1I50H

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i50H00
2R7ZH 2NN6I 1L1OA 1JJCB 1N34L 4HJ8A 1PV4A 2VQEL 1I6HH 1X65A 4DR3L 1KAWA 2PQAB 2F3IA 5M3FG 1IBKL 4B3MQ 4LF9Q 4WJ4A 2C35B 3I4OA 3K80C 4JG2A 3RN5A 2WB1G 4MTNA 2NVQH 2UXBL 4BY7H 4JI8L 1EUJA 4GLAC 3PIPA 1YI2A 1C9OA 2JA5H 3JAMi 2R7ZG 2JJQA 5GQOA 2JA6G 5JEAJ 4NXNL 3MXNB 4HJ9A 2I5HA 1OTCA 3VDYA 5GAHC 2H5XA 1PYSB 4JI0L 4IPDA 1GD7A 4P71A 3H3VH 1N36L 5FJ8H 3HKZG 2F52A 2HHHQ 2YTXA 2ZTEA 4BY7G 1QZHA 2CQOA 2GVAA 2VL6A 1EIYB 2OTLA 2K52A 3MEFA 4AIMA 2RF4A 1SN8A 3M4QA 4BA1I 5FLXc 2IX1A 3E9IA 4QJFA 1Q86C 1TWGH 1VQOA 2E2JH 2V1CC 1PH1A 1UE5A 1TWFH 2N3SA 2UUBL 2ZJQA 3ICEA 4GKJQ 3F2DA 3CD6A 1HZAA 1CSQA 4R4CA 3GO5A 1KL9A 2JEBI 3S24A 1JMCA 1IBLQ 4C2MH 4AYBE 3PUZA 1CKNB 1LUZA 1QVGA 1ASZA 3CC2A 3S2DH 2ZJRA 1KRTA 2MNAA 1FGUA 1KIXA 4RG1A 5AJ3Q 2IHFA 2KBNA 2KCTA 2Y0SG 5BR8Q 4LF5Q 2QGQA 5IYBH 2A8VA 3KF8B 1MIUA 3KJPA 4IFDG 2VW9A 1Y1WH 1X3EA 4JI2L 1JJ2A 5IYDH 4PZ8A 1UEBA 4AH6A 1HNZQ 4LFCL 2UUCL 4UY8C 4DV4Q 1VQ5A 3GTKH 1S72A 3J80i 3U58A 5M5XH 1X56A 2R6GA 3KOJA 3D0FA 5C4JH 5C0XJ 2KCMA 1VQPA 5FLMH 4KHZA 4A3FG 3PGZA 2ZTCA 3J81c 4LF7Q 1VQHA 4GOPB 5IYBG 4YY3L 3Q8DA 3RZDH 4B3TL 3M9BA 3GTJH 1Y1WG 1XMQL 2E2HH 2AHOB 4OO1I 2MQHA 5IYDG 1MKHA 3PF4A 3F1ZA 1D8LA 4DPGA 3GTQH 1CUKA 3L7ZC 4DAYB 1EYGA 3DM3A 2K14A 2Z6KC 2E5LQ 1HH2P 3CPWA 1BKBA 1Q8KA 3KYHC 3S16H 2PQAA 1V43A 4JV5L 2CWPA 3HFZB 3J81j 1VQBA 1XPUA 1YJWA 1VQMA 1FL0A 4LF4L 4TVAB 1NBWA 5IWAQ 4JBMA 2D62A 3T1YL 2GN5A 4DV7L 4JI4L 2ZM6Q 1E7ZA 4NB3A 2BH2A 1JE5A 3RLFA 4BBSH 5GROA 1OXTA 2BH8A 2CKZB 2OCEA 3CMAA 4DV2L 1HR0Q 4R1JA 1I50H 4DR4Q 4B3SL 1OXXK 1EQRA 1PH2A 1CKMA 4A93H 4DUZL 3CCSA 4JC0A 1BBUA 4PZ7A 4KHPQ 2WAQG 4ME3A 2IX0A 4A3JH 4OX9L 3CF5A 3M4OH 3UE0A 1VQ9A 1E3PA 3UDXA 1LYLA 1U5KA 2RCNA 5IY0A 1L2FA 3RN2A 4JBJA 1VQKA 3S2HH 1N34Q 3I7FA 4DR2L 1J5EL 2ASBA 2UXCQ 2VQEQ 4GNXC 2NZHA 3CCRA 3G71A 5IP7H 4DV5L 2JQOA 4DR3Q 1LTLA 1Q1EA 1ASYA 3M7NA 4AYBG 1IBKQ 2CFMA 1CKNA 1EOVA 3KJOA 2Q2IA 4LF8L 3CCQA 2UXBQ 4ALPA 2K75A 1FJGL 2UXDL 4A3JG 1KD1C 4A3LH 5LMNW 4HJ7A 1GVPA 3PUWA 5GAEC 4NXNQ 1QVFA 2D0PA 3GTGH 4DR5L 4JI0Q 5IP7G 1TWHH 5M3MH 4UP7A 4DNIA 1X55A 1K3RA 1N36Q 4JOIA 3A5UA 4DV6L 3F2CA 1NMFA 4YCUA 3TQYA 3U50C 3FP9A 1Q46A 4PZ6A 2B63H 3AEVA 3EBEA 1UE6A 4GOPA 1YHQA 1L1OC 3CCEA 2WFWA 3GDEA 2N78A 3BZKA 4A3LG 1PH9A 1SFOH 2VQFL 1M90C 2VZAA 4YHHL 3K81C 2YTYA 4X64L 1U0LA 4R4TA 4BA2I 3L0OA 4IJHA 4R4QA 2UU9Q 1RIPA 5M3MG 1HR0W 4BBRH 3PO3H 4HIMA 1E22A 1XNRQ 1I3QH 3U4ZA 3G6EA 1TWAH 1S40A 2B63G 4L5SA 4A3IH 3GTMH 2PI2E 2XTIA 5M5YH 4X6AH 1WYDA 3LGJA 5E7NA 4DV0L 4A3GH 2DUDA 4H02A 4DKAC 2QA4A 3GTOH 3STBC 1JJGA 3CCMA 3AYHB 3KDFB 4LFCQ 3ULPA 2UUCQ 1VQIA 5EAYA 4BBRG 3PO3G 1VQ8A 1YJ9A 1GKHA 1B7YB 1W2BA 1AE3A 2N8NA 2IT1A 5C0XI 1Z9FA 1YJNA 3S15H 1YEZA 4A3CH 1PVOA 2GVBA 1VQAA 1WI5A 3CP0A 4A3IG 3U4VA 1VQFA 2IHEA 2WAQE 1IBML 3CPFA 4QY7A 3ZJYC 1PH8A 2JA5G 1KXLA 4P74A 1K8AC 4B3TQ 1XMQQ 4A3DH 1WCMH 4A3GG 5H1SE 2ALYB 3TS0A 4B3RL 3H15A 1HNXL 1TXYA 3S1NH 5FJ8G 4GS3A 2PMZE 3H0GH 4L5TA 1YZ6A 1KRSA 4LNQA 2A1AA 3PV0A 4P73A 4IOAA 4JV5Q 2KENA 4DK3C 4YWKA 1Q7YC 1I5FA 3S1QH 2ZJPA 1KHIA 3I55A 2LXJA 1CSPA 4A3DG 4HIDA 1WCMG 4PG3A 1I94L 2MFIA 4DV1L 1CKOA 1VCIA 1VQ4A 2KHIA 5JJKA 4IPCA 1OXUA 4QIWE 1XNQL 1NY4A 2PNHA 3T1YQ 1HZ9A 4DV7Q 4JI4Q 4JCVE 1N32L 3HOZH 1KQSA 1YVCA 1YNXA 3H0GG 1IXRA 5ELOA 5HY6A 4DV2Q 4YCWA 3OTOL 4K0KL 4OXPA 2EXDA 4B3SQ 1EIFA 4DUYL 4GNXB 4POFA 4DUZQ 1QVCA 3J7ZC 4IO9A 4NXML 2AKWB 1EFWA 2A19A 2Q2HA 1IZ6A 2EQSA 1Q81C 1N33L 4X66Q 3I2ZA 3CXCA 3HOZG 1IL2A 2AWOA 4X62L 1DGSA 1A0IA 4JBWA 1BBWA 3S1RH 1J5EQ 5FLMG 1VQCA 4LWCA 2XGTA 2I0QA 2OQ0A 3G4SA 2HHHL 3W1BA 3A74A 4P75A 4R4OA 4JI7L 2UUAQ 1PYBA 4JYAL 1FJGQ 3HOVH 4AQYL 2UXDQ 5K36G 1XTDA 1NE3A 3G48A 4RMFA 4HIKA 1EQQA 2F4VL 4GN4B 1WJJA 4GLVB 1X6OA 4DV3L 4WJ3M 3T1HL 1L1OB 5JJLA 3KDFA 3CCVA 1PH7A 4DR7L 5C3EH 4DR5Q 2ES2A 5JJIA 1S3OA 4LFAL 1HNWL 4JI1L 4DV6Q 3PF5A 4JI5L 1FVIA 2EIFA 1EWIA 2R7FA 2I5MX 2NVYH 1GO3E 1B70B 2Z6KA 3D31A 2JK8A 3UDFA 2VNUD 1YIJA 3HOVG 5JEAG 4C3IH 4OWTB 3KF6B 3AFQA 1HZBA 1QZGA 1K9MC 4YHHQ 2CCZA 1O7IA 4UP8A 4BBSG 1D7QA 2BA1A 2YU9H 2B29A 3RR5A 2K5NA 2LSSA 1PH4A 3CC7A 3S17H 1QUQB 4P72A 4A93G 3F8TA 4JI8Q 2NN6G 1PFSA 2FXQA 1L0WA 4IFDJ 1B8AA 5IE8A 1OXSC 1WOCA 1RL2A 4DV0Q 5LMNL 4DR1L 3J80c 4OWXB 3PO2H 3CAMA 3GTPH 2HT1A 1A8VA 1VQDA 4PMWA 1K0RA 1M1KC 3S1MH 3EIVA 2VY3A 2DGYA 1AH9A 4GN5A 1A62A 1OXVA 1IBMQ 4GNXA 3UDIA 4IOCA 4LFBL 1R9TH 2K5HA 4DK6C 4L5QA 4XIGS 3RZOH 3CCJA 2R93H 2UUBQ 2HIVA 4LUZA 3PCOB 2VUMH 3PO2G 1V1QA 2ZM6L 2OWOA 3ERSX 1UE1A 4TQUS 3ULJA 3M4PA 4A4IA 1IYJB 3PUYA 5C0XG 3ER0A 1VQJA 3W1GA 4X65L 5GADC 1HR0L 4XTCS 1YHAA 2MO0A 1AE2A 1K8GA 1VQ7A 4JI3L 1Y1VH 2E2IH 3BZCA 3J81i 4HIOA 1E1TA 4JI2Q 4BXXH 4QGUA 1I94Q 2VUMG 4DV1Q 2K50A 3E0EA 1XNQQ 4LW1A 1XMOL 2JA6H 3KFUA 3JC66 3HKSA 1N32Q 3W5OA 3TEHB 2UXCL 2AMCB 3TS2A 3CQZH 4C3JH 2IY5B 3A0JA 1SMXA 5DLQE 1XJVA 3UE1A 3OTOQ 3L2PA 4K0KQ 3PIOA 4MNOA 1Y1VG 4YY3Q 4UPAA 3CCUA 2BA0A 2QEXA 4DUYQ 3CW2C 5LMUL 3KLWA 3E9HA 4NXMQ 2B3GA 2R92H 4BXXG 3I56A 2RHQB 3KF6A 1G51A 1N33Q 1VQEA 3RLNA 1JT8A 1N8RC 4DR6L 2Z0SA 4YWMA 4LF6L 2YTVA 4X62Q 4J15A 2R7DA 4A3CG 4GKKL 2OQKA 4MZ9A 2I5LX 1SLJA 1VQNA 1Q1BA 1QUQA 4DAMA 1C7YA 1P16A 4OO1G 1J6QA 3K7AH 4A3MH 4JI6L 4KHPL 4YCVA 3M85A 1YBYA 3DLLA 4JI7Q 4LF4Q 2R92G 4JYAQ 4Y52H 5M5WH 2CWAA 2LXKA 4AQYQ 1YITA 3HOYH 2F4VQ 3K0XA 5HGQA 1PH3A 3K8AA 4DV3Q 1SRUA 2L15A 3ULLA 3OW2A 3T1HQ 2ZTDA 2UU9L 4A3EH 4DR7Q 4B3ML 1SE8A 3S14H 4YWLA 2K5VA 4LF9L 3CMEA 3GTLH 2JA8H 3F2BA 4HJAA 3NBHB 1XNRL 3NENA 4LFAQ 1HNWQ 4JI1Q 2N49A 3PUXA 4A3MG 3EN2A 4A3FH 4JI5Q 1UE7A 3IRBA 4A76A 3STBD 4JBKA 4OX9Q 1T9HA 3HOYG 3TRZA 4A3BH 4GN3B 4LUVA 1HJPA 1W3SA 4DR2Q 3CC4A 5IT9c 1K73C 4APVA 2JEAI 4A3EG 2HQLA 3NEMA 4DV5Q 1X9NA 2JA7H 1KC8C 3H3VI 2JA8G 3HOXH 1Z47A 2NZOA 2WP8J 3TREA 4EX5A 4LF8Q 2KHJA 4OONA 3JAMc 1X3FA 1K83H 1PA6A 2NVXH 1SR3A 3CCLA 2Q2UA 5ELNA 4IFDI 2K4KA 4A3BG 4GKJL 1Q12A 1XPRA 1VQGA 4O0AA 3J7A5 4LUOA 5LMNQ 1UWVA 3SGIA 4DR1Q 3B6YA 3AQQA 1NMGA 1IBLL 2JA7G 1H95A 4GLXA 4IJLA 3HOXG 1SROA 2E8GA 2WB1E 5IP9H 3NELA 5AJ3L 4LF5L 3FKIH 5BR8L 2AWNA 2PI2A 2YYZA 4BY1H 1WFQA 5GAGC 4LFBQ 4A3KH 2VQFQ 5J3BA 1HNZL 1TWCH 2RHSB 3M3YH 4KI0A 1P8LA 4DV4L 4X64Q 1N9WA 1G291 4OWWB 5C3EG 1MJEA 5C4XH 4NPSA 1LM0A 4FDBA 3BJUA 1PH5A 4POGA 4EQ5A 2ATWA 3K7UC 4QL5A 3HOWH 4X65Q 3HOUH 3HKZE 3AFPA 1NTGA 1X54A 5IP9G 3RLOA 3FKIG 4LF7L 1MJCA 3OYYA 4BY1G 1YHBA 3UDGA 4JI3Q 4A3KG 1E1OA 2YV5A 4Y7NH 3I4NH 2JE6I 1C0AA 4JOIC 2VS1A 4X66L 2E5LL 5C4XG 1XMOQ 4HJ5A 3PSIA 4GOPC 2MO1A 1XPOA 1Q82C 1VQLA 3HOWG 1V9PA 2HIXA 4IPHA 1GM5A 1X3GA 5IYCH 3HOUG 1Y14B 5C44H 1JB7A 2Y0SE 4UP9A 4O2DA 2Q2TA 1A63A 4KLKA 2UUAL 3I4NG 4QQBX 4C3HH 5IWAL 5LMUQ 3FHWA 1PHJA 1NJIC 3I4MH 2OTJA 3PUVA 4B3RQ 1G6PA 1HZCA 1HNXQ 4A75A 2JA9A 4R4IA 4DR6Q 4LF6Q 4IPGA 1VQ6A 3RNUA 3GD7A 5IYCG 5M3FH 1PH6A 4GKKQ 4L5RC 4DR4L 3A5ZB 1VS0A 5C44G 3WWVA 1E24A 2R93G 2ID0A 4JI6Q 1BVSA 2D0OA 2NVTH 3BU2A 3I4MG
chains in the Genus database with same CATH superfamily
2R7ZH 2FINB 1TU2B 1N34L 3V96A 1EEID 5K5PA 1PV4A 1X65A 5KNCA 3C1FA 4X3TA 2HDLA 5M3FG 3GTLB 2C35B 4JG2A 3TP5A 3I73A 4MTNA 4JI8L 1YI2A 1K8MA 1AP0A 2JJQA 5GQOA 4A3BB 2JA6G 2R3ZA 5GAHC 2JA7B 1ET9A 3CRKC 3HKZG 1PFBA 2K5WA 2YTXA 2OTLA 2NVXB 2K52A 4AIMA 1SN8A 1TT2A 1VQOA 1CTMA 1TWFH 3K5OA 3F2DA 3ITPA 1CSQA 3GO5A 1JMCA 4KD4A 3J7YW 1CZGA 4AYBE 2NVYB 3CC2A 2ZJRA 4RG1A 1V1OA 2KBNA 2Y0SG 5BR8Q 4CJ2C 3G6JB 2VW9A 4G57A 2MPMA 4PZ8A 1UEBA 5CGKA 3NTKA 2UUCL 2L0CA 1VQ5A 4UY8C 3J80i 1PMRA 3HOWB 3P75A 2KCMA 1VQPA 5FLMH 4KN4C 4PMCA 2ZTCA 5BN5A 3RZDH 4YY3L 4B3TL 4HSPA 3I4NB 3K6OA 5CV4A 2EJFC 3I72A 5TSSA 1HTPA 1D8LA 3C2PA 4DPGA 4DAYB 1SE2A 4X3KA 3OSOA 1V43A 1SYEA 4C56C 1WTVA 1ICWA 1VQBA 2KEDA 3CRLC 2WKDA 1H9RA 3NXWA 3I4MB 3KLSA 1RF2D 1NBWA 1FYCA 4MTKA 2KEEA 4JBMA 3T1YL 2KCCA 1PYWD 4NB3A 1DCZA 2EDGA 1OXTA 2F0UA 3CMAA 1HR0Q 1I50H 1EQRA 1CKMA 1EQVA 4ILWA 4XYOA 3U9SA 1FGBD 2PZUA 3CF5A 4K5VA 1VQ9A 1E3PA 3OIQA 1LYLA 1VQKA 5IY0A 1L2FA 1UUPA 3I7FA 4DR2L 2ASBA 1K3BC 4GNXC 2B39A 3O13A 3VR3A 3M7NA 1IBKQ 2CFMA 1EOVA 1EOTA 2F3WA 2F0TA 2UXBQ 1FJGL 1ESFA 4ZCKA 4CDDC 1KD1C 1GUGA 2EE1A 3SK8A 3GTGH 3NE5B 2FMCA 1ICFB 5KYIA 5IP7G 4UP7A 1L0YB 1K3RA 3A5UA 4XT1B 4PV1C 3K7AB 3U50C 4PZ6A 1GOZA 3AEVA 5J22A 1X3QA 4K2LA 1SFOH 2A5HA 2YTYA 2G5DA 1U0LA 4R4TA 5FOBB 3L0OA 4R4QA 1F9PA 3P1HA 3HRZC 3AMUA 2B63G 2J4XA 4L5SA 3D4DA 5M5YH 2EYJA 1ZXTA 2M00A 1EWHA 2XN9C 4A3GH 3P20A 1AFPA 4DA2A 3CCMA 3ULPA 1SE4A 1LTRD 5EAYA 4BBRG 4S3SA 3PO3G 1GKHA 3S15H 4X3SA 1W2BA 2IT1A 4ZKBB 1Z9FA 1SNQA 4RCOA 4NDXA 3CP0A 4DK1A 1RDPD 1VQFA 3U4VA 5KIXA 3CPFA 4QY7A 1STHA 1PH8A 1XMQQ 1CHPD 5T1IA 5H1SE 1FNUA 1HNXL 1PRTB 3KBXA 4GS3A 3H0GH 1YZ6A 4ABNA 4IOAA 1CI3M 3S1QH 1I5FA 3WOFA 2LXJA 2L12A 1CSPA 1DJRD 2I46A 3T4AC 4MN3A 4IPCA 1NY4A 1HZ9A 4JCVE 2A6HC 4Z9CB 1YVCA 1YNXA 5BN3A 4EQPA 4DV2Q 3OTOL 2EXDA 4B3SQ 3QG1A 3J7ZC 2AKWB 4LK1C 5C3WA 2A19A 1EFWA 3M4OB 1IZ6A 3S2HB 5IGCA 2QF7A 3HOZG 2RA4A 1B2TA 1A0IA 1PFNA 4LWCA 4K2KA 2I0QA 2OQ0A 2D2CC 3W1BA 4C3HB 1PYBA 3HOVH 1XTDA 1YNJD 1C4QA 3G48A 4QUFA 1ZYRC 4GN4B 1WJJA 1KDCA 1X6OA 2B2VA 3QWNA 1PH7A 1TWHB 5M3MB 5JJIA 1S3OA 4HCEA 4ZAIA 2OEOA 4RWSC 4JI5L 2R7FA 3D31A 2VNUD 2JK8A 5JEAG 1B9MA 4OWTB 1KDBA 3AFQA 1SNDA 2A6HD 3KF6B 1CQFA 1OO9B 2EYHA 4N9TA 2QEJC 1QZGA 4YHHQ 1K9MC 2F0NA 4BBSG 2BA1A 2B29A 3J80L 1I3QB 2K04A 4P72A 4A93G 3GTMB 1TWAB 2ENBA 1BF4A 2KJXA 3BDLA 4N8X1 4KY7A 3NWSA 1L0WA 4IFDJ 5CV8A 4FO2A 1WOCA 1EY4A 1RL2A 5LMNL 4I65A 3HG9A 3OIPA 3FRPB 5FO8B 1PTOB 1A8VA 4R8IA 1JR0D 5T1GA 4BS9A 1PRTD 2EY5A 4EQOA 1IBMQ 5C4HA 2KCNA 1R9TH 1WCMB 1JB3A 3RZOH 2R93H 1HRJA 2HIVA 3PCOB 5EPJA 3H94A 3ULJA 1EY6A 3S1NB 1A2UA 3Q24A 1STYA 2B2YA 2F1MA 1MSHA 3DWQA 2O5JC 3W1GA 1HR0L 4QUCA 2BOSA 5C4ZA 1AE2A 1VQ7A 4JI3L 1Y1VH 3BYTB 3BZCA 3J81i 2E2IH 1VF7A 1E1TA 4G7ZC 4JI2Q 4QGUA 2K50A 3E0EA 3JC66 3HKSA 1N32Q 4X3UA 3TEHB 1YNNC 2AMCB 2LKVA 2F0SA 3CQZH 2IY5B 1RJTA 1U4MA 3A0JA 1SMXA 5DLQE 2O5IC 3UE1A 3RZDB 4IUUA 3W3AA 3PIOA 4MNOA 1L0XB 4K6LA 3CW2C 2QEXA 4DUYQ 1PLFA 3TP8A 2EY2A 2K5QA 2SOBA 3K57A 1X32A 4CBVA 5JVG3 2ZXOA 4XT3B 5CBAE 1DXMA 4DXFA 4DAVA 1ENCA 4GKKL 4MZ9A 2I5LX 3N6RA 5I6WA 1H9KA 1J6QA 1O7ZA 5CV7A 4JYAQ 3KLRA 1YITA 3S9WA 2F4VQ 3K0XA 4OIKA 5HGQA 1RKNA 3K8AA 1PH3A 4DV3Q 1SRUA 3ULLA 3OW2A 1I4HA 1SE8A 3GTLH 1QNUA 2NZ1D 3NBHB 1HNWQ 4K5WA 3PUXA 4A3MG 5E3FA 4A3FH 3CU7A 4C3IB 4OX9Q 4A3BH 3HOYG 4GN3B 1ESRA 1W3SA 5FKAC 3CC4A 4APVA 1WTPA 1TY0A 4R8NA 1X9NA 3VYUA 4PNYA 2JA7H 4KMUC 4FXDA 5A2QL 2A73B 3Q22A 1PTOD 3WDNA 2NZOA 2BCOA 4OONA 3JAMc 2EJMA 2RDFA 2NVXH 4IFDI 4GKJL 1PZID 1TS3A 1SEBD 3PO2B 4K6DA 1UWVA 1VF5C 3SGIA 3QIAA 1NSNS 1MBYA 3VR5A 4RFBA 3FEWX 3ND8A 4KV6A 3NELA 1Q3LA 2NUCA 1STNA 4LFBQ 1BO0A 4ZQ3A 1HNZL 1RHPA 1RD9D 4KI0A 3KBGA 3SE0A 1N9WA 2SEBD 5C3EG 1WTHA 1LM0A 1PH5A 1E2WA 1JOOA 3K7UC 3HOWH 2EVBA 2PZTA 1PZKD 3HKZE 5IP9G 1UEAB 3D4RA 4LF7L 2PYKA 3OYYA 1YHBA 3EVQA 5EBCA 4A3KG 1WTRA 1E1OA 5J39A 5LL6X 3I4NH 4KTAA 1ZKOA 4DN4M 5C4XG 3MXUA 1Q82C 3HOUG 5F2DA 2L9HA 3OMGA 3RD4A 1JB7A 2Y0SE 4UP9A 2Q2TA 1AEXA 4KLKA 3DHQA 5IWAL 3FHWA 2OTJA 1BQQT 1NJIC 3I4MH 3PUVA 2JA9A 5KRUA 3BVZA 2WINB 4LJZC 4K5XA 1IHZA 3GD7A 5IYCG 3S1QB 3A5ZB 2K03A 5C44G 1CZWA 1QG7A 1A3TA 4JI6Q 2H4OA 1GHKA 2VB3X 5M5WB 1FD7D 4EQ5A 1V1PA 1TR5A 2NN6I 1DOMA 1SMYC 1EY9A 1K28A 4TKOB 5FK9C 2PQAB 2F3IA 3Q23A 2JA8B 4LF9Q 1W6KA 2F0OA 4XXEA 2MUYA 2JA5H 3JAMi 1JOQA 2R7ZG 3MXNB 4HJ9A 3NQIA 1LTAD 4JI0L 4IPDA 4G7HC 1GD7A 1EY7A 1NR4A 1W6JA 1SAPA 3TMEA 2HHHQ 1K83B 2GVAA 1IW7C 2F0FA 1AN8A 3HGBA 1EIYB 3FPPA 3MEFA 3A7LA 4IFDH 2IX1A 4BA1I 4KHVA 1T5XD 3E9IA 4QJFA 1TWGH 2E2JH 4R9WA 1BOSA 1HZAA 4R4CA 1KL9A 4CKBA 1IBLQ 1A3VA 5IT9L 1QVGA 1LUZA 1ASZA 1PFMA 1XYIA 1FGUA 5AJ3Q 2A8VA 5EJWA 5KNDA 1IKLA 1TWCB 4JI2L 3J81L 5IYDH 2RDHA 1A2TA 1G8ZD 4AH6A 2Z4HA 2RVLA 5FO9B 4DV4Q 2A74C 3HP3A 1X56A 3OOCA 2R6GA 5C0XJ 1CA5A 5I4DA 3BVGA 3PGZA 2XVSA 2F3VA 3W2DA 2B2VC 4GOPB 2QILA 3M9BA 4Y7NB 4FF3A 4OO1I 1EIGA 4J8QA 3SHLA 1HUNA 3F1ZA 5EKKA 4PMBA 1CUKA 3L7ZC 2E5LQ 2K14A 1HQMC 1Q8KA 3KYHC 2A69C 1LLRD 2DY7A 2K33A 3J81j 5KGUA 2X6LA 1GUOA 2R93B 1FNWA 5DEHA 2F0MA 2D62A 4NMZA 5IGEA 2ZM6Q 1BCPB 2EYFA 4U673 3RLFA 2ZXPA 4KY5A 2BH8A 2JXMB 2OCEA 4R1JA 2ZXRA 2WB1B 4DR4Q 1OXXK 1PH2A 3L3OC 1BBUA 3J7AF 2NVTB 3SR1A 4KKSA 1WTOA 4OX9L 2Z8LA 3M4OH 4ID6A 3RN2A 3S2HH 1F2YA 4JBJA 3I8ZA 1J5EL 2UXCQ 2VQEQ 4P2CB 3CCRA 3G71A 4DR3Q 1LTLA 2NWGA 3BS1A 4G7OC 1CKNA 4E6IA 3V2TA 4BY7B 1LT3D 1XTCD 2UXDL 3KF8A 2B2YC 3X3NA 5CV5A 1EWCA 5LMNW 4HJ7A 4NXNQ 1QVFA 2D0PA 2E2DC 2B2UA 1TWHH 5M3MH 4DNIA 3R93A 1RODA 1N36Q 3D3RA 1EL0A 1NMFA 4YCUA 1QB5D 1D1IA 4IUPA 1LO5D 4WORA 1L1OC 5CBEE 2J0TD 5LHY1 2BE5D 3K81C 5IIFA 2AQ3B 1RIPA 2F0EA 3E6ZX 1HR0W 4C2MB 4HIMA 3S2DB 1XNRQ 4RGTA 1I3QH 3U4ZA 4A3FB 2O2LD 3G6EA 1TWAH 4ZRZA 3GTMH 2XTIA 1Y1WB 3Q0AA 3GV6A 3LGJA 5E7NA 3JAME 4DV0L 2ICEC 2DUDA 2D9UA 1K0SA 4DKAC 2QA4A 3GTKB 3KDFB 4LFCQ 1PTOH 2F0KA 1SYBA 4CJ0B 2L11A 1VQ8A 5C0XI 1YJNA 4A3CH 1YEZA 3IL8A 1VQAA 1WI5A 1H9SA 2WAQE 3GTJB 2F4IA 2E2HB 2LS01 1K8AC 1WCMH 4A3GG 1XWEA 4ULLA 1KDAA 3S1NH 5FJ8G 4L5TA 2PMZE 1KRSA 1BCPD 2RCFA 5C5MA 2F0DA 4JV5Q 1E2ZA 4UDUC 4JVZA 4YWKA 4DK3C 2WAQB 4B08A 1MI2A 4HIDA 1I94L 4DV1L 1VCIA 3DM1A 4DXGA 1ONLA 4QIWE 1XNQL 1LTSD 1GUSA 3DUZA 4DV7Q 4JI4Q 1LACA 2PQEA 1Y8PB 3H0GG 4C1NK 5HY6A 4IUTA 4AYBB 3BZDB 4GNXB 4IO9A 4POFA 4DUZQ 2DY8A 4A3JB 2RQXA 5K36H 1Q81C 1N33L 3I2ZA 3CXCA 4QIWB 1IL2A 1BBWA 5I6YA 1VQCA 1D5ZC 3G4SA 2HHHL 2J7ZA 3A74A 3SEBA 3M4YA 1HFGA 1NE3A 4HIKA 4RMFA 3TBIB 1EQQA 1HA5A 3T1HL 4DR5Q 1V8QA 2PW5A 2IPKD 4JI1L 4DV6Q 3PF5A 2I5MX 2Z6KA 3UDFA 2K7VA 3I3CA 3HOVG 1SJHD 4C3IH 1HZBA 1C48A 2ICIA 2CCZA 1O7IA 4K8IA 5I9PA 3CC7A 1B9NA 1QUQB 4EQNA 4A3IB 2JA5B 2C5CA 2RKSA 1VMPA 4DR1L 1DM0B 2WIIB 3PO2H 1QE6A 3CAMA 5C0XH 1VQDA 1M1KC 5E4XA 2VY3A 2DGYA 1AH9A 1HCZA 5CYUA 5CMDA 3ONAB 4KK7A 1TWGB 4A3DB 2E2JB 1Z7TA 4TSSA 4XIGS 4F7XA 5J1ZA 1E0BA 1V1QA 2ZM6L 2X69A 4DK0A 3E3XA 4CDEC 3M7GA 2CHBD 3QJYA 2Z4IA 1MHWC 1D5XC 4HIOA 1VDZA 2JA6H 4LW1A 4IUVA 2UXCL 3K59A 1JE4A 1JWMD 3MWYW 4QMGA 1XJVA 2FMMA 3NK9A 4F87A 4K0KQ 1STAA 1Y1VG 3CCUA 2BA0A 1R4QB 5LMUL 1B3QA 3E9HA 4K14A 4NXMQ 3PMFA 2IWHA 4V0BA 1Y8NB 2RHQB 1N8RC 2Z0SA 3H91A 4YWMA 4LF6L 3S1RB 3T56B 2YTVA 4X62Q 1NCVA 2F0PA 1WTWA 1SLJA 1IYVA 4IUNA 4DAMA 1P16A 5EKIA 3T13A 4KHPL 3KK7A 4YCVA 3M85A 3DLLA 4I7AA 1S5ED 4JI7Q 4Y52H 5M5WH 2CWAA 4AQYQ 4ZKCB 1JWUD 4HSVA 2L15A 1XX8A 4DR7Q 1ILQA 4YWLA 3CMEA 1NNXA 2JA8H 1XNRL 3NENA 4LFAQ 2M2LA 2N49A 3MFGA 4A76A 3IRBA 3G7LA 4HTHA 2JN4A 4JBKA 2A68C 1T9HA 3SVMA 1JCKB 2B8FA 5IT9c 1K73C 2QCPX 4RHRA 2HQLA 1AZQA 2VB2X 3S17B 1Z47A 2WP8J 4ODGA 3I90A 1K83H 1SR3A 2DJFC 2Q2UA 4A3BG 4I7ZC 1VQGA 2F0JA 3J7A5 4RA8A 2FHTA 3AQQA 3B6YA 1GXDC 1NMGA 5LL6S 2JA7G 1H95A 1EY8A 3C1EA 2RBMA 3SXHA 1SROA 1STBA 5BR8L 3H6MA 2YYZA 2HCCA 1F9RA 3I91A 5GAGC 2VQFQ 3QB3A 2VUMB 1TWCH 4X64Q 2WKCA 4OWWB 1MJEA 3BJUA 2ATWA 4QL5A 4X65Q 1S5BD 3AFPA 4C1NI 4DNTB 1MJCA 1H9SB 2A68D 2LFNA 1TVXA 2B2UC 2YV5A 4Y7NH 4QF4A 2K5DA 2KHSA 3FMCA 2I07B 5C5LA 1I4PA 1XMOQ 4HJ5A 2MO1A 4C3JB 3HOWG 4Q0FA 2AQ2B 1Q90A 3TDQA 5ELDA 1G91A 2OT2A 1ZYRD 4O2DA 3I4NG 4QQBX 2R92B 4KJNA 1JOKA 1G6PA 1HZCA 1TS2A 2SDFA 4A75A 4DR6Q 1VMCA 3SK5A 2JYOA 1IL8A 4IPGA 5AFWA 3X3MA 1VS0A 1KNAA 4FF2A 1E24A 2PCFB 2NVTH 2D0OA 1T5EA 4FF1A 4GZYC 2PO4A 3F2CA 3I4MG 1CFMA 1M4VA 1L1OA 1JJCB 3OWEB 4A3EB 1KAWA 3A8JE 4B3MQ 1HHVA 1IBKL 4WJ4A 1GUWA 3I4OA 1O80A 2UXBL 4CKCA 4BY7H 1EUJA 1F2MA 1SYGA 2AUJD 2I5HA 4RHSA 3VR6A 4CGYB 1OTCA 1BXTA 3FPUB 3RUZA 3Q6SA 4P71A 3HOXB 2IJ0A 2F52A 2V4DA 1QILA 2ZTEA 4XYQA 3M4QA 1PH1A 1UE5A 2N3SA 2ZJQA 3CD6A 3E0JA 3R2TA 3S24A 1G2SA 4C2MH 4EGVA 3S2DH 3MAQA 3FKIB 4IURA 1KRTA 4LF5Q 3A8IE 2IHFA 2KCTA 4L6TB 4BY1B 4IFDG 4DFAA 5IYBH 2HUGA 1UNSA 1Y1WH 1YNND 1X3EA 1JJ2A 1EY5A 2BDNA 1QJOA 3GTKH 4PQXA 2FJ2A 4OHJA 3D0FA 4QCLA 2OF1A 3WOEA 4F8MA 5FO7B 1VQHA 3Q8DA 4IN3A 3GTJH 1XMQL 2IL8A 2E2HH 2AHOB 2SNMA 5IYDG 1MKHA 3PF4A 2K6AA 5COYA 1EYGA 3DM3A 2Z6KC 3CPWA 2HD3A 3HFZB 1XPUA 1YJWA 1VQMA 1FL0A 4TVAB 1LTGD 5C3XA 2VXWA 1B50A 2GN5A 4HMJA 1E7ZA 3KUPA 2BH2A 1JE5A 4BBSH 5GROA 5M3FB 4DV2L 4B3SL 3MA2B 5ELBA 4A93H 3CCSA 4JC0A 4ME3A 5D65A 4O1NA 2IX0A 4A3JH 4TRDA 1LV9A 3UE0A 2JA6B 3UDXA 3TSSA 1U5KA 2RCNA 3D6CA 5JJZA 4ZK9B 1HPCA 1N34Q 2NZHA 1Q1EA 1I4GA 5JPNC 3D6WA 3HKZB 4H0LC 4ZYSA 3KJOA 2NVQB 3CCQA 1KLUD 2K75A 4RGMA 3I70A 4FXKC 4RGOS 4H7BA 2F0IA 4A3LH 1GVPA 3PUWA 3OW7A 1C8CA 1EQTA 2PW7A 3NTIA 1TKWB 3EQLC 4JOIA 1KAAA 1Q46A 2Y0SB 4C3HG 4DU9A 2N78A 3BZKA 2NTTA 1S5CD 2VQFL 4DF7A 4YHHL 5EQ0A 4X64L 4DAYA 4BA2I 1D1KA 4F88A 4IJHA 2L5TA 5M3MG 3T16A 3TP6A 3VYSA 1E22A 2CH4W 1HFNA 3EJIA 1J8IA 1S40A 4A3IH 1IKMA 2EY1A 4HMIA 3HZXA 1WYDA 3MFYA 4JPBW 3TP7A 4XQNA 5FLXL 3GTOH 3STBC 1GHJA 4CKEA 1JJGA 3AYHB 1EU3A 2UUCQ 3BYYB 5C4JB 2F0HA 1D5MC 1QCBD 1GUNA 2GVBA 1IBML 2B8GA 2IHEA 3EFXD 4KKUA 3H3VC 4B3TQ 4A3DH 1U4RA 2E75C 3GTQB 1TS5A 4WJWA 4RKBA 1TXYA 2LMCB 2FFKB 3S16B 1DONA 4LNQA 1II3A 2A1AA 3PV0A 4P73A 3MVVA 2JP1A 3I55A 1SMYD 1WCMG 4PG3A 2MFIA 1OXUA 2Q8TA 2PNHA 3T1YQ 2CW0C 1N32L 4FXGC 1A6XA 1KQSA 1IXRA 4IALA 5ELOA 5EBDA 4NP5A 1B4OA 3LNNA 1SJED 4DUYL 1QVCA 2Q2HA 2EQSA 2K28A 1DGSA 4JBWA 2AUKA 1F2LA 3S1RH 1IW7D 5FLMG 3DWAA 2XGTA 5IGBA 3TN2A 4P75A 4R4OA 1WVLA 4JYAL 1FJGQ 5K36G 5CORA 2F4VL 4WJ3M 4DV3L 1L1OB 5JJLA 5C3EH 3L9AX 5EKLA 2CQAA 1BR9A 1HNWL 2B63B 1FVIA 1LT6D 1S5FD 4RAUC 1YIJA 2NN6H 2A6EC 2CW0D 4ZUIA 4KKTA 4ZUJA 1SDFA 5JAVA 3PIP3 1D7QA 1TIID 3OHXC 2F0QA 3R8BA 4BBRB 2LSSA 3PO3B 1K8OA 3S17H 1SE3A 3F8TA 2R61A 2FXQA 4G4KA 4C3IG 1B8AA 1EEFD 1U4LA 2A69D 4H44C 3J80c 4XQJA 2HT1A 4PMWA 1K0RA 1I4RA 3EIVA 3VA5A 1DYQA 2DNEA 4GN5A 2HDMA 1A62A 1LT5D 1PRTF 5DNFA 4LFBL 5JPMC 5CC4A 3CCJA 2OXPA 2UUBQ 1Y8OB 2VUMH 2Z1CA 3PO2G 1CK1A 3ERSX 1IYJB 4DGZA 5C0XG 2XRSD 2Z9HA 4B9XA 3DXJC 5GADC 3OWFA 1R4PB 3MC0B 1RTOA 1WTXA 4BXXH 3J7AV 1SSOA 3DEOA 4WRDA 3KFUA 3HOZB 4V190 4IQZA 1HTLD 3MXPA 4C3JH 3OTOQ 4OO1H 4UPAA 4HCSA 3KLWA 1WD1A 2R92H 1FNVA 3KF6A 3I56A 1VQEA 3RLNA 1JT8A 4HEDA 1SYDA 3TZUA 4J15A 3MHBA 1ENFA 1A3UA 2F0GA 4KJOA 1ML0D 2N88A 4JI6L 4MIUA 3V05A 3D8GA 1BUVT 1YBYA 4LF4Q 2IX3A 2L55A 3MEHA 1HQRD 4BBSB 5CV9A 5EGTA 3VR2A 2ZTDA 2ZT9C 4FF4A 2PMZB 2RSOA 4A3EH 2O4XA 2PZWA 4LF9L 4A93B 1B1ZA 4JI5Q 3BVMA 3FVQA 1UE7A 3BG3A 3TZDA 3JAML 3A7AB 4LUVA 5KEEA 1CQVA 2YU9B 1FR3A 2XWBB 4DV5Q 1GJXA 4J6HA 4CDFC 4ZLTF 1KC8C 2JA8G 3H3VI 3HOXH 3TREA 4EX5A 4LF8Q 2KHJA 1PTOF 1PA6A 4FNFA 2K4KA 1V1PB 1XPRA 1BNZA 4O0AA 4LUOA 5D14A 5LMNQ 1MSGA 3GTPB 5A35A 1IBLL 5E4WC 4GLXA 4IJLA 3S1MB 2F0LA 2E8GA 5AJ3L 3FKIH 3D4WA 2PI2A 4BY1H 1QNKA 2NBFA 4DV4L 3HS0C 4J1MA 1EYAA 4NPSA 4FDBA 2RDGA 2NTSA 2XRQD 3F2UA 4POGA 1CHQD 1Q8IA 1STGA 1NTGA 3H09A 2QDLA 4IUQA 1SNOA 2K32A 4JI3Q 2TSSA 2JE6I 3E5SA 3GTOB 4JOIC 4L63B 2VS1A 1HXYD 3CKIB 2E5LL 3PIO3 4NW2A 1XPOA 1V9PA 3U9OA 5IODA 2HIXA 3A8KE 1X3GA 1GM5A 1X3PA 3NBHA 1Y14B 2G9HD 3DEPA 1G2TA 1TY2A 1KTKA 1SYFA 3LX0A 5IGDA 4B3RQ 1Z6HA 3KLSX 2F0VA 1ZEQX 4R4IA 1SBBB 3RNUA 5M3FH 4MHEA 1PH6A 4GKKQ 4DR4L 1MD2D 4A3MB 3QR8A 3K58A 2R93G 4RKLA 5NUCA 3BU2A 3T53B 2NB0A 3HOYB 4HN7A 1S4ZA 1U9RA 4HJ8A 1NUCA 4HR7B 2VQEL 1I6HH 3DMUA 4RH6A 3S14B 4DR3L 3K80C 3RN5A 3NQTA 2WB1G 2D5DA 5DM63 3K5LA 2NVQH 4GLAC 3PIPA 1C9OA 2EOTA 4UHVA 2JSOA 5JEAJ 4NXNL 2B2TC 4CDCC 1WD0A 3VDYA 2H5XA 1PDQA 1PYSB 1G6ZA 2B2WA 1F9SA 5EPLA 3H3VH 1N36L 2BDOA 2EPBA 5FJ8H 1EZ8A 4BY7G 4N8FA 2CQOA 2VL6A 1QZHA 3QOLA 2KQ3A 2RF4A 5FLXc 1PXUA 1BBXC 1Q86C 3ICEA 2V1CC 4GKJQ 1H9MA 2UUBL 2PNRC 2EY6A 3A56A 3EROA 5C3EB 5ELEA 2JEBI 1YNJC 1EZ6A 3PUZA 1CKNB 1KIXA 4FP5D 2MNAA 4QB4A 2QGQA 1J9OA 3KF8B 1MIUA 3KJPA 4A3KB 2Z6BA 1JC7A 3NP8A 2MGSA 3M3YB 1HNZQ 2EXZA 4LFCL 3GP7A 1A15A 5C4XB 1S72A 1EYCA 3U58A 5M5XH 3KOJA 5C4JH 1LTID 1SYCA 3HOUB 3J80E 4KHZA 4A3FG 3J81c 5G3LF 4LF7Q 5IYBG 1Y1WG 3URYA 2MQHA 3GTQH 5ELCA 3A55A 1HH2P 1BKBA 1Y69U 2TMPA 3S16H 2PQAA 4JV5L 4JK1C 2CWPA 5C44B 1PRTC 3LWEA 4LF4L 5IWAQ 3SK4A 3MXNA 4DV7L 4JI4L 2N55A 2EYLA 5EPKA 5DAUA 2SNSA 2CKZB 1E2VA 4L8JA 1I6VC 3P7JA 4DUZL 4PZ7A 2WAQG 1EFID 2R7ZB 1KNEA 4KY6A 3IAYA 3VYRA 2M9VA 1CT1D 2EYOA 3N52A 4DV5L 5IP7H 1ASYA 2JQOA 1EIHA 3VA7A 4AYBG 2HQEA 2Q2IA 4LF8L 3NHHA 1B44D 4ALPA 4A3JG 1LTBD 5JOBA 4CJ1B 2XWJB 2F03A 5GAEC 3SK6A 4DR5L 4JI0Q 1WTQA 1X55A 4JW0A 4DV6L 3TQYA 1LABA 3FP9A 2Q8RE 2B63H 1O7LA 3EBEA 1UE6A 3LWUA 4GOPA 1YHQA 3CCEA 2WFWA 3GDEA 1PZJD 4A3LG 1PH9A 1TWFB 1QOHA 1M90C 2VZAA 1NR2A 5CV6A 3K5NA 4LMQD 2UU9Q 2H1EA 2L4NA 4BBRH 3PO3H 3BDOA 3SDZA 1EY0A 3OPOA 2DJGC 3MXGA 2EYMA 2PI2E 1RTNA 3R2IA 4X6AH 4H02A 2CVRA 1VQIA 4M1UB 1JQYD 1YJ9A 1B7YB 1AE3A 2EYPA 2N8NA 4OL7A 5A2QE 1PVOA 1GUTA 4A3IG 4BWGB 2JA5G 3ZJYC 1PTOC 4Q5VA 4P74A 1KXLA 3OMCA 5HURA 3TS0A 2ALYB 5ELFA 4B3RL 3I4LA 3H15A 4KD3A 4OIJA 3AB9A 4ME5A 3MTSA 2K05A 2KENA 5JVH3 1BCPF 2QDBA 1Q7YC 1LTTD 2ZJPA 1KHIA 3CHBD 4HAEA 4A3DG 2P5ZX 1JWSD 3RMHA 5IGFA 1CKOA 1VQ4A 2KHIA 4O42A 3NBIA 5JJKA 4KN7C 4IZ8A 3HOZH 2KA7A 1QWYA 1DZ1A 2MP1A 4NKLA 1I50B 4YCWA 4K0KL 4OXPA 1EIFA 4NXML 4X66Q 1M8AA 5I2YA 2EJGC 4YIJA 2AWOA 5CR3A 4EVOA 4X62L 1S5DD 1J5EQ 2G9DA 5L37A 2K01A 3NSWA 3NUCA 1CM9A 5M9OA 4JI7L 2UUAQ 3BDCA 3IKJA 1STEA 3UI2A 4AQYL 2UXDQ 5JEAH 3K0YA 5D3DA 1SNCA 1BDOA 1F2ZA 4GLVB 3GTGB 2KUMA 2WV6D 4FVMA 4OELB 3KDFA 3CCVA 4DR7L 2ES2A 1SNPA 5I9OA 1D2BA 4LFAL 5ISRA 4UAIA 2EIFA 1EWIA 2NVYH 4K8JA 1GO3E 1B70B 1KABA 1SFOB 2HCIA 1I6HB 5BN4A 3FDTA 1UAPA 4UP8A 2L1BA 2MHVA 5HGTA 2YU9H 4DNRB 3RR5A 2K5NA 1JICA 1PH4A 1KLGD 5DM73 4JI8Q 3QOJA 1DOKA 5E1FA 5M5YB 4DAPA 2NN6G 1PFSA 3AU7A 4A3GB 5IE8A 1OXSC 4DV0Q 4OWXB 1AW7A 5FLXE 3C46A 1RCVD 3GTPH 1ILPA 2KECA 2DNCA 3S15B 4FYDA 3S1MH 5C6AA 5KYLA 1OXVA 4GNXA 3UDIA 4IOCA 2EZVA 3ERQA 2K5HA 4DK6C 4L5QA 1HA6A 4M8AA 4LUZA 2KVMA 2OWOA 3NPPA 1EU4A 1UE1A 2F0WA 3M4PA 4TQUS 3H0GB 4A4IA 3PUYA 4OEMB 4XQQA 3IFTA 3ER0A 1VQJA 4X65L 5IT9E 3ND9A 4XTCS 1YHAA 2MO0A 1K8GA 1D6EC 4N9PA 2E76C 3GV3A 2QKIC 1XXGA 2B2WC 2XNAC 1F77A 1B53A 3R3OA 1I94Q 2VUMG 4DV1Q 4RGNA 3J81E 3K5MA 1CA6A 5M5XB 1XNQQ 5KNBA 1XMOL 3W5OA 2LY7A 3TS2A 1DD2A 3L2PA 4YY3Q 3VR4A 1HUMA 1EYDA 1TQOA 4BXXG 2B3GA 1B3AA 1G51A 1N33Q 1DOLA 4DR6L 3VYTA 4C3JG 2R7DA 2X6GA 2B2TA 2OQKA 4A3CG 1VQNA 3PQIA 1Q1BA 1QUQA 1C7YA 3EA6A 4OO1G 4LAAA 3K7AH 2CH4A 4A3MH 1ENAA 1O78A 2DN8A 3HOVB 2R92G 2LXKA 3HOYH 1ET6A 3T1HQ 2UU9L 1MGSA 4OGQC 4B3ML 1H9JA 3S14H 2K5VA 2GA4B 3F2BA 4HJAA 1TS4A 1U4PA 4JI1Q 2QW7A 3EN2A 2E74C 3C3LA 3STBD 2XSCA 3GQBA 4CHTB 3TRZA 2MJ8A 1F9QA 1HJPA 1NAPA 4DR2Q 2JEAI 4A3EG 3NEMA 1O7YA 3DWPA 5G3LD 1JORA 1LT4D 1X3FA 5IOCA 2Q8IB 2C9OA 3CCLA 5ELNA 1Q12A 3ZYYX 4DR1Q 3HOXG 2NYZD 3NTHA 4RCNA 4LF5L 2WB1E 5IP9H 3NWTA 2AWNA 1WFQA 3HEJA 3IFDA 2K1BA 1R9TB 4A3KH 3RZOB 3QO2A 5J3BA 3A54A 3M3YH 2RHSB 1IYUA 5IGGA 5I2XA 1P8LA 1G291 1I4QA 1AZPA 5C4XH 2BE5C 3T51B 3HOUH 1X54A 3RLOA 3FKIG 1Y1VB 4BY1G 2E2IB 3UDGA 5D3IB 2RSNA 4U68A 1C0AA 4X66L 4H13C 2WACA 3PSIA 2XIWA 4GOPC 3CQZB 1VQLA 4XDXA 4IPHA 5IYCH 1SNMA 1SXTA 2AQ1B 5C44H 1A63A 2UUAL 3MZ5A 4C3HH 5LMUQ 1PHJA 2IW3A 1HNXQ 2PPBC 4B9WA 4LF6Q 1I4XA 1VQ6A 4WFN3 4L5RC 2A6ED 3WWVA 2KOLA 1BCPC 2ID0A 1BVSA 4KHPQ
chains in the Genus database with same CATH topology
2R7ZH 2NN6I 1L1OA 1JJCB 1N34L 4HJ8A 1PV4A 2VQEL 1I6HH 1X65A 4DR3L 1KAWA 2PQAB 2F3IA 5M3FG 1IBKL 4B3MQ 4LF9Q 4WJ4A 2C35B 3I4OA 3K80C 4JG2A 3RN5A 2WB1G 4MTNA 2NVQH 2UXBL 4BY7H 4JI8L 1EUJA 4GLAC 3PIPA 1YI2A 1C9OA 2JA5H 3JAMi 2R7ZG 2JJQA 5GQOA 2JA6G 5JEAJ 4NXNL 3MXNB 4HJ9A 2I5HA 1OTCA 3VDYA 5GAHC 2H5XA 1PYSB 4JI0L 4IPDA 1GD7A 4P71A 3H3VH 1N36L 5FJ8H 3HKZG 2F52A 2HHHQ 2YTXA 2ZTEA 4BY7G 1QZHA 2CQOA 2GVAA 2VL6A 1EIYB 2OTLA 2K52A 3MEFA 4AIMA 2RF4A 1SN8A 3M4QA 4BA1I 5FLXc 2IX1A 3E9IA 4QJFA 1Q86C 1TWGH 1VQOA 2E2JH 2V1CC 1PH1A 1UE5A 1TWFH 2N3SA 2UUBL 2ZJQA 3ICEA 4GKJQ 3F2DA 3CD6A 1HZAA 1CSQA 4R4CA 3GO5A 1KL9A 2JEBI 3S24A 1JMCA 1IBLQ 4C2MH 4AYBE 3PUZA 1CKNB 1LUZA 1QVGA 1ASZA 3CC2A 3S2DH 2ZJRA 1KRTA 2MNAA 1FGUA 1KIXA 4RG1A 5AJ3Q 2IHFA 2KBNA 2KCTA 2Y0SG 5BR8Q 4LF5Q 2QGQA 5IYBH 2A8VA 3KF8B 1MIUA 3KJPA 4IFDG 2VW9A 1Y1WH 1X3EA 4JI2L 1JJ2A 5IYDH 4PZ8A 1UEBA 4AH6A 1HNZQ 4LFCL 2UUCL 4UY8C 4DV4Q 1VQ5A 3GTKH 1S72A 3J80i 3U58A 5M5XH 1X56A 2R6GA 3KOJA 3D0FA 5C4JH 5C0XJ 2KCMA 1VQPA 5FLMH 4KHZA 4A3FG 3PGZA 2ZTCA 3J81c 4LF7Q 1VQHA 4GOPB 5IYBG 4YY3L 3Q8DA 3RZDH 4B3TL 3M9BA 3GTJH 1Y1WG 1XMQL 2E2HH 2AHOB 4OO1I 2MQHA 5IYDG 1MKHA 3PF4A 3F1ZA 1D8LA 4DPGA 3GTQH 1CUKA 3L7ZC 4DAYB 1EYGA 3DM3A 2K14A 2Z6KC 2E5LQ 1HH2P 3CPWA 1BKBA 1Q8KA 3KYHC 3S16H 2PQAA 1V43A 4JV5L 2CWPA 3HFZB 3J81j 1VQBA 1XPUA 1YJWA 1VQMA 1FL0A 4LF4L 4TVAB 1NBWA 5IWAQ 4JBMA 2D62A 3T1YL 2GN5A 4DV7L 4JI4L 2ZM6Q 1E7ZA 4NB3A 2BH2A 1JE5A 3RLFA 4BBSH 5GROA 1OXTA 2BH8A 2CKZB 2OCEA 3CMAA 4DV2L 1HR0Q 4R1JA 1I50H 4DR4Q 4B3SL 1OXXK 1EQRA 1PH2A 1CKMA 4A93H 4DUZL 3CCSA 4JC0A 1BBUA 4PZ7A 4KHPQ 2WAQG 4ME3A 2IX0A 4A3JH 4OX9L 3CF5A 3M4OH 3UE0A 1VQ9A 1E3PA 3UDXA 1LYLA 1U5KA 2RCNA 5IY0A 1L2FA 3RN2A 4JBJA 1VQKA 3S2HH 1N34Q 3I7FA 4DR2L 1J5EL 2ASBA 2UXCQ 2VQEQ 4GNXC 2NZHA 3CCRA 3G71A 5IP7H 4DV5L 2JQOA 4DR3Q 1LTLA 1Q1EA 1ASYA 3M7NA 4AYBG 1IBKQ 2CFMA 1CKNA 1EOVA 3KJOA 2Q2IA 4LF8L 3CCQA 2UXBQ 4ALPA 2K75A 1FJGL 2UXDL 4A3JG 1KD1C 4A3LH 5LMNW 4HJ7A 1GVPA 3PUWA 5GAEC 4NXNQ 1QVFA 2D0PA 3GTGH 4DR5L 4JI0Q 5IP7G 1TWHH 5M3MH 4UP7A 4DNIA 1X55A 1K3RA 1N36Q 4JOIA 3A5UA 4DV6L 3F2CA 1NMFA 4YCUA 3TQYA 3U50C 3FP9A 1Q46A 4PZ6A 2B63H 3AEVA 3EBEA 1UE6A 4GOPA 1YHQA 1L1OC 3CCEA 2WFWA 3GDEA 2N78A 3BZKA 4A3LG 1PH9A 1SFOH 2VQFL 1M90C 2VZAA 4YHHL 3K81C 2YTYA 4X64L 1U0LA 4R4TA 4BA2I 3L0OA 4IJHA 4R4QA 2UU9Q 1RIPA 5M3MG 1HR0W 4BBRH 3PO3H 4HIMA 1E22A 1XNRQ 1I3QH 3U4ZA 3G6EA 1TWAH 1S40A 2B63G 4L5SA 4A3IH 3GTMH 2PI2E 2XTIA 5M5YH 4X6AH 1WYDA 3LGJA 5E7NA 4DV0L 4A3GH 2DUDA 4H02A 4DKAC 2QA4A 3GTOH 3STBC 1JJGA 3CCMA 3AYHB 3KDFB 4LFCQ 3ULPA 2UUCQ 1VQIA 5EAYA 4BBRG 3PO3G 1VQ8A 1YJ9A 1GKHA 1B7YB 1W2BA 1AE3A 2N8NA 2IT1A 5C0XI 1Z9FA 1YJNA 3S15H 1YEZA 4A3CH 1PVOA 2GVBA 1VQAA 1WI5A 3CP0A 4A3IG 3U4VA 1VQFA 2IHEA 2WAQE 1IBML 3CPFA 4QY7A 3ZJYC 1PH8A 2JA5G 1KXLA 4P74A 1K8AC 4B3TQ 1XMQQ 4A3DH 1WCMH 4A3GG 5H1SE 2ALYB 3TS0A 4B3RL 3H15A 1HNXL 1TXYA 3S1NH 5FJ8G 4GS3A 2PMZE 3H0GH 4L5TA 1YZ6A 1KRSA 4LNQA 2A1AA 3PV0A 4P73A 4IOAA 4JV5Q 2KENA 4DK3C 4YWKA 1Q7YC 1I5FA 3S1QH 2ZJPA 1KHIA 3I55A 2LXJA 1CSPA 4A3DG 4HIDA 1WCMG 4PG3A 1I94L 2MFIA 4DV1L 1CKOA 1VCIA 1VQ4A 2KHIA 5JJKA 4IPCA 1OXUA 4QIWE 1XNQL 1NY4A 2PNHA 3T1YQ 1HZ9A 4DV7Q 4JI4Q 4JCVE 1N32L 3HOZH 1KQSA 1YVCA 1YNXA 3H0GG 1IXRA 5ELOA 5HY6A 4DV2Q 4YCWA 3OTOL 4K0KL 4OXPA 2EXDA 4B3SQ 1EIFA 4DUYL 4GNXB 4POFA 4DUZQ 1QVCA 3J7ZC 4IO9A 4NXML 2AKWB 1EFWA 2A19A 2Q2HA 1IZ6A 2EQSA 1Q81C 1N33L 4X66Q 3I2ZA 3CXCA 3HOZG 1IL2A 2AWOA 4X62L 1DGSA 1A0IA 4JBWA 1BBWA 3S1RH 1J5EQ 5FLMG 1VQCA 4LWCA 2XGTA 2I0QA 2OQ0A 3G4SA 2HHHL 3W1BA 3A74A 4P75A 4R4OA 4JI7L 2UUAQ 1PYBA 4JYAL 1FJGQ 3HOVH 4AQYL 2UXDQ 5K36G 1XTDA 1NE3A 3G48A 4RMFA 4HIKA 1EQQA 2F4VL 4GN4B 1WJJA 4GLVB 1X6OA 4DV3L 4WJ3M 3T1HL 1L1OB 5JJLA 3KDFA 3CCVA 1PH7A 4DR7L 5C3EH 4DR5Q 2ES2A 5JJIA 1S3OA 4LFAL 1HNWL 4JI1L 4DV6Q 3PF5A 4JI5L 1FVIA 2EIFA 1EWIA 2R7FA 2I5MX 2NVYH 1GO3E 1B70B 2Z6KA 3D31A 2JK8A 3UDFA 2VNUD 1YIJA 3HOVG 5JEAG 4C3IH 4OWTB 3KF6B 3AFQA 1HZBA 1QZGA 1K9MC 4YHHQ 2CCZA 1O7IA 4UP8A 4BBSG 1D7QA 2BA1A 2YU9H 2B29A 3RR5A 2K5NA 2LSSA 1PH4A 3CC7A 3S17H 1QUQB 4P72A 4A93G 3F8TA 4JI8Q 2NN6G 1PFSA 2FXQA 1L0WA 4IFDJ 1B8AA 5IE8A 1OXSC 1WOCA 1RL2A 4DV0Q 5LMNL 4DR1L 3J80c 4OWXB 3PO2H 3CAMA 3GTPH 2HT1A 1A8VA 1VQDA 4PMWA 1K0RA 1M1KC 3S1MH 3EIVA 2VY3A 2DGYA 1AH9A 4GN5A 1A62A 1OXVA 1IBMQ 4GNXA 3UDIA 4IOCA 4LFBL 1R9TH 2K5HA 4DK6C 4L5QA 4XIGS 3RZOH 3CCJA 2R93H 2UUBQ 2HIVA 4LUZA 3PCOB 2VUMH 3PO2G 1V1QA 2ZM6L 2OWOA 3ERSX 1UE1A 4TQUS 3ULJA 3M4PA 4A4IA 1IYJB 3PUYA 5C0XG 3ER0A 1VQJA 3W1GA 4X65L 5GADC 1HR0L 4XTCS 1YHAA 2MO0A 1AE2A 1K8GA 1VQ7A 4JI3L 1Y1VH 2E2IH 3BZCA 3J81i 4HIOA 1E1TA 4JI2Q 4BXXH 4QGUA 1I94Q 2VUMG 4DV1Q 2K50A 3E0EA 1XNQQ 4LW1A 1XMOL 2JA6H 3KFUA 3JC66 3HKSA 1N32Q 3W5OA 3TEHB 2UXCL 2AMCB 3TS2A 3CQZH 4C3JH 2IY5B 3A0JA 1SMXA 5DLQE 1XJVA 3UE1A 3OTOQ 3L2PA 4K0KQ 3PIOA 4MNOA 1Y1VG 4YY3Q 4UPAA 3CCUA 2BA0A 2QEXA 4DUYQ 3CW2C 5LMUL 3KLWA 3E9HA 4NXMQ 2B3GA 2R92H 4BXXG 3I56A 2RHQB 3KF6A 1G51A 1N33Q 1VQEA 3RLNA 1JT8A 1N8RC 4DR6L 2Z0SA 4YWMA 4LF6L 2YTVA 4X62Q 4J15A 2R7DA 4A3CG 4GKKL 2OQKA 4MZ9A 2I5LX 1SLJA 1VQNA 1Q1BA 1QUQA 4DAMA 1C7YA 1P16A 4OO1G 1J6QA 3K7AH 4A3MH 4JI6L 4KHPL 4YCVA 3M85A 1YBYA 3DLLA 4JI7Q 4LF4Q 2R92G 4JYAQ 4Y52H 5M5WH 2CWAA 2LXKA 4AQYQ 1YITA 3HOYH 2F4VQ 3K0XA 5HGQA 1PH3A 3K8AA 4DV3Q 1SRUA 2L15A 3ULLA 3OW2A 3T1HQ 2ZTDA 2UU9L 4A3EH 4DR7Q 4B3ML 1SE8A 3S14H 4YWLA 2K5VA 4LF9L 3CMEA 3GTLH 2JA8H 3F2BA 4HJAA 3NBHB 1XNRL 3NENA 4LFAQ 1HNWQ 4JI1Q 2N49A 3PUXA 4A3MG 3EN2A 4A3FH 4JI5Q 1UE7A 3IRBA 4A76A 3STBD 4JBKA 4OX9Q 1T9HA 3HOYG 3TRZA 4A3BH 4GN3B 4LUVA 1HJPA 1W3SA 4DR2Q 3CC4A 5IT9c 1K73C 4APVA 2JEAI 4A3EG 2HQLA 3NEMA 4DV5Q 1X9NA 2JA7H 1KC8C 3H3VI 2JA8G 3HOXH 1Z47A 2NZOA 2WP8J 3TREA 4EX5A 4LF8Q 2KHJA 4OONA 3JAMc 1X3FA 1K83H 1PA6A 2NVXH 1SR3A 3CCLA 2Q2UA 5ELNA 4IFDI 2K4KA 4A3BG 4GKJL 1Q12A 1XPRA 1VQGA 4O0AA 3J7A5 4LUOA 5LMNQ 1UWVA 3SGIA 4DR1Q 3B6YA 3AQQA 1NMGA 1IBLL 2JA7G 1H95A 4GLXA 4IJLA 3HOXG 1SROA 2E8GA 2WB1E 5IP9H 3NELA 5AJ3L 4LF5L 3FKIH 5BR8L 2AWNA 2PI2A 2YYZA 4BY1H 1WFQA 5GAGC 4LFBQ 4A3KH 2VQFQ 5J3BA 1HNZL 1TWCH 2RHSB 3M3YH 4KI0A 1P8LA 4DV4L 4X64Q 1N9WA 1G291 4OWWB 5C3EG 1MJEA 5C4XH 4NPSA 1LM0A 4FDBA 3BJUA 1PH5A 4POGA 4EQ5A 2ATWA 3K7UC 4QL5A 3HOWH 4X65Q 3HOUH 3HKZE 3AFPA 1NTGA 1X54A 5IP9G 3RLOA 3FKIG 4LF7L 1MJCA 3OYYA 4BY1G 1YHBA 3UDGA 4JI3Q 4A3KG 1E1OA 2YV5A 4Y7NH 3I4NH 2JE6I 1C0AA 4JOIC 2VS1A 4X66L 2E5LL 5C4XG 1XMOQ 4HJ5A 3PSIA 4GOPC 2MO1A 1XPOA 1Q82C 1VQLA 3HOWG 1V9PA 2HIXA 4IPHA 1GM5A 1X3GA 5IYCH 3HOUG 1Y14B 5C44H 1JB7A 2Y0SE 4UP9A 4O2DA 2Q2TA 1A63A 4KLKA 2UUAL 3I4NG 4QQBX 4C3HH 5IWAL 5LMUQ 3FHWA 1PHJA 1NJIC 3I4MH 2OTJA 3PUVA 4B3RQ 1G6PA 1HZCA 1HNXQ 4A75A 2JA9A 4R4IA 4DR6Q 4LF6Q 4IPGA 1VQ6A 3RNUA 3GD7A 5IYCG 5M3FH 1PH6A 4GKKQ 4L5RC 4DR4L 3A5ZB 1VS0A 5C44G 3WWVA 1E24A 2R93G 2ID0A 4JI6Q 1BVSA 2D0OA 2NVTH 3BU2A 3I4MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z H;  2NN6 I;  1L1O A;  1JJC B;  1N34 L;  4HJ8 A;  1PV4 A;  2VQE L;  1I6H H;  1X65 A;  4DR3 L;  1KAW A;  2PQA B;  2F3I A;  5M3F G;  1IBK L;  4B3M Q;  4LF9 Q;  4WJ4 A;  2C35 B;  3I4O A;  3K80 C;  4JG2 A;  3RN5 A;  2WB1 G;  4MTN A;  2NVQ H;  2UXB L;  4BY7 H;  4JI8 L;  1EUJ A;  4GLA C;  3PIP A;  1YI2 A;  1C9O A;  2JA5 H;  3JAM i;  2R7Z G;  2JJQ A;  5GQO A;  2JA6 G;  5JEA J;  4NXN L;  3MXN B;  4HJ9 A;  2I5H A;  1OTC A;  3VDY A;  5GAH C;  2H5X A;  1PYS B;  4JI0 L;  4IPD A;  1GD7 A;  4P71 A;  3H3V H;  1N36 L;  5FJ8 H;  3HKZ G;  2F52 A;  2HHH Q;  2YTX A;  2ZTE A;  4BY7 G;  1QZH A;  2CQO A;  2GVA A;  2VL6 A;  1EIY B;  2OTL A;  2K52 A;  3MEF A;  4AIM A;  2RF4 A;  1SN8 A;  3M4Q A;  4BA1 I;  5FLX c;  2IX1 A;  3E9I A;  4QJF A;  1Q86 C;  1TWG H;  1VQO A;  2E2J H;  2V1C C;  1PH1 A;  1UE5 A;  1TWF H;  2N3S A;  2UUB L;  2ZJQ A;  3ICE A;  4GKJ Q;  3F2D A;  3CD6 A;  1HZA A;  1CSQ A;  4R4C A;  3GO5 A;  1KL9 A;  2JEB I;  3S24 A;  1JMC A;  1IBL Q;  4C2M H;  4AYB E;  3PUZ A;  1CKN B;  1LUZ A;  1QVG A;  1ASZ A;  3CC2 A;  3S2D H;  2ZJR A;  1KRT A;  2MNA A;  1FGU A;  1KIX A;  4RG1 A;  5AJ3 Q;  2IHF A;  2KBN A;  2KCT A;  2Y0S G;  5BR8 Q;  4LF5 Q;  2QGQ A;  5IYB H;  2A8V A;  3KF8 B;  1MIU A;  3KJP A;  4IFD G;  2VW9 A;  1Y1W H;  1X3E A;  4JI2 L;  1JJ2 A;  5IYD H;  4PZ8 A;  1UEB A;  4AH6 A;  1HNZ Q;  4LFC L;  2UUC L;  4UY8 C;  4DV4 Q;  1VQ5 A;  3GTK H;  1S72 A;  3J80 i;  3U58 A;  5M5X H;  1X56 A;  2R6G A;  3KOJ A;  3D0F A;  5C4J H;  5C0X J;  2KCM A;  1VQP A;  5FLM H;  4KHZ A;  4A3F G;  3PGZ A;  2ZTC A;  3J81 c;  4LF7 Q;  1VQH A;  4GOP B;  5IYB G;  4YY3 L;  3Q8D A;  3RZD H;  4B3T L;  3M9B A;  3GTJ H;  1Y1W G;  1XMQ L;  2E2H H;  2AHO B;  4OO1 I;  2MQH A;  5IYD G;  1MKH A;  3PF4 A;  3F1Z A;  1D8L A;  4DPG A;  3GTQ H;  1CUK A;  3L7Z C;  4DAY B;  1EYG A;  3DM3 A;  2K14 A;  2Z6K C;  2E5L Q;  1HH2 P;  3CPW A;  1BKB A;  1Q8K A;  3KYH C;  3S16 H;  2PQA A;  1V43 A;  4JV5 L;  2CWP A;  3HFZ B;  3J81 j;  1VQB A;  1XPU A;  1YJW A;  1VQM A;  1FL0 A;  4LF4 L;  4TVA B;  1NBW A;  5IWA Q;  4JBM A;  2D62 A;  3T1Y L;  2GN5 A;  4DV7 L;  4JI4 L;  2ZM6 Q;  1E7Z A;  4NB3 A;  2BH2 A;  1JE5 A;  3RLF A;  4BBS H;  5GRO A;  1OXT A;  2BH8 A;  2CKZ B;  2OCE A;  3CMA A;  4DV2 L;  1HR0 Q;  4R1J A;  1I50 H;  4DR4 Q;  4B3S L;  1OXX K;  1EQR A;  1PH2 A;  1CKM A;  4A93 H;  4DUZ L;  3CCS A;  4JC0 A;  1BBU A;  4PZ7 A;  4KHP Q;  2WAQ G;  4ME3 A;  2IX0 A;  4A3J H;  4OX9 L;  3CF5 A;  3M4O H;  3UE0 A;  1VQ9 A;  1E3P A;  3UDX A;  1LYL A;  1U5K A;  2RCN A;  5IY0 A;  1L2F A;  3RN2 A;  4JBJ A;  1VQK A;  3S2H H;  1N34 Q;  3I7F A;  4DR2 L;  1J5E L;  2ASB A;  2UXC Q;  2VQE Q;  4GNX C;  2NZH A;  3CCR A;  3G71 A;  5IP7 H;  4DV5 L;  2JQO A;  4DR3 Q;  1LTL A;  1Q1E A;  1ASY A;  3M7N A;  4AYB G;  1IBK Q;  2CFM A;  1CKN A;  1EOV A;  3KJO A;  2Q2I A;  4LF8 L;  3CCQ A;  2UXB Q;  4ALP A;  2K75 A;  1FJG L;  2UXD L;  4A3J G;  1KD1 C;  4A3L H;  5LMN W;  4HJ7 A;  1GVP A;  3PUW A;  5GAE C;  4NXN Q;  1QVF A;  2D0P A;  3GTG H;  4DR5 L;  4JI0 Q;  5IP7 G;  1TWH H;  5M3M H;  4UP7 A;  4DNI A;  1X55 A;  1K3R A;  1N36 Q;  4JOI A;  3A5U A;  4DV6 L;  3F2C A;  1NMF A;  4YCU A;  3TQY A;  3U50 C;  3FP9 A;  1Q46 A;  4PZ6 A;  2B63 H;  3AEV A;  3EBE A;  1UE6 A;  4GOP A;  1YHQ A;  1L1O C;  3CCE A;  2WFW A;  3GDE A;  2N78 A;  3BZK A;  4A3L G;  1PH9 A;  1SFO H;  2VQF L;  1M90 C;  2VZA A;  4YHH L;  3K81 C;  2YTY A;  4X64 L;  1U0L A;  4R4T A;  4BA2 I;  3L0O A;  4IJH A;  4R4Q A;  2UU9 Q;  1RIP A;  5M3M G;  1HR0 W;  4BBR H;  3PO3 H;  4HIM A;  1E22 A;  1XNR Q;  1I3Q H;  3U4Z A;  3G6E A;  1TWA H;  1S40 A;  2B63 G;  4L5S A;  4A3I H;  3GTM H;  2PI2 E;  2XTI A;  5M5Y H;  4X6A H;  1WYD A;  3LGJ A;  5E7N A;  4DV0 L;  4A3G H;  2DUD A;  4H02 A;  4DKA C;  2QA4 A;  3GTO H;  3STB C;  1JJG A;  3CCM A;  3AYH B;  3KDF B;  4LFC Q;  3ULP A;  2UUC Q;  1VQI A;  5EAY A;  4BBR G;  3PO3 G;  1VQ8 A;  1YJ9 A;  1GKH A;  1B7Y B;  1W2B A;  1AE3 A;  2N8N A;  2IT1 A;  5C0X I;  1Z9F A;  1YJN A;  3S15 H;  1YEZ A;  4A3C H;  1PVO A;  2GVB A;  1VQA A;  1WI5 A;  3CP0 A;  4A3I G;  3U4V A;  1VQF A;  2IHE A;  2WAQ E;  1IBM L;  3CPF A;  4QY7 A;  3ZJY C;  1PH8 A;  2JA5 G;  1KXL A;  4P74 A;  1K8A C;  4B3T Q;  1XMQ Q;  4A3D H;  1WCM H;  4A3G G;  5H1S E;  2ALY B;  3TS0 A;  4B3R L;  3H15 A;  1HNX L;  1TXY A;  3S1N H;  5FJ8 G;  4GS3 A;  2PMZ E;  3H0G H;  4L5T A;  1YZ6 A;  1KRS A;  4LNQ A;  2A1A A;  3PV0 A;  4P73 A;  4IOA A;  4JV5 Q;  2KEN A;  4DK3 C;  4YWK A;  1Q7Y C;  1I5F A;  3S1Q H;  2ZJP A;  1KHI A;  3I55 A;  2LXJ A;  1CSP A;  4A3D G;  4HID A;  1WCM G;  4PG3 A;  1I94 L;  2MFI A;  4DV1 L;  1CKO A;  1VCI A;  1VQ4 A;  2KHI A;  5JJK A;  4IPC A;  1OXU A;  4QIW E;  1XNQ L;  1NY4 A;  2PNH A;  3T1Y Q;  1HZ9 A;  4DV7 Q;  4JI4 Q;  4JCV E;  1N32 L;  3HOZ H;  1KQS A;  1YVC A;  1YNX A;  3H0G G;  1IXR A;  5ELO A;  5HY6 A;  4DV2 Q;  4YCW A;  3OTO L;  4K0K L;  4OXP A;  2EXD A;  4B3S Q;  1EIF A;  4DUY L;  4GNX B;  4POF A;  4DUZ Q;  1QVC A;  3J7Z C;  4IO9 A;  4NXM L;  2AKW B;  1EFW A;  2A19 A;  2Q2H A;  1IZ6 A;  2EQS A;  1Q81 C;  1N33 L;  4X66 Q;  3I2Z A;  3CXC A;  3HOZ G;  1IL2 A;  2AWO A;  4X62 L;  1DGS A;  1A0I A;  4JBW A;  1BBW A;  3S1R H;  1J5E Q;  5FLM G;  1VQC A;  4LWC A;  2XGT A;  2I0Q A;  2OQ0 A;  3G4S A;  2HHH L;  3W1B A;  3A74 A;  4P75 A;  4R4O A;  4JI7 L;  2UUA Q;  1PYB A;  4JYA L;  1FJG Q;  3HOV H;  4AQY L;  2UXD Q;  5K36 G;  1XTD A;  1NE3 A;  3G48 A;  4RMF A;  4HIK A;  1EQQ A;  2F4V L;  4GN4 B;  1WJJ A;  4GLV B;  1X6O A;  4DV3 L;  4WJ3 M;  3T1H L;  1L1O B;  5JJL A;  3KDF A;  3CCV A;  1PH7 A;  4DR7 L;  5C3E H;  4DR5 Q;  2ES2 A;  5JJI A;  1S3O A;  4LFA L;  1HNW L;  4JI1 L;  4DV6 Q;  3PF5 A;  4JI5 L;  1FVI A;  2EIF A;  1EWI A;  2R7F A;  2I5M X;  2NVY H;  1GO3 E;  1B70 B;  2Z6K A;  3D31 A;  2JK8 A;  3UDF A;  2VNU D;  1YIJ A;  3HOV G;  5JEA G;  4C3I H;  4OWT B;  3KF6 B;  3AFQ A;  1HZB A;  1QZG A;  1K9M C;  4YHH Q;  2CCZ A;  1O7I A;  4UP8 A;  4BBS G;  1D7Q A;  2BA1 A;  2YU9 H;  2B29 A;  3RR5 A;  2K5N A;  2LSS A;  1PH4 A;  3CC7 A;  3S17 H;  1QUQ B;  4P72 A;  4A93 G;  3F8T A;  4JI8 Q;  2NN6 G;  1PFS A;  2FXQ A;  1L0W A;  4IFD J;  1B8A A;  5IE8 A;  1OXS C;  1WOC A;  1RL2 A;  4DV0 Q;  5LMN L;  4DR1 L;  3J80 c;  4OWX B;  3PO2 H;  3CAM A;  3GTP H;  2HT1 A;  1A8V A;  1VQD A;  4PMW A;  1K0R A;  1M1K C;  3S1M H;  3EIV A;  2VY3 A;  2DGY A;  1AH9 A;  4GN5 A;  1A62 A;  1OXV A;  1IBM Q;  4GNX A;  3UDI A;  4IOC A;  4LFB L;  1R9T H;  2K5H A;  4DK6 C;  4L5Q A;  4XIG S;  3RZO H;  3CCJ A;  2R93 H;  2UUB Q;  2HIV A;  4LUZ A;  3PCO B;  2VUM H;  3PO2 G;  1V1Q A;  2ZM6 L;  2OWO A;  3ERS X;  1UE1 A;  4TQU S;  3ULJ A;  3M4P A;  4A4I A;  1IYJ B;  3PUY A;  5C0X G;  3ER0 A;  1VQJ A;  3W1G A;  4X65 L;  5GAD C;  1HR0 L;  4XTC S;  1YHA A;  2MO0 A;  1AE2 A;  1K8G A;  1VQ7 A;  4JI3 L;  1Y1V H;  2E2I H;  3BZC A;  3J81 i;  4HIO A;  1E1T A;  4JI2 Q;  4BXX H;  4QGU A;  1I94 Q;  2VUM G;  4DV1 Q;  2K50 A;  3E0E A;  1XNQ Q;  4LW1 A;  1XMO L;  2JA6 H;  3KFU A;  3JC6 6;  3HKS A;  1N32 Q;  3W5O A;  3TEH B;  2UXC L;  2AMC B;  3TS2 A;  3CQZ H;  4C3J H;  2IY5 B;  3A0J A;  1SMX A;  5DLQ E;  1XJV A;  3UE1 A;  3OTO Q;  3L2P A;  4K0K Q;  3PIO A;  4MNO A;  1Y1V G;  4YY3 Q;  4UPA A;  3CCU A;  2BA0 A;  2QEX A;  4DUY Q;  3CW2 C;  5LMU L;  3KLW A;  3E9H A;  4NXM Q;  2B3G A;  2R92 H;  4BXX G;  3I56 A;  2RHQ B;  3KF6 A;  1G51 A;  1N33 Q;  1VQE A;  3RLN A;  1JT8 A;  1N8R C;  4DR6 L;  2Z0S A;  4YWM A;  4LF6 L;  2YTV A;  4X62 Q;  4J15 A;  2R7D A;  4A3C G;  4GKK L;  2OQK A;  4MZ9 A;  2I5L X;  1SLJ A;  1VQN A;  1Q1B A;  1QUQ A;  4DAM A;  1C7Y A;  1P16 A;  4OO1 G;  1J6Q A;  3K7A H;  4A3M H;  4JI6 L;  4KHP L;  4YCV A;  3M85 A;  1YBY A;  3DLL A;  4JI7 Q;  4LF4 Q;  2R92 G;  4JYA Q;  4Y52 H;  5M5W H;  2CWA A;  2LXK A;  4AQY Q;  1YIT A;  3HOY H;  2F4V Q;  3K0X A;  5HGQ A;  1PH3 A;  3K8A A;  4DV3 Q;  1SRU A;  2L15 A;  3ULL A;  3OW2 A;  3T1H Q;  2ZTD A;  2UU9 L;  4A3E H;  4DR7 Q;  4B3M L;  1SE8 A;  3S14 H;  4YWL A;  2K5V A;  4LF9 L;  3CME A;  3GTL H;  2JA8 H;  3F2B A;  4HJA A;  3NBH B;  1XNR L;  3NEN A;  4LFA Q;  1HNW Q;  4JI1 Q;  2N49 A;  3PUX A;  4A3M G;  3EN2 A;  4A3F H;  4JI5 Q;  1UE7 A;  3IRB A;  4A76 A;  3STB D;  4JBK A;  4OX9 Q;  1T9H A;  3HOY G;  3TRZ A;  4A3B H;  4GN3 B;  4LUV A;  1HJP A;  1W3S A;  4DR2 Q;  3CC4 A;  5IT9 c;  1K73 C;  4APV A;  2JEA I;  4A3E G;  2HQL A;  3NEM A;  4DV5 Q;  1X9N A;  2JA7 H;  1KC8 C;  3H3V I;  2JA8 G;  3HOX H;  1Z47 A;  2NZO A;  2WP8 J;  3TRE A;  4EX5 A;  4LF8 Q;  2KHJ A;  4OON A;  3JAM c;  1X3F A;  1K83 H;  1PA6 A;  2NVX H;  1SR3 A;  3CCL A;  2Q2U A;  5ELN A;  4IFD I;  2K4K A;  4A3B G;  4GKJ L;  1Q12 A;  1XPR A;  1VQG A;  4O0A A;  3J7A 5;  4LUO A;  5LMN Q;  1UWV A;  3SGI A;  4DR1 Q;  3B6Y A;  3AQQ A;  1NMG A;  1IBL L;  2JA7 G;  1H95 A;  4GLX A;  4IJL A;  3HOX G;  1SRO A;  2E8G A;  2WB1 E;  5IP9 H;  3NEL A;  5AJ3 L;  4LF5 L;  3FKI H;  5BR8 L;  2AWN A;  2PI2 A;  2YYZ A;  4BY1 H;  1WFQ A;  5GAG C;  4LFB Q;  4A3K H;  2VQF Q;  5J3B A;  1HNZ L;  1TWC H;  2RHS B;  3M3Y H;  4KI0 A;  1P8L A;  4DV4 L;  4X64 Q;  1N9W A;  1G29 1;  4OWW B;  5C3E G;  1MJE A;  5C4X H;  4NPS A;  1LM0 A;  4FDB A;  3BJU A;  1PH5 A;  4POG A;  4EQ5 A;  2ATW A;  3K7U C;  4QL5 A;  3HOW H;  4X65 Q;  3HOU H;  3HKZ E;  3AFP A;  1NTG A;  1X54 A;  5IP9 G;  3RLO A;  3FKI G;  4LF7 L;  1MJC A;  3OYY A;  4BY1 G;  1YHB A;  3UDG A;  4JI3 Q;  4A3K G;  1E1O A;  2YV5 A;  4Y7N H;  3I4N H;  2JE6 I;  1C0A A;  4JOI C;  2VS1 A;  4X66 L;  2E5L L;  5C4X G;  1XMO Q;  4HJ5 A;  3PSI A;  4GOP C;  2MO1 A;  1XPO A;  1Q82 C;  1VQL A;  3HOW G;  1V9P A;  2HIX A;  4IPH A;  1GM5 A;  1X3G A;  5IYC H;  3HOU G;  1Y14 B;  5C44 H;  1JB7 A;  2Y0S E;  4UP9 A;  4O2D A;  2Q2T A;  1A63 A;  4KLK A;  2UUA L;  3I4N G;  4QQB X;  4C3H H;  5IWA L;  5LMU Q;  3FHW A;  1PHJ A;  1NJI C;  3I4M H;  2OTJ A;  3PUV A;  4B3R Q;  1G6P A;  1HZC A;  1HNX Q;  4A75 A;  2JA9 A;  4R4I A;  4DR6 Q;  4LF6 Q;  4IPG A;  1VQ6 A;  3RNU A;  3GD7 A;  5IYC G;  5M3F H;  1PH6 A;  4GKK Q;  4L5R C;  4DR4 L;  3A5Z B;  1VS0 A;  5C44 G;  3WWV A;  1E24 A;  2R93 G;  2ID0 A;  4JI6 Q;  1BVS A;  2D0O A;  2NVT H;  3BU2 A;  3I4M G; 
#chains in the Genus database with same CATH topology
 2R7Z H;  2FIN B;  1TU2 B;  1N34 L;  3V96 A;  1EEI D;  5K5P A;  1PV4 A;  1X65 A;  5KNC A;  3C1F A;  4X3T A;  2HDL A;  5M3F G;  3GTL B;  2C35 B;  4JG2 A;  3TP5 A;  3I73 A;  4MTN A;  4JI8 L;  1YI2 A;  1K8M A;  1AP0 A;  2JJQ A;  5GQO A;  4A3B B;  2JA6 G;  2R3Z A;  5GAH C;  2JA7 B;  1ET9 A;  3CRK C;  3HKZ G;  1PFB A;  2K5W A;  2YTX A;  2OTL A;  2NVX B;  2K52 A;  4AIM A;  1SN8 A;  1TT2 A;  1VQO A;  1CTM A;  1TWF H;  3K5O A;  3F2D A;  3ITP A;  1CSQ A;  3GO5 A;  1JMC A;  4KD4 A;  3J7Y W;  1CZG A;  4AYB E;  2NVY B;  3CC2 A;  2ZJR A;  4RG1 A;  1V1O A;  2KBN A;  2Y0S G;  5BR8 Q;  4CJ2 C;  3G6J B;  2VW9 A;  4G57 A;  2MPM A;  4PZ8 A;  1UEB A;  5CGK A;  3NTK A;  2UUC L;  2L0C A;  1VQ5 A;  4UY8 C;  3J80 i;  1PMR A;  3HOW B;  3P75 A;  2KCM A;  1VQP A;  5FLM H;  4KN4 C;  4PMC A;  2ZTC A;  5BN5 A;  3RZD H;  4YY3 L;  4B3T L;  4HSP A;  3I4N B;  3K6O A;  5CV4 A;  2EJF C;  3I72 A;  5TSS A;  1HTP A;  1D8L A;  3C2P A;  4DPG A;  4DAY B;  1SE2 A;  4X3K A;  3OSO A;  1V43 A;  1SYE A;  4C56 C;  1WTV A;  1ICW A;  1VQB A;  2KED A;  3CRL C;  2WKD A;  1H9R A;  3NXW A;  3I4M B;  3KLS A;  1RF2 D;  1NBW A;  1FYC A;  4MTK A;  2KEE A;  4JBM A;  3T1Y L;  2KCC A;  1PYW D;  4NB3 A;  1DCZ A;  2EDG A;  1OXT A;  2F0U A;  3CMA A;  1HR0 Q;  1I50 H;  1EQR A;  1CKM A;  1EQV A;  4ILW A;  4XYO A;  3U9S A;  1FGB D;  2PZU A;  3CF5 A;  4K5V A;  1VQ9 A;  1E3P A;  3OIQ A;  1LYL A;  1VQK A;  5IY0 A;  1L2F A;  1UUP A;  3I7F A;  4DR2 L;  2ASB A;  1K3B C;  4GNX C;  2B39 A;  3O13 A;  3VR3 A;  3M7N A;  1IBK Q;  2CFM A;  1EOV A;  1EOT A;  2F3W A;  2F0T A;  2UXB Q;  1FJG L;  1ESF A;  4ZCK A;  4CDD C;  1KD1 C;  1GUG A;  2EE1 A;  3SK8 A;  3GTG H;  3NE5 B;  2FMC A;  1ICF B;  5KYI A;  5IP7 G;  4UP7 A;  1L0Y B;  1K3R A;  3A5U A;  4XT1 B;  4PV1 C;  3K7A B;  3U50 C;  4PZ6 A;  1GOZ A;  3AEV A;  5J22 A;  1X3Q A;  4K2L A;  1SFO H;  2A5H A;  2YTY A;  2G5D A;  1U0L A;  4R4T A;  5FOB B;  3L0O A;  4R4Q A;  1F9P A;  3P1H A;  3HRZ C;  3AMU A;  2B63 G;  2J4X A;  4L5S A;  3D4D A;  5M5Y H;  2EYJ A;  1ZXT A;  2M00 A;  1EWH A;  2XN9 C;  4A3G H;  3P20 A;  1AFP A;  4DA2 A;  3CCM A;  3ULP A;  1SE4 A;  1LTR D;  5EAY A;  4BBR G;  4S3S A;  3PO3 G;  1GKH A;  3S15 H;  4X3S A;  1W2B A;  2IT1 A;  4ZKB B;  1Z9F A;  1SNQ A;  4RCO A;  4NDX A;  3CP0 A;  4DK1 A;  1RDP D;  1VQF A;  3U4V A;  5KIX A;  3CPF A;  4QY7 A;  1STH A;  1PH8 A;  1XMQ Q;  1CHP D;  5T1I A;  5H1S E;  1FNU A;  1HNX L;  1PRT B;  3KBX A;  4GS3 A;  3H0G H;  1YZ6 A;  4ABN A;  4IOA A;  1CI3 M;  3S1Q H;  1I5F A;  3WOF A;  2LXJ A;  2L12 A;  1CSP A;  1DJR D;  2I46 A;  3T4A C;  4MN3 A;  4IPC A;  1NY4 A;  1HZ9 A;  4JCV E;  2A6H C;  4Z9C B;  1YVC A;  1YNX A;  5BN3 A;  4EQP A;  4DV2 Q;  3OTO L;  2EXD A;  4B3S Q;  3QG1 A;  3J7Z C;  2AKW B;  4LK1 C;  5C3W A;  2A19 A;  1EFW A;  3M4O B;  1IZ6 A;  3S2H B;  5IGC A;  2QF7 A;  3HOZ G;  2RA4 A;  1B2T A;  1A0I A;  1PFN A;  4LWC A;  4K2K A;  2I0Q A;  2OQ0 A;  2D2C C;  3W1B A;  4C3H B;  1PYB A;  3HOV H;  1XTD A;  1YNJ D;  1C4Q A;  3G48 A;  4QUF A;  1ZYR C;  4GN4 B;  1WJJ A;  1KDC A;  1X6O A;  2B2V A;  3QWN A;  1PH7 A;  1TWH B;  5M3M B;  5JJI A;  1S3O A;  4HCE A;  4ZAI A;  2OEO A;  4RWS C;  4JI5 L;  2R7F A;  3D31 A;  2VNU D;  2JK8 A;  5JEA G;  1B9M A;  4OWT B;  1KDB A;  3AFQ A;  1SND A;  2A6H D;  3KF6 B;  1CQF A;  1OO9 B;  2EYH A;  4N9T A;  2QEJ C;  1QZG A;  4YHH Q;  1K9M C;  2F0N A;  4BBS G;  2BA1 A;  2B29 A;  3J80 L;  1I3Q B;  2K04 A;  4P72 A;  4A93 G;  3GTM B;  1TWA B;  2ENB A;  1BF4 A;  2KJX A;  3BDL A;  4N8X 1;  4KY7 A;  3NWS A;  1L0W A;  4IFD J;  5CV8 A;  4FO2 A;  1WOC A;  1EY4 A;  1RL2 A;  5LMN L;  4I65 A;  3HG9 A;  3OIP A;  3FRP B;  5FO8 B;  1PTO B;  1A8V A;  4R8I A;  1JR0 D;  5T1G A;  4BS9 A;  1PRT D;  2EY5 A;  4EQO A;  1IBM Q;  5C4H A;  2KCN A;  1R9T H;  1WCM B;  1JB3 A;  3RZO H;  2R93 H;  1HRJ A;  2HIV A;  3PCO B;  5EPJ A;  3H94 A;  3ULJ A;  1EY6 A;  3S1N B;  1A2U A;  3Q24 A;  1STY A;  2B2Y A;  2F1M A;  1MSH A;  3DWQ A;  2O5J C;  3W1G A;  1HR0 L;  4QUC A;  2BOS A;  5C4Z A;  1AE2 A;  1VQ7 A;  4JI3 L;  1Y1V H;  3BYT B;  3BZC A;  3J81 i;  2E2I H;  1VF7 A;  1E1T A;  4G7Z C;  4JI2 Q;  4QGU A;  2K50 A;  3E0E A;  3JC6 6;  3HKS A;  1N32 Q;  4X3U A;  3TEH B;  1YNN C;  2AMC B;  2LKV A;  2F0S A;  3CQZ H;  2IY5 B;  1RJT A;  1U4M A;  3A0J A;  1SMX A;  5DLQ E;  2O5I C;  3UE1 A;  3RZD B;  4IUU A;  3W3A A;  3PIO A;  4MNO A;  1L0X B;  4K6L A;  3CW2 C;  2QEX A;  4DUY Q;  1PLF A;  3TP8 A;  2EY2 A;  2K5Q A;  2SOB A;  3K57 A;  1X32 A;  4CBV A;  5JVG 3;  2ZXO A;  4XT3 B;  5CBA E;  1DXM A;  4DXF A;  4DAV A;  1ENC A;  4GKK L;  4MZ9 A;  2I5L X;  3N6R A;  5I6W A;  1H9K A;  1J6Q A;  1O7Z A;  5CV7 A;  4JYA Q;  3KLR A;  1YIT A;  3S9W A;  2F4V Q;  3K0X A;  4OIK A;  5HGQ A;  1RKN A;  3K8A A;  1PH3 A;  4DV3 Q;  1SRU A;  3ULL A;  3OW2 A;  1I4H A;  1SE8 A;  3GTL H;  1QNU A;  2NZ1 D;  3NBH B;  1HNW Q;  4K5W A;  3PUX A;  4A3M G;  5E3F A;  4A3F H;  3CU7 A;  4C3I B;  4OX9 Q;  4A3B H;  3HOY G;  4GN3 B;  1ESR A;  1W3S A;  5FKA C;  3CC4 A;  4APV A;  1WTP A;  1TY0 A;  4R8N A;  1X9N A;  3VYU A;  4PNY A;  2JA7 H;  4KMU C;  4FXD A;  5A2Q L;  2A73 B;  3Q22 A;  1PTO D;  3WDN A;  2NZO A;  2BCO A;  4OON A;  3JAM c;  2EJM A;  2RDF A;  2NVX H;  4IFD I;  4GKJ L;  1PZI D;  1TS3 A;  1SEB D;  3PO2 B;  4K6D A;  1UWV A;  1VF5 C;  3SGI A;  3QIA A;  1NSN S;  1MBY A;  3VR5 A;  4RFB A;  3FEW X;  3ND8 A;  4KV6 A;  3NEL A;  1Q3L A;  2NUC A;  1STN A;  4LFB Q;  1BO0 A;  4ZQ3 A;  1HNZ L;  1RHP A;  1RD9 D;  4KI0 A;  3KBG A;  3SE0 A;  1N9W A;  2SEB D;  5C3E G;  1WTH A;  1LM0 A;  1PH5 A;  1E2W A;  1JOO A;  3K7U C;  3HOW H;  2EVB A;  2PZT A;  1PZK D;  3HKZ E;  5IP9 G;  1UEA B;  3D4R A;  4LF7 L;  2PYK A;  3OYY A;  1YHB A;  3EVQ A;  5EBC A;  4A3K G;  1WTR A;  1E1O A;  5J39 A;  5LL6 X;  3I4N H;  4KTA A;  1ZKO A;  4DN4 M;  5C4X G;  3MXU A;  1Q82 C;  3HOU G;  5F2D A;  2L9H A;  3OMG A;  3RD4 A;  1JB7 A;  2Y0S E;  4UP9 A;  2Q2T A;  1AEX A;  4KLK A;  3DHQ A;  5IWA L;  3FHW A;  2OTJ A;  1BQQ T;  1NJI C;  3I4M H;  3PUV A;  2JA9 A;  5KRU A;  3BVZ A;  2WIN B;  4LJZ C;  4K5X A;  1IHZ A;  3GD7 A;  5IYC G;  3S1Q B;  3A5Z B;  2K03 A;  5C44 G;  1CZW A;  1QG7 A;  1A3T A;  4JI6 Q;  2H4O A;  1GHK A;  2VB3 X;  5M5W B;  1FD7 D;  4EQ5 A;  1V1P A;  1TR5 A;  2NN6 I;  1DOM A;  1SMY C;  1EY9 A;  1K28 A;  4TKO B;  5FK9 C;  2PQA B;  2F3I A;  3Q23 A;  2JA8 B;  4LF9 Q;  1W6K A;  2F0O A;  4XXE A;  2MUY A;  2JA5 H;  3JAM i;  1JOQ A;  2R7Z G;  3MXN B;  4HJ9 A;  3NQI A;  1LTA D;  4JI0 L;  4IPD A;  4G7H C;  1GD7 A;  1EY7 A;  1NR4 A;  1W6J A;  1SAP A;  3TME A;  2HHH Q;  1K83 B;  2GVA A;  1IW7 C;  2F0F A;  1AN8 A;  3HGB A;  1EIY B;  3FPP A;  3MEF A;  3A7L A;  4IFD H;  2IX1 A;  4BA1 I;  4KHV A;  1T5X D;  3E9I A;  4QJF A;  1TWG H;  2E2J H;  4R9W A;  1BOS A;  1HZA A;  4R4C A;  1KL9 A;  4CKB A;  1IBL Q;  1A3V A;  5IT9 L;  1QVG A;  1LUZ A;  1ASZ A;  1PFM A;  1XYI A;  1FGU A;  5AJ3 Q;  2A8V A;  5EJW A;  5KND A;  1IKL A;  1TWC B;  4JI2 L;  3J81 L;  5IYD H;  2RDH A;  1A2T A;  1G8Z D;  4AH6 A;  2Z4H A;  2RVL A;  5FO9 B;  4DV4 Q;  2A74 C;  3HP3 A;  1X56 A;  3OOC A;  2R6G A;  5C0X J;  1CA5 A;  5I4D A;  3BVG A;  3PGZ A;  2XVS A;  2F3V A;  3W2D A;  2B2V C;  4GOP B;  2QIL A;  3M9B A;  4Y7N B;  4FF3 A;  4OO1 I;  1EIG A;  4J8Q A;  3SHL A;  1HUN A;  3F1Z A;  5EKK A;  4PMB A;  1CUK A;  3L7Z C;  2E5L Q;  2K14 A;  1HQM C;  1Q8K A;  3KYH C;  2A69 C;  1LLR D;  2DY7 A;  2K33 A;  3J81 j;  5KGU A;  2X6L A;  1GUO A;  2R93 B;  1FNW A;  5DEH A;  2F0M A;  2D62 A;  4NMZ A;  5IGE A;  2ZM6 Q;  1BCP B;  2EYF A;  4U67 3;  3RLF A;  2ZXP A;  4KY5 A;  2BH8 A;  2JXM B;  2OCE A;  4R1J A;  2ZXR A;  2WB1 B;  4DR4 Q;  1OXX K;  1PH2 A;  3L3O C;  1BBU A;  3J7A F;  2NVT B;  3SR1 A;  4KKS A;  1WTO A;  4OX9 L;  2Z8L A;  3M4O H;  4ID6 A;  3RN2 A;  3S2H H;  1F2Y A;  4JBJ A;  3I8Z A;  1J5E L;  2UXC Q;  2VQE Q;  4P2C B;  3CCR A;  3G71 A;  4DR3 Q;  1LTL A;  2NWG A;  3BS1 A;  4G7O C;  1CKN A;  4E6I A;  3V2T A;  4BY7 B;  1LT3 D;  1XTC D;  2UXD L;  3KF8 A;  2B2Y C;  3X3N A;  5CV5 A;  1EWC A;  5LMN W;  4HJ7 A;  4NXN Q;  1QVF A;  2D0P A;  2E2D C;  2B2U A;  1TWH H;  5M3M H;  4DNI A;  3R93 A;  1ROD A;  1N36 Q;  3D3R A;  1EL0 A;  1NMF A;  4YCU A;  1QB5 D;  1D1I A;  4IUP A;  1LO5 D;  4WOR A;  1L1O C;  5CBE E;  2J0T D;  5LHY 1;  2BE5 D;  3K81 C;  5IIF A;  2AQ3 B;  1RIP A;  2F0E A;  3E6Z X;  1HR0 W;  4C2M B;  4HIM A;  3S2D B;  1XNR Q;  4RGT A;  1I3Q H;  3U4Z A;  4A3F B;  2O2L D;  3G6E A;  1TWA H;  4ZRZ A;  3GTM H;  2XTI A;  1Y1W B;  3Q0A A;  3GV6 A;  3LGJ A;  5E7N A;  3JAM E;  4DV0 L;  2ICE C;  2DUD A;  2D9U A;  1K0S A;  4DKA C;  2QA4 A;  3GTK B;  3KDF B;  4LFC Q;  1PTO H;  2F0K A;  1SYB A;  4CJ0 B;  2L11 A;  1VQ8 A;  5C0X I;  1YJN A;  4A3C H;  1YEZ A;  3IL8 A;  1VQA A;  1WI5 A;  1H9S A;  2WAQ E;  3GTJ B;  2F4I A;  2E2H B;  2LS0 1;  1K8A C;  1WCM H;  4A3G G;  1XWE A;  4ULL A;  1KDA A;  3S1N H;  5FJ8 G;  4L5T A;  2PMZ E;  1KRS A;  1BCP D;  2RCF A;  5C5M A;  2F0D A;  4JV5 Q;  1E2Z A;  4UDU C;  4JVZ A;  4YWK A;  4DK3 C;  2WAQ B;  4B08 A;  1MI2 A;  4HID A;  1I94 L;  4DV1 L;  1VCI A;  3DM1 A;  4DXG A;  1ONL A;  4QIW E;  1XNQ L;  1LTS D;  1GUS A;  3DUZ A;  4DV7 Q;  4JI4 Q;  1LAC A;  2PQE A;  1Y8P B;  3H0G G;  4C1N K;  5HY6 A;  4IUT A;  4AYB B;  3BZD B;  4GNX B;  4IO9 A;  4POF A;  4DUZ Q;  2DY8 A;  4A3J B;  2RQX A;  5K36 H;  1Q81 C;  1N33 L;  3I2Z A;  3CXC A;  4QIW B;  1IL2 A;  1BBW A;  5I6Y A;  1VQC A;  1D5Z C;  3G4S A;  2HHH L;  2J7Z A;  3A74 A;  3SEB A;  3M4Y A;  1HFG A;  1NE3 A;  4HIK A;  4RMF A;  3TBI B;  1EQQ A;  1HA5 A;  3T1H L;  4DR5 Q;  1V8Q A;  2PW5 A;  2IPK D;  4JI1 L;  4DV6 Q;  3PF5 A;  2I5M X;  2Z6K A;  3UDF A;  2K7V A;  3I3C A;  3HOV G;  1SJH D;  4C3I H;  1HZB A;  1C48 A;  2ICI A;  2CCZ A;  1O7I A;  4K8I A;  5I9P A;  3CC7 A;  1B9N A;  1QUQ B;  4EQN A;  4A3I B;  2JA5 B;  2C5C A;  2RKS A;  1VMP A;  4DR1 L;  1DM0 B;  2WII B;  3PO2 H;  1QE6 A;  3CAM A;  5C0X H;  1VQD A;  1M1K C;  5E4X A;  2VY3 A;  2DGY A;  1AH9 A;  1HCZ A;  5CYU A;  5CMD A;  3ONA B;  4KK7 A;  1TWG B;  4A3D B;  2E2J B;  1Z7T A;  4TSS A;  4XIG S;  4F7X A;  5J1Z A;  1E0B A;  1V1Q A;  2ZM6 L;  2X69 A;  4DK0 A;  3E3X A;  4CDE C;  3M7G A;  2CHB D;  3QJY A;  2Z4I A;  1MHW C;  1D5X C;  4HIO A;  1VDZ A;  2JA6 H;  4LW1 A;  4IUV A;  2UXC L;  3K59 A;  1JE4 A;  1JWM D;  3MWY W;  4QMG A;  1XJV A;  2FMM A;  3NK9 A;  4F87 A;  4K0K Q;  1STA A;  1Y1V G;  3CCU A;  2BA0 A;  1R4Q B;  5LMU L;  1B3Q A;  3E9H A;  4K14 A;  4NXM Q;  3PMF A;  2IWH A;  4V0B A;  1Y8N B;  2RHQ B;  1N8R C;  2Z0S A;  3H91 A;  4YWM A;  4LF6 L;  3S1R B;  3T56 B;  2YTV A;  4X62 Q;  1NCV A;  2F0P A;  1WTW A;  1SLJ A;  1IYV A;  4IUN A;  4DAM A;  1P16 A;  5EKI A;  3T13 A;  4KHP L;  3KK7 A;  4YCV A;  3M85 A;  3DLL A;  4I7A A;  1S5E D;  4JI7 Q;  4Y52 H;  5M5W H;  2CWA A;  4AQY Q;  4ZKC B;  1JWU D;  4HSV A;  2L15 A;  1XX8 A;  4DR7 Q;  1ILQ A;  4YWL A;  3CME A;  1NNX A;  2JA8 H;  1XNR L;  3NEN A;  4LFA Q;  2M2L A;  2N49 A;  3MFG A;  4A76 A;  3IRB A;  3G7L A;  4HTH A;  2JN4 A;  4JBK A;  2A68 C;  1T9H A;  3SVM A;  1JCK B;  2B8F A;  5IT9 c;  1K73 C;  2QCP X;  4RHR A;  2HQL A;  1AZQ A;  2VB2 X;  3S17 B;  1Z47 A;  2WP8 J;  4ODG A;  3I90 A;  1K83 H;  1SR3 A;  2DJF C;  2Q2U A;  4A3B G;  4I7Z C;  1VQG A;  2F0J A;  3J7A 5;  4RA8 A;  2FHT A;  3AQQ A;  3B6Y A;  1GXD C;  1NMG A;  5LL6 S;  2JA7 G;  1H95 A;  1EY8 A;  3C1E A;  2RBM A;  3SXH A;  1SRO A;  1STB A;  5BR8 L;  3H6M A;  2YYZ A;  2HCC A;  1F9R A;  3I91 A;  5GAG C;  2VQF Q;  3QB3 A;  2VUM B;  1TWC H;  4X64 Q;  2WKC A;  4OWW B;  1MJE A;  3BJU A;  2ATW A;  4QL5 A;  4X65 Q;  1S5B D;  3AFP A;  4C1N I;  4DNT B;  1MJC A;  1H9S B;  2A68 D;  2LFN A;  1TVX A;  2B2U C;  2YV5 A;  4Y7N H;  4QF4 A;  2K5D A;  2KHS A;  3FMC A;  2I07 B;  5C5L A;  1I4P A;  1XMO Q;  4HJ5 A;  2MO1 A;  4C3J B;  3HOW G;  4Q0F A;  2AQ2 B;  1Q90 A;  3TDQ A;  5ELD A;  1G91 A;  2OT2 A;  1ZYR D;  4O2D A;  3I4N G;  4QQB X;  2R92 B;  4KJN A;  1JOK A;  1G6P A;  1HZC A;  1TS2 A;  2SDF A;  4A75 A;  4DR6 Q;  1VMC A;  3SK5 A;  2JYO A;  1IL8 A;  4IPG A;  5AFW A;  3X3M A;  1VS0 A;  1KNA A;  4FF2 A;  1E24 A;  2PCF B;  2NVT H;  2D0O A;  1T5E A;  4FF1 A;  4GZY C;  2PO4 A;  3F2C A;  3I4M G;  1CFM A;  1M4V A;  1L1O A;  1JJC B;  3OWE B;  4A3E B;  1KAW A;  3A8J E;  4B3M Q;  1HHV A;  1IBK L;  4WJ4 A;  1GUW A;  3I4O A;  1O80 A;  2UXB L;  4CKC A;  4BY7 H;  1EUJ A;  1F2M A;  1SYG A;  2AUJ D;  2I5H A;  4RHS A;  3VR6 A;  4CGY B;  1OTC A;  1BXT A;  3FPU B;  3RUZ A;  3Q6S A;  4P71 A;  3HOX B;  2IJ0 A;  2F52 A;  2V4D A;  1QIL A;  2ZTE A;  4XYQ A;  3M4Q A;  1PH1 A;  1UE5 A;  2N3S A;  2ZJQ A;  3CD6 A;  3E0J A;  3R2T A;  3S24 A;  1G2S A;  4C2M H;  4EGV A;  3S2D H;  3MAQ A;  3FKI B;  4IUR A;  1KRT A;  4LF5 Q;  3A8I E;  2IHF A;  2KCT A;  4L6T B;  4BY1 B;  4IFD G;  4DFA A;  5IYB H;  2HUG A;  1UNS A;  1Y1W H;  1YNN D;  1X3E A;  1JJ2 A;  1EY5 A;  2BDN A;  1QJO A;  3GTK H;  4PQX A;  2FJ2 A;  4OHJ A;  3D0F A;  4QCL A;  2OF1 A;  3WOE A;  4F8M A;  5FO7 B;  1VQH A;  3Q8D A;  4IN3 A;  3GTJ H;  1XMQ L;  2IL8 A;  2E2H H;  2AHO B;  2SNM A;  5IYD G;  1MKH A;  3PF4 A;  2K6A A;  5COY A;  1EYG A;  3DM3 A;  2Z6K C;  3CPW A;  2HD3 A;  3HFZ B;  1XPU A;  1YJW A;  1VQM A;  1FL0 A;  4TVA B;  1LTG D;  5C3X A;  2VXW A;  1B50 A;  2GN5 A;  4HMJ A;  1E7Z A;  3KUP A;  2BH2 A;  1JE5 A;  4BBS H;  5GRO A;  5M3F B;  4DV2 L;  4B3S L;  3MA2 B;  5ELB A;  4A93 H;  3CCS A;  4JC0 A;  4ME3 A;  5D65 A;  4O1N A;  2IX0 A;  4A3J H;  4TRD A;  1LV9 A;  3UE0 A;  2JA6 B;  3UDX A;  3TSS A;  1U5K A;  2RCN A;  3D6C A;  5JJZ A;  4ZK9 B;  1HPC A;  1N34 Q;  2NZH A;  1Q1E A;  1I4G A;  5JPN C;  3D6W A;  3HKZ B;  4H0L C;  4ZYS A;  3KJO A;  2NVQ B;  3CCQ A;  1KLU D;  2K75 A;  4RGM A;  3I70 A;  4FXK C;  4RGO S;  4H7B A;  2F0I A;  4A3L H;  1GVP A;  3PUW A;  3OW7 A;  1C8C A;  1EQT A;  2PW7 A;  3NTI A;  1TKW B;  3EQL C;  4JOI A;  1KAA A;  1Q46 A;  2Y0S B;  4C3H G;  4DU9 A;  2N78 A;  3BZK A;  2NTT A;  1S5C D;  2VQF L;  4DF7 A;  4YHH L;  5EQ0 A;  4X64 L;  4DAY A;  4BA2 I;  1D1K A;  4F88 A;  4IJH A;  2L5T A;  5M3M G;  3T16 A;  3TP6 A;  3VYS A;  1E22 A;  2CH4 W;  1HFN A;  3EJI A;  1J8I A;  1S40 A;  4A3I H;  1IKM A;  2EY1 A;  4HMI A;  3HZX A;  1WYD A;  3MFY A;  4JPB W;  3TP7 A;  4XQN A;  5FLX L;  3GTO H;  3STB C;  1GHJ A;  4CKE A;  1JJG A;  3AYH B;  1EU3 A;  2UUC Q;  3BYY B;  5C4J B;  2F0H A;  1D5M C;  1QCB D;  1GUN A;  2GVB A;  1IBM L;  2B8G A;  2IHE A;  3EFX D;  4KKU A;  3H3V C;  4B3T Q;  4A3D H;  1U4R A;  2E75 C;  3GTQ B;  1TS5 A;  4WJW A;  4RKB A;  1TXY A;  2LMC B;  2FFK B;  3S16 B;  1DON A;  4LNQ A;  1II3 A;  2A1A A;  3PV0 A;  4P73 A;  3MVV A;  2JP1 A;  3I55 A;  1SMY D;  1WCM G;  4PG3 A;  2MFI A;  1OXU A;  2Q8T A;  2PNH A;  3T1Y Q;  2CW0 C;  1N32 L;  4FXG C;  1A6X A;  1KQS A;  1IXR A;  4IAL A;  5ELO A;  5EBD A;  4NP5 A;  1B4O A;  3LNN A;  1SJE D;  4DUY L;  1QVC A;  2Q2H A;  2EQS A;  2K28 A;  1DGS A;  4JBW A;  2AUK A;  1F2L A;  3S1R H;  1IW7 D;  5FLM G;  3DWA A;  2XGT A;  5IGB A;  3TN2 A;  4P75 A;  4R4O A;  1WVL A;  4JYA L;  1FJG Q;  5K36 G;  5COR A;  2F4V L;  4WJ3 M;  4DV3 L;  1L1O B;  5JJL A;  5C3E H;  3L9A X;  5EKL A;  2CQA A;  1BR9 A;  1HNW L;  2B63 B;  1FVI A;  1LT6 D;  1S5F D;  4RAU C;  1YIJ A;  2NN6 H;  2A6E C;  2CW0 D;  4ZUI A;  4KKT A;  4ZUJ A;  1SDF A;  5JAV A;  3PIP 3;  1D7Q A;  1TII D;  3OHX C;  2F0Q A;  3R8B A;  4BBR B;  2LSS A;  3PO3 B;  1K8O A;  3S17 H;  1SE3 A;  3F8T A;  2R61 A;  2FXQ A;  4G4K A;  4C3I G;  1B8A A;  1EEF D;  1U4L A;  2A69 D;  4H44 C;  3J80 c;  4XQJ A;  2HT1 A;  4PMW A;  1K0R A;  1I4R A;  3EIV A;  3VA5 A;  1DYQ A;  2DNE A;  4GN5 A;  2HDM A;  1A62 A;  1LT5 D;  1PRT F;  5DNF A;  4LFB L;  5JPM C;  5CC4 A;  3CCJ A;  2OXP A;  2UUB Q;  1Y8O B;  2VUM H;  2Z1C A;  3PO2 G;  1CK1 A;  3ERS X;  1IYJ B;  4DGZ A;  5C0X G;  2XRS D;  2Z9H A;  4B9X A;  3DXJ C;  5GAD C;  3OWF A;  1R4P B;  3MC0 B;  1RTO A;  1WTX A;  4BXX H;  3J7A V;  1SSO A;  3DEO A;  4WRD A;  3KFU A;  3HOZ B;  4V19 0;  4IQZ A;  1HTL D;  3MXP A;  4C3J H;  3OTO Q;  4OO1 H;  4UPA A;  4HCS A;  3KLW A;  1WD1 A;  2R92 H;  1FNV A;  3KF6 A;  3I56 A;  1VQE A;  3RLN A;  1JT8 A;  4HED A;  1SYD A;  3TZU A;  4J15 A;  3MHB A;  1ENF A;  1A3U A;  2F0G A;  4KJO A;  1ML0 D;  2N88 A;  4JI6 L;  4MIU A;  3V05 A;  3D8G A;  1BUV T;  1YBY A;  4LF4 Q;  2IX3 A;  2L55 A;  3MEH A;  1HQR D;  4BBS B;  5CV9 A;  5EGT A;  3VR2 A;  2ZTD A;  2ZT9 C;  4FF4 A;  2PMZ B;  2RSO A;  4A3E H;  2O4X A;  2PZW A;  4LF9 L;  4A93 B;  1B1Z A;  4JI5 Q;  3BVM A;  3FVQ A;  1UE7 A;  3BG3 A;  3TZD A;  3JAM L;  3A7A B;  4LUV A;  5KEE A;  1CQV A;  2YU9 B;  1FR3 A;  2XWB B;  4DV5 Q;  1GJX A;  4J6H A;  4CDF C;  4ZLT F;  1KC8 C;  2JA8 G;  3H3V I;  3HOX H;  3TRE A;  4EX5 A;  4LF8 Q;  2KHJ A;  1PTO F;  1PA6 A;  4FNF A;  2K4K A;  1V1P B;  1XPR A;  1BNZ A;  4O0A A;  4LUO A;  5D14 A;  5LMN Q;  1MSG A;  3GTP B;  5A35 A;  1IBL L;  5E4W C;  4GLX A;  4IJL A;  3S1M B;  2F0L A;  2E8G A;  5AJ3 L;  3FKI H;  3D4W A;  2PI2 A;  4BY1 H;  1QNK A;  2NBF A;  4DV4 L;  3HS0 C;  4J1M A;  1EYA A;  4NPS A;  4FDB A;  2RDG A;  2NTS A;  2XRQ D;  3F2U A;  4POG A;  1CHQ D;  1Q8I A;  1STG A;  1NTG A;  3H09 A;  2QDL A;  4IUQ A;  1SNO A;  2K32 A;  4JI3 Q;  2TSS A;  2JE6 I;  3E5S A;  3GTO B;  4JOI C;  4L63 B;  2VS1 A;  1HXY D;  3CKI B;  2E5L L;  3PIO 3;  4NW2 A;  1XPO A;  1V9P A;  3U9O A;  5IOD A;  2HIX A;  3A8K E;  1X3G A;  1GM5 A;  1X3P A;  3NBH A;  1Y14 B;  2G9H D;  3DEP A;  1G2T A;  1TY2 A;  1KTK A;  1SYF A;  3LX0 A;  5IGD A;  4B3R Q;  1Z6H A;  3KLS X;  2F0V A;  1ZEQ X;  4R4I A;  1SBB B;  3RNU A;  5M3F H;  4MHE A;  1PH6 A;  4GKK Q;  4DR4 L;  1MD2 D;  4A3M B;  3QR8 A;  3K58 A;  2R93 G;  4RKL A;  5NUC A;  3BU2 A;  3T53 B;  2NB0 A;  3HOY B;  4HN7 A;  1S4Z A;  1U9R A;  4HJ8 A;  1NUC A;  4HR7 B;  2VQE L;  1I6H H;  3DMU A;  4RH6 A;  3S14 B;  4DR3 L;  3K80 C;  3RN5 A;  3NQT A;  2WB1 G;  2D5D A;  5DM6 3;  3K5L A;  2NVQ H;  4GLA C;  3PIP A;  1C9O A;  2EOT A;  4UHV A;  2JSO A;  5JEA J;  4NXN L;  2B2T C;  4CDC C;  1WD0 A;  3VDY A;  2H5X A;  1PDQ A;  1PYS B;  1G6Z A;  2B2W A;  1F9S A;  5EPL A;  3H3V H;  1N36 L;  2BDO A;  2EPB A;  5FJ8 H;  1EZ8 A;  4BY7 G;  4N8F A;  2CQO A;  2VL6 A;  1QZH A;  3QOL A;  2KQ3 A;  2RF4 A;  5FLX c;  1PXU A;  1BBX C;  1Q86 C;  3ICE A;  2V1C C;  4GKJ Q;  1H9M A;  2UUB L;  2PNR C;  2EY6 A;  3A56 A;  3ERO A;  5C3E B;  5ELE A;  2JEB I;  1YNJ C;  1EZ6 A;  3PUZ A;  1CKN B;  1KIX A;  4FP5 D;  2MNA A;  4QB4 A;  2QGQ A;  1J9O A;  3KF8 B;  1MIU A;  3KJP A;  4A3K B;  2Z6B A;  1JC7 A;  3NP8 A;  2MGS A;  3M3Y B;  1HNZ Q;  2EXZ A;  4LFC L;  3GP7 A;  1A15 A;  5C4X B;  1S72 A;  1EYC A;  3U58 A;  5M5X H;  3KOJ A;  5C4J H;  1LTI D;  1SYC A;  3HOU B;  3J80 E;  4KHZ A;  4A3F G;  3J81 c;  5G3L F;  4LF7 Q;  5IYB G;  1Y1W G;  3URY A;  2MQH A;  3GTQ H;  5ELC A;  3A55 A;  1HH2 P;  1BKB A;  1Y69 U;  2TMP A;  3S16 H;  2PQA A;  4JV5 L;  4JK1 C;  2CWP A;  5C44 B;  1PRT C;  3LWE A;  4LF4 L;  5IWA Q;  3SK4 A;  3MXN A;  4DV7 L;  4JI4 L;  2N55 A;  2EYL A;  5EPK A;  5DAU A;  2SNS A;  2CKZ B;  1E2V A;  4L8J A;  1I6V C;  3P7J A;  4DUZ L;  4PZ7 A;  2WAQ G;  1EFI D;  2R7Z B;  1KNE A;  4KY6 A;  3IAY A;  3VYR A;  2M9V A;  1CT1 D;  2EYO A;  3N52 A;  4DV5 L;  5IP7 H;  1ASY A;  2JQO A;  1EIH A;  3VA7 A;  4AYB G;  2HQE A;  2Q2I A;  4LF8 L;  3NHH A;  1B44 D;  4ALP A;  4A3J G;  1LTB D;  5JOB A;  4CJ1 B;  2XWJ B;  2F03 A;  5GAE C;  3SK6 A;  4DR5 L;  4JI0 Q;  1WTQ A;  1X55 A;  4JW0 A;  4DV6 L;  3TQY A;  1LAB A;  3FP9 A;  2Q8R E;  2B63 H;  1O7L A;  3EBE A;  1UE6 A;  3LWU A;  4GOP A;  1YHQ A;  3CCE A;  2WFW A;  3GDE A;  1PZJ D;  4A3L G;  1PH9 A;  1TWF B;  1QOH A;  1M90 C;  2VZA A;  1NR2 A;  5CV6 A;  3K5N A;  4LMQ D;  2UU9 Q;  2H1E A;  2L4N A;  4BBR H;  3PO3 H;  3BDO A;  3SDZ A;  1EY0 A;  3OPO A;  2DJG C;  3MXG A;  2EYM A;  2PI2 E;  1RTN A;  3R2I A;  4X6A H;  4H02 A;  2CVR A;  1VQI A;  4M1U B;  1JQY D;  1YJ9 A;  1B7Y B;  1AE3 A;  2EYP A;  2N8N A;  4OL7 A;  5A2Q E;  1PVO A;  1GUT A;  4A3I G;  4BWG B;  2JA5 G;  3ZJY C;  1PTO C;  4Q5V A;  4P74 A;  1KXL A;  3OMC A;  5HUR A;  3TS0 A;  2ALY B;  5ELF A;  4B3R L;  3I4L A;  3H15 A;  4KD3 A;  4OIJ A;  3AB9 A;  4ME5 A;  3MTS A;  2K05 A;  2KEN A;  5JVH 3;  1BCP F;  2QDB A;  1Q7Y C;  1LTT D;  2ZJP A;  1KHI A;  3CHB D;  4HAE A;  4A3D G;  2P5Z X;  1JWS D;  3RMH A;  5IGF A;  1CKO A;  1VQ4 A;  2KHI A;  4O42 A;  3NBI A;  5JJK A;  4KN7 C;  4IZ8 A;  3HOZ H;  2KA7 A;  1QWY A;  1DZ1 A;  2MP1 A;  4NKL A;  1I50 B;  4YCW A;  4K0K L;  4OXP A;  1EIF A;  4NXM L;  4X66 Q;  1M8A A;  5I2Y A;  2EJG C;  4YIJ A;  2AWO A;  5CR3 A;  4EVO A;  4X62 L;  1S5D D;  1J5E Q;  2G9D A;  5L37 A;  2K01 A;  3NSW A;  3NUC A;  1CM9 A;  5M9O A;  4JI7 L;  2UUA Q;  3BDC A;  3IKJ A;  1STE A;  3UI2 A;  4AQY L;  2UXD Q;  5JEA H;  3K0Y A;  5D3D A;  1SNC A;  1BDO A;  1F2Z A;  4GLV B;  3GTG B;  2KUM A;  2WV6 D;  4FVM A;  4OEL B;  3KDF A;  3CCV A;  4DR7 L;  2ES2 A;  1SNP A;  5I9O A;  1D2B A;  4LFA L;  5ISR A;  4UAI A;  2EIF A;  1EWI A;  2NVY H;  4K8J A;  1GO3 E;  1B70 B;  1KAB A;  1SFO B;  2HCI A;  1I6H B;  5BN4 A;  3FDT A;  1UAP A;  4UP8 A;  2L1B A;  2MHV A;  5HGT A;  2YU9 H;  4DNR B;  3RR5 A;  2K5N A;  1JIC A;  1PH4 A;  1KLG D;  5DM7 3;  4JI8 Q;  3QOJ A;  1DOK A;  5E1F A;  5M5Y B;  4DAP A;  2NN6 G;  1PFS A;  3AU7 A;  4A3G B;  5IE8 A;  1OXS C;  4DV0 Q;  4OWX B;  1AW7 A;  5FLX E;  3C46 A;  1RCV D;  3GTP H;  1ILP A;  2KEC A;  2DNC A;  3S15 B;  4FYD A;  3S1M H;  5C6A A;  5KYL A;  1OXV A;  4GNX A;  3UDI A;  4IOC A;  2EZV A;  3ERQ A;  2K5H A;  4DK6 C;  4L5Q A;  1HA6 A;  4M8A A;  4LUZ A;  2KVM A;  2OWO A;  3NPP A;  1EU4 A;  1UE1 A;  2F0W A;  3M4P A;  4TQU S;  3H0G B;  4A4I A;  3PUY A;  4OEM B;  4XQQ A;  3IFT A;  3ER0 A;  1VQJ A;  4X65 L;  5IT9 E;  3ND9 A;  4XTC S;  1YHA A;  2MO0 A;  1K8G A;  1D6E C;  4N9P A;  2E76 C;  3GV3 A;  2QKI C;  1XXG A;  2B2W C;  2XNA C;  1F77 A;  1B53 A;  3R3O A;  1I94 Q;  2VUM G;  4DV1 Q;  4RGN A;  3J81 E;  3K5M A;  1CA6 A;  5M5X B;  1XNQ Q;  5KNB A;  1XMO L;  3W5O A;  2LY7 A;  3TS2 A;  1DD2 A;  3L2P A;  4YY3 Q;  3VR4 A;  1HUM A;  1EYD A;  1TQO A;  4BXX G;  2B3G A;  1B3A A;  1G51 A;  1N33 Q;  1DOL A;  4DR6 L;  3VYT A;  4C3J G;  2R7D A;  2X6G A;  2B2T A;  2OQK A;  4A3C G;  1VQN A;  3PQI A;  1Q1B A;  1QUQ A;  1C7Y A;  3EA6 A;  4OO1 G;  4LAA A;  3K7A H;  2CH4 A;  4A3M H;  1ENA A;  1O78 A;  2DN8 A;  3HOV B;  2R92 G;  2LXK A;  3HOY H;  1ET6 A;  3T1H Q;  2UU9 L;  1MGS A;  4OGQ C;  4B3M L;  1H9J A;  3S14 H;  2K5V A;  2GA4 B;  3F2B A;  4HJA A;  1TS4 A;  1U4P A;  4JI1 Q;  2QW7 A;  3EN2 A;  2E74 C;  3C3L A;  3STB D;  2XSC A;  3GQB A;  4CHT B;  3TRZ A;  2MJ8 A;  1F9Q A;  1HJP A;  1NAP A;  4DR2 Q;  2JEA I;  4A3E G;  3NEM A;  1O7Y A;  3DWP A;  5G3L D;  1JOR A;  1LT4 D;  1X3F A;  5IOC A;  2Q8I B;  2C9O A;  3CCL A;  5ELN A;  1Q12 A;  3ZYY X;  4DR1 Q;  3HOX G;  2NYZ D;  3NTH A;  4RCN A;  4LF5 L;  2WB1 E;  5IP9 H;  3NWT A;  2AWN A;  1WFQ A;  3HEJ A;  3IFD A;  2K1B A;  1R9T B;  4A3K H;  3RZO B;  3QO2 A;  5J3B A;  3A54 A;  3M3Y H;  2RHS B;  1IYU A;  5IGG A;  5I2X A;  1P8L A;  1G29 1;  1I4Q A;  1AZP A;  5C4X H;  2BE5 C;  3T51 B;  3HOU H;  1X54 A;  3RLO A;  3FKI G;  1Y1V B;  4BY1 G;  2E2I B;  3UDG A;  5D3I B;  2RSN A;  4U68 A;  1C0A A;  4X66 L;  4H13 C;  2WAC A;  3PSI A;  2XIW A;  4GOP C;  3CQZ B;  1VQL A;  4XDX A;  4IPH A;  5IYC H;  1SNM A;  1SXT A;  2AQ1 B;  5C44 H;  1A63 A;  2UUA L;  3MZ5 A;  4C3H H;  5LMU Q;  1PHJ A;  2IW3 A;  1HNX Q;  2PPB C;  4B9W A;  4LF6 Q;  1I4X A;  1VQ6 A;  4WFN 3;  4L5R C;  2A6E D;  3WWV A;  2KOL A;  1BCP C;  2ID0 A;  1BVS A;  4KHP Q; 
#chains in the Genus database with same CATH homology
 2R7Z H;  2NN6 I;  1L1O A;  1JJC B;  1N34 L;  4HJ8 A;  1PV4 A;  2VQE L;  1I6H H;  1X65 A;  4DR3 L;  1KAW A;  2PQA B;  2F3I A;  5M3F G;  1IBK L;  4B3M Q;  4LF9 Q;  4WJ4 A;  2C35 B;  3I4O A;  3K80 C;  4JG2 A;  3RN5 A;  2WB1 G;  4MTN A;  2NVQ H;  2UXB L;  4BY7 H;  4JI8 L;  1EUJ A;  4GLA C;  3PIP A;  1YI2 A;  1C9O A;  2JA5 H;  3JAM i;  2R7Z G;  2JJQ A;  5GQO A;  2JA6 G;  5JEA J;  4NXN L;  3MXN B;  4HJ9 A;  2I5H A;  1OTC A;  3VDY A;  5GAH C;  2H5X A;  1PYS B;  4JI0 L;  4IPD A;  1GD7 A;  4P71 A;  3H3V H;  1N36 L;  5FJ8 H;  3HKZ G;  2F52 A;  2HHH Q;  2YTX A;  2ZTE A;  4BY7 G;  1QZH A;  2CQO A;  2GVA A;  2VL6 A;  1EIY B;  2OTL A;  2K52 A;  3MEF A;  4AIM A;  2RF4 A;  1SN8 A;  3M4Q A;  4BA1 I;  5FLX c;  2IX1 A;  3E9I A;  4QJF A;  1Q86 C;  1TWG H;  1VQO A;  2E2J H;  2V1C C;  1PH1 A;  1UE5 A;  1TWF H;  2N3S A;  2UUB L;  2ZJQ A;  3ICE A;  4GKJ Q;  3F2D A;  3CD6 A;  1HZA A;  1CSQ A;  4R4C A;  3GO5 A;  1KL9 A;  2JEB I;  3S24 A;  1JMC A;  1IBL Q;  4C2M H;  4AYB E;  3PUZ A;  1CKN B;  1LUZ A;  1QVG A;  1ASZ A;  3CC2 A;  3S2D H;  2ZJR A;  1KRT A;  2MNA A;  1FGU A;  1KIX A;  4RG1 A;  5AJ3 Q;  2IHF A;  2KBN A;  2KCT A;  2Y0S G;  5BR8 Q;  4LF5 Q;  2QGQ A;  5IYB H;  2A8V A;  3KF8 B;  1MIU A;  3KJP A;  4IFD G;  2VW9 A;  1Y1W H;  1X3E A;  4JI2 L;  1JJ2 A;  5IYD H;  4PZ8 A;  1UEB A;  4AH6 A;  1HNZ Q;  4LFC L;  2UUC L;  4UY8 C;  4DV4 Q;  1VQ5 A;  3GTK H;  1S72 A;  3J80 i;  3U58 A;  5M5X H;  1X56 A;  2R6G A;  3KOJ A;  3D0F A;  5C4J H;  5C0X J;  2KCM A;  1VQP A;  5FLM H;  4KHZ A;  4A3F G;  3PGZ A;  2ZTC A;  3J81 c;  4LF7 Q;  1VQH A;  4GOP B;  5IYB G;  4YY3 L;  3Q8D A;  3RZD H;  4B3T L;  3M9B A;  3GTJ H;  1Y1W G;  1XMQ L;  2E2H H;  2AHO B;  4OO1 I;  2MQH A;  5IYD G;  1MKH A;  3PF4 A;  3F1Z A;  1D8L A;  4DPG A;  3GTQ H;  1CUK A;  3L7Z C;  4DAY B;  1EYG A;  3DM3 A;  2K14 A;  2Z6K C;  2E5L Q;  1HH2 P;  3CPW A;  1BKB A;  1Q8K A;  3KYH C;  3S16 H;  2PQA A;  1V43 A;  4JV5 L;  2CWP A;  3HFZ B;  3J81 j;  1VQB A;  1XPU A;  1YJW A;  1VQM A;  1FL0 A;  4LF4 L;  4TVA B;  1NBW A;  5IWA Q;  4JBM A;  2D62 A;  3T1Y L;  2GN5 A;  4DV7 L;  4JI4 L;  2ZM6 Q;  1E7Z A;  4NB3 A;  2BH2 A;  1JE5 A;  3RLF A;  4BBS H;  5GRO A;  1OXT A;  2BH8 A;  2CKZ B;  2OCE A;  3CMA A;  4DV2 L;  1HR0 Q;  4R1J A;  1I50 H;  4DR4 Q;  4B3S L;  1OXX K;  1EQR A;  1PH2 A;  1CKM A;  4A93 H;  4DUZ L;  3CCS A;  4JC0 A;  1BBU A;  4PZ7 A;  4KHP Q;  2WAQ G;  4ME3 A;  2IX0 A;  4A3J H;  4OX9 L;  3CF5 A;  3M4O H;  3UE0 A;  1VQ9 A;  1E3P A;  3UDX A;  1LYL A;  1U5K A;  2RCN A;  5IY0 A;  1L2F A;  3RN2 A;  4JBJ A;  1VQK A;  3S2H H;  1N34 Q;  3I7F A;  4DR2 L;  1J5E L;  2ASB A;  2UXC Q;  2VQE Q;  4GNX C;  2NZH A;  3CCR A;  3G71 A;  5IP7 H;  4DV5 L;  2JQO A;  4DR3 Q;  1LTL A;  1Q1E A;  1ASY A;  3M7N A;  4AYB G;  1IBK Q;  2CFM A;  1CKN A;  1EOV A;  3KJO A;  2Q2I A;  4LF8 L;  3CCQ A;  2UXB Q;  4ALP A;  2K75 A;  1FJG L;  2UXD L;  4A3J G;  1KD1 C;  4A3L H;  5LMN W;  4HJ7 A;  1GVP A;  3PUW A;  5GAE C;  4NXN Q;  1QVF A;  2D0P A;  3GTG H;  4DR5 L;  4JI0 Q;  5IP7 G;  1TWH H;  5M3M H;  4UP7 A;  4DNI A;  1X55 A;  1K3R A;  1N36 Q;  4JOI A;  3A5U A;  4DV6 L;  3F2C A;  1NMF A;  4YCU A;  3TQY A;  3U50 C;  3FP9 A;  1Q46 A;  4PZ6 A;  2B63 H;  3AEV A;  3EBE A;  1UE6 A;  4GOP A;  1YHQ A;  1L1O C;  3CCE A;  2WFW A;  3GDE A;  2N78 A;  3BZK A;  4A3L G;  1PH9 A;  1SFO H;  2VQF L;  1M90 C;  2VZA A;  4YHH L;  3K81 C;  2YTY A;  4X64 L;  1U0L A;  4R4T A;  4BA2 I;  3L0O A;  4IJH A;  4R4Q A;  2UU9 Q;  1RIP A;  5M3M G;  1HR0 W;  4BBR H;  3PO3 H;  4HIM A;  1E22 A;  1XNR Q;  1I3Q H;  3U4Z A;  3G6E A;  1TWA H;  1S40 A;  2B63 G;  4L5S A;  4A3I H;  3GTM H;  2PI2 E;  2XTI A;  5M5Y H;  4X6A H;  1WYD A;  3LGJ A;  5E7N A;  4DV0 L;  4A3G H;  2DUD A;  4H02 A;  4DKA C;  2QA4 A;  3GTO H;  3STB C;  1JJG A;  3CCM A;  3AYH B;  3KDF B;  4LFC Q;  3ULP A;  2UUC Q;  1VQI A;  5EAY A;  4BBR G;  3PO3 G;  1VQ8 A;  1YJ9 A;  1GKH A;  1B7Y B;  1W2B A;  1AE3 A;  2N8N A;  2IT1 A;  5C0X I;  1Z9F A;  1YJN A;  3S15 H;  1YEZ A;  4A3C H;  1PVO A;  2GVB A;  1VQA A;  1WI5 A;  3CP0 A;  4A3I G;  3U4V A;  1VQF A;  2IHE A;  2WAQ E;  1IBM L;  3CPF A;  4QY7 A;  3ZJY C;  1PH8 A;  2JA5 G;  1KXL A;  4P74 A;  1K8A C;  4B3T Q;  1XMQ Q;  4A3D H;  1WCM H;  4A3G G;  5H1S E;  2ALY B;  3TS0 A;  4B3R L;  3H15 A;  1HNX L;  1TXY A;  3S1N H;  5FJ8 G;  4GS3 A;  2PMZ E;  3H0G H;  4L5T A;  1YZ6 A;  1KRS A;  4LNQ A;  2A1A A;  3PV0 A;  4P73 A;  4IOA A;  4JV5 Q;  2KEN A;  4DK3 C;  4YWK A;  1Q7Y C;  1I5F A;  3S1Q H;  2ZJP A;  1KHI A;  3I55 A;  2LXJ A;  1CSP A;  4A3D G;  4HID A;  1WCM G;  4PG3 A;  1I94 L;  2MFI A;  4DV1 L;  1CKO A;  1VCI A;  1VQ4 A;  2KHI A;  5JJK A;  4IPC A;  1OXU A;  4QIW E;  1XNQ L;  1NY4 A;  2PNH A;  3T1Y Q;  1HZ9 A;  4DV7 Q;  4JI4 Q;  4JCV E;  1N32 L;  3HOZ H;  1KQS A;  1YVC A;  1YNX A;  3H0G G;  1IXR A;  5ELO A;  5HY6 A;  4DV2 Q;  4YCW A;  3OTO L;  4K0K L;  4OXP A;  2EXD A;  4B3S Q;  1EIF A;  4DUY L;  4GNX B;  4POF A;  4DUZ Q;  1QVC A;  3J7Z C;  4IO9 A;  4NXM L;  2AKW B;  1EFW A;  2A19 A;  2Q2H A;  1IZ6 A;  2EQS A;  1Q81 C;  1N33 L;  4X66 Q;  3I2Z A;  3CXC A;  3HOZ G;  1IL2 A;  2AWO A;  4X62 L;  1DGS A;  1A0I A;  4JBW A;  1BBW A;  3S1R H;  1J5E Q;  5FLM G;  1VQC A;  4LWC A;  2XGT A;  2I0Q A;  2OQ0 A;  3G4S A;  2HHH L;  3W1B A;  3A74 A;  4P75 A;  4R4O A;  4JI7 L;  2UUA Q;  1PYB A;  4JYA L;  1FJG Q;  3HOV H;  4AQY L;  2UXD Q;  5K36 G;  1XTD A;  1NE3 A;  3G48 A;  4RMF A;  4HIK A;  1EQQ A;  2F4V L;  4GN4 B;  1WJJ A;  4GLV B;  1X6O A;  4DV3 L;  4WJ3 M;  3T1H L;  1L1O B;  5JJL A;  3KDF A;  3CCV A;  1PH7 A;  4DR7 L;  5C3E H;  4DR5 Q;  2ES2 A;  5JJI A;  1S3O A;  4LFA L;  1HNW L;  4JI1 L;  4DV6 Q;  3PF5 A;  4JI5 L;  1FVI A;  2EIF A;  1EWI A;  2R7F A;  2I5M X;  2NVY H;  1GO3 E;  1B70 B;  2Z6K A;  3D31 A;  2JK8 A;  3UDF A;  2VNU D;  1YIJ A;  3HOV G;  5JEA G;  4C3I H;  4OWT B;  3KF6 B;  3AFQ A;  1HZB A;  1QZG A;  1K9M C;  4YHH Q;  2CCZ A;  1O7I A;  4UP8 A;  4BBS G;  1D7Q A;  2BA1 A;  2YU9 H;  2B29 A;  3RR5 A;  2K5N A;  2LSS A;  1PH4 A;  3CC7 A;  3S17 H;  1QUQ B;  4P72 A;  4A93 G;  3F8T A;  4JI8 Q;  2NN6 G;  1PFS A;  2FXQ A;  1L0W A;  4IFD J;  1B8A A;  5IE8 A;  1OXS C;  1WOC A;  1RL2 A;  4DV0 Q;  5LMN L;  4DR1 L;  3J80 c;  4OWX B;  3PO2 H;  3CAM A;  3GTP H;  2HT1 A;  1A8V A;  1VQD A;  4PMW A;  1K0R A;  1M1K C;  3S1M H;  3EIV A;  2VY3 A;  2DGY A;  1AH9 A;  4GN5 A;  1A62 A;  1OXV A;  1IBM Q;  4GNX A;  3UDI A;  4IOC A;  4LFB L;  1R9T H;  2K5H A;  4DK6 C;  4L5Q A;  4XIG S;  3RZO H;  3CCJ A;  2R93 H;  2UUB Q;  2HIV A;  4LUZ A;  3PCO B;  2VUM H;  3PO2 G;  1V1Q A;  2ZM6 L;  2OWO A;  3ERS X;  1UE1 A;  4TQU S;  3ULJ A;  3M4P A;  4A4I A;  1IYJ B;  3PUY A;  5C0X G;  3ER0 A;  1VQJ A;  3W1G A;  4X65 L;  5GAD C;  1HR0 L;  4XTC S;  1YHA A;  2MO0 A;  1AE2 A;  1K8G A;  1VQ7 A;  4JI3 L;  1Y1V H;  2E2I H;  3BZC A;  3J81 i;  4HIO A;  1E1T A;  4JI2 Q;  4BXX H;  4QGU A;  1I94 Q;  2VUM G;  4DV1 Q;  2K50 A;  3E0E A;  1XNQ Q;  4LW1 A;  1XMO L;  2JA6 H;  3KFU A;  3JC6 6;  3HKS A;  1N32 Q;  3W5O A;  3TEH B;  2UXC L;  2AMC B;  3TS2 A;  3CQZ H;  4C3J H;  2IY5 B;  3A0J A;  1SMX A;  5DLQ E;  1XJV A;  3UE1 A;  3OTO Q;  3L2P A;  4K0K Q;  3PIO A;  4MNO A;  1Y1V G;  4YY3 Q;  4UPA A;  3CCU A;  2BA0 A;  2QEX A;  4DUY Q;  3CW2 C;  5LMU L;  3KLW A;  3E9H A;  4NXM Q;  2B3G A;  2R92 H;  4BXX G;  3I56 A;  2RHQ B;  3KF6 A;  1G51 A;  1N33 Q;  1VQE A;  3RLN A;  1JT8 A;  1N8R C;  4DR6 L;  2Z0S A;  4YWM A;  4LF6 L;  2YTV A;  4X62 Q;  4J15 A;  2R7D A;  4A3C G;  4GKK L;  2OQK A;  4MZ9 A;  2I5L X;  1SLJ A;  1VQN A;  1Q1B A;  1QUQ A;  4DAM A;  1C7Y A;  1P16 A;  4OO1 G;  1J6Q A;  3K7A H;  4A3M H;  4JI6 L;  4KHP L;  4YCV A;  3M85 A;  1YBY A;  3DLL A;  4JI7 Q;  4LF4 Q;  2R92 G;  4JYA Q;  4Y52 H;  5M5W H;  2CWA A;  2LXK A;  4AQY Q;  1YIT A;  3HOY H;  2F4V Q;  3K0X A;  5HGQ A;  1PH3 A;  3K8A A;  4DV3 Q;  1SRU A;  2L15 A;  3ULL A;  3OW2 A;  3T1H Q;  2ZTD A;  2UU9 L;  4A3E H;  4DR7 Q;  4B3M L;  1SE8 A;  3S14 H;  4YWL A;  2K5V A;  4LF9 L;  3CME A;  3GTL H;  2JA8 H;  3F2B A;  4HJA A;  3NBH B;  1XNR L;  3NEN A;  4LFA Q;  1HNW Q;  4JI1 Q;  2N49 A;  3PUX A;  4A3M G;  3EN2 A;  4A3F H;  4JI5 Q;  1UE7 A;  3IRB A;  4A76 A;  3STB D;  4JBK A;  4OX9 Q;  1T9H A;  3HOY G;  3TRZ A;  4A3B H;  4GN3 B;  4LUV A;  1HJP A;  1W3S A;  4DR2 Q;  3CC4 A;  5IT9 c;  1K73 C;  4APV A;  2JEA I;  4A3E G;  2HQL A;  3NEM A;  4DV5 Q;  1X9N A;  2JA7 H;  1KC8 C;  3H3V I;  2JA8 G;  3HOX H;  1Z47 A;  2NZO A;  2WP8 J;  3TRE A;  4EX5 A;  4LF8 Q;  2KHJ A;  4OON A;  3JAM c;  1X3F A;  1K83 H;  1PA6 A;  2NVX H;  1SR3 A;  3CCL A;  2Q2U A;  5ELN A;  4IFD I;  2K4K A;  4A3B G;  4GKJ L;  1Q12 A;  1XPR A;  1VQG A;  4O0A A;  3J7A 5;  4LUO A;  5LMN Q;  1UWV A;  3SGI A;  4DR1 Q;  3B6Y A;  3AQQ A;  1NMG A;  1IBL L;  2JA7 G;  1H95 A;  4GLX A;  4IJL A;  3HOX G;  1SRO A;  2E8G A;  2WB1 E;  5IP9 H;  3NEL A;  5AJ3 L;  4LF5 L;  3FKI H;  5BR8 L;  2AWN A;  2PI2 A;  2YYZ A;  4BY1 H;  1WFQ A;  5GAG C;  4LFB Q;  4A3K H;  2VQF Q;  5J3B A;  1HNZ L;  1TWC H;  2RHS B;  3M3Y H;  4KI0 A;  1P8L A;  4DV4 L;  4X64 Q;  1N9W A;  1G29 1;  4OWW B;  5C3E G;  1MJE A;  5C4X H;  4NPS A;  1LM0 A;  4FDB A;  3BJU A;  1PH5 A;  4POG A;  4EQ5 A;  2ATW A;  3K7U C;  4QL5 A;  3HOW H;  4X65 Q;  3HOU H;  3HKZ E;  3AFP A;  1NTG A;  1X54 A;  5IP9 G;  3RLO A;  3FKI G;  4LF7 L;  1MJC A;  3OYY A;  4BY1 G;  1YHB A;  3UDG A;  4JI3 Q;  4A3K G;  1E1O A;  2YV5 A;  4Y7N H;  3I4N H;  2JE6 I;  1C0A A;  4JOI C;  2VS1 A;  4X66 L;  2E5L L;  5C4X G;  1XMO Q;  4HJ5 A;  3PSI A;  4GOP C;  2MO1 A;  1XPO A;  1Q82 C;  1VQL A;  3HOW G;  1V9P A;  2HIX A;  4IPH A;  1GM5 A;  1X3G A;  5IYC H;  3HOU G;  1Y14 B;  5C44 H;  1JB7 A;  2Y0S E;  4UP9 A;  4O2D A;  2Q2T A;  1A63 A;  4KLK A;  2UUA L;  3I4N G;  4QQB X;  4C3H H;  5IWA L;  5LMU Q;  3FHW A;  1PHJ A;  1NJI C;  3I4M H;  2OTJ A;  3PUV A;  4B3R Q;  1G6P A;  1HZC A;  1HNX Q;  4A75 A;  2JA9 A;  4R4I A;  4DR6 Q;  4LF6 Q;  4IPG A;  1VQ6 A;  3RNU A;  3GD7 A;  5IYC G;  5M3F H;  1PH6 A;  4GKK Q;  4L5R C;  4DR4 L;  3A5Z B;  1VS0 A;  5C44 G;  3WWV A;  1E24 A;  2R93 G;  2ID0 A;  4JI6 Q;  1BVS A;  2D0O A;  2NVT H;  3BU2 A;  3I4M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...