1I50H

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i50H00
4YY3Q 1A0IA 2LXKA 2ASBA 4C2MH 4L5SA 4P74A 4HJ8A 3M3YH 5FJ8H 3J81c 1VQFA 4C3IH 4PZ6A 3GO5A 2VY3A 3HFZB 2UUAQ 3RLNA 4NXML 3I2ZA 1Y1WH 2UXCQ 1VQKA 5IYCG 1YI2A 4DR3Q 4JI4L 4ALPA 4LF9Q 3F2BA 2QA4A 5C44G 2UXDQ 1C7YA 4HJAA 4LF6L 3PUYA 1KD1C 4IO9A 2HHHQ 1GO3E 4R4OA 4LFCL 4DR4Q 2I0QA 2R7DA 4A93G 1YHBA 3UDXA 2F4VQ 3ZJYC 4DUYL 2Q2HA 2OQKA 1YBYA 2UXBQ 5C0XG 3OTOL 4GOPC 1N32L 1YVCA 3RR5A 4MNOA 4OO1I 1C0AA 3I4OA 4IPCA 1I94Q 4B3RQ 3KF6A 1XNRL 1EQRA 4BXXG 3J81i 3F8TA 3KJOA 4LF4Q 1I50H 3TREA 4BA2I 3F2CA 4O2DA 2MFIA 4EQ5A 1FL0A 1Q81C 4LF5Q 3SGIA 1SR3A 4YCVA 3OYYA 3Q8DA 4NB3A 1G291 1HR0L 1N33Q 5LMUQ 2NN6I 4UP7A 4LUOA 3ULLA 3A5UA 2CCZA 4B3SQ 1L1OC 1WJJA 3W1BA 3NENA 4JI5L 4DR5Q 1XPRA 1UE7A 4X64Q 5BR8L 4JI6Q 4BXXH 1JJCB 1A8VA 1PFSA 1YHAA 1KL9A 3HOXH 3RZOH 2D0PA 2RHQB 4LFAQ 1VQOA 4DK3C 1X9NA 4KI0A 4DV0L 1X54A 1K9MC 4R4TA 4DV1Q 1V9PA 3PO3G 1B70B 3CCQA 3DM3A 4Y52H 4JBJA 3W1GA 2N8NA 2Z6KC 5LMNQ 1FGUA 4A3KG 4IFDG 1VQ9A 4R4CA 5ELNA 2E2IH 4A3BH 4YHHL 1N34Q 1VS0A 4DV7L 1JMCA 4GKKQ 4PZ8A 4DUZQ 1YZ6A 3AEVA 4JI2Q 1ASZA 4C3JH 1HNXQ 2JJQA 3MEFA 4GOPB 3GTMH 3BZCA 3J80c 2UUBQ 2ZTEA 1WI5A 4JBMA 3ICEA 3KOJA 4A3KH 2XGTA 3FKIG 3CCUA 2JQOA 1BVSA 3U4ZA 2QEXA 3HOWG 4JI0L 5JJKA 2Z0SA 3IRBA 1XPOA 3I4MG 2ZJRA 1HZBA 1SN8A 2EIFA 4KLKA 4AH6A 1NMFA 3PIOA 4LWCA 5AJ3L 4LFBL 3M85A 1V43A 2E2JH 1L1OB 2MO0A 4BY1G 1IBKL 3F2DA 4DR2L 1X56A 4NXMQ 4APVA 4JI4Q 1JJGA 3H0GG 1NMGA 3HOUH 5H1SE 3KJPA 3I4MH 5DLQE 4LF6Q 2NVXH 4LFCQ 2R93G 1SRUA 1ASYA 1VCIA 1A62A 2YTXA 4BY1H 1XNQL 4DUYQ 5C4JH 3TS0A 2CWPA 3TRZA 3OTOQ 4YWKA 1GKHA 4X66L 5C0XI 3K8AA 2ES2A 4BA1I 1NTGA 3H0GH 1XNRQ 5C4XG 1VQ8A 1OXVA 1WCMG 4XIGS 3PUXA 1HZ9A 2R93H 1FJGL 2JA5H 2WB1G 3CCSA 2AKWB 1RIPA 2ID0A 3F1ZA 1IYJB 3CCEA 4JBKA 2ZM6L 4QGUA 1S72A 2AMCB 2F3IA 1HR0Q 1CKNB 3H3VI 3KDFA 5IYDG 3S17H 1M90C 4LNQA 4UY8C 1GD7A 4HJ7A 2BH8A 3ULJA 4JI5Q 5BR8Q 2I5MX 3HOYG 1CKMA 4IJLA 3PUZA 1VQJA 1TWFH 2NZOA 1YITA 1FVIA 3JAMc 4LF8L 2K75A 2B63H 4BY7G 1PVOA 2Q2TA 2OWOA 1TWHH 4DV0Q 3ERSX 2V1CC 3MXNB 1OXXK 4BBRG 3CPWA 3H15A 1K8AC 2JK8A 4OONA 3S1RH 2JA7G 4DR6L 1BBUA 3K81C 4LUZA 4WJ3M 5IYDH 4NXNL 3CCMA 1EQQA 1JT8A 1GM5A 3W5OA 3RNUA 1M1KC 2NVYH 3D31A 4MTNA 4YHHQ 4IFDI 3AQQA 3CP0A 4DV2L 4DV7Q 1QUQA 5GQOA 5GAHC 4QY7A 1BBWA 4R4IA 4GLXA 4YWMA 1CSPA 4DK6C 4IPDA 4BBRH 1J6QA 5IYCH 3PV0A 3GTKH 3JAMi 1DGSA 1EUJA 2ZJQA 3B6YA 2GVBA 1B7YB 4A3CG 5C44H 1X3EA 2B29A 4HIOA 1QZHA 2E2HH 4A3DG 4UPAA 4QJFA 2Q2IA 2VW9A 1CUKA 4A93H 2Y0SE 4GNXA 1Q1BA 2VL6A 4JI0Q 2D0OA 5E7NA 4HIMA 3PUWA 2R7ZG 3KF8B 2Y0SG 4R4QA 1PHJA 3EBEA 2MQHA 4DR1L 4RMFA 1XPUA 3RN2A 2KCMA 5IYBG 4P73A 5AJ3Q 4LFBQ 1AH9A 3NELA 1X55A 2VQFL 3U4VA 4A3CH 1Z47A 1IBKQ 3AFPA 3TEHB 2NVTH 1PH6A 4DR2Q 2N3SA 1Q12A 4OXPA 3RLOA 2HQLA 5C3EG 4DV5Q 1VQIA 2K50A 5IP9G 4UP9A 3T1HL 2R7ZH 3H3VH 3I4NG 5K36G 4GLAC 3PUVA 1EOVA 1SFOH 1C9OA 1P16A 2AWNA 3CC2A 3CQZH 1NBWA 3GD7A 1YEZA 2WAQG 1S40A 1I5FA 1Z9FA 4AQYL 1E22A 3CCLA 1XNQQ 4A3JG 3E9IA 3PCOB 2GN5A 5GROA 1Q86C 4LF7L 1UE5A 3UDIA 2IY5B 1L1OA 3K0XA 1HH2P 2BA0A 4LUVA 5C3EH 3G6EA 4DV4L 2UUCL 3S14H 3FP9A 1SLJA 2LSSA 3A5ZB 3PO3H 2VNUD 3KF6B 3CMAA 1AE2A 4UP8A 2N78A 3G71A 1FJGQ 4P72A 2UUAL 2ZTCA 1U0LA 2CWAA 1YJWA 1YJ9A 4KHPL 3GTOH 4A3JH 4HIDA 1Q46A 3U50C 1KXLA 2ZM6Q 4DAMA 5M5YH 4JI7L 4A76A 1TWGH 2YYZA 1CKOA 1SROA 5IT9c 4A75A 2KCTA 2BH2A 2BA1A 1N36Q 3I56A 2UU9L 1VQNA 1KAWA 3CC7A 2VS1A 3A0JA 3PIPA 4DKAC 3FKIH 4X6AH 3UE0A 3J81j 1QVCA 1A63A 2RCNA 4JI8L 2E8GA 4IOAA 4GLVB 4OWXB 4GN3B 3HOWH 3AFQA 4DR6Q 3J80i 2ATWA 4NXNQ 2PQAA 4DPGA 1X3FA 2IHFA 1EIYB 4JYAL 2WP8J 2DGYA 1UWVA 3M4OH 5JJLA 1L0WA 4A3EG 2VZAA 2IX0A 1IBML 1VQHA 1K83H 1LYLA 4DNIA 3RZDH 2ALYB 3BZKA 3TQYA 1XTDA 2Q2UA 3PGZA 5J3BA 3A74A 4GN5A 1HJPA 2PI2E 3U58A 1SE8A 3GTJH 1L2FA 1S3OA 2HIVA 5IP7G 1N32Q 4HJ9A 1J5EL 4POGA 3HOVG 2VQEL 5M3FG 4J15A 4JI1L 2R92G 1G6PA 3NBHB 4JC0A 1VQ5A 2WB1E 3FHWA 3S15H 1GVPA 2RHSB 4TQUS 5M5WH 4BBSG 2OTJA 5M3MG 2I5HA 2K5VA 4AYBE 3UDGA 4A3EH 4A3FG 3DLLA 1EFWA 1PH4A 2ZJPA 4A3IG 3ULPA 4JCVE 4AYBG 1HNZL 1D7QA 1QVGA 3M9BA 5IP7H 4NPSA 1MJCA 3STBD 4DR1Q 4YCWA 2CFMA 3ER0A 4A3LG 1KC8C 2L15A 3TS2A 2AHOB 2VQFQ 1UE6A 5C4XH 1WCMH 2PMZE 1EIFA 3K7AH 1W2BA 5M3MH 5GAEC 1X6OA 4A3FH 4H02A 1MJEA 1T9HA 4A3IH 2OQ0A 3D0FA 1PYBA 3T1HQ 1LTLA 1PH2A 1IXRA 2JA9A 4YCUA 1YJNA 3HKSA 2JEAI 2EXDA 4OWTB 2N49A 1PH3A 3S1NH 3RLFA 3PF5A 2IX1A 1K8GA 1P8LA 1Y1WG 3HOYH 3KFUA 3EIVA 4AQYQ 1NY4A 5LMNW 3AYHB 3CXCA 4DV3L 4B3TL 4BY7H 2HT1A 2K14A 3E0EA 4R1JA 4JOIA 4OX9L 1VQDA 1TXYA 3L0OA 4LF7Q 4XTCS 1TWCH 4IPGA 2UUCQ 4DV4Q 4FDBA 4MZ9A 4IOCA 3K80C 4X62L 2KENA 1QZGA 3HOZG 3M4QA 1KRTA 2JA7H 4Y7NH 4LW1A 4AIMA 1I6HH 4RG1A 2YU9H 5IWAL 5GAGC 2K4KA 1VQAA 4YWLA 1PH1A 4KHPQ 4K0KL 1AE3A 3HKZE 1Q7YC 2JE6I 4GNXC 3T1YL 4JI3L 2R6GA 4B3ML 4JI7Q 5HY6A 3G4SA 3HKZG 1K3RA 3E9HA 3CPFA 1IZ6A 4DV6L 3GTGH 4L5QA 2H5XA 4GKJL 1E1TA 3KDFB 2UU9Q 1PH9A 3HOZH 5FLXc 1PYSB 2F52A 2KBNA 2K52A 4HIKA 3S16H 3I7FA 1HZCA 1EWIA 3NEMA 2FXQA 5JEAJ 5M5XH 4A3MG 2OTLA 4TVAB 4DR7L 4GOPA 4A3DH 4GS3A 4JV5L 4JI8Q 3S1MH 1N9WA 1E3PA 1XMOL 2B3GA 4X65L 4ME3A 2PNHA 3CCVA 1SMXA 2YTVA 3HOXG 1PH7A 2A1AA 2JEBI 5GADC 3GTLH 1W3SA 4JYAQ 4WJ4A 2WAQE 1Q1EA 1R9TH 2VUMG 1IBMQ 2IT1A 2A19A 5IYBH 3BU2A 4HJ5A 3K7UC 4A3MH 5ELOA 1IBLL 1QUQB 4QIWE 2E5LL 1B8AA 3GDEA 4X66Q 3WWVA 2JA6G 1XMQL 1HNWL 1J5EQ 4A3BG 3CF5A 1X3GA 1TWAH 4YY3L 2VQEQ 5FLMG 2MO1A 4JI1Q 1VQEA 2XTIA 5IP9H 1VQPA 1XJVA 1H95A 3I4NH 1K0RA 4O0AA 2VUMH 3PSIA 4POFA 2YTYA 1UE1A 2IHEA 2UXCL 4QQBX 2ZTDA 4DR3L 4LF9L 1YNXA 1HNZQ 1D8LA 4GNXB 1WOCA 2UXDL 2JA6H 3CCRA 1KIXA 1UEBA 1HR0W 1OXSC 2HHHL 2Z6KA 1LM0A 5FLMH 4DR4L 2NVQH 2YV5A 1E1OA 4LF8Q 1I3QH 1EYGA 4PG3A 1VQLA 3EN2A 2F4VL 2GVAA 2MNAA 3VDYA 4KHZA 2UXBL 1LUZA 2KHIA 3S2HH 2JA8G 5IE8A 3BJUA 3PO2G 4OO1G 1VQ4A 1PH8A 1KRSA 4IJHA 1I94L 4B3RL 4A4IA 1BKBA 2WFWA 1VQBA 4LF4L 2KHJA 2PI2A 1NE3A 3I55A 1MIUA 4DV3Q 2D62A 4DV2Q 1NJIC 4B3TQ 1PV4A 1CKNA 4LF5L 4A3GG 3HOUG 3UE1A 2A8VA 4OX9Q 1YIJA 3GTPH 2NN6G 2JA8H 1Q82C 5LMUL 2K5HA 4L5RC 1N33L 3PO2H 3S1QH 2CQOA 1KQSA 4B3SL 3J7ZC 1IL2A 1VQGA 4X62Q 2CKZB 5C0XJ 4DR5L 3KLWA 5JEAG 4X64L 3KYHC 1PH5A 2C35B 3S24A 4JI6L 5JJIA 3PF4A 1JE5A 1E24A 1KHIA 5IWAQ 4LFAL 3RN5A 3LGJA 4C3HH 4K0KQ 1OXTA 1Y1VG 3J7A5 4A3GH 3T1YQ 4DV1L 4DV5L 4JBWA 4JI3Q 1V1QA 4B3MQ 1YHQA 1WFQA 4DAYB 1PA6A 4DV6Q 3OW2A 2I5LX 4JG2A 5EAYA 1HZAA 1RL2A 4GKJQ 1X65A 1Q8KA 2QGQA 1MKHA 4QL5A 5LMNL 2JA5G 3M4PA 1N34L 2DUDA 1JB7A 1K73C 1QVFA 2OCEA 1U5KA 1VQCA 4P75A 3L2PA 5M3FH 2R92H 3HOVH 2HIXA 3JC66 1WYDA 1E7ZA 2EQSA 1VQ6A 3M7NA 3S2DH 4BBSH 1Y1VH 4DUZL 4DR7Q 4GKKL 4P71A 3CMEA 3CC4A 3CCJA 4JV5Q 4JI2L 3CAMA 1JJ2A 2R7FA 5IY0A 1XMOQ 4X65Q 1HNXL 2NZHA 4GN4B 3CD6A 1VQMA 1O7IA 1Y14B 2B63G 1G51A 2UUBL 5FJ8G 2LXJA 1OTCA 2PQAB 2K5NA 4A3LH 3UDFA 1OXUA 2RF4A 2AWOA 4IFDJ 4JOIC 4PMWA 3G48A 4L5TA 1CSQA 4PZ7A 3STBC 4EX5A 1N8RC 4IPHA 1IBLQ 3CW2C 5HGQA 1VQ7A 2E5LQ 4OWWB 1N36L 1HNWQ 1XMQQ 3GTQH 3L7ZC
chains in the Genus database with same CATH superfamily
2X69A 4WORA 3J81c 1VQFA 1LTRD 5E1FA 3GO5A 1S4ZA 3RLNA 3I2ZA 2CW0C 2UXCQ 2A6HD 4LF9Q 3F2BA 1BCPB 3SE0A 1PMRA 1C7YA 2B2WA 2Z1CA 4HJAA 4LF6L 4IO9A 4BBRB 1GO3E 1ML0D 3QWNA 1T5XD 4ID6A 3NE5B 1Y8OB 2R7DA 1TIID 2Q2HA 2UXBQ 1YBYA 3OTOL 1SYGA 4DAPA 4OO1I 4MNOA 3SK4A 3NXWA 2F0MA 2ICIA 3F8TA 4BWGB 3F2CA 5FO8B 1ICWA 1Q81C 4LF5Q 1SR3A 2NVTB 2J4XA 1BO0A 4LUOA 1JC7A 4KY5A 2D5DA 5BR8L 4JI6Q 4BXXH 1JJCB 2WKDA 5JPNC 3OIPA 2KUMA 2R7ZB 3RZOH 2G5DA 4DK3C 1X9NA 4R4TA 4DV1Q 1I4XA 1B70B 1MD2D 3D4RA 3I72A 1TR5A 4PV1C 2QDBA 1VQ9A 2EXZA 5ELNA 4A3BH 3A55A 1QCBD 3GTMB 4DV7L 5HGTA 5EQ0A 4DUZQ 2F0DA 1PZKD 1YZ6A 1A2UA 2L1BA 1HNXQ 1DZ1A 3NBHA 2QCPX 2ZTEA 1WI5A 3ICEA 4RHSA 3MXUA 3FKIG 5FLXL 1SNMA 2JQOA 4DAYA 2F3WA 3M4YA 2IWHA 5G3LD 2E2JB 5JJKA 1QOHA 1K8OA 3A7LA 3CRKC 3FKIB 4AH6A 4OO1H 1EWCA 2R3ZA 4N9TA 4G7OC 4LWCA 1FR3A 1WTHA 4LFBL 1V43A 3W3AA 2PQEA 3H94A 4NXMQ 4APVA 5JVH3 4MN3A 1JJGA 3H0GG 3HOUH 5CV4A 4EQPA 1F2YA 5EGTA 1F9SA 3MZ5A 3H0GB 3I8ZA 4MTKA 4DUYQ 5FO9B 3K8AA 4FXKC 3Q6SA 1EOTA 2K6AA 4HMIA 3RD4A 1VQ8A 4I7AA 1E2ZA 1HZ9A 2WB1G 4EVOA 2ID0A 4FNFA 2F1MA 4G57A 1HR0Q 1CKNB 1X32A 3KDFA 3S17H 1W6KA 2ZXPA 1GD7A 2WB1B 1HA6A 3HOYG 3GP7A 4IJLA 5E4WC 5KYIA 2AUJD 1TWFH 1PVOA 2L4NA 5J1ZA 3ERSX 1WD0A 3HOYB 1QE6A 5ELBA 3H15A 1K8AC 1GUNA 3K58A 4OELB 1M1KC 2NVYH 4YHHQ 4XT1B 1PLFA 3AQQA 1SNCA 1H9SB 2J7ZA 4YIJA 1QUQA 4RHRA 4YWMA 4DK6C 4BBRH 1ZYRC 2MGSA 4G4KA 1DGSA 1EUJA 3B6YA 1EY5A 4A3CG 2F0UA 2B29A 1STBA 3SDZA 2BDOA 5CBAE 4UPAA 4QJFA 3S16B 1JORA 2F0PA 4ZUJA 4JI0Q 1Q1BA 5KNDA 1ET9A 1JWSD 5A2QE 1F9RA 4P73A 4WJWA 5AJ3Q 1BQQT 5EPKA 2ZXOA 4E6IA 2NVTH 3RLOA 3SK5A 3D3RA 5KYLA 2HQLA 2D9UA 4DV5Q 2K50A 5IP9G 3T1HL 2R7ZH 1MSGA 1C9OA 1ENAA 2LKVA 3DM1A 1YEZA 1U4PA 4AQYL 4A3JG 1CA5A 1LTTD 4RWSC 1Q3LA 2XIWA 4ZK9B 2IY5B 1RKNA 4H44C 3K0XA 3G6EA 1ZXTA 3S14H 4A3JB 1SLJA 2LSSA 3LX0A 3SXHA 4EQNA 4WFN3 2EYPA 4UP8A 4ODGA 1FJGQ 3WDNA 2CWAA 1MHWC 1YJWA 2QF7A 2ZM6Q 4DAMA 2FFKB 1SROA 4A75A 2RDHA 2BA1A 3J7YW 4HCEA 3R8BA 4JPBW 1DJRD 3FKIH 3VR2A 4X6AH 3UE0A 1K0SA 2RCNA 3M4OB 1PFNA 1EYDA 3AFQA 4DR6Q 3VR6A 3GTPB 4DPGA 2H1EA 2IHFA 2F0NA 1UWVA 4A3EG 2VZAA 1LYLA 4V0BA 2ALYB 3JAME 4M1UB 1HJPA 1L2FA 2HIVA 3OPOA 4HCSA 5IP7G 4A3GB 4A3EB 4KJOA 1SE2A 2VB2X 1RODA 1VMPA 4J1MA 1BR9A 3AB9A 2NTSA 2OTJA 3MA2B 2K5VA 4C1NK 3DLLA 2M9VA 1I4HA 2ZJPA 5ELCA 2OEOA 1D7QA 1QVGA 1AN8A 1SYFA 3S2DB 1H9SA 3STBD 4DR1Q 4YCWA 3ER0A 2DJGC 1EU3A 4K14A 3MTSA 3KUPA 2LY7A 1EIFA 4ME5A 1PTOF 1SNDA 1FNUA 2B2TA 1IYUA 1D6EC 3D0FA 1ENFA 1B53A 5I6YA 1MSHA 1PH2A 2JEAI 2EXDA 2N49A 1SMYC 3RLFA 1SYBA 1P8LA 3OMCA 1NNXA 3HOYH 5LMNW 1EU4A 4R1JA 4JOIA 2E75C 3L0OA 4IPGA 1SE4A 2KEDA 1KRTA 2ICEC 4RG1A 5HURA 5IWAL 5DNFA 1PH1A 2F0JA 4K5WA 4KHPQ 1JICA 2DNCA 3T1YL 1EY9A 5HY6A 4C1NI 4DV6L 4X3KA 3MEHA 5BN4A 3HOZH 5FLXc 1PYSB 3S1MB 3S16H 3I7FA 3NBIA 1B3AA 1EWIA 1NR2A 1LTAD 1V1PB 5JEAJ 4A3MG 2IPKD 1DXMA 3VR4A 4CDDC 2PNHA 4DA2A 1PH7A 5EJWA 2JEBI 5GADC 3GTLH 1W3SA 4L8JA 2WAQE 1Q1EA 2VUMG 3ONAB 4N8X1 1NCVA 1QB5D 4CJ1B 3G7LA 3HP3A 2Q8IB 1O7LA 3GDEA 2KJXA 2VUMB 2JA6G 2VQEQ 1VQEA 5IP9H 1VQPA 5CORA 1K0RA 4O0AA 3NWTA 4FP5D 2JA6B 1PDQA 1CK1A 4DR3L 1YNJD 2K7VA 5IIFA 4Q5VA 3U9OA 1EY6A 1JQYD 1WTQA 1LM0A 5FLMH 4DR4L 2NVQH 2JP1A 1DONA 4PG3A 1VQLA 2GVAA 2MNAA 3VDYA 1ET6A 4A3KB 5ISRA 2DY8A 5LL6S 2JA8G 1B1ZA 1EY8A 5CV6A 1IHZA 4RGNA 1SNOA 1KRSA 1NUCA 2PW7A 3EQLC 3NK9A 2HCIA 4OL7A 1MIUA 1TS3A 3VR3A 2D62A 2F0HA 1NJIC 3V96A 1D5XC 2A73B 1YIJA 1I4RA 2NN6G 5EKIA 3GTPH 2OT2A 4F7XA 1N33L 2K5HA 5T1GA 4B3SL 2B2VC 1IL2A 1VQGA 2CKZB 5C0XJ 3KLWA 5JEAG 3KYHC 1PH5A 2C35B 5JJIA 1KLUD 4LFAL 1O78A 1WVLA 4K0KQ 1ZEQX 5I2XA 1BCPC 1OXTA 4A3GH 4DV5L 1V1QA 5C4JB 4M8AA 4RKLA 5EAYA 2QGQA 1TY2A 3M4PA 4KV6A 3WOFA 1N34L 1IW7C 4KD4A 2OCEA 1K73C 1VQCA 4QCLA 3I73A 4QB4A 3JC66 1VQ6A 3M7NA 4FYDA 3S2DH 1CZGA 3CMEA 1GOZA 4JI2L 5IY0A 4H7BA 4X65Q 1XMOQ 4GN4B 3IKJA 1BOSA 3K57A 3HG9A 1DD2A 2A68D 5I6WA 1TS2A 1OTCA 2PQAB 3TSSA 2RF4A 4R8IA 4NDXA 1ILPA 5IGCA 2QILA 4L5TA 1CSQA 4IPHA 3CW2C 1VQ7A 4OWWB 1XMQQ 4YY3Q 1EEFD 1W6JA 1A0IA 3S1RB 1V1PA 4L5SA 1HXYD 3M3YH 5FJ8H 1GUTA 4B9WA 2VY3A 2UUAQ 1SAPA 4L6TB 5C3WA 5IYCG 1EZ6A 4JI4L 4ALPA 2XSCA 4DK1A 5L37A 2UXDQ 4Q0FA 4R4OA 4R8NA 4LFCL 2I0QA 4A93G 1YHBA 2F4VQ 1K3BC 5C0XG 2E2HB 5JOBA 3SVMA 1SDFA 1C0AA 2EYMA 1JWUD 3I4OA 1KAAA 4A93B 1LT3D 1JOOA 4BXXG 1I50H 3NUCA 1XWEA 4O2DA 2MFIA 4EQ5A 3X3MA 1FL0A 3SGIA 1JCKB 3OYYA 1RTOA 4Z9CB 1G291 3HZXA 3RZOB 2NN6I 3ULLA 1EQTA 3MFYA 3W1BA 3NENA 4JI5L 4DR5Q 1XPRA 4X64Q 1A8VA 1KL9A 1S5FD 3VA7A 1D5MC 2D0PA 2RHQB 3SEBA 3I3CA 4IN3A 4KI0A 1K9MC 4RH6A 1EZ8A 1D2BA 5KRUA 4RCNA 2IL8A 3MWYW 3W1GA 2N8NA 5LMNQ 1FGUA 1PRTC 4R4CA 1JOKA 5EPJA 1LO5D 2I07B 3AEVA 2BOSA 3C46A 3GTOB 3MEFA 1F9PA 2UUBQ 4JBMA 3EFXD 4A3KH 2BDNA 2XGTA 5FO7B 1BVSA 1EEID 1FNVA 3U4ZA 4K8JA 5A35A 2L11A 3VYSA 5CMDA 2EIFA 4HTHA 1QNKA 3PIOA 1VMCA 3M85A 1L1OB 1GUOA 1IBKL 4DFAA 2KCNA 4DR2L 1S5DD 5I4DA 4CJ2C 4FF4A 4WRDA 2NN6H 2O5IC 2NVXH 1EYCA 1SRUA 1ASYA 1VCIA 5JEAH 1A62A 2B8GA 4KD3A 5C4JH 3TS0A 4X3SA 3TRZA 1GKHA 5C0XI 2B2TC 4BA1I 1NTGA 2H4OA 2P5ZX 1XNRQ 3BVGA 2F0IA 1Y8NB 3EJIA 1RHPA 1WCMG 1I6VC 4HAEA 1IYJB 3CCEA 1VF5C 4QGUA 3GV3A 1S72A 1WCMB 4LNQA 2K5DA 1JWMD 3BDCA 2QKIC 4AYBB 1II3A 4FF2A 2NZOA 1YITA 3JAMc 2K75A 3FEWX 4DV0Q 3S1NB 3MXNB 2NVYB 4BBRG 3CPWA 1M4VA 2JK8A 3S1RH 1F9QA 3ND8A 4LUZA 4B9XA 4NXNL 4WJ3M 3W5OA 5IOCA 3RNUA 3D31A 2O4XA 2A69C 5IGBA 2GA4B 5IODA 5GQOA 1HTLD 1BBWA 1EYAA 2IX3A 5IYCH 2NWGA 3C2PA 3L3OC 3T51B 2A6HC 2E2HH 1JE4A 3R3OA 4A93H 1PZID 5E7NA 5C0XH 3PUWA 2R7ZG 4R4QA 2B2UC 2PZUA 2MQHA 2HCCA 3EBEA 5IYBG 4IUQA 1BCPF 4IUUA 1AH9A 3AFPA 1STYA 3TEHB 4TSSA 3MAQA 3AU7A 2EYFA 1BUVT 3O13A 2CHBD 3I90A 4TRDA 3H09A 5IT9E 1PTOD 1NBWA 4HSPA 3LWUA 1WTVA 1S40A 1Z9FA 1XNQQ 3CCLA 3S14B 3E9IA 2GN5A 3R93A 1L1OA 4DV4L 1HH2P 2BA0A 3DWPA 3FP9A 3KF6B 3DWQA 2UUAL 1U0LA 3W2DA 3OIQA 1YJ9A 4KHVA 4XDXA 3GTOH 4HIDA 3U50C 1ILQA 3VA5A 1CKOA 2BH2A 2V4DA 3I56A 2UU9L 1STAA 1KAWA 3CC7A 3A8JE 5KIXA 4LJZC 2VS1A 2JN4A 2EDGA 4XT3B 2VB3X 4RCOA 1QVCA 4KKSA 4JI8L 1WTXA 4OWXB 3KLSX 2DNEA 2ATWA 1EIYB 2XVSA 3PO2B 3S1QB 2DGYA 3Q24A 1IBML 1EIGA 2IX0A 1S5BD 1VQHA 2Z4HA 3BZKA 3TQYA 4EGVA 1PRTB 1AZQA 4NP5A 2PI2E 1B4OA 1SBBB 3GTJH 1N32Q 4HJ9A 1F2LA 2TMPA 1LLRD 2B2VA 3HOVG 5M3FG 4JI1L 4EQOA 2X6LA 3MXNA 2WB1E 2I5HA 5NUCA 3HOVB 5M3FB 3ULPA 4JCVE 5ELDA 2MHVA 3M9BA 2CFMA 2RQXA 2L15A 2AHOB 2VQFQ 1UE6A 1WCMH 1I4GA 2PMZE 1FGBD 3K7AH 5M3MH 5GAEC 4ZAIA 1MJEA 4A3IH 4KN4C 2RDGA 1QWYA 1FD7D 1IXRA 1YJNA 1J8IA 3S1NH 2PMZB 1K8GA 3D4DA 1Y1WG 2EYLA 3EIVA 4TKOB 3AYHB 3QOLA 4DV3L 4B3TL 4QUFA 1B9MA 1VQDA 5CC4A 2EVBA 4LF7Q 2TSSA 2UUCQ 1Y1WB 4MZ9A 4DXGA 3K80C 4IUTA 4X62L 3HOZG 3M4QA 4AIMA 1O7ZA 1TKWB 3IL8A 5GAGC 1VQAA 4YWLA 1Q7YC 4I65A 2F03A 1NAPA 3HOZB 4JI3L 4JI7Q 1G91A 3G4SA 3E9HA 3T13A 1IZ6A 4PMCA 4GKJL 1E1TA 4KJNA 3DXJC 2KVMA 1HZCA 3NPPA 3NEMA 3OOCA 1XYIA 1HCZA 3GTLB 3S9WA 4DR7L 1N9WA 4N9PA 1HRJA 4ME3A 4IUPA 3NSWA 3HOXG 2A1AA 4JYAQ 4JVZA 1R9TH 2BE5D 4G7HC 1GUSA 5IYBH 3BU2A 1WTRA 4H13C 4HJ5A 2N55A 3K7UC 3HOXB 1IBLL 1C48A 4ZCKA 2PNRC 3WWVA 1FYCA 3C1FA 1ENCA 1HNWL 1J5EQ 1GUWA 1EQVA 3DHQA 3NQTA 5FLMG 2MP1A 1SYEA 4C3JG 2UXCL 2IHEA 3DUZA 4K2LA 4RKBA 2ZTDA 4LF9L 1YNND 1HNZQ 2NVQB 1B44D 4RFBA 2RBMA 4GNXB 1Q90A 5LL6X 1FNWA 1KIXA 1SYCA 1UEBA 4C3JB 1LV9A 1BDOA 4LF8Q 1ICFB 2UXBL 5EBDA 4ZQ3A 3S2HH 5IE8A 2KHSA 1VQ4A 4A4IA 1BKBA 2PI2A 1NE3A 2FJ2A 3I55A 4KMUC 1CQVA 4A3GG 1CKNA 4LF5L 3UE1A 4OX9Q 2CH4W 1CHPD 3PO2H 1E0BA 3S1QH 2CQOA 4FF1A 1Z6HA 4CKCA 3N6RA 4JI6L 3S24A 3QB3A 2EOTA 3LGJA 3MXGA 5JVG3 3I4LA 4OGQC 1O80A 3R2IA 4DV1L 2B39A 4B3MQ 1YHQA 3T56B 1PA6A 1EIHA 1C4QA 4JG2A 3MHBA 5A2QL 2WKCA 4QL5A 2JA5G 2F0GA 1MKHA 3V2TA 4NKLA 2C5CA 2DUDA 3HOVH 5M3FH 1U5KA 3L2PA 4ZYSA 2NYZD 1U4RA 1HFNA 3SK6A 4UDUC 4DUZL 2JA5B 3CC4A 4JV5Q 2RDFA 4F88A 2R7FA 1JJ2A 1HNXL 1O7IA 3Q22A 5E3FA 2B63G 1G51A 3P7JA 1HA5A 4CBVA 5FJ8G 1U9RA 1OXUA 3CRLC 2B63B 3G48A 3STBC 2E5LQ 3M3YB 3R2TA 1TWHB 3GTQH 4ZKBB 4F8MA 2LXKA 2ASBA 4HJ8A 2L0CA 1TU2B 5D3IB 3BG3A 1SXTA 4NXML 1Y1WH 3DEPA 1SEBD 1IKLA 2HHHQ 1WTWA 3C1EA 3UDXA 3ZJYC 4DUYL 2OQKA 2PZTA 1I50B 1N32L 1YVCA 2A74C 5BN5A 3PMFA 4IPCA 1I94Q 4B3RQ 3J81i 4LF4Q 4BA2I 1F2ZA 2RSOA 1DOLA 4PMBA 1K8MA 3JAML 3Q8DA 3MC0B 4NB3A 1HR0L 5LMUQ 4UP7A 5EKKA 1L1OC 5IGFA 2B2UA 1YHAA 3HOXH 1VQOA 1SFOB 5I2YA 3D6CA 1X54A 1V9PA 3PO3G 4XQQA 3CCQA 1PFBA 4Y52H 2XN9C 1VDZA 2Z6KC 4A3KG 4YHHL 3PO3B 3H91A 2EYOA 3PIP3 1S5CD 3EA6A 1JMCA 1STHA 1TY0A 3NTIA 4GKKQ 4C3JH 4GOPB 3BS1A 3BZCA 1HUMA 5M5YB 3EROA 3J7AF 1TWGB 3KOJA 3A7AB 3CCUA 1YNJC 1ESRA 1JR0D 2QEXA 1DM0B 4JI0L 2Z0SA 3IRBA 1XPOA 3BVMA 1SN8A 4JK1C 2EJFC 1NMFA 5CV5A 5IGGA 4CDFC 5AJ3L 1A15A 1UNSA 1OO9B 4K6DA 2JYOA 2EYHA 3F2DA 1X56A 2NVXB 3C3LA 1EY4A 2WACA 1NMGA 1S5ED 3I4MH 1LTBD 5CYUA 1WD1A 5DLQE 3E5SA 4LF6Q 1DYQA 2DJFC 5FKAC 4BY1H 2CWPA 3S15B 3OTOQ 5M5WB 5CR3A 2ES2A 2RA4A 1PTOH 2A6ED 2B2YC 5C4XG 1G2TA 1OXVA 3SR1A 3K59A 3PUXA 2R93H 1DOKA 1FJGL 2JA5H 1MGSA 2L9HA 3CCSA 2AKWB 2NB0A 4ILWA 1LT6D 3F1ZA 5EKLA 5C4XB 3OHXC 4LK1C 5J22A 2ZM6L 2AMCB 3TP6A 3H3VI 4P2CB 4UY8C 4HJ7A 3ULJA 5BR8Q 2KECA 4LF8L 1FVIA 2B63H 5E4XA 4KKUA 3SK8A 4CKBA 2Q2TA 2OWOA 1TWHH 4K2KA 1G2SA 1OXXK 3FVQA 4FF3A 1EY0A 4RGOS 3FPPA 3TDQA 2A68C 2JA7G 3OWFA 4DR6L 1HPCA 1BBUA 5IYDH 3IFTA 1TWCB 4IURA 4MTNA 1IKMA 3CP0A 4RGMA 2JA7B 4DV7Q 4QY7A 2YU9B 4GLXA 4O1NA 1J6QA 1WTOA 1SJED 3PV0A 2F3VA 2ZJQA 2GVBA 2EJMA 1X3EA 1RTNA 1BBXC 1DOMA 4A3DG 1E2WA 2Q2IA 1CUKA 1F2MA 4G7ZC 4DR1L 3D6WA 4RMFA 3I91A 4A3DB 2KCMA 4LFBQ 1X55A 3U4VA 3J80E 5DAUA 1Z47A 1E2VA 3OW7A 1U4MA 1PH6A 1H9MA 3G6JB 2FMMA 2M00A 2I46A 5CV8A 1VQIA 2XNAC 3H3VH 1XX8A 3PUVA 1SFOH 2XWBB 2AWNA 3CC2A 3CQZH 3ZYYX 1TWAB 3HEJA 1I5FA 1E22A 2EYJA 5GROA 4DU9A 2IW3A 1TT2A 2K5QA 1Q86C 3UDIA 3KLRA 1C8CA 4LUVA 5AFWA 5C3EH 3J7AV 4K5VA 3PO3H 4R9WA 2OXPA 2VNUD 5K36H 3CMAA 4DXFA 3G71A 4P72A 2EY6A 4QIWB 4KHPL 2F0LA 4CKEA 4KY6A 1CM9A 2LFNA 1I3QB 5M5YH 1STGA 4F87A 1BF4A 1TWGH 1N36Q 5DM63 2F0EA 3HGBA 4DKAC 1V1OA 4O42A 2AUKA 4IOAA 3J80i 5J39A 2PQAA 5CBEE 2WP8J 3KK7A 1AFPA 3GTJB 4PNYA 1L0WA 4FXDA 1K83H 4DNIA 3FRPB 1XTDA 2Q2UA 3PGZA 3K5NA 3A74A 3U58A 1SE8A 4POGA 1GUGA 1TS5A 2HUGA 4J15A 2VQEL 1G6PA 3NBHB 3MVVA 3S15H 2AQ1B 2RHSB 4TQUS 5M5WH 1X3PA 3BZDB 5M3MG 4AYBE 2F0OA 1ZKOA 1EFWA 1PH4A 3QJYA 4A3IG 4HR7B 4AYBG 3K7AB 5M3MB 4A3LG 3K6OA 3ERQA 2X6GA 4A3IB 5ELFA 5C4XH 1AZPA 1NSNS 1W2BA 3Q0AA 1JOQA 4A3FH 2NZ1D 1CHQD 2K1BA 2K28A 1CI3M 2CW0D 3T1HQ 2JA9A 4YCUA 3HKSA 1I4QA 5FLXE 3TP5A 2IX1A 4DF7A 4ABNA 5KNBA 3KFUA 4AQYQ 3CXCA 3ND9A 2K14A 4XTCS 1TWCH 4FDBA 3T4AC 2F4IA 2JA7H 2MJ8A 4Y7NH 1HHVA 1QILA 3FDTA 2YU9H 4K0KL 3LWEA 2AQ2B 1AE3A 1A3TA 5CGKA 2JE6I 4NW2A 3K5LA 4GNXC 1PYWD 2R6GA 3CPFA 2F0QA 3KDFB 2FINB 1PH9A 2F52A 3QG1A 1GJXA 4HIKA 2K52A 3EVQA 3KLSA 2FXQA 5M5XH 1D1IA 4XXEA 1R9TB 4A3DH 3QIAA 3FMCA 1E3PA 1XMOL 4X65L 1IYVA 1Y8PB 5I9PA 3TZDA 3CCVA 3CHBD 3QOJA 2EZVA 4WJ4A 3HS0C 4ULLA 5C5LA 1EWHA 3TP8A 4XQNA 3VYUA 2CQAA 5FK9C 5ELOA 1QUQB 4X66Q 2G9HD 1XMQL 1X3GA 1TWAH 4YY3L 2MO1A 4UAIA 2XTIA 3KBXA 1XJVA 1H95A 3QR8A 2Z8LA 2HDLA 3PSIA 4DN4M 2L12A 2LS01 4DNRB 1GHJA 4POFA 2E2IB 2SNSA 1KNAA 2YTYA 1UE1A 4QQBX 4LAAA 3K5MA 1YNXA 1PTOC 4JW0A 2J0TD 5JPMC 1WOCA 2UXDL 3CCRA 3S2HB 2Z6KA 1HUNA 2EE1A 2KQ3A 1E1OA 1I3QH 2F4VL 3EN2A 1KDCA 2Q8RE 1LUZA 1HTPA 3PO2G 1PH8A 5C4ZA 4IJHA 2DN8A 2WFWA 1VQBA 3VYTA 4DV2Q 4KN7C 5TSSA 3ITPA 2A8VA 1Q82C 4L5RC 1KQSA 3J7ZC 4IUVA 5LHY1 4DR5L 4X64L 2FMCA 2NBFA 3PF4A 4RA8A 1JE5A 1E24A 3BDLA 3P1HA 5IWAQ 1UUPA 3RN5A 3L9AX 2NUCA 1SJHD 3T1YQ 4JBWA 2CH4A 1WFQA 1K28A 4DV6Q 3OW2A 1HZAA 1PZJD 2KOLA 1X65A 5LMNL 3VYRA 2SDFA 4FVMA 1JB7A 1QVFA 4HMJA 1E7ZA 2E74C 2EQSA 5D14A 1Y1VH 3BDOA 1LTGD 3CCJA 5EBCA 3CD6A 2NZHA 2Z9HA 5T1IA 5KGUA 1VQMA 1PRTF 3GQBA 2B2YA 2K5WA 2UUBL 5IT9L 1ESFA 3TBIB 1XXGA 1SSOA 1MBYA 1VF7A 2K5NA 3NP8A 4CHTB 4A3LH 3UDFA 1L0XB 3GTQB 2AWOA 4IFDJ 4EX5A 1A63A 4XQJA 1AEXA 1N36L 4HN7A 3H3VC 2O2LD 4GZYC 4C2MH 4P74A 4LMQD 1ZYRD 4K8IA 4C3IH 4PZ6A 1SYDA 3HFZB 1G8ZD 5KNCA 1VQKA 4V190 1YI2A 4DR3Q 5C5MA 1H9RA 2QA4A 2RSNA 4IZ8A 2Q8TA 5C44G 1B3QA 5IGEA 3PUYA 1KD1C 1A6XA 4K6LA 1SNPA 4KY7A 4DR4Q 3GTKB 3OMGA 3N52A 5C44B 3A8IE 4GOPC 2C9OA 2QW7A 3RR5A 1RD9D 1TQOA 3KF6A 1XNRL 1EQRA 3D4WA 1LTID 3KJOA 3TREA 2HDMA 1EY7A 1T5EA 1R4QB 3CU7A 4KK7A 3IAYA 2SEBD 4YCVA 3F2UA 1N33Q 3A5UA 4MHEA 2K03A 2CCZA 4B3SQ 1WJJA 2E76C 1UE7A 1PFSA 1KNEA 4LFAQ 2A5HA 3OSOA 4DV0L 1CZWA 1B2TA 1F77A 2ENBA 1U4LA 3OWEB 3DM3A 2BE5C 4JBJA 4CJ0B 2F0WA 4IFDG 2E2IH 2SNMA 1N34Q 1VS0A 4PZ8A 4J8QA 3URYA 4JI2Q 1ASZA 5FOBB 3RUZA 4CDCC 2JJQA 1UAPA 3GTMH 3J80c 2XRSD 1TS4A 3AMUA 1YNNC 3RMHA 3HOWG 2L55A 1KDAA 3I4MG 2ZJRA 1HZBA 3MFGA 3P75A 4KLKA 2BCOA 4CGYB 3HOWB 2E2JH 2MO0A 4BY1G 3I4MB 4UHVA 2Z4IA 3QO2A 1AP0A 4CDEC 3T16A 4JI4Q 3RZDB 5C3XA 5H1SE 3KJPA 4BY1B 2KA7A 1DCZA 3NTHA 4LFCQ 2R93G 4QF4A 1PTOB 1STEA 5D65A 3BYTB 1I4PA 2YTXA 1XNQL 3J81E 2QDLA 4YWKA 4X66L 2R93B 1GHKA 3X3NA 2M2LA 3H0GH 1XTCD 5I9OA 4XIGS 2PO4A 4N8FA 5DM73 5KEEA 4DAVA 1ONLA 4BS9A 1RIPA 4XYOA 1SMYD 1BXTA 4JBKA 1EL0A 1G6ZA 2F3IA 5IYDG 1M90C 3KBGA 2BH8A 4JI5Q 2I5MX 1CKMA 1HQRD 3PUZA 1VQJA 1H9JA 4BY7G 2OF1A 4C56C 5CV7A 2G9DA 2V1CC 5F2DA 3BVZA 2D2CC 1CTMA 4OONA 4BY7B 2B2WC 3K81C 1JT8A 4QMGA 3CCMA 1EQQA 3K0YA 1RJTA 1IL8A 1WTPA 1GM5A 1L0YB 1RCVD 5IGDA 4IFDI 2EY1A 1R4PB 3NWSA 4DV2L 1D1KA 1I6HB 5GAHC 1CQFA 4R4IA 2ZT9C 1CSPA 4IPDA 1SE3A 1BNZA 2AQ3B 3GTKH 3TZUA 3JAMi 4ZKCB 2RKSA 1Y69U 3A56A 1B7YB 5C44H 3GTGB 5G3LF 4HIOA 1QZHA 2KCCA 1A3UA 3E6ZX 2VW9A 1JB3A 2Y0SE 4GNXA 2VL6A 2D0OA 2QEJC 3K5OA 4HIMA 3KF8B 2Y0SG 1PHJA 1XPUA 2F0SA 3RN2A 4U68A 3NELA 2VQFL 4A3CH 1IBKQ 3DEOA 1MI2A 5COYA 4DR2Q 2Y0SB 2N3SA 1Q12A 4OXPA 4XYQA 3CQZB 5C3EG 2ZXRA 5D3DA 4UP9A 4A3MB 5DEHA 2F0TA 3V05A 4GLAC 3I4NG 1EOVA 5K36G 1P16A 3E0JA 3GD7A 4DNTB 2WAQG 5C3EB 3J81L 2K32A 3PCOB 3I4NB 4FXGC 3A8KE 2HD3A 1QNUA 4LF7L 1UE5A 2WAQB 2UUCL 1QJOA 1CA6A 3A5ZB 3LNNA 4OEMB 1AE2A 2N78A 5K5PA 4IFDH 2ZTCA 2HQEA 3TN2A 4ZUIA 4A3JH 1KXLA 1Q46A 1AW7A 4HSVA 2VXWA 4B08A 3P20A 4JI7L 4A76A 2YYZA 5IT9c 1Q8IA 2KCTA 2DY7A 4X3UA 1KLGD 1VQNA 4H0LC 3U9SA 2WINB 1SNQA 1RF2D 3A0JA 3PIPA 3IFDA 3J81j 2E8GA 1BCPD 4GLVB 4GN3B 2WIIB 1K83B 3HOWH 2L5TA 4NXNQ 2JA8B 1X3FA 4JYAL 4C3HG 1CFMA 4NMZA 2JSOA 2F0FA 1D5ZC 3M4OH 5JJLA 1KABA 2KEEA 3RZDH 3FPUB 5J3BA 4DK0A 3E3XA 1IW7D 4GN5A 4C3HB 1B9NA 1S3OA 2K01A 1J5EL 4OIJA 5EPLA 3BYYB 2R92G 2PYKA 4JC0A 1VQ5A 3FHWA 4BBSG 2CVRA 1GVPA 2R61A 2MPMA 3UDGA 4A3EH 4A3FG 3I70A 3VR5A 1LT5D 2R92B 1HNZL 1UEAB 2JXMB 2K33A 3HRZC 5C6AA 4BBSB 5IP7H 4NPSA 4J6HA 1MJCA 1A2TA 4A3FB 1KC8C 1CT1D 3TS2A 3TP7A 5CV9A 2A6EC 2WV6D 1X6OA 4H02A 1T9HA 3Q23A 2PZWA 2OQ0A 2XRQD 1PYBA 1A3VA 1LTLA 2XWJB 1TVXA 4RAUC 4OWTB 5ELEA 1PH3A 3PF5A 2EJGC 1NY4A 4BY7H 3KF8A 2HT1A 4Y7NB 3E0EA 4OX9L 3DMUA 1TXYA 1NR4A 4QUCA 4DV4Q 4IOCA 2KENA 1QZGA 4LW1A 1I6HH 1PXUA 1GXDC 2K4KA 3HKZE 4B3ML 3HKZG 1K3RA 4OHJA 3H6MA 3GTGH 4ZRZA 2EPBA 4L5QA 2H5XA 5M5XB 2UU9Q 3M7GA 1EFID 2KBNA 2MUYA 3GV6A 3HKZB 2F0KA 1HQMC 4KKTA 2OTLA 4PQXA 4TVAB 4GOPA 4GS3A 4JV5L 4JI8Q 2K05A 3S1MH 2EY2A 2B3GA 1M8AA 1SMXA 2FHTA 2YTVA 1HFGA 2B8FA 4L63B 4X3TA 4U673 1IBMQ 2IT1A 2A19A 1PRTD 2N88A 4RGTA 3NHHA 2F0VA 5JJZA 4A3MH 4QIWE 2E5LL 4DGZA 1B8AA 1H9KA 2PCFB 3MXPA 4A3BG 3CF5A 3DWAA 4JI1Q 2RVLA 3I4NH 2RCFA 2VUMH 4IUNA 3NTKA 4A3BB 1LTSD 5JAVA 1D8LA 3PQIA 3PIO3 2JA6H 1HR0W 1OXSC 2HHHL 2YV5A 4HEDA 1EYGA 2O5JC 1LACA 4KHZA 2KHIA 3BJUA 4OO1G 3NQIA 1QG7A 1I94L 4B3RL 4IQZA 1O7YA 2PW5A 4LF4L 3UI2A 1V8QA 2IJ0A 2KHJA 3CKIB 5M9OA 3WOEA 1LABA 4OIKA 3T53B 4DV3Q 4B3TQ 1PV4A 1Z7TA 3HOUG 2LMCB 2JA8H 5LMUL 4K5XA 4X62Q 1B50A 1LT4D 1PFMA 3HOUB 3D8GA 3TMEA 1KHIA 4ZLTF 4IALA 4C3HH 2PPBC 1X3QA 1Y1VG 3J7A5 4JI3Q 3A54A 1RDPD 4DAYB 2I5LX 5C4HA 4GKJQ 1RL2A 1Q8KA 1Y1VB 2EY5A 4P75A 3J80L 2R92H 2HIXA 1WYDA 4GKKL 4BBSH 4DR7Q 4P71A 1STNA 3CAMA 4FO2A 4MIUA 1Y14B 1KDBA 3S17B 4KTAA 2SOBA 1J9OA 2LXJA 3SHLA 4C3IG 2NTTA 2Z6BA 4S3SA 5BN3A 2E2DC 1TWFB 1KTKA 4JOIC 4PMWA 4C2MB 4PZ7A 1IBLQ 2A69D 1N8RC 5HGQA 4C3IB 1HNWQ 4I7ZC 3L7ZC 2K04A
chains in the Genus database with same CATH topology
4YY3Q 1A0IA 2LXKA 2ASBA 4C2MH 4L5SA 4P74A 4HJ8A 3M3YH 5FJ8H 3J81c 1VQFA 4C3IH 4PZ6A 3GO5A 2VY3A 3HFZB 2UUAQ 3RLNA 4NXML 3I2ZA 1Y1WH 2UXCQ 1VQKA 5IYCG 1YI2A 4DR3Q 4JI4L 4ALPA 4LF9Q 3F2BA 2QA4A 5C44G 2UXDQ 1C7YA 4HJAA 4LF6L 3PUYA 1KD1C 4IO9A 2HHHQ 1GO3E 4R4OA 4LFCL 4DR4Q 2I0QA 2R7DA 4A93G 1YHBA 3UDXA 2F4VQ 3ZJYC 4DUYL 2Q2HA 2OQKA 1YBYA 2UXBQ 5C0XG 3OTOL 4GOPC 1N32L 1YVCA 3RR5A 4MNOA 4OO1I 1C0AA 3I4OA 4IPCA 1I94Q 4B3RQ 3KF6A 1XNRL 1EQRA 4BXXG 3J81i 3F8TA 3KJOA 4LF4Q 1I50H 3TREA 4BA2I 3F2CA 4O2DA 2MFIA 4EQ5A 1FL0A 1Q81C 4LF5Q 3SGIA 1SR3A 4YCVA 3OYYA 3Q8DA 4NB3A 1G291 1HR0L 1N33Q 5LMUQ 2NN6I 4UP7A 4LUOA 3ULLA 3A5UA 2CCZA 4B3SQ 1L1OC 1WJJA 3W1BA 3NENA 4JI5L 4DR5Q 1XPRA 1UE7A 4X64Q 5BR8L 4JI6Q 4BXXH 1JJCB 1A8VA 1PFSA 1YHAA 1KL9A 3HOXH 3RZOH 2D0PA 2RHQB 4LFAQ 1VQOA 4DK3C 1X9NA 4KI0A 4DV0L 1X54A 1K9MC 4R4TA 4DV1Q 1V9PA 3PO3G 1B70B 3CCQA 3DM3A 4Y52H 4JBJA 3W1GA 2N8NA 2Z6KC 5LMNQ 1FGUA 4A3KG 4IFDG 1VQ9A 4R4CA 5ELNA 2E2IH 4A3BH 4YHHL 1N34Q 1VS0A 4DV7L 1JMCA 4GKKQ 4PZ8A 4DUZQ 1YZ6A 3AEVA 4JI2Q 1ASZA 4C3JH 1HNXQ 2JJQA 3MEFA 4GOPB 3GTMH 3BZCA 3J80c 2UUBQ 2ZTEA 1WI5A 4JBMA 3ICEA 3KOJA 4A3KH 2XGTA 3FKIG 3CCUA 2JQOA 1BVSA 3U4ZA 2QEXA 3HOWG 4JI0L 5JJKA 2Z0SA 3IRBA 1XPOA 3I4MG 2ZJRA 1HZBA 1SN8A 2EIFA 4KLKA 4AH6A 1NMFA 3PIOA 4LWCA 5AJ3L 4LFBL 3M85A 1V43A 2E2JH 1L1OB 2MO0A 4BY1G 1IBKL 3F2DA 4DR2L 1X56A 4NXMQ 4APVA 4JI4Q 1JJGA 3H0GG 1NMGA 3HOUH 5H1SE 3KJPA 3I4MH 5DLQE 4LF6Q 2NVXH 4LFCQ 2R93G 1SRUA 1ASYA 1VCIA 1A62A 2YTXA 4BY1H 1XNQL 4DUYQ 5C4JH 3TS0A 2CWPA 3TRZA 3OTOQ 4YWKA 1GKHA 4X66L 5C0XI 3K8AA 2ES2A 4BA1I 1NTGA 3H0GH 1XNRQ 5C4XG 1VQ8A 1OXVA 1WCMG 4XIGS 3PUXA 1HZ9A 2R93H 1FJGL 2JA5H 2WB1G 3CCSA 2AKWB 1RIPA 2ID0A 3F1ZA 1IYJB 3CCEA 4JBKA 2ZM6L 4QGUA 1S72A 2AMCB 2F3IA 1HR0Q 1CKNB 3H3VI 3KDFA 5IYDG 3S17H 1M90C 4LNQA 4UY8C 1GD7A 4HJ7A 2BH8A 3ULJA 4JI5Q 5BR8Q 2I5MX 3HOYG 1CKMA 4IJLA 3PUZA 1VQJA 1TWFH 2NZOA 1YITA 1FVIA 3JAMc 4LF8L 2K75A 2B63H 4BY7G 1PVOA 2Q2TA 2OWOA 1TWHH 4DV0Q 3ERSX 2V1CC 3MXNB 1OXXK 4BBRG 3CPWA 3H15A 1K8AC 2JK8A 4OONA 3S1RH 2JA7G 4DR6L 1BBUA 3K81C 4LUZA 4WJ3M 5IYDH 4NXNL 3CCMA 1EQQA 1JT8A 1GM5A 3W5OA 3RNUA 1M1KC 2NVYH 3D31A 4MTNA 4YHHQ 4IFDI 3AQQA 3CP0A 4DV2L 4DV7Q 1QUQA 5GQOA 5GAHC 4QY7A 1BBWA 4R4IA 4GLXA 4YWMA 1CSPA 4DK6C 4IPDA 4BBRH 1J6QA 5IYCH 3PV0A 3GTKH 3JAMi 1DGSA 1EUJA 2ZJQA 3B6YA 2GVBA 1B7YB 4A3CG 5C44H 1X3EA 2B29A 4HIOA 1QZHA 2E2HH 4A3DG 4UPAA 4QJFA 2Q2IA 2VW9A 1CUKA 4A93H 2Y0SE 4GNXA 1Q1BA 2VL6A 4JI0Q 2D0OA 5E7NA 4HIMA 3PUWA 2R7ZG 3KF8B 2Y0SG 4R4QA 1PHJA 3EBEA 2MQHA 4DR1L 4RMFA 1XPUA 3RN2A 2KCMA 5IYBG 4P73A 5AJ3Q 4LFBQ 1AH9A 3NELA 1X55A 2VQFL 3U4VA 4A3CH 1Z47A 1IBKQ 3AFPA 3TEHB 2NVTH 1PH6A 4DR2Q 2N3SA 1Q12A 4OXPA 3RLOA 2HQLA 5C3EG 4DV5Q 1VQIA 2K50A 5IP9G 4UP9A 3T1HL 2R7ZH 3H3VH 3I4NG 5K36G 4GLAC 3PUVA 1EOVA 1SFOH 1C9OA 1P16A 2AWNA 3CC2A 3CQZH 1NBWA 3GD7A 1YEZA 2WAQG 1S40A 1I5FA 1Z9FA 4AQYL 1E22A 3CCLA 1XNQQ 4A3JG 3E9IA 3PCOB 2GN5A 5GROA 1Q86C 4LF7L 1UE5A 3UDIA 2IY5B 1L1OA 3K0XA 1HH2P 2BA0A 4LUVA 5C3EH 3G6EA 4DV4L 2UUCL 3S14H 3FP9A 1SLJA 2LSSA 3A5ZB 3PO3H 2VNUD 3KF6B 3CMAA 1AE2A 4UP8A 2N78A 3G71A 1FJGQ 4P72A 2UUAL 2ZTCA 1U0LA 2CWAA 1YJWA 1YJ9A 4KHPL 3GTOH 4A3JH 4HIDA 1Q46A 3U50C 1KXLA 2ZM6Q 4DAMA 5M5YH 4JI7L 4A76A 1TWGH 2YYZA 1CKOA 1SROA 5IT9c 4A75A 2KCTA 2BH2A 2BA1A 1N36Q 3I56A 2UU9L 1VQNA 1KAWA 3CC7A 2VS1A 3A0JA 3PIPA 4DKAC 3FKIH 4X6AH 3UE0A 3J81j 1QVCA 1A63A 2RCNA 4JI8L 2E8GA 4IOAA 4GLVB 4OWXB 4GN3B 3HOWH 3AFQA 4DR6Q 3J80i 2ATWA 4NXNQ 2PQAA 4DPGA 1X3FA 2IHFA 1EIYB 4JYAL 2WP8J 2DGYA 1UWVA 3M4OH 5JJLA 1L0WA 4A3EG 2VZAA 2IX0A 1IBML 1VQHA 1K83H 1LYLA 4DNIA 3RZDH 2ALYB 3BZKA 3TQYA 1XTDA 2Q2UA 3PGZA 5J3BA 3A74A 4GN5A 1HJPA 2PI2E 3U58A 1SE8A 3GTJH 1L2FA 1S3OA 2HIVA 5IP7G 1N32Q 4HJ9A 1J5EL 4POGA 3HOVG 2VQEL 5M3FG 4J15A 4JI1L 2R92G 1G6PA 3NBHB 4JC0A 1VQ5A 2WB1E 3FHWA 3S15H 1GVPA 2RHSB 4TQUS 5M5WH 4BBSG 2OTJA 5M3MG 2I5HA 2K5VA 4AYBE 3UDGA 4A3EH 4A3FG 3DLLA 1EFWA 1PH4A 2ZJPA 4A3IG 3ULPA 4JCVE 4AYBG 1HNZL 1D7QA 1QVGA 3M9BA 5IP7H 4NPSA 1MJCA 3STBD 4DR1Q 4YCWA 2CFMA 3ER0A 4A3LG 1KC8C 2L15A 3TS2A 2AHOB 2VQFQ 1UE6A 5C4XH 1WCMH 2PMZE 1EIFA 3K7AH 1W2BA 5M3MH 5GAEC 1X6OA 4A3FH 4H02A 1MJEA 1T9HA 4A3IH 2OQ0A 3D0FA 1PYBA 3T1HQ 1LTLA 1PH2A 1IXRA 2JA9A 4YCUA 1YJNA 3HKSA 2JEAI 2EXDA 4OWTB 2N49A 1PH3A 3S1NH 3RLFA 3PF5A 2IX1A 1K8GA 1P8LA 1Y1WG 3HOYH 3KFUA 3EIVA 4AQYQ 1NY4A 5LMNW 3AYHB 3CXCA 4DV3L 4B3TL 4BY7H 2HT1A 2K14A 3E0EA 4R1JA 4JOIA 4OX9L 1VQDA 1TXYA 3L0OA 4LF7Q 4XTCS 1TWCH 4IPGA 2UUCQ 4DV4Q 4FDBA 4MZ9A 4IOCA 3K80C 4X62L 2KENA 1QZGA 3HOZG 3M4QA 1KRTA 2JA7H 4Y7NH 4LW1A 4AIMA 1I6HH 4RG1A 2YU9H 5IWAL 5GAGC 2K4KA 1VQAA 4YWLA 1PH1A 4KHPQ 4K0KL 1AE3A 3HKZE 1Q7YC 2JE6I 4GNXC 3T1YL 4JI3L 2R6GA 4B3ML 4JI7Q 5HY6A 3G4SA 3HKZG 1K3RA 3E9HA 3CPFA 1IZ6A 4DV6L 3GTGH 4L5QA 2H5XA 4GKJL 1E1TA 3KDFB 2UU9Q 1PH9A 3HOZH 5FLXc 1PYSB 2F52A 2KBNA 2K52A 4HIKA 3S16H 3I7FA 1HZCA 1EWIA 3NEMA 2FXQA 5JEAJ 5M5XH 4A3MG 2OTLA 4TVAB 4DR7L 4GOPA 4A3DH 4GS3A 4JV5L 4JI8Q 3S1MH 1N9WA 1E3PA 1XMOL 2B3GA 4X65L 4ME3A 2PNHA 3CCVA 1SMXA 2YTVA 3HOXG 1PH7A 2A1AA 2JEBI 5GADC 3GTLH 1W3SA 4JYAQ 4WJ4A 2WAQE 1Q1EA 1R9TH 2VUMG 1IBMQ 2IT1A 2A19A 5IYBH 3BU2A 4HJ5A 3K7UC 4A3MH 5ELOA 1IBLL 1QUQB 4QIWE 2E5LL 1B8AA 3GDEA 4X66Q 3WWVA 2JA6G 1XMQL 1HNWL 1J5EQ 4A3BG 3CF5A 1X3GA 1TWAH 4YY3L 2VQEQ 5FLMG 2MO1A 4JI1Q 1VQEA 2XTIA 5IP9H 1VQPA 1XJVA 1H95A 3I4NH 1K0RA 4O0AA 2VUMH 3PSIA 4POFA 2YTYA 1UE1A 2IHEA 2UXCL 4QQBX 2ZTDA 4DR3L 4LF9L 1YNXA 1HNZQ 1D8LA 4GNXB 1WOCA 2UXDL 2JA6H 3CCRA 1KIXA 1UEBA 1HR0W 1OXSC 2HHHL 2Z6KA 1LM0A 5FLMH 4DR4L 2NVQH 2YV5A 1E1OA 4LF8Q 1I3QH 1EYGA 4PG3A 1VQLA 3EN2A 2F4VL 2GVAA 2MNAA 3VDYA 4KHZA 2UXBL 1LUZA 2KHIA 3S2HH 2JA8G 5IE8A 3BJUA 3PO2G 4OO1G 1VQ4A 1PH8A 1KRSA 4IJHA 1I94L 4B3RL 4A4IA 1BKBA 2WFWA 1VQBA 4LF4L 2KHJA 2PI2A 1NE3A 3I55A 1MIUA 4DV3Q 2D62A 4DV2Q 1NJIC 4B3TQ 1PV4A 1CKNA 4LF5L 4A3GG 3HOUG 3UE1A 2A8VA 4OX9Q 1YIJA 3GTPH 2NN6G 2JA8H 1Q82C 5LMUL 2K5HA 4L5RC 1N33L 3PO2H 3S1QH 2CQOA 1KQSA 4B3SL 3J7ZC 1IL2A 1VQGA 4X62Q 2CKZB 5C0XJ 4DR5L 3KLWA 5JEAG 4X64L 3KYHC 1PH5A 2C35B 3S24A 4JI6L 5JJIA 3PF4A 1JE5A 1E24A 1KHIA 5IWAQ 4LFAL 3RN5A 3LGJA 4C3HH 4K0KQ 1OXTA 1Y1VG 3J7A5 4A3GH 3T1YQ 4DV1L 4DV5L 4JBWA 4JI3Q 1V1QA 4B3MQ 1YHQA 1WFQA 4DAYB 1PA6A 4DV6Q 3OW2A 2I5LX 4JG2A 5EAYA 1HZAA 1RL2A 4GKJQ 1X65A 1Q8KA 2QGQA 1MKHA 4QL5A 5LMNL 2JA5G 3M4PA 1N34L 2DUDA 1JB7A 1K73C 1QVFA 2OCEA 1U5KA 1VQCA 4P75A 3L2PA 5M3FH 2R92H 3HOVH 2HIXA 3JC66 1WYDA 1E7ZA 2EQSA 1VQ6A 3M7NA 3S2DH 4BBSH 1Y1VH 4DUZL 4DR7Q 4GKKL 4P71A 3CMEA 3CC4A 3CCJA 4JV5Q 4JI2L 3CAMA 1JJ2A 2R7FA 5IY0A 1XMOQ 4X65Q 1HNXL 2NZHA 4GN4B 3CD6A 1VQMA 1O7IA 1Y14B 2B63G 1G51A 2UUBL 5FJ8G 2LXJA 1OTCA 2PQAB 2K5NA 4A3LH 3UDFA 1OXUA 2RF4A 2AWOA 4IFDJ 4JOIC 4PMWA 3G48A 4L5TA 1CSQA 4PZ7A 3STBC 4EX5A 1N8RC 4IPHA 1IBLQ 3CW2C 5HGQA 1VQ7A 2E5LQ 4OWWB 1N36L 1HNWQ 1XMQQ 3GTQH 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 Q;  1A0I A;  2LXK A;  2ASB A;  4C2M H;  4L5S A;  4P74 A;  4HJ8 A;  3M3Y H;  5FJ8 H;  3J81 c;  1VQF A;  4C3I H;  4PZ6 A;  3GO5 A;  2VY3 A;  3HFZ B;  2UUA Q;  3RLN A;  4NXM L;  3I2Z A;  1Y1W H;  2UXC Q;  1VQK A;  5IYC G;  1YI2 A;  4DR3 Q;  4JI4 L;  4ALP A;  4LF9 Q;  3F2B A;  2QA4 A;  5C44 G;  2UXD Q;  1C7Y A;  4HJA A;  4LF6 L;  3PUY A;  1KD1 C;  4IO9 A;  2HHH Q;  1GO3 E;  4R4O A;  4LFC L;  4DR4 Q;  2I0Q A;  2R7D A;  4A93 G;  1YHB A;  3UDX A;  2F4V Q;  3ZJY C;  4DUY L;  2Q2H A;  2OQK A;  1YBY A;  2UXB Q;  5C0X G;  3OTO L;  4GOP C;  1N32 L;  1YVC A;  3RR5 A;  4MNO A;  4OO1 I;  1C0A A;  3I4O A;  4IPC A;  1I94 Q;  4B3R Q;  3KF6 A;  1XNR L;  1EQR A;  4BXX G;  3J81 i;  3F8T A;  3KJO A;  4LF4 Q;  1I50 H;  3TRE A;  4BA2 I;  3F2C A;  4O2D A;  2MFI A;  4EQ5 A;  1FL0 A;  1Q81 C;  4LF5 Q;  3SGI A;  1SR3 A;  4YCV A;  3OYY A;  3Q8D A;  4NB3 A;  1G29 1;  1HR0 L;  1N33 Q;  5LMU Q;  2NN6 I;  4UP7 A;  4LUO A;  3ULL A;  3A5U A;  2CCZ A;  4B3S Q;  1L1O C;  1WJJ A;  3W1B A;  3NEN A;  4JI5 L;  4DR5 Q;  1XPR A;  1UE7 A;  4X64 Q;  5BR8 L;  4JI6 Q;  4BXX H;  1JJC B;  1A8V A;  1PFS A;  1YHA A;  1KL9 A;  3HOX H;  3RZO H;  2D0P A;  2RHQ B;  4LFA Q;  1VQO A;  4DK3 C;  1X9N A;  4KI0 A;  4DV0 L;  1X54 A;  1K9M C;  4R4T A;  4DV1 Q;  1V9P A;  3PO3 G;  1B70 B;  3CCQ A;  3DM3 A;  4Y52 H;  4JBJ A;  3W1G A;  2N8N A;  2Z6K C;  5LMN Q;  1FGU A;  4A3K G;  4IFD G;  1VQ9 A;  4R4C A;  5ELN A;  2E2I H;  4A3B H;  4YHH L;  1N34 Q;  1VS0 A;  4DV7 L;  1JMC A;  4GKK Q;  4PZ8 A;  4DUZ Q;  1YZ6 A;  3AEV A;  4JI2 Q;  1ASZ A;  4C3J H;  1HNX Q;  2JJQ A;  3MEF A;  4GOP B;  3GTM H;  3BZC A;  3J80 c;  2UUB Q;  2ZTE A;  1WI5 A;  4JBM A;  3ICE A;  3KOJ A;  4A3K H;  2XGT A;  3FKI G;  3CCU A;  2JQO A;  1BVS A;  3U4Z A;  2QEX A;  3HOW G;  4JI0 L;  5JJK A;  2Z0S A;  3IRB A;  1XPO A;  3I4M G;  2ZJR A;  1HZB A;  1SN8 A;  2EIF A;  4KLK A;  4AH6 A;  1NMF A;  3PIO A;  4LWC A;  5AJ3 L;  4LFB L;  3M85 A;  1V43 A;  2E2J H;  1L1O B;  2MO0 A;  4BY1 G;  1IBK L;  3F2D A;  4DR2 L;  1X56 A;  4NXM Q;  4APV A;  4JI4 Q;  1JJG A;  3H0G G;  1NMG A;  3HOU H;  5H1S E;  3KJP A;  3I4M H;  5DLQ E;  4LF6 Q;  2NVX H;  4LFC Q;  2R93 G;  1SRU A;  1ASY A;  1VCI A;  1A62 A;  2YTX A;  4BY1 H;  1XNQ L;  4DUY Q;  5C4J H;  3TS0 A;  2CWP A;  3TRZ A;  3OTO Q;  4YWK A;  1GKH A;  4X66 L;  5C0X I;  3K8A A;  2ES2 A;  4BA1 I;  1NTG A;  3H0G H;  1XNR Q;  5C4X G;  1VQ8 A;  1OXV A;  1WCM G;  4XIG S;  3PUX A;  1HZ9 A;  2R93 H;  1FJG L;  2JA5 H;  2WB1 G;  3CCS A;  2AKW B;  1RIP A;  2ID0 A;  3F1Z A;  1IYJ B;  3CCE A;  4JBK A;  2ZM6 L;  4QGU A;  1S72 A;  2AMC B;  2F3I A;  1HR0 Q;  1CKN B;  3H3V I;  3KDF A;  5IYD G;  3S17 H;  1M90 C;  4LNQ A;  4UY8 C;  1GD7 A;  4HJ7 A;  2BH8 A;  3ULJ A;  4JI5 Q;  5BR8 Q;  2I5M X;  3HOY G;  1CKM A;  4IJL A;  3PUZ A;  1VQJ A;  1TWF H;  2NZO A;  1YIT A;  1FVI A;  3JAM c;  4LF8 L;  2K75 A;  2B63 H;  4BY7 G;  1PVO A;  2Q2T A;  2OWO A;  1TWH H;  4DV0 Q;  3ERS X;  2V1C C;  3MXN B;  1OXX K;  4BBR G;  3CPW A;  3H15 A;  1K8A C;  2JK8 A;  4OON A;  3S1R H;  2JA7 G;  4DR6 L;  1BBU A;  3K81 C;  4LUZ A;  4WJ3 M;  5IYD H;  4NXN L;  3CCM A;  1EQQ A;  1JT8 A;  1GM5 A;  3W5O A;  3RNU A;  1M1K C;  2NVY H;  3D31 A;  4MTN A;  4YHH Q;  4IFD I;  3AQQ A;  3CP0 A;  4DV2 L;  4DV7 Q;  1QUQ A;  5GQO A;  5GAH C;  4QY7 A;  1BBW A;  4R4I A;  4GLX A;  4YWM A;  1CSP A;  4DK6 C;  4IPD A;  4BBR H;  1J6Q A;  5IYC H;  3PV0 A;  3GTK H;  3JAM i;  1DGS A;  1EUJ A;  2ZJQ A;  3B6Y A;  2GVB A;  1B7Y B;  4A3C G;  5C44 H;  1X3E A;  2B29 A;  4HIO A;  1QZH A;  2E2H H;  4A3D G;  4UPA A;  4QJF A;  2Q2I A;  2VW9 A;  1CUK A;  4A93 H;  2Y0S E;  4GNX A;  1Q1B A;  2VL6 A;  4JI0 Q;  2D0O A;  5E7N A;  4HIM A;  3PUW A;  2R7Z G;  3KF8 B;  2Y0S G;  4R4Q A;  1PHJ A;  3EBE A;  2MQH A;  4DR1 L;  4RMF A;  1XPU A;  3RN2 A;  2KCM A;  5IYB G;  4P73 A;  5AJ3 Q;  4LFB Q;  1AH9 A;  3NEL A;  1X55 A;  2VQF L;  3U4V A;  4A3C H;  1Z47 A;  1IBK Q;  3AFP A;  3TEH B;  2NVT H;  1PH6 A;  4DR2 Q;  2N3S A;  1Q12 A;  4OXP A;  3RLO A;  2HQL A;  5C3E G;  4DV5 Q;  1VQI A;  2K50 A;  5IP9 G;  4UP9 A;  3T1H L;  2R7Z H;  3H3V H;  3I4N G;  5K36 G;  4GLA C;  3PUV A;  1EOV A;  1SFO H;  1C9O A;  1P16 A;  2AWN A;  3CC2 A;  3CQZ H;  1NBW A;  3GD7 A;  1YEZ A;  2WAQ G;  1S40 A;  1I5F A;  1Z9F A;  4AQY L;  1E22 A;  3CCL A;  1XNQ Q;  4A3J G;  3E9I A;  3PCO B;  2GN5 A;  5GRO A;  1Q86 C;  4LF7 L;  1UE5 A;  3UDI A;  2IY5 B;  1L1O A;  3K0X A;  1HH2 P;  2BA0 A;  4LUV A;  5C3E H;  3G6E A;  4DV4 L;  2UUC L;  3S14 H;  3FP9 A;  1SLJ A;  2LSS A;  3A5Z B;  3PO3 H;  2VNU D;  3KF6 B;  3CMA A;  1AE2 A;  4UP8 A;  2N78 A;  3G71 A;  1FJG Q;  4P72 A;  2UUA L;  2ZTC A;  1U0L A;  2CWA A;  1YJW A;  1YJ9 A;  4KHP L;  3GTO H;  4A3J H;  4HID A;  1Q46 A;  3U50 C;  1KXL A;  2ZM6 Q;  4DAM A;  5M5Y H;  4JI7 L;  4A76 A;  1TWG H;  2YYZ A;  1CKO A;  1SRO A;  5IT9 c;  4A75 A;  2KCT A;  2BH2 A;  2BA1 A;  1N36 Q;  3I56 A;  2UU9 L;  1VQN A;  1KAW A;  3CC7 A;  2VS1 A;  3A0J A;  3PIP A;  4DKA C;  3FKI H;  4X6A H;  3UE0 A;  3J81 j;  1QVC A;  1A63 A;  2RCN A;  4JI8 L;  2E8G A;  4IOA A;  4GLV B;  4OWX B;  4GN3 B;  3HOW H;  3AFQ A;  4DR6 Q;  3J80 i;  2ATW A;  4NXN Q;  2PQA A;  4DPG A;  1X3F A;  2IHF A;  1EIY B;  4JYA L;  2WP8 J;  2DGY A;  1UWV A;  3M4O H;  5JJL A;  1L0W A;  4A3E G;  2VZA A;  2IX0 A;  1IBM L;  1VQH A;  1K83 H;  1LYL A;  4DNI A;  3RZD H;  2ALY B;  3BZK A;  3TQY A;  1XTD A;  2Q2U A;  3PGZ A;  5J3B A;  3A74 A;  4GN5 A;  1HJP A;  2PI2 E;  3U58 A;  1SE8 A;  3GTJ H;  1L2F A;  1S3O A;  2HIV A;  5IP7 G;  1N32 Q;  4HJ9 A;  1J5E L;  4POG A;  3HOV G;  2VQE L;  5M3F G;  4J15 A;  4JI1 L;  2R92 G;  1G6P A;  3NBH B;  4JC0 A;  1VQ5 A;  2WB1 E;  3FHW A;  3S15 H;  1GVP A;  2RHS B;  4TQU S;  5M5W H;  4BBS G;  2OTJ A;  5M3M G;  2I5H A;  2K5V A;  4AYB E;  3UDG A;  4A3E H;  4A3F G;  3DLL A;  1EFW A;  1PH4 A;  2ZJP A;  4A3I G;  3ULP A;  4JCV E;  4AYB G;  1HNZ L;  1D7Q A;  1QVG A;  3M9B A;  5IP7 H;  4NPS A;  1MJC A;  3STB D;  4DR1 Q;  4YCW A;  2CFM A;  3ER0 A;  4A3L G;  1KC8 C;  2L15 A;  3TS2 A;  2AHO B;  2VQF Q;  1UE6 A;  5C4X H;  1WCM H;  2PMZ E;  1EIF A;  3K7A H;  1W2B A;  5M3M H;  5GAE C;  1X6O A;  4A3F H;  4H02 A;  1MJE A;  1T9H A;  4A3I H;  2OQ0 A;  3D0F A;  1PYB A;  3T1H Q;  1LTL A;  1PH2 A;  1IXR A;  2JA9 A;  4YCU A;  1YJN A;  3HKS A;  2JEA I;  2EXD A;  4OWT B;  2N49 A;  1PH3 A;  3S1N H;  3RLF A;  3PF5 A;  2IX1 A;  1K8G A;  1P8L A;  1Y1W G;  3HOY H;  3KFU A;  3EIV A;  4AQY Q;  1NY4 A;  5LMN W;  3AYH B;  3CXC A;  4DV3 L;  4B3T L;  4BY7 H;  2HT1 A;  2K14 A;  3E0E A;  4R1J A;  4JOI A;  4OX9 L;  1VQD A;  1TXY A;  3L0O A;  4LF7 Q;  4XTC S;  1TWC H;  4IPG A;  2UUC Q;  4DV4 Q;  4FDB A;  4MZ9 A;  4IOC A;  3K80 C;  4X62 L;  2KEN A;  1QZG A;  3HOZ G;  3M4Q A;  1KRT A;  2JA7 H;  4Y7N H;  4LW1 A;  4AIM A;  1I6H H;  4RG1 A;  2YU9 H;  5IWA L;  5GAG C;  2K4K A;  1VQA A;  4YWL A;  1PH1 A;  4KHP Q;  4K0K L;  1AE3 A;  3HKZ E;  1Q7Y C;  2JE6 I;  4GNX C;  3T1Y L;  4JI3 L;  2R6G A;  4B3M L;  4JI7 Q;  5HY6 A;  3G4S A;  3HKZ G;  1K3R A;  3E9H A;  3CPF A;  1IZ6 A;  4DV6 L;  3GTG H;  4L5Q A;  2H5X A;  4GKJ L;  1E1T A;  3KDF B;  2UU9 Q;  1PH9 A;  3HOZ H;  5FLX c;  1PYS B;  2F52 A;  2KBN A;  2K52 A;  4HIK A;  3S16 H;  3I7F A;  1HZC A;  1EWI A;  3NEM A;  2FXQ A;  5JEA J;  5M5X H;  4A3M G;  2OTL A;  4TVA B;  4DR7 L;  4GOP A;  4A3D H;  4GS3 A;  4JV5 L;  4JI8 Q;  3S1M H;  1N9W A;  1E3P A;  1XMO L;  2B3G A;  4X65 L;  4ME3 A;  2PNH A;  3CCV A;  1SMX A;  2YTV A;  3HOX G;  1PH7 A;  2A1A A;  2JEB I;  5GAD C;  3GTL H;  1W3S A;  4JYA Q;  4WJ4 A;  2WAQ E;  1Q1E A;  1R9T H;  2VUM G;  1IBM Q;  2IT1 A;  2A19 A;  5IYB H;  3BU2 A;  4HJ5 A;  3K7U C;  4A3M H;  5ELO A;  1IBL L;  1QUQ B;  4QIW E;  2E5L L;  1B8A A;  3GDE A;  4X66 Q;  3WWV A;  2JA6 G;  1XMQ L;  1HNW L;  1J5E Q;  4A3B G;  3CF5 A;  1X3G A;  1TWA H;  4YY3 L;  2VQE Q;  5FLM G;  2MO1 A;  4JI1 Q;  1VQE A;  2XTI A;  5IP9 H;  1VQP A;  1XJV A;  1H95 A;  3I4N H;  1K0R A;  4O0A A;  2VUM H;  3PSI A;  4POF A;  2YTY A;  1UE1 A;  2IHE A;  2UXC L;  4QQB X;  2ZTD A;  4DR3 L;  4LF9 L;  1YNX A;  1HNZ Q;  1D8L A;  4GNX B;  1WOC A;  2UXD L;  2JA6 H;  3CCR A;  1KIX A;  1UEB A;  1HR0 W;  1OXS C;  2HHH L;  2Z6K A;  1LM0 A;  5FLM H;  4DR4 L;  2NVQ H;  2YV5 A;  1E1O A;  4LF8 Q;  1I3Q H;  1EYG A;  4PG3 A;  1VQL A;  3EN2 A;  2F4V L;  2GVA A;  2MNA A;  3VDY A;  4KHZ A;  2UXB L;  1LUZ A;  2KHI A;  3S2H H;  2JA8 G;  5IE8 A;  3BJU A;  3PO2 G;  4OO1 G;  1VQ4 A;  1PH8 A;  1KRS A;  4IJH A;  1I94 L;  4B3R L;  4A4I A;  1BKB A;  2WFW A;  1VQB A;  4LF4 L;  2KHJ A;  2PI2 A;  1NE3 A;  3I55 A;  1MIU A;  4DV3 Q;  2D62 A;  4DV2 Q;  1NJI C;  4B3T Q;  1PV4 A;  1CKN A;  4LF5 L;  4A3G G;  3HOU G;  3UE1 A;  2A8V A;  4OX9 Q;  1YIJ A;  3GTP H;  2NN6 G;  2JA8 H;  1Q82 C;  5LMU L;  2K5H A;  4L5R C;  1N33 L;  3PO2 H;  3S1Q H;  2CQO A;  1KQS A;  4B3S L;  3J7Z C;  1IL2 A;  1VQG A;  4X62 Q;  2CKZ B;  5C0X J;  4DR5 L;  3KLW A;  5JEA G;  4X64 L;  3KYH C;  1PH5 A;  2C35 B;  3S24 A;  4JI6 L;  5JJI A;  3PF4 A;  1JE5 A;  1E24 A;  1KHI A;  5IWA Q;  4LFA L;  3RN5 A;  3LGJ A;  4C3H H;  4K0K Q;  1OXT A;  1Y1V G;  3J7A 5;  4A3G H;  3T1Y Q;  4DV1 L;  4DV5 L;  4JBW A;  4JI3 Q;  1V1Q A;  4B3M Q;  1YHQ A;  1WFQ A;  4DAY B;  1PA6 A;  4DV6 Q;  3OW2 A;  2I5L X;  4JG2 A;  5EAY A;  1HZA A;  1RL2 A;  4GKJ Q;  1X65 A;  1Q8K A;  2QGQ A;  1MKH A;  4QL5 A;  5LMN L;  2JA5 G;  3M4P A;  1N34 L;  2DUD A;  1JB7 A;  1K73 C;  1QVF A;  2OCE A;  1U5K A;  1VQC A;  4P75 A;  3L2P A;  5M3F H;  2R92 H;  3HOV H;  2HIX A;  3JC6 6;  1WYD A;  1E7Z A;  2EQS A;  1VQ6 A;  3M7N A;  3S2D H;  4BBS H;  1Y1V H;  4DUZ L;  4DR7 Q;  4GKK L;  4P71 A;  3CME A;  3CC4 A;  3CCJ A;  4JV5 Q;  4JI2 L;  3CAM A;  1JJ2 A;  2R7F A;  5IY0 A;  1XMO Q;  4X65 Q;  1HNX L;  2NZH A;  4GN4 B;  3CD6 A;  1VQM A;  1O7I A;  1Y14 B;  2B63 G;  1G51 A;  2UUB L;  5FJ8 G;  2LXJ A;  1OTC A;  2PQA B;  2K5N A;  4A3L H;  3UDF A;  1OXU A;  2RF4 A;  2AWO A;  4IFD J;  4JOI C;  4PMW A;  3G48 A;  4L5T A;  1CSQ A;  4PZ7 A;  3STB C;  4EX5 A;  1N8R C;  4IPH A;  1IBL Q;  3CW2 C;  5HGQ A;  1VQ7 A;  2E5L Q;  4OWW B;  1N36 L;  1HNW Q;  1XMQ Q;  3GTQ H;  3L7Z C; 
#chains in the Genus database with same CATH topology
 2X69 A;  4WOR A;  3J81 c;  1VQF A;  1LTR D;  5E1F A;  3GO5 A;  1S4Z A;  3RLN A;  3I2Z A;  2CW0 C;  2UXC Q;  2A6H D;  4LF9 Q;  3F2B A;  1BCP B;  3SE0 A;  1PMR A;  1C7Y A;  2B2W A;  2Z1C A;  4HJA A;  4LF6 L;  4IO9 A;  4BBR B;  1GO3 E;  1ML0 D;  3QWN A;  1T5X D;  4ID6 A;  3NE5 B;  1Y8O B;  2R7D A;  1TII D;  2Q2H A;  2UXB Q;  1YBY A;  3OTO L;  1SYG A;  4DAP A;  4OO1 I;  4MNO A;  3SK4 A;  3NXW A;  2F0M A;  2ICI A;  3F8T A;  4BWG B;  3F2C A;  5FO8 B;  1ICW A;  1Q81 C;  4LF5 Q;  1SR3 A;  2NVT B;  2J4X A;  1BO0 A;  4LUO A;  1JC7 A;  4KY5 A;  2D5D A;  5BR8 L;  4JI6 Q;  4BXX H;  1JJC B;  2WKD A;  5JPN C;  3OIP A;  2KUM A;  2R7Z B;  3RZO H;  2G5D A;  4DK3 C;  1X9N A;  4R4T A;  4DV1 Q;  1I4X A;  1B70 B;  1MD2 D;  3D4R A;  3I72 A;  1TR5 A;  4PV1 C;  2QDB A;  1VQ9 A;  2EXZ A;  5ELN A;  4A3B H;  3A55 A;  1QCB D;  3GTM B;  4DV7 L;  5HGT A;  5EQ0 A;  4DUZ Q;  2F0D A;  1PZK D;  1YZ6 A;  1A2U A;  2L1B A;  1HNX Q;  1DZ1 A;  3NBH A;  2QCP X;  2ZTE A;  1WI5 A;  3ICE A;  4RHS A;  3MXU A;  3FKI G;  5FLX L;  1SNM A;  2JQO A;  4DAY A;  2F3W A;  3M4Y A;  2IWH A;  5G3L D;  2E2J B;  5JJK A;  1QOH A;  1K8O A;  3A7L A;  3CRK C;  3FKI B;  4AH6 A;  4OO1 H;  1EWC A;  2R3Z A;  4N9T A;  4G7O C;  4LWC A;  1FR3 A;  1WTH A;  4LFB L;  1V43 A;  3W3A A;  2PQE A;  3H94 A;  4NXM Q;  4APV A;  5JVH 3;  4MN3 A;  1JJG A;  3H0G G;  3HOU H;  5CV4 A;  4EQP A;  1F2Y A;  5EGT A;  1F9S A;  3MZ5 A;  3H0G B;  3I8Z A;  4MTK A;  4DUY Q;  5FO9 B;  3K8A A;  4FXK C;  3Q6S A;  1EOT A;  2K6A A;  4HMI A;  3RD4 A;  1VQ8 A;  4I7A A;  1E2Z A;  1HZ9 A;  2WB1 G;  4EVO A;  2ID0 A;  4FNF A;  2F1M A;  4G57 A;  1HR0 Q;  1CKN B;  1X32 A;  3KDF A;  3S17 H;  1W6K A;  2ZXP A;  1GD7 A;  2WB1 B;  1HA6 A;  3HOY G;  3GP7 A;  4IJL A;  5E4W C;  5KYI A;  2AUJ D;  1TWF H;  1PVO A;  2L4N A;  5J1Z A;  3ERS X;  1WD0 A;  3HOY B;  1QE6 A;  5ELB A;  3H15 A;  1K8A C;  1GUN A;  3K58 A;  4OEL B;  1M1K C;  2NVY H;  4YHH Q;  4XT1 B;  1PLF A;  3AQQ A;  1SNC A;  1H9S B;  2J7Z A;  4YIJ A;  1QUQ A;  4RHR A;  4YWM A;  4DK6 C;  4BBR H;  1ZYR C;  2MGS A;  4G4K A;  1DGS A;  1EUJ A;  3B6Y A;  1EY5 A;  4A3C G;  2F0U A;  2B29 A;  1STB A;  3SDZ A;  2BDO A;  5CBA E;  4UPA A;  4QJF A;  3S16 B;  1JOR A;  2F0P A;  4ZUJ A;  4JI0 Q;  1Q1B A;  5KND A;  1ET9 A;  1JWS D;  5A2Q E;  1F9R A;  4P73 A;  4WJW A;  5AJ3 Q;  1BQQ T;  5EPK A;  2ZXO A;  4E6I A;  2NVT H;  3RLO A;  3SK5 A;  3D3R A;  5KYL A;  2HQL A;  2D9U A;  4DV5 Q;  2K50 A;  5IP9 G;  3T1H L;  2R7Z H;  1MSG A;  1C9O A;  1ENA A;  2LKV A;  3DM1 A;  1YEZ A;  1U4P A;  4AQY L;  4A3J G;  1CA5 A;  1LTT D;  4RWS C;  1Q3L A;  2XIW A;  4ZK9 B;  2IY5 B;  1RKN A;  4H44 C;  3K0X A;  3G6E A;  1ZXT A;  3S14 H;  4A3J B;  1SLJ A;  2LSS A;  3LX0 A;  3SXH A;  4EQN A;  4WFN 3;  2EYP A;  4UP8 A;  4ODG A;  1FJG Q;  3WDN A;  2CWA A;  1MHW C;  1YJW A;  2QF7 A;  2ZM6 Q;  4DAM A;  2FFK B;  1SRO A;  4A75 A;  2RDH A;  2BA1 A;  3J7Y W;  4HCE A;  3R8B A;  4JPB W;  1DJR D;  3FKI H;  3VR2 A;  4X6A H;  3UE0 A;  1K0S A;  2RCN A;  3M4O B;  1PFN A;  1EYD A;  3AFQ A;  4DR6 Q;  3VR6 A;  3GTP B;  4DPG A;  2H1E A;  2IHF A;  2F0N A;  1UWV A;  4A3E G;  2VZA A;  1LYL A;  4V0B A;  2ALY B;  3JAM E;  4M1U B;  1HJP A;  1L2F A;  2HIV A;  3OPO A;  4HCS A;  5IP7 G;  4A3G B;  4A3E B;  4KJO A;  1SE2 A;  2VB2 X;  1ROD A;  1VMP A;  4J1M A;  1BR9 A;  3AB9 A;  2NTS A;  2OTJ A;  3MA2 B;  2K5V A;  4C1N K;  3DLL A;  2M9V A;  1I4H A;  2ZJP A;  5ELC A;  2OEO A;  1D7Q A;  1QVG A;  1AN8 A;  1SYF A;  3S2D B;  1H9S A;  3STB D;  4DR1 Q;  4YCW A;  3ER0 A;  2DJG C;  1EU3 A;  4K14 A;  3MTS A;  3KUP A;  2LY7 A;  1EIF A;  4ME5 A;  1PTO F;  1SND A;  1FNU A;  2B2T A;  1IYU A;  1D6E C;  3D0F A;  1ENF A;  1B53 A;  5I6Y A;  1MSH A;  1PH2 A;  2JEA I;  2EXD A;  2N49 A;  1SMY C;  3RLF A;  1SYB A;  1P8L A;  3OMC A;  1NNX A;  3HOY H;  5LMN W;  1EU4 A;  4R1J A;  4JOI A;  2E75 C;  3L0O A;  4IPG A;  1SE4 A;  2KED A;  1KRT A;  2ICE C;  4RG1 A;  5HUR A;  5IWA L;  5DNF A;  1PH1 A;  2F0J A;  4K5W A;  4KHP Q;  1JIC A;  2DNC A;  3T1Y L;  1EY9 A;  5HY6 A;  4C1N I;  4DV6 L;  4X3K A;  3MEH A;  5BN4 A;  3HOZ H;  5FLX c;  1PYS B;  3S1M B;  3S16 H;  3I7F A;  3NBI A;  1B3A A;  1EWI A;  1NR2 A;  1LTA D;  1V1P B;  5JEA J;  4A3M G;  2IPK D;  1DXM A;  3VR4 A;  4CDD C;  2PNH A;  4DA2 A;  1PH7 A;  5EJW A;  2JEB I;  5GAD C;  3GTL H;  1W3S A;  4L8J A;  2WAQ E;  1Q1E A;  2VUM G;  3ONA B;  4N8X 1;  1NCV A;  1QB5 D;  4CJ1 B;  3G7L A;  3HP3 A;  2Q8I B;  1O7L A;  3GDE A;  2KJX A;  2VUM B;  2JA6 G;  2VQE Q;  1VQE A;  5IP9 H;  1VQP A;  5COR A;  1K0R A;  4O0A A;  3NWT A;  4FP5 D;  2JA6 B;  1PDQ A;  1CK1 A;  4DR3 L;  1YNJ D;  2K7V A;  5IIF A;  4Q5V A;  3U9O A;  1EY6 A;  1JQY D;  1WTQ A;  1LM0 A;  5FLM H;  4DR4 L;  2NVQ H;  2JP1 A;  1DON A;  4PG3 A;  1VQL A;  2GVA A;  2MNA A;  3VDY A;  1ET6 A;  4A3K B;  5ISR A;  2DY8 A;  5LL6 S;  2JA8 G;  1B1Z A;  1EY8 A;  5CV6 A;  1IHZ A;  4RGN A;  1SNO A;  1KRS A;  1NUC A;  2PW7 A;  3EQL C;  3NK9 A;  2HCI A;  4OL7 A;  1MIU A;  1TS3 A;  3VR3 A;  2D62 A;  2F0H A;  1NJI C;  3V96 A;  1D5X C;  2A73 B;  1YIJ A;  1I4R A;  2NN6 G;  5EKI A;  3GTP H;  2OT2 A;  4F7X A;  1N33 L;  2K5H A;  5T1G A;  4B3S L;  2B2V C;  1IL2 A;  1VQG A;  2CKZ B;  5C0X J;  3KLW A;  5JEA G;  3KYH C;  1PH5 A;  2C35 B;  5JJI A;  1KLU D;  4LFA L;  1O78 A;  1WVL A;  4K0K Q;  1ZEQ X;  5I2X A;  1BCP C;  1OXT A;  4A3G H;  4DV5 L;  1V1Q A;  5C4J B;  4M8A A;  4RKL A;  5EAY A;  2QGQ A;  1TY2 A;  3M4P A;  4KV6 A;  3WOF A;  1N34 L;  1IW7 C;  4KD4 A;  2OCE A;  1K73 C;  1VQC A;  4QCL A;  3I73 A;  4QB4 A;  3JC6 6;  1VQ6 A;  3M7N A;  4FYD A;  3S2D H;  1CZG A;  3CME A;  1GOZ A;  4JI2 L;  5IY0 A;  4H7B A;  4X65 Q;  1XMO Q;  4GN4 B;  3IKJ A;  1BOS A;  3K57 A;  3HG9 A;  1DD2 A;  2A68 D;  5I6W A;  1TS2 A;  1OTC A;  2PQA B;  3TSS A;  2RF4 A;  4R8I A;  4NDX A;  1ILP A;  5IGC A;  2QIL A;  4L5T A;  1CSQ A;  4IPH A;  3CW2 C;  1VQ7 A;  4OWW B;  1XMQ Q;  4YY3 Q;  1EEF D;  1W6J A;  1A0I A;  3S1R B;  1V1P A;  4L5S A;  1HXY D;  3M3Y H;  5FJ8 H;  1GUT A;  4B9W A;  2VY3 A;  2UUA Q;  1SAP A;  4L6T B;  5C3W A;  5IYC G;  1EZ6 A;  4JI4 L;  4ALP A;  2XSC A;  4DK1 A;  5L37 A;  2UXD Q;  4Q0F A;  4R4O A;  4R8N A;  4LFC L;  2I0Q A;  4A93 G;  1YHB A;  2F4V Q;  1K3B C;  5C0X G;  2E2H B;  5JOB A;  3SVM A;  1SDF A;  1C0A A;  2EYM A;  1JWU D;  3I4O A;  1KAA A;  4A93 B;  1LT3 D;  1JOO A;  4BXX G;  1I50 H;  3NUC A;  1XWE A;  4O2D A;  2MFI A;  4EQ5 A;  3X3M A;  1FL0 A;  3SGI A;  1JCK B;  3OYY A;  1RTO A;  4Z9C B;  1G29 1;  3HZX A;  3RZO B;  2NN6 I;  3ULL A;  1EQT A;  3MFY A;  3W1B A;  3NEN A;  4JI5 L;  4DR5 Q;  1XPR A;  4X64 Q;  1A8V A;  1KL9 A;  1S5F D;  3VA7 A;  1D5M C;  2D0P A;  2RHQ B;  3SEB A;  3I3C A;  4IN3 A;  4KI0 A;  1K9M C;  4RH6 A;  1EZ8 A;  1D2B A;  5KRU A;  4RCN A;  2IL8 A;  3MWY W;  3W1G A;  2N8N A;  5LMN Q;  1FGU A;  1PRT C;  4R4C A;  1JOK A;  5EPJ A;  1LO5 D;  2I07 B;  3AEV A;  2BOS A;  3C46 A;  3GTO B;  3MEF A;  1F9P A;  2UUB Q;  4JBM A;  3EFX D;  4A3K H;  2BDN A;  2XGT A;  5FO7 B;  1BVS A;  1EEI D;  1FNV A;  3U4Z A;  4K8J A;  5A35 A;  2L11 A;  3VYS A;  5CMD A;  2EIF A;  4HTH A;  1QNK A;  3PIO A;  1VMC A;  3M85 A;  1L1O B;  1GUO A;  1IBK L;  4DFA A;  2KCN A;  4DR2 L;  1S5D D;  5I4D A;  4CJ2 C;  4FF4 A;  4WRD A;  2NN6 H;  2O5I C;  2NVX H;  1EYC A;  1SRU A;  1ASY A;  1VCI A;  5JEA H;  1A62 A;  2B8G A;  4KD3 A;  5C4J H;  3TS0 A;  4X3S A;  3TRZ A;  1GKH A;  5C0X I;  2B2T C;  4BA1 I;  1NTG A;  2H4O A;  2P5Z X;  1XNR Q;  3BVG A;  2F0I A;  1Y8N B;  3EJI A;  1RHP A;  1WCM G;  1I6V C;  4HAE A;  1IYJ B;  3CCE A;  1VF5 C;  4QGU A;  3GV3 A;  1S72 A;  1WCM B;  4LNQ A;  2K5D A;  1JWM D;  3BDC A;  2QKI C;  4AYB B;  1II3 A;  4FF2 A;  2NZO A;  1YIT A;  3JAM c;  2K75 A;  3FEW X;  4DV0 Q;  3S1N B;  3MXN B;  2NVY B;  4BBR G;  3CPW A;  1M4V A;  2JK8 A;  3S1R H;  1F9Q A;  3ND8 A;  4LUZ A;  4B9X A;  4NXN L;  4WJ3 M;  3W5O A;  5IOC A;  3RNU A;  3D31 A;  2O4X A;  2A69 C;  5IGB A;  2GA4 B;  5IOD A;  5GQO A;  1HTL D;  1BBW A;  1EYA A;  2IX3 A;  5IYC H;  2NWG A;  3C2P A;  3L3O C;  3T51 B;  2A6H C;  2E2H H;  1JE4 A;  3R3O A;  4A93 H;  1PZI D;  5E7N A;  5C0X H;  3PUW A;  2R7Z G;  4R4Q A;  2B2U C;  2PZU A;  2MQH A;  2HCC A;  3EBE A;  5IYB G;  4IUQ A;  1BCP F;  4IUU A;  1AH9 A;  3AFP A;  1STY A;  3TEH B;  4TSS A;  3MAQ A;  3AU7 A;  2EYF A;  1BUV T;  3O13 A;  2CHB D;  3I90 A;  4TRD A;  3H09 A;  5IT9 E;  1PTO D;  1NBW A;  4HSP A;  3LWU A;  1WTV A;  1S40 A;  1Z9F A;  1XNQ Q;  3CCL A;  3S14 B;  3E9I A;  2GN5 A;  3R93 A;  1L1O A;  4DV4 L;  1HH2 P;  2BA0 A;  3DWP A;  3FP9 A;  3KF6 B;  3DWQ A;  2UUA L;  1U0L A;  3W2D A;  3OIQ A;  1YJ9 A;  4KHV A;  4XDX A;  3GTO H;  4HID A;  3U50 C;  1ILQ A;  3VA5 A;  1CKO A;  2BH2 A;  2V4D A;  3I56 A;  2UU9 L;  1STA A;  1KAW A;  3CC7 A;  3A8J E;  5KIX A;  4LJZ C;  2VS1 A;  2JN4 A;  2EDG A;  4XT3 B;  2VB3 X;  4RCO A;  1QVC A;  4KKS A;  4JI8 L;  1WTX A;  4OWX B;  3KLS X;  2DNE A;  2ATW A;  1EIY B;  2XVS A;  3PO2 B;  3S1Q B;  2DGY A;  3Q24 A;  1IBM L;  1EIG A;  2IX0 A;  1S5B D;  1VQH A;  2Z4H A;  3BZK A;  3TQY A;  4EGV A;  1PRT B;  1AZQ A;  4NP5 A;  2PI2 E;  1B4O A;  1SBB B;  3GTJ H;  1N32 Q;  4HJ9 A;  1F2L A;  2TMP A;  1LLR D;  2B2V A;  3HOV G;  5M3F G;  4JI1 L;  4EQO A;  2X6L A;  3MXN A;  2WB1 E;  2I5H A;  5NUC A;  3HOV B;  5M3F B;  3ULP A;  4JCV E;  5ELD A;  2MHV A;  3M9B A;  2CFM A;  2RQX A;  2L15 A;  2AHO B;  2VQF Q;  1UE6 A;  1WCM H;  1I4G A;  2PMZ E;  1FGB D;  3K7A H;  5M3M H;  5GAE C;  4ZAI A;  1MJE A;  4A3I H;  4KN4 C;  2RDG A;  1QWY A;  1FD7 D;  1IXR A;  1YJN A;  1J8I A;  3S1N H;  2PMZ B;  1K8G A;  3D4D A;  1Y1W G;  2EYL A;  3EIV A;  4TKO B;  3AYH B;  3QOL A;  4DV3 L;  4B3T L;  4QUF A;  1B9M A;  1VQD A;  5CC4 A;  2EVB A;  4LF7 Q;  2TSS A;  2UUC Q;  1Y1W B;  4MZ9 A;  4DXG A;  3K80 C;  4IUT A;  4X62 L;  3HOZ G;  3M4Q A;  4AIM A;  1O7Z A;  1TKW B;  3IL8 A;  5GAG C;  1VQA A;  4YWL A;  1Q7Y C;  4I65 A;  2F03 A;  1NAP A;  3HOZ B;  4JI3 L;  4JI7 Q;  1G91 A;  3G4S A;  3E9H A;  3T13 A;  1IZ6 A;  4PMC A;  4GKJ L;  1E1T A;  4KJN A;  3DXJ C;  2KVM A;  1HZC A;  3NPP A;  3NEM A;  3OOC A;  1XYI A;  1HCZ A;  3GTL B;  3S9W A;  4DR7 L;  1N9W A;  4N9P A;  1HRJ A;  4ME3 A;  4IUP A;  3NSW A;  3HOX G;  2A1A A;  4JYA Q;  4JVZ A;  1R9T H;  2BE5 D;  4G7H C;  1GUS A;  5IYB H;  3BU2 A;  1WTR A;  4H13 C;  4HJ5 A;  2N55 A;  3K7U C;  3HOX B;  1IBL L;  1C48 A;  4ZCK A;  2PNR C;  3WWV A;  1FYC A;  3C1F A;  1ENC A;  1HNW L;  1J5E Q;  1GUW A;  1EQV A;  3DHQ A;  3NQT A;  5FLM G;  2MP1 A;  1SYE A;  4C3J G;  2UXC L;  2IHE A;  3DUZ A;  4K2L A;  4RKB A;  2ZTD A;  4LF9 L;  1YNN D;  1HNZ Q;  2NVQ B;  1B44 D;  4RFB A;  2RBM A;  4GNX B;  1Q90 A;  5LL6 X;  1FNW A;  1KIX A;  1SYC A;  1UEB A;  4C3J B;  1LV9 A;  1BDO A;  4LF8 Q;  1ICF B;  2UXB L;  5EBD A;  4ZQ3 A;  3S2H H;  5IE8 A;  2KHS A;  1VQ4 A;  4A4I A;  1BKB A;  2PI2 A;  1NE3 A;  2FJ2 A;  3I55 A;  4KMU C;  1CQV A;  4A3G G;  1CKN A;  4LF5 L;  3UE1 A;  4OX9 Q;  2CH4 W;  1CHP D;  3PO2 H;  1E0B A;  3S1Q H;  2CQO A;  4FF1 A;  1Z6H A;  4CKC A;  3N6R A;  4JI6 L;  3S24 A;  3QB3 A;  2EOT A;  3LGJ A;  3MXG A;  5JVG 3;  3I4L A;  4OGQ C;  1O80 A;  3R2I A;  4DV1 L;  2B39 A;  4B3M Q;  1YHQ A;  3T56 B;  1PA6 A;  1EIH A;  1C4Q A;  4JG2 A;  3MHB A;  5A2Q L;  2WKC A;  4QL5 A;  2JA5 G;  2F0G A;  1MKH A;  3V2T A;  4NKL A;  2C5C A;  2DUD A;  3HOV H;  5M3F H;  1U5K A;  3L2P A;  4ZYS A;  2NYZ D;  1U4R A;  1HFN A;  3SK6 A;  4UDU C;  4DUZ L;  2JA5 B;  3CC4 A;  4JV5 Q;  2RDF A;  4F88 A;  2R7F A;  1JJ2 A;  1HNX L;  1O7I A;  3Q22 A;  5E3F A;  2B63 G;  1G51 A;  3P7J A;  1HA5 A;  4CBV A;  5FJ8 G;  1U9R A;  1OXU A;  3CRL C;  2B63 B;  3G48 A;  3STB C;  2E5L Q;  3M3Y B;  3R2T A;  1TWH B;  3GTQ H;  4ZKB B;  4F8M A;  2LXK A;  2ASB A;  4HJ8 A;  2L0C A;  1TU2 B;  5D3I B;  3BG3 A;  1SXT A;  4NXM L;  1Y1W H;  3DEP A;  1SEB D;  1IKL A;  2HHH Q;  1WTW A;  3C1E A;  3UDX A;  3ZJY C;  4DUY L;  2OQK A;  2PZT A;  1I50 B;  1N32 L;  1YVC A;  2A74 C;  5BN5 A;  3PMF A;  4IPC A;  1I94 Q;  4B3R Q;  3J81 i;  4LF4 Q;  4BA2 I;  1F2Z A;  2RSO A;  1DOL A;  4PMB A;  1K8M A;  3JAM L;  3Q8D A;  3MC0 B;  4NB3 A;  1HR0 L;  5LMU Q;  4UP7 A;  5EKK A;  1L1O C;  5IGF A;  2B2U A;  1YHA A;  3HOX H;  1VQO A;  1SFO B;  5I2Y A;  3D6C A;  1X54 A;  1V9P A;  3PO3 G;  4XQQ A;  3CCQ A;  1PFB A;  4Y52 H;  2XN9 C;  1VDZ A;  2Z6K C;  4A3K G;  4YHH L;  3PO3 B;  3H91 A;  2EYO A;  3PIP 3;  1S5C D;  3EA6 A;  1JMC A;  1STH A;  1TY0 A;  3NTI A;  4GKK Q;  4C3J H;  4GOP B;  3BS1 A;  3BZC A;  1HUM A;  5M5Y B;  3ERO A;  3J7A F;  1TWG B;  3KOJ A;  3A7A B;  3CCU A;  1YNJ C;  1ESR A;  1JR0 D;  2QEX A;  1DM0 B;  4JI0 L;  2Z0S A;  3IRB A;  1XPO A;  3BVM A;  1SN8 A;  4JK1 C;  2EJF C;  1NMF A;  5CV5 A;  5IGG A;  4CDF C;  5AJ3 L;  1A15 A;  1UNS A;  1OO9 B;  4K6D A;  2JYO A;  2EYH A;  3F2D A;  1X56 A;  2NVX B;  3C3L A;  1EY4 A;  2WAC A;  1NMG A;  1S5E D;  3I4M H;  1LTB D;  5CYU A;  1WD1 A;  5DLQ E;  3E5S A;  4LF6 Q;  1DYQ A;  2DJF C;  5FKA C;  4BY1 H;  2CWP A;  3S15 B;  3OTO Q;  5M5W B;  5CR3 A;  2ES2 A;  2RA4 A;  1PTO H;  2A6E D;  2B2Y C;  5C4X G;  1G2T A;  1OXV A;  3SR1 A;  3K59 A;  3PUX A;  2R93 H;  1DOK A;  1FJG L;  2JA5 H;  1MGS A;  2L9H A;  3CCS A;  2AKW B;  2NB0 A;  4ILW A;  1LT6 D;  3F1Z A;  5EKL A;  5C4X B;  3OHX C;  4LK1 C;  5J22 A;  2ZM6 L;  2AMC B;  3TP6 A;  3H3V I;  4P2C B;  4UY8 C;  4HJ7 A;  3ULJ A;  5BR8 Q;  2KEC A;  4LF8 L;  1FVI A;  2B63 H;  5E4X A;  4KKU A;  3SK8 A;  4CKB A;  2Q2T A;  2OWO A;  1TWH H;  4K2K A;  1G2S A;  1OXX K;  3FVQ A;  4FF3 A;  1EY0 A;  4RGO S;  3FPP A;  3TDQ A;  2A68 C;  2JA7 G;  3OWF A;  4DR6 L;  1HPC A;  1BBU A;  5IYD H;  3IFT A;  1TWC B;  4IUR A;  4MTN A;  1IKM A;  3CP0 A;  4RGM A;  2JA7 B;  4DV7 Q;  4QY7 A;  2YU9 B;  4GLX A;  4O1N A;  1J6Q A;  1WTO A;  1SJE D;  3PV0 A;  2F3V A;  2ZJQ A;  2GVB A;  2EJM A;  1X3E A;  1RTN A;  1BBX C;  1DOM A;  4A3D G;  1E2W A;  2Q2I A;  1CUK A;  1F2M A;  4G7Z C;  4DR1 L;  3D6W A;  4RMF A;  3I91 A;  4A3D B;  2KCM A;  4LFB Q;  1X55 A;  3U4V A;  3J80 E;  5DAU A;  1Z47 A;  1E2V A;  3OW7 A;  1U4M A;  1PH6 A;  1H9M A;  3G6J B;  2FMM A;  2M00 A;  2I46 A;  5CV8 A;  1VQI A;  2XNA C;  3H3V H;  1XX8 A;  3PUV A;  1SFO H;  2XWB B;  2AWN A;  3CC2 A;  3CQZ H;  3ZYY X;  1TWA B;  3HEJ A;  1I5F A;  1E22 A;  2EYJ A;  5GRO A;  4DU9 A;  2IW3 A;  1TT2 A;  2K5Q A;  1Q86 C;  3UDI A;  3KLR A;  1C8C A;  4LUV A;  5AFW A;  5C3E H;  3J7A V;  4K5V A;  3PO3 H;  4R9W A;  2OXP A;  2VNU D;  5K36 H;  3CMA A;  4DXF A;  3G71 A;  4P72 A;  2EY6 A;  4QIW B;  4KHP L;  2F0L A;  4CKE A;  4KY6 A;  1CM9 A;  2LFN A;  1I3Q B;  5M5Y H;  1STG A;  4F87 A;  1BF4 A;  1TWG H;  1N36 Q;  5DM6 3;  2F0E A;  3HGB A;  4DKA C;  1V1O A;  4O42 A;  2AUK A;  4IOA A;  3J80 i;  5J39 A;  2PQA A;  5CBE E;  2WP8 J;  3KK7 A;  1AFP A;  3GTJ B;  4PNY A;  1L0W A;  4FXD A;  1K83 H;  4DNI A;  3FRP B;  1XTD A;  2Q2U A;  3PGZ A;  3K5N A;  3A74 A;  3U58 A;  1SE8 A;  4POG A;  1GUG A;  1TS5 A;  2HUG A;  4J15 A;  2VQE L;  1G6P A;  3NBH B;  3MVV A;  3S15 H;  2AQ1 B;  2RHS B;  4TQU S;  5M5W H;  1X3P A;  3BZD B;  5M3M G;  4AYB E;  2F0O A;  1ZKO A;  1EFW A;  1PH4 A;  3QJY A;  4A3I G;  4HR7 B;  4AYB G;  3K7A B;  5M3M B;  4A3L G;  3K6O A;  3ERQ A;  2X6G A;  4A3I B;  5ELF A;  5C4X H;  1AZP A;  1NSN S;  1W2B A;  3Q0A A;  1JOQ A;  4A3F H;  2NZ1 D;  1CHQ D;  2K1B A;  2K28 A;  1CI3 M;  2CW0 D;  3T1H Q;  2JA9 A;  4YCU A;  3HKS A;  1I4Q A;  5FLX E;  3TP5 A;  2IX1 A;  4DF7 A;  4ABN A;  5KNB A;  3KFU A;  4AQY Q;  3CXC A;  3ND9 A;  2K14 A;  4XTC S;  1TWC H;  4FDB A;  3T4A C;  2F4I A;  2JA7 H;  2MJ8 A;  4Y7N H;  1HHV A;  1QIL A;  3FDT A;  2YU9 H;  4K0K L;  3LWE A;  2AQ2 B;  1AE3 A;  1A3T A;  5CGK A;  2JE6 I;  4NW2 A;  3K5L A;  4GNX C;  1PYW D;  2R6G A;  3CPF A;  2F0Q A;  3KDF B;  2FIN B;  1PH9 A;  2F52 A;  3QG1 A;  1GJX A;  4HIK A;  2K52 A;  3EVQ A;  3KLS A;  2FXQ A;  5M5X H;  1D1I A;  4XXE A;  1R9T B;  4A3D H;  3QIA A;  3FMC A;  1E3P A;  1XMO L;  4X65 L;  1IYV A;  1Y8P B;  5I9P A;  3TZD A;  3CCV A;  3CHB D;  3QOJ A;  2EZV A;  4WJ4 A;  3HS0 C;  4ULL A;  5C5L A;  1EWH A;  3TP8 A;  4XQN A;  3VYU A;  2CQA A;  5FK9 C;  5ELO A;  1QUQ B;  4X66 Q;  2G9H D;  1XMQ L;  1X3G A;  1TWA H;  4YY3 L;  2MO1 A;  4UAI A;  2XTI A;  3KBX A;  1XJV A;  1H95 A;  3QR8 A;  2Z8L A;  2HDL A;  3PSI A;  4DN4 M;  2L12 A;  2LS0 1;  4DNR B;  1GHJ A;  4POF A;  2E2I B;  2SNS A;  1KNA A;  2YTY A;  1UE1 A;  4QQB X;  4LAA A;  3K5M A;  1YNX A;  1PTO C;  4JW0 A;  2J0T D;  5JPM C;  1WOC A;  2UXD L;  3CCR A;  3S2H B;  2Z6K A;  1HUN A;  2EE1 A;  2KQ3 A;  1E1O A;  1I3Q H;  2F4V L;  3EN2 A;  1KDC A;  2Q8R E;  1LUZ A;  1HTP A;  3PO2 G;  1PH8 A;  5C4Z A;  4IJH A;  2DN8 A;  2WFW A;  1VQB A;  3VYT A;  4DV2 Q;  4KN7 C;  5TSS A;  3ITP A;  2A8V A;  1Q82 C;  4L5R C;  1KQS A;  3J7Z C;  4IUV A;  5LHY 1;  4DR5 L;  4X64 L;  2FMC A;  2NBF A;  3PF4 A;  4RA8 A;  1JE5 A;  1E24 A;  3BDL A;  3P1H A;  5IWA Q;  1UUP A;  3RN5 A;  3L9A X;  2NUC A;  1SJH D;  3T1Y Q;  4JBW A;  2CH4 A;  1WFQ A;  1K28 A;  4DV6 Q;  3OW2 A;  1HZA A;  1PZJ D;  2KOL A;  1X65 A;  5LMN L;  3VYR A;  2SDF A;  4FVM A;  1JB7 A;  1QVF A;  4HMJ A;  1E7Z A;  2E74 C;  2EQS A;  5D14 A;  1Y1V H;  3BDO A;  1LTG D;  3CCJ A;  5EBC A;  3CD6 A;  2NZH A;  2Z9H A;  5T1I A;  5KGU A;  1VQM A;  1PRT F;  3GQB A;  2B2Y A;  2K5W A;  2UUB L;  5IT9 L;  1ESF A;  3TBI B;  1XXG A;  1SSO A;  1MBY A;  1VF7 A;  2K5N A;  3NP8 A;  4CHT B;  4A3L H;  3UDF A;  1L0X B;  3GTQ B;  2AWO A;  4IFD J;  4EX5 A;  1A63 A;  4XQJ A;  1AEX A;  1N36 L;  4HN7 A;  3H3V C;  2O2L D;  4GZY C;  4C2M H;  4P74 A;  4LMQ D;  1ZYR D;  4K8I A;  4C3I H;  4PZ6 A;  1SYD A;  3HFZ B;  1G8Z D;  5KNC A;  1VQK A;  4V19 0;  1YI2 A;  4DR3 Q;  5C5M A;  1H9R A;  2QA4 A;  2RSN A;  4IZ8 A;  2Q8T A;  5C44 G;  1B3Q A;  5IGE A;  3PUY A;  1KD1 C;  1A6X A;  4K6L A;  1SNP A;  4KY7 A;  4DR4 Q;  3GTK B;  3OMG A;  3N52 A;  5C44 B;  3A8I E;  4GOP C;  2C9O A;  2QW7 A;  3RR5 A;  1RD9 D;  1TQO A;  3KF6 A;  1XNR L;  1EQR A;  3D4W A;  1LTI D;  3KJO A;  3TRE A;  2HDM A;  1EY7 A;  1T5E A;  1R4Q B;  3CU7 A;  4KK7 A;  3IAY A;  2SEB D;  4YCV A;  3F2U A;  1N33 Q;  3A5U A;  4MHE A;  2K03 A;  2CCZ A;  4B3S Q;  1WJJ A;  2E76 C;  1UE7 A;  1PFS A;  1KNE A;  4LFA Q;  2A5H A;  3OSO A;  4DV0 L;  1CZW A;  1B2T A;  1F77 A;  2ENB A;  1U4L A;  3OWE B;  3DM3 A;  2BE5 C;  4JBJ A;  4CJ0 B;  2F0W A;  4IFD G;  2E2I H;  2SNM A;  1N34 Q;  1VS0 A;  4PZ8 A;  4J8Q A;  3URY A;  4JI2 Q;  1ASZ A;  5FOB B;  3RUZ A;  4CDC C;  2JJQ A;  1UAP A;  3GTM H;  3J80 c;  2XRS D;  1TS4 A;  3AMU A;  1YNN C;  3RMH A;  3HOW G;  2L55 A;  1KDA A;  3I4M G;  2ZJR A;  1HZB A;  3MFG A;  3P75 A;  4KLK A;  2BCO A;  4CGY B;  3HOW B;  2E2J H;  2MO0 A;  4BY1 G;  3I4M B;  4UHV A;  2Z4I A;  3QO2 A;  1AP0 A;  4CDE C;  3T16 A;  4JI4 Q;  3RZD B;  5C3X A;  5H1S E;  3KJP A;  4BY1 B;  2KA7 A;  1DCZ A;  3NTH A;  4LFC Q;  2R93 G;  4QF4 A;  1PTO B;  1STE A;  5D65 A;  3BYT B;  1I4P A;  2YTX A;  1XNQ L;  3J81 E;  2QDL A;  4YWK A;  4X66 L;  2R93 B;  1GHK A;  3X3N A;  2M2L A;  3H0G H;  1XTC D;  5I9O A;  4XIG S;  2PO4 A;  4N8F A;  5DM7 3;  5KEE A;  4DAV A;  1ONL A;  4BS9 A;  1RIP A;  4XYO A;  1SMY D;  1BXT A;  4JBK A;  1EL0 A;  1G6Z A;  2F3I A;  5IYD G;  1M90 C;  3KBG A;  2BH8 A;  4JI5 Q;  2I5M X;  1CKM A;  1HQR D;  3PUZ A;  1VQJ A;  1H9J A;  4BY7 G;  2OF1 A;  4C56 C;  5CV7 A;  2G9D A;  2V1C C;  5F2D A;  3BVZ A;  2D2C C;  1CTM A;  4OON A;  4BY7 B;  2B2W C;  3K81 C;  1JT8 A;  4QMG A;  3CCM A;  1EQQ A;  3K0Y A;  1RJT A;  1IL8 A;  1WTP A;  1GM5 A;  1L0Y B;  1RCV D;  5IGD A;  4IFD I;  2EY1 A;  1R4P B;  3NWS A;  4DV2 L;  1D1K A;  1I6H B;  5GAH C;  1CQF A;  4R4I A;  2ZT9 C;  1CSP A;  4IPD A;  1SE3 A;  1BNZ A;  2AQ3 B;  3GTK H;  3TZU A;  3JAM i;  4ZKC B;  2RKS A;  1Y69 U;  3A56 A;  1B7Y B;  5C44 H;  3GTG B;  5G3L F;  4HIO A;  1QZH A;  2KCC A;  1A3U A;  3E6Z X;  2VW9 A;  1JB3 A;  2Y0S E;  4GNX A;  2VL6 A;  2D0O A;  2QEJ C;  3K5O A;  4HIM A;  3KF8 B;  2Y0S G;  1PHJ A;  1XPU A;  2F0S A;  3RN2 A;  4U68 A;  3NEL A;  2VQF L;  4A3C H;  1IBK Q;  3DEO A;  1MI2 A;  5COY A;  4DR2 Q;  2Y0S B;  2N3S A;  1Q12 A;  4OXP A;  4XYQ A;  3CQZ B;  5C3E G;  2ZXR A;  5D3D A;  4UP9 A;  4A3M B;  5DEH A;  2F0T A;  3V05 A;  4GLA C;  3I4N G;  1EOV A;  5K36 G;  1P16 A;  3E0J A;  3GD7 A;  4DNT B;  2WAQ G;  5C3E B;  3J81 L;  2K32 A;  3PCO B;  3I4N B;  4FXG C;  3A8K E;  2HD3 A;  1QNU A;  4LF7 L;  1UE5 A;  2WAQ B;  2UUC L;  1QJO A;  1CA6 A;  3A5Z B;  3LNN A;  4OEM B;  1AE2 A;  2N78 A;  5K5P A;  4IFD H;  2ZTC A;  2HQE A;  3TN2 A;  4ZUI A;  4A3J H;  1KXL A;  1Q46 A;  1AW7 A;  4HSV A;  2VXW A;  4B08 A;  3P20 A;  4JI7 L;  4A76 A;  2YYZ A;  5IT9 c;  1Q8I A;  2KCT A;  2DY7 A;  4X3U A;  1KLG D;  1VQN A;  4H0L C;  3U9S A;  2WIN B;  1SNQ A;  1RF2 D;  3A0J A;  3PIP A;  3IFD A;  3J81 j;  2E8G A;  1BCP D;  4GLV B;  4GN3 B;  2WII B;  1K83 B;  3HOW H;  2L5T A;  4NXN Q;  2JA8 B;  1X3F A;  4JYA L;  4C3H G;  1CFM A;  4NMZ A;  2JSO A;  2F0F A;  1D5Z C;  3M4O H;  5JJL A;  1KAB A;  2KEE A;  3RZD H;  3FPU B;  5J3B A;  4DK0 A;  3E3X A;  1IW7 D;  4GN5 A;  4C3H B;  1B9N A;  1S3O A;  2K01 A;  1J5E L;  4OIJ A;  5EPL A;  3BYY B;  2R92 G;  2PYK A;  4JC0 A;  1VQ5 A;  3FHW A;  4BBS G;  2CVR A;  1GVP A;  2R61 A;  2MPM A;  3UDG A;  4A3E H;  4A3F G;  3I70 A;  3VR5 A;  1LT5 D;  2R92 B;  1HNZ L;  1UEA B;  2JXM B;  2K33 A;  3HRZ C;  5C6A A;  4BBS B;  5IP7 H;  4NPS A;  4J6H A;  1MJC A;  1A2T A;  4A3F B;  1KC8 C;  1CT1 D;  3TS2 A;  3TP7 A;  5CV9 A;  2A6E C;  2WV6 D;  1X6O A;  4H02 A;  1T9H A;  3Q23 A;  2PZW A;  2OQ0 A;  2XRQ D;  1PYB A;  1A3V A;  1LTL A;  2XWJ B;  1TVX A;  4RAU C;  4OWT B;  5ELE A;  1PH3 A;  3PF5 A;  2EJG C;  1NY4 A;  4BY7 H;  3KF8 A;  2HT1 A;  4Y7N B;  3E0E A;  4OX9 L;  3DMU A;  1TXY A;  1NR4 A;  4QUC A;  4DV4 Q;  4IOC A;  2KEN A;  1QZG A;  4LW1 A;  1I6H H;  1PXU A;  1GXD C;  2K4K A;  3HKZ E;  4B3M L;  3HKZ G;  1K3R A;  4OHJ A;  3H6M A;  3GTG H;  4ZRZ A;  2EPB A;  4L5Q A;  2H5X A;  5M5X B;  2UU9 Q;  3M7G A;  1EFI D;  2KBN A;  2MUY A;  3GV6 A;  3HKZ B;  2F0K A;  1HQM C;  4KKT A;  2OTL A;  4PQX A;  4TVA B;  4GOP A;  4GS3 A;  4JV5 L;  4JI8 Q;  2K05 A;  3S1M H;  2EY2 A;  2B3G A;  1M8A A;  1SMX A;  2FHT A;  2YTV A;  1HFG A;  2B8F A;  4L63 B;  4X3T A;  4U67 3;  1IBM Q;  2IT1 A;  2A19 A;  1PRT D;  2N88 A;  4RGT A;  3NHH A;  2F0V A;  5JJZ A;  4A3M H;  4QIW E;  2E5L L;  4DGZ A;  1B8A A;  1H9K A;  2PCF B;  3MXP A;  4A3B G;  3CF5 A;  3DWA A;  4JI1 Q;  2RVL A;  3I4N H;  2RCF A;  2VUM H;  4IUN A;  3NTK A;  4A3B B;  1LTS D;  5JAV A;  1D8L A;  3PQI A;  3PIO 3;  2JA6 H;  1HR0 W;  1OXS C;  2HHH L;  2YV5 A;  4HED A;  1EYG A;  2O5J C;  1LAC A;  4KHZ A;  2KHI A;  3BJU A;  4OO1 G;  3NQI A;  1QG7 A;  1I94 L;  4B3R L;  4IQZ A;  1O7Y A;  2PW5 A;  4LF4 L;  3UI2 A;  1V8Q A;  2IJ0 A;  2KHJ A;  3CKI B;  5M9O A;  3WOE A;  1LAB A;  4OIK A;  3T53 B;  4DV3 Q;  4B3T Q;  1PV4 A;  1Z7T A;  3HOU G;  2LMC B;  2JA8 H;  5LMU L;  4K5X A;  4X62 Q;  1B50 A;  1LT4 D;  1PFM A;  3HOU B;  3D8G A;  3TME A;  1KHI A;  4ZLT F;  4IAL A;  4C3H H;  2PPB C;  1X3Q A;  1Y1V G;  3J7A 5;  4JI3 Q;  3A54 A;  1RDP D;  4DAY B;  2I5L X;  5C4H A;  4GKJ Q;  1RL2 A;  1Q8K A;  1Y1V B;  2EY5 A;  4P75 A;  3J80 L;  2R92 H;  2HIX A;  1WYD A;  4GKK L;  4BBS H;  4DR7 Q;  4P71 A;  1STN A;  3CAM A;  4FO2 A;  4MIU A;  1Y14 B;  1KDB A;  3S17 B;  4KTA A;  2SOB A;  1J9O A;  2LXJ A;  3SHL A;  4C3I G;  2NTT A;  2Z6B A;  4S3S A;  5BN3 A;  2E2D C;  1TWF B;  1KTK A;  4JOI C;  4PMW A;  4C2M B;  4PZ7 A;  1IBL Q;  2A69 D;  1N8R C;  5HGQ A;  4C3I B;  1HNW Q;  4I7Z C;  3L7Z C;  2K04 A; 
#chains in the Genus database with same CATH homology
 4YY3 Q;  1A0I A;  2LXK A;  2ASB A;  4C2M H;  4L5S A;  4P74 A;  4HJ8 A;  3M3Y H;  5FJ8 H;  3J81 c;  1VQF A;  4C3I H;  4PZ6 A;  3GO5 A;  2VY3 A;  3HFZ B;  2UUA Q;  3RLN A;  4NXM L;  3I2Z A;  1Y1W H;  2UXC Q;  1VQK A;  5IYC G;  1YI2 A;  4DR3 Q;  4JI4 L;  4ALP A;  4LF9 Q;  3F2B A;  2QA4 A;  5C44 G;  2UXD Q;  1C7Y A;  4HJA A;  4LF6 L;  3PUY A;  1KD1 C;  4IO9 A;  2HHH Q;  1GO3 E;  4R4O A;  4LFC L;  4DR4 Q;  2I0Q A;  2R7D A;  4A93 G;  1YHB A;  3UDX A;  2F4V Q;  3ZJY C;  4DUY L;  2Q2H A;  2OQK A;  1YBY A;  2UXB Q;  5C0X G;  3OTO L;  4GOP C;  1N32 L;  1YVC A;  3RR5 A;  4MNO A;  4OO1 I;  1C0A A;  3I4O A;  4IPC A;  1I94 Q;  4B3R Q;  3KF6 A;  1XNR L;  1EQR A;  4BXX G;  3J81 i;  3F8T A;  3KJO A;  4LF4 Q;  1I50 H;  3TRE A;  4BA2 I;  3F2C A;  4O2D A;  2MFI A;  4EQ5 A;  1FL0 A;  1Q81 C;  4LF5 Q;  3SGI A;  1SR3 A;  4YCV A;  3OYY A;  3Q8D A;  4NB3 A;  1G29 1;  1HR0 L;  1N33 Q;  5LMU Q;  2NN6 I;  4UP7 A;  4LUO A;  3ULL A;  3A5U A;  2CCZ A;  4B3S Q;  1L1O C;  1WJJ A;  3W1B A;  3NEN A;  4JI5 L;  4DR5 Q;  1XPR A;  1UE7 A;  4X64 Q;  5BR8 L;  4JI6 Q;  4BXX H;  1JJC B;  1A8V A;  1PFS A;  1YHA A;  1KL9 A;  3HOX H;  3RZO H;  2D0P A;  2RHQ B;  4LFA Q;  1VQO A;  4DK3 C;  1X9N A;  4KI0 A;  4DV0 L;  1X54 A;  1K9M C;  4R4T A;  4DV1 Q;  1V9P A;  3PO3 G;  1B70 B;  3CCQ A;  3DM3 A;  4Y52 H;  4JBJ A;  3W1G A;  2N8N A;  2Z6K C;  5LMN Q;  1FGU A;  4A3K G;  4IFD G;  1VQ9 A;  4R4C A;  5ELN A;  2E2I H;  4A3B H;  4YHH L;  1N34 Q;  1VS0 A;  4DV7 L;  1JMC A;  4GKK Q;  4PZ8 A;  4DUZ Q;  1YZ6 A;  3AEV A;  4JI2 Q;  1ASZ A;  4C3J H;  1HNX Q;  2JJQ A;  3MEF A;  4GOP B;  3GTM H;  3BZC A;  3J80 c;  2UUB Q;  2ZTE A;  1WI5 A;  4JBM A;  3ICE A;  3KOJ A;  4A3K H;  2XGT A;  3FKI G;  3CCU A;  2JQO A;  1BVS A;  3U4Z A;  2QEX A;  3HOW G;  4JI0 L;  5JJK A;  2Z0S A;  3IRB A;  1XPO A;  3I4M G;  2ZJR A;  1HZB A;  1SN8 A;  2EIF A;  4KLK A;  4AH6 A;  1NMF A;  3PIO A;  4LWC A;  5AJ3 L;  4LFB L;  3M85 A;  1V43 A;  2E2J H;  1L1O B;  2MO0 A;  4BY1 G;  1IBK L;  3F2D A;  4DR2 L;  1X56 A;  4NXM Q;  4APV A;  4JI4 Q;  1JJG A;  3H0G G;  1NMG A;  3HOU H;  5H1S E;  3KJP A;  3I4M H;  5DLQ E;  4LF6 Q;  2NVX H;  4LFC Q;  2R93 G;  1SRU A;  1ASY A;  1VCI A;  1A62 A;  2YTX A;  4BY1 H;  1XNQ L;  4DUY Q;  5C4J H;  3TS0 A;  2CWP A;  3TRZ A;  3OTO Q;  4YWK A;  1GKH A;  4X66 L;  5C0X I;  3K8A A;  2ES2 A;  4BA1 I;  1NTG A;  3H0G H;  1XNR Q;  5C4X G;  1VQ8 A;  1OXV A;  1WCM G;  4XIG S;  3PUX A;  1HZ9 A;  2R93 H;  1FJG L;  2JA5 H;  2WB1 G;  3CCS A;  2AKW B;  1RIP A;  2ID0 A;  3F1Z A;  1IYJ B;  3CCE A;  4JBK A;  2ZM6 L;  4QGU A;  1S72 A;  2AMC B;  2F3I A;  1HR0 Q;  1CKN B;  3H3V I;  3KDF A;  5IYD G;  3S17 H;  1M90 C;  4LNQ A;  4UY8 C;  1GD7 A;  4HJ7 A;  2BH8 A;  3ULJ A;  4JI5 Q;  5BR8 Q;  2I5M X;  3HOY G;  1CKM A;  4IJL A;  3PUZ A;  1VQJ A;  1TWF H;  2NZO A;  1YIT A;  1FVI A;  3JAM c;  4LF8 L;  2K75 A;  2B63 H;  4BY7 G;  1PVO A;  2Q2T A;  2OWO A;  1TWH H;  4DV0 Q;  3ERS X;  2V1C C;  3MXN B;  1OXX K;  4BBR G;  3CPW A;  3H15 A;  1K8A C;  2JK8 A;  4OON A;  3S1R H;  2JA7 G;  4DR6 L;  1BBU A;  3K81 C;  4LUZ A;  4WJ3 M;  5IYD H;  4NXN L;  3CCM A;  1EQQ A;  1JT8 A;  1GM5 A;  3W5O A;  3RNU A;  1M1K C;  2NVY H;  3D31 A;  4MTN A;  4YHH Q;  4IFD I;  3AQQ A;  3CP0 A;  4DV2 L;  4DV7 Q;  1QUQ A;  5GQO A;  5GAH C;  4QY7 A;  1BBW A;  4R4I A;  4GLX A;  4YWM A;  1CSP A;  4DK6 C;  4IPD A;  4BBR H;  1J6Q A;  5IYC H;  3PV0 A;  3GTK H;  3JAM i;  1DGS A;  1EUJ A;  2ZJQ A;  3B6Y A;  2GVB A;  1B7Y B;  4A3C G;  5C44 H;  1X3E A;  2B29 A;  4HIO A;  1QZH A;  2E2H H;  4A3D G;  4UPA A;  4QJF A;  2Q2I A;  2VW9 A;  1CUK A;  4A93 H;  2Y0S E;  4GNX A;  1Q1B A;  2VL6 A;  4JI0 Q;  2D0O A;  5E7N A;  4HIM A;  3PUW A;  2R7Z G;  3KF8 B;  2Y0S G;  4R4Q A;  1PHJ A;  3EBE A;  2MQH A;  4DR1 L;  4RMF A;  1XPU A;  3RN2 A;  2KCM A;  5IYB G;  4P73 A;  5AJ3 Q;  4LFB Q;  1AH9 A;  3NEL A;  1X55 A;  2VQF L;  3U4V A;  4A3C H;  1Z47 A;  1IBK Q;  3AFP A;  3TEH B;  2NVT H;  1PH6 A;  4DR2 Q;  2N3S A;  1Q12 A;  4OXP A;  3RLO A;  2HQL A;  5C3E G;  4DV5 Q;  1VQI A;  2K50 A;  5IP9 G;  4UP9 A;  3T1H L;  2R7Z H;  3H3V H;  3I4N G;  5K36 G;  4GLA C;  3PUV A;  1EOV A;  1SFO H;  1C9O A;  1P16 A;  2AWN A;  3CC2 A;  3CQZ H;  1NBW A;  3GD7 A;  1YEZ A;  2WAQ G;  1S40 A;  1I5F A;  1Z9F A;  4AQY L;  1E22 A;  3CCL A;  1XNQ Q;  4A3J G;  3E9I A;  3PCO B;  2GN5 A;  5GRO A;  1Q86 C;  4LF7 L;  1UE5 A;  3UDI A;  2IY5 B;  1L1O A;  3K0X A;  1HH2 P;  2BA0 A;  4LUV A;  5C3E H;  3G6E A;  4DV4 L;  2UUC L;  3S14 H;  3FP9 A;  1SLJ A;  2LSS A;  3A5Z B;  3PO3 H;  2VNU D;  3KF6 B;  3CMA A;  1AE2 A;  4UP8 A;  2N78 A;  3G71 A;  1FJG Q;  4P72 A;  2UUA L;  2ZTC A;  1U0L A;  2CWA A;  1YJW A;  1YJ9 A;  4KHP L;  3GTO H;  4A3J H;  4HID A;  1Q46 A;  3U50 C;  1KXL A;  2ZM6 Q;  4DAM A;  5M5Y H;  4JI7 L;  4A76 A;  1TWG H;  2YYZ A;  1CKO A;  1SRO A;  5IT9 c;  4A75 A;  2KCT A;  2BH2 A;  2BA1 A;  1N36 Q;  3I56 A;  2UU9 L;  1VQN A;  1KAW A;  3CC7 A;  2VS1 A;  3A0J A;  3PIP A;  4DKA C;  3FKI H;  4X6A H;  3UE0 A;  3J81 j;  1QVC A;  1A63 A;  2RCN A;  4JI8 L;  2E8G A;  4IOA A;  4GLV B;  4OWX B;  4GN3 B;  3HOW H;  3AFQ A;  4DR6 Q;  3J80 i;  2ATW A;  4NXN Q;  2PQA A;  4DPG A;  1X3F A;  2IHF A;  1EIY B;  4JYA L;  2WP8 J;  2DGY A;  1UWV A;  3M4O H;  5JJL A;  1L0W A;  4A3E G;  2VZA A;  2IX0 A;  1IBM L;  1VQH A;  1K83 H;  1LYL A;  4DNI A;  3RZD H;  2ALY B;  3BZK A;  3TQY A;  1XTD A;  2Q2U A;  3PGZ A;  5J3B A;  3A74 A;  4GN5 A;  1HJP A;  2PI2 E;  3U58 A;  1SE8 A;  3GTJ H;  1L2F A;  1S3O A;  2HIV A;  5IP7 G;  1N32 Q;  4HJ9 A;  1J5E L;  4POG A;  3HOV G;  2VQE L;  5M3F G;  4J15 A;  4JI1 L;  2R92 G;  1G6P A;  3NBH B;  4JC0 A;  1VQ5 A;  2WB1 E;  3FHW A;  3S15 H;  1GVP A;  2RHS B;  4TQU S;  5M5W H;  4BBS G;  2OTJ A;  5M3M G;  2I5H A;  2K5V A;  4AYB E;  3UDG A;  4A3E H;  4A3F G;  3DLL A;  1EFW A;  1PH4 A;  2ZJP A;  4A3I G;  3ULP A;  4JCV E;  4AYB G;  1HNZ L;  1D7Q A;  1QVG A;  3M9B A;  5IP7 H;  4NPS A;  1MJC A;  3STB D;  4DR1 Q;  4YCW A;  2CFM A;  3ER0 A;  4A3L G;  1KC8 C;  2L15 A;  3TS2 A;  2AHO B;  2VQF Q;  1UE6 A;  5C4X H;  1WCM H;  2PMZ E;  1EIF A;  3K7A H;  1W2B A;  5M3M H;  5GAE C;  1X6O A;  4A3F H;  4H02 A;  1MJE A;  1T9H A;  4A3I H;  2OQ0 A;  3D0F A;  1PYB A;  3T1H Q;  1LTL A;  1PH2 A;  1IXR A;  2JA9 A;  4YCU A;  1YJN A;  3HKS A;  2JEA I;  2EXD A;  4OWT B;  2N49 A;  1PH3 A;  3S1N H;  3RLF A;  3PF5 A;  2IX1 A;  1K8G A;  1P8L A;  1Y1W G;  3HOY H;  3KFU A;  3EIV A;  4AQY Q;  1NY4 A;  5LMN W;  3AYH B;  3CXC A;  4DV3 L;  4B3T L;  4BY7 H;  2HT1 A;  2K14 A;  3E0E A;  4R1J A;  4JOI A;  4OX9 L;  1VQD A;  1TXY A;  3L0O A;  4LF7 Q;  4XTC S;  1TWC H;  4IPG A;  2UUC Q;  4DV4 Q;  4FDB A;  4MZ9 A;  4IOC A;  3K80 C;  4X62 L;  2KEN A;  1QZG A;  3HOZ G;  3M4Q A;  1KRT A;  2JA7 H;  4Y7N H;  4LW1 A;  4AIM A;  1I6H H;  4RG1 A;  2YU9 H;  5IWA L;  5GAG C;  2K4K A;  1VQA A;  4YWL A;  1PH1 A;  4KHP Q;  4K0K L;  1AE3 A;  3HKZ E;  1Q7Y C;  2JE6 I;  4GNX C;  3T1Y L;  4JI3 L;  2R6G A;  4B3M L;  4JI7 Q;  5HY6 A;  3G4S A;  3HKZ G;  1K3R A;  3E9H A;  3CPF A;  1IZ6 A;  4DV6 L;  3GTG H;  4L5Q A;  2H5X A;  4GKJ L;  1E1T A;  3KDF B;  2UU9 Q;  1PH9 A;  3HOZ H;  5FLX c;  1PYS B;  2F52 A;  2KBN A;  2K52 A;  4HIK A;  3S16 H;  3I7F A;  1HZC A;  1EWI A;  3NEM A;  2FXQ A;  5JEA J;  5M5X H;  4A3M G;  2OTL A;  4TVA B;  4DR7 L;  4GOP A;  4A3D H;  4GS3 A;  4JV5 L;  4JI8 Q;  3S1M H;  1N9W A;  1E3P A;  1XMO L;  2B3G A;  4X65 L;  4ME3 A;  2PNH A;  3CCV A;  1SMX A;  2YTV A;  3HOX G;  1PH7 A;  2A1A A;  2JEB I;  5GAD C;  3GTL H;  1W3S A;  4JYA Q;  4WJ4 A;  2WAQ E;  1Q1E A;  1R9T H;  2VUM G;  1IBM Q;  2IT1 A;  2A19 A;  5IYB H;  3BU2 A;  4HJ5 A;  3K7U C;  4A3M H;  5ELO A;  1IBL L;  1QUQ B;  4QIW E;  2E5L L;  1B8A A;  3GDE A;  4X66 Q;  3WWV A;  2JA6 G;  1XMQ L;  1HNW L;  1J5E Q;  4A3B G;  3CF5 A;  1X3G A;  1TWA H;  4YY3 L;  2VQE Q;  5FLM G;  2MO1 A;  4JI1 Q;  1VQE A;  2XTI A;  5IP9 H;  1VQP A;  1XJV A;  1H95 A;  3I4N H;  1K0R A;  4O0A A;  2VUM H;  3PSI A;  4POF A;  2YTY A;  1UE1 A;  2IHE A;  2UXC L;  4QQB X;  2ZTD A;  4DR3 L;  4LF9 L;  1YNX A;  1HNZ Q;  1D8L A;  4GNX B;  1WOC A;  2UXD L;  2JA6 H;  3CCR A;  1KIX A;  1UEB A;  1HR0 W;  1OXS C;  2HHH L;  2Z6K A;  1LM0 A;  5FLM H;  4DR4 L;  2NVQ H;  2YV5 A;  1E1O A;  4LF8 Q;  1I3Q H;  1EYG A;  4PG3 A;  1VQL A;  3EN2 A;  2F4V L;  2GVA A;  2MNA A;  3VDY A;  4KHZ A;  2UXB L;  1LUZ A;  2KHI A;  3S2H H;  2JA8 G;  5IE8 A;  3BJU A;  3PO2 G;  4OO1 G;  1VQ4 A;  1PH8 A;  1KRS A;  4IJH A;  1I94 L;  4B3R L;  4A4I A;  1BKB A;  2WFW A;  1VQB A;  4LF4 L;  2KHJ A;  2PI2 A;  1NE3 A;  3I55 A;  1MIU A;  4DV3 Q;  2D62 A;  4DV2 Q;  1NJI C;  4B3T Q;  1PV4 A;  1CKN A;  4LF5 L;  4A3G G;  3HOU G;  3UE1 A;  2A8V A;  4OX9 Q;  1YIJ A;  3GTP H;  2NN6 G;  2JA8 H;  1Q82 C;  5LMU L;  2K5H A;  4L5R C;  1N33 L;  3PO2 H;  3S1Q H;  2CQO A;  1KQS A;  4B3S L;  3J7Z C;  1IL2 A;  1VQG A;  4X62 Q;  2CKZ B;  5C0X J;  4DR5 L;  3KLW A;  5JEA G;  4X64 L;  3KYH C;  1PH5 A;  2C35 B;  3S24 A;  4JI6 L;  5JJI A;  3PF4 A;  1JE5 A;  1E24 A;  1KHI A;  5IWA Q;  4LFA L;  3RN5 A;  3LGJ A;  4C3H H;  4K0K Q;  1OXT A;  1Y1V G;  3J7A 5;  4A3G H;  3T1Y Q;  4DV1 L;  4DV5 L;  4JBW A;  4JI3 Q;  1V1Q A;  4B3M Q;  1YHQ A;  1WFQ A;  4DAY B;  1PA6 A;  4DV6 Q;  3OW2 A;  2I5L X;  4JG2 A;  5EAY A;  1HZA A;  1RL2 A;  4GKJ Q;  1X65 A;  1Q8K A;  2QGQ A;  1MKH A;  4QL5 A;  5LMN L;  2JA5 G;  3M4P A;  1N34 L;  2DUD A;  1JB7 A;  1K73 C;  1QVF A;  2OCE A;  1U5K A;  1VQC A;  4P75 A;  3L2P A;  5M3F H;  2R92 H;  3HOV H;  2HIX A;  3JC6 6;  1WYD A;  1E7Z A;  2EQS A;  1VQ6 A;  3M7N A;  3S2D H;  4BBS H;  1Y1V H;  4DUZ L;  4DR7 Q;  4GKK L;  4P71 A;  3CME A;  3CC4 A;  3CCJ A;  4JV5 Q;  4JI2 L;  3CAM A;  1JJ2 A;  2R7F A;  5IY0 A;  1XMO Q;  4X65 Q;  1HNX L;  2NZH A;  4GN4 B;  3CD6 A;  1VQM A;  1O7I A;  1Y14 B;  2B63 G;  1G51 A;  2UUB L;  5FJ8 G;  2LXJ A;  1OTC A;  2PQA B;  2K5N A;  4A3L H;  3UDF A;  1OXU A;  2RF4 A;  2AWO A;  4IFD J;  4JOI C;  4PMW A;  3G48 A;  4L5T A;  1CSQ A;  4PZ7 A;  3STB C;  4EX5 A;  1N8R C;  4IPH A;  1IBL Q;  3CW2 C;  5HGQ A;  1VQ7 A;  2E5L Q;  4OWW B;  1N36 L;  1HNW Q;  1XMQ Q;  3GTQ H;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...