5C4HA

Crystal structure of staphylococcal nuclease variant delta+phs i92h at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYHYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4hA00
2EY1A 2F0UA 3TP6A 2F0VA 5C6AA 3HZXA 5IGBA 3U9OA 1STNA 5IGDA 2OEOA 4IZ8A 5C4HA 2PQEA 4IUNA 4I65A 5EKLA 4KY5A 4LAAA 2F0QA 4NKLA 2F0SA 3C1EA 1EYCA 3MEHA 4QB4A 4IALA 1SYFA 1EY8A 1STAA 1SYCA 4ZUIA 4DGZA 4KHVA 1ENAA 2F0PA 4G57A 5IGCA 2F0HA 5JAVA 5IGGA 2RKSA 4K8JA 3ITPA 3D4DA 4B9WA 5I6YA 2SNMA 4K2LA 5KRUA 5C5LA 4HMIA 4WRDA 1EY5A 3T13A 3SK8A 5KYIA 3C1FA 4F8MA 1TQOA 3MHBA 2PZWA 4WORA 5M9OA 4HTHA 1AEXA 5C4ZA 1EZ6A 3MZ5A 4PMBA 4ZUJA 3SK4A 5HURA 2PW7A 3V2TA 2F0OA 1SYBA 3H6MA 2EY5A 3NUCA 3VA5A 1STYA 4K6DA 1SNPA 3TP5A 4EQPA 5I6WA 5IGFA 3SK5A 3OWFA 5IODA 2SNSA 3DMUA 3EROA 2EYPA 4H7BA 5NUCA 5CV9A 5IIFA 3R3OA 4YIJA 1KDCA 2EY2A 1KDAA 3EVQA 4DF7A 4K2KA 2EYHA 3T16A 1F2YA 2F0MA 1STGA 3EJIA 2KHSA 3HEJA 5DAUA 5HGTA 5KEEA 2M00A 1ENCA 2F3WA 3SK6A 2F0TA 5F2DA 5CGKA 4DFAA 1SNCA 4R8NA 4TRDA 1STHA 5DEHA 4HMJA 1KAAA 3QOJA 5C5MA 1EY4A 4MIUA 4E6IA 4QF4A 5CV7A 1SNDA 3NXWA 5K5PA 5KYLA 3E5SA 2F0EA 2SOBA 1F2MA 2F0GA 1SYGA 1F2ZA 3NHHA 3OMGA 4PNYA 4N9PA 4EQNA 2F0NA 4N9TA 4KY7A 4F7XA 5IOCA 3MXPA 4KJOA 4RKLA 5J39A 5EKKA 3P75A 4DU9A 1II3A 2NUCA 3QB3A 2EXZA 3SR1A 3BDCA 5CV5A 3NP8A 2PW5A 4NMZA 3DHQA 2O4XA 1EY0A 5CV6A 3SHLA 1EZ8A 2ENBA 2RDFA 3D4WA 4OL7A 4K5WA 2F0JA 1IHZA 1SNMA 5JOBA 1TT2A 2EY6A 2F0WA 5EGTA 5I9PA 2KQ3A 1JORA 3BDLA 1EY7A 1EYAA 1A2TA 3SXHA 5C3XA 5J1ZA 1A3UA 2EYOA 1U9RA 3TMEA 2OF1A 2PZTA 4B9XA 2F0KA 2LKVA 1SNQA 4KY6A 2F0FA 1SYEA 3MVVA 4K14A 5I9OA 4K5XA 1JOOA 5E1FA 3S9WA 4K5VA 2F0LA 1A3VA 2HQEA 4KD3A 1EYDA 1EY9A 3OSOA 4ID6A 5E3FA 4RKBA 2F0DA 3NQTA 4NDXA 4EVOA 4KV6A 5CV4A 4EQOA 4QMGA 5IGEA 3P1HA 1KDBA 5CR3A 5CV8A 5ISRA 5KGUA 3LX0A 5KIXA 3D8GA 1NUCA 1KABA 4KJNA 1JOKA 2PYKA 3TP8A 1RKNA 2F3VA 3RUZA 2WACA 4ZQ3A 1NSNS 2EYFA 2F0IA 3ERQA 4J1MA 1STBA 4ODGA 4K8IA 2OXPA 1A2UA 3NK9A 4KD4A 1JOQA 2RBMA 4S3SA 2QDBA 2EYMA 4NP5A 2EYJA 1EQVA 5C3WA 3OMCA 3TP7A 1SNOA 2PZUA 1TR5A 3D6CA 3QOLA 4KTAA 4ME5A 4PMCA 5J22A 1SYDA 4J6HA 1A3TA 5CC4A 2EYLA 1EY6A 3PMFA
chains in the Genus database with same CATH superfamily
3M7GA 2RHQB 1PRTB 1JC7A 4EX5A 4WFN3 1IBKQ 2QW7A 4IQZA 3E3XA 4I65A 3QR8A 5IWAL 1PH1A 2L12A 3S2DB 2X6GA 5JJKA 4F88A 2K03A 2R7ZH 3UDGA 3B6YA 5IGCA 3F2CA 2L15A 4K8JA 4OEMB 3TBIB 4B3RQ 3GTGB 2SNMA 4K2LA 2K7VA 3DWQA 3EIVA 2EPBA 2HCCA 1A63A 2JK8A 3CC4A 5C4ZA 2O2LD 4GNXB 5HURA 1WTRA 4KI0A 1EIHA 2IT1A 2EY5A 2G9DA 2KHIA 4Z9CB 3SK5A 5L37A 2B29A 3G6EA 4A3DG 1KDCA 3GTPH 1FGBD 3MC0B 5KEEA 4R4CA 4A93B 4DR7L 1CFMA 2UUAQ 2B2UA 2M2LA 4NXNL 1R4QB 1HR0L 3M4OH 4A3KG 1HXYD 4DK3C 2N3SA 4POFA 2K5QA 2F0NA 2JQOA 3MWYW 2WAQE 3PO3H 4RKLA 3P75A 3QB3A 3NELA 1PH2A 2E2JH 1E2WA 1RTNA 2EJMA 5DM63 3S14H 3WOFA 1V9PA 1C4QA 4A3IG 1CT1D 5M5WB 5C3EH 4DV0Q 1E1TA 2FJ2A 2WFWA 3W2DA 3TMEA 4B3TL 1JQYD 2PCFB 5M5YB 2LKVA 1TU2B 1YNXA 3BG3A 2DY8A 4JBWA 4YCWA 4JI6Q 1E2ZA 2UU9L 2A1AA 1BCPB 2NZHA 1MGSA 2NWGA 2JSOA 4LMQD 1VQBA 4JI0Q 3BDOA 2PPBC 3OTOL 3LX0A 4N8X1 1BVSA 5M3FG 1GM5A 4LF6Q 3HP3A 1CKNA 1R9TB 1B9NA 2R93G 4NPSA 2R7FA 2RBMA 2N88A 4NP5A 1IKMA 1MSGA 3DWPA 2NZ1D 2PZUA 5FOBB 2JA6G 1KL9A 3H15A 4JI4Q 5CR3A 5M3FB 2NVYB 3S2HB 4IUPA 2A6HC 1HNWQ 2L9HA 5IYDG 5COYA 1TS2A 3GTMH 1H9SA 1PYWD 4IALA 3VDYA 4JK1C 1E1OA 4R4TA 4GOPC 4BY7G 4DR6Q 4JYAQ 5HY6A 1GJXA 3GP7A 5IP7H 5IT9E 4JI4L 1EEID 2B2WA 1OXVA 2ZTDA 3F8TA 3MXNB 1IXRA 4OIJA 4DUYQ 4LF4Q 3BVGA 1B70B 1RF2D 1PTOH 1Q12A 1U4MA 3G6JB 1PHJA 4K6DA 1RIPA 2E5LQ 3HOYG 2JN4A 3DMUA 1GUNA 2D0OA 2AUKA 4KKTA 4L5RC 5C4XB 4ZKCB 1V43A 2JA6H 1YITA 1NTGA 3VR2A 1X9NA 1LT3D 1D1IA 4H0LC 4JC0A 2A68D 2XGTA 2F0EA 4K6LA 1HZ9A 1GXDC 2Q2TA 4A3CG 4A3EG 3MXNA 3SVMA 4KY7A 2QKIC 2D9UA 2NZOA 3L9AX 4UP7A 3VR6A 3BDCA 5JVG3 5LL6X 1L0WA 3U4ZA 1SE3A 1LV9A 5FKAC 4C1NI 1I5FA 2LY7A 3EN2A 4G7HC 3K0XA 4QJFA 3BYTB 3J81c 1M90C 3KDFB 1GD7A 2Z9HA 3CQZB 2E2IH 1GUWA 3J81j 2IWHA 3S17H 4ID6A 1Y1VH 1D8LA 2K32A 1AE2A 3NQTA 3TS0A 1I4XA 4JI1Q 1LABA 4ZKBB 1KNAA 1G51A 3NEMA 1TY2A 2PYKA 3CRKC 2QEXA 1GKHA 2A74C 2A68C 3DM1A 4I7ZC 1IW7D 5K36H 2DY7A 4DKAC 3NK9A 4KD4A 3CC2A 4DV3Q 2QDBA 1UE5A 3K5MA 4KTAA 4ALPA 1UUPA 2IHFA 4HIOA 4PV1C 2CH4A 1SE4A 3KDFA 4LF8Q 1M8AA 1BDOA 3A55A 2OCEA 3BJUA 3E6ZX 2CCZA 3I91A 2F4IA 2F0VA 3I4LA 1L0XB 2I5MX 1STNA 5IGDA 2DJFC 4X66L 4XDXA 3PF4A 1HNWL 5BN3A 2UXDL 4GOPB 2F0SA 1TWCH 3H0GG 1STAA 1SYCA 3RZDH 1NMFA 2TSSA 2QF7A 4JPBW 1TWCB 1B9MA 1GVPA 3A54A 4DR6L 4LFBL 3RD4A 2UXCQ 1IKLA 1E0BA 2JEBI 2R7DA 3AEVA 4FDBA 1STEA 2YU9B 4WORA 4UP8A 2L55A 5M3FH 3FKIB 4HJ9A 1RD9D 3MXGA 4LWCA 1SYBA 3VA5A 1G6PA 2MHVA 3TSSA 2HT1A 1SJHD 1LTRD 5NUCA 4XT1B 2A69C 3R3OA 4DV2Q 1ET9A 1VQCA 5E7NA 5C0XG 2A73B 1BCPD 2PQAB 3W5OA 1TWAB 3K58A 5CGKA 4TQUS 2AQ1B 3BZKA 3K5OA 3T53B 1ESFA 3PO3G 2X6LA 2UXCL 2B2TA 1OXXK 2K28A 5IT9c 2OT2A 2UUAL 1Z47A 3K81C 3GO5A 4JI3Q 4EQNA 1KNEA 2RQXA 1YIJA 3F2DA 5IOCA 1KIXA 2J7ZA 2D5DA 2VS1A 1FL0A 4TSSA 1GUTA 3S15B 4DR1L 5CV5A 3NP8A 5AJ3L 4CJ1B 2FMMA 3M3YB 3U4VA 5EGTA 4NXML 2NVXH 4FYDA 3CU7A 5J1ZA 1Y8OB 3S1NH 4YY3L 2VNUD 5GAHC 4ZRZA 5CMDA 1NMGA 1JOOA 5EPLA 3EFXD 2IW3A 3LGJA 2CQAA 2VB3X 4DXGA 3J81L 5LL6S 1Q1BA 1SBBB 3CMAA 1IL2A 3TP8A 1LTID 2JA6B 3JC66 2SDFA 1BKBA 4ZLTF 1IBLL 1SSOA 4A75A 1DONA 1NCVA 1PYSB 3GV6A 4BA2I 4B3RL 1V8QA 1RODA 4HJ8A 1K83B 5J39A 2HIXA 1D5XC 1K0RA 2WKDA 4FF3A 1YJNA 5BN5A 4IZ8A 3PUWA 4GN4B 3CRLC 2K5WA 4H13C 1YVCA 4JI5L 1SYFA 3PQIA 1EWIA 1D2BA 2M9VA 1U4PA 4ZYSA 5EBDA 3A8KE 1S4ZA 3UI2A 1WYDA 3D4DA 4L5QA 2JEAI 3VYSA 1PZKD 4MNOA 4KN7C 5FLXE 4DR7Q 2L1BA 4KHPL 4H44C 2D62A 1SLJA 2JA7H 4LUZA 3J80L 2KECA 4AQYL 2PW7A 3D4RA 1PFMA 1B7YB 1XPUA 2D0PA 3CQZH 4OXPA 4R1JA 2E2IB 3A56A 5GROA 3PUYA 5G3LD 2J4XA 3STBD 1Y8PB 3SK6A 1LTLA 1F9PA 2XNAC 1AW7A 3J81E 1LT5D 2WP8J 2RVLA 1WFQA 4TRDA 1LYLA 1XMOL 5KNDA 1SNDA 3CC7A 1F2MA 4MTKA 1SYGA 1AZQA 4KHPQ 3CXCA 3RN5A 5M5XB 4XYQA 1CUKA 1SROA 3S1RH 3FKIG 4KJOA 5EKKA 1PDQA 4C56C 2VUMG 4BY1G 3D4WA 4OL7A 1JCKB 2XSCA 4O0AA 2X69A 5LMUQ 3GD7A 1EYAA 5JPMC 1Q82C 1SMYC 1YNJD 3UE0A 1XWEA 1D7QA 2KVMA 3L0OA 3T56B 3V05A 4RMFA 1OXTA 4JV5L 4A93G 1KQSA 1QVFA 2JA5B 5E1FA 4GKKL 2B2YC 4X65L 4IFDI 1T9HA 2E2HH 3J7AV 1MJEA 1HZBA 4YWMA 1KDBA 2E2HB 1O80A 3OHXC 2MUYA 1NNXA 3AMUA 5C6AA 4L63B 4X62L 4A3LG 2K50A 2XIWA 1KXLA 1J6QA 1JB3A 4BBRH 1SXTA 3J7AF 2ICIA 1SNOA 5ELBA 4A3IB 4B3TQ 2YV5A 2VZAA 3E9IA 4UAIA 2R93H 2O5JC 1LT4D 2E75C 4OONA 1AP0A 1YHBA 4DAMA 3GTKH 1U4LA 5EKLA 1VQJA 1HQRD 4OELB 2B2UC 4QB4A 4A3FH 1XYIA 2BE5D 4X66Q 5FLMH 5IYCG 4G57A 4B9WA 2E74C 5C3EG 5A2QE 1A62A 1Y1VG 2B8GA 1QNUA 2JP1A 1S5BD 4QUCA 3GTLB 4X3KA 1UNSA 4LJZC 5M9OA 3NTHA 4DR3Q 1RCVD 4OWTB 5T1IA 1TIID 1XPOA 1XNQL 3H6MA 3ZYYX 4EQPA 1SNPA 1TWFH 5ELCA 3J80c 1BF4A 2YYZA 4L6TB 2Q8IB 1FD7D 2EYHA 5C0XH 2ZM6L 3EJIA 1EYGA 2R92B 3JAME 5I4DA 2DNEA 2A5HA 1U5KA 3RZOH 4C3HH 2Q2UA 5BN4A 2NTTA 2B2YA 3T4AC 2XWBB 4J8QA 2XRSD 3TEHB 3AFQA 3FVQA 3HOVB 1JT8A 2CFMA 2PI2E 3M9BA 1V1PA 2HDMA 4O42A 3PIP3 2BH2A 4A3LH 4F7XA 3C2PA 5G3LF 2JA7G 5EPJA 1XPRA 2OQKA 4R4IA 3I72A 5FJ8G 1MJCA 4A3BB 2SEBD 5CV6A 3SDZA 2ZJRA 4POGA 2F0JA 4DR1Q 4GLAC 3CCJA 1Q86C 3BDLA 1EY7A 1FNWA 2K4KA 3BYYB 2R6GA 1QILA 1EQQA 4LUVA 1SNQA 5EBCA 2Q8TA 1K3RA 2KCMA 2WB1G 1SE8A 1OXSC 2F0LA 3GDEA 3H91A 4DR4Q 5FO8B 1QWYA 2VL6A 3IKJA 2F0DA 2B2VC 4QMGA 3KLWA 2ZJPA 4IJLA 5CV8A 4KJNA 1JOKA 1BQQT 5JEAH 4DV5L 3RUZA 2WACA 1NSNS 4A3BG 3CP0A 1J9OA 1X56A 5FO9B 1CKOA 4JVZA 3FDTA 3HOXH 2EYJA 5C3WA 4L8JA 1T5EA 4LFBQ 2NVXB 1FJGL 2EYLA 2EE1A 1P8LA 3OIPA 1GHKA 4QIWE 2YU9H 4UP9A 1JMCA 3U9OA 4DNIA 5IT9L 1QE6A 1CKNB 4LUOA 1Q1EA 3K8AA 3K7AH 1ICFB 4JI1L 1CKMA 1HCZA 3GTOB 1ILQA 1WJJA 2NB0A 1WTPA 3HOXB 4RGMA 1YBYA 1E7ZA 4DR2L 1WCMG 3DWAA 4YHHQ 1TWAH 1XXGA 1TQOA 2R61A 1ONLA 3D6WA 3S16H 1B44D 3I3CA 1BXTA 1H95A 2ALYB 5IGFA 2ZT9C 2SNSA 1XNQQ 1MD2D 1YZ6A 4PZ8A 2MO0A 4HJ5A 1K0SA 3CHBD 5EKIA 3HGBA 3HOVG 3OW2A 3L2PA 4N8FA 1CSPA 2F0TA 3KOJA 1KLUD 1N36L 2OTJA 2MJ8A 1ILPA 5CV7A 3E5SA 1K3BC 3CCSA 2Z4IA 2E2JB 4IO9A 2A19A 3RZDB 4AYBG 2GVAA 3GTGH 3L7ZC 2HD3A 4MN3A 5CBEE 4XTCS 2EXZA 1SFOH 2Z6KA 2PMZE 1QVGA 3NENA 2EY6A 1VMPA 2ZTEA 1IBMQ 2L4NA 3ULLA 5D14A 1PXUA 1YNND 1IBLQ 1UEBA 1GUSA 1D6EC 2QGQA 1ASZA 3CCEA 1CHPD 4A76A 5M3MG 3U50C 1EY9A 1ESRA 4DR4L 4AYBB 3G7LA 1ML0D 3HKZB 1NAPA 3EQLC 2F3VA 2R7ZG 1O7YA 5LHY1 4C3JG 3HOZH 1X32A 4JI6L 1EQVA 2PQAA 3TP7A 2OQ0A 3CCUA 4IPGA 5JAVA 4A3MG 3S2DH 4JBJA 4KLKA 2BA0A 2ZTCA 4XQJA 2MNAA 1RDPD 3PCOB 4IUNA 2Z4HA 1R4PB 3LNNA 1JE4A 1BCPF 1MKHA 1QUQA 2VQEL 4A3BH 3R93A 3S9WA 3Q0AA 5FLMG 3GTOH 4A3GH 4C1NK 4WRDA 3M4OB 2E8GA 4NW2A 1N9WA 3TS2A 1EEFD 1O7LA 1IYUA 3N6RA 4JI8Q 4PMBA 4PMWA 1S5CD 3GTPB 4I7AA 3S1MB 3X3NA 3I8ZA 3EROA 1HA6A 5IIFA 2A6HD 4DPGA 1KDAA 1F2YA 3HEJA 1I4RA 3FEWX 3A0JA 2WKCA 3E0EA 1ET6A 4B3MQ 1Y1WG 5H1SE 1YHQA 4HR7B 1Y1VB 4JI8L 3S17B 4MIUA 4UHVA 1VQ6A 1HFNA 3VR5A 4IOAA 4IN3A 2K52A 3MXPA 3GTJB 3IFTA 2BCOA 4OO1H 4LF7Q 1M4VA 4IUTA 3KBGA 1EY0A 2K5DA 2Z6KC 4BY1H 4NXMQ 1XMQL 2R3ZA 2K75A 4Q5VA 3GTKB 3CPFA 4HN7A 1A3UA 5GAGC 4B08A 2LSSA 2R92G 2B39A 4P71A 4K5XA 3KFUA 3JAML 4A3IH 3KLSA 5JJLA 2HQEA 4LF9Q 1X54A 3HOVH 2K5NA 3K0YA 1VQPA 1E3PA 4XT3B 4RKBA 3MFGA 3TQYA 2UXBQ 2CW0D 3P1HA 4DR5L 4PG3A 1U4RA 2KCCA 5C4HA 1YNNC 2F0IA 3NQIA 1SE2A 1WTWA 4CBVA 1BBXC 1L1OA 1B53A 5M5YH 1TWGB 2NYZD 4DK0A 4GLVB 4Y52H 4RCOA 5A2QL 3CW2C 3I4NG 1EY6A 3I4MH 2Z0SA 4R8IA 5IGBA 3S14B 5M3MH 1H9SB 3H94A 1PRTC 1SEBD 4JCVE 4LAAA 5HGQA 2UUBL 4MTNA 2C35B 2WB1B 1WCMB 4CGYB 3CF5A 3KBXA 1X3FA 1G91A 3X3MA 5C5LA 4HMIA 1B4OA 2ZM6Q 4V190 2DGYA 2G9HD 3PSIA 1EIYB 1LTSD 2A6EC 4MZ9A 2NVYH 3S2HH 1QJOA 1EFID 2AUJD 4LFAL 2FHTA 1TY0A 2NN6G 3R2IA 4PZ6A 3SK4A 1X3GA 4OIKA 3N52A 4GNXC 2I46A 1ZKOA 4FXKC 5KNCA 2BOSA 4A3GG 3D3RA 3GQBA 2MFIA 1C9OA 4G7ZC 1EU4A 1IYVA 1EQTA 4OO1G 3J7A5 4BA1I 5DEHA 5E4XA 4FXDA 1Y69U 4KK7A 4BY1B 5C5MA 3OPOA 1BNZA 3NSWA 2AHOB 3R8BA 3EA6A 3S15H 3CD6A 3VR3A 1W6KA 2G5DA 1PH9A 1JJ2A 2JXMB 1UAPA 4NMZA 3SHLA 4X3SA 2RDFA 1WTVA 3I4MG 1N8RC 4O1NA 2KA7A 1I4QA 4GLXA 4PZ7A 2QA4A 3J81i 1SYEA 4APVA 2WAQB 3IL8A 2RCFA 3RN2A 3TDQA 1A3VA 3VA7A 3HOZB 2ATWA 1HNZL 5CV4A 1XTCD 5E4WC 5KGUA 2L0CA 4R9WA 4IURA 1WD1A 2LXJA 3KJPA 2GVBA 2L11A 3IAYA 1GHJA 1X3PA 4ABNA 3G71A 3D6CA 4A3KH 1VQ5A 4XXEA 4A3EB 3RLNA 5EAYA 4HIMA 2RHSB 3A7AB 2WINB 2A8VA 1VF5C 1EU3A 2K33A 1J5EL 1PLFA 3C1EA 1HJPA 4KHVA 1ENAA 3OW7A 1VQGA 4QGUA 1GUOA 4X6AH 1L2FA 5ELFA 1PMRA 3ULPA 2YTVA 2UUCQ 3C1FA 5DM73 5IYBH 1B50A 2C5CA 1B2TA 1FJGQ 4GZYC 2RCNA 4RH6A 1PZID 3V2TA 5I6WA 1ENFA 3NTKA 2MGSA 5C4XH 4NB3A 1DZ1A 1B3QA 5JPNC 2M00A 2UUCL 2PO4A 3HOWG 4DAYB 2AQ3B 4FF2A 4JV5Q 1Q7YC 1TWHB 3K7UC 2B2VA 4FP5D 4A3JH 4GKKQ 3KUPA 1YJ9A 2CQOA 1DM0B 4PNYA 4IUUA 5DNFA 4C2MH 1G291 4C3HG 3Q22A 1JB7A 2HUGA 3HFZB 3FHWA 2CWAA 3RLOA 3Q23A 4IFDG 1ZYRD 4EQ5A 1VF7A 1W6JA 2QILA 4HSVA 3J7ZC 3I56A 4A3MH 4KKUA 1XNRL 3NBIA 2JA9A 1AN8A 2IJ0A 3WOEA 5C3XA 1VQFA 4YCUA 4IUVA 3S1RB 2NVTB 4K14A 1HR0Q 1BUVT 3QWNA 3J80i 3QIAA 4DAPA 3OYYA 4GOPA 1P16A 1H9MA 4KV6A 4A3FG 4BWGB 1D5ZC 1OO9B 4BBSG 3C3LA 3S16B 4IPDA 2ZJQA 4DU9A 1NUCA 2FINB 4HEDA 5EPKA 1B8AA 1LTGD 4K8IA 1K8OA 1Q3LA 3CCVA 4DAYA 1NY4A 2EYMA 5C44B 1VS0A 1VQOA 4F87A 1G2SA 5J22A 4H02A 1I6HB 4J6HA 1A3TA 2B8FA 1K8GA 3V96A 2JA7B 4IPCA 1HRJA 3R2TA 1XX8A 2WAQG 4OX9Q 1RHPA 2V4DA 4CKEA 3IRBA 2HCIA 1FR3A 3A8IE 3PUXA 3UE1A 1VQ7A 2YTYA 4CDCC 2F0HA 5IGGA 1N34Q 1AFPA 5I6YA 5C44H 1RL2A 3M85A 5IP7G 2KCNA 1TS4A 1EY5A 2K04A 3T13A 3SK8A 3T51B 3KLSX 2EVBA 2C9OA 4DR2Q 2XVSA 2EJFC 5C4JB 3L3OC 2B2TC 3JAMc 4MHEA 2XRQD 3RZOB 2K01A 4JBKA 2I5HA 1JJGA 5IP9H 4RA8A 4DF7A 2F0MA 1STGA 4IUQA 1MBYA 1CSQA 5I2XA 5F2DA 1C0AA 4DUYL 4RG1A 1L1OC 4R8NA 4HSPA 4DV6Q 3QOJA 3RMHA 1X65A 2ASBA 3AYHB 1M1KC 2O5IC 1X6OA 1BR9A 2Q2HA 3K7AB 1XNRQ 3PUZA 2DJGC 3ER0A 4RFBA 1KTKA 2PW5A 2N8NA 1IL8A 3HRZC 1IHZA 4QY7A 2F4VQ 3M3YH 4JOIC 2HHHQ 1OTCA 5LMNL 3HOYH 1DXMA 3HKZG 2UU9Q 2R92H 4KY6A 1FGUA 3MVVA 1FVIA 1LM0A 4JG2A 5JEAG 5IP9G 2OWOA 3MTSA 4LK1C 3CKIB 1F9RA 2I07B 4EVOA 3HOUG 1DJRD 1LLRD 4CDFC 1UE1A 4JI0L 5KIXA 1JWSD 3ERSX 1SMXA 1A6XA 4ZQ3A 4HCEA 3CMEA 2K05A 5IE8A 3H09A 4KN4C 2HHHL 2TMPA 1HPCA 2BH8A 3QOLA 2RF4A 3S1MH 4CHTB 3TRZA 4ZUJA 1Z9FA 4OO1I 2CVRA 1IYJB 3H0GB 4RHRA 5IY0A 3OIQA 4HJ7A 2CWPA 1FNUA 1KAWA 5M3MB 1SFOB 3FP9A 1NR2A 2K5HA 2F0QA 3I55A 1N34L 3MEHA 1NJIC 2EIFA 1SJED 4BBRB 4DV7Q 1KLGD 1DOLA 4DR3L 2NN6I 3E9HA 3M4YA 3FMCA 2KJXA 4JI3L 4F8MA 1C8CA 3DLLA 1KRSA 4A93H 3A5ZB 4RHSA 4AYBE 2LFNA 5K36G 1CZWA 3PO2G 1I6HH 4C3IB 4GKJQ 5IODA 5AJ3Q 4G7OC 2EYPA 3NPPA 4AQYQ 1G8ZD 1CA6A 1YEZA 5C4JH 2EY2A 2UXDQ 1MIUA 1I3QH 1VDZA 2E76C 4YY3Q 3A8JE 3PO2B 4RWSC 3W1GA 4B3ML 4U68A 4GKJL 5IYCH 4NXNQ 5EJWA 3K80C 1EWHA 4DV2L 3TZUA 1C7YA 4A3FB 2XWJB 2AQ2B 1I4PA 5M5XH 1B3AA 2VQFQ 1W3SA 2F4VL 3JAMi 2KBNA 3DHQA 1HTPA 2O4XA 2E2DC 5GQOA 1N36Q 2VXWA 3F2UA 4LF5Q 2VB2X 3MFYA 4DK6C 5C0XJ 4PQXA 1CM9A 1BOSA 2EYOA 1U9RA 4GN5A 4O2DA 1PRTF 1K83H 1Q90A 3I73A 2YTXA 4DAVA 3HS0C 4GN3B 1HNXL 1G2TA 4A3JB 4JBMA 2ES2A 2K5VA 2EXDA 4CKBA 1DOMA 1QB5D 5IGEA 2Q2IA 2LMCB 1PFNA 4X65Q 4C3HB 2KHJA 2K1BA 3D8GA 1CQFA 2ID0A 3I7FA 5TSSA 4DV4Q 1HUMA 3I4NB 4J1MA 1QVCA 4KKSA 3I90A 3SGIA 1DYQA 3VYUA 1WD0A 4FF1A 3G4SA 1TWFB 4DUZQ 2D2CC 4ZAIA 1HNXQ 4XQQA 1N33Q 3J7YW 1PH6A 3S1NB 3ND8A 4P75A 2B2WC 3G48A 4KY5A 1KRTA 3HG9A 1N32Q 3I4MB 2NBFA 1HNZQ 2UUBQ 1EY8A 1WOCA 4DV7L 2MPMA 2V1CC 2JJQA 3ITPA 2VY3A 2R7ZB 3D0FA 1LUZA 5FJ8H 2MP1A 1PTOD 1VQLA 4DUZL 1JWMD 2PZWA 1DCZA 1LT6D 1EIGA 1AEXA 3PO2H 3HOZG 2QDLA 2F0OA 3NUCA 2WIIB 2F52A 1S3OA 5BR8L 3K59A 1EUJA 4OGQC 4FO2A 1ZXTA 1R9TH 2CHBD 2KHSA 1I50B 2RDGA 1QZGA 1Z7TA 1KC8C 2F3WA 5JVH3 1SDFA 3HOYB 3URYA 1I94L 5CBAE 3GTLH 1STHA 1H9KA 1O7ZA 4DV0L 5BR8Q 5KYLA 2F0GA 3NHHA 3H3VH 1WVLA 4JI7L 1D5MC 2FMCA 5AFWA 3DEPA 3T1YQ 3CPWA 4FXGC 1VQ9A 2B63H 1LO5D 1LTAD 4DNRB 2CH4W 3RLFA 3RNUA 4K5WA 1CTMA 5JOBA 1TT2A 5C44G 4B3SL 1JE5A 4U673 1E22A 4IOCA 1Y1WB 4X62Q 3MXUA 4B9XA 2F0KA 1DOKA 4JI7Q 3O13A 2F0FA 4IFDJ 1PZJD 4OWXB 3Q8DA 3E0JA 3S24A 1EYDA 2KEDA 4C3IH 2NVQB 3CCQA 4EQOA 1A0IA 4QUFA 1F2LA 2NVQH 1CI3M 1FYCA 2IPKD 5FK9C 4WJ4A 2BE5C 3IFDA 3CCLA 4DV4L 1JOQA 3KF6B 2KCTA 1QCBD 3KYHC 3F2BA 3KF8B 3OMCA 1QOHA 1PRTD 1HA5A 1S5FD 1OXUA 2AWNA 1EL0A 2K6AA 2IX3A 1RJTA 1IBKL 2JYOA 2ICEC 1NR4A 1S5DD 3TZDA 4JW0A 2B63B 4LFCL 4FVMA 3T1HL 1TS3A 1EYCA 4X3TA 2BDOA 1L1OB 1UWVA 3ND9A 4DGZA 1QZHA 2F0PA 2I0QA 1X3QA 1UEAB 2KOLA 3AB9A 4X3UA 4DNTB 1I4GA 1BCPC 5KYIA 2B63G 4YWLA 4UY8C 4UPAA 1WTHA 2A69D 3HKZE 2EQSA 4HTHA 2KUMA 2GN5A 1EZ6A 3MZ5A 1EOVA 2WB1E 5I2YA 4DV6L 5EQ0A 1Q46A 3TP5A 1S72A 2PI2A 4LFCQ 2DUDA 2KENA 4C3JB 3BVMA 1C48A 3KF8A 3UDXA 5JJZA 3DEOA 4DFAA 5FLXc 5C4XG 4HMJA 4GNXA 4IJHA 1KAAA 2RSNA 1QNKA 5K5PA 4X64Q 4E6IA 1G6ZA 2SOBA 1F2ZA 1E24A 3OMGA 1F9QA 3U58A 3A5UA 4IPHA 1O7IA 3FRPB 1HZCA 1II3A 3FPUB 4C2MB 3SR1A 3ONAB 1EIFA 3SEBA 3BZCA 5GAEC 3H0GH 1I4HA 3NBHB 4RGTA 3D31A 1SNMA 1JORA 4GS3A 3SXHA 1A2TA 4DV5Q 1JR0D 4LNQA 2AKWB 4CJ2C 2BDNA 1AZPA 3PF5A 4BS9A 4HJAA 1Q8IA 4DR5Q 4BXXG 3OSOA 5E3FA 1F77A 1Y14B 5D65A 1EWCA 4ZK9B 2F3IA 3NTIA 1CQVA 3Q6SA 3OWEB 2FXQA 1HH2P 1KABA 4J15A 4XYOA 2EYFA 2OXPA 1PV4A 1SRUA 3HOUH 4TKOB 3SE0A 1TR5A 1MSHA 3S1QH 3PMFA 2NVTH 2EY1A 3M4PA 1NBWA 1O78A 4YCVA 3TP6A 2PNRC 1Z6HA 4M8AA 1BO0A 1PTOF 4CDDC 1PH8A 1AH9A 2GA4B 5C3EB 4QIWB 1J8IA 4KMUC 3I2ZA 1U0LA 1K9MC 2IX1A 5D3DA 3T1HQ 1EOTA 4A3EH 5KNBA 1N32L 2RKSA 3H3VI 1HFGA 4JYAL 4P2CB 5KRUA 4RAUC 3KF6A 3A74A 2HDLA 3STBC 5LMNW 4P74A 3ULJA 4LF4L 4A3DH 3MHBA 4L5SA 3U9SA 1DGSA 1ZYRC 1CA5A 1YHAA 2JA5G 3DM3A 4JOIA 4R4QA 1K28A 1PFBA 4YIJA 5IYBG 3ICEA 1GUGA 1H9JA 2HIVA 5DAUA 3PUVA 1ENCA 3KJOA 3W1BA 4YHHL 4OWWB 4A4IA 4Q0FA 4IFDH 1WTOA 3QJYA 1IBML 4A3DB 4A3MB 3NWSA 3NXWA 1FNVA 4CKCA 4CDEC 2AMCB 4N9PA 1NE3A 1PVOA 4DN4M 1PFSA 1GO3E 3PO3B 3OTOQ 4LW1A 2NUCA 1XTDA 2H5XA 4JI2L 4XIGS 3EBEA 4BY7H 3T1YL 1EZ8A 1TWHH 4BY7B 2NN6H 3BU2A 3ZJYC 5I9PA 2KQ3A 3GTMB 2MQHA 3RR5A 1GOZA 1VQAA 1MHWC 2OF1A 4K0KQ 1IZ6A 3HOUB 1K8AC 3K57A 1TXYA 1VQ4A 1UE6A 4JI2Q 2PNHA 1CK1A 1V1PB 5C0XI 5GADC 1L0YB 1SAPA 1H9RA 1QG7A 2RSOA 2F03A 2H1EA 3BS1A 4TVAB 3ERQA 1PH5A 4HCSA 1HR0W 1A2UA 2MO1A 1PH7A 2CKZB 3C46A 2ZXRA 4G4KA 5ELOA 2IL8A 2B3GA 5CC4A 1LTBD 2Y0SB 1JWUD 2F0UA 1PTOC 5ELEA 2H4OA 2I5LX 4ZCKA 2OTLA 3VYTA 3W3AA 3I70A 2PQEA 1VQIA 3HOXG 1HZAA 1A8VA 4QL5A 4NKLA 5D3IB 2LS01 3S1QB 3CAMA 4ZUIA 3OOCA 4A3KB 1S5ED 2Y0SG 1AE3A 4ILWA 3NE5B 1WTXA 1A15A 1JICA 2N78A 4KHZA 4OX9L 1VQMA 2K14A 2ZXPA 5T1GA 4A3JG 3TN2A 3GV3A 4WJWA 3KK7A 1VQHA 4C3JH 4RGNA 4A3CH 5ELDA 2VQEQ 1VQNA 3GTQB 5IYDH 1ZEQX 3WDNA 1I6VC 4HIDA 2WV6D 3EVQA 1TKWB 4K2KA 1TVXA 3VR4A 4DV1L 5HGTA 4UDUC 4QQBX 1VQEA 3QO2A 1HTLD 4EGVA 1KHIA 1SNCA 4RGOS 1PYBA 1SR3A 4ULLA 5LMUL 1X55A 2N49A 4YWKA 4QF4A 2JE6I 1MI2A 1W2BA 4AIMA 2E5LL 3P20A 1PH3A 2JA8B 2EDGA 1WTQA 2VQFL 4BBSH 3H3VC 5JEAJ 4P73A 4DV1Q 3MAQA 4LF9L 1VQDA 2J0TD 1V1OA 1D1KA 3UDIA 3FPPA 3PGZA 2LXKA 2ENBA 4M1UB 2R93B 2RA4A 4DV3L 1HQMC 3MA2B 1PA6A 1VQKA 2F0WA 2QCPX 1Q81C 2XTIA 3BVZA 1Y8NB 1EQRA 5A35A 1IW7C 5CYUA 4LF8L 2XN9C 2PZTA 3MEFA 4LF5L 3F1ZA 4K0KL 2EOTA 3A7LA 1XMOQ 4K5VA 4KD3A 4XQNA 4Y7NH 2DN8A 2ZXOA 3KLRA 4ME3A 4NDXA 2DNCA 5CORA 4QCLA 1VQ8A 1CZGA 2IHEA 4AH6A 4FF4A 3AFPA 1RKNA 5ISRA 2JA5H 4ODGA 1STBA 1YJWA 1PH4A 1XMQQ 3CCRA 4A3GB 3QG1A 4B3SQ 1Q8KA 4PMCA 4ME5A 3J80E 1PTOB 3TREA 2UXBL 2CW0C 3DUZA 1LACA 3WWVA 5J3BA 5FLXL 5ELNA 3HZXA 5IWAQ 2OEOA 1J5EQ 2F1MA 4BBRG 4DK1A 3LWEA 1LTTD 4JI5Q 3M4QA 1SMYD 1YNJC 3LWUA 3PV0A 5JJIA 4DXFA 1JJCB 2RDHA 4BBSB 2EJGC 1VCIA 4WJ3M 1KD1C 2Z8LA 4C3IG 1EFWA 4OHJA 1I50H 2Y0SE 4X64L 3M7NA 1X3EA 2QEJC 1STYA 1YI2A 2Z6BA 3OWFA 1B1ZA 1BBWA 1I3QB 4H7BA 5CV9A 2EZVA 3NWTA 2HQLA 1SN8A 3Q24A 3T16A 3CCMA 3K5NA 4FNFA 2N55A 3P7JA 1K73C 3GTQH 4BXXH 1TS5A 3HOWH 3AQQA 1CHQD 2L5TA 1VMCA 4R4OA 3FKIH 1I94Q 1E2VA 4LFAQ 1BBUA 2Z1CA 1EY4A 2VUMH 4LF7L 4N9TA 1ASYA 3HKSA 4RCNA 5FO7B 3GTJH 2A6ED 1Y1WH 1V1QA 3PIPA 2PMZB 2VW9A 2JA8H 1WI5A 3AU7A 1WCMH 3UDFA 1RTOA 5M5WH 1T5XD 5LMNQ 4HIKA 3NBHA 3I4OA 1ICWA 4DA2A 3K5LA 1HUNA 1N33L 1TWGH 2NTSA 3PIO3 4V0BA 2Q8RE 5I9OA 2P5ZX 2VUMB 3I4NH 2FFKB 2KEEA 3BZDB 1UE7A 1XJVA 2IX0A 2JA8G 4LF6L 1DD2A 2BA1A 1QUQB 4Y7NB 1HHVA 1F9SA 3HOWB 3VYRA 1K8MA 5DLQE 2IY5B 2AWOA 4S3SA 3K6OA 4L5TA 4P72A 1S40A 3DXJC 1SYDA 4HAEA 3PIOA 4CJ0B
chains in the Genus database with same CATH topology
3M7GA 1PRTB 1JC7A 4WFN3 4IQZA 4I65A 2L12A 3S2DB 2X6GA 4F88A 2K03A 5IGCA 4K8JA 3TBIB 3GTGB 2SNMA 4K2LA 2K7VA 3DWQA 2EPBA 2HCCA 5C4ZA 2O2LD 5HURA 1WTRA 4KI0A 1EIHA 2IT1A 2EY5A 2G9DA 4Z9CB 3SK5A 1KDCA 1FGBD 3MC0B 5KEEA 4A93B 1CFMA 2B2UA 2M2LA 1R4QB 1HXYD 2K5QA 2F0NA 3MWYW 4RKLA 3P75A 3QB3A 1E2WA 1RTNA 2EJMA 5DM63 3WOFA 1C4QA 1CT1D 5M5WB 2FJ2A 3W2DA 3TMEA 1JQYD 2PCFB 5M5YB 2LKVA 1TU2B 3BG3A 2DY8A 4JBWA 1E2ZA 1BCPB 1MGSA 2NWGA 2JSOA 4LMQD 3BDOA 2PPBC 3LX0A 3HP3A 1R9TB 1B9NA 2RBMA 2N88A 4NP5A 1IKMA 1MSGA 3DWPA 2NZ1D 2PZUA 5FOBB 5CR3A 5M3FB 2NVYB 3S2HB 4IUPA 2A6HC 2L9HA 5COYA 1TS2A 1H9SA 1PYWD 4IALA 4JK1C 1GJXA 3GP7A 5IT9E 1EEID 2B2WA 1OXVA 4OIJA 3BVGA 1RF2D 1PTOH 1Q12A 1U4MA 3G6JB 4K6DA 3DMUA 1GUNA 2AUKA 4KKTA 5C4XB 4ZKCB 1V43A 3VR2A 1LT3D 1D1IA 4H0LC 2A68D 2F0EA 4K6LA 1GXDC 3MXNA 3SVMA 4KY7A 2QKIC 2D9UA 3L9AX 3VR6A 3BDCA 5JVG3 5LL6X 1SE3A 1LV9A 5FKAC 4C1NI 2LY7A 4G7HC 3BYTB 3CQZB 1GUWA 2IWHA 4ID6A 2K32A 3NQTA 1I4XA 1LABA 4ZKBB 1KNAA 1TY2A 2PYKA 3CRKC 2A74C 2A68C 3DM1A 5K36H 4I7ZC 1IW7D 2DY7A 3NK9A 4KD4A 2QDBA 3K5MA 4KTAA 1UUPA 4PV1C 1SE4A 1M8AA 1BDOA 3A55A 3E6ZX 3I91A 2F4IA 2F0VA 3I4LA 1L0XB 1STNA 5IGDA 4XDXA 5BN3A 2F0SA 1STAA 1SYCA 2QF7A 2TSSA 1TWCB 1B9MA 3A54A 3RD4A 1IKLA 1E0BA 2JEBI 1STEA 2YU9B 4WORA 2L55A 3FKIB 1RD9D 3MXGA 1SYBA 3VA5A 2MHVA 3TSSA 1SJHD 1LTRD 5NUCA 4XT1B 2A69C 3R3OA 1ET9A 5C0XG 2A73B 1BCPD 1TWAB 3K58A 5CGKA 4TQUS 3T53B 2AQ1B 3K5OA 1ESFA 2X6LA 2B2TA 1OXXK 2K28A 2OT2A 1Z47A 3GO5A 4EQNA 1KNEA 2RQXA 5IOCA 2J7ZA 2D5DA 4TSSA 1GUTA 3S15B 5CV5A 3NP8A 4CJ1B 2FMMA 3M3YB 5EGTA 4FYDA 3CU7A 5J1ZA 1Y8OB 2VNUD 4ZRZA 5CMDA 1JOOA 5EPLA 3EFXD 2IW3A 2CQAA 2VB3X 4DXGA 3J81L 5LL6S 1Q1BA 1SBBB 3TP8A 1LTID 2JA6B 2SDFA 4ZLTF 1SSOA 1DONA 1NCVA 3GV6A 4BA2I 1V8QA 1RODA 1K83B 5J39A 1D5XC 2WKDA 4FF3A 5BN5A 3PUWA 4IZ8A 3CRLC 2K5WA 4H13C 1SYFA 1D2BA 2M9VA 1U4PA 4ZYSA 5EBDA 3A8KE 1S4ZA 3UI2A 3D4DA 2JEAI 3VYSA 1PZKD 4KN7C 5FLXE 2L1BA 4H44C 2D62A 3J80L 2KECA 2PW7A 3D4RA 1PFMA 2E2IB 3A56A 3PUYA 5G3LD 2J4XA 1Y8PB 3SK6A 1F9PA 2XNAC 1AW7A 3J81E 1LT5D 2WP8J 2RVLA 4TRDA 5KNDA 1SNDA 1F2MA 1AZQA 1SYGA 5M5XB 4XYQA 4KJOA 5EKKA 1PDQA 4C56C 3D4WA 4OL7A 1JCKB 2XSCA 2X69A 3GD7A 1EYAA 5JPMC 1SMYC 1YNJD 1XWEA 2KVMA 3T56B 3V05A 1OXTA 2JA5B 5E1FA 2B2YC 4IFDI 3J7AV 1KDBA 2E2HB 1O80A 3OHXC 2MUYA 3AMUA 5C6AA 4L63B 2XIWA 1JB3A 1SXTA 3J7AF 2ICIA 1SNOA 5ELBA 4A3IB 4UAIA 2O5JC 1LT4D 2E75C 1AP0A 1U4LA 5EKLA 1HQRD 2B2UC 4QB4A 1XYIA 2BE5D 4G57A 4B9WA 2E74C 5A2QE 2B8GA 1QNUA 2JP1A 1S5BD 4QUCA 3GTLB 4X3KA 1UNSA 4LJZC 5M9OA 3NTHA 1RCVD 5T1IA 1TIID 3H6MA 3ZYYX 4EQPA 1SNPA 5ELCA 1BF4A 2YYZA 4L6TB 2Q8IB 1FD7D 2EYHA 5C0XH 3EJIA 2R92B 3JAME 5I4DA 2DNEA 2A5HA 5BN4A 2NTTA 2B2YA 3T4AC 2XWBB 4J8QA 2XRSD 3FVQA 3HOVB 1V1PA 2HDMA 4O42A 3PIP3 4F7XA 3C2PA 5G3LF 5EPJA 3I72A 4A3BB 2SEBD 5CV6A 3SDZA 2F0JA 3BDLA 1EY7A 1FNWA 3BYYB 2R6GA 1QILA 1SNQA 5EBCA 2Q8TA 1OXSC 2F0LA 3H91A 5FO8B 1QWYA 3IKJA 2F0DA 2B2VC 4QMGA 5CV8A 4KJNA 1JOKA 1BQQT 5JEAH 3RUZA 2WACA 1NSNS 1J9OA 5FO9B 3FDTA 2EYJA 5C3WA 4L8JA 1T5EA 2NVXB 2EYLA 2EE1A 3OIPA 1GHKA 3U9OA 5IT9L 1QE6A 1Q1EA 1HCZA 3GTOB 1ILQA 2NB0A 1WTPA 3HOXB 4RGMA 3DWAA 1XXGA 1TQOA 2R61A 1ONLA 3D6WA 1B44D 3I3CA 1BXTA 5IGFA 2ZT9C 2SNSA 1MD2D 3CHBD 5EKIA 3HGBA 2F0TA 1KLUD 2MJ8A 1ILPA 5CV7A 3E5SA 2Z4IA 2E2JB 3RZDB 3L7ZC 4MN3A 5CBEE 4XTCS 2EXZA 2EY6A 1VMPA 2L4NA 5D14A 1PXUA 1YNND 1GUSA 1D6EC 1CHPD 1EY9A 1ESRA 4AYBB 3G7LA 1ML0D 3HKZB 1NAPA 3EQLC 2F3VA 1O7YA 5LHY1 4C3JG 1X32A 1EQVA 3TP7A 5JAVA 2BA0A 4XQJA 1RDPD 4IUNA 2Z4HA 1R4PB 3LNNA 1JE4A 1BCPF 3R93A 3S9WA 3Q0AA 4C1NK 4WRDA 3M4OB 4NW2A 1EEFD 1O7LA 1IYUA 3N6RA 4PMBA 4PMWA 1S5CD 3GTPB 3S1MB 3X3NA 3I8ZA 3EROA 1HA6A 5IIFA 2A6HD 1KDAA 1F2YA 3HEJA 1I4RA 3FEWX 2WKCA 1ET6A 4HR7B 1Y1VB 3S17B 4MIUA 1HFNA 3VR5A 4IN3A 3MXPA 3GTJB 3IFTA 2BCOA 4OO1H 1M4VA 4IUTA 3KBGA 1EY0A 2K5DA 2R3ZA 4Q5VA 3GTKB 4HN7A 1A3UA 4B08A 2B39A 4K5XA 3JAML 3KLSA 2HQEA 3K0YA 4XT3B 4RKBA 3MFGA 2CW0D 3P1HA 1U4RA 2KCCA 5C4HA 1YNNC 2F0IA 3NQIA 1SE2A 1WTWA 4CBVA 1BBXC 1B53A 1TWGB 2NYZD 4DK0A 4RCOA 5A2QL 1EY6A 4R8IA 5IGBA 3S14B 1H9SB 3H94A 1PRTC 1SEBD 4LAAA 2WB1B 1WCMB 4CGYB 3KBXA 1G91A 3X3MA 5C5LA 4HMIA 1B4OA 4V190 2G9HD 1LTSD 2A6EC 1QJOA 1EFID 2AUJD 2FHTA 1TY0A 2NN6G 3R2IA 3SK4A 4OIKA 3N52A 2I46A 1ZKOA 4FXKC 5KNCA 2BOSA 3D3RA 3GQBA 4G7ZC 1EU4A 1IYVA 1EQTA 4OO1G 4BA1I 5DEHA 5E4XA 4FXDA 1Y69U 4KK7A 4BY1B 5C5MA 3OPOA 1BNZA 3NSWA 3R8BA 3EA6A 3VR3A 1W6KA 2JXMB 1UAPA 4NMZA 3SHLA 4X3SA 2RDFA 1WTVA 4O1NA 2KA7A 1I4QA 1SYEA 2WAQB 3IL8A 3TDQA 1A3VA 3VA7A 3HOZB 5CV4A 1XTCD 5E4WC 5KGUA 2L0CA 4R9WA 4IURA 1WD1A 2L11A 3IAYA 1GHJA 1X3PA 4ABNA 3D6CA 4XXEA 4A3EB 3A7AB 2WINB 1VF5C 1EU3A 2K33A 1PLFA 3C1EA 4KHVA 1ENAA 3OW7A 1GUOA 5ELFA 1PMRA 3C1FA 5DM73 1B50A 2C5CA 1B2TA 4GZYC 4RH6A 1PZID 3V2TA 5I6WA 1ENFA 3NTKA 2MGSA 1DZ1A 5JPNC 2M00A 2PO4A 2AQ3B 4FF2A 1TWHB 4FP5D 2B2VA 3KUPA 1DM0B 4PNYA 4IUUA 5DNFA 4C3HG 1G291 3Q22A 2HUGA 4IFDG 3Q23A 1ZYRD 1VF7A 1W6JA 2QILA 4HSVA 4KKUA 3NBIA 1AN8A 2IJ0A 3WOEA 5C3XA 4IUVA 3S1RB 2NVTB 4K14A 1BUVT 3QWNA 3QIAA 4DAPA 1H9MA 4KV6A 4BWGB 1D5ZC 1OO9B 3C3LA 3S16B 4DU9A 1NUCA 2FINB 4HEDA 5EPKA 1LTGD 4K8IA 1K8OA 1Q3LA 4DAYA 2EYMA 5C44B 4F87A 1G2SA 5J22A 1I6HB 4J6HA 1A3TA 2B8FA 3V96A 2JA7B 1HRJA 3R2TA 1XX8A 1RHPA 2V4DA 4CKEA 2HCIA 1FR3A 3A8IE 3PUXA 2F0HA 5IGGA 1AFPA 5I6YA 3M85A 2KCNA 1TS4A 1EY5A 2K04A 3T13A 3SK8A 3T51B 3KLSX 2EVBA 2C9OA 2XVSA 2EJFC 5C4JB 3L3OC 2B2TC 4MHEA 2XRQD 3RZOB 2K01A 4RA8A 4DF7A 2F0MA 1STGA 4IUQA 1MBYA 5I2XA 5F2DA 4R8NA 4HSPA 3QOJA 3RMHA 2O5IC 1BR9A 3K7AB 3PUZA 4RFBA 1KTKA 2PW5A 1IL8A 3HRZC 1IHZA 1DXMA 4KY6A 3MVVA 5JEAG 3MTSA 4LK1C 3CKIB 4EVOA 1F9RA 2I07B 1DJRD 1LLRD 5KIXA 1JWSD 1A6XA 4ZQ3A 4HCEA 2K05A 3H09A 4KN4C 2TMPA 1HPCA 3QOLA 4CHTB 4ZUJA 4OO1I 2CVRA 3H0GB 4RHRA 3OIQA 1FNUA 5M3MB 1SFOB 1NR2A 2F0QA 3MEHA 1SJED 4BBRB 1KLGD 1DOLA 2NN6I 3M4YA 3FMCA 2KJXA 4F8MA 1C8CA 4RHSA 2LFNA 5K36G 1CZWA 4C3IB 5IODA 4G7OC 2EYPA 3NPPA 1G8ZD 1CA6A 2EY2A 1VDZA 2E76C 3A8JE 3PO2B 4RWSC 4U68A 5EJWA 1EWHA 3TZUA 4A3FB 2XWJB 2AQ2B 1I4PA 1B3AA 3DHQA 1HTPA 2O4XA 2E2DC 2VXWA 3F2UA 2VB2X 3MFYA 5C0XJ 4PQXA 1CM9A 1BOSA 2EYOA 1U9RA 1PRTF 1Q90A 3I73A 4DAVA 3HS0C 1G2TA 4A3JB 4CKBA 1DOMA 1QB5D 5IGEA 2LMCB 1PFNA 4C3HB 2K1BA 3D8GA 1CQFA 2ID0A 5TSSA 1HUMA 3I4NB 4J1MA 4KKSA 3I90A 1DYQA 3VYUA 1WD0A 4FF1A 1TWFB 2D2CC 4ZAIA 4XQQA 3J7YW 3S1NB 3ND8A 2B2WC 4KY5A 3HG9A 3I4MB 2NBFA 1EY8A 2MPMA 3ITPA 2R7ZB 2MP1A 1PTOD 1JWMD 2PZWA 1DCZA 1LT6D 1EIGA 1AEXA 2F0OA 3NUCA 2WIIB 3K59A 4OGQC 4FO2A 1ZXTA 2CHBD 2KHSA 1I50B 2RDGA 1Z7TA 2F3WA 5JVH3 1SDFA 3HOYB 3URYA 5CBAE 1STHA 1H9KA 1O7ZA 5KYLA 2F0GA 3NHHA 1WVLA 1D5MC 2FMCA 5AFWA 3DEPA 4FXGC 1LO5D 1LTAD 4DNRB 3RLFA 4K5WA 1CTMA 5JOBA 1TT2A 4U673 1Y1WB 3MXUA 4B9XA 2F0KA 1DOKA 3O13A 2F0FA 4IFDJ 1PZJD 3E0JA 1EYDA 2KEDA 2NVQB 4EQOA 4QUFA 1F2LA 1CI3M 1FYCA 2IPKD 5FK9C 2BE5C 3IFDA 1JOQA 1QCBD 3OMCA 1QOHA 1PRTD 1HA5A 1S5FD 1OXUA 2AWNA 1EL0A 2K6AA 2IX3A 1RJTA 2JYOA 2ICEC 1NR4A 1S5DD 3TZDA 2B63B 4FVMA 1TS3A 1EYCA 4X3TA 2BDOA 3ND9A 4DGZA 2F0PA 1X3QA 1UEAB 2KOLA 3AB9A 4X3UA 4DNTB 1I4GA 1BCPC 5KYIA 2A69D 4HTHA 2KUMA 1EZ6A 3MZ5A 5I2YA 5EQ0A 3TP5A 4C3JB 3BVMA 1C48A 3KF8A 5JJZA 3DEOA 4DFAA 4HMJA 1KAAA 2RSNA 1QNKA 5K5PA 4E6IA 1G6ZA 2SOBA 1F2ZA 3OMGA 1F9QA 3FRPB 1II3A 3FPUB 4C2MB 3SR1A 3ONAB 3SEBA 1I4HA 4RGTA 3D31A 1SNMA 1JORA 3SXHA 1A2TA 1JR0D 4CJ2C 2BDNA 1AZPA 4BS9A 1Q8IA 3OSOA 5E3FA 1F77A 5D65A 1EWCA 4ZK9B 3NTIA 1CQVA 3Q6SA 3OWEB 1KABA 4XYOA 2EYFA 2OXPA 4TKOB 3SE0A 1TR5A 1MSHA 3PMFA 2EY1A 1O78A 3TP6A 2PNRC 1Z6HA 4M8AA 1BO0A 1PTOF 2GA4B 5C3EB 4QIWB 1J8IA 4KMUC 2IX1A 5D3DA 1EOTA 5KNBA 2RKSA 1HFGA 4P2CB 5KRUA 4RAUC 2HDLA 3MHBA 3U9SA 1ZYRC 1CA5A 1PFBA 4YIJA 1GUGA 1H9JA 5DAUA 3PUVA 1ENCA 4Q0FA 4IFDH 1WTOA 3QJYA 4A3DB 4A3MB 3NWSA 3NXWA 1FNVA 4CKCA 4N9PA 4DN4M 3PO3B 2NUCA 4XIGS 1EZ8A 4BY7B 2NN6H 3GTMB 5I9PA 2KQ3A 1GOZA 2OF1A 3HOUB 3K57A 1CK1A 1V1PB 5C0XI 1L0YB 1SAPA 1H9RA 1QG7A 2RSOA 2F03A 2H1EA 3BS1A 3ERQA 4HCSA 1A2UA 3C46A 2ZXRA 4G4KA 2IL8A 5CC4A 1LTBD 2Y0SB 1JWUD 2F0UA 1PTOC 5ELEA 2H4OA 3VYTA 3W3AA 3I70A 2PQEA 4NKLA 5D3IB 2LS01 3S1QB 4ZUIA 3OOCA 4A3KB 1S5ED 4ILWA 3NE5B 1WTXA 1A15A 1JICA 4KHZA 2ZXPA 5T1GA 3TN2A 3GV3A 4WJWA 3KK7A 4RGNA 5ELDA 3GTQB 1ZEQX 3WDNA 1I6VC 2WV6D 3EVQA 1TKWB 4K2KA 1TVXA 3VR4A 5HGTA 4UDUC 3QO2A 1HTLD 4EGVA 1SNCA 4RGOS 4ULLA 4QF4A 2JE6I 1MI2A 3P20A 2JA8B 2EDGA 1WTQA 3H3VC 5JEAJ 3MAQA 2J0TD 1V1OA 1D1KA 3FPPA 2ENBA 4M1UB 2R93B 2RA4A 1HQMC 3MA2B 2F0WA 2QCPX 1Y8NB 3BVZA 5A35A 1IW7C 5CYUA 2XN9C 2PZTA 2EOTA 3A7LA 4K5VA 4KD3A 4XQNA 2DN8A 2ZXOA 3KLRA 4NDXA 2DNCA 5CORA 4QCLA 1CZGA 4FF4A 1RKNA 5ISRA 4ODGA 1STBA 4A3GB 3QG1A 4PMCA 4ME5A 3J80E 1PTOB 2CW0C 3DUZA 1LACA 5FLXL 3HZXA 2OEOA 2F1MA 4DK1A 3LWEA 1LTTD 1SMYD 1YNJC 3LWUA 3PV0A 4DXFA 2RDHA 4BBSB 2EJGC 1VCIA 2Z8LA 4C3IG 4OHJA 3M7NA 2QEJC 1STYA 3OWFA 1B1ZA 1I3QB 4H7BA 5CV9A 2EZVA 3NWTA 3Q24A 3T16A 3K5NA 4FNFA 2N55A 3P7JA 1TS5A 1CHQD 2L5TA 1VMCA 1E2VA 2Z1CA 1EY4A 4N9TA 4RCNA 5FO7B 2A6ED 2PMZB 3AU7A 1RTOA 1T5XD 3NBHA 1ICWA 4DA2A 3K5LA 1HUNA 3PIO3 2NTSA 4V0BA 2Q8RE 5I9OA 2VUMB 2FFKB 2KEEA 3BZDB 2IX0A 1DD2A 2BA1A 4Y7NB 1HHVA 1F9SA 3HOWB 3VYRA 1K8MA 2AWOA 4S3SA 3K6OA 3DXJC 1SYDA 4HAEA 4CJ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY1 A;  2F0U A;  3TP6 A;  2F0V A;  5C6A A;  3HZX A;  5IGB A;  3U9O A;  1STN A;  5IGD A;  2OEO A;  4IZ8 A;  5C4H A;  2PQE A;  4IUN A;  4I65 A;  5EKL A;  4KY5 A;  4LAA A;  2F0Q A;  4NKL A;  2F0S A;  3C1E A;  1EYC A;  3MEH A;  4QB4 A;  4IAL A;  1SYF A;  1EY8 A;  1STA A;  1SYC A;  4ZUI A;  4DGZ A;  4KHV A;  1ENA A;  2F0P A;  4G57 A;  5IGC A;  2F0H A;  5JAV A;  5IGG A;  2RKS A;  4K8J A;  3ITP A;  3D4D A;  4B9W A;  5I6Y A;  2SNM A;  4K2L A;  5KRU A;  5C5L A;  4HMI A;  4WRD A;  1EY5 A;  3T13 A;  3SK8 A;  5KYI A;  3C1F A;  4F8M A;  1TQO A;  3MHB A;  2PZW A;  4WOR A;  5M9O A;  4HTH A;  1AEX A;  5C4Z A;  1EZ6 A;  3MZ5 A;  4PMB A;  4ZUJ A;  3SK4 A;  5HUR A;  2PW7 A;  3V2T A;  2F0O A;  1SYB A;  3H6M A;  2EY5 A;  3NUC A;  3VA5 A;  1STY A;  4K6D A;  1SNP A;  3TP5 A;  4EQP A;  5I6W A;  5IGF A;  3SK5 A;  3OWF A;  5IOD A;  2SNS A;  3DMU A;  3ERO A;  2EYP A;  4H7B A;  5NUC A;  5CV9 A;  5IIF A;  3R3O A;  4YIJ A;  1KDC A;  2EY2 A;  1KDA A;  3EVQ A;  4DF7 A;  4K2K A;  2EYH A;  3T16 A;  1F2Y A;  2F0M A;  1STG A;  3EJI A;  2KHS A;  3HEJ A;  5DAU A;  5HGT A;  5KEE A;  2M00 A;  1ENC A;  2F3W A;  3SK6 A;  2F0T A;  5F2D A;  5CGK A;  4DFA A;  1SNC A;  4R8N A;  4TRD A;  1STH A;  5DEH A;  4HMJ A;  1KAA A;  3QOJ A;  5C5M A;  1EY4 A;  4MIU A;  4E6I A;  4QF4 A;  5CV7 A;  1SND A;  3NXW A;  5K5P A;  5KYL A;  3E5S A;  2F0E A;  2SOB A;  1F2M A;  2F0G A;  1SYG A;  1F2Z A;  3NHH A;  3OMG A;  4PNY A;  4N9P A;  4EQN A;  2F0N A;  4N9T A;  4KY7 A;  4F7X A;  5IOC A;  3MXP A;  4KJO A;  4RKL A;  5J39 A;  5EKK A;  3P75 A;  4DU9 A;  1II3 A;  2NUC A;  3QB3 A;  2EXZ A;  3SR1 A;  3BDC A;  5CV5 A;  3NP8 A;  2PW5 A;  4NMZ A;  3DHQ A;  2O4X A;  1EY0 A;  5CV6 A;  3SHL A;  1EZ8 A;  2ENB A;  2RDF A;  3D4W A;  4OL7 A;  4K5W A;  2F0J A;  1IHZ A;  1SNM A;  5JOB A;  1TT2 A;  2EY6 A;  2F0W A;  5EGT A;  5I9P A;  2KQ3 A;  1JOR A;  3BDL A;  1EY7 A;  1EYA A;  1A2T A;  3SXH A;  5C3X A;  5J1Z A;  1A3U A;  2EYO A;  1U9R A;  3TME A;  2OF1 A;  2PZT A;  4B9X A;  2F0K A;  2LKV A;  1SNQ A;  4KY6 A;  2F0F A;  1SYE A;  3MVV A;  4K14 A;  5I9O A;  4K5X A;  1JOO A;  5E1F A;  3S9W A;  4K5V A;  2F0L A;  1A3V A;  2HQE A;  4KD3 A;  1EYD A;  1EY9 A;  3OSO A;  4ID6 A;  5E3F A;  4RKB A;  2F0D A;  3NQT A;  4NDX A;  4EVO A;  4KV6 A;  5CV4 A;  4EQO A;  4QMG A;  5IGE A;  3P1H A;  1KDB A;  5CR3 A;  5CV8 A;  5ISR A;  5KGU A;  3LX0 A;  5KIX A;  3D8G A;  1NUC A;  1KAB A;  4KJN A;  1JOK A;  2PYK A;  3TP8 A;  1RKN A;  2F3V A;  3RUZ A;  2WAC A;  4ZQ3 A;  1NSN S;  2EYF A;  2F0I A;  3ERQ A;  4J1M A;  1STB A;  4ODG A;  4K8I A;  2OXP A;  1A2U A;  3NK9 A;  4KD4 A;  1JOQ A;  2RBM A;  4S3S A;  2QDB A;  2EYM A;  4NP5 A;  2EYJ A;  1EQV A;  5C3W A;  3OMC A;  3TP7 A;  1SNO A;  2PZU A;  1TR5 A;  3D6C A;  3QOL A;  4KTA A;  4ME5 A;  4PMC A;  5J22 A;  1SYD A;  4J6H A;  1A3T A;  5CC4 A;  2EYL A;  1EY6 A;  3PMF A; 
#chains in the Genus database with same CATH topology
 3M7G A;  2RHQ B;  1PRT B;  1JC7 A;  4EX5 A;  4WFN 3;  1IBK Q;  2QW7 A;  4IQZ A;  3E3X A;  4I65 A;  3QR8 A;  5IWA L;  1PH1 A;  2L12 A;  3S2D B;  2X6G A;  5JJK A;  4F88 A;  2K03 A;  2R7Z H;  3UDG A;  3B6Y A;  5IGC A;  3F2C A;  2L15 A;  4K8J A;  4OEM B;  3TBI B;  4B3R Q;  3GTG B;  2SNM A;  4K2L A;  2K7V A;  3DWQ A;  3EIV A;  2EPB A;  2HCC A;  1A63 A;  2JK8 A;  3CC4 A;  5C4Z A;  2O2L D;  4GNX B;  5HUR A;  1WTR A;  4KI0 A;  1EIH A;  2IT1 A;  2EY5 A;  2G9D A;  2KHI A;  4Z9C B;  3SK5 A;  5L37 A;  2B29 A;  3G6E A;  4A3D G;  1KDC A;  3GTP H;  1FGB D;  3MC0 B;  5KEE A;  4R4C A;  4A93 B;  4DR7 L;  1CFM A;  2UUA Q;  2B2U A;  2M2L A;  4NXN L;  1R4Q B;  1HR0 L;  3M4O H;  4A3K G;  1HXY D;  4DK3 C;  2N3S A;  4POF A;  2K5Q A;  2F0N A;  2JQO A;  3MWY W;  2WAQ E;  3PO3 H;  4RKL A;  3P75 A;  3QB3 A;  3NEL A;  1PH2 A;  2E2J H;  1E2W A;  1RTN A;  2EJM A;  5DM6 3;  3S14 H;  3WOF A;  1V9P A;  1C4Q A;  4A3I G;  1CT1 D;  5M5W B;  5C3E H;  4DV0 Q;  1E1T A;  2FJ2 A;  2WFW A;  3W2D A;  3TME A;  4B3T L;  1JQY D;  2PCF B;  5M5Y B;  2LKV A;  1TU2 B;  1YNX A;  3BG3 A;  2DY8 A;  4JBW A;  4YCW A;  4JI6 Q;  1E2Z A;  2UU9 L;  2A1A A;  1BCP B;  2NZH A;  1MGS A;  2NWG A;  2JSO A;  4LMQ D;  1VQB A;  4JI0 Q;  3BDO A;  2PPB C;  3OTO L;  3LX0 A;  4N8X 1;  1BVS A;  5M3F G;  1GM5 A;  4LF6 Q;  3HP3 A;  1CKN A;  1R9T B;  1B9N A;  2R93 G;  4NPS A;  2R7F A;  2RBM A;  2N88 A;  4NP5 A;  1IKM A;  1MSG A;  3DWP A;  2NZ1 D;  2PZU A;  5FOB B;  2JA6 G;  1KL9 A;  3H15 A;  4JI4 Q;  5CR3 A;  5M3F B;  2NVY B;  3S2H B;  4IUP A;  2A6H C;  1HNW Q;  2L9H A;  5IYD G;  5COY A;  1TS2 A;  3GTM H;  1H9S A;  1PYW D;  4IAL A;  3VDY A;  4JK1 C;  1E1O A;  4R4T A;  4GOP C;  4BY7 G;  4DR6 Q;  4JYA Q;  5HY6 A;  1GJX A;  3GP7 A;  5IP7 H;  5IT9 E;  4JI4 L;  1EEI D;  2B2W A;  1OXV A;  2ZTD A;  3F8T A;  3MXN B;  1IXR A;  4OIJ A;  4DUY Q;  4LF4 Q;  3BVG A;  1B70 B;  1RF2 D;  1PTO H;  1Q12 A;  1U4M A;  3G6J B;  1PHJ A;  4K6D A;  1RIP A;  2E5L Q;  3HOY G;  2JN4 A;  3DMU A;  1GUN A;  2D0O A;  2AUK A;  4KKT A;  4L5R C;  5C4X B;  4ZKC B;  1V43 A;  2JA6 H;  1YIT A;  1NTG A;  3VR2 A;  1X9N A;  1LT3 D;  1D1I A;  4H0L C;  4JC0 A;  2A68 D;  2XGT A;  2F0E A;  4K6L A;  1HZ9 A;  1GXD C;  2Q2T A;  4A3C G;  4A3E G;  3MXN A;  3SVM A;  4KY7 A;  2QKI C;  2D9U A;  2NZO A;  3L9A X;  4UP7 A;  3VR6 A;  3BDC A;  5JVG 3;  5LL6 X;  1L0W A;  3U4Z A;  1SE3 A;  1LV9 A;  5FKA C;  4C1N I;  1I5F A;  2LY7 A;  3EN2 A;  4G7H C;  3K0X A;  4QJF A;  3BYT B;  3J81 c;  1M90 C;  3KDF B;  1GD7 A;  2Z9H A;  3CQZ B;  2E2I H;  1GUW A;  3J81 j;  2IWH A;  3S17 H;  4ID6 A;  1Y1V H;  1D8L A;  2K32 A;  1AE2 A;  3NQT A;  3TS0 A;  1I4X A;  4JI1 Q;  1LAB A;  4ZKB B;  1KNA A;  1G51 A;  3NEM A;  1TY2 A;  2PYK A;  3CRK C;  2QEX A;  1GKH A;  2A74 C;  2A68 C;  3DM1 A;  4I7Z C;  1IW7 D;  5K36 H;  2DY7 A;  4DKA C;  3NK9 A;  4KD4 A;  3CC2 A;  4DV3 Q;  2QDB A;  1UE5 A;  3K5M A;  4KTA A;  4ALP A;  1UUP A;  2IHF A;  4HIO A;  4PV1 C;  2CH4 A;  1SE4 A;  3KDF A;  4LF8 Q;  1M8A A;  1BDO A;  3A55 A;  2OCE A;  3BJU A;  3E6Z X;  2CCZ A;  3I91 A;  2F4I A;  2F0V A;  3I4L A;  1L0X B;  2I5M X;  1STN A;  5IGD A;  2DJF C;  4X66 L;  4XDX A;  3PF4 A;  1HNW L;  5BN3 A;  2UXD L;  4GOP B;  2F0S A;  1TWC H;  3H0G G;  1STA A;  1SYC A;  3RZD H;  1NMF A;  2TSS A;  2QF7 A;  4JPB W;  1TWC B;  1B9M A;  1GVP A;  3A54 A;  4DR6 L;  4LFB L;  3RD4 A;  2UXC Q;  1IKL A;  1E0B A;  2JEB I;  2R7D A;  3AEV A;  4FDB A;  1STE A;  2YU9 B;  4WOR A;  4UP8 A;  2L55 A;  5M3F H;  3FKI B;  4HJ9 A;  1RD9 D;  3MXG A;  4LWC A;  1SYB A;  3VA5 A;  1G6P A;  2MHV A;  3TSS A;  2HT1 A;  1SJH D;  1LTR D;  5NUC A;  4XT1 B;  2A69 C;  3R3O A;  4DV2 Q;  1ET9 A;  1VQC A;  5E7N A;  5C0X G;  2A73 B;  1BCP D;  2PQA B;  3W5O A;  1TWA B;  3K58 A;  5CGK A;  4TQU S;  2AQ1 B;  3BZK A;  3K5O A;  3T53 B;  1ESF A;  3PO3 G;  2X6L A;  2UXC L;  2B2T A;  1OXX K;  2K28 A;  5IT9 c;  2OT2 A;  2UUA L;  1Z47 A;  3K81 C;  3GO5 A;  4JI3 Q;  4EQN A;  1KNE A;  2RQX A;  1YIJ A;  3F2D A;  5IOC A;  1KIX A;  2J7Z A;  2D5D A;  2VS1 A;  1FL0 A;  4TSS A;  1GUT A;  3S15 B;  4DR1 L;  5CV5 A;  3NP8 A;  5AJ3 L;  4CJ1 B;  2FMM A;  3M3Y B;  3U4V A;  5EGT A;  4NXM L;  2NVX H;  4FYD A;  3CU7 A;  5J1Z A;  1Y8O B;  3S1N H;  4YY3 L;  2VNU D;  5GAH C;  4ZRZ A;  5CMD A;  1NMG A;  1JOO A;  5EPL A;  3EFX D;  2IW3 A;  3LGJ A;  2CQA A;  2VB3 X;  4DXG A;  3J81 L;  5LL6 S;  1Q1B A;  1SBB B;  3CMA A;  1IL2 A;  3TP8 A;  1LTI D;  2JA6 B;  3JC6 6;  2SDF A;  1BKB A;  4ZLT F;  1IBL L;  1SSO A;  4A75 A;  1DON A;  1NCV A;  1PYS B;  3GV6 A;  4BA2 I;  4B3R L;  1V8Q A;  1ROD A;  4HJ8 A;  1K83 B;  5J39 A;  2HIX A;  1D5X C;  1K0R A;  2WKD A;  4FF3 A;  1YJN A;  5BN5 A;  4IZ8 A;  3PUW A;  4GN4 B;  3CRL C;  2K5W A;  4H13 C;  1YVC A;  4JI5 L;  1SYF A;  3PQI A;  1EWI A;  1D2B A;  2M9V A;  1U4P A;  4ZYS A;  5EBD A;  3A8K E;  1S4Z A;  3UI2 A;  1WYD A;  3D4D A;  4L5Q A;  2JEA I;  3VYS A;  1PZK D;  4MNO A;  4KN7 C;  5FLX E;  4DR7 Q;  2L1B A;  4KHP L;  4H44 C;  2D62 A;  1SLJ A;  2JA7 H;  4LUZ A;  3J80 L;  2KEC A;  4AQY L;  2PW7 A;  3D4R A;  1PFM A;  1B7Y B;  1XPU A;  2D0P A;  3CQZ H;  4OXP A;  4R1J A;  2E2I B;  3A56 A;  5GRO A;  3PUY A;  5G3L D;  2J4X A;  3STB D;  1Y8P B;  3SK6 A;  1LTL A;  1F9P A;  2XNA C;  1AW7 A;  3J81 E;  1LT5 D;  2WP8 J;  2RVL A;  1WFQ A;  4TRD A;  1LYL A;  1XMO L;  5KND A;  1SND A;  3CC7 A;  1F2M A;  4MTK A;  1SYG A;  1AZQ A;  4KHP Q;  3CXC A;  3RN5 A;  5M5X B;  4XYQ A;  1CUK A;  1SRO A;  3S1R H;  3FKI G;  4KJO A;  5EKK A;  1PDQ A;  4C56 C;  2VUM G;  4BY1 G;  3D4W A;  4OL7 A;  1JCK B;  2XSC A;  4O0A A;  2X69 A;  5LMU Q;  3GD7 A;  1EYA A;  5JPM C;  1Q82 C;  1SMY C;  1YNJ D;  3UE0 A;  1XWE A;  1D7Q A;  2KVM A;  3L0O A;  3T56 B;  3V05 A;  4RMF A;  1OXT A;  4JV5 L;  4A93 G;  1KQS A;  1QVF A;  2JA5 B;  5E1F A;  4GKK L;  2B2Y C;  4X65 L;  4IFD I;  1T9H A;  2E2H H;  3J7A V;  1MJE A;  1HZB A;  4YWM A;  1KDB A;  2E2H B;  1O80 A;  3OHX C;  2MUY A;  1NNX A;  3AMU A;  5C6A A;  4L63 B;  4X62 L;  4A3L G;  2K50 A;  2XIW A;  1KXL A;  1J6Q A;  1JB3 A;  4BBR H;  1SXT A;  3J7A F;  2ICI A;  1SNO A;  5ELB A;  4A3I B;  4B3T Q;  2YV5 A;  2VZA A;  3E9I A;  4UAI A;  2R93 H;  2O5J C;  1LT4 D;  2E75 C;  4OON A;  1AP0 A;  1YHB A;  4DAM A;  3GTK H;  1U4L A;  5EKL A;  1VQJ A;  1HQR D;  4OEL B;  2B2U C;  4QB4 A;  4A3F H;  1XYI A;  2BE5 D;  4X66 Q;  5FLM H;  5IYC G;  4G57 A;  4B9W A;  2E74 C;  5C3E G;  5A2Q E;  1A62 A;  1Y1V G;  2B8G A;  1QNU A;  2JP1 A;  1S5B D;  4QUC A;  3GTL B;  4X3K A;  1UNS A;  4LJZ C;  5M9O A;  3NTH A;  4DR3 Q;  1RCV D;  4OWT B;  5T1I A;  1TII D;  1XPO A;  1XNQ L;  3H6M A;  3ZYY X;  4EQP A;  1SNP A;  1TWF H;  5ELC A;  3J80 c;  1BF4 A;  2YYZ A;  4L6T B;  2Q8I B;  1FD7 D;  2EYH A;  5C0X H;  2ZM6 L;  3EJI A;  1EYG A;  2R92 B;  3JAM E;  5I4D A;  2DNE A;  2A5H A;  1U5K A;  3RZO H;  4C3H H;  2Q2U A;  5BN4 A;  2NTT A;  2B2Y A;  3T4A C;  2XWB B;  4J8Q A;  2XRS D;  3TEH B;  3AFQ A;  3FVQ A;  3HOV B;  1JT8 A;  2CFM A;  2PI2 E;  3M9B A;  1V1P A;  2HDM A;  4O42 A;  3PIP 3;  2BH2 A;  4A3L H;  4F7X A;  3C2P A;  5G3L F;  2JA7 G;  5EPJ A;  1XPR A;  2OQK A;  4R4I A;  3I72 A;  5FJ8 G;  1MJC A;  4A3B B;  2SEB D;  5CV6 A;  3SDZ A;  2ZJR A;  4POG A;  2F0J A;  4DR1 Q;  4GLA C;  3CCJ A;  1Q86 C;  3BDL A;  1EY7 A;  1FNW A;  2K4K A;  3BYY B;  2R6G A;  1QIL A;  1EQQ A;  4LUV A;  1SNQ A;  5EBC A;  2Q8T A;  1K3R A;  2KCM A;  2WB1 G;  1SE8 A;  1OXS C;  2F0L A;  3GDE A;  3H91 A;  4DR4 Q;  5FO8 B;  1QWY A;  2VL6 A;  3IKJ A;  2F0D A;  2B2V C;  4QMG A;  3KLW A;  2ZJP A;  4IJL A;  5CV8 A;  4KJN A;  1JOK A;  1BQQ T;  5JEA H;  4DV5 L;  3RUZ A;  2WAC A;  1NSN S;  4A3B G;  3CP0 A;  1J9O A;  1X56 A;  5FO9 B;  1CKO A;  4JVZ A;  3FDT A;  3HOX H;  2EYJ A;  5C3W A;  4L8J A;  1T5E A;  4LFB Q;  2NVX B;  1FJG L;  2EYL A;  2EE1 A;  1P8L A;  3OIP A;  1GHK A;  4QIW E;  2YU9 H;  4UP9 A;  1JMC A;  3U9O A;  4DNI A;  5IT9 L;  1QE6 A;  1CKN B;  4LUO A;  1Q1E A;  3K8A A;  3K7A H;  1ICF B;  4JI1 L;  1CKM A;  1HCZ A;  3GTO B;  1ILQ A;  1WJJ A;  2NB0 A;  1WTP A;  3HOX B;  4RGM A;  1YBY A;  1E7Z A;  4DR2 L;  1WCM G;  3DWA A;  4YHH Q;  1TWA H;  1XXG A;  1TQO A;  2R61 A;  1ONL A;  3D6W A;  3S16 H;  1B44 D;  3I3C A;  1BXT A;  1H95 A;  2ALY B;  5IGF A;  2ZT9 C;  2SNS A;  1XNQ Q;  1MD2 D;  1YZ6 A;  4PZ8 A;  2MO0 A;  4HJ5 A;  1K0S A;  3CHB D;  5EKI A;  3HGB A;  3HOV G;  3OW2 A;  3L2P A;  4N8F A;  1CSP A;  2F0T A;  3KOJ A;  1KLU D;  1N36 L;  2OTJ A;  2MJ8 A;  1ILP A;  5CV7 A;  3E5S A;  1K3B C;  3CCS A;  2Z4I A;  2E2J B;  4IO9 A;  2A19 A;  3RZD B;  4AYB G;  2GVA A;  3GTG H;  3L7Z C;  2HD3 A;  4MN3 A;  5CBE E;  4XTC S;  2EXZ A;  1SFO H;  2Z6K A;  2PMZ E;  1QVG A;  3NEN A;  2EY6 A;  1VMP A;  2ZTE A;  1IBM Q;  2L4N A;  3ULL A;  5D14 A;  1PXU A;  1YNN D;  1IBL Q;  1UEB A;  1GUS A;  1D6E C;  2QGQ A;  1ASZ A;  3CCE A;  1CHP D;  4A76 A;  5M3M G;  3U50 C;  1EY9 A;  1ESR A;  4DR4 L;  4AYB B;  3G7L A;  1ML0 D;  3HKZ B;  1NAP A;  3EQL C;  2F3V A;  2R7Z G;  1O7Y A;  5LHY 1;  4C3J G;  3HOZ H;  1X32 A;  4JI6 L;  1EQV A;  2PQA A;  3TP7 A;  2OQ0 A;  3CCU A;  4IPG A;  5JAV A;  4A3M G;  3S2D H;  4JBJ A;  4KLK A;  2BA0 A;  2ZTC A;  4XQJ A;  2MNA A;  1RDP D;  3PCO B;  4IUN A;  2Z4H A;  1R4P B;  3LNN A;  1JE4 A;  1BCP F;  1MKH A;  1QUQ A;  2VQE L;  4A3B H;  3R93 A;  3S9W A;  3Q0A A;  5FLM G;  3GTO H;  4A3G H;  4C1N K;  4WRD A;  3M4O B;  2E8G A;  4NW2 A;  1N9W A;  3TS2 A;  1EEF D;  1O7L A;  1IYU A;  3N6R A;  4JI8 Q;  4PMB A;  4PMW A;  1S5C D;  3GTP B;  4I7A A;  3S1M B;  3X3N A;  3I8Z A;  3ERO A;  1HA6 A;  5IIF A;  2A6H D;  4DPG A;  1KDA A;  1F2Y A;  3HEJ A;  1I4R A;  3FEW X;  3A0J A;  2WKC A;  3E0E A;  1ET6 A;  4B3M Q;  1Y1W G;  5H1S E;  1YHQ A;  4HR7 B;  1Y1V B;  4JI8 L;  3S17 B;  4MIU A;  4UHV A;  1VQ6 A;  1HFN A;  3VR5 A;  4IOA A;  4IN3 A;  2K52 A;  3MXP A;  3GTJ B;  3IFT A;  2BCO A;  4OO1 H;  4LF7 Q;  1M4V A;  4IUT A;  3KBG A;  1EY0 A;  2K5D A;  2Z6K C;  4BY1 H;  4NXM Q;  1XMQ L;  2R3Z A;  2K75 A;  4Q5V A;  3GTK B;  3CPF A;  4HN7 A;  1A3U A;  5GAG C;  4B08 A;  2LSS A;  2R92 G;  2B39 A;  4P71 A;  4K5X A;  3KFU A;  3JAM L;  4A3I H;  3KLS A;  5JJL A;  2HQE A;  4LF9 Q;  1X54 A;  3HOV H;  2K5N A;  3K0Y A;  1VQP A;  1E3P A;  4XT3 B;  4RKB A;  3MFG A;  3TQY A;  2UXB Q;  2CW0 D;  3P1H A;  4DR5 L;  4PG3 A;  1U4R A;  2KCC A;  5C4H A;  1YNN C;  2F0I A;  3NQI A;  1SE2 A;  1WTW A;  4CBV A;  1BBX C;  1L1O A;  1B53 A;  5M5Y H;  1TWG B;  2NYZ D;  4DK0 A;  4GLV B;  4Y52 H;  4RCO A;  5A2Q L;  3CW2 C;  3I4N G;  1EY6 A;  3I4M H;  2Z0S A;  4R8I A;  5IGB A;  3S14 B;  5M3M H;  1H9S B;  3H94 A;  1PRT C;  1SEB D;  4JCV E;  4LAA A;  5HGQ A;  2UUB L;  4MTN A;  2C35 B;  2WB1 B;  1WCM B;  4CGY B;  3CF5 A;  3KBX A;  1X3F A;  1G91 A;  3X3M A;  5C5L A;  4HMI A;  1B4O A;  2ZM6 Q;  4V19 0;  2DGY A;  2G9H D;  3PSI A;  1EIY B;  1LTS D;  2A6E C;  4MZ9 A;  2NVY H;  3S2H H;  1QJO A;  1EFI D;  2AUJ D;  4LFA L;  2FHT A;  1TY0 A;  2NN6 G;  3R2I A;  4PZ6 A;  3SK4 A;  1X3G A;  4OIK A;  3N52 A;  4GNX C;  2I46 A;  1ZKO A;  4FXK C;  5KNC A;  2BOS A;  4A3G G;  3D3R A;  3GQB A;  2MFI A;  1C9O A;  4G7Z C;  1EU4 A;  1IYV A;  1EQT A;  4OO1 G;  3J7A 5;  4BA1 I;  5DEH A;  5E4X A;  4FXD A;  1Y69 U;  4KK7 A;  4BY1 B;  5C5M A;  3OPO A;  1BNZ A;  3NSW A;  2AHO B;  3R8B A;  3EA6 A;  3S15 H;  3CD6 A;  3VR3 A;  1W6K A;  2G5D A;  1PH9 A;  1JJ2 A;  2JXM B;  1UAP A;  4NMZ A;  3SHL A;  4X3S A;  2RDF A;  1WTV A;  3I4M G;  1N8R C;  4O1N A;  2KA7 A;  1I4Q A;  4GLX A;  4PZ7 A;  2QA4 A;  3J81 i;  1SYE A;  4APV A;  2WAQ B;  3IL8 A;  2RCF A;  3RN2 A;  3TDQ A;  1A3V A;  3VA7 A;  3HOZ B;  2ATW A;  1HNZ L;  5CV4 A;  1XTC D;  5E4W C;  5KGU A;  2L0C A;  4R9W A;  4IUR A;  1WD1 A;  2LXJ A;  3KJP A;  2GVB A;  2L11 A;  3IAY A;  1GHJ A;  1X3P A;  4ABN A;  3G71 A;  3D6C A;  4A3K H;  1VQ5 A;  4XXE A;  4A3E B;  3RLN A;  5EAY A;  4HIM A;  2RHS B;  3A7A B;  2WIN B;  2A8V A;  1VF5 C;  1EU3 A;  2K33 A;  1J5E L;  1PLF A;  3C1E A;  1HJP A;  4KHV A;  1ENA A;  3OW7 A;  1VQG A;  4QGU A;  1GUO A;  4X6A H;  1L2F A;  5ELF A;  1PMR A;  3ULP A;  2YTV A;  2UUC Q;  3C1F A;  5DM7 3;  5IYB H;  1B50 A;  2C5C A;  1B2T A;  1FJG Q;  4GZY C;  2RCN A;  4RH6 A;  1PZI D;  3V2T A;  5I6W A;  1ENF A;  3NTK A;  2MGS A;  5C4X H;  4NB3 A;  1DZ1 A;  1B3Q A;  5JPN C;  2M00 A;  2UUC L;  2PO4 A;  3HOW G;  4DAY B;  2AQ3 B;  4FF2 A;  4JV5 Q;  1Q7Y C;  1TWH B;  3K7U C;  2B2V A;  4FP5 D;  4A3J H;  4GKK Q;  3KUP A;  1YJ9 A;  2CQO A;  1DM0 B;  4PNY A;  4IUU A;  5DNF A;  4C2M H;  1G29 1;  4C3H G;  3Q22 A;  1JB7 A;  2HUG A;  3HFZ B;  3FHW A;  2CWA A;  3RLO A;  3Q23 A;  4IFD G;  1ZYR D;  4EQ5 A;  1VF7 A;  1W6J A;  2QIL A;  4HSV A;  3J7Z C;  3I56 A;  4A3M H;  4KKU A;  1XNR L;  3NBI A;  2JA9 A;  1AN8 A;  2IJ0 A;  3WOE A;  5C3X A;  1VQF A;  4YCU A;  4IUV A;  3S1R B;  2NVT B;  4K14 A;  1HR0 Q;  1BUV T;  3QWN A;  3J80 i;  3QIA A;  4DAP A;  3OYY A;  4GOP A;  1P16 A;  1H9M A;  4KV6 A;  4A3F G;  4BWG B;  1D5Z C;  1OO9 B;  4BBS G;  3C3L A;  3S16 B;  4IPD A;  2ZJQ A;  4DU9 A;  1NUC A;  2FIN B;  4HED A;  5EPK A;  1B8A A;  1LTG D;  4K8I A;  1K8O A;  1Q3L A;  3CCV A;  4DAY A;  1NY4 A;  2EYM A;  5C44 B;  1VS0 A;  1VQO A;  4F87 A;  1G2S A;  5J22 A;  4H02 A;  1I6H B;  4J6H A;  1A3T A;  2B8F A;  1K8G A;  3V96 A;  2JA7 B;  4IPC A;  1HRJ A;  3R2T A;  1XX8 A;  2WAQ G;  4OX9 Q;  1RHP A;  2V4D A;  4CKE A;  3IRB A;  2HCI A;  1FR3 A;  3A8I E;  3PUX A;  3UE1 A;  1VQ7 A;  2YTY A;  4CDC C;  2F0H A;  5IGG A;  1N34 Q;  1AFP A;  5I6Y A;  5C44 H;  1RL2 A;  3M85 A;  5IP7 G;  2KCN A;  1TS4 A;  1EY5 A;  2K04 A;  3T13 A;  3SK8 A;  3T51 B;  3KLS X;  2EVB A;  2C9O A;  4DR2 Q;  2XVS A;  2EJF C;  5C4J B;  3L3O C;  2B2T C;  3JAM c;  4MHE A;  2XRQ D;  3RZO B;  2K01 A;  4JBK A;  2I5H A;  1JJG A;  5IP9 H;  4RA8 A;  4DF7 A;  2F0M A;  1STG A;  4IUQ A;  1MBY A;  1CSQ A;  5I2X A;  5F2D A;  1C0A A;  4DUY L;  4RG1 A;  1L1O C;  4R8N A;  4HSP A;  4DV6 Q;  3QOJ A;  3RMH A;  1X65 A;  2ASB A;  3AYH B;  1M1K C;  2O5I C;  1X6O A;  1BR9 A;  2Q2H A;  3K7A B;  1XNR Q;  3PUZ A;  2DJG C;  3ER0 A;  4RFB A;  1KTK A;  2PW5 A;  2N8N A;  1IL8 A;  3HRZ C;  1IHZ A;  4QY7 A;  2F4V Q;  3M3Y H;  4JOI C;  2HHH Q;  1OTC A;  5LMN L;  3HOY H;  1DXM A;  3HKZ G;  2UU9 Q;  2R92 H;  4KY6 A;  1FGU A;  3MVV A;  1FVI A;  1LM0 A;  4JG2 A;  5JEA G;  5IP9 G;  2OWO A;  3MTS A;  4LK1 C;  3CKI B;  1F9R A;  2I07 B;  4EVO A;  3HOU G;  1DJR D;  1LLR D;  4CDF C;  1UE1 A;  4JI0 L;  5KIX A;  1JWS D;  3ERS X;  1SMX A;  1A6X A;  4ZQ3 A;  4HCE A;  3CME A;  2K05 A;  5IE8 A;  3H09 A;  4KN4 C;  2HHH L;  2TMP A;  1HPC A;  2BH8 A;  3QOL A;  2RF4 A;  3S1M H;  4CHT B;  3TRZ A;  4ZUJ A;  1Z9F A;  4OO1 I;  2CVR A;  1IYJ B;  3H0G B;  4RHR A;  5IY0 A;  3OIQ A;  4HJ7 A;  2CWP A;  1FNU A;  1KAW A;  5M3M B;  1SFO B;  3FP9 A;  1NR2 A;  2K5H A;  2F0Q A;  3I55 A;  1N34 L;  3MEH A;  1NJI C;  2EIF A;  1SJE D;  4BBR B;  4DV7 Q;  1KLG D;  1DOL A;  4DR3 L;  2NN6 I;  3E9H A;  3M4Y A;  3FMC A;  2KJX A;  4JI3 L;  4F8M A;  1C8C A;  3DLL A;  1KRS A;  4A93 H;  3A5Z B;  4RHS A;  4AYB E;  2LFN A;  5K36 G;  1CZW A;  3PO2 G;  1I6H H;  4C3I B;  4GKJ Q;  5IOD A;  5AJ3 Q;  4G7O C;  2EYP A;  3NPP A;  4AQY Q;  1G8Z D;  1CA6 A;  1YEZ A;  5C4J H;  2EY2 A;  2UXD Q;  1MIU A;  1I3Q H;  1VDZ A;  2E76 C;  4YY3 Q;  3A8J E;  3PO2 B;  4RWS C;  3W1G A;  4B3M L;  4U68 A;  4GKJ L;  5IYC H;  4NXN Q;  5EJW A;  3K80 C;  1EWH A;  4DV2 L;  3TZU A;  1C7Y A;  4A3F B;  2XWJ B;  2AQ2 B;  1I4P A;  5M5X H;  1B3A A;  2VQF Q;  1W3S A;  2F4V L;  3JAM i;  2KBN A;  3DHQ A;  1HTP A;  2O4X A;  2E2D C;  5GQO A;  1N36 Q;  2VXW A;  3F2U A;  4LF5 Q;  2VB2 X;  3MFY A;  4DK6 C;  5C0X J;  4PQX A;  1CM9 A;  1BOS A;  2EYO A;  1U9R A;  4GN5 A;  4O2D A;  1PRT F;  1K83 H;  1Q90 A;  3I73 A;  2YTX A;  4DAV A;  3HS0 C;  4GN3 B;  1HNX L;  1G2T A;  4A3J B;  4JBM A;  2ES2 A;  2K5V A;  2EXD A;  4CKB A;  1DOM A;  1QB5 D;  5IGE A;  2Q2I A;  2LMC B;  1PFN A;  4X65 Q;  4C3H B;  2KHJ A;  2K1B A;  3D8G A;  1CQF A;  2ID0 A;  3I7F A;  5TSS A;  4DV4 Q;  1HUM A;  3I4N B;  4J1M A;  1QVC A;  4KKS A;  3I90 A;  3SGI A;  1DYQ A;  3VYU A;  1WD0 A;  4FF1 A;  3G4S A;  1TWF B;  4DUZ Q;  2D2C C;  4ZAI A;  1HNX Q;  4XQQ A;  1N33 Q;  3J7Y W;  1PH6 A;  3S1N B;  3ND8 A;  4P75 A;  2B2W C;  3G48 A;  4KY5 A;  1KRT A;  3HG9 A;  1N32 Q;  3I4M B;  2NBF A;  1HNZ Q;  2UUB Q;  1EY8 A;  1WOC A;  4DV7 L;  2MPM A;  2V1C C;  2JJQ A;  3ITP A;  2VY3 A;  2R7Z B;  3D0F A;  1LUZ A;  5FJ8 H;  2MP1 A;  1PTO D;  1VQL A;  4DUZ L;  1JWM D;  2PZW A;  1DCZ A;  1LT6 D;  1EIG A;  1AEX A;  3PO2 H;  3HOZ G;  2QDL A;  2F0O A;  3NUC A;  2WII B;  2F52 A;  1S3O A;  5BR8 L;  3K59 A;  1EUJ A;  4OGQ C;  4FO2 A;  1ZXT A;  1R9T H;  2CHB D;  2KHS A;  1I50 B;  2RDG A;  1QZG A;  1Z7T A;  1KC8 C;  2F3W A;  5JVH 3;  1SDF A;  3HOY B;  3URY A;  1I94 L;  5CBA E;  3GTL H;  1STH A;  1H9K A;  1O7Z A;  4DV0 L;  5BR8 Q;  5KYL A;  2F0G A;  3NHH A;  3H3V H;  1WVL A;  4JI7 L;  1D5M C;  2FMC A;  5AFW A;  3DEP A;  3T1Y Q;  3CPW A;  4FXG C;  1VQ9 A;  2B63 H;  1LO5 D;  1LTA D;  4DNR B;  2CH4 W;  3RLF A;  3RNU A;  4K5W A;  1CTM A;  5JOB A;  1TT2 A;  5C44 G;  4B3S L;  1JE5 A;  4U67 3;  1E22 A;  4IOC A;  1Y1W B;  4X62 Q;  3MXU A;  4B9X A;  2F0K A;  1DOK A;  4JI7 Q;  3O13 A;  2F0F A;  4IFD J;  1PZJ D;  4OWX B;  3Q8D A;  3E0J A;  3S24 A;  1EYD A;  2KED A;  4C3I H;  2NVQ B;  3CCQ A;  4EQO A;  1A0I A;  4QUF A;  1F2L A;  2NVQ H;  1CI3 M;  1FYC A;  2IPK D;  5FK9 C;  4WJ4 A;  2BE5 C;  3IFD A;  3CCL A;  4DV4 L;  1JOQ A;  3KF6 B;  2KCT A;  1QCB D;  3KYH C;  3F2B A;  3KF8 B;  3OMC A;  1QOH A;  1PRT D;  1HA5 A;  1S5F D;  1OXU A;  2AWN A;  1EL0 A;  2K6A A;  2IX3 A;  1RJT A;  1IBK L;  2JYO A;  2ICE C;  1NR4 A;  1S5D D;  3TZD A;  4JW0 A;  2B63 B;  4LFC L;  4FVM A;  3T1H L;  1TS3 A;  1EYC A;  4X3T A;  2BDO A;  1L1O B;  1UWV A;  3ND9 A;  4DGZ A;  1QZH A;  2F0P A;  2I0Q A;  1X3Q A;  1UEA B;  2KOL A;  3AB9 A;  4X3U A;  4DNT B;  1I4G A;  1BCP C;  5KYI A;  2B63 G;  4YWL A;  4UY8 C;  4UPA A;  1WTH A;  2A69 D;  3HKZ E;  2EQS A;  4HTH A;  2KUM A;  2GN5 A;  1EZ6 A;  3MZ5 A;  1EOV A;  2WB1 E;  5I2Y A;  4DV6 L;  5EQ0 A;  1Q46 A;  3TP5 A;  1S72 A;  2PI2 A;  4LFC Q;  2DUD A;  2KEN A;  4C3J B;  3BVM A;  1C48 A;  3KF8 A;  3UDX A;  5JJZ A;  3DEO A;  4DFA A;  5FLX c;  5C4X G;  4HMJ A;  4GNX A;  4IJH A;  1KAA A;  2RSN A;  1QNK A;  5K5P A;  4X64 Q;  4E6I A;  1G6Z A;  2SOB A;  1F2Z A;  1E24 A;  3OMG A;  1F9Q A;  3U58 A;  3A5U A;  4IPH A;  1O7I A;  3FRP B;  1HZC A;  1II3 A;  3FPU B;  4C2M B;  3SR1 A;  3ONA B;  1EIF A;  3SEB A;  3BZC A;  5GAE C;  3H0G H;  1I4H A;  3NBH B;  4RGT A;  3D31 A;  1SNM A;  1JOR A;  4GS3 A;  3SXH A;  1A2T A;  4DV5 Q;  1JR0 D;  4LNQ A;  2AKW B;  4CJ2 C;  2BDN A;  1AZP A;  3PF5 A;  4BS9 A;  4HJA A;  1Q8I A;  4DR5 Q;  4BXX G;  3OSO A;  5E3F A;  1F77 A;  1Y14 B;  5D65 A;  1EWC A;  4ZK9 B;  2F3I A;  3NTI A;  1CQV A;  3Q6S A;  3OWE B;  2FXQ A;  1HH2 P;  1KAB A;  4J15 A;  4XYO A;  2EYF A;  2OXP A;  1PV4 A;  1SRU A;  3HOU H;  4TKO B;  3SE0 A;  1TR5 A;  1MSH A;  3S1Q H;  3PMF A;  2NVT H;  2EY1 A;  3M4P A;  1NBW A;  1O78 A;  4YCV A;  3TP6 A;  2PNR C;  1Z6H A;  4M8A A;  1BO0 A;  1PTO F;  4CDD C;  1PH8 A;  1AH9 A;  2GA4 B;  5C3E B;  4QIW B;  1J8I A;  4KMU C;  3I2Z A;  1U0L A;  1K9M C;  2IX1 A;  5D3D A;  3T1H Q;  1EOT A;  4A3E H;  5KNB A;  1N32 L;  2RKS A;  3H3V I;  1HFG A;  4JYA L;  4P2C B;  5KRU A;  4RAU C;  3KF6 A;  3A74 A;  2HDL A;  3STB C;  5LMN W;  4P74 A;  3ULJ A;  4LF4 L;  4A3D H;  3MHB A;  4L5S A;  3U9S A;  1DGS A;  1ZYR C;  1CA5 A;  1YHA A;  2JA5 G;  3DM3 A;  4JOI A;  4R4Q A;  1K28 A;  1PFB A;  4YIJ A;  5IYB G;  3ICE A;  1GUG A;  1H9J A;  2HIV A;  5DAU A;  3PUV A;  1ENC A;  3KJO A;  3W1B A;  4YHH L;  4OWW B;  4A4I A;  4Q0F A;  4IFD H;  1WTO A;  3QJY A;  1IBM L;  4A3D B;  4A3M B;  3NWS A;  3NXW A;  1FNV A;  4CKC A;  4CDE C;  2AMC B;  4N9P A;  1NE3 A;  1PVO A;  4DN4 M;  1PFS A;  1GO3 E;  3PO3 B;  3OTO Q;  4LW1 A;  2NUC A;  1XTD A;  2H5X A;  4JI2 L;  4XIG S;  3EBE A;  4BY7 H;  3T1Y L;  1EZ8 A;  1TWH H;  4BY7 B;  2NN6 H;  3BU2 A;  3ZJY C;  5I9P A;  2KQ3 A;  3GTM B;  2MQH A;  3RR5 A;  1GOZ A;  1VQA A;  1MHW C;  2OF1 A;  4K0K Q;  1IZ6 A;  3HOU B;  1K8A C;  3K57 A;  1TXY A;  1VQ4 A;  1UE6 A;  4JI2 Q;  2PNH A;  1CK1 A;  1V1P B;  5C0X I;  5GAD C;  1L0Y B;  1SAP A;  1H9R A;  1QG7 A;  2RSO A;  2F03 A;  2H1E A;  3BS1 A;  4TVA B;  3ERQ A;  1PH5 A;  4HCS A;  1HR0 W;  1A2U A;  2MO1 A;  1PH7 A;  2CKZ B;  3C46 A;  2ZXR A;  4G4K A;  5ELO A;  2IL8 A;  2B3G A;  5CC4 A;  1LTB D;  2Y0S B;  1JWU D;  2F0U A;  1PTO C;  5ELE A;  2H4O A;  2I5L X;  4ZCK A;  2OTL A;  3VYT A;  3W3A A;  3I70 A;  2PQE A;  1VQI A;  3HOX G;  1HZA A;  1A8V A;  4QL5 A;  4NKL A;  5D3I B;  2LS0 1;  3S1Q B;  3CAM A;  4ZUI A;  3OOC A;  4A3K B;  1S5E D;  2Y0S G;  1AE3 A;  4ILW A;  3NE5 B;  1WTX A;  1A15 A;  1JIC A;  2N78 A;  4KHZ A;  4OX9 L;  1VQM A;  2K14 A;  2ZXP A;  5T1G A;  4A3J G;  3TN2 A;  3GV3 A;  4WJW A;  3KK7 A;  1VQH A;  4C3J H;  4RGN A;  4A3C H;  5ELD A;  2VQE Q;  1VQN A;  3GTQ B;  5IYD H;  1ZEQ X;  3WDN A;  1I6V C;  4HID A;  2WV6 D;  3EVQ A;  1TKW B;  4K2K A;  1TVX A;  3VR4 A;  4DV1 L;  5HGT A;  4UDU C;  4QQB X;  1VQE A;  3QO2 A;  1HTL D;  4EGV A;  1KHI A;  1SNC A;  4RGO S;  1PYB A;  1SR3 A;  4ULL A;  5LMU L;  1X55 A;  2N49 A;  4YWK A;  4QF4 A;  2JE6 I;  1MI2 A;  1W2B A;  4AIM A;  2E5L L;  3P20 A;  1PH3 A;  2JA8 B;  2EDG A;  1WTQ A;  2VQF L;  4BBS H;  3H3V C;  5JEA J;  4P73 A;  4DV1 Q;  3MAQ A;  4LF9 L;  1VQD A;  2J0T D;  1V1O A;  1D1K A;  3UDI A;  3FPP A;  3PGZ A;  2LXK A;  2ENB A;  4M1U B;  2R93 B;  2RA4 A;  4DV3 L;  1HQM C;  3MA2 B;  1PA6 A;  1VQK A;  2F0W A;  2QCP X;  1Q81 C;  2XTI A;  3BVZ A;  1Y8N B;  1EQR A;  5A35 A;  1IW7 C;  5CYU A;  4LF8 L;  2XN9 C;  2PZT A;  3MEF A;  4LF5 L;  3F1Z A;  4K0K L;  2EOT A;  3A7L A;  1XMO Q;  4K5V A;  4KD3 A;  4XQN A;  4Y7N H;  2DN8 A;  2ZXO A;  3KLR A;  4ME3 A;  4NDX A;  2DNC A;  5COR A;  4QCL A;  1VQ8 A;  1CZG A;  2IHE A;  4AH6 A;  4FF4 A;  3AFP A;  1RKN A;  5ISR A;  2JA5 H;  4ODG A;  1STB A;  1YJW A;  1PH4 A;  1XMQ Q;  3CCR A;  4A3G B;  3QG1 A;  4B3S Q;  1Q8K A;  4PMC A;  4ME5 A;  3J80 E;  1PTO B;  3TRE A;  2UXB L;  2CW0 C;  3DUZ A;  1LAC A;  3WWV A;  5J3B A;  5FLX L;  5ELN A;  3HZX A;  5IWA Q;  2OEO A;  1J5E Q;  2F1M A;  4BBR G;  4DK1 A;  3LWE A;  1LTT D;  4JI5 Q;  3M4Q A;  1SMY D;  1YNJ C;  3LWU A;  3PV0 A;  5JJI A;  4DXF A;  1JJC B;  2RDH A;  4BBS B;  2EJG C;  1VCI A;  4WJ3 M;  1KD1 C;  2Z8L A;  4C3I G;  1EFW A;  4OHJ A;  1I50 H;  2Y0S E;  4X64 L;  3M7N A;  1X3E A;  2QEJ C;  1STY A;  1YI2 A;  2Z6B A;  3OWF A;  1B1Z A;  1BBW A;  1I3Q B;  4H7B A;  5CV9 A;  2EZV A;  3NWT A;  2HQL A;  1SN8 A;  3Q24 A;  3T16 A;  3CCM A;  3K5N A;  4FNF A;  2N55 A;  3P7J A;  1K73 C;  3GTQ H;  4BXX H;  1TS5 A;  3HOW H;  3AQQ A;  1CHQ D;  2L5T A;  1VMC A;  4R4O A;  3FKI H;  1I94 Q;  1E2V A;  4LFA Q;  1BBU A;  2Z1C A;  1EY4 A;  2VUM H;  4LF7 L;  4N9T A;  1ASY A;  3HKS A;  4RCN A;  5FO7 B;  3GTJ H;  2A6E D;  1Y1W H;  1V1Q A;  3PIP A;  2PMZ B;  2VW9 A;  2JA8 H;  1WI5 A;  3AU7 A;  1WCM H;  3UDF A;  1RTO A;  5M5W H;  1T5X D;  5LMN Q;  4HIK A;  3NBH A;  3I4O A;  1ICW A;  4DA2 A;  3K5L A;  1HUN A;  1N33 L;  1TWG H;  2NTS A;  3PIO 3;  4V0B A;  2Q8R E;  5I9O A;  2P5Z X;  2VUM B;  3I4N H;  2FFK B;  2KEE A;  3BZD B;  1UE7 A;  1XJV A;  2IX0 A;  2JA8 G;  4LF6 L;  1DD2 A;  2BA1 A;  1QUQ B;  4Y7N B;  1HHV A;  1F9S A;  3HOW B;  3VYR A;  1K8M A;  5DLQ E;  2IY5 B;  2AWO A;  4S3S A;  3K6O A;  4L5T A;  4P72 A;  1S40 A;  3DXJ C;  1SYD A;  4HAE A;  3PIO A;  4CJ0 B; 
#chains in the Genus database with same CATH homology
 3M7G A;  1PRT B;  1JC7 A;  4WFN 3;  4IQZ A;  4I65 A;  2L12 A;  3S2D B;  2X6G A;  4F88 A;  2K03 A;  5IGC A;  4K8J A;  3TBI B;  3GTG B;  2SNM A;  4K2L A;  2K7V A;  3DWQ A;  2EPB A;  2HCC A;  5C4Z A;  2O2L D;  5HUR A;  1WTR A;  4KI0 A;  1EIH A;  2IT1 A;  2EY5 A;  2G9D A;  4Z9C B;  3SK5 A;  1KDC A;  1FGB D;  3MC0 B;  5KEE A;  4A93 B;  1CFM A;  2B2U A;  2M2L A;  1R4Q B;  1HXY D;  2K5Q A;  2F0N A;  3MWY W;  4RKL A;  3P75 A;  3QB3 A;  1E2W A;  1RTN A;  2EJM A;  5DM6 3;  3WOF A;  1C4Q A;  1CT1 D;  5M5W B;  2FJ2 A;  3W2D A;  3TME A;  1JQY D;  2PCF B;  5M5Y B;  2LKV A;  1TU2 B;  3BG3 A;  2DY8 A;  4JBW A;  1E2Z A;  1BCP B;  1MGS A;  2NWG A;  2JSO A;  4LMQ D;  3BDO A;  2PPB C;  3LX0 A;  3HP3 A;  1R9T B;  1B9N A;  2RBM A;  2N88 A;  4NP5 A;  1IKM A;  1MSG A;  3DWP A;  2NZ1 D;  2PZU A;  5FOB B;  5CR3 A;  5M3F B;  2NVY B;  3S2H B;  4IUP A;  2A6H C;  2L9H A;  5COY A;  1TS2 A;  1H9S A;  1PYW D;  4IAL A;  4JK1 C;  1GJX A;  3GP7 A;  5IT9 E;  1EEI D;  2B2W A;  1OXV A;  4OIJ A;  3BVG A;  1RF2 D;  1PTO H;  1Q12 A;  1U4M A;  3G6J B;  4K6D A;  3DMU A;  1GUN A;  2AUK A;  4KKT A;  5C4X B;  4ZKC B;  1V43 A;  3VR2 A;  1LT3 D;  1D1I A;  4H0L C;  2A68 D;  2F0E A;  4K6L A;  1GXD C;  3MXN A;  3SVM A;  4KY7 A;  2QKI C;  2D9U A;  3L9A X;  3VR6 A;  3BDC A;  5JVG 3;  5LL6 X;  1SE3 A;  1LV9 A;  5FKA C;  4C1N I;  2LY7 A;  4G7H C;  3BYT B;  3CQZ B;  1GUW A;  2IWH A;  4ID6 A;  2K32 A;  3NQT A;  1I4X A;  1LAB A;  4ZKB B;  1KNA A;  1TY2 A;  2PYK A;  3CRK C;  2A74 C;  2A68 C;  3DM1 A;  5K36 H;  4I7Z C;  1IW7 D;  2DY7 A;  3NK9 A;  4KD4 A;  2QDB A;  3K5M A;  4KTA A;  1UUP A;  4PV1 C;  1SE4 A;  1M8A A;  1BDO A;  3A55 A;  3E6Z X;  3I91 A;  2F4I A;  2F0V A;  3I4L A;  1L0X B;  1STN A;  5IGD A;  4XDX A;  5BN3 A;  2F0S A;  1STA A;  1SYC A;  2QF7 A;  2TSS A;  1TWC B;  1B9M A;  3A54 A;  3RD4 A;  1IKL A;  1E0B A;  2JEB I;  1STE A;  2YU9 B;  4WOR A;  2L55 A;  3FKI B;  1RD9 D;  3MXG A;  1SYB A;  3VA5 A;  2MHV A;  3TSS A;  1SJH D;  1LTR D;  5NUC A;  4XT1 B;  2A69 C;  3R3O A;  1ET9 A;  5C0X G;  2A73 B;  1BCP D;  1TWA B;  3K58 A;  5CGK A;  4TQU S;  3T53 B;  2AQ1 B;  3K5O A;  1ESF A;  2X6L A;  2B2T A;  1OXX K;  2K28 A;  2OT2 A;  1Z47 A;  3GO5 A;  4EQN A;  1KNE A;  2RQX A;  5IOC A;  2J7Z A;  2D5D A;  4TSS A;  1GUT A;  3S15 B;  5CV5 A;  3NP8 A;  4CJ1 B;  2FMM A;  3M3Y B;  5EGT A;  4FYD A;  3CU7 A;  5J1Z A;  1Y8O B;  2VNU D;  4ZRZ A;  5CMD A;  1JOO A;  5EPL A;  3EFX D;  2IW3 A;  2CQA A;  2VB3 X;  4DXG A;  3J81 L;  5LL6 S;  1Q1B A;  1SBB B;  3TP8 A;  1LTI D;  2JA6 B;  2SDF A;  4ZLT F;  1SSO A;  1DON A;  1NCV A;  3GV6 A;  4BA2 I;  1V8Q A;  1ROD A;  1K83 B;  5J39 A;  1D5X C;  2WKD A;  4FF3 A;  5BN5 A;  3PUW A;  4IZ8 A;  3CRL C;  2K5W A;  4H13 C;  1SYF A;  1D2B A;  2M9V A;  1U4P A;  4ZYS A;  5EBD A;  3A8K E;  1S4Z A;  3UI2 A;  3D4D A;  2JEA I;  3VYS A;  1PZK D;  4KN7 C;  5FLX E;  2L1B A;  4H44 C;  2D62 A;  3J80 L;  2KEC A;  2PW7 A;  3D4R A;  1PFM A;  2E2I B;  3A56 A;  3PUY A;  5G3L D;  2J4X A;  1Y8P B;  3SK6 A;  1F9P A;  2XNA C;  1AW7 A;  3J81 E;  1LT5 D;  2WP8 J;  2RVL A;  4TRD A;  5KND A;  1SND A;  1F2M A;  1AZQ A;  1SYG A;  5M5X B;  4XYQ A;  4KJO A;  5EKK A;  1PDQ A;  4C56 C;  3D4W A;  4OL7 A;  1JCK B;  2XSC A;  2X69 A;  3GD7 A;  1EYA A;  5JPM C;  1SMY C;  1YNJ D;  1XWE A;  2KVM A;  3T56 B;  3V05 A;  1OXT A;  2JA5 B;  5E1F A;  2B2Y C;  4IFD I;  3J7A V;  1KDB A;  2E2H B;  1O80 A;  3OHX C;  2MUY A;  3AMU A;  5C6A A;  4L63 B;  2XIW A;  1JB3 A;  1SXT A;  3J7A F;  2ICI A;  1SNO A;  5ELB A;  4A3I B;  4UAI A;  2O5J C;  1LT4 D;  2E75 C;  1AP0 A;  1U4L A;  5EKL A;  1HQR D;  2B2U C;  4QB4 A;  1XYI A;  2BE5 D;  4G57 A;  4B9W A;  2E74 C;  5A2Q E;  2B8G A;  1QNU A;  2JP1 A;  1S5B D;  4QUC A;  3GTL B;  4X3K A;  1UNS A;  4LJZ C;  5M9O A;  3NTH A;  1RCV D;  5T1I A;  1TII D;  3H6M A;  3ZYY X;  4EQP A;  1SNP A;  5ELC A;  1BF4 A;  2YYZ A;  4L6T B;  2Q8I B;  1FD7 D;  2EYH A;  5C0X H;  3EJI A;  2R92 B;  3JAM E;  5I4D A;  2DNE A;  2A5H A;  5BN4 A;  2NTT A;  2B2Y A;  3T4A C;  2XWB B;  4J8Q A;  2XRS D;  3FVQ A;  3HOV B;  1V1P A;  2HDM A;  4O42 A;  3PIP 3;  4F7X A;  3C2P A;  5G3L F;  5EPJ A;  3I72 A;  4A3B B;  2SEB D;  5CV6 A;  3SDZ A;  2F0J A;  3BDL A;  1EY7 A;  1FNW A;  3BYY B;  2R6G A;  1QIL A;  1SNQ A;  5EBC A;  2Q8T A;  1OXS C;  2F0L A;  3H91 A;  5FO8 B;  1QWY A;  3IKJ A;  2F0D A;  2B2V C;  4QMG A;  5CV8 A;  4KJN A;  1JOK A;  1BQQ T;  5JEA H;  3RUZ A;  2WAC A;  1NSN S;  1J9O A;  5FO9 B;  3FDT A;  2EYJ A;  5C3W A;  4L8J A;  1T5E A;  2NVX B;  2EYL A;  2EE1 A;  3OIP A;  1GHK A;  3U9O A;  5IT9 L;  1QE6 A;  1Q1E A;  1HCZ A;  3GTO B;  1ILQ A;  2NB0 A;  1WTP A;  3HOX B;  4RGM A;  3DWA A;  1XXG A;  1TQO A;  2R61 A;  1ONL A;  3D6W A;  1B44 D;  3I3C A;  1BXT A;  5IGF A;  2ZT9 C;  2SNS A;  1MD2 D;  3CHB D;  5EKI A;  3HGB A;  2F0T A;  1KLU D;  2MJ8 A;  1ILP A;  5CV7 A;  3E5S A;  2Z4I A;  2E2J B;  3RZD B;  3L7Z C;  4MN3 A;  5CBE E;  4XTC S;  2EXZ A;  2EY6 A;  1VMP A;  2L4N A;  5D14 A;  1PXU A;  1YNN D;  1GUS A;  1D6E C;  1CHP D;  1EY9 A;  1ESR A;  4AYB B;  3G7L A;  1ML0 D;  3HKZ B;  1NAP A;  3EQL C;  2F3V A;  1O7Y A;  5LHY 1;  4C3J G;  1X32 A;  1EQV A;  3TP7 A;  5JAV A;  2BA0 A;  4XQJ A;  1RDP D;  4IUN A;  2Z4H A;  1R4P B;  3LNN A;  1JE4 A;  1BCP F;  3R93 A;  3S9W A;  3Q0A A;  4C1N K;  4WRD A;  3M4O B;  4NW2 A;  1EEF D;  1O7L A;  1IYU A;  3N6R A;  4PMB A;  4PMW A;  1S5C D;  3GTP B;  3S1M B;  3X3N A;  3I8Z A;  3ERO A;  1HA6 A;  5IIF A;  2A6H D;  1KDA A;  1F2Y A;  3HEJ A;  1I4R A;  3FEW X;  2WKC A;  1ET6 A;  4HR7 B;  1Y1V B;  3S17 B;  4MIU A;  1HFN A;  3VR5 A;  4IN3 A;  3MXP A;  3GTJ B;  3IFT A;  2BCO A;  4OO1 H;  1M4V A;  4IUT A;  3KBG A;  1EY0 A;  2K5D A;  2R3Z A;  4Q5V A;  3GTK B;  4HN7 A;  1A3U A;  4B08 A;  2B39 A;  4K5X A;  3JAM L;  3KLS A;  2HQE A;  3K0Y A;  4XT3 B;  4RKB A;  3MFG A;  2CW0 D;  3P1H A;  1U4R A;  2KCC A;  5C4H A;  1YNN C;  2F0I A;  3NQI A;  1SE2 A;  1WTW A;  4CBV A;  1BBX C;  1B53 A;  1TWG B;  2NYZ D;  4DK0 A;  4RCO A;  5A2Q L;  1EY6 A;  4R8I A;  5IGB A;  3S14 B;  1H9S B;  3H94 A;  1PRT C;  1SEB D;  4LAA A;  2WB1 B;  1WCM B;  4CGY B;  3KBX A;  1G91 A;  3X3M A;  5C5L A;  4HMI A;  1B4O A;  4V19 0;  2G9H D;  1LTS D;  2A6E C;  1QJO A;  1EFI D;  2AUJ D;  2FHT A;  1TY0 A;  2NN6 G;  3R2I A;  3SK4 A;  4OIK A;  3N52 A;  2I46 A;  1ZKO A;  4FXK C;  5KNC A;  2BOS A;  3D3R A;  3GQB A;  4G7Z C;  1EU4 A;  1IYV A;  1EQT A;  4OO1 G;  4BA1 I;  5DEH A;  5E4X A;  4FXD A;  1Y69 U;  4KK7 A;  4BY1 B;  5C5M A;  3OPO A;  1BNZ A;  3NSW A;  3R8B A;  3EA6 A;  3VR3 A;  1W6K A;  2JXM B;  1UAP A;  4NMZ A;  3SHL A;  4X3S A;  2RDF A;  1WTV A;  4O1N A;  2KA7 A;  1I4Q A;  1SYE A;  2WAQ B;  3IL8 A;  3TDQ A;  1A3V A;  3VA7 A;  3HOZ B;  5CV4 A;  1XTC D;  5E4W C;  5KGU A;  2L0C A;  4R9W A;  4IUR A;  1WD1 A;  2L11 A;  3IAY A;  1GHJ A;  1X3P A;  4ABN A;  3D6C A;  4XXE A;  4A3E B;  3A7A B;  2WIN B;  1VF5 C;  1EU3 A;  2K33 A;  1PLF A;  3C1E A;  4KHV A;  1ENA A;  3OW7 A;  1GUO A;  5ELF A;  1PMR A;  3C1F A;  5DM7 3;  1B50 A;  2C5C A;  1B2T A;  4GZY C;  4RH6 A;  1PZI D;  3V2T A;  5I6W A;  1ENF A;  3NTK A;  2MGS A;  1DZ1 A;  5JPN C;  2M00 A;  2PO4 A;  2AQ3 B;  4FF2 A;  1TWH B;  4FP5 D;  2B2V A;  3KUP A;  1DM0 B;  4PNY A;  4IUU A;  5DNF A;  4C3H G;  1G29 1;  3Q22 A;  2HUG A;  4IFD G;  3Q23 A;  1ZYR D;  1VF7 A;  1W6J A;  2QIL A;  4HSV A;  4KKU A;  3NBI A;  1AN8 A;  2IJ0 A;  3WOE A;  5C3X A;  4IUV A;  3S1R B;  2NVT B;  4K14 A;  1BUV T;  3QWN A;  3QIA A;  4DAP A;  1H9M A;  4KV6 A;  4BWG B;  1D5Z C;  1OO9 B;  3C3L A;  3S16 B;  4DU9 A;  1NUC A;  2FIN B;  4HED A;  5EPK A;  1LTG D;  4K8I A;  1K8O A;  1Q3L A;  4DAY A;  2EYM A;  5C44 B;  4F87 A;  1G2S A;  5J22 A;  1I6H B;  4J6H A;  1A3T A;  2B8F A;  3V96 A;  2JA7 B;  1HRJ A;  3R2T A;  1XX8 A;  1RHP A;  2V4D A;  4CKE A;  2HCI A;  1FR3 A;  3A8I E;  3PUX A;  2F0H A;  5IGG A;  1AFP A;  5I6Y A;  3M85 A;  2KCN A;  1TS4 A;  1EY5 A;  2K04 A;  3T13 A;  3SK8 A;  3T51 B;  3KLS X;  2EVB A;  2C9O A;  2XVS A;  2EJF C;  5C4J B;  3L3O C;  2B2T C;  4MHE A;  2XRQ D;  3RZO B;  2K01 A;  4RA8 A;  4DF7 A;  2F0M A;  1STG A;  4IUQ A;  1MBY A;  5I2X A;  5F2D A;  4R8N A;  4HSP A;  3QOJ A;  3RMH A;  2O5I C;  1BR9 A;  3K7A B;  3PUZ A;  4RFB A;  1KTK A;  2PW5 A;  1IL8 A;  3HRZ C;  1IHZ A;  1DXM A;  4KY6 A;  3MVV A;  5JEA G;  3MTS A;  4LK1 C;  3CKI B;  4EVO A;  1F9R A;  2I07 B;  1DJR D;  1LLR D;  5KIX A;  1JWS D;  1A6X A;  4ZQ3 A;  4HCE A;  2K05 A;  3H09 A;  4KN4 C;  2TMP A;  1HPC A;  3QOL A;  4CHT B;  4ZUJ A;  4OO1 I;  2CVR A;  3H0G B;  4RHR A;  3OIQ A;  1FNU A;  5M3M B;  1SFO B;  1NR2 A;  2F0Q A;  3MEH A;  1SJE D;  4BBR B;  1KLG D;  1DOL A;  2NN6 I;  3M4Y A;  3FMC A;  2KJX A;  4F8M A;  1C8C A;  4RHS A;  2LFN A;  5K36 G;  1CZW A;  4C3I B;  5IOD A;  4G7O C;  2EYP A;  3NPP A;  1G8Z D;  1CA6 A;  2EY2 A;  1VDZ A;  2E76 C;  3A8J E;  3PO2 B;  4RWS C;  4U68 A;  5EJW A;  1EWH A;  3TZU A;  4A3F B;  2XWJ B;  2AQ2 B;  1I4P A;  1B3A A;  3DHQ A;  1HTP A;  2O4X A;  2E2D C;  2VXW A;  3F2U A;  2VB2 X;  3MFY A;  5C0X J;  4PQX A;  1CM9 A;  1BOS A;  2EYO A;  1U9R A;  1PRT F;  1Q90 A;  3I73 A;  4DAV A;  3HS0 C;  1G2T A;  4A3J B;  4CKB A;  1DOM A;  1QB5 D;  5IGE A;  2LMC B;  1PFN A;  4C3H B;  2K1B A;  3D8G A;  1CQF A;  2ID0 A;  5TSS A;  1HUM A;  3I4N B;  4J1M A;  4KKS A;  3I90 A;  1DYQ A;  3VYU A;  1WD0 A;  4FF1 A;  1TWF B;  2D2C C;  4ZAI A;  4XQQ A;  3J7Y W;  3S1N B;  3ND8 A;  2B2W C;  4KY5 A;  3HG9 A;  3I4M B;  2NBF A;  1EY8 A;  2MPM A;  3ITP A;  2R7Z B;  2MP1 A;  1PTO D;  1JWM D;  2PZW A;  1DCZ A;  1LT6 D;  1EIG A;  1AEX A;  2F0O A;  3NUC A;  2WII B;  3K59 A;  4OGQ C;  4FO2 A;  1ZXT A;  2CHB D;  2KHS A;  1I50 B;  2RDG A;  1Z7T A;  2F3W A;  5JVH 3;  1SDF A;  3HOY B;  3URY A;  5CBA E;  1STH A;  1H9K A;  1O7Z A;  5KYL A;  2F0G A;  3NHH A;  1WVL A;  1D5M C;  2FMC A;  5AFW A;  3DEP A;  4FXG C;  1LO5 D;  1LTA D;  4DNR B;  3RLF A;  4K5W A;  1CTM A;  5JOB A;  1TT2 A;  4U67 3;  1Y1W B;  3MXU A;  4B9X A;  2F0K A;  1DOK A;  3O13 A;  2F0F A;  4IFD J;  1PZJ D;  3E0J A;  1EYD A;  2KED A;  2NVQ B;  4EQO A;  4QUF A;  1F2L A;  1CI3 M;  1FYC A;  2IPK D;  5FK9 C;  2BE5 C;  3IFD A;  1JOQ A;  1QCB D;  3OMC A;  1QOH A;  1PRT D;  1HA5 A;  1S5F D;  1OXU A;  2AWN A;  1EL0 A;  2K6A A;  2IX3 A;  1RJT A;  2JYO A;  2ICE C;  1NR4 A;  1S5D D;  3TZD A;  2B63 B;  4FVM A;  1TS3 A;  1EYC A;  4X3T A;  2BDO A;  3ND9 A;  4DGZ A;  2F0P A;  1X3Q A;  1UEA B;  2KOL A;  3AB9 A;  4X3U A;  4DNT B;  1I4G A;  1BCP C;  5KYI A;  2A69 D;  4HTH A;  2KUM A;  1EZ6 A;  3MZ5 A;  5I2Y A;  5EQ0 A;  3TP5 A;  4C3J B;  3BVM A;  1C48 A;  3KF8 A;  5JJZ A;  3DEO A;  4DFA A;  4HMJ A;  1KAA A;  2RSN A;  1QNK A;  5K5P A;  4E6I A;  1G6Z A;  2SOB A;  1F2Z A;  3OMG A;  1F9Q A;  3FRP B;  1II3 A;  3FPU B;  4C2M B;  3SR1 A;  3ONA B;  3SEB A;  1I4H A;  4RGT A;  3D31 A;  1SNM A;  1JOR A;  3SXH A;  1A2T A;  1JR0 D;  4CJ2 C;  2BDN A;  1AZP A;  4BS9 A;  1Q8I A;  3OSO A;  5E3F A;  1F77 A;  5D65 A;  1EWC A;  4ZK9 B;  3NTI A;  1CQV A;  3Q6S A;  3OWE B;  1KAB A;  4XYO A;  2EYF A;  2OXP A;  4TKO B;  3SE0 A;  1TR5 A;  1MSH A;  3PMF A;  2EY1 A;  1O78 A;  3TP6 A;  2PNR C;  1Z6H A;  4M8A A;  1BO0 A;  1PTO F;  2GA4 B;  5C3E B;  4QIW B;  1J8I A;  4KMU C;  2IX1 A;  5D3D A;  1EOT A;  5KNB A;  2RKS A;  1HFG A;  4P2C B;  5KRU A;  4RAU C;  2HDL A;  3MHB A;  3U9S A;  1ZYR C;  1CA5 A;  1PFB A;  4YIJ A;  1GUG A;  1H9J A;  5DAU A;  3PUV A;  1ENC A;  4Q0F A;  4IFD H;  1WTO A;  3QJY A;  4A3D B;  4A3M B;  3NWS A;  3NXW A;  1FNV A;  4CKC A;  4N9P A;  4DN4 M;  3PO3 B;  2NUC A;  4XIG S;  1EZ8 A;  4BY7 B;  2NN6 H;  3GTM B;  5I9P A;  2KQ3 A;  1GOZ A;  2OF1 A;  3HOU B;  3K57 A;  1CK1 A;  1V1P B;  5C0X I;  1L0Y B;  1SAP A;  1H9R A;  1QG7 A;  2RSO A;  2F03 A;  2H1E A;  3BS1 A;  3ERQ A;  4HCS A;  1A2U A;  3C46 A;  2ZXR A;  4G4K A;  2IL8 A;  5CC4 A;  1LTB D;  2Y0S B;  1JWU D;  2F0U A;  1PTO C;  5ELE A;  2H4O A;  3VYT A;  3W3A A;  3I70 A;  2PQE A;  4NKL A;  5D3I B;  2LS0 1;  3S1Q B;  4ZUI A;  3OOC A;  4A3K B;  1S5E D;  4ILW A;  3NE5 B;  1WTX A;  1A15 A;  1JIC A;  4KHZ A;  2ZXP A;  5T1G A;  3TN2 A;  3GV3 A;  4WJW A;  3KK7 A;  4RGN A;  5ELD A;  3GTQ B;  1ZEQ X;  3WDN A;  1I6V C;  2WV6 D;  3EVQ A;  1TKW B;  4K2K A;  1TVX A;  3VR4 A;  5HGT A;  4UDU C;  3QO2 A;  1HTL D;  4EGV A;  1SNC A;  4RGO S;  4ULL A;  4QF4 A;  2JE6 I;  1MI2 A;  3P20 A;  2JA8 B;  2EDG A;  1WTQ A;  3H3V C;  5JEA J;  3MAQ A;  2J0T D;  1V1O A;  1D1K A;  3FPP A;  2ENB A;  4M1U B;  2R93 B;  2RA4 A;  1HQM C;  3MA2 B;  2F0W A;  2QCP X;  1Y8N B;  3BVZ A;  5A35 A;  1IW7 C;  5CYU A;  2XN9 C;  2PZT A;  2EOT A;  3A7L A;  4K5V A;  4KD3 A;  4XQN A;  2DN8 A;  2ZXO A;  3KLR A;  4NDX A;  2DNC A;  5COR A;  4QCL A;  1CZG A;  4FF4 A;  1RKN A;  5ISR A;  4ODG A;  1STB A;  4A3G B;  3QG1 A;  4PMC A;  4ME5 A;  3J80 E;  1PTO B;  2CW0 C;  3DUZ A;  1LAC A;  5FLX L;  3HZX A;  2OEO A;  2F1M A;  4DK1 A;  3LWE A;  1LTT D;  1SMY D;  1YNJ C;  3LWU A;  3PV0 A;  4DXF A;  2RDH A;  4BBS B;  2EJG C;  1VCI A;  2Z8L A;  4C3I G;  4OHJ A;  3M7N A;  2QEJ C;  1STY A;  3OWF A;  1B1Z A;  1I3Q B;  4H7B A;  5CV9 A;  2EZV A;  3NWT A;  3Q24 A;  3T16 A;  3K5N A;  4FNF A;  2N55 A;  3P7J A;  1TS5 A;  1CHQ D;  2L5T A;  1VMC A;  1E2V A;  2Z1C A;  1EY4 A;  4N9T A;  4RCN A;  5FO7 B;  2A6E D;  2PMZ B;  3AU7 A;  1RTO A;  1T5X D;  3NBH A;  1ICW A;  4DA2 A;  3K5L A;  1HUN A;  3PIO 3;  2NTS A;  4V0B A;  2Q8R E;  5I9O A;  2VUM B;  2FFK B;  2KEE A;  3BZD B;  2IX0 A;  1DD2 A;  2BA1 A;  4Y7N B;  1HHV A;  1F9S A;  3HOW B;  3VYR A;  1K8M A;  2AWO A;  4S3S A;  3K6O A;  3DXJ C;  1SYD A;  4HAE A;  4CJ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...