3NHHA

Crystal structure of staphylococcal nuclease variant v23e-l36k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclease A
publication title Structural and thermodynamic consequences of burial of an artificial ion pair in the hydrophobic interior of a protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nhhA00
1EY7A 3E5SA 3NHHA 3SHLA 4K2KA 4RKLA 5IGDA 4WORA 4ZUJA 1JORA 2OF1A 2PQEA 4DU9A 5KYLA 5C4HA 3BDCA 3R3OA 1EY9A 3ERQA 2EY6A 3P75A 2PW5A 3QB3A 3V2TA 1EY5A 3HEJA 1EY0A 4KD3A 5IGEA 2F3VA 3H6MA 2RBMA 1A2TA 1II3A 4EQNA 1NUCA 4K6DA 5CV5A 3D6CA 3RUZA 1KDCA 2SNSA 4QMGA 4DFAA 1STGA 4RKBA 1SNQA 2EYFA 3EJIA 5I6YA 4K14A 3TP8A 1EYAA 1SNCA 1KDBA 2F0JA 4IUNA 4N9PA 1EZ8A 1A3TA 1KDAA 1SNDA 2F0LA 5J1ZA 2HQEA 5KIXA 1ENAA 2F0OA 2NUCA 1STHA 3MEHA 5KYIA 2F0QA 2SOBA 4H7BA 3T16A 5C6AA 2QDBA 1TR5A 3DHQA 2EXZA 4KV6A 4NP5A 5J22A 5IGBA 1ENCA 3D4WA 4KY5A 5C5MA 3NXWA 2RDFA 2PYKA 1EY6A 5DEHA 2F0MA 3NK9A 3MVVA 5CV8A 1KAAA 2F0GA 3OSOA 3P1HA 5CV4A 2F0IA 3NQTA 1KABA 4HMJA 4ME5A 5F2DA 4R8NA 1SNMA 5CV6A 3SXHA 2EYLA 1SYFA 1F2MA 1IHZA 1JOKA 2KHSA 2OEOA 2F0UA 1EYCA 4E6IA 4HMIA 5EGTA 2F0VA 4KY7A 2PZUA 4IALA 3VA5A 1EY4A 4S3SA 4DF7A 1NSNS 5DAUA 4PMCA 4F8MA 5IGGA 3S9WA 2O4XA 2F0WA 2F0TA 4K8JA 5IGFA 5CR3A 4ZQ3A 4J6HA 3D8GA 1EYDA 5E1FA 5KGUA 1F2ZA 2EY2A 2F3WA 3MHBA 4QF4A 1EZ6A 1JOOA 3QOLA 5IIFA 1SYEA 5KEEA 1SYBA 4KTAA 4EQPA 5C4ZA 2OXPA 5HGTA 5IOCA 2EYJA 2EYPA 5ISRA 5HURA 3OMGA 3SK5A 1STBA 4YIJA 1TQOA 1SNOA 3MZ5A 1AEXA 2SNMA 1U9RA 4K5XA 4KD4A 5EKKA 5C5LA 3HZXA 4LAAA 4TRDA 1SYCA 2M00A 4EQOA 5CC4A 4DGZA 3BDLA 4IZ8A 4B9WA 1SNPA 2ENBA 2F0PA 2F0DA 3MXPA 3LX0A 4K8IA 3SK4A 2F0HA 4NKLA 5JAVA 5C3WA 3PMFA 4I65A 4PNYA 4PMBA 4KY6A 4F7XA 3D4DA 3TP7A 1A3UA 2F0KA 3NP8A 5E3FA 3OWFA 2RKSA 4ZUIA 4G57A 2EYHA 1RKNA 1STAA 4N9TA 5IODA 4KHVA 3NUCA 2LKVA 3T13A 4MIUA 4QB4A 3SR1A 5I9OA 1STNA 2KQ3A 3QOJA 4J1MA 2WACA 4B9XA 5M9OA 1A2UA 1F2YA 1JOQA 4K2LA 5I6WA 2F0EA 3U9OA 5K5PA 3C1EA 4KJNA 2F0FA 1STYA 2EYMA 2PW7A 5KRUA 4ODGA 2F0NA 5IGCA 3ITPA 5CV7A 5NUCA 4NDXA 2EY1A 1EY8A 2PZTA 2PZWA 5JOBA 3SK8A 4EVOA 3TP5A 4OL7A 4KJOA 1TT2A 1SYDA 4NMZA 1SYGA 4WRDA 3EROA 5C3XA 5EKLA 2EY5A 1A3VA 4ID6A 3TP6A 3SK6A 3EVQA 2EYOA 3C1FA 3DMUA 3OMCA 4K5VA 5I9PA 3TMEA 5CV9A 4HTHA 5J39A 5CGKA 4K5WA 2F0SA 1EQVA
chains in the Genus database with same CATH superfamily
2B8GA 5M3MH 4QUFA 4DXGA 4WORA 4HJ7A 5E4XA 1CSQA 2E8GA 2BDOA 2EVBA 2WB1B 2EOTA 4RHRA 1EU3A 3M85A 5IT9E 1YJNA 5EAYA 4CDDC 5K36G 2M9VA 4A3BB 3S1MB 3HEJA 3HOXH 1I94L 5BR8L 1NR2A 3RUZA 4ALPA 2SNSA 5CORA 1HZAA 1WTVA 1SNQA 4B3TQ 2OTLA 4GOPC 2MO0A 1JWUD 4UDUC 2K4KA 5GAHC 1T9HA 1P8LA 5M3MG 4L6TB 1GUGA 5JPMC 4JI3L 4GLXA 1NR4A 1U4LA 1WTHA 2QA4A 1IL2A 3A0JA 5LMNL 2VQEL 2NVTH 3HOXG 2VZAA 4G4KA 5CBAE 5C44H 2QF7A 1Q3LA 5I4DA 4WJ4A 2VS1A 1QG7A 4R1JA 4E6IA 4B3MQ 4DR7Q 4CDCC 5C0XI 4KHPQ 4C56C 1VQ4A 3A8KE 3PV0A 1CTMA 1BNZA 4BBSB 4ZQ3A 2UXDL 2QDLA 3OWEB 1RF2D 1KD1C 3I4LA 1ESRA 3JAMi 2BCOA 2AQ3B 1E2WA 4YWKA 5C4ZA 4IUUA 2Y0SB 4AYBG 4HEDA 5EPLA 3HG9A 1U4MA 5M3FG 5C44G 1N8RC 4CJ0B 1FD7D 2BA1A 1VQCA 1PTOD 4MTKA 1X6OA 4H0LC 1EIGA 3ULJA 1JJCB 2K33A 4XQJA 4DR4L 4IUTA 4XQNA 4JI6Q 4X62L 3NUCA 1ZEQX 4DV1L 2L9HA 2GN5A 4KMUC 2JA8B 4OX9Q 1S3OA 3P7JA 3C1EA 3FVQA 2EYMA 1SEBD 1NBWA 4X65Q 2Q8IB 2CW0D 2ID0A 2VUMH 1PH1A 3K81C 4NMZA 5C3XA 4DR5L 4HIOA 3DEPA 4DKAC 3IKJA 1N34L 5EPKA 4LF7Q 1PHJA 3CU7A 3C2PA 4PZ8A 2E2JH 3E0EA 1BBXC 3H0GG 1KXLA 1FNUA 1K3RA 1YNND 4I7AA 1G2SA 2IW3A 3J81j 3K5NA 4CDFC 1HA6A 2EPBA 1EU4A 3X3NA 1IXRA 3IRBA 4N8X1 2VUMG 2F03A 3NTIA 2AMCB 1DD2A 3VYTA 1XXGA 3CCRA 2NZOA 1R4PB 3L0OA 2C5CA 4RKBA 1TWAH 1MBYA 5ELOA 3TP8A 3FP9A 3GDEA 3KF6A 2NZHA 4P72A 1EWHA 4GOPB 1J5EQ 2K52A 3IAYA 2HD3A 1CUKA 4CKEA 3GTJH 1AE2A 5IY0A 5FKAC 1LO5D 2ZXRA 2QDBA 1DOLA 2B39A 2NN6H 2XRQD 2F0MA 3NK9A 3KJOA 3M7NA 3BG3A 3GTGB 3VR4A 3OTOQ 2F0IA 2FHTA 2J4XA 3BVZA 4DV6L 4HIDA 1IHZA 3WOEA 3VR3A 2GA4B 1V1PB 3NSWA 2PZUA 3AQQA 5IWAQ 1XTCD 1PYSB 1FNVA 1PTOF 2E76C 3PF4A 3GTQB 3M4OB 2Z1CA 2DJFC 2NN6G 1JOOA 4KTAA 1LV9A 1HTLD 1OXVA 4MNOA 3SK5A 2SDFA 4C3IH 4WFN3 3S1NH 1Y1WH 1JCKB 2M00A 4HN7A 3KBXA 4DGZA 1PFBA 1CKNB 4FXGC 3SK4A 5T1GA 1EEFD 1CZGA 1S5ED 2RQXA 2IHEA 1SMYD 1CT1D 2K5HA 1V1PA 1HXYD 4A3MB 3S2DH 1XYIA 1WD0A 2K01A 1Y1WG 1TS5A 2KECA 4JYAL 2RF4A 1AE3A 1U0LA 1RHPA 1UUPA 3PO3B 3RNUA 3SGIA 1PH7A 1TWHB 4EVOA 5IP7H 3J81c 3P20A 4DAMA 1RJTA 1PRTB 2PCFB 2ZJRA 3TMEA 1IBML 4LFBQ 2F4VL 3H3VC 3PQIA 5JJLA 2F0SA 1EQVA 1A62A 3ERSX 3SHLA 3GTOB 4O1NA 2R93H 4K2KA 2G9HD 1M8AA 1Q90A 4YCVA 5C4HA 3KJPA 3VDYA 1PZJD 2WIIB 2AUJD 5KNCA 2F3VA 3PSIA 1RTOA 3CCLA 2NZ1D 1PTOH 1VQDA 5IP7G 2QILA 4EQNA 1I4HA 4QGUA 1DOKA 1RCVD 4NXNQ 3L9AX 1SE4A 3G4SA 3S15H 1R4QB 1X54A 2I5HA 2A5HA 1ZYRD 4CJ2C 2HQEA 3U58A 3S24A 2R93G 4IJHA 2H5XA 1QVGA 4DK3C 3CCQA 2FINB 1K83H 4DV7Q 1WI5A 4BY1H 3QWNA 1IYUA 1KL9A 4PV1C 1VQMA 1E0BA 2JEBI 1HNZQ 2N3SA 2R7FA 4N8FA 3RZDH 1JOKA 1FGUA 2KHSA 4HJAA 3M4YA 2BH2A 2XTIA 2NVYB 1NSNS 3S9WA 4LUZA 2F0WA 4XXEA 1TWGB 3KUPA 4GKKQ 3OIPA 4GNXC 3GV3A 1H95A 4OO1I 4A3IB 2Y0SG 1MJCA 2RVLA 4BY1G 4X3SA 4JI2L 4A3FH 5C4JH 4GKJL 4J8QA 4Y52H 2IJ0A 1B9MA 2DY8A 3U4VA 3I7FA 3I4NH 2KVMA 3SEBA 5FLXE 3MZ5A 4LF9Q 4A3KB 4K5XA 1BR9A 1G6PA 4LAAA 3DUZA 3NELA 3J7YW 4H02A 1SNPA 1BXTA 4NXML 4KI0A 5T1IA 5AJ3Q 4R4TA 2CWPA 5JJZA 1M1KC 5BN3A 1VMCA 2JA8G 2X69A 4M8AA 2JA7B 4IPHA 1EWCA 4R4QA 3I4NG 1NY4A 2Z6KA 1A0IA 4DV0L 1B53A 4IUPA 2FMCA 3GP7A 5C4XH 4A3CH 3ITPA 3LNNA 1HNXQ 1BCPB 1BVSA 4JVZA 3E3XA 2X6LA 2EY5A 1PFSA 4ID6A 1YHAA 4JI0Q 1DYQA 2LXJA 2IT1A 5CGKA 4K5WA 1MSGA 3KFUA 2IWHA 1ET9A 4A93H 1FR3A 2PW5A 3I73A 2IX1A 4X3KA 4A3CG 2IL8A 2QW7A 4KD3A 3FKIB 4JI7Q 2OWOA 3M7GA 4GS3A 4ZYSA 1CFMA 1STGA 2B2TA 5IT9c 2UUCQ 2ZXOA 4ZK9B 3T51B 3GTPH 3TEHB 5FLMG 4TSSA 2R7ZH 4V0BA 3NQIA 4NP5A 3RMHA 5JPNC 1QJOA 5FJ8H 2FFKB 4A93G 3K6OA 3J7ZC 3CD6A 2UXCL 3F2DA 1LYLA 3DWQA 4X3UA 4DV3Q 4H44C 5ELDA 5TSSA 2A6HC 1UNSA 1E1TA 1VQLA 5EGTA 4DUYL 4P74A 1O78A 2AUKA 1VQKA 3Q24A 2Q8RE 2R7ZG 4JV5L 1EQRA 5FJ8G 4GNXB 3TS0A 2GVBA 1WTWA 2Z6BA 1H9RA 1XNRL 3C46A 2A74C 3K8AA 3HKZE 3VA7A 1SNOA 2SNMA 1QB5D 1WYDA 3PO3H 5M5WH 1WFQA 2JA5H 1R9TB 1PVOA 2NWGA 1GUOA 2KEDA 2WKCA 3J81L 1O7LA 2QGQA 2Q2IA 1LT6D 4F87A 2L0CA 3HKSA 4KHVA 1TS3A 3RLFA 3VYRA 3DWPA 2K32A 1QOHA 1GUSA 3Q22A 1GUTA 1QZHA 5GQOA 4HSVA 3PO3G 1BDOA 3QIAA 4KJNA 4LFCL 1HFGA 3K0YA 1LTAD 2UUAL 3A74A 2PZTA 4IN3A 4DV4Q 5C3EH 1SYGA 4WRDA 3M3YB 2KCTA 1TXYA 1I50H 1I4GA 1WVLA 2EYOA 5GADC 1SFOB 3HS0C 1H9SB 5J39A 4UAIA 4DR2L 4A3DB 2J0TD 3MWYW 2VQFL 3ULLA 3CC7A 4JW0A 2FMMA 2R92H 5DM63 1DJRD 1C48A 4PQXA 3K59A 3CQZH 4DAYB 5C3EG 3J80L 2K5DA 4AQYL 4K0KL 2EYFA 3ZYYX 3I72A 1EFWA 2QCPX 1XTDA 3MXNB 1KDAA 3S1QB 3SDZA 5EKIA 5I2XA 5J22A 2EXZA 1HHVA 4KY5A 4A3KH 2R92G 1AFPA 1KAAA 4XT3B 5F2DA 3F1ZA 3BJUA 1FL0A 2F0UA 3QJYA 4IQZA 4RCNA 4LF4L 2AQ2B 4KY7A 3VA5A 3URYA 4PMCA 2HIVA 2K6AA 5IGGA 1PH4A 3G7LA 3W2DA 4Y7NH 2F3WA 1F9QA 4FXDA 1U4PA 3NWTA 2CKZB 4A3KG 1SYEA 1Y69U 2A68D 3HP3A 3MXGA 3RD4A 1STBA 1AN8A 1NMGA 1UEAB 1OTCA 4JI8L 2F3IA 3HZXA 1CHQD 1RTNA 1B70B 2XGTA 1VQ5A 3PCOB 1A6XA 2A6HD 5BR8Q 5A2QL 1PH3A 4ME3A 4AYBE 3L2PA 2HHHL 3NP8A 4XYQA 2CQOA 2KHJA 2K1BA 1H9KA 3S1RH 1EOVA 1ML0D 3H3VH 1G8ZD 2LKVA 3K5MA 4LFAQ 3UDIA 3QOJA 1VF5C 1HQRD 2JA6B 5K5PA 3FKIH 3JAME 4JI3Q 5ELEA 2YTYA 3ONAB 5KRUA 2UXBQ 3FRPB 5CV7A 3A56A 2K5WA 4NDXA 1EQQA 3HOUH 4LF8Q 1SLJA 2ZTCA 4FF3A 1W3SA 2NYZD 5EKLA 2UU9L 4O42A 1Y1VH 3FPUB 4K5VA 2UXDQ 4BBRH 1N33Q 1LT3D 3CRLC 1YJ9A 1SAPA 3MA2B 4IURA 4XIGS 2OF1A 1TKWB 3FKIG 5FO8B 1MI2A 2JE6I 3V2TA 2D9UA 3HOUG 1HRJA 4DV2L 3KOJA 1NUCA 3T1HQ 2GVAA 4J15A 1E2ZA 4M1UB 4DPGA 1JE5A 1Y1VG 1CM9A 2F0JA 1B50A 2D2CC 4H13C 1LM0A 1SNDA 4BBRG 5KIXA 3J81i 3S16B 1GVPA 1KNEA 4KV6A 4OEMB 1RDPD 4JOIA 2NVXB 4LJZC 1IBLL 3NXWA 5G3LD 1DZ1A 2EJMA 2B8FA 3KLRA 1J6QA 1JQYD 2LY7A 2K50A 1I4RA 1UE6A 5GAEC 2OEOA 4EQ5A 2R3ZA 1XNQL 1EYCA 3VYUA 3ULPA 4QJFA 2BE5C 2PMZE 3GTLH 1T5EA 1DM0B 4J6HA 1WTRA 5M5YB 3D0FA 4LF6Q 2E2IB 2WAQB 3VYSA 4QF4A 3M9BA 4DNRB 3KBGA 3TQYA 2VW9A 3CMEA 5ISRA 1N36L 2MQHA 4RH6A 2EQSA 1AEXA 1Q81C 2PQAB 5M3FH 3CPWA 1HPCA 3KDFB 1G91A 1VQIA 1KC8C 3QO2A 1K28A 5FLXc 3TP7A 1SFOH 5E3FA 2IX3A 4ZUIA 1EL0A 2IX0A 1RIPA 3J80i 4IOAA 4OXPA 1U5KA 4DNIA 1PH8A 4C1NK 1J9OA 1STNA 2KQ3A 1CQFA 4LUVA 1VQOA 4DK1A 1X3FA 4G7OC 1UE1A 1B2TA 4DAPA 2F0NA 3BZKA 4Z9CB 2KUMA 1EY8A 1GKHA 2E5LQ 2OCEA 3HRZC 4KKUA 2WKDA 4JPBW 4OL7A 4C3HB 1X3GA 5LL6S 3EVQA 2L12A 1PYWD 2PQAA 1I3QB 3KDFA 4HTHA 1PH9A 3CHBD 1K0SA 1MSHA 1XMOQ 2N55A 1MKHA 2K5QA 3Q0AA 2UUBQ 3UI2A 3H0GH 3LWEA 2PI2E 3H15A 2E2HB 4IPGA 3KF6B 2I5MX 2I46A 1HH2P 2N8NA 1TY2A 1VQ7A 1Q86C 1L2FA 4K6DA 4JI4L 1KDCA 1VCIA 3EA6A 3DLLA 2VNUD 1J8IA 1PRTC 3EJIA 3G6EA 4RMFA 2B63H 3FMCA 3HOZB 4N9PA 5D14A 1EWIA 2YU9B 1A3TA 5KYIA 1QCBD 2F1MA 4XDXA 4R4CA 3TZDA 2MO1A 3MXUA 5D65A 2VXWA 1ENCA 1H9MA 3BZDB 2JQOA 1SMXA 2A69D 3WWVA 3M4QA 2M2LA 1L0WA 2E75C 2F52A 2RCNA 2B3GA 4DUZL 4KN7C 2KJXA 4HMIA 4B3TL 1EYGA 1A15A 4IOCA 2B63G 5C0XH 4HIKA 4JI1Q 1S5FD 2EY2A 3MHBA 4P75A 2KCNA 1IBMQ 4L5SA 2F4VQ 1A8VA 5KEEA 3CRKC 3RZOH 4BWGB 1E1OA 1GJXA 1SXTA 1LABA 5LMUL 2Y0SE 1C8CA 5CC4A 1S4ZA 4B9WA 2Z6KC 5C0XG 2HUGA 2F0HA 1NTGA 4PMBA 1A3UA 2BE5D 4DV5Q 1WOCA 1VMPA 2K75A 2Z4IA 1PZKD 1RKNA 5IODA 2JA6G 1STEA 3R2TA 4P71A 1W2BA 1I6VC 1O7ZA 1WTPA 3HOWB 1HA5A 1CQVA 3TN2A 4LF5Q 2DGYA 2VB3X 2F0FA 3HOYB 2ZXPA 4HJ8A 2VY3A 3TREA 4A3JB 4U68A 1X3QA 1B4OA 4RA8A 5KNDA 4B08A 4JI6L 1A3VA 4A3GH 1KNAA 2NVXH 4XTCS 3NHHA 2B2TC 1UEBA 2A1AA 2B2YA 3PF5A 4OX9L 2RA4A 1VQFA 1W6KA 3BDCA 1VQAA 4APVA 4A3BH 3T56B 1AZQA 3S1MH 4X65L 4BXXG 3GTMB 3H6MA 2K7VA 4C3JB 5IYBH 4ZRZA 1BCPC 1BOSA 1D5MC 1ZKOA 4NXMQ 4GN5A 2WV6D 3K7UC 4LF7L 4A3GG 2FJ2A 4U673 3G48A 1D8LA 1G2TA 2SOBA 1E3PA 1NJIC 2WB1G 3A7AB 4IUQA 3A5UA 2D0OA 1S5BD 1YNJC 3RLNA 5DEHA 4A3BG 3S17B 1FYCA 4QIWB 3ND8A 1I5FA 2LSSA 3P1HA 5CV4A 4ME5A 4DK6C 4R8NA 1SNMA 4ZLTF 4DV0Q 3S14B 1F2MA 4ZAIA 5IYBG 1TY0A 1RODA 3T1YQ 4YCUA 3NE5B 1HNWL 4IALA 5COYA 1JJ2A 3C3LA 4BBSH 1CA6A 5ELBA 1J5EL 2WAQG 1PRTD 5EJWA 5CR3A 2L5TA 5CMDA 4ULLA 1C7YA 4C2MB 5FK9C 3TDQA 4B3SQ 1F2ZA 1WTOA 1A63A 3CKIB 3NTHA 3I70A 3EN2A 3BVMA 3NEMA 4RGTA 1ASZA 1Y14B 5HGTA 5HURA 1SJHD 5EKKA 3D31A 2O5JC 3HOVB 1PH5A 1BKBA 1SYCA 1B9NA 4A4IA 4OIJA 3K7AB 2K04A 4BBSG 4YY3L 5IWAL 3PMFA 4PNYA 3RN2A 1I3QH 5DM73 2XSCA 3BS1A 1CHPD 2EYHA 4F88A 2HQLA 3CXCA 4TKOB 1GHKA 4PG3A 2HDMA 2JA8H 2WACA 1Y8OB 1JOQA 1B3QA 2AWNA 1OXUA 3K5OA 1M90C 2ZM6Q 2KA7A 5LMNW 3VR2A 1CA5A 3HOZH 4KJOA 3CPFA 4DUYQ 4HSPA 4V190 4DR6Q 3JAMc 1O7IA 3CC4A 1WJJA 3D6WA 3OMCA 1RD9D 2NTSA 1F9SA 1YHBA 4UP7A 1B7YB 1C4QA 3IFTA 4RKLA 2K5NA 1G51A 1SROA 4FXKC 3I2ZA 2EY6A 1XNRQ 3DM3A 3UDFA 2O5IC 3QB3A 4EGVA 4X64Q 1GD7A 2CQAA 5DNFA 1II3A 3HOZG 1Z47A 4R4IA 5CV5A 2PNHA 4LW1A 3PUVA 1YEZA 5I6YA 4LFBL 2ZJPA 1K8MA 3U50C 2I0QA 1ENAA 2F0OA 1SSOA 3CAMA 3PO2B 1B44D 4OGQC 5FLMH 1DCZA 2A73B 1TWFB 3GTGH 1HR0L 3A55A 1F9RA 4HMJA 3RR5A 3V05A 1PH6A 1PFMA 1WCMB 4NXNL 3GTKB 2XNAC 2F0VA 2K05A 1BCPD 1QVCA 2RSOA 2O4XA 3GTQH 2F0TA 3EBEA 4K8JA 3AFQA 5GAGC 2ZTDA 3M4OH 1O7YA 2JXMB 1KIXA 3TBIB 1SR3A 4DV7L 4OO1H 3S2HB 4IO9A 3QOLA 1X65A 1SYBA 3ER0A 2IY5B 2OXPA 3OOCA 3U4ZA 3E9IA 5J3BA 4DK0A 1TQOA 3I56A 3NTKA 4FDBA 4A3LG 4KKTA 3DEOA 2E2DC 4R9WA 2B2UA 3LX0A 2K03A 5JAVA 2LFNA 4AQYQ 2F0KA 4A3EB 3D3RA 1EFID 2XIWA 4G57A 3MFGA 3Q6SA 5IE8A 3HOWG 4OO1G 1IW7C 1JWMD 1WD1A 1X3PA 3W1GA 4DNTB 4A3MH 4B3RL 4BS9A 4J1MA 4PZ7A 4LF9L 1JR0D 3NPPA 4A3JG 4KHZA 3NBHA 2QKIC 3CC2A 1V1OA 4C3JH 1XPOA 1TWHH 3CCSA 2KBNA 1KLGD 2CVRA 3TP5A 1TT2A 2SEBD 5BN5A 2EXDA 1U4RA 3GQBA 4Q5VA 3GTOH 4A3MG 1TWCB 1XMQQ 5IGDA 4MZ9A 1Q7YC 2PQEA 3KLSX 1HTPA 5M3MB 3ERQA 3KF8A 4C3JG 4IPDA 1D1KA 3A8IE 4OIKA 1HNXL 4JOIC 1QZGA 3HOXB 3J7A5 3NWSA 4QUCA 4JI0L 4X3TA 2KENA 4C2MH 1SNCA 3STBC 4HCSA 1YVCA 1L1OA 4JG2A 1FJGL 3MEHA 1HFNA 3CP0A 2B2WA 4CDEC 1HJPA 5C5MA 4IFDI 4XT1B 4C1NI 1QVFA 1QUQA 3TZUA 1B8AA 4OWTB 1VF7A 4JI7L 2N78A 4AH6A 3MEFA 1ICFB 5A35A 3K7AH 2NVTB 4AYBB 1K8GA 5C44B 1MHWC 2NVYH 2V1CC 3CW2C 2UUCL 3AU7A 1PDQA 5L37A 4JI5Q 3J7AV 1TWGH 1N32Q 2A6EC 1F2LA 5LHY1 4A3IH 2UU9Q 5BN4A 3FDTA 1PLFA 1Y8PB 1IKMA 2MJ8A 3W5OA 1EZ6A 4JK1C 3J81E 1HUMA 3DXJC 4DR1L 2HT1A 4QY7A 1K8OA 4ZKCB 1EUJA 1ZXTA 5HGQA 1YZ6A 4DV3L 5ELCA 1B3AA 2ENBA 4DV2Q 1NAPA 4A3IG 4YHHQ 2JA7H 4X66Q 1SRUA 2Z0SA 1HQMC 3TRZA 4FNFA 1X56A 4POFA 3CF5A 3KLWA 2P5ZX 1V1QA 2G9DA 1IBLQ 5KNBA 1RL2A 3E0JA 2JA9A 2PW7A 2WINB 1HCZA 5NUCA 4ABNA 2IHFA 1I94Q 1XNQQ 2PZWA 1W6JA 2PNRC 1FVIA 2JA7G 1Q46A 3F2CA 4UPAA 3BYTB 4A75A 1KAWA 2A19A 3T53B 4XQQA 3PUZA 3J80E 3V96A 5KYLA 2DY7A 2VL6A 4KN4C 4O0AA 1WCMH 2C35B 5JJIA 1QNKA 5FO9B 3GTKH 4CBVA 5LMNQ 1PTOC 2B2VA 2VQEQ 4IJLA 2JEAI 2C9OA 1CZWA 1TVXA 4QMGA 2YYZA 5IT9L 1ASYA 4R4OA 5EQ0A 1TWAB 2D62A 3GV6A 5C6AA 2AHOB 4DXFA 2RDFA 3FHWA 1PA6A 1JB7A 1WCMG 1HZ9A 1KABA 2F4IA 1LTGD 2CW0C 1SYFA 3I4OA 4WJWA 1I4PA 3GO5A 3VR5A 4FVMA 3PIOA 2K28A 5IP9H 3FEWX 4UHVA 2O2LD 3STBD 4HAEA 3PIPA 1BQQT 4RG1A 3CCUA 1X32A 1YNNC 2OTJA 4DR4Q 3G71A 2Z4HA 4X62Q 5A2QE 3MFYA 4L5RC 2EYPA 3UDXA 4DV1Q 4YIJA 1IYVA 2MGSA 4L5QA 1R9TH 4C3IB 2VB2X 3S1NB 1EEID 4EQOA 1G291 1Y1WB 4A3EG 1E24A 2F0DA 5IP9G 1XX8A 2Q8TA 4DR5Q 1STAA 1N34Q 2G5DA 1MJEA 4L5TA 4QB4A 4FO2A 2XRSD 1Q82C 1UE7A 3N6RA 3A7LA 3ND9A 2MUYA 3S2DB 4BA1I 4OONA 4BY7B 1YJWA 3I4MB 3JC66 2B2YC 1UE5A 4DUZQ 1D6EC 5JOBA 3M3YH 4YCWA 1WTXA 2DNCA 5CYUA 1E7ZA 3SK6A 2PPBC 4LFAL 1QWYA 4DR3L 4A3DH 1OXTA 3OIQA 4ZCKA 1EY7A 1IBKL 1LLRD 4ZUJA 2R93B 3CMAA 3AFPA 1H9JA 2UXBL 3I55A 3UE1A 2BDNA 2D5DA 4JBWA 5LMUQ 4A76A 4LF8L 3J7AF 2JP1A 2PI2A 4FYDA 4DV6Q 1LTID 1PTOB 2EDGA 3Q8DA 2B29A 1SMYC 4MN3A 3K5LA 3S1QH 1ILPA 1N33L 1V8QA 1K0RA 3S15B 4A3DG 5FO7B 2F0QA 4H7BA 2ZJQA 2NN6I 2JK8A 4LMQD 1K83B 4BY1B 2F0GA 3OSOA 3SE0A 2ICEC 2EYLA 2WB1E 3T1HL 5G3LF 3RZDB 1X9NA 1V9PA 2BA0A 1EY4A 5DAUA 1BBUA 4IPCA 4CKCA 1M4VA 3F8TA 3BDOA 1LTSD 4G7HC 3RLOA 2CHBD 2WAQE 4A3FB 1BO0A 5C4JB 4KD4A 3I4NB 4P73A 4JYAQ 1BF4A 1KRSA 3BDLA 2RDHA 3MXPA 1HZCA 5C3WA 4UY8C 4I65A 3KK7A 1S5CD 1ZYRC 3OW7A 1GXDC 2L11A 2L1BA 1CKMA 4LF6L 1SE3A 1PH2A 2RSNA 1IYJB 1KRTA 3T13A 4MIUA 5I9OA 2JA6H 2AQ1B 5I6WA 2R6GA 4MHEA 4JCVE 3GD7A 3U9SA 4NW2A 5IGCA 4B3ML 1XPRA 4DR7L 1TS4A 4KHPL 5C4XB 2E74C 1HNWQ 1SYDA 1AZPA 3TS2A 4PMWA 1KLUD 2HCIA 3NBIA 5CV9A 2N88A 3ICEA 5JVG3 2RHSB 1YITA 3R3OA 1EY9A 2L55A 4Q0FA 4TQUS 4A93B 5AFWA 3WDNA 5C0XJ 2DJGC 2E5LL 4FF4A 3K57A 4BXXH 4BA2I 1S5DD 3PUWA 2WP8J 4YY3Q 3M4PA 4HR7B 1EYAA 3S16H 1EZ8A 2NVQB 5ELFA 1XMOL 4PZ6A 4P2CB 2UUBL 3PIO3 3GTPB 1PV4A 1C9OA 2AKWB 2R7ZB 3B6YA 3D4WA 2CH4W 5LL6X 1TU2B 4JI2Q 3WOFA 2XVSA 4GKJQ 3PIP3 4GOPA 2EE1A 3I3CA 4DN4M 3K58A 4S3SA 4L8JA 3PUYA 1KTKA 5M5YH 3T4AC 2E2IH 1EYDA 1NMFA 2B2UC 5KGUA 3LWUA 1CSPA 5IYCH 4C3IG 4EQPA 1EIFA 5IOCA 4BY7H 3AMUA 4LNQA 3K0XA 3I4MH 1JICA 1Q8KA 5C5LA 4X6AH 2JSOA 3MTSA 4JBJA 2XN9C 1DONA 3CCMA 5M5WB 3H09A 4WJ3M 1JB3A 4K8IA 3NENA 3OW2A 2JA5B 4JI1L 4F7XA 2LS01 3AB9A 3D4DA 5FLXL 2MP1A 1LTRD 2I5LX 4OELB 4JBMA 2DNEA 5IYCG 1DXMA 4QL5A 1CKNA 4ZKBB 1Z7TA 1DOMA 4B9XA 5JVH3 4BY7G 4OWXB 4POGA 3I4MG 1A2UA 1Z6HA 3OTOL 3EQLC 1L0YB 4DAVA 1EQTA 1HR0Q 1HUNA 5EBCA 3L3OC 4RCOA 1VQ8A 1XWEA 3A8JE 4C3HH 3BU2A 3PGZA 4DV5L 4KLKA 3H94A 2EZVA 1T5XD 1SDFA 1GM5A 2MNAA 1LACA 5C3EB 1I50B 3CCEA 1ENFA 1X3EA 1VQNA 2K14A 2I07B 3E5SA 2DUDA 1DGSA 2Q2TA 4LF5L 1JORA 2E2HH 4DU9A 1L1OC 2YTVA 5D3IB 4CJ1B 5FOBB 3O13A 1K73C 1EY5A 2B2WC 2UXCQ 2J7ZA 2R92B 4C3HG 2RBMA 1A2TA 5ELNA 3J80c 2HDLA 3A5ZB 3CQZB 4DFAA 3DM1A 4CGYB 3HFZB 2YU9H 4IUNA 1KDBA 2EIFA 1VQHA 4DA2A 4NB3A 2F0LA 1D7QA 3RN5A 2XWJB 4JV5Q 1TR5A 3KYHC 1SBBB 2L4NA 2OT2A 2QEXA 1E2VA 2PYKA 4B3RQ 1LTLA 3MVVA 1TS2A 2YTXA 2ASBA 1QNUA 3E9HA 4O2DA 4RAUC 4GZYC 4RGOS 4AIMA 1YBYA 4QIWE 1LTBD 1GUWA 1NCVA 1FGBD 1L0XB 2V4DA 4DF7A 4CHTB 1VS0A 1SE8A 3F2BA 4FF1A 1CKOA 3X3MA 1ESFA 4A3FG 4Y7NB 1VQ6A 1UWVA 5IIFA 1JMCA 1PRTF 3HKZB 4UP8A 1YI2A 2Z9HA 3BVGA 1VDZA 2EYJA 2KCMA 3OMGA 4JC0A 3UE0A 3ZJYC 3T1YL 4LFCQ 3G6JB 4A3LH 5CBEE 3I8ZA 4NKLA 1V43A 2UUAQ 5M5XB 1BUVT 4QCLA 2LMCB 4B3SL 2KOLA 3NBHB 4LUOA 2QEJC 3L7ZC 3S1RB 3OPOA 1MD2D 1FJGQ 3SVMA 2CFMA 5H1SE 3HOWH 4DR2Q 4K6LA 1YNJD 1F2YA 3HOYH 1UAPA 1HNZL 5C4XG 2IPKD 1CI3M 1X55A 4ODGA 4G7ZC 4RFBA 2VQFQ 1Z9FA 5GROA 4A3JH 1IL8A 1BBWA 1AH9A 1F77A 4RGMA 1GUNA 1NE3A 1Q1EA 3I90A 3H91A 1I6HB 3HOUB 2NVQH 3LGJA 4GKKL 1YIJA 3KF8B 2N49A 4K0KQ 2B2VC 5I9PA 1I4XA 3DMUA 1Y1VB 3MC0B 3F2UA 4F8MA 4BBRB 2A68C 4UP9A 2ZT9C 3HOYG 2ZM6L 2TMPA 4DR1Q 3P75A 4GLVB 3GTMH 2JJQA 1L1OB 1EY0A 3OHXC 1OXXK 5AJ3L 4DR6L 4CKBA 2CWAA 3N52A 1K8AC 1LT4D 4FF2A 1VQ9A 4LF4Q 2KEEA 1JC7A 1QUQB 1VQEA 3W3AA 4K14A 2AWOA 2CCZA 4QQBX 3R8BA 1TIID 3QG1A 1Q1BA 3AEVA 3TSSA 2NUCA 2NB0A 3T16A 1LTTD 3DHQA 3S17H 5IGBA 1JJGA 5EPJA 1EY6A 4KK7A 4X64L 2DN8A 3S14H 1QILA 1O80A 4YWMA 3BYYB 1VQGA 2PO4A 1D5ZC 1XJVA 4JI8Q 4JBKA 1JE4A 1SE2A 3EFXD 4FP5D 4RGNA 3IL8A 3A54A 1E22A 1LUZA 3D8GA 1S72A 3GTLB 2OQ0A 5E1FA 2HHHQ 5EBDA 2RHQB 1BCPF 1D2BA 5JJKA 1ET6A 1Q12A 3HOVH 2JA5G 1U9RA 1OXSC 3R2IA 2BH8A 1JT8A 4TRDA 3CCJA 4GNXA 3R93A 5M3FB 4HJ5A 4IZ8A 2BOSA 2F0PA 3KLSA 2A8VA 2ALYB 1K9MC 1IZ6A 1ONLA 4R8IA 4KKSA 3OWFA 2RKSA 4L63B 4YWLA 2ATWA 3H3VI 4N9TA 1JWSD 2X6GA 2Z8LA 3MAQA 1KQSA 4LK1C 2HIXA 3HOVG 2F0EA 1PYBA 3U9OA 5HY6A 1STYA 4NPSA 1OO9B 1VQPA 1WTQA 2EY1A 1NNXA 1PMRA 3SK8A 1IKLA 1I4QA 2MHVA 4GN3B 3JAML 1MGSA 2LXKA 3C1FA 2TSSA 3W1BA 1PXUA 1EIHA 2YV5A 2L15A 2Q2UA 2EJGC 3D4RA 1QE6A 3OYYA 1D5XC 4OHJA 3H0GB 5IGEA 1H9SA 3PUXA 3BZCA 4HJ9A 4IUVA 3D6CA 3CCVA 2VUMB 3QR8A 5E4WC 3E6ZX 3VR6A 1GHJA 2B63B 1Y8NB 1XMQL 5J1ZA 3PO2H 1STHA 1VQBA 4TVAB 1Q8IA 2MFIA 4DAYA 1TWFH 5IYDH 1IW7D 2OQKA 1SJED 2XWBB 2E2JB 4IFDH 5CV8A 3MXNA 3NQTA 1B1ZA 1N36Q 1PFNA 5CV6A 3SXHA 3DWAA 2PMZB 5M5XH 4DV4L 2JYOA 2NBFA 2NTTA 1K3BC 5JEAH 1GO3E 2RDGA 5IGFA 3PO2G 4GN4B 3HKZG 1P16A 3K80C 3Q23A 3S2HH 1HZBA 5IYDG 4RWSC 5I2YA 4DR3Q 3UDGA 3GTJB 4IFDG 1IBKQ 4LWCA 1D1IA 4ILWA 1EIYB 3EIVA 1AP0A 1LT5D 3RZOB 2ICIA 4MTNA 1YNXA 2MPMA 2HCCA 1FNWA 2H4OA 3FPPA 4OWWB 2H1EA 2KHIA 1AW7A 2D0PA 4JI5L 1I6HH 1XPUA 1N32L 5JEAG 1ILQA 5DLQE 2RCFA 1F9PA 4A3EH 4KY6A 1CK1A 2CH4A 4HCEA 4IFDJ 2KCCA 1PZID 1VQJA 1YHQA 2EJFC 4HIMA 3HGBA 3I91A 2A69C 3SR1A 5E7NA 5D3DA 3AYHB 4XYOA 1S40A 4I7ZC 5M9OA 1G6ZA 4K2LA 1MIUA 3IFDA 2R7DA 2WFWA 1SN8A 5JEAJ 2ES2A 1HR0W 2JN4A 4RHSA 5K36H 1ICWA 1GOZA 2FXQA 4GLAC 1C0AA 4JI4Q 3EROA 4YHHL 4EX5A 2Q2HA 1KHIA 1N9WA 1EOTA 3TP6A 4X66L 2R61A 1TWCH 2K5VA 2ZTEA 4A3GB 2A6ED
chains in the Genus database with same CATH topology
2B8GA 4QUFA 4DXGA 4WORA 5E4XA 2BDOA 2EVBA 2WB1B 2EOTA 4RHRA 1EU3A 3M85A 5IT9E 5K36G 2M9VA 4A3BB 3S1MB 3HEJA 1NR2A 3RUZA 2SNSA 5CORA 1WTVA 1SNQA 1JWUD 4UDUC 4L6TB 1GUGA 5JPMC 1NR4A 1U4LA 4G4KA 5CBAE 2QF7A 1Q3LA 5I4DA 1QG7A 4E6IA 5C0XI 4C56C 3A8KE 3PV0A 1CTMA 1BNZA 4BBSB 4ZQ3A 3OWEB 1RF2D 3I4LA 1ESRA 2BCOA 2AQ3B 1E2WA 5C4ZA 4IUUA 2Y0SB 4HEDA 5EPLA 3HG9A 1U4MA 4CJ0B 1FD7D 2BA1A 1PTOD 4H0LC 1EIGA 2K33A 4XQJA 4IUTA 4XQNA 3NUCA 1ZEQX 2L9HA 4KMUC 2JA8B 3P7JA 3C1EA 3FVQA 2EYMA 1SEBD 2Q8IB 2CW0D 2ID0A 4NMZA 5C3XA 3DEPA 3IKJA 5EPKA 3CU7A 3C2PA 1BBXC 1FNUA 1YNND 1G2SA 2IW3A 3K5NA 1HA6A 2EPBA 1EU4A 3X3NA 2F03A 3NTIA 1DD2A 3VYTA 1XXGA 1R4PB 2C5CA 4RKBA 1MBYA 3TP8A 1EWHA 3IAYA 4CKEA 5FKAC 1LO5D 2ZXRA 2QDBA 1DOLA 2B39A 2NN6H 2XRQD 2F0MA 3NK9A 3M7NA 3BG3A 3GTGB 3VR4A 2F0IA 2FHTA 2J4XA 3BVZA 1IHZA 3WOEA 3VR3A 2GA4B 1V1PB 3NSWA 2PZUA 1XTCD 1FNVA 1PTOF 2E76C 3GTQB 3M4OB 2Z1CA 2NN6G 1JOOA 4KTAA 1LV9A 1HTLD 1OXVA 3SK5A 2SDFA 4WFN3 1JCKB 2M00A 4HN7A 3KBXA 4DGZA 1PFBA 4FXGC 3SK4A 5T1GA 1EEFD 1CZGA 1S5ED 2RQXA 1SMYD 1CT1D 1V1PA 1HXYD 4A3MB 1XYIA 1WD0A 2K01A 1TS5A 2KECA 1RHPA 1UUPA 3PO3B 1TWHB 4EVOA 3P20A 1RJTA 1PRTB 2PCFB 3TMEA 3H3VC 2F0SA 1EQVA 3SHLA 3GTOB 4O1NA 4K2KA 2G9HD 1M8AA 1Q90A 5C4HA 1PZJD 2WIIB 2AUJD 5KNCA 2F3VA 1RTOA 2NZ1D 1PTOH 4EQNA 2QILA 1I4HA 1DOKA 1RCVD 3L9AX 1SE4A 1R4QB 2A5HA 1ZYRD 4CJ2C 2HQEA 2FINB 3QWNA 1IYUA 4PV1C 1E0BA 2JEBI 1JOKA 2KHSA 3M4YA 2NVYB 1NSNS 3S9WA 2F0WA 4XXEA 1TWGB 3KUPA 3OIPA 3GV3A 4OO1I 4A3IB 2RVLA 4X3SA 4J8QA 2IJ0A 1B9MA 2DY8A 2KVMA 3SEBA 5FLXE 3MZ5A 4A3KB 4K5XA 1BR9A 4LAAA 3DUZA 3J7YW 1SNPA 1BXTA 4KI0A 5T1IA 5JJZA 5BN3A 1VMCA 2X69A 4M8AA 2JA7B 1EWCA 1B53A 4IUPA 2FMCA 3GP7A 3ITPA 3LNNA 1BCPB 2X6LA 2EY5A 4ID6A 1DYQA 2IT1A 5CGKA 4K5WA 1MSGA 2IWHA 1ET9A 1FR3A 2PW5A 3I73A 2IX1A 4X3KA 2IL8A 4KD3A 3FKIB 3M7GA 4ZYSA 1CFMA 1STGA 2B2TA 2ZXOA 4ZK9B 3T51B 4TSSA 4V0BA 3NQIA 4NP5A 3RMHA 5JPNC 1QJOA 2FFKB 3K6OA 3DWQA 4X3UA 4H44C 5ELDA 5TSSA 2A6HC 1UNSA 5EGTA 1O78A 2AUKA 3Q24A 2Q8RE 1WTWA 1H9RA 3C46A 2A74C 3VA7A 1SNOA 2SNMA 1QB5D 1R9TB 2NWGA 1GUOA 2KEDA 2WKCA 3J81L 1O7LA 1LT6D 4F87A 2L0CA 4KHVA 1TS3A 3RLFA 3VYRA 3DWPA 2K32A 1QOHA 1GUSA 3Q22A 1GUTA 4HSVA 1BDOA 3QIAA 4KJNA 1HFGA 3K0YA 1LTAD 2PZTA 4IN3A 1SYGA 4WRDA 3M3YB 1I4GA 1WVLA 2EYOA 1SFOB 3HS0C 1H9SB 5J39A 4UAIA 4A3DB 2J0TD 3MWYW 2FMMA 5DM63 1DJRD 1C48A 4PQXA 3K59A 3J80L 2K5DA 2EYFA 3ZYYX 3I72A 2QCPX 1KDAA 3S1QB 3SDZA 5EKIA 5I2XA 5J22A 2EXZA 1HHVA 4KY5A 1AFPA 1KAAA 4XT3B 5F2DA 2F0UA 3QJYA 4IQZA 4RCNA 2AQ2B 4KY7A 3VA5A 3URYA 4PMCA 2K6AA 5IGGA 3G7LA 3W2DA 2F3WA 1F9QA 4FXDA 1U4PA 3NWTA 1SYEA 1Y69U 2A68D 3HP3A 3MXGA 3RD4A 1STBA 1AN8A 1UEAB 3HZXA 1CHQD 1RTNA 1A6XA 2A6HD 5A2QL 3NP8A 4XYQA 2K1BA 1H9KA 1ML0D 1G8ZD 2LKVA 3K5MA 3QOJA 1VF5C 1HQRD 2JA6B 5K5PA 3JAME 5ELEA 3ONAB 5KRUA 3FRPB 5CV7A 3A56A 2K5WA 4NDXA 4FF3A 2NYZD 5EKLA 4O42A 3FPUB 4K5VA 1LT3D 3CRLC 1SAPA 3MA2B 4IURA 4XIGS 2OF1A 1TKWB 5FO8B 1MI2A 2JE6I 3V2TA 2D9UA 1HRJA 1NUCA 1E2ZA 4M1UB 1CM9A 2F0JA 1B50A 2D2CC 4H13C 1SNDA 5KIXA 3S16B 1KNEA 4KV6A 1RDPD 2NVXB 4LJZC 3NXWA 5G3LD 1DZ1A 2EJMA 2B8FA 3KLRA 1JQYD 2LY7A 1I4RA 2OEOA 2R3ZA 1EYCA 3VYUA 2BE5C 1T5EA 1DM0B 4J6HA 1WTRA 5M5YB 2E2IB 2WAQB 3VYSA 4QF4A 4DNRB 3KBGA 5ISRA 4RH6A 1AEXA 1HPCA 1G91A 3QO2A 3TP7A 5E3FA 2IX3A 4ZUIA 1EL0A 2IX0A 4C1NK 1J9OA 1STNA 2KQ3A 1CQFA 4DK1A 4G7OC 1B2TA 4DAPA 2F0NA 4Z9CB 2KUMA 1EY8A 3HRZC 4KKUA 2WKDA 4OL7A 4C3HB 5LL6S 3EVQA 2L12A 1PYWD 1I3QB 4HTHA 3CHBD 1MSHA 2N55A 2K5QA 3Q0AA 3UI2A 3LWEA 2E2HB 2I46A 1TY2A 4K6DA 1KDCA 1VCIA 3EA6A 2VNUD 1J8IA 1PRTC 3EJIA 3FMCA 3HOZB 4N9PA 5D14A 2YU9B 1A3TA 5KYIA 1QCBD 2F1MA 4XDXA 3TZDA 3MXUA 5D65A 2VXWA 1ENCA 1H9MA 3BZDB 2A69D 2M2LA 2E75C 4KN7C 2KJXA 4HMIA 1A15A 5C0XH 1S5FD 2EY2A 3MHBA 2KCNA 5KEEA 3CRKC 4BWGB 1GJXA 1SXTA 1LABA 1C8CA 5CC4A 1S4ZA 4B9WA 5C0XG 2HUGA 2F0HA 4PMBA 1A3UA 2BE5D 1VMPA 2Z4IA 1PZKD 1RKNA 5IODA 1STEA 3R2TA 1I6VC 1O7ZA 1WTPA 3HOWB 1HA5A 1CQVA 3TN2A 2VB3X 2F0FA 3HOYB 2ZXPA 4A3JB 4U68A 1X3QA 1B4OA 4RA8A 5KNDA 4B08A 1A3VA 1KNAA 4XTCS 3NHHA 2B2TC 2B2YA 2RA4A 1W6KA 3BDCA 3T56B 1AZQA 3GTMB 3H6MA 2K7VA 4C3JB 4ZRZA 1BCPC 1BOSA 1D5MC 1ZKOA 2WV6D 2FJ2A 4U673 1G2TA 2SOBA 3A7AB 4IUQA 1S5BD 1YNJC 5DEHA 3S17B 1FYCA 4QIWB 3ND8A 3P1HA 5CV4A 4ME5A 4R8NA 1SNMA 4ZLTF 3S14B 1F2MA 4ZAIA 1TY0A 1RODA 3NE5B 4IALA 5COYA 3C3LA 1CA6A 5ELBA 1PRTD 5EJWA 5CR3A 2L5TA 5CMDA 4ULLA 4C2MB 5FK9C 3TDQA 1F2ZA 1WTOA 3CKIB 3NTHA 3I70A 3BVMA 4RGTA 5HGTA 5HURA 1SJHD 5EKKA 3D31A 2O5JC 3HOVB 1SYCA 1B9NA 4OIJA 3K7AB 2K04A 3PMFA 4PNYA 5DM73 2XSCA 3BS1A 1CHPD 2EYHA 4F88A 4TKOB 1GHKA 2HDMA 2WACA 1Y8OB 1JOQA 2AWNA 1OXUA 3K5OA 2KA7A 3VR2A 1CA5A 4KJOA 4V190 4HSPA 3D6WA 3OMCA 1RD9D 2NTSA 1F9SA 1C4QA 3IFTA 4RKLA 4FXKC 2EY6A 2O5IC 3QB3A 4EGVA 2CQAA 5DNFA 1II3A 1Z47A 5CV5A 3PUVA 5I6YA 1K8MA 1ENAA 2F0OA 1SSOA 3PO2B 1B44D 4OGQC 1DCZA 2A73B 1TWFB 3A55A 1F9RA 4HMJA 3V05A 1PFMA 1WCMB 3GTKB 2XNAC 2F0VA 2K05A 1BCPD 2RSOA 2O4XA 2F0TA 4K8JA 1O7YA 2JXMB 3TBIB 4OO1H 3S2HB 3QOLA 1SYBA 2OXPA 3OOCA 4DK0A 1TQOA 3NTKA 4KKTA 3DEOA 2E2DC 4R9WA 2B2UA 3LX0A 2K03A 5JAVA 2LFNA 2F0KA 4A3EB 3D3RA 1EFID 2XIWA 4G57A 3MFGA 3Q6SA 4OO1G 1IW7C 1JWMD 1WD1A 1X3PA 4DNTB 4BS9A 4J1MA 1JR0D 3NPPA 4KHZA 3NBHA 2QKIC 1V1OA 1KLGD 2CVRA 3TP5A 1TT2A 2SEBD 5BN5A 1U4RA 3GQBA 4Q5VA 1TWCB 5IGDA 2PQEA 3KLSX 1HTPA 5M3MB 3ERQA 3KF8A 4C3JG 1D1KA 3A8IE 4OIKA 3HOXB 3NWSA 4QUCA 4X3TA 1SNCA 4HCSA 3MEHA 1HFNA 2B2WA 5C5MA 4IFDI 4XT1B 4C1NI 3TZUA 1VF7A 5A35A 2NVTB 4AYBB 5C44B 3AU7A 1PDQA 3J7AV 2A6EC 1F2LA 5LHY1 5BN4A 3FDTA 1PLFA 1Y8PB 1IKMA 2MJ8A 1EZ6A 4JK1C 3J81E 1HUMA 3DXJC 1K8OA 4ZKCB 1ZXTA 5ELCA 1B3AA 2ENBA 1NAPA 1HQMC 4FNFA 2G9DA 5KNBA 3E0JA 2PW7A 2WINB 1HCZA 5NUCA 4ABNA 2PZWA 1W6JA 2PNRC 3BYTB 3T53B 4XQQA 3PUZA 3J80E 3V96A 5KYLA 2DY7A 4KN4C 1QNKA 5FO9B 4CBVA 1PTOC 2B2VA 2JEAI 2C9OA 1CZWA 1TVXA 4QMGA 2YYZA 5IT9L 5EQ0A 1TWAB 2D62A 3GV6A 5C6AA 4DXFA 2RDFA 1KABA 2F4IA 1LTGD 2CW0C 1SYFA 4WJWA 1I4PA 3GO5A 3VR5A 4FVMA 2K28A 3FEWX 2O2LD 4HAEA 1BQQT 1X32A 1YNNC 2Z4HA 5A2QE 3MFYA 2EYPA 4YIJA 1IYVA 2MGSA 4C3IB 2VB2X 3S1NB 1EEID 4EQOA 1G291 1Y1WB 2F0DA 1XX8A 2Q8TA 1STAA 4QB4A 4FO2A 2XRSD 3N6RA 3A7LA 3ND9A 2MUYA 3S2DB 4BA1I 4BY7B 3I4MB 2B2YC 1D6EC 5JOBA 1WTXA 2DNCA 5CYUA 3SK6A 2PPBC 1QWYA 1OXTA 3OIQA 1EY7A 1LLRD 4ZUJA 2R93B 1H9JA 2BDNA 2D5DA 4JBWA 3J7AF 2JP1A 4FYDA 1LTID 1PTOB 2EDGA 1SMYC 4MN3A 3K5LA 1ILPA 1V8QA 3S15B 5FO7B 2F0QA 4H7BA 2NN6I 4LMQD 1K83B 4BY1B 2F0GA 3OSOA 3SE0A 2ICEC 2EYLA 5G3LF 3RZDB 2BA0A 1EY4A 5DAUA 4CKCA 1M4VA 3BDOA 1LTSD 4G7HC 2CHBD 4A3FB 1BO0A 5C4JB 4KD4A 3I4NB 1BF4A 3BDLA 2RDHA 3MXPA 5C3WA 4I65A 3KK7A 1S5CD 1ZYRC 3OW7A 1GXDC 2L11A 2L1BA 1SE3A 2RSNA 3T13A 4MIUA 5I9OA 2AQ1B 5I6WA 2R6GA 4MHEA 3GD7A 3U9SA 4NW2A 5IGCA 1TS4A 5C4XB 2E74C 1SYDA 1AZPA 4PMWA 1KLUD 2HCIA 3NBIA 5CV9A 2N88A 5JVG3 3R3OA 1EY9A 2L55A 4Q0FA 4TQUS 4A93B 5AFWA 3WDNA 5C0XJ 4FF4A 3K57A 4BA2I 1S5DD 3PUWA 2WP8J 4HR7B 1EYAA 1EZ8A 2NVQB 5ELFA 4P2CB 3GTPB 3PIO3 2R7ZB 3D4WA 5LL6X 1TU2B 3WOFA 2XVSA 3PIP3 2EE1A 3I3CA 4DN4M 3K58A 4S3SA 4L8JA 3PUYA 1KTKA 3T4AC 1EYDA 5KGUA 2B2UC 3LWUA 4C3IG 4EQPA 5IOCA 3AMUA 1JICA 5C5LA 2JSOA 3MTSA 2XN9C 1DONA 5M5WB 3H09A 1JB3A 4K8IA 2JA5B 4F7XA 2LS01 3AB9A 3D4DA 5FLXL 2MP1A 1LTRD 2DNEA 1DXMA 4ZKBB 1Z7TA 1DOMA 4B9XA 5JVH3 1A2UA 1Z6HA 3EQLC 1L0YB 4DAVA 1EQTA 1HUNA 5EBCA 3L3OC 4RCOA 1XWEA 3A8JE 3H94A 2EZVA 1T5XD 1SDFA 1LACA 5C3EB 1I50B 1ENFA 2I07B 3E5SA 1JORA 4DU9A 5D3IB 4CJ1B 5FOBB 3O13A 1EY5A 2B2WC 2J7ZA 2R92B 4C3HG 2RBMA 1A2TA 2HDLA 4DFAA 3CQZB 3DM1A 4CGYB 4IUNA 1KDBA 4DA2A 2F0LA 2XWJB 1TR5A 1SBBB 2L4NA 2OT2A 1E2VA 2PYKA 3MVVA 1TS2A 1QNUA 4RAUC 4GZYC 4RGOS 1LTBD 1GUWA 1NCVA 1FGBD 1L0XB 2V4DA 4DF7A 4CHTB 4FF1A 3X3MA 1ESFA 4Y7NB 5IIFA 1PRTF 3HKZB 3BVGA 1VDZA 2EYJA 3OMGA 3G6JB 5CBEE 3I8ZA 4NKLA 1V43A 5M5XB 1BUVT 4QCLA 2LMCB 2KOLA 2QEJC 3L7ZC 3S1RB 3OPOA 1MD2D 3SVMA 4K6LA 1YNJD 1F2YA 1UAPA 2IPKD 1CI3M 4ODGA 4G7ZC 4RFBA 1IL8A 1F77A 4RGMA 1GUNA 1Q1EA 3I90A 3H91A 1I6HB 3HOUB 2B2VC 5I9PA 1I4XA 3DMUA 1Y1VB 3MC0B 3F2UA 4F8MA 4BBRB 2A68C 2ZT9C 2TMPA 3P75A 1EY0A 3OHXC 1OXXK 4CKBA 3N52A 4FF2A 1LT4D 2KEEA 1JC7A 3W3AA 4K14A 2AWOA 3R8BA 1TIID 3QG1A 1Q1BA 3TSSA 2NUCA 2NB0A 3T16A 1LTTD 3DHQA 5IGBA 5EPJA 1EY6A 4KK7A 2DN8A 1QILA 1O80A 3BYYB 2PO4A 1D5ZC 1JE4A 1SE2A 3EFXD 4FP5D 4RGNA 3IL8A 3A54A 3D8GA 3GTLB 5E1FA 5EBDA 1BCPF 1D2BA 1ET6A 1Q12A 1U9RA 1OXSC 3R2IA 4TRDA 3R93A 5M3FB 4IZ8A 2BOSA 2F0PA 3KLSA 1ONLA 4R8IA 4KKSA 3OWFA 2RKSA 4L63B 4N9TA 1JWSD 2X6GA 2Z8LA 3MAQA 4LK1C 2F0EA 3U9OA 1STYA 1OO9B 1WTQA 2EY1A 1PMRA 3SK8A 1IKLA 1I4QA 2MHVA 3JAML 1MGSA 3C1FA 2TSSA 1PXUA 1EIHA 2EJGC 3D4RA 1QE6A 1D5XC 4OHJA 3H0GB 5IGEA 1H9SA 3PUXA 4IUVA 3D6CA 2VUMB 5E4WC 3E6ZX 3VR6A 1GHJA 2B63B 1Y8NB 5J1ZA 1STHA 1Q8IA 4DAYA 1IW7D 1SJED 2XWBB 2E2JB 4IFDH 5CV8A 3MXNA 3NQTA 1B1ZA 1PFNA 5CV6A 3SXHA 3DWAA 2PMZB 2JYOA 2NBFA 2NTTA 5JEAH 2RDGA 5IGFA 3Q23A 4RWSC 5I2YA 3GTJB 4IFDG 1D1IA 4ILWA 1AP0A 1LT5D 3RZOB 2ICIA 2MPMA 2HCCA 1FNWA 2H4OA 3FPPA 2H1EA 1AW7A 5JEAG 1ILQA 1F9PA 4KY6A 1CK1A 4HCEA 4IFDJ 2KCCA 1PZID 2EJFC 3HGBA 3I91A 2A69C 3SR1A 5D3DA 4XYOA 4I7ZC 5M9OA 1G6ZA 4K2LA 3IFDA 5JEAJ 4RHSA 5K36H 1ICWA 1GOZA 3EROA 1EOTA 3TP6A 2R61A 4A3GB 2A6ED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY7 A;  3E5S A;  3NHH A;  3SHL A;  4K2K A;  4RKL A;  5IGD A;  4WOR A;  4ZUJ A;  1JOR A;  2OF1 A;  2PQE A;  4DU9 A;  5KYL A;  5C4H A;  3BDC A;  3R3O A;  1EY9 A;  3ERQ A;  2EY6 A;  3P75 A;  2PW5 A;  3QB3 A;  3V2T A;  1EY5 A;  3HEJ A;  1EY0 A;  4KD3 A;  5IGE A;  2F3V A;  3H6M A;  2RBM A;  1A2T A;  1II3 A;  4EQN A;  1NUC A;  4K6D A;  5CV5 A;  3D6C A;  3RUZ A;  1KDC A;  2SNS A;  4QMG A;  4DFA A;  1STG A;  4RKB A;  1SNQ A;  2EYF A;  3EJI A;  5I6Y A;  4K14 A;  3TP8 A;  1EYA A;  1SNC A;  1KDB A;  2F0J A;  4IUN A;  4N9P A;  1EZ8 A;  1A3T A;  1KDA A;  1SND A;  2F0L A;  5J1Z A;  2HQE A;  5KIX A;  1ENA A;  2F0O A;  2NUC A;  1STH A;  3MEH A;  5KYI A;  2F0Q A;  2SOB A;  4H7B A;  3T16 A;  5C6A A;  2QDB A;  1TR5 A;  3DHQ A;  2EXZ A;  4KV6 A;  4NP5 A;  5J22 A;  5IGB A;  1ENC A;  3D4W A;  4KY5 A;  5C5M A;  3NXW A;  2RDF A;  2PYK A;  1EY6 A;  5DEH A;  2F0M A;  3NK9 A;  3MVV A;  5CV8 A;  1KAA A;  2F0G A;  3OSO A;  3P1H A;  5CV4 A;  2F0I A;  3NQT A;  1KAB A;  4HMJ A;  4ME5 A;  5F2D A;  4R8N A;  1SNM A;  5CV6 A;  3SXH A;  2EYL A;  1SYF A;  1F2M A;  1IHZ A;  1JOK A;  2KHS A;  2OEO A;  2F0U A;  1EYC A;  4E6I A;  4HMI A;  5EGT A;  2F0V A;  4KY7 A;  2PZU A;  4IAL A;  3VA5 A;  1EY4 A;  4S3S A;  4DF7 A;  1NSN S;  5DAU A;  4PMC A;  4F8M A;  5IGG A;  3S9W A;  2O4X A;  2F0W A;  2F0T A;  4K8J A;  5IGF A;  5CR3 A;  4ZQ3 A;  4J6H A;  3D8G A;  1EYD A;  5E1F A;  5KGU A;  1F2Z A;  2EY2 A;  2F3W A;  3MHB A;  4QF4 A;  1EZ6 A;  1JOO A;  3QOL A;  5IIF A;  1SYE A;  5KEE A;  1SYB A;  4KTA A;  4EQP A;  5C4Z A;  2OXP A;  5HGT A;  5IOC A;  2EYJ A;  2EYP A;  5ISR A;  5HUR A;  3OMG A;  3SK5 A;  1STB A;  4YIJ A;  1TQO A;  1SNO A;  3MZ5 A;  1AEX A;  2SNM A;  1U9R A;  4K5X A;  4KD4 A;  5EKK A;  5C5L A;  3HZX A;  4LAA A;  4TRD A;  1SYC A;  2M00 A;  4EQO A;  5CC4 A;  4DGZ A;  3BDL A;  4IZ8 A;  4B9W A;  1SNP A;  2ENB A;  2F0P A;  2F0D A;  3MXP A;  3LX0 A;  4K8I A;  3SK4 A;  2F0H A;  4NKL A;  5JAV A;  5C3W A;  3PMF A;  4I65 A;  4PNY A;  4PMB A;  4KY6 A;  4F7X A;  3D4D A;  3TP7 A;  1A3U A;  2F0K A;  3NP8 A;  5E3F A;  3OWF A;  2RKS A;  4ZUI A;  4G57 A;  2EYH A;  1RKN A;  1STA A;  4N9T A;  5IOD A;  4KHV A;  3NUC A;  2LKV A;  3T13 A;  4MIU A;  4QB4 A;  3SR1 A;  5I9O A;  1STN A;  2KQ3 A;  3QOJ A;  4J1M A;  2WAC A;  4B9X A;  5M9O A;  1A2U A;  1F2Y A;  1JOQ A;  4K2L A;  5I6W A;  2F0E A;  3U9O A;  5K5P A;  3C1E A;  4KJN A;  2F0F A;  1STY A;  2EYM A;  2PW7 A;  5KRU A;  4ODG A;  2F0N A;  5IGC A;  3ITP A;  5CV7 A;  5NUC A;  4NDX A;  2EY1 A;  1EY8 A;  2PZT A;  2PZW A;  5JOB A;  3SK8 A;  4EVO A;  3TP5 A;  4OL7 A;  4KJO A;  1TT2 A;  1SYD A;  4NMZ A;  1SYG A;  4WRD A;  3ERO A;  5C3X A;  5EKL A;  2EY5 A;  1A3V A;  4ID6 A;  3TP6 A;  3SK6 A;  3EVQ A;  2EYO A;  3C1F A;  3DMU A;  3OMC A;  4K5V A;  5I9P A;  3TME A;  5CV9 A;  4HTH A;  5J39 A;  5CGK A;  4K5W A;  2F0S A;  1EQV A; 
#chains in the Genus database with same CATH topology
 2B8G A;  5M3M H;  4QUF A;  4DXG A;  4WOR A;  4HJ7 A;  5E4X A;  1CSQ A;  2E8G A;  2BDO A;  2EVB A;  2WB1 B;  2EOT A;  4RHR A;  1EU3 A;  3M85 A;  5IT9 E;  1YJN A;  5EAY A;  4CDD C;  5K36 G;  2M9V A;  4A3B B;  3S1M B;  3HEJ A;  3HOX H;  1I94 L;  5BR8 L;  1NR2 A;  3RUZ A;  4ALP A;  2SNS A;  5COR A;  1HZA A;  1WTV A;  1SNQ A;  4B3T Q;  2OTL A;  4GOP C;  2MO0 A;  1JWU D;  4UDU C;  2K4K A;  5GAH C;  1T9H A;  1P8L A;  5M3M G;  4L6T B;  1GUG A;  5JPM C;  4JI3 L;  4GLX A;  1NR4 A;  1U4L A;  1WTH A;  2QA4 A;  1IL2 A;  3A0J A;  5LMN L;  2VQE L;  2NVT H;  3HOX G;  2VZA A;  4G4K A;  5CBA E;  5C44 H;  2QF7 A;  1Q3L A;  5I4D A;  4WJ4 A;  2VS1 A;  1QG7 A;  4R1J A;  4E6I A;  4B3M Q;  4DR7 Q;  4CDC C;  5C0X I;  4KHP Q;  4C56 C;  1VQ4 A;  3A8K E;  3PV0 A;  1CTM A;  1BNZ A;  4BBS B;  4ZQ3 A;  2UXD L;  2QDL A;  3OWE B;  1RF2 D;  1KD1 C;  3I4L A;  1ESR A;  3JAM i;  2BCO A;  2AQ3 B;  1E2W A;  4YWK A;  5C4Z A;  4IUU A;  2Y0S B;  4AYB G;  4HED A;  5EPL A;  3HG9 A;  1U4M A;  5M3F G;  5C44 G;  1N8R C;  4CJ0 B;  1FD7 D;  2BA1 A;  1VQC A;  1PTO D;  4MTK A;  1X6O A;  4H0L C;  1EIG A;  3ULJ A;  1JJC B;  2K33 A;  4XQJ A;  4DR4 L;  4IUT A;  4XQN A;  4JI6 Q;  4X62 L;  3NUC A;  1ZEQ X;  4DV1 L;  2L9H A;  2GN5 A;  4KMU C;  2JA8 B;  4OX9 Q;  1S3O A;  3P7J A;  3C1E A;  3FVQ A;  2EYM A;  1SEB D;  1NBW A;  4X65 Q;  2Q8I B;  2CW0 D;  2ID0 A;  2VUM H;  1PH1 A;  3K81 C;  4NMZ A;  5C3X A;  4DR5 L;  4HIO A;  3DEP A;  4DKA C;  3IKJ A;  1N34 L;  5EPK A;  4LF7 Q;  1PHJ A;  3CU7 A;  3C2P A;  4PZ8 A;  2E2J H;  3E0E A;  1BBX C;  3H0G G;  1KXL A;  1FNU A;  1K3R A;  1YNN D;  4I7A A;  1G2S A;  2IW3 A;  3J81 j;  3K5N A;  4CDF C;  1HA6 A;  2EPB A;  1EU4 A;  3X3N A;  1IXR A;  3IRB A;  4N8X 1;  2VUM G;  2F03 A;  3NTI A;  2AMC B;  1DD2 A;  3VYT A;  1XXG A;  3CCR A;  2NZO A;  1R4P B;  3L0O A;  2C5C A;  4RKB A;  1TWA H;  1MBY A;  5ELO A;  3TP8 A;  3FP9 A;  3GDE A;  3KF6 A;  2NZH A;  4P72 A;  1EWH A;  4GOP B;  1J5E Q;  2K52 A;  3IAY A;  2HD3 A;  1CUK A;  4CKE A;  3GTJ H;  1AE2 A;  5IY0 A;  5FKA C;  1LO5 D;  2ZXR A;  2QDB A;  1DOL A;  2B39 A;  2NN6 H;  2XRQ D;  2F0M A;  3NK9 A;  3KJO A;  3M7N A;  3BG3 A;  3GTG B;  3VR4 A;  3OTO Q;  2F0I A;  2FHT A;  2J4X A;  3BVZ A;  4DV6 L;  4HID A;  1IHZ A;  3WOE A;  3VR3 A;  2GA4 B;  1V1P B;  3NSW A;  2PZU A;  3AQQ A;  5IWA Q;  1XTC D;  1PYS B;  1FNV A;  1PTO F;  2E76 C;  3PF4 A;  3GTQ B;  3M4O B;  2Z1C A;  2DJF C;  2NN6 G;  1JOO A;  4KTA A;  1LV9 A;  1HTL D;  1OXV A;  4MNO A;  3SK5 A;  2SDF A;  4C3I H;  4WFN 3;  3S1N H;  1Y1W H;  1JCK B;  2M00 A;  4HN7 A;  3KBX A;  4DGZ A;  1PFB A;  1CKN B;  4FXG C;  3SK4 A;  5T1G A;  1EEF D;  1CZG A;  1S5E D;  2RQX A;  2IHE A;  1SMY D;  1CT1 D;  2K5H A;  1V1P A;  1HXY D;  4A3M B;  3S2D H;  1XYI A;  1WD0 A;  2K01 A;  1Y1W G;  1TS5 A;  2KEC A;  4JYA L;  2RF4 A;  1AE3 A;  1U0L A;  1RHP A;  1UUP A;  3PO3 B;  3RNU A;  3SGI A;  1PH7 A;  1TWH B;  4EVO A;  5IP7 H;  3J81 c;  3P20 A;  4DAM A;  1RJT A;  1PRT B;  2PCF B;  2ZJR A;  3TME A;  1IBM L;  4LFB Q;  2F4V L;  3H3V C;  3PQI A;  5JJL A;  2F0S A;  1EQV A;  1A62 A;  3ERS X;  3SHL A;  3GTO B;  4O1N A;  2R93 H;  4K2K A;  2G9H D;  1M8A A;  1Q90 A;  4YCV A;  5C4H A;  3KJP A;  3VDY A;  1PZJ D;  2WII B;  2AUJ D;  5KNC A;  2F3V A;  3PSI A;  1RTO A;  3CCL A;  2NZ1 D;  1PTO H;  1VQD A;  5IP7 G;  2QIL A;  4EQN A;  1I4H A;  4QGU A;  1DOK A;  1RCV D;  4NXN Q;  3L9A X;  1SE4 A;  3G4S A;  3S15 H;  1R4Q B;  1X54 A;  2I5H A;  2A5H A;  1ZYR D;  4CJ2 C;  2HQE A;  3U58 A;  3S24 A;  2R93 G;  4IJH A;  2H5X A;  1QVG A;  4DK3 C;  3CCQ A;  2FIN B;  1K83 H;  4DV7 Q;  1WI5 A;  4BY1 H;  3QWN A;  1IYU A;  1KL9 A;  4PV1 C;  1VQM A;  1E0B A;  2JEB I;  1HNZ Q;  2N3S A;  2R7F A;  4N8F A;  3RZD H;  1JOK A;  1FGU A;  2KHS A;  4HJA A;  3M4Y A;  2BH2 A;  2XTI A;  2NVY B;  1NSN S;  3S9W A;  4LUZ A;  2F0W A;  4XXE A;  1TWG B;  3KUP A;  4GKK Q;  3OIP A;  4GNX C;  3GV3 A;  1H95 A;  4OO1 I;  4A3I B;  2Y0S G;  1MJC A;  2RVL A;  4BY1 G;  4X3S A;  4JI2 L;  4A3F H;  5C4J H;  4GKJ L;  4J8Q A;  4Y52 H;  2IJ0 A;  1B9M A;  2DY8 A;  3U4V A;  3I7F A;  3I4N H;  2KVM A;  3SEB A;  5FLX E;  3MZ5 A;  4LF9 Q;  4A3K B;  4K5X A;  1BR9 A;  1G6P A;  4LAA A;  3DUZ A;  3NEL A;  3J7Y W;  4H02 A;  1SNP A;  1BXT A;  4NXM L;  4KI0 A;  5T1I A;  5AJ3 Q;  4R4T A;  2CWP A;  5JJZ A;  1M1K C;  5BN3 A;  1VMC A;  2JA8 G;  2X69 A;  4M8A A;  2JA7 B;  4IPH A;  1EWC A;  4R4Q A;  3I4N G;  1NY4 A;  2Z6K A;  1A0I A;  4DV0 L;  1B53 A;  4IUP A;  2FMC A;  3GP7 A;  5C4X H;  4A3C H;  3ITP A;  3LNN A;  1HNX Q;  1BCP B;  1BVS A;  4JVZ A;  3E3X A;  2X6L A;  2EY5 A;  1PFS A;  4ID6 A;  1YHA A;  4JI0 Q;  1DYQ A;  2LXJ A;  2IT1 A;  5CGK A;  4K5W A;  1MSG A;  3KFU A;  2IWH A;  1ET9 A;  4A93 H;  1FR3 A;  2PW5 A;  3I73 A;  2IX1 A;  4X3K A;  4A3C G;  2IL8 A;  2QW7 A;  4KD3 A;  3FKI B;  4JI7 Q;  2OWO A;  3M7G A;  4GS3 A;  4ZYS A;  1CFM A;  1STG A;  2B2T A;  5IT9 c;  2UUC Q;  2ZXO A;  4ZK9 B;  3T51 B;  3GTP H;  3TEH B;  5FLM G;  4TSS A;  2R7Z H;  4V0B A;  3NQI A;  4NP5 A;  3RMH A;  5JPN C;  1QJO A;  5FJ8 H;  2FFK B;  4A93 G;  3K6O A;  3J7Z C;  3CD6 A;  2UXC L;  3F2D A;  1LYL A;  3DWQ A;  4X3U A;  4DV3 Q;  4H44 C;  5ELD A;  5TSS A;  2A6H C;  1UNS A;  1E1T A;  1VQL A;  5EGT A;  4DUY L;  4P74 A;  1O78 A;  2AUK A;  1VQK A;  3Q24 A;  2Q8R E;  2R7Z G;  4JV5 L;  1EQR A;  5FJ8 G;  4GNX B;  3TS0 A;  2GVB A;  1WTW A;  2Z6B A;  1H9R A;  1XNR L;  3C46 A;  2A74 C;  3K8A A;  3HKZ E;  3VA7 A;  1SNO A;  2SNM A;  1QB5 D;  1WYD A;  3PO3 H;  5M5W H;  1WFQ A;  2JA5 H;  1R9T B;  1PVO A;  2NWG A;  1GUO A;  2KED A;  2WKC A;  3J81 L;  1O7L A;  2QGQ A;  2Q2I A;  1LT6 D;  4F87 A;  2L0C A;  3HKS A;  4KHV A;  1TS3 A;  3RLF A;  3VYR A;  3DWP A;  2K32 A;  1QOH A;  1GUS A;  3Q22 A;  1GUT A;  1QZH A;  5GQO A;  4HSV A;  3PO3 G;  1BDO A;  3QIA A;  4KJN A;  4LFC L;  1HFG A;  3K0Y A;  1LTA D;  2UUA L;  3A74 A;  2PZT A;  4IN3 A;  4DV4 Q;  5C3E H;  1SYG A;  4WRD A;  3M3Y B;  2KCT A;  1TXY A;  1I50 H;  1I4G A;  1WVL A;  2EYO A;  5GAD C;  1SFO B;  3HS0 C;  1H9S B;  5J39 A;  4UAI A;  4DR2 L;  4A3D B;  2J0T D;  3MWY W;  2VQF L;  3ULL A;  3CC7 A;  4JW0 A;  2FMM A;  2R92 H;  5DM6 3;  1DJR D;  1C48 A;  4PQX A;  3K59 A;  3CQZ H;  4DAY B;  5C3E G;  3J80 L;  2K5D A;  4AQY L;  4K0K L;  2EYF A;  3ZYY X;  3I72 A;  1EFW A;  2QCP X;  1XTD A;  3MXN B;  1KDA A;  3S1Q B;  3SDZ A;  5EKI A;  5I2X A;  5J22 A;  2EXZ A;  1HHV A;  4KY5 A;  4A3K H;  2R92 G;  1AFP A;  1KAA A;  4XT3 B;  5F2D A;  3F1Z A;  3BJU A;  1FL0 A;  2F0U A;  3QJY A;  4IQZ A;  4RCN A;  4LF4 L;  2AQ2 B;  4KY7 A;  3VA5 A;  3URY A;  4PMC A;  2HIV A;  2K6A A;  5IGG A;  1PH4 A;  3G7L A;  3W2D A;  4Y7N H;  2F3W A;  1F9Q A;  4FXD A;  1U4P A;  3NWT A;  2CKZ B;  4A3K G;  1SYE A;  1Y69 U;  2A68 D;  3HP3 A;  3MXG A;  3RD4 A;  1STB A;  1AN8 A;  1NMG A;  1UEA B;  1OTC A;  4JI8 L;  2F3I A;  3HZX A;  1CHQ D;  1RTN A;  1B70 B;  2XGT A;  1VQ5 A;  3PCO B;  1A6X A;  2A6H D;  5BR8 Q;  5A2Q L;  1PH3 A;  4ME3 A;  4AYB E;  3L2P A;  2HHH L;  3NP8 A;  4XYQ A;  2CQO A;  2KHJ A;  2K1B A;  1H9K A;  3S1R H;  1EOV A;  1ML0 D;  3H3V H;  1G8Z D;  2LKV A;  3K5M A;  4LFA Q;  3UDI A;  3QOJ A;  1VF5 C;  1HQR D;  2JA6 B;  5K5P A;  3FKI H;  3JAM E;  4JI3 Q;  5ELE A;  2YTY A;  3ONA B;  5KRU A;  2UXB Q;  3FRP B;  5CV7 A;  3A56 A;  2K5W A;  4NDX A;  1EQQ A;  3HOU H;  4LF8 Q;  1SLJ A;  2ZTC A;  4FF3 A;  1W3S A;  2NYZ D;  5EKL A;  2UU9 L;  4O42 A;  1Y1V H;  3FPU B;  4K5V A;  2UXD Q;  4BBR H;  1N33 Q;  1LT3 D;  3CRL C;  1YJ9 A;  1SAP A;  3MA2 B;  4IUR A;  4XIG S;  2OF1 A;  1TKW B;  3FKI G;  5FO8 B;  1MI2 A;  2JE6 I;  3V2T A;  2D9U A;  3HOU G;  1HRJ A;  4DV2 L;  3KOJ A;  1NUC A;  3T1H Q;  2GVA A;  4J15 A;  1E2Z A;  4M1U B;  4DPG A;  1JE5 A;  1Y1V G;  1CM9 A;  2F0J A;  1B50 A;  2D2C C;  4H13 C;  1LM0 A;  1SND A;  4BBR G;  5KIX A;  3J81 i;  3S16 B;  1GVP A;  1KNE A;  4KV6 A;  4OEM B;  1RDP D;  4JOI A;  2NVX B;  4LJZ C;  1IBL L;  3NXW A;  5G3L D;  1DZ1 A;  2EJM A;  2B8F A;  3KLR A;  1J6Q A;  1JQY D;  2LY7 A;  2K50 A;  1I4R A;  1UE6 A;  5GAE C;  2OEO A;  4EQ5 A;  2R3Z A;  1XNQ L;  1EYC A;  3VYU A;  3ULP A;  4QJF A;  2BE5 C;  2PMZ E;  3GTL H;  1T5E A;  1DM0 B;  4J6H A;  1WTR A;  5M5Y B;  3D0F A;  4LF6 Q;  2E2I B;  2WAQ B;  3VYS A;  4QF4 A;  3M9B A;  4DNR B;  3KBG A;  3TQY A;  2VW9 A;  3CME A;  5ISR A;  1N36 L;  2MQH A;  4RH6 A;  2EQS A;  1AEX A;  1Q81 C;  2PQA B;  5M3F H;  3CPW A;  1HPC A;  3KDF B;  1G91 A;  1VQI A;  1KC8 C;  3QO2 A;  1K28 A;  5FLX c;  3TP7 A;  1SFO H;  5E3F A;  2IX3 A;  4ZUI A;  1EL0 A;  2IX0 A;  1RIP A;  3J80 i;  4IOA A;  4OXP A;  1U5K A;  4DNI A;  1PH8 A;  4C1N K;  1J9O A;  1STN A;  2KQ3 A;  1CQF A;  4LUV A;  1VQO A;  4DK1 A;  1X3F A;  4G7O C;  1UE1 A;  1B2T A;  4DAP A;  2F0N A;  3BZK A;  4Z9C B;  2KUM A;  1EY8 A;  1GKH A;  2E5L Q;  2OCE A;  3HRZ C;  4KKU A;  2WKD A;  4JPB W;  4OL7 A;  4C3H B;  1X3G A;  5LL6 S;  3EVQ A;  2L12 A;  1PYW D;  2PQA A;  1I3Q B;  3KDF A;  4HTH A;  1PH9 A;  3CHB D;  1K0S A;  1MSH A;  1XMO Q;  2N55 A;  1MKH A;  2K5Q A;  3Q0A A;  2UUB Q;  3UI2 A;  3H0G H;  3LWE A;  2PI2 E;  3H15 A;  2E2H B;  4IPG A;  3KF6 B;  2I5M X;  2I46 A;  1HH2 P;  2N8N A;  1TY2 A;  1VQ7 A;  1Q86 C;  1L2F A;  4K6D A;  4JI4 L;  1KDC A;  1VCI A;  3EA6 A;  3DLL A;  2VNU D;  1J8I A;  1PRT C;  3EJI A;  3G6E A;  4RMF A;  2B63 H;  3FMC A;  3HOZ B;  4N9P A;  5D14 A;  1EWI A;  2YU9 B;  1A3T A;  5KYI A;  1QCB D;  2F1M A;  4XDX A;  4R4C A;  3TZD A;  2MO1 A;  3MXU A;  5D65 A;  2VXW A;  1ENC A;  1H9M A;  3BZD B;  2JQO A;  1SMX A;  2A69 D;  3WWV A;  3M4Q A;  2M2L A;  1L0W A;  2E75 C;  2F52 A;  2RCN A;  2B3G A;  4DUZ L;  4KN7 C;  2KJX A;  4HMI A;  4B3T L;  1EYG A;  1A15 A;  4IOC A;  2B63 G;  5C0X H;  4HIK A;  4JI1 Q;  1S5F D;  2EY2 A;  3MHB A;  4P75 A;  2KCN A;  1IBM Q;  4L5S A;  2F4V Q;  1A8V A;  5KEE A;  3CRK C;  3RZO H;  4BWG B;  1E1O A;  1GJX A;  1SXT A;  1LAB A;  5LMU L;  2Y0S E;  1C8C A;  5CC4 A;  1S4Z A;  4B9W A;  2Z6K C;  5C0X G;  2HUG A;  2F0H A;  1NTG A;  4PMB A;  1A3U A;  2BE5 D;  4DV5 Q;  1WOC A;  1VMP A;  2K75 A;  2Z4I A;  1PZK D;  1RKN A;  5IOD A;  2JA6 G;  1STE A;  3R2T A;  4P71 A;  1W2B A;  1I6V C;  1O7Z A;  1WTP A;  3HOW B;  1HA5 A;  1CQV A;  3TN2 A;  4LF5 Q;  2DGY A;  2VB3 X;  2F0F A;  3HOY B;  2ZXP A;  4HJ8 A;  2VY3 A;  3TRE A;  4A3J B;  4U68 A;  1X3Q A;  1B4O A;  4RA8 A;  5KND A;  4B08 A;  4JI6 L;  1A3V A;  4A3G H;  1KNA A;  2NVX H;  4XTC S;  3NHH A;  2B2T C;  1UEB A;  2A1A A;  2B2Y A;  3PF5 A;  4OX9 L;  2RA4 A;  1VQF A;  1W6K A;  3BDC A;  1VQA A;  4APV A;  4A3B H;  3T56 B;  1AZQ A;  3S1M H;  4X65 L;  4BXX G;  3GTM B;  3H6M A;  2K7V A;  4C3J B;  5IYB H;  4ZRZ A;  1BCP C;  1BOS A;  1D5M C;  1ZKO A;  4NXM Q;  4GN5 A;  2WV6 D;  3K7U C;  4LF7 L;  4A3G G;  2FJ2 A;  4U67 3;  3G48 A;  1D8L A;  1G2T A;  2SOB A;  1E3P A;  1NJI C;  2WB1 G;  3A7A B;  4IUQ A;  3A5U A;  2D0O A;  1S5B D;  1YNJ C;  3RLN A;  5DEH A;  4A3B G;  3S17 B;  1FYC A;  4QIW B;  3ND8 A;  1I5F A;  2LSS A;  3P1H A;  5CV4 A;  4ME5 A;  4DK6 C;  4R8N A;  1SNM A;  4ZLT F;  4DV0 Q;  3S14 B;  1F2M A;  4ZAI A;  5IYB G;  1TY0 A;  1ROD A;  3T1Y Q;  4YCU A;  3NE5 B;  1HNW L;  4IAL A;  5COY A;  1JJ2 A;  3C3L A;  4BBS H;  1CA6 A;  5ELB A;  1J5E L;  2WAQ G;  1PRT D;  5EJW A;  5CR3 A;  2L5T A;  5CMD A;  4ULL A;  1C7Y A;  4C2M B;  5FK9 C;  3TDQ A;  4B3S Q;  1F2Z A;  1WTO A;  1A63 A;  3CKI B;  3NTH A;  3I70 A;  3EN2 A;  3BVM A;  3NEM A;  4RGT A;  1ASZ A;  1Y14 B;  5HGT A;  5HUR A;  1SJH D;  5EKK A;  3D31 A;  2O5J C;  3HOV B;  1PH5 A;  1BKB A;  1SYC A;  1B9N A;  4A4I A;  4OIJ A;  3K7A B;  2K04 A;  4BBS G;  4YY3 L;  5IWA L;  3PMF A;  4PNY A;  3RN2 A;  1I3Q H;  5DM7 3;  2XSC A;  3BS1 A;  1CHP D;  2EYH A;  4F88 A;  2HQL A;  3CXC A;  4TKO B;  1GHK A;  4PG3 A;  2HDM A;  2JA8 H;  2WAC A;  1Y8O B;  1JOQ A;  1B3Q A;  2AWN A;  1OXU A;  3K5O A;  1M90 C;  2ZM6 Q;  2KA7 A;  5LMN W;  3VR2 A;  1CA5 A;  3HOZ H;  4KJO A;  3CPF A;  4DUY Q;  4HSP A;  4V19 0;  4DR6 Q;  3JAM c;  1O7I A;  3CC4 A;  1WJJ A;  3D6W A;  3OMC A;  1RD9 D;  2NTS A;  1F9S A;  1YHB A;  4UP7 A;  1B7Y B;  1C4Q A;  3IFT A;  4RKL A;  2K5N A;  1G51 A;  1SRO A;  4FXK C;  3I2Z A;  2EY6 A;  1XNR Q;  3DM3 A;  3UDF A;  2O5I C;  3QB3 A;  4EGV A;  4X64 Q;  1GD7 A;  2CQA A;  5DNF A;  1II3 A;  3HOZ G;  1Z47 A;  4R4I A;  5CV5 A;  2PNH A;  4LW1 A;  3PUV A;  1YEZ A;  5I6Y A;  4LFB L;  2ZJP A;  1K8M A;  3U50 C;  2I0Q A;  1ENA A;  2F0O A;  1SSO A;  3CAM A;  3PO2 B;  1B44 D;  4OGQ C;  5FLM H;  1DCZ A;  2A73 B;  1TWF B;  3GTG H;  1HR0 L;  3A55 A;  1F9R A;  4HMJ A;  3RR5 A;  3V05 A;  1PH6 A;  1PFM A;  1WCM B;  4NXN L;  3GTK B;  2XNA C;  2F0V A;  2K05 A;  1BCP D;  1QVC A;  2RSO A;  2O4X A;  3GTQ H;  2F0T A;  3EBE A;  4K8J A;  3AFQ A;  5GAG C;  2ZTD A;  3M4O H;  1O7Y A;  2JXM B;  1KIX A;  3TBI B;  1SR3 A;  4DV7 L;  4OO1 H;  3S2H B;  4IO9 A;  3QOL A;  1X65 A;  1SYB A;  3ER0 A;  2IY5 B;  2OXP A;  3OOC A;  3U4Z A;  3E9I A;  5J3B A;  4DK0 A;  1TQO A;  3I56 A;  3NTK A;  4FDB A;  4A3L G;  4KKT A;  3DEO A;  2E2D C;  4R9W A;  2B2U A;  3LX0 A;  2K03 A;  5JAV A;  2LFN A;  4AQY Q;  2F0K A;  4A3E B;  3D3R A;  1EFI D;  2XIW A;  4G57 A;  3MFG A;  3Q6S A;  5IE8 A;  3HOW G;  4OO1 G;  1IW7 C;  1JWM D;  1WD1 A;  1X3P A;  3W1G A;  4DNT B;  4A3M H;  4B3R L;  4BS9 A;  4J1M A;  4PZ7 A;  4LF9 L;  1JR0 D;  3NPP A;  4A3J G;  4KHZ A;  3NBH A;  2QKI C;  3CC2 A;  1V1O A;  4C3J H;  1XPO A;  1TWH H;  3CCS A;  2KBN A;  1KLG D;  2CVR A;  3TP5 A;  1TT2 A;  2SEB D;  5BN5 A;  2EXD A;  1U4R A;  3GQB A;  4Q5V A;  3GTO H;  4A3M G;  1TWC B;  1XMQ Q;  5IGD A;  4MZ9 A;  1Q7Y C;  2PQE A;  3KLS X;  1HTP A;  5M3M B;  3ERQ A;  3KF8 A;  4C3J G;  4IPD A;  1D1K A;  3A8I E;  4OIK A;  1HNX L;  4JOI C;  1QZG A;  3HOX B;  3J7A 5;  3NWS A;  4QUC A;  4JI0 L;  4X3T A;  2KEN A;  4C2M H;  1SNC A;  3STB C;  4HCS A;  1YVC A;  1L1O A;  4JG2 A;  1FJG L;  3MEH A;  1HFN A;  3CP0 A;  2B2W A;  4CDE C;  1HJP A;  5C5M A;  4IFD I;  4XT1 B;  4C1N I;  1QVF A;  1QUQ A;  3TZU A;  1B8A A;  4OWT B;  1VF7 A;  4JI7 L;  2N78 A;  4AH6 A;  3MEF A;  1ICF B;  5A35 A;  3K7A H;  2NVT B;  4AYB B;  1K8G A;  5C44 B;  1MHW C;  2NVY H;  2V1C C;  3CW2 C;  2UUC L;  3AU7 A;  1PDQ A;  5L37 A;  4JI5 Q;  3J7A V;  1TWG H;  1N32 Q;  2A6E C;  1F2L A;  5LHY 1;  4A3I H;  2UU9 Q;  5BN4 A;  3FDT A;  1PLF A;  1Y8P B;  1IKM A;  2MJ8 A;  3W5O A;  1EZ6 A;  4JK1 C;  3J81 E;  1HUM A;  3DXJ C;  4DR1 L;  2HT1 A;  4QY7 A;  1K8O A;  4ZKC B;  1EUJ A;  1ZXT A;  5HGQ A;  1YZ6 A;  4DV3 L;  5ELC A;  1B3A A;  2ENB A;  4DV2 Q;  1NAP A;  4A3I G;  4YHH Q;  2JA7 H;  4X66 Q;  1SRU A;  2Z0S A;  1HQM C;  3TRZ A;  4FNF A;  1X56 A;  4POF A;  3CF5 A;  3KLW A;  2P5Z X;  1V1Q A;  2G9D A;  1IBL Q;  5KNB A;  1RL2 A;  3E0J A;  2JA9 A;  2PW7 A;  2WIN B;  1HCZ A;  5NUC A;  4ABN A;  2IHF A;  1I94 Q;  1XNQ Q;  2PZW A;  1W6J A;  2PNR C;  1FVI A;  2JA7 G;  1Q46 A;  3F2C A;  4UPA A;  3BYT B;  4A75 A;  1KAW A;  2A19 A;  3T53 B;  4XQQ A;  3PUZ A;  3J80 E;  3V96 A;  5KYL A;  2DY7 A;  2VL6 A;  4KN4 C;  4O0A A;  1WCM H;  2C35 B;  5JJI A;  1QNK A;  5FO9 B;  3GTK H;  4CBV A;  5LMN Q;  1PTO C;  2B2V A;  2VQE Q;  4IJL A;  2JEA I;  2C9O A;  1CZW A;  1TVX A;  4QMG A;  2YYZ A;  5IT9 L;  1ASY A;  4R4O A;  5EQ0 A;  1TWA B;  2D62 A;  3GV6 A;  5C6A A;  2AHO B;  4DXF A;  2RDF A;  3FHW A;  1PA6 A;  1JB7 A;  1WCM G;  1HZ9 A;  1KAB A;  2F4I A;  1LTG D;  2CW0 C;  1SYF A;  3I4O A;  4WJW A;  1I4P A;  3GO5 A;  3VR5 A;  4FVM A;  3PIO A;  2K28 A;  5IP9 H;  3FEW X;  4UHV A;  2O2L D;  3STB D;  4HAE A;  3PIP A;  1BQQ T;  4RG1 A;  3CCU A;  1X32 A;  1YNN C;  2OTJ A;  4DR4 Q;  3G71 A;  2Z4H A;  4X62 Q;  5A2Q E;  3MFY A;  4L5R C;  2EYP A;  3UDX A;  4DV1 Q;  4YIJ A;  1IYV A;  2MGS A;  4L5Q A;  1R9T H;  4C3I B;  2VB2 X;  3S1N B;  1EEI D;  4EQO A;  1G29 1;  1Y1W B;  4A3E G;  1E24 A;  2F0D A;  5IP9 G;  1XX8 A;  2Q8T A;  4DR5 Q;  1STA A;  1N34 Q;  2G5D A;  1MJE A;  4L5T A;  4QB4 A;  4FO2 A;  2XRS D;  1Q82 C;  1UE7 A;  3N6R A;  3A7L A;  3ND9 A;  2MUY A;  3S2D B;  4BA1 I;  4OON A;  4BY7 B;  1YJW A;  3I4M B;  3JC6 6;  2B2Y C;  1UE5 A;  4DUZ Q;  1D6E C;  5JOB A;  3M3Y H;  4YCW A;  1WTX A;  2DNC A;  5CYU A;  1E7Z A;  3SK6 A;  2PPB C;  4LFA L;  1QWY A;  4DR3 L;  4A3D H;  1OXT A;  3OIQ A;  4ZCK A;  1EY7 A;  1IBK L;  1LLR D;  4ZUJ A;  2R93 B;  3CMA A;  3AFP A;  1H9J A;  2UXB L;  3I55 A;  3UE1 A;  2BDN A;  2D5D A;  4JBW A;  5LMU Q;  4A76 A;  4LF8 L;  3J7A F;  2JP1 A;  2PI2 A;  4FYD A;  4DV6 Q;  1LTI D;  1PTO B;  2EDG A;  3Q8D A;  2B29 A;  1SMY C;  4MN3 A;  3K5L A;  3S1Q H;  1ILP A;  1N33 L;  1V8Q A;  1K0R A;  3S15 B;  4A3D G;  5FO7 B;  2F0Q A;  4H7B A;  2ZJQ A;  2NN6 I;  2JK8 A;  4LMQ D;  1K83 B;  4BY1 B;  2F0G A;  3OSO A;  3SE0 A;  2ICE C;  2EYL A;  2WB1 E;  3T1H L;  5G3L F;  3RZD B;  1X9N A;  1V9P A;  2BA0 A;  1EY4 A;  5DAU A;  1BBU A;  4IPC A;  4CKC A;  1M4V A;  3F8T A;  3BDO A;  1LTS D;  4G7H C;  3RLO A;  2CHB D;  2WAQ E;  4A3F B;  1BO0 A;  5C4J B;  4KD4 A;  3I4N B;  4P73 A;  4JYA Q;  1BF4 A;  1KRS A;  3BDL A;  2RDH A;  3MXP A;  1HZC A;  5C3W A;  4UY8 C;  4I65 A;  3KK7 A;  1S5C D;  1ZYR C;  3OW7 A;  1GXD C;  2L11 A;  2L1B A;  1CKM A;  4LF6 L;  1SE3 A;  1PH2 A;  2RSN A;  1IYJ B;  1KRT A;  3T13 A;  4MIU A;  5I9O A;  2JA6 H;  2AQ1 B;  5I6W A;  2R6G A;  4MHE A;  4JCV E;  3GD7 A;  3U9S A;  4NW2 A;  5IGC A;  4B3M L;  1XPR A;  4DR7 L;  1TS4 A;  4KHP L;  5C4X B;  2E74 C;  1HNW Q;  1SYD A;  1AZP A;  3TS2 A;  4PMW A;  1KLU D;  2HCI A;  3NBI A;  5CV9 A;  2N88 A;  3ICE A;  5JVG 3;  2RHS B;  1YIT A;  3R3O A;  1EY9 A;  2L55 A;  4Q0F A;  4TQU S;  4A93 B;  5AFW A;  3WDN A;  5C0X J;  2DJG C;  2E5L L;  4FF4 A;  3K57 A;  4BXX H;  4BA2 I;  1S5D D;  3PUW A;  2WP8 J;  4YY3 Q;  3M4P A;  4HR7 B;  1EYA A;  3S16 H;  1EZ8 A;  2NVQ B;  5ELF A;  1XMO L;  4PZ6 A;  4P2C B;  2UUB L;  3PIO 3;  3GTP B;  1PV4 A;  1C9O A;  2AKW B;  2R7Z B;  3B6Y A;  3D4W A;  2CH4 W;  5LL6 X;  1TU2 B;  4JI2 Q;  3WOF A;  2XVS A;  4GKJ Q;  3PIP 3;  4GOP A;  2EE1 A;  3I3C A;  4DN4 M;  3K58 A;  4S3S A;  4L8J A;  3PUY A;  1KTK A;  5M5Y H;  3T4A C;  2E2I H;  1EYD A;  1NMF A;  2B2U C;  5KGU A;  3LWU A;  1CSP A;  5IYC H;  4C3I G;  4EQP A;  1EIF A;  5IOC A;  4BY7 H;  3AMU A;  4LNQ A;  3K0X A;  3I4M H;  1JIC A;  1Q8K A;  5C5L A;  4X6A H;  2JSO A;  3MTS A;  4JBJ A;  2XN9 C;  1DON A;  3CCM A;  5M5W B;  3H09 A;  4WJ3 M;  1JB3 A;  4K8I A;  3NEN A;  3OW2 A;  2JA5 B;  4JI1 L;  4F7X A;  2LS0 1;  3AB9 A;  3D4D A;  5FLX L;  2MP1 A;  1LTR D;  2I5L X;  4OEL B;  4JBM A;  2DNE A;  5IYC G;  1DXM A;  4QL5 A;  1CKN A;  4ZKB B;  1Z7T A;  1DOM A;  4B9X A;  5JVH 3;  4BY7 G;  4OWX B;  4POG A;  3I4M G;  1A2U A;  1Z6H A;  3OTO L;  3EQL C;  1L0Y B;  4DAV A;  1EQT A;  1HR0 Q;  1HUN A;  5EBC A;  3L3O C;  4RCO A;  1VQ8 A;  1XWE A;  3A8J E;  4C3H H;  3BU2 A;  3PGZ A;  4DV5 L;  4KLK A;  3H94 A;  2EZV A;  1T5X D;  1SDF A;  1GM5 A;  2MNA A;  1LAC A;  5C3E B;  1I50 B;  3CCE A;  1ENF A;  1X3E A;  1VQN A;  2K14 A;  2I07 B;  3E5S A;  2DUD A;  1DGS A;  2Q2T A;  4LF5 L;  1JOR A;  2E2H H;  4DU9 A;  1L1O C;  2YTV A;  5D3I B;  4CJ1 B;  5FOB B;  3O13 A;  1K73 C;  1EY5 A;  2B2W C;  2UXC Q;  2J7Z A;  2R92 B;  4C3H G;  2RBM A;  1A2T A;  5ELN A;  3J80 c;  2HDL A;  3A5Z B;  3CQZ B;  4DFA A;  3DM1 A;  4CGY B;  3HFZ B;  2YU9 H;  4IUN A;  1KDB A;  2EIF A;  1VQH A;  4DA2 A;  4NB3 A;  2F0L A;  1D7Q A;  3RN5 A;  2XWJ B;  4JV5 Q;  1TR5 A;  3KYH C;  1SBB B;  2L4N A;  2OT2 A;  2QEX A;  1E2V A;  2PYK A;  4B3R Q;  1LTL A;  3MVV A;  1TS2 A;  2YTX A;  2ASB A;  1QNU A;  3E9H A;  4O2D A;  4RAU C;  4GZY C;  4RGO S;  4AIM A;  1YBY A;  4QIW E;  1LTB D;  1GUW A;  1NCV A;  1FGB D;  1L0X B;  2V4D A;  4DF7 A;  4CHT B;  1VS0 A;  1SE8 A;  3F2B A;  4FF1 A;  1CKO A;  3X3M A;  1ESF A;  4A3F G;  4Y7N B;  1VQ6 A;  1UWV A;  5IIF A;  1JMC A;  1PRT F;  3HKZ B;  4UP8 A;  1YI2 A;  2Z9H A;  3BVG A;  1VDZ A;  2EYJ A;  2KCM A;  3OMG A;  4JC0 A;  3UE0 A;  3ZJY C;  3T1Y L;  4LFC Q;  3G6J B;  4A3L H;  5CBE E;  3I8Z A;  4NKL A;  1V43 A;  2UUA Q;  5M5X B;  1BUV T;  4QCL A;  2LMC B;  4B3S L;  2KOL A;  3NBH B;  4LUO A;  2QEJ C;  3L7Z C;  3S1R B;  3OPO A;  1MD2 D;  1FJG Q;  3SVM A;  2CFM A;  5H1S E;  3HOW H;  4DR2 Q;  4K6L A;  1YNJ D;  1F2Y A;  3HOY H;  1UAP A;  1HNZ L;  5C4X G;  2IPK D;  1CI3 M;  1X55 A;  4ODG A;  4G7Z C;  4RFB A;  2VQF Q;  1Z9F A;  5GRO A;  4A3J H;  1IL8 A;  1BBW A;  1AH9 A;  1F77 A;  4RGM A;  1GUN A;  1NE3 A;  1Q1E A;  3I90 A;  3H91 A;  1I6H B;  3HOU B;  2NVQ H;  3LGJ A;  4GKK L;  1YIJ A;  3KF8 B;  2N49 A;  4K0K Q;  2B2V C;  5I9P A;  1I4X A;  3DMU A;  1Y1V B;  3MC0 B;  3F2U A;  4F8M A;  4BBR B;  2A68 C;  4UP9 A;  2ZT9 C;  3HOY G;  2ZM6 L;  2TMP A;  4DR1 Q;  3P75 A;  4GLV B;  3GTM H;  2JJQ A;  1L1O B;  1EY0 A;  3OHX C;  1OXX K;  5AJ3 L;  4DR6 L;  4CKB A;  2CWA A;  3N52 A;  1K8A C;  1LT4 D;  4FF2 A;  1VQ9 A;  4LF4 Q;  2KEE A;  1JC7 A;  1QUQ B;  1VQE A;  3W3A A;  4K14 A;  2AWO A;  2CCZ A;  4QQB X;  3R8B A;  1TII D;  3QG1 A;  1Q1B A;  3AEV A;  3TSS A;  2NUC A;  2NB0 A;  3T16 A;  1LTT D;  3DHQ A;  3S17 H;  5IGB A;  1JJG A;  5EPJ A;  1EY6 A;  4KK7 A;  4X64 L;  2DN8 A;  3S14 H;  1QIL A;  1O80 A;  4YWM A;  3BYY B;  1VQG A;  2PO4 A;  1D5Z C;  1XJV A;  4JI8 Q;  4JBK A;  1JE4 A;  1SE2 A;  3EFX D;  4FP5 D;  4RGN A;  3IL8 A;  3A54 A;  1E22 A;  1LUZ A;  3D8G A;  1S72 A;  3GTL B;  2OQ0 A;  5E1F A;  2HHH Q;  5EBD A;  2RHQ B;  1BCP F;  1D2B A;  5JJK A;  1ET6 A;  1Q12 A;  3HOV H;  2JA5 G;  1U9R A;  1OXS C;  3R2I A;  2BH8 A;  1JT8 A;  4TRD A;  3CCJ A;  4GNX A;  3R93 A;  5M3F B;  4HJ5 A;  4IZ8 A;  2BOS A;  2F0P A;  3KLS A;  2A8V A;  2ALY B;  1K9M C;  1IZ6 A;  1ONL A;  4R8I A;  4KKS A;  3OWF A;  2RKS A;  4L63 B;  4YWL A;  2ATW A;  3H3V I;  4N9T A;  1JWS D;  2X6G A;  2Z8L A;  3MAQ A;  1KQS A;  4LK1 C;  2HIX A;  3HOV G;  2F0E A;  1PYB A;  3U9O A;  5HY6 A;  1STY A;  4NPS A;  1OO9 B;  1VQP A;  1WTQ A;  2EY1 A;  1NNX A;  1PMR A;  3SK8 A;  1IKL A;  1I4Q A;  2MHV A;  4GN3 B;  3JAM L;  1MGS A;  2LXK A;  3C1F A;  2TSS A;  3W1B A;  1PXU A;  1EIH A;  2YV5 A;  2L15 A;  2Q2U A;  2EJG C;  3D4R A;  1QE6 A;  3OYY A;  1D5X C;  4OHJ A;  3H0G B;  5IGE A;  1H9S A;  3PUX A;  3BZC A;  4HJ9 A;  4IUV A;  3D6C A;  3CCV A;  2VUM B;  3QR8 A;  5E4W C;  3E6Z X;  3VR6 A;  1GHJ A;  2B63 B;  1Y8N B;  1XMQ L;  5J1Z A;  3PO2 H;  1STH A;  1VQB A;  4TVA B;  1Q8I A;  2MFI A;  4DAY A;  1TWF H;  5IYD H;  1IW7 D;  2OQK A;  1SJE D;  2XWB B;  2E2J B;  4IFD H;  5CV8 A;  3MXN A;  3NQT A;  1B1Z A;  1N36 Q;  1PFN A;  5CV6 A;  3SXH A;  3DWA A;  2PMZ B;  5M5X H;  4DV4 L;  2JYO A;  2NBF A;  2NTT A;  1K3B C;  5JEA H;  1GO3 E;  2RDG A;  5IGF A;  3PO2 G;  4GN4 B;  3HKZ G;  1P16 A;  3K80 C;  3Q23 A;  3S2H H;  1HZB A;  5IYD G;  4RWS C;  5I2Y A;  4DR3 Q;  3UDG A;  3GTJ B;  4IFD G;  1IBK Q;  4LWC A;  1D1I A;  4ILW A;  1EIY B;  3EIV A;  1AP0 A;  1LT5 D;  3RZO B;  2ICI A;  4MTN A;  1YNX A;  2MPM A;  2HCC A;  1FNW A;  2H4O A;  3FPP A;  4OWW B;  2H1E A;  2KHI A;  1AW7 A;  2D0P A;  4JI5 L;  1I6H H;  1XPU A;  1N32 L;  5JEA G;  1ILQ A;  5DLQ E;  2RCF A;  1F9P A;  4A3E H;  4KY6 A;  1CK1 A;  2CH4 A;  4HCE A;  4IFD J;  2KCC A;  1PZI D;  1VQJ A;  1YHQ A;  2EJF C;  4HIM A;  3HGB A;  3I91 A;  2A69 C;  3SR1 A;  5E7N A;  5D3D A;  3AYH B;  4XYO A;  1S40 A;  4I7Z C;  5M9O A;  1G6Z A;  4K2L A;  1MIU A;  3IFD A;  2R7D A;  2WFW A;  1SN8 A;  5JEA J;  2ES2 A;  1HR0 W;  2JN4 A;  4RHS A;  5K36 H;  1ICW A;  1GOZ A;  2FXQ A;  4GLA C;  1C0A A;  4JI4 Q;  3ERO A;  4YHH L;  4EX5 A;  2Q2H A;  1KHI A;  1N9W A;  1EOT A;  3TP6 A;  4X66 L;  2R61 A;  1TWC H;  2K5V A;  2ZTE A;  4A3G B;  2A6E D; 
#chains in the Genus database with same CATH homology
 2B8G A;  4QUF A;  4DXG A;  4WOR A;  5E4X A;  2BDO A;  2EVB A;  2WB1 B;  2EOT A;  4RHR A;  1EU3 A;  3M85 A;  5IT9 E;  5K36 G;  2M9V A;  4A3B B;  3S1M B;  3HEJ A;  1NR2 A;  3RUZ A;  2SNS A;  5COR A;  1WTV A;  1SNQ A;  1JWU D;  4UDU C;  4L6T B;  1GUG A;  5JPM C;  1NR4 A;  1U4L A;  4G4K A;  5CBA E;  2QF7 A;  1Q3L A;  5I4D A;  1QG7 A;  4E6I A;  5C0X I;  4C56 C;  3A8K E;  3PV0 A;  1CTM A;  1BNZ A;  4BBS B;  4ZQ3 A;  3OWE B;  1RF2 D;  3I4L A;  1ESR A;  2BCO A;  2AQ3 B;  1E2W A;  5C4Z A;  4IUU A;  2Y0S B;  4HED A;  5EPL A;  3HG9 A;  1U4M A;  4CJ0 B;  1FD7 D;  2BA1 A;  1PTO D;  4H0L C;  1EIG A;  2K33 A;  4XQJ A;  4IUT A;  4XQN A;  3NUC A;  1ZEQ X;  2L9H A;  4KMU C;  2JA8 B;  3P7J A;  3C1E A;  3FVQ A;  2EYM A;  1SEB D;  2Q8I B;  2CW0 D;  2ID0 A;  4NMZ A;  5C3X A;  3DEP A;  3IKJ A;  5EPK A;  3CU7 A;  3C2P A;  1BBX C;  1FNU A;  1YNN D;  1G2S A;  2IW3 A;  3K5N A;  1HA6 A;  2EPB A;  1EU4 A;  3X3N A;  2F03 A;  3NTI A;  1DD2 A;  3VYT A;  1XXG A;  1R4P B;  2C5C A;  4RKB A;  1MBY A;  3TP8 A;  1EWH A;  3IAY A;  4CKE A;  5FKA C;  1LO5 D;  2ZXR A;  2QDB A;  1DOL A;  2B39 A;  2NN6 H;  2XRQ D;  2F0M A;  3NK9 A;  3M7N A;  3BG3 A;  3GTG B;  3VR4 A;  2F0I A;  2FHT A;  2J4X A;  3BVZ A;  1IHZ A;  3WOE A;  3VR3 A;  2GA4 B;  1V1P B;  3NSW A;  2PZU A;  1XTC D;  1FNV A;  1PTO F;  2E76 C;  3GTQ B;  3M4O B;  2Z1C A;  2NN6 G;  1JOO A;  4KTA A;  1LV9 A;  1HTL D;  1OXV A;  3SK5 A;  2SDF A;  4WFN 3;  1JCK B;  2M00 A;  4HN7 A;  3KBX A;  4DGZ A;  1PFB A;  4FXG C;  3SK4 A;  5T1G A;  1EEF D;  1CZG A;  1S5E D;  2RQX A;  1SMY D;  1CT1 D;  1V1P A;  1HXY D;  4A3M B;  1XYI A;  1WD0 A;  2K01 A;  1TS5 A;  2KEC A;  1RHP A;  1UUP A;  3PO3 B;  1TWH B;  4EVO A;  3P20 A;  1RJT A;  1PRT B;  2PCF B;  3TME A;  3H3V C;  2F0S A;  1EQV A;  3SHL A;  3GTO B;  4O1N A;  4K2K A;  2G9H D;  1M8A A;  1Q90 A;  5C4H A;  1PZJ D;  2WII B;  2AUJ D;  5KNC A;  2F3V A;  1RTO A;  2NZ1 D;  1PTO H;  4EQN A;  2QIL A;  1I4H A;  1DOK A;  1RCV D;  3L9A X;  1SE4 A;  1R4Q B;  2A5H A;  1ZYR D;  4CJ2 C;  2HQE A;  2FIN B;  3QWN A;  1IYU A;  4PV1 C;  1E0B A;  2JEB I;  1JOK A;  2KHS A;  3M4Y A;  2NVY B;  1NSN S;  3S9W A;  2F0W A;  4XXE A;  1TWG B;  3KUP A;  3OIP A;  3GV3 A;  4OO1 I;  4A3I B;  2RVL A;  4X3S A;  4J8Q A;  2IJ0 A;  1B9M A;  2DY8 A;  2KVM A;  3SEB A;  5FLX E;  3MZ5 A;  4A3K B;  4K5X A;  1BR9 A;  4LAA A;  3DUZ A;  3J7Y W;  1SNP A;  1BXT A;  4KI0 A;  5T1I A;  5JJZ A;  5BN3 A;  1VMC A;  2X69 A;  4M8A A;  2JA7 B;  1EWC A;  1B53 A;  4IUP A;  2FMC A;  3GP7 A;  3ITP A;  3LNN A;  1BCP B;  2X6L A;  2EY5 A;  4ID6 A;  1DYQ A;  2IT1 A;  5CGK A;  4K5W A;  1MSG A;  2IWH A;  1ET9 A;  1FR3 A;  2PW5 A;  3I73 A;  2IX1 A;  4X3K A;  2IL8 A;  4KD3 A;  3FKI B;  3M7G A;  4ZYS A;  1CFM A;  1STG A;  2B2T A;  2ZXO A;  4ZK9 B;  3T51 B;  4TSS A;  4V0B A;  3NQI A;  4NP5 A;  3RMH A;  5JPN C;  1QJO A;  2FFK B;  3K6O A;  3DWQ A;  4X3U A;  4H44 C;  5ELD A;  5TSS A;  2A6H C;  1UNS A;  5EGT A;  1O78 A;  2AUK A;  3Q24 A;  2Q8R E;  1WTW A;  1H9R A;  3C46 A;  2A74 C;  3VA7 A;  1SNO A;  2SNM A;  1QB5 D;  1R9T B;  2NWG A;  1GUO A;  2KED A;  2WKC A;  3J81 L;  1O7L A;  1LT6 D;  4F87 A;  2L0C A;  4KHV A;  1TS3 A;  3RLF A;  3VYR A;  3DWP A;  2K32 A;  1QOH A;  1GUS A;  3Q22 A;  1GUT A;  4HSV A;  1BDO A;  3QIA A;  4KJN A;  1HFG A;  3K0Y A;  1LTA D;  2PZT A;  4IN3 A;  1SYG A;  4WRD A;  3M3Y B;  1I4G A;  1WVL A;  2EYO A;  1SFO B;  3HS0 C;  1H9S B;  5J39 A;  4UAI A;  4A3D B;  2J0T D;  3MWY W;  2FMM A;  5DM6 3;  1DJR D;  1C48 A;  4PQX A;  3K59 A;  3J80 L;  2K5D A;  2EYF A;  3ZYY X;  3I72 A;  2QCP X;  1KDA A;  3S1Q B;  3SDZ A;  5EKI A;  5I2X A;  5J22 A;  2EXZ A;  1HHV A;  4KY5 A;  1AFP A;  1KAA A;  4XT3 B;  5F2D A;  2F0U A;  3QJY A;  4IQZ A;  4RCN A;  2AQ2 B;  4KY7 A;  3VA5 A;  3URY A;  4PMC A;  2K6A A;  5IGG A;  3G7L A;  3W2D A;  2F3W A;  1F9Q A;  4FXD A;  1U4P A;  3NWT A;  1SYE A;  1Y69 U;  2A68 D;  3HP3 A;  3MXG A;  3RD4 A;  1STB A;  1AN8 A;  1UEA B;  3HZX A;  1CHQ D;  1RTN A;  1A6X A;  2A6H D;  5A2Q L;  3NP8 A;  4XYQ A;  2K1B A;  1H9K A;  1ML0 D;  1G8Z D;  2LKV A;  3K5M A;  3QOJ A;  1VF5 C;  1HQR D;  2JA6 B;  5K5P A;  3JAM E;  5ELE A;  3ONA B;  5KRU A;  3FRP B;  5CV7 A;  3A56 A;  2K5W A;  4NDX A;  4FF3 A;  2NYZ D;  5EKL A;  4O42 A;  3FPU B;  4K5V A;  1LT3 D;  3CRL C;  1SAP A;  3MA2 B;  4IUR A;  4XIG S;  2OF1 A;  1TKW B;  5FO8 B;  1MI2 A;  2JE6 I;  3V2T A;  2D9U A;  1HRJ A;  1NUC A;  1E2Z A;  4M1U B;  1CM9 A;  2F0J A;  1B50 A;  2D2C C;  4H13 C;  1SND A;  5KIX A;  3S16 B;  1KNE A;  4KV6 A;  1RDP D;  2NVX B;  4LJZ C;  3NXW A;  5G3L D;  1DZ1 A;  2EJM A;  2B8F A;  3KLR A;  1JQY D;  2LY7 A;  1I4R A;  2OEO A;  2R3Z A;  1EYC A;  3VYU A;  2BE5 C;  1T5E A;  1DM0 B;  4J6H A;  1WTR A;  5M5Y B;  2E2I B;  2WAQ B;  3VYS A;  4QF4 A;  4DNR B;  3KBG A;  5ISR A;  4RH6 A;  1AEX A;  1HPC A;  1G91 A;  3QO2 A;  3TP7 A;  5E3F A;  2IX3 A;  4ZUI A;  1EL0 A;  2IX0 A;  4C1N K;  1J9O A;  1STN A;  2KQ3 A;  1CQF A;  4DK1 A;  4G7O C;  1B2T A;  4DAP A;  2F0N A;  4Z9C B;  2KUM A;  1EY8 A;  3HRZ C;  4KKU A;  2WKD A;  4OL7 A;  4C3H B;  5LL6 S;  3EVQ A;  2L12 A;  1PYW D;  1I3Q B;  4HTH A;  3CHB D;  1MSH A;  2N55 A;  2K5Q A;  3Q0A A;  3UI2 A;  3LWE A;  2E2H B;  2I46 A;  1TY2 A;  4K6D A;  1KDC A;  1VCI A;  3EA6 A;  2VNU D;  1J8I A;  1PRT C;  3EJI A;  3FMC A;  3HOZ B;  4N9P A;  5D14 A;  2YU9 B;  1A3T A;  5KYI A;  1QCB D;  2F1M A;  4XDX A;  3TZD A;  3MXU A;  5D65 A;  2VXW A;  1ENC A;  1H9M A;  3BZD B;  2A69 D;  2M2L A;  2E75 C;  4KN7 C;  2KJX A;  4HMI A;  1A15 A;  5C0X H;  1S5F D;  2EY2 A;  3MHB A;  2KCN A;  5KEE A;  3CRK C;  4BWG B;  1GJX A;  1SXT A;  1LAB A;  1C8C A;  5CC4 A;  1S4Z A;  4B9W A;  5C0X G;  2HUG A;  2F0H A;  4PMB A;  1A3U A;  2BE5 D;  1VMP A;  2Z4I A;  1PZK D;  1RKN A;  5IOD A;  1STE A;  3R2T A;  1I6V C;  1O7Z A;  1WTP A;  3HOW B;  1HA5 A;  1CQV A;  3TN2 A;  2VB3 X;  2F0F A;  3HOY B;  2ZXP A;  4A3J B;  4U68 A;  1X3Q A;  1B4O A;  4RA8 A;  5KND A;  4B08 A;  1A3V A;  1KNA A;  4XTC S;  3NHH A;  2B2T C;  2B2Y A;  2RA4 A;  1W6K A;  3BDC A;  3T56 B;  1AZQ A;  3GTM B;  3H6M A;  2K7V A;  4C3J B;  4ZRZ A;  1BCP C;  1BOS A;  1D5M C;  1ZKO A;  2WV6 D;  2FJ2 A;  4U67 3;  1G2T A;  2SOB A;  3A7A B;  4IUQ A;  1S5B D;  1YNJ C;  5DEH A;  3S17 B;  1FYC A;  4QIW B;  3ND8 A;  3P1H A;  5CV4 A;  4ME5 A;  4R8N A;  1SNM A;  4ZLT F;  3S14 B;  1F2M A;  4ZAI A;  1TY0 A;  1ROD A;  3NE5 B;  4IAL A;  5COY A;  3C3L A;  1CA6 A;  5ELB A;  1PRT D;  5EJW A;  5CR3 A;  2L5T A;  5CMD A;  4ULL A;  4C2M B;  5FK9 C;  3TDQ A;  1F2Z A;  1WTO A;  3CKI B;  3NTH A;  3I70 A;  3BVM A;  4RGT A;  5HGT A;  5HUR A;  1SJH D;  5EKK A;  3D31 A;  2O5J C;  3HOV B;  1SYC A;  1B9N A;  4OIJ A;  3K7A B;  2K04 A;  3PMF A;  4PNY A;  5DM7 3;  2XSC A;  3BS1 A;  1CHP D;  2EYH A;  4F88 A;  4TKO B;  1GHK A;  2HDM A;  2WAC A;  1Y8O B;  1JOQ A;  2AWN A;  1OXU A;  3K5O A;  2KA7 A;  3VR2 A;  1CA5 A;  4KJO A;  4V19 0;  4HSP A;  3D6W A;  3OMC A;  1RD9 D;  2NTS A;  1F9S A;  1C4Q A;  3IFT A;  4RKL A;  4FXK C;  2EY6 A;  2O5I C;  3QB3 A;  4EGV A;  2CQA A;  5DNF A;  1II3 A;  1Z47 A;  5CV5 A;  3PUV A;  5I6Y A;  1K8M A;  1ENA A;  2F0O A;  1SSO A;  3PO2 B;  1B44 D;  4OGQ C;  1DCZ A;  2A73 B;  1TWF B;  3A55 A;  1F9R A;  4HMJ A;  3V05 A;  1PFM A;  1WCM B;  3GTK B;  2XNA C;  2F0V A;  2K05 A;  1BCP D;  2RSO A;  2O4X A;  2F0T A;  4K8J A;  1O7Y A;  2JXM B;  3TBI B;  4OO1 H;  3S2H B;  3QOL A;  1SYB A;  2OXP A;  3OOC A;  4DK0 A;  1TQO A;  3NTK A;  4KKT A;  3DEO A;  2E2D C;  4R9W A;  2B2U A;  3LX0 A;  2K03 A;  5JAV A;  2LFN A;  2F0K A;  4A3E B;  3D3R A;  1EFI D;  2XIW A;  4G57 A;  3MFG A;  3Q6S A;  4OO1 G;  1IW7 C;  1JWM D;  1WD1 A;  1X3P A;  4DNT B;  4BS9 A;  4J1M A;  1JR0 D;  3NPP A;  4KHZ A;  3NBH A;  2QKI C;  1V1O A;  1KLG D;  2CVR A;  3TP5 A;  1TT2 A;  2SEB D;  5BN5 A;  1U4R A;  3GQB A;  4Q5V A;  1TWC B;  5IGD A;  2PQE A;  3KLS X;  1HTP A;  5M3M B;  3ERQ A;  3KF8 A;  4C3J G;  1D1K A;  3A8I E;  4OIK A;  3HOX B;  3NWS A;  4QUC A;  4X3T A;  1SNC A;  4HCS A;  3MEH A;  1HFN A;  2B2W A;  5C5M A;  4IFD I;  4XT1 B;  4C1N I;  3TZU A;  1VF7 A;  5A35 A;  2NVT B;  4AYB B;  5C44 B;  3AU7 A;  1PDQ A;  3J7A V;  2A6E C;  1F2L A;  5LHY 1;  5BN4 A;  3FDT A;  1PLF A;  1Y8P B;  1IKM A;  2MJ8 A;  1EZ6 A;  4JK1 C;  3J81 E;  1HUM A;  3DXJ C;  1K8O A;  4ZKC B;  1ZXT A;  5ELC A;  1B3A A;  2ENB A;  1NAP A;  1HQM C;  4FNF A;  2G9D A;  5KNB A;  3E0J A;  2PW7 A;  2WIN B;  1HCZ A;  5NUC A;  4ABN A;  2PZW A;  1W6J A;  2PNR C;  3BYT B;  3T53 B;  4XQQ A;  3PUZ A;  3J80 E;  3V96 A;  5KYL A;  2DY7 A;  4KN4 C;  1QNK A;  5FO9 B;  4CBV A;  1PTO C;  2B2V A;  2JEA I;  2C9O A;  1CZW A;  1TVX A;  4QMG A;  2YYZ A;  5IT9 L;  5EQ0 A;  1TWA B;  2D62 A;  3GV6 A;  5C6A A;  4DXF A;  2RDF A;  1KAB A;  2F4I A;  1LTG D;  2CW0 C;  1SYF A;  4WJW A;  1I4P A;  3GO5 A;  3VR5 A;  4FVM A;  2K28 A;  3FEW X;  2O2L D;  4HAE A;  1BQQ T;  1X32 A;  1YNN C;  2Z4H A;  5A2Q E;  3MFY A;  2EYP A;  4YIJ A;  1IYV A;  2MGS A;  4C3I B;  2VB2 X;  3S1N B;  1EEI D;  4EQO A;  1G29 1;  1Y1W B;  2F0D A;  1XX8 A;  2Q8T A;  1STA A;  4QB4 A;  4FO2 A;  2XRS D;  3N6R A;  3A7L A;  3ND9 A;  2MUY A;  3S2D B;  4BA1 I;  4BY7 B;  3I4M B;  2B2Y C;  1D6E C;  5JOB A;  1WTX A;  2DNC A;  5CYU A;  3SK6 A;  2PPB C;  1QWY A;  1OXT A;  3OIQ A;  1EY7 A;  1LLR D;  4ZUJ A;  2R93 B;  1H9J A;  2BDN A;  2D5D A;  4JBW A;  3J7A F;  2JP1 A;  4FYD A;  1LTI D;  1PTO B;  2EDG A;  1SMY C;  4MN3 A;  3K5L A;  1ILP A;  1V8Q A;  3S15 B;  5FO7 B;  2F0Q A;  4H7B A;  2NN6 I;  4LMQ D;  1K83 B;  4BY1 B;  2F0G A;  3OSO A;  3SE0 A;  2ICE C;  2EYL A;  5G3L F;  3RZD B;  2BA0 A;  1EY4 A;  5DAU A;  4CKC A;  1M4V A;  3BDO A;  1LTS D;  4G7H C;  2CHB D;  4A3F B;  1BO0 A;  5C4J B;  4KD4 A;  3I4N B;  1BF4 A;  3BDL A;  2RDH A;  3MXP A;  5C3W A;  4I65 A;  3KK7 A;  1S5C D;  1ZYR C;  3OW7 A;  1GXD C;  2L11 A;  2L1B A;  1SE3 A;  2RSN A;  3T13 A;  4MIU A;  5I9O A;  2AQ1 B;  5I6W A;  2R6G A;  4MHE A;  3GD7 A;  3U9S A;  4NW2 A;  5IGC A;  1TS4 A;  5C4X B;  2E74 C;  1SYD A;  1AZP A;  4PMW A;  1KLU D;  2HCI A;  3NBI A;  5CV9 A;  2N88 A;  5JVG 3;  3R3O A;  1EY9 A;  2L55 A;  4Q0F A;  4TQU S;  4A93 B;  5AFW A;  3WDN A;  5C0X J;  4FF4 A;  3K57 A;  4BA2 I;  1S5D D;  3PUW A;  2WP8 J;  4HR7 B;  1EYA A;  1EZ8 A;  2NVQ B;  5ELF A;  4P2C B;  3GTP B;  3PIO 3;  2R7Z B;  3D4W A;  5LL6 X;  1TU2 B;  3WOF A;  2XVS A;  3PIP 3;  2EE1 A;  3I3C A;  4DN4 M;  3K58 A;  4S3S A;  4L8J A;  3PUY A;  1KTK A;  3T4A C;  1EYD A;  5KGU A;  2B2U C;  3LWU A;  4C3I G;  4EQP A;  5IOC A;  3AMU A;  1JIC A;  5C5L A;  2JSO A;  3MTS A;  2XN9 C;  1DON A;  5M5W B;  3H09 A;  1JB3 A;  4K8I A;  2JA5 B;  4F7X A;  2LS0 1;  3AB9 A;  3D4D A;  5FLX L;  2MP1 A;  1LTR D;  2DNE A;  1DXM A;  4ZKB B;  1Z7T A;  1DOM A;  4B9X A;  5JVH 3;  1A2U A;  1Z6H A;  3EQL C;  1L0Y B;  4DAV A;  1EQT A;  1HUN A;  5EBC A;  3L3O C;  4RCO A;  1XWE A;  3A8J E;  3H94 A;  2EZV A;  1T5X D;  1SDF A;  1LAC A;  5C3E B;  1I50 B;  1ENF A;  2I07 B;  3E5S A;  1JOR A;  4DU9 A;  5D3I B;  4CJ1 B;  5FOB B;  3O13 A;  1EY5 A;  2B2W C;  2J7Z A;  2R92 B;  4C3H G;  2RBM A;  1A2T A;  2HDL A;  4DFA A;  3CQZ B;  3DM1 A;  4CGY B;  4IUN A;  1KDB A;  4DA2 A;  2F0L A;  2XWJ B;  1TR5 A;  1SBB B;  2L4N A;  2OT2 A;  1E2V A;  2PYK A;  3MVV A;  1TS2 A;  1QNU A;  4RAU C;  4GZY C;  4RGO S;  1LTB D;  1GUW A;  1NCV A;  1FGB D;  1L0X B;  2V4D A;  4DF7 A;  4CHT B;  4FF1 A;  3X3M A;  1ESF A;  4Y7N B;  5IIF A;  1PRT F;  3HKZ B;  3BVG A;  1VDZ A;  2EYJ A;  3OMG A;  3G6J B;  5CBE E;  3I8Z A;  4NKL A;  1V43 A;  5M5X B;  1BUV T;  4QCL A;  2LMC B;  2KOL A;  2QEJ C;  3L7Z C;  3S1R B;  3OPO A;  1MD2 D;  3SVM A;  4K6L A;  1YNJ D;  1F2Y A;  1UAP A;  2IPK D;  1CI3 M;  4ODG A;  4G7Z C;  4RFB A;  1IL8 A;  1F77 A;  4RGM A;  1GUN A;  1Q1E A;  3I90 A;  3H91 A;  1I6H B;  3HOU B;  2B2V C;  5I9P A;  1I4X A;  3DMU A;  1Y1V B;  3MC0 B;  3F2U A;  4F8M A;  4BBR B;  2A68 C;  2ZT9 C;  2TMP A;  3P75 A;  1EY0 A;  3OHX C;  1OXX K;  4CKB A;  3N52 A;  4FF2 A;  1LT4 D;  2KEE A;  1JC7 A;  3W3A A;  4K14 A;  2AWO A;  3R8B A;  1TII D;  3QG1 A;  1Q1B A;  3TSS A;  2NUC A;  2NB0 A;  3T16 A;  1LTT D;  3DHQ A;  5IGB A;  5EPJ A;  1EY6 A;  4KK7 A;  2DN8 A;  1QIL A;  1O80 A;  3BYY B;  2PO4 A;  1D5Z C;  1JE4 A;  1SE2 A;  3EFX D;  4FP5 D;  4RGN A;  3IL8 A;  3A54 A;  3D8G A;  3GTL B;  5E1F A;  5EBD A;  1BCP F;  1D2B A;  1ET6 A;  1Q12 A;  1U9R A;  1OXS C;  3R2I A;  4TRD A;  3R93 A;  5M3F B;  4IZ8 A;  2BOS A;  2F0P A;  3KLS A;  1ONL A;  4R8I A;  4KKS A;  3OWF A;  2RKS A;  4L63 B;  4N9T A;  1JWS D;  2X6G A;  2Z8L A;  3MAQ A;  4LK1 C;  2F0E A;  3U9O A;  1STY A;  1OO9 B;  1WTQ A;  2EY1 A;  1PMR A;  3SK8 A;  1IKL A;  1I4Q A;  2MHV A;  3JAM L;  1MGS A;  3C1F A;  2TSS A;  1PXU A;  1EIH A;  2EJG C;  3D4R A;  1QE6 A;  1D5X C;  4OHJ A;  3H0G B;  5IGE A;  1H9S A;  3PUX A;  4IUV A;  3D6C A;  2VUM B;  5E4W C;  3E6Z X;  3VR6 A;  1GHJ A;  2B63 B;  1Y8N B;  5J1Z A;  1STH A;  1Q8I A;  4DAY A;  1IW7 D;  1SJE D;  2XWB B;  2E2J B;  4IFD H;  5CV8 A;  3MXN A;  3NQT A;  1B1Z A;  1PFN A;  5CV6 A;  3SXH A;  3DWA A;  2PMZ B;  2JYO A;  2NBF A;  2NTT A;  5JEA H;  2RDG A;  5IGF A;  3Q23 A;  4RWS C;  5I2Y A;  3GTJ B;  4IFD G;  1D1I A;  4ILW A;  1AP0 A;  1LT5 D;  3RZO B;  2ICI A;  2MPM A;  2HCC A;  1FNW A;  2H4O A;  3FPP A;  2H1E A;  1AW7 A;  5JEA G;  1ILQ A;  1F9P A;  4KY6 A;  1CK1 A;  4HCE A;  4IFD J;  2KCC A;  1PZI D;  2EJF C;  3HGB A;  3I91 A;  2A69 C;  3SR1 A;  5D3D A;  4XYO A;  4I7Z C;  5M9O A;  1G6Z A;  4K2L A;  3IFD A;  5JEA J;  4RHS A;  5K36 H;  1ICW A;  1GOZ A;  3ERO A;  1EOT A;  3TP6 A;  2R61 A;  4A3G B;  2A6E D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...