1I50H

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i50H00
2V1CC 3S2HH 3CPWA 4OWTB 1KRTA 4LFAL 1MIUA 1X3FA 5GAGC 3L7ZC 3HOZG 3CQZH 2B29A 2I5LX 2JA7H 3D0FA 4JBJA 5AJ3L 1IBMQ 1O7IA 1EWIA 1NBWA 1IBKQ 1SROA 1FVIA 2R7FA 2CFMA 2R93G 4R4CA 3J81j 5M3FH 4PZ7A 4EQ5A 4JI4L 2L15A 3CCUA 4NXNL 4LF9L 2HHHL 3HOVH 2YTVA 4B3MQ 3T1YQ 4KLKA 1SMXA 2IX0A 3W1GA 4DK3C 4DR3Q 2JA5G 3CC4A 4TQUS 4OWXB 1K73C 2OCEA 1N34Q 1Z47A 4YCVA 3S1RH 1EIFA 4A3JG 3OTOQ 4X6AH 1B8AA 1N34L 5IYDG 3E0EA 3RLNA 2ZTDA 5H1SE 1KAWA 3I56A 2IX1A 3KDFA 2Y0SG 1YJNA 4LFCQ 3HOYG 4GOPA 1VQKA 3HOUG 1D8LA 4BBRH 4DV7L 3GTGH 2PQAA 1XPOA 2UUCL 1ASYA 3I7FA 1FJGL 4JG2A 2D62A 2K14A 4JI2Q 4A3MG 3GTPH 2K50A 4OXPA 3M85A 1QUQA 2VQFL 1PH7A 3I55A 1JT8A 4LUVA 1VQBA 2MQHA 1L0WA 3W1BA 3PIPA 1YHBA 2KENA 4DV0Q 4A3MH 3J80i 1GO3E 1G51A 3ICEA 1B7YB 5GADC 4GNXB 2B63G 4JYAQ 3PUWA 4WJ3M 2CQOA 1KXLA 1C0AA 4LF9Q 2I5HA 4JCVE 2VQEQ 2UXDL 1JB7A 3K8AA 1PH4A 3J80c 3CF5A 4JV5Q 3CW2C 3LGJA 3A5UA 1PH2A 4HIKA 4DR6L 1H95A 1E1OA 1IXRA 1UE5A 1WOCA 1GD7A 1JE5A 2VL6A 1PV4A 4LF6L 4YWLA 2JE6I 1A0IA 1PHJA 1L1OA 4A3IH 3U4ZA 3K7UC 1K0RA 3BZKA 2UUAQ 4JI7L 4GN4B 1V1QA 2JK8A 1J5EQ 2RF4A 4DR4L 4RG1A 1M90C 1P16A 5C4XG 4J15A 1AE3A 1UE6A 1TWHH 2OTJA 1EUJA 5C44H 3RZDH 2E2IH 2BH2A 3H15A 1A62A 2WAQE 5C4JH 3HOUH 3A0JA 4NPSA 1HNWQ 1VQFA 4LF7Q 2Y0SE 3H3VH 4DUZQ 1WJJA 1VQ6A 3KJOA 1HNWL 1Q86C 3KDFB 1YHQA 4YCUA 4BA1I 3FKIH 4DV1Q 4DR1L 1PVOA 2HQLA 3GO5A 3KF6B 1HR0Q 2F4VL 1XNRQ 4YY3Q 1VQCA 1NE3A 5FJ8G 3TS2A 1B70B 4NXML 4DPGA 1BVSA 4JI5Q 1U0LA 1SN8A 4A76A 4IPHA 4DK6C 1VQIA 4LFAQ 2ZM6Q 2JEBI 4BY7H 5M5WH 4C2MH 4P73A 2N49A 4UP8A 2K4KA 4P71A 1XPRA 1OXXK 3OW2A 1JJ2A 2ZJQA 3AFQA 3K81C 1RIPA 2EIFA 4LWCA 4DV6Q 1YJ9A 5IYCH 4DKAC 3M4OH 3Q8DA 4DR7L 4Y52H 4MNOA 1XMQQ 4EX5A 1ASZA 4JI6Q 5LMNQ 3RZOH 2CWPA 2LSSA 5GAHC 4AQYQ 4IJLA 3OYYA 3CC7A 4AQYL 1NMFA 3S1NH 4DV1L 4DR1Q 4B3ML 1R9TH 3BJUA 1N33Q 2E5LL 4L5SA 1I50H 4X65L 4LUZA 1PYSB 4A3LG 1Y1VH 1HZ9A 2IHEA 4A3KG 2E2HH 2WAQG 2GVBA 4HIMA 4X62L 2RCNA 4PG3A 1VQ7A 4IPGA 4A3EH 2UU9Q 1N32L 3H3VI 1T9HA 4XTCS 5HGQA 1BBWA 5C0XI 4DV4L 3T1HQ 2ASBA 1NTGA 1YHAA 2ALYB 5GAEC 1SLJA 5IYBG 3F2CA 4K0KL 2A19A 2A1AA 4C3JH 5JJKA 1LYLA 2OQ0A 3EBEA 5IP7H 3S14H 3GTOH 2BA0A 3CMEA 4BBSG 4QIWE 1DGSA 2HIXA 5AJ3Q 1VQ4A 3CD6A 4GKKQ 4C3HH 4HJ5A 5EAYA 4Y7NH 1VQ5A 2HHHQ 4A4IA 1VQHA 4L5QA 1PH6A 3J81c 1Q12A 3KF8B 3CXCA 4B3SL 3ULLA 4A3DH 1VQAA 3M9BA 1N33L 1OXSC 4YY3L 1MJEA 4UP9A 3M3YH 2K52A 3UDIA 5C3EG 1Y1VG 3M4PA 3MEFA 2KBNA 2JA8H 2R7ZH 3PUVA 3S1MH 5M3FG 4OO1G 5IP9G 1N9WA 2WFWA 5HY6A 2ZM6L 1EQQA 1VCIA 4FDBA 3GTJH 1PYBA 1YITA 3KYHC 4BY1H 5K36G 2DUDA 4HJ7A 1I5FA 1PH1A 3HOWG 3GTKH 1YBYA 3EIVA 1V9PA 3T1HL 2AWNA 4QL5A 4DV5Q 2K5VA 2JA6G 3U58A 1HNXL 5ELOA 3ER0A 1VQOA 4DV7Q 2VW9A 3GDEA 1AE2A 1Q8KA 4LW1A 4RMFA 3S24A 1YZ6A 4X64Q 1J5EL 3GTMH 2PMZE 3STBD 4DR2L 5DLQE 1WCMH 3K7AH 4YHHL 4JI4Q 4DV3L 1KHIA 1X6OA 1AH9A 4AH6A 1VQNA 4A3GH 4JI8Q 5IY0A 4DUYQ 2MO1A 5IT9c 2MFIA 2F52A 3D31A 4DV2Q 2JEAI 5LMNW 1V43A 3AFPA 4JI8L 5LMNL 5FLMH 4DUYL 1OXUA 1YEZA 1IL2A 4A3LH 3RLOA 4UY8C 3JAMc 4DR5L 4C3IH 4IPDA 1PA6A 3PO2G 4AYBE 1GKHA 4LF8L 4JI5L 3I4NH 1N36L 2CKZB 2XTIA 1KD1C 2C35B 1KL9A 3ERSX 3CCLA 2AHOB 1KQSA 1S72A 4YCWA 1XMOL 2UU9L 2F4VQ 4JI0L 2GN5A 5BR8L 2IY5B 1X9NA 3RN2A 3F2DA 4R1JA 2KCTA 3GTQH 4OX9L 3E9HA 2A8VA 3STBC 1EQRA 2JJQA 2K75A 1HH2P 3HOXH 3VDYA 5IE8A 1K3RA 2R7DA 1KRSA 3I4OA 2R6GA 4OO1I 4R4TA 2Q2UA 3U4VA 1SRUA 1YJWA 3KJPA 4IFDI 1X3EA 1HZBA 3PSIA 4AIMA 1XMQL 3W5OA 4JI6L 4IO9A 4JI1Q 3E9IA 1S3OA 4R4IA 2E8GA 4B3SQ 2I0QA 4JI1L 4IOCA 4MTNA 2N78A 5FLMG 1LTLA 1NY4A 4HJAA 3SGIA 3I4NG 3I4MG 1K8AC 2D0PA 4OONA 4TVAB 2QEXA 2MNAA 1HR0L 4B3RQ 5JJIA 4BY1G 1J6QA 4POGA 1MKHA 4PZ6A 4LFCL 2NN6G 5C3EH 2JA8G 1NMGA 2ATWA 3HOVG 3S1QH 2WB1G 5M3MG 1I94L 4O0AA 2AMCB 1L1OC 2MO0A 4MZ9A 4JBKA 2Z0SA 1CKNB 4UP7A 5C0XG 1XNQQ 4A3BH 1IBLL 2PI2A 1YIJA 4QQBX 4X64L 2VUMG 1LM0A 1TWAH 1KC8C 3PCOB 4L5TA 3G71A 2YU9H 4JI0Q 4A93G 4L5RC 1I6HH 4AYBG 1HNXQ 4DAYB 3HOXG 1X65A 4DNIA 3MXNB 5IP7G 3RNUA 2R92G 4DV3Q 4K0KQ 5IWAQ 3UE0A 3NBHB 4BBRG 2VNUD 2VS1A 3K80C 1HNZQ 3CCJA 4JOIA 1OXTA 3CCVA 3UDXA 3M4QA 4GOPB 1EOVA 1VQGA 4KI0A 4JBWA 1HZAA 1Q7YC 4JYAL 3HKSA 4DV2L 1TWGH 4LF5L 1IZ6A 1OTCA 4IOAA 3CPFA 3PO2H 3G48A 4O2DA 1N8RC 1Y1WH 2JQOA 1QVFA 1QUQB 4A3KH 2ZTEA 2ES2A 5GROA 1BBUA 4NXMQ 4YWKA 2RHQB 1BKBA 3CCEA 4B3TL 2ID0A 2R93H 1Q46A 1FJGQ 2ZTCA 2QGQA 3TS0A 3NELA 4KHPQ 2NVXH 3CMAA 3UDFA 4GNXA 3IRBA 1IBLQ 5M5YH 4XIGS 1CUKA 2XGTA 1CSQA 4DV6L 1JJCB 2AWOA 3K0XA 3TQYA 3U50C 4OX9Q 1VQEA 2IHFA 3AQQA 3PO3G 4X66Q 2HT1A 5JJLA 2KCMA 1CKOA 1L2FA 3BZCA 2H5XA 1G6PA 1P8LA 1E22A 2N8NA 2LXKA 4BA2I 3S2DH 1YNXA 2UUBL 3HOZH 3F2BA 1CKNA 2BH8A 1HNZL 3PGZA 1PH9A 4NXNQ 3J7A5 1VQPA 2R7ZG 2JA5H 1RL2A 1L1OB 4DUZL 1FL0A 1Q1BA 3J81i 1A63A 4HJ9A 3JAMi 1Y1WG 4GLAC 1QZGA 4DAMA 1TWFH 3S17H 4B3RL 4H02A 4POFA 4GNXC 3DM3A 3GD7A 1E3PA 3KLWA 4PZ8A 4X62Q 4IFDJ 2PI2E 4B3TQ 4ALPA 1S40A 1N32Q 1W3SA 4LFBL 3EN2A 3UDGA 4LF8Q 4LUOA 1GM5A 2LXJA 2NN6I 1UE7A 4R4QA 1Q81C 4KHPL 3JC66 2Z6KC 4A75A 1SFOH 1A8VA 2K5HA 4KHZA 1HZCA 2EQSA 3CCMA 1IBML 5IYBH 4GKJQ 2R92H 3KF6A 1I3QH 4IPCA 2EXDA 4ME3A 2VY3A 1U5KA 3G4SA 4DV0L 2Q2TA 1VS0A 4GLVB 3I2ZA 1OXVA 2VQFQ 1TWCH 1CSPA 4A3EG 4YHHQ 4NB3A 4JOIC 1XTDA 2E5LQ 5JEAG 4LF7L 3A74A 2N3SA 4A3IG 3PV0A 3H0GG 1QVGA 2YTXA 3L2PA 2GVAA 4IFDG 4A3BG 3CAMA 4QY7A 3ULJA 4GLXA 4DR6Q 2DGYA 2WP8J 3H0GH 3HKZE 3PF4A 4JV5L 4JC0A 5C0XJ 3OTOL 2YTYA 1YVCA 3RLFA 4X65Q 4DV4Q 1Q82C 4APVA 3I4MH 2IT1A 2CWAA 4PMWA 1UEBA 4GOPC 1YI2A 1M1KC 3RR5A 2UUCQ 1VQMA 3AYHB 4WJ4A 3FP9A 4X66L 2NVYH 4DV5L 4JI3Q 3S16H 2K5NA 1XNQL 2B63H 4A93H 5IWAL 1CKMA 3F1ZA 1VQDA 3NEMA 4JI3L 3CCSA 4JI2L 1HR0W 2UUBQ 2WB1E 4GKKL 4GKJL 2F3IA 4YWMA 3B6YA 1W2BA 4LF5Q 1PH3A 3FHWA 1JJGA 3PIOA 5J3BA 1D7QA 2JA6H 4R4OA 4A3FG 3GTLH 3T1YL 2NVTH 4DR7Q 1GVPA 1SR3A 1UE1A 2YYZA 2UXDQ 3PUZA 3RN5A 3TREA 4HIOA 4HIDA 3CP0A 2FXQA 4A3CG 1C7YA 5IYDH 1XNRL 4DR3L 2AKWB 2HIVA 1XJVA 1SE8A 3DLLA 1X55A 4LNQA 4A3GG 2UXCQ 1EFWA 2ZJPA 5C44G 5E7NA 3G6EA 3ULPA 3PUXA 2D0OA 1K9MC 1Z9FA 5GQOA 3WWVA 1K83H 1JMCA 3HKZG 4UPAA 3F8TA 1E7ZA 3A5ZB 1VQ9A 2YV5A 5M3MH 1WI5A 2UXBQ 1PFSA 4P75A 3HFZB 2OQKA 3NENA 1VQLA 2JA7G 4DR4Q 3S15H 4LF4Q 2NZHA 4P74A 1LUZA 1EIYB 3PO3H 3HOYH 2QA4A 5FJ8H 4P72A 2Q2HA 1QZHA 3KFUA 4HJ8A 3L0OA 3HOWH 5FLXc 3J7ZC 4A3CH 2Z6KA 3FKIG 1Y14B 1QVCA 3PUYA 5JEAJ 3TRZA 1Q1EA 3ZJYC 3PF5A 1C9OA 2PNHA 2ZJRA 1I94Q 1IYJB 3AEVA 4BXXG 2UXCL 4IJHA 2KHJA 1PH5A 4LF6Q 1G291 4LFBQ 5BR8Q 1KIXA 1EYGA 1X54A 2OTLA 4A3DG 2NVQH 1VQJA 3TEHB 2VZAA 4GN5A 4GN3B 1XMOQ 1MJCA 5C4XH 3CC2A 4BBSH 5LMUL 2I5MX 2UUAL 1VQ8A 1UWVA 4JBMA 4JI7Q 5LMUQ 3M7NA 1HJPA 4LF4L 4DR2Q 2Q2IA 3UE1A 3BU2A 2E2JH 2RHSB 1IBKL 2CCZA 5IYCG 2UXBL 5ELNA 4GS3A 1E1TA 4A3JH 1NJIC 1FGUA 1WFQA 3CCQA 1PH8A 1XPUA 2KHIA 1WYDA 2JA9A 1E24A 2BA1A 2PQAB 5M5XH 2B3GA 2VUMH 1N36Q 4BY7G 5IP9H 2OWOA 2VQEL 3CCRA 4A3FH 1TXYA 4QGUA 4DR5Q 2NZOA 4OWWB 3KOJA 1K8GA 1X3GA 4BXXH 1X56A 4QJFA 1WCMG
chains in the Genus database with same CATH superfamily
3SK5A 3D3RA 1MIUA 4RHSA 1HA6A 2HDLA 1S5DD 2NTSA 2SDFA 1HHVA 2PQEA 5C44B 1EY5A 3D0FA 2SOBA 3RMHA 1EWIA 1SNOA 1FVIA 2R7FA 3OSOA 1EQTA 1H9MA 4PZ7A 5M3FH 3ND8A 3K57A 3VR3A 2HHHL 3K59A 4KLKA 4KKSA 3W1GA 4HCEA 1VDZA 4FNFA 4XT3B 3VR6A 3CC4A 5T1IA 1EY8A 4CDEC 3FPPA 3SVMA 1F9SA 5EQ0A 5IYDG 4CKEA 1KAWA 4QCLA 1U4RA 3KBGA 1RD9D 3D4RA 3K5LA 3GTGH 2K04A 2UUCL 2A74C 1FJGL 4JG2A 1DZ1A 3D6CA 3CU7A 4J1MA 1JT8A 3MC0B 3PIPA 3W1BA 5IGBA 3J80i 2R93B 1QCBD 2AQ2B 4WRDA 4GNXB 4JYAQ 1O7ZA 4HMIA 5CORA 2Z6BA 1UNSA 2VQEQ 1PH4A 4JV5Q 3A5UA 1PH2A 3I4NB 3IAYA 3FEWX 1UE5A 2X69A 1F9QA 2WACA 3HOVB 4B08A 2XN9C 1A0IA 1EIGA 2BE5C 1L1OA 3K7AB 3K7UC 3FDTA 3D8GA 4GN4B 2A6HD 3J81E 1PTOH 1E2ZA 4C56C 1QOHA 1TWHB 2F3VA 2RF4A 3C2PA 1K8MA 1M90C 1P16A 1AE3A 1EUJA 1BR9A 3RZDH 1PTOB 5CV9A 3KK7A 5FO9B 5FKAC 4LF7Q 1HNWQ 4DUZQ 3L9AX 1VQ6A 5JPMC 2VXWA 2K7VA 2PZTA 3M4YA 1YHQA 4YCUA 3I4MB 3KF6B 2JA8B 2I07B 1XNRQ 5JVH3 1PTOF 4YY3Q 1DD2A 3HGBA 1BVSA 1WTOA 1EYCA 1SN8A 5JVG3 4BY7H 1G8ZD 4UP8A 2G5DA 3HZXA 1EIHA 1PRTC 3AFQA 1RIPA 4LWCA 1U4MA 5IYCH 2B2YA 4DKAC 4DR7L 4LJZC 2HCCA 3H3VC 3RZOH 2CWPA 3OMCA 1NMFA 4K2KA 4DV1L 3BJUA 2KOLA 2B8GA 1FYCA 1ML0D 1NSNS 1CT1D 4H7BA 1HZ9A 4A3KG 2WAQG 3K58A 4RGNA 2F3WA 3HOWB 3TP5A 2UU9Q 2JSOA 1FD7D 3IKJA 2L12A 3HRZC 3T1HQ 2OXPA 1B4OA 2ALYB 3VA5A 4K0KL 5EBDA 5LHY1 2BOSA 5KRUA 3CMEA 2MP1A 1DGSA 2HIXA 1VQ4A 1PMRA 5A2QL 1ILQA 2QCPX 4L5QA 1PH6A 1Q12A 2PMZB 2B2YC 4A3DH 4BY1B 1MJEA 3M3YH 2K52A 3P75A 2NN6H 1Y1VG 2A6EC 3MEFA 2KBNA 5TSSA 3PUVA 2RCFA 1IW7C 5IP9G 2ZT9C 1BNZA 1Q90A 3LNNA 5E1FA 1VCIA 4RHRA 4HJ7A 1I5FA 1EYDA 4QB4A 3GTKH 1YBYA 2EYHA 4DV5Q 1S5FD 3U58A 2JA6G 3R3OA 2L55A 5ELOA 1PZKD 1VQOA 5BN3A 1EY4A 1V1OA 4RGMA 3GDEA 1AE2A 4RMFA 3GTMH 5J22A 2YU9B 4DR2L 3OMGA 1B2TA 4DV3L 2EDGA 1X6OA 2M9VA 1AH9A 1MD2D 5D14A 4DUYQ 2MFIA 4CBVA 1F77A 5LMNL 4A3LH 3RLOA 1V1PB 2E2HB 1F2ZA 4DR5L 3NQTA 3I4NH 3SR1A 1R9TB 5HURA 1STAA 2CKZB 2XTIA 1XXGA 3CCLA 4L6TB 2AQ3B 2IL8A 4YCWA 2F4VQ 5BR8L 4IZ8A 1X9NA 3RN2A 1STEA 3Q24A 1TS3A 4KD3A 3HOXH 3NBIA 1JWUD 2R6GA 2EYLA 2QDBA 2R61A 2Q2UA 3U4VA 1ENFA 1X3EA 4LAAA 3W5OA 4JI1Q 1A2UA 4R4IA 2QEJC 1D1KA 2F0KA 4K14A 4MTNA 1BDOA 4TVAB 4DU9A 4HSVA 4POGA 1MKHA 3P20A 2NN6G 3QR8A 4FF3A 3A7LA 3FKIB 4MZ9A 1CKNB 5F2DA 1IBLL 2PI2A 4QQBX 1TWAH 3PCOB 2NYZD 4A93G 2YU9H 1I6HH 2JA7B 4AYBG 3NTHA 1HNXQ 3HOXG 1ICFB 4IUTA 3BVZA 2O4XA 5IWAQ 4A3BB 1HNZQ 4DR4L 1OXTA 1HZAA 1STYA 1TWGH 1IZ6A 3PO2H 1I4HA 1N8RC 1DCZA 4Z9CB 4HTHA 1QUQB 4A3KH 5GROA 1QWYA 3T13A 4A3DB 3P7JA 2R93H 1Q46A 1FJGQ 2ZTCA 1S5BD 2QGQA 3SE0A 2E2JB 1ILPA 3UDFA 4GNXA 1WTXA 1IBLQ 2G9HD 1CUKA 3GTPB 3MZ5A 3K0XA 3TQYA 3U50C 3AQQA 2HD3A 1E2WA 2IHFA 2KVMA 2IPKD 2H5XA 2E74C 4FVMA 2J4XA 4MN3A 3F2BA 2BH8A 1HNZL 3PGZA 4O42A 1L1OB 1Q1BA 1H9SB 4HJ9A 5HGTA 1G6ZA 4H02A 4POFA 3GD7A 2F0UA 4LFBL 4CHTB 5M3FB 1CA6A 2FFKB 1LTID 4LUOA 3JAML 1GM5A 4LK1C 3S15B 1UE7A 4R4QA 4A75A 1SFOH 3VYTA 1A8VA 1HZCA 2EQSA 1IBML 5IYBH 3H6MA 1K83B 1U5KA 1E2VA 1VS0A 4GLVB 3TDQA 4YHHQ 1MI2A 2E5LQ 3CRLC 4IN3A 2PZUA 3H0GG 1GUGA 4GLXA 2DGYA 1F2YA 1Y8PB 4JC0A 2MPMA 3VR5A 4MTKA 3RLFA 4DV4Q 3I4MH 4APVA 2JA6B 5EJWA 2TSSA 2K32A 1I4PA 3R2TA 2KA7A 3FP9A 1J8IA 4X66L 1O78A 4JI3Q 3S16H 3J80L 1CKMA 3GTMB 3NEMA 3CCSA 1SJHD 3G7LA 4CDFC 1W2BA 1PH3A 2IW3A 5EKKA 5J3BA 1D7QA 2EOTA 5CV5A 3T1YL 4DR7Q 1MGSA 2HCIA 4QF4A 2SNSA 1Y8NB 1UE1A 3BDCA 3QIAA 1FR3A 4HIOA 4HIDA 3CP0A 4RFBA 2F0EA 2FXQA 4ULLA 3BDLA 2HIVA 2JN4A 4ME5A 4LNQA 1LTBD 2I46A 1SNMA 3EFXD 3GP7A 5E7NA 4QUFA 4KTAA 1LTTD 1K83H 3KF8A 3HOYB 3HKZG 4UPAA 3F8TA 1E7ZA 1S4ZA 3GTOB 3QB3A 1PFSA 2NB0A 3S15H 4LF4Q 3HOYH 4HR7B 2Q2HA 2K1BA 3V05A 3QO2A 3S17B 1HTPA 5KYIA 4A3CH 3FKIG 3NWTA 4IUNA 3PF5A 1SNDA 5IIFA 2MJ8A 1KDCA 3AEVA 1YNND 4XDXA 4K5XA 2UXCL 1EEID 4LFBQ 2NVQH 3TEHB 1XMOQ 4GN3B 4I7AA 5ISRA 5KEEA 1LTRD 3M4OB 1XYIA 2I5MX 1A3UA 1UWVA 1HJPA 4CKBA 3J80E 5ELDA 5M5YB 2E2JH 2RHSB 1IBKL 2JP1A 2L0CA 5ELNA 1NJIC 4A3JH 3CCQA 1PH8A 1PXUA 2KHIA 2QF7A 5M5XH 4IUQA 4BY7G 2OWOA 1R4PB 1RJTA 2VQEL 2B2WC 4OWWB 3KOJA 3L3OC 1DXMA 1IL8A 1X56A 1EWHA 4B9WA 5JEAH 1Y8OB 4BXXH 1G6PA 3S2HH 4UAIA 3CPWA 1SE4A 1X3FA 3L7ZC 3HOZG 4C3HB 2J0TD 1IKMA 2B29A 3ITPA 2I5LX 1QNUA 4X3SA 1B1ZA 2DY8A 3MTSA 4HN7A 4OGQC 2R3ZA 1M8AA 2R93G 2AUKA 4JI4L 4EQ5A 4ZUJA 3CCUA 3HOVH 2YTVA 3T1YQ 3KLRA 4DK3C 1ET9A 3V2TA 4X3KA 4ODGA 4DAYA 4DR3Q 4RCOA 2JA5G 3VR2A 4TQUS 4OWXB 3U9OA 2OCEA 3NBHA 4YCVA 4A3JG 1AN8A 3OTOQ 2M2LA 1TT2A 1QB5D 1N34L 3MXNA 5H1SE 3DM1A 3I56A 3OPOA 3E6ZX 1DOMA 4ZK9B 1MSGA 1XPOA 1PLFA 3FVQA 3HP3A 3I7FA 2D62A 1ZEQX 4JI2Q 4A3MG 4QUCA 2MHVA 3SK4A 4UHVA 4OXPA 4NP5A 3M85A 1QUQA 2MQHA 1YHBA 1QNKA 3DEOA 1G51A 2PNRC 2PO4A 4XQQA 1WTRA 3PUWA 5FK9C 1QILA 5T1GA 1KXLA 1C0AA 4P2CB 4C3IB 3BVGA 2UXDL 2EYPA 4A3FB 3WDNA 1IXRA 2WIIB 1WOCA 3A54A 1GD7A 1JE5A 1FNWA 5EBCA 1D1IA 5CBAE 4U673 4DXFA 2UUAQ 4JI7L 3R2IA 2JK8A 3J7AV 2B2WA 1C48A 1UE6A 2CH4A 5C44H 3OWFA 1TU2B 1EU4A 4AYBB 1A62A 1UUPA 5C4JH 2Y0SE 1B3QA 1QE6A 3KJOA 1LO5D 1Q86C 4IQZA 2F0HA 5LL6X 3FKIH 1SYEA 1D5XC 2KHSA 4IUPA 2EY5A 1HR0Q 2C5CA 3J7YW 2O5IC 1VMPA 1NE3A 3MHBA 5FJ8G 1B70B 2DY7A 4NXML 4WFN3 1U0LA 4IPHA 2X6GA 2ZXPA 2ZM6Q 5M5WH 1JOQA 2K33A 5G3LF 2K4KA 4KN7C 4P71A 3EA6A 1OXXK 3W3AA 3K81C 1YJ9A 3S14B 4M8AA 3KBXA 3VYSA 1A15A 4PV1C 2LSSA 2QW7A 4IJLA 1ENCA 1DOLA 2ZXRA 2A69C 3S1NH 4DR1Q 2E5LL 1XTCD 4LUZA 1PYSB 1Y1VB 4RKLA 3C1EA 3I3CA 4DFAA 1PDQA 4ZLTF 2GVBA 4ZQ3A 4HIMA 5DNFA 4X62L 1U9RA 3RZOB 1JOOA 1WTVA 3H3VI 1T9HA 3OWEB 4XTCS 5HGQA 4DV4L 3VYRA 2ASBA 5GAEC 1D6EC 1YHAA 3PO3B 2KUMA 2A1AA 4C3JH 3JAME 1AZPA 2OQ0A 2XWBB 2E76C 4QIWE 4G7ZC 4Y7NH 4EQOA 3TMEA 5K5PA 2EYOA 4R8NA 3ULLA 4OO1H 1N33L 1KLUD 2EJMA 4YY3L 1D5ZC 4UP9A 3UDIA 1GUSA 2R7ZH 1EY6A 3S1MH 2F0GA 5M3FG 3QJYA 3H09A 1SNCA 2WFWA 4XYQA 5HY6A 5I9PA 4RA8A 2WINB 3NQIA 1YITA 4BY1H 4E6IA 3HOWG 1A6XA 3EIVA 1V9PA 4QL5A 2K5VA 4QIWB 4PNYA 1V8QA 4HMJA 5A2QE 2VW9A 2WV6D 1CTMA 1Q8KA 2BE5D 3S24A 1S5ED 4PQXA 1PYWD 3STBD 3K7AH 4JI4Q 1VQNA 3A8KE 5IT9c 3QOJA 4XYOA 5LMNW 5C0XH 4JI8L 1JQYD 2F0JA 3D6WA 5FLMH 1TWFB 1YEZA 4UY8C 3JAMc 1G2SA 4JI5L 3EJIA 3SXHA 2B2UC 2MGSA 2AHOB 1S5CD 2F0NA 1KQSA 1S72A 1XMOL 4FYDA 3T4AC 2PPBC 2IY5B 3BDOA 1C8CA 1CHPD 2A8VA 4JPBW 3STBC 1BCPD 4ZYSA 1HH2P 3VDYA 5IE8A 5CR3A 5C6AA 1YJWA 1SYGA 1WVLA 2Z9HA 1HZBA 1BUVT 4NKLA 3SDZA 3MWYW 1EZ6A 3BG3A 1S3OA 3S1RB 4B3SQ 2F4IA 4TRDA 1HQMC 4JVZA 5FLMG 3I4NG 4HJAA 3HG9A 1K8AC 2QEXA 2MNAA 1AZQA 2JA8G 4DNTB 3HOVG 2ATWA 3S1QH 2JA5B 2WB1G 1I94L 2RQXA 1XNQQ 5C0XG 4A3BH 1KDAA 2CQAA 1YIJA 4OIKA 3S2DB 5C5LA 2VUMG 4KK7A 5IGFA 4L5TA 1ZYRC 4DAYB 4K5WA 2B2TC 2ZXOA 1BCPB 3K6OA 3K80C 3CCJA 1E0BA 3M4QA 1EOVA 3IFDA 1Q7YC 2N55A 4JYAL 4LMQD 4R8IA 1KNAA 4IOAA 3A8IE 4O2DA 4IUVA 1TVXA 3ND9A 1GXDC 2ES2A 1BBUA 1EQVA 4NXMQ 4YWKA 1BCPF 1Y1WB 1STGA 1BKBA 4B3TL 3TS0A 5JAVA 2EYMA 3WOEA 3IRBA 2FINB 1CSQA 2AWOA 3PO3G 3BZCA 1CKOA 2N8NA 2LXKA 1A2TA 1YNXA 2K5DA 2UUBL 4WJWA 2F0SA 4NXNQ 3J7A5 1VQPA 2JA5H 1JOKA 1A63A 3OIQA 4H0LC 1EFID 1ZKOA 2HUGA 1Y1WG 4GLAC 4X62Q 2KJXA 3KLWA 4KHVA 2CVRA 5EPJA 1LTAD 1W3SA 4LF8Q 2LXJA 2ENBA 5M3MB 3NSWA 1Q81C 1TS5A 3JC66 3NP8A 2XSCA 2RA4A 2K6AA 4NW2A 2R92H 4IPCA 1B53A 2EXDA 4ME3A 2VY3A 2Q2TA 1F9PA 2X6LA 1OXVA 2VQFQ 1TWCH 1CSPA 3CQZB 4A3EG 4JOIC 2NVXB 5JEAG 1SSOA 2N3SA 4A3IG 3PV0A 2YTXA 3CAMA 3ULJA 2F0LA 3WOFA 1IYUA 1WTQA 3H0GH 3PF4A 2TMPA 1O80A 1YVCA 1AEXA 4FXGC 3GV3A 2IT1A 3RR5A 1B3AA 1X3PA 1NCVA 5M9OA 2EVBA 1VF7A 1EL0A 3F1ZA 1VQDA 3K5NA 3FRPB 4JI2L 4BWGB 3T56B 3B6YA 4LF5Q 3FHWA 3PIOA 3KLSX 3IL8A 2RDFA 1SNQA 1HA5A 2NVTH 1GUTA 1JWSD 1TIID 4XQJA 2OF1A 2Q8TA 3TREA 4EGVA 4A3CG 1C7YA 1SMYD 4I7ZC 1CM9A 2AKWB 1XJVA 1SE8A 3DLLA 1X55A 4A3GG 3G6EA 1H9KA 3PUXA 4OL7A 1BCPC 5IGGA 1K9MC 1JMCA 1EY7A 3RUZA 3M7GA 4P75A 1KABA 1VQLA 2OQKA 3NENA 2JA7G 2NZHA 4N9PA 1LUZA 1EIYB 3PO3H 1IHZA 1RODA 1JWMD 5FJ8H 3PIO3 4P72A 1WTWA 2QDLA 1GHKA 1AW7A 4QMGA 3ERQA 3TRZA 5JEAJ 3O13A 3VYUA 3I4LA 1Q1EA 1KAAA 4DF7A 2PNHA 1I94Q 4BXXG 2L9HA 5COYA 3BZDB 1NNXA 1HUNA 5BR8Q 1F2LA 2OTLA 1VQJA 3HOZB 3TZDA 1MJCA 3TZUA 4K2LA 4BBSH 5ELBA 3N52A 1H9RA 1RF2D 2WKDA 4CJ1B 1RDPD 4JBMA 5LMUQ 1PZJD 2QILA 2B63B 2O5JC 5IYCG 1EU3A 1FGUA 1XWEA 1XPUA 3S2HB 2VUMH 1NR2A 4H13C 4PMCA 4KD4A 3E3XA 4F87A 1LT5D 1GOZA 4OWTB 1KRTA 3FPUB 2D5DA 4LFAL 2PW7A 2Y0SB 3RD4A 5C4JB 1FNUA 3CQZH 3QOLA 4DAPA 2E2IB 1RTNA 1SFOB 4K6DA 4CDCC 4JBJA 5AJ3L 1IBMQ 1O7IA 1NBWA 1SROA 2CFMA 1I6HB 1LV9A 4NXNL 3S1QB 2OEOA 4DK0A 4B3MQ 2IX0A 5KGUA 5I6YA 2Q8IB 1PRTF 1K73C 1LTSD 4ILWA 1N34Q 3S1RH 1EIFA 1MHWC 2WAQB 3T51B 3RLNA 2ZTDA 2IX1A 1YJNA 3HOYG 3HOUG 1VQKA 4OHJA 4BBRH 4DV7L 2K14A 1JB3A 1T5XD 3GTPH 3DHQA 3GTQB 2VQFL 1PH7A 4LUVA 3FMCA 5DM73 1L0WA 4A3MH 2KENA 4DV0Q 1GO3E 5G3LD 4WJ3M 1B7YB 3A56A 5BN4A 4KY5A 2CQOA 3K0YA 4A3KB 1LLRD 4JCVE 2HQEA 3J80c 3CF5A 2F0PA 3LGJA 1CFMA 4HIKA 4DR6L 2A69D 1PV4A 3LX0A 3DEPA 2JE6I 1WCMB 4A3IH 3BZKA 2A73B 1V1QA 4A93B 2FMCA 2EYJA 1TWHH 2V4DA 3HKZB 2BH2A 2OTJA 3HOUH 4N8FA 3A0JA 3NE5B 5C3EB 1CQVA 1W6JA 3KDFB 4C3IG 2VB3X 1SMYC 4DV1Q 1PVOA 1PFBA 2HQLA 3GO5A 2F4VL 2L11A 1VQCA 3TS2A 2OT2A 4KV6A 2BDNA 4DK6C 1VQIA 4LFAQ 1AP0A 2JEBI 4C2MH 5CV6A 2N49A 4DNRB 3SK8A 1DYQA 2C9OA 3OW2A 1XPRA 5ELFA 1JJ2A 2ZJQA 2EIFA 1BF4A 5CGKA 3TP7A 3M4OH 4IALA 4ZUIA 4MNOA 3PQIA 4TKOB 4EX5A 1XMQQ 1GJXA 3I91A 5GAHC 3OYYA 4TSSA 3CC7A 4AQYL 5JPNC 4B3ML 1R9TH 1K0SA 3EROA 1I50H 2E2DC 2IHEA 1DOKA 3R8BA 2RCNA 1VQ7A 1F9RA 4G7OC 1VMCA 2WB1B 5DEHA 1PRTD 1EY0A 3F2CA 5E3FA 5IP7H 3EBEA 3GTOH 2NVYB 2F0WA 4GKKQ 5DAUA 5EAYA 1VQHA 5EPLA 3J81c 3W2DA 3KF8B 4B3SL 4K5VA 4EQNA 3M9BA 1OXSC 3M3YB 5I6WA 5C3EG 1M4VA 3D4DA 3X3MA 4OO1G 3S1MB 5IT9E 3PO2B 1N9WA 2ZM6L 1EQQA 2B8FA 4FDBA 3KYHC 2EZVA 2DUDA 2CW0D 3J81L 3T1HL 2AWNA 1YNJD 1STBA 3CHBD 1ENAA 4C3JG 4LW1A 1SJED 4X64Q 3NTKA 2PMZE 3P1HA 4ZKCB 3ONAB 4CJ2C 5A35A 3SHLA 4JI8Q 2MO1A 3D31A 2JEAI 1V43A 3AMUA 1LACA 5C3WA 4C3IH 1G2TA 4AYBE 1GKHA 2B39A 1ZXTA 1KD1C 3ERSX 5D65A 1CK1A 4JI0L 2GN5A 1ESRA 3F2DA 4R1JA 2KCTA 1GUWA 2NBFA 4OX9L 1EQRA 2JJQA 2K75A 2F0IA 3HOXB 2L1BA 1K3RA 4K8IA 1KRSA 3I4OA 4C3HG 4OO1I 4RH6A 4C2MB 1SRUA 3KJPA 2Z8LA 3ZYYX 2EXZA 3PSIA 4RCNA 1C4QA 4AIMA 1XMQL 4BBRB 4IO9A 1TR5A 4IOCA 2N78A 3KUPA 3T16A 4RGTA 1LTLA 3I4MG 2D0PA 4OONA 5E4WC 1HR0L 4BY1G 4LFCL 5C3EH 1NMGA 2XNAC 5M3MG 2AMCB 1L1OC 2MO0A 4UP7A 2XWJB 3QWNA 1LM0A 3NK9A 4JI0Q 4L5RC 5CV4A 3U9SA 1CZWA 4DNIA 3DWQA 1TKWB 2XRSD 3MXNB 3KLSA 5IP7G 3RNUA 2R92G 4K0KQ 3UE0A 1OO9B 4BBRG 2VNUD 3CCVA 4JOIA 4O1NA 3A55A 4GOPB 1VQGA 1K8OA 4JBWA 5BN5A 4DK1A 1UAPA 3HKSA 3TP8A 4DV2L 1OTCA 3PIP3 3G48A 1GUOA 1EWCA 1LABA 1SNPA 1QVFA 2ZTEA 1CI3M 2RHQB 1STHA 1SYDA 2ID0A 4CJ0B 2DN8A 1PFMA 2NVXH 3BYYB 3CMAA 4XIGS 2XGTA 1JJCB 1VQEA 3VR4A 5JJLA 2KCMA 1L2FA 2EE1A 1P8LA 1E22A 1HFGA 3NUCA 5KNDA 3C46A 3Q6SA 4BA2I 3HOZH 1PH9A 4IFDH 3NTIA 1FL0A 4R9WA 4Q5VA 2BCOA 2IWHA 2A6ED 1QZGA 4DAMA 1TWFH 3S17H 4B3RL 1J9OA 3DM3A 4L8JA 4IFDJ 4PZ8A 2PI2E 1S40A 1I4GA 3EN2A 3MA2B 4S3SA 3UDGA 4H44C 2XVSA 2NN6I 2E75C 2K5HA 3CCMA 4JK1C 3KF6A 1I3QH 5FLXE 4XT1B 3DXJC 1X3QA 3I2ZA 2XRQD 4NB3A 1BBXC 1BOSA 4LF7L 3A74A 1YNNC 5KNBA 2KCNA 3L2PA 3MAQA 2B2TA 1IW7D 4A3BG 3Q22A 4ZCKA 2WP8J 2DNEA 3K5OA 1IYVA 1PZID 3MFYA 3Q0AA 1A3VA 1SXTA 2B2VC 4X65Q 1Q82C 3E0JA 4PMWA 2CWAA 2KQ3A 5M5XB 1UEBA 2L4NA 4GOPC 1YI2A 1M1KC 2UUCQ 4WJ4A 1SBBB 1WD0A 4DV5L 2EYFA 2K5NA 4A93H 1SDFA 5IWAL 2LKVA 2UUBQ 1R4QB 3I8ZA 3MFGA 2F3IA 5C4XB 2NVQB 2K01A 2JA6H 4R4OA 4A3FG 3GTLH 2NTTA 5AFWA 5EPKA 2EY2A 3RN5A 4FXKC 1I6VC 2L5TA 3HEJA 1U4PA 3VA7A 2Q8RE 5KNCA 4DR3L 5FOBB 5IT9L 1B50A 2F0VA 2N88A 2UXCQ 1JE4A 3ULPA 1Z9FA 3WWVA 3X3NA 2EJFC 1TY2A 1JR0D 1L0YB 3TN2A 2JXMB 1PTOD 1TS4A 2YV5A 1WI5A 4KKTA 1KNEA 5CMDA 5EKLA 3GTGB 4RKBA 1GUNA 1SAPA 3A8JE 4P74A 4K8JA 3DWPA 3EVQA 1KDBA 2QA4A 4V190 3D4WA 3KFUA 5I2XA 3HOWH 5FLXc 4ZRZA 1JICA 2EPBA 2KECA 3J7ZC 2Z6KA 5IGEA 4X3TA 3NWSA 1STNA 3PUYA 3DMUA 4IJHA 2KHJA 4LF6Q 3AU7A 3OHXC 2EY1A 1EYGA 3C3LA 1X54A 4A3GB 3C1FA 4KN4C 4GN5A 5FLXL 1FNVA 5C4XH 3CC2A 5LMUL 2UUAL 1SEBD 4JI7Q 1HRJA 1EYAA 1YNJC 4LF4L 4DR2Q 4JW0A 3BU2A 1GHJA 2CCZA 4GS3A 3N6RA 1WFQA 1WYDA 2FHTA 3DWAA 3H91A 3GTJB 3GQBA 5IP9H 3CCRA 4A3FH 1TXYA 4QGUA 4DR5Q 2NZOA 1K8GA 2IJ0A 1H9JA 1X3GA 4BA1I 2RBMA 1WCMG 2V1CC 1RTOA 5GAGC 1ET6A 1B9NA 4DAVA 3HOUB 2P5ZX 4CGYB 3RZDB 5L37A 2JA7H 3URYA 2FMMA 1TWAB 1SYCA 2KEEA 1IBKQ 1I4QA 3J7AF 1PFNA 4R4CA 2F1MA 3J81j 3A7AB 1CHQD 4FXDA 2L15A 2A6HC 2ICEC 1D2BA 3BVMA 4LF9L 2F0QA 4A3EB 1SMXA 2RVLA 3IFTA 3NHHA 2BDOA 1I4RA 2FJ2A 1IKLA 4IUUA 5DM63 2A5HA 1NAPA 1Z47A 1HQRD 4X6AH 1B8AA 2K03A 5KIXA 1LT6D 3E0EA 2PZWA 4GZYC 3KDFA 4B9XA 2Y0SG 4LFCQ 4GOPA 1D8LA 2PQAA 5C4HA 4EVOA 4ZKBB 1ASYA 2F0OA 2F0TA 4FF1A 5IODA 2K50A 4XXEA 2RSNA 1JC7A 4L63B 3I55A 4HSPA 1VQBA 2ICIA 1KTKA 1BXTA 2RSOA 4F7XA 4ZAIA 5GADC 2B63G 3ICEA 2A68D 4LF9Q 2I5HA 1ESFA 3K8AA 1JB7A 1RCVD 4KJOA 3CW2C 5ELEA 1QJOA 1H95A 1E1OA 3NPPA 1Z7TA 2VL6A 4LF6L 4YWLA 4K6LA 1PHJA 3U4ZA 1K0RA 1HXYD 1SE2A 2NUCA 1J5EQ 1BO0A 1UEAB 4RG1A 5C4XG 4J15A 3T53B 1SYBA 5J1ZA 2E2IH 3H15A 3G6JB 2WAQE 2WKCA 4NPSA 1VQFA 3H3VH 1WJJA 2SNMA 1HNWL 1K28A 1TQOA 1EEFD 4KJNA 4DR1L 1MSHA 3H0GB 5K36H 4G4KA 5I2YA 2D2CC 2VUMB 4DPGA 4JI5Q 4A76A 1SE3A 2K5WA 5IGCA 1HFNA 4P73A 1PTOC 3R93A 4M1UB 2R92B 1XX8A 4DV6Q 2G9DA 4BBSB 3Q8DA 4Y52H 1ASZA 4JI6Q 5LMNQ 1U4LA 4EQPA 4AQYQ 1HUMA 3H94A 2KEDA 3EQLC 1N33Q 4L5SA 1DONA 1I50B 4X65L 1CA5A 5I4DA 4A3LG 4C1NI 1Y1VH 1W6KA 2K5QA 2E2HH 1N32L 1A3TA 4FP5D 4IPGA 4PG3A 4A3EH 2MUYA 3MVVA 1LT4D 4V0BA 1BBWA 5C0XI 1NTGA 1SLJA 5IYBG 2A19A 3MXUA 2EY6A 5JJKA 4NDXA 1LYLA 4ID6A 3S14H 2BA0A 4BBSG 5AJ3Q 1O7YA 3CD6A 3AB9A 4N8X1 4C3HH 4HJ5A 1O7LA 1VQ5A 2HHHQ 3LWUA 4A4IA 3CXCA 2F0MA 1VQAA 1II3A 4OEMB 2JA8H 3M4PA 3TP6A 3NXWA 5K36G 3GTJH 1PYBA 5J39A 5ELCA 1PH1A 4A3JB 1HNXL 3TBIB 3ER0A 4XQNA 2LS01 2LMCB 1ONLA 4NMZA 2K05A 4DV7Q 1SYFA 3MEHA 4KY7A 1J5EL 5CV7A 1YZ6A 3S9WA 5DLQE 1WCMH 4YHHL 4A3IB 1LTGD 1KHIA 4HCSA 2EJGC 4AH6A 1D5MC 4A3GH 5IY0A 2F52A 4DV2Q 4IURA 5EKIA 3AFPA 4DUYL 1IL2A 3BS1A 1OXUA 4IPDA 2F0FA 1PA6A 3PO2G 4LF8L 1N36L 4FF4A 2C35B 1KL9A 2LY7A 1B9MA 2UU9L 1B44D 3CKIB 4RAUC 4A3MB 2LFNA 1LT3D 2DNCA 3GTQH 3E9HA 4HAEA 1TWCB 2NZ1D 2R7DA 1Z6HA 5IOCA 5D3DA 4R4TA 5FO8B 1ZYRD 4MIUA 4IFDI 3GV6A 4JI6L 4N9TA 4BY7B 3E9IA 2E8GA 2I0QA 4JI1L 4G57A 1NY4A 3SGIA 5JJIA 2AQ1B 1RHPA 3K5MA 4B3RQ 1J6QA 4PZ6A 2Z4IA 1TWGB 4HEDA 4O0AA 4JBKA 3GTLB 2Z0SA 4FF2A 4X64L 1KC8C 2DJGC 1H9SA 3G71A 2RDGA 1HPCA 2M00A 1X65A 2O2LD 4DV3Q 2AUJD 3NBHB 2VS1A 3UDXA 2CHBD 4KI0A 4LF5L 3CPFA 4U68A 1Q8IA 1Y1WH 2JQOA 3I70A 3MXGA 4CKCA 4C1NK 3CCEA 4ABNA 3NELA 4KHPQ 3OW7A 2J7ZA 4PMBA 2CH4W 5NUCA 1L0XB 3QG1A 3OOCA 5M5YH 4DV6L 1I3QB 1F2MA 1ICWA 3SEBA 4OX9Q 2K28A 4X66Q 2HT1A 2H4OA 2KCCA 5D3IB 1Q3LA 5E4XA 3S2DH 1BQQT 4G7HC 2Z4HA 1I4XA 4BS9A 2QKIC 1CKNA 2R7ZG 1RL2A 4Q0FA 4DUZL 3J81i 5IGDA 3JAMi 5CV8A 3I72A 4GNXC 3Q23A 3I90A 5JJZA 1E3PA 1WD1A 1N32Q 4B3TQ 2A68C 2PW5A 4ALPA 1TY0A 1Y69U 3OIPA 5CBEE 5LL6S 3MXPA 2B2UA 3I73A 2IX3A 3HS0C 4KHPL 1T5EA 2Z6KC 4MHEA 4KHZA 4GKJQ 4X3UA 1PRTB 3G4SA 4DV0L 5M5WB 2F03A 2Z1CA 3LWEA 3GTKB 1XTDA 1G91A 1VF5C 1QVGA 2GVAA 4IFDG 4QY7A 4DR6Q 3HKZE 5FO7B 2SEBD 2XIWA 4JV5L 5C0XJ 3OTOL 2YTYA 2NVTB 2VB2X 3V96A 1WTPA 2PCFB 2RKSA 3AYHB 1VQMA 2NVYH 2PYKA 1XNQL 2B63H 3E5SA 4JI3L 1RKNA 1JORA 4YIJA 1WTHA 1HR0W 1CZGA 2WB1E 3S16B 4GKKL 4GKJL 3PMFA 4YWMA 1TS2A 1JJGA 1EOTA 4DGZA 1GVPA 2CW0C 4F88A 1SR3A 2UXDQ 2YYZA 2D9UA 3PUZA 1CQFA 5CC4A 4DXGA 2NWGA 2R7ZB 5IYDH 1XNRL 4RGOS 4J6HA 1HTLD 5KYLA 1EFWA 1EZ8A 3SK6A 5C44G 2ZJPA 5CYUA 1DJRD 2B2VA 4DA2A 2D0OA 5EGTA 2RDHA 1QG7A 5GQOA 4KKUA 4Y7NB 1X32A 3A5ZB 1VQ9A 5M3MH 4I65A 2UXBQ 5JOBA 3HFZB 4C3JB 4DR4Q 2F0DA 1HCZA 5I9OA 4KMUC 1QZHA 2JYOA 5C5MA 1AFPA 4HJ8A 3L0OA 1Y14B 1QVCA 4KY6A 3ZJYC 1C9OA 2ZJRA 1IYJB 5C4ZA 3CRKC 4CDDC 3S1NB 4J8QA 1PH5A 1G291 3BYTB 1KIXA 4A3DG 1K3BC 1KLGD 2H1EA 2VZAA 2DJFC 1V1PA 1NUCA 3UI2A 1DM0B 4OELB 1MBYA 1VQ8A 3M7NA 5C3XA 2Q2IA 3UE1A 2UXBL 2GA4B 1E1TA 4RWSC 2PQAB 2JA9A 1E24A 2BA1A 1FGBD 1NR4A 2B3GA 4WORA 1EY9A 1JCKB 3DUZA 4UDUC 1N36Q 3F2UA 4DN4M 4OIJA 4F8MA 3TSSA 2HDMA 4QJFA 4FO2A
chains in the Genus database with same CATH topology
2V1CC 3S2HH 3CPWA 4OWTB 1KRTA 4LFAL 1MIUA 1X3FA 5GAGC 3L7ZC 3HOZG 3CQZH 2B29A 2I5LX 2JA7H 3D0FA 4JBJA 5AJ3L 1IBMQ 1O7IA 1EWIA 1NBWA 1IBKQ 1SROA 1FVIA 2R7FA 2CFMA 2R93G 4R4CA 3J81j 5M3FH 4PZ7A 4EQ5A 4JI4L 2L15A 3CCUA 4NXNL 4LF9L 2HHHL 3HOVH 2YTVA 4B3MQ 3T1YQ 4KLKA 1SMXA 2IX0A 3W1GA 4DK3C 4DR3Q 2JA5G 3CC4A 4TQUS 4OWXB 1K73C 2OCEA 1N34Q 1Z47A 4YCVA 3S1RH 1EIFA 4A3JG 3OTOQ 4X6AH 1B8AA 1N34L 5IYDG 3E0EA 3RLNA 2ZTDA 5H1SE 1KAWA 3I56A 2IX1A 3KDFA 2Y0SG 1YJNA 4LFCQ 3HOYG 4GOPA 1VQKA 3HOUG 1D8LA 4BBRH 4DV7L 3GTGH 2PQAA 1XPOA 2UUCL 1ASYA 3I7FA 1FJGL 4JG2A 2D62A 2K14A 4JI2Q 4A3MG 3GTPH 2K50A 4OXPA 3M85A 1QUQA 2VQFL 1PH7A 3I55A 1JT8A 4LUVA 1VQBA 2MQHA 1L0WA 3W1BA 3PIPA 1YHBA 2KENA 4DV0Q 4A3MH 3J80i 1GO3E 1G51A 3ICEA 1B7YB 5GADC 4GNXB 2B63G 4JYAQ 3PUWA 4WJ3M 2CQOA 1KXLA 1C0AA 4LF9Q 2I5HA 4JCVE 2VQEQ 2UXDL 1JB7A 3K8AA 1PH4A 3J80c 3CF5A 4JV5Q 3CW2C 3LGJA 3A5UA 1PH2A 4HIKA 4DR6L 1H95A 1E1OA 1IXRA 1UE5A 1WOCA 1GD7A 1JE5A 2VL6A 1PV4A 4LF6L 4YWLA 2JE6I 1A0IA 1PHJA 1L1OA 4A3IH 3U4ZA 3K7UC 1K0RA 3BZKA 2UUAQ 4JI7L 4GN4B 1V1QA 2JK8A 1J5EQ 2RF4A 4DR4L 4RG1A 1M90C 1P16A 5C4XG 4J15A 1AE3A 1UE6A 1TWHH 2OTJA 1EUJA 5C44H 3RZDH 2E2IH 2BH2A 3H15A 1A62A 2WAQE 5C4JH 3HOUH 3A0JA 4NPSA 1HNWQ 1VQFA 4LF7Q 2Y0SE 3H3VH 4DUZQ 1WJJA 1VQ6A 3KJOA 1HNWL 1Q86C 3KDFB 1YHQA 4YCUA 4BA1I 3FKIH 4DV1Q 4DR1L 1PVOA 2HQLA 3GO5A 3KF6B 1HR0Q 2F4VL 1XNRQ 4YY3Q 1VQCA 1NE3A 5FJ8G 3TS2A 1B70B 4NXML 4DPGA 1BVSA 4JI5Q 1U0LA 1SN8A 4A76A 4IPHA 4DK6C 1VQIA 4LFAQ 2ZM6Q 2JEBI 4BY7H 5M5WH 4C2MH 4P73A 2N49A 4UP8A 2K4KA 4P71A 1XPRA 1OXXK 3OW2A 1JJ2A 2ZJQA 3AFQA 3K81C 1RIPA 2EIFA 4LWCA 4DV6Q 1YJ9A 5IYCH 4DKAC 3M4OH 3Q8DA 4DR7L 4Y52H 4MNOA 1XMQQ 4EX5A 1ASZA 4JI6Q 5LMNQ 3RZOH 2CWPA 2LSSA 5GAHC 4AQYQ 4IJLA 3OYYA 3CC7A 4AQYL 1NMFA 3S1NH 4DV1L 4DR1Q 4B3ML 1R9TH 3BJUA 1N33Q 2E5LL 4L5SA 1I50H 4X65L 4LUZA 1PYSB 4A3LG 1Y1VH 1HZ9A 2IHEA 4A3KG 2E2HH 2WAQG 2GVBA 4HIMA 4X62L 2RCNA 4PG3A 1VQ7A 4IPGA 4A3EH 2UU9Q 1N32L 3H3VI 1T9HA 4XTCS 5HGQA 1BBWA 5C0XI 4DV4L 3T1HQ 2ASBA 1NTGA 1YHAA 2ALYB 5GAEC 1SLJA 5IYBG 3F2CA 4K0KL 2A19A 2A1AA 4C3JH 5JJKA 1LYLA 2OQ0A 3EBEA 5IP7H 3S14H 3GTOH 2BA0A 3CMEA 4BBSG 4QIWE 1DGSA 2HIXA 5AJ3Q 1VQ4A 3CD6A 4GKKQ 4C3HH 4HJ5A 5EAYA 4Y7NH 1VQ5A 2HHHQ 4A4IA 1VQHA 4L5QA 1PH6A 3J81c 1Q12A 3KF8B 3CXCA 4B3SL 3ULLA 4A3DH 1VQAA 3M9BA 1N33L 1OXSC 4YY3L 1MJEA 4UP9A 3M3YH 2K52A 3UDIA 5C3EG 1Y1VG 3M4PA 3MEFA 2KBNA 2JA8H 2R7ZH 3PUVA 3S1MH 5M3FG 4OO1G 5IP9G 1N9WA 2WFWA 5HY6A 2ZM6L 1EQQA 1VCIA 4FDBA 3GTJH 1PYBA 1YITA 3KYHC 4BY1H 5K36G 2DUDA 4HJ7A 1I5FA 1PH1A 3HOWG 3GTKH 1YBYA 3EIVA 1V9PA 3T1HL 2AWNA 4QL5A 4DV5Q 2K5VA 2JA6G 3U58A 1HNXL 5ELOA 3ER0A 1VQOA 4DV7Q 2VW9A 3GDEA 1AE2A 1Q8KA 4LW1A 4RMFA 3S24A 1YZ6A 4X64Q 1J5EL 3GTMH 2PMZE 3STBD 4DR2L 5DLQE 1WCMH 3K7AH 4YHHL 4JI4Q 4DV3L 1KHIA 1X6OA 1AH9A 4AH6A 1VQNA 4A3GH 4JI8Q 5IY0A 4DUYQ 2MO1A 5IT9c 2MFIA 2F52A 3D31A 4DV2Q 2JEAI 5LMNW 1V43A 3AFPA 4JI8L 5LMNL 5FLMH 4DUYL 1OXUA 1YEZA 1IL2A 4A3LH 3RLOA 4UY8C 3JAMc 4DR5L 4C3IH 4IPDA 1PA6A 3PO2G 4AYBE 1GKHA 4LF8L 4JI5L 3I4NH 1N36L 2CKZB 2XTIA 1KD1C 2C35B 1KL9A 3ERSX 3CCLA 2AHOB 1KQSA 1S72A 4YCWA 1XMOL 2UU9L 2F4VQ 4JI0L 2GN5A 5BR8L 2IY5B 1X9NA 3RN2A 3F2DA 4R1JA 2KCTA 3GTQH 4OX9L 3E9HA 2A8VA 3STBC 1EQRA 2JJQA 2K75A 1HH2P 3HOXH 3VDYA 5IE8A 1K3RA 2R7DA 1KRSA 3I4OA 2R6GA 4OO1I 4R4TA 2Q2UA 3U4VA 1SRUA 1YJWA 3KJPA 4IFDI 1X3EA 1HZBA 3PSIA 4AIMA 1XMQL 3W5OA 4JI6L 4IO9A 4JI1Q 3E9IA 1S3OA 4R4IA 2E8GA 4B3SQ 2I0QA 4JI1L 4IOCA 4MTNA 2N78A 5FLMG 1LTLA 1NY4A 4HJAA 3SGIA 3I4NG 3I4MG 1K8AC 2D0PA 4OONA 4TVAB 2QEXA 2MNAA 1HR0L 4B3RQ 5JJIA 4BY1G 1J6QA 4POGA 1MKHA 4PZ6A 4LFCL 2NN6G 5C3EH 2JA8G 1NMGA 2ATWA 3HOVG 3S1QH 2WB1G 5M3MG 1I94L 4O0AA 2AMCB 1L1OC 2MO0A 4MZ9A 4JBKA 2Z0SA 1CKNB 4UP7A 5C0XG 1XNQQ 4A3BH 1IBLL 2PI2A 1YIJA 4QQBX 4X64L 2VUMG 1LM0A 1TWAH 1KC8C 3PCOB 4L5TA 3G71A 2YU9H 4JI0Q 4A93G 4L5RC 1I6HH 4AYBG 1HNXQ 4DAYB 3HOXG 1X65A 4DNIA 3MXNB 5IP7G 3RNUA 2R92G 4DV3Q 4K0KQ 5IWAQ 3UE0A 3NBHB 4BBRG 2VNUD 2VS1A 3K80C 1HNZQ 3CCJA 4JOIA 1OXTA 3CCVA 3UDXA 3M4QA 4GOPB 1EOVA 1VQGA 4KI0A 4JBWA 1HZAA 1Q7YC 4JYAL 3HKSA 4DV2L 1TWGH 4LF5L 1IZ6A 1OTCA 4IOAA 3CPFA 3PO2H 3G48A 4O2DA 1N8RC 1Y1WH 2JQOA 1QVFA 1QUQB 4A3KH 2ZTEA 2ES2A 5GROA 1BBUA 4NXMQ 4YWKA 2RHQB 1BKBA 3CCEA 4B3TL 2ID0A 2R93H 1Q46A 1FJGQ 2ZTCA 2QGQA 3TS0A 3NELA 4KHPQ 2NVXH 3CMAA 3UDFA 4GNXA 3IRBA 1IBLQ 5M5YH 4XIGS 1CUKA 2XGTA 1CSQA 4DV6L 1JJCB 2AWOA 3K0XA 3TQYA 3U50C 4OX9Q 1VQEA 2IHFA 3AQQA 3PO3G 4X66Q 2HT1A 5JJLA 2KCMA 1CKOA 1L2FA 3BZCA 2H5XA 1G6PA 1P8LA 1E22A 2N8NA 2LXKA 4BA2I 3S2DH 1YNXA 2UUBL 3HOZH 3F2BA 1CKNA 2BH8A 1HNZL 3PGZA 1PH9A 4NXNQ 3J7A5 1VQPA 2R7ZG 2JA5H 1RL2A 1L1OB 4DUZL 1FL0A 1Q1BA 3J81i 1A63A 4HJ9A 3JAMi 1Y1WG 4GLAC 1QZGA 4DAMA 1TWFH 3S17H 4B3RL 4H02A 4POFA 4GNXC 3DM3A 3GD7A 1E3PA 3KLWA 4PZ8A 4X62Q 4IFDJ 2PI2E 4B3TQ 4ALPA 1S40A 1N32Q 1W3SA 4LFBL 3EN2A 3UDGA 4LF8Q 4LUOA 1GM5A 2LXJA 2NN6I 1UE7A 4R4QA 1Q81C 4KHPL 3JC66 2Z6KC 4A75A 1SFOH 1A8VA 2K5HA 4KHZA 1HZCA 2EQSA 3CCMA 1IBML 5IYBH 4GKJQ 2R92H 3KF6A 1I3QH 4IPCA 2EXDA 4ME3A 2VY3A 1U5KA 3G4SA 4DV0L 2Q2TA 1VS0A 4GLVB 3I2ZA 1OXVA 2VQFQ 1TWCH 1CSPA 4A3EG 4YHHQ 4NB3A 4JOIC 1XTDA 2E5LQ 5JEAG 4LF7L 3A74A 2N3SA 4A3IG 3PV0A 3H0GG 1QVGA 2YTXA 3L2PA 2GVAA 4IFDG 4A3BG 3CAMA 4QY7A 3ULJA 4GLXA 4DR6Q 2DGYA 2WP8J 3H0GH 3HKZE 3PF4A 4JV5L 4JC0A 5C0XJ 3OTOL 2YTYA 1YVCA 3RLFA 4X65Q 4DV4Q 1Q82C 4APVA 3I4MH 2IT1A 2CWAA 4PMWA 1UEBA 4GOPC 1YI2A 1M1KC 3RR5A 2UUCQ 1VQMA 3AYHB 4WJ4A 3FP9A 4X66L 2NVYH 4DV5L 4JI3Q 3S16H 2K5NA 1XNQL 2B63H 4A93H 5IWAL 1CKMA 3F1ZA 1VQDA 3NEMA 4JI3L 3CCSA 4JI2L 1HR0W 2UUBQ 2WB1E 4GKKL 4GKJL 2F3IA 4YWMA 3B6YA 1W2BA 4LF5Q 1PH3A 3FHWA 1JJGA 3PIOA 5J3BA 1D7QA 2JA6H 4R4OA 4A3FG 3GTLH 3T1YL 2NVTH 4DR7Q 1GVPA 1SR3A 1UE1A 2YYZA 2UXDQ 3PUZA 3RN5A 3TREA 4HIOA 4HIDA 3CP0A 2FXQA 4A3CG 1C7YA 5IYDH 1XNRL 4DR3L 2AKWB 2HIVA 1XJVA 1SE8A 3DLLA 1X55A 4LNQA 4A3GG 2UXCQ 1EFWA 2ZJPA 5C44G 5E7NA 3G6EA 3ULPA 3PUXA 2D0OA 1K9MC 1Z9FA 5GQOA 3WWVA 1K83H 1JMCA 3HKZG 4UPAA 3F8TA 1E7ZA 3A5ZB 1VQ9A 2YV5A 5M3MH 1WI5A 2UXBQ 1PFSA 4P75A 3HFZB 2OQKA 3NENA 1VQLA 2JA7G 4DR4Q 3S15H 4LF4Q 2NZHA 4P74A 1LUZA 1EIYB 3PO3H 3HOYH 2QA4A 5FJ8H 4P72A 2Q2HA 1QZHA 3KFUA 4HJ8A 3L0OA 3HOWH 5FLXc 3J7ZC 4A3CH 2Z6KA 3FKIG 1Y14B 1QVCA 3PUYA 5JEAJ 3TRZA 1Q1EA 3ZJYC 3PF5A 1C9OA 2PNHA 2ZJRA 1I94Q 1IYJB 3AEVA 4BXXG 2UXCL 4IJHA 2KHJA 1PH5A 4LF6Q 1G291 4LFBQ 5BR8Q 1KIXA 1EYGA 1X54A 2OTLA 4A3DG 2NVQH 1VQJA 3TEHB 2VZAA 4GN5A 4GN3B 1XMOQ 1MJCA 5C4XH 3CC2A 4BBSH 5LMUL 2I5MX 2UUAL 1VQ8A 1UWVA 4JBMA 4JI7Q 5LMUQ 3M7NA 1HJPA 4LF4L 4DR2Q 2Q2IA 3UE1A 3BU2A 2E2JH 2RHSB 1IBKL 2CCZA 5IYCG 2UXBL 5ELNA 4GS3A 1E1TA 4A3JH 1NJIC 1FGUA 1WFQA 3CCQA 1PH8A 1XPUA 2KHIA 1WYDA 2JA9A 1E24A 2BA1A 2PQAB 5M5XH 2B3GA 2VUMH 1N36Q 4BY7G 5IP9H 2OWOA 2VQEL 3CCRA 4A3FH 1TXYA 4QGUA 4DR5Q 2NZOA 4OWWB 3KOJA 1K8GA 1X3GA 4BXXH 1X56A 4QJFA 1WCMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1C C;  3S2H H;  3CPW A;  4OWT B;  1KRT A;  4LFA L;  1MIU A;  1X3F A;  5GAG C;  3L7Z C;  3HOZ G;  3CQZ H;  2B29 A;  2I5L X;  2JA7 H;  3D0F A;  4JBJ A;  5AJ3 L;  1IBM Q;  1O7I A;  1EWI A;  1NBW A;  1IBK Q;  1SRO A;  1FVI A;  2R7F A;  2CFM A;  2R93 G;  4R4C A;  3J81 j;  5M3F H;  4PZ7 A;  4EQ5 A;  4JI4 L;  2L15 A;  3CCU A;  4NXN L;  4LF9 L;  2HHH L;  3HOV H;  2YTV A;  4B3M Q;  3T1Y Q;  4KLK A;  1SMX A;  2IX0 A;  3W1G A;  4DK3 C;  4DR3 Q;  2JA5 G;  3CC4 A;  4TQU S;  4OWX B;  1K73 C;  2OCE A;  1N34 Q;  1Z47 A;  4YCV A;  3S1R H;  1EIF A;  4A3J G;  3OTO Q;  4X6A H;  1B8A A;  1N34 L;  5IYD G;  3E0E A;  3RLN A;  2ZTD A;  5H1S E;  1KAW A;  3I56 A;  2IX1 A;  3KDF A;  2Y0S G;  1YJN A;  4LFC Q;  3HOY G;  4GOP A;  1VQK A;  3HOU G;  1D8L A;  4BBR H;  4DV7 L;  3GTG H;  2PQA A;  1XPO A;  2UUC L;  1ASY A;  3I7F A;  1FJG L;  4JG2 A;  2D62 A;  2K14 A;  4JI2 Q;  4A3M G;  3GTP H;  2K50 A;  4OXP A;  3M85 A;  1QUQ A;  2VQF L;  1PH7 A;  3I55 A;  1JT8 A;  4LUV A;  1VQB A;  2MQH A;  1L0W A;  3W1B A;  3PIP A;  1YHB A;  2KEN A;  4DV0 Q;  4A3M H;  3J80 i;  1GO3 E;  1G51 A;  3ICE A;  1B7Y B;  5GAD C;  4GNX B;  2B63 G;  4JYA Q;  3PUW A;  4WJ3 M;  2CQO A;  1KXL A;  1C0A A;  4LF9 Q;  2I5H A;  4JCV E;  2VQE Q;  2UXD L;  1JB7 A;  3K8A A;  1PH4 A;  3J80 c;  3CF5 A;  4JV5 Q;  3CW2 C;  3LGJ A;  3A5U A;  1PH2 A;  4HIK A;  4DR6 L;  1H95 A;  1E1O A;  1IXR A;  1UE5 A;  1WOC A;  1GD7 A;  1JE5 A;  2VL6 A;  1PV4 A;  4LF6 L;  4YWL A;  2JE6 I;  1A0I A;  1PHJ A;  1L1O A;  4A3I H;  3U4Z A;  3K7U C;  1K0R A;  3BZK A;  2UUA Q;  4JI7 L;  4GN4 B;  1V1Q A;  2JK8 A;  1J5E Q;  2RF4 A;  4DR4 L;  4RG1 A;  1M90 C;  1P16 A;  5C4X G;  4J15 A;  1AE3 A;  1UE6 A;  1TWH H;  2OTJ A;  1EUJ A;  5C44 H;  3RZD H;  2E2I H;  2BH2 A;  3H15 A;  1A62 A;  2WAQ E;  5C4J H;  3HOU H;  3A0J A;  4NPS A;  1HNW Q;  1VQF A;  4LF7 Q;  2Y0S E;  3H3V H;  4DUZ Q;  1WJJ A;  1VQ6 A;  3KJO A;  1HNW L;  1Q86 C;  3KDF B;  1YHQ A;  4YCU A;  4BA1 I;  3FKI H;  4DV1 Q;  4DR1 L;  1PVO A;  2HQL A;  3GO5 A;  3KF6 B;  1HR0 Q;  2F4V L;  1XNR Q;  4YY3 Q;  1VQC A;  1NE3 A;  5FJ8 G;  3TS2 A;  1B70 B;  4NXM L;  4DPG A;  1BVS A;  4JI5 Q;  1U0L A;  1SN8 A;  4A76 A;  4IPH A;  4DK6 C;  1VQI A;  4LFA Q;  2ZM6 Q;  2JEB I;  4BY7 H;  5M5W H;  4C2M H;  4P73 A;  2N49 A;  4UP8 A;  2K4K A;  4P71 A;  1XPR A;  1OXX K;  3OW2 A;  1JJ2 A;  2ZJQ A;  3AFQ A;  3K81 C;  1RIP A;  2EIF A;  4LWC A;  4DV6 Q;  1YJ9 A;  5IYC H;  4DKA C;  3M4O H;  3Q8D A;  4DR7 L;  4Y52 H;  4MNO A;  1XMQ Q;  4EX5 A;  1ASZ A;  4JI6 Q;  5LMN Q;  3RZO H;  2CWP A;  2LSS A;  5GAH C;  4AQY Q;  4IJL A;  3OYY A;  3CC7 A;  4AQY L;  1NMF A;  3S1N H;  4DV1 L;  4DR1 Q;  4B3M L;  1R9T H;  3BJU A;  1N33 Q;  2E5L L;  4L5S A;  1I50 H;  4X65 L;  4LUZ A;  1PYS B;  4A3L G;  1Y1V H;  1HZ9 A;  2IHE A;  4A3K G;  2E2H H;  2WAQ G;  2GVB A;  4HIM A;  4X62 L;  2RCN A;  4PG3 A;  1VQ7 A;  4IPG A;  4A3E H;  2UU9 Q;  1N32 L;  3H3V I;  1T9H A;  4XTC S;  5HGQ A;  1BBW A;  5C0X I;  4DV4 L;  3T1H Q;  2ASB A;  1NTG A;  1YHA A;  2ALY B;  5GAE C;  1SLJ A;  5IYB G;  3F2C A;  4K0K L;  2A19 A;  2A1A A;  4C3J H;  5JJK A;  1LYL A;  2OQ0 A;  3EBE A;  5IP7 H;  3S14 H;  3GTO H;  2BA0 A;  3CME A;  4BBS G;  4QIW E;  1DGS A;  2HIX A;  5AJ3 Q;  1VQ4 A;  3CD6 A;  4GKK Q;  4C3H H;  4HJ5 A;  5EAY A;  4Y7N H;  1VQ5 A;  2HHH Q;  4A4I A;  1VQH A;  4L5Q A;  1PH6 A;  3J81 c;  1Q12 A;  3KF8 B;  3CXC A;  4B3S L;  3ULL A;  4A3D H;  1VQA A;  3M9B A;  1N33 L;  1OXS C;  4YY3 L;  1MJE A;  4UP9 A;  3M3Y H;  2K52 A;  3UDI A;  5C3E G;  1Y1V G;  3M4P A;  3MEF A;  2KBN A;  2JA8 H;  2R7Z H;  3PUV A;  3S1M H;  5M3F G;  4OO1 G;  5IP9 G;  1N9W A;  2WFW A;  5HY6 A;  2ZM6 L;  1EQQ A;  1VCI A;  4FDB A;  3GTJ H;  1PYB A;  1YIT A;  3KYH C;  4BY1 H;  5K36 G;  2DUD A;  4HJ7 A;  1I5F A;  1PH1 A;  3HOW G;  3GTK H;  1YBY A;  3EIV A;  1V9P A;  3T1H L;  2AWN A;  4QL5 A;  4DV5 Q;  2K5V A;  2JA6 G;  3U58 A;  1HNX L;  5ELO A;  3ER0 A;  1VQO A;  4DV7 Q;  2VW9 A;  3GDE A;  1AE2 A;  1Q8K A;  4LW1 A;  4RMF A;  3S24 A;  1YZ6 A;  4X64 Q;  1J5E L;  3GTM H;  2PMZ E;  3STB D;  4DR2 L;  5DLQ E;  1WCM H;  3K7A H;  4YHH L;  4JI4 Q;  4DV3 L;  1KHI A;  1X6O A;  1AH9 A;  4AH6 A;  1VQN A;  4A3G H;  4JI8 Q;  5IY0 A;  4DUY Q;  2MO1 A;  5IT9 c;  2MFI A;  2F52 A;  3D31 A;  4DV2 Q;  2JEA I;  5LMN W;  1V43 A;  3AFP A;  4JI8 L;  5LMN L;  5FLM H;  4DUY L;  1OXU A;  1YEZ A;  1IL2 A;  4A3L H;  3RLO A;  4UY8 C;  3JAM c;  4DR5 L;  4C3I H;  4IPD A;  1PA6 A;  3PO2 G;  4AYB E;  1GKH A;  4LF8 L;  4JI5 L;  3I4N H;  1N36 L;  2CKZ B;  2XTI A;  1KD1 C;  2C35 B;  1KL9 A;  3ERS X;  3CCL A;  2AHO B;  1KQS A;  1S72 A;  4YCW A;  1XMO L;  2UU9 L;  2F4V Q;  4JI0 L;  2GN5 A;  5BR8 L;  2IY5 B;  1X9N A;  3RN2 A;  3F2D A;  4R1J A;  2KCT A;  3GTQ H;  4OX9 L;  3E9H A;  2A8V A;  3STB C;  1EQR A;  2JJQ A;  2K75 A;  1HH2 P;  3HOX H;  3VDY A;  5IE8 A;  1K3R A;  2R7D A;  1KRS A;  3I4O A;  2R6G A;  4OO1 I;  4R4T A;  2Q2U A;  3U4V A;  1SRU A;  1YJW A;  3KJP A;  4IFD I;  1X3E A;  1HZB A;  3PSI A;  4AIM A;  1XMQ L;  3W5O A;  4JI6 L;  4IO9 A;  4JI1 Q;  3E9I A;  1S3O A;  4R4I A;  2E8G A;  4B3S Q;  2I0Q A;  4JI1 L;  4IOC A;  4MTN A;  2N78 A;  5FLM G;  1LTL A;  1NY4 A;  4HJA A;  3SGI A;  3I4N G;  3I4M G;  1K8A C;  2D0P A;  4OON A;  4TVA B;  2QEX A;  2MNA A;  1HR0 L;  4B3R Q;  5JJI A;  4BY1 G;  1J6Q A;  4POG A;  1MKH A;  4PZ6 A;  4LFC L;  2NN6 G;  5C3E H;  2JA8 G;  1NMG A;  2ATW A;  3HOV G;  3S1Q H;  2WB1 G;  5M3M G;  1I94 L;  4O0A A;  2AMC B;  1L1O C;  2MO0 A;  4MZ9 A;  4JBK A;  2Z0S A;  1CKN B;  4UP7 A;  5C0X G;  1XNQ Q;  4A3B H;  1IBL L;  2PI2 A;  1YIJ A;  4QQB X;  4X64 L;  2VUM G;  1LM0 A;  1TWA H;  1KC8 C;  3PCO B;  4L5T A;  3G71 A;  2YU9 H;  4JI0 Q;  4A93 G;  4L5R C;  1I6H H;  4AYB G;  1HNX Q;  4DAY B;  3HOX G;  1X65 A;  4DNI A;  3MXN B;  5IP7 G;  3RNU A;  2R92 G;  4DV3 Q;  4K0K Q;  5IWA Q;  3UE0 A;  3NBH B;  4BBR G;  2VNU D;  2VS1 A;  3K80 C;  1HNZ Q;  3CCJ A;  4JOI A;  1OXT A;  3CCV A;  3UDX A;  3M4Q A;  4GOP B;  1EOV A;  1VQG A;  4KI0 A;  4JBW A;  1HZA A;  1Q7Y C;  4JYA L;  3HKS A;  4DV2 L;  1TWG H;  4LF5 L;  1IZ6 A;  1OTC A;  4IOA A;  3CPF A;  3PO2 H;  3G48 A;  4O2D A;  1N8R C;  1Y1W H;  2JQO A;  1QVF A;  1QUQ B;  4A3K H;  2ZTE A;  2ES2 A;  5GRO A;  1BBU A;  4NXM Q;  4YWK A;  2RHQ B;  1BKB A;  3CCE A;  4B3T L;  2ID0 A;  2R93 H;  1Q46 A;  1FJG Q;  2ZTC A;  2QGQ A;  3TS0 A;  3NEL A;  4KHP Q;  2NVX H;  3CMA A;  3UDF A;  4GNX A;  3IRB A;  1IBL Q;  5M5Y H;  4XIG S;  1CUK A;  2XGT A;  1CSQ A;  4DV6 L;  1JJC B;  2AWO A;  3K0X A;  3TQY A;  3U50 C;  4OX9 Q;  1VQE A;  2IHF A;  3AQQ A;  3PO3 G;  4X66 Q;  2HT1 A;  5JJL A;  2KCM A;  1CKO A;  1L2F A;  3BZC A;  2H5X A;  1G6P A;  1P8L A;  1E22 A;  2N8N A;  2LXK A;  4BA2 I;  3S2D H;  1YNX A;  2UUB L;  3HOZ H;  3F2B A;  1CKN A;  2BH8 A;  1HNZ L;  3PGZ A;  1PH9 A;  4NXN Q;  3J7A 5;  1VQP A;  2R7Z G;  2JA5 H;  1RL2 A;  1L1O B;  4DUZ L;  1FL0 A;  1Q1B A;  3J81 i;  1A63 A;  4HJ9 A;  3JAM i;  1Y1W G;  4GLA C;  1QZG A;  4DAM A;  1TWF H;  3S17 H;  4B3R L;  4H02 A;  4POF A;  4GNX C;  3DM3 A;  3GD7 A;  1E3P A;  3KLW A;  4PZ8 A;  4X62 Q;  4IFD J;  2PI2 E;  4B3T Q;  4ALP A;  1S40 A;  1N32 Q;  1W3S A;  4LFB L;  3EN2 A;  3UDG A;  4LF8 Q;  4LUO A;  1GM5 A;  2LXJ A;  2NN6 I;  1UE7 A;  4R4Q A;  1Q81 C;  4KHP L;  3JC6 6;  2Z6K C;  4A75 A;  1SFO H;  1A8V A;  2K5H A;  4KHZ A;  1HZC A;  2EQS A;  3CCM A;  1IBM L;  5IYB H;  4GKJ Q;  2R92 H;  3KF6 A;  1I3Q H;  4IPC A;  2EXD A;  4ME3 A;  2VY3 A;  1U5K A;  3G4S A;  4DV0 L;  2Q2T A;  1VS0 A;  4GLV B;  3I2Z A;  1OXV A;  2VQF Q;  1TWC H;  1CSP A;  4A3E G;  4YHH Q;  4NB3 A;  4JOI C;  1XTD A;  2E5L Q;  5JEA G;  4LF7 L;  3A74 A;  2N3S A;  4A3I G;  3PV0 A;  3H0G G;  1QVG A;  2YTX A;  3L2P A;  2GVA A;  4IFD G;  4A3B G;  3CAM A;  4QY7 A;  3ULJ A;  4GLX A;  4DR6 Q;  2DGY A;  2WP8 J;  3H0G H;  3HKZ E;  3PF4 A;  4JV5 L;  4JC0 A;  5C0X J;  3OTO L;  2YTY A;  1YVC A;  3RLF A;  4X65 Q;  4DV4 Q;  1Q82 C;  4APV A;  3I4M H;  2IT1 A;  2CWA A;  4PMW A;  1UEB A;  4GOP C;  1YI2 A;  1M1K C;  3RR5 A;  2UUC Q;  1VQM A;  3AYH B;  4WJ4 A;  3FP9 A;  4X66 L;  2NVY H;  4DV5 L;  4JI3 Q;  3S16 H;  2K5N A;  1XNQ L;  2B63 H;  4A93 H;  5IWA L;  1CKM A;  3F1Z A;  1VQD A;  3NEM A;  4JI3 L;  3CCS A;  4JI2 L;  1HR0 W;  2UUB Q;  2WB1 E;  4GKK L;  4GKJ L;  2F3I A;  4YWM A;  3B6Y A;  1W2B A;  4LF5 Q;  1PH3 A;  3FHW A;  1JJG A;  3PIO A;  5J3B A;  1D7Q A;  2JA6 H;  4R4O A;  4A3F G;  3GTL H;  3T1Y L;  2NVT H;  4DR7 Q;  1GVP A;  1SR3 A;  1UE1 A;  2YYZ A;  2UXD Q;  3PUZ A;  3RN5 A;  3TRE A;  4HIO A;  4HID A;  3CP0 A;  2FXQ A;  4A3C G;  1C7Y A;  5IYD H;  1XNR L;  4DR3 L;  2AKW B;  2HIV A;  1XJV A;  1SE8 A;  3DLL A;  1X55 A;  4LNQ A;  4A3G G;  2UXC Q;  1EFW A;  2ZJP A;  5C44 G;  5E7N A;  3G6E A;  3ULP A;  3PUX A;  2D0O A;  1K9M C;  1Z9F A;  5GQO A;  3WWV A;  1K83 H;  1JMC A;  3HKZ G;  4UPA A;  3F8T A;  1E7Z A;  3A5Z B;  1VQ9 A;  2YV5 A;  5M3M H;  1WI5 A;  2UXB Q;  1PFS A;  4P75 A;  3HFZ B;  2OQK A;  3NEN A;  1VQL A;  2JA7 G;  4DR4 Q;  3S15 H;  4LF4 Q;  2NZH A;  4P74 A;  1LUZ A;  1EIY B;  3PO3 H;  3HOY H;  2QA4 A;  5FJ8 H;  4P72 A;  2Q2H A;  1QZH A;  3KFU A;  4HJ8 A;  3L0O A;  3HOW H;  5FLX c;  3J7Z C;  4A3C H;  2Z6K A;  3FKI G;  1Y14 B;  1QVC A;  3PUY A;  5JEA J;  3TRZ A;  1Q1E A;  3ZJY C;  3PF5 A;  1C9O A;  2PNH A;  2ZJR A;  1I94 Q;  1IYJ B;  3AEV A;  4BXX G;  2UXC L;  4IJH A;  2KHJ A;  1PH5 A;  4LF6 Q;  1G29 1;  4LFB Q;  5BR8 Q;  1KIX A;  1EYG A;  1X54 A;  2OTL A;  4A3D G;  2NVQ H;  1VQJ A;  3TEH B;  2VZA A;  4GN5 A;  4GN3 B;  1XMO Q;  1MJC A;  5C4X H;  3CC2 A;  4BBS H;  5LMU L;  2I5M X;  2UUA L;  1VQ8 A;  1UWV A;  4JBM A;  4JI7 Q;  5LMU Q;  3M7N A;  1HJP A;  4LF4 L;  4DR2 Q;  2Q2I A;  3UE1 A;  3BU2 A;  2E2J H;  2RHS B;  1IBK L;  2CCZ A;  5IYC G;  2UXB L;  5ELN A;  4GS3 A;  1E1T A;  4A3J H;  1NJI C;  1FGU A;  1WFQ A;  3CCQ A;  1PH8 A;  1XPU A;  2KHI A;  1WYD A;  2JA9 A;  1E24 A;  2BA1 A;  2PQA B;  5M5X H;  2B3G A;  2VUM H;  1N36 Q;  4BY7 G;  5IP9 H;  2OWO A;  2VQE L;  3CCR A;  4A3F H;  1TXY A;  4QGU A;  4DR5 Q;  2NZO A;  4OWW B;  3KOJ A;  1K8G A;  1X3G A;  4BXX H;  1X56 A;  4QJF A;  1WCM G; 
#chains in the Genus database with same CATH topology
 3SK5 A;  3D3R A;  1MIU A;  4RHS A;  1HA6 A;  2HDL A;  1S5D D;  2NTS A;  2SDF A;  1HHV A;  2PQE A;  5C44 B;  1EY5 A;  3D0F A;  2SOB A;  3RMH A;  1EWI A;  1SNO A;  1FVI A;  2R7F A;  3OSO A;  1EQT A;  1H9M A;  4PZ7 A;  5M3F H;  3ND8 A;  3K57 A;  3VR3 A;  2HHH L;  3K59 A;  4KLK A;  4KKS A;  3W1G A;  4HCE A;  1VDZ A;  4FNF A;  4XT3 B;  3VR6 A;  3CC4 A;  5T1I A;  1EY8 A;  4CDE C;  3FPP A;  3SVM A;  1F9S A;  5EQ0 A;  5IYD G;  4CKE A;  1KAW A;  4QCL A;  1U4R A;  3KBG A;  1RD9 D;  3D4R A;  3K5L A;  3GTG H;  2K04 A;  2UUC L;  2A74 C;  1FJG L;  4JG2 A;  1DZ1 A;  3D6C A;  3CU7 A;  4J1M A;  1JT8 A;  3MC0 B;  3PIP A;  3W1B A;  5IGB A;  3J80 i;  2R93 B;  1QCB D;  2AQ2 B;  4WRD A;  4GNX B;  4JYA Q;  1O7Z A;  4HMI A;  5COR A;  2Z6B A;  1UNS A;  2VQE Q;  1PH4 A;  4JV5 Q;  3A5U A;  1PH2 A;  3I4N B;  3IAY A;  3FEW X;  1UE5 A;  2X69 A;  1F9Q A;  2WAC A;  3HOV B;  4B08 A;  2XN9 C;  1A0I A;  1EIG A;  2BE5 C;  1L1O A;  3K7A B;  3K7U C;  3FDT A;  3D8G A;  4GN4 B;  2A6H D;  3J81 E;  1PTO H;  1E2Z A;  4C56 C;  1QOH A;  1TWH B;  2F3V A;  2RF4 A;  3C2P A;  1K8M A;  1M90 C;  1P16 A;  1AE3 A;  1EUJ A;  1BR9 A;  3RZD H;  1PTO B;  5CV9 A;  3KK7 A;  5FO9 B;  5FKA C;  4LF7 Q;  1HNW Q;  4DUZ Q;  3L9A X;  1VQ6 A;  5JPM C;  2VXW A;  2K7V A;  2PZT A;  3M4Y A;  1YHQ A;  4YCU A;  3I4M B;  3KF6 B;  2JA8 B;  2I07 B;  1XNR Q;  5JVH 3;  1PTO F;  4YY3 Q;  1DD2 A;  3HGB A;  1BVS A;  1WTO A;  1EYC A;  1SN8 A;  5JVG 3;  4BY7 H;  1G8Z D;  4UP8 A;  2G5D A;  3HZX A;  1EIH A;  1PRT C;  3AFQ A;  1RIP A;  4LWC A;  1U4M A;  5IYC H;  2B2Y A;  4DKA C;  4DR7 L;  4LJZ C;  2HCC A;  3H3V C;  3RZO H;  2CWP A;  3OMC A;  1NMF A;  4K2K A;  4DV1 L;  3BJU A;  2KOL A;  2B8G A;  1FYC A;  1ML0 D;  1NSN S;  1CT1 D;  4H7B A;  1HZ9 A;  4A3K G;  2WAQ G;  3K58 A;  4RGN A;  2F3W A;  3HOW B;  3TP5 A;  2UU9 Q;  2JSO A;  1FD7 D;  3IKJ A;  2L12 A;  3HRZ C;  3T1H Q;  2OXP A;  1B4O A;  2ALY B;  3VA5 A;  4K0K L;  5EBD A;  5LHY 1;  2BOS A;  5KRU A;  3CME A;  2MP1 A;  1DGS A;  2HIX A;  1VQ4 A;  1PMR A;  5A2Q L;  1ILQ A;  2QCP X;  4L5Q A;  1PH6 A;  1Q12 A;  2PMZ B;  2B2Y C;  4A3D H;  4BY1 B;  1MJE A;  3M3Y H;  2K52 A;  3P75 A;  2NN6 H;  1Y1V G;  2A6E C;  3MEF A;  2KBN A;  5TSS A;  3PUV A;  2RCF A;  1IW7 C;  5IP9 G;  2ZT9 C;  1BNZ A;  1Q90 A;  3LNN A;  5E1F A;  1VCI A;  4RHR A;  4HJ7 A;  1I5F A;  1EYD A;  4QB4 A;  3GTK H;  1YBY A;  2EYH A;  4DV5 Q;  1S5F D;  3U58 A;  2JA6 G;  3R3O A;  2L55 A;  5ELO A;  1PZK D;  1VQO A;  5BN3 A;  1EY4 A;  1V1O A;  4RGM A;  3GDE A;  1AE2 A;  4RMF A;  3GTM H;  5J22 A;  2YU9 B;  4DR2 L;  3OMG A;  1B2T A;  4DV3 L;  2EDG A;  1X6O A;  2M9V A;  1AH9 A;  1MD2 D;  5D14 A;  4DUY Q;  2MFI A;  4CBV A;  1F77 A;  5LMN L;  4A3L H;  3RLO A;  1V1P B;  2E2H B;  1F2Z A;  4DR5 L;  3NQT A;  3I4N H;  3SR1 A;  1R9T B;  5HUR A;  1STA A;  2CKZ B;  2XTI A;  1XXG A;  3CCL A;  4L6T B;  2AQ3 B;  2IL8 A;  4YCW A;  2F4V Q;  5BR8 L;  4IZ8 A;  1X9N A;  3RN2 A;  1STE A;  3Q24 A;  1TS3 A;  4KD3 A;  3HOX H;  3NBI A;  1JWU D;  2R6G A;  2EYL A;  2QDB A;  2R61 A;  2Q2U A;  3U4V A;  1ENF A;  1X3E A;  4LAA A;  3W5O A;  4JI1 Q;  1A2U A;  4R4I A;  2QEJ C;  1D1K A;  2F0K A;  4K14 A;  4MTN A;  1BDO A;  4TVA B;  4DU9 A;  4HSV A;  4POG A;  1MKH A;  3P20 A;  2NN6 G;  3QR8 A;  4FF3 A;  3A7L A;  3FKI B;  4MZ9 A;  1CKN B;  5F2D A;  1IBL L;  2PI2 A;  4QQB X;  1TWA H;  3PCO B;  2NYZ D;  4A93 G;  2YU9 H;  1I6H H;  2JA7 B;  4AYB G;  3NTH A;  1HNX Q;  3HOX G;  1ICF B;  4IUT A;  3BVZ A;  2O4X A;  5IWA Q;  4A3B B;  1HNZ Q;  4DR4 L;  1OXT A;  1HZA A;  1STY A;  1TWG H;  1IZ6 A;  3PO2 H;  1I4H A;  1N8R C;  1DCZ A;  4Z9C B;  4HTH A;  1QUQ B;  4A3K H;  5GRO A;  1QWY A;  3T13 A;  4A3D B;  3P7J A;  2R93 H;  1Q46 A;  1FJG Q;  2ZTC A;  1S5B D;  2QGQ A;  3SE0 A;  2E2J B;  1ILP A;  3UDF A;  4GNX A;  1WTX A;  1IBL Q;  2G9H D;  1CUK A;  3GTP B;  3MZ5 A;  3K0X A;  3TQY A;  3U50 C;  3AQQ A;  2HD3 A;  1E2W A;  2IHF A;  2KVM A;  2IPK D;  2H5X A;  2E74 C;  4FVM A;  2J4X A;  4MN3 A;  3F2B A;  2BH8 A;  1HNZ L;  3PGZ A;  4O42 A;  1L1O B;  1Q1B A;  1H9S B;  4HJ9 A;  5HGT A;  1G6Z A;  4H02 A;  4POF A;  3GD7 A;  2F0U A;  4LFB L;  4CHT B;  5M3F B;  1CA6 A;  2FFK B;  1LTI D;  4LUO A;  3JAM L;  1GM5 A;  4LK1 C;  3S15 B;  1UE7 A;  4R4Q A;  4A75 A;  1SFO H;  3VYT A;  1A8V A;  1HZC A;  2EQS A;  1IBM L;  5IYB H;  3H6M A;  1K83 B;  1U5K A;  1E2V A;  1VS0 A;  4GLV B;  3TDQ A;  4YHH Q;  1MI2 A;  2E5L Q;  3CRL C;  4IN3 A;  2PZU A;  3H0G G;  1GUG A;  4GLX A;  2DGY A;  1F2Y A;  1Y8P B;  4JC0 A;  2MPM A;  3VR5 A;  4MTK A;  3RLF A;  4DV4 Q;  3I4M H;  4APV A;  2JA6 B;  5EJW A;  2TSS A;  2K32 A;  1I4P A;  3R2T A;  2KA7 A;  3FP9 A;  1J8I A;  4X66 L;  1O78 A;  4JI3 Q;  3S16 H;  3J80 L;  1CKM A;  3GTM B;  3NEM A;  3CCS A;  1SJH D;  3G7L A;  4CDF C;  1W2B A;  1PH3 A;  2IW3 A;  5EKK A;  5J3B A;  1D7Q A;  2EOT A;  5CV5 A;  3T1Y L;  4DR7 Q;  1MGS A;  2HCI A;  4QF4 A;  2SNS A;  1Y8N B;  1UE1 A;  3BDC A;  3QIA A;  1FR3 A;  4HIO A;  4HID A;  3CP0 A;  4RFB A;  2F0E A;  2FXQ A;  4ULL A;  3BDL A;  2HIV A;  2JN4 A;  4ME5 A;  4LNQ A;  1LTB D;  2I46 A;  1SNM A;  3EFX D;  3GP7 A;  5E7N A;  4QUF A;  4KTA A;  1LTT D;  1K83 H;  3KF8 A;  3HOY B;  3HKZ G;  4UPA A;  3F8T A;  1E7Z A;  1S4Z A;  3GTO B;  3QB3 A;  1PFS A;  2NB0 A;  3S15 H;  4LF4 Q;  3HOY H;  4HR7 B;  2Q2H A;  2K1B A;  3V05 A;  3QO2 A;  3S17 B;  1HTP A;  5KYI A;  4A3C H;  3FKI G;  3NWT A;  4IUN A;  3PF5 A;  1SND A;  5IIF A;  2MJ8 A;  1KDC A;  3AEV A;  1YNN D;  4XDX A;  4K5X A;  2UXC L;  1EEI D;  4LFB Q;  2NVQ H;  3TEH B;  1XMO Q;  4GN3 B;  4I7A A;  5ISR A;  5KEE A;  1LTR D;  3M4O B;  1XYI A;  2I5M X;  1A3U A;  1UWV A;  1HJP A;  4CKB A;  3J80 E;  5ELD A;  5M5Y B;  2E2J H;  2RHS B;  1IBK L;  2JP1 A;  2L0C A;  5ELN A;  1NJI C;  4A3J H;  3CCQ A;  1PH8 A;  1PXU A;  2KHI A;  2QF7 A;  5M5X H;  4IUQ A;  4BY7 G;  2OWO A;  1R4P B;  1RJT A;  2VQE L;  2B2W C;  4OWW B;  3KOJ A;  3L3O C;  1DXM A;  1IL8 A;  1X56 A;  1EWH A;  4B9W A;  5JEA H;  1Y8O B;  4BXX H;  1G6P A;  3S2H H;  4UAI A;  3CPW A;  1SE4 A;  1X3F A;  3L7Z C;  3HOZ G;  4C3H B;  2J0T D;  1IKM A;  2B29 A;  3ITP A;  2I5L X;  1QNU A;  4X3S A;  1B1Z A;  2DY8 A;  3MTS A;  4HN7 A;  4OGQ C;  2R3Z A;  1M8A A;  2R93 G;  2AUK A;  4JI4 L;  4EQ5 A;  4ZUJ A;  3CCU A;  3HOV H;  2YTV A;  3T1Y Q;  3KLR A;  4DK3 C;  1ET9 A;  3V2T A;  4X3K A;  4ODG A;  4DAY A;  4DR3 Q;  4RCO A;  2JA5 G;  3VR2 A;  4TQU S;  4OWX B;  3U9O A;  2OCE A;  3NBH A;  4YCV A;  4A3J G;  1AN8 A;  3OTO Q;  2M2L A;  1TT2 A;  1QB5 D;  1N34 L;  3MXN A;  5H1S E;  3DM1 A;  3I56 A;  3OPO A;  3E6Z X;  1DOM A;  4ZK9 B;  1MSG A;  1XPO A;  1PLF A;  3FVQ A;  3HP3 A;  3I7F A;  2D62 A;  1ZEQ X;  4JI2 Q;  4A3M G;  4QUC A;  2MHV A;  3SK4 A;  4UHV A;  4OXP A;  4NP5 A;  3M85 A;  1QUQ A;  2MQH A;  1YHB A;  1QNK A;  3DEO A;  1G51 A;  2PNR C;  2PO4 A;  4XQQ A;  1WTR A;  3PUW A;  5FK9 C;  1QIL A;  5T1G A;  1KXL A;  1C0A A;  4P2C B;  4C3I B;  3BVG A;  2UXD L;  2EYP A;  4A3F B;  3WDN A;  1IXR A;  2WII B;  1WOC A;  3A54 A;  1GD7 A;  1JE5 A;  1FNW A;  5EBC A;  1D1I A;  5CBA E;  4U67 3;  4DXF A;  2UUA Q;  4JI7 L;  3R2I A;  2JK8 A;  3J7A V;  2B2W A;  1C48 A;  1UE6 A;  2CH4 A;  5C44 H;  3OWF A;  1TU2 B;  1EU4 A;  4AYB B;  1A62 A;  1UUP A;  5C4J H;  2Y0S E;  1B3Q A;  1QE6 A;  3KJO A;  1LO5 D;  1Q86 C;  4IQZ A;  2F0H A;  5LL6 X;  3FKI H;  1SYE A;  1D5X C;  2KHS A;  4IUP A;  2EY5 A;  1HR0 Q;  2C5C A;  3J7Y W;  2O5I C;  1VMP A;  1NE3 A;  3MHB A;  5FJ8 G;  1B70 B;  2DY7 A;  4NXM L;  4WFN 3;  1U0L A;  4IPH A;  2X6G A;  2ZXP A;  2ZM6 Q;  5M5W H;  1JOQ A;  2K33 A;  5G3L F;  2K4K A;  4KN7 C;  4P71 A;  3EA6 A;  1OXX K;  3W3A A;  3K81 C;  1YJ9 A;  3S14 B;  4M8A A;  3KBX A;  3VYS A;  1A15 A;  4PV1 C;  2LSS A;  2QW7 A;  4IJL A;  1ENC A;  1DOL A;  2ZXR A;  2A69 C;  3S1N H;  4DR1 Q;  2E5L L;  1XTC D;  4LUZ A;  1PYS B;  1Y1V B;  4RKL A;  3C1E A;  3I3C A;  4DFA A;  1PDQ A;  4ZLT F;  2GVB A;  4ZQ3 A;  4HIM A;  5DNF A;  4X62 L;  1U9R A;  3RZO B;  1JOO A;  1WTV A;  3H3V I;  1T9H A;  3OWE B;  4XTC S;  5HGQ A;  4DV4 L;  3VYR A;  2ASB A;  5GAE C;  1D6E C;  1YHA A;  3PO3 B;  2KUM A;  2A1A A;  4C3J H;  3JAM E;  1AZP A;  2OQ0 A;  2XWB B;  2E76 C;  4QIW E;  4G7Z C;  4Y7N H;  4EQO A;  3TME A;  5K5P A;  2EYO A;  4R8N A;  3ULL A;  4OO1 H;  1N33 L;  1KLU D;  2EJM A;  4YY3 L;  1D5Z C;  4UP9 A;  3UDI A;  1GUS A;  2R7Z H;  1EY6 A;  3S1M H;  2F0G A;  5M3F G;  3QJY A;  3H09 A;  1SNC A;  2WFW A;  4XYQ A;  5HY6 A;  5I9P A;  4RA8 A;  2WIN B;  3NQI A;  1YIT A;  4BY1 H;  4E6I A;  3HOW G;  1A6X A;  3EIV A;  1V9P A;  4QL5 A;  2K5V A;  4QIW B;  4PNY A;  1V8Q A;  4HMJ A;  5A2Q E;  2VW9 A;  2WV6 D;  1CTM A;  1Q8K A;  2BE5 D;  3S24 A;  1S5E D;  4PQX A;  1PYW D;  3STB D;  3K7A H;  4JI4 Q;  1VQN A;  3A8K E;  5IT9 c;  3QOJ A;  4XYO A;  5LMN W;  5C0X H;  4JI8 L;  1JQY D;  2F0J A;  3D6W A;  5FLM H;  1TWF B;  1YEZ A;  4UY8 C;  3JAM c;  1G2S A;  4JI5 L;  3EJI A;  3SXH A;  2B2U C;  2MGS A;  2AHO B;  1S5C D;  2F0N A;  1KQS A;  1S72 A;  1XMO L;  4FYD A;  3T4A C;  2PPB C;  2IY5 B;  3BDO A;  1C8C A;  1CHP D;  2A8V A;  4JPB W;  3STB C;  1BCP D;  4ZYS A;  1HH2 P;  3VDY A;  5IE8 A;  5CR3 A;  5C6A A;  1YJW A;  1SYG A;  1WVL A;  2Z9H A;  1HZB A;  1BUV T;  4NKL A;  3SDZ A;  3MWY W;  1EZ6 A;  3BG3 A;  1S3O A;  3S1R B;  4B3S Q;  2F4I A;  4TRD A;  1HQM C;  4JVZ A;  5FLM G;  3I4N G;  4HJA A;  3HG9 A;  1K8A C;  2QEX A;  2MNA A;  1AZQ A;  2JA8 G;  4DNT B;  3HOV G;  2ATW A;  3S1Q H;  2JA5 B;  2WB1 G;  1I94 L;  2RQX A;  1XNQ Q;  5C0X G;  4A3B H;  1KDA A;  2CQA A;  1YIJ A;  4OIK A;  3S2D B;  5C5L A;  2VUM G;  4KK7 A;  5IGF A;  4L5T A;  1ZYR C;  4DAY B;  4K5W A;  2B2T C;  2ZXO A;  1BCP B;  3K6O A;  3K80 C;  3CCJ A;  1E0B A;  3M4Q A;  1EOV A;  3IFD A;  1Q7Y C;  2N55 A;  4JYA L;  4LMQ D;  4R8I A;  1KNA A;  4IOA A;  3A8I E;  4O2D A;  4IUV A;  1TVX A;  3ND9 A;  1GXD C;  2ES2 A;  1BBU A;  1EQV A;  4NXM Q;  4YWK A;  1BCP F;  1Y1W B;  1STG A;  1BKB A;  4B3T L;  3TS0 A;  5JAV A;  2EYM A;  3WOE A;  3IRB A;  2FIN B;  1CSQ A;  2AWO A;  3PO3 G;  3BZC A;  1CKO A;  2N8N A;  2LXK A;  1A2T A;  1YNX A;  2K5D A;  2UUB L;  4WJW A;  2F0S A;  4NXN Q;  3J7A 5;  1VQP A;  2JA5 H;  1JOK A;  1A63 A;  3OIQ A;  4H0L C;  1EFI D;  1ZKO A;  2HUG A;  1Y1W G;  4GLA C;  4X62 Q;  2KJX A;  3KLW A;  4KHV A;  2CVR A;  5EPJ A;  1LTA D;  1W3S A;  4LF8 Q;  2LXJ A;  2ENB A;  5M3M B;  3NSW A;  1Q81 C;  1TS5 A;  3JC6 6;  3NP8 A;  2XSC A;  2RA4 A;  2K6A A;  4NW2 A;  2R92 H;  4IPC A;  1B53 A;  2EXD A;  4ME3 A;  2VY3 A;  2Q2T A;  1F9P A;  2X6L A;  1OXV A;  2VQF Q;  1TWC H;  1CSP A;  3CQZ B;  4A3E G;  4JOI C;  2NVX B;  5JEA G;  1SSO A;  2N3S A;  4A3I G;  3PV0 A;  2YTX A;  3CAM A;  3ULJ A;  2F0L A;  3WOF A;  1IYU A;  1WTQ A;  3H0G H;  3PF4 A;  2TMP A;  1O80 A;  1YVC A;  1AEX A;  4FXG C;  3GV3 A;  2IT1 A;  3RR5 A;  1B3A A;  1X3P A;  1NCV A;  5M9O A;  2EVB A;  1VF7 A;  1EL0 A;  3F1Z A;  1VQD A;  3K5N A;  3FRP B;  4JI2 L;  4BWG B;  3T56 B;  3B6Y A;  4LF5 Q;  3FHW A;  3PIO A;  3KLS X;  3IL8 A;  2RDF A;  1SNQ A;  1HA5 A;  2NVT H;  1GUT A;  1JWS D;  1TII D;  4XQJ A;  2OF1 A;  2Q8T A;  3TRE A;  4EGV A;  4A3C G;  1C7Y A;  1SMY D;  4I7Z C;  1CM9 A;  2AKW B;  1XJV A;  1SE8 A;  3DLL A;  1X55 A;  4A3G G;  3G6E A;  1H9K A;  3PUX A;  4OL7 A;  1BCP C;  5IGG A;  1K9M C;  1JMC A;  1EY7 A;  3RUZ A;  3M7G A;  4P75 A;  1KAB A;  1VQL A;  2OQK A;  3NEN A;  2JA7 G;  2NZH A;  4N9P A;  1LUZ A;  1EIY B;  3PO3 H;  1IHZ A;  1ROD A;  1JWM D;  5FJ8 H;  3PIO 3;  4P72 A;  1WTW A;  2QDL A;  1GHK A;  1AW7 A;  4QMG A;  3ERQ A;  3TRZ A;  5JEA J;  3O13 A;  3VYU A;  3I4L A;  1Q1E A;  1KAA A;  4DF7 A;  2PNH A;  1I94 Q;  4BXX G;  2L9H A;  5COY A;  3BZD B;  1NNX A;  1HUN A;  5BR8 Q;  1F2L A;  2OTL A;  1VQJ A;  3HOZ B;  3TZD A;  1MJC A;  3TZU A;  4K2L A;  4BBS H;  5ELB A;  3N52 A;  1H9R A;  1RF2 D;  2WKD A;  4CJ1 B;  1RDP D;  4JBM A;  5LMU Q;  1PZJ D;  2QIL A;  2B63 B;  2O5J C;  5IYC G;  1EU3 A;  1FGU A;  1XWE A;  1XPU A;  3S2H B;  2VUM H;  1NR2 A;  4H13 C;  4PMC A;  4KD4 A;  3E3X A;  4F87 A;  1LT5 D;  1GOZ A;  4OWT B;  1KRT A;  3FPU B;  2D5D A;  4LFA L;  2PW7 A;  2Y0S B;  3RD4 A;  5C4J B;  1FNU A;  3CQZ H;  3QOL A;  4DAP A;  2E2I B;  1RTN A;  1SFO B;  4K6D A;  4CDC C;  4JBJ A;  5AJ3 L;  1IBM Q;  1O7I A;  1NBW A;  1SRO A;  2CFM A;  1I6H B;  1LV9 A;  4NXN L;  3S1Q B;  2OEO A;  4DK0 A;  4B3M Q;  2IX0 A;  5KGU A;  5I6Y A;  2Q8I B;  1PRT F;  1K73 C;  1LTS D;  4ILW A;  1N34 Q;  3S1R H;  1EIF A;  1MHW C;  2WAQ B;  3T51 B;  3RLN A;  2ZTD A;  2IX1 A;  1YJN A;  3HOY G;  3HOU G;  1VQK A;  4OHJ A;  4BBR H;  4DV7 L;  2K14 A;  1JB3 A;  1T5X D;  3GTP H;  3DHQ A;  3GTQ B;  2VQF L;  1PH7 A;  4LUV A;  3FMC A;  5DM7 3;  1L0W A;  4A3M H;  2KEN A;  4DV0 Q;  1GO3 E;  5G3L D;  4WJ3 M;  1B7Y B;  3A56 A;  5BN4 A;  4KY5 A;  2CQO A;  3K0Y A;  4A3K B;  1LLR D;  4JCV E;  2HQE A;  3J80 c;  3CF5 A;  2F0P A;  3LGJ A;  1CFM A;  4HIK A;  4DR6 L;  2A69 D;  1PV4 A;  3LX0 A;  3DEP A;  2JE6 I;  1WCM B;  4A3I H;  3BZK A;  2A73 B;  1V1Q A;  4A93 B;  2FMC A;  2EYJ A;  1TWH H;  2V4D A;  3HKZ B;  2BH2 A;  2OTJ A;  3HOU H;  4N8F A;  3A0J A;  3NE5 B;  5C3E B;  1CQV A;  1W6J A;  3KDF B;  4C3I G;  2VB3 X;  1SMY C;  4DV1 Q;  1PVO A;  1PFB A;  2HQL A;  3GO5 A;  2F4V L;  2L11 A;  1VQC A;  3TS2 A;  2OT2 A;  4KV6 A;  2BDN A;  4DK6 C;  1VQI A;  4LFA Q;  1AP0 A;  2JEB I;  4C2M H;  5CV6 A;  2N49 A;  4DNR B;  3SK8 A;  1DYQ A;  2C9O A;  3OW2 A;  1XPR A;  5ELF A;  1JJ2 A;  2ZJQ A;  2EIF A;  1BF4 A;  5CGK A;  3TP7 A;  3M4O H;  4IAL A;  4ZUI A;  4MNO A;  3PQI A;  4TKO B;  4EX5 A;  1XMQ Q;  1GJX A;  3I91 A;  5GAH C;  3OYY A;  4TSS A;  3CC7 A;  4AQY L;  5JPN C;  4B3M L;  1R9T H;  1K0S A;  3ERO A;  1I50 H;  2E2D C;  2IHE A;  1DOK A;  3R8B A;  2RCN A;  1VQ7 A;  1F9R A;  4G7O C;  1VMC A;  2WB1 B;  5DEH A;  1PRT D;  1EY0 A;  3F2C A;  5E3F A;  5IP7 H;  3EBE A;  3GTO H;  2NVY B;  2F0W A;  4GKK Q;  5DAU A;  5EAY A;  1VQH A;  5EPL A;  3J81 c;  3W2D A;  3KF8 B;  4B3S L;  4K5V A;  4EQN A;  3M9B A;  1OXS C;  3M3Y B;  5I6W A;  5C3E G;  1M4V A;  3D4D A;  3X3M A;  4OO1 G;  3S1M B;  5IT9 E;  3PO2 B;  1N9W A;  2ZM6 L;  1EQQ A;  2B8F A;  4FDB A;  3KYH C;  2EZV A;  2DUD A;  2CW0 D;  3J81 L;  3T1H L;  2AWN A;  1YNJ D;  1STB A;  3CHB D;  1ENA A;  4C3J G;  4LW1 A;  1SJE D;  4X64 Q;  3NTK A;  2PMZ E;  3P1H A;  4ZKC B;  3ONA B;  4CJ2 C;  5A35 A;  3SHL A;  4JI8 Q;  2MO1 A;  3D31 A;  2JEA I;  1V43 A;  3AMU A;  1LAC A;  5C3W A;  4C3I H;  1G2T A;  4AYB E;  1GKH A;  2B39 A;  1ZXT A;  1KD1 C;  3ERS X;  5D65 A;  1CK1 A;  4JI0 L;  2GN5 A;  1ESR A;  3F2D A;  4R1J A;  2KCT A;  1GUW A;  2NBF A;  4OX9 L;  1EQR A;  2JJQ A;  2K75 A;  2F0I A;  3HOX B;  2L1B A;  1K3R A;  4K8I A;  1KRS A;  3I4O A;  4C3H G;  4OO1 I;  4RH6 A;  4C2M B;  1SRU A;  3KJP A;  2Z8L A;  3ZYY X;  2EXZ A;  3PSI A;  4RCN A;  1C4Q A;  4AIM A;  1XMQ L;  4BBR B;  4IO9 A;  1TR5 A;  4IOC A;  2N78 A;  3KUP A;  3T16 A;  4RGT A;  1LTL A;  3I4M G;  2D0P A;  4OON A;  5E4W C;  1HR0 L;  4BY1 G;  4LFC L;  5C3E H;  1NMG A;  2XNA C;  5M3M G;  2AMC B;  1L1O C;  2MO0 A;  4UP7 A;  2XWJ B;  3QWN A;  1LM0 A;  3NK9 A;  4JI0 Q;  4L5R C;  5CV4 A;  3U9S A;  1CZW A;  4DNI A;  3DWQ A;  1TKW B;  2XRS D;  3MXN B;  3KLS A;  5IP7 G;  3RNU A;  2R92 G;  4K0K Q;  3UE0 A;  1OO9 B;  4BBR G;  2VNU D;  3CCV A;  4JOI A;  4O1N A;  3A55 A;  4GOP B;  1VQG A;  1K8O A;  4JBW A;  5BN5 A;  4DK1 A;  1UAP A;  3HKS A;  3TP8 A;  4DV2 L;  1OTC A;  3PIP 3;  3G48 A;  1GUO A;  1EWC A;  1LAB A;  1SNP A;  1QVF A;  2ZTE A;  1CI3 M;  2RHQ B;  1STH A;  1SYD A;  2ID0 A;  4CJ0 B;  2DN8 A;  1PFM A;  2NVX H;  3BYY B;  3CMA A;  4XIG S;  2XGT A;  1JJC B;  1VQE A;  3VR4 A;  5JJL A;  2KCM A;  1L2F A;  2EE1 A;  1P8L A;  1E22 A;  1HFG A;  3NUC A;  5KND A;  3C46 A;  3Q6S A;  4BA2 I;  3HOZ H;  1PH9 A;  4IFD H;  3NTI A;  1FL0 A;  4R9W A;  4Q5V A;  2BCO A;  2IWH A;  2A6E D;  1QZG A;  4DAM A;  1TWF H;  3S17 H;  4B3R L;  1J9O A;  3DM3 A;  4L8J A;  4IFD J;  4PZ8 A;  2PI2 E;  1S40 A;  1I4G A;  3EN2 A;  3MA2 B;  4S3S A;  3UDG A;  4H44 C;  2XVS A;  2NN6 I;  2E75 C;  2K5H A;  3CCM A;  4JK1 C;  3KF6 A;  1I3Q H;  5FLX E;  4XT1 B;  3DXJ C;  1X3Q A;  3I2Z A;  2XRQ D;  4NB3 A;  1BBX C;  1BOS A;  4LF7 L;  3A74 A;  1YNN C;  5KNB A;  2KCN A;  3L2P A;  3MAQ A;  2B2T A;  1IW7 D;  4A3B G;  3Q22 A;  4ZCK A;  2WP8 J;  2DNE A;  3K5O A;  1IYV A;  1PZI D;  3MFY A;  3Q0A A;  1A3V A;  1SXT A;  2B2V C;  4X65 Q;  1Q82 C;  3E0J A;  4PMW A;  2CWA A;  2KQ3 A;  5M5X B;  1UEB A;  2L4N A;  4GOP C;  1YI2 A;  1M1K C;  2UUC Q;  4WJ4 A;  1SBB B;  1WD0 A;  4DV5 L;  2EYF A;  2K5N A;  4A93 H;  1SDF A;  5IWA L;  2LKV A;  2UUB Q;  1R4Q B;  3I8Z A;  3MFG A;  2F3I A;  5C4X B;  2NVQ B;  2K01 A;  2JA6 H;  4R4O A;  4A3F G;  3GTL H;  2NTT A;  5AFW A;  5EPK A;  2EY2 A;  3RN5 A;  4FXK C;  1I6V C;  2L5T A;  3HEJ A;  1U4P A;  3VA7 A;  2Q8R E;  5KNC A;  4DR3 L;  5FOB B;  5IT9 L;  1B50 A;  2F0V A;  2N88 A;  2UXC Q;  1JE4 A;  3ULP A;  1Z9F A;  3WWV A;  3X3N A;  2EJF C;  1TY2 A;  1JR0 D;  1L0Y B;  3TN2 A;  2JXM B;  1PTO D;  1TS4 A;  2YV5 A;  1WI5 A;  4KKT A;  1KNE A;  5CMD A;  5EKL A;  3GTG B;  4RKB A;  1GUN A;  1SAP A;  3A8J E;  4P74 A;  4K8J A;  3DWP A;  3EVQ A;  1KDB A;  2QA4 A;  4V19 0;  3D4W A;  3KFU A;  5I2X A;  3HOW H;  5FLX c;  4ZRZ A;  1JIC A;  2EPB A;  2KEC A;  3J7Z C;  2Z6K A;  5IGE A;  4X3T A;  3NWS A;  1STN A;  3PUY A;  3DMU A;  4IJH A;  2KHJ A;  4LF6 Q;  3AU7 A;  3OHX C;  2EY1 A;  1EYG A;  3C3L A;  1X54 A;  4A3G B;  3C1F A;  4KN4 C;  4GN5 A;  5FLX L;  1FNV A;  5C4X H;  3CC2 A;  5LMU L;  2UUA L;  1SEB D;  4JI7 Q;  1HRJ A;  1EYA A;  1YNJ C;  4LF4 L;  4DR2 Q;  4JW0 A;  3BU2 A;  1GHJ A;  2CCZ A;  4GS3 A;  3N6R A;  1WFQ A;  1WYD A;  2FHT A;  3DWA A;  3H91 A;  3GTJ B;  3GQB A;  5IP9 H;  3CCR A;  4A3F H;  1TXY A;  4QGU A;  4DR5 Q;  2NZO A;  1K8G A;  2IJ0 A;  1H9J A;  1X3G A;  4BA1 I;  2RBM A;  1WCM G;  2V1C C;  1RTO A;  5GAG C;  1ET6 A;  1B9N A;  4DAV A;  3HOU B;  2P5Z X;  4CGY B;  3RZD B;  5L37 A;  2JA7 H;  3URY A;  2FMM A;  1TWA B;  1SYC A;  2KEE A;  1IBK Q;  1I4Q A;  3J7A F;  1PFN A;  4R4C A;  2F1M A;  3J81 j;  3A7A B;  1CHQ D;  4FXD A;  2L15 A;  2A6H C;  2ICE C;  1D2B A;  3BVM A;  4LF9 L;  2F0Q A;  4A3E B;  1SMX A;  2RVL A;  3IFT A;  3NHH A;  2BDO A;  1I4R A;  2FJ2 A;  1IKL A;  4IUU A;  5DM6 3;  2A5H A;  1NAP A;  1Z47 A;  1HQR D;  4X6A H;  1B8A A;  2K03 A;  5KIX A;  1LT6 D;  3E0E A;  2PZW A;  4GZY C;  3KDF A;  4B9X A;  2Y0S G;  4LFC Q;  4GOP A;  1D8L A;  2PQA A;  5C4H A;  4EVO A;  4ZKB B;  1ASY A;  2F0O A;  2F0T A;  4FF1 A;  5IOD A;  2K50 A;  4XXE A;  2RSN A;  1JC7 A;  4L63 B;  3I55 A;  4HSP A;  1VQB A;  2ICI A;  1KTK A;  1BXT A;  2RSO A;  4F7X A;  4ZAI A;  5GAD C;  2B63 G;  3ICE A;  2A68 D;  4LF9 Q;  2I5H A;  1ESF A;  3K8A A;  1JB7 A;  1RCV D;  4KJO A;  3CW2 C;  5ELE A;  1QJO A;  1H95 A;  1E1O A;  3NPP A;  1Z7T A;  2VL6 A;  4LF6 L;  4YWL A;  4K6L A;  1PHJ A;  3U4Z A;  1K0R A;  1HXY D;  1SE2 A;  2NUC A;  1J5E Q;  1BO0 A;  1UEA B;  4RG1 A;  5C4X G;  4J15 A;  3T53 B;  1SYB A;  5J1Z A;  2E2I H;  3H15 A;  3G6J B;  2WAQ E;  2WKC A;  4NPS A;  1VQF A;  3H3V H;  1WJJ A;  2SNM A;  1HNW L;  1K28 A;  1TQO A;  1EEF D;  4KJN A;  4DR1 L;  1MSH A;  3H0G B;  5K36 H;  4G4K A;  5I2Y A;  2D2C C;  2VUM B;  4DPG A;  4JI5 Q;  4A76 A;  1SE3 A;  2K5W A;  5IGC A;  1HFN A;  4P73 A;  1PTO C;  3R93 A;  4M1U B;  2R92 B;  1XX8 A;  4DV6 Q;  2G9D A;  4BBS B;  3Q8D A;  4Y52 H;  1ASZ A;  4JI6 Q;  5LMN Q;  1U4L A;  4EQP A;  4AQY Q;  1HUM A;  3H94 A;  2KED A;  3EQL C;  1N33 Q;  4L5S A;  1DON A;  1I50 B;  4X65 L;  1CA5 A;  5I4D A;  4A3L G;  4C1N I;  1Y1V H;  1W6K A;  2K5Q A;  2E2H H;  1N32 L;  1A3T A;  4FP5 D;  4IPG A;  4PG3 A;  4A3E H;  2MUY A;  3MVV A;  1LT4 D;  4V0B A;  1BBW A;  5C0X I;  1NTG A;  1SLJ A;  5IYB G;  2A19 A;  3MXU A;  2EY6 A;  5JJK A;  4NDX A;  1LYL A;  4ID6 A;  3S14 H;  2BA0 A;  4BBS G;  5AJ3 Q;  1O7Y A;  3CD6 A;  3AB9 A;  4N8X 1;  4C3H H;  4HJ5 A;  1O7L A;  1VQ5 A;  2HHH Q;  3LWU A;  4A4I A;  3CXC A;  2F0M A;  1VQA A;  1II3 A;  4OEM B;  2JA8 H;  3M4P A;  3TP6 A;  3NXW A;  5K36 G;  3GTJ H;  1PYB A;  5J39 A;  5ELC A;  1PH1 A;  4A3J B;  1HNX L;  3TBI B;  3ER0 A;  4XQN A;  2LS0 1;  2LMC B;  1ONL A;  4NMZ A;  2K05 A;  4DV7 Q;  1SYF A;  3MEH A;  4KY7 A;  1J5E L;  5CV7 A;  1YZ6 A;  3S9W A;  5DLQ E;  1WCM H;  4YHH L;  4A3I B;  1LTG D;  1KHI A;  4HCS A;  2EJG C;  4AH6 A;  1D5M C;  4A3G H;  5IY0 A;  2F52 A;  4DV2 Q;  4IUR A;  5EKI A;  3AFP A;  4DUY L;  1IL2 A;  3BS1 A;  1OXU A;  4IPD A;  2F0F A;  1PA6 A;  3PO2 G;  4LF8 L;  1N36 L;  4FF4 A;  2C35 B;  1KL9 A;  2LY7 A;  1B9M A;  2UU9 L;  1B44 D;  3CKI B;  4RAU C;  4A3M B;  2LFN A;  1LT3 D;  2DNC A;  3GTQ H;  3E9H A;  4HAE A;  1TWC B;  2NZ1 D;  2R7D A;  1Z6H A;  5IOC A;  5D3D A;  4R4T A;  5FO8 B;  1ZYR D;  4MIU A;  4IFD I;  3GV6 A;  4JI6 L;  4N9T A;  4BY7 B;  3E9I A;  2E8G A;  2I0Q A;  4JI1 L;  4G57 A;  1NY4 A;  3SGI A;  5JJI A;  2AQ1 B;  1RHP A;  3K5M A;  4B3R Q;  1J6Q A;  4PZ6 A;  2Z4I A;  1TWG B;  4HED A;  4O0A A;  4JBK A;  3GTL B;  2Z0S A;  4FF2 A;  4X64 L;  1KC8 C;  2DJG C;  1H9S A;  3G71 A;  2RDG A;  1HPC A;  2M00 A;  1X65 A;  2O2L D;  4DV3 Q;  2AUJ D;  3NBH B;  2VS1 A;  3UDX A;  2CHB D;  4KI0 A;  4LF5 L;  3CPF A;  4U68 A;  1Q8I A;  1Y1W H;  2JQO A;  3I70 A;  3MXG A;  4CKC A;  4C1N K;  3CCE A;  4ABN A;  3NEL A;  4KHP Q;  3OW7 A;  2J7Z A;  4PMB A;  2CH4 W;  5NUC A;  1L0X B;  3QG1 A;  3OOC A;  5M5Y H;  4DV6 L;  1I3Q B;  1F2M A;  1ICW A;  3SEB A;  4OX9 Q;  2K28 A;  4X66 Q;  2HT1 A;  2H4O A;  2KCC A;  5D3I B;  1Q3L A;  5E4X A;  3S2D H;  1BQQ T;  4G7H C;  2Z4H A;  1I4X A;  4BS9 A;  2QKI C;  1CKN A;  2R7Z G;  1RL2 A;  4Q0F A;  4DUZ L;  3J81 i;  5IGD A;  3JAM i;  5CV8 A;  3I72 A;  4GNX C;  3Q23 A;  3I90 A;  5JJZ A;  1E3P A;  1WD1 A;  1N32 Q;  4B3T Q;  2A68 C;  2PW5 A;  4ALP A;  1TY0 A;  1Y69 U;  3OIP A;  5CBE E;  5LL6 S;  3MXP A;  2B2U A;  3I73 A;  2IX3 A;  3HS0 C;  4KHP L;  1T5E A;  2Z6K C;  4MHE A;  4KHZ A;  4GKJ Q;  4X3U A;  1PRT B;  3G4S A;  4DV0 L;  5M5W B;  2F03 A;  2Z1C A;  3LWE A;  3GTK B;  1XTD A;  1G91 A;  1VF5 C;  1QVG A;  2GVA A;  4IFD G;  4QY7 A;  4DR6 Q;  3HKZ E;  5FO7 B;  2SEB D;  2XIW A;  4JV5 L;  5C0X J;  3OTO L;  2YTY A;  2NVT B;  2VB2 X;  3V96 A;  1WTP A;  2PCF B;  2RKS A;  3AYH B;  1VQM A;  2NVY H;  2PYK A;  1XNQ L;  2B63 H;  3E5S A;  4JI3 L;  1RKN A;  1JOR A;  4YIJ A;  1WTH A;  1HR0 W;  1CZG A;  2WB1 E;  3S16 B;  4GKK L;  4GKJ L;  3PMF A;  4YWM A;  1TS2 A;  1JJG A;  1EOT A;  4DGZ A;  1GVP A;  2CW0 C;  4F88 A;  1SR3 A;  2UXD Q;  2YYZ A;  2D9U A;  3PUZ A;  1CQF A;  5CC4 A;  4DXG A;  2NWG A;  2R7Z B;  5IYD H;  1XNR L;  4RGO S;  4J6H A;  1HTL D;  5KYL A;  1EFW A;  1EZ8 A;  3SK6 A;  5C44 G;  2ZJP A;  5CYU A;  1DJR D;  2B2V A;  4DA2 A;  2D0O A;  5EGT A;  2RDH A;  1QG7 A;  5GQO A;  4KKU A;  4Y7N B;  1X32 A;  3A5Z B;  1VQ9 A;  5M3M H;  4I65 A;  2UXB Q;  5JOB A;  3HFZ B;  4C3J B;  4DR4 Q;  2F0D A;  1HCZ A;  5I9O A;  4KMU C;  1QZH A;  2JYO A;  5C5M A;  1AFP A;  4HJ8 A;  3L0O A;  1Y14 B;  1QVC A;  4KY6 A;  3ZJY C;  1C9O A;  2ZJR A;  1IYJ B;  5C4Z A;  3CRK C;  4CDD C;  3S1N B;  4J8Q A;  1PH5 A;  1G29 1;  3BYT B;  1KIX A;  4A3D G;  1K3B C;  1KLG D;  2H1E A;  2VZA A;  2DJF C;  1V1P A;  1NUC A;  3UI2 A;  1DM0 B;  4OEL B;  1MBY A;  1VQ8 A;  3M7N A;  5C3X A;  2Q2I A;  3UE1 A;  2UXB L;  2GA4 B;  1E1T A;  4RWS C;  2PQA B;  2JA9 A;  1E24 A;  2BA1 A;  1FGB D;  1NR4 A;  2B3G A;  4WOR A;  1EY9 A;  1JCK B;  3DUZ A;  4UDU C;  1N36 Q;  3F2U A;  4DN4 M;  4OIJ A;  4F8M A;  3TSS A;  2HDM A;  4QJF A;  4FO2 A; 
#chains in the Genus database with same CATH homology
 2V1C C;  3S2H H;  3CPW A;  4OWT B;  1KRT A;  4LFA L;  1MIU A;  1X3F A;  5GAG C;  3L7Z C;  3HOZ G;  3CQZ H;  2B29 A;  2I5L X;  2JA7 H;  3D0F A;  4JBJ A;  5AJ3 L;  1IBM Q;  1O7I A;  1EWI A;  1NBW A;  1IBK Q;  1SRO A;  1FVI A;  2R7F A;  2CFM A;  2R93 G;  4R4C A;  3J81 j;  5M3F H;  4PZ7 A;  4EQ5 A;  4JI4 L;  2L15 A;  3CCU A;  4NXN L;  4LF9 L;  2HHH L;  3HOV H;  2YTV A;  4B3M Q;  3T1Y Q;  4KLK A;  1SMX A;  2IX0 A;  3W1G A;  4DK3 C;  4DR3 Q;  2JA5 G;  3CC4 A;  4TQU S;  4OWX B;  1K73 C;  2OCE A;  1N34 Q;  1Z47 A;  4YCV A;  3S1R H;  1EIF A;  4A3J G;  3OTO Q;  4X6A H;  1B8A A;  1N34 L;  5IYD G;  3E0E A;  3RLN A;  2ZTD A;  5H1S E;  1KAW A;  3I56 A;  2IX1 A;  3KDF A;  2Y0S G;  1YJN A;  4LFC Q;  3HOY G;  4GOP A;  1VQK A;  3HOU G;  1D8L A;  4BBR H;  4DV7 L;  3GTG H;  2PQA A;  1XPO A;  2UUC L;  1ASY A;  3I7F A;  1FJG L;  4JG2 A;  2D62 A;  2K14 A;  4JI2 Q;  4A3M G;  3GTP H;  2K50 A;  4OXP A;  3M85 A;  1QUQ A;  2VQF L;  1PH7 A;  3I55 A;  1JT8 A;  4LUV A;  1VQB A;  2MQH A;  1L0W A;  3W1B A;  3PIP A;  1YHB A;  2KEN A;  4DV0 Q;  4A3M H;  3J80 i;  1GO3 E;  1G51 A;  3ICE A;  1B7Y B;  5GAD C;  4GNX B;  2B63 G;  4JYA Q;  3PUW A;  4WJ3 M;  2CQO A;  1KXL A;  1C0A A;  4LF9 Q;  2I5H A;  4JCV E;  2VQE Q;  2UXD L;  1JB7 A;  3K8A A;  1PH4 A;  3J80 c;  3CF5 A;  4JV5 Q;  3CW2 C;  3LGJ A;  3A5U A;  1PH2 A;  4HIK A;  4DR6 L;  1H95 A;  1E1O A;  1IXR A;  1UE5 A;  1WOC A;  1GD7 A;  1JE5 A;  2VL6 A;  1PV4 A;  4LF6 L;  4YWL A;  2JE6 I;  1A0I A;  1PHJ A;  1L1O A;  4A3I H;  3U4Z A;  3K7U C;  1K0R A;  3BZK A;  2UUA Q;  4JI7 L;  4GN4 B;  1V1Q A;  2JK8 A;  1J5E Q;  2RF4 A;  4DR4 L;  4RG1 A;  1M90 C;  1P16 A;  5C4X G;  4J15 A;  1AE3 A;  1UE6 A;  1TWH H;  2OTJ A;  1EUJ A;  5C44 H;  3RZD H;  2E2I H;  2BH2 A;  3H15 A;  1A62 A;  2WAQ E;  5C4J H;  3HOU H;  3A0J A;  4NPS A;  1HNW Q;  1VQF A;  4LF7 Q;  2Y0S E;  3H3V H;  4DUZ Q;  1WJJ A;  1VQ6 A;  3KJO A;  1HNW L;  1Q86 C;  3KDF B;  1YHQ A;  4YCU A;  4BA1 I;  3FKI H;  4DV1 Q;  4DR1 L;  1PVO A;  2HQL A;  3GO5 A;  3KF6 B;  1HR0 Q;  2F4V L;  1XNR Q;  4YY3 Q;  1VQC A;  1NE3 A;  5FJ8 G;  3TS2 A;  1B70 B;  4NXM L;  4DPG A;  1BVS A;  4JI5 Q;  1U0L A;  1SN8 A;  4A76 A;  4IPH A;  4DK6 C;  1VQI A;  4LFA Q;  2ZM6 Q;  2JEB I;  4BY7 H;  5M5W H;  4C2M H;  4P73 A;  2N49 A;  4UP8 A;  2K4K A;  4P71 A;  1XPR A;  1OXX K;  3OW2 A;  1JJ2 A;  2ZJQ A;  3AFQ A;  3K81 C;  1RIP A;  2EIF A;  4LWC A;  4DV6 Q;  1YJ9 A;  5IYC H;  4DKA C;  3M4O H;  3Q8D A;  4DR7 L;  4Y52 H;  4MNO A;  1XMQ Q;  4EX5 A;  1ASZ A;  4JI6 Q;  5LMN Q;  3RZO H;  2CWP A;  2LSS A;  5GAH C;  4AQY Q;  4IJL A;  3OYY A;  3CC7 A;  4AQY L;  1NMF A;  3S1N H;  4DV1 L;  4DR1 Q;  4B3M L;  1R9T H;  3BJU A;  1N33 Q;  2E5L L;  4L5S A;  1I50 H;  4X65 L;  4LUZ A;  1PYS B;  4A3L G;  1Y1V H;  1HZ9 A;  2IHE A;  4A3K G;  2E2H H;  2WAQ G;  2GVB A;  4HIM A;  4X62 L;  2RCN A;  4PG3 A;  1VQ7 A;  4IPG A;  4A3E H;  2UU9 Q;  1N32 L;  3H3V I;  1T9H A;  4XTC S;  5HGQ A;  1BBW A;  5C0X I;  4DV4 L;  3T1H Q;  2ASB A;  1NTG A;  1YHA A;  2ALY B;  5GAE C;  1SLJ A;  5IYB G;  3F2C A;  4K0K L;  2A19 A;  2A1A A;  4C3J H;  5JJK A;  1LYL A;  2OQ0 A;  3EBE A;  5IP7 H;  3S14 H;  3GTO H;  2BA0 A;  3CME A;  4BBS G;  4QIW E;  1DGS A;  2HIX A;  5AJ3 Q;  1VQ4 A;  3CD6 A;  4GKK Q;  4C3H H;  4HJ5 A;  5EAY A;  4Y7N H;  1VQ5 A;  2HHH Q;  4A4I A;  1VQH A;  4L5Q A;  1PH6 A;  3J81 c;  1Q12 A;  3KF8 B;  3CXC A;  4B3S L;  3ULL A;  4A3D H;  1VQA A;  3M9B A;  1N33 L;  1OXS C;  4YY3 L;  1MJE A;  4UP9 A;  3M3Y H;  2K52 A;  3UDI A;  5C3E G;  1Y1V G;  3M4P A;  3MEF A;  2KBN A;  2JA8 H;  2R7Z H;  3PUV A;  3S1M H;  5M3F G;  4OO1 G;  5IP9 G;  1N9W A;  2WFW A;  5HY6 A;  2ZM6 L;  1EQQ A;  1VCI A;  4FDB A;  3GTJ H;  1PYB A;  1YIT A;  3KYH C;  4BY1 H;  5K36 G;  2DUD A;  4HJ7 A;  1I5F A;  1PH1 A;  3HOW G;  3GTK H;  1YBY A;  3EIV A;  1V9P A;  3T1H L;  2AWN A;  4QL5 A;  4DV5 Q;  2K5V A;  2JA6 G;  3U58 A;  1HNX L;  5ELO A;  3ER0 A;  1VQO A;  4DV7 Q;  2VW9 A;  3GDE A;  1AE2 A;  1Q8K A;  4LW1 A;  4RMF A;  3S24 A;  1YZ6 A;  4X64 Q;  1J5E L;  3GTM H;  2PMZ E;  3STB D;  4DR2 L;  5DLQ E;  1WCM H;  3K7A H;  4YHH L;  4JI4 Q;  4DV3 L;  1KHI A;  1X6O A;  1AH9 A;  4AH6 A;  1VQN A;  4A3G H;  4JI8 Q;  5IY0 A;  4DUY Q;  2MO1 A;  5IT9 c;  2MFI A;  2F52 A;  3D31 A;  4DV2 Q;  2JEA I;  5LMN W;  1V43 A;  3AFP A;  4JI8 L;  5LMN L;  5FLM H;  4DUY L;  1OXU A;  1YEZ A;  1IL2 A;  4A3L H;  3RLO A;  4UY8 C;  3JAM c;  4DR5 L;  4C3I H;  4IPD A;  1PA6 A;  3PO2 G;  4AYB E;  1GKH A;  4LF8 L;  4JI5 L;  3I4N H;  1N36 L;  2CKZ B;  2XTI A;  1KD1 C;  2C35 B;  1KL9 A;  3ERS X;  3CCL A;  2AHO B;  1KQS A;  1S72 A;  4YCW A;  1XMO L;  2UU9 L;  2F4V Q;  4JI0 L;  2GN5 A;  5BR8 L;  2IY5 B;  1X9N A;  3RN2 A;  3F2D A;  4R1J A;  2KCT A;  3GTQ H;  4OX9 L;  3E9H A;  2A8V A;  3STB C;  1EQR A;  2JJQ A;  2K75 A;  1HH2 P;  3HOX H;  3VDY A;  5IE8 A;  1K3R A;  2R7D A;  1KRS A;  3I4O A;  2R6G A;  4OO1 I;  4R4T A;  2Q2U A;  3U4V A;  1SRU A;  1YJW A;  3KJP A;  4IFD I;  1X3E A;  1HZB A;  3PSI A;  4AIM A;  1XMQ L;  3W5O A;  4JI6 L;  4IO9 A;  4JI1 Q;  3E9I A;  1S3O A;  4R4I A;  2E8G A;  4B3S Q;  2I0Q A;  4JI1 L;  4IOC A;  4MTN A;  2N78 A;  5FLM G;  1LTL A;  1NY4 A;  4HJA A;  3SGI A;  3I4N G;  3I4M G;  1K8A C;  2D0P A;  4OON A;  4TVA B;  2QEX A;  2MNA A;  1HR0 L;  4B3R Q;  5JJI A;  4BY1 G;  1J6Q A;  4POG A;  1MKH A;  4PZ6 A;  4LFC L;  2NN6 G;  5C3E H;  2JA8 G;  1NMG A;  2ATW A;  3HOV G;  3S1Q H;  2WB1 G;  5M3M G;  1I94 L;  4O0A A;  2AMC B;  1L1O C;  2MO0 A;  4MZ9 A;  4JBK A;  2Z0S A;  1CKN B;  4UP7 A;  5C0X G;  1XNQ Q;  4A3B H;  1IBL L;  2PI2 A;  1YIJ A;  4QQB X;  4X64 L;  2VUM G;  1LM0 A;  1TWA H;  1KC8 C;  3PCO B;  4L5T A;  3G71 A;  2YU9 H;  4JI0 Q;  4A93 G;  4L5R C;  1I6H H;  4AYB G;  1HNX Q;  4DAY B;  3HOX G;  1X65 A;  4DNI A;  3MXN B;  5IP7 G;  3RNU A;  2R92 G;  4DV3 Q;  4K0K Q;  5IWA Q;  3UE0 A;  3NBH B;  4BBR G;  2VNU D;  2VS1 A;  3K80 C;  1HNZ Q;  3CCJ A;  4JOI A;  1OXT A;  3CCV A;  3UDX A;  3M4Q A;  4GOP B;  1EOV A;  1VQG A;  4KI0 A;  4JBW A;  1HZA A;  1Q7Y C;  4JYA L;  3HKS A;  4DV2 L;  1TWG H;  4LF5 L;  1IZ6 A;  1OTC A;  4IOA A;  3CPF A;  3PO2 H;  3G48 A;  4O2D A;  1N8R C;  1Y1W H;  2JQO A;  1QVF A;  1QUQ B;  4A3K H;  2ZTE A;  2ES2 A;  5GRO A;  1BBU A;  4NXM Q;  4YWK A;  2RHQ B;  1BKB A;  3CCE A;  4B3T L;  2ID0 A;  2R93 H;  1Q46 A;  1FJG Q;  2ZTC A;  2QGQ A;  3TS0 A;  3NEL A;  4KHP Q;  2NVX H;  3CMA A;  3UDF A;  4GNX A;  3IRB A;  1IBL Q;  5M5Y H;  4XIG S;  1CUK A;  2XGT A;  1CSQ A;  4DV6 L;  1JJC B;  2AWO A;  3K0X A;  3TQY A;  3U50 C;  4OX9 Q;  1VQE A;  2IHF A;  3AQQ A;  3PO3 G;  4X66 Q;  2HT1 A;  5JJL A;  2KCM A;  1CKO A;  1L2F A;  3BZC A;  2H5X A;  1G6P A;  1P8L A;  1E22 A;  2N8N A;  2LXK A;  4BA2 I;  3S2D H;  1YNX A;  2UUB L;  3HOZ H;  3F2B A;  1CKN A;  2BH8 A;  1HNZ L;  3PGZ A;  1PH9 A;  4NXN Q;  3J7A 5;  1VQP A;  2R7Z G;  2JA5 H;  1RL2 A;  1L1O B;  4DUZ L;  1FL0 A;  1Q1B A;  3J81 i;  1A63 A;  4HJ9 A;  3JAM i;  1Y1W G;  4GLA C;  1QZG A;  4DAM A;  1TWF H;  3S17 H;  4B3R L;  4H02 A;  4POF A;  4GNX C;  3DM3 A;  3GD7 A;  1E3P A;  3KLW A;  4PZ8 A;  4X62 Q;  4IFD J;  2PI2 E;  4B3T Q;  4ALP A;  1S40 A;  1N32 Q;  1W3S A;  4LFB L;  3EN2 A;  3UDG A;  4LF8 Q;  4LUO A;  1GM5 A;  2LXJ A;  2NN6 I;  1UE7 A;  4R4Q A;  1Q81 C;  4KHP L;  3JC6 6;  2Z6K C;  4A75 A;  1SFO H;  1A8V A;  2K5H A;  4KHZ A;  1HZC A;  2EQS A;  3CCM A;  1IBM L;  5IYB H;  4GKJ Q;  2R92 H;  3KF6 A;  1I3Q H;  4IPC A;  2EXD A;  4ME3 A;  2VY3 A;  1U5K A;  3G4S A;  4DV0 L;  2Q2T A;  1VS0 A;  4GLV B;  3I2Z A;  1OXV A;  2VQF Q;  1TWC H;  1CSP A;  4A3E G;  4YHH Q;  4NB3 A;  4JOI C;  1XTD A;  2E5L Q;  5JEA G;  4LF7 L;  3A74 A;  2N3S A;  4A3I G;  3PV0 A;  3H0G G;  1QVG A;  2YTX A;  3L2P A;  2GVA A;  4IFD G;  4A3B G;  3CAM A;  4QY7 A;  3ULJ A;  4GLX A;  4DR6 Q;  2DGY A;  2WP8 J;  3H0G H;  3HKZ E;  3PF4 A;  4JV5 L;  4JC0 A;  5C0X J;  3OTO L;  2YTY A;  1YVC A;  3RLF A;  4X65 Q;  4DV4 Q;  1Q82 C;  4APV A;  3I4M H;  2IT1 A;  2CWA A;  4PMW A;  1UEB A;  4GOP C;  1YI2 A;  1M1K C;  3RR5 A;  2UUC Q;  1VQM A;  3AYH B;  4WJ4 A;  3FP9 A;  4X66 L;  2NVY H;  4DV5 L;  4JI3 Q;  3S16 H;  2K5N A;  1XNQ L;  2B63 H;  4A93 H;  5IWA L;  1CKM A;  3F1Z A;  1VQD A;  3NEM A;  4JI3 L;  3CCS A;  4JI2 L;  1HR0 W;  2UUB Q;  2WB1 E;  4GKK L;  4GKJ L;  2F3I A;  4YWM A;  3B6Y A;  1W2B A;  4LF5 Q;  1PH3 A;  3FHW A;  1JJG A;  3PIO A;  5J3B A;  1D7Q A;  2JA6 H;  4R4O A;  4A3F G;  3GTL H;  3T1Y L;  2NVT H;  4DR7 Q;  1GVP A;  1SR3 A;  1UE1 A;  2YYZ A;  2UXD Q;  3PUZ A;  3RN5 A;  3TRE A;  4HIO A;  4HID A;  3CP0 A;  2FXQ A;  4A3C G;  1C7Y A;  5IYD H;  1XNR L;  4DR3 L;  2AKW B;  2HIV A;  1XJV A;  1SE8 A;  3DLL A;  1X55 A;  4LNQ A;  4A3G G;  2UXC Q;  1EFW A;  2ZJP A;  5C44 G;  5E7N A;  3G6E A;  3ULP A;  3PUX A;  2D0O A;  1K9M C;  1Z9F A;  5GQO A;  3WWV A;  1K83 H;  1JMC A;  3HKZ G;  4UPA A;  3F8T A;  1E7Z A;  3A5Z B;  1VQ9 A;  2YV5 A;  5M3M H;  1WI5 A;  2UXB Q;  1PFS A;  4P75 A;  3HFZ B;  2OQK A;  3NEN A;  1VQL A;  2JA7 G;  4DR4 Q;  3S15 H;  4LF4 Q;  2NZH A;  4P74 A;  1LUZ A;  1EIY B;  3PO3 H;  3HOY H;  2QA4 A;  5FJ8 H;  4P72 A;  2Q2H A;  1QZH A;  3KFU A;  4HJ8 A;  3L0O A;  3HOW H;  5FLX c;  3J7Z C;  4A3C H;  2Z6K A;  3FKI G;  1Y14 B;  1QVC A;  3PUY A;  5JEA J;  3TRZ A;  1Q1E A;  3ZJY C;  3PF5 A;  1C9O A;  2PNH A;  2ZJR A;  1I94 Q;  1IYJ B;  3AEV A;  4BXX G;  2UXC L;  4IJH A;  2KHJ A;  1PH5 A;  4LF6 Q;  1G29 1;  4LFB Q;  5BR8 Q;  1KIX A;  1EYG A;  1X54 A;  2OTL A;  4A3D G;  2NVQ H;  1VQJ A;  3TEH B;  2VZA A;  4GN5 A;  4GN3 B;  1XMO Q;  1MJC A;  5C4X H;  3CC2 A;  4BBS H;  5LMU L;  2I5M X;  2UUA L;  1VQ8 A;  1UWV A;  4JBM A;  4JI7 Q;  5LMU Q;  3M7N A;  1HJP A;  4LF4 L;  4DR2 Q;  2Q2I A;  3UE1 A;  3BU2 A;  2E2J H;  2RHS B;  1IBK L;  2CCZ A;  5IYC G;  2UXB L;  5ELN A;  4GS3 A;  1E1T A;  4A3J H;  1NJI C;  1FGU A;  1WFQ A;  3CCQ A;  1PH8 A;  1XPU A;  2KHI A;  1WYD A;  2JA9 A;  1E24 A;  2BA1 A;  2PQA B;  5M5X H;  2B3G A;  2VUM H;  1N36 Q;  4BY7 G;  5IP9 H;  2OWO A;  2VQE L;  3CCR A;  4A3F H;  1TXY A;  4QGU A;  4DR5 Q;  2NZO A;  4OWW B;  3KOJ A;  1K8G A;  1X3G A;  4BXX H;  1X56 A;  4QJF A;  1WCM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...