5C4HA

Crystal structure of staphylococcal nuclease variant delta+phs i92h at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYHYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4hA00
2F0DA 2LKVA 2QDBA 2EYLA 5CV6A 4KY5A 5NUCA 5K5PA 2EYMA 1EZ8A 4ID6A 4YIJA 1EYCA 4G57A 5EKKA 5IGEA 5KYIA 5J22A 5EGTA 2F0GA 2KHSA 3NXWA 3D4WA 2OXPA 4KTAA 5KRUA 2EXZA 2EYJA 3PMFA 4KV6A 5KIXA 1SYCA 1SNMA 1AEXA 4LAAA 5IODA 3SR1A 2F0PA 1A3TA 1F2YA 1KDBA 2F0VA 4IUNA 4ODGA 4PNYA 3TP8A 1STAA 5I6YA 2F0KA 1EY5A 1JOQA 3P1HA 5IOCA 3OMCA 2OEOA 1EY4A 1A2UA 3BDLA 5C4HA 4ME5A 4H7BA 4WRDA 5E3FA 3U9OA 3ITPA 4ZQ3A 5EKLA 1NUCA 3D8GA 5C4ZA 1A2TA 3OWFA 2EYFA 4K2LA 2WACA 4PMBA 5JOBA 4K5VA 3TP6A 4K5XA 4KY7A 1TT2A 5C5LA 2F0EA 3T13A 5I9PA 1JOKA 2F0TA 4EVOA 5C3XA 3OSOA 1KAAA 2M00A 4MIUA 3V2TA 5DAUA 1SYBA 5HGTA 4ZUIA 2EY2A 3MHBA 3TP7A 4K8JA 3HEJA 4DU9A 2F3VA 3BDCA 3E5SA 4KJNA 5CV4A 4IALA 2F0HA 5KGUA 3SK6A 2O4XA 2F0MA 5I6WA 4J1MA 4F8MA 3SK4A 1U9RA 5IGCA 1SYGA 1F2ZA 1JORA 1ENAA 2KQ3A 4HMJA 1SNOA 1STYA 3EJIA 4K5WA 2PQEA 5KYLA 1EY9A 3VA5A 1TQOA 4RKLA 4NDXA 3SK8A 4QB4A 1SYDA 2PW5A 4E6IA 1EQVA 2F0LA 5C5MA 5CV8A 4EQPA 5C3WA 2EY6A 2F0IA 2PZWA 4HMIA 1EYDA 3T16A 2NUCA 4K2KA 5IGBA 1SNQA 5ISRA 3R3OA 5IGFA 5C6AA 1SYEA 3NP8A 4RKBA 4EQNA 1EY0A 5J39A 2PZUA 2RBMA 3NHHA 3NUCA 4KHVA 4S3SA 1STBA 4DF7A 5IGDA 4K14A 1EY6A 2RKSA 2F0UA 3EVQA 5DEHA 2SOBA 3TMEA 2PYKA 4B9WA 3LX0A 3EROA 2F0NA 4DGZA 4EQOA 4QF4A 1KDCA 3C1EA 2EYPA 4NP5A 3NK9A 1STHA 3QB3A 3D6CA 3DHQA 4KD3A 4NMZA 4TRDA 5CV7A 5IGGA 4I65A 4J6HA 4KJOA 5JAVA 4QMGA 5CV9A 1F2MA 3H6MA 2EY1A 3QOJA 3SXHA 4KY6A 4N9PA 3D4DA 1ENCA 3MEHA 4K6DA 4NKLA 1JOOA 1TR5A 1EY8A 2F0WA 2F0QA 3MZ5A 2OF1A 3NQTA 5E1FA 1SYFA 2RDFA 1STGA 1STNA 1SNPA 1EZ6A 1RKNA 4OL7A 4KD4A 2F3WA 3SHLA 3P75A 3DMUA 1A3UA 2F0JA 4R8NA 4ZUJA 5CC4A 1SNDA 3TP5A 1IHZA 2PZTA 5F2DA 3SK5A 2SNMA 5IIFA 3ERQA 5KEEA 3OMGA 5HURA 3MXPA 4DFAA 5CGKA 1SNCA 4WORA 3HZXA 1II3A 4IZ8A 1NSNS 5CR3A 4N9TA 2PW7A 3QOLA 5J1ZA 4B9XA 5I9OA 4PMCA 5CV5A 2F0FA 2F0SA 2F0OA 3C1FA 5M9OA 3MVVA 3S9WA 2SNSA 2EY5A 3RUZA 1EYAA 1KDAA 2EYOA 1KABA 4K8IA 2HQEA 2EYHA 4F7XA 1EY7A 1A3VA 4HTHA 2ENBA
chains in the Genus database with same CATH superfamily
5NUCA 2L15A 4A93H 5K5PA 3VYSA 3CRLC 4ID6A 3R93A 2ZJRA 5KYIA 3ERSX 2J0TD 2OXPA 1N32Q 2OTJA 4KV6A 4C2MB 1SNMA 3S1RB 1KDBA 4P2CB 1XPRA 4IPCA 3CPWA 3UI2A 2DUDA 3K5NA 5E7NA 1RD9D 3HOXG 1V1OA 5M3FB 4PZ6A 3RD4A 2R7ZG 4OIJA 1G291 3PV0A 4PMBA 4WJ4A 1SFOB 4X65L 2HQLA 1XNRL 2A74C 4A3IB 2L0CA 1CZWA 3QO2A 4JVZA 4U68A 2R93H 1FGUA 2JEAI 1ESFA 3F2CA 5M5XH 2LFNA 4HJAA 1G8ZD 2AMCB 2O4XA 1S4ZA 4RMFA 1WI5A 3WWVA 2A8VA 1STYA 4JYAL 4DR6Q 4P72A 2BE5C 4YCVA 2PZWA 3OTOL 3WOFA 1HNZL 5IGBA 1FVIA 1K8AC 4HJ8A 1PH9A 1LTID 1DYQA 1PXUA 2PMZE 4K14A 1CKNB 1U5KA 1EOVA 2R7ZH 3M85A 3D6CA 2UXDQ 1FR3A 3X3MA 4KKTA 4I65A 3S1MB 2ATWA 2YTYA 2B2UA 1R9TB 4G7OC 4LF7Q 1HRJA 1UWVA 4DR2Q 3U4ZA 2QW7A 3MEHA 2ES2A 1KXLA 2VUMB 4XXEA 1BO0A 3Q6SA 4LF4Q 4CKBA 1C7YA 3PQIA 3TP5A 3H09A 2KEDA 2C35B 4A76A 5A2QL 3FRPB 1DXMA 1PRTC 3NENA 4DK1A 1II3A 3CRKC 1LUZA 4Y7NB 2ZJPA 1HUNA 2F0FA 1LTBD 2F0SA 1OTCA 2M9VA 4LMQD 2F52A 1EYAA 2EYOA 4MTNA 4K8IA 4NDXA 2DJGC 5FJ8G 3GTJB 3LGJA 2PPBC 2Z4IA 3I91A 4G57A 2RQXA 2MP1A 2IX1A 1XNQQ 1LTAD 2MO1A 1JT8A 4X66L 2EYJA 3MXNA 1D5MC 1I6HB 1Q46A 1AEXA 3F2UA 5I6YA 1IBML 2JN4A 1EY4A 4XQNA 2NN6H 5C4JB 5C4ZA 5ELEA 2WB1B 2EYFA 3NSWA 4K5XA 4C3IH 2B3GA 2PNRC 1CSPA 2MHVA 1XMOQ 1G91A 1VQCA 4IOCA 3HGBA 3VYTA 1J5EL 2Q8IB 3HEJA 4M8AA 4JI8L 3BDCA 3G4SA 3TS0A 1BBUA 1IW7C 2LXKA 4A93G 2I46A 1M8AA 4HMJA 3GV6A 1SNOA 2RSNA 3Q24A 4LF9L 2R93B 3I4MH 1DOMA 2RDGA 1X56A 2K7VA 4WFN3 4CJ0B 4JI2Q 3CF5A 1HZAA 4LF6Q 4RH6A 1PFBA 1VQFA 4EQNA 5KNCA 4OX9L 1SRUA 4GN5A 3VR5A 1K0RA 3L2PA 4GOPC 1Y1VB 2MNAA 3I4MG 4KN7C 1CKNA 4C3HH 4XIGS 2SEBD 1E1OA 1AP0A 3VR4A 1TS5A 1EWHA 1OXXK 4B3RL 5C3EB 2QKIC 3T56B 1OXVA 1MSHA 2F3WA 3PCOB 2GVBA 4TVAB 1D6EC 1QNUA 5GQOA 4IFDH 4GN3B 5G3LD 5C44H 3BZDB 3OMGA 5LL6X 2R3ZA 3QR8A 4O2DA 5C0XH 3KDFB 1ICFB 4HJ7A 1X9NA 2A69C 3I4NH 1TY0A 2YTVA 1STEA 2X69A 1WTRA 2E5LQ 5M5WB 4YWLA 3G48A 3GO5A 3MFYA 2EYMA 1K8OA 2NVYB 3LNNA 4IFDG 3CKIB 2ZTCA 1HQRD 3GTOB 5L37A 1U4MA 1HXYD 1HH2P 1RTOA 4PG3A 3STBC 4H13C 2E2JH 3JAMi 4O42A 1A2TA 2WINB 2AQ2B 3GD7A 2DNCA 1B9MA 3S1NB 4IOAA 1JR0D 3URYA 1TS4A 3VR2A 2NVQH 3HOXB 1IBMQ 3DEOA 4BY7B 1KAAA 3OHXC 3RN2A 4LF4L 1PFNA 1PZJD 2KHIA 3SK4A 3W5OA 4BWGB 4C3JG 3F1ZA 2ID0A 4V0BA 4AQYQ 4DR5Q 1YIJA 4YWKA 4HCSA 1TS3A 2UXDL 2WIIB 3A8JE 1CSQA 3TN2A 5DM63 3PUVA 3M3YH 3U9SA 2J7ZA 2IPKD 4HIDA 3PIPA 3Q23A 2KJXA 1TU2B 4GNXA 5DM73 3TMEA 4B9WA 1U4RA 2CW0C 4QF4A 4A3KB 4J8QA 2HHHQ 3R2IA 5DNFA 1EL0A 1B50A 3U50C 3DUZA 1GJXA 1PTOH 4L8JA 2RDFA 1L0XB 1D1IA 1JE4A 1EZ6A 5CBAE 4X3SA 5KNBA 1ILPA 1LTLA 1A3UA 1VQ5A 3BVGA 2UUCQ 5F2DA 3KUPA 3PUWA 4LFBL 3AFPA 4POGA 2O5IC 3S1MH 1YHQA 5CR3A 4LNQA 1IXRA 1FNWA 4PMCA 4A3MG 3PO2B 1B4OA 1Z9FA 3M4YA 4B3RQ 1B7YB 3CXCA 1JWMD 1BBWA 1N9WA 2EYHA 4ZK9B 1QB5D 2ENBA 2RBMA 2QDBA 1QE6A 3NELA 1K83B 5I2YA 2NZOA 3OPOA 5J22A 5LHY1 4HCEA 3MXGA 4DNTB 2WKCA 3A7AB 1H9RA 1NR2A 4LFAL 2BDNA 3LWUA 3TP8A 1TKWB 2F0KA 3PO3B 1CKOA 3M7NA 3FMCA 1YNXA 1XPOA 3AU7A 4IUPA 2OEOA 4DV0Q 5EPLA 1Q1BA 1OXTA 1HNZQ 1D8LA 2F1MA 3GTGH 1C0AA 5EJWA 2JEBI 1NUCA 3QG1A 3D8GA 1JQYD 1VQJA 5IP7G 5ELBA 2BOSA 1PTOB 1SE3A 4PMWA 4RGMA 3J80c 1WTVA 1LTGD 4JK1C 5JEAH 1EWIA 3J81i 3V2TA 5M5YH 2NYZD 4ZUIA 3Q22A 1RDPD 1HNWQ 1WTQA 2K03A 4AYBG 1KTKA 3T53B 3PF5A 1PFMA 4DK3C 4FXKC 1XTDA 1XMOL 4F8MA 4RCNA 1AH9A 3KYHC 5D3DA 4FVMA 3M3YB 2NZ1D 4JI6L 4A3JB 4NXNQ 4DR7L 1HFNA 4JI5Q 3TDQA 4C2MH 1C4QA 3S1RH 4F88A 3CC4A 4A3FB 4OONA 2ICEC 4QL5A 5ISRA 3HKZB 3NP8A 5J39A 1SJHD 1B2TA 1TWHH 2PCFB 2PYKA 1I4QA 2CKZB 4PZ7A 1ASZA 1PH3A 3HOVG 4BS9A 3E0JA 2BE5D 2L12A 1O7ZA 1F2MA 4JG2A 1TWAH 3T1HL 4WJWA 5GADC 5ELNA 2Z9HA 2NVQB 2A69D 2E2IH 2F0QA 2ZTEA 1QG7A 2JA6H 1MJCA 1SNPA 2F3IA 3HOWH 1V43A 1PYSB 1A62A 1MKHA 3J7A5 3KJOA 4BBSG 3MXUA 2YV5A 3SK5A 5G3LF 5GAHC 1LV9A 4LF5L 1KL9A 3KBGA 1PDQA 1KABA 1VQLA 3M4PA 3D3RA 1VQ6A 1ILQA 4KHPL 2AWOA 2G9HD 4BY1G 2L1BA 1EQQA 4X62L 1ZYRC 5M3FG 1F2YA 4IUNA 1D5ZC 4OXPA 3X3NA 3S16B 4X64Q 4JPBW 1X55A 1XX8A 3W1GA 3BJUA 1XPUA 3U4VA 3U9OA 2MQHA 3J81E 3FP9A 3K5MA 1EIYB 2VB2X 4K2LA 2R92B 4B3TL 3BVMA 1TT2A 4MN3A 3S17H 1PVOA 1J9OA 2A6EC 1UE1A 3S1NH 1Q12A 1PRTB 2NVXB 4JI6Q 4DR7Q 4IALA 2X6LA 2GVAA 2UXBL 2XNAC 3GTPH 1PZKD 2IX0A 3KLSA 3PUXA 3ER0A 4IPHA 4J1MA 4DXGA 2DN8A 3BZCA 1VQKA 1L1OC 1KC8C 1EFWA 1HUMA 1G2SA 1GXDC 5FLXE 4LF8Q 3I73A 3VA5A 2A73B 1F9QA 4DAYA 1VQMA 4EQPA 1K0SA 2NTTA 3CAMA 3ULPA 1JE5A 1MGSA 3E6ZX 2K6AA 3H3VH 3NUCA 2DNEA 5M3MB 4L63B 3G6EA 4R4TA 4FYDA 2ALYB 3K7UC 1VQAA 3I70A 4N8FA 5CV5A 4BA1I 1F77A 5FOBB 4KD3A 1N36L 1ML0D 3M4OH 1R4QB 3VYUA 2Y0SE 5E1FA 1QZGA 3HOZH 4DK6C 1U0LA 4K0KQ 3GQBA 4X6AH 1V1QA 4JI7L 1Q81C 2VQFQ 2OTLA 1RCVD 2A6ED 4RHSA 1CZGA 1P16A 3BYTB 4L5RC 4I7AA 4XYQA 4I7ZC 2PO4A 3HZXA 3DLLA 5LL6S 4CBVA 3C1FA 2E2HH 4HIOA 1XTCD 2K5WA 1N33L 3AEVA 1HNXL 2EYLA 4DN4M 3PO2G 4AYBE 1CI3M 3GTJH 4DV3L 1I4PA 1EQTA 1N8RC 2B2VA 2KHSA 4CHTB 4R9WA 3HOYG 1GUWA 2CH4W 2HDLA 3RLFA 4P75A 4Y7NH 1EUJA 1E2ZA 1I4XA 2PMZB 3I7FA 1EY5A 4DV1L 1BOSA 4WRDA 2FINB 4H7BA 3VDYA 1Y14B 2VY3A 3NWSA 3AMUA 3HOWB 2UXBQ 3RR5A 1J5EQ 3KLRA 4A3EH 3E9IA 5EBCA 2VUMH 1YZ6A 1E3PA 5JJKA 1AN8A 1LYLA 1VF5C 5CYUA 5J3BA 5IY0A 1S5ED 3TQYA 1FJGQ 1XXGA 3TP7A 2FJ2A 4DAYB 2ASBA 3GTQB 2R93G 2Z4HA 2AUKA 2QA4A 4A3LG 2L5TA 4XQJA 4HSPA 4HN7A 5FJ8H 1ZKOA 2KQ3A 5EQ0A 3ULJA 1EY9A 1TQOA 4ZYSA 4A3LH 1I6HH 2FXQA 4E6IA 2B2WC 2L9HA 1QNKA 4LFAQ 3I55A 1TWFH 1DCZA 1D5XC 4A3JG 1L0WA 2CH4A 2ZJQA 4RA8A 1EY6A 1H9KA 2RVLA 4LK1C 2XWBB 2PI2A 5EPKA 1LO5D 1I50H 3VR6A 2KA7A 5CORA 1STHA 2B8FA 4KLKA 4RFBA 2WP8J 1Q8KA 4KJOA 1IBLL 3H3VI 3A54A 1VS0A 1B8AA 3EIVA 1WTPA 2MGSA 3HOVB 1EY8A 3NQTA 4EX5A 4EQ5A 2QEJC 3SHLA 1GHJA 1PFSA 3ND8A 4B3ML 2NVTH 2A5HA 2KCMA 3OIQA 4JI3Q 3MEFA 5HURA 3MXPA 2CCZA 2JA5B 3KF6A 4DUYQ 5I9OA 1WTHA 2DY8A 2WKDA 4DXFA 3EA6A 3DM1A 1I4HA 4A3EG 1MIUA 2RF4A 3EQLC 4R4IA 2JA8H 4DNRB 2FHTA 2Z0SA 1PRTD 2N55A 3NXWA 2F4VL 2YYZA 3RN5A 4FDBA 2OWOA 2XWJB 3PO2H 2KOLA 4JYAQ 3M7GA 2IX3A 5HGQA 3T1HQ 4U673 1I4GA 2XTIA 2DJFC 3NPPA 2VZAA 3T1YQ 4ZQ3A 4LJZC 4A3IG 1SE2A 5E4XA 1IBKL 4HIMA 3S1QB 2K5VA 1NNXA 4CKEA 1TIID 3N52A 4RGTA 4JBMA 1ICWA 3OWEB 4A3BB 4MIUA 3NBHB 3PSIA 4L5TA 2KECA 1F9PA 1SDFA 3TRZA 2B2TC 1WJJA 5C4XH 3J7AF 3DWAA 2NTSA 3KDFA 3W1BA 1Y1WH 1MI2A 1PLFA 4OEMB 4APVA 1K3RA 1TVXA 4O1NA 2NWGA 2K28A 2SDFA 3AYHB 2K04A 3FKIH 4PV1C 5T1IA 4LFBQ 4BA2I 3CU7A 2I5MX 2B2TA 5C5MA 3A0JA 4BXXG 1OXUA 4DUYL 2DGYA 2NUCA 4C3JB 1G6ZA 1EY0A 4ZCKA 3HOVH 3L7ZC 5D14A 1UE7A 1B70B 1QCBD 5IGDA 4LF9Q 3SDZA 3TZDA 1HHVA 2RA4A 1JJCB 5JPNC 3OYYA 4A4IA 3CCQA 4AH6A 5LMNW 2JA8G 4BY7H 2O2LD 1GUTA 1QZHA 1ENCA 3UDFA 4OX9Q 2QEXA 4JI8Q 1TR5A 1AW7A 1CK1A 4BBRH 3MAQA 4RWSC 3T1YL 2UUAQ 1ET6A 3KJPA 2SNMA 5BR8L 2XRQD 5KNDA 2MPMA 3V05A 5CGKA 1M90C 1PH2A 3MVVA 3RUZA 1SEBD 1KDAA 4C3IG 3K6OA 3GTQH 3BU2A 4EQOA 1JB3A 5IT9E 2X6GA 2C9OA 1E0BA 3J80L 1EEID 2VL6A 2AHOB 4DV6Q 4GOPB 3PO3G 3NTIA 3A8KE 3D31A 3I4NB 2LS01 5KIXA 1VCIA 1RF2D 4UY8C 3G7LA 3RZDH 3PUYA 4FXGC 3A8IE 3H15A 3KF6B 4R4OA 5IOCA 4UDUC 3CCJA 4QJFA 3HOYB 3S15B 2EQSA 2EOTA 4HR7B 1M1KC 1DZ1A 1SMXA 2CQAA 1C48A 2G5DA 2CW0D 4KY7A 3T13A 4UP7A 1YJWA 5IP9G 3RZOB 4IUTA 1BCPF 3K8AA 3HOWG 3MHBA 3SVMA 1K73C 4CKCA 4YHHQ 1RL2A 4JC0A 1KAWA 5KGUA 5JJIA 1IZ6A 5JJLA 1RJTA 1YITA 3PF4A 2XIWA 3P7JA 1SYGA 1L0YB 4JBJA 4L5QA 1HZBA 2UUBL 4IPDA 1Z47A 4AYBB 5GAEC 2N3SA 4JOIA 3F8TA 4QIWE 4B08A 5D3IB 3HRZC 1NCVA 3I4MB 2NB0A 3J81L 5C0XG 1VQ4A 1BCPC 2F0UA 4LF7L 5K36G 1LLRD 3CCSA 2QGQA 3LX0A 5HY6A 4GKJL 4LUOA 5CV7A 4JBWA 1FD7D 4IUUA 5CV9A 4DV6L 3QOJA 3BVZA 2B39A 1YNNC 4C3HG 4JI4Q 2B2WA 2QF7A 4OHJA 1GUGA 2Z8LA 1RKNA 1Y8OB 2R61A 1V1PA 2D0OA 1DJRD 4FF3A 4R8NA 2DY7A 1IBLQ 4CGYB 1K3BC 3QIAA 5GAGC 1ET9A 4QQBX 2Q2TA 2JA9A 1VQEA 4JBKA 5M9OA 1NY4A 4KMUC 3CPFA 4BBRB 3L0OA 4DV5L 1N32L 2EVBA 2HQEA 3A55A 5IYCH 1E2WA 2H5XA 1VQIA 4KY5A 5T1GA 1HTPA 4P74A 4YIJA 5K36H 5IGEA 4RAUC 4JV5L 4HJ5A 4KTAA 3K7AH 3I2ZA 3PMFA 1XMQL 4QIWB 3TEHB 3SR1A 4JI2L 1KHIA 2CHBD 3CCEA 1TXYA 2JA7B 1KLGD 2K01A 2R92G 4JI7Q 3K57A 1HPCA 1NMFA 1DOLA 3V96A 1Q7YC 3BS1A 1X3PA 3K0YA 4X64L 1R9TH 4NW2A 3OSOA 4MTKA 1N33Q 1N36Q 2EY2A 1VQ8A 3E5SA 1DGSA 2PQAA 3TSSA 2K5QA 4HSVA 5IP9H 3VYRA 4GLXA 1DONA 1I5FA 1ASYA 1SE4A 4ILWA 2K33A 3HP3A 1WYDA 4BY1H 4K0KL 3EJIA 3CCMA 1SMYD 3CQZH 4RKLA 4FF4A 2PW5A 1EQVA 2B8GA 2P5ZX 3FDTA 4LF5Q 2MFIA 4K2KA 1UAPA 4UAIA 1STBA 1TWAB 2RKSA 4FXDA 2KCTA 5JEAG 3HG9A 2ICIA 4BBSH 1B44D 2EYPA 3WOEA 1PTOD 1S72A 5M3MG 4RCOA 1SBBB 3EFXD 4HAEA 4EGVA 2B2YC 1EU4A 4KY6A 4QUCA 1Q86C 3J81c 4C1NI 3CHBD 2I0QA 2FFKB 5FLMH 1YNJC 3NTKA 1SYFA 3K5OA 3J80i 2JA8B 1A6XA 4A3FH 1VQ9A 1KNEA 2IW3A 5M3FH 1PA6A 5C44G 4A3MB 2I5HA 1FYCA 2PZTA 3KLWA 3JAME 1K9MC 1WCMG 3ERQA 3Q8DA 2LSSA 2K05A 1BF4A 4JI4L 4IZ8A 4DV2L 3KBXA 5EKIA 4X3TA 3S9WA 2XRSD 1AFPA 4JI3L 3S24A 3KK7A 5C4XB 1PZID 1Q3LA 2LKVA 4JI0L 4Z9CB 2ZXOA 4MNOA 1EYCA 1HJPA 2F0GA 1JWSD 1RHPA 2EXZA 3IFTA 1HFGA 4RGOS 2B63G 1I50B 3CCLA 4DR2L 1QJOA 2Q8TA 5JPMC 1MJEA 4G7HC 1H9MA 1LT3D 2CQOA 1EU3A 3S2HB 3M9BA 3NBHA 1HZ9A 1NBWA 2AQ1B 3BDLA 3M4QA 1Q8IA 3ITPA 1SAPA 3IKJA 4A3GH 4ZKCB 1JB7A 1X3EA 4DV2Q 2EJFC 1WCMH 2J4XA 4H0LC 2TSSA 1UE5A 1QOHA 2CWPA 2F0EA 4XQQA 4C1NK 1Y1WG 1EFID 3CQZB 4IN3A 5LMUQ 4DR1L 1QUQB 1IYUA 2E76C 4F87A 4QUFA 3AFQA 2YU9B 1GO3E 1ENAA 1D1KA 4QCLA 2JA6G 1X32A 3QJYA 5FLMG 2NVTB 1ESRA 1CHQD 4IJHA 1ENFA 1EYDA 1DOKA 2A1AA 1TY2A 1W6KA 2AWNA 4TKOB 1J8IA 4JI1L 4RKBA 5EBDA 1F9SA 2XSCA 2PZUA 3RLOA 1IBKQ 4C56C 5IYBG 4IO9A 5DLQE 3OTOQ 2JXMB 3I8ZA 3UDGA 1LTRD 2HD3A 3FKIG 4XTCS 3DHQA 5JJZA 5IGGA 4J6HA 1S40A 3K7AB 4QMGA 3T51B 2EY1A 3K80C 4DV7L 3GTKH 4N9PA 1BVSA 3D4DA 2VQEQ 1Y69U 3MZ5A 1N34Q 1UEAB 1STGA 2B2VC 2QCPX 3IL8A 1Q90A 3E0EA 1P8LA 2FMCA 1SSOA 3CC2A 3BG3A 2IWHA 5IYDG 5KEEA 1FGBD 2HT1A 2NN6I 3CCUA 2RCNA 1WTWA 4WORA 1T5XD 1NSNS 3TZUA 1I94L 3CMAA 2K1BA 1S5BD 4B9XA 2VNUD 2F0OA 4GS3A 1PH5A 1HTLD 2N49A 1JMCA 2D2CC 4ABNA 4H44C 2F03A 1MBYA 4POFA 1WD1A 1EYGA 3HKZE 4QY7A 2D9UA 4CJ2C 4KHZA 4IJLA 5EKKA 1PYBA 4DUZQ 4A75A 3J7ZC 4A3EB 1QVCA 2IJ0A 4LAAA 1B1ZA 4KKSA 1M4VA 2F0PA 3BZKA 4LFCQ 2K5HA 2Z6KC 1X54A 4YCWA 2EZVA 2E74C 4NXML 3K81C 1O7IA 1E22A 2WAQE 1KLUD 2ZTDA 5IWAL 5E3FA 1L1OB 2Q2HA 3HKSA 3LWEA 1H9JA 4UP9A 1NMGA 3I4LA 1RODA 4OO1G 1TWGH 2WACA 1JWUD 1BNZA 1GOZA 1Z6HA 1VMCA 2GN5A 1KD1C 2NVYH 1FNUA 1F2LA 4RGNA 1A8VA 1EQRA 1HCZA 3H0GB 1G6PA 4A3GB 2PI2E 3GTMH 2OQKA 2IHFA 3EN2A 4JOIC 3GTPB 4A3BG 3SK6A 3C46A 2JJQA 1SROA 2UUCL 3HOUB 1A63A 1XYIA 4CDDC 4KK7A 5IP7H 2NVXH 4X62Q 4OO1H 4GOPA 4G4KA 5ELFA 4ALPA 1ZXTA 2EE1A 3NWTA 5FLXc 3S17B 5I4DA 2AUJD 1ZEQX 2JYOA 5C3WA 2F0IA 4HMIA 1H9SB 1G51A 1W6JA 2A6HD 3DWPA 2RCFA 3NHHA 1BXTA 1FL0A 3S15H 2XGTA 1GUNA 3CW2C 1S5FD 5AJ3L 2R6GA 1XWEA 2GA4B 1AE2A 2BH8A 4N8X1 3OOCA 2Z6KA 4WJ3M 3H6MA 3CMEA 4NB3A 1FJGL 2N8NA 1PH8A 1I4RA 1W2BA 2RDHA 2TMPA 5TSSA 4A3MH 2KCCA 4GKKQ 1CM9A 2OF1A 1KIXA 3NE5B 2QILA 2XVSA 1I94Q 4Y52H 1ZYRD 4A3DH 1LTSD 2RHQB 2N88A 3D6WA 1PHJA 4LF6L 1AE3A 5BN3A 4DUZL 4N9TA 3QOLA 1PTOF 2Y0SG 1YI2A 2UU9Q 4BXXH 1VQGA 3NQIA 3ULLA 5A2QE 2KVMA 1IKMA 4FF2A 5FK9C 1IL2A 3TS2A 1H9SA 1VDZA 4F7XA 3I4NG 4PQXA 2QDLA 1R4PB 3R2TA 5D65A 1QWYA 4C3IB 1BCPB 3ND9A 3J7AV 5C4XG 3D0FA 4NXMQ 2R92H 2WB1E 3GTLH 4X3KA 4GLAC 5BN4A 1HNXQ 1W3SA 3S2DB 4FO2A 4X65Q 3AQQA 3J7YW 1TWCB 4L5SA 1KNAA 3K59A 3CC7A 2C5CA 2HIXA 4IPGA 1A2UA 3A74A 1CQVA 2B63B 1GM5A 4OO1I 4FF1A 5EPJA 1RTNA 3DEPA 4R4CA 3OWFA 1KRTA 4C3JH 1MSGA 3FPPA 1CKMA 1HA5A 3CCRA 2HDMA 2LXJA 5ELDA 5C5LA 4GNXC 4G7ZC 4B3SQ 2JQOA 1CUKA 1D7QA 1EIHA 2F0TA 1IKLA 1WFQA 3GP7A 4EVOA 5C3XA 1NJIC 4DR4L 2FMMA 2KUMA 2F3VA 2WAQB 4KN4C 4NXNL 4ME3A 1AZQA 4TQUS 1UNSA 2F0MA 1U9RA 2JA7H 1EEFD 5ELOA 1VMPA 3VA7A 2PQAB 4K5WA 1CA6A 2L11A 4A3BH 2AKWB 3G71A 1SYDA 2F0LA 5CV8A 3STBD 2VXWA 3S1QH 1SNQA 3R3OA 1O7YA 5IT9L 2JA6B 1K8MA 3RLNA 2E2IB 3FEWX 2ZT9C 1V9PA 4S3SA 4DV0L 3GTGB 3C3LA 2PNHA 2IY5B 1PH7A 3HOUH 3EVQA 1SLJA 1IYVA 1WVLA 1J6QA 4NP5A 4ZKBB 4JV5Q 3DWQA 1PRTF 1QVFA 4XDXA 1TWHB 1X65A 1GHKA 3PIO3 1Y1VG 4A3DB 5I2XA 1PMRA 1X6OA 4GKJQ 2JA5G 1DM0B 4A3CH 4O0AA 2RHSB 3DMUA 2HHHL 1IHZA 2K32A 3QWNA 3TREA 4BBRG 4RHRA 4A3JH 2WV6D 3I56A 2JA5H 4A3CG 5BN5A 2NN6G 2MJ8A 3DM3A 2ZXPA 4X66Q 2B2YA 2SNSA 2XN9C 4RG1A 5M5XB 3I3CA 2Q8RE 5H1SE 3KF8B 2Z1CA 4KI0A 3ZJYC 4DAPA 1UE6A 4A3KH 2Q2UA 1YBYA 5IODA 1XJVA 1I3QH 5CMDA 5EAYA 1STAA 1BBXC 1E7ZA 2I07B 1QUQA 1RIPA 3P1HA 1AZPA 1O78A 2OQ0A 3NTHA 3PGZA 4UP8A 5C4HA 1XNQL 3GTMB 4FNFA 3WDNA 1NR4A 4X3UA 2JA7G 3H0GH 1TWFB 2K5DA 5JOBA 3TP6A 2F4IA 5A35A 1ONLA 1CTMA 3KF8A 5GROA 3GTKB 3JAMc 5DAUA 4CDEC 4GKKL 3PIOA 3PUZA 2R7FA 4ZRZA 1EWCA 4BY7G 2L4NA 2K50A 5IGCA 4DV4Q 3H0GG 2K14A 3RZDB 4A3GG 5LMNQ 2PQEA 5KYLA 4DR4Q 1VQ7A 2N78A 4L6TB 4V190 1FNVA 3RMHA 1SYEA 4R4QA 4JI5L 4KHVA 5JVG3 3IRBA 3KLSX 5DEHA 4LUZA 1NTGA 4OWXB 2F0NA 1XNRQ 4DR3L 3NK9A 2LY7A 1HR0W 4CDFC 4MZ9A 1LT6D 1X3FA 5JAVA 3ONAB 4YCUA 1DD2A 3PIP3 1Y8PB 3FVQA 4LUVA 1WCMB 1STNA 4A3KG 1LT4D 3D4RA 3KFUA 1GUSA 4DV7Q 4ZUJA 1SNDA 2E2HB 3U58A 2VUMG 5IIFA 2D0PA 1PH4A 2BCOA 3BDOA 4LF8L 2IHEA 3A56A 1SNCA 3K5LA 2PW7A 1I3QB 5C44B 5E4WC 1PH6A 1YVCA 1XMQQ 2RSOA 1NE3A 3R8BA 2BA1A 4HIKA 4Q0FA 4ZAIA 1WTXA 5C3EH 5JVH3 4FP5D 3HOZB 1BQQT 2F0DA 1PTOC 5JEAJ 1U4PA 2HIVA 1S3OA 1C8CA 4DV1Q 1EIFA 4LW1A 1A3TA 4ODGA 1Y1VH 1CFMA 3EBEA 4XYOA 1SE8A 3W2DA 3OMCA 4DV3Q 3DXJC 3UDXA 1Y1WB 1B3QA 1YNND 4JI1Q 4PZ8A 2BA0A 3I90A 1VF7A 4OELB 1JOKA 1S5DD 5M5WH 2M00A 2HCCA 2WB1G 2KCNA 2V4DA 1NAPA 4DU9A 1N34L 4B3TQ 1QVGA 2A68D 3MFGA 4GZYC 2M2LA 1F2ZA 1JORA 2D62A 3L9AX 1A0IA 2NZHA 3E9HA 1CT1D 1LACA 5FO8B 4QB4A 2VB3X 1BKBA 2EY6A 1WOCA 3UE0A 1HR0Q 1EOTA 5C4JH 2NBFA 5IGFA 4DR3Q 4H02A 2E8GA 4AQYL 3SGIA 4A3FG 2A19A 4OIKA 2IL8A 3EROA 3KOJA 4C3HB 3HKZG 3C1EA 3QB3A 1YJ9A 1U4LA 4NMZA 5IYCG 5C3EG 1O80A 1PH1A 2KENA 5FO9B 3MWYW 4K6LA 4UPAA 1WTOA 1V8QA 2F0WA 3F2DA 3VR3A 4OL7A 1F9RA 2IT1A 1Y8NB 2B29A 2KHJA 3P75A 4LWCA 2B63H 1Q1EA 4CJ1B 1S5CD 3B6YA 1CQFA 5IWAQ 1B3AA 4JCVE 2JSOA 2EJGC 1TWCH 1VQDA 4KHPQ 1PYWD 3S2DH 3SEBA 1X3QA 4BBSB 2UXCQ 4DKAC 2EY5A 3GTLB 1HNWL 1YHBA 4IURA 3MA2B 2V1CC 1MHWC 1JICA 3TBIB 2UU9L 1JJGA 1EZ8A 2CVRA 4YY3L 2KBNA 4IQZA 3D4WA 1L1OA 2CWAA 3E3XA 3O13A 1SYCA 5FLXL 4JI0Q 4BY1B 3RNUA 4PNYA 2R7ZB 1L2FA 3IAYA 1MD2D 1B53A 5FO7B 1HR0L 2Q2IA 4ME5A 1E24A 1HQMC 2ZXRA 1B9NA 2JK8A 3FHWA 1BUVT 1CHPD 4J15A 1VQNA 5IYDH 3UE1A 2CFMA 3I4OA 1A15A 2K4KA 1VQHA 2ZM6L 3OW2A 1SYBA 2HCIA 1HZCA 1LTTD 1LT5D 1QILA 2K52A 2YTXA 4KJNA 4Q5VA 1BDOA 2F0HA 4GN4B 3Q0AA 4P71A 1D2BA 1JJ2A 1WD0A 1YNJD 2I5LX 2K75A 3MXNB 1HA6A 1VQBA 4M1UB 2O5JC 5M5YB 1O7LA 3P20A 5BR8Q 1G2TA 2LMCB 1V1PB 4P73A 1SFOH 1GKHA 3W3AA 2EXDA 3HOUG 3ICEA 3NBIA 4R8IA 3MTSA 3C2PA 4QGUA 2VS1A 1UUPA 2H4OA 3UDIA 2K5NA 3A5UA 4KKUA 1OXSC 2E75C 3H94A 4DK0A 5AFWA 4DF7A 2VQEL 1BR9A 4IFDI 4GLVB 2A6HC 2Z6BA 3PO3H 2SOBA 4OWTB 5IYBH 3BYYB 1KDCA 4OGQC 4TRDA 2MO0A 2KEEA 4YY3Q 1YJNA 3K0XA 3CCVA 3SXHA 3RZOH 5LMUL 2EPBA 4UHVA 1X3GA 4K6DA 3GV3A 3OIPA 1K83H 4NPSA 3J80E 2OCEA 4DR1Q 2D5DA 4ULLA 5FKAC 3ZYYX 1TWGB 2UXCL 2BDOA 3OW7A 2F0JA 2Y0SB 4XT1B 3IFDA 2VW9A 3I72A 1VQOA 1K8GA 1YHAA 4DR5L 3M4OB 1YEZA 5J1ZA 4GNXB 4IUVA 4B3SL 1SR3A 1I6VC 3J81j 1T5EA 2ZM6Q 1EY7A 5M3MH 1A3VA 3K58A 4JW0A 3HFZB 1CA5A 2EDGA 5CV6A 5CBEE 3HS0C 3F2BA 4A3IH 5EGTA 3MC0B 2BH2A 1SJED 4DV4L 5KRUA 4R1JA 2AQ3B 3HOZG 2F0VA 4ZLTF 4XT3B 2E2DC 1JOQA 5IT9c 4AIMA 2VQFL 1LABA 1SMYC 5EKLA 4LFCL 2EJMA 5AJ3Q 4TSSA 1PV4A 4K5VA 4OWWB 5I9PA 1BCPD 4A93B 5HGTA 1SN8A 2WFWA 4DA2A 2E5LL 4K8JA 2EIFA 1KRSA 3GDEA 5CV4A 3JC66 3AB9A 2UUBQ 1GUOA 1LM0A 1OO9B 3CP0A 1K28A 3HOYH 5I6WA 2JE6I 3A7LA 3H3VC 2R7DA 4IUQA 3S16H 2WAQG 4YHHL 2F4VQ 2L55A 3SK8A 3HOXH 1T9HA 1UEBA 3T4AC 3S14B 5COYA 3G6JB 3T16A 5ELCA 3A5ZB 4HJ9A 5C6AA 1Q82C 2A68C 5LMNL 4MHEA 4CDCC 3FKIB 4DNIA 2E2JB 1KQSA 2YU9H 1GD7A 5C0XI 1IL8A 3FPUB 4DGZA 4YWMA 1VQPA 4DPGA 5IE8A 3GTOH 2HUGA 2MUYA 2H1EA 1EIGA 4B3MQ 4NKLA 1JOOA 3SE0A 1IW7D 2JP1A 1GVPA 3CD6A 4KD4A 4IFDJ 1TS2A 1SXTA 1JCKB 1JC7A 5CC4A 3L3OC 3S14H 1C9OA 1Z7TA 4A3DG 4DV5Q 1E2VA 3S2HH 4DAMA 1IYJB 2G9DA 4DR6L 3H91A 1H95A 4DFAA 4DAVA 3NEMA 2OT2A 4HEDA 5C0XJ 2UUAL 3JAML 1E1TA 3N6RA 2B2UC 4HTHA
chains in the Genus database with same CATH topology
5NUCA 5K5PA 3VYSA 3CRLC 4ID6A 3R93A 5KYIA 2J0TD 2OXPA 4KV6A 4C2MB 1SNMA 3S1RB 1KDBA 4P2CB 3UI2A 3K5NA 1RD9D 1V1OA 5M3FB 3RD4A 4OIJA 1G291 3PV0A 4PMBA 1SFOB 2A74C 4A3IB 2L0CA 1CZWA 3QO2A 4U68A 2JEAI 1ESFA 2LFNA 1G8ZD 2O4XA 1S4ZA 1STYA 2BE5C 2PZWA 3WOFA 5IGBA 1LTID 1DYQA 1PXUA 4K14A 3M85A 3D6CA 1FR3A 3X3MA 4KKTA 4I65A 3S1MB 2B2UA 1R9TB 4G7OC 1HRJA 3MEHA 2VUMB 4XXEA 1BO0A 3Q6SA 4CKBA 3TP5A 3H09A 2KEDA 5A2QL 3FRPB 1DXMA 1PRTC 4DK1A 1II3A 3CRKC 4Y7NB 1HUNA 2F0FA 1LTBD 2F0SA 2M9VA 4LMQD 1EYAA 2EYOA 4K8IA 4NDXA 3GTJB 2PPBC 2Z4IA 3I91A 4G57A 2RQXA 2MP1A 2IX1A 1LTAD 2EYJA 3MXNA 1D5MC 1I6HB 1AEXA 3F2UA 5I6YA 1EY4A 4XQNA 2NN6H 5C4JB 5C4ZA 5ELEA 2WB1B 2EYFA 3NSWA 4K5XA 2PNRC 2MHVA 1G91A 3HGBA 3VYTA 2Q8IB 3HEJA 4M8AA 3BDCA 1IW7C 2I46A 1M8AA 4HMJA 3GV6A 1SNOA 2RSNA 3Q24A 2R93B 1DOMA 2RDGA 2K7VA 4WFN3 4CJ0B 4RH6A 1PFBA 4EQNA 5KNCA 3VR5A 1Y1VB 4KN7C 4XIGS 2SEBD 1AP0A 3VR4A 1TS5A 1EWHA 1OXXK 5C3EB 3T56B 2QKIC 1OXVA 1MSHA 2F3WA 1D6EC 1QNUA 4IFDH 5G3LD 3BZDB 3OMGA 5LL6X 2R3ZA 5C0XH 2A69C 1TY0A 1STEA 2X69A 1WTRA 5M5WB 3GO5A 3MFYA 2EYMA 1K8OA 2NVYB 3LNNA 4IFDG 3CKIB 1HQRD 3GTOB 1U4MA 1HXYD 1RTOA 4H13C 4O42A 1A2TA 2WINB 2AQ2B 3GD7A 2DNCA 1B9MA 3S1NB 1JR0D 3URYA 1TS4A 3VR2A 3HOXB 3DEOA 4BY7B 1KAAA 3OHXC 1PFNA 1PZJD 3SK4A 4BWGB 4C3JG 2ID0A 4V0BA 4HCSA 1TS3A 2WIIB 3A8JE 3TN2A 5DM63 3PUVA 3U9SA 2J7ZA 2IPKD 3Q23A 2KJXA 1TU2B 5DM73 3TMEA 4B9WA 1U4RA 2CW0C 4QF4A 4A3KB 4J8QA 3R2IA 5DNFA 1EL0A 1B50A 3DUZA 1GJXA 1PTOH 4L8JA 2RDFA 1L0XB 1D1IA 1JE4A 1EZ6A 5CBAE 4X3SA 5KNBA 1ILPA 1A3UA 3BVGA 5F2DA 3KUPA 3PUWA 2O5IC 5CR3A 1FNWA 4PMCA 3PO2B 1B4OA 3M4YA 1JWMD 2EYHA 4ZK9B 1QB5D 2ENBA 2RBMA 2QDBA 1QE6A 1K83B 5I2YA 3OPOA 5J22A 5LHY1 4HCEA 3MXGA 4DNTB 2WKCA 3A7AB 1H9RA 1NR2A 2BDNA 3LWUA 3TP8A 1TKWB 2F0KA 3PO3B 3M7NA 3FMCA 3AU7A 4IUPA 2OEOA 5EPLA 1OXTA 1Q1BA 2F1MA 5EJWA 2JEBI 1NUCA 3QG1A 3D8GA 1JQYD 5ELBA 2BOSA 1PTOB 1SE3A 4PMWA 4RGMA 1WTVA 1LTGD 4JK1C 5JEAH 3V2TA 2NYZD 4ZUIA 3Q22A 1RDPD 1WTQA 2K03A 1KTKA 3T53B 1PFMA 4FXKC 4F8MA 4RCNA 5D3DA 4FVMA 3M3YB 2NZ1D 4A3JB 1HFNA 3TDQA 1C4QA 4F88A 4A3FB 2ICEC 5ISRA 3HKZB 3NP8A 5J39A 1SJHD 1B2TA 2PCFB 2PYKA 1I4QA 4BS9A 3E0JA 2BE5D 2L12A 1O7ZA 1F2MA 4WJWA 2NVQB 2A69D 2F0QA 1QG7A 1SNPA 1V43A 3MXUA 3SK5A 5G3LF 1LV9A 3KBGA 1PDQA 1KABA 3D3RA 1ILQA 2AWOA 2G9HD 2L1BA 1ZYRC 1F2YA 4IUNA 1D5ZC 3X3NA 3S16B 1XX8A 3U9OA 3J81E 3K5MA 2VB2X 4K2LA 2R92B 3BVMA 1TT2A 4MN3A 1J9OA 2A6EC 1Q12A 1PRTB 2NVXB 4IALA 2X6LA 2XNAC 1PZKD 2IX0A 3KLSA 3PUXA 4J1MA 4DXGA 2DN8A 1HUMA 1G2SA 1GXDC 5FLXE 3I73A 3VA5A 2A73B 1F9QA 4DAYA 4EQPA 2NTTA 1MGSA 3E6ZX 2K6AA 3NUCA 2DNEA 5M3MB 4L63B 4FYDA 3I70A 5CV5A 4BA1I 1F77A 5FOBB 4KD3A 1ML0D 1R4QB 3VYUA 5E1FA 3GQBA 1RCVD 2A6ED 4RHSA 1CZGA 3BYTB 4XYQA 4I7ZC 2PO4A 3HZXA 5LL6S 4CBVA 3C1FA 1XTCD 2K5WA 2EYLA 4DN4M 1CI3M 1I4PA 1EQTA 2B2VA 2KHSA 4CHTB 4R9WA 1GUWA 2HDLA 3RLFA 1E2ZA 1I4XA 2PMZB 1EY5A 1BOSA 4WRDA 2FINB 4H7BA 3NWSA 3AMUA 3HOWB 3KLRA 5EBCA 1AN8A 5CYUA 1VF5C 1S5ED 1XXGA 3TP7A 2FJ2A 3GTQB 2Z4HA 2AUKA 2L5TA 4XQJA 4HSPA 4HN7A 1ZKOA 2KQ3A 5EQ0A 1EY9A 1TQOA 4ZYSA 4E6IA 2B2WC 2L9HA 1QNKA 1DCZA 1D5XC 4RA8A 1EY6A 1H9KA 2RVLA 4LK1C 2XWBB 5EPKA 1LO5D 3VR6A 2KA7A 5CORA 1STHA 2B8FA 4RFBA 2WP8J 4KJOA 3A54A 1WTPA 2MGSA 3HOVB 1EY8A 3NQTA 2QEJC 3SHLA 1GHJA 3ND8A 2A5HA 3OIQA 5HURA 3MXPA 2JA5B 5I9OA 2DY8A 2WKDA 4DXFA 3EA6A 3DM1A 1I4HA 3EQLC 4DNRB 2FHTA 1PRTD 2N55A 3NXWA 2YYZA 2XWJB 2KOLA 3M7GA 2IX3A 4U673 1I4GA 3NPPA 4ZQ3A 4LJZC 1SE2A 5E4XA 3S1QB 4CKEA 1TIID 3N52A 4RGTA 4A3BB 1ICWA 3OWEB 4MIUA 1F9PA 2KECA 1SDFA 2B2TC 3J7AF 3DWAA 2NTSA 1MI2A 1PLFA 1TVXA 4O1NA 2NWGA 2K28A 2SDFA 2K04A 4PV1C 5T1IA 4BA2I 3CU7A 2B2TA 5C5MA 1OXUA 2NUCA 4C3JB 1G6ZA 1EY0A 3L7ZC 5D14A 5IGDA 1QCBD 3SDZA 3TZDA 1HHVA 2RA4A 5JPNC 2O2LD 1GUTA 1ENCA 1TR5A 1AW7A 1CK1A 3MAQA 4RWSC 1ET6A 2SNMA 2XRQD 5KNDA 2MPMA 3V05A 5CGKA 3MVVA 3RUZA 1SEBD 1KDAA 4C3IG 3K6OA 4EQOA 1JB3A 5IT9E 2X6GA 2C9OA 1E0BA 3J80L 1EEID 3NTIA 3A8KE 3D31A 3I4NB 2LS01 5KIXA 1VCIA 1RF2D 3G7LA 3PUYA 4FXGC 3A8IE 5IOCA 4UDUC 3HOYB 3S15B 2EOTA 4HR7B 1DZ1A 2CQAA 1C48A 2CW0D 4KY7A 3T13A 3RZOB 4IUTA 1BCPF 3MHBA 3SVMA 4CKCA 5KGUA 1RJTA 2XIWA 3P7JA 1SYGA 1L0YB 1Z47A 4AYBB 4B08A 5D3IB 3HRZC 3I4MB 1NCVA 2NB0A 3J81L 5C0XG 1BCPC 2F0UA 5K36G 1LLRD 3LX0A 5CV7A 4JBWA 1FD7D 4IUUA 5CV9A 3QOJA 3BVZA 2B39A 1YNNC 4C3HG 2B2WA 2QF7A 4OHJA 1GUGA 2Z8LA 1RKNA 1Y8OB 2R61A 1V1PA 1DJRD 4FF3A 4R8NA 2DY7A 4CGYB 3QIAA 1ET9A 5M9OA 4KMUC 4BBRB 2EVBA 2HQEA 3A55A 1E2WA 4KY5A 5T1GA 1HTPA 4YIJA 5K36H 5IGEA 4RAUC 4KTAA 3PMFA 4QIWB 3SR1A 2CHBD 2JA7B 1KLGD 2K01A 3K57A 1HPCA 1DOLA 3V96A 3BS1A 1X3PA 3K0YA 4NW2A 3OSOA 2EY2A 3E5SA 3TSSA 2K5QA 4HSVA 3VYRA 1DONA 1SE4A 4ILWA 2K33A 3HP3A 3EJIA 1SMYD 4RKLA 4FF4A 2PW5A 1EQVA 2B8GA 3FDTA 4K2KA 1UAPA 4UAIA 1STBA 1TWAB 2RKSA 4FXDA 5JEAG 3HG9A 2ICIA 1B44D 2EYPA 3WOEA 1PTOD 4RCOA 1SBBB 3EFXD 4HAEA 4EGVA 2B2YC 1EU4A 4KY6A 4QUCA 4C1NI 3CHBD 2FFKB 1YNJC 3NTKA 1SYFA 3K5OA 2JA8B 1A6XA 1KNEA 2IW3A 4A3MB 1FYCA 2PZTA 3JAME 3ERQA 2K05A 1BF4A 4IZ8A 3KBXA 5EKIA 4X3TA 3S9WA 2XRSD 1AFPA 3KK7A 5C4XB 1PZID 1Q3LA 2LKVA 4Z9CB 2ZXOA 1EYCA 2F0GA 1JWSD 1RHPA 2EXZA 3IFTA 1HFGA 4RGOS 1I50B 1QJOA 2Q8TA 5JPMC 4G7HC 1H9MA 1LT3D 1EU3A 3S2HB 3NBHA 3BDLA 2AQ1B 1Q8IA 3ITPA 1SAPA 3IKJA 4ZKCB 2EJFC 2J4XA 4H0LC 2TSSA 1QOHA 2F0EA 4XQQA 4C1NK 1EFID 3CQZB 4IN3A 1IYUA 2E76C 4F87A 4QUFA 2YU9B 1ENAA 1D1KA 4QCLA 1X32A 3QJYA 2NVTB 1ESRA 1CHQD 1ENFA 1EYDA 1DOKA 1TY2A 1W6KA 2AWNA 4TKOB 1J8IA 4RKBA 5EBDA 1F9SA 2XSCA 2PZUA 4C56C 2JXMB 3I8ZA 1LTRD 4XTCS 3DHQA 5JJZA 5IGGA 4J6HA 3K7AB 4QMGA 3T51B 2EY1A 4N9PA 3D4DA 1Y69U 3MZ5A 1UEAB 1STGA 2B2VC 2QCPX 3IL8A 1Q90A 2FMCA 1SSOA 3BG3A 2IWHA 5KEEA 1FGBD 2NN6I 1WTWA 4WORA 1T5XD 1NSNS 3TZUA 2K1BA 1S5BD 4B9XA 2VNUD 2F0OA 1HTLD 2D2CC 4ABNA 4H44C 2F03A 1MBYA 1WD1A 2D9UA 4CJ2C 4KHZA 5EKKA 4A3EB 2IJ0A 4LAAA 1B1ZA 4KKSA 1M4VA 2F0PA 2EZVA 2E74C 1KLUD 5E3FA 3LWEA 1H9JA 3I4LA 1RODA 4OO1G 2WACA 1JWUD 1BNZA 1GOZA 1Z6HA 1VMCA 1FNUA 1F2LA 4RGNA 1HCZA 3H0GB 4A3GB 3GTPB 3SK6A 3C46A 3HOUB 1XYIA 4KK7A 4OO1H 4G4KA 5ELFA 1ZXTA 2EE1A 3NWTA 3S17B 5I4DA 2AUJD 1ZEQX 2JYOA 5C3WA 2F0IA 4HMIA 1H9SB 1W6JA 2A6HD 3DWPA 3NHHA 1BXTA 1GUNA 1S5FD 2R6GA 1XWEA 2GA4B 3OOCA 3H6MA 1I4RA 2RDHA 2TMPA 5TSSA 2KCCA 1CM9A 2OF1A 3NE5B 2QILA 2XVSA 1ZYRD 1LTSD 2N88A 3D6WA 5BN3A 4N9TA 3QOLA 1PTOF 3NQIA 5A2QE 2KVMA 1IKMA 4FF2A 5FK9C 1H9SA 1VDZA 4F7XA 4PQXA 1R4PB 3R2TA 5D65A 1QWYA 4C3IB 1BCPB 3ND9A 3J7AV 4X3KA 5BN4A 3S2DB 4FO2A 3J7YW 1TWCB 1KNAA 3K59A 2C5CA 1A2UA 1CQVA 2B63B 4OO1I 4FF1A 5EPJA 1RTNA 3DEPA 3OWFA 1MSGA 3FPPA 1HA5A 2HDMA 5ELDA 5C5LA 4G7ZC 1EIHA 2F0TA 1IKLA 3GP7A 4EVOA 5C3XA 2FMMA 2KUMA 2F3VA 2WAQB 4KN4C 1AZQA 4TQUS 1UNSA 2F0MA 1U9RA 1EEFD 1VMPA 3VA7A 4K5WA 1CA6A 2L11A 1SYDA 2F0LA 5CV8A 2VXWA 1SNQA 2JA6B 3R3OA 1O7YA 5IT9L 1K8MA 2E2IB 3FEWX 2ZT9C 4S3SA 3GTGB 3C3LA 3EVQA 1IYVA 1WVLA 4NP5A 4ZKBB 3DWQA 1PRTF 4XDXA 1TWHB 1GHKA 3PIO3 4A3DB 5I2XA 1PMRA 1DM0B 3DMUA 1IHZA 2K32A 3QWNA 4RHRA 2WV6D 5BN5A 2NN6G 2MJ8A 2ZXPA 2B2YA 2SNSA 2XN9C 5M5XB 3I3CA 2Q8RE 2Z1CA 4KI0A 4DAPA 5IODA 5CMDA 1STAA 1BBXC 2I07B 3P1HA 1AZPA 1O78A 3NTHA 5C4HA 3GTMB 4FNFA 3WDNA 1NR4A 4X3UA 1TWFB 2K5DA 5JOBA 3TP6A 2F4IA 5A35A 1ONLA 1CTMA 3KF8A 3GTKB 5DAUA 3PUZA 4ZRZA 1EWCA 2L4NA 5IGCA 3RZDB 2PQEA 5KYLA 4L6TB 4V190 1FNVA 3RMHA 1SYEA 4KHVA 5JVG3 3KLSX 5DEHA 2F0NA 3NK9A 2LY7A 1LT6D 5JAVA 3ONAB 1DD2A 3PIP3 1Y8PB 3FVQA 1WCMB 1STNA 1LT4D 3D4RA 1GUSA 4ZUJA 1SNDA 2E2HB 5IIFA 2BCOA 3BDOA 3A56A 1SNCA 3K5LA 2PW7A 1I3QB 5C44B 5E4WC 2RSOA 3R8BA 2BA1A 4Q0FA 4ZAIA 1WTXA 5JVH3 4FP5D 3HOZB 1BQQT 2F0DA 1PTOC 5JEAJ 1U4PA 1C8CA 1A3TA 4ODGA 1CFMA 4XYOA 3W2DA 3OMCA 3DXJC 1Y1WB 1YNND 2BA0A 3I90A 1VF7A 1JOKA 1S5DD 2M00A 2HCCA 2KCNA 2V4DA 1NAPA 4DU9A 2A68D 3MFGA 4GZYC 2M2LA 1F2ZA 1JORA 2D62A 3L9AX 1CT1D 1LACA 5FO8B 4QB4A 2VB3X 2EY6A 1EOTA 2NBFA 5IGFA 4OIKA 2IL8A 3EROA 4C3HB 3C1EA 3QB3A 1U4LA 4NMZA 1O80A 5FO9B 3MWYW 4K6LA 1WTOA 1V8QA 2F0WA 3VR3A 4OL7A 1F9RA 2IT1A 1Y8NB 3P75A 1Q1EA 4CJ1B 1S5CD 1CQFA 1B3AA 2JSOA 2EJGC 1PYWD 3SEBA 1X3QA 4BBSB 2EY5A 3GTLB 4IURA 3MA2B 1JICA 3TBIB 1EZ8A 2CVRA 4IQZA 3D4WA 3O13A 1SYCA 5FLXL 4BY1B 4PNYA 2R7ZB 3IAYA 1MD2D 1B53A 5FO7B 4ME5A 1HQMC 2ZXRA 1B9NA 1BUVT 1CHPD 1A15A 1SYBA 2HCIA 1LTTD 1LT5D 1QILA 4KJNA 4Q5VA 1BDOA 2F0HA 3Q0AA 1D2BA 1WD0A 1YNJD 1HA6A 4M1UB 2O5JC 5M5YB 1O7LA 3P20A 1G2TA 2LMCB 1V1PB 3W3AA 3NBIA 4R8IA 3MTSA 3C2PA 1UUPA 2H4OA 4KKUA 1OXSC 2E75C 3H94A 4DK0A 5AFWA 4DF7A 1BR9A 4IFDI 2A6HC 2SOBA 3BYYB 1KDCA 4OGQC 4TRDA 2KEEA 3SXHA 2EPBA 4K6DA 3GV3A 3OIPA 3J80E 2D5DA 4ULLA 5FKAC 3ZYYX 1TWGB 2BDOA 3OW7A 2F0JA 2Y0SB 4XT1B 3IFDA 3I72A 3M4OB 5J1ZA 4IUVA 1I6VC 1T5EA 1EY7A 1A3VA 3K58A 1CA5A 2EDGA 5CV6A 5CBEE 3HS0C 5EGTA 3MC0B 1SJED 5KRUA 2AQ3B 2F0VA 4ZLTF 4XT3B 2E2DC 1JOQA 1LABA 1SMYC 5EKLA 2EJMA 4TSSA 4K5VA 5I9PA 1BCPD 4A93B 5HGTA 4DA2A 4K8JA 5CV4A 3AB9A 1GUOA 1OO9B 5I6WA 2JE6I 3A7LA 3H3VC 4IUQA 2L55A 3SK8A 3T4AC 3S14B 5COYA 3G6JB 3T16A 5ELCA 5C6AA 2A68C 4MHEA 3FKIB 2E2JB 5C0XI 1IL8A 3FPUB 4DGZA 2HUGA 2MUYA 2H1EA 1EIGA 4NKLA 1JOOA 3SE0A 1IW7D 2JP1A 4KD4A 4IFDJ 1TS2A 1SXTA 1JCKB 1JC7A 5CC4A 3L3OC 1Z7TA 1E2VA 2G9DA 3H91A 4DFAA 4DAVA 2OT2A 4HEDA 5C0XJ 3JAML 3N6RA 2B2UC 4HTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0D A;  2LKV A;  2QDB A;  2EYL A;  5CV6 A;  4KY5 A;  5NUC A;  5K5P A;  2EYM A;  1EZ8 A;  4ID6 A;  4YIJ A;  1EYC A;  4G57 A;  5EKK A;  5IGE A;  5KYI A;  5J22 A;  5EGT A;  2F0G A;  2KHS A;  3NXW A;  3D4W A;  2OXP A;  4KTA A;  5KRU A;  2EXZ A;  2EYJ A;  3PMF A;  4KV6 A;  5KIX A;  1SYC A;  1SNM A;  1AEX A;  4LAA A;  5IOD A;  3SR1 A;  2F0P A;  1A3T A;  1F2Y A;  1KDB A;  2F0V A;  4IUN A;  4ODG A;  4PNY A;  3TP8 A;  1STA A;  5I6Y A;  2F0K A;  1EY5 A;  1JOQ A;  3P1H A;  5IOC A;  3OMC A;  2OEO A;  1EY4 A;  1A2U A;  3BDL A;  5C4H A;  4ME5 A;  4H7B A;  4WRD A;  5E3F A;  3U9O A;  3ITP A;  4ZQ3 A;  5EKL A;  1NUC A;  3D8G A;  5C4Z A;  1A2T A;  3OWF A;  2EYF A;  4K2L A;  2WAC A;  4PMB A;  5JOB A;  4K5V A;  3TP6 A;  4K5X A;  4KY7 A;  1TT2 A;  5C5L A;  2F0E A;  3T13 A;  5I9P A;  1JOK A;  2F0T A;  4EVO A;  5C3X A;  3OSO A;  1KAA A;  2M00 A;  4MIU A;  3V2T A;  5DAU A;  1SYB A;  5HGT A;  4ZUI A;  2EY2 A;  3MHB A;  3TP7 A;  4K8J A;  3HEJ A;  4DU9 A;  2F3V A;  3BDC A;  3E5S A;  4KJN A;  5CV4 A;  4IAL A;  2F0H A;  5KGU A;  3SK6 A;  2O4X A;  2F0M A;  5I6W A;  4J1M A;  4F8M A;  3SK4 A;  1U9R A;  5IGC A;  1SYG A;  1F2Z A;  1JOR A;  1ENA A;  2KQ3 A;  4HMJ A;  1SNO A;  1STY A;  3EJI A;  4K5W A;  2PQE A;  5KYL A;  1EY9 A;  3VA5 A;  1TQO A;  4RKL A;  4NDX A;  3SK8 A;  4QB4 A;  1SYD A;  2PW5 A;  4E6I A;  1EQV A;  2F0L A;  5C5M A;  5CV8 A;  4EQP A;  5C3W A;  2EY6 A;  2F0I A;  2PZW A;  4HMI A;  1EYD A;  3T16 A;  2NUC A;  4K2K A;  5IGB A;  1SNQ A;  5ISR A;  3R3O A;  5IGF A;  5C6A A;  1SYE A;  3NP8 A;  4RKB A;  4EQN A;  1EY0 A;  5J39 A;  2PZU A;  2RBM A;  3NHH A;  3NUC A;  4KHV A;  4S3S A;  1STB A;  4DF7 A;  5IGD A;  4K14 A;  1EY6 A;  2RKS A;  2F0U A;  3EVQ A;  5DEH A;  2SOB A;  3TME A;  2PYK A;  4B9W A;  3LX0 A;  3ERO A;  2F0N A;  4DGZ A;  4EQO A;  4QF4 A;  1KDC A;  3C1E A;  2EYP A;  4NP5 A;  3NK9 A;  1STH A;  3QB3 A;  3D6C A;  3DHQ A;  4KD3 A;  4NMZ A;  4TRD A;  5CV7 A;  5IGG A;  4I65 A;  4J6H A;  4KJO A;  5JAV A;  4QMG A;  5CV9 A;  1F2M A;  3H6M A;  2EY1 A;  3QOJ A;  3SXH A;  4KY6 A;  4N9P A;  3D4D A;  1ENC A;  3MEH A;  4K6D A;  4NKL A;  1JOO A;  1TR5 A;  1EY8 A;  2F0W A;  2F0Q A;  3MZ5 A;  2OF1 A;  3NQT A;  5E1F A;  1SYF A;  2RDF A;  1STG A;  1STN A;  1SNP A;  1EZ6 A;  1RKN A;  4OL7 A;  4KD4 A;  2F3W A;  3SHL A;  3P75 A;  3DMU A;  1A3U A;  2F0J A;  4R8N A;  4ZUJ A;  5CC4 A;  1SND A;  3TP5 A;  1IHZ A;  2PZT A;  5F2D A;  3SK5 A;  2SNM A;  5IIF A;  3ERQ A;  5KEE A;  3OMG A;  5HUR A;  3MXP A;  4DFA A;  5CGK A;  1SNC A;  4WOR A;  3HZX A;  1II3 A;  4IZ8 A;  1NSN S;  5CR3 A;  4N9T A;  2PW7 A;  3QOL A;  5J1Z A;  4B9X A;  5I9O A;  4PMC A;  5CV5 A;  2F0F A;  2F0S A;  2F0O A;  3C1F A;  5M9O A;  3MVV A;  3S9W A;  2SNS A;  2EY5 A;  3RUZ A;  1EYA A;  1KDA A;  2EYO A;  1KAB A;  4K8I A;  2HQE A;  2EYH A;  4F7X A;  1EY7 A;  1A3V A;  4HTH A;  2ENB A; 
#chains in the Genus database with same CATH topology
 5NUC A;  2L15 A;  4A93 H;  5K5P A;  3VYS A;  3CRL C;  4ID6 A;  3R93 A;  2ZJR A;  5KYI A;  3ERS X;  2J0T D;  2OXP A;  1N32 Q;  2OTJ A;  4KV6 A;  4C2M B;  1SNM A;  3S1R B;  1KDB A;  4P2C B;  1XPR A;  4IPC A;  3CPW A;  3UI2 A;  2DUD A;  3K5N A;  5E7N A;  1RD9 D;  3HOX G;  1V1O A;  5M3F B;  4PZ6 A;  3RD4 A;  2R7Z G;  4OIJ A;  1G29 1;  3PV0 A;  4PMB A;  4WJ4 A;  1SFO B;  4X65 L;  2HQL A;  1XNR L;  2A74 C;  4A3I B;  2L0C A;  1CZW A;  3QO2 A;  4JVZ A;  4U68 A;  2R93 H;  1FGU A;  2JEA I;  1ESF A;  3F2C A;  5M5X H;  2LFN A;  4HJA A;  1G8Z D;  2AMC B;  2O4X A;  1S4Z A;  4RMF A;  1WI5 A;  3WWV A;  2A8V A;  1STY A;  4JYA L;  4DR6 Q;  4P72 A;  2BE5 C;  4YCV A;  2PZW A;  3OTO L;  3WOF A;  1HNZ L;  5IGB A;  1FVI A;  1K8A C;  4HJ8 A;  1PH9 A;  1LTI D;  1DYQ A;  1PXU A;  2PMZ E;  4K14 A;  1CKN B;  1U5K A;  1EOV A;  2R7Z H;  3M85 A;  3D6C A;  2UXD Q;  1FR3 A;  3X3M A;  4KKT A;  4I65 A;  3S1M B;  2ATW A;  2YTY A;  2B2U A;  1R9T B;  4G7O C;  4LF7 Q;  1HRJ A;  1UWV A;  4DR2 Q;  3U4Z A;  2QW7 A;  3MEH A;  2ES2 A;  1KXL A;  2VUM B;  4XXE A;  1BO0 A;  3Q6S A;  4LF4 Q;  4CKB A;  1C7Y A;  3PQI A;  3TP5 A;  3H09 A;  2KED A;  2C35 B;  4A76 A;  5A2Q L;  3FRP B;  1DXM A;  1PRT C;  3NEN A;  4DK1 A;  1II3 A;  3CRK C;  1LUZ A;  4Y7N B;  2ZJP A;  1HUN A;  2F0F A;  1LTB D;  2F0S A;  1OTC A;  2M9V A;  4LMQ D;  2F52 A;  1EYA A;  2EYO A;  4MTN A;  4K8I A;  4NDX A;  2DJG C;  5FJ8 G;  3GTJ B;  3LGJ A;  2PPB C;  2Z4I A;  3I91 A;  4G57 A;  2RQX A;  2MP1 A;  2IX1 A;  1XNQ Q;  1LTA D;  2MO1 A;  1JT8 A;  4X66 L;  2EYJ A;  3MXN A;  1D5M C;  1I6H B;  1Q46 A;  1AEX A;  3F2U A;  5I6Y A;  1IBM L;  2JN4 A;  1EY4 A;  4XQN A;  2NN6 H;  5C4J B;  5C4Z A;  5ELE A;  2WB1 B;  2EYF A;  3NSW A;  4K5X A;  4C3I H;  2B3G A;  2PNR C;  1CSP A;  2MHV A;  1XMO Q;  1G91 A;  1VQC A;  4IOC A;  3HGB A;  3VYT A;  1J5E L;  2Q8I B;  3HEJ A;  4M8A A;  4JI8 L;  3BDC A;  3G4S A;  3TS0 A;  1BBU A;  1IW7 C;  2LXK A;  4A93 G;  2I46 A;  1M8A A;  4HMJ A;  3GV6 A;  1SNO A;  2RSN A;  3Q24 A;  4LF9 L;  2R93 B;  3I4M H;  1DOM A;  2RDG A;  1X56 A;  2K7V A;  4WFN 3;  4CJ0 B;  4JI2 Q;  3CF5 A;  1HZA A;  4LF6 Q;  4RH6 A;  1PFB A;  1VQF A;  4EQN A;  5KNC A;  4OX9 L;  1SRU A;  4GN5 A;  3VR5 A;  1K0R A;  3L2P A;  4GOP C;  1Y1V B;  2MNA A;  3I4M G;  4KN7 C;  1CKN A;  4C3H H;  4XIG S;  2SEB D;  1E1O A;  1AP0 A;  3VR4 A;  1TS5 A;  1EWH A;  1OXX K;  4B3R L;  5C3E B;  2QKI C;  3T56 B;  1OXV A;  1MSH A;  2F3W A;  3PCO B;  2GVB A;  4TVA B;  1D6E C;  1QNU A;  5GQO A;  4IFD H;  4GN3 B;  5G3L D;  5C44 H;  3BZD B;  3OMG A;  5LL6 X;  2R3Z A;  3QR8 A;  4O2D A;  5C0X H;  3KDF B;  1ICF B;  4HJ7 A;  1X9N A;  2A69 C;  3I4N H;  1TY0 A;  2YTV A;  1STE A;  2X69 A;  1WTR A;  2E5L Q;  5M5W B;  4YWL A;  3G48 A;  3GO5 A;  3MFY A;  2EYM A;  1K8O A;  2NVY B;  3LNN A;  4IFD G;  3CKI B;  2ZTC A;  1HQR D;  3GTO B;  5L37 A;  1U4M A;  1HXY D;  1HH2 P;  1RTO A;  4PG3 A;  3STB C;  4H13 C;  2E2J H;  3JAM i;  4O42 A;  1A2T A;  2WIN B;  2AQ2 B;  3GD7 A;  2DNC A;  1B9M A;  3S1N B;  4IOA A;  1JR0 D;  3URY A;  1TS4 A;  3VR2 A;  2NVQ H;  3HOX B;  1IBM Q;  3DEO A;  4BY7 B;  1KAA A;  3OHX C;  3RN2 A;  4LF4 L;  1PFN A;  1PZJ D;  2KHI A;  3SK4 A;  3W5O A;  4BWG B;  4C3J G;  3F1Z A;  2ID0 A;  4V0B A;  4AQY Q;  4DR5 Q;  1YIJ A;  4YWK A;  4HCS A;  1TS3 A;  2UXD L;  2WII B;  3A8J E;  1CSQ A;  3TN2 A;  5DM6 3;  3PUV A;  3M3Y H;  3U9S A;  2J7Z A;  2IPK D;  4HID A;  3PIP A;  3Q23 A;  2KJX A;  1TU2 B;  4GNX A;  5DM7 3;  3TME A;  4B9W A;  1U4R A;  2CW0 C;  4QF4 A;  4A3K B;  4J8Q A;  2HHH Q;  3R2I A;  5DNF A;  1EL0 A;  1B50 A;  3U50 C;  3DUZ A;  1GJX A;  1PTO H;  4L8J A;  2RDF A;  1L0X B;  1D1I A;  1JE4 A;  1EZ6 A;  5CBA E;  4X3S A;  5KNB A;  1ILP A;  1LTL A;  1A3U A;  1VQ5 A;  3BVG A;  2UUC Q;  5F2D A;  3KUP A;  3PUW A;  4LFB L;  3AFP A;  4POG A;  2O5I C;  3S1M H;  1YHQ A;  5CR3 A;  4LNQ A;  1IXR A;  1FNW A;  4PMC A;  4A3M G;  3PO2 B;  1B4O A;  1Z9F A;  3M4Y A;  4B3R Q;  1B7Y B;  3CXC A;  1JWM D;  1BBW A;  1N9W A;  2EYH A;  4ZK9 B;  1QB5 D;  2ENB A;  2RBM A;  2QDB A;  1QE6 A;  3NEL A;  1K83 B;  5I2Y A;  2NZO A;  3OPO A;  5J22 A;  5LHY 1;  4HCE A;  3MXG A;  4DNT B;  2WKC A;  3A7A B;  1H9R A;  1NR2 A;  4LFA L;  2BDN A;  3LWU A;  3TP8 A;  1TKW B;  2F0K A;  3PO3 B;  1CKO A;  3M7N A;  3FMC A;  1YNX A;  1XPO A;  3AU7 A;  4IUP A;  2OEO A;  4DV0 Q;  5EPL A;  1Q1B A;  1OXT A;  1HNZ Q;  1D8L A;  2F1M A;  3GTG H;  1C0A A;  5EJW A;  2JEB I;  1NUC A;  3QG1 A;  3D8G A;  1JQY D;  1VQJ A;  5IP7 G;  5ELB A;  2BOS A;  1PTO B;  1SE3 A;  4PMW A;  4RGM A;  3J80 c;  1WTV A;  1LTG D;  4JK1 C;  5JEA H;  1EWI A;  3J81 i;  3V2T A;  5M5Y H;  2NYZ D;  4ZUI A;  3Q22 A;  1RDP D;  1HNW Q;  1WTQ A;  2K03 A;  4AYB G;  1KTK A;  3T53 B;  3PF5 A;  1PFM A;  4DK3 C;  4FXK C;  1XTD A;  1XMO L;  4F8M A;  4RCN A;  1AH9 A;  3KYH C;  5D3D A;  4FVM A;  3M3Y B;  2NZ1 D;  4JI6 L;  4A3J B;  4NXN Q;  4DR7 L;  1HFN A;  4JI5 Q;  3TDQ A;  4C2M H;  1C4Q A;  3S1R H;  4F88 A;  3CC4 A;  4A3F B;  4OON A;  2ICE C;  4QL5 A;  5ISR A;  3HKZ B;  3NP8 A;  5J39 A;  1SJH D;  1B2T A;  1TWH H;  2PCF B;  2PYK A;  1I4Q A;  2CKZ B;  4PZ7 A;  1ASZ A;  1PH3 A;  3HOV G;  4BS9 A;  3E0J A;  2BE5 D;  2L12 A;  1O7Z A;  1F2M A;  4JG2 A;  1TWA H;  3T1H L;  4WJW A;  5GAD C;  5ELN A;  2Z9H A;  2NVQ B;  2A69 D;  2E2I H;  2F0Q A;  2ZTE A;  1QG7 A;  2JA6 H;  1MJC A;  1SNP A;  2F3I A;  3HOW H;  1V43 A;  1PYS B;  1A62 A;  1MKH A;  3J7A 5;  3KJO A;  4BBS G;  3MXU A;  2YV5 A;  3SK5 A;  5G3L F;  5GAH C;  1LV9 A;  4LF5 L;  1KL9 A;  3KBG A;  1PDQ A;  1KAB A;  1VQL A;  3M4P A;  3D3R A;  1VQ6 A;  1ILQ A;  4KHP L;  2AWO A;  2G9H D;  4BY1 G;  2L1B A;  1EQQ A;  4X62 L;  1ZYR C;  5M3F G;  1F2Y A;  4IUN A;  1D5Z C;  4OXP A;  3X3N A;  3S16 B;  4X64 Q;  4JPB W;  1X55 A;  1XX8 A;  3W1G A;  3BJU A;  1XPU A;  3U4V A;  3U9O A;  2MQH A;  3J81 E;  3FP9 A;  3K5M A;  1EIY B;  2VB2 X;  4K2L A;  2R92 B;  4B3T L;  3BVM A;  1TT2 A;  4MN3 A;  3S17 H;  1PVO A;  1J9O A;  2A6E C;  1UE1 A;  3S1N H;  1Q12 A;  1PRT B;  2NVX B;  4JI6 Q;  4DR7 Q;  4IAL A;  2X6L A;  2GVA A;  2UXB L;  2XNA C;  3GTP H;  1PZK D;  2IX0 A;  3KLS A;  3PUX A;  3ER0 A;  4IPH A;  4J1M A;  4DXG A;  2DN8 A;  3BZC A;  1VQK A;  1L1O C;  1KC8 C;  1EFW A;  1HUM A;  1G2S A;  1GXD C;  5FLX E;  4LF8 Q;  3I73 A;  3VA5 A;  2A73 B;  1F9Q A;  4DAY A;  1VQM A;  4EQP A;  1K0S A;  2NTT A;  3CAM A;  3ULP A;  1JE5 A;  1MGS A;  3E6Z X;  2K6A A;  3H3V H;  3NUC A;  2DNE A;  5M3M B;  4L63 B;  3G6E A;  4R4T A;  4FYD A;  2ALY B;  3K7U C;  1VQA A;  3I70 A;  4N8F A;  5CV5 A;  4BA1 I;  1F77 A;  5FOB B;  4KD3 A;  1N36 L;  1ML0 D;  3M4O H;  1R4Q B;  3VYU A;  2Y0S E;  5E1F A;  1QZG A;  3HOZ H;  4DK6 C;  1U0L A;  4K0K Q;  3GQB A;  4X6A H;  1V1Q A;  4JI7 L;  1Q81 C;  2VQF Q;  2OTL A;  1RCV D;  2A6E D;  4RHS A;  1CZG A;  1P16 A;  3BYT B;  4L5R C;  4I7A A;  4XYQ A;  4I7Z C;  2PO4 A;  3HZX A;  3DLL A;  5LL6 S;  4CBV A;  3C1F A;  2E2H H;  4HIO A;  1XTC D;  2K5W A;  1N33 L;  3AEV A;  1HNX L;  2EYL A;  4DN4 M;  3PO2 G;  4AYB E;  1CI3 M;  3GTJ H;  4DV3 L;  1I4P A;  1EQT A;  1N8R C;  2B2V A;  2KHS A;  4CHT B;  4R9W A;  3HOY G;  1GUW A;  2CH4 W;  2HDL A;  3RLF A;  4P75 A;  4Y7N H;  1EUJ A;  1E2Z A;  1I4X A;  2PMZ B;  3I7F A;  1EY5 A;  4DV1 L;  1BOS A;  4WRD A;  2FIN B;  4H7B A;  3VDY A;  1Y14 B;  2VY3 A;  3NWS A;  3AMU A;  3HOW B;  2UXB Q;  3RR5 A;  1J5E Q;  3KLR A;  4A3E H;  3E9I A;  5EBC A;  2VUM H;  1YZ6 A;  1E3P A;  5JJK A;  1AN8 A;  1LYL A;  1VF5 C;  5CYU A;  5J3B A;  5IY0 A;  1S5E D;  3TQY A;  1FJG Q;  1XXG A;  3TP7 A;  2FJ2 A;  4DAY B;  2ASB A;  3GTQ B;  2R93 G;  2Z4H A;  2AUK A;  2QA4 A;  4A3L G;  2L5T A;  4XQJ A;  4HSP A;  4HN7 A;  5FJ8 H;  1ZKO A;  2KQ3 A;  5EQ0 A;  3ULJ A;  1EY9 A;  1TQO A;  4ZYS A;  4A3L H;  1I6H H;  2FXQ A;  4E6I A;  2B2W C;  2L9H A;  1QNK A;  4LFA Q;  3I55 A;  1TWF H;  1DCZ A;  1D5X C;  4A3J G;  1L0W A;  2CH4 A;  2ZJQ A;  4RA8 A;  1EY6 A;  1H9K A;  2RVL A;  4LK1 C;  2XWB B;  2PI2 A;  5EPK A;  1LO5 D;  1I50 H;  3VR6 A;  2KA7 A;  5COR A;  1STH A;  2B8F A;  4KLK A;  4RFB A;  2WP8 J;  1Q8K A;  4KJO A;  1IBL L;  3H3V I;  3A54 A;  1VS0 A;  1B8A A;  3EIV A;  1WTP A;  2MGS A;  3HOV B;  1EY8 A;  3NQT A;  4EX5 A;  4EQ5 A;  2QEJ C;  3SHL A;  1GHJ A;  1PFS A;  3ND8 A;  4B3M L;  2NVT H;  2A5H A;  2KCM A;  3OIQ A;  4JI3 Q;  3MEF A;  5HUR A;  3MXP A;  2CCZ A;  2JA5 B;  3KF6 A;  4DUY Q;  5I9O A;  1WTH A;  2DY8 A;  2WKD A;  4DXF A;  3EA6 A;  3DM1 A;  1I4H A;  4A3E G;  1MIU A;  2RF4 A;  3EQL C;  4R4I A;  2JA8 H;  4DNR B;  2FHT A;  2Z0S A;  1PRT D;  2N55 A;  3NXW A;  2F4V L;  2YYZ A;  3RN5 A;  4FDB A;  2OWO A;  2XWJ B;  3PO2 H;  2KOL A;  4JYA Q;  3M7G A;  2IX3 A;  5HGQ A;  3T1H Q;  4U67 3;  1I4G A;  2XTI A;  2DJF C;  3NPP A;  2VZA A;  3T1Y Q;  4ZQ3 A;  4LJZ C;  4A3I G;  1SE2 A;  5E4X A;  1IBK L;  4HIM A;  3S1Q B;  2K5V A;  1NNX A;  4CKE A;  1TII D;  3N52 A;  4RGT A;  4JBM A;  1ICW A;  3OWE B;  4A3B B;  4MIU A;  3NBH B;  3PSI A;  4L5T A;  2KEC A;  1F9P A;  1SDF A;  3TRZ A;  2B2T C;  1WJJ A;  5C4X H;  3J7A F;  3DWA A;  2NTS A;  3KDF A;  3W1B A;  1Y1W H;  1MI2 A;  1PLF A;  4OEM B;  4APV A;  1K3R A;  1TVX A;  4O1N A;  2NWG A;  2K28 A;  2SDF A;  3AYH B;  2K04 A;  3FKI H;  4PV1 C;  5T1I A;  4LFB Q;  4BA2 I;  3CU7 A;  2I5M X;  2B2T A;  5C5M A;  3A0J A;  4BXX G;  1OXU A;  4DUY L;  2DGY A;  2NUC A;  4C3J B;  1G6Z A;  1EY0 A;  4ZCK A;  3HOV H;  3L7Z C;  5D14 A;  1UE7 A;  1B70 B;  1QCB D;  5IGD A;  4LF9 Q;  3SDZ A;  3TZD A;  1HHV A;  2RA4 A;  1JJC B;  5JPN C;  3OYY A;  4A4I A;  3CCQ A;  4AH6 A;  5LMN W;  2JA8 G;  4BY7 H;  2O2L D;  1GUT A;  1QZH A;  1ENC A;  3UDF A;  4OX9 Q;  2QEX A;  4JI8 Q;  1TR5 A;  1AW7 A;  1CK1 A;  4BBR H;  3MAQ A;  4RWS C;  3T1Y L;  2UUA Q;  1ET6 A;  3KJP A;  2SNM A;  5BR8 L;  2XRQ D;  5KND A;  2MPM A;  3V05 A;  5CGK A;  1M90 C;  1PH2 A;  3MVV A;  3RUZ A;  1SEB D;  1KDA A;  4C3I G;  3K6O A;  3GTQ H;  3BU2 A;  4EQO A;  1JB3 A;  5IT9 E;  2X6G A;  2C9O A;  1E0B A;  3J80 L;  1EEI D;  2VL6 A;  2AHO B;  4DV6 Q;  4GOP B;  3PO3 G;  3NTI A;  3A8K E;  3D31 A;  3I4N B;  2LS0 1;  5KIX A;  1VCI A;  1RF2 D;  4UY8 C;  3G7L A;  3RZD H;  3PUY A;  4FXG C;  3A8I E;  3H15 A;  3KF6 B;  4R4O A;  5IOC A;  4UDU C;  3CCJ A;  4QJF A;  3HOY B;  3S15 B;  2EQS A;  2EOT A;  4HR7 B;  1M1K C;  1DZ1 A;  1SMX A;  2CQA A;  1C48 A;  2G5D A;  2CW0 D;  4KY7 A;  3T13 A;  4UP7 A;  1YJW A;  5IP9 G;  3RZO B;  4IUT A;  1BCP F;  3K8A A;  3HOW G;  3MHB A;  3SVM A;  1K73 C;  4CKC A;  4YHH Q;  1RL2 A;  4JC0 A;  1KAW A;  5KGU A;  5JJI A;  1IZ6 A;  5JJL A;  1RJT A;  1YIT A;  3PF4 A;  2XIW A;  3P7J A;  1SYG A;  1L0Y B;  4JBJ A;  4L5Q A;  1HZB A;  2UUB L;  4IPD A;  1Z47 A;  4AYB B;  5GAE C;  2N3S A;  4JOI A;  3F8T A;  4QIW E;  4B08 A;  5D3I B;  3HRZ C;  1NCV A;  3I4M B;  2NB0 A;  3J81 L;  5C0X G;  1VQ4 A;  1BCP C;  2F0U A;  4LF7 L;  5K36 G;  1LLR D;  3CCS A;  2QGQ A;  3LX0 A;  5HY6 A;  4GKJ L;  4LUO A;  5CV7 A;  4JBW A;  1FD7 D;  4IUU A;  5CV9 A;  4DV6 L;  3QOJ A;  3BVZ A;  2B39 A;  1YNN C;  4C3H G;  4JI4 Q;  2B2W A;  2QF7 A;  4OHJ A;  1GUG A;  2Z8L A;  1RKN A;  1Y8O B;  2R61 A;  1V1P A;  2D0O A;  1DJR D;  4FF3 A;  4R8N A;  2DY7 A;  1IBL Q;  4CGY B;  1K3B C;  3QIA A;  5GAG C;  1ET9 A;  4QQB X;  2Q2T A;  2JA9 A;  1VQE A;  4JBK A;  5M9O A;  1NY4 A;  4KMU C;  3CPF A;  4BBR B;  3L0O A;  4DV5 L;  1N32 L;  2EVB A;  2HQE A;  3A55 A;  5IYC H;  1E2W A;  2H5X A;  1VQI A;  4KY5 A;  5T1G A;  1HTP A;  4P74 A;  4YIJ A;  5K36 H;  5IGE A;  4RAU C;  4JV5 L;  4HJ5 A;  4KTA A;  3K7A H;  3I2Z A;  3PMF A;  1XMQ L;  4QIW B;  3TEH B;  3SR1 A;  4JI2 L;  1KHI A;  2CHB D;  3CCE A;  1TXY A;  2JA7 B;  1KLG D;  2K01 A;  2R92 G;  4JI7 Q;  3K57 A;  1HPC A;  1NMF A;  1DOL A;  3V96 A;  1Q7Y C;  3BS1 A;  1X3P A;  3K0Y A;  4X64 L;  1R9T H;  4NW2 A;  3OSO A;  4MTK A;  1N33 Q;  1N36 Q;  2EY2 A;  1VQ8 A;  3E5S A;  1DGS A;  2PQA A;  3TSS A;  2K5Q A;  4HSV A;  5IP9 H;  3VYR A;  4GLX A;  1DON A;  1I5F A;  1ASY A;  1SE4 A;  4ILW A;  2K33 A;  3HP3 A;  1WYD A;  4BY1 H;  4K0K L;  3EJI A;  3CCM A;  1SMY D;  3CQZ H;  4RKL A;  4FF4 A;  2PW5 A;  1EQV A;  2B8G A;  2P5Z X;  3FDT A;  4LF5 Q;  2MFI A;  4K2K A;  1UAP A;  4UAI A;  1STB A;  1TWA B;  2RKS A;  4FXD A;  2KCT A;  5JEA G;  3HG9 A;  2ICI A;  4BBS H;  1B44 D;  2EYP A;  3WOE A;  1PTO D;  1S72 A;  5M3M G;  4RCO A;  1SBB B;  3EFX D;  4HAE A;  4EGV A;  2B2Y C;  1EU4 A;  4KY6 A;  4QUC A;  1Q86 C;  3J81 c;  4C1N I;  3CHB D;  2I0Q A;  2FFK B;  5FLM H;  1YNJ C;  3NTK A;  1SYF A;  3K5O A;  3J80 i;  2JA8 B;  1A6X A;  4A3F H;  1VQ9 A;  1KNE A;  2IW3 A;  5M3F H;  1PA6 A;  5C44 G;  4A3M B;  2I5H A;  1FYC A;  2PZT A;  3KLW A;  3JAM E;  1K9M C;  1WCM G;  3ERQ A;  3Q8D A;  2LSS A;  2K05 A;  1BF4 A;  4JI4 L;  4IZ8 A;  4DV2 L;  3KBX A;  5EKI A;  4X3T A;  3S9W A;  2XRS D;  1AFP A;  4JI3 L;  3S24 A;  3KK7 A;  5C4X B;  1PZI D;  1Q3L A;  2LKV A;  4JI0 L;  4Z9C B;  2ZXO A;  4MNO A;  1EYC A;  1HJP A;  2F0G A;  1JWS D;  1RHP A;  2EXZ A;  3IFT A;  1HFG A;  4RGO S;  2B63 G;  1I50 B;  3CCL A;  4DR2 L;  1QJO A;  2Q8T A;  5JPM C;  1MJE A;  4G7H C;  1H9M A;  1LT3 D;  2CQO A;  1EU3 A;  3S2H B;  3M9B A;  3NBH A;  1HZ9 A;  1NBW A;  2AQ1 B;  3BDL A;  3M4Q A;  1Q8I A;  3ITP A;  1SAP A;  3IKJ A;  4A3G H;  4ZKC B;  1JB7 A;  1X3E A;  4DV2 Q;  2EJF C;  1WCM H;  2J4X A;  4H0L C;  2TSS A;  1UE5 A;  1QOH A;  2CWP A;  2F0E A;  4XQQ A;  4C1N K;  1Y1W G;  1EFI D;  3CQZ B;  4IN3 A;  5LMU Q;  4DR1 L;  1QUQ B;  1IYU A;  2E76 C;  4F87 A;  4QUF A;  3AFQ A;  2YU9 B;  1GO3 E;  1ENA A;  1D1K A;  4QCL A;  2JA6 G;  1X32 A;  3QJY A;  5FLM G;  2NVT B;  1ESR A;  1CHQ D;  4IJH A;  1ENF A;  1EYD A;  1DOK A;  2A1A A;  1TY2 A;  1W6K A;  2AWN A;  4TKO B;  1J8I A;  4JI1 L;  4RKB A;  5EBD A;  1F9S A;  2XSC A;  2PZU A;  3RLO A;  1IBK Q;  4C56 C;  5IYB G;  4IO9 A;  5DLQ E;  3OTO Q;  2JXM B;  3I8Z A;  3UDG A;  1LTR D;  2HD3 A;  3FKI G;  4XTC S;  3DHQ A;  5JJZ A;  5IGG A;  4J6H A;  1S40 A;  3K7A B;  4QMG A;  3T51 B;  2EY1 A;  3K80 C;  4DV7 L;  3GTK H;  4N9P A;  1BVS A;  3D4D A;  2VQE Q;  1Y69 U;  3MZ5 A;  1N34 Q;  1UEA B;  1STG A;  2B2V C;  2QCP X;  3IL8 A;  1Q90 A;  3E0E A;  1P8L A;  2FMC A;  1SSO A;  3CC2 A;  3BG3 A;  2IWH A;  5IYD G;  5KEE A;  1FGB D;  2HT1 A;  2NN6 I;  3CCU A;  2RCN A;  1WTW A;  4WOR A;  1T5X D;  1NSN S;  3TZU A;  1I94 L;  3CMA A;  2K1B A;  1S5B D;  4B9X A;  2VNU D;  2F0O A;  4GS3 A;  1PH5 A;  1HTL D;  2N49 A;  1JMC A;  2D2C C;  4ABN A;  4H44 C;  2F03 A;  1MBY A;  4POF A;  1WD1 A;  1EYG A;  3HKZ E;  4QY7 A;  2D9U A;  4CJ2 C;  4KHZ A;  4IJL A;  5EKK A;  1PYB A;  4DUZ Q;  4A75 A;  3J7Z C;  4A3E B;  1QVC A;  2IJ0 A;  4LAA A;  1B1Z A;  4KKS A;  1M4V A;  2F0P A;  3BZK A;  4LFC Q;  2K5H A;  2Z6K C;  1X54 A;  4YCW A;  2EZV A;  2E74 C;  4NXM L;  3K81 C;  1O7I A;  1E22 A;  2WAQ E;  1KLU D;  2ZTD A;  5IWA L;  5E3F A;  1L1O B;  2Q2H A;  3HKS A;  3LWE A;  1H9J A;  4UP9 A;  1NMG A;  3I4L A;  1ROD A;  4OO1 G;  1TWG H;  2WAC A;  1JWU D;  1BNZ A;  1GOZ A;  1Z6H A;  1VMC A;  2GN5 A;  1KD1 C;  2NVY H;  1FNU A;  1F2L A;  4RGN A;  1A8V A;  1EQR A;  1HCZ A;  3H0G B;  1G6P A;  4A3G B;  2PI2 E;  3GTM H;  2OQK A;  2IHF A;  3EN2 A;  4JOI C;  3GTP B;  4A3B G;  3SK6 A;  3C46 A;  2JJQ A;  1SRO A;  2UUC L;  3HOU B;  1A63 A;  1XYI A;  4CDD C;  4KK7 A;  5IP7 H;  2NVX H;  4X62 Q;  4OO1 H;  4GOP A;  4G4K A;  5ELF A;  4ALP A;  1ZXT A;  2EE1 A;  3NWT A;  5FLX c;  3S17 B;  5I4D A;  2AUJ D;  1ZEQ X;  2JYO A;  5C3W A;  2F0I A;  4HMI A;  1H9S B;  1G51 A;  1W6J A;  2A6H D;  3DWP A;  2RCF A;  3NHH A;  1BXT A;  1FL0 A;  3S15 H;  2XGT A;  1GUN A;  3CW2 C;  1S5F D;  5AJ3 L;  2R6G A;  1XWE A;  2GA4 B;  1AE2 A;  2BH8 A;  4N8X 1;  3OOC A;  2Z6K A;  4WJ3 M;  3H6M A;  3CME A;  4NB3 A;  1FJG L;  2N8N A;  1PH8 A;  1I4R A;  1W2B A;  2RDH A;  2TMP A;  5TSS A;  4A3M H;  2KCC A;  4GKK Q;  1CM9 A;  2OF1 A;  1KIX A;  3NE5 B;  2QIL A;  2XVS A;  1I94 Q;  4Y52 H;  1ZYR D;  4A3D H;  1LTS D;  2RHQ B;  2N88 A;  3D6W A;  1PHJ A;  4LF6 L;  1AE3 A;  5BN3 A;  4DUZ L;  4N9T A;  3QOL A;  1PTO F;  2Y0S G;  1YI2 A;  2UU9 Q;  4BXX H;  1VQG A;  3NQI A;  3ULL A;  5A2Q E;  2KVM A;  1IKM A;  4FF2 A;  5FK9 C;  1IL2 A;  3TS2 A;  1H9S A;  1VDZ A;  4F7X A;  3I4N G;  4PQX A;  2QDL A;  1R4P B;  3R2T A;  5D65 A;  1QWY A;  4C3I B;  1BCP B;  3ND9 A;  3J7A V;  5C4X G;  3D0F A;  4NXM Q;  2R92 H;  2WB1 E;  3GTL H;  4X3K A;  4GLA C;  5BN4 A;  1HNX Q;  1W3S A;  3S2D B;  4FO2 A;  4X65 Q;  3AQQ A;  3J7Y W;  1TWC B;  4L5S A;  1KNA A;  3K59 A;  3CC7 A;  2C5C A;  2HIX A;  4IPG A;  1A2U A;  3A74 A;  1CQV A;  2B63 B;  1GM5 A;  4OO1 I;  4FF1 A;  5EPJ A;  1RTN A;  3DEP A;  4R4C A;  3OWF A;  1KRT A;  4C3J H;  1MSG A;  3FPP A;  1CKM A;  1HA5 A;  3CCR A;  2HDM A;  2LXJ A;  5ELD A;  5C5L A;  4GNX C;  4G7Z C;  4B3S Q;  2JQO A;  1CUK A;  1D7Q A;  1EIH A;  2F0T A;  1IKL A;  1WFQ A;  3GP7 A;  4EVO A;  5C3X A;  1NJI C;  4DR4 L;  2FMM A;  2KUM A;  2F3V A;  2WAQ B;  4KN4 C;  4NXN L;  4ME3 A;  1AZQ A;  4TQU S;  1UNS A;  2F0M A;  1U9R A;  2JA7 H;  1EEF D;  5ELO A;  1VMP A;  3VA7 A;  2PQA B;  4K5W A;  1CA6 A;  2L11 A;  4A3B H;  2AKW B;  3G71 A;  1SYD A;  2F0L A;  5CV8 A;  3STB D;  2VXW A;  3S1Q H;  1SNQ A;  3R3O A;  1O7Y A;  5IT9 L;  2JA6 B;  1K8M A;  3RLN A;  2E2I B;  3FEW X;  2ZT9 C;  1V9P A;  4S3S A;  4DV0 L;  3GTG B;  3C3L A;  2PNH A;  2IY5 B;  1PH7 A;  3HOU H;  3EVQ A;  1SLJ A;  1IYV A;  1WVL A;  1J6Q A;  4NP5 A;  4ZKB B;  4JV5 Q;  3DWQ A;  1PRT F;  1QVF A;  4XDX A;  1TWH B;  1X65 A;  1GHK A;  3PIO 3;  1Y1V G;  4A3D B;  5I2X A;  1PMR A;  1X6O A;  4GKJ Q;  2JA5 G;  1DM0 B;  4A3C H;  4O0A A;  2RHS B;  3DMU A;  2HHH L;  1IHZ A;  2K32 A;  3QWN A;  3TRE A;  4BBR G;  4RHR A;  4A3J H;  2WV6 D;  3I56 A;  2JA5 H;  4A3C G;  5BN5 A;  2NN6 G;  2MJ8 A;  3DM3 A;  2ZXP A;  4X66 Q;  2B2Y A;  2SNS A;  2XN9 C;  4RG1 A;  5M5X B;  3I3C A;  2Q8R E;  5H1S E;  3KF8 B;  2Z1C A;  4KI0 A;  3ZJY C;  4DAP A;  1UE6 A;  4A3K H;  2Q2U A;  1YBY A;  5IOD A;  1XJV A;  1I3Q H;  5CMD A;  5EAY A;  1STA A;  1BBX C;  1E7Z A;  2I07 B;  1QUQ A;  1RIP A;  3P1H A;  1AZP A;  1O78 A;  2OQ0 A;  3NTH A;  3PGZ A;  4UP8 A;  5C4H A;  1XNQ L;  3GTM B;  4FNF A;  3WDN A;  1NR4 A;  4X3U A;  2JA7 G;  3H0G H;  1TWF B;  2K5D A;  5JOB A;  3TP6 A;  2F4I A;  5A35 A;  1ONL A;  1CTM A;  3KF8 A;  5GRO A;  3GTK B;  3JAM c;  5DAU A;  4CDE C;  4GKK L;  3PIO A;  3PUZ A;  2R7F A;  4ZRZ A;  1EWC A;  4BY7 G;  2L4N A;  2K50 A;  5IGC A;  4DV4 Q;  3H0G G;  2K14 A;  3RZD B;  4A3G G;  5LMN Q;  2PQE A;  5KYL A;  4DR4 Q;  1VQ7 A;  2N78 A;  4L6T B;  4V19 0;  1FNV A;  3RMH A;  1SYE A;  4R4Q A;  4JI5 L;  4KHV A;  5JVG 3;  3IRB A;  3KLS X;  5DEH A;  4LUZ A;  1NTG A;  4OWX B;  2F0N A;  1XNR Q;  4DR3 L;  3NK9 A;  2LY7 A;  1HR0 W;  4CDF C;  4MZ9 A;  1LT6 D;  1X3F A;  5JAV A;  3ONA B;  4YCU A;  1DD2 A;  3PIP 3;  1Y8P B;  3FVQ A;  4LUV A;  1WCM B;  1STN A;  4A3K G;  1LT4 D;  3D4R A;  3KFU A;  1GUS A;  4DV7 Q;  4ZUJ A;  1SND A;  2E2H B;  3U58 A;  2VUM G;  5IIF A;  2D0P A;  1PH4 A;  2BCO A;  3BDO A;  4LF8 L;  2IHE A;  3A56 A;  1SNC A;  3K5L A;  2PW7 A;  1I3Q B;  5C44 B;  5E4W C;  1PH6 A;  1YVC A;  1XMQ Q;  2RSO A;  1NE3 A;  3R8B A;  2BA1 A;  4HIK A;  4Q0F A;  4ZAI A;  1WTX A;  5C3E H;  5JVH 3;  4FP5 D;  3HOZ B;  1BQQ T;  2F0D A;  1PTO C;  5JEA J;  1U4P A;  2HIV A;  1S3O A;  1C8C A;  4DV1 Q;  1EIF A;  4LW1 A;  1A3T A;  4ODG A;  1Y1V H;  1CFM A;  3EBE A;  4XYO A;  1SE8 A;  3W2D A;  3OMC A;  4DV3 Q;  3DXJ C;  3UDX A;  1Y1W B;  1B3Q A;  1YNN D;  4JI1 Q;  4PZ8 A;  2BA0 A;  3I90 A;  1VF7 A;  4OEL B;  1JOK A;  1S5D D;  5M5W H;  2M00 A;  2HCC A;  2WB1 G;  2KCN A;  2V4D A;  1NAP A;  4DU9 A;  1N34 L;  4B3T Q;  1QVG A;  2A68 D;  3MFG A;  4GZY C;  2M2L A;  1F2Z A;  1JOR A;  2D62 A;  3L9A X;  1A0I A;  2NZH A;  3E9H A;  1CT1 D;  1LAC A;  5FO8 B;  4QB4 A;  2VB3 X;  1BKB A;  2EY6 A;  1WOC A;  3UE0 A;  1HR0 Q;  1EOT A;  5C4J H;  2NBF A;  5IGF A;  4DR3 Q;  4H02 A;  2E8G A;  4AQY L;  3SGI A;  4A3F G;  2A19 A;  4OIK A;  2IL8 A;  3ERO A;  3KOJ A;  4C3H B;  3HKZ G;  3C1E A;  3QB3 A;  1YJ9 A;  1U4L A;  4NMZ A;  5IYC G;  5C3E G;  1O80 A;  1PH1 A;  2KEN A;  5FO9 B;  3MWY W;  4K6L A;  4UPA A;  1WTO A;  1V8Q A;  2F0W A;  3F2D A;  3VR3 A;  4OL7 A;  1F9R A;  2IT1 A;  1Y8N B;  2B29 A;  2KHJ A;  3P75 A;  4LWC A;  2B63 H;  1Q1E A;  4CJ1 B;  1S5C D;  3B6Y A;  1CQF A;  5IWA Q;  1B3A A;  4JCV E;  2JSO A;  2EJG C;  1TWC H;  1VQD A;  4KHP Q;  1PYW D;  3S2D H;  3SEB A;  1X3Q A;  4BBS B;  2UXC Q;  4DKA C;  2EY5 A;  3GTL B;  1HNW L;  1YHB A;  4IUR A;  3MA2 B;  2V1C C;  1MHW C;  1JIC A;  3TBI B;  2UU9 L;  1JJG A;  1EZ8 A;  2CVR A;  4YY3 L;  2KBN A;  4IQZ A;  3D4W A;  1L1O A;  2CWA A;  3E3X A;  3O13 A;  1SYC A;  5FLX L;  4JI0 Q;  4BY1 B;  3RNU A;  4PNY A;  2R7Z B;  1L2F A;  3IAY A;  1MD2 D;  1B53 A;  5FO7 B;  1HR0 L;  2Q2I A;  4ME5 A;  1E24 A;  1HQM C;  2ZXR A;  1B9N A;  2JK8 A;  3FHW A;  1BUV T;  1CHP D;  4J15 A;  1VQN A;  5IYD H;  3UE1 A;  2CFM A;  3I4O A;  1A15 A;  2K4K A;  1VQH A;  2ZM6 L;  3OW2 A;  1SYB A;  2HCI A;  1HZC A;  1LTT D;  1LT5 D;  1QIL A;  2K52 A;  2YTX A;  4KJN A;  4Q5V A;  1BDO A;  2F0H A;  4GN4 B;  3Q0A A;  4P71 A;  1D2B A;  1JJ2 A;  1WD0 A;  1YNJ D;  2I5L X;  2K75 A;  3MXN B;  1HA6 A;  1VQB A;  4M1U B;  2O5J C;  5M5Y B;  1O7L A;  3P20 A;  5BR8 Q;  1G2T A;  2LMC B;  1V1P B;  4P73 A;  1SFO H;  1GKH A;  3W3A A;  2EXD A;  3HOU G;  3ICE A;  3NBI A;  4R8I A;  3MTS A;  3C2P A;  4QGU A;  2VS1 A;  1UUP A;  2H4O A;  3UDI A;  2K5N A;  3A5U A;  4KKU A;  1OXS C;  2E75 C;  3H94 A;  4DK0 A;  5AFW A;  4DF7 A;  2VQE L;  1BR9 A;  4IFD I;  4GLV B;  2A6H C;  2Z6B A;  3PO3 H;  2SOB A;  4OWT B;  5IYB H;  3BYY B;  1KDC A;  4OGQ C;  4TRD A;  2MO0 A;  2KEE A;  4YY3 Q;  1YJN A;  3K0X A;  3CCV A;  3SXH A;  3RZO H;  5LMU L;  2EPB A;  4UHV A;  1X3G A;  4K6D A;  3GV3 A;  3OIP A;  1K83 H;  4NPS A;  3J80 E;  2OCE A;  4DR1 Q;  2D5D A;  4ULL A;  5FKA C;  3ZYY X;  1TWG B;  2UXC L;  2BDO A;  3OW7 A;  2F0J A;  2Y0S B;  4XT1 B;  3IFD A;  2VW9 A;  3I72 A;  1VQO A;  1K8G A;  1YHA A;  4DR5 L;  3M4O B;  1YEZ A;  5J1Z A;  4GNX B;  4IUV A;  4B3S L;  1SR3 A;  1I6V C;  3J81 j;  1T5E A;  2ZM6 Q;  1EY7 A;  5M3M H;  1A3V A;  3K58 A;  4JW0 A;  3HFZ B;  1CA5 A;  2EDG A;  5CV6 A;  5CBE E;  3HS0 C;  3F2B A;  4A3I H;  5EGT A;  3MC0 B;  2BH2 A;  1SJE D;  4DV4 L;  5KRU A;  4R1J A;  2AQ3 B;  3HOZ G;  2F0V A;  4ZLT F;  4XT3 B;  2E2D C;  1JOQ A;  5IT9 c;  4AIM A;  2VQF L;  1LAB A;  1SMY C;  5EKL A;  4LFC L;  2EJM A;  5AJ3 Q;  4TSS A;  1PV4 A;  4K5V A;  4OWW B;  5I9P A;  1BCP D;  4A93 B;  5HGT A;  1SN8 A;  2WFW A;  4DA2 A;  2E5L L;  4K8J A;  2EIF A;  1KRS A;  3GDE A;  5CV4 A;  3JC6 6;  3AB9 A;  2UUB Q;  1GUO A;  1LM0 A;  1OO9 B;  3CP0 A;  1K28 A;  3HOY H;  5I6W A;  2JE6 I;  3A7L A;  3H3V C;  2R7D A;  4IUQ A;  3S16 H;  2WAQ G;  4YHH L;  2F4V Q;  2L55 A;  3SK8 A;  3HOX H;  1T9H A;  1UEB A;  3T4A C;  3S14 B;  5COY A;  3G6J B;  3T16 A;  5ELC A;  3A5Z B;  4HJ9 A;  5C6A A;  1Q82 C;  2A68 C;  5LMN L;  4MHE A;  4CDC C;  3FKI B;  4DNI A;  2E2J B;  1KQS A;  2YU9 H;  1GD7 A;  5C0X I;  1IL8 A;  3FPU B;  4DGZ A;  4YWM A;  1VQP A;  4DPG A;  5IE8 A;  3GTO H;  2HUG A;  2MUY A;  2H1E A;  1EIG A;  4B3M Q;  4NKL A;  1JOO A;  3SE0 A;  1IW7 D;  2JP1 A;  1GVP A;  3CD6 A;  4KD4 A;  4IFD J;  1TS2 A;  1SXT A;  1JCK B;  1JC7 A;  5CC4 A;  3L3O C;  3S14 H;  1C9O A;  1Z7T A;  4A3D G;  4DV5 Q;  1E2V A;  3S2H H;  4DAM A;  1IYJ B;  2G9D A;  4DR6 L;  3H91 A;  1H95 A;  4DFA A;  4DAV A;  3NEM A;  2OT2 A;  4HED A;  5C0X J;  2UUA L;  3JAM L;  1E1T A;  3N6R A;  2B2U C;  4HTH A; 
#chains in the Genus database with same CATH homology
 5NUC A;  5K5P A;  3VYS A;  3CRL C;  4ID6 A;  3R93 A;  5KYI A;  2J0T D;  2OXP A;  4KV6 A;  4C2M B;  1SNM A;  3S1R B;  1KDB A;  4P2C B;  3UI2 A;  3K5N A;  1RD9 D;  1V1O A;  5M3F B;  3RD4 A;  4OIJ A;  1G29 1;  3PV0 A;  4PMB A;  1SFO B;  2A74 C;  4A3I B;  2L0C A;  1CZW A;  3QO2 A;  4U68 A;  2JEA I;  1ESF A;  2LFN A;  1G8Z D;  2O4X A;  1S4Z A;  1STY A;  2BE5 C;  2PZW A;  3WOF A;  5IGB A;  1LTI D;  1DYQ A;  1PXU A;  4K14 A;  3M85 A;  3D6C A;  1FR3 A;  3X3M A;  4KKT A;  4I65 A;  3S1M B;  2B2U A;  1R9T B;  4G7O C;  1HRJ A;  3MEH A;  2VUM B;  4XXE A;  1BO0 A;  3Q6S A;  4CKB A;  3TP5 A;  3H09 A;  2KED A;  5A2Q L;  3FRP B;  1DXM A;  1PRT C;  4DK1 A;  1II3 A;  3CRK C;  4Y7N B;  1HUN A;  2F0F A;  1LTB D;  2F0S A;  2M9V A;  4LMQ D;  1EYA A;  2EYO A;  4K8I A;  4NDX A;  3GTJ B;  2PPB C;  2Z4I A;  3I91 A;  4G57 A;  2RQX A;  2MP1 A;  2IX1 A;  1LTA D;  2EYJ A;  3MXN A;  1D5M C;  1I6H B;  1AEX A;  3F2U A;  5I6Y A;  1EY4 A;  4XQN A;  2NN6 H;  5C4J B;  5C4Z A;  5ELE A;  2WB1 B;  2EYF A;  3NSW A;  4K5X A;  2PNR C;  2MHV A;  1G91 A;  3HGB A;  3VYT A;  2Q8I B;  3HEJ A;  4M8A A;  3BDC A;  1IW7 C;  2I46 A;  1M8A A;  4HMJ A;  3GV6 A;  1SNO A;  2RSN A;  3Q24 A;  2R93 B;  1DOM A;  2RDG A;  2K7V A;  4WFN 3;  4CJ0 B;  4RH6 A;  1PFB A;  4EQN A;  5KNC A;  3VR5 A;  1Y1V B;  4KN7 C;  4XIG S;  2SEB D;  1AP0 A;  3VR4 A;  1TS5 A;  1EWH A;  1OXX K;  5C3E B;  3T56 B;  2QKI C;  1OXV A;  1MSH A;  2F3W A;  1D6E C;  1QNU A;  4IFD H;  5G3L D;  3BZD B;  3OMG A;  5LL6 X;  2R3Z A;  5C0X H;  2A69 C;  1TY0 A;  1STE A;  2X69 A;  1WTR A;  5M5W B;  3GO5 A;  3MFY A;  2EYM A;  1K8O A;  2NVY B;  3LNN A;  4IFD G;  3CKI B;  1HQR D;  3GTO B;  1U4M A;  1HXY D;  1RTO A;  4H13 C;  4O42 A;  1A2T A;  2WIN B;  2AQ2 B;  3GD7 A;  2DNC A;  1B9M A;  3S1N B;  1JR0 D;  3URY A;  1TS4 A;  3VR2 A;  3HOX B;  3DEO A;  4BY7 B;  1KAA A;  3OHX C;  1PFN A;  1PZJ D;  3SK4 A;  4BWG B;  4C3J G;  2ID0 A;  4V0B A;  4HCS A;  1TS3 A;  2WII B;  3A8J E;  3TN2 A;  5DM6 3;  3PUV A;  3U9S A;  2J7Z A;  2IPK D;  3Q23 A;  2KJX A;  1TU2 B;  5DM7 3;  3TME A;  4B9W A;  1U4R A;  2CW0 C;  4QF4 A;  4A3K B;  4J8Q A;  3R2I A;  5DNF A;  1EL0 A;  1B50 A;  3DUZ A;  1GJX A;  1PTO H;  4L8J A;  2RDF A;  1L0X B;  1D1I A;  1JE4 A;  1EZ6 A;  5CBA E;  4X3S A;  5KNB A;  1ILP A;  1A3U A;  3BVG A;  5F2D A;  3KUP A;  3PUW A;  2O5I C;  5CR3 A;  1FNW A;  4PMC A;  3PO2 B;  1B4O A;  3M4Y A;  1JWM D;  2EYH A;  4ZK9 B;  1QB5 D;  2ENB A;  2RBM A;  2QDB A;  1QE6 A;  1K83 B;  5I2Y A;  3OPO A;  5J22 A;  5LHY 1;  4HCE A;  3MXG A;  4DNT B;  2WKC A;  3A7A B;  1H9R A;  1NR2 A;  2BDN A;  3LWU A;  3TP8 A;  1TKW B;  2F0K A;  3PO3 B;  3M7N A;  3FMC A;  3AU7 A;  4IUP A;  2OEO A;  5EPL A;  1OXT A;  1Q1B A;  2F1M A;  5EJW A;  2JEB I;  1NUC A;  3QG1 A;  3D8G A;  1JQY D;  5ELB A;  2BOS A;  1PTO B;  1SE3 A;  4PMW A;  4RGM A;  1WTV A;  1LTG D;  4JK1 C;  5JEA H;  3V2T A;  2NYZ D;  4ZUI A;  3Q22 A;  1RDP D;  1WTQ A;  2K03 A;  1KTK A;  3T53 B;  1PFM A;  4FXK C;  4F8M A;  4RCN A;  5D3D A;  4FVM A;  3M3Y B;  2NZ1 D;  4A3J B;  1HFN A;  3TDQ A;  1C4Q A;  4F88 A;  4A3F B;  2ICE C;  5ISR A;  3HKZ B;  3NP8 A;  5J39 A;  1SJH D;  1B2T A;  2PCF B;  2PYK A;  1I4Q A;  4BS9 A;  3E0J A;  2BE5 D;  2L12 A;  1O7Z A;  1F2M A;  4WJW A;  2NVQ B;  2A69 D;  2F0Q A;  1QG7 A;  1SNP A;  1V43 A;  3MXU A;  3SK5 A;  5G3L F;  1LV9 A;  3KBG A;  1PDQ A;  1KAB A;  3D3R A;  1ILQ A;  2AWO A;  2G9H D;  2L1B A;  1ZYR C;  1F2Y A;  4IUN A;  1D5Z C;  3X3N A;  3S16 B;  1XX8 A;  3U9O A;  3J81 E;  3K5M A;  2VB2 X;  4K2L A;  2R92 B;  3BVM A;  1TT2 A;  4MN3 A;  1J9O A;  2A6E C;  1Q12 A;  1PRT B;  2NVX B;  4IAL A;  2X6L A;  2XNA C;  1PZK D;  2IX0 A;  3KLS A;  3PUX A;  4J1M A;  4DXG A;  2DN8 A;  1HUM A;  1G2S A;  1GXD C;  5FLX E;  3I73 A;  3VA5 A;  2A73 B;  1F9Q A;  4DAY A;  4EQP A;  2NTT A;  1MGS A;  3E6Z X;  2K6A A;  3NUC A;  2DNE A;  5M3M B;  4L63 B;  4FYD A;  3I70 A;  5CV5 A;  4BA1 I;  1F77 A;  5FOB B;  4KD3 A;  1ML0 D;  1R4Q B;  3VYU A;  5E1F A;  3GQB A;  1RCV D;  2A6E D;  4RHS A;  1CZG A;  3BYT B;  4XYQ A;  4I7Z C;  2PO4 A;  3HZX A;  5LL6 S;  4CBV A;  3C1F A;  1XTC D;  2K5W A;  2EYL A;  4DN4 M;  1CI3 M;  1I4P A;  1EQT A;  2B2V A;  2KHS A;  4CHT B;  4R9W A;  1GUW A;  2HDL A;  3RLF A;  1E2Z A;  1I4X A;  2PMZ B;  1EY5 A;  1BOS A;  4WRD A;  2FIN B;  4H7B A;  3NWS A;  3AMU A;  3HOW B;  3KLR A;  5EBC A;  1AN8 A;  5CYU A;  1VF5 C;  1S5E D;  1XXG A;  3TP7 A;  2FJ2 A;  3GTQ B;  2Z4H A;  2AUK A;  2L5T A;  4XQJ A;  4HSP A;  4HN7 A;  1ZKO A;  2KQ3 A;  5EQ0 A;  1EY9 A;  1TQO A;  4ZYS A;  4E6I A;  2B2W C;  2L9H A;  1QNK A;  1DCZ A;  1D5X C;  4RA8 A;  1EY6 A;  1H9K A;  2RVL A;  4LK1 C;  2XWB B;  5EPK A;  1LO5 D;  3VR6 A;  2KA7 A;  5COR A;  1STH A;  2B8F A;  4RFB A;  2WP8 J;  4KJO A;  3A54 A;  1WTP A;  2MGS A;  3HOV B;  1EY8 A;  3NQT A;  2QEJ C;  3SHL A;  1GHJ A;  3ND8 A;  2A5H A;  3OIQ A;  5HUR A;  3MXP A;  2JA5 B;  5I9O A;  2DY8 A;  2WKD A;  4DXF A;  3EA6 A;  3DM1 A;  1I4H A;  3EQL C;  4DNR B;  2FHT A;  1PRT D;  2N55 A;  3NXW A;  2YYZ A;  2XWJ B;  2KOL A;  3M7G A;  2IX3 A;  4U67 3;  1I4G A;  3NPP A;  4ZQ3 A;  4LJZ C;  1SE2 A;  5E4X A;  3S1Q B;  4CKE A;  1TII D;  3N52 A;  4RGT A;  4A3B B;  1ICW A;  3OWE B;  4MIU A;  1F9P A;  2KEC A;  1SDF A;  2B2T C;  3J7A F;  3DWA A;  2NTS A;  1MI2 A;  1PLF A;  1TVX A;  4O1N A;  2NWG A;  2K28 A;  2SDF A;  2K04 A;  4PV1 C;  5T1I A;  4BA2 I;  3CU7 A;  2B2T A;  5C5M A;  1OXU A;  2NUC A;  4C3J B;  1G6Z A;  1EY0 A;  3L7Z C;  5D14 A;  5IGD A;  1QCB D;  3SDZ A;  3TZD A;  1HHV A;  2RA4 A;  5JPN C;  2O2L D;  1GUT A;  1ENC A;  1TR5 A;  1AW7 A;  1CK1 A;  3MAQ A;  4RWS C;  1ET6 A;  2SNM A;  2XRQ D;  5KND A;  2MPM A;  3V05 A;  5CGK A;  3MVV A;  3RUZ A;  1SEB D;  1KDA A;  4C3I G;  3K6O A;  4EQO A;  1JB3 A;  5IT9 E;  2X6G A;  2C9O A;  1E0B A;  3J80 L;  1EEI D;  3NTI A;  3A8K E;  3D31 A;  3I4N B;  2LS0 1;  5KIX A;  1VCI A;  1RF2 D;  3G7L A;  3PUY A;  4FXG C;  3A8I E;  5IOC A;  4UDU C;  3HOY B;  3S15 B;  2EOT A;  4HR7 B;  1DZ1 A;  2CQA A;  1C48 A;  2CW0 D;  4KY7 A;  3T13 A;  3RZO B;  4IUT A;  1BCP F;  3MHB A;  3SVM A;  4CKC A;  5KGU A;  1RJT A;  2XIW A;  3P7J A;  1SYG A;  1L0Y B;  1Z47 A;  4AYB B;  4B08 A;  5D3I B;  3HRZ C;  3I4M B;  1NCV A;  2NB0 A;  3J81 L;  5C0X G;  1BCP C;  2F0U A;  5K36 G;  1LLR D;  3LX0 A;  5CV7 A;  4JBW A;  1FD7 D;  4IUU A;  5CV9 A;  3QOJ A;  3BVZ A;  2B39 A;  1YNN C;  4C3H G;  2B2W A;  2QF7 A;  4OHJ A;  1GUG A;  2Z8L A;  1RKN A;  1Y8O B;  2R61 A;  1V1P A;  1DJR D;  4FF3 A;  4R8N A;  2DY7 A;  4CGY B;  3QIA A;  1ET9 A;  5M9O A;  4KMU C;  4BBR B;  2EVB A;  2HQE A;  3A55 A;  1E2W A;  4KY5 A;  5T1G A;  1HTP A;  4YIJ A;  5K36 H;  5IGE A;  4RAU C;  4KTA A;  3PMF A;  4QIW B;  3SR1 A;  2CHB D;  2JA7 B;  1KLG D;  2K01 A;  3K57 A;  1HPC A;  1DOL A;  3V96 A;  3BS1 A;  1X3P A;  3K0Y A;  4NW2 A;  3OSO A;  2EY2 A;  3E5S A;  3TSS A;  2K5Q A;  4HSV A;  3VYR A;  1DON A;  1SE4 A;  4ILW A;  2K33 A;  3HP3 A;  3EJI A;  1SMY D;  4RKL A;  4FF4 A;  2PW5 A;  1EQV A;  2B8G A;  3FDT A;  4K2K A;  1UAP A;  4UAI A;  1STB A;  1TWA B;  2RKS A;  4FXD A;  5JEA G;  3HG9 A;  2ICI A;  1B44 D;  2EYP A;  3WOE A;  1PTO D;  4RCO A;  1SBB B;  3EFX D;  4HAE A;  4EGV A;  2B2Y C;  1EU4 A;  4KY6 A;  4QUC A;  4C1N I;  3CHB D;  2FFK B;  1YNJ C;  3NTK A;  1SYF A;  3K5O A;  2JA8 B;  1A6X A;  1KNE A;  2IW3 A;  4A3M B;  1FYC A;  2PZT A;  3JAM E;  3ERQ A;  2K05 A;  1BF4 A;  4IZ8 A;  3KBX A;  5EKI A;  4X3T A;  3S9W A;  2XRS D;  1AFP A;  3KK7 A;  5C4X B;  1PZI D;  1Q3L A;  2LKV A;  4Z9C B;  2ZXO A;  1EYC A;  2F0G A;  1JWS D;  1RHP A;  2EXZ A;  3IFT A;  1HFG A;  4RGO S;  1I50 B;  1QJO A;  2Q8T A;  5JPM C;  4G7H C;  1H9M A;  1LT3 D;  1EU3 A;  3S2H B;  3NBH A;  3BDL A;  2AQ1 B;  1Q8I A;  3ITP A;  1SAP A;  3IKJ A;  4ZKC B;  2EJF C;  2J4X A;  4H0L C;  2TSS A;  1QOH A;  2F0E A;  4XQQ A;  4C1N K;  1EFI D;  3CQZ B;  4IN3 A;  1IYU A;  2E76 C;  4F87 A;  4QUF A;  2YU9 B;  1ENA A;  1D1K A;  4QCL A;  1X32 A;  3QJY A;  2NVT B;  1ESR A;  1CHQ D;  1ENF A;  1EYD A;  1DOK A;  1TY2 A;  1W6K A;  2AWN A;  4TKO B;  1J8I A;  4RKB A;  5EBD A;  1F9S A;  2XSC A;  2PZU A;  4C56 C;  2JXM B;  3I8Z A;  1LTR D;  4XTC S;  3DHQ A;  5JJZ A;  5IGG A;  4J6H A;  3K7A B;  4QMG A;  3T51 B;  2EY1 A;  4N9P A;  3D4D A;  1Y69 U;  3MZ5 A;  1UEA B;  1STG A;  2B2V C;  2QCP X;  3IL8 A;  1Q90 A;  2FMC A;  1SSO A;  3BG3 A;  2IWH A;  5KEE A;  1FGB D;  2NN6 I;  1WTW A;  4WOR A;  1T5X D;  1NSN S;  3TZU A;  2K1B A;  1S5B D;  4B9X A;  2VNU D;  2F0O A;  1HTL D;  2D2C C;  4ABN A;  4H44 C;  2F03 A;  1MBY A;  1WD1 A;  2D9U A;  4CJ2 C;  4KHZ A;  5EKK A;  4A3E B;  2IJ0 A;  4LAA A;  1B1Z A;  4KKS A;  1M4V A;  2F0P A;  2EZV A;  2E74 C;  1KLU D;  5E3F A;  3LWE A;  1H9J A;  3I4L A;  1ROD A;  4OO1 G;  2WAC A;  1JWU D;  1BNZ A;  1GOZ A;  1Z6H A;  1VMC A;  1FNU A;  1F2L A;  4RGN A;  1HCZ A;  3H0G B;  4A3G B;  3GTP B;  3SK6 A;  3C46 A;  3HOU B;  1XYI A;  4KK7 A;  4OO1 H;  4G4K A;  5ELF A;  1ZXT A;  2EE1 A;  3NWT A;  3S17 B;  5I4D A;  2AUJ D;  1ZEQ X;  2JYO A;  5C3W A;  2F0I A;  4HMI A;  1H9S B;  1W6J A;  2A6H D;  3DWP A;  3NHH A;  1BXT A;  1GUN A;  1S5F D;  2R6G A;  1XWE A;  2GA4 B;  3OOC A;  3H6M A;  1I4R A;  2RDH A;  2TMP A;  5TSS A;  2KCC A;  1CM9 A;  2OF1 A;  3NE5 B;  2QIL A;  2XVS A;  1ZYR D;  1LTS D;  2N88 A;  3D6W A;  5BN3 A;  4N9T A;  3QOL A;  1PTO F;  3NQI A;  5A2Q E;  2KVM A;  1IKM A;  4FF2 A;  5FK9 C;  1H9S A;  1VDZ A;  4F7X A;  4PQX A;  1R4P B;  3R2T A;  5D65 A;  1QWY A;  4C3I B;  1BCP B;  3ND9 A;  3J7A V;  4X3K A;  5BN4 A;  3S2D B;  4FO2 A;  3J7Y W;  1TWC B;  1KNA A;  3K59 A;  2C5C A;  1A2U A;  1CQV A;  2B63 B;  4OO1 I;  4FF1 A;  5EPJ A;  1RTN A;  3DEP A;  3OWF A;  1MSG A;  3FPP A;  1HA5 A;  2HDM A;  5ELD A;  5C5L A;  4G7Z C;  1EIH A;  2F0T A;  1IKL A;  3GP7 A;  4EVO A;  5C3X A;  2FMM A;  2KUM A;  2F3V A;  2WAQ B;  4KN4 C;  1AZQ A;  4TQU S;  1UNS A;  2F0M A;  1U9R A;  1EEF D;  1VMP A;  3VA7 A;  4K5W A;  1CA6 A;  2L11 A;  1SYD A;  2F0L A;  5CV8 A;  2VXW A;  1SNQ A;  2JA6 B;  3R3O A;  1O7Y A;  5IT9 L;  1K8M A;  2E2I B;  3FEW X;  2ZT9 C;  4S3S A;  3GTG B;  3C3L A;  3EVQ A;  1IYV A;  1WVL A;  4NP5 A;  4ZKB B;  3DWQ A;  1PRT F;  4XDX A;  1TWH B;  1GHK A;  3PIO 3;  4A3D B;  5I2X A;  1PMR A;  1DM0 B;  3DMU A;  1IHZ A;  2K32 A;  3QWN A;  4RHR A;  2WV6 D;  5BN5 A;  2NN6 G;  2MJ8 A;  2ZXP A;  2B2Y A;  2SNS A;  2XN9 C;  5M5X B;  3I3C A;  2Q8R E;  2Z1C A;  4KI0 A;  4DAP A;  5IOD A;  5CMD A;  1STA A;  1BBX C;  2I07 B;  3P1H A;  1AZP A;  1O78 A;  3NTH A;  5C4H A;  3GTM B;  4FNF A;  3WDN A;  1NR4 A;  4X3U A;  1TWF B;  2K5D A;  5JOB A;  3TP6 A;  2F4I A;  5A35 A;  1ONL A;  1CTM A;  3KF8 A;  3GTK B;  5DAU A;  3PUZ A;  4ZRZ A;  1EWC A;  2L4N A;  5IGC A;  3RZD B;  2PQE A;  5KYL A;  4L6T B;  4V19 0;  1FNV A;  3RMH A;  1SYE A;  4KHV A;  5JVG 3;  3KLS X;  5DEH A;  2F0N A;  3NK9 A;  2LY7 A;  1LT6 D;  5JAV A;  3ONA B;  1DD2 A;  3PIP 3;  1Y8P B;  3FVQ A;  1WCM B;  1STN A;  1LT4 D;  3D4R A;  1GUS A;  4ZUJ A;  1SND A;  2E2H B;  5IIF A;  2BCO A;  3BDO A;  3A56 A;  1SNC A;  3K5L A;  2PW7 A;  1I3Q B;  5C44 B;  5E4W C;  2RSO A;  3R8B A;  2BA1 A;  4Q0F A;  4ZAI A;  1WTX A;  5JVH 3;  4FP5 D;  3HOZ B;  1BQQ T;  2F0D A;  1PTO C;  5JEA J;  1U4P A;  1C8C A;  1A3T A;  4ODG A;  1CFM A;  4XYO A;  3W2D A;  3OMC A;  3DXJ C;  1Y1W B;  1YNN D;  2BA0 A;  3I90 A;  1VF7 A;  1JOK A;  1S5D D;  2M00 A;  2HCC A;  2KCN A;  2V4D A;  1NAP A;  4DU9 A;  2A68 D;  3MFG A;  4GZY C;  2M2L A;  1F2Z A;  1JOR A;  2D62 A;  3L9A X;  1CT1 D;  1LAC A;  5FO8 B;  4QB4 A;  2VB3 X;  2EY6 A;  1EOT A;  2NBF A;  5IGF A;  4OIK A;  2IL8 A;  3ERO A;  4C3H B;  3C1E A;  3QB3 A;  1U4L A;  4NMZ A;  1O80 A;  5FO9 B;  3MWY W;  4K6L A;  1WTO A;  1V8Q A;  2F0W A;  3VR3 A;  4OL7 A;  1F9R A;  2IT1 A;  1Y8N B;  3P75 A;  1Q1E A;  4CJ1 B;  1S5C D;  1CQF A;  1B3A A;  2JSO A;  2EJG C;  1PYW D;  3SEB A;  1X3Q A;  4BBS B;  2EY5 A;  3GTL B;  4IUR A;  3MA2 B;  1JIC A;  3TBI B;  1EZ8 A;  2CVR A;  4IQZ A;  3D4W A;  3O13 A;  1SYC A;  5FLX L;  4BY1 B;  4PNY A;  2R7Z B;  3IAY A;  1MD2 D;  1B53 A;  5FO7 B;  4ME5 A;  1HQM C;  2ZXR A;  1B9N A;  1BUV T;  1CHP D;  1A15 A;  1SYB A;  2HCI A;  1LTT D;  1LT5 D;  1QIL A;  4KJN A;  4Q5V A;  1BDO A;  2F0H A;  3Q0A A;  1D2B A;  1WD0 A;  1YNJ D;  1HA6 A;  4M1U B;  2O5J C;  5M5Y B;  1O7L A;  3P20 A;  1G2T A;  2LMC B;  1V1P B;  3W3A A;  3NBI A;  4R8I A;  3MTS A;  3C2P A;  1UUP A;  2H4O A;  4KKU A;  1OXS C;  2E75 C;  3H94 A;  4DK0 A;  5AFW A;  4DF7 A;  1BR9 A;  4IFD I;  2A6H C;  2SOB A;  3BYY B;  1KDC A;  4OGQ C;  4TRD A;  2KEE A;  3SXH A;  2EPB A;  4K6D A;  3GV3 A;  3OIP A;  3J80 E;  2D5D A;  4ULL A;  5FKA C;  3ZYY X;  1TWG B;  2BDO A;  3OW7 A;  2F0J A;  2Y0S B;  4XT1 B;  3IFD A;  3I72 A;  3M4O B;  5J1Z A;  4IUV A;  1I6V C;  1T5E A;  1EY7 A;  1A3V A;  3K58 A;  1CA5 A;  2EDG A;  5CV6 A;  5CBE E;  3HS0 C;  5EGT A;  3MC0 B;  1SJE D;  5KRU A;  2AQ3 B;  2F0V A;  4ZLT F;  4XT3 B;  2E2D C;  1JOQ A;  1LAB A;  1SMY C;  5EKL A;  2EJM A;  4TSS A;  4K5V A;  5I9P A;  1BCP D;  4A93 B;  5HGT A;  4DA2 A;  4K8J A;  5CV4 A;  3AB9 A;  1GUO A;  1OO9 B;  5I6W A;  2JE6 I;  3A7L A;  3H3V C;  4IUQ A;  2L55 A;  3SK8 A;  3T4A C;  3S14 B;  5COY A;  3G6J B;  3T16 A;  5ELC A;  5C6A A;  2A68 C;  4MHE A;  3FKI B;  2E2J B;  5C0X I;  1IL8 A;  3FPU B;  4DGZ A;  2HUG A;  2MUY A;  2H1E A;  1EIG A;  4NKL A;  1JOO A;  3SE0 A;  1IW7 D;  2JP1 A;  4KD4 A;  4IFD J;  1TS2 A;  1SXT A;  1JCK B;  1JC7 A;  5CC4 A;  3L3O C;  1Z7T A;  1E2V A;  2G9D A;  3H91 A;  4DFA A;  4DAV A;  2OT2 A;  4HED A;  5C0X J;  3JAM L;  3N6R A;  2B2U C;  4HTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...