3P1HA

Crystal structure of staphylococcal nuclease variant delta+phs v23k/i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTKKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords thermonuclease
publication title Pressure unfolding effects of artificial cavities in proteins.
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p1hA00
3MVVA 2PYKA 3MXPA 3TP5A 5IGBA 3T13A 4LAAA 4K14A 3VA5A 5ISRA 2PZUA 4KV6A 1JOKA 2F3VA 1F2MA 4MIUA 4QMGA 5J39A 2F0TA 2OXPA 4N9PA 4PMBA 5CV4A 4J1MA 4KJNA 3EROA 1F2YA 2ENBA 5KGUA 2F0MA 2HQEA 2EYHA 4HTHA 1F2ZA 1STNA 1SNDA 2EY6A 3OWFA 1SYDA 4HMIA 2F0VA 1STAA 2RBMA 4IZ8A 3EJIA 5CV5A 1SYCA 4EQNA 1A2TA 5M9OA 2EYJA 1KAAA 2OEOA 4KD4A 5C4ZA 5IGCA 2EYFA 1EYCA 4ZUIA 3S9WA 4PMCA 3PMFA 4K8JA 3MHBA 4NP5A 2SOBA 4E6IA 5IGDA 3SK5A 1EZ8A 4ID6A 4ZQ3A 5E1FA 3H6MA 5E3FA 2EY5A 2F0NA 4DGZA 1EY4A 1EY7A 2PQEA 3D4DA 5C5LA 5NUCA 3HEJA 5C6AA 3SR1A 4K2LA 2EY2A 1EY0A 4B9XA 3OMGA 4YIJA 1SNQA 1SYGA 5IGGA 4K8IA 2F0LA 2PZTA 1SYEA 2EYPA 2RDFA 3E5SA 3NXWA 4K5XA 1JORA 2PZWA 5KIXA 1IHZA 1TR5A 1A3TA 4H7BA 3EVQA 3TP7A 5CGKA 4TRDA 5I9PA 5C5MA 3D8GA 5CV6A 5EGTA 2F0DA 2F0UA 4EQPA 5I6YA 4N9TA 1EYAA 3C1EA 4DF7A 1STBA 3ERQA 3QB3A 4ZUJA 3LX0A 1NSNS 5DAUA 5J1ZA 3DHQA 2LKVA 4NDXA 5DEHA 4KHVA 3QOJA 2QDBA 3P1HA 2F3WA 5C3XA 3BDCA 3D4WA 4J6HA 3SK6A 4RKLA 2F0JA 5CR3A 4K5VA 1TQOA 5KEEA 4EVOA 5HURA 5KRUA 2KQ3A 1EQVA 4QB4A 2F0OA 3V2TA 1KDBA 4B9WA 5CC4A 5JAVA 5KYLA 4KJOA 5KYIA 1ENCA 4G57A 3QOLA 2EXZA 3MEHA 4WORA 3DMUA 2F0HA 2PW5A 4WRDA 4NMZA 5CV9A 5EKKA 4I65A 4KD3A 2F0IA 2F0SA 3ITPA 3R3OA 1JOOA 4KY7A 4DFAA 1SYFA 4DU9A 3U9OA 1KABA 1RKNA 2F0WA 5HGTA 1II3A 5IOCA 1SNOA 4ODGA 1A3UA 5IGFA 2EY1A 2RKSA 1U9RA 4K6DA 3SK4A 4EQOA 1AEXA 2WACA 5IGEA 3SHLA 3TP6A 3RUZA 2NUCA 1A2UA 3OSOA 1NUCA 1EY6A 4R8NA 1SNMA 3MZ5A 3OMCA 3D6CA 4HMJA 4K5WA 2F0FA 5JOBA 3P75A 3TP8A 2EYMA 2F0GA 1EY8A 2O4XA 3NHHA 4NKLA 1STGA 3BDLA 5C4HA 3SXHA 5C3WA 5CV7A 2SNSA 2F0KA 1STYA 3NQTA 4PNYA 5J22A 4KTAA 4K2KA 3NK9A 1KDAA 4S3SA 2F0EA 5F2DA 4ME5A 4OL7A 5I6WA 1TT2A 1SNCA 2OF1A 4KY5A 4RKBA 3NUCA 1ENAA 5I9OA 4F8MA 5IODA 2F0QA 3T16A 1SYBA 1EY5A 2SNMA 2KHSA 5EKLA 1JOQA 1EZ6A 1SNPA 1KDCA 2F0PA 2M00A 1EY9A 5IIFA 1EYDA 3HZXA 3C1FA 2EYLA 4IUNA 3SK8A 4KY6A 3NP8A 5CV8A 4QF4A 3TMEA 1A3VA 4F7XA 4IALA 1STHA 5K5PA 2EYOA 2PW7A
chains in the Genus database with same CATH superfamily
3S2DB 3MXGA 3U50C 3IRBA 1C0AA 1SBBB 1MHWC 3C46A 2ES2A 4DAYA 2CFMA 4RMFA 3ULPA 2EDGA 3STBD 2F3VA 2MNAA 4N9PA 3H3VC 1PH8A 5D65A 1TVXA 5C4XH 4DR7L 2JP1A 3OWFA 3KUPA 3S16B 3R2IA 4IZ8A 1EIFA 3S2DH 1X3PA 5JJKA 3M4QA 1GJXA 4NP5A 5IGDA 5FLMG 1M90C 1X56A 1HFNA 2EPBA 3MXNA 2JA6B 1EY7A 4X3UA 3J80L 1QG7A 4K2LA 2R6GA 4R9WA 1EEFD 4O1NA 1FJGL 1PYWD 1SYGA 1SYEA 5J3BA 2PZWA 4DR5L 2L0CA 1DOMA 1UUPA 2I46A 2YV5A 4IFDJ 1PYSB 1TIID 3EIVA 5CV6A 1U5KA 2JA6H 2K4KA 3TN2A 1ASYA 1SMYC 3C2PA 4QGUA 2QDBA 1K3RA 3BDCA 1W3SA 4KKTA 1H95A 2NVQB 2B8FA 4RGTA 3S1RH 2K28A 5C4JB 4JI2Q 3I4MG 4A3JB 1UE6A 4U68A 2XWBB 2ZM6Q 4ME3A 4IURA 2UU9Q 1QVFA 4K0KL 2A68D 2LFNA 3BS1A 4LF6L 4K6DA 3KF8A 2NVQH 1DOLA 4FXGC 1K0RA 1S3OA 2KA7A 5C4JH 4DK0A 1ZXTA 3S24A 2K75A 1GD7A 3JAME 2EYMA 3BYYB 3BDLA 5C4HA 4UP7A 3FHWA 4K2KA 3A74A 4KY5A 4A76A 3VA7A 4A3EH 3A5ZB 4A75A 1M4VA 2JA8G 5LMNW 4A3FG 4I7ZC 5ELEA 1ASZA 1EZ6A 1PLFA 2A69D 2WAQE 1OXSC 1PFMA 3I7FA 3JC66 3J80c 1EWIA 1UE5A 2NN6H 2NTSA 3NQIA 2ICIA 2SEBD 3TREA 3MC0B 1GM5A 1BBUA 2PW7A 2H4OA 3J7A5 1LUZA 2RCFA 2KCMA 3J81E 4A3MB 1CFMA 4ZKBB 5FLXE 4DV2Q 1I4RA 1IBLL 4KV6A 3PGZA 3NSWA 2R7ZB 4A3GB 3E0JA 5C44G 1OO9B 2ZT9C 2Z6KC 1Y69U 4A3MH 3CCMA 3G7LA 3CMAA 1Q3LA 2NZOA 2SOBA 5IP7G 1UE1A 2OTJA 3AYHB 4UP9A 5E3FA 1XXGA 3J81j 1EY4A 3CQZB 2X6GA 3SGIA 2JE6I 4A3KB 4GLVB 3CD6A 3S1MB 2L11A 3S1QH 4C3JG 1EFID 3TDQA 3CQZH 4HR7B 4POFA 5I2XA 4XT3B 1WTVA 3C1EA 1YHAA 4GN4B 4Q0FA 4JI8L 4A3KH 2R93H 3NTKA 3N6RA 3RZDH 2VQFL 4PMWA 4QCLA 3A0JA 3S1MH 5G3LF 1V9PA 5KYLA 1QB5D 1G2SA 4LF5Q 1ENCA 2EXDA 4HCEA 4XQNA 3PO2H 1HCZA 5C4XG 4KHPQ 3RNUA 4OIJA 2LXKA 3IKJA 2HCIA 5IOCA 4R4OA 2QKIC 3HKZB 2EJMA 1PZKD 1MD2D 5IYDH 4DR1L 4RH6A 3D6CA 3TP8A 3CCLA 2OQ0A 1STGA 1CKNA 3GTOB 4I7AA 2E5LQ 1EQTA 1I3QH 2EJFC 1OXXK 5I9OA 1IBKQ 1JOQA 3FRPB 1IXRA 1KDCA 2M00A 1RTNA 1EY9A 3EQLC 3CF5A 2LSSA 3DUZA 1LT5D 1RCVD 2B2WA 3GTOH 4OX9Q 4LFCQ 3IFTA 2I0QA 1RIPA 2RDGA 3AQQA 2EYOA 1EQRA 5IP9H 1QE6A 2QF7A 2DGYA 5C3EB 3S1NH 2Q2HA 1HZBA 4F88A 4G7ZC 1GUWA 3NELA 1Z9FA 3MEFA 3NBHA 4MIUA 4P73A 3RZOB 2J4XA 3I70A 4KN4C 1RL2A 2F0MA 4LF8Q 1SNDA 3UI2A 4DAVA 1WI5A 1VMCA 1SYDA 3KBGA 4HMIA 5M9OA 1AH9A 2N3SA 5C3EH 1A2TA 4RAUC 4DV0L 1WTHA 1TS4A 3KLSX 1D1IA 3SK5A 3HKSA 3RZOH 3FKIB 3H6MA 2F0NA 4GOPC 3A7AB 3CU7A 2D2CC 2HDMA 4JK1C 4B9XA 4A3EG 4X65Q 3G71A 2KVMA 4JI3L 4A3IG 2WB1E 1E7ZA 4UHVA 4X62L 3FKIH 2NN6G 1STEA 2Y0SG 1X3QA 4CGYB 2E2JB 3QB3A 4HJAA 2H1EA 3DHQA 3ND9A 1GKHA 2A68C 1B7YB 1E0BA 3KLRA 2L55A 3I73A 1TQOA 1YI2A 1HNWL 1EQQA 4FF2A 3F2BA 1UWVA 2C35B 4G57A 3RMHA 5EKKA 4R4IA 2E2JH 3Q22A 1DXMA 1NBWA 1S5CD 4BBSB 1JJGA 4GN3B 4A3MG 2ZXOA 1U4MA 1CQVA 2RHSB 3A5UA 3HOZH 1K28A 4LWCA 1A3UA 3PIPA 2J0TD 2K5WA 1PH6A 2AHOB 1QOHA 3FMCA 3SHLA 4JI0Q 1E2WA 2A69C 2X69A 2D0OA 2F0FA 1O7ZA 3JAMi 3K59A 3U58A 1U4RA 4DV6Q 1HA6A 2BDOA 3EN2A 1A8VA 4KTAA 4N8FA 2BH2A 4ME5A 1MSHA 2ZTCA 1D5XC 2VS1A 3D4RA 5DLQE 4JBMA 4WJ3M 3V05A 5COYA 4BWGB 3MAQA 3TQYA 1EIYB 3R8BA 1EY5A 4A3KG 2R93G 1SNPA 2K05A 2F0PA 4Z9CB 3QO2A 1QUQA 2JSOA 4JOIC 3IFDA 3I90A 1V1PB 3SVMA 3RN2A 1UNSA 1BKBA 1Z6HA 5K5PA 2KHIA 3ITPA 3PO2G 1HTLD 1QZHA 2VUMH 3J81i 2JA7B 1QCBD 2A19A 3RR5A 1L0XB 2L5TA 5EAYA 2UU9L 1CSPA 1GUNA 5JVH3 4PMBA 1W6JA 2Q8TA 1PH3A 2RCNA 1UAPA 2RBMA 4QY7A 4G4KA 2VB2X 5IYDG 1LTTD 1PTOH 3QWNA 3K5MA 2KECA 1AW7A 1PHJA 4NXNQ 1IBML 4ZCKA 4DGZA 2PQEA 5C5LA 4DUYQ 4GNXA 2K01A 4F87A 4BA2I 5KIXA 1YEZA 4TRDA 2BA0A 1DONA 4JI4L 1C4QA 4IOCA 3I55A 2WIIB 1VQ4A 2B8GA 5D14A 3GTPB 1Q12A 4DV2L 5LMNL 2B2TC 3LX0A 2O2LD 3CCQA 2N49A 2RSOA 3D4WA 3CC7A 3V96A 1VQPA 1PTOC 3DWPA 4JI5Q 1VQAA 4CDCC 1SMXA 2Q8RE 1BOSA 2K32A 1B3AA 1PH5A 1KLGD 3GTPH 4DPGA 5C0XI 3NWTA 5C3EG 2HT1A 2E2HH 3NBIA 1HHVA 5ELFA 5CYUA 1B4OA 2YTXA 3K80C 3K0YA 4IUPA 5ELCA 1SE3A 3RUZA 2R92B 2FHTA 2F3IA 3D6WA 2R61A 1LTBD 4ILWA 1XJVA 1H9RA 4NKLA 5G3LD 1VQ5A 2GA4B 5M3FB 1KDAA 5F2DA 1F77A 3J7ZC 3TEHB 2UUAL 4AYBG 2R92H 4YY3L 4JPBW 4MNOA 4DAYB 3VYRA 5JPMC 2K5NA 2K52A 4P2CB 1B70B 2E75C 3HP3A 2IPKD 5JEAH 4FP5D 3T1HQ 1PH7A 1CTMA 3SDZA 2ASBA 1YZ6A 1U4LA 4GLAC 1L1OC 1Y14B 3DM1A 3MXNB 3HOZG 1BXTA 1F2YA 1FGBD 2OTLA 1WVLA 1STNA 2AMCB 1FNWA 3ULJA 4RFBA 1J6QA 3HOVH 5K36H 2WB1B 2NWGA 2Q2UA 1TWHB 1DZ1A 4HJ7A 3F2UA 3CC4A 5IT9L 3F2DA 4H02A 1GUOA 4OX9L 1TR5A 2WAQG 2EQSA 3KBXA 2E2IB 3EVQA 2P5ZX 3A8JE 3M4OB 2L4NA 1EFWA 2F0UA 1EYAA 1J5EQ 4DR2L 5IYCG 1GHJA 1YBYA 4Y7NB 1QVGA 1P16A 4DR6L 1PVOA 2VUMG 4A3CH 3BZDB 5KRUA 2B2VC 4EVOA 5EPJA 2E2IH 4FF1A 3HOXH 4LF8L 3M4OH 4LFBL 1LO5D 2L15A 3BG3A 3F8TA 4TVAB 3J7AF 2KEDA 5D3DA 4NMZA 4I65A 4KK7A 4KD3A 2JA5H 1BR9A 1HUNA 5AJ3Q 2BE5D 2Z1CA 3A54A 5EQ0A 2IY5B 2N8NA 4ODGA 5IGFA 2QCPX 4GLXA 1G2TA 1EIGA 1XWEA 4OO1I 2Z6BA 1M1KC 1EU4A 1HZAA 3KLWA 2EOTA 2UUCQ 1EWHA 1GVPA 5LL6S 3FPUB 3P20A 1J8IA 4DK6C 1EOTA 1SNCA 4DAPA 1KNAA 3ER0A 4NW2A 3NUCA 3UE1A 1OXTA 2QDLA 2SNMA 3E0EA 3LNNA 4KI0A 3BVMA 3GTKB 4X64L 4GN5A 1AP0A 3FEWX 3S2HB 4CKBA 1LTGD 1RTOA 2DY8A 1JWUD 3T51B 3OW2A 2VNUD 2OCEA 1A62A 4F7XA 1VQGA 5IT9c 2A73B 4P75A 2HCCA 3MVVA 2K5DA 3KJOA 4K14A 5L37A 5ISRA 1I4HA 3GTLB 1O7YA 1N33Q 1EWCA 3WDNA 3CPFA 2MFIA 4B3SQ 3EROA 3QIAA 4MTKA 3AU7A 1WCMB 3BVZA 5HGQA 4HN7A 2CH4A 3GTLH 4N8X1 4K8JA 2LS01 2UXCL 3AB9A 1GUTA 3H0GB 1PRTF 2EY5A 1KAWA 4M1UB 3OIPA 1HNZL 3NWSA 2DNEA 3T53B 1WCMH 5C0XH 4YIJA 2PMZE 5LHY1 2G9HD 2MQHA 2VL6A 2MP1A 3ERSX 2WFWA 5IWAL 3EA6A 3H0GH 2PNRC 4IUTA 1EYGA 4C3HG 1CKMA 2KENA 4XDXA 1MBYA 1IZ6A 5JEAG 4DV7Q 4A93B 1W6KA 4AIMA 5DAUA 1ESFA 4DV4Q 1QNKA 1SJED 1KIXA 3GQBA 1NNXA 1ILQA 2B2YC 2F0JA 2HD3A 4LF4L 1ENFA 2R7FA 1EQVA 5M5YB 1I6HB 3H91A 1L0WA 1B9NA 2WV6D 2G5DA 4JCVE 3S16H 3PUVA 3CW2C 1IW7D 3ZJYC 3BZCA 2VB3X 1BDOA 3OIQA 4DFAA 1SYFA 1KABA 3HOVG 1T5XD 5K36G 4XQQA 2UXDL 2CCZA 4KMUC 5M5YH 1XMQQ 1I6HH 1LTRD 3PUWA 3K58A 2IX0A 1WTRA 1YITA 5FO7B 1B1ZA 2RDHA 2O4XA 1JJ2A 3MFYA 2L9HA 3I4OA 4GS3A 3J81L 2NZ1D 1RODA 2WB1G 1SRUA 4OL7A 5I6WA 1HH2P 2CQAA 4DK3C 4DUZQ 1L0YB 3S14B 4PV1C 1DOKA 1LTAD 5EKLA 1Q8KA 3OTOL 1BO0A 4WFN3 4HIDA 1SR3A 1HZ9A 3NBHB 2Z4IA 3C1FA 4ULLA 4A3BG 1AFPA 3HOXG 1JMCA 4A3JH 2XWJB 4R1JA 2JA5G 3GV6A 3RN5A 4LUVA 2CWAA 1TKWB 4RG1A 2B63B 1IL8A 1I6VC 1O7IA 4KJNA 2Q2IA 2NTTA 1RHPA 2G9DA 4CDFC 4P71A 3IL8A 1PFBA 5IGCA 3JAMc 1EYCA 1YNND 1O7LA 4QIWE 1Q86C 4QUCA 2HHHL 1Q1EA 4CDDC 1F9SA 2B63H 5C6AA 3I8ZA 1OXUA 3KF6A 3NTIA 4IOAA 4ALPA 2F4VQ 2RDFA 1KD1C 2HQLA 3WOEA 1BVSA 1VDZA 2EVBA 1CM9A 3D31A 3TP7A 1KC8C 5JEAJ 5I6YA 3T1HL 5GQOA 2BE5C 2VY3A 4EGVA 2K50A 1HJPA 4YCVA 1NCVA 3J81c 3Q0AA 5DEHA 4IQZA 5FLXc 2I07B 2R7ZH 3KFUA 3SK6A 3GTJB 5CR3A 5FO8B 4A3GH 5DM73 1JWSD 4KKUA 4OONA 1Z47A 4BA1I 5EPKA 1E1TA 3TBIB 4EX5A 1Q7YC 2UUBQ 3KJPA 3GP7A 2V4DA 4LF9Q 3T1YQ 2F0IA 4QJFA 4LF7Q 2DUDA 4JBKA 3FP9A 5BR8Q 4DU9A 2F4IA 4YCUA 1VS0A 2FINB 3QG1A 4DR3Q 1K3BC 1AEXA 5IE8A 3M7NA 1HR0W 1WCMG 4HMJA 2SDFA 5C0XG 3L3OC 1NAPA 1QUQB 3NQTA 1YNJD 2F0EA 1YJNA 3M4YA 4XXEA 3H0GG 2FMMA 4MHEA 1ENAA 4OHJA 4F8MA 2ATWA 5KNDA 1HR0Q 2V1CC 2BOSA 1XNRQ 3S17B 1NJIC 1FD7D 3NENA 3T4AC 1SE8A 3D0FA 4BXXH 3OW7A 2JYOA 1LACA 5AJ3L 3RLNA 2PYKA 2UXBL 4IFDI 4JV5Q 1MSGA 3E9IA 4ZAIA 3AFPA 2ZJPA 3MWYW 1I4QA 3J7AV 3S17H 3M9BA 4MTNA 1N34Q 2TSSA 2JA6G 1C7YA 1WOCA 3GTMB 3STBC 2F0VA 1SLJA 4GNXB 2UUCL 2PMZB 2BH8A 3UDFA 3F1ZA 1FVIA 4GKJQ 1MGSA 4DR4L 4DV5L 1LV9A 2D9UA 1N9WA 1TWGB 1HNXQ 1EY0A 2B29A 3PO3B 4JG2A 1F9RA 3EFXD 4C3IB 4AH6A 1HFGA 3HOWB 5I2YA 3ND8A 1HA5A 1SSOA 1D7QA 1NR2A 3L9AX 5I9PA 4K6LA 1IW7C 1AN8A 3ERQA 1TWGH 2J7ZA 3GD7A 3CMEA 3PO3H 4FDBA 4A3JG 2DN8A 3ZYYX 3VR5A 3TS0A 3NEMA 4KHVA 1X9NA 4GKKL 1TY2A 4FXKC 2F3WA 3HOWH 4IO9A 3I3CA 1XNQQ 4B3SL 1X32A 1EU3A 4B3RL 1PRTD 2ICEC 1VF5C 2GN5A 1IKMA 3PIOA 1LTLA 1VQNA 2ALYB 2JK8A 2KJXA 3T56B 1G91A 3HGBA 4DV1Q 1A6XA 5DNFA 4BBRB 1EL0A 1I4PA 3U9OA 2JN4A 1BF4A 4H13C 2EY1A 2RKSA 3CRKC 4RGOS 2B63G 2H5XA 1VF7A 5C0XJ 4YHHQ 4DV3Q 1A2UA 1EUJA 1NUCA 3W1BA 1K73C 1IYVA 5JOBA 2KCCA 1Q82C 4DNIA 2Z4HA 2JQOA 4L8JA 4O2DA 1F2LA 2KOLA 3VR3A 2B39A 2N88A 4DV7L 1XTCD 2CW0D 1YHBA 4DV4L 3K0XA 5EBDA 2NBFA 3PUYA 4A3DB 2R7ZG 1EYDA 1HQRD 4JI7Q 2K03A 3O13A 3NE5B 5CV8A 1MJCA 4A3GG 2YU9B 1CQFA 3I72A 1HTPA 1L2FA 1E3PA 1W2BA 4JBJA 4A4IA 2IWHA 4BBSH 3W3AA 3PUZA 4X66Q 4QIWB 2N55A 4YCWA 4A3DH 1S5DD 1XMQL 1A63A 4DKAC 2YU9H 4JYAQ 1JWMD 3VR4A 3HOYB 2QILA 1YJWA 2B2UA 1SYCA 1KNEA 4PQXA 4HCSA 3S15B 4TSSA 3MHBA 1EOVA 1EZ8A 3GTQB 4JI2L 4GZYC 1SROA 3M4PA 2BCOA 4IUVA 1S40A 1N36Q 3D4DA 3UDIA 5NUCA 4BS9A 3Q24A 1VQMA 2ZM6L 1V1QA 3IAYA 4OIKA 1CZGA 4ABNA 3E5SA 2RHQB 4ZLTF 3S15H 4QL5A 3RLOA 2WKCA 1PV4A 1T9HA 1WTQA 1QZGA 1VQ9A 4BXXG 1KXLA 4LFAQ 2JA7H 5BN5A 5A2QE 3PSIA 2LKVA 4NDXA 1KTKA 5M3MB 4HJ8A 2PO4A 1BCPF 4X3KA 2F0OA 2PQAA 4L5QA 3K7UC 3HKZG 1S4ZA 2EXZA 3MEHA 1AE3A 2CQOA 2F0SA 1WJJA 3MXUA 1MIUA 4DK1A 1LT6D 1G291 1HUMA 5M3MH 1FJGQ 1RKNA 2E2DC 3PF4A 4U673 4GOPA 2JEAI 4DR5Q 4O0AA 1Y1WB 3KYHC 2K5HA 5IP9G 1YIJA 4IFDH 2F4VL 2XN9C 3MZ5A 2YYZA 3E3XA 4RGNA 1XPOA 1EY8A 3I4NB 1JCKB 4RCNA 3VYTA 1LLRD 3R2TA 1SE2A 2OF1A 1TU2B 1V1OA 4C1NI 3P7JA 4IPHA 1Y1WH 1VQIA 1PRTB 2F0QA 1H9JA 1X55A 2K1BA 2K04A 2D5DA 2GVBA 2A1AA 2QEJC 4RCOA 5GAEC 4G7HC 1EEID 1JC7A 5M5XB 4K0KQ 2K6AA 3T1YL 4DNTB 1LTSD 3WWVA 3NTHA 4LF7L 2ID0A 3SE0A 5BR8L 2Z9HA 3H15A 2R7DA 3PV0A 2CWPA 1FNUA 4DR3L 1SXTA 1GUSA 4RWSC 3FKIG 4LJZC 1TXYA 2X6LA 3Q23A 2XRSD 2FMCA 1FR3A 1F2ZA 2EY6A 5JJZA 3X3MA 2ZXPA 3Q8DA 2E8GA 4PMCA 5FK9C 4LF5L 2OWOA 4OEMB 5M3FH 2KCTA 3CAMA 4QQBX 4KHPL 1PYBA 1DJRD 2XSCA 4NB3A 3L7ZC 1HR0L 3A8IE 4UPAA 4DA2A 1XNRL 4JOIA 1PRTC 5M5WB 1B53A 2IT1A 1WFQA 4OWXB 1SMYD 2QW7A 1IBLQ 2CH4W 1NMGA 2A6HD 2M9VA 5GAGC 4ZUJA 4BBSG 1PXUA 1QVCA 5C3XA 5CBAE 1RF2D 1X3FA 5M5WH 2E5LL 3KK7A 4K5VA 4A3DG 2KQ3A 1N34L 3V2TA 5CC4A 4LW1A 1IBKL 2WKDA 3KDFA 3RD4A 4KY7A 4LFCL 1TWCB 4GKJL 4L6TB 2F0WA 5IY0A 5CMDA 1Q46A 2QEXA 1CUKA 1TWHH 4QUFA 3A56A 3ONAB 3PIP3 3OYYA 5BN3A 3AMUA 2Y0SE 2NUCA 1AZPA 1PFNA 3I4MB 2EIFA 3B6YA 2EJGC 1DD2A 1V43A 2L1BA 2SNSA 4PNYA 3KF8B 3BJUA 5JVG3 3OHXC 1CHPD 4KHZA 1UE7A 4LNQA 3AEVA 4Y7NH 5JPNC 2D0PA 1ML0D 2JA7G 1VQEA 2XVSA 1XMOQ 1K9MC 1CK1A 3URYA 4P74A 2CKZB 2EZVA 4X65L 2WP8J 1HRJA 3LWUA 1H9KA 1Y1VB 3MXPA 2IJ0A 4A3FB 4IUUA 3VA5A 4DR1Q 3HG9A 1NTGA 2OQKA 3W2DA 5M3MG 1PH1A 2K5VA 4HIOA 1R9TB 4DV3L 2OT2A 1PTOF 1XPRA 1ET6A 3KF6B 5CV5A 1Y1VH 4A3FH 2EYJA 2OEOA 1KHIA 3S9WA 2LXJA 4PZ7A 4E6IA 3GO5A 4OWWB 3TSSA 3VYSA 3E6ZX 1CSQA 4ZQ3A 4UP8A 4FO2A 1B44D 1N8RC 3M3YB 4X3SA 3GTKH 2R3ZA 3G6JB 3KOJA 4K5XA 2AKWB 4O42A 3S2HH 2L12A 2IHFA 1YHQA 4YWLA 4JI0L 4FXDA 1H9SA 3VR2A 2C9OA 4L5TA 2Q8IB 3MFGA 1HXYD 2PI2A 4CJ0B 4FYDA 1XYIA 4DV6L 4X66L 1MKHA 5GROA 2MPMA 5D3IB 1L1OA 4HAEA 1GUGA 4V0BA 5IP7H 4JYAL 1TWFB 4C3JB 3DMUA 4B3MQ 2A74C 2R92G 3NPPA 4TQUS 4OWTB 1JOOA 3MA2B 2RF4A 2HUGA 2ZXRA 4BY7B 5M3FG 4JI3Q 1U9RA 1BQQT 1TWFH 3K81C 1SAPA 4ZK9B 1JB7A 2RQXA 3A8KE 2F03A 5IGEA 2QA4A 2RVLA 4X62Q 4DXGA 5LL6X 1Q90A 1BCPD 4LUZA 1ZEQX 3SXHA 4XYQA 3JAML 1XTDA 3UDXA 1IL2A 3CCVA 1C48A 4BY7H 1E22A 3LGJA 1TT2A 5AFWA 1CI3M 1HNWQ 3VDYA 4LFAL 4A93H 1D5ZC 4HSVA 2VQEQ 1WTOA 2AQ1B 4NXNL 1UEAB 1CKNB 2B2VA 1VQCA 2BDNA 2XGTA 4IUNA 1WTXA 3TMEA 1QNUA 2KHJA 4DUYL 4MN3A 1IYJB 3A55A 1QJOA 5IGBA 4LAAA 3CCSA 1VQ6A 1F2MA 5FLXL 4J1MA 1YVCA 1O78A 5KGUA 3A7LA 5LMUQ 3S1RB 1VQOA 4AYBE 1CA6A 4JW0A 1D5MC 4KD4A 5C4ZA 3CCEA 2EYFA 4A3CG 4JI5L 4C2MB 3PMFA 1Y8NB 2A6HC 3RLFA 1NY4A 2AUKA 4JVZA 2RSNA 3SR1A 1FNVA 1S5BD 3S14H 2NVTB 1VQHA 1E2VA 4IJHA 1I4GA 2KUMA 4XQJA 1SNQA 2NYZD 2XRQD 3BU2A 1NR4A 2PCFB 4C2MH 4JBWA 4R4QA 3UDGA 1A3TA 4JI6Q 3CCJA 1C8CA 1MI2A 3N52A 2VW9A 4ZYSA 4N9TA 4A3EB 1K83B 1VQFA 1T5EA 2NVTH 4LUOA 2CVRA 4P72A 4CBVA 3QOJA 4A3IB 3CKIB 1RDPD 3TRZA 3J80E 4RKLA 2WINB 4XTCS 2KCNA 1PH9A 1XX8A 4XT1B 1Y8OB 2B2WC 5KYIA 1B9MA 1F9PA 3QOLA 2Y0SB 4DNRB 2F0HA 1IBMQ 2JJQA 1K83H 2HIXA 4LK1C 1BUVT 2O5IC 3R3OA 1RJTA 1B8AA 4FF3A 1Y1VG 1I94Q 4Y52H 2VXWA 4R4CA 4A3IH 1NMFA 2C5CA 4OO1H 3M85A 1E1OA 1Q8IA 1KLUD 1TS2A 1SNMA 4JI4Q 1SEBD 1R4QB 1D1KA 5LMNQ 3G6EA 1S72A 3BZKA 2PNHA 5CBEE 5CV7A 1X3EA 2F0KA 3VYUA 5J22A 1E2ZA 3NK9A 2K5QA 4RKBA 1ZYRD 5JJLA 1SYBA 5ELNA 5IYBH 1LM0A 2B2YA 3GTJH 3K5NA 2F52A 1SFOB 5E4XA 5TSSA 2EYLA 3U4VA 1PFSA 3K6OA 3S1QB 1VQ7A 1XPUA 1A3VA 1GXDC 2NVXB 2DNCA 1PDQA 2ZTDA 3HOUB 3PF5A 3CP0A 1ONLA 4HIMA 4L63B 4B3TQ 2R93B 3RZDB 1VMPA 1VQKA 1SFOH 2OXPA 2IHEA 1J5EL 1BCPB 1DM0B 2D62A 2EYHA 2NVXH 4BY1B 3PO2B 3HOUH 4A3LH 1CKOA 2UUAQ 2DY7A 5ELDA 4YY3Q 3TZUA 4KKSA 4ID6A 1WYDA 3GDEA 1B3QA 1WTPA 4BY7G 3HEJA 4OGQC 4H44C 4H0LC 4BY1H 2NVYB 4A93G 1XMOL 5IGGA 1JORA 4FF4A 4H7BA 4KN7C 1D2BA 1OXVA 1KRSA 2PQAB 5EGTA 4EQPA 5E4WC 4NXMQ 1JQYD 1ICFB 1PTOD 1SDFA 5GADC 2XTIA 3QJYA 1I3QB 1S5ED 2PI2E 2NVYH 5J1ZA 1FL0A 1VQBA 2FJ2A 2B2UC 3SEBA 1I4XA 5KEEA 1LT4D 3G48A 4GOPB 5KNCA 1BBWA 1TWAB 4HJ9A 2A5HA 2BA1A 3GTMH 4RA8A 2DJFC 4JI1Q 5CV9A 1BCPC 3F2CA 3PUXA 3S1NB 2AWNA 1G8ZD 1A15A 1VQDA 4CHTB 1SE4A 3I4LA 1TS3A 1II3A 1SNOA 2Z0SA 1PH4A 4CKEA 2RA4A 2XIWA 1TWAH 4OXPA 2WACA 5FKAC 3QR8A 2YTVA 1GOZA 5EBCA 1VCIA 4C3IH 1N33L 3OMCA 3PQIA 1ILPA 2F0GA 4DR2Q 3CCUA 1PA6A 1P8LA 4DR6Q 4EQ5A 3DEOA 3HFZB 2K33A 2JEBI 2Z6KA 1G51A 2VZAA 3CPWA 4UAIA 4LFBQ 2KHSA 4GNXC 4IPDA 2MO0A 3HZXA 2ZJRA 4KY6A 3NP8A 2AQ2B 4B3ML 4IPCA 4AYBB 2FFKB 1LT3D 4X3TA 1NE3A 4BBRH 3K7AB 4XIGS 2PZUA 1K0SA 4X6AH 5J39A 1EIHA 3G4SA 1U0LA 3E9HA 4OO1G 2HQEA 4DXFA 1VQJA 3C3LA 1STAA 4AQYQ 1V8QA 1KAAA 2MUYA 1O80A 3I2ZA 4RGMA 3K7AH 1K8GA 3HOZB 5A2QL 1JE4A 4X64Q 1ESRA 2IL8A 1CZWA 5JJIA 2VQEL 2DJGC 1YNNC 3DWQA 3CC2A 2EY2A 3ULLA 3OMGA 4CDEC 1IYUA 2F0LA 1K8AC 1N32Q 5IYBG 1CA5A 1WD1A 4PZ8A 3GV3A 5H1SE 3Q6SA 3KDFB 1JB3A 4DF7A 1STBA 2MGSA 3DM3A 4J6HA 2WAQB 3J80i 1C9OA 4NPSA 5HURA 2FXQA 1H9MA 1OTCA 4M8AA 5ELBA 1VQLA 4DUZL 4KJOA 2QGQA 5LMUL 2Z8LA 2UXCQ 3HOYH 4HEDA 2PW5A 1I50B 2ZJQA 1YJ9A 5FJ8H 4IUQA 1HNZQ 3HOUG 2VUMB 4A3LG 4HJ5A 4ZKCB 3GTQH 5E7NA 1PZID 3CRLC 3EBEA 1SN8A 1ZYRC 3I56A 5IWAQ 2KBNA 4DR7Q 1I50H 1EY6A 2K14A 5IYCH 4BY1G 2A8VA 4K5WA 3U9SA 4PG3A 3NHHA 1PTOB 4JI6L 4JC0A 5C3WA 1STYA 4KLKA 3LWEA 3BVGA 4S3SA 3UE0A 3L2PA 4CJ2C 4LF4Q 1AZQA 3HS0C 4APVA 5CORA 5A35A 3TZDA 1M8AA 5IODA 3T16A 1YNJC 1X54A 1ET9A 3DEPA 3J7YW 2GVAA 1CHQD 3R93A 1JICA 3SK8A 1ZKOA 4B08A 4QF4A 3D3RA 1QILA 2A6ED 3AFQA 2UXDQ 4FVMA 2Q2TA 1I5FA 4G7OC 3MTSA 5EJWA 2HDLA 1I94L 3TS2A 1LTID 1TS5A 1Y8PB 4IN3A 3H3VI 3CHBD 4QMGA 4XYOA 2ENBA 2E76C 4EQNA 3PO3G 3EJIA 1PH2A 4DN4M 2M2LA 1A0IA 1G6ZA 4C3IG 3I4NH 3HOWG 3H09A 1JE5A 2JXMB 4RHRA 2E2HB 3VR6A 1IKLA 3OTOQ 2UUBL 1H9SB 1QWYA 2HIVA 4LF9L 4LF6Q 5I4DA 1WD0A 1GO3E 1X3GA 3BDOA 4K8IA 2PZTA 4MZ9A 1L1OB 1LYLA 3GTGB 3FDTA 2E74C 5CGKA 5M5XH 1K8MA 4YWKA 4HIKA 3OWEB 5FOBB 4TKOB 4B3TL 1NSNS 4ZRZA 1D6EC 3P1HA 4BBRG 3GTGH 4YWMA 1MJEA 4QB4A 5FO9B 4B9WA 2I5LX 2HHHQ 4C3HB 2CHBD 2I5MX 1PZJD 3FVQA 4WORA 4WRDA 3CCRA 1R4PB 1DGSA 3PIO3 2O5JC 4FNFA 5HGTA 4POGA 1B2TA 3L0OA 3SK4A 5T1GA 4UY8C 1X65A 4C3HH 4JV5L 3TP6A 2EE1A 1HZCA 4Q5VA 3P75A 5FLMH 3CXCA 3HOVB 3X3NA 2I5HA 3KLSA 4OELB 3HRZC 4NXML 2B3GA 2XNAC 1PMRA 4PZ6A 1JT8A 1RD9D 2MO1A 4R4TA 1LABA 1ICWA 3I91A 2CW0C 3W1GA 1VQ8A 2IX3A 1HNXL 4C56C 3DWAA 4JI1L 4IALA 1STHA 2IW3A 3D8GA 3OPOA 5BN4A 3HOYG 2MJ8A 1J9OA 1DCZA 3TP5A 3K5OA 3T13A 4JI8Q 5FJ8G 1JR0D 1TWCH 2VQFQ 1KL9A 1JOKA 2F0TA 1V1PA 5CV4A 3DLLA 4A3BB 2B2TA 3HOXB 4HTHA 3ICEA 2N78A 3I4MH 1X6OA 4L5RC 1XNQL 2JA5B 1G6PA 2PPBC 1UEBA 5T1IA 4ZUIA 1CT1D 3K57A 1K8OA 3BYTB 2NN6I 5E1FA 4IPGA 1HQMC 2JA8B 2ZTEA 4A3BH 4DV1L 2AUJD 1BBXC 1B50A 3NXWA 4CJ1B 2EYPA 2UXBQ 1GHKA 4WJ4A 1IHZA 2AWOA 2F1MA 4YHHL 2NB0A 5C5MA 2K7VA 1YNXA 2F0DA 4HSPA 2JA8H 1D8LA 4V190 4IFDG 4R8IA 1SJHD 3K8AA 4UDUC 5ELOA 5C44B 3H94A 2YTYA 1R9TH 1KDBA 5JAVA 5IT9E 1HPCA 2NZHA 4WJWA 4DR4Q 1TY0A 2JA9A 2TMPA 5HY6A 4DV5Q 4AQYL 1Y1WG 3FPPA 1FGUA 1KQSA 5EKIA 4JI7L 3OOCA 1WTWA 3U4ZA 2MHVA 1AE2A 1S5FD 1U4PA 3I4NG 5C44H 1BNZA 3PCOB 5DM63 1JJCB 4EQOA 5EPLA 1F9QA 1E24A 3OSOA 3WOFA 2IX1A 4R8NA 3M3YH 5GAHC 1N32L 4DV0Q 4J8QA 3DXJC 4RHSA 3H3VH 4C1NK 2A6EC 4GKKQ 1Z7TA 4J15A 3HKZE 1DYQA 1KRTA 4B3RQ 4IJLA 3K5LA 4L5SA 2AQ3B 3M7GA 2LMCB 5KNBA 2LY7A 1Q81C 1FYCA 5IIFA 4CKCA 1N36L 3W5OA 2KEEA 4C3JH 1Q1BA 4DAMA 5C4XB 4LMQD
chains in the Genus database with same CATH topology
3S2DB 3MXGA 1SBBB 3C46A 4DAYA 2EDGA 2F3VA 4N9PA 3H3VC 5D65A 1TVXA 2JP1A 3OWFA 3KUPA 3S16B 3R2IA 4IZ8A 1X3PA 1GJXA 4NP5A 5IGDA 1HFNA 2EPBA 3MXNA 2JA6B 1EY7A 4X3UA 3J80L 1QG7A 4K2LA 2R6GA 4R9WA 1EEFD 4O1NA 1PYWD 1SYGA 1SYEA 2PZWA 2L0CA 1DOMA 1UUPA 2I46A 4IFDJ 1TIID 5CV6A 3TN2A 1SMYC 3C2PA 2QDBA 3BDCA 4KKTA 2NVQB 2B8FA 4RGTA 2K28A 5C4JB 4A3JB 4U68A 2XWBB 4IURA 2A68D 2LFNA 3BS1A 4K6DA 3KF8A 1DOLA 4FXGC 2KA7A 4DK0A 1ZXTA 3JAME 2EYMA 3BYYB 3BDLA 5C4HA 4K2KA 4KY5A 3VA7A 1M4VA 4I7ZC 5ELEA 1EZ6A 1PLFA 2A69D 1OXSC 1PFMA 2NN6H 2NTSA 3NQIA 2ICIA 2SEBD 3MC0B 2PW7A 2H4OA 3J81E 4A3MB 1CFMA 4ZKBB 5FLXE 1I4RA 4KV6A 2R7ZB 3NSWA 4A3GB 3E0JA 1OO9B 2ZT9C 1Y69U 3G7LA 1Q3LA 2SOBA 5E3FA 1XXGA 1EY4A 3CQZB 2X6GA 2JE6I 4A3KB 3S1MB 2L11A 4C3JG 1EFID 3TDQA 4HR7B 5I2XA 4XT3B 1WTVA 3C1EA 4Q0FA 3NTKA 3N6RA 4PMWA 4QCLA 5G3LF 5KYLA 1QB5D 1G2SA 1ENCA 4HCEA 4XQNA 1HCZA 4OIJA 3IKJA 2HCIA 5IOCA 2QKIC 3HKZB 2EJMA 1PZKD 1MD2D 4RH6A 3D6CA 3TP8A 1STGA 3GTOB 1EQTA 2EJFC 1OXXK 5I9OA 1JOQA 3FRPB 1KDCA 2M00A 1RTNA 1EY9A 3EQLC 3DUZA 1LT5D 1RCVD 2B2WA 3IFTA 2RDGA 2EYOA 1QE6A 2QF7A 5C3EB 4F88A 4G7ZC 1GUWA 3NBHA 4MIUA 3RZOB 2J4XA 3I70A 4KN4C 2F0MA 1SNDA 3UI2A 4DAVA 1VMCA 1SYDA 3KBGA 4HMIA 5M9OA 1A2TA 4RAUC 1TS4A 3KLSX 1D1IA 3SK5A 3FKIB 3H6MA 2F0NA 3A7AB 3CU7A 2D2CC 2HDMA 4JK1C 4B9XA 2KVMA 2NN6G 1STEA 1X3QA 4CGYB 2E2JB 3QB3A 2H1EA 3DHQA 3ND9A 2A68C 1E0BA 3KLRA 2L55A 3I73A 1TQOA 4FF2A 4G57A 3RMHA 5EKKA 3Q22A 1DXMA 1S5CD 4BBSB 2ZXOA 1U4MA 1CQVA 1A3UA 2J0TD 2K5WA 1QOHA 3FMCA 3SHLA 1E2WA 2A69C 2X69A 2F0FA 1O7ZA 3K59A 1U4RA 1HA6A 2BDOA 4KTAA 4ME5A 1MSHA 1D5XC 3D4RA 3V05A 5COYA 4BWGB 3MAQA 3R8BA 1EY5A 1SNPA 2K05A 2F0PA 4Z9CB 3QO2A 2JSOA 3IFDA 3I90A 1V1PB 3SVMA 1UNSA 1Z6HA 5K5PA 3ITPA 1HTLD 2JA7B 1QCBD 1L0XB 2L5TA 1GUNA 5JVH3 4PMBA 1W6JA 2Q8TA 1UAPA 2RBMA 4G4KA 2VB2X 1LTTD 1PTOH 3QWNA 3K5MA 2KECA 1AW7A 4DGZA 2PQEA 5C5LA 2K01A 4F87A 4BA2I 5KIXA 4TRDA 2BA0A 1DONA 1C4QA 2WIIB 2B8GA 5D14A 3GTPB 1Q12A 2B2TC 3LX0A 2O2LD 2RSOA 3D4WA 3V96A 1PTOC 3DWPA 2Q8RE 1BOSA 2K32A 1B3AA 1KLGD 5C0XI 3NWTA 3NBIA 1HHVA 5ELFA 5CYUA 1B4OA 3K0YA 4IUPA 5ELCA 1SE3A 3RUZA 2R92B 2FHTA 3D6WA 2R61A 1LTBD 4ILWA 1H9RA 4NKLA 5G3LD 2GA4B 5M3FB 1KDAA 5F2DA 1F77A 3VYRA 5JPMC 4P2CB 2E75C 3HP3A 2IPKD 5JEAH 4FP5D 1CTMA 3SDZA 1U4LA 3DM1A 1BXTA 1F2YA 1FGBD 1WVLA 1STNA 1FNWA 4RFBA 5K36H 2WB1B 2NWGA 1TWHB 1DZ1A 3F2UA 5IT9L 1GUOA 1TR5A 3KBXA 2E2IB 3EVQA 3A8JE 3M4OB 2L4NA 2F0UA 1EYAA 1GHJA 4Y7NB 3BZDB 5KRUA 2B2VC 4EVOA 5EPJA 4FF1A 1LO5D 3BG3A 3J7AF 2KEDA 5D3DA 4NMZA 4I65A 4KK7A 4KD3A 1BR9A 1HUNA 2BE5D 2Z1CA 3A54A 5EQ0A 5IGFA 4ODGA 2QCPX 1G2TA 1EIGA 1XWEA 4OO1I 1EU4A 2EOTA 1EWHA 5LL6S 3FPUB 3P20A 1J8IA 1EOTA 1SNCA 4DAPA 1KNAA 4NW2A 3NUCA 1OXTA 2SNMA 4KI0A 3LNNA 3BVMA 3GTKB 1AP0A 3FEWX 3S2HB 4CKBA 1LTGD 1RTOA 2DY8A 1JWUD 3T51B 2VNUD 4F7XA 2A73B 2HCCA 3MVVA 2K5DA 4K14A 3GTLB 5ISRA 1I4HA 1O7YA 1EWCA 3WDNA 3EROA 3QIAA 3AU7A 1WCMB 3BVZA 4HN7A 4K8JA 2LS01 3AB9A 1GUTA 3H0GB 1PRTF 2EY5A 4M1UB 3OIPA 3NWSA 2DNEA 3T53B 5C0XH 4YIJA 5LHY1 2G9HD 2MP1A 3EA6A 2PNRC 4IUTA 4C3HG 4XDXA 1MBYA 5JEAG 4A93B 1W6KA 5DAUA 1ESFA 1QNKA 1SJED 3GQBA 1ILQA 2B2YC 2F0JA 1ENFA 1EQVA 5M5YB 1I6HB 3H91A 1B9NA 2WV6D 3PUVA 1IW7D 2VB3X 1BDOA 3OIQA 4DFAA 1SYFA 1KABA 1T5XD 5K36G 4XQQA 4KMUC 1LTRD 3PUWA 3K58A 2IX0A 1WTRA 5FO7B 1B1ZA 2RDHA 2O4XA 3MFYA 2L9HA 3J81L 2NZ1D 1RODA 4OL7A 5I6WA 2CQAA 1L0YB 3S14B 4PV1C 1DOKA 1LTAD 5EKLA 1BO0A 4WFN3 2Z4IA 3C1FA 4ULLA 1AFPA 2XWJB 3GV6A 2B63B 1TKWB 1IL8A 1I6VC 4KJNA 2NTTA 1RHPA 2G9DA 3IL8A 1PFBA 5IGCA 1EYCA 1YNND 1O7LA 4QUCA 1Q1EA 1F9SA 5C6AA 3I8ZA 1OXUA 3NTIA 2RDFA 3WOEA 1VDZA 2EVBA 1CM9A 3D31A 3TP7A 5JEAJ 5I6YA 2BE5C 4EGVA 1NCVA 3Q0AA 5DEHA 4IQZA 2I07B 3SK6A 3GTJB 5CR3A 5FO8B 5DM73 1JWSD 4KKUA 1Z47A 4BA1I 5EPKA 3TBIB 3GP7A 2V4DA 2F0IA 4DU9A 2F4IA 2FINB 3QG1A 1AEXA 3M7NA 4HMJA 2SDFA 5C0XG 3L3OC 1NAPA 3NQTA 1YNJD 2F0EA 3M4YA 4XXEA 2FMMA 4MHEA 1ENAA 4OHJA 4F8MA 5KNDA 2BOSA 3S17B 1FD7D 3T4AC 3OW7A 2JYOA 1LACA 2PYKA 4IFDI 1MSGA 4ZAIA 3MWYW 1I4QA 3J7AV 2TSSA 3GTMB 2F0VA 2PMZB 1MGSA 1LV9A 2D9UA 1TWGB 3PO3B 1EY0A 1F9RA 3EFXD 4C3IB 1HFGA 3HOWB 5I2YA 3ND8A 1HA5A 1SSOA 1NR2A 3L9AX 5I9PA 4K6LA 1IW7C 1AN8A 3ERQA 2J7ZA 3GD7A 2DN8A 3ZYYX 3VR5A 4KHVA 1TY2A 4FXKC 2F3WA 3I3CA 1X32A 1EU3A 1PRTD 2ICEC 1VF5C 1IKMA 3T56B 1G91A 2KJXA 3HGBA 1A6XA 5DNFA 4BBRB 1EL0A 1I4PA 3U9OA 1BF4A 4H13C 2EY1A 2RKSA 3CRKC 4RGOS 1VF7A 5C0XJ 1A2UA 1NUCA 1IYVA 5JOBA 2KCCA 2Z4HA 4L8JA 1F2LA 2KOLA 3VR3A 2B39A 2N88A 1XTCD 2CW0D 5EBDA 2NBFA 3PUYA 4A3DB 1EYDA 1HQRD 2K03A 3O13A 3NE5B 5CV8A 2YU9B 1CQFA 3I72A 1HTPA 2IWHA 3W3AA 3PUZA 4QIWB 2N55A 1S5DD 1JWMD 3VR4A 3HOYB 2QILA 2B2UA 1SYCA 1KNEA 4PQXA 4HCSA 3S15B 4TSSA 3MHBA 1EZ8A 3GTQB 4GZYC 2BCOA 4IUVA 3D4DA 4BS9A 5NUCA 3Q24A 3IAYA 4OIKA 1CZGA 4ABNA 3E5SA 4ZLTF 2WKCA 1WTQA 5BN5A 5A2QE 2LKVA 4NDXA 1KTKA 5M3MB 2PO4A 1BCPF 4X3KA 2F0OA 1S4ZA 2EXZA 3MEHA 2F0SA 3MXUA 4DK1A 1LT6D 1G291 1HUMA 1RKNA 2E2DC 4U673 2JEAI 1Y1WB 4IFDH 2XN9C 3MZ5A 2YYZA 4RGNA 1EY8A 3I4NB 1JCKB 4RCNA 3VYTA 1LLRD 3R2TA 1SE2A 2OF1A 1TU2B 1V1OA 4C1NI 3P7JA 1PRTB 2F0QA 1H9JA 2K1BA 2K04A 2D5DA 2QEJC 4RCOA 4G7HC 1EEID 1JC7A 5M5XB 2K6AA 4DNTB 1LTSD 3NTHA 2ID0A 3SE0A 3PV0A 1FNUA 1SXTA 1GUSA 4RWSC 4LJZC 2X6LA 3Q23A 2XRSD 2FMCA 1FR3A 1F2ZA 2EY6A 5JJZA 3X3MA 2ZXPA 4PMCA 5FK9C 1DJRD 2XSCA 3L7ZC 3A8IE 4DA2A 1PRTC 5M5WB 1B53A 2IT1A 1SMYD 2A6HD 2M9VA 4ZUJA 1PXUA 5CBAE 5C3XA 1RF2D 3KK7A 4K5VA 2KQ3A 3V2TA 5CC4A 2WKDA 3RD4A 4KY7A 1TWCB 4L6TB 2F0WA 5CMDA 4QUFA 3A56A 3ONAB 3PIP3 5BN3A 3AMUA 2NUCA 1AZPA 1PFNA 3I4MB 2EJGC 1DD2A 1V43A 2L1BA 2SNSA 4PNYA 5JVG3 3OHXC 1CHPD 4KHZA 5JPNC 1ML0D 2XVSA 1CK1A 3URYA 2EZVA 2WP8J 1HRJA 3LWUA 1H9KA 1Y1VB 3MXPA 2IJ0A 4A3FB 4IUUA 3VA5A 3HG9A 3W2DA 1R9TB 2OT2A 1PTOF 1ET6A 5CV5A 2EYJA 2OEOA 3S9WA 4E6IA 3GO5A 3TSSA 3VYSA 3E6ZX 4ZQ3A 4FO2A 1B44D 3M3YB 4X3SA 2R3ZA 3G6JB 4K5XA 4O42A 2L12A 4FXDA 1H9SA 3VR2A 2C9OA 2Q8IB 3MFGA 1HXYD 4CJ0B 4FYDA 1XYIA 2MPMA 5D3IB 4HAEA 1GUGA 4V0BA 1TWFB 4C3JB 3DMUA 2A74C 3NPPA 4TQUS 1JOOA 3MA2B 2HUGA 2ZXRA 4BY7B 1U9RA 1BQQT 1SAPA 4ZK9B 2RQXA 3A8KE 2F03A 5IGEA 2RVLA 4DXGA 5LL6X 1Q90A 1BCPD 1ZEQX 3SXHA 4XYQA 3JAML 1C48A 1TT2A 5AFWA 1CI3M 1D5ZC 4HSVA 1WTOA 2AQ1B 1UEAB 2B2VA 2BDNA 4IUNA 1WTXA 3TMEA 1QNUA 4MN3A 3A55A 1QJOA 5IGBA 4LAAA 1F2MA 5FLXL 4J1MA 1O78A 5KGUA 3A7LA 3S1RB 1CA6A 1D5MC 4KD4A 5C4ZA 2EYFA 4C2MB 3PMFA 1Y8NB 2A6HC 3RLFA 2AUKA 2RSNA 3SR1A 1FNVA 1S5BD 2NVTB 1E2VA 1I4GA 2KUMA 4XQJA 1SNQA 2NYZD 2XRQD 1NR4A 2PCFB 4JBWA 1A3TA 1C8CA 1MI2A 3N52A 4ZYSA 4N9TA 4A3EB 1K83B 1T5EA 2CVRA 4CBVA 3QOJA 4A3IB 3CKIB 1RDPD 3J80E 4RKLA 2WINB 4XTCS 2KCNA 1XX8A 4XT1B 1Y8OB 2B2WC 5KYIA 1B9MA 1F9PA 3QOLA 2Y0SB 4DNRB 2F0HA 4LK1C 1BUVT 2O5IC 3R3OA 1RJTA 4FF3A 2VXWA 2C5CA 4OO1H 3M85A 1Q8IA 1KLUD 1TS2A 1SNMA 1SEBD 1R4QB 1D1KA 5CBEE 5CV7A 2F0KA 3VYUA 5J22A 1E2ZA 3NK9A 2K5QA 4RKBA 1ZYRD 1SYBA 2B2YA 3K5NA 1SFOB 5E4XA 5TSSA 2EYLA 3K6OA 3S1QB 1A3VA 1GXDC 2NVXB 2DNCA 1PDQA 3HOUB 1ONLA 4L63B 2R93B 3RZDB 1VMPA 2OXPA 1BCPB 1DM0B 2D62A 2EYHA 4BY1B 3PO2B 2DY7A 5ELDA 3TZUA 4KKSA 4ID6A 1WTPA 3HEJA 4OGQC 4H44C 4H0LC 2NVYB 5IGGA 1JORA 4FF4A 4H7BA 4KN7C 1D2BA 1OXVA 5EGTA 4EQPA 5E4WC 1JQYD 1PTOD 1SDFA 3QJYA 1I3QB 1S5ED 5J1ZA 2FJ2A 2B2UC 3SEBA 1I4XA 5KEEA 1LT4D 5KNCA 1TWAB 2A5HA 2BA1A 4RA8A 5CV9A 1BCPC 3PUXA 3S1NB 2AWNA 1G8ZD 1A15A 4CHTB 1SE4A 3I4LA 1TS3A 1II3A 1SNOA 4CKEA 2RA4A 2XIWA 2WACA 5FKAC 1GOZA 5EBCA 1VCIA 3OMCA 1ILPA 2F0GA 3DEOA 2K33A 2JEBI 4UAIA 2KHSA 3HZXA 4KY6A 3NP8A 2AQ2B 4AYBB 2FFKB 1LT3D 4X3TA 3K7AB 4XIGS 2PZUA 5J39A 1EIHA 4OO1G 2HQEA 4DXFA 3C3LA 1STAA 1V8QA 1KAAA 2MUYA 1O80A 4RGMA 3HOZB 5A2QL 1JE4A 1ESRA 2IL8A 1CZWA 1YNNC 3DWQA 2EY2A 3OMGA 1IYUA 2F0LA 1CA5A 1WD1A 3GV3A 3Q6SA 1JB3A 4DF7A 1STBA 2MGSA 4J6HA 2WAQB 5HURA 1H9MA 4M8AA 5ELBA 4KJOA 2Z8LA 4HEDA 2PW5A 1I50B 4IUQA 2VUMB 4ZKCB 1PZID 3CRLC 1ZYRC 1EY6A 4K5WA 3U9SA 3NHHA 1PTOB 5C3WA 1STYA 3LWEA 3BVGA 4S3SA 4CJ2C 1AZQA 3HS0C 5CORA 5A35A 3TZDA 1M8AA 5IODA 3T16A 1YNJC 1ET9A 3DEPA 3J7YW 1CHQD 3R93A 1JICA 3SK8A 1ZKOA 4B08A 4QF4A 3D3RA 1QILA 2A6ED 4FVMA 4G7OC 3MTSA 5EJWA 2HDLA 1LTID 1TS5A 1Y8PB 4IN3A 3CHBD 4QMGA 4XYOA 2ENBA 2E76C 4EQNA 3EJIA 4DN4M 2M2LA 1G6ZA 4C3IG 3H09A 2JXMB 4RHRA 2E2HB 3VR6A 1IKLA 1H9SB 1QWYA 5I4DA 1WD0A 3BDOA 4K8IA 2PZTA 3GTGB 3FDTA 2E74C 5CGKA 1K8MA 3OWEB 5FOBB 4TKOB 1NSNS 4ZRZA 1D6EC 3P1HA 4QB4A 5FO9B 4B9WA 4C3HB 2CHBD 3FVQA 1PZJD 4WORA 4WRDA 1R4PB 3PIO3 2O5JC 4FNFA 5HGTA 1B2TA 3SK4A 5T1GA 3TP6A 2EE1A 4Q5VA 3P75A 3HOVB 3X3NA 3KLSA 3HRZC 2XNAC 1PMRA 1RD9D 1LABA 1ICWA 3I91A 2CW0C 2IX3A 4C56C 3DWAA 4IALA 1STHA 2IW3A 3D8GA 3OPOA 5BN4A 2MJ8A 1J9OA 1DCZA 3TP5A 3K5OA 3T13A 1JR0D 1JOKA 2F0TA 1V1PA 5CV4A 4A3BB 2B2TA 3HOXB 4HTHA 2JA5B 2PPBC 5T1IA 4ZUIA 1CT1D 3K57A 1K8OA 3BYTB 2NN6I 5E1FA 1HQMC 2JA8B 2AUJD 1BBXC 1B50A 3NXWA 4CJ1B 2EYPA 1GHKA 1IHZA 2AWOA 2F1MA 2NB0A 5C5MA 2K7VA 2F0DA 4HSPA 4V190 4IFDG 4R8IA 1SJHD 4UDUC 5C44B 3H94A 1KDBA 5JAVA 5IT9E 1HPCA 4WJWA 1TY0A 2TMPA 3FPPA 5EKIA 3OOCA 1WTWA 2MHVA 1S5FD 1U4PA 1BNZA 5DM63 4EQOA 5EPLA 1F9QA 3OSOA 3WOFA 2IX1A 4R8NA 4J8QA 3DXJC 4RHSA 4C1NK 2A6EC 1Z7TA 1DYQA 3K5LA 2AQ3B 3M7GA 2LMCB 5KNBA 2LY7A 1FYCA 5IIFA 4CKCA 2KEEA 1Q1BA 5C4XB 4LMQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVV A;  2PYK A;  3MXP A;  3TP5 A;  5IGB A;  3T13 A;  4LAA A;  4K14 A;  3VA5 A;  5ISR A;  2PZU A;  4KV6 A;  1JOK A;  2F3V A;  1F2M A;  4MIU A;  4QMG A;  5J39 A;  2F0T A;  2OXP A;  4N9P A;  4PMB A;  5CV4 A;  4J1M A;  4KJN A;  3ERO A;  1F2Y A;  2ENB A;  5KGU A;  2F0M A;  2HQE A;  2EYH A;  4HTH A;  1F2Z A;  1STN A;  1SND A;  2EY6 A;  3OWF A;  1SYD A;  4HMI A;  2F0V A;  1STA A;  2RBM A;  4IZ8 A;  3EJI A;  5CV5 A;  1SYC A;  4EQN A;  1A2T A;  5M9O A;  2EYJ A;  1KAA A;  2OEO A;  4KD4 A;  5C4Z A;  5IGC A;  2EYF A;  1EYC A;  4ZUI A;  3S9W A;  4PMC A;  3PMF A;  4K8J A;  3MHB A;  4NP5 A;  2SOB A;  4E6I A;  5IGD A;  3SK5 A;  1EZ8 A;  4ID6 A;  4ZQ3 A;  5E1F A;  3H6M A;  5E3F A;  2EY5 A;  2F0N A;  4DGZ A;  1EY4 A;  1EY7 A;  2PQE A;  3D4D A;  5C5L A;  5NUC A;  3HEJ A;  5C6A A;  3SR1 A;  4K2L A;  2EY2 A;  1EY0 A;  4B9X A;  3OMG A;  4YIJ A;  1SNQ A;  1SYG A;  5IGG A;  4K8I A;  2F0L A;  2PZT A;  1SYE A;  2EYP A;  2RDF A;  3E5S A;  3NXW A;  4K5X A;  1JOR A;  2PZW A;  5KIX A;  1IHZ A;  1TR5 A;  1A3T A;  4H7B A;  3EVQ A;  3TP7 A;  5CGK A;  4TRD A;  5I9P A;  5C5M A;  3D8G A;  5CV6 A;  5EGT A;  2F0D A;  2F0U A;  4EQP A;  5I6Y A;  4N9T A;  1EYA A;  3C1E A;  4DF7 A;  1STB A;  3ERQ A;  3QB3 A;  4ZUJ A;  3LX0 A;  1NSN S;  5DAU A;  5J1Z A;  3DHQ A;  2LKV A;  4NDX A;  5DEH A;  4KHV A;  3QOJ A;  2QDB A;  3P1H A;  2F3W A;  5C3X A;  3BDC A;  3D4W A;  4J6H A;  3SK6 A;  4RKL A;  2F0J A;  5CR3 A;  4K5V A;  1TQO A;  5KEE A;  4EVO A;  5HUR A;  5KRU A;  2KQ3 A;  1EQV A;  4QB4 A;  2F0O A;  3V2T A;  1KDB A;  4B9W A;  5CC4 A;  5JAV A;  5KYL A;  4KJO A;  5KYI A;  1ENC A;  4G57 A;  3QOL A;  2EXZ A;  3MEH A;  4WOR A;  3DMU A;  2F0H A;  2PW5 A;  4WRD A;  4NMZ A;  5CV9 A;  5EKK A;  4I65 A;  4KD3 A;  2F0I A;  2F0S A;  3ITP A;  3R3O A;  1JOO A;  4KY7 A;  4DFA A;  1SYF A;  4DU9 A;  3U9O A;  1KAB A;  1RKN A;  2F0W A;  5HGT A;  1II3 A;  5IOC A;  1SNO A;  4ODG A;  1A3U A;  5IGF A;  2EY1 A;  2RKS A;  1U9R A;  4K6D A;  3SK4 A;  4EQO A;  1AEX A;  2WAC A;  5IGE A;  3SHL A;  3TP6 A;  3RUZ A;  2NUC A;  1A2U A;  3OSO A;  1NUC A;  1EY6 A;  4R8N A;  1SNM A;  3MZ5 A;  3OMC A;  3D6C A;  4HMJ A;  4K5W A;  2F0F A;  5JOB A;  3P75 A;  3TP8 A;  2EYM A;  2F0G A;  1EY8 A;  2O4X A;  3NHH A;  4NKL A;  1STG A;  3BDL A;  5C4H A;  3SXH A;  5C3W A;  5CV7 A;  2SNS A;  2F0K A;  1STY A;  3NQT A;  4PNY A;  5J22 A;  4KTA A;  4K2K A;  3NK9 A;  1KDA A;  4S3S A;  2F0E A;  5F2D A;  4ME5 A;  4OL7 A;  5I6W A;  1TT2 A;  1SNC A;  2OF1 A;  4KY5 A;  4RKB A;  3NUC A;  1ENA A;  5I9O A;  4F8M A;  5IOD A;  2F0Q A;  3T16 A;  1SYB A;  1EY5 A;  2SNM A;  2KHS A;  5EKL A;  1JOQ A;  1EZ6 A;  1SNP A;  1KDC A;  2F0P A;  2M00 A;  1EY9 A;  5IIF A;  1EYD A;  3HZX A;  3C1F A;  2EYL A;  4IUN A;  3SK8 A;  4KY6 A;  3NP8 A;  5CV8 A;  4QF4 A;  3TME A;  1A3V A;  4F7X A;  4IAL A;  1STH A;  5K5P A;  2EYO A;  2PW7 A; 
#chains in the Genus database with same CATH topology
 3S2D B;  3MXG A;  3U50 C;  3IRB A;  1C0A A;  1SBB B;  1MHW C;  3C46 A;  2ES2 A;  4DAY A;  2CFM A;  4RMF A;  3ULP A;  2EDG A;  3STB D;  2F3V A;  2MNA A;  4N9P A;  3H3V C;  1PH8 A;  5D65 A;  1TVX A;  5C4X H;  4DR7 L;  2JP1 A;  3OWF A;  3KUP A;  3S16 B;  3R2I A;  4IZ8 A;  1EIF A;  3S2D H;  1X3P A;  5JJK A;  3M4Q A;  1GJX A;  4NP5 A;  5IGD A;  5FLM G;  1M90 C;  1X56 A;  1HFN A;  2EPB A;  3MXN A;  2JA6 B;  1EY7 A;  4X3U A;  3J80 L;  1QG7 A;  4K2L A;  2R6G A;  4R9W A;  1EEF D;  4O1N A;  1FJG L;  1PYW D;  1SYG A;  1SYE A;  5J3B A;  2PZW A;  4DR5 L;  2L0C A;  1DOM A;  1UUP A;  2I46 A;  2YV5 A;  4IFD J;  1PYS B;  1TII D;  3EIV A;  5CV6 A;  1U5K A;  2JA6 H;  2K4K A;  3TN2 A;  1ASY A;  1SMY C;  3C2P A;  4QGU A;  2QDB A;  1K3R A;  3BDC A;  1W3S A;  4KKT A;  1H95 A;  2NVQ B;  2B8F A;  4RGT A;  3S1R H;  2K28 A;  5C4J B;  4JI2 Q;  3I4M G;  4A3J B;  1UE6 A;  4U68 A;  2XWB B;  2ZM6 Q;  4ME3 A;  4IUR A;  2UU9 Q;  1QVF A;  4K0K L;  2A68 D;  2LFN A;  3BS1 A;  4LF6 L;  4K6D A;  3KF8 A;  2NVQ H;  1DOL A;  4FXG C;  1K0R A;  1S3O A;  2KA7 A;  5C4J H;  4DK0 A;  1ZXT A;  3S24 A;  2K75 A;  1GD7 A;  3JAM E;  2EYM A;  3BYY B;  3BDL A;  5C4H A;  4UP7 A;  3FHW A;  4K2K A;  3A74 A;  4KY5 A;  4A76 A;  3VA7 A;  4A3E H;  3A5Z B;  4A75 A;  1M4V A;  2JA8 G;  5LMN W;  4A3F G;  4I7Z C;  5ELE A;  1ASZ A;  1EZ6 A;  1PLF A;  2A69 D;  2WAQ E;  1OXS C;  1PFM A;  3I7F A;  3JC6 6;  3J80 c;  1EWI A;  1UE5 A;  2NN6 H;  2NTS A;  3NQI A;  2ICI A;  2SEB D;  3TRE A;  3MC0 B;  1GM5 A;  1BBU A;  2PW7 A;  2H4O A;  3J7A 5;  1LUZ A;  2RCF A;  2KCM A;  3J81 E;  4A3M B;  1CFM A;  4ZKB B;  5FLX E;  4DV2 Q;  1I4R A;  1IBL L;  4KV6 A;  3PGZ A;  3NSW A;  2R7Z B;  4A3G B;  3E0J A;  5C44 G;  1OO9 B;  2ZT9 C;  2Z6K C;  1Y69 U;  4A3M H;  3CCM A;  3G7L A;  3CMA A;  1Q3L A;  2NZO A;  2SOB A;  5IP7 G;  1UE1 A;  2OTJ A;  3AYH B;  4UP9 A;  5E3F A;  1XXG A;  3J81 j;  1EY4 A;  3CQZ B;  2X6G A;  3SGI A;  2JE6 I;  4A3K B;  4GLV B;  3CD6 A;  3S1M B;  2L11 A;  3S1Q H;  4C3J G;  1EFI D;  3TDQ A;  3CQZ H;  4HR7 B;  4POF A;  5I2X A;  4XT3 B;  1WTV A;  3C1E A;  1YHA A;  4GN4 B;  4Q0F A;  4JI8 L;  4A3K H;  2R93 H;  3NTK A;  3N6R A;  3RZD H;  2VQF L;  4PMW A;  4QCL A;  3A0J A;  3S1M H;  5G3L F;  1V9P A;  5KYL A;  1QB5 D;  1G2S A;  4LF5 Q;  1ENC A;  2EXD A;  4HCE A;  4XQN A;  3PO2 H;  1HCZ A;  5C4X G;  4KHP Q;  3RNU A;  4OIJ A;  2LXK A;  3IKJ A;  2HCI A;  5IOC A;  4R4O A;  2QKI C;  3HKZ B;  2EJM A;  1PZK D;  1MD2 D;  5IYD H;  4DR1 L;  4RH6 A;  3D6C A;  3TP8 A;  3CCL A;  2OQ0 A;  1STG A;  1CKN A;  3GTO B;  4I7A A;  2E5L Q;  1EQT A;  1I3Q H;  2EJF C;  1OXX K;  5I9O A;  1IBK Q;  1JOQ A;  3FRP B;  1IXR A;  1KDC A;  2M00 A;  1RTN A;  1EY9 A;  3EQL C;  3CF5 A;  2LSS A;  3DUZ A;  1LT5 D;  1RCV D;  2B2W A;  3GTO H;  4OX9 Q;  4LFC Q;  3IFT A;  2I0Q A;  1RIP A;  2RDG A;  3AQQ A;  2EYO A;  1EQR A;  5IP9 H;  1QE6 A;  2QF7 A;  2DGY A;  5C3E B;  3S1N H;  2Q2H A;  1HZB A;  4F88 A;  4G7Z C;  1GUW A;  3NEL A;  1Z9F A;  3MEF A;  3NBH A;  4MIU A;  4P73 A;  3RZO B;  2J4X A;  3I70 A;  4KN4 C;  1RL2 A;  2F0M A;  4LF8 Q;  1SND A;  3UI2 A;  4DAV A;  1WI5 A;  1VMC A;  1SYD A;  3KBG A;  4HMI A;  5M9O A;  1AH9 A;  2N3S A;  5C3E H;  1A2T A;  4RAU C;  4DV0 L;  1WTH A;  1TS4 A;  3KLS X;  1D1I A;  3SK5 A;  3HKS A;  3RZO H;  3FKI B;  3H6M A;  2F0N A;  4GOP C;  3A7A B;  3CU7 A;  2D2C C;  2HDM A;  4JK1 C;  4B9X A;  4A3E G;  4X65 Q;  3G71 A;  2KVM A;  4JI3 L;  4A3I G;  2WB1 E;  1E7Z A;  4UHV A;  4X62 L;  3FKI H;  2NN6 G;  1STE A;  2Y0S G;  1X3Q A;  4CGY B;  2E2J B;  3QB3 A;  4HJA A;  2H1E A;  3DHQ A;  3ND9 A;  1GKH A;  2A68 C;  1B7Y B;  1E0B A;  3KLR A;  2L55 A;  3I73 A;  1TQO A;  1YI2 A;  1HNW L;  1EQQ A;  4FF2 A;  3F2B A;  1UWV A;  2C35 B;  4G57 A;  3RMH A;  5EKK A;  4R4I A;  2E2J H;  3Q22 A;  1DXM A;  1NBW A;  1S5C D;  4BBS B;  1JJG A;  4GN3 B;  4A3M G;  2ZXO A;  1U4M A;  1CQV A;  2RHS B;  3A5U A;  3HOZ H;  1K28 A;  4LWC A;  1A3U A;  3PIP A;  2J0T D;  2K5W A;  1PH6 A;  2AHO B;  1QOH A;  3FMC A;  3SHL A;  4JI0 Q;  1E2W A;  2A69 C;  2X69 A;  2D0O A;  2F0F A;  1O7Z A;  3JAM i;  3K59 A;  3U58 A;  1U4R A;  4DV6 Q;  1HA6 A;  2BDO A;  3EN2 A;  1A8V A;  4KTA A;  4N8F A;  2BH2 A;  4ME5 A;  1MSH A;  2ZTC A;  1D5X C;  2VS1 A;  3D4R A;  5DLQ E;  4JBM A;  4WJ3 M;  3V05 A;  5COY A;  4BWG B;  3MAQ A;  3TQY A;  1EIY B;  3R8B A;  1EY5 A;  4A3K G;  2R93 G;  1SNP A;  2K05 A;  2F0P A;  4Z9C B;  3QO2 A;  1QUQ A;  2JSO A;  4JOI C;  3IFD A;  3I90 A;  1V1P B;  3SVM A;  3RN2 A;  1UNS A;  1BKB A;  1Z6H A;  5K5P A;  2KHI A;  3ITP A;  3PO2 G;  1HTL D;  1QZH A;  2VUM H;  3J81 i;  2JA7 B;  1QCB D;  2A19 A;  3RR5 A;  1L0X B;  2L5T A;  5EAY A;  2UU9 L;  1CSP A;  1GUN A;  5JVH 3;  4PMB A;  1W6J A;  2Q8T A;  1PH3 A;  2RCN A;  1UAP A;  2RBM A;  4QY7 A;  4G4K A;  2VB2 X;  5IYD G;  1LTT D;  1PTO H;  3QWN A;  3K5M A;  2KEC A;  1AW7 A;  1PHJ A;  4NXN Q;  1IBM L;  4ZCK A;  4DGZ A;  2PQE A;  5C5L A;  4DUY Q;  4GNX A;  2K01 A;  4F87 A;  4BA2 I;  5KIX A;  1YEZ A;  4TRD A;  2BA0 A;  1DON A;  4JI4 L;  1C4Q A;  4IOC A;  3I55 A;  2WII B;  1VQ4 A;  2B8G A;  5D14 A;  3GTP B;  1Q12 A;  4DV2 L;  5LMN L;  2B2T C;  3LX0 A;  2O2L D;  3CCQ A;  2N49 A;  2RSO A;  3D4W A;  3CC7 A;  3V96 A;  1VQP A;  1PTO C;  3DWP A;  4JI5 Q;  1VQA A;  4CDC C;  1SMX A;  2Q8R E;  1BOS A;  2K32 A;  1B3A A;  1PH5 A;  1KLG D;  3GTP H;  4DPG A;  5C0X I;  3NWT A;  5C3E G;  2HT1 A;  2E2H H;  3NBI A;  1HHV A;  5ELF A;  5CYU A;  1B4O A;  2YTX A;  3K80 C;  3K0Y A;  4IUP A;  5ELC A;  1SE3 A;  3RUZ A;  2R92 B;  2FHT A;  2F3I A;  3D6W A;  2R61 A;  1LTB D;  4ILW A;  1XJV A;  1H9R A;  4NKL A;  5G3L D;  1VQ5 A;  2GA4 B;  5M3F B;  1KDA A;  5F2D A;  1F77 A;  3J7Z C;  3TEH B;  2UUA L;  4AYB G;  2R92 H;  4YY3 L;  4JPB W;  4MNO A;  4DAY B;  3VYR A;  5JPM C;  2K5N A;  2K52 A;  4P2C B;  1B70 B;  2E75 C;  3HP3 A;  2IPK D;  5JEA H;  4FP5 D;  3T1H Q;  1PH7 A;  1CTM A;  3SDZ A;  2ASB A;  1YZ6 A;  1U4L A;  4GLA C;  1L1O C;  1Y14 B;  3DM1 A;  3MXN B;  3HOZ G;  1BXT A;  1F2Y A;  1FGB D;  2OTL A;  1WVL A;  1STN A;  2AMC B;  1FNW A;  3ULJ A;  4RFB A;  1J6Q A;  3HOV H;  5K36 H;  2WB1 B;  2NWG A;  2Q2U A;  1TWH B;  1DZ1 A;  4HJ7 A;  3F2U A;  3CC4 A;  5IT9 L;  3F2D A;  4H02 A;  1GUO A;  4OX9 L;  1TR5 A;  2WAQ G;  2EQS A;  3KBX A;  2E2I B;  3EVQ A;  2P5Z X;  3A8J E;  3M4O B;  2L4N A;  1EFW A;  2F0U A;  1EYA A;  1J5E Q;  4DR2 L;  5IYC G;  1GHJ A;  1YBY A;  4Y7N B;  1QVG A;  1P16 A;  4DR6 L;  1PVO A;  2VUM G;  4A3C H;  3BZD B;  5KRU A;  2B2V C;  4EVO A;  5EPJ A;  2E2I H;  4FF1 A;  3HOX H;  4LF8 L;  3M4O H;  4LFB L;  1LO5 D;  2L15 A;  3BG3 A;  3F8T A;  4TVA B;  3J7A F;  2KED A;  5D3D A;  4NMZ A;  4I65 A;  4KK7 A;  4KD3 A;  2JA5 H;  1BR9 A;  1HUN A;  5AJ3 Q;  2BE5 D;  2Z1C A;  3A54 A;  5EQ0 A;  2IY5 B;  2N8N A;  4ODG A;  5IGF A;  2QCP X;  4GLX A;  1G2T A;  1EIG A;  1XWE A;  4OO1 I;  2Z6B A;  1M1K C;  1EU4 A;  1HZA A;  3KLW A;  2EOT A;  2UUC Q;  1EWH A;  1GVP A;  5LL6 S;  3FPU B;  3P20 A;  1J8I A;  4DK6 C;  1EOT A;  1SNC A;  4DAP A;  1KNA A;  3ER0 A;  4NW2 A;  3NUC A;  3UE1 A;  1OXT A;  2QDL A;  2SNM A;  3E0E A;  3LNN A;  4KI0 A;  3BVM A;  3GTK B;  4X64 L;  4GN5 A;  1AP0 A;  3FEW X;  3S2H B;  4CKB A;  1LTG D;  1RTO A;  2DY8 A;  1JWU D;  3T51 B;  3OW2 A;  2VNU D;  2OCE A;  1A62 A;  4F7X A;  1VQG A;  5IT9 c;  2A73 B;  4P75 A;  2HCC A;  3MVV A;  2K5D A;  3KJO A;  4K14 A;  5L37 A;  5ISR A;  1I4H A;  3GTL B;  1O7Y A;  1N33 Q;  1EWC A;  3WDN A;  3CPF A;  2MFI A;  4B3S Q;  3ERO A;  3QIA A;  4MTK A;  3AU7 A;  1WCM B;  3BVZ A;  5HGQ A;  4HN7 A;  2CH4 A;  3GTL H;  4N8X 1;  4K8J A;  2LS0 1;  2UXC L;  3AB9 A;  1GUT A;  3H0G B;  1PRT F;  2EY5 A;  1KAW A;  4M1U B;  3OIP A;  1HNZ L;  3NWS A;  2DNE A;  3T53 B;  1WCM H;  5C0X H;  4YIJ A;  2PMZ E;  5LHY 1;  2G9H D;  2MQH A;  2VL6 A;  2MP1 A;  3ERS X;  2WFW A;  5IWA L;  3EA6 A;  3H0G H;  2PNR C;  4IUT A;  1EYG A;  4C3H G;  1CKM A;  2KEN A;  4XDX A;  1MBY A;  1IZ6 A;  5JEA G;  4DV7 Q;  4A93 B;  1W6K A;  4AIM A;  5DAU A;  1ESF A;  4DV4 Q;  1QNK A;  1SJE D;  1KIX A;  3GQB A;  1NNX A;  1ILQ A;  2B2Y C;  2F0J A;  2HD3 A;  4LF4 L;  1ENF A;  2R7F A;  1EQV A;  5M5Y B;  1I6H B;  3H91 A;  1L0W A;  1B9N A;  2WV6 D;  2G5D A;  4JCV E;  3S16 H;  3PUV A;  3CW2 C;  1IW7 D;  3ZJY C;  3BZC A;  2VB3 X;  1BDO A;  3OIQ A;  4DFA A;  1SYF A;  1KAB A;  3HOV G;  1T5X D;  5K36 G;  4XQQ A;  2UXD L;  2CCZ A;  4KMU C;  5M5Y H;  1XMQ Q;  1I6H H;  1LTR D;  3PUW A;  3K58 A;  2IX0 A;  1WTR A;  1YIT A;  5FO7 B;  1B1Z A;  2RDH A;  2O4X A;  1JJ2 A;  3MFY A;  2L9H A;  3I4O A;  4GS3 A;  3J81 L;  2NZ1 D;  1ROD A;  2WB1 G;  1SRU A;  4OL7 A;  5I6W A;  1HH2 P;  2CQA A;  4DK3 C;  4DUZ Q;  1L0Y B;  3S14 B;  4PV1 C;  1DOK A;  1LTA D;  5EKL A;  1Q8K A;  3OTO L;  1BO0 A;  4WFN 3;  4HID A;  1SR3 A;  1HZ9 A;  3NBH B;  2Z4I A;  3C1F A;  4ULL A;  4A3B G;  1AFP A;  3HOX G;  1JMC A;  4A3J H;  2XWJ B;  4R1J A;  2JA5 G;  3GV6 A;  3RN5 A;  4LUV A;  2CWA A;  1TKW B;  4RG1 A;  2B63 B;  1IL8 A;  1I6V C;  1O7I A;  4KJN A;  2Q2I A;  2NTT A;  1RHP A;  2G9D A;  4CDF C;  4P71 A;  3IL8 A;  1PFB A;  5IGC A;  3JAM c;  1EYC A;  1YNN D;  1O7L A;  4QIW E;  1Q86 C;  4QUC A;  2HHH L;  1Q1E A;  4CDD C;  1F9S A;  2B63 H;  5C6A A;  3I8Z A;  1OXU A;  3KF6 A;  3NTI A;  4IOA A;  4ALP A;  2F4V Q;  2RDF A;  1KD1 C;  2HQL A;  3WOE A;  1BVS A;  1VDZ A;  2EVB A;  1CM9 A;  3D31 A;  3TP7 A;  1KC8 C;  5JEA J;  5I6Y A;  3T1H L;  5GQO A;  2BE5 C;  2VY3 A;  4EGV A;  2K50 A;  1HJP A;  4YCV A;  1NCV A;  3J81 c;  3Q0A A;  5DEH A;  4IQZ A;  5FLX c;  2I07 B;  2R7Z H;  3KFU A;  3SK6 A;  3GTJ B;  5CR3 A;  5FO8 B;  4A3G H;  5DM7 3;  1JWS D;  4KKU A;  4OON A;  1Z47 A;  4BA1 I;  5EPK A;  1E1T A;  3TBI B;  4EX5 A;  1Q7Y C;  2UUB Q;  3KJP A;  3GP7 A;  2V4D A;  4LF9 Q;  3T1Y Q;  2F0I A;  4QJF A;  4LF7 Q;  2DUD A;  4JBK A;  3FP9 A;  5BR8 Q;  4DU9 A;  2F4I A;  4YCU A;  1VS0 A;  2FIN B;  3QG1 A;  4DR3 Q;  1K3B C;  1AEX A;  5IE8 A;  3M7N A;  1HR0 W;  1WCM G;  4HMJ A;  2SDF A;  5C0X G;  3L3O C;  1NAP A;  1QUQ B;  3NQT A;  1YNJ D;  2F0E A;  1YJN A;  3M4Y A;  4XXE A;  3H0G G;  2FMM A;  4MHE A;  1ENA A;  4OHJ A;  4F8M A;  2ATW A;  5KND A;  1HR0 Q;  2V1C C;  2BOS A;  1XNR Q;  3S17 B;  1NJI C;  1FD7 D;  3NEN A;  3T4A C;  1SE8 A;  3D0F A;  4BXX H;  3OW7 A;  2JYO A;  1LAC A;  5AJ3 L;  3RLN A;  2PYK A;  2UXB L;  4IFD I;  4JV5 Q;  1MSG A;  3E9I A;  4ZAI A;  3AFP A;  2ZJP A;  3MWY W;  1I4Q A;  3J7A V;  3S17 H;  3M9B A;  4MTN A;  1N34 Q;  2TSS A;  2JA6 G;  1C7Y A;  1WOC A;  3GTM B;  3STB C;  2F0V A;  1SLJ A;  4GNX B;  2UUC L;  2PMZ B;  2BH8 A;  3UDF A;  3F1Z A;  1FVI A;  4GKJ Q;  1MGS A;  4DR4 L;  4DV5 L;  1LV9 A;  2D9U A;  1N9W A;  1TWG B;  1HNX Q;  1EY0 A;  2B29 A;  3PO3 B;  4JG2 A;  1F9R A;  3EFX D;  4C3I B;  4AH6 A;  1HFG A;  3HOW B;  5I2Y A;  3ND8 A;  1HA5 A;  1SSO A;  1D7Q A;  1NR2 A;  3L9A X;  5I9P A;  4K6L A;  1IW7 C;  1AN8 A;  3ERQ A;  1TWG H;  2J7Z A;  3GD7 A;  3CME A;  3PO3 H;  4FDB A;  4A3J G;  2DN8 A;  3ZYY X;  3VR5 A;  3TS0 A;  3NEM A;  4KHV A;  1X9N A;  4GKK L;  1TY2 A;  4FXK C;  2F3W A;  3HOW H;  4IO9 A;  3I3C A;  1XNQ Q;  4B3S L;  1X32 A;  1EU3 A;  4B3R L;  1PRT D;  2ICE C;  1VF5 C;  2GN5 A;  1IKM A;  3PIO A;  1LTL A;  1VQN A;  2ALY B;  2JK8 A;  2KJX A;  3T56 B;  1G91 A;  3HGB A;  4DV1 Q;  1A6X A;  5DNF A;  4BBR B;  1EL0 A;  1I4P A;  3U9O A;  2JN4 A;  1BF4 A;  4H13 C;  2EY1 A;  2RKS A;  3CRK C;  4RGO S;  2B63 G;  2H5X A;  1VF7 A;  5C0X J;  4YHH Q;  4DV3 Q;  1A2U A;  1EUJ A;  1NUC A;  3W1B A;  1K73 C;  1IYV A;  5JOB A;  2KCC A;  1Q82 C;  4DNI A;  2Z4H A;  2JQO A;  4L8J A;  4O2D A;  1F2L A;  2KOL A;  3VR3 A;  2B39 A;  2N88 A;  4DV7 L;  1XTC D;  2CW0 D;  1YHB A;  4DV4 L;  3K0X A;  5EBD A;  2NBF A;  3PUY A;  4A3D B;  2R7Z G;  1EYD A;  1HQR D;  4JI7 Q;  2K03 A;  3O13 A;  3NE5 B;  5CV8 A;  1MJC A;  4A3G G;  2YU9 B;  1CQF A;  3I72 A;  1HTP A;  1L2F A;  1E3P A;  1W2B A;  4JBJ A;  4A4I A;  2IWH A;  4BBS H;  3W3A A;  3PUZ A;  4X66 Q;  4QIW B;  2N55 A;  4YCW A;  4A3D H;  1S5D D;  1XMQ L;  1A63 A;  4DKA C;  2YU9 H;  4JYA Q;  1JWM D;  3VR4 A;  3HOY B;  2QIL A;  1YJW A;  2B2U A;  1SYC A;  1KNE A;  4PQX A;  4HCS A;  3S15 B;  4TSS A;  3MHB A;  1EOV A;  1EZ8 A;  3GTQ B;  4JI2 L;  4GZY C;  1SRO A;  3M4P A;  2BCO A;  4IUV A;  1S40 A;  1N36 Q;  3D4D A;  3UDI A;  5NUC A;  4BS9 A;  3Q24 A;  1VQM A;  2ZM6 L;  1V1Q A;  3IAY A;  4OIK A;  1CZG A;  4ABN A;  3E5S A;  2RHQ B;  4ZLT F;  3S15 H;  4QL5 A;  3RLO A;  2WKC A;  1PV4 A;  1T9H A;  1WTQ A;  1QZG A;  1VQ9 A;  4BXX G;  1KXL A;  4LFA Q;  2JA7 H;  5BN5 A;  5A2Q E;  3PSI A;  2LKV A;  4NDX A;  1KTK A;  5M3M B;  4HJ8 A;  2PO4 A;  1BCP F;  4X3K A;  2F0O A;  2PQA A;  4L5Q A;  3K7U C;  3HKZ G;  1S4Z A;  2EXZ A;  3MEH A;  1AE3 A;  2CQO A;  2F0S A;  1WJJ A;  3MXU A;  1MIU A;  4DK1 A;  1LT6 D;  1G29 1;  1HUM A;  5M3M H;  1FJG Q;  1RKN A;  2E2D C;  3PF4 A;  4U67 3;  4GOP A;  2JEA I;  4DR5 Q;  4O0A A;  1Y1W B;  3KYH C;  2K5H A;  5IP9 G;  1YIJ A;  4IFD H;  2F4V L;  2XN9 C;  3MZ5 A;  2YYZ A;  3E3X A;  4RGN A;  1XPO A;  1EY8 A;  3I4N B;  1JCK B;  4RCN A;  3VYT A;  1LLR D;  3R2T A;  1SE2 A;  2OF1 A;  1TU2 B;  1V1O A;  4C1N I;  3P7J A;  4IPH A;  1Y1W H;  1VQI A;  1PRT B;  2F0Q A;  1H9J A;  1X55 A;  2K1B A;  2K04 A;  2D5D A;  2GVB A;  2A1A A;  2QEJ C;  4RCO A;  5GAE C;  4G7H C;  1EEI D;  1JC7 A;  5M5X B;  4K0K Q;  2K6A A;  3T1Y L;  4DNT B;  1LTS D;  3WWV A;  3NTH A;  4LF7 L;  2ID0 A;  3SE0 A;  5BR8 L;  2Z9H A;  3H15 A;  2R7D A;  3PV0 A;  2CWP A;  1FNU A;  4DR3 L;  1SXT A;  1GUS A;  4RWS C;  3FKI G;  4LJZ C;  1TXY A;  2X6L A;  3Q23 A;  2XRS D;  2FMC A;  1FR3 A;  1F2Z A;  2EY6 A;  5JJZ A;  3X3M A;  2ZXP A;  3Q8D A;  2E8G A;  4PMC A;  5FK9 C;  4LF5 L;  2OWO A;  4OEM B;  5M3F H;  2KCT A;  3CAM A;  4QQB X;  4KHP L;  1PYB A;  1DJR D;  2XSC A;  4NB3 A;  3L7Z C;  1HR0 L;  3A8I E;  4UPA A;  4DA2 A;  1XNR L;  4JOI A;  1PRT C;  5M5W B;  1B53 A;  2IT1 A;  1WFQ A;  4OWX B;  1SMY D;  2QW7 A;  1IBL Q;  2CH4 W;  1NMG A;  2A6H D;  2M9V A;  5GAG C;  4ZUJ A;  4BBS G;  1PXU A;  1QVC A;  5C3X A;  5CBA E;  1RF2 D;  1X3F A;  5M5W H;  2E5L L;  3KK7 A;  4K5V A;  4A3D G;  2KQ3 A;  1N34 L;  3V2T A;  5CC4 A;  4LW1 A;  1IBK L;  2WKD A;  3KDF A;  3RD4 A;  4KY7 A;  4LFC L;  1TWC B;  4GKJ L;  4L6T B;  2F0W A;  5IY0 A;  5CMD A;  1Q46 A;  2QEX A;  1CUK A;  1TWH H;  4QUF A;  3A56 A;  3ONA B;  3PIP 3;  3OYY A;  5BN3 A;  3AMU A;  2Y0S E;  2NUC A;  1AZP A;  1PFN A;  3I4M B;  2EIF A;  3B6Y A;  2EJG C;  1DD2 A;  1V43 A;  2L1B A;  2SNS A;  4PNY A;  3KF8 B;  3BJU A;  5JVG 3;  3OHX C;  1CHP D;  4KHZ A;  1UE7 A;  4LNQ A;  3AEV A;  4Y7N H;  5JPN C;  2D0P A;  1ML0 D;  2JA7 G;  1VQE A;  2XVS A;  1XMO Q;  1K9M C;  1CK1 A;  3URY A;  4P74 A;  2CKZ B;  2EZV A;  4X65 L;  2WP8 J;  1HRJ A;  3LWU A;  1H9K A;  1Y1V B;  3MXP A;  2IJ0 A;  4A3F B;  4IUU A;  3VA5 A;  4DR1 Q;  3HG9 A;  1NTG A;  2OQK A;  3W2D A;  5M3M G;  1PH1 A;  2K5V A;  4HIO A;  1R9T B;  4DV3 L;  2OT2 A;  1PTO F;  1XPR A;  1ET6 A;  3KF6 B;  5CV5 A;  1Y1V H;  4A3F H;  2EYJ A;  2OEO A;  1KHI A;  3S9W A;  2LXJ A;  4PZ7 A;  4E6I A;  3GO5 A;  4OWW B;  3TSS A;  3VYS A;  3E6Z X;  1CSQ A;  4ZQ3 A;  4UP8 A;  4FO2 A;  1B44 D;  1N8R C;  3M3Y B;  4X3S A;  3GTK H;  2R3Z A;  3G6J B;  3KOJ A;  4K5X A;  2AKW B;  4O42 A;  3S2H H;  2L12 A;  2IHF A;  1YHQ A;  4YWL A;  4JI0 L;  4FXD A;  1H9S A;  3VR2 A;  2C9O A;  4L5T A;  2Q8I B;  3MFG A;  1HXY D;  2PI2 A;  4CJ0 B;  4FYD A;  1XYI A;  4DV6 L;  4X66 L;  1MKH A;  5GRO A;  2MPM A;  5D3I B;  1L1O A;  4HAE A;  1GUG A;  4V0B A;  5IP7 H;  4JYA L;  1TWF B;  4C3J B;  3DMU A;  4B3M Q;  2A74 C;  2R92 G;  3NPP A;  4TQU S;  4OWT B;  1JOO A;  3MA2 B;  2RF4 A;  2HUG A;  2ZXR A;  4BY7 B;  5M3F G;  4JI3 Q;  1U9R A;  1BQQ T;  1TWF H;  3K81 C;  1SAP A;  4ZK9 B;  1JB7 A;  2RQX A;  3A8K E;  2F03 A;  5IGE A;  2QA4 A;  2RVL A;  4X62 Q;  4DXG A;  5LL6 X;  1Q90 A;  1BCP D;  4LUZ A;  1ZEQ X;  3SXH A;  4XYQ A;  3JAM L;  1XTD A;  3UDX A;  1IL2 A;  3CCV A;  1C48 A;  4BY7 H;  1E22 A;  3LGJ A;  1TT2 A;  5AFW A;  1CI3 M;  1HNW Q;  3VDY A;  4LFA L;  4A93 H;  1D5Z C;  4HSV A;  2VQE Q;  1WTO A;  2AQ1 B;  4NXN L;  1UEA B;  1CKN B;  2B2V A;  1VQC A;  2BDN A;  2XGT A;  4IUN A;  1WTX A;  3TME A;  1QNU A;  2KHJ A;  4DUY L;  4MN3 A;  1IYJ B;  3A55 A;  1QJO A;  5IGB A;  4LAA A;  3CCS A;  1VQ6 A;  1F2M A;  5FLX L;  4J1M A;  1YVC A;  1O78 A;  5KGU A;  3A7L A;  5LMU Q;  3S1R B;  1VQO A;  4AYB E;  1CA6 A;  4JW0 A;  1D5M C;  4KD4 A;  5C4Z A;  3CCE A;  2EYF A;  4A3C G;  4JI5 L;  4C2M B;  3PMF A;  1Y8N B;  2A6H C;  3RLF A;  1NY4 A;  2AUK A;  4JVZ A;  2RSN A;  3SR1 A;  1FNV A;  1S5B D;  3S14 H;  2NVT B;  1VQH A;  1E2V A;  4IJH A;  1I4G A;  2KUM A;  4XQJ A;  1SNQ A;  2NYZ D;  2XRQ D;  3BU2 A;  1NR4 A;  2PCF B;  4C2M H;  4JBW A;  4R4Q A;  3UDG A;  1A3T A;  4JI6 Q;  3CCJ A;  1C8C A;  1MI2 A;  3N52 A;  2VW9 A;  4ZYS A;  4N9T A;  4A3E B;  1K83 B;  1VQF A;  1T5E A;  2NVT H;  4LUO A;  2CVR A;  4P72 A;  4CBV A;  3QOJ A;  4A3I B;  3CKI B;  1RDP D;  3TRZ A;  3J80 E;  4RKL A;  2WIN B;  4XTC S;  2KCN A;  1PH9 A;  1XX8 A;  4XT1 B;  1Y8O B;  2B2W C;  5KYI A;  1B9M A;  1F9P A;  3QOL A;  2Y0S B;  4DNR B;  2F0H A;  1IBM Q;  2JJQ A;  1K83 H;  2HIX A;  4LK1 C;  1BUV T;  2O5I C;  3R3O A;  1RJT A;  1B8A A;  4FF3 A;  1Y1V G;  1I94 Q;  4Y52 H;  2VXW A;  4R4C A;  4A3I H;  1NMF A;  2C5C A;  4OO1 H;  3M85 A;  1E1O A;  1Q8I A;  1KLU D;  1TS2 A;  1SNM A;  4JI4 Q;  1SEB D;  1R4Q B;  1D1K A;  5LMN Q;  3G6E A;  1S72 A;  3BZK A;  2PNH A;  5CBE E;  5CV7 A;  1X3E A;  2F0K A;  3VYU A;  5J22 A;  1E2Z A;  3NK9 A;  2K5Q A;  4RKB A;  1ZYR D;  5JJL A;  1SYB A;  5ELN A;  5IYB H;  1LM0 A;  2B2Y A;  3GTJ H;  3K5N A;  2F52 A;  1SFO B;  5E4X A;  5TSS A;  2EYL A;  3U4V A;  1PFS A;  3K6O A;  3S1Q B;  1VQ7 A;  1XPU A;  1A3V A;  1GXD C;  2NVX B;  2DNC A;  1PDQ A;  2ZTD A;  3HOU B;  3PF5 A;  3CP0 A;  1ONL A;  4HIM A;  4L63 B;  4B3T Q;  2R93 B;  3RZD B;  1VMP A;  1VQK A;  1SFO H;  2OXP A;  2IHE A;  1J5E L;  1BCP B;  1DM0 B;  2D62 A;  2EYH A;  2NVX H;  4BY1 B;  3PO2 B;  3HOU H;  4A3L H;  1CKO A;  2UUA Q;  2DY7 A;  5ELD A;  4YY3 Q;  3TZU A;  4KKS A;  4ID6 A;  1WYD A;  3GDE A;  1B3Q A;  1WTP A;  4BY7 G;  3HEJ A;  4OGQ C;  4H44 C;  4H0L C;  4BY1 H;  2NVY B;  4A93 G;  1XMO L;  5IGG A;  1JOR A;  4FF4 A;  4H7B A;  4KN7 C;  1D2B A;  1OXV A;  1KRS A;  2PQA B;  5EGT A;  4EQP A;  5E4W C;  4NXM Q;  1JQY D;  1ICF B;  1PTO D;  1SDF A;  5GAD C;  2XTI A;  3QJY A;  1I3Q B;  1S5E D;  2PI2 E;  2NVY H;  5J1Z A;  1FL0 A;  1VQB A;  2FJ2 A;  2B2U C;  3SEB A;  1I4X A;  5KEE A;  1LT4 D;  3G48 A;  4GOP B;  5KNC A;  1BBW A;  1TWA B;  4HJ9 A;  2A5H A;  2BA1 A;  3GTM H;  4RA8 A;  2DJF C;  4JI1 Q;  5CV9 A;  1BCP C;  3F2C A;  3PUX A;  3S1N B;  2AWN A;  1G8Z D;  1A15 A;  1VQD A;  4CHT B;  1SE4 A;  3I4L A;  1TS3 A;  1II3 A;  1SNO A;  2Z0S A;  1PH4 A;  4CKE A;  2RA4 A;  2XIW A;  1TWA H;  4OXP A;  2WAC A;  5FKA C;  3QR8 A;  2YTV A;  1GOZ A;  5EBC A;  1VCI A;  4C3I H;  1N33 L;  3OMC A;  3PQI A;  1ILP A;  2F0G A;  4DR2 Q;  3CCU A;  1PA6 A;  1P8L A;  4DR6 Q;  4EQ5 A;  3DEO A;  3HFZ B;  2K33 A;  2JEB I;  2Z6K A;  1G51 A;  2VZA A;  3CPW A;  4UAI A;  4LFB Q;  2KHS A;  4GNX C;  4IPD A;  2MO0 A;  3HZX A;  2ZJR A;  4KY6 A;  3NP8 A;  2AQ2 B;  4B3M L;  4IPC A;  4AYB B;  2FFK B;  1LT3 D;  4X3T A;  1NE3 A;  4BBR H;  3K7A B;  4XIG S;  2PZU A;  1K0S A;  4X6A H;  5J39 A;  1EIH A;  3G4S A;  1U0L A;  3E9H A;  4OO1 G;  2HQE A;  4DXF A;  1VQJ A;  3C3L A;  1STA A;  4AQY Q;  1V8Q A;  1KAA A;  2MUY A;  1O80 A;  3I2Z A;  4RGM A;  3K7A H;  1K8G A;  3HOZ B;  5A2Q L;  1JE4 A;  4X64 Q;  1ESR A;  2IL8 A;  1CZW A;  5JJI A;  2VQE L;  2DJG C;  1YNN C;  3DWQ A;  3CC2 A;  2EY2 A;  3ULL A;  3OMG A;  4CDE C;  1IYU A;  2F0L A;  1K8A C;  1N32 Q;  5IYB G;  1CA5 A;  1WD1 A;  4PZ8 A;  3GV3 A;  5H1S E;  3Q6S A;  3KDF B;  1JB3 A;  4DF7 A;  1STB A;  2MGS A;  3DM3 A;  4J6H A;  2WAQ B;  3J80 i;  1C9O A;  4NPS A;  5HUR A;  2FXQ A;  1H9M A;  1OTC A;  4M8A A;  5ELB A;  1VQL A;  4DUZ L;  4KJO A;  2QGQ A;  5LMU L;  2Z8L A;  2UXC Q;  3HOY H;  4HED A;  2PW5 A;  1I50 B;  2ZJQ A;  1YJ9 A;  5FJ8 H;  4IUQ A;  1HNZ Q;  3HOU G;  2VUM B;  4A3L G;  4HJ5 A;  4ZKC B;  3GTQ H;  5E7N A;  1PZI D;  3CRL C;  3EBE A;  1SN8 A;  1ZYR C;  3I56 A;  5IWA Q;  2KBN A;  4DR7 Q;  1I50 H;  1EY6 A;  2K14 A;  5IYC H;  4BY1 G;  2A8V A;  4K5W A;  3U9S A;  4PG3 A;  3NHH A;  1PTO B;  4JI6 L;  4JC0 A;  5C3W A;  1STY A;  4KLK A;  3LWE A;  3BVG A;  4S3S A;  3UE0 A;  3L2P A;  4CJ2 C;  4LF4 Q;  1AZQ A;  3HS0 C;  4APV A;  5COR A;  5A35 A;  3TZD A;  1M8A A;  5IOD A;  3T16 A;  1YNJ C;  1X54 A;  1ET9 A;  3DEP A;  3J7Y W;  2GVA A;  1CHQ D;  3R93 A;  1JIC A;  3SK8 A;  1ZKO A;  4B08 A;  4QF4 A;  3D3R A;  1QIL A;  2A6E D;  3AFQ A;  2UXD Q;  4FVM A;  2Q2T A;  1I5F A;  4G7O C;  3MTS A;  5EJW A;  2HDL A;  1I94 L;  3TS2 A;  1LTI D;  1TS5 A;  1Y8P B;  4IN3 A;  3H3V I;  3CHB D;  4QMG A;  4XYO A;  2ENB A;  2E76 C;  4EQN A;  3PO3 G;  3EJI A;  1PH2 A;  4DN4 M;  2M2L A;  1A0I A;  1G6Z A;  4C3I G;  3I4N H;  3HOW G;  3H09 A;  1JE5 A;  2JXM B;  4RHR A;  2E2H B;  3VR6 A;  1IKL A;  3OTO Q;  2UUB L;  1H9S B;  1QWY A;  2HIV A;  4LF9 L;  4LF6 Q;  5I4D A;  1WD0 A;  1GO3 E;  1X3G A;  3BDO A;  4K8I A;  2PZT A;  4MZ9 A;  1L1O B;  1LYL A;  3GTG B;  3FDT A;  2E74 C;  5CGK A;  5M5X H;  1K8M A;  4YWK A;  4HIK A;  3OWE B;  5FOB B;  4TKO B;  4B3T L;  1NSN S;  4ZRZ A;  1D6E C;  3P1H A;  4BBR G;  3GTG H;  4YWM A;  1MJE A;  4QB4 A;  5FO9 B;  4B9W A;  2I5L X;  2HHH Q;  4C3H B;  2CHB D;  2I5M X;  1PZJ D;  3FVQ A;  4WOR A;  4WRD A;  3CCR A;  1R4P B;  1DGS A;  3PIO 3;  2O5J C;  4FNF A;  5HGT A;  4POG A;  1B2T A;  3L0O A;  3SK4 A;  5T1G A;  4UY8 C;  1X65 A;  4C3H H;  4JV5 L;  3TP6 A;  2EE1 A;  1HZC A;  4Q5V A;  3P75 A;  5FLM H;  3CXC A;  3HOV B;  3X3N A;  2I5H A;  3KLS A;  4OEL B;  3HRZ C;  4NXM L;  2B3G A;  2XNA C;  1PMR A;  4PZ6 A;  1JT8 A;  1RD9 D;  2MO1 A;  4R4T A;  1LAB A;  1ICW A;  3I91 A;  2CW0 C;  3W1G A;  1VQ8 A;  2IX3 A;  1HNX L;  4C56 C;  3DWA A;  4JI1 L;  4IAL A;  1STH A;  2IW3 A;  3D8G A;  3OPO A;  5BN4 A;  3HOY G;  2MJ8 A;  1J9O A;  1DCZ A;  3TP5 A;  3K5O A;  3T13 A;  4JI8 Q;  5FJ8 G;  1JR0 D;  1TWC H;  2VQF Q;  1KL9 A;  1JOK A;  2F0T A;  1V1P A;  5CV4 A;  3DLL A;  4A3B B;  2B2T A;  3HOX B;  4HTH A;  3ICE A;  2N78 A;  3I4M H;  1X6O A;  4L5R C;  1XNQ L;  2JA5 B;  1G6P A;  2PPB C;  1UEB A;  5T1I A;  4ZUI A;  1CT1 D;  3K57 A;  1K8O A;  3BYT B;  2NN6 I;  5E1F A;  4IPG A;  1HQM C;  2JA8 B;  2ZTE A;  4A3B H;  4DV1 L;  2AUJ D;  1BBX C;  1B50 A;  3NXW A;  4CJ1 B;  2EYP A;  2UXB Q;  1GHK A;  4WJ4 A;  1IHZ A;  2AWO A;  2F1M A;  4YHH L;  2NB0 A;  5C5M A;  2K7V A;  1YNX A;  2F0D A;  4HSP A;  2JA8 H;  1D8L A;  4V19 0;  4IFD G;  4R8I A;  1SJH D;  3K8A A;  4UDU C;  5ELO A;  5C44 B;  3H94 A;  2YTY A;  1R9T H;  1KDB A;  5JAV A;  5IT9 E;  1HPC A;  2NZH A;  4WJW A;  4DR4 Q;  1TY0 A;  2JA9 A;  2TMP A;  5HY6 A;  4DV5 Q;  4AQY L;  1Y1W G;  3FPP A;  1FGU A;  1KQS A;  5EKI A;  4JI7 L;  3OOC A;  1WTW A;  3U4Z A;  2MHV A;  1AE2 A;  1S5F D;  1U4P A;  3I4N G;  5C44 H;  1BNZ A;  3PCO B;  5DM6 3;  1JJC B;  4EQO A;  5EPL A;  1F9Q A;  1E24 A;  3OSO A;  3WOF A;  2IX1 A;  4R8N A;  3M3Y H;  5GAH C;  1N32 L;  4DV0 Q;  4J8Q A;  3DXJ C;  4RHS A;  3H3V H;  4C1N K;  2A6E C;  4GKK Q;  1Z7T A;  4J15 A;  3HKZ E;  1DYQ A;  1KRT A;  4B3R Q;  4IJL A;  3K5L A;  4L5S A;  2AQ3 B;  3M7G A;  2LMC B;  5KNB A;  2LY7 A;  1Q81 C;  1FYC A;  5IIF A;  4CKC A;  1N36 L;  3W5O A;  2KEE A;  4C3J H;  1Q1B A;  4DAM A;  5C4X B;  4LMQ D; 
#chains in the Genus database with same CATH homology
 3S2D B;  3MXG A;  1SBB B;  3C46 A;  4DAY A;  2EDG A;  2F3V A;  4N9P A;  3H3V C;  5D65 A;  1TVX A;  2JP1 A;  3OWF A;  3KUP A;  3S16 B;  3R2I A;  4IZ8 A;  1X3P A;  1GJX A;  4NP5 A;  5IGD A;  1HFN A;  2EPB A;  3MXN A;  2JA6 B;  1EY7 A;  4X3U A;  3J80 L;  1QG7 A;  4K2L A;  2R6G A;  4R9W A;  1EEF D;  4O1N A;  1PYW D;  1SYG A;  1SYE A;  2PZW A;  2L0C A;  1DOM A;  1UUP A;  2I46 A;  4IFD J;  1TII D;  5CV6 A;  3TN2 A;  1SMY C;  3C2P A;  2QDB A;  3BDC A;  4KKT A;  2NVQ B;  2B8F A;  4RGT A;  2K28 A;  5C4J B;  4A3J B;  4U68 A;  2XWB B;  4IUR A;  2A68 D;  2LFN A;  3BS1 A;  4K6D A;  3KF8 A;  1DOL A;  4FXG C;  2KA7 A;  4DK0 A;  1ZXT A;  3JAM E;  2EYM A;  3BYY B;  3BDL A;  5C4H A;  4K2K A;  4KY5 A;  3VA7 A;  1M4V A;  4I7Z C;  5ELE A;  1EZ6 A;  1PLF A;  2A69 D;  1OXS C;  1PFM A;  2NN6 H;  2NTS A;  3NQI A;  2ICI A;  2SEB D;  3MC0 B;  2PW7 A;  2H4O A;  3J81 E;  4A3M B;  1CFM A;  4ZKB B;  5FLX E;  1I4R A;  4KV6 A;  2R7Z B;  3NSW A;  4A3G B;  3E0J A;  1OO9 B;  2ZT9 C;  1Y69 U;  3G7L A;  1Q3L A;  2SOB A;  5E3F A;  1XXG A;  1EY4 A;  3CQZ B;  2X6G A;  2JE6 I;  4A3K B;  3S1M B;  2L11 A;  4C3J G;  1EFI D;  3TDQ A;  4HR7 B;  5I2X A;  4XT3 B;  1WTV A;  3C1E A;  4Q0F A;  3NTK A;  3N6R A;  4PMW A;  4QCL A;  5G3L F;  5KYL A;  1QB5 D;  1G2S A;  1ENC A;  4HCE A;  4XQN A;  1HCZ A;  4OIJ A;  3IKJ A;  2HCI A;  5IOC A;  2QKI C;  3HKZ B;  2EJM A;  1PZK D;  1MD2 D;  4RH6 A;  3D6C A;  3TP8 A;  1STG A;  3GTO B;  1EQT A;  2EJF C;  1OXX K;  5I9O A;  1JOQ A;  3FRP B;  1KDC A;  2M00 A;  1RTN A;  1EY9 A;  3EQL C;  3DUZ A;  1LT5 D;  1RCV D;  2B2W A;  3IFT A;  2RDG A;  2EYO A;  1QE6 A;  2QF7 A;  5C3E B;  4F88 A;  4G7Z C;  1GUW A;  3NBH A;  4MIU A;  3RZO B;  2J4X A;  3I70 A;  4KN4 C;  2F0M A;  1SND A;  3UI2 A;  4DAV A;  1VMC A;  1SYD A;  3KBG A;  4HMI A;  5M9O A;  1A2T A;  4RAU C;  1TS4 A;  3KLS X;  1D1I A;  3SK5 A;  3FKI B;  3H6M A;  2F0N A;  3A7A B;  3CU7 A;  2D2C C;  2HDM A;  4JK1 C;  4B9X A;  2KVM A;  2NN6 G;  1STE A;  1X3Q A;  4CGY B;  2E2J B;  3QB3 A;  2H1E A;  3DHQ A;  3ND9 A;  2A68 C;  1E0B A;  3KLR A;  2L55 A;  3I73 A;  1TQO A;  4FF2 A;  4G57 A;  3RMH A;  5EKK A;  3Q22 A;  1DXM A;  1S5C D;  4BBS B;  2ZXO A;  1U4M A;  1CQV A;  1A3U A;  2J0T D;  2K5W A;  1QOH A;  3FMC A;  3SHL A;  1E2W A;  2A69 C;  2X69 A;  2F0F A;  1O7Z A;  3K59 A;  1U4R A;  1HA6 A;  2BDO A;  4KTA A;  4ME5 A;  1MSH A;  1D5X C;  3D4R A;  3V05 A;  5COY A;  4BWG B;  3MAQ A;  3R8B A;  1EY5 A;  1SNP A;  2K05 A;  2F0P A;  4Z9C B;  3QO2 A;  2JSO A;  3IFD A;  3I90 A;  1V1P B;  3SVM A;  1UNS A;  1Z6H A;  5K5P A;  3ITP A;  1HTL D;  2JA7 B;  1QCB D;  1L0X B;  2L5T A;  1GUN A;  5JVH 3;  4PMB A;  1W6J A;  2Q8T A;  1UAP A;  2RBM A;  4G4K A;  2VB2 X;  1LTT D;  1PTO H;  3QWN A;  3K5M A;  2KEC A;  1AW7 A;  4DGZ A;  2PQE A;  5C5L A;  2K01 A;  4F87 A;  4BA2 I;  5KIX A;  4TRD A;  2BA0 A;  1DON A;  1C4Q A;  2WII B;  2B8G A;  5D14 A;  3GTP B;  1Q12 A;  2B2T C;  3LX0 A;  2O2L D;  2RSO A;  3D4W A;  3V96 A;  1PTO C;  3DWP A;  2Q8R E;  1BOS A;  2K32 A;  1B3A A;  1KLG D;  5C0X I;  3NWT A;  3NBI A;  1HHV A;  5ELF A;  5CYU A;  1B4O A;  3K0Y A;  4IUP A;  5ELC A;  1SE3 A;  3RUZ A;  2R92 B;  2FHT A;  3D6W A;  2R61 A;  1LTB D;  4ILW A;  1H9R A;  4NKL A;  5G3L D;  2GA4 B;  5M3F B;  1KDA A;  5F2D A;  1F77 A;  3VYR A;  5JPM C;  4P2C B;  2E75 C;  3HP3 A;  2IPK D;  5JEA H;  4FP5 D;  1CTM A;  3SDZ A;  1U4L A;  3DM1 A;  1BXT A;  1F2Y A;  1FGB D;  1WVL A;  1STN A;  1FNW A;  4RFB A;  5K36 H;  2WB1 B;  2NWG A;  1TWH B;  1DZ1 A;  3F2U A;  5IT9 L;  1GUO A;  1TR5 A;  3KBX A;  2E2I B;  3EVQ A;  3A8J E;  3M4O B;  2L4N A;  2F0U A;  1EYA A;  1GHJ A;  4Y7N B;  3BZD B;  5KRU A;  2B2V C;  4EVO A;  5EPJ A;  4FF1 A;  1LO5 D;  3BG3 A;  3J7A F;  2KED A;  5D3D A;  4NMZ A;  4I65 A;  4KK7 A;  4KD3 A;  1BR9 A;  1HUN A;  2BE5 D;  2Z1C A;  3A54 A;  5EQ0 A;  5IGF A;  4ODG A;  2QCP X;  1G2T A;  1EIG A;  1XWE A;  4OO1 I;  1EU4 A;  2EOT A;  1EWH A;  5LL6 S;  3FPU B;  3P20 A;  1J8I A;  1EOT A;  1SNC A;  4DAP A;  1KNA A;  4NW2 A;  3NUC A;  1OXT A;  2SNM A;  4KI0 A;  3LNN A;  3BVM A;  3GTK B;  1AP0 A;  3FEW X;  3S2H B;  4CKB A;  1LTG D;  1RTO A;  2DY8 A;  1JWU D;  3T51 B;  2VNU D;  4F7X A;  2A73 B;  2HCC A;  3MVV A;  2K5D A;  4K14 A;  3GTL B;  5ISR A;  1I4H A;  1O7Y A;  1EWC A;  3WDN A;  3ERO A;  3QIA A;  3AU7 A;  1WCM B;  3BVZ A;  4HN7 A;  4K8J A;  2LS0 1;  3AB9 A;  1GUT A;  3H0G B;  1PRT F;  2EY5 A;  4M1U B;  3OIP A;  3NWS A;  2DNE A;  3T53 B;  5C0X H;  4YIJ A;  5LHY 1;  2G9H D;  2MP1 A;  3EA6 A;  2PNR C;  4IUT A;  4C3H G;  4XDX A;  1MBY A;  5JEA G;  4A93 B;  1W6K A;  5DAU A;  1ESF A;  1QNK A;  1SJE D;  3GQB A;  1ILQ A;  2B2Y C;  2F0J A;  1ENF A;  1EQV A;  5M5Y B;  1I6H B;  3H91 A;  1B9N A;  2WV6 D;  3PUV A;  1IW7 D;  2VB3 X;  1BDO A;  3OIQ A;  4DFA A;  1SYF A;  1KAB A;  1T5X D;  5K36 G;  4XQQ A;  4KMU C;  1LTR D;  3PUW A;  3K58 A;  2IX0 A;  1WTR A;  5FO7 B;  1B1Z A;  2RDH A;  2O4X A;  3MFY A;  2L9H A;  3J81 L;  2NZ1 D;  1ROD A;  4OL7 A;  5I6W A;  2CQA A;  1L0Y B;  3S14 B;  4PV1 C;  1DOK A;  1LTA D;  5EKL A;  1BO0 A;  4WFN 3;  2Z4I A;  3C1F A;  4ULL A;  1AFP A;  2XWJ B;  3GV6 A;  2B63 B;  1TKW B;  1IL8 A;  1I6V C;  4KJN A;  2NTT A;  1RHP A;  2G9D A;  3IL8 A;  1PFB A;  5IGC A;  1EYC A;  1YNN D;  1O7L A;  4QUC A;  1Q1E A;  1F9S A;  5C6A A;  3I8Z A;  1OXU A;  3NTI A;  2RDF A;  3WOE A;  1VDZ A;  2EVB A;  1CM9 A;  3D31 A;  3TP7 A;  5JEA J;  5I6Y A;  2BE5 C;  4EGV A;  1NCV A;  3Q0A A;  5DEH A;  4IQZ A;  2I07 B;  3SK6 A;  3GTJ B;  5CR3 A;  5FO8 B;  5DM7 3;  1JWS D;  4KKU A;  1Z47 A;  4BA1 I;  5EPK A;  3TBI B;  3GP7 A;  2V4D A;  2F0I A;  4DU9 A;  2F4I A;  2FIN B;  3QG1 A;  1AEX A;  3M7N A;  4HMJ A;  2SDF A;  5C0X G;  3L3O C;  1NAP A;  3NQT A;  1YNJ D;  2F0E A;  3M4Y A;  4XXE A;  2FMM A;  4MHE A;  1ENA A;  4OHJ A;  4F8M A;  5KND A;  2BOS A;  3S17 B;  1FD7 D;  3T4A C;  3OW7 A;  2JYO A;  1LAC A;  2PYK A;  4IFD I;  1MSG A;  4ZAI A;  3MWY W;  1I4Q A;  3J7A V;  2TSS A;  3GTM B;  2F0V A;  2PMZ B;  1MGS A;  1LV9 A;  2D9U A;  1TWG B;  3PO3 B;  1EY0 A;  1F9R A;  3EFX D;  4C3I B;  1HFG A;  3HOW B;  5I2Y A;  3ND8 A;  1HA5 A;  1SSO A;  1NR2 A;  3L9A X;  5I9P A;  4K6L A;  1IW7 C;  1AN8 A;  3ERQ A;  2J7Z A;  3GD7 A;  2DN8 A;  3ZYY X;  3VR5 A;  4KHV A;  1TY2 A;  4FXK C;  2F3W A;  3I3C A;  1X32 A;  1EU3 A;  1PRT D;  2ICE C;  1VF5 C;  1IKM A;  3T56 B;  1G91 A;  2KJX A;  3HGB A;  1A6X A;  5DNF A;  4BBR B;  1EL0 A;  1I4P A;  3U9O A;  1BF4 A;  4H13 C;  2EY1 A;  2RKS A;  3CRK C;  4RGO S;  1VF7 A;  5C0X J;  1A2U A;  1NUC A;  1IYV A;  5JOB A;  2KCC A;  2Z4H A;  4L8J A;  1F2L A;  2KOL A;  3VR3 A;  2B39 A;  2N88 A;  1XTC D;  2CW0 D;  5EBD A;  2NBF A;  3PUY A;  4A3D B;  1EYD A;  1HQR D;  2K03 A;  3O13 A;  3NE5 B;  5CV8 A;  2YU9 B;  1CQF A;  3I72 A;  1HTP A;  2IWH A;  3W3A A;  3PUZ A;  4QIW B;  2N55 A;  1S5D D;  1JWM D;  3VR4 A;  3HOY B;  2QIL A;  2B2U A;  1SYC A;  1KNE A;  4PQX A;  4HCS A;  3S15 B;  4TSS A;  3MHB A;  1EZ8 A;  3GTQ B;  4GZY C;  2BCO A;  4IUV A;  3D4D A;  4BS9 A;  5NUC A;  3Q24 A;  3IAY A;  4OIK A;  1CZG A;  4ABN A;  3E5S A;  4ZLT F;  2WKC A;  1WTQ A;  5BN5 A;  5A2Q E;  2LKV A;  4NDX A;  1KTK A;  5M3M B;  2PO4 A;  1BCP F;  4X3K A;  2F0O A;  1S4Z A;  2EXZ A;  3MEH A;  2F0S A;  3MXU A;  4DK1 A;  1LT6 D;  1G29 1;  1HUM A;  1RKN A;  2E2D C;  4U67 3;  2JEA I;  1Y1W B;  4IFD H;  2XN9 C;  3MZ5 A;  2YYZ A;  4RGN A;  1EY8 A;  3I4N B;  1JCK B;  4RCN A;  3VYT A;  1LLR D;  3R2T A;  1SE2 A;  2OF1 A;  1TU2 B;  1V1O A;  4C1N I;  3P7J A;  1PRT B;  2F0Q A;  1H9J A;  2K1B A;  2K04 A;  2D5D A;  2QEJ C;  4RCO A;  4G7H C;  1EEI D;  1JC7 A;  5M5X B;  2K6A A;  4DNT B;  1LTS D;  3NTH A;  2ID0 A;  3SE0 A;  3PV0 A;  1FNU A;  1SXT A;  1GUS A;  4RWS C;  4LJZ C;  2X6L A;  3Q23 A;  2XRS D;  2FMC A;  1FR3 A;  1F2Z A;  2EY6 A;  5JJZ A;  3X3M A;  2ZXP A;  4PMC A;  5FK9 C;  1DJR D;  2XSC A;  3L7Z C;  3A8I E;  4DA2 A;  1PRT C;  5M5W B;  1B53 A;  2IT1 A;  1SMY D;  2A6H D;  2M9V A;  4ZUJ A;  1PXU A;  5CBA E;  5C3X A;  1RF2 D;  3KK7 A;  4K5V A;  2KQ3 A;  3V2T A;  5CC4 A;  2WKD A;  3RD4 A;  4KY7 A;  1TWC B;  4L6T B;  2F0W A;  5CMD A;  4QUF A;  3A56 A;  3ONA B;  3PIP 3;  5BN3 A;  3AMU A;  2NUC A;  1AZP A;  1PFN A;  3I4M B;  2EJG C;  1DD2 A;  1V43 A;  2L1B A;  2SNS A;  4PNY A;  5JVG 3;  3OHX C;  1CHP D;  4KHZ A;  5JPN C;  1ML0 D;  2XVS A;  1CK1 A;  3URY A;  2EZV A;  2WP8 J;  1HRJ A;  3LWU A;  1H9K A;  1Y1V B;  3MXP A;  2IJ0 A;  4A3F B;  4IUU A;  3VA5 A;  3HG9 A;  3W2D A;  1R9T B;  2OT2 A;  1PTO F;  1ET6 A;  5CV5 A;  2EYJ A;  2OEO A;  3S9W A;  4E6I A;  3GO5 A;  3TSS A;  3VYS A;  3E6Z X;  4ZQ3 A;  4FO2 A;  1B44 D;  3M3Y B;  4X3S A;  2R3Z A;  3G6J B;  4K5X A;  4O42 A;  2L12 A;  4FXD A;  1H9S A;  3VR2 A;  2C9O A;  2Q8I B;  3MFG A;  1HXY D;  4CJ0 B;  4FYD A;  1XYI A;  2MPM A;  5D3I B;  4HAE A;  1GUG A;  4V0B A;  1TWF B;  4C3J B;  3DMU A;  2A74 C;  3NPP A;  4TQU S;  1JOO A;  3MA2 B;  2HUG A;  2ZXR A;  4BY7 B;  1U9R A;  1BQQ T;  1SAP A;  4ZK9 B;  2RQX A;  3A8K E;  2F03 A;  5IGE A;  2RVL A;  4DXG A;  5LL6 X;  1Q90 A;  1BCP D;  1ZEQ X;  3SXH A;  4XYQ A;  3JAM L;  1C48 A;  1TT2 A;  5AFW A;  1CI3 M;  1D5Z C;  4HSV A;  1WTO A;  2AQ1 B;  1UEA B;  2B2V A;  2BDN A;  4IUN A;  1WTX A;  3TME A;  1QNU A;  4MN3 A;  3A55 A;  1QJO A;  5IGB A;  4LAA A;  1F2M A;  5FLX L;  4J1M A;  1O78 A;  5KGU A;  3A7L A;  3S1R B;  1CA6 A;  1D5M C;  4KD4 A;  5C4Z A;  2EYF A;  4C2M B;  3PMF A;  1Y8N B;  2A6H C;  3RLF A;  2AUK A;  2RSN A;  3SR1 A;  1FNV A;  1S5B D;  2NVT B;  1E2V A;  1I4G A;  2KUM A;  4XQJ A;  1SNQ A;  2NYZ D;  2XRQ D;  1NR4 A;  2PCF B;  4JBW A;  1A3T A;  1C8C A;  1MI2 A;  3N52 A;  4ZYS A;  4N9T A;  4A3E B;  1K83 B;  1T5E A;  2CVR A;  4CBV A;  3QOJ A;  4A3I B;  3CKI B;  1RDP D;  3J80 E;  4RKL A;  2WIN B;  4XTC S;  2KCN A;  1XX8 A;  4XT1 B;  1Y8O B;  2B2W C;  5KYI A;  1B9M A;  1F9P A;  3QOL A;  2Y0S B;  4DNR B;  2F0H A;  4LK1 C;  1BUV T;  2O5I C;  3R3O A;  1RJT A;  4FF3 A;  2VXW A;  2C5C A;  4OO1 H;  3M85 A;  1Q8I A;  1KLU D;  1TS2 A;  1SNM A;  1SEB D;  1R4Q B;  1D1K A;  5CBE E;  5CV7 A;  2F0K A;  3VYU A;  5J22 A;  1E2Z A;  3NK9 A;  2K5Q A;  4RKB A;  1ZYR D;  1SYB A;  2B2Y A;  3K5N A;  1SFO B;  5E4X A;  5TSS A;  2EYL A;  3K6O A;  3S1Q B;  1A3V A;  1GXD C;  2NVX B;  2DNC A;  1PDQ A;  3HOU B;  1ONL A;  4L63 B;  2R93 B;  3RZD B;  1VMP A;  2OXP A;  1BCP B;  1DM0 B;  2D62 A;  2EYH A;  4BY1 B;  3PO2 B;  2DY7 A;  5ELD A;  3TZU A;  4KKS A;  4ID6 A;  1WTP A;  3HEJ A;  4OGQ C;  4H44 C;  4H0L C;  2NVY B;  5IGG A;  1JOR A;  4FF4 A;  4H7B A;  4KN7 C;  1D2B A;  1OXV A;  5EGT A;  4EQP A;  5E4W C;  1JQY D;  1PTO D;  1SDF A;  3QJY A;  1I3Q B;  1S5E D;  5J1Z A;  2FJ2 A;  2B2U C;  3SEB A;  1I4X A;  5KEE A;  1LT4 D;  5KNC A;  1TWA B;  2A5H A;  2BA1 A;  4RA8 A;  5CV9 A;  1BCP C;  3PUX A;  3S1N B;  2AWN A;  1G8Z D;  1A15 A;  4CHT B;  1SE4 A;  3I4L A;  1TS3 A;  1II3 A;  1SNO A;  4CKE A;  2RA4 A;  2XIW A;  2WAC A;  5FKA C;  1GOZ A;  5EBC A;  1VCI A;  3OMC A;  1ILP A;  2F0G A;  3DEO A;  2K33 A;  2JEB I;  4UAI A;  2KHS A;  3HZX A;  4KY6 A;  3NP8 A;  2AQ2 B;  4AYB B;  2FFK B;  1LT3 D;  4X3T A;  3K7A B;  4XIG S;  2PZU A;  5J39 A;  1EIH A;  4OO1 G;  2HQE A;  4DXF A;  3C3L A;  1STA A;  1V8Q A;  1KAA A;  2MUY A;  1O80 A;  4RGM A;  3HOZ B;  5A2Q L;  1JE4 A;  1ESR A;  2IL8 A;  1CZW A;  1YNN C;  3DWQ A;  2EY2 A;  3OMG A;  1IYU A;  2F0L A;  1CA5 A;  1WD1 A;  3GV3 A;  3Q6S A;  1JB3 A;  4DF7 A;  1STB A;  2MGS A;  4J6H A;  2WAQ B;  5HUR A;  1H9M A;  4M8A A;  5ELB A;  4KJO A;  2Z8L A;  4HED A;  2PW5 A;  1I50 B;  4IUQ A;  2VUM B;  4ZKC B;  1PZI D;  3CRL C;  1ZYR C;  1EY6 A;  4K5W A;  3U9S A;  3NHH A;  1PTO B;  5C3W A;  1STY A;  3LWE A;  3BVG A;  4S3S A;  4CJ2 C;  1AZQ A;  3HS0 C;  5COR A;  5A35 A;  3TZD A;  1M8A A;  5IOD A;  3T16 A;  1YNJ C;  1ET9 A;  3DEP A;  3J7Y W;  1CHQ D;  3R93 A;  1JIC A;  3SK8 A;  1ZKO A;  4B08 A;  4QF4 A;  3D3R A;  1QIL A;  2A6E D;  4FVM A;  4G7O C;  3MTS A;  5EJW A;  2HDL A;  1LTI D;  1TS5 A;  1Y8P B;  4IN3 A;  3CHB D;  4QMG A;  4XYO A;  2ENB A;  2E76 C;  4EQN A;  3EJI A;  4DN4 M;  2M2L A;  1G6Z A;  4C3I G;  3H09 A;  2JXM B;  4RHR A;  2E2H B;  3VR6 A;  1IKL A;  1H9S B;  1QWY A;  5I4D A;  1WD0 A;  3BDO A;  4K8I A;  2PZT A;  3GTG B;  3FDT A;  2E74 C;  5CGK A;  1K8M A;  3OWE B;  5FOB B;  4TKO B;  1NSN S;  4ZRZ A;  1D6E C;  3P1H A;  4QB4 A;  5FO9 B;  4B9W A;  4C3H B;  2CHB D;  3FVQ A;  1PZJ D;  4WOR A;  4WRD A;  1R4P B;  3PIO 3;  2O5J C;  4FNF A;  5HGT A;  1B2T A;  3SK4 A;  5T1G A;  3TP6 A;  2EE1 A;  4Q5V A;  3P75 A;  3HOV B;  3X3N A;  3KLS A;  3HRZ C;  2XNA C;  1PMR A;  1RD9 D;  1LAB A;  1ICW A;  3I91 A;  2CW0 C;  2IX3 A;  4C56 C;  3DWA A;  4IAL A;  1STH A;  2IW3 A;  3D8G A;  3OPO A;  5BN4 A;  2MJ8 A;  1J9O A;  1DCZ A;  3TP5 A;  3K5O A;  3T13 A;  1JR0 D;  1JOK A;  2F0T A;  1V1P A;  5CV4 A;  4A3B B;  2B2T A;  3HOX B;  4HTH A;  2JA5 B;  2PPB C;  5T1I A;  4ZUI A;  1CT1 D;  3K57 A;  1K8O A;  3BYT B;  2NN6 I;  5E1F A;  1HQM C;  2JA8 B;  2AUJ D;  1BBX C;  1B50 A;  3NXW A;  4CJ1 B;  2EYP A;  1GHK A;  1IHZ A;  2AWO A;  2F1M A;  2NB0 A;  5C5M A;  2K7V A;  2F0D A;  4HSP A;  4V19 0;  4IFD G;  4R8I A;  1SJH D;  4UDU C;  5C44 B;  3H94 A;  1KDB A;  5JAV A;  5IT9 E;  1HPC A;  4WJW A;  1TY0 A;  2TMP A;  3FPP A;  5EKI A;  3OOC A;  1WTW A;  2MHV A;  1S5F D;  1U4P A;  1BNZ A;  5DM6 3;  4EQO A;  5EPL A;  1F9Q A;  3OSO A;  3WOF A;  2IX1 A;  4R8N A;  4J8Q A;  3DXJ C;  4RHS A;  4C1N K;  2A6E C;  1Z7T A;  1DYQ A;  3K5L A;  2AQ3 B;  3M7G A;  2LMC B;  5KNB A;  2LY7 A;  1FYC A;  5IIF A;  4CKC A;  2KEE A;  1Q1B A;  5C4X B;  4LMQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...