1I50H

Rna polymerase ii crystal form ii at 2.8 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i50H00
1HZBA 2VQFQ 3RZDH 5M3FH 2ES2A 3RN5A 1J5EQ 1K8GA 1NMGA 4K0KQ 2R7DA 3I4OA 3HOVH 3HOUH 3I4MH 4IFDJ 5M3MG 2ZJQA 2DUDA 5LMUL 4DV7Q 3TEHB 5C0XI 1XMOL 5IYDG 1S3OA 3J7ZC 3GTJH 4GN5A 4LF4Q 2LXJA 4MTNA 5GROA 4LFAQ 2R7FA 5IY0A 5IWAQ 3M85A 3PSIA 2UUAL 3TS2A 2PI2E 4HJ8A 1CKMA 2K5VA 2ZM6Q 4NPSA 3RZOH 1X3GA 4JV5Q 3HKZG 2QGQA 1CUKA 4GOPA 3NBHB 4H02A 4LUVA 3J81c 4GNXB 3S1MH 2UU9Q 1J5EL 3NELA 3CC4A 4K0KL 4O0AA 1Y1VH 2OTJA 3WWVA 1UWVA 1QZGA 2K5HA 2VQEQ 1YJ9A 4DV7L 5LMNQ 4KHZA 4WJ3M 2VL6A 1NJIC 4LF4L 1JMCA 4LFAL 3S1NH 5JJIA 5IWAL 5JEAJ 3W5OA 2EQSA 1VQ9A 3DLLA 4A3DH 4LUZA 1WCMG 4JYAQ 4KHPQ 5JJLA 2ZM6L 2CKZB 1VQBA 1PHJA 4JV5L 4A75A 3STBD 1FGUA 1VQKA 4B3RQ 3H3VI 4A3LH 4IPGA 2Q2IA 1QVFA 3L7ZC 2UU9L 4RG1A 3PV0A 1BVSA 4DAMA 1KXLA 2Y0SG 1MJCA 3BZCA 2R92H 4Y52H 2JA5H 4FDBA 3GTLH 4DKAC 2DGYA 5FJ8G 5LMNL 4HJ5A 3MEFA 2ASBA 5AJ3L 4HJ7A 1HR0Q 2UXBQ 4GNXA 1PYSB 4DR1Q 2CFMA 4BY7G 3GO5A 1CKNB 1V43A 2JEAI 2R7ZH 4JYAL 4A3FG 1K9MC 1VQCA 2F4VQ 4POFA 4KHPL 3RLFA 2K50A 3PUYA 5IYBG 4GNXC 1GO3E 3HOWG 3UDIA 2VW9A 4B3RL 4YWMA 1UE1A 1PH6A 1M1KC 4NXNQ 3PO2G 1GM5A 1D7QA 1XPRA 1UE5A 2IX1A 3CAMA 2JQOA 4A3GH 1A63A 4JI3Q 2KHIA 4A3BH 3CCSA 5M3MH 3CCUA 3ZJYC 1VQHA 2HQLA 2OCEA 3UDXA 4A3IG 3BU2A 2K4KA 2PI2A 1FL0A 1HR0L 4DR1L 5IYDH 1CSQA 3S1QH 3T1YQ 2Q2UA 2F4VL 1KAWA 5M5XH 3I4NG 5IT9c 1GD7A 4DR7Q 4BBRG 4NB3A 1IZ6A 4LF5Q 2CWAA 4OO1I 1TWGH 3PGZA 3CCQA 1EOVA 3ERSX 4QL5A 2RHSB 1N32L 4NXNL 2R93G 4L5TA 5JJKA 3K0XA 4JI7Q 3ER0A 1ASZA 4AYBG 3E9HA 2LXKA 3PUXA 4A76A 3CMAA 3PIPA 4R4QA 3RNUA 3B6YA 1VQ6A 1XNQQ 4JI4Q 3CCJA 1HNXQ 1ASYA 3T1YL 3G6EA 1M90C 1J6QA 3E0EA 4DR7L 1XJVA 2I5HA 4LF5L 3D31A 1FJGQ 1U5KA 1I94Q 3W1GA 2ZTEA 2N3SA 2I5MX 1VQ8A 1YITA 4JI7L 3JAMi 1NMFA 4GLVB 1S40A 1YVCA 1N33L 3G48A 4GN4B 2E2HH 2FXQA 5C4JH 1U0LA 4IFDG 4A3JG 4OWTB 1YZ6A 5FJ8H 3J81j 4A3CG 4JI4L 1YHQA 3M7NA 1HNXL 4BY7H 2YV5A 1AE2A 4A3FH 1TXYA 1PV4A 5IYBH 3KF6B 4DNIA 5M5YH 3LGJA 1YI2A 1I94L 1FJGL 4DV1L 3HOWH 4C3HH 5LMNW 4LF9Q 1P8LA 2HT1A 2E2JH 2Z6KC 1G51A 3PO2H 3AYHB 1B8AA 1K83H 1SE8A 4JI8Q 3H3VH 3T1HQ 5IP7G 3F8TA 3I55A 4DV0Q 4JI0Q 3SGIA 1KC8C 2WFWA 4DV4Q 1E1TA 2UXCQ 2JA6H 3BJUA 4A3IH 2Q2TA 3U4VA 1L0WA 2ID0A 1VQDA 1YHBA 2BA1A 5GAHC 3ULPA 4NXMQ 1SFOH 3NEMA 1R9TH 2B63G 3I4NH 2F52A 1VQ4A 1HZAA 2K52A 5JEAG 4BBRH 3M4OH 2K14A 2Z0SA 1KD1C 3BZKA 3KLWA 4A3MG 5DLQE 4DR3L 4LF9L 3AFPA 2E5LQ 1E22A 3L0OA 1HR0W 2XTIA 4A93G 2HIVA 2R93H 1WJJA 4JI8L 3T1HL 4DV0L 4JI0L 1QVCA 2B3GA 3FP9A 3KF6A 2VZAA 3Q8DA 4DV4L 2JK8A 2R6GA 3H0GG 2UXCL 4BXXG 1PH1A 4LNQA 2L15A 4APVA 1P16A 4NXML 2ZJPA 2MFIA 3TREA 4IJHA 1I3QH 5GAGC 3EIVA 1IBMQ 1VQGA 3KFUA 1OXXK 1IXRA 1KRSA 1HH2P 4P73A 2A8VA 2WB1G 2VQFL 3IRBA 1AH9A 2E5LL 3M3YH 1OXUA 1E7ZA 1OXVA 4HIDA 2K5NA 4QJFA 1I5FA 4GOPC 2CCZA 1HNWQ 1JJGA 1KRTA 2YYZA 1VQIA 1X56A 1JJCB 2D62A 4JG2A 4DR4Q 4X64Q 1MJEA 3RLOA 4R4CA 4JI2Q 1QVGA 2VS1A 3KOJA 4A3CH 2YTYA 3HKSA 4LF6Q 4YWLA 4JI6Q 1VS0A 4DK3C 4P71A 4LWCA 1PVOA 3DM3A 2IY5B 1IBML 1E1OA 1SMXA 1VQEA 2CWPA 1UEBA 4YY3Q 1N34Q 3S24A 1O7IA 3FKIG 1PH9A 2C35B 1N36Q 1HNWL 1BKBA 1UE7A 5C44H 1EWIA 1BBWA 2VQEL 5IP7H 3HOXG 2MO0A 3PUZA 2UUBQ 4DR4L 4X64L 4JBWA 5BR8Q 3M4QA 3S1RH 1KL9A 4JBMA 4JI2L 5GADC 4OX9Q 2MQHA 4A4IA 3ULLA 4JI6L 1VQJA 4LF8Q 4HIKA 1HNZQ 1S72A 5HGQA 5M5WH 1X6OA 1PH3A 4EX5A 1I6HH 4YY3L 3S2HH 2A1AA 1N34L 4A3MH 4LUOA 3I7FA 1N36L 4IOAA 5ELOA 2EIFA 2VNUD 4ALPA 1PH4A 4BY1G 2UUBL 4YCVA 1A8VA 2UXBL 3H0GH 2F3IA 4BXXH 4PMWA 4TVAB 1W3SA 2JE6I 3K80C 1TWFH 4YCWA 3F1ZA 4LF8L 1JE5A 4XTCS 4POGA 1OXTA 1HNZL 2UXDQ 3K81C 1N8RC 3I56A 1K73C 4LF7Q 3CCRA 4DR5Q 1RIPA 1D8LA 4JBJA 4DK6C 3JAMc 4R4OA 3TS0A 1IL2A 1Q7YC 2AKWB 2V1CC 1H95A 2D0OA 3PUVA 3OYYA 4JI3L 1C0AA 1E3PA 1RL2A 2I0QA 1E24A 1AE3A 4YHHQ 4JC0A 5C0XJ 4WJ4A 2KBNA 4X66Q 1GKHA 5IE8A 4UP9A 3KJOA 4X62Q 1WCMH 4L5RC 2UXDL 4X65Q 1Q8KA 1V9PA 4AQYQ 4LF7L 2E8GA 4DR5L 2AWOA 3STBC 4TQUS 3CCEA 1VQ7A 4EQ5A 3OW2A 2OTLA 1YJWA 4B3TQ 4PZ8A 2KENA 3E9IA 3FKIH 1PFSA 4LW1A 5GQOA 1PH2A 3ICEA 4GKKQ 2NVXH 3HOUG 3W1BA 1WFQA 4HJAA 4LFBQ 4HIOA 2E2IH 3HFZB 4OXPA 5C3EG 1LYLA 4YHHL 1FVIA 3HOXH 1Q1EA 1XNQL 3UE0A 1B7YB 1YHAA 4IPCA 4HIMA 1G291 2QA4A 1WYDA 4GLXA 1QZHA 1XMQQ 3AEVA 5C4XG 4X62L 1X3FA 4QY7A 3RR5A 2WP8J 4X65L 4AQYL 1LM0A 2KCTA 3TQYA 1EQQA 4YWKA 4DUYQ 1VQMA 1YNXA 3K7UC 4R4TA 4B3TL 4GKKL 3A0JA 3G4SA 1K0RA 4LFBL 2D0PA 2IHFA 4DR6Q 4IPHA 4UY8C 4GN3B 2N8NA 3L2PA 2RF4A 2YTXA 3GTGH 3J80i 1Q1BA 1KIXA 4YCUA 1XMQL 1SROA 1K3RA 1VQAA 3K8AA 2PMZE 2ZTDA 1Q46A 1V1QA 2ZTCA 1SLJA 4AH6A 4DUYL 3I2ZA 3U4ZA 3ULJA 4A3EG 4Y7NH 3CF5A 2GN5A 2IX0A 3TRZA 2JA7G 3MXNB 4O2DA 3D0FA 1NBWA 1VQPA 4DR6L 3HKZE 2JA5G 4IPDA 2NN6G 2PNHA 3PIOA 3GTKH 3S16H 4BBSG 1YEZA 3KDFA 1XPOA 1VQLA 4MNOA 1Z9FA 3CCLA 3FHWA 4C3IH 1VQOA 2B29A 4PG3A 5ELNA 1W2BA 2ATWA 1JB7A 3AQQA 1EIYB 1X65A 3RLNA 4DV3Q 4JI5Q 1Q82C 4QIWE 4KLKA 4DV5Q 4A3GG 4IO9A 2K75A 1OXSC 4A3BG 5C3EH 4A3JH 3CPFA 5EAYA 2YU9H 2BH2A 4L5SA 2JEBI 3U50C 2Y0SE 3UDGA 5C4XH 1MKHA 2RCNA 1PA6A 4DV6Q 4PZ7A 1Q86C 4JCVE 2OWOA 3M9BA 4UPAA 1I50H 1X55A 2IT1A 2UUCQ 3GTMH 4DV3L 4JI5L 3GTPH 4BA1I 5H1SE 3PF5A 3HOYG 1C9OA 4DV5L 3CC7A 4GKJQ 5IP9G 1QUQB 4B3SQ 2N49A 2WAQE 3PO3G 1VQ5A 4OWXB 3GDEA 4QGUA 4B3MQ 2KCMA 5AJ3Q 1BBUA 5FLMG 3PUWA 3F2BA 5C0XG 4LF6L 2JA9A 2AHOB 2CQOA 1Q81C 2B63H 4LFCQ 3HOZG 3UE1A 4DV6L 2IHEA 3CCMA 3GTOH 5GAEC 1PH5A 1PH7A 1YJNA 4KI0A 2JA8G 2NZOA 2NZHA 1LUZA 2UUCL 4OONA 3PF4A 1EQRA 1NE3A 4A93H 1KHIA 1MIUA 3KF8B 4GLAC 4A3EH 1DGSA 2N78A 3U58A 2JA7H 3A74A 4GKJL 4MZ9A 2PQAB 3J81i 4B3SL 1Q12A 1X54A 5J3BA 4P75A 2BA0A 3EN2A 5BR8L 1HJPA 4DAYB 1G6PA 4JI1Q 4B3ML 1XPUA 4OX9L 1LTLA 4BBSH 4DUZQ 1B70B 2AMCB 4AYBE 2NVYH 5FLXc 1CKOA 1EIFA 4LFCL 3G71A 1QUQA 1PH8A 4DR2Q 1IYJB 1SRUA 2WAQG 5K36G 4PZ6A 2QEXA 1JJ2A 5IYCG 1N32Q 3GD7A 3CPWA 4IOCA 1WI5A 4A3KG 4IFDI 2OQKA 2VUMG 1PYBA 1C7YA 3F2DA 3M4PA 1N9WA 3JC66 3H15A 1KQSA 1Y1WG 2JA6G 1TWAH 1K8AC 3NENA 4JI1L 1Y14B 3VDYA 1XNRQ 5HY6A 3CCVA 4DUZL 4JOIA 1OTCA 1EFWA 1TWCH 2OQ0A 2PQAA 1EUJA 5E7NA 4X6AH 4DR2L 4L5QA 4R1JA 1YIJA 4JOIC 2HHHQ 3S2DH 5M3FG 3K7AH 3A5ZB 4RMFA 1IBKQ 3KYHC 2RHQB 3CC2A 1CKNA 2NVQH 1L2FA 1T9HA 3CQZH 3HOYH 3HOVG 3I4MG 4C3JH 5IP9H 4UP8A 3OTOQ 1A62A 1N33Q 3PO3H 3J80c 4DV2Q 1VQNA 3CXCA 4QQBX 4X66L 1XNRL 5FLMH 4AIMA 1IBLQ 1X3EA 2JJQA 4XIGS 2BH8A 1NY4A 2XGTA 3HOZH 2KHJA 4P72A 3S17H 2VY3A 2HHHL 4OWWB 1VCIA 3CW2C 1UE6A 2JA8H 2GVBA 1NTGA 1L1OB 4DPGA 1GVPA 4DV1Q 1IBKL 1EYGA 3EBEA 4OO1G 3KDFB 3S15H 2NN6I 1Y1VG 2YTVA 1JT8A 2I5LX 1SN8A 3OTOL 3S14H 4R4IA 4IJLA 4C2MH 4DV2L 3UDFA 4BY1H 4ME3A 3CMEA 3J7A5 1SR3A 2HIXA 4UP7A 4HJ9A 3AFQA 2MNAA 1IBLL 2NVTH 2AWNA 4A3DG 4JBKA 2EXDA 3CD6A 4GS3A 2GVAA 4P74A 1VQFA 4BA2I 1TWHH 2Z6KA 1XTDA 3CP0A 4A3LG 4J15A 4DR3Q 1HZCA 5IYCH 1X9NA 2A19A 4A3KH 1Z47A 2R92G 5C44G 2VUMH 2Q2HA 3A5UA 3GTQH 2MO1A 2WB1E 5LMUQ 3RN2A 2H5XA 1XMOQ 1YBYA 4GOPB 1L1OA 1CSPA 1Y1WH 2R7ZG 1A0IA 2ZJRA 2UUAQ 2LSSA 3KJPA 3PCOB 1HZ9A 1WOCA 1L1OC 2ALYB 3F2CA
chains in the Genus database with same CATH superfamily
3RZDH 5M3FH 2PMZB 1NMGA 4K0KQ 3PMFA 3S1QB 4IFDJ 4KK7A 2DUDA 2PW5A 5C0XI 2BE5C 3H6MA 1S3OA 3J7ZC 4LFAQ 2R7FA 4DF7A 2PI2E 3L9AX 4BS9A 3RZOH 3HKZG 2QGQA 1CTMA 1CUKA 2PCFB 3TZUA 4GOPA 5BN3A 3J81c 2DY7A 1SNPA 3S1MH 4K0KL 3A55A 1EY7A 5KNDA 2OTJA 1QZGA 4QIWB 1DOKA 4WJ3M 2NB0A 4G7OC 4F7XA 4LFAL 4JYAQ 1DZ1A 2EQSA 2WKCA 3CHBD 4QUFA 4A3DH 4I7AA 3STBD 4B3RQ 3H3VI 2PYKA 4A3LH 2B2YC 4RG1A 1KXLA 2Y0SG 4V190 4DKAC 2DGYA 2ASBA 3DHQA 5CV4A 4CKEA 3HOWB 1G6ZA 1WD1A 1K9MC 2F4VQ 4JYAL 2EYLA 4KKTA 3UDIA 2VW9A 4QCLA 4B3RL 4YWMA 1PH6A 2F4IA 2IX1A 2K1BA 3X3MA 1Y69U 1QILA 2A69D 3LWEA 5M3MH 2XVSA 1IW7C 3N52A 4A3IG 2PI2A 3R8BA 3D3RA 2O2LD 5TSSA 2F4VL 1KAWA 1MI2A 1GD7A 4KY7A 3MXGA 4NB3A 4AYBB 1K8MA 2KCNA 3PGZA 1EOVA 4QL5A 5JJKA 3GTKB 3K0XA 2B2UC 1ASZA 1D5ZC 3E9HA 2LXKA 3CMAA 4R4QA 3GQBA 1EQVA 2EJFC 1M90C 3E0EA 5FO9B 1U5KA 1EL0A 3TN2A 1EIHA 5K5PA 1SYDA 1YITA 2YU9B 1NMFA 3A8IE 4GLVB 2B2VC 4GN4B 2E2HH 4IUVA 5C4XB 5A2QL 5FJ8H 5IGGA 5F2DA 1IYVA 5E4WC 1YHQA 3M7NA 4BY7H 1GJXA 1S5CD 4N8FA 2PZWA 1STEA 1TXYA 3KF6B 5M5YH 4DV1L 4CJ1B 5A2QE 1P8LA 2E2JH 1G51A 1SE8A 5IP7G 2A6ED 2LKVA 4DV0Q 4JI0Q 1GHJA 1JR0D 4UDUC 3VYRA 3BJUA 1LTID 1BNZA 1YHBA 2BA1A 5GAHC 2O5JC 2B63G 1R9TH 1EY0A 3I4NH 4ZAIA 4NMZA 2F52A 1L0YB 2K52A 1DOMA 1F9RA 4HMJA 5JEAG 3M4OH 2Z0SA 1KD1C 3IFDA 1GUGA 5DLQE 3TP8A 2R93H 2HIVA 2EYHA 4DV0L 4JI0L 4KJNA 3Q8DA 3H0GG 4ZKCB 1ET9A 5I2YA 5I6WA 1RTOA 4LNQA 2WB1B 2MFIA 3TREA 1Q90A 1PMRA 1S5BD 2RBMA 5COYA 3A8JE 1ET6A 1BF4A 4U673 4EQPA 1IXRA 4XYQA 3KUPA 4Z9CB 2L11A 3IRBA 3M3YH 3A8KE 1DD2A 3VR4A 3K5MA 1KRTA 1TY2A 1X56A 3MC0B 4X64Q 1PTOF 5I9OA 1MJEA 4X3UA 2QCPX 3NPPA 1MSGA 3KOJA 1H9RA 4A3CH 1PRTD 3HKSA 5EQ0A 4YWLA 1VS0A 2N55A 3DM3A 3CQZB 4ZKBB 4KKUA 5CBEE 2CWPA 1UEBA 1SSOA 1N34Q 1KDCA 1O7IA 1SBBB 5EKIA 5A35A 3OPOA 5C44H 1BBWA 3OW7A 1HHVA 2UUBQ 4X64L 5BR8Q 3S17B 1KL9A 4JBMA 5KIXA 4OX9Q 1X3PA 4ZYSA 2MQHA 4A4IA 1H9SA 1VQJA 3S15B 1S72A 5M5WH 1H9JA 4EX5A 1I6HH 2A1AA 1N34L 1PRTB 3NUCA 1FR3A 4LUOA 2M00A 3K0YA 2KVMA 1EYAA 4BY1G 2UUBL 2UXBL 4X3TA 2SNMA 3C1FA 1E0BA 2JE6I 3F1ZA 3LNNA 3R2IA 1OXTA 5DEHA 3I56A 3CCRA 1H9KA 1H95A 2D0OA 1Y1WB 3OYYA 3NXWA 1E24A 1EU4A 1KABA 2D2CC 4YHHQ 1K3BC 4WJ4A 1LTRD 2KBNA 3J7AV 5IE8A 2FINB 2E74C 1V9PA 1JCKB 5I4DA 3Q23A 3STBC 2XNAC 1VQ7A 3HS0C 1YJWA 4PZ8A 4HSVA 3FKIH 2NVXH 1SNOA 5C3EG 4YHHL 1FVIA 1XNQL 3UE0A 4CDEC 3W2DA 4MN3A 1LLRD 4GLXA 3IFTA 1TT2A 2DNEA 2WP8J 2KCTA 5D14A 1EQQA 1YNXA 4R4TA 3G4SA 3BDLA 4RWSC 2IHFA 2J4XA 4GN3B 2N8NA 2A69C 3PIP3 3FRPB 4IN3A 3DXJC 3R3OA 3CRKC 3J80i 1IYUA 3QO2A 4YCUA 1SROA 1VQAA 4G4KA 2JA7B 3KLSX 1SLJA 4ZRZA 3TSSA 1B2TA 3I2ZA 3ULJA 2GN5A 3HEJA 3KLSA 5CMDA 4XYOA 4IPDA 4G7HC 1Y8PB 2MHVA 2Q8TA 5IGBA 1BCPC 1YEZA 1AEXA 1HPCA 1VQLA 4C3IH 4A3GB 5ELNA 1JB7A 1PFMA 5E3FA 1X65A 4JI5Q 5AFWA 1O7YA 3WOEA 5M5XB 5FLXL 1XWEA 5EAYA 1A3VA 1TWGB 3HKZB 3MXNA 4IUPA 2NVQB 1PA6A 3CRLC 2F3WA 4JCVE 1I50H 1HCZA 1UNSA 3CKIB 4JI5L 3SVMA 3HOYG 5H1SE 1B1ZA 4S3SA 4C3JG 1B4OA 3PO3G 3HOZB 2A6EC 4OWXB 3GDEA 4WRDA 1SYBA 1QG7A 2H1EA 1F9SA 5C0XG 4LF6L 2FJ2A 2CQOA 2B63H 1EU3A 3T13A 3UE1A 1JWUD 5JEAH 1PH5A 4KI0A 2Y0SB 2NZHA 4C2MB 5C4JB 1KHIA 3KF8B 4GLAC 4A3EH 3J80L 1XX8A 3A74A 4EQOA 4MZ9A 2PQAB 1MGSA 2NVTB 1LTTD 1X54A 4PV1C 3SK8A 1NNXA 2L9HA 3EN2A 2MUYA 2NN6H 1HJPA 1TWHB 4K2KA 5IGCA 4DUZQ 2AMCB 5FLXc 2NVYH 4C3HB 1EIFA 3G71A 4OIKA 3J80E 5LHY1 1K83B 3NSWA 1ENAA 1N32Q 4A3IB 3GD7A 2VUMG 2WINB 1C7YA 1N9WA 2E76C 1QNUA 1RDPD 1QE6A 1TS5A 3U9OA 1QWYA 1K8AC 3NENA 1W6JA 1Y14B 4ILWA 2A74C 3CCVA 4DUZL 1OTCA 1EFWA 3I4MB 1ZYRD 1RCVD 1V1PA 5M3FG 3FPUB 2Z6BA 4H7BA 1CKNA 1L2FA 3BYYB 4UP8A 3OTOQ 3J80c 4DV2Q 2EY5A 4QQBX 4X66L 2HD3A 1QCBD 1T5XD 3BG3A 5FLMH 4N9TA 2JJQA 5E4XA 1YNND 2XGTA 1O7ZA 1Y1VB 3CW2C 2GVBA 1NTGA 1TQOA 3KDFB 2NN6I 1JT8A 2I5LX 1SN8A 3I70A 3OTOL 3S14H 4DV2L 4BY1H 2KQ3A 2HIXA 4UP7A 2K01A 4A3DG 2EXDA 3QJYA 2HDMA 5E1FA 5NUCA 1VQFA 1TU2B 4BA2I 5IODA 4A3LG 5IYCH 2A19A 5ELCA 4A3KH 3CU7A 3MHBA 1CQVA 3GTQH 1KLUD 3BVGA 1XMOQ 1ENCA 3K5LA 4L63B 4GOPB 1CSPA 2VB2X 2KJXA 5JVG3 1RD9D 2EYOA 3S2HB 1BBXC 3F2CA 1QNKA 2MPMA 1EWCA 1Z6HA 2ES2A 3RN5A 3BYTB 1J5EQ 1EY5A 5M3MG 1TWFB 4DV7Q 1PZKD 3TEHB 1XMOL 4LF4Q 5GROA 2KCCA 5IY0A 1B3QA 1JWSD 4HJ8A 2G9DA 2K5VA 3ND8A 1UEAB 3NQIA 2ZM6Q 2ZXPA 1HXYD 1H9MA 3RUZA 2UU9Q 2JP1A 1J5EL 4JK1C 3CC4A 1Q8IA 3WWVA 1YJ9A 1WCMB 4DV7L 3DEOA 5LMNQ 2VL6A 4RKLA 2ICEC 3PIO3 4LF4L 1JMCA 3W5OA 1VQ9A 2RSOA 1L0XB 3I72A 2ZM6L 2CKZB 4C1NK 4K8IA 1ICFB 5CBAE 2F0WA 3AMUA 3DWAA 3L7ZC 4JW0A 2UU9L 2EYPA 2XWJB 2OXPA 4LK1C 5IT9E 1PTOH 1DM0B 1MJCA 4XQJA 2R92H 4Y52H 1F9PA 4FDBA 5JOBA 5J22A 3GTLH 4HJ5A 5FJ8G 3M7GA 5LMNL 3MEFA 2C9OA 5AJ3L 3MFGA 1SNDA 4CGYB 4HJ7A 1PYSB 4BY7G 3GO5A 2R7ZH 1FYCA 1TS2A 1SNCA 2RKSA 2K50A 2C5CA 3VYSA 1M1KC 4UAIA 1GM5A 1XPRA 4RFBA 1SAPA 3CAMA 2BDNA 5C3WA 3UDXA 1UUPA 5IYDH 1CSQA 3S1QH 4HN7A 1LT6D 3I4NG 4CBVA 5IT9c 4Y7NB 1IZ6A 4LF5Q 4KN7C 4NKLA 2RHSB 2R93G 1I4XA 3S16B 5C4HA 4A76A 3QG1A 4HMIA 3PIPA 3GV6A 3B6YA 2F0FA 1AW7A 1DJRD 1SE2A 2CHBD 1WTXA 2LY7A 5DAUA 1ILQA 1HNXQ 3I91A 2RCFA 1YNJD 1KLGD 4RGTA 2I5HA 5L37A 4LF5L 4FP5D 1FJGQ 1I94Q 3W1GA 4PMCA 1JICA 2OF1A 2ZTEA 1STGA 1LACA 5C3EB 1VQ8A 2ZXRA 1EOTA 5CORA 1S40A 1YVCA 2FXQA 1U0LA 4A3JG 4OWTB 1YZ6A 3J81j 3MFYA 2NTSA 4A3CG 3OMCA 1HNXL 2EY2A 1NSNS 4A3FH 5EKLA 3J81L 1EIGA 1U4LA 1PV4A 1FJGL 4DNIA 1I94L 1YI2A 3HOWH 5LMNW 1MSHA 1LABA 2NUCA 2HT1A 1W6KA 2EDGA 2Z6KC 3PO2H 3ND9A 1B8AA 1SE4A 4RHSA 3H3VH 3F8TA 2JYOA 1KC8C 3SK4A 3GTOB 2Q2TA 2OT2A 3URYA 4NXMQ 1E2VA 5KEEA 1CHPD 2P5ZX 2K14A 3A7LA 1CZGA 5KGUA 1ZYRC 3Q0AA 4DR3L 2E5LQ 3L0OA 4A93G 4P2CB 4G57A 1NAPA 3BZDB 1LT4D 2F0HA 5FO8B 3SK6A 2K04A 2L15A 1TIID 4APVA 1EY8A 1P16A 4NXML 2ZJPA 4IJHA 1IBMQ 1YNNC 4FVMA 2E5LL 2RSNA 1OXUA 1OXVA 4HIDA 4Q0FA 2ZT9C 4GOPC 1H9SB 2YYZA 1TWCB 2D62A 3IKJA 5LL6S 2F0LA 4RCNA 2O4XA 1BDOA 4R4CA 1QVGA 4RH6A 4M8AA 2YTYA 3K7AB 5HURA 1BXTA 4P71A 3HOYB 1IBML 2IPKD 2AUKA 3Q24A 4KTAA 3MEHA 1II3A 3HOXB 4YIJA 3FKIG 4XQQA 1BKBA 1UE7A 4JBWA 4K5WA 3M4QA 1LTGD 2BCOA 2JSOA 2B8FA 4DA2A 3ULLA 1PH3A 2KHSA 3GTGB 2QDLA 2WACA 5ELOA 2VNUD 1PH4A 2WIIB 1A3UA 1A8VA 4BXXH 3D6WA 3BVMA 4RCOA 4TSSA 4LF7Q 1CHQD 1K73C 1D8LA 4DK6C 1STHA 1Q7YC 3EVQA 2KECA 3PUVA 1E3PA 5EPLA 4XT3B 4R8NA 3PQIA 5ELBA 1BCPD 1Y8OB 4K5VA 5D3IB 4UP9A 2EE1A 1C8CA 1SMYD 4NDXA 4LJZC 2V4DA 1GOZA 4C3IG 2D5DA 2IL8A 4EGVA 4X65Q 4LF7L 2EOTA 4DAYA 2OTLA 4GKKQ 2WV6D 1PFSA 3HOUG 3W1BA 4HJAA 4HIOA 5EKKA 1U9RA 2E2IH 3RZOB 1RHPA 1YHAA 4HIMA 2K5DA 3AEVA 1WYDA 3FPPA 3GTMB 3GTPB 3GV3A 3TP5A 4ZCKA 3S1MB 3RR5A 4X65L 1BCPB 1LM0A 4IURA 2BDOA 4LAAA 4GKKL 1HQMC 1K0RA 2A6HD 3K57A 1G2TA 2A73B 3UI2A 3DWQA 3K8AA 2PMZE 1WTOA 1EY9A 1Q46A 1JOKA 4AH6A 3U4ZA 5EBDA 2PZUA 3I4LA 4A3EG 3TRZA 3CF5A 4HSPA 4BBSB 2EYMA 3MXNB 1NBWA 4B9XA 2JA5G 2NN6G 1EY4A 1TY0A 2FHTA 3PIOA 3H91A 2K7VA 1ENFA 1XYIA 4MNOA 1Z9FA 1YNJC 4PQXA 1S5FD 1W2BA 4PG3A 2ATWA 1JOQA 2XSCA 5M3MB 1EIYB 1LTSD 1EZ6A 1TWAB 5I2XA 4QIWE 4DV5Q 5IGDA 2K75A 4A3BG 1PZJD 1U4MA 4A3JH 5CYUA 5T1GA 3NTKA 4GZYC 4L5SA 1PTOC 2JEBI 4K8JA 4PZ7A 2OWOA 3M9BA 4BA1I 3PF5A 1C9OA 4DV5L 4ZK9B 5HGTA 4MTKA 5KNCA 3IL8A 2RDFA 5FLMG 5FO7B 2CQAA 2AHOB 1ILPA 1QOHA 2NZOA 1LUZA 2E2HB 2F0NA 4OONA 4A93H 1DGSA 3U58A 4XXEA 2JA7H 4BY7B 5J39A 1EFID 5J3BA 5BR8L 3TP7A 4FF1A 4OX9L 1LTLA 4AYBE 1F2LA 2E2JB 2WAQG 1JJ2A 5IYCG 4DNRB 1WI5A 4A3KG 1IHZA 4L8JA 1PYBA 1R9TB 3M4PA 3I4NB 3JC66 3H15A 2JA6G 3M4OB 3VDYA 1XNRQ 1B9MA 3DUZA 3A7AB 2TMPA 4TKOB 4X6AH 2OQ0A 3A5ZB 2NVQH 2E2DC 2K28A 1N33Q 3CXCA 2MJ8A 1JC7A 1XNRL 2L5TA 3H3VC 1IBLQ 3M3YB 3HOZH 1NY4A 2KHJA 5CR3A 2EVBA 3A54A 3P7JA 2VY3A 3NE5B 3I73A 2JA8H 1UE6A 3BVZA 3EBEA 3K5OA 4OHJA 2YTVA 4R4IA 4C2MH 3CMEA 2QW7A 1RF2D 3AFQA 2MNAA 1IBLL 2NVTH 2AWNA 2CH4W 2K33A 4GS3A 2GVAA 1TWHH 5C44B 5K36H 1PDQA 1SYEA 5G3LF 1EZ8A 1HZCA 2AQ1B 1FGBD 4HCEA 2R92G 2IW3A 1AFPA 1KTKA 2WB1E 3RN2A 3VA7A 1L1OA 5M5WB 1S5DD 2R7ZG 1A0IA 2ZJRA 2UUAQ 2LSSA 3KJPA 2A68D 3PCOB 5EBCA 1L1OC 1SMYC 3DEPA 4KHVA 2VQFQ 4I7ZC 1VMCA 1K8GA 2R7DA 3I4OA 3HOVH 3HOUH 3I4MH 4KKSA 3V96A 1EQTA 3FEWX 4FXGC 2F0JA 1T5EA 1D5XC 5IYDG 3EQLC 3GTJH 1STNA 4GN5A 2LXJA 4MTNA 2UUAL 1M4VA 5IWAQ 3M85A 3PSIA 2AUJD 5FK9C 4C56C 3QOLA 4H44C 5KYIA 1X3GA 4JV5Q 3C3LA 3NBHB 2M9VA 4H02A 4LUVA 2HDLA 3NELA 4OO1H 1PFBA 1G8ZD 1Y1VH 2A6HC 1UWVA 2HCIA 2K5HA 4K14A 2VQEQ 2F0QA 4KHZA 2KEDA 1NJIC 1D1IA 1GUWA 3EJIA 3S1NH 5JJIA 3QIAA 5JEAJ 5IWAL 5JAVA 4LUZA 5JJLA 3FKIB 1LTAD 4JV5L 2NVXB 4XT1B 2VXWA 1VQKA 4IPGA 2Q2IA 3PV0A 4DNTB 1BVSA 2LS01 4DAMA 1BUVT 2JA5H 4GNXA 2KA7A 4CJ0B 4A3FG 3RLFA 4FO2A 3VR3A 1F2YA 3PUYA 1JORA 4GNXC 1GO3E 4FF4A 3HOWG 1HFGA 4NXNQ 3PO2G 3QR8A 1JWMD 4WFN3 4JI3Q 1SFOB 2KHIA 2PO4A 3G7LA 4A3BH 3CCSA 3CCUA 1VQHA 2HQLA 2OCEA 2SDFA 2FFKB 3BU2A 2J7ZA 1FL0A 3D4WA 2Q2UA 4B08A 4DR7Q 3BS1A 1BR9A 2F0DA 2CWAA 2KUMA 3ERQA 3CCQA 4OO1I 1LV9A 3ERSX 1N32L 4NXNL 3ER0A 4AYBG 1WTWA 2F03A 1I4HA 1VQ6A 1B50A 1HTPA 3CCJA 1RODA 3Q6SA 1PRTF 2CW0C 1DONA 4FNFA 1SYCA 4DR7L 1J6QA 4R8IA 1C48A 2I5MX 1D5MC 3N6RA 2K03A 2L0CA 4IFDG 3VA5A 3T4AC 3T51B 1VF5C 4DFAA 5IYBH 4H0LC 3LGJA 4FXKC 4FF3A 3S1RB 1KNEA 3NTIA 4E6IA 2B63B 3SGIA 2WFWA 1ZKOA 4DV4Q 2K32A 2UXCQ 2JA6H 1F2MA 1L0WA 3E0JA 2QKIC 3SDZA 1BQQT 1VQ4A 2B8GA 4BBRH 4ZLTF 3OHXC 3BZKA 1IKLA 1MD2D 2D9UA 3KLWA 1E22A 3H0GB 1Y8NB 2DY8A 1WJJA 1UAPA 1QVCA 2B3GA 4UHVA 2VZAA 4DV4L 2JK8A 2UXCL 4BXXG 1I3QH 2XIWA 3QOJA 2M2LA 4K5XA 3EIVA 1OXXK 1KRSA 1Q3LA 3SXHA 2WB1G 4FYDA 3G6JB 5EGTA 2BOSA 2EXZA 1E7ZA 4ZQ3A 1I6VC 4QJFA 1I5FA 2CCZA 1CA5A 3BDCA 1VQIA 2MP1A 1JJCB 4JG2A 4DR4Q 5IT9L 3RLOA 4IQZA 2QILA 2VS1A 1D1KA 2X6GA 5JPMC 1WVLA 2EPBA 3M4YA 3LWUA 1R4PB 3OWFA 4JI6Q 1PVOA 2IY5B 4DN4M 4RAUC 3SE0A 3ZYYX 4IUQA 4RA8A 4HAEA 3T56B 1DXMA 4ID6A 3S24A 1PH9A 5EPKA 1EWIA 3L3OC 3K5NA 3HP3A 3A56A 4K2LA 2LFNA 4O1NA 4DR4L 2Q8IB 3HG9A 4JI6L 4LF8Q 4X3KA 2A68C 1HNZQ 2HUGA 5HGQA 1X6OA 4LMQD 3S14B 4A3MH 4BY1B 1HA6A 3E3XA 3FDTA 5T1IA 1EWHA 1V8QA 2EIFA 5DNFA 2HQEA 2F0EA 2OEOA 4ALPA 3EROA 4DXFA 2G9HD 1NUCA 4LF8L 1JB3A 1JE5A 4POGA 1HNZL 2F0KA 3K81C 1N8RC 2QDBA 4H13C 4DU9A 4F8MA 1AZPA 1SE3A 3GTQB 4JBJA 4R4OA 1X3QA 2F3VA 2V1CC 1OO9B 5FOBB 2I0QA 5C0XJ 1GKHA 3RD4A 3KJOA 4X62Q 4L5RC 1LT3D 4AQYQ 1Q8KA 4KY6A 3QWNA 4OGQC 3CCEA 3OW2A 4B3TQ 3V05A 3E9IA 4LW1A 5GQOA 4ZUJA 1NCVA 3HFZB 4OXPA 3HOXH 1LYLA 2EJMA 1Q1EA 1F2ZA 1PTOD 4IPCA 2R61A 3WDNA 4DAVA 1KAAA 5CV7A 1XMQQ 2B2TA 4X62L 4AQYL 4MHEA 3T53B 4HEDA 2PQEA 1VQMA 1DCZA 1TVXA 3VR6A 4B3TL 3A0JA 4IPHA 3O13A 4UY8C 3L2PA 2YTXA 3GTGH 1ESFA 1STAA 4NW2A 2NWGA 4J6HA 1XMQL 4KMUC 2ZTDA 1V1QA 1PTOB 2R92B 1SYFA 4OIJA 3GTLB 1TS3A 2JA7G 4XDXA 1K8OA 5ELEA 1M8AA 4V0BA 1VQPA 3SHLA 3K6OA 1HA5A 1V1OA 3GTKH 1FNWA 2EZVA 1VF7A 3C1EA 3KDFA 3CCLA 3FHWA 1SYGA 3AQQA 4DV3Q 4CJ2C 5CC4A 1Q82C 4KLKA 4A3GG 4IO9A 1OXSC 3I90A 4RHRA 5KNBA 1G91A 4IFDH 1SNQA 2NTTA 3CPFA 4MIUA 2DJGC 3S2DB 2YU9H 2BH2A 4XQNA 1TKWB 5C4XH 1MKHA 3LX0A 1WTPA 3NK9A 4C3JB 2XRSD 2R3ZA 3VR2A 3IAYA 3PO3B 4UPAA 2IT1A 2SNSA 4DV3L 3GTMH 3GTPH 3CC7A 4F87A 4GKJQ 1TR5A 2L55A 4B3SQ 2WAQE 2K5QA 5IIFA 1BBUA 2PW7A 2JN4A 3HOZG 1Q81C 4LFCQ 2IHEA 3CCMA 5GAEC 2B2YA 1NR4A 4RGNA 2JA8G 1EQRA 4DGZA 1EY6A 2N78A 4GKJL 3NTHA 4B3SL 3W3AA 4A3FB 4P75A 2BA0A 4JI1Q 1XPUA 4BBSH 1CKOA 2EYJA 4LFCL 1QUQA 3PO2B 1QB5D 2VUMB 1IYJB 1SRUA 5K36G 2QEXA 4HR7B 4C3HG 4ULLA 3OSOA 5G3LD 2L12A 3CPWA 4IOCA 4IFDI 1SJED 2OQKA 2EYFA 3NQTA 1O78A 2PNRC 2F0IA 1R4QB 1TWAH 4JI1L 3NHHA 3RZDB 5M3FB 4JOIA 4WORA 3OMGA 1I4QA 4L5QA 4R1JA 1STBA 4JOIC 2HHHQ 2B2UA 1BO0A 4RMFA 1IBKQ 3KYHC 2RHQB 3CC2A 2MGSA 2PZTA 3CQZH 4EVOA 3HOVG 3I4MG 1K0SA 5IP9H 4CKBA 3U9SA 3SEBA 2AQ3B 1QJOA 2NYZD 2KEEA 3RMHA 4AIMA 1A2TA 1X3EA 4N8X1 2BH8A 3S17H 2HHHL 2RA4A 4OWWB 3TMEA 3MWYW 2B2VA 4DV1Q 1L1OB 4DPGA 1IBKL 1EYGA 1MHWC 3WOFA 4OO1G 3S15H 1Y1VG 1SJHD 1RKNA 1SDFA 5C4ZA 3T16A 4A3DB 3P1HA 1I4RA 3UDFA 4ME3A 1CM9A 3J7A5 1SR3A 3E6ZX 4HJ9A 2XN9C 3D6CA 1WTRA 4JBKA 3P75A 4P74A 2IWHA 4F88A 5D65A 4IZ8A 3H09A 1XTDA 2J0TD 4J15A 1NR2A 5LL6X 4ABNA 3MTSA 1Z47A 1B3AA 4O42A 1PZID 2Q2HA 3A5UA 5DM63 2RQXA 5LMUQ 2H5XA 1D6EC 1YBYA 1Y1WH 1PLFA 4J1MA 2F1MA 1Z7TA 1HZ9A 1WOCA 1U4RA 3CD6A 4DK1A 1GUNA 1WD0A 1HZBA 1AP0A 1BOSA 2A5HA 2Z8LA 4IUNA 2ZJQA 5LMUL 3MXPA 3TS2A 3KBGA 2NBFA 1I4GA 1GXDC 4Q5VA 3K58A 1CKMA 4NPSA 1HUMA 1D2BA 4IUTA 4GNXB 2JXMB 5EJWA 3TP6A 1J8IA 4O0AA 2AQ2B 3AU7A 2CW0D 4M1UB 4KY5A 4JPBW 4KHPQ 3DLLA 1WCMG 3P20A 1VQBA 3E5SA 4HCSA 1PHJA 4A75A 1FGUA 2E2IB 4OELB 2F0OA 1QVFA 5D3DA 3BZCA 2Z4HA 2RDGA 1V1PB 4N9PA 4ME5A 1HR0Q 2UXBQ 4DR1Q 5M5YB 2CFMA 1F9QA 1CKNB 1V43A 2JEAI 1VQCA 4KHPL 4POFA 3EA6A 5IYBG 5CGKA 1UE1A 1D7QA 1UE5A 2JQOA 4A3GH 2ZXOA 1A63A 2F0VA 3ZJYC 2DN8A 5ELDA 1GUOA 3TBIB 2K4KA 1HR0L 4DR1L 3AB9A 3T1YQ 1WTVA 5M5XH 2R93B 2XWBB 1JE4A 4BBRG 1KDBA 1TWGH 4TRDA 1SEBD 2B2WA 4KJOA 5JPNC 4L5TA 4JI7Q 5CV8A 2B2WC 3PUXA 2K05A 2DNCA 4DK0A 1GHKA 3RNUA 1XNQQ 4JI4Q 3D4RA 1ASYA 3T1YL 3G6EA 1XJVA 1DOLA 2GA4B 3D31A 4ODGA 2N3SA 1JOOA 3KK7A 3QB3A 4A3JB 4JI7L 1HFNA 3JAMi 1N33L 3G48A 1ZXTA 5C4JH 2CH4A 3OIPA 4NP5A 2SOBA 1PFNA 5DM73 4JI4L 2YV5A 2L4NA 1AE2A 5C3XA 5BN5A 3OWEB 4KD4A 4C3HH 4LF9Q 4CHTB 2O5IC 3DWPA 5KRUA 3AYHB 4JI8Q 1K83H 3D8GA 3T1HQ 1WTHA 3I55A 1EEID 2G5DA 5J1ZA 1LT5D 1E1TA 4A3IH 3U4VA 2ID0A 1VQDA 1I6HB 3ULPA 1AN8A 1SFOH 3NEMA 4A93B 4RGMA 1HZAA 5I9PA 5JVH3 4A3MG 5ELFA 4LF9L 3AFPA 4DAPA 1HR0W 2XTIA 4QMGA 4JI8L 3T1HL 1RJTA 1A6XA 3FP9A 1TS4A 3KF6A 2R6GA 1BCPF 3HRZC 1PH1A 2IX3A 1ESRA 1I4PA 2IJ0A 2Q8RE 3NWTA 5GAGC 1VQGA 1B53A 1E2ZA 3KFUA 1HH2P 4P73A 2A8VA 2VQFL 1AH9A 4I65A 3FVQA 1LO5D 1RTNA 2K5NA 2SEBD 4IALA 1HNWQ 1JJGA 4CDCC 3Q22A 1O80A 4JI2Q 3SR1A 2F0MA 3J7AF 4LF6Q 1A15A 4DK3C 4FXDA 4LWCA 1E1OA 3JAML 1SMXA 1VQEA 4J8QA 4YY3Q 2ICIA 5FLXE 2C35B 1N36Q 3R93A 1FNUA 1HNWL 2VQEL 5IP7H 1SXTA 3HOXG 2MO0A 3PUZA 1K28A 4R9WA 3JAME 3S1RH 4JI2L 5GADC 3SK5A 5CV6A 2JA8B 1C4QA 3MAQA 2X6LA 4B9WA 4HIKA 2VB3X 4K6DA 5M9OA 1U4PA 4YY3L 3S2HH 1FNVA 3NP8A 1G2SA 1HQRD 3I7FA 1N36L 1CA6A 4IOAA 1F77A 4QF4A 4YCVA 3H0GH 2F3IA 4PMWA 4TVAB 1W3SA 3H94A 1IKMA 3K80C 5ISRA 1TWFH 4YCWA 4XTCS 1E2WA 2UXDQ 3VYTA 1STYA 4DR5Q 1RIPA 3JAMc 1IL2A 3TS0A 2B39A 2AKWB 4KV6A 4JI3L 1C0AA 1RL2A 1AE3A 2PPBC 2Z9HA 3FMCA 4JC0A 4C3IB 4KD3A 1B9NA 4X66Q 1WCMH 5C5LA 1PRTC 2UXDL 1EEFD 3HOVB 3HOUB 2KOLA 2E8GA 4DR5L 2AWOA 4TQUS 4EQ5A 2F0UA 2KENA 3GTJB 3ICEA 1PH2A 4LFBQ 1WFQA 2FMCA 4RGOS 2BE5D 4OL7A 1B7YB 1G291 1GUTA 1I50B 3S9WA 2QA4A 1QZHA 5C4XG 3D4DA 1X3FA 4QY7A 3KLRA 1B44D 3TQYA 4YWKA 4DUYQ 4RKBA 3K7UC 1S4ZA 1HUNA 4LFBL 3OIQA 1EYDA 5CV5A 2D0PA 3S1NB 1CI3M 5IOCA 4DR6Q 4CKCA 2RF4A 4OEMB 1XTCD 2E75C 3KBXA 1AZQA 1Q1BA 1KIXA 4U68A 4A3EB 1K3RA 2I07B 3ITPA 2ZTCA 1X32A 4DUYL 4FF2A 2JA5B 1MBYA 5BN4A 3TDQA 4Y7NH 2IX0A 4O2DA 3D0FA 1XXGA 2NVYB 3J7YW 1ONLA 4DR6L 3HKZE 2PNHA 2XRQD 3S16H 4BBSG 2F0SA 2N88A 1XPOA 1VQOA 2B29A 2QEJC 3VYUA 4A3BB 2WKDA 3RLNA 2F0PA 2HCCA 2EY1A 1IW7D 3MXUA 2Z4IA 1HTLD 5C3EH 1ICWA 4PNYA 5C6AA 3ONAB 3U50C 2Y0SE 1ZEQX 3UDGA 3R2TA 2RCNA 4DV6Q 5FKAC 2RVLA 1Q86C 1CT1D 1X55A 2UUCQ 5CV9A 1CQFA 1IL8A 5IP9G 1WTQA 4PMBA 1QUQB 2N49A 3TZDA 3C2PA 2ENBA 1VQ5A 1KDAA 2FMMA 2K6AA 4QGUA 2KCMA 5AJ3Q 3F2UA 4B3MQ 3PUWA 3F2BA 3HZXA 3MZ5A 2JA9A 3I3CA 3K59A 2CVRA 4DV6L 3GTOH 1PH7A 1YJNA 4K6LA 2Z1CA 2UUCL 3PF4A 1NE3A 1MIUA 2I46A 1CZWA 3J81i 2X69A 1LTBD 1CFMA 1Q12A 3OOCA 2H4OA 4DAYB 1G6PA 4B3ML 3NBHA 2WAQB 1B70B 5C5MA 1KNAA 2LMCB 4L6TB 1PH8A 4DR2Q 4A3KB 1PYWD 1FD7D 1DYQA 4PZ6A 3GP7A 3C46A 1HRJA 5IGFA 2JA6B 3V2TA 2K5WA 3NWSA 5KYLA 5I6YA 3F2DA 5IGEA 2DJFC 4QUCA 1KQSA 5EPJA 1Y1WG 4BBRB 1A2UA 5HY6A 3KF8A 1TWCH 2PQAA 5E7NA 1EUJA 1GUSA 4DR2L 1VDZA 1YIJA 4HTHA 3S2DH 4EQNA 3K7AH 1T9HA 3HOYH 4C3JH 3NBIA 1A62A 1I3QB 3PO3H 3EFXD 1J9OA 1VQNA 4QB4A 4G7ZC 4ZUIA 5C0XH 4XIGS 1S5ED 3I8ZA 4DXGA 4CDFC 2QF7A 4P72A 4X3SA 2B2TC 1VCIA 4WJWA 1GVPA 3BDOA 1JQYD 3X3NA 1A3TA 2EY6A 2NZ1D 4IJLA 3DMUA 3DM1A 2TSSA 4C1NI 4CDDC 1O7LA 1SNMA 2Z6KA 3CP0A 3MA2B 3HGBA 4DR3Q 2L1BA 1X9NA 2RDHA 2R7ZB 1ML0D 5C44G 2VUMH 3VR5A 5JJZA 2F0GA 2EJGC 1EYCA 1PXUA 2MO1A 2F0TA 3J81E 1VMPA 4JVZA 4IUUA 4A3MB 4BWGB 1CK1A 3MVVA 2ALYB 4KN4C
chains in the Genus database with same CATH topology
1HZBA 2VQFQ 3RZDH 5M3FH 2ES2A 3RN5A 1J5EQ 1K8GA 1NMGA 4K0KQ 2R7DA 3I4OA 3HOVH 3HOUH 3I4MH 4IFDJ 5M3MG 2ZJQA 2DUDA 5LMUL 4DV7Q 3TEHB 5C0XI 1XMOL 5IYDG 1S3OA 3J7ZC 3GTJH 4GN5A 4LF4Q 2LXJA 4MTNA 5GROA 4LFAQ 2R7FA 5IY0A 5IWAQ 3M85A 3PSIA 2UUAL 3TS2A 2PI2E 4HJ8A 1CKMA 2K5VA 2ZM6Q 4NPSA 3RZOH 1X3GA 4JV5Q 3HKZG 2QGQA 1CUKA 4GOPA 3NBHB 4H02A 4LUVA 3J81c 4GNXB 3S1MH 2UU9Q 1J5EL 3NELA 3CC4A 4K0KL 4O0AA 1Y1VH 2OTJA 3WWVA 1UWVA 1QZGA 2K5HA 2VQEQ 1YJ9A 4DV7L 5LMNQ 4KHZA 4WJ3M 2VL6A 1NJIC 4LF4L 1JMCA 4LFAL 3S1NH 5JJIA 5IWAL 5JEAJ 3W5OA 2EQSA 1VQ9A 3DLLA 4A3DH 4LUZA 1WCMG 4JYAQ 4KHPQ 5JJLA 2ZM6L 2CKZB 1VQBA 1PHJA 4JV5L 4A75A 3STBD 1FGUA 1VQKA 4B3RQ 3H3VI 4A3LH 4IPGA 2Q2IA 1QVFA 3L7ZC 2UU9L 4RG1A 3PV0A 1BVSA 4DAMA 1KXLA 2Y0SG 1MJCA 3BZCA 2R92H 4Y52H 2JA5H 4FDBA 3GTLH 4DKAC 2DGYA 5FJ8G 5LMNL 4HJ5A 3MEFA 2ASBA 5AJ3L 4HJ7A 1HR0Q 2UXBQ 4GNXA 1PYSB 4DR1Q 2CFMA 4BY7G 3GO5A 1CKNB 1V43A 2JEAI 2R7ZH 4JYAL 4A3FG 1K9MC 1VQCA 2F4VQ 4POFA 4KHPL 3RLFA 2K50A 3PUYA 5IYBG 4GNXC 1GO3E 3HOWG 3UDIA 2VW9A 4B3RL 4YWMA 1UE1A 1PH6A 1M1KC 4NXNQ 3PO2G 1GM5A 1D7QA 1XPRA 1UE5A 2IX1A 3CAMA 2JQOA 4A3GH 1A63A 4JI3Q 2KHIA 4A3BH 3CCSA 5M3MH 3CCUA 3ZJYC 1VQHA 2HQLA 2OCEA 3UDXA 4A3IG 3BU2A 2K4KA 2PI2A 1FL0A 1HR0L 4DR1L 5IYDH 1CSQA 3S1QH 3T1YQ 2Q2UA 2F4VL 1KAWA 5M5XH 3I4NG 5IT9c 1GD7A 4DR7Q 4BBRG 4NB3A 1IZ6A 4LF5Q 2CWAA 4OO1I 1TWGH 3PGZA 3CCQA 1EOVA 3ERSX 4QL5A 2RHSB 1N32L 4NXNL 2R93G 4L5TA 5JJKA 3K0XA 4JI7Q 3ER0A 1ASZA 4AYBG 3E9HA 2LXKA 3PUXA 4A76A 3CMAA 3PIPA 4R4QA 3RNUA 3B6YA 1VQ6A 1XNQQ 4JI4Q 3CCJA 1HNXQ 1ASYA 3T1YL 3G6EA 1M90C 1J6QA 3E0EA 4DR7L 1XJVA 2I5HA 4LF5L 3D31A 1FJGQ 1U5KA 1I94Q 3W1GA 2ZTEA 2N3SA 2I5MX 1VQ8A 1YITA 4JI7L 3JAMi 1NMFA 4GLVB 1S40A 1YVCA 1N33L 3G48A 4GN4B 2E2HH 2FXQA 5C4JH 1U0LA 4IFDG 4A3JG 4OWTB 1YZ6A 5FJ8H 3J81j 4A3CG 4JI4L 1YHQA 3M7NA 1HNXL 4BY7H 2YV5A 1AE2A 4A3FH 1TXYA 1PV4A 5IYBH 3KF6B 4DNIA 5M5YH 3LGJA 1YI2A 1I94L 1FJGL 4DV1L 3HOWH 4C3HH 5LMNW 4LF9Q 1P8LA 2HT1A 2E2JH 2Z6KC 1G51A 3PO2H 3AYHB 1B8AA 1K83H 1SE8A 4JI8Q 3H3VH 3T1HQ 5IP7G 3F8TA 3I55A 4DV0Q 4JI0Q 3SGIA 1KC8C 2WFWA 4DV4Q 1E1TA 2UXCQ 2JA6H 3BJUA 4A3IH 2Q2TA 3U4VA 1L0WA 2ID0A 1VQDA 1YHBA 2BA1A 5GAHC 3ULPA 4NXMQ 1SFOH 3NEMA 1R9TH 2B63G 3I4NH 2F52A 1VQ4A 1HZAA 2K52A 5JEAG 4BBRH 3M4OH 2K14A 2Z0SA 1KD1C 3BZKA 3KLWA 4A3MG 5DLQE 4DR3L 4LF9L 3AFPA 2E5LQ 1E22A 3L0OA 1HR0W 2XTIA 4A93G 2HIVA 2R93H 1WJJA 4JI8L 3T1HL 4DV0L 4JI0L 1QVCA 2B3GA 3FP9A 3KF6A 2VZAA 3Q8DA 4DV4L 2JK8A 2R6GA 3H0GG 2UXCL 4BXXG 1PH1A 4LNQA 2L15A 4APVA 1P16A 4NXML 2ZJPA 2MFIA 3TREA 4IJHA 1I3QH 5GAGC 3EIVA 1IBMQ 1VQGA 3KFUA 1OXXK 1IXRA 1KRSA 1HH2P 4P73A 2A8VA 2WB1G 2VQFL 3IRBA 1AH9A 2E5LL 3M3YH 1OXUA 1E7ZA 1OXVA 4HIDA 2K5NA 4QJFA 1I5FA 4GOPC 2CCZA 1HNWQ 1JJGA 1KRTA 2YYZA 1VQIA 1X56A 1JJCB 2D62A 4JG2A 4DR4Q 4X64Q 1MJEA 3RLOA 4R4CA 4JI2Q 1QVGA 2VS1A 3KOJA 4A3CH 2YTYA 3HKSA 4LF6Q 4YWLA 4JI6Q 1VS0A 4DK3C 4P71A 4LWCA 1PVOA 3DM3A 2IY5B 1IBML 1E1OA 1SMXA 1VQEA 2CWPA 1UEBA 4YY3Q 1N34Q 3S24A 1O7IA 3FKIG 1PH9A 2C35B 1N36Q 1HNWL 1BKBA 1UE7A 5C44H 1EWIA 1BBWA 2VQEL 5IP7H 3HOXG 2MO0A 3PUZA 2UUBQ 4DR4L 4X64L 4JBWA 5BR8Q 3M4QA 3S1RH 1KL9A 4JBMA 4JI2L 5GADC 4OX9Q 2MQHA 4A4IA 3ULLA 4JI6L 1VQJA 4LF8Q 4HIKA 1HNZQ 1S72A 5HGQA 5M5WH 1X6OA 1PH3A 4EX5A 1I6HH 4YY3L 3S2HH 2A1AA 1N34L 4A3MH 4LUOA 3I7FA 1N36L 4IOAA 5ELOA 2EIFA 2VNUD 4ALPA 1PH4A 4BY1G 2UUBL 4YCVA 1A8VA 2UXBL 3H0GH 2F3IA 4BXXH 4PMWA 4TVAB 1W3SA 2JE6I 3K80C 1TWFH 4YCWA 3F1ZA 4LF8L 1JE5A 4XTCS 4POGA 1OXTA 1HNZL 2UXDQ 3K81C 1N8RC 3I56A 1K73C 4LF7Q 3CCRA 4DR5Q 1RIPA 1D8LA 4JBJA 4DK6C 3JAMc 4R4OA 3TS0A 1IL2A 1Q7YC 2AKWB 2V1CC 1H95A 2D0OA 3PUVA 3OYYA 4JI3L 1C0AA 1E3PA 1RL2A 2I0QA 1E24A 1AE3A 4YHHQ 4JC0A 5C0XJ 4WJ4A 2KBNA 4X66Q 1GKHA 5IE8A 4UP9A 3KJOA 4X62Q 1WCMH 4L5RC 2UXDL 4X65Q 1Q8KA 1V9PA 4AQYQ 4LF7L 2E8GA 4DR5L 2AWOA 3STBC 4TQUS 3CCEA 1VQ7A 4EQ5A 3OW2A 2OTLA 1YJWA 4B3TQ 4PZ8A 2KENA 3E9IA 3FKIH 1PFSA 4LW1A 5GQOA 1PH2A 3ICEA 4GKKQ 2NVXH 3HOUG 3W1BA 1WFQA 4HJAA 4LFBQ 4HIOA 2E2IH 3HFZB 4OXPA 5C3EG 1LYLA 4YHHL 1FVIA 3HOXH 1Q1EA 1XNQL 3UE0A 1B7YB 1YHAA 4IPCA 4HIMA 1G291 2QA4A 1WYDA 4GLXA 1QZHA 1XMQQ 3AEVA 5C4XG 4X62L 1X3FA 4QY7A 3RR5A 2WP8J 4X65L 4AQYL 1LM0A 2KCTA 3TQYA 1EQQA 4YWKA 4DUYQ 1VQMA 1YNXA 3K7UC 4R4TA 4B3TL 4GKKL 3A0JA 3G4SA 1K0RA 4LFBL 2D0PA 2IHFA 4DR6Q 4IPHA 4UY8C 4GN3B 2N8NA 3L2PA 2RF4A 2YTXA 3GTGH 3J80i 1Q1BA 1KIXA 4YCUA 1XMQL 1SROA 1K3RA 1VQAA 3K8AA 2PMZE 2ZTDA 1Q46A 1V1QA 2ZTCA 1SLJA 4AH6A 4DUYL 3I2ZA 3U4ZA 3ULJA 4A3EG 4Y7NH 3CF5A 2GN5A 2IX0A 3TRZA 2JA7G 3MXNB 4O2DA 3D0FA 1NBWA 1VQPA 4DR6L 3HKZE 2JA5G 4IPDA 2NN6G 2PNHA 3PIOA 3GTKH 3S16H 4BBSG 1YEZA 3KDFA 1XPOA 1VQLA 4MNOA 1Z9FA 3CCLA 3FHWA 4C3IH 1VQOA 2B29A 4PG3A 5ELNA 1W2BA 2ATWA 1JB7A 3AQQA 1EIYB 1X65A 3RLNA 4DV3Q 4JI5Q 1Q82C 4QIWE 4KLKA 4DV5Q 4A3GG 4IO9A 2K75A 1OXSC 4A3BG 5C3EH 4A3JH 3CPFA 5EAYA 2YU9H 2BH2A 4L5SA 2JEBI 3U50C 2Y0SE 3UDGA 5C4XH 1MKHA 2RCNA 1PA6A 4DV6Q 4PZ7A 1Q86C 4JCVE 2OWOA 3M9BA 4UPAA 1I50H 1X55A 2IT1A 2UUCQ 3GTMH 4DV3L 4JI5L 3GTPH 4BA1I 5H1SE 3PF5A 3HOYG 1C9OA 4DV5L 3CC7A 4GKJQ 5IP9G 1QUQB 4B3SQ 2N49A 2WAQE 3PO3G 1VQ5A 4OWXB 3GDEA 4QGUA 4B3MQ 2KCMA 5AJ3Q 1BBUA 5FLMG 3PUWA 3F2BA 5C0XG 4LF6L 2JA9A 2AHOB 2CQOA 1Q81C 2B63H 4LFCQ 3HOZG 3UE1A 4DV6L 2IHEA 3CCMA 3GTOH 5GAEC 1PH5A 1PH7A 1YJNA 4KI0A 2JA8G 2NZOA 2NZHA 1LUZA 2UUCL 4OONA 3PF4A 1EQRA 1NE3A 4A93H 1KHIA 1MIUA 3KF8B 4GLAC 4A3EH 1DGSA 2N78A 3U58A 2JA7H 3A74A 4GKJL 4MZ9A 2PQAB 3J81i 4B3SL 1Q12A 1X54A 5J3BA 4P75A 2BA0A 3EN2A 5BR8L 1HJPA 4DAYB 1G6PA 4JI1Q 4B3ML 1XPUA 4OX9L 1LTLA 4BBSH 4DUZQ 1B70B 2AMCB 4AYBE 2NVYH 5FLXc 1CKOA 1EIFA 4LFCL 3G71A 1QUQA 1PH8A 4DR2Q 1IYJB 1SRUA 2WAQG 5K36G 4PZ6A 2QEXA 1JJ2A 5IYCG 1N32Q 3GD7A 3CPWA 4IOCA 1WI5A 4A3KG 4IFDI 2OQKA 2VUMG 1PYBA 1C7YA 3F2DA 3M4PA 1N9WA 3JC66 3H15A 1KQSA 1Y1WG 2JA6G 1TWAH 1K8AC 3NENA 4JI1L 1Y14B 3VDYA 1XNRQ 5HY6A 3CCVA 4DUZL 4JOIA 1OTCA 1EFWA 1TWCH 2OQ0A 2PQAA 1EUJA 5E7NA 4X6AH 4DR2L 4L5QA 4R1JA 1YIJA 4JOIC 2HHHQ 3S2DH 5M3FG 3K7AH 3A5ZB 4RMFA 1IBKQ 3KYHC 2RHQB 3CC2A 1CKNA 2NVQH 1L2FA 1T9HA 3CQZH 3HOYH 3HOVG 3I4MG 4C3JH 5IP9H 4UP8A 3OTOQ 1A62A 1N33Q 3PO3H 3J80c 4DV2Q 1VQNA 3CXCA 4QQBX 4X66L 1XNRL 5FLMH 4AIMA 1IBLQ 1X3EA 2JJQA 4XIGS 2BH8A 1NY4A 2XGTA 3HOZH 2KHJA 4P72A 3S17H 2VY3A 2HHHL 4OWWB 1VCIA 3CW2C 1UE6A 2JA8H 2GVBA 1NTGA 1L1OB 4DPGA 1GVPA 4DV1Q 1IBKL 1EYGA 3EBEA 4OO1G 3KDFB 3S15H 2NN6I 1Y1VG 2YTVA 1JT8A 2I5LX 1SN8A 3OTOL 3S14H 4R4IA 4IJLA 4C2MH 4DV2L 3UDFA 4BY1H 4ME3A 3CMEA 3J7A5 1SR3A 2HIXA 4UP7A 4HJ9A 3AFQA 2MNAA 1IBLL 2NVTH 2AWNA 4A3DG 4JBKA 2EXDA 3CD6A 4GS3A 2GVAA 4P74A 1VQFA 4BA2I 1TWHH 2Z6KA 1XTDA 3CP0A 4A3LG 4J15A 4DR3Q 1HZCA 5IYCH 1X9NA 2A19A 4A3KH 1Z47A 2R92G 5C44G 2VUMH 2Q2HA 3A5UA 3GTQH 2MO1A 2WB1E 5LMUQ 3RN2A 2H5XA 1XMOQ 1YBYA 4GOPB 1L1OA 1CSPA 1Y1WH 2R7ZG 1A0IA 2ZJRA 2UUAQ 2LSSA 3KJPA 3PCOB 1HZ9A 1WOCA 1L1OC 2ALYB 3F2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZB A;  2VQF Q;  3RZD H;  5M3F H;  2ES2 A;  3RN5 A;  1J5E Q;  1K8G A;  1NMG A;  4K0K Q;  2R7D A;  3I4O A;  3HOV H;  3HOU H;  3I4M H;  4IFD J;  5M3M G;  2ZJQ A;  2DUD A;  5LMU L;  4DV7 Q;  3TEH B;  5C0X I;  1XMO L;  5IYD G;  1S3O A;  3J7Z C;  3GTJ H;  4GN5 A;  4LF4 Q;  2LXJ A;  4MTN A;  5GRO A;  4LFA Q;  2R7F A;  5IY0 A;  5IWA Q;  3M85 A;  3PSI A;  2UUA L;  3TS2 A;  2PI2 E;  4HJ8 A;  1CKM A;  2K5V A;  2ZM6 Q;  4NPS A;  3RZO H;  1X3G A;  4JV5 Q;  3HKZ G;  2QGQ A;  1CUK A;  4GOP A;  3NBH B;  4H02 A;  4LUV A;  3J81 c;  4GNX B;  3S1M H;  2UU9 Q;  1J5E L;  3NEL A;  3CC4 A;  4K0K L;  4O0A A;  1Y1V H;  2OTJ A;  3WWV A;  1UWV A;  1QZG A;  2K5H A;  2VQE Q;  1YJ9 A;  4DV7 L;  5LMN Q;  4KHZ A;  4WJ3 M;  2VL6 A;  1NJI C;  4LF4 L;  1JMC A;  4LFA L;  3S1N H;  5JJI A;  5IWA L;  5JEA J;  3W5O A;  2EQS A;  1VQ9 A;  3DLL A;  4A3D H;  4LUZ A;  1WCM G;  4JYA Q;  4KHP Q;  5JJL A;  2ZM6 L;  2CKZ B;  1VQB A;  1PHJ A;  4JV5 L;  4A75 A;  3STB D;  1FGU A;  1VQK A;  4B3R Q;  3H3V I;  4A3L H;  4IPG A;  2Q2I A;  1QVF A;  3L7Z C;  2UU9 L;  4RG1 A;  3PV0 A;  1BVS A;  4DAM A;  1KXL A;  2Y0S G;  1MJC A;  3BZC A;  2R92 H;  4Y52 H;  2JA5 H;  4FDB A;  3GTL H;  4DKA C;  2DGY A;  5FJ8 G;  5LMN L;  4HJ5 A;  3MEF A;  2ASB A;  5AJ3 L;  4HJ7 A;  1HR0 Q;  2UXB Q;  4GNX A;  1PYS B;  4DR1 Q;  2CFM A;  4BY7 G;  3GO5 A;  1CKN B;  1V43 A;  2JEA I;  2R7Z H;  4JYA L;  4A3F G;  1K9M C;  1VQC A;  2F4V Q;  4POF A;  4KHP L;  3RLF A;  2K50 A;  3PUY A;  5IYB G;  4GNX C;  1GO3 E;  3HOW G;  3UDI A;  2VW9 A;  4B3R L;  4YWM A;  1UE1 A;  1PH6 A;  1M1K C;  4NXN Q;  3PO2 G;  1GM5 A;  1D7Q A;  1XPR A;  1UE5 A;  2IX1 A;  3CAM A;  2JQO A;  4A3G H;  1A63 A;  4JI3 Q;  2KHI A;  4A3B H;  3CCS A;  5M3M H;  3CCU A;  3ZJY C;  1VQH A;  2HQL A;  2OCE A;  3UDX A;  4A3I G;  3BU2 A;  2K4K A;  2PI2 A;  1FL0 A;  1HR0 L;  4DR1 L;  5IYD H;  1CSQ A;  3S1Q H;  3T1Y Q;  2Q2U A;  2F4V L;  1KAW A;  5M5X H;  3I4N G;  5IT9 c;  1GD7 A;  4DR7 Q;  4BBR G;  4NB3 A;  1IZ6 A;  4LF5 Q;  2CWA A;  4OO1 I;  1TWG H;  3PGZ A;  3CCQ A;  1EOV A;  3ERS X;  4QL5 A;  2RHS B;  1N32 L;  4NXN L;  2R93 G;  4L5T A;  5JJK A;  3K0X A;  4JI7 Q;  3ER0 A;  1ASZ A;  4AYB G;  3E9H A;  2LXK A;  3PUX A;  4A76 A;  3CMA A;  3PIP A;  4R4Q A;  3RNU A;  3B6Y A;  1VQ6 A;  1XNQ Q;  4JI4 Q;  3CCJ A;  1HNX Q;  1ASY A;  3T1Y L;  3G6E A;  1M90 C;  1J6Q A;  3E0E A;  4DR7 L;  1XJV A;  2I5H A;  4LF5 L;  3D31 A;  1FJG Q;  1U5K A;  1I94 Q;  3W1G A;  2ZTE A;  2N3S A;  2I5M X;  1VQ8 A;  1YIT A;  4JI7 L;  3JAM i;  1NMF A;  4GLV B;  1S40 A;  1YVC A;  1N33 L;  3G48 A;  4GN4 B;  2E2H H;  2FXQ A;  5C4J H;  1U0L A;  4IFD G;  4A3J G;  4OWT B;  1YZ6 A;  5FJ8 H;  3J81 j;  4A3C G;  4JI4 L;  1YHQ A;  3M7N A;  1HNX L;  4BY7 H;  2YV5 A;  1AE2 A;  4A3F H;  1TXY A;  1PV4 A;  5IYB H;  3KF6 B;  4DNI A;  5M5Y H;  3LGJ A;  1YI2 A;  1I94 L;  1FJG L;  4DV1 L;  3HOW H;  4C3H H;  5LMN W;  4LF9 Q;  1P8L A;  2HT1 A;  2E2J H;  2Z6K C;  1G51 A;  3PO2 H;  3AYH B;  1B8A A;  1K83 H;  1SE8 A;  4JI8 Q;  3H3V H;  3T1H Q;  5IP7 G;  3F8T A;  3I55 A;  4DV0 Q;  4JI0 Q;  3SGI A;  1KC8 C;  2WFW A;  4DV4 Q;  1E1T A;  2UXC Q;  2JA6 H;  3BJU A;  4A3I H;  2Q2T A;  3U4V A;  1L0W A;  2ID0 A;  1VQD A;  1YHB A;  2BA1 A;  5GAH C;  3ULP A;  4NXM Q;  1SFO H;  3NEM A;  1R9T H;  2B63 G;  3I4N H;  2F52 A;  1VQ4 A;  1HZA A;  2K52 A;  5JEA G;  4BBR H;  3M4O H;  2K14 A;  2Z0S A;  1KD1 C;  3BZK A;  3KLW A;  4A3M G;  5DLQ E;  4DR3 L;  4LF9 L;  3AFP A;  2E5L Q;  1E22 A;  3L0O A;  1HR0 W;  2XTI A;  4A93 G;  2HIV A;  2R93 H;  1WJJ A;  4JI8 L;  3T1H L;  4DV0 L;  4JI0 L;  1QVC A;  2B3G A;  3FP9 A;  3KF6 A;  2VZA A;  3Q8D A;  4DV4 L;  2JK8 A;  2R6G A;  3H0G G;  2UXC L;  4BXX G;  1PH1 A;  4LNQ A;  2L15 A;  4APV A;  1P16 A;  4NXM L;  2ZJP A;  2MFI A;  3TRE A;  4IJH A;  1I3Q H;  5GAG C;  3EIV A;  1IBM Q;  1VQG A;  3KFU A;  1OXX K;  1IXR A;  1KRS A;  1HH2 P;  4P73 A;  2A8V A;  2WB1 G;  2VQF L;  3IRB A;  1AH9 A;  2E5L L;  3M3Y H;  1OXU A;  1E7Z A;  1OXV A;  4HID A;  2K5N A;  4QJF A;  1I5F A;  4GOP C;  2CCZ A;  1HNW Q;  1JJG A;  1KRT A;  2YYZ A;  1VQI A;  1X56 A;  1JJC B;  2D62 A;  4JG2 A;  4DR4 Q;  4X64 Q;  1MJE A;  3RLO A;  4R4C A;  4JI2 Q;  1QVG A;  2VS1 A;  3KOJ A;  4A3C H;  2YTY A;  3HKS A;  4LF6 Q;  4YWL A;  4JI6 Q;  1VS0 A;  4DK3 C;  4P71 A;  4LWC A;  1PVO A;  3DM3 A;  2IY5 B;  1IBM L;  1E1O A;  1SMX A;  1VQE A;  2CWP A;  1UEB A;  4YY3 Q;  1N34 Q;  3S24 A;  1O7I A;  3FKI G;  1PH9 A;  2C35 B;  1N36 Q;  1HNW L;  1BKB A;  1UE7 A;  5C44 H;  1EWI A;  1BBW A;  2VQE L;  5IP7 H;  3HOX G;  2MO0 A;  3PUZ A;  2UUB Q;  4DR4 L;  4X64 L;  4JBW A;  5BR8 Q;  3M4Q A;  3S1R H;  1KL9 A;  4JBM A;  4JI2 L;  5GAD C;  4OX9 Q;  2MQH A;  4A4I A;  3ULL A;  4JI6 L;  1VQJ A;  4LF8 Q;  4HIK A;  1HNZ Q;  1S72 A;  5HGQ A;  5M5W H;  1X6O A;  1PH3 A;  4EX5 A;  1I6H H;  4YY3 L;  3S2H H;  2A1A A;  1N34 L;  4A3M H;  4LUO A;  3I7F A;  1N36 L;  4IOA A;  5ELO A;  2EIF A;  2VNU D;  4ALP A;  1PH4 A;  4BY1 G;  2UUB L;  4YCV A;  1A8V A;  2UXB L;  3H0G H;  2F3I A;  4BXX H;  4PMW A;  4TVA B;  1W3S A;  2JE6 I;  3K80 C;  1TWF H;  4YCW A;  3F1Z A;  4LF8 L;  1JE5 A;  4XTC S;  4POG A;  1OXT A;  1HNZ L;  2UXD Q;  3K81 C;  1N8R C;  3I56 A;  1K73 C;  4LF7 Q;  3CCR A;  4DR5 Q;  1RIP A;  1D8L A;  4JBJ A;  4DK6 C;  3JAM c;  4R4O A;  3TS0 A;  1IL2 A;  1Q7Y C;  2AKW B;  2V1C C;  1H95 A;  2D0O A;  3PUV A;  3OYY A;  4JI3 L;  1C0A A;  1E3P A;  1RL2 A;  2I0Q A;  1E24 A;  1AE3 A;  4YHH Q;  4JC0 A;  5C0X J;  4WJ4 A;  2KBN A;  4X66 Q;  1GKH A;  5IE8 A;  4UP9 A;  3KJO A;  4X62 Q;  1WCM H;  4L5R C;  2UXD L;  4X65 Q;  1Q8K A;  1V9P A;  4AQY Q;  4LF7 L;  2E8G A;  4DR5 L;  2AWO A;  3STB C;  4TQU S;  3CCE A;  1VQ7 A;  4EQ5 A;  3OW2 A;  2OTL A;  1YJW A;  4B3T Q;  4PZ8 A;  2KEN A;  3E9I A;  3FKI H;  1PFS A;  4LW1 A;  5GQO A;  1PH2 A;  3ICE A;  4GKK Q;  2NVX H;  3HOU G;  3W1B A;  1WFQ A;  4HJA A;  4LFB Q;  4HIO A;  2E2I H;  3HFZ B;  4OXP A;  5C3E G;  1LYL A;  4YHH L;  1FVI A;  3HOX H;  1Q1E A;  1XNQ L;  3UE0 A;  1B7Y B;  1YHA A;  4IPC A;  4HIM A;  1G29 1;  2QA4 A;  1WYD A;  4GLX A;  1QZH A;  1XMQ Q;  3AEV A;  5C4X G;  4X62 L;  1X3F A;  4QY7 A;  3RR5 A;  2WP8 J;  4X65 L;  4AQY L;  1LM0 A;  2KCT A;  3TQY A;  1EQQ A;  4YWK A;  4DUY Q;  1VQM A;  1YNX A;  3K7U C;  4R4T A;  4B3T L;  4GKK L;  3A0J A;  3G4S A;  1K0R A;  4LFB L;  2D0P A;  2IHF A;  4DR6 Q;  4IPH A;  4UY8 C;  4GN3 B;  2N8N A;  3L2P A;  2RF4 A;  2YTX A;  3GTG H;  3J80 i;  1Q1B A;  1KIX A;  4YCU A;  1XMQ L;  1SRO A;  1K3R A;  1VQA A;  3K8A A;  2PMZ E;  2ZTD A;  1Q46 A;  1V1Q A;  2ZTC A;  1SLJ A;  4AH6 A;  4DUY L;  3I2Z A;  3U4Z A;  3ULJ A;  4A3E G;  4Y7N H;  3CF5 A;  2GN5 A;  2IX0 A;  3TRZ A;  2JA7 G;  3MXN B;  4O2D A;  3D0F A;  1NBW A;  1VQP A;  4DR6 L;  3HKZ E;  2JA5 G;  4IPD A;  2NN6 G;  2PNH A;  3PIO A;  3GTK H;  3S16 H;  4BBS G;  1YEZ A;  3KDF A;  1XPO A;  1VQL A;  4MNO A;  1Z9F A;  3CCL A;  3FHW A;  4C3I H;  1VQO A;  2B29 A;  4PG3 A;  5ELN A;  1W2B A;  2ATW A;  1JB7 A;  3AQQ A;  1EIY B;  1X65 A;  3RLN A;  4DV3 Q;  4JI5 Q;  1Q82 C;  4QIW E;  4KLK A;  4DV5 Q;  4A3G G;  4IO9 A;  2K75 A;  1OXS C;  4A3B G;  5C3E H;  4A3J H;  3CPF A;  5EAY A;  2YU9 H;  2BH2 A;  4L5S A;  2JEB I;  3U50 C;  2Y0S E;  3UDG A;  5C4X H;  1MKH A;  2RCN A;  1PA6 A;  4DV6 Q;  4PZ7 A;  1Q86 C;  4JCV E;  2OWO A;  3M9B A;  4UPA A;  1I50 H;  1X55 A;  2IT1 A;  2UUC Q;  3GTM H;  4DV3 L;  4JI5 L;  3GTP H;  4BA1 I;  5H1S E;  3PF5 A;  3HOY G;  1C9O A;  4DV5 L;  3CC7 A;  4GKJ Q;  5IP9 G;  1QUQ B;  4B3S Q;  2N49 A;  2WAQ E;  3PO3 G;  1VQ5 A;  4OWX B;  3GDE A;  4QGU A;  4B3M Q;  2KCM A;  5AJ3 Q;  1BBU A;  5FLM G;  3PUW A;  3F2B A;  5C0X G;  4LF6 L;  2JA9 A;  2AHO B;  2CQO A;  1Q81 C;  2B63 H;  4LFC Q;  3HOZ G;  3UE1 A;  4DV6 L;  2IHE A;  3CCM A;  3GTO H;  5GAE C;  1PH5 A;  1PH7 A;  1YJN A;  4KI0 A;  2JA8 G;  2NZO A;  2NZH A;  1LUZ A;  2UUC L;  4OON A;  3PF4 A;  1EQR A;  1NE3 A;  4A93 H;  1KHI A;  1MIU A;  3KF8 B;  4GLA C;  4A3E H;  1DGS A;  2N78 A;  3U58 A;  2JA7 H;  3A74 A;  4GKJ L;  4MZ9 A;  2PQA B;  3J81 i;  4B3S L;  1Q12 A;  1X54 A;  5J3B A;  4P75 A;  2BA0 A;  3EN2 A;  5BR8 L;  1HJP A;  4DAY B;  1G6P A;  4JI1 Q;  4B3M L;  1XPU A;  4OX9 L;  1LTL A;  4BBS H;  4DUZ Q;  1B70 B;  2AMC B;  4AYB E;  2NVY H;  5FLX c;  1CKO A;  1EIF A;  4LFC L;  3G71 A;  1QUQ A;  1PH8 A;  4DR2 Q;  1IYJ B;  1SRU A;  2WAQ G;  5K36 G;  4PZ6 A;  2QEX A;  1JJ2 A;  5IYC G;  1N32 Q;  3GD7 A;  3CPW A;  4IOC A;  1WI5 A;  4A3K G;  4IFD I;  2OQK A;  2VUM G;  1PYB A;  1C7Y A;  3F2D A;  3M4P A;  1N9W A;  3JC6 6;  3H15 A;  1KQS A;  1Y1W G;  2JA6 G;  1TWA H;  1K8A C;  3NEN A;  4JI1 L;  1Y14 B;  3VDY A;  1XNR Q;  5HY6 A;  3CCV A;  4DUZ L;  4JOI A;  1OTC A;  1EFW A;  1TWC H;  2OQ0 A;  2PQA A;  1EUJ A;  5E7N A;  4X6A H;  4DR2 L;  4L5Q A;  4R1J A;  1YIJ A;  4JOI C;  2HHH Q;  3S2D H;  5M3F G;  3K7A H;  3A5Z B;  4RMF A;  1IBK Q;  3KYH C;  2RHQ B;  3CC2 A;  1CKN A;  2NVQ H;  1L2F A;  1T9H A;  3CQZ H;  3HOY H;  3HOV G;  3I4M G;  4C3J H;  5IP9 H;  4UP8 A;  3OTO Q;  1A62 A;  1N33 Q;  3PO3 H;  3J80 c;  4DV2 Q;  1VQN A;  3CXC A;  4QQB X;  4X66 L;  1XNR L;  5FLM H;  4AIM A;  1IBL Q;  1X3E A;  2JJQ A;  4XIG S;  2BH8 A;  1NY4 A;  2XGT A;  3HOZ H;  2KHJ A;  4P72 A;  3S17 H;  2VY3 A;  2HHH L;  4OWW B;  1VCI A;  3CW2 C;  1UE6 A;  2JA8 H;  2GVB A;  1NTG A;  1L1O B;  4DPG A;  1GVP A;  4DV1 Q;  1IBK L;  1EYG A;  3EBE A;  4OO1 G;  3KDF B;  3S15 H;  2NN6 I;  1Y1V G;  2YTV A;  1JT8 A;  2I5L X;  1SN8 A;  3OTO L;  3S14 H;  4R4I A;  4IJL A;  4C2M H;  4DV2 L;  3UDF A;  4BY1 H;  4ME3 A;  3CME A;  3J7A 5;  1SR3 A;  2HIX A;  4UP7 A;  4HJ9 A;  3AFQ A;  2MNA A;  1IBL L;  2NVT H;  2AWN A;  4A3D G;  4JBK A;  2EXD A;  3CD6 A;  4GS3 A;  2GVA A;  4P74 A;  1VQF A;  4BA2 I;  1TWH H;  2Z6K A;  1XTD A;  3CP0 A;  4A3L G;  4J15 A;  4DR3 Q;  1HZC A;  5IYC H;  1X9N A;  2A19 A;  4A3K H;  1Z47 A;  2R92 G;  5C44 G;  2VUM H;  2Q2H A;  3A5U A;  3GTQ H;  2MO1 A;  2WB1 E;  5LMU Q;  3RN2 A;  2H5X A;  1XMO Q;  1YBY A;  4GOP B;  1L1O A;  1CSP A;  1Y1W H;  2R7Z G;  1A0I A;  2ZJR A;  2UUA Q;  2LSS A;  3KJP A;  3PCO B;  1HZ9 A;  1WOC A;  1L1O C;  2ALY B;  3F2C A; 
#chains in the Genus database with same CATH topology
 3RZD H;  5M3F H;  2PMZ B;  1NMG A;  4K0K Q;  3PMF A;  3S1Q B;  4IFD J;  4KK7 A;  2DUD A;  2PW5 A;  5C0X I;  2BE5 C;  3H6M A;  1S3O A;  3J7Z C;  4LFA Q;  2R7F A;  4DF7 A;  2PI2 E;  3L9A X;  4BS9 A;  3RZO H;  3HKZ G;  2QGQ A;  1CTM A;  1CUK A;  2PCF B;  3TZU A;  4GOP A;  5BN3 A;  3J81 c;  2DY7 A;  1SNP A;  3S1M H;  4K0K L;  3A55 A;  1EY7 A;  5KND A;  2OTJ A;  1QZG A;  4QIW B;  1DOK A;  4WJ3 M;  2NB0 A;  4G7O C;  4F7X A;  4LFA L;  4JYA Q;  1DZ1 A;  2EQS A;  2WKC A;  3CHB D;  4QUF A;  4A3D H;  4I7A A;  3STB D;  4B3R Q;  3H3V I;  2PYK A;  4A3L H;  2B2Y C;  4RG1 A;  1KXL A;  2Y0S G;  4V19 0;  4DKA C;  2DGY A;  2ASB A;  3DHQ A;  5CV4 A;  4CKE A;  3HOW B;  1G6Z A;  1WD1 A;  1K9M C;  2F4V Q;  4JYA L;  2EYL A;  4KKT A;  3UDI A;  2VW9 A;  4QCL A;  4B3R L;  4YWM A;  1PH6 A;  2F4I A;  2IX1 A;  2K1B A;  3X3M A;  1Y69 U;  1QIL A;  2A69 D;  3LWE A;  5M3M H;  2XVS A;  1IW7 C;  3N52 A;  4A3I G;  2PI2 A;  3R8B A;  3D3R A;  2O2L D;  5TSS A;  2F4V L;  1KAW A;  1MI2 A;  1GD7 A;  4KY7 A;  3MXG A;  4NB3 A;  4AYB B;  1K8M A;  2KCN A;  3PGZ A;  1EOV A;  4QL5 A;  5JJK A;  3GTK B;  3K0X A;  2B2U C;  1ASZ A;  1D5Z C;  3E9H A;  2LXK A;  3CMA A;  4R4Q A;  3GQB A;  1EQV A;  2EJF C;  1M90 C;  3E0E A;  5FO9 B;  1U5K A;  1EL0 A;  3TN2 A;  1EIH A;  5K5P A;  1SYD A;  1YIT A;  2YU9 B;  1NMF A;  3A8I E;  4GLV B;  2B2V C;  4GN4 B;  2E2H H;  4IUV A;  5C4X B;  5A2Q L;  5FJ8 H;  5IGG A;  5F2D A;  1IYV A;  5E4W C;  1YHQ A;  3M7N A;  4BY7 H;  1GJX A;  1S5C D;  4N8F A;  2PZW A;  1STE A;  1TXY A;  3KF6 B;  5M5Y H;  4DV1 L;  4CJ1 B;  5A2Q E;  1P8L A;  2E2J H;  1G51 A;  1SE8 A;  5IP7 G;  2A6E D;  2LKV A;  4DV0 Q;  4JI0 Q;  1GHJ A;  1JR0 D;  4UDU C;  3VYR A;  3BJU A;  1LTI D;  1BNZ A;  1YHB A;  2BA1 A;  5GAH C;  2O5J C;  2B63 G;  1R9T H;  1EY0 A;  3I4N H;  4ZAI A;  4NMZ A;  2F52 A;  1L0Y B;  2K52 A;  1DOM A;  1F9R A;  4HMJ A;  5JEA G;  3M4O H;  2Z0S A;  1KD1 C;  3IFD A;  1GUG A;  5DLQ E;  3TP8 A;  2R93 H;  2HIV A;  2EYH A;  4DV0 L;  4JI0 L;  4KJN A;  3Q8D A;  3H0G G;  4ZKC B;  1ET9 A;  5I2Y A;  5I6W A;  1RTO A;  4LNQ A;  2WB1 B;  2MFI A;  3TRE A;  1Q90 A;  1PMR A;  1S5B D;  2RBM A;  5COY A;  3A8J E;  1ET6 A;  1BF4 A;  4U67 3;  4EQP A;  1IXR A;  4XYQ A;  3KUP A;  4Z9C B;  2L11 A;  3IRB A;  3M3Y H;  3A8K E;  1DD2 A;  3VR4 A;  3K5M A;  1KRT A;  1TY2 A;  1X56 A;  3MC0 B;  4X64 Q;  1PTO F;  5I9O A;  1MJE A;  4X3U A;  2QCP X;  3NPP A;  1MSG A;  3KOJ A;  1H9R A;  4A3C H;  1PRT D;  3HKS A;  5EQ0 A;  4YWL A;  1VS0 A;  2N55 A;  3DM3 A;  3CQZ B;  4ZKB B;  4KKU A;  5CBE E;  2CWP A;  1UEB A;  1SSO A;  1N34 Q;  1KDC A;  1O7I A;  1SBB B;  5EKI A;  5A35 A;  3OPO A;  5C44 H;  1BBW A;  3OW7 A;  1HHV A;  2UUB Q;  4X64 L;  5BR8 Q;  3S17 B;  1KL9 A;  4JBM A;  5KIX A;  4OX9 Q;  1X3P A;  4ZYS A;  2MQH A;  4A4I A;  1H9S A;  1VQJ A;  3S15 B;  1S72 A;  5M5W H;  1H9J A;  4EX5 A;  1I6H H;  2A1A A;  1N34 L;  1PRT B;  3NUC A;  1FR3 A;  4LUO A;  2M00 A;  3K0Y A;  2KVM A;  1EYA A;  4BY1 G;  2UUB L;  2UXB L;  4X3T A;  2SNM A;  3C1F A;  1E0B A;  2JE6 I;  3F1Z A;  3LNN A;  3R2I A;  1OXT A;  5DEH A;  3I56 A;  3CCR A;  1H9K A;  1H95 A;  2D0O A;  1Y1W B;  3OYY A;  3NXW A;  1E24 A;  1EU4 A;  1KAB A;  2D2C C;  4YHH Q;  1K3B C;  4WJ4 A;  1LTR D;  2KBN A;  3J7A V;  5IE8 A;  2FIN B;  2E74 C;  1V9P A;  1JCK B;  5I4D A;  3Q23 A;  3STB C;  2XNA C;  1VQ7 A;  3HS0 C;  1YJW A;  4PZ8 A;  4HSV A;  3FKI H;  2NVX H;  1SNO A;  5C3E G;  4YHH L;  1FVI A;  1XNQ L;  3UE0 A;  4CDE C;  3W2D A;  4MN3 A;  1LLR D;  4GLX A;  3IFT A;  1TT2 A;  2DNE A;  2WP8 J;  2KCT A;  5D14 A;  1EQQ A;  1YNX A;  4R4T A;  3G4S A;  3BDL A;  4RWS C;  2IHF A;  2J4X A;  4GN3 B;  2N8N A;  2A69 C;  3PIP 3;  3FRP B;  4IN3 A;  3DXJ C;  3R3O A;  3CRK C;  3J80 i;  1IYU A;  3QO2 A;  4YCU A;  1SRO A;  1VQA A;  4G4K A;  2JA7 B;  3KLS X;  1SLJ A;  4ZRZ A;  3TSS A;  1B2T A;  3I2Z A;  3ULJ A;  2GN5 A;  3HEJ A;  3KLS A;  5CMD A;  4XYO A;  4IPD A;  4G7H C;  1Y8P B;  2MHV A;  2Q8T A;  5IGB A;  1BCP C;  1YEZ A;  1AEX A;  1HPC A;  1VQL A;  4C3I H;  4A3G B;  5ELN A;  1JB7 A;  1PFM A;  5E3F A;  1X65 A;  4JI5 Q;  5AFW A;  1O7Y A;  3WOE A;  5M5X B;  5FLX L;  1XWE A;  5EAY A;  1A3V A;  1TWG B;  3HKZ B;  3MXN A;  4IUP A;  2NVQ B;  1PA6 A;  3CRL C;  2F3W A;  4JCV E;  1I50 H;  1HCZ A;  1UNS A;  3CKI B;  4JI5 L;  3SVM A;  3HOY G;  5H1S E;  1B1Z A;  4S3S A;  4C3J G;  1B4O A;  3PO3 G;  3HOZ B;  2A6E C;  4OWX B;  3GDE A;  4WRD A;  1SYB A;  1QG7 A;  2H1E A;  1F9S A;  5C0X G;  4LF6 L;  2FJ2 A;  2CQO A;  2B63 H;  1EU3 A;  3T13 A;  3UE1 A;  1JWU D;  5JEA H;  1PH5 A;  4KI0 A;  2Y0S B;  2NZH A;  4C2M B;  5C4J B;  1KHI A;  3KF8 B;  4GLA C;  4A3E H;  3J80 L;  1XX8 A;  3A74 A;  4EQO A;  4MZ9 A;  2PQA B;  1MGS A;  2NVT B;  1LTT D;  1X54 A;  4PV1 C;  3SK8 A;  1NNX A;  2L9H A;  3EN2 A;  2MUY A;  2NN6 H;  1HJP A;  1TWH B;  4K2K A;  5IGC A;  4DUZ Q;  2AMC B;  5FLX c;  2NVY H;  4C3H B;  1EIF A;  3G71 A;  4OIK A;  3J80 E;  5LHY 1;  1K83 B;  3NSW A;  1ENA A;  1N32 Q;  4A3I B;  3GD7 A;  2VUM G;  2WIN B;  1C7Y A;  1N9W A;  2E76 C;  1QNU A;  1RDP D;  1QE6 A;  1TS5 A;  3U9O A;  1QWY A;  1K8A C;  3NEN A;  1W6J A;  1Y14 B;  4ILW A;  2A74 C;  3CCV A;  4DUZ L;  1OTC A;  1EFW A;  3I4M B;  1ZYR D;  1RCV D;  1V1P A;  5M3F G;  3FPU B;  2Z6B A;  4H7B A;  1CKN A;  1L2F A;  3BYY B;  4UP8 A;  3OTO Q;  3J80 c;  4DV2 Q;  2EY5 A;  4QQB X;  4X66 L;  2HD3 A;  1QCB D;  1T5X D;  3BG3 A;  5FLM H;  4N9T A;  2JJQ A;  5E4X A;  1YNN D;  2XGT A;  1O7Z A;  1Y1V B;  3CW2 C;  2GVB A;  1NTG A;  1TQO A;  3KDF B;  2NN6 I;  1JT8 A;  2I5L X;  1SN8 A;  3I70 A;  3OTO L;  3S14 H;  4DV2 L;  4BY1 H;  2KQ3 A;  2HIX A;  4UP7 A;  2K01 A;  4A3D G;  2EXD A;  3QJY A;  2HDM A;  5E1F A;  5NUC A;  1VQF A;  1TU2 B;  4BA2 I;  5IOD A;  4A3L G;  5IYC H;  2A19 A;  5ELC A;  4A3K H;  3CU7 A;  3MHB A;  1CQV A;  3GTQ H;  1KLU D;  3BVG A;  1XMO Q;  1ENC A;  3K5L A;  4L63 B;  4GOP B;  1CSP A;  2VB2 X;  2KJX A;  5JVG 3;  1RD9 D;  2EYO A;  3S2H B;  1BBX C;  3F2C A;  1QNK A;  2MPM A;  1EWC A;  1Z6H A;  2ES2 A;  3RN5 A;  3BYT B;  1J5E Q;  1EY5 A;  5M3M G;  1TWF B;  4DV7 Q;  1PZK D;  3TEH B;  1XMO L;  4LF4 Q;  5GRO A;  2KCC A;  5IY0 A;  1B3Q A;  1JWS D;  4HJ8 A;  2G9D A;  2K5V A;  3ND8 A;  1UEA B;  3NQI A;  2ZM6 Q;  2ZXP A;  1HXY D;  1H9M A;  3RUZ A;  2UU9 Q;  2JP1 A;  1J5E L;  4JK1 C;  3CC4 A;  1Q8I A;  3WWV A;  1YJ9 A;  1WCM B;  4DV7 L;  3DEO A;  5LMN Q;  2VL6 A;  4RKL A;  2ICE C;  3PIO 3;  4LF4 L;  1JMC A;  3W5O A;  1VQ9 A;  2RSO A;  1L0X B;  3I72 A;  2ZM6 L;  2CKZ B;  4C1N K;  4K8I A;  1ICF B;  5CBA E;  2F0W A;  3AMU A;  3DWA A;  3L7Z C;  4JW0 A;  2UU9 L;  2EYP A;  2XWJ B;  2OXP A;  4LK1 C;  5IT9 E;  1PTO H;  1DM0 B;  1MJC A;  4XQJ A;  2R92 H;  4Y52 H;  1F9P A;  4FDB A;  5JOB A;  5J22 A;  3GTL H;  4HJ5 A;  5FJ8 G;  3M7G A;  5LMN L;  3MEF A;  2C9O A;  5AJ3 L;  3MFG A;  1SND A;  4CGY B;  4HJ7 A;  1PYS B;  4BY7 G;  3GO5 A;  2R7Z H;  1FYC A;  1TS2 A;  1SNC A;  2RKS A;  2K50 A;  2C5C A;  3VYS A;  1M1K C;  4UAI A;  1GM5 A;  1XPR A;  4RFB A;  1SAP A;  3CAM A;  2BDN A;  5C3W A;  3UDX A;  1UUP A;  5IYD H;  1CSQ A;  3S1Q H;  4HN7 A;  1LT6 D;  3I4N G;  4CBV A;  5IT9 c;  4Y7N B;  1IZ6 A;  4LF5 Q;  4KN7 C;  4NKL A;  2RHS B;  2R93 G;  1I4X A;  3S16 B;  5C4H A;  4A76 A;  3QG1 A;  4HMI A;  3PIP A;  3GV6 A;  3B6Y A;  2F0F A;  1AW7 A;  1DJR D;  1SE2 A;  2CHB D;  1WTX A;  2LY7 A;  5DAU A;  1ILQ A;  1HNX Q;  3I91 A;  2RCF A;  1YNJ D;  1KLG D;  4RGT A;  2I5H A;  5L37 A;  4LF5 L;  4FP5 D;  1FJG Q;  1I94 Q;  3W1G A;  4PMC A;  1JIC A;  2OF1 A;  2ZTE A;  1STG A;  1LAC A;  5C3E B;  1VQ8 A;  2ZXR A;  1EOT A;  5COR A;  1S40 A;  1YVC A;  2FXQ A;  1U0L A;  4A3J G;  4OWT B;  1YZ6 A;  3J81 j;  3MFY A;  2NTS A;  4A3C G;  3OMC A;  1HNX L;  2EY2 A;  1NSN S;  4A3F H;  5EKL A;  3J81 L;  1EIG A;  1U4L A;  1PV4 A;  1FJG L;  4DNI A;  1I94 L;  1YI2 A;  3HOW H;  5LMN W;  1MSH A;  1LAB A;  2NUC A;  2HT1 A;  1W6K A;  2EDG A;  2Z6K C;  3PO2 H;  3ND9 A;  1B8A A;  1SE4 A;  4RHS A;  3H3V H;  3F8T A;  2JYO A;  1KC8 C;  3SK4 A;  3GTO B;  2Q2T A;  2OT2 A;  3URY A;  4NXM Q;  1E2V A;  5KEE A;  1CHP D;  2P5Z X;  2K14 A;  3A7L A;  1CZG A;  5KGU A;  1ZYR C;  3Q0A A;  4DR3 L;  2E5L Q;  3L0O A;  4A93 G;  4P2C B;  4G57 A;  1NAP A;  3BZD B;  1LT4 D;  2F0H A;  5FO8 B;  3SK6 A;  2K04 A;  2L15 A;  1TII D;  4APV A;  1EY8 A;  1P16 A;  4NXM L;  2ZJP A;  4IJH A;  1IBM Q;  1YNN C;  4FVM A;  2E5L L;  2RSN A;  1OXU A;  1OXV A;  4HID A;  4Q0F A;  2ZT9 C;  4GOP C;  1H9S B;  2YYZ A;  1TWC B;  2D62 A;  3IKJ A;  5LL6 S;  2F0L A;  4RCN A;  2O4X A;  1BDO A;  4R4C A;  1QVG A;  4RH6 A;  4M8A A;  2YTY A;  3K7A B;  5HUR A;  1BXT A;  4P71 A;  3HOY B;  1IBM L;  2IPK D;  2AUK A;  3Q24 A;  4KTA A;  3MEH A;  1II3 A;  3HOX B;  4YIJ A;  3FKI G;  4XQQ A;  1BKB A;  1UE7 A;  4JBW A;  4K5W A;  3M4Q A;  1LTG D;  2BCO A;  2JSO A;  2B8F A;  4DA2 A;  3ULL A;  1PH3 A;  2KHS A;  3GTG B;  2QDL A;  2WAC A;  5ELO A;  2VNU D;  1PH4 A;  2WII B;  1A3U A;  1A8V A;  4BXX H;  3D6W A;  3BVM A;  4RCO A;  4TSS A;  4LF7 Q;  1CHQ D;  1K73 C;  1D8L A;  4DK6 C;  1STH A;  1Q7Y C;  3EVQ A;  2KEC A;  3PUV A;  1E3P A;  5EPL A;  4XT3 B;  4R8N A;  3PQI A;  5ELB A;  1BCP D;  1Y8O B;  4K5V A;  5D3I B;  4UP9 A;  2EE1 A;  1C8C A;  1SMY D;  4NDX A;  4LJZ C;  2V4D A;  1GOZ A;  4C3I G;  2D5D A;  2IL8 A;  4EGV A;  4X65 Q;  4LF7 L;  2EOT A;  4DAY A;  2OTL A;  4GKK Q;  2WV6 D;  1PFS A;  3HOU G;  3W1B A;  4HJA A;  4HIO A;  5EKK A;  1U9R A;  2E2I H;  3RZO B;  1RHP A;  1YHA A;  4HIM A;  2K5D A;  3AEV A;  1WYD A;  3FPP A;  3GTM B;  3GTP B;  3GV3 A;  3TP5 A;  4ZCK A;  3S1M B;  3RR5 A;  4X65 L;  1BCP B;  1LM0 A;  4IUR A;  2BDO A;  4LAA A;  4GKK L;  1HQM C;  1K0R A;  2A6H D;  3K57 A;  1G2T A;  2A73 B;  3UI2 A;  3DWQ A;  3K8A A;  2PMZ E;  1WTO A;  1EY9 A;  1Q46 A;  1JOK A;  4AH6 A;  3U4Z A;  5EBD A;  2PZU A;  3I4L A;  4A3E G;  3TRZ A;  3CF5 A;  4HSP A;  4BBS B;  2EYM A;  3MXN B;  1NBW A;  4B9X A;  2JA5 G;  2NN6 G;  1EY4 A;  1TY0 A;  2FHT A;  3PIO A;  3H91 A;  2K7V A;  1ENF A;  1XYI A;  4MNO A;  1Z9F A;  1YNJ C;  4PQX A;  1S5F D;  1W2B A;  4PG3 A;  2ATW A;  1JOQ A;  2XSC A;  5M3M B;  1EIY B;  1LTS D;  1EZ6 A;  1TWA B;  5I2X A;  4QIW E;  4DV5 Q;  5IGD A;  2K75 A;  4A3B G;  1PZJ D;  1U4M A;  4A3J H;  5CYU A;  5T1G A;  3NTK A;  4GZY C;  4L5S A;  1PTO C;  2JEB I;  4K8J A;  4PZ7 A;  2OWO A;  3M9B A;  4BA1 I;  3PF5 A;  1C9O A;  4DV5 L;  4ZK9 B;  5HGT A;  4MTK A;  5KNC A;  3IL8 A;  2RDF A;  5FLM G;  5FO7 B;  2CQA A;  2AHO B;  1ILP A;  1QOH A;  2NZO A;  1LUZ A;  2E2H B;  2F0N A;  4OON A;  4A93 H;  1DGS A;  3U58 A;  4XXE A;  2JA7 H;  4BY7 B;  5J39 A;  1EFI D;  5J3B A;  5BR8 L;  3TP7 A;  4FF1 A;  4OX9 L;  1LTL A;  4AYB E;  1F2L A;  2E2J B;  2WAQ G;  1JJ2 A;  5IYC G;  4DNR B;  1WI5 A;  4A3K G;  1IHZ A;  4L8J A;  1PYB A;  1R9T B;  3M4P A;  3I4N B;  3JC6 6;  3H15 A;  2JA6 G;  3M4O B;  3VDY A;  1XNR Q;  1B9M A;  3DUZ A;  3A7A B;  2TMP A;  4TKO B;  4X6A H;  2OQ0 A;  3A5Z B;  2NVQ H;  2E2D C;  2K28 A;  1N33 Q;  3CXC A;  2MJ8 A;  1JC7 A;  1XNR L;  2L5T A;  3H3V C;  1IBL Q;  3M3Y B;  3HOZ H;  1NY4 A;  2KHJ A;  5CR3 A;  2EVB A;  3A54 A;  3P7J A;  2VY3 A;  3NE5 B;  3I73 A;  2JA8 H;  1UE6 A;  3BVZ A;  3EBE A;  3K5O A;  4OHJ A;  2YTV A;  4R4I A;  4C2M H;  3CME A;  2QW7 A;  1RF2 D;  3AFQ A;  2MNA A;  1IBL L;  2NVT H;  2AWN A;  2CH4 W;  2K33 A;  4GS3 A;  2GVA A;  1TWH H;  5C44 B;  5K36 H;  1PDQ A;  1SYE A;  5G3L F;  1EZ8 A;  1HZC A;  2AQ1 B;  1FGB D;  4HCE A;  2R92 G;  2IW3 A;  1AFP A;  1KTK A;  2WB1 E;  3RN2 A;  3VA7 A;  1L1O A;  5M5W B;  1S5D D;  2R7Z G;  1A0I A;  2ZJR A;  2UUA Q;  2LSS A;  3KJP A;  2A68 D;  3PCO B;  5EBC A;  1L1O C;  1SMY C;  3DEP A;  4KHV A;  2VQF Q;  4I7Z C;  1VMC A;  1K8G A;  2R7D A;  3I4O A;  3HOV H;  3HOU H;  3I4M H;  4KKS A;  3V96 A;  1EQT A;  3FEW X;  4FXG C;  2F0J A;  1T5E A;  1D5X C;  5IYD G;  3EQL C;  3GTJ H;  1STN A;  4GN5 A;  2LXJ A;  4MTN A;  2UUA L;  1M4V A;  5IWA Q;  3M85 A;  3PSI A;  2AUJ D;  5FK9 C;  4C56 C;  3QOL A;  4H44 C;  5KYI A;  1X3G A;  4JV5 Q;  3C3L A;  3NBH B;  2M9V A;  4H02 A;  4LUV A;  2HDL A;  3NEL A;  4OO1 H;  1PFB A;  1G8Z D;  1Y1V H;  2A6H C;  1UWV A;  2HCI A;  2K5H A;  4K14 A;  2VQE Q;  2F0Q A;  4KHZ A;  2KED A;  1NJI C;  1D1I A;  1GUW A;  3EJI A;  3S1N H;  5JJI A;  3QIA A;  5JEA J;  5IWA L;  5JAV A;  4LUZ A;  5JJL A;  3FKI B;  1LTA D;  4JV5 L;  2NVX B;  4XT1 B;  2VXW A;  1VQK A;  4IPG A;  2Q2I A;  3PV0 A;  4DNT B;  1BVS A;  2LS0 1;  4DAM A;  1BUV T;  2JA5 H;  4GNX A;  2KA7 A;  4CJ0 B;  4A3F G;  3RLF A;  4FO2 A;  3VR3 A;  1F2Y A;  3PUY A;  1JOR A;  4GNX C;  1GO3 E;  4FF4 A;  3HOW G;  1HFG A;  4NXN Q;  3PO2 G;  3QR8 A;  1JWM D;  4WFN 3;  4JI3 Q;  1SFO B;  2KHI A;  2PO4 A;  3G7L A;  4A3B H;  3CCS A;  3CCU A;  1VQH A;  2HQL A;  2OCE A;  2SDF A;  2FFK B;  3BU2 A;  2J7Z A;  1FL0 A;  3D4W A;  2Q2U A;  4B08 A;  4DR7 Q;  3BS1 A;  1BR9 A;  2F0D A;  2CWA A;  2KUM A;  3ERQ A;  3CCQ A;  4OO1 I;  1LV9 A;  3ERS X;  1N32 L;  4NXN L;  3ER0 A;  4AYB G;  1WTW A;  2F03 A;  1I4H A;  1VQ6 A;  1B50 A;  1HTP A;  3CCJ A;  1ROD A;  3Q6S A;  1PRT F;  2CW0 C;  1DON A;  4FNF A;  1SYC A;  4DR7 L;  1J6Q A;  4R8I A;  1C48 A;  2I5M X;  1D5M C;  3N6R A;  2K03 A;  2L0C A;  4IFD G;  3VA5 A;  3T4A C;  3T51 B;  1VF5 C;  4DFA A;  5IYB H;  4H0L C;  3LGJ A;  4FXK C;  4FF3 A;  3S1R B;  1KNE A;  3NTI A;  4E6I A;  2B63 B;  3SGI A;  2WFW A;  1ZKO A;  4DV4 Q;  2K32 A;  2UXC Q;  2JA6 H;  1F2M A;  1L0W A;  3E0J A;  2QKI C;  3SDZ A;  1BQQ T;  1VQ4 A;  2B8G A;  4BBR H;  4ZLT F;  3OHX C;  3BZK A;  1IKL A;  1MD2 D;  2D9U A;  3KLW A;  1E22 A;  3H0G B;  1Y8N B;  2DY8 A;  1WJJ A;  1UAP A;  1QVC A;  2B3G A;  4UHV A;  2VZA A;  4DV4 L;  2JK8 A;  2UXC L;  4BXX G;  1I3Q H;  2XIW A;  3QOJ A;  2M2L A;  4K5X A;  3EIV A;  1OXX K;  1KRS A;  1Q3L A;  3SXH A;  2WB1 G;  4FYD A;  3G6J B;  5EGT A;  2BOS A;  2EXZ A;  1E7Z A;  4ZQ3 A;  1I6V C;  4QJF A;  1I5F A;  2CCZ A;  1CA5 A;  3BDC A;  1VQI A;  2MP1 A;  1JJC B;  4JG2 A;  4DR4 Q;  5IT9 L;  3RLO A;  4IQZ A;  2QIL A;  2VS1 A;  1D1K A;  2X6G A;  5JPM C;  1WVL A;  2EPB A;  3M4Y A;  3LWU A;  1R4P B;  3OWF A;  4JI6 Q;  1PVO A;  2IY5 B;  4DN4 M;  4RAU C;  3SE0 A;  3ZYY X;  4IUQ A;  4RA8 A;  4HAE A;  3T56 B;  1DXM A;  4ID6 A;  3S24 A;  1PH9 A;  5EPK A;  1EWI A;  3L3O C;  3K5N A;  3HP3 A;  3A56 A;  4K2L A;  2LFN A;  4O1N A;  4DR4 L;  2Q8I B;  3HG9 A;  4JI6 L;  4LF8 Q;  4X3K A;  2A68 C;  1HNZ Q;  2HUG A;  5HGQ A;  1X6O A;  4LMQ D;  3S14 B;  4A3M H;  4BY1 B;  1HA6 A;  3E3X A;  3FDT A;  5T1I A;  1EWH A;  1V8Q A;  2EIF A;  5DNF A;  2HQE A;  2F0E A;  2OEO A;  4ALP A;  3ERO A;  4DXF A;  2G9H D;  1NUC A;  4LF8 L;  1JB3 A;  1JE5 A;  4POG A;  1HNZ L;  2F0K A;  3K81 C;  1N8R C;  2QDB A;  4H13 C;  4DU9 A;  4F8M A;  1AZP A;  1SE3 A;  3GTQ B;  4JBJ A;  4R4O A;  1X3Q A;  2F3V A;  2V1C C;  1OO9 B;  5FOB B;  2I0Q A;  5C0X J;  1GKH A;  3RD4 A;  3KJO A;  4X62 Q;  4L5R C;  1LT3 D;  4AQY Q;  1Q8K A;  4KY6 A;  3QWN A;  4OGQ C;  3CCE A;  3OW2 A;  4B3T Q;  3V05 A;  3E9I A;  4LW1 A;  5GQO A;  4ZUJ A;  1NCV A;  3HFZ B;  4OXP A;  3HOX H;  1LYL A;  2EJM A;  1Q1E A;  1F2Z A;  1PTO D;  4IPC A;  2R61 A;  3WDN A;  4DAV A;  1KAA A;  5CV7 A;  1XMQ Q;  2B2T A;  4X62 L;  4AQY L;  4MHE A;  3T53 B;  4HED A;  2PQE A;  1VQM A;  1DCZ A;  1TVX A;  3VR6 A;  4B3T L;  3A0J A;  4IPH A;  3O13 A;  4UY8 C;  3L2P A;  2YTX A;  3GTG H;  1ESF A;  1STA A;  4NW2 A;  2NWG A;  4J6H A;  1XMQ L;  4KMU C;  2ZTD A;  1V1Q A;  1PTO B;  2R92 B;  1SYF A;  4OIJ A;  3GTL B;  1TS3 A;  2JA7 G;  4XDX A;  1K8O A;  5ELE A;  1M8A A;  4V0B A;  1VQP A;  3SHL A;  3K6O A;  1HA5 A;  1V1O A;  3GTK H;  1FNW A;  2EZV A;  1VF7 A;  3C1E A;  3KDF A;  3CCL A;  3FHW A;  1SYG A;  3AQQ A;  4DV3 Q;  4CJ2 C;  5CC4 A;  1Q82 C;  4KLK A;  4A3G G;  4IO9 A;  1OXS C;  3I90 A;  4RHR A;  5KNB A;  1G91 A;  4IFD H;  1SNQ A;  2NTT A;  3CPF A;  4MIU A;  2DJG C;  3S2D B;  2YU9 H;  2BH2 A;  4XQN A;  1TKW B;  5C4X H;  1MKH A;  3LX0 A;  1WTP A;  3NK9 A;  4C3J B;  2XRS D;  2R3Z A;  3VR2 A;  3IAY A;  3PO3 B;  4UPA A;  2IT1 A;  2SNS A;  4DV3 L;  3GTM H;  3GTP H;  3CC7 A;  4F87 A;  4GKJ Q;  1TR5 A;  2L55 A;  4B3S Q;  2WAQ E;  2K5Q A;  5IIF A;  1BBU A;  2PW7 A;  2JN4 A;  3HOZ G;  1Q81 C;  4LFC Q;  2IHE A;  3CCM A;  5GAE C;  2B2Y A;  1NR4 A;  4RGN A;  2JA8 G;  1EQR A;  4DGZ A;  1EY6 A;  2N78 A;  4GKJ L;  3NTH A;  4B3S L;  3W3A A;  4A3F B;  4P75 A;  2BA0 A;  4JI1 Q;  1XPU A;  4BBS H;  1CKO A;  2EYJ A;  4LFC L;  1QUQ A;  3PO2 B;  1QB5 D;  2VUM B;  1IYJ B;  1SRU A;  5K36 G;  2QEX A;  4HR7 B;  4C3H G;  4ULL A;  3OSO A;  5G3L D;  2L12 A;  3CPW A;  4IOC A;  4IFD I;  1SJE D;  2OQK A;  2EYF A;  3NQT A;  1O78 A;  2PNR C;  2F0I A;  1R4Q B;  1TWA H;  4JI1 L;  3NHH A;  3RZD B;  5M3F B;  4JOI A;  4WOR A;  3OMG A;  1I4Q A;  4L5Q A;  4R1J A;  1STB A;  4JOI C;  2HHH Q;  2B2U A;  1BO0 A;  4RMF A;  1IBK Q;  3KYH C;  2RHQ B;  3CC2 A;  2MGS A;  2PZT A;  3CQZ H;  4EVO A;  3HOV G;  3I4M G;  1K0S A;  5IP9 H;  4CKB A;  3U9S A;  3SEB A;  2AQ3 B;  1QJO A;  2NYZ D;  2KEE A;  3RMH A;  4AIM A;  1A2T A;  1X3E A;  4N8X 1;  2BH8 A;  3S17 H;  2HHH L;  2RA4 A;  4OWW B;  3TME A;  3MWY W;  2B2V A;  4DV1 Q;  1L1O B;  4DPG A;  1IBK L;  1EYG A;  1MHW C;  3WOF A;  4OO1 G;  3S15 H;  1Y1V G;  1SJH D;  1RKN A;  1SDF A;  5C4Z A;  3T16 A;  4A3D B;  3P1H A;  1I4R A;  3UDF A;  4ME3 A;  1CM9 A;  3J7A 5;  1SR3 A;  3E6Z X;  4HJ9 A;  2XN9 C;  3D6C A;  1WTR A;  4JBK A;  3P75 A;  4P74 A;  2IWH A;  4F88 A;  5D65 A;  4IZ8 A;  3H09 A;  1XTD A;  2J0T D;  4J15 A;  1NR2 A;  5LL6 X;  4ABN A;  3MTS A;  1Z47 A;  1B3A A;  4O42 A;  1PZI D;  2Q2H A;  3A5U A;  5DM6 3;  2RQX A;  5LMU Q;  2H5X A;  1D6E C;  1YBY A;  1Y1W H;  1PLF A;  4J1M A;  2F1M A;  1Z7T A;  1HZ9 A;  1WOC A;  1U4R A;  3CD6 A;  4DK1 A;  1GUN A;  1WD0 A;  1HZB A;  1AP0 A;  1BOS A;  2A5H A;  2Z8L A;  4IUN A;  2ZJQ A;  5LMU L;  3MXP A;  3TS2 A;  3KBG A;  2NBF A;  1I4G A;  1GXD C;  4Q5V A;  3K58 A;  1CKM A;  4NPS A;  1HUM A;  1D2B A;  4IUT A;  4GNX B;  2JXM B;  5EJW A;  3TP6 A;  1J8I A;  4O0A A;  2AQ2 B;  3AU7 A;  2CW0 D;  4M1U B;  4KY5 A;  4JPB W;  4KHP Q;  3DLL A;  1WCM G;  3P20 A;  1VQB A;  3E5S A;  4HCS A;  1PHJ A;  4A75 A;  1FGU A;  2E2I B;  4OEL B;  2F0O A;  1QVF A;  5D3D A;  3BZC A;  2Z4H A;  2RDG A;  1V1P B;  4N9P A;  4ME5 A;  1HR0 Q;  2UXB Q;  4DR1 Q;  5M5Y B;  2CFM A;  1F9Q A;  1CKN B;  1V43 A;  2JEA I;  1VQC A;  4KHP L;  4POF A;  3EA6 A;  5IYB G;  5CGK A;  1UE1 A;  1D7Q A;  1UE5 A;  2JQO A;  4A3G H;  2ZXO A;  1A63 A;  2F0V A;  3ZJY C;  2DN8 A;  5ELD A;  1GUO A;  3TBI B;  2K4K A;  1HR0 L;  4DR1 L;  3AB9 A;  3T1Y Q;  1WTV A;  5M5X H;  2R93 B;  2XWB B;  1JE4 A;  4BBR G;  1KDB A;  1TWG H;  4TRD A;  1SEB D;  2B2W A;  4KJO A;  5JPN C;  4L5T A;  4JI7 Q;  5CV8 A;  2B2W C;  3PUX A;  2K05 A;  2DNC A;  4DK0 A;  1GHK A;  3RNU A;  1XNQ Q;  4JI4 Q;  3D4R A;  1ASY A;  3T1Y L;  3G6E A;  1XJV A;  1DOL A;  2GA4 B;  3D31 A;  4ODG A;  2N3S A;  1JOO A;  3KK7 A;  3QB3 A;  4A3J B;  4JI7 L;  1HFN A;  3JAM i;  1N33 L;  3G48 A;  1ZXT A;  5C4J H;  2CH4 A;  3OIP A;  4NP5 A;  2SOB A;  1PFN A;  5DM7 3;  4JI4 L;  2YV5 A;  2L4N A;  1AE2 A;  5C3X A;  5BN5 A;  3OWE B;  4KD4 A;  4C3H H;  4LF9 Q;  4CHT B;  2O5I C;  3DWP A;  5KRU A;  3AYH B;  4JI8 Q;  1K83 H;  3D8G A;  3T1H Q;  1WTH A;  3I55 A;  1EEI D;  2G5D A;  5J1Z A;  1LT5 D;  1E1T A;  4A3I H;  3U4V A;  2ID0 A;  1VQD A;  1I6H B;  3ULP A;  1AN8 A;  1SFO H;  3NEM A;  4A93 B;  4RGM A;  1HZA A;  5I9P A;  5JVH 3;  4A3M G;  5ELF A;  4LF9 L;  3AFP A;  4DAP A;  1HR0 W;  2XTI A;  4QMG A;  4JI8 L;  3T1H L;  1RJT A;  1A6X A;  3FP9 A;  1TS4 A;  3KF6 A;  2R6G A;  1BCP F;  3HRZ C;  1PH1 A;  2IX3 A;  1ESR A;  1I4P A;  2IJ0 A;  2Q8R E;  3NWT A;  5GAG C;  1VQG A;  1B53 A;  1E2Z A;  3KFU A;  1HH2 P;  4P73 A;  2A8V A;  2VQF L;  1AH9 A;  4I65 A;  3FVQ A;  1LO5 D;  1RTN A;  2K5N A;  2SEB D;  4IAL A;  1HNW Q;  1JJG A;  4CDC C;  3Q22 A;  1O80 A;  4JI2 Q;  3SR1 A;  2F0M A;  3J7A F;  4LF6 Q;  1A15 A;  4DK3 C;  4FXD A;  4LWC A;  1E1O A;  3JAM L;  1SMX A;  1VQE A;  4J8Q A;  4YY3 Q;  2ICI A;  5FLX E;  2C35 B;  1N36 Q;  3R93 A;  1FNU A;  1HNW L;  2VQE L;  5IP7 H;  1SXT A;  3HOX G;  2MO0 A;  3PUZ A;  1K28 A;  4R9W A;  3JAM E;  3S1R H;  4JI2 L;  5GAD C;  3SK5 A;  5CV6 A;  2JA8 B;  1C4Q A;  3MAQ A;  2X6L A;  4B9W A;  4HIK A;  2VB3 X;  4K6D A;  5M9O A;  1U4P A;  4YY3 L;  3S2H H;  1FNV A;  3NP8 A;  1G2S A;  1HQR D;  3I7F A;  1N36 L;  1CA6 A;  4IOA A;  1F77 A;  4QF4 A;  4YCV A;  3H0G H;  2F3I A;  4PMW A;  4TVA B;  1W3S A;  3H94 A;  1IKM A;  3K80 C;  5ISR A;  1TWF H;  4YCW A;  4XTC S;  1E2W A;  2UXD Q;  3VYT A;  1STY A;  4DR5 Q;  1RIP A;  3JAM c;  1IL2 A;  3TS0 A;  2B39 A;  2AKW B;  4KV6 A;  4JI3 L;  1C0A A;  1RL2 A;  1AE3 A;  2PPB C;  2Z9H A;  3FMC A;  4JC0 A;  4C3I B;  4KD3 A;  1B9N A;  4X66 Q;  1WCM H;  5C5L A;  1PRT C;  2UXD L;  1EEF D;  3HOV B;  3HOU B;  2KOL A;  2E8G A;  4DR5 L;  2AWO A;  4TQU S;  4EQ5 A;  2F0U A;  2KEN A;  3GTJ B;  3ICE A;  1PH2 A;  4LFB Q;  1WFQ A;  2FMC A;  4RGO S;  2BE5 D;  4OL7 A;  1B7Y B;  1G29 1;  1GUT A;  1I50 B;  3S9W A;  2QA4 A;  1QZH A;  5C4X G;  3D4D A;  1X3F A;  4QY7 A;  3KLR A;  1B44 D;  3TQY A;  4YWK A;  4DUY Q;  4RKB A;  3K7U C;  1S4Z A;  1HUN A;  4LFB L;  3OIQ A;  1EYD A;  5CV5 A;  2D0P A;  3S1N B;  1CI3 M;  5IOC A;  4DR6 Q;  4CKC A;  2RF4 A;  4OEM B;  1XTC D;  2E75 C;  3KBX A;  1AZQ A;  1Q1B A;  1KIX A;  4U68 A;  4A3E B;  1K3R A;  2I07 B;  3ITP A;  2ZTC A;  1X32 A;  4DUY L;  4FF2 A;  2JA5 B;  1MBY A;  5BN4 A;  3TDQ A;  4Y7N H;  2IX0 A;  4O2D A;  3D0F A;  1XXG A;  2NVY B;  3J7Y W;  1ONL A;  4DR6 L;  3HKZ E;  2PNH A;  2XRQ D;  3S16 H;  4BBS G;  2F0S A;  2N88 A;  1XPO A;  1VQO A;  2B29 A;  2QEJ C;  3VYU A;  4A3B B;  2WKD A;  3RLN A;  2F0P A;  2HCC A;  2EY1 A;  1IW7 D;  3MXU A;  2Z4I A;  1HTL D;  5C3E H;  1ICW A;  4PNY A;  5C6A A;  3ONA B;  3U50 C;  2Y0S E;  1ZEQ X;  3UDG A;  3R2T A;  2RCN A;  4DV6 Q;  5FKA C;  2RVL A;  1Q86 C;  1CT1 D;  1X55 A;  2UUC Q;  5CV9 A;  1CQF A;  1IL8 A;  5IP9 G;  1WTQ A;  4PMB A;  1QUQ B;  2N49 A;  3TZD A;  3C2P A;  2ENB A;  1VQ5 A;  1KDA A;  2FMM A;  2K6A A;  4QGU A;  2KCM A;  5AJ3 Q;  3F2U A;  4B3M Q;  3PUW A;  3F2B A;  3HZX A;  3MZ5 A;  2JA9 A;  3I3C A;  3K59 A;  2CVR A;  4DV6 L;  3GTO H;  1PH7 A;  1YJN A;  4K6L A;  2Z1C A;  2UUC L;  3PF4 A;  1NE3 A;  1MIU A;  2I46 A;  1CZW A;  3J81 i;  2X69 A;  1LTB D;  1CFM A;  1Q12 A;  3OOC A;  2H4O A;  4DAY B;  1G6P A;  4B3M L;  3NBH A;  2WAQ B;  1B70 B;  5C5M A;  1KNA A;  2LMC B;  4L6T B;  1PH8 A;  4DR2 Q;  4A3K B;  1PYW D;  1FD7 D;  1DYQ A;  4PZ6 A;  3GP7 A;  3C46 A;  1HRJ A;  5IGF A;  2JA6 B;  3V2T A;  2K5W A;  3NWS A;  5KYL A;  5I6Y A;  3F2D A;  5IGE A;  2DJF C;  4QUC A;  1KQS A;  5EPJ A;  1Y1W G;  4BBR B;  1A2U A;  5HY6 A;  3KF8 A;  1TWC H;  2PQA A;  5E7N A;  1EUJ A;  1GUS A;  4DR2 L;  1VDZ A;  1YIJ A;  4HTH A;  3S2D H;  4EQN A;  3K7A H;  1T9H A;  3HOY H;  4C3J H;  3NBI A;  1A62 A;  1I3Q B;  3PO3 H;  3EFX D;  1J9O A;  1VQN A;  4QB4 A;  4G7Z C;  4ZUI A;  5C0X H;  4XIG S;  1S5E D;  3I8Z A;  4DXG A;  4CDF C;  2QF7 A;  4P72 A;  4X3S A;  2B2T C;  1VCI A;  4WJW A;  1GVP A;  3BDO A;  1JQY D;  3X3N A;  1A3T A;  2EY6 A;  2NZ1 D;  4IJL A;  3DMU A;  3DM1 A;  2TSS A;  4C1N I;  4CDD C;  1O7L A;  1SNM A;  2Z6K A;  3CP0 A;  3MA2 B;  3HGB A;  4DR3 Q;  2L1B A;  1X9N A;  2RDH A;  2R7Z B;  1ML0 D;  5C44 G;  2VUM H;  3VR5 A;  5JJZ A;  2F0G A;  2EJG C;  1EYC A;  1PXU A;  2MO1 A;  2F0T A;  3J81 E;  1VMP A;  4JVZ A;  4IUU A;  4A3M B;  4BWG B;  1CK1 A;  3MVV A;  2ALY B;  4KN4 C; 
#chains in the Genus database with same CATH homology
 1HZB A;  2VQF Q;  3RZD H;  5M3F H;  2ES2 A;  3RN5 A;  1J5E Q;  1K8G A;  1NMG A;  4K0K Q;  2R7D A;  3I4O A;  3HOV H;  3HOU H;  3I4M H;  4IFD J;  5M3M G;  2ZJQ A;  2DUD A;  5LMU L;  4DV7 Q;  3TEH B;  5C0X I;  1XMO L;  5IYD G;  1S3O A;  3J7Z C;  3GTJ H;  4GN5 A;  4LF4 Q;  2LXJ A;  4MTN A;  5GRO A;  4LFA Q;  2R7F A;  5IY0 A;  5IWA Q;  3M85 A;  3PSI A;  2UUA L;  3TS2 A;  2PI2 E;  4HJ8 A;  1CKM A;  2K5V A;  2ZM6 Q;  4NPS A;  3RZO H;  1X3G A;  4JV5 Q;  3HKZ G;  2QGQ A;  1CUK A;  4GOP A;  3NBH B;  4H02 A;  4LUV A;  3J81 c;  4GNX B;  3S1M H;  2UU9 Q;  1J5E L;  3NEL A;  3CC4 A;  4K0K L;  4O0A A;  1Y1V H;  2OTJ A;  3WWV A;  1UWV A;  1QZG A;  2K5H A;  2VQE Q;  1YJ9 A;  4DV7 L;  5LMN Q;  4KHZ A;  4WJ3 M;  2VL6 A;  1NJI C;  4LF4 L;  1JMC A;  4LFA L;  3S1N H;  5JJI A;  5IWA L;  5JEA J;  3W5O A;  2EQS A;  1VQ9 A;  3DLL A;  4A3D H;  4LUZ A;  1WCM G;  4JYA Q;  4KHP Q;  5JJL A;  2ZM6 L;  2CKZ B;  1VQB A;  1PHJ A;  4JV5 L;  4A75 A;  3STB D;  1FGU A;  1VQK A;  4B3R Q;  3H3V I;  4A3L H;  4IPG A;  2Q2I A;  1QVF A;  3L7Z C;  2UU9 L;  4RG1 A;  3PV0 A;  1BVS A;  4DAM A;  1KXL A;  2Y0S G;  1MJC A;  3BZC A;  2R92 H;  4Y52 H;  2JA5 H;  4FDB A;  3GTL H;  4DKA C;  2DGY A;  5FJ8 G;  5LMN L;  4HJ5 A;  3MEF A;  2ASB A;  5AJ3 L;  4HJ7 A;  1HR0 Q;  2UXB Q;  4GNX A;  1PYS B;  4DR1 Q;  2CFM A;  4BY7 G;  3GO5 A;  1CKN B;  1V43 A;  2JEA I;  2R7Z H;  4JYA L;  4A3F G;  1K9M C;  1VQC A;  2F4V Q;  4POF A;  4KHP L;  3RLF A;  2K50 A;  3PUY A;  5IYB G;  4GNX C;  1GO3 E;  3HOW G;  3UDI A;  2VW9 A;  4B3R L;  4YWM A;  1UE1 A;  1PH6 A;  1M1K C;  4NXN Q;  3PO2 G;  1GM5 A;  1D7Q A;  1XPR A;  1UE5 A;  2IX1 A;  3CAM A;  2JQO A;  4A3G H;  1A63 A;  4JI3 Q;  2KHI A;  4A3B H;  3CCS A;  5M3M H;  3CCU A;  3ZJY C;  1VQH A;  2HQL A;  2OCE A;  3UDX A;  4A3I G;  3BU2 A;  2K4K A;  2PI2 A;  1FL0 A;  1HR0 L;  4DR1 L;  5IYD H;  1CSQ A;  3S1Q H;  3T1Y Q;  2Q2U A;  2F4V L;  1KAW A;  5M5X H;  3I4N G;  5IT9 c;  1GD7 A;  4DR7 Q;  4BBR G;  4NB3 A;  1IZ6 A;  4LF5 Q;  2CWA A;  4OO1 I;  1TWG H;  3PGZ A;  3CCQ A;  1EOV A;  3ERS X;  4QL5 A;  2RHS B;  1N32 L;  4NXN L;  2R93 G;  4L5T A;  5JJK A;  3K0X A;  4JI7 Q;  3ER0 A;  1ASZ A;  4AYB G;  3E9H A;  2LXK A;  3PUX A;  4A76 A;  3CMA A;  3PIP A;  4R4Q A;  3RNU A;  3B6Y A;  1VQ6 A;  1XNQ Q;  4JI4 Q;  3CCJ A;  1HNX Q;  1ASY A;  3T1Y L;  3G6E A;  1M90 C;  1J6Q A;  3E0E A;  4DR7 L;  1XJV A;  2I5H A;  4LF5 L;  3D31 A;  1FJG Q;  1U5K A;  1I94 Q;  3W1G A;  2ZTE A;  2N3S A;  2I5M X;  1VQ8 A;  1YIT A;  4JI7 L;  3JAM i;  1NMF A;  4GLV B;  1S40 A;  1YVC A;  1N33 L;  3G48 A;  4GN4 B;  2E2H H;  2FXQ A;  5C4J H;  1U0L A;  4IFD G;  4A3J G;  4OWT B;  1YZ6 A;  5FJ8 H;  3J81 j;  4A3C G;  4JI4 L;  1YHQ A;  3M7N A;  1HNX L;  4BY7 H;  2YV5 A;  1AE2 A;  4A3F H;  1TXY A;  1PV4 A;  5IYB H;  3KF6 B;  4DNI A;  5M5Y H;  3LGJ A;  1YI2 A;  1I94 L;  1FJG L;  4DV1 L;  3HOW H;  4C3H H;  5LMN W;  4LF9 Q;  1P8L A;  2HT1 A;  2E2J H;  2Z6K C;  1G51 A;  3PO2 H;  3AYH B;  1B8A A;  1K83 H;  1SE8 A;  4JI8 Q;  3H3V H;  3T1H Q;  5IP7 G;  3F8T A;  3I55 A;  4DV0 Q;  4JI0 Q;  3SGI A;  1KC8 C;  2WFW A;  4DV4 Q;  1E1T A;  2UXC Q;  2JA6 H;  3BJU A;  4A3I H;  2Q2T A;  3U4V A;  1L0W A;  2ID0 A;  1VQD A;  1YHB A;  2BA1 A;  5GAH C;  3ULP A;  4NXM Q;  1SFO H;  3NEM A;  1R9T H;  2B63 G;  3I4N H;  2F52 A;  1VQ4 A;  1HZA A;  2K52 A;  5JEA G;  4BBR H;  3M4O H;  2K14 A;  2Z0S A;  1KD1 C;  3BZK A;  3KLW A;  4A3M G;  5DLQ E;  4DR3 L;  4LF9 L;  3AFP A;  2E5L Q;  1E22 A;  3L0O A;  1HR0 W;  2XTI A;  4A93 G;  2HIV A;  2R93 H;  1WJJ A;  4JI8 L;  3T1H L;  4DV0 L;  4JI0 L;  1QVC A;  2B3G A;  3FP9 A;  3KF6 A;  2VZA A;  3Q8D A;  4DV4 L;  2JK8 A;  2R6G A;  3H0G G;  2UXC L;  4BXX G;  1PH1 A;  4LNQ A;  2L15 A;  4APV A;  1P16 A;  4NXM L;  2ZJP A;  2MFI A;  3TRE A;  4IJH A;  1I3Q H;  5GAG C;  3EIV A;  1IBM Q;  1VQG A;  3KFU A;  1OXX K;  1IXR A;  1KRS A;  1HH2 P;  4P73 A;  2A8V A;  2WB1 G;  2VQF L;  3IRB A;  1AH9 A;  2E5L L;  3M3Y H;  1OXU A;  1E7Z A;  1OXV A;  4HID A;  2K5N A;  4QJF A;  1I5F A;  4GOP C;  2CCZ A;  1HNW Q;  1JJG A;  1KRT A;  2YYZ A;  1VQI A;  1X56 A;  1JJC B;  2D62 A;  4JG2 A;  4DR4 Q;  4X64 Q;  1MJE A;  3RLO A;  4R4C A;  4JI2 Q;  1QVG A;  2VS1 A;  3KOJ A;  4A3C H;  2YTY A;  3HKS A;  4LF6 Q;  4YWL A;  4JI6 Q;  1VS0 A;  4DK3 C;  4P71 A;  4LWC A;  1PVO A;  3DM3 A;  2IY5 B;  1IBM L;  1E1O A;  1SMX A;  1VQE A;  2CWP A;  1UEB A;  4YY3 Q;  1N34 Q;  3S24 A;  1O7I A;  3FKI G;  1PH9 A;  2C35 B;  1N36 Q;  1HNW L;  1BKB A;  1UE7 A;  5C44 H;  1EWI A;  1BBW A;  2VQE L;  5IP7 H;  3HOX G;  2MO0 A;  3PUZ A;  2UUB Q;  4DR4 L;  4X64 L;  4JBW A;  5BR8 Q;  3M4Q A;  3S1R H;  1KL9 A;  4JBM A;  4JI2 L;  5GAD C;  4OX9 Q;  2MQH A;  4A4I A;  3ULL A;  4JI6 L;  1VQJ A;  4LF8 Q;  4HIK A;  1HNZ Q;  1S72 A;  5HGQ A;  5M5W H;  1X6O A;  1PH3 A;  4EX5 A;  1I6H H;  4YY3 L;  3S2H H;  2A1A A;  1N34 L;  4A3M H;  4LUO A;  3I7F A;  1N36 L;  4IOA A;  5ELO A;  2EIF A;  2VNU D;  4ALP A;  1PH4 A;  4BY1 G;  2UUB L;  4YCV A;  1A8V A;  2UXB L;  3H0G H;  2F3I A;  4BXX H;  4PMW A;  4TVA B;  1W3S A;  2JE6 I;  3K80 C;  1TWF H;  4YCW A;  3F1Z A;  4LF8 L;  1JE5 A;  4XTC S;  4POG A;  1OXT A;  1HNZ L;  2UXD Q;  3K81 C;  1N8R C;  3I56 A;  1K73 C;  4LF7 Q;  3CCR A;  4DR5 Q;  1RIP A;  1D8L A;  4JBJ A;  4DK6 C;  3JAM c;  4R4O A;  3TS0 A;  1IL2 A;  1Q7Y C;  2AKW B;  2V1C C;  1H95 A;  2D0O A;  3PUV A;  3OYY A;  4JI3 L;  1C0A A;  1E3P A;  1RL2 A;  2I0Q A;  1E24 A;  1AE3 A;  4YHH Q;  4JC0 A;  5C0X J;  4WJ4 A;  2KBN A;  4X66 Q;  1GKH A;  5IE8 A;  4UP9 A;  3KJO A;  4X62 Q;  1WCM H;  4L5R C;  2UXD L;  4X65 Q;  1Q8K A;  1V9P A;  4AQY Q;  4LF7 L;  2E8G A;  4DR5 L;  2AWO A;  3STB C;  4TQU S;  3CCE A;  1VQ7 A;  4EQ5 A;  3OW2 A;  2OTL A;  1YJW A;  4B3T Q;  4PZ8 A;  2KEN A;  3E9I A;  3FKI H;  1PFS A;  4LW1 A;  5GQO A;  1PH2 A;  3ICE A;  4GKK Q;  2NVX H;  3HOU G;  3W1B A;  1WFQ A;  4HJA A;  4LFB Q;  4HIO A;  2E2I H;  3HFZ B;  4OXP A;  5C3E G;  1LYL A;  4YHH L;  1FVI A;  3HOX H;  1Q1E A;  1XNQ L;  3UE0 A;  1B7Y B;  1YHA A;  4IPC A;  4HIM A;  1G29 1;  2QA4 A;  1WYD A;  4GLX A;  1QZH A;  1XMQ Q;  3AEV A;  5C4X G;  4X62 L;  1X3F A;  4QY7 A;  3RR5 A;  2WP8 J;  4X65 L;  4AQY L;  1LM0 A;  2KCT A;  3TQY A;  1EQQ A;  4YWK A;  4DUY Q;  1VQM A;  1YNX A;  3K7U C;  4R4T A;  4B3T L;  4GKK L;  3A0J A;  3G4S A;  1K0R A;  4LFB L;  2D0P A;  2IHF A;  4DR6 Q;  4IPH A;  4UY8 C;  4GN3 B;  2N8N A;  3L2P A;  2RF4 A;  2YTX A;  3GTG H;  3J80 i;  1Q1B A;  1KIX A;  4YCU A;  1XMQ L;  1SRO A;  1K3R A;  1VQA A;  3K8A A;  2PMZ E;  2ZTD A;  1Q46 A;  1V1Q A;  2ZTC A;  1SLJ A;  4AH6 A;  4DUY L;  3I2Z A;  3U4Z A;  3ULJ A;  4A3E G;  4Y7N H;  3CF5 A;  2GN5 A;  2IX0 A;  3TRZ A;  2JA7 G;  3MXN B;  4O2D A;  3D0F A;  1NBW A;  1VQP A;  4DR6 L;  3HKZ E;  2JA5 G;  4IPD A;  2NN6 G;  2PNH A;  3PIO A;  3GTK H;  3S16 H;  4BBS G;  1YEZ A;  3KDF A;  1XPO A;  1VQL A;  4MNO A;  1Z9F A;  3CCL A;  3FHW A;  4C3I H;  1VQO A;  2B29 A;  4PG3 A;  5ELN A;  1W2B A;  2ATW A;  1JB7 A;  3AQQ A;  1EIY B;  1X65 A;  3RLN A;  4DV3 Q;  4JI5 Q;  1Q82 C;  4QIW E;  4KLK A;  4DV5 Q;  4A3G G;  4IO9 A;  2K75 A;  1OXS C;  4A3B G;  5C3E H;  4A3J H;  3CPF A;  5EAY A;  2YU9 H;  2BH2 A;  4L5S A;  2JEB I;  3U50 C;  2Y0S E;  3UDG A;  5C4X H;  1MKH A;  2RCN A;  1PA6 A;  4DV6 Q;  4PZ7 A;  1Q86 C;  4JCV E;  2OWO A;  3M9B A;  4UPA A;  1I50 H;  1X55 A;  2IT1 A;  2UUC Q;  3GTM H;  4DV3 L;  4JI5 L;  3GTP H;  4BA1 I;  5H1S E;  3PF5 A;  3HOY G;  1C9O A;  4DV5 L;  3CC7 A;  4GKJ Q;  5IP9 G;  1QUQ B;  4B3S Q;  2N49 A;  2WAQ E;  3PO3 G;  1VQ5 A;  4OWX B;  3GDE A;  4QGU A;  4B3M Q;  2KCM A;  5AJ3 Q;  1BBU A;  5FLM G;  3PUW A;  3F2B A;  5C0X G;  4LF6 L;  2JA9 A;  2AHO B;  2CQO A;  1Q81 C;  2B63 H;  4LFC Q;  3HOZ G;  3UE1 A;  4DV6 L;  2IHE A;  3CCM A;  3GTO H;  5GAE C;  1PH5 A;  1PH7 A;  1YJN A;  4KI0 A;  2JA8 G;  2NZO A;  2NZH A;  1LUZ A;  2UUC L;  4OON A;  3PF4 A;  1EQR A;  1NE3 A;  4A93 H;  1KHI A;  1MIU A;  3KF8 B;  4GLA C;  4A3E H;  1DGS A;  2N78 A;  3U58 A;  2JA7 H;  3A74 A;  4GKJ L;  4MZ9 A;  2PQA B;  3J81 i;  4B3S L;  1Q12 A;  1X54 A;  5J3B A;  4P75 A;  2BA0 A;  3EN2 A;  5BR8 L;  1HJP A;  4DAY B;  1G6P A;  4JI1 Q;  4B3M L;  1XPU A;  4OX9 L;  1LTL A;  4BBS H;  4DUZ Q;  1B70 B;  2AMC B;  4AYB E;  2NVY H;  5FLX c;  1CKO A;  1EIF A;  4LFC L;  3G71 A;  1QUQ A;  1PH8 A;  4DR2 Q;  1IYJ B;  1SRU A;  2WAQ G;  5K36 G;  4PZ6 A;  2QEX A;  1JJ2 A;  5IYC G;  1N32 Q;  3GD7 A;  3CPW A;  4IOC A;  1WI5 A;  4A3K G;  4IFD I;  2OQK A;  2VUM G;  1PYB A;  1C7Y A;  3F2D A;  3M4P A;  1N9W A;  3JC6 6;  3H15 A;  1KQS A;  1Y1W G;  2JA6 G;  1TWA H;  1K8A C;  3NEN A;  4JI1 L;  1Y14 B;  3VDY A;  1XNR Q;  5HY6 A;  3CCV A;  4DUZ L;  4JOI A;  1OTC A;  1EFW A;  1TWC H;  2OQ0 A;  2PQA A;  1EUJ A;  5E7N A;  4X6A H;  4DR2 L;  4L5Q A;  4R1J A;  1YIJ A;  4JOI C;  2HHH Q;  3S2D H;  5M3F G;  3K7A H;  3A5Z B;  4RMF A;  1IBK Q;  3KYH C;  2RHQ B;  3CC2 A;  1CKN A;  2NVQ H;  1L2F A;  1T9H A;  3CQZ H;  3HOY H;  3HOV G;  3I4M G;  4C3J H;  5IP9 H;  4UP8 A;  3OTO Q;  1A62 A;  1N33 Q;  3PO3 H;  3J80 c;  4DV2 Q;  1VQN A;  3CXC A;  4QQB X;  4X66 L;  1XNR L;  5FLM H;  4AIM A;  1IBL Q;  1X3E A;  2JJQ A;  4XIG S;  2BH8 A;  1NY4 A;  2XGT A;  3HOZ H;  2KHJ A;  4P72 A;  3S17 H;  2VY3 A;  2HHH L;  4OWW B;  1VCI A;  3CW2 C;  1UE6 A;  2JA8 H;  2GVB A;  1NTG A;  1L1O B;  4DPG A;  1GVP A;  4DV1 Q;  1IBK L;  1EYG A;  3EBE A;  4OO1 G;  3KDF B;  3S15 H;  2NN6 I;  1Y1V G;  2YTV A;  1JT8 A;  2I5L X;  1SN8 A;  3OTO L;  3S14 H;  4R4I A;  4IJL A;  4C2M H;  4DV2 L;  3UDF A;  4BY1 H;  4ME3 A;  3CME A;  3J7A 5;  1SR3 A;  2HIX A;  4UP7 A;  4HJ9 A;  3AFQ A;  2MNA A;  1IBL L;  2NVT H;  2AWN A;  4A3D G;  4JBK A;  2EXD A;  3CD6 A;  4GS3 A;  2GVA A;  4P74 A;  1VQF A;  4BA2 I;  1TWH H;  2Z6K A;  1XTD A;  3CP0 A;  4A3L G;  4J15 A;  4DR3 Q;  1HZC A;  5IYC H;  1X9N A;  2A19 A;  4A3K H;  1Z47 A;  2R92 G;  5C44 G;  2VUM H;  2Q2H A;  3A5U A;  3GTQ H;  2MO1 A;  2WB1 E;  5LMU Q;  3RN2 A;  2H5X A;  1XMO Q;  1YBY A;  4GOP B;  1L1O A;  1CSP A;  1Y1W H;  2R7Z G;  1A0I A;  2ZJR A;  2UUA Q;  2LSS A;  3KJP A;  3PCO B;  1HZ9 A;  1WOC A;  1L1O C;  2ALY B;  3F2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...