4GLVB

Obody am3l09 bound to hen egg-white lysozyme
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
total genus 23
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glvB00
1EIFA 1IZ6A 3PUVA 2LSSA 4OWTB 4DV0Q 1YBYA 4FDBA 1LM0A 2K75A 3RNUA 4LF9Q 4JYAQ 5C3EH 1K9MC 2ID0A 3RLFA 1X3EA 1Y1VG 2K5NA 1B8AA 4AYBG 3I4NH 2PMZE 3RZOH 2B63H 2VNUD 3CC7A 5ELOA 1SFOH 3AFPA 4YCVA 5IP9H 5JEAJ 2KBNA 4AQYL 1NJIC 4IPDA 3BZKA 3I4NG 1VQAA 5C0XI 2I5MX 1VQHA 2VQEQ 2B63G 1HNZL 5IYCH 1C0AA 2UUAQ 3S17H 5IP9G 1PH1A 4JC0A 3S15H 4LFCL 3A5ZB 4A3BH 3G71A 1PH8A 3STBC 1E24A 1OTCA 1N34L 4B3TL 1K0RA 5IYCG 4QIWE 2VY3A 3HFZB 2HHHQ 4HJ8A 1PA6A 3HOWH 1YEZA 4A3BG 3PUXA 1S72A 1LTLA 2YU9H 4BY1H 4DUYL 2IX0A 4A3IH 1E7ZA 3PO2H 1A0IA 1Q82C 2IHFA 3RN2A 3HOWG 2YV5A 4UP7A 2Q2TA 1Q7YC 3BJUA 3CD6A 4BY1G 1KC8C 3CCQA 1PH7A 2OTLA 2UUAL 5DLQE 4A3IG 3HOXH 3PO2G 3L7ZC 4DR2Q 3H3VH 1EOVA 2K4KA 4LWCA 4X62L 1XPOA 4YWMA 3CMEA 1L1OC 3KJPA 4NPSA 1C9OA 2OWOA 2XGTA 3Q8DA 4LF8L 4B3SQ 3HOXG 1ASZA 3BU2A 2E5LL 2BH8A 4L5SA 2CCZA 4KHPL 4JI4Q 2K5HA 2D0PA 2Q2HA 3ULPA 1AE3A 2YYZA 3TRZA 4J15A 3L2PA 3KOJA 4Y7NH 3UDGA 2NZHA 4JI6Q 4XIGS 1E22A 1YIJA 4IFDI 4GN3B 4GNXA 2AWOA 1HNWQ 3OTOQ 1XMQL 1EUJA 2LXJA 2WAQG 4LF5L 3BZCA 1VQ8A 3W5OA 4JI3Q 3GTLH 4DV7L 1Q12A 4GKKL 2IT1A 5H1SE 1UWVA 3PGZA 1TWFH 2EIFA 4JI4L 3H3VI 4RG1A 4DV1L 3PO3H 3G6EA 1AE2A 2YTXA 4DNIA 4LUVA 1T9HA 4B3MQ 1HNWL 1JJGA 1VQFA 4JBWA 5LMNL 1MJEA 1KRSA 1N33L 2NVTH 2PQAB 2QA4A 3G4SA 4R4OA 1QUQB 4OX9L 1V1QA 3ULJA 1P16A 1X54A 3CMAA 2GVBA 3F2CA 4A3JH 3I55A 3ER0A 1OXVA 3K8AA 4DR7Q 2CKZB 3H15A 4A4IA 3T1YQ 1IBKL 4DV2Q 3E0EA 3GTQH 3HKSA 4O0AA 1TXYA 1K8AC 3CCMA 1JJ2A 3S16H 4K0KQ 1EQQA 4LFAQ 1WFQA 3CF5A 4B3ML 1XNQL 1CKMA 2ZJQA 3GO5A 1VQNA 3TQYA 4B3RQ 4JI2Q 5HY6A 3UDFA 3PUYA 4HJ7A 4IPHA 1KAWA 3CPFA 1L1OB 3K81C 5C44H 1MIUA 5LMNW 2E2JH 1VQOA 2UUCQ 2A8VA 3T1HL 3S1QH 1VQBA 4GLVB 4POFA 3M4QA 3EBEA 3SGIA 2NVXH 4P74A 3M4OH 4QGUA 1TWCH 1M1KC 1KL9A 5C44G 3I56A 4JBJA 3F2BA 1HR0Q 2UXCQ 4QL5A 3DM3A 4DK3C 1Q86C 2CWPA 4JI2L 2ZM6Q 4DR4Q 1Z9FA 3HOVG 2JK8A 2WB1E 4RMFA 3I4MH 2MFIA 4OWXB 4A3KH 1OXTA 4POGA 1HZCA 4YHHL 1XPRA 1KD1C 1C7YA 4IPCA 4HIMA 1G291 2RF4A 3CCVA 3I4MG 2MNAA 4A3KG 1VQLA 3E9IA 1HR0L 4JI8Q 2E2IH 1J5EQ 3F1ZA 4HIKA 3ZJYC 1E1OA 1JMCA 2JQOA 3S1NH 4UP9A 3UDIA 2KCMA 1QVGA 4JBMA 1Q8KA 4UP8A 5GAHC 4LF6L 4DV3Q 1GVPA 2MO0A 1PH5A 1N32L 4Y52H 1Q1EA 2MO1A 3W1BA 1PH3A 1PH9A 4DR1L 3EIVA 1XTDA 4DR3Q 4APVA 2CWAA 1VQ9A 3WWVA 4NXNQ 5C3EG 3K0XA 1FJGQ 1X55A 3M9BA 4H02A 1XMOL 5M5WH 2K14A 3J7ZC 1TWAH 3GTOH 4TVAB 3HOYH 5J3BA 4LW1A 2QEXA 3NELA 3A0JA 2Q2UA 2IY5B 4DV0L 4LF9L 4JYAL 5JJKA 3I7FA 1ASYA 1IBMQ 5GAEC 1HJPA 1VQKA 3L0OA 4DR3L 3HOYG 4LUZA 1G6PA 2JEBI 2PI2A 3K7AH 3S1RH 2UXBQ 3GTMH 1Q1BA 1YJ9A 1FJGL 2I5HA 4MZ9A 3KDFA 4P72A 2A1AA 2F4VQ 1WOCA 1YHBA 2VQEL 4IFDG 1W3SA 4R1JA 3NEMA 1HZ9A 2ATWA 1K3RA 2D0OA 1A62A 5EAYA 3F2DA 3RLNA 3PUZA 1X65A 2QGQA 1I3QH 1LYLA 3D0FA 4A75A 4C3HH 1GO3E 1VQ6A 3U58A 2UXDQ 2YTVA 3KF8B 3KF6B 2HHHL 1GKHA 2JA5H 4QY7A 2VQFQ 1E3PA 2ES2A 1Z47A 2GN5A 5M5XH 5LMUQ 1EFWA 1CSQA 1VQIA 4GOPA 3A74A 1IXRA 2N3SA 1BVSA 3A5UA 2F4VL 2JA5G 3J81i 3ERSX 1CKNB 3U50C 1NBWA 1I5FA 4DKAC 2JE6I 1X6OA 3FKIH 1RIPA 4DR2L 3RN5A 2UXDL 1GD7A 4DR6Q 2LXKA 2WB1G 4WJ4A 4YCUA 2AHOB 1SROA 1EQRA 3FKIG 4O2DA 1B7YB 4B3SL 3J7A5 1TWHH 4DV6Q 4PZ6A 2EXDA 2EQSA 1YJWA 1KRTA 3OYYA 4DV5Q 3H0GH 4IO9A 1QZHA 2C35B 2N8NA 4JI6L 4C3JH 4NXMQ 4JI7Q 5HGQA 1VQPA 1OXSC 4PZ8A 4IPGA 1M90C 2GVAA 1IYJB 2B3GA 1V9PA 3H0GG 3PUWA 3OTOL 2E2HH 1B70B 4DR5Q 3PO3G 2VUMH 1FVIA 4JI3L 1VCIA 4HJAA 2PNHA 1WCMH 4P75A 1R9TH 4GKJQ 4X65Q 1QZGA 2R6GA 4LFBQ 4P71A 1YI2A 3S2DH 4DV5L 2VUMG 3CC4A 4JI5Q 1TWGH 1UE7A 2L15A 3MXNB 5ELNA 1E1TA 4EX5A 4GNXC 3MEFA 1PH6A 3HOZH 3S24A 1L2FA 1MJCA 1EIYB 4YCWA 4WJ3M 3PF4A 4A3JG 3J81j 4DUZQ 1HZAA 1PH4A 2XTIA 3HOZG 1N36Q 3ICEA 4DR5L 1X3FA 2Z6KA 2AWNA 1KHIA 4A3DH 5JJLA 3PIOA 5AJ3Q 5C0XJ 2R7ZH 4EQ5A 4HJ9A 4LFBL 2ZTDA 4A3DG 2Y0SE 2OCEA 1WI5A 4JOIA 3TEHB 1H95A 3GD7A 4YWKA 3U4VA 4LF4Q 2CFMA 4JV5Q 4DR7L 5GROA 4YY3Q 1SN8A 3S2HH 3T1YL 3CC2A 2VL6A 4DV2L 5IYDH 1A63A 3U4ZA 4A76A 2R93H 4BA2I 3K7UC 4K0KL 1EWIA 4LFAL 1JB7A 4MNOA 1UE6A 2KHJA 3KF6A 5IYDG 4B3RL 5AJ3L 3VDYA 3AQQA 4MTNA 3TREA 4OWWB 2B29A 2MQHA 3AEVA 2ASBA 4IJLA 4OO1G 3LGJA 4GN4B 4BBSH 1IBLQ 2PI2E 1YITA 2UUCL 2HT1A 4JV5L 1NMGA 4R4CA 2NN6I 4C2MH 4YY3L 2R92H 2DUDA 1PH2A 4BBSG 5C4JH 1YJNA 3TS2A 3CCJA 3I4OA 4A3FH 2UXCL 2R92G 4LNQA 1VQEA 1WYDA 2UUBQ 3RZDH 2ZM6L 3IRBA 4DR4L 4GLAC 4GN5A 3CCUA 2R7DA 3J80i 1YNXA 1L0WA 4A3FG 4IFDJ 3AYHB 2N49A 5E7NA 1I94Q 4IOAA 4OO1I 5JJIA 1JT8A 2AMCB 1UEBA 4NB3A 4LF7Q 5GAGC 3STBD 4ALPA 1D8LA 2ALYB 4R4TA 1PVOA 3J80c 3CP0A 4JG2A 1VQGA 4OXPA 3F8TA 2JA6H 1Y1WH 4JI8L 1MKHA 1KIXA 2PQAA 4GNXB 1J5EL 5FLMH 2FXQA 1SLJA 3HKZE 3KJOA 2ZJRA 2UUBL 1NE3A 1QUQA 5BR8Q 2JA8H 4A3LH 4HJ5A 2JA6G 1Y1WG 1HR0W 4DV3L 1PFSA 1VS0A 5GQOA 5IY0A 5FLMG 2E8GA 3NENA 1U5KA 2KCTA 3FP9A 1N8RC 2JA8G 4A3LG 1HNZQ 1XPUA 3FHWA 2VS1A 1HH2P 2I0QA 4LFCQ 1KQSA 4IOCA 2K50A 4PMWA 1N34Q 2IX1A 1VQ4A 4NXNL 4B3TQ 2YTYA 1W2BA 4QQBX 5FJ8H 5BR8L 5IP7H 4LUOA 2OQKA 4DUYQ 1L1OA 1SMXA 1YVCA 3PSIA 3CPWA 3KYHC 1XNRQ 5FJ8G 1NTGA 1QVFA 5IP7G 4KHPQ 1SE8A 4DPGA 1VQ7A 4L5TA 1IBML 1BKBA 1K83H 4P73A 3CCLA 3PF5A 2Y0SG 2UXBL 2ZTCA 3ULLA 4X62Q 3RR5A 4LF8Q 3DLLA 2E5LQ 4BXXH 2BH2A 5C4XH 1J6QA 1A8VA 2Z0SA 3G48A 3UE0A 1CUKA 5IE8A 1GM5A 4DAMA 1XNRL 2BA0A 3GTPH 3OW2A 4HIOA 2D62A 4DV4Q 3GTGH 1V43A 1SRUA 3CAMA 4BXXG 3J81c 5M3MH 2VW9A 5C4XG 1Q46A 2KENA 4OONA 2HIXA 4AH6A 3TS0A 3GTJH 1UE5A 2RHSB 2VQFL 1BBWA 5LMUL 5M3FH 2F3IA 1XMQQ 3JC66 4LF5Q 5M3MG 2RCNA 4HIDA 5JEAG 1I6HH 4DV7Q 1S40A 3RLOA 1EYGA 4UPAA 4GKKQ 1CSPA 1X3GA 5M3FG 3S14H 4X64Q 1I50H 4DV4L 4JI0Q 2KHIA 4DV1Q 3M7NA 2F52A 2AKWB 4GLXA 4GOPC 4DR6L 1PYBA 3KFUA 4DAYB 5FLXc 4A93H 5LMNQ 4DV6L 3S1MH 4PG3A 2V1CC 1N33Q 5IYBH 3CCRA 4JBKA 4L5RC 1AH9A 4OX9Q 2NVYH 5M5YH 1WCMG 4AYBE 1PYSB 4A93G 4NXML 4X64L 4A3EH 2JA9A 5IYBG 4JI7L 3HKZG 4JI0L 3GTKH 3HOUH 1Q81C 3W1GA 2JEAI 1Y14B 1IBKQ 1P8LA 3AFQA 4AIMA 1JJCB 2DGYA 4BBRH 4A3EG 3HOUG 1U0LA 2JJQA 4X65L 1HNXQ 2CQOA 1XNQQ 1NY4A 2WP8J 4GKJL 2A19A 1UE1A 1PHJA 2UU9Q 2NN6G 4KLKA 1G51A 4KHZA 4A3MH 2K52A 1VQCA 4QJFA 4JI5L 4GS3A 2NZOA 1RL2A 4L5QA 1QVCA 4BBRG 3K80C 2R7ZG 3JAMi 4A3MG 4DK6C 4X66Q 4JCVE 3M85A 3T1HQ 1VQMA 1PV4A 4DUZL 2Q2IA 4KI0A 1NMFA 1N36L 2RHQB 3KLWA 3NBHB 1VQDA 3CW2C 3CQZH 2H5XA 4R4QA 1HNXL 2R93G 1O7IA 3E9HA 2JA7H 3JAMc 4BY7H 2UU9L 2HIVA 1YHQA 2WFWA 3UE1A 4R4IA 1CKNA 3CCSA 3M4PA 3KDFB 4LF4L 4BA1I 2IHEA 5IT9c 2BA1A 3B6YA 1CKOA 1OXXK 4TQUS 1K8GA 5IWAQ 1KXLA 1X9NA 2JA7G 1SR3A 2Z6KC 3GDEA 3PV0A 1XJVA 4BY7G 1HZBA 4IJHA 1LUZA 3UDXA 4X66L 3D31A 4YHHQ 3CCEA 1X56A 1DGSA 1OXUA 4XTCS 3HOVH 4JOIC 2R7FA 1WJJA 4C3IH 4A3GH 2ZJPA 2ZTEA 3CXCA 3PCOB 5GADC 2OQ0A 1IBLL 4A3CH 4GOPB 3EN2A 3M3YH 1YHAA 1FL0A 2WAQE 1IL2A 4A3GG 1VQ5A 2I5LX 5IWAL 4JI1Q 4LF6Q 1VQJA 2K5VA 1N32Q 4A3CG 4UY8C 5K36G 4PZ7A 1BBUA 2VZAA 1D7QA 1JE5A 3PIPA 1YZ6A 2OTJA 4DR1Q 3I2ZA 4YWLA 1K73C 1FGUA 2HQLA 4ME3A 2N78A 5C0XG 4AQYQ 1XMOQ 1I94L 4X6AH 1N9WA 1S3OA 2NVQH 4LF7L 4JI1L 1Y1VH
chains in the Genus database with same CATH superfamily
3NQIA 1SNOA 1YBYA 3DEOA 2K75A 3ITPA 1ONLA 1K9MC 1S5FD 2K5NA 1Y1VG 3I4NH 3S2HB 5J39A 1B53A 3OPOA 2B63H 2VNUD 2R93B 5IP9H 5JEAJ 5EKKA 4IPDA 5C0XI 1CA6A 3I70A 2I5MX 5IYCH 3IAYA 3A55A 3S17H 1PH1A 4A3BH 4LFCL 3A5ZB 1PH8A 4C2MB 3TZDA 5EJWA 1J9OA 1SE4A 4HJ8A 4DFAA 3PUXA 5C4JB 4DUYL 5ELDA 2F0DA 1PDQA 3HOWG 4RGNA 5E4WC 5C5MA 3C2PA 2UUAL 5CMDA 5DLQE 3HOXH 1A2TA 2K4KA 2PO4A 2XWJB 4LWCA 4ME5A 4YWMA 1L1OC 3KJPA 2OWOA 3HP3A 3BS1A 2G9HD 4X3KA 3VYTA 4K2KA 2D0PA 1AE3A 1K28A 2B2YA 2NZHA 1YIJA 4IFDI 2AWOA 4IUQA 1XMQL 1EUJA 2LXJA 4I65A 3VR6A 3BZCA 4JI3Q 1KDCA 1E0BA 2HDMA 1HQMC 1TWFH 4JI4L 4B9WA 3H3VI 4DV1L 2IJ0A 1SFOB 1WTVA 4U673 4DF7A 4B3MQ 1JJGA 1VQFA 4JBWA 3NE5B 1SJHD 2PQAB 2QA4A 1SEBD 1D1KA 3G4SA 4OX9L 5EQ0A 1P16A 1SNDA 2GVBA 3F2CA 1HTPA 1STAA 3ND8A 4NMZA 1B3AA 3H15A 3GTQH 1RODA 3CCMA 1WD1A 4K0KQ 1WFQA 1XNQL 3P1HA 1RDPD 1Z6HA 1STYA 3GTJB 4HJ7A 2A8VA 2E76C 2NVXH 3M4QA 1QB5D 3M4OH 4P74A 1F9RA 4PQXA 1M1KC 5C44G 3I56A 3DWQA 4JBJA 2WIIB 2ZM6Q 1HTLD 2NB0A 4U68A 2JK8A 4RMFA 5CBAE 1LT6D 4KKSA 2LMCB 2E74C 3HG9A 4B08A 4HIMA 4IZ8A 2RF4A 2EJGC 2XIWA 3EFXD 5TSSA 1VQLA 4RHRA 1LT4D 1EFID 2L1BA 3F1ZA 4HIKA 1JMCA 1E1OA 4L6TB 2B2VA 4UP9A 1BCPB 1Q8KA 2A5HA 3K5NA 2F0NA 2CVRA 1TT2A 1PH5A 2HCCA 2NVTB 3A54A 1JE4A 1XTDA 4F7XA 4DR3Q 3BVZA 1BUVT 4NXNQ 3K0XA 4Q0FA 1X55A 1ILQA 3M9BA 4OL7A 3J7ZC 3F2UA 1TWAH 5ELCA 1LTID 4BY7B 2Q2UA 1AN8A 4DV0L 1SMYD 1IYVA 1HFNA 4FO2A 5HGTA 3NK9A 1BXTA 5GAEC 1H9SA 1VQKA 3HOYG 2PPBC 3S1RH 1M8AA 5EBDA 1DYQA 3KDFA 3C3LA 2A1AA 1TWCB 1YHBA 4IFDG 2ATWA 3K0YA 4H0LC 3RLNA 1EY5A 1LYLA 4C3HH 5ELBA 3BDOA 5G3LF 3H3VC 1AEXA 3FDTA 1EWCA 3KF8B 1LACA 3KF6B 1BCPF 1JOOA 1E3PA 1TS2A 5M5XH 3IFDA 3A74A 1YNND 2KCCA 1G91A 5KNDA 3U50C 3WOEA 1I5FA 2E2IB 2DNCA 3QOLA 4KHVA 3T4AC 1U4LA 3RN5A 2AQ2B 1GD7A 2LXKA 4AYBB 4YCUA 2AHOB 4B3SL 1EQRA 4DV6Q 3KK7A 4ZYSA 5C3EB 4CHTB 4KTAA 1HCZA 1PLFA 2EQSA 5IGCA 4DV5Q 4IO9A 3A7AB 4ZK9B 4QCLA 1CZWA 3RZOB 4JI6L 2IL8A 4NXMQ 3I72A 5HGQA 1WD0A 4PZ8A 3HEJA 1Q90A 1V9PA 3MWYW 3PUWA 1BR9A 4C1NK 1B70B 4XDXA 2VUMH 1VCIA 1WCMH 1QZGA 2A6HC 2F0LA 3GQBA 4BS9A 4CBVA 4CDDC 4GNXC 1E1TA 3IKJA 3S24A 1L2FA 1MJCA 1KAAA 2EY2A 2FMCA 5KGUA 3PO2B 1EIGA 2QKIC 3R3OA 1D1IA 1NR4A 2XTIA 2Z6KA 2AWNA 2JN4A 1DD2A 2LY7A 2XSCA 5IGFA 5C0XJ 4HJ9A 1QJOA 1WI5A 3QB3A 2EZVA 2DN8A 3S2HH 3CC2A 1PFBA 1A63A 4A76A 2R93H 3K7UC 3MXUA 4LFAL 2KVMA 1JB7A 3KUPA 3KF6A 4CKCA 5IYDG 3SE0A 3AQQA 2MQHA 2ASBA 4OO1G 3WDNA 2PI2E 2UUCL 2HT1A 3X3NA 4JV5L 1NMGA 4C2MH 1IKMA 1I4GA 4YIJA 5C4JH 1L0YB 3I4OA 1BF4A 2R92G 2EOTA 3J80L 4GN5A 4V0BA 1TVXA 4IFDJ 3AYHB 5E7NA 3W3AA 5JJIA 2AMCB 1FYCA 4LF7Q 1C4QA 5GAGC 3STBD 4QUFA 5CORA 1PVOA 1YNJD 3J80c 4OXPA 2JA6H 2ZXOA 1ICFB 1MGSA 4WJWA 1D5ZC 1HR0W 2A73B 5FLMG 5E4XA 2KECA 3K5LA 2PYKA 2JA8G 1E2WA 2VS1A 3VR2A 2I0QA 4LFCQ 1SAPA 2K01A 3VYUA 1W6JA 4EGVA 1KQSA 2LFNA 4L63B 3E5SA 1VQ4A 2Z1CA 2YTYA 3S1QB 4BWGB 5BR8L 5IP7H 4DUYQ 3DUZA 3PSIA 1EY8A 1LV9A 3OIPA 4IUNA 1G2SA 1NTGA 5ISRA 1VQ7A 4L5TA 2K03A 4G7OC 3I4MB 2UXBL 3ULLA 4A3KB 2L5TA 3QIAA 5EPJA 1HFGA 2VB3X 4K8JA 4K5WA 3DLLA 4BXXH 1XXGA 1A8VA 1TKWB 3G48A 1CUKA 5IE8A 1EOTA 4DAMA 3GTPH 4PMCA 4DV4Q 2P5ZX 1SRUA 1FNUA 1SMYC 5C4XG 2KENA 2PZUA 3GTJH 5CGKA 5LMUL 1XMQQ 3JC66 2QCPX 3EQLC 3E0JA 4FXKC 4HIDA 1SYBA 1S40A 1EYGA 2I46A 2EYLA 1J8IA 4DV1Q 1G2TA 2NTSA 1SYCA 2F52A 4KKTA 2NTTA 4GOPC 2DJFC 1EL0A 2OEOA 5IYBH 4JBKA 4RGOS 4OX9Q 1YNNC 5T1GA 4X64L 4A3EH 4JI7L 4JI0L 3ZYYX 3NP8A 1Q81C 3W1GA 2JEAI 2NN6H 1PXUA 1F9QA 4ZCKA 4PMBA 1JJCB 4AIMA 4HSVA 4TSSA 3HOUG 1QWYA 4OGQC 1D2BA 4GKJL 4X65L 1I3QB 4MTKA 1HNXQ 1XNQQ 1G51A 4A3MH 1GUNA 1VQCA 1K83B 4JI5L 2NZOA 2R7ZG 1GJXA 4IQZA 3JAMi 4X3SA 3M85A 3SDZA 2Q2IA 1N36L 2RHQB 5BN5A 2WB1B 2PZWA 4TKOB 5C5LA 4C56C 4PNYA 4HSPA 4CDEC 3E9HA 4BY7H 4Q5VA 2HIVA 1CKNA 1EU4A 3C46A 4LF4L 4DN4M 1JWSD 4LAAA 1CKOA 1K8GA 1JORA 4KD3A 5IWAQ 1KXLA 1ENCA 5CBEE 1TWHB 2J4XA 3N6RA 1AFPA 1KTKA 1X56A 2QF7A 4PV1C 3E3XA 3A8IE 4JOIC 4C3JB 4A3GH 1WJJA 1AP0A 4NDXA 2KHSA 2OQ0A 3EN2A 1NSNS 2O5JC 4C3IG 4A93B 3T56B 4PZ7A 4MN3A 2NVYB 2B2UC 3D4WA 2O2LD 2F0SA 2SNMA 2RCFA 1U4RA 4ME3A 5IIFA 3GP7A 4AQYQ 3MFYA 3FPPA 4EX5A 3PUVA 4OWTB 4DV0Q 1QNKA 5C3EH 3CHBD 3RLFA 1X3EA 2TMPA 1B8AA 3H09A 2PMZE 2VB2X 3RZOH 3LWUA 3I8ZA 1LT5D 1OO9B 1F2ZA 4MIUA 3I4NG 1VQAA 2J0TD 4R9WA 3CQZB 2B63G 2FMMA 1ZXTA 5IP9G 1EY9A 3H94A 3G71A 3STBC 3K57A 2K5DA 1OTCA 3MHBA 3QJYA 1N34L 5DM63 1YNJC 2XVSA 5IYCG 1T5EA 2VY3A 1UEAB 4A3BG 3NQTA 3SHLA 4BY1H 2KEEA 4A3IH 3PO2H 3G6JB 3H91A 1PH7A 2OTLA 1RTNA 2EYJA 3VR4A 5EPLA 3OHXC 2XGTA 3Q8DA 4LF8L 4B3SQ 3HOXG 2E5LL 3URYA 2IX3A 1AZPA 2CCZA 4HTHA 1KDAA 2K5HA 1EYCA 1Y8NB 3MEHA 3TRZA 4J15A 4Y7NH 4JI6Q 4FF1A 4XIGS 2NWGA 3NTHA 4DU9A 1UUPA 2B2TA 4DA2A 2WAQG 1Y1VB 1VQ8A 2RQXA 2B8GA 4IN3A 1UWVA 3PGZA 3ERQA 2D5DA 4V190 5ELEA 1PTOF 3EVQA 1CK1A 3G6EA 4DNIA 4E6IA 1T9HA 1HNWL 1MJEA 4KY5A 1KRSA 1N33L 2I07B 4R4OA 1SYFA 1WTWA 1QUQB 1V1QA 2EJMA 4DXGA 1X54A 3R8BA 3CMAA 1WTXA 2Z4HA 2FJ2A 4XQJA 4GZYC 1II3A 4N9PA 3HOWB 1GUGA 5JAVA 2YU9B 1IBKL 3E0EA 1QG7A 4O0AA 1TXYA 3S16H 1EQQA 4LFAQ 3CF5A 2GA4B 2HQEA 5I6YA 4DAPA 1VQNA 3NSWA 4JI2Q 1LTBD 3PUYA 5FO7B 1KAWA 1L1OB 2UUCQ 4M1UB 1VQOA 2F0QA 3T1HL 3S1QH 4GLVB 1DONA 2CHBD 3EBEA 2K5QA 1A3VA 4QGUA 2F0OA 1BNZA 1HR0Q 3F2BA 1EQTA 4ZUIA 2CWPA 1Z9FA 3HOVG 1I4HA 3I4MH 3DM1A 4OWXB 2AUJD 1EEID 4A3KH 1OXTA 3GTLB 2PW5A 4JW0A 3H6MA 4QMGA 3MAQA 1XPRA 4IPCA 4DAYA 5KNCA 2L0CA 3E9IA 2JQOA 3UDIA 1QVGA 2KCMA 5GAHC 1GVPA 3QO2A 1Y69U 1Q1EA 2ZXRA 3W1BA 2XWBB 2PMZB 5EKIA 4DR1L 3EIVA 2L55A 4HN7A 3BVGA 4APVA 1Y8PB 3WWVA 4IUPA 5I2YA 5DM73 5J1ZA 1EEFD 4H02A 1XX8A 3GTOH 2JA7B 2QEXA 2CQAA 2IY5B 4JYAL 3I7FA 3NBHA 4LUZA 4WORA 5E1FA 2JEBI 4XT1B 2UXBQ 3GTMH 3NUCA 3NTIA 1YJ9A 2QW7A 1FJGL 1SDFA 4ZKBB 2FHTA 2VQEL 3D8GA 1CQVA 2C5CA 3NEMA 4OIJA 3F2DA 1DXMA 1PRTC 3PUZA 1I3QH 4A75A 1ESRA 1QE6A 1VQ6A 3U58A 2JA5H 1GKHA 5JVH3 1MBYA 4QY7A 2A6HD 1SNPA 4C3HG 5LMUQ 1EFWA 3J81L 2PW7A 2N3SA 1BVSA 3A5UA 2F4VL 4R8IA 3SK6A 1WTOA 5F2DA 4O1NA 1X6OA 3FKIH 3S1NB 4DR2L 2UXDL 2F0JA 4I7ZC 3C1EA 4O2DA 4ID6A 1B7YB 1QILA 1TWHH 3V05A 4PZ6A 1EU3A 1YJWA 2F3WA 1KRTA 3OYYA 1PYWD 2RDGA 5KRUA 5FLXL 3NPPA 2RSOA 4ABNA 4C3JH 4JI7Q 1M90C 2GVAA 3OTOL 1EZ8A 4DR5Q 3PO3G 4CJ2C 1FVIA 1ML0D 4CDFC 1E2VA 4P75A 1IKLA 4GKJQ 4X65Q 2B2YC 1RTOA 4P71A 1YI2A 2VUMG 3CC4A 4JI5Q 2L15A 3T13A 3K5OA 4YCWA 3I4LA 4A3JG 1JWMD 3L9AX 1HZAA 1PH4A 4A3DH 3ICEA 1N36Q 5JJLA 1RJTA 1CHPD 1VF5C 2RBMA 4LFBL 2ZTDA 2PQEA 3TEHB 2F0KA 3GD7A 1QOHA 3U4VA 4LF4Q 2CFMA 4DR7L 5GROA 4YY3Q 1SN8A 1GUSA 4UAIA 4DV2L 2F03A 3U4ZA 4BA2I 1CM9A 2XRSD 1EWIA 4MNOA 2Z6BA 3BDLA 4B3RL 5AJ3L 3TREA 3AEVA 4IJLA 5JPMC 4BBSH 1O78A 1YITA 1PTOH 5I2XA 2NN6I 5JVG3 1PH2A 4FVMA 4QB4A 2VXWA 1YJNA 2F1MA 2K05A 3TS2A 4A3FH 2UXCL 1FNWA 2F0WA 1WYDA 4H13C 2CH4W 3IRBA 4DR4L 3J80i 1L0WA 3OOCA 1SNQA 4OO1I 1JT8A 2G9DA 1UEBA 4KY7A 4N9TA 5CYUA 2ALYB 2KCNA 4RFBA 2AQ1B 1Y1WH 4JI8L 1KIXA 1MSGA 2PQAA 1TWGB 4GNXB 2N55A 2FXQA 2UUBL 4WRDA 3SK8A 5D14A 4ZLTF 2JA6G 4DV3L 1VS0A 2B8FA 1N8RC 3NENA 4G7HC 1NAPA 5I9PA 2B2VC 4IOCA 2K50A 2RDHA 1N34Q 3TDQA 2Z8LA 1SE3A 2ZXPA 1W2BA 4QQBX 5FJ8H 1EY4A 4LUOA 4M8AA 3UI2A 1PFMA 3KYHC 4KK7A 5IP7G 1CA5A 1BKBA 3E6ZX 3KBXA 4P73A 3CCLA 3AU7A 3PF5A 3BYTB 1PZJD 2R92B 1TS3A 1TS4A 4LF8Q 2E5LQ 1J6QA 1KABA 1EY7A 1XNRL 3OW2A 2D62A 2NZ1D 4BXXG 5C3XA 4XYOA 1Q46A 3TS0A 1UE5A 4IUVA 4UPAA 2OT2A 5A2QL 4XYQA 1I50H 2KHIA 1GHJA 2FFKB 4C1NI 3KFUA 2PNRC 1H9MA 3S1MH 1N33Q 3CCRA 3GV6A 4HEDA 3K7AB 1JC7A 1BBXC 3FRPB 4RAUC 4CJ0B 5IYBG 2PCFB 1BO0A 1H9RA 1IBKQ 3G7LA 1BCPC 1STEA 3AFQA 3A56A 4BBRH 1HQRD 4A3EG 2JJQA 4JK1C 3D3RA 2A19A 2NN6G 4KLKA 4KHZA 3BG3A 2K52A 4GS3A 5NUCA 1RL2A 4L5QA 3QOJA 2WV6D 2X6GA 4A3MG 4X66Q 3J81E 3T1HQ 1PV4A 1BOSA 3KF8A 1DM0B 1NMFA 4CGYB 1VQDA 3VR3A 4HMJA 4LK1C 2JA7H 2UU9L 1YHQA 3UE1A 2DJGC 4L8JA 4HAEA 3TBIB 2F3VA 2IHEA 4J1MA 1NNXA 3B6YA 5C3WA 1HA5A 2Z6KC 4BY7G 3CCEA 1I6HB 3H0GB 1LTAD 5FLXE 2R7FA 2L12A 3CXCA 3PCOB 2K04A 4A3CH 1RKNA 4GOPB 2WAQE 4A3GG 1ENAA 4JI1Q 3IFTA 1BBUA 5C0XH 5IGEA 1D7QA 1YZ6A 3HOZB 4DR1Q 1D6EC 3OSOA 1SE2A 1FGUA 2EE1A 4IUUA 1I94L 3TP5A 1S3OA 1F2MA 2R7ZB 3RNUA 4JYAQ 4FDBA 1LM0A 1WVLA 1A2UA 5JJZA 2ID0A 1STGA 2H1EA 3T16A 4AYBG 1FGBD 1SFOH 1SJED 3AFPA 4KD4A 4YCVA 2KBNA 2B2WA 2AUKA 2VQEQ 1VQHA 2UUAQ 1GHKA 3FMCA 2OF1A 1M4VA 1K0RA 4QIWE 1PA6A 4IFDH 1IHZA 1S4ZA 4OHJA 1BDOA 2IHFA 2FINB 1MI2A 4UP7A 3RZDB 1Q7YC 2Q2TA 3BJUA 1V1PB 4BY1G 2ENBA 2JP1A 1DOLA 4A3IG 1SNMA 3PO2G 3L7ZC 4DR2Q 3H3VH 1EOVA 4FXGC 4X62L 5C4ZA 1XPOA 3CMEA 1U4MA 5CR3A 4NPSA 1C9OA 1Q3LA 1ASZA 3BU2A 2RSNA 4KHPL 2IPKD 4JI4Q 2EY5A 2A68D 2YYZA 1Z7TA 4H44C 1I4PA 2M2LA 4K5XA 1KLUD 4ZQ3A 3OTOQ 2Q8RE 2NVQB 3NHHA 4LF5L 3TZUA 4DV7L 1Q12A 4GKKL 3OMGA 5H1SE 2EIFA 3QG1A 4OIKA 4FF2A 3I4NB 4RG1A 1TS5A 1F2LA 1AE2A 2YTXA 2K6AA 4LUVA 4QF4A 2F0UA 2NVTH 2RDFA 1DOKA 3VYRA 3ULJA 3FVQA 1PTOD 3TN2A 3I55A 3C1FA 1OXVA 3K8AA 3KLSX 4DR7Q 1B2TA 4A4IA 5FO8B 1S5BD 4DV2Q 1DOMA 1K8AC 2D9UA 4B3ML 5CV6A 1CKMA 3GO5A 5JOBA 3TQYA 4B3RQ 5HY6A 1T5XD 2EYHA 2PZTA 5M3MB 3UDFA 2MHVA 1IW7D 4IPHA 3K81C 2F0PA 5M3FB 3P75A 3DXJC 2L4NA 4IUTA 4POFA 3SGIA 1TWCH 4UDUC 1KL9A 5A2QE 4K8IA 3J7AV 2UXCQ 1NR2A 2K33A 5KYIA 3DM3A 4DK3C 4DR4Q 1E2ZA 2MFIA 4POGA 2O5IC 2DNEA 4YHHL 1LTGD 2L11A 5M5YB 2HD3A 3CCVA 3I4MG 1EQVA 1TWFB 2MNAA 4A3KG 3GTKB 4JI8Q 2E2IH 4FP5D 2Q8TA 1JWUD 4KV6A 3RUZA 1PRTD 4DV3Q 2MO0A 2BOSA 2F0IA 3W2DA 4DNRB 4FYDA 1PH3A 1PH9A 2KEDA 2CWAA 1WTRA 1I4QA 2V4DA 1MSHA 3U9OA 2K14A 4RA8A 5J3BA 3A0JA 4LF9L 5JJKA 1S5CD 2F4IA 1ASYA 1HJPA 3I90A 3L0OA 4DR3L 2PI2A 3K7AH 1Q1BA 2CW0D 2EPBA 2I5HA 4MZ9A 5DEHA 3HOVB 1W3SA 5EAYA 3BZDB 2QGQA 3M3YB 1STBA 5EKLA 1IL8A 3PIO3 2HHHL 2MGSA 4ILWA 1KDBA 5JPNC 2ES2A 1Z47A 2F0GA 1VQIA 1IXRA 3MA2B 3OMCA 2JA5G 3J81i 3P20A 2LKVA 3TP8A 2JE6I 5D65A 1RIPA 1EYAA 2WB1G 4WJ4A 1H9KA 1G6ZA 1SROA 3FKIG 3DMUA 4DK0A 3H0GH 4HCSA 2N8NA 3Q22A 1JOQA 3R2TA 1VQPA 1OXSC 2EXZA 4IPGA 1IYJB 1CT1D 1F9PA 1O80A 1EYDA 4C3JG 1PZKD 2A6ED 4HJAA 2PNHA 4N8X1 3S15B 2R6GA 2F0HA 4HR7B 4RGTA 1RCVD 1HUNA 4DV5L 4I7AA 1UE7A 3MXNB 3HOZH 4MHEA 2B2TC 2A68C 3MEFA 1HA6A 3PF4A 2F0EA 4P2CB 3J81j 1FR3A 1TY0A 1KHIA 1ZKOA 3PIOA 2H4OA 2R7ZH 1A3TA 4A3DG 2WKCA 2OCEA 4YWKA 4CKBA 4JV5Q 3HZXA 3T1YL 3I73A 4XQNA 5IT9L 3IL8A 1KLGD 2KHJA 2K7VA 3VDYA 4MTNA 3OWFA 2B29A 3GV3A 2EYMA 2JXMB 3MFGA 1PTOC 5J22A 2DUDA 1O7ZA 4BBSG 2NUCA 1SYEA 4F8MA 4ZRZA 3SXHA 4LNQA 3PO3B 4J6HA 4X3UA 3RZDH 2F0VA 2AQ3B 5IOCA 3CCUA 2R7DA 1B9NA 1VMPA 1YNXA 5D3IB 4A3FG 4EQPA 1I94Q 4IOAA 2VUMB 1IW7C 1FNVA 3X3MA 1D8LA 4A3JB 3CD6A 1VQGA 1MKHA 2O4XA 3M7GA 1J5EL 3KJOA 2RVLA 1NE3A 1QUQA 5BR8Q 1MHWC 4A3LH 1Y1WG 1PFSA 2QILA 5GQOA 2KCTA 1VF7A 3FP9A 1ENFA 1ET9A 1EY6A 1XPUA 1LO5D 3FHWA 3HS0C 5BN4A 2KJXA 4DNTB 5C44B 2E2JB 3AB9A 1K0SA 1K8OA 2MUYA 2OQKA 2LS01 1L1OA 1SMXA 1F77A 2F0TA 3D6CA 1S5DD 4LMQD 5FJ8G 1DJRD 2BDNA 1QVFA 1IYUA 3NWTA 1SE8A 4DPGA 1IBML 4HCEA 1K83H 2Y0SG 4RKBA 4X62Q 3Q24A 1O7YA 3RR5A 1TR5A 2BH2A 1LTRD 1R4PB 4RGMA 1GM5A 3UE0A 4KHPQ 5G3LD 2EYOA 4G7ZC 1UAPA 5FK9C 1NUCA 1V43A 1B1ZA 1BCPD 1AW7A 1UNSA 3J81c 5M3MH 3BVMA 5JEAH 1CZGA 4AH6A 2N88A 3ONAB 4OEMB 2VQFL 2K28A 1BBWA 5M3FH 2F3IA 4LF5Q 1L0XB 2CW0C 4DV7Q 3RLOA 5FO9B 2JA6B 4GKKQ 1CSPA 4FF4A 4X64Q 1V8QA 4DV4L 4JI0Q 3EA6A 2HDLA 5M5WB 3NWSA 4DR6L 3HOYB 5KIXA 3J7AF 5FLXc 4A93H 1EWHA 1DZ1A 4PG3A 1W6KA 2V1CC 4ZAIA 4HMIA 4L5RC 1AH9A 2NVYH 1GOZA 5M5YH 1WCMG 4AYBE 1AZQA 2HCIA 2JA9A 3GTKH 3HKZG 1S5ED 5FKAC 4O42A 2DGYA 3T53B 2CQOA 1NY4A 2WP8J 3CRLC 4QJFA 5CV7A 4BBRG 1ET6A 2EY6A 4DUZL 4KI0A 3KLWA 3TMEA 3CW2C 1H9SB 3CQZH 5CV8A 4Z9CB 3GTPB 2H5XA 4R4QA 1HNXL 2R93G 1O7IA 2A6EC 4X3TA 4XXEA 3P7JA 4R4IA 1B9MA 3M4PA 3KDFB 4BA1I 1PMRA 4TQUS 1OXXK 1SYGA 2KA7A 2JA7G 1SR3A 3GDEA 3PV0A 1HZBA 4IJHA 3UDXA 4YHHQ 3SR1A 1OXUA 2QDLA 3HOVH 1Q8IA 3MTSA 4KY6A 5GADC 1IBLL 2E2HB 1PFNA 3M3YH 5K36H 4K6LA 1IL2A 4DAVA 1VQ5A 1R9TB 5IWAL 4H7BA 1EY0A 4A3CG 1HHVA 1JR0D 3S2DB 1JE5A 1STNA 1ILPA 4KMUC 2WACA 2KOLA 1QNUA 4A3EB 1K73C 2HQLA 5C0XG 2MP1A 1CFMA 1N9WA 1X3PA 1Y1VH 1EIFA 1IZ6A 2LSSA 1XTCD 4LF9Q 1RD9D 4A3MB 3MXPA 1JCKB 1SNCA 1STHA 1X3QA 3JAME 1TIID 3CC7A 5ELOA 1NJIC 4AQYL 5IT9E 4IURA 3BZKA 1FD7D 3CKIB 1HNZL 1C0AA 2Z9HA 4JC0A 3S15H 5CV4A 1E24A 5D3DA 2NBFA 3A8JE 4B3TL 2HHHQ 3HFZB 3HOWH 1YEZA 1HXYD 1S72A 1LTLA 5CV5A 2YU9H 2F0FA 2IX0A 1E7ZA 1A0IA 3OWEB 1Q82C 3RN2A 2YV5A 4A3GB 1KC8C 3CCQA 4KKUA 4G4KA 1ZYRC 4JPBW 4UHVA 4R8NA 1CQFA 3D6WA 2BH8A 4L5SA 5IODA 2M9VA 2R3ZA 2X69A 2Q2HA 3ULPA 1NCVA 2JA8B 1GUWA 2WINB 3L2PA 3KOJA 3UDGA 3QWNA 3ND9A 1E22A 2A74C 4GN3B 1JB3A 4JVZA 4CJ1B 3S9WA 4GNXA 3LNNA 2Q8IB 3OIQA 1HNWQ 1LLRD 1A6XA 3W5OA 3GTLH 5EPKA 2ICEC 2E75C 2IT1A 1CI3M 1U9RA 3DHQA 1F2YA 2BE5D 5DNFA 5M9OA 3PO3H 3V2TA 1CTMA 1WTPA 1D5MC 2E2DC 3HGBA 5LMNL 2SDFA 2ZT9C 4K2LA 5AFWA 3KBGA 3VA5A 4DXFA 4A3JH 3R93A 3ER0A 2CKZB 3T1YQ 1EZ6A 4BY1B 3HKSA 5C4XB 4A3IB 1JJ2A 1R4QB 3GTGB 2ZJQA 4S3SA 1JQYD 3DEPA 2KQ3A 3D4RA 3FEWX 3CPFA 1TQOA 5LMNW 5C44H 1MIUA 2E2JH 3LWEA 2C9OA 1VQBA 5E3FA 5IGDA 3S14B 2ICIA 2BCOA 4QL5A 4Y7NB 4JI2L 2A69D 3TSSA 3MZ5A 1Q86C 5C4HA 3SK4A 3D4DA 2WB1E 3SVMA 1A3UA 1HZCA 4K5VA 1KD1C 1C7YA 1G291 4K14A 1HR0L 3HOUB 1J5EQ 3ZJYC 3S1NH 4JBMA 3KLRA 4UP8A 2K32A 4LF6L 1N32L 3FPUB 4Y52H 4RWSC 2MO1A 4ULLA 3NTKA 1I4RA 4CKEA 2L9HA 1VQ9A 1LTSD 5C3EG 3QR8A 1FJGQ 1XMOL 1WTHA 5M5WH 1HUMA 4TVAB 3HOYH 3S16B 4LW1A 3NELA 1VDZA 2K5WA 3SK5A 1IBMQ 1G6PA 2SOBA 4FF3A 1GXDC 2TSSA 5LHY1 1KNEA 4P72A 2DY7A 2F4VQ 1WOCA 4C3IB 3J7YW 4R1JA 1HZ9A 1K3RA 2D0OA 1A62A 1X65A 3D0FA 1LTTD 1GO3E 1HRJA 2UXDQ 2YTVA 2B2WC 1V1OA 2VQFQ 2GN5A 1SSOA 3EROA 1CSQA 4GOPA 3CRKC 3Q23A 1K8MA 1XYIA 3ERSX 1CKNB 4NW2A 1NBWA 2MJ8A 3K5MA 3OW7A 4DKAC 2M00A 1C48A 4DR6Q 1RHPA 1B44D 2QEJC 3HRZC 2EY1A 3J7A5 2EXDA 4KN7C 4NKLA 2C35B 1QZHA 2B63B 4RCNA 3H0GG 2B3GA 2E2HH 4FXDA 3GTOB 4CDCC 1O7LA 2NYZD 4JI3L 3S17B 1R9TH 4EVOA 4A3BB 4LFBQ 3S2DH 1A15A 2SNSA 1TWGH 4OELB 1PH6A 5ELNA 4J8QA 1HPCA 3GTMB 1EIYB 4XQQA 4WJ3M 5IGBA 3V96A 1X32A 4DUZQ 5A35A 3HOZG 3M4YA 4DR5L 1X3FA 1QCBD 5AJ3Q 5I6WA 1ICWA 4KN4C 3HOXB 4EQ5A 3L3OC 1K3BC 2Y0SE 4JOIA 2Z4IA 1V1PA 2JA5B 2WKDA 2R61A 2VL6A 2BE5C 4F88A 1I4XA 5IYDH 5CV9A 5CC4A 2F0MA 3I91A 4K0KL 4OO1H 2QDBA 1UE6A 1JICA 2WAQB 4XT3B 4OWWB 3FKIB 2B2UA 3LGJA 4GN4B 3TP7A 1IBLQ 4R4CA 4YY3L 2R92H 1SYDA 4LJZC 2DY8A 3CCJA 1VQEA 2UUBQ 4QUCA 2ZM6L 4GLAC 5K5PA 2N49A 3NBIA 3O13A 4NB3A 3R2IA 5KYLA 4ALPA 4R4TA 3TP6A 2D2CC 3CP0A 4JG2A 3F8TA 2OXPA 5FLMH 3HKZE 1SLJA 1TU2B 2ZJRA 2JA8H 3GTQB 5KEEA 3BYYB 2A69C 4HJ5A 3N52A 4A3DB 5IY0A 1PZID 2E8GA 1U5KA 1SXTA 4A3LG 4FNFA 1ESFA 1B3QA 4QIWB 1HNZQ 1BQQT 1HH2P 1H9JA 1JOKA 3PMFA 4RH6A 4PMWA 2K1BA 3PQIA 2IX1A 4NXNL 4B3TQ 2NVXB 3M4OB 2RKSA 1YVCA 1XWEA 5BN3A 3CPWA 1XNRQ 2XN9C 2IW3A 2KUMA 3Q0AA 4BBSB 4RKLA 4KJNA 5HURA 1PTOB 2ZTCA 2HUGA 3RD4A 1WTQA 1D5XC 4ZKCB 1C8CA 5C4XH 2Z0SA 5L37A 5LL6S 3VA7A 1GUTA 4A3FB 2BA0A 2EYPA 4HIOA 3GTGH 3CAMA 1MD2D 3J80E 4K6DA 5I4DA 3CU7A 4ZUJA 2VW9A 1KNAA 4OONA 2HIXA 1DCZA 2RHSB 4ODGA 2J7ZA 3MXGA 3SEBA 5FOBB 5M3MG 2RCNA 1I6HH 5JEAG 1Y8OB 4WFN3 1SBBB 1X3GA 1Y1WB 5M3FG 3NXWA 3S14H 1CHQD 3A8KE 5DAUA 2G5DA 3M7NA 2CH4A 2SEBD 2IWHA 3RMHA 4G57A 2AKWB 3BDCA 4GLXA 1TWAB 1PYBA 4DAYB 5COYA 3WOFA 2B39A 5LMNQ 4DV6L 3K59A 4N8FA 3U9SA 3VYSA 4DGZA 2EDGA 3KLSA 3S1RB 1PYSB 4A93G 4NXML 3HOUH 4TRDA 4EQNA 3PIP3 1Y14B 1P8LA 1TY2A 2XRQD 1PRTB 2BDOA 2Y0SB 1U0LA 2JYOA 1I6VC 3MC0B 4C3HB 1UE1A 5ELFA 4DK1A 1PHJA 2UU9Q 1H95A 4B9XA 4IALA 3LX0A 5EGTA 1QVCA 3I3CA 3K80C 3JAML 5M5XB 2EJFC 4RHSA 1VQMA 4DK6C 4JCVE 1G8ZD 3K6OA 3K58A 1VMCA 3NBHB 3DWPA 1ZEQX 2EYFA 3MVVA 2MPMA 1B50A 3JAMc 2WFWA 5T1IA 3CCSA 1EIHA 4F87A 1GUOA 5IT9c 1RF2D 2BA1A 1U4PA 3T51B 1X9NA 3AMUA 1XJVA 2RA4A 1LUZA 4X66L 3D31A 4NP5A 5EBCA 1DGSA 4XTCS 4RCOA 4C3IH 5IGGA 1I50B 2ZJPA 2ZTEA 2JSOA 3DWAA 1YHAA 3Q6SA 1FL0A 4KJOA 2I5LX 1WCMB 4LF6Q 3VR5A 1VQJA 2K5VA 3S1MB 1N32Q 2X6LA 1PRTF 5KNBA 3HKZB 5LL6X 4UY8C 4EQOA 2VZAA 5K36G 3PIPA 1LT3D 2OTJA 3EJIA 3I2ZA 4YWLA 1B4OA 2EVBA 2N78A 5C6AA 2XNAC 1XMOQ 4X6AH 1F9SA 3MXNA 5I9OA 3A7LA 4BBRB 2NVQH 4LF7L 4JI1L 1LABA 1ZYRD
chains in the Genus database with same CATH topology
1EIFA 1IZ6A 3PUVA 2LSSA 4OWTB 4DV0Q 1YBYA 4FDBA 1LM0A 2K75A 3RNUA 4LF9Q 4JYAQ 5C3EH 1K9MC 2ID0A 3RLFA 1X3EA 1Y1VG 2K5NA 1B8AA 4AYBG 3I4NH 2PMZE 3RZOH 2B63H 2VNUD 3CC7A 5ELOA 1SFOH 3AFPA 4YCVA 5IP9H 5JEAJ 2KBNA 4AQYL 1NJIC 4IPDA 3BZKA 3I4NG 1VQAA 5C0XI 2I5MX 1VQHA 2VQEQ 2B63G 1HNZL 5IYCH 1C0AA 2UUAQ 3S17H 5IP9G 1PH1A 4JC0A 3S15H 4LFCL 3A5ZB 4A3BH 3G71A 1PH8A 3STBC 1E24A 1OTCA 1N34L 4B3TL 1K0RA 5IYCG 4QIWE 2VY3A 3HFZB 2HHHQ 4HJ8A 1PA6A 3HOWH 1YEZA 4A3BG 3PUXA 1S72A 1LTLA 2YU9H 4BY1H 4DUYL 2IX0A 4A3IH 1E7ZA 3PO2H 1A0IA 1Q82C 2IHFA 3RN2A 3HOWG 2YV5A 4UP7A 2Q2TA 1Q7YC 3BJUA 3CD6A 4BY1G 1KC8C 3CCQA 1PH7A 2OTLA 2UUAL 5DLQE 4A3IG 3HOXH 3PO2G 3L7ZC 4DR2Q 3H3VH 1EOVA 2K4KA 4LWCA 4X62L 1XPOA 4YWMA 3CMEA 1L1OC 3KJPA 4NPSA 1C9OA 2OWOA 2XGTA 3Q8DA 4LF8L 4B3SQ 3HOXG 1ASZA 3BU2A 2E5LL 2BH8A 4L5SA 2CCZA 4KHPL 4JI4Q 2K5HA 2D0PA 2Q2HA 3ULPA 1AE3A 2YYZA 3TRZA 4J15A 3L2PA 3KOJA 4Y7NH 3UDGA 2NZHA 4JI6Q 4XIGS 1E22A 1YIJA 4IFDI 4GN3B 4GNXA 2AWOA 1HNWQ 3OTOQ 1XMQL 1EUJA 2LXJA 2WAQG 4LF5L 3BZCA 1VQ8A 3W5OA 4JI3Q 3GTLH 4DV7L 1Q12A 4GKKL 2IT1A 5H1SE 1UWVA 3PGZA 1TWFH 2EIFA 4JI4L 3H3VI 4RG1A 4DV1L 3PO3H 3G6EA 1AE2A 2YTXA 4DNIA 4LUVA 1T9HA 4B3MQ 1HNWL 1JJGA 1VQFA 4JBWA 5LMNL 1MJEA 1KRSA 1N33L 2NVTH 2PQAB 2QA4A 3G4SA 4R4OA 1QUQB 4OX9L 1V1QA 3ULJA 1P16A 1X54A 3CMAA 2GVBA 3F2CA 4A3JH 3I55A 3ER0A 1OXVA 3K8AA 4DR7Q 2CKZB 3H15A 4A4IA 3T1YQ 1IBKL 4DV2Q 3E0EA 3GTQH 3HKSA 4O0AA 1TXYA 1K8AC 3CCMA 1JJ2A 3S16H 4K0KQ 1EQQA 4LFAQ 1WFQA 3CF5A 4B3ML 1XNQL 1CKMA 2ZJQA 3GO5A 1VQNA 3TQYA 4B3RQ 4JI2Q 5HY6A 3UDFA 3PUYA 4HJ7A 4IPHA 1KAWA 3CPFA 1L1OB 3K81C 5C44H 1MIUA 5LMNW 2E2JH 1VQOA 2UUCQ 2A8VA 3T1HL 3S1QH 1VQBA 4GLVB 4POFA 3M4QA 3EBEA 3SGIA 2NVXH 4P74A 3M4OH 4QGUA 1TWCH 1M1KC 1KL9A 5C44G 3I56A 4JBJA 3F2BA 1HR0Q 2UXCQ 4QL5A 3DM3A 4DK3C 1Q86C 2CWPA 4JI2L 2ZM6Q 4DR4Q 1Z9FA 3HOVG 2JK8A 2WB1E 4RMFA 3I4MH 2MFIA 4OWXB 4A3KH 1OXTA 4POGA 1HZCA 4YHHL 1XPRA 1KD1C 1C7YA 4IPCA 4HIMA 1G291 2RF4A 3CCVA 3I4MG 2MNAA 4A3KG 1VQLA 3E9IA 1HR0L 4JI8Q 2E2IH 1J5EQ 3F1ZA 4HIKA 3ZJYC 1E1OA 1JMCA 2JQOA 3S1NH 4UP9A 3UDIA 2KCMA 1QVGA 4JBMA 1Q8KA 4UP8A 5GAHC 4LF6L 4DV3Q 1GVPA 2MO0A 1PH5A 1N32L 4Y52H 1Q1EA 2MO1A 3W1BA 1PH3A 1PH9A 4DR1L 3EIVA 1XTDA 4DR3Q 4APVA 2CWAA 1VQ9A 3WWVA 4NXNQ 5C3EG 3K0XA 1FJGQ 1X55A 3M9BA 4H02A 1XMOL 5M5WH 2K14A 3J7ZC 1TWAH 3GTOH 4TVAB 3HOYH 5J3BA 4LW1A 2QEXA 3NELA 3A0JA 2Q2UA 2IY5B 4DV0L 4LF9L 4JYAL 5JJKA 3I7FA 1ASYA 1IBMQ 5GAEC 1HJPA 1VQKA 3L0OA 4DR3L 3HOYG 4LUZA 1G6PA 2JEBI 2PI2A 3K7AH 3S1RH 2UXBQ 3GTMH 1Q1BA 1YJ9A 1FJGL 2I5HA 4MZ9A 3KDFA 4P72A 2A1AA 2F4VQ 1WOCA 1YHBA 2VQEL 4IFDG 1W3SA 4R1JA 3NEMA 1HZ9A 2ATWA 1K3RA 2D0OA 1A62A 5EAYA 3F2DA 3RLNA 3PUZA 1X65A 2QGQA 1I3QH 1LYLA 3D0FA 4A75A 4C3HH 1GO3E 1VQ6A 3U58A 2UXDQ 2YTVA 3KF8B 3KF6B 2HHHL 1GKHA 2JA5H 4QY7A 2VQFQ 1E3PA 2ES2A 1Z47A 2GN5A 5M5XH 5LMUQ 1EFWA 1CSQA 1VQIA 4GOPA 3A74A 1IXRA 2N3SA 1BVSA 3A5UA 2F4VL 2JA5G 3J81i 3ERSX 1CKNB 3U50C 1NBWA 1I5FA 4DKAC 2JE6I 1X6OA 3FKIH 1RIPA 4DR2L 3RN5A 2UXDL 1GD7A 4DR6Q 2LXKA 2WB1G 4WJ4A 4YCUA 2AHOB 1SROA 1EQRA 3FKIG 4O2DA 1B7YB 4B3SL 3J7A5 1TWHH 4DV6Q 4PZ6A 2EXDA 2EQSA 1YJWA 1KRTA 3OYYA 4DV5Q 3H0GH 4IO9A 1QZHA 2C35B 2N8NA 4JI6L 4C3JH 4NXMQ 4JI7Q 5HGQA 1VQPA 1OXSC 4PZ8A 4IPGA 1M90C 2GVAA 1IYJB 2B3GA 1V9PA 3H0GG 3PUWA 3OTOL 2E2HH 1B70B 4DR5Q 3PO3G 2VUMH 1FVIA 4JI3L 1VCIA 4HJAA 2PNHA 1WCMH 4P75A 1R9TH 4GKJQ 4X65Q 1QZGA 2R6GA 4LFBQ 4P71A 1YI2A 3S2DH 4DV5L 2VUMG 3CC4A 4JI5Q 1TWGH 1UE7A 2L15A 3MXNB 5ELNA 1E1TA 4EX5A 4GNXC 3MEFA 1PH6A 3HOZH 3S24A 1L2FA 1MJCA 1EIYB 4YCWA 4WJ3M 3PF4A 4A3JG 3J81j 4DUZQ 1HZAA 1PH4A 2XTIA 3HOZG 1N36Q 3ICEA 4DR5L 1X3FA 2Z6KA 2AWNA 1KHIA 4A3DH 5JJLA 3PIOA 5AJ3Q 5C0XJ 2R7ZH 4EQ5A 4HJ9A 4LFBL 2ZTDA 4A3DG 2Y0SE 2OCEA 1WI5A 4JOIA 3TEHB 1H95A 3GD7A 4YWKA 3U4VA 4LF4Q 2CFMA 4JV5Q 4DR7L 5GROA 4YY3Q 1SN8A 3S2HH 3T1YL 3CC2A 2VL6A 4DV2L 5IYDH 1A63A 3U4ZA 4A76A 2R93H 4BA2I 3K7UC 4K0KL 1EWIA 4LFAL 1JB7A 4MNOA 1UE6A 2KHJA 3KF6A 5IYDG 4B3RL 5AJ3L 3VDYA 3AQQA 4MTNA 3TREA 4OWWB 2B29A 2MQHA 3AEVA 2ASBA 4IJLA 4OO1G 3LGJA 4GN4B 4BBSH 1IBLQ 2PI2E 1YITA 2UUCL 2HT1A 4JV5L 1NMGA 4R4CA 2NN6I 4C2MH 4YY3L 2R92H 2DUDA 1PH2A 4BBSG 5C4JH 1YJNA 3TS2A 3CCJA 3I4OA 4A3FH 2UXCL 2R92G 4LNQA 1VQEA 1WYDA 2UUBQ 3RZDH 2ZM6L 3IRBA 4DR4L 4GLAC 4GN5A 3CCUA 2R7DA 3J80i 1YNXA 1L0WA 4A3FG 4IFDJ 3AYHB 2N49A 5E7NA 1I94Q 4IOAA 4OO1I 5JJIA 1JT8A 2AMCB 1UEBA 4NB3A 4LF7Q 5GAGC 3STBD 4ALPA 1D8LA 2ALYB 4R4TA 1PVOA 3J80c 3CP0A 4JG2A 1VQGA 4OXPA 3F8TA 2JA6H 1Y1WH 4JI8L 1MKHA 1KIXA 2PQAA 4GNXB 1J5EL 5FLMH 2FXQA 1SLJA 3HKZE 3KJOA 2ZJRA 2UUBL 1NE3A 1QUQA 5BR8Q 2JA8H 4A3LH 4HJ5A 2JA6G 1Y1WG 1HR0W 4DV3L 1PFSA 1VS0A 5GQOA 5IY0A 5FLMG 2E8GA 3NENA 1U5KA 2KCTA 3FP9A 1N8RC 2JA8G 4A3LG 1HNZQ 1XPUA 3FHWA 2VS1A 1HH2P 2I0QA 4LFCQ 1KQSA 4IOCA 2K50A 4PMWA 1N34Q 2IX1A 1VQ4A 4NXNL 4B3TQ 2YTYA 1W2BA 4QQBX 5FJ8H 5BR8L 5IP7H 4LUOA 2OQKA 4DUYQ 1L1OA 1SMXA 1YVCA 3PSIA 3CPWA 3KYHC 1XNRQ 5FJ8G 1NTGA 1QVFA 5IP7G 4KHPQ 1SE8A 4DPGA 1VQ7A 4L5TA 1IBML 1BKBA 1K83H 4P73A 3CCLA 3PF5A 2Y0SG 2UXBL 2ZTCA 3ULLA 4X62Q 3RR5A 4LF8Q 3DLLA 2E5LQ 4BXXH 2BH2A 5C4XH 1J6QA 1A8VA 2Z0SA 3G48A 3UE0A 1CUKA 5IE8A 1GM5A 4DAMA 1XNRL 2BA0A 3GTPH 3OW2A 4HIOA 2D62A 4DV4Q 3GTGH 1V43A 1SRUA 3CAMA 4BXXG 3J81c 5M3MH 2VW9A 5C4XG 1Q46A 2KENA 4OONA 2HIXA 4AH6A 3TS0A 3GTJH 1UE5A 2RHSB 2VQFL 1BBWA 5LMUL 5M3FH 2F3IA 1XMQQ 3JC66 4LF5Q 5M3MG 2RCNA 4HIDA 5JEAG 1I6HH 4DV7Q 1S40A 3RLOA 1EYGA 4UPAA 4GKKQ 1CSPA 1X3GA 5M3FG 3S14H 4X64Q 1I50H 4DV4L 4JI0Q 2KHIA 4DV1Q 3M7NA 2F52A 2AKWB 4GLXA 4GOPC 4DR6L 1PYBA 3KFUA 4DAYB 5FLXc 4A93H 5LMNQ 4DV6L 3S1MH 4PG3A 2V1CC 1N33Q 5IYBH 3CCRA 4JBKA 4L5RC 1AH9A 4OX9Q 2NVYH 5M5YH 1WCMG 4AYBE 1PYSB 4A93G 4NXML 4X64L 4A3EH 2JA9A 5IYBG 4JI7L 3HKZG 4JI0L 3GTKH 3HOUH 1Q81C 3W1GA 2JEAI 1Y14B 1IBKQ 1P8LA 3AFQA 4AIMA 1JJCB 2DGYA 4BBRH 4A3EG 3HOUG 1U0LA 2JJQA 4X65L 1HNXQ 2CQOA 1XNQQ 1NY4A 2WP8J 4GKJL 2A19A 1UE1A 1PHJA 2UU9Q 2NN6G 4KLKA 1G51A 4KHZA 4A3MH 2K52A 1VQCA 4QJFA 4JI5L 4GS3A 2NZOA 1RL2A 4L5QA 1QVCA 4BBRG 3K80C 2R7ZG 3JAMi 4A3MG 4DK6C 4X66Q 4JCVE 3M85A 3T1HQ 1VQMA 1PV4A 4DUZL 2Q2IA 4KI0A 1NMFA 1N36L 2RHQB 3KLWA 3NBHB 1VQDA 3CW2C 3CQZH 2H5XA 4R4QA 1HNXL 2R93G 1O7IA 3E9HA 2JA7H 3JAMc 4BY7H 2UU9L 2HIVA 1YHQA 2WFWA 3UE1A 4R4IA 1CKNA 3CCSA 3M4PA 3KDFB 4LF4L 4BA1I 2IHEA 5IT9c 2BA1A 3B6YA 1CKOA 1OXXK 4TQUS 1K8GA 5IWAQ 1KXLA 1X9NA 2JA7G 1SR3A 2Z6KC 3GDEA 3PV0A 1XJVA 4BY7G 1HZBA 4IJHA 1LUZA 3UDXA 4X66L 3D31A 4YHHQ 3CCEA 1X56A 1DGSA 1OXUA 4XTCS 3HOVH 4JOIC 2R7FA 1WJJA 4C3IH 4A3GH 2ZJPA 2ZTEA 3CXCA 3PCOB 5GADC 2OQ0A 1IBLL 4A3CH 4GOPB 3EN2A 3M3YH 1YHAA 1FL0A 2WAQE 1IL2A 4A3GG 1VQ5A 2I5LX 5IWAL 4JI1Q 4LF6Q 1VQJA 2K5VA 1N32Q 4A3CG 4UY8C 5K36G 4PZ7A 1BBUA 2VZAA 1D7QA 1JE5A 3PIPA 1YZ6A 2OTJA 4DR1Q 3I2ZA 4YWLA 1K73C 1FGUA 2HQLA 4ME3A 2N78A 5C0XG 4AQYQ 1XMOQ 1I94L 4X6AH 1N9WA 1S3OA 2NVQH 4LF7L 4JI1L 1Y1VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIF A;  1IZ6 A;  3PUV A;  2LSS A;  4OWT B;  4DV0 Q;  1YBY A;  4FDB A;  1LM0 A;  2K75 A;  3RNU A;  4LF9 Q;  4JYA Q;  5C3E H;  1K9M C;  2ID0 A;  3RLF A;  1X3E A;  1Y1V G;  2K5N A;  1B8A A;  4AYB G;  3I4N H;  2PMZ E;  3RZO H;  2B63 H;  2VNU D;  3CC7 A;  5ELO A;  1SFO H;  3AFP A;  4YCV A;  5IP9 H;  5JEA J;  2KBN A;  4AQY L;  1NJI C;  4IPD A;  3BZK A;  3I4N G;  1VQA A;  5C0X I;  2I5M X;  1VQH A;  2VQE Q;  2B63 G;  1HNZ L;  5IYC H;  1C0A A;  2UUA Q;  3S17 H;  5IP9 G;  1PH1 A;  4JC0 A;  3S15 H;  4LFC L;  3A5Z B;  4A3B H;  3G71 A;  1PH8 A;  3STB C;  1E24 A;  1OTC A;  1N34 L;  4B3T L;  1K0R A;  5IYC G;  4QIW E;  2VY3 A;  3HFZ B;  2HHH Q;  4HJ8 A;  1PA6 A;  3HOW H;  1YEZ A;  4A3B G;  3PUX A;  1S72 A;  1LTL A;  2YU9 H;  4BY1 H;  4DUY L;  2IX0 A;  4A3I H;  1E7Z A;  3PO2 H;  1A0I A;  1Q82 C;  2IHF A;  3RN2 A;  3HOW G;  2YV5 A;  4UP7 A;  2Q2T A;  1Q7Y C;  3BJU A;  3CD6 A;  4BY1 G;  1KC8 C;  3CCQ A;  1PH7 A;  2OTL A;  2UUA L;  5DLQ E;  4A3I G;  3HOX H;  3PO2 G;  3L7Z C;  4DR2 Q;  3H3V H;  1EOV A;  2K4K A;  4LWC A;  4X62 L;  1XPO A;  4YWM A;  3CME A;  1L1O C;  3KJP A;  4NPS A;  1C9O A;  2OWO A;  2XGT A;  3Q8D A;  4LF8 L;  4B3S Q;  3HOX G;  1ASZ A;  3BU2 A;  2E5L L;  2BH8 A;  4L5S A;  2CCZ A;  4KHP L;  4JI4 Q;  2K5H A;  2D0P A;  2Q2H A;  3ULP A;  1AE3 A;  2YYZ A;  3TRZ A;  4J15 A;  3L2P A;  3KOJ A;  4Y7N H;  3UDG A;  2NZH A;  4JI6 Q;  4XIG S;  1E22 A;  1YIJ A;  4IFD I;  4GN3 B;  4GNX A;  2AWO A;  1HNW Q;  3OTO Q;  1XMQ L;  1EUJ A;  2LXJ A;  2WAQ G;  4LF5 L;  3BZC A;  1VQ8 A;  3W5O A;  4JI3 Q;  3GTL H;  4DV7 L;  1Q12 A;  4GKK L;  2IT1 A;  5H1S E;  1UWV A;  3PGZ A;  1TWF H;  2EIF A;  4JI4 L;  3H3V I;  4RG1 A;  4DV1 L;  3PO3 H;  3G6E A;  1AE2 A;  2YTX A;  4DNI A;  4LUV A;  1T9H A;  4B3M Q;  1HNW L;  1JJG A;  1VQF A;  4JBW A;  5LMN L;  1MJE A;  1KRS A;  1N33 L;  2NVT H;  2PQA B;  2QA4 A;  3G4S A;  4R4O A;  1QUQ B;  4OX9 L;  1V1Q A;  3ULJ A;  1P16 A;  1X54 A;  3CMA A;  2GVB A;  3F2C A;  4A3J H;  3I55 A;  3ER0 A;  1OXV A;  3K8A A;  4DR7 Q;  2CKZ B;  3H15 A;  4A4I A;  3T1Y Q;  1IBK L;  4DV2 Q;  3E0E A;  3GTQ H;  3HKS A;  4O0A A;  1TXY A;  1K8A C;  3CCM A;  1JJ2 A;  3S16 H;  4K0K Q;  1EQQ A;  4LFA Q;  1WFQ A;  3CF5 A;  4B3M L;  1XNQ L;  1CKM A;  2ZJQ A;  3GO5 A;  1VQN A;  3TQY A;  4B3R Q;  4JI2 Q;  5HY6 A;  3UDF A;  3PUY A;  4HJ7 A;  4IPH A;  1KAW A;  3CPF A;  1L1O B;  3K81 C;  5C44 H;  1MIU A;  5LMN W;  2E2J H;  1VQO A;  2UUC Q;  2A8V A;  3T1H L;  3S1Q H;  1VQB A;  4GLV B;  4POF A;  3M4Q A;  3EBE A;  3SGI A;  2NVX H;  4P74 A;  3M4O H;  4QGU A;  1TWC H;  1M1K C;  1KL9 A;  5C44 G;  3I56 A;  4JBJ A;  3F2B A;  1HR0 Q;  2UXC Q;  4QL5 A;  3DM3 A;  4DK3 C;  1Q86 C;  2CWP A;  4JI2 L;  2ZM6 Q;  4DR4 Q;  1Z9F A;  3HOV G;  2JK8 A;  2WB1 E;  4RMF A;  3I4M H;  2MFI A;  4OWX B;  4A3K H;  1OXT A;  4POG A;  1HZC A;  4YHH L;  1XPR A;  1KD1 C;  1C7Y A;  4IPC A;  4HIM A;  1G29 1;  2RF4 A;  3CCV A;  3I4M G;  2MNA A;  4A3K G;  1VQL A;  3E9I A;  1HR0 L;  4JI8 Q;  2E2I H;  1J5E Q;  3F1Z A;  4HIK A;  3ZJY C;  1E1O A;  1JMC A;  2JQO A;  3S1N H;  4UP9 A;  3UDI A;  2KCM A;  1QVG A;  4JBM A;  1Q8K A;  4UP8 A;  5GAH C;  4LF6 L;  4DV3 Q;  1GVP A;  2MO0 A;  1PH5 A;  1N32 L;  4Y52 H;  1Q1E A;  2MO1 A;  3W1B A;  1PH3 A;  1PH9 A;  4DR1 L;  3EIV A;  1XTD A;  4DR3 Q;  4APV A;  2CWA A;  1VQ9 A;  3WWV A;  4NXN Q;  5C3E G;  3K0X A;  1FJG Q;  1X55 A;  3M9B A;  4H02 A;  1XMO L;  5M5W H;  2K14 A;  3J7Z C;  1TWA H;  3GTO H;  4TVA B;  3HOY H;  5J3B A;  4LW1 A;  2QEX A;  3NEL A;  3A0J A;  2Q2U A;  2IY5 B;  4DV0 L;  4LF9 L;  4JYA L;  5JJK A;  3I7F A;  1ASY A;  1IBM Q;  5GAE C;  1HJP A;  1VQK A;  3L0O A;  4DR3 L;  3HOY G;  4LUZ A;  1G6P A;  2JEB I;  2PI2 A;  3K7A H;  3S1R H;  2UXB Q;  3GTM H;  1Q1B A;  1YJ9 A;  1FJG L;  2I5H A;  4MZ9 A;  3KDF A;  4P72 A;  2A1A A;  2F4V Q;  1WOC A;  1YHB A;  2VQE L;  4IFD G;  1W3S A;  4R1J A;  3NEM A;  1HZ9 A;  2ATW A;  1K3R A;  2D0O A;  1A62 A;  5EAY A;  3F2D A;  3RLN A;  3PUZ A;  1X65 A;  2QGQ A;  1I3Q H;  1LYL A;  3D0F A;  4A75 A;  4C3H H;  1GO3 E;  1VQ6 A;  3U58 A;  2UXD Q;  2YTV A;  3KF8 B;  3KF6 B;  2HHH L;  1GKH A;  2JA5 H;  4QY7 A;  2VQF Q;  1E3P A;  2ES2 A;  1Z47 A;  2GN5 A;  5M5X H;  5LMU Q;  1EFW A;  1CSQ A;  1VQI A;  4GOP A;  3A74 A;  1IXR A;  2N3S A;  1BVS A;  3A5U A;  2F4V L;  2JA5 G;  3J81 i;  3ERS X;  1CKN B;  3U50 C;  1NBW A;  1I5F A;  4DKA C;  2JE6 I;  1X6O A;  3FKI H;  1RIP A;  4DR2 L;  3RN5 A;  2UXD L;  1GD7 A;  4DR6 Q;  2LXK A;  2WB1 G;  4WJ4 A;  4YCU A;  2AHO B;  1SRO A;  1EQR A;  3FKI G;  4O2D A;  1B7Y B;  4B3S L;  3J7A 5;  1TWH H;  4DV6 Q;  4PZ6 A;  2EXD A;  2EQS A;  1YJW A;  1KRT A;  3OYY A;  4DV5 Q;  3H0G H;  4IO9 A;  1QZH A;  2C35 B;  2N8N A;  4JI6 L;  4C3J H;  4NXM Q;  4JI7 Q;  5HGQ A;  1VQP A;  1OXS C;  4PZ8 A;  4IPG A;  1M90 C;  2GVA A;  1IYJ B;  2B3G A;  1V9P A;  3H0G G;  3PUW A;  3OTO L;  2E2H H;  1B70 B;  4DR5 Q;  3PO3 G;  2VUM H;  1FVI A;  4JI3 L;  1VCI A;  4HJA A;  2PNH A;  1WCM H;  4P75 A;  1R9T H;  4GKJ Q;  4X65 Q;  1QZG A;  2R6G A;  4LFB Q;  4P71 A;  1YI2 A;  3S2D H;  4DV5 L;  2VUM G;  3CC4 A;  4JI5 Q;  1TWG H;  1UE7 A;  2L15 A;  3MXN B;  5ELN A;  1E1T A;  4EX5 A;  4GNX C;  3MEF A;  1PH6 A;  3HOZ H;  3S24 A;  1L2F A;  1MJC A;  1EIY B;  4YCW A;  4WJ3 M;  3PF4 A;  4A3J G;  3J81 j;  4DUZ Q;  1HZA A;  1PH4 A;  2XTI A;  3HOZ G;  1N36 Q;  3ICE A;  4DR5 L;  1X3F A;  2Z6K A;  2AWN A;  1KHI A;  4A3D H;  5JJL A;  3PIO A;  5AJ3 Q;  5C0X J;  2R7Z H;  4EQ5 A;  4HJ9 A;  4LFB L;  2ZTD A;  4A3D G;  2Y0S E;  2OCE A;  1WI5 A;  4JOI A;  3TEH B;  1H95 A;  3GD7 A;  4YWK A;  3U4V A;  4LF4 Q;  2CFM A;  4JV5 Q;  4DR7 L;  5GRO A;  4YY3 Q;  1SN8 A;  3S2H H;  3T1Y L;  3CC2 A;  2VL6 A;  4DV2 L;  5IYD H;  1A63 A;  3U4Z A;  4A76 A;  2R93 H;  4BA2 I;  3K7U C;  4K0K L;  1EWI A;  4LFA L;  1JB7 A;  4MNO A;  1UE6 A;  2KHJ A;  3KF6 A;  5IYD G;  4B3R L;  5AJ3 L;  3VDY A;  3AQQ A;  4MTN A;  3TRE A;  4OWW B;  2B29 A;  2MQH A;  3AEV A;  2ASB A;  4IJL A;  4OO1 G;  3LGJ A;  4GN4 B;  4BBS H;  1IBL Q;  2PI2 E;  1YIT A;  2UUC L;  2HT1 A;  4JV5 L;  1NMG A;  4R4C A;  2NN6 I;  4C2M H;  4YY3 L;  2R92 H;  2DUD A;  1PH2 A;  4BBS G;  5C4J H;  1YJN A;  3TS2 A;  3CCJ A;  3I4O A;  4A3F H;  2UXC L;  2R92 G;  4LNQ A;  1VQE A;  1WYD A;  2UUB Q;  3RZD H;  2ZM6 L;  3IRB A;  4DR4 L;  4GLA C;  4GN5 A;  3CCU A;  2R7D A;  3J80 i;  1YNX A;  1L0W A;  4A3F G;  4IFD J;  3AYH B;  2N49 A;  5E7N A;  1I94 Q;  4IOA A;  4OO1 I;  5JJI A;  1JT8 A;  2AMC B;  1UEB A;  4NB3 A;  4LF7 Q;  5GAG C;  3STB D;  4ALP A;  1D8L A;  2ALY B;  4R4T A;  1PVO A;  3J80 c;  3CP0 A;  4JG2 A;  1VQG A;  4OXP A;  3F8T A;  2JA6 H;  1Y1W H;  4JI8 L;  1MKH A;  1KIX A;  2PQA A;  4GNX B;  1J5E L;  5FLM H;  2FXQ A;  1SLJ A;  3HKZ E;  3KJO A;  2ZJR A;  2UUB L;  1NE3 A;  1QUQ A;  5BR8 Q;  2JA8 H;  4A3L H;  4HJ5 A;  2JA6 G;  1Y1W G;  1HR0 W;  4DV3 L;  1PFS A;  1VS0 A;  5GQO A;  5IY0 A;  5FLM G;  2E8G A;  3NEN A;  1U5K A;  2KCT A;  3FP9 A;  1N8R C;  2JA8 G;  4A3L G;  1HNZ Q;  1XPU A;  3FHW A;  2VS1 A;  1HH2 P;  2I0Q A;  4LFC Q;  1KQS A;  4IOC A;  2K50 A;  4PMW A;  1N34 Q;  2IX1 A;  1VQ4 A;  4NXN L;  4B3T Q;  2YTY A;  1W2B A;  4QQB X;  5FJ8 H;  5BR8 L;  5IP7 H;  4LUO A;  2OQK A;  4DUY Q;  1L1O A;  1SMX A;  1YVC A;  3PSI A;  3CPW A;  3KYH C;  1XNR Q;  5FJ8 G;  1NTG A;  1QVF A;  5IP7 G;  4KHP Q;  1SE8 A;  4DPG A;  1VQ7 A;  4L5T A;  1IBM L;  1BKB A;  1K83 H;  4P73 A;  3CCL A;  3PF5 A;  2Y0S G;  2UXB L;  2ZTC A;  3ULL A;  4X62 Q;  3RR5 A;  4LF8 Q;  3DLL A;  2E5L Q;  4BXX H;  2BH2 A;  5C4X H;  1J6Q A;  1A8V A;  2Z0S A;  3G48 A;  3UE0 A;  1CUK A;  5IE8 A;  1GM5 A;  4DAM A;  1XNR L;  2BA0 A;  3GTP H;  3OW2 A;  4HIO A;  2D62 A;  4DV4 Q;  3GTG H;  1V43 A;  1SRU A;  3CAM A;  4BXX G;  3J81 c;  5M3M H;  2VW9 A;  5C4X G;  1Q46 A;  2KEN A;  4OON A;  2HIX A;  4AH6 A;  3TS0 A;  3GTJ H;  1UE5 A;  2RHS B;  2VQF L;  1BBW A;  5LMU L;  5M3F H;  2F3I A;  1XMQ Q;  3JC6 6;  4LF5 Q;  5M3M G;  2RCN A;  4HID A;  5JEA G;  1I6H H;  4DV7 Q;  1S40 A;  3RLO A;  1EYG A;  4UPA A;  4GKK Q;  1CSP A;  1X3G A;  5M3F G;  3S14 H;  4X64 Q;  1I50 H;  4DV4 L;  4JI0 Q;  2KHI A;  4DV1 Q;  3M7N A;  2F52 A;  2AKW B;  4GLX A;  4GOP C;  4DR6 L;  1PYB A;  3KFU A;  4DAY B;  5FLX c;  4A93 H;  5LMN Q;  4DV6 L;  3S1M H;  4PG3 A;  2V1C C;  1N33 Q;  5IYB H;  3CCR A;  4JBK A;  4L5R C;  1AH9 A;  4OX9 Q;  2NVY H;  5M5Y H;  1WCM G;  4AYB E;  1PYS B;  4A93 G;  4NXM L;  4X64 L;  4A3E H;  2JA9 A;  5IYB G;  4JI7 L;  3HKZ G;  4JI0 L;  3GTK H;  3HOU H;  1Q81 C;  3W1G A;  2JEA I;  1Y14 B;  1IBK Q;  1P8L A;  3AFQ A;  4AIM A;  1JJC B;  2DGY A;  4BBR H;  4A3E G;  3HOU G;  1U0L A;  2JJQ A;  4X65 L;  1HNX Q;  2CQO A;  1XNQ Q;  1NY4 A;  2WP8 J;  4GKJ L;  2A19 A;  1UE1 A;  1PHJ A;  2UU9 Q;  2NN6 G;  4KLK A;  1G51 A;  4KHZ A;  4A3M H;  2K52 A;  1VQC A;  4QJF A;  4JI5 L;  4GS3 A;  2NZO A;  1RL2 A;  4L5Q A;  1QVC A;  4BBR G;  3K80 C;  2R7Z G;  3JAM i;  4A3M G;  4DK6 C;  4X66 Q;  4JCV E;  3M85 A;  3T1H Q;  1VQM A;  1PV4 A;  4DUZ L;  2Q2I A;  4KI0 A;  1NMF A;  1N36 L;  2RHQ B;  3KLW A;  3NBH B;  1VQD A;  3CW2 C;  3CQZ H;  2H5X A;  4R4Q A;  1HNX L;  2R93 G;  1O7I A;  3E9H A;  2JA7 H;  3JAM c;  4BY7 H;  2UU9 L;  2HIV A;  1YHQ A;  2WFW A;  3UE1 A;  4R4I A;  1CKN A;  3CCS A;  3M4P A;  3KDF B;  4LF4 L;  4BA1 I;  2IHE A;  5IT9 c;  2BA1 A;  3B6Y A;  1CKO A;  1OXX K;  4TQU S;  1K8G A;  5IWA Q;  1KXL A;  1X9N A;  2JA7 G;  1SR3 A;  2Z6K C;  3GDE A;  3PV0 A;  1XJV A;  4BY7 G;  1HZB A;  4IJH A;  1LUZ A;  3UDX A;  4X66 L;  3D31 A;  4YHH Q;  3CCE A;  1X56 A;  1DGS A;  1OXU A;  4XTC S;  3HOV H;  4JOI C;  2R7F A;  1WJJ A;  4C3I H;  4A3G H;  2ZJP A;  2ZTE A;  3CXC A;  3PCO B;  5GAD C;  2OQ0 A;  1IBL L;  4A3C H;  4GOP B;  3EN2 A;  3M3Y H;  1YHA A;  1FL0 A;  2WAQ E;  1IL2 A;  4A3G G;  1VQ5 A;  2I5L X;  5IWA L;  4JI1 Q;  4LF6 Q;  1VQJ A;  2K5V A;  1N32 Q;  4A3C G;  4UY8 C;  5K36 G;  4PZ7 A;  1BBU A;  2VZA A;  1D7Q A;  1JE5 A;  3PIP A;  1YZ6 A;  2OTJ A;  4DR1 Q;  3I2Z A;  4YWL A;  1K73 C;  1FGU A;  2HQL A;  4ME3 A;  2N78 A;  5C0X G;  4AQY Q;  1XMO Q;  1I94 L;  4X6A H;  1N9W A;  1S3O A;  2NVQ H;  4LF7 L;  4JI1 L;  1Y1V H; 
#chains in the Genus database with same CATH topology
 3NQI A;  1SNO A;  1YBY A;  3DEO A;  2K75 A;  3ITP A;  1ONL A;  1K9M C;  1S5F D;  2K5N A;  1Y1V G;  3I4N H;  3S2H B;  5J39 A;  1B53 A;  3OPO A;  2B63 H;  2VNU D;  2R93 B;  5IP9 H;  5JEA J;  5EKK A;  4IPD A;  5C0X I;  1CA6 A;  3I70 A;  2I5M X;  5IYC H;  3IAY A;  3A55 A;  3S17 H;  1PH1 A;  4A3B H;  4LFC L;  3A5Z B;  1PH8 A;  4C2M B;  3TZD A;  5EJW A;  1J9O A;  1SE4 A;  4HJ8 A;  4DFA A;  3PUX A;  5C4J B;  4DUY L;  5ELD A;  2F0D A;  1PDQ A;  3HOW G;  4RGN A;  5E4W C;  5C5M A;  3C2P A;  2UUA L;  5CMD A;  5DLQ E;  3HOX H;  1A2T A;  2K4K A;  2PO4 A;  2XWJ B;  4LWC A;  4ME5 A;  4YWM A;  1L1O C;  3KJP A;  2OWO A;  3HP3 A;  3BS1 A;  2G9H D;  4X3K A;  3VYT A;  4K2K A;  2D0P A;  1AE3 A;  1K28 A;  2B2Y A;  2NZH A;  1YIJ A;  4IFD I;  2AWO A;  4IUQ A;  1XMQ L;  1EUJ A;  2LXJ A;  4I65 A;  3VR6 A;  3BZC A;  4JI3 Q;  1KDC A;  1E0B A;  2HDM A;  1HQM C;  1TWF H;  4JI4 L;  4B9W A;  3H3V I;  4DV1 L;  2IJ0 A;  1SFO B;  1WTV A;  4U67 3;  4DF7 A;  4B3M Q;  1JJG A;  1VQF A;  4JBW A;  3NE5 B;  1SJH D;  2PQA B;  2QA4 A;  1SEB D;  1D1K A;  3G4S A;  4OX9 L;  5EQ0 A;  1P16 A;  1SND A;  2GVB A;  3F2C A;  1HTP A;  1STA A;  3ND8 A;  4NMZ A;  1B3A A;  3H15 A;  3GTQ H;  1ROD A;  3CCM A;  1WD1 A;  4K0K Q;  1WFQ A;  1XNQ L;  3P1H A;  1RDP D;  1Z6H A;  1STY A;  3GTJ B;  4HJ7 A;  2A8V A;  2E76 C;  2NVX H;  3M4Q A;  1QB5 D;  3M4O H;  4P74 A;  1F9R A;  4PQX A;  1M1K C;  5C44 G;  3I56 A;  3DWQ A;  4JBJ A;  2WII B;  2ZM6 Q;  1HTL D;  2NB0 A;  4U68 A;  2JK8 A;  4RMF A;  5CBA E;  1LT6 D;  4KKS A;  2LMC B;  2E74 C;  3HG9 A;  4B08 A;  4HIM A;  4IZ8 A;  2RF4 A;  2EJG C;  2XIW A;  3EFX D;  5TSS A;  1VQL A;  4RHR A;  1LT4 D;  1EFI D;  2L1B A;  3F1Z A;  4HIK A;  1JMC A;  1E1O A;  4L6T B;  2B2V A;  4UP9 A;  1BCP B;  1Q8K A;  2A5H A;  3K5N A;  2F0N A;  2CVR A;  1TT2 A;  1PH5 A;  2HCC A;  2NVT B;  3A54 A;  1JE4 A;  1XTD A;  4F7X A;  4DR3 Q;  3BVZ A;  1BUV T;  4NXN Q;  3K0X A;  4Q0F A;  1X55 A;  1ILQ A;  3M9B A;  4OL7 A;  3J7Z C;  3F2U A;  1TWA H;  5ELC A;  1LTI D;  4BY7 B;  2Q2U A;  1AN8 A;  4DV0 L;  1SMY D;  1IYV A;  1HFN A;  4FO2 A;  5HGT A;  3NK9 A;  1BXT A;  5GAE C;  1H9S A;  1VQK A;  3HOY G;  2PPB C;  3S1R H;  1M8A A;  5EBD A;  1DYQ A;  3KDF A;  3C3L A;  2A1A A;  1TWC B;  1YHB A;  4IFD G;  2ATW A;  3K0Y A;  4H0L C;  3RLN A;  1EY5 A;  1LYL A;  4C3H H;  5ELB A;  3BDO A;  5G3L F;  3H3V C;  1AEX A;  3FDT A;  1EWC A;  3KF8 B;  1LAC A;  3KF6 B;  1BCP F;  1JOO A;  1E3P A;  1TS2 A;  5M5X H;  3IFD A;  3A74 A;  1YNN D;  2KCC A;  1G91 A;  5KND A;  3U50 C;  3WOE A;  1I5F A;  2E2I B;  2DNC A;  3QOL A;  4KHV A;  3T4A C;  1U4L A;  3RN5 A;  2AQ2 B;  1GD7 A;  2LXK A;  4AYB B;  4YCU A;  2AHO B;  4B3S L;  1EQR A;  4DV6 Q;  3KK7 A;  4ZYS A;  5C3E B;  4CHT B;  4KTA A;  1HCZ A;  1PLF A;  2EQS A;  5IGC A;  4DV5 Q;  4IO9 A;  3A7A B;  4ZK9 B;  4QCL A;  1CZW A;  3RZO B;  4JI6 L;  2IL8 A;  4NXM Q;  3I72 A;  5HGQ A;  1WD0 A;  4PZ8 A;  3HEJ A;  1Q90 A;  1V9P A;  3MWY W;  3PUW A;  1BR9 A;  4C1N K;  1B70 B;  4XDX A;  2VUM H;  1VCI A;  1WCM H;  1QZG A;  2A6H C;  2F0L A;  3GQB A;  4BS9 A;  4CBV A;  4CDD C;  4GNX C;  1E1T A;  3IKJ A;  3S24 A;  1L2F A;  1MJC A;  1KAA A;  2EY2 A;  2FMC A;  5KGU A;  3PO2 B;  1EIG A;  2QKI C;  3R3O A;  1D1I A;  1NR4 A;  2XTI A;  2Z6K A;  2AWN A;  2JN4 A;  1DD2 A;  2LY7 A;  2XSC A;  5IGF A;  5C0X J;  4HJ9 A;  1QJO A;  1WI5 A;  3QB3 A;  2EZV A;  2DN8 A;  3S2H H;  3CC2 A;  1PFB A;  1A63 A;  4A76 A;  2R93 H;  3K7U C;  3MXU A;  4LFA L;  2KVM A;  1JB7 A;  3KUP A;  3KF6 A;  4CKC A;  5IYD G;  3SE0 A;  3AQQ A;  2MQH A;  2ASB A;  4OO1 G;  3WDN A;  2PI2 E;  2UUC L;  2HT1 A;  3X3N A;  4JV5 L;  1NMG A;  4C2M H;  1IKM A;  1I4G A;  4YIJ A;  5C4J H;  1L0Y B;  3I4O A;  1BF4 A;  2R92 G;  2EOT A;  3J80 L;  4GN5 A;  4V0B A;  1TVX A;  4IFD J;  3AYH B;  5E7N A;  3W3A A;  5JJI A;  2AMC B;  1FYC A;  4LF7 Q;  1C4Q A;  5GAG C;  3STB D;  4QUF A;  5COR A;  1PVO A;  1YNJ D;  3J80 c;  4OXP A;  2JA6 H;  2ZXO A;  1ICF B;  1MGS A;  4WJW A;  1D5Z C;  1HR0 W;  2A73 B;  5FLM G;  5E4X A;  2KEC A;  3K5L A;  2PYK A;  2JA8 G;  1E2W A;  2VS1 A;  3VR2 A;  2I0Q A;  4LFC Q;  1SAP A;  2K01 A;  3VYU A;  1W6J A;  4EGV A;  1KQS A;  2LFN A;  4L63 B;  3E5S A;  1VQ4 A;  2Z1C A;  2YTY A;  3S1Q B;  4BWG B;  5BR8 L;  5IP7 H;  4DUY Q;  3DUZ A;  3PSI A;  1EY8 A;  1LV9 A;  3OIP A;  4IUN A;  1G2S A;  1NTG A;  5ISR A;  1VQ7 A;  4L5T A;  2K03 A;  4G7O C;  3I4M B;  2UXB L;  3ULL A;  4A3K B;  2L5T A;  3QIA A;  5EPJ A;  1HFG A;  2VB3 X;  4K8J A;  4K5W A;  3DLL A;  4BXX H;  1XXG A;  1A8V A;  1TKW B;  3G48 A;  1CUK A;  5IE8 A;  1EOT A;  4DAM A;  3GTP H;  4PMC A;  4DV4 Q;  2P5Z X;  1SRU A;  1FNU A;  1SMY C;  5C4X G;  2KEN A;  2PZU A;  3GTJ H;  5CGK A;  5LMU L;  1XMQ Q;  3JC6 6;  2QCP X;  3EQL C;  3E0J A;  4FXK C;  4HID A;  1SYB A;  1S40 A;  1EYG A;  2I46 A;  2EYL A;  1J8I A;  4DV1 Q;  1G2T A;  2NTS A;  1SYC A;  2F52 A;  4KKT A;  2NTT A;  4GOP C;  2DJF C;  1EL0 A;  2OEO A;  5IYB H;  4JBK A;  4RGO S;  4OX9 Q;  1YNN C;  5T1G A;  4X64 L;  4A3E H;  4JI7 L;  4JI0 L;  3ZYY X;  3NP8 A;  1Q81 C;  3W1G A;  2JEA I;  2NN6 H;  1PXU A;  1F9Q A;  4ZCK A;  4PMB A;  1JJC B;  4AIM A;  4HSV A;  4TSS A;  3HOU G;  1QWY A;  4OGQ C;  1D2B A;  4GKJ L;  4X65 L;  1I3Q B;  4MTK A;  1HNX Q;  1XNQ Q;  1G51 A;  4A3M H;  1GUN A;  1VQC A;  1K83 B;  4JI5 L;  2NZO A;  2R7Z G;  1GJX A;  4IQZ A;  3JAM i;  4X3S A;  3M85 A;  3SDZ A;  2Q2I A;  1N36 L;  2RHQ B;  5BN5 A;  2WB1 B;  2PZW A;  4TKO B;  5C5L A;  4C56 C;  4PNY A;  4HSP A;  4CDE C;  3E9H A;  4BY7 H;  4Q5V A;  2HIV A;  1CKN A;  1EU4 A;  3C46 A;  4LF4 L;  4DN4 M;  1JWS D;  4LAA A;  1CKO A;  1K8G A;  1JOR A;  4KD3 A;  5IWA Q;  1KXL A;  1ENC A;  5CBE E;  1TWH B;  2J4X A;  3N6R A;  1AFP A;  1KTK A;  1X56 A;  2QF7 A;  4PV1 C;  3E3X A;  3A8I E;  4JOI C;  4C3J B;  4A3G H;  1WJJ A;  1AP0 A;  4NDX A;  2KHS A;  2OQ0 A;  3EN2 A;  1NSN S;  2O5J C;  4C3I G;  4A93 B;  3T56 B;  4PZ7 A;  4MN3 A;  2NVY B;  2B2U C;  3D4W A;  2O2L D;  2F0S A;  2SNM A;  2RCF A;  1U4R A;  4ME3 A;  5IIF A;  3GP7 A;  4AQY Q;  3MFY A;  3FPP A;  4EX5 A;  3PUV A;  4OWT B;  4DV0 Q;  1QNK A;  5C3E H;  3CHB D;  3RLF A;  1X3E A;  2TMP A;  1B8A A;  3H09 A;  2PMZ E;  2VB2 X;  3RZO H;  3LWU A;  3I8Z A;  1LT5 D;  1OO9 B;  1F2Z A;  4MIU A;  3I4N G;  1VQA A;  2J0T D;  4R9W A;  3CQZ B;  2B63 G;  2FMM A;  1ZXT A;  5IP9 G;  1EY9 A;  3H94 A;  3G71 A;  3STB C;  3K57 A;  2K5D A;  1OTC A;  3MHB A;  3QJY A;  1N34 L;  5DM6 3;  1YNJ C;  2XVS A;  5IYC G;  1T5E A;  2VY3 A;  1UEA B;  4A3B G;  3NQT A;  3SHL A;  4BY1 H;  2KEE A;  4A3I H;  3PO2 H;  3G6J B;  3H91 A;  1PH7 A;  2OTL A;  1RTN A;  2EYJ A;  3VR4 A;  5EPL A;  3OHX C;  2XGT A;  3Q8D A;  4LF8 L;  4B3S Q;  3HOX G;  2E5L L;  3URY A;  2IX3 A;  1AZP A;  2CCZ A;  4HTH A;  1KDA A;  2K5H A;  1EYC A;  1Y8N B;  3MEH A;  3TRZ A;  4J15 A;  4Y7N H;  4JI6 Q;  4FF1 A;  4XIG S;  2NWG A;  3NTH A;  4DU9 A;  1UUP A;  2B2T A;  4DA2 A;  2WAQ G;  1Y1V B;  1VQ8 A;  2RQX A;  2B8G A;  4IN3 A;  1UWV A;  3PGZ A;  3ERQ A;  2D5D A;  4V19 0;  5ELE A;  1PTO F;  3EVQ A;  1CK1 A;  3G6E A;  4DNI A;  4E6I A;  1T9H A;  1HNW L;  1MJE A;  4KY5 A;  1KRS A;  1N33 L;  2I07 B;  4R4O A;  1SYF A;  1WTW A;  1QUQ B;  1V1Q A;  2EJM A;  4DXG A;  1X54 A;  3R8B A;  3CMA A;  1WTX A;  2Z4H A;  2FJ2 A;  4XQJ A;  4GZY C;  1II3 A;  4N9P A;  3HOW B;  1GUG A;  5JAV A;  2YU9 B;  1IBK L;  3E0E A;  1QG7 A;  4O0A A;  1TXY A;  3S16 H;  1EQQ A;  4LFA Q;  3CF5 A;  2GA4 B;  2HQE A;  5I6Y A;  4DAP A;  1VQN A;  3NSW A;  4JI2 Q;  1LTB D;  3PUY A;  5FO7 B;  1KAW A;  1L1O B;  2UUC Q;  4M1U B;  1VQO A;  2F0Q A;  3T1H L;  3S1Q H;  4GLV B;  1DON A;  2CHB D;  3EBE A;  2K5Q A;  1A3V A;  4QGU A;  2F0O A;  1BNZ A;  1HR0 Q;  3F2B A;  1EQT A;  4ZUI A;  2CWP A;  1Z9F A;  3HOV G;  1I4H A;  3I4M H;  3DM1 A;  4OWX B;  2AUJ D;  1EEI D;  4A3K H;  1OXT A;  3GTL B;  2PW5 A;  4JW0 A;  3H6M A;  4QMG A;  3MAQ A;  1XPR A;  4IPC A;  4DAY A;  5KNC A;  2L0C A;  3E9I A;  2JQO A;  3UDI A;  1QVG A;  2KCM A;  5GAH C;  1GVP A;  3QO2 A;  1Y69 U;  1Q1E A;  2ZXR A;  3W1B A;  2XWB B;  2PMZ B;  5EKI A;  4DR1 L;  3EIV A;  2L55 A;  4HN7 A;  3BVG A;  4APV A;  1Y8P B;  3WWV A;  4IUP A;  5I2Y A;  5DM7 3;  5J1Z A;  1EEF D;  4H02 A;  1XX8 A;  3GTO H;  2JA7 B;  2QEX A;  2CQA A;  2IY5 B;  4JYA L;  3I7F A;  3NBH A;  4LUZ A;  4WOR A;  5E1F A;  2JEB I;  4XT1 B;  2UXB Q;  3GTM H;  3NUC A;  3NTI A;  1YJ9 A;  2QW7 A;  1FJG L;  1SDF A;  4ZKB B;  2FHT A;  2VQE L;  3D8G A;  1CQV A;  2C5C A;  3NEM A;  4OIJ A;  3F2D A;  1DXM A;  1PRT C;  3PUZ A;  1I3Q H;  4A75 A;  1ESR A;  1QE6 A;  1VQ6 A;  3U58 A;  2JA5 H;  1GKH A;  5JVH 3;  1MBY A;  4QY7 A;  2A6H D;  1SNP A;  4C3H G;  5LMU Q;  1EFW A;  3J81 L;  2PW7 A;  2N3S A;  1BVS A;  3A5U A;  2F4V L;  4R8I A;  3SK6 A;  1WTO A;  5F2D A;  4O1N A;  1X6O A;  3FKI H;  3S1N B;  4DR2 L;  2UXD L;  2F0J A;  4I7Z C;  3C1E A;  4O2D A;  4ID6 A;  1B7Y B;  1QIL A;  1TWH H;  3V05 A;  4PZ6 A;  1EU3 A;  1YJW A;  2F3W A;  1KRT A;  3OYY A;  1PYW D;  2RDG A;  5KRU A;  5FLX L;  3NPP A;  2RSO A;  4ABN A;  4C3J H;  4JI7 Q;  1M90 C;  2GVA A;  3OTO L;  1EZ8 A;  4DR5 Q;  3PO3 G;  4CJ2 C;  1FVI A;  1ML0 D;  4CDF C;  1E2V A;  4P75 A;  1IKL A;  4GKJ Q;  4X65 Q;  2B2Y C;  1RTO A;  4P71 A;  1YI2 A;  2VUM G;  3CC4 A;  4JI5 Q;  2L15 A;  3T13 A;  3K5O A;  4YCW A;  3I4L A;  4A3J G;  1JWM D;  3L9A X;  1HZA A;  1PH4 A;  4A3D H;  3ICE A;  1N36 Q;  5JJL A;  1RJT A;  1CHP D;  1VF5 C;  2RBM A;  4LFB L;  2ZTD A;  2PQE A;  3TEH B;  2F0K A;  3GD7 A;  1QOH A;  3U4V A;  4LF4 Q;  2CFM A;  4DR7 L;  5GRO A;  4YY3 Q;  1SN8 A;  1GUS A;  4UAI A;  4DV2 L;  2F03 A;  3U4Z A;  4BA2 I;  1CM9 A;  2XRS D;  1EWI A;  4MNO A;  2Z6B A;  3BDL A;  4B3R L;  5AJ3 L;  3TRE A;  3AEV A;  4IJL A;  5JPM C;  4BBS H;  1O78 A;  1YIT A;  1PTO H;  5I2X A;  2NN6 I;  5JVG 3;  1PH2 A;  4FVM A;  4QB4 A;  2VXW A;  1YJN A;  2F1M A;  2K05 A;  3TS2 A;  4A3F H;  2UXC L;  1FNW A;  2F0W A;  1WYD A;  4H13 C;  2CH4 W;  3IRB A;  4DR4 L;  3J80 i;  1L0W A;  3OOC A;  1SNQ A;  4OO1 I;  1JT8 A;  2G9D A;  1UEB A;  4KY7 A;  4N9T A;  5CYU A;  2ALY B;  2KCN A;  4RFB A;  2AQ1 B;  1Y1W H;  4JI8 L;  1KIX A;  1MSG A;  2PQA A;  1TWG B;  4GNX B;  2N55 A;  2FXQ A;  2UUB L;  4WRD A;  3SK8 A;  5D14 A;  4ZLT F;  2JA6 G;  4DV3 L;  1VS0 A;  2B8F A;  1N8R C;  3NEN A;  4G7H C;  1NAP A;  5I9P A;  2B2V C;  4IOC A;  2K50 A;  2RDH A;  1N34 Q;  3TDQ A;  2Z8L A;  1SE3 A;  2ZXP A;  1W2B A;  4QQB X;  5FJ8 H;  1EY4 A;  4LUO A;  4M8A A;  3UI2 A;  1PFM A;  3KYH C;  4KK7 A;  5IP7 G;  1CA5 A;  1BKB A;  3E6Z X;  3KBX A;  4P73 A;  3CCL A;  3AU7 A;  3PF5 A;  3BYT B;  1PZJ D;  2R92 B;  1TS3 A;  1TS4 A;  4LF8 Q;  2E5L Q;  1J6Q A;  1KAB A;  1EY7 A;  1XNR L;  3OW2 A;  2D62 A;  2NZ1 D;  4BXX G;  5C3X A;  4XYO A;  1Q46 A;  3TS0 A;  1UE5 A;  4IUV A;  4UPA A;  2OT2 A;  5A2Q L;  4XYQ A;  1I50 H;  2KHI A;  1GHJ A;  2FFK B;  4C1N I;  3KFU A;  2PNR C;  1H9M A;  3S1M H;  1N33 Q;  3CCR A;  3GV6 A;  4HED A;  3K7A B;  1JC7 A;  1BBX C;  3FRP B;  4RAU C;  4CJ0 B;  5IYB G;  2PCF B;  1BO0 A;  1H9R A;  1IBK Q;  3G7L A;  1BCP C;  1STE A;  3AFQ A;  3A56 A;  4BBR H;  1HQR D;  4A3E G;  2JJQ A;  4JK1 C;  3D3R A;  2A19 A;  2NN6 G;  4KLK A;  4KHZ A;  3BG3 A;  2K52 A;  4GS3 A;  5NUC A;  1RL2 A;  4L5Q A;  3QOJ A;  2WV6 D;  2X6G A;  4A3M G;  4X66 Q;  3J81 E;  3T1H Q;  1PV4 A;  1BOS A;  3KF8 A;  1DM0 B;  1NMF A;  4CGY B;  1VQD A;  3VR3 A;  4HMJ A;  4LK1 C;  2JA7 H;  2UU9 L;  1YHQ A;  3UE1 A;  2DJG C;  4L8J A;  4HAE A;  3TBI B;  2F3V A;  2IHE A;  4J1M A;  1NNX A;  3B6Y A;  5C3W A;  1HA5 A;  2Z6K C;  4BY7 G;  3CCE A;  1I6H B;  3H0G B;  1LTA D;  5FLX E;  2R7F A;  2L12 A;  3CXC A;  3PCO B;  2K04 A;  4A3C H;  1RKN A;  4GOP B;  2WAQ E;  4A3G G;  1ENA A;  4JI1 Q;  3IFT A;  1BBU A;  5C0X H;  5IGE A;  1D7Q A;  1YZ6 A;  3HOZ B;  4DR1 Q;  1D6E C;  3OSO A;  1SE2 A;  1FGU A;  2EE1 A;  4IUU A;  1I94 L;  3TP5 A;  1S3O A;  1F2M A;  2R7Z B;  3RNU A;  4JYA Q;  4FDB A;  1LM0 A;  1WVL A;  1A2U A;  5JJZ A;  2ID0 A;  1STG A;  2H1E A;  3T16 A;  4AYB G;  1FGB D;  1SFO H;  1SJE D;  3AFP A;  4KD4 A;  4YCV A;  2KBN A;  2B2W A;  2AUK A;  2VQE Q;  1VQH A;  2UUA Q;  1GHK A;  3FMC A;  2OF1 A;  1M4V A;  1K0R A;  4QIW E;  1PA6 A;  4IFD H;  1IHZ A;  1S4Z A;  4OHJ A;  1BDO A;  2IHF A;  2FIN B;  1MI2 A;  4UP7 A;  3RZD B;  1Q7Y C;  2Q2T A;  3BJU A;  1V1P B;  4BY1 G;  2ENB A;  2JP1 A;  1DOL A;  4A3I G;  1SNM A;  3PO2 G;  3L7Z C;  4DR2 Q;  3H3V H;  1EOV A;  4FXG C;  4X62 L;  5C4Z A;  1XPO A;  3CME A;  1U4M A;  5CR3 A;  4NPS A;  1C9O A;  1Q3L A;  1ASZ A;  3BU2 A;  2RSN A;  4KHP L;  2IPK D;  4JI4 Q;  2EY5 A;  2A68 D;  2YYZ A;  1Z7T A;  4H44 C;  1I4P A;  2M2L A;  4K5X A;  1KLU D;  4ZQ3 A;  3OTO Q;  2Q8R E;  2NVQ B;  3NHH A;  4LF5 L;  3TZU A;  4DV7 L;  1Q12 A;  4GKK L;  3OMG A;  5H1S E;  2EIF A;  3QG1 A;  4OIK A;  4FF2 A;  3I4N B;  4RG1 A;  1TS5 A;  1F2L A;  1AE2 A;  2YTX A;  2K6A A;  4LUV A;  4QF4 A;  2F0U A;  2NVT H;  2RDF A;  1DOK A;  3VYR A;  3ULJ A;  3FVQ A;  1PTO D;  3TN2 A;  3I55 A;  3C1F A;  1OXV A;  3K8A A;  3KLS X;  4DR7 Q;  1B2T A;  4A4I A;  5FO8 B;  1S5B D;  4DV2 Q;  1DOM A;  1K8A C;  2D9U A;  4B3M L;  5CV6 A;  1CKM A;  3GO5 A;  5JOB A;  3TQY A;  4B3R Q;  5HY6 A;  1T5X D;  2EYH A;  2PZT A;  5M3M B;  3UDF A;  2MHV A;  1IW7 D;  4IPH A;  3K81 C;  2F0P A;  5M3F B;  3P75 A;  3DXJ C;  2L4N A;  4IUT A;  4POF A;  3SGI A;  1TWC H;  4UDU C;  1KL9 A;  5A2Q E;  4K8I A;  3J7A V;  2UXC Q;  1NR2 A;  2K33 A;  5KYI A;  3DM3 A;  4DK3 C;  4DR4 Q;  1E2Z A;  2MFI A;  4POG A;  2O5I C;  2DNE A;  4YHH L;  1LTG D;  2L11 A;  5M5Y B;  2HD3 A;  3CCV A;  3I4M G;  1EQV A;  1TWF B;  2MNA A;  4A3K G;  3GTK B;  4JI8 Q;  2E2I H;  4FP5 D;  2Q8T A;  1JWU D;  4KV6 A;  3RUZ A;  1PRT D;  4DV3 Q;  2MO0 A;  2BOS A;  2F0I A;  3W2D A;  4DNR B;  4FYD A;  1PH3 A;  1PH9 A;  2KED A;  2CWA A;  1WTR A;  1I4Q A;  2V4D A;  1MSH A;  3U9O A;  2K14 A;  4RA8 A;  5J3B A;  3A0J A;  4LF9 L;  5JJK A;  1S5C D;  2F4I A;  1ASY A;  1HJP A;  3I90 A;  3L0O A;  4DR3 L;  2PI2 A;  3K7A H;  1Q1B A;  2CW0 D;  2EPB A;  2I5H A;  4MZ9 A;  5DEH A;  3HOV B;  1W3S A;  5EAY A;  3BZD B;  2QGQ A;  3M3Y B;  1STB A;  5EKL A;  1IL8 A;  3PIO 3;  2HHH L;  2MGS A;  4ILW A;  1KDB A;  5JPN C;  2ES2 A;  1Z47 A;  2F0G A;  1VQI A;  1IXR A;  3MA2 B;  3OMC A;  2JA5 G;  3J81 i;  3P20 A;  2LKV A;  3TP8 A;  2JE6 I;  5D65 A;  1RIP A;  1EYA A;  2WB1 G;  4WJ4 A;  1H9K A;  1G6Z A;  1SRO A;  3FKI G;  3DMU A;  4DK0 A;  3H0G H;  4HCS A;  2N8N A;  3Q22 A;  1JOQ A;  3R2T A;  1VQP A;  1OXS C;  2EXZ A;  4IPG A;  1IYJ B;  1CT1 D;  1F9P A;  1O80 A;  1EYD A;  4C3J G;  1PZK D;  2A6E D;  4HJA A;  2PNH A;  4N8X 1;  3S15 B;  2R6G A;  2F0H A;  4HR7 B;  4RGT A;  1RCV D;  1HUN A;  4DV5 L;  4I7A A;  1UE7 A;  3MXN B;  3HOZ H;  4MHE A;  2B2T C;  2A68 C;  3MEF A;  1HA6 A;  3PF4 A;  2F0E A;  4P2C B;  3J81 j;  1FR3 A;  1TY0 A;  1KHI A;  1ZKO A;  3PIO A;  2H4O A;  2R7Z H;  1A3T A;  4A3D G;  2WKC A;  2OCE A;  4YWK A;  4CKB A;  4JV5 Q;  3HZX A;  3T1Y L;  3I73 A;  4XQN A;  5IT9 L;  3IL8 A;  1KLG D;  2KHJ A;  2K7V A;  3VDY A;  4MTN A;  3OWF A;  2B29 A;  3GV3 A;  2EYM A;  2JXM B;  3MFG A;  1PTO C;  5J22 A;  2DUD A;  1O7Z A;  4BBS G;  2NUC A;  1SYE A;  4F8M A;  4ZRZ A;  3SXH A;  4LNQ A;  3PO3 B;  4J6H A;  4X3U A;  3RZD H;  2F0V A;  2AQ3 B;  5IOC A;  3CCU A;  2R7D A;  1B9N A;  1VMP A;  1YNX A;  5D3I B;  4A3F G;  4EQP A;  1I94 Q;  4IOA A;  2VUM B;  1IW7 C;  1FNV A;  3X3M A;  1D8L A;  4A3J B;  3CD6 A;  1VQG A;  1MKH A;  2O4X A;  3M7G A;  1J5E L;  3KJO A;  2RVL A;  1NE3 A;  1QUQ A;  5BR8 Q;  1MHW C;  4A3L H;  1Y1W G;  1PFS A;  2QIL A;  5GQO A;  2KCT A;  1VF7 A;  3FP9 A;  1ENF A;  1ET9 A;  1EY6 A;  1XPU A;  1LO5 D;  3FHW A;  3HS0 C;  5BN4 A;  2KJX A;  4DNT B;  5C44 B;  2E2J B;  3AB9 A;  1K0S A;  1K8O A;  2MUY A;  2OQK A;  2LS0 1;  1L1O A;  1SMX A;  1F77 A;  2F0T A;  3D6C A;  1S5D D;  4LMQ D;  5FJ8 G;  1DJR D;  2BDN A;  1QVF A;  1IYU A;  3NWT A;  1SE8 A;  4DPG A;  1IBM L;  4HCE A;  1K83 H;  2Y0S G;  4RKB A;  4X62 Q;  3Q24 A;  1O7Y A;  3RR5 A;  1TR5 A;  2BH2 A;  1LTR D;  1R4P B;  4RGM A;  1GM5 A;  3UE0 A;  4KHP Q;  5G3L D;  2EYO A;  4G7Z C;  1UAP A;  5FK9 C;  1NUC A;  1V43 A;  1B1Z A;  1BCP D;  1AW7 A;  1UNS A;  3J81 c;  5M3M H;  3BVM A;  5JEA H;  1CZG A;  4AH6 A;  2N88 A;  3ONA B;  4OEM B;  2VQF L;  2K28 A;  1BBW A;  5M3F H;  2F3I A;  4LF5 Q;  1L0X B;  2CW0 C;  4DV7 Q;  3RLO A;  5FO9 B;  2JA6 B;  4GKK Q;  1CSP A;  4FF4 A;  4X64 Q;  1V8Q A;  4DV4 L;  4JI0 Q;  3EA6 A;  2HDL A;  5M5W B;  3NWS A;  4DR6 L;  3HOY B;  5KIX A;  3J7A F;  5FLX c;  4A93 H;  1EWH A;  1DZ1 A;  4PG3 A;  1W6K A;  2V1C C;  4ZAI A;  4HMI A;  4L5R C;  1AH9 A;  2NVY H;  1GOZ A;  5M5Y H;  1WCM G;  4AYB E;  1AZQ A;  2HCI A;  2JA9 A;  3GTK H;  3HKZ G;  1S5E D;  5FKA C;  4O42 A;  2DGY A;  3T53 B;  2CQO A;  1NY4 A;  2WP8 J;  3CRL C;  4QJF A;  5CV7 A;  4BBR G;  1ET6 A;  2EY6 A;  4DUZ L;  4KI0 A;  3KLW A;  3TME A;  3CW2 C;  1H9S B;  3CQZ H;  5CV8 A;  4Z9C B;  3GTP B;  2H5X A;  4R4Q A;  1HNX L;  2R93 G;  1O7I A;  2A6E C;  4X3T A;  4XXE A;  3P7J A;  4R4I A;  1B9M A;  3M4P A;  3KDF B;  4BA1 I;  1PMR A;  4TQU S;  1OXX K;  1SYG A;  2KA7 A;  2JA7 G;  1SR3 A;  3GDE A;  3PV0 A;  1HZB A;  4IJH A;  3UDX A;  4YHH Q;  3SR1 A;  1OXU A;  2QDL A;  3HOV H;  1Q8I A;  3MTS A;  4KY6 A;  5GAD C;  1IBL L;  2E2H B;  1PFN A;  3M3Y H;  5K36 H;  4K6L A;  1IL2 A;  4DAV A;  1VQ5 A;  1R9T B;  5IWA L;  4H7B A;  1EY0 A;  4A3C G;  1HHV A;  1JR0 D;  3S2D B;  1JE5 A;  1STN A;  1ILP A;  4KMU C;  2WAC A;  2KOL A;  1QNU A;  4A3E B;  1K73 C;  2HQL A;  5C0X G;  2MP1 A;  1CFM A;  1N9W A;  1X3P A;  1Y1V H;  1EIF A;  1IZ6 A;  2LSS A;  1XTC D;  4LF9 Q;  1RD9 D;  4A3M B;  3MXP A;  1JCK B;  1SNC A;  1STH A;  1X3Q A;  3JAM E;  1TII D;  3CC7 A;  5ELO A;  1NJI C;  4AQY L;  5IT9 E;  4IUR A;  3BZK A;  1FD7 D;  3CKI B;  1HNZ L;  1C0A A;  2Z9H A;  4JC0 A;  3S15 H;  5CV4 A;  1E24 A;  5D3D A;  2NBF A;  3A8J E;  4B3T L;  2HHH Q;  3HFZ B;  3HOW H;  1YEZ A;  1HXY D;  1S72 A;  1LTL A;  5CV5 A;  2YU9 H;  2F0F A;  2IX0 A;  1E7Z A;  1A0I A;  3OWE B;  1Q82 C;  3RN2 A;  2YV5 A;  4A3G B;  1KC8 C;  3CCQ A;  4KKU A;  4G4K A;  1ZYR C;  4JPB W;  4UHV A;  4R8N A;  1CQF A;  3D6W A;  2BH8 A;  4L5S A;  5IOD A;  2M9V A;  2R3Z A;  2X69 A;  2Q2H A;  3ULP A;  1NCV A;  2JA8 B;  1GUW A;  2WIN B;  3L2P A;  3KOJ A;  3UDG A;  3QWN A;  3ND9 A;  1E22 A;  2A74 C;  4GN3 B;  1JB3 A;  4JVZ A;  4CJ1 B;  3S9W A;  4GNX A;  3LNN A;  2Q8I B;  3OIQ A;  1HNW Q;  1LLR D;  1A6X A;  3W5O A;  3GTL H;  5EPK A;  2ICE C;  2E75 C;  2IT1 A;  1CI3 M;  1U9R A;  3DHQ A;  1F2Y A;  2BE5 D;  5DNF A;  5M9O A;  3PO3 H;  3V2T A;  1CTM A;  1WTP A;  1D5M C;  2E2D C;  3HGB A;  5LMN L;  2SDF A;  2ZT9 C;  4K2L A;  5AFW A;  3KBG A;  3VA5 A;  4DXF A;  4A3J H;  3R93 A;  3ER0 A;  2CKZ B;  3T1Y Q;  1EZ6 A;  4BY1 B;  3HKS A;  5C4X B;  4A3I B;  1JJ2 A;  1R4Q B;  3GTG B;  2ZJQ A;  4S3S A;  1JQY D;  3DEP A;  2KQ3 A;  3D4R A;  3FEW X;  3CPF A;  1TQO A;  5LMN W;  5C44 H;  1MIU A;  2E2J H;  3LWE A;  2C9O A;  1VQB A;  5E3F A;  5IGD A;  3S14 B;  2ICI A;  2BCO A;  4QL5 A;  4Y7N B;  4JI2 L;  2A69 D;  3TSS A;  3MZ5 A;  1Q86 C;  5C4H A;  3SK4 A;  3D4D A;  2WB1 E;  3SVM A;  1A3U A;  1HZC A;  4K5V A;  1KD1 C;  1C7Y A;  1G29 1;  4K14 A;  1HR0 L;  3HOU B;  1J5E Q;  3ZJY C;  3S1N H;  4JBM A;  3KLR A;  4UP8 A;  2K32 A;  4LF6 L;  1N32 L;  3FPU B;  4Y52 H;  4RWS C;  2MO1 A;  4ULL A;  3NTK A;  1I4R A;  4CKE A;  2L9H A;  1VQ9 A;  1LTS D;  5C3E G;  3QR8 A;  1FJG Q;  1XMO L;  1WTH A;  5M5W H;  1HUM A;  4TVA B;  3HOY H;  3S16 B;  4LW1 A;  3NEL A;  1VDZ A;  2K5W A;  3SK5 A;  1IBM Q;  1G6P A;  2SOB A;  4FF3 A;  1GXD C;  2TSS A;  5LHY 1;  1KNE A;  4P72 A;  2DY7 A;  2F4V Q;  1WOC A;  4C3I B;  3J7Y W;  4R1J A;  1HZ9 A;  1K3R A;  2D0O A;  1A62 A;  1X65 A;  3D0F A;  1LTT D;  1GO3 E;  1HRJ A;  2UXD Q;  2YTV A;  2B2W C;  1V1O A;  2VQF Q;  2GN5 A;  1SSO A;  3ERO A;  1CSQ A;  4GOP A;  3CRK C;  3Q23 A;  1K8M A;  1XYI A;  3ERS X;  1CKN B;  4NW2 A;  1NBW A;  2MJ8 A;  3K5M A;  3OW7 A;  4DKA C;  2M00 A;  1C48 A;  4DR6 Q;  1RHP A;  1B44 D;  2QEJ C;  3HRZ C;  2EY1 A;  3J7A 5;  2EXD A;  4KN7 C;  4NKL A;  2C35 B;  1QZH A;  2B63 B;  4RCN A;  3H0G G;  2B3G A;  2E2H H;  4FXD A;  3GTO B;  4CDC C;  1O7L A;  2NYZ D;  4JI3 L;  3S17 B;  1R9T H;  4EVO A;  4A3B B;  4LFB Q;  3S2D H;  1A15 A;  2SNS A;  1TWG H;  4OEL B;  1PH6 A;  5ELN A;  4J8Q A;  1HPC A;  3GTM B;  1EIY B;  4XQQ A;  4WJ3 M;  5IGB A;  3V96 A;  1X32 A;  4DUZ Q;  5A35 A;  3HOZ G;  3M4Y A;  4DR5 L;  1X3F A;  1QCB D;  5AJ3 Q;  5I6W A;  1ICW A;  4KN4 C;  3HOX B;  4EQ5 A;  3L3O C;  1K3B C;  2Y0S E;  4JOI A;  2Z4I A;  1V1P A;  2JA5 B;  2WKD A;  2R61 A;  2VL6 A;  2BE5 C;  4F88 A;  1I4X A;  5IYD H;  5CV9 A;  5CC4 A;  2F0M A;  3I91 A;  4K0K L;  4OO1 H;  2QDB A;  1UE6 A;  1JIC A;  2WAQ B;  4XT3 B;  4OWW B;  3FKI B;  2B2U A;  3LGJ A;  4GN4 B;  3TP7 A;  1IBL Q;  4R4C A;  4YY3 L;  2R92 H;  1SYD A;  4LJZ C;  2DY8 A;  3CCJ A;  1VQE A;  2UUB Q;  4QUC A;  2ZM6 L;  4GLA C;  5K5P A;  2N49 A;  3NBI A;  3O13 A;  4NB3 A;  3R2I A;  5KYL A;  4ALP A;  4R4T A;  3TP6 A;  2D2C C;  3CP0 A;  4JG2 A;  3F8T A;  2OXP A;  5FLM H;  3HKZ E;  1SLJ A;  1TU2 B;  2ZJR A;  2JA8 H;  3GTQ B;  5KEE A;  3BYY B;  2A69 C;  4HJ5 A;  3N52 A;  4A3D B;  5IY0 A;  1PZI D;  2E8G A;  1U5K A;  1SXT A;  4A3L G;  4FNF A;  1ESF A;  1B3Q A;  4QIW B;  1HNZ Q;  1BQQ T;  1HH2 P;  1H9J A;  1JOK A;  3PMF A;  4RH6 A;  4PMW A;  2K1B A;  3PQI A;  2IX1 A;  4NXN L;  4B3T Q;  2NVX B;  3M4O B;  2RKS A;  1YVC A;  1XWE A;  5BN3 A;  3CPW A;  1XNR Q;  2XN9 C;  2IW3 A;  2KUM A;  3Q0A A;  4BBS B;  4RKL A;  4KJN A;  5HUR A;  1PTO B;  2ZTC A;  2HUG A;  3RD4 A;  1WTQ A;  1D5X C;  4ZKC B;  1C8C A;  5C4X H;  2Z0S A;  5L37 A;  5LL6 S;  3VA7 A;  1GUT A;  4A3F B;  2BA0 A;  2EYP A;  4HIO A;  3GTG H;  3CAM A;  1MD2 D;  3J80 E;  4K6D A;  5I4D A;  3CU7 A;  4ZUJ A;  2VW9 A;  1KNA A;  4OON A;  2HIX A;  1DCZ A;  2RHS B;  4ODG A;  2J7Z A;  3MXG A;  3SEB A;  5FOB B;  5M3M G;  2RCN A;  1I6H H;  5JEA G;  1Y8O B;  4WFN 3;  1SBB B;  1X3G A;  1Y1W B;  5M3F G;  3NXW A;  3S14 H;  1CHQ D;  3A8K E;  5DAU A;  2G5D A;  3M7N A;  2CH4 A;  2SEB D;  2IWH A;  3RMH A;  4G57 A;  2AKW B;  3BDC A;  4GLX A;  1TWA B;  1PYB A;  4DAY B;  5COY A;  3WOF A;  2B39 A;  5LMN Q;  4DV6 L;  3K59 A;  4N8F A;  3U9S A;  3VYS A;  4DGZ A;  2EDG A;  3KLS A;  3S1R B;  1PYS B;  4A93 G;  4NXM L;  3HOU H;  4TRD A;  4EQN A;  3PIP 3;  1Y14 B;  1P8L A;  1TY2 A;  2XRQ D;  1PRT B;  2BDO A;  2Y0S B;  1U0L A;  2JYO A;  1I6V C;  3MC0 B;  4C3H B;  1UE1 A;  5ELF A;  4DK1 A;  1PHJ A;  2UU9 Q;  1H95 A;  4B9X A;  4IAL A;  3LX0 A;  5EGT A;  1QVC A;  3I3C A;  3K80 C;  3JAM L;  5M5X B;  2EJF C;  4RHS A;  1VQM A;  4DK6 C;  4JCV E;  1G8Z D;  3K6O A;  3K58 A;  1VMC A;  3NBH B;  3DWP A;  1ZEQ X;  2EYF A;  3MVV A;  2MPM A;  1B50 A;  3JAM c;  2WFW A;  5T1I A;  3CCS A;  1EIH A;  4F87 A;  1GUO A;  5IT9 c;  1RF2 D;  2BA1 A;  1U4P A;  3T51 B;  1X9N A;  3AMU A;  1XJV A;  2RA4 A;  1LUZ A;  4X66 L;  3D31 A;  4NP5 A;  5EBC A;  1DGS A;  4XTC S;  4RCO A;  4C3I H;  5IGG A;  1I50 B;  2ZJP A;  2ZTE A;  2JSO A;  3DWA A;  1YHA A;  3Q6S A;  1FL0 A;  4KJO A;  2I5L X;  1WCM B;  4LF6 Q;  3VR5 A;  1VQJ A;  2K5V A;  3S1M B;  1N32 Q;  2X6L A;  1PRT F;  5KNB A;  3HKZ B;  5LL6 X;  4UY8 C;  4EQO A;  2VZA A;  5K36 G;  3PIP A;  1LT3 D;  2OTJ A;  3EJI A;  3I2Z A;  4YWL A;  1B4O A;  2EVB A;  2N78 A;  5C6A A;  2XNA C;  1XMO Q;  4X6A H;  1F9S A;  3MXN A;  5I9O A;  3A7L A;  4BBR B;  2NVQ H;  4LF7 L;  4JI1 L;  1LAB A;  1ZYR D; 
#chains in the Genus database with same CATH homology
 1EIF A;  1IZ6 A;  3PUV A;  2LSS A;  4OWT B;  4DV0 Q;  1YBY A;  4FDB A;  1LM0 A;  2K75 A;  3RNU A;  4LF9 Q;  4JYA Q;  5C3E H;  1K9M C;  2ID0 A;  3RLF A;  1X3E A;  1Y1V G;  2K5N A;  1B8A A;  4AYB G;  3I4N H;  2PMZ E;  3RZO H;  2B63 H;  2VNU D;  3CC7 A;  5ELO A;  1SFO H;  3AFP A;  4YCV A;  5IP9 H;  5JEA J;  2KBN A;  4AQY L;  1NJI C;  4IPD A;  3BZK A;  3I4N G;  1VQA A;  5C0X I;  2I5M X;  1VQH A;  2VQE Q;  2B63 G;  1HNZ L;  5IYC H;  1C0A A;  2UUA Q;  3S17 H;  5IP9 G;  1PH1 A;  4JC0 A;  3S15 H;  4LFC L;  3A5Z B;  4A3B H;  3G71 A;  1PH8 A;  3STB C;  1E24 A;  1OTC A;  1N34 L;  4B3T L;  1K0R A;  5IYC G;  4QIW E;  2VY3 A;  3HFZ B;  2HHH Q;  4HJ8 A;  1PA6 A;  3HOW H;  1YEZ A;  4A3B G;  3PUX A;  1S72 A;  1LTL A;  2YU9 H;  4BY1 H;  4DUY L;  2IX0 A;  4A3I H;  1E7Z A;  3PO2 H;  1A0I A;  1Q82 C;  2IHF A;  3RN2 A;  3HOW G;  2YV5 A;  4UP7 A;  2Q2T A;  1Q7Y C;  3BJU A;  3CD6 A;  4BY1 G;  1KC8 C;  3CCQ A;  1PH7 A;  2OTL A;  2UUA L;  5DLQ E;  4A3I G;  3HOX H;  3PO2 G;  3L7Z C;  4DR2 Q;  3H3V H;  1EOV A;  2K4K A;  4LWC A;  4X62 L;  1XPO A;  4YWM A;  3CME A;  1L1O C;  3KJP A;  4NPS A;  1C9O A;  2OWO A;  2XGT A;  3Q8D A;  4LF8 L;  4B3S Q;  3HOX G;  1ASZ A;  3BU2 A;  2E5L L;  2BH8 A;  4L5S A;  2CCZ A;  4KHP L;  4JI4 Q;  2K5H A;  2D0P A;  2Q2H A;  3ULP A;  1AE3 A;  2YYZ A;  3TRZ A;  4J15 A;  3L2P A;  3KOJ A;  4Y7N H;  3UDG A;  2NZH A;  4JI6 Q;  4XIG S;  1E22 A;  1YIJ A;  4IFD I;  4GN3 B;  4GNX A;  2AWO A;  1HNW Q;  3OTO Q;  1XMQ L;  1EUJ A;  2LXJ A;  2WAQ G;  4LF5 L;  3BZC A;  1VQ8 A;  3W5O A;  4JI3 Q;  3GTL H;  4DV7 L;  1Q12 A;  4GKK L;  2IT1 A;  5H1S E;  1UWV A;  3PGZ A;  1TWF H;  2EIF A;  4JI4 L;  3H3V I;  4RG1 A;  4DV1 L;  3PO3 H;  3G6E A;  1AE2 A;  2YTX A;  4DNI A;  4LUV A;  1T9H A;  4B3M Q;  1HNW L;  1JJG A;  1VQF A;  4JBW A;  5LMN L;  1MJE A;  1KRS A;  1N33 L;  2NVT H;  2PQA B;  2QA4 A;  3G4S A;  4R4O A;  1QUQ B;  4OX9 L;  1V1Q A;  3ULJ A;  1P16 A;  1X54 A;  3CMA A;  2GVB A;  3F2C A;  4A3J H;  3I55 A;  3ER0 A;  1OXV A;  3K8A A;  4DR7 Q;  2CKZ B;  3H15 A;  4A4I A;  3T1Y Q;  1IBK L;  4DV2 Q;  3E0E A;  3GTQ H;  3HKS A;  4O0A A;  1TXY A;  1K8A C;  3CCM A;  1JJ2 A;  3S16 H;  4K0K Q;  1EQQ A;  4LFA Q;  1WFQ A;  3CF5 A;  4B3M L;  1XNQ L;  1CKM A;  2ZJQ A;  3GO5 A;  1VQN A;  3TQY A;  4B3R Q;  4JI2 Q;  5HY6 A;  3UDF A;  3PUY A;  4HJ7 A;  4IPH A;  1KAW A;  3CPF A;  1L1O B;  3K81 C;  5C44 H;  1MIU A;  5LMN W;  2E2J H;  1VQO A;  2UUC Q;  2A8V A;  3T1H L;  3S1Q H;  1VQB A;  4GLV B;  4POF A;  3M4Q A;  3EBE A;  3SGI A;  2NVX H;  4P74 A;  3M4O H;  4QGU A;  1TWC H;  1M1K C;  1KL9 A;  5C44 G;  3I56 A;  4JBJ A;  3F2B A;  1HR0 Q;  2UXC Q;  4QL5 A;  3DM3 A;  4DK3 C;  1Q86 C;  2CWP A;  4JI2 L;  2ZM6 Q;  4DR4 Q;  1Z9F A;  3HOV G;  2JK8 A;  2WB1 E;  4RMF A;  3I4M H;  2MFI A;  4OWX B;  4A3K H;  1OXT A;  4POG A;  1HZC A;  4YHH L;  1XPR A;  1KD1 C;  1C7Y A;  4IPC A;  4HIM A;  1G29 1;  2RF4 A;  3CCV A;  3I4M G;  2MNA A;  4A3K G;  1VQL A;  3E9I A;  1HR0 L;  4JI8 Q;  2E2I H;  1J5E Q;  3F1Z A;  4HIK A;  3ZJY C;  1E1O A;  1JMC A;  2JQO A;  3S1N H;  4UP9 A;  3UDI A;  2KCM A;  1QVG A;  4JBM A;  1Q8K A;  4UP8 A;  5GAH C;  4LF6 L;  4DV3 Q;  1GVP A;  2MO0 A;  1PH5 A;  1N32 L;  4Y52 H;  1Q1E A;  2MO1 A;  3W1B A;  1PH3 A;  1PH9 A;  4DR1 L;  3EIV A;  1XTD A;  4DR3 Q;  4APV A;  2CWA A;  1VQ9 A;  3WWV A;  4NXN Q;  5C3E G;  3K0X A;  1FJG Q;  1X55 A;  3M9B A;  4H02 A;  1XMO L;  5M5W H;  2K14 A;  3J7Z C;  1TWA H;  3GTO H;  4TVA B;  3HOY H;  5J3B A;  4LW1 A;  2QEX A;  3NEL A;  3A0J A;  2Q2U A;  2IY5 B;  4DV0 L;  4LF9 L;  4JYA L;  5JJK A;  3I7F A;  1ASY A;  1IBM Q;  5GAE C;  1HJP A;  1VQK A;  3L0O A;  4DR3 L;  3HOY G;  4LUZ A;  1G6P A;  2JEB I;  2PI2 A;  3K7A H;  3S1R H;  2UXB Q;  3GTM H;  1Q1B A;  1YJ9 A;  1FJG L;  2I5H A;  4MZ9 A;  3KDF A;  4P72 A;  2A1A A;  2F4V Q;  1WOC A;  1YHB A;  2VQE L;  4IFD G;  1W3S A;  4R1J A;  3NEM A;  1HZ9 A;  2ATW A;  1K3R A;  2D0O A;  1A62 A;  5EAY A;  3F2D A;  3RLN A;  3PUZ A;  1X65 A;  2QGQ A;  1I3Q H;  1LYL A;  3D0F A;  4A75 A;  4C3H H;  1GO3 E;  1VQ6 A;  3U58 A;  2UXD Q;  2YTV A;  3KF8 B;  3KF6 B;  2HHH L;  1GKH A;  2JA5 H;  4QY7 A;  2VQF Q;  1E3P A;  2ES2 A;  1Z47 A;  2GN5 A;  5M5X H;  5LMU Q;  1EFW A;  1CSQ A;  1VQI A;  4GOP A;  3A74 A;  1IXR A;  2N3S A;  1BVS A;  3A5U A;  2F4V L;  2JA5 G;  3J81 i;  3ERS X;  1CKN B;  3U50 C;  1NBW A;  1I5F A;  4DKA C;  2JE6 I;  1X6O A;  3FKI H;  1RIP A;  4DR2 L;  3RN5 A;  2UXD L;  1GD7 A;  4DR6 Q;  2LXK A;  2WB1 G;  4WJ4 A;  4YCU A;  2AHO B;  1SRO A;  1EQR A;  3FKI G;  4O2D A;  1B7Y B;  4B3S L;  3J7A 5;  1TWH H;  4DV6 Q;  4PZ6 A;  2EXD A;  2EQS A;  1YJW A;  1KRT A;  3OYY A;  4DV5 Q;  3H0G H;  4IO9 A;  1QZH A;  2C35 B;  2N8N A;  4JI6 L;  4C3J H;  4NXM Q;  4JI7 Q;  5HGQ A;  1VQP A;  1OXS C;  4PZ8 A;  4IPG A;  1M90 C;  2GVA A;  1IYJ B;  2B3G A;  1V9P A;  3H0G G;  3PUW A;  3OTO L;  2E2H H;  1B70 B;  4DR5 Q;  3PO3 G;  2VUM H;  1FVI A;  4JI3 L;  1VCI A;  4HJA A;  2PNH A;  1WCM H;  4P75 A;  1R9T H;  4GKJ Q;  4X65 Q;  1QZG A;  2R6G A;  4LFB Q;  4P71 A;  1YI2 A;  3S2D H;  4DV5 L;  2VUM G;  3CC4 A;  4JI5 Q;  1TWG H;  1UE7 A;  2L15 A;  3MXN B;  5ELN A;  1E1T A;  4EX5 A;  4GNX C;  3MEF A;  1PH6 A;  3HOZ H;  3S24 A;  1L2F A;  1MJC A;  1EIY B;  4YCW A;  4WJ3 M;  3PF4 A;  4A3J G;  3J81 j;  4DUZ Q;  1HZA A;  1PH4 A;  2XTI A;  3HOZ G;  1N36 Q;  3ICE A;  4DR5 L;  1X3F A;  2Z6K A;  2AWN A;  1KHI A;  4A3D H;  5JJL A;  3PIO A;  5AJ3 Q;  5C0X J;  2R7Z H;  4EQ5 A;  4HJ9 A;  4LFB L;  2ZTD A;  4A3D G;  2Y0S E;  2OCE A;  1WI5 A;  4JOI A;  3TEH B;  1H95 A;  3GD7 A;  4YWK A;  3U4V A;  4LF4 Q;  2CFM A;  4JV5 Q;  4DR7 L;  5GRO A;  4YY3 Q;  1SN8 A;  3S2H H;  3T1Y L;  3CC2 A;  2VL6 A;  4DV2 L;  5IYD H;  1A63 A;  3U4Z A;  4A76 A;  2R93 H;  4BA2 I;  3K7U C;  4K0K L;  1EWI A;  4LFA L;  1JB7 A;  4MNO A;  1UE6 A;  2KHJ A;  3KF6 A;  5IYD G;  4B3R L;  5AJ3 L;  3VDY A;  3AQQ A;  4MTN A;  3TRE A;  4OWW B;  2B29 A;  2MQH A;  3AEV A;  2ASB A;  4IJL A;  4OO1 G;  3LGJ A;  4GN4 B;  4BBS H;  1IBL Q;  2PI2 E;  1YIT A;  2UUC L;  2HT1 A;  4JV5 L;  1NMG A;  4R4C A;  2NN6 I;  4C2M H;  4YY3 L;  2R92 H;  2DUD A;  1PH2 A;  4BBS G;  5C4J H;  1YJN A;  3TS2 A;  3CCJ A;  3I4O A;  4A3F H;  2UXC L;  2R92 G;  4LNQ A;  1VQE A;  1WYD A;  2UUB Q;  3RZD H;  2ZM6 L;  3IRB A;  4DR4 L;  4GLA C;  4GN5 A;  3CCU A;  2R7D A;  3J80 i;  1YNX A;  1L0W A;  4A3F G;  4IFD J;  3AYH B;  2N49 A;  5E7N A;  1I94 Q;  4IOA A;  4OO1 I;  5JJI A;  1JT8 A;  2AMC B;  1UEB A;  4NB3 A;  4LF7 Q;  5GAG C;  3STB D;  4ALP A;  1D8L A;  2ALY B;  4R4T A;  1PVO A;  3J80 c;  3CP0 A;  4JG2 A;  1VQG A;  4OXP A;  3F8T A;  2JA6 H;  1Y1W H;  4JI8 L;  1MKH A;  1KIX A;  2PQA A;  4GNX B;  1J5E L;  5FLM H;  2FXQ A;  1SLJ A;  3HKZ E;  3KJO A;  2ZJR A;  2UUB L;  1NE3 A;  1QUQ A;  5BR8 Q;  2JA8 H;  4A3L H;  4HJ5 A;  2JA6 G;  1Y1W G;  1HR0 W;  4DV3 L;  1PFS A;  1VS0 A;  5GQO A;  5IY0 A;  5FLM G;  2E8G A;  3NEN A;  1U5K A;  2KCT A;  3FP9 A;  1N8R C;  2JA8 G;  4A3L G;  1HNZ Q;  1XPU A;  3FHW A;  2VS1 A;  1HH2 P;  2I0Q A;  4LFC Q;  1KQS A;  4IOC A;  2K50 A;  4PMW A;  1N34 Q;  2IX1 A;  1VQ4 A;  4NXN L;  4B3T Q;  2YTY A;  1W2B A;  4QQB X;  5FJ8 H;  5BR8 L;  5IP7 H;  4LUO A;  2OQK A;  4DUY Q;  1L1O A;  1SMX A;  1YVC A;  3PSI A;  3CPW A;  3KYH C;  1XNR Q;  5FJ8 G;  1NTG A;  1QVF A;  5IP7 G;  4KHP Q;  1SE8 A;  4DPG A;  1VQ7 A;  4L5T A;  1IBM L;  1BKB A;  1K83 H;  4P73 A;  3CCL A;  3PF5 A;  2Y0S G;  2UXB L;  2ZTC A;  3ULL A;  4X62 Q;  3RR5 A;  4LF8 Q;  3DLL A;  2E5L Q;  4BXX H;  2BH2 A;  5C4X H;  1J6Q A;  1A8V A;  2Z0S A;  3G48 A;  3UE0 A;  1CUK A;  5IE8 A;  1GM5 A;  4DAM A;  1XNR L;  2BA0 A;  3GTP H;  3OW2 A;  4HIO A;  2D62 A;  4DV4 Q;  3GTG H;  1V43 A;  1SRU A;  3CAM A;  4BXX G;  3J81 c;  5M3M H;  2VW9 A;  5C4X G;  1Q46 A;  2KEN A;  4OON A;  2HIX A;  4AH6 A;  3TS0 A;  3GTJ H;  1UE5 A;  2RHS B;  2VQF L;  1BBW A;  5LMU L;  5M3F H;  2F3I A;  1XMQ Q;  3JC6 6;  4LF5 Q;  5M3M G;  2RCN A;  4HID A;  5JEA G;  1I6H H;  4DV7 Q;  1S40 A;  3RLO A;  1EYG A;  4UPA A;  4GKK Q;  1CSP A;  1X3G A;  5M3F G;  3S14 H;  4X64 Q;  1I50 H;  4DV4 L;  4JI0 Q;  2KHI A;  4DV1 Q;  3M7N A;  2F52 A;  2AKW B;  4GLX A;  4GOP C;  4DR6 L;  1PYB A;  3KFU A;  4DAY B;  5FLX c;  4A93 H;  5LMN Q;  4DV6 L;  3S1M H;  4PG3 A;  2V1C C;  1N33 Q;  5IYB H;  3CCR A;  4JBK A;  4L5R C;  1AH9 A;  4OX9 Q;  2NVY H;  5M5Y H;  1WCM G;  4AYB E;  1PYS B;  4A93 G;  4NXM L;  4X64 L;  4A3E H;  2JA9 A;  5IYB G;  4JI7 L;  3HKZ G;  4JI0 L;  3GTK H;  3HOU H;  1Q81 C;  3W1G A;  2JEA I;  1Y14 B;  1IBK Q;  1P8L A;  3AFQ A;  4AIM A;  1JJC B;  2DGY A;  4BBR H;  4A3E G;  3HOU G;  1U0L A;  2JJQ A;  4X65 L;  1HNX Q;  2CQO A;  1XNQ Q;  1NY4 A;  2WP8 J;  4GKJ L;  2A19 A;  1UE1 A;  1PHJ A;  2UU9 Q;  2NN6 G;  4KLK A;  1G51 A;  4KHZ A;  4A3M H;  2K52 A;  1VQC A;  4QJF A;  4JI5 L;  4GS3 A;  2NZO A;  1RL2 A;  4L5Q A;  1QVC A;  4BBR G;  3K80 C;  2R7Z G;  3JAM i;  4A3M G;  4DK6 C;  4X66 Q;  4JCV E;  3M85 A;  3T1H Q;  1VQM A;  1PV4 A;  4DUZ L;  2Q2I A;  4KI0 A;  1NMF A;  1N36 L;  2RHQ B;  3KLW A;  3NBH B;  1VQD A;  3CW2 C;  3CQZ H;  2H5X A;  4R4Q A;  1HNX L;  2R93 G;  1O7I A;  3E9H A;  2JA7 H;  3JAM c;  4BY7 H;  2UU9 L;  2HIV A;  1YHQ A;  2WFW A;  3UE1 A;  4R4I A;  1CKN A;  3CCS A;  3M4P A;  3KDF B;  4LF4 L;  4BA1 I;  2IHE A;  5IT9 c;  2BA1 A;  3B6Y A;  1CKO A;  1OXX K;  4TQU S;  1K8G A;  5IWA Q;  1KXL A;  1X9N A;  2JA7 G;  1SR3 A;  2Z6K C;  3GDE A;  3PV0 A;  1XJV A;  4BY7 G;  1HZB A;  4IJH A;  1LUZ A;  3UDX A;  4X66 L;  3D31 A;  4YHH Q;  3CCE A;  1X56 A;  1DGS A;  1OXU A;  4XTC S;  3HOV H;  4JOI C;  2R7F A;  1WJJ A;  4C3I H;  4A3G H;  2ZJP A;  2ZTE A;  3CXC A;  3PCO B;  5GAD C;  2OQ0 A;  1IBL L;  4A3C H;  4GOP B;  3EN2 A;  3M3Y H;  1YHA A;  1FL0 A;  2WAQ E;  1IL2 A;  4A3G G;  1VQ5 A;  2I5L X;  5IWA L;  4JI1 Q;  4LF6 Q;  1VQJ A;  2K5V A;  1N32 Q;  4A3C G;  4UY8 C;  5K36 G;  4PZ7 A;  1BBU A;  2VZA A;  1D7Q A;  1JE5 A;  3PIP A;  1YZ6 A;  2OTJ A;  4DR1 Q;  3I2Z A;  4YWL A;  1K73 C;  1FGU A;  2HQL A;  4ME3 A;  2N78 A;  5C0X G;  4AQY Q;  1XMO Q;  1I94 L;  4X6A H;  1N9W A;  1S3O A;  2NVQ H;  4LF7 L;  4JI1 L;  1Y1V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...