4GLVB

Obody am3l09 bound to hen egg-white lysozyme
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
total genus 23
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glvB00
5FLXc 5H1SE 1PHJA 3BZCA 3FKIG 4XIGS 4K0KQ 2A8VA 4RG1A 4LFBQ 3RZDH 4DR4L 1EFWA 1TWGH 4JI3L 1UWVA 5JEAJ 3PUWA 4DPGA 4GKJQ 4HIMA 1HR0Q 1OXXK 2BH8A 4HJ9A 2AKWB 4QJFA 3UDIA 3HOUH 1VQBA 1HNWL 2A19A 2Y0SE 1NMFA 2MO0A 5IP7G 4LF7Q 1BKBA 2Z6KA 1MIUA 2ZTCA 3L7ZC 4NPSA 1ASYA 4A3LH 3AEVA 4DV4Q 3H0GG 1S72A 1HZCA 4PZ8A 4DV3Q 3RLOA 1N33L 4A3IG 1W3SA 4DK3C 5IT9c 4JI4Q 3CC4A 1XNQQ 1K73C 1GM5A 4OX9Q 2K5VA 2WB1G 3KF6A 1NMGA 4BY1G 3CCRA 1PH1A 2VNUD 4JBKA 1GD7A 1Q7YC 2PMZE 1VQDA 4NXNQ 2RHQB 2AWOA 1P16A 3HOXH 1X3GA 2BA0A 1VQ6A 4DR2L 3K80C 4DR7Q 4DV1L 4DR6Q 4DV7Q 2IY5B 3HKZG 3RLNA 1X54A 4DR5L 2I5HA 1I5FA 1VQFA 2NVTH 5HY6A 1XMOL 3GTMH 1L1OC 4X62L 3NENA 3T1HL 1Q86C 4JI8Q 1KIXA 3CPWA 1KQSA 2R7FA 3F2DA 1E7ZA 4GOPC 4UPAA 3A5ZB 5GAEC 1HR0W 2UXDL 4HJ7A 3I4NG 3STBC 2MFIA 3ULLA 4DV0L 3PSIA 3S1MH 2HIVA 4IFDG 3HOZG 2YYZA 1GO3E 1VQEA 3CCJA 1V43A 1ASZA 2VY3A 1JJ2A 1AH9A 3RNUA 1PH8A 2VQFL 2CWPA 1YIJA 2NVYH 3E9IA 3F1ZA 1N9WA 3KOJA 1QZHA 2NZHA 3AQQA 1S40A 4A3GH 1E1TA 3OTOL 5C4XG 5K36G 4B3MQ 4DKAC 1IBML 1VQHA 2ALYB 1V1QA 2JQOA 4A3FG 2UUAL 5IYDG 1RIPA 2I5LX 2QEXA 2Z6KC 1JT8A 4DV2L 4JYAL 3A74A 2H5XA 4GLAC 3I7FA 1DGSA 1BBUA 4WJ4A 2KHJA 1KL9A 4JBWA 4JI5L 4LF6Q 1CUKA 1IBKQ 4X64Q 2RCNA 4R1JA 3RZOH 1IZ6A 3H0GH 1B8AA 3W5OA 4POGA 4IJLA 3TREA 2CCZA 5AJ3Q 4B3ML 4YHHL 4OWXB 5C4JH 3S2HH 2R92H 2WB1E 1YZ6A 2RF4A 3UE0A 2B63G 2CKZB 4IPHA 5LMNL 4EX5A 2EIFA 4LF9L 1I3QH 3OYYA 1N34Q 1VQIA 4BY1H 1JJCB 1Y1VG 3K81C 3U58A 4LFAQ 3CC7A 4QIWE 2CQOA 4LF8L 3PO3H 2ZM6L 1G6PA 3L2PA 5AJ3L 4IFDI 1YHQA 1I6HH 2JA9A 1WI5A 5BR8L 1AE3A 2KBNA 3BJUA 1SFOH 3PUZA 1WFQA 3PV0A 4LF5Q 2LSSA 1L2FA 4TQUS 1FJGL 2Y0SG 3PO2H 4DUYQ 4EQ5A 3PUVA 4JC0A 3GDEA 2N78A 4APVA 3I4NH 1YITA 1PVOA 1VQ9A 3CCMA 2JA7H 3HOWG 1I94Q 2UUCL 1XPOA 1T9HA 3HOZH 1NE3A 1YVCA 2UXBQ 3ER0A 4YWLA 4JV5Q 2OCEA 4LUOA 1EUJA 3AFQA 3J80c 4A4IA 2VQEL 1WJJA 4DR3Q 3I2ZA 2ZTEA 4YY3Q 1B70B 5C4XH 1YJWA 5DLQE 4IPCA 4C3IH 3TS0A 1YJNA 1K83H 5GADC 2UUBQ 3S15H 2IT1A 5IYDH 2N49A 2LXKA 1QVGA 1HZBA 3JAMc 4BBRG 1X9NA 4QL5A 2OQKA 4AYBE 1P8LA 2R7ZG 2VS1A 1CSPA 1I50H 4DR4Q 4A3CH 4Y7NH 3S17H 4JI3Q 4BBSH 1L1OA 4DR3L 1MJEA 1K8GA 2ZTDA 2ZJRA 2HT1A 1CKNB 4IJHA 3SGIA 4GOPA 3S14H 1OXVA 3L0OA 1HNWQ 2JK8A 1XTDA 2JA8H 1V9PA 3Q8DA 4LUZA 4DUZL 1VQKA 1NTGA 2IHFA 1N32Q 2ES2A 3F8TA 3RR5A 1J5EL 2HHHL 1N33Q 3KFUA 4YCUA 3HOYH 2NZOA 2D62A 4IPDA 1Y1WG 3GTOH 2I5MX 2Q2TA 2YV5A 3RN2A 3S1RH 2LXJA 1UE1A 3HOVH 1E24A 1TWHH 1VQOA 3PCOB 3DLLA 1SR3A 1PH4A 1PFSA 4DR2Q 1N32L 4DV1Q 1EYGA 1G291 1G51A 1Z9FA 2Z0SA 1N36L 4UY8C 3E0EA 4DR5Q 2ZJPA 5FJ8H 1LTLA 3HOWH 3M4PA 4JG2A 4C3JH 1XMOQ 3NEMA 2Q2HA 4X62Q 3T1HQ 2KCMA 1E3PA 4MTNA 1R9TH 3K7UC 3T1YL 4JI6L 3CQZH 3G4SA 1UE6A 4LF4L 1PH7A 4A3JG 3M4OH 4BXXG 2UXDQ 4A3MG 1QUQB 1HNXL 4DV0Q 2YU9H 5M3MG 2K75A 3CP0A 3PGZA 4B3RL 2PQAB 3F2CA 5IYCH 2AHOB 1VQPA 1EIYB 4P73A 2C35B 3KLWA 1Q8KA 2VQFQ 2R7DA 3I4MG 4OXPA 1Q46A 4KI0A 1PH3A 1IL2A 1GKHA 2YTVA 3M7NA 4GKKL 4X65L 3OTOQ 4KLKA 1M1KC 1IBMQ 4LUVA 2E8GA 5J3BA 5IWAQ 1PH2A 2UUAQ 4NXMQ 4RMFA 1U5KA 2I0QA 1WCMG 1UE7A 4DV2Q 4JYAQ 3AFPA 4IOAA 4JI5Q 3FKIH 4A3EG 2KCTA 2K5NA 3CPFA 3KF8B 3CAMA 4R4QA 1A8VA 1PA6A 1VQJA 1JJGA 3E9HA 2KHIA 1S3OA 4YHHQ 2K52A 3HKSA 5IWAL 3J80i 3A0JA 3CCUA 4NXML 1GVPA 4R4IA 4LF9Q 2XTIA 3MXNB 5LMNQ 4IO9A 4B3SL 2GN5A 2F52A 1Y14B 4GN5A 5IP7H 4LF8Q 4AYBG 1Q82C 3KF6B 3A5UA 2ZM6Q 1IBLL 3JAMi 4MNOA 2AWNA 4GLVB 5GAGC 1Q81C 5GAHC 2Q2UA 1Q12A 4A3IH 4HIKA 1TWCH 3NELA 1Q1BA 2JJQA 5BR8Q 5IYBG 3GTJH 2UU9L 1C0AA 1WOCA 3ERSX 4J15A 4L5QA 4Y52H 1EOVA 1FJGQ 2E2HH 1VQGA 3BZKA 3U4ZA 3UDFA 1VQMA 4P75A 4UP7A 1EQRA 1K3RA 1KRTA 1PH9A 4A3KG 1CKMA 4UP9A 3RN5A 3K8AA 5M3MH 3W1BA 1MKHA 2UUCQ 2PI2A 4A3BH 4BY7G 3J81j 4DR1L 5JEAG 3I55A 2EQSA 4KHPL 5M3FG 2B3GA 2K4KA 3CF5A 2JA6G 3GTQH 4LNQA 3CCLA 3I4MH 2N8NA 2VQEQ 2VZAA 3S1QH 3I4OA 5M5YH 2GVAA 1EWIA 4A3DG 4JI0L 3UDXA 1TWAH 5LMNW 2JA5G 5JJLA 4PZ7A 2VW9A 4B3TL 1UE5A 1WCMH 2BA1A 1CKNA 4JI1L 3KDFA 1YJ9A 3M4QA 3UDGA 4BA2I 4LFCL 4QGUA 4PMWA 1JE5A 1XPUA 1QVFA 4OO1G 2WP8J 2IHEA 4R4TA 3I56A 1KRSA 3GTPH 1PH5A 2WAQE 4A3FH 1NY4A 2NVQH 4A3BG 4BXXH 2E2JH 4HJAA 1IYJB 4A3LG 4DUZQ 3BU2A 4UP8A 5IP9G 2ATWA 4IFDJ 4H02A 5C0XI 1VQ4A 1J5EQ 2HHHQ 3WWVA 1PV4A 1YHBA 4AQYL 4GNXB 4C2MH 3GD7A 4DV5L 4MZ9A 3CMEA 2WFWA 1XMQL 1J6QA 5JJIA 1FL0A 4HJ5A 4DNIA 2E5LQ 1KHIA 2B63H 1X3EA 4X66L 4JBJA 1YEZA 1TWFH 3GO5A 2ID0A 1VQAA 4JI2L 1Y1VH 2PNHA 2F4VL 1N36Q 1VQ5A 4L5RC 3IRBA 1H95A 4A3KH 3FP9A 2JA5H 2K5HA 2K14A 1PH6A 3G71A 1QUQA 1QZGA 3UE1A 3CD6A 3S1NH 2N3SA 4DV6L 4BY7H 4IPGA 2E5LL 2JA6H 4OONA 1K0RA 1SLJA 4BA1I 3T1YQ 1KC8C 4JOIA 1M90C 4JI6Q 4LF4Q 5LMUL 3OW2A 2D0OA 1LYLA 1HNXQ 5EAYA 1EIFA 2VUMG 3GTKH 4B3RQ 2GVBA 4FDBA 4YWMA 4A3DH 4OO1I 3J7ZC 4HIDA 4A93G 3ZJYC 4JI7L 4A3GG 1A0IA 4GKKQ 4QQBX 3ULPA 4X65Q 2HQLA 1X3FA 4POFA 1HNZL 1JB7A 4WJ3M 1O7IA 1VQNA 2BH2A 1HJPA 2JEBI 1BBWA 1VS0A 2YTYA 4HIOA 4IOCA 1OTCA 1XNRQ 3J81c 3K0XA 1L1OB 1SN8A 2NVXH 3CC2A 4R4CA 3KYHC 4GOPB 3CCQA 1W2BA 5FLMG 4BBRH 5IY0A 4K0KL 4GN3B 5IP9H 4LFBL 2R93G 2R7ZH 4L5SA 2E2IH 2D0PA 2Q2IA 4P72A 3G6EA 1E1OA 5GQOA 2R92G 4OWWB 3CCEA 4GKJL 1HR0L 1TXYA 3G48A 3J7A5 5IE8A 4B3SQ 1XNRL 1A63A 4O2DA 1B7YB 2VL6A 1NBWA 2B29A 1YNXA 3ICEA 1PYSB 4LF7L 4XTCS 1PYBA 3PO3G 3TRZA 5C3EG 1XPRA 4DV4L 3PIOA 1YI2A 1IBLQ 4DV3L 4A75A 3PF5A 1D7QA 2JE6I 3DM3A 1JMCA 3HFZB 1U0LA 4JI4L 3KJOA 5C44G 1XNQL 1Y1WH 1OXUA 4OX9L 2UU9Q 4JOIC 3S2DH 2WAQG 4P74A 5M5WH 3PO2G 1Z47A 3FHWA 4PZ6A 4YCVA 2YTXA 4YCWA 4NXNL 1SROA 5E7NA 4DK6C 4JBMA 3EN2A 3RLFA 2JA7G 4DR6L 4DR7L 4DV7L 2VUMH 2OTLA 4O0AA 1HZAA 4DR1Q 3U4VA 1KD1C 4KHPQ 1LM0A 4GS3A 3TEHB 2K50A 2IX1A 1UEBA 3VDYA 4A93H 5C0XG 4JI8L 1FGUA 1KXLA 2JEAI 3M3YH 2F3IA 2RHSB 1K9MC 2OWOA 3K7AH 4A3JH 4JCVE 3PUXA 4LW1A 1L0WA 2IX0A 4A3MH 4JI0Q 4X6AH 1SMXA 2V1CC 4B3TQ 3M9BA 3B6YA 4JI1Q 4AIMA 4A3CG 4ALPA 2A1AA 3CCSA 4BBSG 2KENA 4LFCQ 5FLMH 1OXTA 4OWTB 3CCVA 2R93H 1BVSA 4LWCA 1MJCA 1YHAA 4C3HH 3M85A 1CSQA 3AYHB 1AE2A 4NB3A 1EQQA 2ZJQA 1LUZA 1CKOA 1IXRA 2JA8G 2MQHA 4GNXA 2QGQA 2EXDA 2CFMA 2CWAA 1SRUA 5M5XH 4HJ8A 1VQ8A 4LF6L 1IBKL 3HOYG 3HKZE 4X64L 5C3EH 4KHZA 4AQYQ 4A3EH 1SE8A 1RL2A 4DV5Q 1HZ9A 1YBYA 4DAMA 3KJPA 3CW2C 1XJVA 3PUYA 3F2BA 2NN6G 1XMQQ 2ASBA 3HOVG 3HOUG 5C44H 3TS2A 4TVAB 1VQLA 3CXCA 3GTGH 1VCIA 1VQCA 3NBHB 2MNAA 1X65A 4GLXA 1NJIC 2MO1A 4X66Q 5ELNA 1N8RC 1N34L 3EIVA 3LGJA 1QVCA 3H3VI 1X55A 4JI2Q 1C9OA 3D31A 1X56A 3TQYA 3W1GA 2HIXA 3J81i 4LFAL 2F4VQ 1K8AC 5FJ8G 1FVIA 3S16H 5HGQA 4R4OA 3MEFA 3H15A 4DV6Q 3PF4A 1HH2P 1WYDA 3JC66 4PG3A 5IYBH 3D0FA 3H3VH 4LF5L 2UXCQ 3HOXG 5LMUQ 4L5TA 4QY7A 2AMCB 2XGTA 4DUYL 1KAWA 5GROA 5IYCG 1VQ7A 2DUDA 2L15A 1C7YA 3GTLH 1D8LA 3ULJA 1E22A 1A62A 3CMAA 1X6OA 1I94L 5JJKA 5ELOA 4ME3A 3PIPA 4JI7Q 2UXBL 4GN4B 2QA4A 4JV5L 2FXQA 4YWKA 5M3FH 3EBEA 2PQAA 2PI2E 1HNZQ 2OQ0A 3S24A 2UXCL 4YY3L 2R6GA 2OTJA 2DGYA 4AH6A 1Q1EA 4P71A 3KDFB 4DAYB 3STBD 3U50C 5C0XJ 1OXSC 4GNXC 2UUBL 4A76A 2NN6I
chains in the Genus database with same CATH superfamily
1EL0A 1PHJA 4IALA 5ELFA 1SAPA 1G91A 1O78A 4HR7B 4DR4L 3ONAB 1TWGH 4ZKBB 1EFWA 1LTBD 5I2XA 4YIJA 3H94A 3I70A 4GKJQ 4DPGA 2PO4A 1RCVD 1OXXK 4OO1H 2PZTA 2A19A 2F0MA 2PW7A 2Z6KA 1MIUA 2PMZB 1GHKA 4PNYA 4DV4Q 1V8QA 2BDOA 1S5BD 4OX9Q 4V0BA 2WB1G 4G4KA 4OGQC 3NE5B 1NMGA 4BY1G 3KLSX 1SNOA 1TKWB 2Z8LA 4KY7A 1Q7YC 4JK1C 2PMZE 2RHQB 5JJZA 4MIUA 4ABNA 1X3GA 3K80C 5FLXL 3HKZG 1PTOC 4KN4C 1X54A 2FMMA 1PRTD 1L1OC 4X62L 1SNPA 4JI8Q 2R7FA 1GUOA 3A8JE 3FDTA 1D6EC 4HJ7A 3I4NG 3STBC 3S1MH 1JOQA 3J81L 3I8ZA 1JB3A 1VQEA 3CCJA 1V43A 2AQ2B 1JJ2A 2A69D 2L5TA 3ZYYX 2G9HD 2WV6D 3KOJA 4OHJA 2NZHA 1QZHA 3OTOL 1TWCB 1WTVA 4B3MQ 4C3IG 2F0HA 1IBML 1STGA 1VQHA 2WB1B 4CDCC 4BY1B 3IFDA 4K8JA 2I5LX 2QEXA 3U9OA 2K03A 5D3DA 1B50A 4I7AA 4WJ4A 1DGSA 1BBUA 5FO7B 4JI5L 4XQNA 4X64Q 4R1JA 3HKZB 3VR3A 1IZ6A 5C4JH 2L0CA 2WB1E 3ND8A 2RF4A 2AUJD 4IPHA 2PNRC 1I3QH 1TY0A 2EY2A 4KMUC 1T5XD 2QDBA 5IT9E 3I4NB 2RDHA 4QIWE 1SDFA 1JORA 5K5PA 4RGMA 2OEOA 1YHQA 2J7ZA 4ZAIA 1LACA 2EYHA 5M9OA 3MA2B 4TSSA 1K8MA 5FO8B 2K33A 3G7LA 1K83B 2RSOA 3QIAA 2NVQB 1U4MA 1I4GA 3PIO3 4EQ5A 3PUVA 2F3VA 4RCNA 1Q3LA 3CCMA 2UUCL 2UXBQ 3ER0A 4JV5Q 4ZK9B 3QOJA 5EPKA 2ENBA 1HTLD 2ZTEA 2F0NA 1B70B 5DLQE 1YJNA 2UUBQ 1TWFB 4H13C 5IYDH 2A6HC 2LXKA 1RDPD 4BBRG 1P8LA 4DK0A 4CDEC 1CSPA 4NDXA 4A3CH 1EWCA 1B1ZA 4JI3Q 1L0YB 1L1OA 5IODA 2ZJRA 4IJHA 2JA6B 3S14H 2JK8A 3HG9A 1V9PA 1WTXA 1VQKA 4DUZL 2CW0C 2IHFA 1N32Q 2ES2A 3DWAA 3KFUA 2PYKA 3GTOH 2I5MX 2Q2TA 2YV5A 1VF5C 3HOVH 1BR9A 1IKLA 5L37A 3PCOB 3DXJC 4XQJA 5IIFA 1QNUA 1PFSA 5C5LA 2G9DA 4DV1Q 5AFWA 4B9XA 4UY8C 4F8MA 4BBRB 5C3XA 1HXYD 1XTCD 3CQZH 3M4OH 1Y8NB 5D14A 4XXEA 1QUQB 1AZQA 2YU9H 5M3MG 4B3RL 1IL8A 3F2CA 1A2TA 2DNCA 3N52A 1JC7A 2VQFQ 3I4MG 1Q46A 1BCPF 3D8GA 3V05A 2XRSD 4GKKL 3Q6SA 4X65L 1F77A 4OEMB 5KNCA 2CHBD 1DM0B 4L8JA 4A3EG 4R4QA 2K5NA 3CPFA 2K1BA 3CAMA 3R3OA 5I6WA 3E9HA 4EQNA 1X3PA 4R4IA 4LF9Q 2XTIA 5LMNQ 1Y14B 3TZDA 5M3MB 2MHVA 4S3SA 1Q82C 1HA5A 2EPBA 5GAGC 5GAHC 1YNND 4A3IH 3I4MB 4HIKA 5BR8Q 3GTJH 1WOCA 3C1EA 3ERSX 2CQAA 4MTKA 1EOVA 4ZCKA 1FJGQ 4R8IA 2E2HH 1VQGA 3BZKA 2QDLA 2K28A 3T4AC 4A3KG 1DJRD 2A6ED 2J0TD 5C3EB 3I55A 3Q0AA 4A3EB 1LTSD 5F2DA 2EY6A 5EJWA 2N8NA 1S5FD 1I4HA 5BN4A 1CFMA 1TIID 1I4QA 3GTGB 4A3DG 4JI0L 2E75C 4FP5D 4PZ7A 1WCMH 4F88A 2IL8A 3P1HA 1AFPA 3MZ5A 1EY8A 4O1NA 5KNBA 1QVFA 4CBVA 2WP8J 3I56A 4C1NK 1PH5A 2E2DC 4WFN3 1NY4A 3KLRA 4A3BG 3NUCA 2E2JH 4A3LG 4A3KB 2HHHQ 1BXTA 2NUCA 2SDFA 2PCFB 1K3BC 3GD7A 2WFWA 3TBIB 1G8ZD 2M9VA 3VYRA 1EYCA 3L9AX 1CA6A 1CQVA 4WRDA 4C1NI 2HUGA 1EY7A 1N36Q 1VQ5A 4L5RC 4LAAA 5FK9C 1KABA 1V1OA 3T51B 3RZDB 4BY7H 1SYFA 2A5HA 1EIHA 1TVXA 1K0RA 1KC8C 1M90C 3EA6A 4LF4Q 1LYLA 1HNXQ 5EAYA 2F0KA 3GTKH 4A3BB 3FEWX 2NVXB 1O7LA 5IGFA 1H9KA 4A3GG 1A0IA 5G3LD 2SOBA 3DM1A 1GUGA 1OTCA 1VS0A 4LJZC 5I6YA 2R93G 2V4DA 2F0FA 2WACA 2D0PA 5GQOA 4K14A 4R9WA 4C3HG 3GTMB 5E1FA 4GKJL 3JAME 1DOMA 1PTOH 3J7A5 1XNRL 4B3SQ 5JPMC 3ICEA 3TRZA 3PO3G 2KCNA 4DV4L 4U673 1LO5D 1IBLQ 4H0LC 1H9SB 1A6XA 1J8IA 1JMCA 4H7BA 1C8CA 4A3GB 5A35A 3A56A 4OX9L 3C46A 2WAQG 1F2ZA 4P74A 3RLFA 3X3NA 3MVVA 2VUMH 1CM9A 1ET9A 3TDQA 3W3AA 3U9SA 3U4VA 4KHPQ 4GS3A 3RUZA 3H0GB 2K50A 1KNEA 2EZVA 3S2HB 1WTHA 2KVMA 4JI8L 4C3HB 1GUWA 3ERQA 2JEAI 1E2WA 1K9MC 2OWOA 2RQXA 4JCVE 1L0WA 4RGOS 3IAYA 1X32A 4B3TQ 2EDGA 1KNAA 4U68A 3DUZA 4KD4A 1J9OA 3PO3B 2RKSA 4ULLA 4JI1Q 2N55A 3CCSA 1HPCA 2KENA 3TSSA 5FLMH 4LFCQ 4V190 1BVSA 2ZT9C 4FNFA 1SFOB 1YHAA 4RFBA 1EEFD 1LUZA 1QCBD 2JA8G 1SE3A 2HDMA 1SRUA 4L63B 5J22A 4HJ8A 3OIQA 1VQ8A 4X64L 3VR5A 1E2VA 1JWMD 3MXUA 2NN6G 5E4XA 5C44H 3NPPA 1A3TA 1VQCA 3BYYB 4GLXA 3DMUA 5C4XB 2MO1A 4X66Q 2NYZD 4ZQ3A 4RKLA 2AQ3B 3MFYA 1N8RC 2TMPA 4PV1C 3H3VI 1X55A 1C9OA 3D31A 5KNDA 2HIXA 4IZ8A 2NBFA 1K8AC 3D6CA 1FVIA 4Y7NB 3SK6A 1KLUD 3J7AF 2KA7A 3HOXG 1F9SA 3GP7A 2VB2X 2B2WC 1VQ7A 2JA8B 1D8LA 1A62A 3CMAA 3MTSA 2UXBL 3PIPA 3HP3A 4JV5L 5M3FH 3EBEA 1F9QA 1HHVA 1AP0A 4ZYSA 2WIIB 3S1RB 1HNZQ 2OTJA 2DNEA 3FRPB 4K2LA 2UUBL 4FO2A 4A76A 2NN6I 2JA5H 1F2YA 5H1SE 5FLXc 1LV9A 2QF7A 2A8VA 2Z1CA 4HMJA 5EKLA 1NR2A 4JI3L 1UWVA 4C3JB 1JE4A 3K0YA 1R9TB 2BH8A 4HJ9A 1D2BA 2AKWB 4QJFA 3UDIA 3HOUH 1VQBA 1YNJC 3LNNA 5IP7G 1ILPA 1DONA 3RLOA 1ENCA 4EGVA 1K73C 3CCRA 3NHHA 4FF3A 5EQ0A 4NXNQ 1VQDA 3OSOA 2BA0A 4X3SA 4DV1L 1JCKB 4DR6Q 2CH4W 2IY5B 2NVYB 2I5HA 2VB3X 2NVTH 2O5JC 3PMFA 2XN9C 5CBEE 2K5WA 3ULLA 4IFDG 3HOZG 2F0LA 3RNUA 2VQFL 2O5IC 1YIJA 3K6OA 3E9IA 2R3ZA 4R8NA 1LTID 5IT9L 1E1TA 4A3FG 2D2CC 3BDLA 5CV8A 2B2WA 2Z6KC 2Z4HA 4G7ZC 2F0IA 3A74A 4GLAC 5JOBA 5KYLA 1JT8A 2KQ3A 2ZXPA 1IBKQ 3SK5A 3W5OA 2CCZA 5AJ3Q 3GTQB 4OWXB 4LF9L 5LMNL 2EIFA 4BY1H 1B3QA 1Y1VG 4LFAQ 3CC7A 1F9RA 1SEBD 2CQOA 3HOZB 1F2MA 4K5VA 4IFDI 1IW7D 3ITPA 2F0SA 1WI5A 5BR8L 2KBNA 1WFQA 3PV0A 4FXGC 2LSSA 1L2FA 1FJGL 4A3FB 3PO2H 4MHEA 1I4RA 1EZ8A 3GDEA 2XWBB 3I4NH 2A69C 1PRTF 1I50B 3T16A 2FJ2A 2OCEA 4N9TA 4C2MB 1EUJA 3WDNA 2XNAC 4YY3Q 2MJ8A 4RHSA 4C3IH 1K83H 5GADC 2IW3A 1QVGA 1Y1VB 3JAMc 3H3VC 1TS2A 2OQKA 3M7GA 4J1MA 4WORA 4KKUA 4DR3L 3S1NB 2ZTDA 1PMRA 3VA5A 4X3KA 2L55A 3FPPA 2B8GA 1BCPB 1FYCA 1NTGA 2HHHL 2JYOA 3NSWA 1N33Q 4YCUA 3HOYH 2NZOA 2AUKA 2D62A 1Y1WG 5T1IA 3RN2A 4FVMA 1U9RA 1PDQA 2LXJA 1UE1A 4CKBA 1E24A 1H9SA 2F4IA 1PH4A 4DAVA 5I9OA 4DR2Q 1EY0A 1G51A 3MC0B 2OF1A 1N36L 3E0EA 4DR5Q 1KLGD 2ZJPA 5FJ8H 1VDZA 3NEMA 2Q2HA 4CGYB 4MTNA 3K7UC 5CC4A 1ZYRD 2M2LA 4LF4L 4HSPA 2SEBD 2UXDQ 1HNXL 4DV0Q 2K75A 3PGZA 2PQAB 3VYSA 5IYCH 5FKAC 1VQPA 3KLSA 1EIYB 1A15A 4KI0A 4ME5A 1CHQD 1GKHA 2YTVA 1Y1WB 4NW2A 1G2SA 4LUVA 2E8GA 5IWAQ 2UUAQ 3K5OA 1BUVT 2PZUA 1BOSA 2RSNA 4JYAQ 4IOAA 3FKIH 4UDUC 4M8AA 1S3OA 2K52A 5J1ZA 3HKSA 4NXML 3J80i 3V2TA 4B3SL 3K7AB 5EGTA 4KTAA 2F1MA 4GN5A 1IYUA 1ZKOA 4LF8Q 1PTOF 2HQEA 4QIWB 3KF6B 5BN3A 2ZM6Q 1IBLL 1LTRD 1FD7D 5DEHA 1CT1D 5IYBG 2JJQA 3S1QB 2Z9HA 4BS9A 2NZ1D 3X3MA 4OIJA 1VQMA 3U4ZA 5ELCA 4UP7A 1K3RA 1KRTA 1PH9A 1CKMA 3RN5A 5M3MH 1OO9B 3W1BA 1MKHA 5M5XB 1RTOA 1WD0A 4IUTA 1ICWA 1MHWC 2EQSA 3NQIA 4KHPL 2JA6G 2K4KA 3I4MH 2VZAA 5M5YH 2GVAA 2LMCB 1TWAH 2VW9A 4B3TL 1CKNA 4JI1L 3HZXA 3S16B 2F0EA 3UDGA 4LFCL 4QGUA 4Q5VA 1XPUA 1HUNA 1LT5D 3Q24A 4OO1G 5K36H 2IHEA 3GTPH 3QG1A 2ICEC 1IYJB 2EXZA 3BU2A 3NTHA 4H02A 5C0XI 1VQ4A 1RF2D 1TR5A 3CMEA 1FL0A 4QF4A 1EY9A 3SEBA 2E5LQ 4RAUC 2B63H 1X3EA 4X66L 4CJ0B 3OPOA 1YEZA 2B2VA 2ID0A 1A3VA 1SNCA 3BVMA 3IRBA 4A3KH 1PTOD 3FP9A 2K05A 1V1PB 3P75A 1TWGB 3G71A 3UE1A 3NXWA 1B53A 1SLJA 1S4ZA 3GV3A 4IUVA 4JOIA 4QMGA 1EIFA 1U4RA 4A3DH 2EYLA 4OO1I 3JAML 5DM63 3OOCA 2DJGC 3OIPA 3SK8A 4A93G 3I3CA 3C3LA 3ZJYC 3H6MA 3ULPA 1BCPC 3VR2A 1HNZL 1WVLA 1JB7A 2BE5C 2YTYA 5T1GA 1BBWA 4HIOA 3K0XA 2HCCA 2NVXH 1BDOA 4N9PA 4R4CA 1STHA 3CC2A 5HURA 4GOPB 1W2BA 3MXNA 3NBIA 4L5SA 2E2IH 2R7ZH 2Q2IA 4P72A 3G6EA 1II3A 1E1OA 3FPUB 2F0VA 5IE8A 1RD9D 1B7YB 2Z6BA 2VL6A 3S1MB 1YNXA 1PYSB 4JW0A 1JICA 4XTCS 1UUPA 3VA7A 5C3EG 2ZXOA 1G2TA 3PIOA 4A75A 2JE6I 3T56B 1SNDA 1EFID 4A93B 3KJOA 2Q8IB 2VXWA 1STEA 1WTQA 3K58A 1EIGA 3N6RA 3EROA 2EE1A 5M5WH 1Z47A 3FHWA 3OMCA 4NXNL 4DA2A 5IGCA 1E0BA 3O13A 4DR6L 1MD2D 3IFTA 1LM0A 2X69A 3CKIB 2IX1A 3VDYA 5E4WC 5C4JB 1R4QB 1KXLA 3M3YH 3LWUA 4BXXH 1I3QB 4A3JH 3PUXA 4X6AH 4A3MH 2A73B 1SMXA 2V1CC 1MI2A 2F0TA 3CHBD 5G3LF 1CHPD 5EKKA 4A3CG 4ALPA 2A1AA 4DN4M 3QO2A 3ND9A 4OWTB 2KECA 2R93H 2F03A 4LWCA 1BO0A 1Q8IA 4C3HH 4IUQA 1AE2A 3AYHB 4NB3A 4RHRA 3LX0A 2QGQA 2CFMA 2CWAA 2CW0D 1IBKL 1S5CD 2XVSA 4DV5Q 1YBYA 4DAMA 3PUYA 3HOVG 2AQ1B 1GOZA 2MNAA 5ELNA 3TQYA 3MHBA 3J81i 4LFAL 2LY7A 1Z7TA 2F4VQ 5HGQA 3WOFA 2EOTA 4R4OA 5ELBA 3V96A 1M8AA 4OIKA 3MEFA 1HH2P 1LTTD 3D0FA 3S14B 3H3VH 4QY7A 3PQIA 1DZ1A 2EY1A 4CDFC 2DUDA 1C7YA 2EVBA 3GTLH 2QILA 3ULJA 1Z6HA 5JJKA 4M1UB 4RCOA 4ME3A 4JI7Q 1CQFA 4DU9A 2FXQA 5JEAH 2QW7A 2PQAA 4RGTA 5DNFA 2UXCL 4YY3L 1CI3M 3HOVB 4AH6A 1Q1EA 4P71A 3KDFB 4K6DA 1SXTA 5IGBA 5CV6A 1OXSC 5NUCA 4JPBW 2F0PA 2JXMB 3BZCA 2HCIA 4K0KQ 4ODGA 4RG1A 4LFBQ 1LT6D 1SSOA 2F0JA 5JEAJ 1H9JA 1Y8PB 3BDCA 3PUWA 1IHZA 2EJMA 1B2TA 3CQZB 2NN6H 3M4OB 2EY5A 4TRDA 2Y0SE 2YU9B 4F7XA 3L7ZC 2K5QA 4NPSA 1ASYA 3H0GG 4IN3A 4KJOA 2KHSA 1S72A 1HZCA 4PZ8A 4DV3Q 1N33L 4A3IG 2NWGA 4DK3C 5IT9c 5CBAE 3CC4A 2IWHA 1XNQQ 3SVMA 1GM5A 1WTPA 2H1EA 1STAA 2K5VA 5EPLA 1EY6A 1RKNA 3KF6A 2VNUD 1PLFA 1GD7A 3SXHA 3H91A 2AWOA 1P16A 3HOXH 1UEAB 4DR2L 4DV7Q 3RLNA 5COYA 4DR5L 3MAQA 1I5FA 1VQFA 5HY6A 4ILWA 3S9WA 5C4ZA 1Q86C 4CKCA 3CPWA 4GOPC 1E7ZA 1HR0W 3I73A 3QJYA 2UXDL 2B39A 4DV0L 2HIVA 1AEXA 1CK1A 1AH9A 2L11A 1PH8A 3RZOB 2CWPA 2KUMA 2NVYH 1C4QA 3DEOA 2HDLA 4A3IB 1MGSA 3EQLC 4HMIA 5C4XG 3W2DA 4DKAC 1LABA 3GTJB 1Q90A 1QG7A 1V1QA 2O2LD 5KGUA 5CR3A 2UUAL 3AU7A 2Q8RE 1HA6A 1PRTB 1SYCA 2E2HB 2P5ZX 4JYAL 3E6ZX 1JR0D 3I7FA 2C5CA 1CUKA 5ISRA 2RCNA 4QB4A 1B8AA 3MXPA 5I2YA 4POGA 4IJLA 4B3ML 2R92H 3UE0A 1DCZA 4EX5A 3OYYA 1SJHD 1VQIA 1N34Q 1JJCB 1W6JA 5BN5A 4LF8L 2ZM6L 3OW7A 4F87A 1MBYA 1D5MC 3C1FA 1G6PA 3L2PA 2EYJA 5KYIA 1I6HH 2JA9A 2GA4B 1AE3A 3BJUA 3PUZA 1JOKA 3HRZC 4RH6A 5C4HA 2A68D 1EU3A 1V1PA 2J4XA 4DUYQ 2E2JB 4JC0A 4APVA 2N78A 3E3XA 1YITA 1VQ9A 2JA7H 3HOWG 3HOZH 1XYIA 2L4NA 4C3JG 4DAYA 4LUOA 1XWEA 4A4IA 1IYVA 3K5MA 3I2ZA 4RGNA 4IPCA 5CORA 1QB5D 3S15H 2IT1A 1HZBA 1JWUD 3I72A 1X9NA 4QL5A 4I65A 4AYBE 2VS1A 1I50H 1SMYD 3NWSA 3S17H 4BBSH 4BY7B 3DWPA 2HT1A 1CKNB 3SGIA 4GOPA 1HNWQ 4ZRZA 2D9UA 3GTKB 5ELDA 2CH4A 1GHJA 5JVH3 3F8TA 2MUYA 3RR5A 1SYBA 3HOWB 4IPDA 3I90A 4C56C 1TWHH 2LKVA 1VQOA 1R4PB 1H9RA 1N32L 1G291 3M4PA 1XMOQ 3T1HQ 2KCMA 1E3PA 3Q22A 2MGSA 3G4SA 1UE6A 1PH7A 1PTOB 5C5MA 1D5XC 4XQQA 3EFXD 3DEPA 4EQPA 2AHOB 4P73A 2C35B 4OXPA 3IKJA 3OWFA 3A7AB 2CVRA 3T53B 1AZPA 1AN8A 1PH2A 2B2TA 4RMFA 5EPJA 1G6ZA 1UE7A 2BDNA 4DV2Q 2IJ0A 3C2PA 2VUMB 2FFKB 2KCTA 3KF8B 1A8VA 2KHIA 4YHHQ 4KN7C 4H44C 3R2IA 1BF4A 3CCUA 1GVPA 3MXNB 4IO9A 2X6GA 4KKSA 2RA4A 3K5NA 1L0XB 3MEHA 1JOOA 1PFMA 4MNOA 1S5ED 1Q81C 1Q12A 1TWCH 3NELA 4XYQA 1C0AA 2JN4A 4L5QA 1ZYRC 4Y52H 4KY6A 2RDFA 1NR4A 4P75A 4UAIA 1ZXTA 3K8AA 4QCLA 3J81j 3QWNA 2EJFC 1PRTC 5M3FG 4IUNA 3A55A 3CF5A 3I91A 5D3IB 1JQYD 2C9OA 3CCLA 4LNQA 2VQEQ 2B8FA 3S1QH 5C44B 1NNXA 2MPMA 1EWIA 3K57A 1LT3D 2JA5G 5JJLA 2OXPA 1O7YA 1UE5A 1W6KA 3R2TA 1SYDA 1CZGA 4DF7A 3KDFA 3M4QA 3G6JB 3D3RA 4K5WA 1NSNS 4DXGA 3UI2A 3BG3A 1RTNA 1XXGA 1KRSA 2NVQH 4OL7A 1YNJD 1GUTA 1I4XA 3QR8A 5IP9G 2ATWA 5JAVA 3T13A 1J5EQ 3WWVA 1PV4A 1HQRD 2F0WA 2PQEA 4DV5L 4MZ9A 5M3FB 1J6QA 5JJIA 4DNIA 1NAPA 1KHIA 1KDAA 4ZUIA 4JBJA 1TWFH 4FXDA 3SK4A 1VQAA 2JA5B 2PNHA 2F4VL 1FGBD 2H4OA 2WKCA 4HTHA 1EYDA 1VF7A 4NMZA 1PH6A 1D1IA 4IPGA 2JA6H 4BA1I 3T1YQ 4JI6Q 3OW2A 2D0OA 1BNZA 3HOUB 4K6LA 1SYEA 2A74C 4FDBA 2XIWA 3J7ZC 1ENFA 1BBXC 3BVGA 4JI7L 2LS01 5CV9A 1FNUA 2HQLA 2N88A 1X3FA 5A2QE 1KAAA 4KJNA 1O7IA 4WJ3M 4O42A 1VQNA 2JEBI 1H95A 1XNRQ 4IOCA 3HS0C 3J80E 2EJGC 3CCQA 4BBRH 4K0KL 4CKEA 4LFBL 1PZJD 4XT1B 4LK1C 2NVTB 4OWWB 3BDOA 3CCEA 4JVZA 1HFGA 3S2DB 3TMEA 1TXYA 3G48A 1ICFB 1A63A 2B2VC 4O2DA 1NBWA 1LTAD 2B29A 2IPKD 1XPRA 2RBMA 1YI2A 4DV3L 1D7QA 3F2UA 5IOCA 1XNQL 1FR3A 1OXUA 2UU9Q 1JWSD 4JOIC 2EYOA 3A54A 2K5DA 4J6HA 3PO2G 1MSGA 4YCVA 4PZ6A 4YCWA 1B9MA 2YTXA 3SR1A 3E5SA 4K2KA 4FF2A 1U4PA 2XRQD 4KD3A 5E3FA 4DV7L 2OTLA 4DR1Q 4ZLTF 1HQMC 1KD1C 4X3TA 3BS1A 4A93H 5C0XG 4HCEA 3VR6A 1KTKA 3M4YA 3TN2A 2RHSB 3OWEB 1ET6A 4LW1A 2IX0A 3D4WA 2L9HA 3M9BA 4AIMA 2I46A 3CRLC 4HSVA 1OXTA 2DJFC 3CCVA 3A7LA 3R8BA 2LFNA 3M85A 1CSQA 2ZJQA 3A8IE 1CKOA 1IXRA 2D5DA 4UHVA 3PO2B 2MQHA 4GNXA 2NTSA 2EXDA 3HOYG 3HKZE 3LWEA 3NP8A 5C3EH 4KK7A 5C6AA 3NTKA 4AQYQ 1CZWA 4A3EH 1RL2A 1K0SA 3KJPA 3CW2C 3F2BA 1XMQQ 1DXMA 4TVAB 1VQLA 3GTGH 1X65A 1GXDC 1NJIC 4C3IB 1N34L 5ELEA 4JI2Q 1X56A 3TP5A 2QKIC 5FJ8G 1YNNC 4FF4A 3KBGA 3H15A 4IURA 4DV6Q 2JSOA 3JC66 3QOLA 5LMUQ 4DUYL 1KAWA 5GROA 5IYCG 2L15A 4LMQD 4DK1A 2A6EC 1QWYA 1E22A 1RODA 3OMGA 5ELOA 5FO9B 2QA4A 3HOYB 3MXGA 1QE6A 2PI2E 2OQ0A 3S24A 3SHLA 2R6GA 4N8X1 2DGYA 1QOHA 1F2LA 3VYUA 4DAYB 1HFNA 3STBD 1XX8A 3CRKC 3FKIG 4XIGS 2KEDA 3RZDH 1X3QA 4HIMA 1HR0Q 4G7HC 2PW5A 3KF8A 4IQZA 1SYGA 5TSSA 1HNWL 4A3BH 1NMFA 2MO0A 4LF7Q 1SNMA 1BKBA 3J7AV 2ZTCA 3FMCA 4CHTB 4A3LH 3AEVA 3RMHA 1TS4A 1D5ZC 4DFAA 5DM73 1W3SA 4JI4Q 3J7YW 1B44D 3NWTA 1ONLA 2TSSA 1EWHA 1QJOA 3EJIA 1PH1A 5LL6X 5I9PA 4JBKA 2Z4IA 5LHY1 1PFNA 1VQ6A 4DR7Q 1O7ZA 1EYAA 3SDZA 4RKBA 3FKIB 2XSCA 2RVLA 1XMOL 1HTPA 3GTMH 1NCVA 3NENA 3T1HL 1KIXA 1KQSA 3F2DA 4UPAA 3A5ZB 2FHTA 5GAEC 2MFIA 3PSIA 2YYZA 1GO3E 4Z9CB 1ASZA 1FNVA 2K6AA 2VY3A 2ZXRA 1M4VA 2NTTA 3F1ZA 1N9WA 4A3GH 3AQQA 1S40A 5K36G 5FLXE 2ALYB 2JQOA 1SE2A 5IYDG 2F0GA 2X6LA 1RIPA 3R93A 1TU2B 5I4DA 4DV2L 2A6HD 2H5XA 4RA8A 2KHJA 1KL9A 4JBWA 2EYMA 4LF6Q 5HGTA 3NBHA 3RZOH 4KHVA 3H0GH 1SJED 3TREA 3J81E 4YHHL 3S2HH 1YZ6A 2B63G 2CKZB 5CGKA 5M5YB 1EEID 2F3WA 3P20A 1ESFA 1MSHA 2ICIA 1TWAB 3K81C 5KEEA 1HUMA 4QUCA 3U58A 4K8IA 3PO3H 2F0UA 1K28A 5AJ3L 3L3OC 2FINB 1DD2A 2M00A 1TT2A 4K5XA 2IX3A 1SE4A 1SFOH 3D4RA 4LF5Q 3DHQA 1VMCA 4TQUS 3GTPB 2Y0SG 4IUUA 5JPNC 5JVG3 1GUSA 1PVOA 1I94Q 2HD3A 1XPOA 1T9HA 1NE3A 4P2CB 1YVCA 4YWLA 1Y69U 3AFQA 3GQBA 3J80c 2VQEL 1WJJA 4DR3Q 4FF1A 1BCPD 5C4XH 1YJWA 2B63B 3TS0A 2BE5D 3EVQA 1SBBB 4ZKCB 2N49A 3HGBA 5IGEA 2QEJC 2R7ZG 3OHXC 3GTOB 4DR4Q 2KJXA 4Y7NH 1K8GA 1MJEA 4NKLA 1OXVA 3L0OA 1HRJA 5D65A 1IKMA 1XTDA 2B2UC 2Y0SB 2JA8H 4LUZA 3Q8DA 1EOTA 4A3DB 1J5EL 4DAPA 1ILQA 1I6VC 4NP5A 2XWJB 1A3UA 3S1RH 4N8FA 1FNWA 4QUFA 3DWQA 2A68C 3DLLA 1SR3A 4XDXA 2EYFA 1EYGA 1Z9FA 2Z0SA 4EVOA 1C48A 5DAUA 3Q23A 1CTMA 1LTLA 3HOWH 2R7ZB 4JG2A 4C3JH 4ZUJA 2E2IB 4X62Q 1DOLA 3KBXA 4B9WA 1R9TH 3T1YL 4JI6L 1D1KA 4BXXG 4A3JG 4A3MG 3AMUA 4ID6A 3CP0A 2EYPA 3KUPA 4OELB 5LL6S 1B9NA 3KLWA 4BWGB 1Q8KA 2R7DA 1ZEQX 1SMYC 2K04A 1PH3A 1IL2A 3M7NA 3OTOQ 4DXFA 4KLKA 1M1KC 2DN8A 1ML0D 1IBMQ 2E74C 5J3BA 5EBCA 4NXMQ 2K32A 1U5KA 5M5WB 2I0QA 1GJXA 1WCMG 1O80A 5FOBB 3AFPA 3BVZA 3PIP3 4FYDA 4JI5Q 2KCCA 2NB0A 1PA6A 1VQJA 1JJGA 4CDDC 5IWAL 2QCPX 3A0JA 1QNKA 1QILA 2PPBC 3M3YB 2GN5A 2F52A 4A3JB 1STBA 2E76C 1B4OA 4A3MB 1WTRA 5IP7H 1EY5A 4AYBG 3A5UA 3JAMi 2AWNA 4GLVB 2Q2UA 1PZKD 4MN3A 1Q1BA 2UU9L 2R93B 1UAPA 4J15A 4DNTB 1I4PA 1KDBA 4PMCA 3UDFA 2B2UA 1EQRA 1WCMB 3FVQA 3TP8A 1BQQT 4UP9A 5C3WA 2UUCQ 2PI2A 4BY7G 4DR1L 5JEAG 5IGGA 2B3GA 1F9PA 3GTQH 3RD4A 3URYA 3I4OA 2K01A 2B2TC 4PMBA 1DYQA 3UDXA 5LMNW 2WAQB 3GV6A 1ENAA 3MWYW 4IFDH 2BA1A 1YJ9A 4AYBB 4BA2I 3K59A 2F0QA 5J39A 2KEEA 1U4LA 4PMWA 1JE5A 4XT3B 1WTWA 4R4TA 2WAQE 4A3FH 4HJAA 1DOKA 4DUZQ 4UP8A 3GTLB 4IFDJ 4WJWA 1CA5A 1YHBA 4AQYL 2B2YC 2BCOA 4GNXB 4C2MH 4HAEA 2R61A 1WTOA 1XMQL 3BZDB 2SNMA 3IL8A 4HJ5A 1EQTA 4HCSA 1ESRA 2L12A 3GO5A 4XYOA 3VYTA 4JI2L 2Q8TA 5A2QL 1Y1VH 3AB9A 4G57A 4B08A 4FXKC 2I07B 1B3AA 1TQOA 3E0JA 4KY5A 1IW7C 2MP1A 2K5HA 2K14A 2PZWA 1QZGA 1QUQA 3CD6A 3S1NH 2N3SA 3J80L 4DV6L 1STNA 2E5LL 1LTGD 4OONA 2O4XA 1AW7A 1PFBA 3SE0A 5LMUL 1KDCA 1STYA 1TS5A 2VUMG 4B3RQ 4CJ2C 2GVBA 1EZ6A 4YWMA 4TKOB 4HIDA 2F0OA 1WD1A 4GKKQ 4QQBX 2DY8A 4X65Q 1EY4A 4POFA 3NQTA 4I7ZC 1T5EA 2F0DA 3TP6A 2SNSA 2BH2A 1HJPA 3J81c 1L1OB 3HOXB 1UNSA 1SN8A 3KYHC 1H9MA 4E6IA 5FLMG 5IY0A 1EU4A 4GN3B 5IP9H 2DY7A 2WINB 2R92G 1S5DD 3K5LA 1HR0L 1PYWD 1HCZA 3D6WA 4G7OC 4LF7L 1PYBA 1GUNA 5IGDA 3QB3A 3TZUA 3PF5A 3DM3A 3HFZB 1U0LA 4JI4L 2G5DA 4Q0FA 5C44G 4CJ1B 1Y1WH 4HEDA 3S2DH 4JBMA 1SROA 5E7NA 4DK6C 3MFGA 3EN2A 1RHPA 2JA7G 4DR7L 4HN7A 1RJTA 1E2ZA 4O0AA 3BYTB 1HZAA 2RDGA 2B2YA 3TEHB 1UEBA 3CU7A 2R92B 2L1BA 3P7JA 1FGUA 2K7VA 3NK9A 1EQVA 1A2UA 3H09A 5EKIA 2F3IA 5KIXA 3K7AH 4JI0Q 5CYUA 2OT2A 4KV6A 3B6YA 2RCFA 3A8KE 4BBSG 4DGZA 1I6HB 1MJCA 1VMPA 1EQQA 1SNQA 1TS3A 4KKTA 3HEJA 5M5XH 5CMDA 4LF6L 2JA7B 4KHZA 1SE8A 2FMCA 4J8QA 1HZ9A 1XJVA 2ASBA 3HOUG 3TS2A 3CXCA 1VCIA 3NBHB 2KOLA 1LT4D 2BOSA 3EIVA 3LGJA 1QVCA 4EQOA 3S15B 3W1GA 3WOEA 3S16H 5CV7A 5CV4A 3S17B 4IUPA 5EBDA 4BBSB 3PF4A 1WYDA 4PG3A 1Y8OB 3NTIA 4X3UA 5IYBH 4LF5L 3VR4A 4GZYC 2UXCQ 5C0XH 4L5TA 2AMCB 2XGTA 5KRUA 1PZID 2JP1A 1PXUA 4DNRB 3I4LA 1I94L 1X6OA 1TY2A 4L6TB 1LLRD 4GN4B 3TP7A 2WKDA 4YWKA 4RWSC 1K8OA 3D4DA 1TWHB 5CV5A 1NUCA 3U50C 5C0XJ 3KK7A 4PQXA 4GNXC
chains in the Genus database with same CATH topology
5FLXc 5H1SE 1PHJA 3BZCA 3FKIG 4XIGS 4K0KQ 2A8VA 4RG1A 4LFBQ 3RZDH 4DR4L 1EFWA 1TWGH 4JI3L 1UWVA 5JEAJ 3PUWA 4DPGA 4GKJQ 4HIMA 1HR0Q 1OXXK 2BH8A 4HJ9A 2AKWB 4QJFA 3UDIA 3HOUH 1VQBA 1HNWL 2A19A 2Y0SE 1NMFA 2MO0A 5IP7G 4LF7Q 1BKBA 2Z6KA 1MIUA 2ZTCA 3L7ZC 4NPSA 1ASYA 4A3LH 3AEVA 4DV4Q 3H0GG 1S72A 1HZCA 4PZ8A 4DV3Q 3RLOA 1N33L 4A3IG 1W3SA 4DK3C 5IT9c 4JI4Q 3CC4A 1XNQQ 1K73C 1GM5A 4OX9Q 2K5VA 2WB1G 3KF6A 1NMGA 4BY1G 3CCRA 1PH1A 2VNUD 4JBKA 1GD7A 1Q7YC 2PMZE 1VQDA 4NXNQ 2RHQB 2AWOA 1P16A 3HOXH 1X3GA 2BA0A 1VQ6A 4DR2L 3K80C 4DR7Q 4DV1L 4DR6Q 4DV7Q 2IY5B 3HKZG 3RLNA 1X54A 4DR5L 2I5HA 1I5FA 1VQFA 2NVTH 5HY6A 1XMOL 3GTMH 1L1OC 4X62L 3NENA 3T1HL 1Q86C 4JI8Q 1KIXA 3CPWA 1KQSA 2R7FA 3F2DA 1E7ZA 4GOPC 4UPAA 3A5ZB 5GAEC 1HR0W 2UXDL 4HJ7A 3I4NG 3STBC 2MFIA 3ULLA 4DV0L 3PSIA 3S1MH 2HIVA 4IFDG 3HOZG 2YYZA 1GO3E 1VQEA 3CCJA 1V43A 1ASZA 2VY3A 1JJ2A 1AH9A 3RNUA 1PH8A 2VQFL 2CWPA 1YIJA 2NVYH 3E9IA 3F1ZA 1N9WA 3KOJA 1QZHA 2NZHA 3AQQA 1S40A 4A3GH 1E1TA 3OTOL 5C4XG 5K36G 4B3MQ 4DKAC 1IBML 1VQHA 2ALYB 1V1QA 2JQOA 4A3FG 2UUAL 5IYDG 1RIPA 2I5LX 2QEXA 2Z6KC 1JT8A 4DV2L 4JYAL 3A74A 2H5XA 4GLAC 3I7FA 1DGSA 1BBUA 4WJ4A 2KHJA 1KL9A 4JBWA 4JI5L 4LF6Q 1CUKA 1IBKQ 4X64Q 2RCNA 4R1JA 3RZOH 1IZ6A 3H0GH 1B8AA 3W5OA 4POGA 4IJLA 3TREA 2CCZA 5AJ3Q 4B3ML 4YHHL 4OWXB 5C4JH 3S2HH 2R92H 2WB1E 1YZ6A 2RF4A 3UE0A 2B63G 2CKZB 4IPHA 5LMNL 4EX5A 2EIFA 4LF9L 1I3QH 3OYYA 1N34Q 1VQIA 4BY1H 1JJCB 1Y1VG 3K81C 3U58A 4LFAQ 3CC7A 4QIWE 2CQOA 4LF8L 3PO3H 2ZM6L 1G6PA 3L2PA 5AJ3L 4IFDI 1YHQA 1I6HH 2JA9A 1WI5A 5BR8L 1AE3A 2KBNA 3BJUA 1SFOH 3PUZA 1WFQA 3PV0A 4LF5Q 2LSSA 1L2FA 4TQUS 1FJGL 2Y0SG 3PO2H 4DUYQ 4EQ5A 3PUVA 4JC0A 3GDEA 2N78A 4APVA 3I4NH 1YITA 1PVOA 1VQ9A 3CCMA 2JA7H 3HOWG 1I94Q 2UUCL 1XPOA 1T9HA 3HOZH 1NE3A 1YVCA 2UXBQ 3ER0A 4YWLA 4JV5Q 2OCEA 4LUOA 1EUJA 3AFQA 3J80c 4A4IA 2VQEL 1WJJA 4DR3Q 3I2ZA 2ZTEA 4YY3Q 1B70B 5C4XH 1YJWA 5DLQE 4IPCA 4C3IH 3TS0A 1YJNA 1K83H 5GADC 2UUBQ 3S15H 2IT1A 5IYDH 2N49A 2LXKA 1QVGA 1HZBA 3JAMc 4BBRG 1X9NA 4QL5A 2OQKA 4AYBE 1P8LA 2R7ZG 2VS1A 1CSPA 1I50H 4DR4Q 4A3CH 4Y7NH 3S17H 4JI3Q 4BBSH 1L1OA 4DR3L 1MJEA 1K8GA 2ZTDA 2ZJRA 2HT1A 1CKNB 4IJHA 3SGIA 4GOPA 3S14H 1OXVA 3L0OA 1HNWQ 2JK8A 1XTDA 2JA8H 1V9PA 3Q8DA 4LUZA 4DUZL 1VQKA 1NTGA 2IHFA 1N32Q 2ES2A 3F8TA 3RR5A 1J5EL 2HHHL 1N33Q 3KFUA 4YCUA 3HOYH 2NZOA 2D62A 4IPDA 1Y1WG 3GTOH 2I5MX 2Q2TA 2YV5A 3RN2A 3S1RH 2LXJA 1UE1A 3HOVH 1E24A 1TWHH 1VQOA 3PCOB 3DLLA 1SR3A 1PH4A 1PFSA 4DR2Q 1N32L 4DV1Q 1EYGA 1G291 1G51A 1Z9FA 2Z0SA 1N36L 4UY8C 3E0EA 4DR5Q 2ZJPA 5FJ8H 1LTLA 3HOWH 3M4PA 4JG2A 4C3JH 1XMOQ 3NEMA 2Q2HA 4X62Q 3T1HQ 2KCMA 1E3PA 4MTNA 1R9TH 3K7UC 3T1YL 4JI6L 3CQZH 3G4SA 1UE6A 4LF4L 1PH7A 4A3JG 3M4OH 4BXXG 2UXDQ 4A3MG 1QUQB 1HNXL 4DV0Q 2YU9H 5M3MG 2K75A 3CP0A 3PGZA 4B3RL 2PQAB 3F2CA 5IYCH 2AHOB 1VQPA 1EIYB 4P73A 2C35B 3KLWA 1Q8KA 2VQFQ 2R7DA 3I4MG 4OXPA 1Q46A 4KI0A 1PH3A 1IL2A 1GKHA 2YTVA 3M7NA 4GKKL 4X65L 3OTOQ 4KLKA 1M1KC 1IBMQ 4LUVA 2E8GA 5J3BA 5IWAQ 1PH2A 2UUAQ 4NXMQ 4RMFA 1U5KA 2I0QA 1WCMG 1UE7A 4DV2Q 4JYAQ 3AFPA 4IOAA 4JI5Q 3FKIH 4A3EG 2KCTA 2K5NA 3CPFA 3KF8B 3CAMA 4R4QA 1A8VA 1PA6A 1VQJA 1JJGA 3E9HA 2KHIA 1S3OA 4YHHQ 2K52A 3HKSA 5IWAL 3J80i 3A0JA 3CCUA 4NXML 1GVPA 4R4IA 4LF9Q 2XTIA 3MXNB 5LMNQ 4IO9A 4B3SL 2GN5A 2F52A 1Y14B 4GN5A 5IP7H 4LF8Q 4AYBG 1Q82C 3KF6B 3A5UA 2ZM6Q 1IBLL 3JAMi 4MNOA 2AWNA 4GLVB 5GAGC 1Q81C 5GAHC 2Q2UA 1Q12A 4A3IH 4HIKA 1TWCH 3NELA 1Q1BA 2JJQA 5BR8Q 5IYBG 3GTJH 2UU9L 1C0AA 1WOCA 3ERSX 4J15A 4L5QA 4Y52H 1EOVA 1FJGQ 2E2HH 1VQGA 3BZKA 3U4ZA 3UDFA 1VQMA 4P75A 4UP7A 1EQRA 1K3RA 1KRTA 1PH9A 4A3KG 1CKMA 4UP9A 3RN5A 3K8AA 5M3MH 3W1BA 1MKHA 2UUCQ 2PI2A 4A3BH 4BY7G 3J81j 4DR1L 5JEAG 3I55A 2EQSA 4KHPL 5M3FG 2B3GA 2K4KA 3CF5A 2JA6G 3GTQH 4LNQA 3CCLA 3I4MH 2N8NA 2VQEQ 2VZAA 3S1QH 3I4OA 5M5YH 2GVAA 1EWIA 4A3DG 4JI0L 3UDXA 1TWAH 5LMNW 2JA5G 5JJLA 4PZ7A 2VW9A 4B3TL 1UE5A 1WCMH 2BA1A 1CKNA 4JI1L 3KDFA 1YJ9A 3M4QA 3UDGA 4BA2I 4LFCL 4QGUA 4PMWA 1JE5A 1XPUA 1QVFA 4OO1G 2WP8J 2IHEA 4R4TA 3I56A 1KRSA 3GTPH 1PH5A 2WAQE 4A3FH 1NY4A 2NVQH 4A3BG 4BXXH 2E2JH 4HJAA 1IYJB 4A3LG 4DUZQ 3BU2A 4UP8A 5IP9G 2ATWA 4IFDJ 4H02A 5C0XI 1VQ4A 1J5EQ 2HHHQ 3WWVA 1PV4A 1YHBA 4AQYL 4GNXB 4C2MH 3GD7A 4DV5L 4MZ9A 3CMEA 2WFWA 1XMQL 1J6QA 5JJIA 1FL0A 4HJ5A 4DNIA 2E5LQ 1KHIA 2B63H 1X3EA 4X66L 4JBJA 1YEZA 1TWFH 3GO5A 2ID0A 1VQAA 4JI2L 1Y1VH 2PNHA 2F4VL 1N36Q 1VQ5A 4L5RC 3IRBA 1H95A 4A3KH 3FP9A 2JA5H 2K5HA 2K14A 1PH6A 3G71A 1QUQA 1QZGA 3UE1A 3CD6A 3S1NH 2N3SA 4DV6L 4BY7H 4IPGA 2E5LL 2JA6H 4OONA 1K0RA 1SLJA 4BA1I 3T1YQ 1KC8C 4JOIA 1M90C 4JI6Q 4LF4Q 5LMUL 3OW2A 2D0OA 1LYLA 1HNXQ 5EAYA 1EIFA 2VUMG 3GTKH 4B3RQ 2GVBA 4FDBA 4YWMA 4A3DH 4OO1I 3J7ZC 4HIDA 4A93G 3ZJYC 4JI7L 4A3GG 1A0IA 4GKKQ 4QQBX 3ULPA 4X65Q 2HQLA 1X3FA 4POFA 1HNZL 1JB7A 4WJ3M 1O7IA 1VQNA 2BH2A 1HJPA 2JEBI 1BBWA 1VS0A 2YTYA 4HIOA 4IOCA 1OTCA 1XNRQ 3J81c 3K0XA 1L1OB 1SN8A 2NVXH 3CC2A 4R4CA 3KYHC 4GOPB 3CCQA 1W2BA 5FLMG 4BBRH 5IY0A 4K0KL 4GN3B 5IP9H 4LFBL 2R93G 2R7ZH 4L5SA 2E2IH 2D0PA 2Q2IA 4P72A 3G6EA 1E1OA 5GQOA 2R92G 4OWWB 3CCEA 4GKJL 1HR0L 1TXYA 3G48A 3J7A5 5IE8A 4B3SQ 1XNRL 1A63A 4O2DA 1B7YB 2VL6A 1NBWA 2B29A 1YNXA 3ICEA 1PYSB 4LF7L 4XTCS 1PYBA 3PO3G 3TRZA 5C3EG 1XPRA 4DV4L 3PIOA 1YI2A 1IBLQ 4DV3L 4A75A 3PF5A 1D7QA 2JE6I 3DM3A 1JMCA 3HFZB 1U0LA 4JI4L 3KJOA 5C44G 1XNQL 1Y1WH 1OXUA 4OX9L 2UU9Q 4JOIC 3S2DH 2WAQG 4P74A 5M5WH 3PO2G 1Z47A 3FHWA 4PZ6A 4YCVA 2YTXA 4YCWA 4NXNL 1SROA 5E7NA 4DK6C 4JBMA 3EN2A 3RLFA 2JA7G 4DR6L 4DR7L 4DV7L 2VUMH 2OTLA 4O0AA 1HZAA 4DR1Q 3U4VA 1KD1C 4KHPQ 1LM0A 4GS3A 3TEHB 2K50A 2IX1A 1UEBA 3VDYA 4A93H 5C0XG 4JI8L 1FGUA 1KXLA 2JEAI 3M3YH 2F3IA 2RHSB 1K9MC 2OWOA 3K7AH 4A3JH 4JCVE 3PUXA 4LW1A 1L0WA 2IX0A 4A3MH 4JI0Q 4X6AH 1SMXA 2V1CC 4B3TQ 3M9BA 3B6YA 4JI1Q 4AIMA 4A3CG 4ALPA 2A1AA 3CCSA 4BBSG 2KENA 4LFCQ 5FLMH 1OXTA 4OWTB 3CCVA 2R93H 1BVSA 4LWCA 1MJCA 1YHAA 4C3HH 3M85A 1CSQA 3AYHB 1AE2A 4NB3A 1EQQA 2ZJQA 1LUZA 1CKOA 1IXRA 2JA8G 2MQHA 4GNXA 2QGQA 2EXDA 2CFMA 2CWAA 1SRUA 5M5XH 4HJ8A 1VQ8A 4LF6L 1IBKL 3HOYG 3HKZE 4X64L 5C3EH 4KHZA 4AQYQ 4A3EH 1SE8A 1RL2A 4DV5Q 1HZ9A 1YBYA 4DAMA 3KJPA 3CW2C 1XJVA 3PUYA 3F2BA 2NN6G 1XMQQ 2ASBA 3HOVG 3HOUG 5C44H 3TS2A 4TVAB 1VQLA 3CXCA 3GTGH 1VCIA 1VQCA 3NBHB 2MNAA 1X65A 4GLXA 1NJIC 2MO1A 4X66Q 5ELNA 1N8RC 1N34L 3EIVA 3LGJA 1QVCA 3H3VI 1X55A 4JI2Q 1C9OA 3D31A 1X56A 3TQYA 3W1GA 2HIXA 3J81i 4LFAL 2F4VQ 1K8AC 5FJ8G 1FVIA 3S16H 5HGQA 4R4OA 3MEFA 3H15A 4DV6Q 3PF4A 1HH2P 1WYDA 3JC66 4PG3A 5IYBH 3D0FA 3H3VH 4LF5L 2UXCQ 3HOXG 5LMUQ 4L5TA 4QY7A 2AMCB 2XGTA 4DUYL 1KAWA 5GROA 5IYCG 1VQ7A 2DUDA 2L15A 1C7YA 3GTLH 1D8LA 3ULJA 1E22A 1A62A 3CMAA 1X6OA 1I94L 5JJKA 5ELOA 4ME3A 3PIPA 4JI7Q 2UXBL 4GN4B 2QA4A 4JV5L 2FXQA 4YWKA 5M3FH 3EBEA 2PQAA 2PI2E 1HNZQ 2OQ0A 3S24A 2UXCL 4YY3L 2R6GA 2OTJA 2DGYA 4AH6A 1Q1EA 4P71A 3KDFB 4DAYB 3STBD 3U50C 5C0XJ 1OXSC 4GNXC 2UUBL 4A76A 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX c;  5H1S E;  1PHJ A;  3BZC A;  3FKI G;  4XIG S;  4K0K Q;  2A8V A;  4RG1 A;  4LFB Q;  3RZD H;  4DR4 L;  1EFW A;  1TWG H;  4JI3 L;  1UWV A;  5JEA J;  3PUW A;  4DPG A;  4GKJ Q;  4HIM A;  1HR0 Q;  1OXX K;  2BH8 A;  4HJ9 A;  2AKW B;  4QJF A;  3UDI A;  3HOU H;  1VQB A;  1HNW L;  2A19 A;  2Y0S E;  1NMF A;  2MO0 A;  5IP7 G;  4LF7 Q;  1BKB A;  2Z6K A;  1MIU A;  2ZTC A;  3L7Z C;  4NPS A;  1ASY A;  4A3L H;  3AEV A;  4DV4 Q;  3H0G G;  1S72 A;  1HZC A;  4PZ8 A;  4DV3 Q;  3RLO A;  1N33 L;  4A3I G;  1W3S A;  4DK3 C;  5IT9 c;  4JI4 Q;  3CC4 A;  1XNQ Q;  1K73 C;  1GM5 A;  4OX9 Q;  2K5V A;  2WB1 G;  3KF6 A;  1NMG A;  4BY1 G;  3CCR A;  1PH1 A;  2VNU D;  4JBK A;  1GD7 A;  1Q7Y C;  2PMZ E;  1VQD A;  4NXN Q;  2RHQ B;  2AWO A;  1P16 A;  3HOX H;  1X3G A;  2BA0 A;  1VQ6 A;  4DR2 L;  3K80 C;  4DR7 Q;  4DV1 L;  4DR6 Q;  4DV7 Q;  2IY5 B;  3HKZ G;  3RLN A;  1X54 A;  4DR5 L;  2I5H A;  1I5F A;  1VQF A;  2NVT H;  5HY6 A;  1XMO L;  3GTM H;  1L1O C;  4X62 L;  3NEN A;  3T1H L;  1Q86 C;  4JI8 Q;  1KIX A;  3CPW A;  1KQS A;  2R7F A;  3F2D A;  1E7Z A;  4GOP C;  4UPA A;  3A5Z B;  5GAE C;  1HR0 W;  2UXD L;  4HJ7 A;  3I4N G;  3STB C;  2MFI A;  3ULL A;  4DV0 L;  3PSI A;  3S1M H;  2HIV A;  4IFD G;  3HOZ G;  2YYZ A;  1GO3 E;  1VQE A;  3CCJ A;  1V43 A;  1ASZ A;  2VY3 A;  1JJ2 A;  1AH9 A;  3RNU A;  1PH8 A;  2VQF L;  2CWP A;  1YIJ A;  2NVY H;  3E9I A;  3F1Z A;  1N9W A;  3KOJ A;  1QZH A;  2NZH A;  3AQQ A;  1S40 A;  4A3G H;  1E1T A;  3OTO L;  5C4X G;  5K36 G;  4B3M Q;  4DKA C;  1IBM L;  1VQH A;  2ALY B;  1V1Q A;  2JQO A;  4A3F G;  2UUA L;  5IYD G;  1RIP A;  2I5L X;  2QEX A;  2Z6K C;  1JT8 A;  4DV2 L;  4JYA L;  3A74 A;  2H5X A;  4GLA C;  3I7F A;  1DGS A;  1BBU A;  4WJ4 A;  2KHJ A;  1KL9 A;  4JBW A;  4JI5 L;  4LF6 Q;  1CUK A;  1IBK Q;  4X64 Q;  2RCN A;  4R1J A;  3RZO H;  1IZ6 A;  3H0G H;  1B8A A;  3W5O A;  4POG A;  4IJL A;  3TRE A;  2CCZ A;  5AJ3 Q;  4B3M L;  4YHH L;  4OWX B;  5C4J H;  3S2H H;  2R92 H;  2WB1 E;  1YZ6 A;  2RF4 A;  3UE0 A;  2B63 G;  2CKZ B;  4IPH A;  5LMN L;  4EX5 A;  2EIF A;  4LF9 L;  1I3Q H;  3OYY A;  1N34 Q;  1VQI A;  4BY1 H;  1JJC B;  1Y1V G;  3K81 C;  3U58 A;  4LFA Q;  3CC7 A;  4QIW E;  2CQO A;  4LF8 L;  3PO3 H;  2ZM6 L;  1G6P A;  3L2P A;  5AJ3 L;  4IFD I;  1YHQ A;  1I6H H;  2JA9 A;  1WI5 A;  5BR8 L;  1AE3 A;  2KBN A;  3BJU A;  1SFO H;  3PUZ A;  1WFQ A;  3PV0 A;  4LF5 Q;  2LSS A;  1L2F A;  4TQU S;  1FJG L;  2Y0S G;  3PO2 H;  4DUY Q;  4EQ5 A;  3PUV A;  4JC0 A;  3GDE A;  2N78 A;  4APV A;  3I4N H;  1YIT A;  1PVO A;  1VQ9 A;  3CCM A;  2JA7 H;  3HOW G;  1I94 Q;  2UUC L;  1XPO A;  1T9H A;  3HOZ H;  1NE3 A;  1YVC A;  2UXB Q;  3ER0 A;  4YWL A;  4JV5 Q;  2OCE A;  4LUO A;  1EUJ A;  3AFQ A;  3J80 c;  4A4I A;  2VQE L;  1WJJ A;  4DR3 Q;  3I2Z A;  2ZTE A;  4YY3 Q;  1B70 B;  5C4X H;  1YJW A;  5DLQ E;  4IPC A;  4C3I H;  3TS0 A;  1YJN A;  1K83 H;  5GAD C;  2UUB Q;  3S15 H;  2IT1 A;  5IYD H;  2N49 A;  2LXK A;  1QVG A;  1HZB A;  3JAM c;  4BBR G;  1X9N A;  4QL5 A;  2OQK A;  4AYB E;  1P8L A;  2R7Z G;  2VS1 A;  1CSP A;  1I50 H;  4DR4 Q;  4A3C H;  4Y7N H;  3S17 H;  4JI3 Q;  4BBS H;  1L1O A;  4DR3 L;  1MJE A;  1K8G A;  2ZTD A;  2ZJR A;  2HT1 A;  1CKN B;  4IJH A;  3SGI A;  4GOP A;  3S14 H;  1OXV A;  3L0O A;  1HNW Q;  2JK8 A;  1XTD A;  2JA8 H;  1V9P A;  3Q8D A;  4LUZ A;  4DUZ L;  1VQK A;  1NTG A;  2IHF A;  1N32 Q;  2ES2 A;  3F8T A;  3RR5 A;  1J5E L;  2HHH L;  1N33 Q;  3KFU A;  4YCU A;  3HOY H;  2NZO A;  2D62 A;  4IPD A;  1Y1W G;  3GTO H;  2I5M X;  2Q2T A;  2YV5 A;  3RN2 A;  3S1R H;  2LXJ A;  1UE1 A;  3HOV H;  1E24 A;  1TWH H;  1VQO A;  3PCO B;  3DLL A;  1SR3 A;  1PH4 A;  1PFS A;  4DR2 Q;  1N32 L;  4DV1 Q;  1EYG A;  1G29 1;  1G51 A;  1Z9F A;  2Z0S A;  1N36 L;  4UY8 C;  3E0E A;  4DR5 Q;  2ZJP A;  5FJ8 H;  1LTL A;  3HOW H;  3M4P A;  4JG2 A;  4C3J H;  1XMO Q;  3NEM A;  2Q2H A;  4X62 Q;  3T1H Q;  2KCM A;  1E3P A;  4MTN A;  1R9T H;  3K7U C;  3T1Y L;  4JI6 L;  3CQZ H;  3G4S A;  1UE6 A;  4LF4 L;  1PH7 A;  4A3J G;  3M4O H;  4BXX G;  2UXD Q;  4A3M G;  1QUQ B;  1HNX L;  4DV0 Q;  2YU9 H;  5M3M G;  2K75 A;  3CP0 A;  3PGZ A;  4B3R L;  2PQA B;  3F2C A;  5IYC H;  2AHO B;  1VQP A;  1EIY B;  4P73 A;  2C35 B;  3KLW A;  1Q8K A;  2VQF Q;  2R7D A;  3I4M G;  4OXP A;  1Q46 A;  4KI0 A;  1PH3 A;  1IL2 A;  1GKH A;  2YTV A;  3M7N A;  4GKK L;  4X65 L;  3OTO Q;  4KLK A;  1M1K C;  1IBM Q;  4LUV A;  2E8G A;  5J3B A;  5IWA Q;  1PH2 A;  2UUA Q;  4NXM Q;  4RMF A;  1U5K A;  2I0Q A;  1WCM G;  1UE7 A;  4DV2 Q;  4JYA Q;  3AFP A;  4IOA A;  4JI5 Q;  3FKI H;  4A3E G;  2KCT A;  2K5N A;  3CPF A;  3KF8 B;  3CAM A;  4R4Q A;  1A8V A;  1PA6 A;  1VQJ A;  1JJG A;  3E9H A;  2KHI A;  1S3O A;  4YHH Q;  2K52 A;  3HKS A;  5IWA L;  3J80 i;  3A0J A;  3CCU A;  4NXM L;  1GVP A;  4R4I A;  4LF9 Q;  2XTI A;  3MXN B;  5LMN Q;  4IO9 A;  4B3S L;  2GN5 A;  2F52 A;  1Y14 B;  4GN5 A;  5IP7 H;  4LF8 Q;  4AYB G;  1Q82 C;  3KF6 B;  3A5U A;  2ZM6 Q;  1IBL L;  3JAM i;  4MNO A;  2AWN A;  4GLV B;  5GAG C;  1Q81 C;  5GAH C;  2Q2U A;  1Q12 A;  4A3I H;  4HIK A;  1TWC H;  3NEL A;  1Q1B A;  2JJQ A;  5BR8 Q;  5IYB G;  3GTJ H;  2UU9 L;  1C0A A;  1WOC A;  3ERS X;  4J15 A;  4L5Q A;  4Y52 H;  1EOV A;  1FJG Q;  2E2H H;  1VQG A;  3BZK A;  3U4Z A;  3UDF A;  1VQM A;  4P75 A;  4UP7 A;  1EQR A;  1K3R A;  1KRT A;  1PH9 A;  4A3K G;  1CKM A;  4UP9 A;  3RN5 A;  3K8A A;  5M3M H;  3W1B A;  1MKH A;  2UUC Q;  2PI2 A;  4A3B H;  4BY7 G;  3J81 j;  4DR1 L;  5JEA G;  3I55 A;  2EQS A;  4KHP L;  5M3F G;  2B3G A;  2K4K A;  3CF5 A;  2JA6 G;  3GTQ H;  4LNQ A;  3CCL A;  3I4M H;  2N8N A;  2VQE Q;  2VZA A;  3S1Q H;  3I4O A;  5M5Y H;  2GVA A;  1EWI A;  4A3D G;  4JI0 L;  3UDX A;  1TWA H;  5LMN W;  2JA5 G;  5JJL A;  4PZ7 A;  2VW9 A;  4B3T L;  1UE5 A;  1WCM H;  2BA1 A;  1CKN A;  4JI1 L;  3KDF A;  1YJ9 A;  3M4Q A;  3UDG A;  4BA2 I;  4LFC L;  4QGU A;  4PMW A;  1JE5 A;  1XPU A;  1QVF A;  4OO1 G;  2WP8 J;  2IHE A;  4R4T A;  3I56 A;  1KRS A;  3GTP H;  1PH5 A;  2WAQ E;  4A3F H;  1NY4 A;  2NVQ H;  4A3B G;  4BXX H;  2E2J H;  4HJA A;  1IYJ B;  4A3L G;  4DUZ Q;  3BU2 A;  4UP8 A;  5IP9 G;  2ATW A;  4IFD J;  4H02 A;  5C0X I;  1VQ4 A;  1J5E Q;  2HHH Q;  3WWV A;  1PV4 A;  1YHB A;  4AQY L;  4GNX B;  4C2M H;  3GD7 A;  4DV5 L;  4MZ9 A;  3CME A;  2WFW A;  1XMQ L;  1J6Q A;  5JJI A;  1FL0 A;  4HJ5 A;  4DNI A;  2E5L Q;  1KHI A;  2B63 H;  1X3E A;  4X66 L;  4JBJ A;  1YEZ A;  1TWF H;  3GO5 A;  2ID0 A;  1VQA A;  4JI2 L;  1Y1V H;  2PNH A;  2F4V L;  1N36 Q;  1VQ5 A;  4L5R C;  3IRB A;  1H95 A;  4A3K H;  3FP9 A;  2JA5 H;  2K5H A;  2K14 A;  1PH6 A;  3G71 A;  1QUQ A;  1QZG A;  3UE1 A;  3CD6 A;  3S1N H;  2N3S A;  4DV6 L;  4BY7 H;  4IPG A;  2E5L L;  2JA6 H;  4OON A;  1K0R A;  1SLJ A;  4BA1 I;  3T1Y Q;  1KC8 C;  4JOI A;  1M90 C;  4JI6 Q;  4LF4 Q;  5LMU L;  3OW2 A;  2D0O A;  1LYL A;  1HNX Q;  5EAY A;  1EIF A;  2VUM G;  3GTK H;  4B3R Q;  2GVB A;  4FDB A;  4YWM A;  4A3D H;  4OO1 I;  3J7Z C;  4HID A;  4A93 G;  3ZJY C;  4JI7 L;  4A3G G;  1A0I A;  4GKK Q;  4QQB X;  3ULP A;  4X65 Q;  2HQL A;  1X3F A;  4POF A;  1HNZ L;  1JB7 A;  4WJ3 M;  1O7I A;  1VQN A;  2BH2 A;  1HJP A;  2JEB I;  1BBW A;  1VS0 A;  2YTY A;  4HIO A;  4IOC A;  1OTC A;  1XNR Q;  3J81 c;  3K0X A;  1L1O B;  1SN8 A;  2NVX H;  3CC2 A;  4R4C A;  3KYH C;  4GOP B;  3CCQ A;  1W2B A;  5FLM G;  4BBR H;  5IY0 A;  4K0K L;  4GN3 B;  5IP9 H;  4LFB L;  2R93 G;  2R7Z H;  4L5S A;  2E2I H;  2D0P A;  2Q2I A;  4P72 A;  3G6E A;  1E1O A;  5GQO A;  2R92 G;  4OWW B;  3CCE A;  4GKJ L;  1HR0 L;  1TXY A;  3G48 A;  3J7A 5;  5IE8 A;  4B3S Q;  1XNR L;  1A63 A;  4O2D A;  1B7Y B;  2VL6 A;  1NBW A;  2B29 A;  1YNX A;  3ICE A;  1PYS B;  4LF7 L;  4XTC S;  1PYB A;  3PO3 G;  3TRZ A;  5C3E G;  1XPR A;  4DV4 L;  3PIO A;  1YI2 A;  1IBL Q;  4DV3 L;  4A75 A;  3PF5 A;  1D7Q A;  2JE6 I;  3DM3 A;  1JMC A;  3HFZ B;  1U0L A;  4JI4 L;  3KJO A;  5C44 G;  1XNQ L;  1Y1W H;  1OXU A;  4OX9 L;  2UU9 Q;  4JOI C;  3S2D H;  2WAQ G;  4P74 A;  5M5W H;  3PO2 G;  1Z47 A;  3FHW A;  4PZ6 A;  4YCV A;  2YTX A;  4YCW A;  4NXN L;  1SRO A;  5E7N A;  4DK6 C;  4JBM A;  3EN2 A;  3RLF A;  2JA7 G;  4DR6 L;  4DR7 L;  4DV7 L;  2VUM H;  2OTL A;  4O0A A;  1HZA A;  4DR1 Q;  3U4V A;  1KD1 C;  4KHP Q;  1LM0 A;  4GS3 A;  3TEH B;  2K50 A;  2IX1 A;  1UEB A;  3VDY A;  4A93 H;  5C0X G;  4JI8 L;  1FGU A;  1KXL A;  2JEA I;  3M3Y H;  2F3I A;  2RHS B;  1K9M C;  2OWO A;  3K7A H;  4A3J H;  4JCV E;  3PUX A;  4LW1 A;  1L0W A;  2IX0 A;  4A3M H;  4JI0 Q;  4X6A H;  1SMX A;  2V1C C;  4B3T Q;  3M9B A;  3B6Y A;  4JI1 Q;  4AIM A;  4A3C G;  4ALP A;  2A1A A;  3CCS A;  4BBS G;  2KEN A;  4LFC Q;  5FLM H;  1OXT A;  4OWT B;  3CCV A;  2R93 H;  1BVS A;  4LWC A;  1MJC A;  1YHA A;  4C3H H;  3M85 A;  1CSQ A;  3AYH B;  1AE2 A;  4NB3 A;  1EQQ A;  2ZJQ A;  1LUZ A;  1CKO A;  1IXR A;  2JA8 G;  2MQH A;  4GNX A;  2QGQ A;  2EXD A;  2CFM A;  2CWA A;  1SRU A;  5M5X H;  4HJ8 A;  1VQ8 A;  4LF6 L;  1IBK L;  3HOY G;  3HKZ E;  4X64 L;  5C3E H;  4KHZ A;  4AQY Q;  4A3E H;  1SE8 A;  1RL2 A;  4DV5 Q;  1HZ9 A;  1YBY A;  4DAM A;  3KJP A;  3CW2 C;  1XJV A;  3PUY A;  3F2B A;  2NN6 G;  1XMQ Q;  2ASB A;  3HOV G;  3HOU G;  5C44 H;  3TS2 A;  4TVA B;  1VQL A;  3CXC A;  3GTG H;  1VCI A;  1VQC A;  3NBH B;  2MNA A;  1X65 A;  4GLX A;  1NJI C;  2MO1 A;  4X66 Q;  5ELN A;  1N8R C;  1N34 L;  3EIV A;  3LGJ A;  1QVC A;  3H3V I;  1X55 A;  4JI2 Q;  1C9O A;  3D31 A;  1X56 A;  3TQY A;  3W1G A;  2HIX A;  3J81 i;  4LFA L;  2F4V Q;  1K8A C;  5FJ8 G;  1FVI A;  3S16 H;  5HGQ A;  4R4O A;  3MEF A;  3H15 A;  4DV6 Q;  3PF4 A;  1HH2 P;  1WYD A;  3JC6 6;  4PG3 A;  5IYB H;  3D0F A;  3H3V H;  4LF5 L;  2UXC Q;  3HOX G;  5LMU Q;  4L5T A;  4QY7 A;  2AMC B;  2XGT A;  4DUY L;  1KAW A;  5GRO A;  5IYC G;  1VQ7 A;  2DUD A;  2L15 A;  1C7Y A;  3GTL H;  1D8L A;  3ULJ A;  1E22 A;  1A62 A;  3CMA A;  1X6O A;  1I94 L;  5JJK A;  5ELO A;  4ME3 A;  3PIP A;  4JI7 Q;  2UXB L;  4GN4 B;  2QA4 A;  4JV5 L;  2FXQ A;  4YWK A;  5M3F H;  3EBE A;  2PQA A;  2PI2 E;  1HNZ Q;  2OQ0 A;  3S24 A;  2UXC L;  4YY3 L;  2R6G A;  2OTJ A;  2DGY A;  4AH6 A;  1Q1E A;  4P71 A;  3KDF B;  4DAY B;  3STB D;  3U50 C;  5C0X J;  1OXS C;  4GNX C;  2UUB L;  4A76 A;  2NN6 I; 
#chains in the Genus database with same CATH topology
 1EL0 A;  1PHJ A;  4IAL A;  5ELF A;  1SAP A;  1G91 A;  1O78 A;  4HR7 B;  4DR4 L;  3ONA B;  1TWG H;  4ZKB B;  1EFW A;  1LTB D;  5I2X A;  4YIJ A;  3H94 A;  3I70 A;  4GKJ Q;  4DPG A;  2PO4 A;  1RCV D;  1OXX K;  4OO1 H;  2PZT A;  2A19 A;  2F0M A;  2PW7 A;  2Z6K A;  1MIU A;  2PMZ B;  1GHK A;  4PNY A;  4DV4 Q;  1V8Q A;  2BDO A;  1S5B D;  4OX9 Q;  4V0B A;  2WB1 G;  4G4K A;  4OGQ C;  3NE5 B;  1NMG A;  4BY1 G;  3KLS X;  1SNO A;  1TKW B;  2Z8L A;  4KY7 A;  1Q7Y C;  4JK1 C;  2PMZ E;  2RHQ B;  5JJZ A;  4MIU A;  4ABN A;  1X3G A;  3K80 C;  5FLX L;  3HKZ G;  1PTO C;  4KN4 C;  1X54 A;  2FMM A;  1PRT D;  1L1O C;  4X62 L;  1SNP A;  4JI8 Q;  2R7F A;  1GUO A;  3A8J E;  3FDT A;  1D6E C;  4HJ7 A;  3I4N G;  3STB C;  3S1M H;  1JOQ A;  3J81 L;  3I8Z A;  1JB3 A;  1VQE A;  3CCJ A;  1V43 A;  2AQ2 B;  1JJ2 A;  2A69 D;  2L5T A;  3ZYY X;  2G9H D;  2WV6 D;  3KOJ A;  4OHJ A;  2NZH A;  1QZH A;  3OTO L;  1TWC B;  1WTV A;  4B3M Q;  4C3I G;  2F0H A;  1IBM L;  1STG A;  1VQH A;  2WB1 B;  4CDC C;  4BY1 B;  3IFD A;  4K8J A;  2I5L X;  2QEX A;  3U9O A;  2K03 A;  5D3D A;  1B50 A;  4I7A A;  4WJ4 A;  1DGS A;  1BBU A;  5FO7 B;  4JI5 L;  4XQN A;  4X64 Q;  4R1J A;  3HKZ B;  3VR3 A;  1IZ6 A;  5C4J H;  2L0C A;  2WB1 E;  3ND8 A;  2RF4 A;  2AUJ D;  4IPH A;  2PNR C;  1I3Q H;  1TY0 A;  2EY2 A;  4KMU C;  1T5X D;  2QDB A;  5IT9 E;  3I4N B;  2RDH A;  4QIW E;  1SDF A;  1JOR A;  5K5P A;  4RGM A;  2OEO A;  1YHQ A;  2J7Z A;  4ZAI A;  1LAC A;  2EYH A;  5M9O A;  3MA2 B;  4TSS A;  1K8M A;  5FO8 B;  2K33 A;  3G7L A;  1K83 B;  2RSO A;  3QIA A;  2NVQ B;  1U4M A;  1I4G A;  3PIO 3;  4EQ5 A;  3PUV A;  2F3V A;  4RCN A;  1Q3L A;  3CCM A;  2UUC L;  2UXB Q;  3ER0 A;  4JV5 Q;  4ZK9 B;  3QOJ A;  5EPK A;  2ENB A;  1HTL D;  2ZTE A;  2F0N A;  1B70 B;  5DLQ E;  1YJN A;  2UUB Q;  1TWF B;  4H13 C;  5IYD H;  2A6H C;  2LXK A;  1RDP D;  4BBR G;  1P8L A;  4DK0 A;  4CDE C;  1CSP A;  4NDX A;  4A3C H;  1EWC A;  1B1Z A;  4JI3 Q;  1L0Y B;  1L1O A;  5IOD A;  2ZJR A;  4IJH A;  2JA6 B;  3S14 H;  2JK8 A;  3HG9 A;  1V9P A;  1WTX A;  1VQK A;  4DUZ L;  2CW0 C;  2IHF A;  1N32 Q;  2ES2 A;  3DWA A;  3KFU A;  2PYK A;  3GTO H;  2I5M X;  2Q2T A;  2YV5 A;  1VF5 C;  3HOV H;  1BR9 A;  1IKL A;  5L37 A;  3PCO B;  3DXJ C;  4XQJ A;  5IIF A;  1QNU A;  1PFS A;  5C5L A;  2G9D A;  4DV1 Q;  5AFW A;  4B9X A;  4UY8 C;  4F8M A;  4BBR B;  5C3X A;  1HXY D;  1XTC D;  3CQZ H;  3M4O H;  1Y8N B;  5D14 A;  4XXE A;  1QUQ B;  1AZQ A;  2YU9 H;  5M3M G;  4B3R L;  1IL8 A;  3F2C A;  1A2T A;  2DNC A;  3N52 A;  1JC7 A;  2VQF Q;  3I4M G;  1Q46 A;  1BCP F;  3D8G A;  3V05 A;  2XRS D;  4GKK L;  3Q6S A;  4X65 L;  1F77 A;  4OEM B;  5KNC A;  2CHB D;  1DM0 B;  4L8J A;  4A3E G;  4R4Q A;  2K5N A;  3CPF A;  2K1B A;  3CAM A;  3R3O A;  5I6W A;  3E9H A;  4EQN A;  1X3P A;  4R4I A;  4LF9 Q;  2XTI A;  5LMN Q;  1Y14 B;  3TZD A;  5M3M B;  2MHV A;  4S3S A;  1Q82 C;  1HA5 A;  2EPB A;  5GAG C;  5GAH C;  1YNN D;  4A3I H;  3I4M B;  4HIK A;  5BR8 Q;  3GTJ H;  1WOC A;  3C1E A;  3ERS X;  2CQA A;  4MTK A;  1EOV A;  4ZCK A;  1FJG Q;  4R8I A;  2E2H H;  1VQG A;  3BZK A;  2QDL A;  2K28 A;  3T4A C;  4A3K G;  1DJR D;  2A6E D;  2J0T D;  5C3E B;  3I55 A;  3Q0A A;  4A3E B;  1LTS D;  5F2D A;  2EY6 A;  5EJW A;  2N8N A;  1S5F D;  1I4H A;  5BN4 A;  1CFM A;  1TII D;  1I4Q A;  3GTG B;  4A3D G;  4JI0 L;  2E75 C;  4FP5 D;  4PZ7 A;  1WCM H;  4F88 A;  2IL8 A;  3P1H A;  1AFP A;  3MZ5 A;  1EY8 A;  4O1N A;  5KNB A;  1QVF A;  4CBV A;  2WP8 J;  3I56 A;  4C1N K;  1PH5 A;  2E2D C;  4WFN 3;  1NY4 A;  3KLR A;  4A3B G;  3NUC A;  2E2J H;  4A3L G;  4A3K B;  2HHH Q;  1BXT A;  2NUC A;  2SDF A;  2PCF B;  1K3B C;  3GD7 A;  2WFW A;  3TBI B;  1G8Z D;  2M9V A;  3VYR A;  1EYC A;  3L9A X;  1CA6 A;  1CQV A;  4WRD A;  4C1N I;  2HUG A;  1EY7 A;  1N36 Q;  1VQ5 A;  4L5R C;  4LAA A;  5FK9 C;  1KAB A;  1V1O A;  3T51 B;  3RZD B;  4BY7 H;  1SYF A;  2A5H A;  1EIH A;  1TVX A;  1K0R A;  1KC8 C;  1M90 C;  3EA6 A;  4LF4 Q;  1LYL A;  1HNX Q;  5EAY A;  2F0K A;  3GTK H;  4A3B B;  3FEW X;  2NVX B;  1O7L A;  5IGF A;  1H9K A;  4A3G G;  1A0I A;  5G3L D;  2SOB A;  3DM1 A;  1GUG A;  1OTC A;  1VS0 A;  4LJZ C;  5I6Y A;  2R93 G;  2V4D A;  2F0F A;  2WAC A;  2D0P A;  5GQO A;  4K14 A;  4R9W A;  4C3H G;  3GTM B;  5E1F A;  4GKJ L;  3JAM E;  1DOM A;  1PTO H;  3J7A 5;  1XNR L;  4B3S Q;  5JPM C;  3ICE A;  3TRZ A;  3PO3 G;  2KCN A;  4DV4 L;  4U67 3;  1LO5 D;  1IBL Q;  4H0L C;  1H9S B;  1A6X A;  1J8I A;  1JMC A;  4H7B A;  1C8C A;  4A3G B;  5A35 A;  3A56 A;  4OX9 L;  3C46 A;  2WAQ G;  1F2Z A;  4P74 A;  3RLF A;  3X3N A;  3MVV A;  2VUM H;  1CM9 A;  1ET9 A;  3TDQ A;  3W3A A;  3U9S A;  3U4V A;  4KHP Q;  4GS3 A;  3RUZ A;  3H0G B;  2K50 A;  1KNE A;  2EZV A;  3S2H B;  1WTH A;  2KVM A;  4JI8 L;  4C3H B;  1GUW A;  3ERQ A;  2JEA I;  1E2W A;  1K9M C;  2OWO A;  2RQX A;  4JCV E;  1L0W A;  4RGO S;  3IAY A;  1X32 A;  4B3T Q;  2EDG A;  1KNA A;  4U68 A;  3DUZ A;  4KD4 A;  1J9O A;  3PO3 B;  2RKS A;  4ULL A;  4JI1 Q;  2N55 A;  3CCS A;  1HPC A;  2KEN A;  3TSS A;  5FLM H;  4LFC Q;  4V19 0;  1BVS A;  2ZT9 C;  4FNF A;  1SFO B;  1YHA A;  4RFB A;  1EEF D;  1LUZ A;  1QCB D;  2JA8 G;  1SE3 A;  2HDM A;  1SRU A;  4L63 B;  5J22 A;  4HJ8 A;  3OIQ A;  1VQ8 A;  4X64 L;  3VR5 A;  1E2V A;  1JWM D;  3MXU A;  2NN6 G;  5E4X A;  5C44 H;  3NPP A;  1A3T A;  1VQC A;  3BYY B;  4GLX A;  3DMU A;  5C4X B;  2MO1 A;  4X66 Q;  2NYZ D;  4ZQ3 A;  4RKL A;  2AQ3 B;  3MFY A;  1N8R C;  2TMP A;  4PV1 C;  3H3V I;  1X55 A;  1C9O A;  3D31 A;  5KND A;  2HIX A;  4IZ8 A;  2NBF A;  1K8A C;  3D6C A;  1FVI A;  4Y7N B;  3SK6 A;  1KLU D;  3J7A F;  2KA7 A;  3HOX G;  1F9S A;  3GP7 A;  2VB2 X;  2B2W C;  1VQ7 A;  2JA8 B;  1D8L A;  1A62 A;  3CMA A;  3MTS A;  2UXB L;  3PIP A;  3HP3 A;  4JV5 L;  5M3F H;  3EBE A;  1F9Q A;  1HHV A;  1AP0 A;  4ZYS A;  2WII B;  3S1R B;  1HNZ Q;  2OTJ A;  2DNE A;  3FRP B;  4K2L A;  2UUB L;  4FO2 A;  4A76 A;  2NN6 I;  2JA5 H;  1F2Y A;  5H1S E;  5FLX c;  1LV9 A;  2QF7 A;  2A8V A;  2Z1C A;  4HMJ A;  5EKL A;  1NR2 A;  4JI3 L;  1UWV A;  4C3J B;  1JE4 A;  3K0Y A;  1R9T B;  2BH8 A;  4HJ9 A;  1D2B A;  2AKW B;  4QJF A;  3UDI A;  3HOU H;  1VQB A;  1YNJ C;  3LNN A;  5IP7 G;  1ILP A;  1DON A;  3RLO A;  1ENC A;  4EGV A;  1K73 C;  3CCR A;  3NHH A;  4FF3 A;  5EQ0 A;  4NXN Q;  1VQD A;  3OSO A;  2BA0 A;  4X3S A;  4DV1 L;  1JCK B;  4DR6 Q;  2CH4 W;  2IY5 B;  2NVY B;  2I5H A;  2VB3 X;  2NVT H;  2O5J C;  3PMF A;  2XN9 C;  5CBE E;  2K5W A;  3ULL A;  4IFD G;  3HOZ G;  2F0L A;  3RNU A;  2VQF L;  2O5I C;  1YIJ A;  3K6O A;  3E9I A;  2R3Z A;  4R8N A;  1LTI D;  5IT9 L;  1E1T A;  4A3F G;  2D2C C;  3BDL A;  5CV8 A;  2B2W A;  2Z6K C;  2Z4H A;  4G7Z C;  2F0I A;  3A74 A;  4GLA C;  5JOB A;  5KYL A;  1JT8 A;  2KQ3 A;  2ZXP A;  1IBK Q;  3SK5 A;  3W5O A;  2CCZ A;  5AJ3 Q;  3GTQ B;  4OWX B;  4LF9 L;  5LMN L;  2EIF A;  4BY1 H;  1B3Q A;  1Y1V G;  4LFA Q;  3CC7 A;  1F9R A;  1SEB D;  2CQO A;  3HOZ B;  1F2M A;  4K5V A;  4IFD I;  1IW7 D;  3ITP A;  2F0S A;  1WI5 A;  5BR8 L;  2KBN A;  1WFQ A;  3PV0 A;  4FXG C;  2LSS A;  1L2F A;  1FJG L;  4A3F B;  3PO2 H;  4MHE A;  1I4R A;  1EZ8 A;  3GDE A;  2XWB B;  3I4N H;  2A69 C;  1PRT F;  1I50 B;  3T16 A;  2FJ2 A;  2OCE A;  4N9T A;  4C2M B;  1EUJ A;  3WDN A;  2XNA C;  4YY3 Q;  2MJ8 A;  4RHS A;  4C3I H;  1K83 H;  5GAD C;  2IW3 A;  1QVG A;  1Y1V B;  3JAM c;  3H3V C;  1TS2 A;  2OQK A;  3M7G A;  4J1M A;  4WOR A;  4KKU A;  4DR3 L;  3S1N B;  2ZTD A;  1PMR A;  3VA5 A;  4X3K A;  2L55 A;  3FPP A;  2B8G A;  1BCP B;  1FYC A;  1NTG A;  2HHH L;  2JYO A;  3NSW A;  1N33 Q;  4YCU A;  3HOY H;  2NZO A;  2AUK A;  2D62 A;  1Y1W G;  5T1I A;  3RN2 A;  4FVM A;  1U9R A;  1PDQ A;  2LXJ A;  1UE1 A;  4CKB A;  1E24 A;  1H9S A;  2F4I A;  1PH4 A;  4DAV A;  5I9O A;  4DR2 Q;  1EY0 A;  1G51 A;  3MC0 B;  2OF1 A;  1N36 L;  3E0E A;  4DR5 Q;  1KLG D;  2ZJP A;  5FJ8 H;  1VDZ A;  3NEM A;  2Q2H A;  4CGY B;  4MTN A;  3K7U C;  5CC4 A;  1ZYR D;  2M2L A;  4LF4 L;  4HSP A;  2SEB D;  2UXD Q;  1HNX L;  4DV0 Q;  2K75 A;  3PGZ A;  2PQA B;  3VYS A;  5IYC H;  5FKA C;  1VQP A;  3KLS A;  1EIY B;  1A15 A;  4KI0 A;  4ME5 A;  1CHQ D;  1GKH A;  2YTV A;  1Y1W B;  4NW2 A;  1G2S A;  4LUV A;  2E8G A;  5IWA Q;  2UUA Q;  3K5O A;  1BUV T;  2PZU A;  1BOS A;  2RSN A;  4JYA Q;  4IOA A;  3FKI H;  4UDU C;  4M8A A;  1S3O A;  2K52 A;  5J1Z A;  3HKS A;  4NXM L;  3J80 i;  3V2T A;  4B3S L;  3K7A B;  5EGT A;  4KTA A;  2F1M A;  4GN5 A;  1IYU A;  1ZKO A;  4LF8 Q;  1PTO F;  2HQE A;  4QIW B;  3KF6 B;  5BN3 A;  2ZM6 Q;  1IBL L;  1LTR D;  1FD7 D;  5DEH A;  1CT1 D;  5IYB G;  2JJQ A;  3S1Q B;  2Z9H A;  4BS9 A;  2NZ1 D;  3X3M A;  4OIJ A;  1VQM A;  3U4Z A;  5ELC A;  4UP7 A;  1K3R A;  1KRT A;  1PH9 A;  1CKM A;  3RN5 A;  5M3M H;  1OO9 B;  3W1B A;  1MKH A;  5M5X B;  1RTO A;  1WD0 A;  4IUT A;  1ICW A;  1MHW C;  2EQS A;  3NQI A;  4KHP L;  2JA6 G;  2K4K A;  3I4M H;  2VZA A;  5M5Y H;  2GVA A;  2LMC B;  1TWA H;  2VW9 A;  4B3T L;  1CKN A;  4JI1 L;  3HZX A;  3S16 B;  2F0E A;  3UDG A;  4LFC L;  4QGU A;  4Q5V A;  1XPU A;  1HUN A;  1LT5 D;  3Q24 A;  4OO1 G;  5K36 H;  2IHE A;  3GTP H;  3QG1 A;  2ICE C;  1IYJ B;  2EXZ A;  3BU2 A;  3NTH A;  4H02 A;  5C0X I;  1VQ4 A;  1RF2 D;  1TR5 A;  3CME A;  1FL0 A;  4QF4 A;  1EY9 A;  3SEB A;  2E5L Q;  4RAU C;  2B63 H;  1X3E A;  4X66 L;  4CJ0 B;  3OPO A;  1YEZ A;  2B2V A;  2ID0 A;  1A3V A;  1SNC A;  3BVM A;  3IRB A;  4A3K H;  1PTO D;  3FP9 A;  2K05 A;  1V1P B;  3P75 A;  1TWG B;  3G71 A;  3UE1 A;  3NXW A;  1B53 A;  1SLJ A;  1S4Z A;  3GV3 A;  4IUV A;  4JOI A;  4QMG A;  1EIF A;  1U4R A;  4A3D H;  2EYL A;  4OO1 I;  3JAM L;  5DM6 3;  3OOC A;  2DJG C;  3OIP A;  3SK8 A;  4A93 G;  3I3C A;  3C3L A;  3ZJY C;  3H6M A;  3ULP A;  1BCP C;  3VR2 A;  1HNZ L;  1WVL A;  1JB7 A;  2BE5 C;  2YTY A;  5T1G A;  1BBW A;  4HIO A;  3K0X A;  2HCC A;  2NVX H;  1BDO A;  4N9P A;  4R4C A;  1STH A;  3CC2 A;  5HUR A;  4GOP B;  1W2B A;  3MXN A;  3NBI A;  4L5S A;  2E2I H;  2R7Z H;  2Q2I A;  4P72 A;  3G6E A;  1II3 A;  1E1O A;  3FPU B;  2F0V A;  5IE8 A;  1RD9 D;  1B7Y B;  2Z6B A;  2VL6 A;  3S1M B;  1YNX A;  1PYS B;  4JW0 A;  1JIC A;  4XTC S;  1UUP A;  3VA7 A;  5C3E G;  2ZXO A;  1G2T A;  3PIO A;  4A75 A;  2JE6 I;  3T56 B;  1SND A;  1EFI D;  4A93 B;  3KJO A;  2Q8I B;  2VXW A;  1STE A;  1WTQ A;  3K58 A;  1EIG A;  3N6R A;  3ERO A;  2EE1 A;  5M5W H;  1Z47 A;  3FHW A;  3OMC A;  4NXN L;  4DA2 A;  5IGC A;  1E0B A;  3O13 A;  4DR6 L;  1MD2 D;  3IFT A;  1LM0 A;  2X69 A;  3CKI B;  2IX1 A;  3VDY A;  5E4W C;  5C4J B;  1R4Q B;  1KXL A;  3M3Y H;  3LWU A;  4BXX H;  1I3Q B;  4A3J H;  3PUX A;  4X6A H;  4A3M H;  2A73 B;  1SMX A;  2V1C C;  1MI2 A;  2F0T A;  3CHB D;  5G3L F;  1CHP D;  5EKK A;  4A3C G;  4ALP A;  2A1A A;  4DN4 M;  3QO2 A;  3ND9 A;  4OWT B;  2KEC A;  2R93 H;  2F03 A;  4LWC A;  1BO0 A;  1Q8I A;  4C3H H;  4IUQ A;  1AE2 A;  3AYH B;  4NB3 A;  4RHR A;  3LX0 A;  2QGQ A;  2CFM A;  2CWA A;  2CW0 D;  1IBK L;  1S5C D;  2XVS A;  4DV5 Q;  1YBY A;  4DAM A;  3PUY A;  3HOV G;  2AQ1 B;  1GOZ A;  2MNA A;  5ELN A;  3TQY A;  3MHB A;  3J81 i;  4LFA L;  2LY7 A;  1Z7T A;  2F4V Q;  5HGQ A;  3WOF A;  2EOT A;  4R4O A;  5ELB A;  3V96 A;  1M8A A;  4OIK A;  3MEF A;  1HH2 P;  1LTT D;  3D0F A;  3S14 B;  3H3V H;  4QY7 A;  3PQI A;  1DZ1 A;  2EY1 A;  4CDF C;  2DUD A;  1C7Y A;  2EVB A;  3GTL H;  2QIL A;  3ULJ A;  1Z6H A;  5JJK A;  4M1U B;  4RCO A;  4ME3 A;  4JI7 Q;  1CQF A;  4DU9 A;  2FXQ A;  5JEA H;  2QW7 A;  2PQA A;  4RGT A;  5DNF A;  2UXC L;  4YY3 L;  1CI3 M;  3HOV B;  4AH6 A;  1Q1E A;  4P71 A;  3KDF B;  4K6D A;  1SXT A;  5IGB A;  5CV6 A;  1OXS C;  5NUC A;  4JPB W;  2F0P A;  2JXM B;  3BZC A;  2HCI A;  4K0K Q;  4ODG A;  4RG1 A;  4LFB Q;  1LT6 D;  1SSO A;  2F0J A;  5JEA J;  1H9J A;  1Y8P B;  3BDC A;  3PUW A;  1IHZ A;  2EJM A;  1B2T A;  3CQZ B;  2NN6 H;  3M4O B;  2EY5 A;  4TRD A;  2Y0S E;  2YU9 B;  4F7X A;  3L7Z C;  2K5Q A;  4NPS A;  1ASY A;  3H0G G;  4IN3 A;  4KJO A;  2KHS A;  1S72 A;  1HZC A;  4PZ8 A;  4DV3 Q;  1N33 L;  4A3I G;  2NWG A;  4DK3 C;  5IT9 c;  5CBA E;  3CC4 A;  2IWH A;  1XNQ Q;  3SVM A;  1GM5 A;  1WTP A;  2H1E A;  1STA A;  2K5V A;  5EPL A;  1EY6 A;  1RKN A;  3KF6 A;  2VNU D;  1PLF A;  1GD7 A;  3SXH A;  3H91 A;  2AWO A;  1P16 A;  3HOX H;  1UEA B;  4DR2 L;  4DV7 Q;  3RLN A;  5COY A;  4DR5 L;  3MAQ A;  1I5F A;  1VQF A;  5HY6 A;  4ILW A;  3S9W A;  5C4Z A;  1Q86 C;  4CKC A;  3CPW A;  4GOP C;  1E7Z A;  1HR0 W;  3I73 A;  3QJY A;  2UXD L;  2B39 A;  4DV0 L;  2HIV A;  1AEX A;  1CK1 A;  1AH9 A;  2L11 A;  1PH8 A;  3RZO B;  2CWP A;  2KUM A;  2NVY H;  1C4Q A;  3DEO A;  2HDL A;  4A3I B;  1MGS A;  3EQL C;  4HMI A;  5C4X G;  3W2D A;  4DKA C;  1LAB A;  3GTJ B;  1Q90 A;  1QG7 A;  1V1Q A;  2O2L D;  5KGU A;  5CR3 A;  2UUA L;  3AU7 A;  2Q8R E;  1HA6 A;  1PRT B;  1SYC A;  2E2H B;  2P5Z X;  4JYA L;  3E6Z X;  1JR0 D;  3I7F A;  2C5C A;  1CUK A;  5ISR A;  2RCN A;  4QB4 A;  1B8A A;  3MXP A;  5I2Y A;  4POG A;  4IJL A;  4B3M L;  2R92 H;  3UE0 A;  1DCZ A;  4EX5 A;  3OYY A;  1SJH D;  1VQI A;  1N34 Q;  1JJC B;  1W6J A;  5BN5 A;  4LF8 L;  2ZM6 L;  3OW7 A;  4F87 A;  1MBY A;  1D5M C;  3C1F A;  1G6P A;  3L2P A;  2EYJ A;  5KYI A;  1I6H H;  2JA9 A;  2GA4 B;  1AE3 A;  3BJU A;  3PUZ A;  1JOK A;  3HRZ C;  4RH6 A;  5C4H A;  2A68 D;  1EU3 A;  1V1P A;  2J4X A;  4DUY Q;  2E2J B;  4JC0 A;  4APV A;  2N78 A;  3E3X A;  1YIT A;  1VQ9 A;  2JA7 H;  3HOW G;  3HOZ H;  1XYI A;  2L4N A;  4C3J G;  4DAY A;  4LUO A;  1XWE A;  4A4I A;  1IYV A;  3K5M A;  3I2Z A;  4RGN A;  4IPC A;  5COR A;  1QB5 D;  3S15 H;  2IT1 A;  1HZB A;  1JWU D;  3I72 A;  1X9N A;  4QL5 A;  4I65 A;  4AYB E;  2VS1 A;  1I50 H;  1SMY D;  3NWS A;  3S17 H;  4BBS H;  4BY7 B;  3DWP A;  2HT1 A;  1CKN B;  3SGI A;  4GOP A;  1HNW Q;  4ZRZ A;  2D9U A;  3GTK B;  5ELD A;  2CH4 A;  1GHJ A;  5JVH 3;  3F8T A;  2MUY A;  3RR5 A;  1SYB A;  3HOW B;  4IPD A;  3I90 A;  4C56 C;  1TWH H;  2LKV A;  1VQO A;  1R4P B;  1H9R A;  1N32 L;  1G29 1;  3M4P A;  1XMO Q;  3T1H Q;  2KCM A;  1E3P A;  3Q22 A;  2MGS A;  3G4S A;  1UE6 A;  1PH7 A;  1PTO B;  5C5M A;  1D5X C;  4XQQ A;  3EFX D;  3DEP A;  4EQP A;  2AHO B;  4P73 A;  2C35 B;  4OXP A;  3IKJ A;  3OWF A;  3A7A B;  2CVR A;  3T53 B;  1AZP A;  1AN8 A;  1PH2 A;  2B2T A;  4RMF A;  5EPJ A;  1G6Z A;  1UE7 A;  2BDN A;  4DV2 Q;  2IJ0 A;  3C2P A;  2VUM B;  2FFK B;  2KCT A;  3KF8 B;  1A8V A;  2KHI A;  4YHH Q;  4KN7 C;  4H44 C;  3R2I A;  1BF4 A;  3CCU A;  1GVP A;  3MXN B;  4IO9 A;  2X6G A;  4KKS A;  2RA4 A;  3K5N A;  1L0X B;  3MEH A;  1JOO A;  1PFM A;  4MNO A;  1S5E D;  1Q81 C;  1Q12 A;  1TWC H;  3NEL A;  4XYQ A;  1C0A A;  2JN4 A;  4L5Q A;  1ZYR C;  4Y52 H;  4KY6 A;  2RDF A;  1NR4 A;  4P75 A;  4UAI A;  1ZXT A;  3K8A A;  4QCL A;  3J81 j;  3QWN A;  2EJF C;  1PRT C;  5M3F G;  4IUN A;  3A55 A;  3CF5 A;  3I91 A;  5D3I B;  1JQY D;  2C9O A;  3CCL A;  4LNQ A;  2VQE Q;  2B8F A;  3S1Q H;  5C44 B;  1NNX A;  2MPM A;  1EWI A;  3K57 A;  1LT3 D;  2JA5 G;  5JJL A;  2OXP A;  1O7Y A;  1UE5 A;  1W6K A;  3R2T A;  1SYD A;  1CZG A;  4DF7 A;  3KDF A;  3M4Q A;  3G6J B;  3D3R A;  4K5W A;  1NSN S;  4DXG A;  3UI2 A;  3BG3 A;  1RTN A;  1XXG A;  1KRS A;  2NVQ H;  4OL7 A;  1YNJ D;  1GUT A;  1I4X A;  3QR8 A;  5IP9 G;  2ATW A;  5JAV A;  3T13 A;  1J5E Q;  3WWV A;  1PV4 A;  1HQR D;  2F0W A;  2PQE A;  4DV5 L;  4MZ9 A;  5M3F B;  1J6Q A;  5JJI A;  4DNI A;  1NAP A;  1KHI A;  1KDA A;  4ZUI A;  4JBJ A;  1TWF H;  4FXD A;  3SK4 A;  1VQA A;  2JA5 B;  2PNH A;  2F4V L;  1FGB D;  2H4O A;  2WKC A;  4HTH A;  1EYD A;  1VF7 A;  4NMZ A;  1PH6 A;  1D1I A;  4IPG A;  2JA6 H;  4BA1 I;  3T1Y Q;  4JI6 Q;  3OW2 A;  2D0O A;  1BNZ A;  3HOU B;  4K6L A;  1SYE A;  2A74 C;  4FDB A;  2XIW A;  3J7Z C;  1ENF A;  1BBX C;  3BVG A;  4JI7 L;  2LS0 1;  5CV9 A;  1FNU A;  2HQL A;  2N88 A;  1X3F A;  5A2Q E;  1KAA A;  4KJN A;  1O7I A;  4WJ3 M;  4O42 A;  1VQN A;  2JEB I;  1H95 A;  1XNR Q;  4IOC A;  3HS0 C;  3J80 E;  2EJG C;  3CCQ A;  4BBR H;  4K0K L;  4CKE A;  4LFB L;  1PZJ D;  4XT1 B;  4LK1 C;  2NVT B;  4OWW B;  3BDO A;  3CCE A;  4JVZ A;  1HFG A;  3S2D B;  3TME A;  1TXY A;  3G48 A;  1ICF B;  1A63 A;  2B2V C;  4O2D A;  1NBW A;  1LTA D;  2B29 A;  2IPK D;  1XPR A;  2RBM A;  1YI2 A;  4DV3 L;  1D7Q A;  3F2U A;  5IOC A;  1XNQ L;  1FR3 A;  1OXU A;  2UU9 Q;  1JWS D;  4JOI C;  2EYO A;  3A54 A;  2K5D A;  4J6H A;  3PO2 G;  1MSG A;  4YCV A;  4PZ6 A;  4YCW A;  1B9M A;  2YTX A;  3SR1 A;  3E5S A;  4K2K A;  4FF2 A;  1U4P A;  2XRQ D;  4KD3 A;  5E3F A;  4DV7 L;  2OTL A;  4DR1 Q;  4ZLT F;  1HQM C;  1KD1 C;  4X3T A;  3BS1 A;  4A93 H;  5C0X G;  4HCE A;  3VR6 A;  1KTK A;  3M4Y A;  3TN2 A;  2RHS B;  3OWE B;  1ET6 A;  4LW1 A;  2IX0 A;  3D4W A;  2L9H A;  3M9B A;  4AIM A;  2I46 A;  3CRL C;  4HSV A;  1OXT A;  2DJF C;  3CCV A;  3A7L A;  3R8B A;  2LFN A;  3M85 A;  1CSQ A;  2ZJQ A;  3A8I E;  1CKO A;  1IXR A;  2D5D A;  4UHV A;  3PO2 B;  2MQH A;  4GNX A;  2NTS A;  2EXD A;  3HOY G;  3HKZ E;  3LWE A;  3NP8 A;  5C3E H;  4KK7 A;  5C6A A;  3NTK A;  4AQY Q;  1CZW A;  4A3E H;  1RL2 A;  1K0S A;  3KJP A;  3CW2 C;  3F2B A;  1XMQ Q;  1DXM A;  4TVA B;  1VQL A;  3GTG H;  1X65 A;  1GXD C;  1NJI C;  4C3I B;  1N34 L;  5ELE A;  4JI2 Q;  1X56 A;  3TP5 A;  2QKI C;  5FJ8 G;  1YNN C;  4FF4 A;  3KBG A;  3H15 A;  4IUR A;  4DV6 Q;  2JSO A;  3JC6 6;  3QOL A;  5LMU Q;  4DUY L;  1KAW A;  5GRO A;  5IYC G;  2L15 A;  4LMQ D;  4DK1 A;  2A6E C;  1QWY A;  1E22 A;  1ROD A;  3OMG A;  5ELO A;  5FO9 B;  2QA4 A;  3HOY B;  3MXG A;  1QE6 A;  2PI2 E;  2OQ0 A;  3S24 A;  3SHL A;  2R6G A;  4N8X 1;  2DGY A;  1QOH A;  1F2L A;  3VYU A;  4DAY B;  1HFN A;  3STB D;  1XX8 A;  3CRK C;  3FKI G;  4XIG S;  2KED A;  3RZD H;  1X3Q A;  4HIM A;  1HR0 Q;  4G7H C;  2PW5 A;  3KF8 A;  4IQZ A;  1SYG A;  5TSS A;  1HNW L;  4A3B H;  1NMF A;  2MO0 A;  4LF7 Q;  1SNM A;  1BKB A;  3J7A V;  2ZTC A;  3FMC A;  4CHT B;  4A3L H;  3AEV A;  3RMH A;  1TS4 A;  1D5Z C;  4DFA A;  5DM7 3;  1W3S A;  4JI4 Q;  3J7Y W;  1B44 D;  3NWT A;  1ONL A;  2TSS A;  1EWH A;  1QJO A;  3EJI A;  1PH1 A;  5LL6 X;  5I9P A;  4JBK A;  2Z4I A;  5LHY 1;  1PFN A;  1VQ6 A;  4DR7 Q;  1O7Z A;  1EYA A;  3SDZ A;  4RKB A;  3FKI B;  2XSC A;  2RVL A;  1XMO L;  1HTP A;  3GTM H;  1NCV A;  3NEN A;  3T1H L;  1KIX A;  1KQS A;  3F2D A;  4UPA A;  3A5Z B;  2FHT A;  5GAE C;  2MFI A;  3PSI A;  2YYZ A;  1GO3 E;  4Z9C B;  1ASZ A;  1FNV A;  2K6A A;  2VY3 A;  2ZXR A;  1M4V A;  2NTT A;  3F1Z A;  1N9W A;  4A3G H;  3AQQ A;  1S40 A;  5K36 G;  5FLX E;  2ALY B;  2JQO A;  1SE2 A;  5IYD G;  2F0G A;  2X6L A;  1RIP A;  3R93 A;  1TU2 B;  5I4D A;  4DV2 L;  2A6H D;  2H5X A;  4RA8 A;  2KHJ A;  1KL9 A;  4JBW A;  2EYM A;  4LF6 Q;  5HGT A;  3NBH A;  3RZO H;  4KHV A;  3H0G H;  1SJE D;  3TRE A;  3J81 E;  4YHH L;  3S2H H;  1YZ6 A;  2B63 G;  2CKZ B;  5CGK A;  5M5Y B;  1EEI D;  2F3W A;  3P20 A;  1ESF A;  1MSH A;  2ICI A;  1TWA B;  3K81 C;  5KEE A;  1HUM A;  4QUC A;  3U58 A;  4K8I A;  3PO3 H;  2F0U A;  1K28 A;  5AJ3 L;  3L3O C;  2FIN B;  1DD2 A;  2M00 A;  1TT2 A;  4K5X A;  2IX3 A;  1SE4 A;  1SFO H;  3D4R A;  4LF5 Q;  3DHQ A;  1VMC A;  4TQU S;  3GTP B;  2Y0S G;  4IUU A;  5JPN C;  5JVG 3;  1GUS A;  1PVO A;  1I94 Q;  2HD3 A;  1XPO A;  1T9H A;  1NE3 A;  4P2C B;  1YVC A;  4YWL A;  1Y69 U;  3AFQ A;  3GQB A;  3J80 c;  2VQE L;  1WJJ A;  4DR3 Q;  4FF1 A;  1BCP D;  5C4X H;  1YJW A;  2B63 B;  3TS0 A;  2BE5 D;  3EVQ A;  1SBB B;  4ZKC B;  2N49 A;  3HGB A;  5IGE A;  2QEJ C;  2R7Z G;  3OHX C;  3GTO B;  4DR4 Q;  2KJX A;  4Y7N H;  1K8G A;  1MJE A;  4NKL A;  1OXV A;  3L0O A;  1HRJ A;  5D65 A;  1IKM A;  1XTD A;  2B2U C;  2Y0S B;  2JA8 H;  4LUZ A;  3Q8D A;  1EOT A;  4A3D B;  1J5E L;  4DAP A;  1ILQ A;  1I6V C;  4NP5 A;  2XWJ B;  1A3U A;  3S1R H;  4N8F A;  1FNW A;  4QUF A;  3DWQ A;  2A68 C;  3DLL A;  1SR3 A;  4XDX A;  2EYF A;  1EYG A;  1Z9F A;  2Z0S A;  4EVO A;  1C48 A;  5DAU A;  3Q23 A;  1CTM A;  1LTL A;  3HOW H;  2R7Z B;  4JG2 A;  4C3J H;  4ZUJ A;  2E2I B;  4X62 Q;  1DOL A;  3KBX A;  4B9W A;  1R9T H;  3T1Y L;  4JI6 L;  1D1K A;  4BXX G;  4A3J G;  4A3M G;  3AMU A;  4ID6 A;  3CP0 A;  2EYP A;  3KUP A;  4OEL B;  5LL6 S;  1B9N A;  3KLW A;  4BWG B;  1Q8K A;  2R7D A;  1ZEQ X;  1SMY C;  2K04 A;  1PH3 A;  1IL2 A;  3M7N A;  3OTO Q;  4DXF A;  4KLK A;  1M1K C;  2DN8 A;  1ML0 D;  1IBM Q;  2E74 C;  5J3B A;  5EBC A;  4NXM Q;  2K32 A;  1U5K A;  5M5W B;  2I0Q A;  1GJX A;  1WCM G;  1O80 A;  5FOB B;  3AFP A;  3BVZ A;  3PIP 3;  4FYD A;  4JI5 Q;  2KCC A;  2NB0 A;  1PA6 A;  1VQJ A;  1JJG A;  4CDD C;  5IWA L;  2QCP X;  3A0J A;  1QNK A;  1QIL A;  2PPB C;  3M3Y B;  2GN5 A;  2F52 A;  4A3J B;  1STB A;  2E76 C;  1B4O A;  4A3M B;  1WTR A;  5IP7 H;  1EY5 A;  4AYB G;  3A5U A;  3JAM i;  2AWN A;  4GLV B;  2Q2U A;  1PZK D;  4MN3 A;  1Q1B A;  2UU9 L;  2R93 B;  1UAP A;  4J15 A;  4DNT B;  1I4P A;  1KDB A;  4PMC A;  3UDF A;  2B2U A;  1EQR A;  1WCM B;  3FVQ A;  3TP8 A;  1BQQ T;  4UP9 A;  5C3W A;  2UUC Q;  2PI2 A;  4BY7 G;  4DR1 L;  5JEA G;  5IGG A;  2B3G A;  1F9P A;  3GTQ H;  3RD4 A;  3URY A;  3I4O A;  2K01 A;  2B2T C;  4PMB A;  1DYQ A;  3UDX A;  5LMN W;  2WAQ B;  3GV6 A;  1ENA A;  3MWY W;  4IFD H;  2BA1 A;  1YJ9 A;  4AYB B;  4BA2 I;  3K59 A;  2F0Q A;  5J39 A;  2KEE A;  1U4L A;  4PMW A;  1JE5 A;  4XT3 B;  1WTW A;  4R4T A;  2WAQ E;  4A3F H;  4HJA A;  1DOK A;  4DUZ Q;  4UP8 A;  3GTL B;  4IFD J;  4WJW A;  1CA5 A;  1YHB A;  4AQY L;  2B2Y C;  2BCO A;  4GNX B;  4C2M H;  4HAE A;  2R61 A;  1WTO A;  1XMQ L;  3BZD B;  2SNM A;  3IL8 A;  4HJ5 A;  1EQT A;  4HCS A;  1ESR A;  2L12 A;  3GO5 A;  4XYO A;  3VYT A;  4JI2 L;  2Q8T A;  5A2Q L;  1Y1V H;  3AB9 A;  4G57 A;  4B08 A;  4FXK C;  2I07 B;  1B3A A;  1TQO A;  3E0J A;  4KY5 A;  1IW7 C;  2MP1 A;  2K5H A;  2K14 A;  2PZW A;  1QZG A;  1QUQ A;  3CD6 A;  3S1N H;  2N3S A;  3J80 L;  4DV6 L;  1STN A;  2E5L L;  1LTG D;  4OON A;  2O4X A;  1AW7 A;  1PFB A;  3SE0 A;  5LMU L;  1KDC A;  1STY A;  1TS5 A;  2VUM G;  4B3R Q;  4CJ2 C;  2GVB A;  1EZ6 A;  4YWM A;  4TKO B;  4HID A;  2F0O A;  1WD1 A;  4GKK Q;  4QQB X;  2DY8 A;  4X65 Q;  1EY4 A;  4POF A;  3NQT A;  4I7Z C;  1T5E A;  2F0D A;  3TP6 A;  2SNS A;  2BH2 A;  1HJP A;  3J81 c;  1L1O B;  3HOX B;  1UNS A;  1SN8 A;  3KYH C;  1H9M A;  4E6I A;  5FLM G;  5IY0 A;  1EU4 A;  4GN3 B;  5IP9 H;  2DY7 A;  2WIN B;  2R92 G;  1S5D D;  3K5L A;  1HR0 L;  1PYW D;  1HCZ A;  3D6W A;  4G7O C;  4LF7 L;  1PYB A;  1GUN A;  5IGD A;  3QB3 A;  3TZU A;  3PF5 A;  3DM3 A;  3HFZ B;  1U0L A;  4JI4 L;  2G5D A;  4Q0F A;  5C44 G;  4CJ1 B;  1Y1W H;  4HED A;  3S2D H;  4JBM A;  1SRO A;  5E7N A;  4DK6 C;  3MFG A;  3EN2 A;  1RHP A;  2JA7 G;  4DR7 L;  4HN7 A;  1RJT A;  1E2Z A;  4O0A A;  3BYT B;  1HZA A;  2RDG A;  2B2Y A;  3TEH B;  1UEB A;  3CU7 A;  2R92 B;  2L1B A;  3P7J A;  1FGU A;  2K7V A;  3NK9 A;  1EQV A;  1A2U A;  3H09 A;  5EKI A;  2F3I A;  5KIX A;  3K7A H;  4JI0 Q;  5CYU A;  2OT2 A;  4KV6 A;  3B6Y A;  2RCF A;  3A8K E;  4BBS G;  4DGZ A;  1I6H B;  1MJC A;  1VMP A;  1EQQ A;  1SNQ A;  1TS3 A;  4KKT A;  3HEJ A;  5M5X H;  5CMD A;  4LF6 L;  2JA7 B;  4KHZ A;  1SE8 A;  2FMC A;  4J8Q A;  1HZ9 A;  1XJV A;  2ASB A;  3HOU G;  3TS2 A;  3CXC A;  1VCI A;  3NBH B;  2KOL A;  1LT4 D;  2BOS A;  3EIV A;  3LGJ A;  1QVC A;  4EQO A;  3S15 B;  3W1G A;  3WOE A;  3S16 H;  5CV7 A;  5CV4 A;  3S17 B;  4IUP A;  5EBD A;  4BBS B;  3PF4 A;  1WYD A;  4PG3 A;  1Y8O B;  3NTI A;  4X3U A;  5IYB H;  4LF5 L;  3VR4 A;  4GZY C;  2UXC Q;  5C0X H;  4L5T A;  2AMC B;  2XGT A;  5KRU A;  1PZI D;  2JP1 A;  1PXU A;  4DNR B;  3I4L A;  1I94 L;  1X6O A;  1TY2 A;  4L6T B;  1LLR D;  4GN4 B;  3TP7 A;  2WKD A;  4YWK A;  4RWS C;  1K8O A;  3D4D A;  1TWH B;  5CV5 A;  1NUC A;  3U50 C;  5C0X J;  3KK7 A;  4PQX A;  4GNX C; 
#chains in the Genus database with same CATH homology
 5FLX c;  5H1S E;  1PHJ A;  3BZC A;  3FKI G;  4XIG S;  4K0K Q;  2A8V A;  4RG1 A;  4LFB Q;  3RZD H;  4DR4 L;  1EFW A;  1TWG H;  4JI3 L;  1UWV A;  5JEA J;  3PUW A;  4DPG A;  4GKJ Q;  4HIM A;  1HR0 Q;  1OXX K;  2BH8 A;  4HJ9 A;  2AKW B;  4QJF A;  3UDI A;  3HOU H;  1VQB A;  1HNW L;  2A19 A;  2Y0S E;  1NMF A;  2MO0 A;  5IP7 G;  4LF7 Q;  1BKB A;  2Z6K A;  1MIU A;  2ZTC A;  3L7Z C;  4NPS A;  1ASY A;  4A3L H;  3AEV A;  4DV4 Q;  3H0G G;  1S72 A;  1HZC A;  4PZ8 A;  4DV3 Q;  3RLO A;  1N33 L;  4A3I G;  1W3S A;  4DK3 C;  5IT9 c;  4JI4 Q;  3CC4 A;  1XNQ Q;  1K73 C;  1GM5 A;  4OX9 Q;  2K5V A;  2WB1 G;  3KF6 A;  1NMG A;  4BY1 G;  3CCR A;  1PH1 A;  2VNU D;  4JBK A;  1GD7 A;  1Q7Y C;  2PMZ E;  1VQD A;  4NXN Q;  2RHQ B;  2AWO A;  1P16 A;  3HOX H;  1X3G A;  2BA0 A;  1VQ6 A;  4DR2 L;  3K80 C;  4DR7 Q;  4DV1 L;  4DR6 Q;  4DV7 Q;  2IY5 B;  3HKZ G;  3RLN A;  1X54 A;  4DR5 L;  2I5H A;  1I5F A;  1VQF A;  2NVT H;  5HY6 A;  1XMO L;  3GTM H;  1L1O C;  4X62 L;  3NEN A;  3T1H L;  1Q86 C;  4JI8 Q;  1KIX A;  3CPW A;  1KQS A;  2R7F A;  3F2D A;  1E7Z A;  4GOP C;  4UPA A;  3A5Z B;  5GAE C;  1HR0 W;  2UXD L;  4HJ7 A;  3I4N G;  3STB C;  2MFI A;  3ULL A;  4DV0 L;  3PSI A;  3S1M H;  2HIV A;  4IFD G;  3HOZ G;  2YYZ A;  1GO3 E;  1VQE A;  3CCJ A;  1V43 A;  1ASZ A;  2VY3 A;  1JJ2 A;  1AH9 A;  3RNU A;  1PH8 A;  2VQF L;  2CWP A;  1YIJ A;  2NVY H;  3E9I A;  3F1Z A;  1N9W A;  3KOJ A;  1QZH A;  2NZH A;  3AQQ A;  1S40 A;  4A3G H;  1E1T A;  3OTO L;  5C4X G;  5K36 G;  4B3M Q;  4DKA C;  1IBM L;  1VQH A;  2ALY B;  1V1Q A;  2JQO A;  4A3F G;  2UUA L;  5IYD G;  1RIP A;  2I5L X;  2QEX A;  2Z6K C;  1JT8 A;  4DV2 L;  4JYA L;  3A74 A;  2H5X A;  4GLA C;  3I7F A;  1DGS A;  1BBU A;  4WJ4 A;  2KHJ A;  1KL9 A;  4JBW A;  4JI5 L;  4LF6 Q;  1CUK A;  1IBK Q;  4X64 Q;  2RCN A;  4R1J A;  3RZO H;  1IZ6 A;  3H0G H;  1B8A A;  3W5O A;  4POG A;  4IJL A;  3TRE A;  2CCZ A;  5AJ3 Q;  4B3M L;  4YHH L;  4OWX B;  5C4J H;  3S2H H;  2R92 H;  2WB1 E;  1YZ6 A;  2RF4 A;  3UE0 A;  2B63 G;  2CKZ B;  4IPH A;  5LMN L;  4EX5 A;  2EIF A;  4LF9 L;  1I3Q H;  3OYY A;  1N34 Q;  1VQI A;  4BY1 H;  1JJC B;  1Y1V G;  3K81 C;  3U58 A;  4LFA Q;  3CC7 A;  4QIW E;  2CQO A;  4LF8 L;  3PO3 H;  2ZM6 L;  1G6P A;  3L2P A;  5AJ3 L;  4IFD I;  1YHQ A;  1I6H H;  2JA9 A;  1WI5 A;  5BR8 L;  1AE3 A;  2KBN A;  3BJU A;  1SFO H;  3PUZ A;  1WFQ A;  3PV0 A;  4LF5 Q;  2LSS A;  1L2F A;  4TQU S;  1FJG L;  2Y0S G;  3PO2 H;  4DUY Q;  4EQ5 A;  3PUV A;  4JC0 A;  3GDE A;  2N78 A;  4APV A;  3I4N H;  1YIT A;  1PVO A;  1VQ9 A;  3CCM A;  2JA7 H;  3HOW G;  1I94 Q;  2UUC L;  1XPO A;  1T9H A;  3HOZ H;  1NE3 A;  1YVC A;  2UXB Q;  3ER0 A;  4YWL A;  4JV5 Q;  2OCE A;  4LUO A;  1EUJ A;  3AFQ A;  3J80 c;  4A4I A;  2VQE L;  1WJJ A;  4DR3 Q;  3I2Z A;  2ZTE A;  4YY3 Q;  1B70 B;  5C4X H;  1YJW A;  5DLQ E;  4IPC A;  4C3I H;  3TS0 A;  1YJN A;  1K83 H;  5GAD C;  2UUB Q;  3S15 H;  2IT1 A;  5IYD H;  2N49 A;  2LXK A;  1QVG A;  1HZB A;  3JAM c;  4BBR G;  1X9N A;  4QL5 A;  2OQK A;  4AYB E;  1P8L A;  2R7Z G;  2VS1 A;  1CSP A;  1I50 H;  4DR4 Q;  4A3C H;  4Y7N H;  3S17 H;  4JI3 Q;  4BBS H;  1L1O A;  4DR3 L;  1MJE A;  1K8G A;  2ZTD A;  2ZJR A;  2HT1 A;  1CKN B;  4IJH A;  3SGI A;  4GOP A;  3S14 H;  1OXV A;  3L0O A;  1HNW Q;  2JK8 A;  1XTD A;  2JA8 H;  1V9P A;  3Q8D A;  4LUZ A;  4DUZ L;  1VQK A;  1NTG A;  2IHF A;  1N32 Q;  2ES2 A;  3F8T A;  3RR5 A;  1J5E L;  2HHH L;  1N33 Q;  3KFU A;  4YCU A;  3HOY H;  2NZO A;  2D62 A;  4IPD A;  1Y1W G;  3GTO H;  2I5M X;  2Q2T A;  2YV5 A;  3RN2 A;  3S1R H;  2LXJ A;  1UE1 A;  3HOV H;  1E24 A;  1TWH H;  1VQO A;  3PCO B;  3DLL A;  1SR3 A;  1PH4 A;  1PFS A;  4DR2 Q;  1N32 L;  4DV1 Q;  1EYG A;  1G29 1;  1G51 A;  1Z9F A;  2Z0S A;  1N36 L;  4UY8 C;  3E0E A;  4DR5 Q;  2ZJP A;  5FJ8 H;  1LTL A;  3HOW H;  3M4P A;  4JG2 A;  4C3J H;  1XMO Q;  3NEM A;  2Q2H A;  4X62 Q;  3T1H Q;  2KCM A;  1E3P A;  4MTN A;  1R9T H;  3K7U C;  3T1Y L;  4JI6 L;  3CQZ H;  3G4S A;  1UE6 A;  4LF4 L;  1PH7 A;  4A3J G;  3M4O H;  4BXX G;  2UXD Q;  4A3M G;  1QUQ B;  1HNX L;  4DV0 Q;  2YU9 H;  5M3M G;  2K75 A;  3CP0 A;  3PGZ A;  4B3R L;  2PQA B;  3F2C A;  5IYC H;  2AHO B;  1VQP A;  1EIY B;  4P73 A;  2C35 B;  3KLW A;  1Q8K A;  2VQF Q;  2R7D A;  3I4M G;  4OXP A;  1Q46 A;  4KI0 A;  1PH3 A;  1IL2 A;  1GKH A;  2YTV A;  3M7N A;  4GKK L;  4X65 L;  3OTO Q;  4KLK A;  1M1K C;  1IBM Q;  4LUV A;  2E8G A;  5J3B A;  5IWA Q;  1PH2 A;  2UUA Q;  4NXM Q;  4RMF A;  1U5K A;  2I0Q A;  1WCM G;  1UE7 A;  4DV2 Q;  4JYA Q;  3AFP A;  4IOA A;  4JI5 Q;  3FKI H;  4A3E G;  2KCT A;  2K5N A;  3CPF A;  3KF8 B;  3CAM A;  4R4Q A;  1A8V A;  1PA6 A;  1VQJ A;  1JJG A;  3E9H A;  2KHI A;  1S3O A;  4YHH Q;  2K52 A;  3HKS A;  5IWA L;  3J80 i;  3A0J A;  3CCU A;  4NXM L;  1GVP A;  4R4I A;  4LF9 Q;  2XTI A;  3MXN B;  5LMN Q;  4IO9 A;  4B3S L;  2GN5 A;  2F52 A;  1Y14 B;  4GN5 A;  5IP7 H;  4LF8 Q;  4AYB G;  1Q82 C;  3KF6 B;  3A5U A;  2ZM6 Q;  1IBL L;  3JAM i;  4MNO A;  2AWN A;  4GLV B;  5GAG C;  1Q81 C;  5GAH C;  2Q2U A;  1Q12 A;  4A3I H;  4HIK A;  1TWC H;  3NEL A;  1Q1B A;  2JJQ A;  5BR8 Q;  5IYB G;  3GTJ H;  2UU9 L;  1C0A A;  1WOC A;  3ERS X;  4J15 A;  4L5Q A;  4Y52 H;  1EOV A;  1FJG Q;  2E2H H;  1VQG A;  3BZK A;  3U4Z A;  3UDF A;  1VQM A;  4P75 A;  4UP7 A;  1EQR A;  1K3R A;  1KRT A;  1PH9 A;  4A3K G;  1CKM A;  4UP9 A;  3RN5 A;  3K8A A;  5M3M H;  3W1B A;  1MKH A;  2UUC Q;  2PI2 A;  4A3B H;  4BY7 G;  3J81 j;  4DR1 L;  5JEA G;  3I55 A;  2EQS A;  4KHP L;  5M3F G;  2B3G A;  2K4K A;  3CF5 A;  2JA6 G;  3GTQ H;  4LNQ A;  3CCL A;  3I4M H;  2N8N A;  2VQE Q;  2VZA A;  3S1Q H;  3I4O A;  5M5Y H;  2GVA A;  1EWI A;  4A3D G;  4JI0 L;  3UDX A;  1TWA H;  5LMN W;  2JA5 G;  5JJL A;  4PZ7 A;  2VW9 A;  4B3T L;  1UE5 A;  1WCM H;  2BA1 A;  1CKN A;  4JI1 L;  3KDF A;  1YJ9 A;  3M4Q A;  3UDG A;  4BA2 I;  4LFC L;  4QGU A;  4PMW A;  1JE5 A;  1XPU A;  1QVF A;  4OO1 G;  2WP8 J;  2IHE A;  4R4T A;  3I56 A;  1KRS A;  3GTP H;  1PH5 A;  2WAQ E;  4A3F H;  1NY4 A;  2NVQ H;  4A3B G;  4BXX H;  2E2J H;  4HJA A;  1IYJ B;  4A3L G;  4DUZ Q;  3BU2 A;  4UP8 A;  5IP9 G;  2ATW A;  4IFD J;  4H02 A;  5C0X I;  1VQ4 A;  1J5E Q;  2HHH Q;  3WWV A;  1PV4 A;  1YHB A;  4AQY L;  4GNX B;  4C2M H;  3GD7 A;  4DV5 L;  4MZ9 A;  3CME A;  2WFW A;  1XMQ L;  1J6Q A;  5JJI A;  1FL0 A;  4HJ5 A;  4DNI A;  2E5L Q;  1KHI A;  2B63 H;  1X3E A;  4X66 L;  4JBJ A;  1YEZ A;  1TWF H;  3GO5 A;  2ID0 A;  1VQA A;  4JI2 L;  1Y1V H;  2PNH A;  2F4V L;  1N36 Q;  1VQ5 A;  4L5R C;  3IRB A;  1H95 A;  4A3K H;  3FP9 A;  2JA5 H;  2K5H A;  2K14 A;  1PH6 A;  3G71 A;  1QUQ A;  1QZG A;  3UE1 A;  3CD6 A;  3S1N H;  2N3S A;  4DV6 L;  4BY7 H;  4IPG A;  2E5L L;  2JA6 H;  4OON A;  1K0R A;  1SLJ A;  4BA1 I;  3T1Y Q;  1KC8 C;  4JOI A;  1M90 C;  4JI6 Q;  4LF4 Q;  5LMU L;  3OW2 A;  2D0O A;  1LYL A;  1HNX Q;  5EAY A;  1EIF A;  2VUM G;  3GTK H;  4B3R Q;  2GVB A;  4FDB A;  4YWM A;  4A3D H;  4OO1 I;  3J7Z C;  4HID A;  4A93 G;  3ZJY C;  4JI7 L;  4A3G G;  1A0I A;  4GKK Q;  4QQB X;  3ULP A;  4X65 Q;  2HQL A;  1X3F A;  4POF A;  1HNZ L;  1JB7 A;  4WJ3 M;  1O7I A;  1VQN A;  2BH2 A;  1HJP A;  2JEB I;  1BBW A;  1VS0 A;  2YTY A;  4HIO A;  4IOC A;  1OTC A;  1XNR Q;  3J81 c;  3K0X A;  1L1O B;  1SN8 A;  2NVX H;  3CC2 A;  4R4C A;  3KYH C;  4GOP B;  3CCQ A;  1W2B A;  5FLM G;  4BBR H;  5IY0 A;  4K0K L;  4GN3 B;  5IP9 H;  4LFB L;  2R93 G;  2R7Z H;  4L5S A;  2E2I H;  2D0P A;  2Q2I A;  4P72 A;  3G6E A;  1E1O A;  5GQO A;  2R92 G;  4OWW B;  3CCE A;  4GKJ L;  1HR0 L;  1TXY A;  3G48 A;  3J7A 5;  5IE8 A;  4B3S Q;  1XNR L;  1A63 A;  4O2D A;  1B7Y B;  2VL6 A;  1NBW A;  2B29 A;  1YNX A;  3ICE A;  1PYS B;  4LF7 L;  4XTC S;  1PYB A;  3PO3 G;  3TRZ A;  5C3E G;  1XPR A;  4DV4 L;  3PIO A;  1YI2 A;  1IBL Q;  4DV3 L;  4A75 A;  3PF5 A;  1D7Q A;  2JE6 I;  3DM3 A;  1JMC A;  3HFZ B;  1U0L A;  4JI4 L;  3KJO A;  5C44 G;  1XNQ L;  1Y1W H;  1OXU A;  4OX9 L;  2UU9 Q;  4JOI C;  3S2D H;  2WAQ G;  4P74 A;  5M5W H;  3PO2 G;  1Z47 A;  3FHW A;  4PZ6 A;  4YCV A;  2YTX A;  4YCW A;  4NXN L;  1SRO A;  5E7N A;  4DK6 C;  4JBM A;  3EN2 A;  3RLF A;  2JA7 G;  4DR6 L;  4DR7 L;  4DV7 L;  2VUM H;  2OTL A;  4O0A A;  1HZA A;  4DR1 Q;  3U4V A;  1KD1 C;  4KHP Q;  1LM0 A;  4GS3 A;  3TEH B;  2K50 A;  2IX1 A;  1UEB A;  3VDY A;  4A93 H;  5C0X G;  4JI8 L;  1FGU A;  1KXL A;  2JEA I;  3M3Y H;  2F3I A;  2RHS B;  1K9M C;  2OWO A;  3K7A H;  4A3J H;  4JCV E;  3PUX A;  4LW1 A;  1L0W A;  2IX0 A;  4A3M H;  4JI0 Q;  4X6A H;  1SMX A;  2V1C C;  4B3T Q;  3M9B A;  3B6Y A;  4JI1 Q;  4AIM A;  4A3C G;  4ALP A;  2A1A A;  3CCS A;  4BBS G;  2KEN A;  4LFC Q;  5FLM H;  1OXT A;  4OWT B;  3CCV A;  2R93 H;  1BVS A;  4LWC A;  1MJC A;  1YHA A;  4C3H H;  3M85 A;  1CSQ A;  3AYH B;  1AE2 A;  4NB3 A;  1EQQ A;  2ZJQ A;  1LUZ A;  1CKO A;  1IXR A;  2JA8 G;  2MQH A;  4GNX A;  2QGQ A;  2EXD A;  2CFM A;  2CWA A;  1SRU A;  5M5X H;  4HJ8 A;  1VQ8 A;  4LF6 L;  1IBK L;  3HOY G;  3HKZ E;  4X64 L;  5C3E H;  4KHZ A;  4AQY Q;  4A3E H;  1SE8 A;  1RL2 A;  4DV5 Q;  1HZ9 A;  1YBY A;  4DAM A;  3KJP A;  3CW2 C;  1XJV A;  3PUY A;  3F2B A;  2NN6 G;  1XMQ Q;  2ASB A;  3HOV G;  3HOU G;  5C44 H;  3TS2 A;  4TVA B;  1VQL A;  3CXC A;  3GTG H;  1VCI A;  1VQC A;  3NBH B;  2MNA A;  1X65 A;  4GLX A;  1NJI C;  2MO1 A;  4X66 Q;  5ELN A;  1N8R C;  1N34 L;  3EIV A;  3LGJ A;  1QVC A;  3H3V I;  1X55 A;  4JI2 Q;  1C9O A;  3D31 A;  1X56 A;  3TQY A;  3W1G A;  2HIX A;  3J81 i;  4LFA L;  2F4V Q;  1K8A C;  5FJ8 G;  1FVI A;  3S16 H;  5HGQ A;  4R4O A;  3MEF A;  3H15 A;  4DV6 Q;  3PF4 A;  1HH2 P;  1WYD A;  3JC6 6;  4PG3 A;  5IYB H;  3D0F A;  3H3V H;  4LF5 L;  2UXC Q;  3HOX G;  5LMU Q;  4L5T A;  4QY7 A;  2AMC B;  2XGT A;  4DUY L;  1KAW A;  5GRO A;  5IYC G;  1VQ7 A;  2DUD A;  2L15 A;  1C7Y A;  3GTL H;  1D8L A;  3ULJ A;  1E22 A;  1A62 A;  3CMA A;  1X6O A;  1I94 L;  5JJK A;  5ELO A;  4ME3 A;  3PIP A;  4JI7 Q;  2UXB L;  4GN4 B;  2QA4 A;  4JV5 L;  2FXQ A;  4YWK A;  5M3F H;  3EBE A;  2PQA A;  2PI2 E;  1HNZ Q;  2OQ0 A;  3S24 A;  2UXC L;  4YY3 L;  2R6G A;  2OTJ A;  2DGY A;  4AH6 A;  1Q1E A;  4P71 A;  3KDF B;  4DAY B;  3STB D;  3U50 C;  5C0X J;  1OXS C;  4GNX C;  2UUB L;  4A76 A;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...