4GLVB

Obody am3l09 bound to hen egg-white lysozyme
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
b'SPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEATTVTRWDTGVEIFPSEIWILNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
total genus 23
structure length 106
sequence length 106
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glvB00
3I56A 2A19A 2AWNA 2UXCQ 3GO5A 4NXNL 1HNXQ 3HOZH 4LFBL 1PH3A 2FXQA 1PH6A 5M3FH 1PH2A 1PVOA 3G48A 2ZM6L 5HY6A 3FKIG 1EYGA 1IZ6A 1VQCA 3OTOQ 1AE2A 3HKZG 4KLKA 5C44H 4DV2L 2YU9H 1OXSC 1A63A 4A3IH 4IFDG 3W1BA 1CKOA 1LTLA 3AQQA 3LGJA 3I55A 4HJAA 2BH2A 4LF6L 3ULPA 3FKIH 1CUKA 1TWAH 1V1QA 3PSIA 1D8LA 4HJ7A 1V43A 1QVFA 2NZHA 3ICEA 3F2DA 3M4QA 1K83H 5GROA 4LUOA 4APVA 1YJWA 4IOAA 4YWLA 4MTNA 5GQOA 4TVAB 3H0GH 3E9IA 4GKKQ 3M7NA 3PF4A 5C0XG 1SMXA 4POGA 1JJCB 5JEAG 4X64Q 4DUYQ 4HIKA 2JA6G 5EAYA 2HT1A 4JI5Q 2UXBQ 1HZAA 4JBJA 4FDBA 5FLXc 2UU9L 3U50C 4GOPC 3AFPA 1EQQA 2OWOA 3U58A 4JBMA 3G6EA 3E0EA 2PI2A 1WCMH 1YHAA 4YCUA 2JQOA 1HH2P 1X6OA 4LF8Q 4A93H 4MZ9A 2E5LL 1E3PA 5IP7H 1XNQQ 1VQ6A 3I2ZA 3PUYA 4JYAL 2KBNA 1CSPA 2XTIA 3HOYG 1WFQA 1JJGA 3PF5A 2JA7H 3PV0A 2UUCL 3I4NH 2KHJA 3CPWA 5JJLA 1XMQL 3K0XA 4GNXB 5DLQE 2JK8A 4DV7L 1M1KC 4BBRG 2JA5G 1KL9A 3L2PA 4A3GH 1QUQA 4OWXB 3TS0A 4GLAC 4DR7Q 1HNWQ 1VQPA 1I5FA 3RZDH 2ZTCA 4JI2L 1Q1EA 3T1YL 3L7ZC 1DGSA 1Y1WH 4NXNQ 2B63G 4BBRH 1VQAA 2KCMA 3NBHB 3PCOB 1T9HA 5H1SE 2ZJQA 2Y0SG 2PQAA 2CCZA 3ULLA 2ZM6Q 3WWVA 4Y52H 4X62Q 4NXMQ 3TRZA 2VUMH 2MNAA 3H15A 1PFSA 4DV2Q 3J7A5 3VDYA 4DV4L 1NMGA 4JI0L 4C3IH 3W1GA 1ASZA 1IL2A 4BBSG 3PIPA 3CC2A 5IWAL 1YJ9A 3HOWH 4OX9L 4BY7H 4RG1A 1NJIC 1E7ZA 3M9BA 1IBLL 1TWFH 4DV6L 5IY0A 4HJ5A 1X3FA 3RLNA 3DLLA 1QZHA 4GLVB 3S17H 2EXDA 1HR0W 4A3LH 3DM3A 1EWIA 1VQKA 5FJ8H 1OXTA 1CSQA 1VQMA 1SROA 3PGZA 2UUAL 3F8TA 5IP9G 4B3RL 3A0JA 1E22A 1BVSA 3T1HL 1QVCA 2UU9Q 2JA8H 4IPHA 4LUZA 1L0WA 2AWOA 4C3HH 1PH7A 1X3EA 3Q8DA 4DR2L 1K0RA 4DR4Q 3PO2G 3KFUA 3CP0A 5IP9H 3UDFA 3J7ZC 2Q2IA 4JI8L 2GVBA 3I4OA 1L1OB 2AKWB 2JE6I 4AYBE 2KCTA 4QQBX 2PNHA 1R9TH 4YHHL 4JYAQ 1HNWL 3EN2A 3PUXA 3S1NH 1AE3A 4QL5A 2N78A 4BY1G 4O0AA 4H02A 1CKNA 1OXVA 5GAEC 2QEXA 1LYLA 1XMQQ 3I4MG 2WB1G 1PYBA 5K36G 1GO3E 4YCWA 1MJEA 4JC0A 1KAWA 3CCUA 1VQBA 4QY7A 3RLFA 5M5WH 4DR5L 4GS3A 4DV5L 4LF9L 5GADC 4JI2Q 4IPCA 1Q12A 3I4MH 1KRSA 1Q8KA 4A3KG 1HJPA 4C2MH 1PA6A 4K0KL 2IY5B 2JEBI 1VQOA 3AFQA 2ES2A 2ALYB 2HIVA 5FLMG 4JV5L 5IT9c 4OXPA 4DPGA 1HNZL 1E1OA 1KD1C 2MO0A 1B8AA 3ER0A 4DV4Q 4GLXA 1K3RA 1BBUA 4X66L 5IWAQ 1K8AC 1IBMQ 4YWMA 2HHHL 2B29A 4DV6Q 3GTOH 2NVTH 3CW2C 2WAQE 5M3MH 1S40A 2JJQA 4DR3Q 4A3JH 1J6QA 3HOZG 5M3FG 1A0IA 3B6YA 1N9WA 2DUDA 4JI7L 3GTQH 5C44G 1U5KA 2RCNA 3CCEA 2I5LX 2IHFA 5IE8A 4OWTB 4RMFA 4A3IG 2UUAQ 2YYZA 3T1HQ 4B3RQ 1YNXA 4A3FH 1B70B 3JAMi 4B3ML 1WYDA 4LF4L 1HZ9A 1X3GA 4DR2Q 2R6GA 1VQHA 2PMZE 2DGYA 4OONA 4JI8Q 4XIGS 1I94L 3H0GG 4P75A 1EIYB 4JCVE 3OYYA 1E1TA 2ZTEA 1IBKL 2IHEA 1SN8A 5BR8Q 5C3EH 3G4SA 1XMOL 1PH4A 1Y14B 3J81j 3A5UA 1X56A 3CCLA 1MJCA 3KOJA 4L5QA 2Z0SA 3ZJYC 4A4IA 3HOVH 2N3SA 4P71A 1WCMG 3KDFA 4JOIA 3CMAA 4A75A 2HQLA 2UXDL 4WJ3M 4LF5L 2OTLA 4A93G 1VQLA 4DV5Q 1E24A 5IP7G 5IYCH 4LF9Q 2R92H 1FJGL 2VQFL 1MKHA 1GKHA 2R93H 4OO1I 1IYJB 3CCVA 4K0KQ 2Q2TA 3CMEA 4JV5Q 3JC66 2JA7G 4DR6Q 3I4NG 1Z9FA 1SR3A 1NE3A 1UWVA 2MFIA 4AIMA 2KHIA 3L0OA 2R7ZH 1EIFA 4DUZL 1VQDA 4A3GG 2BA0A 2ZTDA 1YITA 1G291 2AMCB 3UDGA 4DR1L 5IYBH 1D7QA 1YIJA 2KENA 3H3VH 1Y1WG 3PUVA 1XPOA 1K8GA 2D0PA 4A3CH 1PV4A 2NVQH 1UE1A 1EFWA 1P8LA 2MO1A 4JI7Q 1XPUA 2VUMG 4POFA 4LFBQ 2QGQA 5ELNA 4LFCL 1SFOH 1KQSA 3NENA 2AHOB 2PI2E 3EIVA 1KC8C 4IPDA 4LF4Q 3F2CA 4PZ8A 3HOWG 4DAMA 4BY7G 3M85A 1NBWA 1QUQB 1LM0A 2VS1A 2K4KA 2RHQB 3CQZH 2ZJRA 3MXNB 2UUBL 1SE8A 3AEVA 4NB3A 1OXXK 4O2DA 4IO9A 4GOPA 2IT1A 4LF6Q 3U4VA 4A3LG 5FJ8G 1I94Q 4LWCA 1YJNA 2PQAB 1HZBA 5C4JH 1WI5A 2VY3A 1YHQA 5LMNL 1XMOQ 4JI3L 1OTCA 4BXXH 4WJ4A 4UY8C 2JA8G 1Q81C 1FVIA 2H5XA 2L15A 4JI1L 1QZGA 4IFDI 1PH5A 3J80c 2WFWA 2XGTA 2VQEL 2UXDQ 3BU2A 4DK6C 4LF7L 4KHZA 1PH9A 5ELOA 4UPAA 2VQFQ 3HFZB 1FJGQ 3AYHB 3M4OH 2ID0A 2YV5A 2F4VL 2WAQG 2CFMA 1X65A 4MNOA 4DV3L 1G51A 2E5LQ 1XNRL 5AJ3L 1N36L 5C0XI 3STBD 3GTKH 3RN2A 4QJFA 3G71A 2NZOA 4UP8A 3D31A 4DUZQ 4B3SL 1M90C 4KHPL 2UUCQ 4HJ8A 2Z6KC 1U0LA 5C4XH 3TQYA 4DV1L 1HNXL 4C3JH 2I5HA 3BZKA 4DV7Q 4JI6L 3KYHC 1VQJA 3HOUH 4UP7A 4GKJL 4DV0L 1NY4A 3OTOL 4X65L 4HIOA 1N34L 3T1YQ 4IJLA 2QA4A 4QIWE 1CKNB 3CC7A 4DAYB 4LFCQ 1MIUA 1SLJA 1LUZA 4R4QA 1Y1VH 2OQ0A 4NPSA 5GAHC 2Q2UA 3CD6A 3HOXH 1VQEA 3CCJA 2RHSB 3STBC 2Y0SE 4A3DH 1C7YA 4GN5A 5M3MG 2V1CC 1L2FA 3MEFA 4A3JG 2R7DA 1W3SA 4AQYL 1GD7A 1ASYA 2UUBQ 4JI0Q 3PO3H 3K8AA 1VS0A 3K7AH 1N8RC 4JBWA 4OX9Q 1IBLQ 4X64L 3M4PA 4IJHA 1VQ5A 4JI5L 1XTDA 3CCRA 5LMNQ 4YY3L 4A3FG 3SGIA 4JI1Q 2VNUD 2C35B 3RNUA 3GDEA 2CWAA 5JEAJ 3W5OA 5LMUL 2OQKA 4A3BH 2VQEQ 1XPRA 1YEZA 2VW9A 4LF7Q 1A8VA 1XNQL 3OW2A 4X6AH 1NMFA 1NTGA 3GD7A 3CF5A 1YI2A 3KLWA 3PUZA 1VQ9A 1TWCH 1EOVA 5JJIA 3CCMA 3GTPH 5C3EG 4ME3A 3J80i 4DV3Q 3RZOH 1XNRQ 5AJ3Q 1N36Q 2GN5A 1S72A 1KRTA 2JEAI 4YHHQ 2GVAA 4PMWA 3HOVG 3S2HH 4YWKA 3F1ZA 3KJPA 1CKMA 4GNXC 4B3SQ 3K7UC 3RN5A 5J3BA 3S2DH 4A3MG 4LFAL 2R92G 3NEMA 5IYCG 1HZCA 3FP9A 4DV1Q 1K9MC 2K5NA 3NELA 3TREA 3CCSA 1C9OA 4JI6Q 2NVXH 2R93G 1JT8A 1V9PA 4GKJQ 4DV0Q 2F52A 4DR5Q 1I3QH 4A3MH 4X62L 5E7NA 2WB1E 4X65Q 1N34Q 1VCIA 2IX1A 3UDIA 1AH9A 3K80C 3KJOA 1S3OA 2R7ZG 1A62A 1HR0L 5JJKA 5M5XH 3S1MH 3BJUA 2OCEA 4L5RC 1HNZQ 3KDFB 1FGUA 4JG2A 3BZCA 4PZ7A 4LUVA 5IYBG 1Q1BA 3M3YH 4HIDA 2D62A 3U4ZA 2ZJPA 3K81C 3CXCA 4HIMA 4R4TA 4HJ9A 4AQYQ 4A3CG 3KF8B 4X66Q 1VQ8A 1GM5A 3A5ZB 2K50A 1TWGH 2HHHQ 4R4OA 1PH8A 1N33L 2I5MX 3GTJH 4YY3Q 3I7FA 1N32L 1SRUA 1O7IA 4AYBG 1Q7YC 4A3EG 2JA6H 1J5EL 3GTLH 4DR4L 3UE1A 1I50H 4R1JA 5LMUQ 4GNXA 1YBYA 1VQFA 1X9NA 1TXYA 3CAMA 4UP9A 1UEBA 2NN6G 4PZ6A 4B3MQ 1YZ6A 1VQGA 3J81c 1VQ4A 4A3EH 2BA1A 1L1OC 3RR5A 3E9HA 3S16H 1UE7A 1EQRA 4QGUA 3TEHB 1K73C 1PHJA 4DNIA 1JE5A 4J15A 3KF6A 4BXXG 3HKZE 2YTYA 2CKZB 2BH8A 3ERSX 4IOCA 3HOYH 1Q46A 2LXJA 1IBKQ 1Q86C 4JBKA 2YTVA 2B3GA 2I0QA 4LFAQ 1VQIA 2VL6A 2JA5H 4EX5A 4JI4L 3S15H 2D0OA 3KF6B 1OXUA 2WP8J 4GOPB 3ULJA 1VQ7A 3UE0A 4GN4B 4P73A 4LF5Q 2RF4A 2CQOA 3CCQA 1JMCA 1VQNA 2F3IA 2YTXA 3A74A 2B63H 1W2BA 1BKBA 2NVYH 1QVGA 2CWPA 1Z47A 3PUWA 1HR0Q 1I6HH 5GAGC 1IBML 4B3TL 2N49A 1X55A 1RIPA 1RL2A 2EIFA 5C4XG 2E2HH 4NXML 1PH1A 4DR3L 4LW1A 3S1QH 3JAMc 4BBSH 4EQ5A 4P72A 5BR8L 3PIOA 3HOUG 1BBWA 3D0FA 2E2JH 1KHIA 1L1OA 4BA1I 4DR1Q 2UXCL 2LXKA 1WJJA 1B7YB 2A1AA 2K52A 4L5TA 4OWWB 3F2BA 1N33Q 4AH6A 4DKAC 1N32Q 3GTMH 1Y1VG 3S1RH 4L5SA 3H3VI 3S14H 1IXRA 1P16A 3EBEA 1J5EQ 3HOXG 1X54A 3FHWA 4IPGA 2A8VA 4DR7L 4A3DG 1C0AA 3S24A 2K5HA 3TS2A 3PO3G 1YHBA 4Y7NH 2JA9A 1JB7A 2ASBA 3GTGH 5HGQA 2E8GA 3PO2H 4TQUS 4A76A 3CPFA 4OO1G 4LNQA 4YCVA 1UE6A 2VZAA 4IFDJ 1PYSB 1KIXA 4GKKL 1Q82C 4P74A 3J81i 4KHPQ 4DUYL 4DK3C 4BY1H 2UXBL 2NN6I 1XJVA 4A3BG 2R7FA 4JI3Q 1H95A 2IX0A 2K14A 5M5YH 1FL0A 1TWHH 2N8NA 1EUJA 1UE5A 2LSSA 5IYDG 4JI4Q 5C0XJ 2HIXA 2E2IH 1GVPA 2K75A 4PG3A 3CC4A 4LF8L 5LMNW 4DR6L 2EQSA 2Z6KA 4GN3B 1KXLA 4ALPA 3IRBA 4A3KH 5IYDH 2OTJA 2F4VQ 4JOIC 5FLMH 1WOCA 2K5VA 3RLOA 1YVCA 3HKSA 4B3TQ 4BA2I 4KI0A 2MQHA 1G6PA 2ATWA 4R4CA 4XTCS 4R4IA 1JJ2A 3UDXA 2Q2HA
chains in the Genus database with same CATH superfamily
2FJ2A 3HOZH 2JN4A 1B9MA 4LFBL 2KCNA 3TSSA 2ZM6L 4K6LA 1EYGA 4NXML 3K7AB 4LMQD 1OXSC 3W1BA 1LTLA 3AQQA 3LGJA 3K5MA 2BH2A 3ULPA 3FKIH 5KGUA 1D8LA 1J9OA 2B2TA 1YJWA 2B2WA 3HZXA 4MTNA 3M7NA 1SMXA 2JA6G 5C5MA 4JBJA 1LO5D 5FLXc 3KLSA 3U58A 2A68D 1YHAA 3OMGA 1Y8PB 3NUCA 1CA6A 4LF8Q 1E3PA 2EY5A 1XNQQ 3S2DB 2Q8RE 1Y8OB 4JYAL 1SNOA 3HOYG 4RFBA 1C4QA 2E2DC 3PV0A 1BCPD 1GUNA 4K5VA 3CPWA 1SYFA 1ZXTA 2XVSA 5DLQE 4BBRG 4DV7L 3BDCA 4A3GH 1HNWQ 1QUQA 1VQPA 3RZDH 2PW7A 4CKBA 1VQAA 3PCOB 5H1SE 3R3OA 2ZM6Q 1ILPA 4RWSC 4NXMQ 1JB3A 2MNAA 1TWGB 3R93A 3VDYA 4JI0L 4BBSG 1MSHA 2NVQB 2CH4A 3M9BA 1TWFH 1PRTB 1I50B 3DLLA 4GLVB 1JC7A 2EXDA 1HR0W 1EWIA 1VQKA 5FJ8H 1OXTA 1CSQA 3S16B 1QVCA 2JA8H 4LUZA 1KNEA 2KEEA 4DR2L 5IGCA 4HSVA 2F0HA 3CP0A 3J7ZC 2FHTA 3JAME 2MJ8A 2GVBA 1FNVA 3K5NA 2JE6I 1HUNA 2PNHA 4JYAQ 3S1NH 1NNXA 1AE3A 1DCZA 1PZID 2N78A 1ZYRD 4H02A 4WJWA 1OXVA 1R4QB 5GAEC 3LWUA 1LYLA 1PTOC 1TIID 4KY7A 3NK9A 1I6HB 4DR5L 1C48A 1W6JA 3I8ZA 2L1BA 4M8AA 3D4RA 4IPCA 3I4MH 4H13C 5FLMG 4JV5L 4OXPA 2E2JB 5C4XB 1KD1C 4DU9A 2MO0A 3U9OA 4GLXA 1K3RA 1BBUA 4YWMA 5CV5A 2HHHL 2NVTH 3HOZG 5M3MH 2JJQA 4DR3Q 1A0IA 1N9WA 1Y1VB 2C5CA 1LT3D 3GTQH 3IKJA 1U5KA 2CHBD 4PV1C 3QOJA 3EROA 4IUVA 4A3FH 3NTIA 2PZWA 1AEXA 1SYCA 1EEID 4CJ1B 1X3GA 4DR2Q 2R6GA 1SNCA 1VQHA 5KEEA 4KJOA 3K5LA 1GUTA 3OSOA 1KDAA 1ONLA 3FPUB 5C3EH 3G4SA 1Y14B 1S4ZA 2KUMA 3J81j 1JORA 1MJCA 3KOJA 3ZJYC 2Z0SA 2D2CC 5C4ZA 4JOIA 1S5ED 4IURA 5IGDA 2R92H 1E24A 4FXGC 2VQFL 1GKHA 2R93H 5M9OA 3EFXD 4JV5Q 4DR6Q 1SR3A 2B2VC 2KHIA 2BE5C 1FGBD 5JPMC 4RA8A 5M3FB 4FXDA 4A3GG 2AMCB 3UDGA 5CR3A 2YU9B 5IYBH 1D7QA 4I7ZC 2KENA 3H3VH 3MEHA 1Q90A 5M5XB 1EFWA 4ZRZA 3HKZB 3M3YB 1PTOF 2QGQA 1KQSA 2A68C 4MTKA 3NENA 1Z6HA 1YNND 1KC8C 4IPDA 4DXGA 4U68A 4OL7A 1STGA 2F0NA 1JOQA 3M85A 1ICFB 3E6ZX 2K4KA 4U673 3TP7A 1SE8A 2UUBL 5EJWA 3AEVA 4LF6Q 5FJ8G 2PQAB 5IGEA 1HZBA 4ZUJA 4RHSA 3A56A 4DK1A 4TKOB 1YHQA 1LT5D 5JVG3 4WJ4A 4UY8C 2JA8G 1A15A 4KKTA 4KMUC 2H5XA 4JI1L 5A2QL 3J80c 2WFWA 2XGTA 1PH9A 3SK8A 4UPAA 2VQFQ 3VR2A 2F0GA 3DXJC 2WAQG 4BWGB 1EYAA 1X65A 2E5LQ 1XNRL 2O4XA 5E4XA 5C0XI 3GTKH 2BDNA 3RN2A 4QJFA 3G71A 4ZKBB 1NR4A 5J22A 4KHPL 2UUCQ 2Z6KC 1U0LA 4WORA 3TQYA 1HNXL 2I5HA 2M2LA 2I46A 1VQJA 4C3IB 3HOUH 4DV0L 1NY4A 4GZYC 3OTOL 1JWUD 4BY7B 4QIWE 2FFKB 4EQOA 1SLJA 3S17B 4DAPA 1A2UA 4NPSA 2Y0SE 1C7YA 4GN5A 5M3MG 2V1CC 1L2FA 3MEFA 4ILWA 1ASYA 2UUBQ 1UUPA 5T1IA 2R3ZA 1EU4A 4MHEA 1G2SA 3K8AA 1F77A 4JBWA 1IBLQ 4X64L 1QOHA 1K3BC 4IJHA 1V1PA 4HMJA 1XTDA 3CCRA 3L9AX 1TQOA 2K5WA 4A3FG 1ILQA 1R9TB 1SSOA 4JI1Q 2C35B 3PO2B 3RNUA 2QCPX 1WTVA 3VR3A 2F4IA 2B2TC 5JEAJ 4L8JA 2N55A 4OIKA 3NTHA 2VW9A 1A8VA 5AFWA 3MAQA 4KJNA 3V2TA 3RD4A 1EOVA 3CCMA 3GTPH 5C3EG 5M5WB 4FO2A 1XNRQ 5D3DA 2GN5A 2B8GA 2J0TD 1NR2A 4YWKA 2O2LD 2SDFA 1D1KA 1PTOB 1PRTD 3KJPA 3K7UC 3RN5A 4LFAL 2R92G 3FP9A 2F0QA 4A3KB 2R93G 2IL8A 4Q5VA 4DV0Q 5CV8A 1GUOA 5E7NA 5JPNC 1LTGD 5HGTA 1CHQD 2DN8A 1VCIA 5J1ZA 5C4HA 3UDIA 1OO9B 1KABA 2LFNA 2OCEA 3KDFB 3BZCA 1KDCA 5IYBG 2ENBA 1XWEA 5E4WC 1EQVA 3K81C 2O5IC 2G5DA 4JPBW 1TS4A 4R4OA 1PH8A 1IL8A 1TWAB 4DR4L 1J5EL 3UE1A 4GNXA 1X9NA 3QIAA 1D5MC 1L1OC 2K7VA 4R8IA 3E9HA 3HOVB 3OMCA 1S5FD 3NQTA 1U9RA 3OOCA 3TEHB 2OXPA 4QGUA 1HTLD 2E76C 1GJXA 2CKZB 2KHSA 4IOCA 4IUTA 1WCMB 2LXJA 4JBKA 2YTVA 1HFGA 1ZKOA 1WTWA 4HN7A 4A93B 4XYOA 2F03A 4LFAQ 3S15H 2R7ZB 1E2ZA 1VQ7A 3UE0A 4GN4B 2RF4A 3CCQA 1JMCA 2F3VA 3A8KE 4LJZC 1VMCA 1BKBA 5CYUA 2BOSA 2NWGA 4G7OC 1CHPD 4B3TL 1O7ZA 1X55A 1STAA 1RIPA 1AP0A 2EIFA 2ZXOA 2E2HH 4RGTA 2Z4HA 2F0PA 2EDGA 4P72A 4DAVA 3HOUG 1BBWA 4K6DA 2UXCL 4BA1I 2L11A 1B7YB 4G7ZC 2K52A 5JOBA 1CQFA 1LTTD 3HOWB 3S1RH 3EBEA 1J5EQ 4IPGA 3U9SA 1F2ZA 2F0WA 2OT2A 3TS2A 2JA9A 2ASBA 2E8GA 5CC4A 1SMYC 4TQUS 4A76A 2EYPA 2A69D 1QG7A 3KBXA 5I9OA 4YCVA 1UE6A 4LNQA 1BCPB 1ET6A 5ELDA 4C3HB 4N8FA 4GKKL 1Q82C 4P74A 4V190 1QNUA 3KUPA 2K5QA 1H95A 2IX0A 2B39A 1H9MA 2K1BA 5K36H 5IYDG 2XSCA 5CMDA 5C0XJ 2K75A 3IFTA 4GN3B 2L9HA 3IRBA 5I2XA 3MFGA 2OTJA 1CM9A 4JOIC 2IX3A 3OWEB 3RLOA 3HKSA 2M00A 4B3TQ 4CDCC 5LL6S 1JJ2A 4DR7L 1TT2A 2RVLA 3KK7A 3LNNA 3K6OA 2UXCQ 3HOXB 4NXNL 4IALA 1PH3A 4A3DB 2FXQA 1PH6A 1B44D 1PH2A 5C5LA 1O80A 1EU3A 5HY6A 1I4PA 1IZ6A 1AE2A 5C44H 4DV2L 2EY2A 3GTOB 2PNRC 4A3JB 1CKOA 3KLSX 2EZVA 2MGSA 1V1QA 2AQ1B 2DJGC 1V43A 1NAPA 2EY1A 2NZHA 2Z4IA 4PQXA 4ODGA 3M4QA 1K83H 3BDOA 4A3BB 4APVA 3SK4A 3BYTB 4TVAB 4GKKQ 2Z9HA 5C0XG 1TWCB 2CVRA 1QWYA 2HT1A 4JI5Q 4FDBA 2UU9L 3RZOB 4FF4A 4O42A 2AQ2B 2OWOA 2RKSA 2SNSA 3E0EA 3Q6SA 4YCUA 2F0FA 1CI3M 1HH2P 3RMHA 3Q0AA 4MZ9A 3SK5A 3PUYA 2KBNA 1RODA 3BZDB 1KDBA 2XTIA 1JCKB 3O13A 5DEHA 3PF5A 2JA7H 3NBHA 4RCOA 1KNAA 4A3MB 2KHJA 1XMQL 4XQQA 1NSNS 2JK8A 3J7YW 3J81L 3TS0A 4OWXB 4GLAC 3C1FA 4DR7Q 3MXNA 2PO4A 5I4DA 1PFBA 4JI2L 3NBIA 4NXNQ 4BBRH 2KCMA 3MWYW 2Y0SG 2F0LA 3FPPA 1RHPA 3WWVA 1PZKD 3TRZA 3C3LA 3H15A 4DV2Q 3J7A5 4ZYSA 1IL2A 1TS2A 3PIPA 4NP5A 3CC2A 1YJ9A 1A3VA 3RLNA 4I7AA 1PTOD 2GA4B 1QB5D 4AYBB 4A3EB 4B3RL 2UU9Q 4IPHA 1PH7A 1SXTA 2AWOA 4PMBA 5D3IB 3Q8DA 3KFUA 3HOYB 1DM0B 1I4XA 3UDFA 1L1OB 2OF1A 2KCTA 1ENCA 3OW7A 4QL5A 3G7LA 3A7LA 1CKNA 3VYSA 1XMQQ 5K36G 2Q8IB 3M4OB 4JC0A 1KAWA 3CCUA 4QY7A 4LF9L 2RCFA 3SXHA 4JI2Q 1Q8KA 2SOBA 4C2MH 4HAEA 3S1QB 3AFQA 1NUCA 2ES2A 2HIVA 5G3LF 1VF5C 1AFPA 5EKLA 3ER0A 4X66L 5IIFA 2EYLA 3GTMB 2B29A 2QKIC 5HURA 2WAQE 1S40A 4K14A 3MHBA 4HR7B 1G2TA 2DUDA 5CGKA 4RKLA 5C44G 2CH4W 3CCEA 3WOFA 1LTAD 2I5LX 4B3RQ 1TKWB 4CBVA 1YNXA 3PO3B 3JAMi 4B3ML 1WYDA 2B2UA 1QILA 2PZTA 2PMZE 2DGYA 1EWHA 1GUSA 5EBCA 3N52A 2BE5D 1EIYB 1BR9A 4JCVE 5FOBB 1E1TA 1S5CD 2ZTEA 2PQEA 3SE0A 1XMOL 5C6AA 2A74C 2PCFB 4QF4A 4P71A 4A75A 4DF7A 2UXDL 4LF9Q 2RDFA 4KD4A 1IYJB 1QNKA 2Q2TA 2E74C 3H3VC 2JA7G 1NE3A 3OHXC 1B53A 4K8JA 4B9XA 3HOZB 1B1ZA 1MGSA 2EYOA 5KNCA 1VQDA 5FLXE 3DEOA 2Z1CA 2BA0A 1G291 1I3QB 4FNFA 4DR1L 5CORA 2KJXA 5ELEA 2O5JC 2K5DA 2D0PA 3S9WA 2NVQH 1UE1A 1STBA 3S1MB 3FKIB 1XPUA 1E2VA 1DYQA 3I3CA 3PMFA 4LFBQ 2AHOB 4IUPA 4OEMB 1NBWA 2VS1A 2NN6H 4NB3A 4O2DA 3GTJB 4GOPA 2IT1A 4F87A 3MA2B 1SYEA 3DEPA 4K5XA 2SEBD 5LMNL 1XMOQ 3D6CA 1Q81C 1QZGA 3T16A 2B8FA 3ONAB 1C8CA 1HA6A 2XWJB 2UXDQ 3UI2A 2QILA 3QG1A 3X3MA 4KN4C 5FO8B 1N36L 1EOTA 1IKLA 2LS01 3TP6A 2NZOA 1JICA 4UP8A 3D31A 2MUYA 1M90C 2XNAC 2L5TA 1LV9A 5C4XH 2D9UA 2L55A 4C3JH 3BZKA 4DV7Q 5CV6A 4UP7A 3SK6A 2OEOA 4KTAA 2KCCA 4L6TB 2F0TA 1TWFB 4IJLA 4DAYB 2BCOA 1Y1VH 2WIIB 2Q2UA 2RHSB 3STBC 1TS3A 1LT6D 1RDPD 2R7DA 4JI0Q 2FINB 2Z8LA 3T56B 4JW0A 5LMNQ 4YY3L 1B2TA 1ML0D 2A5HA 2ZXPA 3NWSA 3A55A 3S1NB 2CWAA 3W5OA 5LMUL 5IOCA 1XPRA 1PFNA 3C46A 4QUCA 1NMFA 3CHBD 3GD7A 4PNYA 1YI2A 3P1HA 4ZQ3A 5JJIA 4BY1B 1T5XD 1A3UA 3J80i 1DD2A 1N36Q 1SNDA 1UAPA 5M5YB 3I4MB 1EY7A 2WB1B 4PMWA 1SJHD 4NW2A 3F1ZA 1BO0A 2H4OA 3KBGA 4E6IA 1HZCA 4UHVA 1RCVD 2K5NA 3NELA 1C9OA 1JT8A 4IUNA 2TSSA 4DR5Q 3OWFA 4K2LA 4X62L 5CV7A 2IX1A 1AH9A 1O7YA 3KJOA 1S3OA 1A62A 1HR0L 3SVMA 5M5XH 3C2PA 2K01A 1RTOA 1GXDC 1X32A 4KKSA 3MXUA 4LUVA 4PZ7A 3M3YH 5KNDA 2D62A 2ZJPA 4HJ9A 4A3FB 3KF8B 4XT3B 1K8MA 5E1FA 3A5ZB 2K50A 1EY8A 2HHHQ 3MFYA 4QUFA 4A3IB 4YY3Q 3I7FA 1SRUA 2XWBB 5JEAH 1CA5A 2KVMA 3A8IE 4DNRB 1EY4A 4R1JA 5LMUQ 1YBYA 1TXYA 3CAMA 2NN6G 3J81c 1VQGA 3H0GB 1MI2A 1EQRA 4UDUC 1TS5A 2K05A 3KF6A 2JYOA 4KY6A 3K57A 3TP8A 5DNFA 1G8ZD 1VQIA 2L12A 2VL6A 4MIUA 2JA5H 4JI4L 1PYWD 1EY0A 2WP8J 3BVZA 1D1IA 5I2YA 5KNBA 1A2TA 5EGTA 3I4NB 5FKAC 2YTXA 2B63H 4CKCA 1W2BA 2NVYH 2CWPA 3QR8A 1HR0Q 2QEJC 5GAGC 4P2CB 2C9OA 2ZT9C 3QO2A 1IBML 1LTBD 1I4RA 1SMYD 5C4XG 1WTPA 4RHRA 1PH1A 1Y1WB 4C3JG 1F2MA 4HMIA 3J80E 3NQIA 2EJMA 1KHIA 1ET9A 1BDOA 2LXKA 1WJJA 4L5TA 3V96A 5LL6X 3I72A 4AH6A 3FRPB 4C1NK 2PYKA 1Y1VG 4HEDA 2LY7A 3S14H 2A8VA 1P16A 3Q23A 2K5HA 1EY5A 4Y7NH 1JB7A 2LKVA 5HGQA 3MXPA 1QCBD 3PO2H 4KV6A 2MP1A 1PYSB 1KIXA 1IYUA 1UEAB 3URYA 2B2UC 2B2YA 2UXBL 2RSNA 1TWHH 4JI4Q 2X6LA 2HIXA 2E2IH 1GVPA 3CC4A 1BF4A 2B2WC 2EYJA 4A3KH 5IYDH 4PMCA 2WINB 3I90A 3PIP3 5I9PA 3K0YA 3CRLC 2HUGA 1HTPA 2ATWA 4R4IA 2A6EC 4KHPQ 3I56A 5ELBA 2AWNA 5G3LD 1HNXQ 3DM1A 3ND8A 1VQCA 1D6EC 3OTOQ 2WKDA 3HKZG 4KD3A 4KLKA 2IJ0A 3T13A 3I55A 1CUKA 1TWAH 3PSIA 2SNMA 3GQBA 3HP3A 4EVOA 1SJED 5L37A 2WV6D 2F0DA 5GQOA 3E9IA 3PF4A 5JEAG 4X64Q 4HIKA 2ICEC 4IUQA 2UXBQ 5KYIA 4GOPC 4H44C 1EQQA 4JBMA 5C0XH 3G6EA 1WTXA 1WCMH 1I4GA 4XT1B 2JQOA 3NSWA 4A93H 3SEBA 2CQAA 1RF2D 3D4WA 1CSPA 1SEBD 1B50A 3K0XA 2JA5G 1M1KC 4RH6A 1KL9A 3D4DA 1I5FA 1Q1EA 3T1YL 1GHJA 2B63G 3WOEA 3NBHB 3DWAA 5BN3A 2PQAA 2CCZA 2VUMH 2PW5A 1PFSA 4X3TA 4XQJA 3X3NA 3W1GA 2J7ZA 3HOWH 4OX9L 3D3RA 4RG1A 1NJIC 4DV6L 3QJYA 5IY0A 4HJ5A 1WTRA 1H9KA 3DM3A 2K6AA 3GP7A 5EPKA 5IP9G 3A0JA 1E22A 4DGZA 1L0WA 4C3HH 1KAAA 1X3EA 2KECA 1VMPA 2F0UA 1K0RA 3JAML 2I07B 3PO2G 4DR4Q 5C4JB 4B08A 2Q2IA 4JI8L 3I4OA 5EKKA 2A6HC 1MBYA 4AYBE 4QQBX 3V05A 4YHHL 1G91A 3S15B 3PUXA 4QIWB 4O0AA 3TDQA 4DFAA 2J4XA 2QEXA 4KHVA 1PYBA 4YCWA 1MJEA 2TMPA 5GADC 1TY0A 3BVGA 3PQIA 2E2HB 4A3KG 1E2WA 1HJPA 4YIJA 3H91A 5JJZA 4K0KL 2JEBI 2ALYB 1V8QA 1DOMA 5IT9c 4DPGA 1HNZL 5I6YA 2F0VA 3OPOA 4K5WA 1HXYD 3TBIB 4RKBA 3VA5A 3RUZA 1AZPA 1CT1D 4CGYB 3S1RB 4DV6Q 3GTOH 1DOLA 4A3JH 1J6QA 3B6YA 1KTKA 4RAUC 5KYLA 4DK0A 2PPBC 4QCLA 2DNCA 2RCNA 5DM63 1TR5A 5IE8A 4IUUA 2YYZA 3W2DA 1Y69U 1B70B 3M4YA 1HZ9A 2WKCA 3R8BA 4DXFA 3QB3A 2QW7A 4JI8Q 2F0KA 4P75A 4XXEA 1SE4A 1IBKL 5JVH3 1X56A 4I65A 4S3SA 1LACA 1PMRA 2EYFA 4L5QA 2N3SA 1WCMG 3KDFA 3CMAA 2HQLA 4LF5L 4A93G 1VQLA 5IYCH 4OO1I 3CCVA 4K0KQ 3S2HB 1CZWA 4ULLA 5K5PA 3NHHA 5DAUA 4AIMA 1UWVA 5EBDA 4EQPA 4FF3A 1EIFA 1CFMA 2NVXB 1WTQA 1IW7C 3P20A 1LTRD 1SNPA 1STNA 5C44B 1DJRD 3EVQA 1ZEQX 1K8GA 1STYA 1GOZA 1P8LA 1AZQA 1LTID 2VUMG 2EYMA 4FF1A 4POFA 3A7AB 1SFOH 1ENAA 5ELNA 4LFCL 1K83B 2PI2E 1FNWA 1QE6A 3F2CA 3HOWG 3ND9A 2ZJRA 1QUQB 1LM0A 2RHQB 3CQZH 4ABNA 3C1EA 4IO9A 3N6RA 4LWCA 1YJNA 2K28A 2JA6B 2BDOA 1D5ZC 3GTLB 1WI5A 1OTCA 4JI3L 3J7AV 2B2VA 4C3HG 2N88A 3HRZC 1FVIA 5KRUA 1BUVT 4IFDI 5A2QE 2VQEL 2HCCA 3BU2A 4DK6C 4KY5A 1HRJA 4LAAA 4KHZA 1HPCA 3M4OH 2ID0A 4J8QA 2YV5A 2F4VL 2B2YC 3AB9A 1LABA 2CFMA 1G51A 1H9RA 5AJ3L 3STBD 1J8IA 5CV4A 3T53B 4BBRB 1PXUA 4LK1C 4B3SL 4KN7C 4HJ8A 4DV1L 4JI6L 1O7LA 4GKJL 4TSSA 1N34L 3IL8A 3H09A 4LFCQ 1MIUA 4BBSB 2OQ0A 3CD6A 3CCJA 1SE2A 1FYCA 3BDLA 4QMGA 3DWPA 4A3JG 3PO3H 5DM73 1VS0A 3K7AH 1VQ5A 4OO1H 1A6XA 3GTGB 3SGIA 3VYTA 3I70A 1MD2D 2VQEQ 1WD0A 1XNQL 1RTNA 3OW2A 4FP5D 2VB2X 3CF5A 1EIGA 2NYZD 5CV9A 3K59A 3Q24A 4ME3A 2NTSA 5AJ3Q 4N9TA 4F7XA 1S72A 1KRTA 4IN3A 1JOKA 4B3SQ 4GNXC 1CKMA 3HG9A 3S2DH 4A3MG 5EQ0A 3NEMA 5IYCG 2D5DA 4DV1Q 3P7JA 3TREA 3BYYB 1K9MC 4JI6Q 4G57A 5CBEE 4ID6A 4GKJQ 2HDMA 3BG3A 1I3QH 2HD3A 2WB1E 1N34Q 4ME5A 1HQRD 3K80C 3OIQA 2F1MA 1YNJC 2F0SA 1SYBA 3S1MH 4L5RC 5CBAE 1FGUA 4JG2A 1Q1BA 1LT4D 4IFDH 3CXCA 1HUMA 4R4TA 4HIMA 1XYIA 4ZUIA 3WDNA 2CW0C 4X66Q 1VQ8A 1GM5A 2RA4A 2MPMA 3IAYA 1TWGH 1N33L 4F8MA 3GTJH 1AW7A 5ELFA 1N32L 1O7IA 4OELB 4AYBG 4UAIA 4A3EG 1CK1A 3BS1A 3H6MA 1I50H 2M9VA 1VQFA 2KQ3A 3FMCA 4R8NA 4UP9A 4B3MQ 1YZ6A 1Q8IA 2BA1A 1MHWC 1BQQT 3LX0A 3S16H 1UE7A 3K58A 4FXKC 4DNIA 1JE5A 3HKZE 2YTYA 1IHZA 2BH8A 3ERSX 1BBXC 4FF2A 1II3A 3W3AA 2B3GA 5IODA 1NCVA 1PZJD 4EX5A 2D0OA 3KF6B 3ERQA 4P73A 4CDDC 1JWSD 3A74A 3G6JB 2KA7A 2AUKA 1QVGA 5C3WA 1Z47A 3PUWA 4X3SA 1I6HH 4A3GB 3MVVA 2K33A 1I6VC 1H9SA 3RZDB 3SHLA 2F0JA 5EKIA 4DR3L 1M8AA 3JAMc 2MHVA 4EQ5A 3PIOA 3D0FA 1PFMA 2E2JH 4M1UB 2H1EA 1L1OA 4DR1Q 2Z6BA 1RJTA 2A1AA 2AUJD 4OWWB 1N33Q 2EJGC 1B3AA 1K28A 3E0JA 3SDZA 1N32Q 4KK7A 1GHKA 4L5SA 3H3VI 1IXRA 1X54A 3FHWA 2DNEA 5NUCA 1C0AA 3S24A 1EZ6A 3PO3G 2QDBA 3EJIA 1CTMA 2E75C 3CPFA 4EQNA 4OO1G 4IFDJ 2JA8B 1WTOA 3J81i 4DUYL 2A6ED 4BY1H 5IT9L 3CKIB 1XJVA 1V1OA 5M5YH 1UE5A 2LSSA 4O1NA 2KEDA 2WAQB 4PG3A 3BVMA 1HQMC 2EQSA 4DR6L 5J39A 1B4OA 2QF7A 1KXLA 1V1PB 4C3JB 1BXTA 1WOCA 2K5VA 4NMZA 3FDTA 1YVCA 3T51B 4FVMA 1Y8NB 2MQHA 1KLGD 1G6PA 1SDFA 2PMZB 4XTCS 3UDXA 2A19A 2JP1A 1F9RA 3GO5A 5IGGA 1EQTA 5M3FH 1PVOA 1DONA 3G48A 1CQVA 3FKIG 5A35A 3EQLC 2YU9H 3NPPA 2NVTB 1A63A 4A3IH 5M3MB 4IFDG 3D6WA 1HA5A 4HJAA 4LF6L 1XX8A 4HJ7A 3I4LA 1QVFA 2R61A 5EPLA 3GTQB 1S5DD 3ICEA 3F2DA 4CJ0B 2DY7A 5GROA 4IOAA 4LUOA 4YWLA 1AN8A 3H0GH 5ISRA 5BN5A 4POGA 1JJCB 4DUYQ 5EAYA 1PDQA 2EE1A 1HZAA 3U50C 3AFPA 2F0IA 1QJOA 2PI2A 1X3PA 1X6OA 5C3EB 2QDLA 2E5LL 5IGBA 5IP7H 1UNSA 1VDZA 1VQ6A 3I2ZA 2IW3A 4J6HA 1S5BD 2F0OA 1WFQA 5E3FA 4KKUA 1JJGA 2UUCL 3I4NH 2R92B 5JJLA 2NUCA 4GNXB 2R93B 5T1GA 4G7HC 3L2PA 1B3QA 1SNQA 3J81E 2ZTCA 3TP5A 3L7ZC 1DGSA 4RCNA 1Y1WH 1T9HA 2JSOA 3NXWA 2AQ3B 1HHVA 3ULLA 3CRKC 4Y52H 4X62Q 2X69A 5D65A 3J7AF 1X3QA 4DV4L 1NMGA 2A6HD 4C3IH 1ASZA 5IWAL 1F2YA 4BY7H 1BCPC 1E7ZA 1IBLL 1BNZA 2XN9C 1XTCD 1X3FA 1G6ZA 1QZHA 1ENFA 3S17H 4A3LH 2DY8A 1SYDA 1VQMA 1SROA 3PGZA 4ZLTF 3E5SA 2UUAL 2X6GA 3F8TA 3QWNA 4QB4A 3ZYYX 3T1HL 1BVSA 5FO9B 4CJ2C 1SBBB 3M7GA 5IP9H 5LHY1 3E3XA 2AKWB 3HGBA 1R9TH 4CHTB 2JA5B 3EN2A 4BY1G 4DAYA 3LWEA 4HCSA 5KIXA 1IKMA 4K8IA 2B63B 3I4MG 2WB1G 1GO3E 4V0BA 4IQZA 2NVYB 4RGOS 1VQBA 3RLFA 5M5WH 4GS3A 3TZDA 4DV5L 1M4VA 3GV3A 3GTKB 1Q12A 2HDLA 1KRSA 2FMMA 1PA6A 2IY5B 1VQOA 1PTOH 3KLRA 2G9DA 3R2TA 3T4AC 4JK1C 1A3TA 2JXMB 1E1OA 2K03A 4J1MA 1B8AA 1F9PA 1LLRD 4DV4Q 5BN4A 3HOUB 1ZYRC 5IWAQ 1U4PA 1K8AC 1IBMQ 5IGFA 2P5ZX 3S14B 1Q3LA 3CW2C 4R9WA 1L0YB 5M3FG 4Y7NB 3MTSA 1DZ1A 4JI7L 1TVXA 1B9NA 2EYHA 1SYGA 2IHFA 2UUAQ 4OWTB 4RMFA 4A3IG 3T1HQ 3GV6A 4LF4L 1K0SA 1TY2A 1WTHA 4CKEA 3VA7A 1R4PB 4DA2A 4OONA 1SE3A 4BS9A 1TU2B 2VXWA 4XIGS 1I94L 3H0GG 4ZAIA 1TWHB 3OYYA 4CDFC 1EEFD 2IHEA 1IW7D 1SN8A 1U4LA 4H0LC 4ZCKA 2E2IB 4EGVA 1PH4A 3IFDA 1E0BA 2F0MA 3A5UA 3CCLA 1SNMA 4A4IA 3HOVH 4XDXA 2RBMA 1BCPF 4WJ3M 4Z9CB 3GTPB 2OTLA 4DV5Q 5I6WA 5IP7G 1JR0D 1FJGL 1MKHA 1W6KA 3KF8A 2XRSD 1GUGA 3CMEA 3JC66 3I4NG 1Z9FA 2KOLA 2MFIA 1U4RA 1EY6A 5FLXL 1WD1A 3L0OA 2R7ZH 1STHA 4DUZL 1JE4A 2ZTDA 4WRDA 1YITA 1YIJA 4OIJA 1Y1WG 3PUVA 1XPOA 4A3CH 1PV4A 2HQEA 4CDEC 2MO1A 3D8GA 4DN4M 4JI7Q 3A8JE 3L3OC 3H94A 3EIVA 3DUZA 4C3IG 2ZXRA 4LF4Q 4PZ8A 4DAMA 3Q22A 4BY7G 3MXNB 1STEA 2RSOA 4A3LG 1OXXK 2VNUD 2G9HD 3U4VA 1I94Q 4TRDA 3I73A 5C4JH 4L63B 2VY3A 4HSPA 4BXXH 1XXGA 2L15A 2EXZA 1PH5A 3AU7A 4LF7L 2IWHA 2V4DA 4DNTB 1YNNC 5ELOA 3VR6A 4ZK9B 1FJGQ 3HFZB 3AYHB 4RGMA 4NKLA 3EA6A 3FVQA 4MNOA 3TZUA 5FK9C 4DV3L 3VYRA 3MZ5A 4RGNA 3NWTA 4DUZQ 3AMUA 2DJFC 4Q0FA 1DOKA 2VUMB 1JWMD 2Y0SB 3KYHC 3NTKA 4N9PA 4X65L 4HIOA 2IPKD 3T1YQ 2QA4A 1CKNB 3CC7A 2NB0A 1MSGA 1EFID 4N8X1 1LUZA 4R4QA 2RQXA 5GAHC 3HOXH 1VQEA 4A3DH 1F9QA 2ZJQA 3TN2A 1IYVA 1RKNA 1W3SA 1GD7A 4AQYL 1EIHA 1N8RC 4OX9Q 3M4PA 3FEWX 1I4QA 2HCIA 4JI5L 1F9SA 1ICWA 4ZKCB 4H7BA 2WACA 5IT9E 2EPBA 1U4MA 1I4HA 3GDEA 3QOLA 2OQKA 4A3BH 1HFNA 2NBFA 1YEZA 4LF7Q 4X6AH 1NTGA 2F3WA 3KLWA 3PUZA 1VQ9A 1HCZA 1TWCH 3R2IA 3MC0B 1YNJD 1EWCA 1D2BA 2RDHA 4DV3Q 3RZOH 3A54A 1L0XB 4YHHQ 2JEAI 4XYQA 2GVAA 3HOVG 3S2HH 1EL0A 2CW0D 3PIO3 2A73B 5COYA 5J3BA 3NP8A 4X3UA 3CCSA 2XIWA 2NVXH 1V9PA 2RDGA 1DXMA 2F52A 2F0EA 2ICIA 4A3MH 4X65Q 2K04A 2EJFC 2R7ZG 1RD9D 1FD7D 5JJKA 3BJUA 1HNZQ 2L0CA 4HIDA 3SR1A 3U4ZA 4AQYQ 4A3CG 4IZ8A 1PRTC 1O78A 4C56C 4B9WA 2I5MX 4OHJA 3VR4A 4NDXA 5JAVA 4FYDA 1CZGA 2VB3X 3P75A 1ESRA 1T5EA 1Q7YC 2JA6H 3GTLH 4OGQC 1UEBA 4PZ6A 1VQ4A 4A3EH 3DHQA 3RR5A 1K73C 1PHJA 4J15A 4BXXG 3VR5A 4K2KA 1Z7TA 2LMCB 3MXGA 3HOYH 1Q46A 1IBKQ 2NZ1D 1Q86C 3CU7A 2I0QA 1WVLA 1JQYD 2K32A 2EVBA 2XRQD 4C1NI 1OXUA 4X3KA 5D14A 4GOPB 3ULJA 4LF5Q 2CQOA 2FMCA 3ITPA 2JA7B 1VQNA 2F3IA 3DMUA 1EZ8A 5TSSA 3F2UA 1JOOA 2N49A 1RL2A 3J80L 4LW1A 4MN3A 3I91A 1FR3A 1SFOB 3S1QH 4BBSH 5BR8L 1H9JA 1LTSD 3HS0C 1K8OA 3F2BA 3CQZB 1H9SB 1GUWA 4DKAC 2PZUA 3GTMH 1VF7A 4G4KA 3VYUA 3HOXG 4A3DG 1YHBA 3GTGH 1EYDA 4HCEA 1D5XC 5F2DA 1ESFA 2EY6A 2VZAA 2L4NA 2NTTA 1EY9A 3OIPA 4DK3C 3DWQA 5ELCA 2NN6I 4A3BG 2R7FA 4JI3Q 2K14A 1FL0A 2N8NA 1EUJA 1PRTF 2Q8TA 5C3XA 1KLUD 4LF8L 5LMNW 2Z6KA 3K5OA 4XQNA 4ALPA 1BOSA 1FNUA 1EYCA 5EPJA 2F4VQ 5FLMH 5FO7B 4F88A 4HTHA 2A69C 3NE5B 4BA2I 2EOTA 3HEJA 4KI0A 3TMEA 4WFN3 1F2LA 4C2MB 4R4CA 1HNWL 1PLFA 4JVZA 5BR8Q 1SAPA 2Q2HA
chains in the Genus database with same CATH topology
3I56A 2A19A 2AWNA 2UXCQ 3GO5A 4NXNL 1HNXQ 3HOZH 4LFBL 1PH3A 2FXQA 1PH6A 5M3FH 1PH2A 1PVOA 3G48A 2ZM6L 5HY6A 3FKIG 1EYGA 1IZ6A 1VQCA 3OTOQ 1AE2A 3HKZG 4KLKA 5C44H 4DV2L 2YU9H 1OXSC 1A63A 4A3IH 4IFDG 3W1BA 1CKOA 1LTLA 3AQQA 3LGJA 3I55A 4HJAA 2BH2A 4LF6L 3ULPA 3FKIH 1CUKA 1TWAH 1V1QA 3PSIA 1D8LA 4HJ7A 1V43A 1QVFA 2NZHA 3ICEA 3F2DA 3M4QA 1K83H 5GROA 4LUOA 4APVA 1YJWA 4IOAA 4YWLA 4MTNA 5GQOA 4TVAB 3H0GH 3E9IA 4GKKQ 3M7NA 3PF4A 5C0XG 1SMXA 4POGA 1JJCB 5JEAG 4X64Q 4DUYQ 4HIKA 2JA6G 5EAYA 2HT1A 4JI5Q 2UXBQ 1HZAA 4JBJA 4FDBA 5FLXc 2UU9L 3U50C 4GOPC 3AFPA 1EQQA 2OWOA 3U58A 4JBMA 3G6EA 3E0EA 2PI2A 1WCMH 1YHAA 4YCUA 2JQOA 1HH2P 1X6OA 4LF8Q 4A93H 4MZ9A 2E5LL 1E3PA 5IP7H 1XNQQ 1VQ6A 3I2ZA 3PUYA 4JYAL 2KBNA 1CSPA 2XTIA 3HOYG 1WFQA 1JJGA 3PF5A 2JA7H 3PV0A 2UUCL 3I4NH 2KHJA 3CPWA 5JJLA 1XMQL 3K0XA 4GNXB 5DLQE 2JK8A 4DV7L 1M1KC 4BBRG 2JA5G 1KL9A 3L2PA 4A3GH 1QUQA 4OWXB 3TS0A 4GLAC 4DR7Q 1HNWQ 1VQPA 1I5FA 3RZDH 2ZTCA 4JI2L 1Q1EA 3T1YL 3L7ZC 1DGSA 1Y1WH 4NXNQ 2B63G 4BBRH 1VQAA 2KCMA 3NBHB 3PCOB 1T9HA 5H1SE 2ZJQA 2Y0SG 2PQAA 2CCZA 3ULLA 2ZM6Q 3WWVA 4Y52H 4X62Q 4NXMQ 3TRZA 2VUMH 2MNAA 3H15A 1PFSA 4DV2Q 3J7A5 3VDYA 4DV4L 1NMGA 4JI0L 4C3IH 3W1GA 1ASZA 1IL2A 4BBSG 3PIPA 3CC2A 5IWAL 1YJ9A 3HOWH 4OX9L 4BY7H 4RG1A 1NJIC 1E7ZA 3M9BA 1IBLL 1TWFH 4DV6L 5IY0A 4HJ5A 1X3FA 3RLNA 3DLLA 1QZHA 4GLVB 3S17H 2EXDA 1HR0W 4A3LH 3DM3A 1EWIA 1VQKA 5FJ8H 1OXTA 1CSQA 1VQMA 1SROA 3PGZA 2UUAL 3F8TA 5IP9G 4B3RL 3A0JA 1E22A 1BVSA 3T1HL 1QVCA 2UU9Q 2JA8H 4IPHA 4LUZA 1L0WA 2AWOA 4C3HH 1PH7A 1X3EA 3Q8DA 4DR2L 1K0RA 4DR4Q 3PO2G 3KFUA 3CP0A 5IP9H 3UDFA 3J7ZC 2Q2IA 4JI8L 2GVBA 3I4OA 1L1OB 2AKWB 2JE6I 4AYBE 2KCTA 4QQBX 2PNHA 1R9TH 4YHHL 4JYAQ 1HNWL 3EN2A 3PUXA 3S1NH 1AE3A 4QL5A 2N78A 4BY1G 4O0AA 4H02A 1CKNA 1OXVA 5GAEC 2QEXA 1LYLA 1XMQQ 3I4MG 2WB1G 1PYBA 5K36G 1GO3E 4YCWA 1MJEA 4JC0A 1KAWA 3CCUA 1VQBA 4QY7A 3RLFA 5M5WH 4DR5L 4GS3A 4DV5L 4LF9L 5GADC 4JI2Q 4IPCA 1Q12A 3I4MH 1KRSA 1Q8KA 4A3KG 1HJPA 4C2MH 1PA6A 4K0KL 2IY5B 2JEBI 1VQOA 3AFQA 2ES2A 2ALYB 2HIVA 5FLMG 4JV5L 5IT9c 4OXPA 4DPGA 1HNZL 1E1OA 1KD1C 2MO0A 1B8AA 3ER0A 4DV4Q 4GLXA 1K3RA 1BBUA 4X66L 5IWAQ 1K8AC 1IBMQ 4YWMA 2HHHL 2B29A 4DV6Q 3GTOH 2NVTH 3CW2C 2WAQE 5M3MH 1S40A 2JJQA 4DR3Q 4A3JH 1J6QA 3HOZG 5M3FG 1A0IA 3B6YA 1N9WA 2DUDA 4JI7L 3GTQH 5C44G 1U5KA 2RCNA 3CCEA 2I5LX 2IHFA 5IE8A 4OWTB 4RMFA 4A3IG 2UUAQ 2YYZA 3T1HQ 4B3RQ 1YNXA 4A3FH 1B70B 3JAMi 4B3ML 1WYDA 4LF4L 1HZ9A 1X3GA 4DR2Q 2R6GA 1VQHA 2PMZE 2DGYA 4OONA 4JI8Q 4XIGS 1I94L 3H0GG 4P75A 1EIYB 4JCVE 3OYYA 1E1TA 2ZTEA 1IBKL 2IHEA 1SN8A 5BR8Q 5C3EH 3G4SA 1XMOL 1PH4A 1Y14B 3J81j 3A5UA 1X56A 3CCLA 1MJCA 3KOJA 4L5QA 2Z0SA 3ZJYC 4A4IA 3HOVH 2N3SA 4P71A 1WCMG 3KDFA 4JOIA 3CMAA 4A75A 2HQLA 2UXDL 4WJ3M 4LF5L 2OTLA 4A93G 1VQLA 4DV5Q 1E24A 5IP7G 5IYCH 4LF9Q 2R92H 1FJGL 2VQFL 1MKHA 1GKHA 2R93H 4OO1I 1IYJB 3CCVA 4K0KQ 2Q2TA 3CMEA 4JV5Q 3JC66 2JA7G 4DR6Q 3I4NG 1Z9FA 1SR3A 1NE3A 1UWVA 2MFIA 4AIMA 2KHIA 3L0OA 2R7ZH 1EIFA 4DUZL 1VQDA 4A3GG 2BA0A 2ZTDA 1YITA 1G291 2AMCB 3UDGA 4DR1L 5IYBH 1D7QA 1YIJA 2KENA 3H3VH 1Y1WG 3PUVA 1XPOA 1K8GA 2D0PA 4A3CH 1PV4A 2NVQH 1UE1A 1EFWA 1P8LA 2MO1A 4JI7Q 1XPUA 2VUMG 4POFA 4LFBQ 2QGQA 5ELNA 4LFCL 1SFOH 1KQSA 3NENA 2AHOB 2PI2E 3EIVA 1KC8C 4IPDA 4LF4Q 3F2CA 4PZ8A 3HOWG 4DAMA 4BY7G 3M85A 1NBWA 1QUQB 1LM0A 2VS1A 2K4KA 2RHQB 3CQZH 2ZJRA 3MXNB 2UUBL 1SE8A 3AEVA 4NB3A 1OXXK 4O2DA 4IO9A 4GOPA 2IT1A 4LF6Q 3U4VA 4A3LG 5FJ8G 1I94Q 4LWCA 1YJNA 2PQAB 1HZBA 5C4JH 1WI5A 2VY3A 1YHQA 5LMNL 1XMOQ 4JI3L 1OTCA 4BXXH 4WJ4A 4UY8C 2JA8G 1Q81C 1FVIA 2H5XA 2L15A 4JI1L 1QZGA 4IFDI 1PH5A 3J80c 2WFWA 2XGTA 2VQEL 2UXDQ 3BU2A 4DK6C 4LF7L 4KHZA 1PH9A 5ELOA 4UPAA 2VQFQ 3HFZB 1FJGQ 3AYHB 3M4OH 2ID0A 2YV5A 2F4VL 2WAQG 2CFMA 1X65A 4MNOA 4DV3L 1G51A 2E5LQ 1XNRL 5AJ3L 1N36L 5C0XI 3STBD 3GTKH 3RN2A 4QJFA 3G71A 2NZOA 4UP8A 3D31A 4DUZQ 4B3SL 1M90C 4KHPL 2UUCQ 4HJ8A 2Z6KC 1U0LA 5C4XH 3TQYA 4DV1L 1HNXL 4C3JH 2I5HA 3BZKA 4DV7Q 4JI6L 3KYHC 1VQJA 3HOUH 4UP7A 4GKJL 4DV0L 1NY4A 3OTOL 4X65L 4HIOA 1N34L 3T1YQ 4IJLA 2QA4A 4QIWE 1CKNB 3CC7A 4DAYB 4LFCQ 1MIUA 1SLJA 1LUZA 4R4QA 1Y1VH 2OQ0A 4NPSA 5GAHC 2Q2UA 3CD6A 3HOXH 1VQEA 3CCJA 2RHSB 3STBC 2Y0SE 4A3DH 1C7YA 4GN5A 5M3MG 2V1CC 1L2FA 3MEFA 4A3JG 2R7DA 1W3SA 4AQYL 1GD7A 1ASYA 2UUBQ 4JI0Q 3PO3H 3K8AA 1VS0A 3K7AH 1N8RC 4JBWA 4OX9Q 1IBLQ 4X64L 3M4PA 4IJHA 1VQ5A 4JI5L 1XTDA 3CCRA 5LMNQ 4YY3L 4A3FG 3SGIA 4JI1Q 2VNUD 2C35B 3RNUA 3GDEA 2CWAA 5JEAJ 3W5OA 5LMUL 2OQKA 4A3BH 2VQEQ 1XPRA 1YEZA 2VW9A 4LF7Q 1A8VA 1XNQL 3OW2A 4X6AH 1NMFA 1NTGA 3GD7A 3CF5A 1YI2A 3KLWA 3PUZA 1VQ9A 1TWCH 1EOVA 5JJIA 3CCMA 3GTPH 5C3EG 4ME3A 3J80i 4DV3Q 3RZOH 1XNRQ 5AJ3Q 1N36Q 2GN5A 1S72A 1KRTA 2JEAI 4YHHQ 2GVAA 4PMWA 3HOVG 3S2HH 4YWKA 3F1ZA 3KJPA 1CKMA 4GNXC 4B3SQ 3K7UC 3RN5A 5J3BA 3S2DH 4A3MG 4LFAL 2R92G 3NEMA 5IYCG 1HZCA 3FP9A 4DV1Q 1K9MC 2K5NA 3NELA 3TREA 3CCSA 1C9OA 4JI6Q 2NVXH 2R93G 1JT8A 1V9PA 4GKJQ 4DV0Q 2F52A 4DR5Q 1I3QH 4A3MH 4X62L 5E7NA 2WB1E 4X65Q 1N34Q 1VCIA 2IX1A 3UDIA 1AH9A 3K80C 3KJOA 1S3OA 2R7ZG 1A62A 1HR0L 5JJKA 5M5XH 3S1MH 3BJUA 2OCEA 4L5RC 1HNZQ 3KDFB 1FGUA 4JG2A 3BZCA 4PZ7A 4LUVA 5IYBG 1Q1BA 3M3YH 4HIDA 2D62A 3U4ZA 2ZJPA 3K81C 3CXCA 4HIMA 4R4TA 4HJ9A 4AQYQ 4A3CG 3KF8B 4X66Q 1VQ8A 1GM5A 3A5ZB 2K50A 1TWGH 2HHHQ 4R4OA 1PH8A 1N33L 2I5MX 3GTJH 4YY3Q 3I7FA 1N32L 1SRUA 1O7IA 4AYBG 1Q7YC 4A3EG 2JA6H 1J5EL 3GTLH 4DR4L 3UE1A 1I50H 4R1JA 5LMUQ 4GNXA 1YBYA 1VQFA 1X9NA 1TXYA 3CAMA 4UP9A 1UEBA 2NN6G 4PZ6A 4B3MQ 1YZ6A 1VQGA 3J81c 1VQ4A 4A3EH 2BA1A 1L1OC 3RR5A 3E9HA 3S16H 1UE7A 1EQRA 4QGUA 3TEHB 1K73C 1PHJA 4DNIA 1JE5A 4J15A 3KF6A 4BXXG 3HKZE 2YTYA 2CKZB 2BH8A 3ERSX 4IOCA 3HOYH 1Q46A 2LXJA 1IBKQ 1Q86C 4JBKA 2YTVA 2B3GA 2I0QA 4LFAQ 1VQIA 2VL6A 2JA5H 4EX5A 4JI4L 3S15H 2D0OA 3KF6B 1OXUA 2WP8J 4GOPB 3ULJA 1VQ7A 3UE0A 4GN4B 4P73A 4LF5Q 2RF4A 2CQOA 3CCQA 1JMCA 1VQNA 2F3IA 2YTXA 3A74A 2B63H 1W2BA 1BKBA 2NVYH 1QVGA 2CWPA 1Z47A 3PUWA 1HR0Q 1I6HH 5GAGC 1IBML 4B3TL 2N49A 1X55A 1RIPA 1RL2A 2EIFA 5C4XG 2E2HH 4NXML 1PH1A 4DR3L 4LW1A 3S1QH 3JAMc 4BBSH 4EQ5A 4P72A 5BR8L 3PIOA 3HOUG 1BBWA 3D0FA 2E2JH 1KHIA 1L1OA 4BA1I 4DR1Q 2UXCL 2LXKA 1WJJA 1B7YB 2A1AA 2K52A 4L5TA 4OWWB 3F2BA 1N33Q 4AH6A 4DKAC 1N32Q 3GTMH 1Y1VG 3S1RH 4L5SA 3H3VI 3S14H 1IXRA 1P16A 3EBEA 1J5EQ 3HOXG 1X54A 3FHWA 4IPGA 2A8VA 4DR7L 4A3DG 1C0AA 3S24A 2K5HA 3TS2A 3PO3G 1YHBA 4Y7NH 2JA9A 1JB7A 2ASBA 3GTGH 5HGQA 2E8GA 3PO2H 4TQUS 4A76A 3CPFA 4OO1G 4LNQA 4YCVA 1UE6A 2VZAA 4IFDJ 1PYSB 1KIXA 4GKKL 1Q82C 4P74A 3J81i 4KHPQ 4DUYL 4DK3C 4BY1H 2UXBL 2NN6I 1XJVA 4A3BG 2R7FA 4JI3Q 1H95A 2IX0A 2K14A 5M5YH 1FL0A 1TWHH 2N8NA 1EUJA 1UE5A 2LSSA 5IYDG 4JI4Q 5C0XJ 2HIXA 2E2IH 1GVPA 2K75A 4PG3A 3CC4A 4LF8L 5LMNW 4DR6L 2EQSA 2Z6KA 4GN3B 1KXLA 4ALPA 3IRBA 4A3KH 5IYDH 2OTJA 2F4VQ 4JOIC 5FLMH 1WOCA 2K5VA 3RLOA 1YVCA 3HKSA 4B3TQ 4BA2I 4KI0A 2MQHA 1G6PA 2ATWA 4R4CA 4XTCS 4R4IA 1JJ2A 3UDXA 2Q2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 A;  2A19 A;  2AWN A;  2UXC Q;  3GO5 A;  4NXN L;  1HNX Q;  3HOZ H;  4LFB L;  1PH3 A;  2FXQ A;  1PH6 A;  5M3F H;  1PH2 A;  1PVO A;  3G48 A;  2ZM6 L;  5HY6 A;  3FKI G;  1EYG A;  1IZ6 A;  1VQC A;  3OTO Q;  1AE2 A;  3HKZ G;  4KLK A;  5C44 H;  4DV2 L;  2YU9 H;  1OXS C;  1A63 A;  4A3I H;  4IFD G;  3W1B A;  1CKO A;  1LTL A;  3AQQ A;  3LGJ A;  3I55 A;  4HJA A;  2BH2 A;  4LF6 L;  3ULP A;  3FKI H;  1CUK A;  1TWA H;  1V1Q A;  3PSI A;  1D8L A;  4HJ7 A;  1V43 A;  1QVF A;  2NZH A;  3ICE A;  3F2D A;  3M4Q A;  1K83 H;  5GRO A;  4LUO A;  4APV A;  1YJW A;  4IOA A;  4YWL A;  4MTN A;  5GQO A;  4TVA B;  3H0G H;  3E9I A;  4GKK Q;  3M7N A;  3PF4 A;  5C0X G;  1SMX A;  4POG A;  1JJC B;  5JEA G;  4X64 Q;  4DUY Q;  4HIK A;  2JA6 G;  5EAY A;  2HT1 A;  4JI5 Q;  2UXB Q;  1HZA A;  4JBJ A;  4FDB A;  5FLX c;  2UU9 L;  3U50 C;  4GOP C;  3AFP A;  1EQQ A;  2OWO A;  3U58 A;  4JBM A;  3G6E A;  3E0E A;  2PI2 A;  1WCM H;  1YHA A;  4YCU A;  2JQO A;  1HH2 P;  1X6O A;  4LF8 Q;  4A93 H;  4MZ9 A;  2E5L L;  1E3P A;  5IP7 H;  1XNQ Q;  1VQ6 A;  3I2Z A;  3PUY A;  4JYA L;  2KBN A;  1CSP A;  2XTI A;  3HOY G;  1WFQ A;  1JJG A;  3PF5 A;  2JA7 H;  3PV0 A;  2UUC L;  3I4N H;  2KHJ A;  3CPW A;  5JJL A;  1XMQ L;  3K0X A;  4GNX B;  5DLQ E;  2JK8 A;  4DV7 L;  1M1K C;  4BBR G;  2JA5 G;  1KL9 A;  3L2P A;  4A3G H;  1QUQ A;  4OWX B;  3TS0 A;  4GLA C;  4DR7 Q;  1HNW Q;  1VQP A;  1I5F A;  3RZD H;  2ZTC A;  4JI2 L;  1Q1E A;  3T1Y L;  3L7Z C;  1DGS A;  1Y1W H;  4NXN Q;  2B63 G;  4BBR H;  1VQA A;  2KCM A;  3NBH B;  3PCO B;  1T9H A;  5H1S E;  2ZJQ A;  2Y0S G;  2PQA A;  2CCZ A;  3ULL A;  2ZM6 Q;  3WWV A;  4Y52 H;  4X62 Q;  4NXM Q;  3TRZ A;  2VUM H;  2MNA A;  3H15 A;  1PFS A;  4DV2 Q;  3J7A 5;  3VDY A;  4DV4 L;  1NMG A;  4JI0 L;  4C3I H;  3W1G A;  1ASZ A;  1IL2 A;  4BBS G;  3PIP A;  3CC2 A;  5IWA L;  1YJ9 A;  3HOW H;  4OX9 L;  4BY7 H;  4RG1 A;  1NJI C;  1E7Z A;  3M9B A;  1IBL L;  1TWF H;  4DV6 L;  5IY0 A;  4HJ5 A;  1X3F A;  3RLN A;  3DLL A;  1QZH A;  4GLV B;  3S17 H;  2EXD A;  1HR0 W;  4A3L H;  3DM3 A;  1EWI A;  1VQK A;  5FJ8 H;  1OXT A;  1CSQ A;  1VQM A;  1SRO A;  3PGZ A;  2UUA L;  3F8T A;  5IP9 G;  4B3R L;  3A0J A;  1E22 A;  1BVS A;  3T1H L;  1QVC A;  2UU9 Q;  2JA8 H;  4IPH A;  4LUZ A;  1L0W A;  2AWO A;  4C3H H;  1PH7 A;  1X3E A;  3Q8D A;  4DR2 L;  1K0R A;  4DR4 Q;  3PO2 G;  3KFU A;  3CP0 A;  5IP9 H;  3UDF A;  3J7Z C;  2Q2I A;  4JI8 L;  2GVB A;  3I4O A;  1L1O B;  2AKW B;  2JE6 I;  4AYB E;  2KCT A;  4QQB X;  2PNH A;  1R9T H;  4YHH L;  4JYA Q;  1HNW L;  3EN2 A;  3PUX A;  3S1N H;  1AE3 A;  4QL5 A;  2N78 A;  4BY1 G;  4O0A A;  4H02 A;  1CKN A;  1OXV A;  5GAE C;  2QEX A;  1LYL A;  1XMQ Q;  3I4M G;  2WB1 G;  1PYB A;  5K36 G;  1GO3 E;  4YCW A;  1MJE A;  4JC0 A;  1KAW A;  3CCU A;  1VQB A;  4QY7 A;  3RLF A;  5M5W H;  4DR5 L;  4GS3 A;  4DV5 L;  4LF9 L;  5GAD C;  4JI2 Q;  4IPC A;  1Q12 A;  3I4M H;  1KRS A;  1Q8K A;  4A3K G;  1HJP A;  4C2M H;  1PA6 A;  4K0K L;  2IY5 B;  2JEB I;  1VQO A;  3AFQ A;  2ES2 A;  2ALY B;  2HIV A;  5FLM G;  4JV5 L;  5IT9 c;  4OXP A;  4DPG A;  1HNZ L;  1E1O A;  1KD1 C;  2MO0 A;  1B8A A;  3ER0 A;  4DV4 Q;  4GLX A;  1K3R A;  1BBU A;  4X66 L;  5IWA Q;  1K8A C;  1IBM Q;  4YWM A;  2HHH L;  2B29 A;  4DV6 Q;  3GTO H;  2NVT H;  3CW2 C;  2WAQ E;  5M3M H;  1S40 A;  2JJQ A;  4DR3 Q;  4A3J H;  1J6Q A;  3HOZ G;  5M3F G;  1A0I A;  3B6Y A;  1N9W A;  2DUD A;  4JI7 L;  3GTQ H;  5C44 G;  1U5K A;  2RCN A;  3CCE A;  2I5L X;  2IHF A;  5IE8 A;  4OWT B;  4RMF A;  4A3I G;  2UUA Q;  2YYZ A;  3T1H Q;  4B3R Q;  1YNX A;  4A3F H;  1B70 B;  3JAM i;  4B3M L;  1WYD A;  4LF4 L;  1HZ9 A;  1X3G A;  4DR2 Q;  2R6G A;  1VQH A;  2PMZ E;  2DGY A;  4OON A;  4JI8 Q;  4XIG S;  1I94 L;  3H0G G;  4P75 A;  1EIY B;  4JCV E;  3OYY A;  1E1T A;  2ZTE A;  1IBK L;  2IHE A;  1SN8 A;  5BR8 Q;  5C3E H;  3G4S A;  1XMO L;  1PH4 A;  1Y14 B;  3J81 j;  3A5U A;  1X56 A;  3CCL A;  1MJC A;  3KOJ A;  4L5Q A;  2Z0S A;  3ZJY C;  4A4I A;  3HOV H;  2N3S A;  4P71 A;  1WCM G;  3KDF A;  4JOI A;  3CMA A;  4A75 A;  2HQL A;  2UXD L;  4WJ3 M;  4LF5 L;  2OTL A;  4A93 G;  1VQL A;  4DV5 Q;  1E24 A;  5IP7 G;  5IYC H;  4LF9 Q;  2R92 H;  1FJG L;  2VQF L;  1MKH A;  1GKH A;  2R93 H;  4OO1 I;  1IYJ B;  3CCV A;  4K0K Q;  2Q2T A;  3CME A;  4JV5 Q;  3JC6 6;  2JA7 G;  4DR6 Q;  3I4N G;  1Z9F A;  1SR3 A;  1NE3 A;  1UWV A;  2MFI A;  4AIM A;  2KHI A;  3L0O A;  2R7Z H;  1EIF A;  4DUZ L;  1VQD A;  4A3G G;  2BA0 A;  2ZTD A;  1YIT A;  1G29 1;  2AMC B;  3UDG A;  4DR1 L;  5IYB H;  1D7Q A;  1YIJ A;  2KEN A;  3H3V H;  1Y1W G;  3PUV A;  1XPO A;  1K8G A;  2D0P A;  4A3C H;  1PV4 A;  2NVQ H;  1UE1 A;  1EFW A;  1P8L A;  2MO1 A;  4JI7 Q;  1XPU A;  2VUM G;  4POF A;  4LFB Q;  2QGQ A;  5ELN A;  4LFC L;  1SFO H;  1KQS A;  3NEN A;  2AHO B;  2PI2 E;  3EIV A;  1KC8 C;  4IPD A;  4LF4 Q;  3F2C A;  4PZ8 A;  3HOW G;  4DAM A;  4BY7 G;  3M85 A;  1NBW A;  1QUQ B;  1LM0 A;  2VS1 A;  2K4K A;  2RHQ B;  3CQZ H;  2ZJR A;  3MXN B;  2UUB L;  1SE8 A;  3AEV A;  4NB3 A;  1OXX K;  4O2D A;  4IO9 A;  4GOP A;  2IT1 A;  4LF6 Q;  3U4V A;  4A3L G;  5FJ8 G;  1I94 Q;  4LWC A;  1YJN A;  2PQA B;  1HZB A;  5C4J H;  1WI5 A;  2VY3 A;  1YHQ A;  5LMN L;  1XMO Q;  4JI3 L;  1OTC A;  4BXX H;  4WJ4 A;  4UY8 C;  2JA8 G;  1Q81 C;  1FVI A;  2H5X A;  2L15 A;  4JI1 L;  1QZG A;  4IFD I;  1PH5 A;  3J80 c;  2WFW A;  2XGT A;  2VQE L;  2UXD Q;  3BU2 A;  4DK6 C;  4LF7 L;  4KHZ A;  1PH9 A;  5ELO A;  4UPA A;  2VQF Q;  3HFZ B;  1FJG Q;  3AYH B;  3M4O H;  2ID0 A;  2YV5 A;  2F4V L;  2WAQ G;  2CFM A;  1X65 A;  4MNO A;  4DV3 L;  1G51 A;  2E5L Q;  1XNR L;  5AJ3 L;  1N36 L;  5C0X I;  3STB D;  3GTK H;  3RN2 A;  4QJF A;  3G71 A;  2NZO A;  4UP8 A;  3D31 A;  4DUZ Q;  4B3S L;  1M90 C;  4KHP L;  2UUC Q;  4HJ8 A;  2Z6K C;  1U0L A;  5C4X H;  3TQY A;  4DV1 L;  1HNX L;  4C3J H;  2I5H A;  3BZK A;  4DV7 Q;  4JI6 L;  3KYH C;  1VQJ A;  3HOU H;  4UP7 A;  4GKJ L;  4DV0 L;  1NY4 A;  3OTO L;  4X65 L;  4HIO A;  1N34 L;  3T1Y Q;  4IJL A;  2QA4 A;  4QIW E;  1CKN B;  3CC7 A;  4DAY B;  4LFC Q;  1MIU A;  1SLJ A;  1LUZ A;  4R4Q A;  1Y1V H;  2OQ0 A;  4NPS A;  5GAH C;  2Q2U A;  3CD6 A;  3HOX H;  1VQE A;  3CCJ A;  2RHS B;  3STB C;  2Y0S E;  4A3D H;  1C7Y A;  4GN5 A;  5M3M G;  2V1C C;  1L2F A;  3MEF A;  4A3J G;  2R7D A;  1W3S A;  4AQY L;  1GD7 A;  1ASY A;  2UUB Q;  4JI0 Q;  3PO3 H;  3K8A A;  1VS0 A;  3K7A H;  1N8R C;  4JBW A;  4OX9 Q;  1IBL Q;  4X64 L;  3M4P A;  4IJH A;  1VQ5 A;  4JI5 L;  1XTD A;  3CCR A;  5LMN Q;  4YY3 L;  4A3F G;  3SGI A;  4JI1 Q;  2VNU D;  2C35 B;  3RNU A;  3GDE A;  2CWA A;  5JEA J;  3W5O A;  5LMU L;  2OQK A;  4A3B H;  2VQE Q;  1XPR A;  1YEZ A;  2VW9 A;  4LF7 Q;  1A8V A;  1XNQ L;  3OW2 A;  4X6A H;  1NMF A;  1NTG A;  3GD7 A;  3CF5 A;  1YI2 A;  3KLW A;  3PUZ A;  1VQ9 A;  1TWC H;  1EOV A;  5JJI A;  3CCM A;  3GTP H;  5C3E G;  4ME3 A;  3J80 i;  4DV3 Q;  3RZO H;  1XNR Q;  5AJ3 Q;  1N36 Q;  2GN5 A;  1S72 A;  1KRT A;  2JEA I;  4YHH Q;  2GVA A;  4PMW A;  3HOV G;  3S2H H;  4YWK A;  3F1Z A;  3KJP A;  1CKM A;  4GNX C;  4B3S Q;  3K7U C;  3RN5 A;  5J3B A;  3S2D H;  4A3M G;  4LFA L;  2R92 G;  3NEM A;  5IYC G;  1HZC A;  3FP9 A;  4DV1 Q;  1K9M C;  2K5N A;  3NEL A;  3TRE A;  3CCS A;  1C9O A;  4JI6 Q;  2NVX H;  2R93 G;  1JT8 A;  1V9P A;  4GKJ Q;  4DV0 Q;  2F52 A;  4DR5 Q;  1I3Q H;  4A3M H;  4X62 L;  5E7N A;  2WB1 E;  4X65 Q;  1N34 Q;  1VCI A;  2IX1 A;  3UDI A;  1AH9 A;  3K80 C;  3KJO A;  1S3O A;  2R7Z G;  1A62 A;  1HR0 L;  5JJK A;  5M5X H;  3S1M H;  3BJU A;  2OCE A;  4L5R C;  1HNZ Q;  3KDF B;  1FGU A;  4JG2 A;  3BZC A;  4PZ7 A;  4LUV A;  5IYB G;  1Q1B A;  3M3Y H;  4HID A;  2D62 A;  3U4Z A;  2ZJP A;  3K81 C;  3CXC A;  4HIM A;  4R4T A;  4HJ9 A;  4AQY Q;  4A3C G;  3KF8 B;  4X66 Q;  1VQ8 A;  1GM5 A;  3A5Z B;  2K50 A;  1TWG H;  2HHH Q;  4R4O A;  1PH8 A;  1N33 L;  2I5M X;  3GTJ H;  4YY3 Q;  3I7F A;  1N32 L;  1SRU A;  1O7I A;  4AYB G;  1Q7Y C;  4A3E G;  2JA6 H;  1J5E L;  3GTL H;  4DR4 L;  3UE1 A;  1I50 H;  4R1J A;  5LMU Q;  4GNX A;  1YBY A;  1VQF A;  1X9N A;  1TXY A;  3CAM A;  4UP9 A;  1UEB A;  2NN6 G;  4PZ6 A;  4B3M Q;  1YZ6 A;  1VQG A;  3J81 c;  1VQ4 A;  4A3E H;  2BA1 A;  1L1O C;  3RR5 A;  3E9H A;  3S16 H;  1UE7 A;  1EQR A;  4QGU A;  3TEH B;  1K73 C;  1PHJ A;  4DNI A;  1JE5 A;  4J15 A;  3KF6 A;  4BXX G;  3HKZ E;  2YTY A;  2CKZ B;  2BH8 A;  3ERS X;  4IOC A;  3HOY H;  1Q46 A;  2LXJ A;  1IBK Q;  1Q86 C;  4JBK A;  2YTV A;  2B3G A;  2I0Q A;  4LFA Q;  1VQI A;  2VL6 A;  2JA5 H;  4EX5 A;  4JI4 L;  3S15 H;  2D0O A;  3KF6 B;  1OXU A;  2WP8 J;  4GOP B;  3ULJ A;  1VQ7 A;  3UE0 A;  4GN4 B;  4P73 A;  4LF5 Q;  2RF4 A;  2CQO A;  3CCQ A;  1JMC A;  1VQN A;  2F3I A;  2YTX A;  3A74 A;  2B63 H;  1W2B A;  1BKB A;  2NVY H;  1QVG A;  2CWP A;  1Z47 A;  3PUW A;  1HR0 Q;  1I6H H;  5GAG C;  1IBM L;  4B3T L;  2N49 A;  1X55 A;  1RIP A;  1RL2 A;  2EIF A;  5C4X G;  2E2H H;  4NXM L;  1PH1 A;  4DR3 L;  4LW1 A;  3S1Q H;  3JAM c;  4BBS H;  4EQ5 A;  4P72 A;  5BR8 L;  3PIO A;  3HOU G;  1BBW A;  3D0F A;  2E2J H;  1KHI A;  1L1O A;  4BA1 I;  4DR1 Q;  2UXC L;  2LXK A;  1WJJ A;  1B7Y B;  2A1A A;  2K52 A;  4L5T A;  4OWW B;  3F2B A;  1N33 Q;  4AH6 A;  4DKA C;  1N32 Q;  3GTM H;  1Y1V G;  3S1R H;  4L5S A;  3H3V I;  3S14 H;  1IXR A;  1P16 A;  3EBE A;  1J5E Q;  3HOX G;  1X54 A;  3FHW A;  4IPG A;  2A8V A;  4DR7 L;  4A3D G;  1C0A A;  3S24 A;  2K5H A;  3TS2 A;  3PO3 G;  1YHB A;  4Y7N H;  2JA9 A;  1JB7 A;  2ASB A;  3GTG H;  5HGQ A;  2E8G A;  3PO2 H;  4TQU S;  4A76 A;  3CPF A;  4OO1 G;  4LNQ A;  4YCV A;  1UE6 A;  2VZA A;  4IFD J;  1PYS B;  1KIX A;  4GKK L;  1Q82 C;  4P74 A;  3J81 i;  4KHP Q;  4DUY L;  4DK3 C;  4BY1 H;  2UXB L;  2NN6 I;  1XJV A;  4A3B G;  2R7F A;  4JI3 Q;  1H95 A;  2IX0 A;  2K14 A;  5M5Y H;  1FL0 A;  1TWH H;  2N8N A;  1EUJ A;  1UE5 A;  2LSS A;  5IYD G;  4JI4 Q;  5C0X J;  2HIX A;  2E2I H;  1GVP A;  2K75 A;  4PG3 A;  3CC4 A;  4LF8 L;  5LMN W;  4DR6 L;  2EQS A;  2Z6K A;  4GN3 B;  1KXL A;  4ALP A;  3IRB A;  4A3K H;  5IYD H;  2OTJ A;  2F4V Q;  4JOI C;  5FLM H;  1WOC A;  2K5V A;  3RLO A;  1YVC A;  3HKS A;  4B3T Q;  4BA2 I;  4KI0 A;  2MQH A;  1G6P A;  2ATW A;  4R4C A;  4XTC S;  4R4I A;  1JJ2 A;  3UDX A;  2Q2H A; 
#chains in the Genus database with same CATH topology
 2FJ2 A;  3HOZ H;  2JN4 A;  1B9M A;  4LFB L;  2KCN A;  3TSS A;  2ZM6 L;  4K6L A;  1EYG A;  4NXM L;  3K7A B;  4LMQ D;  1OXS C;  3W1B A;  1LTL A;  3AQQ A;  3LGJ A;  3K5M A;  2BH2 A;  3ULP A;  3FKI H;  5KGU A;  1D8L A;  1J9O A;  2B2T A;  1YJW A;  2B2W A;  3HZX A;  4MTN A;  3M7N A;  1SMX A;  2JA6 G;  5C5M A;  4JBJ A;  1LO5 D;  5FLX c;  3KLS A;  3U58 A;  2A68 D;  1YHA A;  3OMG A;  1Y8P B;  3NUC A;  1CA6 A;  4LF8 Q;  1E3P A;  2EY5 A;  1XNQ Q;  3S2D B;  2Q8R E;  1Y8O B;  4JYA L;  1SNO A;  3HOY G;  4RFB A;  1C4Q A;  2E2D C;  3PV0 A;  1BCP D;  1GUN A;  4K5V A;  3CPW A;  1SYF A;  1ZXT A;  2XVS A;  5DLQ E;  4BBR G;  4DV7 L;  3BDC A;  4A3G H;  1HNW Q;  1QUQ A;  1VQP A;  3RZD H;  2PW7 A;  4CKB A;  1VQA A;  3PCO B;  5H1S E;  3R3O A;  2ZM6 Q;  1ILP A;  4RWS C;  4NXM Q;  1JB3 A;  2MNA A;  1TWG B;  3R93 A;  3VDY A;  4JI0 L;  4BBS G;  1MSH A;  2NVQ B;  2CH4 A;  3M9B A;  1TWF H;  1PRT B;  1I50 B;  3DLL A;  4GLV B;  1JC7 A;  2EXD A;  1HR0 W;  1EWI A;  1VQK A;  5FJ8 H;  1OXT A;  1CSQ A;  3S16 B;  1QVC A;  2JA8 H;  4LUZ A;  1KNE A;  2KEE A;  4DR2 L;  5IGC A;  4HSV A;  2F0H A;  3CP0 A;  3J7Z C;  2FHT A;  3JAM E;  2MJ8 A;  2GVB A;  1FNV A;  3K5N A;  2JE6 I;  1HUN A;  2PNH A;  4JYA Q;  3S1N H;  1NNX A;  1AE3 A;  1DCZ A;  1PZI D;  2N78 A;  1ZYR D;  4H02 A;  4WJW A;  1OXV A;  1R4Q B;  5GAE C;  3LWU A;  1LYL A;  1PTO C;  1TII D;  4KY7 A;  3NK9 A;  1I6H B;  4DR5 L;  1C48 A;  1W6J A;  3I8Z A;  2L1B A;  4M8A A;  3D4R A;  4IPC A;  3I4M H;  4H13 C;  5FLM G;  4JV5 L;  4OXP A;  2E2J B;  5C4X B;  1KD1 C;  4DU9 A;  2MO0 A;  3U9O A;  4GLX A;  1K3R A;  1BBU A;  4YWM A;  5CV5 A;  2HHH L;  2NVT H;  3HOZ G;  5M3M H;  2JJQ A;  4DR3 Q;  1A0I A;  1N9W A;  1Y1V B;  2C5C A;  1LT3 D;  3GTQ H;  3IKJ A;  1U5K A;  2CHB D;  4PV1 C;  3QOJ A;  3ERO A;  4IUV A;  4A3F H;  3NTI A;  2PZW A;  1AEX A;  1SYC A;  1EEI D;  4CJ1 B;  1X3G A;  4DR2 Q;  2R6G A;  1SNC A;  1VQH A;  5KEE A;  4KJO A;  3K5L A;  1GUT A;  3OSO A;  1KDA A;  1ONL A;  3FPU B;  5C3E H;  3G4S A;  1Y14 B;  1S4Z A;  2KUM A;  3J81 j;  1JOR A;  1MJC A;  3KOJ A;  3ZJY C;  2Z0S A;  2D2C C;  5C4Z A;  4JOI A;  1S5E D;  4IUR A;  5IGD A;  2R92 H;  1E24 A;  4FXG C;  2VQF L;  1GKH A;  2R93 H;  5M9O A;  3EFX D;  4JV5 Q;  4DR6 Q;  1SR3 A;  2B2V C;  2KHI A;  2BE5 C;  1FGB D;  5JPM C;  4RA8 A;  5M3F B;  4FXD A;  4A3G G;  2AMC B;  3UDG A;  5CR3 A;  2YU9 B;  5IYB H;  1D7Q A;  4I7Z C;  2KEN A;  3H3V H;  3MEH A;  1Q90 A;  5M5X B;  1EFW A;  4ZRZ A;  3HKZ B;  3M3Y B;  1PTO F;  2QGQ A;  1KQS A;  2A68 C;  4MTK A;  3NEN A;  1Z6H A;  1YNN D;  1KC8 C;  4IPD A;  4DXG A;  4U68 A;  4OL7 A;  1STG A;  2F0N A;  1JOQ A;  3M85 A;  1ICF B;  3E6Z X;  2K4K A;  4U67 3;  3TP7 A;  1SE8 A;  2UUB L;  5EJW A;  3AEV A;  4LF6 Q;  5FJ8 G;  2PQA B;  5IGE A;  1HZB A;  4ZUJ A;  4RHS A;  3A56 A;  4DK1 A;  4TKO B;  1YHQ A;  1LT5 D;  5JVG 3;  4WJ4 A;  4UY8 C;  2JA8 G;  1A15 A;  4KKT A;  4KMU C;  2H5X A;  4JI1 L;  5A2Q L;  3J80 c;  2WFW A;  2XGT A;  1PH9 A;  3SK8 A;  4UPA A;  2VQF Q;  3VR2 A;  2F0G A;  3DXJ C;  2WAQ G;  4BWG B;  1EYA A;  1X65 A;  2E5L Q;  1XNR L;  2O4X A;  5E4X A;  5C0X I;  3GTK H;  2BDN A;  3RN2 A;  4QJF A;  3G71 A;  4ZKB B;  1NR4 A;  5J22 A;  4KHP L;  2UUC Q;  2Z6K C;  1U0L A;  4WOR A;  3TQY A;  1HNX L;  2I5H A;  2M2L A;  2I46 A;  1VQJ A;  4C3I B;  3HOU H;  4DV0 L;  1NY4 A;  4GZY C;  3OTO L;  1JWU D;  4BY7 B;  4QIW E;  2FFK B;  4EQO A;  1SLJ A;  3S17 B;  4DAP A;  1A2U A;  4NPS A;  2Y0S E;  1C7Y A;  4GN5 A;  5M3M G;  2V1C C;  1L2F A;  3MEF A;  4ILW A;  1ASY A;  2UUB Q;  1UUP A;  5T1I A;  2R3Z A;  1EU4 A;  4MHE A;  1G2S A;  3K8A A;  1F77 A;  4JBW A;  1IBL Q;  4X64 L;  1QOH A;  1K3B C;  4IJH A;  1V1P A;  4HMJ A;  1XTD A;  3CCR A;  3L9A X;  1TQO A;  2K5W A;  4A3F G;  1ILQ A;  1R9T B;  1SSO A;  4JI1 Q;  2C35 B;  3PO2 B;  3RNU A;  2QCP X;  1WTV A;  3VR3 A;  2F4I A;  2B2T C;  5JEA J;  4L8J A;  2N55 A;  4OIK A;  3NTH A;  2VW9 A;  1A8V A;  5AFW A;  3MAQ A;  4KJN A;  3V2T A;  3RD4 A;  1EOV A;  3CCM A;  3GTP H;  5C3E G;  5M5W B;  4FO2 A;  1XNR Q;  5D3D A;  2GN5 A;  2B8G A;  2J0T D;  1NR2 A;  4YWK A;  2O2L D;  2SDF A;  1D1K A;  1PTO B;  1PRT D;  3KJP A;  3K7U C;  3RN5 A;  4LFA L;  2R92 G;  3FP9 A;  2F0Q A;  4A3K B;  2R93 G;  2IL8 A;  4Q5V A;  4DV0 Q;  5CV8 A;  1GUO A;  5E7N A;  5JPN C;  1LTG D;  5HGT A;  1CHQ D;  2DN8 A;  1VCI A;  5J1Z A;  5C4H A;  3UDI A;  1OO9 B;  1KAB A;  2LFN A;  2OCE A;  3KDF B;  3BZC A;  1KDC A;  5IYB G;  2ENB A;  1XWE A;  5E4W C;  1EQV A;  3K81 C;  2O5I C;  2G5D A;  4JPB W;  1TS4 A;  4R4O A;  1PH8 A;  1IL8 A;  1TWA B;  4DR4 L;  1J5E L;  3UE1 A;  4GNX A;  1X9N A;  3QIA A;  1D5M C;  1L1O C;  2K7V A;  4R8I A;  3E9H A;  3HOV B;  3OMC A;  1S5F D;  3NQT A;  1U9R A;  3OOC A;  3TEH B;  2OXP A;  4QGU A;  1HTL D;  2E76 C;  1GJX A;  2CKZ B;  2KHS A;  4IOC A;  4IUT A;  1WCM B;  2LXJ A;  4JBK A;  2YTV A;  1HFG A;  1ZKO A;  1WTW A;  4HN7 A;  4A93 B;  4XYO A;  2F03 A;  4LFA Q;  3S15 H;  2R7Z B;  1E2Z A;  1VQ7 A;  3UE0 A;  4GN4 B;  2RF4 A;  3CCQ A;  1JMC A;  2F3V A;  3A8K E;  4LJZ C;  1VMC A;  1BKB A;  5CYU A;  2BOS A;  2NWG A;  4G7O C;  1CHP D;  4B3T L;  1O7Z A;  1X55 A;  1STA A;  1RIP A;  1AP0 A;  2EIF A;  2ZXO A;  2E2H H;  4RGT A;  2Z4H A;  2F0P A;  2EDG A;  4P72 A;  4DAV A;  3HOU G;  1BBW A;  4K6D A;  2UXC L;  4BA1 I;  2L11 A;  1B7Y B;  4G7Z C;  2K52 A;  5JOB A;  1CQF A;  1LTT D;  3HOW B;  3S1R H;  3EBE A;  1J5E Q;  4IPG A;  3U9S A;  1F2Z A;  2F0W A;  2OT2 A;  3TS2 A;  2JA9 A;  2ASB A;  2E8G A;  5CC4 A;  1SMY C;  4TQU S;  4A76 A;  2EYP A;  2A69 D;  1QG7 A;  3KBX A;  5I9O A;  4YCV A;  1UE6 A;  4LNQ A;  1BCP B;  1ET6 A;  5ELD A;  4C3H B;  4N8F A;  4GKK L;  1Q82 C;  4P74 A;  4V19 0;  1QNU A;  3KUP A;  2K5Q A;  1H95 A;  2IX0 A;  2B39 A;  1H9M A;  2K1B A;  5K36 H;  5IYD G;  2XSC A;  5CMD A;  5C0X J;  2K75 A;  3IFT A;  4GN3 B;  2L9H A;  3IRB A;  5I2X A;  3MFG A;  2OTJ A;  1CM9 A;  4JOI C;  2IX3 A;  3OWE B;  3RLO A;  3HKS A;  2M00 A;  4B3T Q;  4CDC C;  5LL6 S;  1JJ2 A;  4DR7 L;  1TT2 A;  2RVL A;  3KK7 A;  3LNN A;  3K6O A;  2UXC Q;  3HOX B;  4NXN L;  4IAL A;  1PH3 A;  4A3D B;  2FXQ A;  1PH6 A;  1B44 D;  1PH2 A;  5C5L A;  1O80 A;  1EU3 A;  5HY6 A;  1I4P A;  1IZ6 A;  1AE2 A;  5C44 H;  4DV2 L;  2EY2 A;  3GTO B;  2PNR C;  4A3J B;  1CKO A;  3KLS X;  2EZV A;  2MGS A;  1V1Q A;  2AQ1 B;  2DJG C;  1V43 A;  1NAP A;  2EY1 A;  2NZH A;  2Z4I A;  4PQX A;  4ODG A;  3M4Q A;  1K83 H;  3BDO A;  4A3B B;  4APV A;  3SK4 A;  3BYT B;  4TVA B;  4GKK Q;  2Z9H A;  5C0X G;  1TWC B;  2CVR A;  1QWY A;  2HT1 A;  4JI5 Q;  4FDB A;  2UU9 L;  3RZO B;  4FF4 A;  4O42 A;  2AQ2 B;  2OWO A;  2RKS A;  2SNS A;  3E0E A;  3Q6S A;  4YCU A;  2F0F A;  1CI3 M;  1HH2 P;  3RMH A;  3Q0A A;  4MZ9 A;  3SK5 A;  3PUY A;  2KBN A;  1ROD A;  3BZD B;  1KDB A;  2XTI A;  1JCK B;  3O13 A;  5DEH A;  3PF5 A;  2JA7 H;  3NBH A;  4RCO A;  1KNA A;  4A3M B;  2KHJ A;  1XMQ L;  4XQQ A;  1NSN S;  2JK8 A;  3J7Y W;  3J81 L;  3TS0 A;  4OWX B;  4GLA C;  3C1F A;  4DR7 Q;  3MXN A;  2PO4 A;  5I4D A;  1PFB A;  4JI2 L;  3NBI A;  4NXN Q;  4BBR H;  2KCM A;  3MWY W;  2Y0S G;  2F0L A;  3FPP A;  1RHP A;  3WWV A;  1PZK D;  3TRZ A;  3C3L A;  3H15 A;  4DV2 Q;  3J7A 5;  4ZYS A;  1IL2 A;  1TS2 A;  3PIP A;  4NP5 A;  3CC2 A;  1YJ9 A;  1A3V A;  3RLN A;  4I7A A;  1PTO D;  2GA4 B;  1QB5 D;  4AYB B;  4A3E B;  4B3R L;  2UU9 Q;  4IPH A;  1PH7 A;  1SXT A;  2AWO A;  4PMB A;  5D3I B;  3Q8D A;  3KFU A;  3HOY B;  1DM0 B;  1I4X A;  3UDF A;  1L1O B;  2OF1 A;  2KCT A;  1ENC A;  3OW7 A;  4QL5 A;  3G7L A;  3A7L A;  1CKN A;  3VYS A;  1XMQ Q;  5K36 G;  2Q8I B;  3M4O B;  4JC0 A;  1KAW A;  3CCU A;  4QY7 A;  4LF9 L;  2RCF A;  3SXH A;  4JI2 Q;  1Q8K A;  2SOB A;  4C2M H;  4HAE A;  3S1Q B;  3AFQ A;  1NUC A;  2ES2 A;  2HIV A;  5G3L F;  1VF5 C;  1AFP A;  5EKL A;  3ER0 A;  4X66 L;  5IIF A;  2EYL A;  3GTM B;  2B29 A;  2QKI C;  5HUR A;  2WAQ E;  1S40 A;  4K14 A;  3MHB A;  4HR7 B;  1G2T A;  2DUD A;  5CGK A;  4RKL A;  5C44 G;  2CH4 W;  3CCE A;  3WOF A;  1LTA D;  2I5L X;  4B3R Q;  1TKW B;  4CBV A;  1YNX A;  3PO3 B;  3JAM i;  4B3M L;  1WYD A;  2B2U A;  1QIL A;  2PZT A;  2PMZ E;  2DGY A;  1EWH A;  1GUS A;  5EBC A;  3N52 A;  2BE5 D;  1EIY B;  1BR9 A;  4JCV E;  5FOB B;  1E1T A;  1S5C D;  2ZTE A;  2PQE A;  3SE0 A;  1XMO L;  5C6A A;  2A74 C;  2PCF B;  4QF4 A;  4P71 A;  4A75 A;  4DF7 A;  2UXD L;  4LF9 Q;  2RDF A;  4KD4 A;  1IYJ B;  1QNK A;  2Q2T A;  2E74 C;  3H3V C;  2JA7 G;  1NE3 A;  3OHX C;  1B53 A;  4K8J A;  4B9X A;  3HOZ B;  1B1Z A;  1MGS A;  2EYO A;  5KNC A;  1VQD A;  5FLX E;  3DEO A;  2Z1C A;  2BA0 A;  1G29 1;  1I3Q B;  4FNF A;  4DR1 L;  5COR A;  2KJX A;  5ELE A;  2O5J C;  2K5D A;  2D0P A;  3S9W A;  2NVQ H;  1UE1 A;  1STB A;  3S1M B;  3FKI B;  1XPU A;  1E2V A;  1DYQ A;  3I3C A;  3PMF A;  4LFB Q;  2AHO B;  4IUP A;  4OEM B;  1NBW A;  2VS1 A;  2NN6 H;  4NB3 A;  4O2D A;  3GTJ B;  4GOP A;  2IT1 A;  4F87 A;  3MA2 B;  1SYE A;  3DEP A;  4K5X A;  2SEB D;  5LMN L;  1XMO Q;  3D6C A;  1Q81 C;  1QZG A;  3T16 A;  2B8F A;  3ONA B;  1C8C A;  1HA6 A;  2XWJ B;  2UXD Q;  3UI2 A;  2QIL A;  3QG1 A;  3X3M A;  4KN4 C;  5FO8 B;  1N36 L;  1EOT A;  1IKL A;  2LS0 1;  3TP6 A;  2NZO A;  1JIC A;  4UP8 A;  3D31 A;  2MUY A;  1M90 C;  2XNA C;  2L5T A;  1LV9 A;  5C4X H;  2D9U A;  2L55 A;  4C3J H;  3BZK A;  4DV7 Q;  5CV6 A;  4UP7 A;  3SK6 A;  2OEO A;  4KTA A;  2KCC A;  4L6T B;  2F0T A;  1TWF B;  4IJL A;  4DAY B;  2BCO A;  1Y1V H;  2WII B;  2Q2U A;  2RHS B;  3STB C;  1TS3 A;  1LT6 D;  1RDP D;  2R7D A;  4JI0 Q;  2FIN B;  2Z8L A;  3T56 B;  4JW0 A;  5LMN Q;  4YY3 L;  1B2T A;  1ML0 D;  2A5H A;  2ZXP A;  3NWS A;  3A55 A;  3S1N B;  2CWA A;  3W5O A;  5LMU L;  5IOC A;  1XPR A;  1PFN A;  3C46 A;  4QUC A;  1NMF A;  3CHB D;  3GD7 A;  4PNY A;  1YI2 A;  3P1H A;  4ZQ3 A;  5JJI A;  4BY1 B;  1T5X D;  1A3U A;  3J80 i;  1DD2 A;  1N36 Q;  1SND A;  1UAP A;  5M5Y B;  3I4M B;  1EY7 A;  2WB1 B;  4PMW A;  1SJH D;  4NW2 A;  3F1Z A;  1BO0 A;  2H4O A;  3KBG A;  4E6I A;  1HZC A;  4UHV A;  1RCV D;  2K5N A;  3NEL A;  1C9O A;  1JT8 A;  4IUN A;  2TSS A;  4DR5 Q;  3OWF A;  4K2L A;  4X62 L;  5CV7 A;  2IX1 A;  1AH9 A;  1O7Y A;  3KJO A;  1S3O A;  1A62 A;  1HR0 L;  3SVM A;  5M5X H;  3C2P A;  2K01 A;  1RTO A;  1GXD C;  1X32 A;  4KKS A;  3MXU A;  4LUV A;  4PZ7 A;  3M3Y H;  5KND A;  2D62 A;  2ZJP A;  4HJ9 A;  4A3F B;  3KF8 B;  4XT3 B;  1K8M A;  5E1F A;  3A5Z B;  2K50 A;  1EY8 A;  2HHH Q;  3MFY A;  4QUF A;  4A3I B;  4YY3 Q;  3I7F A;  1SRU A;  2XWB B;  5JEA H;  1CA5 A;  2KVM A;  3A8I E;  4DNR B;  1EY4 A;  4R1J A;  5LMU Q;  1YBY A;  1TXY A;  3CAM A;  2NN6 G;  3J81 c;  1VQG A;  3H0G B;  1MI2 A;  1EQR A;  4UDU C;  1TS5 A;  2K05 A;  3KF6 A;  2JYO A;  4KY6 A;  3K57 A;  3TP8 A;  5DNF A;  1G8Z D;  1VQI A;  2L12 A;  2VL6 A;  4MIU A;  2JA5 H;  4JI4 L;  1PYW D;  1EY0 A;  2WP8 J;  3BVZ A;  1D1I A;  5I2Y A;  5KNB A;  1A2T A;  5EGT A;  3I4N B;  5FKA C;  2YTX A;  2B63 H;  4CKC A;  1W2B A;  2NVY H;  2CWP A;  3QR8 A;  1HR0 Q;  2QEJ C;  5GAG C;  4P2C B;  2C9O A;  2ZT9 C;  3QO2 A;  1IBM L;  1LTB D;  1I4R A;  1SMY D;  5C4X G;  1WTP A;  4RHR A;  1PH1 A;  1Y1W B;  4C3J G;  1F2M A;  4HMI A;  3J80 E;  3NQI A;  2EJM A;  1KHI A;  1ET9 A;  1BDO A;  2LXK A;  1WJJ A;  4L5T A;  3V96 A;  5LL6 X;  3I72 A;  4AH6 A;  3FRP B;  4C1N K;  2PYK A;  1Y1V G;  4HED A;  2LY7 A;  3S14 H;  2A8V A;  1P16 A;  3Q23 A;  2K5H A;  1EY5 A;  4Y7N H;  1JB7 A;  2LKV A;  5HGQ A;  3MXP A;  1QCB D;  3PO2 H;  4KV6 A;  2MP1 A;  1PYS B;  1KIX A;  1IYU A;  1UEA B;  3URY A;  2B2U C;  2B2Y A;  2UXB L;  2RSN A;  1TWH H;  4JI4 Q;  2X6L A;  2HIX A;  2E2I H;  1GVP A;  3CC4 A;  1BF4 A;  2B2W C;  2EYJ A;  4A3K H;  5IYD H;  4PMC A;  2WIN B;  3I90 A;  3PIP 3;  5I9P A;  3K0Y A;  3CRL C;  2HUG A;  1HTP A;  2ATW A;  4R4I A;  2A6E C;  4KHP Q;  3I56 A;  5ELB A;  2AWN A;  5G3L D;  1HNX Q;  3DM1 A;  3ND8 A;  1VQC A;  1D6E C;  3OTO Q;  2WKD A;  3HKZ G;  4KD3 A;  4KLK A;  2IJ0 A;  3T13 A;  3I55 A;  1CUK A;  1TWA H;  3PSI A;  2SNM A;  3GQB A;  3HP3 A;  4EVO A;  1SJE D;  5L37 A;  2WV6 D;  2F0D A;  5GQO A;  3E9I A;  3PF4 A;  5JEA G;  4X64 Q;  4HIK A;  2ICE C;  4IUQ A;  2UXB Q;  5KYI A;  4GOP C;  4H44 C;  1EQQ A;  4JBM A;  5C0X H;  3G6E A;  1WTX A;  1WCM H;  1I4G A;  4XT1 B;  2JQO A;  3NSW A;  4A93 H;  3SEB A;  2CQA A;  1RF2 D;  3D4W A;  1CSP A;  1SEB D;  1B50 A;  3K0X A;  2JA5 G;  1M1K C;  4RH6 A;  1KL9 A;  3D4D A;  1I5F A;  1Q1E A;  3T1Y L;  1GHJ A;  2B63 G;  3WOE A;  3NBH B;  3DWA A;  5BN3 A;  2PQA A;  2CCZ A;  2VUM H;  2PW5 A;  1PFS A;  4X3T A;  4XQJ A;  3X3N A;  3W1G A;  2J7Z A;  3HOW H;  4OX9 L;  3D3R A;  4RG1 A;  1NJI C;  4DV6 L;  3QJY A;  5IY0 A;  4HJ5 A;  1WTR A;  1H9K A;  3DM3 A;  2K6A A;  3GP7 A;  5EPK A;  5IP9 G;  3A0J A;  1E22 A;  4DGZ A;  1L0W A;  4C3H H;  1KAA A;  1X3E A;  2KEC A;  1VMP A;  2F0U A;  1K0R A;  3JAM L;  2I07 B;  3PO2 G;  4DR4 Q;  5C4J B;  4B08 A;  2Q2I A;  4JI8 L;  3I4O A;  5EKK A;  2A6H C;  1MBY A;  4AYB E;  4QQB X;  3V05 A;  4YHH L;  1G91 A;  3S15 B;  3PUX A;  4QIW B;  4O0A A;  3TDQ A;  4DFA A;  2J4X A;  2QEX A;  4KHV A;  1PYB A;  4YCW A;  1MJE A;  2TMP A;  5GAD C;  1TY0 A;  3BVG A;  3PQI A;  2E2H B;  4A3K G;  1E2W A;  1HJP A;  4YIJ A;  3H91 A;  5JJZ A;  4K0K L;  2JEB I;  2ALY B;  1V8Q A;  1DOM A;  5IT9 c;  4DPG A;  1HNZ L;  5I6Y A;  2F0V A;  3OPO A;  4K5W A;  1HXY D;  3TBI B;  4RKB A;  3VA5 A;  3RUZ A;  1AZP A;  1CT1 D;  4CGY B;  3S1R B;  4DV6 Q;  3GTO H;  1DOL A;  4A3J H;  1J6Q A;  3B6Y A;  1KTK A;  4RAU C;  5KYL A;  4DK0 A;  2PPB C;  4QCL A;  2DNC A;  2RCN A;  5DM6 3;  1TR5 A;  5IE8 A;  4IUU A;  2YYZ A;  3W2D A;  1Y69 U;  1B70 B;  3M4Y A;  1HZ9 A;  2WKC A;  3R8B A;  4DXF A;  3QB3 A;  2QW7 A;  4JI8 Q;  2F0K A;  4P75 A;  4XXE A;  1SE4 A;  1IBK L;  5JVH 3;  1X56 A;  4I65 A;  4S3S A;  1LAC A;  1PMR A;  2EYF A;  4L5Q A;  2N3S A;  1WCM G;  3KDF A;  3CMA A;  2HQL A;  4LF5 L;  4A93 G;  1VQL A;  5IYC H;  4OO1 I;  3CCV A;  4K0K Q;  3S2H B;  1CZW A;  4ULL A;  5K5P A;  3NHH A;  5DAU A;  4AIM A;  1UWV A;  5EBD A;  4EQP A;  4FF3 A;  1EIF A;  1CFM A;  2NVX B;  1WTQ A;  1IW7 C;  3P20 A;  1LTR D;  1SNP A;  1STN A;  5C44 B;  1DJR D;  3EVQ A;  1ZEQ X;  1K8G A;  1STY A;  1GOZ A;  1P8L A;  1AZQ A;  1LTI D;  2VUM G;  2EYM A;  4FF1 A;  4POF A;  3A7A B;  1SFO H;  1ENA A;  5ELN A;  4LFC L;  1K83 B;  2PI2 E;  1FNW A;  1QE6 A;  3F2C A;  3HOW G;  3ND9 A;  2ZJR A;  1QUQ B;  1LM0 A;  2RHQ B;  3CQZ H;  4ABN A;  3C1E A;  4IO9 A;  3N6R A;  4LWC A;  1YJN A;  2K28 A;  2JA6 B;  2BDO A;  1D5Z C;  3GTL B;  1WI5 A;  1OTC A;  4JI3 L;  3J7A V;  2B2V A;  4C3H G;  2N88 A;  3HRZ C;  1FVI A;  5KRU A;  1BUV T;  4IFD I;  5A2Q E;  2VQE L;  2HCC A;  3BU2 A;  4DK6 C;  4KY5 A;  1HRJ A;  4LAA A;  4KHZ A;  1HPC A;  3M4O H;  2ID0 A;  4J8Q A;  2YV5 A;  2F4V L;  2B2Y C;  3AB9 A;  1LAB A;  2CFM A;  1G51 A;  1H9R A;  5AJ3 L;  3STB D;  1J8I A;  5CV4 A;  3T53 B;  4BBR B;  1PXU A;  4LK1 C;  4B3S L;  4KN7 C;  4HJ8 A;  4DV1 L;  4JI6 L;  1O7L A;  4GKJ L;  4TSS A;  1N34 L;  3IL8 A;  3H09 A;  4LFC Q;  1MIU A;  4BBS B;  2OQ0 A;  3CD6 A;  3CCJ A;  1SE2 A;  1FYC A;  3BDL A;  4QMG A;  3DWP A;  4A3J G;  3PO3 H;  5DM7 3;  1VS0 A;  3K7A H;  1VQ5 A;  4OO1 H;  1A6X A;  3GTG B;  3SGI A;  3VYT A;  3I70 A;  1MD2 D;  2VQE Q;  1WD0 A;  1XNQ L;  1RTN A;  3OW2 A;  4FP5 D;  2VB2 X;  3CF5 A;  1EIG A;  2NYZ D;  5CV9 A;  3K59 A;  3Q24 A;  4ME3 A;  2NTS A;  5AJ3 Q;  4N9T A;  4F7X A;  1S72 A;  1KRT A;  4IN3 A;  1JOK A;  4B3S Q;  4GNX C;  1CKM A;  3HG9 A;  3S2D H;  4A3M G;  5EQ0 A;  3NEM A;  5IYC G;  2D5D A;  4DV1 Q;  3P7J A;  3TRE A;  3BYY B;  1K9M C;  4JI6 Q;  4G57 A;  5CBE E;  4ID6 A;  4GKJ Q;  2HDM A;  3BG3 A;  1I3Q H;  2HD3 A;  2WB1 E;  1N34 Q;  4ME5 A;  1HQR D;  3K80 C;  3OIQ A;  2F1M A;  1YNJ C;  2F0S A;  1SYB A;  3S1M H;  4L5R C;  5CBA E;  1FGU A;  4JG2 A;  1Q1B A;  1LT4 D;  4IFD H;  3CXC A;  1HUM A;  4R4T A;  4HIM A;  1XYI A;  4ZUI A;  3WDN A;  2CW0 C;  4X66 Q;  1VQ8 A;  1GM5 A;  2RA4 A;  2MPM A;  3IAY A;  1TWG H;  1N33 L;  4F8M A;  3GTJ H;  1AW7 A;  5ELF A;  1N32 L;  1O7I A;  4OEL B;  4AYB G;  4UAI A;  4A3E G;  1CK1 A;  3BS1 A;  3H6M A;  1I50 H;  2M9V A;  1VQF A;  2KQ3 A;  3FMC A;  4R8N A;  4UP9 A;  4B3M Q;  1YZ6 A;  1Q8I A;  2BA1 A;  1MHW C;  1BQQ T;  3LX0 A;  3S16 H;  1UE7 A;  3K58 A;  4FXK C;  4DNI A;  1JE5 A;  3HKZ E;  2YTY A;  1IHZ A;  2BH8 A;  3ERS X;  1BBX C;  4FF2 A;  1II3 A;  3W3A A;  2B3G A;  5IOD A;  1NCV A;  1PZJ D;  4EX5 A;  2D0O A;  3KF6 B;  3ERQ A;  4P73 A;  4CDD C;  1JWS D;  3A74 A;  3G6J B;  2KA7 A;  2AUK A;  1QVG A;  5C3W A;  1Z47 A;  3PUW A;  4X3S A;  1I6H H;  4A3G B;  3MVV A;  2K33 A;  1I6V C;  1H9S A;  3RZD B;  3SHL A;  2F0J A;  5EKI A;  4DR3 L;  1M8A A;  3JAM c;  2MHV A;  4EQ5 A;  3PIO A;  3D0F A;  1PFM A;  2E2J H;  4M1U B;  2H1E A;  1L1O A;  4DR1 Q;  2Z6B A;  1RJT A;  2A1A A;  2AUJ D;  4OWW B;  1N33 Q;  2EJG C;  1B3A A;  1K28 A;  3E0J A;  3SDZ A;  1N32 Q;  4KK7 A;  1GHK A;  4L5S A;  3H3V I;  1IXR A;  1X54 A;  3FHW A;  2DNE A;  5NUC A;  1C0A A;  3S24 A;  1EZ6 A;  3PO3 G;  2QDB A;  3EJI A;  1CTM A;  2E75 C;  3CPF A;  4EQN A;  4OO1 G;  4IFD J;  2JA8 B;  1WTO A;  3J81 i;  4DUY L;  2A6E D;  4BY1 H;  5IT9 L;  3CKI B;  1XJV A;  1V1O A;  5M5Y H;  1UE5 A;  2LSS A;  4O1N A;  2KED A;  2WAQ B;  4PG3 A;  3BVM A;  1HQM C;  2EQS A;  4DR6 L;  5J39 A;  1B4O A;  2QF7 A;  1KXL A;  1V1P B;  4C3J B;  1BXT A;  1WOC A;  2K5V A;  4NMZ A;  3FDT A;  1YVC A;  3T51 B;  4FVM A;  1Y8N B;  2MQH A;  1KLG D;  1G6P A;  1SDF A;  2PMZ B;  4XTC S;  3UDX A;  2A19 A;  2JP1 A;  1F9R A;  3GO5 A;  5IGG A;  1EQT A;  5M3F H;  1PVO A;  1DON A;  3G48 A;  1CQV A;  3FKI G;  5A35 A;  3EQL C;  2YU9 H;  3NPP A;  2NVT B;  1A63 A;  4A3I H;  5M3M B;  4IFD G;  3D6W A;  1HA5 A;  4HJA A;  4LF6 L;  1XX8 A;  4HJ7 A;  3I4L A;  1QVF A;  2R61 A;  5EPL A;  3GTQ B;  1S5D D;  3ICE A;  3F2D A;  4CJ0 B;  2DY7 A;  5GRO A;  4IOA A;  4LUO A;  4YWL A;  1AN8 A;  3H0G H;  5ISR A;  5BN5 A;  4POG A;  1JJC B;  4DUY Q;  5EAY A;  1PDQ A;  2EE1 A;  1HZA A;  3U50 C;  3AFP A;  2F0I A;  1QJO A;  2PI2 A;  1X3P A;  1X6O A;  5C3E B;  2QDL A;  2E5L L;  5IGB A;  5IP7 H;  1UNS A;  1VDZ A;  1VQ6 A;  3I2Z A;  2IW3 A;  4J6H A;  1S5B D;  2F0O A;  1WFQ A;  5E3F A;  4KKU A;  1JJG A;  2UUC L;  3I4N H;  2R92 B;  5JJL A;  2NUC A;  4GNX B;  2R93 B;  5T1G A;  4G7H C;  3L2P A;  1B3Q A;  1SNQ A;  3J81 E;  2ZTC A;  3TP5 A;  3L7Z C;  1DGS A;  4RCN A;  1Y1W H;  1T9H A;  2JSO A;  3NXW A;  2AQ3 B;  1HHV A;  3ULL A;  3CRK C;  4Y52 H;  4X62 Q;  2X69 A;  5D65 A;  3J7A F;  1X3Q A;  4DV4 L;  1NMG A;  2A6H D;  4C3I H;  1ASZ A;  5IWA L;  1F2Y A;  4BY7 H;  1BCP C;  1E7Z A;  1IBL L;  1BNZ A;  2XN9 C;  1XTC D;  1X3F A;  1G6Z A;  1QZH A;  1ENF A;  3S17 H;  4A3L H;  2DY8 A;  1SYD A;  1VQM A;  1SRO A;  3PGZ A;  4ZLT F;  3E5S A;  2UUA L;  2X6G A;  3F8T A;  3QWN A;  4QB4 A;  3ZYY X;  3T1H L;  1BVS A;  5FO9 B;  4CJ2 C;  1SBB B;  3M7G A;  5IP9 H;  5LHY 1;  3E3X A;  2AKW B;  3HGB A;  1R9T H;  4CHT B;  2JA5 B;  3EN2 A;  4BY1 G;  4DAY A;  3LWE A;  4HCS A;  5KIX A;  1IKM A;  4K8I A;  2B63 B;  3I4M G;  2WB1 G;  1GO3 E;  4V0B A;  4IQZ A;  2NVY B;  4RGO S;  1VQB A;  3RLF A;  5M5W H;  4GS3 A;  3TZD A;  4DV5 L;  1M4V A;  3GV3 A;  3GTK B;  1Q12 A;  2HDL A;  1KRS A;  2FMM A;  1PA6 A;  2IY5 B;  1VQO A;  1PTO H;  3KLR A;  2G9D A;  3R2T A;  3T4A C;  4JK1 C;  1A3T A;  2JXM B;  1E1O A;  2K03 A;  4J1M A;  1B8A A;  1F9P A;  1LLR D;  4DV4 Q;  5BN4 A;  3HOU B;  1ZYR C;  5IWA Q;  1U4P A;  1K8A C;  1IBM Q;  5IGF A;  2P5Z X;  3S14 B;  1Q3L A;  3CW2 C;  4R9W A;  1L0Y B;  5M3F G;  4Y7N B;  3MTS A;  1DZ1 A;  4JI7 L;  1TVX A;  1B9N A;  2EYH A;  1SYG A;  2IHF A;  2UUA Q;  4OWT B;  4RMF A;  4A3I G;  3T1H Q;  3GV6 A;  4LF4 L;  1K0S A;  1TY2 A;  1WTH A;  4CKE A;  3VA7 A;  1R4P B;  4DA2 A;  4OON A;  1SE3 A;  4BS9 A;  1TU2 B;  2VXW A;  4XIG S;  1I94 L;  3H0G G;  4ZAI A;  1TWH B;  3OYY A;  4CDF C;  1EEF D;  2IHE A;  1IW7 D;  1SN8 A;  1U4L A;  4H0L C;  4ZCK A;  2E2I B;  4EGV A;  1PH4 A;  3IFD A;  1E0B A;  2F0M A;  3A5U A;  3CCL A;  1SNM A;  4A4I A;  3HOV H;  4XDX A;  2RBM A;  1BCP F;  4WJ3 M;  4Z9C B;  3GTP B;  2OTL A;  4DV5 Q;  5I6W A;  5IP7 G;  1JR0 D;  1FJG L;  1MKH A;  1W6K A;  3KF8 A;  2XRS D;  1GUG A;  3CME A;  3JC6 6;  3I4N G;  1Z9F A;  2KOL A;  2MFI A;  1U4R A;  1EY6 A;  5FLX L;  1WD1 A;  3L0O A;  2R7Z H;  1STH A;  4DUZ L;  1JE4 A;  2ZTD A;  4WRD A;  1YIT A;  1YIJ A;  4OIJ A;  1Y1W G;  3PUV A;  1XPO A;  4A3C H;  1PV4 A;  2HQE A;  4CDE C;  2MO1 A;  3D8G A;  4DN4 M;  4JI7 Q;  3A8J E;  3L3O C;  3H94 A;  3EIV A;  3DUZ A;  4C3I G;  2ZXR A;  4LF4 Q;  4PZ8 A;  4DAM A;  3Q22 A;  4BY7 G;  3MXN B;  1STE A;  2RSO A;  4A3L G;  1OXX K;  2VNU D;  2G9H D;  3U4V A;  1I94 Q;  4TRD A;  3I73 A;  5C4J H;  4L63 B;  2VY3 A;  4HSP A;  4BXX H;  1XXG A;  2L15 A;  2EXZ A;  1PH5 A;  3AU7 A;  4LF7 L;  2IWH A;  2V4D A;  4DNT B;  1YNN C;  5ELO A;  3VR6 A;  4ZK9 B;  1FJG Q;  3HFZ B;  3AYH B;  4RGM A;  4NKL A;  3EA6 A;  3FVQ A;  4MNO A;  3TZU A;  5FK9 C;  4DV3 L;  3VYR A;  3MZ5 A;  4RGN A;  3NWT A;  4DUZ Q;  3AMU A;  2DJF C;  4Q0F A;  1DOK A;  2VUM B;  1JWM D;  2Y0S B;  3KYH C;  3NTK A;  4N9P A;  4X65 L;  4HIO A;  2IPK D;  3T1Y Q;  2QA4 A;  1CKN B;  3CC7 A;  2NB0 A;  1MSG A;  1EFI D;  4N8X 1;  1LUZ A;  4R4Q A;  2RQX A;  5GAH C;  3HOX H;  1VQE A;  4A3D H;  1F9Q A;  2ZJQ A;  3TN2 A;  1IYV A;  1RKN A;  1W3S A;  1GD7 A;  4AQY L;  1EIH A;  1N8R C;  4OX9 Q;  3M4P A;  3FEW X;  1I4Q A;  2HCI A;  4JI5 L;  1F9S A;  1ICW A;  4ZKC B;  4H7B A;  2WAC A;  5IT9 E;  2EPB A;  1U4M A;  1I4H A;  3GDE A;  3QOL A;  2OQK A;  4A3B H;  1HFN A;  2NBF A;  1YEZ A;  4LF7 Q;  4X6A H;  1NTG A;  2F3W A;  3KLW A;  3PUZ A;  1VQ9 A;  1HCZ A;  1TWC H;  3R2I A;  3MC0 B;  1YNJ D;  1EWC A;  1D2B A;  2RDH A;  4DV3 Q;  3RZO H;  3A54 A;  1L0X B;  4YHH Q;  2JEA I;  4XYQ A;  2GVA A;  3HOV G;  3S2H H;  1EL0 A;  2CW0 D;  3PIO 3;  2A73 B;  5COY A;  5J3B A;  3NP8 A;  4X3U A;  3CCS A;  2XIW A;  2NVX H;  1V9P A;  2RDG A;  1DXM A;  2F52 A;  2F0E A;  2ICI A;  4A3M H;  4X65 Q;  2K04 A;  2EJF C;  2R7Z G;  1RD9 D;  1FD7 D;  5JJK A;  3BJU A;  1HNZ Q;  2L0C A;  4HID A;  3SR1 A;  3U4Z A;  4AQY Q;  4A3C G;  4IZ8 A;  1PRT C;  1O78 A;  4C56 C;  4B9W A;  2I5M X;  4OHJ A;  3VR4 A;  4NDX A;  5JAV A;  4FYD A;  1CZG A;  2VB3 X;  3P75 A;  1ESR A;  1T5E A;  1Q7Y C;  2JA6 H;  3GTL H;  4OGQ C;  1UEB A;  4PZ6 A;  1VQ4 A;  4A3E H;  3DHQ A;  3RR5 A;  1K73 C;  1PHJ A;  4J15 A;  4BXX G;  3VR5 A;  4K2K A;  1Z7T A;  2LMC B;  3MXG A;  3HOY H;  1Q46 A;  1IBK Q;  2NZ1 D;  1Q86 C;  3CU7 A;  2I0Q A;  1WVL A;  1JQY D;  2K32 A;  2EVB A;  2XRQ D;  4C1N I;  1OXU A;  4X3K A;  5D14 A;  4GOP B;  3ULJ A;  4LF5 Q;  2CQO A;  2FMC A;  3ITP A;  2JA7 B;  1VQN A;  2F3I A;  3DMU A;  1EZ8 A;  5TSS A;  3F2U A;  1JOO A;  2N49 A;  1RL2 A;  3J80 L;  4LW1 A;  4MN3 A;  3I91 A;  1FR3 A;  1SFO B;  3S1Q H;  4BBS H;  5BR8 L;  1H9J A;  1LTS D;  3HS0 C;  1K8O A;  3F2B A;  3CQZ B;  1H9S B;  1GUW A;  4DKA C;  2PZU A;  3GTM H;  1VF7 A;  4G4K A;  3VYU A;  3HOX G;  4A3D G;  1YHB A;  3GTG H;  1EYD A;  4HCE A;  1D5X C;  5F2D A;  1ESF A;  2EY6 A;  2VZA A;  2L4N A;  2NTT A;  1EY9 A;  3OIP A;  4DK3 C;  3DWQ A;  5ELC A;  2NN6 I;  4A3B G;  2R7F A;  4JI3 Q;  2K14 A;  1FL0 A;  2N8N A;  1EUJ A;  1PRT F;  2Q8T A;  5C3X A;  1KLU D;  4LF8 L;  5LMN W;  2Z6K A;  3K5O A;  4XQN A;  4ALP A;  1BOS A;  1FNU A;  1EYC A;  5EPJ A;  2F4V Q;  5FLM H;  5FO7 B;  4F88 A;  4HTH A;  2A69 C;  3NE5 B;  4BA2 I;  2EOT A;  3HEJ A;  4KI0 A;  3TME A;  4WFN 3;  1F2L A;  4C2M B;  4R4C A;  1HNW L;  1PLF A;  4JVZ A;  5BR8 Q;  1SAP A;  2Q2H A; 
#chains in the Genus database with same CATH homology
 3I56 A;  2A19 A;  2AWN A;  2UXC Q;  3GO5 A;  4NXN L;  1HNX Q;  3HOZ H;  4LFB L;  1PH3 A;  2FXQ A;  1PH6 A;  5M3F H;  1PH2 A;  1PVO A;  3G48 A;  2ZM6 L;  5HY6 A;  3FKI G;  1EYG A;  1IZ6 A;  1VQC A;  3OTO Q;  1AE2 A;  3HKZ G;  4KLK A;  5C44 H;  4DV2 L;  2YU9 H;  1OXS C;  1A63 A;  4A3I H;  4IFD G;  3W1B A;  1CKO A;  1LTL A;  3AQQ A;  3LGJ A;  3I55 A;  4HJA A;  2BH2 A;  4LF6 L;  3ULP A;  3FKI H;  1CUK A;  1TWA H;  1V1Q A;  3PSI A;  1D8L A;  4HJ7 A;  1V43 A;  1QVF A;  2NZH A;  3ICE A;  3F2D A;  3M4Q A;  1K83 H;  5GRO A;  4LUO A;  4APV A;  1YJW A;  4IOA A;  4YWL A;  4MTN A;  5GQO A;  4TVA B;  3H0G H;  3E9I A;  4GKK Q;  3M7N A;  3PF4 A;  5C0X G;  1SMX A;  4POG A;  1JJC B;  5JEA G;  4X64 Q;  4DUY Q;  4HIK A;  2JA6 G;  5EAY A;  2HT1 A;  4JI5 Q;  2UXB Q;  1HZA A;  4JBJ A;  4FDB A;  5FLX c;  2UU9 L;  3U50 C;  4GOP C;  3AFP A;  1EQQ A;  2OWO A;  3U58 A;  4JBM A;  3G6E A;  3E0E A;  2PI2 A;  1WCM H;  1YHA A;  4YCU A;  2JQO A;  1HH2 P;  1X6O A;  4LF8 Q;  4A93 H;  4MZ9 A;  2E5L L;  1E3P A;  5IP7 H;  1XNQ Q;  1VQ6 A;  3I2Z A;  3PUY A;  4JYA L;  2KBN A;  1CSP A;  2XTI A;  3HOY G;  1WFQ A;  1JJG A;  3PF5 A;  2JA7 H;  3PV0 A;  2UUC L;  3I4N H;  2KHJ A;  3CPW A;  5JJL A;  1XMQ L;  3K0X A;  4GNX B;  5DLQ E;  2JK8 A;  4DV7 L;  1M1K C;  4BBR G;  2JA5 G;  1KL9 A;  3L2P A;  4A3G H;  1QUQ A;  4OWX B;  3TS0 A;  4GLA C;  4DR7 Q;  1HNW Q;  1VQP A;  1I5F A;  3RZD H;  2ZTC A;  4JI2 L;  1Q1E A;  3T1Y L;  3L7Z C;  1DGS A;  1Y1W H;  4NXN Q;  2B63 G;  4BBR H;  1VQA A;  2KCM A;  3NBH B;  3PCO B;  1T9H A;  5H1S E;  2ZJQ A;  2Y0S G;  2PQA A;  2CCZ A;  3ULL A;  2ZM6 Q;  3WWV A;  4Y52 H;  4X62 Q;  4NXM Q;  3TRZ A;  2VUM H;  2MNA A;  3H15 A;  1PFS A;  4DV2 Q;  3J7A 5;  3VDY A;  4DV4 L;  1NMG A;  4JI0 L;  4C3I H;  3W1G A;  1ASZ A;  1IL2 A;  4BBS G;  3PIP A;  3CC2 A;  5IWA L;  1YJ9 A;  3HOW H;  4OX9 L;  4BY7 H;  4RG1 A;  1NJI C;  1E7Z A;  3M9B A;  1IBL L;  1TWF H;  4DV6 L;  5IY0 A;  4HJ5 A;  1X3F A;  3RLN A;  3DLL A;  1QZH A;  4GLV B;  3S17 H;  2EXD A;  1HR0 W;  4A3L H;  3DM3 A;  1EWI A;  1VQK A;  5FJ8 H;  1OXT A;  1CSQ A;  1VQM A;  1SRO A;  3PGZ A;  2UUA L;  3F8T A;  5IP9 G;  4B3R L;  3A0J A;  1E22 A;  1BVS A;  3T1H L;  1QVC A;  2UU9 Q;  2JA8 H;  4IPH A;  4LUZ A;  1L0W A;  2AWO A;  4C3H H;  1PH7 A;  1X3E A;  3Q8D A;  4DR2 L;  1K0R A;  4DR4 Q;  3PO2 G;  3KFU A;  3CP0 A;  5IP9 H;  3UDF A;  3J7Z C;  2Q2I A;  4JI8 L;  2GVB A;  3I4O A;  1L1O B;  2AKW B;  2JE6 I;  4AYB E;  2KCT A;  4QQB X;  2PNH A;  1R9T H;  4YHH L;  4JYA Q;  1HNW L;  3EN2 A;  3PUX A;  3S1N H;  1AE3 A;  4QL5 A;  2N78 A;  4BY1 G;  4O0A A;  4H02 A;  1CKN A;  1OXV A;  5GAE C;  2QEX A;  1LYL A;  1XMQ Q;  3I4M G;  2WB1 G;  1PYB A;  5K36 G;  1GO3 E;  4YCW A;  1MJE A;  4JC0 A;  1KAW A;  3CCU A;  1VQB A;  4QY7 A;  3RLF A;  5M5W H;  4DR5 L;  4GS3 A;  4DV5 L;  4LF9 L;  5GAD C;  4JI2 Q;  4IPC A;  1Q12 A;  3I4M H;  1KRS A;  1Q8K A;  4A3K G;  1HJP A;  4C2M H;  1PA6 A;  4K0K L;  2IY5 B;  2JEB I;  1VQO A;  3AFQ A;  2ES2 A;  2ALY B;  2HIV A;  5FLM G;  4JV5 L;  5IT9 c;  4OXP A;  4DPG A;  1HNZ L;  1E1O A;  1KD1 C;  2MO0 A;  1B8A A;  3ER0 A;  4DV4 Q;  4GLX A;  1K3R A;  1BBU A;  4X66 L;  5IWA Q;  1K8A C;  1IBM Q;  4YWM A;  2HHH L;  2B29 A;  4DV6 Q;  3GTO H;  2NVT H;  3CW2 C;  2WAQ E;  5M3M H;  1S40 A;  2JJQ A;  4DR3 Q;  4A3J H;  1J6Q A;  3HOZ G;  5M3F G;  1A0I A;  3B6Y A;  1N9W A;  2DUD A;  4JI7 L;  3GTQ H;  5C44 G;  1U5K A;  2RCN A;  3CCE A;  2I5L X;  2IHF A;  5IE8 A;  4OWT B;  4RMF A;  4A3I G;  2UUA Q;  2YYZ A;  3T1H Q;  4B3R Q;  1YNX A;  4A3F H;  1B70 B;  3JAM i;  4B3M L;  1WYD A;  4LF4 L;  1HZ9 A;  1X3G A;  4DR2 Q;  2R6G A;  1VQH A;  2PMZ E;  2DGY A;  4OON A;  4JI8 Q;  4XIG S;  1I94 L;  3H0G G;  4P75 A;  1EIY B;  4JCV E;  3OYY A;  1E1T A;  2ZTE A;  1IBK L;  2IHE A;  1SN8 A;  5BR8 Q;  5C3E H;  3G4S A;  1XMO L;  1PH4 A;  1Y14 B;  3J81 j;  3A5U A;  1X56 A;  3CCL A;  1MJC A;  3KOJ A;  4L5Q A;  2Z0S A;  3ZJY C;  4A4I A;  3HOV H;  2N3S A;  4P71 A;  1WCM G;  3KDF A;  4JOI A;  3CMA A;  4A75 A;  2HQL A;  2UXD L;  4WJ3 M;  4LF5 L;  2OTL A;  4A93 G;  1VQL A;  4DV5 Q;  1E24 A;  5IP7 G;  5IYC H;  4LF9 Q;  2R92 H;  1FJG L;  2VQF L;  1MKH A;  1GKH A;  2R93 H;  4OO1 I;  1IYJ B;  3CCV A;  4K0K Q;  2Q2T A;  3CME A;  4JV5 Q;  3JC6 6;  2JA7 G;  4DR6 Q;  3I4N G;  1Z9F A;  1SR3 A;  1NE3 A;  1UWV A;  2MFI A;  4AIM A;  2KHI A;  3L0O A;  2R7Z H;  1EIF A;  4DUZ L;  1VQD A;  4A3G G;  2BA0 A;  2ZTD A;  1YIT A;  1G29 1;  2AMC B;  3UDG A;  4DR1 L;  5IYB H;  1D7Q A;  1YIJ A;  2KEN A;  3H3V H;  1Y1W G;  3PUV A;  1XPO A;  1K8G A;  2D0P A;  4A3C H;  1PV4 A;  2NVQ H;  1UE1 A;  1EFW A;  1P8L A;  2MO1 A;  4JI7 Q;  1XPU A;  2VUM G;  4POF A;  4LFB Q;  2QGQ A;  5ELN A;  4LFC L;  1SFO H;  1KQS A;  3NEN A;  2AHO B;  2PI2 E;  3EIV A;  1KC8 C;  4IPD A;  4LF4 Q;  3F2C A;  4PZ8 A;  3HOW G;  4DAM A;  4BY7 G;  3M85 A;  1NBW A;  1QUQ B;  1LM0 A;  2VS1 A;  2K4K A;  2RHQ B;  3CQZ H;  2ZJR A;  3MXN B;  2UUB L;  1SE8 A;  3AEV A;  4NB3 A;  1OXX K;  4O2D A;  4IO9 A;  4GOP A;  2IT1 A;  4LF6 Q;  3U4V A;  4A3L G;  5FJ8 G;  1I94 Q;  4LWC A;  1YJN A;  2PQA B;  1HZB A;  5C4J H;  1WI5 A;  2VY3 A;  1YHQ A;  5LMN L;  1XMO Q;  4JI3 L;  1OTC A;  4BXX H;  4WJ4 A;  4UY8 C;  2JA8 G;  1Q81 C;  1FVI A;  2H5X A;  2L15 A;  4JI1 L;  1QZG A;  4IFD I;  1PH5 A;  3J80 c;  2WFW A;  2XGT A;  2VQE L;  2UXD Q;  3BU2 A;  4DK6 C;  4LF7 L;  4KHZ A;  1PH9 A;  5ELO A;  4UPA A;  2VQF Q;  3HFZ B;  1FJG Q;  3AYH B;  3M4O H;  2ID0 A;  2YV5 A;  2F4V L;  2WAQ G;  2CFM A;  1X65 A;  4MNO A;  4DV3 L;  1G51 A;  2E5L Q;  1XNR L;  5AJ3 L;  1N36 L;  5C0X I;  3STB D;  3GTK H;  3RN2 A;  4QJF A;  3G71 A;  2NZO A;  4UP8 A;  3D31 A;  4DUZ Q;  4B3S L;  1M90 C;  4KHP L;  2UUC Q;  4HJ8 A;  2Z6K C;  1U0L A;  5C4X H;  3TQY A;  4DV1 L;  1HNX L;  4C3J H;  2I5H A;  3BZK A;  4DV7 Q;  4JI6 L;  3KYH C;  1VQJ A;  3HOU H;  4UP7 A;  4GKJ L;  4DV0 L;  1NY4 A;  3OTO L;  4X65 L;  4HIO A;  1N34 L;  3T1Y Q;  4IJL A;  2QA4 A;  4QIW E;  1CKN B;  3CC7 A;  4DAY B;  4LFC Q;  1MIU A;  1SLJ A;  1LUZ A;  4R4Q A;  1Y1V H;  2OQ0 A;  4NPS A;  5GAH C;  2Q2U A;  3CD6 A;  3HOX H;  1VQE A;  3CCJ A;  2RHS B;  3STB C;  2Y0S E;  4A3D H;  1C7Y A;  4GN5 A;  5M3M G;  2V1C C;  1L2F A;  3MEF A;  4A3J G;  2R7D A;  1W3S A;  4AQY L;  1GD7 A;  1ASY A;  2UUB Q;  4JI0 Q;  3PO3 H;  3K8A A;  1VS0 A;  3K7A H;  1N8R C;  4JBW A;  4OX9 Q;  1IBL Q;  4X64 L;  3M4P A;  4IJH A;  1VQ5 A;  4JI5 L;  1XTD A;  3CCR A;  5LMN Q;  4YY3 L;  4A3F G;  3SGI A;  4JI1 Q;  2VNU D;  2C35 B;  3RNU A;  3GDE A;  2CWA A;  5JEA J;  3W5O A;  5LMU L;  2OQK A;  4A3B H;  2VQE Q;  1XPR A;  1YEZ A;  2VW9 A;  4LF7 Q;  1A8V A;  1XNQ L;  3OW2 A;  4X6A H;  1NMF A;  1NTG A;  3GD7 A;  3CF5 A;  1YI2 A;  3KLW A;  3PUZ A;  1VQ9 A;  1TWC H;  1EOV A;  5JJI A;  3CCM A;  3GTP H;  5C3E G;  4ME3 A;  3J80 i;  4DV3 Q;  3RZO H;  1XNR Q;  5AJ3 Q;  1N36 Q;  2GN5 A;  1S72 A;  1KRT A;  2JEA I;  4YHH Q;  2GVA A;  4PMW A;  3HOV G;  3S2H H;  4YWK A;  3F1Z A;  3KJP A;  1CKM A;  4GNX C;  4B3S Q;  3K7U C;  3RN5 A;  5J3B A;  3S2D H;  4A3M G;  4LFA L;  2R92 G;  3NEM A;  5IYC G;  1HZC A;  3FP9 A;  4DV1 Q;  1K9M C;  2K5N A;  3NEL A;  3TRE A;  3CCS A;  1C9O A;  4JI6 Q;  2NVX H;  2R93 G;  1JT8 A;  1V9P A;  4GKJ Q;  4DV0 Q;  2F52 A;  4DR5 Q;  1I3Q H;  4A3M H;  4X62 L;  5E7N A;  2WB1 E;  4X65 Q;  1N34 Q;  1VCI A;  2IX1 A;  3UDI A;  1AH9 A;  3K80 C;  3KJO A;  1S3O A;  2R7Z G;  1A62 A;  1HR0 L;  5JJK A;  5M5X H;  3S1M H;  3BJU A;  2OCE A;  4L5R C;  1HNZ Q;  3KDF B;  1FGU A;  4JG2 A;  3BZC A;  4PZ7 A;  4LUV A;  5IYB G;  1Q1B A;  3M3Y H;  4HID A;  2D62 A;  3U4Z A;  2ZJP A;  3K81 C;  3CXC A;  4HIM A;  4R4T A;  4HJ9 A;  4AQY Q;  4A3C G;  3KF8 B;  4X66 Q;  1VQ8 A;  1GM5 A;  3A5Z B;  2K50 A;  1TWG H;  2HHH Q;  4R4O A;  1PH8 A;  1N33 L;  2I5M X;  3GTJ H;  4YY3 Q;  3I7F A;  1N32 L;  1SRU A;  1O7I A;  4AYB G;  1Q7Y C;  4A3E G;  2JA6 H;  1J5E L;  3GTL H;  4DR4 L;  3UE1 A;  1I50 H;  4R1J A;  5LMU Q;  4GNX A;  1YBY A;  1VQF A;  1X9N A;  1TXY A;  3CAM A;  4UP9 A;  1UEB A;  2NN6 G;  4PZ6 A;  4B3M Q;  1YZ6 A;  1VQG A;  3J81 c;  1VQ4 A;  4A3E H;  2BA1 A;  1L1O C;  3RR5 A;  3E9H A;  3S16 H;  1UE7 A;  1EQR A;  4QGU A;  3TEH B;  1K73 C;  1PHJ A;  4DNI A;  1JE5 A;  4J15 A;  3KF6 A;  4BXX G;  3HKZ E;  2YTY A;  2CKZ B;  2BH8 A;  3ERS X;  4IOC A;  3HOY H;  1Q46 A;  2LXJ A;  1IBK Q;  1Q86 C;  4JBK A;  2YTV A;  2B3G A;  2I0Q A;  4LFA Q;  1VQI A;  2VL6 A;  2JA5 H;  4EX5 A;  4JI4 L;  3S15 H;  2D0O A;  3KF6 B;  1OXU A;  2WP8 J;  4GOP B;  3ULJ A;  1VQ7 A;  3UE0 A;  4GN4 B;  4P73 A;  4LF5 Q;  2RF4 A;  2CQO A;  3CCQ A;  1JMC A;  1VQN A;  2F3I A;  2YTX A;  3A74 A;  2B63 H;  1W2B A;  1BKB A;  2NVY H;  1QVG A;  2CWP A;  1Z47 A;  3PUW A;  1HR0 Q;  1I6H H;  5GAG C;  1IBM L;  4B3T L;  2N49 A;  1X55 A;  1RIP A;  1RL2 A;  2EIF A;  5C4X G;  2E2H H;  4NXM L;  1PH1 A;  4DR3 L;  4LW1 A;  3S1Q H;  3JAM c;  4BBS H;  4EQ5 A;  4P72 A;  5BR8 L;  3PIO A;  3HOU G;  1BBW A;  3D0F A;  2E2J H;  1KHI A;  1L1O A;  4BA1 I;  4DR1 Q;  2UXC L;  2LXK A;  1WJJ A;  1B7Y B;  2A1A A;  2K52 A;  4L5T A;  4OWW B;  3F2B A;  1N33 Q;  4AH6 A;  4DKA C;  1N32 Q;  3GTM H;  1Y1V G;  3S1R H;  4L5S A;  3H3V I;  3S14 H;  1IXR A;  1P16 A;  3EBE A;  1J5E Q;  3HOX G;  1X54 A;  3FHW A;  4IPG A;  2A8V A;  4DR7 L;  4A3D G;  1C0A A;  3S24 A;  2K5H A;  3TS2 A;  3PO3 G;  1YHB A;  4Y7N H;  2JA9 A;  1JB7 A;  2ASB A;  3GTG H;  5HGQ A;  2E8G A;  3PO2 H;  4TQU S;  4A76 A;  3CPF A;  4OO1 G;  4LNQ A;  4YCV A;  1UE6 A;  2VZA A;  4IFD J;  1PYS B;  1KIX A;  4GKK L;  1Q82 C;  4P74 A;  3J81 i;  4KHP Q;  4DUY L;  4DK3 C;  4BY1 H;  2UXB L;  2NN6 I;  1XJV A;  4A3B G;  2R7F A;  4JI3 Q;  1H95 A;  2IX0 A;  2K14 A;  5M5Y H;  1FL0 A;  1TWH H;  2N8N A;  1EUJ A;  1UE5 A;  2LSS A;  5IYD G;  4JI4 Q;  5C0X J;  2HIX A;  2E2I H;  1GVP A;  2K75 A;  4PG3 A;  3CC4 A;  4LF8 L;  5LMN W;  4DR6 L;  2EQS A;  2Z6K A;  4GN3 B;  1KXL A;  4ALP A;  3IRB A;  4A3K H;  5IYD H;  2OTJ A;  2F4V Q;  4JOI C;  5FLM H;  1WOC A;  2K5V A;  3RLO A;  1YVC A;  3HKS A;  4B3T Q;  4BA2 I;  4KI0 A;  2MQH A;  1G6P A;  2ATW A;  4R4C A;  4XTC S;  4R4I A;  1JJ2 A;  3UDX A;  2Q2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...