3NHHA

Crystal structure of staphylococcal nuclease variant v23e-l36k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Nuclease A
publication title Structural and thermodynamic consequences of burial of an artificial ion pair in the hydrophobic interior of a protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nhhA00
5I9PA 4ID6A 4WORA 2HQEA 5IOCA 4KY5A 5HGTA 3MHBA 4IUNA 1SYFA 2PW7A 3EROA 4K5WA 1SYDA 2EYJA 3P1HA 2F0OA 3EVQA 4DGZA 3TP8A 5M9OA 4IZ8A 4N9PA 1EZ8A 2F0KA 4ODGA 2RDFA 3OMCA 5CV8A 2OEOA 1EQVA 3D4WA 5F2DA 4YIJA 3SK8A 3SR1A 3U9OA 1A3VA 2F0WA 4B9WA 1EY6A 3OWFA 4E6IA 3TP7A 3SK4A 1STYA 4F8MA 4K8JA 3SXHA 4KY7A 1F2YA 4EQNA 3RUZA 3OSOA 4MIUA 4QF4A 4WRDA 1SNCA 5CV7A 3R3OA 4QB4A 1SNDA 3MZ5A 2PZTA 4QMGA 1SNOA 5IODA 1STAA 4S3SA 4LAAA 2EYFA 4K2KA 5EKKA 5C5MA 3TP5A 1A3TA 4ZUJA 3EJIA 5CV5A 4J1MA 4OL7A 1EY7A 1EZ6A 2SOBA 3T16A 4DFAA 1F2ZA 5IGCA 3NK9A 5I9OA 1RKNA 1TQOA 5J1ZA 5E1FA 2F0IA 1EYDA 4K5XA 2M00A 2EY1A 4HMIA 4K8IA 5C4ZA 5IGBA 5J22A 5J39A 1JORA 4NMZA 1STNA 5I6YA 2F0JA 2F0SA 3H6MA 1TT2A 3P75A 2F0PA 3ERQA 1TR5A 3BDCA 2F0QA 5CV9A 4KD4A 1U9RA 2EY6A 5IGEA 2PZWA 1KABA 1SYGA 3NUCA 2EYMA 4KY6A 5EKLA 2EYPA 5JOBA 2KQ3A 3HEJA 3NXWA 2F0EA 3NQTA 4DU9A 4KTAA 4G57A 1EY5A 4NP5A 4EQPA 2EYHA 1EYCA 3NP8A 5HURA 2F0TA 4RKLA 3D8GA 1JOKA 4K14A 3LX0A 5CGKA 4EVOA 1AEXA 4PMCA 4KD3A 2KHSA 2RKSA 5DEHA 2EY5A 3MVVA 5KEEA 2EXZA 1JOQA 1SYBA 2PQEA 1NUCA 3PMFA 1SYEA 2F0VA 1EY4A 2SNSA 2OXPA 4RKBA 5CV6A 3SHLA 2PZUA 2PW5A 4ZQ3A 1NSNS 4R8NA 1KDCA 2F0MA 2F0LA 5NUCA 1STGA 5C4HA 5C3XA 3C1EA 3C1FA 4IALA 4F7XA 5IGDA 5KYLA 1A2TA 2SNMA 2F3WA 2LKVA 3HZXA 4HTHA 2EYOA 2F0GA 4K2LA 4K5VA 1II3A 3DMUA 2F3VA 3V2TA 5KIXA 1EY9A 5JAVA 3QOJA 1F2MA 1STBA 2NUCA 3MEHA 1STHA 2F0NA 3OMGA 4NKLA 4EQOA 3QB3A 5K5PA 3E5SA 1SNMA 2F0DA 4PNYA 5DAUA 5IGGA 5CV4A 4KHVA 1JOOA 5IGFA 3S9WA 5KGUA 2OF1A 2EYLA 3D6CA 2F0HA 2F0FA 2ENBA 3DHQA 1IHZA 3NHHA 4J6HA 4KV6A 1SNQA 4DF7A 2WACA 5KRUA 4KJOA 1EY8A 4N9TA 2EY2A 1A3UA 2PYKA 4K6DA 4KJNA 4I65A 3VA5A 5I6WA 4H7BA 4ME5A 4NDXA 4B9XA 4PMBA 3SK6A 5C5LA 1EYAA 3MXPA 3QOLA 5CC4A 1ENCA 5E3FA 5CR3A 1SNPA 1A2UA 3D4DA 5IIFA 1EY0A 1ENAA 5C3WA 2O4XA 2F0UA 3ITPA 3BDLA 3T13A 3SK5A 2RBMA 4ZUIA 1KDBA 2QDBA 5KYIA 3TMEA 1SYCA 4HMJA 4TRDA 3TP6A 5C6AA 1KAAA 5ISRA 5EGTA 1KDAA
chains in the Genus database with same CATH superfamily
1VMPA 1FL0A 1Y1WB 3K59A 2CFMA 3KF6B 5IP9H 3OTOQ 2K01A 2F0OA 1LLRD 2KA7A 4I7AA 3CQZH 3BYYB 3ER0A 1KAWA 4JOIA 2XVSA 1EY6A 2AHOB 4KLKA 4CDCC 4A3KB 3I73A 2RA4A 3I8ZA 3F1ZA 2DJGC 2NN6H 3CPFA 3H15A 3BG3A 5CV7A 2PZTA 1BXTA 4QMGA 1S5ED 1WYDA 3A0JA 1YJ9A 3WWVA 1MI2A 2AQ3B 3PUYA 2M9VA 1JB3A 4B3MQ 2VNUD 4RH6A 4LFCQ 1IBLQ 4QY7A 2IWHA 1S3OA 3KLRA 3RLOA 1EYGA 3D31A 5J1ZA 5E1FA 5IGBA 2A6ED 2Z6KC 4C3HB 3TS2A 3A7LA 4DV5Q 3STBD 1VMCA 3EIVA 1TR5A 3ERQA 4OO1G 2J4XA 3S1MB 3FP9A 1T9HA 5DNFA 3S24A 4KKTA 3GTKH 1B4OA 3UDIA 2L12A 1D6EC 2Z4HA 3GQBA 4EQPA 5HURA 2BDNA 4GLVB 2A69D 1W3SA 1SSOA 2R3ZA 5DEHA 2A8VA 2BDOA 2PQEA 2F0VA 2N8NA 4A3GB 3S2DB 4NXML 2KVMA 2JA6H 1QJOA 3I4NH 3CU7A 1XJVA 3V2TA 4F88A 3I91A 5LMUQ 2VQFL 1F2MA 1Y1VB 1IYJB 5BN3A 4YWLA 1JOOA 2IJ0A 1I3QB 3F2CA 1CKNB 4NW2A 3PIO3 2E2DC 2B63H 4DF7A 5LHY1 4JI0L 2VQEQ 4PQXA 1KTKA 4FVMA 5E4XA 1D2BA 3HOZB 3LWUA 1L1OA 3J81i 4C3IG 2OTLA 1XPRA 4M1UB 5IIFA 2VUMB 4AYBG 3J80E 1O80A 4ZUIA 5C4XH 2NZHA 1RD9D 4TRDA 1NR2A 3TP6A 3I4MB 1KDAA 2R7DA 3VDYA 4DV1L 4DR4L 3K7AB 1KNAA 1JB7A 1OXTA 1CI3M 4DR5Q 4BA1I 3MXGA 3H3VH 2JXMB 4V190 2WINB 3Q6SA 3IKJA 5LL6X 2HDMA 1XYIA 3HKZG 1LTAD 2JJQA 2XWJB 2B2VA 3GV6A 4YCVA 2JA7B 4DXFA 4KY7A 3ULPA 1FR3A 3W2DA 1V8QA 3RZDB 1PTOB 1TWGH 4JI8L 4BBSB 1MJEA 1RODA 1BNZA 3A54A 4IPGA 4A3EH 4JI3L 2WAQB 1IKLA 3K81C 3N6RA 1F2ZA 4OONA 1TIID 1RKNA 4K5XA 1EYDA 2VZAA 3BU2A 1JORA 4HMIA 3H0GH 5J39A 3Q22A 3FVQA 3HOXB 1A8VA 1I4RA 2F0PA 3FKIH 2UXDQ 1B70B 1I4GA 1MGSA 1LYLA 2R61A 3NSWA 4A3MH 4IPCA 3OWEB 1MBYA 4BXXH 4KTAA 4GNXC 1BO0A 3D8GA 3EBEA 1VQKA 3K5OA 4KD3A 1K73C 1I5FA 3NWSA 1JOQA 1GM5A 1G6ZA 1QOHA 1CSQA 2PCFB 3JAMi 1PFNA 4ALPA 1X56A 4KK7A 4ZKBB 1X3EA 4HTHA 5I2XA 5KIXA 2N78A 3AB9A 1LUZA 1PH5A 3J80c 1AW7A 1ENFA 3QR8A 4UP9A 4QUFA 3S9WA 1VQPA 1KNEA 1KRTA 5IYBH 1QZHA 1CQFA 2SDFA 2X6GA 2WACA 1EY8A 4X62L 3ZYYX 4A93G 3GTKB 3S16H 3IAYA 4LF8Q 2QCPX 2AKWB 4FXDA 4MZ9A 3MAQA 4HIOA 2PPBC 1Z47A 3H3VI 1ICWA 4NPSA 3U50C 4HJ9A 2ZJQA 1VQJA 1OXUA 2E2JH 4A3LH 3IL8A 1SLJA 2WAQE 4LF9Q 3E0EA 4IUVA 3VYUA 2K04A 5AJ3Q 1VQ8A 3GTPH 3P1HA 3KFUA 1K83B 1O78A 5H1SE 3T51B 3ICEA 2F0KA 3PUWA 3CP0A 2L15A 2VS1A 3AEVA 2Q2HA 1LTGD 1STYA 4P2CB 4IO9A 1AFPA 4RFBA 2MUYA 1ILQA 1SNCA 2KCNA 5FLXL 2B63B 2K5HA 4LFAQ 4DK6C 5GAGC 4A75A 2PO4A 2UUAQ 4P75A 3M4OH 2A68C 4DK3C 3HOUB 5ELOA 2H1EA 5IT9E 5EAYA 2F1MA 1K0SA 2K5DA 4K6LA 1EOTA 5ELCA 3S1QH 5C4XB 1O7ZA 4N8X1 3U58A 1V1QA 2M00A 5EQ0A 2Z6BA 3VR6A 3DEPA 4IFDH 3S1NH 1S5BD 2EE1A 2EJFC 5JPMC 1ET9A 4DV0Q 2HHHQ 2PQAB 1J5EL 2KCMA 4IUTA 2BOSA 4IUQA 2UUBL 2AUKA 1IKMA 1ESFA 4IOCA 1KL9A 5IYCG 4JI1Q 4A3FH 2VXWA 4JI6Q 2XSCA 1CA6A 1VQLA 5C4JB 2SNSA 1IW7C 5ELBA 1NSNS 1QUQA 1TWGB 5NUCA 4F7XA 5M3MG 3M4PA 4A3EB 1KIXA 1I94Q 4K0KL 2L11A 2L5TA 1PTOC 1E1TA 1NR4A 2RSOA 2FINB 1PVOA 3H0GB 3D6CA 2F0FA 1EOVA 1Q8KA 1ET6A 5KRUA 3FKIB 1WJJA 1XX8A 1N32L 1R4PB 4MN3A 2ASBA 1A15A 4X66L 3PF5A 4B9XA 3K5NA 2PNRC 4B3TL 4LW1A 1ENCA 3EFXD 1ESRA 2XGTA 1A2UA 5EBCA 2EZVA 5C3EH 1KDBA 1GOZA 2EOTA 3B6YA 2R7ZG 2B2WA 1J9OA 5HGTA 4IUNA 1SMYC 2NZ1D 4G7HC 1BKBA 1B2TA 1B50A 2DN8A 5CORA 5ELNA 4RMFA 2X6LA 2CW0C 3DLLA 4A3IG 4LF7L 1YZ6A 1YIJA 3GTQH 4DAVA 2JEAI 4A3CH 2E2IH 1MD2D 1PRTD 3RUZA 5C0XG 2M2LA 2JA9A 4QF4A 4DV6Q 4U68A 4DV4Q 1HNZQ 2EPBA 4IOAA 1GUSA 1FNVA 4DR1L 1WTOA 3I3CA 3RZOB 2B2UC 3H94A 1C48A 5I9OA 3P20A 2R92H 3CPWA 2E2JB 1VQMA 2EJGC 4RHRA 3DWQA 4A3JH 4TVAB 3DWAA 1CHQD 5CV9A 3CC7A 2C5CA 4LFBQ 3GTPB 4HJAA 2RDGA 2F0EA 5ELDA 2UXBL 4RGTA 4DR7Q 4KHPQ 4OWTB 4I7ZC 1FJGL 4UPAA 3M3YH 2A6EC 2K5NA 4AQYL 2X69A 4L5QA 2ICIA 4BBRG 1STGA 3M4OB 5FJ8H 2H5XA 5JJLA 1NAPA 1Y14B 1XTDA 2F3VA 5M3FH 2JA8G 4XTCS 5JAVA 1M90C 4ZKCB 2KHJA 2BE5D 3S1QB 3V96A 2A69C 4P73A 3T1YL 3TS0A 1PH9A 3GTMH 1SRUA 3PQIA 2EYLA 4KV6A 3J7AF 1Z9FA 2UXCQ 2AWOA 1SJED 1G6PA 3C2PA 4OX9Q 3J80i 3EQLC 5M5WH 1AE2A 2K14A 2K75A 4JYAQ 4ABNA 3RNUA 5M5YB 2AQ2B 5C0XJ 1AP0A 3TN2A 5C44G 1LO5D 2B39A 2TSSA 4A3FB 3KDFB 1TWHH 1ICFB 1SYCA 5KYIA 3CCEA 4WORA 2F4VL 4L5TA 1CTMA 4OWWB 2CH4W 2XN9C 1GUNA 1LTTD 1VQIA 1U4MA 1B9MA 1X6OA 4RAUC 1N36L 1F2LA 4DAYA 3U9OA 2RF4A 2GVAA 5D3IB 1WTWA 3ZJYC 1G2SA 4NXNL 2MNAA 3CCMA 1K9MC 2A74C 1PTOF 1TWCH 3GTGB 4IURA 1N8RC 3K57A 1EEID 1JMCA 4K2KA 1WCMG 2NTSA 3AFQA 4ZUJA 4OGQC 4J1MA 3OIQA 5C3EB 5IGCA 4H0LC 3CCSA 4JV5Q 2YYZA 2KEEA 2VL6A 4C3JG 4CDDC 1Q82C 5ELFA 2F0SA 1K8GA 2A1AA 1CT1D 5A2QE 4TQUS 2YU9B 1CK1A 5GAHC 1HCZA 1PZKD 2KQ3A 3NXWA 1E7ZA 4JBJA 4NP5A 1S72A 3FRPB 3NP8A 1NCVA 4DV7L 3LX0A 2AMCB 2B8GA 2EY5A 1XNRQ 3HOYG 2E2IB 4LNQA 5COYA 2E75C 4R8NA 5C3XA 4Z9CB 2WB1B 3HOWB 1TXYA 2NZOA 3HOVG 3PO3G 3VR4A 1J6QA 4G7ZC 4R4CA 4LF5Q 3I4OA 1PH6A 5IGGA 1OXSC 3KBXA 2G9HD 2E2HH 1HH2P 4RG1A 1N33L 4A3JB 4LMQD 4R4QA 1VQFA 2ZXPA 4LF8L 5I6WA 1J8IA 1EYAA 1V1OA 2RHSB 1SNPA 1V9PA 2I46A 4ME3A 1EY0A 1PDQA 1QG7A 2KUMA 3R93A 4A3BG 1PRTB 5LMNW 4X64Q 5BR8Q 2B2YC 4F87A 5ISRA 5LMNQ 3DUZA 4IJLA 4OO1I 3M3YB 2Z6KA 3R2TA 4ID6A 3X3MA 2I0QA 4FF1A 2PI2A 1PLFA 4DGZA 1D1KA 4B3SQ 2BA1A 3L2PA 5M3FB 1Q1EA 2AUJD 4N9PA 2ZXRA 5CV8A 1DOMA 1T5XD 3IRBA 1VQNA 3KOJA 3OWFA 1CZGA 3TP7A 1QNKA 2UUAL 2IX1A 4QQBX 1LTID 2CQOA 2D5DA 4YY3L 5T1IA 2ID0A 2O2LD 1JJCB 2QEJC 4XQJA 4DR3L 1V43A 2K03A 3BZCA 2BH2A 1TWHB 2WB1E 1NBWA 3S2HH 1H9SB 4GLXA 3VA7A 2IX3A 2F0QA 4CDFC 2B3GA 2G5DA 1WFQA 3H09A 4DV2L 3PO2G 3GTOH 4IUUA 1X3FA 2ZJRA 2YTXA 2R93B 4A93H 3TEHB 2CHBD 2ZM6Q 4YHHL 1GVPA 3K6OA 5CMDA 1JJ2A 3W3AA 4R4OA 2K5QA 4JVZA 1TWCB 1A63A 4MHEA 2NBFA 5JPNC 2F3WA 4XT1B 4QCLA 5EPLA 1Y1WG 3S17B 1X3PA 2Q8TA 2AQ1B 1JQYD 1WOCA 1XTCD 1HPCA 1ZEQX 3CMEA 2F0NA 5CBEE 1DM0B 4NKLA 4OELB 5IGFA 2CKZB 1PXUA 2LMCB 2VB2X 3K80C 2JYOA 5FO9B 4JI7L 2DY7A 3MEFA 2DNEA 3E3XA 1X3GA 4A3KG 2UUCQ 4BY1B 2QKIC 1S4ZA 3IFDA 2WKDA 3M9BA 1W6KA 1MHWC 3MXPA 3D4DA 1GUTA 1DD2A 2OQ0A 4G4KA 4HMJA 1TY2A 2HD3A 4GKJQ 1PFMA 1B7YB 2RCNA 1VQGA 2LS01 5IOCA 2A6HD 1IBKL 2ATWA 4C3HG 3J7ZC 1DOLA 5KNBA 1NTGA 3KUPA 4GNXA 1A3VA 3OW7A 1SFOH 4E6IA 2K28A 3SK4A 3CW2C 3I7FA 3KYHC 1TKWB 4L5RC 1RTOA 1K3BC 1PZJD 2H4OA 3DEOA 5EKIA 1UE1A 5IYCH 4HCSA 1VQEA 3S14H 1IBML 4TSSA 4GOPB 3Q23A 5EPKA 1QVFA 5FKAC 2EYFA 3TBIB 3A5ZB 2I5MX 4A3GG 3EJIA 4IUPA 4TKOB 4JI5Q 5CV5A 3PGZA 3TDQA 3T16A 3AFPA 4DFAA 4LJZC 2L1BA 1G51A 2IPKD 5M5XB 3W1BA 4K8IA 2XWBB 3ONAB 3SEBA 1X32A 5J22A 1Y1VG 1STNA 2HIXA 1PRTC 1FGUA 4BY7B 1BQQT 2MO1A 1HNXL 1U9RA 1KABA 1SYGA 1VQDA 3H91A 1HNWL 1A62A 2J7ZA 1T5EA 1TWFB 1I4PA 2BA0A 1S5DD 3HFZB 3HS0C 3HOZG 5CGKA 3O13A 4YCWA 2ZTDA 3KK7A 4CKBA 1NUCA 3BYTB 2VUMG 2NVXH 4RKBA 1R9TH 2F0MA 3TZUA 2R7ZH 2NVYH 1I50B 4IALA 4B3RQ 2WP8J 1AH9A 1OXVA 1XPUA 4XYOA 3WOEA 1LM0A 1K3RA 2NB0A 1TS3A 3E5SA 3EN2A 3CQZB 4GN4B 5DAUA 1DGSA 1X3QA 1NE3A 1FNUA 3HP3A 2ICEC 1TWAH 4XYQA 2EQSA 4MTKA 4LF6L 2JA7G 1P16A 4XQQA 3GO5A 3GV3A 4ME5A 2DGYA 3FMCA 1D8LA 2UU9L 4BBSG 4UHVA 5E3FA 1W6JA 5IP7G 1XMOL 1ILPA 4DV3L 4HIMA 1EWHA 2B2TA 1UE7A 2Q2IA 3DXJC 2BE5C 5IWAL 2WAQG 2EXDA 1EWIA 3WOFA 5EJWA 4QGUA 1PH4A 1Q81C 2O5IC 3L0OA 4UP7A 1SYFA 1N34L 2PW7A 4U673 1EFID 3HOXG 4LF4L 4Y7NH 1L2FA 3CAMA 4ZLTF 4DR6L 2IX0A 4JI2Q 1CSPA 5D3DA 3PIOA 1BUVT 2K32A 1F2YA 1MSGA 1NMGA 3CKIB 3CCVA 3AQQA 1DJRD 4L6TB 3OSOA 4A3DH 2RQXA 4JBWA 1SNDA 1YNNC 1Q8IA 2WKCA 4JI4Q 2NN6G 3TP5A 4JV5L 1QUQB 4BBRH 2JA5G 2JA6B 3I4NB 3CC2A 1UAPA 1C4QA 1KHIA 1JT8A 5JVG3 4KMUC 1TQOA 4GKKL 2JA8H 2RSNA 1WD1A 4RGNA 4V0BA 2QEXA 2YV5A 2PZWA 1EQTA 1XXGA 1HR0W 2Z0SA 1TU2B 1HR0Q 2CH4A 4CBVA 1AE3A 1LTLA 1AEXA 5FO7B 4CGYB 1VQ7A 3I90A 3RMHA 2FMMA 3MFYA 3PMFA 1CQVA 3RR5A 1EY4A 1D7QA 3LGJA 4X3SA 3K7UC 2F0LA 1JWUD 5IGDA 1XMQQ 3HZXA 1L0YB 2F0GA 4GOPC 2CCZA 3PF4A 4L5SA 3PCOB 3MEHA 3K5LA 4DUZQ 2KECA 5C0XI 1SNMA 2E5LL 1PH3A 5CV4A 1P8LA 3URYA 3CRKC 1WTXA 4J6HA 1YNJC 3N52A 3J81j 4H44C 4B08A 1IL2A 2B63G 4PMBA 2BCOA 5CC4A 4O2DA 5JEAG 3SVMA 2FXQA 1PRTF 3BVZA 5C3WA 3T13A 2B2UA 3SK5A 3HOUG 3CD6A 1HA5A 3QWNA 1FNWA 2MP1A 3JC66 5I9PA 3MXNA 5C4XG 3DM1A 4KY5A 2C35B 1WTHA 3GTLH 3X3NA 3EROA 1F9RA 2VB3X 2NVYB 4K5WA 4C3JH 5BN4A 5FLXE 4HJ8A 5M9OA 1JC7A 3CRLC 4A3MB 1NMFA 5G3LF 3OMCA 2O5JC 1H9RA 3A55A 4RCOA 4PMWA 5FLMH 1XNQL 1SR3A 2ALYB 4K8JA 2E74C 1GUOA 2EIFA 1TWAB 3L3OC 2DUDA 5GAEC 1PA6A 5K36G 1GO3E 3OTOL 1HA6A 1HJPA 1H95A 5EKKA 2VY3A 2Y0SB 5HY6A 2D0PA 2SOBA 4A3EG 4FYDA 4YWMA 1BDOA 2F0IA 3HOVH 1S5CD 2K33A 3G48A 3E9HA 2RHQB 4HJ5A 1VS0A 3FDTA 1TT2A 4APVA 4NXMQ 4C2MH 4ZCKA 3H0GG 4Y7NB 3C3LA 3FKIG 4G57A 4DNIA 4B3ML 2VQFQ 1EYCA 4DAMA 1VF7A 2F0TA 4LFCL 2SEBD 1OXXK 1IBLL 1IYUA 2PQAA 4RHSA 3VYTA 2OWOA 3S16B 1G8ZD 3GTJH 1I6HH 1SYBA 3FEWX 3UE1A 1QWYA 4A3DB 2CWAA 5FOBB 4N8FA 4DV5L 2HIVA 4JI0Q 1K0RA 2PW5A 5JEAJ 3K8AA 1II3A 1VQ5A 4IQZA 4CJ1B 3W1GA 1X54A 1KRSA 1VCIA 2YTYA 1SE4A 3A8IE 1RHPA 2IHEA 4RCNA 2QILA 5KGUA 1U5KA 4FF2A 4DV1Q 4DR4Q 1A3UA 1KLGD 4KJNA 4WFN3 5FLXc 5IYBG 3JAML 5LMUL 3OIPA 3PV0A 3STBC 3NBHB 3PIP3 1RDPD 4H13C 4CDEC 3BDLA 2L55A 1VDZA 3TMEA 5C6AA 5JVH3 5D65A 2Y0SE 2JN4A 5EGTA 3AU7A 2VQEL 4JI8Q 4JBKA 2JEBI 3OPOA 4IZ8A 1ZYRD 4BA2I 1MJCA 4M8AA 4XIGS 4JI3Q 3S1NB 3SR1A 3PO2H 2F0WA 1Y8PB 1LTRD 1U4LA 2IHFA 3J7A5 1VQBA 2K7VA 1O7IA 2JSOA 3T4AC 5HGQA 3H3VC 3D0FA 1WTRA 2RCFA 4DR5L 1IXRA 1YITA 5C5MA 1RF2D 1G291 1C8CA 1VQOA 1HTPA 2LXJA 2ZTEA 2Z4IA 3M85A 1IZ6A 4C56C 1AZPA 1LTSD 1EIYB 4OO1H 3KLSX 1UWVA 2MQHA 5DM63 1VQCA 2KCTA 2F0JA 3NBIA 4X3TA 4DUYQ 1I4HA 2V4DA 4FF3A 2R6GA 1TS2A 1HXYD 2EYMA 5FJ8G 2Q2UA 4R9WA 1LTBD 2KOLA 4IFDG 4A3KH 1BCPD 5FO8B 2GVBA 4QJFA 4K14A 4EVOA 3K5MA 2IL8A 2AWNA 4HIDA 3A5UA 5IE8A 4DNTB 2B2YA 3ULLA 4A3FG 3SHLA 5IGEA 2UXDL 4X62Q 1KDCA 2LY7A 2R7FA 3QIAA 3U4VA 1Q46A 2SNMA 4DKAC 1L0XB 3KF8B 5DLQE 4DNRB 3OMGA 2K5VA 1KQSA 3S1MH 4X3KA 5A35A 1MKHA 2K4KA 3RN2A 3M7GA 1RCVD 3GTQB 4AH6A 4C3IH 1SROA 3K58A 4OEMB 4I65A 4MTNA 2PNHA 3ERSX 1HZBA 1HZCA 1BF4A 2QW7A 5D14A 4OWXB 1YEZA 1HRJA 5JJZA 1S5FD 1M1KC 2D62A 1F9QA 4CKEA 3CCUA 3GTJB 3S2DH 2FMCA 3SE0A 4MNOA 4LK1C 2WIIB 5C3EG 4DAPA 3QG1A 2R92B 3CCQA 5AFWA 1SYDA 4FO2A 3KJPA 1Y1VH 4A76A 3CC4A 4Y52H 2MJ8A 4FDBA 1EZ8A 2RDFA 1IW7D 2OEOA 1HFGA 4P74A 1EFWA 3W5OA 3GDEA 3MFGA 1U0LA 4EQNA 3D4RA 4JI4L 4DXGA 4IFDJ 4LF9L 3MZ5A 1RIPA 2FHTA 4KHZA 1Q90A 4LAAA 4LWCA 5AJ3L 1GKHA 1FGBD 2VUMH 1J5EQ 1RL2A 5CBAE 3G4SA 2LSSA 2WB1G 2ZXOA 2Q2TA 2F03A 3HOWG 1E3PA 3HRZC 3K7AH 3I72A 2E76C 1EWCA 2NVTH 1MSHA 1RJTA 4FP5D 4AIMA 4LFAL 1MIUA 4CJ2C 3GTMB 2VW9A 5EKLA 5JOBA 4RWSC 3KJOA 4K0KQ 4A3JG 2JA7H 2EYHA 5EBDA 2OCEA 1JWMD 4EGVA 1PZID 4G7OC 3OHXC 4XXEA 5M5WB 3NTKA 2N88A 1PTOH 4BBSH 2EXZA 5IP7H 2P5ZX 2D2CC 1JR0D 1PH1A 4DA2A 2PZUA 4WJ3M 1Q1BA 2N49A 4X65Q 1N32Q 2CW0D 1PYWD 3C1FA 4DV0L 2HHHL 1SXTA 1XWEA 1A2TA 4X66Q 4O1NA 1B3QA 4B3TQ 3IFTA 1LABA 3GD7A 3OOCA 1E2VA 4WJ4A 3NEMA 4JI1L 1UNSA 4DR2Q 4JI6L 5M3FG 4KHVA 5EPJA 4KN7C 4XT3B 4GNXB 4PZ6A 1LT6D 1L1OB 1QCBD 1IL8A 2KHIA 1Y8NB 1H9KA 2KBNA 3RD4A 4Q5VA 4JPBW 1I94L 1V1PA 1X55A 1KLUD 1TVXA 1Y69U 4HCEA 4OHJA 3F2BA 5CR3A 3RLFA 3M4QA 4LF7Q 1SE8A 1Z6HA 4POFA 1KAAA 1FYCA 2JA5H 4QL5A 1PYBA 4J8QA 4YCUA 1FD7D 2I07B 2HQEA 3K0YA 4L63B 1WVLA 1EIHA 3TRZA 2I5LX 2D9UA 2KCCA 1WD0A 4DR1Q 3J80L 1SE2A 1SJHD 3D4WA 1UE6A 1HHVA 1SBBB 2R93G 4F8MA 3T53B 3BJUA 4MIUA 4R4TA 1NNXA 4QB4A 2L0CA 1K8MA 2C9OA 4C3IB 2YTVA 4IN3A 1BCPB 2KENA 4AYBB 1B3AA 2UXBQ 2XIWA 1Q86C 2HCIA 3TZDA 4ZRZA 2B29A 4JCVE 1PH2A 1FVIA 1QILA 3NQIA 4CJ0B 5E7NA 3MA2B 1FJGQ 3KF6A 1JE5A 2EY1A 2A19A 1SMXA 5I6YA 1K83H 4DV6L 3BZDB 4AQYQ 2IY5B 2OTJA 4DV4L 2NYZD 1DOKA 1EU3A 1Q3LA 2EY6A 3CCLA 2E2HB 1ASZA 4KY6A 1HNZL 2F52A 3U9SA 4DU9A 4DPGA 3HKZB 1H9SA 4JOIC 4BY1G 2OQKA 1JWSD 1JOKA 1GHJA 3G7LA 3CF5A 1R4QB 3T1YQ 4PMCA 5JEAH 3NTIA 1PMRA 1BVSA 5M3MH 2OXPA 4IPHA 3HOUH 1AZQA 4YWKA 5C4HA 1LT5D 2JK8A 1JJGA 2EJMA 2XNAC 4K2LA 3DMUA 3M4YA 4JBMA 1EY9A 1EIFA 3CCRA 1ASYA 3NE5B 4DR7L 4KHPL 1E24A 4EQOA 2CWPA 4ILWA 1EQQA 4PNYA 1HQRD 4DK1A 2NVTB 3C46A 2NN6I 5I4DA 2F4VQ 3BZKA 1EEFD 1I6VC 4N9TA 3TQYA 1WTQA 3BDOA 4NDXA 2L4NA 3ULJA 3SK6A 1U4PA 1VQHA 3QOLA 3I4MG 1N36Q 3T1HQ 5K36H 1E1OA 5C4JH 2O4XA 2F0UA 5TSSA 1BBWA 4HN7A 4NXNQ 3D6WA 4PG3A 4AYBE 1O7LA 2UXCL 1HUNA 5ELEA 3FPUB 2JQOA 1PFBA 3G71A 4OIKA 3I70A 2EYJA 4OX9L 4X6AH 3S2HB 4A3IH 2ZT9C 1YJNA 4BY7G 4JYAL 3I4LA 5C0XH 1EQVA 1KXLA 1CKNA 4B9WA 1NJIC 2I5HA 3GTOB 1EQRA 4JK1C 3I55A 4KKSA 1C7YA 5DM73 3J7AV 5JJKA 4A93B 4P71A 3HKZE 3AMUA 4ZAIA 1TY0A 1VF5C 1U4RA 1L1OC 2B8FA 5IYDG 2QF7A 1ZYRC 3S1RH 4DV7Q 4OL7A 4GOPA 2CVRA 3U4ZA 2ES2A 4DUYL 5IP9G 2JA5B 4FXKC 1M4VA 3RLNA 1HUMA 1ONLA 3F8TA 3H6MA 4NB3A 1VQ9A 3S15H 1B53A 1M8AA 3NUCA 5IT9L 4OIJA 1VQ6A 2JE6I 1GUGA 1DXMA 1KD1C 4RKLA 1G91A 3VR3A 4DN4M 2B2VC 3A74A 3SGIA 3UDFA 3MVVA 1LACA 1G2TA 2K52A 3QO2A 1N33Q 4ZYSA 1K8OA 1HZAA 3ND8A 5GQOA 5BN5A 1B44D 3C1EA 3RZOH 3E0JA 3MXNB 2F3IA 1F77A 4PZ7A 4UDUC 1BCPC 1Z7TA 1HTLD 4KKUA 4RGMA 3UDGA 3QB3A 3PUZA 2N3SA 4FXGC 1XNRL 4LUZA 3DHQA 3VR2A 2MO0A 2ENBA 2QDLA 1SFOB 1SNQA 4BWGB 4GS3A 3ND9A 4KJOA 2GN5A 4HJ7A 1ZXTA 4POGA 4C1NK 1H9MA 1UEBA 3VA5A 5C44H 4RA8A 1YJWA 1STEA 3S14B 3GP7A 1SE3A 1TS5A 2KEDA 4LF5L 1W2BA 4UY8C 2JA6G 3I4NG 3VYSA 5M3MB 1SEBD 4PV1C 1PH7A 3MTSA 1C0AA 4YY3Q 2NVQH 2MPMA 4QUCA 2B2TC 5JJIA 1E2WA 3RN5A 4LUOA 3CMAA 2K1BA 1B9NA 1SAPA 4DR3Q 3PSIA 4HAEA 3K0XA 5E4WC 1OO9B 1RTNA 4Q0FA 4X64L 4QIWB 3SXHA 3WDNA 5BR8L 5LMNL 1E2ZA 1WCMH 3D3RA 3MC0B 1A6XA 1IYVA 1SNOA 5M5YH 4DV2Q 1E0BA 2NVXB 3CXCA 4B3SL 1R9TB 2R7ZB 2E8GA 4JC0A 2QGQA 4EQ5A 1X65A 3HG9A 4YHHQ 1XPOA 3J81L 4NMZA 2RVLA 4XDXA 1BBUA 2LXKA 2EVBA 1TS4A 3NWTA 3P75A 1PH8A 3BDCA 1I4XA 4KD4A 1B8AA 3P7JA 1HZ9A 2EYPA 4A3IB 3HEJA 2NTTA 1CKOA 1EUJA 3HKSA 4A4IA 3HOYH 1EIGA 3GTGH 2RKSA 2WFWA 4X65L 2J0TD 4JI7Q 1UE5A 1PHJA 4OXPA 5CV6A 3OW2A 1WTPA 3PO3H 1YI2A 2NWGA 5KYLA 1EL0A 2LKVA 4R1JA 1JE4A 4UAIA 4DR2L 3S1RB 2DJFC 4ULLA 3QOJA 1STHA 3I56A 1X9NA 4KI0A 5K5PA 2ZM6L 2Z1CA 2CQAA 4A3MG 2YU9H 3NENA 2OF1A 2F0HA 2ZJPA 1K8AC 3NHHA 3A8KE 3HGBA 1LT4D 1LT3D 1SN8A 4BXXG 1IBKQ 3S15B 3MXUA 5IT9c 1B1ZA 2KJXA 4K6DA 1GXDC 2HQLA 2MFIA 4GLAC 4A3BH 4QIWE 1CZWA 4HR7B 1HFNA 3NTHA 3UE0A 2Y0SG 2QDBA 3L9AX 1YVCA 4BBRB 3J81E 5KNCA 2OT2A 3BVGA 4JG2A 2QA4A 4WJWA 1Q12A 3HOWH 1IBMQ 2UUCL 4DAYB 1N9WA 2D0OA 2JA8B 4IFDI 3TP8A 4BS9A 3NELA 5T1GA 2DY8A 5G3LD 3T56B 3SK8A 1QVCA 1O7YA 3E9IA 4L8JA 1LV9A 1PFSA 3A8JE 3KLWA 4GKJL 1BOSA 3TSSA 1BCPF 4S3SA 5LL6S 1HNXQ 1HNWQ 2A5HA 5C44B 3KLSA 4PZ8A 4A3DG 1A3TA 3Q0AA 4LUVA 3M7NA 1BBXC 2Z9HA 2MGSA 4A3LG 1EZ6A 1YBYA 4GZYC 5GADC 1A0IA 3NPPA 1UUPA 2B2WC 2K05A 1PYSB 4FF4A 3KBGA 1OTCA 2EDGA 1GJXA 2NVQB 3FHWA 2HUGA 2K50A 2Q8RE 2DNCA 5GROA 1DCZA 1EY5A 4JI5L 1D5XC 2A6HC 1QVGA 2ZTCA 1DYQA 5I2YA 3BVMA 2KHSA 5KEEA 3Q24A 4J15A 1YHAA 1SYEA 5A2QL 2FFKB 1WCMB 2L9HA 1Y1WH 4IJHA 4EX5A 4LF6Q 4K5VA 2UU9Q 3GTLB 1XMOQ 5IY0A 4CHTB 4HSPA 3LNNA 4C3JB 3JAME 4DV3Q 2NUCA 4ZK9B 4GN3B 3FPPA 1YNND 1CUKA 2XTIA 2F0DA 3PUVA 4X3UA 5IWAQ 3J81c 1WTVA 1PV4A 2MHVA 1F9SA 1IHZA 2JP1A 4R4IA 3QJYA 2IT1A 1N34Q 2R93H 4O42A 2EY2A 3T1HL 4B3RL 4LF4Q 2PMZB 4H7BA 1JCKB 5C5LA 2F4IA 4DR6Q 2FJ2A 4FNFA 3HOYB 1ENAA 4R8IA 3UDXA 1SDFA 3TREA 2RBMA 2WV6D 4HIKA 1Q7YC 3DWPA 4C3HH 1CM9A 2IW3A 3NBHA 3S17H 1CKMA 3MHBA 3R8BA 3HOVB 3PO3B 2XRSD 1HQMC 2A68D 3R2IA 3EVQA 4C1NI 2BH8A 1I4QA 4JW0A 3F2DA 3VYRA 2K5WA 4C2MB 3G6JB 3CHBD 1S40A 4ODGA 1GUWA 3UI2A 1WI5A 5F2DA 1QNUA 4YIJA 3A56A 2A73B 1K28A 5J3BA 4GKKQ 4BY1H 3L7ZC 3EA6A 4H02A 1QE6A 1D5MC 4WRDA 2Q8IB 5FLMG 3R3OA 1VQ4A 5IODA 4A3GH 2RDHA 1STAA 1I6HB 2Z8LA 3VR5A 3PIPA 2G9DA 3I2ZA 4A3BB 3KDFA 3A7AB 1DONA 2K6AA 1EY7A 4JI2L 1YNJD 3E6ZX 2HCCA 4KN4C 3NK9A 1CFMA 4RGOS 5C4ZA 3BS1A 1EU4A 1I3QH 1C9OA 2GA4B 3SDZA 1GD7A 2LFNA 4CKCA 1YNXA 2XRQD 5CYUA 4DK0A 3OYYA 3HOZH 1JICA 1PTOD 3Q8DA 3NQTA 4A3CG 3CCJA 3JAMc 3V05A 1QB5D 2V1CC 3DM3A 1V1PB 4GN5A 1H9JA 2UUBQ 2E5LQ 3I4MH 2PMZE 4LFBL 1UEAB 4HEDA 4ZQ3A 5FK9C 1DZ1A 4O0AA 4HSVA 4UP8A 1BR9A 3F2UA 2PI2E 1NY4A 3PUXA 2EYOA 4XQNA 1HR0L 1D1IA 2R92G 5L37A 3AYHB 5M5XH 3J7YW 1YHQA 1STBA 5KNDA 4BY7H 2N55A 3KF8A 3PO2B 2TMPA 1D5ZC 1E22A 1KC8C 1ML0D 1CHPD 1SMYD 2HDLA 1TWFH 1ZKOA 3RZDH 3G6EA 2PYKA 1CA5A 1XMQL 3LWEA 4P72A 3MWYW 1L0WA 1Y8OB 4DUZL 2HT1A 3ITPA 4IPDA 1QZGA 1XNQQ 5IYDH 1YHBA 1F9PA 1AN8A 1I50H 3HOXH 1VQAA 1GHKA
chains in the Genus database with same CATH topology
1VMPA 1Y1WB 3K59A 2K01A 2F0OA 1LLRD 2KA7A 3BYYB 2XVSA 1EY6A 4A3KB 3I73A 2RA4A 3I8ZA 2NN6H 3BG3A 5CV7A 2PZTA 1BXTA 4QMGA 1S5ED 1MI2A 2AQ3B 3PUYA 2M9VA 1JB3A 2VNUD 4RH6A 2IWHA 3KLRA 3D31A 5J1ZA 5E1FA 5IGBA 2A6ED 4C3HB 3A7LA 1VMCA 3ERQA 1TR5A 4OO1G 2J4XA 3S1MB 5DNFA 4KKTA 1B4OA 2L12A 1D6EC 2Z4HA 3GQBA 4EQPA 5HURA 2BDNA 2A69D 1SSOA 2R3ZA 5DEHA 2BDOA 2PQEA 2F0VA 4A3GB 3S2DB 2KVMA 1QJOA 3CU7A 3V2TA 4F88A 3I91A 1F2MA 1Y1VB 5BN3A 1JOOA 2IJ0A 1I3QB 4NW2A 3PIO3 2E2DC 4DF7A 5LHY1 4PQXA 1KTKA 4FVMA 5E4XA 1D2BA 3HOZB 3LWUA 4C3IG 4M1UB 5IIFA 2VUMB 3J80E 1O80A 4ZUIA 1RD9D 4TRDA 1NR2A 3TP6A 3I4MB 1KDAA 3K7AB 1KNAA 1OXTA 1CI3M 4BA1I 3MXGA 2JXMB 4V190 2WINB 3Q6SA 3IKJA 5LL6X 2HDMA 1XYIA 1LTAD 2XWJB 2B2VA 3GV6A 2JA7B 4DXFA 4KY7A 1FR3A 3W2DA 1V8QA 3RZDB 1PTOB 4BBSB 1RODA 1BNZA 3A54A 2WAQB 1IKLA 3N6RA 1F2ZA 1TIID 1RKNA 4K5XA 1EYDA 1JORA 4HMIA 5J39A 3Q22A 3FVQA 3HOXB 1I4RA 2F0PA 1I4GA 1MGSA 2R61A 3NSWA 3OWEB 1MBYA 4KTAA 1BO0A 3D8GA 3K5OA 4KD3A 3NWSA 1JOQA 1G6ZA 1QOHA 2PCFB 1PFNA 4KK7A 4ZKBB 4HTHA 5I2XA 5KIXA 3AB9A 1AW7A 1ENFA 4QUFA 3S9WA 1KNEA 1CQFA 2SDFA 2X6GA 2WACA 1EY8A 3ZYYX 3GTKB 3IAYA 2QCPX 4FXDA 3MAQA 2PPBC 1Z47A 1ICWA 1OXUA 3IL8A 4IUVA 3VYUA 2K04A 3P1HA 1K83B 1O78A 3T51B 2F0KA 3PUWA 1LTGD 1STYA 4P2CB 1AFPA 4RFBA 2MUYA 1ILQA 1SNCA 2KCNA 5FLXL 2B63B 2PO4A 2A68C 3HOUB 2H1EA 5IT9E 2F1MA 2K5DA 4K6LA 1EOTA 5ELCA 5C4XB 1O7ZA 5EQ0A 2M00A 3VR6A 3DEPA 4IFDH 1S5BD 2EE1A 2EJFC 5JPMC 1ET9A 4IUTA 2BOSA 4IUQA 2AUKA 1IKMA 1ESFA 2VXWA 2XSCA 1CA6A 5C4JB 2SNSA 1IW7C 5ELBA 1NSNS 1TWGB 5NUCA 4F7XA 4A3EB 2L11A 2L5TA 1PTOC 1NR4A 2RSOA 2FINB 3H0GB 3D6CA 2F0FA 1ET6A 5KRUA 3FKIB 1XX8A 1R4PB 4MN3A 1A15A 4B9XA 3K5NA 2PNRC 1ENCA 3EFXD 1ESRA 1A2UA 5EBCA 2EZVA 1KDBA 1GOZA 2EOTA 2B2WA 1J9OA 5HGTA 4IUNA 1SMYC 2NZ1D 4G7HC 1B2TA 1B50A 2DN8A 5CORA 2X6LA 2CW0C 4DAVA 2JEAI 1MD2D 3RUZA 1PRTD 5C0XG 2M2LA 4QF4A 4U68A 2EPBA 1GUSA 1FNVA 1WTOA 3I3CA 3RZOB 2B2UC 3H94A 1C48A 5I9OA 3P20A 2E2JB 2EJGC 4RHRA 3DWQA 3DWAA 1CHQD 5CV9A 2C5CA 3GTPB 2RDGA 2F0EA 5ELDA 4RGTA 4I7ZC 2A6EC 2X69A 2ICIA 1STGA 3M4OB 1NAPA 2F3VA 4XTCS 5JAVA 4ZKCB 2BE5D 3S1QB 3V96A 2A69C 2EYLA 4KV6A 3J7AF 2AWOA 1SJED 3C2PA 3EQLC 4ABNA 5M5YB 2AQ2B 5C0XJ 1AP0A 3TN2A 1LO5D 2B39A 2TSSA 4A3FB 5KYIA 1SYCA 4WORA 1CTMA 2XN9C 1GUNA 1LTTD 1U4MA 1B9MA 4RAUC 1F2LA 4DAYA 3U9OA 5D3IB 1WTWA 1G2SA 2A74C 1PTOF 3GTGB 4IURA 3K57A 1EEID 4K2KA 2NTSA 4ZUJA 4OGQC 4J1MA 3OIQA 5C3EB 5IGCA 4H0LC 2YYZA 2KEEA 4C3JG 5ELFA 2F0SA 1CT1D 5A2QE 4TQUS 2YU9B 1CK1A 1HCZA 1PZKD 2KQ3A 3NXWA 4NP5A 3FRPB 3NP8A 1NCVA 3LX0A 2B8GA 2EY5A 2E2IB 5COYA 2E75C 4R8NA 5C3XA 4Z9CB 2WB1B 3HOWB 3VR4A 4G7ZC 5IGGA 1OXSC 3KBXA 2G9HD 4A3JB 4LMQD 2ZXPA 5I6WA 1J8IA 1EYAA 1V1OA 1SNPA 2I46A 1EY0A 1PDQA 1QG7A 2KUMA 3R93A 1PRTB 2B2YC 4F87A 5ISRA 4OO1I 3DUZA 3M3YB 3R2TA 4ID6A 3X3MA 4FF1A 1PLFA 4DGZA 1D1KA 2BA1A 5M3FB 1Q1EA 2AUJD 4N9PA 2ZXRA 5CV8A 1DOMA 1T5XD 3OWFA 1CZGA 3TP7A 1QNKA 2IX1A 1LTID 2D5DA 5T1IA 2ID0A 2O2LD 2QEJC 4XQJA 1V43A 2K03A 1TWHB 1H9SB 3VA7A 2IX3A 2F0QA 3H09A 4IUUA 2R93B 2CHBD 3K6OA 5CMDA 3W3AA 2K5QA 1TWCB 4MHEA 2NBFA 5JPNC 2F3WA 4XT1B 4QCLA 5EPLA 3S17B 1X3PA 2Q8TA 2AQ1B 1JQYD 1XTCD 1HPCA 1ZEQX 2F0NA 5CBEE 1DM0B 4NKLA 5IGFA 1PXUA 2LMCB 2VB2X 2JYOA 5FO9B 2DY7A 2DNEA 4BY1B 2QKIC 1S4ZA 3IFDA 2WKDA 1W6KA 3MXPA 3D4DA 1GUTA 1DD2A 4G4KA 4HMJA 1TY2A 1PFMA 2LS01 5IOCA 2A6HD 4C3HG 1DOLA 5KNBA 3KUPA 1A3VA 3OW7A 4E6IA 2K28A 3SK4A 1TKWB 1RTOA 1PZJD 2H4OA 3DEOA 5EKIA 4HCSA 4TSSA 3Q23A 5EPKA 5FKAC 2EYFA 3TBIB 3EJIA 4IUPA 4TKOB 5CV5A 3TDQA 3T16A 4DFAA 4LJZC 2L1BA 2IPKD 5M5XB 4K8IA 2XWBB 3ONAB 3SEBA 1X32A 5J22A 1STNA 1PRTC 4BY7B 1BQQT 1U9RA 1KABA 1SYGA 3H91A 2J7ZA 1T5EA 1TWFB 1I4PA 2BA0A 1S5DD 3HS0C 5CGKA 3O13A 3KK7A 4CKBA 1NUCA 3BYTB 4RKBA 2F0MA 3TZUA 1I50B 4IALA 2WP8J 1OXVA 4XYOA 3WOEA 2NB0A 1TS3A 3E5SA 3CQZB 5DAUA 1X3QA 1FNUA 3HP3A 2ICEC 4XYQA 4XQQA 3GO5A 3GV3A 4ME5A 3FMCA 5E3FA 1W6JA 1ILPA 1EWHA 2B2TA 3DXJC 2BE5C 3WOFA 5EJWA 2O5IC 1SYFA 2PW7A 4U673 1EFID 4ZLTF 2IX0A 5D3DA 1BUVT 2K32A 1F2YA 1MSGA 3CKIB 1DJRD 4L6TB 3OSOA 2RQXA 4JBWA 1SNDA 1YNNC 1Q8IA 2WKCA 2NN6G 3TP5A 2JA6B 3I4NB 1UAPA 1C4QA 5JVG3 4KMUC 1TQOA 2RSNA 1WD1A 4RGNA 4V0BA 2PZWA 1EQTA 1XXGA 1TU2B 4CBVA 1AEXA 5FO7B 4CGYB 3I90A 3RMHA 2FMMA 3MFYA 3PMFA 1CQVA 1EY4A 4X3SA 2F0LA 1JWUD 5IGDA 3HZXA 1L0YB 2F0GA 3MEHA 3K5LA 2KECA 5C0XI 1SNMA 5CV4A 3URYA 3CRKC 1WTXA 4J6HA 1YNJC 3N52A 4H44C 4B08A 4PMBA 2BCOA 5CC4A 5JEAG 3SVMA 3BVZA 1PRTF 5C3WA 3T13A 2B2UA 3SK5A 1HA5A 3QWNA 1FNWA 2MP1A 5I9PA 3MXNA 3DM1A 4KY5A 3X3NA 3EROA 1F9RA 2VB3X 2NVYB 4K5WA 5BN4A 5FLXE 5M9OA 1JC7A 3CRLC 4A3MB 5G3LF 3OMCA 2O5JC 1H9RA 3A55A 4RCOA 4PMWA 4K8JA 2E74C 1GUOA 1TWAB 3L3OC 5K36G 1HA6A 5EKKA 2Y0SB 2SOBA 4FYDA 1BDOA 2F0IA 1S5CD 2K33A 3FDTA 1TT2A 4Y7NB 3C3LA 4G57A 1EYCA 1VF7A 2F0TA 2SEBD 1OXXK 1IYUA 4RHSA 3VYTA 3S16B 1G8ZD 1SYBA 3FEWX 1QWYA 4A3DB 5FOBB 2PW5A 5JEAJ 1II3A 4IQZA 4CJ1B 1VCIA 1SE4A 3A8IE 1RHPA 4RCNA 2QILA 5KGUA 4FF2A 1A3UA 1KLGD 4KJNA 4WFN3 3JAML 3OIPA 3PV0A 3PIP3 1RDPD 4H13C 3BDLA 2L55A 1VDZA 3TMEA 5C6AA 5JVH3 5D65A 5EGTA 3AU7A 2JEBI 3OPOA 4IZ8A 1ZYRD 4BA2I 4M8AA 4XIGS 3S1NB 3SR1A 2F0WA 1Y8PB 1LTRD 1U4LA 2K7VA 2JSOA 3T4AC 3H3VC 1WTRA 5C5MA 1RF2D 1G291 1C8CA 1HTPA 2Z4IA 3M85A 4C56C 1AZPA 1LTSD 4OO1H 3KLSX 5DM63 2F0JA 3NBIA 4X3TA 1I4HA 2V4DA 4FF3A 2R6GA 1TS2A 1HXYD 2EYMA 4R9WA 1LTBD 2KOLA 4IFDG 1BCPD 5FO8B 4K14A 4EVOA 3K5MA 2IL8A 2AWNA 4DNTB 2B2YA 3SHLA 5IGEA 1KDCA 2LY7A 3QIAA 2SNMA 1L0XB 4DNRB 3OMGA 4X3KA 5A35A 3M7GA 1RCVD 3GTQB 3K58A 4I65A 1BF4A 5D14A 1HRJA 5JJZA 1S5FD 2D62A 1F9QA 4CKEA 3GTJB 2FMCA 3SE0A 4LK1C 2WIIB 4DAPA 3QG1A 2R92B 5AFWA 1SYDA 4FO2A 2MJ8A 1EZ8A 2RDFA 1IW7D 2OEOA 1HFGA 3MFGA 4EQNA 3D4RA 4DXGA 4IFDJ 3MZ5A 2FHTA 4KHZA 1Q90A 4LAAA 1FGBD 5CBAE 2ZXOA 2F03A 3HRZC 2E76C 3I72A 1EWCA 1MSHA 1RJTA 4FP5D 4CJ2C 3GTMB 5EKLA 5JOBA 4RWSC 2EYHA 5EBDA 1JWMD 4EGVA 1PZID 4G7OC 3OHXC 4XXEA 5M5WB 3NTKA 2N88A 1PTOH 2EXZA 2D2CC 1JR0D 4DA2A 2PZUA 1Q1BA 2CW0D 1PYWD 3C1FA 1SXTA 1XWEA 1A2TA 4O1NA 3IFTA 1LABA 3GD7A 3OOCA 1E2VA 1UNSA 4KHVA 5EPJA 4KN7C 4XT3B 1LT6D 1QCBD 1IL8A 1Y8NB 1H9KA 3RD4A 4Q5VA 1V1PA 1KLUD 1TVXA 1Y69U 4HCEA 4OHJA 5CR3A 3RLFA 1Z6HA 1KAAA 1FYCA 4J8QA 1FD7D 2I07B 2HQEA 3K0YA 4L63B 1WVLA 1EIHA 2D9UA 2KCCA 1WD0A 3J80L 1SE2A 1SJHD 3D4WA 1HHVA 1SBBB 4F8MA 3T53B 4MIUA 4QB4A 2L0CA 1K8MA 2C9OA 4C3IB 4IN3A 1BCPB 4AYBB 1B3AA 2XIWA 2HCIA 3TZDA 4ZRZA 3NQIA 1QILA 4CJ0B 3MA2B 2EY1A 5I6YA 3BZDB 2NYZD 1DOKA 1EU3A 1Q3LA 2EY6A 2E2HB 4KY6A 3U9SA 4DU9A 3HKZB 1H9SA 1JWSD 1JOKA 1GHJA 3G7LA 1R4QB 4PMCA 5JEAH 3NTIA 1PMRA 2OXPA 1AZQA 5C4HA 1LT5D 2EJMA 2XNAC 4K2LA 3DMUA 3M4YA 1EY9A 3NE5B 4EQOA 4ILWA 4PNYA 1HQRD 4DK1A 2NVTB 3C46A 2NN6I 5I4DA 1EEFD 1I6VC 4N9TA 1WTQA 3BDOA 4NDXA 2L4NA 3SK6A 1U4PA 3QOLA 5K36H 2O4XA 2F0UA 5TSSA 4HN7A 3D6WA 1O7LA 1HUNA 5ELEA 3FPUB 1PFBA 4OIKA 3I70A 2EYJA 3S2HB 2ZT9C 3I4LA 5C0XH 1EQVA 4B9WA 3GTOB 4JK1C 4KKSA 5DM73 3J7AV 4A93B 3AMUA 4ZAIA 1TY0A 1VF5C 1U4RA 2B8FA 2QF7A 1ZYRC 4OL7A 2CVRA 2JA5B 4FXKC 1M4VA 1HUMA 1ONLA 3H6MA 1B53A 1M8AA 3NUCA 5IT9L 4OIJA 2JE6I 1GUGA 1DXMA 4RKLA 1G91A 3VR3A 4DN4M 2B2VC 3MVVA 1LACA 1G2TA 3QO2A 4ZYSA 1K8OA 3ND8A 5BN5A 1B44D 3C1EA 3E0JA 1F77A 4UDUC 1BCPC 1Z7TA 1HTLD 4KKUA 4RGMA 3QB3A 3PUZA 4FXGC 3DHQA 3VR2A 2ENBA 1SFOB 1SNQA 4BWGB 3ND9A 4KJOA 1ZXTA 4C1NK 1H9MA 3VA5A 4RA8A 1STEA 3S14B 3GP7A 1SE3A 1TS5A 2KEDA 3VYSA 5M3MB 1SEBD 4PV1C 3MTSA 2MPMA 4QUCA 2B2TC 1E2WA 2K1BA 1B9NA 1SAPA 4HAEA 5E4WC 1OO9B 1RTNA 4Q0FA 4QIWB 3SXHA 3WDNA 1E2ZA 3D3RA 1A6XA 3MC0B 1IYVA 1SNOA 1E0BA 2NVXB 1R9TB 2R7ZB 3HG9A 3J81L 4NMZA 2RVLA 4XDXA 2EVBA 1TS4A 3NWTA 3P75A 3BDCA 1I4XA 4KD4A 3P7JA 2EYPA 4A3IB 3HEJA 2NTTA 1EIGA 2RKSA 2J0TD 5CV6A 1WTPA 2NWGA 5KYLA 1EL0A 2LKVA 1JE4A 4UAIA 3S1RB 4ULLA 3QOJA 1STHA 4KI0A 5K5PA 2Z1CA 2CQAA 2OF1A 2F0HA 3NHHA 3A8KE 3HGBA 1LT4D 1LT3D 3S15B 3MXUA 1B1ZA 2KJXA 4K6DA 1GXDC 1CZWA 4HR7B 1HFNA 3NTHA 2QDBA 3L9AX 4BBRB 3J81E 5KNCA 2OT2A 3BVGA 4WJWA 1Q12A 2JA8B 4IFDI 3TP8A 4BS9A 5T1GA 2DY8A 5G3LD 3T56B 3SK8A 1O7YA 4L8JA 1LV9A 3A8JE 1BOSA 3TSSA 1BCPF 4S3SA 5LL6S 2A5HA 5C44B 3KLSA 1A3TA 3Q0AA 3M7NA 1BBXC 2MGSA 1EZ6A 4GZYC 3NPPA 1UUPA 2B2WC 2K05A 4FF4A 3KBGA 2EDGA 1GJXA 2NVQB 2HUGA 2Q8RE 2DNCA 1DCZA 1EY5A 1D5XC 2A6HC 1DYQA 5I2YA 3BVMA 2KHSA 5KEEA 3Q24A 1SYEA 5A2QL 2FFKB 1WCMB 2L9HA 4K5VA 3GTLB 4CHTB 4HSPA 3LNNA 4C3JB 3JAME 4ZK9B 2NUCA 3FPPA 1YNND 2F0DA 3PUVA 4X3UA 1WTVA 2MHVA 1F9SA 1IHZA 2JP1A 3QJYA 2IT1A 4O42A 2EY2A 2PMZB 4H7BA 1JCKB 5C5LA 2F4IA 2FJ2A 4FNFA 3HOYB 1ENAA 4R8IA 1SDFA 2RBMA 2WV6D 3DWPA 1CM9A 2IW3A 3NBHA 3MHBA 3R8BA 3HOVB 3PO3B 2XRSD 1HQMC 2A68D 3R2IA 3EVQA 4C1NI 1I4QA 3VYRA 2K5WA 4C2MB 3G6JB 3CHBD 4ODGA 1GUWA 3UI2A 5F2DA 1QNUA 4YIJA 3A56A 2A73B 3L7ZC 3EA6A 1QE6A 1D5MC 4WRDA 2Q8IB 3R3OA 5IODA 2RDHA 1STAA 1I6HB 2Z8LA 3VR5A 2G9DA 4A3BB 3A7AB 1DONA 2K6AA 1EY7A 1YNJD 3E6ZX 2HCCA 4KN4C 3NK9A 1CFMA 4RGOS 5C4ZA 3BS1A 1EU4A 3SDZA 2GA4B 2LFNA 4CKCA 2XRQD 5CYUA 4DK0A 1JICA 1PTOD 3NQTA 3V05A 1QB5D 1V1PB 1H9JA 1UEAB 4HEDA 4ZQ3A 5FK9C 1DZ1A 4HSVA 1BR9A 3F2UA 3PUXA 2EYOA 4XQNA 1D1IA 3J7YW 1STBA 5KNDA 2N55A 3KF8A 3PO2B 2TMPA 1D5ZC 1ML0D 1CHPD 1SMYD 2HDLA 1ZKOA 2PYKA 1CA5A 3LWEA 3MWYW 1Y8OB 3ITPA 1F9PA 1AN8A 1GHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I9P A;  4ID6 A;  4WOR A;  2HQE A;  5IOC A;  4KY5 A;  5HGT A;  3MHB A;  4IUN A;  1SYF A;  2PW7 A;  3ERO A;  4K5W A;  1SYD A;  2EYJ A;  3P1H A;  2F0O A;  3EVQ A;  4DGZ A;  3TP8 A;  5M9O A;  4IZ8 A;  4N9P A;  1EZ8 A;  2F0K A;  4ODG A;  2RDF A;  3OMC A;  5CV8 A;  2OEO A;  1EQV A;  3D4W A;  5F2D A;  4YIJ A;  3SK8 A;  3SR1 A;  3U9O A;  1A3V A;  2F0W A;  4B9W A;  1EY6 A;  3OWF A;  4E6I A;  3TP7 A;  3SK4 A;  1STY A;  4F8M A;  4K8J A;  3SXH A;  4KY7 A;  1F2Y A;  4EQN A;  3RUZ A;  3OSO A;  4MIU A;  4QF4 A;  4WRD A;  1SNC A;  5CV7 A;  3R3O A;  4QB4 A;  1SND A;  3MZ5 A;  2PZT A;  4QMG A;  1SNO A;  5IOD A;  1STA A;  4S3S A;  4LAA A;  2EYF A;  4K2K A;  5EKK A;  5C5M A;  3TP5 A;  1A3T A;  4ZUJ A;  3EJI A;  5CV5 A;  4J1M A;  4OL7 A;  1EY7 A;  1EZ6 A;  2SOB A;  3T16 A;  4DFA A;  1F2Z A;  5IGC A;  3NK9 A;  5I9O A;  1RKN A;  1TQO A;  5J1Z A;  5E1F A;  2F0I A;  1EYD A;  4K5X A;  2M00 A;  2EY1 A;  4HMI A;  4K8I A;  5C4Z A;  5IGB A;  5J22 A;  5J39 A;  1JOR A;  4NMZ A;  1STN A;  5I6Y A;  2F0J A;  2F0S A;  3H6M A;  1TT2 A;  3P75 A;  2F0P A;  3ERQ A;  1TR5 A;  3BDC A;  2F0Q A;  5CV9 A;  4KD4 A;  1U9R A;  2EY6 A;  5IGE A;  2PZW A;  1KAB A;  1SYG A;  3NUC A;  2EYM A;  4KY6 A;  5EKL A;  2EYP A;  5JOB A;  2KQ3 A;  3HEJ A;  3NXW A;  2F0E A;  3NQT A;  4DU9 A;  4KTA A;  4G57 A;  1EY5 A;  4NP5 A;  4EQP A;  2EYH A;  1EYC A;  3NP8 A;  5HUR A;  2F0T A;  4RKL A;  3D8G A;  1JOK A;  4K14 A;  3LX0 A;  5CGK A;  4EVO A;  1AEX A;  4PMC A;  4KD3 A;  2KHS A;  2RKS A;  5DEH A;  2EY5 A;  3MVV A;  5KEE A;  2EXZ A;  1JOQ A;  1SYB A;  2PQE A;  1NUC A;  3PMF A;  1SYE A;  2F0V A;  1EY4 A;  2SNS A;  2OXP A;  4RKB A;  5CV6 A;  3SHL A;  2PZU A;  2PW5 A;  4ZQ3 A;  1NSN S;  4R8N A;  1KDC A;  2F0M A;  2F0L A;  5NUC A;  1STG A;  5C4H A;  5C3X A;  3C1E A;  3C1F A;  4IAL A;  4F7X A;  5IGD A;  5KYL A;  1A2T A;  2SNM A;  2F3W A;  2LKV A;  3HZX A;  4HTH A;  2EYO A;  2F0G A;  4K2L A;  4K5V A;  1II3 A;  3DMU A;  2F3V A;  3V2T A;  5KIX A;  1EY9 A;  5JAV A;  3QOJ A;  1F2M A;  1STB A;  2NUC A;  3MEH A;  1STH A;  2F0N A;  3OMG A;  4NKL A;  4EQO A;  3QB3 A;  5K5P A;  3E5S A;  1SNM A;  2F0D A;  4PNY A;  5DAU A;  5IGG A;  5CV4 A;  4KHV A;  1JOO A;  5IGF A;  3S9W A;  5KGU A;  2OF1 A;  2EYL A;  3D6C A;  2F0H A;  2F0F A;  2ENB A;  3DHQ A;  1IHZ A;  3NHH A;  4J6H A;  4KV6 A;  1SNQ A;  4DF7 A;  2WAC A;  5KRU A;  4KJO A;  1EY8 A;  4N9T A;  2EY2 A;  1A3U A;  2PYK A;  4K6D A;  4KJN A;  4I65 A;  3VA5 A;  5I6W A;  4H7B A;  4ME5 A;  4NDX A;  4B9X A;  4PMB A;  3SK6 A;  5C5L A;  1EYA A;  3MXP A;  3QOL A;  5CC4 A;  1ENC A;  5E3F A;  5CR3 A;  1SNP A;  1A2U A;  3D4D A;  5IIF A;  1EY0 A;  1ENA A;  5C3W A;  2O4X A;  2F0U A;  3ITP A;  3BDL A;  3T13 A;  3SK5 A;  2RBM A;  4ZUI A;  1KDB A;  2QDB A;  5KYI A;  3TME A;  1SYC A;  4HMJ A;  4TRD A;  3TP6 A;  5C6A A;  1KAA A;  5ISR A;  5EGT A;  1KDA A; 
#chains in the Genus database with same CATH topology
 1VMP A;  1FL0 A;  1Y1W B;  3K59 A;  2CFM A;  3KF6 B;  5IP9 H;  3OTO Q;  2K01 A;  2F0O A;  1LLR D;  2KA7 A;  4I7A A;  3CQZ H;  3BYY B;  3ER0 A;  1KAW A;  4JOI A;  2XVS A;  1EY6 A;  2AHO B;  4KLK A;  4CDC C;  4A3K B;  3I73 A;  2RA4 A;  3I8Z A;  3F1Z A;  2DJG C;  2NN6 H;  3CPF A;  3H15 A;  3BG3 A;  5CV7 A;  2PZT A;  1BXT A;  4QMG A;  1S5E D;  1WYD A;  3A0J A;  1YJ9 A;  3WWV A;  1MI2 A;  2AQ3 B;  3PUY A;  2M9V A;  1JB3 A;  4B3M Q;  2VNU D;  4RH6 A;  4LFC Q;  1IBL Q;  4QY7 A;  2IWH A;  1S3O A;  3KLR A;  3RLO A;  1EYG A;  3D31 A;  5J1Z A;  5E1F A;  5IGB A;  2A6E D;  2Z6K C;  4C3H B;  3TS2 A;  3A7L A;  4DV5 Q;  3STB D;  1VMC A;  3EIV A;  1TR5 A;  3ERQ A;  4OO1 G;  2J4X A;  3S1M B;  3FP9 A;  1T9H A;  5DNF A;  3S24 A;  4KKT A;  3GTK H;  1B4O A;  3UDI A;  2L12 A;  1D6E C;  2Z4H A;  3GQB A;  4EQP A;  5HUR A;  2BDN A;  4GLV B;  2A69 D;  1W3S A;  1SSO A;  2R3Z A;  5DEH A;  2A8V A;  2BDO A;  2PQE A;  2F0V A;  2N8N A;  4A3G B;  3S2D B;  4NXM L;  2KVM A;  2JA6 H;  1QJO A;  3I4N H;  3CU7 A;  1XJV A;  3V2T A;  4F88 A;  3I91 A;  5LMU Q;  2VQF L;  1F2M A;  1Y1V B;  1IYJ B;  5BN3 A;  4YWL A;  1JOO A;  2IJ0 A;  1I3Q B;  3F2C A;  1CKN B;  4NW2 A;  3PIO 3;  2E2D C;  2B63 H;  4DF7 A;  5LHY 1;  4JI0 L;  2VQE Q;  4PQX A;  1KTK A;  4FVM A;  5E4X A;  1D2B A;  3HOZ B;  3LWU A;  1L1O A;  3J81 i;  4C3I G;  2OTL A;  1XPR A;  4M1U B;  5IIF A;  2VUM B;  4AYB G;  3J80 E;  1O80 A;  4ZUI A;  5C4X H;  2NZH A;  1RD9 D;  4TRD A;  1NR2 A;  3TP6 A;  3I4M B;  1KDA A;  2R7D A;  3VDY A;  4DV1 L;  4DR4 L;  3K7A B;  1KNA A;  1JB7 A;  1OXT A;  1CI3 M;  4DR5 Q;  4BA1 I;  3MXG A;  3H3V H;  2JXM B;  4V19 0;  2WIN B;  3Q6S A;  3IKJ A;  5LL6 X;  2HDM A;  1XYI A;  3HKZ G;  1LTA D;  2JJQ A;  2XWJ B;  2B2V A;  3GV6 A;  4YCV A;  2JA7 B;  4DXF A;  4KY7 A;  3ULP A;  1FR3 A;  3W2D A;  1V8Q A;  3RZD B;  1PTO B;  1TWG H;  4JI8 L;  4BBS B;  1MJE A;  1ROD A;  1BNZ A;  3A54 A;  4IPG A;  4A3E H;  4JI3 L;  2WAQ B;  1IKL A;  3K81 C;  3N6R A;  1F2Z A;  4OON A;  1TII D;  1RKN A;  4K5X A;  1EYD A;  2VZA A;  3BU2 A;  1JOR A;  4HMI A;  3H0G H;  5J39 A;  3Q22 A;  3FVQ A;  3HOX B;  1A8V A;  1I4R A;  2F0P A;  3FKI H;  2UXD Q;  1B70 B;  1I4G A;  1MGS A;  1LYL A;  2R61 A;  3NSW A;  4A3M H;  4IPC A;  3OWE B;  1MBY A;  4BXX H;  4KTA A;  4GNX C;  1BO0 A;  3D8G A;  3EBE A;  1VQK A;  3K5O A;  4KD3 A;  1K73 C;  1I5F A;  3NWS A;  1JOQ A;  1GM5 A;  1G6Z A;  1QOH A;  1CSQ A;  2PCF B;  3JAM i;  1PFN A;  4ALP A;  1X56 A;  4KK7 A;  4ZKB B;  1X3E A;  4HTH A;  5I2X A;  5KIX A;  2N78 A;  3AB9 A;  1LUZ A;  1PH5 A;  3J80 c;  1AW7 A;  1ENF A;  3QR8 A;  4UP9 A;  4QUF A;  3S9W A;  1VQP A;  1KNE A;  1KRT A;  5IYB H;  1QZH A;  1CQF A;  2SDF A;  2X6G A;  2WAC A;  1EY8 A;  4X62 L;  3ZYY X;  4A93 G;  3GTK B;  3S16 H;  3IAY A;  4LF8 Q;  2QCP X;  2AKW B;  4FXD A;  4MZ9 A;  3MAQ A;  4HIO A;  2PPB C;  1Z47 A;  3H3V I;  1ICW A;  4NPS A;  3U50 C;  4HJ9 A;  2ZJQ A;  1VQJ A;  1OXU A;  2E2J H;  4A3L H;  3IL8 A;  1SLJ A;  2WAQ E;  4LF9 Q;  3E0E A;  4IUV A;  3VYU A;  2K04 A;  5AJ3 Q;  1VQ8 A;  3GTP H;  3P1H A;  3KFU A;  1K83 B;  1O78 A;  5H1S E;  3T51 B;  3ICE A;  2F0K A;  3PUW A;  3CP0 A;  2L15 A;  2VS1 A;  3AEV A;  2Q2H A;  1LTG D;  1STY A;  4P2C B;  4IO9 A;  1AFP A;  4RFB A;  2MUY A;  1ILQ A;  1SNC A;  2KCN A;  5FLX L;  2B63 B;  2K5H A;  4LFA Q;  4DK6 C;  5GAG C;  4A75 A;  2PO4 A;  2UUA Q;  4P75 A;  3M4O H;  2A68 C;  4DK3 C;  3HOU B;  5ELO A;  2H1E A;  5IT9 E;  5EAY A;  2F1M A;  1K0S A;  2K5D A;  4K6L A;  1EOT A;  5ELC A;  3S1Q H;  5C4X B;  1O7Z A;  4N8X 1;  3U58 A;  1V1Q A;  2M00 A;  5EQ0 A;  2Z6B A;  3VR6 A;  3DEP A;  4IFD H;  3S1N H;  1S5B D;  2EE1 A;  2EJF C;  5JPM C;  1ET9 A;  4DV0 Q;  2HHH Q;  2PQA B;  1J5E L;  2KCM A;  4IUT A;  2BOS A;  4IUQ A;  2UUB L;  2AUK A;  1IKM A;  1ESF A;  4IOC A;  1KL9 A;  5IYC G;  4JI1 Q;  4A3F H;  2VXW A;  4JI6 Q;  2XSC A;  1CA6 A;  1VQL A;  5C4J B;  2SNS A;  1IW7 C;  5ELB A;  1NSN S;  1QUQ A;  1TWG B;  5NUC A;  4F7X A;  5M3M G;  3M4P A;  4A3E B;  1KIX A;  1I94 Q;  4K0K L;  2L11 A;  2L5T A;  1PTO C;  1E1T A;  1NR4 A;  2RSO A;  2FIN B;  1PVO A;  3H0G B;  3D6C A;  2F0F A;  1EOV A;  1Q8K A;  1ET6 A;  5KRU A;  3FKI B;  1WJJ A;  1XX8 A;  1N32 L;  1R4P B;  4MN3 A;  2ASB A;  1A15 A;  4X66 L;  3PF5 A;  4B9X A;  3K5N A;  2PNR C;  4B3T L;  4LW1 A;  1ENC A;  3EFX D;  1ESR A;  2XGT A;  1A2U A;  5EBC A;  2EZV A;  5C3E H;  1KDB A;  1GOZ A;  2EOT A;  3B6Y A;  2R7Z G;  2B2W A;  1J9O A;  5HGT A;  4IUN A;  1SMY C;  2NZ1 D;  4G7H C;  1BKB A;  1B2T A;  1B50 A;  2DN8 A;  5COR A;  5ELN A;  4RMF A;  2X6L A;  2CW0 C;  3DLL A;  4A3I G;  4LF7 L;  1YZ6 A;  1YIJ A;  3GTQ H;  4DAV A;  2JEA I;  4A3C H;  2E2I H;  1MD2 D;  1PRT D;  3RUZ A;  5C0X G;  2M2L A;  2JA9 A;  4QF4 A;  4DV6 Q;  4U68 A;  4DV4 Q;  1HNZ Q;  2EPB A;  4IOA A;  1GUS A;  1FNV A;  4DR1 L;  1WTO A;  3I3C A;  3RZO B;  2B2U C;  3H94 A;  1C48 A;  5I9O A;  3P20 A;  2R92 H;  3CPW A;  2E2J B;  1VQM A;  2EJG C;  4RHR A;  3DWQ A;  4A3J H;  4TVA B;  3DWA A;  1CHQ D;  5CV9 A;  3CC7 A;  2C5C A;  4LFB Q;  3GTP B;  4HJA A;  2RDG A;  2F0E A;  5ELD A;  2UXB L;  4RGT A;  4DR7 Q;  4KHP Q;  4OWT B;  4I7Z C;  1FJG L;  4UPA A;  3M3Y H;  2A6E C;  2K5N A;  4AQY L;  2X69 A;  4L5Q A;  2ICI A;  4BBR G;  1STG A;  3M4O B;  5FJ8 H;  2H5X A;  5JJL A;  1NAP A;  1Y14 B;  1XTD A;  2F3V A;  5M3F H;  2JA8 G;  4XTC S;  5JAV A;  1M90 C;  4ZKC B;  2KHJ A;  2BE5 D;  3S1Q B;  3V96 A;  2A69 C;  4P73 A;  3T1Y L;  3TS0 A;  1PH9 A;  3GTM H;  1SRU A;  3PQI A;  2EYL A;  4KV6 A;  3J7A F;  1Z9F A;  2UXC Q;  2AWO A;  1SJE D;  1G6P A;  3C2P A;  4OX9 Q;  3J80 i;  3EQL C;  5M5W H;  1AE2 A;  2K14 A;  2K75 A;  4JYA Q;  4ABN A;  3RNU A;  5M5Y B;  2AQ2 B;  5C0X J;  1AP0 A;  3TN2 A;  5C44 G;  1LO5 D;  2B39 A;  2TSS A;  4A3F B;  3KDF B;  1TWH H;  1ICF B;  1SYC A;  5KYI A;  3CCE A;  4WOR A;  2F4V L;  4L5T A;  1CTM A;  4OWW B;  2CH4 W;  2XN9 C;  1GUN A;  1LTT D;  1VQI A;  1U4M A;  1B9M A;  1X6O A;  4RAU C;  1N36 L;  1F2L A;  4DAY A;  3U9O A;  2RF4 A;  2GVA A;  5D3I B;  1WTW A;  3ZJY C;  1G2S A;  4NXN L;  2MNA A;  3CCM A;  1K9M C;  2A74 C;  1PTO F;  1TWC H;  3GTG B;  4IUR A;  1N8R C;  3K57 A;  1EEI D;  1JMC A;  4K2K A;  1WCM G;  2NTS A;  3AFQ A;  4ZUJ A;  4OGQ C;  4J1M A;  3OIQ A;  5C3E B;  5IGC A;  4H0L C;  3CCS A;  4JV5 Q;  2YYZ A;  2KEE A;  2VL6 A;  4C3J G;  4CDD C;  1Q82 C;  5ELF A;  2F0S A;  1K8G A;  2A1A A;  1CT1 D;  5A2Q E;  4TQU S;  2YU9 B;  1CK1 A;  5GAH C;  1HCZ A;  1PZK D;  2KQ3 A;  3NXW A;  1E7Z A;  4JBJ A;  4NP5 A;  1S72 A;  3FRP B;  3NP8 A;  1NCV A;  4DV7 L;  3LX0 A;  2AMC B;  2B8G A;  2EY5 A;  1XNR Q;  3HOY G;  2E2I B;  4LNQ A;  5COY A;  2E75 C;  4R8N A;  5C3X A;  4Z9C B;  2WB1 B;  3HOW B;  1TXY A;  2NZO A;  3HOV G;  3PO3 G;  3VR4 A;  1J6Q A;  4G7Z C;  4R4C A;  4LF5 Q;  3I4O A;  1PH6 A;  5IGG A;  1OXS C;  3KBX A;  2G9H D;  2E2H H;  1HH2 P;  4RG1 A;  1N33 L;  4A3J B;  4LMQ D;  4R4Q A;  1VQF A;  2ZXP A;  4LF8 L;  5I6W A;  1J8I A;  1EYA A;  1V1O A;  2RHS B;  1SNP A;  1V9P A;  2I46 A;  4ME3 A;  1EY0 A;  1PDQ A;  1QG7 A;  2KUM A;  3R93 A;  4A3B G;  1PRT B;  5LMN W;  4X64 Q;  5BR8 Q;  2B2Y C;  4F87 A;  5ISR A;  5LMN Q;  3DUZ A;  4IJL A;  4OO1 I;  3M3Y B;  2Z6K A;  3R2T A;  4ID6 A;  3X3M A;  2I0Q A;  4FF1 A;  2PI2 A;  1PLF A;  4DGZ A;  1D1K A;  4B3S Q;  2BA1 A;  3L2P A;  5M3F B;  1Q1E A;  2AUJ D;  4N9P A;  2ZXR A;  5CV8 A;  1DOM A;  1T5X D;  3IRB A;  1VQN A;  3KOJ A;  3OWF A;  1CZG A;  3TP7 A;  1QNK A;  2UUA L;  2IX1 A;  4QQB X;  1LTI D;  2CQO A;  2D5D A;  4YY3 L;  5T1I A;  2ID0 A;  2O2L D;  1JJC B;  2QEJ C;  4XQJ A;  4DR3 L;  1V43 A;  2K03 A;  3BZC A;  2BH2 A;  1TWH B;  2WB1 E;  1NBW A;  3S2H H;  1H9S B;  4GLX A;  3VA7 A;  2IX3 A;  2F0Q A;  4CDF C;  2B3G A;  2G5D A;  1WFQ A;  3H09 A;  4DV2 L;  3PO2 G;  3GTO H;  4IUU A;  1X3F A;  2ZJR A;  2YTX A;  2R93 B;  4A93 H;  3TEH B;  2CHB D;  2ZM6 Q;  4YHH L;  1GVP A;  3K6O A;  5CMD A;  1JJ2 A;  3W3A A;  4R4O A;  2K5Q A;  4JVZ A;  1TWC B;  1A63 A;  4MHE A;  2NBF A;  5JPN C;  2F3W A;  4XT1 B;  4QCL A;  5EPL A;  1Y1W G;  3S17 B;  1X3P A;  2Q8T A;  2AQ1 B;  1JQY D;  1WOC A;  1XTC D;  1HPC A;  1ZEQ X;  3CME A;  2F0N A;  5CBE E;  1DM0 B;  4NKL A;  4OEL B;  5IGF A;  2CKZ B;  1PXU A;  2LMC B;  2VB2 X;  3K80 C;  2JYO A;  5FO9 B;  4JI7 L;  2DY7 A;  3MEF A;  2DNE A;  3E3X A;  1X3G A;  4A3K G;  2UUC Q;  4BY1 B;  2QKI C;  1S4Z A;  3IFD A;  2WKD A;  3M9B A;  1W6K A;  1MHW C;  3MXP A;  3D4D A;  1GUT A;  1DD2 A;  2OQ0 A;  4G4K A;  4HMJ A;  1TY2 A;  2HD3 A;  4GKJ Q;  1PFM A;  1B7Y B;  2RCN A;  1VQG A;  2LS0 1;  5IOC A;  2A6H D;  1IBK L;  2ATW A;  4C3H G;  3J7Z C;  1DOL A;  5KNB A;  1NTG A;  3KUP A;  4GNX A;  1A3V A;  3OW7 A;  1SFO H;  4E6I A;  2K28 A;  3SK4 A;  3CW2 C;  3I7F A;  3KYH C;  1TKW B;  4L5R C;  1RTO A;  1K3B C;  1PZJ D;  2H4O A;  3DEO A;  5EKI A;  1UE1 A;  5IYC H;  4HCS A;  1VQE A;  3S14 H;  1IBM L;  4TSS A;  4GOP B;  3Q23 A;  5EPK A;  1QVF A;  5FKA C;  2EYF A;  3TBI B;  3A5Z B;  2I5M X;  4A3G G;  3EJI A;  4IUP A;  4TKO B;  4JI5 Q;  5CV5 A;  3PGZ A;  3TDQ A;  3T16 A;  3AFP A;  4DFA A;  4LJZ C;  2L1B A;  1G51 A;  2IPK D;  5M5X B;  3W1B A;  4K8I A;  2XWB B;  3ONA B;  3SEB A;  1X32 A;  5J22 A;  1Y1V G;  1STN A;  2HIX A;  1PRT C;  1FGU A;  4BY7 B;  1BQQ T;  2MO1 A;  1HNX L;  1U9R A;  1KAB A;  1SYG A;  1VQD A;  3H91 A;  1HNW L;  1A62 A;  2J7Z A;  1T5E A;  1TWF B;  1I4P A;  2BA0 A;  1S5D D;  3HFZ B;  3HS0 C;  3HOZ G;  5CGK A;  3O13 A;  4YCW A;  2ZTD A;  3KK7 A;  4CKB A;  1NUC A;  3BYT B;  2VUM G;  2NVX H;  4RKB A;  1R9T H;  2F0M A;  3TZU A;  2R7Z H;  2NVY H;  1I50 B;  4IAL A;  4B3R Q;  2WP8 J;  1AH9 A;  1OXV A;  1XPU A;  4XYO A;  3WOE A;  1LM0 A;  1K3R A;  2NB0 A;  1TS3 A;  3E5S A;  3EN2 A;  3CQZ B;  4GN4 B;  5DAU A;  1DGS A;  1X3Q A;  1NE3 A;  1FNU A;  3HP3 A;  2ICE C;  1TWA H;  4XYQ A;  2EQS A;  4MTK A;  4LF6 L;  2JA7 G;  1P16 A;  4XQQ A;  3GO5 A;  3GV3 A;  4ME5 A;  2DGY A;  3FMC A;  1D8L A;  2UU9 L;  4BBS G;  4UHV A;  5E3F A;  1W6J A;  5IP7 G;  1XMO L;  1ILP A;  4DV3 L;  4HIM A;  1EWH A;  2B2T A;  1UE7 A;  2Q2I A;  3DXJ C;  2BE5 C;  5IWA L;  2WAQ G;  2EXD A;  1EWI A;  3WOF A;  5EJW A;  4QGU A;  1PH4 A;  1Q81 C;  2O5I C;  3L0O A;  4UP7 A;  1SYF A;  1N34 L;  2PW7 A;  4U67 3;  1EFI D;  3HOX G;  4LF4 L;  4Y7N H;  1L2F A;  3CAM A;  4ZLT F;  4DR6 L;  2IX0 A;  4JI2 Q;  1CSP A;  5D3D A;  3PIO A;  1BUV T;  2K32 A;  1F2Y A;  1MSG A;  1NMG A;  3CKI B;  3CCV A;  3AQQ A;  1DJR D;  4L6T B;  3OSO A;  4A3D H;  2RQX A;  4JBW A;  1SND A;  1YNN C;  1Q8I A;  2WKC A;  4JI4 Q;  2NN6 G;  3TP5 A;  4JV5 L;  1QUQ B;  4BBR H;  2JA5 G;  2JA6 B;  3I4N B;  3CC2 A;  1UAP A;  1C4Q A;  1KHI A;  1JT8 A;  5JVG 3;  4KMU C;  1TQO A;  4GKK L;  2JA8 H;  2RSN A;  1WD1 A;  4RGN A;  4V0B A;  2QEX A;  2YV5 A;  2PZW A;  1EQT A;  1XXG A;  1HR0 W;  2Z0S A;  1TU2 B;  1HR0 Q;  2CH4 A;  4CBV A;  1AE3 A;  1LTL A;  1AEX A;  5FO7 B;  4CGY B;  1VQ7 A;  3I90 A;  3RMH A;  2FMM A;  3MFY A;  3PMF A;  1CQV A;  3RR5 A;  1EY4 A;  1D7Q A;  3LGJ A;  4X3S A;  3K7U C;  2F0L A;  1JWU D;  5IGD A;  1XMQ Q;  3HZX A;  1L0Y B;  2F0G A;  4GOP C;  2CCZ A;  3PF4 A;  4L5S A;  3PCO B;  3MEH A;  3K5L A;  4DUZ Q;  2KEC A;  5C0X I;  1SNM A;  2E5L L;  1PH3 A;  5CV4 A;  1P8L A;  3URY A;  3CRK C;  1WTX A;  4J6H A;  1YNJ C;  3N52 A;  3J81 j;  4H44 C;  4B08 A;  1IL2 A;  2B63 G;  4PMB A;  2BCO A;  5CC4 A;  4O2D A;  5JEA G;  3SVM A;  2FXQ A;  1PRT F;  3BVZ A;  5C3W A;  3T13 A;  2B2U A;  3SK5 A;  3HOU G;  3CD6 A;  1HA5 A;  3QWN A;  1FNW A;  2MP1 A;  3JC6 6;  5I9P A;  3MXN A;  5C4X G;  3DM1 A;  4KY5 A;  2C35 B;  1WTH A;  3GTL H;  3X3N A;  3ERO A;  1F9R A;  2VB3 X;  2NVY B;  4K5W A;  4C3J H;  5BN4 A;  5FLX E;  4HJ8 A;  5M9O A;  1JC7 A;  3CRL C;  4A3M B;  1NMF A;  5G3L F;  3OMC A;  2O5J C;  1H9R A;  3A55 A;  4RCO A;  4PMW A;  5FLM H;  1XNQ L;  1SR3 A;  2ALY B;  4K8J A;  2E74 C;  1GUO A;  2EIF A;  1TWA B;  3L3O C;  2DUD A;  5GAE C;  1PA6 A;  5K36 G;  1GO3 E;  3OTO L;  1HA6 A;  1HJP A;  1H95 A;  5EKK A;  2VY3 A;  2Y0S B;  5HY6 A;  2D0P A;  2SOB A;  4A3E G;  4FYD A;  4YWM A;  1BDO A;  2F0I A;  3HOV H;  1S5C D;  2K33 A;  3G48 A;  3E9H A;  2RHQ B;  4HJ5 A;  1VS0 A;  3FDT A;  1TT2 A;  4APV A;  4NXM Q;  4C2M H;  4ZCK A;  3H0G G;  4Y7N B;  3C3L A;  3FKI G;  4G57 A;  4DNI A;  4B3M L;  2VQF Q;  1EYC A;  4DAM A;  1VF7 A;  2F0T A;  4LFC L;  2SEB D;  1OXX K;  1IBL L;  1IYU A;  2PQA A;  4RHS A;  3VYT A;  2OWO A;  3S16 B;  1G8Z D;  3GTJ H;  1I6H H;  1SYB A;  3FEW X;  3UE1 A;  1QWY A;  4A3D B;  2CWA A;  5FOB B;  4N8F A;  4DV5 L;  2HIV A;  4JI0 Q;  1K0R A;  2PW5 A;  5JEA J;  3K8A A;  1II3 A;  1VQ5 A;  4IQZ A;  4CJ1 B;  3W1G A;  1X54 A;  1KRS A;  1VCI A;  2YTY A;  1SE4 A;  3A8I E;  1RHP A;  2IHE A;  4RCN A;  2QIL A;  5KGU A;  1U5K A;  4FF2 A;  4DV1 Q;  4DR4 Q;  1A3U A;  1KLG D;  4KJN A;  4WFN 3;  5FLX c;  5IYB G;  3JAM L;  5LMU L;  3OIP A;  3PV0 A;  3STB C;  3NBH B;  3PIP 3;  1RDP D;  4H13 C;  4CDE C;  3BDL A;  2L55 A;  1VDZ A;  3TME A;  5C6A A;  5JVH 3;  5D65 A;  2Y0S E;  2JN4 A;  5EGT A;  3AU7 A;  2VQE L;  4JI8 Q;  4JBK A;  2JEB I;  3OPO A;  4IZ8 A;  1ZYR D;  4BA2 I;  1MJC A;  4M8A A;  4XIG S;  4JI3 Q;  3S1N B;  3SR1 A;  3PO2 H;  2F0W A;  1Y8P B;  1LTR D;  1U4L A;  2IHF A;  3J7A 5;  1VQB A;  2K7V A;  1O7I A;  2JSO A;  3T4A C;  5HGQ A;  3H3V C;  3D0F A;  1WTR A;  2RCF A;  4DR5 L;  1IXR A;  1YIT A;  5C5M A;  1RF2 D;  1G29 1;  1C8C A;  1VQO A;  1HTP A;  2LXJ A;  2ZTE A;  2Z4I A;  3M85 A;  1IZ6 A;  4C56 C;  1AZP A;  1LTS D;  1EIY B;  4OO1 H;  3KLS X;  1UWV A;  2MQH A;  5DM6 3;  1VQC A;  2KCT A;  2F0J A;  3NBI A;  4X3T A;  4DUY Q;  1I4H A;  2V4D A;  4FF3 A;  2R6G A;  1TS2 A;  1HXY D;  2EYM A;  5FJ8 G;  2Q2U A;  4R9W A;  1LTB D;  2KOL A;  4IFD G;  4A3K H;  1BCP D;  5FO8 B;  2GVB A;  4QJF A;  4K14 A;  4EVO A;  3K5M A;  2IL8 A;  2AWN A;  4HID A;  3A5U A;  5IE8 A;  4DNT B;  2B2Y A;  3ULL A;  4A3F G;  3SHL A;  5IGE A;  2UXD L;  4X62 Q;  1KDC A;  2LY7 A;  2R7F A;  3QIA A;  3U4V A;  1Q46 A;  2SNM A;  4DKA C;  1L0X B;  3KF8 B;  5DLQ E;  4DNR B;  3OMG A;  2K5V A;  1KQS A;  3S1M H;  4X3K A;  5A35 A;  1MKH A;  2K4K A;  3RN2 A;  3M7G A;  1RCV D;  3GTQ B;  4AH6 A;  4C3I H;  1SRO A;  3K58 A;  4OEM B;  4I65 A;  4MTN A;  2PNH A;  3ERS X;  1HZB A;  1HZC A;  1BF4 A;  2QW7 A;  5D14 A;  4OWX B;  1YEZ A;  1HRJ A;  5JJZ A;  1S5F D;  1M1K C;  2D62 A;  1F9Q A;  4CKE A;  3CCU A;  3GTJ B;  3S2D H;  2FMC A;  3SE0 A;  4MNO A;  4LK1 C;  2WII B;  5C3E G;  4DAP A;  3QG1 A;  2R92 B;  3CCQ A;  5AFW A;  1SYD A;  4FO2 A;  3KJP A;  1Y1V H;  4A76 A;  3CC4 A;  4Y52 H;  2MJ8 A;  4FDB A;  1EZ8 A;  2RDF A;  1IW7 D;  2OEO A;  1HFG A;  4P74 A;  1EFW A;  3W5O A;  3GDE A;  3MFG A;  1U0L A;  4EQN A;  3D4R A;  4JI4 L;  4DXG A;  4IFD J;  4LF9 L;  3MZ5 A;  1RIP A;  2FHT A;  4KHZ A;  1Q90 A;  4LAA A;  4LWC A;  5AJ3 L;  1GKH A;  1FGB D;  2VUM H;  1J5E Q;  1RL2 A;  5CBA E;  3G4S A;  2LSS A;  2WB1 G;  2ZXO A;  2Q2T A;  2F03 A;  3HOW G;  1E3P A;  3HRZ C;  3K7A H;  3I72 A;  2E76 C;  1EWC A;  2NVT H;  1MSH A;  1RJT A;  4FP5 D;  4AIM A;  4LFA L;  1MIU A;  4CJ2 C;  3GTM B;  2VW9 A;  5EKL A;  5JOB A;  4RWS C;  3KJO A;  4K0K Q;  4A3J G;  2JA7 H;  2EYH A;  5EBD A;  2OCE A;  1JWM D;  4EGV A;  1PZI D;  4G7O C;  3OHX C;  4XXE A;  5M5W B;  3NTK A;  2N88 A;  1PTO H;  4BBS H;  2EXZ A;  5IP7 H;  2P5Z X;  2D2C C;  1JR0 D;  1PH1 A;  4DA2 A;  2PZU A;  4WJ3 M;  1Q1B A;  2N49 A;  4X65 Q;  1N32 Q;  2CW0 D;  1PYW D;  3C1F A;  4DV0 L;  2HHH L;  1SXT A;  1XWE A;  1A2T A;  4X66 Q;  4O1N A;  1B3Q A;  4B3T Q;  3IFT A;  1LAB A;  3GD7 A;  3OOC A;  1E2V A;  4WJ4 A;  3NEM A;  4JI1 L;  1UNS A;  4DR2 Q;  4JI6 L;  5M3F G;  4KHV A;  5EPJ A;  4KN7 C;  4XT3 B;  4GNX B;  4PZ6 A;  1LT6 D;  1L1O B;  1QCB D;  1IL8 A;  2KHI A;  1Y8N B;  1H9K A;  2KBN A;  3RD4 A;  4Q5V A;  4JPB W;  1I94 L;  1V1P A;  1X55 A;  1KLU D;  1TVX A;  1Y69 U;  4HCE A;  4OHJ A;  3F2B A;  5CR3 A;  3RLF A;  3M4Q A;  4LF7 Q;  1SE8 A;  1Z6H A;  4POF A;  1KAA A;  1FYC A;  2JA5 H;  4QL5 A;  1PYB A;  4J8Q A;  4YCU A;  1FD7 D;  2I07 B;  2HQE A;  3K0Y A;  4L63 B;  1WVL A;  1EIH A;  3TRZ A;  2I5L X;  2D9U A;  2KCC A;  1WD0 A;  4DR1 Q;  3J80 L;  1SE2 A;  1SJH D;  3D4W A;  1UE6 A;  1HHV A;  1SBB B;  2R93 G;  4F8M A;  3T53 B;  3BJU A;  4MIU A;  4R4T A;  1NNX A;  4QB4 A;  2L0C A;  1K8M A;  2C9O A;  4C3I B;  2YTV A;  4IN3 A;  1BCP B;  2KEN A;  4AYB B;  1B3A A;  2UXB Q;  2XIW A;  1Q86 C;  2HCI A;  3TZD A;  4ZRZ A;  2B29 A;  4JCV E;  1PH2 A;  1FVI A;  1QIL A;  3NQI A;  4CJ0 B;  5E7N A;  3MA2 B;  1FJG Q;  3KF6 A;  1JE5 A;  2EY1 A;  2A19 A;  1SMX A;  5I6Y A;  1K83 H;  4DV6 L;  3BZD B;  4AQY Q;  2IY5 B;  2OTJ A;  4DV4 L;  2NYZ D;  1DOK A;  1EU3 A;  1Q3L A;  2EY6 A;  3CCL A;  2E2H B;  1ASZ A;  4KY6 A;  1HNZ L;  2F52 A;  3U9S A;  4DU9 A;  4DPG A;  3HKZ B;  1H9S A;  4JOI C;  4BY1 G;  2OQK A;  1JWS D;  1JOK A;  1GHJ A;  3G7L A;  3CF5 A;  1R4Q B;  3T1Y Q;  4PMC A;  5JEA H;  3NTI A;  1PMR A;  1BVS A;  5M3M H;  2OXP A;  4IPH A;  3HOU H;  1AZQ A;  4YWK A;  5C4H A;  1LT5 D;  2JK8 A;  1JJG A;  2EJM A;  2XNA C;  4K2L A;  3DMU A;  3M4Y A;  4JBM A;  1EY9 A;  1EIF A;  3CCR A;  1ASY A;  3NE5 B;  4DR7 L;  4KHP L;  1E24 A;  4EQO A;  2CWP A;  4ILW A;  1EQQ A;  4PNY A;  1HQR D;  4DK1 A;  2NVT B;  3C46 A;  2NN6 I;  5I4D A;  2F4V Q;  3BZK A;  1EEF D;  1I6V C;  4N9T A;  3TQY A;  1WTQ A;  3BDO A;  4NDX A;  2L4N A;  3ULJ A;  3SK6 A;  1U4P A;  1VQH A;  3QOL A;  3I4M G;  1N36 Q;  3T1H Q;  5K36 H;  1E1O A;  5C4J H;  2O4X A;  2F0U A;  5TSS A;  1BBW A;  4HN7 A;  4NXN Q;  3D6W A;  4PG3 A;  4AYB E;  1O7L A;  2UXC L;  1HUN A;  5ELE A;  3FPU B;  2JQO A;  1PFB A;  3G71 A;  4OIK A;  3I70 A;  2EYJ A;  4OX9 L;  4X6A H;  3S2H B;  4A3I H;  2ZT9 C;  1YJN A;  4BY7 G;  4JYA L;  3I4L A;  5C0X H;  1EQV A;  1KXL A;  1CKN A;  4B9W A;  1NJI C;  2I5H A;  3GTO B;  1EQR A;  4JK1 C;  3I55 A;  4KKS A;  1C7Y A;  5DM7 3;  3J7A V;  5JJK A;  4A93 B;  4P71 A;  3HKZ E;  3AMU A;  4ZAI A;  1TY0 A;  1VF5 C;  1U4R A;  1L1O C;  2B8F A;  5IYD G;  2QF7 A;  1ZYR C;  3S1R H;  4DV7 Q;  4OL7 A;  4GOP A;  2CVR A;  3U4Z A;  2ES2 A;  4DUY L;  5IP9 G;  2JA5 B;  4FXK C;  1M4V A;  3RLN A;  1HUM A;  1ONL A;  3F8T A;  3H6M A;  4NB3 A;  1VQ9 A;  3S15 H;  1B53 A;  1M8A A;  3NUC A;  5IT9 L;  4OIJ A;  1VQ6 A;  2JE6 I;  1GUG A;  1DXM A;  1KD1 C;  4RKL A;  1G91 A;  3VR3 A;  4DN4 M;  2B2V C;  3A74 A;  3SGI A;  3UDF A;  3MVV A;  1LAC A;  1G2T A;  2K52 A;  3QO2 A;  1N33 Q;  4ZYS A;  1K8O A;  1HZA A;  3ND8 A;  5GQO A;  5BN5 A;  1B44 D;  3C1E A;  3RZO H;  3E0J A;  3MXN B;  2F3I A;  1F77 A;  4PZ7 A;  4UDU C;  1BCP C;  1Z7T A;  1HTL D;  4KKU A;  4RGM A;  3UDG A;  3QB3 A;  3PUZ A;  2N3S A;  4FXG C;  1XNR L;  4LUZ A;  3DHQ A;  3VR2 A;  2MO0 A;  2ENB A;  2QDL A;  1SFO B;  1SNQ A;  4BWG B;  4GS3 A;  3ND9 A;  4KJO A;  2GN5 A;  4HJ7 A;  1ZXT A;  4POG A;  4C1N K;  1H9M A;  1UEB A;  3VA5 A;  5C44 H;  4RA8 A;  1YJW A;  1STE A;  3S14 B;  3GP7 A;  1SE3 A;  1TS5 A;  2KED A;  4LF5 L;  1W2B A;  4UY8 C;  2JA6 G;  3I4N G;  3VYS A;  5M3M B;  1SEB D;  4PV1 C;  1PH7 A;  3MTS A;  1C0A A;  4YY3 Q;  2NVQ H;  2MPM A;  4QUC A;  2B2T C;  5JJI A;  1E2W A;  3RN5 A;  4LUO A;  3CMA A;  2K1B A;  1B9N A;  1SAP A;  4DR3 Q;  3PSI A;  4HAE A;  3K0X A;  5E4W C;  1OO9 B;  1RTN A;  4Q0F A;  4X64 L;  4QIW B;  3SXH A;  3WDN A;  5BR8 L;  5LMN L;  1E2Z A;  1WCM H;  3D3R A;  3MC0 B;  1A6X A;  1IYV A;  1SNO A;  5M5Y H;  4DV2 Q;  1E0B A;  2NVX B;  3CXC A;  4B3S L;  1R9T B;  2R7Z B;  2E8G A;  4JC0 A;  2QGQ A;  4EQ5 A;  1X65 A;  3HG9 A;  4YHH Q;  1XPO A;  3J81 L;  4NMZ A;  2RVL A;  4XDX A;  1BBU A;  2LXK A;  2EVB A;  1TS4 A;  3NWT A;  3P75 A;  1PH8 A;  3BDC A;  1I4X A;  4KD4 A;  1B8A A;  3P7J A;  1HZ9 A;  2EYP A;  4A3I B;  3HEJ A;  2NTT A;  1CKO A;  1EUJ A;  3HKS A;  4A4I A;  3HOY H;  1EIG A;  3GTG H;  2RKS A;  2WFW A;  4X65 L;  2J0T D;  4JI7 Q;  1UE5 A;  1PHJ A;  4OXP A;  5CV6 A;  3OW2 A;  1WTP A;  3PO3 H;  1YI2 A;  2NWG A;  5KYL A;  1EL0 A;  2LKV A;  4R1J A;  1JE4 A;  4UAI A;  4DR2 L;  3S1R B;  2DJF C;  4ULL A;  3QOJ A;  1STH A;  3I56 A;  1X9N A;  4KI0 A;  5K5P A;  2ZM6 L;  2Z1C A;  2CQA A;  4A3M G;  2YU9 H;  3NEN A;  2OF1 A;  2F0H A;  2ZJP A;  1K8A C;  3NHH A;  3A8K E;  3HGB A;  1LT4 D;  1LT3 D;  1SN8 A;  4BXX G;  1IBK Q;  3S15 B;  3MXU A;  5IT9 c;  1B1Z A;  2KJX A;  4K6D A;  1GXD C;  2HQL A;  2MFI A;  4GLA C;  4A3B H;  4QIW E;  1CZW A;  4HR7 B;  1HFN A;  3NTH A;  3UE0 A;  2Y0S G;  2QDB A;  3L9A X;  1YVC A;  4BBR B;  3J81 E;  5KNC A;  2OT2 A;  3BVG A;  4JG2 A;  2QA4 A;  4WJW A;  1Q12 A;  3HOW H;  1IBM Q;  2UUC L;  4DAY B;  1N9W A;  2D0O A;  2JA8 B;  4IFD I;  3TP8 A;  4BS9 A;  3NEL A;  5T1G A;  2DY8 A;  5G3L D;  3T56 B;  3SK8 A;  1QVC A;  1O7Y A;  3E9I A;  4L8J A;  1LV9 A;  1PFS A;  3A8J E;  3KLW A;  4GKJ L;  1BOS A;  3TSS A;  1BCP F;  4S3S A;  5LL6 S;  1HNX Q;  1HNW Q;  2A5H A;  5C44 B;  3KLS A;  4PZ8 A;  4A3D G;  1A3T A;  3Q0A A;  4LUV A;  3M7N A;  1BBX C;  2Z9H A;  2MGS A;  4A3L G;  1EZ6 A;  1YBY A;  4GZY C;  5GAD C;  1A0I A;  3NPP A;  1UUP A;  2B2W C;  2K05 A;  1PYS B;  4FF4 A;  3KBG A;  1OTC A;  2EDG A;  1GJX A;  2NVQ B;  3FHW A;  2HUG A;  2K50 A;  2Q8R E;  2DNC A;  5GRO A;  1DCZ A;  1EY5 A;  4JI5 L;  1D5X C;  2A6H C;  1QVG A;  2ZTC A;  1DYQ A;  5I2Y A;  3BVM A;  2KHS A;  5KEE A;  3Q24 A;  4J15 A;  1YHA A;  1SYE A;  5A2Q L;  2FFK B;  1WCM B;  2L9H A;  1Y1W H;  4IJH A;  4EX5 A;  4LF6 Q;  4K5V A;  2UU9 Q;  3GTL B;  1XMO Q;  5IY0 A;  4CHT B;  4HSP A;  3LNN A;  4C3J B;  3JAM E;  4DV3 Q;  2NUC A;  4ZK9 B;  4GN3 B;  3FPP A;  1YNN D;  1CUK A;  2XTI A;  2F0D A;  3PUV A;  4X3U A;  5IWA Q;  3J81 c;  1WTV A;  1PV4 A;  2MHV A;  1F9S A;  1IHZ A;  2JP1 A;  4R4I A;  3QJY A;  2IT1 A;  1N34 Q;  2R93 H;  4O42 A;  2EY2 A;  3T1H L;  4B3R L;  4LF4 Q;  2PMZ B;  4H7B A;  1JCK B;  5C5L A;  2F4I A;  4DR6 Q;  2FJ2 A;  4FNF A;  3HOY B;  1ENA A;  4R8I A;  3UDX A;  1SDF A;  3TRE A;  2RBM A;  2WV6 D;  4HIK A;  1Q7Y C;  3DWP A;  4C3H H;  1CM9 A;  2IW3 A;  3NBH A;  3S17 H;  1CKM A;  3MHB A;  3R8B A;  3HOV B;  3PO3 B;  2XRS D;  1HQM C;  2A68 D;  3R2I A;  3EVQ A;  4C1N I;  2BH8 A;  1I4Q A;  4JW0 A;  3F2D A;  3VYR A;  2K5W A;  4C2M B;  3G6J B;  3CHB D;  1S40 A;  4ODG A;  1GUW A;  3UI2 A;  1WI5 A;  5F2D A;  1QNU A;  4YIJ A;  3A56 A;  2A73 B;  1K28 A;  5J3B A;  4GKK Q;  4BY1 H;  3L7Z C;  3EA6 A;  4H02 A;  1QE6 A;  1D5M C;  4WRD A;  2Q8I B;  5FLM G;  3R3O A;  1VQ4 A;  5IOD A;  4A3G H;  2RDH A;  1STA A;  1I6H B;  2Z8L A;  3VR5 A;  3PIP A;  2G9D A;  3I2Z A;  4A3B B;  3KDF A;  3A7A B;  1DON A;  2K6A A;  1EY7 A;  4JI2 L;  1YNJ D;  3E6Z X;  2HCC A;  4KN4 C;  3NK9 A;  1CFM A;  4RGO S;  5C4Z A;  3BS1 A;  1EU4 A;  1I3Q H;  1C9O A;  2GA4 B;  3SDZ A;  1GD7 A;  2LFN A;  4CKC A;  1YNX A;  2XRQ D;  5CYU A;  4DK0 A;  3OYY A;  3HOZ H;  1JIC A;  1PTO D;  3Q8D A;  3NQT A;  4A3C G;  3CCJ A;  3JAM c;  3V05 A;  1QB5 D;  2V1C C;  3DM3 A;  1V1P B;  4GN5 A;  1H9J A;  2UUB Q;  2E5L Q;  3I4M H;  2PMZ E;  4LFB L;  1UEA B;  4HED A;  4ZQ3 A;  5FK9 C;  1DZ1 A;  4O0A A;  4HSV A;  4UP8 A;  1BR9 A;  3F2U A;  2PI2 E;  1NY4 A;  3PUX A;  2EYO A;  4XQN A;  1HR0 L;  1D1I A;  2R92 G;  5L37 A;  3AYH B;  5M5X H;  3J7Y W;  1YHQ A;  1STB A;  5KND A;  4BY7 H;  2N55 A;  3KF8 A;  3PO2 B;  2TMP A;  1D5Z C;  1E22 A;  1KC8 C;  1ML0 D;  1CHP D;  1SMY D;  2HDL A;  1TWF H;  1ZKO A;  3RZD H;  3G6E A;  2PYK A;  1CA5 A;  1XMQ L;  3LWE A;  4P72 A;  3MWY W;  1L0W A;  1Y8O B;  4DUZ L;  2HT1 A;  3ITP A;  4IPD A;  1QZG A;  1XNQ Q;  5IYD H;  1YHB A;  1F9P A;  1AN8 A;  1I50 H;  3HOX H;  1VQA A;  1GHK A; 
#chains in the Genus database with same CATH homology
 1VMP A;  1Y1W B;  3K59 A;  2K01 A;  2F0O A;  1LLR D;  2KA7 A;  3BYY B;  2XVS A;  1EY6 A;  4A3K B;  3I73 A;  2RA4 A;  3I8Z A;  2NN6 H;  3BG3 A;  5CV7 A;  2PZT A;  1BXT A;  4QMG A;  1S5E D;  1MI2 A;  2AQ3 B;  3PUY A;  2M9V A;  1JB3 A;  2VNU D;  4RH6 A;  2IWH A;  3KLR A;  3D31 A;  5J1Z A;  5E1F A;  5IGB A;  2A6E D;  4C3H B;  3A7L A;  1VMC A;  3ERQ A;  1TR5 A;  4OO1 G;  2J4X A;  3S1M B;  5DNF A;  4KKT A;  1B4O A;  2L12 A;  1D6E C;  2Z4H A;  3GQB A;  4EQP A;  5HUR A;  2BDN A;  2A69 D;  1SSO A;  2R3Z A;  5DEH A;  2BDO A;  2PQE A;  2F0V A;  4A3G B;  3S2D B;  2KVM A;  1QJO A;  3CU7 A;  3V2T A;  4F88 A;  3I91 A;  1F2M A;  1Y1V B;  5BN3 A;  1JOO A;  2IJ0 A;  1I3Q B;  4NW2 A;  3PIO 3;  2E2D C;  4DF7 A;  5LHY 1;  4PQX A;  1KTK A;  4FVM A;  5E4X A;  1D2B A;  3HOZ B;  3LWU A;  4C3I G;  4M1U B;  5IIF A;  2VUM B;  3J80 E;  1O80 A;  4ZUI A;  1RD9 D;  4TRD A;  1NR2 A;  3TP6 A;  3I4M B;  1KDA A;  3K7A B;  1KNA A;  1OXT A;  1CI3 M;  4BA1 I;  3MXG A;  2JXM B;  4V19 0;  2WIN B;  3Q6S A;  3IKJ A;  5LL6 X;  2HDM A;  1XYI A;  1LTA D;  2XWJ B;  2B2V A;  3GV6 A;  2JA7 B;  4DXF A;  4KY7 A;  1FR3 A;  3W2D A;  1V8Q A;  3RZD B;  1PTO B;  4BBS B;  1ROD A;  1BNZ A;  3A54 A;  2WAQ B;  1IKL A;  3N6R A;  1F2Z A;  1TII D;  1RKN A;  4K5X A;  1EYD A;  1JOR A;  4HMI A;  5J39 A;  3Q22 A;  3FVQ A;  3HOX B;  1I4R A;  2F0P A;  1I4G A;  1MGS A;  2R61 A;  3NSW A;  3OWE B;  1MBY A;  4KTA A;  1BO0 A;  3D8G A;  3K5O A;  4KD3 A;  3NWS A;  1JOQ A;  1G6Z A;  1QOH A;  2PCF B;  1PFN A;  4KK7 A;  4ZKB B;  4HTH A;  5I2X A;  5KIX A;  3AB9 A;  1AW7 A;  1ENF A;  4QUF A;  3S9W A;  1KNE A;  1CQF A;  2SDF A;  2X6G A;  2WAC A;  1EY8 A;  3ZYY X;  3GTK B;  3IAY A;  2QCP X;  4FXD A;  3MAQ A;  2PPB C;  1Z47 A;  1ICW A;  1OXU A;  3IL8 A;  4IUV A;  3VYU A;  2K04 A;  3P1H A;  1K83 B;  1O78 A;  3T51 B;  2F0K A;  3PUW A;  1LTG D;  1STY A;  4P2C B;  1AFP A;  4RFB A;  2MUY A;  1ILQ A;  1SNC A;  2KCN A;  5FLX L;  2B63 B;  2PO4 A;  2A68 C;  3HOU B;  2H1E A;  5IT9 E;  2F1M A;  2K5D A;  4K6L A;  1EOT A;  5ELC A;  5C4X B;  1O7Z A;  5EQ0 A;  2M00 A;  3VR6 A;  3DEP A;  4IFD H;  1S5B D;  2EE1 A;  2EJF C;  5JPM C;  1ET9 A;  4IUT A;  2BOS A;  4IUQ A;  2AUK A;  1IKM A;  1ESF A;  2VXW A;  2XSC A;  1CA6 A;  5C4J B;  2SNS A;  1IW7 C;  5ELB A;  1NSN S;  1TWG B;  5NUC A;  4F7X A;  4A3E B;  2L11 A;  2L5T A;  1PTO C;  1NR4 A;  2RSO A;  2FIN B;  3H0G B;  3D6C A;  2F0F A;  1ET6 A;  5KRU A;  3FKI B;  1XX8 A;  1R4P B;  4MN3 A;  1A15 A;  4B9X A;  3K5N A;  2PNR C;  1ENC A;  3EFX D;  1ESR A;  1A2U A;  5EBC A;  2EZV A;  1KDB A;  1GOZ A;  2EOT A;  2B2W A;  1J9O A;  5HGT A;  4IUN A;  1SMY C;  2NZ1 D;  4G7H C;  1B2T A;  1B50 A;  2DN8 A;  5COR A;  2X6L A;  2CW0 C;  4DAV A;  2JEA I;  1MD2 D;  3RUZ A;  1PRT D;  5C0X G;  2M2L A;  4QF4 A;  4U68 A;  2EPB A;  1GUS A;  1FNV A;  1WTO A;  3I3C A;  3RZO B;  2B2U C;  3H94 A;  1C48 A;  5I9O A;  3P20 A;  2E2J B;  2EJG C;  4RHR A;  3DWQ A;  3DWA A;  1CHQ D;  5CV9 A;  2C5C A;  3GTP B;  2RDG A;  2F0E A;  5ELD A;  4RGT A;  4I7Z C;  2A6E C;  2X69 A;  2ICI A;  1STG A;  3M4O B;  1NAP A;  2F3V A;  4XTC S;  5JAV A;  4ZKC B;  2BE5 D;  3S1Q B;  3V96 A;  2A69 C;  2EYL A;  4KV6 A;  3J7A F;  2AWO A;  1SJE D;  3C2P A;  3EQL C;  4ABN A;  5M5Y B;  2AQ2 B;  5C0X J;  1AP0 A;  3TN2 A;  1LO5 D;  2B39 A;  2TSS A;  4A3F B;  5KYI A;  1SYC A;  4WOR A;  1CTM A;  2XN9 C;  1GUN A;  1LTT D;  1U4M A;  1B9M A;  4RAU C;  1F2L A;  4DAY A;  3U9O A;  5D3I B;  1WTW A;  1G2S A;  2A74 C;  1PTO F;  3GTG B;  4IUR A;  3K57 A;  1EEI D;  4K2K A;  2NTS A;  4ZUJ A;  4OGQ C;  4J1M A;  3OIQ A;  5C3E B;  5IGC A;  4H0L C;  2YYZ A;  2KEE A;  4C3J G;  5ELF A;  2F0S A;  1CT1 D;  5A2Q E;  4TQU S;  2YU9 B;  1CK1 A;  1HCZ A;  1PZK D;  2KQ3 A;  3NXW A;  4NP5 A;  3FRP B;  3NP8 A;  1NCV A;  3LX0 A;  2B8G A;  2EY5 A;  2E2I B;  5COY A;  2E75 C;  4R8N A;  5C3X A;  4Z9C B;  2WB1 B;  3HOW B;  3VR4 A;  4G7Z C;  5IGG A;  1OXS C;  3KBX A;  2G9H D;  4A3J B;  4LMQ D;  2ZXP A;  5I6W A;  1J8I A;  1EYA A;  1V1O A;  1SNP A;  2I46 A;  1EY0 A;  1PDQ A;  1QG7 A;  2KUM A;  3R93 A;  1PRT B;  2B2Y C;  4F87 A;  5ISR A;  4OO1 I;  3DUZ A;  3M3Y B;  3R2T A;  4ID6 A;  3X3M A;  4FF1 A;  1PLF A;  4DGZ A;  1D1K A;  2BA1 A;  5M3F B;  1Q1E A;  2AUJ D;  4N9P A;  2ZXR A;  5CV8 A;  1DOM A;  1T5X D;  3OWF A;  1CZG A;  3TP7 A;  1QNK A;  2IX1 A;  1LTI D;  2D5D A;  5T1I A;  2ID0 A;  2O2L D;  2QEJ C;  4XQJ A;  1V43 A;  2K03 A;  1TWH B;  1H9S B;  3VA7 A;  2IX3 A;  2F0Q A;  3H09 A;  4IUU A;  2R93 B;  2CHB D;  3K6O A;  5CMD A;  3W3A A;  2K5Q A;  1TWC B;  4MHE A;  2NBF A;  5JPN C;  2F3W A;  4XT1 B;  4QCL A;  5EPL A;  3S17 B;  1X3P A;  2Q8T A;  2AQ1 B;  1JQY D;  1XTC D;  1HPC A;  1ZEQ X;  2F0N A;  5CBE E;  1DM0 B;  4NKL A;  5IGF A;  1PXU A;  2LMC B;  2VB2 X;  2JYO A;  5FO9 B;  2DY7 A;  2DNE A;  4BY1 B;  2QKI C;  1S4Z A;  3IFD A;  2WKD A;  1W6K A;  3MXP A;  3D4D A;  1GUT A;  1DD2 A;  4G4K A;  4HMJ A;  1TY2 A;  1PFM A;  2LS0 1;  5IOC A;  2A6H D;  4C3H G;  1DOL A;  5KNB A;  3KUP A;  1A3V A;  3OW7 A;  4E6I A;  2K28 A;  3SK4 A;  1TKW B;  1RTO A;  1PZJ D;  2H4O A;  3DEO A;  5EKI A;  4HCS A;  4TSS A;  3Q23 A;  5EPK A;  5FKA C;  2EYF A;  3TBI B;  3EJI A;  4IUP A;  4TKO B;  5CV5 A;  3TDQ A;  3T16 A;  4DFA A;  4LJZ C;  2L1B A;  2IPK D;  5M5X B;  4K8I A;  2XWB B;  3ONA B;  3SEB A;  1X32 A;  5J22 A;  1STN A;  1PRT C;  4BY7 B;  1BQQ T;  1U9R A;  1KAB A;  1SYG A;  3H91 A;  2J7Z A;  1T5E A;  1TWF B;  1I4P A;  2BA0 A;  1S5D D;  3HS0 C;  5CGK A;  3O13 A;  3KK7 A;  4CKB A;  1NUC A;  3BYT B;  4RKB A;  2F0M A;  3TZU A;  1I50 B;  4IAL A;  2WP8 J;  1OXV A;  4XYO A;  3WOE A;  2NB0 A;  1TS3 A;  3E5S A;  3CQZ B;  5DAU A;  1X3Q A;  1FNU A;  3HP3 A;  2ICE C;  4XYQ A;  4XQQ A;  3GO5 A;  3GV3 A;  4ME5 A;  3FMC A;  5E3F A;  1W6J A;  1ILP A;  1EWH A;  2B2T A;  3DXJ C;  2BE5 C;  3WOF A;  5EJW A;  2O5I C;  1SYF A;  2PW7 A;  4U67 3;  1EFI D;  4ZLT F;  2IX0 A;  5D3D A;  1BUV T;  2K32 A;  1F2Y A;  1MSG A;  3CKI B;  1DJR D;  4L6T B;  3OSO A;  2RQX A;  4JBW A;  1SND A;  1YNN C;  1Q8I A;  2WKC A;  2NN6 G;  3TP5 A;  2JA6 B;  3I4N B;  1UAP A;  1C4Q A;  5JVG 3;  4KMU C;  1TQO A;  2RSN A;  1WD1 A;  4RGN A;  4V0B A;  2PZW A;  1EQT A;  1XXG A;  1TU2 B;  4CBV A;  1AEX A;  5FO7 B;  4CGY B;  3I90 A;  3RMH A;  2FMM A;  3MFY A;  3PMF A;  1CQV A;  1EY4 A;  4X3S A;  2F0L A;  1JWU D;  5IGD A;  3HZX A;  1L0Y B;  2F0G A;  3MEH A;  3K5L A;  2KEC A;  5C0X I;  1SNM A;  5CV4 A;  3URY A;  3CRK C;  1WTX A;  4J6H A;  1YNJ C;  3N52 A;  4H44 C;  4B08 A;  4PMB A;  2BCO A;  5CC4 A;  5JEA G;  3SVM A;  3BVZ A;  1PRT F;  5C3W A;  3T13 A;  2B2U A;  3SK5 A;  1HA5 A;  3QWN A;  1FNW A;  2MP1 A;  5I9P A;  3MXN A;  3DM1 A;  4KY5 A;  3X3N A;  3ERO A;  1F9R A;  2VB3 X;  2NVY B;  4K5W A;  5BN4 A;  5FLX E;  5M9O A;  1JC7 A;  3CRL C;  4A3M B;  5G3L F;  3OMC A;  2O5J C;  1H9R A;  3A55 A;  4RCO A;  4PMW A;  4K8J A;  2E74 C;  1GUO A;  1TWA B;  3L3O C;  5K36 G;  1HA6 A;  5EKK A;  2Y0S B;  2SOB A;  4FYD A;  1BDO A;  2F0I A;  1S5C D;  2K33 A;  3FDT A;  1TT2 A;  4Y7N B;  3C3L A;  4G57 A;  1EYC A;  1VF7 A;  2F0T A;  2SEB D;  1OXX K;  1IYU A;  4RHS A;  3VYT A;  3S16 B;  1G8Z D;  1SYB A;  3FEW X;  1QWY A;  4A3D B;  5FOB B;  2PW5 A;  5JEA J;  1II3 A;  4IQZ A;  4CJ1 B;  1VCI A;  1SE4 A;  3A8I E;  1RHP A;  4RCN A;  2QIL A;  5KGU A;  4FF2 A;  1A3U A;  1KLG D;  4KJN A;  4WFN 3;  3JAM L;  3OIP A;  3PV0 A;  3PIP 3;  1RDP D;  4H13 C;  3BDL A;  2L55 A;  1VDZ A;  3TME A;  5C6A A;  5JVH 3;  5D65 A;  5EGT A;  3AU7 A;  2JEB I;  3OPO A;  4IZ8 A;  1ZYR D;  4BA2 I;  4M8A A;  4XIG S;  3S1N B;  3SR1 A;  2F0W A;  1Y8P B;  1LTR D;  1U4L A;  2K7V A;  2JSO A;  3T4A C;  3H3V C;  1WTR A;  5C5M A;  1RF2 D;  1G29 1;  1C8C A;  1HTP A;  2Z4I A;  3M85 A;  4C56 C;  1AZP A;  1LTS D;  4OO1 H;  3KLS X;  5DM6 3;  2F0J A;  3NBI A;  4X3T A;  1I4H A;  2V4D A;  4FF3 A;  2R6G A;  1TS2 A;  1HXY D;  2EYM A;  4R9W A;  1LTB D;  2KOL A;  4IFD G;  1BCP D;  5FO8 B;  4K14 A;  4EVO A;  3K5M A;  2IL8 A;  2AWN A;  4DNT B;  2B2Y A;  3SHL A;  5IGE A;  1KDC A;  2LY7 A;  3QIA A;  2SNM A;  1L0X B;  4DNR B;  3OMG A;  4X3K A;  5A35 A;  3M7G A;  1RCV D;  3GTQ B;  3K58 A;  4I65 A;  1BF4 A;  5D14 A;  1HRJ A;  5JJZ A;  1S5F D;  2D62 A;  1F9Q A;  4CKE A;  3GTJ B;  2FMC A;  3SE0 A;  4LK1 C;  2WII B;  4DAP A;  3QG1 A;  2R92 B;  5AFW A;  1SYD A;  4FO2 A;  2MJ8 A;  1EZ8 A;  2RDF A;  1IW7 D;  2OEO A;  1HFG A;  3MFG A;  4EQN A;  3D4R A;  4DXG A;  4IFD J;  3MZ5 A;  2FHT A;  4KHZ A;  1Q90 A;  4LAA A;  1FGB D;  5CBA E;  2ZXO A;  2F03 A;  3HRZ C;  2E76 C;  3I72 A;  1EWC A;  1MSH A;  1RJT A;  4FP5 D;  4CJ2 C;  3GTM B;  5EKL A;  5JOB A;  4RWS C;  2EYH A;  5EBD A;  1JWM D;  4EGV A;  1PZI D;  4G7O C;  3OHX C;  4XXE A;  5M5W B;  3NTK A;  2N88 A;  1PTO H;  2EXZ A;  2D2C C;  1JR0 D;  4DA2 A;  2PZU A;  1Q1B A;  2CW0 D;  1PYW D;  3C1F A;  1SXT A;  1XWE A;  1A2T A;  4O1N A;  3IFT A;  1LAB A;  3GD7 A;  3OOC A;  1E2V A;  1UNS A;  4KHV A;  5EPJ A;  4KN7 C;  4XT3 B;  1LT6 D;  1QCB D;  1IL8 A;  1Y8N B;  1H9K A;  3RD4 A;  4Q5V A;  1V1P A;  1KLU D;  1TVX A;  1Y69 U;  4HCE A;  4OHJ A;  5CR3 A;  3RLF A;  1Z6H A;  1KAA A;  1FYC A;  4J8Q A;  1FD7 D;  2I07 B;  2HQE A;  3K0Y A;  4L63 B;  1WVL A;  1EIH A;  2D9U A;  2KCC A;  1WD0 A;  3J80 L;  1SE2 A;  1SJH D;  3D4W A;  1HHV A;  1SBB B;  4F8M A;  3T53 B;  4MIU A;  4QB4 A;  2L0C A;  1K8M A;  2C9O A;  4C3I B;  4IN3 A;  1BCP B;  4AYB B;  1B3A A;  2XIW A;  2HCI A;  3TZD A;  4ZRZ A;  3NQI A;  1QIL A;  4CJ0 B;  3MA2 B;  2EY1 A;  5I6Y A;  3BZD B;  2NYZ D;  1DOK A;  1EU3 A;  1Q3L A;  2EY6 A;  2E2H B;  4KY6 A;  3U9S A;  4DU9 A;  3HKZ B;  1H9S A;  1JWS D;  1JOK A;  1GHJ A;  3G7L A;  1R4Q B;  4PMC A;  5JEA H;  3NTI A;  1PMR A;  2OXP A;  1AZQ A;  5C4H A;  1LT5 D;  2EJM A;  2XNA C;  4K2L A;  3DMU A;  3M4Y A;  1EY9 A;  3NE5 B;  4EQO A;  4ILW A;  4PNY A;  1HQR D;  4DK1 A;  2NVT B;  3C46 A;  2NN6 I;  5I4D A;  1EEF D;  1I6V C;  4N9T A;  1WTQ A;  3BDO A;  4NDX A;  2L4N A;  3SK6 A;  1U4P A;  3QOL A;  5K36 H;  2O4X A;  2F0U A;  5TSS A;  4HN7 A;  3D6W A;  1O7L A;  1HUN A;  5ELE A;  3FPU B;  1PFB A;  4OIK A;  3I70 A;  2EYJ A;  3S2H B;  2ZT9 C;  3I4L A;  5C0X H;  1EQV A;  4B9W A;  3GTO B;  4JK1 C;  4KKS A;  5DM7 3;  3J7A V;  4A93 B;  3AMU A;  4ZAI A;  1TY0 A;  1VF5 C;  1U4R A;  2B8F A;  2QF7 A;  1ZYR C;  4OL7 A;  2CVR A;  2JA5 B;  4FXK C;  1M4V A;  1HUM A;  1ONL A;  3H6M A;  1B53 A;  1M8A A;  3NUC A;  5IT9 L;  4OIJ A;  2JE6 I;  1GUG A;  1DXM A;  4RKL A;  1G91 A;  3VR3 A;  4DN4 M;  2B2V C;  3MVV A;  1LAC A;  1G2T A;  3QO2 A;  4ZYS A;  1K8O A;  3ND8 A;  5BN5 A;  1B44 D;  3C1E A;  3E0J A;  1F77 A;  4UDU C;  1BCP C;  1Z7T A;  1HTL D;  4KKU A;  4RGM A;  3QB3 A;  3PUZ A;  4FXG C;  3DHQ A;  3VR2 A;  2ENB A;  1SFO B;  1SNQ A;  4BWG B;  3ND9 A;  4KJO A;  1ZXT A;  4C1N K;  1H9M A;  3VA5 A;  4RA8 A;  1STE A;  3S14 B;  3GP7 A;  1SE3 A;  1TS5 A;  2KED A;  3VYS A;  5M3M B;  1SEB D;  4PV1 C;  3MTS A;  2MPM A;  4QUC A;  2B2T C;  1E2W A;  2K1B A;  1B9N A;  1SAP A;  4HAE A;  5E4W C;  1OO9 B;  1RTN A;  4Q0F A;  4QIW B;  3SXH A;  3WDN A;  1E2Z A;  3D3R A;  1A6X A;  3MC0 B;  1IYV A;  1SNO A;  1E0B A;  2NVX B;  1R9T B;  2R7Z B;  3HG9 A;  3J81 L;  4NMZ A;  2RVL A;  4XDX A;  2EVB A;  1TS4 A;  3NWT A;  3P75 A;  3BDC A;  1I4X A;  4KD4 A;  3P7J A;  2EYP A;  4A3I B;  3HEJ A;  2NTT A;  1EIG A;  2RKS A;  2J0T D;  5CV6 A;  1WTP A;  2NWG A;  5KYL A;  1EL0 A;  2LKV A;  1JE4 A;  4UAI A;  3S1R B;  4ULL A;  3QOJ A;  1STH A;  4KI0 A;  5K5P A;  2Z1C A;  2CQA A;  2OF1 A;  2F0H A;  3NHH A;  3A8K E;  3HGB A;  1LT4 D;  1LT3 D;  3S15 B;  3MXU A;  1B1Z A;  2KJX A;  4K6D A;  1GXD C;  1CZW A;  4HR7 B;  1HFN A;  3NTH A;  2QDB A;  3L9A X;  4BBR B;  3J81 E;  5KNC A;  2OT2 A;  3BVG A;  4WJW A;  1Q12 A;  2JA8 B;  4IFD I;  3TP8 A;  4BS9 A;  5T1G A;  2DY8 A;  5G3L D;  3T56 B;  3SK8 A;  1O7Y A;  4L8J A;  1LV9 A;  3A8J E;  1BOS A;  3TSS A;  1BCP F;  4S3S A;  5LL6 S;  2A5H A;  5C44 B;  3KLS A;  1A3T A;  3Q0A A;  3M7N A;  1BBX C;  2MGS A;  1EZ6 A;  4GZY C;  3NPP A;  1UUP A;  2B2W C;  2K05 A;  4FF4 A;  3KBG A;  2EDG A;  1GJX A;  2NVQ B;  2HUG A;  2Q8R E;  2DNC A;  1DCZ A;  1EY5 A;  1D5X C;  2A6H C;  1DYQ A;  5I2Y A;  3BVM A;  2KHS A;  5KEE A;  3Q24 A;  1SYE A;  5A2Q L;  2FFK B;  1WCM B;  2L9H A;  4K5V A;  3GTL B;  4CHT B;  4HSP A;  3LNN A;  4C3J B;  3JAM E;  4ZK9 B;  2NUC A;  3FPP A;  1YNN D;  2F0D A;  3PUV A;  4X3U A;  1WTV A;  2MHV A;  1F9S A;  1IHZ A;  2JP1 A;  3QJY A;  2IT1 A;  4O42 A;  2EY2 A;  2PMZ B;  4H7B A;  1JCK B;  5C5L A;  2F4I A;  2FJ2 A;  4FNF A;  3HOY B;  1ENA A;  4R8I A;  1SDF A;  2RBM A;  2WV6 D;  3DWP A;  1CM9 A;  2IW3 A;  3NBH A;  3MHB A;  3R8B A;  3HOV B;  3PO3 B;  2XRS D;  1HQM C;  2A68 D;  3R2I A;  3EVQ A;  4C1N I;  1I4Q A;  3VYR A;  2K5W A;  4C2M B;  3G6J B;  3CHB D;  4ODG A;  1GUW A;  3UI2 A;  5F2D A;  1QNU A;  4YIJ A;  3A56 A;  2A73 B;  3L7Z C;  3EA6 A;  1QE6 A;  1D5M C;  4WRD A;  2Q8I B;  3R3O A;  5IOD A;  2RDH A;  1STA A;  1I6H B;  2Z8L A;  3VR5 A;  2G9D A;  4A3B B;  3A7A B;  1DON A;  2K6A A;  1EY7 A;  1YNJ D;  3E6Z X;  2HCC A;  4KN4 C;  3NK9 A;  1CFM A;  4RGO S;  5C4Z A;  3BS1 A;  1EU4 A;  3SDZ A;  2GA4 B;  2LFN A;  4CKC A;  2XRQ D;  5CYU A;  4DK0 A;  1JIC A;  1PTO D;  3NQT A;  3V05 A;  1QB5 D;  1V1P B;  1H9J A;  1UEA B;  4HED A;  4ZQ3 A;  5FK9 C;  1DZ1 A;  4HSV A;  1BR9 A;  3F2U A;  3PUX A;  2EYO A;  4XQN A;  1D1I A;  3J7Y W;  1STB A;  5KND A;  2N55 A;  3KF8 A;  3PO2 B;  2TMP A;  1D5Z C;  1ML0 D;  1CHP D;  1SMY D;  2HDL A;  1ZKO A;  2PYK A;  1CA5 A;  3LWE A;  3MWY W;  1Y8O B;  3ITP A;  1F9P A;  1AN8 A;  1GHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...