1EYCA

Structure of s. nuclease stabilizing quintuple mutant t41i/s59a/p117g/h124l/s128a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eycA00
1STGA 2F3WA 4NDXA 2OF1A 5C3XA 5IIFA 4K8JA 3BDCA 1EZ8A 1EQVA 1TR5A 3NP8A 3TP7A 1KAAA 1SNPA 2F0GA 2LKVA 4TRDA 5KYLA 5E1FA 4NMZA 1STHA 5C5LA 3U9OA 4MIUA 5KGUA 2F0MA 4E6IA 4QF4A 4ID6A 4F8MA 4KD4A 4QMGA 5JAVA 5CR3A 4YIJA 3SHLA 3SK4A 2HQEA 4DFAA 1SNCA 3E5SA 2F0EA 3SK8A 4S3SA 3EVQA 3HZXA 4K8IA 4WRDA 1U9RA 3SXHA 3MHBA 2EYMA 3DMUA 3OWFA 3TMEA 2PZUA 2EYPA 5F2DA 1TQOA 5C3WA 2PZTA 1SNQA 2PQEA 5M9OA 1JORA 3NXWA 2PW5A 5CV5A 5I6YA 3SK5A 4KHVA 1EZ6A 4ZUIA 3SR1A 5CV9A 5HURA 5C5MA 1KDCA 2PZWA 2ENBA 2EYHA 1ENCA 4I65A 3V2TA 5IGGA 4KY5A 2SOBA 4IZ8A 4R8NA 4IALA 4K5VA 4QB4A 3T16A 1KDBA 1SNMA 4PMBA 4DGZA 3LX0A 3QOJA 4PMCA 5IGFA 3D4DA 3NK9A 4K14A 4OL7A 5EKKA 1TT2A 5C4HA 2F0IA 5EKLA 4K2LA 4LAAA 2NUCA 1EYCA 4ODGA 3DHQA 2M00A 1F2ZA 3ITPA 2F0JA 2F0QA 2F0UA 1EY0A 4N9PA 5IGEA 5CV4A 1STNA 4HMIA 4KJOA 4KJNA 3P75A 1KDAA 4DU9A 3SK6A 1EY7A 1SNOA 2F0OA 3PMFA 5DEHA 3OMGA 4G57A 5K5PA 3OMCA 1A3TA 1JOOA 5E3FA 3TP8A 2OEOA 2OXPA 5IODA 1RKNA 2F0SA 3TP6A 5C4ZA 5C6AA 4EQPA 5KRUA 1EY8A 5KYIA 1JOQA 3RUZA 5DAUA 2EY5A 1SNDA 1NSNS 1F2MA 5CV8A 5IGCA 1A3UA 2F0KA 4NP5A 5CV7A 3OSOA 3NQTA 4N9TA 5JOBA 5EGTA 2RKSA 1II3A 1SYDA 2EYLA 2KHSA 1AEXA 3BDLA 3ERQA 3NHHA 4IUNA 2KQ3A 4ME5A 3TP5A 1A2TA 1SYCA 5CC4A 5I9OA 2F0WA 4EVOA 2RBMA 1EYAA 3MVVA 3EROA 4NKLA 5IOCA 3S9WA 1STBA 5IGDA 2SNMA 2EY6A 1A2UA 4EQNA 2F0LA 5CGKA 5J22A 1STAA 4KY7A 5NUCA 4H7BA 1IHZA 4B9XA 5IGBA 1EY4A 4DF7A 4ZUJA 3C1EA 4KTAA 4ZQ3A 1SYGA 4K6DA 4KD3A 1A3VA 3D6CA 3NUCA 5KIXA 4F7XA 2EYOA 2F0FA 5CV6A 1SYFA 1ENAA 4J1MA 4KY6A 1EY5A 1SYEA 2O4XA 4RKBA 4KV6A 1KABA 5ISRA 1EY9A 2F0PA 5J1ZA 4RKLA 3QOLA 4K2KA 3H6MA 3C1FA 5I9PA 2F0DA 4HTHA 4J6HA 3D4WA 2SNSA 2EYFA 2F0NA 3D8GA 3MEHA 4K5XA 4PNYA 4B9WA 3P1HA 1STYA 4WORA 2F0HA 3MXPA 2EXZA 4K5WA 4EQOA 3MZ5A 1F2YA 2WACA 5KEEA 2EYJA 3EJIA 2QDBA 2F3VA 3QB3A 1NUCA 1EY6A 5HGTA 5I6WA 3HEJA 3R3OA 2RDFA 1EYDA 3T13A 3VA5A 2PYKA 4HMJA 1SYBA 2EY1A 2F0VA 1JOKA 5J39A 2F0TA 2PW7A 2EY2A
chains in the Genus database with same CATH superfamily
2MGSA 1JWMD 5C3XA 3BJUA 3GTLB 2CWPA 3C2PA 5KNBA 1IYVA 1YJ9A 4RCNA 2KJXA 2F0MA 4E6IA 1MI2A 4K0KL 3RN2A 1GUSA 4H13C 4FYDA 2O2LD 2L4NA 4S3SA 1J5EL 2MP1A 1P16A 1HNXL 3ER0A 2PW5A 5FO8B 1FVIA 4RHRA 2YTVA 4LW1A 4GZYC 1RTOA 5FO9B 1LTID 2WIIB 3A5UA 4A3CH 1LTTD 4A3JG 5JVH3 5GROA 5M3MB 2LMCB 5FLMH 4OONA 1AW7A 4L5TA 4P74A 3F1ZA 1JE5A 2NVTB 4GN3B 4DU9A 1HPCA 1KLUD 1EY7A 2RSNA 4OIKA 2G5DA 2B8GA 2XSCA 1GO3E 1WTVA 5IODA 3CKIB 5C6AA 1BCPC 2RCNA 3E9IA 2E76C 3NQIA 1X54A 3BVMA 1EWHA 1WI5A 3I4MB 1I94L 2K5WA 1LTRD 2VW9A 3M7GA 4CKBA 3D0FA 2ICEC 1CKNA 1EWIA 1VF7A 1CHPD 2KEDA 2SNMA 5CGKA 4A3IG 1BVSA 1J6QA 1IHZA 4HSPA 2NVYB 4DV3Q 3WDNA 1XJVA 1WYDA 3I73A 2NZHA 3KF8A 5DNFA 4UDUC 1ENAA 4A4IA 3GTQB 2E2HH 3M4QA 5ISRA 4DV1Q 1SDFA 3CU7A 3HKZE 5FO7B 2F0DA 3J81L 2G9DA 4JBJA 2AUJD 4XTCS 2EXZA 1ZYRC 3DWQA 1JCKB 1F2YA 2N8NA 1IBLQ 2F3VA 3T53B 1SJHD 3K58A 1EY6A 4KI0A 5LMNL 3GTOB 1G2SA 1JJ2A 4DNTB 1VQAA 3R8BA 4IOAA 1VQGA 2CVRA 1L0XB 4FF3A 1STGA 2XRSD 2F3WA 2E75C 4RGOS 2KCNA 3IFTA 3BDCA 3NSWA 4YY3Q 1PH8A 4MNOA 1Y1WG 3P7JA 4MIUA 2H1EA 3J81c 2YU9H 3RZOH 3VYRA 2HQEA 5CYUA 4MN3A 4RAUC 3PQIA 4JI3Q 1XMQQ 1JC7A 4YWKA 1HNZQ 3PO2H 4XT3B 3EFXD 3TS0A 1JJCB 1PH1A 4A3LH 2RA4A 1PRTB 4KY5A 3OW7A 1BCPB 4IALA 4CBVA 4LFAQ 3LX0A 2NUCA 4DR4L 4LUOA 3KJOA 2A1AA 2VUMH 5EPKA 3MFGA 1G6ZA 4N8FA 1ESRA 4A3BH 1KTKA 2JA6B 4A3GG 2A69D 1EYGA 1HNZL 4FXGC 1C4QA 4DR5L 3K59A 3UE0A 2RQXA 1IXRA 4DV0L 4AYBG 4LF9L 4JVZA 5C0XI 1EY8A 1H9RA 1E7ZA 1EOTA 3M9BA 3Q8DA 1MJCA 4GKJL 2E5LL 2DY8A 4GOPC 2JYOA 3SE0A 1U4PA 5C4JB 1L1OA 3ZJYC 4JBKA 4C3HG 3A74A 5I9OA 3DWAA 3MVVA 1O7YA 3F8TA 4XQNA 2AKWB 2IHEA 2B2WC 1UEAB 1HH2P 4DV5Q 4QUCA 1KL9A 1A3VA 3EA6A 4RKBA 5AJ3L 2XN9C 2TMPA 2MO1A 5D3DA 2PCFB 4HJ5A 3K0YA 1WCMH 1NE3A 3L7ZC 4XQJA 1YEZA 4GKKL 1XPUA 2I46A 2G9HD 3KLSA 1VQ6A 1GHKA 2B2YA 2UU9Q 2SDFA 1EQQA 1EFID 4AH6A 1GUOA 1CZWA 4A3JB 1TVXA 1C48A 4NXMQ 1Q1BA 4K0KQ 1A63A 2MUYA 1GM5A 2IW3A 1IYUA 1D5MC 2JEBI 3W3AA 1QZHA 1JT8A 1QOHA 4A93G 1EIFA 4DR3L 1UWVA 4DV0Q 3GP7A 4JI6L 1WTWA 1G8ZD 2EQSA 1NR4A 1I4XA 1X3FA 4RHSA 2F0GA 5IYBH 1EEFD 3I7FA 3VDYA 3WOEA 2Q2HA 5JAVA 4GOPA 4RGMA 3SK8A 3C3LA 4WRDA 1TWHB 1U9RA 3GO5A 4IO9A 5I2XA 2PZUA 3WWVA 4DR3Q 3J80E 1SNQA 4YHHQ 2HDMA 3KF6A 5HURA 2Z6BA 2K50A 4LUVA 3KDFB 1O7LA 2WAQB 4PMBA 1X3QA 4UY8C 2K14A 4K14A 2UUAL 4DV7L 1OTCA 1CM9A 1I94Q 1B9NA 4DV4L 1STNA 1Q86C 4N8X1 3S15B 1H9MA 2N78A 3T1HQ 2WINB 2B2YC 1CK1A 4JBMA 2E2IB 3KF8B 4BS9A 3E9HA 4EQPA 2MFIA 4P73A 4A3JH 1UE6A 2X6LA 3KOJA 5CV7A 1VQ8A 4BY1B 3NWSA 5A35A 1YHBA 2CCZA 4DR6L 4JI3L 4DAPA 1A2TA 2H5XA 4A93B 1N33Q 1EYAA 1G91A 2PQAB 3I4MG 2DUDA 1VQHA 5E4WC 4B9XA 4QGUA 1X3EA 3RMHA 2X69A 3DEOA 4BA2I 3HOYH 1SYGA 1X65A 4F7XA 1S5DD 3AYHB 4GLXA 4DR6Q 3O13A 2O5JC 2V4DA 3A8KE 3OOCA 2QKIC 4JBWA 3BS1A 1KNAA 4GNXA 1DZ1A 3S24A 2HQLA 1Y8OB 3U4VA 3A7AB 4DV7Q 3I2ZA 3H0GB 4WJWA 4CJ1B 1YZ6A 1Q90A 2Z1CA 1N9WA 1H9SA 5IYCG 1JOKA 2X6GA 1KRTA 4ABNA 5J39A 1S3OA 4LWCA 4APVA 5M5XH 2EY2A 1X56A 1KLGD 5M5YH 1BO0A 1E1OA 1S40A 4LF6Q 2VUMB 1K83B 1WTPA 2LKVA 5L37A 4L5SA 1O7IA 1U4RA 1X32A 3X3MA 1IBLL 1LTGD 1SE4A 2EZVA 2FFKB 1HUNA 2ZT9C 1N34L 4MZ9A 1N33L 4KN7C 2ZXOA 5IY0A 3RLOA 4X65Q 1QJOA 1SLJA 4KHVA 1SEBD 4KKSA 1B50A 3A56A 1ENFA 3I4NG 3CCSA 1N8RC 4OWTB 4RGNA 3MAQA 5IGFA 1KIXA 2EE1A 3QG1A 4KK7A 2Q8TA 2F0IA 2F4IA 3AFPA 3QJYA 3PUZA 4LF7L 4NXML 1PVOA 2F0JA 2F0QA 1CSQA 2RHQB 2JA7H 3AB9A 1ILPA 3I8ZA 1EQRA 3HOWG 3JAMc 3BZKA 3LWUA 1TIID 1JOOA 3B6YA 2Y0SG 1HTLD 3G6JB 2F0SA 3RR5A 1TWFB 4X6AH 4C2MB 1IW7D 5ELEA 5LMUL 2QA4A 4LF8Q 4JI7Q 4ALPA 3TRZA 2A68C 2UUCQ 3NQTA 4N9TA 4JI4Q 5ELFA 3E0JA 1II3A 5AJ3Q 1STEA 2JA5B 4GNXB 5EQ0A 2KCTA 4ME3A 4QIWE 4TQUS 2FXQA 3OIQA 4DPGA 4OO1H 2EY6A 2NVXB 3A7LA 2HT1A 1RIPA 4O0AA 3FDTA 1QB5D 2B2TC 1RCVD 1JE4A 4WJ3M 1F9RA 1I3QH 1E2WA 4ILWA 1NMFA 1JR0D 4A3IB 3GTMH 1WD1A 2IY5B 2I5HA 3OWEB 2K5NA 1I6VC 3D4WA 3J7YW 1VQ4A 3D6WA 1C7YA 2DY7A 3PV0A 2F0HA 4HJ9A 3A55A 1ICWA 1ONLA 3NBHA 3UDGA 1XNQL 1JQYD 4Z9CB 4JI8Q 1CFMA 3KDFA 3NELA 1TWCH 2OQ0A 2FHTA 4A3DB 3RNUA 3CCVA 5K36H 2RBMA 1XWEA 1HNXQ 4DNRB 1TWAB 4DAMA 5M5WH 1TS4A 4JI1Q 2Y0SE 1SNPA 2JA7G 4OO1G 3JAMi 2D0PA 3VYSA 1L1OC 2WB1E 1K8AC 2OWOA 3OHXC 1IW7C 2F0EA 1VQ9A 3PUWA 3RD4A 3MHBA 5GAEC 2KENA 4C56C 1SFOH 3EBEA 3NXWA 5CV5A 4L8JA 4Q0FA 3JC66 4JW0A 2UXBL 1HZCA 1B8AA 1KDBA 4RWSC 1PTOC 2BE5D 3CCJA 1QVCA 3TEHB 2B29A 3PGZA 4DAVA 2IT1A 1D5XC 2R61A 3D31A 2KCMA 3BU2A 2F0OA 1E2ZA 2R7ZH 1YBYA 3M85A 3FKIH 5HGQA 1P8LA 4JI0L 1Q7YC 4Y7NB 1UEBA 3S2HH 1M90C 2EDGA 4XDXA 3RZDH 1SXTA 4OHJA 5IGCA 3GTKH 1SBBB 2WP8J 1YNXA 2JA8G 2RF4A 2BDNA 3OSOA 3W2DA 1B2TA 3RZDB 4BBSG 2XVSA 5JPNC 3R2TA 4CHTB 3PCOB 1B4OA 2OCEA 3KBGA 3S1QB 2FINB 3S9WA 1FD7D 3NTKA 2N49A 3SDZA 1XPOA 1PH4A 4ZCKA 4H7BA 4HIKA 4P2CB 1HZ9A 4DF7A 1VDZA 4CKEA 4ZUJA 4KTAA 1CKOA 3CC4A 3TDQA 1WVLA 4LFAL 3K7AH 1LT6D 1HZAA 4PZ6A 2AQ3B 1F9QA 5CV6A 5EPLA 3TN2A 4G4KA 2Q8IB 1VQMA 2NTSA 2KBNA 1AE3A 1M8AA 4BXXG 3A5ZB 3MWYW 1GXDC 2UXBQ 3PIO3 4A3DG 3P1HA 1QZGA 3IRBA 4HEDA 1JB3A 1CTMA 2MJ8A 1BBUA 4R4QA 4PZ7A 2KECA 4WFN3 4DK6C 1EL0A 2EJGC 5ELCA 3BYYB 4LF8L 2XNAC 4I7AA 3PUVA 2E2IH 4DR7Q 2AUKA 1QVGA 1R9TH 4Y52H 4BY1H 4DR2Q 2WKDA 4JI4L 3WOFA 4CDDC 1EFWA 4HJ8A 3CW2C 4X3KA 3I4LA 4A3EB 2EXDA 5IT9c 4GNXC 3F2UA 3NP8A 3TP7A 4C3IB 1YHQA 4P72A 1BUVT 2MPMA 3T56B 1C9OA 3M3YB 3L0OA 4F8MA 4QF4A 3VA7A 2A69C 4NB3A 4C3IG 1VQ7A 2QW7A 3K5LA 2ZJQA 4OWWB 1MJEA 2LY7A 1LYLA 3SXHA 3E6ZX 2Q8RE 3K0XA 5M9OA 4DR5Q 3H3VI 1MKHA 3PO3B 2B2UA 3S1QH 5CV9A 5C5MA 1WFQA 2LXJA 2ZXPA 5IYDH 2SOBA 1BCPF 1FGUA 1D1KA 2OT2A 5GAGC 2L15A 1VQDA 4CJ2C 3CCUA 1CKNB 2FMCA 2XWJB 4MTNA 5CV4A 1WTQA 5IYBG 1O7ZA 2DJFC 2ZTDA 5JEAH 1XMOL 1CHQD 2JA6G 4X65L 5D14A 1VQEA 3VR5A 4GN5A 3DUZA 2B63H 1XX8A 4X64L 4DV6L 1PTOB 2AWNA 2ICIA 1J9OA 5FLXc 1IYJB 5JOBA 2QEXA 2EYLA 1I4PA 1PH7A 1K28A 3J7AV 1EIGA 2LSSA 3HOWH 4B3SL 3X3NA 1R4QB 5IGDA 4EQNA 1SJED 2R6GA 2MHVA 4BBRH 5LL6X 2AQ1B 3NUCA 1DXMA 1N34Q 3K7UC 1O78A 4HCEA 3U9SA 1SMYD 4KY6A 3STBD 4JI5L 5H1SE 3CF5A 2Q2UA 4A93H 3A54A 1ILQA 4LMQD 1GUNA 5COYA 2L12A 1ESFA 3A8IE 3G4SA 1Q8IA 1IBMQ 3DXJC 2WACA 2AQ2B 4DV5L 3CD6A 1AP0A 3GV6A 1CI3M 5M5WB 2PMZB 1LUZA 3VR6A 3KLSX 1I4HA 2RVLA 1QUQA 1PH9A 5IIFA 3P20A 4UP9A 4G7ZC 1PTOH 2EOTA 4OELB 3AQQA 2B2VC 5KGUA 5ELDA 5CR3A 3GQBA 3SK4A 4FDBA 3TZDA 2CHBD 2GN5A 2E2HB 2HUGA 4DV4Q 3FHWA 5JVG3 2I5MX 5IE8A 1HJPA 4JI6Q 3VR2A 5I6YA 1BBXC 4AQYL 3S16B 2JQOA 4DKAC 1SAPA 4JG2A 4XQQA 1VCIA 4F87A 1FNUA 5EBCA 3VYTA 5EKLA 4LAAA 1OXVA 2P5ZX 3E0EA 3I4OA 4A3GH 3FRPB 2F0UA 1Y1WH 2VUMG 5JJIA 1EUJA 4L63B 3OMGA 1A3TA 2PI2E 5E3FA 2UUBL 5KNCA 3M3YH 2LS01 2OEOA 1RKNA 4KKUA 5C4ZA 2YV5A 5CMDA 2MO0A 2NVTH 3OPOA 5BN4A 2KCCA 2RHSB 3D3RA 2UXCL 2D0OA 3BDLA 5FLXL 1LLRD 1V1PB 1K0SA 4DXFA 3EROA 2K6AA 3DM3A 2YTYA 4JI1L 1ZYRD 5G3LF 5C44G 5J22A 5D3IB 1PA6A 4IPGA 2JA9A 3HOVH 4C1NK 1F77A 1WTRA 4KMUC 2F4VL 2JA8B 3KJPA 4C1NI 3L9AX 3C1EA 5C44B 5C4XG 1UNSA 1BBWA 4CDEC 1H9KA 5KIXA 5JJZA 2EYOA 4DV2Q 1KABA 1Y14B 3S17B 2M9VA 1PFNA 1FNVA 2J0TD 1BF4A 2EYFA 2NWGA 2F03A 4R1JA 3TZUA 4YCVA 4IPCA 4LK1C 4GOPB 4EQOA 3H94A 3EJIA 2QDBA 1FJGL 3K57A 3J81i 1TWCB 2B63G 5I6WA 1ZXTA 1Q81C 2NN6G 3S2HB 5JEAG 3V05A 3D4RA 2EY1A 3HOVG 3GTKB 1BOSA 4HSVA 5E7NA 2NN6H 2A6ED 1XNRL 1JWUD 3CC7A 1TWFH 1G51A 3FKIB 1RF2D 4Y7NH 2HCCA 1IBKL 4RA8A 3ERSX 4MHEA 3Q23A 1UE5A 4YIJA 4DFAA 3PO3H 1OXTA 4DK0A 4X3TA 3VR3A 4B3ML 1Q3LA 3HZXA 3J7ZC 3M4OH 2NVXH 1JORA 1HNWL 3UE1A 1EZ6A 1LT3D 1D2BA 2PZWA 2ENBA 4IUUA 1Q1EA 1B70B 1EU4A 5CORA 4A76A 1XYIA 1K0RA 1PYWD 4DV2L 1VMPA 3CXCA 1CSPA 1SR3A 1XMQL 1F9PA 4TSSA 3QR8A 1I6HB 4BY1G 3CRKC 5FLMG 5DEHA 2IPKD 1R9TB 1K8GA 4JYAQ 1VQNA 4F88A 2L11A 2K52A 2J7ZA 1HQMC 2LFNA 4H44C 4LFCQ 4A3DH 1EQTA 3MXNB 3HKZB 1PHJA 3S1RH 3K81C 1SYDA 1AEXA 3ERQA 3V96A 1KAWA 2R7ZB 5EJWA 1VQBA 2B39A 2WAQE 1OXXK 4CJ0B 3SVMA 1EY4A 2CW0D 2Z4HA 1EEID 2NVQB 2BDOA 4JI7L 1YVCA 2K5VA 1AFPA 1A15A 1ML0D 4A3FB 2ZM6Q 1X6OA 1TS5A 4O42A 1NY4A 5LHY1 1UE1A 4P71A 2E2JB 3C1FA 4HTHA 1QG7A 3PIP3 2ASBA 2SNSA 4JPBW 2JA5H 3D8GA 2JA8H 5LMNW 4X3SA 2Q2IA 5M5YB 3HOVB 1L0WA 3T1HL 3LGJA 1L1OB 4JC0A 4A3KB 3ULJA 1SE3A 2YU9B 3SGIA 1GD7A 5IT9E 3E3XA 3H0GH 4DR1Q 1EYDA 2R7ZG 4BBRG 5CBEE 1SYBA 5JPMC 2WB1G 3UDIA 1E0BA 3JAME 2RDGA 1A62A 4K8JA 1VQFA 1WCMB 4IPHA 4A3FG 1GUTA 5E1FA 4DNIA 2ZTEA 4LFCL 2R93H 3M7NA 3W5OA 4LF5L 3S15H 4JV5L 1TXYA 1B44D 3J81j 1ET9A 2A19A 1ZKOA 1N36Q 4QQBX 2TSSA 3HOUG 3DMUA 2R7DA 2C9OA 1C0AA 4DV1L 4R9WA 1FYCA 1KQSA 1Q8KA 1HRJA 3V2TA 2BCOA 2OQKA 1CQFA 1E24A 1HCZA 1Z47A 1TWAH 3K80C 4LF5Q 2BE5C 2XGTA 4X62L 3ITPA 3CRLC 1SNOA 3PMFA 4YWLA 5K5PA 4LUZA 1GUGA 4HJAA 1YI2A 1XNQQ 3KFUA 3NTHA 2ALYB 5DAUA 1SNDA 3OTOQ 5C0XH 1IBKQ 3BZDB 4NP5A 1HFNA 3ICEA 2Q2TA 5BR8L 2OTLA 1PTOD 2KQ3A 4BY7G 5CC4A 4EVOA 4OGQC 4HIOA 3S1MB 2R92H 4UHVA 4IFDH 4KY7A 5IYDG 1YITA 3TS2A 2DN8A 3J80L 1VQKA 1SE2A 1FJGQ 4K6LA 3M4YA 3NBIA 2QF7A 4DUZL 2D62A 2Z6KA 4HR7B 1Q12A 1ZEQX 3HOYB 3CC2A 2EVBA 1EY9A 1MD2D 4FXKC 2VL6A 2C35B 4C3IH 3Q6SA 2WB1B 2K04A 2LXKA 4BBRB 2K03A 1STYA 4WORA 2D5DA 1I4GA 3MA2B 2D2CC 2GVAA 1LM0A 3HRZC 3NE5B 3H3VH 4IJLA 1LTLA 2JJQA 3NENA 1VQPA 4TVAB 1ASZA 1NCVA 1H95A 4JI0Q 4DK1A 4RCOA 3ONAB 1R4PB 3OW2A 3AEVA 4IQZA 3M4PA 1CA6A 1VS0A 1L2FA 5AFWA 1XTDA 4QMGA 1OXUA 3K8AA 1K73C 4FO2A 2ZTCA 1J8IA 1FL0A 1ET6A 1QUQB 1JWSD 2EYPA 2CWAA 1RHPA 5C3WA 4B3RL 4O1NA 3SK5A 1KNEA 4V0BA 1HR0W 1G2TA 2EYHA 2NYZD 2E8GA 3MC0B 1I3QB 1SRUA 3GV3A 3I3CA 1U5KA 1TY2A 1K3BC 4PMCA 4PQXA 3NBHB 3J80i 1K83H 3U58A 3HS0C 4DUZQ 2A68D 3W1GA 5C4HA 5HY6A 1WOCA 4X66Q 4OEMB 4OIJA 2EJFC 1M4VA 4KLKA 3BVGA 3LWEA 3BYTB 4KJOA 5IYCH 3IFDA 4IPDA 4XXEA 1FNWA 3TQYA 4RMFA 3HOXH 4H02A 1W3SA 1CT1D 3NPPA 5KRUA 1XPRA 1W6KA 1WTHA 4EX5A 1NSNS 4JCVE 5M3MH 1JB7A 5EGTA 5EKIA 2RKSA 1DOLA 4QY7A 4HCSA 2XTIA 5I4DA 1X9NA 2ID0A 4DAYA 4GKKQ 4YY3L 1UAPA 1YHAA 4LF9Q 3HOYG 2F0LA 2UU9L 5ELOA 2JE6I 1K8MA 1RD9D 2WFWA 4KD3A 1JJGA 1LACA 1YNJC 3D6CA 3CQZB 2VB3X 1DD2A 2KHJA 1EWCA 1PFSA 2Z8LA 4CGYB 1SFOB 1HR0Q 4IUPA 3I56A 2UXDL 3H6MA 3GTLH 1PMRA 1VQOA 3HP3A 5IT9L 3S2DH 4K5XA 3MEHA 3G71A 3RLFA 1GJXA 4IFDJ 3MZ5A 5KEEA 1PDQA 2EYJA 5I2YA 4DR4Q 2R92G 4FF2A 1VF5C 2QDLA 5LL6S 1B1ZA 1TY0A 5K36G 5C4JH 1I50H 1J5EQ 1PV4A 1Q46A 4ZAIA 3S1NB 4YCUA 2PO4A 4IN3A 1V1QA 3GTGB 4YWMA 1KAAA 5EAYA 3F2CA 3R93A 1RTNA 1PH6A 2Z0SA 4KD4A 3BG3A 5IP9G 4LJZC 2VZAA 4IJHA 5G3LD 1H9JA 4X62Q 3E5SA 3I90A 2WKCA 4J8QA 1W6JA 1T5EA 3N6RA 1Z9FA 5IP7G 5F2DA 3AFQA 3J80c 1ASYA 3GD7A 1SE8A 4ZUIA 4BY7H 1Y8PB 1KDCA 1EU3A 2B3GA 1XTCD 4YCWA 1F9SA 4WJ4A 3Q22A 3D4DA 1TT2A 4U68A 3J81E 5C0XG 4ODGA 4B3TL 1F2ZA 1HUMA 3IL8A 2KUMA 1MSGA 1KDAA 3SK6A 1K8OA 5T1GA 2A73B 5JJLA 1I50B 4I7ZC 1U4MA 2RSOA 3CCMA 4HJ7A 3RN5A 1VQCA 3CP0A 1A3UA 5FJ8H 2F0KA 4LFBL 4QJFA 3KLWA 1AN8A 4JOIA 3CCQA 4R4IA 4DUYQ 4V190 5ELBA 3CCRA 1PH3A 3DM1A 3KYHC 3SEBA 3CCLA 3HFZB 3I91A 3HKZG 3HOUH 3I4NH 4AYBE 1Z7TA 3IAYA 4IUTA 4ZQ3A 1PTOF 2DNEA 4B08A 1DONA 2K4KA 5C4XB 3HOZB 1N36L 5GADC 1EIYB 4ZYSA 3QWNA 2R93G 4DR7L 1A6XA 4LF7Q 1EY5A 2O4XA 4C3HH 1QNKA 1HQRD 4OWXB 1M1KC 2K32A 3MXUA 1TWHH 5I9PA 1Y69U 2K5DA 2XIWA 4B9WA 5M5XB 5D65A 4ZKCB 1S5BD 1B53A 2V1CC 2JSOA 3JAML 3H0GG 1D7QA 4B3TQ 3J7A5 1NNXA 4C3JB 2E5LQ 2OTJA 1HFGA 4GLVB 4A3BG 2VS1A 3I4MH 2MNAA 2JA5G 3UDXA 5FK9C 1O80A 4RH6A 4BBSB 4C2MH 4A3KH 2FJ2A 4P75A 1EQVA 4FVMA 4IURA 1IZ6A 1WJJA 5A2QE 3CHBD 1A0IA 1JICA 1SNCA 1HTPA 1PRTD 1D1IA 2PPBC 1KHIA 1L0YB 1NR2A 1JMCA 1NTGA 1PH2A 4L5RC 4M1UB 1FR3A 1MSHA 3I70A 1D5ZC 1B9MA 1LT4D 2BA1A 3HOUB 4OX9L 2IWHA 4K5VA 1PYSB 1SNMA 1Y1VG 1IBML 4JI2Q 3KUPA 2A8VA 1OO9B 4GKJQ 3DHQA 3H91A 2O5IC 2JEAI 1X55A 2IX0A 1LT5D 1DYQA 1KRSA 2I07B 2FMMA 2AMCB 1PFBA 4DK3C 3G6EA 1V8QA 4FXDA 2QILA 4BWGB 5KYIA 1PRTC 3PSIA 1PH5A 5CV8A 4RGTA 1OXSC 2VQFL 3NHHA 2ES2A 4IUNA 1V1PA 1SYCA 2JP1A 4GS3A 4C3JG 4JYAL 1FGBD 3CCEA 2HIVA 1A2UA 1GVPA 1RODA 1STAA 1PZKD 3MXNA 1LTBD 3FP9A 2YYZA 4A3IH 1CA5A 1DCZA 3PO3G 3GTPB 4B3MQ 1HXYD 2F0FA 4DN4M 1SSOA 1BKBA 1HZBA 2WAQG 1SYEA 1UUPA 3S1MH 5M3FH 2GVBA 1HNWQ 4J6HA 2BOSA 5T1IA 3F2DA 1YIJA 2BH8A 4M8AA 1DOMA 1NAPA 1WTOA 5KNDA 4X66L 1MHWC 1NUCA 5HGTA 2GA4B 1PFMA 3KLRA 5M3FG 1CKMA 3T13A 4HMJA 2CW0C 4FF4A 1IL2A 4G7OC 1H9SB 2L5TA 2UXDQ 2HD3A 1YNND 5IWAQ 3BVZA 2D9UA 1EZ8A 1TR5A 5J3BA 2K5QA 1LTAD 5LMUQ 1Y1WB 5E4XA 4ZKBB 3PUYA 3A8JE 3ZYYX 1WCMG 4LF4L 5C4XH 3CMEA 2VQFQ 2VB2X 2A6HC 3KBXA 2Z6KC 3CQZH 2A5HA 1E22A 5C44H 4IOCA 2PQEA 5IWAL 3FPUB 3SR1A 1I5FA 3GTMB 4XIGS 1ENCA 2E74C 5IGGA 4LNQA 4R8NA 5CBAE 2L55A 4OL7A 2KEEA 1F2LA 4HAEA 3W1BA 2I5LX 4LF4Q 4LFBQ 4L6TB 1EY0A 5IGEA 1AE2A 2Y0SB 3R2IA 2ZXRA 3Q0AA 1AZQA 1D8LA 5TSSA 4A75A 4NW2A 4AIMA 2YTXA 4YHHL 4QIWB 4Q5VA 3PO2G 5BN3A 1Y1VH 2NZ1D 1NJIC 3T51B 2NTTA 2XRQD 1I4QA 2RDHA 2VXWA 3H09A 3BZCA 4ZRZA 4OXPA 2A6EC 4QL5A 2DNCA 4DAYB 1S72A 4A3BB 3S14B 1ICFB 2F0WA 5M3FB 1S5ED 1A8VA 4HIMA 1B7YB 3AMUA 2F3IA 5IOCA 1STBA 2L0CA 3T1YL 2QGQA 5NUCA 1V9PA 5IGBA 4POGA 4MTKA 5EBDA 3ULPA 2VY3A 4A3LG 4A3KG 1RJTA 1XXGA 1TWGH 3N52A 2EIFA 4PV1C 2UXCQ 4L5QA 3PO2B 4AQYQ 2A6HD 1YJNA 3CPWA 3MXPA 4NXNL 3L2PA 2F4VQ 2UUAQ 2J4XA 4KHPQ 1Y1VB 1HHVA 1BQQT 2K7VA 3EN2A 2CQAA 2PYKA 1W2BA 1Y8NB 2IHFA 3EIVA 2F0VA 3FMCA 3NEMA 1LO5D 1QCBD 1BXTA 1U4LA 1EOVA 2F0TA 3P75A 2UUBQ 1PZJD 3KK7A 3C46A 1T9HA 2B63B 2OF1A 4GN4B 1WTXA 3S2DB 2B2UC 3K6OA 3PUXA 5FLXE 4TRDA 1PLFA 2E2DC 4NMZA 2JA6H 2HIXA 2HHHL 1TWGB 1TS2A 1BNZA 4QUFA 3H3VC 2N55A 2NN6I 1V1OA 4R4OA 3KF6B 3J7AF 2K33A 1XMOQ 3GTQH 4NPSA 5FJ8G 2MQHA 2HDLA 3URYA 5GAHC 4KHZA 2IL8A 2K5HA 4X64Q 4DV6Q 4PMWA 2K1BA 3T16A 1IL8A 4DGZA 1MBYA 3QOJA 4PG3A 4CDFC 4J15A 4IFDI 3Q24A 2M00A 3UI2A 3FVQA 2JN4A 4AYBB 4HMIA 4X3UA 5JEAJ 4G7HC 2Z9HA 2VNUD 4C3JH 4B3RQ 3RZOB 1SMYC 4NXNQ 1K9MC 1CUKA 3TP8A 4H0LC 4A3EH 2RCFA 2N88A 3TP6A 2CKZB 1JOQA 4KHPL 3G48A 5LMNQ 1YJWA 3ND9A 1AZPA 4KKTA 2PQAA 5IP7H 1PZID 4JI5Q 3U4ZA 4ME5A 2K28A 3GDEA 4UPAA 1QE6A 1E3PA 1EIHA 3S17H 5DLQE 4NKLA 2AWOA 4R8IA 4HN7A 4A3CG 3PF5A 2ZJRA 1HA5A 3K5NA 1AH9A 1PXUA 3I4NB 4XYOA 5JJKA 4K6DA 4JI8L 1IKLA 2UUCL 3MXGA 3TREA 2A74C 4J1MA 1X3PA 3TBIB 2F0PA 5J1ZA 4K2KA 5FKAC 4RG1A 2R93B 3LNNA 2F0NA 1BDOA 1QWYA 2CFMA 3QB3A 4R4CA 5GQOA 4FF1A 3VA5A 2KHIA 3NWTA 4DUYL 1I6HH 2SEBD 4BBSH 1YNJD 1N32Q 3QIAA 4BXXH 2KOLA 1NMGA 2DJGC 1BR9A 3HOZG 4QCLA 1TU2B 4ID6A 1CZGA 5FOBB 3A0JA 3FKIG 1VQLA 4RFBA 3VR4A 3BDOA 1YNNC 3S16H 2AHOB 3TMEA 2K05A 3GTPH 4UP7A 3TSSA 5M3MG 1KC8C 1CQVA 1RDPD 2WV6D 1BCPD 2B2WA 2R7FA 1S4ZA 4IZ8A 4A3MH 2B2VA 4ZK9B 3HOZH 3NK9A 5EKKA 3I55A 4K2LA 2C5CA 1EYCA 4OO1I 1HR0L 4N9PA 3GTGH 3S1RB 1HA6A 1S5FD 4G57A 3OMCA 2OXPA 2NBFA 3IKJA 1S5CD 1DGSA 2R3ZA 3RUZA 4ZLTF 1X3GA 1F2MA 3MFYA 3GTOH 3UDFA 4DA2A 3MTSA 1IKMA 1SMXA 5A2QL 1VMCA 1U0LA 1QVFA 4GLAC 3DWPA 3U50C 3CAMA 1LV9A 1G291 3VYUA 2H4OA 4IUQA 1MIUA 2QEJC 2QCPX 3DEPA 4IUVA 5DM73 2PNRC 5C3EH 2N3SA 3T4AC 4A3MB 2ZJPA 2K75A 1DM0B 1DJRD 2F1MA 1GOZA 4JOIC 4ULLA 3GTJH 1Q82C 4JK1C 4DR2L 4KV6A 3HOWB 1XNRQ 4IFDG 1NBWA 2DGYA 1LTSD 2KVMA 4PNYA 1Z6HA 1VQJA 1PYBA 4TKOB 3T1YQ 3EQLC 1GHJA 2R92B 1PRTF 4DV3L 5IP9H 4A3EG 1QILA 3K5MA 2CQOA 1I4RA 3G7LA 5C3EG 2VQEL 3HOXB 1B3QA 1LABA 2PW7A 2XWBB 2PMZE 4NDXA 4HIDA 3S1NH 5KYLA 2L9HA 3OTOL 1STHA 2IJ0A 5C5LA 3U9OA 1RL2A 4XT1B 2JA7B 3SHLA 2B2TA 5EPJA 4FNFA 5BR8Q 2PNHA 3EVQA 4K8IA 3FEWX 3QO2A 3OWFA 2EYMA 1T5XD 1TQOA 2F52A 2PZTA 4C3HB 3GTJB 4KN4C 1C8CA 3MEFA 1GKHA 3HG9A 4I65A 5BN5A 5C0XJ 1GUWA 4QB4A 2CH4W 4UP8A 4CKCA 2L1BA 1TS3A 2NZOA 3H15A 2JK8A 3ULLA 3OIPA 2B8FA 3L3OC 1MGSA 2NVYH 2PI2A 2IX1A 2HHHQ 1G6PA 4A3MG 1WD0A 4O2DA 2KA7A 4KJNA 2IX3A 4CDCC 4B3SQ 1QNUA 3PF4A 1N32L 4UAIA 3I72A 1B3AA 2EY5A 4JI2L 3FPPA 2ZM6L 2VQEQ 4JV5Q 4A3GB 2M2LA 4FP5D 2KHSA 1SN8A 2BA0A 2EPBA 3TP5A 4LF6L 3HOXG 1VQIA 1E2VA 1V43A 4BY7B 2NB0A 3M4OB 1DOKA 4A3FH 3ND8A 4U673 3K7AB 1KXLA 3RLNA 3F2BA 2E2JH 1K3RA 3OYYA 3HKSA 4DR1L 1SYFA 4EQ5A 4XYQA 3S14H 1E1TA 1D6EC 2BH2A 3PIPA 2EJMA 4RKLA 3QOLA 1SROA 5ELNA 5C3EB 3K5OA 2NVQH 4OX9Q 1UE7A 4POFA 4DXGA 1TKWB 4K5WA 4R4TA 2Z4IA 2ATWA 1KD1C 2I0QA 4BA1I 2JXMB 2K01A 5DM63 2CH4A 4PZ8A 3AU7A 2HCIA 3HEJA 3NTIA 3R3OA 2RDFA 3PIOA 3HGBA 3DLLA 3CPFA 3STBC 1VQ5A 3CMAA 4EGVA
chains in the Genus database with same CATH topology
2MGSA 1JWMD 5C3XA 3GTLB 3C2PA 5KNBA 1IYVA 4RCNA 2KJXA 2F0MA 4E6IA 1MI2A 1GUSA 4H13C 4FYDA 2O2LD 2L4NA 4S3SA 2MP1A 2PW5A 5FO8B 4RHRA 4GZYC 1RTOA 5FO9B 1LTID 2WIIB 1LTTD 5JVH3 5M3MB 2LMCB 1AW7A 2NVTB 4DU9A 1HPCA 1KLUD 1EY7A 2RSNA 4OIKA 2B8GA 2XSCA 1WTVA 5IODA 3CKIB 5C6AA 1BCPC 2E76C 3NQIA 3BVMA 1EWHA 3I4MB 2K5WA 1LTRD 3M7GA 4CKBA 2ICEC 1VF7A 1CHPD 2KEDA 2SNMA 5CGKA 1IHZA 4HSPA 2NVYB 3WDNA 3I73A 3KF8A 5DNFA 4UDUC 1ENAA 3GTQB 5ISRA 1SDFA 3CU7A 5FO7B 2F0DA 3J81L 2G9DA 4XTCS 2AUJD 2EXZA 1ZYRC 3DWQA 1JCKB 1F2YA 2F3VA 3T53B 1SJHD 3K58A 1EY6A 4KI0A 3GTOB 1G2SA 4DNTB 3R8BA 2CVRA 1L0XB 4FF3A 1STGA 2XRSD 2F3WA 2E75C 4RGOS 2KCNA 3IFTA 3BDCA 3NSWA 3P7JA 4MIUA 2H1EA 3VYRA 2HQEA 5CYUA 4MN3A 4RAUC 1JC7A 4XT3B 3EFXD 2RA4A 1PRTB 4KY5A 3OW7A 1BCPB 4IALA 4CBVA 3LX0A 2NUCA 5EPKA 3MFGA 1G6ZA 1ESRA 1KTKA 2JA6B 2A69D 4FXGC 1C4QA 3K59A 2RQXA 5C0XI 1EY8A 1H9RA 1EOTA 2DY8A 2JYOA 3SE0A 1U4PA 5C4JB 4C3HG 5I9OA 3DWAA 3MVVA 1O7YA 4XQNA 2B2WC 1UEAB 4QUCA 1A3VA 3EA6A 4RKBA 2XN9C 2TMPA 5D3DA 2PCFB 3K0YA 3L7ZC 4XQJA 2I46A 2G9HD 3KLSA 1GHKA 2B2YA 2SDFA 1EFID 1GUOA 1CZWA 4A3JB 1TVXA 1C48A 1Q1BA 2MUYA 2IW3A 1IYUA 1D5MC 2JEBI 3W3AA 1QOHA 3GP7A 1WTWA 1G8ZD 1NR4A 1I4XA 4RHSA 2F0GA 1EEFD 3WOEA 5JAVA 4RGMA 3SK8A 3C3LA 4WRDA 1TWHB 1U9RA 3GO5A 5I2XA 2PZUA 3J80E 1SNQA 2HDMA 5HURA 1O7LA 2WAQB 4PMBA 1X3QA 4K14A 1CM9A 1B9NA 1STNA 3S15B 1H9MA 2WINB 2B2YC 1CK1A 2E2IB 4BS9A 4EQPA 2X6LA 5CV7A 4BY1B 3NWSA 5A35A 4DAPA 1A2TA 4A93B 1EYAA 1G91A 5E4WC 4B9XA 3RMHA 2X69A 3DEOA 4BA2I 1SYGA 4F7XA 1S5DD 3O13A 2O5JC 2V4DA 3A8KE 3OOCA 2QKIC 4JBWA 3BS1A 1KNAA 1DZ1A 1Y8OB 3A7AB 3H0GB 4WJWA 4CJ1B 1Q90A 2Z1CA 1H9SA 1JOKA 2X6GA 4ABNA 5J39A 2EY2A 1KLGD 1BO0A 2VUMB 1K83B 1WTPA 2LKVA 1U4RA 1X32A 3X3MA 1LTGD 1SE4A 2EZVA 2FFKB 1HUNA 2ZT9C 4KN7C 2ZXOA 1QJOA 4KHVA 1SEBD 4KKSA 1B50A 3A56A 1ENFA 4RGNA 3MAQA 5IGFA 2EE1A 3QG1A 4KK7A 2Q8TA 2F0IA 2F4IA 3PUZA 3QJYA 2F0JA 2F0QA 3AB9A 1ILPA 3I8ZA 3LWUA 1TIID 1JOOA 1HTLD 3G6JB 2F0SA 1TWFB 4C2MB 1IW7D 5ELEA 2A68C 3NQTA 4N9TA 5ELFA 3E0JA 1II3A 1STEA 2JA5B 5EQ0A 4TQUS 3OIQA 4OO1H 2EY6A 2NVXB 3A7LA 3FDTA 1QB5D 2B2TC 1RCVD 1JE4A 1F9RA 1E2WA 4ILWA 1JR0D 4A3IB 1WD1A 3OWEB 1I6VC 3D4WA 3J7YW 3D6WA 2DY7A 3PV0A 2F0HA 3A55A 1ICWA 1ONLA 3NBHA 1JQYD 4Z9CB 1CFMA 2FHTA 4A3DB 5K36H 2RBMA 1XWEA 4DNRB 1TWAB 1TS4A 1SNPA 4OO1G 3VYSA 3OHXC 1IW7C 2F0EA 3PUWA 3RD4A 3MHBA 4C56C 3NXWA 5CV5A 4L8JA 4Q0FA 1KDBA 4RWSC 1PTOC 2BE5D 4DAVA 2IT1A 1D5XC 2R61A 3D31A 2F0OA 1E2ZA 3M85A 4Y7NB 2EDGA 4XDXA 1SXTA 4OHJA 5IGCA 1SBBB 2WP8J 2BDNA 3OSOA 3W2DA 1B2TA 3RZDB 2XVSA 5JPNC 3R2TA 4CHTB 1B4OA 3KBGA 3S1QB 2FINB 3S9WA 1FD7D 3NTKA 3SDZA 4H7BA 4P2CB 4DF7A 1VDZA 4CKEA 4ZUJA 4KTAA 3TDQA 1WVLA 1LT6D 2AQ3B 1F9QA 5CV6A 5EPLA 3TN2A 4G4KA 2Q8IB 2NTSA 1M8AA 3MWYW 1GXDC 3PIO3 3P1HA 4HEDA 1JB3A 1CTMA 2MJ8A 4WFN3 2KECA 1EL0A 2EJGC 5ELCA 3BYYB 2XNAC 3PUVA 2AUKA 2WKDA 3WOFA 4X3KA 3I4LA 4A3EB 3F2UA 3NP8A 3TP7A 4C3IB 1BUVT 2MPMA 3T56B 3M3YB 4F8MA 4QF4A 3VA7A 2A69C 4C3IG 3K5LA 2LY7A 3SXHA 3E6ZX 2Q8RE 5M9OA 3PO3B 2B2UA 5CV9A 5C5MA 2ZXPA 2SOBA 1BCPF 1D1KA 2OT2A 4CJ2C 2FMCA 2XWJB 5CV4A 1WTQA 1O7ZA 5JEAH 1CHQD 5D14A 3VR5A 3DUZA 1XX8A 1PTOB 2AWNA 2ICIA 1J9OA 5JOBA 2EYLA 1I4PA 3J7AV 1EIGA 3X3NA 1R4QB 5IGDA 4EQNA 1SJED 2R6GA 2MHVA 5LL6X 2AQ1B 3NUCA 1DXMA 1O78A 4HCEA 3U9SA 1SMYD 4KY6A 3A54A 1ILQA 4LMQD 1GUNA 5COYA 2L12A 1ESFA 3A8IE 1Q8IA 3DXJC 2WACA 2AQ2B 1AP0A 3GV6A 1CI3M 5M5WB 2PMZB 3VR6A 3KLSX 1I4HA 2RVLA 5IIFA 3P20A 4G7ZC 1PTOH 2EOTA 2B2VC 5KGUA 5ELDA 5CR3A 3GQBA 3SK4A 3TZDA 2CHBD 2E2HB 2HUGA 5JVG3 3VR2A 5I6YA 1BBXC 3S16B 1SAPA 4XQQA 1VCIA 4F87A 1FNUA 5EBCA 3VYTA 5EKLA 4LAAA 1OXVA 3FRPB 2F0UA 4L63B 3OMGA 1A3TA 5E3FA 5KNCA 2LS01 2OEOA 1RKNA 4KKUA 5C4ZA 5CMDA 3OPOA 5BN4A 2KCCA 3D3RA 3BDLA 5FLXL 1LLRD 1V1PB 4DXFA 3EROA 2K6AA 1ZYRD 5G3LF 5J22A 5D3IB 4C1NK 1F77A 1WTRA 4KMUC 2JA8B 4C1NI 3L9AX 3C1EA 5C44B 1UNSA 1H9KA 5KIXA 5JJZA 2EYOA 1KABA 3S17B 2M9VA 1PFNA 1FNVA 2J0TD 1BF4A 2EYFA 2F03A 2NWGA 3TZUA 4LK1C 4EQOA 3H94A 3EJIA 2QDBA 3K57A 1TWCB 5I6WA 1ZXTA 2NN6G 3S2HB 5JEAG 3V05A 3D4RA 2EY1A 3GTKB 1BOSA 4HSVA 2NN6H 2A6ED 1JWUD 3FKIB 1RF2D 2HCCA 4RA8A 4MHEA 3Q23A 4YIJA 4DFAA 1OXTA 4DK0A 4X3TA 3VR3A 1Q3LA 3HZXA 1JORA 1EZ6A 1LT3D 1D2BA 2PZWA 2ENBA 4IUUA 1Q1EA 1EU4A 5CORA 1XYIA 1PYWD 1VMPA 1F9PA 4TSSA 1I6HB 3CRKC 5DEHA 2IPKD 1R9TB 4F88A 2L11A 2J7ZA 1HQMC 2LFNA 4H44C 1EQTA 3HKZB 1SYDA 1AEXA 3ERQA 3V96A 2R7ZB 5EJWA 2B39A 1OXXK 4CJ0B 3SVMA 1EY4A 2CW0D 2Z4HA 1EEID 2NVQB 2BDOA 1AFPA 1A15A 1ML0D 4A3FB 1TS5A 4O42A 5LHY1 2E2JB 3C1FA 4HTHA 1QG7A 3PIP3 2SNSA 3D8GA 4X3SA 5M5YB 3HOVB 4A3KB 1SE3A 2YU9B 5IT9E 1EYDA 5CBEE 1SYBA 5JPMC 1E0BA 3JAME 2RDGA 4K8JA 1WCMB 1GUTA 5E1FA 3M7NA 1B44D 1ET9A 1ZKOA 2TSSA 3DMUA 2C9OA 4R9WA 1FYCA 1HRJA 3V2TA 2BCOA 1CQFA 1HCZA 1Z47A 2BE5C 3ITPA 3CRLC 1SNOA 3PMFA 5K5PA 1GUGA 3NTHA 5DAUA 1SNDA 5C0XH 3BZDB 4NP5A 1HFNA 1PTOD 2KQ3A 5CC4A 4EVOA 4OGQC 3S1MB 4IFDH 4KY7A 2DN8A 3J80L 1SE2A 4K6LA 3M4YA 3NBIA 2QF7A 2D62A 4HR7B 1Q12A 1ZEQX 3HOYB 2EVBA 1EY9A 1MD2D 4FXKC 3Q6SA 2WB1B 2K04A 4BBRB 2K03A 1STYA 4WORA 2D5DA 1I4GA 3MA2B 2D2CC 3HRZC 3NE5B 1NCVA 4DK1A 4RCOA 3ONAB 1R4PB 4IQZA 1CA6A 5AFWA 4QMGA 1OXUA 4FO2A 1J8IA 1ET6A 1JWSD 2EYPA 5C3WA 1RHPA 4O1NA 3SK5A 1KNEA 4V0BA 1G2TA 2EYHA 2NYZD 3MC0B 1I3QB 3GV3A 3I3CA 1TY2A 4PMCA 4PQXA 3HS0C 2A68D 5C4HA 4OIJA 2EJFC 1M4VA 3BVGA 3LWEA 3BYTB 4KJOA 3IFDA 4XXEA 1FNWA 1CT1D 3NPPA 5KRUA 1W6KA 1NSNS 5EGTA 5EKIA 2RKSA 1DOLA 4HCSA 5I4DA 2ID0A 4DAYA 1UAPA 2F0LA 2JE6I 1K8MA 1RD9D 4KD3A 1LACA 1YNJC 3D6CA 3CQZB 2VB3X 1DD2A 1EWCA 2Z8LA 4CGYB 1SFOB 4IUPA 3H6MA 1PMRA 3HP3A 5IT9L 4K5XA 3MEHA 3RLFA 1GJXA 4IFDJ 3MZ5A 5KEEA 1PDQA 2EYJA 5I2YA 4FF2A 1VF5C 5LL6S 1B1ZA 1TY0A 5K36G 4ZAIA 3S1NB 2PO4A 4IN3A 3GTGB 1KAAA 3R93A 1RTNA 4KD4A 3BG3A 4LJZC 5G3LD 1H9JA 3E5SA 3I90A 2WKCA 4J8QA 1W6JA 1T5EA 3N6RA 5F2DA 3GD7A 4ZUIA 1Y8PB 1KDCA 1EU3A 1XTCD 1F9SA 3Q22A 3D4DA 1TT2A 4U68A 3J81E 5C0XG 4ODGA 1F2ZA 1HUMA 3IL8A 2KUMA 1MSGA 1KDAA 3SK6A 1K8OA 5T1GA 2A73B 1I50B 4I7ZC 1U4MA 2RSOA 1A3UA 2F0KA 1AN8A 4V190 5ELBA 3DM1A 3SEBA 3I91A 1Z7TA 3IAYA 4IUTA 4ZQ3A 1PTOF 2DNEA 4B08A 1DONA 5C4XB 3HOZB 4ZYSA 3QWNA 1A6XA 1EY5A 2O4XA 1QNKA 1HQRD 2K32A 3MXUA 5I9PA 1Y69U 2K5DA 2XIWA 4B9WA 5M5XB 5D65A 4ZKCB 1S5BD 1B53A 3JAML 2JSOA 4C3JB 1HFGA 5FK9C 1O80A 4RH6A 4BBSB 2FJ2A 1EQVA 4FVMA 4IURA 5A2QE 3CHBD 1JICA 1SNCA 1HTPA 1PRTD 1D1IA 2PPBC 1L0YB 1NR2A 4M1UB 1FR3A 1MSHA 3I70A 1D5ZC 1B9MA 1LT4D 3HOUB 2BA1A 2IWHA 4K5VA 1SNMA 3KUPA 1OO9B 3DHQA 3H91A 2O5IC 2JEAI 2IX0A 1LT5D 1DYQA 2I07B 2FMMA 1PFBA 1V8QA 4FXDA 2QILA 4BWGB 5KYIA 1PRTC 5CV8A 4RGTA 1OXSC 3NHHA 4IUNA 1V1PA 1SYCA 2JP1A 4C3JG 1FGBD 1A2UA 1RODA 1STAA 1PZKD 3MXNA 1LTBD 2YYZA 1CA5A 1DCZA 3GTPB 1HXYD 2F0FA 4DN4M 1SSOA 1SYEA 1UUPA 4J6HA 2BOSA 5T1IA 4M8AA 1DOMA 1NAPA 1WTOA 5KNDA 1NUCA 5HGTA 2GA4B 1PFMA 3KLRA 3T13A 4HMJA 2CW0C 4FF4A 4G7OC 1H9SB 2L5TA 1YNND 3BVZA 2D9UA 1EZ8A 1TR5A 2K5QA 1LTAD 1Y1WB 5E4XA 4ZKBB 3PUYA 3A8JE 3ZYYX 2VB2X 2A6HC 3KBXA 2A5HA 2PQEA 3FPUB 3SR1A 3GTMB 4XIGS 1ENCA 2E74C 5IGGA 4R8NA 5CBAE 2L55A 4OL7A 2KEEA 1F2LA 4HAEA 4L6TB 1EY0A 5IGEA 2Y0SB 3R2IA 2ZXRA 3Q0AA 1AZQA 5TSSA 4NW2A 4QIWB 4Q5VA 5BN3A 2NZ1D 3T51B 2NTTA 2XRQD 1I4QA 2RDHA 2VXWA 3H09A 4ZRZA 2A6EC 2DNCA 4A3BB 3S14B 2F0WA 5M3FB 1S5ED 3AMUA 5IOCA 1STBA 2L0CA 5NUCA 5IGBA 5EBDA 1RJTA 1XXGA 3N52A 4PV1C 3PO2B 2A6HD 3MXPA 2J4XA 1Y1VB 1HHVA 1BQQT 2K7VA 2CQAA 2PYKA 1Y8NB 3FMCA 2F0VA 1LO5D 1QCBD 1U4LA 1BXTA 2F0TA 3P75A 1PZJD 3KK7A 3C46A 2B63B 2OF1A 1WTXA 3S2DB 2B2UC 3K6OA 3PUXA 5FLXE 4TRDA 1PLFA 2E2DC 4NMZA 1TWGB 1TS2A 1BNZA 4QUFA 3H3VC 2N55A 2NN6I 1V1OA 3J7AF 2K33A 2HDLA 3URYA 4KHZA 2IL8A 4PMWA 2K1BA 3T16A 1IL8A 4DGZA 1MBYA 3QOJA 4IFDI 3Q24A 2M00A 3UI2A 3FVQA 4AYBB 4HMIA 4X3UA 5JEAJ 4G7HC 2VNUD 3RZOB 1SMYC 3TP8A 4H0LC 2N88A 3TP6A 1JOQA 3ND9A 1AZPA 4KKTA 1PZID 4ME5A 2K28A 1QE6A 1EIHA 4NKLA 2AWOA 4R8IA 4HN7A 1HA5A 3K5NA 1PXUA 3I4NB 4XYOA 4K6DA 1IKLA 3MXGA 2A74C 4J1MA 1X3PA 3TBIB 2F0PA 5J1ZA 4K2KA 5FKAC 2R93B 3LNNA 2F0NA 1BDOA 1QWYA 3QB3A 4FF1A 3VA5A 3NWTA 2SEBD 1YNJD 3QIAA 2KOLA 1BR9A 4QCLA 1TU2B 4ID6A 1CZGA 5FOBB 4RFBA 3VR4A 3BDOA 1YNNC 3TMEA 2K05A 3TSSA 1CQVA 1RDPD 2WV6D 1BCPD 2B2WA 1S4ZA 4IZ8A 2B2VA 4ZK9B 3NK9A 5EKKA 4K2LA 2C5CA 1EYCA 4OO1I 4N9PA 3S1RB 1HA6A 1S5FD 4G57A 3OMCA 2OXPA 2NBFA 3IKJA 1S5CD 2R3ZA 3RUZA 4ZLTF 1F2MA 3MFYA 4DA2A 3MTSA 1IKMA 5A2QL 1VMCA 3DWPA 1LV9A 1G291 3VYUA 2H4OA 4IUQA 2QEJC 2QCPX 3DEPA 4IUVA 5DM73 2PNRC 3T4AC 4A3MB 1DM0B 1DJRD 2F1MA 1GOZA 4ULLA 4JK1C 4KV6A 3HOWB 4IFDG 1LTSD 2KVMA 4PNYA 1Z6HA 4TKOB 3EQLC 1GHJA 2R92B 1PRTF 1QILA 3K5MA 1I4RA 3G7LA 3HOXB 1LABA 2PW7A 2XWBB 4NDXA 5KYLA 2L9HA 1STHA 2IJ0A 5C5LA 3U9OA 4XT1B 2JA7B 3SHLA 2B2TA 5EPJA 4FNFA 3EVQA 4K8IA 3FEWX 3QO2A 3OWFA 2EYMA 1T5XD 1TQOA 4C3HB 2PZTA 3GTJB 4KN4C 1C8CA 3HG9A 4I65A 5BN5A 5C0XJ 1GUWA 4QB4A 4CKCA 2L1BA 1TS3A 3OIPA 2B8FA 3L3OC 1MGSA 2IX1A 1WD0A 2KA7A 4KJNA 2IX3A 1QNUA 4UAIA 3I72A 1B3AA 2EY5A 3FPPA 4A3GB 2M2LA 4FP5D 2KHSA 2EPBA 2BA0A 3TP5A 1E2VA 1V43A 4BY7B 2NB0A 3M4OB 1DOKA 3ND8A 4U673 3K7AB 1SYFA 4XYQA 1D6EC 2EJMA 4RKLA 3QOLA 5C3EB 3K5OA 4DXGA 1TKWB 4K5WA 2Z4IA 4BA1I 2JXMB 2K01A 5DM63 3AU7A 2HCIA 3HEJA 3NTIA 3R3OA 2RDFA 3HGBA 4EGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STG A;  2F3W A;  4NDX A;  2OF1 A;  5C3X A;  5IIF A;  4K8J A;  3BDC A;  1EZ8 A;  1EQV A;  1TR5 A;  3NP8 A;  3TP7 A;  1KAA A;  1SNP A;  2F0G A;  2LKV A;  4TRD A;  5KYL A;  5E1F A;  4NMZ A;  1STH A;  5C5L A;  3U9O A;  4MIU A;  5KGU A;  2F0M A;  4E6I A;  4QF4 A;  4ID6 A;  4F8M A;  4KD4 A;  4QMG A;  5JAV A;  5CR3 A;  4YIJ A;  3SHL A;  3SK4 A;  2HQE A;  4DFA A;  1SNC A;  3E5S A;  2F0E A;  3SK8 A;  4S3S A;  3EVQ A;  3HZX A;  4K8I A;  4WRD A;  1U9R A;  3SXH A;  3MHB A;  2EYM A;  3DMU A;  3OWF A;  3TME A;  2PZU A;  2EYP A;  5F2D A;  1TQO A;  5C3W A;  2PZT A;  1SNQ A;  2PQE A;  5M9O A;  1JOR A;  3NXW A;  2PW5 A;  5CV5 A;  5I6Y A;  3SK5 A;  4KHV A;  1EZ6 A;  4ZUI A;  3SR1 A;  5CV9 A;  5HUR A;  5C5M A;  1KDC A;  2PZW A;  2ENB A;  2EYH A;  1ENC A;  4I65 A;  3V2T A;  5IGG A;  4KY5 A;  2SOB A;  4IZ8 A;  4R8N A;  4IAL A;  4K5V A;  4QB4 A;  3T16 A;  1KDB A;  1SNM A;  4PMB A;  4DGZ A;  3LX0 A;  3QOJ A;  4PMC A;  5IGF A;  3D4D A;  3NK9 A;  4K14 A;  4OL7 A;  5EKK A;  1TT2 A;  5C4H A;  2F0I A;  5EKL A;  4K2L A;  4LAA A;  2NUC A;  1EYC A;  4ODG A;  3DHQ A;  2M00 A;  1F2Z A;  3ITP A;  2F0J A;  2F0Q A;  2F0U A;  1EY0 A;  4N9P A;  5IGE A;  5CV4 A;  1STN A;  4HMI A;  4KJO A;  4KJN A;  3P75 A;  1KDA A;  4DU9 A;  3SK6 A;  1EY7 A;  1SNO A;  2F0O A;  3PMF A;  5DEH A;  3OMG A;  4G57 A;  5K5P A;  3OMC A;  1A3T A;  1JOO A;  5E3F A;  3TP8 A;  2OEO A;  2OXP A;  5IOD A;  1RKN A;  2F0S A;  3TP6 A;  5C4Z A;  5C6A A;  4EQP A;  5KRU A;  1EY8 A;  5KYI A;  1JOQ A;  3RUZ A;  5DAU A;  2EY5 A;  1SND A;  1NSN S;  1F2M A;  5CV8 A;  5IGC A;  1A3U A;  2F0K A;  4NP5 A;  5CV7 A;  3OSO A;  3NQT A;  4N9T A;  5JOB A;  5EGT A;  2RKS A;  1II3 A;  1SYD A;  2EYL A;  2KHS A;  1AEX A;  3BDL A;  3ERQ A;  3NHH A;  4IUN A;  2KQ3 A;  4ME5 A;  3TP5 A;  1A2T A;  1SYC A;  5CC4 A;  5I9O A;  2F0W A;  4EVO A;  2RBM A;  1EYA A;  3MVV A;  3ERO A;  4NKL A;  5IOC A;  3S9W A;  1STB A;  5IGD A;  2SNM A;  2EY6 A;  1A2U A;  4EQN A;  2F0L A;  5CGK A;  5J22 A;  1STA A;  4KY7 A;  5NUC A;  4H7B A;  1IHZ A;  4B9X A;  5IGB A;  1EY4 A;  4DF7 A;  4ZUJ A;  3C1E A;  4KTA A;  4ZQ3 A;  1SYG A;  4K6D A;  4KD3 A;  1A3V A;  3D6C A;  3NUC A;  5KIX A;  4F7X A;  2EYO A;  2F0F A;  5CV6 A;  1SYF A;  1ENA A;  4J1M A;  4KY6 A;  1EY5 A;  1SYE A;  2O4X A;  4RKB A;  4KV6 A;  1KAB A;  5ISR A;  1EY9 A;  2F0P A;  5J1Z A;  4RKL A;  3QOL A;  4K2K A;  3H6M A;  3C1F A;  5I9P A;  2F0D A;  4HTH A;  4J6H A;  3D4W A;  2SNS A;  2EYF A;  2F0N A;  3D8G A;  3MEH A;  4K5X A;  4PNY A;  4B9W A;  3P1H A;  1STY A;  4WOR A;  2F0H A;  3MXP A;  2EXZ A;  4K5W A;  4EQO A;  3MZ5 A;  1F2Y A;  2WAC A;  5KEE A;  2EYJ A;  3EJI A;  2QDB A;  2F3V A;  3QB3 A;  1NUC A;  1EY6 A;  5HGT A;  5I6W A;  3HEJ A;  3R3O A;  2RDF A;  1EYD A;  3T13 A;  3VA5 A;  2PYK A;  4HMJ A;  1SYB A;  2EY1 A;  2F0V A;  1JOK A;  5J39 A;  2F0T A;  2PW7 A;  2EY2 A; 
#chains in the Genus database with same CATH topology
 2MGS A;  1JWM D;  5C3X A;  3BJU A;  3GTL B;  2CWP A;  3C2P A;  5KNB A;  1IYV A;  1YJ9 A;  4RCN A;  2KJX A;  2F0M A;  4E6I A;  1MI2 A;  4K0K L;  3RN2 A;  1GUS A;  4H13 C;  4FYD A;  2O2L D;  2L4N A;  4S3S A;  1J5E L;  2MP1 A;  1P16 A;  1HNX L;  3ER0 A;  2PW5 A;  5FO8 B;  1FVI A;  4RHR A;  2YTV A;  4LW1 A;  4GZY C;  1RTO A;  5FO9 B;  1LTI D;  2WII B;  3A5U A;  4A3C H;  1LTT D;  4A3J G;  5JVH 3;  5GRO A;  5M3M B;  2LMC B;  5FLM H;  4OON A;  1AW7 A;  4L5T A;  4P74 A;  3F1Z A;  1JE5 A;  2NVT B;  4GN3 B;  4DU9 A;  1HPC A;  1KLU D;  1EY7 A;  2RSN A;  4OIK A;  2G5D A;  2B8G A;  2XSC A;  1GO3 E;  1WTV A;  5IOD A;  3CKI B;  5C6A A;  1BCP C;  2RCN A;  3E9I A;  2E76 C;  3NQI A;  1X54 A;  3BVM A;  1EWH A;  1WI5 A;  3I4M B;  1I94 L;  2K5W A;  1LTR D;  2VW9 A;  3M7G A;  4CKB A;  3D0F A;  2ICE C;  1CKN A;  1EWI A;  1VF7 A;  1CHP D;  2KED A;  2SNM A;  5CGK A;  4A3I G;  1BVS A;  1J6Q A;  1IHZ A;  4HSP A;  2NVY B;  4DV3 Q;  3WDN A;  1XJV A;  1WYD A;  3I73 A;  2NZH A;  3KF8 A;  5DNF A;  4UDU C;  1ENA A;  4A4I A;  3GTQ B;  2E2H H;  3M4Q A;  5ISR A;  4DV1 Q;  1SDF A;  3CU7 A;  3HKZ E;  5FO7 B;  2F0D A;  3J81 L;  2G9D A;  4JBJ A;  2AUJ D;  4XTC S;  2EXZ A;  1ZYR C;  3DWQ A;  1JCK B;  1F2Y A;  2N8N A;  1IBL Q;  2F3V A;  3T53 B;  1SJH D;  3K58 A;  1EY6 A;  4KI0 A;  5LMN L;  3GTO B;  1G2S A;  1JJ2 A;  4DNT B;  1VQA A;  3R8B A;  4IOA A;  1VQG A;  2CVR A;  1L0X B;  4FF3 A;  1STG A;  2XRS D;  2F3W A;  2E75 C;  4RGO S;  2KCN A;  3IFT A;  3BDC A;  3NSW A;  4YY3 Q;  1PH8 A;  4MNO A;  1Y1W G;  3P7J A;  4MIU A;  2H1E A;  3J81 c;  2YU9 H;  3RZO H;  3VYR A;  2HQE A;  5CYU A;  4MN3 A;  4RAU C;  3PQI A;  4JI3 Q;  1XMQ Q;  1JC7 A;  4YWK A;  1HNZ Q;  3PO2 H;  4XT3 B;  3EFX D;  3TS0 A;  1JJC B;  1PH1 A;  4A3L H;  2RA4 A;  1PRT B;  4KY5 A;  3OW7 A;  1BCP B;  4IAL A;  4CBV A;  4LFA Q;  3LX0 A;  2NUC A;  4DR4 L;  4LUO A;  3KJO A;  2A1A A;  2VUM H;  5EPK A;  3MFG A;  1G6Z A;  4N8F A;  1ESR A;  4A3B H;  1KTK A;  2JA6 B;  4A3G G;  2A69 D;  1EYG A;  1HNZ L;  4FXG C;  1C4Q A;  4DR5 L;  3K59 A;  3UE0 A;  2RQX A;  1IXR A;  4DV0 L;  4AYB G;  4LF9 L;  4JVZ A;  5C0X I;  1EY8 A;  1H9R A;  1E7Z A;  1EOT A;  3M9B A;  3Q8D A;  1MJC A;  4GKJ L;  2E5L L;  2DY8 A;  4GOP C;  2JYO A;  3SE0 A;  1U4P A;  5C4J B;  1L1O A;  3ZJY C;  4JBK A;  4C3H G;  3A74 A;  5I9O A;  3DWA A;  3MVV A;  1O7Y A;  3F8T A;  4XQN A;  2AKW B;  2IHE A;  2B2W C;  1UEA B;  1HH2 P;  4DV5 Q;  4QUC A;  1KL9 A;  1A3V A;  3EA6 A;  4RKB A;  5AJ3 L;  2XN9 C;  2TMP A;  2MO1 A;  5D3D A;  2PCF B;  4HJ5 A;  3K0Y A;  1WCM H;  1NE3 A;  3L7Z C;  4XQJ A;  1YEZ A;  4GKK L;  1XPU A;  2I46 A;  2G9H D;  3KLS A;  1VQ6 A;  1GHK A;  2B2Y A;  2UU9 Q;  2SDF A;  1EQQ A;  1EFI D;  4AH6 A;  1GUO A;  1CZW A;  4A3J B;  1TVX A;  1C48 A;  4NXM Q;  1Q1B A;  4K0K Q;  1A63 A;  2MUY A;  1GM5 A;  2IW3 A;  1IYU A;  1D5M C;  2JEB I;  3W3A A;  1QZH A;  1JT8 A;  1QOH A;  4A93 G;  1EIF A;  4DR3 L;  1UWV A;  4DV0 Q;  3GP7 A;  4JI6 L;  1WTW A;  1G8Z D;  2EQS A;  1NR4 A;  1I4X A;  1X3F A;  4RHS A;  2F0G A;  5IYB H;  1EEF D;  3I7F A;  3VDY A;  3WOE A;  2Q2H A;  5JAV A;  4GOP A;  4RGM A;  3SK8 A;  3C3L A;  4WRD A;  1TWH B;  1U9R A;  3GO5 A;  4IO9 A;  5I2X A;  2PZU A;  3WWV A;  4DR3 Q;  3J80 E;  1SNQ A;  4YHH Q;  2HDM A;  3KF6 A;  5HUR A;  2Z6B A;  2K50 A;  4LUV A;  3KDF B;  1O7L A;  2WAQ B;  4PMB A;  1X3Q A;  4UY8 C;  2K14 A;  4K14 A;  2UUA L;  4DV7 L;  1OTC A;  1CM9 A;  1I94 Q;  1B9N A;  4DV4 L;  1STN A;  1Q86 C;  4N8X 1;  3S15 B;  1H9M A;  2N78 A;  3T1H Q;  2WIN B;  2B2Y C;  1CK1 A;  4JBM A;  2E2I B;  3KF8 B;  4BS9 A;  3E9H A;  4EQP A;  2MFI A;  4P73 A;  4A3J H;  1UE6 A;  2X6L A;  3KOJ A;  5CV7 A;  1VQ8 A;  4BY1 B;  3NWS A;  5A35 A;  1YHB A;  2CCZ A;  4DR6 L;  4JI3 L;  4DAP A;  1A2T A;  2H5X A;  4A93 B;  1N33 Q;  1EYA A;  1G91 A;  2PQA B;  3I4M G;  2DUD A;  1VQH A;  5E4W C;  4B9X A;  4QGU A;  1X3E A;  3RMH A;  2X69 A;  3DEO A;  4BA2 I;  3HOY H;  1SYG A;  1X65 A;  4F7X A;  1S5D D;  3AYH B;  4GLX A;  4DR6 Q;  3O13 A;  2O5J C;  2V4D A;  3A8K E;  3OOC A;  2QKI C;  4JBW A;  3BS1 A;  1KNA A;  4GNX A;  1DZ1 A;  3S24 A;  2HQL A;  1Y8O B;  3U4V A;  3A7A B;  4DV7 Q;  3I2Z A;  3H0G B;  4WJW A;  4CJ1 B;  1YZ6 A;  1Q90 A;  2Z1C A;  1N9W A;  1H9S A;  5IYC G;  1JOK A;  2X6G A;  1KRT A;  4ABN A;  5J39 A;  1S3O A;  4LWC A;  4APV A;  5M5X H;  2EY2 A;  1X56 A;  1KLG D;  5M5Y H;  1BO0 A;  1E1O A;  1S40 A;  4LF6 Q;  2VUM B;  1K83 B;  1WTP A;  2LKV A;  5L37 A;  4L5S A;  1O7I A;  1U4R A;  1X32 A;  3X3M A;  1IBL L;  1LTG D;  1SE4 A;  2EZV A;  2FFK B;  1HUN A;  2ZT9 C;  1N34 L;  4MZ9 A;  1N33 L;  4KN7 C;  2ZXO A;  5IY0 A;  3RLO A;  4X65 Q;  1QJO A;  1SLJ A;  4KHV A;  1SEB D;  4KKS A;  1B50 A;  3A56 A;  1ENF A;  3I4N G;  3CCS A;  1N8R C;  4OWT B;  4RGN A;  3MAQ A;  5IGF A;  1KIX A;  2EE1 A;  3QG1 A;  4KK7 A;  2Q8T A;  2F0I A;  2F4I A;  3AFP A;  3QJY A;  3PUZ A;  4LF7 L;  4NXM L;  1PVO A;  2F0J A;  2F0Q A;  1CSQ A;  2RHQ B;  2JA7 H;  3AB9 A;  1ILP A;  3I8Z A;  1EQR A;  3HOW G;  3JAM c;  3BZK A;  3LWU A;  1TII D;  1JOO A;  3B6Y A;  2Y0S G;  1HTL D;  3G6J B;  2F0S A;  3RR5 A;  1TWF B;  4X6A H;  4C2M B;  1IW7 D;  5ELE A;  5LMU L;  2QA4 A;  4LF8 Q;  4JI7 Q;  4ALP A;  3TRZ A;  2A68 C;  2UUC Q;  3NQT A;  4N9T A;  4JI4 Q;  5ELF A;  3E0J A;  1II3 A;  5AJ3 Q;  1STE A;  2JA5 B;  4GNX B;  5EQ0 A;  2KCT A;  4ME3 A;  4QIW E;  4TQU S;  2FXQ A;  3OIQ A;  4DPG A;  4OO1 H;  2EY6 A;  2NVX B;  3A7L A;  2HT1 A;  1RIP A;  4O0A A;  3FDT A;  1QB5 D;  2B2T C;  1RCV D;  1JE4 A;  4WJ3 M;  1F9R A;  1I3Q H;  1E2W A;  4ILW A;  1NMF A;  1JR0 D;  4A3I B;  3GTM H;  1WD1 A;  2IY5 B;  2I5H A;  3OWE B;  2K5N A;  1I6V C;  3D4W A;  3J7Y W;  1VQ4 A;  3D6W A;  1C7Y A;  2DY7 A;  3PV0 A;  2F0H A;  4HJ9 A;  3A55 A;  1ICW A;  1ONL A;  3NBH A;  3UDG A;  1XNQ L;  1JQY D;  4Z9C B;  4JI8 Q;  1CFM A;  3KDF A;  3NEL A;  1TWC H;  2OQ0 A;  2FHT A;  4A3D B;  3RNU A;  3CCV A;  5K36 H;  2RBM A;  1XWE A;  1HNX Q;  4DNR B;  1TWA B;  4DAM A;  5M5W H;  1TS4 A;  4JI1 Q;  2Y0S E;  1SNP A;  2JA7 G;  4OO1 G;  3JAM i;  2D0P A;  3VYS A;  1L1O C;  2WB1 E;  1K8A C;  2OWO A;  3OHX C;  1IW7 C;  2F0E A;  1VQ9 A;  3PUW A;  3RD4 A;  3MHB A;  5GAE C;  2KEN A;  4C56 C;  1SFO H;  3EBE A;  3NXW A;  5CV5 A;  4L8J A;  4Q0F A;  3JC6 6;  4JW0 A;  2UXB L;  1HZC A;  1B8A A;  1KDB A;  4RWS C;  1PTO C;  2BE5 D;  3CCJ A;  1QVC A;  3TEH B;  2B29 A;  3PGZ A;  4DAV A;  2IT1 A;  1D5X C;  2R61 A;  3D31 A;  2KCM A;  3BU2 A;  2F0O A;  1E2Z A;  2R7Z H;  1YBY A;  3M85 A;  3FKI H;  5HGQ A;  1P8L A;  4JI0 L;  1Q7Y C;  4Y7N B;  1UEB A;  3S2H H;  1M90 C;  2EDG A;  4XDX A;  3RZD H;  1SXT A;  4OHJ A;  5IGC A;  3GTK H;  1SBB B;  2WP8 J;  1YNX A;  2JA8 G;  2RF4 A;  2BDN A;  3OSO A;  3W2D A;  1B2T A;  3RZD B;  4BBS G;  2XVS A;  5JPN C;  3R2T A;  4CHT B;  3PCO B;  1B4O A;  2OCE A;  3KBG A;  3S1Q B;  2FIN B;  3S9W A;  1FD7 D;  3NTK A;  2N49 A;  3SDZ A;  1XPO A;  1PH4 A;  4ZCK A;  4H7B A;  4HIK A;  4P2C B;  1HZ9 A;  4DF7 A;  1VDZ A;  4CKE A;  4ZUJ A;  4KTA A;  1CKO A;  3CC4 A;  3TDQ A;  1WVL A;  4LFA L;  3K7A H;  1LT6 D;  1HZA A;  4PZ6 A;  2AQ3 B;  1F9Q A;  5CV6 A;  5EPL A;  3TN2 A;  4G4K A;  2Q8I B;  1VQM A;  2NTS A;  2KBN A;  1AE3 A;  1M8A A;  4BXX G;  3A5Z B;  3MWY W;  1GXD C;  2UXB Q;  3PIO 3;  4A3D G;  3P1H A;  1QZG A;  3IRB A;  4HED A;  1JB3 A;  1CTM A;  2MJ8 A;  1BBU A;  4R4Q A;  4PZ7 A;  2KEC A;  4WFN 3;  4DK6 C;  1EL0 A;  2EJG C;  5ELC A;  3BYY B;  4LF8 L;  2XNA C;  4I7A A;  3PUV A;  2E2I H;  4DR7 Q;  2AUK A;  1QVG A;  1R9T H;  4Y52 H;  4BY1 H;  4DR2 Q;  2WKD A;  4JI4 L;  3WOF A;  4CDD C;  1EFW A;  4HJ8 A;  3CW2 C;  4X3K A;  3I4L A;  4A3E B;  2EXD A;  5IT9 c;  4GNX C;  3F2U A;  3NP8 A;  3TP7 A;  4C3I B;  1YHQ A;  4P72 A;  1BUV T;  2MPM A;  3T56 B;  1C9O A;  3M3Y B;  3L0O A;  4F8M A;  4QF4 A;  3VA7 A;  2A69 C;  4NB3 A;  4C3I G;  1VQ7 A;  2QW7 A;  3K5L A;  2ZJQ A;  4OWW B;  1MJE A;  2LY7 A;  1LYL A;  3SXH A;  3E6Z X;  2Q8R E;  3K0X A;  5M9O A;  4DR5 Q;  3H3V I;  1MKH A;  3PO3 B;  2B2U A;  3S1Q H;  5CV9 A;  5C5M A;  1WFQ A;  2LXJ A;  2ZXP A;  5IYD H;  2SOB A;  1BCP F;  1FGU A;  1D1K A;  2OT2 A;  5GAG C;  2L15 A;  1VQD A;  4CJ2 C;  3CCU A;  1CKN B;  2FMC A;  2XWJ B;  4MTN A;  5CV4 A;  1WTQ A;  5IYB G;  1O7Z A;  2DJF C;  2ZTD A;  5JEA H;  1XMO L;  1CHQ D;  2JA6 G;  4X65 L;  5D14 A;  1VQE A;  3VR5 A;  4GN5 A;  3DUZ A;  2B63 H;  1XX8 A;  4X64 L;  4DV6 L;  1PTO B;  2AWN A;  2ICI A;  1J9O A;  5FLX c;  1IYJ B;  5JOB A;  2QEX A;  2EYL A;  1I4P A;  1PH7 A;  1K28 A;  3J7A V;  1EIG A;  2LSS A;  3HOW H;  4B3S L;  3X3N A;  1R4Q B;  5IGD A;  4EQN A;  1SJE D;  2R6G A;  2MHV A;  4BBR H;  5LL6 X;  2AQ1 B;  3NUC A;  1DXM A;  1N34 Q;  3K7U C;  1O78 A;  4HCE A;  3U9S A;  1SMY D;  4KY6 A;  3STB D;  4JI5 L;  5H1S E;  3CF5 A;  2Q2U A;  4A93 H;  3A54 A;  1ILQ A;  4LMQ D;  1GUN A;  5COY A;  2L12 A;  1ESF A;  3A8I E;  3G4S A;  1Q8I A;  1IBM Q;  3DXJ C;  2WAC A;  2AQ2 B;  4DV5 L;  3CD6 A;  1AP0 A;  3GV6 A;  1CI3 M;  5M5W B;  2PMZ B;  1LUZ A;  3VR6 A;  3KLS X;  1I4H A;  2RVL A;  1QUQ A;  1PH9 A;  5IIF A;  3P20 A;  4UP9 A;  4G7Z C;  1PTO H;  2EOT A;  4OEL B;  3AQQ A;  2B2V C;  5KGU A;  5ELD A;  5CR3 A;  3GQB A;  3SK4 A;  4FDB A;  3TZD A;  2CHB D;  2GN5 A;  2E2H B;  2HUG A;  4DV4 Q;  3FHW A;  5JVG 3;  2I5M X;  5IE8 A;  1HJP A;  4JI6 Q;  3VR2 A;  5I6Y A;  1BBX C;  4AQY L;  3S16 B;  2JQO A;  4DKA C;  1SAP A;  4JG2 A;  4XQQ A;  1VCI A;  4F87 A;  1FNU A;  5EBC A;  3VYT A;  5EKL A;  4LAA A;  1OXV A;  2P5Z X;  3E0E A;  3I4O A;  4A3G H;  3FRP B;  2F0U A;  1Y1W H;  2VUM G;  5JJI A;  1EUJ A;  4L63 B;  3OMG A;  1A3T A;  2PI2 E;  5E3F A;  2UUB L;  5KNC A;  3M3Y H;  2LS0 1;  2OEO A;  1RKN A;  4KKU A;  5C4Z A;  2YV5 A;  5CMD A;  2MO0 A;  2NVT H;  3OPO A;  5BN4 A;  2KCC A;  2RHS B;  3D3R A;  2UXC L;  2D0O A;  3BDL A;  5FLX L;  1LLR D;  1V1P B;  1K0S A;  4DXF A;  3ERO A;  2K6A A;  3DM3 A;  2YTY A;  4JI1 L;  1ZYR D;  5G3L F;  5C44 G;  5J22 A;  5D3I B;  1PA6 A;  4IPG A;  2JA9 A;  3HOV H;  4C1N K;  1F77 A;  1WTR A;  4KMU C;  2F4V L;  2JA8 B;  3KJP A;  4C1N I;  3L9A X;  3C1E A;  5C44 B;  5C4X G;  1UNS A;  1BBW A;  4CDE C;  1H9K A;  5KIX A;  5JJZ A;  2EYO A;  4DV2 Q;  1KAB A;  1Y14 B;  3S17 B;  2M9V A;  1PFN A;  1FNV A;  2J0T D;  1BF4 A;  2EYF A;  2NWG A;  2F03 A;  4R1J A;  3TZU A;  4YCV A;  4IPC A;  4LK1 C;  4GOP B;  4EQO A;  3H94 A;  3EJI A;  2QDB A;  1FJG L;  3K57 A;  3J81 i;  1TWC B;  2B63 G;  5I6W A;  1ZXT A;  1Q81 C;  2NN6 G;  3S2H B;  5JEA G;  3V05 A;  3D4R A;  2EY1 A;  3HOV G;  3GTK B;  1BOS A;  4HSV A;  5E7N A;  2NN6 H;  2A6E D;  1XNR L;  1JWU D;  3CC7 A;  1TWF H;  1G51 A;  3FKI B;  1RF2 D;  4Y7N H;  2HCC A;  1IBK L;  4RA8 A;  3ERS X;  4MHE A;  3Q23 A;  1UE5 A;  4YIJ A;  4DFA A;  3PO3 H;  1OXT A;  4DK0 A;  4X3T A;  3VR3 A;  4B3M L;  1Q3L A;  3HZX A;  3J7Z C;  3M4O H;  2NVX H;  1JOR A;  1HNW L;  3UE1 A;  1EZ6 A;  1LT3 D;  1D2B A;  2PZW A;  2ENB A;  4IUU A;  1Q1E A;  1B70 B;  1EU4 A;  5COR A;  4A76 A;  1XYI A;  1K0R A;  1PYW D;  4DV2 L;  1VMP A;  3CXC A;  1CSP A;  1SR3 A;  1XMQ L;  1F9P A;  4TSS A;  3QR8 A;  1I6H B;  4BY1 G;  3CRK C;  5FLM G;  5DEH A;  2IPK D;  1R9T B;  1K8G A;  4JYA Q;  1VQN A;  4F88 A;  2L11 A;  2K52 A;  2J7Z A;  1HQM C;  2LFN A;  4H44 C;  4LFC Q;  4A3D H;  1EQT A;  3MXN B;  3HKZ B;  1PHJ A;  3S1R H;  3K81 C;  1SYD A;  1AEX A;  3ERQ A;  3V96 A;  1KAW A;  2R7Z B;  5EJW A;  1VQB A;  2B39 A;  2WAQ E;  1OXX K;  4CJ0 B;  3SVM A;  1EY4 A;  2CW0 D;  2Z4H A;  1EEI D;  2NVQ B;  2BDO A;  4JI7 L;  1YVC A;  2K5V A;  1AFP A;  1A15 A;  1ML0 D;  4A3F B;  2ZM6 Q;  1X6O A;  1TS5 A;  4O42 A;  1NY4 A;  5LHY 1;  1UE1 A;  4P71 A;  2E2J B;  3C1F A;  4HTH A;  1QG7 A;  3PIP 3;  2ASB A;  2SNS A;  4JPB W;  2JA5 H;  3D8G A;  2JA8 H;  5LMN W;  4X3S A;  2Q2I A;  5M5Y B;  3HOV B;  1L0W A;  3T1H L;  3LGJ A;  1L1O B;  4JC0 A;  4A3K B;  3ULJ A;  1SE3 A;  2YU9 B;  3SGI A;  1GD7 A;  5IT9 E;  3E3X A;  3H0G H;  4DR1 Q;  1EYD A;  2R7Z G;  4BBR G;  5CBE E;  1SYB A;  5JPM C;  2WB1 G;  3UDI A;  1E0B A;  3JAM E;  2RDG A;  1A62 A;  4K8J A;  1VQF A;  1WCM B;  4IPH A;  4A3F G;  1GUT A;  5E1F A;  4DNI A;  2ZTE A;  4LFC L;  2R93 H;  3M7N A;  3W5O A;  4LF5 L;  3S15 H;  4JV5 L;  1TXY A;  1B44 D;  3J81 j;  1ET9 A;  2A19 A;  1ZKO A;  1N36 Q;  4QQB X;  2TSS A;  3HOU G;  3DMU A;  2R7D A;  2C9O A;  1C0A A;  4DV1 L;  4R9W A;  1FYC A;  1KQS A;  1Q8K A;  1HRJ A;  3V2T A;  2BCO A;  2OQK A;  1CQF A;  1E24 A;  1HCZ A;  1Z47 A;  1TWA H;  3K80 C;  4LF5 Q;  2BE5 C;  2XGT A;  4X62 L;  3ITP A;  3CRL C;  1SNO A;  3PMF A;  4YWL A;  5K5P A;  4LUZ A;  1GUG A;  4HJA A;  1YI2 A;  1XNQ Q;  3KFU A;  3NTH A;  2ALY B;  5DAU A;  1SND A;  3OTO Q;  5C0X H;  1IBK Q;  3BZD B;  4NP5 A;  1HFN A;  3ICE A;  2Q2T A;  5BR8 L;  2OTL A;  1PTO D;  2KQ3 A;  4BY7 G;  5CC4 A;  4EVO A;  4OGQ C;  4HIO A;  3S1M B;  2R92 H;  4UHV A;  4IFD H;  4KY7 A;  5IYD G;  1YIT A;  3TS2 A;  2DN8 A;  3J80 L;  1VQK A;  1SE2 A;  1FJG Q;  4K6L A;  3M4Y A;  3NBI A;  2QF7 A;  4DUZ L;  2D62 A;  2Z6K A;  4HR7 B;  1Q12 A;  1ZEQ X;  3HOY B;  3CC2 A;  2EVB A;  1EY9 A;  1MD2 D;  4FXK C;  2VL6 A;  2C35 B;  4C3I H;  3Q6S A;  2WB1 B;  2K04 A;  2LXK A;  4BBR B;  2K03 A;  1STY A;  4WOR A;  2D5D A;  1I4G A;  3MA2 B;  2D2C C;  2GVA A;  1LM0 A;  3HRZ C;  3NE5 B;  3H3V H;  4IJL A;  1LTL A;  2JJQ A;  3NEN A;  1VQP A;  4TVA B;  1ASZ A;  1NCV A;  1H95 A;  4JI0 Q;  4DK1 A;  4RCO A;  3ONA B;  1R4P B;  3OW2 A;  3AEV A;  4IQZ A;  3M4P A;  1CA6 A;  1VS0 A;  1L2F A;  5AFW A;  1XTD A;  4QMG A;  1OXU A;  3K8A A;  1K73 C;  4FO2 A;  2ZTC A;  1J8I A;  1FL0 A;  1ET6 A;  1QUQ B;  1JWS D;  2EYP A;  2CWA A;  1RHP A;  5C3W A;  4B3R L;  4O1N A;  3SK5 A;  1KNE A;  4V0B A;  1HR0 W;  1G2T A;  2EYH A;  2NYZ D;  2E8G A;  3MC0 B;  1I3Q B;  1SRU A;  3GV3 A;  3I3C A;  1U5K A;  1TY2 A;  1K3B C;  4PMC A;  4PQX A;  3NBH B;  3J80 i;  1K83 H;  3U58 A;  3HS0 C;  4DUZ Q;  2A68 D;  3W1G A;  5C4H A;  5HY6 A;  1WOC A;  4X66 Q;  4OEM B;  4OIJ A;  2EJF C;  1M4V A;  4KLK A;  3BVG A;  3LWE A;  3BYT B;  4KJO A;  5IYC H;  3IFD A;  4IPD A;  4XXE A;  1FNW A;  3TQY A;  4RMF A;  3HOX H;  4H02 A;  1W3S A;  1CT1 D;  3NPP A;  5KRU A;  1XPR A;  1W6K A;  1WTH A;  4EX5 A;  1NSN S;  4JCV E;  5M3M H;  1JB7 A;  5EGT A;  5EKI A;  2RKS A;  1DOL A;  4QY7 A;  4HCS A;  2XTI A;  5I4D A;  1X9N A;  2ID0 A;  4DAY A;  4GKK Q;  4YY3 L;  1UAP A;  1YHA A;  4LF9 Q;  3HOY G;  2F0L A;  2UU9 L;  5ELO A;  2JE6 I;  1K8M A;  1RD9 D;  2WFW A;  4KD3 A;  1JJG A;  1LAC A;  1YNJ C;  3D6C A;  3CQZ B;  2VB3 X;  1DD2 A;  2KHJ A;  1EWC A;  1PFS A;  2Z8L A;  4CGY B;  1SFO B;  1HR0 Q;  4IUP A;  3I56 A;  2UXD L;  3H6M A;  3GTL H;  1PMR A;  1VQO A;  3HP3 A;  5IT9 L;  3S2D H;  4K5X A;  3MEH A;  3G71 A;  3RLF A;  1GJX A;  4IFD J;  3MZ5 A;  5KEE A;  1PDQ A;  2EYJ A;  5I2Y A;  4DR4 Q;  2R92 G;  4FF2 A;  1VF5 C;  2QDL A;  5LL6 S;  1B1Z A;  1TY0 A;  5K36 G;  5C4J H;  1I50 H;  1J5E Q;  1PV4 A;  1Q46 A;  4ZAI A;  3S1N B;  4YCU A;  2PO4 A;  4IN3 A;  1V1Q A;  3GTG B;  4YWM A;  1KAA A;  5EAY A;  3F2C A;  3R93 A;  1RTN A;  1PH6 A;  2Z0S A;  4KD4 A;  3BG3 A;  5IP9 G;  4LJZ C;  2VZA A;  4IJH A;  5G3L D;  1H9J A;  4X62 Q;  3E5S A;  3I90 A;  2WKC A;  4J8Q A;  1W6J A;  1T5E A;  3N6R A;  1Z9F A;  5IP7 G;  5F2D A;  3AFQ A;  3J80 c;  1ASY A;  3GD7 A;  1SE8 A;  4ZUI A;  4BY7 H;  1Y8P B;  1KDC A;  1EU3 A;  2B3G A;  1XTC D;  4YCW A;  1F9S A;  4WJ4 A;  3Q22 A;  3D4D A;  1TT2 A;  4U68 A;  3J81 E;  5C0X G;  4ODG A;  4B3T L;  1F2Z A;  1HUM A;  3IL8 A;  2KUM A;  1MSG A;  1KDA A;  3SK6 A;  1K8O A;  5T1G A;  2A73 B;  5JJL A;  1I50 B;  4I7Z C;  1U4M A;  2RSO A;  3CCM A;  4HJ7 A;  3RN5 A;  1VQC A;  3CP0 A;  1A3U A;  5FJ8 H;  2F0K A;  4LFB L;  4QJF A;  3KLW A;  1AN8 A;  4JOI A;  3CCQ A;  4R4I A;  4DUY Q;  4V19 0;  5ELB A;  3CCR A;  1PH3 A;  3DM1 A;  3KYH C;  3SEB A;  3CCL A;  3HFZ B;  3I91 A;  3HKZ G;  3HOU H;  3I4N H;  4AYB E;  1Z7T A;  3IAY A;  4IUT A;  4ZQ3 A;  1PTO F;  2DNE A;  4B08 A;  1DON A;  2K4K A;  5C4X B;  3HOZ B;  1N36 L;  5GAD C;  1EIY B;  4ZYS A;  3QWN A;  2R93 G;  4DR7 L;  1A6X A;  4LF7 Q;  1EY5 A;  2O4X A;  4C3H H;  1QNK A;  1HQR D;  4OWX B;  1M1K C;  2K32 A;  3MXU A;  1TWH H;  5I9P A;  1Y69 U;  2K5D A;  2XIW A;  4B9W A;  5M5X B;  5D65 A;  4ZKC B;  1S5B D;  1B53 A;  2V1C C;  2JSO A;  3JAM L;  3H0G G;  1D7Q A;  4B3T Q;  3J7A 5;  1NNX A;  4C3J B;  2E5L Q;  2OTJ A;  1HFG A;  4GLV B;  4A3B G;  2VS1 A;  3I4M H;  2MNA A;  2JA5 G;  3UDX A;  5FK9 C;  1O80 A;  4RH6 A;  4BBS B;  4C2M H;  4A3K H;  2FJ2 A;  4P75 A;  1EQV A;  4FVM A;  4IUR A;  1IZ6 A;  1WJJ A;  5A2Q E;  3CHB D;  1A0I A;  1JIC A;  1SNC A;  1HTP A;  1PRT D;  1D1I A;  2PPB C;  1KHI A;  1L0Y B;  1NR2 A;  1JMC A;  1NTG A;  1PH2 A;  4L5R C;  4M1U B;  1FR3 A;  1MSH A;  3I70 A;  1D5Z C;  1B9M A;  1LT4 D;  2BA1 A;  3HOU B;  4OX9 L;  2IWH A;  4K5V A;  1PYS B;  1SNM A;  1Y1V G;  1IBM L;  4JI2 Q;  3KUP A;  2A8V A;  1OO9 B;  4GKJ Q;  3DHQ A;  3H91 A;  2O5I C;  2JEA I;  1X55 A;  2IX0 A;  1LT5 D;  1DYQ A;  1KRS A;  2I07 B;  2FMM A;  2AMC B;  1PFB A;  4DK3 C;  3G6E A;  1V8Q A;  4FXD A;  2QIL A;  4BWG B;  5KYI A;  1PRT C;  3PSI A;  1PH5 A;  5CV8 A;  4RGT A;  1OXS C;  2VQF L;  3NHH A;  2ES2 A;  4IUN A;  1V1P A;  1SYC A;  2JP1 A;  4GS3 A;  4C3J G;  4JYA L;  1FGB D;  3CCE A;  2HIV A;  1A2U A;  1GVP A;  1ROD A;  1STA A;  1PZK D;  3MXN A;  1LTB D;  3FP9 A;  2YYZ A;  4A3I H;  1CA5 A;  1DCZ A;  3PO3 G;  3GTP B;  4B3M Q;  1HXY D;  2F0F A;  4DN4 M;  1SSO A;  1BKB A;  1HZB A;  2WAQ G;  1SYE A;  1UUP A;  3S1M H;  5M3F H;  2GVB A;  1HNW Q;  4J6H A;  2BOS A;  5T1I A;  3F2D A;  1YIJ A;  2BH8 A;  4M8A A;  1DOM A;  1NAP A;  1WTO A;  5KND A;  4X66 L;  1MHW C;  1NUC A;  5HGT A;  2GA4 B;  1PFM A;  3KLR A;  5M3F G;  1CKM A;  3T13 A;  4HMJ A;  2CW0 C;  4FF4 A;  1IL2 A;  4G7O C;  1H9S B;  2L5T A;  2UXD Q;  2HD3 A;  1YNN D;  5IWA Q;  3BVZ A;  2D9U A;  1EZ8 A;  1TR5 A;  5J3B A;  2K5Q A;  1LTA D;  5LMU Q;  1Y1W B;  5E4X A;  4ZKB B;  3PUY A;  3A8J E;  3ZYY X;  1WCM G;  4LF4 L;  5C4X H;  3CME A;  2VQF Q;  2VB2 X;  2A6H C;  3KBX A;  2Z6K C;  3CQZ H;  2A5H A;  1E22 A;  5C44 H;  4IOC A;  2PQE A;  5IWA L;  3FPU B;  3SR1 A;  1I5F A;  3GTM B;  4XIG S;  1ENC A;  2E74 C;  5IGG A;  4LNQ A;  4R8N A;  5CBA E;  2L55 A;  4OL7 A;  2KEE A;  1F2L A;  4HAE A;  3W1B A;  2I5L X;  4LF4 Q;  4LFB Q;  4L6T B;  1EY0 A;  5IGE A;  1AE2 A;  2Y0S B;  3R2I A;  2ZXR A;  3Q0A A;  1AZQ A;  1D8L A;  5TSS A;  4A75 A;  4NW2 A;  4AIM A;  2YTX A;  4YHH L;  4QIW B;  4Q5V A;  3PO2 G;  5BN3 A;  1Y1V H;  2NZ1 D;  1NJI C;  3T51 B;  2NTT A;  2XRQ D;  1I4Q A;  2RDH A;  2VXW A;  3H09 A;  3BZC A;  4ZRZ A;  4OXP A;  2A6E C;  4QL5 A;  2DNC A;  4DAY B;  1S72 A;  4A3B B;  3S14 B;  1ICF B;  2F0W A;  5M3F B;  1S5E D;  1A8V A;  4HIM A;  1B7Y B;  3AMU A;  2F3I A;  5IOC A;  1STB A;  2L0C A;  3T1Y L;  2QGQ A;  5NUC A;  1V9P A;  5IGB A;  4POG A;  4MTK A;  5EBD A;  3ULP A;  2VY3 A;  4A3L G;  4A3K G;  1RJT A;  1XXG A;  1TWG H;  3N52 A;  2EIF A;  4PV1 C;  2UXC Q;  4L5Q A;  3PO2 B;  4AQY Q;  2A6H D;  1YJN A;  3CPW A;  3MXP A;  4NXN L;  3L2P A;  2F4V Q;  2UUA Q;  2J4X A;  4KHP Q;  1Y1V B;  1HHV A;  1BQQ T;  2K7V A;  3EN2 A;  2CQA A;  2PYK A;  1W2B A;  1Y8N B;  2IHF A;  3EIV A;  2F0V A;  3FMC A;  3NEM A;  1LO5 D;  1QCB D;  1BXT A;  1U4L A;  1EOV A;  2F0T A;  3P75 A;  2UUB Q;  1PZJ D;  3KK7 A;  3C46 A;  1T9H A;  2B63 B;  2OF1 A;  4GN4 B;  1WTX A;  3S2D B;  2B2U C;  3K6O A;  3PUX A;  5FLX E;  4TRD A;  1PLF A;  2E2D C;  4NMZ A;  2JA6 H;  2HIX A;  2HHH L;  1TWG B;  1TS2 A;  1BNZ A;  4QUF A;  3H3V C;  2N55 A;  2NN6 I;  1V1O A;  4R4O A;  3KF6 B;  3J7A F;  2K33 A;  1XMO Q;  3GTQ H;  4NPS A;  5FJ8 G;  2MQH A;  2HDL A;  3URY A;  5GAH C;  4KHZ A;  2IL8 A;  2K5H A;  4X64 Q;  4DV6 Q;  4PMW A;  2K1B A;  3T16 A;  1IL8 A;  4DGZ A;  1MBY A;  3QOJ A;  4PG3 A;  4CDF C;  4J15 A;  4IFD I;  3Q24 A;  2M00 A;  3UI2 A;  3FVQ A;  2JN4 A;  4AYB B;  4HMI A;  4X3U A;  5JEA J;  4G7H C;  2Z9H A;  2VNU D;  4C3J H;  4B3R Q;  3RZO B;  1SMY C;  4NXN Q;  1K9M C;  1CUK A;  3TP8 A;  4H0L C;  4A3E H;  2RCF A;  2N88 A;  3TP6 A;  2CKZ B;  1JOQ A;  4KHP L;  3G48 A;  5LMN Q;  1YJW A;  3ND9 A;  1AZP A;  4KKT A;  2PQA A;  5IP7 H;  1PZI D;  4JI5 Q;  3U4Z A;  4ME5 A;  2K28 A;  3GDE A;  4UPA A;  1QE6 A;  1E3P A;  1EIH A;  3S17 H;  5DLQ E;  4NKL A;  2AWO A;  4R8I A;  4HN7 A;  4A3C G;  3PF5 A;  2ZJR A;  1HA5 A;  3K5N A;  1AH9 A;  1PXU A;  3I4N B;  4XYO A;  5JJK A;  4K6D A;  4JI8 L;  1IKL A;  2UUC L;  3MXG A;  3TRE A;  2A74 C;  4J1M A;  1X3P A;  3TBI B;  2F0P A;  5J1Z A;  4K2K A;  5FKA C;  4RG1 A;  2R93 B;  3LNN A;  2F0N A;  1BDO A;  1QWY A;  2CFM A;  3QB3 A;  4R4C A;  5GQO A;  4FF1 A;  3VA5 A;  2KHI A;  3NWT A;  4DUY L;  1I6H H;  2SEB D;  4BBS H;  1YNJ D;  1N32 Q;  3QIA A;  4BXX H;  2KOL A;  1NMG A;  2DJG C;  1BR9 A;  3HOZ G;  4QCL A;  1TU2 B;  4ID6 A;  1CZG A;  5FOB B;  3A0J A;  3FKI G;  1VQL A;  4RFB A;  3VR4 A;  3BDO A;  1YNN C;  3S16 H;  2AHO B;  3TME A;  2K05 A;  3GTP H;  4UP7 A;  3TSS A;  5M3M G;  1KC8 C;  1CQV A;  1RDP D;  2WV6 D;  1BCP D;  2B2W A;  2R7F A;  1S4Z A;  4IZ8 A;  4A3M H;  2B2V A;  4ZK9 B;  3HOZ H;  3NK9 A;  5EKK A;  3I55 A;  4K2L A;  2C5C A;  1EYC A;  4OO1 I;  1HR0 L;  4N9P A;  3GTG H;  3S1R B;  1HA6 A;  1S5F D;  4G57 A;  3OMC A;  2OXP A;  2NBF A;  3IKJ A;  1S5C D;  1DGS A;  2R3Z A;  3RUZ A;  4ZLT F;  1X3G A;  1F2M A;  3MFY A;  3GTO H;  3UDF A;  4DA2 A;  3MTS A;  1IKM A;  1SMX A;  5A2Q L;  1VMC A;  1U0L A;  1QVF A;  4GLA C;  3DWP A;  3U50 C;  3CAM A;  1LV9 A;  1G29 1;  3VYU A;  2H4O A;  4IUQ A;  1MIU A;  2QEJ C;  2QCP X;  3DEP A;  4IUV A;  5DM7 3;  2PNR C;  5C3E H;  2N3S A;  3T4A C;  4A3M B;  2ZJP A;  2K75 A;  1DM0 B;  1DJR D;  2F1M A;  1GOZ A;  4JOI C;  4ULL A;  3GTJ H;  1Q82 C;  4JK1 C;  4DR2 L;  4KV6 A;  3HOW B;  1XNR Q;  4IFD G;  1NBW A;  2DGY A;  1LTS D;  2KVM A;  4PNY A;  1Z6H A;  1VQJ A;  1PYB A;  4TKO B;  3T1Y Q;  3EQL C;  1GHJ A;  2R92 B;  1PRT F;  4DV3 L;  5IP9 H;  4A3E G;  1QIL A;  3K5M A;  2CQO A;  1I4R A;  3G7L A;  5C3E G;  2VQE L;  3HOX B;  1B3Q A;  1LAB A;  2PW7 A;  2XWB B;  2PMZ E;  4NDX A;  4HID A;  3S1N H;  5KYL A;  2L9H A;  3OTO L;  1STH A;  2IJ0 A;  5C5L A;  3U9O A;  1RL2 A;  4XT1 B;  2JA7 B;  3SHL A;  2B2T A;  5EPJ A;  4FNF A;  5BR8 Q;  2PNH A;  3EVQ A;  4K8I A;  3FEW X;  3QO2 A;  3OWF A;  2EYM A;  1T5X D;  1TQO A;  2F52 A;  2PZT A;  4C3H B;  3GTJ B;  4KN4 C;  1C8C A;  3MEF A;  1GKH A;  3HG9 A;  4I65 A;  5BN5 A;  5C0X J;  1GUW A;  4QB4 A;  2CH4 W;  4UP8 A;  4CKC A;  2L1B A;  1TS3 A;  2NZO A;  3H15 A;  2JK8 A;  3ULL A;  3OIP A;  2B8F A;  3L3O C;  1MGS A;  2NVY H;  2PI2 A;  2IX1 A;  2HHH Q;  1G6P A;  4A3M G;  1WD0 A;  4O2D A;  2KA7 A;  4KJN A;  2IX3 A;  4CDC C;  4B3S Q;  1QNU A;  3PF4 A;  1N32 L;  4UAI A;  3I72 A;  1B3A A;  2EY5 A;  4JI2 L;  3FPP A;  2ZM6 L;  2VQE Q;  4JV5 Q;  4A3G B;  2M2L A;  4FP5 D;  2KHS A;  1SN8 A;  2BA0 A;  2EPB A;  3TP5 A;  4LF6 L;  3HOX G;  1VQI A;  1E2V A;  1V43 A;  4BY7 B;  2NB0 A;  3M4O B;  1DOK A;  4A3F H;  3ND8 A;  4U67 3;  3K7A B;  1KXL A;  3RLN A;  3F2B A;  2E2J H;  1K3R A;  3OYY A;  3HKS A;  4DR1 L;  1SYF A;  4EQ5 A;  4XYQ A;  3S14 H;  1E1T A;  1D6E C;  2BH2 A;  3PIP A;  2EJM A;  4RKL A;  3QOL A;  1SRO A;  5ELN A;  5C3E B;  3K5O A;  2NVQ H;  4OX9 Q;  1UE7 A;  4POF A;  4DXG A;  1TKW B;  4K5W A;  4R4T A;  2Z4I A;  2ATW A;  1KD1 C;  2I0Q A;  4BA1 I;  2JXM B;  2K01 A;  5DM6 3;  2CH4 A;  4PZ8 A;  3AU7 A;  2HCI A;  3HEJ A;  3NTI A;  3R3O A;  2RDF A;  3PIO A;  3HGB A;  3DLL A;  3CPF A;  3STB C;  1VQ5 A;  3CMA A;  4EGV A; 
#chains in the Genus database with same CATH homology
 2MGS A;  1JWM D;  5C3X A;  3GTL B;  3C2P A;  5KNB A;  1IYV A;  4RCN A;  2KJX A;  2F0M A;  4E6I A;  1MI2 A;  1GUS A;  4H13 C;  4FYD A;  2O2L D;  2L4N A;  4S3S A;  2MP1 A;  2PW5 A;  5FO8 B;  4RHR A;  4GZY C;  1RTO A;  5FO9 B;  1LTI D;  2WII B;  1LTT D;  5JVH 3;  5M3M B;  2LMC B;  1AW7 A;  2NVT B;  4DU9 A;  1HPC A;  1KLU D;  1EY7 A;  2RSN A;  4OIK A;  2B8G A;  2XSC A;  1WTV A;  5IOD A;  3CKI B;  5C6A A;  1BCP C;  2E76 C;  3NQI A;  3BVM A;  1EWH A;  3I4M B;  2K5W A;  1LTR D;  3M7G A;  4CKB A;  2ICE C;  1VF7 A;  1CHP D;  2KED A;  2SNM A;  5CGK A;  1IHZ A;  4HSP A;  2NVY B;  3WDN A;  3I73 A;  3KF8 A;  5DNF A;  4UDU C;  1ENA A;  3GTQ B;  5ISR A;  1SDF A;  3CU7 A;  5FO7 B;  2F0D A;  3J81 L;  2G9D A;  4XTC S;  2AUJ D;  2EXZ A;  1ZYR C;  3DWQ A;  1JCK B;  1F2Y A;  2F3V A;  3T53 B;  1SJH D;  3K58 A;  1EY6 A;  4KI0 A;  3GTO B;  1G2S A;  4DNT B;  3R8B A;  2CVR A;  1L0X B;  4FF3 A;  1STG A;  2XRS D;  2F3W A;  2E75 C;  4RGO S;  2KCN A;  3IFT A;  3BDC A;  3NSW A;  3P7J A;  4MIU A;  2H1E A;  3VYR A;  2HQE A;  5CYU A;  4MN3 A;  4RAU C;  1JC7 A;  4XT3 B;  3EFX D;  2RA4 A;  1PRT B;  4KY5 A;  3OW7 A;  1BCP B;  4IAL A;  4CBV A;  3LX0 A;  2NUC A;  5EPK A;  3MFG A;  1G6Z A;  1ESR A;  1KTK A;  2JA6 B;  2A69 D;  4FXG C;  1C4Q A;  3K59 A;  2RQX A;  5C0X I;  1EY8 A;  1H9R A;  1EOT A;  2DY8 A;  2JYO A;  3SE0 A;  1U4P A;  5C4J B;  4C3H G;  5I9O A;  3DWA A;  3MVV A;  1O7Y A;  4XQN A;  2B2W C;  1UEA B;  4QUC A;  1A3V A;  3EA6 A;  4RKB A;  2XN9 C;  2TMP A;  5D3D A;  2PCF B;  3K0Y A;  3L7Z C;  4XQJ A;  2I46 A;  2G9H D;  3KLS A;  1GHK A;  2B2Y A;  2SDF A;  1EFI D;  1GUO A;  1CZW A;  4A3J B;  1TVX A;  1C48 A;  1Q1B A;  2MUY A;  2IW3 A;  1IYU A;  1D5M C;  2JEB I;  3W3A A;  1QOH A;  3GP7 A;  1WTW A;  1G8Z D;  1NR4 A;  1I4X A;  4RHS A;  2F0G A;  1EEF D;  3WOE A;  5JAV A;  4RGM A;  3SK8 A;  3C3L A;  4WRD A;  1TWH B;  1U9R A;  3GO5 A;  5I2X A;  2PZU A;  3J80 E;  1SNQ A;  2HDM A;  5HUR A;  1O7L A;  2WAQ B;  4PMB A;  1X3Q A;  4K14 A;  1CM9 A;  1B9N A;  1STN A;  3S15 B;  1H9M A;  2WIN B;  2B2Y C;  1CK1 A;  2E2I B;  4BS9 A;  4EQP A;  2X6L A;  5CV7 A;  4BY1 B;  3NWS A;  5A35 A;  4DAP A;  1A2T A;  4A93 B;  1EYA A;  1G91 A;  5E4W C;  4B9X A;  3RMH A;  2X69 A;  3DEO A;  4BA2 I;  1SYG A;  4F7X A;  1S5D D;  3O13 A;  2O5J C;  2V4D A;  3A8K E;  3OOC A;  2QKI C;  4JBW A;  3BS1 A;  1KNA A;  1DZ1 A;  1Y8O B;  3A7A B;  3H0G B;  4WJW A;  4CJ1 B;  1Q90 A;  2Z1C A;  1H9S A;  1JOK A;  2X6G A;  4ABN A;  5J39 A;  2EY2 A;  1KLG D;  1BO0 A;  2VUM B;  1K83 B;  1WTP A;  2LKV A;  1U4R A;  1X32 A;  3X3M A;  1LTG D;  1SE4 A;  2EZV A;  2FFK B;  1HUN A;  2ZT9 C;  4KN7 C;  2ZXO A;  1QJO A;  4KHV A;  1SEB D;  4KKS A;  1B50 A;  3A56 A;  1ENF A;  4RGN A;  3MAQ A;  5IGF A;  2EE1 A;  3QG1 A;  4KK7 A;  2Q8T A;  2F0I A;  2F4I A;  3PUZ A;  3QJY A;  2F0J A;  2F0Q A;  3AB9 A;  1ILP A;  3I8Z A;  3LWU A;  1TII D;  1JOO A;  1HTL D;  3G6J B;  2F0S A;  1TWF B;  4C2M B;  1IW7 D;  5ELE A;  2A68 C;  3NQT A;  4N9T A;  5ELF A;  3E0J A;  1II3 A;  1STE A;  2JA5 B;  5EQ0 A;  4TQU S;  3OIQ A;  4OO1 H;  2EY6 A;  2NVX B;  3A7L A;  3FDT A;  1QB5 D;  2B2T C;  1RCV D;  1JE4 A;  1F9R A;  1E2W A;  4ILW A;  1JR0 D;  4A3I B;  1WD1 A;  3OWE B;  1I6V C;  3D4W A;  3J7Y W;  3D6W A;  2DY7 A;  3PV0 A;  2F0H A;  3A55 A;  1ICW A;  1ONL A;  3NBH A;  1JQY D;  4Z9C B;  1CFM A;  2FHT A;  4A3D B;  5K36 H;  2RBM A;  1XWE A;  4DNR B;  1TWA B;  1TS4 A;  1SNP A;  4OO1 G;  3VYS A;  3OHX C;  1IW7 C;  2F0E A;  3PUW A;  3RD4 A;  3MHB A;  4C56 C;  3NXW A;  5CV5 A;  4L8J A;  4Q0F A;  1KDB A;  4RWS C;  1PTO C;  2BE5 D;  4DAV A;  2IT1 A;  1D5X C;  2R61 A;  3D31 A;  2F0O A;  1E2Z A;  3M85 A;  4Y7N B;  2EDG A;  4XDX A;  1SXT A;  4OHJ A;  5IGC A;  1SBB B;  2WP8 J;  2BDN A;  3OSO A;  3W2D A;  1B2T A;  3RZD B;  2XVS A;  5JPN C;  3R2T A;  4CHT B;  1B4O A;  3KBG A;  3S1Q B;  2FIN B;  3S9W A;  1FD7 D;  3NTK A;  3SDZ A;  4H7B A;  4P2C B;  4DF7 A;  1VDZ A;  4CKE A;  4ZUJ A;  4KTA A;  3TDQ A;  1WVL A;  1LT6 D;  2AQ3 B;  1F9Q A;  5CV6 A;  5EPL A;  3TN2 A;  4G4K A;  2Q8I B;  2NTS A;  1M8A A;  3MWY W;  1GXD C;  3PIO 3;  3P1H A;  4HED A;  1JB3 A;  1CTM A;  2MJ8 A;  4WFN 3;  2KEC A;  1EL0 A;  2EJG C;  5ELC A;  3BYY B;  2XNA C;  3PUV A;  2AUK A;  2WKD A;  3WOF A;  4X3K A;  3I4L A;  4A3E B;  3F2U A;  3NP8 A;  3TP7 A;  4C3I B;  1BUV T;  2MPM A;  3T56 B;  3M3Y B;  4F8M A;  4QF4 A;  3VA7 A;  2A69 C;  4C3I G;  3K5L A;  2LY7 A;  3SXH A;  3E6Z X;  2Q8R E;  5M9O A;  3PO3 B;  2B2U A;  5CV9 A;  5C5M A;  2ZXP A;  2SOB A;  1BCP F;  1D1K A;  2OT2 A;  4CJ2 C;  2FMC A;  2XWJ B;  5CV4 A;  1WTQ A;  1O7Z A;  5JEA H;  1CHQ D;  5D14 A;  3VR5 A;  3DUZ A;  1XX8 A;  1PTO B;  2AWN A;  2ICI A;  1J9O A;  5JOB A;  2EYL A;  1I4P A;  3J7A V;  1EIG A;  3X3N A;  1R4Q B;  5IGD A;  4EQN A;  1SJE D;  2R6G A;  2MHV A;  5LL6 X;  2AQ1 B;  3NUC A;  1DXM A;  1O78 A;  4HCE A;  3U9S A;  1SMY D;  4KY6 A;  3A54 A;  1ILQ A;  4LMQ D;  1GUN A;  5COY A;  2L12 A;  1ESF A;  3A8I E;  1Q8I A;  3DXJ C;  2WAC A;  2AQ2 B;  1AP0 A;  3GV6 A;  1CI3 M;  5M5W B;  2PMZ B;  3VR6 A;  3KLS X;  1I4H A;  2RVL A;  5IIF A;  3P20 A;  4G7Z C;  1PTO H;  2EOT A;  2B2V C;  5KGU A;  5ELD A;  5CR3 A;  3GQB A;  3SK4 A;  3TZD A;  2CHB D;  2E2H B;  2HUG A;  5JVG 3;  3VR2 A;  5I6Y A;  1BBX C;  3S16 B;  1SAP A;  4XQQ A;  1VCI A;  4F87 A;  1FNU A;  5EBC A;  3VYT A;  5EKL A;  4LAA A;  1OXV A;  3FRP B;  2F0U A;  4L63 B;  3OMG A;  1A3T A;  5E3F A;  5KNC A;  2LS0 1;  2OEO A;  1RKN A;  4KKU A;  5C4Z A;  5CMD A;  3OPO A;  5BN4 A;  2KCC A;  3D3R A;  3BDL A;  5FLX L;  1LLR D;  1V1P B;  4DXF A;  3ERO A;  2K6A A;  1ZYR D;  5G3L F;  5J22 A;  5D3I B;  4C1N K;  1F77 A;  1WTR A;  4KMU C;  2JA8 B;  4C1N I;  3L9A X;  3C1E A;  5C44 B;  1UNS A;  1H9K A;  5KIX A;  5JJZ A;  2EYO A;  1KAB A;  3S17 B;  2M9V A;  1PFN A;  1FNV A;  2J0T D;  1BF4 A;  2EYF A;  2F03 A;  2NWG A;  3TZU A;  4LK1 C;  4EQO A;  3H94 A;  3EJI A;  2QDB A;  3K57 A;  1TWC B;  5I6W A;  1ZXT A;  2NN6 G;  3S2H B;  5JEA G;  3V05 A;  3D4R A;  2EY1 A;  3GTK B;  1BOS A;  4HSV A;  2NN6 H;  2A6E D;  1JWU D;  3FKI B;  1RF2 D;  2HCC A;  4RA8 A;  4MHE A;  3Q23 A;  4YIJ A;  4DFA A;  1OXT A;  4DK0 A;  4X3T A;  3VR3 A;  1Q3L A;  3HZX A;  1JOR A;  1EZ6 A;  1LT3 D;  1D2B A;  2PZW A;  2ENB A;  4IUU A;  1Q1E A;  1EU4 A;  5COR A;  1XYI A;  1PYW D;  1VMP A;  1F9P A;  4TSS A;  1I6H B;  3CRK C;  5DEH A;  2IPK D;  1R9T B;  4F88 A;  2L11 A;  2J7Z A;  1HQM C;  2LFN A;  4H44 C;  1EQT A;  3HKZ B;  1SYD A;  1AEX A;  3ERQ A;  3V96 A;  2R7Z B;  5EJW A;  2B39 A;  1OXX K;  4CJ0 B;  3SVM A;  1EY4 A;  2CW0 D;  2Z4H A;  1EEI D;  2NVQ B;  2BDO A;  1AFP A;  1A15 A;  1ML0 D;  4A3F B;  1TS5 A;  4O42 A;  5LHY 1;  2E2J B;  3C1F A;  4HTH A;  1QG7 A;  3PIP 3;  2SNS A;  3D8G A;  4X3S A;  5M5Y B;  3HOV B;  4A3K B;  1SE3 A;  2YU9 B;  5IT9 E;  1EYD A;  5CBE E;  1SYB A;  5JPM C;  1E0B A;  3JAM E;  2RDG A;  4K8J A;  1WCM B;  1GUT A;  5E1F A;  3M7N A;  1B44 D;  1ET9 A;  1ZKO A;  2TSS A;  3DMU A;  2C9O A;  4R9W A;  1FYC A;  1HRJ A;  3V2T A;  2BCO A;  1CQF A;  1HCZ A;  1Z47 A;  2BE5 C;  3ITP A;  3CRL C;  1SNO A;  3PMF A;  5K5P A;  1GUG A;  3NTH A;  5DAU A;  1SND A;  5C0X H;  3BZD B;  4NP5 A;  1HFN A;  1PTO D;  2KQ3 A;  5CC4 A;  4EVO A;  4OGQ C;  3S1M B;  4IFD H;  4KY7 A;  2DN8 A;  3J80 L;  1SE2 A;  4K6L A;  3M4Y A;  3NBI A;  2QF7 A;  2D62 A;  4HR7 B;  1Q12 A;  1ZEQ X;  3HOY B;  2EVB A;  1EY9 A;  1MD2 D;  4FXK C;  3Q6S A;  2WB1 B;  2K04 A;  4BBR B;  2K03 A;  1STY A;  4WOR A;  2D5D A;  1I4G A;  3MA2 B;  2D2C C;  3HRZ C;  3NE5 B;  1NCV A;  4DK1 A;  4RCO A;  3ONA B;  1R4P B;  4IQZ A;  1CA6 A;  5AFW A;  4QMG A;  1OXU A;  4FO2 A;  1J8I A;  1ET6 A;  1JWS D;  2EYP A;  5C3W A;  1RHP A;  4O1N A;  3SK5 A;  1KNE A;  4V0B A;  1G2T A;  2EYH A;  2NYZ D;  3MC0 B;  1I3Q B;  3GV3 A;  3I3C A;  1TY2 A;  4PMC A;  4PQX A;  3HS0 C;  2A68 D;  5C4H A;  4OIJ A;  2EJF C;  1M4V A;  3BVG A;  3LWE A;  3BYT B;  4KJO A;  3IFD A;  4XXE A;  1FNW A;  1CT1 D;  3NPP A;  5KRU A;  1W6K A;  1NSN S;  5EGT A;  5EKI A;  2RKS A;  1DOL A;  4HCS A;  5I4D A;  2ID0 A;  4DAY A;  1UAP A;  2F0L A;  2JE6 I;  1K8M A;  1RD9 D;  4KD3 A;  1LAC A;  1YNJ C;  3D6C A;  3CQZ B;  2VB3 X;  1DD2 A;  1EWC A;  2Z8L A;  4CGY B;  1SFO B;  4IUP A;  3H6M A;  1PMR A;  3HP3 A;  5IT9 L;  4K5X A;  3MEH A;  3RLF A;  1GJX A;  4IFD J;  3MZ5 A;  5KEE A;  1PDQ A;  2EYJ A;  5I2Y A;  4FF2 A;  1VF5 C;  5LL6 S;  1B1Z A;  1TY0 A;  5K36 G;  4ZAI A;  3S1N B;  2PO4 A;  4IN3 A;  3GTG B;  1KAA A;  3R93 A;  1RTN A;  4KD4 A;  3BG3 A;  4LJZ C;  5G3L D;  1H9J A;  3E5S A;  3I90 A;  2WKC A;  4J8Q A;  1W6J A;  1T5E A;  3N6R A;  5F2D A;  3GD7 A;  4ZUI A;  1Y8P B;  1KDC A;  1EU3 A;  1XTC D;  1F9S A;  3Q22 A;  3D4D A;  1TT2 A;  4U68 A;  3J81 E;  5C0X G;  4ODG A;  1F2Z A;  1HUM A;  3IL8 A;  2KUM A;  1MSG A;  1KDA A;  3SK6 A;  1K8O A;  5T1G A;  2A73 B;  1I50 B;  4I7Z C;  1U4M A;  2RSO A;  1A3U A;  2F0K A;  1AN8 A;  4V19 0;  5ELB A;  3DM1 A;  3SEB A;  3I91 A;  1Z7T A;  3IAY A;  4IUT A;  4ZQ3 A;  1PTO F;  2DNE A;  4B08 A;  1DON A;  5C4X B;  3HOZ B;  4ZYS A;  3QWN A;  1A6X A;  1EY5 A;  2O4X A;  1QNK A;  1HQR D;  2K32 A;  3MXU A;  5I9P A;  1Y69 U;  2K5D A;  2XIW A;  4B9W A;  5M5X B;  5D65 A;  4ZKC B;  1S5B D;  1B53 A;  3JAM L;  2JSO A;  4C3J B;  1HFG A;  5FK9 C;  1O80 A;  4RH6 A;  4BBS B;  2FJ2 A;  1EQV A;  4FVM A;  4IUR A;  5A2Q E;  3CHB D;  1JIC A;  1SNC A;  1HTP A;  1PRT D;  1D1I A;  2PPB C;  1L0Y B;  1NR2 A;  4M1U B;  1FR3 A;  1MSH A;  3I70 A;  1D5Z C;  1B9M A;  1LT4 D;  3HOU B;  2BA1 A;  2IWH A;  4K5V A;  1SNM A;  3KUP A;  1OO9 B;  3DHQ A;  3H91 A;  2O5I C;  2JEA I;  2IX0 A;  1LT5 D;  1DYQ A;  2I07 B;  2FMM A;  1PFB A;  1V8Q A;  4FXD A;  2QIL A;  4BWG B;  5KYI A;  1PRT C;  5CV8 A;  4RGT A;  1OXS C;  3NHH A;  4IUN A;  1V1P A;  1SYC A;  2JP1 A;  4C3J G;  1FGB D;  1A2U A;  1ROD A;  1STA A;  1PZK D;  3MXN A;  1LTB D;  2YYZ A;  1CA5 A;  1DCZ A;  3GTP B;  1HXY D;  2F0F A;  4DN4 M;  1SSO A;  1SYE A;  1UUP A;  4J6H A;  2BOS A;  5T1I A;  4M8A A;  1DOM A;  1NAP A;  1WTO A;  5KND A;  1NUC A;  5HGT A;  2GA4 B;  1PFM A;  3KLR A;  3T13 A;  4HMJ A;  2CW0 C;  4FF4 A;  4G7O C;  1H9S B;  2L5T A;  1YNN D;  3BVZ A;  2D9U A;  1EZ8 A;  1TR5 A;  2K5Q A;  1LTA D;  1Y1W B;  5E4X A;  4ZKB B;  3PUY A;  3A8J E;  3ZYY X;  2VB2 X;  2A6H C;  3KBX A;  2A5H A;  2PQE A;  3FPU B;  3SR1 A;  3GTM B;  4XIG S;  1ENC A;  2E74 C;  5IGG A;  4R8N A;  5CBA E;  2L55 A;  4OL7 A;  2KEE A;  1F2L A;  4HAE A;  4L6T B;  1EY0 A;  5IGE A;  2Y0S B;  3R2I A;  2ZXR A;  3Q0A A;  1AZQ A;  5TSS A;  4NW2 A;  4QIW B;  4Q5V A;  5BN3 A;  2NZ1 D;  3T51 B;  2NTT A;  2XRQ D;  1I4Q A;  2RDH A;  2VXW A;  3H09 A;  4ZRZ A;  2A6E C;  2DNC A;  4A3B B;  3S14 B;  2F0W A;  5M3F B;  1S5E D;  3AMU A;  5IOC A;  1STB A;  2L0C A;  5NUC A;  5IGB A;  5EBD A;  1RJT A;  1XXG A;  3N52 A;  4PV1 C;  3PO2 B;  2A6H D;  3MXP A;  2J4X A;  1Y1V B;  1HHV A;  1BQQ T;  2K7V A;  2CQA A;  2PYK A;  1Y8N B;  3FMC A;  2F0V A;  1LO5 D;  1QCB D;  1U4L A;  1BXT A;  2F0T A;  3P75 A;  1PZJ D;  3KK7 A;  3C46 A;  2B63 B;  2OF1 A;  1WTX A;  3S2D B;  2B2U C;  3K6O A;  3PUX A;  5FLX E;  4TRD A;  1PLF A;  2E2D C;  4NMZ A;  1TWG B;  1TS2 A;  1BNZ A;  4QUF A;  3H3V C;  2N55 A;  2NN6 I;  1V1O A;  3J7A F;  2K33 A;  2HDL A;  3URY A;  4KHZ A;  2IL8 A;  4PMW A;  2K1B A;  3T16 A;  1IL8 A;  4DGZ A;  1MBY A;  3QOJ A;  4IFD I;  3Q24 A;  2M00 A;  3UI2 A;  3FVQ A;  4AYB B;  4HMI A;  4X3U A;  5JEA J;  4G7H C;  2VNU D;  3RZO B;  1SMY C;  3TP8 A;  4H0L C;  2N88 A;  3TP6 A;  1JOQ A;  3ND9 A;  1AZP A;  4KKT A;  1PZI D;  4ME5 A;  2K28 A;  1QE6 A;  1EIH A;  4NKL A;  2AWO A;  4R8I A;  4HN7 A;  1HA5 A;  3K5N A;  1PXU A;  3I4N B;  4XYO A;  4K6D A;  1IKL A;  3MXG A;  2A74 C;  4J1M A;  1X3P A;  3TBI B;  2F0P A;  5J1Z A;  4K2K A;  5FKA C;  2R93 B;  3LNN A;  2F0N A;  1BDO A;  1QWY A;  3QB3 A;  4FF1 A;  3VA5 A;  3NWT A;  2SEB D;  1YNJ D;  3QIA A;  2KOL A;  1BR9 A;  4QCL A;  1TU2 B;  4ID6 A;  1CZG A;  5FOB B;  4RFB A;  3VR4 A;  3BDO A;  1YNN C;  3TME A;  2K05 A;  3TSS A;  1CQV A;  1RDP D;  2WV6 D;  1BCP D;  2B2W A;  1S4Z A;  4IZ8 A;  2B2V A;  4ZK9 B;  3NK9 A;  5EKK A;  4K2L A;  2C5C A;  1EYC A;  4OO1 I;  4N9P A;  3S1R B;  1HA6 A;  1S5F D;  4G57 A;  3OMC A;  2OXP A;  2NBF A;  3IKJ A;  1S5C D;  2R3Z A;  3RUZ A;  4ZLT F;  1F2M A;  3MFY A;  4DA2 A;  3MTS A;  1IKM A;  5A2Q L;  1VMC A;  3DWP A;  1LV9 A;  1G29 1;  3VYU A;  2H4O A;  4IUQ A;  2QEJ C;  2QCP X;  3DEP A;  4IUV A;  5DM7 3;  2PNR C;  3T4A C;  4A3M B;  1DM0 B;  1DJR D;  2F1M A;  1GOZ A;  4ULL A;  4JK1 C;  4KV6 A;  3HOW B;  4IFD G;  1LTS D;  2KVM A;  4PNY A;  1Z6H A;  4TKO B;  3EQL C;  1GHJ A;  2R92 B;  1PRT F;  1QIL A;  3K5M A;  1I4R A;  3G7L A;  3HOX B;  1LAB A;  2PW7 A;  2XWB B;  4NDX A;  5KYL A;  2L9H A;  1STH A;  2IJ0 A;  5C5L A;  3U9O A;  4XT1 B;  2JA7 B;  3SHL A;  2B2T A;  5EPJ A;  4FNF A;  3EVQ A;  4K8I A;  3FEW X;  3QO2 A;  3OWF A;  2EYM A;  1T5X D;  1TQO A;  4C3H B;  2PZT A;  3GTJ B;  4KN4 C;  1C8C A;  3HG9 A;  4I65 A;  5BN5 A;  5C0X J;  1GUW A;  4QB4 A;  4CKC A;  2L1B A;  1TS3 A;  3OIP A;  2B8F A;  3L3O C;  1MGS A;  2IX1 A;  1WD0 A;  2KA7 A;  4KJN A;  2IX3 A;  1QNU A;  4UAI A;  3I72 A;  1B3A A;  2EY5 A;  3FPP A;  4A3G B;  2M2L A;  4FP5 D;  2KHS A;  2EPB A;  2BA0 A;  3TP5 A;  1E2V A;  1V43 A;  4BY7 B;  2NB0 A;  3M4O B;  1DOK A;  3ND8 A;  4U67 3;  3K7A B;  1SYF A;  4XYQ A;  1D6E C;  2EJM A;  4RKL A;  3QOL A;  5C3E B;  3K5O A;  4DXG A;  1TKW B;  4K5W A;  2Z4I A;  4BA1 I;  2JXM B;  2K01 A;  5DM6 3;  3AU7 A;  2HCI A;  3HEJ A;  3NTI A;  3R3O A;  2RDF A;  3HGB A;  4EGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...