1EYCA

Structure of s. nuclease stabilizing quintuple mutant t41i/s59a/p117g/h124l/s128a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eycA00
2F0QA 3RUZA 1STAA 5C6AA 1SNQA 2F0TA 2EY6A 1F2YA 3P75A 5E3FA 4KD4A 1SNPA 1KDBA 4RKLA 3EJIA 4K14A 4MIUA 4QF4A 3V2TA 3D4WA 5C4HA 3MZ5A 2PZTA 4IZ8A 3U9OA 5C4ZA 5C3XA 2SOBA 1SYDA 1ENCA 1JOOA 2F0FA 2PW5A 2PW7A 3DHQA 3DMUA 3OMGA 4IALA 5CV5A 4YIJA 5J1ZA 2F0SA 4KJNA 4EQOA 4NP5A 3TP5A 5IGBA 1A3VA 1STHA 4F8MA 5CR3A 2HQEA 3SXHA 1EY7A 3D8GA 2EYFA 1SYEA 3S9WA 2F0GA 1EY0A 2PQEA 1SNDA 3NUCA 4NDXA 4KJOA 3VA5A 3QB3A 4NKLA 5KYLA 1A2TA 4KY7A 2F0LA 3E5SA 3T16A 2WACA 3OMCA 3TMEA 2F0JA 3SK4A 1KDAA 4IUNA 3H6MA 4TRDA 4K5WA 4EQNA 5I6WA 1A3UA 1A3TA 2PZUA 2SNSA 2F0WA 1A2UA 4J1MA 5DEHA 2EYPA 3SR1A 5E1FA 4E6IA 1NUCA 3BDLA 4OL7A 1U9RA 4ME5A 2EYLA 2F0NA 5JOBA 5HURA 5IGEA 1JOKA 3SK8A 1SYFA 5IGFA 3NHHA 3OSOA 1SYBA 4KTAA 4K8IA 1KABA 4RKBA 5CV4A 4LAAA 4PNYA 4QMGA 2KQ3A 3EVQA 5K5PA 2F0UA 4KY6A 4J6HA 5JAVA 2F0MA 2KHSA 5KRUA 4EQPA 1JORA 5C5LA 2EYHA 2OXPA 5ISRA 3MXPA 4DFAA 4DGZA 3NP8A 3OWFA 2EY2A 5EGTA 3ITPA 3R3OA 5CC4A 4WRDA 5IGDA 4ZQ3A 5NUCA 3SK6A 5M9OA 2F3VA 4B9WA 2F0EA 1II3A 1JOQA 4K8JA 4KV6A 2OEOA 2EYOA 1RKNA 2RDFA 1EQVA 3ERQA 4N9TA 4QB4A 3HEJA 3SK5A 4K2KA 4F7XA 4G57A 5IODA 4S3SA 2QDBA 4K5XA 5C5MA 4ZUIA 4KHVA 4B9XA 5I6YA 3TP8A 4KD3A 1STNA 4HMIA 1F2ZA 2F0VA 3C1FA 3D6CA 5CV8A 2RKSA 5F2DA 3TP6A 1F2MA 2EYMA 2F0OA 3NXWA 2F0IA 5KGUA 5KIXA 2SNMA 3EROA 2EY5A 4ID6A 2PZWA 2LKVA 4KY5A 3D4DA 4HMJA 1EY8A 4I65A 3TP7A 2M00A 3MHBA 4PMCA 2OF1A 1SYGA 2ENBA 5CV6A 5CV9A 1EY4A 1EY6A 3MEHA 5C3WA 1AEXA 1EY9A 5IIFA 5KEEA 1SNOA 5J39A 2EXZA 3P1HA 4K5VA 4ODGA 1SYCA 1IHZA 2F0PA 3SHLA 1STBA 3T13A 4K6DA 4EVOA 4ZUJA 2F3WA 1EY5A 2EYJA 3PMFA 4H7BA 2PYKA 1STGA 3NQTA 5CGKA 1EYCA 5HGTA 1STYA 5IGCA 5IGGA 4PMBA 1EYDA 3LX0A 1EZ8A 1EYAA 2F0HA 1KDCA 3C1EA 4WORA 5EKLA 5I9PA 1SNMA 5I9OA 3QOLA 5DAUA 1NSNS 1ENAA 5J22A 1SNCA 4NMZA 1TQOA 1EZ6A 2EY1A 3BDCA 1KAAA 1TT2A 2O4XA 3MVVA 3NK9A 4N9PA 5CV7A 5EKKA 2NUCA 4HTHA 2F0DA 4R8NA 4K2LA 5IOCA 5KYIA 2RBMA 2F0KA 3HZXA 4DF7A 3QOJA 1TR5A 4DU9A
chains in the Genus database with same CATH superfamily
1FL0A 1VDZA 2NYZD 2OQ0A 2ZXOA 1V1OA 3J81j 1Y8NB 3HOYG 4V190 2K5NA 2HIVA 1ASZA 2EE1A 2PW5A 3OW7A 5IWAL 3G4SA 3D31A 2DGYA 4B08A 1WI5A 4PMWA 2B2TC 1K3RA 1STHA 2HD3A 3S17B 1CSQA 3BDOA 4TSSA 4JI0L 3VA5A 3QB3A 1RHPA 4ZLTF 2UXDQ 4X64Q 2K75A 2SNSA 4BBSH 1EOVA 2B8FA 1VQGA 5KNCA 3NEMA 3PUZA 5JOBA 2D2CC 1JOKA 4RH6A 5H1SE 4A3LG 2ZJQA 3CHBD 2WINB 1NR4A 4PNYA 3HG9A 2CW0C 2N55A 5DNFA 4AYBB 3MXPA 4XDXA 1NMGA 2QKIC 1C9OA 4ZQ3A 3CCSA 3H94A 1V1PA 4R8IA 2GVBA 4DR7Q 1CQFA 1NY4A 3OPOA 4LNQA 3SE0A 4LF6L 2H1EA 2XSCA 3K0YA 5HGQA 2XWBB 3RLNA 5KGUA 2ES2A 3M9BA 3I73A 4JYAQ 4NB3A 3ICEA 3HKZE 3K57A 2TSSA 1PYWD 4QGUA 4ODGA 4ZUJA 1D2BA 5C0XG 1SSOA 3BVZA 3PMFA 4DAYA 1KC8C 5AJ3L 5C4XG 2R6GA 5IGGA 1TS2A 3H0GB 1K3BC 3DEOA 3UE1A 3CP0A 4JC0A 1SNMA 3UDFA 1ENAA 3FVQA 2Z4IA 1LT6D 1L0WA 2O4XA 3K0XA 5IYDH 1VQAA 1PVOA 4N8X1 5IOCA 3PO2G 2HCCA 2ZJRA 3HOZB 4PZ6A 3RUZA 5M5YB 1F2YA 2R61A 3Q8DA 4C3JB 4RKLA 1OXVA 3GTJH 1DYQA 2I46A 4I7AA 1BBUA 3JAMc 4DV4L 2BCOA 5CC4A 5I2XA 2RA4A 5J1ZA 5IWAQ 1XNQQ 4A76A 4TVAB 4F8MA 4L8JA 2WP8J 2HQEA 3NBHB 2KCNA 3RD4A 3GTKH 2ALYB 3U50C 1S5FD 4JI0Q 2BA0A 4OX9L 1LTID 3OYYA 3KBXA 3HGBA 4TRDA 1N33L 2VS1A 1VQPA 4B3RQ 1SFOB 4C3HH 5C3EH 2AHOB 4GOPB 1IBML 5JPMC 1LTTD 3CQZB 3SK8A 4DK0A 2EOTA 4RA8A 4LK1C 3S1MH 3UDGA 4KHZA 3PF4A 3G6JB 1E1OA 2IY5B 2KHSA 3S14B 4EQPA 4KMUC 2JEBI 1Q3LA 4XXEA 2QA4A 1I5FA 4A3FB 1XX8A 1QZHA 1G51A 1V43A 1NTGA 5IP7H 3PO3B 2WFWA 4DXFA 1WVLA 1RKNA 3BZDB 2IWHA 3S24A 2YTXA 3W1GA 1PTOB 2ZT9C 5IODA 4K2KA 4H0LC 1GUTA 4A3IB 4JVZA 5M5XH 1TWAH 2RSOA 2J0TD 5M3MB 4L5RC 2RVLA 2ZM6L 2RKSA 4KLKA 5IY0A 2F0OA 1V9PA 3ER0A 3I91A 1F9SA 5C4JB 1I6HH 4NW2A 1ESFA 1AW7A 1CSPA 3GTMH 4BXXG 1UE7A 1S4ZA 3PCOB 1HA5A 3J80i 1EY4A 2NVYH 2EDGA 4RG1A 4AYBG 1DOMA 3K5MA 3UE0A 2RSNA 2K4KA 1CHPD 1EY5A 3A8IE 4DV3L 4IPDA 1EWCA 2R92G 1I4HA 2JA6H 1Y8PB 5A2QE 2A73B 1VQBA 5HGTA 5AJ3Q 4JI3Q 4BA1I 3Q23A 2J7ZA 1AE2A 1C48A 3C1EA 5LMUQ 1QUQA 1PZID 1ZKOA 5DAUA 1Y1VH 4G7HC 5IT9c 1EZ6A 3BDCA 4R4QA 1S5BD 4DAPA 1SE2A 4DR6L 4GN3B 1GOZA 2B29A 2L1BA 3KF8B 1S5CD 2A69D 1SNPA 3EJIA 3RLOA 1PMRA 4B3TL 4GS3A 5K36G 2DN8A 2PW7A 4DV4Q 2PNHA 1NAPA 4EQOA 1X65A 3EQLC 4Y7NH 4DK1A 1B9MA 3GTOH 2M9VA 3PIPA 2JE6I 3H3VI 4BBSB 1H95A 1B70B 1EY0A 1V1PB 3H0GG 1XTDA 3T16A 2KECA 1VF7A 4DV2L 2P5ZX 2MGSA 4OX9Q 4BS9A 2QW7A 4WFN3 1S5DD 1HR0W 3PIOA 1N33Q 1B7YB 2HDMA 3K80C 4M8AA 1IBMQ 4F88A 2BH8A 3HOZG 3L0OA 2A1AA 1RD9D 2JYOA 1B3AA 1TWCB 4C3JG 4L5TA 3Q0AA 1SR3A 1IBKL 1HJPA 3K8AA 3WOEA 1G291 2LMCB 2QEJC 1EOTA 3I55A 5I4DA 4FXKC 4F87A 4G4KA 2K5VA 3NENA 4FDBA 3PSIA 2X6GA 2QDBA 1EEID 2BA1A 4ZUIA 4B9XA 1CQVA 3MC0B 4DPGA 1Z7TA 5CV8A 4BWGB 4BY1G 2PO4A 1QNKA 2CVRA 4O1NA 5G3LF 1TY0A 1Y14B 1B9NA 2EY5A 3EN2A 4PZ7A 4DNIA 2JA7H 4LFBL 1QCBD 1MSHA 2JN4A 1AEXA 5M3FH 2VY3A 5JPNC 4UY8C 1QVFA 1ESRA 1QB5D 1YNJC 4H7BA 4DV3Q 3PO3G 4HSVA 3H09A 2A68C 3J7AF 1UEBA 4JW0A 4R4TA 3E9IA 1XPUA 4U673 1A15A 1SBBB 5GAGC 4HJ5A 3GTJB 4GLVB 1TT2A 1XXGA 3PUWA 1KXLA 5ELBA 1GUNA 1MIUA 1PTOF 1B3QA 5KYIA 2UUAL 3QOJA 4RMFA 4A3CG 2EY6A 2EJMA 4PG3A 3HOUH 3GTKB 1PZKD 4ABNA 1R9TH 4B3TQ 2OTJA 2K50A 1A0IA 1Z9FA 3TP5A 1SEBD 3SXHA 3S9WA 4AYBE 2B2VC 2CFMA 4C3HB 5C3EB 5BN4A 3NUCA 1CUKA 4C1NK 3N6RA 5KYLA 3PIP3 1OXXK 3GTQH 2L9HA 1K0RA 4DK3C 3CAMA 2DJFC 2PQAA 3S1MB 1PH6A 3H3VC 2VUMH 5E4WC 1CI3M 4Y52H 4J1MA 2RDHA 2C9OA 4E6IA 1XMOL 2D9UA 3A56A 3PIO3 1SYFA 1S40A 3HOXH 2R3ZA 4HIMA 4QIWB 1KLGD 2QF7A 4WJWA 2EXDA 5KRUA 1IBKQ 3QG1A 1I4RA 3DUZA 3IAYA 1JJ2A 1TVXA 3H3VH 2VQFL 1SJED 1H9RA 1B2TA 3S16H 5JEAH 5M5XB 2H4OA 1TWAB 2BE5D 2F0EA 3VR4A 1NJIC 1JJGA 2PI2A 1BNZA 3M7NA 2B2VA 1K8GA 5BR8L 1DJRD 1PH5A 4RGNA 3JAME 1I6HB 3UI2A 4IPCA 3BS1A 5A2QL 3GTMB 4OIKA 1QUQB 2NVYB 1EWIA 5F2DA 3CMEA 5J3BA 3M4YA 3TBIB 2LKVA 1CZGA 1AN8A 2M00A 3I4MH 1W6JA 4X65L 2JA6B 2GVAA 5IIFA 4CKCA 1FJGL 4GZYC 3SHLA 3VR5A 1STBA 4EGVA 1HUMA 2D62A 4X6AH 4JK1C 2PYKA 3MFYA 4NXNQ 1Y1VB 2RDGA 4DUYL 1QG7A 2CH4A 1FR3A 4QJFA 5BN3A 4HJAA 3KLWA 1BXTA 4EQ5A 1I4GA 3X3MA 1EYAA 4OONA 3J7ZC 1K9MC 1PH2A 4QL5A 1GO3E 3J81c 2HDLA 3CPWA 4IPHA 3GDEA 1UNSA 3T1YL 3UDXA 4LW1A 3C46A 1STAA 4P71A 4Y7NB 2VW9A 3GTOB 2JA9A 4P74A 1LTRD 4PQXA 5C3XA 1HZCA 5LMNW 4DA2A 1ENCA 4KN7C 4X66L 5FLXE 1KAWA 2RHQB 1WFQA 3P7JA 1E2WA 2EQSA 3J80c 3GTLH 1FVIA 4HJ9A 1EY7A 2EYFA 3OOCA 1RTNA 5IYDG 3F8TA 4KJOA 3IRBA 4DR5L 1EU3A 3D3RA 3OMCA 1EWHA 3H6MA 2DJGC 3F2UA 2O5IC 1M8AA 1O7YA 1UUPA 1EFWA 1GUGA 3SR1A 4RFBA 1XMOQ 2MPMA 3H15A 5IGFA 3NHHA 1R4QB 4K8IA 4IUPA 1TXYA 5CV4A 3M4QA 1BCPD 5IT9E 2FMMA 3GV3A 1VQNA 2ATWA 3HS0C 1D7QA 2VQFQ 2JA5H 1ZYRD 1DZ1A 4XQJA 3BZCA 1PDQA 3VA7A 1LABA 4C3HG 5C3EG 1SDFA 1RF2D 5DM63 2SEBD 1DONA 3K7AH 1O78A 2EZVA 1IZ6A 2JA7B 2DUDA 2XRQD 2Q2UA 2Z0SA 3DWQA 1G2SA 1CA5A 3CC2A 1JWMD 2GN5A 2Z6BA 4H44C 4RGOS 5M3FB 1B1ZA 2F0IA 2EJGC 2AMCB 3EROA 1B4OA 3PQIA 3A5UA 1F9PA 4A75A 3EBEA 1J9OA 4X65Q 4U68A 5IP7G 1EY9A 3NBHA 2ZXRA 2EXZA 3CW2C 1FJGQ 1AFPA 2B2YC 1Q8IA 2MNAA 1EIGA 1LUZA 4GOPA 3LWEA 4YWLA 4A3GH 2NBFA 1M4VA 1H9KA 2V4DA 4PV1C 3QOLA 3ULLA 1NSNS 1ET6A 2PQAB 4HSPA 3HOUB 2AQ2B 1G6PA 4X3KA 3KJPA 1R9TB 3G48A 3ULJA 2K04A 3L9AX 1LACA 3MXUA 2JA6G 3RZOH 5GROA 2PZTA 2SOBA 1MHWC 3A54A 1PH3A 3CC7A 4NXML 4DR3L 3GTQB 1UEAB 1G6ZA 3S1QH 2KHJA 5IGBA 3R93A 2K14A 2R7FA 2WKDA 3HP3A 1Y1VG 3NQIA 3NTIA 3TDQA 1PHJA 2VUMB 1UE1A 1X3PA 4DR5Q 1LTLA 4GLXA 3TMEA 2NVXH 1XPRA 3HOXB 3BVGA 4DR2L 1EIHA 1PH8A 2F0WA 5EJWA 1Q7YC 2JK8A 1BCPC 1U9RA 4YWKA 2A8VA 2J4XA 1ZEQX 4KTAA 3S16B 4QMGA 4V0BA 5K5PA 2KQ3A 1I4XA 3E0EA 3MTSA 3W2DA 1J5EQ 5ISRA 1YBYA 4FF4A 3T1HL 2B2UC 3ITPA 3O13A 3SGIA 3A7LA 2F3VA 5AFWA 1AZPA 3ERSX 2EYOA 3G7LA 4Q0FA 1JE4A 2Q8TA 4FXGC 2KA7A 4IFDG 3BZKA 3SK5A 4L5SA 5C5MA 1AE3A 1JWUD 1BQQT 2JJQA 2RQXA 3KF8A 4KD3A 4DAMA 2QEXA 1F2MA 3NXWA 4I7ZC 2PZWA 1EY8A 4JV5L 2B2TA 1IW7C 3T13A 1LTSD 2K05A 3DWPA 4MNOA 2B2UA 3CXCA 2PMZB 1X55A 1JT8A 1VS0A 1Y69U 5FO8B 5FLXL 3TEHB 1KDCA 2CH4W 1FNVA 1QE6A 3K5NA 3NTKA 1YJWA 3GTPH 3HOWB 4OELB 2NTTA 4FVMA 1LTGD 1VQDA 3DLLA 2KBNA 3FEWX 5M3FG 1PRTD 5CMDA 3T51B 3SDZA 4FF2A 1KLUD 4KKUA 2X69A 4A3EH 4DU9A 1Q12A 2F0QA 4C56C 3NSWA 1SMYD 4LJZC 2Q2TA 1K0SA 3GTLB 1YNND 1UE6A 3WDNA 5C4ZA 5C44H 2CWPA 2F0FA 4IALA 4IPGA 4A3KH 1Q46A 4KJNA 4NXMQ 4DR3Q 2Z9HA 1N34L 2OTLA 4BY7G 3MFGA 1DM0B 1WD1A 4FXDA 2D5DA 2FFKB 2NWGA 3CU7A 1YJNA 1TU2B 5ELOA 2NVTH 1Q1BA 1XJVA 3KJOA 4DR2Q 3HOUG 1X9NA 2EYLA 3PUVA 5LL6S 2JA5B 1L0XB 4X3SA 5JJIA 2AUKA 5D3IB 2YTVA 1N36L 5M5WH 4J6HA 5JAVA 2F0MA 1HR0L 2EJFC 4DR4L 3NP8A 5IP9G 3K7AB 3T1HQ 4DV7L 1Y1WH 5I2YA 1SRUA 2CCZA 2VUMG 2K7VA 4DUZL 4OO1G 3H91A 3ERQA 4ZKCB 4F7XA 3AQQA 4FF1A 1S3OA 4DK6C 1XMQL 1PXUA 2MO0A 4C3IH 3HOXG 2F4VL 3E0JA 3C1FA 2KVMA 3GP7A 3IL8A 4JCVE 5KIXA 2WIIB 3TRZA 1HNXL 5FO7B 1S5ED 5JEAG 4XT3B 5J39A 3K58A 2FINB 2MHVA 4JV5Q 3J81i 1SYCA 4K6DA 4A3GB 1CKNA 5ELCA 3A5ZB 4HR7B 5EQ0A 3T4AC 4JI6L 1MKHA 3I2ZA 4R4CA 1HZ9A 4OEMB 1GXDC 4LF6Q 1EYDA 4A93H 3GQBA 2B63H 2L55A 3RLFA 2OT2A 1PLFA 4LUVA 1M1KC 5IYBG 5J22A 3RN2A 2ZTDA 4DV0L 3RZOB 3CD6A 5EBDA 4PZ8A 3J7AV 1YNNC 3CRKC 4POGA 2VB2X 1VQ8A 3S1QB 3NELA 2XGTA 1G91A 4KD4A 3FP9A 4G7ZC 3EIVA 4MIUA 3FDTA 1F2LA 4ZK9B 2F0SA 4JBJA 4MTKA 2PCFB 2NVXB 2B39A 3ZYYX 1N34Q 2AUJD 2FXQA 1QWYA 4K0KL 1I94L 1I50H 2QDLA 3QJYA 3E5SA 1VQOA 5I6WA 5T1GA 1IKMA 2PZUA 1GUOA 1Y8OB 3HOWG 1LT4D 1UE5A 2ZXPA 5JJLA 3U4VA 5HY6A 4IJHA 3OIPA 1BCPB 2RCNA 4CDCC 4JI4L 1ICWA 3F2DA 4G7OC 2O2LD 1N36Q 4XQQA 1O80A 4LFCL 2OXPA 4DR4Q 1YITA 5EAYA 5EGTA 1GHKA 3R3OA 3CCEA 4IQZA 4GN4B 4DV7Q 1O7IA 1QVCA 2OEOA 4HN7A 2BDNA 4DUZQ 1H9SA 1RTOA 4IOCA 3S15H 3X3NA 4K5XA 1XMQQ 1BVSA 4LFAL 2HQLA 3L2PA 1STNA 4HMIA 2F4VQ 3OIQA 1NCVA 1BF4A 3NE5B 4LF8L 1C0AA 2ICEC 3QR8A 4R4IA 2YU9H 1HNXQ 2JA5G 1GKHA 2L12A 5FJ8H 4CKEA 3OTOL 4XYQA 1T9HA 3CRLC 4J15A 3A8JE 1FGUA 4K5VA 2IL8A 2F3WA 4JI6Q 2Y0SB 1EQTA 3NQTA 4XYOA 4CDFC 3AMUA 4QCLA 1PH9A 3GTPB 2I5HA 2AWOA 3VR2A 5JJKA 2LSSA 1X32A 2I5LX 4A3EB 2ZM6Q 1B44D 3AB9A 1D5ZC 4YCVA 2JP1A 2NZHA 1KAAA 1WTOA 2MQHA 2PI2E 4DV0Q 4ALPA 1EYGA 1F9QA 5C44B 4A3KB 1VQ9A 2IX3A 4UP7A 1SNQA 2ASBA 2DNCA 3TQYA 4IN3A 2ZTEA 3LNNA 3VYRA 4A3FG 1ZXTA 1HFNA 1YEZA 5L37A 5EPKA 1HQRD 3OMGA 4H13C 4RCNA 2CQOA 1GUSA 1IYUA 4YWMA 4POFA 3DM1A 2E2HH 5CR3A 2NVTB 4A3IG 4LUOA 4TKOB 2PQEA 4NDXA 1KNEA 3C2PA 4K0KQ 5M3MG 1I94Q 1WTHA 1SROA 4MHEA 1JB7A 5T1IA 5LMNL 2XWJB 2A69C 4X62L 3IFTA 2BOSA 4FO2A 4A3BH 5M5WB 3I3CA 1D6EC 4DR6Q 2A6ED 5D3DA 2AKWB 2EPBA 3BDLA 1OO9B 4WJ3M 4R9WA 5C4XH 1HZAA 2D0OA 1Y1WB 1B53A 1XNRL 3EFXD 2XRSD 4KY6A 4JI4Q 4M1UB 1RDPD 2AQ3B 3J7YW 1DOKA 1CT1D 4LFCQ 1PYBA 1N32L 4WRDA 5IGDA 1CKNB 4C3IB 3PO2H 1JOQA 4DV2Q 1TWFH 4C1NI 1EQVA 4QB4A 4TQUS 2V1CC 4O0AA 1I3QH 4CJ2C 4A4IA 3D4RA 3QWNA 3TP8A 1X56A 4LFAQ 2K01A 3PUXA 1BOSA 4LF8Q 5ELEA 1MJEA 2Z8LA 3W1BA 2N88A 2MO1A 3HKZB 3OW2A 2F1MA 3MHBA 3IFDA 1KRTA 1QZGA 5JJZA 3OTOQ 1VQIA 2KEEA 4A93B 4ZAIA 2F0PA 5FOBB 2B63B 4BBSG 4LUZA 2UU9L 1JICA 4DAVA 1WTVA 3VYUA 1BCPF 1QVGA 4KHPL 4QUFA 2WAQB 5IYCH 2PPBC 1EYCA 1XYIA 3AFPA 4IO9A 4MZ9A 1LTBD 4DN4M 1ENFA 1WTWA 2L15A 2A6HD 1ICFB 2HT1A 1WTRA 4O42A 2G9HD 2MUYA 4N9PA 4GNXC 4LFBQ 3V05A 2NUCA 2B3GA 2CKZB 1STEA 3HOVH 2I07B 4KN4C 4A3JH 3B6YA 4NPSA 1K8AC 2JEAI 1D1IA 3K5OA 5C4HA 3D4WA 1FNWA 3M7GA 3U9OA 3TZUA 1I50B 1W3SA 2ZJPA 3BJUA 3G6EA 1O7ZA 1A3VA 3NWSA 4CGYB 3IKJA 1SYEA 1UWVA 4BXXH 3MAQA 1PH7A 4LF7L 4NKLA 1EL0A 1H9SB 3ND9A 4A3EG 4X62Q 1A3TA 2UUAQ 4XTCS 2UXBL 5KEEA 1NUCA 4OL7A 5KNBA 4GNXA 2E2IH 2F0NA 5C44G 1TKWB 2R92H 5FLMH 4A3KG 4HCSA 3S2DH 5E7NA 4CJ1B 2UUCL 1KABA 1V1QA 3E3XA 1XNRQ 3L3OC 2VB3X 2EYHA 1EIYB 4FNFA 2NN6I 4L6TB 3P20A 5DLQE 2Q2IA 4HJ7A 1N32Q 3SK6A 3S15B 3RR5A 4JG2A 1TS3A 2RDFA 3VYSA 3A8KE 1CKOA 3OHXC 2FJ2A 2DY7A 3DXJC 3S1NH 1TS4A 4UAIA 5K36H 4IUQA 1VQ4A 3CCRA 1F2ZA 3BVMA 1LT3D 1LO5D 4APVA 4ID6A 2IHEA 5ELFA 2AQ1B 4WJ4A 1JWSD 2BE5C 4HMJA 4I65A 1Y1WG 5C3WA 1CA6A 4JI8L 4GKKL 1I6VC 3P1HA 3NPPA 2ICIA 3L7ZC 1N9WA 3I4NH 3FMCA 4UP8A 4JI5L 2UU9Q 1A62A 2K1BA 3CF5A 5BR8Q 4C3IG 1KTKA 1U4MA 4KHPQ 4R4OA 3ND8A 2A6HC 4WORA 5I9PA 4LF5L 3LWUA 1FNUA 1RODA 1DOLA 1HCZA 1I4QA 2R7DA 3NK9A 1EIFA 4X64L 1SAPA 2KOLA 2RBMA 4DF7A 4YHHL 4ULLA 4X3TA 1X54A 2UUBL 2XVSA 2F4IA 2E2HB 1TWHH 1YNXA 1TS5A 1L2FA 4A93G 1E2VA 2JA8H 1HPCA 3DHQA 4DUYQ 2B63G 1HTPA 4BY1H 2Q8IB 4A3BB 3D8GA 2WAQG 2E75C 3R8BA 2CW0D 3FKIH 3GTGH 4DV5L 3VR3A 4LF7Q 4KY7A 1HHVA 3QO2A 3DWAA 3R2IA 4EQNA 1G2TA 3T1YQ 3KLSA 3ZJYC 1BR9A 1WCMH 2UXBQ 1B8AA 4UHVA 1D8LA 2IHFA 3FPPA 3A0JA 5TSSA 2L11A 4P72A 4LAAA 4X66Q 2UUCQ 4B3ML 3PO2B 2F03A 4IUUA 1PRTF 4BA2I 2B2YA 1TWFB 1P8LA 1IXRA 1I3QB 4JI7L 2DY8A 1K83H 1II3A 1IL8A 1EU4A 2Q8RE 3VR6A 4MTNA 3JAML 2NZ1D 3BU2A 3Q22A 1R4PB 2QCPX 4HCEA 1EEFD 5LHY1 5I6YA 1KL9A 4Q5VA 1BBXC 1AP0A 1A8VA 1ZYRC 1PH4A 3T56B 4UP9A 1Z47A 2NN6H 2ENBA 4R1JA 1MI2A 2K6AA 4CHTB 1SNOA 1RIPA 4GKKQ 4QUCA 3AU7A 4X3UA 2EVBA 4JBKA 2OCEA 4JI5Q 5JVG3 4DKAC 4OWTB 1XNQL 2B8GA 3I4MB 2R7ZH 1YJ9A 1PFNA 2CHBD 2F0HA 5GQOA 3HOVB 3JC66 4A3JB 1MJCA 3KBGA 3MWYW 1LM0A 3A74A 1AZQA 1ML0D 4LF5Q 5FJ8G 2HHHL 2YYZA 4A3DH 3I4LA 2R93H 1YZ6A 4BBRH 4HTHA 4B3RL 3E9HA 3BYTB 3TREA 2F0KA 1K8MA 4EVOA 1OXUA 1KRSA 3M85A 4GNXB 1C7YA 5IGCA 3KLSX 1LYLA 4YHHQ 5E3FA 2UUBQ 4IFDJ 2WB1B 3V2TA 2O5JC 1TY2A 3M3YH 2Z4HA 2N78A 4OIJA 1C4QA 2IX1A 1FGBD 5CV5A 2E2JH 1F77A 4NP5A 1HQMC 5EKIA 4KKTA 2K03A 2JA7G 3STBD 2RF4A 3I7FA 1IYVA 1TWCH 2R92B 4DV5Q 3NWTA 2MFIA 2E2IB 2WACA 1E7ZA 1KDAA 1HH2P 4IUNA 3S2DB 4YCUA 1V8QA 1D5MC 2IW3A 1PZJD 2VZAA 1A2UA 4RCOA 2CWAA 2EYPA 5DEHA 5E1FA 3MXGA 1A63A 3A7AB 1GVPA 1J8IA 2K5HA 3CCMA 3OSOA 1F9RA 1PFBA 4JOIC 2UXCL 1FYCA 3W5OA 4A3MH 2A19A 1K28A 1N8RC 1L1OC 5BN5A 4QIWE 5IT9L 4B3MQ 1JE5A 3N52A 4DFAA 1A6XA 1XWEA 1J6QA 3S1NB 4JI7Q 4YCWA 2NZOA 2G9DA 2K28A 4A3BG 4AH6A 4KV6A 4LF9L 2NTSA 3KOJA 3UDIA 1MSGA 5C0XJ 3AFQA 4JI3L 1U4PA 2WAQE 4JPBW 4KHVA 1GM5A 2YV5A 5LMUL 5M9OA 5JVH3 2EYMA 3U58A 4FP5D 3J81E 2LS01 2VXWA 1SE8A 2HUGA 3I4NB 1U0LA 3CC4A 2AWNA 4KY5A 4CDEC 1VQFA 3ONAB 3HRZC 4IURA 4JOIA 1LT5D 4DNTB 4LF4L 4HEDA 1L1OA 4ZRZA 1D5XC 1JJCB 2NVQH 1IHZA 3A55A 1Q81C 1VQ6A 3S1RH 1VQJA 4IFDI 4CDDC 2EYJA 4GKJL 4DV1L 1STGA 2HIXA 1KIXA 3FHWA 5DM73 1QILA 3J80E 3KF6B 1EZ8A 4ME3A 5CBEE 1JCKB 2HCIA 2K5DA 4HIDA 5CYUA 4Z9CB 1IL2A 3I8ZA 2E2DC 2HHHQ 2XNAC 1TWHB 5GADC 1VMPA 2F0DA 1Q1EA 2JA8B 1JB3A 3LGJA 4BY1B 3FPUB 3CCJA 1GUWA 5IYCG 3FKIB 3GTGB 1JOOA 3TZDA 3STBC 1U4RA 4AIMA 1EQRA 2F0GA 1PRTC 4C2MH 4JI1L 5JEAJ 3I4MG 1WCMB 3D0FA 1SN8A 3CCQA 3I70A 4QY7A 3SK4A 3HOVG 1SMYC 1LV9A 3RZDH 4A3JG 2FMCA 2H5XA 2Q2HA 5C0XI 4ME5A 1X3GA 4CKBA 4P75A 1TIID 1SYBA 4DNRB 1KD1C 3R2TA 2VNUD 1T5XD 1VQ7A 2UXCQ 5E4XA 1DD2A 1K83B 2F0UA 2WB1G 5FLXc 2K52A 1S72A 1QNUA 2WV6D 4CJ0B 2F52A 1CK1A 4DGZA 1WJJA 1ILPA 4IJLA 1E1TA 3K5LA 5NUCA 2KCCA 4ILWA 4FYDA 3Q6SA 4B3SL 4J8QA 4LF9Q 1CFMA 1E24A 1SE3A 5FLMG 4S3SA 2VQEL 3RNUA 1YNJD 3TSSA 1XTCD 2MP1A 3SVMA 1OXSC 1WYDA 2A68D 3PUYA 3D4DA 1HR0Q 3KK7A 5CV6A 3GV6A 3U9SA 4AQYL 1EY6A 4LF4Q 2D0PA 2R7ZB 1BO0A 4OO1I 2KHIA 2XIWA 5FO9B 2B2WC 1VCIA 1E2ZA 1LLRD 3K59A 4DV1Q 4GKJQ 3M4PA 3HOYH 5CGKA 1YVCA 4A3DB 1STYA 2R93B 4RGTA 1Z6HA 2OWOA 4BBRB 4IUVA 1OTCA 4JBMA 1CKMA 1BDOA 3AEVA 1ILQA 4NMZA 1VQ5A 2EY1A 4RHSA 3M3YB 3MVVA 4QQBX 4R8NA 4K2LA 1SMXA 1L0YB 3I4NG 3E6ZX 1TR5A 1HNZL 2E2JB 1EUJA 3MXNA 5GAHC 2FHTA 1KHIA 2F0TA 3MEFA 1ONLA 4IFDH 1KDBA 2NB0A 2C5CA 4XT1B 3MZ5A 1HNWL 3DMUA 2BDOA 4A3LH 1CM9A 1HFGA 2B2WA 1HZBA 3VYTA 1KNAA 2QILA 3WOFA 1RCVD 4JI1Q 1GHJA 1IYJB 2A5HA 3F1ZA 1FD7D 4DAYB 4A3MB 4KK7A 2BH2A 2I5MX 4OXPA 2N49A 3WWVA 2JA8G 1PV4A 3RN5A 1P16A 1VQKA 1NBWA 2JSOA 4A3GG 5EBCA 2GA4B 2N8NA 3J81L 5ELDA 1L1OB 3FKIG 5D14A 1Q86C 3KUPA 3M4OH 4K8JA 2K33A 1EFID 2A74C 5D65A 1K8OA 4B3SQ 4NXNL 1WCMG 2JXMB 5C0XH 4G57A 2L4NA 3KLRA 2VQEQ 1WTPA 3J80L 4GLAC 4BY7H 2IPKD 2NVQB 5CORA 1SE4A 3S1RB 3S2HH 2KUMA 1GD7A 3TP7A 1HRJA 4PMCA 1BKBA 4AQYQ 1JR0D 3I4OA 4P2CB 2DNEA 1CHQD 2WB1E 1TWGH 2PMZE 1ET9A 1JC7A 4PMBA 3GD7A 2Z1CA 1OXTA 1H9MA 4JI2L 4YY3L 4L63B 3U4ZA 1RJTA 2E8GA 4KKSA 5I9OA 4DV6L 3KDFA 2NN6G 2LY7A 4DR1L 5IP9H 1TQOA 2CQAA 3K7UC 3ULPA 5EKKA 2Z6KC 3CKIB 1LTAD 1U4LA 3HZXA 3NBIA 1IKLA 1HNZQ 4OO1H 1MGSA 4H02A 3P75A 3RMHA 1DXMA 4QF4A 4XIGS 2PNRC 4C2MB 1HNWQ 1SYDA 2R7ZG 3CCLA 4YIJA 3RZDB 1PH1A 1CZWA 4JBWA 4OWXB 1E0BA 2K32A 2K5WA 5FKAC 4A3DG 2VL6A 2R93G 1E3PA 4N8FA 4BBRG 2KEDA 1SLJA 3SEBA 1PRTB 2E76C 5G3LD 5GAEC 3I56A 1NNXA 1C8CA 3CCUA 3S17H 1D1KA 1A3UA 3PF5A 1YHAA 2F3IA 2ZTCA 5HURA 2Z6KA 2G5DA 3G71A 3V96A 3F2BA 2N3SA 4HIOA 3BYYB 3FRPB 4RAUC 1IBLL 1PYSB 1GJXA 1K73C 4UDUC 1JORA 2Y0SG 1VF5C 3I72A 4K6LA 5IYBH 1H9JA 1I4PA 5CBAE 3EA6A 3OWEB 2KCTA 4O2DA 2A6EC 2LXJA 5LMNQ 1PFSA 3TS2A 3CMAA 1XPOA 2EIFA 3I90A 2YTYA 4N9TA 3CPFA 4RWSC 1VQCA 1PTOD 4HAEA 2JQOA 1PA6A 1YIJA 4LWCA 4A3MG 3KYHC 2F0VA 3D6CA 2SNMA 1QOHA 3JAMi 2XTIA 3URYA 4ZCKA 2RCFA 3PV0A 1M90C 1WD0A 2OF1A 1SYGA 1EQQA 3MXNB 3HOYB 1T5EA 1X3QA 2X6LA 1HTLD 2RHSB 3K6OA 3CCVA 3HOWH 2E5LL 4HIKA 1RL2A 1NMFA 2KJXA 2YU9B 1HUNA 1Q8KA 3LX0A 4JI2Q 2OQKA 4YY3Q 1E22A 5EKLA 1MBYA 2XN9C 4DV6Q 4P73A 1SNCA 1VQEA 4DR1Q 4GN5A 5CV7A 1DCZA 1X3EA 3H0GH 2SDFA 3AYHB 3K81C 1X3FA 5FK9C 5EPJA 5C6AA 3W3AA 4K14A 4IZ8A 4EX5A 3HOZH 1J5EL 5M5YH 1YI2A 1DGSA 3F2CA 4C3JH 1JQYD 2KENA 3HFZB 1Q82C 1VQMA 3C3LA 1UAPA 1SNDA 2ID0A 1NR2A 1SXTA 1BUVT 1W6KA 5IE8A 2E74C 1A2TA 3NTHA 2F0LA 2UXDL 2F0JA 3QIAA 4GOPC 4K5WA 1VMCA 4IUTA 4FF3A 4RHRA 1O7LA 3HKZG 4OWWB 2KCMA 3BG3A 2M2LA 5IGEA 3T53B 4LMQD 2K5QA 2LFNA 1W2BA 1SFOH 4RKBA 4KI0A 3M4OB 3EVQA 5EPLA 1IBLQ 2C35B 5C5LA 3KFUA 3CQZH 3OWFA 3KF6A 3J7A5 2EY2A 2QGQA 1QJOA 1VQHA 5KNDA 2LXKA 2TMPA 1MD2D 4B9WA 1U5KA 1PTOC 1B50A 5C4XB 3S14H 4DR7L 4BY7B 3TN2A 2IT1A 1Q90A 3HEJA 1G8ZD 1YHBA 1SJHD 4XQNA 1IW7D 1BBWA 4A3FH 3S2HB 1WTQA 4ZKBB 3PO3H 1HXYD 1WOCA 4CBVA 5ELNA 3GO5A 3KDFB 3D6WA 1CTMA 3TP6A 1KQSA 3Q24A 1ASYA 1PTOH 4OGQC 5COYA 2I0QA 4JYAL 4A3IH 2L0CA 2IX0A 4L5QA 4MN3A 3DEPA 3MA2B 5M3MH 1TWGB 5CV9A 3MEHA 4OHJA 5C4JH 1X6OA 2IJ0A 3TS0A 5A35A 4A3CH 1WTXA 3HKSA 2E5LQ 4ZYSA 2Y0SE 3VDYA 1VQLA 1JMCA 4UPAA 4RGMA 4HJ8A 1YHQA 3PGZA 1AH9A 4DXGA 4IOAA 2WKCA 1PFMA 2L5TA 5LL6X 1HA6A 2MJ8A 1NE3A 3DM3A 4JI8Q
chains in the Genus database with same CATH topology
1VDZA 2NYZD 2ZXOA 1V1OA 1Y8NB 4V190 2EE1A 2PW5A 3OW7A 3D31A 4B08A 4PMWA 2B2TC 1STHA 3S17B 3BDOA 4TSSA 3VA5A 3QB3A 1RHPA 4ZLTF 2SNSA 2B8FA 5KNCA 3PUZA 5JOBA 2D2CC 1JOKA 4RH6A 3CHBD 2WINB 1NR4A 4PNYA 3HG9A 2CW0C 2N55A 5DNFA 4AYBB 3MXPA 4XDXA 2QKIC 4ZQ3A 3H94A 1V1PA 4R8IA 1CQFA 3OPOA 3SE0A 2H1EA 2XSCA 3K0YA 2XWBB 5KGUA 3I73A 3K57A 2TSSA 1PYWD 4ODGA 4ZUJA 1D2BA 5C0XG 1SSOA 3BVZA 3PMFA 4DAYA 2R6GA 5IGGA 1TS2A 3H0GB 3DEOA 1SNMA 1ENAA 3FVQA 2Z4IA 1LT6D 2O4XA 5IOCA 2HCCA 3HOZB 3RUZA 5M5YB 1F2YA 2R61A 4C3JB 4RKLA 1OXVA 1DYQA 2I46A 2BCOA 5CC4A 5I2XA 2RA4A 5J1ZA 4F8MA 4L8JA 2WP8J 2HQEA 2KCNA 3RD4A 1S5FD 2BA0A 1LTID 3KBXA 3HGBA 4TRDA 1SFOB 5JPMC 1LTTD 3CQZB 3SK8A 4DK0A 2EOTA 4RA8A 4LK1C 4KHZA 3G6JB 2KHSA 3S14B 4EQPA 4KMUC 2JEBI 1Q3LA 4XXEA 4A3FB 1XX8A 1V43A 3PO3B 4DXFA 1WVLA 1RKNA 3BZDB 2IWHA 1PTOB 2ZT9C 5IODA 4K2KA 4H0LC 1GUTA 4A3IB 2RSOA 2J0TD 5M3MB 2RVLA 2RKSA 2F0OA 3I91A 1F9SA 5C4JB 4NW2A 1ESFA 1AW7A 1S4ZA 1HA5A 1EY4A 2EDGA 1DOMA 3K5MA 2RSNA 1CHPD 1EY5A 3A8IE 1EWCA 1I4HA 1Y8PB 5A2QE 2A73B 5HGTA 4BA1I 3Q23A 2J7ZA 1C48A 3C1EA 1PZID 1ZKOA 5DAUA 4G7HC 1EZ6A 3BDCA 1S5BD 4DAPA 1SE2A 1GOZA 2L1BA 1S5CD 2A69D 1SNPA 3EJIA 1PMRA 5K36G 2DN8A 2PW7A 1NAPA 4EQOA 3EQLC 4DK1A 1B9MA 2M9VA 2JE6I 4BBSB 1EY0A 1V1PB 3T16A 2KECA 1VF7A 2MGSA 4BS9A 4WFN3 1S5DD 2HDMA 4M8AA 4F88A 1RD9D 2JYOA 1B3AA 1TWCB 4C3JG 3Q0AA 3WOEA 1G291 2LMCB 2QEJC 1EOTA 5I4DA 4FXKC 4F87A 4G4KA 2X6GA 2QDBA 1EEID 2BA1A 4ZUIA 4B9XA 1CQVA 3MC0B 1Z7TA 5CV8A 4BWGB 2PO4A 1QNKA 2CVRA 4O1NA 5G3LF 1TY0A 1B9NA 2EY5A 1QCBD 1MSHA 1AEXA 5JPNC 1ESRA 1QB5D 1YNJC 4H7BA 4HSVA 3H09A 2A68C 3J7AF 4U673 1A15A 1SBBB 3GTJB 1TT2A 1XXGA 3PUWA 5ELBA 1GUNA 1PTOF 5KYIA 3QOJA 2EY6A 2EJMA 3GTKB 1PZKD 4ABNA 3TP5A 1SEBD 3SXHA 3S9WA 4C3HB 2B2VC 5C3EB 5BN4A 3NUCA 4C1NK 3N6RA 5KYLA 3PIP3 1OXXK 2L9HA 3S1MB 3H3VC 5E4WC 1CI3M 4J1MA 2RDHA 2C9OA 4E6IA 2D9UA 3A56A 3PIO3 1SYFA 2R3ZA 4QIWB 1KLGD 2QF7A 4WJWA 5KRUA 3QG1A 1I4RA 3DUZA 3IAYA 1TVXA 1SJED 1H9RA 1B2TA 5JEAH 5M5XB 2H4OA 1TWAB 2BE5D 2F0EA 3VR4A 1BNZA 3M7NA 2B2VA 1DJRD 4RGNA 3JAME 1I6HB 3UI2A 3BS1A 5A2QL 3GTMB 4OIKA 2NVYB 5F2DA 3M4YA 3TBIB 2LKVA 1CZGA 1AN8A 2M00A 1W6JA 2JA6B 5IIFA 4CKCA 4GZYC 3SHLA 3VR5A 1STBA 4EGVA 1HUMA 2D62A 4JK1C 2PYKA 3MFYA 1Y1VB 2RDGA 1QG7A 1FR3A 5BN3A 1BXTA 1I4GA 3X3MA 1EYAA 2HDLA 1UNSA 3C46A 1STAA 4Y7NB 3GTOB 1LTRD 4PQXA 5C3XA 4DA2A 1ENCA 4KN7C 5FLXE 3P7JA 1E2WA 1EY7A 2EYFA 3OOCA 1RTNA 4KJOA 1EU3A 3D3RA 3OMCA 1EWHA 3H6MA 3F2UA 2O5IC 1M8AA 1O7YA 1UUPA 1GUGA 3SR1A 4RFBA 2MPMA 5IGFA 3NHHA 1R4QB 4K8IA 4IUPA 5CV4A 1BCPD 5IT9E 2FMMA 3GV3A 3HS0C 1ZYRD 1DZ1A 4XQJA 1PDQA 3VA7A 1LABA 4C3HG 1SDFA 1RF2D 5DM63 2SEBD 1DONA 1O78A 2EZVA 2JA7B 2XRQD 3DWQA 1G2SA 1CA5A 1JWMD 4RGOS 4H44C 5M3FB 1B1ZA 2F0IA 2EJGC 3EROA 1B4OA 1F9PA 1J9OA 4U68A 1EY9A 3NBHA 2ZXRA 2EXZA 1AFPA 2B2YC 1Q8IA 1EIGA 3LWEA 2NBFA 1M4VA 1H9KA 2V4DA 4PV1C 3QOLA 1ET6A 1NSNS 4HSPA 3HOUB 2AQ2B 4X3KA 1R9TB 2K04A 3L9AX 1LACA 3MXUA 2PZTA 2SOBA 3A54A 3GTQB 1UEAB 1G6ZA 5IGBA 3R93A 2WKDA 3HP3A 3NQIA 3NTIA 3TDQA 2VUMB 1X3PA 3TMEA 3HOXB 3BVGA 1EIHA 2F0WA 5EJWA 1BCPC 1U9RA 2J4XA 1ZEQX 4KTAA 3S16B 4QMGA 4V0BA 5K5PA 2KQ3A 1I4XA 3W2DA 3MTSA 5ISRA 4FF4A 2B2UC 3ITPA 3O13A 3A7LA 2F3VA 5AFWA 1AZPA 2EYOA 3G7LA 4Q0FA 1JE4A 2Q8TA 4FXGC 2KA7A 4IFDG 3SK5A 5C5MA 1JWUD 1BQQT 2RQXA 3KF8A 4KD3A 1F2MA 3NXWA 4I7ZC 2PZWA 1EY8A 2B2TA 1IW7C 3T13A 1LTSD 2K05A 3DWPA 2B2UA 2PMZB 1Y69U 5FO8B 5FLXL 1KDCA 1FNVA 1QE6A 3K5NA 3NTKA 3HOWB 2NTTA 4FVMA 1LTGD 3FEWX 1PRTD 5CMDA 3T51B 3SDZA 4FF2A 1KLUD 4KKUA 2X69A 4DU9A 1Q12A 2F0QA 4C56C 3NSWA 1SMYD 4LJZC 3GTLB 1YNND 3WDNA 5C4ZA 2F0FA 4IALA 4KJNA 3MFGA 1DM0B 1WD1A 4FXDA 2D5DA 2FFKB 2NWGA 3CU7A 1TU2B 1Q1BA 2EYLA 3PUVA 5LL6S 2JA5B 1L0XB 4X3SA 2AUKA 5D3IB 4J6HA 5JAVA 2F0MA 2EJFC 3NP8A 3K7AB 5I2YA 2K7VA 4OO1G 3H91A 3ERQA 4ZKCB 4F7XA 4FF1A 1PXUA 3E0JA 3C1FA 2KVMA 3GP7A 3IL8A 5KIXA 2WIIB 5FO7B 1S5ED 5JEAG 4XT3B 5J39A 3K58A 2FINB 2MHVA 1SYCA 4K6DA 4A3GB 5ELCA 3T4AC 4HR7B 5EQ0A 1GXDC 1EYDA 3GQBA 2L55A 3RLFA 2OT2A 1PLFA 5J22A 3RZOB 5EBDA 3J7AV 1YNNC 3CRKC 2VB2X 1G91A 3S1QB 4KD4A 4G7ZC 4MIUA 3FDTA 1F2LA 4ZK9B 2F0SA 2PCFB 2NVXB 2B39A 3ZYYX 2AUJD 1QWYA 3QJYA 3E5SA 5I6WA 5T1GA 1IKMA 2PZUA 1GUOA 1Y8OB 1LT4D 2ZXPA 3OIPA 1BCPB 1ICWA 4G7OC 2O2LD 4XQQA 1O80A 2OXPA 5EGTA 1GHKA 3R3OA 4IQZA 2OEOA 4HN7A 2BDNA 1H9SA 1RTOA 3X3NA 4K5XA 1STNA 4HMIA 3OIQA 1NCVA 1BF4A 3NE5B 2ICEC 2L12A 4CKEA 4XYQA 3CRLC 3A8JE 4K5VA 2IL8A 2F3WA 2Y0SB 1EQTA 3NQTA 4XYOA 3AMUA 4QCLA 3GTPB 2AWOA 3VR2A 1X32A 4A3EB 1B44D 3AB9A 1D5ZC 2JP1A 1KAAA 1WTOA 1F9QA 5C44B 4A3KB 2IX3A 1SNQA 2DNCA 4IN3A 3VYRA 3LNNA 1ZXTA 1HFNA 5EPKA 1HQRD 3OMGA 4H13C 4RCNA 1GUSA 1IYUA 3DM1A 5CR3A 2NVTB 4TKOB 2PQEA 4NDXA 1KNEA 3C2PA 4MHEA 5T1IA 2XWJB 2A69C 3IFTA 2BOSA 4FO2A 5M5WB 3I3CA 1D6EC 2A6ED 5D3DA 2EPBA 3BDLA 1OO9B 4R9WA 1Y1WB 1B53A 3EFXD 2XRSD 4KY6A 4M1UB 1RDPD 2AQ3B 3J7YW 1DOKA 1CT1D 4WRDA 5IGDA 4C3IB 1JOQA 4C1NI 1EQVA 4QB4A 4TQUS 4CJ2C 3D4RA 3QWNA 3TP8A 2K01A 3PUXA 1BOSA 5ELEA 2Z8LA 2N88A 3HKZB 2F1MA 3MHBA 3IFDA 5JJZA 2KEEA 4A93B 4ZAIA 2F0PA 5FOBB 2B63B 1JICA 4DAVA 1WTVA 3VYUA 1BCPF 4QUFA 2WAQB 2PPBC 1EYCA 1XYIA 1LTBD 4DN4M 1ENFA 1WTWA 2A6HD 1WTRA 4O42A 2G9HD 2MUYA 4N9PA 3V05A 2NUCA 1STEA 2I07B 4KN4C 2JEAI 1D1IA 3K5OA 5C4HA 3D4WA 1FNWA 3M7GA 3U9OA 3TZUA 1I50B 1O7ZA 1A3VA 3NWSA 4CGYB 3IKJA 1SYEA 3MAQA 4NKLA 1EL0A 1H9SB 3ND9A 1A3TA 4XTCS 5KEEA 1NUCA 4OL7A 5KNBA 2F0NA 1TKWB 4HCSA 4CJ1B 1KABA 3L3OC 2VB3X 2EYHA 4FNFA 2NN6I 4L6TB 3P20A 3SK6A 3S15B 3VYSA 1TS3A 2RDFA 3A8KE 3OHXC 2FJ2A 2DY7A 3DXJC 1TS4A 4UAIA 5K36H 4IUQA 1F2ZA 3BVMA 1LT3D 1LO5D 4ID6A 5ELFA 2AQ1B 1JWSD 2BE5C 4HMJA 4I65A 5C3WA 1CA6A 1I6VC 3P1HA 3NPPA 2ICIA 3L7ZC 3FMCA 2K1BA 4C3IG 1KTKA 1U4MA 3ND8A 2A6HC 4WORA 5I9PA 3LWUA 1FNUA 1RODA 1DOLA 1HCZA 1I4QA 3NK9A 1SAPA 2KOLA 2RBMA 4DF7A 4ULLA 4X3TA 2XVSA 2F4IA 2E2HB 1TS5A 1E2VA 1HPCA 3DHQA 1HTPA 2Q8IB 4A3BB 3D8GA 2E75C 3R8BA 2CW0D 3VR3A 4KY7A 1HHVA 3QO2A 3DWAA 3R2IA 4EQNA 1G2TA 3KLSA 1BR9A 3FPPA 5TSSA 2L11A 4LAAA 3PO2B 2F03A 4IUUA 1PRTF 4BA2I 2B2YA 1TWFB 1I3QB 2DY8A 1II3A 1IL8A 1EU4A 2Q8RE 3VR6A 3JAML 2NZ1D 3Q22A 1R4PB 2QCPX 4HCEA 1EEFD 5LHY1 5I6YA 4Q5VA 1BBXC 1AP0A 1ZYRC 3T56B 1Z47A 2NN6H 2ENBA 1MI2A 2K6AA 4CHTB 1SNOA 4QUCA 3AU7A 4X3UA 2EVBA 5JVG3 2B8GA 3I4MB 1PFNA 2CHBD 2F0HA 3HOVB 4A3JB 3KBGA 3MWYW 1AZQA 1ML0D 2YYZA 3I4LA 4HTHA 3BYTB 2F0KA 1K8MA 4EVOA 1OXUA 3M85A 5IGCA 3KLSX 5E3FA 4IFDJ 2WB1B 3V2TA 2O5JC 1TY2A 2Z4HA 4OIJA 1C4QA 2IX1A 1FGBD 5CV5A 1F77A 4NP5A 1HQMC 5EKIA 4KKTA 2K03A 1IYVA 2R92B 2E2IB 3NWTA 2WACA 1KDAA 4IUNA 3S2DB 1V8QA 1D5MC 2IW3A 1PZJD 1A2UA 5DEHA 4RCOA 2EYPA 5E1FA 3MXGA 3A7AB 1J8IA 3OSOA 1F9RA 1PFBA 1FYCA 5BN5A 5IT9L 3N52A 4DFAA 1A6XA 1XWEA 3S1NB 2G9DA 2K28A 4KV6A 2NTSA 1MSGA 5C0XJ 1U4PA 4KHVA 5M9OA 5JVH3 2EYMA 4FP5D 3J81E 2LS01 2VXWA 2HUGA 3I4NB 2AWNA 4KY5A 4IURA 3ONAB 4DNTB 3HRZC 1LT5D 4HEDA 4ZRZA 1D5XC 1IHZA 3A55A 4IFDI 2EYJA 1STGA 5DM73 1QILA 3J80E 1EZ8A 5CBEE 1JCKB 2HCIA 2K5DA 5CYUA 4Z9CB 3I8ZA 2E2DC 2XNAC 1TWHB 1VMPA 2F0DA 1Q1EA 2JA8B 1JB3A 4BY1B 3FPUB 1GUWA 3FKIB 3GTGB 1JOOA 3TZDA 1U4RA 2F0GA 1PRTC 5JEAJ 1WCMB 3I70A 3SK4A 1SMYC 1LV9A 2FMCA 5C0XI 4ME5A 4CKBA 1TIID 1SYBA 4DNRB 3R2TA 2VNUD 1T5XD 5E4XA 1DD2A 1K83B 2F0UA 1QNUA 2WV6D 4CJ0B 1CK1A 4DGZA 1ILPA 3K5LA 5NUCA 2KCCA 4ILWA 4FYDA 3Q6SA 4J8QA 1CFMA 1SE3A 4S3SA 1YNJD 3TSSA 1XTCD 2MP1A 3SVMA 1OXSC 2A68D 3PUYA 3D4DA 3KK7A 5CV6A 3GV6A 3U9SA 1EY6A 2R7ZB 1BO0A 4OO1I 2XIWA 5FO9B 2B2WC 1VCIA 1E2ZA 1LLRD 3K59A 5CGKA 4A3DB 1STYA 2R93B 4RGTA 1Z6HA 4BBRB 4IUVA 1BDOA 1ILQA 4NMZA 2EY1A 4RHSA 3M3YB 3MVVA 4R8NA 4K2LA 1L0YB 3E6ZX 1TR5A 2E2JB 3MXNA 2FHTA 2F0TA 1ONLA 4IFDH 1KDBA 2NB0A 2C5CA 4XT1B 3MZ5A 3DMUA 2BDOA 1CM9A 1HFGA 2B2WA 3VYTA 1KNAA 2QILA 3WOFA 1RCVD 1GHJA 2A5HA 1FD7D 4A3MB 4KK7A 2JSOA 5EBCA 2GA4B 3J81L 5ELDA 5D14A 3KUPA 4K8JA 2K33A 1EFID 2A74C 5D65A 1K8OA 2JXMB 5C0XH 4G57A 2L4NA 3KLRA 1WTPA 3J80L 2IPKD 2NVQB 5CORA 1SE4A 3S1RB 2KUMA 3TP7A 1HRJA 4PMCA 1JR0D 4P2CB 2DNEA 1CHQD 1ET9A 1JC7A 4PMBA 3GD7A 2Z1CA 1OXTA 1H9MA 4L63B 1RJTA 4KKSA 5I9OA 2NN6G 2LY7A 1TQOA 2CQAA 5EKKA 3CKIB 1LTAD 1U4LA 3HZXA 3NBIA 1IKLA 4OO1H 1MGSA 3P75A 3RMHA 1DXMA 4QF4A 4XIGS 2PNRC 4C2MB 1SYDA 4YIJA 3RZDB 1CZWA 4JBWA 1E0BA 2K32A 2K5WA 5FKAC 2KEDA 3SEBA 1PRTB 2E76C 5G3LD 1C8CA 1D1KA 1A3UA 5HURA 3V96A 3BYYB 3FRPB 4RAUC 1GJXA 4UDUC 1JORA 1VF5C 3I72A 4K6LA 1H9JA 1I4PA 5CBAE 3EA6A 3OWEB 2A6EC 3I90A 4N9TA 4RWSC 1PTOD 4HAEA 2F0VA 3D6CA 2SNMA 1QOHA 3URYA 3PV0A 1WD0A 2OF1A 1SYGA 3HOYB 1T5EA 1X3QA 2X6LA 1HTLD 3K6OA 2KJXA 2YU9B 1HUNA 3LX0A 5EKLA 1MBYA 2XN9C 1SNCA 5CV7A 1DCZA 2SDFA 5FK9C 5EPJA 5C6AA 3W3AA 4K14A 4IZ8A 1JQYD 3C3LA 1UAPA 1SNDA 2ID0A 1NR2A 1SXTA 1BUVT 1W6KA 2E74C 1A2TA 3NTHA 2F0LA 2F0JA 3QIAA 4K5WA 1VMCA 4IUTA 4FF3A 4RHRA 1O7LA 3BG3A 2M2LA 5IGEA 3T53B 4LMQD 2K5QA 2LFNA 4RKBA 4KI0A 3M4OB 3EVQA 5EPLA 5C5LA 3OWFA 2EY2A 1QJOA 5KNDA 2TMPA 1MD2D 4B9WA 1PTOC 1B50A 5C4XB 4BY7B 3TN2A 2IT1A 1Q90A 3HEJA 1G8ZD 1SJHD 4XQNA 1IW7D 3S2HB 1WTQA 4ZKBB 1HXYD 4CBVA 3GO5A 3D6WA 1CTMA 3TP6A 3Q24A 1PTOH 4OGQC 5COYA 2L0CA 2IX0A 4MN3A 3DEPA 3MA2B 1TWGB 5CV9A 3MEHA 4OHJA 2IJ0A 5A35A 1WTXA 4ZYSA 4RGMA 4DXGA 2WKCA 1PFMA 2L5TA 5LL6X 1HA6A 2MJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Q A;  3RUZ A;  1STA A;  5C6A A;  1SNQ A;  2F0T A;  2EY6 A;  1F2Y A;  3P75 A;  5E3F A;  4KD4 A;  1SNP A;  1KDB A;  4RKL A;  3EJI A;  4K14 A;  4MIU A;  4QF4 A;  3V2T A;  3D4W A;  5C4H A;  3MZ5 A;  2PZT A;  4IZ8 A;  3U9O A;  5C4Z A;  5C3X A;  2SOB A;  1SYD A;  1ENC A;  1JOO A;  2F0F A;  2PW5 A;  2PW7 A;  3DHQ A;  3DMU A;  3OMG A;  4IAL A;  5CV5 A;  4YIJ A;  5J1Z A;  2F0S A;  4KJN A;  4EQO A;  4NP5 A;  3TP5 A;  5IGB A;  1A3V A;  1STH A;  4F8M A;  5CR3 A;  2HQE A;  3SXH A;  1EY7 A;  3D8G A;  2EYF A;  1SYE A;  3S9W A;  2F0G A;  1EY0 A;  2PQE A;  1SND A;  3NUC A;  4NDX A;  4KJO A;  3VA5 A;  3QB3 A;  4NKL A;  5KYL A;  1A2T A;  4KY7 A;  2F0L A;  3E5S A;  3T16 A;  2WAC A;  3OMC A;  3TME A;  2F0J A;  3SK4 A;  1KDA A;  4IUN A;  3H6M A;  4TRD A;  4K5W A;  4EQN A;  5I6W A;  1A3U A;  1A3T A;  2PZU A;  2SNS A;  2F0W A;  1A2U A;  4J1M A;  5DEH A;  2EYP A;  3SR1 A;  5E1F A;  4E6I A;  1NUC A;  3BDL A;  4OL7 A;  1U9R A;  4ME5 A;  2EYL A;  2F0N A;  5JOB A;  5HUR A;  5IGE A;  1JOK A;  3SK8 A;  1SYF A;  5IGF A;  3NHH A;  3OSO A;  1SYB A;  4KTA A;  4K8I A;  1KAB A;  4RKB A;  5CV4 A;  4LAA A;  4PNY A;  4QMG A;  2KQ3 A;  3EVQ A;  5K5P A;  2F0U A;  4KY6 A;  4J6H A;  5JAV A;  2F0M A;  2KHS A;  5KRU A;  4EQP A;  1JOR A;  5C5L A;  2EYH A;  2OXP A;  5ISR A;  3MXP A;  4DFA A;  4DGZ A;  3NP8 A;  3OWF A;  2EY2 A;  5EGT A;  3ITP A;  3R3O A;  5CC4 A;  4WRD A;  5IGD A;  4ZQ3 A;  5NUC A;  3SK6 A;  5M9O A;  2F3V A;  4B9W A;  2F0E A;  1II3 A;  1JOQ A;  4K8J A;  4KV6 A;  2OEO A;  2EYO A;  1RKN A;  2RDF A;  1EQV A;  3ERQ A;  4N9T A;  4QB4 A;  3HEJ A;  3SK5 A;  4K2K A;  4F7X A;  4G57 A;  5IOD A;  4S3S A;  2QDB A;  4K5X A;  5C5M A;  4ZUI A;  4KHV A;  4B9X A;  5I6Y A;  3TP8 A;  4KD3 A;  1STN A;  4HMI A;  1F2Z A;  2F0V A;  3C1F A;  3D6C A;  5CV8 A;  2RKS A;  5F2D A;  3TP6 A;  1F2M A;  2EYM A;  2F0O A;  3NXW A;  2F0I A;  5KGU A;  5KIX A;  2SNM A;  3ERO A;  2EY5 A;  4ID6 A;  2PZW A;  2LKV A;  4KY5 A;  3D4D A;  4HMJ A;  1EY8 A;  4I65 A;  3TP7 A;  2M00 A;  3MHB A;  4PMC A;  2OF1 A;  1SYG A;  2ENB A;  5CV6 A;  5CV9 A;  1EY4 A;  1EY6 A;  3MEH A;  5C3W A;  1AEX A;  1EY9 A;  5IIF A;  5KEE A;  1SNO A;  5J39 A;  2EXZ A;  3P1H A;  4K5V A;  4ODG A;  1SYC A;  1IHZ A;  2F0P A;  3SHL A;  1STB A;  3T13 A;  4K6D A;  4EVO A;  4ZUJ A;  2F3W A;  1EY5 A;  2EYJ A;  3PMF A;  4H7B A;  2PYK A;  1STG A;  3NQT A;  5CGK A;  1EYC A;  5HGT A;  1STY A;  5IGC A;  5IGG A;  4PMB A;  1EYD A;  3LX0 A;  1EZ8 A;  1EYA A;  2F0H A;  1KDC A;  3C1E A;  4WOR A;  5EKL A;  5I9P A;  1SNM A;  5I9O A;  3QOL A;  5DAU A;  1NSN S;  1ENA A;  5J22 A;  1SNC A;  4NMZ A;  1TQO A;  1EZ6 A;  2EY1 A;  3BDC A;  1KAA A;  1TT2 A;  2O4X A;  3MVV A;  3NK9 A;  4N9P A;  5CV7 A;  5EKK A;  2NUC A;  4HTH A;  2F0D A;  4R8N A;  4K2L A;  5IOC A;  5KYI A;  2RBM A;  2F0K A;  3HZX A;  4DF7 A;  3QOJ A;  1TR5 A;  4DU9 A; 
#chains in the Genus database with same CATH topology
 1FL0 A;  1VDZ A;  2NYZ D;  2OQ0 A;  2ZXO A;  1V1O A;  3J81 j;  1Y8N B;  3HOY G;  4V19 0;  2K5N A;  2HIV A;  1ASZ A;  2EE1 A;  2PW5 A;  3OW7 A;  5IWA L;  3G4S A;  3D31 A;  2DGY A;  4B08 A;  1WI5 A;  4PMW A;  2B2T C;  1K3R A;  1STH A;  2HD3 A;  3S17 B;  1CSQ A;  3BDO A;  4TSS A;  4JI0 L;  3VA5 A;  3QB3 A;  1RHP A;  4ZLT F;  2UXD Q;  4X64 Q;  2K75 A;  2SNS A;  4BBS H;  1EOV A;  2B8F A;  1VQG A;  5KNC A;  3NEM A;  3PUZ A;  5JOB A;  2D2C C;  1JOK A;  4RH6 A;  5H1S E;  4A3L G;  2ZJQ A;  3CHB D;  2WIN B;  1NR4 A;  4PNY A;  3HG9 A;  2CW0 C;  2N55 A;  5DNF A;  4AYB B;  3MXP A;  4XDX A;  1NMG A;  2QKI C;  1C9O A;  4ZQ3 A;  3CCS A;  3H94 A;  1V1P A;  4R8I A;  2GVB A;  4DR7 Q;  1CQF A;  1NY4 A;  3OPO A;  4LNQ A;  3SE0 A;  4LF6 L;  2H1E A;  2XSC A;  3K0Y A;  5HGQ A;  2XWB B;  3RLN A;  5KGU A;  2ES2 A;  3M9B A;  3I73 A;  4JYA Q;  4NB3 A;  3ICE A;  3HKZ E;  3K57 A;  2TSS A;  1PYW D;  4QGU A;  4ODG A;  4ZUJ A;  1D2B A;  5C0X G;  1SSO A;  3BVZ A;  3PMF A;  4DAY A;  1KC8 C;  5AJ3 L;  5C4X G;  2R6G A;  5IGG A;  1TS2 A;  3H0G B;  1K3B C;  3DEO A;  3UE1 A;  3CP0 A;  4JC0 A;  1SNM A;  3UDF A;  1ENA A;  3FVQ A;  2Z4I A;  1LT6 D;  1L0W A;  2O4X A;  3K0X A;  5IYD H;  1VQA A;  1PVO A;  4N8X 1;  5IOC A;  3PO2 G;  2HCC A;  2ZJR A;  3HOZ B;  4PZ6 A;  3RUZ A;  5M5Y B;  1F2Y A;  2R61 A;  3Q8D A;  4C3J B;  4RKL A;  1OXV A;  3GTJ H;  1DYQ A;  2I46 A;  4I7A A;  1BBU A;  3JAM c;  4DV4 L;  2BCO A;  5CC4 A;  5I2X A;  2RA4 A;  5J1Z A;  5IWA Q;  1XNQ Q;  4A76 A;  4TVA B;  4F8M A;  4L8J A;  2WP8 J;  2HQE A;  3NBH B;  2KCN A;  3RD4 A;  3GTK H;  2ALY B;  3U50 C;  1S5F D;  4JI0 Q;  2BA0 A;  4OX9 L;  1LTI D;  3OYY A;  3KBX A;  3HGB A;  4TRD A;  1N33 L;  2VS1 A;  1VQP A;  4B3R Q;  1SFO B;  4C3H H;  5C3E H;  2AHO B;  4GOP B;  1IBM L;  5JPM C;  1LTT D;  3CQZ B;  3SK8 A;  4DK0 A;  2EOT A;  4RA8 A;  4LK1 C;  3S1M H;  3UDG A;  4KHZ A;  3PF4 A;  3G6J B;  1E1O A;  2IY5 B;  2KHS A;  3S14 B;  4EQP A;  4KMU C;  2JEB I;  1Q3L A;  4XXE A;  2QA4 A;  1I5F A;  4A3F B;  1XX8 A;  1QZH A;  1G51 A;  1V43 A;  1NTG A;  5IP7 H;  3PO3 B;  2WFW A;  4DXF A;  1WVL A;  1RKN A;  3BZD B;  2IWH A;  3S24 A;  2YTX A;  3W1G A;  1PTO B;  2ZT9 C;  5IOD A;  4K2K A;  4H0L C;  1GUT A;  4A3I B;  4JVZ A;  5M5X H;  1TWA H;  2RSO A;  2J0T D;  5M3M B;  4L5R C;  2RVL A;  2ZM6 L;  2RKS A;  4KLK A;  5IY0 A;  2F0O A;  1V9P A;  3ER0 A;  3I91 A;  1F9S A;  5C4J B;  1I6H H;  4NW2 A;  1ESF A;  1AW7 A;  1CSP A;  3GTM H;  4BXX G;  1UE7 A;  1S4Z A;  3PCO B;  1HA5 A;  3J80 i;  1EY4 A;  2NVY H;  2EDG A;  4RG1 A;  4AYB G;  1DOM A;  3K5M A;  3UE0 A;  2RSN A;  2K4K A;  1CHP D;  1EY5 A;  3A8I E;  4DV3 L;  4IPD A;  1EWC A;  2R92 G;  1I4H A;  2JA6 H;  1Y8P B;  5A2Q E;  2A73 B;  1VQB A;  5HGT A;  5AJ3 Q;  4JI3 Q;  4BA1 I;  3Q23 A;  2J7Z A;  1AE2 A;  1C48 A;  3C1E A;  5LMU Q;  1QUQ A;  1PZI D;  1ZKO A;  5DAU A;  1Y1V H;  4G7H C;  5IT9 c;  1EZ6 A;  3BDC A;  4R4Q A;  1S5B D;  4DAP A;  1SE2 A;  4DR6 L;  4GN3 B;  1GOZ A;  2B29 A;  2L1B A;  3KF8 B;  1S5C D;  2A69 D;  1SNP A;  3EJI A;  3RLO A;  1PMR A;  4B3T L;  4GS3 A;  5K36 G;  2DN8 A;  2PW7 A;  4DV4 Q;  2PNH A;  1NAP A;  4EQO A;  1X65 A;  3EQL C;  4Y7N H;  4DK1 A;  1B9M A;  3GTO H;  2M9V A;  3PIP A;  2JE6 I;  3H3V I;  4BBS B;  1H95 A;  1B70 B;  1EY0 A;  1V1P B;  3H0G G;  1XTD A;  3T16 A;  2KEC A;  1VF7 A;  4DV2 L;  2P5Z X;  2MGS A;  4OX9 Q;  4BS9 A;  2QW7 A;  4WFN 3;  1S5D D;  1HR0 W;  3PIO A;  1N33 Q;  1B7Y B;  2HDM A;  3K80 C;  4M8A A;  1IBM Q;  4F88 A;  2BH8 A;  3HOZ G;  3L0O A;  2A1A A;  1RD9 D;  2JYO A;  1B3A A;  1TWC B;  4C3J G;  4L5T A;  3Q0A A;  1SR3 A;  1IBK L;  1HJP A;  3K8A A;  3WOE A;  1G29 1;  2LMC B;  2QEJ C;  1EOT A;  3I55 A;  5I4D A;  4FXK C;  4F87 A;  4G4K A;  2K5V A;  3NEN A;  4FDB A;  3PSI A;  2X6G A;  2QDB A;  1EEI D;  2BA1 A;  4ZUI A;  4B9X A;  1CQV A;  3MC0 B;  4DPG A;  1Z7T A;  5CV8 A;  4BWG B;  4BY1 G;  2PO4 A;  1QNK A;  2CVR A;  4O1N A;  5G3L F;  1TY0 A;  1Y14 B;  1B9N A;  2EY5 A;  3EN2 A;  4PZ7 A;  4DNI A;  2JA7 H;  4LFB L;  1QCB D;  1MSH A;  2JN4 A;  1AEX A;  5M3F H;  2VY3 A;  5JPN C;  4UY8 C;  1QVF A;  1ESR A;  1QB5 D;  1YNJ C;  4H7B A;  4DV3 Q;  3PO3 G;  4HSV A;  3H09 A;  2A68 C;  3J7A F;  1UEB A;  4JW0 A;  4R4T A;  3E9I A;  1XPU A;  4U67 3;  1A15 A;  1SBB B;  5GAG C;  4HJ5 A;  3GTJ B;  4GLV B;  1TT2 A;  1XXG A;  3PUW A;  1KXL A;  5ELB A;  1GUN A;  1MIU A;  1PTO F;  1B3Q A;  5KYI A;  2UUA L;  3QOJ A;  4RMF A;  4A3C G;  2EY6 A;  2EJM A;  4PG3 A;  3HOU H;  3GTK B;  1PZK D;  4ABN A;  1R9T H;  4B3T Q;  2OTJ A;  2K50 A;  1A0I A;  1Z9F A;  3TP5 A;  1SEB D;  3SXH A;  3S9W A;  4AYB E;  2B2V C;  2CFM A;  4C3H B;  5C3E B;  5BN4 A;  3NUC A;  1CUK A;  4C1N K;  3N6R A;  5KYL A;  3PIP 3;  1OXX K;  3GTQ H;  2L9H A;  1K0R A;  4DK3 C;  3CAM A;  2DJF C;  2PQA A;  3S1M B;  1PH6 A;  3H3V C;  2VUM H;  5E4W C;  1CI3 M;  4Y52 H;  4J1M A;  2RDH A;  2C9O A;  4E6I A;  1XMO L;  2D9U A;  3A56 A;  3PIO 3;  1SYF A;  1S40 A;  3HOX H;  2R3Z A;  4HIM A;  4QIW B;  1KLG D;  2QF7 A;  4WJW A;  2EXD A;  5KRU A;  1IBK Q;  3QG1 A;  1I4R A;  3DUZ A;  3IAY A;  1JJ2 A;  1TVX A;  3H3V H;  2VQF L;  1SJE D;  1H9R A;  1B2T A;  3S16 H;  5JEA H;  5M5X B;  2H4O A;  1TWA B;  2BE5 D;  2F0E A;  3VR4 A;  1NJI C;  1JJG A;  2PI2 A;  1BNZ A;  3M7N A;  2B2V A;  1K8G A;  5BR8 L;  1DJR D;  1PH5 A;  4RGN A;  3JAM E;  1I6H B;  3UI2 A;  4IPC A;  3BS1 A;  5A2Q L;  3GTM B;  4OIK A;  1QUQ B;  2NVY B;  1EWI A;  5F2D A;  3CME A;  5J3B A;  3M4Y A;  3TBI B;  2LKV A;  1CZG A;  1AN8 A;  2M00 A;  3I4M H;  1W6J A;  4X65 L;  2JA6 B;  2GVA A;  5IIF A;  4CKC A;  1FJG L;  4GZY C;  3SHL A;  3VR5 A;  1STB A;  4EGV A;  1HUM A;  2D62 A;  4X6A H;  4JK1 C;  2PYK A;  3MFY A;  4NXN Q;  1Y1V B;  2RDG A;  4DUY L;  1QG7 A;  2CH4 A;  1FR3 A;  4QJF A;  5BN3 A;  4HJA A;  3KLW A;  1BXT A;  4EQ5 A;  1I4G A;  3X3M A;  1EYA A;  4OON A;  3J7Z C;  1K9M C;  1PH2 A;  4QL5 A;  1GO3 E;  3J81 c;  2HDL A;  3CPW A;  4IPH A;  3GDE A;  1UNS A;  3T1Y L;  3UDX A;  4LW1 A;  3C46 A;  1STA A;  4P71 A;  4Y7N B;  2VW9 A;  3GTO B;  2JA9 A;  4P74 A;  1LTR D;  4PQX A;  5C3X A;  1HZC A;  5LMN W;  4DA2 A;  1ENC A;  4KN7 C;  4X66 L;  5FLX E;  1KAW A;  2RHQ B;  1WFQ A;  3P7J A;  1E2W A;  2EQS A;  3J80 c;  3GTL H;  1FVI A;  4HJ9 A;  1EY7 A;  2EYF A;  3OOC A;  1RTN A;  5IYD G;  3F8T A;  4KJO A;  3IRB A;  4DR5 L;  1EU3 A;  3D3R A;  3OMC A;  1EWH A;  3H6M A;  2DJG C;  3F2U A;  2O5I C;  1M8A A;  1O7Y A;  1UUP A;  1EFW A;  1GUG A;  3SR1 A;  4RFB A;  1XMO Q;  2MPM A;  3H15 A;  5IGF A;  3NHH A;  1R4Q B;  4K8I A;  4IUP A;  1TXY A;  5CV4 A;  3M4Q A;  1BCP D;  5IT9 E;  2FMM A;  3GV3 A;  1VQN A;  2ATW A;  3HS0 C;  1D7Q A;  2VQF Q;  2JA5 H;  1ZYR D;  1DZ1 A;  4XQJ A;  3BZC A;  1PDQ A;  3VA7 A;  1LAB A;  4C3H G;  5C3E G;  1SDF A;  1RF2 D;  5DM6 3;  2SEB D;  1DON A;  3K7A H;  1O78 A;  2EZV A;  1IZ6 A;  2JA7 B;  2DUD A;  2XRQ D;  2Q2U A;  2Z0S A;  3DWQ A;  1G2S A;  1CA5 A;  3CC2 A;  1JWM D;  2GN5 A;  2Z6B A;  4H44 C;  4RGO S;  5M3F B;  1B1Z A;  2F0I A;  2EJG C;  2AMC B;  3ERO A;  1B4O A;  3PQI A;  3A5U A;  1F9P A;  4A75 A;  3EBE A;  1J9O A;  4X65 Q;  4U68 A;  5IP7 G;  1EY9 A;  3NBH A;  2ZXR A;  2EXZ A;  3CW2 C;  1FJG Q;  1AFP A;  2B2Y C;  1Q8I A;  2MNA A;  1EIG A;  1LUZ A;  4GOP A;  3LWE A;  4YWL A;  4A3G H;  2NBF A;  1M4V A;  1H9K A;  2V4D A;  4PV1 C;  3QOL A;  3ULL A;  1NSN S;  1ET6 A;  2PQA B;  4HSP A;  3HOU B;  2AQ2 B;  1G6P A;  4X3K A;  3KJP A;  1R9T B;  3G48 A;  3ULJ A;  2K04 A;  3L9A X;  1LAC A;  3MXU A;  2JA6 G;  3RZO H;  5GRO A;  2PZT A;  2SOB A;  1MHW C;  3A54 A;  1PH3 A;  3CC7 A;  4NXM L;  4DR3 L;  3GTQ B;  1UEA B;  1G6Z A;  3S1Q H;  2KHJ A;  5IGB A;  3R93 A;  2K14 A;  2R7F A;  2WKD A;  3HP3 A;  1Y1V G;  3NQI A;  3NTI A;  3TDQ A;  1PHJ A;  2VUM B;  1UE1 A;  1X3P A;  4DR5 Q;  1LTL A;  4GLX A;  3TME A;  2NVX H;  1XPR A;  3HOX B;  3BVG A;  4DR2 L;  1EIH A;  1PH8 A;  2F0W A;  5EJW A;  1Q7Y C;  2JK8 A;  1BCP C;  1U9R A;  4YWK A;  2A8V A;  2J4X A;  1ZEQ X;  4KTA A;  3S16 B;  4QMG A;  4V0B A;  5K5P A;  2KQ3 A;  1I4X A;  3E0E A;  3MTS A;  3W2D A;  1J5E Q;  5ISR A;  1YBY A;  4FF4 A;  3T1H L;  2B2U C;  3ITP A;  3O13 A;  3SGI A;  3A7L A;  2F3V A;  5AFW A;  1AZP A;  3ERS X;  2EYO A;  3G7L A;  4Q0F A;  1JE4 A;  2Q8T A;  4FXG C;  2KA7 A;  4IFD G;  3BZK A;  3SK5 A;  4L5S A;  5C5M A;  1AE3 A;  1JWU D;  1BQQ T;  2JJQ A;  2RQX A;  3KF8 A;  4KD3 A;  4DAM A;  2QEX A;  1F2M A;  3NXW A;  4I7Z C;  2PZW A;  1EY8 A;  4JV5 L;  2B2T A;  1IW7 C;  3T13 A;  1LTS D;  2K05 A;  3DWP A;  4MNO A;  2B2U A;  3CXC A;  2PMZ B;  1X55 A;  1JT8 A;  1VS0 A;  1Y69 U;  5FO8 B;  5FLX L;  3TEH B;  1KDC A;  2CH4 W;  1FNV A;  1QE6 A;  3K5N A;  3NTK A;  1YJW A;  3GTP H;  3HOW B;  4OEL B;  2NTT A;  4FVM A;  1LTG D;  1VQD A;  3DLL A;  2KBN A;  3FEW X;  5M3F G;  1PRT D;  5CMD A;  3T51 B;  3SDZ A;  4FF2 A;  1KLU D;  4KKU A;  2X69 A;  4A3E H;  4DU9 A;  1Q12 A;  2F0Q A;  4C56 C;  3NSW A;  1SMY D;  4LJZ C;  2Q2T A;  1K0S A;  3GTL B;  1YNN D;  1UE6 A;  3WDN A;  5C4Z A;  5C44 H;  2CWP A;  2F0F A;  4IAL A;  4IPG A;  4A3K H;  1Q46 A;  4KJN A;  4NXM Q;  4DR3 Q;  2Z9H A;  1N34 L;  2OTL A;  4BY7 G;  3MFG A;  1DM0 B;  1WD1 A;  4FXD A;  2D5D A;  2FFK B;  2NWG A;  3CU7 A;  1YJN A;  1TU2 B;  5ELO A;  2NVT H;  1Q1B A;  1XJV A;  3KJO A;  4DR2 Q;  3HOU G;  1X9N A;  2EYL A;  3PUV A;  5LL6 S;  2JA5 B;  1L0X B;  4X3S A;  5JJI A;  2AUK A;  5D3I B;  2YTV A;  1N36 L;  5M5W H;  4J6H A;  5JAV A;  2F0M A;  1HR0 L;  2EJF C;  4DR4 L;  3NP8 A;  5IP9 G;  3K7A B;  3T1H Q;  4DV7 L;  1Y1W H;  5I2Y A;  1SRU A;  2CCZ A;  2VUM G;  2K7V A;  4DUZ L;  4OO1 G;  3H91 A;  3ERQ A;  4ZKC B;  4F7X A;  3AQQ A;  4FF1 A;  1S3O A;  4DK6 C;  1XMQ L;  1PXU A;  2MO0 A;  4C3I H;  3HOX G;  2F4V L;  3E0J A;  3C1F A;  2KVM A;  3GP7 A;  3IL8 A;  4JCV E;  5KIX A;  2WII B;  3TRZ A;  1HNX L;  5FO7 B;  1S5E D;  5JEA G;  4XT3 B;  5J39 A;  3K58 A;  2FIN B;  2MHV A;  4JV5 Q;  3J81 i;  1SYC A;  4K6D A;  4A3G B;  1CKN A;  5ELC A;  3A5Z B;  4HR7 B;  5EQ0 A;  3T4A C;  4JI6 L;  1MKH A;  3I2Z A;  4R4C A;  1HZ9 A;  4OEM B;  1GXD C;  4LF6 Q;  1EYD A;  4A93 H;  3GQB A;  2B63 H;  2L55 A;  3RLF A;  2OT2 A;  1PLF A;  4LUV A;  1M1K C;  5IYB G;  5J22 A;  3RN2 A;  2ZTD A;  4DV0 L;  3RZO B;  3CD6 A;  5EBD A;  4PZ8 A;  3J7A V;  1YNN C;  3CRK C;  4POG A;  2VB2 X;  1VQ8 A;  3S1Q B;  3NEL A;  2XGT A;  1G91 A;  4KD4 A;  3FP9 A;  4G7Z C;  3EIV A;  4MIU A;  3FDT A;  1F2L A;  4ZK9 B;  2F0S A;  4JBJ A;  4MTK A;  2PCF B;  2NVX B;  2B39 A;  3ZYY X;  1N34 Q;  2AUJ D;  2FXQ A;  1QWY A;  4K0K L;  1I94 L;  1I50 H;  2QDL A;  3QJY A;  3E5S A;  1VQO A;  5I6W A;  5T1G A;  1IKM A;  2PZU A;  1GUO A;  1Y8O B;  3HOW G;  1LT4 D;  1UE5 A;  2ZXP A;  5JJL A;  3U4V A;  5HY6 A;  4IJH A;  3OIP A;  1BCP B;  2RCN A;  4CDC C;  4JI4 L;  1ICW A;  3F2D A;  4G7O C;  2O2L D;  1N36 Q;  4XQQ A;  1O80 A;  4LFC L;  2OXP A;  4DR4 Q;  1YIT A;  5EAY A;  5EGT A;  1GHK A;  3R3O A;  3CCE A;  4IQZ A;  4GN4 B;  4DV7 Q;  1O7I A;  1QVC A;  2OEO A;  4HN7 A;  2BDN A;  4DUZ Q;  1H9S A;  1RTO A;  4IOC A;  3S15 H;  3X3N A;  4K5X A;  1XMQ Q;  1BVS A;  4LFA L;  2HQL A;  3L2P A;  1STN A;  4HMI A;  2F4V Q;  3OIQ A;  1NCV A;  1BF4 A;  3NE5 B;  4LF8 L;  1C0A A;  2ICE C;  3QR8 A;  4R4I A;  2YU9 H;  1HNX Q;  2JA5 G;  1GKH A;  2L12 A;  5FJ8 H;  4CKE A;  3OTO L;  4XYQ A;  1T9H A;  3CRL C;  4J15 A;  3A8J E;  1FGU A;  4K5V A;  2IL8 A;  2F3W A;  4JI6 Q;  2Y0S B;  1EQT A;  3NQT A;  4XYO A;  4CDF C;  3AMU A;  4QCL A;  1PH9 A;  3GTP B;  2I5H A;  2AWO A;  3VR2 A;  5JJK A;  2LSS A;  1X32 A;  2I5L X;  4A3E B;  2ZM6 Q;  1B44 D;  3AB9 A;  1D5Z C;  4YCV A;  2JP1 A;  2NZH A;  1KAA A;  1WTO A;  2MQH A;  2PI2 E;  4DV0 Q;  4ALP A;  1EYG A;  1F9Q A;  5C44 B;  4A3K B;  1VQ9 A;  2IX3 A;  4UP7 A;  1SNQ A;  2ASB A;  2DNC A;  3TQY A;  4IN3 A;  2ZTE A;  3LNN A;  3VYR A;  4A3F G;  1ZXT A;  1HFN A;  1YEZ A;  5L37 A;  5EPK A;  1HQR D;  3OMG A;  4H13 C;  4RCN A;  2CQO A;  1GUS A;  1IYU A;  4YWM A;  4POF A;  3DM1 A;  2E2H H;  5CR3 A;  2NVT B;  4A3I G;  4LUO A;  4TKO B;  2PQE A;  4NDX A;  1KNE A;  3C2P A;  4K0K Q;  5M3M G;  1I94 Q;  1WTH A;  1SRO A;  4MHE A;  1JB7 A;  5T1I A;  5LMN L;  2XWJ B;  2A69 C;  4X62 L;  3IFT A;  2BOS A;  4FO2 A;  4A3B H;  5M5W B;  3I3C A;  1D6E C;  4DR6 Q;  2A6E D;  5D3D A;  2AKW B;  2EPB A;  3BDL A;  1OO9 B;  4WJ3 M;  4R9W A;  5C4X H;  1HZA A;  2D0O A;  1Y1W B;  1B53 A;  1XNR L;  3EFX D;  2XRS D;  4KY6 A;  4JI4 Q;  4M1U B;  1RDP D;  2AQ3 B;  3J7Y W;  1DOK A;  1CT1 D;  4LFC Q;  1PYB A;  1N32 L;  4WRD A;  5IGD A;  1CKN B;  4C3I B;  3PO2 H;  1JOQ A;  4DV2 Q;  1TWF H;  4C1N I;  1EQV A;  4QB4 A;  4TQU S;  2V1C C;  4O0A A;  1I3Q H;  4CJ2 C;  4A4I A;  3D4R A;  3QWN A;  3TP8 A;  1X56 A;  4LFA Q;  2K01 A;  3PUX A;  1BOS A;  4LF8 Q;  5ELE A;  1MJE A;  2Z8L A;  3W1B A;  2N88 A;  2MO1 A;  3HKZ B;  3OW2 A;  2F1M A;  3MHB A;  3IFD A;  1KRT A;  1QZG A;  5JJZ A;  3OTO Q;  1VQI A;  2KEE A;  4A93 B;  4ZAI A;  2F0P A;  5FOB B;  2B63 B;  4BBS G;  4LUZ A;  2UU9 L;  1JIC A;  4DAV A;  1WTV A;  3VYU A;  1BCP F;  1QVG A;  4KHP L;  4QUF A;  2WAQ B;  5IYC H;  2PPB C;  1EYC A;  1XYI A;  3AFP A;  4IO9 A;  4MZ9 A;  1LTB D;  4DN4 M;  1ENF A;  1WTW A;  2L15 A;  2A6H D;  1ICF B;  2HT1 A;  1WTR A;  4O42 A;  2G9H D;  2MUY A;  4N9P A;  4GNX C;  4LFB Q;  3V05 A;  2NUC A;  2B3G A;  2CKZ B;  1STE A;  3HOV H;  2I07 B;  4KN4 C;  4A3J H;  3B6Y A;  4NPS A;  1K8A C;  2JEA I;  1D1I A;  3K5O A;  5C4H A;  3D4W A;  1FNW A;  3M7G A;  3U9O A;  3TZU A;  1I50 B;  1W3S A;  2ZJP A;  3BJU A;  3G6E A;  1O7Z A;  1A3V A;  3NWS A;  4CGY B;  3IKJ A;  1SYE A;  1UWV A;  4BXX H;  3MAQ A;  1PH7 A;  4LF7 L;  4NKL A;  1EL0 A;  1H9S B;  3ND9 A;  4A3E G;  4X62 Q;  1A3T A;  2UUA Q;  4XTC S;  2UXB L;  5KEE A;  1NUC A;  4OL7 A;  5KNB A;  4GNX A;  2E2I H;  2F0N A;  5C44 G;  1TKW B;  2R92 H;  5FLM H;  4A3K G;  4HCS A;  3S2D H;  5E7N A;  4CJ1 B;  2UUC L;  1KAB A;  1V1Q A;  3E3X A;  1XNR Q;  3L3O C;  2VB3 X;  2EYH A;  1EIY B;  4FNF A;  2NN6 I;  4L6T B;  3P20 A;  5DLQ E;  2Q2I A;  4HJ7 A;  1N32 Q;  3SK6 A;  3S15 B;  3RR5 A;  4JG2 A;  1TS3 A;  2RDF A;  3VYS A;  3A8K E;  1CKO A;  3OHX C;  2FJ2 A;  2DY7 A;  3DXJ C;  3S1N H;  1TS4 A;  4UAI A;  5K36 H;  4IUQ A;  1VQ4 A;  3CCR A;  1F2Z A;  3BVM A;  1LT3 D;  1LO5 D;  4APV A;  4ID6 A;  2IHE A;  5ELF A;  2AQ1 B;  4WJ4 A;  1JWS D;  2BE5 C;  4HMJ A;  4I65 A;  1Y1W G;  5C3W A;  1CA6 A;  4JI8 L;  4GKK L;  1I6V C;  3P1H A;  3NPP A;  2ICI A;  3L7Z C;  1N9W A;  3I4N H;  3FMC A;  4UP8 A;  4JI5 L;  2UU9 Q;  1A62 A;  2K1B A;  3CF5 A;  5BR8 Q;  4C3I G;  1KTK A;  1U4M A;  4KHP Q;  4R4O A;  3ND8 A;  2A6H C;  4WOR A;  5I9P A;  4LF5 L;  3LWU A;  1FNU A;  1ROD A;  1DOL A;  1HCZ A;  1I4Q A;  2R7D A;  3NK9 A;  1EIF A;  4X64 L;  1SAP A;  2KOL A;  2RBM A;  4DF7 A;  4YHH L;  4ULL A;  4X3T A;  1X54 A;  2UUB L;  2XVS A;  2F4I A;  2E2H B;  1TWH H;  1YNX A;  1TS5 A;  1L2F A;  4A93 G;  1E2V A;  2JA8 H;  1HPC A;  3DHQ A;  4DUY Q;  2B63 G;  1HTP A;  4BY1 H;  2Q8I B;  4A3B B;  3D8G A;  2WAQ G;  2E75 C;  3R8B A;  2CW0 D;  3FKI H;  3GTG H;  4DV5 L;  3VR3 A;  4LF7 Q;  4KY7 A;  1HHV A;  3QO2 A;  3DWA A;  3R2I A;  4EQN A;  1G2T A;  3T1Y Q;  3KLS A;  3ZJY C;  1BR9 A;  1WCM H;  2UXB Q;  1B8A A;  4UHV A;  1D8L A;  2IHF A;  3FPP A;  3A0J A;  5TSS A;  2L11 A;  4P72 A;  4LAA A;  4X66 Q;  2UUC Q;  4B3M L;  3PO2 B;  2F03 A;  4IUU A;  1PRT F;  4BA2 I;  2B2Y A;  1TWF B;  1P8L A;  1IXR A;  1I3Q B;  4JI7 L;  2DY8 A;  1K83 H;  1II3 A;  1IL8 A;  1EU4 A;  2Q8R E;  3VR6 A;  4MTN A;  3JAM L;  2NZ1 D;  3BU2 A;  3Q22 A;  1R4P B;  2QCP X;  4HCE A;  1EEF D;  5LHY 1;  5I6Y A;  1KL9 A;  4Q5V A;  1BBX C;  1AP0 A;  1A8V A;  1ZYR C;  1PH4 A;  3T56 B;  4UP9 A;  1Z47 A;  2NN6 H;  2ENB A;  4R1J A;  1MI2 A;  2K6A A;  4CHT B;  1SNO A;  1RIP A;  4GKK Q;  4QUC A;  3AU7 A;  4X3U A;  2EVB A;  4JBK A;  2OCE A;  4JI5 Q;  5JVG 3;  4DKA C;  4OWT B;  1XNQ L;  2B8G A;  3I4M B;  2R7Z H;  1YJ9 A;  1PFN A;  2CHB D;  2F0H A;  5GQO A;  3HOV B;  3JC6 6;  4A3J B;  1MJC A;  3KBG A;  3MWY W;  1LM0 A;  3A74 A;  1AZQ A;  1ML0 D;  4LF5 Q;  5FJ8 G;  2HHH L;  2YYZ A;  4A3D H;  3I4L A;  2R93 H;  1YZ6 A;  4BBR H;  4HTH A;  4B3R L;  3E9H A;  3BYT B;  3TRE A;  2F0K A;  1K8M A;  4EVO A;  1OXU A;  1KRS A;  3M85 A;  4GNX B;  1C7Y A;  5IGC A;  3KLS X;  1LYL A;  4YHH Q;  5E3F A;  2UUB Q;  4IFD J;  2WB1 B;  3V2T A;  2O5J C;  1TY2 A;  3M3Y H;  2Z4H A;  2N78 A;  4OIJ A;  1C4Q A;  2IX1 A;  1FGB D;  5CV5 A;  2E2J H;  1F77 A;  4NP5 A;  1HQM C;  5EKI A;  4KKT A;  2K03 A;  2JA7 G;  3STB D;  2RF4 A;  3I7F A;  1IYV A;  1TWC H;  2R92 B;  4DV5 Q;  3NWT A;  2MFI A;  2E2I B;  2WAC A;  1E7Z A;  1KDA A;  1HH2 P;  4IUN A;  3S2D B;  4YCU A;  1V8Q A;  1D5M C;  2IW3 A;  1PZJ D;  2VZA A;  1A2U A;  4RCO A;  2CWA A;  2EYP A;  5DEH A;  5E1F A;  3MXG A;  1A63 A;  3A7A B;  1GVP A;  1J8I A;  2K5H A;  3CCM A;  3OSO A;  1F9R A;  1PFB A;  4JOI C;  2UXC L;  1FYC A;  3W5O A;  4A3M H;  2A19 A;  1K28 A;  1N8R C;  1L1O C;  5BN5 A;  4QIW E;  5IT9 L;  4B3M Q;  1JE5 A;  3N52 A;  4DFA A;  1A6X A;  1XWE A;  1J6Q A;  3S1N B;  4JI7 Q;  4YCW A;  2NZO A;  2G9D A;  2K28 A;  4A3B G;  4AH6 A;  4KV6 A;  4LF9 L;  2NTS A;  3KOJ A;  3UDI A;  1MSG A;  5C0X J;  3AFQ A;  4JI3 L;  1U4P A;  2WAQ E;  4JPB W;  4KHV A;  1GM5 A;  2YV5 A;  5LMU L;  5M9O A;  5JVH 3;  2EYM A;  3U58 A;  4FP5 D;  3J81 E;  2LS0 1;  2VXW A;  1SE8 A;  2HUG A;  3I4N B;  1U0L A;  3CC4 A;  2AWN A;  4KY5 A;  4CDE C;  1VQF A;  3ONA B;  3HRZ C;  4IUR A;  4JOI A;  1LT5 D;  4DNT B;  4LF4 L;  4HED A;  1L1O A;  4ZRZ A;  1D5X C;  1JJC B;  2NVQ H;  1IHZ A;  3A55 A;  1Q81 C;  1VQ6 A;  3S1R H;  1VQJ A;  4IFD I;  4CDD C;  2EYJ A;  4GKJ L;  4DV1 L;  1STG A;  2HIX A;  1KIX A;  3FHW A;  5DM7 3;  1QIL A;  3J80 E;  3KF6 B;  1EZ8 A;  4ME3 A;  5CBE E;  1JCK B;  2HCI A;  2K5D A;  4HID A;  5CYU A;  4Z9C B;  1IL2 A;  3I8Z A;  2E2D C;  2HHH Q;  2XNA C;  1TWH B;  5GAD C;  1VMP A;  2F0D A;  1Q1E A;  2JA8 B;  1JB3 A;  3LGJ A;  4BY1 B;  3FPU B;  3CCJ A;  1GUW A;  5IYC G;  3FKI B;  3GTG B;  1JOO A;  3TZD A;  3STB C;  1U4R A;  4AIM A;  1EQR A;  2F0G A;  1PRT C;  4C2M H;  4JI1 L;  5JEA J;  3I4M G;  1WCM B;  3D0F A;  1SN8 A;  3CCQ A;  3I70 A;  4QY7 A;  3SK4 A;  3HOV G;  1SMY C;  1LV9 A;  3RZD H;  4A3J G;  2FMC A;  2H5X A;  2Q2H A;  5C0X I;  4ME5 A;  1X3G A;  4CKB A;  4P75 A;  1TII D;  1SYB A;  4DNR B;  1KD1 C;  3R2T A;  2VNU D;  1T5X D;  1VQ7 A;  2UXC Q;  5E4X A;  1DD2 A;  1K83 B;  2F0U A;  2WB1 G;  5FLX c;  2K52 A;  1S72 A;  1QNU A;  2WV6 D;  4CJ0 B;  2F52 A;  1CK1 A;  4DGZ A;  1WJJ A;  1ILP A;  4IJL A;  1E1T A;  3K5L A;  5NUC A;  2KCC A;  4ILW A;  4FYD A;  3Q6S A;  4B3S L;  4J8Q A;  4LF9 Q;  1CFM A;  1E24 A;  1SE3 A;  5FLM G;  4S3S A;  2VQE L;  3RNU A;  1YNJ D;  3TSS A;  1XTC D;  2MP1 A;  3SVM A;  1OXS C;  1WYD A;  2A68 D;  3PUY A;  3D4D A;  1HR0 Q;  3KK7 A;  5CV6 A;  3GV6 A;  3U9S A;  4AQY L;  1EY6 A;  4LF4 Q;  2D0P A;  2R7Z B;  1BO0 A;  4OO1 I;  2KHI A;  2XIW A;  5FO9 B;  2B2W C;  1VCI A;  1E2Z A;  1LLR D;  3K59 A;  4DV1 Q;  4GKJ Q;  3M4P A;  3HOY H;  5CGK A;  1YVC A;  4A3D B;  1STY A;  2R93 B;  4RGT A;  1Z6H A;  2OWO A;  4BBR B;  4IUV A;  1OTC A;  4JBM A;  1CKM A;  1BDO A;  3AEV A;  1ILQ A;  4NMZ A;  1VQ5 A;  2EY1 A;  4RHS A;  3M3Y B;  3MVV A;  4QQB X;  4R8N A;  4K2L A;  1SMX A;  1L0Y B;  3I4N G;  3E6Z X;  1TR5 A;  1HNZ L;  2E2J B;  1EUJ A;  3MXN A;  5GAH C;  2FHT A;  1KHI A;  2F0T A;  3MEF A;  1ONL A;  4IFD H;  1KDB A;  2NB0 A;  2C5C A;  4XT1 B;  3MZ5 A;  1HNW L;  3DMU A;  2BDO A;  4A3L H;  1CM9 A;  1HFG A;  2B2W A;  1HZB A;  3VYT A;  1KNA A;  2QIL A;  3WOF A;  1RCV D;  4JI1 Q;  1GHJ A;  1IYJ B;  2A5H A;  3F1Z A;  1FD7 D;  4DAY B;  4A3M B;  4KK7 A;  2BH2 A;  2I5M X;  4OXP A;  2N49 A;  3WWV A;  2JA8 G;  1PV4 A;  3RN5 A;  1P16 A;  1VQK A;  1NBW A;  2JSO A;  4A3G G;  5EBC A;  2GA4 B;  2N8N A;  3J81 L;  5ELD A;  1L1O B;  3FKI G;  5D14 A;  1Q86 C;  3KUP A;  3M4O H;  4K8J A;  2K33 A;  1EFI D;  2A74 C;  5D65 A;  1K8O A;  4B3S Q;  4NXN L;  1WCM G;  2JXM B;  5C0X H;  4G57 A;  2L4N A;  3KLR A;  2VQE Q;  1WTP A;  3J80 L;  4GLA C;  4BY7 H;  2IPK D;  2NVQ B;  5COR A;  1SE4 A;  3S1R B;  3S2H H;  2KUM A;  1GD7 A;  3TP7 A;  1HRJ A;  4PMC A;  1BKB A;  4AQY Q;  1JR0 D;  3I4O A;  4P2C B;  2DNE A;  1CHQ D;  2WB1 E;  1TWG H;  2PMZ E;  1ET9 A;  1JC7 A;  4PMB A;  3GD7 A;  2Z1C A;  1OXT A;  1H9M A;  4JI2 L;  4YY3 L;  4L63 B;  3U4Z A;  1RJT A;  2E8G A;  4KKS A;  5I9O A;  4DV6 L;  3KDF A;  2NN6 G;  2LY7 A;  4DR1 L;  5IP9 H;  1TQO A;  2CQA A;  3K7U C;  3ULP A;  5EKK A;  2Z6K C;  3CKI B;  1LTA D;  1U4L A;  3HZX A;  3NBI A;  1IKL A;  1HNZ Q;  4OO1 H;  1MGS A;  4H02 A;  3P75 A;  3RMH A;  1DXM A;  4QF4 A;  4XIG S;  2PNR C;  4C2M B;  1HNW Q;  1SYD A;  2R7Z G;  3CCL A;  4YIJ A;  3RZD B;  1PH1 A;  1CZW A;  4JBW A;  4OWX B;  1E0B A;  2K32 A;  2K5W A;  5FKA C;  4A3D G;  2VL6 A;  2R93 G;  1E3P A;  4N8F A;  4BBR G;  2KED A;  1SLJ A;  3SEB A;  1PRT B;  2E76 C;  5G3L D;  5GAE C;  3I56 A;  1NNX A;  1C8C A;  3CCU A;  3S17 H;  1D1K A;  1A3U A;  3PF5 A;  1YHA A;  2F3I A;  2ZTC A;  5HUR A;  2Z6K A;  2G5D A;  3G71 A;  3V96 A;  3F2B A;  2N3S A;  4HIO A;  3BYY B;  3FRP B;  4RAU C;  1IBL L;  1PYS B;  1GJX A;  1K73 C;  4UDU C;  1JOR A;  2Y0S G;  1VF5 C;  3I72 A;  4K6L A;  5IYB H;  1H9J A;  1I4P A;  5CBA E;  3EA6 A;  3OWE B;  2KCT A;  4O2D A;  2A6E C;  2LXJ A;  5LMN Q;  1PFS A;  3TS2 A;  3CMA A;  1XPO A;  2EIF A;  3I90 A;  2YTY A;  4N9T A;  3CPF A;  4RWS C;  1VQC A;  1PTO D;  4HAE A;  2JQO A;  1PA6 A;  1YIJ A;  4LWC A;  4A3M G;  3KYH C;  2F0V A;  3D6C A;  2SNM A;  1QOH A;  3JAM i;  2XTI A;  3URY A;  4ZCK A;  2RCF A;  3PV0 A;  1M90 C;  1WD0 A;  2OF1 A;  1SYG A;  1EQQ A;  3MXN B;  3HOY B;  1T5E A;  1X3Q A;  2X6L A;  1HTL D;  2RHS B;  3K6O A;  3CCV A;  3HOW H;  2E5L L;  4HIK A;  1RL2 A;  1NMF A;  2KJX A;  2YU9 B;  1HUN A;  1Q8K A;  3LX0 A;  4JI2 Q;  2OQK A;  4YY3 Q;  1E22 A;  5EKL A;  1MBY A;  2XN9 C;  4DV6 Q;  4P73 A;  1SNC A;  1VQE A;  4DR1 Q;  4GN5 A;  5CV7 A;  1DCZ A;  1X3E A;  3H0G H;  2SDF A;  3AYH B;  3K81 C;  1X3F A;  5FK9 C;  5EPJ A;  5C6A A;  3W3A A;  4K14 A;  4IZ8 A;  4EX5 A;  3HOZ H;  1J5E L;  5M5Y H;  1YI2 A;  1DGS A;  3F2C A;  4C3J H;  1JQY D;  2KEN A;  3HFZ B;  1Q82 C;  1VQM A;  3C3L A;  1UAP A;  1SND A;  2ID0 A;  1NR2 A;  1SXT A;  1BUV T;  1W6K A;  5IE8 A;  2E74 C;  1A2T A;  3NTH A;  2F0L A;  2UXD L;  2F0J A;  3QIA A;  4GOP C;  4K5W A;  1VMC A;  4IUT A;  4FF3 A;  4RHR A;  1O7L A;  3HKZ G;  4OWW B;  2KCM A;  3BG3 A;  2M2L A;  5IGE A;  3T53 B;  4LMQ D;  2K5Q A;  2LFN A;  1W2B A;  1SFO H;  4RKB A;  4KI0 A;  3M4O B;  3EVQ A;  5EPL A;  1IBL Q;  2C35 B;  5C5L A;  3KFU A;  3CQZ H;  3OWF A;  3KF6 A;  3J7A 5;  2EY2 A;  2QGQ A;  1QJO A;  1VQH A;  5KND A;  2LXK A;  2TMP A;  1MD2 D;  4B9W A;  1U5K A;  1PTO C;  1B50 A;  5C4X B;  3S14 H;  4DR7 L;  4BY7 B;  3TN2 A;  2IT1 A;  1Q90 A;  3HEJ A;  1G8Z D;  1YHB A;  1SJH D;  4XQN A;  1IW7 D;  1BBW A;  4A3F H;  3S2H B;  1WTQ A;  4ZKB B;  3PO3 H;  1HXY D;  1WOC A;  4CBV A;  5ELN A;  3GO5 A;  3KDF B;  3D6W A;  1CTM A;  3TP6 A;  1KQS A;  3Q24 A;  1ASY A;  1PTO H;  4OGQ C;  5COY A;  2I0Q A;  4JYA L;  4A3I H;  2L0C A;  2IX0 A;  4L5Q A;  4MN3 A;  3DEP A;  3MA2 B;  5M3M H;  1TWG B;  5CV9 A;  3MEH A;  4OHJ A;  5C4J H;  1X6O A;  2IJ0 A;  3TS0 A;  5A35 A;  4A3C H;  1WTX A;  3HKS A;  2E5L Q;  4ZYS A;  2Y0S E;  3VDY A;  1VQL A;  1JMC A;  4UPA A;  4RGM A;  4HJ8 A;  1YHQ A;  3PGZ A;  1AH9 A;  4DXG A;  4IOA A;  2WKC A;  1PFM A;  2L5T A;  5LL6 X;  1HA6 A;  2MJ8 A;  1NE3 A;  3DM3 A;  4JI8 Q; 
#chains in the Genus database with same CATH homology
 1VDZ A;  2NYZ D;  2ZXO A;  1V1O A;  1Y8N B;  4V19 0;  2EE1 A;  2PW5 A;  3OW7 A;  3D31 A;  4B08 A;  4PMW A;  2B2T C;  1STH A;  3S17 B;  3BDO A;  4TSS A;  3VA5 A;  3QB3 A;  1RHP A;  4ZLT F;  2SNS A;  2B8F A;  5KNC A;  3PUZ A;  5JOB A;  2D2C C;  1JOK A;  4RH6 A;  3CHB D;  2WIN B;  1NR4 A;  4PNY A;  3HG9 A;  2CW0 C;  2N55 A;  5DNF A;  4AYB B;  3MXP A;  4XDX A;  2QKI C;  4ZQ3 A;  3H94 A;  1V1P A;  4R8I A;  1CQF A;  3OPO A;  3SE0 A;  2H1E A;  2XSC A;  3K0Y A;  2XWB B;  5KGU A;  3I73 A;  3K57 A;  2TSS A;  1PYW D;  4ODG A;  4ZUJ A;  1D2B A;  5C0X G;  1SSO A;  3BVZ A;  3PMF A;  4DAY A;  2R6G A;  5IGG A;  1TS2 A;  3H0G B;  3DEO A;  1SNM A;  1ENA A;  3FVQ A;  2Z4I A;  1LT6 D;  2O4X A;  5IOC A;  2HCC A;  3HOZ B;  3RUZ A;  5M5Y B;  1F2Y A;  2R61 A;  4C3J B;  4RKL A;  1OXV A;  1DYQ A;  2I46 A;  2BCO A;  5CC4 A;  5I2X A;  2RA4 A;  5J1Z A;  4F8M A;  4L8J A;  2WP8 J;  2HQE A;  2KCN A;  3RD4 A;  1S5F D;  2BA0 A;  1LTI D;  3KBX A;  3HGB A;  4TRD A;  1SFO B;  5JPM C;  1LTT D;  3CQZ B;  3SK8 A;  4DK0 A;  2EOT A;  4RA8 A;  4LK1 C;  4KHZ A;  3G6J B;  2KHS A;  3S14 B;  4EQP A;  4KMU C;  2JEB I;  1Q3L A;  4XXE A;  4A3F B;  1XX8 A;  1V43 A;  3PO3 B;  4DXF A;  1WVL A;  1RKN A;  3BZD B;  2IWH A;  1PTO B;  2ZT9 C;  5IOD A;  4K2K A;  4H0L C;  1GUT A;  4A3I B;  2RSO A;  2J0T D;  5M3M B;  2RVL A;  2RKS A;  2F0O A;  3I91 A;  1F9S A;  5C4J B;  4NW2 A;  1ESF A;  1AW7 A;  1S4Z A;  1HA5 A;  1EY4 A;  2EDG A;  1DOM A;  3K5M A;  2RSN A;  1CHP D;  1EY5 A;  3A8I E;  1EWC A;  1I4H A;  1Y8P B;  5A2Q E;  2A73 B;  5HGT A;  4BA1 I;  3Q23 A;  2J7Z A;  1C48 A;  3C1E A;  1PZI D;  1ZKO A;  5DAU A;  4G7H C;  1EZ6 A;  3BDC A;  1S5B D;  4DAP A;  1SE2 A;  1GOZ A;  2L1B A;  1S5C D;  2A69 D;  1SNP A;  3EJI A;  1PMR A;  5K36 G;  2DN8 A;  2PW7 A;  1NAP A;  4EQO A;  3EQL C;  4DK1 A;  1B9M A;  2M9V A;  2JE6 I;  4BBS B;  1EY0 A;  1V1P B;  3T16 A;  2KEC A;  1VF7 A;  2MGS A;  4BS9 A;  4WFN 3;  1S5D D;  2HDM A;  4M8A A;  4F88 A;  1RD9 D;  2JYO A;  1B3A A;  1TWC B;  4C3J G;  3Q0A A;  3WOE A;  1G29 1;  2LMC B;  2QEJ C;  1EOT A;  5I4D A;  4FXK C;  4F87 A;  4G4K A;  2X6G A;  2QDB A;  1EEI D;  2BA1 A;  4ZUI A;  4B9X A;  1CQV A;  3MC0 B;  1Z7T A;  5CV8 A;  4BWG B;  2PO4 A;  1QNK A;  2CVR A;  4O1N A;  5G3L F;  1TY0 A;  1B9N A;  2EY5 A;  1QCB D;  1MSH A;  1AEX A;  5JPN C;  1ESR A;  1QB5 D;  1YNJ C;  4H7B A;  4HSV A;  3H09 A;  2A68 C;  3J7A F;  4U67 3;  1A15 A;  1SBB B;  3GTJ B;  1TT2 A;  1XXG A;  3PUW A;  5ELB A;  1GUN A;  1PTO F;  5KYI A;  3QOJ A;  2EY6 A;  2EJM A;  3GTK B;  1PZK D;  4ABN A;  3TP5 A;  1SEB D;  3SXH A;  3S9W A;  4C3H B;  2B2V C;  5C3E B;  5BN4 A;  3NUC A;  4C1N K;  3N6R A;  5KYL A;  3PIP 3;  1OXX K;  2L9H A;  3S1M B;  3H3V C;  5E4W C;  1CI3 M;  4J1M A;  2RDH A;  2C9O A;  4E6I A;  2D9U A;  3A56 A;  3PIO 3;  1SYF A;  2R3Z A;  4QIW B;  1KLG D;  2QF7 A;  4WJW A;  5KRU A;  3QG1 A;  1I4R A;  3DUZ A;  3IAY A;  1TVX A;  1SJE D;  1H9R A;  1B2T A;  5JEA H;  5M5X B;  2H4O A;  1TWA B;  2BE5 D;  2F0E A;  3VR4 A;  1BNZ A;  3M7N A;  2B2V A;  1DJR D;  4RGN A;  3JAM E;  1I6H B;  3UI2 A;  3BS1 A;  5A2Q L;  3GTM B;  4OIK A;  2NVY B;  5F2D A;  3M4Y A;  3TBI B;  2LKV A;  1CZG A;  1AN8 A;  2M00 A;  1W6J A;  2JA6 B;  5IIF A;  4CKC A;  4GZY C;  3SHL A;  3VR5 A;  1STB A;  4EGV A;  1HUM A;  2D62 A;  4JK1 C;  2PYK A;  3MFY A;  1Y1V B;  2RDG A;  1QG7 A;  1FR3 A;  5BN3 A;  1BXT A;  1I4G A;  3X3M A;  1EYA A;  2HDL A;  1UNS A;  3C46 A;  1STA A;  4Y7N B;  3GTO B;  1LTR D;  4PQX A;  5C3X A;  4DA2 A;  1ENC A;  4KN7 C;  5FLX E;  3P7J A;  1E2W A;  1EY7 A;  2EYF A;  3OOC A;  1RTN A;  4KJO A;  1EU3 A;  3D3R A;  3OMC A;  1EWH A;  3H6M A;  3F2U A;  2O5I C;  1M8A A;  1O7Y A;  1UUP A;  1GUG A;  3SR1 A;  4RFB A;  2MPM A;  5IGF A;  3NHH A;  1R4Q B;  4K8I A;  4IUP A;  5CV4 A;  1BCP D;  5IT9 E;  2FMM A;  3GV3 A;  3HS0 C;  1ZYR D;  1DZ1 A;  4XQJ A;  1PDQ A;  3VA7 A;  1LAB A;  4C3H G;  1SDF A;  1RF2 D;  5DM6 3;  2SEB D;  1DON A;  1O78 A;  2EZV A;  2JA7 B;  2XRQ D;  3DWQ A;  1G2S A;  1CA5 A;  1JWM D;  4RGO S;  4H44 C;  5M3F B;  1B1Z A;  2F0I A;  2EJG C;  3ERO A;  1B4O A;  1F9P A;  1J9O A;  4U68 A;  1EY9 A;  3NBH A;  2ZXR A;  2EXZ A;  1AFP A;  2B2Y C;  1Q8I A;  1EIG A;  3LWE A;  2NBF A;  1M4V A;  1H9K A;  2V4D A;  4PV1 C;  3QOL A;  1ET6 A;  1NSN S;  4HSP A;  3HOU B;  2AQ2 B;  4X3K A;  1R9T B;  2K04 A;  3L9A X;  1LAC A;  3MXU A;  2PZT A;  2SOB A;  3A54 A;  3GTQ B;  1UEA B;  1G6Z A;  5IGB A;  3R93 A;  2WKD A;  3HP3 A;  3NQI A;  3NTI A;  3TDQ A;  2VUM B;  1X3P A;  3TME A;  3HOX B;  3BVG A;  1EIH A;  2F0W A;  5EJW A;  1BCP C;  1U9R A;  2J4X A;  1ZEQ X;  4KTA A;  3S16 B;  4QMG A;  4V0B A;  5K5P A;  2KQ3 A;  1I4X A;  3W2D A;  3MTS A;  5ISR A;  4FF4 A;  2B2U C;  3ITP A;  3O13 A;  3A7L A;  2F3V A;  5AFW A;  1AZP A;  2EYO A;  3G7L A;  4Q0F A;  1JE4 A;  2Q8T A;  4FXG C;  2KA7 A;  4IFD G;  3SK5 A;  5C5M A;  1JWU D;  1BQQ T;  2RQX A;  3KF8 A;  4KD3 A;  1F2M A;  3NXW A;  4I7Z C;  2PZW A;  1EY8 A;  2B2T A;  1IW7 C;  3T13 A;  1LTS D;  2K05 A;  3DWP A;  2B2U A;  2PMZ B;  1Y69 U;  5FO8 B;  5FLX L;  1KDC A;  1FNV A;  1QE6 A;  3K5N A;  3NTK A;  3HOW B;  2NTT A;  4FVM A;  1LTG D;  3FEW X;  1PRT D;  5CMD A;  3T51 B;  3SDZ A;  4FF2 A;  1KLU D;  4KKU A;  2X69 A;  4DU9 A;  1Q12 A;  2F0Q A;  4C56 C;  3NSW A;  1SMY D;  4LJZ C;  3GTL B;  1YNN D;  3WDN A;  5C4Z A;  2F0F A;  4IAL A;  4KJN A;  3MFG A;  1DM0 B;  1WD1 A;  4FXD A;  2D5D A;  2FFK B;  2NWG A;  3CU7 A;  1TU2 B;  1Q1B A;  2EYL A;  3PUV A;  5LL6 S;  2JA5 B;  1L0X B;  4X3S A;  2AUK A;  5D3I B;  4J6H A;  5JAV A;  2F0M A;  2EJF C;  3NP8 A;  3K7A B;  5I2Y A;  2K7V A;  4OO1 G;  3H91 A;  3ERQ A;  4ZKC B;  4F7X A;  4FF1 A;  1PXU A;  3E0J A;  3C1F A;  2KVM A;  3GP7 A;  3IL8 A;  5KIX A;  2WII B;  5FO7 B;  1S5E D;  5JEA G;  4XT3 B;  5J39 A;  3K58 A;  2FIN B;  2MHV A;  1SYC A;  4K6D A;  4A3G B;  5ELC A;  3T4A C;  4HR7 B;  5EQ0 A;  1GXD C;  1EYD A;  3GQB A;  2L55 A;  3RLF A;  2OT2 A;  1PLF A;  5J22 A;  3RZO B;  5EBD A;  3J7A V;  1YNN C;  3CRK C;  2VB2 X;  1G91 A;  3S1Q B;  4KD4 A;  4G7Z C;  4MIU A;  3FDT A;  1F2L A;  4ZK9 B;  2F0S A;  2PCF B;  2NVX B;  2B39 A;  3ZYY X;  2AUJ D;  1QWY A;  3QJY A;  3E5S A;  5I6W A;  5T1G A;  1IKM A;  2PZU A;  1GUO A;  1Y8O B;  1LT4 D;  2ZXP A;  3OIP A;  1BCP B;  1ICW A;  4G7O C;  2O2L D;  4XQQ A;  1O80 A;  2OXP A;  5EGT A;  1GHK A;  3R3O A;  4IQZ A;  2OEO A;  4HN7 A;  2BDN A;  1H9S A;  1RTO A;  3X3N A;  4K5X A;  1STN A;  4HMI A;  3OIQ A;  1NCV A;  1BF4 A;  3NE5 B;  2ICE C;  2L12 A;  4CKE A;  4XYQ A;  3CRL C;  3A8J E;  4K5V A;  2IL8 A;  2F3W A;  2Y0S B;  1EQT A;  3NQT A;  4XYO A;  3AMU A;  4QCL A;  3GTP B;  2AWO A;  3VR2 A;  1X32 A;  4A3E B;  1B44 D;  3AB9 A;  1D5Z C;  2JP1 A;  1KAA A;  1WTO A;  1F9Q A;  5C44 B;  4A3K B;  2IX3 A;  1SNQ A;  2DNC A;  4IN3 A;  3VYR A;  3LNN A;  1ZXT A;  1HFN A;  5EPK A;  1HQR D;  3OMG A;  4H13 C;  4RCN A;  1GUS A;  1IYU A;  3DM1 A;  5CR3 A;  2NVT B;  4TKO B;  2PQE A;  4NDX A;  1KNE A;  3C2P A;  4MHE A;  5T1I A;  2XWJ B;  2A69 C;  3IFT A;  2BOS A;  4FO2 A;  5M5W B;  3I3C A;  1D6E C;  2A6E D;  5D3D A;  2EPB A;  3BDL A;  1OO9 B;  4R9W A;  1Y1W B;  1B53 A;  3EFX D;  2XRS D;  4KY6 A;  4M1U B;  1RDP D;  2AQ3 B;  3J7Y W;  1DOK A;  1CT1 D;  4WRD A;  5IGD A;  4C3I B;  1JOQ A;  4C1N I;  1EQV A;  4QB4 A;  4TQU S;  4CJ2 C;  3D4R A;  3QWN A;  3TP8 A;  2K01 A;  3PUX A;  1BOS A;  5ELE A;  2Z8L A;  2N88 A;  3HKZ B;  2F1M A;  3MHB A;  3IFD A;  5JJZ A;  2KEE A;  4A93 B;  4ZAI A;  2F0P A;  5FOB B;  2B63 B;  1JIC A;  4DAV A;  1WTV A;  3VYU A;  1BCP F;  4QUF A;  2WAQ B;  2PPB C;  1EYC A;  1XYI A;  1LTB D;  4DN4 M;  1ENF A;  1WTW A;  2A6H D;  1WTR A;  4O42 A;  2G9H D;  2MUY A;  4N9P A;  3V05 A;  2NUC A;  1STE A;  2I07 B;  4KN4 C;  2JEA I;  1D1I A;  3K5O A;  5C4H A;  3D4W A;  1FNW A;  3M7G A;  3U9O A;  3TZU A;  1I50 B;  1O7Z A;  1A3V A;  3NWS A;  4CGY B;  3IKJ A;  1SYE A;  3MAQ A;  4NKL A;  1EL0 A;  1H9S B;  3ND9 A;  1A3T A;  4XTC S;  5KEE A;  1NUC A;  4OL7 A;  5KNB A;  2F0N A;  1TKW B;  4HCS A;  4CJ1 B;  1KAB A;  3L3O C;  2VB3 X;  2EYH A;  4FNF A;  2NN6 I;  4L6T B;  3P20 A;  3SK6 A;  3S15 B;  3VYS A;  1TS3 A;  2RDF A;  3A8K E;  3OHX C;  2FJ2 A;  2DY7 A;  3DXJ C;  1TS4 A;  4UAI A;  5K36 H;  4IUQ A;  1F2Z A;  3BVM A;  1LT3 D;  1LO5 D;  4ID6 A;  5ELF A;  2AQ1 B;  1JWS D;  2BE5 C;  4HMJ A;  4I65 A;  5C3W A;  1CA6 A;  1I6V C;  3P1H A;  3NPP A;  2ICI A;  3L7Z C;  3FMC A;  2K1B A;  4C3I G;  1KTK A;  1U4M A;  3ND8 A;  2A6H C;  4WOR A;  5I9P A;  3LWU A;  1FNU A;  1ROD A;  1DOL A;  1HCZ A;  1I4Q A;  3NK9 A;  1SAP A;  2KOL A;  2RBM A;  4DF7 A;  4ULL A;  4X3T A;  2XVS A;  2F4I A;  2E2H B;  1TS5 A;  1E2V A;  1HPC A;  3DHQ A;  1HTP A;  2Q8I B;  4A3B B;  3D8G A;  2E75 C;  3R8B A;  2CW0 D;  3VR3 A;  4KY7 A;  1HHV A;  3QO2 A;  3DWA A;  3R2I A;  4EQN A;  1G2T A;  3KLS A;  1BR9 A;  3FPP A;  5TSS A;  2L11 A;  4LAA A;  3PO2 B;  2F03 A;  4IUU A;  1PRT F;  4BA2 I;  2B2Y A;  1TWF B;  1I3Q B;  2DY8 A;  1II3 A;  1IL8 A;  1EU4 A;  2Q8R E;  3VR6 A;  3JAM L;  2NZ1 D;  3Q22 A;  1R4P B;  2QCP X;  4HCE A;  1EEF D;  5LHY 1;  5I6Y A;  4Q5V A;  1BBX C;  1AP0 A;  1ZYR C;  3T56 B;  1Z47 A;  2NN6 H;  2ENB A;  1MI2 A;  2K6A A;  4CHT B;  1SNO A;  4QUC A;  3AU7 A;  4X3U A;  2EVB A;  5JVG 3;  2B8G A;  3I4M B;  1PFN A;  2CHB D;  2F0H A;  3HOV B;  4A3J B;  3KBG A;  3MWY W;  1AZQ A;  1ML0 D;  2YYZ A;  3I4L A;  4HTH A;  3BYT B;  2F0K A;  1K8M A;  4EVO A;  1OXU A;  3M85 A;  5IGC A;  3KLS X;  5E3F A;  4IFD J;  2WB1 B;  3V2T A;  2O5J C;  1TY2 A;  2Z4H A;  4OIJ A;  1C4Q A;  2IX1 A;  1FGB D;  5CV5 A;  1F77 A;  4NP5 A;  1HQM C;  5EKI A;  4KKT A;  2K03 A;  1IYV A;  2R92 B;  2E2I B;  3NWT A;  2WAC A;  1KDA A;  4IUN A;  3S2D B;  1V8Q A;  1D5M C;  2IW3 A;  1PZJ D;  1A2U A;  5DEH A;  4RCO A;  2EYP A;  5E1F A;  3MXG A;  3A7A B;  1J8I A;  3OSO A;  1F9R A;  1PFB A;  1FYC A;  5BN5 A;  5IT9 L;  3N52 A;  4DFA A;  1A6X A;  1XWE A;  3S1N B;  2G9D A;  2K28 A;  4KV6 A;  2NTS A;  1MSG A;  5C0X J;  1U4P A;  4KHV A;  5M9O A;  5JVH 3;  2EYM A;  4FP5 D;  3J81 E;  2LS0 1;  2VXW A;  2HUG A;  3I4N B;  2AWN A;  4KY5 A;  4IUR A;  3ONA B;  4DNT B;  3HRZ C;  1LT5 D;  4HED A;  4ZRZ A;  1D5X C;  1IHZ A;  3A55 A;  4IFD I;  2EYJ A;  1STG A;  5DM7 3;  1QIL A;  3J80 E;  1EZ8 A;  5CBE E;  1JCK B;  2HCI A;  2K5D A;  5CYU A;  4Z9C B;  3I8Z A;  2E2D C;  2XNA C;  1TWH B;  1VMP A;  2F0D A;  1Q1E A;  2JA8 B;  1JB3 A;  4BY1 B;  3FPU B;  1GUW A;  3FKI B;  3GTG B;  1JOO A;  3TZD A;  1U4R A;  2F0G A;  1PRT C;  5JEA J;  1WCM B;  3I70 A;  3SK4 A;  1SMY C;  1LV9 A;  2FMC A;  5C0X I;  4ME5 A;  4CKB A;  1TII D;  1SYB A;  4DNR B;  3R2T A;  2VNU D;  1T5X D;  5E4X A;  1DD2 A;  1K83 B;  2F0U A;  1QNU A;  2WV6 D;  4CJ0 B;  1CK1 A;  4DGZ A;  1ILP A;  3K5L A;  5NUC A;  2KCC A;  4ILW A;  4FYD A;  3Q6S A;  4J8Q A;  1CFM A;  1SE3 A;  4S3S A;  1YNJ D;  3TSS A;  1XTC D;  2MP1 A;  3SVM A;  1OXS C;  2A68 D;  3PUY A;  3D4D A;  3KK7 A;  5CV6 A;  3GV6 A;  3U9S A;  1EY6 A;  2R7Z B;  1BO0 A;  4OO1 I;  2XIW A;  5FO9 B;  2B2W C;  1VCI A;  1E2Z A;  1LLR D;  3K59 A;  5CGK A;  4A3D B;  1STY A;  2R93 B;  4RGT A;  1Z6H A;  4BBR B;  4IUV A;  1BDO A;  1ILQ A;  4NMZ A;  2EY1 A;  4RHS A;  3M3Y B;  3MVV A;  4R8N A;  4K2L A;  1L0Y B;  3E6Z X;  1TR5 A;  2E2J B;  3MXN A;  2FHT A;  2F0T A;  1ONL A;  4IFD H;  1KDB A;  2NB0 A;  2C5C A;  4XT1 B;  3MZ5 A;  3DMU A;  2BDO A;  1CM9 A;  1HFG A;  2B2W A;  3VYT A;  1KNA A;  2QIL A;  3WOF A;  1RCV D;  1GHJ A;  2A5H A;  1FD7 D;  4A3M B;  4KK7 A;  2JSO A;  5EBC A;  2GA4 B;  3J81 L;  5ELD A;  5D14 A;  3KUP A;  4K8J A;  2K33 A;  1EFI D;  2A74 C;  5D65 A;  1K8O A;  2JXM B;  5C0X H;  4G57 A;  2L4N A;  3KLR A;  1WTP A;  3J80 L;  2IPK D;  2NVQ B;  5COR A;  1SE4 A;  3S1R B;  2KUM A;  3TP7 A;  1HRJ A;  4PMC A;  1JR0 D;  4P2C B;  2DNE A;  1CHQ D;  1ET9 A;  1JC7 A;  4PMB A;  3GD7 A;  2Z1C A;  1OXT A;  1H9M A;  4L63 B;  1RJT A;  4KKS A;  5I9O A;  2NN6 G;  2LY7 A;  1TQO A;  2CQA A;  5EKK A;  3CKI B;  1LTA D;  1U4L A;  3HZX A;  3NBI A;  1IKL A;  4OO1 H;  1MGS A;  3P75 A;  3RMH A;  1DXM A;  4QF4 A;  4XIG S;  2PNR C;  4C2M B;  1SYD A;  4YIJ A;  3RZD B;  1CZW A;  4JBW A;  1E0B A;  2K32 A;  2K5W A;  5FKA C;  2KED A;  3SEB A;  1PRT B;  2E76 C;  5G3L D;  1C8C A;  1D1K A;  1A3U A;  5HUR A;  3V96 A;  3BYY B;  3FRP B;  4RAU C;  1GJX A;  4UDU C;  1JOR A;  1VF5 C;  3I72 A;  4K6L A;  1H9J A;  1I4P A;  5CBA E;  3EA6 A;  3OWE B;  2A6E C;  3I90 A;  4N9T A;  4RWS C;  1PTO D;  4HAE A;  2F0V A;  3D6C A;  2SNM A;  1QOH A;  3URY A;  3PV0 A;  1WD0 A;  2OF1 A;  1SYG A;  3HOY B;  1T5E A;  1X3Q A;  2X6L A;  1HTL D;  3K6O A;  2KJX A;  2YU9 B;  1HUN A;  3LX0 A;  5EKL A;  1MBY A;  2XN9 C;  1SNC A;  5CV7 A;  1DCZ A;  2SDF A;  5FK9 C;  5EPJ A;  5C6A A;  3W3A A;  4K14 A;  4IZ8 A;  1JQY D;  3C3L A;  1UAP A;  1SND A;  2ID0 A;  1NR2 A;  1SXT A;  1BUV T;  1W6K A;  2E74 C;  1A2T A;  3NTH A;  2F0L A;  2F0J A;  3QIA A;  4K5W A;  1VMC A;  4IUT A;  4FF3 A;  4RHR A;  1O7L A;  3BG3 A;  2M2L A;  5IGE A;  3T53 B;  4LMQ D;  2K5Q A;  2LFN A;  4RKB A;  4KI0 A;  3M4O B;  3EVQ A;  5EPL A;  5C5L A;  3OWF A;  2EY2 A;  1QJO A;  5KND A;  2TMP A;  1MD2 D;  4B9W A;  1PTO C;  1B50 A;  5C4X B;  4BY7 B;  3TN2 A;  2IT1 A;  1Q90 A;  3HEJ A;  1G8Z D;  1SJH D;  4XQN A;  1IW7 D;  3S2H B;  1WTQ A;  4ZKB B;  1HXY D;  4CBV A;  3GO5 A;  3D6W A;  1CTM A;  3TP6 A;  3Q24 A;  1PTO H;  4OGQ C;  5COY A;  2L0C A;  2IX0 A;  4MN3 A;  3DEP A;  3MA2 B;  1TWG B;  5CV9 A;  3MEH A;  4OHJ A;  2IJ0 A;  5A35 A;  1WTX A;  4ZYS A;  4RGM A;  4DXG A;  2WKC A;  1PFM A;  2L5T A;  5LL6 X;  1HA6 A;  2MJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...