3P1HA

Crystal structure of staphylococcal nuclease variant delta+phs v23k/i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTKKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure unfolding effects of artificial cavities in proteins.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p1hA00
1SNDA 3QOJA 4DFAA 5C3XA 2RBMA 5C5LA 5CV8A 1EZ8A 1A3UA 2F0FA 1F2ZA 2LKVA 1SNMA 5F2DA 2F0NA 2PQEA 4K14A 3DMUA 4KD3A 4WORA 3OSOA 4QMGA 1U9RA 3SR1A 4DGZA 1JOQA 3NK9A 1STGA 2F0MA 4IUNA 1SNOA 1STNA 1A3TA 3HEJA 1NUCA 2PYKA 3MHBA 4OL7A 4NDXA 3SK6A 4B9WA 3NXWA 4S3SA 4K5XA 5DEHA 3VA5A 5IGFA 5KYLA 5C4ZA 3TP5A 1SNPA 4G57A 1EY0A 1JORA 1A3VA 4K2KA 2M00A 1EY5A 4EQNA 2OEOA 2EY5A 1II3A 1JOOA 4I65A 4KJNA 4E6IA 4IZ8A 2F0PA 5CGKA 3MZ5A 5JOBA 4KJOA 3H6MA 3U9OA 2SNMA 3BDLA 3P75A 4KD4A 1KDAA 3PMFA 5CV4A 2F3VA 5I6WA 4EQPA 3EJIA 3TMEA 2EYFA 4QB4A 4DF7A 1AEXA 4KY6A 1SYGA 4K8JA 1SYBA 4ZUIA 4PNYA 2KQ3A 4R8NA 5EKLA 5HURA 1SYDA 2EYOA 2PW7A 3MEHA 1EY9A 2F0WA 2F0OA 3ERQA 5IGGA 5IODA 2KHSA 1STAA 3R3OA 5C6AA 2OXPA 3SHLA 5IGDA 2PZTA 4HMIA 1SYCA 4ID6A 5I6YA 1EZ6A 5J1ZA 4K2LA 4LAAA 2F0VA 1SNQA 2F0TA 4KHVA 3C1FA 1TR5A 1SNCA 2F3WA 5E3FA 2EXZA 4QF4A 1ENCA 1EY8A 2WACA 1NSNS 4NP5A 3ITPA 5I9OA 2F0DA 5IGEA 2EYHA 4N9TA 1KDBA 2EYJA 2RKSA 4H7BA 4YIJA 3D4WA 5KYIA 1KAAA 1STYA 5CV7A 5I9PA 2PZWA 4KY7A 1SYFA 1STBA 4KTAA 5IOCA 4RKBA 5JAVA 2O4XA 3D4DA 5J22A 5CV6A 5CR3A 1F2MA 3NHHA 4K6DA 3OWFA 1EYCA 1IHZA 2F0SA 2OF1A 3T13A 2EYPA 3E5SA 3MXPA 2F0EA 5NUCA 3SK5A 3SXHA 2RDFA 3NUCA 1ENAA 5C5MA 5K5PA 4MIUA 2PZUA 3NP8A 2F0GA 2SOBA 3BDCA 1A2TA 2EY6A 1F2YA 2EY2A 2F0UA 4DU9A 4J1MA 4K5WA 3V2TA 5KIXA 5C4HA 5CV9A 3SK4A 5C3WA 1A2UA 3DHQA 3TP8A 4B9XA 3NQTA 4F7XA 2SNSA 1RKNA 4EQOA 4IALA 2EYLA 1KDCA 4F8MA 2NUCA 1EY4A 4TRDA 2F0JA 4KV6A 2ENBA 2EY1A 5IGCA 2HQEA 5J39A 5EGTA 2F0HA 3RUZA 5HGTA 5IIFA 3OMGA 3QOLA 1STHA 4NMZA 3QB3A 1TT2A 3EVQA 3OMCA 4J6HA 4ODGA 3TP7A 2F0KA 4PMCA 4EVOA 2QDBA 3T16A 3C1EA 4WRDA 5CC4A 4HMJA 5KEEA 5CV5A 2PW5A 2F0QA 4PMBA 1SYEA 2EYMA 1EYAA 2F0LA 3P1HA 4HTHA 4ZQ3A 4K8IA 3MVVA 5KRUA 1JOKA 5EKKA 3D6CA 4N9PA 3TP6A 5M9OA 3S9WA 1EYDA 3LX0A 1EQVA 5DAUA 5IGBA 4ME5A 5KGUA 1KABA 4KY5A 1TQOA 1EY6A 3HZXA 4RKLA 3SK8A 5ISRA 4ZUJA 3D8GA 1EY7A 4NKLA 3EROA 5E1FA 2F0IA 4K5VA
chains in the Genus database with same CATH superfamily
2I46A 3PV0A 1IW7D 3RZOB 4BBSH 2UXBQ 1X55A 1SNMA 1SAPA 3CXCA 1A3TA 2PYKA 4Y7NB 3DM3A 2KEDA 1WD1A 1D8LA 1B4OA 4BBRB 1TWFB 3HKZG 5KNBA 3HKSA 1AE2A 3ER0A 1B1ZA 1ENFA 5JJLA 4I65A 4IZ8A 1GXDC 3OIQA 1E1OA 3TEHB 1JE5A 4A3FG 1TWHH 2BH8A 1LTSD 4KHPL 2F3VA 1EQQA 4EQPA 4RH6A 1SYGA 2EJGC 2AQ3B 3BJUA 3MEHA 3KLRA 1TWAH 1NR2A 1JB7A 4JYAL 3E6ZX 1SSOA 4JI5L 1KLUD 3J81i 1HXYD 1QUQB 1M4VA 4QIWE 4JI6Q 3HOXB 1PTOH 2F0TA 3IFDA 2PCFB 2VUMB 1SNCA 4G7OC 1N9WA 3KUPA 3CF5A 4JBMA 3B6YA 5CV7A 5C3EB 4DUZL 1MIUA 2E75C 5CR3A 2VQFL 2NZHA 1NMGA 1STEA 1R4PB 1PH7A 1O78A 3I90A 4IUQA 3QO2A 4DV3L 4B3TQ 5C3WA 4BA2I 4C1NK 1H9SA 1EWCA 4IUTA 3AQQA 1HH2P 5KNCA 2VB2X 4OONA 3GTLH 5ELFA 1G6PA 2GVBA 4A3BH 1PRTB 3OYYA 2B63G 1AZPA 2AWOA 1TWFH 2OTLA 3J80E 1CKNA 2QGQA 4LFBL 4J15A 4PMCA 1A62A 4WRDA 1G2SA 2JA7B 3KF6B 1E2ZA 1AP0A 1V1PB 3BVGA 3N52A 4ZRZA 4JI1Q 1MJCA 1JWUD 1A63A 5ELCA 3TREA 1C8CA 4QUFA 4LF8L 4V0BA 3GTKH 2WAQG 1EWIA 3BG3A 5D3DA 5C3XA 1IKMA 4C2MB 1M1KC 2OWOA 1B50A 4X3KA 4DR6L 3NK9A 2VUMH 1B9NA 1D5ZC 2JSOA 5I2XA 3BZKA 3PIO3 3MXGA 5IWAL 2BA0A 2UUAQ 1VQPA 1KXLA 4J8QA 1I5FA 4IFDG 3C3LA 4KD4A 3CRLC 1DM0B 1YNJC 3HOUG 2XVSA 4YWKA 1QVCA 4PZ6A 1TS4A 4QB4A 5D14A 3UDXA 3S2DB 4PNYA 3WDNA 1PHJA 3K5LA 1F9PA 2PQAB 1CKNB 4JW0A 4UY8C 4XYOA 5C6AA 5H1SE 2VUMG 4KKSA 1CSPA 4ID6A 5I6YA 4H44C 2ZTEA 4BS9A 1HQRD 2EQSA 1SJED 1Z9FA 1I6HB 4DV6L 2NVQH 5GAEC 2B2WC 1CKMA 1TR5A 5C3EG 1PTOD 2X6LA 1FNUA 1LTAD 4CKEA 1ENCA 4JI3L 4JI8Q 4BBRH 2BE5D 1E7ZA 1DOLA 2EXDA 4AH6A 2ALYB 2Q2TA 2V1CC 2WAQE 2K33A 3T13A 1PH1A 2EYPA 3VR3A 3SXHA 2R93H 3A7AB 1S5FD 3I4NH 3NP8A 2FHTA 2WP8J 2EY2A 3A5ZB 1ICWA 4A3CH 4O42A 1A2UA 2ZXRA 3O13A 1A8VA 2R92G 2E2JH 4JI6L 2DY7A 4IURA 5LMNL 2G9HD 1JMCA 1SMXA 1ZYRC 1K8AC 3G6EA 5EGTA 1STHA 2N8NA 3M3YH 1CT1D 5FJ8H 1JC7A 1B8AA 5HY6A 5E7NA 5BN5A 5BR8L 2O2LD 4LF9L 3CCJA 4A3DH 2XSCA 1BR9A 3X3NA 3S16B 2CFMA 4ZQ3A 3I72A 2CKZB 4DAYA 1TWCH 1EQVA 3A8IE 1TQOA 2R3ZA 4I7ZC 4N8X1 1X9NA 2KHIA 4UHVA 4WORA 3HOZG 4ZLTF 1WTXA 1C0AA 1U9RA 4IUNA 1STNA 4OL7A 4ZKCB 5IGFA 3LWEA 1IBLQ 3T51B 3EFXD 3G6JB 1YJWA 2CWAA 1Y1VH 3MFGA 1I4HA 3TDQA 4DV5L 4A3FH 3I8ZA 3M9BA 3U58A 3CRKC 1PFBA 3BDLA 1Q1BA 3W1BA 2NTSA 2L12A 3TMEA 2I5HA 5ELNA 3S14B 1D2BA 4ZUIA 1HA6A 4A3FB 2F0WA 4DR4L 4H0LC 4DV3Q 4O1NA 3SHLA 1LACA 3LGJA 2Q8RE 1UWVA 2K32A 5IP7G 1Q46A 1YNND 1B7YB 1DXMA 2WB1E 3R2TA 5IWAQ 2UUAL 3PUZA 2VXWA 1EY8A 1NSNS 4YIJA 4A3EB 4C3HH 1LTRD 3S17B 4KY7A 4LK1C 1GUNA 4C3HG 2CW0C 1N34L 1JE4A 2A68C 3E5SA 4EQ5A 2B2WA 4KLKA 4HIOA 3M7NA 3TRZA 4XQNA 3L2PA 4PMWA 2EY6A 1K9MC 2C9OA 4GLXA 4EQOA 3GTJB 2EYLA 2MFIA 1HPCA 4HJ5A 3BYYB 3S1NB 1L1OC 2J4XA 4YWLA 2E5LL 1JQYD 1Q7YC 4JI8L 1Y1WH 1F2LA 5ELDA 4DR6Q 2XWJB 4JI4Q 1CHPD 4MTKA 1OTCA 3EVQA 2AQ2B 3GTMB 4LNQA 2LMCB 1VDZA 2KVMA 3C46A 3HOYG 2CWPA 5IP9G 1G6ZA 1DOKA 1HR0Q 1FJGQ 3I91A 1I3QB 3FMCA 4AYBG 4RKLA 1PLFA 3GV3A 1VQDA 4LF7Q 4K0KL 4GLAC 1LT4D 3AU7A 1HFGA 3NPPA 1S5BD 3S2HH 5CC4A 1K83B 3LNNA 1SFOB 2N3SA 2HDMA 1KAWA 1OXSC 1STGA 2F0MA 3PIOA 2F52A 4LFCL 4XQJA 1WOCA 4BY1B 1VQEA 1XTCD 5FJ8G 1HR0L 2KCTA 2MPMA 1QWYA 2RHSB 2Z0SA 3F2DA 4A3DG 2OEOA 3Q6SA 1NY4A 2EY5A 1I6VC 3HKZB 1WTVA 5C4XG 3DLLA 4K6LA 2Z6KC 2D5DA 3J7AF 2VNUD 3K5MA 3E0JA 5M3FH 3PMFA 5FLXc 3ONAB 4WFN3 3QR8A 1PVOA 1B3QA 4KKTA 3VYSA 2VQFQ 1WCMB 3D3RA 1PH9A 2R7DA 1TU2B 3WOFA 4MNOA 5IGDA 2EJFC 1R9TH 3HOWG 1XMQQ 1TY0A 2JA8B 2F0VA 3BZDB 3OWEB 1PFMA 5C3EH 2A74C 2Q2IA 2RKSA 4KHZA 5IYCG 3W5OA 4HSVA 1AZQA 3FHWA 3K58A 2MQHA 3ND9A 1Q8IA 1PRTC 2JA5H 1Q82C 1EWHA 1U4MA 1WJJA 2RDFA 4HCEA 4R4CA 1DCZA 1IBLL 4L6TB 4C3JH 4MIUA 5E4XA 5ELEA 4B3TL 4B3RQ 4C56C 2NB0A 1K0RA 2NZ1D 2OQ0A 5LL6X 3FRPB 5AJ3Q 3J7ZC 5C0XJ 4GZYC 2BDNA 5I2YA 5JJZA 4AQYQ 4F8MA 4DR3L 4DK0A 3SEBA 4KV6A 1YJNA 3AYHB 5IIFA 3OTOQ 1H9KA 2NZOA 4NMZA 2DGYA 2LY7A 4LF6Q 1KQSA 2F03A 4DA2A 2D0OA 4ILWA 3RN5A 2WV6D 1X56A 3TS2A 3BU2A 3CHBD 1FNWA 2F0LA 3E3XA 5LHY1 4P72A 1JT8A 3EA6A 3TP6A 4GS3A 4ME5A 2JE6I 2SEBD 5CBAE 3D8GA 3EROA 3NXWA 3URYA 4R4TA 3ERSX 1F2ZA 1NJIC 5CORA 2E2HH 3S1QH 5JEAJ 4JG2A 2EIFA 1PV4A 1WTOA 3HEJA 3HOWH 1E3PA 3MHBA 4P73A 4PZ7A 3BZCA 3TS0A 3PSIA 4RHSA 4X3UA 4L8JA 1H9SB 2IX1A 1VQ4A 1YEZA 4JOIA 3I70A 1N8RC 1PTOB 3NBIA 3CCQA 2EVBA 1JB3A 3MZ5A 2RA4A 3K6OA 3DEOA 2XGTA 2A1AA 3VR5A 2D62A 1ZXTA 2B2TA 4NB3A 2EYFA 2B2UA 4KY6A 4BXXG 1MSGA 4LF5Q 3CMAA 1VQAA 1OXTA 1SJHD 2X69A 4IQZA 1VQ9A 1O7IA 3P7JA 1SFOH 1S5DD 2AKWB 4K2LA 2R7FA 2ICEC 3VR6A 1JR0D 5KGUA 4HCSA 2EYHA 1KDBA 2OT2A 3EIVA 3UDFA 4GNXC 3MA2B 1U4PA 1F2MA 1O7YA 1EYCA 1B53A 2OF1A 2CH4W 3KF8A 3QIAA 3PO2H 4JI7Q 1VQ8A 1T9HA 1SLJA 2NN6I 5C44H 3KF8B 4HEDA 3RLOA 3RD4A 2VZAA 2L55A 3V2TA 4JBKA 1NR4A 1GOZA 4HSPA 2VB3X 3H3VC 5AFWA 2YU9H 1AE3A 1KDCA 3A7LA 1IBMQ 1T5EA 4TRDA 2FJ2A 4BY7H 1IYVA 1HNZL 2FXQA 4CJ2C 5KNDA 5M5XB 3IFTA 2UUCL 2F0HA 4A3JH 4A75A 1Y69U 3OMCA 2YV5A 1QE6A 3VR4A 1W2BA 1MGSA 2D9UA 4A3CG 1XNRL 2B39A 5M5XH 1R4QB 4X6AH 3PO3B 2R7ZB 2EYMA 3I4NG 3Q0AA 2Q2UA 1JOKA 4DUYL 4DV4Q 1N33L 1IL2A 4FXDA 2K03A 1PA6A 5IT9c 4XT3B 3I56A 1CI3M 3UI2A 3K7AB 4ZCKA 4A3GG 4JK1C 3BS1A 5JEAH 2RBMA 1F9SA 4FNFA 3GTOB 2RVLA 2ZM6Q 1I94L 1LT5D 2L11A 3GDEA 5FLXL 1V1PA 1VQKA 1XXGA 4NDXA 3CC2A 5DEHA 3VA5A 5KYLA 5FO9B 3MAQA 1HHVA 4Q0FA 4DKAC 4XIGS 3K0YA 4DR3Q 2BA1A 1CUKA 1FNVA 3NBHA 4B3ML 4KJNA 2NVTB 4KJOA 3H6MA 4YWMA 3CC7A 2SDFA 1I94Q 1E0BA 5IYDH 1V43A 1GM5A 5C0XG 2RCNA 4YHHL 1RIPA 2F0OA 4OEMB 2E2DC 2H1EA 4X66Q 4UPAA 5T1GA 2NBFA 4HMIA 1SYCA 1HUMA 2N55A 2PO4A 1EIHA 1HA5A 2JA7G 1PH3A 3C1FA 3AFPA 3DWAA 4FDBA 4A3JG 2WACA 3S17H 1SEBD 4DXGA 2EYJA 2UXDL 2I5MX 3D4WA 1RDPD 1F9QA 3NHHA 5A2QL 3HOYB 5GAGC 1KL9A 2A6ED 4KMUC 5IYBH 1CA5A 1VQLA 5NUCA 1H95A 1D1KA 4A3DB 2K5WA 3TZDA 1HJPA 3JC66 4LF4Q 1CHQD 5C4XB 2VW9A 4NPSA 2NVQB 3S1NH 2NUCA 3FKIG 2A5HA 3ULLA 2O5IC 4A3BG 2EY1A 3HOVB 1I4RA 3J7YW 3VDYA 4JOIC 2UUBL 4JI4L 1Z7TA 5C4JB 2NVXH 4OGQC 4LF7L 4LUOA 2UU9L 2L4NA 1TS5A 1BOSA 3HOWB 2RCFA 4OWWB 4JBWA 3QG1A 1HQMC 3ULPA 5C4JH 2B2UC 2OCEA 4HN7A 1VF7A 1LTBD 4N9PA 3RLNA 1Y1VB 3J7A5 3S1RB 5DAUA 2DJFC 2PNRC 3K8AA 1WTQA 4CKBA 2CVRA 4IO9A 4FXGC 3UDIA 3J80i 1OO9B 3U4VA 3P20A 4R4IA 4TSSA 4LF5L 5CBEE 2A6HD 2UU9Q 2F0NA 3ULJA 1HNWQ 3DMUA 3SVMA 4KHPQ 4XT1B 4X64Q 3VA7A 3NWTA 1QILA 1X32A 5DNFA 1JORA 4K2KA 2M00A 2PI2A 1X6OA 4A3GB 4IOAA 4X3TA 1EQRA 1CTMA 4GN5A 2QF7A 2HIXA 3PO3H 3W1GA 4HIDA 2SNMA 4A3LG 3FKIB 2L9HA 5IE8A 4DF7A 2JXMB 1ZKOA 4LFCQ 1SYBA 5EKLA 3FPUB 1S3OA 2KEEA 1D5XC 2EYOA 2PW7A 4UP8A 1GVPA 4CKCA 1WFQA 2KHSA 5C44B 5EKIA 3HOVH 3RZDH 4B3RL 3CCRA 1BBUA 1Q3LA 3ND8A 3ICEA 1RD9D 2DY8A 1Y14B 3KYHC 1BO0A 3A5UA 3PO3G 1TXYA 5E3FA 3J81j 5IGEA 2PI2E 2F0DA 5KYIA 1YJ9A 2CH4A 3Q24A 1JCKB 1O7ZA 2LXJA 4GOPA 4IFDJ 4KTAA 3OOCA 3J80c 1YIJA 4LWCA 4JV5Q 1DD2A 5D3IB 4A93G 1K8OA 4BWGB 4OELB 1MKHA 3GQBA 3I3CA 4YHHQ 1LTGD 4RGTA 4C3IB 4DU9A 4A76A 4DUYQ 4LFAQ 4WJWA 3SK4A 4AQYL 4A3JB 3DHQA 4B9XA 2CHBD 1Y8PB 4CBVA 4F87A 1PH4A 5JJIA 1GJXA 3KFUA 4YCVA 2VQEL 2B63H 4MZ9A 2TSSA 4C3IH 1KD1C 1ONLA 2A6HC 1YNJD 4GN4B 4P71A 4IFDI 2VS1A 3M3YB 4G7ZC 2UXDQ 1KTKA 5DM73 4O0AA 1TT2A 2C5CA 4DR1Q 3KOJA 2ATWA 1Q8KA 5ELOA 3C1EA 2G5DA 2WIIB 3K7AH 1K3BC 1MHWC 3S16H 3I2ZA 4LF8Q 1L0YB 4DV5Q 2Q8IB 4OWXB 3GTJH 5FLMH 2RSNA 4POGA 4A3IB 2LS01 1EY6A 1AFPA 1S40A 1HNXQ 1AW7A 1SNDA 4DR5L 1W3SA 5C4XH 2IX0A 5M3FB 5C5LA 1QZHA 1W6KA 2LKVA 1PH6A 3SDZA 1JICA 3W2DA 2K5QA 3PUYA 4RCOA 3R93A 2E74C 2E8GA 4O2DA 1EY0A 1TWGH 3G71A 2K14A 4X65L 2E2IH 4ULLA 3I4LA 3GD7A 1SBBB 3QJYA 1LABA 5JOBA 5IT9E 3V05A 4OIJA 2BOSA 5BN4A 3H0GH 1T5XD 2DUDA 1K83H 1QNUA 1ET9A 2VY3A 5LMUQ 1VQBA 5EAYA 1QVFA 2F4VQ 1K28A 3VR2A 1S72A 4JI7L 5C0XH 1GO3E 1PMRA 4A3KB 1V8QA 3GTLB 1JJGA 3BVMA 3F8TA 5A2QE 3EQLC 4QF4A 4BBSG 3ITPA 2B29A 1LV9A 5IOCA 1IKLA 1PH5A 2A19A 1E24A 3RMHA 4CDEC 3OWFA 4DK3C 1QJOA 2ASBA 2XWBB 5DLQE 3F2UA 1CZGA 1ENAA 3HKZE 4DK1A 2KCCA 3D6WA 5BR8Q 1QNKA 1YITA 2F0UA 1H9MA 3CCMA 4U68A 5CV9A 1P8LA 4ZKBB 5D65A 3NE5B 1GUOA 3CPWA 1BBWA 2EPBA 3RN2A 2XNAC 4JC0A 4FF1A 4JI0Q 1PXUA 2MP1A 3OMGA 2IJ0A 1OXUA 2N78A 1CFMA 2E2JB 5FOBB 4R1JA 1TWGB 1AN8A 1F9RA 2A73B 3S15B 3GTMH 5L37A 1GUGA 2A6EC 4X62Q 1A0IA 2IX3A 2N88A 3H0GB 3NWSA 5AJ3L 2AHOB 1KNAA 1QB5D 4Y7NH 3NTHA 4UAIA 5E1FA 4K5VA 3QOJA 1GHKA 3S2HB 1DZ1A 2QDLA 5C0XI 1XNQQ 2L5TA 4UP7A 4DGZA 3T1YL 2IWHA 1NUCA 1SE3A 1YNNC 1DJRD 3DWQA 5K36G 3H94A 4KKUA 3TP5A 1SNPA 3FKIH 4QUCA 2IW3A 4NW2A 5CMDA 4IPGA 1FD7D 1TWCB 1EQTA 2I07B 4EQNA 5K36H 3FVQA 4E6IA 2L15A 2BDOA 4OIKA 2NYZD 4X3SA 1KRTA 3PQIA 4QY7A 1GHJA 4DV0L 1AEXA 4CDCC 4CDFC 1N32L 4R8IA 3E9HA 5J1ZA 3U9SA 1SNQA 4A3MB 2KUMA 2Y0SE 1XYIA 4N9TA 1BCPD 1U0LA 2MO1A 3OTOL 3CQZH 1KAAA 3K7UC 4HR7B 4R4OA 3GTQB 2YTVA 1SYFA 4RKBA 4DR1L 1E22A 2WB1B 1N32Q 4A3EG 4Y52H 2F0SA 1PFNA 5COYA 4A3KG 5IYDG 4A3LH 1C9OA 5K5PA 1A2TA 2OQKA 1KNEA 3TP8A 4IALA 2B8FA 4A3EH 5J39A 5IT9L 1SE8A 2UXCL 1TS3A 4J6HA 3UE0A 3T16A 4KI0A 2M2LA 3JAME 1IZ6A 2FINB 1EFID 4X64L 2RQXA 3I4MH 1EOVA 3K57A 4BA1I 1G291 3TZUA 1X3QA 4LJZC 1UEAB 2XN9C 1N36L 2HCCA 3M4YA 3F2CA 4GLVB 3E0EA 2UUCQ 3W3AA 1JJ2A 3HOXH 5CYUA 3EBEA 1SE2A 3SK6A 3K5OA 1IBKQ 3VYUA 4K5XA 1PH2A 2D2CC 3G7LA 1QOHA 4EX5A 3H09A 2JA5G 5C4ZA 3RR5A 1XNRQ 4OO1I 4TVAB 1E2VA 4X62L 1VS0A 5IYCH 3L3OC 4L5RC 2K75A 1WTHA 3CCUA 1FL0A 3Q8DA 5CGKA 3KDFA 4TQUS 3HP3A 1IXRA 1HNWL 2FMMA 2MHVA 5IYBG 4XDXA 5I6WA 3J81L 2I0QA 3PO2G 2NWGA 1L1OB 2XRSD 1FGBD 2AWNA 4JV5L 5HURA 1SYDA 1UE6A 3ERQA 1KC8C 4DAPA 4DK6C 4A4IA 1BCPB 4IUUA 1FGUA 4M8AA 3PIP3 1WCMG 1LTLA 4ALPA 4JI1L 4HJ7A 2CCZA 1WCMH 4U673 1OXXK 2Q2HA 1BUVT 3I73A 5FLMG 3CMEA 4DUZQ 2RHQB 2R93G 1V1OA 4RGOS 2L0CA 1I4XA 1IHZA 2QW7A 3MXPA 1A6XA 2F0EA 2DJGC 1HFNA 1NMFA 3BDOA 3KLSA 2A69D 2Z4HA 4LFAL 3M4OH 4IPCA 1PZKD 4APVA 3GTPH 2IHFA 1K8MA 1D6EC 3M4QA 4L5SA 4DR2L 1XPRA 4C3IG 3TQYA 1JJCB 2EE1A 1U5KA 1UE1A 2Z1CA 1EY4A 2K6AA 1RODA 1I4PA 2F0JA 3JAML 4KN7C 3GTPB 2HQEA 1YI2A 2RDHA 1NE3A 3KDFB 3KK7A 1VQ5A 4DR5Q 1KLGD 2K50A 3PF4A 3HOYH 1YBYA 1Z6HA 3A56A 3F1ZA 5KEEA 5JPMC 1BXTA 3KBXA 1KHIA 4HTHA 4BBSB 4K8IA 2QCPX 3MXUA 3STBC 3HOVG 1VQIA 2K5VA 4OWTB 4LW1A 2E76C 3SK8A 1HZBA 1PTOC 1FR3A 4OX9L 1EFWA 3H0GG 1LTID 1X3FA 5M5WB 1TWHB 1N34Q 2CW0D 1A3UA 2NVXB 1BNZA 1X3GA 3HG9A 1PZJD 3MC0B 4IN3A 4QMGA 4CDDC 5HGQA 2RDGA 3UDGA 1OXVA 3CCSA 3FDTA 3CAMA 2R6GA 2ICIA 3S1QB 3S1MB 4RFBA 2AMCB 3T4AC 1WTWA 1ILPA 2EOTA 3WWVA 3ZYYX 5LMNQ 1IBML 4TKOB 1N36Q 1KDAA 2K5NA 1M8AA 2JN4A 1VQMA 1ASYA 5M3MB 4M1UB 4NXNL 1YHBA 2OXPA 2XTIA 1CZWA 3U50C 3J81E 1J9OA 1EZ6A 1HTPA 3HFZB 3S14H 2IY5B 4KHVA 5J3BA 2B63B 3N6RA 4NP5A 3F2BA 4K0KQ 4IJHA 4RGNA 1Y1VG 4NXMQ 5I9PA 4ABNA 2HDLA 1UUPA 3K59A 3D4DA 2RSOA 1ZEQX 3PGZA 1L0WA 4IUVA 3KJOA 1KIXA 3NUCA 3H3VH 4DV7L 3ZJYC 2PZUA 2F0GA 3STBD 1HR0W 2PQAA 1F2YA 4OXPA 2HD3A 4F7XA 2H5XA 2KOLA 2SNSA 4PV1C 1VMCA 2WAQB 4C1NI 3GO5A 4JBJA 1L2FA 4HJ9A 1XWEA 2AUKA 2LFNA 4MN3A 1V1QA 1AH9A 2ENBA 3GTKB 4DNIA 4KN4C 3CC4A 5HGTA 3Q23A 4RHRA 2R61A 3K5NA 4DAMA 4DN4M 1EIGA 3H3VI 1G91A 3S24A 4ME3A 2IL8A 2QDBA 2ZM6L 4UP9A 3PIPA 3GTGH 4HMJA 1PRTD 1M90C 1VQHA 4DNRB 4DAYB 5EBCA 4X66L 1D1IA 4FYDA 3CCEA 3MTSA 1XX8A 5KRUA 5IGBA 1PYBA 1DONA 1IL8A 3S1RH 1VQFA 4B3MQ 2WB1G 5M3MH 3NBHB 1F77A 2R7ZH 5CV8A 2K52A 4RMFA 1BDOA 4N8FA 3L7ZC 4K14A 3NQIA 1JOQA 3SR1A 1Y8OB 3DEPA 1VQNA 4GKKQ 4S3SA 1TS2A 1NBWA 2WINB 1WTPA 2HHHQ 4DXFA 4I7AA 1VQGA 3KBGA 1DOMA 1VQ7A 3U9OA 1V9PA 2JP1A 2P5ZX 3EJIA 1HZ9A 2JA8H 5FKAC 3H15A 1TWAB 4FP5D 2GA4B 2KCMA 3PUVA 1HCZA 4GOPC 4FF4A 2R92B 5LMUL 1XPUA 2O5JC 4JI2Q 2Z9HA 1HRJA 2JJQA 2CQAA 2K5DA 1NAPA 5EBDA 2B8GA 2NVYH 4OX9Q 5I9OA 3OPOA 1BKBA 1RF2D 1YZ6A 4A3IG 5M3MG 3VYTA 5JAVA 4A3MG 3D0FA 4B3SL 3GTQH 1MD2D 2XIWA 4JPBW 5FK9C 4KK7A 4LUZA 1VQ6A 2V4DA 1YVCA 2ZJPA 1CM9A 5M3FG 2IT1A 1XPOA 1PTOF 1J5EL 4DV1Q 1U4RA 2YYZA 2JEAI 4DR7Q 1GKHA 4YY3Q 2JA6B 2KHJA 1IW7C 2EZVA 1SMYC 1GUTA 2FFKB 1C4QA 1HZCA 1Q90A 1W6JA 4JI3Q 5GROA 2UUBQ 2ZTCA 1TIID 1HNZQ 4HAEA 3NTKA 4A3BB 5GADC 4QQBX 1PRTF 2PNHA 5IY0A 3FPPA 1MJEA 4JCVE 3HOXG 2PW5A 2RF4A 2QKIC 4FXKC 2NN6G 2JA7H 2L1BA 4JYAQ 3JAMc 1S5ED 2M9VA 3MVVA 2A69C 1EYDA 4KY5A 2GVAA 5I4DA 4A3IH 5M5YB 1Q12A 4WJ3M 3MXNB 2B2YC 2UXCQ 2LXKA 2MNAA 2WKCA 1R9TB 3K80C 2YU9B 1O80A 4QIWB 4KD3A 1TKWB 3HS0C 3NENA 3HOUB 2HUGA 4B9WA 4YCWA 1XMOQ 1C7YA 2VL6A 4BXXH 1B3AA 3OW7A 2Q8TA 1GUWA 4V190 2BCOA 1A3VA 1EUJA 2MJ8A 3A8KE 3E9IA 2QEXA 1VCIA 1JOOA 1O7LA 5GQOA 2ID0A 3X3MA 1LO5D 5EJWA 1GUSA 4C3JB 3M85A 1UAPA 2YTYA 4PG3A 5JEAG 3MEFA 4A3GH 3NEMA 4R8NA 2ZJRA 2NTTA 3AB9A 1PDQA 1BBXC 4LFBQ 4A3KH 1BQQT 2K4KA 3HOZB 2CQOA 1SMYD 2KJXA 3CP0A 3LWUA 5FO8B 1EOTA 3IKJA 2IHEA 2ZXOA 1JWMD 1ILQA 3G4SA 3A8JE 1UEBA 4P2CB 4JI0L 4XYQA 3C2PA 2PZWA 2ZJQA 1DYQA 2O4XA 1H9RA 3MXNA 5JJKA 3R8BA 1ASZA 3FP9A 3T56B 3SK5A 2Z8LA 4BY7B 4XQQA 3CCLA 3H91A 4A93B 1TVXA 3RZDB 4IPDA 1XJVA 5C44G 1SR3A 3SGIA 1S5CD 3OHXC 4QCLA 4RWSC 4X65Q 1VQJA 1QCBD 1RL2A 4F88A 2G9DA 1UE5A 4LF6L 3U4ZA 2ZTDA 1EEID 3QOLA 3HRZC 4L5QA 3OIPA 4GKKL 1I3QH 4C3JG 1BCPC 1G51A 4EVOA 1PYWD 3MFYA 1DGSA 1RHPA 4HIMA 4H13C 4JI2L 1J5EQ 2F4VL 4DV1L 1EYAA 1E2WA 4DR7L 3DUZA 4UDUC 3IRBA 3K81C 5ISRA 3HGBA 4XXEA 5M5WH 3GV6A 1BVSA 3GP7A 2BH2A 1RCVD 2K1BA 2JA6H 2DNCA 4BY1G 1FYCA 1BF4A 3S2DH 2PQEA 4HIKA 1SRUA 2JYOA 1L1OA 1NTGA 2A68D 2N49A 3CD6A 1X65A 1B9MA 4LF9Q 2Z6KA 4G57A 1WYDA 5G3LD 1LT6D 5LMNW 2E5LQ 2NVYB 1I4GA 1K73C 2F0PA 2JA6G 1XTDA 1E1TA 1YNXA 5A35A 4AIMA 2K5HA 3AFQA 2JA5B 5IGGA 4R4QA 1EY9A 1Y8NB 1B44D 1B70B 1STAA 2JA8G 1PH8A 2Z4IA 3V96A 1XMOL 5EQ0A 4GKJQ 4JI5Q 4JVZA 2KA7A 1RJTA 3QWNA 4OO1G 3CCVA 4PQXA 1TY2A 4G7HC 1N33Q 3CQZB 1QVGA 4QGUA 2ZT9C 2PMZE 1STBA 3CU7A 5J22A 1A15A 4DAVA 4Z9CB 2A8VA 5CV6A 4NXNQ 3A0JA 1I50B 2KBNA 4CJ1B 2HT1A 1G2TA 3I4MG 5C5MA 2JQOA 4OHJA 2AQ1B 2Y0SB 2KENA 2SOBA 3BVZA 3WOEA 1Q86C 1K0SA 3A55A 3NELA 4K5WA 4IPHA 3T53B 5C4HA 2K7VA 3L9AX 2PPBC 2B2VA 1C48A 1EEFD 3I4OA 1LT3D 3FEWX 2F3IA 5JPNC 1SE4A 1EL0A 1ET6A 2B3GA 4RG1A 3QB3A 4EGVA 2K28A 4FVMA 4ZYSA 2F0KA 1EIYB 3GTGB 1LTTD 1MBYA 3KLSX 1LM0A 2B2YA 3KLWA 3BYTB 2F0QA 1SDFA 1EYGA 4PMBA 1Z47A 1SYEA 2IPKD 3G48A 4FO2A 2PMZB 4ZAIA 2K01A 5EKKA 3D6CA 2E2HB 4DPGA 3S1MH 3JAMi 3CW2C 2HHHL 4DR2Q 1WI5A 3MWYW 1KABA 3HZXA 1EU4A 4L5TA 1I4QA 1EY7A 2GN5A 1XNQL 2WKDA 4DFAA 4H02A 1EZ8A 4ZK9B 2F0FA 3T1YQ 2B2VC 4RAUC 4AYBE 1ZYRD 4P75A 2QA4A 4BY1H 2ZXPA 4C2MH 5DM63 1MSHA 4FF2A 5G3LF 1IYJB 2F1MA 4GN3B 4BY7G 4Q5VA 2DN8A 1HUNA 1FJGL 2HQLA 2JA9A 1II3A 3TBIB 1J6QA 1QUQA 1I50H 4R9WA 1G8ZD 2F4IA 1LUZA 3I7FA 4IJLA 4QJFA 3OW2A 3HOZH 4YCUA 1NCVA 1PYSB 3M7GA 1CQFA 1CSQA 4LMQD 2KECA 3KF6A 5JVG3 4K8JA 2UXBL 5EPLA 1ESFA 2HCIA 5IODA 1BCPF 1EIFA 1HZAA 2J7ZA 2NN6H 4PZ8A 1RTOA 4A93H 3R3OA 3CKIB 2PZTA 1I6HH 4AYBB 5FO7B 2QILA 4LUVA 4LAAA 4DV2Q 2D0PA 1CQVA 2F3WA 5TSSA 4DV6Q 2EXZA 1HNXL 3Q22A 1CK1A 1WTRA 3S15H 3DXJC 1Q1EA 1YHQA 1Y1WG 1U4LA 2Y0SG 2MO0A 1RTNA 3K0XA 3PF5A 3EN2A 4RCNA 5FLXE 2WFWA 4LF4L 4CJ0B 4GNXB 4POFA 4P74A 3PUXA 2TMPA 4DV2L 3TSSA 1RKNA 3D31A 4XTCS 1UE7A 1XMQL 1YHAA 4G4KA 4B08A 4A3MH 1K8GA 5IGCA 2XRQD 3AEVA 2JK8A 2EDGA 4QL5A 2LSSA 3DWPA 3TP7A 4DNTB 3I55A 5GAHC 1X3EA 5CV5A 2HIVA 4GKJL 3IAYA 1P16A 5IP7H 4DV7Q 3J7AV 3GTOH 1CKOA 5M9OA 3L0OA 2OTJA 3LX0A 4BBRG 4DV4L 2NVTH 3A74A 1Q81C 4NXML 1D5MC 4ZUJA 4CHTB 5E4WC 2F0IA 3PCOB 5M5YH 1J8IA 1ESRA 2EJMA 1ICFB 1PFSA 3SE0A 5F2DA 3HOUH 1MI2A 3OSOA 1QZGA 1IBKL 1SNOA 3J81c 4IOCA 1ML0D 2Z6BA 1NNXA 1VF5C 3NSWA 2BE5C 3UE1A 3I4MB 1EY5A 4IUPA 4IFDH 4WJ4A 2B2TC 1EU3A 3RLFA 3DM1A 3J80L 2R7ZG 1X54A 1FVIA 3D4RA 4OO1H 2AUJD 3RNUA 1PZID 3P75A 1X3PA 1L0XB 5CV4A 4HJAA 5LL6S 2KQ3A 2K05A 4DV0Q 1K3RA 2MGSA 4FF3A 1GD7A 2FMCA 3RZOH 1JWSD 1H9JA 3PUWA 4DR4Q 3VYRA 1SXTA 1UNSA 1D7QA 5EPJA 5EPKA 1QG7A 1WVLA 4HJ8A 4GOPB 4C3HB 1SN8A 1HTLD 3S9WA 1VMPA 4H7BA 2X6GA 4MHEA 1STYA 5T1IA 5JVH3 2K04A 4CGYB 2QEJC 4K6DA 2J0TD 1S4ZA 1KRSA 5IP9H 2H4OA 3PO2B 4RA8A 2R92H 3BDCA 5KIXA 2I5LX 4J1MA 1IYUA 5ELBA 3NQTA 3AMUA 3NTIA 4YY3L 2VQEQ 2ES2A 4L63B 3T1HL 1B2TA 3I4NB 3KJPA 5BN3A 1Y1WB 3A54A 3CPFA 3RUZA 1VQOA 1CA6A 1VQCA 2C35B 1LYLA 3TN2A 3R2IA 4ODGA 4B3SQ 1WD0A 2DNEA 2MUYA 2R93B 2E2IB 3M4PA 4MTNA 2JEBI 3M4OB 1SROA 4RGMA 3P1HA 4GNXA 3T1HQ 3IL8A 1LLRD 2KCNA 2YTXA 4NKLA
chains in the Genus database with same CATH topology
2I46A 3PV0A 1IW7D 3RZOB 1SNMA 1SAPA 1A3TA 2PYKA 4Y7NB 2KEDA 1WD1A 1B4OA 4BBRB 1TWFB 5KNBA 1B1ZA 1ENFA 4I65A 4IZ8A 1GXDC 3OIQA 1LTSD 2F3VA 4EQPA 4RH6A 1SYGA 2EJGC 2AQ3B 3MEHA 3KLRA 1NR2A 3E6ZX 1SSOA 1KLUD 1HXYD 1M4VA 3HOXB 1PTOH 2F0TA 3IFDA 2PCFB 2VUMB 1SNCA 4G7OC 3KUPA 5CV7A 5C3EB 2E75C 5CR3A 1STEA 1R4PB 1O78A 3I90A 4IUQA 3QO2A 5C3WA 4BA2I 4C1NK 1H9SA 1EWCA 4IUTA 5KNCA 2VB2X 5ELFA 1PRTB 1AZPA 2AWOA 3J80E 4PMCA 4WRDA 1G2SA 2JA7B 1E2ZA 1AP0A 1V1PB 3BVGA 3N52A 4ZRZA 1JWUD 5ELCA 1C8CA 4QUFA 4V0BA 3BG3A 5D3DA 5C3XA 1IKMA 4C2MB 1B50A 4X3KA 3NK9A 1B9NA 1D5ZC 2JSOA 5I2XA 3PIO3 3MXGA 2BA0A 4J8QA 4IFDG 3C3LA 4KD4A 3CRLC 1DM0B 1YNJC 2XVSA 1TS4A 4QB4A 5D14A 3S2DB 4PNYA 3WDNA 3K5LA 1F9PA 4XYOA 5C6AA 4KKSA 4ID6A 5I6YA 4H44C 4BS9A 1HQRD 1I6HB 1SJED 2B2WC 1TR5A 1PTOD 2X6LA 1FNUA 1LTAD 4CKEA 1ENCA 2BE5D 1DOLA 2K33A 3T13A 2EYPA 3VR3A 3SXHA 3A7AB 1S5FD 3NP8A 2FHTA 2WP8J 2EY2A 1ICWA 4O42A 1A2UA 2ZXRA 3O13A 2DY7A 4IURA 2G9HD 1ZYRC 5EGTA 1STHA 1CT1D 1JC7A 5BN5A 2O2LD 2XSCA 1BR9A 3X3NA 3S16B 4ZQ3A 3I72A 4DAYA 1EQVA 3A8IE 1TQOA 2R3ZA 4I7ZC 4WORA 4ZLTF 1WTXA 1U9RA 4IUNA 1STNA 4OL7A 4ZKCB 5IGFA 3LWEA 3T51B 3EFXD 3G6JB 3MFGA 1I4HA 3TDQA 3I8ZA 3CRKC 1PFBA 3BDLA 1Q1BA 2NTSA 2L12A 3TMEA 3S14B 1D2BA 4ZUIA 1HA6A 4A3FB 2F0WA 4H0LC 4O1NA 3SHLA 1LACA 2Q8RE 2K32A 1YNND 1DXMA 3R2TA 3PUZA 2VXWA 1EY8A 1NSNS 4YIJA 4A3EB 1LTRD 3S17B 4KY7A 4LK1C 1GUNA 4C3HG 2CW0C 1JE4A 2A68C 3E5SA 2B2WA 3M7NA 4XQNA 4PMWA 2EY6A 2C9OA 4EQOA 3GTJB 2EYLA 1HPCA 3BYYB 3S1NB 2J4XA 1JQYD 1F2LA 5ELDA 2XWJB 1CHPD 3EVQA 2AQ2B 3GTMB 2LMCB 1VDZA 2KVMA 3C46A 1G6ZA 1DOKA 3I91A 1I3QB 3FMCA 4RKLA 1PLFA 3GV3A 1LT4D 3AU7A 1HFGA 3NPPA 1S5BD 5CC4A 1K83B 3LNNA 1SFOB 2HDMA 1OXSC 1STGA 2F0MA 4XQJA 4BY1B 1XTCD 2MPMA 1QWYA 2OEOA 3Q6SA 2EY5A 1WTVA 1I6VC 3HKZB 4K6LA 2D5DA 3J7AF 2VNUD 3K5MA 3E0JA 3PMFA 3ONAB 4WFN3 4KKTA 3VYSA 1WCMB 3D3RA 1TU2B 3WOFA 5IGDA 2EJFC 1TY0A 2JA8B 2F0VA 3BZDB 3OWEB 1PFMA 2A74C 2RKSA 4KHZA 4HSVA 1AZQA 3K58A 3ND9A 1Q8IA 1PRTC 1EWHA 1U4MA 2RDFA 4HCEA 1DCZA 4L6TB 4MIUA 5E4XA 5ELEA 4C56C 2NB0A 2NZ1D 5LL6X 3FRPB 5C0XJ 4GZYC 5JJZA 5I2YA 2BDNA 4F8MA 4DK0A 3SEBA 4KV6A 5IIFA 1H9KA 4NMZA 2LY7A 2F03A 4DA2A 4ILWA 2WV6D 3CHBD 1FNWA 2F0LA 5LHY1 3EA6A 3TP6A 4ME5A 2JE6I 2SEBD 5CBAE 3D8GA 3EROA 3NXWA 3URYA 1F2ZA 5CORA 5JEAJ 1WTOA 3HEJA 3MHBA 4RHSA 4X3UA 4L8JA 1H9SB 2IX1A 3I70A 1PTOB 3NBIA 2EVBA 1JB3A 3MZ5A 2RA4A 3K6OA 3DEOA 3VR5A 2D62A 1ZXTA 2B2TA 2EYFA 2B2UA 4KY6A 1MSGA 1OXTA 1SJHD 2X69A 4IQZA 3P7JA 1S5DD 4K2LA 2ICEC 3VR6A 1JR0D 5KGUA 4HCSA 2EYHA 1KDBA 2OT2A 3MA2B 1U4PA 1F2MA 1O7YA 1EYCA 1B53A 2OF1A 3KF8A 3QIAA 2NN6I 4HEDA 3RD4A 3V2TA 2L55A 1NR4A 1GOZA 4HSPA 2VB3X 3H3VC 5AFWA 1KDCA 3A7LA 1T5EA 4TRDA 2FJ2A 1IYVA 4CJ2C 5KNDA 5M5XB 3IFTA 2F0HA 1Y69U 3OMCA 1QE6A 3VR4A 1MGSA 2D9UA 2B39A 1R4QB 3PO3B 2R7ZB 2EYMA 3Q0AA 1JOKA 4FXDA 2K03A 4XT3B 1CI3M 3UI2A 3K7AB 4JK1C 3BS1A 5JEAH 2RBMA 1F9SA 4FNFA 3GTOB 2RVLA 1LT5D 2L11A 5FLXL 1V1PA 1XXGA 4NDXA 5DEHA 3VA5A 5KYLA 5FO9B 3MAQA 1HHVA 4Q0FA 4XIGS 3K0YA 2BA1A 1FNVA 3NBHA 4KJNA 2NVTB 4KJOA 3H6MA 2SDFA 1E0BA 1V43A 5C0XG 2F0OA 2E2DC 2H1EA 5T1GA 2NBFA 4HMIA 1SYCA 1HUMA 2N55A 2PO4A 1EIHA 1HA5A 3C1FA 3DWAA 2WACA 1SEBD 4DXGA 2EYJA 3D4WA 1RDPD 1F9QA 3NHHA 5A2QL 3HOYB 2A6ED 4KMUC 1CA5A 5NUCA 1D1KA 4A3DB 2K5WA 3TZDA 1CHQD 5C4XB 2NVQB 2NUCA 2A5HA 2O5IC 2EY1A 3HOVB 1I4RA 3J7YW 1Z7TA 5C4JB 4OGQC 2L4NA 1TS5A 1BOSA 3HOWB 4JBWA 3QG1A 1HQMC 2B2UC 4HN7A 1VF7A 1LTBD 4N9PA 1Y1VB 3S1RB 5DAUA 2PNRC 1WTQA 4CKBA 2CVRA 4FXGC 1OO9B 3P20A 4TSSA 5CBEE 2A6HD 2F0NA 3DMUA 3SVMA 4XT1B 3VA7A 3NWTA 1QILA 1X32A 5DNFA 1JORA 4K2KA 2M00A 4A3GB 4X3TA 1CTMA 2QF7A 2SNMA 3FKIB 2L9HA 4DF7A 2JXMB 1ZKOA 1SYBA 5EKLA 3FPUB 2KEEA 1D5XC 2EYOA 2PW7A 4CKCA 2KHSA 5C44B 5EKIA 1Q3LA 3ND8A 1RD9D 2DY8A 1BO0A 5E3FA 5IGEA 2F0DA 5KYIA 3Q24A 1JCKB 1O7ZA 4IFDJ 4KTAA 3OOCA 1DD2A 5D3IB 1K8OA 4BWGB 3GQBA 3I3CA 1LTGD 4RGTA 4C3IB 4DU9A 4WJWA 3SK4A 4A3JB 3DHQA 4B9XA 2CHBD 1Y8PB 4CBVA 4F87A 1GJXA 2TSSA 1ONLA 2A6HC 1YNJD 4IFDI 3M3YB 4G7ZC 1KTKA 5DM73 1TT2A 2C5CA 3C1EA 2WIIB 1L0YB 2Q8IB 2RSNA 4A3IB 2LS01 1EY6A 1AFPA 1AW7A 1SNDA 2IX0A 5M3FB 5C5LA 1W6KA 2LKVA 3SDZA 1JICA 3W2DA 2K5QA 3PUYA 4RCOA 3R93A 2E74C 1EY0A 4ULLA 3I4LA 3GD7A 1SBBB 3QJYA 1LABA 5JOBA 5IT9E 3V05A 4OIJA 2BOSA 5BN4A 1T5XD 1QNUA 1ET9A 3VR2A 5C0XH 1PMRA 4A3KB 1V8QA 3GTLB 3BVMA 5A2QE 3EQLC 4QF4A 3ITPA 1LV9A 5IOCA 1IKLA 3RMHA 3OWFA 1QJOA 2XWBB 3F2UA 1CZGA 1ENAA 4DK1A 2KCCA 3D6WA 1QNKA 2F0UA 1H9MA 4U68A 5CV9A 4ZKBB 5D65A 3NE5B 1GUOA 2EPBA 2XNAC 4FF1A 1PXUA 2MP1A 3OMGA 2IJ0A 1OXUA 1CFMA 2E2JB 5FOBB 1TWGB 1AN8A 1F9RA 2A73B 3S15B 1GUGA 2A6EC 2IX3A 2N88A 3H0GB 3NWSA 1KNAA 1QB5D 3NTHA 4UAIA 5E1FA 4K5VA 3QOJA 1GHKA 3S2HB 1DZ1A 5C0XI 2L5TA 4DGZA 2IWHA 1NUCA 1SE3A 1YNNC 1DJRD 3DWQA 5K36G 3H94A 4KKUA 3TP5A 1SNPA 4QUCA 2IW3A 4NW2A 5CMDA 1FD7D 1TWCB 1EQTA 2I07B 4EQNA 5K36H 3FVQA 4E6IA 2BDOA 4OIKA 2NYZD 4X3SA 1GHJA 1AEXA 4R8IA 5J1ZA 3U9SA 1SNQA 4A3MB 2KUMA 1XYIA 4N9TA 1BCPD 1KAAA 4HR7B 3GTQB 1SYFA 4RKBA 2WB1B 2F0SA 1PFNA 5COYA 5K5PA 1A2TA 1KNEA 3TP8A 4IALA 2B8FA 5J39A 5IT9L 1TS3A 4J6HA 3T16A 4KI0A 2M2LA 3JAME 2FINB 1EFID 2RQXA 3K57A 4BA1I 1G291 3TZUA 1X3QA 4LJZC 1UEAB 2XN9C 2HCCA 3M4YA 3W3AA 5CYUA 1SE2A 3SK6A 3K5OA 3VYUA 4K5XA 2D2CC 3G7LA 1QOHA 3H09A 5C4ZA 4OO1I 1E2VA 3L3OC 5CGKA 4TQUS 3HP3A 2FMMA 2MHVA 4XDXA 5I6WA 3J81L 2NWGA 2XRSD 1FGBD 2AWNA 5HURA 1SYDA 3ERQA 4DAPA 1BCPB 4IUUA 4M8AA 3PIP3 4U673 1OXXK 1BUVT 3I73A 1V1OA 4RGOS 2L0CA 1I4XA 1IHZA 3MXPA 1A6XA 2F0EA 1HFNA 3KLSA 3BDOA 2A69D 2Z4HA 1PZKD 1K8MA 1D6EC 4C3IG 2EE1A 2Z1CA 1EY4A 2K6AA 1RODA 1I4PA 2F0JA 3JAML 4KN7C 3GTPB 2HQEA 2RDHA 3KK7A 1KLGD 1Z6HA 3A56A 5KEEA 5JPMC 1BXTA 3KBXA 4HTHA 4BBSB 4K8IA 2QCPX 3MXUA 2E76C 3SK8A 1PTOC 1FR3A 5M5WB 1LTID 1TWHB 2CW0D 1A3UA 2NVXB 1BNZA 3HG9A 1PZJD 3MC0B 4IN3A 4QMGA 2RDGA 1OXVA 3FDTA 2R6GA 2ICIA 3S1QB 3S1MB 4RFBA 3T4AC 1WTWA 1ILPA 2EOTA 3ZYYX 4TKOB 1KDAA 1M8AA 5M3MB 4M1UB 2OXPA 1CZWA 3J81E 1J9OA 1EZ6A 1HTPA 4KHVA 2B63B 3N6RA 4NP5A 4RGNA 5I9PA 4ABNA 2HDLA 1UUPA 3K59A 3D4DA 2RSOA 1ZEQX 4IUVA 3NUCA 2PZUA 2F0GA 1F2YA 4F7XA 2KOLA 2SNSA 4PV1C 1VMCA 2WAQB 4C1NI 3GO5A 1XWEA 2AUKA 2LFNA 4MN3A 2ENBA 3GTKB 4KN4C 5HGTA 3Q23A 4RHRA 2R61A 3K5NA 4DN4M 1EIGA 1G91A 2IL8A 2QDBA 4HMJA 1PRTD 4DNRB 5EBCA 1D1IA 4FYDA 3MTSA 1XX8A 5KRUA 5IGBA 1DONA 1IL8A 1F77A 5CV8A 1BDOA 3L7ZC 4K14A 3NQIA 1JOQA 3SR1A 1Y8OB 3DEPA 4S3SA 1TS2A 2WINB 1WTPA 4DXFA 3KBGA 1DOMA 3U9OA 2JP1A 3EJIA 5FKAC 1TWAB 4FP5D 2GA4B 3PUVA 1HCZA 4FF4A 2R92B 2O5JC 1HRJA 2K5DA 2CQAA 5EBDA 1NAPA 2B8GA 5I9OA 3OPOA 1RF2D 3VYTA 5JAVA 1MD2D 2XIWA 5FK9C 4KK7A 2V4DA 1CM9A 2IT1A 1PTOF 1U4RA 2YYZA 2JEAI 2JA6B 1IW7C 2EZVA 1SMYC 1GUTA 2FFKB 1C4QA 1Q90A 1W6JA 1TIID 4HAEA 3NTKA 4A3BB 1PRTF 3FPPA 2PW5A 2QKIC 4FXKC 2NN6G 2L1BA 1S5ED 2M9VA 3MVVA 2A69C 1EYDA 4KY5A 5I4DA 5M5YB 1Q12A 2B2YC 2WKCA 1R9TB 2YU9B 1O80A 4QIWB 4KD3A 1TKWB 3HS0C 3HOUB 2HUGA 4B9WA 1B3AA 3OW7A 2Q8TA 1GUWA 4V190 2BCOA 1A3VA 2MJ8A 3A8KE 1VCIA 1JOOA 1O7LA 2ID0A 3X3MA 1LO5D 5EJWA 1GUSA 4C3JB 3M85A 1UAPA 5JEAG 4R8NA 2NTTA 3AB9A 1PDQA 1BBXC 1BQQT 3HOZB 1SMYD 2KJXA 3LWUA 5FO8B 1EOTA 3IKJA 2ZXOA 1JWMD 1ILQA 3A8JE 4P2CB 4XYQA 3C2PA 2PZWA 1DYQA 2O4XA 1H9RA 3MXNA 3R8BA 3T56B 3SK5A 2Z8LA 4BY7B 4XQQA 3H91A 4A93B 1TVXA 3RZDB 1S5CD 3OHXC 4QCLA 4RWSC 1QCBD 4F88A 2G9DA 1EEID 3QOLA 3HRZC 3OIPA 4C3JG 1BCPC 4EVOA 1PYWD 3MFYA 1RHPA 4H13C 1EYAA 1E2WA 3DUZA 4UDUC 5ISRA 3HGBA 4XXEA 3GV6A 3GP7A 1RCVD 2K1BA 2DNCA 1FYCA 1BF4A 2PQEA 2JYOA 2A68D 1B9MA 4G57A 5G3LD 1LT6D 2NVYB 1I4GA 2F0PA 5A35A 2JA5B 5IGGA 1EY9A 1Y8NB 1B44D 1STAA 2Z4IA 3V96A 5EQ0A 2KA7A 1RJTA 3QWNA 4OO1G 4PQXA 1TY2A 4G7HC 3CQZB 2ZT9C 1STBA 3CU7A 5J22A 1A15A 4DAVA 4Z9CB 5CV6A 1I50B 4CJ1B 1G2TA 5C5MA 4OHJA 2AQ1B 2Y0SB 2SOBA 3BVZA 3WOEA 3A55A 4K5WA 3T53B 5C4HA 2K7VA 3L9AX 2PPBC 2B2VA 1C48A 1EEFD 1LT3D 3FEWX 5JPNC 1SE4A 1EL0A 1ET6A 3QB3A 4EGVA 2K28A 4FVMA 4ZYSA 2F0KA 3GTGB 1LTTD 1MBYA 3KLSX 2B2YA 3BYTB 2F0QA 1SDFA 4PMBA 1Z47A 1SYEA 2IPKD 4FO2A 2PMZB 4ZAIA 2K01A 5EKKA 3D6CA 2E2HB 3MWYW 1KABA 3HZXA 1EU4A 1I4QA 1EY7A 2WKDA 4DFAA 1EZ8A 4ZK9B 2F0FA 2B2VC 4RAUC 1ZYRD 2ZXPA 5DM63 1MSHA 4FF2A 5G3LF 2F1MA 4Q5VA 2DN8A 1HUNA 1II3A 3TBIB 4R9WA 1G8ZD 2F4IA 1NCVA 3M7GA 1CQFA 4LMQD 2KECA 5JVG3 4K8JA 5EPLA 1ESFA 2HCIA 5IODA 1BCPF 2NN6H 2J7ZA 1RTOA 3R3OA 3CKIB 2PZTA 4AYBB 5FO7B 2QILA 4LAAA 1CQVA 2F3WA 5TSSA 2EXZA 3Q22A 1CK1A 1WTRA 3DXJC 1Q1EA 1U4LA 1RTNA 4RCNA 5FLXE 4CJ0B 3PUXA 2TMPA 3TSSA 1RKNA 3D31A 4XTCS 4G4KA 4B08A 5IGCA 2XRQD 2EDGA 3DWPA 3TP7A 4DNTB 5CV5A 3IAYA 3J7AV 5M9OA 3LX0A 1D5MC 4ZUJA 4CHTB 5E4WC 2F0IA 1J8IA 1ESRA 2EJMA 3SE0A 5F2DA 1MI2A 3OSOA 1SNOA 1ML0D 1VF5C 3NSWA 2BE5C 3I4MB 1EY5A 4IUPA 4IFDH 2B2TC 1EU3A 3RLFA 3DM1A 3J80L 3D4RA 4OO1H 2AUJD 1PZID 3P75A 1X3PA 1L0XB 5CV4A 5LL6S 2KQ3A 2K05A 2MGSA 4FF3A 2FMCA 1JWSD 1H9JA 3PUWA 3VYRA 1SXTA 1UNSA 5EPJA 5EPKA 1QG7A 1WVLA 4C3HB 1HTLD 3S9WA 1VMPA 4H7BA 2X6GA 4MHEA 1STYA 5T1IA 5JVH3 2K04A 4CGYB 2QEJC 4K6DA 2J0TD 1S4ZA 2H4OA 3PO2B 4RA8A 3BDCA 5KIXA 4J1MA 1IYUA 5ELBA 3NQTA 3AMUA 3NTIA 4L63B 1B2TA 3I4NB 5BN3A 1Y1WB 3A54A 3RUZA 1CA6A 3TN2A 3R2IA 4ODGA 1WD0A 2DNEA 2MUYA 2R93B 2E2IB 2JEBI 3M4OB 4RGMA 3P1HA 3IL8A 1LLRD 2KCNA 4NKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SND A;  3QOJ A;  4DFA A;  5C3X A;  2RBM A;  5C5L A;  5CV8 A;  1EZ8 A;  1A3U A;  2F0F A;  1F2Z A;  2LKV A;  1SNM A;  5F2D A;  2F0N A;  2PQE A;  4K14 A;  3DMU A;  4KD3 A;  4WOR A;  3OSO A;  4QMG A;  1U9R A;  3SR1 A;  4DGZ A;  1JOQ A;  3NK9 A;  1STG A;  2F0M A;  4IUN A;  1SNO A;  1STN A;  1A3T A;  3HEJ A;  1NUC A;  2PYK A;  3MHB A;  4OL7 A;  4NDX A;  3SK6 A;  4B9W A;  3NXW A;  4S3S A;  4K5X A;  5DEH A;  3VA5 A;  5IGF A;  5KYL A;  5C4Z A;  3TP5 A;  1SNP A;  4G57 A;  1EY0 A;  1JOR A;  1A3V A;  4K2K A;  2M00 A;  1EY5 A;  4EQN A;  2OEO A;  2EY5 A;  1II3 A;  1JOO A;  4I65 A;  4KJN A;  4E6I A;  4IZ8 A;  2F0P A;  5CGK A;  3MZ5 A;  5JOB A;  4KJO A;  3H6M A;  3U9O A;  2SNM A;  3BDL A;  3P75 A;  4KD4 A;  1KDA A;  3PMF A;  5CV4 A;  2F3V A;  5I6W A;  4EQP A;  3EJI A;  3TME A;  2EYF A;  4QB4 A;  4DF7 A;  1AEX A;  4KY6 A;  1SYG A;  4K8J A;  1SYB A;  4ZUI A;  4PNY A;  2KQ3 A;  4R8N A;  5EKL A;  5HUR A;  1SYD A;  2EYO A;  2PW7 A;  3MEH A;  1EY9 A;  2F0W A;  2F0O A;  3ERQ A;  5IGG A;  5IOD A;  2KHS A;  1STA A;  3R3O A;  5C6A A;  2OXP A;  3SHL A;  5IGD A;  2PZT A;  4HMI A;  1SYC A;  4ID6 A;  5I6Y A;  1EZ6 A;  5J1Z A;  4K2L A;  4LAA A;  2F0V A;  1SNQ A;  2F0T A;  4KHV A;  3C1F A;  1TR5 A;  1SNC A;  2F3W A;  5E3F A;  2EXZ A;  4QF4 A;  1ENC A;  1EY8 A;  2WAC A;  1NSN S;  4NP5 A;  3ITP A;  5I9O A;  2F0D A;  5IGE A;  2EYH A;  4N9T A;  1KDB A;  2EYJ A;  2RKS A;  4H7B A;  4YIJ A;  3D4W A;  5KYI A;  1KAA A;  1STY A;  5CV7 A;  5I9P A;  2PZW A;  4KY7 A;  1SYF A;  1STB A;  4KTA A;  5IOC A;  4RKB A;  5JAV A;  2O4X A;  3D4D A;  5J22 A;  5CV6 A;  5CR3 A;  1F2M A;  3NHH A;  4K6D A;  3OWF A;  1EYC A;  1IHZ A;  2F0S A;  2OF1 A;  3T13 A;  2EYP A;  3E5S A;  3MXP A;  2F0E A;  5NUC A;  3SK5 A;  3SXH A;  2RDF A;  3NUC A;  1ENA A;  5C5M A;  5K5P A;  4MIU A;  2PZU A;  3NP8 A;  2F0G A;  2SOB A;  3BDC A;  1A2T A;  2EY6 A;  1F2Y A;  2EY2 A;  2F0U A;  4DU9 A;  4J1M A;  4K5W A;  3V2T A;  5KIX A;  5C4H A;  5CV9 A;  3SK4 A;  5C3W A;  1A2U A;  3DHQ A;  3TP8 A;  4B9X A;  3NQT A;  4F7X A;  2SNS A;  1RKN A;  4EQO A;  4IAL A;  2EYL A;  1KDC A;  4F8M A;  2NUC A;  1EY4 A;  4TRD A;  2F0J A;  4KV6 A;  2ENB A;  2EY1 A;  5IGC A;  2HQE A;  5J39 A;  5EGT A;  2F0H A;  3RUZ A;  5HGT A;  5IIF A;  3OMG A;  3QOL A;  1STH A;  4NMZ A;  3QB3 A;  1TT2 A;  3EVQ A;  3OMC A;  4J6H A;  4ODG A;  3TP7 A;  2F0K A;  4PMC A;  4EVO A;  2QDB A;  3T16 A;  3C1E A;  4WRD A;  5CC4 A;  4HMJ A;  5KEE A;  5CV5 A;  2PW5 A;  2F0Q A;  4PMB A;  1SYE A;  2EYM A;  1EYA A;  2F0L A;  3P1H A;  4HTH A;  4ZQ3 A;  4K8I A;  3MVV A;  5KRU A;  1JOK A;  5EKK A;  3D6C A;  4N9P A;  3TP6 A;  5M9O A;  3S9W A;  1EYD A;  3LX0 A;  1EQV A;  5DAU A;  5IGB A;  4ME5 A;  5KGU A;  1KAB A;  4KY5 A;  1TQO A;  1EY6 A;  3HZX A;  4RKL A;  3SK8 A;  5ISR A;  4ZUJ A;  3D8G A;  1EY7 A;  4NKL A;  3ERO A;  5E1F A;  2F0I A;  4K5V A; 
#chains in the Genus database with same CATH topology
 2I46 A;  3PV0 A;  1IW7 D;  3RZO B;  4BBS H;  2UXB Q;  1X55 A;  1SNM A;  1SAP A;  3CXC A;  1A3T A;  2PYK A;  4Y7N B;  3DM3 A;  2KED A;  1WD1 A;  1D8L A;  1B4O A;  4BBR B;  1TWF B;  3HKZ G;  5KNB A;  3HKS A;  1AE2 A;  3ER0 A;  1B1Z A;  1ENF A;  5JJL A;  4I65 A;  4IZ8 A;  1GXD C;  3OIQ A;  1E1O A;  3TEH B;  1JE5 A;  4A3F G;  1TWH H;  2BH8 A;  1LTS D;  4KHP L;  2F3V A;  1EQQ A;  4EQP A;  4RH6 A;  1SYG A;  2EJG C;  2AQ3 B;  3BJU A;  3MEH A;  3KLR A;  1TWA H;  1NR2 A;  1JB7 A;  4JYA L;  3E6Z X;  1SSO A;  4JI5 L;  1KLU D;  3J81 i;  1HXY D;  1QUQ B;  1M4V A;  4QIW E;  4JI6 Q;  3HOX B;  1PTO H;  2F0T A;  3IFD A;  2PCF B;  2VUM B;  1SNC A;  4G7O C;  1N9W A;  3KUP A;  3CF5 A;  4JBM A;  3B6Y A;  5CV7 A;  5C3E B;  4DUZ L;  1MIU A;  2E75 C;  5CR3 A;  2VQF L;  2NZH A;  1NMG A;  1STE A;  1R4P B;  1PH7 A;  1O78 A;  3I90 A;  4IUQ A;  3QO2 A;  4DV3 L;  4B3T Q;  5C3W A;  4BA2 I;  4C1N K;  1H9S A;  1EWC A;  4IUT A;  3AQQ A;  1HH2 P;  5KNC A;  2VB2 X;  4OON A;  3GTL H;  5ELF A;  1G6P A;  2GVB A;  4A3B H;  1PRT B;  3OYY A;  2B63 G;  1AZP A;  2AWO A;  1TWF H;  2OTL A;  3J80 E;  1CKN A;  2QGQ A;  4LFB L;  4J15 A;  4PMC A;  1A62 A;  4WRD A;  1G2S A;  2JA7 B;  3KF6 B;  1E2Z A;  1AP0 A;  1V1P B;  3BVG A;  3N52 A;  4ZRZ A;  4JI1 Q;  1MJC A;  1JWU D;  1A63 A;  5ELC A;  3TRE A;  1C8C A;  4QUF A;  4LF8 L;  4V0B A;  3GTK H;  2WAQ G;  1EWI A;  3BG3 A;  5D3D A;  5C3X A;  1IKM A;  4C2M B;  1M1K C;  2OWO A;  1B50 A;  4X3K A;  4DR6 L;  3NK9 A;  2VUM H;  1B9N A;  1D5Z C;  2JSO A;  5I2X A;  3BZK A;  3PIO 3;  3MXG A;  5IWA L;  2BA0 A;  2UUA Q;  1VQP A;  1KXL A;  4J8Q A;  1I5F A;  4IFD G;  3C3L A;  4KD4 A;  3CRL C;  1DM0 B;  1YNJ C;  3HOU G;  2XVS A;  4YWK A;  1QVC A;  4PZ6 A;  1TS4 A;  4QB4 A;  5D14 A;  3UDX A;  3S2D B;  4PNY A;  3WDN A;  1PHJ A;  3K5L A;  1F9P A;  2PQA B;  1CKN B;  4JW0 A;  4UY8 C;  4XYO A;  5C6A A;  5H1S E;  2VUM G;  4KKS A;  1CSP A;  4ID6 A;  5I6Y A;  4H44 C;  2ZTE A;  4BS9 A;  1HQR D;  2EQS A;  1SJE D;  1Z9F A;  1I6H B;  4DV6 L;  2NVQ H;  5GAE C;  2B2W C;  1CKM A;  1TR5 A;  5C3E G;  1PTO D;  2X6L A;  1FNU A;  1LTA D;  4CKE A;  1ENC A;  4JI3 L;  4JI8 Q;  4BBR H;  2BE5 D;  1E7Z A;  1DOL A;  2EXD A;  4AH6 A;  2ALY B;  2Q2T A;  2V1C C;  2WAQ E;  2K33 A;  3T13 A;  1PH1 A;  2EYP A;  3VR3 A;  3SXH A;  2R93 H;  3A7A B;  1S5F D;  3I4N H;  3NP8 A;  2FHT A;  2WP8 J;  2EY2 A;  3A5Z B;  1ICW A;  4A3C H;  4O42 A;  1A2U A;  2ZXR A;  3O13 A;  1A8V A;  2R92 G;  2E2J H;  4JI6 L;  2DY7 A;  4IUR A;  5LMN L;  2G9H D;  1JMC A;  1SMX A;  1ZYR C;  1K8A C;  3G6E A;  5EGT A;  1STH A;  2N8N A;  3M3Y H;  1CT1 D;  5FJ8 H;  1JC7 A;  1B8A A;  5HY6 A;  5E7N A;  5BN5 A;  5BR8 L;  2O2L D;  4LF9 L;  3CCJ A;  4A3D H;  2XSC A;  1BR9 A;  3X3N A;  3S16 B;  2CFM A;  4ZQ3 A;  3I72 A;  2CKZ B;  4DAY A;  1TWC H;  1EQV A;  3A8I E;  1TQO A;  2R3Z A;  4I7Z C;  4N8X 1;  1X9N A;  2KHI A;  4UHV A;  4WOR A;  3HOZ G;  4ZLT F;  1WTX A;  1C0A A;  1U9R A;  4IUN A;  1STN A;  4OL7 A;  4ZKC B;  5IGF A;  3LWE A;  1IBL Q;  3T51 B;  3EFX D;  3G6J B;  1YJW A;  2CWA A;  1Y1V H;  3MFG A;  1I4H A;  3TDQ A;  4DV5 L;  4A3F H;  3I8Z A;  3M9B A;  3U58 A;  3CRK C;  1PFB A;  3BDL A;  1Q1B A;  3W1B A;  2NTS A;  2L12 A;  3TME A;  2I5H A;  5ELN A;  3S14 B;  1D2B A;  4ZUI A;  1HA6 A;  4A3F B;  2F0W A;  4DR4 L;  4H0L C;  4DV3 Q;  4O1N A;  3SHL A;  1LAC A;  3LGJ A;  2Q8R E;  1UWV A;  2K32 A;  5IP7 G;  1Q46 A;  1YNN D;  1B7Y B;  1DXM A;  2WB1 E;  3R2T A;  5IWA Q;  2UUA L;  3PUZ A;  2VXW A;  1EY8 A;  1NSN S;  4YIJ A;  4A3E B;  4C3H H;  1LTR D;  3S17 B;  4KY7 A;  4LK1 C;  1GUN A;  4C3H G;  2CW0 C;  1N34 L;  1JE4 A;  2A68 C;  3E5S A;  4EQ5 A;  2B2W A;  4KLK A;  4HIO A;  3M7N A;  3TRZ A;  4XQN A;  3L2P A;  4PMW A;  2EY6 A;  1K9M C;  2C9O A;  4GLX A;  4EQO A;  3GTJ B;  2EYL A;  2MFI A;  1HPC A;  4HJ5 A;  3BYY B;  3S1N B;  1L1O C;  2J4X A;  4YWL A;  2E5L L;  1JQY D;  1Q7Y C;  4JI8 L;  1Y1W H;  1F2L A;  5ELD A;  4DR6 Q;  2XWJ B;  4JI4 Q;  1CHP D;  4MTK A;  1OTC A;  3EVQ A;  2AQ2 B;  3GTM B;  4LNQ A;  2LMC B;  1VDZ A;  2KVM A;  3C46 A;  3HOY G;  2CWP A;  5IP9 G;  1G6Z A;  1DOK A;  1HR0 Q;  1FJG Q;  3I91 A;  1I3Q B;  3FMC A;  4AYB G;  4RKL A;  1PLF A;  3GV3 A;  1VQD A;  4LF7 Q;  4K0K L;  4GLA C;  1LT4 D;  3AU7 A;  1HFG A;  3NPP A;  1S5B D;  3S2H H;  5CC4 A;  1K83 B;  3LNN A;  1SFO B;  2N3S A;  2HDM A;  1KAW A;  1OXS C;  1STG A;  2F0M A;  3PIO A;  2F52 A;  4LFC L;  4XQJ A;  1WOC A;  4BY1 B;  1VQE A;  1XTC D;  5FJ8 G;  1HR0 L;  2KCT A;  2MPM A;  1QWY A;  2RHS B;  2Z0S A;  3F2D A;  4A3D G;  2OEO A;  3Q6S A;  1NY4 A;  2EY5 A;  1I6V C;  3HKZ B;  1WTV A;  5C4X G;  3DLL A;  4K6L A;  2Z6K C;  2D5D A;  3J7A F;  2VNU D;  3K5M A;  3E0J A;  5M3F H;  3PMF A;  5FLX c;  3ONA B;  4WFN 3;  3QR8 A;  1PVO A;  1B3Q A;  4KKT A;  3VYS A;  2VQF Q;  1WCM B;  3D3R A;  1PH9 A;  2R7D A;  1TU2 B;  3WOF A;  4MNO A;  5IGD A;  2EJF C;  1R9T H;  3HOW G;  1XMQ Q;  1TY0 A;  2JA8 B;  2F0V A;  3BZD B;  3OWE B;  1PFM A;  5C3E H;  2A74 C;  2Q2I A;  2RKS A;  4KHZ A;  5IYC G;  3W5O A;  4HSV A;  1AZQ A;  3FHW A;  3K58 A;  2MQH A;  3ND9 A;  1Q8I A;  1PRT C;  2JA5 H;  1Q82 C;  1EWH A;  1U4M A;  1WJJ A;  2RDF A;  4HCE A;  4R4C A;  1DCZ A;  1IBL L;  4L6T B;  4C3J H;  4MIU A;  5E4X A;  5ELE A;  4B3T L;  4B3R Q;  4C56 C;  2NB0 A;  1K0R A;  2NZ1 D;  2OQ0 A;  5LL6 X;  3FRP B;  5AJ3 Q;  3J7Z C;  5C0X J;  4GZY C;  2BDN A;  5I2Y A;  5JJZ A;  4AQY Q;  4F8M A;  4DR3 L;  4DK0 A;  3SEB A;  4KV6 A;  1YJN A;  3AYH B;  5IIF A;  3OTO Q;  1H9K A;  2NZO A;  4NMZ A;  2DGY A;  2LY7 A;  4LF6 Q;  1KQS A;  2F03 A;  4DA2 A;  2D0O A;  4ILW A;  3RN5 A;  2WV6 D;  1X56 A;  3TS2 A;  3BU2 A;  3CHB D;  1FNW A;  2F0L A;  3E3X A;  5LHY 1;  4P72 A;  1JT8 A;  3EA6 A;  3TP6 A;  4GS3 A;  4ME5 A;  2JE6 I;  2SEB D;  5CBA E;  3D8G A;  3ERO A;  3NXW A;  3URY A;  4R4T A;  3ERS X;  1F2Z A;  1NJI C;  5COR A;  2E2H H;  3S1Q H;  5JEA J;  4JG2 A;  2EIF A;  1PV4 A;  1WTO A;  3HEJ A;  3HOW H;  1E3P A;  3MHB A;  4P73 A;  4PZ7 A;  3BZC A;  3TS0 A;  3PSI A;  4RHS A;  4X3U A;  4L8J A;  1H9S B;  2IX1 A;  1VQ4 A;  1YEZ A;  4JOI A;  3I70 A;  1N8R C;  1PTO B;  3NBI A;  3CCQ A;  2EVB A;  1JB3 A;  3MZ5 A;  2RA4 A;  3K6O A;  3DEO A;  2XGT A;  2A1A A;  3VR5 A;  2D62 A;  1ZXT A;  2B2T A;  4NB3 A;  2EYF A;  2B2U A;  4KY6 A;  4BXX G;  1MSG A;  4LF5 Q;  3CMA A;  1VQA A;  1OXT A;  1SJH D;  2X69 A;  4IQZ A;  1VQ9 A;  1O7I A;  3P7J A;  1SFO H;  1S5D D;  2AKW B;  4K2L A;  2R7F A;  2ICE C;  3VR6 A;  1JR0 D;  5KGU A;  4HCS A;  2EYH A;  1KDB A;  2OT2 A;  3EIV A;  3UDF A;  4GNX C;  3MA2 B;  1U4P A;  1F2M A;  1O7Y A;  1EYC A;  1B53 A;  2OF1 A;  2CH4 W;  3KF8 A;  3QIA A;  3PO2 H;  4JI7 Q;  1VQ8 A;  1T9H A;  1SLJ A;  2NN6 I;  5C44 H;  3KF8 B;  4HED A;  3RLO A;  3RD4 A;  2VZA A;  2L55 A;  3V2T A;  4JBK A;  1NR4 A;  1GOZ A;  4HSP A;  2VB3 X;  3H3V C;  5AFW A;  2YU9 H;  1AE3 A;  1KDC A;  3A7L A;  1IBM Q;  1T5E A;  4TRD A;  2FJ2 A;  4BY7 H;  1IYV A;  1HNZ L;  2FXQ A;  4CJ2 C;  5KND A;  5M5X B;  3IFT A;  2UUC L;  2F0H A;  4A3J H;  4A75 A;  1Y69 U;  3OMC A;  2YV5 A;  1QE6 A;  3VR4 A;  1W2B A;  1MGS A;  2D9U A;  4A3C G;  1XNR L;  2B39 A;  5M5X H;  1R4Q B;  4X6A H;  3PO3 B;  2R7Z B;  2EYM A;  3I4N G;  3Q0A A;  2Q2U A;  1JOK A;  4DUY L;  4DV4 Q;  1N33 L;  1IL2 A;  4FXD A;  2K03 A;  1PA6 A;  5IT9 c;  4XT3 B;  3I56 A;  1CI3 M;  3UI2 A;  3K7A B;  4ZCK A;  4A3G G;  4JK1 C;  3BS1 A;  5JEA H;  2RBM A;  1F9S A;  4FNF A;  3GTO B;  2RVL A;  2ZM6 Q;  1I94 L;  1LT5 D;  2L11 A;  3GDE A;  5FLX L;  1V1P A;  1VQK A;  1XXG A;  4NDX A;  3CC2 A;  5DEH A;  3VA5 A;  5KYL A;  5FO9 B;  3MAQ A;  1HHV A;  4Q0F A;  4DKA C;  4XIG S;  3K0Y A;  4DR3 Q;  2BA1 A;  1CUK A;  1FNV A;  3NBH A;  4B3M L;  4KJN A;  2NVT B;  4KJO A;  3H6M A;  4YWM A;  3CC7 A;  2SDF A;  1I94 Q;  1E0B A;  5IYD H;  1V43 A;  1GM5 A;  5C0X G;  2RCN A;  4YHH L;  1RIP A;  2F0O A;  4OEM B;  2E2D C;  2H1E A;  4X66 Q;  4UPA A;  5T1G A;  2NBF A;  4HMI A;  1SYC A;  1HUM A;  2N55 A;  2PO4 A;  1EIH A;  1HA5 A;  2JA7 G;  1PH3 A;  3C1F A;  3AFP A;  3DWA A;  4FDB A;  4A3J G;  2WAC A;  3S17 H;  1SEB D;  4DXG A;  2EYJ A;  2UXD L;  2I5M X;  3D4W A;  1RDP D;  1F9Q A;  3NHH A;  5A2Q L;  3HOY B;  5GAG C;  1KL9 A;  2A6E D;  4KMU C;  5IYB H;  1CA5 A;  1VQL A;  5NUC A;  1H95 A;  1D1K A;  4A3D B;  2K5W A;  3TZD A;  1HJP A;  3JC6 6;  4LF4 Q;  1CHQ D;  5C4X B;  2VW9 A;  4NPS A;  2NVQ B;  3S1N H;  2NUC A;  3FKI G;  2A5H A;  3ULL A;  2O5I C;  4A3B G;  2EY1 A;  3HOV B;  1I4R A;  3J7Y W;  3VDY A;  4JOI C;  2UUB L;  4JI4 L;  1Z7T A;  5C4J B;  2NVX H;  4OGQ C;  4LF7 L;  4LUO A;  2UU9 L;  2L4N A;  1TS5 A;  1BOS A;  3HOW B;  2RCF A;  4OWW B;  4JBW A;  3QG1 A;  1HQM C;  3ULP A;  5C4J H;  2B2U C;  2OCE A;  4HN7 A;  1VF7 A;  1LTB D;  4N9P A;  3RLN A;  1Y1V B;  3J7A 5;  3S1R B;  5DAU A;  2DJF C;  2PNR C;  3K8A A;  1WTQ A;  4CKB A;  2CVR A;  4IO9 A;  4FXG C;  3UDI A;  3J80 i;  1OO9 B;  3U4V A;  3P20 A;  4R4I A;  4TSS A;  4LF5 L;  5CBE E;  2A6H D;  2UU9 Q;  2F0N A;  3ULJ A;  1HNW Q;  3DMU A;  3SVM A;  4KHP Q;  4XT1 B;  4X64 Q;  3VA7 A;  3NWT A;  1QIL A;  1X32 A;  5DNF A;  1JOR A;  4K2K A;  2M00 A;  2PI2 A;  1X6O A;  4A3G B;  4IOA A;  4X3T A;  1EQR A;  1CTM A;  4GN5 A;  2QF7 A;  2HIX A;  3PO3 H;  3W1G A;  4HID A;  2SNM A;  4A3L G;  3FKI B;  2L9H A;  5IE8 A;  4DF7 A;  2JXM B;  1ZKO A;  4LFC Q;  1SYB A;  5EKL A;  3FPU B;  1S3O A;  2KEE A;  1D5X C;  2EYO A;  2PW7 A;  4UP8 A;  1GVP A;  4CKC A;  1WFQ A;  2KHS A;  5C44 B;  5EKI A;  3HOV H;  3RZD H;  4B3R L;  3CCR A;  1BBU A;  1Q3L A;  3ND8 A;  3ICE A;  1RD9 D;  2DY8 A;  1Y14 B;  3KYH C;  1BO0 A;  3A5U A;  3PO3 G;  1TXY A;  5E3F A;  3J81 j;  5IGE A;  2PI2 E;  2F0D A;  5KYI A;  1YJ9 A;  2CH4 A;  3Q24 A;  1JCK B;  1O7Z A;  2LXJ A;  4GOP A;  4IFD J;  4KTA A;  3OOC A;  3J80 c;  1YIJ A;  4LWC A;  4JV5 Q;  1DD2 A;  5D3I B;  4A93 G;  1K8O A;  4BWG B;  4OEL B;  1MKH A;  3GQB A;  3I3C A;  4YHH Q;  1LTG D;  4RGT A;  4C3I B;  4DU9 A;  4A76 A;  4DUY Q;  4LFA Q;  4WJW A;  3SK4 A;  4AQY L;  4A3J B;  3DHQ A;  4B9X A;  2CHB D;  1Y8P B;  4CBV A;  4F87 A;  1PH4 A;  5JJI A;  1GJX A;  3KFU A;  4YCV A;  2VQE L;  2B63 H;  4MZ9 A;  2TSS A;  4C3I H;  1KD1 C;  1ONL A;  2A6H C;  1YNJ D;  4GN4 B;  4P71 A;  4IFD I;  2VS1 A;  3M3Y B;  4G7Z C;  2UXD Q;  1KTK A;  5DM7 3;  4O0A A;  1TT2 A;  2C5C A;  4DR1 Q;  3KOJ A;  2ATW A;  1Q8K A;  5ELO A;  3C1E A;  2G5D A;  2WII B;  3K7A H;  1K3B C;  1MHW C;  3S16 H;  3I2Z A;  4LF8 Q;  1L0Y B;  4DV5 Q;  2Q8I B;  4OWX B;  3GTJ H;  5FLM H;  2RSN A;  4POG A;  4A3I B;  2LS0 1;  1EY6 A;  1AFP A;  1S40 A;  1HNX Q;  1AW7 A;  1SND A;  4DR5 L;  1W3S A;  5C4X H;  2IX0 A;  5M3F B;  5C5L A;  1QZH A;  1W6K A;  2LKV A;  1PH6 A;  3SDZ A;  1JIC A;  3W2D A;  2K5Q A;  3PUY A;  4RCO A;  3R93 A;  2E74 C;  2E8G A;  4O2D A;  1EY0 A;  1TWG H;  3G71 A;  2K14 A;  4X65 L;  2E2I H;  4ULL A;  3I4L A;  3GD7 A;  1SBB B;  3QJY A;  1LAB A;  5JOB A;  5IT9 E;  3V05 A;  4OIJ A;  2BOS A;  5BN4 A;  3H0G H;  1T5X D;  2DUD A;  1K83 H;  1QNU A;  1ET9 A;  2VY3 A;  5LMU Q;  1VQB A;  5EAY A;  1QVF A;  2F4V Q;  1K28 A;  3VR2 A;  1S72 A;  4JI7 L;  5C0X H;  1GO3 E;  1PMR A;  4A3K B;  1V8Q A;  3GTL B;  1JJG A;  3BVM A;  3F8T A;  5A2Q E;  3EQL C;  4QF4 A;  4BBS G;  3ITP A;  2B29 A;  1LV9 A;  5IOC A;  1IKL A;  1PH5 A;  2A19 A;  1E24 A;  3RMH A;  4CDE C;  3OWF A;  4DK3 C;  1QJO A;  2ASB A;  2XWB B;  5DLQ E;  3F2U A;  1CZG A;  1ENA A;  3HKZ E;  4DK1 A;  2KCC A;  3D6W A;  5BR8 Q;  1QNK A;  1YIT A;  2F0U A;  1H9M A;  3CCM A;  4U68 A;  5CV9 A;  1P8L A;  4ZKB B;  5D65 A;  3NE5 B;  1GUO A;  3CPW A;  1BBW A;  2EPB A;  3RN2 A;  2XNA C;  4JC0 A;  4FF1 A;  4JI0 Q;  1PXU A;  2MP1 A;  3OMG A;  2IJ0 A;  1OXU A;  2N78 A;  1CFM A;  2E2J B;  5FOB B;  4R1J A;  1TWG B;  1AN8 A;  1F9R A;  2A73 B;  3S15 B;  3GTM H;  5L37 A;  1GUG A;  2A6E C;  4X62 Q;  1A0I A;  2IX3 A;  2N88 A;  3H0G B;  3NWS A;  5AJ3 L;  2AHO B;  1KNA A;  1QB5 D;  4Y7N H;  3NTH A;  4UAI A;  5E1F A;  4K5V A;  3QOJ A;  1GHK A;  3S2H B;  1DZ1 A;  2QDL A;  5C0X I;  1XNQ Q;  2L5T A;  4UP7 A;  4DGZ A;  3T1Y L;  2IWH A;  1NUC A;  1SE3 A;  1YNN C;  1DJR D;  3DWQ A;  5K36 G;  3H94 A;  4KKU A;  3TP5 A;  1SNP A;  3FKI H;  4QUC A;  2IW3 A;  4NW2 A;  5CMD A;  4IPG A;  1FD7 D;  1TWC B;  1EQT A;  2I07 B;  4EQN A;  5K36 H;  3FVQ A;  4E6I A;  2L15 A;  2BDO A;  4OIK A;  2NYZ D;  4X3S A;  1KRT A;  3PQI A;  4QY7 A;  1GHJ A;  4DV0 L;  1AEX A;  4CDC C;  4CDF C;  1N32 L;  4R8I A;  3E9H A;  5J1Z A;  3U9S A;  1SNQ A;  4A3M B;  2KUM A;  2Y0S E;  1XYI A;  4N9T A;  1BCP D;  1U0L A;  2MO1 A;  3OTO L;  3CQZ H;  1KAA A;  3K7U C;  4HR7 B;  4R4O A;  3GTQ B;  2YTV A;  1SYF A;  4RKB A;  4DR1 L;  1E22 A;  2WB1 B;  1N32 Q;  4A3E G;  4Y52 H;  2F0S A;  1PFN A;  5COY A;  4A3K G;  5IYD G;  4A3L H;  1C9O A;  5K5P A;  1A2T A;  2OQK A;  1KNE A;  3TP8 A;  4IAL A;  2B8F A;  4A3E H;  5J39 A;  5IT9 L;  1SE8 A;  2UXC L;  1TS3 A;  4J6H A;  3UE0 A;  3T16 A;  4KI0 A;  2M2L A;  3JAM E;  1IZ6 A;  2FIN B;  1EFI D;  4X64 L;  2RQX A;  3I4M H;  1EOV A;  3K57 A;  4BA1 I;  1G29 1;  3TZU A;  1X3Q A;  4LJZ C;  1UEA B;  2XN9 C;  1N36 L;  2HCC A;  3M4Y A;  3F2C A;  4GLV B;  3E0E A;  2UUC Q;  3W3A A;  1JJ2 A;  3HOX H;  5CYU A;  3EBE A;  1SE2 A;  3SK6 A;  3K5O A;  1IBK Q;  3VYU A;  4K5X A;  1PH2 A;  2D2C C;  3G7L A;  1QOH A;  4EX5 A;  3H09 A;  2JA5 G;  5C4Z A;  3RR5 A;  1XNR Q;  4OO1 I;  4TVA B;  1E2V A;  4X62 L;  1VS0 A;  5IYC H;  3L3O C;  4L5R C;  2K75 A;  1WTH A;  3CCU A;  1FL0 A;  3Q8D A;  5CGK A;  3KDF A;  4TQU S;  3HP3 A;  1IXR A;  1HNW L;  2FMM A;  2MHV A;  5IYB G;  4XDX A;  5I6W A;  3J81 L;  2I0Q A;  3PO2 G;  2NWG A;  1L1O B;  2XRS D;  1FGB D;  2AWN A;  4JV5 L;  5HUR A;  1SYD A;  1UE6 A;  3ERQ A;  1KC8 C;  4DAP A;  4DK6 C;  4A4I A;  1BCP B;  4IUU A;  1FGU A;  4M8A A;  3PIP 3;  1WCM G;  1LTL A;  4ALP A;  4JI1 L;  4HJ7 A;  2CCZ A;  1WCM H;  4U67 3;  1OXX K;  2Q2H A;  1BUV T;  3I73 A;  5FLM G;  3CME A;  4DUZ Q;  2RHQ B;  2R93 G;  1V1O A;  4RGO S;  2L0C A;  1I4X A;  1IHZ A;  2QW7 A;  3MXP A;  1A6X A;  2F0E A;  2DJG C;  1HFN A;  1NMF A;  3BDO A;  3KLS A;  2A69 D;  2Z4H A;  4LFA L;  3M4O H;  4IPC A;  1PZK D;  4APV A;  3GTP H;  2IHF A;  1K8M A;  1D6E C;  3M4Q A;  4L5S A;  4DR2 L;  1XPR A;  4C3I G;  3TQY A;  1JJC B;  2EE1 A;  1U5K A;  1UE1 A;  2Z1C A;  1EY4 A;  2K6A A;  1ROD A;  1I4P A;  2F0J A;  3JAM L;  4KN7 C;  3GTP B;  2HQE A;  1YI2 A;  2RDH A;  1NE3 A;  3KDF B;  3KK7 A;  1VQ5 A;  4DR5 Q;  1KLG D;  2K50 A;  3PF4 A;  3HOY H;  1YBY A;  1Z6H A;  3A56 A;  3F1Z A;  5KEE A;  5JPM C;  1BXT A;  3KBX A;  1KHI A;  4HTH A;  4BBS B;  4K8I A;  2QCP X;  3MXU A;  3STB C;  3HOV G;  1VQI A;  2K5V A;  4OWT B;  4LW1 A;  2E76 C;  3SK8 A;  1HZB A;  1PTO C;  1FR3 A;  4OX9 L;  1EFW A;  3H0G G;  1LTI D;  1X3F A;  5M5W B;  1TWH B;  1N34 Q;  2CW0 D;  1A3U A;  2NVX B;  1BNZ A;  1X3G A;  3HG9 A;  1PZJ D;  3MC0 B;  4IN3 A;  4QMG A;  4CDD C;  5HGQ A;  2RDG A;  3UDG A;  1OXV A;  3CCS A;  3FDT A;  3CAM A;  2R6G A;  2ICI A;  3S1Q B;  3S1M B;  4RFB A;  2AMC B;  3T4A C;  1WTW A;  1ILP A;  2EOT A;  3WWV A;  3ZYY X;  5LMN Q;  1IBM L;  4TKO B;  1N36 Q;  1KDA A;  2K5N A;  1M8A A;  2JN4 A;  1VQM A;  1ASY A;  5M3M B;  4M1U B;  4NXN L;  1YHB A;  2OXP A;  2XTI A;  1CZW A;  3U50 C;  3J81 E;  1J9O A;  1EZ6 A;  1HTP A;  3HFZ B;  3S14 H;  2IY5 B;  4KHV A;  5J3B A;  2B63 B;  3N6R A;  4NP5 A;  3F2B A;  4K0K Q;  4IJH A;  4RGN A;  1Y1V G;  4NXM Q;  5I9P A;  4ABN A;  2HDL A;  1UUP A;  3K59 A;  3D4D A;  2RSO A;  1ZEQ X;  3PGZ A;  1L0W A;  4IUV A;  3KJO A;  1KIX A;  3NUC A;  3H3V H;  4DV7 L;  3ZJY C;  2PZU A;  2F0G A;  3STB D;  1HR0 W;  2PQA A;  1F2Y A;  4OXP A;  2HD3 A;  4F7X A;  2H5X A;  2KOL A;  2SNS A;  4PV1 C;  1VMC A;  2WAQ B;  4C1N I;  3GO5 A;  4JBJ A;  1L2F A;  4HJ9 A;  1XWE A;  2AUK A;  2LFN A;  4MN3 A;  1V1Q A;  1AH9 A;  2ENB A;  3GTK B;  4DNI A;  4KN4 C;  3CC4 A;  5HGT A;  3Q23 A;  4RHR A;  2R61 A;  3K5N A;  4DAM A;  4DN4 M;  1EIG A;  3H3V I;  1G91 A;  3S24 A;  4ME3 A;  2IL8 A;  2QDB A;  2ZM6 L;  4UP9 A;  3PIP A;  3GTG H;  4HMJ A;  1PRT D;  1M90 C;  1VQH A;  4DNR B;  4DAY B;  5EBC A;  4X66 L;  1D1I A;  4FYD A;  3CCE A;  3MTS A;  1XX8 A;  5KRU A;  5IGB A;  1PYB A;  1DON A;  1IL8 A;  3S1R H;  1VQF A;  4B3M Q;  2WB1 G;  5M3M H;  3NBH B;  1F77 A;  2R7Z H;  5CV8 A;  2K52 A;  4RMF A;  1BDO A;  4N8F A;  3L7Z C;  4K14 A;  3NQI A;  1JOQ A;  3SR1 A;  1Y8O B;  3DEP A;  1VQN A;  4GKK Q;  4S3S A;  1TS2 A;  1NBW A;  2WIN B;  1WTP A;  2HHH Q;  4DXF A;  4I7A A;  1VQG A;  3KBG A;  1DOM A;  1VQ7 A;  3U9O A;  1V9P A;  2JP1 A;  2P5Z X;  3EJI A;  1HZ9 A;  2JA8 H;  5FKA C;  3H15 A;  1TWA B;  4FP5 D;  2GA4 B;  2KCM A;  3PUV A;  1HCZ A;  4GOP C;  4FF4 A;  2R92 B;  5LMU L;  1XPU A;  2O5J C;  4JI2 Q;  2Z9H A;  1HRJ A;  2JJQ A;  2CQA A;  2K5D A;  1NAP A;  5EBD A;  2B8G A;  2NVY H;  4OX9 Q;  5I9O A;  3OPO A;  1BKB A;  1RF2 D;  1YZ6 A;  4A3I G;  5M3M G;  3VYT A;  5JAV A;  4A3M G;  3D0F A;  4B3S L;  3GTQ H;  1MD2 D;  2XIW A;  4JPB W;  5FK9 C;  4KK7 A;  4LUZ A;  1VQ6 A;  2V4D A;  1YVC A;  2ZJP A;  1CM9 A;  5M3F G;  2IT1 A;  1XPO A;  1PTO F;  1J5E L;  4DV1 Q;  1U4R A;  2YYZ A;  2JEA I;  4DR7 Q;  1GKH A;  4YY3 Q;  2JA6 B;  2KHJ A;  1IW7 C;  2EZV A;  1SMY C;  1GUT A;  2FFK B;  1C4Q A;  1HZC A;  1Q90 A;  1W6J A;  4JI3 Q;  5GRO A;  2UUB Q;  2ZTC A;  1TII D;  1HNZ Q;  4HAE A;  3NTK A;  4A3B B;  5GAD C;  4QQB X;  1PRT F;  2PNH A;  5IY0 A;  3FPP A;  1MJE A;  4JCV E;  3HOX G;  2PW5 A;  2RF4 A;  2QKI C;  4FXK C;  2NN6 G;  2JA7 H;  2L1B A;  4JYA Q;  3JAM c;  1S5E D;  2M9V A;  3MVV A;  2A69 C;  1EYD A;  4KY5 A;  2GVA A;  5I4D A;  4A3I H;  5M5Y B;  1Q12 A;  4WJ3 M;  3MXN B;  2B2Y C;  2UXC Q;  2LXK A;  2MNA A;  2WKC A;  1R9T B;  3K80 C;  2YU9 B;  1O80 A;  4QIW B;  4KD3 A;  1TKW B;  3HS0 C;  3NEN A;  3HOU B;  2HUG A;  4B9W A;  4YCW A;  1XMO Q;  1C7Y A;  2VL6 A;  4BXX H;  1B3A A;  3OW7 A;  2Q8T A;  1GUW A;  4V19 0;  2BCO A;  1A3V A;  1EUJ A;  2MJ8 A;  3A8K E;  3E9I A;  2QEX A;  1VCI A;  1JOO A;  1O7L A;  5GQO A;  2ID0 A;  3X3M A;  1LO5 D;  5EJW A;  1GUS A;  4C3J B;  3M85 A;  1UAP A;  2YTY A;  4PG3 A;  5JEA G;  3MEF A;  4A3G H;  3NEM A;  4R8N A;  2ZJR A;  2NTT A;  3AB9 A;  1PDQ A;  1BBX C;  4LFB Q;  4A3K H;  1BQQ T;  2K4K A;  3HOZ B;  2CQO A;  1SMY D;  2KJX A;  3CP0 A;  3LWU A;  5FO8 B;  1EOT A;  3IKJ A;  2IHE A;  2ZXO A;  1JWM D;  1ILQ A;  3G4S A;  3A8J E;  1UEB A;  4P2C B;  4JI0 L;  4XYQ A;  3C2P A;  2PZW A;  2ZJQ A;  1DYQ A;  2O4X A;  1H9R A;  3MXN A;  5JJK A;  3R8B A;  1ASZ A;  3FP9 A;  3T56 B;  3SK5 A;  2Z8L A;  4BY7 B;  4XQQ A;  3CCL A;  3H91 A;  4A93 B;  1TVX A;  3RZD B;  4IPD A;  1XJV A;  5C44 G;  1SR3 A;  3SGI A;  1S5C D;  3OHX C;  4QCL A;  4RWS C;  4X65 Q;  1VQJ A;  1QCB D;  1RL2 A;  4F88 A;  2G9D A;  1UE5 A;  4LF6 L;  3U4Z A;  2ZTD A;  1EEI D;  3QOL A;  3HRZ C;  4L5Q A;  3OIP A;  4GKK L;  1I3Q H;  4C3J G;  1BCP C;  1G51 A;  4EVO A;  1PYW D;  3MFY A;  1DGS A;  1RHP A;  4HIM A;  4H13 C;  4JI2 L;  1J5E Q;  2F4V L;  4DV1 L;  1EYA A;  1E2W A;  4DR7 L;  3DUZ A;  4UDU C;  3IRB A;  3K81 C;  5ISR A;  3HGB A;  4XXE A;  5M5W H;  3GV6 A;  1BVS A;  3GP7 A;  2BH2 A;  1RCV D;  2K1B A;  2JA6 H;  2DNC A;  4BY1 G;  1FYC A;  1BF4 A;  3S2D H;  2PQE A;  4HIK A;  1SRU A;  2JYO A;  1L1O A;  1NTG A;  2A68 D;  2N49 A;  3CD6 A;  1X65 A;  1B9M A;  4LF9 Q;  2Z6K A;  4G57 A;  1WYD A;  5G3L D;  1LT6 D;  5LMN W;  2E5L Q;  2NVY B;  1I4G A;  1K73 C;  2F0P A;  2JA6 G;  1XTD A;  1E1T A;  1YNX A;  5A35 A;  4AIM A;  2K5H A;  3AFQ A;  2JA5 B;  5IGG A;  4R4Q A;  1EY9 A;  1Y8N B;  1B44 D;  1B70 B;  1STA A;  2JA8 G;  1PH8 A;  2Z4I A;  3V96 A;  1XMO L;  5EQ0 A;  4GKJ Q;  4JI5 Q;  4JVZ A;  2KA7 A;  1RJT A;  3QWN A;  4OO1 G;  3CCV A;  4PQX A;  1TY2 A;  4G7H C;  1N33 Q;  3CQZ B;  1QVG A;  4QGU A;  2ZT9 C;  2PMZ E;  1STB A;  3CU7 A;  5J22 A;  1A15 A;  4DAV A;  4Z9C B;  2A8V A;  5CV6 A;  4NXN Q;  3A0J A;  1I50 B;  2KBN A;  4CJ1 B;  2HT1 A;  1G2T A;  3I4M G;  5C5M A;  2JQO A;  4OHJ A;  2AQ1 B;  2Y0S B;  2KEN A;  2SOB A;  3BVZ A;  3WOE A;  1Q86 C;  1K0S A;  3A55 A;  3NEL A;  4K5W A;  4IPH A;  3T53 B;  5C4H A;  2K7V A;  3L9A X;  2PPB C;  2B2V A;  1C48 A;  1EEF D;  3I4O A;  1LT3 D;  3FEW X;  2F3I A;  5JPN C;  1SE4 A;  1EL0 A;  1ET6 A;  2B3G A;  4RG1 A;  3QB3 A;  4EGV A;  2K28 A;  4FVM A;  4ZYS A;  2F0K A;  1EIY B;  3GTG B;  1LTT D;  1MBY A;  3KLS X;  1LM0 A;  2B2Y A;  3KLW A;  3BYT B;  2F0Q A;  1SDF A;  1EYG A;  4PMB A;  1Z47 A;  1SYE A;  2IPK D;  3G48 A;  4FO2 A;  2PMZ B;  4ZAI A;  2K01 A;  5EKK A;  3D6C A;  2E2H B;  4DPG A;  3S1M H;  3JAM i;  3CW2 C;  2HHH L;  4DR2 Q;  1WI5 A;  3MWY W;  1KAB A;  3HZX A;  1EU4 A;  4L5T A;  1I4Q A;  1EY7 A;  2GN5 A;  1XNQ L;  2WKD A;  4DFA A;  4H02 A;  1EZ8 A;  4ZK9 B;  2F0F A;  3T1Y Q;  2B2V C;  4RAU C;  4AYB E;  1ZYR D;  4P75 A;  2QA4 A;  4BY1 H;  2ZXP A;  4C2M H;  5DM6 3;  1MSH A;  4FF2 A;  5G3L F;  1IYJ B;  2F1M A;  4GN3 B;  4BY7 G;  4Q5V A;  2DN8 A;  1HUN A;  1FJG L;  2HQL A;  2JA9 A;  1II3 A;  3TBI B;  1J6Q A;  1QUQ A;  1I50 H;  4R9W A;  1G8Z D;  2F4I A;  1LUZ A;  3I7F A;  4IJL A;  4QJF A;  3OW2 A;  3HOZ H;  4YCU A;  1NCV A;  1PYS B;  3M7G A;  1CQF A;  1CSQ A;  4LMQ D;  2KEC A;  3KF6 A;  5JVG 3;  4K8J A;  2UXB L;  5EPL A;  1ESF A;  2HCI A;  5IOD A;  1BCP F;  1EIF A;  1HZA A;  2J7Z A;  2NN6 H;  4PZ8 A;  1RTO A;  4A93 H;  3R3O A;  3CKI B;  2PZT A;  1I6H H;  4AYB B;  5FO7 B;  2QIL A;  4LUV A;  4LAA A;  4DV2 Q;  2D0P A;  1CQV A;  2F3W A;  5TSS A;  4DV6 Q;  2EXZ A;  1HNX L;  3Q22 A;  1CK1 A;  1WTR A;  3S15 H;  3DXJ C;  1Q1E A;  1YHQ A;  1Y1W G;  1U4L A;  2Y0S G;  2MO0 A;  1RTN A;  3K0X A;  3PF5 A;  3EN2 A;  4RCN A;  5FLX E;  2WFW A;  4LF4 L;  4CJ0 B;  4GNX B;  4POF A;  4P74 A;  3PUX A;  2TMP A;  4DV2 L;  3TSS A;  1RKN A;  3D31 A;  4XTC S;  1UE7 A;  1XMQ L;  1YHA A;  4G4K A;  4B08 A;  4A3M H;  1K8G A;  5IGC A;  2XRQ D;  3AEV A;  2JK8 A;  2EDG A;  4QL5 A;  2LSS A;  3DWP A;  3TP7 A;  4DNT B;  3I55 A;  5GAH C;  1X3E A;  5CV5 A;  2HIV A;  4GKJ L;  3IAY A;  1P16 A;  5IP7 H;  4DV7 Q;  3J7A V;  3GTO H;  1CKO A;  5M9O A;  3L0O A;  2OTJ A;  3LX0 A;  4BBR G;  4DV4 L;  2NVT H;  3A74 A;  1Q81 C;  4NXM L;  1D5M C;  4ZUJ A;  4CHT B;  5E4W C;  2F0I A;  3PCO B;  5M5Y H;  1J8I A;  1ESR A;  2EJM A;  1ICF B;  1PFS A;  3SE0 A;  5F2D A;  3HOU H;  1MI2 A;  3OSO A;  1QZG A;  1IBK L;  1SNO A;  3J81 c;  4IOC A;  1ML0 D;  2Z6B A;  1NNX A;  1VF5 C;  3NSW A;  2BE5 C;  3UE1 A;  3I4M B;  1EY5 A;  4IUP A;  4IFD H;  4WJ4 A;  2B2T C;  1EU3 A;  3RLF A;  3DM1 A;  3J80 L;  2R7Z G;  1X54 A;  1FVI A;  3D4R A;  4OO1 H;  2AUJ D;  3RNU A;  1PZI D;  3P75 A;  1X3P A;  1L0X B;  5CV4 A;  4HJA A;  5LL6 S;  2KQ3 A;  2K05 A;  4DV0 Q;  1K3R A;  2MGS A;  4FF3 A;  1GD7 A;  2FMC A;  3RZO H;  1JWS D;  1H9J A;  3PUW A;  4DR4 Q;  3VYR A;  1SXT A;  1UNS A;  1D7Q A;  5EPJ A;  5EPK A;  1QG7 A;  1WVL A;  4HJ8 A;  4GOP B;  4C3H B;  1SN8 A;  1HTL D;  3S9W A;  1VMP A;  4H7B A;  2X6G A;  4MHE A;  1STY A;  5T1I A;  5JVH 3;  2K04 A;  4CGY B;  2QEJ C;  4K6D A;  2J0T D;  1S4Z A;  1KRS A;  5IP9 H;  2H4O A;  3PO2 B;  4RA8 A;  2R92 H;  3BDC A;  5KIX A;  2I5L X;  4J1M A;  1IYU A;  5ELB A;  3NQT A;  3AMU A;  3NTI A;  4YY3 L;  2VQE Q;  2ES2 A;  4L63 B;  3T1H L;  1B2T A;  3I4N B;  3KJP A;  5BN3 A;  1Y1W B;  3A54 A;  3CPF A;  3RUZ A;  1VQO A;  1CA6 A;  1VQC A;  2C35 B;  1LYL A;  3TN2 A;  3R2I A;  4ODG A;  4B3S Q;  1WD0 A;  2DNE A;  2MUY A;  2R93 B;  2E2I B;  3M4P A;  4MTN A;  2JEB I;  3M4O B;  1SRO A;  4RGM A;  3P1H A;  4GNX A;  3T1H Q;  3IL8 A;  1LLR D;  2KCN A;  2YTX A;  4NKL A; 
#chains in the Genus database with same CATH homology
 2I46 A;  3PV0 A;  1IW7 D;  3RZO B;  1SNM A;  1SAP A;  1A3T A;  2PYK A;  4Y7N B;  2KED A;  1WD1 A;  1B4O A;  4BBR B;  1TWF B;  5KNB A;  1B1Z A;  1ENF A;  4I65 A;  4IZ8 A;  1GXD C;  3OIQ A;  1LTS D;  2F3V A;  4EQP A;  4RH6 A;  1SYG A;  2EJG C;  2AQ3 B;  3MEH A;  3KLR A;  1NR2 A;  3E6Z X;  1SSO A;  1KLU D;  1HXY D;  1M4V A;  3HOX B;  1PTO H;  2F0T A;  3IFD A;  2PCF B;  2VUM B;  1SNC A;  4G7O C;  3KUP A;  5CV7 A;  5C3E B;  2E75 C;  5CR3 A;  1STE A;  1R4P B;  1O78 A;  3I90 A;  4IUQ A;  3QO2 A;  5C3W A;  4BA2 I;  4C1N K;  1H9S A;  1EWC A;  4IUT A;  5KNC A;  2VB2 X;  5ELF A;  1PRT B;  1AZP A;  2AWO A;  3J80 E;  4PMC A;  4WRD A;  1G2S A;  2JA7 B;  1E2Z A;  1AP0 A;  1V1P B;  3BVG A;  3N52 A;  4ZRZ A;  1JWU D;  5ELC A;  1C8C A;  4QUF A;  4V0B A;  3BG3 A;  5D3D A;  5C3X A;  1IKM A;  4C2M B;  1B50 A;  4X3K A;  3NK9 A;  1B9N A;  1D5Z C;  2JSO A;  5I2X A;  3PIO 3;  3MXG A;  2BA0 A;  4J8Q A;  4IFD G;  3C3L A;  4KD4 A;  3CRL C;  1DM0 B;  1YNJ C;  2XVS A;  1TS4 A;  4QB4 A;  5D14 A;  3S2D B;  4PNY A;  3WDN A;  3K5L A;  1F9P A;  4XYO A;  5C6A A;  4KKS A;  4ID6 A;  5I6Y A;  4H44 C;  4BS9 A;  1HQR D;  1I6H B;  1SJE D;  2B2W C;  1TR5 A;  1PTO D;  2X6L A;  1FNU A;  1LTA D;  4CKE A;  1ENC A;  2BE5 D;  1DOL A;  2K33 A;  3T13 A;  2EYP A;  3VR3 A;  3SXH A;  3A7A B;  1S5F D;  3NP8 A;  2FHT A;  2WP8 J;  2EY2 A;  1ICW A;  4O42 A;  1A2U A;  2ZXR A;  3O13 A;  2DY7 A;  4IUR A;  2G9H D;  1ZYR C;  5EGT A;  1STH A;  1CT1 D;  1JC7 A;  5BN5 A;  2O2L D;  2XSC A;  1BR9 A;  3X3N A;  3S16 B;  4ZQ3 A;  3I72 A;  4DAY A;  1EQV A;  3A8I E;  1TQO A;  2R3Z A;  4I7Z C;  4WOR A;  4ZLT F;  1WTX A;  1U9R A;  4IUN A;  1STN A;  4OL7 A;  4ZKC B;  5IGF A;  3LWE A;  3T51 B;  3EFX D;  3G6J B;  3MFG A;  1I4H A;  3TDQ A;  3I8Z A;  3CRK C;  1PFB A;  3BDL A;  1Q1B A;  2NTS A;  2L12 A;  3TME A;  3S14 B;  1D2B A;  4ZUI A;  1HA6 A;  4A3F B;  2F0W A;  4H0L C;  4O1N A;  3SHL A;  1LAC A;  2Q8R E;  2K32 A;  1YNN D;  1DXM A;  3R2T A;  3PUZ A;  2VXW A;  1EY8 A;  1NSN S;  4YIJ A;  4A3E B;  1LTR D;  3S17 B;  4KY7 A;  4LK1 C;  1GUN A;  4C3H G;  2CW0 C;  1JE4 A;  2A68 C;  3E5S A;  2B2W A;  3M7N A;  4XQN A;  4PMW A;  2EY6 A;  2C9O A;  4EQO A;  3GTJ B;  2EYL A;  1HPC A;  3BYY B;  3S1N B;  2J4X A;  1JQY D;  1F2L A;  5ELD A;  2XWJ B;  1CHP D;  3EVQ A;  2AQ2 B;  3GTM B;  2LMC B;  1VDZ A;  2KVM A;  3C46 A;  1G6Z A;  1DOK A;  3I91 A;  1I3Q B;  3FMC A;  4RKL A;  1PLF A;  3GV3 A;  1LT4 D;  3AU7 A;  1HFG A;  3NPP A;  1S5B D;  5CC4 A;  1K83 B;  3LNN A;  1SFO B;  2HDM A;  1OXS C;  1STG A;  2F0M A;  4XQJ A;  4BY1 B;  1XTC D;  2MPM A;  1QWY A;  2OEO A;  3Q6S A;  2EY5 A;  1WTV A;  1I6V C;  3HKZ B;  4K6L A;  2D5D A;  3J7A F;  2VNU D;  3K5M A;  3E0J A;  3PMF A;  3ONA B;  4WFN 3;  4KKT A;  3VYS A;  1WCM B;  3D3R A;  1TU2 B;  3WOF A;  5IGD A;  2EJF C;  1TY0 A;  2JA8 B;  2F0V A;  3BZD B;  3OWE B;  1PFM A;  2A74 C;  2RKS A;  4KHZ A;  4HSV A;  1AZQ A;  3K58 A;  3ND9 A;  1Q8I A;  1PRT C;  1EWH A;  1U4M A;  2RDF A;  4HCE A;  1DCZ A;  4L6T B;  4MIU A;  5E4X A;  5ELE A;  4C56 C;  2NB0 A;  2NZ1 D;  5LL6 X;  3FRP B;  5C0X J;  4GZY C;  5JJZ A;  5I2Y A;  2BDN A;  4F8M A;  4DK0 A;  3SEB A;  4KV6 A;  5IIF A;  1H9K A;  4NMZ A;  2LY7 A;  2F03 A;  4DA2 A;  4ILW A;  2WV6 D;  3CHB D;  1FNW A;  2F0L A;  5LHY 1;  3EA6 A;  3TP6 A;  4ME5 A;  2JE6 I;  2SEB D;  5CBA E;  3D8G A;  3ERO A;  3NXW A;  3URY A;  1F2Z A;  5COR A;  5JEA J;  1WTO A;  3HEJ A;  3MHB A;  4RHS A;  4X3U A;  4L8J A;  1H9S B;  2IX1 A;  3I70 A;  1PTO B;  3NBI A;  2EVB A;  1JB3 A;  3MZ5 A;  2RA4 A;  3K6O A;  3DEO A;  3VR5 A;  2D62 A;  1ZXT A;  2B2T A;  2EYF A;  2B2U A;  4KY6 A;  1MSG A;  1OXT A;  1SJH D;  2X69 A;  4IQZ A;  3P7J A;  1S5D D;  4K2L A;  2ICE C;  3VR6 A;  1JR0 D;  5KGU A;  4HCS A;  2EYH A;  1KDB A;  2OT2 A;  3MA2 B;  1U4P A;  1F2M A;  1O7Y A;  1EYC A;  1B53 A;  2OF1 A;  3KF8 A;  3QIA A;  2NN6 I;  4HED A;  3RD4 A;  3V2T A;  2L55 A;  1NR4 A;  1GOZ A;  4HSP A;  2VB3 X;  3H3V C;  5AFW A;  1KDC A;  3A7L A;  1T5E A;  4TRD A;  2FJ2 A;  1IYV A;  4CJ2 C;  5KND A;  5M5X B;  3IFT A;  2F0H A;  1Y69 U;  3OMC A;  1QE6 A;  3VR4 A;  1MGS A;  2D9U A;  2B39 A;  1R4Q B;  3PO3 B;  2R7Z B;  2EYM A;  3Q0A A;  1JOK A;  4FXD A;  2K03 A;  4XT3 B;  1CI3 M;  3UI2 A;  3K7A B;  4JK1 C;  3BS1 A;  5JEA H;  2RBM A;  1F9S A;  4FNF A;  3GTO B;  2RVL A;  1LT5 D;  2L11 A;  5FLX L;  1V1P A;  1XXG A;  4NDX A;  5DEH A;  3VA5 A;  5KYL A;  5FO9 B;  3MAQ A;  1HHV A;  4Q0F A;  4XIG S;  3K0Y A;  2BA1 A;  1FNV A;  3NBH A;  4KJN A;  2NVT B;  4KJO A;  3H6M A;  2SDF A;  1E0B A;  1V43 A;  5C0X G;  2F0O A;  2E2D C;  2H1E A;  5T1G A;  2NBF A;  4HMI A;  1SYC A;  1HUM A;  2N55 A;  2PO4 A;  1EIH A;  1HA5 A;  3C1F A;  3DWA A;  2WAC A;  1SEB D;  4DXG A;  2EYJ A;  3D4W A;  1RDP D;  1F9Q A;  3NHH A;  5A2Q L;  3HOY B;  2A6E D;  4KMU C;  1CA5 A;  5NUC A;  1D1K A;  4A3D B;  2K5W A;  3TZD A;  1CHQ D;  5C4X B;  2NVQ B;  2NUC A;  2A5H A;  2O5I C;  2EY1 A;  3HOV B;  1I4R A;  3J7Y W;  1Z7T A;  5C4J B;  4OGQ C;  2L4N A;  1TS5 A;  1BOS A;  3HOW B;  4JBW A;  3QG1 A;  1HQM C;  2B2U C;  4HN7 A;  1VF7 A;  1LTB D;  4N9P A;  1Y1V B;  3S1R B;  5DAU A;  2PNR C;  1WTQ A;  4CKB A;  2CVR A;  4FXG C;  1OO9 B;  3P20 A;  4TSS A;  5CBE E;  2A6H D;  2F0N A;  3DMU A;  3SVM A;  4XT1 B;  3VA7 A;  3NWT A;  1QIL A;  1X32 A;  5DNF A;  1JOR A;  4K2K A;  2M00 A;  4A3G B;  4X3T A;  1CTM A;  2QF7 A;  2SNM A;  3FKI B;  2L9H A;  4DF7 A;  2JXM B;  1ZKO A;  1SYB A;  5EKL A;  3FPU B;  2KEE A;  1D5X C;  2EYO A;  2PW7 A;  4CKC A;  2KHS A;  5C44 B;  5EKI A;  1Q3L A;  3ND8 A;  1RD9 D;  2DY8 A;  1BO0 A;  5E3F A;  5IGE A;  2F0D A;  5KYI A;  3Q24 A;  1JCK B;  1O7Z A;  4IFD J;  4KTA A;  3OOC A;  1DD2 A;  5D3I B;  1K8O A;  4BWG B;  3GQB A;  3I3C A;  1LTG D;  4RGT A;  4C3I B;  4DU9 A;  4WJW A;  3SK4 A;  4A3J B;  3DHQ A;  4B9X A;  2CHB D;  1Y8P B;  4CBV A;  4F87 A;  1GJX A;  2TSS A;  1ONL A;  2A6H C;  1YNJ D;  4IFD I;  3M3Y B;  4G7Z C;  1KTK A;  5DM7 3;  1TT2 A;  2C5C A;  3C1E A;  2WII B;  1L0Y B;  2Q8I B;  2RSN A;  4A3I B;  2LS0 1;  1EY6 A;  1AFP A;  1AW7 A;  1SND A;  2IX0 A;  5M3F B;  5C5L A;  1W6K A;  2LKV A;  3SDZ A;  1JIC A;  3W2D A;  2K5Q A;  3PUY A;  4RCO A;  3R93 A;  2E74 C;  1EY0 A;  4ULL A;  3I4L A;  3GD7 A;  1SBB B;  3QJY A;  1LAB A;  5JOB A;  5IT9 E;  3V05 A;  4OIJ A;  2BOS A;  5BN4 A;  1T5X D;  1QNU A;  1ET9 A;  3VR2 A;  5C0X H;  1PMR A;  4A3K B;  1V8Q A;  3GTL B;  3BVM A;  5A2Q E;  3EQL C;  4QF4 A;  3ITP A;  1LV9 A;  5IOC A;  1IKL A;  3RMH A;  3OWF A;  1QJO A;  2XWB B;  3F2U A;  1CZG A;  1ENA A;  4DK1 A;  2KCC A;  3D6W A;  1QNK A;  2F0U A;  1H9M A;  4U68 A;  5CV9 A;  4ZKB B;  5D65 A;  3NE5 B;  1GUO A;  2EPB A;  2XNA C;  4FF1 A;  1PXU A;  2MP1 A;  3OMG A;  2IJ0 A;  1OXU A;  1CFM A;  2E2J B;  5FOB B;  1TWG B;  1AN8 A;  1F9R A;  2A73 B;  3S15 B;  1GUG A;  2A6E C;  2IX3 A;  2N88 A;  3H0G B;  3NWS A;  1KNA A;  1QB5 D;  3NTH A;  4UAI A;  5E1F A;  4K5V A;  3QOJ A;  1GHK A;  3S2H B;  1DZ1 A;  5C0X I;  2L5T A;  4DGZ A;  2IWH A;  1NUC A;  1SE3 A;  1YNN C;  1DJR D;  3DWQ A;  5K36 G;  3H94 A;  4KKU A;  3TP5 A;  1SNP A;  4QUC A;  2IW3 A;  4NW2 A;  5CMD A;  1FD7 D;  1TWC B;  1EQT A;  2I07 B;  4EQN A;  5K36 H;  3FVQ A;  4E6I A;  2BDO A;  4OIK A;  2NYZ D;  4X3S A;  1GHJ A;  1AEX A;  4R8I A;  5J1Z A;  3U9S A;  1SNQ A;  4A3M B;  2KUM A;  1XYI A;  4N9T A;  1BCP D;  1KAA A;  4HR7 B;  3GTQ B;  1SYF A;  4RKB A;  2WB1 B;  2F0S A;  1PFN A;  5COY A;  5K5P A;  1A2T A;  1KNE A;  3TP8 A;  4IAL A;  2B8F A;  5J39 A;  5IT9 L;  1TS3 A;  4J6H A;  3T16 A;  4KI0 A;  2M2L A;  3JAM E;  2FIN B;  1EFI D;  2RQX A;  3K57 A;  4BA1 I;  1G29 1;  3TZU A;  1X3Q A;  4LJZ C;  1UEA B;  2XN9 C;  2HCC A;  3M4Y A;  3W3A A;  5CYU A;  1SE2 A;  3SK6 A;  3K5O A;  3VYU A;  4K5X A;  2D2C C;  3G7L A;  1QOH A;  3H09 A;  5C4Z A;  4OO1 I;  1E2V A;  3L3O C;  5CGK A;  4TQU S;  3HP3 A;  2FMM A;  2MHV A;  4XDX A;  5I6W A;  3J81 L;  2NWG A;  2XRS D;  1FGB D;  2AWN A;  5HUR A;  1SYD A;  3ERQ A;  4DAP A;  1BCP B;  4IUU A;  4M8A A;  3PIP 3;  4U67 3;  1OXX K;  1BUV T;  3I73 A;  1V1O A;  4RGO S;  2L0C A;  1I4X A;  1IHZ A;  3MXP A;  1A6X A;  2F0E A;  1HFN A;  3KLS A;  3BDO A;  2A69 D;  2Z4H A;  1PZK D;  1K8M A;  1D6E C;  4C3I G;  2EE1 A;  2Z1C A;  1EY4 A;  2K6A A;  1ROD A;  1I4P A;  2F0J A;  3JAM L;  4KN7 C;  3GTP B;  2HQE A;  2RDH A;  3KK7 A;  1KLG D;  1Z6H A;  3A56 A;  5KEE A;  5JPM C;  1BXT A;  3KBX A;  4HTH A;  4BBS B;  4K8I A;  2QCP X;  3MXU A;  2E76 C;  3SK8 A;  1PTO C;  1FR3 A;  5M5W B;  1LTI D;  1TWH B;  2CW0 D;  1A3U A;  2NVX B;  1BNZ A;  3HG9 A;  1PZJ D;  3MC0 B;  4IN3 A;  4QMG A;  2RDG A;  1OXV A;  3FDT A;  2R6G A;  2ICI A;  3S1Q B;  3S1M B;  4RFB A;  3T4A C;  1WTW A;  1ILP A;  2EOT A;  3ZYY X;  4TKO B;  1KDA A;  1M8A A;  5M3M B;  4M1U B;  2OXP A;  1CZW A;  3J81 E;  1J9O A;  1EZ6 A;  1HTP A;  4KHV A;  2B63 B;  3N6R A;  4NP5 A;  4RGN A;  5I9P A;  4ABN A;  2HDL A;  1UUP A;  3K59 A;  3D4D A;  2RSO A;  1ZEQ X;  4IUV A;  3NUC A;  2PZU A;  2F0G A;  1F2Y A;  4F7X A;  2KOL A;  2SNS A;  4PV1 C;  1VMC A;  2WAQ B;  4C1N I;  3GO5 A;  1XWE A;  2AUK A;  2LFN A;  4MN3 A;  2ENB A;  3GTK B;  4KN4 C;  5HGT A;  3Q23 A;  4RHR A;  2R61 A;  3K5N A;  4DN4 M;  1EIG A;  1G91 A;  2IL8 A;  2QDB A;  4HMJ A;  1PRT D;  4DNR B;  5EBC A;  1D1I A;  4FYD A;  3MTS A;  1XX8 A;  5KRU A;  5IGB A;  1DON A;  1IL8 A;  1F77 A;  5CV8 A;  1BDO A;  3L7Z C;  4K14 A;  3NQI A;  1JOQ A;  3SR1 A;  1Y8O B;  3DEP A;  4S3S A;  1TS2 A;  2WIN B;  1WTP A;  4DXF A;  3KBG A;  1DOM A;  3U9O A;  2JP1 A;  3EJI A;  5FKA C;  1TWA B;  4FP5 D;  2GA4 B;  3PUV A;  1HCZ A;  4FF4 A;  2R92 B;  2O5J C;  1HRJ A;  2K5D A;  2CQA A;  5EBD A;  1NAP A;  2B8G A;  5I9O A;  3OPO A;  1RF2 D;  3VYT A;  5JAV A;  1MD2 D;  2XIW A;  5FK9 C;  4KK7 A;  2V4D A;  1CM9 A;  2IT1 A;  1PTO F;  1U4R A;  2YYZ A;  2JEA I;  2JA6 B;  1IW7 C;  2EZV A;  1SMY C;  1GUT A;  2FFK B;  1C4Q A;  1Q90 A;  1W6J A;  1TII D;  4HAE A;  3NTK A;  4A3B B;  1PRT F;  3FPP A;  2PW5 A;  2QKI C;  4FXK C;  2NN6 G;  2L1B A;  1S5E D;  2M9V A;  3MVV A;  2A69 C;  1EYD A;  4KY5 A;  5I4D A;  5M5Y B;  1Q12 A;  2B2Y C;  2WKC A;  1R9T B;  2YU9 B;  1O80 A;  4QIW B;  4KD3 A;  1TKW B;  3HS0 C;  3HOU B;  2HUG A;  4B9W A;  1B3A A;  3OW7 A;  2Q8T A;  1GUW A;  4V19 0;  2BCO A;  1A3V A;  2MJ8 A;  3A8K E;  1VCI A;  1JOO A;  1O7L A;  2ID0 A;  3X3M A;  1LO5 D;  5EJW A;  1GUS A;  4C3J B;  3M85 A;  1UAP A;  5JEA G;  4R8N A;  2NTT A;  3AB9 A;  1PDQ A;  1BBX C;  1BQQ T;  3HOZ B;  1SMY D;  2KJX A;  3LWU A;  5FO8 B;  1EOT A;  3IKJ A;  2ZXO A;  1JWM D;  1ILQ A;  3A8J E;  4P2C B;  4XYQ A;  3C2P A;  2PZW A;  1DYQ A;  2O4X A;  1H9R A;  3MXN A;  3R8B A;  3T56 B;  3SK5 A;  2Z8L A;  4BY7 B;  4XQQ A;  3H91 A;  4A93 B;  1TVX A;  3RZD B;  1S5C D;  3OHX C;  4QCL A;  4RWS C;  1QCB D;  4F88 A;  2G9D A;  1EEI D;  3QOL A;  3HRZ C;  3OIP A;  4C3J G;  1BCP C;  4EVO A;  1PYW D;  3MFY A;  1RHP A;  4H13 C;  1EYA A;  1E2W A;  3DUZ A;  4UDU C;  5ISR A;  3HGB A;  4XXE A;  3GV6 A;  3GP7 A;  1RCV D;  2K1B A;  2DNC A;  1FYC A;  1BF4 A;  2PQE A;  2JYO A;  2A68 D;  1B9M A;  4G57 A;  5G3L D;  1LT6 D;  2NVY B;  1I4G A;  2F0P A;  5A35 A;  2JA5 B;  5IGG A;  1EY9 A;  1Y8N B;  1B44 D;  1STA A;  2Z4I A;  3V96 A;  5EQ0 A;  2KA7 A;  1RJT A;  3QWN A;  4OO1 G;  4PQX A;  1TY2 A;  4G7H C;  3CQZ B;  2ZT9 C;  1STB A;  3CU7 A;  5J22 A;  1A15 A;  4DAV A;  4Z9C B;  5CV6 A;  1I50 B;  4CJ1 B;  1G2T A;  5C5M A;  4OHJ A;  2AQ1 B;  2Y0S B;  2SOB A;  3BVZ A;  3WOE A;  3A55 A;  4K5W A;  3T53 B;  5C4H A;  2K7V A;  3L9A X;  2PPB C;  2B2V A;  1C48 A;  1EEF D;  1LT3 D;  3FEW X;  5JPN C;  1SE4 A;  1EL0 A;  1ET6 A;  3QB3 A;  4EGV A;  2K28 A;  4FVM A;  4ZYS A;  2F0K A;  3GTG B;  1LTT D;  1MBY A;  3KLS X;  2B2Y A;  3BYT B;  2F0Q A;  1SDF A;  4PMB A;  1Z47 A;  1SYE A;  2IPK D;  4FO2 A;  2PMZ B;  4ZAI A;  2K01 A;  5EKK A;  3D6C A;  2E2H B;  3MWY W;  1KAB A;  3HZX A;  1EU4 A;  1I4Q A;  1EY7 A;  2WKD A;  4DFA A;  1EZ8 A;  4ZK9 B;  2F0F A;  2B2V C;  4RAU C;  1ZYR D;  2ZXP A;  5DM6 3;  1MSH A;  4FF2 A;  5G3L F;  2F1M A;  4Q5V A;  2DN8 A;  1HUN A;  1II3 A;  3TBI B;  4R9W A;  1G8Z D;  2F4I A;  1NCV A;  3M7G A;  1CQF A;  4LMQ D;  2KEC A;  5JVG 3;  4K8J A;  5EPL A;  1ESF A;  2HCI A;  5IOD A;  1BCP F;  2NN6 H;  2J7Z A;  1RTO A;  3R3O A;  3CKI B;  2PZT A;  4AYB B;  5FO7 B;  2QIL A;  4LAA A;  1CQV A;  2F3W A;  5TSS A;  2EXZ A;  3Q22 A;  1CK1 A;  1WTR A;  3DXJ C;  1Q1E A;  1U4L A;  1RTN A;  4RCN A;  5FLX E;  4CJ0 B;  3PUX A;  2TMP A;  3TSS A;  1RKN A;  3D31 A;  4XTC S;  4G4K A;  4B08 A;  5IGC A;  2XRQ D;  2EDG A;  3DWP A;  3TP7 A;  4DNT B;  5CV5 A;  3IAY A;  3J7A V;  5M9O A;  3LX0 A;  1D5M C;  4ZUJ A;  4CHT B;  5E4W C;  2F0I A;  1J8I A;  1ESR A;  2EJM A;  3SE0 A;  5F2D A;  1MI2 A;  3OSO A;  1SNO A;  1ML0 D;  1VF5 C;  3NSW A;  2BE5 C;  3I4M B;  1EY5 A;  4IUP A;  4IFD H;  2B2T C;  1EU3 A;  3RLF A;  3DM1 A;  3J80 L;  3D4R A;  4OO1 H;  2AUJ D;  1PZI D;  3P75 A;  1X3P A;  1L0X B;  5CV4 A;  5LL6 S;  2KQ3 A;  2K05 A;  2MGS A;  4FF3 A;  2FMC A;  1JWS D;  1H9J A;  3PUW A;  3VYR A;  1SXT A;  1UNS A;  5EPJ A;  5EPK A;  1QG7 A;  1WVL A;  4C3H B;  1HTL D;  3S9W A;  1VMP A;  4H7B A;  2X6G A;  4MHE A;  1STY A;  5T1I A;  5JVH 3;  2K04 A;  4CGY B;  2QEJ C;  4K6D A;  2J0T D;  1S4Z A;  2H4O A;  3PO2 B;  4RA8 A;  3BDC A;  5KIX A;  4J1M A;  1IYU A;  5ELB A;  3NQT A;  3AMU A;  3NTI A;  4L63 B;  1B2T A;  3I4N B;  5BN3 A;  1Y1W B;  3A54 A;  3RUZ A;  1CA6 A;  3TN2 A;  3R2I A;  4ODG A;  1WD0 A;  2DNE A;  2MUY A;  2R93 B;  2E2I B;  2JEB I;  3M4O B;  4RGM A;  3P1H A;  3IL8 A;  1LLR D;  2KCN A;  4NKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...