5C4HA

Crystal structure of staphylococcal nuclease variant delta+phs i92h at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYHYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4hA00
1KDCA 3MHBA 3SK6A 4HMIA 4F7XA 5IGDA 2OF1A 1ENAA 4K8IA 5EKLA 2F0VA 2EYLA 2F0OA 5HURA 4QB4A 4PNYA 2PQEA 2EXZA 3PMFA 4G57A 2PZWA 2RKSA 2EYJA 2RBMA 3SHLA 1EY8A 4IZ8A 4KD4A 3ITPA 1EQVA 3EJIA 3U9OA 2F0UA 1KABA 3D6CA 5IODA 2PW7A 1STYA 1JOQA 2PZUA 5C5MA 4WORA 5KEEA 1NSNS 1SYEA 5KYLA 1F2ZA 4DF7A 3HZXA 3QOLA 3SR1A 5C6AA 2LKVA 3C1EA 4RKLA 1A3TA 1SYCA 2ENBA 2PYKA 3NK9A 4RKBA 5DAUA 5E1FA 4HMJA 5CC4A 5IGCA 5CR3A 3EROA 4ID6A 5J1ZA 3S9WA 5CV4A 1SNPA 4NP5A 4KV6A 1RKNA 3MEHA 2EY6A 2RDFA 4IALA 4ZUIA 3D8GA 3H6MA 3SK8A 2F0LA 3DHQA 5C5LA 4H7BA 4EQPA 5KYIA 2SNSA 1SNOA 5I6WA 4EQNA 1NUCA 1STNA 2F0WA 3OMCA 4K14A 2QDBA 1AEXA 1SYBA 1STHA 4S3SA 3TP5A 4MIUA 3ERQA 5IGBA 4KHVA 1A2UA 1EYDA 4J6HA 4K6DA 2F0NA 1EY6A 1SNMA 3E5SA 4N9PA 4B9WA 2EYHA 5IIFA 5KRUA 4EVOA 1KAAA 1EY0A 2F0PA 3D4DA 3V2TA 3VA5A 4QF4A 3SK5A 4OL7A 1EZ8A 2F0EA 4DU9A 4R8NA 4ZQ3A 5E3FA 4DFAA 3NHHA 5JAVA 4YIJA 2O4XA 2F0SA 3OMGA 3P75A 1EY7A 4K2LA 1A3VA 2EY5A 1EY9A 2PZTA 4KY6A 2F0HA 4KY5A 2F0DA 4N9TA 5HGTA 4KJNA 2SOBA 1STAA 4PMCA 3P1HA 3NXWA 4KTAA 2F0TA 5CV5A 3SXHA 1EYCA 3HEJA 5IGFA 5ISRA 2KQ3A 3BDLA 5CGKA 5KGUA 1SNDA 2EYMA 4K5WA 5IOCA 4NKLA 4WRDA 2OXPA 1SNCA 5C4HA 2F0QA 1TT2A 4IUNA 5IGGA 1JORA 5NUCA 1ENCA 1KDAA 2F0GA 4K8JA 5CV6A 1SYFA 1EY4A 1EYAA 1SNQA 2EYOA 2OEOA 3DMUA 4KD3A 4PMBA 5J22A 2F0JA 3LX0A 3T13A 1STGA 3OWFA 3NUCA 3T16A 5CV9A 4ZUJA 3RUZA 1F2YA 3BDCA 2NUCA 4I65A 1U9RA 2PW5A 4K2KA 5C3XA 2F3WA 2M00A 4HTHA 5C3WA 3D4WA 3QB3A 3NP8A 5EGTA 3SK4A 3MVVA 1JOKA 2KHSA 2F0KA 4NMZA 5EKKA 1STBA 5C4ZA 2F3VA 5JOBA 5F2DA 2F0IA 1II3A 1KDBA 1IHZA 2EY2A 1A2TA 1TR5A 1EZ6A 2SNMA 3NQTA 1A3UA 4J1MA 4F8MA 1F2MA 4NDXA 4ODGA 4K5XA 1TQOA 4LAAA 3C1FA 3TP7A 5M9OA 3MZ5A 2EYFA 2EYPA 4EQOA 5I9PA 5DEHA 3QOJA 2F0FA 3MXPA 1SYDA 3OSOA 4TRDA 2F0MA 5CV8A 4E6IA 5K5PA 5KIXA 3TMEA 5J39A 5I6YA 2EY1A 4KY7A 2HQEA 4ME5A 5CV7A 1SYGA 3TP6A 2WACA 3R3OA 4B9XA 1EY5A 3TP8A 5I9OA 4K5VA 4DGZA 4KJOA 1JOOA 3EVQA 5IGEA 4QMGA
chains in the Genus database with same CATH superfamily
2WFWA 3HS0C 5FOBB 2NVQB 1H9JA 3OIQA 4DAYB 4DR4L 3PSIA 2R93B 3SHLA 5C0XJ 3JAMc 3KJPA 3HOZB 1D1IA 4R4IA 1A0IA 4A93H 1RIPA 3H3VH 4F87A 3G7LA 3LWEA 4XQNA 2Q8IB 1EOTA 3O13A 1U5KA 4L5SA 3M7NA 5DAUA 3GTKB 2JA5B 1CHPD 5CR3A 1G2TA 3FHWA 3SVMA 3S9WA 1SEBD 4DR2Q 4CDFC 3PO2H 3LWUA 4O42A 4H7BA 4C3IH 1SLJA 1N36L 2QDBA 1AEXA 2NBFA 2J0TD 4GNXB 1SN8A 2GVBA 3RZDH 3AB9A 4BBSG 1A6XA 4LMQD 4H02A 3CAMA 2UUCQ 5E4XA 3CCJA 1LABA 1Y1VB 2CFMA 2JXMB 4HJ5A 5FLMH 3KF6B 5IP7G 4PZ7A 1XWEA 2GVAA 1WI5A 2F0SA 4K2LA 1BQQT 1BCPC 5DLQE 2K03A 2G9DA 2KCNA 2B63H 1EQTA 2F0TA 4LF8L 2B2VA 4RHSA 4FDBA 1I4XA 3QO2A 1TU2B 2B2VC 2K1BA 1TT2A 2X69A 5IGGA 5K36G 3K8AA 3OW2A 5NUCA 1G291 1EU3A 3M9BA 1XXGA 2AUJD 1D5ZC 1KIXA 1KQSA 3OWFA 1ZXTA 4O1NA 3R8BA 1GOZA 1WTHA 1BOSA 1R9TH 3AYHB 1HJPA 4JCVE 4K6LA 4X3UA 4NXNQ 2QA4A 3GTOB 1YNND 2EY2A 4V190 1L0XB 3CF5A 2FFKB 5FLXc 2CWAA 4F8MA 2D62A 3F1ZA 4YHHL 3CCLA 1SYDA 2PNRC 1YJ9A 3TZDA 1I4PA 1ILQA 3LNNA 4DV3Q 4GN3B 3S1MB 4R1JA 1YI2A 1EIHA 2CH4W 5IGEA 1HHVA 2A73B 1W6JA 4K8IA 2JA8G 2EYLA 3KJOA 5IE8A 2PZWA 4NW2A 3S14H 2OCEA 4IUTA 5CBAE 4IFDH 1EFWA 1WFQA 4HCSA 2UXCL 2JSOA 1B50A 1QNKA 2Q2IA 3OTOL 1RTOA 1A3TA 4L5TA 2E5LL 4IFDJ 3GTJB 1EQQA 4Y7NH 1ML0D 1SNPA 4KKSA 4QY7A 3D3RA 4AYBG 5IP7H 3J81i 4DR3Q 4A3LH 3STBD 3EIVA 1E1TA 4GN5A 1EEID 2K04A 3F2BA 2K5QA 5IIFA 1KL9A 3BYYB 2Z1CA 2JA9A 3PV0A 2F0EA 4C3HB 3H3VC 1J8IA 2IPKD 1N34Q 4RWSC 1DOLA 4R9WA 3SGIA 4RFBA 5K36H 1CA6A 1DM0B 3KOJA 2NVQH 4KY6A 2KVMA 2FINB 1VQJA 4FF2A 1PH9A 4DR6L 1QB5D 2R93H 1PFSA 2BH2A 2ZTEA 4Z9CB 5E4WC 1MHWC 4B3TQ 4IJLA 3HEJA 3UDFA 5ISRA 3HOZH 1DD2A 1NE3A 1SXTA 1JICA 4IUQA 4LF4L 1ESRA 1X3FA 2EYMA 2R61A 4RG1A 4XQJA 4U68A 2F0QA 2N55A 2JA5H 3GTKH 1VQ7A 4DUZL 1VQOA 5C3EG 4IOCA 4AQYL 2H1EA 2KJXA 5C44G 2CW0C 2O2LD 3ONAB 5EPLA 2WB1E 1I4GA 1YNJC 3HOUG 1S72A 3K6OA 2F4VL 4P72A 1NAPA 4KN7C 2BDOA 2B2YC 1HNZQ 4QJFA 3FMCA 5F2DA 5H1SE 1Y1VH 5I4DA 1N8RC 3S1QB 1B7YB 2HD3A 4DNTB 1KLGD 5FK9C 3UDXA 1VQBA 5IP9G 4ZLTF 3RZOB 3VR2A 5IT9c 3FEWX 4NPSA 2ZM6Q 4XIGS 4YCUA 3CU7A 1SYGA 2WACA 3TP8A 4YCVA 3HKZG 3EVQA 4FXDA 3FKIG 3J7ZC 4GZYC 2B29A 4ZCKA 4LUZA 3UE1A 1PV4A 2K52A 5EKLA 2VY3A 3MWYW 1CA5A 2Y0SG 1YVCA 1SE2A 3ER0A 1VQIA 3HOXB 3I4MB 3ND8A 5FO7B 4YY3Q 2R7FA 4JI8Q 4DR2L 4P75A 3VYSA 3AFQA 3MXNB 3PO3G 3EROA 2QILA 3GTOH 1GHJA 1MI2A 3HFZB 4ILWA 2RDFA 3SK8A 4A3JG 1GUNA 2BH8A 1QZHA 2QEJC 2F0WA 2BA0A 2A6ED 2CWPA 3TP5A 4ALPA 1B8AA 4B3MQ 1F9SA 5GQOA 3U9SA 4H0LC 4MNOA 1WTQA 1WCMB 3MXUA 4OONA 1WTXA 3BG3A 3S1MH 3GDEA 1EZ8A 4X66Q 3K7UC 5L37A 2E75C 1PH4A 2G9HD 2D2CC 1VQ6A 1D2BA 1MSHA 3T4AC 3GTMB 2JA7B 1YHBA 2EJGC 1EQRA 5GAEC 2I0QA 3ULLA 2EIFA 2VZAA 1DGSA 3A5UA 4JI4Q 1B9MA 4DUYQ 1IKMA 4WRDA 1IBKL 1PLFA 3X3MA 1JC7A 2G5DA 4IUNA 1VQCA 4M8AA 3GTJH 5G3LD 4KKUA 3ZYYX 2IHEA 3HOYB 3T16A 3NENA 4NXNL 2R7DA 2NUCA 1CZWA 1TY2A 1ICWA 3QIAA 1TWCB 3RR5A 3CCMA 3CC7A 1I6HB 4DV7Q 1HUNA 2SNMA 1M8AA 3U4VA 1PFNA 4C3HH 3CPWA 5TSSA 1UE1A 1TXYA 2KCTA 4K5XA 2AWOA 4G7ZC 5M9OA 4X65Q 3EN2A 2K05A 5DEHA 1BUVT 2F0MA 2DGYA 1IZ6A 3SDZA 2Z9HA 1EY5A 1KNAA 1KRTA 1UEBA 2AMCB 2FHTA 2N78A 2OQKA 3R2TA 4GNXC 2MGSA 2X6LA 1C8CA 2K01A 4DKAC 1VQLA 2EXZA 2EYJA 1Y1WB 2JA7G 3PIPA 1LTGD 1X65A 2TMPA 1HFNA 4WORA 5KYLA 4K0KQ 1G2SA 4HR7B 4X6AH 1P16A 4DR3L 1ZKOA 4DR1Q 1CM9A 5IYDG 2ATWA 3MEHA 4HSVA 1JWUD 4X64Q 2MUYA 3S1QH 4KHPQ 1EWIA 1YJWA 4KHZA 1K83B 3CCQA 4CDEC 1SYBA 4O0AA 4A3DG 3RZOH 1A2UA 2B3GA 2J7ZA 3E5SA 4BS9A 1I94Q 1FL0A 1N34L 1CSQA 2K5DA 3I72A 1HZBA 4C1NK 4HJAA 4DU9A 4DNIA 4C1NI 1JJCB 4YIJA 4HJ8A 4LFBQ 4JBWA 4B3TL 1OTCA 4RGMA 2UUAQ 1HUMA 3HP3A 1VDZA 1F77A 4IOAA 1BVSA 3BDLA 2JA6B 2A69D 1JJGA 1EL0A 3HOXH 3I4MH 3L2PA 4K5WA 3KK7A 3V96A 1K8GA 2PI2A 3CQZB 1PYWD 2YYZA 2UXBL 1EYAA 3VYTA 3I4NB 2EVBA 2F0JA 3PUYA 4H44C 1XPUA 1HNZL 4ZUJA 2GN5A 2PW5A 4HCEA 4A3FG 1V43A 3L3OC 5A2QE 1XMOL 1LLRD 2KEDA 5JJZA 1WCMH 1LT3D 3I55A 4UY8C 1E2WA 1GHKA 1PRTD 1I4RA 3H3VI 2MHVA 1F2MA 1XTCD 1D5XC 4LWCA 1IW7C 1UNSA 1X3GA 3NBHA 3G6EA 4A3BG 1XJVA 3GTMH 1SJHD 2O5IC 2B2WA 3Q23A 1N33Q 1FYCA 3H91A 3J81E 2NVYB 4IO9A 1XNRQ 2K50A 5M5XB 1MD2D 3H0GB 1EY8A 5GAGC 4JI7L 4YY3L 5CYUA 2L11A 4JI8L 4BY1B 2Z4IA 3HOYH 5M5WB 1X56A 3KUPA 5C6AA 1QCBD 4RKBA 1S5ED 5IGCA 1TWCH 1MKHA 1A62A 2EPBA 3Q8DA 1PTOD 4LFAQ 1I6HH 3CCUA 3ICEA 2F1MA 4QUFA 3S15B 3UE0A 1SNOA 4B3ML 4ME3A 5M3FB 4X62Q 1STHA 4IUVA 5GROA 2OQ0A 3GTPB 1AH9A 2RDGA 2BE5D 2LFNA 2NN6G 1EY6A 1LTAD 4X66L 3FPPA 3PIOA 1TS5A 1EY0A 2P5ZX 2FMCA 1CUKA 5C4XB 1VQ8A 3RNUA 1PFBA 1E2VA 2BDNA 1VQNA 5JJKA 2RA4A 4BA1I 2XRQD 4N9TA 3GQBA 1E1OA 3S1NB 1Y1WH 3HOWG 4DUYL 5JJLA 2PQAA 3DWPA 2IX3A 3DM3A 3URYA 4KN4C 5GADC 5ELFA 4K8JA 3J7A5 1SYFA 1S4ZA 3K7AB 1W3SA 5J22A 1CT1D 3T13A 5GAHC 4MHEA 2RSNA 1ZEQX 2L9HA 4BY1G 4A3CG 1K83H 4K2KA 4DV7L 1OXVA 3NP8A 1B4OA 1YBYA 2CQAA 1ONLA 2KEEA 1M90C 4IFDI 4I7ZC 4P2CB 4POFA 1HNXQ 3OW7A 1EZ6A 4X65L 1KTKA 3J80L 1HCZA 1KHIA 1PRTF 3BDOA 4N8X1 3DWAA 4FNFA 4CGYB 3KDFA 2HHHQ 3KBGA 3TMEA 1NBWA 4ULLA 4BXXG 1STEA 2JA6H 4BBSB 5A35A 4JI0Q 5C4XG 4F7XA 3M4YA 4RMFA 1JWMD 3CQZH 1RF2D 3L7ZC 1LTID 2BCOA 3I4NH 4K0KL 1OXSC 3F2UA 2A19A 5IYCH 4DV4Q 4LK1C 1PZID 4UAIA 4PG3A 4M1UB 1F2ZA 3SR1A 4DR1L 4X3TA 4CDCC 5CC4A 1Q82C 4X64L 4KHPL 2ES2A 4KV6A 4IALA 4H13C 5C0XH 4EQPA 4FXKC 1PTOF 1I94L 3KLSX 4LF6L 5IYBH 4WFN3 5LMNW 1T9HA 2XGTA 2EYHA 2WKDA 4IPCA 2VUMG 4CKEA 4LFBL 4JV5Q 4QF4A 1SE3A 3I56A 1I4QA 2VW9A 1C7YA 3E0EA 4LUOA 4DFAA 3DEOA 2RDHA 1Q81C 2UUAL 1YIJA 2NVYH 4R4TA 5LHY1 3TREA 1PH7A 5M5XH 3H0GH 4B08A 3NXWA 1EYCA 1O7LA 4BY1H 2JK8A 1BBWA 5M5WH 3I4OA 3VYRA 2OXPA 4G7HC 2YU9B 3DMUA 2OEOA 4FF4A 2IHFA 1Z9FA 3S15H 4DAMA 4L5RC 2JA8B 2RCFA 2AWNA 4J8QA 2HIVA 5M3FH 3TRZA 4OO1H 2F3WA 2EE1A 5DNFA 3GTPH 1VF7A 1TS2A 2DY8A 4O2DA 3E0JA 2VQEL 5J3BA 3NQTA 1B70B 5I2YA 1CSPA 5C4XH 1VQKA 1PH1A 3DUZA 1E2ZA 4Q0FA 3TP7A 3DWQA 1PH2A 2EYPA 3I73A 2JJQA 4AYBB 3QOJA 3BZKA 2C9OA 1Y14B 1D6EC 2DUDA 1N33L 3S1NH 2C5CA 1R4PB 5EBDA 1XNRL 5IWAQ 2XWBB 3T51B 1X3QA 2MO0A 4LF7Q 3K0YA 2NVXB 3CKIB 1BR9A 1B53A 1QWYA 2RHSB 1TS4A 3K7AH 4G57A 3DLLA 1JMCA 4A3IG 2QKIC 4JI1Q 1STYA 2PZUA 3MC0B 3I70A 1VQDA 2WINB 2ZXRA 1IYJB 3A7AB 4LFAL 4QL5A 2NTTA 3EQLC 2CCZA 3HKSA 1SROA 1VS0A 1PXUA 1QJOA 4IUUA 1BNZA 2QCPX 1L1OA 3M4PA 1LUZA 3SE0A 4X62L 2EY6A 3PUWA 2K6AA 3J81c 4A75A 3B6YA 5I6WA 4JI5Q 5BN4A 5C3EB 4A3EG 3IL8A 5C44B 3I2ZA 1BO0A 1GKHA 4MZ9A 4J6HA 4A3GG 3HOUB 1F9QA 1MJCA 1SNMA 2E2JB 5KRUA 2VS1A 3MXGA 1H9MA 1KAAA 2XN9C 4IJHA 4LJZC 3V2TA 5EPKA 4BBSH 3I8ZA 3QG1A 4CKCA 1CKMA 4PMWA 2K5VA 3HOVG 3NBHB 4PMCA 3P20A 4OIKA 1VQ4A 3A7LA 1HNWQ 3JAML 5EAYA 1CKNA 2FXQA 5C4HA 4C2MB 1LT5D 1XPOA 3GTLB 3PQIA 5JEAG 2Z6BA 5CV6A 3PF4A 3HKZB 1NY4A 3FKIB 3CMAA 1PH5A 3E6ZX 4WJ4A 1YNNC 1EWCA 2NB0A 1MJEA 2Y0SB 2E8GA 1WYDA 3E9HA 4OEMB 1HNXL 1JOKA 1IL2A 1STBA 4TKOB 4BBRG 4IUPA 4A4IA 3L0OA 1F2LA 2EJFC 2YV5A 2LXJA 3PUZA 2HHHL 5LL6X 3PO3B 1J5EQ 1GD7A 3MEFA 1KC8C 1PVOA 3C1FA 1S3OA 3TZUA 2JP1A 2F0FA 4A3JB 1ZYRD 4XYQA 3RMHA 4JI0L 2XTIA 2ZT9C 3TP6A 3R3OA 3PUXA 1JOOA 3VR3A 5EJWA 2K5HA 2F0VA 5HURA 2YU9H 4DV4L 3M85A 2F0UA 3Q6SA 4XXEA 1SYEA 2PQAB 2JA8H 1Q90A 2PMZE 4BY7G 2L12A 1NMFA 5A2QL 5CV4A 5LMUQ 2L4NA 2OTLA 3STBC 3D8GA 2DNEA 2HDMA 4NXMQ 3M3YB 3IFTA 2IW3A 1EWHA 1SMYD 4K14A 3K5NA 5FLXL 1RCVD 1HZAA 4XTCS 4LF5Q 1EYDA 4JV5L 1UE7A 3A0JA 4DAVA 2F0PA 1U4PA 3CW2C 3KF8A 2YTYA 2O4XA 1Z47A 5BN5A 1PTOB 4A76A 1BBXC 1C9OA 1OO9B 1Y8PB 4X3SA 2NVXH 3KDFB 4OIJA 3FDTA 4LF9Q 3AQQA 2B2UA 2MPMA 3P1HA 4F88A 3HGBA 1GM5A 5CV5A 1T5EA 1IBLQ 4HJ9A 5JEAJ 5KNBA 2UUCL 4CJ1B 2Z8LA 3VYUA 1UUPA 1NNXA 1DCZA 5ELDA 1VCIA 1K28A 4BWGB 1FNUA 4X3KA 2PNHA 3CMEA 4FF3A 1STGA 2ZXOA 1YZ6A 2R92G 5JPMC 4JYAQ 1G6PA 3BDCA 5M3MG 3VR6A 3T1HQ 1Q8IA 4UP7A 5C3XA 5C3EH 1LM0A 5C44H 1CTMA 3MVVA 3PIP3 1P8LA 4DV5Q 3HOUH 1ENFA 2DNCA 1RODA 1NR2A 1CK1A 2E2JH 3AU7A 1ET9A 1IBMQ 4J15A 1S5FD 2XWJB 3S2DB 4E6IA 3UDIA 2WAQG 5IWAL 1LTSD 4LF7L 1M1KC 1E7ZA 5IY0A 1K8AC 5IP9H 2H4OA 4A3DB 1C4QA 1HH2P 3MFYA 3NWTA 2Q2UA 4GLAC 4A3MB 3F8TA 2B8FA 1C0AA 4FVMA 4C2MH 2F3IA 3NTHA 3FP9A 5FJ8G 1W2BA 3GTLH 2CH4A 1JE4A 5KGUA 4GOPA 4PZ6A 4G4KA 1K3BC 4GKJQ 3FKIH 4GOPC 1MGSA 4QCLA 4IPDA 5LMNQ 3BYTB 1XX8A 2IWHA 1DOMA 4JI2Q 4DF7A 1PFMA 4DV3L 3TS0A 4RHRA 2DJGC 3PCOB 4LFCQ 4PZ8A 3S1RB 3H94A 4NP5A 2A6HD 4JI5L 2A6EC 4OELB 1WTPA 4LNQA 1B3AA 1NMGA 3K81C 4RGTA 5KYIA 4AYBE 3PGZA 1STNA 2EXDA 3PO3H 4ABNA 5CMDA 4HIMA 2A68D 4A3JH 4B9WA 3A8IE 4NB3A 3A5ZB 5IT9L 4A3FB 3TEHB 4GKKQ 5COYA 5BR8Q 1CKOA 2UXDQ 3OMGA 1EIYB 3D31A 1HNWL 2ALYB 1JB7A 4RA8A 3N52A 4P71A 1Y8NB 2PI2E 4IPHA 4Y52H 2R7ZG 2KCCA 4IURA 4A3BB 3EFXD 1RDPD 4A3MG 4DV1Q 1JORA 1G6ZA 3HG9A 4KMUC 5FO9B 2VQFQ 3FPUB 1O7YA 1A15A 2L1BA 4ZKCB 3VR4A 3M3YH 1H9KA 2M00A 3K5LA 3CXCA 3D4WA 1VQAA 4ZAIA 3J7AF 2B2TA 1QVGA 3T1YQ 1L1OB 1J5EL 2D5DA 4G7OC 2E76C 2IJ0A 4ODGA 1PYBA 1LTLA 1EYGA 1EIFA 5FJ8H 1PTOH 1AFPA 2VB2X 1D7QA 4I7AA 3WOFA 1V9PA 3A54A 5BN3A 3J7AV 4N8FA 5I6YA 3IFDA 4ME5A 5C0XI 3CRLC 2K5NA 1Y69U 1WOCA 3PIO3 3HKZE 3OYYA 3S17B 1Q86C 1KD1C 3SK6A 4JBMA 3R93A 1PH8A 1ENAA 4IPGA 3C46A 1B9NA 4QB4A 3S2HB 1VMPA 2LS01 3ITPA 1EQVA 1WTVA 4V0BA 1HFGA 2Y0SE 2JQOA 5KEEA 2ZM6L 1WVLA 3QOLA 5LMUL 1CKNB 2XRSD 3C1EA 3IRBA 3BU2A 5E1FA 3HOWB 2JA7H 1GUGA 3GO5A 4NXML 4C3JG 2OTJA 1LTBD 3W1BA 2B2WC 3ULPA 4LF5L 1YNXA 4QUCA 3G48A 5JJIA 1HR0W 3QJYA 3J80i 5IYDH 3S2DH 4RGNA 1MBYA 1OXXK 4N9PA 2SEBD 1VQPA 1GJXA 3T56B 1KRSA 3BVMA 2L5TA 2RCNA 5CBEE 4A3DH 4OO1I 2Q8RE 1OXTA 4A3MH 1EY7A 1PA6A 1TWGB 3NELA 1BF4A 1IBLL 2MQHA 2A69C 1ET6A 3ERSX 2HCIA 3I91A 4DR7Q 2HQLA 5CGKA 3UDGA 3OOCA 1I50B 2V4DA 3RN5A 3KFUA 5FKAC 3G4SA 3A55A 1HA5A 1SNQA 4R4QA 4JYAL 3S1RH 3T1HL 1X55A 1S5CD 5T1GA 5CV9A 4DV5L 1U9RA 2YTXA 4B3SQ 1PRTC 5CORA 3ND9A 3Q24A 5JPNC 4JI4L 4JBJA 2XVSA 4HEDA 3S16B 1A2TA 3BJUA 4A3FH 1GUSA 1SAPA 4KLKA 4DV2Q 2R3ZA 4NDXA 1K73C 4DK0A 4GLXA 4EQOA 5M5YB 3S24A 3RLFA 3OSOA 5CV8A 2QDLA 4HIOA 5DM73 2QF7A 2DY7A 1L2FA 5CV7A 5HGTA 3WOEA 4B9XA 1UE5A 4DGZA 3KF8B 2JEBI 2C35B 2UU9Q 1PYSB 2L55A 2A1AA 3D0FA 4A93G 4A3BH 2VUMB 4GKJL 1I3QB 2E2DC 2N3SA 5LMNL 3RN2A 4JI2L 2ZJRA 4A3KB 2I07B 4FXGC 5D14A 1SDFA 2J4XA 1SE4A 1EU4A 1NSNS 1EIGA 2LKVA 2EJMA 4C3IG 1PTOC 1SYCA 2PYKA 3NK9A 2PPBC 3JC66 2EDGA 4MTNA 1B2TA 1V1QA 2CKZB 2VNUD 1FJGQ 1VQGA 2RQXA 1SJED 4FF1A 2BE5C 3BZDB 5FLMG 1SRUA 4DK3C 2K5WA 4MIUA 4K6DA 1K8MA 4GKKL 5BR8L 2UXDL 2AKWB 2OT2A 2I46A 2K32A 3SK5A 4CJ2C 2B63G 4ZRZA 1KNEA 2ID0A 4AQYQ 1HRJA 2NN6H 4UDUC 2N49A 4LUVA 3S17H 2EZVA 3P75A 2NYZD 4CKBA 3GV6A 1EY9A 1NR4A 2F0DA 3S2HH 1IYVA 4LW1A 2AUKA 1PHJA 1X3PA 5IGFA 2NTSA 1QVCA 1RJTA 1BCPD 4DV1L 2VQFL 1U0LA 1HXYD 4JI3Q 4DAPA 4KI0A 2K7VA 2CVRA 3HOWH 2ZXPA 1WJJA 1DOKA 4QQBX 2WIIB 3RLNA 2WB1G 4GOPB 2A5HA 3K0XA 4JVZA 3MAQA 1F2YA 2NZ1D 2KHIA 3P7JA 4A3KG 4OWWB 3T1YL 5EGTA 4A3IB 3U58A 2KHSA 1QUQA 1LTRD 3KLRA 1KDBA 4A3CH 2BOSA 1TR5A 1A3UA 4QIWB 2X6GA 1ASZA 4HN7A 1AW7A 4OGQC 1GUTA 2PCFB 5I9PA 1TWFB 1TWGH 2D9UA 3TS2A 1HQRD 1X54A 1D8LA 1LT6D 1R4QB 4A3EB 4K5VA 4KJOA 3NEMA 2EQSA 4YWLA 4A3GB 4IFDG 3CPFA 1GVPA 1I50H 1Q7YC 2HT1A 2OF1A 4BXXH 1XYIA 1Q1BA 3JAMi 2ASBA 3PF5A 5KNCA 3PMFA 2RBMA 3K5OA 3U9OA 3D6CA 1KABA 2AQ3B 3TQYA 3HOVB 1AE2A 2HCCA 4A3LG 3UI2A 4DK1A 1O80A 1Q8KA 1J9OA 3S16H 1JB3A 2F0LA 3CC4A 2SNSA 2F4IA 3RLOA 2A74C 1YHAA 3H15A 3K80C 5ELOA 5IGBA 5M5YH 1LV9A 3F2DA 1U4LA 3KBXA 1IBKQ 1IKLA 2MO1A 2R93G 4JI6Q 1TKWB 1FD7D 4P74A 1VF5C 3NTIA 5JAVA 3AEVA 3HOZG 4BBRB 2VUMH 1I3QH 1SE8A 2PZTA 4JC0A 1TVXA 3C3LA 4DR7L 1G51A 3A8JE 4RAUC 1EFID 4CBVA 2E74C 3D4RA 1L0WA 1L1OC 2L0CA 3SXHA 2JA5G 3EBEA 3VA7A 2KQ3A 4A3KH 2LSSA 1BCPF 2D0PA 4EQ5A 1FR3A 3W2DA 4OX9Q 1ENCA 3K59A 3Q0AA 1WTOA 4APVA 4B3RQ 1TWAB 4B3SL 2A8VA 4HIDA 3H09A 1KAWA 3G6JB 4I65A 1Y1VG 1LT4D 2CW0D 1AZQA 1YNJD 1QNUA 4DV2L 4C56C 2M2LA 1II3A 3GTGB 4P73A 1XMQQ 1K3RA 4OWTB 2F52A 2Z4HA 4BY7B 1IYUA 3MXPA 2R6GA 1HZ9A 1VQEA 3NQIA 3CRKC 3M4OB 4KY7A 2UU9L 4ZYSA 5I9OA 1B44D 5AJ3Q 3F2CA 2UUBQ 5FO8B 4RCNA 2K33A 3AMUA 1PH6A 1V1PA 2JN4A 1UE6A 2GA4B 3I4LA 3TDQA 2QGQA 1CFMA 4KD4A 3G71A 3GTQB 3J80E 1HR0Q 1CQFA 5IODA 2RSOA 5D3IB 3K58A 1D5MC 3MA2B 2NVTB 1G91A 1RL2A 1WTWA 1PZKD 4HMJA 1O7ZA 5DM63 4A3IH 1FJGL 5J1ZA 1ILPA 1O78A 4QGUA 3GV3A 5C5LA 1QILA 4TQUS 2FMMA 2VB3X 1EUJA 1F9PA 4L5QA 3OMCA 1PRTB 1IXRA 4ZK9B 3KLSA 2QW7A 1GUOA 1TWFH 2K4KA 2R92B 5M3MB 3D4DA 4A3EH 4OL7A 1S40A 2UXBQ 4A3GH 1BKBA 2M9VA 2B2YA 3DEPA 3E3XA 1V1OA 3NBIA 1STAA 2ZJQA 3AFPA 4R4OA 4JI3L 1XMOQ 1YHQA 3BS1A 2WAQB 3CHBD 3HOVH 4EX5A 1SNCA 2F0GA 1LACA 2LXKA 1CHQD 3NTKA 2WKCA 4JK1C 2IX0A 1ESFA 1H9SA 4DXFA 1LTTD 2F03A 2MP1A 1HTPA 1I5FA 5JEAH 1PZJD 4C3HG 1LO5D 3SK4A 3J81L 4EGVA 4JW0A 2F0KA 5C4ZA 1U4MA 1DXMA 2F3VA 4HSPA 4RCOA 2B2UC 4IN3A 4J1MA 1B1ZA 4DV0Q 1XNQQ 3MFGA 1ZYRC 1UAPA 2KHJA 4JI7Q 4BBRH 2K14A 2KECA 2E2HB 1YEZA 2EOTA 2XSCA 4FO2A 1WD1A 3I7FA 4FP5D 1XPRA 1PH3A 3BVZA 3R2IA 1JJ2A 1KDCA 1QE6A 4R4CA 2VXWA 5EQ0A 2F0OA 2PQEA 2RKSA 1OXUA 2WV6D 1FGUA 1G8ZD 2LMCB 1X6OA 1E0BA 1TWAH 1DONA 3CCEA 1QZGA 2O5JC 2ZTDA 3K5MA 4RH6A 4JOIA 4HAEA 1A8VA 4QIWE 1X9NA 2N88A 1SMYC 3A74A 4XYOA 4JOIC 4WJ3M 1NJIC 2R7ZB 3GTGH 3H6MA 2Z0SA 1GO3E 1S5DD 2WP8J 4BY7H 1VQMA 1FNWA 4S3SA 3K57A 2DJFC 2HIXA 4JI1L 2RVLA 2F0NA 2RF4A 1AZPA 1VQHA 1QUQB 1A63A 4JI6L 3M4OH 3VA5A 3Q22A 4YCWA 4R8NA 4ZQ3A 3TSSA 3IKJA 4DAYA 3HOXG 2EY5A 3I4MG 2F0HA 1TWHB 4KY5A 2SOBA 3OHXC 4YWMA 3BVGA 1HTLD 3W1GA 5KNDA 2NZOA 1H9RA 3GTQH 3J7YW 1WTRA 1N9WA 3WWVA 4OX9L 2I5MX 4NKLA 4UPAA 4OWXB 1Q3LA 3NWSA 4DV6Q 2NVTH 2ICIA 4B3RL 5E7NA 4FYDA 4PMBA 1SFOB 1JR0D 3SEBA 5JVG3 5EKIA 3HRZC 4OXPA 1WCMG 3RUZA 4XDXA 1LYLA 4L6TB 5C4JB 2HUGA 2B8GA 5C3WA 4GNXA 2AHOB 1QG7A 1N32Q 3QB3A 1PMRA 4CJ0B 1XMQL 2SDFA 1VQ9A 1BCPB 5JOBA 2R92H 3CD6A 5M3MH 3KF6A 4HJ7A 3FRPB 3U50C 3JAME 1SSOA 2D0OA 4TSSA 4UP8A 1AP0A 1TQOA 1Q46A 3MZ5A 4C3JB 1E22A 2H5XA 4TRDA 4GN4B 1Q12A 5AJ3L 2LY7A 4GLVB 1K0RA 2UUBL 5J39A 2MFIA 1IW7D 1O7IA 4XT1B 1TIID 2NWGA 1WD0A 4GS3A 1JWSD 4JBKA 2FJ2A 2MNAA 3HOYG 3GP7A 1HPCA 2AQ1B 4HMIA 4DR5Q 2MJ8A 1HR0L 2E2IB 4PNYA 5EPJA 2B2TC 4IZ8A 4CDDC 4LF6Q 4DR4Q 1RHPA 2PW7A 3NPPA 1JOQA 1UEAB 5C5MA 2NN6I 3X3NA 4TVAB 1K8OA 3HZXA 2A6HC 4RKLA 2ENBA 2PO4A 2JYOA 1FVIA 2B39A 4ID6A 1KXLA 5HGQA 1S5BD 3TN2A 1E3PA 1RKNA 4ZUIA 2I5LX 1TY0A 4PQXA 1HA6A 4WJWA 1GXDC 2A68C 4EQNA 1H95A 1NUCA 2DN8A 3CCSA 1ICFB 3ERQA 2XNAC 2E2HH 1L0YB 1X32A 1N36Q 3J80c 1BDOA 2IY5B 3E9IA 5G3LF 4AIMA 1Y1WG 4U673 3NHHA 2N8NA 2JEAI 2ZTCA 3KYHC 2Q2HA 1A3VA 4RGOS 4KK7A 3L9AX 3VR5A 4KTAA 1ASYA 5T1IA 2IX1A 3V05A 5D3DA 4BA2I 1SNDA 1K9MC 5FLXE 4LF8Q 5IOCA 3A56A 2VQEQ 1V1PB 1SBBB 1DYQA 3J81j 4CHTB 1U4RA 1KDAA 1I4HA 2AQ2B 1EY4A 4DPGA 4XQQA 3CP0A 3NSWA 4YWKA 2R7ZH 4A93B 1EEFD 2Z6KA 3NUCA 2CHBD 1C48A 1RD9D 4MN3A 4R8IA 4LF9L 2Z6KC 1AE3A 2HDLA 3KLWA 5I2XA 1YITA 1CZGA 3CC2A 3WDNA 4OHJA 2V1CC 4NMZA 2I5HA 2K75A 3ULJA 5HY6A 4DV0L 3BZCA 1XNQL 2F0IA 4IQZA 4KKTA 2VL6A 1IHZA 3PO2B 2L15A 4C3IB 3TBIB 3VDYA 1BBUA 4L63B 3N6RA 4LAAA 2JA6G 1X3EA 3RZDB 3CCRA 4AH6A 1IL8A 5KIXA 1QOHA 1NTGA 5K5PA 1TWHH 3W5OA 4YHHQ 1Z7TA 5ELCA 2EY1A 2WAQE 2KUMA 3I3CA 4XT3B 1Z6HA 3I4NG 1JT8A 1SMXA 3EA6A 5IYCG 3MHBA 5IGDA 2IL8A 4DXGA 1E24A 1YJNA 3C2PA 2B63B 1IBML 2KCMA 1SFOH 3EJIA 5D65A 3ZJYC 2TSSA 4UHVA 4JG2A 5C0XG 1F9RA 5C4JH 4DNRB 2UXCQ 3OTOQ 5IYBG 1AN8A 2KBNA 1Y8OB 3CCVA 2E5LQ 5EBCA 1W6KA 4ZKBB 3DHQA 1H9SB 3DM1A 3U4ZA 3M4QA 1R9TB 1TS3A 1KLUD 2WB1B 2CQOA 4C3JH 2KOLA 4KHVA 1K0SA 1MSGA 3IAYA 1GUWA 2Q8TA 1NCVA 4EVOA 1VQ5A 2RHQB 4HIKA 3H0GG 3PO2G 4LFCL 2Q2TA 4DK6C 5E3FA 3QR8A 1JE5A 1Q1EA 4UP9A 5AFWA 1XTDA 3QWNA 1PDQA 2IT1A 1CI3M 1JCKB 1FNVA 2ICEC 4KJNA 2E2IH 1CQVA 1RTNA 1UWVA 2XIWA 1D1KA 2PMZB 1DJRD 4DN4M 1VMCA 4DV6L 1SR3A 4DR6Q 2YTVA 3OIPA 2QEXA 3T53B 1BXTA 5JVH3 1B3QA 4DA2A 4LF4Q 3MXNA 3OPOA 2JE6I 1MIUA 5M3FG 3M7GA 3PUVA 2OWOA 3MTSA 4OO1G 4KD3A 2EYOA 1EOVA 1M4VA 5IT9E 3S14B 5ELEA 2NZHA 1J6QA 1V8QA 3LX0A 4DUZQ 1N32L 4L8JA 1QVFA 1HQMC 3A8KE 4HTHA 2F4VQ 3LGJA 4Y7NB 1DZ1A 2BA1A 1VQFA 3OWEB 5EKKA 3GD7A 4PV1C 4JPBW 5LL6S 1T5XD 4MTKA 5ELBA 4POGA 1FGBD 2K28A 1JQYD 2EYFA 1HZCA 3DXJC 3FVQA 4Q5VA 3D6WA 5ELNA 2KA7A 2HQEA 2KENA 3NE5B 3RD4A 1I6VC 2ZJPA 4DR5L 3W3AA 3I90A 4QMGA
chains in the Genus database with same CATH topology
3HS0C 5FOBB 2NVQB 1H9JA 3OIQA 2R93B 3SHLA 5C0XJ 3HOZB 1D1IA 4F87A 3G7LA 3LWEA 4XQNA 2Q8IB 1EOTA 3O13A 2JA5B 3M7NA 5DAUA 3GTKB 1CHPD 5CR3A 1G2TA 3SVMA 3S9WA 1SEBD 3LWUA 4O42A 4H7BA 2QDBA 1AEXA 2NBFA 2J0TD 3AB9A 1A6XA 4LMQD 5E4XA 1LABA 1Y1VB 2JXMB 1XWEA 2F0SA 4K2LA 1BQQT 1BCPC 2K03A 2G9DA 2KCNA 1EQTA 2F0TA 2B2VA 4RHSA 1I4XA 3QO2A 1TU2B 2B2VC 2K1BA 1TT2A 2X69A 5IGGA 5K36G 5NUCA 1G291 1EU3A 1XXGA 2AUJD 1D5ZC 3OWFA 1ZXTA 4O1NA 3R8BA 1GOZA 1BOSA 4K6LA 4X3UA 3GTOB 1YNND 2EY2A 4V190 1L0XB 2FFKB 4F8MA 2D62A 1SYDA 2PNRC 3TZDA 1I4PA 1ILQA 3LNNA 3S1MB 1EIHA 5IGEA 1HHVA 2A73B 1W6JA 4K8IA 2EYLA 2PZWA 4NW2A 4IFDH 4IUTA 5CBAE 4HCSA 2JSOA 1B50A 1QNKA 1RTOA 1A3TA 4IFDJ 3GTJB 1ML0D 1SNPA 4KKSA 3D3RA 1EEID 2K04A 2K5QA 5IIFA 3BYYB 2Z1CA 3PV0A 2F0EA 4C3HB 3H3VC 1J8IA 2IPKD 4RWSC 1DOLA 4R9WA 4RFBA 5K36H 1CA6A 1DM0B 4KY6A 2KVMA 2FINB 4FF2A 1QB5D 5E4WC 4Z9CB 3HEJA 5ISRA 1DD2A 1SXTA 1JICA 4IUQA 1ESRA 2EYMA 2R61A 4XQJA 4U68A 2F0QA 2N55A 2H1EA 2KJXA 2CW0C 2O2LD 3ONAB 5EPLA 1I4GA 1YNJC 3K6OA 1NAPA 4KN7C 2BDOA 2B2YC 3FMCA 5F2DA 5I4DA 3S1QB 4DNTB 1KLGD 5FK9C 4ZLTF 3RZOB 3VR2A 3FEWX 4XIGS 3CU7A 1SYGA 2WACA 3TP8A 3EVQA 4FXDA 4GZYC 5EKLA 3MWYW 1CA5A 1SE2A 3HOXB 3I4MB 3ND8A 5FO7B 3VYSA 3EROA 2QILA 1GHJA 1MI2A 4ILWA 2RDFA 3SK8A 1GUNA 2QEJC 2F0WA 2BA0A 2A6ED 3TP5A 1F9SA 3U9SA 4H0LC 1WTQA 1WCMB 3MXUA 1WTXA 3BG3A 1EZ8A 2E75C 2G9HD 2D2CC 1D2BA 1MSHA 3T4AC 3GTMB 2JA7B 2EJGC 1B9MA 1IKMA 4WRDA 1PLFA 3X3MA 1JC7A 4IUNA 4M8AA 5G3LD 4KKUA 3ZYYX 3HOYB 3T16A 2NUCA 1CZWA 1TY2A 1ICWA 3QIAA 1TWCB 1I6HB 1HUNA 2SNMA 1M8AA 1PFNA 5TSSA 4G7ZC 4K5XA 2AWOA 5M9OA 2K05A 5DEHA 1BUVT 2F0MA 3SDZA 1EY5A 1KNAA 2FHTA 3R2TA 2MGSA 2X6LA 1C8CA 2K01A 2EXZA 2EYJA 1Y1WB 1LTGD 2TMPA 1HFNA 4WORA 5KYLA 1G2SA 4HR7B 1ZKOA 1CM9A 3MEHA 4HSVA 1JWUD 2MUYA 4KHZA 1K83B 1SYBA 1A2UA 2J7ZA 3E5SA 4BS9A 2K5DA 3I72A 4C1NK 4DU9A 4C1NI 4YIJA 4JBWA 4RGMA 1HUMA 3HP3A 1VDZA 1F77A 3BDLA 2JA6B 2A69D 1EL0A 4K5WA 3KK7A 3V96A 3CQZB 1PYWD 2YYZA 1EYAA 3VYTA 3I4NB 2EVBA 2F0JA 3PUYA 4H44C 4ZUJA 2PW5A 4HCEA 1V43A 3L3OC 5A2QE 1LLRD 2KEDA 5JJZA 1LT3D 1E2WA 1GHKA 1PRTD 1I4RA 2MHVA 1F2MA 1XTCD 1D5XC 1IW7C 1UNSA 3NBHA 1SJHD 2O5IC 2B2WA 3Q23A 1FYCA 3H91A 3J81E 2NVYB 5M5XB 1MD2D 3H0GB 1EY8A 5CYUA 2L11A 4BY1B 2Z4IA 5M5WB 3KUPA 5C6AA 1QCBD 4RKBA 1S5ED 5IGCA 2EPBA 1PTOD 3S15B 2F1MA 4QUFA 1SNOA 5M3FB 1STHA 4IUVA 3GTPB 2RDGA 2BE5D 2LFNA 2NN6G 1EY6A 1LTAD 3FPPA 1TS5A 1EY0A 2FMCA 5C4XB 1PFBA 1E2VA 2BDNA 2RA4A 4BA1I 2XRQD 4N9TA 3GQBA 3S1NB 3DWPA 2IX3A 3URYA 4KN4C 5ELFA 4K8JA 1SYFA 1S4ZA 3K7AB 5J22A 1CT1D 3T13A 4MHEA 2RSNA 1ZEQX 2L9HA 4K2KA 1OXVA 3NP8A 1B4OA 2CQAA 1ONLA 2KEEA 4IFDI 4I7ZC 4P2CB 3OW7A 1EZ6A 1KTKA 3J80L 1HCZA 1PRTF 3BDOA 3DWAA 4FNFA 4CGYB 3KBGA 3TMEA 4ULLA 1STEA 4BBSB 5A35A 4F7XA 3M4YA 1JWMD 1RF2D 3L7ZC 1LTID 2BCOA 1OXSC 3F2UA 4LK1C 1PZID 4UAIA 4M1UB 1F2ZA 3SR1A 4X3TA 5CC4A 4KV6A 4IALA 4H13C 5C0XH 4EQPA 4FXKC 1PTOF 3KLSX 4WFN3 2EYHA 2WKDA 4CKEA 4QF4A 1SE3A 1I4QA 4DFAA 3DEOA 2RDHA 5LHY1 4B08A 3NXWA 1EYCA 1O7LA 3VYRA 2OXPA 4G7HC 2YU9B 3DMUA 2OEOA 4FF4A 2JA8B 4J8QA 2AWNA 4OO1H 2F3WA 2EE1A 5DNFA 1VF7A 1TS2A 2DY8A 3E0JA 3NQTA 5I2YA 3DUZA 1E2ZA 4Q0FA 3TP7A 3DWQA 2EYPA 3I73A 4AYBB 3QOJA 2C9OA 1D6EC 2C5CA 1R4PB 5EBDA 2XWBB 3T51B 1X3QA 3K0YA 2NVXB 3CKIB 1BR9A 1B53A 1QWYA 4G57A 1TS4A 2QKIC 1STYA 2PZUA 3MC0B 3I70A 2WINB 2ZXRA 3A7AB 2NTTA 3EQLC 1PXUA 1QJOA 4IUUA 1BNZA 2QCPX 3SE0A 2EY6A 3PUWA 2K6AA 5I6WA 5BN4A 5C3EB 3IL8A 5C44B 1BO0A 4J6HA 3HOUB 1F9QA 1SNMA 2E2JB 5KRUA 3MXGA 1H9MA 1KAAA 2XN9C 4LJZC 3V2TA 5EPKA 3I8ZA 3QG1A 4CKCA 4PMWA 4PMCA 3P20A 4OIKA 3A7LA 3JAML 5C4HA 4C2MB 1LT5D 3GTLB 5JEAG 5CV6A 3HKZB 3FKIB 3E6ZX 1YNNC 1EWCA 2NB0A 2Y0SB 1JOKA 1STBA 4TKOB 4IUPA 1F2LA 2EJFC 3PUZA 5LL6X 3PO3B 3C1FA 3TZUA 2JP1A 2F0FA 4A3JB 1ZYRD 4XYQA 3RMHA 2ZT9C 3TP6A 3R3OA 3PUXA 1JOOA 3VR3A 5EJWA 2F0VA 5HURA 3M85A 2F0UA 3Q6SA 4XXEA 1SYEA 1Q90A 2L12A 5A2QL 5CV4A 2L4NA 3D8GA 2DNEA 2HDMA 3M3YB 3IFTA 2IW3A 1EWHA 1SMYD 4K14A 3K5NA 5FLXL 1RCVD 4XTCS 1EYDA 4DAVA 2F0PA 1U4PA 3KF8A 2O4XA 1Z47A 5BN5A 1PTOB 1BBXC 1OO9B 1Y8PB 4X3SA 4OIJA 3FDTA 2B2UA 2MPMA 3P1HA 4F88A 3HGBA 5CV5A 1T5EA 5JEAJ 5KNBA 4CJ1B 2Z8LA 3VYUA 1UUPA 1DCZA 5ELDA 1VCIA 4BWGB 1FNUA 4X3KA 4FF3A 1STGA 2ZXOA 5JPMC 3BDCA 3VR6A 1Q8IA 5C3XA 1CTMA 3MVVA 3PIP3 1ENFA 2DNCA 1RODA 1NR2A 1CK1A 3AU7A 1ET9A 1S5FD 2XWJB 3S2DB 4E6IA 1LTSD 2H4OA 4A3DB 1C4QA 3MFYA 3NWTA 4A3MB 2B8FA 4FVMA 3NTHA 1JE4A 5KGUA 4G4KA 1MGSA 4QCLA 3BYTB 1XX8A 2IWHA 1DOMA 4DF7A 1PFMA 4RHRA 3S1RB 3H94A 4NP5A 2A6HD 2A6EC 1WTPA 1B3AA 4RGTA 5KYIA 1STNA 4ABNA 5CMDA 2A68D 4B9WA 3A8IE 5IT9L 4A3FB 5COYA 3OMGA 3D31A 4RA8A 3N52A 1Y8NB 2KCCA 4IURA 4A3BB 3EFXD 1RDPD 1JORA 1G6ZA 3HG9A 4KMUC 5FO9B 3FPUB 1O7YA 1A15A 2L1BA 4ZKCB 3VR4A 1H9KA 2M00A 3K5LA 3D4WA 4ZAIA 3J7AF 2B2TA 2D5DA 4G7OC 2E76C 2IJ0A 4ODGA 1PTOH 1AFPA 2VB2X 3WOFA 3A54A 5BN3A 3J7AV 5I6YA 3IFDA 4ME5A 5C0XI 3CRLC 1Y69U 3PIO3 3S17B 3SK6A 3C46A 3R93A 1ENAA 1B9NA 4QB4A 3S2HB 1VMPA 2LS01 3ITPA 1EQVA 1WTVA 4V0BA 1HFGA 5KEEA 1WVLA 3QOLA 2XRSD 3C1EA 3HOWB 5E1FA 1GUGA 3GO5A 4C3JG 1LTBD 2B2WC 4QUCA 3QJYA 4RGNA 1MBYA 1OXXK 4N9PA 2SEBD 1GJXA 3T56B 3BVMA 2L5TA 5CBEE 4OO1I 2Q8RE 1OXTA 1EY7A 1TWGB 1BF4A 2A69C 1ET6A 2HCIA 3I91A 5CGKA 3OOCA 1I50B 2V4DA 5FKAC 3A55A 1HA5A 1SNQA 1S5CD 5T1GA 5CV9A 1U9RA 1PRTC 5CORA 3ND9A 3Q24A 5JPNC 2XVSA 4HEDA 3S16B 1A2TA 1GUSA 1SAPA 2R3ZA 4NDXA 4DK0A 4EQOA 5M5YB 3RLFA 3OSOA 5CV8A 5DM73 2QF7A 2DY7A 5HGTA 5CV7A 3WOEA 4B9XA 4DGZA 2JEBI 2L55A 2VUMB 1I3QB 2E2DC 4A3KB 2I07B 4FXGC 5D14A 1SDFA 2J4XA 1SE4A 1EU4A 1NSNS 1EIGA 2LKVA 4C3IG 2EJMA 1PTOC 1SYCA 2PYKA 3NK9A 2PPBC 2EDGA 1B2TA 2VNUD 2RQXA 1SJED 4FF1A 2BE5C 3BZDB 2K5WA 4MIUA 4K6DA 1K8MA 2OT2A 2I46A 2K32A 3SK5A 4CJ2C 4ZRZA 1KNEA 2ID0A 1HRJA 2NN6H 4UDUC 2EZVA 3P75A 2NYZD 4CKBA 3GV6A 1EY9A 1NR4A 2F0DA 1IYVA 2AUKA 1X3PA 5IGFA 2NTSA 1RJTA 1BCPD 1HXYD 4DAPA 4KI0A 2K7VA 2CVRA 2ZXPA 1DOKA 2WIIB 2A5HA 3MAQA 1F2YA 2NZ1D 3P7JA 5EGTA 4A3IB 2KHSA 1LTRD 3KLRA 1KDBA 2BOSA 1TR5A 1A3UA 4QIWB 2X6GA 4HN7A 1AW7A 4OGQC 1GUTA 2PCFB 5I9PA 1TWFB 2D9UA 1HQRD 1LT6D 1R4QB 4A3EB 4K5VA 4KJOA 4A3GB 4IFDG 2OF1A 1XYIA 1Q1BA 5KNCA 3PMFA 2RBMA 3K5OA 3U9OA 3D6CA 1KABA 2AQ3B 3HOVB 2HCCA 3UI2A 4DK1A 1O80A 1J9OA 1JB3A 2F0LA 2SNSA 2F4IA 2A74C 5IGBA 1LV9A 1U4LA 3KBXA 1IKLA 1TKWB 1FD7D 1VF5C 3NTIA 5JAVA 4BBRB 2PZTA 1TVXA 3C3LA 3A8JE 4RAUC 4CBVA 1EFID 2E74C 3D4RA 2L0CA 3SXHA 3VA7A 2KQ3A 1BCPF 1FR3A 3W2DA 1ENCA 3K59A 3Q0AA 1WTOA 1TWAB 3H09A 3G6JB 4I65A 1LT4D 2CW0D 1AZQA 1YNJD 1QNUA 4C56C 2M2LA 1II3A 3GTGB 2Z4HA 4BY7B 1IYUA 3MXPA 2R6GA 3NQIA 3CRKC 3M4OB 4KY7A 4ZYSA 5I9OA 1B44D 5FO8B 4RCNA 2K33A 3AMUA 1V1PA 2GA4B 3I4LA 3TDQA 1CFMA 4KD4A 3GTQB 3J80E 1CQFA 5IODA 2RSOA 5D3IB 3K58A 1D5MC 3MA2B 2NVTB 1G91A 1WTWA 1PZKD 4HMJA 1O7ZA 5DM63 5J1ZA 1ILPA 1O78A 3GV3A 5C5LA 1QILA 4TQUS 2FMMA 2VB3X 1F9PA 3OMCA 1PRTB 4ZK9B 3KLSA 1GUOA 2R92B 5M3MB 3D4DA 4OL7A 2M9VA 2B2YA 3DEPA 1V1OA 3NBIA 1STAA 3BS1A 2WAQB 3CHBD 1SNCA 2F0GA 1LACA 1CHQD 3NTKA 2WKCA 4JK1C 2IX0A 1ESFA 1H9SA 4DXFA 1LTTD 2F03A 2MP1A 1HTPA 5JEAH 1PZJD 4C3HG 1LO5D 3SK4A 3J81L 4EGVA 2F0KA 5C4ZA 1U4MA 1DXMA 2F3VA 4HSPA 4RCOA 2B2UC 4IN3A 4J1MA 1B1ZA 3MFGA 1ZYRC 1UAPA 2KECA 2E2HB 2EOTA 2XSCA 4FO2A 1WD1A 4FP5D 3BVZA 3R2IA 1KDCA 1QE6A 2VXWA 5EQ0A 2F0OA 2PQEA 2RKSA 1OXUA 2WV6D 1G8ZD 2LMCB 1E0BA 1DONA 2O5JC 3K5MA 4RH6A 4HAEA 2N88A 1SMYC 4XYOA 2R7ZB 3H6MA 1S5DD 2WP8J 1FNWA 4S3SA 3K57A 2RVLA 2F0NA 1AZPA 3VA5A 3Q22A 4R8NA 4ZQ3A 3TSSA 3IKJA 4DAYA 2EY5A 2F0HA 1TWHB 4KY5A 2SOBA 3OHXC 3BVGA 1HTLD 5KNDA 1H9RA 3J7YW 1WTRA 4NKLA 1Q3LA 3NWSA 2ICIA 4FYDA 4PMBA 1SFOB 1JR0D 3SEBA 5JVG3 5EKIA 3HRZC 3RUZA 4XDXA 4L6TB 5C4JB 2HUGA 2B8GA 5C3WA 1QG7A 3QB3A 1PMRA 4CJ0B 2SDFA 1BCPB 5JOBA 3FRPB 3JAME 1SSOA 4TSSA 1AP0A 1TQOA 3MZ5A 4C3JB 4TRDA 1Q12A 2LY7A 5J39A 1IW7D 4XT1B 1TIID 2NWGA 1WD0A 1JWSD 2FJ2A 3GP7A 1HPCA 2AQ1B 4HMIA 2MJ8A 2E2IB 4PNYA 5EPJA 2B2TC 4IZ8A 1RHPA 2PW7A 3NPPA 1JOQA 1UEAB 5C5MA 2NN6I 3X3NA 1K8OA 3HZXA 2A6HC 4RKLA 2ENBA 2PO4A 2B39A 2JYOA 4ID6A 1S5BD 3TN2A 1RKNA 4ZUIA 1TY0A 4PQXA 1HA6A 4WJWA 1GXDC 2A68C 4EQNA 1NUCA 2DN8A 3ERQA 2XNAC 1L0YB 1X32A 1BDOA 5G3LF 4U673 3NHHA 2JEAI 1A3VA 4RGOS 4KK7A 3L9AX 3VR5A 4KTAA 5T1IA 2IX1A 3V05A 5D3DA 4BA2I 1SNDA 5FLXE 5IOCA 3A56A 1V1PB 1SBBB 1DYQA 4CHTB 1U4RA 1KDAA 1I4HA 2AQ2B 1EY4A 4XQQA 3NSWA 4A93B 1EEFD 3NUCA 2CHBD 1C48A 1RD9D 4MN3A 4R8IA 2HDLA 5I2XA 1CZGA 3WDNA 4OHJA 4NMZA 2F0IA 4IQZA 4KKTA 3PO2B 1IHZA 4C3IB 3TBIB 4L63B 3N6RA 4LAAA 3RZDB 1IL8A 5KIXA 1QOHA 5K5PA 1Z7TA 5ELCA 2EY1A 3I3CA 2KUMA 4XT3B 1Z6HA 3EA6A 3MHBA 5IGDA 2IL8A 4DXGA 3C2PA 2B63B 3EJIA 5D65A 2TSSA 5C0XG 1F9RA 4DNRB 1AN8A 1Y8OB 5EBCA 1W6KA 4ZKBB 3DHQA 1H9SB 3DM1A 1R9TB 1TS3A 1KLUD 2WB1B 2KOLA 4KHVA 1MSGA 3IAYA 1GUWA 2Q8TA 1NCVA 4EVOA 5E3FA 1Q1EA 5AFWA 3QWNA 1PDQA 2IT1A 1CI3M 1JCKB 1FNVA 2ICEC 4KJNA 1CQVA 1RTNA 2XIWA 1D1KA 2PMZB 1DJRD 4DN4M 1VMCA 3OIPA 3T53B 1BXTA 5JVH3 4DA2A 3MXNA 3OPOA 2JE6I 4OO1G 3M7GA 3PUVA 3MTSA 4KD3A 2EYOA 1M4VA 5IT9E 3S14B 5ELEA 3LX0A 1V8QA 4L8JA 1HQMC 3A8KE 4HTHA 4Y7NB 1DZ1A 2BA1A 3OWEB 5EKKA 3GD7A 4PV1C 5LL6S 1T5XD 5ELBA 1FGBD 2K28A 1JQYD 2EYFA 3DXJC 3FVQA 4Q5VA 3D6WA 2KA7A 2HQEA 3NE5B 3RD4A 1I6VC 3W3AA 3I90A 4QMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDC A;  3MHB A;  3SK6 A;  4HMI A;  4F7X A;  5IGD A;  2OF1 A;  1ENA A;  4K8I A;  5EKL A;  2F0V A;  2EYL A;  2F0O A;  5HUR A;  4QB4 A;  4PNY A;  2PQE A;  2EXZ A;  3PMF A;  4G57 A;  2PZW A;  2RKS A;  2EYJ A;  2RBM A;  3SHL A;  1EY8 A;  4IZ8 A;  4KD4 A;  3ITP A;  1EQV A;  3EJI A;  3U9O A;  2F0U A;  1KAB A;  3D6C A;  5IOD A;  2PW7 A;  1STY A;  1JOQ A;  2PZU A;  5C5M A;  4WOR A;  5KEE A;  1NSN S;  1SYE A;  5KYL A;  1F2Z A;  4DF7 A;  3HZX A;  3QOL A;  3SR1 A;  5C6A A;  2LKV A;  3C1E A;  4RKL A;  1A3T A;  1SYC A;  2ENB A;  2PYK A;  3NK9 A;  4RKB A;  5DAU A;  5E1F A;  4HMJ A;  5CC4 A;  5IGC A;  5CR3 A;  3ERO A;  4ID6 A;  5J1Z A;  3S9W A;  5CV4 A;  1SNP A;  4NP5 A;  4KV6 A;  1RKN A;  3MEH A;  2EY6 A;  2RDF A;  4IAL A;  4ZUI A;  3D8G A;  3H6M A;  3SK8 A;  2F0L A;  3DHQ A;  5C5L A;  4H7B A;  4EQP A;  5KYI A;  2SNS A;  1SNO A;  5I6W A;  4EQN A;  1NUC A;  1STN A;  2F0W A;  3OMC A;  4K14 A;  2QDB A;  1AEX A;  1SYB A;  1STH A;  4S3S A;  3TP5 A;  4MIU A;  3ERQ A;  5IGB A;  4KHV A;  1A2U A;  1EYD A;  4J6H A;  4K6D A;  2F0N A;  1EY6 A;  1SNM A;  3E5S A;  4N9P A;  4B9W A;  2EYH A;  5IIF A;  5KRU A;  4EVO A;  1KAA A;  1EY0 A;  2F0P A;  3D4D A;  3V2T A;  3VA5 A;  4QF4 A;  3SK5 A;  4OL7 A;  1EZ8 A;  2F0E A;  4DU9 A;  4R8N A;  4ZQ3 A;  5E3F A;  4DFA A;  3NHH A;  5JAV A;  4YIJ A;  2O4X A;  2F0S A;  3OMG A;  3P75 A;  1EY7 A;  4K2L A;  1A3V A;  2EY5 A;  1EY9 A;  2PZT A;  4KY6 A;  2F0H A;  4KY5 A;  2F0D A;  4N9T A;  5HGT A;  4KJN A;  2SOB A;  1STA A;  4PMC A;  3P1H A;  3NXW A;  4KTA A;  2F0T A;  5CV5 A;  3SXH A;  1EYC A;  3HEJ A;  5IGF A;  5ISR A;  2KQ3 A;  3BDL A;  5CGK A;  5KGU A;  1SND A;  2EYM A;  4K5W A;  5IOC A;  4NKL A;  4WRD A;  2OXP A;  1SNC A;  5C4H A;  2F0Q A;  1TT2 A;  4IUN A;  5IGG A;  1JOR A;  5NUC A;  1ENC A;  1KDA A;  2F0G A;  4K8J A;  5CV6 A;  1SYF A;  1EY4 A;  1EYA A;  1SNQ A;  2EYO A;  2OEO A;  3DMU A;  4KD3 A;  4PMB A;  5J22 A;  2F0J A;  3LX0 A;  3T13 A;  1STG A;  3OWF A;  3NUC A;  3T16 A;  5CV9 A;  4ZUJ A;  3RUZ A;  1F2Y A;  3BDC A;  2NUC A;  4I65 A;  1U9R A;  2PW5 A;  4K2K A;  5C3X A;  2F3W A;  2M00 A;  4HTH A;  5C3W A;  3D4W A;  3QB3 A;  3NP8 A;  5EGT A;  3SK4 A;  3MVV A;  1JOK A;  2KHS A;  2F0K A;  4NMZ A;  5EKK A;  1STB A;  5C4Z A;  2F3V A;  5JOB A;  5F2D A;  2F0I A;  1II3 A;  1KDB A;  1IHZ A;  2EY2 A;  1A2T A;  1TR5 A;  1EZ6 A;  2SNM A;  3NQT A;  1A3U A;  4J1M A;  4F8M A;  1F2M A;  4NDX A;  4ODG A;  4K5X A;  1TQO A;  4LAA A;  3C1F A;  3TP7 A;  5M9O A;  3MZ5 A;  2EYF A;  2EYP A;  4EQO A;  5I9P A;  5DEH A;  3QOJ A;  2F0F A;  3MXP A;  1SYD A;  3OSO A;  4TRD A;  2F0M A;  5CV8 A;  4E6I A;  5K5P A;  5KIX A;  3TME A;  5J39 A;  5I6Y A;  2EY1 A;  4KY7 A;  2HQE A;  4ME5 A;  5CV7 A;  1SYG A;  3TP6 A;  2WAC A;  3R3O A;  4B9X A;  1EY5 A;  3TP8 A;  5I9O A;  4K5V A;  4DGZ A;  4KJO A;  1JOO A;  3EVQ A;  5IGE A;  4QMG A; 
#chains in the Genus database with same CATH topology
 2WFW A;  3HS0 C;  5FOB B;  2NVQ B;  1H9J A;  3OIQ A;  4DAY B;  4DR4 L;  3PSI A;  2R93 B;  3SHL A;  5C0X J;  3JAM c;  3KJP A;  3HOZ B;  1D1I A;  4R4I A;  1A0I A;  4A93 H;  1RIP A;  3H3V H;  4F87 A;  3G7L A;  3LWE A;  4XQN A;  2Q8I B;  1EOT A;  3O13 A;  1U5K A;  4L5S A;  3M7N A;  5DAU A;  3GTK B;  2JA5 B;  1CHP D;  5CR3 A;  1G2T A;  3FHW A;  3SVM A;  3S9W A;  1SEB D;  4DR2 Q;  4CDF C;  3PO2 H;  3LWU A;  4O42 A;  4H7B A;  4C3I H;  1SLJ A;  1N36 L;  2QDB A;  1AEX A;  2NBF A;  2J0T D;  4GNX B;  1SN8 A;  2GVB A;  3RZD H;  3AB9 A;  4BBS G;  1A6X A;  4LMQ D;  4H02 A;  3CAM A;  2UUC Q;  5E4X A;  3CCJ A;  1LAB A;  1Y1V B;  2CFM A;  2JXM B;  4HJ5 A;  5FLM H;  3KF6 B;  5IP7 G;  4PZ7 A;  1XWE A;  2GVA A;  1WI5 A;  2F0S A;  4K2L A;  1BQQ T;  1BCP C;  5DLQ E;  2K03 A;  2G9D A;  2KCN A;  2B63 H;  1EQT A;  2F0T A;  4LF8 L;  2B2V A;  4RHS A;  4FDB A;  1I4X A;  3QO2 A;  1TU2 B;  2B2V C;  2K1B A;  1TT2 A;  2X69 A;  5IGG A;  5K36 G;  3K8A A;  3OW2 A;  5NUC A;  1G29 1;  1EU3 A;  3M9B A;  1XXG A;  2AUJ D;  1D5Z C;  1KIX A;  1KQS A;  3OWF A;  1ZXT A;  4O1N A;  3R8B A;  1GOZ A;  1WTH A;  1BOS A;  1R9T H;  3AYH B;  1HJP A;  4JCV E;  4K6L A;  4X3U A;  4NXN Q;  2QA4 A;  3GTO B;  1YNN D;  2EY2 A;  4V19 0;  1L0X B;  3CF5 A;  2FFK B;  5FLX c;  2CWA A;  4F8M A;  2D62 A;  3F1Z A;  4YHH L;  3CCL A;  1SYD A;  2PNR C;  1YJ9 A;  3TZD A;  1I4P A;  1ILQ A;  3LNN A;  4DV3 Q;  4GN3 B;  3S1M B;  4R1J A;  1YI2 A;  1EIH A;  2CH4 W;  5IGE A;  1HHV A;  2A73 B;  1W6J A;  4K8I A;  2JA8 G;  2EYL A;  3KJO A;  5IE8 A;  2PZW A;  4NW2 A;  3S14 H;  2OCE A;  4IUT A;  5CBA E;  4IFD H;  1EFW A;  1WFQ A;  4HCS A;  2UXC L;  2JSO A;  1B50 A;  1QNK A;  2Q2I A;  3OTO L;  1RTO A;  1A3T A;  4L5T A;  2E5L L;  4IFD J;  3GTJ B;  1EQQ A;  4Y7N H;  1ML0 D;  1SNP A;  4KKS A;  4QY7 A;  3D3R A;  4AYB G;  5IP7 H;  3J81 i;  4DR3 Q;  4A3L H;  3STB D;  3EIV A;  1E1T A;  4GN5 A;  1EEI D;  2K04 A;  3F2B A;  2K5Q A;  5IIF A;  1KL9 A;  3BYY B;  2Z1C A;  2JA9 A;  3PV0 A;  2F0E A;  4C3H B;  3H3V C;  1J8I A;  2IPK D;  1N34 Q;  4RWS C;  1DOL A;  4R9W A;  3SGI A;  4RFB A;  5K36 H;  1CA6 A;  1DM0 B;  3KOJ A;  2NVQ H;  4KY6 A;  2KVM A;  2FIN B;  1VQJ A;  4FF2 A;  1PH9 A;  4DR6 L;  1QB5 D;  2R93 H;  1PFS A;  2BH2 A;  2ZTE A;  4Z9C B;  5E4W C;  1MHW C;  4B3T Q;  4IJL A;  3HEJ A;  3UDF A;  5ISR A;  3HOZ H;  1DD2 A;  1NE3 A;  1SXT A;  1JIC A;  4IUQ A;  4LF4 L;  1ESR A;  1X3F A;  2EYM A;  2R61 A;  4RG1 A;  4XQJ A;  4U68 A;  2F0Q A;  2N55 A;  2JA5 H;  3GTK H;  1VQ7 A;  4DUZ L;  1VQO A;  5C3E G;  4IOC A;  4AQY L;  2H1E A;  2KJX A;  5C44 G;  2CW0 C;  2O2L D;  3ONA B;  5EPL A;  2WB1 E;  1I4G A;  1YNJ C;  3HOU G;  1S72 A;  3K6O A;  2F4V L;  4P72 A;  1NAP A;  4KN7 C;  2BDO A;  2B2Y C;  1HNZ Q;  4QJF A;  3FMC A;  5F2D A;  5H1S E;  1Y1V H;  5I4D A;  1N8R C;  3S1Q B;  1B7Y B;  2HD3 A;  4DNT B;  1KLG D;  5FK9 C;  3UDX A;  1VQB A;  5IP9 G;  4ZLT F;  3RZO B;  3VR2 A;  5IT9 c;  3FEW X;  4NPS A;  2ZM6 Q;  4XIG S;  4YCU A;  3CU7 A;  1SYG A;  2WAC A;  3TP8 A;  4YCV A;  3HKZ G;  3EVQ A;  4FXD A;  3FKI G;  3J7Z C;  4GZY C;  2B29 A;  4ZCK A;  4LUZ A;  3UE1 A;  1PV4 A;  2K52 A;  5EKL A;  2VY3 A;  3MWY W;  1CA5 A;  2Y0S G;  1YVC A;  1SE2 A;  3ER0 A;  1VQI A;  3HOX B;  3I4M B;  3ND8 A;  5FO7 B;  4YY3 Q;  2R7F A;  4JI8 Q;  4DR2 L;  4P75 A;  3VYS A;  3AFQ A;  3MXN B;  3PO3 G;  3ERO A;  2QIL A;  3GTO H;  1GHJ A;  1MI2 A;  3HFZ B;  4ILW A;  2RDF A;  3SK8 A;  4A3J G;  1GUN A;  2BH8 A;  1QZH A;  2QEJ C;  2F0W A;  2BA0 A;  2A6E D;  2CWP A;  3TP5 A;  4ALP A;  1B8A A;  4B3M Q;  1F9S A;  5GQO A;  3U9S A;  4H0L C;  4MNO A;  1WTQ A;  1WCM B;  3MXU A;  4OON A;  1WTX A;  3BG3 A;  3S1M H;  3GDE A;  1EZ8 A;  4X66 Q;  3K7U C;  5L37 A;  2E75 C;  1PH4 A;  2G9H D;  2D2C C;  1VQ6 A;  1D2B A;  1MSH A;  3T4A C;  3GTM B;  2JA7 B;  1YHB A;  2EJG C;  1EQR A;  5GAE C;  2I0Q A;  3ULL A;  2EIF A;  2VZA A;  1DGS A;  3A5U A;  4JI4 Q;  1B9M A;  4DUY Q;  1IKM A;  4WRD A;  1IBK L;  1PLF A;  3X3M A;  1JC7 A;  2G5D A;  4IUN A;  1VQC A;  4M8A A;  3GTJ H;  5G3L D;  4KKU A;  3ZYY X;  2IHE A;  3HOY B;  3T16 A;  3NEN A;  4NXN L;  2R7D A;  2NUC A;  1CZW A;  1TY2 A;  1ICW A;  3QIA A;  1TWC B;  3RR5 A;  3CCM A;  3CC7 A;  1I6H B;  4DV7 Q;  1HUN A;  2SNM A;  1M8A A;  3U4V A;  1PFN A;  4C3H H;  3CPW A;  5TSS A;  1UE1 A;  1TXY A;  2KCT A;  4K5X A;  2AWO A;  4G7Z C;  5M9O A;  4X65 Q;  3EN2 A;  2K05 A;  5DEH A;  1BUV T;  2F0M A;  2DGY A;  1IZ6 A;  3SDZ A;  2Z9H A;  1EY5 A;  1KNA A;  1KRT A;  1UEB A;  2AMC B;  2FHT A;  2N78 A;  2OQK A;  3R2T A;  4GNX C;  2MGS A;  2X6L A;  1C8C A;  2K01 A;  4DKA C;  1VQL A;  2EXZ A;  2EYJ A;  1Y1W B;  2JA7 G;  3PIP A;  1LTG D;  1X65 A;  2TMP A;  1HFN A;  4WOR A;  5KYL A;  4K0K Q;  1G2S A;  4HR7 B;  4X6A H;  1P16 A;  4DR3 L;  1ZKO A;  4DR1 Q;  1CM9 A;  5IYD G;  2ATW A;  3MEH A;  4HSV A;  1JWU D;  4X64 Q;  2MUY A;  3S1Q H;  4KHP Q;  1EWI A;  1YJW A;  4KHZ A;  1K83 B;  3CCQ A;  4CDE C;  1SYB A;  4O0A A;  4A3D G;  3RZO H;  1A2U A;  2B3G A;  2J7Z A;  3E5S A;  4BS9 A;  1I94 Q;  1FL0 A;  1N34 L;  1CSQ A;  2K5D A;  3I72 A;  1HZB A;  4C1N K;  4HJA A;  4DU9 A;  4DNI A;  4C1N I;  1JJC B;  4YIJ A;  4HJ8 A;  4LFB Q;  4JBW A;  4B3T L;  1OTC A;  4RGM A;  2UUA Q;  1HUM A;  3HP3 A;  1VDZ A;  1F77 A;  4IOA A;  1BVS A;  3BDL A;  2JA6 B;  2A69 D;  1JJG A;  1EL0 A;  3HOX H;  3I4M H;  3L2P A;  4K5W A;  3KK7 A;  3V96 A;  1K8G A;  2PI2 A;  3CQZ B;  1PYW D;  2YYZ A;  2UXB L;  1EYA A;  3VYT A;  3I4N B;  2EVB A;  2F0J A;  3PUY A;  4H44 C;  1XPU A;  1HNZ L;  4ZUJ A;  2GN5 A;  2PW5 A;  4HCE A;  4A3F G;  1V43 A;  3L3O C;  5A2Q E;  1XMO L;  1LLR D;  2KED A;  5JJZ A;  1WCM H;  1LT3 D;  3I55 A;  4UY8 C;  1E2W A;  1GHK A;  1PRT D;  1I4R A;  3H3V I;  2MHV A;  1F2M A;  1XTC D;  1D5X C;  4LWC A;  1IW7 C;  1UNS A;  1X3G A;  3NBH A;  3G6E A;  4A3B G;  1XJV A;  3GTM H;  1SJH D;  2O5I C;  2B2W A;  3Q23 A;  1N33 Q;  1FYC A;  3H91 A;  3J81 E;  2NVY B;  4IO9 A;  1XNR Q;  2K50 A;  5M5X B;  1MD2 D;  3H0G B;  1EY8 A;  5GAG C;  4JI7 L;  4YY3 L;  5CYU A;  2L11 A;  4JI8 L;  4BY1 B;  2Z4I A;  3HOY H;  5M5W B;  1X56 A;  3KUP A;  5C6A A;  1QCB D;  4RKB A;  1S5E D;  5IGC A;  1TWC H;  1MKH A;  1A62 A;  2EPB A;  3Q8D A;  1PTO D;  4LFA Q;  1I6H H;  3CCU A;  3ICE A;  2F1M A;  4QUF A;  3S15 B;  3UE0 A;  1SNO A;  4B3M L;  4ME3 A;  5M3F B;  4X62 Q;  1STH A;  4IUV A;  5GRO A;  2OQ0 A;  3GTP B;  1AH9 A;  2RDG A;  2BE5 D;  2LFN A;  2NN6 G;  1EY6 A;  1LTA D;  4X66 L;  3FPP A;  3PIO A;  1TS5 A;  1EY0 A;  2P5Z X;  2FMC A;  1CUK A;  5C4X B;  1VQ8 A;  3RNU A;  1PFB A;  1E2V A;  2BDN A;  1VQN A;  5JJK A;  2RA4 A;  4BA1 I;  2XRQ D;  4N9T A;  3GQB A;  1E1O A;  3S1N B;  1Y1W H;  3HOW G;  4DUY L;  5JJL A;  2PQA A;  3DWP A;  2IX3 A;  3DM3 A;  3URY A;  4KN4 C;  5GAD C;  5ELF A;  4K8J A;  3J7A 5;  1SYF A;  1S4Z A;  3K7A B;  1W3S A;  5J22 A;  1CT1 D;  3T13 A;  5GAH C;  4MHE A;  2RSN A;  1ZEQ X;  2L9H A;  4BY1 G;  4A3C G;  1K83 H;  4K2K A;  4DV7 L;  1OXV A;  3NP8 A;  1B4O A;  1YBY A;  2CQA A;  1ONL A;  2KEE A;  1M90 C;  4IFD I;  4I7Z C;  4P2C B;  4POF A;  1HNX Q;  3OW7 A;  1EZ6 A;  4X65 L;  1KTK A;  3J80 L;  1HCZ A;  1KHI A;  1PRT F;  3BDO A;  4N8X 1;  3DWA A;  4FNF A;  4CGY B;  3KDF A;  2HHH Q;  3KBG A;  3TME A;  1NBW A;  4ULL A;  4BXX G;  1STE A;  2JA6 H;  4BBS B;  5A35 A;  4JI0 Q;  5C4X G;  4F7X A;  3M4Y A;  4RMF A;  1JWM D;  3CQZ H;  1RF2 D;  3L7Z C;  1LTI D;  2BCO A;  3I4N H;  4K0K L;  1OXS C;  3F2U A;  2A19 A;  5IYC H;  4DV4 Q;  4LK1 C;  1PZI D;  4UAI A;  4PG3 A;  4M1U B;  1F2Z A;  3SR1 A;  4DR1 L;  4X3T A;  4CDC C;  5CC4 A;  1Q82 C;  4X64 L;  4KHP L;  2ES2 A;  4KV6 A;  4IAL A;  4H13 C;  5C0X H;  4EQP A;  4FXK C;  1PTO F;  1I94 L;  3KLS X;  4LF6 L;  5IYB H;  4WFN 3;  5LMN W;  1T9H A;  2XGT A;  2EYH A;  2WKD A;  4IPC A;  2VUM G;  4CKE A;  4LFB L;  4JV5 Q;  4QF4 A;  1SE3 A;  3I56 A;  1I4Q A;  2VW9 A;  1C7Y A;  3E0E A;  4LUO A;  4DFA A;  3DEO A;  2RDH A;  1Q81 C;  2UUA L;  1YIJ A;  2NVY H;  4R4T A;  5LHY 1;  3TRE A;  1PH7 A;  5M5X H;  3H0G H;  4B08 A;  3NXW A;  1EYC A;  1O7L A;  4BY1 H;  2JK8 A;  1BBW A;  5M5W H;  3I4O A;  3VYR A;  2OXP A;  4G7H C;  2YU9 B;  3DMU A;  2OEO A;  4FF4 A;  2IHF A;  1Z9F A;  3S15 H;  4DAM A;  4L5R C;  2JA8 B;  2RCF A;  2AWN A;  4J8Q A;  2HIV A;  5M3F H;  3TRZ A;  4OO1 H;  2F3W A;  2EE1 A;  5DNF A;  3GTP H;  1VF7 A;  1TS2 A;  2DY8 A;  4O2D A;  3E0J A;  2VQE L;  5J3B A;  3NQT A;  1B70 B;  5I2Y A;  1CSP A;  5C4X H;  1VQK A;  1PH1 A;  3DUZ A;  1E2Z A;  4Q0F A;  3TP7 A;  3DWQ A;  1PH2 A;  2EYP A;  3I73 A;  2JJQ A;  4AYB B;  3QOJ A;  3BZK A;  2C9O A;  1Y14 B;  1D6E C;  2DUD A;  1N33 L;  3S1N H;  2C5C A;  1R4P B;  5EBD A;  1XNR L;  5IWA Q;  2XWB B;  3T51 B;  1X3Q A;  2MO0 A;  4LF7 Q;  3K0Y A;  2NVX B;  3CKI B;  1BR9 A;  1B53 A;  1QWY A;  2RHS B;  1TS4 A;  3K7A H;  4G57 A;  3DLL A;  1JMC A;  4A3I G;  2QKI C;  4JI1 Q;  1STY A;  2PZU A;  3MC0 B;  3I70 A;  1VQD A;  2WIN B;  2ZXR A;  1IYJ B;  3A7A B;  4LFA L;  4QL5 A;  2NTT A;  3EQL C;  2CCZ A;  3HKS A;  1SRO A;  1VS0 A;  1PXU A;  1QJO A;  4IUU A;  1BNZ A;  2QCP X;  1L1O A;  3M4P A;  1LUZ A;  3SE0 A;  4X62 L;  2EY6 A;  3PUW A;  2K6A A;  3J81 c;  4A75 A;  3B6Y A;  5I6W A;  4JI5 Q;  5BN4 A;  5C3E B;  4A3E G;  3IL8 A;  5C44 B;  3I2Z A;  1BO0 A;  1GKH A;  4MZ9 A;  4J6H A;  4A3G G;  3HOU B;  1F9Q A;  1MJC A;  1SNM A;  2E2J B;  5KRU A;  2VS1 A;  3MXG A;  1H9M A;  1KAA A;  2XN9 C;  4IJH A;  4LJZ C;  3V2T A;  5EPK A;  4BBS H;  3I8Z A;  3QG1 A;  4CKC A;  1CKM A;  4PMW A;  2K5V A;  3HOV G;  3NBH B;  4PMC A;  3P20 A;  4OIK A;  1VQ4 A;  3A7L A;  1HNW Q;  3JAM L;  5EAY A;  1CKN A;  2FXQ A;  5C4H A;  4C2M B;  1LT5 D;  1XPO A;  3GTL B;  3PQI A;  5JEA G;  2Z6B A;  5CV6 A;  3PF4 A;  3HKZ B;  1NY4 A;  3FKI B;  3CMA A;  1PH5 A;  3E6Z X;  4WJ4 A;  1YNN C;  1EWC A;  2NB0 A;  1MJE A;  2Y0S B;  2E8G A;  1WYD A;  3E9H A;  4OEM B;  1HNX L;  1JOK A;  1IL2 A;  1STB A;  4TKO B;  4BBR G;  4IUP A;  4A4I A;  3L0O A;  1F2L A;  2EJF C;  2YV5 A;  2LXJ A;  3PUZ A;  2HHH L;  5LL6 X;  3PO3 B;  1J5E Q;  1GD7 A;  3MEF A;  1KC8 C;  1PVO A;  3C1F A;  1S3O A;  3TZU A;  2JP1 A;  2F0F A;  4A3J B;  1ZYR D;  4XYQ A;  3RMH A;  4JI0 L;  2XTI A;  2ZT9 C;  3TP6 A;  3R3O A;  3PUX A;  1JOO A;  3VR3 A;  5EJW A;  2K5H A;  2F0V A;  5HUR A;  2YU9 H;  4DV4 L;  3M85 A;  2F0U A;  3Q6S A;  4XXE A;  1SYE A;  2PQA B;  2JA8 H;  1Q90 A;  2PMZ E;  4BY7 G;  2L12 A;  1NMF A;  5A2Q L;  5CV4 A;  5LMU Q;  2L4N A;  2OTL A;  3STB C;  3D8G A;  2DNE A;  2HDM A;  4NXM Q;  3M3Y B;  3IFT A;  2IW3 A;  1EWH A;  1SMY D;  4K14 A;  3K5N A;  5FLX L;  1RCV D;  1HZA A;  4XTC S;  4LF5 Q;  1EYD A;  4JV5 L;  1UE7 A;  3A0J A;  4DAV A;  2F0P A;  1U4P A;  3CW2 C;  3KF8 A;  2YTY A;  2O4X A;  1Z47 A;  5BN5 A;  1PTO B;  4A76 A;  1BBX C;  1C9O A;  1OO9 B;  1Y8P B;  4X3S A;  2NVX H;  3KDF B;  4OIJ A;  3FDT A;  4LF9 Q;  3AQQ A;  2B2U A;  2MPM A;  3P1H A;  4F88 A;  3HGB A;  1GM5 A;  5CV5 A;  1T5E A;  1IBL Q;  4HJ9 A;  5JEA J;  5KNB A;  2UUC L;  4CJ1 B;  2Z8L A;  3VYU A;  1UUP A;  1NNX A;  1DCZ A;  5ELD A;  1VCI A;  1K28 A;  4BWG B;  1FNU A;  4X3K A;  2PNH A;  3CME A;  4FF3 A;  1STG A;  2ZXO A;  1YZ6 A;  2R92 G;  5JPM C;  4JYA Q;  1G6P A;  3BDC A;  5M3M G;  3VR6 A;  3T1H Q;  1Q8I A;  4UP7 A;  5C3X A;  5C3E H;  1LM0 A;  5C44 H;  1CTM A;  3MVV A;  3PIP 3;  1P8L A;  4DV5 Q;  3HOU H;  1ENF A;  2DNC A;  1ROD A;  1NR2 A;  1CK1 A;  2E2J H;  3AU7 A;  1ET9 A;  1IBM Q;  4J15 A;  1S5F D;  2XWJ B;  3S2D B;  4E6I A;  3UDI A;  2WAQ G;  5IWA L;  1LTS D;  4LF7 L;  1M1K C;  1E7Z A;  5IY0 A;  1K8A C;  5IP9 H;  2H4O A;  4A3D B;  1C4Q A;  1HH2 P;  3MFY A;  3NWT A;  2Q2U A;  4GLA C;  4A3M B;  3F8T A;  2B8F A;  1C0A A;  4FVM A;  4C2M H;  2F3I A;  3NTH A;  3FP9 A;  5FJ8 G;  1W2B A;  3GTL H;  2CH4 A;  1JE4 A;  5KGU A;  4GOP A;  4PZ6 A;  4G4K A;  1K3B C;  4GKJ Q;  3FKI H;  4GOP C;  1MGS A;  4QCL A;  4IPD A;  5LMN Q;  3BYT B;  1XX8 A;  2IWH A;  1DOM A;  4JI2 Q;  4DF7 A;  1PFM A;  4DV3 L;  3TS0 A;  4RHR A;  2DJG C;  3PCO B;  4LFC Q;  4PZ8 A;  3S1R B;  3H94 A;  4NP5 A;  2A6H D;  4JI5 L;  2A6E C;  4OEL B;  1WTP A;  4LNQ A;  1B3A A;  1NMG A;  3K81 C;  4RGT A;  5KYI A;  4AYB E;  3PGZ A;  1STN A;  2EXD A;  3PO3 H;  4ABN A;  5CMD A;  4HIM A;  2A68 D;  4A3J H;  4B9W A;  3A8I E;  4NB3 A;  3A5Z B;  5IT9 L;  4A3F B;  3TEH B;  4GKK Q;  5COY A;  5BR8 Q;  1CKO A;  2UXD Q;  3OMG A;  1EIY B;  3D31 A;  1HNW L;  2ALY B;  1JB7 A;  4RA8 A;  3N52 A;  4P71 A;  1Y8N B;  2PI2 E;  4IPH A;  4Y52 H;  2R7Z G;  2KCC A;  4IUR A;  4A3B B;  3EFX D;  1RDP D;  4A3M G;  4DV1 Q;  1JOR A;  1G6Z A;  3HG9 A;  4KMU C;  5FO9 B;  2VQF Q;  3FPU B;  1O7Y A;  1A15 A;  2L1B A;  4ZKC B;  3VR4 A;  3M3Y H;  1H9K A;  2M00 A;  3K5L A;  3CXC A;  3D4W A;  1VQA A;  4ZAI A;  3J7A F;  2B2T A;  1QVG A;  3T1Y Q;  1L1O B;  1J5E L;  2D5D A;  4G7O C;  2E76 C;  2IJ0 A;  4ODG A;  1PYB A;  1LTL A;  1EYG A;  1EIF A;  5FJ8 H;  1PTO H;  1AFP A;  2VB2 X;  1D7Q A;  4I7A A;  3WOF A;  1V9P A;  3A54 A;  5BN3 A;  3J7A V;  4N8F A;  5I6Y A;  3IFD A;  4ME5 A;  5C0X I;  3CRL C;  2K5N A;  1Y69 U;  1WOC A;  3PIO 3;  3HKZ E;  3OYY A;  3S17 B;  1Q86 C;  1KD1 C;  3SK6 A;  4JBM A;  3R93 A;  1PH8 A;  1ENA A;  4IPG A;  3C46 A;  1B9N A;  4QB4 A;  3S2H B;  1VMP A;  2LS0 1;  3ITP A;  1EQV A;  1WTV A;  4V0B A;  1HFG A;  2Y0S E;  2JQO A;  5KEE A;  2ZM6 L;  1WVL A;  3QOL A;  5LMU L;  1CKN B;  2XRS D;  3C1E A;  3IRB A;  3BU2 A;  5E1F A;  3HOW B;  2JA7 H;  1GUG A;  3GO5 A;  4NXM L;  4C3J G;  2OTJ A;  1LTB D;  3W1B A;  2B2W C;  3ULP A;  4LF5 L;  1YNX A;  4QUC A;  3G48 A;  5JJI A;  1HR0 W;  3QJY A;  3J80 i;  5IYD H;  3S2D H;  4RGN A;  1MBY A;  1OXX K;  4N9P A;  2SEB D;  1VQP A;  1GJX A;  3T56 B;  1KRS A;  3BVM A;  2L5T A;  2RCN A;  5CBE E;  4A3D H;  4OO1 I;  2Q8R E;  1OXT A;  4A3M H;  1EY7 A;  1PA6 A;  1TWG B;  3NEL A;  1BF4 A;  1IBL L;  2MQH A;  2A69 C;  1ET6 A;  3ERS X;  2HCI A;  3I91 A;  4DR7 Q;  2HQL A;  5CGK A;  3UDG A;  3OOC A;  1I50 B;  2V4D A;  3RN5 A;  3KFU A;  5FKA C;  3G4S A;  3A55 A;  1HA5 A;  1SNQ A;  4R4Q A;  4JYA L;  3S1R H;  3T1H L;  1X55 A;  1S5C D;  5T1G A;  5CV9 A;  4DV5 L;  1U9R A;  2YTX A;  4B3S Q;  1PRT C;  5COR A;  3ND9 A;  3Q24 A;  5JPN C;  4JI4 L;  4JBJ A;  2XVS A;  4HED A;  3S16 B;  1A2T A;  3BJU A;  4A3F H;  1GUS A;  1SAP A;  4KLK A;  4DV2 Q;  2R3Z A;  4NDX A;  1K73 C;  4DK0 A;  4GLX A;  4EQO A;  5M5Y B;  3S24 A;  3RLF A;  3OSO A;  5CV8 A;  2QDL A;  4HIO A;  5DM7 3;  2QF7 A;  2DY7 A;  1L2F A;  5CV7 A;  5HGT A;  3WOE A;  4B9X A;  1UE5 A;  4DGZ A;  3KF8 B;  2JEB I;  2C35 B;  2UU9 Q;  1PYS B;  2L55 A;  2A1A A;  3D0F A;  4A93 G;  4A3B H;  2VUM B;  4GKJ L;  1I3Q B;  2E2D C;  2N3S A;  5LMN L;  3RN2 A;  4JI2 L;  2ZJR A;  4A3K B;  2I07 B;  4FXG C;  5D14 A;  1SDF A;  2J4X A;  1SE4 A;  1EU4 A;  1NSN S;  1EIG A;  2LKV A;  2EJM A;  4C3I G;  1PTO C;  1SYC A;  2PYK A;  3NK9 A;  2PPB C;  3JC6 6;  2EDG A;  4MTN A;  1B2T A;  1V1Q A;  2CKZ B;  2VNU D;  1FJG Q;  1VQG A;  2RQX A;  1SJE D;  4FF1 A;  2BE5 C;  3BZD B;  5FLM G;  1SRU A;  4DK3 C;  2K5W A;  4MIU A;  4K6D A;  1K8M A;  4GKK L;  5BR8 L;  2UXD L;  2AKW B;  2OT2 A;  2I46 A;  2K32 A;  3SK5 A;  4CJ2 C;  2B63 G;  4ZRZ A;  1KNE A;  2ID0 A;  4AQY Q;  1HRJ A;  2NN6 H;  4UDU C;  2N49 A;  4LUV A;  3S17 H;  2EZV A;  3P75 A;  2NYZ D;  4CKB A;  3GV6 A;  1EY9 A;  1NR4 A;  2F0D A;  3S2H H;  1IYV A;  4LW1 A;  2AUK A;  1PHJ A;  1X3P A;  5IGF A;  2NTS A;  1QVC A;  1RJT A;  1BCP D;  4DV1 L;  2VQF L;  1U0L A;  1HXY D;  4JI3 Q;  4DAP A;  4KI0 A;  2K7V A;  2CVR A;  3HOW H;  2ZXP A;  1WJJ A;  1DOK A;  4QQB X;  2WII B;  3RLN A;  2WB1 G;  4GOP B;  2A5H A;  3K0X A;  4JVZ A;  3MAQ A;  1F2Y A;  2NZ1 D;  2KHI A;  3P7J A;  4A3K G;  4OWW B;  3T1Y L;  5EGT A;  4A3I B;  3U58 A;  2KHS A;  1QUQ A;  1LTR D;  3KLR A;  1KDB A;  4A3C H;  2BOS A;  1TR5 A;  1A3U A;  4QIW B;  2X6G A;  1ASZ A;  4HN7 A;  1AW7 A;  4OGQ C;  1GUT A;  2PCF B;  5I9P A;  1TWF B;  1TWG H;  2D9U A;  3TS2 A;  1HQR D;  1X54 A;  1D8L A;  1LT6 D;  1R4Q B;  4A3E B;  4K5V A;  4KJO A;  3NEM A;  2EQS A;  4YWL A;  4A3G B;  4IFD G;  3CPF A;  1GVP A;  1I50 H;  1Q7Y C;  2HT1 A;  2OF1 A;  4BXX H;  1XYI A;  1Q1B A;  3JAM i;  2ASB A;  3PF5 A;  5KNC A;  3PMF A;  2RBM A;  3K5O A;  3U9O A;  3D6C A;  1KAB A;  2AQ3 B;  3TQY A;  3HOV B;  1AE2 A;  2HCC A;  4A3L G;  3UI2 A;  4DK1 A;  1O80 A;  1Q8K A;  1J9O A;  3S16 H;  1JB3 A;  2F0L A;  3CC4 A;  2SNS A;  2F4I A;  3RLO A;  2A74 C;  1YHA A;  3H15 A;  3K80 C;  5ELO A;  5IGB A;  5M5Y H;  1LV9 A;  3F2D A;  1U4L A;  3KBX A;  1IBK Q;  1IKL A;  2MO1 A;  2R93 G;  4JI6 Q;  1TKW B;  1FD7 D;  4P74 A;  1VF5 C;  3NTI A;  5JAV A;  3AEV A;  3HOZ G;  4BBR B;  2VUM H;  1I3Q H;  1SE8 A;  2PZT A;  4JC0 A;  1TVX A;  3C3L A;  4DR7 L;  1G51 A;  3A8J E;  4RAU C;  1EFI D;  4CBV A;  2E74 C;  3D4R A;  1L0W A;  1L1O C;  2L0C A;  3SXH A;  2JA5 G;  3EBE A;  3VA7 A;  2KQ3 A;  4A3K H;  2LSS A;  1BCP F;  2D0P A;  4EQ5 A;  1FR3 A;  3W2D A;  4OX9 Q;  1ENC A;  3K59 A;  3Q0A A;  1WTO A;  4APV A;  4B3R Q;  1TWA B;  4B3S L;  2A8V A;  4HID A;  3H09 A;  1KAW A;  3G6J B;  4I65 A;  1Y1V G;  1LT4 D;  2CW0 D;  1AZQ A;  1YNJ D;  1QNU A;  4DV2 L;  4C56 C;  2M2L A;  1II3 A;  3GTG B;  4P73 A;  1XMQ Q;  1K3R A;  4OWT B;  2F52 A;  2Z4H A;  4BY7 B;  1IYU A;  3MXP A;  2R6G A;  1HZ9 A;  1VQE A;  3NQI A;  3CRK C;  3M4O B;  4KY7 A;  2UU9 L;  4ZYS A;  5I9O A;  1B44 D;  5AJ3 Q;  3F2C A;  2UUB Q;  5FO8 B;  4RCN A;  2K33 A;  3AMU A;  1PH6 A;  1V1P A;  2JN4 A;  1UE6 A;  2GA4 B;  3I4L A;  3TDQ A;  2QGQ A;  1CFM A;  4KD4 A;  3G71 A;  3GTQ B;  3J80 E;  1HR0 Q;  1CQF A;  5IOD A;  2RSO A;  5D3I B;  3K58 A;  1D5M C;  3MA2 B;  2NVT B;  1G91 A;  1RL2 A;  1WTW A;  1PZK D;  4HMJ A;  1O7Z A;  5DM6 3;  4A3I H;  1FJG L;  5J1Z A;  1ILP A;  1O78 A;  4QGU A;  3GV3 A;  5C5L A;  1QIL A;  4TQU S;  2FMM A;  2VB3 X;  1EUJ A;  1F9P A;  4L5Q A;  3OMC A;  1PRT B;  1IXR A;  4ZK9 B;  3KLS A;  2QW7 A;  1GUO A;  1TWF H;  2K4K A;  2R92 B;  5M3M B;  3D4D A;  4A3E H;  4OL7 A;  1S40 A;  2UXB Q;  4A3G H;  1BKB A;  2M9V A;  2B2Y A;  3DEP A;  3E3X A;  1V1O A;  3NBI A;  1STA A;  2ZJQ A;  3AFP A;  4R4O A;  4JI3 L;  1XMO Q;  1YHQ A;  3BS1 A;  2WAQ B;  3CHB D;  3HOV H;  4EX5 A;  1SNC A;  2F0G A;  1LAC A;  2LXK A;  1CHQ D;  3NTK A;  2WKC A;  4JK1 C;  2IX0 A;  1ESF A;  1H9S A;  4DXF A;  1LTT D;  2F03 A;  2MP1 A;  1HTP A;  1I5F A;  5JEA H;  1PZJ D;  4C3H G;  1LO5 D;  3SK4 A;  3J81 L;  4EGV A;  4JW0 A;  2F0K A;  5C4Z A;  1U4M A;  1DXM A;  2F3V A;  4HSP A;  4RCO A;  2B2U C;  4IN3 A;  4J1M A;  1B1Z A;  4DV0 Q;  1XNQ Q;  3MFG A;  1ZYR C;  1UAP A;  2KHJ A;  4JI7 Q;  4BBR H;  2K14 A;  2KEC A;  2E2H B;  1YEZ A;  2EOT A;  2XSC A;  4FO2 A;  1WD1 A;  3I7F A;  4FP5 D;  1XPR A;  1PH3 A;  3BVZ A;  3R2I A;  1JJ2 A;  1KDC A;  1QE6 A;  4R4C A;  2VXW A;  5EQ0 A;  2F0O A;  2PQE A;  2RKS A;  1OXU A;  2WV6 D;  1FGU A;  1G8Z D;  2LMC B;  1X6O A;  1E0B A;  1TWA H;  1DON A;  3CCE A;  1QZG A;  2O5J C;  2ZTD A;  3K5M A;  4RH6 A;  4JOI A;  4HAE A;  1A8V A;  4QIW E;  1X9N A;  2N88 A;  1SMY C;  3A74 A;  4XYO A;  4JOI C;  4WJ3 M;  1NJI C;  2R7Z B;  3GTG H;  3H6M A;  2Z0S A;  1GO3 E;  1S5D D;  2WP8 J;  4BY7 H;  1VQM A;  1FNW A;  4S3S A;  3K57 A;  2DJF C;  2HIX A;  4JI1 L;  2RVL A;  2F0N A;  2RF4 A;  1AZP A;  1VQH A;  1QUQ B;  1A63 A;  4JI6 L;  3M4O H;  3VA5 A;  3Q22 A;  4YCW A;  4R8N A;  4ZQ3 A;  3TSS A;  3IKJ A;  4DAY A;  3HOX G;  2EY5 A;  3I4M G;  2F0H A;  1TWH B;  4KY5 A;  2SOB A;  3OHX C;  4YWM A;  3BVG A;  1HTL D;  3W1G A;  5KND A;  2NZO A;  1H9R A;  3GTQ H;  3J7Y W;  1WTR A;  1N9W A;  3WWV A;  4OX9 L;  2I5M X;  4NKL A;  4UPA A;  4OWX B;  1Q3L A;  3NWS A;  4DV6 Q;  2NVT H;  2ICI A;  4B3R L;  5E7N A;  4FYD A;  4PMB A;  1SFO B;  1JR0 D;  3SEB A;  5JVG 3;  5EKI A;  3HRZ C;  4OXP A;  1WCM G;  3RUZ A;  4XDX A;  1LYL A;  4L6T B;  5C4J B;  2HUG A;  2B8G A;  5C3W A;  4GNX A;  2AHO B;  1QG7 A;  1N32 Q;  3QB3 A;  1PMR A;  4CJ0 B;  1XMQ L;  2SDF A;  1VQ9 A;  1BCP B;  5JOB A;  2R92 H;  3CD6 A;  5M3M H;  3KF6 A;  4HJ7 A;  3FRP B;  3U50 C;  3JAM E;  1SSO A;  2D0O A;  4TSS A;  4UP8 A;  1AP0 A;  1TQO A;  1Q46 A;  3MZ5 A;  4C3J B;  1E22 A;  2H5X A;  4TRD A;  4GN4 B;  1Q12 A;  5AJ3 L;  2LY7 A;  4GLV B;  1K0R A;  2UUB L;  5J39 A;  2MFI A;  1IW7 D;  1O7I A;  4XT1 B;  1TII D;  2NWG A;  1WD0 A;  4GS3 A;  1JWS D;  4JBK A;  2FJ2 A;  2MNA A;  3HOY G;  3GP7 A;  1HPC A;  2AQ1 B;  4HMI A;  4DR5 Q;  2MJ8 A;  1HR0 L;  2E2I B;  4PNY A;  5EPJ A;  2B2T C;  4IZ8 A;  4CDD C;  4LF6 Q;  4DR4 Q;  1RHP A;  2PW7 A;  3NPP A;  1JOQ A;  1UEA B;  5C5M A;  2NN6 I;  3X3N A;  4TVA B;  1K8O A;  3HZX A;  2A6H C;  4RKL A;  2ENB A;  2PO4 A;  2JYO A;  1FVI A;  2B39 A;  4ID6 A;  1KXL A;  5HGQ A;  1S5B D;  3TN2 A;  1E3P A;  1RKN A;  4ZUI A;  2I5L X;  1TY0 A;  4PQX A;  1HA6 A;  4WJW A;  1GXD C;  2A68 C;  4EQN A;  1H95 A;  1NUC A;  2DN8 A;  3CCS A;  1ICF B;  3ERQ A;  2XNA C;  2E2H H;  1L0Y B;  1X32 A;  1N36 Q;  3J80 c;  1BDO A;  2IY5 B;  3E9I A;  5G3L F;  4AIM A;  1Y1W G;  4U67 3;  3NHH A;  2N8N A;  2JEA I;  2ZTC A;  3KYH C;  2Q2H A;  1A3V A;  4RGO S;  4KK7 A;  3L9A X;  3VR5 A;  4KTA A;  1ASY A;  5T1I A;  2IX1 A;  3V05 A;  5D3D A;  4BA2 I;  1SND A;  1K9M C;  5FLX E;  4LF8 Q;  5IOC A;  3A56 A;  2VQE Q;  1V1P B;  1SBB B;  1DYQ A;  3J81 j;  4CHT B;  1U4R A;  1KDA A;  1I4H A;  2AQ2 B;  1EY4 A;  4DPG A;  4XQQ A;  3CP0 A;  3NSW A;  4YWK A;  2R7Z H;  4A93 B;  1EEF D;  2Z6K A;  3NUC A;  2CHB D;  1C48 A;  1RD9 D;  4MN3 A;  4R8I A;  4LF9 L;  2Z6K C;  1AE3 A;  2HDL A;  3KLW A;  5I2X A;  1YIT A;  1CZG A;  3CC2 A;  3WDN A;  4OHJ A;  2V1C C;  4NMZ A;  2I5H A;  2K75 A;  3ULJ A;  5HY6 A;  4DV0 L;  3BZC A;  1XNQ L;  2F0I A;  4IQZ A;  4KKT A;  2VL6 A;  1IHZ A;  3PO2 B;  2L15 A;  4C3I B;  3TBI B;  3VDY A;  1BBU A;  4L63 B;  3N6R A;  4LAA A;  2JA6 G;  1X3E A;  3RZD B;  3CCR A;  4AH6 A;  1IL8 A;  5KIX A;  1QOH A;  1NTG A;  5K5P A;  1TWH H;  3W5O A;  4YHH Q;  1Z7T A;  5ELC A;  2EY1 A;  2WAQ E;  2KUM A;  3I3C A;  4XT3 B;  1Z6H A;  3I4N G;  1JT8 A;  1SMX A;  3EA6 A;  5IYC G;  3MHB A;  5IGD A;  2IL8 A;  4DXG A;  1E24 A;  1YJN A;  3C2P A;  2B63 B;  1IBM L;  2KCM A;  1SFO H;  3EJI A;  5D65 A;  3ZJY C;  2TSS A;  4UHV A;  4JG2 A;  5C0X G;  1F9R A;  5C4J H;  4DNR B;  2UXC Q;  3OTO Q;  5IYB G;  1AN8 A;  2KBN A;  1Y8O B;  3CCV A;  2E5L Q;  5EBC A;  1W6K A;  4ZKB B;  3DHQ A;  1H9S B;  3DM1 A;  3U4Z A;  3M4Q A;  1R9T B;  1TS3 A;  1KLU D;  2WB1 B;  2CQO A;  4C3J H;  2KOL A;  4KHV A;  1K0S A;  1MSG A;  3IAY A;  1GUW A;  2Q8T A;  1NCV A;  4EVO A;  1VQ5 A;  2RHQ B;  4HIK A;  3H0G G;  3PO2 G;  4LFC L;  2Q2T A;  4DK6 C;  5E3F A;  3QR8 A;  1JE5 A;  1Q1E A;  4UP9 A;  5AFW A;  1XTD A;  3QWN A;  1PDQ A;  2IT1 A;  1CI3 M;  1JCK B;  1FNV A;  2ICE C;  4KJN A;  2E2I H;  1CQV A;  1RTN A;  1UWV A;  2XIW A;  1D1K A;  2PMZ B;  1DJR D;  4DN4 M;  1VMC A;  4DV6 L;  1SR3 A;  4DR6 Q;  2YTV A;  3OIP A;  2QEX A;  3T53 B;  1BXT A;  5JVH 3;  1B3Q A;  4DA2 A;  4LF4 Q;  3MXN A;  3OPO A;  2JE6 I;  1MIU A;  5M3F G;  3M7G A;  3PUV A;  2OWO A;  3MTS A;  4OO1 G;  4KD3 A;  2EYO A;  1EOV A;  1M4V A;  5IT9 E;  3S14 B;  5ELE A;  2NZH A;  1J6Q A;  1V8Q A;  3LX0 A;  4DUZ Q;  1N32 L;  4L8J A;  1QVF A;  1HQM C;  3A8K E;  4HTH A;  2F4V Q;  3LGJ A;  4Y7N B;  1DZ1 A;  2BA1 A;  1VQF A;  3OWE B;  5EKK A;  3GD7 A;  4PV1 C;  4JPB W;  5LL6 S;  1T5X D;  4MTK A;  5ELB A;  4POG A;  1FGB D;  2K28 A;  1JQY D;  2EYF A;  1HZC A;  3DXJ C;  3FVQ A;  4Q5V A;  3D6W A;  5ELN A;  2KA7 A;  2HQE A;  2KEN A;  3NE5 B;  3RD4 A;  1I6V C;  2ZJP A;  4DR5 L;  3W3A A;  3I90 A;  4QMG A; 
#chains in the Genus database with same CATH homology
 3HS0 C;  5FOB B;  2NVQ B;  1H9J A;  3OIQ A;  2R93 B;  3SHL A;  5C0X J;  3HOZ B;  1D1I A;  4F87 A;  3G7L A;  3LWE A;  4XQN A;  2Q8I B;  1EOT A;  3O13 A;  2JA5 B;  3M7N A;  5DAU A;  3GTK B;  1CHP D;  5CR3 A;  1G2T A;  3SVM A;  3S9W A;  1SEB D;  3LWU A;  4O42 A;  4H7B A;  2QDB A;  1AEX A;  2NBF A;  2J0T D;  3AB9 A;  1A6X A;  4LMQ D;  5E4X A;  1LAB A;  1Y1V B;  2JXM B;  1XWE A;  2F0S A;  4K2L A;  1BQQ T;  1BCP C;  2K03 A;  2G9D A;  2KCN A;  1EQT A;  2F0T A;  2B2V A;  4RHS A;  1I4X A;  3QO2 A;  1TU2 B;  2B2V C;  2K1B A;  1TT2 A;  2X69 A;  5IGG A;  5K36 G;  5NUC A;  1G29 1;  1EU3 A;  1XXG A;  2AUJ D;  1D5Z C;  3OWF A;  1ZXT A;  4O1N A;  3R8B A;  1GOZ A;  1BOS A;  4K6L A;  4X3U A;  3GTO B;  1YNN D;  2EY2 A;  4V19 0;  1L0X B;  2FFK B;  4F8M A;  2D62 A;  1SYD A;  2PNR C;  3TZD A;  1I4P A;  1ILQ A;  3LNN A;  3S1M B;  1EIH A;  5IGE A;  1HHV A;  2A73 B;  1W6J A;  4K8I A;  2EYL A;  2PZW A;  4NW2 A;  4IFD H;  4IUT A;  5CBA E;  4HCS A;  2JSO A;  1B50 A;  1QNK A;  1RTO A;  1A3T A;  4IFD J;  3GTJ B;  1ML0 D;  1SNP A;  4KKS A;  3D3R A;  1EEI D;  2K04 A;  2K5Q A;  5IIF A;  3BYY B;  2Z1C A;  3PV0 A;  2F0E A;  4C3H B;  3H3V C;  1J8I A;  2IPK D;  4RWS C;  1DOL A;  4R9W A;  4RFB A;  5K36 H;  1CA6 A;  1DM0 B;  4KY6 A;  2KVM A;  2FIN B;  4FF2 A;  1QB5 D;  5E4W C;  4Z9C B;  3HEJ A;  5ISR A;  1DD2 A;  1SXT A;  1JIC A;  4IUQ A;  1ESR A;  2EYM A;  2R61 A;  4XQJ A;  4U68 A;  2F0Q A;  2N55 A;  2H1E A;  2KJX A;  2CW0 C;  2O2L D;  3ONA B;  5EPL A;  1I4G A;  1YNJ C;  3K6O A;  1NAP A;  4KN7 C;  2BDO A;  2B2Y C;  3FMC A;  5F2D A;  5I4D A;  3S1Q B;  4DNT B;  1KLG D;  5FK9 C;  4ZLT F;  3RZO B;  3VR2 A;  3FEW X;  4XIG S;  3CU7 A;  1SYG A;  2WAC A;  3TP8 A;  3EVQ A;  4FXD A;  4GZY C;  5EKL A;  3MWY W;  1CA5 A;  1SE2 A;  3HOX B;  3I4M B;  3ND8 A;  5FO7 B;  3VYS A;  3ERO A;  2QIL A;  1GHJ A;  1MI2 A;  4ILW A;  2RDF A;  3SK8 A;  1GUN A;  2QEJ C;  2F0W A;  2BA0 A;  2A6E D;  3TP5 A;  1F9S A;  3U9S A;  4H0L C;  1WTQ A;  1WCM B;  3MXU A;  1WTX A;  3BG3 A;  1EZ8 A;  2E75 C;  2G9H D;  2D2C C;  1D2B A;  1MSH A;  3T4A C;  3GTM B;  2JA7 B;  2EJG C;  1B9M A;  1IKM A;  4WRD A;  1PLF A;  3X3M A;  1JC7 A;  4IUN A;  4M8A A;  5G3L D;  4KKU A;  3ZYY X;  3HOY B;  3T16 A;  2NUC A;  1CZW A;  1TY2 A;  1ICW A;  3QIA A;  1TWC B;  1I6H B;  1HUN A;  2SNM A;  1M8A A;  1PFN A;  5TSS A;  4G7Z C;  4K5X A;  2AWO A;  5M9O A;  2K05 A;  5DEH A;  1BUV T;  2F0M A;  3SDZ A;  1EY5 A;  1KNA A;  2FHT A;  3R2T A;  2MGS A;  2X6L A;  1C8C A;  2K01 A;  2EXZ A;  2EYJ A;  1Y1W B;  1LTG D;  2TMP A;  1HFN A;  4WOR A;  5KYL A;  1G2S A;  4HR7 B;  1ZKO A;  1CM9 A;  3MEH A;  4HSV A;  1JWU D;  2MUY A;  4KHZ A;  1K83 B;  1SYB A;  1A2U A;  2J7Z A;  3E5S A;  4BS9 A;  2K5D A;  3I72 A;  4C1N K;  4DU9 A;  4C1N I;  4YIJ A;  4JBW A;  4RGM A;  1HUM A;  3HP3 A;  1VDZ A;  1F77 A;  3BDL A;  2JA6 B;  2A69 D;  1EL0 A;  4K5W A;  3KK7 A;  3V96 A;  3CQZ B;  1PYW D;  2YYZ A;  1EYA A;  3VYT A;  3I4N B;  2EVB A;  2F0J A;  3PUY A;  4H44 C;  4ZUJ A;  2PW5 A;  4HCE A;  1V43 A;  3L3O C;  5A2Q E;  1LLR D;  2KED A;  5JJZ A;  1LT3 D;  1E2W A;  1GHK A;  1PRT D;  1I4R A;  2MHV A;  1F2M A;  1XTC D;  1D5X C;  1IW7 C;  1UNS A;  3NBH A;  1SJH D;  2O5I C;  2B2W A;  3Q23 A;  1FYC A;  3H91 A;  3J81 E;  2NVY B;  5M5X B;  1MD2 D;  3H0G B;  1EY8 A;  5CYU A;  2L11 A;  4BY1 B;  2Z4I A;  5M5W B;  3KUP A;  5C6A A;  1QCB D;  4RKB A;  1S5E D;  5IGC A;  2EPB A;  1PTO D;  3S15 B;  2F1M A;  4QUF A;  1SNO A;  5M3F B;  1STH A;  4IUV A;  3GTP B;  2RDG A;  2BE5 D;  2LFN A;  2NN6 G;  1EY6 A;  1LTA D;  3FPP A;  1TS5 A;  1EY0 A;  2FMC A;  5C4X B;  1PFB A;  1E2V A;  2BDN A;  2RA4 A;  4BA1 I;  2XRQ D;  4N9T A;  3GQB A;  3S1N B;  3DWP A;  2IX3 A;  3URY A;  4KN4 C;  5ELF A;  4K8J A;  1SYF A;  1S4Z A;  3K7A B;  5J22 A;  1CT1 D;  3T13 A;  4MHE A;  2RSN A;  1ZEQ X;  2L9H A;  4K2K A;  1OXV A;  3NP8 A;  1B4O A;  2CQA A;  1ONL A;  2KEE A;  4IFD I;  4I7Z C;  4P2C B;  3OW7 A;  1EZ6 A;  1KTK A;  3J80 L;  1HCZ A;  1PRT F;  3BDO A;  3DWA A;  4FNF A;  4CGY B;  3KBG A;  3TME A;  4ULL A;  1STE A;  4BBS B;  5A35 A;  4F7X A;  3M4Y A;  1JWM D;  1RF2 D;  3L7Z C;  1LTI D;  2BCO A;  1OXS C;  3F2U A;  4LK1 C;  1PZI D;  4UAI A;  4M1U B;  1F2Z A;  3SR1 A;  4X3T A;  5CC4 A;  4KV6 A;  4IAL A;  4H13 C;  5C0X H;  4EQP A;  4FXK C;  1PTO F;  3KLS X;  4WFN 3;  2EYH A;  2WKD A;  4CKE A;  4QF4 A;  1SE3 A;  1I4Q A;  4DFA A;  3DEO A;  2RDH A;  5LHY 1;  4B08 A;  3NXW A;  1EYC A;  1O7L A;  3VYR A;  2OXP A;  4G7H C;  2YU9 B;  3DMU A;  2OEO A;  4FF4 A;  2JA8 B;  4J8Q A;  2AWN A;  4OO1 H;  2F3W A;  2EE1 A;  5DNF A;  1VF7 A;  1TS2 A;  2DY8 A;  3E0J A;  3NQT A;  5I2Y A;  3DUZ A;  1E2Z A;  4Q0F A;  3TP7 A;  3DWQ A;  2EYP A;  3I73 A;  4AYB B;  3QOJ A;  2C9O A;  1D6E C;  2C5C A;  1R4P B;  5EBD A;  2XWB B;  3T51 B;  1X3Q A;  3K0Y A;  2NVX B;  3CKI B;  1BR9 A;  1B53 A;  1QWY A;  4G57 A;  1TS4 A;  2QKI C;  1STY A;  2PZU A;  3MC0 B;  3I70 A;  2WIN B;  2ZXR A;  3A7A B;  2NTT A;  3EQL C;  1PXU A;  1QJO A;  4IUU A;  1BNZ A;  2QCP X;  3SE0 A;  2EY6 A;  3PUW A;  2K6A A;  5I6W A;  5BN4 A;  5C3E B;  3IL8 A;  5C44 B;  1BO0 A;  4J6H A;  3HOU B;  1F9Q A;  1SNM A;  2E2J B;  5KRU A;  3MXG A;  1H9M A;  1KAA A;  2XN9 C;  4LJZ C;  3V2T A;  5EPK A;  3I8Z A;  3QG1 A;  4CKC A;  4PMW A;  4PMC A;  3P20 A;  4OIK A;  3A7L A;  3JAM L;  5C4H A;  4C2M B;  1LT5 D;  3GTL B;  5JEA G;  5CV6 A;  3HKZ B;  3FKI B;  3E6Z X;  1YNN C;  1EWC A;  2NB0 A;  2Y0S B;  1JOK A;  1STB A;  4TKO B;  4IUP A;  1F2L A;  2EJF C;  3PUZ A;  5LL6 X;  3PO3 B;  3C1F A;  3TZU A;  2JP1 A;  2F0F A;  4A3J B;  1ZYR D;  4XYQ A;  3RMH A;  2ZT9 C;  3TP6 A;  3R3O A;  3PUX A;  1JOO A;  3VR3 A;  5EJW A;  2F0V A;  5HUR A;  3M85 A;  2F0U A;  3Q6S A;  4XXE A;  1SYE A;  1Q90 A;  2L12 A;  5A2Q L;  5CV4 A;  2L4N A;  3D8G A;  2DNE A;  2HDM A;  3M3Y B;  3IFT A;  2IW3 A;  1EWH A;  1SMY D;  4K14 A;  3K5N A;  5FLX L;  1RCV D;  4XTC S;  1EYD A;  4DAV A;  2F0P A;  1U4P A;  3KF8 A;  2O4X A;  1Z47 A;  5BN5 A;  1PTO B;  1BBX C;  1OO9 B;  1Y8P B;  4X3S A;  4OIJ A;  3FDT A;  2B2U A;  2MPM A;  3P1H A;  4F88 A;  3HGB A;  5CV5 A;  1T5E A;  5JEA J;  5KNB A;  4CJ1 B;  2Z8L A;  3VYU A;  1UUP A;  1DCZ A;  5ELD A;  1VCI A;  4BWG B;  1FNU A;  4X3K A;  4FF3 A;  1STG A;  2ZXO A;  5JPM C;  3BDC A;  3VR6 A;  1Q8I A;  5C3X A;  1CTM A;  3MVV A;  3PIP 3;  1ENF A;  2DNC A;  1ROD A;  1NR2 A;  1CK1 A;  3AU7 A;  1ET9 A;  1S5F D;  2XWJ B;  3S2D B;  4E6I A;  1LTS D;  2H4O A;  4A3D B;  1C4Q A;  3MFY A;  3NWT A;  4A3M B;  2B8F A;  4FVM A;  3NTH A;  1JE4 A;  5KGU A;  4G4K A;  1MGS A;  4QCL A;  3BYT B;  1XX8 A;  2IWH A;  1DOM A;  4DF7 A;  1PFM A;  4RHR A;  3S1R B;  3H94 A;  4NP5 A;  2A6H D;  2A6E C;  1WTP A;  1B3A A;  4RGT A;  5KYI A;  1STN A;  4ABN A;  5CMD A;  2A68 D;  4B9W A;  3A8I E;  5IT9 L;  4A3F B;  5COY A;  3OMG A;  3D31 A;  4RA8 A;  3N52 A;  1Y8N B;  2KCC A;  4IUR A;  4A3B B;  3EFX D;  1RDP D;  1JOR A;  1G6Z A;  3HG9 A;  4KMU C;  5FO9 B;  3FPU B;  1O7Y A;  1A15 A;  2L1B A;  4ZKC B;  3VR4 A;  1H9K A;  2M00 A;  3K5L A;  3D4W A;  4ZAI A;  3J7A F;  2B2T A;  2D5D A;  4G7O C;  2E76 C;  2IJ0 A;  4ODG A;  1PTO H;  1AFP A;  2VB2 X;  3WOF A;  3A54 A;  5BN3 A;  3J7A V;  5I6Y A;  3IFD A;  4ME5 A;  5C0X I;  3CRL C;  1Y69 U;  3PIO 3;  3S17 B;  3SK6 A;  3C46 A;  3R93 A;  1ENA A;  1B9N A;  4QB4 A;  3S2H B;  1VMP A;  2LS0 1;  3ITP A;  1EQV A;  1WTV A;  4V0B A;  1HFG A;  5KEE A;  1WVL A;  3QOL A;  2XRS D;  3C1E A;  3HOW B;  5E1F A;  1GUG A;  3GO5 A;  4C3J G;  1LTB D;  2B2W C;  4QUC A;  3QJY A;  4RGN A;  1MBY A;  1OXX K;  4N9P A;  2SEB D;  1GJX A;  3T56 B;  3BVM A;  2L5T A;  5CBE E;  4OO1 I;  2Q8R E;  1OXT A;  1EY7 A;  1TWG B;  1BF4 A;  2A69 C;  1ET6 A;  2HCI A;  3I91 A;  5CGK A;  3OOC A;  1I50 B;  2V4D A;  5FKA C;  3A55 A;  1HA5 A;  1SNQ A;  1S5C D;  5T1G A;  5CV9 A;  1U9R A;  1PRT C;  5COR A;  3ND9 A;  3Q24 A;  5JPN C;  2XVS A;  4HED A;  3S16 B;  1A2T A;  1GUS A;  1SAP A;  2R3Z A;  4NDX A;  4DK0 A;  4EQO A;  5M5Y B;  3RLF A;  3OSO A;  5CV8 A;  5DM7 3;  2QF7 A;  2DY7 A;  5HGT A;  5CV7 A;  3WOE A;  4B9X A;  4DGZ A;  2JEB I;  2L55 A;  2VUM B;  1I3Q B;  2E2D C;  4A3K B;  2I07 B;  4FXG C;  5D14 A;  1SDF A;  2J4X A;  1SE4 A;  1EU4 A;  1NSN S;  1EIG A;  2LKV A;  4C3I G;  2EJM A;  1PTO C;  1SYC A;  2PYK A;  3NK9 A;  2PPB C;  2EDG A;  1B2T A;  2VNU D;  2RQX A;  1SJE D;  4FF1 A;  2BE5 C;  3BZD B;  2K5W A;  4MIU A;  4K6D A;  1K8M A;  2OT2 A;  2I46 A;  2K32 A;  3SK5 A;  4CJ2 C;  4ZRZ A;  1KNE A;  2ID0 A;  1HRJ A;  2NN6 H;  4UDU C;  2EZV A;  3P75 A;  2NYZ D;  4CKB A;  3GV6 A;  1EY9 A;  1NR4 A;  2F0D A;  1IYV A;  2AUK A;  1X3P A;  5IGF A;  2NTS A;  1RJT A;  1BCP D;  1HXY D;  4DAP A;  4KI0 A;  2K7V A;  2CVR A;  2ZXP A;  1DOK A;  2WII B;  2A5H A;  3MAQ A;  1F2Y A;  2NZ1 D;  3P7J A;  5EGT A;  4A3I B;  2KHS A;  1LTR D;  3KLR A;  1KDB A;  2BOS A;  1TR5 A;  1A3U A;  4QIW B;  2X6G A;  4HN7 A;  1AW7 A;  4OGQ C;  1GUT A;  2PCF B;  5I9P A;  1TWF B;  2D9U A;  1HQR D;  1LT6 D;  1R4Q B;  4A3E B;  4K5V A;  4KJO A;  4A3G B;  4IFD G;  2OF1 A;  1XYI A;  1Q1B A;  5KNC A;  3PMF A;  2RBM A;  3K5O A;  3U9O A;  3D6C A;  1KAB A;  2AQ3 B;  3HOV B;  2HCC A;  3UI2 A;  4DK1 A;  1O80 A;  1J9O A;  1JB3 A;  2F0L A;  2SNS A;  2F4I A;  2A74 C;  5IGB A;  1LV9 A;  1U4L A;  3KBX A;  1IKL A;  1TKW B;  1FD7 D;  1VF5 C;  3NTI A;  5JAV A;  4BBR B;  2PZT A;  1TVX A;  3C3L A;  3A8J E;  4RAU C;  4CBV A;  1EFI D;  2E74 C;  3D4R A;  2L0C A;  3SXH A;  3VA7 A;  2KQ3 A;  1BCP F;  1FR3 A;  3W2D A;  1ENC A;  3K59 A;  3Q0A A;  1WTO A;  1TWA B;  3H09 A;  3G6J B;  4I65 A;  1LT4 D;  2CW0 D;  1AZQ A;  1YNJ D;  1QNU A;  4C56 C;  2M2L A;  1II3 A;  3GTG B;  2Z4H A;  4BY7 B;  1IYU A;  3MXP A;  2R6G A;  3NQI A;  3CRK C;  3M4O B;  4KY7 A;  4ZYS A;  5I9O A;  1B44 D;  5FO8 B;  4RCN A;  2K33 A;  3AMU A;  1V1P A;  2GA4 B;  3I4L A;  3TDQ A;  1CFM A;  4KD4 A;  3GTQ B;  3J80 E;  1CQF A;  5IOD A;  2RSO A;  5D3I B;  3K58 A;  1D5M C;  3MA2 B;  2NVT B;  1G91 A;  1WTW A;  1PZK D;  4HMJ A;  1O7Z A;  5DM6 3;  5J1Z A;  1ILP A;  1O78 A;  3GV3 A;  5C5L A;  1QIL A;  4TQU S;  2FMM A;  2VB3 X;  1F9P A;  3OMC A;  1PRT B;  4ZK9 B;  3KLS A;  1GUO A;  2R92 B;  5M3M B;  3D4D A;  4OL7 A;  2M9V A;  2B2Y A;  3DEP A;  1V1O A;  3NBI A;  1STA A;  3BS1 A;  2WAQ B;  3CHB D;  1SNC A;  2F0G A;  1LAC A;  1CHQ D;  3NTK A;  2WKC A;  4JK1 C;  2IX0 A;  1ESF A;  1H9S A;  4DXF A;  1LTT D;  2F03 A;  2MP1 A;  1HTP A;  5JEA H;  1PZJ D;  4C3H G;  1LO5 D;  3SK4 A;  3J81 L;  4EGV A;  2F0K A;  5C4Z A;  1U4M A;  1DXM A;  2F3V A;  4HSP A;  4RCO A;  2B2U C;  4IN3 A;  4J1M A;  1B1Z A;  3MFG A;  1ZYR C;  1UAP A;  2KEC A;  2E2H B;  2EOT A;  2XSC A;  4FO2 A;  1WD1 A;  4FP5 D;  3BVZ A;  3R2I A;  1KDC A;  1QE6 A;  2VXW A;  5EQ0 A;  2F0O A;  2PQE A;  2RKS A;  1OXU A;  2WV6 D;  1G8Z D;  2LMC B;  1E0B A;  1DON A;  2O5J C;  3K5M A;  4RH6 A;  4HAE A;  2N88 A;  1SMY C;  4XYO A;  2R7Z B;  3H6M A;  1S5D D;  2WP8 J;  1FNW A;  4S3S A;  3K57 A;  2RVL A;  2F0N A;  1AZP A;  3VA5 A;  3Q22 A;  4R8N A;  4ZQ3 A;  3TSS A;  3IKJ A;  4DAY A;  2EY5 A;  2F0H A;  1TWH B;  4KY5 A;  2SOB A;  3OHX C;  3BVG A;  1HTL D;  5KND A;  1H9R A;  3J7Y W;  1WTR A;  4NKL A;  1Q3L A;  3NWS A;  2ICI A;  4FYD A;  4PMB A;  1SFO B;  1JR0 D;  3SEB A;  5JVG 3;  5EKI A;  3HRZ C;  3RUZ A;  4XDX A;  4L6T B;  5C4J B;  2HUG A;  2B8G A;  5C3W A;  1QG7 A;  3QB3 A;  1PMR A;  4CJ0 B;  2SDF A;  1BCP B;  5JOB A;  3FRP B;  3JAM E;  1SSO A;  4TSS A;  1AP0 A;  1TQO A;  3MZ5 A;  4C3J B;  4TRD A;  1Q12 A;  2LY7 A;  5J39 A;  1IW7 D;  4XT1 B;  1TII D;  2NWG A;  1WD0 A;  1JWS D;  2FJ2 A;  3GP7 A;  1HPC A;  2AQ1 B;  4HMI A;  2MJ8 A;  2E2I B;  4PNY A;  5EPJ A;  2B2T C;  4IZ8 A;  1RHP A;  2PW7 A;  3NPP A;  1JOQ A;  1UEA B;  5C5M A;  2NN6 I;  3X3N A;  1K8O A;  3HZX A;  2A6H C;  4RKL A;  2ENB A;  2PO4 A;  2B39 A;  2JYO A;  4ID6 A;  1S5B D;  3TN2 A;  1RKN A;  4ZUI A;  1TY0 A;  4PQX A;  1HA6 A;  4WJW A;  1GXD C;  2A68 C;  4EQN A;  1NUC A;  2DN8 A;  3ERQ A;  2XNA C;  1L0Y B;  1X32 A;  1BDO A;  5G3L F;  4U67 3;  3NHH A;  2JEA I;  1A3V A;  4RGO S;  4KK7 A;  3L9A X;  3VR5 A;  4KTA A;  5T1I A;  2IX1 A;  3V05 A;  5D3D A;  4BA2 I;  1SND A;  5FLX E;  5IOC A;  3A56 A;  1V1P B;  1SBB B;  1DYQ A;  4CHT B;  1U4R A;  1KDA A;  1I4H A;  2AQ2 B;  1EY4 A;  4XQQ A;  3NSW A;  4A93 B;  1EEF D;  3NUC A;  2CHB D;  1C48 A;  1RD9 D;  4MN3 A;  4R8I A;  2HDL A;  5I2X A;  1CZG A;  3WDN A;  4OHJ A;  4NMZ A;  2F0I A;  4IQZ A;  4KKT A;  3PO2 B;  1IHZ A;  4C3I B;  3TBI B;  4L63 B;  3N6R A;  4LAA A;  3RZD B;  1IL8 A;  5KIX A;  1QOH A;  5K5P A;  1Z7T A;  5ELC A;  2EY1 A;  3I3C A;  2KUM A;  4XT3 B;  1Z6H A;  3EA6 A;  3MHB A;  5IGD A;  2IL8 A;  4DXG A;  3C2P A;  2B63 B;  3EJI A;  5D65 A;  2TSS A;  5C0X G;  1F9R A;  4DNR B;  1AN8 A;  1Y8O B;  5EBC A;  1W6K A;  4ZKB B;  3DHQ A;  1H9S B;  3DM1 A;  1R9T B;  1TS3 A;  1KLU D;  2WB1 B;  2KOL A;  4KHV A;  1MSG A;  3IAY A;  1GUW A;  2Q8T A;  1NCV A;  4EVO A;  5E3F A;  1Q1E A;  5AFW A;  3QWN A;  1PDQ A;  2IT1 A;  1CI3 M;  1JCK B;  1FNV A;  2ICE C;  4KJN A;  1CQV A;  1RTN A;  2XIW A;  1D1K A;  2PMZ B;  1DJR D;  4DN4 M;  1VMC A;  3OIP A;  3T53 B;  1BXT A;  5JVH 3;  4DA2 A;  3MXN A;  3OPO A;  2JE6 I;  4OO1 G;  3M7G A;  3PUV A;  3MTS A;  4KD3 A;  2EYO A;  1M4V A;  5IT9 E;  3S14 B;  5ELE A;  3LX0 A;  1V8Q A;  4L8J A;  1HQM C;  3A8K E;  4HTH A;  4Y7N B;  1DZ1 A;  2BA1 A;  3OWE B;  5EKK A;  3GD7 A;  4PV1 C;  5LL6 S;  1T5X D;  5ELB A;  1FGB D;  2K28 A;  1JQY D;  2EYF A;  3DXJ C;  3FVQ A;  4Q5V A;  3D6W A;  2KA7 A;  2HQE A;  3NE5 B;  3RD4 A;  1I6V C;  3W3A A;  3I90 A;  4QMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...