1EYCA

Structure of s. nuclease stabilizing quintuple mutant t41i/s59a/p117g/h124l/s128a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eycA00
3MXPA 5CC4A 2O4XA 3SK4A 1TQOA 4NDXA 5IGDA 4KHVA 5CV6A 1EY0A 3V2TA 4RKLA 5KRUA 4NMZA 3P75A 4B9XA 4KJOA 5I6WA 5NUCA 3EVQA 2RDFA 4IUNA 1TT2A 3NHHA 4ZQ3A 2EYMA 4IALA 1A2TA 1JOOA 5I6YA 3MHBA 3QOJA 1EY7A 3NXWA 4K5XA 5EGTA 1EZ6A 3SXHA 5CGKA 3MZ5A 2PZUA 3D6CA 4QB4A 4ME5A 1EY9A 3ITPA 5IGGA 5KGUA 2HQEA 3EJIA 2F0HA 3DMUA 4K2KA 5HURA 2EXZA 3OMGA 4HMIA 1JORA 5ISRA 4KY7A 5KIXA 4J1MA 3RUZA 1F2YA 2KQ3A 3OSOA 5JOBA 1SNDA 4K8IA 4WRDA 5I9PA 4K14A 1TR5A 4ID6A 5CV5A 5DAUA 3TP5A 4LAAA 2EYHA 2F0GA 2PZTA 3QB3A 5CR3A 2F0SA 4PMBA 3ERQA 3T13A 1JOQA 1STGA 2RBMA 4N9TA 5KYLA 2EY6A 3D8GA 3H6MA 5IOCA 3HEJA 3QOLA 1KDCA 4DFAA 3TP8A 4MIUA 3NUCA 2RKSA 4NKLA 4EVOA 2PQEA 3EROA 4HTHA 1A2UA 4PMCA 4EQOA 4F8MA 4KY5A 2KHSA 3HZXA 4NP5A 5CV4A 5I9OA 4ODGA 4TRDA 3SK5A 2LKVA 1F2ZA 4H7BA 5CV7A 2EYJA 1NUCA 4G57A 2QDBA 3NK9A 3VA5A 4K8JA 1EQVA 3PMFA 1STBA 4K2LA 1A3UA 2OXPA 1ENAA 2OEOA 1AEXA 1EYCA 1STAA 2EY2A 2SNMA 4KV6A 3OMCA 4RKBA 2F3WA 1ENCA 4EQNA 3P1HA 5C4HA 5C5MA 5CV9A 3C1EA 2F0JA 5C3XA 1EY8A 3BDCA 2F0MA 2SOBA 3C1FA 5CV8A 4YIJA 1STYA 4KJNA 4I65A 1EZ8A 2F0EA 5EKLA 1A3TA 1JOKA 2WACA 4QF4A 1SNQA 3SK6A 5HGTA 5F2DA 1STNA 3D4WA 5KEEA 1SYGA 1SYBA 4EQPA 3S9WA 1STHA 2SNSA 3SK8A 5C4ZA 2F0IA 5C6AA 5E3FA 4DGZA 5IGCA 1SNMA 2PW7A 2F0FA 2F0WA 4S3SA 2EY5A 4J6HA 4OL7A 5JAVA 1KAAA 2M00A 1EYAA 3D4DA 1SNPA 4KY6A 5IODA 5C5LA 1SYFA 4KD4A 2F0OA 4PNYA 3SHLA 2F0VA 1SNOA 3TP7A 1SNCA 5J1ZA 4IZ8A 3MEHA 4QMGA 3NP8A 4WORA 2F0QA 3TMEA 1IHZA 5M9OA 3LX0A 3R3OA 4N9PA 2F0NA 3BDLA 3U9OA 1EY5A 3MVVA 5IGBA 3OWFA 3T16A 4R8NA 4DU9A 2EYOA 5K5PA 2F0TA 5EKKA 2NUCA 4KTAA 2EYPA 2EY1A 2PW5A 4K6DA 1U9RA 5DEHA 2F0DA 4ZUJA 2F0LA 1EY6A 2PYKA 3NQTA 1KABA 2F0PA 4DF7A 5IIFA 1SYCA 4E6IA 1II3A 1SYDA 2EYFA 1SYEA 3SR1A 2F0KA 5KYIA 4K5WA 2ENBA 2PZWA 1F2MA 5C3WA 1KDBA 4F7XA 2F0UA 3TP6A 1KDAA 2EYLA 2F3VA 1A3VA 2OF1A 4B9WA 1NSNS 5IGEA 5J22A 1EY4A 3E5SA 4ZUIA 1RKNA 1EYDA 4HMJA 4K5VA 5IGFA 5E1FA 3DHQA 5J39A 4KD3A
chains in the Genus database with same CATH superfamily
2QILA 4OXPA 5CC4A 4L5QA 1HXYD 1UAPA 1FNUA 4I7AA 2Q2HA 2MP1A 5M3MH 3S2HB 2Z4IA 2E74C 2VB3X 2G9DA 4L63B 4BBRH 3OW7A 3CMAA 3J80i 4OIJA 5K36H 1MSHA 3M4PA 1H9KA 4YWMA 3GDEA 4LWCA 1IW7D 4GOPC 3ERSX 4HCSA 2PQAB 4JI3Q 1A6XA 2K03A 5CV5A 2LSSA 4U68A 1F9SA 2CH4W 2WINB 4CDFC 4LMQD 4DUYL 2KCNA 3ND8A 2B2UA 2N78A 3HGBA 2NVXB 1IBLL 2MGSA 1PTOD 2LXJA 3FKIG 2LXKA 4MIUA 4NKLA 4ZAIA 3QJYA 1Y1WG 4DR4L 3VR2A 2R92G 2JA7H 4OX9Q 2KHSA 3V96A 3J81E 3TREA 1HNZL 1K0SA 2DGYA 3U4ZA 1BUVT 3S1NH 4X3UA 4O1NA 3HOZH 1OXUA 3M4OB 1STBA 3DEPA 3PO3H 2E2IH 5L37A 3GO5A 3E0EA 4DNIA 2SNMA 2EJFC 1S4ZA 1G91A 3A74A 1TWFB 3C1EA 2PPBC 4BA2I 1C48A 4MN3A 4LF7Q 1EQQA 1SNQA 4L5TA 3S9WA 3GV6A 2SNSA 4BY1G 1CSPA 4DV4Q 4J6HA 4YCVA 1YEZA 1G291 2A6ED 1F2LA 1FJGL 4AYBE 4JI8L 2RCFA 3BU2A 4JI1L 4LF5L 1A62A 4ZLTF 1K73C 4QMGA 3U50C 5LMNW 4TVAB 5IGBA 4Y7NB 1LYLA 2UXDL 2F0TA 2FHTA 1MGSA 2EY1A 1IKLA 2F0LA 1YIJA 1EY6A 1LT4D 3MAQA 1L1OB 3SR1A 3CCVA 3I8ZA 4CJ2C 1G6ZA 3RZDH 3TZDA 2C5CA 4DR6L 3GQBA 1QZGA 1K83H 2MNAA 1MI2A 3D0FA 4OHJA 2PO4A 5M5WH 1TWAB 3A5UA 1OO9B 1Q46A 1B50A 1JWSD 3D31A 1HRJA 3NTHA 4CKEA 1LT6D 4C3IB 5A2QE 4LFBL 5C4XB 3OIQA 1JOOA 4BY7H 1PV4A 4K5XA 3G7LA 1CKNB 1B70B 3J7AV 2B2WA 4ME5A 2TSSA 5KGUA 2NN6H 3FMCA 4DK6C 3AFQA 3K5MA 4AQYQ 4A3JG 2ZTCA 4A76A 3VR3A 3HKZE 1NBWA 2EVBA 3F2CA 4JVZA 4WRDA 1WTHA 5CBEE 2RQXA 3UDXA 3J81c 3TP5A 2UU9L 3GTQB 2BOSA 4A93G 3V05A 3STBC 2E2HH 3UDIA 4A3EB 2ATWA 1PXUA 2R7FA 2HCCA 1SLJA 5TSSA 1VQIA 1QUQB 1VQEA 4UP7A 4WJWA 4B3RQ 1PTOF 4PV1C 3NBHB 1PZJD 4IFDG 1EWIA 2BDOA 3KUPA 1S72A 5JJKA 2K5VA 4CHTB 1VDZA 1X3PA 1S5BD 4K8JA 4XT1B 1TWCB 1ESFA 1AZPA 4LF9L 3OWEB 3R2IA 5D3IB 2SEBD 3BDCA 4JI0L 3KDFB 2A19A 1STYA 3KJPA 1EZ8A 3KYHC 2Z6KC 1K0RA 3BZDB 1MSGA 4NXNL 1IBKL 2UUAL 1F77A 1SFOH 1LT3D 5H1SE 2B8GA 1I4HA 2YTYA 3J80E 3J7ZC 4OO1H 1LTTD 4OL7A 1K8AC 2QCPX 3I4MG 4DR7Q 1O7LA 3T1YL 3GTGH 3K5LA 4A3FB 1EU3A 4RCNA 3S2DH 2F0NA 4DV3Q 4AIMA 2A6HC 2VZAA 4UPAA 4DU9A 4DR4Q 5CBAE 1XYIA 4GN3B 5DM63 1VQNA 3UE0A 2CQAA 2KCTA 4A3JB 4DV6L 3QG1A 3DXJC 2AHOB 3NWTA 4L6TB 2JA8G 4B3TQ 1LTAD 3L9AX 4R4IA 2KCMA 2QF7A 1SE3A 4F87A 4A93B 1PMRA 3RN2A 1SE8A 4HIDA 2RSOA 1FD7D 3E5SA 4OELB 3W1BA 2L5TA 1XTCD 1KNEA 1AFPA 1PYBA 2TMPA 3I56A 1HFNA 3NENA 2ZXPA 1Z47A 3GTLB 2QEJC 5EJWA 2CWPA 1KD1C 1I6VC 4BXXG 1HNXL 1EY7A 1EZ6A 2E8GA 4A3LH 1FJGQ 3MZ5A 4JI8Q 4JI1Q 4LF5Q 4DAYB 3GTMH 4B3SL 3VDYA 3EJIA 4C3HG 3PV0A 5EBCA 1GKHA 2VUMB 2OQKA 1O80A 1FYCA 1UE5A 2DUDA 1EYGA 1CHPD 5HGQA 5IE8A 4B08A 1HZ9A 4IUTA 1BCPB 4GLAC 1Q12A 1I50B 2EYHA 2F0GA 1C4QA 2PZTA 1LTLA 1XNQQ 2NB0A 2RBMA 4O2DA 1KRSA 4JBKA 1XPUA 3I4MB 4ILWA 5BN4A 5JEAG 4A3GH 2CW0D 3ZYYX 4FXKC 3HZXA 1ZKOA 4DR6Q 3A8JE 2I0QA 1HTPA 3BVGA 3OTOL 2QDBA 5J3BA 2BDNA 3IFTA 1GUNA 4K2LA 1WFQA 4R4CA 2EY2A 3J80c 4UDUC 1VQ9A 1W3SA 4LFBQ 2JA8B 4TKOB 4QQBX 1IW7C 2N88A 3JAMi 1XPOA 4FF2A 3CU7A 3D4WA 4OONA 1HUMA 1BXTA 1PLFA 2IWHA 5JVG3 2M00A 2OQ0A 2MO1A 1PTOC 3TDQA 2UU9Q 2K5HA 4PG3A 5IT9L 4A3IG 3Q8DA 1PYWD 3M7NA 1IHZA 3GTOH 2E75C 1DONA 1KLGD 4DNTB 5EKKA 2NUCA 2IL8A 4C2MB 2V4DA 2F0DA 2JA5B 1HH2P 3K7AH 2KHJA 1DOKA 3IKJA 1WOCA 1PH6A 3HFZB 1UNSA 2A73B 5ELBA 4F7XA 2ZJRA 4HAEA 2YYZA 3IL8A 2Z4HA 3HOVG 3PO2H 2O2LD 2WFWA 1NSNS 4JI0Q 1V8QA 4HJ7A 1AZQA 5I4DA 2B63G 1WTWA 3MXPA 5IYDH 1J9OA 1CKOA 3G6JB 4K0KQ 2A6EC 4NXNQ 1IBKQ 2K14A 4BS9A 5M3FH 1I5FA 5NUCA 2X6LA 2RDFA 2K01A 1OXSC 1VQJA 4IALA 1VQHA 4P71A 1K3RA 4IURA 1P16A 1CZWA 1B53A 1TS2A 5EGTA 5IYCH 3PIP3 2DY7A 2C9OA 1WJJA 1HNWL 1STEA 3G6EA 1VS0A 3H0GB 4HMIA 3S1RH 1MD2D 1S3OA 1XWEA 3E6ZX 3KLRA 3OIPA 2R93G 5JOBA 2ZXRA 2GA4B 2JA6H 1J5EQ 3HOYB 2CWAA 1STGA 4DV6Q 3GTJH 1TY2A 1BBUA 2R6GA 5IOCA 1PRTB 5IP7G 4U673 4DR1L 1I6HH 5FJ8H 3JC66 4DAPA 4IQZA 1XNRL 1GUWA 1VQPA 4A3CG 1GHJA 5M5XH 4EQ5A 2UXCL 1BCPD 1ENAA 4XQNA 4ULLA 1TVXA 5G3LD 4EQNA 4IJLA 1F9PA 1A63A 1JQYD 4HIMA 1HNXQ 1PH9A 2MHVA 2DNCA 2E2DC 1JOKA 1QE6A 1E1OA 1V43A 2ZTDA 2VW9A 3HOVB 2R7ZB 4EQPA 3RMHA 5C4ZA 3K5OA 1R9TB 3CCLA 1SEBD 1JT8A 2F0WA 5BR8L 2DNEA 4LFAQ 5IYDG 3D4DA 2BE5D 1MKHA 1SR3A 2K52A 4POGA 2HIVA 2F0VA 5C0XH 3S16H 4IZ8A 4WJ4A 2KBNA 1AN8A 4HSPA 1HUNA 3AEVA 3TQYA 3W3AA 4JOIC 4LJZC 2J7ZA 1WCMG 2KA7A 2E2JH 3VA7A 3HOUB 3HG9A 5K5PA 5GQOA 3K0XA 4DV2L 4OIKA 1VQ4A 4HSVA 2UXBL 3I72A 2R93B 1TWGB 3OTOQ 3GP7A 4JBWA 5AFWA 1RTNA 5GROA 2EYFA 2MUYA 3ICEA 3FEWX 4RCOA 4UP9A 2FXQA 4GS3A 1A3VA 2UUCL 4BA1I 5J39A 4YCWA 4DV5L 3PUWA 3M3YH 1MIUA 5IGDA 1JCKB 3P7JA 4UAIA 3V2TA 3S2HH 4LF8L 1TWHH 1Q8IA 3P75A 1UEAB 3JAME 4IFDJ 4IUNA 1EFID 3RLFA 3VYUA 3PIPA 4RGTA 3ONAB 4KI0A 3ND9A 1WTVA 1IL2A 2CFMA 5CORA 1PFMA 5IGGA 3MXNB 1BVSA 4CJ0B 1UWVA 3J81i 1Z9FA 4X3SA 2E5LL 3OPOA 3C3LA 3KJOA 3M4YA 1MJEA 3TS2A 1U4LA 4A3MG 1GXDC 1T9HA 2NVYB 4KLKA 5C44B 4PMBA 4QIWB 2NVXH 1M8AA 1SJED 2V1CC 3NWSA 4YHHQ 4A3DG 3A7AB 4DAVA 1YVCA 3VR5A 1PTOB 4R1JA 1TS3A 2MFIA 2HDMA 3A54A 3PCOB 1I3QB 1HZCA 1U4MA 4KHPL 5JPNC 1SN8A 3FDTA 3HP3A 1TWFH 3NBIA 4JI5L 2ICIA 4Y52H 1BCPF 1JB7A 4JI7L 4YIJA 4JG2A 1C8CA 1PRTD 4QF4A 5G3LF 3KLSX 2PCFB 2NBFA 1Y69U 4AH6A 2F0IA 4DGZA 3KLWA 1H9RA 3F1ZA 3CF5A 3RNUA 1BBXC 5FLXL 2NVQH 1WTRA 2CW0C 3RZOB 2SDFA 3S14H 2A6HD 2M9VA 3NEMA 1C0AA 3LGJA 4JI2Q 3R3OA 2VQFQ 4DR1Q 3S17B 4JV5Q 3I4NB 5FLMG 1HR0W 3TEHB 3PF5A 5IWAL 5DEHA 1NAPA 2ASBA 3CC2A 1UE7A 1D1IA 1X3EA 1M90C 2EZVA 3JAMc 1JJGA 3FKIH 4A3DB 1TWAH 1HZBA 2R92H 2DY8A 4FO2A 1SBBB 3SK4A 4KHVA 3EVQA 4MTKA 3G4SA 1IBML 4RHRA 5BR8Q 2F52A 3CCJA 4R9WA 3MHBA 5CGKA 2ZM6Q 3MXUA 1EY9A 1CQVA 1K8MA 2EJMA 5EQ0A 4GNXA 1SMXA 5HURA 1VCIA 5C4JB 1H9MA 2VXWA 1EWHA 4BY1H 3GTQH 4BBSG 3TBIB 3CCEA 4DV2Q 2DN8A 3B6YA 2OTLA 2HCIA 1FNVA 1VQMA 3H6MA 3NE5B 4KMUC 3K5NA 1ICFB 2PMZB 3TP8A 1XMQL 1HCZA 3R8BA 3K58A 2XRSD 2XSCA 4KY5A 5CV4A 2UUCQ 2VNUD 1D5XC 4ODGA 4DUZL 2IX0A 3SK5A 5FO7B 1F9RA 3EBEA 3PMFA 2K7VA 4LF8Q 4JW0A 1X65A 1CUKA 1KHIA 3HRZC 4KKTA 3S1MB 1K9MC 1B9MA 2F0EA 5F2DA 2RDHA 5I2XA 2B29A 1E24A 2IX3A 1PRTF 2E5LQ 3M7GA 1HA5A 1EQRA 2AQ3B 3CPFA 3LWUA 1HPCA 1FNWA 2LFNA 1SNPA 3E9IA 2NZOA 1PH4A 5AJ3Q 5C4XG 3CP0A 4C3IG 3GD7A 3TP7A 4WORA 1ESRA 2F0QA 1VQ7A 2BH2A 5LMNQ 1BCPC 4MHEA 4A3JH 4OWWB 3MWYW 2L55A 4L5RC 4DAMA 3G48A 3KF8A 4KHPQ 5A35A 2IX1A 1KABA 4A93H 5GAEC 1QVFA 4BBSB 2IW3A 1G2TA 3MFGA 4A3EG 4XTCS 3C2PA 3HOXB 1NTGA 1RJTA 1RKNA 3N6RA 3DHQA 1QOHA 3PSIA 3GTLH 2AWOA 4IFDH 2BE5C 1BBWA 1TS5A 3S1QB 4M8AA 3G71A 2NVTH 1QCBD 1IZ6A 3NHHA 2CCZA 4HJ8A 3FP9A 5I2YA 1SXTA 4DN4M 5D3DA 1E3PA 3KK7A 4QB4A 4NPSA 2K5QA 3I70A 1P8LA 2WAQE 4IPHA 4K2KA 3J81L 1CI3M 1I50H 4ZKBB 4TSSA 5I9PA 3CCUA 1YNJC 2JP1A 3NELA 3I4MH 1B44D 5IWAQ 1D2BA 3HEJA 3QOLA 1D6EC 4A3FG 1EOTA 1U4PA 2PQEA 3EROA 2WB1G 4M1UB 1I4GA 3RLNA 1IYVA 3SVMA 2MPMA 2K04A 1EIGA 3L2PA 1DYQA 1NUCA 2PQAA 4DV1L 2RF4A 4GLXA 2JA8H 3A8IE 1G2SA 4O42A 4DXFA 1IBMQ 3Q23A 2SOBA 3SE0A 1WD1A 5CV8A 2Z1CA 1E2ZA 1PH2A 1X56A 2BA0A 1PH3A 1I4RA 2Y0SE 3IRBA 1QG7A 4PQXA 5ELCA 3CCRA 3KF6A 4BXXH 4PNYA 3OW2A 1SNOA 3D6WA 2RHSB 5IYBG 2KEDA 3VYSA 4C3HH 4GKJL 2VY3A 1BR9A 4OEMB 4C2MH 5C3EG 2VUMG 1XMQQ 1QVCA 3T16A 2D62A 4WFN3 2JA5H 1EIHA 1Q86C 4CGYB 3Q6SA 1ENFA 2B2YC 3BZCA 4DUZQ 4ZCKA 3BZKA 3CRKC 4KKSA 1YITA 4DF7A 1KTKA 2OTJA 4BBRB 1SAPA 1PRTC 5A2QL 2ENBA 2PZWA 1K28A 3I55A 4DV0L 5JEAH 1S5DD 2EYLA 2F3VA 1ASYA 4B9WA 1S40A 2B3GA 4K5VA 5IGFA 3HOWG 4FXGC 2RCNA 1YJ9A 4DUYQ 1TQOA 2WB1B 5C0XJ 2HD3A 1IBLQ 1NE3A 2AQ1B 4PZ6A 1KRTA 1L1OA 1HNZQ 5FKAC 1VQ8A 5BN5A 3H0GH 3D6CA 3SGIA 1X54A 2I5MX 1NR4A 2NWGA 2BA1A 3S1NB 1XXGA 2ICEC 3S15H 4UY8C 1N34L 3GTKB 3FRPB 3CCSA 1B2TA 2O5JC 1D8LA 1S5FD 4OWTB 5ELDA 3I90A 3QO2A 2EY6A 4A3IH 3K0YA 4DV7L 3BVMA 4ZKCB 1A15A 2KENA 2QGQA 3AU7A 4EVOA 4EQOA 1AH9A 1D1KA 2L9HA 5C3EB 1CHQD 5C0XI 4G57A 3DEOA 2ES2A 1VF7A 3J80L 3AMUA 1VQ5A 3EQLC 4C1NI 4CDDC 2JA5G 1W6KA 1OTCA 2R61A 2UXDQ 1E7ZA 4RA8A 1ENCA 1MBYA 4L8JA 4JC0A 3WWVA 4L5SA 3HOVH 5FO9B 2R7ZH 3DUZA 4RGNA 4LUOA 3PQIA 1QNUA 2Z6BA 2H5XA 3FVQA 4Z9CB 2B63H 3UI2A 4CKCA 1STHA 2F3IA 3HOWB 4HR7B 1SNMA 5IGCA 4I7ZC 2K5NA 3DM1A 4PZ7A 5D14A 5ELEA 5T1GA 5M9OA 3VYTA 1DM0B 3U9OA 2ID0A 3MVVA 2AWNA 4TQUS 3H0GG 4R8NA 5M5WB 3BVZA 2Q8IB 2R93H 1R4PB 1TWGH 2QEXA 1XMOL 2K4KA 1HTLD 1C9OA 1HHVA 5FOBB 4E6IA 3HOYG 4BY7B 1SYDA 4DV1Q 1VQBA 4GKKL 4J8QA 1X55A 4NB3A 1T5XD 2F0UA 5IP7H 1VQGA 5IGEA 4GNXC 2Q2UA 5FK9C 1EY0A 1VQAA 3EFXD 4RKLA 4A3CH 4NMZA 1EL0A 1FL0A 1N36L 2HUGA 4ZYSA 4X62L 1TT2A 5I6YA 1KQSA 2XVSA 1GUSA 4GOPA 4OWXB 4RAUC 2F0HA 3D4RA 4KN7C 3T56B 4LF9Q 4A4IA 2R7ZG 5C44H 1Q8KA 2B2VA 1ASZA 3X3NA 2IT1A 2IY5B 1D5ZC 3A5ZB 2UUAQ 2X6GA 1JE4A 4KK7A 2OWOA 1PTOH 1WCMH 4HTHA 1I3QH 1VQCA 4DV0Q 4G7HC 4JBMA 2UUBL 3HOUG 3K6OA 1HR0L 1N33L 3T1YQ 4H7BA 3WOFA 2B2UC 3NSWA 1XX8A 4MZ9A 2ZT9C 5ELOA 2QW7A 1WD0A 2K50A 1VQLA 1GHKA 1JWMD 4XDXA 2B39A 3W5OA 3BS1A 1EEID 2FMMA 1SYBA 3U58A 2I46A 2F0FA 4A3KG 3RZOH 2G9HD 1EYAA 3J81j 2F0OA 3IFDA 4J15A 2Q8TA 2J4XA 4DV7Q 2EIFA 1OXVA 3KBGA 1Z7TA 2XN9C 2GN5A 4Q0FA 3PUZA 4RFBA 4A3MH 2YU9B 4B3SQ 1XTDA 2EDGA 3H3VI 1DOLA 3R2TA 3FPUB 3GTPH 1LACA 5C44G 1K8OA 2OCEA 3ULJA 4JPBW 3MTSA 4RGMA 4MNOA 3CXCA 4A3DH 5C3WA 3TP6A 1LTRD 3GTMB 5EBDA 5J22A 1RDPD 1MJCA 2AKWB 3CC4A 5HY6A 3PUVA 1RIPA 2CVRA 4X66L 1H9SA 4B9XA 3TS0A 1GVPA 3MC0B 5FO8B 1CA5A 4HEDA 5DLQE 1LM0A 4DK0A 4DR2L 1PFNA 1ZEQX 2RA4A 5C4JH 2HQEA 3K8AA 1W6JA 2D5DA 2EXZA 1YNJD 3N52A 4AYBB 1J6QA 2AUKA 2A68C 1SNDA 2B2WC 1WVLA 1AE3A 1TR5A 3ULPA 4HCEA 5DAUA 4LAAA 1NY4A 2EXDA 1HQMC 2B8FA 2AQ2B 2N55A 2R3ZA 3ERQA 1EUJA 4BWGB 4A3KB 4FVMA 5EPJA 4GKKQ 1PVOA 1HFGA 4DR3L 1X9NA 4R8IA 2AMCB 2A5HA 4QUFA 1Q90A 1BDOA 4PMWA 5FLMH 3CC7A 1SRUA 5BN3A 3I4NG 1HQRD 3CW2C 2FFKB 3VA5A 1NNXA 1I4PA 1CKMA 5JJIA 2Z6KA 4G4KA 1N36Q 1ZYRC 4RKBA 3F2DA 3S1MH 3E3XA 4ABNA 2WP8J 1E0BA 5C3XA 4ALPA 1Q1BA 4PZ8A 1CFMA 2BH8A 2K1BA 1SE4A 3DWPA 2Q8RE 1STNA 2JE6I 1SJHD 2CQOA 1M1KC 2EY5A 4X64L 5JAVA 4B3ML 5E4XA 4IUUA 1V1PB 3M4OH 5M5YB 4UHVA 5C5LA 4KD4A 4GNXB 2ZJPA 1I4XA 2M2LA 4IFDI 2K75A 3MEHA 3NP8A 2L12A 2GVBA 3HKZB 3F2UA 3TMEA 1B9NA 4CBVA 3LNNA 1Q3LA 1NCVA 1JJ2A 1E22A 2XIWA 1ET9A 3IAYA 2UUBQ 4BBSH 1HNWQ 4LF7L 1B4OA 1HR0Q 1PDQA 3CRLC 4KN4C 2PYKA 3NQTA 3JAML 1Q1EA 1FGUA 3WDNA 2JN4A 4P72A 1KLUD 4C3JG 1WTQA 1EYDA 2E76C 4IN3A 3S1QH 1LLRD 4Y7NH 2O4XA 3AQQA 1KL9A 4DR5L 5COYA 5ELFA 2JA6B 1VMPA 4KJOA 5KNBA 4FF1A 1RF2D 2VB2X 1DD2A 2WKCA 1XNRQ 1CT1D 1EEFD 1LTGD 2NN6I 1RTOA 1I6HB 2UXCQ 1WI5A 1YHAA 4V190 1N9WA 3KFUA 3R93A 3H3VC 1KXLA 4K8IA 5JEAJ 4LF4L 4UP8A 2RSNA 4N9TA 5C4XH 4C3IH 1UUPA 5GAGC 1E1TA 1L2FA 3D8GA 5EPKA 2EPBA 5IP9G 1YI2A 3NUCA 1A2UA 4HJAA 4NP5A 3KF8B 5E7NA 1ONLA 1ICWA 1LTSD 4IPCA 1J8IA 1Q81C 3D3RA 4X66Q 2OXPA 1PHJA 3OMCA 5EKIA 4LUVA 4A3EH 1MHWC 4A3BG 1G8ZD 2OT2A 2UXBQ 1LUZA 4F88A 1WTXA 5EKLA 1A3TA 2LMCB 3HOXG 3K7UC 2VQEL 2I07B 2KHIA 3SK6A 4X6AH 1NJIC 4C3JB 5EPLA 3SK8A 4OO1I 1E2WA 3A8KE 2J0TD 1TKWB 1IKMA 1KAAA 4DV5Q 1EIYB 1TWCH 5IODA 2A74C 4RMFA 1SNCA 4HJ5A 1IL8A 4IUVA 4IUQA 1CQFA 5DNFA 1RHPA 4DR3Q 3BDLA 3CHBD 3M3YB 4G7ZC 2HDLA 1TWHB 4NXML 4ZUJA 1YNND 3U9SA 1L0YB 3I91A 3TN2A 3K59A 1VQKA 1O7IA 1RODA 1FR3A 1K8GA 1VQDA 1BO0A 4A3FH 1SE2A 2XTIA 4HMJA 4DR7L 4KD3A 2H4OA 3MEFA 3H94A 4NDXA 2JEBI 1NR2A 2KJXA 5CV6A 3TSSA 1M4VA 2YV5A 3NTIA 4V0BA 2BCOA 2B2VC 4DV3L 1HJPA 4X64Q 3DWAA 1GM5A 1JMCA 1SROA 4B3MQ 1S5CD 1TXYA 3BG3A 1JR0D 4A3BB 4GN5A 5ISRA 3GTKH 1N8RC 4B3TL 2NYZD 4J1MA 3KF6B 4JI5Q 3RUZA 1F2YA 3MXGA 4JI7Q 3F2BA 4YWLA 3I2ZA 4HN7A 4DPGA 1JOQA 1GD7A 2G5DA 5LMUL 3M85A 2F1MA 3URYA 3EA6A 1CK1A 2DJFC 5IYBH 1BF4A 1IXRA 1Y1VG 1OXXK 4KKUA 3Q0AA 1S5ED 5C3EH 2VUMH 1JJCB 1CM9A 1PFBA 1U4RA 4QGUA 3MA2B 4TRDA 1YNXA 2EYJA 1O7YA 1TIID 4DR5Q 1EQVA 5M3MG 1PZID 2NVQB 1VQ6A 4N9PA 1EYCA 1B8AA 3QIAA 4H0LC 3S14B 4Q5VA 4BBRG 3CCMA 4G7OC 4HIOA 1DOMA 4ZK9B 1EY8A 2F0MA 5JJLA 1O78A 3WOEA 2HHHL 5K36G 4I65A 4JK1C 2WIIB 2WACA 2JA9A 3HOWH 1XNQL 5KEEA 1V9PA 2JJQA 3OYYA 4JOIA 4JI4L 4LF4Q 1GO3E 3RR5A 3H15A 3FKIB 3NPPA 1Y1WB 4QJFA 4R4QA 3TRZA 2R92B 3CQZB 4QIWE 4QL5A 2JA7G 3OWFA 1PH7A 4XYOA 3H09A 4KTAA 4P75A 3U4VA 1TS4A 2PNRC 3HOZG 4DKAC 5LL6X 1X6OA 3PO3G 3E9HA 1I94L 5KNDA 3PGZA 4POFA 2KCCA 4CDEC 3CCQA 2OF1A 4FF3A 1EY4A 1FVIA 5E1FA 3HKSA 1Y1VB 4BY1B 2VQEQ 4P2CB 1A8VA 2RDGA 5KRUA 1N32L 1Q82C 1YJWA 5I6WA 2KUMA 4XYQA 3CD6A 2PI2A 4ZQ3A 1RL2A 1K3BC 3L0OA 1A2TA 2VS1A 3NXWA 5M3MB 2KEEA 3T53B 3BYYB 2A68D 4DNRB 4X3KA 4H44C 1Y14B 3RN5A 3DLLA 3DMUA 2IPKD 1T5EA 4KY7A 1BKBA 3Q24A 5GADC 3OSOA 1BOSA 2X69A 4RG1A 3H91A 4IUPA 3RD4A 3X3MA 1AE2A 4CJ1B 4NXMQ 2F0SA 5EAYA 5ELNA 3BYTB 4K0KL 3SDZA 3GV3A 1QWYA 4GN4B 3UDGA 4DFAA 4C56C 1VQOA 4R4TA 2RKSA 2QDLA 4KHZA 5KNCA 4C1NK 1ZYRD 1F2ZA 2JA7B 2Q2IA 1EIFA 2NZHA 3K81C 4ME3A 3DWQA 4DK1A 3HOYH 2JQOA 3HOZB 1STAA 1SDFA 4BY7G 3FPPA 1IYUA 3PO3B 4R4OA 2E2IB 4QUCA 3C1FA 2NN6G 2Z9HA 1J5EL 2GVAA 1CKNA 2Q2TA 2IHEA 4RGOS 3NTKA 5C6AA 1C7YA 3A7LA 4FYDA 2KVMA 3E0JA 4GOPB 3PUYA 1KC8C 2MJ8A 3SHLA 1SYFA 3W1GA 4LF6L 1EQTA 3J7AF 5LMUQ 4IPGA 1KNAA 2FJ2A 3L3OC 2RHQB 1GUOA 3A56A 2I5HA 2A69D 1DJRD 2CH4A 2CHBD 1JB3A 4YY3L 2YU9H 2VL6A 2K33A 2HIXA 1R9TH 2PMZE 1QUQA 2NVTB 3FHWA 4JYAL 3NBHA 1ML0D 5IT9E 2B2TA 4A75A 3NQIA 2XWJB 1DGSA 4LFAL 2K6AA 1Q7YC 2HHHQ 4XIGS 1CA6A 4K6LA 3RZDB 3HOUH 1IYJB 1CZGA 1LV9A 3KDFA 1PH8A 1CTMA 5JJZA 1H9JA 1K83B 3J7A5 2CKZB 4JI6L 4OO1G 2KOLA 2KECA 2I5LX 1SMYD 2XRQD 2L1BA 2EQSA 1AW7A 3EN2A 4JI4Q 1CSQA 2DJGC 4FP5D 1JORA 2F4IA 1EU4A 3ZJYC 1YNNC 3CKIB 2KQ3A 5DM73 1VQFA 1Y8PB 3ER0A 1PFSA 1JC7A 4A3KH 2ZXOA 3KOJA 2JK8A 1QILA 1YJNA 5KYLA 5D65A 3LWEA 1I94Q 4RHSA 2E2HB 1KDCA 3OOCA 3KBXA 1QVGA 1LT5D 2PI2E 3K80C 4MTNA 4P73A 4F8MA 4PMCA 3I4OA 3I4LA 4IOAA 4LNQA 2NTTA 4QCLA 4P74A 5CV7A 2K28A 3I73A 1E2VA 3NK9A 1N32Q 1DCZA 4YWKA 4GKJQ 2Z8LA 1NMFA 1VMCA 2NVYH 2L0CA 1X3QA 2F3WA 4EGVA 4N8X1 5CV9A 3MFYA 2F0JA 5C5MA 3UE1A 4A3LG 2L15A 4C3HB 1A0IA 1EOVA 3HS0C 1YZ6A 1H9SB 2JYOA 5HGTA 2K5WA 4YHHL 4DAYA 4LFCL 4X3TA 4EX5A 2HT1A 5M5YH 2PW7A 1ET6A 1SFOB 4YCUA 1D5MC 3CAMA 5E4WC 3AYHB 2IHFA 4DK3C 3CPWA 1U0LA 3T1HL 4A3GG 3LX0A 1UE6A 5IT9c 3Q22A 3GTGB 3CMEA 2L4NA 3PIO3 2EYOA 1EWCA 2P5ZX 4AYBG 3S2DB 2PW5A 4K6DA 2AUJD 2JSOA 1D7QA 3OHXC 4IO9A 1SYEA 3W2DA 1KAWA 1KDBA 1N34Q 1KDAA 1SSOA 2N3SA 1B1ZA 4XT3B 2EJGC 3DM3A 1TU2B 3EIVA 1ILQA 4HJ9A 3S17H 3S15B 2IJ0A 3I4NH 1R4QB 1GUGA 1UE1A 2WAQG 4JI2L 4JBJA 4FF4A 1LO5D 3F8TA 4XQJA 2VQFL 2EYMA 2FINB 3A55A 2K5DA 4JV5L 1FGBD 2N49A 4A3IB 4JCVE 1X3FA 2NTSA 2XGTA 4LF6Q 2MQHA 3ITPA 3J7YW 1PH1A 2ZTEA 1QJOA 2JXMB 1DXMA 5KIXA 2D0PA 1YHQA 4YY3Q 4CDCC 4IJHA 4HIKA 3T13A 2F03A 1HZAA 1PYSB 3QR8A 4JYAQ 4X65L 2H1EA 4XXEA 3I7FA 1DZ1A 3BDOA 1L0XB 3PO2G 1AP0A 1GJXA 3HKZG 2LY7A 2RVLA 2B63B 4A3GB 2ZM6L 2LKVA 3M4QA 2XWBB 2EE1A 5M3FG 1V1QA 4LK1C 1X3GA 4JI6Q 1AEXA 2Y0SG 1PZKD 2WB1E 5IYCG 3VR6A 1XMOQ 2F4VL 4KJNA 3QWNA 4C3JH 2HQLA 3C46A 3P20A 2MO0A 1PH5A 3M9BA 2O5IC 4H13C 5GAHC 3TZUA 2WV6D 3BJUA 2R7DA 1B3QA 3O13A 5E3FA 2JA6G 4S3SA 1WTPA 1QNKA 2WAQB 4CKBA 4NW2A 1F9QA 4XQQA 5J1ZA 3K57A 3PIOA 1PA6A 1GUTA 2B2YA 3VR4A 2WKDA 2Z0SA 4X62Q 1B3AA 3T51B 4RH6A 5FJ8G 4WJ3M 5T1IA 1QZHA 2LS01 4LW1A 4JI3L 1VF5C 2EYPA 3GTOB 1HA6A 4OGQC 5FLXE 1NMGA 2F0PA 1KIXA 2ZJQA 2D9UA 3K7AB 2YTVA 4K5WA 1G6PA 3S24A 5IP9H 4OX9L 3STBD 2K05A 4ZUIA 4DA2A 1QB5D 3PO2B 3KLSA 5AJ3L 2NZ1D 4N8FA 1XPRA 2FMCA 1LTID 4LFCQ 3SEBA 3PF4A 4APVA 1UEBA 5LMNL 3VYRA 5M3FB 3QOJA 5CYUA 2A69C 5IY0A 1LTBD 3SXHA 1Y8NB 3A0JA 2QA4A 5C0XG 1N33Q 2PZUA 4A3BH 3ULLA 2A1AA 2Y0SB 1BQQT 1ILPA 2C35B 1WCMB 3HOXH 1OXTA 1L1OC 3OMGA 3T1HQ 2L11A 4DV4L 5JVH3 1EFWA 3S1RB 4ZRZA 4K14A 4LUZA 4ID6A 1WYDA 3QB3A 5CR3A 1JE5A 1V1OA 4IOCA 4FXDA 1YBYA 3GTJB 1GOZA 4IPDA 2EOTA 3AFPA 4O0AA 5I9OA 2D2CC 1SMYC 5CMDA 1W2BA 4RWSC 2QKIC 1A3UA 4GLVB 5M5XB 1U5KA 2OEOA 4KV6A 2JEAI 5C4HA 3P1HA 2A8VA 4QY7A 1XJVA 4DXGA 3L7ZC 1RCVD 3PUXA 1SYGA 5JPMC 3MXNA 4FNFA 4A3MB 4GZYC 2D0OA 1WTOA 2ALYB 5LL6S 1B7YB 3GTPB 3RLOA 4KY6A 1TY0A 1Y1WH 2K32A 3AB9A 3CQZH 4X65Q 5FLXc 1I4QA 2B2TC 1LABA 1L0WA 4AQYL 2YTXA 3S16B 2PNHA 1EY5A 1Z6HA 4DR2Q 1RD9D 2N8NA 4FDBA 4H02A 2E2JB 1G51A 5LHY1 1U9RA 1O7ZA 1Y8OB 3UDFA 1V1PA 5IIFA 1SYCA 3H3VH 1II3A 1JWUD 3I3CA 2F0KA 5KYIA 1H95A 1F2MA 3T4AC 1ZXTA 1Y1VH 1JICA 2XNAC 1BNZA 1X32A 4B3RL 1YHBA 2F4VQ
chains in the Genus database with same CATH topology
2QILA 5CC4A 1HXYD 1UAPA 1FNUA 2MP1A 3S2HB 2Z4IA 2E74C 2VB3X 2G9DA 4L63B 3OW7A 4OIJA 5K36H 1MSHA 1H9KA 1IW7D 4HCSA 1A6XA 2K03A 5CV5A 4U68A 1F9SA 2WINB 4LMQD 2KCNA 3ND8A 2B2UA 3HGBA 2NVXB 2MGSA 1PTOD 4MIUA 4NKLA 4ZAIA 3QJYA 3VR2A 2KHSA 3V96A 3J81E 1BUVT 4X3UA 4O1NA 1OXUA 3M4OB 1STBA 3DEPA 3GO5A 2SNMA 2EJFC 1S4ZA 1G91A 1TWFB 3C1EA 2PPBC 4BA2I 1C48A 4MN3A 1SNQA 3S9WA 3GV6A 2SNSA 4J6HA 1G291 2A6ED 1F2LA 4ZLTF 4QMGA 5IGBA 4Y7NB 2F0TA 2FHTA 1MGSA 2EY1A 1IKLA 2F0LA 1EY6A 1LT4D 3MAQA 3SR1A 3I8ZA 4CJ2C 1G6ZA 3TZDA 2C5CA 3GQBA 1MI2A 4OHJA 2PO4A 1TWAB 1OO9B 1B50A 1JWSD 3D31A 1HRJA 3NTHA 4CKEA 1LT6D 4C3IB 5A2QE 5C4XB 1JOOA 3OIQA 4K5XA 3G7LA 3J7AV 2B2WA 4ME5A 2TSSA 5KGUA 2NN6H 3FMCA 3K5MA 3VR3A 2EVBA 4WRDA 5CBEE 2RQXA 3TP5A 3GTQB 2BOSA 3V05A 4A3EB 1PXUA 2HCCA 5TSSA 4WJWA 1PTOF 4PV1C 1PZJD 4IFDG 2BDOA 3KUPA 4CHTB 1VDZA 1X3PA 1S5BD 4K8JA 4XT1B 1TWCB 1ESFA 1AZPA 3OWEB 3R2IA 5D3IB 2SEBD 3BDCA 1STYA 1EZ8A 3BZDB 1MSGA 1F77A 1LT3D 2B8GA 1I4HA 3J80E 4OO1H 1LTTD 4OL7A 2QCPX 1O7LA 3K5LA 4A3FB 1EU3A 4RCNA 2F0NA 2A6HC 4DU9A 5CBAE 1XYIA 5DM63 2CQAA 4A3JB 3QG1A 3DXJC 3NWTA 4L6TB 1LTAD 3L9AX 2QF7A 1SE3A 4F87A 4A93B 1PMRA 2RSOA 1FD7D 3E5SA 2L5TA 1XTCD 1KNEA 1AFPA 2TMPA 1HFNA 2ZXPA 1Z47A 3GTLB 2QEJC 5EJWA 1I6VC 1EY7A 1EZ6A 3MZ5A 3EJIA 4C3HG 3PV0A 5EBCA 2VUMB 1O80A 1FYCA 1CHPD 4B08A 4IUTA 1BCPB 1Q12A 1I50B 2EYHA 2F0GA 1C4QA 2PZTA 2NB0A 2RBMA 3I4MB 4ILWA 5BN4A 5JEAG 2CW0D 3ZYYX 4FXKC 3HZXA 1ZKOA 3A8JE 1HTPA 3BVGA 2QDBA 2BDNA 3IFTA 1GUNA 4K2LA 2EY2A 4UDUC 2JA8B 4TKOB 1IW7C 2N88A 4FF2A 3CU7A 3D4WA 1HUMA 1BXTA 1PLFA 2IWHA 5JVG3 2M00A 1PTOC 3TDQA 5IT9L 1PYWD 3M7NA 1IHZA 2E75C 1DONA 1KLGD 4DNTB 5EKKA 2NUCA 2IL8A 4C2MB 2V4DA 2F0DA 2JA5B 1DOKA 3IKJA 1UNSA 2A73B 5ELBA 4F7XA 4HAEA 2YYZA 3IL8A 2Z4HA 2O2LD 1NSNS 1V8QA 1AZQA 5I4DA 1WTWA 3MXPA 1J9OA 3G6JB 2A6EC 4BS9A 5NUCA 2X6LA 2RDFA 2K01A 1OXSC 4IALA 4IURA 1CZWA 1B53A 1TS2A 5EGTA 3PIP3 2DY7A 2C9OA 1STEA 3H0GB 4HMIA 1MD2D 1XWEA 3E6ZX 3KLRA 3OIPA 5JOBA 2ZXRA 2GA4B 3HOYB 1STGA 1TY2A 2R6GA 5IOCA 1PRTB 4U673 4DAPA 4IQZA 1GUWA 1GHJA 1BCPD 1ENAA 4XQNA 4ULLA 1TVXA 5G3LD 4EQNA 1F9PA 1JQYD 2MHVA 2DNCA 2E2DC 1JOKA 1QE6A 1V43A 3HOVB 2R7ZB 4EQPA 3RMHA 5C4ZA 3K5OA 1R9TB 1SEBD 2F0WA 2DNEA 3D4DA 2BE5D 2F0VA 5C0XH 4IZ8A 1AN8A 4HSPA 1HUNA 3W3AA 4LJZC 2J7ZA 2KA7A 3VA7A 3HOUB 3HG9A 5K5PA 4OIKA 4HSVA 3I72A 2R93B 1TWGB 3GP7A 4JBWA 5AFWA 1RTNA 2EYFA 2MUYA 3FEWX 4RCOA 1A3VA 4BA1I 5J39A 3PUWA 5IGDA 1JCKB 3P7JA 4UAIA 3V2TA 3P75A 1Q8IA 1UEAB 3JAME 4IFDJ 4IUNA 1EFID 3RLFA 3VYUA 4RGTA 3ONAB 4KI0A 3ND9A 1WTVA 5CORA 1PFMA 5IGGA 4CJ0B 4X3SA 3OPOA 3C3LA 3M4YA 1U4LA 1GXDC 2NVYB 5C44B 4PMBA 4QIWB 1M8AA 1SJED 3NWSA 3A7AB 4DAVA 3VR5A 1PTOB 1TS3A 2HDMA 3A54A 1I3QB 1U4MA 5JPNC 3FDTA 3HP3A 3NBIA 2ICIA 1BCPF 4YIJA 1C8CA 1PRTD 4QF4A 5G3LF 3KLSX 2PCFB 2NBFA 1Y69U 2F0IA 4DGZA 1H9RA 1BBXC 5FLXL 1WTRA 2CW0C 3RZOB 2SDFA 2A6HD 2M9VA 3R3OA 3S17B 3I4NB 5DEHA 1NAPA 1D1IA 2EZVA 4A3DB 2DY8A 4FO2A 1SBBB 3SK4A 4KHVA 3EVQA 4RHRA 4R9WA 3MHBA 5CGKA 3MXUA 1EY9A 1CQVA 1K8MA 2EJMA 5EQ0A 5HURA 1VCIA 5C4JB 1H9MA 2VXWA 1EWHA 3TBIB 2DN8A 2HCIA 1FNVA 3H6MA 3NE5B 4KMUC 3K5NA 2PMZB 3TP8A 1HCZA 3R8BA 3K58A 2XRSD 2XSCA 4KY5A 5CV4A 2VNUD 1D5XC 4ODGA 2IX0A 3SK5A 5FO7B 1F9RA 3PMFA 2K7VA 3HRZC 4KKTA 3S1MB 1B9MA 2F0EA 5F2DA 2RDHA 5I2XA 2IX3A 1PRTF 3M7GA 1HA5A 2AQ3B 3LWUA 1HPCA 1FNWA 2LFNA 1SNPA 4C3IG 3GD7A 3TP7A 4WORA 1ESRA 2F0QA 1BCPC 4MHEA 3MWYW 2L55A 3KF8A 5A35A 2IX1A 1KABA 1G2TA 4BBSB 2IW3A 3MFGA 4XTCS 3C2PA 3HOXB 1RJTA 1RKNA 3N6RA 3DHQA 1QOHA 4IFDH 2AWOA 2BE5C 1TS5A 3S1QB 4M8AA 1QCBD 3NHHA 5I2YA 1SXTA 4DN4M 5D3DA 3KK7A 4QB4A 2K5QA 3I70A 4K2KA 3J81L 1CI3M 4ZKBB 4TSSA 5I9PA 1YNJC 2JP1A 1B44D 1D2BA 3HEJA 3QOLA 1D6EC 1EOTA 1U4PA 2PQEA 3EROA 4M1UB 1I4GA 1IYVA 3SVMA 2MPMA 2K04A 1EIGA 1DYQA 1NUCA 3A8IE 1G2SA 4O42A 4DXFA 3Q23A 2SOBA 3SE0A 1WD1A 5CV8A 2Z1CA 1E2ZA 2BA0A 1I4RA 1QG7A 4PQXA 5ELCA 4PNYA 1SNOA 3D6WA 2KEDA 3VYSA 1BR9A 3T16A 4WFN3 2D62A 1EIHA 4CGYB 3Q6SA 1ENFA 2B2YC 3CRKC 4KKSA 4DF7A 1KTKA 4BBRB 1SAPA 1PRTC 5A2QL 2ENBA 2PZWA 5JEAH 1S5DD 2EYLA 2F3VA 4B9WA 4K5VA 5IGFA 4FXGC 1TQOA 2WB1B 5C0XJ 2AQ1B 5FKAC 5BN5A 3D6CA 1NR4A 2NWGA 2BA1A 3S1NB 1XXGA 2ICEC 3GTKB 3FRPB 1B2TA 2O5JC 1S5FD 5ELDA 3I90A 3QO2A 2EY6A 3K0YA 3BVMA 4ZKCB 1A15A 4EVOA 3AU7A 4EQOA 1D1KA 2L9HA 5C3EB 1CHQD 5C0XI 4G57A 3DEOA 3AMUA 1VF7A 3J80L 3EQLC 4C1NI 1W6KA 2R61A 4RA8A 1ENCA 1MBYA 4L8JA 5FO9B 3DUZA 4RGNA 1QNUA 3FVQA 4Z9CB 3UI2A 4CKCA 1STHA 3HOWB 4HR7B 1SNMA 5IGCA 4I7ZC 3DM1A 5D14A 5ELEA 5T1GA 5M9OA 3VYTA 1DM0B 3U9OA 2ID0A 3MVVA 2AWNA 4TQUS 4R8NA 5M5WB 3BVZA 2Q8IB 1R4PB 1HTLD 1HHVA 5FOBB 4E6IA 4BY7B 1SYDA 4J8QA 1T5XD 2F0UA 5IGEA 5FK9C 1EY0A 3EFXD 4RKLA 4NMZA 1EL0A 2HUGA 4ZYSA 1TT2A 5I6YA 2XVSA 1GUSA 4RAUC 2F0HA 3D4RA 4KN7C 3T56B 2B2VA 3X3NA 2IT1A 1D5ZC 2X6GA 1JE4A 4KK7A 1PTOH 4HTHA 4G7HC 3K6OA 4H7BA 3WOFA 2B2UC 3NSWA 1XX8A 2ZT9C 1WD0A 1GHKA 1JWMD 4XDXA 2B39A 3BS1A 1EEID 2FMMA 1SYBA 2I46A 2F0FA 2G9HD 1EYAA 2F0OA 3IFDA 2Q8TA 2J4XA 1OXVA 3KBGA 1Z7TA 2XN9C 4Q0FA 3PUZA 4RFBA 2YU9B 2EDGA 1DOLA 3R2TA 3FPUB 1LACA 1K8OA 4RGMA 3MTSA 5C3WA 3TP6A 1LTRD 3GTMB 5EBDA 5J22A 1RDPD 3PUVA 2CVRA 4B9XA 1H9SA 3MC0B 5FO8B 1CA5A 4HEDA 4DK0A 1PFNA 1ZEQX 2RA4A 2HQEA 1W6JA 2D5DA 2EXZA 1YNJD 3N52A 4AYBB 2AUKA 2A68C 1SNDA 2B2WC 1WVLA 1TR5A 4HCEA 5DAUA 4LAAA 4BWGB 2R3ZA 1HQMC 2B8FA 2AQ2B 2N55A 3ERQA 4A3KB 4FVMA 5EPJA 1HFGA 4R8IA 2A5HA 4QUFA 1Q90A 1BDOA 4PMWA 5BN3A 1HQRD 3VA5A 2FFKB 1I4PA 4G4KA 1ZYRC 4RKBA 4ABNA 2WP8J 1E0BA 5C3XA 1Q1BA 1CFMA 2K1BA 1SE4A 3DWPA 2Q8RE 1STNA 2JE6I 1SJHD 2EY5A 5JAVA 5E4XA 4IUUA 1V1PB 5M5YB 5C5LA 4KD4A 1I4XA 2M2LA 4IFDI 3MEHA 3NP8A 2L12A 3HKZB 3F2UA 3TMEA 1B9NA 4CBVA 3LNNA 1Q3LA 1NCVA 2XIWA 1ET9A 3IAYA 1B4OA 1PDQA 3CRLC 4KN4C 2PYKA 3NQTA 3JAML 1Q1EA 3WDNA 1KLUD 4C3JG 1WTQA 1EYDA 2E76C 4IN3A 1LLRD 2O4XA 5COYA 5ELFA 2JA6B 1VMPA 4KJOA 5KNBA 4FF1A 1RF2D 2VB2X 1DD2A 2WKCA 1CT1D 1EEFD 1LTGD 2NN6I 1RTOA 1I6HB 4V190 3R93A 3H3VC 4K8IA 5JEAJ 2RSNA 4N9TA 1UUPA 5EPKA 3D8GA 2EPBA 3NUCA 1A2UA 4NP5A 1ONLA 1ICWA 1LTSD 1J8IA 3D3RA 2OXPA 3OMCA 5EKIA 1G8ZD 2OT2A 4F88A 1WTXA 5EKLA 1A3TA 2LMCB 2I07B 3SK6A 4C3JB 5EPLA 3SK8A 4OO1I 1E2WA 3A8KE 2J0TD 1TKWB 1IKMA 1KAAA 5IODA 2A74C 1SNCA 1IL8A 4IUVA 4IUQA 1CQFA 5DNFA 1RHPA 3BDLA 3CHBD 3M3YB 4G7ZC 2HDLA 1TWHB 4ZUJA 1YNND 3U9SA 1L0YB 3I91A 3TN2A 3K59A 1RODA 1FR3A 1BO0A 1SE2A 4HMJA 4KD3A 2H4OA 3H94A 4NDXA 2JEBI 1NR2A 2KJXA 5CV6A 3TSSA 1M4VA 3NTIA 4V0BA 2BCOA 2B2VC 3DWAA 1S5CD 3BG3A 1JR0D 4A3BB 5ISRA 2NYZD 4J1MA 3RUZA 1F2YA 3MXGA 4HN7A 1JOQA 3M85A 2F1MA 3URYA 3EA6A 1CK1A 1BF4A 1OXXK 4KKUA 3Q0AA 1S5ED 1CM9A 1PFBA 1U4RA 3MA2B 4TRDA 2EYJA 1O7YA 1TIID 1EQVA 1PZID 2NVQB 4N9PA 1EYCA 3QIAA 4H0LC 3S14B 4Q5VA 4G7OC 1DOMA 4ZK9B 1EY8A 2F0MA 1O78A 3WOEA 5K36G 4I65A 4JK1C 2WIIB 2WACA 5KEEA 3FKIB 3NPPA 1Y1WB 2R92B 3CQZB 3OWFA 4XYOA 3H09A 4KTAA 1TS4A 2PNRC 5LL6X 5KNDA 2KCCA 2OF1A 4FF3A 1EY4A 5E1FA 1Y1VB 4BY1B 4P2CB 2RDGA 5KRUA 5I6WA 2KUMA 4XYQA 4ZQ3A 1A2TA 3NXWA 5M3MB 2KEEA 3T53B 3BYYB 2A68D 4DNRB 4X3KA 4H44C 3DMUA 2IPKD 1T5EA 4KY7A 3Q24A 3OSOA 1BOSA 2X69A 3H91A 4IUPA 3RD4A 3X3MA 4CJ1B 2F0SA 3BYTB 3SDZA 3GV3A 1QWYA 4DFAA 4C56C 2RKSA 4KHZA 5KNCA 4C1NK 1ZYRD 1F2ZA 2JA7B 3DWQA 4DK1A 3HOZB 1STAA 1SDFA 3FPPA 1IYUA 3PO3B 2E2IB 4QUCA 3C1FA 2NN6G 4RGOS 3NTKA 5C6AA 3A7LA 4FYDA 2KVMA 3E0JA 3PUYA 2MJ8A 3SHLA 1SYFA 3J7AF 1EQTA 1KNAA 2FJ2A 3L3OC 1GUOA 3A56A 2A69D 1DJRD 2CHBD 1JB3A 2K33A 2NVTB 3NBHA 1ML0D 5IT9E 2B2TA 3NQIA 2XWJB 2K6AA 4XIGS 1CA6A 4K6LA 3RZDB 1CZGA 1LV9A 1CTMA 5JJZA 1H9JA 1K83B 4OO1G 2KOLA 2KECA 1SMYD 2XRQD 2L1BA 1AW7A 4FP5D 1JORA 2F4IA 1EU4A 1YNNC 3CKIB 2KQ3A 5DM73 1Y8PB 1JC7A 2ZXOA 1QILA 5KYLA 5D65A 3LWEA 4RHSA 2E2HB 1KDCA 3OOCA 3KBXA 1LT5D 4F8MA 4PMCA 3I4LA 2NTTA 4QCLA 5CV7A 2K28A 3I73A 1E2VA 3NK9A 1DCZA 2Z8LA 1VMCA 2L0CA 1X3QA 2F3WA 4EGVA 5C5MA 5CV9A 3MFYA 2F0JA 4C3HB 3HS0C 1H9SB 2JYOA 5HGTA 2K5WA 4DAYA 4X3TA 2PW7A 1ET6A 1SFOB 1D5MC 5E4WC 3LX0A 3Q22A 3GTGB 2L4NA 3PIO3 2EYOA 1EWCA 3S2DB 2PW5A 4K6DA 2AUJD 2JSOA 3OHXC 1SYEA 3W2DA 1KDBA 1KDAA 1SSOA 1B1ZA 4XT3B 2EJGC 1TU2B 1ILQA 3S15B 2IJ0A 1R4QB 1GUGA 4FF4A 1LO5D 4XQJA 2EYMA 2FINB 3A55A 2K5DA 1FGBD 4A3IB 2NTSA 3ITPA 3J7YW 1QJOA 2JXMB 1DXMA 5KIXA 3T13A 2F03A 2H1EA 4XXEA 1DZ1A 3BDOA 1L0XB 1AP0A 1GJXA 2LY7A 2RVLA 2B63B 4A3GB 2LKVA 2XWBB 2EE1A 4LK1C 1AEXA 1PZKD 3VR6A 4KJNA 3QWNA 3C46A 3P20A 2O5IC 4H13C 3TZUA 2WV6D 3O13A 5E3FA 4S3SA 1WTPA 1QNKA 2WAQB 4CKBA 4NW2A 1F9QA 4XQQA 5J1ZA 3K57A 1GUTA 2B2YA 3VR4A 2WKDA 1B3AA 3T51B 4RH6A 5T1IA 2LS01 1VF5C 2EYPA 3GTOB 1HA6A 4OGQC 5FLXE 2F0PA 2D9UA 3K7AB 4K5WA 2K05A 4ZUIA 4DA2A 1QB5D 3PO2B 3KLSA 2NZ1D 2FMCA 1LTID 3SEBA 3VYRA 5M3FB 3QOJA 5CYUA 2A69C 1LTBD 3SXHA 1Y8NB 5C0XG 2PZUA 2Y0SB 1BQQT 1ILPA 1WCMB 1OXTA 3OMGA 2L11A 5JVH3 3S1RB 4ZRZA 4K14A 4ID6A 3QB3A 5CR3A 1V1OA 4FXDA 3GTJB 1GOZA 2EOTA 5I9OA 2D2CC 1SMYC 5CMDA 4RWSC 2QKIC 1A3UA 5M5XB 2OEOA 4KV6A 2JEAI 5C4HA 3P1HA 4DXGA 3L7ZC 1RCVD 3PUXA 1SYGA 5JPMC 3MXNA 4FNFA 4A3MB 4GZYC 1WTOA 5LL6S 3GTPB 4KY6A 1TY0A 2K32A 3AB9A 1I4QA 2B2TC 1LABA 3S16B 1EY5A 1Z6HA 1RD9D 2E2JB 5LHY1 1U9RA 1O7ZA 1Y8OB 1V1PA 5IIFA 1SYCA 1II3A 1JWUD 3I3CA 2F0KA 5KYIA 1F2MA 3T4AC 1ZXTA 1JICA 2XNAC 1BNZA 1X32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXP A;  5CC4 A;  2O4X A;  3SK4 A;  1TQO A;  4NDX A;  5IGD A;  4KHV A;  5CV6 A;  1EY0 A;  3V2T A;  4RKL A;  5KRU A;  4NMZ A;  3P75 A;  4B9X A;  4KJO A;  5I6W A;  5NUC A;  3EVQ A;  2RDF A;  4IUN A;  1TT2 A;  3NHH A;  4ZQ3 A;  2EYM A;  4IAL A;  1A2T A;  1JOO A;  5I6Y A;  3MHB A;  3QOJ A;  1EY7 A;  3NXW A;  4K5X A;  5EGT A;  1EZ6 A;  3SXH A;  5CGK A;  3MZ5 A;  2PZU A;  3D6C A;  4QB4 A;  4ME5 A;  1EY9 A;  3ITP A;  5IGG A;  5KGU A;  2HQE A;  3EJI A;  2F0H A;  3DMU A;  4K2K A;  5HUR A;  2EXZ A;  3OMG A;  4HMI A;  1JOR A;  5ISR A;  4KY7 A;  5KIX A;  4J1M A;  3RUZ A;  1F2Y A;  2KQ3 A;  3OSO A;  5JOB A;  1SND A;  4K8I A;  4WRD A;  5I9P A;  4K14 A;  1TR5 A;  4ID6 A;  5CV5 A;  5DAU A;  3TP5 A;  4LAA A;  2EYH A;  2F0G A;  2PZT A;  3QB3 A;  5CR3 A;  2F0S A;  4PMB A;  3ERQ A;  3T13 A;  1JOQ A;  1STG A;  2RBM A;  4N9T A;  5KYL A;  2EY6 A;  3D8G A;  3H6M A;  5IOC A;  3HEJ A;  3QOL A;  1KDC A;  4DFA A;  3TP8 A;  4MIU A;  3NUC A;  2RKS A;  4NKL A;  4EVO A;  2PQE A;  3ERO A;  4HTH A;  1A2U A;  4PMC A;  4EQO A;  4F8M A;  4KY5 A;  2KHS A;  3HZX A;  4NP5 A;  5CV4 A;  5I9O A;  4ODG A;  4TRD A;  3SK5 A;  2LKV A;  1F2Z A;  4H7B A;  5CV7 A;  2EYJ A;  1NUC A;  4G57 A;  2QDB A;  3NK9 A;  3VA5 A;  4K8J A;  1EQV A;  3PMF A;  1STB A;  4K2L A;  1A3U A;  2OXP A;  1ENA A;  2OEO A;  1AEX A;  1EYC A;  1STA A;  2EY2 A;  2SNM A;  4KV6 A;  3OMC A;  4RKB A;  2F3W A;  1ENC A;  4EQN A;  3P1H A;  5C4H A;  5C5M A;  5CV9 A;  3C1E A;  2F0J A;  5C3X A;  1EY8 A;  3BDC A;  2F0M A;  2SOB A;  3C1F A;  5CV8 A;  4YIJ A;  1STY A;  4KJN A;  4I65 A;  1EZ8 A;  2F0E A;  5EKL A;  1A3T A;  1JOK A;  2WAC A;  4QF4 A;  1SNQ A;  3SK6 A;  5HGT A;  5F2D A;  1STN A;  3D4W A;  5KEE A;  1SYG A;  1SYB A;  4EQP A;  3S9W A;  1STH A;  2SNS A;  3SK8 A;  5C4Z A;  2F0I A;  5C6A A;  5E3F A;  4DGZ A;  5IGC A;  1SNM A;  2PW7 A;  2F0F A;  2F0W A;  4S3S A;  2EY5 A;  4J6H A;  4OL7 A;  5JAV A;  1KAA A;  2M00 A;  1EYA A;  3D4D A;  1SNP A;  4KY6 A;  5IOD A;  5C5L A;  1SYF A;  4KD4 A;  2F0O A;  4PNY A;  3SHL A;  2F0V A;  1SNO A;  3TP7 A;  1SNC A;  5J1Z A;  4IZ8 A;  3MEH A;  4QMG A;  3NP8 A;  4WOR A;  2F0Q A;  3TME A;  1IHZ A;  5M9O A;  3LX0 A;  3R3O A;  4N9P A;  2F0N A;  3BDL A;  3U9O A;  1EY5 A;  3MVV A;  5IGB A;  3OWF A;  3T16 A;  4R8N A;  4DU9 A;  2EYO A;  5K5P A;  2F0T A;  5EKK A;  2NUC A;  4KTA A;  2EYP A;  2EY1 A;  2PW5 A;  4K6D A;  1U9R A;  5DEH A;  2F0D A;  4ZUJ A;  2F0L A;  1EY6 A;  2PYK A;  3NQT A;  1KAB A;  2F0P A;  4DF7 A;  5IIF A;  1SYC A;  4E6I A;  1II3 A;  1SYD A;  2EYF A;  1SYE A;  3SR1 A;  2F0K A;  5KYI A;  4K5W A;  2ENB A;  2PZW A;  1F2M A;  5C3W A;  1KDB A;  4F7X A;  2F0U A;  3TP6 A;  1KDA A;  2EYL A;  2F3V A;  1A3V A;  2OF1 A;  4B9W A;  1NSN S;  5IGE A;  5J22 A;  1EY4 A;  3E5S A;  4ZUI A;  1RKN A;  1EYD A;  4HMJ A;  4K5V A;  5IGF A;  5E1F A;  3DHQ A;  5J39 A;  4KD3 A; 
#chains in the Genus database with same CATH topology
 2QIL A;  4OXP A;  5CC4 A;  4L5Q A;  1HXY D;  1UAP A;  1FNU A;  4I7A A;  2Q2H A;  2MP1 A;  5M3M H;  3S2H B;  2Z4I A;  2E74 C;  2VB3 X;  2G9D A;  4L63 B;  4BBR H;  3OW7 A;  3CMA A;  3J80 i;  4OIJ A;  5K36 H;  1MSH A;  3M4P A;  1H9K A;  4YWM A;  3GDE A;  4LWC A;  1IW7 D;  4GOP C;  3ERS X;  4HCS A;  2PQA B;  4JI3 Q;  1A6X A;  2K03 A;  5CV5 A;  2LSS A;  4U68 A;  1F9S A;  2CH4 W;  2WIN B;  4CDF C;  4LMQ D;  4DUY L;  2KCN A;  3ND8 A;  2B2U A;  2N78 A;  3HGB A;  2NVX B;  1IBL L;  2MGS A;  1PTO D;  2LXJ A;  3FKI G;  2LXK A;  4MIU A;  4NKL A;  4ZAI A;  3QJY A;  1Y1W G;  4DR4 L;  3VR2 A;  2R92 G;  2JA7 H;  4OX9 Q;  2KHS A;  3V96 A;  3J81 E;  3TRE A;  1HNZ L;  1K0S A;  2DGY A;  3U4Z A;  1BUV T;  3S1N H;  4X3U A;  4O1N A;  3HOZ H;  1OXU A;  3M4O B;  1STB A;  3DEP A;  3PO3 H;  2E2I H;  5L37 A;  3GO5 A;  3E0E A;  4DNI A;  2SNM A;  2EJF C;  1S4Z A;  1G91 A;  3A74 A;  1TWF B;  3C1E A;  2PPB C;  4BA2 I;  1C48 A;  4MN3 A;  4LF7 Q;  1EQQ A;  1SNQ A;  4L5T A;  3S9W A;  3GV6 A;  2SNS A;  4BY1 G;  1CSP A;  4DV4 Q;  4J6H A;  4YCV A;  1YEZ A;  1G29 1;  2A6E D;  1F2L A;  1FJG L;  4AYB E;  4JI8 L;  2RCF A;  3BU2 A;  4JI1 L;  4LF5 L;  1A62 A;  4ZLT F;  1K73 C;  4QMG A;  3U50 C;  5LMN W;  4TVA B;  5IGB A;  4Y7N B;  1LYL A;  2UXD L;  2F0T A;  2FHT A;  1MGS A;  2EY1 A;  1IKL A;  2F0L A;  1YIJ A;  1EY6 A;  1LT4 D;  3MAQ A;  1L1O B;  3SR1 A;  3CCV A;  3I8Z A;  4CJ2 C;  1G6Z A;  3RZD H;  3TZD A;  2C5C A;  4DR6 L;  3GQB A;  1QZG A;  1K83 H;  2MNA A;  1MI2 A;  3D0F A;  4OHJ A;  2PO4 A;  5M5W H;  1TWA B;  3A5U A;  1OO9 B;  1Q46 A;  1B50 A;  1JWS D;  3D31 A;  1HRJ A;  3NTH A;  4CKE A;  1LT6 D;  4C3I B;  5A2Q E;  4LFB L;  5C4X B;  3OIQ A;  1JOO A;  4BY7 H;  1PV4 A;  4K5X A;  3G7L A;  1CKN B;  1B70 B;  3J7A V;  2B2W A;  4ME5 A;  2TSS A;  5KGU A;  2NN6 H;  3FMC A;  4DK6 C;  3AFQ A;  3K5M A;  4AQY Q;  4A3J G;  2ZTC A;  4A76 A;  3VR3 A;  3HKZ E;  1NBW A;  2EVB A;  3F2C A;  4JVZ A;  4WRD A;  1WTH A;  5CBE E;  2RQX A;  3UDX A;  3J81 c;  3TP5 A;  2UU9 L;  3GTQ B;  2BOS A;  4A93 G;  3V05 A;  3STB C;  2E2H H;  3UDI A;  4A3E B;  2ATW A;  1PXU A;  2R7F A;  2HCC A;  1SLJ A;  5TSS A;  1VQI A;  1QUQ B;  1VQE A;  4UP7 A;  4WJW A;  4B3R Q;  1PTO F;  4PV1 C;  3NBH B;  1PZJ D;  4IFD G;  1EWI A;  2BDO A;  3KUP A;  1S72 A;  5JJK A;  2K5V A;  4CHT B;  1VDZ A;  1X3P A;  1S5B D;  4K8J A;  4XT1 B;  1TWC B;  1ESF A;  1AZP A;  4LF9 L;  3OWE B;  3R2I A;  5D3I B;  2SEB D;  3BDC A;  4JI0 L;  3KDF B;  2A19 A;  1STY A;  3KJP A;  1EZ8 A;  3KYH C;  2Z6K C;  1K0R A;  3BZD B;  1MSG A;  4NXN L;  1IBK L;  2UUA L;  1F77 A;  1SFO H;  1LT3 D;  5H1S E;  2B8G A;  1I4H A;  2YTY A;  3J80 E;  3J7Z C;  4OO1 H;  1LTT D;  4OL7 A;  1K8A C;  2QCP X;  3I4M G;  4DR7 Q;  1O7L A;  3T1Y L;  3GTG H;  3K5L A;  4A3F B;  1EU3 A;  4RCN A;  3S2D H;  2F0N A;  4DV3 Q;  4AIM A;  2A6H C;  2VZA A;  4UPA A;  4DU9 A;  4DR4 Q;  5CBA E;  1XYI A;  4GN3 B;  5DM6 3;  1VQN A;  3UE0 A;  2CQA A;  2KCT A;  4A3J B;  4DV6 L;  3QG1 A;  3DXJ C;  2AHO B;  3NWT A;  4L6T B;  2JA8 G;  4B3T Q;  1LTA D;  3L9A X;  4R4I A;  2KCM A;  2QF7 A;  1SE3 A;  4F87 A;  4A93 B;  1PMR A;  3RN2 A;  1SE8 A;  4HID A;  2RSO A;  1FD7 D;  3E5S A;  4OEL B;  3W1B A;  2L5T A;  1XTC D;  1KNE A;  1AFP A;  1PYB A;  2TMP A;  3I56 A;  1HFN A;  3NEN A;  2ZXP A;  1Z47 A;  3GTL B;  2QEJ C;  5EJW A;  2CWP A;  1KD1 C;  1I6V C;  4BXX G;  1HNX L;  1EY7 A;  1EZ6 A;  2E8G A;  4A3L H;  1FJG Q;  3MZ5 A;  4JI8 Q;  4JI1 Q;  4LF5 Q;  4DAY B;  3GTM H;  4B3S L;  3VDY A;  3EJI A;  4C3H G;  3PV0 A;  5EBC A;  1GKH A;  2VUM B;  2OQK A;  1O80 A;  1FYC A;  1UE5 A;  2DUD A;  1EYG A;  1CHP D;  5HGQ A;  5IE8 A;  4B08 A;  1HZ9 A;  4IUT A;  1BCP B;  4GLA C;  1Q12 A;  1I50 B;  2EYH A;  2F0G A;  1C4Q A;  2PZT A;  1LTL A;  1XNQ Q;  2NB0 A;  2RBM A;  4O2D A;  1KRS A;  4JBK A;  1XPU A;  3I4M B;  4ILW A;  5BN4 A;  5JEA G;  4A3G H;  2CW0 D;  3ZYY X;  4FXK C;  3HZX A;  1ZKO A;  4DR6 Q;  3A8J E;  2I0Q A;  1HTP A;  3BVG A;  3OTO L;  2QDB A;  5J3B A;  2BDN A;  3IFT A;  1GUN A;  4K2L A;  1WFQ A;  4R4C A;  2EY2 A;  3J80 c;  4UDU C;  1VQ9 A;  1W3S A;  4LFB Q;  2JA8 B;  4TKO B;  4QQB X;  1IW7 C;  2N88 A;  3JAM i;  1XPO A;  4FF2 A;  3CU7 A;  3D4W A;  4OON A;  1HUM A;  1BXT A;  1PLF A;  2IWH A;  5JVG 3;  2M00 A;  2OQ0 A;  2MO1 A;  1PTO C;  3TDQ A;  2UU9 Q;  2K5H A;  4PG3 A;  5IT9 L;  4A3I G;  3Q8D A;  1PYW D;  3M7N A;  1IHZ A;  3GTO H;  2E75 C;  1DON A;  1KLG D;  4DNT B;  5EKK A;  2NUC A;  2IL8 A;  4C2M B;  2V4D A;  2F0D A;  2JA5 B;  1HH2 P;  3K7A H;  2KHJ A;  1DOK A;  3IKJ A;  1WOC A;  1PH6 A;  3HFZ B;  1UNS A;  2A73 B;  5ELB A;  4F7X A;  2ZJR A;  4HAE A;  2YYZ A;  3IL8 A;  2Z4H A;  3HOV G;  3PO2 H;  2O2L D;  2WFW A;  1NSN S;  4JI0 Q;  1V8Q A;  4HJ7 A;  1AZQ A;  5I4D A;  2B63 G;  1WTW A;  3MXP A;  5IYD H;  1J9O A;  1CKO A;  3G6J B;  4K0K Q;  2A6E C;  4NXN Q;  1IBK Q;  2K14 A;  4BS9 A;  5M3F H;  1I5F A;  5NUC A;  2X6L A;  2RDF A;  2K01 A;  1OXS C;  1VQJ A;  4IAL A;  1VQH A;  4P71 A;  1K3R A;  4IUR A;  1P16 A;  1CZW A;  1B53 A;  1TS2 A;  5EGT A;  5IYC H;  3PIP 3;  2DY7 A;  2C9O A;  1WJJ A;  1HNW L;  1STE A;  3G6E A;  1VS0 A;  3H0G B;  4HMI A;  3S1R H;  1MD2 D;  1S3O A;  1XWE A;  3E6Z X;  3KLR A;  3OIP A;  2R93 G;  5JOB A;  2ZXR A;  2GA4 B;  2JA6 H;  1J5E Q;  3HOY B;  2CWA A;  1STG A;  4DV6 Q;  3GTJ H;  1TY2 A;  1BBU A;  2R6G A;  5IOC A;  1PRT B;  5IP7 G;  4U67 3;  4DR1 L;  1I6H H;  5FJ8 H;  3JC6 6;  4DAP A;  4IQZ A;  1XNR L;  1GUW A;  1VQP A;  4A3C G;  1GHJ A;  5M5X H;  4EQ5 A;  2UXC L;  1BCP D;  1ENA A;  4XQN A;  4ULL A;  1TVX A;  5G3L D;  4EQN A;  4IJL A;  1F9P A;  1A63 A;  1JQY D;  4HIM A;  1HNX Q;  1PH9 A;  2MHV A;  2DNC A;  2E2D C;  1JOK A;  1QE6 A;  1E1O A;  1V43 A;  2ZTD A;  2VW9 A;  3HOV B;  2R7Z B;  4EQP A;  3RMH A;  5C4Z A;  3K5O A;  1R9T B;  3CCL A;  1SEB D;  1JT8 A;  2F0W A;  5BR8 L;  2DNE A;  4LFA Q;  5IYD G;  3D4D A;  2BE5 D;  1MKH A;  1SR3 A;  2K52 A;  4POG A;  2HIV A;  2F0V A;  5C0X H;  3S16 H;  4IZ8 A;  4WJ4 A;  2KBN A;  1AN8 A;  4HSP A;  1HUN A;  3AEV A;  3TQY A;  3W3A A;  4JOI C;  4LJZ C;  2J7Z A;  1WCM G;  2KA7 A;  2E2J H;  3VA7 A;  3HOU B;  3HG9 A;  5K5P A;  5GQO A;  3K0X A;  4DV2 L;  4OIK A;  1VQ4 A;  4HSV A;  2UXB L;  3I72 A;  2R93 B;  1TWG B;  3OTO Q;  3GP7 A;  4JBW A;  5AFW A;  1RTN A;  5GRO A;  2EYF A;  2MUY A;  3ICE A;  3FEW X;  4RCO A;  4UP9 A;  2FXQ A;  4GS3 A;  1A3V A;  2UUC L;  4BA1 I;  5J39 A;  4YCW A;  4DV5 L;  3PUW A;  3M3Y H;  1MIU A;  5IGD A;  1JCK B;  3P7J A;  4UAI A;  3V2T A;  3S2H H;  4LF8 L;  1TWH H;  1Q8I A;  3P75 A;  1UEA B;  3JAM E;  4IFD J;  4IUN A;  1EFI D;  3RLF A;  3VYU A;  3PIP A;  4RGT A;  3ONA B;  4KI0 A;  3ND9 A;  1WTV A;  1IL2 A;  2CFM A;  5COR A;  1PFM A;  5IGG A;  3MXN B;  1BVS A;  4CJ0 B;  1UWV A;  3J81 i;  1Z9F A;  4X3S A;  2E5L L;  3OPO A;  3C3L A;  3KJO A;  3M4Y A;  1MJE A;  3TS2 A;  1U4L A;  4A3M G;  1GXD C;  1T9H A;  2NVY B;  4KLK A;  5C44 B;  4PMB A;  4QIW B;  2NVX H;  1M8A A;  1SJE D;  2V1C C;  3NWS A;  4YHH Q;  4A3D G;  3A7A B;  4DAV A;  1YVC A;  3VR5 A;  1PTO B;  4R1J A;  1TS3 A;  2MFI A;  2HDM A;  3A54 A;  3PCO B;  1I3Q B;  1HZC A;  1U4M A;  4KHP L;  5JPN C;  1SN8 A;  3FDT A;  3HP3 A;  1TWF H;  3NBI A;  4JI5 L;  2ICI A;  4Y52 H;  1BCP F;  1JB7 A;  4JI7 L;  4YIJ A;  4JG2 A;  1C8C A;  1PRT D;  4QF4 A;  5G3L F;  3KLS X;  2PCF B;  2NBF A;  1Y69 U;  4AH6 A;  2F0I A;  4DGZ A;  3KLW A;  1H9R A;  3F1Z A;  3CF5 A;  3RNU A;  1BBX C;  5FLX L;  2NVQ H;  1WTR A;  2CW0 C;  3RZO B;  2SDF A;  3S14 H;  2A6H D;  2M9V A;  3NEM A;  1C0A A;  3LGJ A;  4JI2 Q;  3R3O A;  2VQF Q;  4DR1 Q;  3S17 B;  4JV5 Q;  3I4N B;  5FLM G;  1HR0 W;  3TEH B;  3PF5 A;  5IWA L;  5DEH A;  1NAP A;  2ASB A;  3CC2 A;  1UE7 A;  1D1I A;  1X3E A;  1M90 C;  2EZV A;  3JAM c;  1JJG A;  3FKI H;  4A3D B;  1TWA H;  1HZB A;  2R92 H;  2DY8 A;  4FO2 A;  1SBB B;  3SK4 A;  4KHV A;  3EVQ A;  4MTK A;  3G4S A;  1IBM L;  4RHR A;  5BR8 Q;  2F52 A;  3CCJ A;  4R9W A;  3MHB A;  5CGK A;  2ZM6 Q;  3MXU A;  1EY9 A;  1CQV A;  1K8M A;  2EJM A;  5EQ0 A;  4GNX A;  1SMX A;  5HUR A;  1VCI A;  5C4J B;  1H9M A;  2VXW A;  1EWH A;  4BY1 H;  3GTQ H;  4BBS G;  3TBI B;  3CCE A;  4DV2 Q;  2DN8 A;  3B6Y A;  2OTL A;  2HCI A;  1FNV A;  1VQM A;  3H6M A;  3NE5 B;  4KMU C;  3K5N A;  1ICF B;  2PMZ B;  3TP8 A;  1XMQ L;  1HCZ A;  3R8B A;  3K58 A;  2XRS D;  2XSC A;  4KY5 A;  5CV4 A;  2UUC Q;  2VNU D;  1D5X C;  4ODG A;  4DUZ L;  2IX0 A;  3SK5 A;  5FO7 B;  1F9R A;  3EBE A;  3PMF A;  2K7V A;  4LF8 Q;  4JW0 A;  1X65 A;  1CUK A;  1KHI A;  3HRZ C;  4KKT A;  3S1M B;  1K9M C;  1B9M A;  2F0E A;  5F2D A;  2RDH A;  5I2X A;  2B29 A;  1E24 A;  2IX3 A;  1PRT F;  2E5L Q;  3M7G A;  1HA5 A;  1EQR A;  2AQ3 B;  3CPF A;  3LWU A;  1HPC A;  1FNW A;  2LFN A;  1SNP A;  3E9I A;  2NZO A;  1PH4 A;  5AJ3 Q;  5C4X G;  3CP0 A;  4C3I G;  3GD7 A;  3TP7 A;  4WOR A;  1ESR A;  2F0Q A;  1VQ7 A;  2BH2 A;  5LMN Q;  1BCP C;  4MHE A;  4A3J H;  4OWW B;  3MWY W;  2L55 A;  4L5R C;  4DAM A;  3G48 A;  3KF8 A;  4KHP Q;  5A35 A;  2IX1 A;  1KAB A;  4A93 H;  5GAE C;  1QVF A;  4BBS B;  2IW3 A;  1G2T A;  3MFG A;  4A3E G;  4XTC S;  3C2P A;  3HOX B;  1NTG A;  1RJT A;  1RKN A;  3N6R A;  3DHQ A;  1QOH A;  3PSI A;  3GTL H;  2AWO A;  4IFD H;  2BE5 C;  1BBW A;  1TS5 A;  3S1Q B;  4M8A A;  3G71 A;  2NVT H;  1QCB D;  1IZ6 A;  3NHH A;  2CCZ A;  4HJ8 A;  3FP9 A;  5I2Y A;  1SXT A;  4DN4 M;  5D3D A;  1E3P A;  3KK7 A;  4QB4 A;  4NPS A;  2K5Q A;  3I70 A;  1P8L A;  2WAQ E;  4IPH A;  4K2K A;  3J81 L;  1CI3 M;  1I50 H;  4ZKB B;  4TSS A;  5I9P A;  3CCU A;  1YNJ C;  2JP1 A;  3NEL A;  3I4M H;  1B44 D;  5IWA Q;  1D2B A;  3HEJ A;  3QOL A;  1D6E C;  4A3F G;  1EOT A;  1U4P A;  2PQE A;  3ERO A;  2WB1 G;  4M1U B;  1I4G A;  3RLN A;  1IYV A;  3SVM A;  2MPM A;  2K04 A;  1EIG A;  3L2P A;  1DYQ A;  1NUC A;  2PQA A;  4DV1 L;  2RF4 A;  4GLX A;  2JA8 H;  3A8I E;  1G2S A;  4O42 A;  4DXF A;  1IBM Q;  3Q23 A;  2SOB A;  3SE0 A;  1WD1 A;  5CV8 A;  2Z1C A;  1E2Z A;  1PH2 A;  1X56 A;  2BA0 A;  1PH3 A;  1I4R A;  2Y0S E;  3IRB A;  1QG7 A;  4PQX A;  5ELC A;  3CCR A;  3KF6 A;  4BXX H;  4PNY A;  3OW2 A;  1SNO A;  3D6W A;  2RHS B;  5IYB G;  2KED A;  3VYS A;  4C3H H;  4GKJ L;  2VY3 A;  1BR9 A;  4OEM B;  4C2M H;  5C3E G;  2VUM G;  1XMQ Q;  1QVC A;  3T16 A;  2D62 A;  4WFN 3;  2JA5 H;  1EIH A;  1Q86 C;  4CGY B;  3Q6S A;  1ENF A;  2B2Y C;  3BZC A;  4DUZ Q;  4ZCK A;  3BZK A;  3CRK C;  4KKS A;  1YIT A;  4DF7 A;  1KTK A;  2OTJ A;  4BBR B;  1SAP A;  1PRT C;  5A2Q L;  2ENB A;  2PZW A;  1K28 A;  3I55 A;  4DV0 L;  5JEA H;  1S5D D;  2EYL A;  2F3V A;  1ASY A;  4B9W A;  1S40 A;  2B3G A;  4K5V A;  5IGF A;  3HOW G;  4FXG C;  2RCN A;  1YJ9 A;  4DUY Q;  1TQO A;  2WB1 B;  5C0X J;  2HD3 A;  1IBL Q;  1NE3 A;  2AQ1 B;  4PZ6 A;  1KRT A;  1L1O A;  1HNZ Q;  5FKA C;  1VQ8 A;  5BN5 A;  3H0G H;  3D6C A;  3SGI A;  1X54 A;  2I5M X;  1NR4 A;  2NWG A;  2BA1 A;  3S1N B;  1XXG A;  2ICE C;  3S15 H;  4UY8 C;  1N34 L;  3GTK B;  3FRP B;  3CCS A;  1B2T A;  2O5J C;  1D8L A;  1S5F D;  4OWT B;  5ELD A;  3I90 A;  3QO2 A;  2EY6 A;  4A3I H;  3K0Y A;  4DV7 L;  3BVM A;  4ZKC B;  1A15 A;  2KEN A;  2QGQ A;  3AU7 A;  4EVO A;  4EQO A;  1AH9 A;  1D1K A;  2L9H A;  5C3E B;  1CHQ D;  5C0X I;  4G57 A;  3DEO A;  2ES2 A;  1VF7 A;  3J80 L;  3AMU A;  1VQ5 A;  3EQL C;  4C1N I;  4CDD C;  2JA5 G;  1W6K A;  1OTC A;  2R61 A;  2UXD Q;  1E7Z A;  4RA8 A;  1ENC A;  1MBY A;  4L8J A;  4JC0 A;  3WWV A;  4L5S A;  3HOV H;  5FO9 B;  2R7Z H;  3DUZ A;  4RGN A;  4LUO A;  3PQI A;  1QNU A;  2Z6B A;  2H5X A;  3FVQ A;  4Z9C B;  2B63 H;  3UI2 A;  4CKC A;  1STH A;  2F3I A;  3HOW B;  4HR7 B;  1SNM A;  5IGC A;  4I7Z C;  2K5N A;  3DM1 A;  4PZ7 A;  5D14 A;  5ELE A;  5T1G A;  5M9O A;  3VYT A;  1DM0 B;  3U9O A;  2ID0 A;  3MVV A;  2AWN A;  4TQU S;  3H0G G;  4R8N A;  5M5W B;  3BVZ A;  2Q8I B;  2R93 H;  1R4P B;  1TWG H;  2QEX A;  1XMO L;  2K4K A;  1HTL D;  1C9O A;  1HHV A;  5FOB B;  4E6I A;  3HOY G;  4BY7 B;  1SYD A;  4DV1 Q;  1VQB A;  4GKK L;  4J8Q A;  1X55 A;  4NB3 A;  1T5X D;  2F0U A;  5IP7 H;  1VQG A;  5IGE A;  4GNX C;  2Q2U A;  5FK9 C;  1EY0 A;  1VQA A;  3EFX D;  4RKL A;  4A3C H;  4NMZ A;  1EL0 A;  1FL0 A;  1N36 L;  2HUG A;  4ZYS A;  4X62 L;  1TT2 A;  5I6Y A;  1KQS A;  2XVS A;  1GUS A;  4GOP A;  4OWX B;  4RAU C;  2F0H A;  3D4R A;  4KN7 C;  3T56 B;  4LF9 Q;  4A4I A;  2R7Z G;  5C44 H;  1Q8K A;  2B2V A;  1ASZ A;  3X3N A;  2IT1 A;  2IY5 B;  1D5Z C;  3A5Z B;  2UUA Q;  2X6G A;  1JE4 A;  4KK7 A;  2OWO A;  1PTO H;  1WCM H;  4HTH A;  1I3Q H;  1VQC A;  4DV0 Q;  4G7H C;  4JBM A;  2UUB L;  3HOU G;  3K6O A;  1HR0 L;  1N33 L;  3T1Y Q;  4H7B A;  3WOF A;  2B2U C;  3NSW A;  1XX8 A;  4MZ9 A;  2ZT9 C;  5ELO A;  2QW7 A;  1WD0 A;  2K50 A;  1VQL A;  1GHK A;  1JWM D;  4XDX A;  2B39 A;  3W5O A;  3BS1 A;  1EEI D;  2FMM A;  1SYB A;  3U58 A;  2I46 A;  2F0F A;  4A3K G;  3RZO H;  2G9H D;  1EYA A;  3J81 j;  2F0O A;  3IFD A;  4J15 A;  2Q8T A;  2J4X A;  4DV7 Q;  2EIF A;  1OXV A;  3KBG A;  1Z7T A;  2XN9 C;  2GN5 A;  4Q0F A;  3PUZ A;  4RFB A;  4A3M H;  2YU9 B;  4B3S Q;  1XTD A;  2EDG A;  3H3V I;  1DOL A;  3R2T A;  3FPU B;  3GTP H;  1LAC A;  5C44 G;  1K8O A;  2OCE A;  3ULJ A;  4JPB W;  3MTS A;  4RGM A;  4MNO A;  3CXC A;  4A3D H;  5C3W A;  3TP6 A;  1LTR D;  3GTM B;  5EBD A;  5J22 A;  1RDP D;  1MJC A;  2AKW B;  3CC4 A;  5HY6 A;  3PUV A;  1RIP A;  2CVR A;  4X66 L;  1H9S A;  4B9X A;  3TS0 A;  1GVP A;  3MC0 B;  5FO8 B;  1CA5 A;  4HED A;  5DLQ E;  1LM0 A;  4DK0 A;  4DR2 L;  1PFN A;  1ZEQ X;  2RA4 A;  5C4J H;  2HQE A;  3K8A A;  1W6J A;  2D5D A;  2EXZ A;  1YNJ D;  3N52 A;  4AYB B;  1J6Q A;  2AUK A;  2A68 C;  1SND A;  2B2W C;  1WVL A;  1AE3 A;  1TR5 A;  3ULP A;  4HCE A;  5DAU A;  4LAA A;  1NY4 A;  2EXD A;  1HQM C;  2B8F A;  2AQ2 B;  2N55 A;  2R3Z A;  3ERQ A;  1EUJ A;  4BWG B;  4A3K B;  4FVM A;  5EPJ A;  4GKK Q;  1PVO A;  1HFG A;  4DR3 L;  1X9N A;  4R8I A;  2AMC B;  2A5H A;  4QUF A;  1Q90 A;  1BDO A;  4PMW A;  5FLM H;  3CC7 A;  1SRU A;  5BN3 A;  3I4N G;  1HQR D;  3CW2 C;  2FFK B;  3VA5 A;  1NNX A;  1I4P A;  1CKM A;  5JJI A;  2Z6K A;  4G4K A;  1N36 Q;  1ZYR C;  4RKB A;  3F2D A;  3S1M H;  3E3X A;  4ABN A;  2WP8 J;  1E0B A;  5C3X A;  4ALP A;  1Q1B A;  4PZ8 A;  1CFM A;  2BH8 A;  2K1B A;  1SE4 A;  3DWP A;  2Q8R E;  1STN A;  2JE6 I;  1SJH D;  2CQO A;  1M1K C;  2EY5 A;  4X64 L;  5JAV A;  4B3M L;  5E4X A;  4IUU A;  1V1P B;  3M4O H;  5M5Y B;  4UHV A;  5C5L A;  4KD4 A;  4GNX B;  2ZJP A;  1I4X A;  2M2L A;  4IFD I;  2K75 A;  3MEH A;  3NP8 A;  2L12 A;  2GVB A;  3HKZ B;  3F2U A;  3TME A;  1B9N A;  4CBV A;  3LNN A;  1Q3L A;  1NCV A;  1JJ2 A;  1E22 A;  2XIW A;  1ET9 A;  3IAY A;  2UUB Q;  4BBS H;  1HNW Q;  4LF7 L;  1B4O A;  1HR0 Q;  1PDQ A;  3CRL C;  4KN4 C;  2PYK A;  3NQT A;  3JAM L;  1Q1E A;  1FGU A;  3WDN A;  2JN4 A;  4P72 A;  1KLU D;  4C3J G;  1WTQ A;  1EYD A;  2E76 C;  4IN3 A;  3S1Q H;  1LLR D;  4Y7N H;  2O4X A;  3AQQ A;  1KL9 A;  4DR5 L;  5COY A;  5ELF A;  2JA6 B;  1VMP A;  4KJO A;  5KNB A;  4FF1 A;  1RF2 D;  2VB2 X;  1DD2 A;  2WKC A;  1XNR Q;  1CT1 D;  1EEF D;  1LTG D;  2NN6 I;  1RTO A;  1I6H B;  2UXC Q;  1WI5 A;  1YHA A;  4V19 0;  1N9W A;  3KFU A;  3R93 A;  3H3V C;  1KXL A;  4K8I A;  5JEA J;  4LF4 L;  4UP8 A;  2RSN A;  4N9T A;  5C4X H;  4C3I H;  1UUP A;  5GAG C;  1E1T A;  1L2F A;  3D8G A;  5EPK A;  2EPB A;  5IP9 G;  1YI2 A;  3NUC A;  1A2U A;  4HJA A;  4NP5 A;  3KF8 B;  5E7N A;  1ONL A;  1ICW A;  1LTS D;  4IPC A;  1J8I A;  1Q81 C;  3D3R A;  4X66 Q;  2OXP A;  1PHJ A;  3OMC A;  5EKI A;  4LUV A;  4A3E H;  1MHW C;  4A3B G;  1G8Z D;  2OT2 A;  2UXB Q;  1LUZ A;  4F88 A;  1WTX A;  5EKL A;  1A3T A;  2LMC B;  3HOX G;  3K7U C;  2VQE L;  2I07 B;  2KHI A;  3SK6 A;  4X6A H;  1NJI C;  4C3J B;  5EPL A;  3SK8 A;  4OO1 I;  1E2W A;  3A8K E;  2J0T D;  1TKW B;  1IKM A;  1KAA A;  4DV5 Q;  1EIY B;  1TWC H;  5IOD A;  2A74 C;  4RMF A;  1SNC A;  4HJ5 A;  1IL8 A;  4IUV A;  4IUQ A;  1CQF A;  5DNF A;  1RHP A;  4DR3 Q;  3BDL A;  3CHB D;  3M3Y B;  4G7Z C;  2HDL A;  1TWH B;  4NXM L;  4ZUJ A;  1YNN D;  3U9S A;  1L0Y B;  3I91 A;  3TN2 A;  3K59 A;  1VQK A;  1O7I A;  1ROD A;  1FR3 A;  1K8G A;  1VQD A;  1BO0 A;  4A3F H;  1SE2 A;  2XTI A;  4HMJ A;  4DR7 L;  4KD3 A;  2H4O A;  3MEF A;  3H94 A;  4NDX A;  2JEB I;  1NR2 A;  2KJX A;  5CV6 A;  3TSS A;  1M4V A;  2YV5 A;  3NTI A;  4V0B A;  2BCO A;  2B2V C;  4DV3 L;  1HJP A;  4X64 Q;  3DWA A;  1GM5 A;  1JMC A;  1SRO A;  4B3M Q;  1S5C D;  1TXY A;  3BG3 A;  1JR0 D;  4A3B B;  4GN5 A;  5ISR A;  3GTK H;  1N8R C;  4B3T L;  2NYZ D;  4J1M A;  3KF6 B;  4JI5 Q;  3RUZ A;  1F2Y A;  3MXG A;  4JI7 Q;  3F2B A;  4YWL A;  3I2Z A;  4HN7 A;  4DPG A;  1JOQ A;  1GD7 A;  2G5D A;  5LMU L;  3M85 A;  2F1M A;  3URY A;  3EA6 A;  1CK1 A;  2DJF C;  5IYB H;  1BF4 A;  1IXR A;  1Y1V G;  1OXX K;  4KKU A;  3Q0A A;  1S5E D;  5C3E H;  2VUM H;  1JJC B;  1CM9 A;  1PFB A;  1U4R A;  4QGU A;  3MA2 B;  4TRD A;  1YNX A;  2EYJ A;  1O7Y A;  1TII D;  4DR5 Q;  1EQV A;  5M3M G;  1PZI D;  2NVQ B;  1VQ6 A;  4N9P A;  1EYC A;  1B8A A;  3QIA A;  4H0L C;  3S14 B;  4Q5V A;  4BBR G;  3CCM A;  4G7O C;  4HIO A;  1DOM A;  4ZK9 B;  1EY8 A;  2F0M A;  5JJL A;  1O78 A;  3WOE A;  2HHH L;  5K36 G;  4I65 A;  4JK1 C;  2WII B;  2WAC A;  2JA9 A;  3HOW H;  1XNQ L;  5KEE A;  1V9P A;  2JJQ A;  3OYY A;  4JOI A;  4JI4 L;  4LF4 Q;  1GO3 E;  3RR5 A;  3H15 A;  3FKI B;  3NPP A;  1Y1W B;  4QJF A;  4R4Q A;  3TRZ A;  2R92 B;  3CQZ B;  4QIW E;  4QL5 A;  2JA7 G;  3OWF A;  1PH7 A;  4XYO A;  3H09 A;  4KTA A;  4P75 A;  3U4V A;  1TS4 A;  2PNR C;  3HOZ G;  4DKA C;  5LL6 X;  1X6O A;  3PO3 G;  3E9H A;  1I94 L;  5KND A;  3PGZ A;  4POF A;  2KCC A;  4CDE C;  3CCQ A;  2OF1 A;  4FF3 A;  1EY4 A;  1FVI A;  5E1F A;  3HKS A;  1Y1V B;  4BY1 B;  2VQE Q;  4P2C B;  1A8V A;  2RDG A;  5KRU A;  1N32 L;  1Q82 C;  1YJW A;  5I6W A;  2KUM A;  4XYQ A;  3CD6 A;  2PI2 A;  4ZQ3 A;  1RL2 A;  1K3B C;  3L0O A;  1A2T A;  2VS1 A;  3NXW A;  5M3M B;  2KEE A;  3T53 B;  3BYY B;  2A68 D;  4DNR B;  4X3K A;  4H44 C;  1Y14 B;  3RN5 A;  3DLL A;  3DMU A;  2IPK D;  1T5E A;  4KY7 A;  1BKB A;  3Q24 A;  5GAD C;  3OSO A;  1BOS A;  2X69 A;  4RG1 A;  3H91 A;  4IUP A;  3RD4 A;  3X3M A;  1AE2 A;  4CJ1 B;  4NXM Q;  2F0S A;  5EAY A;  5ELN A;  3BYT B;  4K0K L;  3SDZ A;  3GV3 A;  1QWY A;  4GN4 B;  3UDG A;  4DFA A;  4C56 C;  1VQO A;  4R4T A;  2RKS A;  2QDL A;  4KHZ A;  5KNC A;  4C1N K;  1ZYR D;  1F2Z A;  2JA7 B;  2Q2I A;  1EIF A;  2NZH A;  3K81 C;  4ME3 A;  3DWQ A;  4DK1 A;  3HOY H;  2JQO A;  3HOZ B;  1STA A;  1SDF A;  4BY7 G;  3FPP A;  1IYU A;  3PO3 B;  4R4O A;  2E2I B;  4QUC A;  3C1F A;  2NN6 G;  2Z9H A;  1J5E L;  2GVA A;  1CKN A;  2Q2T A;  2IHE A;  4RGO S;  3NTK A;  5C6A A;  1C7Y A;  3A7L A;  4FYD A;  2KVM A;  3E0J A;  4GOP B;  3PUY A;  1KC8 C;  2MJ8 A;  3SHL A;  1SYF A;  3W1G A;  4LF6 L;  1EQT A;  3J7A F;  5LMU Q;  4IPG A;  1KNA A;  2FJ2 A;  3L3O C;  2RHQ B;  1GUO A;  3A56 A;  2I5H A;  2A69 D;  1DJR D;  2CH4 A;  2CHB D;  1JB3 A;  4YY3 L;  2YU9 H;  2VL6 A;  2K33 A;  2HIX A;  1R9T H;  2PMZ E;  1QUQ A;  2NVT B;  3FHW A;  4JYA L;  3NBH A;  1ML0 D;  5IT9 E;  2B2T A;  4A75 A;  3NQI A;  2XWJ B;  1DGS A;  4LFA L;  2K6A A;  1Q7Y C;  2HHH Q;  4XIG S;  1CA6 A;  4K6L A;  3RZD B;  3HOU H;  1IYJ B;  1CZG A;  1LV9 A;  3KDF A;  1PH8 A;  1CTM A;  5JJZ A;  1H9J A;  1K83 B;  3J7A 5;  2CKZ B;  4JI6 L;  4OO1 G;  2KOL A;  2KEC A;  2I5L X;  1SMY D;  2XRQ D;  2L1B A;  2EQS A;  1AW7 A;  3EN2 A;  4JI4 Q;  1CSQ A;  2DJG C;  4FP5 D;  1JOR A;  2F4I A;  1EU4 A;  3ZJY C;  1YNN C;  3CKI B;  2KQ3 A;  5DM7 3;  1VQF A;  1Y8P B;  3ER0 A;  1PFS A;  1JC7 A;  4A3K H;  2ZXO A;  3KOJ A;  2JK8 A;  1QIL A;  1YJN A;  5KYL A;  5D65 A;  3LWE A;  1I94 Q;  4RHS A;  2E2H B;  1KDC A;  3OOC A;  3KBX A;  1QVG A;  1LT5 D;  2PI2 E;  3K80 C;  4MTN A;  4P73 A;  4F8M A;  4PMC A;  3I4O A;  3I4L A;  4IOA A;  4LNQ A;  2NTT A;  4QCL A;  4P74 A;  5CV7 A;  2K28 A;  3I73 A;  1E2V A;  3NK9 A;  1N32 Q;  1DCZ A;  4YWK A;  4GKJ Q;  2Z8L A;  1NMF A;  1VMC A;  2NVY H;  2L0C A;  1X3Q A;  2F3W A;  4EGV A;  4N8X 1;  5CV9 A;  3MFY A;  2F0J A;  5C5M A;  3UE1 A;  4A3L G;  2L15 A;  4C3H B;  1A0I A;  1EOV A;  3HS0 C;  1YZ6 A;  1H9S B;  2JYO A;  5HGT A;  2K5W A;  4YHH L;  4DAY A;  4LFC L;  4X3T A;  4EX5 A;  2HT1 A;  5M5Y H;  2PW7 A;  1ET6 A;  1SFO B;  4YCU A;  1D5M C;  3CAM A;  5E4W C;  3AYH B;  2IHF A;  4DK3 C;  3CPW A;  1U0L A;  3T1H L;  4A3G G;  3LX0 A;  1UE6 A;  5IT9 c;  3Q22 A;  3GTG B;  3CME A;  2L4N A;  3PIO 3;  2EYO A;  1EWC A;  2P5Z X;  4AYB G;  3S2D B;  2PW5 A;  4K6D A;  2AUJ D;  2JSO A;  1D7Q A;  3OHX C;  4IO9 A;  1SYE A;  3W2D A;  1KAW A;  1KDB A;  1N34 Q;  1KDA A;  1SSO A;  2N3S A;  1B1Z A;  4XT3 B;  2EJG C;  3DM3 A;  1TU2 B;  3EIV A;  1ILQ A;  4HJ9 A;  3S17 H;  3S15 B;  2IJ0 A;  3I4N H;  1R4Q B;  1GUG A;  1UE1 A;  2WAQ G;  4JI2 L;  4JBJ A;  4FF4 A;  1LO5 D;  3F8T A;  4XQJ A;  2VQF L;  2EYM A;  2FIN B;  3A55 A;  2K5D A;  4JV5 L;  1FGB D;  2N49 A;  4A3I B;  4JCV E;  1X3F A;  2NTS A;  2XGT A;  4LF6 Q;  2MQH A;  3ITP A;  3J7Y W;  1PH1 A;  2ZTE A;  1QJO A;  2JXM B;  1DXM A;  5KIX A;  2D0P A;  1YHQ A;  4YY3 Q;  4CDC C;  4IJH A;  4HIK A;  3T13 A;  2F03 A;  1HZA A;  1PYS B;  3QR8 A;  4JYA Q;  4X65 L;  2H1E A;  4XXE A;  3I7F A;  1DZ1 A;  3BDO A;  1L0X B;  3PO2 G;  1AP0 A;  1GJX A;  3HKZ G;  2LY7 A;  2RVL A;  2B63 B;  4A3G B;  2ZM6 L;  2LKV A;  3M4Q A;  2XWB B;  2EE1 A;  5M3F G;  1V1Q A;  4LK1 C;  1X3G A;  4JI6 Q;  1AEX A;  2Y0S G;  1PZK D;  2WB1 E;  5IYC G;  3VR6 A;  1XMO Q;  2F4V L;  4KJN A;  3QWN A;  4C3J H;  2HQL A;  3C46 A;  3P20 A;  2MO0 A;  1PH5 A;  3M9B A;  2O5I C;  4H13 C;  5GAH C;  3TZU A;  2WV6 D;  3BJU A;  2R7D A;  1B3Q A;  3O13 A;  5E3F A;  2JA6 G;  4S3S A;  1WTP A;  1QNK A;  2WAQ B;  4CKB A;  4NW2 A;  1F9Q A;  4XQQ A;  5J1Z A;  3K57 A;  3PIO A;  1PA6 A;  1GUT A;  2B2Y A;  3VR4 A;  2WKD A;  2Z0S A;  4X62 Q;  1B3A A;  3T51 B;  4RH6 A;  5FJ8 G;  4WJ3 M;  5T1I A;  1QZH A;  2LS0 1;  4LW1 A;  4JI3 L;  1VF5 C;  2EYP A;  3GTO B;  1HA6 A;  4OGQ C;  5FLX E;  1NMG A;  2F0P A;  1KIX A;  2ZJQ A;  2D9U A;  3K7A B;  2YTV A;  4K5W A;  1G6P A;  3S24 A;  5IP9 H;  4OX9 L;  3STB D;  2K05 A;  4ZUI A;  4DA2 A;  1QB5 D;  3PO2 B;  3KLS A;  5AJ3 L;  2NZ1 D;  4N8F A;  1XPR A;  2FMC A;  1LTI D;  4LFC Q;  3SEB A;  3PF4 A;  4APV A;  1UEB A;  5LMN L;  3VYR A;  5M3F B;  3QOJ A;  5CYU A;  2A69 C;  5IY0 A;  1LTB D;  3SXH A;  1Y8N B;  3A0J A;  2QA4 A;  5C0X G;  1N33 Q;  2PZU A;  4A3B H;  3ULL A;  2A1A A;  2Y0S B;  1BQQ T;  1ILP A;  2C35 B;  1WCM B;  3HOX H;  1OXT A;  1L1O C;  3OMG A;  3T1H Q;  2L11 A;  4DV4 L;  5JVH 3;  1EFW A;  3S1R B;  4ZRZ A;  4K14 A;  4LUZ A;  4ID6 A;  1WYD A;  3QB3 A;  5CR3 A;  1JE5 A;  1V1O A;  4IOC A;  4FXD A;  1YBY A;  3GTJ B;  1GOZ A;  4IPD A;  2EOT A;  3AFP A;  4O0A A;  5I9O A;  2D2C C;  1SMY C;  5CMD A;  1W2B A;  4RWS C;  2QKI C;  1A3U A;  4GLV B;  5M5X B;  1U5K A;  2OEO A;  4KV6 A;  2JEA I;  5C4H A;  3P1H A;  2A8V A;  4QY7 A;  1XJV A;  4DXG A;  3L7Z C;  1RCV D;  3PUX A;  1SYG A;  5JPM C;  3MXN A;  4FNF A;  4A3M B;  4GZY C;  2D0O A;  1WTO A;  2ALY B;  5LL6 S;  1B7Y B;  3GTP B;  3RLO A;  4KY6 A;  1TY0 A;  1Y1W H;  2K32 A;  3AB9 A;  3CQZ H;  4X65 Q;  5FLX c;  1I4Q A;  2B2T C;  1LAB A;  1L0W A;  4AQY L;  2YTX A;  3S16 B;  2PNH A;  1EY5 A;  1Z6H A;  4DR2 Q;  1RD9 D;  2N8N A;  4FDB A;  4H02 A;  2E2J B;  1G51 A;  5LHY 1;  1U9R A;  1O7Z A;  1Y8O B;  3UDF A;  1V1P A;  5IIF A;  1SYC A;  3H3V H;  1II3 A;  1JWU D;  3I3C A;  2F0K A;  5KYI A;  1H95 A;  1F2M A;  3T4A C;  1ZXT A;  1Y1V H;  1JIC A;  2XNA C;  1BNZ A;  1X32 A;  4B3R L;  1YHB A;  2F4V Q; 
#chains in the Genus database with same CATH homology
 2QIL A;  5CC4 A;  1HXY D;  1UAP A;  1FNU A;  2MP1 A;  3S2H B;  2Z4I A;  2E74 C;  2VB3 X;  2G9D A;  4L63 B;  3OW7 A;  4OIJ A;  5K36 H;  1MSH A;  1H9K A;  1IW7 D;  4HCS A;  1A6X A;  2K03 A;  5CV5 A;  4U68 A;  1F9S A;  2WIN B;  4LMQ D;  2KCN A;  3ND8 A;  2B2U A;  3HGB A;  2NVX B;  2MGS A;  1PTO D;  4MIU A;  4NKL A;  4ZAI A;  3QJY A;  3VR2 A;  2KHS A;  3V96 A;  3J81 E;  1BUV T;  4X3U A;  4O1N A;  1OXU A;  3M4O B;  1STB A;  3DEP A;  3GO5 A;  2SNM A;  2EJF C;  1S4Z A;  1G91 A;  1TWF B;  3C1E A;  2PPB C;  4BA2 I;  1C48 A;  4MN3 A;  1SNQ A;  3S9W A;  3GV6 A;  2SNS A;  4J6H A;  1G29 1;  2A6E D;  1F2L A;  4ZLT F;  4QMG A;  5IGB A;  4Y7N B;  2F0T A;  2FHT A;  1MGS A;  2EY1 A;  1IKL A;  2F0L A;  1EY6 A;  1LT4 D;  3MAQ A;  3SR1 A;  3I8Z A;  4CJ2 C;  1G6Z A;  3TZD A;  2C5C A;  3GQB A;  1MI2 A;  4OHJ A;  2PO4 A;  1TWA B;  1OO9 B;  1B50 A;  1JWS D;  3D31 A;  1HRJ A;  3NTH A;  4CKE A;  1LT6 D;  4C3I B;  5A2Q E;  5C4X B;  1JOO A;  3OIQ A;  4K5X A;  3G7L A;  3J7A V;  2B2W A;  4ME5 A;  2TSS A;  5KGU A;  2NN6 H;  3FMC A;  3K5M A;  3VR3 A;  2EVB A;  4WRD A;  5CBE E;  2RQX A;  3TP5 A;  3GTQ B;  2BOS A;  3V05 A;  4A3E B;  1PXU A;  2HCC A;  5TSS A;  4WJW A;  1PTO F;  4PV1 C;  1PZJ D;  4IFD G;  2BDO A;  3KUP A;  4CHT B;  1VDZ A;  1X3P A;  1S5B D;  4K8J A;  4XT1 B;  1TWC B;  1ESF A;  1AZP A;  3OWE B;  3R2I A;  5D3I B;  2SEB D;  3BDC A;  1STY A;  1EZ8 A;  3BZD B;  1MSG A;  1F77 A;  1LT3 D;  2B8G A;  1I4H A;  3J80 E;  4OO1 H;  1LTT D;  4OL7 A;  2QCP X;  1O7L A;  3K5L A;  4A3F B;  1EU3 A;  4RCN A;  2F0N A;  2A6H C;  4DU9 A;  5CBA E;  1XYI A;  5DM6 3;  2CQA A;  4A3J B;  3QG1 A;  3DXJ C;  3NWT A;  4L6T B;  1LTA D;  3L9A X;  2QF7 A;  1SE3 A;  4F87 A;  4A93 B;  1PMR A;  2RSO A;  1FD7 D;  3E5S A;  2L5T A;  1XTC D;  1KNE A;  1AFP A;  2TMP A;  1HFN A;  2ZXP A;  1Z47 A;  3GTL B;  2QEJ C;  5EJW A;  1I6V C;  1EY7 A;  1EZ6 A;  3MZ5 A;  3EJI A;  4C3H G;  3PV0 A;  5EBC A;  2VUM B;  1O80 A;  1FYC A;  1CHP D;  4B08 A;  4IUT A;  1BCP B;  1Q12 A;  1I50 B;  2EYH A;  2F0G A;  1C4Q A;  2PZT A;  2NB0 A;  2RBM A;  3I4M B;  4ILW A;  5BN4 A;  5JEA G;  2CW0 D;  3ZYY X;  4FXK C;  3HZX A;  1ZKO A;  3A8J E;  1HTP A;  3BVG A;  2QDB A;  2BDN A;  3IFT A;  1GUN A;  4K2L A;  2EY2 A;  4UDU C;  2JA8 B;  4TKO B;  1IW7 C;  2N88 A;  4FF2 A;  3CU7 A;  3D4W A;  1HUM A;  1BXT A;  1PLF A;  2IWH A;  5JVG 3;  2M00 A;  1PTO C;  3TDQ A;  5IT9 L;  1PYW D;  3M7N A;  1IHZ A;  2E75 C;  1DON A;  1KLG D;  4DNT B;  5EKK A;  2NUC A;  2IL8 A;  4C2M B;  2V4D A;  2F0D A;  2JA5 B;  1DOK A;  3IKJ A;  1UNS A;  2A73 B;  5ELB A;  4F7X A;  4HAE A;  2YYZ A;  3IL8 A;  2Z4H A;  2O2L D;  1NSN S;  1V8Q A;  1AZQ A;  5I4D A;  1WTW A;  3MXP A;  1J9O A;  3G6J B;  2A6E C;  4BS9 A;  5NUC A;  2X6L A;  2RDF A;  2K01 A;  1OXS C;  4IAL A;  4IUR A;  1CZW A;  1B53 A;  1TS2 A;  5EGT A;  3PIP 3;  2DY7 A;  2C9O A;  1STE A;  3H0G B;  4HMI A;  1MD2 D;  1XWE A;  3E6Z X;  3KLR A;  3OIP A;  5JOB A;  2ZXR A;  2GA4 B;  3HOY B;  1STG A;  1TY2 A;  2R6G A;  5IOC A;  1PRT B;  4U67 3;  4DAP A;  4IQZ A;  1GUW A;  1GHJ A;  1BCP D;  1ENA A;  4XQN A;  4ULL A;  1TVX A;  5G3L D;  4EQN A;  1F9P A;  1JQY D;  2MHV A;  2DNC A;  2E2D C;  1JOK A;  1QE6 A;  1V43 A;  3HOV B;  2R7Z B;  4EQP A;  3RMH A;  5C4Z A;  3K5O A;  1R9T B;  1SEB D;  2F0W A;  2DNE A;  3D4D A;  2BE5 D;  2F0V A;  5C0X H;  4IZ8 A;  1AN8 A;  4HSP A;  1HUN A;  3W3A A;  4LJZ C;  2J7Z A;  2KA7 A;  3VA7 A;  3HOU B;  3HG9 A;  5K5P A;  4OIK A;  4HSV A;  3I72 A;  2R93 B;  1TWG B;  3GP7 A;  4JBW A;  5AFW A;  1RTN A;  2EYF A;  2MUY A;  3FEW X;  4RCO A;  1A3V A;  4BA1 I;  5J39 A;  3PUW A;  5IGD A;  1JCK B;  3P7J A;  4UAI A;  3V2T A;  3P75 A;  1Q8I A;  1UEA B;  3JAM E;  4IFD J;  4IUN A;  1EFI D;  3RLF A;  3VYU A;  4RGT A;  3ONA B;  4KI0 A;  3ND9 A;  1WTV A;  5COR A;  1PFM A;  5IGG A;  4CJ0 B;  4X3S A;  3OPO A;  3C3L A;  3M4Y A;  1U4L A;  1GXD C;  2NVY B;  5C44 B;  4PMB A;  4QIW B;  1M8A A;  1SJE D;  3NWS A;  3A7A B;  4DAV A;  3VR5 A;  1PTO B;  1TS3 A;  2HDM A;  3A54 A;  1I3Q B;  1U4M A;  5JPN C;  3FDT A;  3HP3 A;  3NBI A;  2ICI A;  1BCP F;  4YIJ A;  1C8C A;  1PRT D;  4QF4 A;  5G3L F;  3KLS X;  2PCF B;  2NBF A;  1Y69 U;  2F0I A;  4DGZ A;  1H9R A;  1BBX C;  5FLX L;  1WTR A;  2CW0 C;  3RZO B;  2SDF A;  2A6H D;  2M9V A;  3R3O A;  3S17 B;  3I4N B;  5DEH A;  1NAP A;  1D1I A;  2EZV A;  4A3D B;  2DY8 A;  4FO2 A;  1SBB B;  3SK4 A;  4KHV A;  3EVQ A;  4RHR A;  4R9W A;  3MHB A;  5CGK A;  3MXU A;  1EY9 A;  1CQV A;  1K8M A;  2EJM A;  5EQ0 A;  5HUR A;  1VCI A;  5C4J B;  1H9M A;  2VXW A;  1EWH A;  3TBI B;  2DN8 A;  2HCI A;  1FNV A;  3H6M A;  3NE5 B;  4KMU C;  3K5N A;  2PMZ B;  3TP8 A;  1HCZ A;  3R8B A;  3K58 A;  2XRS D;  2XSC A;  4KY5 A;  5CV4 A;  2VNU D;  1D5X C;  4ODG A;  2IX0 A;  3SK5 A;  5FO7 B;  1F9R A;  3PMF A;  2K7V A;  3HRZ C;  4KKT A;  3S1M B;  1B9M A;  2F0E A;  5F2D A;  2RDH A;  5I2X A;  2IX3 A;  1PRT F;  3M7G A;  1HA5 A;  2AQ3 B;  3LWU A;  1HPC A;  1FNW A;  2LFN A;  1SNP A;  4C3I G;  3GD7 A;  3TP7 A;  4WOR A;  1ESR A;  2F0Q A;  1BCP C;  4MHE A;  3MWY W;  2L55 A;  3KF8 A;  5A35 A;  2IX1 A;  1KAB A;  1G2T A;  4BBS B;  2IW3 A;  3MFG A;  4XTC S;  3C2P A;  3HOX B;  1RJT A;  1RKN A;  3N6R A;  3DHQ A;  1QOH A;  4IFD H;  2AWO A;  2BE5 C;  1TS5 A;  3S1Q B;  4M8A A;  1QCB D;  3NHH A;  5I2Y A;  1SXT A;  4DN4 M;  5D3D A;  3KK7 A;  4QB4 A;  2K5Q A;  3I70 A;  4K2K A;  3J81 L;  1CI3 M;  4ZKB B;  4TSS A;  5I9P A;  1YNJ C;  2JP1 A;  1B44 D;  1D2B A;  3HEJ A;  3QOL A;  1D6E C;  1EOT A;  1U4P A;  2PQE A;  3ERO A;  4M1U B;  1I4G A;  1IYV A;  3SVM A;  2MPM A;  2K04 A;  1EIG A;  1DYQ A;  1NUC A;  3A8I E;  1G2S A;  4O42 A;  4DXF A;  3Q23 A;  2SOB A;  3SE0 A;  1WD1 A;  5CV8 A;  2Z1C A;  1E2Z A;  2BA0 A;  1I4R A;  1QG7 A;  4PQX A;  5ELC A;  4PNY A;  1SNO A;  3D6W A;  2KED A;  3VYS A;  1BR9 A;  3T16 A;  4WFN 3;  2D62 A;  1EIH A;  4CGY B;  3Q6S A;  1ENF A;  2B2Y C;  3CRK C;  4KKS A;  4DF7 A;  1KTK A;  4BBR B;  1SAP A;  1PRT C;  5A2Q L;  2ENB A;  2PZW A;  5JEA H;  1S5D D;  2EYL A;  2F3V A;  4B9W A;  4K5V A;  5IGF A;  4FXG C;  1TQO A;  2WB1 B;  5C0X J;  2AQ1 B;  5FKA C;  5BN5 A;  3D6C A;  1NR4 A;  2NWG A;  2BA1 A;  3S1N B;  1XXG A;  2ICE C;  3GTK B;  3FRP B;  1B2T A;  2O5J C;  1S5F D;  5ELD A;  3I90 A;  3QO2 A;  2EY6 A;  3K0Y A;  3BVM A;  4ZKC B;  1A15 A;  4EVO A;  3AU7 A;  4EQO A;  1D1K A;  2L9H A;  5C3E B;  1CHQ D;  5C0X I;  4G57 A;  3DEO A;  3AMU A;  1VF7 A;  3J80 L;  3EQL C;  4C1N I;  1W6K A;  2R61 A;  4RA8 A;  1ENC A;  1MBY A;  4L8J A;  5FO9 B;  3DUZ A;  4RGN A;  1QNU A;  3FVQ A;  4Z9C B;  3UI2 A;  4CKC A;  1STH A;  3HOW B;  4HR7 B;  1SNM A;  5IGC A;  4I7Z C;  3DM1 A;  5D14 A;  5ELE A;  5T1G A;  5M9O A;  3VYT A;  1DM0 B;  3U9O A;  2ID0 A;  3MVV A;  2AWN A;  4TQU S;  4R8N A;  5M5W B;  3BVZ A;  2Q8I B;  1R4P B;  1HTL D;  1HHV A;  5FOB B;  4E6I A;  4BY7 B;  1SYD A;  4J8Q A;  1T5X D;  2F0U A;  5IGE A;  5FK9 C;  1EY0 A;  3EFX D;  4RKL A;  4NMZ A;  1EL0 A;  2HUG A;  4ZYS A;  1TT2 A;  5I6Y A;  2XVS A;  1GUS A;  4RAU C;  2F0H A;  3D4R A;  4KN7 C;  3T56 B;  2B2V A;  3X3N A;  2IT1 A;  1D5Z C;  2X6G A;  1JE4 A;  4KK7 A;  1PTO H;  4HTH A;  4G7H C;  3K6O A;  4H7B A;  3WOF A;  2B2U C;  3NSW A;  1XX8 A;  2ZT9 C;  1WD0 A;  1GHK A;  1JWM D;  4XDX A;  2B39 A;  3BS1 A;  1EEI D;  2FMM A;  1SYB A;  2I46 A;  2F0F A;  2G9H D;  1EYA A;  2F0O A;  3IFD A;  2Q8T A;  2J4X A;  1OXV A;  3KBG A;  1Z7T A;  2XN9 C;  4Q0F A;  3PUZ A;  4RFB A;  2YU9 B;  2EDG A;  1DOL A;  3R2T A;  3FPU B;  1LAC A;  1K8O A;  4RGM A;  3MTS A;  5C3W A;  3TP6 A;  1LTR D;  3GTM B;  5EBD A;  5J22 A;  1RDP D;  3PUV A;  2CVR A;  4B9X A;  1H9S A;  3MC0 B;  5FO8 B;  1CA5 A;  4HED A;  4DK0 A;  1PFN A;  1ZEQ X;  2RA4 A;  2HQE A;  1W6J A;  2D5D A;  2EXZ A;  1YNJ D;  3N52 A;  4AYB B;  2AUK A;  2A68 C;  1SND A;  2B2W C;  1WVL A;  1TR5 A;  4HCE A;  5DAU A;  4LAA A;  4BWG B;  2R3Z A;  1HQM C;  2B8F A;  2AQ2 B;  2N55 A;  3ERQ A;  4A3K B;  4FVM A;  5EPJ A;  1HFG A;  4R8I A;  2A5H A;  4QUF A;  1Q90 A;  1BDO A;  4PMW A;  5BN3 A;  1HQR D;  3VA5 A;  2FFK B;  1I4P A;  4G4K A;  1ZYR C;  4RKB A;  4ABN A;  2WP8 J;  1E0B A;  5C3X A;  1Q1B A;  1CFM A;  2K1B A;  1SE4 A;  3DWP A;  2Q8R E;  1STN A;  2JE6 I;  1SJH D;  2EY5 A;  5JAV A;  5E4X A;  4IUU A;  1V1P B;  5M5Y B;  5C5L A;  4KD4 A;  1I4X A;  2M2L A;  4IFD I;  3MEH A;  3NP8 A;  2L12 A;  3HKZ B;  3F2U A;  3TME A;  1B9N A;  4CBV A;  3LNN A;  1Q3L A;  1NCV A;  2XIW A;  1ET9 A;  3IAY A;  1B4O A;  1PDQ A;  3CRL C;  4KN4 C;  2PYK A;  3NQT A;  3JAM L;  1Q1E A;  3WDN A;  1KLU D;  4C3J G;  1WTQ A;  1EYD A;  2E76 C;  4IN3 A;  1LLR D;  2O4X A;  5COY A;  5ELF A;  2JA6 B;  1VMP A;  4KJO A;  5KNB A;  4FF1 A;  1RF2 D;  2VB2 X;  1DD2 A;  2WKC A;  1CT1 D;  1EEF D;  1LTG D;  2NN6 I;  1RTO A;  1I6H B;  4V19 0;  3R93 A;  3H3V C;  4K8I A;  5JEA J;  2RSN A;  4N9T A;  1UUP A;  5EPK A;  3D8G A;  2EPB A;  3NUC A;  1A2U A;  4NP5 A;  1ONL A;  1ICW A;  1LTS D;  1J8I A;  3D3R A;  2OXP A;  3OMC A;  5EKI A;  1G8Z D;  2OT2 A;  4F88 A;  1WTX A;  5EKL A;  1A3T A;  2LMC B;  2I07 B;  3SK6 A;  4C3J B;  5EPL A;  3SK8 A;  4OO1 I;  1E2W A;  3A8K E;  2J0T D;  1TKW B;  1IKM A;  1KAA A;  5IOD A;  2A74 C;  1SNC A;  1IL8 A;  4IUV A;  4IUQ A;  1CQF A;  5DNF A;  1RHP A;  3BDL A;  3CHB D;  3M3Y B;  4G7Z C;  2HDL A;  1TWH B;  4ZUJ A;  1YNN D;  3U9S A;  1L0Y B;  3I91 A;  3TN2 A;  3K59 A;  1ROD A;  1FR3 A;  1BO0 A;  1SE2 A;  4HMJ A;  4KD3 A;  2H4O A;  3H94 A;  4NDX A;  2JEB I;  1NR2 A;  2KJX A;  5CV6 A;  3TSS A;  1M4V A;  3NTI A;  4V0B A;  2BCO A;  2B2V C;  3DWA A;  1S5C D;  3BG3 A;  1JR0 D;  4A3B B;  5ISR A;  2NYZ D;  4J1M A;  3RUZ A;  1F2Y A;  3MXG A;  4HN7 A;  1JOQ A;  3M85 A;  2F1M A;  3URY A;  3EA6 A;  1CK1 A;  1BF4 A;  1OXX K;  4KKU A;  3Q0A A;  1S5E D;  1CM9 A;  1PFB A;  1U4R A;  3MA2 B;  4TRD A;  2EYJ A;  1O7Y A;  1TII D;  1EQV A;  1PZI D;  2NVQ B;  4N9P A;  1EYC A;  3QIA A;  4H0L C;  3S14 B;  4Q5V A;  4G7O C;  1DOM A;  4ZK9 B;  1EY8 A;  2F0M A;  1O78 A;  3WOE A;  5K36 G;  4I65 A;  4JK1 C;  2WII B;  2WAC A;  5KEE A;  3FKI B;  3NPP A;  1Y1W B;  2R92 B;  3CQZ B;  3OWF A;  4XYO A;  3H09 A;  4KTA A;  1TS4 A;  2PNR C;  5LL6 X;  5KND A;  2KCC A;  2OF1 A;  4FF3 A;  1EY4 A;  5E1F A;  1Y1V B;  4BY1 B;  4P2C B;  2RDG A;  5KRU A;  5I6W A;  2KUM A;  4XYQ A;  4ZQ3 A;  1A2T A;  3NXW A;  5M3M B;  2KEE A;  3T53 B;  3BYY B;  2A68 D;  4DNR B;  4X3K A;  4H44 C;  3DMU A;  2IPK D;  1T5E A;  4KY7 A;  3Q24 A;  3OSO A;  1BOS A;  2X69 A;  3H91 A;  4IUP A;  3RD4 A;  3X3M A;  4CJ1 B;  2F0S A;  3BYT B;  3SDZ A;  3GV3 A;  1QWY A;  4DFA A;  4C56 C;  2RKS A;  4KHZ A;  5KNC A;  4C1N K;  1ZYR D;  1F2Z A;  2JA7 B;  3DWQ A;  4DK1 A;  3HOZ B;  1STA A;  1SDF A;  3FPP A;  1IYU A;  3PO3 B;  2E2I B;  4QUC A;  3C1F A;  2NN6 G;  4RGO S;  3NTK A;  5C6A A;  3A7L A;  4FYD A;  2KVM A;  3E0J A;  3PUY A;  2MJ8 A;  3SHL A;  1SYF A;  3J7A F;  1EQT A;  1KNA A;  2FJ2 A;  3L3O C;  1GUO A;  3A56 A;  2A69 D;  1DJR D;  2CHB D;  1JB3 A;  2K33 A;  2NVT B;  3NBH A;  1ML0 D;  5IT9 E;  2B2T A;  3NQI A;  2XWJ B;  2K6A A;  4XIG S;  1CA6 A;  4K6L A;  3RZD B;  1CZG A;  1LV9 A;  1CTM A;  5JJZ A;  1H9J A;  1K83 B;  4OO1 G;  2KOL A;  2KEC A;  1SMY D;  2XRQ D;  2L1B A;  1AW7 A;  4FP5 D;  1JOR A;  2F4I A;  1EU4 A;  1YNN C;  3CKI B;  2KQ3 A;  5DM7 3;  1Y8P B;  1JC7 A;  2ZXO A;  1QIL A;  5KYL A;  5D65 A;  3LWE A;  4RHS A;  2E2H B;  1KDC A;  3OOC A;  3KBX A;  1LT5 D;  4F8M A;  4PMC A;  3I4L A;  2NTT A;  4QCL A;  5CV7 A;  2K28 A;  3I73 A;  1E2V A;  3NK9 A;  1DCZ A;  2Z8L A;  1VMC A;  2L0C A;  1X3Q A;  2F3W A;  4EGV A;  5C5M A;  5CV9 A;  3MFY A;  2F0J A;  4C3H B;  3HS0 C;  1H9S B;  2JYO A;  5HGT A;  2K5W A;  4DAY A;  4X3T A;  2PW7 A;  1ET6 A;  1SFO B;  1D5M C;  5E4W C;  3LX0 A;  3Q22 A;  3GTG B;  2L4N A;  3PIO 3;  2EYO A;  1EWC A;  3S2D B;  2PW5 A;  4K6D A;  2AUJ D;  2JSO A;  3OHX C;  1SYE A;  3W2D A;  1KDB A;  1KDA A;  1SSO A;  1B1Z A;  4XT3 B;  2EJG C;  1TU2 B;  1ILQ A;  3S15 B;  2IJ0 A;  1R4Q B;  1GUG A;  4FF4 A;  1LO5 D;  4XQJ A;  2EYM A;  2FIN B;  3A55 A;  2K5D A;  1FGB D;  4A3I B;  2NTS A;  3ITP A;  3J7Y W;  1QJO A;  2JXM B;  1DXM A;  5KIX A;  3T13 A;  2F03 A;  2H1E A;  4XXE A;  1DZ1 A;  3BDO A;  1L0X B;  1AP0 A;  1GJX A;  2LY7 A;  2RVL A;  2B63 B;  4A3G B;  2LKV A;  2XWB B;  2EE1 A;  4LK1 C;  1AEX A;  1PZK D;  3VR6 A;  4KJN A;  3QWN A;  3C46 A;  3P20 A;  2O5I C;  4H13 C;  3TZU A;  2WV6 D;  3O13 A;  5E3F A;  4S3S A;  1WTP A;  1QNK A;  2WAQ B;  4CKB A;  4NW2 A;  1F9Q A;  4XQQ A;  5J1Z A;  3K57 A;  1GUT A;  2B2Y A;  3VR4 A;  2WKD A;  1B3A A;  3T51 B;  4RH6 A;  5T1I A;  2LS0 1;  1VF5 C;  2EYP A;  3GTO B;  1HA6 A;  4OGQ C;  5FLX E;  2F0P A;  2D9U A;  3K7A B;  4K5W A;  2K05 A;  4ZUI A;  4DA2 A;  1QB5 D;  3PO2 B;  3KLS A;  2NZ1 D;  2FMC A;  1LTI D;  3SEB A;  3VYR A;  5M3F B;  3QOJ A;  5CYU A;  2A69 C;  1LTB D;  3SXH A;  1Y8N B;  5C0X G;  2PZU A;  2Y0S B;  1BQQ T;  1ILP A;  1WCM B;  1OXT A;  3OMG A;  2L11 A;  5JVH 3;  3S1R B;  4ZRZ A;  4K14 A;  4ID6 A;  3QB3 A;  5CR3 A;  1V1O A;  4FXD A;  3GTJ B;  1GOZ A;  2EOT A;  5I9O A;  2D2C C;  1SMY C;  5CMD A;  4RWS C;  2QKI C;  1A3U A;  5M5X B;  2OEO A;  4KV6 A;  2JEA I;  5C4H A;  3P1H A;  4DXG A;  3L7Z C;  1RCV D;  3PUX A;  1SYG A;  5JPM C;  3MXN A;  4FNF A;  4A3M B;  4GZY C;  1WTO A;  5LL6 S;  3GTP B;  4KY6 A;  1TY0 A;  2K32 A;  3AB9 A;  1I4Q A;  2B2T C;  1LAB A;  3S16 B;  1EY5 A;  1Z6H A;  1RD9 D;  2E2J B;  5LHY 1;  1U9R A;  1O7Z A;  1Y8O B;  1V1P A;  5IIF A;  1SYC A;  1II3 A;  1JWU D;  3I3C A;  2F0K A;  5KYI A;  1F2M A;  3T4A C;  1ZXT A;  1JIC A;  2XNA C;  1BNZ A;  1X32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...