3NHHA

Crystal structure of staphylococcal nuclease variant v23e-l36k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclease A
publication title Structural and thermodynamic consequences of burial of an artificial ion pair in the hydrophobic interior of a protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nhhA00
1NUCA 3SXHA 3QB3A 2F0MA 3LX0A 4OL7A 5CGKA 1JORA 2EYOA 2HQEA 4I65A 2OF1A 3MVVA 2KHSA 1KDBA 4DU9A 1SNQA 3SK5A 2EY2A 5DEHA 1SYGA 2F0QA 3D4DA 4ZUJA 4EQNA 5I6YA 1EY4A 4IZ8A 1KDCA 1SYCA 3NHHA 4IALA 3NQTA 2EYHA 5IGCA 5IIFA 5DAUA 5IGBA 1ENCA 1EZ6A 1STHA 2EYJA 4ODGA 5IGDA 2F0JA 4K14A 2F0NA 2WACA 4K2LA 5C5MA 1JOQA 4J6HA 2QDBA 3NUCA 2F0FA 4KHVA 1JOOA 3S9WA 2EYLA 1F2ZA 3QOJA 4RKBA 1SYBA 2RBMA 3DHQA 5J1ZA 5KIXA 4QF4A 4KJOA 1STAA 1EYCA 3SK4A 5CV8A 4YIJA 3NP8A 1KAAA 2PZTA 5CC4A 5K5PA 2EXZA 1SNOA 3ERQA 4KD3A 4TRDA 1F2YA 2F0IA 4WORA 1KABA 5ISRA 5I6WA 1AEXA 1F2MA 2F0LA 3MZ5A 2RKSA 4WRDA 2ENBA 1U9RA 1SYDA 4J1MA 4B9XA 2O4XA 2PW7A 3TP6A 5C3WA 3D4WA 1SYEA 4ZQ3A 2F0OA 4NMZA 1A2UA 4K5WA 4PNYA 4DGZA 3P75A 1EYAA 5IOCA 4KD4A 4F7XA 3TP5A 4EQOA 2F0SA 1TT2A 2EYFA 2F0KA 3PMFA 4N9PA 1EY7A 3TP8A 5CV7A 1STYA 2EYMA 4QMGA 2F0DA 4K6DA 3SHLA 5HGTA 5JAVA 5CV4A 1EY0A 5C4ZA 5KRUA 4F8MA 2NUCA 1EY5A 2OEOA 5EGTA 3OMGA 4NDXA 3NK9A 5IGFA 3SR1A 2PYKA 3P1HA 1II3A 5IODA 2PQEA 3EVQA 1JOKA 3HEJA 3V2TA 4IUNA 4ZUIA 5E3FA 1TQOA 4PMCA 2SNMA 4K8IA 4NKLA 3RUZA 1EY6A 1SNDA 4K2KA 3T16A 4PMBA 1STGA 4KY6A 4S3SA 5C3XA 1EYDA 2EY1A 2F3VA 3BDLA 5C4HA 5M9OA 3C1EA 5J39A 1IHZA 4KY5A 3EROA 1STNA 4KY7A 5CR3A 3MEHA 2F3WA 3D8GA 4HMIA 3HZXA 4ID6A 3BDCA 5NUCA 1KDAA 5CV5A 2OXPA 3TP7A 3D6CA 3H6MA 1SYFA 3SK8A 4B9WA 2LKVA 3QOLA 4ME5A 3VA5A 5J22A 2F0TA 3EJIA 2EY5A 4K8JA 5EKKA 4K5VA 4DFAA 1SNCA 1STBA 2RDFA 3R3OA 2SNSA 3T13A 4DF7A 5EKLA 4E6IA 4K5XA 2EY6A 3DMUA 4LAAA 2F0VA 4QB4A 1EY9A 4MIUA 4EQPA 5JOBA 5E1FA 5C5LA 5IGEA 5KYLA 1A2TA 4HTHA 2M00A 3E5SA 5F2DA 4H7BA 5KYIA 3NXWA 5KEEA 2F0HA 1RKNA 5C6AA 2PZUA 2F0EA 5HURA 1TR5A 3SK6A 5KGUA 1EY8A 2PW5A 4KTAA 1NSNS 3ITPA 3MXPA 1ENAA 3TMEA 2KQ3A 2EYPA 1A3TA 1A3UA 2F0UA 3OMCA 1A3VA 4EVOA 2SOBA 4NP5A 5IGGA 4R8NA 5I9PA 1EQVA 2PZWA 1SNMA 5CV9A 3OWFA 2F0GA 2F0WA 4KJNA 1EZ8A 5I9OA 4KV6A 4RKLA 3OSOA 4G57A 4N9TA 3MHBA 3C1FA 3U9OA 4HMJA 2F0PA 1SNPA 5CV6A
chains in the Genus database with same CATH superfamily
3A5ZB 2CH4W 4DXFA 3IFTA 1D5XC 4NB3A 1MJEA 5IYCH 1ASZA 4WFN3 5IGBA 1SMYD 4O2DA 2K14A 4DAYB 3J80i 5FKAC 4LUOA 2Z6KC 1CKNA 5DM73 2K32A 1ET6A 1XXGA 3NP8A 2PZTA 2VQEQ 1IBLL 2ICEC 3ICEA 1Q8IA 2VL6A 2RKSA 4LW1A 1A62A 2NN6G 4GNXB 5LMUQ 4KI0A 4DR5Q 4A3CH 1B2TA 1SMYC 2XGTA 4RCOA 4JI1Q 2YU9H 4GNXC 5IT9E 1YVCA 3PMFA 5DNFA 1QG7A 4BA1I 2AHOB 1VQBA 4GKJQ 4F8MA 1SE4A 5IGFA 2A6HC 1DJRD 2FMCA 4LNQA 4LUZA 1E2ZA 1V1QA 1XNQL 2HCCA 4K8IA 4C2MB 1UE5A 1LT6D 3M4OB 1AH9A 2K04A 2KCMA 2AKWB 3ERSX 3PQIA 1E22A 2B39A 1QWYA 1U5KA 2WINB 4L5TA 2E2JH 2A6ED 3FDTA 3AB9A 3VR6A 4X65L 3T51B 1JICA 2F0TA 1K9MC 4WJ4A 1X54A 4DFAA 1KIXA 2ZXOA 3HOWH 4E6IA 1GJXA 4L5RC 5K36H 4QB4A 3CCEA 1Y1VH 3GV6A 2DJFC 5F2DA 4JC0A 1VQMA 3DEPA 1O7ZA 2E76C 1NE3A 1UUPA 5GROA 1X6OA 4N8FA 4YCVA 1HA6A 2LMCB 3I7FA 1GKHA 3J81c 4JI5L 1IBLQ 1EQQA 4BBSH 1QUQB 1YHBA 2OWOA 2J0TD 3GTMB 1B4OA 1S5BD 3J81L 4CDDC 4A3BG 1SE2A 1QNUA 2K52A 5C44H 1H9KA 2OT2A 3E9HA 2L15A 3JC66 1PH5A 4UDUC 2IX1A 1Y8PB 3G71A 1YHAA 3UDFA 1D7QA 1TWGH 3N52A 4B08A 1YJNA 2EPBA 4IPDA 1LTBD 2CQAA 1CK1A 3H3VI 3CMEA 1JOOA 1A6XA 2ZTCA 4IUTA 2RHQB 4RAUC 3Q0AA 3HOZG 2R92H 1HA5A 1KAAA 1EIGA 2ZTEA 3A5UA 1SNOA 1XPRA 3T56B 1BUVT 3CCJA 1SJHD 4KN7C 1XNQQ 1SDFA 2VQFL 1HH2P 4FNFA 2BA0A 3H09A 2PW7A 1ZEQX 4C56C 2ICIA 4ILWA 4XXEA 3OIQA 2F0OA 2XRSD 3H3VH 4JW0A 1YBYA 3K80C 5JJZA 2Z0SA 2F0KA 4JI8L 2Z4IA 1F9SA 1Q46A 1UE6A 3OTOL 4X65Q 3PO3G 4IQZA 2QA4A 1ILPA 2OEOA 3S14B 3TN2A 3S1QH 1XMOL 1MBYA 4C3JB 3GTOB 2SNMA 1G6PA 4K2KA 5HGTA 2EQSA 2KBNA 4KY6A 3BZKA 1N33L 3NBIA 1YJ9A 1IL8A 3T1YL 1VQLA 1GUGA 1EFWA 1I6VC 1A63A 4P2CB 2A74C 2A5HA 4DR7L 3HZXA 4QGUA 1V8QA 1HZBA 2I5HA 2QILA 3D6CA 3H6MA 1GUNA 4H02A 3PIO3 4JI5Q 4ME5A 2JXMB 4RH6A 3CCMA 4P72A 1H9SA 3QJYA 5FJ8G 4K8JA 1SEBD 2K6AA 3QG1A 1TU2B 3GTPB 2NBFA 1X3QA 3ZJYC 4R4QA 2F0VA 4A3KG 1XPUA 3W1GA 4JYAL 2MUYA 5EPLA 2NB0A 1ASYA 3F2UA 2ZJPA 2K05A 2CW0D 4K6LA 3CCSA 2DNCA 2NTSA 1H9MA 4DU9A 3RZOH 4HJ5A 2EYPA 4DNTB 1PLFA 3G48A 4R8NA 3KLSA 4BXXG 3TREA 5JPNC 4A3EB 5A2QL 3HKZB 1E0BA 2JA8G 1Q12A 3VYRA 2IX0A 4IUVA 4WJWA 2E2HH 5LL6X 2VQFQ 3I90A 2FMMA 4I65A 1YEZA 1S5ED 5C0XG 4KHPL 1JE5A 2YV5A 3AMUA 1K3BC 2CW0C 2BA1A 3S2HB 4JI8Q 2MO0A 3OTOQ 1PV4A 4KJOA 4RHRA 1EEID 2EOTA 4XT1B 3SDZA 1VDZA 2EXZA 1XMOQ 1AZPA 4BWGB 3M4YA 1S3OA 1X3FA 1BDOA 1PTOF 5I6WA 4H44C 1M4VA 1AE3A 4GN4B 2E8GA 3CCUA 1XWEA 1PYBA 4IUPA 1N33Q 1I6HH 2PNHA 3T1YQ 1FJGL 2O5IC 1WTOA 4DR7Q 3A74A 4EQOA 2F0SA 2VS1A 4YWKA 4DV2L 1EIYB 3UI2A 1EY7A 3EIVA 1MSHA 2F0DA 3TS2A 2RCFA 4Y7NH 3TZUA 1BNZA 2Q2IA 3FHWA 1W3SA 2PQEA 2XIWA 1KAWA 2AQ3B 4JYAQ 3MTSA 2NTTA 1TQOA 5ELBA 4A3MG 4FXKC 4OIKA 1B8AA 3GTLH 2ZXRA 1A0IA 1IHZA 3HOYH 2VZAA 2X69A 4BY1B 3BDCA 2KA7A 2AQ1B 3WOEA 4H13C 1VCIA 1QNKA 1FL0A 1AW7A 1ESFA 1KD1C 3S15B 4KHPQ 5JOBA 2OQ0A 2QF7A 3UDGA 3VR4A 5M3FG 1FNWA 5ELCA 5EQ0A 3KBXA 1R9TH 4CJ0B 5CORA 3K59A 5I9PA 1CA6A 1L0WA 2XRQD 4V190 1WCMH 3TDQA 2JA6B 1PH6A 1SFOB 4BY7B 1MD2D 3HOUG 4JOIA 4OL7A 1JORA 4EQNA 2D0OA 1F2LA 3MXNB 4UAIA 2VY3A 3EFXD 1HFGA 1FJGQ 2SEBD 5C3EH 4XQNA 1YJWA 4DV2Q 2UUCL 4K2LA 2R93H 4J6HA 3GDEA 1TS5A 1SYBA 3VR5A 2RF4A 3KOJA 1LUZA 1KL9A 2IL8A 1I4RA 1O7LA 3H0GG 2B63G 2CQOA 2K33A 4TRDA 5FO9B 2DUDA 3PCOB 3A55A 3PUWA 1HQRD 4OWWB 4LFAL 2O4XA 2VW9A 4A3JG 2C35B 2E5LL 1EUJA 3AEVA 4DA2A 2R6GA 5C4XH 2X6GA 1PRTD 1TXYA 2DJGC 3TSSA 3FRPB 2K5QA 1TT2A 3BYTB 2Z8LA 2VNUD 5CV7A 2F4VQ 1IW7C 1OXUA 2B2YC 1WVLA 4UP8A 1L1OB 3J81i 5EGTA 2E74C 5FO7B 1B3AA 1L1OC 4BBRB 4PG3A 1Y1WG 5JVH3 1GXDC 2DN8A 3R93A 4CKCA 2LSSA 3NPPA 4IFDG 2N88A 3D4RA 2JA5G 3E3XA 5FK9C 4O1NA 2FJ2A 1NNXA 2Y0SB 5FO8B 1CKOA 1RCVD 3HKZE 1KQSA 2Q8RE 1CHPD 1X3GA 4A3GG 2L4NA 1HUNA 3DLLA 1IYUA 2NZOA 2RDFA 3S16B 4DF7A 4F87A 1VS0A 4A93G 3TQYA 1A2TA 3DEOA 4X64L 4EQ5A 3CCVA 1C0AA 2UUCQ 1PZJD 4LFCL 1CA5A 1E24A 4C3HG 4ABNA 1JB3A 4JPBW 1DXMA 5EKIA 1BCPD 3TZDA 4APVA 4DV1L 1YIJA 2R7ZH 4A3IH 1BF4A 2MNAA 4YCWA 3SXHA 3Q23A 2ATWA 1TWCB 1QZGA 4LFAQ 3SK5A 1W6KA 1SYGA 3MC0B 2E5LQ 1A8VA 1LABA 3PO2B 2J7ZA 4GKKL 4JI6L 2F0NA 1HTLD 1JOQA 2F0FA 1B3QA 3FKIG 4RKBA 1BCPB 3NBHA 4XDXA 2Z6BA 3KBGA 4DR3L 1BCPC 2N3SA 4O42A 1XYIA 1D1IA 2RSNA 4QL5A 3PUZA 4RA8A 1XTCD 2Q8IB 5I4DA 1MI2A 1DYQA 4J1MA 4EX5A 1VQDA 3CC4A 1GHKA 2E75C 5IP9H 4NMZA 1EYAA 4X3KA 5D3IB 1BBWA 3Q8DA 1TS3A 4OELB 2E2DC 4YWMA 4NXNL 1JCKB 5JAVA 4NXML 3G6JB 1WOCA 3HFZB 3X3NA 3A56A 4KKSA 3SR1A 2A68D 2PYKA 4H0LC 3J81E 1O78A 3STBD 4AYBB 3CD6A 2PQAA 1C8CA 3S1RH 4QQBX 3AQQA 4X64Q 1NR2A 1STGA 2R7DA 3BDLA 3PGZA 2K03A 5C4HA 3E0JA 3K7UC 1B1ZA 4LFCQ 1QOHA 3FPPA 3ZYYX 5CR3A 2YU9B 5IYDH 2G5DA 1WFQA 1MIUA 4Q0FA 2LKVA 1NAPA 4DV1Q 4LF8L 3GTKH 2GN5A 3ULLA 5J22A 4OWXB 4B3RL 1N9WA 2P5ZX 4QUCA 1F9PA 5EKLA 1BBXC 1I4HA 2EY6A 2IHEA 1T9HA 1CUKA 1X55A 4G7ZC 3MXUA 3AU7A 4GKKQ 5FOBB 4JI6Q 1WTHA 3OOCA 2RQXA 3S1NH 3GO5A 3SK6A 1EY8A 5J39A 1LLRD 2KEDA 2BE5D 2WKCA 2D2CC 5CV9A 4DR3Q 2E2JB 4KV6A 3VA7A 2KHIA 1TVXA 3MHBA 2RDGA 3EQLC 1N34L 3K7AH 3UE1A 2YYZA 5CGKA 2IT1A 3MVVA 1DOLA 3MA2B 1H9RA 2Q8TA 5DEHA 2F0QA 3UDIA 3HOWB 3NSWA 1EY4A 1I4PA 5IGCA 4IALA 2F4IA 1Y1VB 5LHY1 2BDNA 4RHSA 5JEAJ 3URYA 4DUYL 2JEAI 4RGOS 5M5WH 4NXNQ 1S5CD 2NYZD 2R61A 3C3LA 4NXMQ 3I4NH 2BE5C 2RDHA 3BJUA 1CI3M 2B2VC 3GTQH 4QIWE 1G291 3I91A 2F3IA 4BBSB 3CAMA 4WORA 2B2TC 1XNRL 4ZKCB 4FF2A 1I5FA 3HOVH 1U9RA 1TWHH 2XWJB 3DWPA 1M90C 1LM0A 5C44B 4B3TL 3HKSA 4ZQ3A 5DM63 3G4SA 3TS0A 1YNXA 3KF8A 2EIFA 5IOCA 4OO1I 1TWGB 3K6OA 3TP5A 2XSCA 1RDPD 2ES2A 2K75A 1PXUA 3K8AA 1AE2A 4X66L 1B7YB 2GA4B 4K6DA 4DR1L 3KLRA 5A2QE 4LF8Q 1I50H 3KLWA 3OW2A 4IOAA 5J3BA 4B3RQ 1DM0B 2R92B 1VQ9A 1ILQA 1EYGA 3E0EA 2ALYB 3MWYW 2Z6KA 3G7LA 5BN5A 3T16A 3IRBA 4DAYA 2VUMG 1ZKOA 4O0AA 4OO1H 3I72A 1S5FD 5FLXL 2O5JC 3C1EA 2A73B 1STNA 2PMZB 4TKOB 3E9IA 2RVLA 3TP7A 3ER0A 2OXPA 3PIPA 3H3VC 4IPGA 1HUMA 2K1BA 1WTPA 2JA5H 4B9WA 3I4MH 1AFPA 4CJ1B 1N34Q 4GLVB 1GO3E 1ZXTA 3S1QB 1SMXA 3T13A 4GNXA 1LTID 5BN3A 1HNZL 1TY2A 3HOXH 5JJKA 3I3CA 2RA4A 4HTHA 5D65A 4A3FH 3IFDA 1ESRA 2KOLA 5KEEA 4DUYQ 4TSSA 1X3PA 4C3JG 5H1SE 1D6EC 1CQVA 4U673 2UXBL 5ELDA 3CW2C 3WOFA 2PW5A 2JSOA 1UWVA 3A7LA 4HN7A 4NP5A 2WFWA 2F0GA 4MNOA 4GN3B 2H5XA 3VDYA 1IYJB 4G57A 5E4XA 5GAGC 1XNRQ 3W5OA 2YTXA 1JWSD 2JA7H 4B3TQ 3FEWX 3NELA 4DNRB 1K73C 4KHZA 4HJ7A 4X66Q 4DK1A 4DR1Q 2M9VA 3IKJA 3NQIA 1XX8A 1EYCA 1M8AA 3SK4A 2A6EC 2E2IH 1KRTA 2G9DA 4UHVA 3GV3A 2JN4A 2F0IA 2RSOA 3I4OA 4R9WA 2E2HB 1F2MA 3I70A 2CWAA 4A3EG 1EWCA 4KKTA 3HKZG 1HR0W 2HQLA 3NTHA 3F2CA 3SEBA 4DR6L 3RLFA 2KVMA 4A76A 2IY5B 4RGTA 3R2IA 2EYFA 4OXPA 3TP8A 2JA9A 2N55A 1WD1A 3D3RA 4JBMA 3A8KE 2NUCA 4L63B 4IOCA 4LMQD 4NDXA 5JEAH 2NVTH 2VUMB 3U58A 1G6ZA 3ND8A 1HNZQ 3V2TA 4IUNA 2BDOA 3CC2A 3A54A 2EY1A 5KNBA 1I6HB 1B50A 1EOVA 4QY7A 5FLMG 2UXBQ 3M7NA 1R4PB 4R1JA 2PCFB 4U68A 2EJFC 4ID6A 1LV9A 3K5LA 2DGYA 3SK8A 2BH2A 3NWTA 3AFQA 4Y7NB 4KN4C 3PV0A 4UY8C 2A69D 1IBKL 5IYBG 1Q90A 1SNCA 3BDOA 5IP7H 1MJCA 2HIVA 4LF5L 4A3LH 5E1FA 4HSPA 1RHPA 3T1HL 3EBEA 3JAML 4C3IH 1RIPA 3M3YH 1I4XA 4DV6L 4KTAA 3L0OA 4PZ8A 3HOYB 2F0UA 3CHBD 2SOBA 4L8JA 1KLUD 1Q81C 3L2PA 1L0YB 4KJNA 1BBUA 4FO2A 4R4IA 3R2TA 1PDQA 4BY1G 5LL6S 4RGNA 5GAHC 2HQEA 4JI2L 2UU9L 5M3MB 4DR6Q 4ZUJA 3RNUA 3G6EA 1HFNA 1NBWA 1GUSA 2L1BA 3SE0A 1Z7TA 1N32L 4K0KL 2ZXPA 1I94L 1CFMA 2K7VA 3I8ZA 3NUCA 2EYLA 1R9TB 4DAPA 4POFA 5CC4A 1WCMB 5C4JH 2CWPA 3AYHB 1C7YA 3CQZH 1KNAA 4GLXA 2ENBA 2WAQB 2JA6G 3CP0A 5D3DA 3D4WA 3FVQA 1SYEA 4BY7G 4A3DB 1SR3A 4QJFA 2IWHA 1WTVA 2QEJC 1D8LA 3KDFA 2HCIA 2R7FA 5C3EB 1VQCA 1J9OA 2R93B 3KLSX 1RTNA 2AQ2B 2NN6I 4FXGC 2MO1A 1IBKQ 1Y69U 4HIKA 3P1HA 2A8VA 4IUQA 4WJ3M 1GUTA 5IODA 4LF5Q 1VQIA 1VQ6A 3HEJA 3EA6A 1NJIC 3T1HQ 2QEXA 4OEMB 2HDMA 4UP9A 5LMNL 3BG3A 3E6ZX 1HZAA 1CM9A 1EFID 5IT9L 4DV6Q 5C4XB 2XNAC 1Z47A 3M4QA 3PSIA 3ULPA 2NN6H 1SXTA 1W6JA 1HZ9A 3CXCA 1VQFA 5HY6A 1QCBD 3GQBA 1SE8A 2WB1B 4JI2Q 3R3OA 3HP3A 2Q2UA 2UU9Q 1MKHA 2FHTA 2L0CA 1LYLA 3A8JE 1FNVA 3S1MH 5I2XA 4HJAA 1N32Q 4BBRG 1ENFA 4X62L 2B2UC 4K0KQ 1UEBA 1I94Q 1IBML 1Y8OB 1DD2A 5HURA 5GAEC 1G2SA 2D0PA 3EN2A 4IO9A 1PYWD 2F4VL 2Y0SG 4N9TA 3OW7A 3T53B 1HQMC 1NMGA 3NEMA 3LX0A 4OX9L 1TS4A 1LTSD 2NVXH 4GLAC 5C0XJ 3D0FA 1YNJD 2Z4HA 3M9BA 2L12A 1ENCA 2K4KA 4K14A 2WACA 3V05A 1F2ZA 1CZWA 4AQYL 2AUKA 4P73A 3PUVA 1SRUA 5CBEE 1XMQL 4DN4M 3QIAA 1IZ6A 1GOZA 4PZ7A 5JJLA 3CF5A 2JJQA 5HGQA 1VQGA 3D31A 1LTAD 2R7ZB 4A3IB 2MGSA 4WRDA 4HIDA 4FYDA 1VQ5A 2KUMA 3KYHC 3MXGA 5LMNQ 2UXCQ 2D9UA 1YNJC 4LF7L 1OXVA 4P71A 3F8TA 4KD4A 4I7AA 4N9PA 2YTVA 3BVMA 4A3BH 1V1PB 2B8GA 2EYMA 1EOTA 4DUZL 3PO2G 3J80L 1VQNA 1PH1A 3OYYA 3HGBA 2JQOA 3K57A 3MXNA 1EQRA 3PF4A 4X62Q 2UUBL 4YWLA 5C3XA 3HOZH 1LT3D 2F3VA 1IBMQ 3O13A 1JE4A 3TRZA 1ML0D 1BVSA 3RD4A 1S72A 4PV1C 1UAPA 1VQ8A 1NTGA 5IYCG 4MTKA 1B44D 3PIOA 1PTOH 2D5DA 2J4XA 3NTIA 1HR0L 5ELFA 4OX9Q 4A4IA 1YI2A 1SN8A 1DOMA 2NVQH 2CHBD 3PO3H 1K3RA 3DM3A 3S1RB 4YHHL 1PRTB 2F1MA 3L7ZC 1G91A 1V1OA 4AYBG 1PRTC 1QVFA 2DNEA 5M5XB 3C2PA 1ENAA 3TMEA 4AQYQ 3GD7A 3OHXC 4DAVA 4OHJA 1XMQQ 1PFBA 4MHEA 2O2LD 4QCLA 1Q1EA 1BXTA 2F0WA 2M2LA 4A3CG 1LACA 1D5MC 4IPHA 3GTKB 3C1FA 4Z9CB 3RLOA 2WAQE 2LFNA 3DWAA 3OPOA 2F0MA 2IJ0A 4NPSA 4A75A 1XTDA 4LF7Q 3NQTA 2I5LX 4IN3A 1PH3A 1TIID 3K5OA 1C48A 5COYA 5FJ8H 4BY1H 3K5MA 1CKMA 3S1NB 3K0XA 3QOJA 4DUZQ 2EZVA 3KFUA 4A3KH 3L9AX 5C0XI 1PFMA 4P74A 3S17H 1UEAB 3ONAB 1E7ZA 3BZCA 4JI4L 1J8IA 3CCRA 4JBKA 3Q22A 5JJIA 3K7AB 3MZ5A 2C9OA 3HS0C 2MP1A 4C1NK 1KC8C 3A7AB 1SYDA 4BXXH 2UUBQ 4DAMA 1VQKA 5GQOA 3RLNA 5G3LF 2JA8H 4K5WA 3P75A 2A19A 2KECA 4B3ML 3S2DH 3TBIB 3VYSA 4HSVA 3HOWG 5M5WB 4HCSA 5K36G 4IJHA 3SHLA 5C0XH 1EY0A 1BCPF 1Y1VG 1HR0Q 1JMCA 3I4NB 2WB1E 3GTQB 4HJ8A 1PHJA 3K5NA 3K58A 2KENA 1K8OA 1E2WA 1DOKA 1PH7A 4DPGA 4YHHQ 2XVSA 3RUZA 4NKLA 4NW2A 3HOVB 1TWHB 2K5VA 3WDNA 4BBSG 4IFDJ 1RF2D 2FFKB 4DXGA 2ZTDA 4F88A 1IKMA 1CZGA 3UDXA 2CH4A 4PQXA 4X3UA 5C44G 4Y52H 5CV5A 1KXLA 2D62A 1PZKD 3QOLA 2VXWA 1I50B 1KRSA 5KNCA 4K5VA 4QUFA 4POGA 4YY3L 1IL2A 3CC7A 5M5YH 3LGJA 4X3SA 2KJXA 1FNUA 2R92G 1RODA 2F0HA 3BVGA 4OWTB 3NENA 1QB5D 2R3ZA 3GTJH 1WTWA 1A3UA 4A3MH 4HJ9A 3K0YA 2HT1A 2LXJA 4JI4Q 3I4MB 1JJ2A 2EJGC 2A68C 4LUVA 2EYOA 3STBC 1OXXK 2EY2A 1KLGD 1VQ4A 1VMCA 3HOXB 2EYHA 1U4PA 1Q3LA 5DAUA 4BS9A 4B3MQ 1STHA 2NVYH 3ND9A 4A3FB 1DZ1A 1GUWA 1TS2A 1I3QH 3CMAA 1JB7A 1H9JA 1X56A 4CKEA 5M3FH 4DV3L 2AWOA 1ZYRD 1IKLA 4R8IA 3ERQA 2K01A 1P8LA 1A15A 4ZLTF 4J15A 3TP6A 1Y14B 2JA7B 2XTIA 5ELNA 2WKDA 4ZK9B 4JI3L 4F7XA 1O7IA 3HOUH 2SDFA 1B9MA 3PF5A 3ULJA 4CJ2C 3KF6A 2B2WC 4GOPB 1ZYRC 2E2IB 3DWQA 4V0BA 1TWAH 3IL8A 1PVOA 4ME3A 1EIFA 4GOPC 1II3A 5BN4A 3EVQA 1DCZA 3H15A 1AP0A 4YY3Q 4UPAA 1AZQA 4CDCC 3VR3A 4HR7B 1RTOA 4PMBA 2Y0SE 4S3SA 3H0GH 2B2VA 4DNIA 2ZJRA 2B63H 4UP7A 3KF8B 3NWSA 2ASBA 4HMIA 4JCVE 2PI2E 1V43A 2H4OA 4A3JH 4DV5L 1D1KA 1CKNB 4IFDI 1K83H 3H91A 5IWAL 1G8ZD 2NVTB 1N8RC 3KJPA 2A1AA 2LXKA 2YTYA 5FLXc 3VYUA 3Q24A 5C5LA 4HIMA 1Q7YC 1PYSB 4FF1A 2M00A 1JWUD 2CVRA 3MFYA 1CHQD 3Q6SA 1Y1WH 2LS01 1NSNS 3MXPA 2B29A 5A35A 1A3TA 4EVOA 4DV3Q 4IFDH 3OWFA 1WYDA 2PO4A 2GVBA 1E1OA 1AEXA 2A6HD 3I55A 4FP5D 2MHVA 3FMCA 4EGVA 4LJZC 5I2YA 1TWFH 3DM1A 2KHSA 1KDBA 4HAEA 3BYYB 3F2DA 2V4DA 1GVPA 4IZ8A 1S40A 1WI5A 1ICFB 1DONA 5IIFA 4A3GH 4JI3Q 3HG9A 2EYJA 2F0JA 4N8X1 4C3IB 3M3YB 1QVGA 1JQYD 4KHVA 3GTGH 1HNXL 4A93H 2RBMA 4OGQC 1JT8A 3RZDH 2WIIB 3P7JA 1OTCA 1K28A 4KLKA 3HOYG 1XPOA 2I07B 3A8IE 4C3HH 5JVG3 1HTPA 2IW3A 3BS1A 2KCCA 1UE7A 1A2UA 4KK7A 4JVZA 3W1BA 3CKIB 3MAQA 1B53A 5M3MG 1EWIA 4AIMA 3SGIA 2NWGA 4DV5Q 3OIPA 3M85A 3KK7A 1STEA 5CV4A 3RZOB 3V96A 5IWAQ 1PH8A 4PZ6A 4AYBE 5C4JB 1NCVA 1VQ7A 1D5ZC 1CSQA 3CQZB 1WTRA 3FKIH 1DGSA 5E7NA 4PMCA 4RG1A 1WCMG 4CBVA 4L6TB 3J7ZC 1Y8NB 2BOSA 3RN5A 3N6RA 1RD9D 1VQAA 3S24A 2F3WA 2WAQG 3T4AC 3R8BA 4A3DG 1QUQA 4FDBA 2TSSA 3VA5A 2HDLA 5C3EG 2OTJA 1LTRD 1Z6HA 4KMUC 1VF5C 2R93G 2CKZB 4R4OA 1W2BA 1EY9A 1JR0D 3RMHA 4G7HC 3E5SA 4H7BA 2JE6I 4DKAC 1F77A 1PFNA 4DV4L 3MFGA 4IUUA 1HNXQ 4LK1C 5EJWA 2F03A 1EQVA 4MTNA 3J80E 5GADC 1SNMA 1LTTD 2EE1A 5C4XG 1C4QA 1AN8A 2I0QA 4CKBA 5KYLA 1NUCA 1SE3A 3PUXA 3QB3A 4X6AH 2B8FA 5D14A 4IPCA 1OXSC 3JAMc 3D4DA 1PH4A 1X9NA 1PA6A 3NHHA 2NZHA 3BVZA 1GHJA 1EZ6A 2EDGA 2WB1G 3S1MB 1EU4A 4LF6L 3GTLB 2UXDL 1HNWL 3HRZC 3DHQA 5KIXA 1E2VA 1OXTA 1STAA 4YIJA 1QILA 4IURA 1KTKA 2VB3X 2A69C 2L5TA 3F2BA 2OCEA 3F1ZA 2ID0A 4R4TA 1H9SB 5CBAE 4C2MH 5AJ3L 2NVXB 3M4OH 4ZYSA 1LT4D 1Q8KA 3U9SA 4LFBL 5EBDA 3CPFA 4MN3A 3RR5A 4MZ9A 2XN9C 4B3SL 1SSOA 5C4ZA 1EY5A 2KCNA 2JYOA 1Q82C 4ZAIA 4FXDA 1VQHA 3X3MA 1VF7A 1X3EA 5EAYA 4I7ZC 1HHVA 4RCNA 1VQOA 1EY6A 4CDEC 2PMZE 4Q5VA 2ZJQA 2R7ZG 1UNSA 1M1KC 4DV4Q 4A3IG 4M1UB 3H94A 3KDFB 5NUCA 4A3BB 3CPWA 2F52A 1L2FA 1RL2A 3GTMH 4DR2L 1XJVA 3OWEB 5EKKA 1G2TA 1O7YA 1FVIA 1PTOD 4GN5A 2V1CC 5EPJA 4XYQA 3DMUA 3U50C 2EJMA 5IT9c 2EVBA 3B6YA 4LF4L 3CU7A 1WD0A 5KYIA 2H1EA 3NXWA 2UXCL 1NR4A 3HOZB 3U4ZA 4LF6Q 5C6AA 4GZYC 2UXDQ 2F0EA 2TMPA 1HNWQ 1Z9FA 5E4WC 3I56A 1F9RA 1T5EA 2KQ3A 1PZID 1X32A 3NTKA 4ZRZA 3W2DA 5IGGA 1K8MA 1K8AC 1EZ8A 5IP9G 2VUMH 4YCUA 5T1IA 1PTOB 2JP1A 2F0PA 4GS3A 4HMJA 4JI0L 4OONA 1CT1D 1PTOC 5AJ3Q 2OF1A 2NVQB 1EU3A 1KDCA 1SYCA 3PO3B 3BZDB 1EIHA 4LFBQ 4JK1C 2N78A 5C5MA 1FR3A 3K81C 2QDBA 4B3SQ 1D2BA 5J1ZA 5ELEA 1NMFA 2ZT9C 4QF4A 1O80A 3S14H 1WTQA 3MEFA 5K5PA 4C3JH 2B2UA 2AWNA 5IYDG 3GTOH 1VQJA 3SVMA 2F0LA 5JPMC 1U4RA 1N36L 1SJED 1LTLA 2KHJA 2L9HA 1JC7A 4PMWA 1KNEA 1HZCA 4KKUA 2G9HD 2VB2X 4XQJA 3PUYA 5KRUA 4A3KB 3RN2A 2QGQA 4DR2Q 2HUGA 1J5EL 3NK9A 3QR8A 3CCLA 3S17B 4LWCA 2K5NA 3GTPH 1S5DD 5M3MH 1TKWB 1BOSA 4ZCKA 4ZKBB 3J7AV 2AMCB 5TSSA 1EL0A 2FINB 4LF4Q 1VQEA 1CQFA 5IY0A 1GUOA 5M9OA 1LO5D 2DY7A 4JOIC 2JA8B 1QZHA 3EROA 3J80c 1T5XD 2RCNA 3S2DB 3D8GA 4JBJA 1CTMA 4A3EH 1E3PA 3FPUB 4JI0Q 1J6QA 3I4LA 1P16A 1STBA 3KUPA 1K0RA 2L11A 1IXRA 4LAAA 4EQPA 4L5SA 3I4NG 5T1GA 4A3DH 4MIUA 4XT3B 5KNDA 4BA2I 2QKIC 5EPKA 1U4LA 3AFPA 3S2HH 1BKBA 1RKNA 1V1PA 4C1NI 1SBBB 3M4PA 1TR5A 4LF9L 5KGUA 1ET9A 1YNND 1A3VA 1IW7D 1YZ6A 3HOVG 2PZWA 4CHTB 3KJOA 4P75A 3L3OC 2Q2TA 2OTLA 4RFBA 5FLMH 3DUZA 5AFWA 4JI7L 1QVCA 5DLQE 3LWUA 5BR8L 4M8AA 1CSPA 3BU2A 2K28A 4DR4L 5I6YA 1LT5D 4DK0A 1S4ZA 4ALPA 1N36Q 5CYUA 5M5YB 1ICWA 2MPMA 1SLJA 4X3TA 1PRTF 2KCTA 4L5QA 3LWEA 2B2YA 5IGDA 4IJLA 5IYBH 3FP9A 4TQUS 1YNNC 1IYVA 4CDFC 3GTJB 1L1OA 1U0LA 2K5DA 2Q2HA 3M7GA 1B70B 4J8QA 2HD3A 3D6WA 4RWSC 2K5HA 5CV8A 1J5EQ 2ZM6L 4A3MB 4OO1G 1JWMD 1MSGA 1HXYD 4QIWB 4KD3A 4DK6C 1F2YA 1KABA 1GM5A 1LTGD 1E1TA 3TEHB 3I4MG 2LY7A 3P20A 4DGZA 5FLXE 1BR9A 1VQPA 3W3AA 2NVYB 2X6LA 5CMDA 1STYA 4QMGA 1I4GA 3HOXG 2PI2A 1KHIA 1TY0A 2JK8A 4DV0L 3CCQA 1I3QB 4DV7L 4A3FG 2MFIA 3OMGA 5M3FB 3J7A5 3S15H 2XWBB 1BO0A 4RMFA 4JBWA 5E3FA 3JAMi 2UUAL 5G3LD 4G7OC 1ONLA 3CRKC 1V9PA 2IHFA 4HIOA 4LF9Q 4HEDA 3I73A 4AH6A 3MEHA 1FD7D 3PIP3 3HOUB 2JA7G 1KDAA 1UE1A 4JG2A 2I5MX 4CGYB 2JA6H 3IAYA 1SYFA 2GVAA 2BH8A 1SAPA 1SFOH 4BY7H 4JI7Q 3NBHB 4DK3C 5BR8Q 1U4MA 1PH2A 1TWAB 2CFMA 3VYTA 4DR4Q 2SNSA 4XTCS 2FXQA 2PPBC 1BQQT 1HRJA 2L55A 3J81j 4ULLA 4RGMA 1FGUA 3UE0A 1WTXA 3H0GB 2B63B 4FVMA 2QDLA 2K50A 1WJJA 3OMCA 2AUJD 2ZM6Q 1HCZA 5EBCA 5I9OA 4RKLA 3OSOA 4A3JB 4FF3A 3U9OA 2CCZA 1SNPA 5CV6A 2WP8J 1JJGA 1K83B 2DY8A 3I2ZA 5IE8A 4JV5L 1X65A 3NE5B 1SNQA 1EEFD 1HJPA 2IPKD 2HHHL 1QJOA 1K0SA 3LNNA 2PQAB 4HCEA 5JEAG 4ODGA 1HPCA 1MHWC 3VR2A 1I4QA 2QW7A 4OIJA 3S9WA 1Y1WB 4DV0Q 1VMPA 4R4CA 4TVAB 4DV7Q 1EWHA 1MGSA 2N8NA 2PNRC 2K5WA 4BBRH 2JA5B 3U4VA 5ISRA 1EQTA 1B9NA 2HIXA 2IX3A 3J7YW 2BCOA 2EXDA 1QE6A 1YITA 1H95A 1TWFB 2UUAQ 5C3WA 3C46A 2Z9HA 1Q1BA 4PNYA 1NY4A 1PFSA 5M5XH 4A3GB 1FYCA 2B3GA 5IP7G 1JJCB 2NZ1D 4A3LG 1OO9B 3GTGB 4A93B 5ELOA 2QCPX 4G4KA 3DXJC 4C3IG 3RZDB 3A0JA 2VQEL 2OQKA 2I46A 3S16H 1R4QB 2C5CA 1GD7A 1JOKA 4ZUIA 4C3HB 4B9XA 1L0XB 1SNDA 1Q86C 1EYDA 2MJ8A 5LMUL 2KEEA 3JAME 4DR5L 4KY5A 4KY7A 4JI1L 3J7AF 1PMRA 2MQHA 5L37A 1K8GA 1F9QA 3CRLC 1SROA 2Z1CA 4GKJL 1RJTA 3EJIA 2EY5A 2WV6D 1TWCH 3KF6B 3QWNA 4JV5Q 3QO2A 2N49A 4K5XA 2JEBI 2HHHQ 3PO2H 3FKIB 5IGEA 1C9OA 1G51A 2B2WA 2PZUA 2RHSB 1PH9A 4XIGS 3WWVA 3ITPA 4GOPA 5LMNW 4XQQA 2B2TA 1YHQA 3GP7A 4XYOA 1FGBD 4FF4A
chains in the Genus database with same CATH topology
4DXFA 3IFTA 1D5XC 4WFN3 5IGBA 1SMYD 5FKAC 5DM73 2K32A 1ET6A 1XXGA 3NP8A 2PZTA 2ICEC 1Q8IA 2RKSA 2NN6G 4KI0A 1B2TA 1SMYC 4RCOA 5IT9E 3PMFA 5DNFA 1QG7A 4BA1I 4F8MA 1SE4A 5IGFA 2A6HC 1DJRD 2FMCA 1E2ZA 2HCCA 4K8IA 4C2MB 1LT6D 3M4OB 2K04A 2B39A 1QWYA 2WINB 2A6ED 3FDTA 3AB9A 3VR6A 3T51B 1JICA 2F0TA 4DFAA 2ZXOA 4E6IA 1GJXA 5K36H 4QB4A 3GV6A 5F2DA 3DEPA 1O7ZA 2E76C 1UUPA 1HA6A 2LMCB 3GTMB 2J0TD 1B4OA 1S5BD 3J81L 1SE2A 1QNUA 1H9KA 2OT2A 2IX1A 4UDUC 1Y8PB 3N52A 4B08A 2EPBA 1LTBD 2CQAA 1CK1A 1JOOA 1A6XA 4IUTA 4RAUC 3Q0AA 1HA5A 1KAAA 1EIGA 1SNOA 3T56B 1BUVT 1SJHD 4KN7C 1SDFA 2BA0A 3H09A 4FNFA 2PW7A 1ZEQX 4C56C 2ICIA 4ILWA 4XXEA 3OIQA 2F0OA 2XRSD 5JJZA 2F0KA 2Z4IA 1F9SA 4IQZA 1ILPA 2OEOA 3S14B 3TN2A 1MBYA 4C3JB 3GTOB 2SNMA 4K2KA 5HGTA 4KY6A 3NBIA 1IL8A 1GUGA 1I6VC 4P2CB 2A74C 2A5HA 3HZXA 1V8QA 3PIO3 2QILA 3D6CA 3H6MA 1GUNA 4ME5A 2JXMB 4RH6A 1H9SA 3QJYA 4K8JA 1SEBD 2K6AA 3QG1A 1TU2B 3GTPB 2NBFA 1X3QA 2F0VA 2MUYA 5EPLA 2NB0A 3F2UA 2K05A 2CW0D 4K6LA 2DNCA 2NTSA 1H9MA 4DU9A 2EYPA 4DNTB 1PLFA 4R8NA 3KLSA 5JPNC 4A3EB 5A2QL 3HKZB 1E0BA 1Q12A 3VYRA 2IX0A 4IUVA 4WJWA 5LL6X 3I90A 2FMMA 4I65A 1S5ED 5C0XG 3AMUA 2CW0C 2BA1A 3S2HB 4KJOA 4RHRA 1EEID 2EOTA 4XT1B 3SDZA 1VDZA 2EXZA 1AZPA 4BWGB 3M4YA 1BDOA 1PTOF 5I6WA 4H44C 1M4VA 1XWEA 4IUPA 2O5IC 1WTOA 4EQOA 2F0SA 3UI2A 1EY7A 1MSHA 2F0DA 3TZUA 1BNZA 2PQEA 2XIWA 2AQ3B 3MTSA 2NTTA 1TQOA 5ELBA 4FXKC 4OIKA 2ZXRA 1IHZA 2X69A 4BY1B 3BDCA 2KA7A 2AQ1B 3WOEA 4H13C 1VCIA 1QNKA 1AW7A 1ESFA 3S15B 5JOBA 2QF7A 3VR4A 1FNWA 5ELCA 5EQ0A 3KBXA 4CJ0B 5CORA 3K59A 5I9PA 1CA6A 2XRQD 4V190 3TDQA 2JA6B 1SFOB 4BY7B 1MD2D 4OL7A 1JORA 4EQNA 1F2LA 4UAIA 3EFXD 1HFGA 2SEBD 4XQNA 4K2LA 4J6HA 1TS5A 1SYBA 3VR5A 2IL8A 1I4RA 1O7LA 2K33A 4TRDA 5FO9B 3A55A 3PUWA 1HQRD 2O4XA 4DA2A 2R6GA 2X6GA 1PRTD 3TSSA 3FRPB 2K5QA 1TT2A 3BYTB 2Z8LA 2VNUD 5CV7A 1IW7C 1OXUA 2B2YC 1WVLA 5EGTA 2E74C 5FO7B 1B3AA 4BBRB 5JVH3 1GXDC 2DN8A 3R93A 4CKCA 3NPPA 4IFDG 2N88A 3D4RA 5FK9C 4O1NA 2FJ2A 2Y0SB 5FO8B 1RCVD 2Q8RE 1CHPD 2L4NA 1HUNA 1IYUA 2RDFA 3S16B 4DF7A 4F87A 1A2TA 3DEOA 1PZJD 1CA5A 4C3HG 4ABNA 1JB3A 1DXMA 5EKIA 1BCPD 3TZDA 1BF4A 3SXHA 3Q23A 1TWCB 3SK5A 1W6KA 1SYGA 3MC0B 1LABA 3PO2B 2J7ZA 2F0NA 1HTLD 1JOQA 2F0FA 4RKBA 1BCPB 3NBHA 4XDXA 3KBGA 1BCPC 4O42A 1XYIA 1D1IA 2RSNA 3PUZA 4RA8A 1XTCD 2Q8IB 5I4DA 1MI2A 1DYQA 4J1MA 1GHKA 2E75C 4NMZA 1EYAA 4X3KA 5D3IB 1TS3A 2E2DC 1JCKB 5JAVA 3G6JB 3X3NA 3A56A 4KKSA 3SR1A 2A68D 2PYKA 4H0LC 3J81E 1O78A 4AYBB 1C8CA 1NR2A 1STGA 3BDLA 2K03A 5C4HA 3E0JA 1B1ZA 1QOHA 3FPPA 3ZYYX 5CR3A 2YU9B 4Q0FA 2LKVA 1NAPA 5J22A 4QUCA 1F9PA 5EKLA 1BBXC 1I4HA 2EY6A 4G7ZC 3MXUA 3AU7A 5FOBB 2RQXA 3OOCA 3GO5A 3SK6A 1EY8A 5J39A 1LLRD 2KEDA 2BE5D 2WKCA 2D2CC 5CV9A 2E2JB 4KV6A 3VA7A 1TVXA 3MHBA 2RDGA 3EQLC 5CGKA 2YYZA 2IT1A 3MVVA 1DOLA 3MA2B 1H9RA 2Q8TA 5DEHA 2F0QA 3HOWB 3NSWA 1EY4A 1I4PA 5IGCA 4IALA 2F4IA 1Y1VB 5LHY1 2BDNA 4RHSA 5JEAJ 3URYA 2JEAI 4RGOS 1S5CD 2NYZD 2R61A 3C3LA 2BE5C 2RDHA 1CI3M 2B2VC 1G291 3I91A 4BBSB 4WORA 2B2TC 4ZKCB 4FF2A 1U9RA 2XWJB 3DWPA 5C44B 5DM63 4ZQ3A 3KF8A 5IOCA 4OO1I 1TWGB 3K6OA 3TP5A 2XSCA 1RDPD 1PXUA 4K6DA 2GA4B 3KLRA 5A2QE 1DM0B 2R92B 1ILQA 3MWYW 3G7LA 5BN5A 3T16A 4DAYA 1ZKOA 4OO1H 3I72A 1S5FD 5FLXL 2O5JC 3C1EA 2A73B 1STNA 2PMZB 4TKOB 2RVLA 3TP7A 2OXPA 3H3VC 1WTPA 1HUMA 2K1BA 4B9WA 1AFPA 4CJ1B 1ZXTA 3S1QB 3T13A 1LTID 5BN3A 1TY2A 3I3CA 2RA4A 4HTHA 5D65A 3IFDA 5KEEA 1ESRA 2KOLA 4TSSA 1X3PA 4C3JG 1D6EC 1CQVA 4U673 5ELDA 3WOFA 2PW5A 2JSOA 3A7LA 4HN7A 4NP5A 2F0GA 4G57A 5E4XA 1JWSD 3FEWX 4DNRB 4KHZA 4DK1A 2M9VA 3IKJA 3NQIA 1XX8A 1EYCA 1M8AA 3SK4A 2A6EC 2G9DA 3GV3A 2F0IA 2RSOA 4R9WA 2E2HB 1F2MA 3I70A 1EWCA 4KKTA 3NTHA 3SEBA 3RLFA 2KVMA 4RGTA 3R2IA 2EYFA 3TP8A 2N55A 1WD1A 3D3RA 3A8KE 2NUCA 4L63B 4LMQD 4NDXA 5JEAH 2VUMB 1G6ZA 3ND8A 3V2TA 4IUNA 2BDOA 3A54A 2EY1A 5KNBA 1I6HB 1B50A 3M7NA 1R4PB 2PCFB 4U68A 2EJFC 4ID6A 1LV9A 3K5LA 3SK8A 3NWTA 4Y7NB 4KN4C 3PV0A 2A69D 1Q90A 1SNCA 3BDOA 5E1FA 4HSPA 1RHPA 3JAML 1I4XA 4KTAA 3HOYB 2F0UA 3CHBD 2SOBA 4L8JA 1KLUD 1L0YB 4KJNA 4FO2A 3R2TA 1PDQA 5LL6S 4RGNA 2HQEA 5M3MB 4ZUJA 1HFNA 1GUSA 2L1BA 3SE0A 1Z7TA 2ZXPA 1CFMA 2K7VA 3I8ZA 3NUCA 2EYLA 1R9TB 4DAPA 5CC4A 1WCMB 1KNAA 2ENBA 2WAQB 5D3DA 3D4WA 3FVQA 1SYEA 4A3DB 2IWHA 1WTVA 2QEJC 2HCIA 5C3EB 1J9OA 2R93B 3KLSX 1RTNA 2AQ2B 2NN6I 4FXGC 1Y69U 3P1HA 4IUQA 1GUTA 5IODA 3HEJA 3EA6A 2HDMA 3BG3A 3E6ZX 1CM9A 1EFID 5IT9L 5C4XB 2XNAC 1Z47A 2NN6H 1SXTA 1W6JA 1QCBD 3GQBA 2WB1B 3R3OA 3HP3A 2FHTA 2L0CA 3A8JE 1FNVA 5I2XA 1ENFA 2B2UC 1Y8OB 1DD2A 5HURA 1G2SA 1PYWD 4N9TA 3OW7A 3T53B 1HQMC 3LX0A 1TS4A 1LTSD 5C0XJ 1YNJD 2Z4HA 2L12A 1ENCA 4K14A 2WACA 3V05A 1F2ZA 1CZWA 2AUKA 3PUVA 5CBEE 4DN4M 3QIAA 1GOZA 3D31A 1LTAD 2R7ZB 4A3IB 2MGSA 4WRDA 4FYDA 2KUMA 3MXGA 2D9UA 1YNJC 1OXVA 4KD4A 4N9PA 3BVMA 1V1PB 2B8GA 2EYMA 1EOTA 3J80L 3HGBA 3K57A 3MXNA 5C3XA 1LT3D 2F3VA 3O13A 1JE4A 1ML0D 3RD4A 4PV1C 1UAPA 1B44D 1PTOH 2D5DA 2J4XA 3NTIA 5ELFA 1DOMA 2CHBD 3S1RB 1PRTB 2F1MA 3L7ZC 1G91A 1V1OA 1PRTC 2DNEA 5M5XB 3C2PA 1ENAA 3TMEA 3GD7A 3OHXC 4DAVA 4OHJA 1PFBA 4MHEA 2O2LD 4QCLA 1Q1EA 1BXTA 2F0WA 2M2LA 1LACA 1D5MC 3GTKB 3C1FA 4Z9CB 3DWAA 2LFNA 3OPOA 2F0MA 2IJ0A 3NQTA 4IN3A 1TIID 3K5OA 1C48A 5COYA 3K5MA 3S1NB 3QOJA 2EZVA 3L9AX 5C0XI 1PFMA 1UEAB 3ONAB 1J8IA 3Q22A 3K7AB 3MZ5A 2C9OA 3HS0C 2MP1A 4C1NK 3A7AB 1SYDA 5G3LF 4K5WA 3P75A 2KECA 3TBIB 3VYSA 4HSVA 5M5WB 4HCSA 5K36G 3SHLA 5C0XH 1EY0A 1BCPF 3I4NB 3GTQB 3K5NA 3K58A 1K8OA 1E2WA 1DOKA 2XVSA 3RUZA 4NKLA 4NW2A 3HOVB 1TWHB 3WDNA 4IFDJ 1RF2D 2FFKB 4DXGA 4F88A 1IKMA 1CZGA 4PQXA 4X3UA 5CV5A 2D62A 1PZKD 3QOLA 2VXWA 1I50B 5KNCA 4K5VA 4QUFA 4X3SA 2KJXA 1FNUA 1RODA 2F0HA 3BVGA 1QB5D 2R3ZA 1WTWA 1A3UA 3K0YA 3I4MB 2EJGC 2A68C 2EYOA 1OXXK 2EY2A 1KLGD 1VMCA 3HOXB 2EYHA 1U4PA 1Q3LA 5DAUA 4BS9A 1STHA 3ND9A 4A3FB 1DZ1A 1GUWA 1TS2A 1H9JA 4CKEA 2AWOA 1ZYRD 1IKLA 4R8IA 3ERQA 2K01A 1A15A 4ZLTF 3TP6A 2JA7B 2WKDA 4ZK9B 4F7XA 2SDFA 1B9MA 4CJ2C 2B2WC 1ZYRC 2E2IB 3DWQA 4V0BA 3IL8A 1II3A 5BN4A 3EVQA 1DCZA 1AP0A 1AZQA 3VR3A 4HR7B 1RTOA 4PMBA 4S3SA 2B2VA 3NWSA 4HMIA 1V43A 2H4OA 1D1KA 4IFDI 3H91A 1G8ZD 2NVTB 3VYUA 3Q24A 5C5LA 4FF1A 2M00A 1JWUD 2CVRA 3MFYA 1CHQD 3Q6SA 2LS01 1NSNS 3MXPA 5A35A 1A3TA 4EVOA 4IFDH 3OWFA 2PO4A 2A6HD 1AEXA 4FP5D 2MHVA 3FMCA 4EGVA 4LJZC 5I2YA 3DM1A 2KHSA 1KDBA 4HAEA 3BYYB 2V4DA 4IZ8A 1DONA 5IIFA 3HG9A 2EYJA 2F0JA 4C3IB 3M3YB 1JQYD 4KHVA 2RBMA 4OGQC 2WIIB 3P7JA 2I07B 3A8IE 5JVG3 1HTPA 2IW3A 3BS1A 2KCCA 1A2UA 4KK7A 3CKIB 3MAQA 1B53A 2NWGA 3OIPA 3M85A 3KK7A 1STEA 5CV4A 3RZOB 3V96A 5C4JB 1NCVA 1D5ZC 3CQZB 1WTRA 4PMCA 4CBVA 4L6TB 1Y8NB 2BOSA 3N6RA 1RD9D 2F3WA 3T4AC 3R8BA 2TSSA 3VA5A 2HDLA 1LTRD 1Z6HA 4KMUC 1VF5C 1EY9A 1JR0D 3RMHA 4G7HC 3E5SA 4H7BA 2JE6I 1F77A 1PFNA 3MFGA 4IUUA 4LK1C 5EJWA 2F03A 1EQVA 3J80E 1SNMA 1LTTD 2EE1A 1C4QA 1AN8A 4CKBA 5KYLA 1NUCA 1SE3A 3PUXA 3QB3A 2B8FA 5D14A 1OXSC 3D4DA 3NHHA 3BVZA 1GHJA 1EZ6A 2EDGA 3S1MB 1EU4A 3GTLB 3HRZC 3DHQA 5KIXA 1E2VA 1OXTA 1STAA 4YIJA 1QILA 4IURA 1KTKA 2VB3X 2A69C 2L5TA 2ID0A 1H9SB 5CBAE 2NVXB 4ZYSA 1LT4D 3U9SA 5EBDA 4MN3A 2XN9C 1SSOA 5C4ZA 1EY5A 2KCNA 2JYOA 4ZAIA 4FXDA 3X3MA 1VF7A 4I7ZC 1HHVA 4RCNA 1EY6A 4Q5VA 1UNSA 4M1UB 3H94A 5NUCA 4A3BB 3OWEB 5EKKA 1G2TA 1O7YA 1PTOD 5EPJA 4XYQA 3DMUA 2EJMA 2EVBA 3CU7A 1WD0A 5KYIA 2H1EA 3NXWA 1NR4A 3HOZB 5C6AA 4GZYC 2F0EA 2TMPA 5E4WC 1F9RA 1T5EA 2KQ3A 1PZID 1X32A 3NTKA 4ZRZA 3W2DA 5IGGA 1K8MA 1EZ8A 5T1IA 1PTOB 2JP1A 2F0PA 4HMJA 1CT1D 1PTOC 2OF1A 2NVQB 1EU3A 1KDCA 1SYCA 3PO3B 3BZDB 1EIHA 4JK1C 5C5MA 1FR3A 2QDBA 1D2BA 5J1ZA 5ELEA 2ZT9C 4QF4A 1O80A 1WTQA 5K5PA 2B2UA 2AWNA 3SVMA 2F0LA 5JPMC 1U4RA 1SJED 2L9HA 1JC7A 4PMWA 1KNEA 4KKUA 2G9HD 2VB2X 4XQJA 3PUYA 5KRUA 4A3KB 2HUGA 3NK9A 3S17B 1S5DD 1TKWB 1BOSA 3J7AV 4ZKBB 5TSSA 1EL0A 2FINB 1CQFA 1GUOA 5M9OA 1LO5D 2DY7A 2JA8B 3EROA 1T5XD 3S2DB 3D8GA 1CTMA 3FPUB 3I4LA 1STBA 3KUPA 2L11A 4LAAA 4EQPA 5T1GA 4MIUA 4XT3B 5KNDA 4BA2I 2QKIC 5EPKA 1U4LA 1RKNA 1V1PA 4C1NI 1SBBB 1TR5A 5KGUA 1ET9A 1YNND 1A3VA 1IW7D 2PZWA 4CHTB 3L3OC 4RFBA 3DUZA 5AFWA 3LWUA 4M8AA 2K28A 5I6YA 1LT5D 4DK0A 1S4ZA 5CYUA 5M5YB 1ICWA 2MPMA 4X3TA 1PRTF 3LWEA 2B2YA 5IGDA 4TQUS 1YNNC 1IYVA 3GTJB 2K5DA 4J8QA 3M7GA 3D6WA 4RWSC 5CV8A 4A3MB 4OO1G 1JWMD 1MSGA 1HXYD 4QIWB 4KD3A 1F2YA 1KABA 1LTGD 2LY7A 3P20A 4DGZA 5FLXE 1BR9A 3W3AA 2NVYB 2X6LA 5CMDA 1STYA 4QMGA 1I4GA 1TY0A 1I3QB 3OMGA 5M3FB 2XWBB 1BO0A 4JBWA 5E3FA 5G3LD 4G7OC 1ONLA 3CRKC 4HEDA 3I73A 3MEHA 1FD7D 3PIP3 3HOUB 1KDAA 4CGYB 3IAYA 1SYFA 1SAPA 1U4MA 1TWAB 3VYTA 2SNSA 4XTCS 2PPBC 1BQQT 1HRJA 2L55A 4ULLA 4RGMA 1WTXA 3H0GB 2B63B 4FVMA 3OMCA 2AUJD 1HCZA 5EBCA 5I9OA 4RKLA 3OSOA 4A3JB 4FF3A 3U9OA 1SNPA 5CV6A 2WP8J 1K83B 2DY8A 3NE5B 1SNQA 1EEFD 2IPKD 1QJOA 3LNNA 4HCEA 5JEAG 4ODGA 1HPCA 3VR2A 1I4QA 4OIJA 3S9WA 1Y1WB 1VMPA 1EWHA 1MGSA 2PNRC 2K5WA 2JA5B 5ISRA 1EQTA 1B9NA 2IX3A 3J7YW 2BCOA 1QE6A 1TWFB 5C3WA 3C46A 1Q1BA 4PNYA 4A3GB 1FYCA 2NZ1D 1OO9B 3GTGB 4A93B 2QCPX 4G4KA 3DXJC 4C3IG 3RZDB 2I46A 1R4QB 2C5CA 1JOKA 4ZUIA 4C3HB 4B9XA 1L0XB 1SNDA 1EYDA 2MJ8A 2KEEA 3JAME 4KY5A 4KY7A 3J7AF 1PMRA 1F9QA 3CRLC 2Z1CA 1RJTA 3EJIA 2EY5A 2WV6D 3QWNA 3QO2A 4K5XA 2JEBI 3FKIB 5IGEA 2B2WA 2PZUA 4XIGS 3ITPA 4XQQA 2B2TA 3GP7A 4XYOA 1FGBD 4FF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUC A;  3SXH A;  3QB3 A;  2F0M A;  3LX0 A;  4OL7 A;  5CGK A;  1JOR A;  2EYO A;  2HQE A;  4I65 A;  2OF1 A;  3MVV A;  2KHS A;  1KDB A;  4DU9 A;  1SNQ A;  3SK5 A;  2EY2 A;  5DEH A;  1SYG A;  2F0Q A;  3D4D A;  4ZUJ A;  4EQN A;  5I6Y A;  1EY4 A;  4IZ8 A;  1KDC A;  1SYC A;  3NHH A;  4IAL A;  3NQT A;  2EYH A;  5IGC A;  5IIF A;  5DAU A;  5IGB A;  1ENC A;  1EZ6 A;  1STH A;  2EYJ A;  4ODG A;  5IGD A;  2F0J A;  4K14 A;  2F0N A;  2WAC A;  4K2L A;  5C5M A;  1JOQ A;  4J6H A;  2QDB A;  3NUC A;  2F0F A;  4KHV A;  1JOO A;  3S9W A;  2EYL A;  1F2Z A;  3QOJ A;  4RKB A;  1SYB A;  2RBM A;  3DHQ A;  5J1Z A;  5KIX A;  4QF4 A;  4KJO A;  1STA A;  1EYC A;  3SK4 A;  5CV8 A;  4YIJ A;  3NP8 A;  1KAA A;  2PZT A;  5CC4 A;  5K5P A;  2EXZ A;  1SNO A;  3ERQ A;  4KD3 A;  4TRD A;  1F2Y A;  2F0I A;  4WOR A;  1KAB A;  5ISR A;  5I6W A;  1AEX A;  1F2M A;  2F0L A;  3MZ5 A;  2RKS A;  4WRD A;  2ENB A;  1U9R A;  1SYD A;  4J1M A;  4B9X A;  2O4X A;  2PW7 A;  3TP6 A;  5C3W A;  3D4W A;  1SYE A;  4ZQ3 A;  2F0O A;  4NMZ A;  1A2U A;  4K5W A;  4PNY A;  4DGZ A;  3P75 A;  1EYA A;  5IOC A;  4KD4 A;  4F7X A;  3TP5 A;  4EQO A;  2F0S A;  1TT2 A;  2EYF A;  2F0K A;  3PMF A;  4N9P A;  1EY7 A;  3TP8 A;  5CV7 A;  1STY A;  2EYM A;  4QMG A;  2F0D A;  4K6D A;  3SHL A;  5HGT A;  5JAV A;  5CV4 A;  1EY0 A;  5C4Z A;  5KRU A;  4F8M A;  2NUC A;  1EY5 A;  2OEO A;  5EGT A;  3OMG A;  4NDX A;  3NK9 A;  5IGF A;  3SR1 A;  2PYK A;  3P1H A;  1II3 A;  5IOD A;  2PQE A;  3EVQ A;  1JOK A;  3HEJ A;  3V2T A;  4IUN A;  4ZUI A;  5E3F A;  1TQO A;  4PMC A;  2SNM A;  4K8I A;  4NKL A;  3RUZ A;  1EY6 A;  1SND A;  4K2K A;  3T16 A;  4PMB A;  1STG A;  4KY6 A;  4S3S A;  5C3X A;  1EYD A;  2EY1 A;  2F3V A;  3BDL A;  5C4H A;  5M9O A;  3C1E A;  5J39 A;  1IHZ A;  4KY5 A;  3ERO A;  1STN A;  4KY7 A;  5CR3 A;  3MEH A;  2F3W A;  3D8G A;  4HMI A;  3HZX A;  4ID6 A;  3BDC A;  5NUC A;  1KDA A;  5CV5 A;  2OXP A;  3TP7 A;  3D6C A;  3H6M A;  1SYF A;  3SK8 A;  4B9W A;  2LKV A;  3QOL A;  4ME5 A;  3VA5 A;  5J22 A;  2F0T A;  3EJI A;  2EY5 A;  4K8J A;  5EKK A;  4K5V A;  4DFA A;  1SNC A;  1STB A;  2RDF A;  3R3O A;  2SNS A;  3T13 A;  4DF7 A;  5EKL A;  4E6I A;  4K5X A;  2EY6 A;  3DMU A;  4LAA A;  2F0V A;  4QB4 A;  1EY9 A;  4MIU A;  4EQP A;  5JOB A;  5E1F A;  5C5L A;  5IGE A;  5KYL A;  1A2T A;  4HTH A;  2M00 A;  3E5S A;  5F2D A;  4H7B A;  5KYI A;  3NXW A;  5KEE A;  2F0H A;  1RKN A;  5C6A A;  2PZU A;  2F0E A;  5HUR A;  1TR5 A;  3SK6 A;  5KGU A;  1EY8 A;  2PW5 A;  4KTA A;  1NSN S;  3ITP A;  3MXP A;  1ENA A;  3TME A;  2KQ3 A;  2EYP A;  1A3T A;  1A3U A;  2F0U A;  3OMC A;  1A3V A;  4EVO A;  2SOB A;  4NP5 A;  5IGG A;  4R8N A;  5I9P A;  1EQV A;  2PZW A;  1SNM A;  5CV9 A;  3OWF A;  2F0G A;  2F0W A;  4KJN A;  1EZ8 A;  5I9O A;  4KV6 A;  4RKL A;  3OSO A;  4G57 A;  4N9T A;  3MHB A;  3C1F A;  3U9O A;  4HMJ A;  2F0P A;  1SNP A;  5CV6 A; 
#chains in the Genus database with same CATH topology
 3A5Z B;  2CH4 W;  4DXF A;  3IFT A;  1D5X C;  4NB3 A;  1MJE A;  5IYC H;  1ASZ A;  4WFN 3;  5IGB A;  1SMY D;  4O2D A;  2K14 A;  4DAY B;  3J80 i;  5FKA C;  4LUO A;  2Z6K C;  1CKN A;  5DM7 3;  2K32 A;  1ET6 A;  1XXG A;  3NP8 A;  2PZT A;  2VQE Q;  1IBL L;  2ICE C;  3ICE A;  1Q8I A;  2VL6 A;  2RKS A;  4LW1 A;  1A62 A;  2NN6 G;  4GNX B;  5LMU Q;  4KI0 A;  4DR5 Q;  4A3C H;  1B2T A;  1SMY C;  2XGT A;  4RCO A;  4JI1 Q;  2YU9 H;  4GNX C;  5IT9 E;  1YVC A;  3PMF A;  5DNF A;  1QG7 A;  4BA1 I;  2AHO B;  1VQB A;  4GKJ Q;  4F8M A;  1SE4 A;  5IGF A;  2A6H C;  1DJR D;  2FMC A;  4LNQ A;  4LUZ A;  1E2Z A;  1V1Q A;  1XNQ L;  2HCC A;  4K8I A;  4C2M B;  1UE5 A;  1LT6 D;  3M4O B;  1AH9 A;  2K04 A;  2KCM A;  2AKW B;  3ERS X;  3PQI A;  1E22 A;  2B39 A;  1QWY A;  1U5K A;  2WIN B;  4L5T A;  2E2J H;  2A6E D;  3FDT A;  3AB9 A;  3VR6 A;  4X65 L;  3T51 B;  1JIC A;  2F0T A;  1K9M C;  4WJ4 A;  1X54 A;  4DFA A;  1KIX A;  2ZXO A;  3HOW H;  4E6I A;  1GJX A;  4L5R C;  5K36 H;  4QB4 A;  3CCE A;  1Y1V H;  3GV6 A;  2DJF C;  5F2D A;  4JC0 A;  1VQM A;  3DEP A;  1O7Z A;  2E76 C;  1NE3 A;  1UUP A;  5GRO A;  1X6O A;  4N8F A;  4YCV A;  1HA6 A;  2LMC B;  3I7F A;  1GKH A;  3J81 c;  4JI5 L;  1IBL Q;  1EQQ A;  4BBS H;  1QUQ B;  1YHB A;  2OWO A;  2J0T D;  3GTM B;  1B4O A;  1S5B D;  3J81 L;  4CDD C;  4A3B G;  1SE2 A;  1QNU A;  2K52 A;  5C44 H;  1H9K A;  2OT2 A;  3E9H A;  2L15 A;  3JC6 6;  1PH5 A;  4UDU C;  2IX1 A;  1Y8P B;  3G71 A;  1YHA A;  3UDF A;  1D7Q A;  1TWG H;  3N52 A;  4B08 A;  1YJN A;  2EPB A;  4IPD A;  1LTB D;  2CQA A;  1CK1 A;  3H3V I;  3CME A;  1JOO A;  1A6X A;  2ZTC A;  4IUT A;  2RHQ B;  4RAU C;  3Q0A A;  3HOZ G;  2R92 H;  1HA5 A;  1KAA A;  1EIG A;  2ZTE A;  3A5U A;  1SNO A;  1XPR A;  3T56 B;  1BUV T;  3CCJ A;  1SJH D;  4KN7 C;  1XNQ Q;  1SDF A;  2VQF L;  1HH2 P;  4FNF A;  2BA0 A;  3H09 A;  2PW7 A;  1ZEQ X;  4C56 C;  2ICI A;  4ILW A;  4XXE A;  3OIQ A;  2F0O A;  2XRS D;  3H3V H;  4JW0 A;  1YBY A;  3K80 C;  5JJZ A;  2Z0S A;  2F0K A;  4JI8 L;  2Z4I A;  1F9S A;  1Q46 A;  1UE6 A;  3OTO L;  4X65 Q;  3PO3 G;  4IQZ A;  2QA4 A;  1ILP A;  2OEO A;  3S14 B;  3TN2 A;  3S1Q H;  1XMO L;  1MBY A;  4C3J B;  3GTO B;  2SNM A;  1G6P A;  4K2K A;  5HGT A;  2EQS A;  2KBN A;  4KY6 A;  3BZK A;  1N33 L;  3NBI A;  1YJ9 A;  1IL8 A;  3T1Y L;  1VQL A;  1GUG A;  1EFW A;  1I6V C;  1A63 A;  4P2C B;  2A74 C;  2A5H A;  4DR7 L;  3HZX A;  4QGU A;  1V8Q A;  1HZB A;  2I5H A;  2QIL A;  3D6C A;  3H6M A;  1GUN A;  4H02 A;  3PIO 3;  4JI5 Q;  4ME5 A;  2JXM B;  4RH6 A;  3CCM A;  4P72 A;  1H9S A;  3QJY A;  5FJ8 G;  4K8J A;  1SEB D;  2K6A A;  3QG1 A;  1TU2 B;  3GTP B;  2NBF A;  1X3Q A;  3ZJY C;  4R4Q A;  2F0V A;  4A3K G;  1XPU A;  3W1G A;  4JYA L;  2MUY A;  5EPL A;  2NB0 A;  1ASY A;  3F2U A;  2ZJP A;  2K05 A;  2CW0 D;  4K6L A;  3CCS A;  2DNC A;  2NTS A;  1H9M A;  4DU9 A;  3RZO H;  4HJ5 A;  2EYP A;  4DNT B;  1PLF A;  3G48 A;  4R8N A;  3KLS A;  4BXX G;  3TRE A;  5JPN C;  4A3E B;  5A2Q L;  3HKZ B;  1E0B A;  2JA8 G;  1Q12 A;  3VYR A;  2IX0 A;  4IUV A;  4WJW A;  2E2H H;  5LL6 X;  2VQF Q;  3I90 A;  2FMM A;  4I65 A;  1YEZ A;  1S5E D;  5C0X G;  4KHP L;  1JE5 A;  2YV5 A;  3AMU A;  1K3B C;  2CW0 C;  2BA1 A;  3S2H B;  4JI8 Q;  2MO0 A;  3OTO Q;  1PV4 A;  4KJO A;  4RHR A;  1EEI D;  2EOT A;  4XT1 B;  3SDZ A;  1VDZ A;  2EXZ A;  1XMO Q;  1AZP A;  4BWG B;  3M4Y A;  1S3O A;  1X3F A;  1BDO A;  1PTO F;  5I6W A;  4H44 C;  1M4V A;  1AE3 A;  4GN4 B;  2E8G A;  3CCU A;  1XWE A;  1PYB A;  4IUP A;  1N33 Q;  1I6H H;  2PNH A;  3T1Y Q;  1FJG L;  2O5I C;  1WTO A;  4DR7 Q;  3A74 A;  4EQO A;  2F0S A;  2VS1 A;  4YWK A;  4DV2 L;  1EIY B;  3UI2 A;  1EY7 A;  3EIV A;  1MSH A;  2F0D A;  3TS2 A;  2RCF A;  4Y7N H;  3TZU A;  1BNZ A;  2Q2I A;  3FHW A;  1W3S A;  2PQE A;  2XIW A;  1KAW A;  2AQ3 B;  4JYA Q;  3MTS A;  2NTT A;  1TQO A;  5ELB A;  4A3M G;  4FXK C;  4OIK A;  1B8A A;  3GTL H;  2ZXR A;  1A0I A;  1IHZ A;  3HOY H;  2VZA A;  2X69 A;  4BY1 B;  3BDC A;  2KA7 A;  2AQ1 B;  3WOE A;  4H13 C;  1VCI A;  1QNK A;  1FL0 A;  1AW7 A;  1ESF A;  1KD1 C;  3S15 B;  4KHP Q;  5JOB A;  2OQ0 A;  2QF7 A;  3UDG A;  3VR4 A;  5M3F G;  1FNW A;  5ELC A;  5EQ0 A;  3KBX A;  1R9T H;  4CJ0 B;  5COR A;  3K59 A;  5I9P A;  1CA6 A;  1L0W A;  2XRQ D;  4V19 0;  1WCM H;  3TDQ A;  2JA6 B;  1PH6 A;  1SFO B;  4BY7 B;  1MD2 D;  3HOU G;  4JOI A;  4OL7 A;  1JOR A;  4EQN A;  2D0O A;  1F2L A;  3MXN B;  4UAI A;  2VY3 A;  3EFX D;  1HFG A;  1FJG Q;  2SEB D;  5C3E H;  4XQN A;  1YJW A;  4DV2 Q;  2UUC L;  4K2L A;  2R93 H;  4J6H A;  3GDE A;  1TS5 A;  1SYB A;  3VR5 A;  2RF4 A;  3KOJ A;  1LUZ A;  1KL9 A;  2IL8 A;  1I4R A;  1O7L A;  3H0G G;  2B63 G;  2CQO A;  2K33 A;  4TRD A;  5FO9 B;  2DUD A;  3PCO B;  3A55 A;  3PUW A;  1HQR D;  4OWW B;  4LFA L;  2O4X A;  2VW9 A;  4A3J G;  2C35 B;  2E5L L;  1EUJ A;  3AEV A;  4DA2 A;  2R6G A;  5C4X H;  2X6G A;  1PRT D;  1TXY A;  2DJG C;  3TSS A;  3FRP B;  2K5Q A;  1TT2 A;  3BYT B;  2Z8L A;  2VNU D;  5CV7 A;  2F4V Q;  1IW7 C;  1OXU A;  2B2Y C;  1WVL A;  4UP8 A;  1L1O B;  3J81 i;  5EGT A;  2E74 C;  5FO7 B;  1B3A A;  1L1O C;  4BBR B;  4PG3 A;  1Y1W G;  5JVH 3;  1GXD C;  2DN8 A;  3R93 A;  4CKC A;  2LSS A;  3NPP A;  4IFD G;  2N88 A;  3D4R A;  2JA5 G;  3E3X A;  5FK9 C;  4O1N A;  2FJ2 A;  1NNX A;  2Y0S B;  5FO8 B;  1CKO A;  1RCV D;  3HKZ E;  1KQS A;  2Q8R E;  1CHP D;  1X3G A;  4A3G G;  2L4N A;  1HUN A;  3DLL A;  1IYU A;  2NZO A;  2RDF A;  3S16 B;  4DF7 A;  4F87 A;  1VS0 A;  4A93 G;  3TQY A;  1A2T A;  3DEO A;  4X64 L;  4EQ5 A;  3CCV A;  1C0A A;  2UUC Q;  1PZJ D;  4LFC L;  1CA5 A;  1E24 A;  4C3H G;  4ABN A;  1JB3 A;  4JPB W;  1DXM A;  5EKI A;  1BCP D;  3TZD A;  4APV A;  4DV1 L;  1YIJ A;  2R7Z H;  4A3I H;  1BF4 A;  2MNA A;  4YCW A;  3SXH A;  3Q23 A;  2ATW A;  1TWC B;  1QZG A;  4LFA Q;  3SK5 A;  1W6K A;  1SYG A;  3MC0 B;  2E5L Q;  1A8V A;  1LAB A;  3PO2 B;  2J7Z A;  4GKK L;  4JI6 L;  2F0N A;  1HTL D;  1JOQ A;  2F0F A;  1B3Q A;  3FKI G;  4RKB A;  1BCP B;  3NBH A;  4XDX A;  2Z6B A;  3KBG A;  4DR3 L;  1BCP C;  2N3S A;  4O42 A;  1XYI A;  1D1I A;  2RSN A;  4QL5 A;  3PUZ A;  4RA8 A;  1XTC D;  2Q8I B;  5I4D A;  1MI2 A;  1DYQ A;  4J1M A;  4EX5 A;  1VQD A;  3CC4 A;  1GHK A;  2E75 C;  5IP9 H;  4NMZ A;  1EYA A;  4X3K A;  5D3I B;  1BBW A;  3Q8D A;  1TS3 A;  4OEL B;  2E2D C;  4YWM A;  4NXN L;  1JCK B;  5JAV A;  4NXM L;  3G6J B;  1WOC A;  3HFZ B;  3X3N A;  3A56 A;  4KKS A;  3SR1 A;  2A68 D;  2PYK A;  4H0L C;  3J81 E;  1O78 A;  3STB D;  4AYB B;  3CD6 A;  2PQA A;  1C8C A;  3S1R H;  4QQB X;  3AQQ A;  4X64 Q;  1NR2 A;  1STG A;  2R7D A;  3BDL A;  3PGZ A;  2K03 A;  5C4H A;  3E0J A;  3K7U C;  1B1Z A;  4LFC Q;  1QOH A;  3FPP A;  3ZYY X;  5CR3 A;  2YU9 B;  5IYD H;  2G5D A;  1WFQ A;  1MIU A;  4Q0F A;  2LKV A;  1NAP A;  4DV1 Q;  4LF8 L;  3GTK H;  2GN5 A;  3ULL A;  5J22 A;  4OWX B;  4B3R L;  1N9W A;  2P5Z X;  4QUC A;  1F9P A;  5EKL A;  1BBX C;  1I4H A;  2EY6 A;  2IHE A;  1T9H A;  1CUK A;  1X55 A;  4G7Z C;  3MXU A;  3AU7 A;  4GKK Q;  5FOB B;  4JI6 Q;  1WTH A;  3OOC A;  2RQX A;  3S1N H;  3GO5 A;  3SK6 A;  1EY8 A;  5J39 A;  1LLR D;  2KED A;  2BE5 D;  2WKC A;  2D2C C;  5CV9 A;  4DR3 Q;  2E2J B;  4KV6 A;  3VA7 A;  2KHI A;  1TVX A;  3MHB A;  2RDG A;  3EQL C;  1N34 L;  3K7A H;  3UE1 A;  2YYZ A;  5CGK A;  2IT1 A;  3MVV A;  1DOL A;  3MA2 B;  1H9R A;  2Q8T A;  5DEH A;  2F0Q A;  3UDI A;  3HOW B;  3NSW A;  1EY4 A;  1I4P A;  5IGC A;  4IAL A;  2F4I A;  1Y1V B;  5LHY 1;  2BDN A;  4RHS A;  5JEA J;  3URY A;  4DUY L;  2JEA I;  4RGO S;  5M5W H;  4NXN Q;  1S5C D;  2NYZ D;  2R61 A;  3C3L A;  4NXM Q;  3I4N H;  2BE5 C;  2RDH A;  3BJU A;  1CI3 M;  2B2V C;  3GTQ H;  4QIW E;  1G29 1;  3I91 A;  2F3I A;  4BBS B;  3CAM A;  4WOR A;  2B2T C;  1XNR L;  4ZKC B;  4FF2 A;  1I5F A;  3HOV H;  1U9R A;  1TWH H;  2XWJ B;  3DWP A;  1M90 C;  1LM0 A;  5C44 B;  4B3T L;  3HKS A;  4ZQ3 A;  5DM6 3;  3G4S A;  3TS0 A;  1YNX A;  3KF8 A;  2EIF A;  5IOC A;  4OO1 I;  1TWG B;  3K6O A;  3TP5 A;  2XSC A;  1RDP D;  2ES2 A;  2K75 A;  1PXU A;  3K8A A;  1AE2 A;  4X66 L;  1B7Y B;  2GA4 B;  4K6D A;  4DR1 L;  3KLR A;  5A2Q E;  4LF8 Q;  1I50 H;  3KLW A;  3OW2 A;  4IOA A;  5J3B A;  4B3R Q;  1DM0 B;  2R92 B;  1VQ9 A;  1ILQ A;  1EYG A;  3E0E A;  2ALY B;  3MWY W;  2Z6K A;  3G7L A;  5BN5 A;  3T16 A;  3IRB A;  4DAY A;  2VUM G;  1ZKO A;  4O0A A;  4OO1 H;  3I72 A;  1S5F D;  5FLX L;  2O5J C;  3C1E A;  2A73 B;  1STN A;  2PMZ B;  4TKO B;  3E9I A;  2RVL A;  3TP7 A;  3ER0 A;  2OXP A;  3PIP A;  3H3V C;  4IPG A;  1HUM A;  2K1B A;  1WTP A;  2JA5 H;  4B9W A;  3I4M H;  1AFP A;  4CJ1 B;  1N34 Q;  4GLV B;  1GO3 E;  1ZXT A;  3S1Q B;  1SMX A;  3T13 A;  4GNX A;  1LTI D;  5BN3 A;  1HNZ L;  1TY2 A;  3HOX H;  5JJK A;  3I3C A;  2RA4 A;  4HTH A;  5D65 A;  4A3F H;  3IFD A;  1ESR A;  2KOL A;  5KEE A;  4DUY Q;  4TSS A;  1X3P A;  4C3J G;  5H1S E;  1D6E C;  1CQV A;  4U67 3;  2UXB L;  5ELD A;  3CW2 C;  3WOF A;  2PW5 A;  2JSO A;  1UWV A;  3A7L A;  4HN7 A;  4NP5 A;  2WFW A;  2F0G A;  4MNO A;  4GN3 B;  2H5X A;  3VDY A;  1IYJ B;  4G57 A;  5E4X A;  5GAG C;  1XNR Q;  3W5O A;  2YTX A;  1JWS D;  2JA7 H;  4B3T Q;  3FEW X;  3NEL A;  4DNR B;  1K73 C;  4KHZ A;  4HJ7 A;  4X66 Q;  4DK1 A;  4DR1 Q;  2M9V A;  3IKJ A;  3NQI A;  1XX8 A;  1EYC A;  1M8A A;  3SK4 A;  2A6E C;  2E2I H;  1KRT A;  2G9D A;  4UHV A;  3GV3 A;  2JN4 A;  2F0I A;  2RSO A;  3I4O A;  4R9W A;  2E2H B;  1F2M A;  3I70 A;  2CWA A;  4A3E G;  1EWC A;  4KKT A;  3HKZ G;  1HR0 W;  2HQL A;  3NTH A;  3F2C A;  3SEB A;  4DR6 L;  3RLF A;  2KVM A;  4A76 A;  2IY5 B;  4RGT A;  3R2I A;  2EYF A;  4OXP A;  3TP8 A;  2JA9 A;  2N55 A;  1WD1 A;  3D3R A;  4JBM A;  3A8K E;  2NUC A;  4L63 B;  4IOC A;  4LMQ D;  4NDX A;  5JEA H;  2NVT H;  2VUM B;  3U58 A;  1G6Z A;  3ND8 A;  1HNZ Q;  3V2T A;  4IUN A;  2BDO A;  3CC2 A;  3A54 A;  2EY1 A;  5KNB A;  1I6H B;  1B50 A;  1EOV A;  4QY7 A;  5FLM G;  2UXB Q;  3M7N A;  1R4P B;  4R1J A;  2PCF B;  4U68 A;  2EJF C;  4ID6 A;  1LV9 A;  3K5L A;  2DGY A;  3SK8 A;  2BH2 A;  3NWT A;  3AFQ A;  4Y7N B;  4KN4 C;  3PV0 A;  4UY8 C;  2A69 D;  1IBK L;  5IYB G;  1Q90 A;  1SNC A;  3BDO A;  5IP7 H;  1MJC A;  2HIV A;  4LF5 L;  4A3L H;  5E1F A;  4HSP A;  1RHP A;  3T1H L;  3EBE A;  3JAM L;  4C3I H;  1RIP A;  3M3Y H;  1I4X A;  4DV6 L;  4KTA A;  3L0O A;  4PZ8 A;  3HOY B;  2F0U A;  3CHB D;  2SOB A;  4L8J A;  1KLU D;  1Q81 C;  3L2P A;  1L0Y B;  4KJN A;  1BBU A;  4FO2 A;  4R4I A;  3R2T A;  1PDQ A;  4BY1 G;  5LL6 S;  4RGN A;  5GAH C;  2HQE A;  4JI2 L;  2UU9 L;  5M3M B;  4DR6 Q;  4ZUJ A;  3RNU A;  3G6E A;  1HFN A;  1NBW A;  1GUS A;  2L1B A;  3SE0 A;  1Z7T A;  1N32 L;  4K0K L;  2ZXP A;  1I94 L;  1CFM A;  2K7V A;  3I8Z A;  3NUC A;  2EYL A;  1R9T B;  4DAP A;  4POF A;  5CC4 A;  1WCM B;  5C4J H;  2CWP A;  3AYH B;  1C7Y A;  3CQZ H;  1KNA A;  4GLX A;  2ENB A;  2WAQ B;  2JA6 G;  3CP0 A;  5D3D A;  3D4W A;  3FVQ A;  1SYE A;  4BY7 G;  4A3D B;  1SR3 A;  4QJF A;  2IWH A;  1WTV A;  2QEJ C;  1D8L A;  3KDF A;  2HCI A;  2R7F A;  5C3E B;  1VQC A;  1J9O A;  2R93 B;  3KLS X;  1RTN A;  2AQ2 B;  2NN6 I;  4FXG C;  2MO1 A;  1IBK Q;  1Y69 U;  4HIK A;  3P1H A;  2A8V A;  4IUQ A;  4WJ3 M;  1GUT A;  5IOD A;  4LF5 Q;  1VQI A;  1VQ6 A;  3HEJ A;  3EA6 A;  1NJI C;  3T1H Q;  2QEX A;  4OEM B;  2HDM A;  4UP9 A;  5LMN L;  3BG3 A;  3E6Z X;  1HZA A;  1CM9 A;  1EFI D;  5IT9 L;  4DV6 Q;  5C4X B;  2XNA C;  1Z47 A;  3M4Q A;  3PSI A;  3ULP A;  2NN6 H;  1SXT A;  1W6J A;  1HZ9 A;  3CXC A;  1VQF A;  5HY6 A;  1QCB D;  3GQB A;  1SE8 A;  2WB1 B;  4JI2 Q;  3R3O A;  3HP3 A;  2Q2U A;  2UU9 Q;  1MKH A;  2FHT A;  2L0C A;  1LYL A;  3A8J E;  1FNV A;  3S1M H;  5I2X A;  4HJA A;  1N32 Q;  4BBR G;  1ENF A;  4X62 L;  2B2U C;  4K0K Q;  1UEB A;  1I94 Q;  1IBM L;  1Y8O B;  1DD2 A;  5HUR A;  5GAE C;  1G2S A;  2D0P A;  3EN2 A;  4IO9 A;  1PYW D;  2F4V L;  2Y0S G;  4N9T A;  3OW7 A;  3T53 B;  1HQM C;  1NMG A;  3NEM A;  3LX0 A;  4OX9 L;  1TS4 A;  1LTS D;  2NVX H;  4GLA C;  5C0X J;  3D0F A;  1YNJ D;  2Z4H A;  3M9B A;  2L12 A;  1ENC A;  2K4K A;  4K14 A;  2WAC A;  3V05 A;  1F2Z A;  1CZW A;  4AQY L;  2AUK A;  4P73 A;  3PUV A;  1SRU A;  5CBE E;  1XMQ L;  4DN4 M;  3QIA A;  1IZ6 A;  1GOZ A;  4PZ7 A;  5JJL A;  3CF5 A;  2JJQ A;  5HGQ A;  1VQG A;  3D31 A;  1LTA D;  2R7Z B;  4A3I B;  2MGS A;  4WRD A;  4HID A;  4FYD A;  1VQ5 A;  2KUM A;  3KYH C;  3MXG A;  5LMN Q;  2UXC Q;  2D9U A;  1YNJ C;  4LF7 L;  1OXV A;  4P71 A;  3F8T A;  4KD4 A;  4I7A A;  4N9P A;  2YTV A;  3BVM A;  4A3B H;  1V1P B;  2B8G A;  2EYM A;  1EOT A;  4DUZ L;  3PO2 G;  3J80 L;  1VQN A;  1PH1 A;  3OYY A;  3HGB A;  2JQO A;  3K57 A;  3MXN A;  1EQR A;  3PF4 A;  4X62 Q;  2UUB L;  4YWL A;  5C3X A;  3HOZ H;  1LT3 D;  2F3V A;  1IBM Q;  3O13 A;  1JE4 A;  3TRZ A;  1ML0 D;  1BVS A;  3RD4 A;  1S72 A;  4PV1 C;  1UAP A;  1VQ8 A;  1NTG A;  5IYC G;  4MTK A;  1B44 D;  3PIO A;  1PTO H;  2D5D A;  2J4X A;  3NTI A;  1HR0 L;  5ELF A;  4OX9 Q;  4A4I A;  1YI2 A;  1SN8 A;  1DOM A;  2NVQ H;  2CHB D;  3PO3 H;  1K3R A;  3DM3 A;  3S1R B;  4YHH L;  1PRT B;  2F1M A;  3L7Z C;  1G91 A;  1V1O A;  4AYB G;  1PRT C;  1QVF A;  2DNE A;  5M5X B;  3C2P A;  1ENA A;  3TME A;  4AQY Q;  3GD7 A;  3OHX C;  4DAV A;  4OHJ A;  1XMQ Q;  1PFB A;  4MHE A;  2O2L D;  4QCL A;  1Q1E A;  1BXT A;  2F0W A;  2M2L A;  4A3C G;  1LAC A;  1D5M C;  4IPH A;  3GTK B;  3C1F A;  4Z9C B;  3RLO A;  2WAQ E;  2LFN A;  3DWA A;  3OPO A;  2F0M A;  2IJ0 A;  4NPS A;  4A75 A;  1XTD A;  4LF7 Q;  3NQT A;  2I5L X;  4IN3 A;  1PH3 A;  1TII D;  3K5O A;  1C48 A;  5COY A;  5FJ8 H;  4BY1 H;  3K5M A;  1CKM A;  3S1N B;  3K0X A;  3QOJ A;  4DUZ Q;  2EZV A;  3KFU A;  4A3K H;  3L9A X;  5C0X I;  1PFM A;  4P74 A;  3S17 H;  1UEA B;  3ONA B;  1E7Z A;  3BZC A;  4JI4 L;  1J8I A;  3CCR A;  4JBK A;  3Q22 A;  5JJI A;  3K7A B;  3MZ5 A;  2C9O A;  3HS0 C;  2MP1 A;  4C1N K;  1KC8 C;  3A7A B;  1SYD A;  4BXX H;  2UUB Q;  4DAM A;  1VQK A;  5GQO A;  3RLN A;  5G3L F;  2JA8 H;  4K5W A;  3P75 A;  2A19 A;  2KEC A;  4B3M L;  3S2D H;  3TBI B;  3VYS A;  4HSV A;  3HOW G;  5M5W B;  4HCS A;  5K36 G;  4IJH A;  3SHL A;  5C0X H;  1EY0 A;  1BCP F;  1Y1V G;  1HR0 Q;  1JMC A;  3I4N B;  2WB1 E;  3GTQ B;  4HJ8 A;  1PHJ A;  3K5N A;  3K58 A;  2KEN A;  1K8O A;  1E2W A;  1DOK A;  1PH7 A;  4DPG A;  4YHH Q;  2XVS A;  3RUZ A;  4NKL A;  4NW2 A;  3HOV B;  1TWH B;  2K5V A;  3WDN A;  4BBS G;  4IFD J;  1RF2 D;  2FFK B;  4DXG A;  2ZTD A;  4F88 A;  1IKM A;  1CZG A;  3UDX A;  2CH4 A;  4PQX A;  4X3U A;  5C44 G;  4Y52 H;  5CV5 A;  1KXL A;  2D62 A;  1PZK D;  3QOL A;  2VXW A;  1I50 B;  1KRS A;  5KNC A;  4K5V A;  4QUF A;  4POG A;  4YY3 L;  1IL2 A;  3CC7 A;  5M5Y H;  3LGJ A;  4X3S A;  2KJX A;  1FNU A;  2R92 G;  1ROD A;  2F0H A;  3BVG A;  4OWT B;  3NEN A;  1QB5 D;  2R3Z A;  3GTJ H;  1WTW A;  1A3U A;  4A3M H;  4HJ9 A;  3K0Y A;  2HT1 A;  2LXJ A;  4JI4 Q;  3I4M B;  1JJ2 A;  2EJG C;  2A68 C;  4LUV A;  2EYO A;  3STB C;  1OXX K;  2EY2 A;  1KLG D;  1VQ4 A;  1VMC A;  3HOX B;  2EYH A;  1U4P A;  1Q3L A;  5DAU A;  4BS9 A;  4B3M Q;  1STH A;  2NVY H;  3ND9 A;  4A3F B;  1DZ1 A;  1GUW A;  1TS2 A;  1I3Q H;  3CMA A;  1JB7 A;  1H9J A;  1X56 A;  4CKE A;  5M3F H;  4DV3 L;  2AWO A;  1ZYR D;  1IKL A;  4R8I A;  3ERQ A;  2K01 A;  1P8L A;  1A15 A;  4ZLT F;  4J15 A;  3TP6 A;  1Y14 B;  2JA7 B;  2XTI A;  5ELN A;  2WKD A;  4ZK9 B;  4JI3 L;  4F7X A;  1O7I A;  3HOU H;  2SDF A;  1B9M A;  3PF5 A;  3ULJ A;  4CJ2 C;  3KF6 A;  2B2W C;  4GOP B;  1ZYR C;  2E2I B;  3DWQ A;  4V0B A;  1TWA H;  3IL8 A;  1PVO A;  4ME3 A;  1EIF A;  4GOP C;  1II3 A;  5BN4 A;  3EVQ A;  1DCZ A;  3H15 A;  1AP0 A;  4YY3 Q;  4UPA A;  1AZQ A;  4CDC C;  3VR3 A;  4HR7 B;  1RTO A;  4PMB A;  2Y0S E;  4S3S A;  3H0G H;  2B2V A;  4DNI A;  2ZJR A;  2B63 H;  4UP7 A;  3KF8 B;  3NWS A;  2ASB A;  4HMI A;  4JCV E;  2PI2 E;  1V43 A;  2H4O A;  4A3J H;  4DV5 L;  1D1K A;  1CKN B;  4IFD I;  1K83 H;  3H91 A;  5IWA L;  1G8Z D;  2NVT B;  1N8R C;  3KJP A;  2A1A A;  2LXK A;  2YTY A;  5FLX c;  3VYU A;  3Q24 A;  5C5L A;  4HIM A;  1Q7Y C;  1PYS B;  4FF1 A;  2M00 A;  1JWU D;  2CVR A;  3MFY A;  1CHQ D;  3Q6S A;  1Y1W H;  2LS0 1;  1NSN S;  3MXP A;  2B29 A;  5A35 A;  1A3T A;  4EVO A;  4DV3 Q;  4IFD H;  3OWF A;  1WYD A;  2PO4 A;  2GVB A;  1E1O A;  1AEX A;  2A6H D;  3I55 A;  4FP5 D;  2MHV A;  3FMC A;  4EGV A;  4LJZ C;  5I2Y A;  1TWF H;  3DM1 A;  2KHS A;  1KDB A;  4HAE A;  3BYY B;  3F2D A;  2V4D A;  1GVP A;  4IZ8 A;  1S40 A;  1WI5 A;  1ICF B;  1DON A;  5IIF A;  4A3G H;  4JI3 Q;  3HG9 A;  2EYJ A;  2F0J A;  4N8X 1;  4C3I B;  3M3Y B;  1QVG A;  1JQY D;  4KHV A;  3GTG H;  1HNX L;  4A93 H;  2RBM A;  4OGQ C;  1JT8 A;  3RZD H;  2WII B;  3P7J A;  1OTC A;  1K28 A;  4KLK A;  3HOY G;  1XPO A;  2I07 B;  3A8I E;  4C3H H;  5JVG 3;  1HTP A;  2IW3 A;  3BS1 A;  2KCC A;  1UE7 A;  1A2U A;  4KK7 A;  4JVZ A;  3W1B A;  3CKI B;  3MAQ A;  1B53 A;  5M3M G;  1EWI A;  4AIM A;  3SGI A;  2NWG A;  4DV5 Q;  3OIP A;  3M85 A;  3KK7 A;  1STE A;  5CV4 A;  3RZO B;  3V96 A;  5IWA Q;  1PH8 A;  4PZ6 A;  4AYB E;  5C4J B;  1NCV A;  1VQ7 A;  1D5Z C;  1CSQ A;  3CQZ B;  1WTR A;  3FKI H;  1DGS A;  5E7N A;  4PMC A;  4RG1 A;  1WCM G;  4CBV A;  4L6T B;  3J7Z C;  1Y8N B;  2BOS A;  3RN5 A;  3N6R A;  1RD9 D;  1VQA A;  3S24 A;  2F3W A;  2WAQ G;  3T4A C;  3R8B A;  4A3D G;  1QUQ A;  4FDB A;  2TSS A;  3VA5 A;  2HDL A;  5C3E G;  2OTJ A;  1LTR D;  1Z6H A;  4KMU C;  1VF5 C;  2R93 G;  2CKZ B;  4R4O A;  1W2B A;  1EY9 A;  1JR0 D;  3RMH A;  4G7H C;  3E5S A;  4H7B A;  2JE6 I;  4DKA C;  1F77 A;  1PFN A;  4DV4 L;  3MFG A;  4IUU A;  1HNX Q;  4LK1 C;  5EJW A;  2F03 A;  1EQV A;  4MTN A;  3J80 E;  5GAD C;  1SNM A;  1LTT D;  2EE1 A;  5C4X G;  1C4Q A;  1AN8 A;  2I0Q A;  4CKB A;  5KYL A;  1NUC A;  1SE3 A;  3PUX A;  3QB3 A;  4X6A H;  2B8F A;  5D14 A;  4IPC A;  1OXS C;  3JAM c;  3D4D A;  1PH4 A;  1X9N A;  1PA6 A;  3NHH A;  2NZH A;  3BVZ A;  1GHJ A;  1EZ6 A;  2EDG A;  2WB1 G;  3S1M B;  1EU4 A;  4LF6 L;  3GTL B;  2UXD L;  1HNW L;  3HRZ C;  3DHQ A;  5KIX A;  1E2V A;  1OXT A;  1STA A;  4YIJ A;  1QIL A;  4IUR A;  1KTK A;  2VB3 X;  2A69 C;  2L5T A;  3F2B A;  2OCE A;  3F1Z A;  2ID0 A;  4R4T A;  1H9S B;  5CBA E;  4C2M H;  5AJ3 L;  2NVX B;  3M4O H;  4ZYS A;  1LT4 D;  1Q8K A;  3U9S A;  4LFB L;  5EBD A;  3CPF A;  4MN3 A;  3RR5 A;  4MZ9 A;  2XN9 C;  4B3S L;  1SSO A;  5C4Z A;  1EY5 A;  2KCN A;  2JYO A;  1Q82 C;  4ZAI A;  4FXD A;  1VQH A;  3X3M A;  1VF7 A;  1X3E A;  5EAY A;  4I7Z C;  1HHV A;  4RCN A;  1VQO A;  1EY6 A;  4CDE C;  2PMZ E;  4Q5V A;  2ZJQ A;  2R7Z G;  1UNS A;  1M1K C;  4DV4 Q;  4A3I G;  4M1U B;  3H94 A;  3KDF B;  5NUC A;  4A3B B;  3CPW A;  2F52 A;  1L2F A;  1RL2 A;  3GTM H;  4DR2 L;  1XJV A;  3OWE B;  5EKK A;  1G2T A;  1O7Y A;  1FVI A;  1PTO D;  4GN5 A;  2V1C C;  5EPJ A;  4XYQ A;  3DMU A;  3U50 C;  2EJM A;  5IT9 c;  2EVB A;  3B6Y A;  4LF4 L;  3CU7 A;  1WD0 A;  5KYI A;  2H1E A;  3NXW A;  2UXC L;  1NR4 A;  3HOZ B;  3U4Z A;  4LF6 Q;  5C6A A;  4GZY C;  2UXD Q;  2F0E A;  2TMP A;  1HNW Q;  1Z9F A;  5E4W C;  3I56 A;  1F9R A;  1T5E A;  2KQ3 A;  1PZI D;  1X32 A;  3NTK A;  4ZRZ A;  3W2D A;  5IGG A;  1K8M A;  1K8A C;  1EZ8 A;  5IP9 G;  2VUM H;  4YCU A;  5T1I A;  1PTO B;  2JP1 A;  2F0P A;  4GS3 A;  4HMJ A;  4JI0 L;  4OON A;  1CT1 D;  1PTO C;  5AJ3 Q;  2OF1 A;  2NVQ B;  1EU3 A;  1KDC A;  1SYC A;  3PO3 B;  3BZD B;  1EIH A;  4LFB Q;  4JK1 C;  2N78 A;  5C5M A;  1FR3 A;  3K81 C;  2QDB A;  4B3S Q;  1D2B A;  5J1Z A;  5ELE A;  1NMF A;  2ZT9 C;  4QF4 A;  1O80 A;  3S14 H;  1WTQ A;  3MEF A;  5K5P A;  4C3J H;  2B2U A;  2AWN A;  5IYD G;  3GTO H;  1VQJ A;  3SVM A;  2F0L A;  5JPM C;  1U4R A;  1N36 L;  1SJE D;  1LTL A;  2KHJ A;  2L9H A;  1JC7 A;  4PMW A;  1KNE A;  1HZC A;  4KKU A;  2G9H D;  2VB2 X;  4XQJ A;  3PUY A;  5KRU A;  4A3K B;  3RN2 A;  2QGQ A;  4DR2 Q;  2HUG A;  1J5E L;  3NK9 A;  3QR8 A;  3CCL A;  3S17 B;  4LWC A;  2K5N A;  3GTP H;  1S5D D;  5M3M H;  1TKW B;  1BOS A;  4ZCK A;  4ZKB B;  3J7A V;  2AMC B;  5TSS A;  1EL0 A;  2FIN B;  4LF4 Q;  1VQE A;  1CQF A;  5IY0 A;  1GUO A;  5M9O A;  1LO5 D;  2DY7 A;  4JOI C;  2JA8 B;  1QZH A;  3ERO A;  3J80 c;  1T5X D;  2RCN A;  3S2D B;  3D8G A;  4JBJ A;  1CTM A;  4A3E H;  1E3P A;  3FPU B;  4JI0 Q;  1J6Q A;  3I4L A;  1P16 A;  1STB A;  3KUP A;  1K0R A;  2L11 A;  1IXR A;  4LAA A;  4EQP A;  4L5S A;  3I4N G;  5T1G A;  4A3D H;  4MIU A;  4XT3 B;  5KND A;  4BA2 I;  2QKI C;  5EPK A;  1U4L A;  3AFP A;  3S2H H;  1BKB A;  1RKN A;  1V1P A;  4C1N I;  1SBB B;  3M4P A;  1TR5 A;  4LF9 L;  5KGU A;  1ET9 A;  1YNN D;  1A3V A;  1IW7 D;  1YZ6 A;  3HOV G;  2PZW A;  4CHT B;  3KJO A;  4P75 A;  3L3O C;  2Q2T A;  2OTL A;  4RFB A;  5FLM H;  3DUZ A;  5AFW A;  4JI7 L;  1QVC A;  5DLQ E;  3LWU A;  5BR8 L;  4M8A A;  1CSP A;  3BU2 A;  2K28 A;  4DR4 L;  5I6Y A;  1LT5 D;  4DK0 A;  1S4Z A;  4ALP A;  1N36 Q;  5CYU A;  5M5Y B;  1ICW A;  2MPM A;  1SLJ A;  4X3T A;  1PRT F;  2KCT A;  4L5Q A;  3LWE A;  2B2Y A;  5IGD A;  4IJL A;  5IYB H;  3FP9 A;  4TQU S;  1YNN C;  1IYV A;  4CDF C;  3GTJ B;  1L1O A;  1U0L A;  2K5D A;  2Q2H A;  3M7G A;  1B70 B;  4J8Q A;  2HD3 A;  3D6W A;  4RWS C;  2K5H A;  5CV8 A;  1J5E Q;  2ZM6 L;  4A3M B;  4OO1 G;  1JWM D;  1MSG A;  1HXY D;  4QIW B;  4KD3 A;  4DK6 C;  1F2Y A;  1KAB A;  1GM5 A;  1LTG D;  1E1T A;  3TEH B;  3I4M G;  2LY7 A;  3P20 A;  4DGZ A;  5FLX E;  1BR9 A;  1VQP A;  3W3A A;  2NVY B;  2X6L A;  5CMD A;  1STY A;  4QMG A;  1I4G A;  3HOX G;  2PI2 A;  1KHI A;  1TY0 A;  2JK8 A;  4DV0 L;  3CCQ A;  1I3Q B;  4DV7 L;  4A3F G;  2MFI A;  3OMG A;  5M3F B;  3J7A 5;  3S15 H;  2XWB B;  1BO0 A;  4RMF A;  4JBW A;  5E3F A;  3JAM i;  2UUA L;  5G3L D;  4G7O C;  1ONL A;  3CRK C;  1V9P A;  2IHF A;  4HIO A;  4LF9 Q;  4HED A;  3I73 A;  4AH6 A;  3MEH A;  1FD7 D;  3PIP 3;  3HOU B;  2JA7 G;  1KDA A;  1UE1 A;  4JG2 A;  2I5M X;  4CGY B;  2JA6 H;  3IAY A;  1SYF A;  2GVA A;  2BH8 A;  1SAP A;  1SFO H;  4BY7 H;  4JI7 Q;  3NBH B;  4DK3 C;  5BR8 Q;  1U4M A;  1PH2 A;  1TWA B;  2CFM A;  3VYT A;  4DR4 Q;  2SNS A;  4XTC S;  2FXQ A;  2PPB C;  1BQQ T;  1HRJ A;  2L55 A;  3J81 j;  4ULL A;  4RGM A;  1FGU A;  3UE0 A;  1WTX A;  3H0G B;  2B63 B;  4FVM A;  2QDL A;  2K50 A;  1WJJ A;  3OMC A;  2AUJ D;  2ZM6 Q;  1HCZ A;  5EBC A;  5I9O A;  4RKL A;  3OSO A;  4A3J B;  4FF3 A;  3U9O A;  2CCZ A;  1SNP A;  5CV6 A;  2WP8 J;  1JJG A;  1K83 B;  2DY8 A;  3I2Z A;  5IE8 A;  4JV5 L;  1X65 A;  3NE5 B;  1SNQ A;  1EEF D;  1HJP A;  2IPK D;  2HHH L;  1QJO A;  1K0S A;  3LNN A;  2PQA B;  4HCE A;  5JEA G;  4ODG A;  1HPC A;  1MHW C;  3VR2 A;  1I4Q A;  2QW7 A;  4OIJ A;  3S9W A;  1Y1W B;  4DV0 Q;  1VMP A;  4R4C A;  4TVA B;  4DV7 Q;  1EWH A;  1MGS A;  2N8N A;  2PNR C;  2K5W A;  4BBR H;  2JA5 B;  3U4V A;  5ISR A;  1EQT A;  1B9N A;  2HIX A;  2IX3 A;  3J7Y W;  2BCO A;  2EXD A;  1QE6 A;  1YIT A;  1H95 A;  1TWF B;  2UUA Q;  5C3W A;  3C46 A;  2Z9H A;  1Q1B A;  4PNY A;  1NY4 A;  1PFS A;  5M5X H;  4A3G B;  1FYC A;  2B3G A;  5IP7 G;  1JJC B;  2NZ1 D;  4A3L G;  1OO9 B;  3GTG B;  4A93 B;  5ELO A;  2QCP X;  4G4K A;  3DXJ C;  4C3I G;  3RZD B;  3A0J A;  2VQE L;  2OQK A;  2I46 A;  3S16 H;  1R4Q B;  2C5C A;  1GD7 A;  1JOK A;  4ZUI A;  4C3H B;  4B9X A;  1L0X B;  1SND A;  1Q86 C;  1EYD A;  2MJ8 A;  5LMU L;  2KEE A;  3JAM E;  4DR5 L;  4KY5 A;  4KY7 A;  4JI1 L;  3J7A F;  1PMR A;  2MQH A;  5L37 A;  1K8G A;  1F9Q A;  3CRL C;  1SRO A;  2Z1C A;  4GKJ L;  1RJT A;  3EJI A;  2EY5 A;  2WV6 D;  1TWC H;  3KF6 B;  3QWN A;  4JV5 Q;  3QO2 A;  2N49 A;  4K5X A;  2JEB I;  2HHH Q;  3PO2 H;  3FKI B;  5IGE A;  1C9O A;  1G51 A;  2B2W A;  2PZU A;  2RHS B;  1PH9 A;  4XIG S;  3WWV A;  3ITP A;  4GOP A;  5LMN W;  4XQQ A;  2B2T A;  1YHQ A;  3GP7 A;  4XYO A;  1FGB D;  4FF4 A; 
#chains in the Genus database with same CATH homology
 4DXF A;  3IFT A;  1D5X C;  4WFN 3;  5IGB A;  1SMY D;  5FKA C;  5DM7 3;  2K32 A;  1ET6 A;  1XXG A;  3NP8 A;  2PZT A;  2ICE C;  1Q8I A;  2RKS A;  2NN6 G;  4KI0 A;  1B2T A;  1SMY C;  4RCO A;  5IT9 E;  3PMF A;  5DNF A;  1QG7 A;  4BA1 I;  4F8M A;  1SE4 A;  5IGF A;  2A6H C;  1DJR D;  2FMC A;  1E2Z A;  2HCC A;  4K8I A;  4C2M B;  1LT6 D;  3M4O B;  2K04 A;  2B39 A;  1QWY A;  2WIN B;  2A6E D;  3FDT A;  3AB9 A;  3VR6 A;  3T51 B;  1JIC A;  2F0T A;  4DFA A;  2ZXO A;  4E6I A;  1GJX A;  5K36 H;  4QB4 A;  3GV6 A;  5F2D A;  3DEP A;  1O7Z A;  2E76 C;  1UUP A;  1HA6 A;  2LMC B;  3GTM B;  2J0T D;  1B4O A;  1S5B D;  3J81 L;  1SE2 A;  1QNU A;  1H9K A;  2OT2 A;  2IX1 A;  4UDU C;  1Y8P B;  3N52 A;  4B08 A;  2EPB A;  1LTB D;  2CQA A;  1CK1 A;  1JOO A;  1A6X A;  4IUT A;  4RAU C;  3Q0A A;  1HA5 A;  1KAA A;  1EIG A;  1SNO A;  3T56 B;  1BUV T;  1SJH D;  4KN7 C;  1SDF A;  2BA0 A;  3H09 A;  4FNF A;  2PW7 A;  1ZEQ X;  4C56 C;  2ICI A;  4ILW A;  4XXE A;  3OIQ A;  2F0O A;  2XRS D;  5JJZ A;  2F0K A;  2Z4I A;  1F9S A;  4IQZ A;  1ILP A;  2OEO A;  3S14 B;  3TN2 A;  1MBY A;  4C3J B;  3GTO B;  2SNM A;  4K2K A;  5HGT A;  4KY6 A;  3NBI A;  1IL8 A;  1GUG A;  1I6V C;  4P2C B;  2A74 C;  2A5H A;  3HZX A;  1V8Q A;  3PIO 3;  2QIL A;  3D6C A;  3H6M A;  1GUN A;  4ME5 A;  2JXM B;  4RH6 A;  1H9S A;  3QJY A;  4K8J A;  1SEB D;  2K6A A;  3QG1 A;  1TU2 B;  3GTP B;  2NBF A;  1X3Q A;  2F0V A;  2MUY A;  5EPL A;  2NB0 A;  3F2U A;  2K05 A;  2CW0 D;  4K6L A;  2DNC A;  2NTS A;  1H9M A;  4DU9 A;  2EYP A;  4DNT B;  1PLF A;  4R8N A;  3KLS A;  5JPN C;  4A3E B;  5A2Q L;  3HKZ B;  1E0B A;  1Q12 A;  3VYR A;  2IX0 A;  4IUV A;  4WJW A;  5LL6 X;  3I90 A;  2FMM A;  4I65 A;  1S5E D;  5C0X G;  3AMU A;  2CW0 C;  2BA1 A;  3S2H B;  4KJO A;  4RHR A;  1EEI D;  2EOT A;  4XT1 B;  3SDZ A;  1VDZ A;  2EXZ A;  1AZP A;  4BWG B;  3M4Y A;  1BDO A;  1PTO F;  5I6W A;  4H44 C;  1M4V A;  1XWE A;  4IUP A;  2O5I C;  1WTO A;  4EQO A;  2F0S A;  3UI2 A;  1EY7 A;  1MSH A;  2F0D A;  3TZU A;  1BNZ A;  2PQE A;  2XIW A;  2AQ3 B;  3MTS A;  2NTT A;  1TQO A;  5ELB A;  4FXK C;  4OIK A;  2ZXR A;  1IHZ A;  2X69 A;  4BY1 B;  3BDC A;  2KA7 A;  2AQ1 B;  3WOE A;  4H13 C;  1VCI A;  1QNK A;  1AW7 A;  1ESF A;  3S15 B;  5JOB A;  2QF7 A;  3VR4 A;  1FNW A;  5ELC A;  5EQ0 A;  3KBX A;  4CJ0 B;  5COR A;  3K59 A;  5I9P A;  1CA6 A;  2XRQ D;  4V19 0;  3TDQ A;  2JA6 B;  1SFO B;  4BY7 B;  1MD2 D;  4OL7 A;  1JOR A;  4EQN A;  1F2L A;  4UAI A;  3EFX D;  1HFG A;  2SEB D;  4XQN A;  4K2L A;  4J6H A;  1TS5 A;  1SYB A;  3VR5 A;  2IL8 A;  1I4R A;  1O7L A;  2K33 A;  4TRD A;  5FO9 B;  3A55 A;  3PUW A;  1HQR D;  2O4X A;  4DA2 A;  2R6G A;  2X6G A;  1PRT D;  3TSS A;  3FRP B;  2K5Q A;  1TT2 A;  3BYT B;  2Z8L A;  2VNU D;  5CV7 A;  1IW7 C;  1OXU A;  2B2Y C;  1WVL A;  5EGT A;  2E74 C;  5FO7 B;  1B3A A;  4BBR B;  5JVH 3;  1GXD C;  2DN8 A;  3R93 A;  4CKC A;  3NPP A;  4IFD G;  2N88 A;  3D4R A;  5FK9 C;  4O1N A;  2FJ2 A;  2Y0S B;  5FO8 B;  1RCV D;  2Q8R E;  1CHP D;  2L4N A;  1HUN A;  1IYU A;  2RDF A;  3S16 B;  4DF7 A;  4F87 A;  1A2T A;  3DEO A;  1PZJ D;  1CA5 A;  4C3H G;  4ABN A;  1JB3 A;  1DXM A;  5EKI A;  1BCP D;  3TZD A;  1BF4 A;  3SXH A;  3Q23 A;  1TWC B;  3SK5 A;  1W6K A;  1SYG A;  3MC0 B;  1LAB A;  3PO2 B;  2J7Z A;  2F0N A;  1HTL D;  1JOQ A;  2F0F A;  4RKB A;  1BCP B;  3NBH A;  4XDX A;  3KBG A;  1BCP C;  4O42 A;  1XYI A;  1D1I A;  2RSN A;  3PUZ A;  4RA8 A;  1XTC D;  2Q8I B;  5I4D A;  1MI2 A;  1DYQ A;  4J1M A;  1GHK A;  2E75 C;  4NMZ A;  1EYA A;  4X3K A;  5D3I B;  1TS3 A;  2E2D C;  1JCK B;  5JAV A;  3G6J B;  3X3N A;  3A56 A;  4KKS A;  3SR1 A;  2A68 D;  2PYK A;  4H0L C;  3J81 E;  1O78 A;  4AYB B;  1C8C A;  1NR2 A;  1STG A;  3BDL A;  2K03 A;  5C4H A;  3E0J A;  1B1Z A;  1QOH A;  3FPP A;  3ZYY X;  5CR3 A;  2YU9 B;  4Q0F A;  2LKV A;  1NAP A;  5J22 A;  4QUC A;  1F9P A;  5EKL A;  1BBX C;  1I4H A;  2EY6 A;  4G7Z C;  3MXU A;  3AU7 A;  5FOB B;  2RQX A;  3OOC A;  3GO5 A;  3SK6 A;  1EY8 A;  5J39 A;  1LLR D;  2KED A;  2BE5 D;  2WKC A;  2D2C C;  5CV9 A;  2E2J B;  4KV6 A;  3VA7 A;  1TVX A;  3MHB A;  2RDG A;  3EQL C;  5CGK A;  2YYZ A;  2IT1 A;  3MVV A;  1DOL A;  3MA2 B;  1H9R A;  2Q8T A;  5DEH A;  2F0Q A;  3HOW B;  3NSW A;  1EY4 A;  1I4P A;  5IGC A;  4IAL A;  2F4I A;  1Y1V B;  5LHY 1;  2BDN A;  4RHS A;  5JEA J;  3URY A;  2JEA I;  4RGO S;  1S5C D;  2NYZ D;  2R61 A;  3C3L A;  2BE5 C;  2RDH A;  1CI3 M;  2B2V C;  1G29 1;  3I91 A;  4BBS B;  4WOR A;  2B2T C;  4ZKC B;  4FF2 A;  1U9R A;  2XWJ B;  3DWP A;  5C44 B;  5DM6 3;  4ZQ3 A;  3KF8 A;  5IOC A;  4OO1 I;  1TWG B;  3K6O A;  3TP5 A;  2XSC A;  1RDP D;  1PXU A;  4K6D A;  2GA4 B;  3KLR A;  5A2Q E;  1DM0 B;  2R92 B;  1ILQ A;  3MWY W;  3G7L A;  5BN5 A;  3T16 A;  4DAY A;  1ZKO A;  4OO1 H;  3I72 A;  1S5F D;  5FLX L;  2O5J C;  3C1E A;  2A73 B;  1STN A;  2PMZ B;  4TKO B;  2RVL A;  3TP7 A;  2OXP A;  3H3V C;  1WTP A;  1HUM A;  2K1B A;  4B9W A;  1AFP A;  4CJ1 B;  1ZXT A;  3S1Q B;  3T13 A;  1LTI D;  5BN3 A;  1TY2 A;  3I3C A;  2RA4 A;  4HTH A;  5D65 A;  3IFD A;  5KEE A;  1ESR A;  2KOL A;  4TSS A;  1X3P A;  4C3J G;  1D6E C;  1CQV A;  4U67 3;  5ELD A;  3WOF A;  2PW5 A;  2JSO A;  3A7L A;  4HN7 A;  4NP5 A;  2F0G A;  4G57 A;  5E4X A;  1JWS D;  3FEW X;  4DNR B;  4KHZ A;  4DK1 A;  2M9V A;  3IKJ A;  3NQI A;  1XX8 A;  1EYC A;  1M8A A;  3SK4 A;  2A6E C;  2G9D A;  3GV3 A;  2F0I A;  2RSO A;  4R9W A;  2E2H B;  1F2M A;  3I70 A;  1EWC A;  4KKT A;  3NTH A;  3SEB A;  3RLF A;  2KVM A;  4RGT A;  3R2I A;  2EYF A;  3TP8 A;  2N55 A;  1WD1 A;  3D3R A;  3A8K E;  2NUC A;  4L63 B;  4LMQ D;  4NDX A;  5JEA H;  2VUM B;  1G6Z A;  3ND8 A;  3V2T A;  4IUN A;  2BDO A;  3A54 A;  2EY1 A;  5KNB A;  1I6H B;  1B50 A;  3M7N A;  1R4P B;  2PCF B;  4U68 A;  2EJF C;  4ID6 A;  1LV9 A;  3K5L A;  3SK8 A;  3NWT A;  4Y7N B;  4KN4 C;  3PV0 A;  2A69 D;  1Q90 A;  1SNC A;  3BDO A;  5E1F A;  4HSP A;  1RHP A;  3JAM L;  1I4X A;  4KTA A;  3HOY B;  2F0U A;  3CHB D;  2SOB A;  4L8J A;  1KLU D;  1L0Y B;  4KJN A;  4FO2 A;  3R2T A;  1PDQ A;  5LL6 S;  4RGN A;  2HQE A;  5M3M B;  4ZUJ A;  1HFN A;  1GUS A;  2L1B A;  3SE0 A;  1Z7T A;  2ZXP A;  1CFM A;  2K7V A;  3I8Z A;  3NUC A;  2EYL A;  1R9T B;  4DAP A;  5CC4 A;  1WCM B;  1KNA A;  2ENB A;  2WAQ B;  5D3D A;  3D4W A;  3FVQ A;  1SYE A;  4A3D B;  2IWH A;  1WTV A;  2QEJ C;  2HCI A;  5C3E B;  1J9O A;  2R93 B;  3KLS X;  1RTN A;  2AQ2 B;  2NN6 I;  4FXG C;  1Y69 U;  3P1H A;  4IUQ A;  1GUT A;  5IOD A;  3HEJ A;  3EA6 A;  2HDM A;  3BG3 A;  3E6Z X;  1CM9 A;  1EFI D;  5IT9 L;  5C4X B;  2XNA C;  1Z47 A;  2NN6 H;  1SXT A;  1W6J A;  1QCB D;  3GQB A;  2WB1 B;  3R3O A;  3HP3 A;  2FHT A;  2L0C A;  3A8J E;  1FNV A;  5I2X A;  1ENF A;  2B2U C;  1Y8O B;  1DD2 A;  5HUR A;  1G2S A;  1PYW D;  4N9T A;  3OW7 A;  3T53 B;  1HQM C;  3LX0 A;  1TS4 A;  1LTS D;  5C0X J;  1YNJ D;  2Z4H A;  2L12 A;  1ENC A;  4K14 A;  2WAC A;  3V05 A;  1F2Z A;  1CZW A;  2AUK A;  3PUV A;  5CBE E;  4DN4 M;  3QIA A;  1GOZ A;  3D31 A;  1LTA D;  2R7Z B;  4A3I B;  2MGS A;  4WRD A;  4FYD A;  2KUM A;  3MXG A;  2D9U A;  1YNJ C;  1OXV A;  4KD4 A;  4N9P A;  3BVM A;  1V1P B;  2B8G A;  2EYM A;  1EOT A;  3J80 L;  3HGB A;  3K57 A;  3MXN A;  5C3X A;  1LT3 D;  2F3V A;  3O13 A;  1JE4 A;  1ML0 D;  3RD4 A;  4PV1 C;  1UAP A;  1B44 D;  1PTO H;  2D5D A;  2J4X A;  3NTI A;  5ELF A;  1DOM A;  2CHB D;  3S1R B;  1PRT B;  2F1M A;  3L7Z C;  1G91 A;  1V1O A;  1PRT C;  2DNE A;  5M5X B;  3C2P A;  1ENA A;  3TME A;  3GD7 A;  3OHX C;  4DAV A;  4OHJ A;  1PFB A;  4MHE A;  2O2L D;  4QCL A;  1Q1E A;  1BXT A;  2F0W A;  2M2L A;  1LAC A;  1D5M C;  3GTK B;  3C1F A;  4Z9C B;  3DWA A;  2LFN A;  3OPO A;  2F0M A;  2IJ0 A;  3NQT A;  4IN3 A;  1TII D;  3K5O A;  1C48 A;  5COY A;  3K5M A;  3S1N B;  3QOJ A;  2EZV A;  3L9A X;  5C0X I;  1PFM A;  1UEA B;  3ONA B;  1J8I A;  3Q22 A;  3K7A B;  3MZ5 A;  2C9O A;  3HS0 C;  2MP1 A;  4C1N K;  3A7A B;  1SYD A;  5G3L F;  4K5W A;  3P75 A;  2KEC A;  3TBI B;  3VYS A;  4HSV A;  5M5W B;  4HCS A;  5K36 G;  3SHL A;  5C0X H;  1EY0 A;  1BCP F;  3I4N B;  3GTQ B;  3K5N A;  3K58 A;  1K8O A;  1E2W A;  1DOK A;  2XVS A;  3RUZ A;  4NKL A;  4NW2 A;  3HOV B;  1TWH B;  3WDN A;  4IFD J;  1RF2 D;  2FFK B;  4DXG A;  4F88 A;  1IKM A;  1CZG A;  4PQX A;  4X3U A;  5CV5 A;  2D62 A;  1PZK D;  3QOL A;  2VXW A;  1I50 B;  5KNC A;  4K5V A;  4QUF A;  4X3S A;  2KJX A;  1FNU A;  1ROD A;  2F0H A;  3BVG A;  1QB5 D;  2R3Z A;  1WTW A;  1A3U A;  3K0Y A;  3I4M B;  2EJG C;  2A68 C;  2EYO A;  1OXX K;  2EY2 A;  1KLG D;  1VMC A;  3HOX B;  2EYH A;  1U4P A;  1Q3L A;  5DAU A;  4BS9 A;  1STH A;  3ND9 A;  4A3F B;  1DZ1 A;  1GUW A;  1TS2 A;  1H9J A;  4CKE A;  2AWO A;  1ZYR D;  1IKL A;  4R8I A;  3ERQ A;  2K01 A;  1A15 A;  4ZLT F;  3TP6 A;  2JA7 B;  2WKD A;  4ZK9 B;  4F7X A;  2SDF A;  1B9M A;  4CJ2 C;  2B2W C;  1ZYR C;  2E2I B;  3DWQ A;  4V0B A;  3IL8 A;  1II3 A;  5BN4 A;  3EVQ A;  1DCZ A;  1AP0 A;  1AZQ A;  3VR3 A;  4HR7 B;  1RTO A;  4PMB A;  4S3S A;  2B2V A;  3NWS A;  4HMI A;  1V43 A;  2H4O A;  1D1K A;  4IFD I;  3H91 A;  1G8Z D;  2NVT B;  3VYU A;  3Q24 A;  5C5L A;  4FF1 A;  2M00 A;  1JWU D;  2CVR A;  3MFY A;  1CHQ D;  3Q6S A;  2LS0 1;  1NSN S;  3MXP A;  5A35 A;  1A3T A;  4EVO A;  4IFD H;  3OWF A;  2PO4 A;  2A6H D;  1AEX A;  4FP5 D;  2MHV A;  3FMC A;  4EGV A;  4LJZ C;  5I2Y A;  3DM1 A;  2KHS A;  1KDB A;  4HAE A;  3BYY B;  2V4D A;  4IZ8 A;  1DON A;  5IIF A;  3HG9 A;  2EYJ A;  2F0J A;  4C3I B;  3M3Y B;  1JQY D;  4KHV A;  2RBM A;  4OGQ C;  2WII B;  3P7J A;  2I07 B;  3A8I E;  5JVG 3;  1HTP A;  2IW3 A;  3BS1 A;  2KCC A;  1A2U A;  4KK7 A;  3CKI B;  3MAQ A;  1B53 A;  2NWG A;  3OIP A;  3M85 A;  3KK7 A;  1STE A;  5CV4 A;  3RZO B;  3V96 A;  5C4J B;  1NCV A;  1D5Z C;  3CQZ B;  1WTR A;  4PMC A;  4CBV A;  4L6T B;  1Y8N B;  2BOS A;  3N6R A;  1RD9 D;  2F3W A;  3T4A C;  3R8B A;  2TSS A;  3VA5 A;  2HDL A;  1LTR D;  1Z6H A;  4KMU C;  1VF5 C;  1EY9 A;  1JR0 D;  3RMH A;  4G7H C;  3E5S A;  4H7B A;  2JE6 I;  1F77 A;  1PFN A;  3MFG A;  4IUU A;  4LK1 C;  5EJW A;  2F03 A;  1EQV A;  3J80 E;  1SNM A;  1LTT D;  2EE1 A;  1C4Q A;  1AN8 A;  4CKB A;  5KYL A;  1NUC A;  1SE3 A;  3PUX A;  3QB3 A;  2B8F A;  5D14 A;  1OXS C;  3D4D A;  3NHH A;  3BVZ A;  1GHJ A;  1EZ6 A;  2EDG A;  3S1M B;  1EU4 A;  3GTL B;  3HRZ C;  3DHQ A;  5KIX A;  1E2V A;  1OXT A;  1STA A;  4YIJ A;  1QIL A;  4IUR A;  1KTK A;  2VB3 X;  2A69 C;  2L5T A;  2ID0 A;  1H9S B;  5CBA E;  2NVX B;  4ZYS A;  1LT4 D;  3U9S A;  5EBD A;  4MN3 A;  2XN9 C;  1SSO A;  5C4Z A;  1EY5 A;  2KCN A;  2JYO A;  4ZAI A;  4FXD A;  3X3M A;  1VF7 A;  4I7Z C;  1HHV A;  4RCN A;  1EY6 A;  4Q5V A;  1UNS A;  4M1U B;  3H94 A;  5NUC A;  4A3B B;  3OWE B;  5EKK A;  1G2T A;  1O7Y A;  1PTO D;  5EPJ A;  4XYQ A;  3DMU A;  2EJM A;  2EVB A;  3CU7 A;  1WD0 A;  5KYI A;  2H1E A;  3NXW A;  1NR4 A;  3HOZ B;  5C6A A;  4GZY C;  2F0E A;  2TMP A;  5E4W C;  1F9R A;  1T5E A;  2KQ3 A;  1PZI D;  1X32 A;  3NTK A;  4ZRZ A;  3W2D A;  5IGG A;  1K8M A;  1EZ8 A;  5T1I A;  1PTO B;  2JP1 A;  2F0P A;  4HMJ A;  1CT1 D;  1PTO C;  2OF1 A;  2NVQ B;  1EU3 A;  1KDC A;  1SYC A;  3PO3 B;  3BZD B;  1EIH A;  4JK1 C;  5C5M A;  1FR3 A;  2QDB A;  1D2B A;  5J1Z A;  5ELE A;  2ZT9 C;  4QF4 A;  1O80 A;  1WTQ A;  5K5P A;  2B2U A;  2AWN A;  3SVM A;  2F0L A;  5JPM C;  1U4R A;  1SJE D;  2L9H A;  1JC7 A;  4PMW A;  1KNE A;  4KKU A;  2G9H D;  2VB2 X;  4XQJ A;  3PUY A;  5KRU A;  4A3K B;  2HUG A;  3NK9 A;  3S17 B;  1S5D D;  1TKW B;  1BOS A;  3J7A V;  4ZKB B;  5TSS A;  1EL0 A;  2FIN B;  1CQF A;  1GUO A;  5M9O A;  1LO5 D;  2DY7 A;  2JA8 B;  3ERO A;  1T5X D;  3S2D B;  3D8G A;  1CTM A;  3FPU B;  3I4L A;  1STB A;  3KUP A;  2L11 A;  4LAA A;  4EQP A;  5T1G A;  4MIU A;  4XT3 B;  5KND A;  4BA2 I;  2QKI C;  5EPK A;  1U4L A;  1RKN A;  1V1P A;  4C1N I;  1SBB B;  1TR5 A;  5KGU A;  1ET9 A;  1YNN D;  1A3V A;  1IW7 D;  2PZW A;  4CHT B;  3L3O C;  4RFB A;  3DUZ A;  5AFW A;  3LWU A;  4M8A A;  2K28 A;  5I6Y A;  1LT5 D;  4DK0 A;  1S4Z A;  5CYU A;  5M5Y B;  1ICW A;  2MPM A;  4X3T A;  1PRT F;  3LWE A;  2B2Y A;  5IGD A;  4TQU S;  1YNN C;  1IYV A;  3GTJ B;  2K5D A;  4J8Q A;  3M7G A;  3D6W A;  4RWS C;  5CV8 A;  4A3M B;  4OO1 G;  1JWM D;  1MSG A;  1HXY D;  4QIW B;  4KD3 A;  1F2Y A;  1KAB A;  1LTG D;  2LY7 A;  3P20 A;  4DGZ A;  5FLX E;  1BR9 A;  3W3A A;  2NVY B;  2X6L A;  5CMD A;  1STY A;  4QMG A;  1I4G A;  1TY0 A;  1I3Q B;  3OMG A;  5M3F B;  2XWB B;  1BO0 A;  4JBW A;  5E3F A;  5G3L D;  4G7O C;  1ONL A;  3CRK C;  4HED A;  3I73 A;  3MEH A;  1FD7 D;  3PIP 3;  3HOU B;  1KDA A;  4CGY B;  3IAY A;  1SYF A;  1SAP A;  1U4M A;  1TWA B;  3VYT A;  2SNS A;  4XTC S;  2PPB C;  1BQQ T;  1HRJ A;  2L55 A;  4ULL A;  4RGM A;  1WTX A;  3H0G B;  2B63 B;  4FVM A;  3OMC A;  2AUJ D;  1HCZ A;  5EBC A;  5I9O A;  4RKL A;  3OSO A;  4A3J B;  4FF3 A;  3U9O A;  1SNP A;  5CV6 A;  2WP8 J;  1K83 B;  2DY8 A;  3NE5 B;  1SNQ A;  1EEF D;  2IPK D;  1QJO A;  3LNN A;  4HCE A;  5JEA G;  4ODG A;  1HPC A;  3VR2 A;  1I4Q A;  4OIJ A;  3S9W A;  1Y1W B;  1VMP A;  1EWH A;  1MGS A;  2PNR C;  2K5W A;  2JA5 B;  5ISR A;  1EQT A;  1B9N A;  2IX3 A;  3J7Y W;  2BCO A;  1QE6 A;  1TWF B;  5C3W A;  3C46 A;  1Q1B A;  4PNY A;  4A3G B;  1FYC A;  2NZ1 D;  1OO9 B;  3GTG B;  4A93 B;  2QCP X;  4G4K A;  3DXJ C;  4C3I G;  3RZD B;  2I46 A;  1R4Q B;  2C5C A;  1JOK A;  4ZUI A;  4C3H B;  4B9X A;  1L0X B;  1SND A;  1EYD A;  2MJ8 A;  2KEE A;  3JAM E;  4KY5 A;  4KY7 A;  3J7A F;  1PMR A;  1F9Q A;  3CRL C;  2Z1C A;  1RJT A;  3EJI A;  2EY5 A;  2WV6 D;  3QWN A;  3QO2 A;  4K5X A;  2JEB I;  3FKI B;  5IGE A;  2B2W A;  2PZU A;  4XIG S;  3ITP A;  4XQQ A;  2B2T A;  3GP7 A;  4XYO A;  1FGB D;  4FF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...