1TQOA

Cryogenic crystal structure of staphylococcal nuclease variant truncated delta+phs i92e
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
131
structure length
131
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray and thermodynamic studies of staphylococcal nuclease variants I92E and I92K: insights into polarity of the protein interior
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 39
structure length 131
sequence length 131
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1tqoA00
1IHZA 2LKVA 3SK4A 2F3VA 1F2ZA 5IOCA 4KY6A 2F0UA 1SNOA 3MXPA 4N9TA 5EKLA 1SNMA 2KHSA 3S9WA 1EY7A 3VA5A 4DF7A 1JOQA 2F0JA 5IGBA 3OMGA 4RKBA 3QOLA 1EYDA 4KY5A 4ME5A 4ZUIA 3TP7A 2EYLA 3LX0A 2F0WA 4J1MA 4KHVA 1TQOA 1STYA 5CV5A 5C5MA 1KDCA 1STBA 1KAAA 1NUCA 3BDCA 1SYDA 3QB3A 4HMIA 5CV8A 1A2TA 5CV7A 4DFAA 3NK9A 1F2MA 4K5WA 5CGKA 2F0LA 2PQEA 5CR3A 1EY9A 2SNSA 3SHLA 5KEEA 5I9OA 3MHBA 5E3FA 5KYIA 5CV4A 3ERQA 3D8GA 1EY5A 3TP8A 5KIXA 2PZUA 2RBMA 4HMJA 4EQPA 3SXHA 1SNPA 3OWFA 2SNMA 4HTHA 5DAUA 5C6AA 5J1ZA 3QOJA 5KRUA 2F0FA 2EXZA 5C4HA 2RDFA 4F7XA 2EYHA 1JOKA 5CV6A 5IGGA 3NP8A 3NXWA 3EROA 3EVQA 3HEJA 3NUCA 3E5SA 4QF4A 4ZQ3A 5C3WA 5KGUA 5CV9A 4R8NA 4PMBA 5IGCA 5E1FA 4F8MA 3NHHA 4EQNA 1EY8A 2PZWA 1KDAA 5IIFA 3MEHA 4KV6A 3SK5A 4NP5A 2F0MA 3DHQA 1STGA 1KDBA 2EYPA 3U9OA 5HURA 4K14A 5J39A 2F0TA 1STNA 1NSNS 4MIUA 5JOBA 4ODGA 2RKSA 3SK8A 2F0OA 5JAVA 4IALA 1EY4A 1EYAA 5K5PA 5NUCA 2WACA 2O4XA 1SYBA 1A2UA 3V2TA 4EQOA 4IZ8A 4J6HA 1EZ8A 5CC4A 3C1EA 4I65A 5EKKA 1KABA 2ENBA 3DMUA 3C1FA 1SYGA 4IUNA 5IGEA 3P75A 1RKNA 4NMZA 4DU9A 4ZUJA 3PMFA 4K5VA 5I6YA 2F0QA 3NQTA 4K6DA 3MZ5A 1STAA 2PYKA 2F0HA 3SK6A 1EYCA 2OEOA 1SYCA 3T13A 2F0NA 2OF1A 5I6WA 4RKLA 1A3UA 1SNQA 2F0GA 1SNDA 2OXPA 2F0SA 4KY7A 1EZ6A 1ENCA 1II3A 2EYOA 2F0KA 2F3WA 2NUCA 3TP6A 1SYFA 2PZTA 2F0VA 5IGDA 5IODA 2QDBA 5KYLA 1JORA 2EY6A 4KTAA 1SYEA 1TR5A 4TRDA 2EYJA 3RUZA 5EGTA 1STHA 4QMGA 5DEHA 5HGTA 4WORA 1SNCA 5M9OA 4WRDA 4EVOA 1F2YA 3D6CA 5C5LA 2PW5A 3BDLA 4KD3A 4KJOA 3MVVA 2EYFA 3EJIA 1AEXA 1EY0A 2F0EA 3HZXA 1EQVA 4K8JA 4KJNA 3T16A 3TMEA 2EY2A 3R3OA 5F2DA 4B9XA 4QB4A 2SOBA 2F0PA 4ID6A 2F0DA 4NDXA 1ENAA 4K2KA 3OSOA 4OL7A 3SR1A 3TP5A 4DGZA 5J22A 2M00A 3D4DA 5C3XA 5IGFA 4K5XA 1TT2A 4PNYA 3D4WA 4B9WA 2PW7A 2HQEA 1U9RA 4PMCA 4YIJA 2EY1A 3P1HA 4K2LA 4S3SA 5ISRA 1A3VA 4LAAA 3OMCA 4N9PA 4E6IA 2EY5A 1EY6A 1A3TA 5C4ZA 4K8IA 2EYMA 4H7BA 5I9PA 4G57A 1JOOA 2KQ3A 4NKLA 3ITPA 3H6MA 4KD4A 2F0IA
chains in the Genus database with same CATH superfamily
1G2SA 2EQSA 5M3MH 2QA4A 2PQAA 2IX1A 1FYCA 3HOZH 1G6PA 3MC0B 4DR7L 4CKCA 3K58A 4GKKL 3OMGA 1EQRA 1X6OA 1C48A 4GKJQ 4JI0Q 1TWFH 1SSOA 2B2WA 2DN8A 1CFMA 3J80L 4HIDA 4BY1B 5CV7A 1OXTA 3CCEA 5EBCA 1E24A 1PV4A 3ZJYC 1JMCA 1H9SB 2GA4B 2VNUD 3D8GA 1EY5A 4RCNA 5LMUL 3NELA 5M5XB 4RMFA 1QZHA 1FJGL 4K0KL 3STBC 1PH6A 2RCFA 2BDNA 3MXGA 3DUZA 4JI1L 3PO2B 2OQ0A 2E8GA 4WJWA 1PFNA 1YZ6A 4UP9A 2VB2X 3E9HA 1VQGA 1K8AC 4P74A 4R4CA 1QOHA 4GLVB 1V43A 4G4KA 5G3LD 2JA5H 1HNXL 4AYBE 3FKIB 1HQMC 3BVGA 3CCRA 3S16H 1I6HB 1CKNA 1Q1BA 5IP9H 2R7DA 3NTIA 3ND9A 4JI5Q 4UY8C 4JBKA 5M3FH 4QUFA 4RWSC 1K0RA 2K5DA 3GTMH 4MNOA 4JYAL 2WFWA 4NMZA 2R3ZA 1NMGA 5I4DA 1WD1A 4BS9A 4DV3Q 2K1BA 4IPDA 1F77A 2A1AA 3NBIA 4QUCA 3PO2G 5I6WA 4ZKCB 1PRTB 1DCZA 3T56B 3NTHA 4M8AA 1O7ZA 4X66L 2NN6G 4IPCA 2FFKB 1FGBD 2QEJC 2Z6BA 5KNDA 5H1SE 1IBLQ 1B4OA 3D3RA 3PO3H 4XQQA 2MUYA 4UAIA 4WORA 2L15A 4R4IA 1D1KA 1F9PA 5T1GA 1IKLA 3KJOA 1VQPA 4QY7A 4IFDG 3FKIG 1D5ZC 1ET6A 1DGSA 5LMUQ 1KNEA 2HDMA 5F2DA 2UXCQ 2KCTA 1MBYA 2NWGA 4RH6A 3TP5A 2E5LL 3SR1A 5J22A 2CH4W 4X3UA 2Z4HA 1QG7A 3GO5A 4E6IA 3S2HH 4K8IA 2WAQE 3MA2B 5I9PA 1DD2A 2UXBQ 3CPFA 5JJZA 4B3RL 5NUCA 2E75C 2OTJA 3EFXD 1PZID 4DN4M 3MFYA 4LMQD 1HRJA 3OW7A 2F4IA 2F0JA 2XN9C 2HIXA 4RKBA 3QOLA 4A3EH 1LTGD 1I50H 3BDCA 1AN8A 1SYDA 1B8AA 1BOSA 1N8RC 1EWIA 5M3MB 1LV9A 5E3FA 4GZYC 5FJ8H 1E0BA 1IZ6A 3GTOH 3CC4A 4FO2A 1D2BA 3J81E 3T1YL 1FNUA 4RGOS 4P72A 1K28A 2MO1A 5IGGA 1JB3A 3CW2C 5CV9A 2L5TA 4QIWE 3FDTA 3RD4A 1XMOQ 2CFMA 2IL8A 3DEOA 5M3FB 3ULLA 3W1BA 3GD7A 4PMWA 4YCVA 3T1HQ 3K57A 4OONA 4JVZA 3F2CA 1T9HA 2Z0SA 3BZCA 1J5EL 2JA6B 3IAYA 2R93G 5M5WH 4KN7C 1EY4A 2UUBL 1ESRA 1FNVA 1S5ED 2A68C 4XDXA 4DR2L 1EFID 1HNZQ 1JJGA 1NCVA 5KNBA 1N32Q 4IUNA 4Q0FA 3R8BA 1TWAB 3T1YQ 1FL0A 5JVG3 4YWKA 3VYTA 5K36H 1BBUA 1X65A 2F0HA 3VR2A 2VS1A 1SROA 1XTCD 3PO3G 1NR2A 1LTBD 2F0GA 2SEBD 3KK7A 3OYYA 1NJIC 1WCMG 1E2VA 5IGDA 2JA8G 3IKJA 2YTVA 3PUXA 2UXCL 2HD3A 3PUZA 1VQFA 1KRTA 1BF4A 1VQ8A 3K80C 1YHBA 4LFCQ 4KJOA 1K8MA 2AQ1B 2FINB 4C3IH 4FNFA 2JA6G 4K8JA 2R93B 2YYZA 1UE1A 3G6EA 2XRQD 3H3VC 4B9XA 3KFUA 2F0PA 3TSSA 4OGQC 5T1IA 5TSSA 2Q2HA 1S5FD 5DLQE 2Z6KA 4BBRB 2D0OA 2VQFQ 3A7AB 3RLOA 4A3DB 3NBHA 2Z6KC 2K52A 2EY5A 1JJ2A 3R93A 4NXNQ 4FDBA 2EYMA 5GADC 2AHOB 4BY1G 3QG1A 2KENA 3NPPA 1JOQA 4KY6A 1QNKA 1LTSD 3T53B 3J80c 4DR4L 1ILQA 4ALPA 3IRBA 1FGUA 2G9DA 4J1MA 1SE8A 1UWVA 1H9SA 2QILA 5C5MA 1DYQA 5C4XH 5AJ3Q 4HR7B 2F0LA 1M1KC 4RAUC 4RGMA 3K7UC 3CCVA 5KIXA 3DEPA 4LF7L 3OWFA 3J7ZC 4HJAA 4JI1Q 1PRTD 2A74C 4A76A 3HOZB 1JOKA 3BVMA 4A3BH 1Y8NB 3A74A 5M3MG 2AWOA 3HKSA 2A69C 1DZ1A 5E1FA 1A62A 1IYVA 2CWPA 2KUMA 1H9RA 2WAQB 3M4OB 2ASBA 4GNXC 1A0IA 4HSPA 2EYPA 4P71A 2VY3A 4JI0L 5C3EH 4JC0A 2K5WA 5DM63 1A2UA 2BA0A 1HQRD 1VQHA 4J6HA 5M3FG 1F2LA 1RD9D 5EKKA 2OTLA 3DMUA 1Q7YC 3C1FA 1SYGA 3SE0A 1Y1VG 2ZXPA 4ZUJA 4ILWA 4K6DA 1GUSA 1K83H 4A93H 1PTOD 2I5LX 3ONAB 2NVQH 1VQ5A 4DKAC 4IUTA 4YHHQ 1JJCB 4DNTB 3K81C 1A63A 2B3GA 3S16B 2EYJA 2RVLA 3MAQA 3D4RA 1ESFA 4ZYSA 2UUCQ 1CKMA 5CBEE 1SFOH 3D0FA 3GTMB 3I73A 2XSCA 1AEXA 2RDGA 1CUKA 1AZPA 1MI2A 2VUMH 4XIGS 1JT8A 4J15A 4A3GG 2M00A 3D4DA 5DNFA 1EU3A 4JI6L 2HQEA 3QO2A 4Y7NH 5GAGC 3I90A 1L0WA 2MJ8A 2MP1A 3CC7A 1KLUD 1YIJA 3NWTA 3TS0A 1PYBA 4DR3Q 1WTVA 3N6RA 4OEMB 2F0UA 3NWSA 3E0EA 4MN3A 3ZYYX 4KKTA 2A6HD 2WP8J 4ZRZA 1O78A 1I5FA 1QCBD 2X6GA 5FLXL 3QB3A 1KAAA 3WWVA 5JVH3 5CV8A 4L63B 5ELEA 1J9OA 4L5QA 3QWNA 2ICEC 2VQEL 2RSNA 2RBMA 4HMJA 3S14B 2BH8A 4YWLA 2SNMA 3GTLB 2K04A 1PVOA 3S15B 5CV6A 3KYHC 1X3EA 3OTOQ 4DV0Q 3RR5A 2F03A 3JAME 2B63G 2K4KA 3A56A 5CORA 1EEFD 4LFBQ 1C9OA 2XWBB 2NZOA 3R2IA 1YI2A 2HT1A 1PFBA 3HOYG 2H4OA 4APVA 3HP3A 1U5KA 1PTOB 4RHRA 1EYAA 4DNRB 4CJ1B 2AKWB 3HOVH 4IOAA 3H15A 4CGYB 3I4MG 1WCMB 3GTQB 1Z47A 1PH4A 4IZ8A 5IGEA 3MWYW 1VQNA 1JICA 3CCSA 1L1OB 3SK6A 2B2WC 2NVXB 4A3KB 2NUCA 5IYCH 5KYLA 1VQIA 5BR8Q 1Q86C 3CQZH 2MFIA 4NB3A 2AMCB 2JA6H 3AB9A 1MIUA 5DEHA 2OQKA 4A3DG 3C2PA 1IW7C 4WRDA 4QGUA 1DOMA 1JE5A 3BDLA 4JI4Q 1WTHA 1BR9A 3HZXA 3TMEA 3U50C 2HDLA 4LF6Q 3TDQA 1PH1A 1KQSA 1HXYD 2VUMG 1QB5D 5JPMC 1RTOA 4K2KA 1UAPA 1NR4A 4PV1C 1CK1A 1U9RA 5ISRA 2K32A 5K36G 1OXVA 1VQCA 3HKZE 1FNWA 1L1OC 4H0LC 3HOWG 1XNRQ 2L1BA 2J7ZA 3M3YH 1GHKA 2H1EA 3I55A 1S72A 2R92G 1SRUA 2WV6D 1GHJA 1CA5A 1JCKB 4NKLA 3ITPA 2K75A 5EKLA 4RGNA 2R93H 3I70A 1NBWA 2KHSA 2B2TA 1Y1VH 4IFDJ 4GNXB 2Y0SB 2EYLA 3LX0A 1A8VA 1STBA 3I7FA 2WB1B 2EJGC 1E3PA 1JWSD 1B9NA 4G7OC 4YY3L 1CA6A 1UUPA 1X54A 5E4XA 4C3IG 1MSHA 2NVYB 1PMRA 2N3SA 3S17H 3K5NA 4A3FB 3QOJA 3ER0A 4GN5A 2F0FA 5GQOA 5FJ8G 3WOEA 3K7AH 4KLKA 2R92B 4UDUC 4LUVA 2EDGA 4IJLA 3I4NH 4DA2A 3TRZA 3NQIA 2D2CC 4A3LG 1ET9A 3H0GH 3S24A 2F0MA 3HRZC 2JEBI 1IYJB 3PIO3 2B39A 1XX8A 1I3QH 3RMHA 1NTGA 2HHHQ 4RGTA 3PO3B 1ZXTA 3PIPA 4POFA 1HA6A 2O4XA 3MEFA 4YCUA 5CC4A 2FMCA 1I94Q 4DK3C 4EGVA 3DWAA 2BCOA 1ASZA 3WDNA 2EJMA 4KHPQ 2EVBA 2X6LA 1X55A 2OXPA 4QJFA 1K3RA 2A6EC 2F0VA 2L9HA 3KLSX 1JORA 1Q3LA 3FKIH 3KDFA 1X3PA 1I6HH 4DV6L 1HZBA 1CKNB 1MSGA 2Q8IB 4CJ0B 4EVOA 5ELBA 4C2MB 2I0QA 4M1UB 4ME3A 4X62Q 3PUYA 1QNUA 1EIYB 3VR6A 2FJ2A 5IYDH 4YY3Q 1PZJD 4DAPA 1IBKL 2L0CA 1KL9A 1R9TB 1STEA 2PW7A 4BY7B 1H9KA 1K8GA 3E0JA 5FLXE 1V1PA 3K5LA 3BS1A 1SEBD 3L9AX 1EY6A 4DK0A 2PNHA 4ABNA 1VMPA 1W2BA 2JA8H 1V1PB 5D14A 3Q22A 4ZAIA 4B3SQ 1F2ZA 3S9WA 2DUDA 2NVYH 4OIKA 5LL6S 3N52A 1HR0Q 3RLNA 3U58A 1YNXA 2RF4A 1TQOA 1NUCA 1S5DD 4IPGA 4PG3A 5IT9E 1GD7A 1HFGA 3RZOB 3GTKH 5LL6X 1TXYA 4IFDH 3PSIA 3MHBA 5D3DA 2B63B 1VQMA 1VQ9A 4LF6L 3HOYH 2PZUA 5M5WB 3AFPA 5CMDA 3CC2A 4BY7G 4DR5L 2NN6I 5C6AA 1EL0A 1U4RA 1E7ZA 4DR5Q 1A15A 3NP8A 3TZUA 5M5YB 3AU7A 1RL2A 2R7FA 3W3AA 4R8NA 1CM9A 4CJ2C 1JC7A 3I4MB 5BR8L 2B8GA 4DV5L 1C4QA 3MEHA 3UDIA 1LTID 2PNRC 3C46A 4U673 3G4SA 2NVTH 5C4JB 1WTOA 4N8X1 1HR0L 1CT1D 4DV5Q 1BNZA 3SDZA 1RCVD 1TKWB 2LXJA 2XGTA 1PH5A 3BJUA 1Y8OB 3KLSA 3H0GB 2EXDA 3J80E 3PMFA 2E2IB 1XTDA 5EPLA 2JEAI 3HKZB 3CHBD 2XWJB 2JA7H 1SNQA 4LFBL 2MO0A 2F3WA 1R4QB 3D6WA 4K6LA 2Z9HA 1X9NA 3AQQA 1IBKQ 3NENA 1DOKA 2I5HA 2WAQG 3HGBA 2M9VA 1QUQA 4X62L 1R9TH 3D6CA 4AYBG 5KNCA 4A3GH 1YJ9A 4AH6A 4JOIA 3T16A 1TWAH 2PPBC 1HHVA 1HZCA 3I4LA 4ID6A 4OL7A 1ENAA 1PXUA 3TS2A 2I5MX 3O13A 1OTCA 4BA2I 4RG1A 4K5XA 4V0BA 4C3JH 2QW7A 2RHSB 3D31A 3HOXB 4K2LA 1GKHA 2A6HC 4DR6L 1EOVA 3F2UA 3PUVA 4IUQA 4TKOB 4R9WA 5L37A 3H3VH 5EPKA 5A35A 1CHQD 5I2YA 3PO2H 4L8JA 4DF7A 2A73B 4DUYL 1ZEQX 4G7ZC 1I6VC 1LACA 1EYDA 1IKMA 4A3FG 2B2UC 5CV5A 4JG2A 1UEBA 1HZAA 2LXKA 2B2YC 1LO5D 3BG3A 4V190 5C44G 1K9MC 4HJ7A 4JW0A 2K6AA 4G7HC 3KLRA 4UP8A 1HPCA 2NB0A 4KHPL 2F4VQ 1VQJA 2UUCL 2EYHA 4GN4B 5G3LF 4PZ7A 4LNQA 2MGSA 3TBIB 2Q2IA 2DNEA 1LTTD 4YHHL 4OHJA 3SK5A 1KDBA 4Q5VA 1UE5A 4MIUA 1MD2D 3PF4A 4JCVE 3RZDH 4IUPA 1VQ6A 4TSSA 1CQVA 1SYBA 1X3GA 2G9HD 2QDLA 5BN5A 1O7IA 1EWCA 1XYIA 4LW1A 1EZ8A 2E76C 3VYSA 4BWGB 1CKOA 2ENBA 1BVSA 1L0XB 2IHFA 3I4NB 4FF2A 1SJHD 1HR0W 2PYKA 1LT5D 3OIQA 3HOZG 2QF7A 1SNDA 1ONLA 1PYWD 2L12A 3J81L 3H0GG 2D9UA 1KTKA 4FF1A 4HJ5A 1S40A 1V9PA 3ICEA 2K28A 3HKZG 2JA7B 2K5VA 1UNSA 3E9IA 2DNCA 4R1JA 4JPBW 2PI2A 3J80i 4QB4A 1F9QA 3F2BA 4HEDA 1VQOA 3EA6A 2O2LD 2LY7A 3B6YA 1LT4D 4JI8Q 3MXNA 3P20A 3TQYA 5AJ3L 3J7AF 4BBSH 4DAYB 1YNND 2JN4A 3FPPA 3OWEB 4H7BA 4L5SA 3A7LA 3PGZA 2KQ3A 1TU2B 4KD4A 2E2JB 5C0XI 2F3VA 4R8IA 3MXPA 1SNMA 4DV1L 1PFSA 4X64L 3Q8DA 2YTXA 3F1ZA 4FP5D 1U4MA 4ME5A 2EOTA 1G2TA 1M8AA 4HAEA 2JA7G 1VQLA 2V4DA 1PTOF 4HMIA 4WJ3M 1A2TA 1U0LA 2Z8LA 3NK9A 2SNSA 4OO1I 2D62A 3S1RB 4LF9L 1SNPA 2RSOA 3VR3A 1DM0B 1RF2D 3KF6B 4DUZQ 4CDEC 2K50A 2JQOA 3E5SA 3MFGA 1S4ZA 3DM1A 4PMBA 2CWAA 2ZM6L 1X3QA 3M7GA 1EY8A 3NHHA 1C0AA 2YU9B 3U4VA 3GTJH 4DV2L 1STNA 1XMQQ 5JOBA 1EUJA 1O7YA 3E6ZX 2RKSA 4MZ9A 4LUOA 5JAVA 4QQBX 4H44C 4HIMA 5FLMG 5D65A 1SXTA 1DONA 3V2TA 3S1QB 4DR2Q 4C3IB 4DR3L 1C7YA 4JI3L 1NMFA 3P75A 5LMNQ 2R6GA 3F8TA 4IFDI 3I4MH 1M90C 1BKBA 4B08A 2F0NA 2WINB 5EBDA 3M4PA 2EYOA 4OWXB 5IODA 1PH3A 3M85A 1CZWA 1XPUA 2WB1E 4NW2A 4QMGA 5EGTA 2QEXA 3ERSX 2L11A 1YNJD 4CDCC 5GROA 3Q24A 2IX3A 1EU4A 4JBJA 1YJNA 1BCPF 4J8QA 4R4OA 3A5ZB 2EY2A 3FMCA 1B3QA 2R7ZB 1QVFA 2J0TD 3W5OA 2DJFC 3F2DA 1QZGA 1EYGA 4C3HG 5FKAC 3CQZB 3LGJA 2JSOA 4JI6Q 4DAYA 1JB7A 1EQTA 5JPNC 1SMYD 1AP0A 3GDEA 4O0AA 5ELOA 2UXBL 5IWAL 5ELNA 2LFNA 2ZXRA 4DPGA 4BBSB 4RA8A 1D1IA 1CI3M 2IPKD 2H5XA 4I7AA 4DFAA 4A3JH 2QKIC 3STBD 3KF8B 1F2MA 1N33Q 4KMUC 4LF5Q 3HOUB 2E5LQ 5IY0A 5IE8A 5KYIA 1GXDC 1H9JA 2B29A 2YU9H 4L5RC 1KC8C 3OIPA 4A4IA 3GP7A 3QJYA 2BA1A 4ZQ3A 1JWUD 3V96A 1BXTA 5FOBB 2JJQA 4EQ5A 2KA7A 3CRLC 4A3MH 1IBML 1HUMA 1KDAA 4X66Q 4A3LH 4A93B 4KV6A 3DHQA 1DXMA 3QR8A 2A8VA 3AEVA 3I4NG 3G48A 2UXDQ 5ELDA 1L1OA 2HQLA 2FXQA 1LLRD 2F0OA 4LWCA 3SGIA 4JYAQ 3A55A 2WB1G 2NTSA 4B3TL 2IW3A 1KHIA 5EAYA 2C35B 1RODA 4I65A 2RQXA 1B50A 1RKNA 4R4QA 1U4LA 5I6YA 4AYBB 1S5CD 4IURA 1STAA 3CCMA 2OCEA 4ZLTF 4LF7Q 2UXDL 1NE3A 3A8KE 1A3UA 2NTTA 1CQFA 2IT1A 3SEBA 3TP6A 4UHVA 1SYFA 4POGA 4CDDC 2KVMA 1SR3A 2ZJPA 1BBWA 4KTAA 4A75A 2XIWA 1QVGA 3VA7A 3UDGA 2MHVA 4DV4Q 2KBNA 2VL6A 1GM5A 1KRSA 1EIGA 4DR4Q 4OO1H 3R2TA 3EJIA 4KJNA 4A3BG 3BU2A 3HOWH 2A69D 4PQXA 1Q8IA 1RDPD 4NDXA 4LF5L 1HTLD 4YCWA 5C3XA 1BCPC 1TT2A 3FHWA 3TN2A 1RTNA 4IOCA 1OXUA 1Z7TA 2F3IA 5HY6A 1N36Q 2VB3X 2VQFL 4A3IH 4GKKQ 4DR7Q 5JEAJ 4A3JB 3CAMA 3H91A 4GOPC 1CHPD 3SK4A 4DV0L 3OTOL 1XPRA 4KI0A 3CU7A 4GNXA 2Z1CA 1J5EQ 4F88A 4OWWB 3K8AA 4TVAB 3J81j 4IUVA 4BXXH 2VQEQ 4R4TA 1MJEA 4A3BB 4CKBA 4DK1A 3T4AC 5C4JH 1B44D 4BXXG 1V1QA 3PCOB 1HTPA 4WJ4A 5LHY1 5KRUA 2HCCA 3S1MB 1P8LA 1GUGA 1BCPD 1CZGA 1OXXK 1P16A 5IGCA 2NBFA 2UUBQ 4QCLA 1XNQL 1CSPA 2PZWA 4A3IG 4TQUS 4DK6C 1O80A 1SE4A 1GOZA 1W3SA 2IWHA 1D5XC 4IN3A 1Y1WH 4FYDA 1TWGH 3CP0A 2E2HB 2YV5A 4IALA 1ZYRC 3VYUA 5LMNL 4JI3Q 2P5ZX 5CYUA 2Q8RE 3CD6A 1HFNA 4BA1I 2SDFA 2JXMB 3T51B 1T5EA 2J4XA 3X3NA 1BCPB 1U4PA 2GVAA 3NQTA 1XMQL 3BYTB 3KBGA 2R7ZG 1HNWQ 2DGYA 2NVTB 2VUMB 1IL8A 4ZCKA 1HH2P 1X56A 1CSQA 2R61A 4X65Q 1G91A 4O42A 3OW2A 2EYFA 1J8IA 5BN4A 3H94A 3G71A 4DAMA 4DV4L 5FLXc 2IY5B 3LWEA 3V05A 2F0DA 5ELFA 1RIPA 3HG9A 1XJVA 1RHPA 2EY1A 3OMCA 3TZDA 5FO7B 2Y0SG 4IO9A 1TS5A 4C3HH 4X64Q 5FO9B 3HFZB 1JOOA 4DV1Q 3VDYA 1IYUA 2F0IA 1IHZA 1N34Q 3S1NB 3HOUG 1YNNC 2HUGA 1SNOA 3BZDB 2N88A 4JI5L 1PFMA 3CKIB 3CF5A 3K0XA 1D5MC 4LF8L 4KY5A 1VQKA 1TY2A 1VF5C 4ZUIA 1IXRA 3K6OA 1KDCA 1IBLL 4O2DA 3OPOA 2F1MA 4L6TB 3SHLA 1X3FA 1LTAD 1LT3D 3CRKC 2CQOA 2TMPA 1ZKOA 3KF6A 4GN3B 4OIJA 2BOSA 3C3LA 2EXZA 1FJGQ 4K0KQ 3NXWA 1D8LA 2B2VC 4QF4A 2G5DA 1YJWA 1YVCA 5BN3A 4XXEA 4NXNL 1N33L 3U9OA 3GV3A 3S1MH 4PZ8A 1NSNS 2PMZE 3VR5A 5ELCA 2WACA 4A3KH 3GTGH 4BBRG 3A0JA 5C44B 1YHAA 1TWCB 2JA9A 2AQ2B 4GOPB 4X6AH 2O5JC 1Y8PB 3EIVA 1ILPA 4LFCL 5IT9L 1D6EC 1JR0D 5JJKA 5FK9C 3ND8A 2LS01 4BY7H 2PZTA 1VCIA 2CVRA 1K8OA 1SYEA 4GS3A 1STHA 1WFQA 5M9OA 3K5OA 4CBVA 4MHEA 2C5CA 1AE2A 3BDOA 4KHZA 3U4ZA 2XTIA 3FPUB 4IUUA 3K0YA 2CHBD 1HNZL 2KEEA 1G8ZD 1WVLA 2AWNA 3OSOA 2FHTA 3BYYB 1ICWA 3PIP3 3D4WA 1LABA 3QIAA 4YIJA 1SE3A 1F9SA 1GUTA 1A3VA 3GTKB 4BBSG 4DNIA 2EZVA 3T1HL 4HIOA 2ID0A 3S1RH 3I72A 1AH9A 2AUJD 4DUYQ 1CTMA 1TVXA 4G57A 4A3KG 1PYSB 1SLJA 3H6MA 2L4NA 3GQBA 4QIWB 3U9SA 3DLLA 1XMOL 5IOCA 1SN8A 3M9BA 1Z6HA 1BBXC 3NBHB 5IGBA 4JBMA 3M3YB 3K5MA 4XYQA 4HJ8A 4CHTB 2NYZD 1STYA 2IJ0A 4A3MG 3S1NH 1EY9A 1XXGA 2PI2E 2ZM6Q 2K7VA 2IX0A 2JK8A 4AQYL 4A3IB 1E2WA 1YITA 1S3OA 1Y1VB 3E3XA 1LTLA 4DUZL 3M4OH 1WTPA 4HTHA 3J81c 2TSSA 2MNAA 4X3SA 3GTPH 2RDFA 3KBXA 4LF9Q 4O1NA 4A3EB 2UUAQ 5GAHC 1B3AA 1WOCA 4JV5Q 4EQNA 3Q23A 4B3RQ 3L2PA 1I50B 3Q0AA 2LMCB 5IIFA 3CXCA 2OWOA 1Q90A 1N36L 4GOPA 1UE7A 1IW7D 1YNJC 3J7YW 3M4YA 2R92H 4U68A 2B2YA 1QILA 2DY8A 3M7NA 1A6XA 1JQYD 3A8IE 5D3IB 2VZAA 1ZYRD 3CPWA 3DWPA 4A3GB 2F52A 2FMMA 2VW9A 2Z4IA 4LJZC 4B3MQ 4KK7A 4DU9A 2KHJA 2ATWA 3VR4A 2F0QA 3MZ5A 5C3EB 1W6KA 3S2DB 2N8NA 2OEOA 4JBWA 2F0SA 1II3A 1ENCA 4A3EG 1KD1C 2A19A 2K14A 2EE1A 5C44H 4DV7L 1TWGB 1V1OA 1TWHB 2E2HH 4L5TA 1TR5A 3RUZA 5HGTA 1PDQA 1VQEA 4NXMQ 4DV3L 3MTSA 2HCIA 1K83B 1MHWC 2PQAB 3KLWA 1M4VA 5IP9G 1Y69U 1C8CA 1EY0A 1GUWA 1EQVA 4HCEA 5I2XA 3R3OA 3KJPA 1IL2A 4B3TQ 2JA8B 2DJGC 4JOIC 1HCZA 5CBAE 3UE1A 4B9WA 2PMZB 1I4QA 3I3CA 5C0XJ 4C2MH 4S3SA 1HNXQ 4LAAA 4GLAC 3HOUH 4UP7A 1E1TA 4FXDA 4HCSA 1IBMQ 2Y0SE 1I4PA 3H3VI 2BE5D 2EIFA 1FR3A 2B2TC 1AW7A 1AE3A 1VMCA 1Y1WG 1PH8A 2B63H 2N78A 3MXNB 4XTCS 3HOYB 1NNXA 3FP9A 3IL8A 4JK1C 1Q12A 3J7A5 1GUOA 4KHVA 1KAWA 4JI2L 1BDOA 1I4HA 4CKEA 5CR3A 2I07B 1J6QA 5KEEA 2KEDA 4ZK9B 1PHJA 1HUNA 4LF4L 4GKJL 2QGQA 3NE5B 5DAUA 3I4OA 4ZKBB 3AFQA 1WTQA 4A3CG 3UE0A 5IWAQ 3JAMc 5JJIA 4I7ZC 3EROA 2UU9L 4DV6Q 2A6ED 2JA5G 2KHIA 1MJCA 5IP7H 5LMNW 2GVBA 4A3CH 1SMYC 3S14H 4DR1L 3HOVG 2F0TA 3TEHB 3CCLA 3GTPB 1R4PB 1EIFA 5JEAG 3SK8A 5COYA 5M5YH 3S2DH 3ULJA 3WOFA 2NVXH 2ZTEA 2RA4A 2WKCA 1Q1EA 2JP1A 4FF4A 2K5QA 3C1EA 3ULPA 1PTOC 1TWHH 1B9MA 2F4VL 3HOWB 1QVCA 2NZHA 4DR6Q 4P2CB 1SYCA 2K33A 1Q8KA 3T13A 1ASYA 1E1OA 5IYBG 2JA5B 3DM3A 4FF3A 1E2ZA 1WYDA 2KJXA 2AUKA 4RCOA 1B70B 2JE6I 3CCQA 4C3JB 2Q2TA 3EBEA 2XVSA 5A2QL 1B2TA 2KECA 2F0EA 2RCNA 3FRPB 4HN7A 2CH4A 3HS0C 2A5HA 2HIVA 2NZ1D 1H9MA 2NVQB 2K03A 4OWTB 1GUNA 3Q6SA 2YTYA 3MXUA 1A3TA 4DV2Q 2ZT9C 2BE5C 2CQAA 1HJPA 2LKVA 4OELB 2CKZB 5FO8B 1UE6A 4N9TA 1PH2A 3HOXH 1EY7A 3CCUA 1NY4A 4FXKC 4XQNA 1TIID 4JI7Q 1FVIA 2K5NA 2PCFB 4OX9Q 1L0YB 5CGKA 3GTJB 3I2ZA 4RFBA 1MKHA 3L3OC 1WD0A 4OO1G 4RHSA 1GJXA 4DXGA 1Y1WB 3PQIA 1PZKD 1V8QA 1LYLA 3HOXG 1Z9FA 2ZXOA 2E74C 4KN4C 1I3QB 2GN5A 5KGUA 3EVQA 1VQDA 5C3WA 2K05A 3JC66 4A3JG 3LNNA 5GAEC 5C0XG 1NAPA 1PRTF 1XWEA 4XQJA 1G51A 5J3BA 2N49A 1WTXA 2Q8TA 3UDFA 4OX9L 1RJTA 4A3FH 4JI7L 1JWMD 3K7AB 4ULLA 2B2VA 5C3EG 1EIHA 4JI8L 1TS2A 3GTOB 3X3MA 3J7AV 4P73A 1PH9A 4B3ML 2ZJRA 2KCCA 4DXFA 2DY7A 3VYRA 3IFDA 2AQ3B 4K5VA 2CCZA 3L0OA 3IFTA 3UDXA 2C9OA 1B7YB 1DOLA 1LM0A 2B2UA 4FVMA 4KY7A 1EZ6A 2A68D 4JV5L 4AIMA 1ML0D 1QJOA 2BDOA 4CDFC 2UUAL 3PF5A 1K73C 1WJJA 1Y14B 1PTOH 4KKUA 1LT6D 4IPHA 4C3HB 3I91A 5C0XH 3I56A 1WCMH 3GTQH 2ICIA 5EQ0A 1QWYA 2OT2A 3FVQA 1FD7D 1I4RA 4XT1B 4AQYQ 4HIKA 1N9WA 2WIIB 5JEAH 4HSVA 2E2JH 5IGFA 3BVZA 5C4XB 4BY1H 3P1HA 3JAML 2RDHA 3RN5A 5C4ZA 5IP7G 3P7JA 1VQAA 1F9RA 1HA5A 4YWMA 1TY0A 1EQQA 3GV6A 1OXSC 3VA5A 1W6JA 1OO9B 4LFAQ 3L7ZC 1PLFA 4WFN3 1WTWA 2HHHL 2X69A 1VDZA 2E2DC 3M4QA 2F0WA 4BBRH 2I46A 4A3DH 3RLFA 3I8ZA 1BQQT 2IHEA 1H95A 1T5XD 1LTRD 3AMUA 3RNUA 2O5IC 2XNAC 1K3BC 2UU9Q 3SXHA 3CMAA 1ENFA 1BO0A 2Q2UA 4H02A 5J1ZA 1VF7A 5C4HA 5HGQA 4F7XA 3GTGB 4LFAL 1TWCH 2LSSA 3G7LA 4LF4Q 1QE6A 4NPSA 2ZJQA 1XPOA 1EWHA 4P75A 4F8MA 3UI2A 2VXWA 3S1QH 5AFWA 4XYOA 5HURA 2CW0D 1STGA 4MTNA 4JI2Q 1VQBA 3KUPA 3FEWX 2KCMA 5IYBH 4DR1Q 3S17B 3K59A 5K5PA 4C56C 1B1ZA 1SE2A 2N55A 2QCPX 1SFOB 3EQLC 1PA6A 1KABA 1YHQA 4KKSA 3KOJA 3SVMA 2B8FA 3A54A 2K5HA 1BUVT 2CW0C 5E7NA 5A2QE 1XNRL 1O7LA 4Z9CB 1EYCA 3JAMi 5EJWA 1KLGD 2OF1A 3PUWA 3PV0A 4XT3B 3TREA 4PZ6A 1SAPA 1AZQA 2ZTCA 3CMEA 5IYDG 3NEMA 2QDBA 4X3KA 1ICFB 4N8FA 3S2HB 1G6ZA 4TRDA 1PRTC 2D0PA 2KOLA 3URYA 2NN6H 1F2YA 2KCNA 5C5LA 3MVVA 4QL5A 1DJRD 3OOCA 4NXML 2ZTDA 3G6JB 5JJLA 1S5BD 3H09A 5IT9c 1VQ7A 1SDFA 4PMCA 1GO3E 1JE4A 1D7QA 1VS0A 2ALYB 1SMXA 4LF8Q 3LWUA 2R7ZH 3DWQA 1G291 1SBBB 1TWFB 5EKIA 1YEZA 4ODGA 2JYOA 2WKDA 1N34L 3NTKA 2K01A 4EX5A 3S15H 1L2FA 4GLXA 4JI4L 3A8JE 1UEAB 1KNAA 1Q46A 3TP7A 3W2DA 3RN2A 4F87A 1EEID 5J39A 4Y7NB 1LUZA 4K5WA 4DV7Q 2PQEA 3W1GA 3KF8A 5FLMH 1AFPA 1EOTA 3DXJC 5I9OA 1VQ4A 5CV4A 3EN2A 3ERQA 1EFWA 4EQPA 1K0SA 1PH7A 3HOVB 3AYHB 2ES2A 5E4WC 4X65L 1SJED 1YBYA 1HZ9A 3HEJA 3NUCA 4MTKA 5EPJA 1TS4A 2EJFC 3PIOA 4B3SL 4C1NI 4C1NK 2BH2A 4UPAA 5M5XH 1HNWL 1X32A 4LUZA 4IQZA 1KIXA 1TS3A 4NP5A 3RZOH 4K14A 3CCJA 1I4GA 1B53A 1Q81C 4Y52H 1QUQB 1N32L 2L55A 3GTLH 4A3MB 4OXPA 5DM73 4EQOA 4HJ9A 3OHXC 4X3TA 3NSWA 4H13C 4LK1C 4C3JG 1E22A 3RZDB 4RKLA 2F0KA 2M2LA 1KXLA 1XNQQ 2EY6A 3BZKA 2EPBA 4IJHA 3J81i 2XRSD 4A93G 1SNCA 2MQHA 5C4XG 1WTRA 2PW5A 4KD3A 2PO4A 1Q82C 1WI5A 2RHQB 2E2IH 2V1CC 4FXGC 1MGSA 1I94L 2SOBA 2MPMA 3TP8A 3KDFB 5IYCG 4DGZA 4PNYA 4N9PA 2D5DA 1I4XA 1GVPA 4DAVA 3A5UA
chains in the Genus database with same CATH topology
1G2SA 2IX1A 1FYCA 3MC0B 4CKCA 3K58A 3OMGA 1C48A 1SSOA 2B2WA 2DN8A 1CFMA 3J80L 4BY1B 5CV7A 1OXTA 5EBCA 1H9SB 2GA4B 2VNUD 3D8GA 1EY5A 4RCNA 5M5XB 2BDNA 3MXGA 3DUZA 3PO2B 4WJWA 1PFNA 2VB2X 1QOHA 1V43A 4G4KA 5G3LD 3FKIB 1HQMC 3BVGA 1I6HB 1Q1BA 3NTIA 3ND9A 4QUFA 4RWSC 2K5DA 4NMZA 2R3ZA 5I4DA 1WD1A 4BS9A 2K1BA 1F77A 3NBIA 4QUCA 5I6WA 4ZKCB 1PRTB 1DCZA 3T56B 3NTHA 4M8AA 1O7ZA 2NN6G 2FFKB 1FGBD 2QEJC 5KNDA 1B4OA 3D3RA 4XQQA 2MUYA 4UAIA 4WORA 1D1KA 1F9PA 5T1GA 1IKLA 4IFDG 1D5ZC 1ET6A 1KNEA 2HDMA 5F2DA 1MBYA 2NWGA 4RH6A 3TP5A 3SR1A 5J22A 4X3UA 2Z4HA 1QG7A 3GO5A 4E6IA 4K8IA 3MA2B 5I9PA 1DD2A 5JJZA 5NUCA 2E75C 3EFXD 1PZID 4DN4M 3MFYA 4LMQD 1HRJA 3OW7A 2F4IA 2F0JA 2XN9C 4RKBA 3QOLA 1LTGD 3BDCA 1AN8A 1SYDA 1BOSA 5M3MB 1LV9A 5E3FA 4GZYC 1E0BA 4FO2A 1D2BA 3J81E 1FNUA 4RGOS 5IGGA 1JB3A 5CV9A 2L5TA 3FDTA 3RD4A 2IL8A 3DEOA 5M3FB 3GD7A 4PMWA 3K57A 2JA6B 3IAYA 4KN7C 1EY4A 1ESRA 1FNVA 1S5ED 2A68C 4XDXA 1EFID 1NCVA 5KNBA 4IUNA 4Q0FA 3R8BA 1TWAB 5JVG3 5K36H 3VYTA 2F0HA 3VR2A 1XTCD 1NR2A 1LTBD 2F0GA 2SEBD 3KK7A 1E2VA 5IGDA 3IKJA 3PUXA 3PUZA 1BF4A 4KJOA 1K8MA 2AQ1B 2FINB 4FNFA 2R93B 4K8JA 2YYZA 2XRQD 3H3VC 4B9XA 2F0PA 3TSSA 4OGQC 5T1IA 5TSSA 1S5FD 4BBRB 3A7AB 4A3DB 3NBHA 2EY5A 3R93A 2EYMA 3QG1A 3NPPA 1JOQA 4KY6A 1QNKA 1LTSD 3T53B 1ILQA 2G9DA 4J1MA 1H9SA 2QILA 5C5MA 1DYQA 4HR7B 2F0LA 4RAUC 4RGMA 5KIXA 3DEPA 3OWFA 1PRTD 2A74C 3HOZB 1JOKA 3BVMA 1Y8NB 2AWOA 2A69C 1DZ1A 5E1FA 1IYVA 2KUMA 1H9RA 2WAQB 3M4OB 4HSPA 2EYPA 2K5WA 5DM63 1A2UA 2BA0A 1HQRD 4J6HA 1F2LA 1RD9D 5EKKA 3DMUA 3C1FA 1SYGA 3SE0A 2ZXPA 4ZUJA 4ILWA 4K6DA 1GUSA 1PTOD 3ONAB 4IUTA 4DNTB 3S16B 2EYJA 2RVLA 3MAQA 3D4RA 1ESFA 4ZYSA 5CBEE 3GTMB 3I73A 2XSCA 1AEXA 2RDGA 1AZPA 1MI2A 4XIGS 2M00A 3D4DA 5DNFA 1EU3A 2HQEA 3QO2A 3I90A 2MJ8A 2MP1A 1KLUD 3NWTA 1WTVA 3N6RA 2F0UA 3NWSA 4MN3A 3ZYYX 4KKTA 2A6HD 2WP8J 5FLXL 4ZRZA 1O78A 1QCBD 2X6GA 3QB3A 1KAAA 5JVH3 5CV8A 4L63B 5ELEA 1J9OA 3QWNA 2ICEC 2RSNA 2RBMA 4HMJA 3S14B 2SNMA 3GTLB 2K04A 3S15B 5CV6A 2F03A 3JAME 3A56A 5CORA 1EEFD 2XWBB 3R2IA 1PFBA 2H4OA 3HP3A 1PTOB 4RHRA 1EYAA 4DNRB 4CJ1B 4CGYB 1WCMB 3GTQB 1Z47A 4IZ8A 5IGEA 3MWYW 1JICA 3SK6A 2B2WC 2NVXB 4A3KB 2NUCA 5KYLA 3AB9A 5DEHA 3C2PA 1IW7C 4WRDA 1DOMA 3BDLA 1BR9A 3HZXA 3TMEA 2HDLA 3TDQA 1HXYD 1QB5D 5JPMC 1RTOA 4K2KA 1UAPA 1NR4A 4PV1C 1CK1A 1U9RA 5ISRA 2K32A 5K36G 1OXVA 1FNWA 4H0LC 2L1BA 2J7ZA 1GHKA 2H1EA 2WV6D 1GHJA 1CA5A 1JCKB 4NKLA 3ITPA 5EKLA 4RGNA 3I70A 2KHSA 2B2TA 4IFDJ 2Y0SB 2EYLA 3LX0A 1STBA 2WB1B 2EJGC 1JWSD 1B9NA 4G7OC 1CA6A 1UUPA 5E4XA 4C3IG 1MSHA 2NVYB 1PMRA 3K5NA 4A3FB 3QOJA 2F0FA 3WOEA 2R92B 4UDUC 2EDGA 4DA2A 3NQIA 2D2CC 1ET9A 2F0MA 3HRZC 2JEBI 3PIO3 2B39A 1XX8A 3RMHA 4RGTA 3PO3B 1ZXTA 1HA6A 2O4XA 5CC4A 2FMCA 4EGVA 3DWAA 2BCOA 3WDNA 2EJMA 2EVBA 2X6LA 2OXPA 2A6EC 2F0VA 2L9HA 3KLSX 1JORA 1Q3LA 1X3PA 1MSGA 2Q8IB 4CJ0B 4EVOA 5ELBA 4C2MB 4M1UB 3PUYA 1QNUA 3VR6A 2FJ2A 1PZJD 4DAPA 2L0CA 1R9TB 1STEA 2PW7A 4BY7B 1H9KA 3E0JA 5FLXE 1V1PA 3K5LA 3BS1A 1SEBD 3L9AX 1EY6A 4DK0A 4ABNA 1VMPA 1V1PB 5D14A 3Q22A 4ZAIA 1F2ZA 3S9WA 4OIKA 5LL6S 3N52A 1TQOA 1NUCA 1S5DD 5IT9E 1HFGA 3RZOB 5LL6X 4IFDH 3MHBA 5D3DA 2B63B 2PZUA 5M5WB 5CMDA 2NN6I 5C6AA 1EL0A 1U4RA 1A15A 3NP8A 3TZUA 5M5YB 3AU7A 4R8NA 3W3AA 1CM9A 4CJ2C 1JC7A 3I4MB 2B8GA 1C4QA 3MEHA 1LTID 2PNRC 3C46A 4U673 5C4JB 1WTOA 1CT1D 1BNZA 3SDZA 1RCVD 1TKWB 1Y8OB 3KLSA 3H0GB 3J80E 3PMFA 2E2IB 5EPLA 2JEAI 3HKZB 3CHBD 2XWJB 1SNQA 2F3WA 1R4QB 3D6WA 4K6LA 1DOKA 3HGBA 2M9VA 3D6CA 5KNCA 3T16A 2PPBC 1HHVA 3I4LA 4ID6A 4OL7A 1ENAA 1PXUA 4BA2I 3O13A 4K5XA 4V0BA 3HOXB 3D31A 4K2LA 2A6HC 3F2UA 3PUVA 4IUQA 4TKOB 4R9WA 5EPKA 5A35A 1CHQD 5I2YA 4L8JA 4DF7A 2A73B 1ZEQX 4G7ZC 1I6VC 1LACA 1EYDA 1IKMA 2B2UC 5CV5A 2B2YC 1LO5D 3BG3A 4V190 2K6AA 4G7HC 3KLRA 1HPCA 2NB0A 2EYHA 5G3LF 2MGSA 3TBIB 2DNEA 1LTTD 4OHJA 3SK5A 1KDBA 4Q5VA 4MIUA 1MD2D 4IUPA 4TSSA 1CQVA 1SYBA 2G9HD 5BN5A 1XYIA 1EWCA 1EZ8A 2E76C 3VYSA 4BWGB 2ENBA 1L0XB 3I4NB 4FF2A 1SJHD 2PYKA 1LT5D 3OIQA 2QF7A 1SNDA 1ONLA 1PYWD 2L12A 3J81L 2D9UA 1KTKA 4FF1A 2K28A 2JA7B 1UNSA 2DNCA 4QB4A 1F9QA 4HEDA 3EA6A 2O2LD 2LY7A 1LT4D 3MXNA 3P20A 3J7AF 1YNND 3FPPA 3OWEB 4H7BA 3A7LA 2KQ3A 1TU2B 4KD4A 2E2JB 5C0XI 2F3VA 4R8IA 3MXPA 1SNMA 4FP5D 1U4MA 4ME5A 2EOTA 1G2TA 1M8AA 4HAEA 2V4DA 1PTOF 4HMIA 1A2TA 2Z8LA 3NK9A 2SNSA 4OO1I 2D62A 3S1RB 1SNPA 2RSOA 3VR3A 1DM0B 1RF2D 3E5SA 3MFGA 1S4ZA 3DM1A 4PMBA 1X3QA 3M7GA 1EY8A 3NHHA 2YU9B 1STNA 5JOBA 1O7YA 3E6ZX 2RKSA 5JAVA 4H44C 5D65A 1SXTA 1DONA 3V2TA 3S1QB 4C3IB 3P75A 2R6GA 4IFDI 4B08A 2F0NA 2WINB 5EBDA 2EYOA 5IODA 3M85A 1CZWA 4NW2A 4QMGA 5EGTA 2L11A 1YNJD 3Q24A 2IX3A 1EU4A 1BCPF 4J8QA 2EY2A 3FMCA 2R7ZB 2J0TD 4C3HG 5FKAC 3CQZB 2JSOA 4DAYA 1EQTA 5JPNC 1SMYD 1AP0A 2LFNA 2ZXRA 4BBSB 4RA8A 1D1IA 1CI3M 2IPKD 4DFAA 2QKIC 1F2MA 4KMUC 3HOUB 5KYIA 1GXDC 1H9JA 3OIPA 3GP7A 3QJYA 2BA1A 4ZQ3A 1JWUD 3V96A 1BXTA 5FOBB 2KA7A 3CRLC 1HUMA 1KDAA 4A93B 4KV6A 3DHQA 1DXMA 5ELDA 1LLRD 2F0OA 3A55A 2NTSA 2IW3A 1RODA 4I65A 2RQXA 1B50A 1RKNA 1U4LA 5I6YA 4AYBB 1S5CD 4IURA 1STAA 4ZLTF 3A8KE 1A3UA 2NTTA 1CQFA 2IT1A 3SEBA 3TP6A 1SYFA 2KVMA 4KTAA 2XIWA 3VA7A 2MHVA 1EIGA 4OO1H 3R2TA 3EJIA 4KJNA 2A69D 4PQXA 1Q8IA 1RDPD 4NDXA 1HTLD 5C3XA 1TT2A 1BCPC 3TN2A 1RTNA 1OXUA 1Z7TA 2VB3X 5JEAJ 4A3JB 3H91A 1CHPD 3SK4A 4KI0A 3CU7A 2Z1CA 4F88A 4IUVA 4A3BB 4CKBA 4DK1A 3T4AC 1B44D 1HTPA 5LHY1 5KRUA 2HCCA 3S1MB 1GUGA 1BCPD 1CZGA 1OXXK 5IGCA 2NBFA 4QCLA 2PZWA 4TQUS 1O80A 1SE4A 1GOZA 2IWHA 1D5XC 4IN3A 4FYDA 2E2HB 4IALA 1ZYRC 3VYUA 5CYUA 2Q8RE 1HFNA 4BA1I 2SDFA 2JXMB 3T51B 1T5EA 2J4XA 3X3NA 1BCPB 1U4PA 3NQTA 3BYTB 3KBGA 2NVTB 2VUMB 1IL8A 2R61A 1G91A 4O42A 2EYFA 1J8IA 5BN4A 3H94A 3LWEA 3V05A 2F0DA 5ELFA 3HG9A 1RHPA 2EY1A 3OMCA 3TZDA 5FO7B 1TS5A 5FO9B 1JOOA 1IYUA 2F0IA 1IHZA 3S1NB 1YNNC 2HUGA 1SNOA 3BZDB 2N88A 1PFMA 3CKIB 1D5MC 4KY5A 1TY2A 1VF5C 4ZUIA 3K6OA 1KDCA 3OPOA 2F1MA 4L6TB 3SHLA 1LTAD 1LT3D 3CRKC 2TMPA 1ZKOA 4OIJA 2BOSA 3C3LA 2EXZA 3NXWA 2B2VC 4QF4A 5BN3A 4XXEA 3U9OA 3GV3A 1NSNS 3VR5A 5ELCA 2WACA 5C44B 1TWCB 2AQ2B 2O5JC 1Y8PB 1ILPA 5IT9L 1D6EC 1JR0D 5FK9C 3ND8A 2LS01 2PZTA 1VCIA 2CVRA 1K8OA 1SYEA 1STHA 5M9OA 3K5OA 4CBVA 4MHEA 2C5CA 3BDOA 4KHZA 3FPUB 4IUUA 3K0YA 2CHBD 2KEEA 1G8ZD 1WVLA 2AWNA 3OSOA 2FHTA 3BYYB 1ICWA 3PIP3 3D4WA 1LABA 3QIAA 4YIJA 1SE3A 1F9SA 1GUTA 1A3VA 3GTKB 2EZVA 2ID0A 3I72A 2AUJD 1CTMA 1TVXA 4G57A 3H6MA 2L4NA 3GQBA 4QIWB 3U9SA 5IOCA 1Z6HA 1BBXC 5IGBA 3M3YB 3K5MA 4XYQA 4CHTB 2NYZD 1STYA 2IJ0A 1EY9A 1XXGA 2K7VA 2IX0A 4A3IB 1E2WA 1Y1VB 1WTPA 4HTHA 2TSSA 4X3SA 2RDFA 3KBXA 4O1NA 4A3EB 1B3AA 4EQNA 3Q23A 1I50B 3Q0AA 2LMCB 5IIFA 1Q90A 1IW7D 1YNJC 3J7YW 3M4YA 4U68A 2B2YA 1QILA 2DY8A 3M7NA 1A6XA 1JQYD 3A8IE 5D3IB 1ZYRD 3DWPA 4A3GB 2FMMA 2Z4IA 4LJZC 4KK7A 4DU9A 3VR4A 2F0QA 3MZ5A 5C3EB 1W6KA 3S2DB 2OEOA 4JBWA 2F0SA 1II3A 1ENCA 2EE1A 1TWGB 1V1OA 1TWHB 1TR5A 3RUZA 5HGTA 1PDQA 3MTSA 2HCIA 1K83B 1M4VA 1GUWA 1Y69U 1C8CA 1EY0A 1EQVA 4HCEA 5I2XA 3R3OA 2JA8B 1HCZA 5CBAE 4B9WA 2PMZB 1I4QA 3I3CA 5C0XJ 4S3SA 4LAAA 4FXDA 4HCSA 1I4PA 2BE5D 1FR3A 2B2TC 1AW7A 1VMCA 4XTCS 3HOYB 3IL8A 4JK1C 1Q12A 1GUOA 4KHVA 1BDOA 1I4HA 4CKEA 5CR3A 2I07B 5KEEA 2KEDA 4ZK9B 1HUNA 3NE5B 5DAUA 4ZKBB 1WTQA 4I7ZC 3EROA 2A6ED 1SMYC 2F0TA 3GTPB 1R4PB 5JEAG 3SK8A 5COYA 3WOFA 2RA4A 2WKCA 1Q1EA 2JP1A 4FF4A 2K5QA 3C1EA 1PTOC 1B9MA 3HOWB 4P2CB 1SYCA 2K33A 3T13A 2JA5B 4FF3A 1E2ZA 2KJXA 2AUKA 4RCOA 2JE6I 4C3JB 2XVSA 5A2QL 1B2TA 2KECA 2F0EA 3FRPB 4HN7A 3HS0C 2A5HA 2NZ1D 1H9MA 2NVQB 2K03A 1GUNA 3Q6SA 3MXUA 1A3TA 2ZT9C 2BE5C 2CQAA 2LKVA 5FO8B 4N9TA 1EY7A 4FXKC 4XQNA 1TIID 2PCFB 1L0YB 5CGKA 3GTJB 4RFBA 3L3OC 1WD0A 4OO1G 4RHSA 1GJXA 4DXGA 1Y1WB 1PZKD 1V8QA 2ZXOA 2E74C 4KN4C 1I3QB 5KGUA 3EVQA 5C3WA 2K05A 3LNNA 5C0XG 1NAPA 1PRTF 1XWEA 4XQJA 1WTXA 2Q8TA 1RJTA 1JWMD 3K7AB 4ULLA 2B2VA 1EIHA 1TS2A 3GTOB 3X3MA 3J7AV 2KCCA 4DXFA 2DY7A 3VYRA 3IFDA 2AQ3B 4K5VA 3IFTA 2C9OA 1DOLA 4FVMA 2B2UA 4KY7A 1EZ6A 2A68D 1ML0D 1QJOA 2BDOA 1PTOH 4KKUA 1LT6D 4C3HB 3I91A 5C0XH 2ICIA 5EQ0A 1QWYA 2OT2A 3FVQA 1FD7D 1I4RA 4XT1B 2WIIB 5JEAH 4HSVA 5IGFA 3BVZA 5C4XB 3P1HA 3JAML 2RDHA 5C4ZA 3P7JA 1F9RA 1HA5A 1TY0A 3GV6A 1OXSC 3VA5A 1W6JA 1OO9B 4WFN3 3L7ZC 1PLFA 1WTWA 2X69A 1VDZA 2E2DC 2F0WA 2I46A 3RLFA 3I8ZA 1BQQT 1T5XD 1LTRD 3AMUA 2O5IC 2XNAC 3SXHA 1ENFA 1BO0A 5J1ZA 1VF7A 5C4HA 4F7XA 3GTGB 3G7LA 1QE6A 1EWHA 4F8MA 3UI2A 2VXWA 5AFWA 4XYOA 5HURA 2CW0D 1STGA 3KUPA 3FEWX 3S17B 3K59A 5K5PA 4C56C 1B1ZA 1SE2A 2N55A 1SFOB 2QCPX 3EQLC 1KABA 4KKSA 3SVMA 2B8FA 3A54A 1BUVT 2CW0C 5A2QE 1O7LA 4Z9CB 1EYCA 5EJWA 1KLGD 2OF1A 3PUWA 3PV0A 4XT3B 1SAPA 1AZQA 4X3KA 2QDBA 3S2HB 1G6ZA 4TRDA 1PRTC 2KOLA 3URYA 2NN6H 1F2YA 2KCNA 5C5LA 3MVVA 1DJRD 3OOCA 3G6JB 1S5BD 3H09A 1SDFA 4PMCA 1JE4A 3LWUA 3DWQA 1G291 1SBBB 1TWFB 5EKIA 4ODGA 2JYOA 2WKDA 3NTKA 2K01A 3A8JE 1UEAB 1KNAA 3TP7A 3W2DA 4F87A 1EEID 5J39A 4Y7NB 4K5WA 2PQEA 3KF8A 1AFPA 1EOTA 3DXJC 5I9OA 5CV4A 3ERQA 4EQPA 3HOVB 5E4WC 1SJED 3HEJA 3NUCA 5EPJA 1TS4A 2EJFC 4C1NI 4C1NK 1X32A 4IQZA 1TS3A 4NP5A 4K14A 1I4GA 1B53A 2L55A 4A3MB 5DM73 4EQOA 3OHXC 4X3TA 3NSWA 4H13C 4LK1C 4C3JG 3RZDB 4RKLA 2F0KA 2M2LA 2EY6A 2EPBA 2XRSD 1SNCA 1WTRA 2PW5A 4KD3A 2PO4A 4FXGC 1MGSA 2SOBA 2MPMA 3TP8A 4DGZA 4PNYA 4N9PA 2D5DA 1I4XA 4DAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHZ A;  2LKV A;  3SK4 A;  2F3V A;  1F2Z A;  5IOC A;  4KY6 A;  2F0U A;  1SNO A;  3MXP A;  4N9T A;  5EKL A;  1SNM A;  2KHS A;  3S9W A;  1EY7 A;  3VA5 A;  4DF7 A;  1JOQ A;  2F0J A;  5IGB A;  3OMG A;  4RKB A;  3QOL A;  1EYD A;  4KY5 A;  4ME5 A;  4ZUI A;  3TP7 A;  2EYL A;  3LX0 A;  2F0W A;  4J1M A;  4KHV A;  1TQO A;  1STY A;  5CV5 A;  5C5M A;  1KDC A;  1STB A;  1KAA A;  1NUC A;  3BDC A;  1SYD A;  3QB3 A;  4HMI A;  5CV8 A;  1A2T A;  5CV7 A;  4DFA A;  3NK9 A;  1F2M A;  4K5W A;  5CGK A;  2F0L A;  2PQE A;  5CR3 A;  1EY9 A;  2SNS A;  3SHL A;  5KEE A;  5I9O A;  3MHB A;  5E3F A;  5KYI A;  5CV4 A;  3ERQ A;  3D8G A;  1EY5 A;  3TP8 A;  5KIX A;  2PZU A;  2RBM A;  4HMJ A;  4EQP A;  3SXH A;  1SNP A;  3OWF A;  2SNM A;  4HTH A;  5DAU A;  5C6A A;  5J1Z A;  3QOJ A;  5KRU A;  2F0F A;  2EXZ A;  5C4H A;  2RDF A;  4F7X A;  2EYH A;  1JOK A;  5CV6 A;  5IGG A;  3NP8 A;  3NXW A;  3ERO A;  3EVQ A;  3HEJ A;  3NUC A;  3E5S A;  4QF4 A;  4ZQ3 A;  5C3W A;  5KGU A;  5CV9 A;  4R8N A;  4PMB A;  5IGC A;  5E1F A;  4F8M A;  3NHH A;  4EQN A;  1EY8 A;  2PZW A;  1KDA A;  5IIF A;  3MEH A;  4KV6 A;  3SK5 A;  4NP5 A;  2F0M A;  3DHQ A;  1STG A;  1KDB A;  2EYP A;  3U9O A;  5HUR A;  4K14 A;  5J39 A;  2F0T A;  1STN A;  1NSN S;  4MIU A;  5JOB A;  4ODG A;  2RKS A;  3SK8 A;  2F0O A;  5JAV A;  4IAL A;  1EY4 A;  1EYA A;  5K5P A;  5NUC A;  2WAC A;  2O4X A;  1SYB A;  1A2U A;  3V2T A;  4EQO A;  4IZ8 A;  4J6H A;  1EZ8 A;  5CC4 A;  3C1E A;  4I65 A;  5EKK A;  1KAB A;  2ENB A;  3DMU A;  3C1F A;  1SYG A;  4IUN A;  5IGE A;  3P75 A;  1RKN A;  4NMZ A;  4DU9 A;  4ZUJ A;  3PMF A;  4K5V A;  5I6Y A;  2F0Q A;  3NQT A;  4K6D A;  3MZ5 A;  1STA A;  2PYK A;  2F0H A;  3SK6 A;  1EYC A;  2OEO A;  1SYC A;  3T13 A;  2F0N A;  2OF1 A;  5I6W A;  4RKL A;  1A3U A;  1SNQ A;  2F0G A;  1SND A;  2OXP A;  2F0S A;  4KY7 A;  1EZ6 A;  1ENC A;  1II3 A;  2EYO A;  2F0K A;  2F3W A;  2NUC A;  3TP6 A;  1SYF A;  2PZT A;  2F0V A;  5IGD A;  5IOD A;  2QDB A;  5KYL A;  1JOR A;  2EY6 A;  4KTA A;  1SYE A;  1TR5 A;  4TRD A;  2EYJ A;  3RUZ A;  5EGT A;  1STH A;  4QMG A;  5DEH A;  5HGT A;  4WOR A;  1SNC A;  5M9O A;  4WRD A;  4EVO A;  1F2Y A;  3D6C A;  5C5L A;  2PW5 A;  3BDL A;  4KD3 A;  4KJO A;  3MVV A;  2EYF A;  3EJI A;  1AEX A;  1EY0 A;  2F0E A;  3HZX A;  1EQV A;  4K8J A;  4KJN A;  3T16 A;  3TME A;  2EY2 A;  3R3O A;  5F2D A;  4B9X A;  4QB4 A;  2SOB A;  2F0P A;  4ID6 A;  2F0D A;  4NDX A;  1ENA A;  4K2K A;  3OSO A;  4OL7 A;  3SR1 A;  3TP5 A;  4DGZ A;  5J22 A;  2M00 A;  3D4D A;  5C3X A;  5IGF A;  4K5X A;  1TT2 A;  4PNY A;  3D4W A;  4B9W A;  2PW7 A;  2HQE A;  1U9R A;  4PMC A;  4YIJ A;  2EY1 A;  3P1H A;  4K2L A;  4S3S A;  5ISR A;  1A3V A;  4LAA A;  3OMC A;  4N9P A;  4E6I A;  2EY5 A;  1EY6 A;  1A3T A;  5C4Z A;  4K8I A;  2EYM A;  4H7B A;  5I9P A;  4G57 A;  1JOO A;  2KQ3 A;  4NKL A;  3ITP A;  3H6M A;  4KD4 A;  2F0I A; 
#chains in the Genus database with same CATH topology
 1G2S A;  2EQS A;  5M3M H;  2QA4 A;  2PQA A;  2IX1 A;  1FYC A;  3HOZ H;  1G6P A;  3MC0 B;  4DR7 L;  4CKC A;  3K58 A;  4GKK L;  3OMG A;  1EQR A;  1X6O A;  1C48 A;  4GKJ Q;  4JI0 Q;  1TWF H;  1SSO A;  2B2W A;  2DN8 A;  1CFM A;  3J80 L;  4HID A;  4BY1 B;  5CV7 A;  1OXT A;  3CCE A;  5EBC A;  1E24 A;  1PV4 A;  3ZJY C;  1JMC A;  1H9S B;  2GA4 B;  2VNU D;  3D8G A;  1EY5 A;  4RCN A;  5LMU L;  3NEL A;  5M5X B;  4RMF A;  1QZH A;  1FJG L;  4K0K L;  3STB C;  1PH6 A;  2RCF A;  2BDN A;  3MXG A;  3DUZ A;  4JI1 L;  3PO2 B;  2OQ0 A;  2E8G A;  4WJW A;  1PFN A;  1YZ6 A;  4UP9 A;  2VB2 X;  3E9H A;  1VQG A;  1K8A C;  4P74 A;  4R4C A;  1QOH A;  4GLV B;  1V43 A;  4G4K A;  5G3L D;  2JA5 H;  1HNX L;  4AYB E;  3FKI B;  1HQM C;  3BVG A;  3CCR A;  3S16 H;  1I6H B;  1CKN A;  1Q1B A;  5IP9 H;  2R7D A;  3NTI A;  3ND9 A;  4JI5 Q;  4UY8 C;  4JBK A;  5M3F H;  4QUF A;  4RWS C;  1K0R A;  2K5D A;  3GTM H;  4MNO A;  4JYA L;  2WFW A;  4NMZ A;  2R3Z A;  1NMG A;  5I4D A;  1WD1 A;  4BS9 A;  4DV3 Q;  2K1B A;  4IPD A;  1F77 A;  2A1A A;  3NBI A;  4QUC A;  3PO2 G;  5I6W A;  4ZKC B;  1PRT B;  1DCZ A;  3T56 B;  3NTH A;  4M8A A;  1O7Z A;  4X66 L;  2NN6 G;  4IPC A;  2FFK B;  1FGB D;  2QEJ C;  2Z6B A;  5KND A;  5H1S E;  1IBL Q;  1B4O A;  3D3R A;  3PO3 H;  4XQQ A;  2MUY A;  4UAI A;  4WOR A;  2L15 A;  4R4I A;  1D1K A;  1F9P A;  5T1G A;  1IKL A;  3KJO A;  1VQP A;  4QY7 A;  4IFD G;  3FKI G;  1D5Z C;  1ET6 A;  1DGS A;  5LMU Q;  1KNE A;  2HDM A;  5F2D A;  2UXC Q;  2KCT A;  1MBY A;  2NWG A;  4RH6 A;  3TP5 A;  2E5L L;  3SR1 A;  5J22 A;  2CH4 W;  4X3U A;  2Z4H A;  1QG7 A;  3GO5 A;  4E6I A;  3S2H H;  4K8I A;  2WAQ E;  3MA2 B;  5I9P A;  1DD2 A;  2UXB Q;  3CPF A;  5JJZ A;  4B3R L;  5NUC A;  2E75 C;  2OTJ A;  3EFX D;  1PZI D;  4DN4 M;  3MFY A;  4LMQ D;  1HRJ A;  3OW7 A;  2F4I A;  2F0J A;  2XN9 C;  2HIX A;  4RKB A;  3QOL A;  4A3E H;  1LTG D;  1I50 H;  3BDC A;  1AN8 A;  1SYD A;  1B8A A;  1BOS A;  1N8R C;  1EWI A;  5M3M B;  1LV9 A;  5E3F A;  4GZY C;  5FJ8 H;  1E0B A;  1IZ6 A;  3GTO H;  3CC4 A;  4FO2 A;  1D2B A;  3J81 E;  3T1Y L;  1FNU A;  4RGO S;  4P72 A;  1K28 A;  2MO1 A;  5IGG A;  1JB3 A;  3CW2 C;  5CV9 A;  2L5T A;  4QIW E;  3FDT A;  3RD4 A;  1XMO Q;  2CFM A;  2IL8 A;  3DEO A;  5M3F B;  3ULL A;  3W1B A;  3GD7 A;  4PMW A;  4YCV A;  3T1H Q;  3K57 A;  4OON A;  4JVZ A;  3F2C A;  1T9H A;  2Z0S A;  3BZC A;  1J5E L;  2JA6 B;  3IAY A;  2R93 G;  5M5W H;  4KN7 C;  1EY4 A;  2UUB L;  1ESR A;  1FNV A;  1S5E D;  2A68 C;  4XDX A;  4DR2 L;  1EFI D;  1HNZ Q;  1JJG A;  1NCV A;  5KNB A;  1N32 Q;  4IUN A;  4Q0F A;  3R8B A;  1TWA B;  3T1Y Q;  1FL0 A;  5JVG 3;  4YWK A;  3VYT A;  5K36 H;  1BBU A;  1X65 A;  2F0H A;  3VR2 A;  2VS1 A;  1SRO A;  1XTC D;  3PO3 G;  1NR2 A;  1LTB D;  2F0G A;  2SEB D;  3KK7 A;  3OYY A;  1NJI C;  1WCM G;  1E2V A;  5IGD A;  2JA8 G;  3IKJ A;  2YTV A;  3PUX A;  2UXC L;  2HD3 A;  3PUZ A;  1VQF A;  1KRT A;  1BF4 A;  1VQ8 A;  3K80 C;  1YHB A;  4LFC Q;  4KJO A;  1K8M A;  2AQ1 B;  2FIN B;  4C3I H;  4FNF A;  2JA6 G;  4K8J A;  2R93 B;  2YYZ A;  1UE1 A;  3G6E A;  2XRQ D;  3H3V C;  4B9X A;  3KFU A;  2F0P A;  3TSS A;  4OGQ C;  5T1I A;  5TSS A;  2Q2H A;  1S5F D;  5DLQ E;  2Z6K A;  4BBR B;  2D0O A;  2VQF Q;  3A7A B;  3RLO A;  4A3D B;  3NBH A;  2Z6K C;  2K52 A;  2EY5 A;  1JJ2 A;  3R93 A;  4NXN Q;  4FDB A;  2EYM A;  5GAD C;  2AHO B;  4BY1 G;  3QG1 A;  2KEN A;  3NPP A;  1JOQ A;  4KY6 A;  1QNK A;  1LTS D;  3T53 B;  3J80 c;  4DR4 L;  1ILQ A;  4ALP A;  3IRB A;  1FGU A;  2G9D A;  4J1M A;  1SE8 A;  1UWV A;  1H9S A;  2QIL A;  5C5M A;  1DYQ A;  5C4X H;  5AJ3 Q;  4HR7 B;  2F0L A;  1M1K C;  4RAU C;  4RGM A;  3K7U C;  3CCV A;  5KIX A;  3DEP A;  4LF7 L;  3OWF A;  3J7Z C;  4HJA A;  4JI1 Q;  1PRT D;  2A74 C;  4A76 A;  3HOZ B;  1JOK A;  3BVM A;  4A3B H;  1Y8N B;  3A74 A;  5M3M G;  2AWO A;  3HKS A;  2A69 C;  1DZ1 A;  5E1F A;  1A62 A;  1IYV A;  2CWP A;  2KUM A;  1H9R A;  2WAQ B;  3M4O B;  2ASB A;  4GNX C;  1A0I A;  4HSP A;  2EYP A;  4P71 A;  2VY3 A;  4JI0 L;  5C3E H;  4JC0 A;  2K5W A;  5DM6 3;  1A2U A;  2BA0 A;  1HQR D;  1VQH A;  4J6H A;  5M3F G;  1F2L A;  1RD9 D;  5EKK A;  2OTL A;  3DMU A;  1Q7Y C;  3C1F A;  1SYG A;  3SE0 A;  1Y1V G;  2ZXP A;  4ZUJ A;  4ILW A;  4K6D A;  1GUS A;  1K83 H;  4A93 H;  1PTO D;  2I5L X;  3ONA B;  2NVQ H;  1VQ5 A;  4DKA C;  4IUT A;  4YHH Q;  1JJC B;  4DNT B;  3K81 C;  1A63 A;  2B3G A;  3S16 B;  2EYJ A;  2RVL A;  3MAQ A;  3D4R A;  1ESF A;  4ZYS A;  2UUC Q;  1CKM A;  5CBE E;  1SFO H;  3D0F A;  3GTM B;  3I73 A;  2XSC A;  1AEX A;  2RDG A;  1CUK A;  1AZP A;  1MI2 A;  2VUM H;  4XIG S;  1JT8 A;  4J15 A;  4A3G G;  2M00 A;  3D4D A;  5DNF A;  1EU3 A;  4JI6 L;  2HQE A;  3QO2 A;  4Y7N H;  5GAG C;  3I90 A;  1L0W A;  2MJ8 A;  2MP1 A;  3CC7 A;  1KLU D;  1YIJ A;  3NWT A;  3TS0 A;  1PYB A;  4DR3 Q;  1WTV A;  3N6R A;  4OEM B;  2F0U A;  3NWS A;  3E0E A;  4MN3 A;  3ZYY X;  4KKT A;  2A6H D;  2WP8 J;  4ZRZ A;  1O78 A;  1I5F A;  1QCB D;  2X6G A;  5FLX L;  3QB3 A;  1KAA A;  3WWV A;  5JVH 3;  5CV8 A;  4L63 B;  5ELE A;  1J9O A;  4L5Q A;  3QWN A;  2ICE C;  2VQE L;  2RSN A;  2RBM A;  4HMJ A;  3S14 B;  2BH8 A;  4YWL A;  2SNM A;  3GTL B;  2K04 A;  1PVO A;  3S15 B;  5CV6 A;  3KYH C;  1X3E A;  3OTO Q;  4DV0 Q;  3RR5 A;  2F03 A;  3JAM E;  2B63 G;  2K4K A;  3A56 A;  5COR A;  1EEF D;  4LFB Q;  1C9O A;  2XWB B;  2NZO A;  3R2I A;  1YI2 A;  2HT1 A;  1PFB A;  3HOY G;  2H4O A;  4APV A;  3HP3 A;  1U5K A;  1PTO B;  4RHR A;  1EYA A;  4DNR B;  4CJ1 B;  2AKW B;  3HOV H;  4IOA A;  3H15 A;  4CGY B;  3I4M G;  1WCM B;  3GTQ B;  1Z47 A;  1PH4 A;  4IZ8 A;  5IGE A;  3MWY W;  1VQN A;  1JIC A;  3CCS A;  1L1O B;  3SK6 A;  2B2W C;  2NVX B;  4A3K B;  2NUC A;  5IYC H;  5KYL A;  1VQI A;  5BR8 Q;  1Q86 C;  3CQZ H;  2MFI A;  4NB3 A;  2AMC B;  2JA6 H;  3AB9 A;  1MIU A;  5DEH A;  2OQK A;  4A3D G;  3C2P A;  1IW7 C;  4WRD A;  4QGU A;  1DOM A;  1JE5 A;  3BDL A;  4JI4 Q;  1WTH A;  1BR9 A;  3HZX A;  3TME A;  3U50 C;  2HDL A;  4LF6 Q;  3TDQ A;  1PH1 A;  1KQS A;  1HXY D;  2VUM G;  1QB5 D;  5JPM C;  1RTO A;  4K2K A;  1UAP A;  1NR4 A;  4PV1 C;  1CK1 A;  1U9R A;  5ISR A;  2K32 A;  5K36 G;  1OXV A;  1VQC A;  3HKZ E;  1FNW A;  1L1O C;  4H0L C;  3HOW G;  1XNR Q;  2L1B A;  2J7Z A;  3M3Y H;  1GHK A;  2H1E A;  3I55 A;  1S72 A;  2R92 G;  1SRU A;  2WV6 D;  1GHJ A;  1CA5 A;  1JCK B;  4NKL A;  3ITP A;  2K75 A;  5EKL A;  4RGN A;  2R93 H;  3I70 A;  1NBW A;  2KHS A;  2B2T A;  1Y1V H;  4IFD J;  4GNX B;  2Y0S B;  2EYL A;  3LX0 A;  1A8V A;  1STB A;  3I7F A;  2WB1 B;  2EJG C;  1E3P A;  1JWS D;  1B9N A;  4G7O C;  4YY3 L;  1CA6 A;  1UUP A;  1X54 A;  5E4X A;  4C3I G;  1MSH A;  2NVY B;  1PMR A;  2N3S A;  3S17 H;  3K5N A;  4A3F B;  3QOJ A;  3ER0 A;  4GN5 A;  2F0F A;  5GQO A;  5FJ8 G;  3WOE A;  3K7A H;  4KLK A;  2R92 B;  4UDU C;  4LUV A;  2EDG A;  4IJL A;  3I4N H;  4DA2 A;  3TRZ A;  3NQI A;  2D2C C;  4A3L G;  1ET9 A;  3H0G H;  3S24 A;  2F0M A;  3HRZ C;  2JEB I;  1IYJ B;  3PIO 3;  2B39 A;  1XX8 A;  1I3Q H;  3RMH A;  1NTG A;  2HHH Q;  4RGT A;  3PO3 B;  1ZXT A;  3PIP A;  4POF A;  1HA6 A;  2O4X A;  3MEF A;  4YCU A;  5CC4 A;  2FMC A;  1I94 Q;  4DK3 C;  4EGV A;  3DWA A;  2BCO A;  1ASZ A;  3WDN A;  2EJM A;  4KHP Q;  2EVB A;  2X6L A;  1X55 A;  2OXP A;  4QJF A;  1K3R A;  2A6E C;  2F0V A;  2L9H A;  3KLS X;  1JOR A;  1Q3L A;  3FKI H;  3KDF A;  1X3P A;  1I6H H;  4DV6 L;  1HZB A;  1CKN B;  1MSG A;  2Q8I B;  4CJ0 B;  4EVO A;  5ELB A;  4C2M B;  2I0Q A;  4M1U B;  4ME3 A;  4X62 Q;  3PUY A;  1QNU A;  1EIY B;  3VR6 A;  2FJ2 A;  5IYD H;  4YY3 Q;  1PZJ D;  4DAP A;  1IBK L;  2L0C A;  1KL9 A;  1R9T B;  1STE A;  2PW7 A;  4BY7 B;  1H9K A;  1K8G A;  3E0J A;  5FLX E;  1V1P A;  3K5L A;  3BS1 A;  1SEB D;  3L9A X;  1EY6 A;  4DK0 A;  2PNH A;  4ABN A;  1VMP A;  1W2B A;  2JA8 H;  1V1P B;  5D14 A;  3Q22 A;  4ZAI A;  4B3S Q;  1F2Z A;  3S9W A;  2DUD A;  2NVY H;  4OIK A;  5LL6 S;  3N52 A;  1HR0 Q;  3RLN A;  3U58 A;  1YNX A;  2RF4 A;  1TQO A;  1NUC A;  1S5D D;  4IPG A;  4PG3 A;  5IT9 E;  1GD7 A;  1HFG A;  3RZO B;  3GTK H;  5LL6 X;  1TXY A;  4IFD H;  3PSI A;  3MHB A;  5D3D A;  2B63 B;  1VQM A;  1VQ9 A;  4LF6 L;  3HOY H;  2PZU A;  5M5W B;  3AFP A;  5CMD A;  3CC2 A;  4BY7 G;  4DR5 L;  2NN6 I;  5C6A A;  1EL0 A;  1U4R A;  1E7Z A;  4DR5 Q;  1A15 A;  3NP8 A;  3TZU A;  5M5Y B;  3AU7 A;  1RL2 A;  2R7F A;  3W3A A;  4R8N A;  1CM9 A;  4CJ2 C;  1JC7 A;  3I4M B;  5BR8 L;  2B8G A;  4DV5 L;  1C4Q A;  3MEH A;  3UDI A;  1LTI D;  2PNR C;  3C46 A;  4U67 3;  3G4S A;  2NVT H;  5C4J B;  1WTO A;  4N8X 1;  1HR0 L;  1CT1 D;  4DV5 Q;  1BNZ A;  3SDZ A;  1RCV D;  1TKW B;  2LXJ A;  2XGT A;  1PH5 A;  3BJU A;  1Y8O B;  3KLS A;  3H0G B;  2EXD A;  3J80 E;  3PMF A;  2E2I B;  1XTD A;  5EPL A;  2JEA I;  3HKZ B;  3CHB D;  2XWJ B;  2JA7 H;  1SNQ A;  4LFB L;  2MO0 A;  2F3W A;  1R4Q B;  3D6W A;  4K6L A;  2Z9H A;  1X9N A;  3AQQ A;  1IBK Q;  3NEN A;  1DOK A;  2I5H A;  2WAQ G;  3HGB A;  2M9V A;  1QUQ A;  4X62 L;  1R9T H;  3D6C A;  4AYB G;  5KNC A;  4A3G H;  1YJ9 A;  4AH6 A;  4JOI A;  3T16 A;  1TWA H;  2PPB C;  1HHV A;  1HZC A;  3I4L A;  4ID6 A;  4OL7 A;  1ENA A;  1PXU A;  3TS2 A;  2I5M X;  3O13 A;  1OTC A;  4BA2 I;  4RG1 A;  4K5X A;  4V0B A;  4C3J H;  2QW7 A;  2RHS B;  3D31 A;  3HOX B;  4K2L A;  1GKH A;  2A6H C;  4DR6 L;  1EOV A;  3F2U A;  3PUV A;  4IUQ A;  4TKO B;  4R9W A;  5L37 A;  3H3V H;  5EPK A;  5A35 A;  1CHQ D;  5I2Y A;  3PO2 H;  4L8J A;  4DF7 A;  2A73 B;  4DUY L;  1ZEQ X;  4G7Z C;  1I6V C;  1LAC A;  1EYD A;  1IKM A;  4A3F G;  2B2U C;  5CV5 A;  4JG2 A;  1UEB A;  1HZA A;  2LXK A;  2B2Y C;  1LO5 D;  3BG3 A;  4V19 0;  5C44 G;  1K9M C;  4HJ7 A;  4JW0 A;  2K6A A;  4G7H C;  3KLR A;  4UP8 A;  1HPC A;  2NB0 A;  4KHP L;  2F4V Q;  1VQJ A;  2UUC L;  2EYH A;  4GN4 B;  5G3L F;  4PZ7 A;  4LNQ A;  2MGS A;  3TBI B;  2Q2I A;  2DNE A;  1LTT D;  4YHH L;  4OHJ A;  3SK5 A;  1KDB A;  4Q5V A;  1UE5 A;  4MIU A;  1MD2 D;  3PF4 A;  4JCV E;  3RZD H;  4IUP A;  1VQ6 A;  4TSS A;  1CQV A;  1SYB A;  1X3G A;  2G9H D;  2QDL A;  5BN5 A;  1O7I A;  1EWC A;  1XYI A;  4LW1 A;  1EZ8 A;  2E76 C;  3VYS A;  4BWG B;  1CKO A;  2ENB A;  1BVS A;  1L0X B;  2IHF A;  3I4N B;  4FF2 A;  1SJH D;  1HR0 W;  2PYK A;  1LT5 D;  3OIQ A;  3HOZ G;  2QF7 A;  1SND A;  1ONL A;  1PYW D;  2L12 A;  3J81 L;  3H0G G;  2D9U A;  1KTK A;  4FF1 A;  4HJ5 A;  1S40 A;  1V9P A;  3ICE A;  2K28 A;  3HKZ G;  2JA7 B;  2K5V A;  1UNS A;  3E9I A;  2DNC A;  4R1J A;  4JPB W;  2PI2 A;  3J80 i;  4QB4 A;  1F9Q A;  3F2B A;  4HED A;  1VQO A;  3EA6 A;  2O2L D;  2LY7 A;  3B6Y A;  1LT4 D;  4JI8 Q;  3MXN A;  3P20 A;  3TQY A;  5AJ3 L;  3J7A F;  4BBS H;  4DAY B;  1YNN D;  2JN4 A;  3FPP A;  3OWE B;  4H7B A;  4L5S A;  3A7L A;  3PGZ A;  2KQ3 A;  1TU2 B;  4KD4 A;  2E2J B;  5C0X I;  2F3V A;  4R8I A;  3MXP A;  1SNM A;  4DV1 L;  1PFS A;  4X64 L;  3Q8D A;  2YTX A;  3F1Z A;  4FP5 D;  1U4M A;  4ME5 A;  2EOT A;  1G2T A;  1M8A A;  4HAE A;  2JA7 G;  1VQL A;  2V4D A;  1PTO F;  4HMI A;  4WJ3 M;  1A2T A;  1U0L A;  2Z8L A;  3NK9 A;  2SNS A;  4OO1 I;  2D62 A;  3S1R B;  4LF9 L;  1SNP A;  2RSO A;  3VR3 A;  1DM0 B;  1RF2 D;  3KF6 B;  4DUZ Q;  4CDE C;  2K50 A;  2JQO A;  3E5S A;  3MFG A;  1S4Z A;  3DM1 A;  4PMB A;  2CWA A;  2ZM6 L;  1X3Q A;  3M7G A;  1EY8 A;  3NHH A;  1C0A A;  2YU9 B;  3U4V A;  3GTJ H;  4DV2 L;  1STN A;  1XMQ Q;  5JOB A;  1EUJ A;  1O7Y A;  3E6Z X;  2RKS A;  4MZ9 A;  4LUO A;  5JAV A;  4QQB X;  4H44 C;  4HIM A;  5FLM G;  5D65 A;  1SXT A;  1DON A;  3V2T A;  3S1Q B;  4DR2 Q;  4C3I B;  4DR3 L;  1C7Y A;  4JI3 L;  1NMF A;  3P75 A;  5LMN Q;  2R6G A;  3F8T A;  4IFD I;  3I4M H;  1M90 C;  1BKB A;  4B08 A;  2F0N A;  2WIN B;  5EBD A;  3M4P A;  2EYO A;  4OWX B;  5IOD A;  1PH3 A;  3M85 A;  1CZW A;  1XPU A;  2WB1 E;  4NW2 A;  4QMG A;  5EGT A;  2QEX A;  3ERS X;  2L11 A;  1YNJ D;  4CDC C;  5GRO A;  3Q24 A;  2IX3 A;  1EU4 A;  4JBJ A;  1YJN A;  1BCP F;  4J8Q A;  4R4O A;  3A5Z B;  2EY2 A;  3FMC A;  1B3Q A;  2R7Z B;  1QVF A;  2J0T D;  3W5O A;  2DJF C;  3F2D A;  1QZG A;  1EYG A;  4C3H G;  5FKA C;  3CQZ B;  3LGJ A;  2JSO A;  4JI6 Q;  4DAY A;  1JB7 A;  1EQT A;  5JPN C;  1SMY D;  1AP0 A;  3GDE A;  4O0A A;  5ELO A;  2UXB L;  5IWA L;  5ELN A;  2LFN A;  2ZXR A;  4DPG A;  4BBS B;  4RA8 A;  1D1I A;  1CI3 M;  2IPK D;  2H5X A;  4I7A A;  4DFA A;  4A3J H;  2QKI C;  3STB D;  3KF8 B;  1F2M A;  1N33 Q;  4KMU C;  4LF5 Q;  3HOU B;  2E5L Q;  5IY0 A;  5IE8 A;  5KYI A;  1GXD C;  1H9J A;  2B29 A;  2YU9 H;  4L5R C;  1KC8 C;  3OIP A;  4A4I A;  3GP7 A;  3QJY A;  2BA1 A;  4ZQ3 A;  1JWU D;  3V96 A;  1BXT A;  5FOB B;  2JJQ A;  4EQ5 A;  2KA7 A;  3CRL C;  4A3M H;  1IBM L;  1HUM A;  1KDA A;  4X66 Q;  4A3L H;  4A93 B;  4KV6 A;  3DHQ A;  1DXM A;  3QR8 A;  2A8V A;  3AEV A;  3I4N G;  3G48 A;  2UXD Q;  5ELD A;  1L1O A;  2HQL A;  2FXQ A;  1LLR D;  2F0O A;  4LWC A;  3SGI A;  4JYA Q;  3A55 A;  2WB1 G;  2NTS A;  4B3T L;  2IW3 A;  1KHI A;  5EAY A;  2C35 B;  1ROD A;  4I65 A;  2RQX A;  1B50 A;  1RKN A;  4R4Q A;  1U4L A;  5I6Y A;  4AYB B;  1S5C D;  4IUR A;  1STA A;  3CCM A;  2OCE A;  4ZLT F;  4LF7 Q;  2UXD L;  1NE3 A;  3A8K E;  1A3U A;  2NTT A;  1CQF A;  2IT1 A;  3SEB A;  3TP6 A;  4UHV A;  1SYF A;  4POG A;  4CDD C;  2KVM A;  1SR3 A;  2ZJP A;  1BBW A;  4KTA A;  4A75 A;  2XIW A;  1QVG A;  3VA7 A;  3UDG A;  2MHV A;  4DV4 Q;  2KBN A;  2VL6 A;  1GM5 A;  1KRS A;  1EIG A;  4DR4 Q;  4OO1 H;  3R2T A;  3EJI A;  4KJN A;  4A3B G;  3BU2 A;  3HOW H;  2A69 D;  4PQX A;  1Q8I A;  1RDP D;  4NDX A;  4LF5 L;  1HTL D;  4YCW A;  5C3X A;  1BCP C;  1TT2 A;  3FHW A;  3TN2 A;  1RTN A;  4IOC A;  1OXU A;  1Z7T A;  2F3I A;  5HY6 A;  1N36 Q;  2VB3 X;  2VQF L;  4A3I H;  4GKK Q;  4DR7 Q;  5JEA J;  4A3J B;  3CAM A;  3H91 A;  4GOP C;  1CHP D;  3SK4 A;  4DV0 L;  3OTO L;  1XPR A;  4KI0 A;  3CU7 A;  4GNX A;  2Z1C A;  1J5E Q;  4F88 A;  4OWW B;  3K8A A;  4TVA B;  3J81 j;  4IUV A;  4BXX H;  2VQE Q;  4R4T A;  1MJE A;  4A3B B;  4CKB A;  4DK1 A;  3T4A C;  5C4J H;  1B44 D;  4BXX G;  1V1Q A;  3PCO B;  1HTP A;  4WJ4 A;  5LHY 1;  5KRU A;  2HCC A;  3S1M B;  1P8L A;  1GUG A;  1BCP D;  1CZG A;  1OXX K;  1P16 A;  5IGC A;  2NBF A;  2UUB Q;  4QCL A;  1XNQ L;  1CSP A;  2PZW A;  4A3I G;  4TQU S;  4DK6 C;  1O80 A;  1SE4 A;  1GOZ A;  1W3S A;  2IWH A;  1D5X C;  4IN3 A;  1Y1W H;  4FYD A;  1TWG H;  3CP0 A;  2E2H B;  2YV5 A;  4IAL A;  1ZYR C;  3VYU A;  5LMN L;  4JI3 Q;  2P5Z X;  5CYU A;  2Q8R E;  3CD6 A;  1HFN A;  4BA1 I;  2SDF A;  2JXM B;  3T51 B;  1T5E A;  2J4X A;  3X3N A;  1BCP B;  1U4P A;  2GVA A;  3NQT A;  1XMQ L;  3BYT B;  3KBG A;  2R7Z G;  1HNW Q;  2DGY A;  2NVT B;  2VUM B;  1IL8 A;  4ZCK A;  1HH2 P;  1X56 A;  1CSQ A;  2R61 A;  4X65 Q;  1G91 A;  4O42 A;  3OW2 A;  2EYF A;  1J8I A;  5BN4 A;  3H94 A;  3G71 A;  4DAM A;  4DV4 L;  5FLX c;  2IY5 B;  3LWE A;  3V05 A;  2F0D A;  5ELF A;  1RIP A;  3HG9 A;  1XJV A;  1RHP A;  2EY1 A;  3OMC A;  3TZD A;  5FO7 B;  2Y0S G;  4IO9 A;  1TS5 A;  4C3H H;  4X64 Q;  5FO9 B;  3HFZ B;  1JOO A;  4DV1 Q;  3VDY A;  1IYU A;  2F0I A;  1IHZ A;  1N34 Q;  3S1N B;  3HOU G;  1YNN C;  2HUG A;  1SNO A;  3BZD B;  2N88 A;  4JI5 L;  1PFM A;  3CKI B;  3CF5 A;  3K0X A;  1D5M C;  4LF8 L;  4KY5 A;  1VQK A;  1TY2 A;  1VF5 C;  4ZUI A;  1IXR A;  3K6O A;  1KDC A;  1IBL L;  4O2D A;  3OPO A;  2F1M A;  4L6T B;  3SHL A;  1X3F A;  1LTA D;  1LT3 D;  3CRK C;  2CQO A;  2TMP A;  1ZKO A;  3KF6 A;  4GN3 B;  4OIJ A;  2BOS A;  3C3L A;  2EXZ A;  1FJG Q;  4K0K Q;  3NXW A;  1D8L A;  2B2V C;  4QF4 A;  2G5D A;  1YJW A;  1YVC A;  5BN3 A;  4XXE A;  4NXN L;  1N33 L;  3U9O A;  3GV3 A;  3S1M H;  4PZ8 A;  1NSN S;  2PMZ E;  3VR5 A;  5ELC A;  2WAC A;  4A3K H;  3GTG H;  4BBR G;  3A0J A;  5C44 B;  1YHA A;  1TWC B;  2JA9 A;  2AQ2 B;  4GOP B;  4X6A H;  2O5J C;  1Y8P B;  3EIV A;  1ILP A;  4LFC L;  5IT9 L;  1D6E C;  1JR0 D;  5JJK A;  5FK9 C;  3ND8 A;  2LS0 1;  4BY7 H;  2PZT A;  1VCI A;  2CVR A;  1K8O A;  1SYE A;  4GS3 A;  1STH A;  1WFQ A;  5M9O A;  3K5O A;  4CBV A;  4MHE A;  2C5C A;  1AE2 A;  3BDO A;  4KHZ A;  3U4Z A;  2XTI A;  3FPU B;  4IUU A;  3K0Y A;  2CHB D;  1HNZ L;  2KEE A;  1G8Z D;  1WVL A;  2AWN A;  3OSO A;  2FHT A;  3BYY B;  1ICW A;  3PIP 3;  3D4W A;  1LAB A;  3QIA A;  4YIJ A;  1SE3 A;  1F9S A;  1GUT A;  1A3V A;  3GTK B;  4BBS G;  4DNI A;  2EZV A;  3T1H L;  4HIO A;  2ID0 A;  3S1R H;  3I72 A;  1AH9 A;  2AUJ D;  4DUY Q;  1CTM A;  1TVX A;  4G57 A;  4A3K G;  1PYS B;  1SLJ A;  3H6M A;  2L4N A;  3GQB A;  4QIW B;  3U9S A;  3DLL A;  1XMO L;  5IOC A;  1SN8 A;  3M9B A;  1Z6H A;  1BBX C;  3NBH B;  5IGB A;  4JBM A;  3M3Y B;  3K5M A;  4XYQ A;  4HJ8 A;  4CHT B;  2NYZ D;  1STY A;  2IJ0 A;  4A3M G;  3S1N H;  1EY9 A;  1XXG A;  2PI2 E;  2ZM6 Q;  2K7V A;  2IX0 A;  2JK8 A;  4AQY L;  4A3I B;  1E2W A;  1YIT A;  1S3O A;  1Y1V B;  3E3X A;  1LTL A;  4DUZ L;  3M4O H;  1WTP A;  4HTH A;  3J81 c;  2TSS A;  2MNA A;  4X3S A;  3GTP H;  2RDF A;  3KBX A;  4LF9 Q;  4O1N A;  4A3E B;  2UUA Q;  5GAH C;  1B3A A;  1WOC A;  4JV5 Q;  4EQN A;  3Q23 A;  4B3R Q;  3L2P A;  1I50 B;  3Q0A A;  2LMC B;  5IIF A;  3CXC A;  2OWO A;  1Q90 A;  1N36 L;  4GOP A;  1UE7 A;  1IW7 D;  1YNJ C;  3J7Y W;  3M4Y A;  2R92 H;  4U68 A;  2B2Y A;  1QIL A;  2DY8 A;  3M7N A;  1A6X A;  1JQY D;  3A8I E;  5D3I B;  2VZA A;  1ZYR D;  3CPW A;  3DWP A;  4A3G B;  2F52 A;  2FMM A;  2VW9 A;  2Z4I A;  4LJZ C;  4B3M Q;  4KK7 A;  4DU9 A;  2KHJ A;  2ATW A;  3VR4 A;  2F0Q A;  3MZ5 A;  5C3E B;  1W6K A;  3S2D B;  2N8N A;  2OEO A;  4JBW A;  2F0S A;  1II3 A;  1ENC A;  4A3E G;  1KD1 C;  2A19 A;  2K14 A;  2EE1 A;  5C44 H;  4DV7 L;  1TWG B;  1V1O A;  1TWH B;  2E2H H;  4L5T A;  1TR5 A;  3RUZ A;  5HGT A;  1PDQ A;  1VQE A;  4NXM Q;  4DV3 L;  3MTS A;  2HCI A;  1K83 B;  1MHW C;  2PQA B;  3KLW A;  1M4V A;  5IP9 G;  1Y69 U;  1C8C A;  1EY0 A;  1GUW A;  1EQV A;  4HCE A;  5I2X A;  3R3O A;  3KJP A;  1IL2 A;  4B3T Q;  2JA8 B;  2DJG C;  4JOI C;  1HCZ A;  5CBA E;  3UE1 A;  4B9W A;  2PMZ B;  1I4Q A;  3I3C A;  5C0X J;  4C2M H;  4S3S A;  1HNX Q;  4LAA A;  4GLA C;  3HOU H;  4UP7 A;  1E1T A;  4FXD A;  4HCS A;  1IBM Q;  2Y0S E;  1I4P A;  3H3V I;  2BE5 D;  2EIF A;  1FR3 A;  2B2T C;  1AW7 A;  1AE3 A;  1VMC A;  1Y1W G;  1PH8 A;  2B63 H;  2N78 A;  3MXN B;  4XTC S;  3HOY B;  1NNX A;  3FP9 A;  3IL8 A;  4JK1 C;  1Q12 A;  3J7A 5;  1GUO A;  4KHV A;  1KAW A;  4JI2 L;  1BDO A;  1I4H A;  4CKE A;  5CR3 A;  2I07 B;  1J6Q A;  5KEE A;  2KED A;  4ZK9 B;  1PHJ A;  1HUN A;  4LF4 L;  4GKJ L;  2QGQ A;  3NE5 B;  5DAU A;  3I4O A;  4ZKB B;  3AFQ A;  1WTQ A;  4A3C G;  3UE0 A;  5IWA Q;  3JAM c;  5JJI A;  4I7Z C;  3ERO A;  2UU9 L;  4DV6 Q;  2A6E D;  2JA5 G;  2KHI A;  1MJC A;  5IP7 H;  5LMN W;  2GVB A;  4A3C H;  1SMY C;  3S14 H;  4DR1 L;  3HOV G;  2F0T A;  3TEH B;  3CCL A;  3GTP B;  1R4P B;  1EIF A;  5JEA G;  3SK8 A;  5COY A;  5M5Y H;  3S2D H;  3ULJ A;  3WOF A;  2NVX H;  2ZTE A;  2RA4 A;  2WKC A;  1Q1E A;  2JP1 A;  4FF4 A;  2K5Q A;  3C1E A;  3ULP A;  1PTO C;  1TWH H;  1B9M A;  2F4V L;  3HOW B;  1QVC A;  2NZH A;  4DR6 Q;  4P2C B;  1SYC A;  2K33 A;  1Q8K A;  3T13 A;  1ASY A;  1E1O A;  5IYB G;  2JA5 B;  3DM3 A;  4FF3 A;  1E2Z A;  1WYD A;  2KJX A;  2AUK A;  4RCO A;  1B70 B;  2JE6 I;  3CCQ A;  4C3J B;  2Q2T A;  3EBE A;  2XVS A;  5A2Q L;  1B2T A;  2KEC A;  2F0E A;  2RCN A;  3FRP B;  4HN7 A;  2CH4 A;  3HS0 C;  2A5H A;  2HIV A;  2NZ1 D;  1H9M A;  2NVQ B;  2K03 A;  4OWT B;  1GUN A;  3Q6S A;  2YTY A;  3MXU A;  1A3T A;  4DV2 Q;  2ZT9 C;  2BE5 C;  2CQA A;  1HJP A;  2LKV A;  4OEL B;  2CKZ B;  5FO8 B;  1UE6 A;  4N9T A;  1PH2 A;  3HOX H;  1EY7 A;  3CCU A;  1NY4 A;  4FXK C;  4XQN A;  1TII D;  4JI7 Q;  1FVI A;  2K5N A;  2PCF B;  4OX9 Q;  1L0Y B;  5CGK A;  3GTJ B;  3I2Z A;  4RFB A;  1MKH A;  3L3O C;  1WD0 A;  4OO1 G;  4RHS A;  1GJX A;  4DXG A;  1Y1W B;  3PQI A;  1PZK D;  1V8Q A;  1LYL A;  3HOX G;  1Z9F A;  2ZXO A;  2E74 C;  4KN4 C;  1I3Q B;  2GN5 A;  5KGU A;  3EVQ A;  1VQD A;  5C3W A;  2K05 A;  3JC6 6;  4A3J G;  3LNN A;  5GAE C;  5C0X G;  1NAP A;  1PRT F;  1XWE A;  4XQJ A;  1G51 A;  5J3B A;  2N49 A;  1WTX A;  2Q8T A;  3UDF A;  4OX9 L;  1RJT A;  4A3F H;  4JI7 L;  1JWM D;  3K7A B;  4ULL A;  2B2V A;  5C3E G;  1EIH A;  4JI8 L;  1TS2 A;  3GTO B;  3X3M A;  3J7A V;  4P73 A;  1PH9 A;  4B3M L;  2ZJR A;  2KCC A;  4DXF A;  2DY7 A;  3VYR A;  3IFD A;  2AQ3 B;  4K5V A;  2CCZ A;  3L0O A;  3IFT A;  3UDX A;  2C9O A;  1B7Y B;  1DOL A;  1LM0 A;  2B2U A;  4FVM A;  4KY7 A;  1EZ6 A;  2A68 D;  4JV5 L;  4AIM A;  1ML0 D;  1QJO A;  2BDO A;  4CDF C;  2UUA L;  3PF5 A;  1K73 C;  1WJJ A;  1Y14 B;  1PTO H;  4KKU A;  1LT6 D;  4IPH A;  4C3H B;  3I91 A;  5C0X H;  3I56 A;  1WCM H;  3GTQ H;  2ICI A;  5EQ0 A;  1QWY A;  2OT2 A;  3FVQ A;  1FD7 D;  1I4R A;  4XT1 B;  4AQY Q;  4HIK A;  1N9W A;  2WII B;  5JEA H;  4HSV A;  2E2J H;  5IGF A;  3BVZ A;  5C4X B;  4BY1 H;  3P1H A;  3JAM L;  2RDH A;  3RN5 A;  5C4Z A;  5IP7 G;  3P7J A;  1VQA A;  1F9R A;  1HA5 A;  4YWM A;  1TY0 A;  1EQQ A;  3GV6 A;  1OXS C;  3VA5 A;  1W6J A;  1OO9 B;  4LFA Q;  3L7Z C;  1PLF A;  4WFN 3;  1WTW A;  2HHH L;  2X69 A;  1VDZ A;  2E2D C;  3M4Q A;  2F0W A;  4BBR H;  2I46 A;  4A3D H;  3RLF A;  3I8Z A;  1BQQ T;  2IHE A;  1H95 A;  1T5X D;  1LTR D;  3AMU A;  3RNU A;  2O5I C;  2XNA C;  1K3B C;  2UU9 Q;  3SXH A;  3CMA A;  1ENF A;  1BO0 A;  2Q2U A;  4H02 A;  5J1Z A;  1VF7 A;  5C4H A;  5HGQ A;  4F7X A;  3GTG B;  4LFA L;  1TWC H;  2LSS A;  3G7L A;  4LF4 Q;  1QE6 A;  4NPS A;  2ZJQ A;  1XPO A;  1EWH A;  4P75 A;  4F8M A;  3UI2 A;  2VXW A;  3S1Q H;  5AFW A;  4XYO A;  5HUR A;  2CW0 D;  1STG A;  4MTN A;  4JI2 Q;  1VQB A;  3KUP A;  3FEW X;  2KCM A;  5IYB H;  4DR1 Q;  3S17 B;  3K59 A;  5K5P A;  4C56 C;  1B1Z A;  1SE2 A;  2N55 A;  2QCP X;  1SFO B;  3EQL C;  1PA6 A;  1KAB A;  1YHQ A;  4KKS A;  3KOJ A;  3SVM A;  2B8F A;  3A54 A;  2K5H A;  1BUV T;  2CW0 C;  5E7N A;  5A2Q E;  1XNR L;  1O7L A;  4Z9C B;  1EYC A;  3JAM i;  5EJW A;  1KLG D;  2OF1 A;  3PUW A;  3PV0 A;  4XT3 B;  3TRE A;  4PZ6 A;  1SAP A;  1AZQ A;  2ZTC A;  3CME A;  5IYD G;  3NEM A;  2QDB A;  4X3K A;  1ICF B;  4N8F A;  3S2H B;  1G6Z A;  4TRD A;  1PRT C;  2D0P A;  2KOL A;  3URY A;  2NN6 H;  1F2Y A;  2KCN A;  5C5L A;  3MVV A;  4QL5 A;  1DJR D;  3OOC A;  4NXM L;  2ZTD A;  3G6J B;  5JJL A;  1S5B D;  3H09 A;  5IT9 c;  1VQ7 A;  1SDF A;  4PMC A;  1GO3 E;  1JE4 A;  1D7Q A;  1VS0 A;  2ALY B;  1SMX A;  4LF8 Q;  3LWU A;  2R7Z H;  3DWQ A;  1G29 1;  1SBB B;  1TWF B;  5EKI A;  1YEZ A;  4ODG A;  2JYO A;  2WKD A;  1N34 L;  3NTK A;  2K01 A;  4EX5 A;  3S15 H;  1L2F A;  4GLX A;  4JI4 L;  3A8J E;  1UEA B;  1KNA A;  1Q46 A;  3TP7 A;  3W2D A;  3RN2 A;  4F87 A;  1EEI D;  5J39 A;  4Y7N B;  1LUZ A;  4K5W A;  4DV7 Q;  2PQE A;  3W1G A;  3KF8 A;  5FLM H;  1AFP A;  1EOT A;  3DXJ C;  5I9O A;  1VQ4 A;  5CV4 A;  3EN2 A;  3ERQ A;  1EFW A;  4EQP A;  1K0S A;  1PH7 A;  3HOV B;  3AYH B;  2ES2 A;  5E4W C;  4X65 L;  1SJE D;  1YBY A;  1HZ9 A;  3HEJ A;  3NUC A;  4MTK A;  5EPJ A;  1TS4 A;  2EJF C;  3PIO A;  4B3S L;  4C1N I;  4C1N K;  2BH2 A;  4UPA A;  5M5X H;  1HNW L;  1X32 A;  4LUZ A;  4IQZ A;  1KIX A;  1TS3 A;  4NP5 A;  3RZO H;  4K14 A;  3CCJ A;  1I4G A;  1B53 A;  1Q81 C;  4Y52 H;  1QUQ B;  1N32 L;  2L55 A;  3GTL H;  4A3M B;  4OXP A;  5DM7 3;  4EQO A;  4HJ9 A;  3OHX C;  4X3T A;  3NSW A;  4H13 C;  4LK1 C;  4C3J G;  1E22 A;  3RZD B;  4RKL A;  2F0K A;  2M2L A;  1KXL A;  1XNQ Q;  2EY6 A;  3BZK A;  2EPB A;  4IJH A;  3J81 i;  2XRS D;  4A93 G;  1SNC A;  2MQH A;  5C4X G;  1WTR A;  2PW5 A;  4KD3 A;  2PO4 A;  1Q82 C;  1WI5 A;  2RHQ B;  2E2I H;  2V1C C;  4FXG C;  1MGS A;  1I94 L;  2SOB A;  2MPM A;  3TP8 A;  3KDF B;  5IYC G;  4DGZ A;  4PNY A;  4N9P A;  2D5D A;  1I4X A;  1GVP A;  4DAV A;  3A5U A; 
#chains in the Genus database with same CATH homology
 1G2S A;  2IX1 A;  1FYC A;  3MC0 B;  4CKC A;  3K58 A;  3OMG A;  1C48 A;  1SSO A;  2B2W A;  2DN8 A;  1CFM A;  3J80 L;  4BY1 B;  5CV7 A;  1OXT A;  5EBC A;  1H9S B;  2GA4 B;  2VNU D;  3D8G A;  1EY5 A;  4RCN A;  5M5X B;  2BDN A;  3MXG A;  3DUZ A;  3PO2 B;  4WJW A;  1PFN A;  2VB2 X;  1QOH A;  1V43 A;  4G4K A;  5G3L D;  3FKI B;  1HQM C;  3BVG A;  1I6H B;  1Q1B A;  3NTI A;  3ND9 A;  4QUF A;  4RWS C;  2K5D A;  4NMZ A;  2R3Z A;  5I4D A;  1WD1 A;  4BS9 A;  2K1B A;  1F77 A;  3NBI A;  4QUC A;  5I6W A;  4ZKC B;  1PRT B;  1DCZ A;  3T56 B;  3NTH A;  4M8A A;  1O7Z A;  2NN6 G;  2FFK B;  1FGB D;  2QEJ C;  5KND A;  1B4O A;  3D3R A;  4XQQ A;  2MUY A;  4UAI A;  4WOR A;  1D1K A;  1F9P A;  5T1G A;  1IKL A;  4IFD G;  1D5Z C;  1ET6 A;  1KNE A;  2HDM A;  5F2D A;  1MBY A;  2NWG A;  4RH6 A;  3TP5 A;  3SR1 A;  5J22 A;  4X3U A;  2Z4H A;  1QG7 A;  3GO5 A;  4E6I A;  4K8I A;  3MA2 B;  5I9P A;  1DD2 A;  5JJZ A;  5NUC A;  2E75 C;  3EFX D;  1PZI D;  4DN4 M;  3MFY A;  4LMQ D;  1HRJ A;  3OW7 A;  2F4I A;  2F0J A;  2XN9 C;  4RKB A;  3QOL A;  1LTG D;  3BDC A;  1AN8 A;  1SYD A;  1BOS A;  5M3M B;  1LV9 A;  5E3F A;  4GZY C;  1E0B A;  4FO2 A;  1D2B A;  3J81 E;  1FNU A;  4RGO S;  5IGG A;  1JB3 A;  5CV9 A;  2L5T A;  3FDT A;  3RD4 A;  2IL8 A;  3DEO A;  5M3F B;  3GD7 A;  4PMW A;  3K57 A;  2JA6 B;  3IAY A;  4KN7 C;  1EY4 A;  1ESR A;  1FNV A;  1S5E D;  2A68 C;  4XDX A;  1EFI D;  1NCV A;  5KNB A;  4IUN A;  4Q0F A;  3R8B A;  1TWA B;  5JVG 3;  5K36 H;  3VYT A;  2F0H A;  3VR2 A;  1XTC D;  1NR2 A;  1LTB D;  2F0G A;  2SEB D;  3KK7 A;  1E2V A;  5IGD A;  3IKJ A;  3PUX A;  3PUZ A;  1BF4 A;  4KJO A;  1K8M A;  2AQ1 B;  2FIN B;  4FNF A;  2R93 B;  4K8J A;  2YYZ A;  2XRQ D;  3H3V C;  4B9X A;  2F0P A;  3TSS A;  4OGQ C;  5T1I A;  5TSS A;  1S5F D;  4BBR B;  3A7A B;  4A3D B;  3NBH A;  2EY5 A;  3R93 A;  2EYM A;  3QG1 A;  3NPP A;  1JOQ A;  4KY6 A;  1QNK A;  1LTS D;  3T53 B;  1ILQ A;  2G9D A;  4J1M A;  1H9S A;  2QIL A;  5C5M A;  1DYQ A;  4HR7 B;  2F0L A;  4RAU C;  4RGM A;  5KIX A;  3DEP A;  3OWF A;  1PRT D;  2A74 C;  3HOZ B;  1JOK A;  3BVM A;  1Y8N B;  2AWO A;  2A69 C;  1DZ1 A;  5E1F A;  1IYV A;  2KUM A;  1H9R A;  2WAQ B;  3M4O B;  4HSP A;  2EYP A;  2K5W A;  5DM6 3;  1A2U A;  2BA0 A;  1HQR D;  4J6H A;  1F2L A;  1RD9 D;  5EKK A;  3DMU A;  3C1F A;  1SYG A;  3SE0 A;  2ZXP A;  4ZUJ A;  4ILW A;  4K6D A;  1GUS A;  1PTO D;  3ONA B;  4IUT A;  4DNT B;  3S16 B;  2EYJ A;  2RVL A;  3MAQ A;  3D4R A;  1ESF A;  4ZYS A;  5CBE E;  3GTM B;  3I73 A;  2XSC A;  1AEX A;  2RDG A;  1AZP A;  1MI2 A;  4XIG S;  2M00 A;  3D4D A;  5DNF A;  1EU3 A;  2HQE A;  3QO2 A;  3I90 A;  2MJ8 A;  2MP1 A;  1KLU D;  3NWT A;  1WTV A;  3N6R A;  2F0U A;  3NWS A;  4MN3 A;  3ZYY X;  4KKT A;  2A6H D;  2WP8 J;  5FLX L;  4ZRZ A;  1O78 A;  1QCB D;  2X6G A;  3QB3 A;  1KAA A;  5JVH 3;  5CV8 A;  4L63 B;  5ELE A;  1J9O A;  3QWN A;  2ICE C;  2RSN A;  2RBM A;  4HMJ A;  3S14 B;  2SNM A;  3GTL B;  2K04 A;  3S15 B;  5CV6 A;  2F03 A;  3JAM E;  3A56 A;  5COR A;  1EEF D;  2XWB B;  3R2I A;  1PFB A;  2H4O A;  3HP3 A;  1PTO B;  4RHR A;  1EYA A;  4DNR B;  4CJ1 B;  4CGY B;  1WCM B;  3GTQ B;  1Z47 A;  4IZ8 A;  5IGE A;  3MWY W;  1JIC A;  3SK6 A;  2B2W C;  2NVX B;  4A3K B;  2NUC A;  5KYL A;  3AB9 A;  5DEH A;  3C2P A;  1IW7 C;  4WRD A;  1DOM A;  3BDL A;  1BR9 A;  3HZX A;  3TME A;  2HDL A;  3TDQ A;  1HXY D;  1QB5 D;  5JPM C;  1RTO A;  4K2K A;  1UAP A;  1NR4 A;  4PV1 C;  1CK1 A;  1U9R A;  5ISR A;  2K32 A;  5K36 G;  1OXV A;  1FNW A;  4H0L C;  2L1B A;  2J7Z A;  1GHK A;  2H1E A;  2WV6 D;  1GHJ A;  1CA5 A;  1JCK B;  4NKL A;  3ITP A;  5EKL A;  4RGN A;  3I70 A;  2KHS A;  2B2T A;  4IFD J;  2Y0S B;  2EYL A;  3LX0 A;  1STB A;  2WB1 B;  2EJG C;  1JWS D;  1B9N A;  4G7O C;  1CA6 A;  1UUP A;  5E4X A;  4C3I G;  1MSH A;  2NVY B;  1PMR A;  3K5N A;  4A3F B;  3QOJ A;  2F0F A;  3WOE A;  2R92 B;  4UDU C;  2EDG A;  4DA2 A;  3NQI A;  2D2C C;  1ET9 A;  2F0M A;  3HRZ C;  2JEB I;  3PIO 3;  2B39 A;  1XX8 A;  3RMH A;  4RGT A;  3PO3 B;  1ZXT A;  1HA6 A;  2O4X A;  5CC4 A;  2FMC A;  4EGV A;  3DWA A;  2BCO A;  3WDN A;  2EJM A;  2EVB A;  2X6L A;  2OXP A;  2A6E C;  2F0V A;  2L9H A;  3KLS X;  1JOR A;  1Q3L A;  1X3P A;  1MSG A;  2Q8I B;  4CJ0 B;  4EVO A;  5ELB A;  4C2M B;  4M1U B;  3PUY A;  1QNU A;  3VR6 A;  2FJ2 A;  1PZJ D;  4DAP A;  2L0C A;  1R9T B;  1STE A;  2PW7 A;  4BY7 B;  1H9K A;  3E0J A;  5FLX E;  1V1P A;  3K5L A;  3BS1 A;  1SEB D;  3L9A X;  1EY6 A;  4DK0 A;  4ABN A;  1VMP A;  1V1P B;  5D14 A;  3Q22 A;  4ZAI A;  1F2Z A;  3S9W A;  4OIK A;  5LL6 S;  3N52 A;  1TQO A;  1NUC A;  1S5D D;  5IT9 E;  1HFG A;  3RZO B;  5LL6 X;  4IFD H;  3MHB A;  5D3D A;  2B63 B;  2PZU A;  5M5W B;  5CMD A;  2NN6 I;  5C6A A;  1EL0 A;  1U4R A;  1A15 A;  3NP8 A;  3TZU A;  5M5Y B;  3AU7 A;  4R8N A;  3W3A A;  1CM9 A;  4CJ2 C;  1JC7 A;  3I4M B;  2B8G A;  1C4Q A;  3MEH A;  1LTI D;  2PNR C;  3C46 A;  4U67 3;  5C4J B;  1WTO A;  1CT1 D;  1BNZ A;  3SDZ A;  1RCV D;  1TKW B;  1Y8O B;  3KLS A;  3H0G B;  3J80 E;  3PMF A;  2E2I B;  5EPL A;  2JEA I;  3HKZ B;  3CHB D;  2XWJ B;  1SNQ A;  2F3W A;  1R4Q B;  3D6W A;  4K6L A;  1DOK A;  3HGB A;  2M9V A;  3D6C A;  5KNC A;  3T16 A;  2PPB C;  1HHV A;  3I4L A;  4ID6 A;  4OL7 A;  1ENA A;  1PXU A;  4BA2 I;  3O13 A;  4K5X A;  4V0B A;  3HOX B;  3D31 A;  4K2L A;  2A6H C;  3F2U A;  3PUV A;  4IUQ A;  4TKO B;  4R9W A;  5EPK A;  5A35 A;  1CHQ D;  5I2Y A;  4L8J A;  4DF7 A;  2A73 B;  1ZEQ X;  4G7Z C;  1I6V C;  1LAC A;  1EYD A;  1IKM A;  2B2U C;  5CV5 A;  2B2Y C;  1LO5 D;  3BG3 A;  4V19 0;  2K6A A;  4G7H C;  3KLR A;  1HPC A;  2NB0 A;  2EYH A;  5G3L F;  2MGS A;  3TBI B;  2DNE A;  1LTT D;  4OHJ A;  3SK5 A;  1KDB A;  4Q5V A;  4MIU A;  1MD2 D;  4IUP A;  4TSS A;  1CQV A;  1SYB A;  2G9H D;  5BN5 A;  1XYI A;  1EWC A;  1EZ8 A;  2E76 C;  3VYS A;  4BWG B;  2ENB A;  1L0X B;  3I4N B;  4FF2 A;  1SJH D;  2PYK A;  1LT5 D;  3OIQ A;  2QF7 A;  1SND A;  1ONL A;  1PYW D;  2L12 A;  3J81 L;  2D9U A;  1KTK A;  4FF1 A;  2K28 A;  2JA7 B;  1UNS A;  2DNC A;  4QB4 A;  1F9Q A;  4HED A;  3EA6 A;  2O2L D;  2LY7 A;  1LT4 D;  3MXN A;  3P20 A;  3J7A F;  1YNN D;  3FPP A;  3OWE B;  4H7B A;  3A7L A;  2KQ3 A;  1TU2 B;  4KD4 A;  2E2J B;  5C0X I;  2F3V A;  4R8I A;  3MXP A;  1SNM A;  4FP5 D;  1U4M A;  4ME5 A;  2EOT A;  1G2T A;  1M8A A;  4HAE A;  2V4D A;  1PTO F;  4HMI A;  1A2T A;  2Z8L A;  3NK9 A;  2SNS A;  4OO1 I;  2D62 A;  3S1R B;  1SNP A;  2RSO A;  3VR3 A;  1DM0 B;  1RF2 D;  3E5S A;  3MFG A;  1S4Z A;  3DM1 A;  4PMB A;  1X3Q A;  3M7G A;  1EY8 A;  3NHH A;  2YU9 B;  1STN A;  5JOB A;  1O7Y A;  3E6Z X;  2RKS A;  5JAV A;  4H44 C;  5D65 A;  1SXT A;  1DON A;  3V2T A;  3S1Q B;  4C3I B;  3P75 A;  2R6G A;  4IFD I;  4B08 A;  2F0N A;  2WIN B;  5EBD A;  2EYO A;  5IOD A;  3M85 A;  1CZW A;  4NW2 A;  4QMG A;  5EGT A;  2L11 A;  1YNJ D;  3Q24 A;  2IX3 A;  1EU4 A;  1BCP F;  4J8Q A;  2EY2 A;  3FMC A;  2R7Z B;  2J0T D;  4C3H G;  5FKA C;  3CQZ B;  2JSO A;  4DAY A;  1EQT A;  5JPN C;  1SMY D;  1AP0 A;  2LFN A;  2ZXR A;  4BBS B;  4RA8 A;  1D1I A;  1CI3 M;  2IPK D;  4DFA A;  2QKI C;  1F2M A;  4KMU C;  3HOU B;  5KYI A;  1GXD C;  1H9J A;  3OIP A;  3GP7 A;  3QJY A;  2BA1 A;  4ZQ3 A;  1JWU D;  3V96 A;  1BXT A;  5FOB B;  2KA7 A;  3CRL C;  1HUM A;  1KDA A;  4A93 B;  4KV6 A;  3DHQ A;  1DXM A;  5ELD A;  1LLR D;  2F0O A;  3A55 A;  2NTS A;  2IW3 A;  1ROD A;  4I65 A;  2RQX A;  1B50 A;  1RKN A;  1U4L A;  5I6Y A;  4AYB B;  1S5C D;  4IUR A;  1STA A;  4ZLT F;  3A8K E;  1A3U A;  2NTT A;  1CQF A;  2IT1 A;  3SEB A;  3TP6 A;  1SYF A;  2KVM A;  4KTA A;  2XIW A;  3VA7 A;  2MHV A;  1EIG A;  4OO1 H;  3R2T A;  3EJI A;  4KJN A;  2A69 D;  4PQX A;  1Q8I A;  1RDP D;  4NDX A;  1HTL D;  5C3X A;  1TT2 A;  1BCP C;  3TN2 A;  1RTN A;  1OXU A;  1Z7T A;  2VB3 X;  5JEA J;  4A3J B;  3H91 A;  1CHP D;  3SK4 A;  4KI0 A;  3CU7 A;  2Z1C A;  4F88 A;  4IUV A;  4A3B B;  4CKB A;  4DK1 A;  3T4A C;  1B44 D;  1HTP A;  5LHY 1;  5KRU A;  2HCC A;  3S1M B;  1GUG A;  1BCP D;  1CZG A;  1OXX K;  5IGC A;  2NBF A;  4QCL A;  2PZW A;  4TQU S;  1O80 A;  1SE4 A;  1GOZ A;  2IWH A;  1D5X C;  4IN3 A;  4FYD A;  2E2H B;  4IAL A;  1ZYR C;  3VYU A;  5CYU A;  2Q8R E;  1HFN A;  4BA1 I;  2SDF A;  2JXM B;  3T51 B;  1T5E A;  2J4X A;  3X3N A;  1BCP B;  1U4P A;  3NQT A;  3BYT B;  3KBG A;  2NVT B;  2VUM B;  1IL8 A;  2R61 A;  1G91 A;  4O42 A;  2EYF A;  1J8I A;  5BN4 A;  3H94 A;  3LWE A;  3V05 A;  2F0D A;  5ELF A;  3HG9 A;  1RHP A;  2EY1 A;  3OMC A;  3TZD A;  5FO7 B;  1TS5 A;  5FO9 B;  1JOO A;  1IYU A;  2F0I A;  1IHZ A;  3S1N B;  1YNN C;  2HUG A;  1SNO A;  3BZD B;  2N88 A;  1PFM A;  3CKI B;  1D5M C;  4KY5 A;  1TY2 A;  1VF5 C;  4ZUI A;  3K6O A;  1KDC A;  3OPO A;  2F1M A;  4L6T B;  3SHL A;  1LTA D;  1LT3 D;  3CRK C;  2TMP A;  1ZKO A;  4OIJ A;  2BOS A;  3C3L A;  2EXZ A;  3NXW A;  2B2V C;  4QF4 A;  5BN3 A;  4XXE A;  3U9O A;  3GV3 A;  1NSN S;  3VR5 A;  5ELC A;  2WAC A;  5C44 B;  1TWC B;  2AQ2 B;  2O5J C;  1Y8P B;  1ILP A;  5IT9 L;  1D6E C;  1JR0 D;  5FK9 C;  3ND8 A;  2LS0 1;  2PZT A;  1VCI A;  2CVR A;  1K8O A;  1SYE A;  1STH A;  5M9O A;  3K5O A;  4CBV A;  4MHE A;  2C5C A;  3BDO A;  4KHZ A;  3FPU B;  4IUU A;  3K0Y A;  2CHB D;  2KEE A;  1G8Z D;  1WVL A;  2AWN A;  3OSO A;  2FHT A;  3BYY B;  1ICW A;  3PIP 3;  3D4W A;  1LAB A;  3QIA A;  4YIJ A;  1SE3 A;  1F9S A;  1GUT A;  1A3V A;  3GTK B;  2EZV A;  2ID0 A;  3I72 A;  2AUJ D;  1CTM A;  1TVX A;  4G57 A;  3H6M A;  2L4N A;  3GQB A;  4QIW B;  3U9S A;  5IOC A;  1Z6H A;  1BBX C;  5IGB A;  3M3Y B;  3K5M A;  4XYQ A;  4CHT B;  2NYZ D;  1STY A;  2IJ0 A;  1EY9 A;  1XXG A;  2K7V A;  2IX0 A;  4A3I B;  1E2W A;  1Y1V B;  1WTP A;  4HTH A;  2TSS A;  4X3S A;  2RDF A;  3KBX A;  4O1N A;  4A3E B;  1B3A A;  4EQN A;  3Q23 A;  1I50 B;  3Q0A A;  2LMC B;  5IIF A;  1Q90 A;  1IW7 D;  1YNJ C;  3J7Y W;  3M4Y A;  4U68 A;  2B2Y A;  1QIL A;  2DY8 A;  3M7N A;  1A6X A;  1JQY D;  3A8I E;  5D3I B;  1ZYR D;  3DWP A;  4A3G B;  2FMM A;  2Z4I A;  4LJZ C;  4KK7 A;  4DU9 A;  3VR4 A;  2F0Q A;  3MZ5 A;  5C3E B;  1W6K A;  3S2D B;  2OEO A;  4JBW A;  2F0S A;  1II3 A;  1ENC A;  2EE1 A;  1TWG B;  1V1O A;  1TWH B;  1TR5 A;  3RUZ A;  5HGT A;  1PDQ A;  3MTS A;  2HCI A;  1K83 B;  1M4V A;  1GUW A;  1Y69 U;  1C8C A;  1EY0 A;  1EQV A;  4HCE A;  5I2X A;  3R3O A;  2JA8 B;  1HCZ A;  5CBA E;  4B9W A;  2PMZ B;  1I4Q A;  3I3C A;  5C0X J;  4S3S A;  4LAA A;  4FXD A;  4HCS A;  1I4P A;  2BE5 D;  1FR3 A;  2B2T C;  1AW7 A;  1VMC A;  4XTC S;  3HOY B;  3IL8 A;  4JK1 C;  1Q12 A;  1GUO A;  4KHV A;  1BDO A;  1I4H A;  4CKE A;  5CR3 A;  2I07 B;  5KEE A;  2KED A;  4ZK9 B;  1HUN A;  3NE5 B;  5DAU A;  4ZKB B;  1WTQ A;  4I7Z C;  3ERO A;  2A6E D;  1SMY C;  2F0T A;  3GTP B;  1R4P B;  5JEA G;  3SK8 A;  5COY A;  3WOF A;  2RA4 A;  2WKC A;  1Q1E A;  2JP1 A;  4FF4 A;  2K5Q A;  3C1E A;  1PTO C;  1B9M A;  3HOW B;  4P2C B;  1SYC A;  2K33 A;  3T13 A;  2JA5 B;  4FF3 A;  1E2Z A;  2KJX A;  2AUK A;  4RCO A;  2JE6 I;  4C3J B;  2XVS A;  5A2Q L;  1B2T A;  2KEC A;  2F0E A;  3FRP B;  4HN7 A;  3HS0 C;  2A5H A;  2NZ1 D;  1H9M A;  2NVQ B;  2K03 A;  1GUN A;  3Q6S A;  3MXU A;  1A3T A;  2ZT9 C;  2BE5 C;  2CQA A;  2LKV A;  5FO8 B;  4N9T A;  1EY7 A;  4FXK C;  4XQN A;  1TII D;  2PCF B;  1L0Y B;  5CGK A;  3GTJ B;  4RFB A;  3L3O C;  1WD0 A;  4OO1 G;  4RHS A;  1GJX A;  4DXG A;  1Y1W B;  1PZK D;  1V8Q A;  2ZXO A;  2E74 C;  4KN4 C;  1I3Q B;  5KGU A;  3EVQ A;  5C3W A;  2K05 A;  3LNN A;  5C0X G;  1NAP A;  1PRT F;  1XWE A;  4XQJ A;  1WTX A;  2Q8T A;  1RJT A;  1JWM D;  3K7A B;  4ULL A;  2B2V A;  1EIH A;  1TS2 A;  3GTO B;  3X3M A;  3J7A V;  2KCC A;  4DXF A;  2DY7 A;  3VYR A;  3IFD A;  2AQ3 B;  4K5V A;  3IFT A;  2C9O A;  1DOL A;  4FVM A;  2B2U A;  4KY7 A;  1EZ6 A;  2A68 D;  1ML0 D;  1QJO A;  2BDO A;  1PTO H;  4KKU A;  1LT6 D;  4C3H B;  3I91 A;  5C0X H;  2ICI A;  5EQ0 A;  1QWY A;  2OT2 A;  3FVQ A;  1FD7 D;  1I4R A;  4XT1 B;  2WII B;  5JEA H;  4HSV A;  5IGF A;  3BVZ A;  5C4X B;  3P1H A;  3JAM L;  2RDH A;  5C4Z A;  3P7J A;  1F9R A;  1HA5 A;  1TY0 A;  3GV6 A;  1OXS C;  3VA5 A;  1W6J A;  1OO9 B;  4WFN 3;  3L7Z C;  1PLF A;  1WTW A;  2X69 A;  1VDZ A;  2E2D C;  2F0W A;  2I46 A;  3RLF A;  3I8Z A;  1BQQ T;  1T5X D;  1LTR D;  3AMU A;  2O5I C;  2XNA C;  3SXH A;  1ENF A;  1BO0 A;  5J1Z A;  1VF7 A;  5C4H A;  4F7X A;  3GTG B;  3G7L A;  1QE6 A;  1EWH A;  4F8M A;  3UI2 A;  2VXW A;  5AFW A;  4XYO A;  5HUR A;  2CW0 D;  1STG A;  3KUP A;  3FEW X;  3S17 B;  3K59 A;  5K5P A;  4C56 C;  1B1Z A;  1SE2 A;  2N55 A;  1SFO B;  2QCP X;  3EQL C;  1KAB A;  4KKS A;  3SVM A;  2B8F A;  3A54 A;  1BUV T;  2CW0 C;  5A2Q E;  1O7L A;  4Z9C B;  1EYC A;  5EJW A;  1KLG D;  2OF1 A;  3PUW A;  3PV0 A;  4XT3 B;  1SAP A;  1AZQ A;  4X3K A;  2QDB A;  3S2H B;  1G6Z A;  4TRD A;  1PRT C;  2KOL A;  3URY A;  2NN6 H;  1F2Y A;  2KCN A;  5C5L A;  3MVV A;  1DJR D;  3OOC A;  3G6J B;  1S5B D;  3H09 A;  1SDF A;  4PMC A;  1JE4 A;  3LWU A;  3DWQ A;  1G29 1;  1SBB B;  1TWF B;  5EKI A;  4ODG A;  2JYO A;  2WKD A;  3NTK A;  2K01 A;  3A8J E;  1UEA B;  1KNA A;  3TP7 A;  3W2D A;  4F87 A;  1EEI D;  5J39 A;  4Y7N B;  4K5W A;  2PQE A;  3KF8 A;  1AFP A;  1EOT A;  3DXJ C;  5I9O A;  5CV4 A;  3ERQ A;  4EQP A;  3HOV B;  5E4W C;  1SJE D;  3HEJ A;  3NUC A;  5EPJ A;  1TS4 A;  2EJF C;  4C1N I;  4C1N K;  1X32 A;  4IQZ A;  1TS3 A;  4NP5 A;  4K14 A;  1I4G A;  1B53 A;  2L55 A;  4A3M B;  5DM7 3;  4EQO A;  3OHX C;  4X3T A;  3NSW A;  4H13 C;  4LK1 C;  4C3J G;  3RZD B;  4RKL A;  2F0K A;  2M2L A;  2EY6 A;  2EPB A;  2XRS D;  1SNC A;  1WTR A;  2PW5 A;  4KD3 A;  2PO4 A;  4FXG C;  1MGS A;  2SOB A;  2MPM A;  3TP8 A;  4DGZ A;  4PNY A;  4N9P A;  2D5D A;  1I4X A;  4DAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...