4GLVB

Obody am3l09 bound to hen egg-white lysozyme
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 23
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glvB00
1UE5A 4R4CA 3A5ZB 5GAHC 3VDYA 1J5EL 4A3FH 3H3VH 4LFBQ 4LF4L 3MXNB 1YJ9A 1EOVA 4IJHA 1VQIA 2D0PA 3CC2A 4OO1I 4A3EG 2VQFQ 4DV3Q 4GLXA 3T1YQ 2NN6G 3HKZE 1CSQA 1AE2A 2JK8A 1SFOH 1PYBA 3I4MG 1E1TA 3G4SA 2E5LQ 1E22A 3U50C 3TQYA 4APVA 4YHHL 3L2PA 4HJ7A 1VQLA 2MFIA 4QY7A 2PNHA 1YI2A 3K7AH 2H5XA 4JI6L 1VQ6A 4YWMA 4DR1Q 4R1JA 1I94Q 1Q12A 4A93H 1KIXA 1Y1VH 4AH6A 1VQMA 2BA1A 1HR0L 3KJOA 2R93H 2JA6H 2CWAA 2Q2HA 1RIPA 4LFAL 3M7NA 1EWIA 2NZOA 1YZ6A 2PMZE 2ES2A 2HT1A 2VY3A 1YEZA 4YCUA 3HOVH 4DR3Q 2RCNA 4FDBA 5IY0A 3UE1A 3PIPA 4LF5L 4TQUS 1BVSA 3I4OA 4DV6Q 3RNUA 3HOXG 4B3ML 2UXBQ 1OXTA 4LF9Q 4C3IH 2UXBL 1VQPA 2R92G 1N36Q 1QUQB 1G6PA 4POGA 4A3CG 1N36L 3CCLA 4EX5A 1N9WA 2BH8A 1PH9A 3J7A5 2EQSA 1IBKQ 1QVFA 2I5HA 3A0JA 3I4NG 4DV4Q 1JB7A 3ICEA 3GTOH 4DR4Q 3PIOA 1XPRA 4LUZA 2VQEL 3Q8DA 1SRUA 4R4QA 5C4XH 5IWAL 1FVIA 4L5RC 2YYZA 5M5WH 1L1OB 1HH2P 3JAMc 1WCMG 4X62Q 1I50H 3GTGH 4A3LG 4YCVA 4GKKQ 1N33Q 4R4TA 1Z47A 1C7YA 4X65L 2B63H 1EUJA 1QUQA 2JA7G 4HJAA 4GKJL 4YCWA 1W2BA 1PV4A 4XTCS 3J80c 4JBJA 1QZGA 1KC8C 2NZHA 2UUBQ 3FKIH 1X65A 3E0EA 5HGQA 1PH4A 1A0IA 2ID0A 1Z9FA 5GQOA 1OXVA 3H0GG 2CQOA 4P74A 4LF8L 1HJPA 3M9BA 4A3KH 1Q86C 4DV1L 1AH9A 1BBUA 4EQ5A 1WFQA 1L1OA 1IBLL 4JOIC 2WB1E 2MO0A 3ULPA 4K0KQ 2A19A 4Y52H 2UXDQ 2Y0SG 1Y1WG 4LUOA 4C3JH 2GVAA 4JI7Q 4B3RQ 4LWCA 5AJ3Q 3U4VA 3CPWA 2I5MX 3M4QA 4BBSG 3STBC 1C9OA 1TWGH 1XNQQ 4QJFA 1HNWQ 4A3EH 1A63A 3OTOL 4YY3Q 3TEHB 4HJ5A 3HOZG 1VQCA 1WYDA 3W5OA 3I4MH 2N3SA 3M3YH 4B3TL 3H3VI 4QL5A 2L15A 3EN2A 4HJ8A 3F2BA 1OXSC 4DV7L 4OWXB 3CCVA 1EFWA 3ZJYC 4JI3L 2N49A 4LUVA 5GADC 1BBWA 1HZCA 1VQAA 5FLXc 4KHZA 3BZKA 4GLAC 4GN5A 4OXPA 5IE8A 3CCUA 3AEVA 4JI1Q 2NVTH 2E8GA 3K8AA 4LF6Q 4O2DA 1Q1EA 3D0FA 3S1RH 1WJJA 1V43A 2AWNA 4OO1G 1MKHA 3AYHB 4DK3C 1YBYA 4BY7G 1Q82C 4A3IG 4JI2Q 4LFCQ 1D8LA 3F2CA 4A3MG 4UP9A 2F52A 1XNRQ 1UEBA 1HNXL 1XPOA 2KENA 4X66Q 1VQ4A 1B8AA 1IXRA 1IYJB 3CMAA 3I55A 1EYGA 4JI5L 1E24A 5FJ8G 4KHPQ 1NE3A 1ASZA 5JJLA 3KLWA 3PUVA 4O0AA 1PYSB 4RG1A 1PH2A 3K7UC 5C0XI 3CMEA 4A3GG 3KJPA 2CWPA 1XNRL 4DUZQ 1YITA 2ZM6Q 4HIDA 3EBEA 3I4NH 4QIWE 4LFBL 1Q8KA 1CKMA 2MO1A 2YU9H 3TS0A 1MJEA 4DUYQ 4AYBG 3RZOH 1HZBA 5E7NA 4JI8Q 1K0RA 1S72A 4BY1G 2R7FA 3HKSA 3GTMH 1WCMH 2UXCQ 2VQFL 4DV3L 3PO3H 2A1AA 2ALYB 2JEAI 3T1YL 1X54A 3HKZG 5FLMG 3PUZA 3RLFA 1KL9A 4L5TA 1L2FA 2E5LL 3DLLA 4A3JH 3HOUG 1YNXA 4PG3A 1K9MC 1UE6A 3CCEA 2IT1A 1EIFA 1K3RA 2K75A 3KYHC 5M3FH 3FP9A 4IJLA 4MTNA 5C44H 4DR1L 1GM5A 3H0GH 1I94L 1PH7A 4IOCA 2YTXA 2E2IH 1KQSA 4IPGA 2CCZA 2KCTA 1CKOA 4JBMA 3PO2G 3GTQH 3CP0A 4DPGA 3JAMi 1NMGA 2AWOA 4X64Q 3W1BA 1QVCA 2FXQA 5IYCH 3G6EA 2OWOA 5HY6A 3KFUA 1YHQA 3PV0A 4X64L 1Y1WH 1PA6A 4WJ3M 1LTLA 1MIUA 4DR3L 4LW1A 1T9HA 2NVYH 3CQZH 1R9TH 4A76A 4GLVB 2JEBI 3J80i 4A75A 3S1MH 2VNUD 2JA8G 4IOAA 4DV6L 3PGZA 4OONA 2K52A 4LF9L 4DR5Q 1A8VA 1E1OA 1KRTA 1X9NA 4IPDA 1IZ6A 5IT9c 1Q7YC 3L0OA 4DV0Q 3TREA 3HOZH 5IP7H 1VQJA 4YWKA 3G71A 4DAMA 2AHOB 1NY4A 1IBKL 1K8GA 2PI2A 2QGQA 4DV4L 4AQYQ 4JCVE 4DR4L 3AFQA 3HOYH 1PH8A 5BR8Q 1JT8A 1GKHA 2WFWA 1RL2A 2KCMA 4R4IA 2UUAQ 2UUCQ 2RHQB 3M85A 1HNZQ 3S16H 4X62L 2UUAL 4GKKL 5IYDG 1XJVA 1GVPA 5IYBG 4A3DG 4B3SQ 2CKZB 1PH3A 1N33L 3A5UA 4OX9Q 2PQAB 1Y14B 2HQLA 4IO9A 3UDXA 2KBNA 4GOPB 3S1QH 4DR7Q 3ULJA 3ER0A 3PF5A 1SE8A 4JI4Q 3TS2A 2QA4A 2HHHQ 1LUZA 3SGIA 4JI4L 2UUBL 5C4JH 2B63G 2HHHL 3RZDH 3PF4A 2EXDA 3KDFB 3MEFA 4PZ8A 1X56A 5LMUQ 4NXNQ 1I3QH 2ZTDA 2K50A 4P75A 3RLNA 1VQ9A 3TRZA 4JYAQ 1VCIA 4NXNL 5JEAG 1HZ9A 1UWVA 1JMCA 2B29A 1J6QA 1E3PA 5FJ8H 1FGUA 3J7ZC 2WAQE 4GNXB 2WP8J 3KF6B 4K0KL 3UE0A 2UXDL 2PQAA 1X55A 1NTGA 3F1ZA 5JEAJ 3CCQA 4UP8A 1L1OC 1WI5A 1L0WA 2XGTA 4GOPA 3HFZB 5AJ3L 3CXCA 2E2HH 4JI7L 4AIMA 4B3RL 3J81c 4JBKA 3I7FA 3LGJA 1NBWA 1XNQL 1VQNA 4A93G 3KDFA 5GAGC 2K5NA 4LNQA 1HNWL 2Q2IA 3T1HQ 1K83H 3U4ZA 2B3GA 3T1HL 1CUKA 3CF5A 2R93G 3RN5A 4YY3L 2MNAA 4Y7NH 4JBWA 2JA6G 5FLMH 2UU9Q 1P8LA 2ZTCA 1Q81C 1VQ7A 1I6HH 4GNXA 3HOUH 3KF6A 3FHWA 1JJ2A 3HOWG 4H02A 2I5LX 5C0XG 4C2MH 2F4VQ 5ELOA 3L7ZC 3JC66 5GROA 4DAYB 4JI0Q 5EAYA 1MJCA 2IY5B 1PVOA 3UDIA 4YWLA 1VQ8A 3BJUA 5C0XJ 1DGSA 4JI1L 4P72A 2OQKA 4LF6L 4ME3A 1VQGA 4JG2A 3RR5A 3CD6A 4UPAA 2VS1A 4DR6Q 1H95A 4LF7Q 1Q46A 4J15A 4P73A 5C3EG 1YIJA 4LF7L 5J3BA 1VQBA 5H1SE 2Z6KA 4PMWA 4JI2L 3U58A 5JJIA 4LFCL 5C4XG 1Q1BA 1AE3A 3HOXH 2JA5G 2JA8H 2ZJPA 3D31A 1X6OA 4X66L 2R92H 5DLQE 4A3CH 4IPCA 2RHSB 4KHPL 2JE6I 1XMQQ 4UY8C 3B6YA 1KAWA 1NMFA 2EIFA 4NXMQ 1VQHA 5JJKA 1TXYA 4GN4B 5LMNW 4L5QA 4DUZL 2XTIA 3FKIG 2ZM6L 3GTLH 3I2ZA 4NB3A 3OW2A 1OTCA 3PUWA 3PUYA 4DUYL 4DV2Q 4QGUA 4JI8L 4DV2L 2IX0A 1XMOQ 4A3LH 3BU2A 4NPSA 3RLOA 3GTPH 4A3DH 2UXCL 5IYDH 4C3HH 2R7DA 4DV5Q 4BXXG 2JA7H 5M5YH 3S2DH 2V1CC 1JJGA 1IBMQ 3NELA 1FJGQ 1SN8A 2BA0A 1IBML 3GTJH 1J5EQ 2E2JH 5ELNA 2N78A 1S40A 1G51A 1KHIA 1YJWA 4LF4Q 4ALPA 1WOCA 2OCEA 1JJCB 4PZ7A 4AYBE 1N8RC 3S2HH 3STBD 3AFPA 2GN5A 2VZAA 3E9IA 3K0XA 1SMXA 3GTKH 1U5KA 2YTYA 1PH1A 1EQQA 2K4KA 2Q2TA 3M4OH 4YHHQ 3K81C 4BBRG 1EQRA 1BKBA 2JA9A 1VQ5A 1PHJA 3NEMA 4OWWB 3PSIA 1FL0A 3CAMA 3IRBA 2CFMA 5M5XH 4JI6Q 1TWAH 1G291 3W1GA 2IX1A 5IP9G 4BBSH 2LXKA 1TWCH 1V9PA 4GN3B 3F2DA 4DR5L 1U0LA 4JC0A 1HR0Q 2VW9A 1M90C 3S15H 3CC4A 3M4PA 4LFAQ 4DV0L 3H15A 5M3MG 3S17H 1KXLA 2IHFA 2NVQH 3I56A 4GS3A 2YTVA 2OTLA 1VS0A 4AQYL 3HOWH 4LF5Q 2DUDA 3NENA 2R7ZG 4RMFA 1V1QA 4DK6C 4B3MQ 1D7QA 5BR8L 2NN6I 1LM0A 1P16A 2ZJQA 2UUCL 2Q2UA 3J81j 3KOJA 4TVAB 1CKNB 2YV5A 1S3OA 4P71A 1HNZL 2VUMG 1X3GA 2R6GA 4JV5L 2OQ0A 1KD1C 5GAEC 4B3SL 3J81i 1SR3A 4OX9L 1M1KC 4HIOA 1XPUA 1CSPA 1UE1A 4A3BG 1VQOA 3ULLA 2LXJA 1QVGA 2ASBA 3S1NH 4DR7L 2VL6A 1K73C 4BY7H 2Z0SA 4PZ6A 5C3EH 4A3IH 4A3FG 4R4OA 4WJ4A 2JJQA 1JE5A 2VQEQ 4OWTB 5IWAQ 5LMNQ 4A3MH 3PUXA 3CC7A 3F8TA 5LMNL 2MQHA 5LMUL 4JYAL 1PH6A 2JA5H 4MNOA 2GVBA 2K5VA 4XIGS 2HIVA 3PO3G 2WB1G 1O7IA 1CKNA 3UDFA 4X65Q 3OYYA 2A8VA 3CPFA 4GKJQ 3UDGA 1GD7A 2WAQG 2BH2A 3DM3A 4A3JG 4A3GH 1YVCA 2C35B 4JV5Q 1YJNA 4KI0A 4JOIA 1W3SA 5M3FG 2N8NA 1TWFH 4LF8Q 4DKAC 4IPHA 1GO3E 1Y1VG 3E9HA 5C44G 4DV1Q 4BY1H 1E7ZA 4GOPC 3EIVA 1IBLQ 2JQOA 4DNIA 1EIYB 4MZ9A 2AMCB 3PCOB 4BXXH 2Y0SE 2UU9L 5IYCG 4BA2I 3GDEA 2RF4A 3HOVG 2QEXA 2NVXH 1PFSA 3CCJA 2AKWB 2D62A 3CW2C 3WWVA 4HIMA 1YHBA 2ZJRA 1LYLA 1NJIC 1HR0W 2F4VL 4JI0L 4GNXC 1VQDA 3GO5A 2ATWA 1C0AA 1SLJA 3K80C 1SROA 3OTOQ 3GD7A 3BZCA 1K8AC 3PO2H 1VQFA 1A62A 1ASYA 4B3TQ 5IP7G 4KLKA 4DR6L 4QQBX 1X3EA 2LSSA 1TWHH 4BBRH 4DV7Q 1OXUA 2PI2E 5K36G 4A4IA 4X6AH 4JI3Q 3S14H 3HOYG 2I0QA 3A74A 4IFDG 5IP9H 3ERSX 1X3FA 2KHIA 3CCMA 3G48A 1N32Q 2D0OA 2OTJA 1B7YB 2IHEA 4UP7A 2Z6KC 1N32L 4IFDJ 3NBHB 1XMQL 1QZHA 1N34Q 4NXML 1YHAA 4HJ9A 3CCRA 2HIXA 1VQKA 5M3MH 1N34L 1UE7A 1XTDA 2KHJA 2K5HA 1HZAA 2K14A 4POFA 3CCSA 4HIKA 2ZTEA 4DR2Q 1KRSA 1IL2A 2R7ZH 1HNXQ 4DR2L 4A3KG 1PH5A 3RN2A 4L5SA 3AQQA 1B70B 1XMOL 5IYBH 2VUMH 4JI5Q 1OXXK 4BA1I 4DV5L 1VQEA 2DGYA 4A3BH 3S24A 3KF8B 4IFDI 1I5FA 2F3IA 1FJGL
chains in the Genus database with same CATH superfamily
4R4CA 5GAHC 1PDQA 1EZ6A 3H0GB 3H3VH 3MXNB 2KOLA 1EOVA 3J80L 2K1BA 1EY9A 1SFOH 1CSQA 2JK8A 3G4SA 1R9TB 1E2VA 1VQLA 2B2VC 2PNHA 1TVXA 3OSOA 5IGCA 5KNCA 4YWMA 4R1JA 1Y1VH 1VQMA 1SE2A 3DM1A 3KLRA 2R93H 2JA6H 1RIPA 3M4YA 3M7NA 1GUGA 2EDGA 1EZ8A 2NZOA 2PMZE 1YZ6A 5LL6X 1TKWB 1YEZA 4J6HA 4M1UB 2D2CC 2O4XA 3A8JE 5NUCA 2EYOA 1PFBA 4TQUS 2UXBQ 2UXBL 2R92G 1G6PA 1U4RA 5C4JB 1PH9A 1TIID 5I9OA 1SYCA 2EQSA 1IBKQ 1QVFA 1G2SA 2QILA 4DV4Q 1JB7A 5C3XA 3GTOH 3PIOA 1QG7A 1SSOA 5C4XH 3R2IA 1EIGA 4L5RC 2YYZA 5M5WH 3C3LA 3V96A 4X62Q 4A3LG 4YCVA 1N33Q 4R4TA 4HAEA 1C7YA 4X65L 2JA7G 1QUQA 4GKJL 2E2HB 1PV4A 2EY1A 3FKIH 4AYBB 3E3XA 1ENAA 4BWGB 2OXPA 3TMEA 1U4PA 1S4ZA 1HJPA 4A3KH 1EYCA 1CFMA 5HURA 1BBUA 4DV1L 1I6HB 5EJWA 4EQNA 5D14A 3ULPA 4K0KQ 2KUMA 2NVXB 1U4MA 4C2MB 1Y1WG 3T13A 4JI7Q 2EYHA 3U4VA 4BBSG 1C9OA 4X3TA 1V1OA 3HOZG 2EYMA 3VR4A 3I70A 1A2UA 3NXWA 5KNDA 4DV7L 4OWXB 4G57A 2N49A 2Z4IA 5FLXc 2XWBB 4QMGA 2SOBA 4JI1Q 2E8GA 3MXGA 1JQYD 4O2DA 4HTHA 3IL8A 4KN4C 2X69A 2X6GA 4OO1G 3C1EA 4DK3C 1CTMA 4BY7G 4V0BA 1Q82C 2A73B 4JI2Q 1D8LA 3OPOA 3F2CA 4UP9A 2KENA 1VQ4A 2L9HA 1EY8A 1BCPF 1STYA 3HP3A 2F0UA 3KLWA 1PYSB 3NQIA 3VR5A 4ZQ3A 5CV9A 2EYJA 2B2UC 3JAML 3PIP3 3NPPA 2C9OA 4DUZQ 2DY8A 2F1MA 3I4NH 4QIWE 2NZ1D 5CV4A 3TDQA 3TS0A 4I7ZC 4DUYQ 3RZOH 1BUVT 4JI8Q 1NUCA 1STGA 2KVMA 4LK1C 2R7FA 3GTMH 3M4OB 3PO3H 3C46A 3HKZG 3PUZA 2A6HD 3DUZA 5M5XB 1L2FA 1YNXA 1ICFB 5IT9E 2IT1A 5I6YA 2O5IC 4A93B 4RCOA 1L0YB 4DR1L 3S15B 1GM5A 1I94L 1WTOA 2E2IH 3K6OA 1F2YA 1CKOA 3MWYW 3PO2G 2F0OA 4IURA 3JAMi 3HOWB 2VB2X 4X64Q 2FXQA 3KFUA 1NNXA 1YHQA 4X64L 1LTLA 4LW1A 3S1MH 2JEBI 4IOAA 3TZUA 2LKVA 4OONA 1C8CA 2PZWA 4R9WA 4DR5Q 4BY7B 4IPDA 4DV0Q 2FHTA 5IP7H 3AB9A 1NY4A 1WD1A 4DR4L 2JA5B 3HOYH 2PO4A 1PH8A 2HCIA 4QB4A 1WTVA 2UUAQ 3EQLC 3VYSA 3G6JB 1HNZQ 4GKKL 1MD2D 2UUAL 4A3DG 4XT1B 4C3HG 3J81E 1SXTA 3UDXA 2KBNA 4MN3A 1HTLD 4JI4Q 3TS2A 2QA4A 3SGIA 4JI4L 2UUBL 1RKNA 1SEBD 1ENFA 2EY2A 1GHKA 1AW7A 1I3QH 2ZTDA 3QWNA 4P75A 3HKZB 3RLNA 1VQ9A 1VCIA 1F9QA 2TMPA 1HZ9A 1E3PA 4GNXB 3KF6B 4K6DA 4C56C 4DAVA 2UXDL 1TU2B 4GOPA 2O2LD 2XGTA 4XQQA 4ZCKA 1CZWA 1JOKA 5GAGC 2K5NA 4LNQA 1K83H 3U4ZA 4I65A 1B3QA 2R93G 1PLFA 4YY3L 2JA6G 1Z6HA 2UU9Q 5JAVA 3HOUH 1JJ2A 3WDNA 4C1NK 2AQ1B 4DAYB 5GROA 2QKIC 3BJUA 1RD9D 1H9KA 2F0PA 1EY4A 4JG2A 1K8OA 3KLSA 1H95A 1LT3D 3AU7A 3T51B 1LT6D 2G9DA 4BS9A 4G7OC 4Z9CB 4NKLA 5C4XG 4DFAA 1WTXA 5DLQE 4A3CH 2HDLA 2RHSB 2JE6I 5C5LA 4XDXA 1KAWA 2EIFA 2SEBD 4GN4B 5LMNW 1LACA 3FKIG 1DCZA 1F9RA 3I2ZA 2EY6A 3P1HA 1Q90A 3PUYA 4DV2Q 1SFOB 2WB1B 4DV2L 1XMOQ 2F0MA 1IKMA 4NPSA 3GTPH 4WORA 1G91A 2D5DA 3DWQA 3S2DH 5JPMC 4RGMA 1PRTF 2BDNA 2BA0A 2E2JH 5ELNA 1A3TA 1MI2A 2B2WA 1KDAA 1Y1VB 2BDOA 4UHVA 5FO7B 4PZ7A 1N8RC 2R93B 3STBD 3GTKH 2K32A 1EYAA 4IUTA 3TP8A 3BS1A 2K4KA 1EQRA 2NUCA 2PZUA 1TWAH 1X32A 1SE3A 1U0LA 3T53B 1HR0Q 4DXGA 1CA5A 2VW9A 3GTOB 3L9AX 5M3MG 1RTOA 1KXLA 4K6LA 2RDGA 2OTLA 4RKLA 5M5WB 3OHXC 4RGTA 4LF5Q 2DUDA 1BDOA 1DONA 2N55A 4HSPA 3KOJA 3J81j 5J39A 2I07B 4CJ2C 1KD1C 1SR3A 4OX9L 2K01A 1VQOA 1BOSA 2LXJA 1WTRA 1QVGA 3KBXA 5EKIA 1K73C 1IYUA 3TP5A 1B1ZA 4A3FG 2F0TA 1L0XB 4A3KB 2JJQA 2RKSA 2PW7A 2VQEQ 5LMNQ 2KEDA 4FXDA 1O7ZA 1D1IA 5LMNL 2MQHA 4JYAL 1EQTA 2GVBA 4UAIA 3PO3G 3P7JA 2A8VA 4U68A 2DY7A 3UDGA 2BH2A 3D6CA 1YVCA 2C35B 4KI0A 1W3SA 2N8NA 3D8GA 3E9HA 5D65A 1H9SB 1IBLQ 4DNIA 1EIYB 1KABA 2A6HC 2HQEA 1DOMA 2RF4A 3HOVG 1M8AA 2NVXH 2AQ2B 2AKWB 4QF4A 3WWVA 3N6RA 1YHBA 1RODA 1V1PA 1PZID 4GNXC 5KYIA 1C0AA 1BR9A 1SLJA 3K80C 3OMGA 3GD7A 1B50A 4FNFA 5IP7G 4KLKA 1TS4A 1X3EA 1TWHH 1LTAD 1OXUA 1F2MA 3HOYG 3A74A 4RKBA 1GUSA 2NBFA 5IP9H 3WOFA 3ERSX 1UAPA 5EBCA 2OTJA 1KTKA 3RMHA 4PMCA 2MUYA 2Z6KC 2ZXPA 3PQIA 1QZHA 2B2YC 1QB5D 3I4NB 1VQKA 3RZOB 2H4OA 5IODA 3CCSA 4DR2Q 2WKDA 1IL2A 2R7ZH 4DR2L 1DXMA 3VA5A 4L5SA 1HTPA 2A74C 1B70B 2VUMH 3CKIB 4KN7C 1GUWA 5C4ZA 4DV5L 4B9XA 3GTJB 1CK1A 2DNCA 1GOZA 2B63H 1UE5A 3A5ZB 3F2UA 2E2IB 1A15A 1DM0B 3FPPA 1STBA 4F8MA 3CC2A 5JEAH 4OO1I 4DV3Q 3T1YQ 2ICEC 3FRPB 5J1ZA 1PYBA 5A2QL 3GV3A 1LV9A 3S1MB 4XYQA 2L0CA 2F0FA 2F0LA 2IPKD 4YHHL 3L2PA 2EOTA 3MXUA 3J7YW 3I4LA 4RWSC 3K7AH 1VQ6A 1ZEQX 1NR2A 1Q12A 4A93H 4F87A 1KIXA 4AH6A 1PYWD 1Y8PB 4KD4A 2B8FA 3JAME 2XNAC 2A68D 3HOYB 4F7XA 3OW7A 2FMMA 5IGGA 1JOOA 3ND8A 4DR3Q 2RCNA 4FDBA 4B3ML 4TKOB 1OXTA 4E6IA 2R3ZA 1VQPA 1QUQB 4POGA 3S1NB 3I90A 4OIJA 4A3CG 1T5XD 3HG9A 3NP8A 3J7A5 1BF4A 4A3IB 3QB3A 5FLXL 2BE5D 1I3QB 4B08A 3VA7A 3Q8DA 1SRUA 3OIQA 4R4QA 3MVVA 5IWAL 2RBMA 1CI3M 4G7HC 4CKBA 1Z47A 2QDLA 1UEAB 2XN9C 4A3GB 1W2BA 1MGSA 1QZGA 2NZHA 2K5QA 1LABA 3D4RA 1Z9FA 1K83B 1OXVA 1SYGA 2Q8RE 3H0GG 2CQOA 4CKCA 1IW7D 1AH9A 1L1OA 1EU3A 2KJXA 3HOUB 5DNFA 5FK9C 2MO0A 1SNOA 4Y52H 4C3JH 4B3RQ 4LWCA 4NP5A 5AJ3Q 2DNEA 3M4QA 3STBC 1TWGH 4H7BA 1JE4A 3FMCA 4A3EH 2WIIB 3OTOL 4HJ5A 5HGTA 1DD2A 1WYDA 3I4MH 3H3VI 5ELFA 2F0GA 3HS0C 3EN2A 3S14B 5G3LD 1FR3A 2J4XA 2ICIA 4ZAIA 4JI3L 1HZCA 1C4QA 1VQAA 1G2TA 4GN5A 1WTHA 1TT2A 5CGKA 4LF6Q 1WJJA 1V43A 1MKHA 2F0VA 4KY5A 5FOBB 2FMCA 1B3AA 4LFCQ 3GTPB 4HMJA 2PQEA 1UEBA 5KIXA 4QUFA 4X66Q 3DEOA 2K7VA 1B8AA 3MXPA 4JI5L 5FJ8G 1NE3A 4K5XA 1LLRD 4O0AA 1EY5A 3VYUA 3CMEA 1VDZA 2CWPA 4HEDA 2A6ED 2ZM6Q 3EBEA 2MO1A 3VR3A 1MJEA 3GTKB 4AYBG 3W2DA 2MP1A 4PQXA 1S72A 1WCMH 3URYA 2UXCQ 4Q5VA 2JEAI 4IUNA 1KL9A 4L5TA 3DLLA 1TWAB 4KKSA 1EIFA 3FP9A 4HCEA 4IJLA 2BOSA 1JWSD 4WRDA 1PH7A 4IOCA 4J1MA 2KCTA 4IZ8A 1AZPA 1EU4A 3KBGA 4JBMA 3CP0A 4ME5A 2F3VA 5FO8B 1YNJD 3TSSA 3G6EA 2F4IA 3FPUB 2OWOA 4OEMB 1EY7A 2JYOA 3CQZH 2VNUD 3J80i 3SR1A 3PGZA 1K3BC 4XQNA 4ZK9B 1KRTA 5IT9c 3TREA 2EYFA 1VQJA 1IBKL 1XTCD 1WTWA 4CGYB 2EVBA 4XQJA 2RSOA 3ONAB 4JCVE 4DV4L 4OIKA 1H9MA 1I50B 5BR8Q 1JT8A 2WFWA 2UUCQ 4R4IA 4X62L 4JV5Q 1GVPA 4B3SQ 4FF4A 1N33L 1Y14B 4GOPB 3D6WA 1SE8A 2B39A 4QIWB 2HHHQ 2B63G 3Q6SA 3X3NA 2HHHL 3PF4A 1EOTA 1Y8NB 2EXDA 1I4GA 3TRZA 4CDFC 3HRZC 2PCFB 5JEAG 1JMCA 3NK9A 1QJOA 3J7ZC 4U673 2WAQE 1EFID 4K0KL 1NTGA 3F1ZA 4K2KA 1A2TA 4JI7L 3HFZB 5CBAE 4AIMA 4K5VA 5FKAC 2GA4B 3J81c 4A93G 3KDFA 1HRJA 1F2ZA 1EWHA 2B2TA 5IGFA 2B3GA 1CUKA 1TWHB 2MNAA 4Y7NH 4OL7A 5FLMH 2ZTCA 4ZKCB 1Q81C 3FHWA 3OIPA 3HOWG 5C0XG 1ZKOA 4X3UA 4JI0Q 1MJCA 3CRKC 1CT1D 2IY5B 4JI1L 1HPCA 4P72A 5JJZA 4CKEA 4DA2A 2A68C 1EQVA 3I72A 4LF7Q 1Q46A 3E5SA 4MTKA 3V2TA 4LF7L 2R7ZB 4KK7A 4FF2A 1SYEA 4JI2L 1Y69U 3ITPA 2VUMB 2MHVA 3MC0B 4ZKBB 1AE3A 1PTOF 3HOXH 2JA5G 2F0HA 4N9PA 2JA8H 1X6OA 1CZGA 3U9SA 5K5PA 2B63B 1HFGA 4NXMQ 2PYKA 3BDLA 2BE5C 4L5QA 4DUZL 2XTIA 4DUYL 4QGUA 2K5WA 4JI8L 2L55A 5C6AA 3BU2A 3ZYYX 5IYDH 4A3JB 2R7DA 4BXXG 2KEEA 2V1CC 1JJGA 3K7AB 3NELA 1FJGQ 1SN8A 3GTJH 1J5EQ 1S40A 4S3SA 1KHIA 1RHPA 4LF4Q 1IW7C 2OCEA 4OHJA 1JJCB 4AYBE 3K0XA 2DJGC 4O42A 1U5KA 1PH1A 1MSGA 4CHTB 1EQQA 2NVYB 1PHJA 1X3PA 5CYUA 4JI6Q 4NMZA 1TWCH 2EE1A 1SNMA 4DR5L 5AFWA 4LFAQ 4DV0L 3U9OA 4GS3A 2YTVA 1QOHA 2A5HA 1VS0A 5C4HA 4DK6C 3BVZA 1P16A 2Q2UA 2E75C 4TVAB 1D5MC 1HNZL 1X3GA 5A2QE 1M1KC 4HIOA 2F0IA 1CSPA 1UE1A 1XPUA 2M9VA 3S1NH 4FF3A 2CH4A 3GP7A 4H13C 3RZDB 5C3EH 4A3IH 4R4OA 3MFGA 3F8TA 4FVMA 1I4PA 3NE5B 4IUUA 4MNOA 5IGDA 2K5VA 2WB1G 4C3JB 1CKNA 3UDFA 3OYYA 2LY7A 4WJWA 3D4DA 2A6EC 4A3GH 4NW2A 4FXKC 1TWGB 2PNRC 1V1PB 4JOIA 2D9UA 2F03A 4LAAA 4IUPA 4A3EB 4LF8Q 3DWPA 1ZYRD 4IPHA 1Y1VG 5E4WC 4BY1H 3I4MB 4OELB 4GOPC 4MZ9A 3SEBA 2AMCB 1CHPD 1PMRA 2UU9L 3BYYB 2QEXA 2SDFA 1ILPA 3CCJA 5DEHA 2D62A 2ZJRA 1LYLA 1NJIC 1HR0W 4ILWA 3H6MA 3O13A 3OWFA 3GO5A 4B9WA 5CMDA 3BZCA 1YNJC 1K8AC 4B3TQ 3DEPA 3FEWX 4BBRH 2PI2E 1DJRD 3G7LA 4A4IA 4X6AH 3S14H 4N8X1 2EY5A 3BG3A 1TR5A 1X3FA 3GQBA 3CCMA 2D0OA 1B7YB 4UP7A 4IFDJ 3R2TA 1YHAA 3GTLB 2HIXA 2IX3A 1SYDA 3RUZA 1UE7A 5CV6A 1F2LA 4EGVA 3QR8A 4HIKA 1WCMB 1HNXQ 4A3KG 1LTBD 3IFTA 3RN2A 2WINB 4Q0FA 4K8JA 1EYDA 1XMOL 3A7LA 4BA1I 4O1NA 3M7GA 4KJOA 1VQEA 4A3BH 2Z6BA 1KDBA 3S24A 3NBHA 1XNRQ 4IFDI 2F3IA 2QCPX 4QCLA 4F88A 4LFBQ 2CVRA 3DHQA 1BCPD 2RA4A 4IJHA 1VQIA 2D0PA 3Q22A 2Z9HA 4KY6A 2VQFQ 2B2WC 5E1FA 2Z8LA 3HKZE 1FGBD 1AE2A 1D1KA 1SYFA 1SAPA 3Q23A 2E5LQ 1E22A 5I4DA 3U50C 3CQZB 1CA6A 2MFIA 3T56B 5DM63 4QY7A 3P20A 1YI2A 2H5XA 2Q8IB 2QF7A 1HR0L 3S17B 2Q2HA 1F77A 1EWIA 2HT1A 1E2ZA 1Q8IA 3PIPA 4LF5L 5IGEA 1HCZA 4OGQC 3J80E 4DV6Q 3HOXG 4LF9Q 4C3IH 1N36Q 3N52A 1N36L 4KKUA 2BH8A 2WACA 2FINB 1CHQD 1G8ZD 2RDFA 3I4NG 4A3MB 3ICEA 3NSWA 4DN4M 4LUZA 1XPRA 2BCOA 2VQEL 5K36H 4IN3A 1FVIA 1L1OB 1HH2P 3JAMc 1I50H 4K2LA 1BCPB 1JOQA 2LS01 3A7AB 4YCWA 4XTCS 4JBJA 1KC8C 1X65A 1H9RA 4HCSA 1A0IA 5BN4A 3K59A 2ID0A 3I3CA 4Y7NB 1Q86C 1SYBA 4EQ5A 1WFQA 1FNVA 1IBLL 2OT2A 2WB1E 4K8IA 2A19A 1TS3A 3I73A 2Y0SG 1B2TA 1HUMA 4LUOA 2GVAA 2F3WA 4EQPA 3CPWA 1S5FD 3GV6A 1XNQQ 2AQ3B 2HD3A 1Q3LA 4QJFA 1HNWQ 2F0QA 1A3UA 3SHLA 1VQCA 3W5OA 3M3YH 5DM73 2N3SA 1PFMA 4QL5A 2MJ8A 4HJ8A 3NBIA 1Z7TA 3HOXB 2JA8B 4KJNA 3DXJC 4LUVA 5GADC 1BBWA 3T16A 4KHZA 3BZKA 4FXGC 4GLAC 1QNKA 1Q1EA 1RF2D 3H94A 2AWNA 1O80A 3FDTA 3AYHB 1YBYA 1PXUA 3NQTA 5EKLA 3SVMA 3X3MA 5EPKA 4A3IG 2ZXRA 1A3VA 5D3IB 4IALA 2B8GA 1F9PA 1SNQA 3I55A 4KHPQ 1E24A 1ONLA 1ASZA 3C2PA 4RG1A 1JORA 3K7UC 5C0XI 4A3GG 1BXTA 3KJPA 3KK7A 2WV6D 1YITA 3ERQA 3HGBA 5CV8A 1Q8KA 2YU9H 5F2DA 2P5ZX 4BY1G 4GZYC 1QNUA 1SNDA 2Y0SB 4DV3L 2A1AA 2ALYB 3T1YL 3RLFA 4G4KA 3DWAA 3PIO3 4A3JH 1JWMD 2WKCA 4PG3A 3EVQA 4X3KA 3HOUG 1UE6A 1TWCB 2XIWA 1K3RA 3TBIB 1D5XC 1ZYRC 1WD0A 5ELBA 2F0KA 2QEJC 4MTNA 1ET9A 1AEXA 3K58A 5COYA 2YTXA 1PRTD 1KQSA 5A35A 1E2WA 2G5DA 4DPGA 2AWOA 3W1BA 5IYCH 4KKTA 2RQXA 5HY6A 1PA6A 2E74C 3PV0A 1Y1WH 2LFNA 2OF1A 4DR3L 1T9HA 2NVYH 2EJMA 4GLVB 4A75A 4A76A 1O7YA 2K52A 5JPNC 2PPBC 1E1OA 5CBEE 3R3OA 1X9NA 1IZ6A 3BDCA 1D5ZC 5C3EB 1Q7YC 3L0OA 3HOZH 1MHWC 4YWKA 3G71A 1K8GA 2JN4A 2QGQA 4AQYQ 1TY2A 2JP1A 3AFQA 2JXMB 4ODGA 3OWEB 3TN2A 1RL2A 2KCMA 3A8IE 3M85A 3S16H 4EVOA 3I91A 1PH3A 2O5JC 1BQQT 2HQLA 1LTGD 1WTQA 4DR7Q 1LO5D 4OO1H 3PF5A 5KYLA 4BY1B 2FFKB 3RZDH 3KDFB 3MEFA 5KRUA 4PZ8A 1X56A 5LMUQ 4NXNQ 4FYDA 2F0WA 4NXNL 1UWVA 3E0JA 1PRTB 1FGUA 5I6WA 2WP8J 4RHSA 5KEEA 2PQAA 3CCQA 2ZXOA 3EA6A 4UP8A 1L1OC 1WI5A 1L0WA 4B3RL 5AJ3L 1BCPC 1JR0D 4JBKA 1NBWA 1VQNA 1I4XA 2Q2IA 3T1HQ 2NN6H 2PMZB 3T1HL 3CF5A 4BBRB 4H02A 2RVLA 1IHZA 4RCNA 2F4VQ 4CJ1B 3JC66 1PVOA 1XX8A 1VQ8A 3A8KE 1R4QB 4LF6L 3CD6A 4RHRA 4DR6Q 4J15A 1BNZA 1YIJA 5J3BA 1VQBA 4PMWA 2G9HD 1EY6A 3U58A 4LFCL 1SNPA 2K03A 2CHBD 3BYTB 3V05A 3D31A 2ZJPA 4A3BB 4H44C 4X66L 4IPCA 1KLUD 1XMQQ 3S9WA 3A55A 5JJKA 1VQHA 3VYRA 3W3AA 2ZM6L 3GTLH 2XRQD 1SMYD 4NB3A 1SBBB 3LWEA 1GJXA 1QILA 4K5WA 2UXCL 4A3DH 1CM9A 4C3HH 4V190 5M5YH 4ZYSA 1B9MA 2RCFA 5M3FB 2N78A 2X6LA 5C44B 4ALPA 1M4VA 1WOCA 3S2HH 4JPBW 4R8IA 1STHA 3AFPA 2GN5A 4H0LC 3GTQB 5M9OA 1GHJA 2KCNA 2B2VA 4EQOA 4PMBA 3BVGA 4ZLTF 4KMUC 4ZUIA 4CDCC 1HQRD 1AZQA 2JA9A 1BKBA 1LTID 2PW5A 4OWWB 3PSIA 1FL0A 2AUKA 3IRBA 4C3IB 1G291 3W1GA 1HHVA 5IP9G 2LXKA 2F0NA 1V9PA 1IYVA 1EL0A 3F2DA 4DK0A 1NAPA 4JC0A 2SNSA 5CORA 3M4PA 5IGBA 3CC4A 3P75A 4ZRZA 3H15A 5DAUA 2EZVA 3S17H 2NVQH 3I56A 2K05A 1B4OA 1V8QA 4L63B 2NYZD 3NENA 2R7ZG 4RMFA 5BR8L 1LM0A 2ZJQA 2UUCL 1CKNB 2VUMG 1S3OA 1NR4A 4P71A 1WVLA 4JV5L 2R6GA 1K0SA 5GAEC 4R8NA 4B3SL 3S1QB 3Q24A 1I6VC 3QG1A 2VL6A 4ZUJA 1JC7A 3R93A 2Z0SA 2A69D 4JW0A 2V4DA 1J8IA 4WJ4A 1JE5A 4A3MH 3PUXA 1AP0A 2DN8A 1PTOH 4XIGS 4X65Q 1O7IA 4PV1C 4GKJQ 1GD7A 1GXDC 4A3JG 5ELCA 1TWFH 2IW3A 4DKAC 1GO3E 4P2CB 1ILQA 1D6EC 3MZ5A 1II3A 4DV1Q 3M3YB 3EIVA 2EYPA 1Y8OB 2FJ2A 3EFXD 5IYCG 4BA2I 1PFSA 2B2TC 3CW2C 4HIMA 1RDPD 4DNTB 1PRTC 4JI0L 2F0SA 1VQDA 2ATWA 3QIAA 3NUCA 1XXGA 2SNMA 3PMFA 3SK6A 1VQFA 1A62A 2QDBA 4YIJA 5E4XA 5LHY1 2L5TA 3C1FA 5ISRA 1VMCA 4DV7Q 2EPBA 2IWHA 3IFDA 3WOEA 3R8BA 3CRLC 2R92B 3BDOA 1FNUA 4KD3A 1R4PB 2IHEA 3NBHB 2K33A 1TY0A 4NXML 1KAAA 2YU9B 3CCRA 2KHSA 4N8FA 5M3MH 3KUPA 1KDCA 1TS5A 2K5HA 2CQAA 2ZTEA 1KRSA 1J9OA 2XSCA 1JWUD 2B2UA 3AQQA 5KNBA 5IYBH 2JA7B 1OXXK 4DNRB 1MBYA 2DGYA 4C3JG 1AFPA 2K04A 1FJGL 1KNAA 3VDYA 1J5EL 4A3FH 4LF4L 3SDZA 3T4AC 1YJ9A 3A54A 4A3EG 4GLXA 1HXYD 2NN6G 1Y1WB 2I46A 3I4MG 1E1TA 1T5EA 3K5MA 1STNA 3TQYA 4APVA 4HJ7A 5CV7A 4BBSB 3D4WA 5TSSA 1EEID 3KF8A 1DZ1A 1LT5D 4JI6L 4DR1Q 1I94Q 1SNCA 3HOZB 2BA1A 3MXNA 2VB3X 1K28A 4FP5D 3KJOA 2E76C 2CWAA 2HDMA 5CV5A 2M00A 4M8AA 4LFAL 2ES2A 2L12A 2VY3A 5JVH3 4YCUA 3HOVH 3NHHA 4HR7B 3S16B 5IY0A 3UE1A 3OOCA 4CJ0B 2CW0D 1BVSA 2KCCA 1B9NA 1K8MA 2LMCB 2NWGA 3I4OA 4NDXA 3RNUA 2Z1CA 1XYIA 1D2BA 2XRSD 3CCLA 1HA5A 4EX5A 1N9WA 2QW7A 2I5HA 1ENCA 1U9RA 3A0JA 5LL6S 4K14A 4DR4Q 4MIUA 4XXEA 4LMQD 2HUGA 2RSNA 1WCMG 3GTGH 4GKKQ 5EBDA 2ZT9C 3SK4A 3QO2A 5JOBA 1EUJA 4HJAA 2JSOA 3J80c 1HQMC 1SMYC 5HGQA 3E0EA 2UUBQ 1PH4A 2EXZA 3OMCA 5GQOA 4C1NI 1XWEA 2DJFC 4P74A 4LF8L 3M9BA 4N9TA 1NSNS 4JOIC 3IAYA 5FLXE 4DGZA 4UDUC 2UXDQ 1VMPA 1LT4D 1MSHA 1SE4A 2I5MX 3CU7A 1ESRA 1W6JA 1I4QA 1YNND 3K5OA 3PO2B 3K5NA 5EGTA 1A63A 1IKLA 4DAPA 4YY3Q 3TEHB 4B3TL 4CBVA 2L15A 2KA7A 3F2BA 2TSSA 1OXSC 3CCVA 4TRDA 5EPJA 3ZJYC 1EFWA 3MA2B 2OEOA 1W6KA 5D3DA 5IE8A 4OXPA 3CCUA 5C5MA 3AEVA 2VXWA 2MPMA 5FO9B 2NVTH 5I9PA 5IOCA 1X3QA 3K8AA 3D0FA 3S1RH 1STEA 2AUJD 2L4NA 1TQOA 2H1EA 3NWTA 4A3DB 4A3MG 1RJTA 2F52A 4C3HB 3SK8A 1HNXL 1XPOA 5M5YB 1S5DD 1ICWA 1EYGA 1IXRA 1IYJB 3CMAA 5JJLA 3NTIA 3PUVA 1BBXC 1PH2A 2A69C 1U4LA 1XNRL 1PTOD 5JVG3 3S2HB 1E0BA 4HIDA 4LFBL 1CKMA 3MEHA 4HN7A 1HZBA 5E7NA 1K0RA 3BVMA 3I8ZA 4IUVA 3HKSA 2VQFL 1H9JA 2CH4W 1X54A 5FLMG 2E5LL 1K9MC 4XT3B 3CCEA 3A56A 1I4RA 2K75A 3KYHC 5M3FH 1FNWA 5T1IA 2E2DC 2XVSA 5T1GA 5C44H 3H0GH 3VYTA 2JA6B 1ML0D 4IPGA 2CCZA 1EIHA 5EPLA 2NVQB 1S5BD 1SJHD 4L6TB 3GTQH 1VF5C 2K28A 1NMGA 1QVCA 1QE6A 4WJ3M 1MIUA 1C48A 1WTPA 1R9TH 2JA8G 5CR3A 4DV6L 4LF9L 4DU9A 3VR2A 4CDDC 1A8VA 1LTRD 1QCBD 4CDEC 1LTTD 4DAMA 2AHOB 4HSVA 2PI2A 5C4XB 1PTOB 1O7LA 1PFNA 1UNSA 4KV6A 5IIFA 3HZXA 1QWYA 4IFDH 1GKHA 4PNYA 1RTNA 1RCVD 5I2YA 1F9SA 2RHQB 5EQ0A 5IYDG 1XJVA 1B44D 5IYBG 3QOLA 2CKZB 3A5UA 2C5CA 4OX9Q 2PQAB 1JICA 4IO9A 3FKIB 3S1QH 3ULJA 1TWFB 2K6AA 3ER0A 1AN8A 1LUZA 5C4JH 5L37A 4DXFA 2K5DA 4JYAQ 2K50A 1ZXTA 3KLSX 1PZJD 4RH6A 1HA6A 2B29A 1J6QA 5FJ8H 3UE0A 5EKKA 1X55A 5JEAJ 1ESFA 2RDHA 5CC4A 1STAA 2E2HH 3CXCA 2Q8TA 1DOKA 2KQ3A 1CQVA 3I7FA 5ELEA 3LGJA 1XNQL 5G3LF 1DYQA 5J22A 1HNWL 1EY0A 1KNEA 3RN5A 1SJED 4JBWA 3TZDA 4RA8A 1P8LA 1VQ7A 1I6HH 2NTTA 1A6XA 4GNXA 1S5CD 3KF6A 3CHBD 2I5LX 3ND9A 3NWSA 4KHVA 4C2MH 3H09A 5ELOA 1EEFD 3L7ZC 5EAYA 1I4HA 3UDIA 4YWLA 2NB0A 5C0XJ 1NCVA 1DGSA 2OQKA 4JK1C 5M3MB 4ME3A 1VQGA 3RR5A 4UPAA 2VS1A 3SE0A 3TP6A 4P73A 5C3EG 4X3SA 4RGOS 2CW0C 5H1SE 2Z6KA 2XWJB 5IT9L 5JJIA 2Z4HA 1Q1BA 2B2YA 1GUOA 1B53A 3H91A 1UUPA 3E6ZX 2R92H 4DAYA 4KHPL 4UY8C 3B6YA 1NMFA 4A3FB 3D3RA 2F0JA 3IKJA 3MTSA 1TXYA 4I7AA 4TSSA 3RD4A 2NTSA 1LTSD 3LNNA 2MGSA 3OW2A 1OTCA 3PUWA 3GTMB 2KECA 3PO3B 3NTHA 2IX0A 4A3LH 5KGUA 3RLOA 1ET6A 1GUNA 4DV5Q 4G7ZC 2JA7H 4FO2A 1IBMQ 1HUNA 1IBML 3SXHA 3FVQA 1G51A 1YJWA 2N88A 4HMIA 2VZAA 2J0TD 3E9IA 3H3VC 1SMXA 2YTYA 3HOVB 3J81L 4RGNA 2Q2TA 3M4OH 4YHHQ 4KTAA 2F0DA 3K81C 3SK5A 4BBRG 3K5LA 1VQ5A 1EWCA 1VF7A 3NEMA 3CAMA 5M5XH 2CFMA 1YNNC 4BBSH 2IX1A 2HCCA 4DF7A 4WFN3 1HFNA 4GN3B 3LX0A 1M90C 4LJZC 3S15H 2IHFA 1DOLA 4AQYL 3HOWH 3GTGB 5C0XH 1V1QA 1D7QA 4B3MQ 2EJFC 1SDFA 4JVZA 2NN6I 3LWUA 2YV5A 2OQ0A 1FYCA 3J81i 4IUQA 4A3BG 3ULLA 2ASBA 4DR7L 2R61A 1CQFA 4BY7H 4PZ6A 4OWTB 5IWAQ 3CC7A 5LMUL 2IJ0A 1PH6A 2JA5H 2HIVA 4XYOA 1JB3A 3NTKA 3MHBA 5BN3A 3CPFA 1PTOC 2WAQG 3DM3A 1TS2A 1KLGD 1OO9B 1YJNA 3QJYA 5M3FG 4FF1A 3AMUA 3QOJA 5C44G 1E7ZA 2JQOA 4IQZA 3PCOB 4BXXH 3HEJA 2Y0SE 3GDEA 2IL8A 2M2LA 4DK1A 5ELDA 3J7AF 5I2XA 3EROA 2F4VL 2NVTB 3K57A 4C3IG 1GUTA 3S1RB 5E3FA 1SROA 3OTOQ 1PZKD 3PO2H 3BZDB 1H9SA 1ASYA 3K0YA 5BN5A 4DR6L 4QQBX 4ULLA 2LSSA 5K36G 3MFYA 2L11A 4JI3Q 3Q0AA 2I0QA 1FD7D 4IFDG 4ID6A 3UI2A 2EYLA 4RFBA 2KHIA 3G48A 1N32Q 1JCKB 1S5ED 5C3WA 3VR6A 2J7ZA 3DMUA 1N32L 2L1BA 1XMQL 1N34Q 4HJ9A 1IL8A 2F0EA 1N34L 3MAQA 3TP7A 4L8JA 4ABNA 1XTDA 1O78A 2KHJA 1HZAA 4J8QA 2K14A 4MHEA 4POFA 2ENBA 2PZTA 3EJIA 1PH5A 2EJGC 3L3OC 2WAQB 4RAUC 3S2DB 4JI5Q 4QUCA 1G6ZA 4KY7A 3J7AV 2E2JB 1BO0A 3KF8B 1I5FA
chains in the Genus database with same CATH topology
1UE5A 4R4CA 3A5ZB 5GAHC 3VDYA 1J5EL 4A3FH 3H3VH 4LFBQ 4LF4L 3MXNB 1YJ9A 1EOVA 4IJHA 1VQIA 2D0PA 3CC2A 4OO1I 4A3EG 2VQFQ 4DV3Q 4GLXA 3T1YQ 2NN6G 3HKZE 1CSQA 1AE2A 2JK8A 1SFOH 1PYBA 3I4MG 1E1TA 3G4SA 2E5LQ 1E22A 3U50C 3TQYA 4APVA 4YHHL 3L2PA 4HJ7A 1VQLA 2MFIA 4QY7A 2PNHA 1YI2A 3K7AH 2H5XA 4JI6L 1VQ6A 4YWMA 4DR1Q 4R1JA 1I94Q 1Q12A 4A93H 1KIXA 1Y1VH 4AH6A 1VQMA 2BA1A 1HR0L 3KJOA 2R93H 2JA6H 2CWAA 2Q2HA 1RIPA 4LFAL 3M7NA 1EWIA 2NZOA 1YZ6A 2PMZE 2ES2A 2HT1A 2VY3A 1YEZA 4YCUA 3HOVH 4DR3Q 2RCNA 4FDBA 5IY0A 3UE1A 3PIPA 4LF5L 4TQUS 1BVSA 3I4OA 4DV6Q 3RNUA 3HOXG 4B3ML 2UXBQ 1OXTA 4LF9Q 4C3IH 2UXBL 1VQPA 2R92G 1N36Q 1QUQB 1G6PA 4POGA 4A3CG 1N36L 3CCLA 4EX5A 1N9WA 2BH8A 1PH9A 3J7A5 2EQSA 1IBKQ 1QVFA 2I5HA 3A0JA 3I4NG 4DV4Q 1JB7A 3ICEA 3GTOH 4DR4Q 3PIOA 1XPRA 4LUZA 2VQEL 3Q8DA 1SRUA 4R4QA 5C4XH 5IWAL 1FVIA 4L5RC 2YYZA 5M5WH 1L1OB 1HH2P 3JAMc 1WCMG 4X62Q 1I50H 3GTGH 4A3LG 4YCVA 4GKKQ 1N33Q 4R4TA 1Z47A 1C7YA 4X65L 2B63H 1EUJA 1QUQA 2JA7G 4HJAA 4GKJL 4YCWA 1W2BA 1PV4A 4XTCS 3J80c 4JBJA 1QZGA 1KC8C 2NZHA 2UUBQ 3FKIH 1X65A 3E0EA 5HGQA 1PH4A 1A0IA 2ID0A 1Z9FA 5GQOA 1OXVA 3H0GG 2CQOA 4P74A 4LF8L 1HJPA 3M9BA 4A3KH 1Q86C 4DV1L 1AH9A 1BBUA 4EQ5A 1WFQA 1L1OA 1IBLL 4JOIC 2WB1E 2MO0A 3ULPA 4K0KQ 2A19A 4Y52H 2UXDQ 2Y0SG 1Y1WG 4LUOA 4C3JH 2GVAA 4JI7Q 4B3RQ 4LWCA 5AJ3Q 3U4VA 3CPWA 2I5MX 3M4QA 4BBSG 3STBC 1C9OA 1TWGH 1XNQQ 4QJFA 1HNWQ 4A3EH 1A63A 3OTOL 4YY3Q 3TEHB 4HJ5A 3HOZG 1VQCA 1WYDA 3W5OA 3I4MH 2N3SA 3M3YH 4B3TL 3H3VI 4QL5A 2L15A 3EN2A 4HJ8A 3F2BA 1OXSC 4DV7L 4OWXB 3CCVA 1EFWA 3ZJYC 4JI3L 2N49A 4LUVA 5GADC 1BBWA 1HZCA 1VQAA 5FLXc 4KHZA 3BZKA 4GLAC 4GN5A 4OXPA 5IE8A 3CCUA 3AEVA 4JI1Q 2NVTH 2E8GA 3K8AA 4LF6Q 4O2DA 1Q1EA 3D0FA 3S1RH 1WJJA 1V43A 2AWNA 4OO1G 1MKHA 3AYHB 4DK3C 1YBYA 4BY7G 1Q82C 4A3IG 4JI2Q 4LFCQ 1D8LA 3F2CA 4A3MG 4UP9A 2F52A 1XNRQ 1UEBA 1HNXL 1XPOA 2KENA 4X66Q 1VQ4A 1B8AA 1IXRA 1IYJB 3CMAA 3I55A 1EYGA 4JI5L 1E24A 5FJ8G 4KHPQ 1NE3A 1ASZA 5JJLA 3KLWA 3PUVA 4O0AA 1PYSB 4RG1A 1PH2A 3K7UC 5C0XI 3CMEA 4A3GG 3KJPA 2CWPA 1XNRL 4DUZQ 1YITA 2ZM6Q 4HIDA 3EBEA 3I4NH 4QIWE 4LFBL 1Q8KA 1CKMA 2MO1A 2YU9H 3TS0A 1MJEA 4DUYQ 4AYBG 3RZOH 1HZBA 5E7NA 4JI8Q 1K0RA 1S72A 4BY1G 2R7FA 3HKSA 3GTMH 1WCMH 2UXCQ 2VQFL 4DV3L 3PO3H 2A1AA 2ALYB 2JEAI 3T1YL 1X54A 3HKZG 5FLMG 3PUZA 3RLFA 1KL9A 4L5TA 1L2FA 2E5LL 3DLLA 4A3JH 3HOUG 1YNXA 4PG3A 1K9MC 1UE6A 3CCEA 2IT1A 1EIFA 1K3RA 2K75A 3KYHC 5M3FH 3FP9A 4IJLA 4MTNA 5C44H 4DR1L 1GM5A 3H0GH 1I94L 1PH7A 4IOCA 2YTXA 2E2IH 1KQSA 4IPGA 2CCZA 2KCTA 1CKOA 4JBMA 3PO2G 3GTQH 3CP0A 4DPGA 3JAMi 1NMGA 2AWOA 4X64Q 3W1BA 1QVCA 2FXQA 5IYCH 3G6EA 2OWOA 5HY6A 3KFUA 1YHQA 3PV0A 4X64L 1Y1WH 1PA6A 4WJ3M 1LTLA 1MIUA 4DR3L 4LW1A 1T9HA 2NVYH 3CQZH 1R9TH 4A76A 4GLVB 2JEBI 3J80i 4A75A 3S1MH 2VNUD 2JA8G 4IOAA 4DV6L 3PGZA 4OONA 2K52A 4LF9L 4DR5Q 1A8VA 1E1OA 1KRTA 1X9NA 4IPDA 1IZ6A 5IT9c 1Q7YC 3L0OA 4DV0Q 3TREA 3HOZH 5IP7H 1VQJA 4YWKA 3G71A 4DAMA 2AHOB 1NY4A 1IBKL 1K8GA 2PI2A 2QGQA 4DV4L 4AQYQ 4JCVE 4DR4L 3AFQA 3HOYH 1PH8A 5BR8Q 1JT8A 1GKHA 2WFWA 1RL2A 2KCMA 4R4IA 2UUAQ 2UUCQ 2RHQB 3M85A 1HNZQ 3S16H 4X62L 2UUAL 4GKKL 5IYDG 1XJVA 1GVPA 5IYBG 4A3DG 4B3SQ 2CKZB 1PH3A 1N33L 3A5UA 4OX9Q 2PQAB 1Y14B 2HQLA 4IO9A 3UDXA 2KBNA 4GOPB 3S1QH 4DR7Q 3ULJA 3ER0A 3PF5A 1SE8A 4JI4Q 3TS2A 2QA4A 2HHHQ 1LUZA 3SGIA 4JI4L 2UUBL 5C4JH 2B63G 2HHHL 3RZDH 3PF4A 2EXDA 3KDFB 3MEFA 4PZ8A 1X56A 5LMUQ 4NXNQ 1I3QH 2ZTDA 2K50A 4P75A 3RLNA 1VQ9A 3TRZA 4JYAQ 1VCIA 4NXNL 5JEAG 1HZ9A 1UWVA 1JMCA 2B29A 1J6QA 1E3PA 5FJ8H 1FGUA 3J7ZC 2WAQE 4GNXB 2WP8J 3KF6B 4K0KL 3UE0A 2UXDL 2PQAA 1X55A 1NTGA 3F1ZA 5JEAJ 3CCQA 4UP8A 1L1OC 1WI5A 1L0WA 2XGTA 4GOPA 3HFZB 5AJ3L 3CXCA 2E2HH 4JI7L 4AIMA 4B3RL 3J81c 4JBKA 3I7FA 3LGJA 1NBWA 1XNQL 1VQNA 4A93G 3KDFA 5GAGC 2K5NA 4LNQA 1HNWL 2Q2IA 3T1HQ 1K83H 3U4ZA 2B3GA 3T1HL 1CUKA 3CF5A 2R93G 3RN5A 4YY3L 2MNAA 4Y7NH 4JBWA 2JA6G 5FLMH 2UU9Q 1P8LA 2ZTCA 1Q81C 1VQ7A 1I6HH 4GNXA 3HOUH 3KF6A 3FHWA 1JJ2A 3HOWG 4H02A 2I5LX 5C0XG 4C2MH 2F4VQ 5ELOA 3L7ZC 3JC66 5GROA 4DAYB 4JI0Q 5EAYA 1MJCA 2IY5B 1PVOA 3UDIA 4YWLA 1VQ8A 3BJUA 5C0XJ 1DGSA 4JI1L 4P72A 2OQKA 4LF6L 4ME3A 1VQGA 4JG2A 3RR5A 3CD6A 4UPAA 2VS1A 4DR6Q 1H95A 4LF7Q 1Q46A 4J15A 4P73A 5C3EG 1YIJA 4LF7L 5J3BA 1VQBA 5H1SE 2Z6KA 4PMWA 4JI2L 3U58A 5JJIA 4LFCL 5C4XG 1Q1BA 1AE3A 3HOXH 2JA5G 2JA8H 2ZJPA 3D31A 1X6OA 4X66L 2R92H 5DLQE 4A3CH 4IPCA 2RHSB 4KHPL 2JE6I 1XMQQ 4UY8C 3B6YA 1KAWA 1NMFA 2EIFA 4NXMQ 1VQHA 5JJKA 1TXYA 4GN4B 5LMNW 4L5QA 4DUZL 2XTIA 3FKIG 2ZM6L 3GTLH 3I2ZA 4NB3A 3OW2A 1OTCA 3PUWA 3PUYA 4DUYL 4DV2Q 4QGUA 4JI8L 4DV2L 2IX0A 1XMOQ 4A3LH 3BU2A 4NPSA 3RLOA 3GTPH 4A3DH 2UXCL 5IYDH 4C3HH 2R7DA 4DV5Q 4BXXG 2JA7H 5M5YH 3S2DH 2V1CC 1JJGA 1IBMQ 3NELA 1FJGQ 1SN8A 2BA0A 1IBML 3GTJH 1J5EQ 2E2JH 5ELNA 2N78A 1S40A 1G51A 1KHIA 1YJWA 4LF4Q 4ALPA 1WOCA 2OCEA 1JJCB 4PZ7A 4AYBE 1N8RC 3S2HH 3STBD 3AFPA 2GN5A 2VZAA 3E9IA 3K0XA 1SMXA 3GTKH 1U5KA 2YTYA 1PH1A 1EQQA 2K4KA 2Q2TA 3M4OH 4YHHQ 3K81C 4BBRG 1EQRA 1BKBA 2JA9A 1VQ5A 1PHJA 3NEMA 4OWWB 3PSIA 1FL0A 3CAMA 3IRBA 2CFMA 5M5XH 4JI6Q 1TWAH 1G291 3W1GA 2IX1A 5IP9G 4BBSH 2LXKA 1TWCH 1V9PA 4GN3B 3F2DA 4DR5L 1U0LA 4JC0A 1HR0Q 2VW9A 1M90C 3S15H 3CC4A 3M4PA 4LFAQ 4DV0L 3H15A 5M3MG 3S17H 1KXLA 2IHFA 2NVQH 3I56A 4GS3A 2YTVA 2OTLA 1VS0A 4AQYL 3HOWH 4LF5Q 2DUDA 3NENA 2R7ZG 4RMFA 1V1QA 4DK6C 4B3MQ 1D7QA 5BR8L 2NN6I 1LM0A 1P16A 2ZJQA 2UUCL 2Q2UA 3J81j 3KOJA 4TVAB 1CKNB 2YV5A 1S3OA 4P71A 1HNZL 2VUMG 1X3GA 2R6GA 4JV5L 2OQ0A 1KD1C 5GAEC 4B3SL 3J81i 1SR3A 4OX9L 1M1KC 4HIOA 1XPUA 1CSPA 1UE1A 4A3BG 1VQOA 3ULLA 2LXJA 1QVGA 2ASBA 3S1NH 4DR7L 2VL6A 1K73C 4BY7H 2Z0SA 4PZ6A 5C3EH 4A3IH 4A3FG 4R4OA 4WJ4A 2JJQA 1JE5A 2VQEQ 4OWTB 5IWAQ 5LMNQ 4A3MH 3PUXA 3CC7A 3F8TA 5LMNL 2MQHA 5LMUL 4JYAL 1PH6A 2JA5H 4MNOA 2GVBA 2K5VA 4XIGS 2HIVA 3PO3G 2WB1G 1O7IA 1CKNA 3UDFA 4X65Q 3OYYA 2A8VA 3CPFA 4GKJQ 3UDGA 1GD7A 2WAQG 2BH2A 3DM3A 4A3JG 4A3GH 1YVCA 2C35B 4JV5Q 1YJNA 4KI0A 4JOIA 1W3SA 5M3FG 2N8NA 1TWFH 4LF8Q 4DKAC 4IPHA 1GO3E 1Y1VG 3E9HA 5C44G 4DV1Q 4BY1H 1E7ZA 4GOPC 3EIVA 1IBLQ 2JQOA 4DNIA 1EIYB 4MZ9A 2AMCB 3PCOB 4BXXH 2Y0SE 2UU9L 5IYCG 4BA2I 3GDEA 2RF4A 3HOVG 2QEXA 2NVXH 1PFSA 3CCJA 2AKWB 2D62A 3CW2C 3WWVA 4HIMA 1YHBA 2ZJRA 1LYLA 1NJIC 1HR0W 2F4VL 4JI0L 4GNXC 1VQDA 3GO5A 2ATWA 1C0AA 1SLJA 3K80C 1SROA 3OTOQ 3GD7A 3BZCA 1K8AC 3PO2H 1VQFA 1A62A 1ASYA 4B3TQ 5IP7G 4KLKA 4DR6L 4QQBX 1X3EA 2LSSA 1TWHH 4BBRH 4DV7Q 1OXUA 2PI2E 5K36G 4A4IA 4X6AH 4JI3Q 3S14H 3HOYG 2I0QA 3A74A 4IFDG 5IP9H 3ERSX 1X3FA 2KHIA 3CCMA 3G48A 1N32Q 2D0OA 2OTJA 1B7YB 2IHEA 4UP7A 2Z6KC 1N32L 4IFDJ 3NBHB 1XMQL 1QZHA 1N34Q 4NXML 1YHAA 4HJ9A 3CCRA 2HIXA 1VQKA 5M3MH 1N34L 1UE7A 1XTDA 2KHJA 2K5HA 1HZAA 2K14A 4POFA 3CCSA 4HIKA 2ZTEA 4DR2Q 1KRSA 1IL2A 2R7ZH 1HNXQ 4DR2L 4A3KG 1PH5A 3RN2A 4L5SA 3AQQA 1B70B 1XMOL 5IYBH 2VUMH 4JI5Q 1OXXK 4BA1I 4DV5L 1VQEA 2DGYA 4A3BH 3S24A 3KF8B 4IFDI 1I5FA 2F3IA 1FJGL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE5 A;  4R4C A;  3A5Z B;  5GAH C;  3VDY A;  1J5E L;  4A3F H;  3H3V H;  4LFB Q;  4LF4 L;  3MXN B;  1YJ9 A;  1EOV A;  4IJH A;  1VQI A;  2D0P A;  3CC2 A;  4OO1 I;  4A3E G;  2VQF Q;  4DV3 Q;  4GLX A;  3T1Y Q;  2NN6 G;  3HKZ E;  1CSQ A;  1AE2 A;  2JK8 A;  1SFO H;  1PYB A;  3I4M G;  1E1T A;  3G4S A;  2E5L Q;  1E22 A;  3U50 C;  3TQY A;  4APV A;  4YHH L;  3L2P A;  4HJ7 A;  1VQL A;  2MFI A;  4QY7 A;  2PNH A;  1YI2 A;  3K7A H;  2H5X A;  4JI6 L;  1VQ6 A;  4YWM A;  4DR1 Q;  4R1J A;  1I94 Q;  1Q12 A;  4A93 H;  1KIX A;  1Y1V H;  4AH6 A;  1VQM A;  2BA1 A;  1HR0 L;  3KJO A;  2R93 H;  2JA6 H;  2CWA A;  2Q2H A;  1RIP A;  4LFA L;  3M7N A;  1EWI A;  2NZO A;  1YZ6 A;  2PMZ E;  2ES2 A;  2HT1 A;  2VY3 A;  1YEZ A;  4YCU A;  3HOV H;  4DR3 Q;  2RCN A;  4FDB A;  5IY0 A;  3UE1 A;  3PIP A;  4LF5 L;  4TQU S;  1BVS A;  3I4O A;  4DV6 Q;  3RNU A;  3HOX G;  4B3M L;  2UXB Q;  1OXT A;  4LF9 Q;  4C3I H;  2UXB L;  1VQP A;  2R92 G;  1N36 Q;  1QUQ B;  1G6P A;  4POG A;  4A3C G;  1N36 L;  3CCL A;  4EX5 A;  1N9W A;  2BH8 A;  1PH9 A;  3J7A 5;  2EQS A;  1IBK Q;  1QVF A;  2I5H A;  3A0J A;  3I4N G;  4DV4 Q;  1JB7 A;  3ICE A;  3GTO H;  4DR4 Q;  3PIO A;  1XPR A;  4LUZ A;  2VQE L;  3Q8D A;  1SRU A;  4R4Q A;  5C4X H;  5IWA L;  1FVI A;  4L5R C;  2YYZ A;  5M5W H;  1L1O B;  1HH2 P;  3JAM c;  1WCM G;  4X62 Q;  1I50 H;  3GTG H;  4A3L G;  4YCV A;  4GKK Q;  1N33 Q;  4R4T A;  1Z47 A;  1C7Y A;  4X65 L;  2B63 H;  1EUJ A;  1QUQ A;  2JA7 G;  4HJA A;  4GKJ L;  4YCW A;  1W2B A;  1PV4 A;  4XTC S;  3J80 c;  4JBJ A;  1QZG A;  1KC8 C;  2NZH A;  2UUB Q;  3FKI H;  1X65 A;  3E0E A;  5HGQ A;  1PH4 A;  1A0I A;  2ID0 A;  1Z9F A;  5GQO A;  1OXV A;  3H0G G;  2CQO A;  4P74 A;  4LF8 L;  1HJP A;  3M9B A;  4A3K H;  1Q86 C;  4DV1 L;  1AH9 A;  1BBU A;  4EQ5 A;  1WFQ A;  1L1O A;  1IBL L;  4JOI C;  2WB1 E;  2MO0 A;  3ULP A;  4K0K Q;  2A19 A;  4Y52 H;  2UXD Q;  2Y0S G;  1Y1W G;  4LUO A;  4C3J H;  2GVA A;  4JI7 Q;  4B3R Q;  4LWC A;  5AJ3 Q;  3U4V A;  3CPW A;  2I5M X;  3M4Q A;  4BBS G;  3STB C;  1C9O A;  1TWG H;  1XNQ Q;  4QJF A;  1HNW Q;  4A3E H;  1A63 A;  3OTO L;  4YY3 Q;  3TEH B;  4HJ5 A;  3HOZ G;  1VQC A;  1WYD A;  3W5O A;  3I4M H;  2N3S A;  3M3Y H;  4B3T L;  3H3V I;  4QL5 A;  2L15 A;  3EN2 A;  4HJ8 A;  3F2B A;  1OXS C;  4DV7 L;  4OWX B;  3CCV A;  1EFW A;  3ZJY C;  4JI3 L;  2N49 A;  4LUV A;  5GAD C;  1BBW A;  1HZC A;  1VQA A;  5FLX c;  4KHZ A;  3BZK A;  4GLA C;  4GN5 A;  4OXP A;  5IE8 A;  3CCU A;  3AEV A;  4JI1 Q;  2NVT H;  2E8G A;  3K8A A;  4LF6 Q;  4O2D A;  1Q1E A;  3D0F A;  3S1R H;  1WJJ A;  1V43 A;  2AWN A;  4OO1 G;  1MKH A;  3AYH B;  4DK3 C;  1YBY A;  4BY7 G;  1Q82 C;  4A3I G;  4JI2 Q;  4LFC Q;  1D8L A;  3F2C A;  4A3M G;  4UP9 A;  2F52 A;  1XNR Q;  1UEB A;  1HNX L;  1XPO A;  2KEN A;  4X66 Q;  1VQ4 A;  1B8A A;  1IXR A;  1IYJ B;  3CMA A;  3I55 A;  1EYG A;  4JI5 L;  1E24 A;  5FJ8 G;  4KHP Q;  1NE3 A;  1ASZ A;  5JJL A;  3KLW A;  3PUV A;  4O0A A;  1PYS B;  4RG1 A;  1PH2 A;  3K7U C;  5C0X I;  3CME A;  4A3G G;  3KJP A;  2CWP A;  1XNR L;  4DUZ Q;  1YIT A;  2ZM6 Q;  4HID A;  3EBE A;  3I4N H;  4QIW E;  4LFB L;  1Q8K A;  1CKM A;  2MO1 A;  2YU9 H;  3TS0 A;  1MJE A;  4DUY Q;  4AYB G;  3RZO H;  1HZB A;  5E7N A;  4JI8 Q;  1K0R A;  1S72 A;  4BY1 G;  2R7F A;  3HKS A;  3GTM H;  1WCM H;  2UXC Q;  2VQF L;  4DV3 L;  3PO3 H;  2A1A A;  2ALY B;  2JEA I;  3T1Y L;  1X54 A;  3HKZ G;  5FLM G;  3PUZ A;  3RLF A;  1KL9 A;  4L5T A;  1L2F A;  2E5L L;  3DLL A;  4A3J H;  3HOU G;  1YNX A;  4PG3 A;  1K9M C;  1UE6 A;  3CCE A;  2IT1 A;  1EIF A;  1K3R A;  2K75 A;  3KYH C;  5M3F H;  3FP9 A;  4IJL A;  4MTN A;  5C44 H;  4DR1 L;  1GM5 A;  3H0G H;  1I94 L;  1PH7 A;  4IOC A;  2YTX A;  2E2I H;  1KQS A;  4IPG A;  2CCZ A;  2KCT A;  1CKO A;  4JBM A;  3PO2 G;  3GTQ H;  3CP0 A;  4DPG A;  3JAM i;  1NMG A;  2AWO A;  4X64 Q;  3W1B A;  1QVC A;  2FXQ A;  5IYC H;  3G6E A;  2OWO A;  5HY6 A;  3KFU A;  1YHQ A;  3PV0 A;  4X64 L;  1Y1W H;  1PA6 A;  4WJ3 M;  1LTL A;  1MIU A;  4DR3 L;  4LW1 A;  1T9H A;  2NVY H;  3CQZ H;  1R9T H;  4A76 A;  4GLV B;  2JEB I;  3J80 i;  4A75 A;  3S1M H;  2VNU D;  2JA8 G;  4IOA A;  4DV6 L;  3PGZ A;  4OON A;  2K52 A;  4LF9 L;  4DR5 Q;  1A8V A;  1E1O A;  1KRT A;  1X9N A;  4IPD A;  1IZ6 A;  5IT9 c;  1Q7Y C;  3L0O A;  4DV0 Q;  3TRE A;  3HOZ H;  5IP7 H;  1VQJ A;  4YWK A;  3G71 A;  4DAM A;  2AHO B;  1NY4 A;  1IBK L;  1K8G A;  2PI2 A;  2QGQ A;  4DV4 L;  4AQY Q;  4JCV E;  4DR4 L;  3AFQ A;  3HOY H;  1PH8 A;  5BR8 Q;  1JT8 A;  1GKH A;  2WFW A;  1RL2 A;  2KCM A;  4R4I A;  2UUA Q;  2UUC Q;  2RHQ B;  3M85 A;  1HNZ Q;  3S16 H;  4X62 L;  2UUA L;  4GKK L;  5IYD G;  1XJV A;  1GVP A;  5IYB G;  4A3D G;  4B3S Q;  2CKZ B;  1PH3 A;  1N33 L;  3A5U A;  4OX9 Q;  2PQA B;  1Y14 B;  2HQL A;  4IO9 A;  3UDX A;  2KBN A;  4GOP B;  3S1Q H;  4DR7 Q;  3ULJ A;  3ER0 A;  3PF5 A;  1SE8 A;  4JI4 Q;  3TS2 A;  2QA4 A;  2HHH Q;  1LUZ A;  3SGI A;  4JI4 L;  2UUB L;  5C4J H;  2B63 G;  2HHH L;  3RZD H;  3PF4 A;  2EXD A;  3KDF B;  3MEF A;  4PZ8 A;  1X56 A;  5LMU Q;  4NXN Q;  1I3Q H;  2ZTD A;  2K50 A;  4P75 A;  3RLN A;  1VQ9 A;  3TRZ A;  4JYA Q;  1VCI A;  4NXN L;  5JEA G;  1HZ9 A;  1UWV A;  1JMC A;  2B29 A;  1J6Q A;  1E3P A;  5FJ8 H;  1FGU A;  3J7Z C;  2WAQ E;  4GNX B;  2WP8 J;  3KF6 B;  4K0K L;  3UE0 A;  2UXD L;  2PQA A;  1X55 A;  1NTG A;  3F1Z A;  5JEA J;  3CCQ A;  4UP8 A;  1L1O C;  1WI5 A;  1L0W A;  2XGT A;  4GOP A;  3HFZ B;  5AJ3 L;  3CXC A;  2E2H H;  4JI7 L;  4AIM A;  4B3R L;  3J81 c;  4JBK A;  3I7F A;  3LGJ A;  1NBW A;  1XNQ L;  1VQN A;  4A93 G;  3KDF A;  5GAG C;  2K5N A;  4LNQ A;  1HNW L;  2Q2I A;  3T1H Q;  1K83 H;  3U4Z A;  2B3G A;  3T1H L;  1CUK A;  3CF5 A;  2R93 G;  3RN5 A;  4YY3 L;  2MNA A;  4Y7N H;  4JBW A;  2JA6 G;  5FLM H;  2UU9 Q;  1P8L A;  2ZTC A;  1Q81 C;  1VQ7 A;  1I6H H;  4GNX A;  3HOU H;  3KF6 A;  3FHW A;  1JJ2 A;  3HOW G;  4H02 A;  2I5L X;  5C0X G;  4C2M H;  2F4V Q;  5ELO A;  3L7Z C;  3JC6 6;  5GRO A;  4DAY B;  4JI0 Q;  5EAY A;  1MJC A;  2IY5 B;  1PVO A;  3UDI A;  4YWL A;  1VQ8 A;  3BJU A;  5C0X J;  1DGS A;  4JI1 L;  4P72 A;  2OQK A;  4LF6 L;  4ME3 A;  1VQG A;  4JG2 A;  3RR5 A;  3CD6 A;  4UPA A;  2VS1 A;  4DR6 Q;  1H95 A;  4LF7 Q;  1Q46 A;  4J15 A;  4P73 A;  5C3E G;  1YIJ A;  4LF7 L;  5J3B A;  1VQB A;  5H1S E;  2Z6K A;  4PMW A;  4JI2 L;  3U58 A;  5JJI A;  4LFC L;  5C4X G;  1Q1B A;  1AE3 A;  3HOX H;  2JA5 G;  2JA8 H;  2ZJP A;  3D31 A;  1X6O A;  4X66 L;  2R92 H;  5DLQ E;  4A3C H;  4IPC A;  2RHS B;  4KHP L;  2JE6 I;  1XMQ Q;  4UY8 C;  3B6Y A;  1KAW A;  1NMF A;  2EIF A;  4NXM Q;  1VQH A;  5JJK A;  1TXY A;  4GN4 B;  5LMN W;  4L5Q A;  4DUZ L;  2XTI A;  3FKI G;  2ZM6 L;  3GTL H;  3I2Z A;  4NB3 A;  3OW2 A;  1OTC A;  3PUW A;  3PUY A;  4DUY L;  4DV2 Q;  4QGU A;  4JI8 L;  4DV2 L;  2IX0 A;  1XMO Q;  4A3L H;  3BU2 A;  4NPS A;  3RLO A;  3GTP H;  4A3D H;  2UXC L;  5IYD H;  4C3H H;  2R7D A;  4DV5 Q;  4BXX G;  2JA7 H;  5M5Y H;  3S2D H;  2V1C C;  1JJG A;  1IBM Q;  3NEL A;  1FJG Q;  1SN8 A;  2BA0 A;  1IBM L;  3GTJ H;  1J5E Q;  2E2J H;  5ELN A;  2N78 A;  1S40 A;  1G51 A;  1KHI A;  1YJW A;  4LF4 Q;  4ALP A;  1WOC A;  2OCE A;  1JJC B;  4PZ7 A;  4AYB E;  1N8R C;  3S2H H;  3STB D;  3AFP A;  2GN5 A;  2VZA A;  3E9I A;  3K0X A;  1SMX A;  3GTK H;  1U5K A;  2YTY A;  1PH1 A;  1EQQ A;  2K4K A;  2Q2T A;  3M4O H;  4YHH Q;  3K81 C;  4BBR G;  1EQR A;  1BKB A;  2JA9 A;  1VQ5 A;  1PHJ A;  3NEM A;  4OWW B;  3PSI A;  1FL0 A;  3CAM A;  3IRB A;  2CFM A;  5M5X H;  4JI6 Q;  1TWA H;  1G29 1;  3W1G A;  2IX1 A;  5IP9 G;  4BBS H;  2LXK A;  1TWC H;  1V9P A;  4GN3 B;  3F2D A;  4DR5 L;  1U0L A;  4JC0 A;  1HR0 Q;  2VW9 A;  1M90 C;  3S15 H;  3CC4 A;  3M4P A;  4LFA Q;  4DV0 L;  3H15 A;  5M3M G;  3S17 H;  1KXL A;  2IHF A;  2NVQ H;  3I56 A;  4GS3 A;  2YTV A;  2OTL A;  1VS0 A;  4AQY L;  3HOW H;  4LF5 Q;  2DUD A;  3NEN A;  2R7Z G;  4RMF A;  1V1Q A;  4DK6 C;  4B3M Q;  1D7Q A;  5BR8 L;  2NN6 I;  1LM0 A;  1P16 A;  2ZJQ A;  2UUC L;  2Q2U A;  3J81 j;  3KOJ A;  4TVA B;  1CKN B;  2YV5 A;  1S3O A;  4P71 A;  1HNZ L;  2VUM G;  1X3G A;  2R6G A;  4JV5 L;  2OQ0 A;  1KD1 C;  5GAE C;  4B3S L;  3J81 i;  1SR3 A;  4OX9 L;  1M1K C;  4HIO A;  1XPU A;  1CSP A;  1UE1 A;  4A3B G;  1VQO A;  3ULL A;  2LXJ A;  1QVG A;  2ASB A;  3S1N H;  4DR7 L;  2VL6 A;  1K73 C;  4BY7 H;  2Z0S A;  4PZ6 A;  5C3E H;  4A3I H;  4A3F G;  4R4O A;  4WJ4 A;  2JJQ A;  1JE5 A;  2VQE Q;  4OWT B;  5IWA Q;  5LMN Q;  4A3M H;  3PUX A;  3CC7 A;  3F8T A;  5LMN L;  2MQH A;  5LMU L;  4JYA L;  1PH6 A;  2JA5 H;  4MNO A;  2GVB A;  2K5V A;  4XIG S;  2HIV A;  3PO3 G;  2WB1 G;  1O7I A;  1CKN A;  3UDF A;  4X65 Q;  3OYY A;  2A8V A;  3CPF A;  4GKJ Q;  3UDG A;  1GD7 A;  2WAQ G;  2BH2 A;  3DM3 A;  4A3J G;  4A3G H;  1YVC A;  2C35 B;  4JV5 Q;  1YJN A;  4KI0 A;  4JOI A;  1W3S A;  5M3F G;  2N8N A;  1TWF H;  4LF8 Q;  4DKA C;  4IPH A;  1GO3 E;  1Y1V G;  3E9H A;  5C44 G;  4DV1 Q;  4BY1 H;  1E7Z A;  4GOP C;  3EIV A;  1IBL Q;  2JQO A;  4DNI A;  1EIY B;  4MZ9 A;  2AMC B;  3PCO B;  4BXX H;  2Y0S E;  2UU9 L;  5IYC G;  4BA2 I;  3GDE A;  2RF4 A;  3HOV G;  2QEX A;  2NVX H;  1PFS A;  3CCJ A;  2AKW B;  2D62 A;  3CW2 C;  3WWV A;  4HIM A;  1YHB A;  2ZJR A;  1LYL A;  1NJI C;  1HR0 W;  2F4V L;  4JI0 L;  4GNX C;  1VQD A;  3GO5 A;  2ATW A;  1C0A A;  1SLJ A;  3K80 C;  1SRO A;  3OTO Q;  3GD7 A;  3BZC A;  1K8A C;  3PO2 H;  1VQF A;  1A62 A;  1ASY A;  4B3T Q;  5IP7 G;  4KLK A;  4DR6 L;  4QQB X;  1X3E A;  2LSS A;  1TWH H;  4BBR H;  4DV7 Q;  1OXU A;  2PI2 E;  5K36 G;  4A4I A;  4X6A H;  4JI3 Q;  3S14 H;  3HOY G;  2I0Q A;  3A74 A;  4IFD G;  5IP9 H;  3ERS X;  1X3F A;  2KHI A;  3CCM A;  3G48 A;  1N32 Q;  2D0O A;  2OTJ A;  1B7Y B;  2IHE A;  4UP7 A;  2Z6K C;  1N32 L;  4IFD J;  3NBH B;  1XMQ L;  1QZH A;  1N34 Q;  4NXM L;  1YHA A;  4HJ9 A;  3CCR A;  2HIX A;  1VQK A;  5M3M H;  1N34 L;  1UE7 A;  1XTD A;  2KHJ A;  2K5H A;  1HZA A;  2K14 A;  4POF A;  3CCS A;  4HIK A;  2ZTE A;  4DR2 Q;  1KRS A;  1IL2 A;  2R7Z H;  1HNX Q;  4DR2 L;  4A3K G;  1PH5 A;  3RN2 A;  4L5S A;  3AQQ A;  1B70 B;  1XMO L;  5IYB H;  2VUM H;  4JI5 Q;  1OXX K;  4BA1 I;  4DV5 L;  1VQE A;  2DGY A;  4A3B H;  3S24 A;  3KF8 B;  4IFD I;  1I5F A;  2F3I A;  1FJG L; 
#chains in the Genus database with same CATH topology
 4R4C A;  5GAH C;  1PDQ A;  1EZ6 A;  3H0G B;  3H3V H;  3MXN B;  2KOL A;  1EOV A;  3J80 L;  2K1B A;  1EY9 A;  1SFO H;  1CSQ A;  2JK8 A;  3G4S A;  1R9T B;  1E2V A;  1VQL A;  2B2V C;  2PNH A;  1TVX A;  3OSO A;  5IGC A;  5KNC A;  4YWM A;  4R1J A;  1Y1V H;  1VQM A;  1SE2 A;  3DM1 A;  3KLR A;  2R93 H;  2JA6 H;  1RIP A;  3M4Y A;  3M7N A;  1GUG A;  2EDG A;  1EZ8 A;  2NZO A;  2PMZ E;  1YZ6 A;  5LL6 X;  1TKW B;  1YEZ A;  4J6H A;  4M1U B;  2D2C C;  2O4X A;  3A8J E;  5NUC A;  2EYO A;  1PFB A;  4TQU S;  2UXB Q;  2UXB L;  2R92 G;  1G6P A;  1U4R A;  5C4J B;  1PH9 A;  1TII D;  5I9O A;  1SYC A;  2EQS A;  1IBK Q;  1QVF A;  1G2S A;  2QIL A;  4DV4 Q;  1JB7 A;  5C3X A;  3GTO H;  3PIO A;  1QG7 A;  1SSO A;  5C4X H;  3R2I A;  1EIG A;  4L5R C;  2YYZ A;  5M5W H;  3C3L A;  3V96 A;  4X62 Q;  4A3L G;  4YCV A;  1N33 Q;  4R4T A;  4HAE A;  1C7Y A;  4X65 L;  2JA7 G;  1QUQ A;  4GKJ L;  2E2H B;  1PV4 A;  2EY1 A;  3FKI H;  4AYB B;  3E3X A;  1ENA A;  4BWG B;  2OXP A;  3TME A;  1U4P A;  1S4Z A;  1HJP A;  4A3K H;  1EYC A;  1CFM A;  5HUR A;  1BBU A;  4DV1 L;  1I6H B;  5EJW A;  4EQN A;  5D14 A;  3ULP A;  4K0K Q;  2KUM A;  2NVX B;  1U4M A;  4C2M B;  1Y1W G;  3T13 A;  4JI7 Q;  2EYH A;  3U4V A;  4BBS G;  1C9O A;  4X3T A;  1V1O A;  3HOZ G;  2EYM A;  3VR4 A;  3I70 A;  1A2U A;  3NXW A;  5KND A;  4DV7 L;  4OWX B;  4G57 A;  2N49 A;  2Z4I A;  5FLX c;  2XWB B;  4QMG A;  2SOB A;  4JI1 Q;  2E8G A;  3MXG A;  1JQY D;  4O2D A;  4HTH A;  3IL8 A;  4KN4 C;  2X69 A;  2X6G A;  4OO1 G;  3C1E A;  4DK3 C;  1CTM A;  4BY7 G;  4V0B A;  1Q82 C;  2A73 B;  4JI2 Q;  1D8L A;  3OPO A;  3F2C A;  4UP9 A;  2KEN A;  1VQ4 A;  2L9H A;  1EY8 A;  1BCP F;  1STY A;  3HP3 A;  2F0U A;  3KLW A;  1PYS B;  3NQI A;  3VR5 A;  4ZQ3 A;  5CV9 A;  2EYJ A;  2B2U C;  3JAM L;  3PIP 3;  3NPP A;  2C9O A;  4DUZ Q;  2DY8 A;  2F1M A;  3I4N H;  4QIW E;  2NZ1 D;  5CV4 A;  3TDQ A;  3TS0 A;  4I7Z C;  4DUY Q;  3RZO H;  1BUV T;  4JI8 Q;  1NUC A;  1STG A;  2KVM A;  4LK1 C;  2R7F A;  3GTM H;  3M4O B;  3PO3 H;  3C46 A;  3HKZ G;  3PUZ A;  2A6H D;  3DUZ A;  5M5X B;  1L2F A;  1YNX A;  1ICF B;  5IT9 E;  2IT1 A;  5I6Y A;  2O5I C;  4A93 B;  4RCO A;  1L0Y B;  4DR1 L;  3S15 B;  1GM5 A;  1I94 L;  1WTO A;  2E2I H;  3K6O A;  1F2Y A;  1CKO A;  3MWY W;  3PO2 G;  2F0O A;  4IUR A;  3JAM i;  3HOW B;  2VB2 X;  4X64 Q;  2FXQ A;  3KFU A;  1NNX A;  1YHQ A;  4X64 L;  1LTL A;  4LW1 A;  3S1M H;  2JEB I;  4IOA A;  3TZU A;  2LKV A;  4OON A;  1C8C A;  2PZW A;  4R9W A;  4DR5 Q;  4BY7 B;  4IPD A;  4DV0 Q;  2FHT A;  5IP7 H;  3AB9 A;  1NY4 A;  1WD1 A;  4DR4 L;  2JA5 B;  3HOY H;  2PO4 A;  1PH8 A;  2HCI A;  4QB4 A;  1WTV A;  2UUA Q;  3EQL C;  3VYS A;  3G6J B;  1HNZ Q;  4GKK L;  1MD2 D;  2UUA L;  4A3D G;  4XT1 B;  4C3H G;  3J81 E;  1SXT A;  3UDX A;  2KBN A;  4MN3 A;  1HTL D;  4JI4 Q;  3TS2 A;  2QA4 A;  3SGI A;  4JI4 L;  2UUB L;  1RKN A;  1SEB D;  1ENF A;  2EY2 A;  1GHK A;  1AW7 A;  1I3Q H;  2ZTD A;  3QWN A;  4P75 A;  3HKZ B;  3RLN A;  1VQ9 A;  1VCI A;  1F9Q A;  2TMP A;  1HZ9 A;  1E3P A;  4GNX B;  3KF6 B;  4K6D A;  4C56 C;  4DAV A;  2UXD L;  1TU2 B;  4GOP A;  2O2L D;  2XGT A;  4XQQ A;  4ZCK A;  1CZW A;  1JOK A;  5GAG C;  2K5N A;  4LNQ A;  1K83 H;  3U4Z A;  4I65 A;  1B3Q A;  2R93 G;  1PLF A;  4YY3 L;  2JA6 G;  1Z6H A;  2UU9 Q;  5JAV A;  3HOU H;  1JJ2 A;  3WDN A;  4C1N K;  2AQ1 B;  4DAY B;  5GRO A;  2QKI C;  3BJU A;  1RD9 D;  1H9K A;  2F0P A;  1EY4 A;  4JG2 A;  1K8O A;  3KLS A;  1H95 A;  1LT3 D;  3AU7 A;  3T51 B;  1LT6 D;  2G9D A;  4BS9 A;  4G7O C;  4Z9C B;  4NKL A;  5C4X G;  4DFA A;  1WTX A;  5DLQ E;  4A3C H;  2HDL A;  2RHS B;  2JE6 I;  5C5L A;  4XDX A;  1KAW A;  2EIF A;  2SEB D;  4GN4 B;  5LMN W;  1LAC A;  3FKI G;  1DCZ A;  1F9R A;  3I2Z A;  2EY6 A;  3P1H A;  1Q90 A;  3PUY A;  4DV2 Q;  1SFO B;  2WB1 B;  4DV2 L;  1XMO Q;  2F0M A;  1IKM A;  4NPS A;  3GTP H;  4WOR A;  1G91 A;  2D5D A;  3DWQ A;  3S2D H;  5JPM C;  4RGM A;  1PRT F;  2BDN A;  2BA0 A;  2E2J H;  5ELN A;  1A3T A;  1MI2 A;  2B2W A;  1KDA A;  1Y1V B;  2BDO A;  4UHV A;  5FO7 B;  4PZ7 A;  1N8R C;  2R93 B;  3STB D;  3GTK H;  2K32 A;  1EYA A;  4IUT A;  3TP8 A;  3BS1 A;  2K4K A;  1EQR A;  2NUC A;  2PZU A;  1TWA H;  1X32 A;  1SE3 A;  1U0L A;  3T53 B;  1HR0 Q;  4DXG A;  1CA5 A;  2VW9 A;  3GTO B;  3L9A X;  5M3M G;  1RTO A;  1KXL A;  4K6L A;  2RDG A;  2OTL A;  4RKL A;  5M5W B;  3OHX C;  4RGT A;  4LF5 Q;  2DUD A;  1BDO A;  1DON A;  2N55 A;  4HSP A;  3KOJ A;  3J81 j;  5J39 A;  2I07 B;  4CJ2 C;  1KD1 C;  1SR3 A;  4OX9 L;  2K01 A;  1VQO A;  1BOS A;  2LXJ A;  1WTR A;  1QVG A;  3KBX A;  5EKI A;  1K73 C;  1IYU A;  3TP5 A;  1B1Z A;  4A3F G;  2F0T A;  1L0X B;  4A3K B;  2JJQ A;  2RKS A;  2PW7 A;  2VQE Q;  5LMN Q;  2KED A;  4FXD A;  1O7Z A;  1D1I A;  5LMN L;  2MQH A;  4JYA L;  1EQT A;  2GVB A;  4UAI A;  3PO3 G;  3P7J A;  2A8V A;  4U68 A;  2DY7 A;  3UDG A;  2BH2 A;  3D6C A;  1YVC A;  2C35 B;  4KI0 A;  1W3S A;  2N8N A;  3D8G A;  3E9H A;  5D65 A;  1H9S B;  1IBL Q;  4DNI A;  1EIY B;  1KAB A;  2A6H C;  2HQE A;  1DOM A;  2RF4 A;  3HOV G;  1M8A A;  2NVX H;  2AQ2 B;  2AKW B;  4QF4 A;  3WWV A;  3N6R A;  1YHB A;  1ROD A;  1V1P A;  1PZI D;  4GNX C;  5KYI A;  1C0A A;  1BR9 A;  1SLJ A;  3K80 C;  3OMG A;  3GD7 A;  1B50 A;  4FNF A;  5IP7 G;  4KLK A;  1TS4 A;  1X3E A;  1TWH H;  1LTA D;  1OXU A;  1F2M A;  3HOY G;  3A74 A;  4RKB A;  1GUS A;  2NBF A;  5IP9 H;  3WOF A;  3ERS X;  1UAP A;  5EBC A;  2OTJ A;  1KTK A;  3RMH A;  4PMC A;  2MUY A;  2Z6K C;  2ZXP A;  3PQI A;  1QZH A;  2B2Y C;  1QB5 D;  3I4N B;  1VQK A;  3RZO B;  2H4O A;  5IOD A;  3CCS A;  4DR2 Q;  2WKD A;  1IL2 A;  2R7Z H;  4DR2 L;  1DXM A;  3VA5 A;  4L5S A;  1HTP A;  2A74 C;  1B70 B;  2VUM H;  3CKI B;  4KN7 C;  1GUW A;  5C4Z A;  4DV5 L;  4B9X A;  3GTJ B;  1CK1 A;  2DNC A;  1GOZ A;  2B63 H;  1UE5 A;  3A5Z B;  3F2U A;  2E2I B;  1A15 A;  1DM0 B;  3FPP A;  1STB A;  4F8M A;  3CC2 A;  5JEA H;  4OO1 I;  4DV3 Q;  3T1Y Q;  2ICE C;  3FRP B;  5J1Z A;  1PYB A;  5A2Q L;  3GV3 A;  1LV9 A;  3S1M B;  4XYQ A;  2L0C A;  2F0F A;  2F0L A;  2IPK D;  4YHH L;  3L2P A;  2EOT A;  3MXU A;  3J7Y W;  3I4L A;  4RWS C;  3K7A H;  1VQ6 A;  1ZEQ X;  1NR2 A;  1Q12 A;  4A93 H;  4F87 A;  1KIX A;  4AH6 A;  1PYW D;  1Y8P B;  4KD4 A;  2B8F A;  3JAM E;  2XNA C;  2A68 D;  3HOY B;  4F7X A;  3OW7 A;  2FMM A;  5IGG A;  1JOO A;  3ND8 A;  4DR3 Q;  2RCN A;  4FDB A;  4B3M L;  4TKO B;  1OXT A;  4E6I A;  2R3Z A;  1VQP A;  1QUQ B;  4POG A;  3S1N B;  3I90 A;  4OIJ A;  4A3C G;  1T5X D;  3HG9 A;  3NP8 A;  3J7A 5;  1BF4 A;  4A3I B;  3QB3 A;  5FLX L;  2BE5 D;  1I3Q B;  4B08 A;  3VA7 A;  3Q8D A;  1SRU A;  3OIQ A;  4R4Q A;  3MVV A;  5IWA L;  2RBM A;  1CI3 M;  4G7H C;  4CKB A;  1Z47 A;  2QDL A;  1UEA B;  2XN9 C;  4A3G B;  1W2B A;  1MGS A;  1QZG A;  2NZH A;  2K5Q A;  1LAB A;  3D4R A;  1Z9F A;  1K83 B;  1OXV A;  1SYG A;  2Q8R E;  3H0G G;  2CQO A;  4CKC A;  1IW7 D;  1AH9 A;  1L1O A;  1EU3 A;  2KJX A;  3HOU B;  5DNF A;  5FK9 C;  2MO0 A;  1SNO A;  4Y52 H;  4C3J H;  4B3R Q;  4LWC A;  4NP5 A;  5AJ3 Q;  2DNE A;  3M4Q A;  3STB C;  1TWG H;  4H7B A;  1JE4 A;  3FMC A;  4A3E H;  2WII B;  3OTO L;  4HJ5 A;  5HGT A;  1DD2 A;  1WYD A;  3I4M H;  3H3V I;  5ELF A;  2F0G A;  3HS0 C;  3EN2 A;  3S14 B;  5G3L D;  1FR3 A;  2J4X A;  2ICI A;  4ZAI A;  4JI3 L;  1HZC A;  1C4Q A;  1VQA A;  1G2T A;  4GN5 A;  1WTH A;  1TT2 A;  5CGK A;  4LF6 Q;  1WJJ A;  1V43 A;  1MKH A;  2F0V A;  4KY5 A;  5FOB B;  2FMC A;  1B3A A;  4LFC Q;  3GTP B;  4HMJ A;  2PQE A;  1UEB A;  5KIX A;  4QUF A;  4X66 Q;  3DEO A;  2K7V A;  1B8A A;  3MXP A;  4JI5 L;  5FJ8 G;  1NE3 A;  4K5X A;  1LLR D;  4O0A A;  1EY5 A;  3VYU A;  3CME A;  1VDZ A;  2CWP A;  4HED A;  2A6E D;  2ZM6 Q;  3EBE A;  2MO1 A;  3VR3 A;  1MJE A;  3GTK B;  4AYB G;  3W2D A;  2MP1 A;  4PQX A;  1S72 A;  1WCM H;  3URY A;  2UXC Q;  4Q5V A;  2JEA I;  4IUN A;  1KL9 A;  4L5T A;  3DLL A;  1TWA B;  4KKS A;  1EIF A;  3FP9 A;  4HCE A;  4IJL A;  2BOS A;  1JWS D;  4WRD A;  1PH7 A;  4IOC A;  4J1M A;  2KCT A;  4IZ8 A;  1AZP A;  1EU4 A;  3KBG A;  4JBM A;  3CP0 A;  4ME5 A;  2F3V A;  5FO8 B;  1YNJ D;  3TSS A;  3G6E A;  2F4I A;  3FPU B;  2OWO A;  4OEM B;  1EY7 A;  2JYO A;  3CQZ H;  2VNU D;  3J80 i;  3SR1 A;  3PGZ A;  1K3B C;  4XQN A;  4ZK9 B;  1KRT A;  5IT9 c;  3TRE A;  2EYF A;  1VQJ A;  1IBK L;  1XTC D;  1WTW A;  4CGY B;  2EVB A;  4XQJ A;  2RSO A;  3ONA B;  4JCV E;  4DV4 L;  4OIK A;  1H9M A;  1I50 B;  5BR8 Q;  1JT8 A;  2WFW A;  2UUC Q;  4R4I A;  4X62 L;  4JV5 Q;  1GVP A;  4B3S Q;  4FF4 A;  1N33 L;  1Y14 B;  4GOP B;  3D6W A;  1SE8 A;  2B39 A;  4QIW B;  2HHH Q;  2B63 G;  3Q6S A;  3X3N A;  2HHH L;  3PF4 A;  1EOT A;  1Y8N B;  2EXD A;  1I4G A;  3TRZ A;  4CDF C;  3HRZ C;  2PCF B;  5JEA G;  1JMC A;  3NK9 A;  1QJO A;  3J7Z C;  4U67 3;  2WAQ E;  1EFI D;  4K0K L;  1NTG A;  3F1Z A;  4K2K A;  1A2T A;  4JI7 L;  3HFZ B;  5CBA E;  4AIM A;  4K5V A;  5FKA C;  2GA4 B;  3J81 c;  4A93 G;  3KDF A;  1HRJ A;  1F2Z A;  1EWH A;  2B2T A;  5IGF A;  2B3G A;  1CUK A;  1TWH B;  2MNA A;  4Y7N H;  4OL7 A;  5FLM H;  2ZTC A;  4ZKC B;  1Q81 C;  3FHW A;  3OIP A;  3HOW G;  5C0X G;  1ZKO A;  4X3U A;  4JI0 Q;  1MJC A;  3CRK C;  1CT1 D;  2IY5 B;  4JI1 L;  1HPC A;  4P72 A;  5JJZ A;  4CKE A;  4DA2 A;  2A68 C;  1EQV A;  3I72 A;  4LF7 Q;  1Q46 A;  3E5S A;  4MTK A;  3V2T A;  4LF7 L;  2R7Z B;  4KK7 A;  4FF2 A;  1SYE A;  4JI2 L;  1Y69 U;  3ITP A;  2VUM B;  2MHV A;  3MC0 B;  4ZKB B;  1AE3 A;  1PTO F;  3HOX H;  2JA5 G;  2F0H A;  4N9P A;  2JA8 H;  1X6O A;  1CZG A;  3U9S A;  5K5P A;  2B63 B;  1HFG A;  4NXM Q;  2PYK A;  3BDL A;  2BE5 C;  4L5Q A;  4DUZ L;  2XTI A;  4DUY L;  4QGU A;  2K5W A;  4JI8 L;  2L55 A;  5C6A A;  3BU2 A;  3ZYY X;  5IYD H;  4A3J B;  2R7D A;  4BXX G;  2KEE A;  2V1C C;  1JJG A;  3K7A B;  3NEL A;  1FJG Q;  1SN8 A;  3GTJ H;  1J5E Q;  1S40 A;  4S3S A;  1KHI A;  1RHP A;  4LF4 Q;  1IW7 C;  2OCE A;  4OHJ A;  1JJC B;  4AYB E;  3K0X A;  2DJG C;  4O42 A;  1U5K A;  1PH1 A;  1MSG A;  4CHT B;  1EQQ A;  2NVY B;  1PHJ A;  1X3P A;  5CYU A;  4JI6 Q;  4NMZ A;  1TWC H;  2EE1 A;  1SNM A;  4DR5 L;  5AFW A;  4LFA Q;  4DV0 L;  3U9O A;  4GS3 A;  2YTV A;  1QOH A;  2A5H A;  1VS0 A;  5C4H A;  4DK6 C;  3BVZ A;  1P16 A;  2Q2U A;  2E75 C;  4TVA B;  1D5M C;  1HNZ L;  1X3G A;  5A2Q E;  1M1K C;  4HIO A;  2F0I A;  1CSP A;  1UE1 A;  1XPU A;  2M9V A;  3S1N H;  4FF3 A;  2CH4 A;  3GP7 A;  4H13 C;  3RZD B;  5C3E H;  4A3I H;  4R4O A;  3MFG A;  3F8T A;  4FVM A;  1I4P A;  3NE5 B;  4IUU A;  4MNO A;  5IGD A;  2K5V A;  2WB1 G;  4C3J B;  1CKN A;  3UDF A;  3OYY A;  2LY7 A;  4WJW A;  3D4D A;  2A6E C;  4A3G H;  4NW2 A;  4FXK C;  1TWG B;  2PNR C;  1V1P B;  4JOI A;  2D9U A;  2F03 A;  4LAA A;  4IUP A;  4A3E B;  4LF8 Q;  3DWP A;  1ZYR D;  4IPH A;  1Y1V G;  5E4W C;  4BY1 H;  3I4M B;  4OEL B;  4GOP C;  4MZ9 A;  3SEB A;  2AMC B;  1CHP D;  1PMR A;  2UU9 L;  3BYY B;  2QEX A;  2SDF A;  1ILP A;  3CCJ A;  5DEH A;  2D62 A;  2ZJR A;  1LYL A;  1NJI C;  1HR0 W;  4ILW A;  3H6M A;  3O13 A;  3OWF A;  3GO5 A;  4B9W A;  5CMD A;  3BZC A;  1YNJ C;  1K8A C;  4B3T Q;  3DEP A;  3FEW X;  4BBR H;  2PI2 E;  1DJR D;  3G7L A;  4A4I A;  4X6A H;  3S14 H;  4N8X 1;  2EY5 A;  3BG3 A;  1TR5 A;  1X3F A;  3GQB A;  3CCM A;  2D0O A;  1B7Y B;  4UP7 A;  4IFD J;  3R2T A;  1YHA A;  3GTL B;  2HIX A;  2IX3 A;  1SYD A;  3RUZ A;  1UE7 A;  5CV6 A;  1F2L A;  4EGV A;  3QR8 A;  4HIK A;  1WCM B;  1HNX Q;  4A3K G;  1LTB D;  3IFT A;  3RN2 A;  2WIN B;  4Q0F A;  4K8J A;  1EYD A;  1XMO L;  3A7L A;  4BA1 I;  4O1N A;  3M7G A;  4KJO A;  1VQE A;  4A3B H;  2Z6B A;  1KDB A;  3S24 A;  3NBH A;  1XNR Q;  4IFD I;  2F3I A;  2QCP X;  4QCL A;  4F88 A;  4LFB Q;  2CVR A;  3DHQ A;  1BCP D;  2RA4 A;  4IJH A;  1VQI A;  2D0P A;  3Q22 A;  2Z9H A;  4KY6 A;  2VQF Q;  2B2W C;  5E1F A;  2Z8L A;  3HKZ E;  1FGB D;  1AE2 A;  1D1K A;  1SYF A;  1SAP A;  3Q23 A;  2E5L Q;  1E22 A;  5I4D A;  3U50 C;  3CQZ B;  1CA6 A;  2MFI A;  3T56 B;  5DM6 3;  4QY7 A;  3P20 A;  1YI2 A;  2H5X A;  2Q8I B;  2QF7 A;  1HR0 L;  3S17 B;  2Q2H A;  1F77 A;  1EWI A;  2HT1 A;  1E2Z A;  1Q8I A;  3PIP A;  4LF5 L;  5IGE A;  1HCZ A;  4OGQ C;  3J80 E;  4DV6 Q;  3HOX G;  4LF9 Q;  4C3I H;  1N36 Q;  3N52 A;  1N36 L;  4KKU A;  2BH8 A;  2WAC A;  2FIN B;  1CHQ D;  1G8Z D;  2RDF A;  3I4N G;  4A3M B;  3ICE A;  3NSW A;  4DN4 M;  4LUZ A;  1XPR A;  2BCO A;  2VQE L;  5K36 H;  4IN3 A;  1FVI A;  1L1O B;  1HH2 P;  3JAM c;  1I50 H;  4K2L A;  1BCP B;  1JOQ A;  2LS0 1;  3A7A B;  4YCW A;  4XTC S;  4JBJ A;  1KC8 C;  1X65 A;  1H9R A;  4HCS A;  1A0I A;  5BN4 A;  3K59 A;  2ID0 A;  3I3C A;  4Y7N B;  1Q86 C;  1SYB A;  4EQ5 A;  1WFQ A;  1FNV A;  1IBL L;  2OT2 A;  2WB1 E;  4K8I A;  2A19 A;  1TS3 A;  3I73 A;  2Y0S G;  1B2T A;  1HUM A;  4LUO A;  2GVA A;  2F3W A;  4EQP A;  3CPW A;  1S5F D;  3GV6 A;  1XNQ Q;  2AQ3 B;  2HD3 A;  1Q3L A;  4QJF A;  1HNW Q;  2F0Q A;  1A3U A;  3SHL A;  1VQC A;  3W5O A;  3M3Y H;  5DM7 3;  2N3S A;  1PFM A;  4QL5 A;  2MJ8 A;  4HJ8 A;  3NBI A;  1Z7T A;  3HOX B;  2JA8 B;  4KJN A;  3DXJ C;  4LUV A;  5GAD C;  1BBW A;  3T16 A;  4KHZ A;  3BZK A;  4FXG C;  4GLA C;  1QNK A;  1Q1E A;  1RF2 D;  3H94 A;  2AWN A;  1O80 A;  3FDT A;  3AYH B;  1YBY A;  1PXU A;  3NQT A;  5EKL A;  3SVM A;  3X3M A;  5EPK A;  4A3I G;  2ZXR A;  1A3V A;  5D3I B;  4IAL A;  2B8G A;  1F9P A;  1SNQ A;  3I55 A;  4KHP Q;  1E24 A;  1ONL A;  1ASZ A;  3C2P A;  4RG1 A;  1JOR A;  3K7U C;  5C0X I;  4A3G G;  1BXT A;  3KJP A;  3KK7 A;  2WV6 D;  1YIT A;  3ERQ A;  3HGB A;  5CV8 A;  1Q8K A;  2YU9 H;  5F2D A;  2P5Z X;  4BY1 G;  4GZY C;  1QNU A;  1SND A;  2Y0S B;  4DV3 L;  2A1A A;  2ALY B;  3T1Y L;  3RLF A;  4G4K A;  3DWA A;  3PIO 3;  4A3J H;  1JWM D;  2WKC A;  4PG3 A;  3EVQ A;  4X3K A;  3HOU G;  1UE6 A;  1TWC B;  2XIW A;  1K3R A;  3TBI B;  1D5X C;  1ZYR C;  1WD0 A;  5ELB A;  2F0K A;  2QEJ C;  4MTN A;  1ET9 A;  1AEX A;  3K58 A;  5COY A;  2YTX A;  1PRT D;  1KQS A;  5A35 A;  1E2W A;  2G5D A;  4DPG A;  2AWO A;  3W1B A;  5IYC H;  4KKT A;  2RQX A;  5HY6 A;  1PA6 A;  2E74 C;  3PV0 A;  1Y1W H;  2LFN A;  2OF1 A;  4DR3 L;  1T9H A;  2NVY H;  2EJM A;  4GLV B;  4A75 A;  4A76 A;  1O7Y A;  2K52 A;  5JPN C;  2PPB C;  1E1O A;  5CBE E;  3R3O A;  1X9N A;  1IZ6 A;  3BDC A;  1D5Z C;  5C3E B;  1Q7Y C;  3L0O A;  3HOZ H;  1MHW C;  4YWK A;  3G71 A;  1K8G A;  2JN4 A;  2QGQ A;  4AQY Q;  1TY2 A;  2JP1 A;  3AFQ A;  2JXM B;  4ODG A;  3OWE B;  3TN2 A;  1RL2 A;  2KCM A;  3A8I E;  3M85 A;  3S16 H;  4EVO A;  3I91 A;  1PH3 A;  2O5J C;  1BQQ T;  2HQL A;  1LTG D;  1WTQ A;  4DR7 Q;  1LO5 D;  4OO1 H;  3PF5 A;  5KYL A;  4BY1 B;  2FFK B;  3RZD H;  3KDF B;  3MEF A;  5KRU A;  4PZ8 A;  1X56 A;  5LMU Q;  4NXN Q;  4FYD A;  2F0W A;  4NXN L;  1UWV A;  3E0J A;  1PRT B;  1FGU A;  5I6W A;  2WP8 J;  4RHS A;  5KEE A;  2PQA A;  3CCQ A;  2ZXO A;  3EA6 A;  4UP8 A;  1L1O C;  1WI5 A;  1L0W A;  4B3R L;  5AJ3 L;  1BCP C;  1JR0 D;  4JBK A;  1NBW A;  1VQN A;  1I4X A;  2Q2I A;  3T1H Q;  2NN6 H;  2PMZ B;  3T1H L;  3CF5 A;  4BBR B;  4H02 A;  2RVL A;  1IHZ A;  4RCN A;  2F4V Q;  4CJ1 B;  3JC6 6;  1PVO A;  1XX8 A;  1VQ8 A;  3A8K E;  1R4Q B;  4LF6 L;  3CD6 A;  4RHR A;  4DR6 Q;  4J15 A;  1BNZ A;  1YIJ A;  5J3B A;  1VQB A;  4PMW A;  2G9H D;  1EY6 A;  3U58 A;  4LFC L;  1SNP A;  2K03 A;  2CHB D;  3BYT B;  3V05 A;  3D31 A;  2ZJP A;  4A3B B;  4H44 C;  4X66 L;  4IPC A;  1KLU D;  1XMQ Q;  3S9W A;  3A55 A;  5JJK A;  1VQH A;  3VYR A;  3W3A A;  2ZM6 L;  3GTL H;  2XRQ D;  1SMY D;  4NB3 A;  1SBB B;  3LWE A;  1GJX A;  1QIL A;  4K5W A;  2UXC L;  4A3D H;  1CM9 A;  4C3H H;  4V19 0;  5M5Y H;  4ZYS A;  1B9M A;  2RCF A;  5M3F B;  2N78 A;  2X6L A;  5C44 B;  4ALP A;  1M4V A;  1WOC A;  3S2H H;  4JPB W;  4R8I A;  1STH A;  3AFP A;  2GN5 A;  4H0L C;  3GTQ B;  5M9O A;  1GHJ A;  2KCN A;  2B2V A;  4EQO A;  4PMB A;  3BVG A;  4ZLT F;  4KMU C;  4ZUI A;  4CDC C;  1HQR D;  1AZQ A;  2JA9 A;  1BKB A;  1LTI D;  2PW5 A;  4OWW B;  3PSI A;  1FL0 A;  2AUK A;  3IRB A;  4C3I B;  1G29 1;  3W1G A;  1HHV A;  5IP9 G;  2LXK A;  2F0N A;  1V9P A;  1IYV A;  1EL0 A;  3F2D A;  4DK0 A;  1NAP A;  4JC0 A;  2SNS A;  5COR A;  3M4P A;  5IGB A;  3CC4 A;  3P75 A;  4ZRZ A;  3H15 A;  5DAU A;  2EZV A;  3S17 H;  2NVQ H;  3I56 A;  2K05 A;  1B4O A;  1V8Q A;  4L63 B;  2NYZ D;  3NEN A;  2R7Z G;  4RMF A;  5BR8 L;  1LM0 A;  2ZJQ A;  2UUC L;  1CKN B;  2VUM G;  1S3O A;  1NR4 A;  4P71 A;  1WVL A;  4JV5 L;  2R6G A;  1K0S A;  5GAE C;  4R8N A;  4B3S L;  3S1Q B;  3Q24 A;  1I6V C;  3QG1 A;  2VL6 A;  4ZUJ A;  1JC7 A;  3R93 A;  2Z0S A;  2A69 D;  4JW0 A;  2V4D A;  1J8I A;  4WJ4 A;  1JE5 A;  4A3M H;  3PUX A;  1AP0 A;  2DN8 A;  1PTO H;  4XIG S;  4X65 Q;  1O7I A;  4PV1 C;  4GKJ Q;  1GD7 A;  1GXD C;  4A3J G;  5ELC A;  1TWF H;  2IW3 A;  4DKA C;  1GO3 E;  4P2C B;  1ILQ A;  1D6E C;  3MZ5 A;  1II3 A;  4DV1 Q;  3M3Y B;  3EIV A;  2EYP A;  1Y8O B;  2FJ2 A;  3EFX D;  5IYC G;  4BA2 I;  1PFS A;  2B2T C;  3CW2 C;  4HIM A;  1RDP D;  4DNT B;  1PRT C;  4JI0 L;  2F0S A;  1VQD A;  2ATW A;  3QIA A;  3NUC A;  1XXG A;  2SNM A;  3PMF A;  3SK6 A;  1VQF A;  1A62 A;  2QDB A;  4YIJ A;  5E4X A;  5LHY 1;  2L5T A;  3C1F A;  5ISR A;  1VMC A;  4DV7 Q;  2EPB A;  2IWH A;  3IFD A;  3WOE A;  3R8B A;  3CRL C;  2R92 B;  3BDO A;  1FNU A;  4KD3 A;  1R4P B;  2IHE A;  3NBH B;  2K33 A;  1TY0 A;  4NXM L;  1KAA A;  2YU9 B;  3CCR A;  2KHS A;  4N8F A;  5M3M H;  3KUP A;  1KDC A;  1TS5 A;  2K5H A;  2CQA A;  2ZTE A;  1KRS A;  1J9O A;  2XSC A;  1JWU D;  2B2U A;  3AQQ A;  5KNB A;  5IYB H;  2JA7 B;  1OXX K;  4DNR B;  1MBY A;  2DGY A;  4C3J G;  1AFP A;  2K04 A;  1FJG L;  1KNA A;  3VDY A;  1J5E L;  4A3F H;  4LF4 L;  3SDZ A;  3T4A C;  1YJ9 A;  3A54 A;  4A3E G;  4GLX A;  1HXY D;  2NN6 G;  1Y1W B;  2I46 A;  3I4M G;  1E1T A;  1T5E A;  3K5M A;  1STN A;  3TQY A;  4APV A;  4HJ7 A;  5CV7 A;  4BBS B;  3D4W A;  5TSS A;  1EEI D;  3KF8 A;  1DZ1 A;  1LT5 D;  4JI6 L;  4DR1 Q;  1I94 Q;  1SNC A;  3HOZ B;  2BA1 A;  3MXN A;  2VB3 X;  1K28 A;  4FP5 D;  3KJO A;  2E76 C;  2CWA A;  2HDM A;  5CV5 A;  2M00 A;  4M8A A;  4LFA L;  2ES2 A;  2L12 A;  2VY3 A;  5JVH 3;  4YCU A;  3HOV H;  3NHH A;  4HR7 B;  3S16 B;  5IY0 A;  3UE1 A;  3OOC A;  4CJ0 B;  2CW0 D;  1BVS A;  2KCC A;  1B9N A;  1K8M A;  2LMC B;  2NWG A;  3I4O A;  4NDX A;  3RNU A;  2Z1C A;  1XYI A;  1D2B A;  2XRS D;  3CCL A;  1HA5 A;  4EX5 A;  1N9W A;  2QW7 A;  2I5H A;  1ENC A;  1U9R A;  3A0J A;  5LL6 S;  4K14 A;  4DR4 Q;  4MIU A;  4XXE A;  4LMQ D;  2HUG A;  2RSN A;  1WCM G;  3GTG H;  4GKK Q;  5EBD A;  2ZT9 C;  3SK4 A;  3QO2 A;  5JOB A;  1EUJ A;  4HJA A;  2JSO A;  3J80 c;  1HQM C;  1SMY C;  5HGQ A;  3E0E A;  2UUB Q;  1PH4 A;  2EXZ A;  3OMC A;  5GQO A;  4C1N I;  1XWE A;  2DJF C;  4P74 A;  4LF8 L;  3M9B A;  4N9T A;  1NSN S;  4JOI C;  3IAY A;  5FLX E;  4DGZ A;  4UDU C;  2UXD Q;  1VMP A;  1LT4 D;  1MSH A;  1SE4 A;  2I5M X;  3CU7 A;  1ESR A;  1W6J A;  1I4Q A;  1YNN D;  3K5O A;  3PO2 B;  3K5N A;  5EGT A;  1A63 A;  1IKL A;  4DAP A;  4YY3 Q;  3TEH B;  4B3T L;  4CBV A;  2L15 A;  2KA7 A;  3F2B A;  2TSS A;  1OXS C;  3CCV A;  4TRD A;  5EPJ A;  3ZJY C;  1EFW A;  3MA2 B;  2OEO A;  1W6K A;  5D3D A;  5IE8 A;  4OXP A;  3CCU A;  5C5M A;  3AEV A;  2VXW A;  2MPM A;  5FO9 B;  2NVT H;  5I9P A;  5IOC A;  1X3Q A;  3K8A A;  3D0F A;  3S1R H;  1STE A;  2AUJ D;  2L4N A;  1TQO A;  2H1E A;  3NWT A;  4A3D B;  4A3M G;  1RJT A;  2F52 A;  4C3H B;  3SK8 A;  1HNX L;  1XPO A;  5M5Y B;  1S5D D;  1ICW A;  1EYG A;  1IXR A;  1IYJ B;  3CMA A;  5JJL A;  3NTI A;  3PUV A;  1BBX C;  1PH2 A;  2A69 C;  1U4L A;  1XNR L;  1PTO D;  5JVG 3;  3S2H B;  1E0B A;  4HID A;  4LFB L;  1CKM A;  3MEH A;  4HN7 A;  1HZB A;  5E7N A;  1K0R A;  3BVM A;  3I8Z A;  4IUV A;  3HKS A;  2VQF L;  1H9J A;  2CH4 W;  1X54 A;  5FLM G;  2E5L L;  1K9M C;  4XT3 B;  3CCE A;  3A56 A;  1I4R A;  2K75 A;  3KYH C;  5M3F H;  1FNW A;  5T1I A;  2E2D C;  2XVS A;  5T1G A;  5C44 H;  3H0G H;  3VYT A;  2JA6 B;  1ML0 D;  4IPG A;  2CCZ A;  1EIH A;  5EPL A;  2NVQ B;  1S5B D;  1SJH D;  4L6T B;  3GTQ H;  1VF5 C;  2K28 A;  1NMG A;  1QVC A;  1QE6 A;  4WJ3 M;  1MIU A;  1C48 A;  1WTP A;  1R9T H;  2JA8 G;  5CR3 A;  4DV6 L;  4LF9 L;  4DU9 A;  3VR2 A;  4CDD C;  1A8V A;  1LTR D;  1QCB D;  4CDE C;  1LTT D;  4DAM A;  2AHO B;  4HSV A;  2PI2 A;  5C4X B;  1PTO B;  1O7L A;  1PFN A;  1UNS A;  4KV6 A;  5IIF A;  3HZX A;  1QWY A;  4IFD H;  1GKH A;  4PNY A;  1RTN A;  1RCV D;  5I2Y A;  1F9S A;  2RHQ B;  5EQ0 A;  5IYD G;  1XJV A;  1B44 D;  5IYB G;  3QOL A;  2CKZ B;  3A5U A;  2C5C A;  4OX9 Q;  2PQA B;  1JIC A;  4IO9 A;  3FKI B;  3S1Q H;  3ULJ A;  1TWF B;  2K6A A;  3ER0 A;  1AN8 A;  1LUZ A;  5C4J H;  5L37 A;  4DXF A;  2K5D A;  4JYA Q;  2K50 A;  1ZXT A;  3KLS X;  1PZJ D;  4RH6 A;  1HA6 A;  2B29 A;  1J6Q A;  5FJ8 H;  3UE0 A;  5EKK A;  1X55 A;  5JEA J;  1ESF A;  2RDH A;  5CC4 A;  1STA A;  2E2H H;  3CXC A;  2Q8T A;  1DOK A;  2KQ3 A;  1CQV A;  3I7F A;  5ELE A;  3LGJ A;  1XNQ L;  5G3L F;  1DYQ A;  5J22 A;  1HNW L;  1EY0 A;  1KNE A;  3RN5 A;  1SJE D;  4JBW A;  3TZD A;  4RA8 A;  1P8L A;  1VQ7 A;  1I6H H;  2NTT A;  1A6X A;  4GNX A;  1S5C D;  3KF6 A;  3CHB D;  2I5L X;  3ND9 A;  3NWS A;  4KHV A;  4C2M H;  3H09 A;  5ELO A;  1EEF D;  3L7Z C;  5EAY A;  1I4H A;  3UDI A;  4YWL A;  2NB0 A;  5C0X J;  1NCV A;  1DGS A;  2OQK A;  4JK1 C;  5M3M B;  4ME3 A;  1VQG A;  3RR5 A;  4UPA A;  2VS1 A;  3SE0 A;  3TP6 A;  4P73 A;  5C3E G;  4X3S A;  4RGO S;  2CW0 C;  5H1S E;  2Z6K A;  2XWJ B;  5IT9 L;  5JJI A;  2Z4H A;  1Q1B A;  2B2Y A;  1GUO A;  1B53 A;  3H91 A;  1UUP A;  3E6Z X;  2R92 H;  4DAY A;  4KHP L;  4UY8 C;  3B6Y A;  1NMF A;  4A3F B;  3D3R A;  2F0J A;  3IKJ A;  3MTS A;  1TXY A;  4I7A A;  4TSS A;  3RD4 A;  2NTS A;  1LTS D;  3LNN A;  2MGS A;  3OW2 A;  1OTC A;  3PUW A;  3GTM B;  2KEC A;  3PO3 B;  3NTH A;  2IX0 A;  4A3L H;  5KGU A;  3RLO A;  1ET6 A;  1GUN A;  4DV5 Q;  4G7Z C;  2JA7 H;  4FO2 A;  1IBM Q;  1HUN A;  1IBM L;  3SXH A;  3FVQ A;  1G51 A;  1YJW A;  2N88 A;  4HMI A;  2VZA A;  2J0T D;  3E9I A;  3H3V C;  1SMX A;  2YTY A;  3HOV B;  3J81 L;  4RGN A;  2Q2T A;  3M4O H;  4YHH Q;  4KTA A;  2F0D A;  3K81 C;  3SK5 A;  4BBR G;  3K5L A;  1VQ5 A;  1EWC A;  1VF7 A;  3NEM A;  3CAM A;  5M5X H;  2CFM A;  1YNN C;  4BBS H;  2IX1 A;  2HCC A;  4DF7 A;  4WFN 3;  1HFN A;  4GN3 B;  3LX0 A;  1M90 C;  4LJZ C;  3S15 H;  2IHF A;  1DOL A;  4AQY L;  3HOW H;  3GTG B;  5C0X H;  1V1Q A;  1D7Q A;  4B3M Q;  2EJF C;  1SDF A;  4JVZ A;  2NN6 I;  3LWU A;  2YV5 A;  2OQ0 A;  1FYC A;  3J81 i;  4IUQ A;  4A3B G;  3ULL A;  2ASB A;  4DR7 L;  2R61 A;  1CQF A;  4BY7 H;  4PZ6 A;  4OWT B;  5IWA Q;  3CC7 A;  5LMU L;  2IJ0 A;  1PH6 A;  2JA5 H;  2HIV A;  4XYO A;  1JB3 A;  3NTK A;  3MHB A;  5BN3 A;  3CPF A;  1PTO C;  2WAQ G;  3DM3 A;  1TS2 A;  1KLG D;  1OO9 B;  1YJN A;  3QJY A;  5M3F G;  4FF1 A;  3AMU A;  3QOJ A;  5C44 G;  1E7Z A;  2JQO A;  4IQZ A;  3PCO B;  4BXX H;  3HEJ A;  2Y0S E;  3GDE A;  2IL8 A;  2M2L A;  4DK1 A;  5ELD A;  3J7A F;  5I2X A;  3ERO A;  2F4V L;  2NVT B;  3K57 A;  4C3I G;  1GUT A;  3S1R B;  5E3F A;  1SRO A;  3OTO Q;  1PZK D;  3PO2 H;  3BZD B;  1H9S A;  1ASY A;  3K0Y A;  5BN5 A;  4DR6 L;  4QQB X;  4ULL A;  2LSS A;  5K36 G;  3MFY A;  2L11 A;  4JI3 Q;  3Q0A A;  2I0Q A;  1FD7 D;  4IFD G;  4ID6 A;  3UI2 A;  2EYL A;  4RFB A;  2KHI A;  3G48 A;  1N32 Q;  1JCK B;  1S5E D;  5C3W A;  3VR6 A;  2J7Z A;  3DMU A;  1N32 L;  2L1B A;  1XMQ L;  1N34 Q;  4HJ9 A;  1IL8 A;  2F0E A;  1N34 L;  3MAQ A;  3TP7 A;  4L8J A;  4ABN A;  1XTD A;  1O78 A;  2KHJ A;  1HZA A;  4J8Q A;  2K14 A;  4MHE A;  4POF A;  2ENB A;  2PZT A;  3EJI A;  1PH5 A;  2EJG C;  3L3O C;  2WAQ B;  4RAU C;  3S2D B;  4JI5 Q;  4QUC A;  1G6Z A;  4KY7 A;  3J7A V;  2E2J B;  1BO0 A;  3KF8 B;  1I5F A; 
#chains in the Genus database with same CATH homology
 1UE5 A;  4R4C A;  3A5Z B;  5GAH C;  3VDY A;  1J5E L;  4A3F H;  3H3V H;  4LFB Q;  4LF4 L;  3MXN B;  1YJ9 A;  1EOV A;  4IJH A;  1VQI A;  2D0P A;  3CC2 A;  4OO1 I;  4A3E G;  2VQF Q;  4DV3 Q;  4GLX A;  3T1Y Q;  2NN6 G;  3HKZ E;  1CSQ A;  1AE2 A;  2JK8 A;  1SFO H;  1PYB A;  3I4M G;  1E1T A;  3G4S A;  2E5L Q;  1E22 A;  3U50 C;  3TQY A;  4APV A;  4YHH L;  3L2P A;  4HJ7 A;  1VQL A;  2MFI A;  4QY7 A;  2PNH A;  1YI2 A;  3K7A H;  2H5X A;  4JI6 L;  1VQ6 A;  4YWM A;  4DR1 Q;  4R1J A;  1I94 Q;  1Q12 A;  4A93 H;  1KIX A;  1Y1V H;  4AH6 A;  1VQM A;  2BA1 A;  1HR0 L;  3KJO A;  2R93 H;  2JA6 H;  2CWA A;  2Q2H A;  1RIP A;  4LFA L;  3M7N A;  1EWI A;  2NZO A;  1YZ6 A;  2PMZ E;  2ES2 A;  2HT1 A;  2VY3 A;  1YEZ A;  4YCU A;  3HOV H;  4DR3 Q;  2RCN A;  4FDB A;  5IY0 A;  3UE1 A;  3PIP A;  4LF5 L;  4TQU S;  1BVS A;  3I4O A;  4DV6 Q;  3RNU A;  3HOX G;  4B3M L;  2UXB Q;  1OXT A;  4LF9 Q;  4C3I H;  2UXB L;  1VQP A;  2R92 G;  1N36 Q;  1QUQ B;  1G6P A;  4POG A;  4A3C G;  1N36 L;  3CCL A;  4EX5 A;  1N9W A;  2BH8 A;  1PH9 A;  3J7A 5;  2EQS A;  1IBK Q;  1QVF A;  2I5H A;  3A0J A;  3I4N G;  4DV4 Q;  1JB7 A;  3ICE A;  3GTO H;  4DR4 Q;  3PIO A;  1XPR A;  4LUZ A;  2VQE L;  3Q8D A;  1SRU A;  4R4Q A;  5C4X H;  5IWA L;  1FVI A;  4L5R C;  2YYZ A;  5M5W H;  1L1O B;  1HH2 P;  3JAM c;  1WCM G;  4X62 Q;  1I50 H;  3GTG H;  4A3L G;  4YCV A;  4GKK Q;  1N33 Q;  4R4T A;  1Z47 A;  1C7Y A;  4X65 L;  2B63 H;  1EUJ A;  1QUQ A;  2JA7 G;  4HJA A;  4GKJ L;  4YCW A;  1W2B A;  1PV4 A;  4XTC S;  3J80 c;  4JBJ A;  1QZG A;  1KC8 C;  2NZH A;  2UUB Q;  3FKI H;  1X65 A;  3E0E A;  5HGQ A;  1PH4 A;  1A0I A;  2ID0 A;  1Z9F A;  5GQO A;  1OXV A;  3H0G G;  2CQO A;  4P74 A;  4LF8 L;  1HJP A;  3M9B A;  4A3K H;  1Q86 C;  4DV1 L;  1AH9 A;  1BBU A;  4EQ5 A;  1WFQ A;  1L1O A;  1IBL L;  4JOI C;  2WB1 E;  2MO0 A;  3ULP A;  4K0K Q;  2A19 A;  4Y52 H;  2UXD Q;  2Y0S G;  1Y1W G;  4LUO A;  4C3J H;  2GVA A;  4JI7 Q;  4B3R Q;  4LWC A;  5AJ3 Q;  3U4V A;  3CPW A;  2I5M X;  3M4Q A;  4BBS G;  3STB C;  1C9O A;  1TWG H;  1XNQ Q;  4QJF A;  1HNW Q;  4A3E H;  1A63 A;  3OTO L;  4YY3 Q;  3TEH B;  4HJ5 A;  3HOZ G;  1VQC A;  1WYD A;  3W5O A;  3I4M H;  2N3S A;  3M3Y H;  4B3T L;  3H3V I;  4QL5 A;  2L15 A;  3EN2 A;  4HJ8 A;  3F2B A;  1OXS C;  4DV7 L;  4OWX B;  3CCV A;  1EFW A;  3ZJY C;  4JI3 L;  2N49 A;  4LUV A;  5GAD C;  1BBW A;  1HZC A;  1VQA A;  5FLX c;  4KHZ A;  3BZK A;  4GLA C;  4GN5 A;  4OXP A;  5IE8 A;  3CCU A;  3AEV A;  4JI1 Q;  2NVT H;  2E8G A;  3K8A A;  4LF6 Q;  4O2D A;  1Q1E A;  3D0F A;  3S1R H;  1WJJ A;  1V43 A;  2AWN A;  4OO1 G;  1MKH A;  3AYH B;  4DK3 C;  1YBY A;  4BY7 G;  1Q82 C;  4A3I G;  4JI2 Q;  4LFC Q;  1D8L A;  3F2C A;  4A3M G;  4UP9 A;  2F52 A;  1XNR Q;  1UEB A;  1HNX L;  1XPO A;  2KEN A;  4X66 Q;  1VQ4 A;  1B8A A;  1IXR A;  1IYJ B;  3CMA A;  3I55 A;  1EYG A;  4JI5 L;  1E24 A;  5FJ8 G;  4KHP Q;  1NE3 A;  1ASZ A;  5JJL A;  3KLW A;  3PUV A;  4O0A A;  1PYS B;  4RG1 A;  1PH2 A;  3K7U C;  5C0X I;  3CME A;  4A3G G;  3KJP A;  2CWP A;  1XNR L;  4DUZ Q;  1YIT A;  2ZM6 Q;  4HID A;  3EBE A;  3I4N H;  4QIW E;  4LFB L;  1Q8K A;  1CKM A;  2MO1 A;  2YU9 H;  3TS0 A;  1MJE A;  4DUY Q;  4AYB G;  3RZO H;  1HZB A;  5E7N A;  4JI8 Q;  1K0R A;  1S72 A;  4BY1 G;  2R7F A;  3HKS A;  3GTM H;  1WCM H;  2UXC Q;  2VQF L;  4DV3 L;  3PO3 H;  2A1A A;  2ALY B;  2JEA I;  3T1Y L;  1X54 A;  3HKZ G;  5FLM G;  3PUZ A;  3RLF A;  1KL9 A;  4L5T A;  1L2F A;  2E5L L;  3DLL A;  4A3J H;  3HOU G;  1YNX A;  4PG3 A;  1K9M C;  1UE6 A;  3CCE A;  2IT1 A;  1EIF A;  1K3R A;  2K75 A;  3KYH C;  5M3F H;  3FP9 A;  4IJL A;  4MTN A;  5C44 H;  4DR1 L;  1GM5 A;  3H0G H;  1I94 L;  1PH7 A;  4IOC A;  2YTX A;  2E2I H;  1KQS A;  4IPG A;  2CCZ A;  2KCT A;  1CKO A;  4JBM A;  3PO2 G;  3GTQ H;  3CP0 A;  4DPG A;  3JAM i;  1NMG A;  2AWO A;  4X64 Q;  3W1B A;  1QVC A;  2FXQ A;  5IYC H;  3G6E A;  2OWO A;  5HY6 A;  3KFU A;  1YHQ A;  3PV0 A;  4X64 L;  1Y1W H;  1PA6 A;  4WJ3 M;  1LTL A;  1MIU A;  4DR3 L;  4LW1 A;  1T9H A;  2NVY H;  3CQZ H;  1R9T H;  4A76 A;  4GLV B;  2JEB I;  3J80 i;  4A75 A;  3S1M H;  2VNU D;  2JA8 G;  4IOA A;  4DV6 L;  3PGZ A;  4OON A;  2K52 A;  4LF9 L;  4DR5 Q;  1A8V A;  1E1O A;  1KRT A;  1X9N A;  4IPD A;  1IZ6 A;  5IT9 c;  1Q7Y C;  3L0O A;  4DV0 Q;  3TRE A;  3HOZ H;  5IP7 H;  1VQJ A;  4YWK A;  3G71 A;  4DAM A;  2AHO B;  1NY4 A;  1IBK L;  1K8G A;  2PI2 A;  2QGQ A;  4DV4 L;  4AQY Q;  4JCV E;  4DR4 L;  3AFQ A;  3HOY H;  1PH8 A;  5BR8 Q;  1JT8 A;  1GKH A;  2WFW A;  1RL2 A;  2KCM A;  4R4I A;  2UUA Q;  2UUC Q;  2RHQ B;  3M85 A;  1HNZ Q;  3S16 H;  4X62 L;  2UUA L;  4GKK L;  5IYD G;  1XJV A;  1GVP A;  5IYB G;  4A3D G;  4B3S Q;  2CKZ B;  1PH3 A;  1N33 L;  3A5U A;  4OX9 Q;  2PQA B;  1Y14 B;  2HQL A;  4IO9 A;  3UDX A;  2KBN A;  4GOP B;  3S1Q H;  4DR7 Q;  3ULJ A;  3ER0 A;  3PF5 A;  1SE8 A;  4JI4 Q;  3TS2 A;  2QA4 A;  2HHH Q;  1LUZ A;  3SGI A;  4JI4 L;  2UUB L;  5C4J H;  2B63 G;  2HHH L;  3RZD H;  3PF4 A;  2EXD A;  3KDF B;  3MEF A;  4PZ8 A;  1X56 A;  5LMU Q;  4NXN Q;  1I3Q H;  2ZTD A;  2K50 A;  4P75 A;  3RLN A;  1VQ9 A;  3TRZ A;  4JYA Q;  1VCI A;  4NXN L;  5JEA G;  1HZ9 A;  1UWV A;  1JMC A;  2B29 A;  1J6Q A;  1E3P A;  5FJ8 H;  1FGU A;  3J7Z C;  2WAQ E;  4GNX B;  2WP8 J;  3KF6 B;  4K0K L;  3UE0 A;  2UXD L;  2PQA A;  1X55 A;  1NTG A;  3F1Z A;  5JEA J;  3CCQ A;  4UP8 A;  1L1O C;  1WI5 A;  1L0W A;  2XGT A;  4GOP A;  3HFZ B;  5AJ3 L;  3CXC A;  2E2H H;  4JI7 L;  4AIM A;  4B3R L;  3J81 c;  4JBK A;  3I7F A;  3LGJ A;  1NBW A;  1XNQ L;  1VQN A;  4A93 G;  3KDF A;  5GAG C;  2K5N A;  4LNQ A;  1HNW L;  2Q2I A;  3T1H Q;  1K83 H;  3U4Z A;  2B3G A;  3T1H L;  1CUK A;  3CF5 A;  2R93 G;  3RN5 A;  4YY3 L;  2MNA A;  4Y7N H;  4JBW A;  2JA6 G;  5FLM H;  2UU9 Q;  1P8L A;  2ZTC A;  1Q81 C;  1VQ7 A;  1I6H H;  4GNX A;  3HOU H;  3KF6 A;  3FHW A;  1JJ2 A;  3HOW G;  4H02 A;  2I5L X;  5C0X G;  4C2M H;  2F4V Q;  5ELO A;  3L7Z C;  3JC6 6;  5GRO A;  4DAY B;  4JI0 Q;  5EAY A;  1MJC A;  2IY5 B;  1PVO A;  3UDI A;  4YWL A;  1VQ8 A;  3BJU A;  5C0X J;  1DGS A;  4JI1 L;  4P72 A;  2OQK A;  4LF6 L;  4ME3 A;  1VQG A;  4JG2 A;  3RR5 A;  3CD6 A;  4UPA A;  2VS1 A;  4DR6 Q;  1H95 A;  4LF7 Q;  1Q46 A;  4J15 A;  4P73 A;  5C3E G;  1YIJ A;  4LF7 L;  5J3B A;  1VQB A;  5H1S E;  2Z6K A;  4PMW A;  4JI2 L;  3U58 A;  5JJI A;  4LFC L;  5C4X G;  1Q1B A;  1AE3 A;  3HOX H;  2JA5 G;  2JA8 H;  2ZJP A;  3D31 A;  1X6O A;  4X66 L;  2R92 H;  5DLQ E;  4A3C H;  4IPC A;  2RHS B;  4KHP L;  2JE6 I;  1XMQ Q;  4UY8 C;  3B6Y A;  1KAW A;  1NMF A;  2EIF A;  4NXM Q;  1VQH A;  5JJK A;  1TXY A;  4GN4 B;  5LMN W;  4L5Q A;  4DUZ L;  2XTI A;  3FKI G;  2ZM6 L;  3GTL H;  3I2Z A;  4NB3 A;  3OW2 A;  1OTC A;  3PUW A;  3PUY A;  4DUY L;  4DV2 Q;  4QGU A;  4JI8 L;  4DV2 L;  2IX0 A;  1XMO Q;  4A3L H;  3BU2 A;  4NPS A;  3RLO A;  3GTP H;  4A3D H;  2UXC L;  5IYD H;  4C3H H;  2R7D A;  4DV5 Q;  4BXX G;  2JA7 H;  5M5Y H;  3S2D H;  2V1C C;  1JJG A;  1IBM Q;  3NEL A;  1FJG Q;  1SN8 A;  2BA0 A;  1IBM L;  3GTJ H;  1J5E Q;  2E2J H;  5ELN A;  2N78 A;  1S40 A;  1G51 A;  1KHI A;  1YJW A;  4LF4 Q;  4ALP A;  1WOC A;  2OCE A;  1JJC B;  4PZ7 A;  4AYB E;  1N8R C;  3S2H H;  3STB D;  3AFP A;  2GN5 A;  2VZA A;  3E9I A;  3K0X A;  1SMX A;  3GTK H;  1U5K A;  2YTY A;  1PH1 A;  1EQQ A;  2K4K A;  2Q2T A;  3M4O H;  4YHH Q;  3K81 C;  4BBR G;  1EQR A;  1BKB A;  2JA9 A;  1VQ5 A;  1PHJ A;  3NEM A;  4OWW B;  3PSI A;  1FL0 A;  3CAM A;  3IRB A;  2CFM A;  5M5X H;  4JI6 Q;  1TWA H;  1G29 1;  3W1G A;  2IX1 A;  5IP9 G;  4BBS H;  2LXK A;  1TWC H;  1V9P A;  4GN3 B;  3F2D A;  4DR5 L;  1U0L A;  4JC0 A;  1HR0 Q;  2VW9 A;  1M90 C;  3S15 H;  3CC4 A;  3M4P A;  4LFA Q;  4DV0 L;  3H15 A;  5M3M G;  3S17 H;  1KXL A;  2IHF A;  2NVQ H;  3I56 A;  4GS3 A;  2YTV A;  2OTL A;  1VS0 A;  4AQY L;  3HOW H;  4LF5 Q;  2DUD A;  3NEN A;  2R7Z G;  4RMF A;  1V1Q A;  4DK6 C;  4B3M Q;  1D7Q A;  5BR8 L;  2NN6 I;  1LM0 A;  1P16 A;  2ZJQ A;  2UUC L;  2Q2U A;  3J81 j;  3KOJ A;  4TVA B;  1CKN B;  2YV5 A;  1S3O A;  4P71 A;  1HNZ L;  2VUM G;  1X3G A;  2R6G A;  4JV5 L;  2OQ0 A;  1KD1 C;  5GAE C;  4B3S L;  3J81 i;  1SR3 A;  4OX9 L;  1M1K C;  4HIO A;  1XPU A;  1CSP A;  1UE1 A;  4A3B G;  1VQO A;  3ULL A;  2LXJ A;  1QVG A;  2ASB A;  3S1N H;  4DR7 L;  2VL6 A;  1K73 C;  4BY7 H;  2Z0S A;  4PZ6 A;  5C3E H;  4A3I H;  4A3F G;  4R4O A;  4WJ4 A;  2JJQ A;  1JE5 A;  2VQE Q;  4OWT B;  5IWA Q;  5LMN Q;  4A3M H;  3PUX A;  3CC7 A;  3F8T A;  5LMN L;  2MQH A;  5LMU L;  4JYA L;  1PH6 A;  2JA5 H;  4MNO A;  2GVB A;  2K5V A;  4XIG S;  2HIV A;  3PO3 G;  2WB1 G;  1O7I A;  1CKN A;  3UDF A;  4X65 Q;  3OYY A;  2A8V A;  3CPF A;  4GKJ Q;  3UDG A;  1GD7 A;  2WAQ G;  2BH2 A;  3DM3 A;  4A3J G;  4A3G H;  1YVC A;  2C35 B;  4JV5 Q;  1YJN A;  4KI0 A;  4JOI A;  1W3S A;  5M3F G;  2N8N A;  1TWF H;  4LF8 Q;  4DKA C;  4IPH A;  1GO3 E;  1Y1V G;  3E9H A;  5C44 G;  4DV1 Q;  4BY1 H;  1E7Z A;  4GOP C;  3EIV A;  1IBL Q;  2JQO A;  4DNI A;  1EIY B;  4MZ9 A;  2AMC B;  3PCO B;  4BXX H;  2Y0S E;  2UU9 L;  5IYC G;  4BA2 I;  3GDE A;  2RF4 A;  3HOV G;  2QEX A;  2NVX H;  1PFS A;  3CCJ A;  2AKW B;  2D62 A;  3CW2 C;  3WWV A;  4HIM A;  1YHB A;  2ZJR A;  1LYL A;  1NJI C;  1HR0 W;  2F4V L;  4JI0 L;  4GNX C;  1VQD A;  3GO5 A;  2ATW A;  1C0A A;  1SLJ A;  3K80 C;  1SRO A;  3OTO Q;  3GD7 A;  3BZC A;  1K8A C;  3PO2 H;  1VQF A;  1A62 A;  1ASY A;  4B3T Q;  5IP7 G;  4KLK A;  4DR6 L;  4QQB X;  1X3E A;  2LSS A;  1TWH H;  4BBR H;  4DV7 Q;  1OXU A;  2PI2 E;  5K36 G;  4A4I A;  4X6A H;  4JI3 Q;  3S14 H;  3HOY G;  2I0Q A;  3A74 A;  4IFD G;  5IP9 H;  3ERS X;  1X3F A;  2KHI A;  3CCM A;  3G48 A;  1N32 Q;  2D0O A;  2OTJ A;  1B7Y B;  2IHE A;  4UP7 A;  2Z6K C;  1N32 L;  4IFD J;  3NBH B;  1XMQ L;  1QZH A;  1N34 Q;  4NXM L;  1YHA A;  4HJ9 A;  3CCR A;  2HIX A;  1VQK A;  5M3M H;  1N34 L;  1UE7 A;  1XTD A;  2KHJ A;  2K5H A;  1HZA A;  2K14 A;  4POF A;  3CCS A;  4HIK A;  2ZTE A;  4DR2 Q;  1KRS A;  1IL2 A;  2R7Z H;  1HNX Q;  4DR2 L;  4A3K G;  1PH5 A;  3RN2 A;  4L5S A;  3AQQ A;  1B70 B;  1XMO L;  5IYB H;  2VUM H;  4JI5 Q;  1OXX K;  4BA1 I;  4DV5 L;  1VQE A;  2DGY A;  4A3B H;  3S24 A;  3KF8 B;  4IFD I;  1I5F A;  2F3I A;  1FJG L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...