SGIA 3GTGH 3OW2A 3I4NH 3FKIH 4GNXA 5GADC 1QZHA 1LYLA 1C0AA 4IJLA 1IZ6A 4R4TA 4DR2L 4LF6Q 5GAGC 5IP9H 4DV2L 4JI1L 3KJOA 4A3LH 1E22A 3E9HA 4JI8L 4A3KG 1FL0A 1IBKQ 4L5QA 3KF6A 4KI0A 4R4CA 1HNWQ 2Q2UA 2ALYB 3J80i 3NELA 4JBKA 3CCUA 1K0RA 2K52A 3G71A 2E5LQ 4JI6Q 2JE6I 4A3GH 1L1OB 2IHFA 1V1QA 5BR8Q 4DUYL 1OXTA 2YTYA 3I55A 1L1OA 1VQDA 1PH9A 2JA8H 4B3RL 1A63A 1XNQL 4A93H 5HGQA 1X55A 2QGQA 4C3JH 3A5UA 4DV6Q 3AEVA 4PG3A 1YHBA 1E1TA 1L0WA 2CKZB 1A62A 2I5MX 4XTCS 2VS1A 4LWCA 3M4OH 1U5KA 4KLKA 2IT1A 5IE8A 2ZJRA 2PQAA 3K0XA 4DUYQ 1EIFA 1QVFA 4POFA 1WCMG 3MEFA 4DR4Q 3RR5A 1X65A 2D0PA 4UP7A 3M85A 1XMQQ 3ICEA 2IX1A 4DR7Q 5FJ8H 4GNXB 2C35B 1VQJA 3G48A 4JI2L 4BBSG 4DR3Q 2UUCL 1N34Q 4GKKQ 4K0KL 3E0EA 2QA4A 3S14H 2Z0SA 1KRTA 2UXBQ 2WAQE 3TEHB 3HOYG 2R7FA 4MNOA 5GROA 1QVCA 3M4PA 1HNZQ 4KHZA 3J81i 2EIFA 2I5LX 3ERSX 2EQSA 4PZ8A 4JI3Q 4DR6L 4DAMA 1VQMA 2VUMG 4JI4Q 5AJ3L 1KD1C 2KHJA 4QL5A 4AQYL 3JC66 2MNAA 2KENA 5GAEC 3PSIA 4UP9A 4WJ3M 1VQCA 1N36Q 1W2BA 4X66L 1VQPA 4A3MG 4L5RC 3HOUH 2A1AA 4IPDA 1W3SA 1X54A 1GD7A 4P71A 3B6YA 1UE7A 4OWWB 1VQ4A 3I4MG 2UUAQ 3FHWA 4YHHQ 1I50H 3Q8DA 4DV7Q 5IYCG 1SMXA 1IXRA 4O0AA 3CC2A 3S16H 3J81j 3RNUA 3S17H 3I7FA 5C44H 3HKSA 4GN3B 5IP9G 3T1HQ 4A3FG 3HOUG 2F4VL 1B7YB 2ID0A 2NN6G 2VL6A 1T9HA 4DV0Q 3CW2C 1R9TH 5IP7G 1Z47A 2RHSB 3KJPA 4DNIA 4DR1Q 2JEAI 2HQLA 2KCTA 1S72A 5C3EG 1K83H 1WYDA 5IYDH 2JK8A 4B3SQ 2LXKA 2NVQH 4APVA 2PNHA 4DV1L 1Q1EA 3ER0A 4HJ5A 3K8AA 1Y14B 3H0GH 4DV3Q 4AYBE 2BH2A 3J80c 2R7ZH 4HJ9A 1N8RC 5K36G 2JQOA 1Q1BA 2K75A 4BA1I 2F4VQ 1AE2A 4A3DG 4X64L 1YJ9A 4IFDG 1H95A 2BA1A 1NY4A 2YTVA 1PH6A 1QUQA 4LFBQ 3CCSA 2YV5A 1K3RA 2B3GA 3F1ZA 4A76A 2VNUD 1WFQA 4ME3A 2Q2IA 3I4OA 3OYYA 1GO3E 2ZTCA 1XPUA 3S1QH 1RIPA 5E7NA 4X66Q 2MQHA 2R92H 3PO2G 4QIWE 1Q46A 2K14A 1Y1VH 2VQFQ 2N49A 1BVSA 1UE1A 4YWKA 4DV4L 4H02A 4HJAA 3MXNB 3BJUA 1PV4A 1AH9A 3W5OA 5FLMG 5IYBG 1EYGA 1HNXL 4JYAQ 1YJNA 3GTPH 1C9OA 1G291 4A75A 3TS0A 1QZGA 1E3PA 3CMEA 1GM5A 3H0GG 4QJFA 1ASZA 2UUBL 3DM3A 2HIVA 4DV1Q 3UDFA 3UE1A 2JA5H 2ZM6Q 4XIGS 3FKIG 4JI0L 2R6GA 1SRUA 3UDXA 1B8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW A;  1SN8 A;  1BKB A;  1FJG Q;  3TS2 A;  4GKJ Q;  4JI2 Q;  5IWA Q;  4HJ7 A;  1ASY A;  3RN5 A;  2UXD Q;  2A19 A;  1X3G A;  4OXP A;  4JV5 L;  4A3K H;  1CKM A;  3JAM i;  1NMG A;  2VW9 A;  2E8G A;  3HOX G;  4LFC Q;  3I56 A;  2VUM H;  4R1J A;  2Z6K A;  1VQE A;  5FLX c;  1G6P A;  1LUZ A;  2KHI A;  1TWC H;  2VZA A;  1VQL A;  4GN5 A;  4LF5 Q;  1OXS C;  4A3I H;  3STB D;  2RHQ B;  3EBE A;  4YWL A;  2GVB A;  1XMO L;  4BY1 G;  1U0L A;  4B3R Q;  4GLX A;  2KBN A;  3PUW A;  5M5W H;  3D31 A;  1AE3 A;  4R4Q A;  4IPH A;  4NXM L;  4BXX H;  5JEA G;  2IX0 A;  2JEB I;  3HOV G;  2Q2H A;  1K8G A;  1YNX A;  2VY3 A;  5M3F G;  2XGT A;  4X62 L;  2A8V A;  4LF8 Q;  2UUB Q;  1PFS A;  3KF8 B;  4AQY Q;  5C4J H;  4LNQ A;  4A3C H;  1HNW L;  1JT8 A;  3OTO Q;  3M9B A;  1D8L A;  1MJC A;  1HH2 P;  3WWV A;  1BBU A;  1IBK L;  1O7I A;  1XTD A;  4NPS A;  4JI8 Q;  1PYS B;  1HNZ L;  1K9M C;  1CKN A;  2YYZ A;  4DV4 Q;  2E2J H;  1HR0 W;  2UXB L;  4YCV A;  2WB1 G;  4NXM Q;  4DR3 L;  2AWN A;  2ASB A;  4TVA B;  4YY3 L;  2RF4 A;  5M3M H;  5M5X H;  1XMO Q;  2L15 A;  4AIM A;  4DR7 L;  3I2Z A;  3AFP A;  4LUV A;  3LGJ A;  1KL9 A;  1GVP A;  4C2M H;  2EXD A;  5JJI A;  3K81 C;  2UU9 Q;  4BY7 H;  2MFI A;  3OTO L;  3S1N H;  2JA6 G;  2NVY H;  1HZC A;  3RLN A;  4JOI A;  1KAW A;  1SRO A;  2JA7 G;  4X64 Q;  1PYB A;  4LFC L;  4A3G G;  3NEM A;  1LM0 A;  2YTX A;  4RG1 A;  1HR0 Q;  2HT1 A;  2NN6 I;  2HHH Q;  1XNQ Q;  4OO1 I;  1JJC B;  1VQ7 A;  2Y0S G;  3A0J A;  2DGY A;  2HHH L;  1D7Q A;  1L2F A;  5IT9 c;  3CF5 A;  1YIT A;  1PA6 A;  1XNR L;  1XPR A;  2E5L L;  1TWA H;  3GD7 A;  1MIU A;  4LF5 L;  1KQS A;  1Q8K A;  4GLA C;  2ZJQ A;  3CMA A;  3PO3 H;  4DAY B;  2K5V A;  1OXV A;  1GKH A;  2OCE A;  3S2D H;  3S1M H;  3HFZ B;  3AFQ A;  2N78 A;  1EFW A;  1YI2 A;  4JV5 Q;  2R7Z G;  5IYB H;  3F2D A;  2UXC L;  4GNX C;  1HZ9 A;  4RMF A;  1X9N A;  2NZO A;  1WI5 A;  3CC4 A;  4GKJ L;  3KDF A;  3PUX A;  2LXJ A;  2VQE L;  3RN2 A;  1WOC A;  2KCM A;  4B3T Q;  4OX9 L;  4C3H H;  1VQI A;  3S15 H;  1BBW A;  1TWH H;  1UWV A;  1VQ5 A;  3L0O A;  1VQ6 A;  4KHP Q;  2PI2 A;  5JJK A;  3PF5 A;  1JJG A;  5HY6 A;  1VQK A;  3U58 A;  1HNX Q;  4JYA L;  4A3J H;  1X56 A;  4X65 Q;  1N9W A;  2JA9 A;  3RLO A;  1N33 L;  3H3V I;  5LMN L;  1Y1V G;  4X62 Q;  1EOV A;  4UPA A;  1I94 Q;  4L5T A;  4NB3 A;  3HKZ E;  1KIX A;  1Z9F A;  3IRB A;  1C7Y A;  1IBM L;  4LF9 L;  1L1O C;  2NZH A;  3M3Y H;  4A3C G;  2CQO A;  4DKA C;  3GDE A;  3EIV A;  1UEB A;  1YVC A;  1UE6 A;  4A3I G;  2F3I A;  3DLL A;  4HJ8 A;  3KYH C;  3CAM A;  4B3T L;  4NXN Q;  3U4Z A;  2WFW A;  3EN2 A;  1IL2 A;  4LFB L;  4JBM A;  3J81 c;  2AMC B;  2N8N A;  4P72 A;  1YZ6 A;  5C44 G;  1VQH A;  5JJL A;  3NBH B;  3NEN A;  1J6Q A;  5LMN W;  2CFM A;  4QY7 A;  4DV0 L;  1WCM H;  4DV3 L;  3A74 A;  4AH6 A;  3ULP A;  1YEZ A;  4A3E G;  1V9P A;  1YJW A;  2UXD L;  4LUO A;  2HIX A;  3PGZ A;  5IWA L;  4BBR G;  1M90 C;  3CP0 A;  2MO1 A;  1FJG L;  2JA7 H;  4LUZ A;  2K50 A;  4DV7 L;  4HID A;  1I3Q H;  1E24 A;  3S2H H;  3BZC A;  3HOW H;  3TRZ A;  3K7A H;  4UY8 C;  2MO0 A;  3PCO B;  1KHI A;  1PH7 A;  4C3I H;  2JJQ A;  5GAH C;  3JAM c;  3PUV A;  1VS0 A;  3PV0 A;  4JBW A;  1VQO A;  1PH2 A;  1IBM Q;  4OO1 G;  1NJI C;  3TQY A;  1JE5 A;  4BBR H;  5C4X H;  3F2B A;  4DPG A;  1K73 C;  1J5E L;  3ULJ A;  1I94 L;  3HKZ G;  4IPC A;  3HOX H;  2OTL A;  1MJE A;  5C0X J;  5FJ8 G;  1N33 Q;  2VQF L;  3GO5 A;  3AQQ A;  4MTN A;  5AJ3 Q;  4J15 A;  4DR6 Q;  3PUY A;  1EQR A;  1TXY A;  3J7A 5;  2I5H A;  1X3F A;  3E9I A;  1WJJ A;  4JI1 Q;  2ZTE A;  4OX9 Q;  3I4M H;  1NMF A;  4YY3 Q;  4DV2 Q;  2VQE Q;  3A5Z B;  4IOC A;  2OQK A;  3F2C A;  3U50 C;  4HIO A;  1QVG A;  4IPG A;  2R92 G;  3F8T A;  1N36 L;  3PO2 H;  1VQ9 A;  4PZ7 A;  4TQU S;  4A3B G;  4B3M Q;  1OXX K;  2IHE A;  1PH8 A;  1A8V A;  4GOP B;  1PVO A;  5C0X I;  3ZJY C;  4MZ9 A;  4JI4 L;  3PIO A;  3PO3 G;  1YHQ A;  2AHO B;  2JA8 G;  2JA6 H;  1VQF A;  4LF4 L;  4LF8 L;  5C4X G;  2JA5 G;  4BY1 H;  3GTL H;  3AYH B;  1B70 B;  4YCU A;  5IY0 A;  5IYD G;  1N34 L;  4PZ6 A;  2UUC Q;  4GKK L;  4K0K Q;  1TWG H;  4DV5 L;  1EUJ A;  3GTK H;  4LFA Q;  3CC7 A;  4UP8 A;  4A3F H;  4DR1 L;  4YWM A;  2IY5 B;  3CXC A;  1HR0 L;  3H15 A;  2V1C C;  2R7D A;  3KDF B;  4L5S A;  3GTQ H;  2CWA A;  1Q7Y C;  3BU2 A;  4P74 A;  4IO9 A;  4BY7 G;  4OON A;  4LF7 Q;  3CCL A;  1Q81 C;  2R93 H;  3T1H L;  3BZK A;  4A3J G;  4DUZ Q;  3RZD H;  2NVT H;  3CCM A;  2YU9 H;  2GN5 A;  3PF4 A;  1JJ2 A;  3CD6 A;  4DV6 L;  4A3L G;  2QEX A;  2ATW A;  1I5F A;  3HOY H;  1S3O A;  4DR5 Q;  1IBL Q;  2F52 A;  2OTJ A;  4DR2 Q;  4LF6 L;  2R93 G;  3GTM H;  1SE8 A;  5ELO A;  5BR8 L;  2BH8 A;  4JI0 Q;  1CSP A;  1LTL A;  4JI6 L;  3HOZ G;  1VQA A;  1EWI A;  2DUD A;  5LMU Q;  1KXL A;  2WAQ G;  4JOI C;  1E7Z A;  1P8L A;  4WJ4 A;  4Y52 H;  2RCN A;  2WB1 E;  4A3M H;  3STB C;  5DLQ E;  1M1K C;  4DR5 L;  1IBL L;  2Q2T A;  1E1O A;  4YCW A;  1VCI A;  4DK6 C;  3CCJ A;  2D62 A;  3D0F A;  1JB7 A;  4GOP A;  2PMZ E;  3RZO H;  1MKH A;  1OXU A;  3U4V A;  1YBY A;  1V43 A;  4BA2 I;  2XTI A;  3HOW G;  2ZTD A;  1G51 A;  1I6H H;  1N32 L;  2H5X A;  1J5E Q;  5FLM H;  3KLW A;  2FXQ A;  4O2D A;  5ELN A;  3G6E A;  4GOP C;  1DGS A;  4JI7 L;  2Y0S E;  2LSS A;  3RLF A;  4A93 G;  4BBS H;  5C3E H;  1FVI A;  2K5H A;  2PQA B;  1P16 A;  1NE3 A;  4OWX B;  2K4K A;  4EX5 A;  4ALP A;  1PH5 A;  3HOZ H;  2B63 G;  1CKO A;  3GTO H;  4A3B H;  3W1B A;  4HIK A;  1CUK A;  3G4S A;  1PH4 A;  5C0X G;  2I0Q A;  1FGU A;  3KOJ A;  4FDB A;  3M4Q A;  3HOV H;  3I4N G;  3S1R H;  3PIP A;  2ZM6 L;  2B63 H;  1Q82 C;  4A3D H;  5M5Y H;  4P75 A;  1PH3 A;  3KFU A;  1PHJ A;  4JI7 Q;  4JI5 Q;  1YHA A;  1Y1W G;  4NXN L;  3PUZ A;  3TRE A;  1QUQ B;  1N32 Q;  2ES2 A;  2NVX H;  2BA0 A;  3KF6 B;  1SR3 A;  2CWP A;  2PI2 E;  4QQB X;  4JCV E;  3T1Y Q;  1K8A C;  3K7U C;  4LW1 A;  4IFD I;  2UUA L;  5M3F H;  5J3B A;  4DK3 C;  1HZA A;  2WP8 J;  5M3M G;  4AYB G;  1Y1W H;  4X65 L;  3UDI A;  4QGU A;  4JI5 L;  2D0O A;  1X3E A;  3UDG A;  2CCZ A;  5LMU L;  1XPO A;  4KHP L;  1PH1 A;  3M7N A;  1RL2 A;  3ULL A;  3CCE A;  1VQN A;  1UE5 A;  5IYC H;  1A0I A;  3S24 A;  1JMC A;  1KRS A;  2K5N A;  2B29 A;  2AKW B;  4GLV B;  4P73 A;  3VDY A;  3T1Y L;  1OTC A;  3GTJ H;  5JEA J;  5GQO A;  4JI3 L;  1SFO H;  2E2I H;  2OWO A;  4IOA A;  1TWF H;  1HJP A;  4PMW A;  4JBJ A;  3K80 C;  1EQQ A;  2UXC Q;  2GVA A;  1VQ8 A;  1XJV A;  4B3S L;  4R4I A;  4HIM A;  4OWT B;  1YIJ A;  1IYJ B;  4IJH A;  3CCQ A;  1VQB A;  2AWO A;  3H3V H;  4POG A;  4DUZ L;  2ZJP A;  4JG2 A;  1XMQ L;  4LF7 L;  4IFD J;  4DR4 L;  1NBW A;  3L2P A;  3L7Z C;  1XNR Q;  4GS3 A;  2OQ0 A;  2Z6K C;  1HZB A;  2N3S A;  4A3E H;  2E2H H;  4LFA L;  5H1S E;  4DV5 Q;  4LF9 Q;  4A4I A;  3J7Z C;  1CKN B;  1EIY B;  4BXX G;  1SLJ A;  1CSQ A;  3W1G A;  1VQG A;  4YHH L;  1Q12 A;  3FP9 A;  1X6O A;  5LMN Q;  1S40 A;  4LF4 Q;  1Q86 C;  1KC8 C;  5IP7 H;  4JC0 A;  4X6A H;  4GN4 B;  1NTG A;  3CQZ H;  3CPF A;  3CCV A;  2UU9 L;  4EQ5 A;  4R4O A;  3CCR A;  3UE0 A;  5EAY A;  4B3M L;  4Y7N H;  3SGI A;  3GTG H;  3OW2 A;  3I4N H;  3FKI H;  4GNX A;  5GAD C;  1QZH A;  1LYL A;  1C0A A;  4IJL A;  1IZ6 A;  4R4T A;  4DR2 L;  4LF6 Q;  5GAG C;  5IP9 H;  4DV2 L;  4JI1 L;  3KJO A;  4A3L H;  1E22 A;  3E9H A;  4JI8 L;  4A3K G;  1FL0 A;  1IBK Q;  4L5Q A;  3KF6 A;  4KI0 A;  4R4C A;  1HNW Q;  2Q2U A;  2ALY B;  3J80 i;  3NEL A;  4JBK A;  3CCU A;  1K0R A;  2K52 A;  3G71 A;  2E5L Q;  4JI6 Q;  2JE6 I;  4A3G H;  1L1O B;  2IHF A;  1V1Q A;  5BR8 Q;  4DUY L;  1OXT A;  2YTY A;  3I55 A;  1L1O A;  1VQD A;  1PH9 A;  2JA8 H;  4B3R L;  1A63 A;  1XNQ L;  4A93 H;  5HGQ A;  1X55 A;  2QGQ A;  4C3J H;  3A5U A;  4DV6 Q;  3AEV A;  4PG3 A;  1YHB A;  1E1T A;  1L0W A;  2CKZ B;  1A62 A;  2I5M X;  4XTC S;  2VS1 A;  4LWC A;  3M4O H;  1U5K A;  4KLK A;  2IT1 A;  5IE8 A;  2ZJR A;  2PQA A;  3K0X A;  4DUY Q;  1EIF A;  1QVF A;  4POF A;  1WCM G;  3MEF A;  4DR4 Q;  3RR5 A;  1X65 A;  2D0P A;  4UP7 A;  3M85 A;  1XMQ Q;  3ICE A;  2IX1 A;  4DR7 Q;  5FJ8 H;  4GNX B;  2C35 B;  1VQJ A;  3G48 A;  4JI2 L;  4BBS G;  4DR3 Q;  2UUC L;  1N34 Q;  4GKK Q;  4K0K L;  3E0E A;  2QA4 A;  3S14 H;  2Z0S A;  1KRT A;  2UXB Q;  2WAQ E;  3TEH B;  3HOY G;  2R7F A;  4MNO A;  5GRO A;  1QVC A;  3M4P A;  1HNZ Q;  4KHZ A;  3J81 i;  2EIF A;  2I5L X;  3ERS X;  2EQS A;  4PZ8 A;  4JI3 Q;  4DR6 L;  4DAM A;  1VQM A;  2VUM G;  4JI4 Q;  5AJ3 L;  1KD1 C;  2KHJ A;  4QL5 A;  4AQY L;  3JC6 6;  2MNA A;  2KEN A;  5GAE C;  3PSI A;  4UP9 A;  4WJ3 M;  1VQC A;  1N36 Q;  1W2B A;  4X66 L;  1VQP A;  4A3M G;  4L5R C;  3HOU H;  2A1A A;  4IPD A;  1W3S A;  1X54 A;  1GD7 A;  4P71 A;  3B6Y A;  1UE7 A;  4OWW B;  1VQ4 A;  3I4M G;  2UUA Q;  3FHW A;  4YHH Q;  1I50 H;  3Q8D A;  4DV7 Q;  5IYC G;  1SMX A;  1IXR A;  4O0A A;  3CC2 A;  3S16 H;  3J81 j;  3RNU A;  3S17 H;  3I7F A;  5C44 H;  3HKS A;  4GN3 B;  5IP9 G;  3T1H Q;  4A3F G;  3HOU G;  2F4V L;  1B7Y B;  2ID0 A;  2NN6 G;  2VL6 A;  1T9H A;  4DV0 Q;  3CW2 C;  1R9T H;  5IP7 G;  1Z47 A;  2RHS B;  3KJP A;  4DNI A;  4DR1 Q;  2JEA I;  2HQL A;  2KCT A;  1S72 A;  5C3E G;  1K83 H;  1WYD A;  5IYD H;  2JK8 A;  4B3S Q;  2LXK A;  2NVQ H;  4APV A;  2PNH A;  4DV1 L;  1Q1E A;  3ER0 A;  4HJ5 A;  3K8A A;  1Y14 B;  3H0G H;  4DV3 Q;  4AYB E;  2BH2 A;  3J80 c;  2R7Z H;  4HJ9 A;  1N8R C;  5K36 G;  2JQO A;  1Q1B A;  2K75 A;  4BA1 I;  2F4V Q;  1AE2 A;  4A3D G;  4X64 L;  1YJ9 A;  4IFD G;  1H95 A;  2BA1 A;  1NY4 A;  2YTV A;  1PH6 A;  1QUQ A;  4LFB Q;  3CCS A;  2YV5 A;  1K3R A;  2B3G A;  3F1Z A;  4A76 A;  2VNU D;  1WFQ A;  4ME3 A;  2Q2I A;  3I4O A;  3OYY A;  1GO3 E;  2ZTC A;  1XPU A;  3S1Q H;  1RIP A;  5E7N A;  4X66 Q;  2MQH A;  2R92 H;  3PO2 G;  4QIW E;  1Q46 A;  2K14 A;  1Y1V H;  2VQF Q;  2N49 A;  1BVS A;  1UE1 A;  4YWK A;  4DV4 L;  4H02 A;  4HJA A;  3MXN B;  3BJU A;  1PV4 A;  1AH9 A;  3W5O A;  5FLM G;  5IYB G;  1EYG A;  1HNX L;  4JYA Q;  1YJN A;  3GTP H;  1C9O A;  1G29 1;  4A75 A;  3TS0 A;  1QZG A;  1E3P A;  3CME A;  1GM5 A;  3H0G G;  4QJF A;  1ASZ A;  2UUB L;  3DM3 A;  2HIV A;  4DV1 Q;  3UDF A;  3UE1 A;  2JA5 H;  2ZM6 Q;  4XIG S;  3FKI G;  4JI0 L;  2R6G A;  1SRU A;  3UDX A;  1B8A A; 
#chains in the Genus database with same CATH topology
 1QOH A;  3CPW A;  1GUG A;  1BKB A;  3TS2 A;  1A2T A;  4GKJ Q;  2B2U C;  2CHB D;  4JI2 Q;  5IWA Q;  2XRS D;  4A3G B;  1H9S A;  2EDG A;  2Y0S B;  2B8G A;  3GV6 A;  1D5X C;  5FLX c;  5I4D A;  1G6P A;  4LF5 Q;  1TWC H;  1TII D;  3E5S A;  2SEB D;  2RHQ B;  1EY8 A;  3PUW A;  4NXM L;  4IPH A;  3MXG A;  2IX0 A;  2JEB I;  4ZAI A;  4XQQ A;  3KLS X;  3KF8 B;  5C4J H;  2CW0 C;  2ZXO A;  1O7I A;  4JI8 Q;  2KJX A;  1EYD A;  1HR0 W;  2EXZ A;  1FNV A;  2NWG A;  4QUF A;  3PMF A;  1B1Z A;  2RF4 A;  4YY3 L;  5HUR A;  4DR7 L;  3I2Z A;  4LUV A;  1D6E C;  3LGJ A;  4I7Z C;  2EXD A;  2R92 B;  2UU9 Q;  3TSS A;  2MFI A;  3OTO L;  2EZV A;  1J8I A;  1CI3 M;  4H13 C;  1R9T B;  2ZT9 C;  5FK9 C;  1KAW A;  1SRO A;  1SNP A;  3A7A B;  1X32 A;  4A3G G;  1PLF A;  1VDZ A;  2NN6 I;  3H94 A;  2HHH Q;  4KD4 A;  2Y0S G;  2DGY A;  1EZ8 A;  4TRD A;  4WJW A;  3WDN A;  2EYF A;  5KIX A;  2N88 A;  4LF5 L;  2F0O A;  4QB4 A;  1OXV A;  1GKH A;  5I2X A;  3S1M H;  1EFW A;  1KLU D;  4IUV A;  2YU9 B;  4HCS A;  4H44 C;  4GKJ L;  2F0I A;  1AZP A;  4C3H H;  2RKS A;  1BBW A;  1TWH H;  2VB3 X;  1VQ6 A;  1JJG A;  1SE4 A;  3NWT A;  5CGK A;  4A3J H;  1N9W A;  3RLO A;  1HFN A;  5LMN L;  1DOK A;  1S5D D;  1Y1V G;  1EOV A;  2ICI A;  1I94 Q;  1IYU A;  1Z9F A;  1NR2 A;  1L1O C;  4NMZ A;  4A3C G;  3GDE A;  2K05 A;  4J8Q A;  3QOJ A;  3X3N A;  1BCP C;  3DLL A;  4HJ8 A;  4K2K A;  3FVQ A;  4DNT B;  2M00 A;  1IL2 A;  2KUM A;  2SOB A;  2L9H A;  4JBM A;  4LFB L;  4KHV A;  1AFP A;  5JJL A;  1EY9 A;  4FXG C;  3NEN A;  1ESR A;  3T16 A;  1SXT A;  2G9D A;  3OPO A;  3A74 A;  4A3E G;  4XXE A;  2UXD L;  1K3B C;  2EY2 A;  2B63 B;  3CP0 A;  2K50 A;  3MZ5 A;  4L8J A;  1KHI A;  3FDT A;  3H6M A;  2JJQ A;  5IOD A;  3C2P A;  3PV0 A;  5JJZ A;  1PH2 A;  2LY7 A;  1ZEQ X;  3F2B A;  1I94 L;  2X6G A;  3HOX H;  1MJE A;  5C0X J;  1N33 Q;  2AQ2 B;  2NZ1 D;  4H7B A;  1R4P B;  2WB1 B;  3C1F A;  4IZ8 A;  1WJJ A;  3I4M H;  4DV2 Q;  2VQE Q;  2B8F A;  2OQK A;  1QVG A;  5A35 A;  1G2T A;  3F8T A;  4ABN A;  4PZ7 A;  2JA7 B;  2IHE A;  3EFX D;  4GOP B;  1PH8 A;  4JI4 L;  3PIO A;  2AHO B;  3CKI B;  5C4Z A;  3MAQ A;  2JA5 G;  5LHY 1;  5J1Z A;  1Y1V B;  3R2T A;  1TWG H;  1EUJ A;  5EKL A;  4A3F H;  4I65 A;  1EY0 A;  3KDF B;  4L5S A;  3FPU B;  2Q8I B;  3QWN A;  1CM9 A;  1Q7Y C;  4BY7 G;  1B4O A;  1FNW A;  3E0J A;  4OON A;  4X3K A;  4LF7 Q;  5IGG A;  3MA2 B;  3D3R A;  1A3V A;  5KGU A;  1VF7 A;  2YU9 H;  2GN5 A;  3CD6 A;  1JE4 A;  4DV6 L;  4DR5 Q;  4MIU A;  5C5L A;  4LF6 L;  2R93 G;  5G3L D;  2BDN A;  5ELO A;  2FFK B;  3HP3 A;  1CSP A;  3NQT A;  2DUD A;  2FJ2 A;  5LMU Q;  2RSO A;  1P8L A;  4WJ4 A;  4Y52 H;  1C4Q A;  2L5T A;  4A3M H;  3STB C;  1IW7 D;  2E76 C;  1M1K C;  5A2Q L;  1VCI A;  1ENC A;  1D1K A;  4DK6 C;  2R61 A;  5CV9 A;  5CV7 A;  3U4V A;  2MPM A;  1BR9 A;  5KYL A;  1CA5 A;  3DEP A;  2NVX B;  2ZTD A;  1G51 A;  4RWS C;  2H5X A;  5FOB B;  4CDE C;  1PDQ A;  1MHW C;  1PTO B;  4BBS H;  3NPP A;  2M2L A;  1P16 A;  1F9P A;  4A3B H;  2K4K A;  2K03 A;  3GTO H;  1CUK A;  1V8Q A;  3G4S A;  1PH4 A;  5C0X G;  1FGU A;  2EYP A;  3BS1 A;  5K36 H;  4ZRZ A;  4C1N I;  2DNC A;  2IWH A;  1PH3 A;  1BQQ T;  4JI7 Q;  3T53 B;  5D65 A;  1Y1W G;  3I72 A;  3TRE A;  1N32 Q;  1QUQ B;  2ES2 A;  5JVH 3;  2PNR C;  2F0S A;  1NR4 A;  1SJH D;  2XWJ B;  3LWU A;  1CHQ D;  4ODG A;  4IFD I;  4OHJ A;  5J3B A;  1AEX A;  4C3I G;  2D0O A;  1X3E A;  2O4X A;  4N8F A;  1XPO A;  2JA8 B;  4K5V A;  1JMC A;  2AKW B;  1OTC A;  1I6V C;  5EJW A;  4IOA A;  1BUV T;  5GQO A;  1LT6 D;  1EQQ A;  4B3S L;  1TY2 A;  3CCQ A;  3QIA A;  2AWO A;  3K6O A;  4RKB A;  4POG A;  1CTM A;  1GUW A;  1XMQ L;  4DR4 L;  1NBW A;  2NYZ D;  1DD2 A;  3L7Z C;  2K04 A;  1HZB A;  2N3S A;  4A3E H;  2E2H H;  4LFA L;  3GTG B;  5H1S E;  1RCV D;  5E4W C;  4A4I A;  1CKN B;  2LMC B;  1EFI D;  1VQG A;  1WTQ A;  1S40 A;  5IP7 H;  4JC0 A;  3CQZ H;  2UU9 L;  1TWA B;  2IW3 A;  1EEF D;  1HA6 A;  4B3M L;  4Y7N H;  1H9R A;  3GTG H;  3I4N H;  4JK1 C;  4F8M A;  5GAD C;  2Z4H A;  1LYL A;  1C0A A;  3BDL A;  4R4T A;  4DR2 L;  3EVQ A;  5IP9 H;  2OT2 A;  4A3L H;  4DU9 A;  3U9O A;  4V19 0;  4L5Q A;  1F2Z A;  2ALY B;  2PMZ B;  2ZXP A;  1TT2 A;  1YNN C;  4C3J G;  3C1E A;  5ELF A;  2A69 C;  2E5L Q;  4JI6 Q;  3PO3 B;  2K32 A;  1EOT A;  1V1Q A;  2IHF A;  3T13 A;  1B3Q A;  1PZI D;  1L1O A;  1VQD A;  1PH9 A;  1XNQ L;  4HAE A;  4IUQ A;  1X55 A;  3AEV A;  3KK7 A;  4O42 A;  1ILQ A;  3J81 E;  1QNU A;  3M4O H;  1HRJ A;  3I90 A;  2EJM A;  3A56 A;  4G7Z C;  2IT1 A;  5IE8 A;  2ZJR A;  2PZU A;  4DUY Q;  3TP5 A;  1JOO A;  1EIF A;  2PPB C;  4A3J B;  4DR4 Q;  1X65 A;  2F0F A;  4UP7 A;  2IX1 A;  5FJ8 H;  3BG3 A;  4GKK Q;  4K0K L;  2Z0S A;  2WAQ E;  3HOY G;  1PXU A;  4EGV A;  1HNZ Q;  4HMJ A;  2EIF A;  2I5L X;  3ERS X;  4DAM A;  2VUM G;  2CVR A;  1GOZ A;  1LLR D;  3JC6 6;  4AQY L;  2KEN A;  1CQF A;  4BY1 B;  2JA6 B;  1ICF B;  5E4X A;  4CKE A;  4IUR A;  4A3M G;  1O7Z A;  1WVL A;  4RA8 A;  2NTT A;  4P71 A;  3B6Y A;  1UE7 A;  2F0N A;  5FO9 B;  3FHW A;  2A6E D;  4LAA A;  1IXR A;  3GTM B;  3S16 H;  3S17 H;  3NQI A;  3LNN A;  1WTR A;  3CRL C;  2F4V L;  3W3A A;  3H3V C;  4DV0 Q;  2A74 C;  1R9T H;  3OW7 A;  4PMB A;  4DNI A;  4DR1 Q;  2KCT A;  5EBD A;  1WYD A;  3A8K E;  5IYD H;  2JK8 A;  1B9M A;  3C46 A;  3NXW A;  4C56 C;  2QF7 A;  1TS2 A;  4HJ9 A;  4DFA A;  1Q1B A;  4BA1 I;  1YJ9 A;  1JOR A;  2YV5 A;  1XTC D;  4H0L C;  2K1B A;  1WFQ A;  1ILP A;  3OYY A;  3I4O A;  1EY4 A;  5E7N A;  2EY5 A;  3PO2 G;  2Z8L A;  2A6E C;  2N49 A;  4OIK A;  3KF8 A;  1PV4 A;  4GZY C;  4A3B B;  1TY0 A;  2F0H A;  5IYB G;  5FLM G;  3GTP H;  3IKJ A;  1QZG A;  1E3P A;  1GM5 A;  4QJF A;  2B2T A;  5DNF A;  3UDF A;  5COR A;  1LTG D;  2R6G A;  3UDX A;  2FMM A;  2DN8 A;  1FJG Q;  5IT9 E;  1WCM B;  4KMU C;  2A19 A;  3SE0 A;  1UEA B;  5KND A;  1FD7 D;  4A3K H;  2EYH A;  3K0Y A;  5ELB A;  1HFG A;  3HOX G;  3I56 A;  2VUM H;  1VQE A;  4XYO A;  4KJN A;  5JEA H;  1VQL A;  1E2Z A;  2Q8T A;  5FLX L;  4A3I H;  1SFO B;  2CH4 W;  3ITP A;  3EBE A;  4X3S A;  4BY1 G;  1Z7T A;  4GLX A;  4R9W A;  4OEM B;  2KBN A;  5M5W H;  1GXD C;  4R4Q A;  3GP7 A;  3OIQ A;  1SE3 A;  1YNX A;  3DWQ A;  2TSS A;  2XGT A;  2A8V A;  3JAM L;  4UHV A;  4LNQ A;  4A3C H;  1D2B A;  4UY8 C;  1IBK L;  1BBU A;  1F9S A;  1HNZ L;  2F0P A;  1BBX C;  3L9A X;  2YYZ A;  4P2C B;  3PO2 B;  3ND9 A;  3IFT A;  5E1F A;  4NXM Q;  4X3U A;  1YNJ C;  2A6H C;  3E3X A;  2PZW A;  3VR3 A;  2ASB A;  4TVA B;  2D2C C;  1KL9 A;  3K81 C;  3HOU B;  4BY7 H;  4A3I B;  3P1H A;  2NVY H;  2KVM A;  3RLN A;  2JA7 G;  4MHE A;  4X64 Q;  5C44 B;  4QMG A;  1HR0 Q;  3VR2 A;  4KTA A;  5BN4 A;  1XNQ Q;  2J7Z A;  3A0J A;  4HSP A;  1D7Q A;  1MI2 A;  2EJF C;  1U4P A;  5I9O A;  1WD0 A;  4GLA C;  2JN4 A;  3HOZ B;  2EOT A;  2OCE A;  5IGC A;  1S5B D;  3HFZ B;  1LTI D;  3J7A F;  2F3W A;  1TS5 A;  1O78 A;  4RMF A;  2NZO A;  1DON A;  1WI5 A;  3BVG A;  3CC4 A;  3I4M B;  4CHT B;  1Q3L A;  2LXJ A;  2QDL A;  3RN2 A;  2KCM A;  4OX9 L;  2OF1 A;  2J4X A;  1SAP A;  1UWV A;  1BNZ A;  5JJK A;  3IFD A;  2QEJ C;  3VR6 A;  4HMI A;  2LFN A;  5LL6 S;  4X65 Q;  2D5D A;  2JA9 A;  2KCC A;  3H3V I;  3J80 E;  4RHR A;  4X62 Q;  5IT9 L;  1WTV A;  3A7L A;  4NB3 A;  3HKZ E;  3IRB A;  1SJE D;  3TN2 A;  5IGF A;  5M3F B;  1C7Y A;  4A3I G;  5I2Y A;  3HG9 A;  2WAC A;  3U4Z A;  4TKO B;  2VB2 X;  5M3M B;  3J81 c;  4P72 A;  1VQH A;  4DF7 A;  3T4A C;  1JQY D;  5LMN W;  3H0G B;  1WCM H;  4AH6 A;  1V9P A;  3ERQ A;  1YJW A;  2B2U A;  3FKI B;  4LUO A;  2HIX A;  4PQX A;  3RD4 A;  1GUN A;  2EVB A;  4LUZ A;  2I07 B;  3BZC A;  1K0S A;  3TRZ A;  1SDF A;  2HD3 A;  1CFM A;  1TQO A;  2WV6 D;  3D4W A;  1PH7 A;  2ENB A;  3VYU A;  1IBM Q;  1U4L A;  1JE5 A;  1J5E L;  1HA5 A;  5C4X H;  1FNU A;  4UAI A;  4A3D B;  3ULJ A;  4CGY B;  4CDD C;  1KAB A;  4DAV A;  1JC7 A;  1CZW A;  5FJ8 G;  1PRT D;  2VQF L;  3AQQ A;  1Y1W B;  4DR6 Q;  4ZKB B;  1M8A A;  2Z9H A;  2E74 C;  3J7A 5;  2I5H A;  3E9I A;  1RDP D;  1MSH A;  4OX9 Q;  1A6X A;  1NMF A;  4YY3 Q;  3HEJ A;  3F2C A;  2BDO A;  4HIO A;  1YNJ D;  2A6H D;  2JXM B;  3PO2 H;  1ET9 A;  1DYQ A;  4RCO A;  1A8V A;  1T5E A;  4NP5 A;  1DJR D;  2JA8 G;  5FKA C;  5C4X G;  3AYH B;  3JAM E;  1O7L A;  1N34 L;  2UUC Q;  1JOQ A;  1L0X B;  3GTK H;  4DA2 A;  3CC7 A;  1IL8 A;  3H91 A;  4YWM A;  2IY5 B;  4A3E B;  1CHP D;  1HR0 L;  4QIW B;  2CWA A;  4IO9 A;  1YNN D;  4HCE A;  2R93 H;  1SYC A;  3RZD H;  3BYY B;  5EQ0 A;  3CCM A;  1RF2 D;  4A3L G;  2QEX A;  2ATW A;  2FMC A;  1F2L A;  1IBL Q;  2F3V A;  1SYE A;  3GTM H;  1SE8 A;  1VMP A;  2BH8 A;  1ROD A;  2EYJ A;  1EWI A;  1I6H B;  3BDO A;  4ZK9 B;  4JOI C;  1E7Z A;  4KY5 A;  4G57 A;  5EPJ A;  4K2L A;  1PZK D;  4DR5 L;  1E1O A;  4YCW A;  2D62 A;  4GOP A;  3PQI A;  1Y69 U;  1MKH A;  3RZO H;  1SBB B;  2EE1 A;  1A3T A;  1Z6H A;  1K28 A;  5F2D A;  1J5E Q;  5FLM H;  3SDZ A;  1ENA A;  4JI7 L;  1J9O A;  4LJZ C;  4RFB A;  2LSS A;  3RLF A;  1D5M C;  4A93 G;  5M5Y B;  3L3O C;  2K5H A;  1D5Z C;  5C3E H;  3M4O B;  1S5E D;  3HOZ H;  1GJX A;  1JWM D;  1I4H A;  3QG1 A;  1LTA D;  1U4M A;  4KKS A;  3M4Y A;  1STN A;  3M4Q A;  5I9P A;  3HOV H;  4FYD A;  3S1R H;  3PIP A;  4BBR B;  5M5Y H;  2PW7 A;  2DJF C;  2JSO A;  1YHA A;  3RZO B;  4KV6 A;  5C0X H;  4NXN L;  3PUZ A;  2NVT B;  3KF6 B;  2KED A;  2C9O A;  3NK9 A;  2CWP A;  1PRT C;  1C8C A;  2D9U A;  1K8A C;  4LW1 A;  2ICE C;  2UUA L;  4DK3 C;  2WP8 J;  1SNC A;  1Y1W H;  5M5W B;  1BCP D;  3UDI A;  2HCC A;  2CCZ A;  5LMU L;  3M7N A;  1RL2 A;  2KOL A;  3CCE A;  1PYW D;  1A0I A;  3S24 A;  5IYC H;  4P73 A;  2B29 A;  3CQZ B;  1B44 D;  3VDY A;  2XN9 C;  1SFO H;  1TWF H;  1HJP A;  3KBX A;  3VR4 A;  3K80 C;  3AMU A;  2UXC Q;  1VQ8 A;  2DJG C;  1XJV A;  4K14 A;  1EU4 A;  1EQT A;  4IJH A;  3H3V H;  4DUZ L;  2ZJP A;  3SEB A;  4LF7 L;  3RZD B;  1H9M A;  1A2U A;  3DMU A;  4DV5 Q;  3J7A V;  3CHB D;  1EIY B;  4XQN A;  3W1G A;  4FO2 A;  5CV6 A;  3QR8 A;  4UDU C;  3FP9 A;  4C3H G;  5LMN Q;  1Q86 C;  3A8I E;  4PMC A;  2JYO A;  1KC8 C;  1LO5 D;  3I73 A;  4R4O A;  3P7J A;  4XT3 B;  1QZH A;  4FF2 A;  4IJL A;  5GAG C;  1WTH A;  1E22 A;  1LTR D;  4IUP A;  4A3K G;  1FL0 A;  1STA A;  3OMG A;  4U67 3;  1AW7 A;  2Q2U A;  4JBK A;  4IUN A;  2DY7 A;  1ENF A;  4FXD A;  1G2S A;  4A3G H;  3OOC A;  3TP8 A;  4DUY L;  4QUC A;  2O2L D;  3Q24 A;  2YTY A;  4IUT A;  3I55 A;  4OL7 A;  1JWU D;  4B3R L;  2PQE A;  2A68 D;  2PW5 A;  4A93 H;  4C3J H;  4M8A A;  4DV6 Q;  4HN7 A;  1YHB A;  1PTO H;  2CKZ B;  3S14 B;  1HUM A;  5C3E B;  4XTC S;  1U5K A;  3QJY A;  2NTS A;  1E2W A;  4POF A;  1WCM G;  3MEF A;  2IL8 A;  4FNF A;  3RR5 A;  4DR7 Q;  3ICE A;  2IJ0 A;  3FPP A;  4GNX B;  2C35 B;  2BOS A;  4BBS G;  1AP0 A;  3MFY A;  3OHX C;  2QA4 A;  3AU7 A;  1F9Q A;  2R7F A;  4ZCK A;  3M4P A;  5C3X A;  4N8X 1;  4C1N K;  2EPB A;  1TR5 A;  4PZ8 A;  4DR6 L;  1VQM A;  4JI4 Q;  5AJ3 L;  1KD1 C;  5GAE C;  1QG7 A;  1W2B A;  2A1A A;  1VQ4 A;  2UUA Q;  4DV7 Q;  1F9R A;  1SMX A;  3I7F A;  4GN3 B;  4DAY A;  2L55 A;  3HOU G;  1B7Y B;  1LAB A;  1BO0 A;  2VL6 A;  1QE6 A;  3MC0 B;  3NBH A;  1Z47 A;  3UI2 A;  2RHS B;  3KJP A;  4R8N A;  3HOV B;  2QIL A;  1CT1 D;  5D3I B;  5C3E G;  2L11 A;  2WKD A;  5C4H A;  2LXK A;  2NVQ H;  2PNH A;  4DV1 L;  2TMP A;  2C5C A;  3K8A A;  3D8G A;  4DV3 Q;  4AYB E;  2BH2 A;  1MGS A;  5T1I A;  4F7X A;  4IQZ A;  1AE2 A;  1NY4 A;  1PFB A;  2YTV A;  1AN8 A;  3MVV A;  1PH6 A;  3HS0 C;  4LFB Q;  3CCS A;  1K3R A;  1QIL A;  2B3G A;  2XWB B;  1L0Y B;  2Q2I A;  1GO3 E;  4X66 Q;  2OEO A;  2MQH A;  1M4V A;  4Y7N B;  2K6A A;  3ZYY X;  2E2I B;  1W6K A;  2M9V A;  4DV4 L;  1EQV A;  4IUU A;  2XNA C;  4JYA Q;  1C9O A;  4BWG B;  4A75 A;  3S1N H;  4DV1 Q;  5CC4 A;  3BDC A;  5CV8 A;  4XIG S;  3FKI G;  5KRU A;  1IYV A;  4IFD H;  2RDG A;  5FLX E;  1SN8 A;  4KKT A;  4HJ7 A;  1ASY A;  3RN5 A;  1O80 A;  4QF4 A;  3BVM A;  4JV5 L;  1H9J A;  3JAM i;  2VW9 A;  2E8G A;  4LFC Q;  2Z6K A;  2RQX A;  1EEI D;  4N9T A;  1LUZ A;  2KHI A;  2VZA A;  2AUK A;  3BYT B;  4GN5 A;  2F1M A;  1TWG B;  4PV1 C;  4MTK A;  2G9H D;  2P5Z X;  4YWL A;  2K5Q A;  3WOF A;  3D31 A;  2XSC A;  2FIN B;  4BXX H;  5JEA G;  2Z4I A;  1K8G A;  1KLG D;  1G8Z D;  2VY3 A;  3HOV G;  5M3F G;  4X62 L;  3OIP A;  2UUB Q;  2NBF A;  1HCZ A;  3VA7 A;  1HNW L;  1JT8 A;  3OTO Q;  3M9B A;  1D8L A;  1MJC A;  3WWV A;  1XTD A;  4KJO A;  4NPS A;  5IIF A;  3RUZ A;  1K9M C;  1CKN A;  4DV4 Q;  2UXB L;  5ELE A;  3NP8 A;  4O1N A;  2G5D A;  4YCV A;  2F0G A;  3IL8 A;  2WB1 G;  4DR3 L;  2AWN A;  2XRQ D;  1ZYR C;  1CZG A;  1XMO Q;  2L15 A;  2X6L A;  4AIM A;  1EY5 A;  1GVP A;  1BOS A;  3R2I A;  3Q22 A;  4S3S A;  3J81 L;  3S9W A;  1CQV A;  3FRP B;  3TBI B;  1HZC A;  4HSV A;  3S1M B;  3I4L A;  5KEE A;  1STG A;  2YTX A;  4OO1 I;  2EYL A;  3NTI A;  2JA5 B;  1JJC B;  4XT1 B;  1VQ7 A;  1L2F A;  2DNE A;  5BN5 A;  5IT9 c;  1E0B A;  1YIT A;  2EYO A;  3R3O A;  1RTO A;  3GD7 A;  1MIU A;  1KQS A;  5NUC A;  3GQB A;  3CMA A;  3PO3 H;  4I7A A;  4DAY B;  3TDQ A;  3S2D H;  1QJO A;  4L6T B;  2R93 B;  4JV5 Q;  5TSS A;  4GNX C;  5EGT A;  2HCI A;  1X9N A;  1GUT A;  3A55 A;  1K8M A;  3KDF A;  2AQ3 B;  4EQP A;  1PRT F;  2VQE L;  1WOC A;  4Q0F A;  4B3T Q;  2XVS A;  3S15 H;  3L0O A;  4KHP Q;  2PI2 A;  3VR5 A;  3K58 A;  1STB A;  2F0V A;  3U58 A;  4OEL B;  4JYA L;  1X56 A;  1N33 L;  4UPA A;  1QWY A;  4FF4 A;  3QO2 A;  5I6Y A;  2MHV A;  4LF9 L;  2NZH A;  3M3Y H;  3EIV A;  1YVC A;  1UE6 A;  2F3I A;  3KYH C;  3CAM A;  2B2Y A;  5D3D A;  2KHS A;  1UNS A;  2AMC B;  2QW7 A;  1YZ6 A;  3D6W A;  5C44 G;  2CH4 A;  3NBH B;  4DV0 L;  4DV3 L;  2O5J C;  4RGT A;  4NW2 A;  2RDH A;  3PGZ A;  1FJG L;  2JA7 H;  1U4R A;  3OSO A;  3HOW H;  1S4Z A;  5COY A;  3K7A H;  5IGB A;  2MO0 A;  2ZXR A;  4HR7 B;  5GAH C;  3JAM c;  1KTK A;  4OO1 G;  1VQO A;  1MD2 D;  2BE5 C;  1SEB D;  4BBR H;  4NDX A;  4DPG A;  2PO4 A;  4IPC A;  5DM6 3;  2OTL A;  1B50 A;  5JPN C;  3GO5 A;  2A5H A;  3I70 A;  3VYR A;  3PUY A;  1EQR A;  1TXY A;  4DK1 A;  1X3F A;  5HGT A;  2ZTE A;  3VYT A;  1JWS D;  4RGN A;  1ONL A;  1N36 L;  4WOR A;  1VQ9 A;  4TQU S;  2GA4 B;  2B39 A;  1TWF B;  1OXX K;  2O5I C;  3GTQ B;  1H9K A;  4OIJ A;  1PVO A;  5C0X I;  3PO3 G;  1STH A;  1YHQ A;  4LF8 L;  1XWE A;  4XDX A;  3GTL H;  3MXU A;  2K01 A;  1B70 B;  4YCU A;  3WOE A;  5K5P A;  5IYD G;  1EY6 A;  1EIH A;  2MUY A;  1PZJ D;  4DV5 L;  1TS4 A;  5LL6 X;  4DR1 L;  3GTQ H;  3H15 A;  2V1C C;  4K8J A;  4MN3 A;  1TVX A;  1STY A;  1Q81 C;  1ICW A;  2B2Y C;  3T1H L;  4A3J G;  4DUZ Q;  2NVT H;  4RH6 A;  3PF4 A;  1JJ2 A;  1XYI A;  3T56 B;  3HOY H;  1S3O A;  3T51 B;  2OTJ A;  1GHJ A;  4DR2 Q;  4FP5 D;  4A3K B;  3NHH A;  3K7A B;  4JI0 Q;  1LTL A;  4B9W A;  1KXL A;  3E6Z X;  2WAQ G;  2RCN A;  2WB1 E;  4C3H B;  5IOC A;  1JCK B;  3SK5 A;  1SSO A;  5DLQ E;  1IBL L;  2F0T A;  3D0F A;  1PFM A;  2PMZ E;  4KN4 C;  3SK6 A;  4CKC A;  5ELC A;  1OXU A;  1V1O A;  1YBY A;  3HOW G;  4K6L A;  3NSW A;  4O2D A;  3G6E A;  3DWP A;  3V96 A;  2Y0S E;  1JOK A;  1R4Q B;  3R93 A;  1PH5 A;  1NE3 A;  4ALP A;  1WTW A;  4WFN 3;  2B63 G;  1CKO A;  3W1B A;  3KUP A;  3MWY W;  1Q90 A;  2QDB A;  4L63 B;  1G6Z A;  2KQ3 A;  4FDB A;  3GTJ B;  5M9O A;  4A3D H;  4P75 A;  4DK0 A;  3KFU A;  4JI5 Q;  1F77 A;  3Q6S A;  2VUM B;  2NVX H;  3V2T A;  4RCN A;  3QB3 A;  1SR3 A;  1JIC A;  3HOY B;  3ONA B;  4JCV E;  4DGZ A;  5M3M G;  5M3F H;  5C6A A;  4ME5 A;  4AYB G;  4G7O C;  1SMY C;  3Q0A A;  4J1M A;  5L37 A;  4ULL A;  4JI5 L;  1LTS D;  4LMQ D;  1MBY A;  4KHP L;  3NTH A;  1DOM A;  1NCV A;  1PH1 A;  3ULL A;  1LV9 A;  1VQN A;  1UE5 A;  4A3M B;  3T1Y L;  2E2I H;  1NNX A;  1QCB D;  3NUC A;  4PMW A;  4JBJ A;  2GVA A;  1ZKO A;  4R4I A;  4HIM A;  2A68 C;  1FGB D;  4CKB A;  2BE5 D;  2N55 A;  1PMR A;  4JG2 A;  1B53 A;  4C2M B;  4IFD J;  1SYD A;  1K8O A;  2Z6K C;  5KNB A;  2LKV A;  2CQA A;  3K57 A;  3J7Z C;  1SLJ A;  2LS0 1;  1Y8P B;  4YHH L;  5JAV A;  4LF4 Q;  3D4R A;  4X6A H;  3LWE A;  3CPF A;  5JOB A;  2L0C A;  4EQ5 A;  1I4G A;  2K7V A;  5EAY A;  3OW2 A;  3FKI H;  3TME A;  1ZXT A;  4GNX A;  3MFG A;  4LK1 C;  1WTP A;  2E75 C;  2K28 A;  5EKI A;  4AYB B;  4LF6 Q;  5D14 A;  2QCP X;  1KDC A;  1BCP F;  4JI1 L;  2NN6 H;  4KN7 C;  4JI8 L;  4Q5V A;  3GV3 A;  1EWC A;  1HNW Q;  2FHT A;  3CCU A;  3HOX B;  2K52 A;  3LX0 A;  1ESF A;  3G71 A;  1HTL D;  2JE6 I;  1DOL A;  5E3F A;  4CJ0 B;  3N52 A;  2F0U A;  5BR8 Q;  2VXW A;  4ZQ3 A;  3VYS A;  1II3 A;  5CV4 A;  5HGQ A;  1RJT A;  1TU2 B;  2A69 D;  3A5U A;  1L0W A;  2I5M X;  3G6J B;  4LWC A;  3V05 A;  3S15 B;  2F0D A;  3PIO 3;  2HDL A;  3K0X A;  2SNS A;  1QVF A;  4HED A;  3NBI A;  1T5X D;  3HGB A;  1HQM C;  1I4Q A;  2D0P A;  2F0E A;  1XMQ Q;  4IN3 A;  4JI2 L;  2UUC L;  2WKC A;  3DXJ C;  1N34 Q;  4G7H C;  4ZKC B;  3S14 H;  2Z1C A;  3ERO A;  3TEH B;  3SK8 A;  4MNO A;  2EYM A;  3S2D B;  3J81 i;  2CW0 D;  2EQS A;  3SK4 A;  2KHJ A;  4QL5 A;  1RKN A;  2SDF A;  2MNA A;  2NVQ B;  4CDF C;  4K8I A;  4K5W A;  3SHL A;  4X66 L;  1VQP A;  4L5R C;  3HOU H;  4IPD A;  3J7Y W;  1GUO A;  1GD7 A;  2L1B A;  1S5C D;  3I4M G;  2L12 A;  4KY6 A;  3CC2 A;  3J81 j;  1AZQ A;  1WD1 A;  3T1H Q;  1E2V A;  2ID0 A;  3QOL A;  1IKM A;  3CW2 C;  1KNE A;  5IP7 G;  1DM0 B;  2HQL A;  1K83 H;  1Q1E A;  2WII B;  5I6W A;  4HJ5 A;  1Y14 B;  2X69 A;  3H0G H;  4RGO S;  3R8B A;  3J80 c;  2R7Z H;  1N8R C;  1EYA A;  2E2H B;  1TKW B;  2DY8 A;  2JQO A;  2K75 A;  3P75 A;  5K36 G;  4A3D G;  4X64 L;  4YIJ A;  1H95 A;  3SR1 A;  3I91 A;  1WTX A;  1QUQ A;  1I4X A;  3GTO B;  3F1Z A;  2SNM A;  2VNU D;  3S17 B;  4PNY A;  4RKL A;  2EY1 A;  2F0K A;  2ZTC A;  1XPU A;  1RIP A;  3PIP 3;  2R7Z B;  2R92 H;  4QIW E;  1BVS A;  3W2D A;  4H02 A;  2PZT A;  3MXN B;  1AH9 A;  2WIN B;  1HNX L;  3G7L A;  1EWH A;  1G29 1;  4BY1 H;  4KY7 A;  4NKL A;  3H0G G;  1ASZ A;  3DM3 A;  3UE1 A;  2PYK A;  2ZM6 Q;  5CYU A;  4JI0 L;  1ML0 D;  5DEH A;  1B8A A;  2RDF A;  3DHQ A;  1KAA A;  2UXD Q;  4G4K A;  2EY6 A;  1X3G A;  4XQJ A;  4OXP A;  3BZD B;  2B2V C;  1CKM A;  1NMG A;  1O7Y A;  4R1J A;  5FO8 B;  4RGM A;  2J0T D;  3N6R A;  3IAY A;  1QNK A;  3TZU A;  1OXS C;  5JPM C;  2HQE A;  3STB D;  4A3F B;  5C4X B;  2E2J B;  2GVB A;  3J80 L;  1XMO L;  1U0L A;  4B3R Q;  3SVM A;  1AE3 A;  5ELD A;  2B2T C;  4DAP A;  2Q2H A;  3H09 A;  4LF8 Q;  1PFS A;  4AQY Q;  2JP1 A;  2AUJ D;  4BY7 B;  4ZUJ A;  3VA5 A;  1HH2 P;  1PYS B;  1TS3 A;  2E2J H;  1PTO D;  2RCF A;  4U68 A;  2OXP A;  5M3M H;  5M5X H;  3AFP A;  4RHS A;  4C2M H;  1LAC A;  5JJI A;  3GTL B;  1EY7 A;  4WRD A;  4EVO A;  2JA6 G;  2EJG C;  4JOI A;  1G91 A;  1PYB A;  4LFC L;  2IX3 A;  2E2D C;  1C48 A;  3Q23 A;  1HHV A;  4BS9 A;  3NEM A;  1LM0 A;  1VMC A;  4RG1 A;  2HT1 A;  2HHH L;  3CF5 A;  3FEW X;  1PA6 A;  1XNR L;  2H4O A;  1XPR A;  4CJ1 B;  1LTT D;  2E5L L;  1TWA H;  1K83 B;  1Q8K A;  2ZJQ A;  2K5V A;  3AFQ A;  1DXM A;  2N78 A;  1YI2 A;  2R7Z G;  1IW7 C;  5IYB H;  5ISR A;  3F2D A;  2UXC L;  4FXK C;  2K33 A;  1NSN S;  1HZ9 A;  2B2V A;  3BVZ A;  4FF3 A;  3PUX A;  3SXH A;  4F88 A;  2F0L A;  1VQI A;  2I46 A;  1VQ5 A;  2RSN A;  3PF5 A;  1HPC A;  2MP1 A;  3D6C A;  5HY6 A;  1A3U A;  1I50 B;  1VQK A;  1HNX Q;  4E6I A;  1STE A;  3K5O A;  4A93 B;  4L5T A;  2KEE A;  1KIX A;  1IBM L;  3DM1 A;  1I4R A;  2CQO A;  4DKA C;  1UEB A;  1TWH B;  2WAQ B;  1LT4 D;  1HTP A;  4B3T L;  4NXN Q;  2H1E A;  2WFW A;  3EN2 A;  4IAL A;  2N8N A;  2A73 B;  1ET6 A;  1J6Q A;  2CFM A;  4QY7 A;  3X3M A;  3EQL C;  3ULP A;  1YEZ A;  5EKK A;  4Z9C B;  1SND A;  4J6H A;  5IWA L;  4BBR G;  1M90 C;  3AB9 A;  5KNC A;  2MO1 A;  1BF4 A;  4DV7 L;  4HID A;  1I3Q H;  1E24 A;  3CRK C;  1HQR D;  4KD3 A;  3PCO B;  4C3I H;  2B2W A;  1SYF A;  1VS0 A;  3PUV A;  4JBW A;  1I6H H;  1NJI C;  3TQY A;  1K73 C;  4CJ2 C;  3HKZ G;  5BN3 A;  1XXG A;  1EZ6 A;  5EBC A;  4MTN A;  3NTK A;  5AJ3 Q;  4J15 A;  4FF1 A;  1Y8O B;  5AFW A;  3F2U A;  4JI1 Q;  4M1U B;  4IOC A;  3A5Z B;  1F2Y A;  1A15 A;  3U50 C;  4IPG A;  4EQO A;  2R92 G;  1EL0 A;  5IGD A;  1NAP A;  1KDA A;  4A3B G;  4B3M Q;  4K6D A;  4HTH A;  3I8Z A;  3ZJY C;  4MZ9 A;  3A54 A;  2JA6 H;  1VQF A;  4LF4 L;  2QKI C;  5IY0 A;  5EPL A;  3TZD A;  5JVG 3;  1V1P B;  3NWS A;  4GKK L;  4PZ6 A;  4K0K Q;  2F0W A;  4LFA Q;  3TP7 A;  4UP8 A;  5EPK A;  3OMC A;  3CXC A;  2R7D A;  1BDO A;  3BU2 A;  4P74 A;  4ZUI A;  3CCL A;  3MHB A;  5CMD A;  1JB3 A;  3BZK A;  1IKL A;  4B08 A;  1F2M A;  4R8I A;  2Z6B A;  1I5F A;  2F52 A;  3ND8 A;  2XIW A;  3NE5 B;  2BCO A;  5BR8 L;  3S2H B;  3D4D A;  3HOZ G;  4JI6 L;  4CBV A;  1VQA A;  3KLS A;  3A8J E;  2K5D A;  2Q2T A;  4BBS B;  3CCJ A;  1JB7 A;  2IPK D;  3HKZ B;  3HZX A;  4ILW A;  1V43 A;  2F03 A;  4BA2 I;  2XTI A;  3S1Q B;  1N32 L;  5T1G A;  3OWF A;  3KLW A;  2FXQ A;  1CK1 A;  5ELN A;  4GOP C;  1DGS A;  1SYG A;  4TSS A;  1XX8 A;  3RMH A;  4K5X A;  2PQA B;  1FVI A;  1VF5 C;  4OWX B;  4EX5 A;  1EU3 A;  4HIK A;  5CR3 A;  5DAU A;  3MEH A;  2B2W C;  4KKU A;  2I0Q A;  3KOJ A;  5C4J B;  3I4N G;  5CBE E;  2B63 H;  2ZM6 L;  1Q82 C;  1KDB A;  1PHJ A;  4RAU C;  5G3L F;  2BA0 A;  4EQN A;  1TWC B;  1FYC A;  2HDM A;  2PI2 E;  4QQB X;  3T1Y Q;  3K7U C;  1RHP A;  1HZA A;  4OGQ C;  5C3W A;  4X65 L;  4DXG A;  4QGU A;  1KNA A;  4ZYS A;  2MJ8 A;  3U9S A;  1ZYR D;  3KLR A;  1LT5 D;  1EIG A;  3UDG A;  3K5N A;  1V1P A;  3EA6 A;  2Q8R E;  1KRS A;  2K5N A;  4GLV B;  4C3J B;  1MSG A;  5JEA J;  4JI3 L;  3GTJ H;  2OWO A;  1RTN A;  1BCP B;  3CU7 A;  1U9R A;  5CV5 A;  3GTP B;  1CA6 A;  4OWT B;  1YIJ A;  1W6J A;  1IYJ B;  1VQB A;  3KBG A;  3P20 A;  3C3L A;  5KYI A;  5A2Q E;  1HXY D;  2L4N A;  3L2P A;  1NUC A;  1XNR Q;  4GS3 A;  2AQ1 B;  2OQ0 A;  3M3Y B;  3I4N B;  2NUC A;  4LF9 Q;  1PTO C;  4BXX G;  1CSQ A;  1JR0 D;  1SYB A;  1Q12 A;  3K59 A;  1X6O A;  1DCZ A;  5FO7 B;  4B9X A;  4GN4 B;  1NTG A;  1DZ1 A;  3CCV A;  2MGS A;  3DWA A;  3CCR A;  3UE0 A;  3SGI A;  4JPB W;  5C5M A;  2V4D A;  1IZ6 A;  4QCL A;  4DNR B;  1BXT A;  4DV2 L;  1PTO F;  3S16 B;  3KJO A;  3E9H A;  1RD9 D;  1S5F D;  1IBK Q;  4X3T A;  3KF6 A;  4KI0 A;  4R4C A;  5DM7 3;  3J80 i;  3NEL A;  4ID6 A;  2F0Q A;  1K0R A;  1H9S B;  3K5M A;  2RA4 A;  1L1O B;  1I3Q B;  3S1N B;  5CBA E;  1OXT A;  1Q8I A;  3MXP A;  2JA8 H;  2RBM A;  1A63 A;  2KEC A;  4C3I B;  2QGQ A;  4ZLT F;  4PG3 A;  1E1T A;  1X3P A;  1A62 A;  2VS1 A;  4FVM A;  3MXN A;  4KLK A;  2RVL A;  2PQA A;  4V0B A;  4F87 A;  4OO1 H;  1I4P A;  1IHZ A;  4DN4 M;  3M85 A;  1VQJ A;  3G48 A;  4DR3 Q;  1UUP A;  3E0E A;  3FMC A;  1KRT A;  2UXB Q;  1QB5 D;  4N9P A;  5GRO A;  1QVC A;  4KHZ A;  3O13 A;  1B2T A;  3DUZ A;  4JI3 Q;  4JW0 A;  1B9N A;  5J22 A;  3PSI A;  4UP9 A;  4WJ3 M;  1VQC A;  1N36 Q;  2HUG A;  2F0J A;  1SNM A;  1W3S A;  1X54 A;  2NVY B;  4OWW B;  1SMY D;  2K5W A;  1D1I A;  1I50 H;  2NB0 A;  3Q8D A;  4JVZ A;  3TP6 A;  5IYC G;  4YHH Q;  2KA7 A;  4O0A A;  3I3C A;  3HOW B;  5J39 A;  3RNU A;  4CDC C;  5C44 H;  1SNQ A;  2F4I A;  3HKS A;  5IP9 G;  4A3F G;  1PFN A;  2NN6 G;  1T9H A;  4KK7 A;  2PCF B;  2JEA I;  5IGE A;  1S72 A;  3EJI A;  1LT3 D;  1PRT B;  4DXF A;  4B3S Q;  4APV A;  3ER0 A;  3OWE B;  1Y8N B;  3M7G A;  1SE2 A;  1SNO A;  2R3Z A;  2F4V Q;  1WTO A;  3DEO A;  3HRZ C;  4IFD G;  3K5L A;  2BA1 A;  4A76 A;  1UAP A;  1FR3 A;  1OO9 B;  1HUN A;  4ME3 A;  5M5X B;  1GUS A;  3S1Q H;  1Q46 A;  2K14 A;  4XYQ A;  1Y1V H;  3S1R B;  2VQF Q;  3GTK B;  1UE1 A;  4YWK A;  4HJA A;  2KCN A;  3BJU A;  3W5O A;  1LTB D;  1EYG A;  1YJN A;  3TS0 A;  3S2H H;  3MTS A;  1B3A A;  3CME A;  1GHK A;  2UUB L;  2HIV A;  2JA5 H;  1EYC A;  3URY A;  1SRU A;  2F0M A;  1X3Q A; 
#chains in the Genus database with same CATH homology
 3CPW A;  1SN8 A;  1BKB A;  1FJG Q;  3TS2 A;  4GKJ Q;  4JI2 Q;  5IWA Q;  4HJ7 A;  1ASY A;  3RN5 A;  2UXD Q;  2A19 A;  1X3G A;  4OXP A;  4JV5 L;  4A3K H;  1CKM A;  3JAM i;  1NMG A;  2VW9 A;  2E8G A;  3HOX G;  4LFC Q;  3I56 A;  2VUM H;  4R1J A;  2Z6K A;  1VQE A;  5FLX c;  1G6P A;  1LUZ A;  2KHI A;  1TWC H;  2VZA A;  1VQL A;  4GN5 A;  4LF5 Q;  1OXS C;  4A3I H;  3STB D;  2RHQ B;  3EBE A;  4YWL A;  2GVB A;  1XMO L;  4BY1 G;  1U0L A;  4B3R Q;  4GLX A;  2KBN A;  3PUW A;  5M5W H;  3D31 A;  1AE3 A;  4R4Q A;  4IPH A;  4NXM L;  4BXX H;  5JEA G;  2IX0 A;  2JEB I;  3HOV G;  2Q2H A;  1K8G A;  1YNX A;  2VY3 A;  5M3F G;  2XGT A;  4X62 L;  2A8V A;  4LF8 Q;  2UUB Q;  1PFS A;  3KF8 B;  4AQY Q;  5C4J H;  4LNQ A;  4A3C H;  1HNW L;  1JT8 A;  3OTO Q;  3M9B A;  1D8L A;  1MJC A;  1HH2 P;  3WWV A;  1BBU A;  1IBK L;  1O7I A;  1XTD A;  4NPS A;  4JI8 Q;  1PYS B;  1HNZ L;  1K9M C;  1CKN A;  2YYZ A;  4DV4 Q;  2E2J H;  1HR0 W;  2UXB L;  4YCV A;  2WB1 G;  4NXM Q;  4DR3 L;  2AWN A;  2ASB A;  4TVA B;  4YY3 L;  2RF4 A;  5M3M H;  5M5X H;  1XMO Q;  2L15 A;  4AIM A;  4DR7 L;  3I2Z A;  3AFP A;  4LUV A;  3LGJ A;  1KL9 A;  1GVP A;  4C2M H;  2EXD A;  5JJI A;  3K81 C;  2UU9 Q;  4BY7 H;  2MFI A;  3OTO L;  3S1N H;  2JA6 G;  2NVY H;  1HZC A;  3RLN A;  4JOI A;  1KAW A;  1SRO A;  2JA7 G;  4X64 Q;  1PYB A;  4LFC L;  4A3G G;  3NEM A;  1LM0 A;  2YTX A;  4RG1 A;  1HR0 Q;  2HT1 A;  2NN6 I;  2HHH Q;  1XNQ Q;  4OO1 I;  1JJC B;  1VQ7 A;  2Y0S G;  3A0J A;  2DGY A;  2HHH L;  1D7Q A;  1L2F A;  5IT9 c;  3CF5 A;  1YIT A;  1PA6 A;  1XNR L;  1XPR A;  2E5L L;  1TWA H;  3GD7 A;  1MIU A;  4LF5 L;  1KQS A;  1Q8K A;  4GLA C;  2ZJQ A;  3CMA A;  3PO3 H;  4DAY B;  2K5V A;  1OXV A;  1GKH A;  2OCE A;  3S2D H;  3S1M H;  3HFZ B;  3AFQ A;  2N78 A;  1EFW A;  1YI2 A;  4JV5 Q;  2R7Z G;  5IYB H;  3F2D A;  2UXC L;  4GNX C;  1HZ9 A;  4RMF A;  1X9N A;  2NZO A;  1WI5 A;  3CC4 A;  4GKJ L;  3KDF A;  3PUX A;  2LXJ A;  2VQE L;  3RN2 A;  1WOC A;  2KCM A;  4B3T Q;  4OX9 L;  4C3H H;  1VQI A;  3S15 H;  1BBW A;  1TWH H;  1UWV A;  1VQ5 A;  3L0O A;  1VQ6 A;  4KHP Q;  2PI2 A;  5JJK A;  3PF5 A;  1JJG A;  5HY6 A;  1VQK A;  3U58 A;  1HNX Q;  4JYA L;  4A3J H;  1X56 A;  4X65 Q;  1N9W A;  2JA9 A;  3RLO A;  1N33 L;  3H3V I;  5LMN L;  1Y1V G;  4X62 Q;  1EOV A;  4UPA A;  1I94 Q;  4L5T A;  4NB3 A;  3HKZ E;  1KIX A;  1Z9F A;  3IRB A;  1C7Y A;  1IBM L;  4LF9 L;  1L1O C;  2NZH A;  3M3Y H;  4A3C G;  2CQO A;  4DKA C;  3GDE A;  3EIV A;  1UEB A;  1YVC A;  1UE6 A;  4A3I G;  2F3I A;  3DLL A;  4HJ8 A;  3KYH C;  3CAM A;  4B3T L;  4NXN Q;  3U4Z A;  2WFW A;  3EN2 A;  1IL2 A;  4LFB L;  4JBM A;  3J81 c;  2AMC B;  2N8N A;  4P72 A;  1YZ6 A;  5C44 G;  1VQH A;  5JJL A;  3NBH B;  3NEN A;  1J6Q A;  5LMN W;  2CFM A;  4QY7 A;  4DV0 L;  1WCM H;  4DV3 L;  3A74 A;  4AH6 A;  3ULP A;  1YEZ A;  4A3E G;  1V9P A;  1YJW A;  2UXD L;  4LUO A;  2HIX A;  3PGZ A;  5IWA L;  4BBR G;  1M90 C;  3CP0 A;  2MO1 A;  1FJG L;  2JA7 H;  4LUZ A;  2K50 A;  4DV7 L;  4HID A;  1I3Q H;  1E24 A;  3S2H H;  3BZC A;  3HOW H;  3TRZ A;  3K7A H;  4UY8 C;  2MO0 A;  3PCO B;  1KHI A;  1PH7 A;  4C3I H;  2JJQ A;  5GAH C;  3JAM c;  3PUV A;  1VS0 A;  3PV0 A;  4JBW A;  1VQO A;  1PH2 A;  1IBM Q;  4OO1 G;  1NJI C;  3TQY A;  1JE5 A;  4BBR H;  5C4X H;  3F2B A;  4DPG A;  1K73 C;  1J5E L;  3ULJ A;  1I94 L;  3HKZ G;  4IPC A;  3HOX H;  2OTL A;  1MJE A;  5C0X J;  5FJ8 G;  1N33 Q;  2VQF L;  3GO5 A;  3AQQ A;  4MTN A;  5AJ3 Q;  4J15 A;  4DR6 Q;  3PUY A;  1EQR A;  1TXY A;  3J7A 5;  2I5H A;  1X3F A;  3E9I A;  1WJJ A;  4JI1 Q;  2ZTE A;  4OX9 Q;  3I4M H;  1NMF A;  4YY3 Q;  4DV2 Q;  2VQE Q;  3A5Z B;  4IOC A;  2OQK A;  3F2C A;  3U50 C;  4HIO A;  1QVG A;  4IPG A;  2R92 G;  3F8T A;  1N36 L;  3PO2 H;  1VQ9 A;  4PZ7 A;  4TQU S;  4A3B G;  4B3M Q;  1OXX K;  2IHE A;  1PH8 A;  1A8V A;  4GOP B;  1PVO A;  5C0X I;  3ZJY C;  4MZ9 A;  4JI4 L;  3PIO A;  3PO3 G;  1YHQ A;  2AHO B;  2JA8 G;  2JA6 H;  1VQF A;  4LF4 L;  4LF8 L;  5C4X G;  2JA5 G;  4BY1 H;  3GTL H;  3AYH B;  1B70 B;  4YCU A;  5IY0 A;  5IYD G;  1N34 L;  4PZ6 A;  2UUC Q;  4GKK L;  4K0K Q;  1TWG H;  4DV5 L;  1EUJ A;  3GTK H;  4LFA Q;  3CC7 A;  4UP8 A;  4A3F H;  4DR1 L;  4YWM A;  2IY5 B;  3CXC A;  1HR0 L;  3H15 A;  2V1C C;  2R7D A;  3KDF B;  4L5S A;  3GTQ H;  2CWA A;  1Q7Y C;  3BU2 A;  4P74 A;  4IO9 A;  4BY7 G;  4OON A;  4LF7 Q;  3CCL A;  1Q81 C;  2R93 H;  3T1H L;  3BZK A;  4A3J G;  4DUZ Q;  3RZD H;  2NVT H;  3CCM A;  2YU9 H;  2GN5 A;  3PF4 A;  1JJ2 A;  3CD6 A;  4DV6 L;  4A3L G;  2QEX A;  2ATW A;  1I5F A;  3HOY H;  1S3O A;  4DR5 Q;  1IBL Q;  2F52 A;  2OTJ A;  4DR2 Q;  4LF6 L;  2R93 G;  3GTM H;  1SE8 A;  5ELO A;  5BR8 L;  2BH8 A;  4JI0 Q;  1CSP A;  1LTL A;  4JI6 L;  3HOZ G;  1VQA A;  1EWI A;  2DUD A;  5LMU Q;  1KXL A;  2WAQ G;  4JOI C;  1E7Z A;  1P8L A;  4WJ4 A;  4Y52 H;  2RCN A;  2WB1 E;  4A3M H;  3STB C;  5DLQ E;  1M1K C;  4DR5 L;  1IBL L;  2Q2T A;  1E1O A;  4YCW A;  1VCI A;  4DK6 C;  3CCJ A;  2D62 A;  3D0F A;  1JB7 A;  4GOP A;  2PMZ E;  3RZO H;  1MKH A;  1OXU A;  3U4V A;  1YBY A;  1V43 A;  4BA2 I;  2XTI A;  3HOW G;  2ZTD A;  1G51 A;  1I6H H;  1N32 L;  2H5X A;  1J5E Q;  5FLM H;  3KLW A;  2FXQ A;  4O2D A;  5ELN A;  3G6E A;  4GOP C;  1DGS A;  4JI7 L;  2Y0S E;  2LSS A;  3RLF A;  4A93 G;  4BBS H;  5C3E H;  1FVI A;  2K5H A;  2PQA B;  1P16 A;  1NE3 A;  4OWX B;  2K4K A;  4EX5 A;  4ALP A;  1PH5 A;  3HOZ H;  2B63 G;  1CKO A;  3GTO H;  4A3B H;  3W1B A;  4HIK A;  1CUK A;  3G4S A;  1PH4 A;  5C0X G;  2I0Q A;  1FGU A;  3KOJ A;  4FDB A;  3M4Q A;  3HOV H;  3I4N G;  3S1R H;  3PIP A;  2ZM6 L;  2B63 H;  1Q82 C;  4A3D H;  5M5Y H;  4P75 A;  1PH3 A;  3KFU A;  1PHJ A;  4JI7 Q;  4JI5 Q;  1YHA A;  1Y1W G;  4NXN L;  3PUZ A;  3TRE A;  1QUQ B;  1N32 Q;  2ES2 A;  2NVX H;  2BA0 A;  3KF6 B;  1SR3 A;  2CWP A;  2PI2 E;  4QQB X;  4JCV E;  3T1Y Q;  1K8A C;  3K7U C;  4LW1 A;  4IFD I;  2UUA L;  5M3F H;  5J3B A;  4DK3 C;  1HZA A;  2WP8 J;  5M3M G;  4AYB G;  1Y1W H;  4X65 L;  3UDI A;  4QGU A;  4JI5 L;  2D0O A;  1X3E A;  3UDG A;  2CCZ A;  5LMU L;  1XPO A;  4KHP L;  1PH1 A;  3M7N A;  1RL2 A;  3ULL A;  3CCE A;  1VQN A;  1UE5 A;  5IYC H;  1A0I A;  3S24 A;  1JMC A;  1KRS A;  2K5N A;  2B29 A;  2AKW B;  4GLV B;  4P73 A;  3VDY A;  3T1Y L;  1OTC A;  3GTJ H;  5JEA J;  5GQO A;  4JI3 L;  1SFO H;  2E2I H;  2OWO A;  4IOA A;  1TWF H;  1HJP A;  4PMW A;  4JBJ A;  3K80 C;  1EQQ A;  2UXC Q;  2GVA A;  1VQ8 A;  1XJV A;  4B3S L;  4R4I A;  4HIM A;  4OWT B;  1YIJ A;  1IYJ B;  4IJH A;  3CCQ A;  1VQB A;  2AWO A;  3H3V H;  4POG A;  4DUZ L;  2ZJP A;  4JG2 A;  1XMQ L;  4LF7 L;  4IFD J;  4DR4 L;  1NBW A;  3L2P A;  3L7Z C;  1XNR Q;  4GS3 A;  2OQ0 A;  2Z6K C;  1HZB A;  2N3S A;  4A3E H;  2E2H H;  4LFA L;  5H1S E;  4DV5 Q;  4LF9 Q;  4A4I A;  3J7Z C;  1CKN B;  1EIY B;  4BXX G;  1SLJ A;  1CSQ A;  3W1G A;  1VQG A;  4YHH L;  1Q12 A;  3FP9 A;  1X6O A;  5LMN Q;  1S40 A;  4LF4 Q;  1Q86 C;  1KC8 C;  5IP7 H;  4JC0 A;  4X6A H;  4GN4 B;  1NTG A;  3CQZ H;  3CPF A;  3CCV A;  2UU9 L;  4EQ5 A;  4R4O A;  3CCR A;  3UE0 A;  5EAY A;  4B3M L;  4Y7N H;  3SGI A;  3GTG H;  3OW2 A;  3I4N H;  3FKI H;  4GNX A;  5GAD C;  1QZH A;  1LYL A;  1C0A A;  4IJL A;  1IZ6 A;  4R4T A;  4DR2 L;  4LF6 Q;  5GAG C;  5IP9 H;  4DV2 L;  4JI1 L;  3KJO A;  4A3L H;  1E22 A;  3E9H A;  4JI8 L;  4A3K G;  1FL0 A;  1IBK Q;  4L5Q A;  3KF6 A;  4KI0 A;  4R4C A;  1HNW Q;  2Q2U A;  2ALY B;  3J80 i;  3NEL A;  4JBK A;  3CCU A;  1K0R A;  2K52 A;  3G71 A;  2E5L Q;  4JI6 Q;  2JE6 I;  4A3G H;  1L1O B;  2IHF A;  1V1Q A;  5BR8 Q;  4DUY L;  1OXT A;  2YTY A;  3I55 A;  1L1O A;  1VQD A;  1PH9 A;  2JA8 H;  4B3R L;  1A63 A;  1XNQ L;  4A93 H;  5HGQ A;  1X55 A;  2QGQ A;  4C3J H;  3A5U A;  4DV6 Q;  3AEV A;  4PG3 A;  1YHB A;  1E1T A;  1L0W A;  2CKZ B;  1A62 A;  2I5M X;  4XTC S;  2VS1 A;  4LWC A;  3M4O H;  1U5K A;  4KLK A;  2IT1 A;  5IE8 A;  2ZJR A;  2PQA A;  3K0X A;  4DUY Q;  1EIF A;  1QVF A;  4POF A;  1WCM G;  3MEF A;  4DR4 Q;  3RR5 A;  1X65 A;  2D0P A;  4UP7 A;  3M85 A;  1XMQ Q;  3ICE A;  2IX1 A;  4DR7 Q;  5FJ8 H;  4GNX B;  2C35 B;  1VQJ A;  3G48 A;  4JI2 L;  4BBS G;  4DR3 Q;  2UUC L;  1N34 Q;  4GKK Q;  4K0K L;  3E0E A;  2QA4 A;  3S14 H;  2Z0S A;  1KRT A;  2UXB Q;  2WAQ E;  3TEH B;  3HOY G;  2R7F A;  4MNO A;  5GRO A;  1QVC A;  3M4P A;  1HNZ Q;  4KHZ A;  3J81 i;  2EIF A;  2I5L X;  3ERS X;  2EQS A;  4PZ8 A;  4JI3 Q;  4DR6 L;  4DAM A;  1VQM A;  2VUM G;  4JI4 Q;  5AJ3 L;  1KD1 C;  2KHJ A;  4QL5 A;  4AQY L;  3JC6 6;  2MNA A;  2KEN A;  5GAE C;  3PSI A;  4UP9 A;  4WJ3 M;  1VQC A;  1N36 Q;  1W2B A;  4X66 L;  1VQP A;  4A3M G;  4L5R C;  3HOU H;  2A1A A;  4IPD A;  1W3S A;  1X54 A;  1GD7 A;  4P71 A;  3B6Y A;  1UE7 A;  4OWW B;  1VQ4 A;  3I4M G;  2UUA Q;  3FHW A;  4YHH Q;  1I50 H;  3Q8D A;  4DV7 Q;  5IYC G;  1SMX A;  1IXR A;  4O0A A;  3CC2 A;  3S16 H;  3J81 j;  3RNU A;  3S17 H;  3I7F A;  5C44 H;  3HKS A;  4GN3 B;  5IP9 G;  3T1H Q;  4A3F G;  3HOU G;  2F4V L;  1B7Y B;  2ID0 A;  2NN6 G;  2VL6 A;  1T9H A;  4DV0 Q;  3CW2 C;  1R9T H;  5IP7 G;  1Z47 A;  2RHS B;  3KJP A;  4DNI A;  4DR1 Q;  2JEA I;  2HQL A;  2KCT A;  1S72 A;  5C3E G;  1K83 H;  1WYD A;  5IYD H;  2JK8 A;  4B3S Q;  2LXK A;  2NVQ H;  4APV A;  2PNH A;  4DV1 L;  1Q1E A;  3ER0 A;  4HJ5 A;  3K8A A;  1Y14 B;  3H0G H;  4DV3 Q;  4AYB E;  2BH2 A;  3J80 c;  2R7Z H;  4HJ9 A;  1N8R C;  5K36 G;  2JQO A;  1Q1B A;  2K75 A;  4BA1 I;  2F4V Q;  1AE2 A;  4A3D G;  4X64 L;  1YJ9 A;  4IFD G;  1H95 A;  2BA1 A;  1NY4 A;  2YTV A;  1PH6 A;  1QUQ A;  4LFB Q;  3CCS A;  2YV5 A;  1K3R A;  2B3G A;  3F1Z A;  4A76 A;  2VNU D;  1WFQ A;  4ME3 A;  2Q2I A;  3I4O A;  3OYY A;  1GO3 E;  2ZTC A;  1XPU A;  3S1Q H;  1RIP A;  5E7N A;  4X66 Q;  2MQH A;  2R92 H;  3PO2 G;  4QIW E;  1Q46 A;  2K14 A;  1Y1V H;  2VQF Q;  2N49 A;  1BVS A;  1UE1 A;  4YWK A;  4DV4 L;  4H02 A;  4HJA A;  3MXN B;  3BJU A;  1PV4 A;  1AH9 A;  3W5O A;  5FLM G;  5IYB G;  1EYG A;  1HNX L;  4JYA Q;  1YJN A;  3GTP H;  1C9O A;  1G29 1;  4A75 A;  3TS0 A;  1QZG A;  1E3P A;  3CME A;  1GM5 A;  3H0G G;  4QJF A;  1ASZ A;  2UUB L;  3DM3 A;  2HIV A;  4DV1 Q;  3UDF A;  3UE1 A;  2JA5 H;  2ZM6 Q;  4XIG S;  3FKI G;  4JI0 L;  2R6G A;  1SRU A;  3UDX A;  1B8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...