5C4HA

Crystal structure of staphylococcal nuclease variant delta+phs i92h at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYHYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4hA00
1SYEA 1KDBA 5I6WA 1STHA 1TT2A 1A3TA 1KDCA 4K2LA 4IALA 2EYOA 5IODA 1EZ6A 1F2YA 1SYGA 5KGUA 4ZUJA 3SR1A 5DAUA 3SXHA 4KJNA 1EY7A 5I6YA 4ME5A 4ODGA 2SOBA 5EKLA 4KD3A 3MHBA 3MXPA 3OMCA 4F8MA 3MEHA 1SYCA 5C4ZA 1TQOA 3MVVA 5E1FA 3MZ5A 1JOKA 2F0WA 3LX0A 1STYA 3BDCA 3TP7A 2PZTA 5KIXA 3HEJA 2F0MA 5CGKA 2KQ3A 5M9OA 2F0GA 1U9RA 2OF1A 1EY0A 2EY6A 2PZUA 4LAAA 3NUCA 3EVQA 1II3A 3D8GA 4H7BA 4IUNA 5CV6A 5IOCA 5NUCA 4K14A 4K5XA 5IGBA 4PNYA 3QOLA 3SK4A 3ERQA 4OL7A 4DU9A 2F3WA 2NUCA 1SYDA 4IZ8A 4B9XA 5KRUA 1SYFA 1EYAA 2EYHA 1EQVA 1SNOA 2EYPA 5EKKA 3T16A 2F0IA 4J6HA 1A2UA 3VA5A 2RDFA 3H6MA 4S3SA 5CC4A 2F3VA 3SK6A 2F0QA 5J39A 2PYKA 2EY2A 5CR3A 5IGEA 3C1FA 3HZXA 2HQEA 1A3VA 4MIUA 4WORA 5C5LA 3BDLA 4YIJA 3V2TA 5CV8A 1A3UA 1EY8A 1JORA 1EY5A 3SK5A 5CV9A 1EY9A 2KHSA 2PZWA 2M00A 1EYDA 2F0HA 4NMZA 3NQTA 4NKLA 1SNDA 5C5MA 4EQOA 4WRDA 1RKNA 3OWFA 4KHVA 3NHHA 4QF4A 2EYLA 3RUZA 3T13A 2F0JA 3C1EA 5C4HA 5KYIA 1EYCA 4J1MA 2F0PA 4DGZA 2F0FA 3P75A 4KY6A 4RKBA 3TP8A 4NDXA 5K5PA 5IGGA 5C3XA 4PMCA 1IHZA 2F0DA 4EQPA 5IGCA 3R3OA 1EY6A 1A2TA 1SNCA 5CV5A 3TP6A 2OXPA 3OSOA 4R8NA 4KV6A 3E5SA 1NSNS 3NXWA 3P1HA 1KAAA 1EY4A 3EJIA 1SNQA 5J1ZA 3DMUA 4N9PA 3SHLA 4B9WA 5ISRA 3SK8A 2SNSA 2EY1A 1JOQA 5CV7A 3NK9A 5C6AA 4KY5A 1SYBA 4ZQ3A 4QB4A 5KYLA 2F0VA 2O4XA 1JOOA 2F0KA 4RKLA 5EGTA 2PQEA 4KY7A 1EZ8A 4I65A 1TR5A 4EQNA 2EXZA 1KABA 2LKVA 1ENCA 4ZUIA 4EVOA 5C3WA 1SNMA 1F2MA 2F0LA 2OEOA 2QDBA 4K8JA 4KTAA 4N9TA 4PMBA 2F0SA 2F0OA 5CV4A 4DF7A 5I9PA 5J22A 2F0EA 1STNA 3D6CA 4HTHA 5HGTA 4G57A 4HMIA 3S9WA 4KD4A 2SNMA 5HURA 5IIFA 2EY5A 4NP5A 1SNPA 5KEEA 3EROA 3D4DA 2EYJA 4TRDA 5JOBA 1STBA 2F0NA 2PW5A 5F2DA 1ENAA 2F0UA 3NP8A 4HMJA 1F2ZA 2RBMA 3DHQA 2EYFA 3PMFA 5I9OA 2PW7A 1STGA 4K5WA 5E3FA 3QOJA 1NUCA 3TMEA 1KDAA 4K6DA 2ENBA 2EYMA 5JAVA 4KJOA 4ID6A 3ITPA 5IGFA 3OMGA 1STAA 4K2KA 5IGDA 4K8IA 1AEXA 4F7XA 3TP5A 3D4WA 3QB3A 5DEHA 2WACA 2RKSA 3U9OA 4DFAA 4E6IA 4QMGA 2F0TA 4K5VA
chains in the Genus database with same CATH superfamily
1FD7D 5IP9G 1KDCA 1KRTA 1Y1VB 2A69D 1A8VA 4DV6Q 1G8ZD 3D6WA 3CP0A 4HAEA 1QUQB 2CH4A 3RLOA 5C0XG 5C44B 1K83H 2WKCA 4TVAB 2VY3A 1VQHA 4IUPA 5CGKA 2KQ3A 1L2FA 1CA6A 1Y1VG 2A19A 3KFUA 3HOYB 1EIFA 5JJIA 2EDGA 3EA6A 1TKWB 4GKKL 1SROA 4PZ6A 4XTCS 5IWAQ 3LNNA 1RCVD 2JA6H 1TY0A 5LMNL 1H9MA 3Q0AA 1D5ZC 1PYSB 1SNOA 3HOZB 3H15A 3HOYG 1JICA 1EWIA 2N55A 4GN3B 3RZOH 4DKAC 1I6HH 4DR3Q 4FXGC 1A3VA 3QJYA 5CV8A 2DUDA 3SK5A 3GTLH 2FINB 2F0HA 4DK3C 4EQOA 1SNDA 2EYLA 3NBHB 1NTGA 2KHJA 5KYIA 4HIDA 2K50A 1KAWA 1M8AA 1BKBA 2Y0SG 1XWEA 2BH8A 2NVXB 3E0EA 4PMCA 1KTKA 1KLUD 1J8IA 2B2UA 5M5WB 2BA1A 1VQMA 4NXNQ 3AFPA 3RR5A 2JA7B 4XYQA 1H95A 3OOCA 4JI7L 1MGSA 5GAEC 3ULLA 3PUZA 5H1SE 1VQ5A 1NR2A 4L5QA 3CD6A 3GTKB 1LO5D 4QB4A 1N33Q 1GUTA 2F0VA 4JI1L 5KYLA 4I65A 4B3SQ 2EXZA 4CJ0B 4NXMQ 3S1RB 1CZGA 2OEOA 1KIXA 3MAQA 4K0KQ 3PUXA 4HTHA 5C44H 3CCSA 1I94L 1SE3A 2EY5A 5KEEA 1EWCA 1LT4D 3TS2A 3GTPB 2RBMA 3J7AF 1LTRD 1XNRL 2WB1B 1LTTD 1TWCB 1KL9A 1L0YB 1AEXA 5IWAL 2IX3A 2G9HD 4JI6Q 2JA8B 3HOZH 1E1OA 1MJEA 2VS1A 4K6LA 5ELOA 2VQFL 1CKOA 2CHBD 2JK8A 1XTCD 2EPBA 4HIKA 1YI2A 4DR7L 3RLNA 1Q81C 3O13A 4KD3A 3MHBA 1CSPA 1PH8A 3SGIA 2FMMA 1F9SA 1NY4A 3E9HA 4CKBA 1OXXK 2BOSA 4IFDI 3BDCA 3G71A 1QG7A 2B8FA 5KIXA 3UDXA 3J81j 2F0GA 1F77A 4IURA 1GHKA 1ENFA 1FGUA 1UNSA 2KECA 4BBRB 4CGYB 4R9WA 3GTJH 2JA7H 2RHQB 1VF7A 4BY1B 1LTSD 2G9DA 1LUZA 2ASBA 1D7QA 3K5MA 3CHBD 3T1HQ 1NMFA 3RNUA 3GTGB 1X55A 4FNFA 2F0QA 3S1RH 2XN9C 4JI8L 2OWOA 1AZQA 2R7FA 1WD1A 3C2PA 4IJLA 1O80A 4O42A 3L2PA 2E2HH 3VYTA 4GS3A 4NXML 4RGOS 2M00A 5C4XB 2UUAL 5ELBA 1H9JA 4JI4L 1RKNA 4UP9A 3RN2A 3RUZA 4LF7L 4K0KL 2OTJA 2F0PA 2A68C 1PTOC 1L1OB 3CW2C 1R9TB 3BVZA 2E5LL 4JI3L 4KV6A 4I7ZC 1SEBD 2JSOA 2MNAA 4IUQA 5FO9B 2JA8H 3PO2B 2RSNA 3H91A 3QIAA 3CCRA 2R93G 1FVIA 1JE4A 2WKDA 1A6XA 3OIPA 1TS4A 1QE6A 4BY7G 2J4XA 3OTOL 4JBMA 3A8KE 4UDUC 1DGSA 3HKSA 3UDFA 1A63A 2A73B 3M4YA 5HGTA 4HMIA 4KD4A 3S2HB 1K9MC 3S17B 1OO9B 3PO2G 4A3MH 2EOTA 3D4DA 1FJGQ 5F2DA 5AJ3L 3AFQA 4P73A 5D65A 4A3BB 2RCNA 2RF4A 2PW7A 1ICWA 4UY8C 5CBAE 3L9AX 4L63B 4DAYB 2ENBA 1N8RC 4KLKA 1IBKQ 1HZAA 4BY1H 4YWKA 4MZ9A 1HR0W 2VZAA 2Q2HA 5K36G 1FNWA 5C3EG 1PTOB 2KHIA 5KGUA 3I55A 1UE5A 5GROA 4KJNA 4FF1A 1EY7A 2KJXA 5I6YA 3DM3A 4ODGA 4IJHA 1X3GA 5C4XH 1JWUD 3PUVA 2Q8TA 4HIOA 2CVRA 3K59A 5E1FA 4JCVE 2N8NA 4GLXA 4YHHL 1TWAB 4Y52H 3TP7A 1VQPA 4UPAA 1R9TH 5M9OA 5JJKA 2PZUA 5IYCH 5NUCA 4DXFA 3STBC 2IW3A 4A93G 2RA4A 3VR3A 3T53B 4GNXB 2F3WA 2VQEQ 4KHPQ 1K8OA 4OWTB 4RG1A 4DNIA 4V0BA 1EYAA 3NENA 2FHTA 4JYAL 3CCMA 4O1NA 2WV6D 1K73C 5CC4A 3C1FA 4F87A 3G6EA 1EWHA 4U673 4JI0Q 3S2HH 1T5XD 3HOXH 3NWSA 1EEFD 1GD7A 3NQIA 1XMQL 3P75A 1KHIA 4A3BH 1I3QB 5IGGA 1YIJA 1FJGL 3VA7A 1IW7C 3CRLC 2R92B 3L7ZC 5LMNW 2A74C 3C46A 3OSOA 4POGA 3EJIA 3J80L 3GV6A 4AYBE 4JG2A 1Q46A 1JR0D 4KY5A 1AE3A 3J81L 2R92G 2JA9A 1H9KA 4OX9Q 4ZUIA 4G7ZC 1NNXA 4PMBA 3H3VH 5J22A 3CCEA 2A5HA 1VCIA 3MA2B 1SNPA 3CCVA 1TWAH 3TZUA 1TWGH 4DN4M 4IUTA 5JOBA 2VNUD 2CQAA 1S5FD 3CCLA 1KQSA 1Z9FA 1B53A 1PXUA 4JVZA 3DXJC 2D5DA 3K7AH 5ELDA 3K0YA 5E3FA 4B3MQ 3S2DB 1NUCA 1X3QA 3FPUB 5IY0A 4LFAQ 4KJOA 4DAMA 4X66Q 1SN8A 5DNFA 1KLGD 1R4PB 2WB1E 2Z4HA 2EJMA 2A6HD 3G7LA 4DR6Q 3X3MA 3T4AC 4FP5D 1WTWA 1T5EA 3I70A 3J80E 1P8LA 2IX1A 1DOLA 5LL6S 2K28A 3MEHA 3CCQA 3M4QA 3K5OA 4TSSA 3LX0A 2V4DA 4C3IG 2B2VC 1I3QH 3Q6SA 1NCVA 3ICEA 2M9VA 2FXQA 4B3TL 3F2BA 4YCUA 2RHSB 2R6GA 5GAGC 4P71A 4JI5L 2X6LA 1RD9D 4A3LG 3HKZG 4DA2A 4RCNA 3NWTA 4LFBQ 3I72A 2X6GA 3NBHA 2B2YC 3SEBA 2HDMA 1XPUA 2YTYA 3HGBA 1BO0A 3BYYB 1PH5A 2ES2A 4QCLA 1EYGA 2NVTH 2YYZA 1S5BD 1XPRA 4C3HB 1Q8KA 1JORA 4OX9L 5CV9A 1TWFH 1S40A 2PI2E 5JPNC 4GOPB 4J1MA 3S24A 4PZ8A 2D0OA 3I4NG 4C1NI 3UE1A 4NDXA 1E2WA 1LACA 3I90A 5C3XA 4DV3Q 1HNWQ 1JT8A 3VR6A 3S2DH 5LL6X 1QJOA 3MC0B 4C3HG 3PF5A 2L55A 3H3VI 1RODA 1N32L 1B9MA 3S15B 1SNQA 1JJ2A 4LUZA 4LFAL 1A62A 5JEAH 3KLWA 5KNCA 4CJ1B 4UAIA 1X32A 5JVH3 1JOOA 1HFGA 2F0KA 4DR6L 1EZ8A 1T9HA 4X64Q 2LKVA 3IKJA 4FF3A 4DK1A 4RGNA 1E2ZA 3A8IE 2B63H 3MWYW 3W2DA 2SNMA 1KNEA 2XGTA 1TS5A 4NW2A 4TRDA 3RLFA 3W5OA 1A0IA 2F0UA 3I8ZA 3GDEA 2K6AA 3JC66 1ESRA 3FP9A 4J15A 4K5WA 3AQQA 4JI2Q 2GA4B 4ID6A 2C5CA 3OMGA 4R8IA 4HJ9A 4K2KA 2E2JH 5FJ8G 5LMUQ 2UUCQ 4DFAA 4JBJA 2DY7A 5EKLA 4E6IA 3JAML 4LFBL 2H4OA 4HN7A 2EE1A 4IALA 1SLJA 5DAUA 4DPGA 1BDOA 1PLFA 4IFDJ 1XTDA 3K6OA 1IKLA 4KKSA 2QEJC 3MXPA 3OW7A 4F8MA 4DR2Q 1BQQT 4OO1H 2G5DA 2MGSA 2UU9Q 1BF4A 3PO3G 4FYDA 3DWAA 4ZKBB 1F9QA 3BYTB 3FKIB 2F52A 3VYUA 1PRTD 1X6OA 3T56B 1J9OA 4DV3L 2YTXA 2PI2A 1O7YA 1ZEQX 3S15H 1SBBB 4OL7A 2NUCA 3PUYA 4PMWA 5EPLA 2YU9H 1QZGA 1HNXQ 2ZJQA 5M5XB 1DJRD 2XWJB 1L1OA 4XT3B 3B6YA 4NB3A 4L6TB 1U4MA 4A3FH 4JV5Q 1A3UA 4ABNA 4X64L 3L0OA 5JJLA 2ZJPA 3S14B 3T13A 2KUMA 1FNVA 1DYQA 3ULJA 3J80c 2F0FA 2EJFC 4C2MB 4ZKCB 3K57A 4A3GB 1UUPA 4RGMA 2KOLA 1CI3M 2VUMG 1SMXA 3RZDH 3J81c 3P1HA 3R2TA 2ZXOA 2ZJRA 1PHJA 4N9PA 4OEMB 4JI2L 5ISRA 3MXUA 5C6AA 4P75A 2AQ2B 1WVLA 5FLXE 1I4GA 3G6JB 3V96A 1ENCA 4R4QA 1F2MA 1IYUA 4KTAA 1PRTF 4LF5Q 4DAYA 3K8AA 4DNRB 1V43A 3BDOA 1YNJD 4DR2L 2EYJA 3A5UA 2PW5A 2TSSA 3CPWA 4TKOB 1VQIA 3A7LA 3FKIH 5EJWA 2E75C 2N49A 2K05A 1Q1BA 1N9WA 4DNTB 2IY5B 1IKMA 1LTID 3Q23A 5IGDA 1CQVA 1CKNA 4K8IA 4H0LC 2E2DC 2I0QA 3U9OA 1PH7A 4K5VA 3GD7A 1YNNC 5M5XH 3I7FA 2AWOA 2QW7A 1VQAA 4MTNA 3BZDB 3SXHA 2R7ZB 4PG3A 2E2IB 2CWAA 4A3KB 4IOAA 4GZYC 4L5RC 3A5ZB 4LUVA 2R3ZA 4GNXA 2ID0A 2D0PA 3ND9A 3PSIA 1M90C 4C2MH 4A3GH 4ZCKA 1JJCB 2R7ZG 2OF1A 1S5CD 4IFDG 2IWHA 2NN6H 1CZWA 2HQLA 3I91A 2YTVA 3ZYYX 4LF4Q 2JEBI 1A2UA 1PYWD 4FXKC 2I07B 2B2WC 1EY5A 3I3CA 2DN8A 4N8FA 4OONA 4MN3A 2N88A 1BBUA 1K3RA 4Z9CB 3CXCA 3PIO3 1PH3A 1ZXTA 5C4JH 2BDNA 5CV5A 3TP6A 1BCPD 1X3FA 4FF4A 1LT5D 1Q12A 2ZTDA 4X3TA 2XRQD 4QIWB 4DR5Q 5EAYA 4A3JG 3E6ZX 1K8GA 2NBFA 4QUFA 4BXXH 1EY4A 3SHLA 2Y0SB 1XJVA 3RN5A 1V1PA 2RSOA 2O5IC 3IL8A 1Q82C 3OWEB 4OIKA 2XNAC 2PQEA 1QZHA 4M1UB 1KABA 1D8LA 2E2IH 2F0LA 2QDBA 1UEAB 4N9TA 4A3KH 3S1NH 4DR1Q 3OHXC 1GXDC 3D6CA 4R4CA 1OXSC 2PNRC 2Z4IA 1LM0A 4H13C 5IT9E 4KKTA 1SAPA 3KBXA 4WJWA 1CQFA 5C0XH 1PH2A 3JAMc 3AB9A 3QOJA 2BA0A 3HG9A 4RA8A 5JAVA 1GVPA 3ITPA 4WJ3M 1VQCA 1Y1VH 1D5XC 2LY7A 1A15A 4A76A 1E24A 1CM9A 1O7LA 2WACA 3D4WA 3QWNA 1IL8A 2Z9HA 1TXYA 1F2YA 2K32A 3GTOB 5JJZA 4DV6L 3Q24A 3MXGA 2TMPA 2F1MA 1BCPF 1VS0A 4O2DA 3HOYH 1MBYA 1UE6A 4A3CG 2B3GA 1GKHA 3MZ5A 3GP7A 2B8GA 2PZTA 4DV0Q 1EFID 4AYBG 2NZOA 3URYA 4MNOA 1U9RA 2XTIA 4LAAA 1EY0A 3AYHB 2DNCA 4H44C 3GTQB 1I4QA 3S16B 3ERQA 2E74C 2WAQB 3ND8A 4DAVA 5EQ0A 1ZYRD 4GOPA 3T16A 2F0IA 4HJ5A 3K5NA 4S3SA 3M3YB 4DR3L 2F3VA 2PYKA 2HQEA 3V2TA 4YIJA 4A3DG 2WAQG 1YJ9A 1B3QA 1EY9A 2CH4W 1PZID 2NVXH 3NQTA 1KRSA 3EIVA 4WRDA 2Q8IB 4KHVA 4DR1L 4DR4Q 1BXTA 3H09A 4YCVA 2RDGA 4YCWA 5M5WH 2IL8A 4KY6A 4ZRZA 3FHWA 4NXNL 4LF8Q 3FVQA 2I5MX 3NXWA 3GTKH 5CORA 1KAAA 3T1YQ 3PIOA 2ICEC 5J1ZA 1PA6A 1WI5A 3CC7A 2AKWB 1MSGA 1I4XA 1PZKD 1N33L 3P7JA 3QO2A 1VMCA 4A3IB 4A4IA 4LNQA 4B3SL 3W3AA 1B9NA 3TREA 4IUUA 3DEPA 4DV5Q 2OQ0A 5C0XI 1I4RA 3HOWB 1B50A 1XNQQ 4KN7C 4IPCA 2H1EA 4JW0A 4JC0A 4HJ8A 3GTPH 2R93B 5HURA 4BY7B 3HOUG 4RHSA 3IFTA 1TWCH 4A3IG 4J8QA 4JBWA 5IP7G 1S5ED 4R4OA 4DUZQ 3KDFA 1HPCA 2DJFC 2PQAB 5I9OA 4DV0L 1J5EQ 2A6EC 3HOWG 3CCUA 3K58A 3TMEA 3S16H 3OW2A 4K6DA 3S1QB 4XQJA 1VQ4A 1C7YA 4JI6L 4JOIA 1J6QA 2JA5G 3MEFA 3GTMB 1SYEA 1IYVA 1WTVA 1QNUA 2M2LA 1MJCA 4ZUJA 2OCEA 2HHHQ 1S4ZA 2FJ2A 4LF6Q 1YHQA 2NYZD 5C3EB 1JB7A 3FDTA 2LFNA 4XQNA 1YEZA 4BBRH 1B3AA 2ZTEA 3CRKC 3MXNB 2BE5C 4H7BA 5GQOA 4DV1Q 2L4NA 1EU3A 3TEHB 3KF6B 5IGBA 3QOLA 1CA5A 3OPOA 3FRPB 1DM0B 3GTGH 4LF8L 3T1YL 2ZM6Q 3T1HL 2LXKA 2EYHA 4KHZA 2A69C 3BS1A 1PFNA 3VA5A 3HRZC 4A93B 5CR3A 2JP1A 1EY8A 3M9BA 3NTHA 4B08A 2R93H 4CKCA 1W2BA 1TU2B 3OWFA 2K5QA 5C4HA 1SMYD 3C1EA 5IYBG 2L9HA 3D31A 2CW0D 4LF9Q 2PMZB 4EQPA 2F4VQ 2GVBA 3CU7A 2FMCA 4DUZL 3QG1A 3PO2H 3H0GG 4LMQD 4JBKA 3S1QH 5FLMG 1JWSD 1YJWA 2AUKA 1ESFA 2ZXRA 4B9WA 3K0XA 4V190 2JYOA 1JWMD 1Z6HA 4KY7A 1VQ9A 3S17H 1TWHB 1WFQA 4DV2Q 2LMCB 3NTKA 2F0SA 5K36H 1HZCA 5C3EH 4FXDA 2EXDA 4HIMA 1V8QA 1EEID 1VQ7A 1VQBA 5D3DA 2F0NA 4GN5A 3CCJA 1TVXA 3BVMA 1HZBA 3NP8A 1I5FA 3QR8A 1ILQA 3ERSX 2L11A 5M5YB 1IBKL 1PTOH 3RMHA 1UEBA 2B2UC 4A3EB 3IFDA 3TP5A 2ATWA 2RKSA 4UP7A 2AUJD 1L0WA 1RTNA 3CAMA 1OXVA 2K4KA 4A93H 3OIQA 1Y8NB 1VQ8A 2Z8LA 2I5HA 4X62Q 2B39A 4HCEA 2SOBA 4CDCC 4G7OC 4IPGA 4XT1B 3D3RA 2IX0A 4A3EG 1C8CA 2ICIA 2F0WA 2VXWA 4L5SA 1XXGA 2F0MA 2MP1A 2QKIC 1QUQA 3A74A 5IOCA 1YJNA 3SK4A 4C3IB 1YBYA 2VQEL 4KHPL 1Y1WG 4BBSB 1I4PA 2EQSA 1SYDA 2MO1A 1GHJA 3S1MB 1P16A 1XX8A 4C56C 5T1IA 4C3JG 3VR5A 3M7GA 1TWHH 3HKZB 4X65Q 5M3MB 1D6EC 5IGEA 3KLRA 4JI0L 1PZJD 2AQ1B 2KCTA 1EYDA 2O2LD 1X9NA 4UP8A 4BBSG 2R92H 2F0JA 5L37A 2Z6KA 2EZVA 4QJFA 3A8JE 1IHZA 1X3EA 5M3MG 5M5YH 4R4IA 1SJHD 1M4VA 5ELNA 3I4NB 1B4OA 1JE5A 2KEDA 1HNZQ 1SE4A 3DLLA 5I2XA 3HFZB 2RVLA 5LHY1 5EPJA 2UXBQ 2FFKB 1EU4A 2AMCB 2NZ1D 2AQ3B 3HOVG 4DUYQ 4EVOA 1HTPA 1G2SA 2HDLA 5JVG3 5CV4A 2HCIA 1D2BA 5FK9C 1STNA 2WIIB 4CJ2C 1L0XB 1V1OA 3A54A 1GUGA 2B2TA 1AZPA 3PGZA 4HMJA 4B3ML 1BUVT 3T51B 1CTMA 1HQRD 3CMEA 4X66L 4R1JA 4C3IH 2L12A 3KK7A 1IBMQ 1B8AA 2K75A 2ZTCA 4XXEA 2WP8J 3NBIA 4RGTA 2RCFA 3S1MH 4OGQC 5G3LD 1TS2A 4A3LH 1SYGA 3WOFA 1OTCA 3I56A 4OELB 4P74A 2K5DA 4KMUC 5C4ZA 1DOMA 1GJXA 5HY6A 3VYRA 4ALPA 4CDFC 3I2ZA 1PFMA 5M3FB 1ET6A 1FGBD 2HUGA 1DZ1A 5CV6A 5FOBB 1LV9A 1QCBD 2DGYA 4AQYQ 3I4NH 3M4OB 1LTAD 1WCMB 3PO3B 3J81i 5IYDG 3I4MG 4IZ8A 2WINB 2EYPA 4C3HH 1HNZL 1FYCA 5M3FG 4J6HA 4LWCA 4LJZC 1BR9A 4DV7Q 2A8VA 1ASZA 3F2UA 2UXBL 2A1AA 4L8JA 3J7YW 4AIMA 1Q90A 1S5DD 4DUYL 3CKIB 2KENA 3CMAA 1WCMG 2NVQB 2DY8A 2Z1CA 3M7NA 1RTOA 5D14A 1DD2A 1Y8OB 1H9SB 1IL2A 3VDYA 1WTPA 4DV4Q 1HNWL 3KUPA 5FLXL 2N78A 5G3LF 1A2TA 4P72A 2QA4A 1K0RA 4M8AA 2PMZE 1B7YB 4FDBA 4F88A 2CQOA 1SXTA 1N36Q 1HTLD 3EQLC 1NE3A 5C0XJ 3KF8B 1PFSA 2UXDQ 1KXLA 2VUMB 1G51A 3I4LA 4EGVA 3DM1A 2KCNA 1BNZA 4EQNA 5FJ8H 4RFBA 1HH2P 3IRBA 4YY3Q 4IPDA 1ONLA 5ELFA 2JQOA 1ILPA 2EJGC 5BR8Q 1DOKA 2IPKD 3SDZA 4DAPA 1AN8A 4QQBX 3VR2A 1AW7A 2JJQA 4JPBW 4X6AH 1YITA 4IOCA 1YHBA 3IAYA 2VB2X 4X3SA 1PH4A 1KDAA 3M4OH 1HCZA 1DONA 3ER0A 1VQDA 5LMUL 1U0LA 2UUCL 3PO3H 1E3PA 5DEHA 4AQYL 4BS9A 1VQEA 2K01A 3UE0A 3NPPA 3HP3A 5BN5A 1YHAA 3GQBA 3WOEA 1WYDA 1LTGD 2YV5A 4ME5A 2NVQH 1JB3A 1JOKA 3R8BA 2UU9L 1JMCA 3A56A 2PO4A 4DV4L 2A68D 1K83B 3F8TA 1PTOD 4C1NK 4OO1I 1LTBD 1AE2A 1EL0A 3M85A 4BA2I 4EQ5A 4GKKQ 2A6HC 5BN4A 1SRUA 1NMGA 1HNXL 5LMNQ 1QOHA 2VUMH 3FMCA 4BA1I 1X56A 3S14H 3AMUA 1F9RA 4JV5L 1ET9A 3HZXA 4KI0A 4CDEC 4MIUA 5C5LA 1QVCA 2Q2IA 3TDQA 1VQOA 4NMZA 2E76C 3PV0A 4NKLA 1HQMC 5C5MA 3PUWA 4U68A 1JOQA 1CHQD 3RZOB 1I6HB 1VQGA 1EYCA 3ONAB 4DGZA 4RKBA 2JA6G 3TP8A 5BR8L 3GTLB 4LW1A 1FL0A 2F0DA 2MFIA 2MHVA 1DXMA 1EY6A 1K28A 1ZKOA 4LK1C 5KNBA 1TIID 1NSNS 3M4PA 1EIHA 5GAHC 3JAMi 5JPMC 1PDQA 3DMUA 3DWQA 1SE2A 4ZK9B 4JI7Q 5IT9L 1EQRA 3U58A 4ZQ3A 2O4XA 4A3JB 1WTOA 4JI1Q 4LF5L 1TY2A 5I9PA 1QVFA 2DNEA 4DF7A 1PTOF 4WFN3 2XIWA 2ZT9C 1NR4A 1QVGA 3TN2A 1I94Q 1EQTA 1STBA 3H94A 3N6RA 3E0JA 1S3OA 1G91A 1W6JA 1UWVA 1Q3LA 4QGUA 2MJ8A 1XNRQ 2B2TC 1U4LA 5FKAC 2CWPA 3STBD 5CMDA 1GM5A 2R7ZH 1JJGA 1HA6A 1TT2A 2EIFA 5C44G 3BJUA 4K2LA 5IODA 2OQKA 4IFDH 5IP9H 3PF4A 2VQFQ 1HJPA 1Q8IA 4DR7Q 1K8AC 1RDPD 3MVVA 1CUKA 1GOZA 2K33A 1O7ZA 2RQXA 1PH9A 3G48A 1QB5D 1BVSA 2F4IA 3A7AB 2QF7A 1LT6D 1D1KA 3HOZG 1K8MA 1I50B 4G7HC 1IW7D 2L0CA 1WTRA 1MHWC 1I4HA 4CKEA 1IZ6A 3BVGA 2JEAI 2C35B 4XYOA 4AYBB 3VYSA 4LF4L 5EPKA 1S72A 2BH2A 2VL6A 3GTJB 4A3JH 1H9RA 3H6MA 1GUOA 4POFA 2R61A 1EQQA 1EOVA 2NN6I 4JI8Q 2VW9A 5FLXc 1CSQA 5EKIA 2XRSD 3DUZA 1SE8A 1Q7YC 4GKJQ 2UUAQ 4JI4Q 2QEXA 2JA7G 4LF7Q 2E2HB 1HUMA 1PRTC 1DCZA 1U4PA 1X54A 5TSSA 4A3DB 3F2CA 1RJTA 2NB0A 4DR5L 2L15A 3MFGA 2E5LQ 5GADC 4JI3Q 3E3XA 1F9PA 3SK8A 3J7AV 3WDNA 4TQUS 1MKHA 5CV7A 2MPMA 1O78A 3BZCA 2B29A 1X3PA 1CT1D 1UE1A 5C3WA 1SNMA 2P5ZX 3NSWA 4X3KA 1PMRA 3OTOQ 1VQNA 3SVMA 1L1OC 1RL2A 2B2VA 4PZ7A 1IXRA 5IIFA 2WB1G 4NP5A 3D0FA 4RCOA 1WOCA 1HXYD 4XDXA 1M1KC 4LFCQ 2BDOA 3AU7A 3DEOA 4ZYSA 1U5KA 3EN2A 4FVMA 3J7ZC 5AJ3Q 3KBGA 4RAUC 1Q1EA 2JA8G 4A3CH 4A3MB 1I50H 1JQYD 4O0AA 4OWXB 3R93A 2B2YA 1ML0D 2EYMA 3E9IA 3HOUB 3PCOB 3NELA 3GTOH 3QB3A 2LS01 4HJ7A 1K0SA 3U4ZA 5I6WA 1PRTB 1A3TA 1EZ6A 4A3MG 3Q8DA 3BG3A 3SR1A 1SSOA 1CKMA 2JXMB 1WTQA 1NJIC 3SE0A 2J0TD 3PQIA 1XPOA 3KJOA 2GVAA 2JA5B 3OMCA 5FO8B 1YNJC 2XSCA 4BBRG 1Z47A 2UUBQ 3X3NA 3GTQH 2OTLA 4YHHQ 2K5WA 3KYHC 4A3DH 4GKJL 4BY1G 1AH9A 2Z0SA 1MSHA 1B1ZA 4P2CB 3NUCA 3D8GA 4IUNA 5IE8A 3TRZA 3M3YH 2LXJA 1VF5C 4XIGS 1KNAA 3PIP3 5KRUA 1PVOA 3H3VC 1H9SA 5C4XG 5EKKA 3U4VA 4WJ4A 3AEVA 3SK6A 5J39A 3LWEA 4JYAQ 3KLSA 4WORA 3ZJYC 4DR4L 2AHOB 2CFMA 5CBEE 3CC2A 5IYCG 3KF8A 1BOSA 1XMQQ 5T1GA 5K5PA 4A75A 3HOXB 3V05A 1VDZA 5IT9c 4GNXC 3R3OA 4LFCL 2K14A 2ZXPA 4DK6C 1F2LA 1MD2D 2OXPA 4CDDC 3HOUH 4A3IH 5IP7H 2SEBD 2IHEA 2EY1A 5E7NA 3HOWH 2LSSA 2H5XA 2HT1A 2JE6I 3GV3A 5JEAJ 3HOXG 3H0GB 1FNUA 1I6VC 4RKLA 4DV5L 1G2TA 3N52A 1XNQL 4BY7H 2JA5H 4HEDA 4A3BG 3I4OA 4Y7NB 3S9WA 1MIUA 1ASYA 5DM73 4RHRA 3TZDA 4HJAA 2UUBL 4R4TA 1J5EL 1BCPC 1CKNB 2SDFA 5E4WC 4Q5VA 3DHQA 2RDHA 4AH6A 3MFYA 1WJJA 3R2IA 2KBNA 1PH1A 4KN4C 1TWGB 3K5LA 3P20A 3GTMH 4QIWE 2Y0SE 1WD0A 3KLSX 1WTXA 3K7AB 1QWYA 3EROA 1NAPA 4FF2A 3I73A 2CCZA 1KDBA 1W6KA 1STHA 2D62A 1GUWA 1K3BC 2EYOA 5HGQA 2HHHL 4LF6L 2QILA 4DK0A 3KOJA 2HCCA 1AP0A 1KC8C 2NVYB 5J3BA 1VMPA 2IJ0A 2HIXA 4ZAIA 5FO7B 5EBCA 4MHEA 1LTLA 4DV1L 4X3UA 1O7IA 1R4QB 4YWMA 4B3TQ 5IYBH 4GN4B 4ILWA 1SJED 4JI5Q 2ZM6L 1JC7A 4DU9A 1Q86C 1JCKB 2J7ZA 4KKUA 1SYFA 3H0GH 4IUVA 1BCPB 5FLMH 1IBLQ 1HUNA 4Q0FA 1E22A 3PIPA 3BDLA 1D5MC 3F1ZA 1Y1WB 4Y7NH 3CPFA 4LUOA 2NVTB 4C3JB 2I5LX 4LF9L 1D1IA 1SFOB 5E4XA 2F4VL 1QILA 1TWFB 2O5JC 3LWUA 1V1PB 4IN3A 2K1BA 1SNCA 3EBEA 2NTSA 2Q8RE 1HFNA 1V9PA 2WAQE 1ZYRC 1N32Q 2SNSA 1IYJB 3NK9A 1GUSA 1YNND 4DV2L 1TR5A 1GO3E 4GOPC 3ULPA 3D4RA 1B2TA 2MUYA 1CHPD 1STEA 3TSSA 3UDGA 4HSVA 2NVYH 4DXGA 3HOVB 3NTIA 1CFMA 2N3SA 2B63B 3J81E 3HS0C 1B44D 4YWLA 5JEAG 4A3EH 1BBWA 3J7A5 3UDIA 3K80C 1CK1A 2K5NA 1G291 3BU2A 1BBXC 2K5HA 1U4RA 2Z6BA 1N34Q 4CHTB 2B2WA 2B63G 4X62L 2E2JB 2MQHA 4IO9A 1Y1WH 1IBLL 1LYLA 2WFWA 3VR4A 1YVCA 1TQOA 4C3JH 2PNHA 2KEEA 1FR3A 1RIPA 1QNKA 1STYA 2IHFA 1SFOH 5I4DA 3HEJA 4RMFA 5ELEA 2D2CC 1PV4A 2VB3X 2DJGC 4EX5A 1GUNA 2Q2TA 1YZ6A 3MTSA 3UI2A 4BBSH 3RD4A 3EVQA 1II3A 4QY7A 2JN4A 5COYA 4K5XA 1OXTA 4MTKA 2QGQA 5M3MH 2K03A 4N8X1 4PV1C 1EQVA 4X65L 4OO1G 1C48A 4JOIC 1VQJA 2EY2A 2KVMA 2YU9B 1PFBA 1E1TA 3I4MB 2KHSA 2PZWA 1EOTA 3NEMA 3C3LA 2K5VA 1XMOQ 2NZHA 1YNXA 1KD1C 3CQZB 3HOVH 1OXUA 3J80i 3F2DA 4A3FB 4H02A 1HRJA 1B70B 3OYYA 5IGCA 5ELCA 1Y8PB 2XVSA 1WTHA 1LT3D 2I46A 1SDFA 3U50C 4A3FG 3RZDB 5I2YA 1SYBA 2CKZB 5EGTA 5DLQE 1VQ6A 1N34L 1RF2D 4KK7A 3FPPA 3KJPA 3BZKA 1ICFB 4K8JA 3KDFB 5A2QL 5AFWA 2BCOA 1SMYC 4G57A 1EIGA 2CW0C 2UXCQ 1E2VA 2KCMA 3K81C 1E0BA 1PYBA 3K7UC 4NPSA 1ENAA 2OT2A 1F2ZA 3PMFA 2EYFA 4OXPA 4OIJA 5A35A 2KCCA 2L5TA 3TS0A 1STGA 1Y69U 2GN5A 1IBML 1Z7TA 4CBVA 4GLAC 1STAA 4B3RQ 4ME3A 4F7XA 2QDLA 2PQAA 2PCFB 4GLVB 1HR0Q 2K04A 3A55A 4G4KA 4PQXA 3DWPA 2X69A 2PPBC 2C9OA 3LGJA 3FEWX 1W3SA 1VQKA 5IYDH 3I4MH 2AWNA 3FKIG 3G4SA 1C4QA 1SYCA 4IPHA 5M3FH 4ULLA 3CQZH 1EFWA 2MO0A 1TS3A 1SR3A 1XMOL 3JAME 3A0JA 5DM63 5A2QE 1WCMH 3W1BA 4QL5A 2EY6A 2F03A 2R7DA 3W1GA 2IT1A 5CYUA 1G6PA 4K14A 4PNYA 1AFPA 4IQZA 1MI2A 4XQQA 1HZ9A 1E7ZA 1PH6A 4B9XA 3MXNA 1XYIA 4I7AA 4DV7L 2RDFA 3KF6A 3Q22A 3CC4A 3WWVA 2K52A 5D3IB 4A3GG 1RHPA 4QF4A 3NHHA 4QMGA 2L1BA 2F3IA 4RH6A 3U9SA 4APVA 2UXCL 2NN6G 2NWGA 1UE7A 2HIVA 4RWSC 4R8NA 3E5SA 4HSPA 2A6ED 1N36L 1C0AA 4ZLTF 1V1QA 5C4JB 1UAPA 1G6ZA 5KNDA 2JA6B 2UXDL 3NE5B 4L5TA 4B3RL 1VQFA 1NBWA 1LLRD 2QCPX 2D9UA 4JK1C 1HA5A 2HD3A 4HR7B 3EFXD 5BN3A 1HR0L 1EUJA 3HKZE 4YY3L 3TBIB 1LABA 4FO2A 1EIYB 1HHVA 2F0OA 2F0EA 2K7VA 5EBDA 1Y14B 2NTTA 2ALYB 4BWGB 4UHVA 1VQLA 2Q2UA 3S1NB 4QUCA 4OHJA 4BXXG 2EVBA 2Z6KC 3L3OC 2V1CC 4HCSA 1C9OA 3GO5A 1X65A 2BE5D 3CF5A 5IGFA 2E8GA 4OWWB 3TQYA 4A3KG 2KA7A 2XWBB 2F0TA
chains in the Genus database with same CATH topology
1FD7D 1KDCA 1Y1VB 2A69D 1G8ZD 3D6WA 4HAEA 5C0XG 5C44B 2WKCA 4IUPA 5CGKA 2KQ3A 1CA6A 3HOYB 2EDGA 3EA6A 1TKWB 4XTCS 3LNNA 1RCVD 1TY0A 1H9MA 3Q0AA 1D5ZC 1SNOA 3HOZB 1JICA 2N55A 4FXGC 1A3VA 3QJYA 5CV8A 3SK5A 2FINB 2F0HA 4EQOA 1SNDA 2EYLA 5KYIA 1M8AA 1XWEA 2NVXB 4PMCA 1KTKA 1KLUD 1J8IA 2B2UA 5M5WB 2BA1A 2JA7B 4XYQA 3OOCA 1MGSA 3PUZA 1NR2A 3GTKB 1LO5D 4QB4A 1GUTA 2F0VA 5KYLA 4I65A 2EXZA 4CJ0B 3S1RB 1CZGA 2OEOA 3MAQA 3PUXA 4HTHA 1SE3A 2EY5A 5KEEA 1EWCA 1LT4D 3GTPB 2RBMA 3J7AF 1LTRD 2WB1B 1LTTD 1TWCB 1L0YB 1AEXA 2IX3A 2G9HD 2JA8B 4K6LA 2CHBD 1XTCD 2EPBA 3O13A 4KD3A 3MHBA 2FMMA 1F9SA 4CKBA 1OXXK 2BOSA 4IFDI 3BDCA 1QG7A 2B8FA 5KIXA 2F0GA 1F77A 4IURA 1GHKA 1ENFA 1UNSA 2KECA 4BBRB 4CGYB 4R9WA 1VF7A 4BY1B 1LTSD 2G9DA 3K5MA 3CHBD 3GTGB 4FNFA 2F0QA 2XN9C 1AZQA 3C2PA 1WD1A 1O80A 4O42A 3VYTA 4RGOS 2M00A 5C4XB 5ELBA 1H9JA 1RKNA 3RUZA 2F0PA 2A68C 1PTOC 1R9TB 3BVZA 4KV6A 4I7ZC 1SEBD 2JSOA 4IUQA 5FO9B 3PO2B 2RSNA 3H91A 3QIAA 1JE4A 2WKDA 1A6XA 3OIPA 1TS4A 1QE6A 2J4XA 3A8KE 4UDUC 2A73B 3M4YA 5HGTA 4HMIA 4KD4A 3S2HB 3S17B 1OO9B 2EOTA 3D4DA 5F2DA 5D65A 4A3BB 2PW7A 1ICWA 5CBAE 3L9AX 4L63B 2ENBA 5K36G 1FNWA 1PTOB 5KGUA 4KJNA 4FF1A 1EY7A 2KJXA 5I6YA 4ODGA 1JWUD 3PUVA 2Q8TA 2CVRA 3K59A 5E1FA 1TWAB 3TP7A 5M9OA 2PZUA 5NUCA 4DXFA 2IW3A 2RA4A 3VR3A 3T53B 2F3WA 1K8OA 4V0BA 1EYAA 2FHTA 4O1NA 2WV6D 5CC4A 3C1FA 4F87A 1EWHA 4U673 1T5XD 3NWSA 1EEFD 3NQIA 3P75A 1I3QB 5IGGA 3VA7A 1IW7C 3CRLC 2R92B 3L7ZC 3C46A 2A74C 3OSOA 3EJIA 3J80L 3GV6A 1JR0D 4KY5A 3J81L 1H9KA 4ZUIA 4G7ZC 4PMBA 5J22A 2A5HA 1VCIA 3MA2B 1SNPA 3TZUA 4DN4M 4IUTA 5JOBA 2VNUD 2CQAA 1S5FD 1B53A 1PXUA 3DXJC 2D5DA 5ELDA 3K0YA 5E3FA 3S2DB 1NUCA 1X3QA 3FPUB 4KJOA 5DNFA 1KLGD 1R4PB 2Z4HA 2EJMA 2A6HD 3G7LA 3X3MA 3T4AC 4FP5D 1WTWA 1T5EA 3I70A 3J80E 2IX1A 1DOLA 5LL6S 2K28A 3MEHA 3K5OA 4TSSA 3LX0A 2V4DA 4C3IG 2B2VC 3Q6SA 1NCVA 2M9VA 2R6GA 2X6LA 1RD9D 4DA2A 4RCNA 3NWTA 3I72A 2X6GA 3NBHA 2B2YC 3SEBA 2HDMA 3HGBA 1BO0A 3BYYB 4QCLA 2YYZA 1S5BD 4C3HB 1JORA 5CV9A 5JPNC 4J1MA 4C1NI 4NDXA 1E2WA 1LACA 3I90A 5C3XA 3VR6A 5LL6X 1QJOA 3MC0B 4C3HG 2L55A 1RODA 1B9MA 3S15B 1SNQA 5JEAH 5KNCA 4CJ1B 4UAIA 1X32A 5JVH3 1JOOA 1HFGA 2F0KA 1EZ8A 2LKVA 3IKJA 4FF3A 4DK1A 4RGNA 1E2ZA 3A8IE 3MWYW 3W2DA 2SNMA 1KNEA 1TS5A 4NW2A 4TRDA 3RLFA 2F0UA 3I8ZA 2K6AA 1ESRA 4K5WA 2GA4B 4ID6A 2C5CA 3OMGA 4R8IA 4K2KA 4DFAA 4E6IA 5EKLA 2DY7A 3JAML 2H4OA 4HN7A 2EE1A 4IALA 5DAUA 1BDOA 1PLFA 4IFDJ 3K6OA 1IKLA 4KKSA 2QEJC 3MXPA 3OW7A 4F8MA 1BQQT 4OO1H 2MGSA 1BF4A 4FYDA 3DWAA 4ZKBB 1F9QA 3BYTB 3FKIB 3VYUA 1PRTD 3T56B 1J9OA 1O7YA 1ZEQX 1SBBB 4OL7A 2NUCA 3PUYA 4PMWA 5EPLA 5M5XB 1DJRD 2XWJB 4XT3B 4L6TB 1U4MA 1A3UA 4ABNA 3S14B 3T13A 2KUMA 1FNVA 1DYQA 2F0FA 2EJFC 4C2MB 4ZKCB 3K57A 4A3GB 1UUPA 4RGMA 2KOLA 1CI3M 3P1HA 3R2TA 2ZXOA 4N9PA 5ISRA 3MXUA 5C6AA 2AQ2B 1WVLA 5FLXE 1I4GA 3G6JB 3V96A 1ENCA 1F2MA 1IYUA 4KTAA 1PRTF 4DAYA 4DNRB 1V43A 3BDOA 1YNJD 2EYJA 2PW5A 2TSSA 4TKOB 5EJWA 3A7LA 2E75C 2K05A 1Q1BA 4DNTB 1IKMA 1LTID 3Q23A 1CQVA 4K8IA 4H0LC 2E2DC 3U9OA 4K5VA 3GD7A 1YNNC 2AWOA 3BZDB 3SXHA 2R7ZB 2E2IB 4A3KB 4GZYC 2R3ZA 2ID0A 3ND9A 2OF1A 1S5CD 4IFDG 2IWHA 2NN6H 1CZWA 3I91A 3ZYYX 2JEBI 1A2UA 1PYWD 4FXKC 2I07B 2B2WC 1EY5A 3I3CA 2DN8A 4MN3A 2N88A 4Z9CB 3PIO3 1ZXTA 2BDNA 5CV5A 3TP6A 1BCPD 4FF4A 1LT5D 1Q12A 4X3TA 2XRQD 4QIWB 3E6ZX 2NBFA 4QUFA 1EY4A 3SHLA 2Y0SB 1V1PA 2RSOA 2O5IC 3IL8A 3OWEB 4OIKA 2XNAC 2PQEA 4M1UB 1KABA 2F0LA 2QDBA 1UEAB 4N9TA 3OHXC 1GXDC 3D6CA 1OXSC 2PNRC 2Z4IA 4H13C 5IT9E 4KKTA 1SAPA 3KBXA 4WJWA 1CQFA 5C0XH 3AB9A 3QOJA 2BA0A 3HG9A 4RA8A 5JAVA 3ITPA 1D5XC 2LY7A 1A15A 3D4WA 1CM9A 1O7LA 2WACA 3QWNA 1IL8A 2K32A 1F2YA 3GTOB 5JJZA 3Q24A 3MXGA 2TMPA 2F1MA 1BCPF 1MBYA 3MZ5A 3GP7A 2B8GA 2PZTA 1EFID 3URYA 1U9RA 4LAAA 1EY0A 2DNCA 4H44C 3GTQB 1I4QA 3S16B 3ERQA 2E74C 2WAQB 3ND8A 4DAVA 5EQ0A 1ZYRD 3T16A 2F0IA 3K5NA 4S3SA 3M3YB 2F3VA 2PYKA 2HQEA 3V2TA 4YIJA 1EY9A 1PZID 3NQTA 4WRDA 2Q8IB 4KHVA 1BXTA 3H09A 2RDGA 2IL8A 4KY6A 4ZRZA 3FVQA 3NXWA 5CORA 1KAAA 2ICEC 5J1ZA 1MSGA 1I4XA 1PZKD 3P7JA 3QO2A 1VMCA 4A3IB 3W3AA 1B9NA 4IUUA 3DEPA 5C0XI 1I4RA 3HOWB 1B50A 4KN7C 2H1EA 2R93B 5HURA 4BY7B 4RHSA 3IFTA 4J8QA 4JBWA 1S5ED 1HPCA 5I9OA 2A6EC 3K58A 3TMEA 4K6DA 3S1QB 4XQJA 3GTMB 1SYEA 1IYVA 1WTVA 1QNUA 2M2LA 4ZUJA 1S4ZA 2FJ2A 2NYZD 5C3EB 3FDTA 2LFNA 4XQNA 1B3AA 3CRKC 2BE5C 4H7BA 2L4NA 1EU3A 5IGBA 1CA5A 3QOLA 3OPOA 3FRPB 1DM0B 2EYHA 4KHZA 2A69C 3BS1A 1PFNA 3VA5A 3HRZC 4A93B 5CR3A 2JP1A 1EY8A 3NTHA 4B08A 4CKCA 1TU2B 3OWFA 2K5QA 5C4HA 1SMYD 3C1EA 2L9HA 3D31A 2CW0D 2PMZB 4EQPA 3CU7A 2FMCA 3QG1A 4LMQD 1JWSD 2AUKA 1ESFA 2ZXRA 4B9WA 4V190 2JYOA 1JWMD 1Z6HA 4KY7A 1TWHB 2LMCB 3NTKA 2F0SA 5K36H 4FXDA 1V8QA 1EEID 5D3DA 2F0NA 1TVXA 3BVMA 3NP8A 1ILQA 2L11A 5M5YB 1PTOH 3RMHA 2B2UC 4A3EB 3IFDA 3TP5A 2RKSA 2AUJD 1RTNA 1OXVA 3OIQA 1Y8NB 2Z8LA 2B39A 4HCEA 2SOBA 4G7OC 4XT1B 3D3RA 2IX0A 1C8CA 2ICIA 2F0WA 2VXWA 1XXGA 2F0MA 2MP1A 2QKIC 5IOCA 3SK4A 4C3IB 4BBSB 1I4PA 1SYDA 1GHJA 3S1MB 1XX8A 4C56C 5T1IA 4C3JG 3VR5A 3M7GA 3HKZB 5M3MB 1D6EC 5IGEA 3KLRA 1PZJD 2AQ1B 2O2LD 1EYDA 2F0JA 2EZVA 3A8JE 1IHZA 1SJHD 1M4VA 3I4NB 1B4OA 2KEDA 1SE4A 5I2XA 2RVLA 5LHY1 5EPJA 2FFKB 1EU4A 2NZ1D 2AQ3B 4EVOA 1HTPA 1G2SA 2HDLA 5JVG3 5CV4A 2HCIA 1D2BA 5FK9C 1STNA 2WIIB 4CJ2C 1L0XB 1V1OA 3A54A 1GUGA 2B2TA 1AZPA 4HMJA 1BUVT 3T51B 1CTMA 1HQRD 2L12A 3KK7A 4XXEA 2WP8J 3NBIA 4RGTA 4OGQC 5G3LD 1TS2A 1SYGA 3WOFA 2K5DA 4KMUC 5C4ZA 1DOMA 1GJXA 3VYRA 1PFMA 5M3FB 1ET6A 1FGBD 2HUGA 1DZ1A 5CV6A 5FOBB 1LV9A 1QCBD 3M4OB 1LTAD 1WCMB 3PO3B 4IZ8A 2WINB 2EYPA 1FYCA 4J6HA 4LJZC 1BR9A 3F2UA 4L8JA 3J7YW 1Q90A 1S5DD 3CKIB 2NVQB 2DY8A 2Z1CA 3M7NA 1RTOA 5D14A 1DD2A 1Y8OB 1H9SB 1WTPA 3KUPA 5FLXL 5G3LF 1A2TA 4M8AA 4F88A 1SXTA 1HTLD 3EQLC 5C0XJ 2VUMB 3I4LA 4EGVA 3DM1A 2KCNA 1BNZA 4EQNA 4RFBA 1ONLA 5ELFA 1ILPA 2EJGC 1DOKA 2IPKD 3SDZA 4DAPA 1AN8A 3VR2A 1AW7A 3IAYA 2VB2X 4X3SA 1KDAA 1HCZA 1DONA 5DEHA 4BS9A 2K01A 3NPPA 3HP3A 5BN5A 3GQBA 3WOEA 1LTGD 4ME5A 1JB3A 1JOKA 3R8BA 3A56A 2PO4A 2A68D 1K83B 1PTOD 4C1NK 4OO1I 1LTBD 1EL0A 3M85A 4BA2I 2A6HC 5BN4A 1QOHA 3FMCA 4BA1I 3AMUA 1F9RA 1ET9A 3HZXA 4KI0A 4MIUA 5C5LA 3TDQA 4NMZA 5C5MA 2E76C 3PV0A 1HQMC 4NKLA 3PUWA 4U68A 1JOQA 1CHQD 3RZOB 1I6HB 1EYCA 3ONAB 4DGZA 4RKBA 3TP8A 3GTLB 2F0DA 2MHVA 1DXMA 1EY6A 1ZKOA 4LK1C 5KNBA 1TIID 1NSNS 1EIHA 5JPMC 1PDQA 3DMUA 3DWQA 1SE2A 4ZK9B 5IT9L 4ZQ3A 2O4XA 4A3JB 1WTOA 1TY2A 5I9PA 2DNEA 4DF7A 1PTOF 4WFN3 2XIWA 2ZT9C 1NR4A 3TN2A 1EQTA 1STBA 3H94A 3N6RA 3E0JA 1G91A 1W6JA 1Q3LA 2MJ8A 2B2TC 1U4LA 5FKAC 5CMDA 1HA6A 1TT2A 4K2LA 5IODA 4IFDH 1Q8IA 1RDPD 3MVVA 1GOZA 2K33A 1O7ZA 2RQXA 1QB5D 2F4IA 3A7AB 2QF7A 1LT6D 1D1KA 1K8MA 1I50B 4G7HC 1IW7D 2L0CA 1WTRA 1I4HA 4CKEA 3BVGA 2JEAI 4XYOA 4AYBB 3VYSA 5EPKA 3GTJB 1H9RA 3H6MA 1GUOA 2R61A 2NN6I 5EKIA 2XRSD 3DUZA 2E2HB 1HUMA 1PRTC 1DCZA 1U4PA 5TSSA 4A3DB 1RJTA 2NB0A 3MFGA 1F9PA 3SK8A 3J7AV 3WDNA 4TQUS 5CV7A 2MPMA 1O78A 1X3PA 1CT1D 5C3WA 1SNMA 3NSWA 4X3KA 1PMRA 3SVMA 2B2VA 5IIFA 4NP5A 4RCOA 1HXYD 4XDXA 2BDOA 3AU7A 3DEOA 4ZYSA 4FVMA 3KBGA 4RAUC 1Q1EA 4A3MB 1JQYD 3R93A 2B2YA 1ML0D 2EYMA 3HOUB 3QB3A 2LS01 5I6WA 1PRTB 1A3TA 1EZ6A 3BG3A 3SR1A 1SSOA 2JXMB 1WTQA 3SE0A 2J0TD 2JA5B 3OMCA 5FO8B 1YNJC 2XSCA 1Z47A 3X3NA 2K5WA 1MSHA 1B1ZA 4P2CB 3NUCA 3D8GA 4IUNA 1VF5C 4XIGS 1KNAA 3PIP3 5KRUA 3H3VC 1H9SA 5EKKA 3SK6A 5J39A 3LWEA 3KLSA 4WORA 5CBEE 3KF8A 1BOSA 5T1GA 5K5PA 3HOXB 3V05A 1VDZA 3R3OA 2ZXPA 1F2LA 1MD2D 2OXPA 2SEBD 2EY1A 2JE6I 3GV3A 5JEAJ 3H0GB 1FNUA 1I6VC 4RKLA 1G2TA 3N52A 4HEDA 4Y7NB 3S9WA 5DM73 4RHRA 3TZDA 1BCPC 5E4WC 2SDFA 4Q5VA 3DHQA 2RDHA 3MFYA 3R2IA 4KN4C 1TWGB 3K5LA 3P20A 1WD0A 3KLSX 1WTXA 3K7AB 1QWYA 3EROA 1NAPA 4FF2A 3I73A 1KDBA 1W6KA 1STHA 2D62A 1GUWA 2EYOA 2QILA 4DK0A 2HCCA 1AP0A 2NVYB 1VMPA 2IJ0A 4ZAIA 5FO7B 5EBCA 4MHEA 4X3UA 1R4QB 4ILWA 1SJED 1JC7A 4DU9A 1JCKB 2J7ZA 4KKUA 1SYFA 4IUVA 1BCPB 1HUNA 4Q0FA 3BDLA 1D5MC 1Y1WB 2NVTB 4C3JB 1D1IA 1SFOB 5E4XA 1QILA 1TWFB 2O5JC 3LWUA 1V1PB 4IN3A 2K1BA 1SNCA 2NTSA 2Q8RE 1HFNA 1ZYRC 2SNSA 3NK9A 1GUSA 1YNND 1TR5A 3D4RA 1B2TA 2MUYA 1CHPD 1STEA 3TSSA 4HSVA 4DXGA 3HOVB 3NTIA 1CFMA 2B63B 3J81E 3HS0C 1B44D 5JEAG 1CK1A 1G291 1BBXC 1U4RA 4CHTB 2B2WA 2E2JB 3VR4A 1TQOA 2KEEA 1FR3A 1QNKA 1STYA 5I4DA 3HEJA 5ELEA 2D2CC 2VB3X 1GUNA 3MTSA 3UI2A 3RD4A 3EVQA 1II3A 5COYA 4K5XA 1OXTA 2K03A 4PV1C 1EQVA 4OO1G 1C48A 2EY2A 2KVMA 2YU9B 1PFBA 3I4MB 2KHSA 2PZWA 1EOTA 3C3LA 3CQZB 1OXUA 4A3FB 1HRJA 5IGCA 5ELCA 1Y8PB 2XVSA 1LT3D 2I46A 1SDFA 3RZDB 5I2YA 1SYBA 5EGTA 1RF2D 4KK7A 3FPPA 4K8JA 5A2QL 5AFWA 2BCOA 1SMYC 4G57A 1EIGA 2CW0C 1E2VA 1E0BA 1ENAA 2OT2A 1F2ZA 3PMFA 2EYFA 4OIJA 5A35A 2KCCA 2L5TA 1STGA 1Y69U 1Z7TA 4CBVA 1STAA 4F7XA 2PCFB 2K04A 3A55A 4G4KA 4PQXA 3DWPA 2X69A 2PPBC 2C9OA 3FEWX 2AWNA 1C4QA 1SYCA 4ULLA 1TS3A 3JAME 5DM63 5A2QE 2EY6A 2F03A 2IT1A 5CYUA 4K14A 4PNYA 1AFPA 4IQZA 1MI2A 4XQQA 4B9XA 3MXNA 1XYIA 2RDFA 3Q22A 5D3IB 1RHPA 2KA7A 4QF4A 3NHHA 4QMGA 2L1BA 4RH6A 3U9SA 2NN6G 2NWGA 4RWSC 4R8NA 3E5SA 4HSPA 2A6ED 4ZLTF 5C4JB 1UAPA 1G6ZA 5KNDA 2JA6B 3NE5B 2QCPX 1LLRD 2D9UA 4JK1C 1HA5A 4HR7B 3EFXD 5BN3A 3TBIB 1LABA 4FO2A 1HHVA 2F0OA 2F0EA 2K7VA 5EBDA 2NTTA 4BWGB 3S1NB 4QUCA 4OHJA 2EVBA 3L3OC 4HCSA 3GO5A 2BE5D 5IGFA 5IGDA 2XWBB 2F0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  1KDB A;  5I6W A;  1STH A;  1TT2 A;  1A3T A;  1KDC A;  4K2L A;  4IAL A;  2EYO A;  5IOD A;  1EZ6 A;  1F2Y A;  1SYG A;  5KGU A;  4ZUJ A;  3SR1 A;  5DAU A;  3SXH A;  4KJN A;  1EY7 A;  5I6Y A;  4ME5 A;  4ODG A;  2SOB A;  5EKL A;  4KD3 A;  3MHB A;  3MXP A;  3OMC A;  4F8M A;  3MEH A;  1SYC A;  5C4Z A;  1TQO A;  3MVV A;  5E1F A;  3MZ5 A;  1JOK A;  2F0W A;  3LX0 A;  1STY A;  3BDC A;  3TP7 A;  2PZT A;  5KIX A;  3HEJ A;  2F0M A;  5CGK A;  2KQ3 A;  5M9O A;  2F0G A;  1U9R A;  2OF1 A;  1EY0 A;  2EY6 A;  2PZU A;  4LAA A;  3NUC A;  3EVQ A;  1II3 A;  3D8G A;  4H7B A;  4IUN A;  5CV6 A;  5IOC A;  5NUC A;  4K14 A;  4K5X A;  5IGB A;  4PNY A;  3QOL A;  3SK4 A;  3ERQ A;  4OL7 A;  4DU9 A;  2F3W A;  2NUC A;  1SYD A;  4IZ8 A;  4B9X A;  5KRU A;  1SYF A;  1EYA A;  2EYH A;  1EQV A;  1SNO A;  2EYP A;  5EKK A;  3T16 A;  2F0I A;  4J6H A;  1A2U A;  3VA5 A;  2RDF A;  3H6M A;  4S3S A;  5CC4 A;  2F3V A;  3SK6 A;  2F0Q A;  5J39 A;  2PYK A;  2EY2 A;  5CR3 A;  5IGE A;  3C1F A;  3HZX A;  2HQE A;  1A3V A;  4MIU A;  4WOR A;  5C5L A;  3BDL A;  4YIJ A;  3V2T A;  5CV8 A;  1A3U A;  1EY8 A;  1JOR A;  1EY5 A;  3SK5 A;  5CV9 A;  1EY9 A;  2KHS A;  2PZW A;  2M00 A;  1EYD A;  2F0H A;  4NMZ A;  3NQT A;  4NKL A;  1SND A;  5C5M A;  4EQO A;  4WRD A;  1RKN A;  3OWF A;  4KHV A;  3NHH A;  4QF4 A;  2EYL A;  3RUZ A;  3T13 A;  2F0J A;  3C1E A;  5C4H A;  5KYI A;  1EYC A;  4J1M A;  2F0P A;  4DGZ A;  2F0F A;  3P75 A;  4KY6 A;  4RKB A;  3TP8 A;  4NDX A;  5K5P A;  5IGG A;  5C3X A;  4PMC A;  1IHZ A;  2F0D A;  4EQP A;  5IGC A;  3R3O A;  1EY6 A;  1A2T A;  1SNC A;  5CV5 A;  3TP6 A;  2OXP A;  3OSO A;  4R8N A;  4KV6 A;  3E5S A;  1NSN S;  3NXW A;  3P1H A;  1KAA A;  1EY4 A;  3EJI A;  1SNQ A;  5J1Z A;  3DMU A;  4N9P A;  3SHL A;  4B9W A;  5ISR A;  3SK8 A;  2SNS A;  2EY1 A;  1JOQ A;  5CV7 A;  3NK9 A;  5C6A A;  4KY5 A;  1SYB A;  4ZQ3 A;  4QB4 A;  5KYL A;  2F0V A;  2O4X A;  1JOO A;  2F0K A;  4RKL A;  5EGT A;  2PQE A;  4KY7 A;  1EZ8 A;  4I65 A;  1TR5 A;  4EQN A;  2EXZ A;  1KAB A;  2LKV A;  1ENC A;  4ZUI A;  4EVO A;  5C3W A;  1SNM A;  1F2M A;  2F0L A;  2OEO A;  2QDB A;  4K8J A;  4KTA A;  4N9T A;  4PMB A;  2F0S A;  2F0O A;  5CV4 A;  4DF7 A;  5I9P A;  5J22 A;  2F0E A;  1STN A;  3D6C A;  4HTH A;  5HGT A;  4G57 A;  4HMI A;  3S9W A;  4KD4 A;  2SNM A;  5HUR A;  5IIF A;  2EY5 A;  4NP5 A;  1SNP A;  5KEE A;  3ERO A;  3D4D A;  2EYJ A;  4TRD A;  5JOB A;  1STB A;  2F0N A;  2PW5 A;  5F2D A;  1ENA A;  2F0U A;  3NP8 A;  4HMJ A;  1F2Z A;  2RBM A;  3DHQ A;  2EYF A;  3PMF A;  5I9O A;  2PW7 A;  1STG A;  4K5W A;  5E3F A;  3QOJ A;  1NUC A;  3TME A;  1KDA A;  4K6D A;  2ENB A;  2EYM A;  5JAV A;  4KJO A;  4ID6 A;  3ITP A;  5IGF A;  3OMG A;  1STA A;  4K2K A;  5IGD A;  4K8I A;  1AEX A;  4F7X A;  3TP5 A;  3D4W A;  3QB3 A;  5DEH A;  2WAC A;  2RKS A;  3U9O A;  4DFA A;  4E6I A;  4QMG A;  2F0T A;  4K5V A; 
#chains in the Genus database with same CATH topology
 1FD7 D;  5IP9 G;  1KDC A;  1KRT A;  1Y1V B;  2A69 D;  1A8V A;  4DV6 Q;  1G8Z D;  3D6W A;  3CP0 A;  4HAE A;  1QUQ B;  2CH4 A;  3RLO A;  5C0X G;  5C44 B;  1K83 H;  2WKC A;  4TVA B;  2VY3 A;  1VQH A;  4IUP A;  5CGK A;  2KQ3 A;  1L2F A;  1CA6 A;  1Y1V G;  2A19 A;  3KFU A;  3HOY B;  1EIF A;  5JJI A;  2EDG A;  3EA6 A;  1TKW B;  4GKK L;  1SRO A;  4PZ6 A;  4XTC S;  5IWA Q;  3LNN A;  1RCV D;  2JA6 H;  1TY0 A;  5LMN L;  1H9M A;  3Q0A A;  1D5Z C;  1PYS B;  1SNO A;  3HOZ B;  3H15 A;  3HOY G;  1JIC A;  1EWI A;  2N55 A;  4GN3 B;  3RZO H;  4DKA C;  1I6H H;  4DR3 Q;  4FXG C;  1A3V A;  3QJY A;  5CV8 A;  2DUD A;  3SK5 A;  3GTL H;  2FIN B;  2F0H A;  4DK3 C;  4EQO A;  1SND A;  2EYL A;  3NBH B;  1NTG A;  2KHJ A;  5KYI A;  4HID A;  2K50 A;  1KAW A;  1M8A A;  1BKB A;  2Y0S G;  1XWE A;  2BH8 A;  2NVX B;  3E0E A;  4PMC A;  1KTK A;  1KLU D;  1J8I A;  2B2U A;  5M5W B;  2BA1 A;  1VQM A;  4NXN Q;  3AFP A;  3RR5 A;  2JA7 B;  4XYQ A;  1H95 A;  3OOC A;  4JI7 L;  1MGS A;  5GAE C;  3ULL A;  3PUZ A;  5H1S E;  1VQ5 A;  1NR2 A;  4L5Q A;  3CD6 A;  3GTK B;  1LO5 D;  4QB4 A;  1N33 Q;  1GUT A;  2F0V A;  4JI1 L;  5KYL A;  4I65 A;  4B3S Q;  2EXZ A;  4CJ0 B;  4NXM Q;  3S1R B;  1CZG A;  2OEO A;  1KIX A;  3MAQ A;  4K0K Q;  3PUX A;  4HTH A;  5C44 H;  3CCS A;  1I94 L;  1SE3 A;  2EY5 A;  5KEE A;  1EWC A;  1LT4 D;  3TS2 A;  3GTP B;  2RBM A;  3J7A F;  1LTR D;  1XNR L;  2WB1 B;  1LTT D;  1TWC B;  1KL9 A;  1L0Y B;  1AEX A;  5IWA L;  2IX3 A;  2G9H D;  4JI6 Q;  2JA8 B;  3HOZ H;  1E1O A;  1MJE A;  2VS1 A;  4K6L A;  5ELO A;  2VQF L;  1CKO A;  2CHB D;  2JK8 A;  1XTC D;  2EPB A;  4HIK A;  1YI2 A;  4DR7 L;  3RLN A;  1Q81 C;  3O13 A;  4KD3 A;  3MHB A;  1CSP A;  1PH8 A;  3SGI A;  2FMM A;  1F9S A;  1NY4 A;  3E9H A;  4CKB A;  1OXX K;  2BOS A;  4IFD I;  3BDC A;  3G71 A;  1QG7 A;  2B8F A;  5KIX A;  3UDX A;  3J81 j;  2F0G A;  1F77 A;  4IUR A;  1GHK A;  1ENF A;  1FGU A;  1UNS A;  2KEC A;  4BBR B;  4CGY B;  4R9W A;  3GTJ H;  2JA7 H;  2RHQ B;  1VF7 A;  4BY1 B;  1LTS D;  2G9D A;  1LUZ A;  2ASB A;  1D7Q A;  3K5M A;  3CHB D;  3T1H Q;  1NMF A;  3RNU A;  3GTG B;  1X55 A;  4FNF A;  2F0Q A;  3S1R H;  2XN9 C;  4JI8 L;  2OWO A;  1AZQ A;  2R7F A;  1WD1 A;  3C2P A;  4IJL A;  1O80 A;  4O42 A;  3L2P A;  2E2H H;  3VYT A;  4GS3 A;  4NXM L;  4RGO S;  2M00 A;  5C4X B;  2UUA L;  5ELB A;  1H9J A;  4JI4 L;  1RKN A;  4UP9 A;  3RN2 A;  3RUZ A;  4LF7 L;  4K0K L;  2OTJ A;  2F0P A;  2A68 C;  1PTO C;  1L1O B;  3CW2 C;  1R9T B;  3BVZ A;  2E5L L;  4JI3 L;  4KV6 A;  4I7Z C;  1SEB D;  2JSO A;  2MNA A;  4IUQ A;  5FO9 B;  2JA8 H;  3PO2 B;  2RSN A;  3H91 A;  3QIA A;  3CCR A;  2R93 G;  1FVI A;  1JE4 A;  2WKD A;  1A6X A;  3OIP A;  1TS4 A;  1QE6 A;  4BY7 G;  2J4X A;  3OTO L;  4JBM A;  3A8K E;  4UDU C;  1DGS A;  3HKS A;  3UDF A;  1A63 A;  2A73 B;  3M4Y A;  5HGT A;  4HMI A;  4KD4 A;  3S2H B;  1K9M C;  3S17 B;  1OO9 B;  3PO2 G;  4A3M H;  2EOT A;  3D4D A;  1FJG Q;  5F2D A;  5AJ3 L;  3AFQ A;  4P73 A;  5D65 A;  4A3B B;  2RCN A;  2RF4 A;  2PW7 A;  1ICW A;  4UY8 C;  5CBA E;  3L9A X;  4L63 B;  4DAY B;  2ENB A;  1N8R C;  4KLK A;  1IBK Q;  1HZA A;  4BY1 H;  4YWK A;  4MZ9 A;  1HR0 W;  2VZA A;  2Q2H A;  5K36 G;  1FNW A;  5C3E G;  1PTO B;  2KHI A;  5KGU A;  3I55 A;  1UE5 A;  5GRO A;  4KJN A;  4FF1 A;  1EY7 A;  2KJX A;  5I6Y A;  3DM3 A;  4ODG A;  4IJH A;  1X3G A;  5C4X H;  1JWU D;  3PUV A;  2Q8T A;  4HIO A;  2CVR A;  3K59 A;  5E1F A;  4JCV E;  2N8N A;  4GLX A;  4YHH L;  1TWA B;  4Y52 H;  3TP7 A;  1VQP A;  4UPA A;  1R9T H;  5M9O A;  5JJK A;  2PZU A;  5IYC H;  5NUC A;  4DXF A;  3STB C;  2IW3 A;  4A93 G;  2RA4 A;  3VR3 A;  3T53 B;  4GNX B;  2F3W A;  2VQE Q;  4KHP Q;  1K8O A;  4OWT B;  4RG1 A;  4DNI A;  4V0B A;  1EYA A;  3NEN A;  2FHT A;  4JYA L;  3CCM A;  4O1N A;  2WV6 D;  1K73 C;  5CC4 A;  3C1F A;  4F87 A;  3G6E A;  1EWH A;  4U67 3;  4JI0 Q;  3S2H H;  1T5X D;  3HOX H;  3NWS A;  1EEF D;  1GD7 A;  3NQI A;  1XMQ L;  3P75 A;  1KHI A;  4A3B H;  1I3Q B;  5IGG A;  1YIJ A;  1FJG L;  3VA7 A;  1IW7 C;  3CRL C;  2R92 B;  3L7Z C;  5LMN W;  2A74 C;  3C46 A;  3OSO A;  4POG A;  3EJI A;  3J80 L;  3GV6 A;  4AYB E;  4JG2 A;  1Q46 A;  1JR0 D;  4KY5 A;  1AE3 A;  3J81 L;  2R92 G;  2JA9 A;  1H9K A;  4OX9 Q;  4ZUI A;  4G7Z C;  1NNX A;  4PMB A;  3H3V H;  5J22 A;  3CCE A;  2A5H A;  1VCI A;  3MA2 B;  1SNP A;  3CCV A;  1TWA H;  3TZU A;  1TWG H;  4DN4 M;  4IUT A;  5JOB A;  2VNU D;  2CQA A;  1S5F D;  3CCL A;  1KQS A;  1Z9F A;  1B53 A;  1PXU A;  4JVZ A;  3DXJ C;  2D5D A;  3K7A H;  5ELD A;  3K0Y A;  5E3F A;  4B3M Q;  3S2D B;  1NUC A;  1X3Q A;  3FPU B;  5IY0 A;  4LFA Q;  4KJO A;  4DAM A;  4X66 Q;  1SN8 A;  5DNF A;  1KLG D;  1R4P B;  2WB1 E;  2Z4H A;  2EJM A;  2A6H D;  3G7L A;  4DR6 Q;  3X3M A;  3T4A C;  4FP5 D;  1WTW A;  1T5E A;  3I70 A;  3J80 E;  1P8L A;  2IX1 A;  1DOL A;  5LL6 S;  2K28 A;  3MEH A;  3CCQ A;  3M4Q A;  3K5O A;  4TSS A;  3LX0 A;  2V4D A;  4C3I G;  2B2V C;  1I3Q H;  3Q6S A;  1NCV A;  3ICE A;  2M9V A;  2FXQ A;  4B3T L;  3F2B A;  4YCU A;  2RHS B;  2R6G A;  5GAG C;  4P71 A;  4JI5 L;  2X6L A;  1RD9 D;  4A3L G;  3HKZ G;  4DA2 A;  4RCN A;  3NWT A;  4LFB Q;  3I72 A;  2X6G A;  3NBH A;  2B2Y C;  3SEB A;  2HDM A;  1XPU A;  2YTY A;  3HGB A;  1BO0 A;  3BYY B;  1PH5 A;  2ES2 A;  4QCL A;  1EYG A;  2NVT H;  2YYZ A;  1S5B D;  1XPR A;  4C3H B;  1Q8K A;  1JOR A;  4OX9 L;  5CV9 A;  1TWF H;  1S40 A;  2PI2 E;  5JPN C;  4GOP B;  4J1M A;  3S24 A;  4PZ8 A;  2D0O A;  3I4N G;  4C1N I;  3UE1 A;  4NDX A;  1E2W A;  1LAC A;  3I90 A;  5C3X A;  4DV3 Q;  1HNW Q;  1JT8 A;  3VR6 A;  3S2D H;  5LL6 X;  1QJO A;  3MC0 B;  4C3H G;  3PF5 A;  2L55 A;  3H3V I;  1ROD A;  1N32 L;  1B9M A;  3S15 B;  1SNQ A;  1JJ2 A;  4LUZ A;  4LFA L;  1A62 A;  5JEA H;  3KLW A;  5KNC A;  4CJ1 B;  4UAI A;  1X32 A;  5JVH 3;  1JOO A;  1HFG A;  2F0K A;  4DR6 L;  1EZ8 A;  1T9H A;  4X64 Q;  2LKV A;  3IKJ A;  4FF3 A;  4DK1 A;  4RGN A;  1E2Z A;  3A8I E;  2B63 H;  3MWY W;  3W2D A;  2SNM A;  1KNE A;  2XGT A;  1TS5 A;  4NW2 A;  4TRD A;  3RLF A;  3W5O A;  1A0I A;  2F0U A;  3I8Z A;  3GDE A;  2K6A A;  3JC6 6;  1ESR A;  3FP9 A;  4J15 A;  4K5W A;  3AQQ A;  4JI2 Q;  2GA4 B;  4ID6 A;  2C5C A;  3OMG A;  4R8I A;  4HJ9 A;  4K2K A;  2E2J H;  5FJ8 G;  5LMU Q;  2UUC Q;  4DFA A;  4JBJ A;  2DY7 A;  5EKL A;  4E6I A;  3JAM L;  4LFB L;  2H4O A;  4HN7 A;  2EE1 A;  4IAL A;  1SLJ A;  5DAU A;  4DPG A;  1BDO A;  1PLF A;  4IFD J;  1XTD A;  3K6O A;  1IKL A;  4KKS A;  2QEJ C;  3MXP A;  3OW7 A;  4F8M A;  4DR2 Q;  1BQQ T;  4OO1 H;  2G5D A;  2MGS A;  2UU9 Q;  1BF4 A;  3PO3 G;  4FYD A;  3DWA A;  4ZKB B;  1F9Q A;  3BYT B;  3FKI B;  2F52 A;  3VYU A;  1PRT D;  1X6O A;  3T56 B;  1J9O A;  4DV3 L;  2YTX A;  2PI2 A;  1O7Y A;  1ZEQ X;  3S15 H;  1SBB B;  4OL7 A;  2NUC A;  3PUY A;  4PMW A;  5EPL A;  2YU9 H;  1QZG A;  1HNX Q;  2ZJQ A;  5M5X B;  1DJR D;  2XWJ B;  1L1O A;  4XT3 B;  3B6Y A;  4NB3 A;  4L6T B;  1U4M A;  4A3F H;  4JV5 Q;  1A3U A;  4ABN A;  4X64 L;  3L0O A;  5JJL A;  2ZJP A;  3S14 B;  3T13 A;  2KUM A;  1FNV A;  1DYQ A;  3ULJ A;  3J80 c;  2F0F A;  2EJF C;  4C2M B;  4ZKC B;  3K57 A;  4A3G B;  1UUP A;  4RGM A;  2KOL A;  1CI3 M;  2VUM G;  1SMX A;  3RZD H;  3J81 c;  3P1H A;  3R2T A;  2ZXO A;  2ZJR A;  1PHJ A;  4N9P A;  4OEM B;  4JI2 L;  5ISR A;  3MXU A;  5C6A A;  4P75 A;  2AQ2 B;  1WVL A;  5FLX E;  1I4G A;  3G6J B;  3V96 A;  1ENC A;  4R4Q A;  1F2M A;  1IYU A;  4KTA A;  1PRT F;  4LF5 Q;  4DAY A;  3K8A A;  4DNR B;  1V43 A;  3BDO A;  1YNJ D;  4DR2 L;  2EYJ A;  3A5U A;  2PW5 A;  2TSS A;  3CPW A;  4TKO B;  1VQI A;  3A7L A;  3FKI H;  5EJW A;  2E75 C;  2N49 A;  2K05 A;  1Q1B A;  1N9W A;  4DNT B;  2IY5 B;  1IKM A;  1LTI D;  3Q23 A;  5IGD A;  1CQV A;  1CKN A;  4K8I A;  4H0L C;  2E2D C;  2I0Q A;  3U9O A;  1PH7 A;  4K5V A;  3GD7 A;  1YNN C;  5M5X H;  3I7F A;  2AWO A;  2QW7 A;  1VQA A;  4MTN A;  3BZD B;  3SXH A;  2R7Z B;  4PG3 A;  2E2I B;  2CWA A;  4A3K B;  4IOA A;  4GZY C;  4L5R C;  3A5Z B;  4LUV A;  2R3Z A;  4GNX A;  2ID0 A;  2D0P A;  3ND9 A;  3PSI A;  1M90 C;  4C2M H;  4A3G H;  4ZCK A;  1JJC B;  2R7Z G;  2OF1 A;  1S5C D;  4IFD G;  2IWH A;  2NN6 H;  1CZW A;  2HQL A;  3I91 A;  2YTV A;  3ZYY X;  4LF4 Q;  2JEB I;  1A2U A;  1PYW D;  4FXK C;  2I07 B;  2B2W C;  1EY5 A;  3I3C A;  2DN8 A;  4N8F A;  4OON A;  4MN3 A;  2N88 A;  1BBU A;  1K3R A;  4Z9C B;  3CXC A;  3PIO 3;  1PH3 A;  1ZXT A;  5C4J H;  2BDN A;  5CV5 A;  3TP6 A;  1BCP D;  1X3F A;  4FF4 A;  1LT5 D;  1Q12 A;  2ZTD A;  4X3T A;  2XRQ D;  4QIW B;  4DR5 Q;  5EAY A;  4A3J G;  3E6Z X;  1K8G A;  2NBF A;  4QUF A;  4BXX H;  1EY4 A;  3SHL A;  2Y0S B;  1XJV A;  3RN5 A;  1V1P A;  2RSO A;  2O5I C;  3IL8 A;  1Q82 C;  3OWE B;  4OIK A;  2XNA C;  2PQE A;  1QZH A;  4M1U B;  1KAB A;  1D8L A;  2E2I H;  2F0L A;  2QDB A;  1UEA B;  4N9T A;  4A3K H;  3S1N H;  4DR1 Q;  3OHX C;  1GXD C;  3D6C A;  4R4C A;  1OXS C;  2PNR C;  2Z4I A;  1LM0 A;  4H13 C;  5IT9 E;  4KKT A;  1SAP A;  3KBX A;  4WJW A;  1CQF A;  5C0X H;  1PH2 A;  3JAM c;  3AB9 A;  3QOJ A;  2BA0 A;  3HG9 A;  4RA8 A;  5JAV A;  1GVP A;  3ITP A;  4WJ3 M;  1VQC A;  1Y1V H;  1D5X C;  2LY7 A;  1A15 A;  4A76 A;  1E24 A;  1CM9 A;  1O7L A;  2WAC A;  3D4W A;  3QWN A;  1IL8 A;  2Z9H A;  1TXY A;  1F2Y A;  2K32 A;  3GTO B;  5JJZ A;  4DV6 L;  3Q24 A;  3MXG A;  2TMP A;  2F1M A;  1BCP F;  1VS0 A;  4O2D A;  3HOY H;  1MBY A;  1UE6 A;  4A3C G;  2B3G A;  1GKH A;  3MZ5 A;  3GP7 A;  2B8G A;  2PZT A;  4DV0 Q;  1EFI D;  4AYB G;  2NZO A;  3URY A;  4MNO A;  1U9R A;  2XTI A;  4LAA A;  1EY0 A;  3AYH B;  2DNC A;  4H44 C;  3GTQ B;  1I4Q A;  3S16 B;  3ERQ A;  2E74 C;  2WAQ B;  3ND8 A;  4DAV A;  5EQ0 A;  1ZYR D;  4GOP A;  3T16 A;  2F0I A;  4HJ5 A;  3K5N A;  4S3S A;  3M3Y B;  4DR3 L;  2F3V A;  2PYK A;  2HQE A;  3V2T A;  4YIJ A;  4A3D G;  2WAQ G;  1YJ9 A;  1B3Q A;  1EY9 A;  2CH4 W;  1PZI D;  2NVX H;  3NQT A;  1KRS A;  3EIV A;  4WRD A;  2Q8I B;  4KHV A;  4DR1 L;  4DR4 Q;  1BXT A;  3H09 A;  4YCV A;  2RDG A;  4YCW A;  5M5W H;  2IL8 A;  4KY6 A;  4ZRZ A;  3FHW A;  4NXN L;  4LF8 Q;  3FVQ A;  2I5M X;  3NXW A;  3GTK H;  5COR A;  1KAA A;  3T1Y Q;  3PIO A;  2ICE C;  5J1Z A;  1PA6 A;  1WI5 A;  3CC7 A;  2AKW B;  1MSG A;  1I4X A;  1PZK D;  1N33 L;  3P7J A;  3QO2 A;  1VMC A;  4A3I B;  4A4I A;  4LNQ A;  4B3S L;  3W3A A;  1B9N A;  3TRE A;  4IUU A;  3DEP A;  4DV5 Q;  2OQ0 A;  5C0X I;  1I4R A;  3HOW B;  1B50 A;  1XNQ Q;  4KN7 C;  4IPC A;  2H1E A;  4JW0 A;  4JC0 A;  4HJ8 A;  3GTP H;  2R93 B;  5HUR A;  4BY7 B;  3HOU G;  4RHS A;  3IFT A;  1TWC H;  4A3I G;  4J8Q A;  4JBW A;  5IP7 G;  1S5E D;  4R4O A;  4DUZ Q;  3KDF A;  1HPC A;  2DJF C;  2PQA B;  5I9O A;  4DV0 L;  1J5E Q;  2A6E C;  3HOW G;  3CCU A;  3K58 A;  3TME A;  3S16 H;  3OW2 A;  4K6D A;  3S1Q B;  4XQJ A;  1VQ4 A;  1C7Y A;  4JI6 L;  4JOI A;  1J6Q A;  2JA5 G;  3MEF A;  3GTM B;  1SYE A;  1IYV A;  1WTV A;  1QNU A;  2M2L A;  1MJC A;  4ZUJ A;  2OCE A;  2HHH Q;  1S4Z A;  2FJ2 A;  4LF6 Q;  1YHQ A;  2NYZ D;  5C3E B;  1JB7 A;  3FDT A;  2LFN A;  4XQN A;  1YEZ A;  4BBR H;  1B3A A;  2ZTE A;  3CRK C;  3MXN B;  2BE5 C;  4H7B A;  5GQO A;  4DV1 Q;  2L4N A;  1EU3 A;  3TEH B;  3KF6 B;  5IGB A;  3QOL A;  1CA5 A;  3OPO A;  3FRP B;  1DM0 B;  3GTG H;  4LF8 L;  3T1Y L;  2ZM6 Q;  3T1H L;  2LXK A;  2EYH A;  4KHZ A;  2A69 C;  3BS1 A;  1PFN A;  3VA5 A;  3HRZ C;  4A93 B;  5CR3 A;  2JP1 A;  1EY8 A;  3M9B A;  3NTH A;  4B08 A;  2R93 H;  4CKC A;  1W2B A;  1TU2 B;  3OWF A;  2K5Q A;  5C4H A;  1SMY D;  3C1E A;  5IYB G;  2L9H A;  3D31 A;  2CW0 D;  4LF9 Q;  2PMZ B;  4EQP A;  2F4V Q;  2GVB A;  3CU7 A;  2FMC A;  4DUZ L;  3QG1 A;  3PO2 H;  3H0G G;  4LMQ D;  4JBK A;  3S1Q H;  5FLM G;  1JWS D;  1YJW A;  2AUK A;  1ESF A;  2ZXR A;  4B9W A;  3K0X A;  4V19 0;  2JYO A;  1JWM D;  1Z6H A;  4KY7 A;  1VQ9 A;  3S17 H;  1TWH B;  1WFQ A;  4DV2 Q;  2LMC B;  3NTK A;  2F0S A;  5K36 H;  1HZC A;  5C3E H;  4FXD A;  2EXD A;  4HIM A;  1V8Q A;  1EEI D;  1VQ7 A;  1VQB A;  5D3D A;  2F0N A;  4GN5 A;  3CCJ A;  1TVX A;  3BVM A;  1HZB A;  3NP8 A;  1I5F A;  3QR8 A;  1ILQ A;  3ERS X;  2L11 A;  5M5Y B;  1IBK L;  1PTO H;  3RMH A;  1UEB A;  2B2U C;  4A3E B;  3IFD A;  3TP5 A;  2ATW A;  2RKS A;  4UP7 A;  2AUJ D;  1L0W A;  1RTN A;  3CAM A;  1OXV A;  2K4K A;  4A93 H;  3OIQ A;  1Y8N B;  1VQ8 A;  2Z8L A;  2I5H A;  4X62 Q;  2B39 A;  4HCE A;  2SOB A;  4CDC C;  4G7O C;  4IPG A;  4XT1 B;  3D3R A;  2IX0 A;  4A3E G;  1C8C A;  2ICI A;  2F0W A;  2VXW A;  4L5S A;  1XXG A;  2F0M A;  2MP1 A;  2QKI C;  1QUQ A;  3A74 A;  5IOC A;  1YJN A;  3SK4 A;  4C3I B;  1YBY A;  2VQE L;  4KHP L;  1Y1W G;  4BBS B;  1I4P A;  2EQS A;  1SYD A;  2MO1 A;  1GHJ A;  3S1M B;  1P16 A;  1XX8 A;  4C56 C;  5T1I A;  4C3J G;  3VR5 A;  3M7G A;  1TWH H;  3HKZ B;  4X65 Q;  5M3M B;  1D6E C;  5IGE A;  3KLR A;  4JI0 L;  1PZJ D;  2AQ1 B;  2KCT A;  1EYD A;  2O2L D;  1X9N A;  4UP8 A;  4BBS G;  2R92 H;  2F0J A;  5L37 A;  2Z6K A;  2EZV A;  4QJF A;  3A8J E;  1IHZ A;  1X3E A;  5M3M G;  5M5Y H;  4R4I A;  1SJH D;  1M4V A;  5ELN A;  3I4N B;  1B4O A;  1JE5 A;  2KED A;  1HNZ Q;  1SE4 A;  3DLL A;  5I2X A;  3HFZ B;  2RVL A;  5LHY 1;  5EPJ A;  2UXB Q;  2FFK B;  1EU4 A;  2AMC B;  2NZ1 D;  2AQ3 B;  3HOV G;  4DUY Q;  4EVO A;  1HTP A;  1G2S A;  2HDL A;  5JVG 3;  5CV4 A;  2HCI A;  1D2B A;  5FK9 C;  1STN A;  2WII B;  4CJ2 C;  1L0X B;  1V1O A;  3A54 A;  1GUG A;  2B2T A;  1AZP A;  3PGZ A;  4HMJ A;  4B3M L;  1BUV T;  3T51 B;  1CTM A;  1HQR D;  3CME A;  4X66 L;  4R1J A;  4C3I H;  2L12 A;  3KK7 A;  1IBM Q;  1B8A A;  2K75 A;  2ZTC A;  4XXE A;  2WP8 J;  3NBI A;  4RGT A;  2RCF A;  3S1M H;  4OGQ C;  5G3L D;  1TS2 A;  4A3L H;  1SYG A;  3WOF A;  1OTC A;  3I56 A;  4OEL B;  4P74 A;  2K5D A;  4KMU C;  5C4Z A;  1DOM A;  1GJX A;  5HY6 A;  3VYR A;  4ALP A;  4CDF C;  3I2Z A;  1PFM A;  5M3F B;  1ET6 A;  1FGB D;  2HUG A;  1DZ1 A;  5CV6 A;  5FOB B;  1LV9 A;  1QCB D;  2DGY A;  4AQY Q;  3I4N H;  3M4O B;  1LTA D;  1WCM B;  3PO3 B;  3J81 i;  5IYD G;  3I4M G;  4IZ8 A;  2WIN B;  2EYP A;  4C3H H;  1HNZ L;  1FYC A;  5M3F G;  4J6H A;  4LWC A;  4LJZ C;  1BR9 A;  4DV7 Q;  2A8V A;  1ASZ A;  3F2U A;  2UXB L;  2A1A A;  4L8J A;  3J7Y W;  4AIM A;  1Q90 A;  1S5D D;  4DUY L;  3CKI B;  2KEN A;  3CMA A;  1WCM G;  2NVQ B;  2DY8 A;  2Z1C A;  3M7N A;  1RTO A;  5D14 A;  1DD2 A;  1Y8O B;  1H9S B;  1IL2 A;  3VDY A;  1WTP A;  4DV4 Q;  1HNW L;  3KUP A;  5FLX L;  2N78 A;  5G3L F;  1A2T A;  4P72 A;  2QA4 A;  1K0R A;  4M8A A;  2PMZ E;  1B7Y B;  4FDB A;  4F88 A;  2CQO A;  1SXT A;  1N36 Q;  1HTL D;  3EQL C;  1NE3 A;  5C0X J;  3KF8 B;  1PFS A;  2UXD Q;  1KXL A;  2VUM B;  1G51 A;  3I4L A;  4EGV A;  3DM1 A;  2KCN A;  1BNZ A;  4EQN A;  5FJ8 H;  4RFB A;  1HH2 P;  3IRB A;  4YY3 Q;  4IPD A;  1ONL A;  5ELF A;  2JQO A;  1ILP A;  2EJG C;  5BR8 Q;  1DOK A;  2IPK D;  3SDZ A;  4DAP A;  1AN8 A;  4QQB X;  3VR2 A;  1AW7 A;  2JJQ A;  4JPB W;  4X6A H;  1YIT A;  4IOC A;  1YHB A;  3IAY A;  2VB2 X;  4X3S A;  1PH4 A;  1KDA A;  3M4O H;  1HCZ A;  1DON A;  3ER0 A;  1VQD A;  5LMU L;  1U0L A;  2UUC L;  3PO3 H;  1E3P A;  5DEH A;  4AQY L;  4BS9 A;  1VQE A;  2K01 A;  3UE0 A;  3NPP A;  3HP3 A;  5BN5 A;  1YHA A;  3GQB A;  3WOE A;  1WYD A;  1LTG D;  2YV5 A;  4ME5 A;  2NVQ H;  1JB3 A;  1JOK A;  3R8B A;  2UU9 L;  1JMC A;  3A56 A;  2PO4 A;  4DV4 L;  2A68 D;  1K83 B;  3F8T A;  1PTO D;  4C1N K;  4OO1 I;  1LTB D;  1AE2 A;  1EL0 A;  3M85 A;  4BA2 I;  4EQ5 A;  4GKK Q;  2A6H C;  5BN4 A;  1SRU A;  1NMG A;  1HNX L;  5LMN Q;  1QOH A;  2VUM H;  3FMC A;  4BA1 I;  1X56 A;  3S14 H;  3AMU A;  1F9R A;  4JV5 L;  1ET9 A;  3HZX A;  4KI0 A;  4CDE C;  4MIU A;  5C5L A;  1QVC A;  2Q2I A;  3TDQ A;  1VQO A;  4NMZ A;  2E76 C;  3PV0 A;  4NKL A;  1HQM C;  5C5M A;  3PUW A;  4U68 A;  1JOQ A;  1CHQ D;  3RZO B;  1I6H B;  1VQG A;  1EYC A;  3ONA B;  4DGZ A;  4RKB A;  2JA6 G;  3TP8 A;  5BR8 L;  3GTL B;  4LW1 A;  1FL0 A;  2F0D A;  2MFI A;  2MHV A;  1DXM A;  1EY6 A;  1K28 A;  1ZKO A;  4LK1 C;  5KNB A;  1TII D;  1NSN S;  3M4P A;  1EIH A;  5GAH C;  3JAM i;  5JPM C;  1PDQ A;  3DMU A;  3DWQ A;  1SE2 A;  4ZK9 B;  4JI7 Q;  5IT9 L;  1EQR A;  3U58 A;  4ZQ3 A;  2O4X A;  4A3J B;  1WTO A;  4JI1 Q;  4LF5 L;  1TY2 A;  5I9P A;  1QVF A;  2DNE A;  4DF7 A;  1PTO F;  4WFN 3;  2XIW A;  2ZT9 C;  1NR4 A;  1QVG A;  3TN2 A;  1I94 Q;  1EQT A;  1STB A;  3H94 A;  3N6R A;  3E0J A;  1S3O A;  1G91 A;  1W6J A;  1UWV A;  1Q3L A;  4QGU A;  2MJ8 A;  1XNR Q;  2B2T C;  1U4L A;  5FKA C;  2CWP A;  3STB D;  5CMD A;  1GM5 A;  2R7Z H;  1JJG A;  1HA6 A;  1TT2 A;  2EIF A;  5C44 G;  3BJU A;  4K2L A;  5IOD A;  2OQK A;  4IFD H;  5IP9 H;  3PF4 A;  2VQF Q;  1HJP A;  1Q8I A;  4DR7 Q;  1K8A C;  1RDP D;  3MVV A;  1CUK A;  1GOZ A;  2K33 A;  1O7Z A;  2RQX A;  1PH9 A;  3G48 A;  1QB5 D;  1BVS A;  2F4I A;  3A7A B;  2QF7 A;  1LT6 D;  1D1K A;  3HOZ G;  1K8M A;  1I50 B;  4G7H C;  1IW7 D;  2L0C A;  1WTR A;  1MHW C;  1I4H A;  4CKE A;  1IZ6 A;  3BVG A;  2JEA I;  2C35 B;  4XYO A;  4AYB B;  3VYS A;  4LF4 L;  5EPK A;  1S72 A;  2BH2 A;  2VL6 A;  3GTJ B;  4A3J H;  1H9R A;  3H6M A;  1GUO A;  4POF A;  2R61 A;  1EQQ A;  1EOV A;  2NN6 I;  4JI8 Q;  2VW9 A;  5FLX c;  1CSQ A;  5EKI A;  2XRS D;  3DUZ A;  1SE8 A;  1Q7Y C;  4GKJ Q;  2UUA Q;  4JI4 Q;  2QEX A;  2JA7 G;  4LF7 Q;  2E2H B;  1HUM A;  1PRT C;  1DCZ A;  1U4P A;  1X54 A;  5TSS A;  4A3D B;  3F2C A;  1RJT A;  2NB0 A;  4DR5 L;  2L15 A;  3MFG A;  2E5L Q;  5GAD C;  4JI3 Q;  3E3X A;  1F9P A;  3SK8 A;  3J7A V;  3WDN A;  4TQU S;  1MKH A;  5CV7 A;  2MPM A;  1O78 A;  3BZC A;  2B29 A;  1X3P A;  1CT1 D;  1UE1 A;  5C3W A;  1SNM A;  2P5Z X;  3NSW A;  4X3K A;  1PMR A;  3OTO Q;  1VQN A;  3SVM A;  1L1O C;  1RL2 A;  2B2V A;  4PZ7 A;  1IXR A;  5IIF A;  2WB1 G;  4NP5 A;  3D0F A;  4RCO A;  1WOC A;  1HXY D;  4XDX A;  1M1K C;  4LFC Q;  2BDO A;  3AU7 A;  3DEO A;  4ZYS A;  1U5K A;  3EN2 A;  4FVM A;  3J7Z C;  5AJ3 Q;  3KBG A;  4RAU C;  1Q1E A;  2JA8 G;  4A3C H;  4A3M B;  1I50 H;  1JQY D;  4O0A A;  4OWX B;  3R93 A;  2B2Y A;  1ML0 D;  2EYM A;  3E9I A;  3HOU B;  3PCO B;  3NEL A;  3GTO H;  3QB3 A;  2LS0 1;  4HJ7 A;  1K0S A;  3U4Z A;  5I6W A;  1PRT B;  1A3T A;  1EZ6 A;  4A3M G;  3Q8D A;  3BG3 A;  3SR1 A;  1SSO A;  1CKM A;  2JXM B;  1WTQ A;  1NJI C;  3SE0 A;  2J0T D;  3PQI A;  1XPO A;  3KJO A;  2GVA A;  2JA5 B;  3OMC A;  5FO8 B;  1YNJ C;  2XSC A;  4BBR G;  1Z47 A;  2UUB Q;  3X3N A;  3GTQ H;  2OTL A;  4YHH Q;  2K5W A;  3KYH C;  4A3D H;  4GKJ L;  4BY1 G;  1AH9 A;  2Z0S A;  1MSH A;  1B1Z A;  4P2C B;  3NUC A;  3D8G A;  4IUN A;  5IE8 A;  3TRZ A;  3M3Y H;  2LXJ A;  1VF5 C;  4XIG S;  1KNA A;  3PIP 3;  5KRU A;  1PVO A;  3H3V C;  1H9S A;  5C4X G;  5EKK A;  3U4V A;  4WJ4 A;  3AEV A;  3SK6 A;  5J39 A;  3LWE A;  4JYA Q;  3KLS A;  4WOR A;  3ZJY C;  4DR4 L;  2AHO B;  2CFM A;  5CBE E;  3CC2 A;  5IYC G;  3KF8 A;  1BOS A;  1XMQ Q;  5T1G A;  5K5P A;  4A75 A;  3HOX B;  3V05 A;  1VDZ A;  5IT9 c;  4GNX C;  3R3O A;  4LFC L;  2K14 A;  2ZXP A;  4DK6 C;  1F2L A;  1MD2 D;  2OXP A;  4CDD C;  3HOU H;  4A3I H;  5IP7 H;  2SEB D;  2IHE A;  2EY1 A;  5E7N A;  3HOW H;  2LSS A;  2H5X A;  2HT1 A;  2JE6 I;  3GV3 A;  5JEA J;  3HOX G;  3H0G B;  1FNU A;  1I6V C;  4RKL A;  4DV5 L;  1G2T A;  3N52 A;  1XNQ L;  4BY7 H;  2JA5 H;  4HED A;  4A3B G;  3I4O A;  4Y7N B;  3S9W A;  1MIU A;  1ASY A;  5DM7 3;  4RHR A;  3TZD A;  4HJA A;  2UUB L;  4R4T A;  1J5E L;  1BCP C;  1CKN B;  2SDF A;  5E4W C;  4Q5V A;  3DHQ A;  2RDH A;  4AH6 A;  3MFY A;  1WJJ A;  3R2I A;  2KBN A;  1PH1 A;  4KN4 C;  1TWG B;  3K5L A;  3P20 A;  3GTM H;  4QIW E;  2Y0S E;  1WD0 A;  3KLS X;  1WTX A;  3K7A B;  1QWY A;  3ERO A;  1NAP A;  4FF2 A;  3I73 A;  2CCZ A;  1KDB A;  1W6K A;  1STH A;  2D62 A;  1GUW A;  1K3B C;  2EYO A;  5HGQ A;  2HHH L;  4LF6 L;  2QIL A;  4DK0 A;  3KOJ A;  2HCC A;  1AP0 A;  1KC8 C;  2NVY B;  5J3B A;  1VMP A;  2IJ0 A;  2HIX A;  4ZAI A;  5FO7 B;  5EBC A;  4MHE A;  1LTL A;  4DV1 L;  4X3U A;  1O7I A;  1R4Q B;  4YWM A;  4B3T Q;  5IYB H;  4GN4 B;  4ILW A;  1SJE D;  4JI5 Q;  2ZM6 L;  1JC7 A;  4DU9 A;  1Q86 C;  1JCK B;  2J7Z A;  4KKU A;  1SYF A;  3H0G H;  4IUV A;  1BCP B;  5FLM H;  1IBL Q;  1HUN A;  4Q0F A;  1E22 A;  3PIP A;  3BDL A;  1D5M C;  3F1Z A;  1Y1W B;  4Y7N H;  3CPF A;  4LUO A;  2NVT B;  4C3J B;  2I5L X;  4LF9 L;  1D1I A;  1SFO B;  5E4X A;  2F4V L;  1QIL A;  1TWF B;  2O5J C;  3LWU A;  1V1P B;  4IN3 A;  2K1B A;  1SNC A;  3EBE A;  2NTS A;  2Q8R E;  1HFN A;  1V9P A;  2WAQ E;  1ZYR C;  1N32 Q;  2SNS A;  1IYJ B;  3NK9 A;  1GUS A;  1YNN D;  4DV2 L;  1TR5 A;  1GO3 E;  4GOP C;  3ULP A;  3D4R A;  1B2T A;  2MUY A;  1CHP D;  1STE A;  3TSS A;  3UDG A;  4HSV A;  2NVY H;  4DXG A;  3HOV B;  3NTI A;  1CFM A;  2N3S A;  2B63 B;  3J81 E;  3HS0 C;  1B44 D;  4YWL A;  5JEA G;  4A3E H;  1BBW A;  3J7A 5;  3UDI A;  3K80 C;  1CK1 A;  2K5N A;  1G29 1;  3BU2 A;  1BBX C;  2K5H A;  1U4R A;  2Z6B A;  1N34 Q;  4CHT B;  2B2W A;  2B63 G;  4X62 L;  2E2J B;  2MQH A;  4IO9 A;  1Y1W H;  1IBL L;  1LYL A;  2WFW A;  3VR4 A;  1YVC A;  1TQO A;  4C3J H;  2PNH A;  2KEE A;  1FR3 A;  1RIP A;  1QNK A;  1STY A;  2IHF A;  1SFO H;  5I4D A;  3HEJ A;  4RMF A;  5ELE A;  2D2C C;  1PV4 A;  2VB3 X;  2DJG C;  4EX5 A;  1GUN A;  2Q2T A;  1YZ6 A;  3MTS A;  3UI2 A;  4BBS H;  3RD4 A;  3EVQ A;  1II3 A;  4QY7 A;  2JN4 A;  5COY A;  4K5X A;  1OXT A;  4MTK A;  2QGQ A;  5M3M H;  2K03 A;  4N8X 1;  4PV1 C;  1EQV A;  4X65 L;  4OO1 G;  1C48 A;  4JOI C;  1VQJ A;  2EY2 A;  2KVM A;  2YU9 B;  1PFB A;  1E1T A;  3I4M B;  2KHS A;  2PZW A;  1EOT A;  3NEM A;  3C3L A;  2K5V A;  1XMO Q;  2NZH A;  1YNX A;  1KD1 C;  3CQZ B;  3HOV H;  1OXU A;  3J80 i;  3F2D A;  4A3F B;  4H02 A;  1HRJ A;  1B70 B;  3OYY A;  5IGC A;  5ELC A;  1Y8P B;  2XVS A;  1WTH A;  1LT3 D;  2I46 A;  1SDF A;  3U50 C;  4A3F G;  3RZD B;  5I2Y A;  1SYB A;  2CKZ B;  5EGT A;  5DLQ E;  1VQ6 A;  1N34 L;  1RF2 D;  4KK7 A;  3FPP A;  3KJP A;  3BZK A;  1ICF B;  4K8J A;  3KDF B;  5A2Q L;  5AFW A;  2BCO A;  1SMY C;  4G57 A;  1EIG A;  2CW0 C;  2UXC Q;  1E2V A;  2KCM A;  3K81 C;  1E0B A;  1PYB A;  3K7U C;  4NPS A;  1ENA A;  2OT2 A;  1F2Z A;  3PMF A;  2EYF A;  4OXP A;  4OIJ A;  5A35 A;  2KCC A;  2L5T A;  3TS0 A;  1STG A;  1Y69 U;  2GN5 A;  1IBM L;  1Z7T A;  4CBV A;  4GLA C;  1STA A;  4B3R Q;  4ME3 A;  4F7X A;  2QDL A;  2PQA A;  2PCF B;  4GLV B;  1HR0 Q;  2K04 A;  3A55 A;  4G4K A;  4PQX A;  3DWP A;  2X69 A;  2PPB C;  2C9O A;  3LGJ A;  3FEW X;  1W3S A;  1VQK A;  5IYD H;  3I4M H;  2AWN A;  3FKI G;  3G4S A;  1C4Q A;  1SYC A;  4IPH A;  5M3F H;  4ULL A;  3CQZ H;  1EFW A;  2MO0 A;  1TS3 A;  1SR3 A;  1XMO L;  3JAM E;  3A0J A;  5DM6 3;  5A2Q E;  1WCM H;  3W1B A;  4QL5 A;  2EY6 A;  2F03 A;  2R7D A;  3W1G A;  2IT1 A;  5CYU A;  1G6P A;  4K14 A;  4PNY A;  1AFP A;  4IQZ A;  1MI2 A;  4XQQ A;  1HZ9 A;  1E7Z A;  1PH6 A;  4B9X A;  3MXN A;  1XYI A;  4I7A A;  4DV7 L;  2RDF A;  3KF6 A;  3Q22 A;  3CC4 A;  3WWV A;  2K52 A;  5D3I B;  4A3G G;  1RHP A;  4QF4 A;  3NHH A;  4QMG A;  2L1B A;  2F3I A;  4RH6 A;  3U9S A;  4APV A;  2UXC L;  2NN6 G;  2NWG A;  1UE7 A;  2HIV A;  4RWS C;  4R8N A;  3E5S A;  4HSP A;  2A6E D;  1N36 L;  1C0A A;  4ZLT F;  1V1Q A;  5C4J B;  1UAP A;  1G6Z A;  5KND A;  2JA6 B;  2UXD L;  3NE5 B;  4L5T A;  4B3R L;  1VQF A;  1NBW A;  1LLR D;  2QCP X;  2D9U A;  4JK1 C;  1HA5 A;  2HD3 A;  4HR7 B;  3EFX D;  5BN3 A;  1HR0 L;  1EUJ A;  3HKZ E;  4YY3 L;  3TBI B;  1LAB A;  4FO2 A;  1EIY B;  1HHV A;  2F0O A;  2F0E A;  2K7V A;  5EBD A;  1Y14 B;  2NTT A;  2ALY B;  4BWG B;  4UHV A;  1VQL A;  2Q2U A;  3S1N B;  4QUC A;  4OHJ A;  4BXX G;  2EVB A;  2Z6K C;  3L3O C;  2V1C C;  4HCS A;  1C9O A;  3GO5 A;  1X65 A;  2BE5 D;  3CF5 A;  5IGF A;  2E8G A;  4OWW B;  3TQY A;  4A3K G;  2KA7 A;  2XWB B;  2F0T A; 
#chains in the Genus database with same CATH homology
 1FD7 D;  1KDC A;  1Y1V B;  2A69 D;  1G8Z D;  3D6W A;  4HAE A;  5C0X G;  5C44 B;  2WKC A;  4IUP A;  5CGK A;  2KQ3 A;  1CA6 A;  3HOY B;  2EDG A;  3EA6 A;  1TKW B;  4XTC S;  3LNN A;  1RCV D;  1TY0 A;  1H9M A;  3Q0A A;  1D5Z C;  1SNO A;  3HOZ B;  1JIC A;  2N55 A;  4FXG C;  1A3V A;  3QJY A;  5CV8 A;  3SK5 A;  2FIN B;  2F0H A;  4EQO A;  1SND A;  2EYL A;  5KYI A;  1M8A A;  1XWE A;  2NVX B;  4PMC A;  1KTK A;  1KLU D;  1J8I A;  2B2U A;  5M5W B;  2BA1 A;  2JA7 B;  4XYQ A;  3OOC A;  1MGS A;  3PUZ A;  1NR2 A;  3GTK B;  1LO5 D;  4QB4 A;  1GUT A;  2F0V A;  5KYL A;  4I65 A;  2EXZ A;  4CJ0 B;  3S1R B;  1CZG A;  2OEO A;  3MAQ A;  3PUX A;  4HTH A;  1SE3 A;  2EY5 A;  5KEE A;  1EWC A;  1LT4 D;  3GTP B;  2RBM A;  3J7A F;  1LTR D;  2WB1 B;  1LTT D;  1TWC B;  1L0Y B;  1AEX A;  2IX3 A;  2G9H D;  2JA8 B;  4K6L A;  2CHB D;  1XTC D;  2EPB A;  3O13 A;  4KD3 A;  3MHB A;  2FMM A;  1F9S A;  4CKB A;  1OXX K;  2BOS A;  4IFD I;  3BDC A;  1QG7 A;  2B8F A;  5KIX A;  2F0G A;  1F77 A;  4IUR A;  1GHK A;  1ENF A;  1UNS A;  2KEC A;  4BBR B;  4CGY B;  4R9W A;  1VF7 A;  4BY1 B;  1LTS D;  2G9D A;  3K5M A;  3CHB D;  3GTG B;  4FNF A;  2F0Q A;  2XN9 C;  1AZQ A;  3C2P A;  1WD1 A;  1O80 A;  4O42 A;  3VYT A;  4RGO S;  2M00 A;  5C4X B;  5ELB A;  1H9J A;  1RKN A;  3RUZ A;  2F0P A;  2A68 C;  1PTO C;  1R9T B;  3BVZ A;  4KV6 A;  4I7Z C;  1SEB D;  2JSO A;  4IUQ A;  5FO9 B;  3PO2 B;  2RSN A;  3H91 A;  3QIA A;  1JE4 A;  2WKD A;  1A6X A;  3OIP A;  1TS4 A;  1QE6 A;  2J4X A;  3A8K E;  4UDU C;  2A73 B;  3M4Y A;  5HGT A;  4HMI A;  4KD4 A;  3S2H B;  3S17 B;  1OO9 B;  2EOT A;  3D4D A;  5F2D A;  5D65 A;  4A3B B;  2PW7 A;  1ICW A;  5CBA E;  3L9A X;  4L63 B;  2ENB A;  5K36 G;  1FNW A;  1PTO B;  5KGU A;  4KJN A;  4FF1 A;  1EY7 A;  2KJX A;  5I6Y A;  4ODG A;  1JWU D;  3PUV A;  2Q8T A;  2CVR A;  3K59 A;  5E1F A;  1TWA B;  3TP7 A;  5M9O A;  2PZU A;  5NUC A;  4DXF A;  2IW3 A;  2RA4 A;  3VR3 A;  3T53 B;  2F3W A;  1K8O A;  4V0B A;  1EYA A;  2FHT A;  4O1N A;  2WV6 D;  5CC4 A;  3C1F A;  4F87 A;  1EWH A;  4U67 3;  1T5X D;  3NWS A;  1EEF D;  3NQI A;  3P75 A;  1I3Q B;  5IGG A;  3VA7 A;  1IW7 C;  3CRL C;  2R92 B;  3L7Z C;  3C46 A;  2A74 C;  3OSO A;  3EJI A;  3J80 L;  3GV6 A;  1JR0 D;  4KY5 A;  3J81 L;  1H9K A;  4ZUI A;  4G7Z C;  4PMB A;  5J22 A;  2A5H A;  1VCI A;  3MA2 B;  1SNP A;  3TZU A;  4DN4 M;  4IUT A;  5JOB A;  2VNU D;  2CQA A;  1S5F D;  1B53 A;  1PXU A;  3DXJ C;  2D5D A;  5ELD A;  3K0Y A;  5E3F A;  3S2D B;  1NUC A;  1X3Q A;  3FPU B;  4KJO A;  5DNF A;  1KLG D;  1R4P B;  2Z4H A;  2EJM A;  2A6H D;  3G7L A;  3X3M A;  3T4A C;  4FP5 D;  1WTW A;  1T5E A;  3I70 A;  3J80 E;  2IX1 A;  1DOL A;  5LL6 S;  2K28 A;  3MEH A;  3K5O A;  4TSS A;  3LX0 A;  2V4D A;  4C3I G;  2B2V C;  3Q6S A;  1NCV A;  2M9V A;  2R6G A;  2X6L A;  1RD9 D;  4DA2 A;  4RCN A;  3NWT A;  3I72 A;  2X6G A;  3NBH A;  2B2Y C;  3SEB A;  2HDM A;  3HGB A;  1BO0 A;  3BYY B;  4QCL A;  2YYZ A;  1S5B D;  4C3H B;  1JOR A;  5CV9 A;  5JPN C;  4J1M A;  4C1N I;  4NDX A;  1E2W A;  1LAC A;  3I90 A;  5C3X A;  3VR6 A;  5LL6 X;  1QJO A;  3MC0 B;  4C3H G;  2L55 A;  1ROD A;  1B9M A;  3S15 B;  1SNQ A;  5JEA H;  5KNC A;  4CJ1 B;  4UAI A;  1X32 A;  5JVH 3;  1JOO A;  1HFG A;  2F0K A;  1EZ8 A;  2LKV A;  3IKJ A;  4FF3 A;  4DK1 A;  4RGN A;  1E2Z A;  3A8I E;  3MWY W;  3W2D A;  2SNM A;  1KNE A;  1TS5 A;  4NW2 A;  4TRD A;  3RLF A;  2F0U A;  3I8Z A;  2K6A A;  1ESR A;  4K5W A;  2GA4 B;  4ID6 A;  2C5C A;  3OMG A;  4R8I A;  4K2K A;  4DFA A;  4E6I A;  5EKL A;  2DY7 A;  3JAM L;  2H4O A;  4HN7 A;  2EE1 A;  4IAL A;  5DAU A;  1BDO A;  1PLF A;  4IFD J;  3K6O A;  1IKL A;  4KKS A;  2QEJ C;  3MXP A;  3OW7 A;  4F8M A;  1BQQ T;  4OO1 H;  2MGS A;  1BF4 A;  4FYD A;  3DWA A;  4ZKB B;  1F9Q A;  3BYT B;  3FKI B;  3VYU A;  1PRT D;  3T56 B;  1J9O A;  1O7Y A;  1ZEQ X;  1SBB B;  4OL7 A;  2NUC A;  3PUY A;  4PMW A;  5EPL A;  5M5X B;  1DJR D;  2XWJ B;  4XT3 B;  4L6T B;  1U4M A;  1A3U A;  4ABN A;  3S14 B;  3T13 A;  2KUM A;  1FNV A;  1DYQ A;  2F0F A;  2EJF C;  4C2M B;  4ZKC B;  3K57 A;  4A3G B;  1UUP A;  4RGM A;  2KOL A;  1CI3 M;  3P1H A;  3R2T A;  2ZXO A;  4N9P A;  5ISR A;  3MXU A;  5C6A A;  2AQ2 B;  1WVL A;  5FLX E;  1I4G A;  3G6J B;  3V96 A;  1ENC A;  1F2M A;  1IYU A;  4KTA A;  1PRT F;  4DAY A;  4DNR B;  1V43 A;  3BDO A;  1YNJ D;  2EYJ A;  2PW5 A;  2TSS A;  4TKO B;  5EJW A;  3A7L A;  2E75 C;  2K05 A;  1Q1B A;  4DNT B;  1IKM A;  1LTI D;  3Q23 A;  1CQV A;  4K8I A;  4H0L C;  2E2D C;  3U9O A;  4K5V A;  3GD7 A;  1YNN C;  2AWO A;  3BZD B;  3SXH A;  2R7Z B;  2E2I B;  4A3K B;  4GZY C;  2R3Z A;  2ID0 A;  3ND9 A;  2OF1 A;  1S5C D;  4IFD G;  2IWH A;  2NN6 H;  1CZW A;  3I91 A;  3ZYY X;  2JEB I;  1A2U A;  1PYW D;  4FXK C;  2I07 B;  2B2W C;  1EY5 A;  3I3C A;  2DN8 A;  4MN3 A;  2N88 A;  4Z9C B;  3PIO 3;  1ZXT A;  2BDN A;  5CV5 A;  3TP6 A;  1BCP D;  4FF4 A;  1LT5 D;  1Q12 A;  4X3T A;  2XRQ D;  4QIW B;  3E6Z X;  2NBF A;  4QUF A;  1EY4 A;  3SHL A;  2Y0S B;  1V1P A;  2RSO A;  2O5I C;  3IL8 A;  3OWE B;  4OIK A;  2XNA C;  2PQE A;  4M1U B;  1KAB A;  2F0L A;  2QDB A;  1UEA B;  4N9T A;  3OHX C;  1GXD C;  3D6C A;  1OXS C;  2PNR C;  2Z4I A;  4H13 C;  5IT9 E;  4KKT A;  1SAP A;  3KBX A;  4WJW A;  1CQF A;  5C0X H;  3AB9 A;  3QOJ A;  2BA0 A;  3HG9 A;  4RA8 A;  5JAV A;  3ITP A;  1D5X C;  2LY7 A;  1A15 A;  3D4W A;  1CM9 A;  1O7L A;  2WAC A;  3QWN A;  1IL8 A;  2K32 A;  1F2Y A;  3GTO B;  5JJZ A;  3Q24 A;  3MXG A;  2TMP A;  2F1M A;  1BCP F;  1MBY A;  3MZ5 A;  3GP7 A;  2B8G A;  2PZT A;  1EFI D;  3URY A;  1U9R A;  4LAA A;  1EY0 A;  2DNC A;  4H44 C;  3GTQ B;  1I4Q A;  3S16 B;  3ERQ A;  2E74 C;  2WAQ B;  3ND8 A;  4DAV A;  5EQ0 A;  1ZYR D;  3T16 A;  2F0I A;  3K5N A;  4S3S A;  3M3Y B;  2F3V A;  2PYK A;  2HQE A;  3V2T A;  4YIJ A;  1EY9 A;  1PZI D;  3NQT A;  4WRD A;  2Q8I B;  4KHV A;  1BXT A;  3H09 A;  2RDG A;  2IL8 A;  4KY6 A;  4ZRZ A;  3FVQ A;  3NXW A;  5COR A;  1KAA A;  2ICE C;  5J1Z A;  1MSG A;  1I4X A;  1PZK D;  3P7J A;  3QO2 A;  1VMC A;  4A3I B;  3W3A A;  1B9N A;  4IUU A;  3DEP A;  5C0X I;  1I4R A;  3HOW B;  1B50 A;  4KN7 C;  2H1E A;  2R93 B;  5HUR A;  4BY7 B;  4RHS A;  3IFT A;  4J8Q A;  4JBW A;  1S5E D;  1HPC A;  5I9O A;  2A6E C;  3K58 A;  3TME A;  4K6D A;  3S1Q B;  4XQJ A;  3GTM B;  1SYE A;  1IYV A;  1WTV A;  1QNU A;  2M2L A;  4ZUJ A;  1S4Z A;  2FJ2 A;  2NYZ D;  5C3E B;  3FDT A;  2LFN A;  4XQN A;  1B3A A;  3CRK C;  2BE5 C;  4H7B A;  2L4N A;  1EU3 A;  5IGB A;  1CA5 A;  3QOL A;  3OPO A;  3FRP B;  1DM0 B;  2EYH A;  4KHZ A;  2A69 C;  3BS1 A;  1PFN A;  3VA5 A;  3HRZ C;  4A93 B;  5CR3 A;  2JP1 A;  1EY8 A;  3NTH A;  4B08 A;  4CKC A;  1TU2 B;  3OWF A;  2K5Q A;  5C4H A;  1SMY D;  3C1E A;  2L9H A;  3D31 A;  2CW0 D;  2PMZ B;  4EQP A;  3CU7 A;  2FMC A;  3QG1 A;  4LMQ D;  1JWS D;  2AUK A;  1ESF A;  2ZXR A;  4B9W A;  4V19 0;  2JYO A;  1JWM D;  1Z6H A;  4KY7 A;  1TWH B;  2LMC B;  3NTK A;  2F0S A;  5K36 H;  4FXD A;  1V8Q A;  1EEI D;  5D3D A;  2F0N A;  1TVX A;  3BVM A;  3NP8 A;  1ILQ A;  2L11 A;  5M5Y B;  1PTO H;  3RMH A;  2B2U C;  4A3E B;  3IFD A;  3TP5 A;  2RKS A;  2AUJ D;  1RTN A;  1OXV A;  3OIQ A;  1Y8N B;  2Z8L A;  2B39 A;  4HCE A;  2SOB A;  4G7O C;  4XT1 B;  3D3R A;  2IX0 A;  1C8C A;  2ICI A;  2F0W A;  2VXW A;  1XXG A;  2F0M A;  2MP1 A;  2QKI C;  5IOC A;  3SK4 A;  4C3I B;  4BBS B;  1I4P A;  1SYD A;  1GHJ A;  3S1M B;  1XX8 A;  4C56 C;  5T1I A;  4C3J G;  3VR5 A;  3M7G A;  3HKZ B;  5M3M B;  1D6E C;  5IGE A;  3KLR A;  1PZJ D;  2AQ1 B;  2O2L D;  1EYD A;  2F0J A;  2EZV A;  3A8J E;  1IHZ A;  1SJH D;  1M4V A;  3I4N B;  1B4O A;  2KED A;  1SE4 A;  5I2X A;  2RVL A;  5LHY 1;  5EPJ A;  2FFK B;  1EU4 A;  2NZ1 D;  2AQ3 B;  4EVO A;  1HTP A;  1G2S A;  2HDL A;  5JVG 3;  5CV4 A;  2HCI A;  1D2B A;  5FK9 C;  1STN A;  2WII B;  4CJ2 C;  1L0X B;  1V1O A;  3A54 A;  1GUG A;  2B2T A;  1AZP A;  4HMJ A;  1BUV T;  3T51 B;  1CTM A;  1HQR D;  2L12 A;  3KK7 A;  4XXE A;  2WP8 J;  3NBI A;  4RGT A;  4OGQ C;  5G3L D;  1TS2 A;  1SYG A;  3WOF A;  2K5D A;  4KMU C;  5C4Z A;  1DOM A;  1GJX A;  3VYR A;  1PFM A;  5M3F B;  1ET6 A;  1FGB D;  2HUG A;  1DZ1 A;  5CV6 A;  5FOB B;  1LV9 A;  1QCB D;  3M4O B;  1LTA D;  1WCM B;  3PO3 B;  4IZ8 A;  2WIN B;  2EYP A;  1FYC A;  4J6H A;  4LJZ C;  1BR9 A;  3F2U A;  4L8J A;  3J7Y W;  1Q90 A;  1S5D D;  3CKI B;  2NVQ B;  2DY8 A;  2Z1C A;  3M7N A;  1RTO A;  5D14 A;  1DD2 A;  1Y8O B;  1H9S B;  1WTP A;  3KUP A;  5FLX L;  5G3L F;  1A2T A;  4M8A A;  4F88 A;  1SXT A;  1HTL D;  3EQL C;  5C0X J;  2VUM B;  3I4L A;  4EGV A;  3DM1 A;  2KCN A;  1BNZ A;  4EQN A;  4RFB A;  1ONL A;  5ELF A;  1ILP A;  2EJG C;  1DOK A;  2IPK D;  3SDZ A;  4DAP A;  1AN8 A;  3VR2 A;  1AW7 A;  3IAY A;  2VB2 X;  4X3S A;  1KDA A;  1HCZ A;  1DON A;  5DEH A;  4BS9 A;  2K01 A;  3NPP A;  3HP3 A;  5BN5 A;  3GQB A;  3WOE A;  1LTG D;  4ME5 A;  1JB3 A;  1JOK A;  3R8B A;  3A56 A;  2PO4 A;  2A68 D;  1K83 B;  1PTO D;  4C1N K;  4OO1 I;  1LTB D;  1EL0 A;  3M85 A;  4BA2 I;  2A6H C;  5BN4 A;  1QOH A;  3FMC A;  4BA1 I;  3AMU A;  1F9R A;  1ET9 A;  3HZX A;  4KI0 A;  4MIU A;  5C5L A;  3TDQ A;  4NMZ A;  5C5M A;  2E76 C;  3PV0 A;  1HQM C;  4NKL A;  3PUW A;  4U68 A;  1JOQ A;  1CHQ D;  3RZO B;  1I6H B;  1EYC A;  3ONA B;  4DGZ A;  4RKB A;  3TP8 A;  3GTL B;  2F0D A;  2MHV A;  1DXM A;  1EY6 A;  1ZKO A;  4LK1 C;  5KNB A;  1TII D;  1NSN S;  1EIH A;  5JPM C;  1PDQ A;  3DMU A;  3DWQ A;  1SE2 A;  4ZK9 B;  5IT9 L;  4ZQ3 A;  2O4X A;  4A3J B;  1WTO A;  1TY2 A;  5I9P A;  2DNE A;  4DF7 A;  1PTO F;  4WFN 3;  2XIW A;  2ZT9 C;  1NR4 A;  3TN2 A;  1EQT A;  1STB A;  3H94 A;  3N6R A;  3E0J A;  1G91 A;  1W6J A;  1Q3L A;  2MJ8 A;  2B2T C;  1U4L A;  5FKA C;  5CMD A;  1HA6 A;  1TT2 A;  4K2L A;  5IOD A;  4IFD H;  1Q8I A;  1RDP D;  3MVV A;  1GOZ A;  2K33 A;  1O7Z A;  2RQX A;  1QB5 D;  2F4I A;  3A7A B;  2QF7 A;  1LT6 D;  1D1K A;  1K8M A;  1I50 B;  4G7H C;  1IW7 D;  2L0C A;  1WTR A;  1I4H A;  4CKE A;  3BVG A;  2JEA I;  4XYO A;  4AYB B;  3VYS A;  5EPK A;  3GTJ B;  1H9R A;  3H6M A;  1GUO A;  2R61 A;  2NN6 I;  5EKI A;  2XRS D;  3DUZ A;  2E2H B;  1HUM A;  1PRT C;  1DCZ A;  1U4P A;  5TSS A;  4A3D B;  1RJT A;  2NB0 A;  3MFG A;  1F9P A;  3SK8 A;  3J7A V;  3WDN A;  4TQU S;  5CV7 A;  2MPM A;  1O78 A;  1X3P A;  1CT1 D;  5C3W A;  1SNM A;  3NSW A;  4X3K A;  1PMR A;  3SVM A;  2B2V A;  5IIF A;  4NP5 A;  4RCO A;  1HXY D;  4XDX A;  2BDO A;  3AU7 A;  3DEO A;  4ZYS A;  4FVM A;  3KBG A;  4RAU C;  1Q1E A;  4A3M B;  1JQY D;  3R93 A;  2B2Y A;  1ML0 D;  2EYM A;  3HOU B;  3QB3 A;  2LS0 1;  5I6W A;  1PRT B;  1A3T A;  1EZ6 A;  3BG3 A;  3SR1 A;  1SSO A;  2JXM B;  1WTQ A;  3SE0 A;  2J0T D;  2JA5 B;  3OMC A;  5FO8 B;  1YNJ C;  2XSC A;  1Z47 A;  3X3N A;  2K5W A;  1MSH A;  1B1Z A;  4P2C B;  3NUC A;  3D8G A;  4IUN A;  1VF5 C;  4XIG S;  1KNA A;  3PIP 3;  5KRU A;  3H3V C;  1H9S A;  5EKK A;  3SK6 A;  5J39 A;  3LWE A;  3KLS A;  4WOR A;  5CBE E;  3KF8 A;  1BOS A;  5T1G A;  5K5P A;  3HOX B;  3V05 A;  1VDZ A;  3R3O A;  2ZXP A;  1F2L A;  1MD2 D;  2OXP A;  2SEB D;  2EY1 A;  2JE6 I;  3GV3 A;  5JEA J;  3H0G B;  1FNU A;  1I6V C;  4RKL A;  1G2T A;  3N52 A;  4HED A;  4Y7N B;  3S9W A;  5DM7 3;  4RHR A;  3TZD A;  1BCP C;  5E4W C;  2SDF A;  4Q5V A;  3DHQ A;  2RDH A;  3MFY A;  3R2I A;  4KN4 C;  1TWG B;  3K5L A;  3P20 A;  1WD0 A;  3KLS X;  1WTX A;  3K7A B;  1QWY A;  3ERO A;  1NAP A;  4FF2 A;  3I73 A;  1KDB A;  1W6K A;  1STH A;  2D62 A;  1GUW A;  2EYO A;  2QIL A;  4DK0 A;  2HCC A;  1AP0 A;  2NVY B;  1VMP A;  2IJ0 A;  4ZAI A;  5FO7 B;  5EBC A;  4MHE A;  4X3U A;  1R4Q B;  4ILW A;  1SJE D;  1JC7 A;  4DU9 A;  1JCK B;  2J7Z A;  4KKU A;  1SYF A;  4IUV A;  1BCP B;  1HUN A;  4Q0F A;  3BDL A;  1D5M C;  1Y1W B;  2NVT B;  4C3J B;  1D1I A;  1SFO B;  5E4X A;  1QIL A;  1TWF B;  2O5J C;  3LWU A;  1V1P B;  4IN3 A;  2K1B A;  1SNC A;  2NTS A;  2Q8R E;  1HFN A;  1ZYR C;  2SNS A;  3NK9 A;  1GUS A;  1YNN D;  1TR5 A;  3D4R A;  1B2T A;  2MUY A;  1CHP D;  1STE A;  3TSS A;  4HSV A;  4DXG A;  3HOV B;  3NTI A;  1CFM A;  2B63 B;  3J81 E;  3HS0 C;  1B44 D;  5JEA G;  1CK1 A;  1G29 1;  1BBX C;  1U4R A;  4CHT B;  2B2W A;  2E2J B;  3VR4 A;  1TQO A;  2KEE A;  1FR3 A;  1QNK A;  1STY A;  5I4D A;  3HEJ A;  5ELE A;  2D2C C;  2VB3 X;  1GUN A;  3MTS A;  3UI2 A;  3RD4 A;  3EVQ A;  1II3 A;  5COY A;  4K5X A;  1OXT A;  2K03 A;  4PV1 C;  1EQV A;  4OO1 G;  1C48 A;  2EY2 A;  2KVM A;  2YU9 B;  1PFB A;  3I4M B;  2KHS A;  2PZW A;  1EOT A;  3C3L A;  3CQZ B;  1OXU A;  4A3F B;  1HRJ A;  5IGC A;  5ELC A;  1Y8P B;  2XVS A;  1LT3 D;  2I46 A;  1SDF A;  3RZD B;  5I2Y A;  1SYB A;  5EGT A;  1RF2 D;  4KK7 A;  3FPP A;  4K8J A;  5A2Q L;  5AFW A;  2BCO A;  1SMY C;  4G57 A;  1EIG A;  2CW0 C;  1E2V A;  1E0B A;  1ENA A;  2OT2 A;  1F2Z A;  3PMF A;  2EYF A;  4OIJ A;  5A35 A;  2KCC A;  2L5T A;  1STG A;  1Y69 U;  1Z7T A;  4CBV A;  1STA A;  4F7X A;  2PCF B;  2K04 A;  3A55 A;  4G4K A;  4PQX A;  3DWP A;  2X69 A;  2PPB C;  2C9O A;  3FEW X;  2AWN A;  1C4Q A;  1SYC A;  4ULL A;  1TS3 A;  3JAM E;  5DM6 3;  5A2Q E;  2EY6 A;  2F03 A;  2IT1 A;  5CYU A;  4K14 A;  4PNY A;  1AFP A;  4IQZ A;  1MI2 A;  4XQQ A;  4B9X A;  3MXN A;  1XYI A;  2RDF A;  3Q22 A;  5D3I B;  1RHP A;  2KA7 A;  4QF4 A;  3NHH A;  4QMG A;  2L1B A;  4RH6 A;  3U9S A;  2NN6 G;  2NWG A;  4RWS C;  4R8N A;  3E5S A;  4HSP A;  2A6E D;  4ZLT F;  5C4J B;  1UAP A;  1G6Z A;  5KND A;  2JA6 B;  3NE5 B;  2QCP X;  1LLR D;  2D9U A;  4JK1 C;  1HA5 A;  4HR7 B;  3EFX D;  5BN3 A;  3TBI B;  1LAB A;  4FO2 A;  1HHV A;  2F0O A;  2F0E A;  2K7V A;  5EBD A;  2NTT A;  4BWG B;  3S1N B;  4QUC A;  4OHJ A;  2EVB A;  3L3O C;  4HCS A;  3GO5 A;  2BE5 D;  5IGF A;  5IGD A;  2XWB B;  2F0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...