3P1HA

Crystal structure of staphylococcal nuclease variant delta+phs v23k/i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTKKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thermonuclease
publication title Pressure unfolding effects of artificial cavities in proteins.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p1hA00
2EYMA 2F0QA 4R8NA 2F0HA 3BDCA 4ZUIA 4KV6A 3C1EA 4HMJA 5C5MA 2F0OA 2EXZA 4ODGA 5HURA 5KRUA 1KABA 4RKBA 3D4WA 1A3UA 1U9RA 3EJIA 3ITPA 3HZXA 4LAAA 3MVVA 1NSNS 4EQPA 3MZ5A 1A2UA 5CGKA 3SK4A 1JOKA 4IZ8A 5EKLA 1SYBA 4DU9A 5CR3A 1EY8A 1AEXA 1TQOA 1SNQA 2WACA 4EQOA 3T13A 4KHVA 5M9OA 5J39A 1EY5A 1EY9A 4WRDA 3DHQA 3HEJA 4K5VA 5EGTA 1ENCA 1A3TA 3PMFA 1EY0A 5CV5A 5E1FA 3ERQA 5KYIA 3S9WA 4PMBA 4K5XA 3QOJA 2EYJA 2EYPA 3OMCA 2RDFA 5EKKA 2KQ3A 2NUCA 5IGBA 5IODA 1JORA 4ZUJA 5C6AA 3T16A 4RKLA 4QMGA 3NUCA 1KDAA 2F0UA 5C3XA 4KD3A 5CV9A 5JOBA 4B9WA 3MXPA 4NKLA 2F0JA 4IUNA 4K2LA 4F7XA 1EY6A 2F0TA 5IIFA 5IGFA 2F0FA 4K6DA 4KY5A 4DF7A 2OEOA 4TRDA 1IHZA 2F3VA 1EY4A 1A2TA 4OL7A 5C4HA 4IALA 2PZTA 3D6CA 5C3WA 2O4XA 2F0EA 2KHSA 3RUZA 3MEHA 1TT2A 2EY5A 4ID6A 1EYCA 1SNCA 1SYCA 4HMIA 2PW5A 1SNPA 5HGTA 3TP5A 2OXPA 5IOCA 3E5SA 5C4ZA 2EY6A 1F2MA 4KY6A 4DFAA 2SNSA 4QF4A 5K5PA 3U9OA 5NUCA 1EZ8A 4KJNA 3SR1A 5J22A 5E3FA 3P75A 1SNOA 5JAVA 5CV6A 3OSOA 2F0GA 4PNYA 3BDLA 5IGDA 1NUCA 2F3WA 3TMEA 4MIUA 3QB3A 4G57A 3SXHA 4K2KA 4EQNA 3NXWA 2F0KA 5DEHA 3H6MA 4NMZA 4I65A 2F0SA 1EYDA 5I6WA 2F0VA 5I6YA 5IGCA 3NP8A 1STGA 4WORA 3NQTA 1KDCA 2EY1A 1TR5A 2F0MA 2HQEA 4K14A 3SK5A 4H7BA 1II3A 1SYDA 4KTAA 5J1ZA 4KJOA 4YIJA 1F2YA 1STBA 5DAUA 3V2TA 5CV7A 2QDBA 3C1FA 5KIXA 2RKSA 2F0NA 1A3VA 2EYHA 2SOBA 4J1MA 3MHBA 1STAA 2PW7A 4F8MA 2PZWA 4ZQ3A 5I9PA 4N9PA 5C5LA 2F0PA 2M00A 4S3SA 1EZ6A 5IGEA 3SK8A 1SYEA 1STHA 2SNMA 3D8GA 4HTHA 4J6HA 4KD4A 2PZUA 2F0IA 4N9TA 1STNA 2LKVA 4PMCA 2F0LA 5CV4A 4B9XA 2F0DA 5KYLA 5ISRA 2F0WA 2RBMA 5F2DA 4ME5A 5I9OA 5KGUA 4K5WA 3LX0A 4EVOA 1SYGA 2ENBA 3DMUA 2OF1A 3EROA 1EQVA 1EYAA 3D4DA 3TP6A 4DGZA 5IGGA 2EYFA 4KY7A 1KDBA 1ENAA 1F2ZA 1STYA 4K8IA 2EYLA 5CV8A 3SK6A 3OWFA 2PYKA 2EY2A 1JOQA 1RKNA 1SNMA 1SYFA 3R3OA 2EYOA 1KAAA 2PQEA 3TP8A 1SNDA 3TP7A 1EY7A 3NK9A 3P1HA 5KEEA 4E6IA 3QOLA 5CC4A 4K8JA 4NDXA 4QB4A 3VA5A 4NP5A 3SHLA 1JOOA 3OMGA 3EVQA 3NHHA
chains in the Genus database with same CATH superfamily
3GTJB 4JI6L 1DOLA 1TWAB 2RVLA 3PUYA 1D1IA 1J5EL 4OEMB 1A3UA 3EJIA 2A74C 3ULJA 4EQPA 2A69D 2N88A 3STBC 4OGQC 3I4OA 1SYBA 2A6ED 4EQOA 4KHVA 3I4MG 1IKMA 1JE5A 3DHQA 2TSSA 4OWWB 2ZJRA 4DR2L 3ERQA 4HIDA 3RZDB 1HZBA 2JA7G 1S72A 1UE7A 3HFZB 5EKKA 4JOIA 3JAMc 3DM1A 4QGUA 3F1ZA 4NXMQ 1EY6A 1GHKA 2YU9H 4HIOA 4X3UA 3MXNA 3E9IA 2K01A 1SYCA 4GN5A 2OXPA 3VYRA 5IWAQ 1VF7A 4JI4L 4O2DA 1EWCA 1HA5A 3FPPA 1S5FD 3SR1A 3URYA 5FJ8H 2DJFC 1X3QA 2K14A 1I4QA 4R4TA 3HOYG 4JPBW 1DZ1A 1CSQA 1UEBA 1FJGL 1FVIA 1LT5D 4KN4C 3KF6B 4A3EH 2P5ZX 4JI8Q 3NP8A 3OIPA 5JVH3 4DV7Q 5FO7B 3OWEB 1NAPA 3K0YA 5AJ3L 2KECA 2NTSA 4KJOA 2VB3X 4A3BH 2VUMG 3OIQA 4TKOB 5DAUA 3JAME 1AP0A 2BOSA 1MGSA 2DUDA 1RF2D 3NBHA 5KIXA 2WV6D 4DXGA 4RHRA 3KBGA 1KNAA 2Z4HA 3IKJA 3PUWA 4KHZA 1I94L 3UE1A 2F52A 4IPGA 1EZ6A 3HGBA 3SDZA 3I4MB 1SYEA 2K32A 3KF8A 3GTKB 2D62A 4WFN3 2UU9L 2NZ1D 1PYSB 4ME5A 5KGUA 3PF5A 3FEWX 3D4DA 3FRPB 2CQAA 4DR3Q 1XTCD 2K5VA 4L5QA 1PTOH 1PH1A 2PQAA 2JA6H 1VF5C 2RSNA 2X69A 4C3JB 4DR6Q 1WCMB 1K8MA 5C4JH 4IJLA 5KEEA 3QO2A 1Q12A 2OT2A 3DWAA 2XNAC 3QR8A 3J81c 2I07B 1PHJA 4LF8L 2ZT9C 3T51B 5C0XH 1RD9D 2BH2A 1CZGA 2RF4A 3RN5A 1E7ZA 4HN7A 3TN2A 3MZ5A 3VYUA 5CGKA 5J3BA 3CC2A 4TVAB 3ULLA 4M1UB 5ELBA 3HEJA 5EGTA 1EY0A 2V4DA 5ELDA 4PMBA 5IGBA 3FDTA 2K52A 1KDAA 3T1HQ 1PH5A 2SDFA 3TZDA 1EYGA 4DK3C 1B9MA 1L2FA 4C1NK 4BXXG 3RR5A 3HOVG 1HNXL 3J81E 1LT3D 2EXDA 3L3OC 2IHEA 1TT2A 1JC7A 1X9NA 1LTID 1VQEA 2OCEA 3R93A 2LSSA 5JEAH 5K5PA 3SVMA 5IP7G 1EZ8A 3I72A 2QILA 3P75A 1VQKA 2J4XA 1YNXA 1L1OA 4A3IG 3JC66 3M7NA 5FLMG 1UNSA 2CQOA 4RCOA 2L12A 4JI3L 1ML0D 3VR5A 4XYQA 2MPMA 1WD0A 5J1ZA 3A54A 5IY0A 4C3HH 3MXUA 4ALPA 2RKSA 1BCPD 1X6OA 2K1BA 1S5ED 1L0XB 3M7GA 1DGSA 3BZDB 4ZLTF 2IL8A 5I9PA 4LF6Q 1Y8OB 4DN4M 4S3SA 1F9RA 5LHY1 2I5HA 4PMWA 5CMDA 3J7A5 1IBKQ 4A3EB 3E3XA 3VYTA 3I4NH 2E2HB 4QIWE 3EROA 1EYAA 5IGGA 4R4CA 3HP3A 3J7YW 3S1RH 2B2VC 1HNWQ 1LTGD 2K4KA 1QE6A 2V1CC 3QG1A 3P1HA 4CJ2C 1OXXK 2ZTDA 3AB9A 4A3MB 1K8AC 4LFCQ 3KJPA 2BDNA 2CVRA 5CBAE 1X32A 1YHBA 2F1MA 4MTKA 4JI6Q 4IFDG 1J8IA 2D0OA 4JYAL 4L63B 1JQYD 4JBMA 1G51A 3WWVA 1J5EQ 2N3SA 4A3IB 3MVVA 3S1NH 3MFGA 3D6WA 5IE8A 3EN2A 1TWGB 2WACA 3T13A 1PTOC 4POFA 4DR2Q 1YNND 2CWAA 2ES2A 1VQ7A 3V96A 4NXNL 2XVSA 3GTMH 2EZVA 1O7IA 1YVCA 1N9WA 2B39A 5C3XA 1VQ9A 4LFAL 2WKCA 1FL0A 2K5WA 5D14A 1BUVT 1EIHA 2F3VA 3TSSA 2B8FA 2QDLA 5EBDA 2EY5A 4X62L 2YYZA 3ZJYC 3F2BA 4IOCA 4IUVA 1O80A 3CCJA 5BR8L 4CBVA 2R7ZH 5E3FA 2F4IA 2E2DC 2IJ0A 1T9HA 1HQRD 4IUQA 1FJGQ 1VQ4A 4C56C 4YY3L 1EIFA 1U5KA 4X3TA 4LF9L 3AEVA 5H1SE 3CQZH 1II3A 5AJ3Q 1QVCA 2DY8A 3K58A 1SFOH 4GS3A 3CCSA 2C5CA 1MKHA 1F9SA 1TU2B 1D8LA 4FF2A 2QCPX 4KD4A 1S4ZA 4HTHA 1XMOL 4N9TA 4LMQD 4GLAC 4DV0Q 2YTVA 4B9XA 1IZ6A 4HSPA 1SN8A 2Y0SB 1TY2A 2UU9Q 5JJZA 2WAQE 1PRTF 1C48A 2NN6I 4UAIA 1E24A 2NVQH 3GTPH 2KEDA 1XYIA 5IYDH 5LMNL 4C3HB 2HCCA 4GNXB 3K59A 1HR0W 2OQ0A 3T56B 3U4VA 4JV5Q 3TP8A 3RD4A 4GNXC 2NB0A 4LK1C 4K8JA 4NDXA 4LW1A 2YV5A 3SHLA 2PCFB 1PYBA 2F0HA 2LXKA 3BDCA 1KRTA 1EQQA 5C0XI 1N34L 1R4QB 5HURA 2GA4B 1HJPA 2F0OA 1IBLL 3I4NB 4DR7Q 1OO9B 1TWCB 3NELA 2L1BA 3ICEA 5EKLA 4CDDC 5GADC 4O42A 1PH2A 1D5ZC 4C1NI 2E2IH 1A6XA 5TSSA 4A4IA 4JI1Q 4C2MH 2E76C 4O0AA 4DUYL 3C46A 2EYJA 1JORA 2KQ3A 1NNXA 4JW0A 3H0GG 1SLJA 1D5XC 2XGTA 1YHAA 3SEBA 2BDOA 1X3FA 1JR0D 4NPSA 4KLKA 4OL7A 4A3JH 3PO3G 4IALA 4B3ML 3D6CA 1G6ZA 4ID6A 2JA5H 2JQOA 4BS9A 1TS4A 4LF4Q 2HHHL 4DFAA 3UI2A 4DNIA 3PIP3 4RHSA 5NUCA 4C3IG 5DM73 2Z6KC 5ELCA 1VQDA 4L5RC 3GTMB 3S2DH 3BDLA 4DKAC 1HPCA 2I5MX 1SEBD 5IP9H 2NBFA 5M3FH 3NXWA 3BZCA 4IFDJ 1PFMA 1JWSD 2R93H 1QVFA 1E2VA 1DOMA 1VQJA 4JI2Q 4J1MA 1P8LA 2AQ3B 2DNCA 1E1OA 4DAPA 4R4IA 5C44G 5ELFA 1HTLD 4LWCA 2SNMA 5A35A 2RCFA 4DAYB 5FLXL 3O13A 1HUNA 2F0DA 3DWPA 4LF7Q 3I91A 1CQVA 2WP8J 2A68C 3QIAA 4PZ6A 4BY1H 5FLXc 5FO9B 4JI8L 4EVOA 2SEBD 4QL5A 1QNUA 3CQZB 1UE5A 3LWEA 3TBIB 3H0GB 3MTSA 5A2QL 4EGVA 2B2VA 3QWNA 3M4OB 2B63G 5LMUL 1SFOB 3PO3B 4ILWA 5ELOA 2UXCL 1SBBB 4GKKL 3Q0AA 1WTVA 2E5LL 4O1NA 2XRSD 4A3KB 1FD7D 1HA6A 4NW2A 4XXEA 1SSOA 1YEZA 4C3IB 1TWAH 2MO0A 4JI7L 4JYAQ 4OO1I 4XDXA 1LTAD 3GTPB 2NVQB 4DR3L 4XTCS 4RA8A 1XXGA 4DR6L 1SNQA 4X66Q 4MZ9A 2AUJD 3KOJA 2F3IA 4M8AA 1DM0B 4JBWA 3HOXG 4QJFA 1AE2A 3RZDH 1EFID 2NUCA 2K6AA 3NUCA 4FF3A 3G6EA 2F0UA 4KD3A 5CV9A 1EU4A 4XT3B 5CYUA 3MXPA 1E2ZA 4TRDA 4R8IA 1LT4D 4OX9L 1WTHA 3CPWA 1C9OA 1SNCA 1LACA 3FMCA 3TS0A 5HGTA 4GKJL 2EPBA 2E2IB 1QZHA 2KCCA 1ZXTA 3A0JA 2CH4A 2OWOA 3W1GA 5BR8Q 4FXGC 1GUWA 1QNKA 1BBWA 1U4PA 2EOTA 3T1HL 4DV5L 2VY3A 4YY3Q 4A3GG 5IT9L 3A5ZB 3HOUG 2E2JH 3NPPA 1XNQL 2WIIB 1HZAA 1L0YB 5JPMC 1EWIA 1JE4A 4HJ7A 2EYHA 1S5CD 2LXJA 1X3GA 2K5HA 3A74A 4ZQ3A 3K8AA 2VNUD 3CXCA 1D7QA 3GTGH 3AFQA 2LKVA 3I4MH 5C4XG 1Q1BA 3HOXB 2VB2X 1G8ZD 1PRTD 1K9MC 1KQSA 2JA7H 1EL0A 1VQMA 4JBKA 1F2ZA 2KENA 2WAQG 5LMNQ 1CT1D 3I90A 2JA8G 1RCVD 4GNXA 4JI5Q 1GKHA 3PO2G 1D6EC 3N6RA 3TP7A 2YTXA 3A8IE 1WCMH 1EIGA 1LTRD 2H1EA 2WB1B 4LF6L 2B29A 1CKMA 3M4YA 3RMHA 1JOOA 4UY8C 1SRUA 3NBIA 5G3LF 2K5QA 4GN3B 4R1JA 4AYBG 4BY1B 5C5MA 1GO3E 3U58A 2RSOA 1IBLQ 4QQBX 5K36G 3H3VH 4K0KQ 1IBML 3HOYH 1Y8PB 3BS1A 1SJHD 1CTMA 3T53B 3PIOA 1EY8A 3HG9A 4A3GB 1EY5A 5M5YH 1BVSA 4DA2A 4FO2A 5D3IB 3AFPA 3GTLB 1LM0A 4Q5VA 3J80E 2VUMH 3OMCA 1LO5D 4CJ0B 3I4LA 5M3MG 3T1YQ 1M1KC 4GOPB 1JICA 3HS0C 4KY5A 4GOPC 1GHJA 1KD1C 2R3ZA 1K0SA 2NWGA 1BNZA 4B3MQ 2UXBQ 3K81C 1CKNB 3KDFB 3SGIA 2PW5A 1YNJD 1ESFA 3LGJA 1IYJB 3OPOA 2HHHQ 3L2PA 1LUZA 3OOCA 2Z6KA 1EFWA 4PG3A 1J9OA 2CHBD 2PI2A 3UDIA 3JAMi 2K75A 5CV6A 3BU2A 2FINB 3E0JA 5AFWA 4BY7G 4IPDA 4RG1A 4UP9A 4A75A 4YWKA 1HZ9A 4N8FA 5I6YA 1M4VA 2ICIA 2AQ1B 4IURA 1BO0A 3BZKA 2R7FA 4XQNA 2HQEA 3MAQA 4H7BA 4AYBB 1STBA 4B3SL 3DXJC 3L0OA 2N49A 1STAA 2ASBA 1ET6A 1NJIC 5C5LA 2F0PA 1WTXA 2F0IA 1WFQA 4GLXA 1V1PA 2HD3A 1CUKA 3GQBA 2HDMA 5T1IA 5KYLA 2A1AA 1PV4A 1K28A 4FDBA 4CKEA 1Q46A 5M3MB 2E2HH 2E2JB 1BBXC 3P20A 2EYLA 1G91A 1YBYA 2K7VA 5EPLA 3PCOB 2I46A 1BF4A 4B3RQ 5LMUQ 4KMUC 3VDYA 4BXXH 1HZCA 1Q81C 2UXCQ 2KVMA 3HOVH 1V8QA 4GKKQ 2QKIC 2E5LQ 4A3MH 3GTGB 1K83B 1JB3A 3OMGA 1TWHH 1G6PA 4DV0L 4R8NA 4BWGB 2IPKD 1V1QA 4HMJA 2KEEA 4JI7Q 2MP1A 4RKBA 5IP7H 4KHPL 4DV4L 2LY7A 3KJOA 2JA7B 1A2UA 1I50B 2FXQA 2HDLA 2ID0A 1K3RA 1JOKA 2RDGA 4IUUA 1TS2A 3SK4A 4A3IH 4FF4A 5FLMH 5GQOA 1GD7A 1T5XD 3I7FA 4LUZA 4ZKCB 4A3DG 4JV5L 1TWGH 1JWMD 3J81i 1RTNA 1IW7D 1WVLA 2QGQA 1VMPA 4RGMA 4ABNA 4K5XA 3HOWG 3CCLA 1CI3M 4J15A 4ZUJA 5C6AA 4GZYC 3TREA 4LJZC 1UAPA 3W3AA 2PI2E 1PFNA 1B2TA 3CRKC 1K8OA 4DR7L 3HOYB 2MGSA 4K6DA 1EIYB 2JEBI 5C3WA 3H3VC 2F4VL 4OX9Q 1AH9A 1EYCA 3OHXC 5IOCA 4GKJQ 5M5YB 1KL9A 1MJCA 1V1OA 1L0WA 4RFBA 4KK7A 4POGA 4JI1L 1SNOA 2ZXPA 5JAVA 1HXYD 2ZJPA 2NZOA 2VUMB 1GJXA 1WTQA 4N8X1 1P16A 2VXWA 2FFKB 4OIJA 3QB3A 4KKUA 1JT8A 2F0KA 4Y7NH 4DV5Q 4DV2L 1XPUA 1G2TA 1QILA 4CHTB 1Q7YC 3RN2A 1KIXA 2KA7A 4IFDH 3V2TA 1XNQQ 1OXUA 1MD2D 2JSOA 4LF4L 2XSCA 3K80C 4F8MA 1XPOA 2OTJA 3HKZE 2Z0SA 2EE1A 5IGEA 3TZUA 4A3DB 1PVOA 2B2TC 2JJQA 5BN5A 1Z9FA 1XNRL 3S1MH 1K3BC 1QB5D 3IFTA 1ZKOA 3TP6A 1B9NA 1XJVA 3C3LA 3BG3A 3IAYA 4JC0A 1F9QA 1Z47A 4DXFA 4JI2L 4HJ9A 1W2BA 2JYOA 5CC4A 3IFDA 3L9AX 1I4PA 3CKIB 1VQAA 5CBEE 2NN6G 4XIGS 5G3LD 4ZCKA 2JA6G 2F0QA 1X54A 3H3VI 3PUZA 4LF7L 2HIVA 1LTLA 4R4QA 1M8AA 5EPKA 1CFMA 4MTNA 3D4RA 1IBMQ 1LTTD 4LUVA 1TWCH 1JJGA 1Y1VG 2MJ8A 2BE5C 1LT6D 5IYCG 5M9OA 4NB3A 5CV5A 1A3TA 3HOVB 3S9WA 1VQHA 1Q82C 4RAUC 1LYLA 1SR3A 1TWHB 3QOJA 3ER0A 3PV0A 1GUOA 2B2UC 5JPNC 1E22A 4HAEA 3TDQA 4GOPA 4F7XA 2KCNA 1H9JA 2F0FA 5DLQE 1EY4A 1W6KA 3M9BA 4R4OA 1CHQD 1OXTA 4G7OC 2F0EA 1PZID 3MFYA 3KDFA 4X66L 3I8ZA 1SMYD 1HCZA 2RDHA 2SNSA 1A62A 3NWTA 1ASYA 3UDGA 1ENFA 2EDGA 4KJNA 5HGQA 3GO5A 2KCMA 1V9PA 2FMMA 1QUQB 2KHIA 4PNYA 4DV1L 4L5TA 2D9UA 3MC0B 1EQTA 2GVBA 3NSWA 1Y1WG 1H9RA 3F8TA 2O5IC 2N78A 2N55A 1TR5A 3GV3A 1F77A 4YWMA 4X64Q 4YIJA 1B70B 3CCUA 4B3SQ 3C1FA 3STBD 3G71A 1W6JA 2F0NA 2K28A 5I2XA 1QVGA 1VQ6A 3HOZG 1B53A 2NVTB 1HFNA 1H9MA 4N9PA 1ET9A 1PTOF 2UUBQ 1N32L 1IKLA 3GTOH 5M5WB 5GROA 2MO1A 1STNA 4YCVA 4XT1B 4Y7NB 1NCVA 3DUZA 5GAHC 1V43A 2FHTA 2Q2HA 3LX0A 3RZOB 1SYGA 3KF6A 4PQXA 2ZJQA 5JJKA 4WJWA 1EU3A 3DEPA 2UUAQ 4OHJA 2NTTA 3H0GH 4H44C 2JEAI 2NYZD 1I6VC 2PYKA 4J8QA 3M4OH 1VQLA 5CORA 3NTHA 1PYWD 1EY7A 4FYDA 3K5LA 3PO3H 1PRTB 4UP7A 1LTSD 1GUSA 3PMFA 2B8GA 4A3KH 1C7YA 2G5DA 3S1MB 3I73A 1VQIA 3S15B 4FVMA 4Q0FA 2IY5B 4C3IH 4KHPQ 4HJ8A 1U9RA 4DV4Q 1KC8C 1UE1A 4IZ8A 4KKTA 4DU9A 2Q8TA 5CR3A 4OXPA 3K0XA 4JI5L 2A73B 1EY9A 1Q8KA 1K8GA 1SXTA 1I5FA 5BN3A 4QUCA 1E3PA 3CP0A 4DNRB 2CH4W 1X65A 4OO1G 1PH6A 1BR9A 4ZK9B 2XWBB 3T16A 2Q2UA 2HIXA 4QMGA 3HOZB 1GOZA 2JXMB 4NKLA 3A8JE 1I4RA 5IYBG 5C44H 4A3FG 2VL6A 4K0KL 4Z9CB 1I6HB 2F4VQ 3RUZA 4DV6L 2AUKA 4IN3A 3E5SA 3NE5B 2KBNA 3K5OA 1OTCA 2QEJC 3FPUB 1E2WA 2IWHA 4HR7B 4HIMA 1TS3A 4EX5A 1HH2P 1KLUD 2F0GA 5IGDA 2B63H 3T1YL 4KN7C 1CK1A 1H9SB 3EIVA 4LUOA 2A69C 1IL2A 1STGA 1CA6A 4WORA 1B1ZA 1YNJC 2A6EC 1FNWA 4DV2Q 3SK5A 3PSIA 4PZ7A 2UXBL 2GN5A 4L8JA 2XRQD 5FK9C 1H9KA 1KHIA 1VS0A 2WKDA 4ZYSA 4DR4L 1S5BD 5BN4A 1EEFD 3MHBA 2RHSB 2JE6I 3K5MA 2A8VA 3I56A 2Q2TA 4WJ4A 2B2TA 1QG7A 5D65A 5C0XJ 2PZUA 4QY7A 5CV4A 1X55A 5F2DA 1XNRQ 1VQ8A 2BH8A 4FP5D 4RMFA 3HOXH 5M5XH 2RA4A 2B2WC 4KY7A 4CDCC 1TS5A 2I5LX 1JOQA 1SYFA 2Z6BA 1EEID 4A3FB 2PQEA 4AQYQ 1VQGA 1WTPA 1NMFA 3GTOB 3FKIG 5DM63 1PDQA 1B8AA 4F88A 5C3EG 1PMRA 3U50C 1E0BA 2L15A 1HHVA 3ND8A 2EVBA 1EOTA 2VQFL 3KFUA 1G291 3T4AC 2B3GA 5JEAJ 1TQOA 2XTIA 4B3RL 4YHHL 5E1FA 4A3GH 3HOUH 5EBCA 2LS01 3GTLH 3DEOA 2B2UA 4RKLA 1YI2A 5JOBA 5KNBA 4B9WA 5E4XA 2TMPA 2K33A 2OEOA 4TSSA 1A2TA 1GUGA 4BBRG 3AQQA 5JJIA 3MEHA 5C4XH 2KUMA 1IW7C 2KHJA 3EA6A 2PPBC 1A8VA 4RGOS 3UDXA 5FLXE 1TWFH 3KF8B 2NVYH 1X56A 4A3CG 3H15A 2JA8H 4G4KA 4A93G 4DV1Q 5I2YA 1O7YA 5A2QE 3D0FA 1PH4A 4UHVA 1EYDA 5I6WA 5C44B 1DXMA 4V0BA 3CC4A 2EY1A 2L55A 2MHVA 1SYDA 5JVG3 5M3FG 5ELNA 4JBJA 1B3AA 1PTOD 3Q24A 1QOHA 4OWTB 4QIWB 1YJNA 1N32Q 1A15A 2B63B 4BBSG 2R93G 1N36Q 2R7DA 3R2IA 4BA1I 4RGTA 3WOEA 5M3MH 1R4PB 3SK6A 2Q8RE 3OWFA 2EY2A 5IT9c 3TS2A 1X3PA 2CW0D 3KK7A 4BBRB 4BA2I 1LV9A 4JCVE 3CD6A 3S1QB 1IYVA 1J6QA 4FNFA 4DR5Q 3RLFA 2E8GA 1K83H 1WTOA 2R92G 5FKAC 1CHPD 2EXZA 3X3NA 2D2CC 3J80i 3A7AB 1GUNA 3MXGA 2ATWA 3HZXA 5M5XB 4A3LG 4A93B 1BCPB 2A6HD 4BY7H 1CSPA 3J7AF 3NTIA 1HNZL 4DUZQ 1I50H 1BCPC 1S5DD 4A76A 1RDPD 1VQOA 1C8CA 4UDUC 1L1OB 2D0PA 2MFIA 1HR0L 1OXSC 3VYSA 3G4SA 4DPGA 2RDFA 1AN8A 5IT9E 5LL6S 3Q22A 2B2YC 1VQCA 2PZTA 2KHSA 1UEAB 3MA2B 1DD2A 2JN4A 1VQ5A 4DV6Q 4HMIA 1SE3A 1UWVA 1ONLA 4HCSA 3AU7A 5C4ZA 1DOKA 2CWPA 4G7ZC 4DAMA 4KY6A 3HOUB 3KLWA 3HKSA 5E4WC 4LFBL 1U4RA 4IPHA 1VQNA 2K5DA 2F3WA 3SXHA 1PFSA 4P2CB 2IT1A 3M3YH 3H6MA 3OW7A 4I65A 5GAEC 2AKWB 1TXYA 3VR4A 3W2DA 1WD1A 4G7HC 4B3TL 1PXUA 4K14A 1SE4A 5C4XB 1F2YA 2BCOA 1GM5A 1NE3A 1YNNC 3IL8A 2Z1CA 1RHPA 2Z4IA 3Q23A 4DR4Q 1A3VA 1S3OA 1TWFB 2HQLA 2OTLA 4P75A 2VQEL 1STEA 2NVYB 2WAQB 2L9HA 2JA8B 1STHA 2N8NA 2R61A 4GN4B 3PO2B 1SE8A 4A3DH 5ISRA 2F0WA 3J7ZC 2NZHA 3LNNA 1Q3LA 4K5WA 3BYTB 2ZM6Q 2B2WA 3HOWH 2O2LD 2A5HA 1ENAA 2MUYA 3W5OA 5CV8A 4X64L 2Y0SE 1A0IA 1NR4A 1ESRA 3JAML 4RH6A 1W3SA 2UUBL 3A55A 2L4NA 1RL2A 3GP7A 3S16B 2EYMA 1MI2A 2WINB 3P7JA 4KV6A 3TQYA 3C1EA 4C3JG 4DAYA 1KABA 1WCMG 2KJXA 2VQFQ 1KNEA 1QZGA 4DV3Q 2DN8A 3NWSA 3U4ZA 2UUAL 1PA6A 2PMZB 2EQSA 4UPAA 1SMXA 4MHEA 2IHFA 5J39A 3BJUA 4YHHQ 3MEFA 1N33Q 3S14H 1IXRA 2QEXA 2ZTCA 2ALYB 1Y14B 3E9HA 3ND9A 3I55A 4YCWA 3H91A 2HUGA 5C4HA 3PGZA 4BY7B 2A68D 1DYQA 1SNPA 4OELB 2L5TA 1F2MA 3KLSX 2CFMA 4LF5L 3K6OA 5J22A 3CCRA 2PNRC 1ZYRD 1NUCA 2ICEC 5LMNW 1HQMC 5KNCA 1NBWA 2L11A 4MN3A 5DEHA 4NMZA 1DCZA 2DJGC 1SDFA 2XWJB 3QJYA 2PO4A 3EQLC 1XPRA 3TEHB 2NN6H 1FNUA 4KTAA 3S24A 3VR2A 1Q8IA 2UUCL 5I4DA 1B4OA 3J81L 3PQIA 2SOBA 4I7AA 2PW7A 1BDOA 2E75C 1Y1VH 2NVTH 2GVAA 4ME3A 5IYCH 4DR1Q 3TRZA 2F0LA 5M5WH 2CKZB 3VR3A 2NVXH 3M3YB 1U4LA 1UUPA 1Q86C 4U68A 3BVGA 3DMUA 3RZOH 5FJ8G 1K73C 3GTQB 1LABA 1AZPA 3Q8DA 3PF4A 3NK9A 4A3EG 2IX1A 3A56A 4DK6C 1VDZA 2Q2IA 1HRJA 1PZKD 1Q90A 3G7LA 3PIO3 4A3BG 1BXTA 3N52A 1G2SA 5E7NA 5KRUA 3V05A 3S15H 3HOWB 3E0EA 2AWNA 1TVXA 4A3MG 3BYYB 1HNZQ 1ICWA 1IL8A 3NEMA 1Y1WH 4H13C 4AH6A 4HEDA 4AQYL 2Z9HA 4HJ5A 2KOLA 5DNFA 4QCLA 3ERSX 1HR0Q 4OWXB 1CZWA 3ONAB 1D5MC 5COYA 2YU9B 1JB7A 3HOZH 2FMCA 2B2YA 5IGFA 4H02A 1RODA 1IHZA 3CMEA 1MSGA 1NMGA 3G48A 4F87A 2J0TD 3RNUA 5D3DA 1I6HH 3PUVA 4XQJA 2EY6A 1RIPA 1SROA 4DK0A 3CCEA 2IW3A 5C0XG 4TQUS 3S14B 4IO9A 4YWLA 4LFBQ 1MJEA 1I3QH 3GD7A 3AYHB 3PIPA 3ZYYX 3CMAA 2K04A 4A3BB 4B3TQ 1MSHA 1CQFA 5CV7A 2K5NA 5KNDA 1CKNA 1I4HA 1K0RA 2AQ2B 4DK1A 1O78A 4JG2A 2VQEQ 4CDFC 1PH3A 2M00A 2QW7A 1TIID 1XTDA 4PMCA 4R9WA 2H4OA 5I9OA 3AMUA 1FGUA 2VZAA 3KBXA 5JEAG 4OO1H 4IJHA 1PTOB 4K8IA 2JA6B 2AWOA 3D3RA 3NTKA 1PH7A 2AMCB 1RKNA 5C4JB 4IUTA 4ZAIA 5IYBH 4A3FH 4E6IA 3WDNA 1ILQA 2Y0SG 2G9HD 3E6ZX 4X65L 1Y1VB 1M90C 1B3QA 2J7ZA 1MBYA 3EVQA 3C2PA 4ULLA 2NVXB 3OYYA 1KRSA 1N36L 4C3HG 1WOCA 2HCIA 4ODGA 4P72A 1LTBD 1BKBA 2WB1E 1C0AA 4IPCA 4LAAA 2C9OA 2CW0C 1WTWA 4L5SA 3A7LA 2RCNA 1JJ2A 1ILPA 1EQRA 3I2ZA 4JI4Q 1R9TH 4FXDA 3GDEA 1JMCA 3DM3A 3I4NG 4P73A 1JJCB 5GAGC 1UE6A 1B44D 4JI0L 4DR5L 4I7ZC 1C4QA 2EYPA 4CKBA 1PRTC 2A6HC 5IIFA 2IX3A 2E74C 4IUPA 2K05A 2R6GA 3CPFA 5JJLA 4HIKA 1VMCA 2X6GA 4DUZL 1Y1WB 3TP5A 1TY0A 4B08A 2F03A 1PH8A 4LF5Q 2K50A 1I94Q 4MNOA 4WJ3M 2DNEA 3OSOA 1JCKB 2YTYA 2DGYA 3GV6A 4DNTB 4G57A 1X3EA 2CCZA 4OIKA 3OW2A 1HTPA 2F0VA 1GXDC 1MIUA 1RTOA 4JVZA 3NQTA 4P74A 2VS1A 3FKIH 5C3EH 3X3MA 2UUCQ 5T1GA 1T5EA 3CC7A 1U0LA 3CRLC 2PNHA 4AYBE 1O7LA 1XX8A 1I3QB 3OTOL 4LF8Q 2EJFC 4IQZA 3BVZA 3CCVA 3KYHC 2UXDL 2OF1A 4PZ8A 4IFDI 4OONA 3S1RB 2R7ZG 1STYA 3SE0A 1XMQL 3UDFA 2LMCB 3M4PA 1ICFB 3A5UA 3CCMA 1SNDA 3KLSA 3QOLA 2BA0A 4BBRH 4IOAA 4NP5A 3S1QH 2PMZE 4HSVA 3NHHA 1KAWA 3RLNA 3CHBD 3A8KE 4ZUIA 1OXVA 3IRBA 3HKZG 1NTGA 1FR3A 1BOSA 1YZ6A 5FOBB 1EUJA 3ITPA 2ZM6L 3S1NB 1FNVA 4A3CH 1B50A 1HNXQ 1N8RC 2MNAA 3BDOA 4A93H 2JK8A 2I0QA 2OQKA 4A3KG 4RCNA 3M85A 4WRDA 5EQ0A 3KUPA 2QA4A 2DY7A 2ZXOA 1KTKA 1U4MA 3M4QA 5ELEA 1CKOA 4P71A 4XYOA 3F2UA 5IODA 1SE2A 5IYDG 5EKIA 4JOIC 1AW7A 2XIWA 5EPJA 3S17H 4NXML 1VQBA 1Y8NB 4K2LA 1NY4A 1NR2A 2F0TA 1QJOA 2M9VA 4DF7A 2HT1A 4JI3Q 3MXNB 1FGBD 3J7AV 1D1KA 4UP8A 4DV3L 4BBSH 1SAPA 4GLVB 5IWAL 1MHWC 1R9TB 2VW9A 4RWSC 3UE0A 2R7ZB 2Q8IB 1QCBD 3U9OA 3W1BA 1N33L 1V1PB 3K7AH 1AE3A 3EFXD 1E1TA 4HJAA 3TMEA 4MIUA 1BQQT 1LLRD 2KCTA 3CW2C 4EQNA 3ULPA 1H95A 1XWEA 4APVA 1PLFA 2LFNA 3BVMA 4DV7L 5IGCA 3F2CA 4AIMA 1YJWA 2EJMA 1F9PA 2G9DA 3HKZB 1WJJA 3NBHB 3DLLA 3H09A 2R92H 3CF5A 2K03A 3S2HH 2BE5D 3Q6SA 4JK1C 4A3LH 1ZYRC 2EIFA 3R2TA 2PZWA 2A19A 4A3JG 3SK8A 2XN9C 2MQHA 3GTJH 1QUQA 2D5DA 2JA5G 3PO2H 3EBEA 2O5JC 4QUFA 1RJTA 3K7UC 3I3CA 2JA9A 3FKIB 1EQVA 4HCEA 3NQIA 2EYFA 5C3EB 1KDBA 2PQAB 3CU7A 2FJ2A 1HFGA 1YJ9A 1SNMA 3R3OA 4L6TB 3VA7A 4H0LC 3FHWA 1AZQA 5IP9G 2X6LA 3U9SA 5K36H 4U673 4QB4A 3VA5A 4X65Q 2QF7A 5EAYA 3CAMA 4NXNQ 3B6YA 3S16H 4DR1L 3KLRA 4LFAQ 3R8BA 5LL6X 1Q1EA 3D4WA 2EJGC 1ASZA 4ZKBB 2M2LA 2H5XA 1NSNS 3H94A 1I4XA 4X3SA 2ZXRA 1CA5A 2WB1G 3J81j 3DWQA 1DONA 4X62Q 1AEXA 1IYUA 3I70A 4K5VA 1ENCA 3LWUA 4CJ1B 5KYIA 4DAVA 4C2MB 1ZEQX 2RQXA 4BY1G 3WOFA 2AHOB 1AFPA 1GVPA 1Z7TA 4JI0Q 4ZRZA 1SJED 1WI5A 1O7ZA 1EOVA 1BBUA 1GUTA 2F0JA 4IUNA 4A3JB 4CGYB 1CM9A 4LF9Q 4Y52H 2JA5B 3FP9A 2O4XA 3VR6A 3HRZC 1PZJD 1I4GA 4QF4A 4V190 3D31A 1A63A 3K5NA 3S2DB 1B7YB 1VQPA 4KKSA 1WTRA 3L7ZC 5FO8B 5HY6A 4XQQA 1DJRD 1XMOQ 2ZTEA 5M3FB 1L1OC 3S17B 3GTKH 1YITA 4FXKC 4K2KA 3J80L 3K57A 2F0SA 4PV1C 3G6JB 3J80c 4X3KA 1KDCA 4BBSB 2IX0A 2F0MA 3RLOA 2R93B 4CKCA 1Z6HA 1YHQA 2JP1A 4FF1A 5L37A 2QDBA 4C3JH 4LNQA 1F2LA 1VQFA 1VCIA 5EJWA 4KI0A 1WYDA 1YIJA 2L0CA 4EQ5A 1BCPF 3K7AB 3NENA 1Y69U 1S40A 3PUXA 3D8GA 4J6HA 4RGNA 3OTOQ 1N34Q 1IBKL 1QWYA 2RBMA 2C35B 3FVQA 2ENBA 1EWHA 4DGZA 2UXDQ 1D2BA 1H9SA 1JWUD 1PFBA 4CDEC 3MWYW 1PH9A 1XMQQ 1HNWL 2R92B 1SMYC 2WFWA 1HUMA 3S2HB 4YCUA 3F2DA 2EYOA 4X6AH 1KAAA 3GTQH 1KLGD 2Z8LA 3CCQA 1FYCA 4LFCL 1TKWB 4DUYQ 2BA1A 1KXLA 4K6LA 2RHQB
chains in the Genus database with same CATH topology
3GTJB 1DOLA 1TWAB 2RVLA 3PUYA 1D1IA 1A3UA 3EJIA 2A74C 4EQPA 2A69D 2N88A 4OGQC 1SYBA 2A6ED 4EQOA 4KHVA 1IKMA 3DHQA 2TSSA 3ERQA 3RZDB 5EKKA 3DM1A 1EY6A 1GHKA 4X3UA 3MXNA 2K01A 1SYCA 2OXPA 3VYRA 1VF7A 1EWCA 1HA5A 3FPPA 1S5FD 3SR1A 3URYA 1X3QA 1I4QA 1DZ1A 1LT5D 4KN4C 3NP8A 3OIPA 5JVH3 5FO7B 3OWEB 1NAPA 3K0YA 2KECA 2NTSA 4KJOA 2VB3X 3OIQA 4TKOB 5DAUA 3JAME 1AP0A 2BOSA 1MGSA 1RF2D 3NBHA 5KIXA 2WV6D 4DXGA 4RHRA 3KBGA 1KNAA 2Z4HA 3IKJA 3PUWA 4KHZA 1EZ6A 3HGBA 3SDZA 3I4MB 1SYEA 2K32A 3KF8A 3GTKB 2D62A 4WFN3 2NZ1D 4ME5A 5KGUA 3FEWX 3D4DA 3FRPB 2CQAA 1XTCD 1PTOH 1VF5C 2RSNA 2X69A 4C3JB 1WCMB 1K8MA 5KEEA 3QO2A 1Q12A 2OT2A 3DWAA 2XNAC 2I07B 2ZT9C 3T51B 5C0XH 1RD9D 1CZGA 4HN7A 3TN2A 3MZ5A 3VYUA 5CGKA 4M1UB 5ELBA 3HEJA 5EGTA 1EY0A 2V4DA 5ELDA 4PMBA 5IGBA 3FDTA 1KDAA 2SDFA 3TZDA 1B9MA 4C1NK 3J81E 1LT3D 3L3OC 1TT2A 1JC7A 1LTID 3R93A 5JEAH 5K5PA 3SVMA 1EZ8A 3I72A 2QILA 3P75A 2J4XA 3M7NA 1UNSA 4RCOA 2L12A 1ML0D 3VR5A 4XYQA 2MPMA 1WD0A 5J1ZA 3A54A 3MXUA 2RKSA 1BCPD 2K1BA 1S5ED 1L0XB 3M7GA 3BZDB 4ZLTF 2IL8A 5I9PA 4DN4M 1Y8OB 4S3SA 1F9RA 5LHY1 4PMWA 5CMDA 4A3EB 3VYTA 2E2HB 3EROA 1EYAA 5IGGA 3HP3A 3J7YW 2B2VC 1LTGD 1QE6A 3QG1A 3P1HA 4CJ2C 1OXXK 3AB9A 4A3MB 2BDNA 2CVRA 5CBAE 1X32A 2F1MA 4IFDG 1J8IA 4L63B 1JQYD 4A3IB 3MVVA 3MFGA 3D6WA 1TWGB 2WACA 3T13A 1PTOC 1YNND 3V96A 2XVSA 2EZVA 2B39A 5C3XA 2WKCA 5D14A 2K5WA 1BUVT 1EIHA 2F3VA 3TSSA 2B8FA 5EBDA 2EY5A 2YYZA 4IUVA 1O80A 4CBVA 5E3FA 2F4IA 2E2DC 2IJ0A 1HQRD 4IUQA 4C56C 4X3TA 1II3A 2DY8A 3K58A 2C5CA 1F9SA 1TU2B 4FF2A 2QCPX 4KD4A 1S4ZA 4HTHA 4N9TA 4LMQD 4B9XA 4HSPA 2Y0SB 1TY2A 5JJZA 1PRTF 1C48A 2NN6I 4UAIA 2KEDA 1XYIA 4C3HB 2HCCA 3K59A 3T56B 3TP8A 3RD4A 2NB0A 4LK1C 4K8JA 4NDXA 3SHLA 2PCFB 2F0HA 3BDCA 5C0XI 1R4QB 5HURA 2GA4B 2F0OA 3I4NB 1OO9B 1TWCB 2L1BA 5EKLA 4O42A 1D5ZC 4C1NI 1A6XA 5TSSA 2E76C 3C46A 2EYJA 1JORA 2KQ3A 1D5XC 3SEBA 2BDOA 1JR0D 4OL7A 4IALA 3D6CA 1G6ZA 4ID6A 4BS9A 1TS4A 4DFAA 3UI2A 3PIP3 4RHSA 5NUCA 4C3IG 5DM73 5ELCA 3GTMB 3BDLA 1HPCA 1SEBD 2NBFA 3NXWA 4IFDJ 1PFMA 1JWSD 1E2VA 1DOMA 4J1MA 2AQ3B 2DNCA 4DAPA 5ELFA 1HTLD 2SNMA 5A35A 5FLXL 3O13A 1HUNA 2F0DA 3DWPA 3I91A 1CQVA 2WP8J 2A68C 3QIAA 5FO9B 4EVOA 2SEBD 1QNUA 3CQZB 3LWEA 3TBIB 3H0GB 3MTSA 5A2QL 4EGVA 2B2VA 3QWNA 3M4OB 1SFOB 3PO3B 4ILWA 1SBBB 3Q0AA 1WTVA 4O1NA 2XRSD 4A3KB 1FD7D 1HA6A 4NW2A 4XXEA 1SSOA 4C3IB 4OO1I 4XDXA 1LTAD 3GTPB 2NVQB 4XTCS 4RA8A 1XXGA 1SNQA 2AUJD 4M8AA 1DM0B 4JBWA 1EFID 2NUCA 2K6AA 3NUCA 4FF3A 2F0UA 4KD3A 5CV9A 1EU4A 4XT3B 5CYUA 3MXPA 1E2ZA 4TRDA 4R8IA 1LT4D 1SNCA 1LACA 3FMCA 5HGTA 2EPBA 2E2IB 2KCCA 1ZXTA 4FXGC 1GUWA 1QNKA 1U4PA 2EOTA 5IT9L 3NPPA 2WIIB 1L0YB 5JPMC 1JE4A 2EYHA 1S5CD 4ZQ3A 2VNUD 2LKVA 1Q1BA 3HOXB 2VB2X 1G8ZD 1PRTD 1EL0A 1F2ZA 1CT1D 3I90A 1RCVD 1D6EC 3N6RA 3TP7A 3A8IE 1EIGA 1LTRD 2H1EA 2WB1B 3M4YA 3RMHA 1JOOA 3NBIA 5G3LF 2K5QA 4BY1B 5C5MA 2RSOA 5K36G 1Y8PB 3BS1A 1SJHD 1CTMA 3T53B 1EY8A 3HG9A 4A3GB 1EY5A 4DA2A 4FO2A 5D3IB 3GTLB 4Q5VA 3J80E 3OMCA 1LO5D 4CJ0B 3I4LA 1JICA 3HS0C 4KY5A 1GHJA 2R3ZA 2NWGA 1BNZA 2PW5A 1YNJD 1ESFA 3OPOA 3OOCA 1J9OA 2CHBD 5CV6A 2FINB 3E0JA 5AFWA 5I6YA 1M4VA 2ICIA 2AQ1B 4IURA 1BO0A 4XQNA 2HQEA 3MAQA 4H7BA 4AYBB 1STBA 3DXJC 1STAA 1ET6A 5C5LA 2F0PA 1WTXA 2F0IA 1V1PA 5T1IA 3GQBA 2HDMA 5KYLA 4CKEA 5M3MB 2E2JB 1BBXC 3P20A 2EYLA 1G91A 5EPLA 2K7VA 1BF4A 2I46A 4KMUC 2KVMA 1V8QA 2QKIC 3GTGB 1K83B 1JB3A 3OMGA 4R8NA 4BWGB 2IPKD 4HMJA 2KEEA 2MP1A 4RKBA 2LY7A 2JA7B 1A2UA 1I50B 2HDLA 2ID0A 4IUUA 1JOKA 2RDGA 3SK4A 1TS2A 4FF4A 1T5XD 4ZKCB 1JWMD 1RTNA 1IW7D 1WVLA 1VMPA 4RGMA 4ABNA 4K5XA 1CI3M 4ZUJA 5C6AA 4GZYC 4LJZC 1UAPA 3W3AA 1PFNA 1B2TA 3CRKC 1K8OA 3HOYB 2MGSA 4K6DA 2JEBI 5C3WA 3H3VC 1EYCA 3OHXC 5IOCA 5M5YB 1V1OA 4RFBA 4KK7A 1SNOA 2ZXPA 5JAVA 1HXYD 2VUMB 1GJXA 1WTQA 2VXWA 2FFKB 4OIJA 3QB3A 4KKUA 2F0KA 1G2TA 1QILA 4CHTB 2KA7A 4IFDH 3V2TA 1OXUA 1MD2D 2JSOA 2XSCA 4F8MA 2EE1A 5IGEA 3TZUA 4A3DB 2B2TC 5BN5A 1QB5D 3TP6A 1ZKOA 3IFTA 1B9NA 3C3LA 3BG3A 3IAYA 1F9QA 1Z47A 4DXFA 2JYOA 5CC4A 3IFDA 3L9AX 1I4PA 3CKIB 5CBEE 2NN6G 4XIGS 5G3LD 2F0QA 3PUZA 1M8AA 5EPKA 1CFMA 3D4RA 1LTTD 2MJ8A 2BE5C 1LT6D 5M9OA 5CV5A 1A3TA 3HOVB 3S9WA 4RAUC 1TWHB 3QOJA 3PV0A 1GUOA 2B2UC 5JPNC 4HAEA 3TDQA 4F7XA 2KCNA 1H9JA 2F0FA 1EY4A 1W6KA 1CHQD 1OXTA 4G7OC 2F0EA 1PZID 3MFYA 3I8ZA 1SMYD 1HCZA 2RDHA 2SNSA 3NWTA 1ENFA 2EDGA 4KJNA 3GO5A 2FMMA 4PNYA 2D9UA 3MC0B 1EQTA 3NSWA 1H9RA 2O5IC 2N55A 1TR5A 3GV3A 1F77A 4YIJA 3C1FA 1W6JA 2F0NA 2K28A 5I2XA 1B53A 2NVTB 1HFNA 1H9MA 4N9PA 1ET9A 1PTOF 1IKLA 5M5WB 1STNA 4XT1B 4Y7NB 1NCVA 3DUZA 1V43A 2FHTA 3LX0A 3RZOB 1SYGA 4PQXA 4WJWA 1EU3A 3DEPA 4OHJA 2NTTA 4H44C 2JEAI 2NYZD 1I6VC 2PYKA 4J8QA 5CORA 3NTHA 1PYWD 1EY7A 4FYDA 3K5LA 1PRTB 1LTSD 1GUSA 3PMFA 2B8GA 3S1MB 3I73A 3S15B 4FVMA 4Q0FA 1U9RA 4IZ8A 4KKTA 4DU9A 2Q8TA 5CR3A 2A73B 1EY9A 1SXTA 5BN3A 4QUCA 4DNRB 4OO1G 1BR9A 4ZK9B 2XWBB 3T16A 4QMGA 3HOZB 1GOZA 2JXMB 4NKLA 3A8JE 1I4RA 4Z9CB 1I6HB 3RUZA 2AUKA 4IN3A 3E5SA 3NE5B 3K5OA 2QEJC 3FPUB 1E2WA 2IWHA 4HR7B 1TS3A 1KLUD 2F0GA 5IGDA 4KN7C 1CK1A 1H9SB 2A69C 1STGA 1CA6A 4WORA 1B1ZA 1YNJC 2A6EC 1FNWA 3SK5A 4L8JA 2XRQD 5FK9C 1H9KA 2WKDA 4ZYSA 1S5BD 5BN4A 1EEFD 3MHBA 2JE6I 3K5MA 2B2TA 1QG7A 5D65A 5C0XJ 2PZUA 5CV4A 5F2DA 4FP5D 2RA4A 2B2WC 4KY7A 1TS5A 1JOQA 1SYFA 4A3FB 1EEID 2PQEA 1WTPA 3GTOB 5DM63 1PDQA 4F88A 1PMRA 1E0BA 1HHVA 3ND8A 2EVBA 1EOTA 1G291 3T4AC 5JEAJ 1TQOA 5E1FA 5EBCA 2LS01 3DEOA 2B2UA 4RKLA 5JOBA 5KNBA 4B9WA 5E4XA 2TMPA 2K33A 2OEOA 4TSSA 1A2TA 1GUGA 3MEHA 2KUMA 1IW7C 3EA6A 2PPBC 4RGOS 5FLXE 4G4KA 5I2YA 1O7YA 5A2QE 1EYDA 5I6WA 5C44B 1DXMA 4V0BA 2EY1A 2L55A 2MHVA 1SYDA 5JVG3 1B3AA 1PTOD 3Q24A 1QOHA 4QIWB 1A15A 2B63B 3R2IA 4BA1I 4RGTA 3WOEA 1R4PB 3SK6A 2Q8RE 3OWFA 2EY2A 1X3PA 2CW0D 3KK7A 4BBRB 4BA2I 1LV9A 3S1QB 1IYVA 4FNFA 3RLFA 1WTOA 5FKAC 1CHPD 2EXZA 3X3NA 2D2CC 3A7AB 1GUNA 3MXGA 3HZXA 5M5XB 4A93B 1BCPB 2A6HD 3J7AF 3NTIA 1BCPC 1S5DD 1RDPD 1C8CA 4UDUC 1OXSC 3VYSA 2RDFA 1AN8A 5IT9E 5LL6S 3Q22A 2B2YC 2PZTA 2KHSA 1UEAB 3MA2B 1DD2A 4HMIA 1SE3A 1ONLA 4HCSA 3AU7A 5C4ZA 1DOKA 4G7ZC 4KY6A 3HOUB 5E4WC 1U4RA 2K5DA 2F3WA 3SXHA 4P2CB 2IT1A 3H6MA 3OW7A 4I65A 3VR4A 3W2DA 1WD1A 4G7HC 1PXUA 4K14A 1SE4A 5C4XB 1F2YA 2BCOA 1YNNC 3IL8A 2Z1CA 1RHPA 2Z4IA 3Q23A 1A3VA 1TWFB 1STEA 2NVYB 2WAQB 2L9HA 2JA8B 1STHA 2R61A 3PO2B 5ISRA 2F0WA 3LNNA 1Q3LA 4K5WA 3BYTB 2B2WA 2O2LD 2A5HA 1ENAA 2MUYA 5CV8A 1NR4A 1ESRA 3JAML 4RH6A 3A55A 2L4NA 3GP7A 3S16B 2EYMA 1MI2A 2WINB 3P7JA 4KV6A 3C1EA 4C3JG 4DAYA 1KABA 2KJXA 1KNEA 2DN8A 3NWSA 2PMZB 4MHEA 5J39A 3ND9A 3H91A 2HUGA 5C4HA 4BY7B 2A68D 1DYQA 1SNPA 2L5TA 1F2MA 3KLSX 3K6OA 5J22A 2PNRC 1ZYRD 1NUCA 2ICEC 1HQMC 5KNCA 4MN3A 2L11A 5DEHA 4NMZA 1DCZA 1SDFA 2XWJB 3QJYA 2PO4A 3EQLC 2NN6H 1FNUA 4KTAA 3VR2A 1Q8IA 5I4DA 1B4OA 3J81L 2SOBA 2PW7A 1BDOA 2E75C 2F0LA 3VR3A 3M3YB 1U4LA 1UUPA 4U68A 3BVGA 3DMUA 3GTQB 1LABA 1AZPA 3NK9A 2IX1A 3A56A 1VDZA 1HRJA 1PZKD 1Q90A 3G7LA 3PIO3 1BXTA 3N52A 1G2SA 5KRUA 3V05A 3HOWB 2AWNA 1TVXA 3BYYB 1ICWA 1IL8A 4H13C 4HEDA 2KOLA 5DNFA 4QCLA 1CZWA 3ONAB 1D5MC 5COYA 2YU9B 2FMCA 2B2YA 5IGFA 1RODA 1IHZA 1MSGA 4F87A 2J0TD 5D3DA 3PUVA 4XQJA 2EY6A 4DK0A 2IW3A 5C0XG 4TQUS 3S14B 3GD7A 3ZYYX 2K04A 4A3BB 1MSHA 1CQFA 5CV7A 5KNDA 1I4HA 2AQ2B 4DK1A 1O78A 2M00A 1TIID 4PMCA 4R9WA 2H4OA 5I9OA 3AMUA 3KBXA 5JEAG 4OO1H 1PTOB 4K8IA 2JA6B 2AWOA 3D3RA 3NTKA 1RKNA 5C4JB 4IUTA 4ZAIA 4E6IA 3WDNA 1ILQA 2G9HD 3E6ZX 1Y1VB 2J7ZA 1MBYA 3EVQA 3C2PA 4ULLA 2NVXB 4C3HG 2HCIA 4ODGA 1LTBD 4LAAA 2C9OA 2CW0C 1WTWA 3A7LA 1ILPA 4FXDA 1B44D 4I7ZC 1C4QA 2EYPA 4CKBA 1PRTC 2A6HC 5IIFA 2IX3A 2E74C 4IUPA 2K05A 2R6GA 1VMCA 2X6GA 1Y1WB 3TP5A 1TY0A 4B08A 2F03A 2DNEA 3OSOA 1JCKB 3GV6A 4DNTB 4G57A 4OIKA 1HTPA 2F0VA 1GXDC 1RTOA 3NQTA 3X3MA 5T1GA 1T5EA 3CRLC 1O7LA 1XX8A 1I3QB 2EJFC 4IQZA 3BVZA 2OF1A 4IFDI 3S1RB 1STYA 3SE0A 2LMCB 1SNDA 3KLSA 3QOLA 2BA0A 4NP5A 4HSVA 3NHHA 3CHBD 3A8KE 4ZUIA 1OXVA 1FR3A 1BOSA 5FOBB 3ITPA 3S1NB 1B50A 1FNVA 3BDOA 4RCNA 3M85A 4WRDA 5EQ0A 3KUPA 2DY7A 2ZXOA 1KTKA 1U4MA 5ELEA 4XYOA 3F2UA 5IODA 1SE2A 5EKIA 1AW7A 2XIWA 5EPJA 1Y8NB 4K2LA 1NR2A 2F0TA 1QJOA 2M9VA 4DF7A 1FGBD 3J7AV 1D1KA 1SAPA 1R9TB 4RWSC 2R7ZB 2Q8IB 1QCBD 3U9OA 1V1PB 3EFXD 3TMEA 4MIUA 1BQQT 1LLRD 4EQNA 1XWEA 1PLFA 2LFNA 3BVMA 5IGCA 2EJMA 1F9PA 2G9DA 3HKZB 3H09A 2K03A 2BE5D 3Q6SA 4JK1C 1ZYRC 3R2TA 2PZWA 3SK8A 2XN9C 2D5DA 2O5JC 4QUFA 1RJTA 3I3CA 3FKIB 1EQVA 4HCEA 3NQIA 2EYFA 5C3EB 1KDBA 3CU7A 2FJ2A 1HFGA 1SNMA 3R3OA 4L6TB 3VA7A 4H0LC 1AZQA 2X6LA 3U9SA 5K36H 4U673 4QB4A 3VA5A 2QF7A 3KLRA 3R8BA 5LL6X 1Q1EA 3D4WA 2EJGC 4ZKBB 2M2LA 1NSNS 3H94A 1I4XA 4X3SA 2ZXRA 1CA5A 3DWQA 1DONA 1AEXA 1IYUA 3I70A 4K5VA 1ENCA 3LWUA 4CJ1B 5KYIA 4DAVA 4C2MB 1ZEQX 2RQXA 3WOFA 1AFPA 1Z7TA 4ZRZA 1SJED 1O7ZA 1GUTA 2F0JA 4IUNA 4A3JB 4CGYB 1CM9A 2JA5B 2O4XA 3VR6A 3HRZC 1PZJD 1I4GA 4QF4A 4V190 3D31A 3K5NA 3S2DB 4KKSA 1WTRA 3L7ZC 5FO8B 4XQQA 1DJRD 5M3FB 3S17B 4FXKC 4K2KA 3J80L 3K57A 2F0SA 4PV1C 3G6JB 4X3KA 1KDCA 4BBSB 2IX0A 2F0MA 2R93B 4CKCA 1Z6HA 2JP1A 4FF1A 2QDBA 1F2LA 1VCIA 5EJWA 4KI0A 2L0CA 1BCPF 3K7AB 1Y69U 3PUXA 3D8GA 4J6HA 4RGNA 1QWYA 2RBMA 3FVQA 2ENBA 1EWHA 4DGZA 1D2BA 1H9SA 1JWUD 1PFBA 3MWYW 2R92B 1SMYC 1HUMA 3S2HB 2EYOA 1KAAA 1KLGD 2Z8LA 1FYCA 1TKWB 2BA1A 4K6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYM A;  2F0Q A;  4R8N A;  2F0H A;  3BDC A;  4ZUI A;  4KV6 A;  3C1E A;  4HMJ A;  5C5M A;  2F0O A;  2EXZ A;  4ODG A;  5HUR A;  5KRU A;  1KAB A;  4RKB A;  3D4W A;  1A3U A;  1U9R A;  3EJI A;  3ITP A;  3HZX A;  4LAA A;  3MVV A;  1NSN S;  4EQP A;  3MZ5 A;  1A2U A;  5CGK A;  3SK4 A;  1JOK A;  4IZ8 A;  5EKL A;  1SYB A;  4DU9 A;  5CR3 A;  1EY8 A;  1AEX A;  1TQO A;  1SNQ A;  2WAC A;  4EQO A;  3T13 A;  4KHV A;  5M9O A;  5J39 A;  1EY5 A;  1EY9 A;  4WRD A;  3DHQ A;  3HEJ A;  4K5V A;  5EGT A;  1ENC A;  1A3T A;  3PMF A;  1EY0 A;  5CV5 A;  5E1F A;  3ERQ A;  5KYI A;  3S9W A;  4PMB A;  4K5X A;  3QOJ A;  2EYJ A;  2EYP A;  3OMC A;  2RDF A;  5EKK A;  2KQ3 A;  2NUC A;  5IGB A;  5IOD A;  1JOR A;  4ZUJ A;  5C6A A;  3T16 A;  4RKL A;  4QMG A;  3NUC A;  1KDA A;  2F0U A;  5C3X A;  4KD3 A;  5CV9 A;  5JOB A;  4B9W A;  3MXP A;  4NKL A;  2F0J A;  4IUN A;  4K2L A;  4F7X A;  1EY6 A;  2F0T A;  5IIF A;  5IGF A;  2F0F A;  4K6D A;  4KY5 A;  4DF7 A;  2OEO A;  4TRD A;  1IHZ A;  2F3V A;  1EY4 A;  1A2T A;  4OL7 A;  5C4H A;  4IAL A;  2PZT A;  3D6C A;  5C3W A;  2O4X A;  2F0E A;  2KHS A;  3RUZ A;  3MEH A;  1TT2 A;  2EY5 A;  4ID6 A;  1EYC A;  1SNC A;  1SYC A;  4HMI A;  2PW5 A;  1SNP A;  5HGT A;  3TP5 A;  2OXP A;  5IOC A;  3E5S A;  5C4Z A;  2EY6 A;  1F2M A;  4KY6 A;  4DFA A;  2SNS A;  4QF4 A;  5K5P A;  3U9O A;  5NUC A;  1EZ8 A;  4KJN A;  3SR1 A;  5J22 A;  5E3F A;  3P75 A;  1SNO A;  5JAV A;  5CV6 A;  3OSO A;  2F0G A;  4PNY A;  3BDL A;  5IGD A;  1NUC A;  2F3W A;  3TME A;  4MIU A;  3QB3 A;  4G57 A;  3SXH A;  4K2K A;  4EQN A;  3NXW A;  2F0K A;  5DEH A;  3H6M A;  4NMZ A;  4I65 A;  2F0S A;  1EYD A;  5I6W A;  2F0V A;  5I6Y A;  5IGC A;  3NP8 A;  1STG A;  4WOR A;  3NQT A;  1KDC A;  2EY1 A;  1TR5 A;  2F0M A;  2HQE A;  4K14 A;  3SK5 A;  4H7B A;  1II3 A;  1SYD A;  4KTA A;  5J1Z A;  4KJO A;  4YIJ A;  1F2Y A;  1STB A;  5DAU A;  3V2T A;  5CV7 A;  2QDB A;  3C1F A;  5KIX A;  2RKS A;  2F0N A;  1A3V A;  2EYH A;  2SOB A;  4J1M A;  3MHB A;  1STA A;  2PW7 A;  4F8M A;  2PZW A;  4ZQ3 A;  5I9P A;  4N9P A;  5C5L A;  2F0P A;  2M00 A;  4S3S A;  1EZ6 A;  5IGE A;  3SK8 A;  1SYE A;  1STH A;  2SNM A;  3D8G A;  4HTH A;  4J6H A;  4KD4 A;  2PZU A;  2F0I A;  4N9T A;  1STN A;  2LKV A;  4PMC A;  2F0L A;  5CV4 A;  4B9X A;  2F0D A;  5KYL A;  5ISR A;  2F0W A;  2RBM A;  5F2D A;  4ME5 A;  5I9O A;  5KGU A;  4K5W A;  3LX0 A;  4EVO A;  1SYG A;  2ENB A;  3DMU A;  2OF1 A;  3ERO A;  1EQV A;  1EYA A;  3D4D A;  3TP6 A;  4DGZ A;  5IGG A;  2EYF A;  4KY7 A;  1KDB A;  1ENA A;  1F2Z A;  1STY A;  4K8I A;  2EYL A;  5CV8 A;  3SK6 A;  3OWF A;  2PYK A;  2EY2 A;  1JOQ A;  1RKN A;  1SNM A;  1SYF A;  3R3O A;  2EYO A;  1KAA A;  2PQE A;  3TP8 A;  1SND A;  3TP7 A;  1EY7 A;  3NK9 A;  3P1H A;  5KEE A;  4E6I A;  3QOL A;  5CC4 A;  4K8J A;  4NDX A;  4QB4 A;  3VA5 A;  4NP5 A;  3SHL A;  1JOO A;  3OMG A;  3EVQ A;  3NHH A; 
#chains in the Genus database with same CATH topology
 3GTJ B;  4JI6 L;  1DOL A;  1TWA B;  2RVL A;  3PUY A;  1D1I A;  1J5E L;  4OEM B;  1A3U A;  3EJI A;  2A74 C;  3ULJ A;  4EQP A;  2A69 D;  2N88 A;  3STB C;  4OGQ C;  3I4O A;  1SYB A;  2A6E D;  4EQO A;  4KHV A;  3I4M G;  1IKM A;  1JE5 A;  3DHQ A;  2TSS A;  4OWW B;  2ZJR A;  4DR2 L;  3ERQ A;  4HID A;  3RZD B;  1HZB A;  2JA7 G;  1S72 A;  1UE7 A;  3HFZ B;  5EKK A;  4JOI A;  3JAM c;  3DM1 A;  4QGU A;  3F1Z A;  4NXM Q;  1EY6 A;  1GHK A;  2YU9 H;  4HIO A;  4X3U A;  3MXN A;  3E9I A;  2K01 A;  1SYC A;  4GN5 A;  2OXP A;  3VYR A;  5IWA Q;  1VF7 A;  4JI4 L;  4O2D A;  1EWC A;  1HA5 A;  3FPP A;  1S5F D;  3SR1 A;  3URY A;  5FJ8 H;  2DJF C;  1X3Q A;  2K14 A;  1I4Q A;  4R4T A;  3HOY G;  4JPB W;  1DZ1 A;  1CSQ A;  1UEB A;  1FJG L;  1FVI A;  1LT5 D;  4KN4 C;  3KF6 B;  4A3E H;  2P5Z X;  4JI8 Q;  3NP8 A;  3OIP A;  5JVH 3;  4DV7 Q;  5FO7 B;  3OWE B;  1NAP A;  3K0Y A;  5AJ3 L;  2KEC A;  2NTS A;  4KJO A;  2VB3 X;  4A3B H;  2VUM G;  3OIQ A;  4TKO B;  5DAU A;  3JAM E;  1AP0 A;  2BOS A;  1MGS A;  2DUD A;  1RF2 D;  3NBH A;  5KIX A;  2WV6 D;  4DXG A;  4RHR A;  3KBG A;  1KNA A;  2Z4H A;  3IKJ A;  3PUW A;  4KHZ A;  1I94 L;  3UE1 A;  2F52 A;  4IPG A;  1EZ6 A;  3HGB A;  3SDZ A;  3I4M B;  1SYE A;  2K32 A;  3KF8 A;  3GTK B;  2D62 A;  4WFN 3;  2UU9 L;  2NZ1 D;  1PYS B;  4ME5 A;  5KGU A;  3PF5 A;  3FEW X;  3D4D A;  3FRP B;  2CQA A;  4DR3 Q;  1XTC D;  2K5V A;  4L5Q A;  1PTO H;  1PH1 A;  2PQA A;  2JA6 H;  1VF5 C;  2RSN A;  2X69 A;  4C3J B;  4DR6 Q;  1WCM B;  1K8M A;  5C4J H;  4IJL A;  5KEE A;  3QO2 A;  1Q12 A;  2OT2 A;  3DWA A;  2XNA C;  3QR8 A;  3J81 c;  2I07 B;  1PHJ A;  4LF8 L;  2ZT9 C;  3T51 B;  5C0X H;  1RD9 D;  2BH2 A;  1CZG A;  2RF4 A;  3RN5 A;  1E7Z A;  4HN7 A;  3TN2 A;  3MZ5 A;  3VYU A;  5CGK A;  5J3B A;  3CC2 A;  4TVA B;  3ULL A;  4M1U B;  5ELB A;  3HEJ A;  5EGT A;  1EY0 A;  2V4D A;  5ELD A;  4PMB A;  5IGB A;  3FDT A;  2K52 A;  1KDA A;  3T1H Q;  1PH5 A;  2SDF A;  3TZD A;  1EYG A;  4DK3 C;  1B9M A;  1L2F A;  4C1N K;  4BXX G;  3RR5 A;  3HOV G;  1HNX L;  3J81 E;  1LT3 D;  2EXD A;  3L3O C;  2IHE A;  1TT2 A;  1JC7 A;  1X9N A;  1LTI D;  1VQE A;  2OCE A;  3R93 A;  2LSS A;  5JEA H;  5K5P A;  3SVM A;  5IP7 G;  1EZ8 A;  3I72 A;  2QIL A;  3P75 A;  1VQK A;  2J4X A;  1YNX A;  1L1O A;  4A3I G;  3JC6 6;  3M7N A;  5FLM G;  1UNS A;  2CQO A;  4RCO A;  2L12 A;  4JI3 L;  1ML0 D;  3VR5 A;  4XYQ A;  2MPM A;  1WD0 A;  5J1Z A;  3A54 A;  5IY0 A;  4C3H H;  3MXU A;  4ALP A;  2RKS A;  1BCP D;  1X6O A;  2K1B A;  1S5E D;  1L0X B;  3M7G A;  1DGS A;  3BZD B;  4ZLT F;  2IL8 A;  5I9P A;  4LF6 Q;  1Y8O B;  4DN4 M;  4S3S A;  1F9R A;  5LHY 1;  2I5H A;  4PMW A;  5CMD A;  3J7A 5;  1IBK Q;  4A3E B;  3E3X A;  3VYT A;  3I4N H;  2E2H B;  4QIW E;  3ERO A;  1EYA A;  5IGG A;  4R4C A;  3HP3 A;  3J7Y W;  3S1R H;  2B2V C;  1HNW Q;  1LTG D;  2K4K A;  1QE6 A;  2V1C C;  3QG1 A;  3P1H A;  4CJ2 C;  1OXX K;  2ZTD A;  3AB9 A;  4A3M B;  1K8A C;  4LFC Q;  3KJP A;  2BDN A;  2CVR A;  5CBA E;  1X32 A;  1YHB A;  2F1M A;  4MTK A;  4JI6 Q;  4IFD G;  1J8I A;  2D0O A;  4JYA L;  4L63 B;  1JQY D;  4JBM A;  1G51 A;  3WWV A;  1J5E Q;  2N3S A;  4A3I B;  3MVV A;  3S1N H;  3MFG A;  3D6W A;  5IE8 A;  3EN2 A;  1TWG B;  2WAC A;  3T13 A;  1PTO C;  4POF A;  4DR2 Q;  1YNN D;  2CWA A;  2ES2 A;  1VQ7 A;  3V96 A;  4NXN L;  2XVS A;  3GTM H;  2EZV A;  1O7I A;  1YVC A;  1N9W A;  2B39 A;  5C3X A;  1VQ9 A;  4LFA L;  2WKC A;  1FL0 A;  2K5W A;  5D14 A;  1BUV T;  1EIH A;  2F3V A;  3TSS A;  2B8F A;  2QDL A;  5EBD A;  2EY5 A;  4X62 L;  2YYZ A;  3ZJY C;  3F2B A;  4IOC A;  4IUV A;  1O80 A;  3CCJ A;  5BR8 L;  4CBV A;  2R7Z H;  5E3F A;  2F4I A;  2E2D C;  2IJ0 A;  1T9H A;  1HQR D;  4IUQ A;  1FJG Q;  1VQ4 A;  4C56 C;  4YY3 L;  1EIF A;  1U5K A;  4X3T A;  4LF9 L;  3AEV A;  5H1S E;  3CQZ H;  1II3 A;  5AJ3 Q;  1QVC A;  2DY8 A;  3K58 A;  1SFO H;  4GS3 A;  3CCS A;  2C5C A;  1MKH A;  1F9S A;  1TU2 B;  1D8L A;  4FF2 A;  2QCP X;  4KD4 A;  1S4Z A;  4HTH A;  1XMO L;  4N9T A;  4LMQ D;  4GLA C;  4DV0 Q;  2YTV A;  4B9X A;  1IZ6 A;  4HSP A;  1SN8 A;  2Y0S B;  1TY2 A;  2UU9 Q;  5JJZ A;  2WAQ E;  1PRT F;  1C48 A;  2NN6 I;  4UAI A;  1E24 A;  2NVQ H;  3GTP H;  2KED A;  1XYI A;  5IYD H;  5LMN L;  4C3H B;  2HCC A;  4GNX B;  3K59 A;  1HR0 W;  2OQ0 A;  3T56 B;  3U4V A;  4JV5 Q;  3TP8 A;  3RD4 A;  4GNX C;  2NB0 A;  4LK1 C;  4K8J A;  4NDX A;  4LW1 A;  2YV5 A;  3SHL A;  2PCF B;  1PYB A;  2F0H A;  2LXK A;  3BDC A;  1KRT A;  1EQQ A;  5C0X I;  1N34 L;  1R4Q B;  5HUR A;  2GA4 B;  1HJP A;  2F0O A;  1IBL L;  3I4N B;  4DR7 Q;  1OO9 B;  1TWC B;  3NEL A;  2L1B A;  3ICE A;  5EKL A;  4CDD C;  5GAD C;  4O42 A;  1PH2 A;  1D5Z C;  4C1N I;  2E2I H;  1A6X A;  5TSS A;  4A4I A;  4JI1 Q;  4C2M H;  2E76 C;  4O0A A;  4DUY L;  3C46 A;  2EYJ A;  1JOR A;  2KQ3 A;  1NNX A;  4JW0 A;  3H0G G;  1SLJ A;  1D5X C;  2XGT A;  1YHA A;  3SEB A;  2BDO A;  1X3F A;  1JR0 D;  4NPS A;  4KLK A;  4OL7 A;  4A3J H;  3PO3 G;  4IAL A;  4B3M L;  3D6C A;  1G6Z A;  4ID6 A;  2JA5 H;  2JQO A;  4BS9 A;  1TS4 A;  4LF4 Q;  2HHH L;  4DFA A;  3UI2 A;  4DNI A;  3PIP 3;  4RHS A;  5NUC A;  4C3I G;  5DM7 3;  2Z6K C;  5ELC A;  1VQD A;  4L5R C;  3GTM B;  3S2D H;  3BDL A;  4DKA C;  1HPC A;  2I5M X;  1SEB D;  5IP9 H;  2NBF A;  5M3F H;  3NXW A;  3BZC A;  4IFD J;  1PFM A;  1JWS D;  2R93 H;  1QVF A;  1E2V A;  1DOM A;  1VQJ A;  4JI2 Q;  4J1M A;  1P8L A;  2AQ3 B;  2DNC A;  1E1O A;  4DAP A;  4R4I A;  5C44 G;  5ELF A;  1HTL D;  4LWC A;  2SNM A;  5A35 A;  2RCF A;  4DAY B;  5FLX L;  3O13 A;  1HUN A;  2F0D A;  3DWP A;  4LF7 Q;  3I91 A;  1CQV A;  2WP8 J;  2A68 C;  3QIA A;  4PZ6 A;  4BY1 H;  5FLX c;  5FO9 B;  4JI8 L;  4EVO A;  2SEB D;  4QL5 A;  1QNU A;  3CQZ B;  1UE5 A;  3LWE A;  3TBI B;  3H0G B;  3MTS A;  5A2Q L;  4EGV A;  2B2V A;  3QWN A;  3M4O B;  2B63 G;  5LMU L;  1SFO B;  3PO3 B;  4ILW A;  5ELO A;  2UXC L;  1SBB B;  4GKK L;  3Q0A A;  1WTV A;  2E5L L;  4O1N A;  2XRS D;  4A3K B;  1FD7 D;  1HA6 A;  4NW2 A;  4XXE A;  1SSO A;  1YEZ A;  4C3I B;  1TWA H;  2MO0 A;  4JI7 L;  4JYA Q;  4OO1 I;  4XDX A;  1LTA D;  3GTP B;  2NVQ B;  4DR3 L;  4XTC S;  4RA8 A;  1XXG A;  4DR6 L;  1SNQ A;  4X66 Q;  4MZ9 A;  2AUJ D;  3KOJ A;  2F3I A;  4M8A A;  1DM0 B;  4JBW A;  3HOX G;  4QJF A;  1AE2 A;  3RZD H;  1EFI D;  2NUC A;  2K6A A;  3NUC A;  4FF3 A;  3G6E A;  2F0U A;  4KD3 A;  5CV9 A;  1EU4 A;  4XT3 B;  5CYU A;  3MXP A;  1E2Z A;  4TRD A;  4R8I A;  1LT4 D;  4OX9 L;  1WTH A;  3CPW A;  1C9O A;  1SNC A;  1LAC A;  3FMC A;  3TS0 A;  5HGT A;  4GKJ L;  2EPB A;  2E2I B;  1QZH A;  2KCC A;  1ZXT A;  3A0J A;  2CH4 A;  2OWO A;  3W1G A;  5BR8 Q;  4FXG C;  1GUW A;  1QNK A;  1BBW A;  1U4P A;  2EOT A;  3T1H L;  4DV5 L;  2VY3 A;  4YY3 Q;  4A3G G;  5IT9 L;  3A5Z B;  3HOU G;  2E2J H;  3NPP A;  1XNQ L;  2WII B;  1HZA A;  1L0Y B;  5JPM C;  1EWI A;  1JE4 A;  4HJ7 A;  2EYH A;  1S5C D;  2LXJ A;  1X3G A;  2K5H A;  3A74 A;  4ZQ3 A;  3K8A A;  2VNU D;  3CXC A;  1D7Q A;  3GTG H;  3AFQ A;  2LKV A;  3I4M H;  5C4X G;  1Q1B A;  3HOX B;  2VB2 X;  1G8Z D;  1PRT D;  1K9M C;  1KQS A;  2JA7 H;  1EL0 A;  1VQM A;  4JBK A;  1F2Z A;  2KEN A;  2WAQ G;  5LMN Q;  1CT1 D;  3I90 A;  2JA8 G;  1RCV D;  4GNX A;  4JI5 Q;  1GKH A;  3PO2 G;  1D6E C;  3N6R A;  3TP7 A;  2YTX A;  3A8I E;  1WCM H;  1EIG A;  1LTR D;  2H1E A;  2WB1 B;  4LF6 L;  2B29 A;  1CKM A;  3M4Y A;  3RMH A;  1JOO A;  4UY8 C;  1SRU A;  3NBI A;  5G3L F;  2K5Q A;  4GN3 B;  4R1J A;  4AYB G;  4BY1 B;  5C5M A;  1GO3 E;  3U58 A;  2RSO A;  1IBL Q;  4QQB X;  5K36 G;  3H3V H;  4K0K Q;  1IBM L;  3HOY H;  1Y8P B;  3BS1 A;  1SJH D;  1CTM A;  3T53 B;  3PIO A;  1EY8 A;  3HG9 A;  4A3G B;  1EY5 A;  5M5Y H;  1BVS A;  4DA2 A;  4FO2 A;  5D3I B;  3AFP A;  3GTL B;  1LM0 A;  4Q5V A;  3J80 E;  2VUM H;  3OMC A;  1LO5 D;  4CJ0 B;  3I4L A;  5M3M G;  3T1Y Q;  1M1K C;  4GOP B;  1JIC A;  3HS0 C;  4KY5 A;  4GOP C;  1GHJ A;  1KD1 C;  2R3Z A;  1K0S A;  2NWG A;  1BNZ A;  4B3M Q;  2UXB Q;  3K81 C;  1CKN B;  3KDF B;  3SGI A;  2PW5 A;  1YNJ D;  1ESF A;  3LGJ A;  1IYJ B;  3OPO A;  2HHH Q;  3L2P A;  1LUZ A;  3OOC A;  2Z6K A;  1EFW A;  4PG3 A;  1J9O A;  2CHB D;  2PI2 A;  3UDI A;  3JAM i;  2K75 A;  5CV6 A;  3BU2 A;  2FIN B;  3E0J A;  5AFW A;  4BY7 G;  4IPD A;  4RG1 A;  4UP9 A;  4A75 A;  4YWK A;  1HZ9 A;  4N8F A;  5I6Y A;  1M4V A;  2ICI A;  2AQ1 B;  4IUR A;  1BO0 A;  3BZK A;  2R7F A;  4XQN A;  2HQE A;  3MAQ A;  4H7B A;  4AYB B;  1STB A;  4B3S L;  3DXJ C;  3L0O A;  2N49 A;  1STA A;  2ASB A;  1ET6 A;  1NJI C;  5C5L A;  2F0P A;  1WTX A;  2F0I A;  1WFQ A;  4GLX A;  1V1P A;  2HD3 A;  1CUK A;  3GQB A;  2HDM A;  5T1I A;  5KYL A;  2A1A A;  1PV4 A;  1K28 A;  4FDB A;  4CKE A;  1Q46 A;  5M3M B;  2E2H H;  2E2J B;  1BBX C;  3P20 A;  2EYL A;  1G91 A;  1YBY A;  2K7V A;  5EPL A;  3PCO B;  2I46 A;  1BF4 A;  4B3R Q;  5LMU Q;  4KMU C;  3VDY A;  4BXX H;  1HZC A;  1Q81 C;  2UXC Q;  2KVM A;  3HOV H;  1V8Q A;  4GKK Q;  2QKI C;  2E5L Q;  4A3M H;  3GTG B;  1K83 B;  1JB3 A;  3OMG A;  1TWH H;  1G6P A;  4DV0 L;  4R8N A;  4BWG B;  2IPK D;  1V1Q A;  4HMJ A;  2KEE A;  4JI7 Q;  2MP1 A;  4RKB A;  5IP7 H;  4KHP L;  4DV4 L;  2LY7 A;  3KJO A;  2JA7 B;  1A2U A;  1I50 B;  2FXQ A;  2HDL A;  2ID0 A;  1K3R A;  1JOK A;  2RDG A;  4IUU A;  1TS2 A;  3SK4 A;  4A3I H;  4FF4 A;  5FLM H;  5GQO A;  1GD7 A;  1T5X D;  3I7F A;  4LUZ A;  4ZKC B;  4A3D G;  4JV5 L;  1TWG H;  1JWM D;  3J81 i;  1RTN A;  1IW7 D;  1WVL A;  2QGQ A;  1VMP A;  4RGM A;  4ABN A;  4K5X A;  3HOW G;  3CCL A;  1CI3 M;  4J15 A;  4ZUJ A;  5C6A A;  4GZY C;  3TRE A;  4LJZ C;  1UAP A;  3W3A A;  2PI2 E;  1PFN A;  1B2T A;  3CRK C;  1K8O A;  4DR7 L;  3HOY B;  2MGS A;  4K6D A;  1EIY B;  2JEB I;  5C3W A;  3H3V C;  2F4V L;  4OX9 Q;  1AH9 A;  1EYC A;  3OHX C;  5IOC A;  4GKJ Q;  5M5Y B;  1KL9 A;  1MJC A;  1V1O A;  1L0W A;  4RFB A;  4KK7 A;  4POG A;  4JI1 L;  1SNO A;  2ZXP A;  5JAV A;  1HXY D;  2ZJP A;  2NZO A;  2VUM B;  1GJX A;  1WTQ A;  4N8X 1;  1P16 A;  2VXW A;  2FFK B;  4OIJ A;  3QB3 A;  4KKU A;  1JT8 A;  2F0K A;  4Y7N H;  4DV5 Q;  4DV2 L;  1XPU A;  1G2T A;  1QIL A;  4CHT B;  1Q7Y C;  3RN2 A;  1KIX A;  2KA7 A;  4IFD H;  3V2T A;  1XNQ Q;  1OXU A;  1MD2 D;  2JSO A;  4LF4 L;  2XSC A;  3K80 C;  4F8M A;  1XPO A;  2OTJ A;  3HKZ E;  2Z0S A;  2EE1 A;  5IGE A;  3TZU A;  4A3D B;  1PVO A;  2B2T C;  2JJQ A;  5BN5 A;  1Z9F A;  1XNR L;  3S1M H;  1K3B C;  1QB5 D;  3IFT A;  1ZKO A;  3TP6 A;  1B9N A;  1XJV A;  3C3L A;  3BG3 A;  3IAY A;  4JC0 A;  1F9Q A;  1Z47 A;  4DXF A;  4JI2 L;  4HJ9 A;  1W2B A;  2JYO A;  5CC4 A;  3IFD A;  3L9A X;  1I4P A;  3CKI B;  1VQA A;  5CBE E;  2NN6 G;  4XIG S;  5G3L D;  4ZCK A;  2JA6 G;  2F0Q A;  1X54 A;  3H3V I;  3PUZ A;  4LF7 L;  2HIV A;  1LTL A;  4R4Q A;  1M8A A;  5EPK A;  1CFM A;  4MTN A;  3D4R A;  1IBM Q;  1LTT D;  4LUV A;  1TWC H;  1JJG A;  1Y1V G;  2MJ8 A;  2BE5 C;  1LT6 D;  5IYC G;  5M9O A;  4NB3 A;  5CV5 A;  1A3T A;  3HOV B;  3S9W A;  1VQH A;  1Q82 C;  4RAU C;  1LYL A;  1SR3 A;  1TWH B;  3QOJ A;  3ER0 A;  3PV0 A;  1GUO A;  2B2U C;  5JPN C;  1E22 A;  4HAE A;  3TDQ A;  4GOP A;  4F7X A;  2KCN A;  1H9J A;  2F0F A;  5DLQ E;  1EY4 A;  1W6K A;  3M9B A;  4R4O A;  1CHQ D;  1OXT A;  4G7O C;  2F0E A;  1PZI D;  3MFY A;  3KDF A;  4X66 L;  3I8Z A;  1SMY D;  1HCZ A;  2RDH A;  2SNS A;  1A62 A;  3NWT A;  1ASY A;  3UDG A;  1ENF A;  2EDG A;  4KJN A;  5HGQ A;  3GO5 A;  2KCM A;  1V9P A;  2FMM A;  1QUQ B;  2KHI A;  4PNY A;  4DV1 L;  4L5T A;  2D9U A;  3MC0 B;  1EQT A;  2GVB A;  3NSW A;  1Y1W G;  1H9R A;  3F8T A;  2O5I C;  2N78 A;  2N55 A;  1TR5 A;  3GV3 A;  1F77 A;  4YWM A;  4X64 Q;  4YIJ A;  1B70 B;  3CCU A;  4B3S Q;  3C1F A;  3STB D;  3G71 A;  1W6J A;  2F0N A;  2K28 A;  5I2X A;  1QVG A;  1VQ6 A;  3HOZ G;  1B53 A;  2NVT B;  1HFN A;  1H9M A;  4N9P A;  1ET9 A;  1PTO F;  2UUB Q;  1N32 L;  1IKL A;  3GTO H;  5M5W B;  5GRO A;  2MO1 A;  1STN A;  4YCV A;  4XT1 B;  4Y7N B;  1NCV A;  3DUZ A;  5GAH C;  1V43 A;  2FHT A;  2Q2H A;  3LX0 A;  3RZO B;  1SYG A;  3KF6 A;  4PQX A;  2ZJQ A;  5JJK A;  4WJW A;  1EU3 A;  3DEP A;  2UUA Q;  4OHJ A;  2NTT A;  3H0G H;  4H44 C;  2JEA I;  2NYZ D;  1I6V C;  2PYK A;  4J8Q A;  3M4O H;  1VQL A;  5COR A;  3NTH A;  1PYW D;  1EY7 A;  4FYD A;  3K5L A;  3PO3 H;  1PRT B;  4UP7 A;  1LTS D;  1GUS A;  3PMF A;  2B8G A;  4A3K H;  1C7Y A;  2G5D A;  3S1M B;  3I73 A;  1VQI A;  3S15 B;  4FVM A;  4Q0F A;  2IY5 B;  4C3I H;  4KHP Q;  4HJ8 A;  1U9R A;  4DV4 Q;  1KC8 C;  1UE1 A;  4IZ8 A;  4KKT A;  4DU9 A;  2Q8T A;  5CR3 A;  4OXP A;  3K0X A;  4JI5 L;  2A73 B;  1EY9 A;  1Q8K A;  1K8G A;  1SXT A;  1I5F A;  5BN3 A;  4QUC A;  1E3P A;  3CP0 A;  4DNR B;  2CH4 W;  1X65 A;  4OO1 G;  1PH6 A;  1BR9 A;  4ZK9 B;  2XWB B;  3T16 A;  2Q2U A;  2HIX A;  4QMG A;  3HOZ B;  1GOZ A;  2JXM B;  4NKL A;  3A8J E;  1I4R A;  5IYB G;  5C44 H;  4A3F G;  2VL6 A;  4K0K L;  4Z9C B;  1I6H B;  2F4V Q;  3RUZ A;  4DV6 L;  2AUK A;  4IN3 A;  3E5S A;  3NE5 B;  2KBN A;  3K5O A;  1OTC A;  2QEJ C;  3FPU B;  1E2W A;  2IWH A;  4HR7 B;  4HIM A;  1TS3 A;  4EX5 A;  1HH2 P;  1KLU D;  2F0G A;  5IGD A;  2B63 H;  3T1Y L;  4KN7 C;  1CK1 A;  1H9S B;  3EIV A;  4LUO A;  2A69 C;  1IL2 A;  1STG A;  1CA6 A;  4WOR A;  1B1Z A;  1YNJ C;  2A6E C;  1FNW A;  4DV2 Q;  3SK5 A;  3PSI A;  4PZ7 A;  2UXB L;  2GN5 A;  4L8J A;  2XRQ D;  5FK9 C;  1H9K A;  1KHI A;  1VS0 A;  2WKD A;  4ZYS A;  4DR4 L;  1S5B D;  5BN4 A;  1EEF D;  3MHB A;  2RHS B;  2JE6 I;  3K5M A;  2A8V A;  3I56 A;  2Q2T A;  4WJ4 A;  2B2T A;  1QG7 A;  5D65 A;  5C0X J;  2PZU A;  4QY7 A;  5CV4 A;  1X55 A;  5F2D A;  1XNR Q;  1VQ8 A;  2BH8 A;  4FP5 D;  4RMF A;  3HOX H;  5M5X H;  2RA4 A;  2B2W C;  4KY7 A;  4CDC C;  1TS5 A;  2I5L X;  1JOQ A;  1SYF A;  2Z6B A;  1EEI D;  4A3F B;  2PQE A;  4AQY Q;  1VQG A;  1WTP A;  1NMF A;  3GTO B;  3FKI G;  5DM6 3;  1PDQ A;  1B8A A;  4F88 A;  5C3E G;  1PMR A;  3U50 C;  1E0B A;  2L15 A;  1HHV A;  3ND8 A;  2EVB A;  1EOT A;  2VQF L;  3KFU A;  1G29 1;  3T4A C;  2B3G A;  5JEA J;  1TQO A;  2XTI A;  4B3R L;  4YHH L;  5E1F A;  4A3G H;  3HOU H;  5EBC A;  2LS0 1;  3GTL H;  3DEO A;  2B2U A;  4RKL A;  1YI2 A;  5JOB A;  5KNB A;  4B9W A;  5E4X A;  2TMP A;  2K33 A;  2OEO A;  4TSS A;  1A2T A;  1GUG A;  4BBR G;  3AQQ A;  5JJI A;  3MEH A;  5C4X H;  2KUM A;  1IW7 C;  2KHJ A;  3EA6 A;  2PPB C;  1A8V A;  4RGO S;  3UDX A;  5FLX E;  1TWF H;  3KF8 B;  2NVY H;  1X56 A;  4A3C G;  3H15 A;  2JA8 H;  4G4K A;  4A93 G;  4DV1 Q;  5I2Y A;  1O7Y A;  5A2Q E;  3D0F A;  1PH4 A;  4UHV A;  1EYD A;  5I6W A;  5C44 B;  1DXM A;  4V0B A;  3CC4 A;  2EY1 A;  2L55 A;  2MHV A;  1SYD A;  5JVG 3;  5M3F G;  5ELN A;  4JBJ A;  1B3A A;  1PTO D;  3Q24 A;  1QOH A;  4OWT B;  4QIW B;  1YJN A;  1N32 Q;  1A15 A;  2B63 B;  4BBS G;  2R93 G;  1N36 Q;  2R7D A;  3R2I A;  4BA1 I;  4RGT A;  3WOE A;  5M3M H;  1R4P B;  3SK6 A;  2Q8R E;  3OWF A;  2EY2 A;  5IT9 c;  3TS2 A;  1X3P A;  2CW0 D;  3KK7 A;  4BBR B;  4BA2 I;  1LV9 A;  4JCV E;  3CD6 A;  3S1Q B;  1IYV A;  1J6Q A;  4FNF A;  4DR5 Q;  3RLF A;  2E8G A;  1K83 H;  1WTO A;  2R92 G;  5FKA C;  1CHP D;  2EXZ A;  3X3N A;  2D2C C;  3J80 i;  3A7A B;  1GUN A;  3MXG A;  2ATW A;  3HZX A;  5M5X B;  4A3L G;  4A93 B;  1BCP B;  2A6H D;  4BY7 H;  1CSP A;  3J7A F;  3NTI A;  1HNZ L;  4DUZ Q;  1I50 H;  1BCP C;  1S5D D;  4A76 A;  1RDP D;  1VQO A;  1C8C A;  4UDU C;  1L1O B;  2D0P A;  2MFI A;  1HR0 L;  1OXS C;  3VYS A;  3G4S A;  4DPG A;  2RDF A;  1AN8 A;  5IT9 E;  5LL6 S;  3Q22 A;  2B2Y C;  1VQC A;  2PZT A;  2KHS A;  1UEA B;  3MA2 B;  1DD2 A;  2JN4 A;  1VQ5 A;  4DV6 Q;  4HMI A;  1SE3 A;  1UWV A;  1ONL A;  4HCS A;  3AU7 A;  5C4Z A;  1DOK A;  2CWP A;  4G7Z C;  4DAM A;  4KY6 A;  3HOU B;  3KLW A;  3HKS A;  5E4W C;  4LFB L;  1U4R A;  4IPH A;  1VQN A;  2K5D A;  2F3W A;  3SXH A;  1PFS A;  4P2C B;  2IT1 A;  3M3Y H;  3H6M A;  3OW7 A;  4I65 A;  5GAE C;  2AKW B;  1TXY A;  3VR4 A;  3W2D A;  1WD1 A;  4G7H C;  4B3T L;  1PXU A;  4K14 A;  1SE4 A;  5C4X B;  1F2Y A;  2BCO A;  1GM5 A;  1NE3 A;  1YNN C;  3IL8 A;  2Z1C A;  1RHP A;  2Z4I A;  3Q23 A;  4DR4 Q;  1A3V A;  1S3O A;  1TWF B;  2HQL A;  2OTL A;  4P75 A;  2VQE L;  1STE A;  2NVY B;  2WAQ B;  2L9H A;  2JA8 B;  1STH A;  2N8N A;  2R61 A;  4GN4 B;  3PO2 B;  1SE8 A;  4A3D H;  5ISR A;  2F0W A;  3J7Z C;  2NZH A;  3LNN A;  1Q3L A;  4K5W A;  3BYT B;  2ZM6 Q;  2B2W A;  3HOW H;  2O2L D;  2A5H A;  1ENA A;  2MUY A;  3W5O A;  5CV8 A;  4X64 L;  2Y0S E;  1A0I A;  1NR4 A;  1ESR A;  3JAM L;  4RH6 A;  1W3S A;  2UUB L;  3A55 A;  2L4N A;  1RL2 A;  3GP7 A;  3S16 B;  2EYM A;  1MI2 A;  2WIN B;  3P7J A;  4KV6 A;  3TQY A;  3C1E A;  4C3J G;  4DAY A;  1KAB A;  1WCM G;  2KJX A;  2VQF Q;  1KNE A;  1QZG A;  4DV3 Q;  2DN8 A;  3NWS A;  3U4Z A;  2UUA L;  1PA6 A;  2PMZ B;  2EQS A;  4UPA A;  1SMX A;  4MHE A;  2IHF A;  5J39 A;  3BJU A;  4YHH Q;  3MEF A;  1N33 Q;  3S14 H;  1IXR A;  2QEX A;  2ZTC A;  2ALY B;  1Y14 B;  3E9H A;  3ND9 A;  3I55 A;  4YCW A;  3H91 A;  2HUG A;  5C4H A;  3PGZ A;  4BY7 B;  2A68 D;  1DYQ A;  1SNP A;  4OEL B;  2L5T A;  1F2M A;  3KLS X;  2CFM A;  4LF5 L;  3K6O A;  5J22 A;  3CCR A;  2PNR C;  1ZYR D;  1NUC A;  2ICE C;  5LMN W;  1HQM C;  5KNC A;  1NBW A;  2L11 A;  4MN3 A;  5DEH A;  4NMZ A;  1DCZ A;  2DJG C;  1SDF A;  2XWJ B;  3QJY A;  2PO4 A;  3EQL C;  1XPR A;  3TEH B;  2NN6 H;  1FNU A;  4KTA A;  3S24 A;  3VR2 A;  1Q8I A;  2UUC L;  5I4D A;  1B4O A;  3J81 L;  3PQI A;  2SOB A;  4I7A A;  2PW7 A;  1BDO A;  2E75 C;  1Y1V H;  2NVT H;  2GVA A;  4ME3 A;  5IYC H;  4DR1 Q;  3TRZ A;  2F0L A;  5M5W H;  2CKZ B;  3VR3 A;  2NVX H;  3M3Y B;  1U4L A;  1UUP A;  1Q86 C;  4U68 A;  3BVG A;  3DMU A;  3RZO H;  5FJ8 G;  1K73 C;  3GTQ B;  1LAB A;  1AZP A;  3Q8D A;  3PF4 A;  3NK9 A;  4A3E G;  2IX1 A;  3A56 A;  4DK6 C;  1VDZ A;  2Q2I A;  1HRJ A;  1PZK D;  1Q90 A;  3G7L A;  3PIO 3;  4A3B G;  1BXT A;  3N52 A;  1G2S A;  5E7N A;  5KRU A;  3V05 A;  3S15 H;  3HOW B;  3E0E A;  2AWN A;  1TVX A;  4A3M G;  3BYY B;  1HNZ Q;  1ICW A;  1IL8 A;  3NEM A;  1Y1W H;  4H13 C;  4AH6 A;  4HED A;  4AQY L;  2Z9H A;  4HJ5 A;  2KOL A;  5DNF A;  4QCL A;  3ERS X;  1HR0 Q;  4OWX B;  1CZW A;  3ONA B;  1D5M C;  5COY A;  2YU9 B;  1JB7 A;  3HOZ H;  2FMC A;  2B2Y A;  5IGF A;  4H02 A;  1ROD A;  1IHZ A;  3CME A;  1MSG A;  1NMG A;  3G48 A;  4F87 A;  2J0T D;  3RNU A;  5D3D A;  1I6H H;  3PUV A;  4XQJ A;  2EY6 A;  1RIP A;  1SRO A;  4DK0 A;  3CCE A;  2IW3 A;  5C0X G;  4TQU S;  3S14 B;  4IO9 A;  4YWL A;  4LFB Q;  1MJE A;  1I3Q H;  3GD7 A;  3AYH B;  3PIP A;  3ZYY X;  3CMA A;  2K04 A;  4A3B B;  4B3T Q;  1MSH A;  1CQF A;  5CV7 A;  2K5N A;  5KND A;  1CKN A;  1I4H A;  1K0R A;  2AQ2 B;  4DK1 A;  1O78 A;  4JG2 A;  2VQE Q;  4CDF C;  1PH3 A;  2M00 A;  2QW7 A;  1TII D;  1XTD A;  4PMC A;  4R9W A;  2H4O A;  5I9O A;  3AMU A;  1FGU A;  2VZA A;  3KBX A;  5JEA G;  4OO1 H;  4IJH A;  1PTO B;  4K8I A;  2JA6 B;  2AWO A;  3D3R A;  3NTK A;  1PH7 A;  2AMC B;  1RKN A;  5C4J B;  4IUT A;  4ZAI A;  5IYB H;  4A3F H;  4E6I A;  3WDN A;  1ILQ A;  2Y0S G;  2G9H D;  3E6Z X;  4X65 L;  1Y1V B;  1M90 C;  1B3Q A;  2J7Z A;  1MBY A;  3EVQ A;  3C2P A;  4ULL A;  2NVX B;  3OYY A;  1KRS A;  1N36 L;  4C3H G;  1WOC A;  2HCI A;  4ODG A;  4P72 A;  1LTB D;  1BKB A;  2WB1 E;  1C0A A;  4IPC A;  4LAA A;  2C9O A;  2CW0 C;  1WTW A;  4L5S A;  3A7L A;  2RCN A;  1JJ2 A;  1ILP A;  1EQR A;  3I2Z A;  4JI4 Q;  1R9T H;  4FXD A;  3GDE A;  1JMC A;  3DM3 A;  3I4N G;  4P73 A;  1JJC B;  5GAG C;  1UE6 A;  1B44 D;  4JI0 L;  4DR5 L;  4I7Z C;  1C4Q A;  2EYP A;  4CKB A;  1PRT C;  2A6H C;  5IIF A;  2IX3 A;  2E74 C;  4IUP A;  2K05 A;  2R6G A;  3CPF A;  5JJL A;  4HIK A;  1VMC A;  2X6G A;  4DUZ L;  1Y1W B;  3TP5 A;  1TY0 A;  4B08 A;  2F03 A;  1PH8 A;  4LF5 Q;  2K50 A;  1I94 Q;  4MNO A;  4WJ3 M;  2DNE A;  3OSO A;  1JCK B;  2YTY A;  2DGY A;  3GV6 A;  4DNT B;  4G57 A;  1X3E A;  2CCZ A;  4OIK A;  3OW2 A;  1HTP A;  2F0V A;  1GXD C;  1MIU A;  1RTO A;  4JVZ A;  3NQT A;  4P74 A;  2VS1 A;  3FKI H;  5C3E H;  3X3M A;  2UUC Q;  5T1G A;  1T5E A;  3CC7 A;  1U0L A;  3CRL C;  2PNH A;  4AYB E;  1O7L A;  1XX8 A;  1I3Q B;  3OTO L;  4LF8 Q;  2EJF C;  4IQZ A;  3BVZ A;  3CCV A;  3KYH C;  2UXD L;  2OF1 A;  4PZ8 A;  4IFD I;  4OON A;  3S1R B;  2R7Z G;  1STY A;  3SE0 A;  1XMQ L;  3UDF A;  2LMC B;  3M4P A;  1ICF B;  3A5U A;  3CCM A;  1SND A;  3KLS A;  3QOL A;  2BA0 A;  4BBR H;  4IOA A;  4NP5 A;  3S1Q H;  2PMZ E;  4HSV A;  3NHH A;  1KAW A;  3RLN A;  3CHB D;  3A8K E;  4ZUI A;  1OXV A;  3IRB A;  3HKZ G;  1NTG A;  1FR3 A;  1BOS A;  1YZ6 A;  5FOB B;  1EUJ A;  3ITP A;  2ZM6 L;  3S1N B;  1FNV A;  4A3C H;  1B50 A;  1HNX Q;  1N8R C;  2MNA A;  3BDO A;  4A93 H;  2JK8 A;  2I0Q A;  2OQK A;  4A3K G;  4RCN A;  3M85 A;  4WRD A;  5EQ0 A;  3KUP A;  2QA4 A;  2DY7 A;  2ZXO A;  1KTK A;  1U4M A;  3M4Q A;  5ELE A;  1CKO A;  4P71 A;  4XYO A;  3F2U A;  5IOD A;  1SE2 A;  5IYD G;  5EKI A;  4JOI C;  1AW7 A;  2XIW A;  5EPJ A;  3S17 H;  4NXM L;  1VQB A;  1Y8N B;  4K2L A;  1NY4 A;  1NR2 A;  2F0T A;  1QJO A;  2M9V A;  4DF7 A;  2HT1 A;  4JI3 Q;  3MXN B;  1FGB D;  3J7A V;  1D1K A;  4UP8 A;  4DV3 L;  4BBS H;  1SAP A;  4GLV B;  5IWA L;  1MHW C;  1R9T B;  2VW9 A;  4RWS C;  3UE0 A;  2R7Z B;  2Q8I B;  1QCB D;  3U9O A;  3W1B A;  1N33 L;  1V1P B;  3K7A H;  1AE3 A;  3EFX D;  1E1T A;  4HJA A;  3TME A;  4MIU A;  1BQQ T;  1LLR D;  2KCT A;  3CW2 C;  4EQN A;  3ULP A;  1H95 A;  1XWE A;  4APV A;  1PLF A;  2LFN A;  3BVM A;  4DV7 L;  5IGC A;  3F2C A;  4AIM A;  1YJW A;  2EJM A;  1F9P A;  2G9D A;  3HKZ B;  1WJJ A;  3NBH B;  3DLL A;  3H09 A;  2R92 H;  3CF5 A;  2K03 A;  3S2H H;  2BE5 D;  3Q6S A;  4JK1 C;  4A3L H;  1ZYR C;  2EIF A;  3R2T A;  2PZW A;  2A19 A;  4A3J G;  3SK8 A;  2XN9 C;  2MQH A;  3GTJ H;  1QUQ A;  2D5D A;  2JA5 G;  3PO2 H;  3EBE A;  2O5J C;  4QUF A;  1RJT A;  3K7U C;  3I3C A;  2JA9 A;  3FKI B;  1EQV A;  4HCE A;  3NQI A;  2EYF A;  5C3E B;  1KDB A;  2PQA B;  3CU7 A;  2FJ2 A;  1HFG A;  1YJ9 A;  1SNM A;  3R3O A;  4L6T B;  3VA7 A;  4H0L C;  3FHW A;  1AZQ A;  5IP9 G;  2X6L A;  3U9S A;  5K36 H;  4U67 3;  4QB4 A;  3VA5 A;  4X65 Q;  2QF7 A;  5EAY A;  3CAM A;  4NXN Q;  3B6Y A;  3S16 H;  4DR1 L;  3KLR A;  4LFA Q;  3R8B A;  5LL6 X;  1Q1E A;  3D4W A;  2EJG C;  1ASZ A;  4ZKB B;  2M2L A;  2H5X A;  1NSN S;  3H94 A;  1I4X A;  4X3S A;  2ZXR A;  1CA5 A;  2WB1 G;  3J81 j;  3DWQ A;  1DON A;  4X62 Q;  1AEX A;  1IYU A;  3I70 A;  4K5V A;  1ENC A;  3LWU A;  4CJ1 B;  5KYI A;  4DAV A;  4C2M B;  1ZEQ X;  2RQX A;  4BY1 G;  3WOF A;  2AHO B;  1AFP A;  1GVP A;  1Z7T A;  4JI0 Q;  4ZRZ A;  1SJE D;  1WI5 A;  1O7Z A;  1EOV A;  1BBU A;  1GUT A;  2F0J A;  4IUN A;  4A3J B;  4CGY B;  1CM9 A;  4LF9 Q;  4Y52 H;  2JA5 B;  3FP9 A;  2O4X A;  3VR6 A;  3HRZ C;  1PZJ D;  1I4G A;  4QF4 A;  4V19 0;  3D31 A;  1A63 A;  3K5N A;  3S2D B;  1B7Y B;  1VQP A;  4KKS A;  1WTR A;  3L7Z C;  5FO8 B;  5HY6 A;  4XQQ A;  1DJR D;  1XMO Q;  2ZTE A;  5M3F B;  1L1O C;  3S17 B;  3GTK H;  1YIT A;  4FXK C;  4K2K A;  3J80 L;  3K57 A;  2F0S A;  4PV1 C;  3G6J B;  3J80 c;  4X3K A;  1KDC A;  4BBS B;  2IX0 A;  2F0M A;  3RLO A;  2R93 B;  4CKC A;  1Z6H A;  1YHQ A;  2JP1 A;  4FF1 A;  5L37 A;  2QDB A;  4C3J H;  4LNQ A;  1F2L A;  1VQF A;  1VCI A;  5EJW A;  4KI0 A;  1WYD A;  1YIJ A;  2L0C A;  4EQ5 A;  1BCP F;  3K7A B;  3NEN A;  1Y69 U;  1S40 A;  3PUX A;  3D8G A;  4J6H A;  4RGN A;  3OTO Q;  1N34 Q;  1IBK L;  1QWY A;  2RBM A;  2C35 B;  3FVQ A;  2ENB A;  1EWH A;  4DGZ A;  2UXD Q;  1D2B A;  1H9S A;  1JWU D;  1PFB A;  4CDE C;  3MWY W;  1PH9 A;  1XMQ Q;  1HNW L;  2R92 B;  1SMY C;  2WFW A;  1HUM A;  3S2H B;  4YCU A;  3F2D A;  2EYO A;  4X6A H;  1KAA A;  3GTQ H;  1KLG D;  2Z8L A;  3CCQ A;  1FYC A;  4LFC L;  1TKW B;  4DUY Q;  2BA1 A;  1KXL A;  4K6L A;  2RHQ B; 
#chains in the Genus database with same CATH homology
 3GTJ B;  1DOL A;  1TWA B;  2RVL A;  3PUY A;  1D1I A;  1A3U A;  3EJI A;  2A74 C;  4EQP A;  2A69 D;  2N88 A;  4OGQ C;  1SYB A;  2A6E D;  4EQO A;  4KHV A;  1IKM A;  3DHQ A;  2TSS A;  3ERQ A;  3RZD B;  5EKK A;  3DM1 A;  1EY6 A;  1GHK A;  4X3U A;  3MXN A;  2K01 A;  1SYC A;  2OXP A;  3VYR A;  1VF7 A;  1EWC A;  1HA5 A;  3FPP A;  1S5F D;  3SR1 A;  3URY A;  1X3Q A;  1I4Q A;  1DZ1 A;  1LT5 D;  4KN4 C;  3NP8 A;  3OIP A;  5JVH 3;  5FO7 B;  3OWE B;  1NAP A;  3K0Y A;  2KEC A;  2NTS A;  4KJO A;  2VB3 X;  3OIQ A;  4TKO B;  5DAU A;  3JAM E;  1AP0 A;  2BOS A;  1MGS A;  1RF2 D;  3NBH A;  5KIX A;  2WV6 D;  4DXG A;  4RHR A;  3KBG A;  1KNA A;  2Z4H A;  3IKJ A;  3PUW A;  4KHZ A;  1EZ6 A;  3HGB A;  3SDZ A;  3I4M B;  1SYE A;  2K32 A;  3KF8 A;  3GTK B;  2D62 A;  4WFN 3;  2NZ1 D;  4ME5 A;  5KGU A;  3FEW X;  3D4D A;  3FRP B;  2CQA A;  1XTC D;  1PTO H;  1VF5 C;  2RSN A;  2X69 A;  4C3J B;  1WCM B;  1K8M A;  5KEE A;  3QO2 A;  1Q12 A;  2OT2 A;  3DWA A;  2XNA C;  2I07 B;  2ZT9 C;  3T51 B;  5C0X H;  1RD9 D;  1CZG A;  4HN7 A;  3TN2 A;  3MZ5 A;  3VYU A;  5CGK A;  4M1U B;  5ELB A;  3HEJ A;  5EGT A;  1EY0 A;  2V4D A;  5ELD A;  4PMB A;  5IGB A;  3FDT A;  1KDA A;  2SDF A;  3TZD A;  1B9M A;  4C1N K;  3J81 E;  1LT3 D;  3L3O C;  1TT2 A;  1JC7 A;  1LTI D;  3R93 A;  5JEA H;  5K5P A;  3SVM A;  1EZ8 A;  3I72 A;  2QIL A;  3P75 A;  2J4X A;  3M7N A;  1UNS A;  4RCO A;  2L12 A;  1ML0 D;  3VR5 A;  4XYQ A;  2MPM A;  1WD0 A;  5J1Z A;  3A54 A;  3MXU A;  2RKS A;  1BCP D;  2K1B A;  1S5E D;  1L0X B;  3M7G A;  3BZD B;  4ZLT F;  2IL8 A;  5I9P A;  4DN4 M;  1Y8O B;  4S3S A;  1F9R A;  5LHY 1;  4PMW A;  5CMD A;  4A3E B;  3VYT A;  2E2H B;  3ERO A;  1EYA A;  5IGG A;  3HP3 A;  3J7Y W;  2B2V C;  1LTG D;  1QE6 A;  3QG1 A;  3P1H A;  4CJ2 C;  1OXX K;  3AB9 A;  4A3M B;  2BDN A;  2CVR A;  5CBA E;  1X32 A;  2F1M A;  4IFD G;  1J8I A;  4L63 B;  1JQY D;  4A3I B;  3MVV A;  3MFG A;  3D6W A;  1TWG B;  2WAC A;  3T13 A;  1PTO C;  1YNN D;  3V96 A;  2XVS A;  2EZV A;  2B39 A;  5C3X A;  2WKC A;  5D14 A;  2K5W A;  1BUV T;  1EIH A;  2F3V A;  3TSS A;  2B8F A;  5EBD A;  2EY5 A;  2YYZ A;  4IUV A;  1O80 A;  4CBV A;  5E3F A;  2F4I A;  2E2D C;  2IJ0 A;  1HQR D;  4IUQ A;  4C56 C;  4X3T A;  1II3 A;  2DY8 A;  3K58 A;  2C5C A;  1F9S A;  1TU2 B;  4FF2 A;  2QCP X;  4KD4 A;  1S4Z A;  4HTH A;  4N9T A;  4LMQ D;  4B9X A;  4HSP A;  2Y0S B;  1TY2 A;  5JJZ A;  1PRT F;  1C48 A;  2NN6 I;  4UAI A;  2KED A;  1XYI A;  4C3H B;  2HCC A;  3K59 A;  3T56 B;  3TP8 A;  3RD4 A;  2NB0 A;  4LK1 C;  4K8J A;  4NDX A;  3SHL A;  2PCF B;  2F0H A;  3BDC A;  5C0X I;  1R4Q B;  5HUR A;  2GA4 B;  2F0O A;  3I4N B;  1OO9 B;  1TWC B;  2L1B A;  5EKL A;  4O42 A;  1D5Z C;  4C1N I;  1A6X A;  5TSS A;  2E76 C;  3C46 A;  2EYJ A;  1JOR A;  2KQ3 A;  1D5X C;  3SEB A;  2BDO A;  1JR0 D;  4OL7 A;  4IAL A;  3D6C A;  1G6Z A;  4ID6 A;  4BS9 A;  1TS4 A;  4DFA A;  3UI2 A;  3PIP 3;  4RHS A;  5NUC A;  4C3I G;  5DM7 3;  5ELC A;  3GTM B;  3BDL A;  1HPC A;  1SEB D;  2NBF A;  3NXW A;  4IFD J;  1PFM A;  1JWS D;  1E2V A;  1DOM A;  4J1M A;  2AQ3 B;  2DNC A;  4DAP A;  5ELF A;  1HTL D;  2SNM A;  5A35 A;  5FLX L;  3O13 A;  1HUN A;  2F0D A;  3DWP A;  3I91 A;  1CQV A;  2WP8 J;  2A68 C;  3QIA A;  5FO9 B;  4EVO A;  2SEB D;  1QNU A;  3CQZ B;  3LWE A;  3TBI B;  3H0G B;  3MTS A;  5A2Q L;  4EGV A;  2B2V A;  3QWN A;  3M4O B;  1SFO B;  3PO3 B;  4ILW A;  1SBB B;  3Q0A A;  1WTV A;  4O1N A;  2XRS D;  4A3K B;  1FD7 D;  1HA6 A;  4NW2 A;  4XXE A;  1SSO A;  4C3I B;  4OO1 I;  4XDX A;  1LTA D;  3GTP B;  2NVQ B;  4XTC S;  4RA8 A;  1XXG A;  1SNQ A;  2AUJ D;  4M8A A;  1DM0 B;  4JBW A;  1EFI D;  2NUC A;  2K6A A;  3NUC A;  4FF3 A;  2F0U A;  4KD3 A;  5CV9 A;  1EU4 A;  4XT3 B;  5CYU A;  3MXP A;  1E2Z A;  4TRD A;  4R8I A;  1LT4 D;  1SNC A;  1LAC A;  3FMC A;  5HGT A;  2EPB A;  2E2I B;  2KCC A;  1ZXT A;  4FXG C;  1GUW A;  1QNK A;  1U4P A;  2EOT A;  5IT9 L;  3NPP A;  2WII B;  1L0Y B;  5JPM C;  1JE4 A;  2EYH A;  1S5C D;  4ZQ3 A;  2VNU D;  2LKV A;  1Q1B A;  3HOX B;  2VB2 X;  1G8Z D;  1PRT D;  1EL0 A;  1F2Z A;  1CT1 D;  3I90 A;  1RCV D;  1D6E C;  3N6R A;  3TP7 A;  3A8I E;  1EIG A;  1LTR D;  2H1E A;  2WB1 B;  3M4Y A;  3RMH A;  1JOO A;  3NBI A;  5G3L F;  2K5Q A;  4BY1 B;  5C5M A;  2RSO A;  5K36 G;  1Y8P B;  3BS1 A;  1SJH D;  1CTM A;  3T53 B;  1EY8 A;  3HG9 A;  4A3G B;  1EY5 A;  4DA2 A;  4FO2 A;  5D3I B;  3GTL B;  4Q5V A;  3J80 E;  3OMC A;  1LO5 D;  4CJ0 B;  3I4L A;  1JIC A;  3HS0 C;  4KY5 A;  1GHJ A;  2R3Z A;  2NWG A;  1BNZ A;  2PW5 A;  1YNJ D;  1ESF A;  3OPO A;  3OOC A;  1J9O A;  2CHB D;  5CV6 A;  2FIN B;  3E0J A;  5AFW A;  5I6Y A;  1M4V A;  2ICI A;  2AQ1 B;  4IUR A;  1BO0 A;  4XQN A;  2HQE A;  3MAQ A;  4H7B A;  4AYB B;  1STB A;  3DXJ C;  1STA A;  1ET6 A;  5C5L A;  2F0P A;  1WTX A;  2F0I A;  1V1P A;  5T1I A;  3GQB A;  2HDM A;  5KYL A;  4CKE A;  5M3M B;  2E2J B;  1BBX C;  3P20 A;  2EYL A;  1G91 A;  5EPL A;  2K7V A;  1BF4 A;  2I46 A;  4KMU C;  2KVM A;  1V8Q A;  2QKI C;  3GTG B;  1K83 B;  1JB3 A;  3OMG A;  4R8N A;  4BWG B;  2IPK D;  4HMJ A;  2KEE A;  2MP1 A;  4RKB A;  2LY7 A;  2JA7 B;  1A2U A;  1I50 B;  2HDL A;  2ID0 A;  4IUU A;  1JOK A;  2RDG A;  3SK4 A;  1TS2 A;  4FF4 A;  1T5X D;  4ZKC B;  1JWM D;  1RTN A;  1IW7 D;  1WVL A;  1VMP A;  4RGM A;  4ABN A;  4K5X A;  1CI3 M;  4ZUJ A;  5C6A A;  4GZY C;  4LJZ C;  1UAP A;  3W3A A;  1PFN A;  1B2T A;  3CRK C;  1K8O A;  3HOY B;  2MGS A;  4K6D A;  2JEB I;  5C3W A;  3H3V C;  1EYC A;  3OHX C;  5IOC A;  5M5Y B;  1V1O A;  4RFB A;  4KK7 A;  1SNO A;  2ZXP A;  5JAV A;  1HXY D;  2VUM B;  1GJX A;  1WTQ A;  2VXW A;  2FFK B;  4OIJ A;  3QB3 A;  4KKU A;  2F0K A;  1G2T A;  1QIL A;  4CHT B;  2KA7 A;  4IFD H;  3V2T A;  1OXU A;  1MD2 D;  2JSO A;  2XSC A;  4F8M A;  2EE1 A;  5IGE A;  3TZU A;  4A3D B;  2B2T C;  5BN5 A;  1QB5 D;  3TP6 A;  1ZKO A;  3IFT A;  1B9N A;  3C3L A;  3BG3 A;  3IAY A;  1F9Q A;  1Z47 A;  4DXF A;  2JYO A;  5CC4 A;  3IFD A;  3L9A X;  1I4P A;  3CKI B;  5CBE E;  2NN6 G;  4XIG S;  5G3L D;  2F0Q A;  3PUZ A;  1M8A A;  5EPK A;  1CFM A;  3D4R A;  1LTT D;  2MJ8 A;  2BE5 C;  1LT6 D;  5M9O A;  5CV5 A;  1A3T A;  3HOV B;  3S9W A;  4RAU C;  1TWH B;  3QOJ A;  3PV0 A;  1GUO A;  2B2U C;  5JPN C;  4HAE A;  3TDQ A;  4F7X A;  2KCN A;  1H9J A;  2F0F A;  1EY4 A;  1W6K A;  1CHQ D;  1OXT A;  4G7O C;  2F0E A;  1PZI D;  3MFY A;  3I8Z A;  1SMY D;  1HCZ A;  2RDH A;  2SNS A;  3NWT A;  1ENF A;  2EDG A;  4KJN A;  3GO5 A;  2FMM A;  4PNY A;  2D9U A;  3MC0 B;  1EQT A;  3NSW A;  1H9R A;  2O5I C;  2N55 A;  1TR5 A;  3GV3 A;  1F77 A;  4YIJ A;  3C1F A;  1W6J A;  2F0N A;  2K28 A;  5I2X A;  1B53 A;  2NVT B;  1HFN A;  1H9M A;  4N9P A;  1ET9 A;  1PTO F;  1IKL A;  5M5W B;  1STN A;  4XT1 B;  4Y7N B;  1NCV A;  3DUZ A;  1V43 A;  2FHT A;  3LX0 A;  3RZO B;  1SYG A;  4PQX A;  4WJW A;  1EU3 A;  3DEP A;  4OHJ A;  2NTT A;  4H44 C;  2JEA I;  2NYZ D;  1I6V C;  2PYK A;  4J8Q A;  5COR A;  3NTH A;  1PYW D;  1EY7 A;  4FYD A;  3K5L A;  1PRT B;  1LTS D;  1GUS A;  3PMF A;  2B8G A;  3S1M B;  3I73 A;  3S15 B;  4FVM A;  4Q0F A;  1U9R A;  4IZ8 A;  4KKT A;  4DU9 A;  2Q8T A;  5CR3 A;  2A73 B;  1EY9 A;  1SXT A;  5BN3 A;  4QUC A;  4DNR B;  4OO1 G;  1BR9 A;  4ZK9 B;  2XWB B;  3T16 A;  4QMG A;  3HOZ B;  1GOZ A;  2JXM B;  4NKL A;  3A8J E;  1I4R A;  4Z9C B;  1I6H B;  3RUZ A;  2AUK A;  4IN3 A;  3E5S A;  3NE5 B;  3K5O A;  2QEJ C;  3FPU B;  1E2W A;  2IWH A;  4HR7 B;  1TS3 A;  1KLU D;  2F0G A;  5IGD A;  4KN7 C;  1CK1 A;  1H9S B;  2A69 C;  1STG A;  1CA6 A;  4WOR A;  1B1Z A;  1YNJ C;  2A6E C;  1FNW A;  3SK5 A;  4L8J A;  2XRQ D;  5FK9 C;  1H9K A;  2WKD A;  4ZYS A;  1S5B D;  5BN4 A;  1EEF D;  3MHB A;  2JE6 I;  3K5M A;  2B2T A;  1QG7 A;  5D65 A;  5C0X J;  2PZU A;  5CV4 A;  5F2D A;  4FP5 D;  2RA4 A;  2B2W C;  4KY7 A;  1TS5 A;  1JOQ A;  1SYF A;  4A3F B;  1EEI D;  2PQE A;  1WTP A;  3GTO B;  5DM6 3;  1PDQ A;  4F88 A;  1PMR A;  1E0B A;  1HHV A;  3ND8 A;  2EVB A;  1EOT A;  1G29 1;  3T4A C;  5JEA J;  1TQO A;  5E1F A;  5EBC A;  2LS0 1;  3DEO A;  2B2U A;  4RKL A;  5JOB A;  5KNB A;  4B9W A;  5E4X A;  2TMP A;  2K33 A;  2OEO A;  4TSS A;  1A2T A;  1GUG A;  3MEH A;  2KUM A;  1IW7 C;  3EA6 A;  2PPB C;  4RGO S;  5FLX E;  4G4K A;  5I2Y A;  1O7Y A;  5A2Q E;  1EYD A;  5I6W A;  5C44 B;  1DXM A;  4V0B A;  2EY1 A;  2L55 A;  2MHV A;  1SYD A;  5JVG 3;  1B3A A;  1PTO D;  3Q24 A;  1QOH A;  4QIW B;  1A15 A;  2B63 B;  3R2I A;  4BA1 I;  4RGT A;  3WOE A;  1R4P B;  3SK6 A;  2Q8R E;  3OWF A;  2EY2 A;  1X3P A;  2CW0 D;  3KK7 A;  4BBR B;  4BA2 I;  1LV9 A;  3S1Q B;  1IYV A;  4FNF A;  3RLF A;  1WTO A;  5FKA C;  1CHP D;  2EXZ A;  3X3N A;  2D2C C;  3A7A B;  1GUN A;  3MXG A;  3HZX A;  5M5X B;  4A93 B;  1BCP B;  2A6H D;  3J7A F;  3NTI A;  1BCP C;  1S5D D;  1RDP D;  1C8C A;  4UDU C;  1OXS C;  3VYS A;  2RDF A;  1AN8 A;  5IT9 E;  5LL6 S;  3Q22 A;  2B2Y C;  2PZT A;  2KHS A;  1UEA B;  3MA2 B;  1DD2 A;  4HMI A;  1SE3 A;  1ONL A;  4HCS A;  3AU7 A;  5C4Z A;  1DOK A;  4G7Z C;  4KY6 A;  3HOU B;  5E4W C;  1U4R A;  2K5D A;  2F3W A;  3SXH A;  4P2C B;  2IT1 A;  3H6M A;  3OW7 A;  4I65 A;  3VR4 A;  3W2D A;  1WD1 A;  4G7H C;  1PXU A;  4K14 A;  1SE4 A;  5C4X B;  1F2Y A;  2BCO A;  1YNN C;  3IL8 A;  2Z1C A;  1RHP A;  2Z4I A;  3Q23 A;  1A3V A;  1TWF B;  1STE A;  2NVY B;  2WAQ B;  2L9H A;  2JA8 B;  1STH A;  2R61 A;  3PO2 B;  5ISR A;  2F0W A;  3LNN A;  1Q3L A;  4K5W A;  3BYT B;  2B2W A;  2O2L D;  2A5H A;  1ENA A;  2MUY A;  5CV8 A;  1NR4 A;  1ESR A;  3JAM L;  4RH6 A;  3A55 A;  2L4N A;  3GP7 A;  3S16 B;  2EYM A;  1MI2 A;  2WIN B;  3P7J A;  4KV6 A;  3C1E A;  4C3J G;  4DAY A;  1KAB A;  2KJX A;  1KNE A;  2DN8 A;  3NWS A;  2PMZ B;  4MHE A;  5J39 A;  3ND9 A;  3H91 A;  2HUG A;  5C4H A;  4BY7 B;  2A68 D;  1DYQ A;  1SNP A;  2L5T A;  1F2M A;  3KLS X;  3K6O A;  5J22 A;  2PNR C;  1ZYR D;  1NUC A;  2ICE C;  1HQM C;  5KNC A;  4MN3 A;  2L11 A;  5DEH A;  4NMZ A;  1DCZ A;  1SDF A;  2XWJ B;  3QJY A;  2PO4 A;  3EQL C;  2NN6 H;  1FNU A;  4KTA A;  3VR2 A;  1Q8I A;  5I4D A;  1B4O A;  3J81 L;  2SOB A;  2PW7 A;  1BDO A;  2E75 C;  2F0L A;  3VR3 A;  3M3Y B;  1U4L A;  1UUP A;  4U68 A;  3BVG A;  3DMU A;  3GTQ B;  1LAB A;  1AZP A;  3NK9 A;  2IX1 A;  3A56 A;  1VDZ A;  1HRJ A;  1PZK D;  1Q90 A;  3G7L A;  3PIO 3;  1BXT A;  3N52 A;  1G2S A;  5KRU A;  3V05 A;  3HOW B;  2AWN A;  1TVX A;  3BYY B;  1ICW A;  1IL8 A;  4H13 C;  4HED A;  2KOL A;  5DNF A;  4QCL A;  1CZW A;  3ONA B;  1D5M C;  5COY A;  2YU9 B;  2FMC A;  2B2Y A;  5IGF A;  1ROD A;  1IHZ A;  1MSG A;  4F87 A;  2J0T D;  5D3D A;  3PUV A;  4XQJ A;  2EY6 A;  4DK0 A;  2IW3 A;  5C0X G;  4TQU S;  3S14 B;  3GD7 A;  3ZYY X;  2K04 A;  4A3B B;  1MSH A;  1CQF A;  5CV7 A;  5KND A;  1I4H A;  2AQ2 B;  4DK1 A;  1O78 A;  2M00 A;  1TII D;  4PMC A;  4R9W A;  2H4O A;  5I9O A;  3AMU A;  3KBX A;  5JEA G;  4OO1 H;  1PTO B;  4K8I A;  2JA6 B;  2AWO A;  3D3R A;  3NTK A;  1RKN A;  5C4J B;  4IUT A;  4ZAI A;  4E6I A;  3WDN A;  1ILQ A;  2G9H D;  3E6Z X;  1Y1V B;  2J7Z A;  1MBY A;  3EVQ A;  3C2P A;  4ULL A;  2NVX B;  4C3H G;  2HCI A;  4ODG A;  1LTB D;  4LAA A;  2C9O A;  2CW0 C;  1WTW A;  3A7L A;  1ILP A;  4FXD A;  1B44 D;  4I7Z C;  1C4Q A;  2EYP A;  4CKB A;  1PRT C;  2A6H C;  5IIF A;  2IX3 A;  2E74 C;  4IUP A;  2K05 A;  2R6G A;  1VMC A;  2X6G A;  1Y1W B;  3TP5 A;  1TY0 A;  4B08 A;  2F03 A;  2DNE A;  3OSO A;  1JCK B;  3GV6 A;  4DNT B;  4G57 A;  4OIK A;  1HTP A;  2F0V A;  1GXD C;  1RTO A;  3NQT A;  3X3M A;  5T1G A;  1T5E A;  3CRL C;  1O7L A;  1XX8 A;  1I3Q B;  2EJF C;  4IQZ A;  3BVZ A;  2OF1 A;  4IFD I;  3S1R B;  1STY A;  3SE0 A;  2LMC B;  1SND A;  3KLS A;  3QOL A;  2BA0 A;  4NP5 A;  4HSV A;  3NHH A;  3CHB D;  3A8K E;  4ZUI A;  1OXV A;  1FR3 A;  1BOS A;  5FOB B;  3ITP A;  3S1N B;  1B50 A;  1FNV A;  3BDO A;  4RCN A;  3M85 A;  4WRD A;  5EQ0 A;  3KUP A;  2DY7 A;  2ZXO A;  1KTK A;  1U4M A;  5ELE A;  4XYO A;  3F2U A;  5IOD A;  1SE2 A;  5EKI A;  1AW7 A;  2XIW A;  5EPJ A;  1Y8N B;  4K2L A;  1NR2 A;  2F0T A;  1QJO A;  2M9V A;  4DF7 A;  1FGB D;  3J7A V;  1D1K A;  1SAP A;  1R9T B;  4RWS C;  2R7Z B;  2Q8I B;  1QCB D;  3U9O A;  1V1P B;  3EFX D;  3TME A;  4MIU A;  1BQQ T;  1LLR D;  4EQN A;  1XWE A;  1PLF A;  2LFN A;  3BVM A;  5IGC A;  2EJM A;  1F9P A;  2G9D A;  3HKZ B;  3H09 A;  2K03 A;  2BE5 D;  3Q6S A;  4JK1 C;  1ZYR C;  3R2T A;  2PZW A;  3SK8 A;  2XN9 C;  2D5D A;  2O5J C;  4QUF A;  1RJT A;  3I3C A;  3FKI B;  1EQV A;  4HCE A;  3NQI A;  2EYF A;  5C3E B;  1KDB A;  3CU7 A;  2FJ2 A;  1HFG A;  1SNM A;  3R3O A;  4L6T B;  3VA7 A;  4H0L C;  1AZQ A;  2X6L A;  3U9S A;  5K36 H;  4U67 3;  4QB4 A;  3VA5 A;  2QF7 A;  3KLR A;  3R8B A;  5LL6 X;  1Q1E A;  3D4W A;  2EJG C;  4ZKB B;  2M2L A;  1NSN S;  3H94 A;  1I4X A;  4X3S A;  2ZXR A;  1CA5 A;  3DWQ A;  1DON A;  1AEX A;  1IYU A;  3I70 A;  4K5V A;  1ENC A;  3LWU A;  4CJ1 B;  5KYI A;  4DAV A;  4C2M B;  1ZEQ X;  2RQX A;  3WOF A;  1AFP A;  1Z7T A;  4ZRZ A;  1SJE D;  1O7Z A;  1GUT A;  2F0J A;  4IUN A;  4A3J B;  4CGY B;  1CM9 A;  2JA5 B;  2O4X A;  3VR6 A;  3HRZ C;  1PZJ D;  1I4G A;  4QF4 A;  4V19 0;  3D31 A;  3K5N A;  3S2D B;  4KKS A;  1WTR A;  3L7Z C;  5FO8 B;  4XQQ A;  1DJR D;  5M3F B;  3S17 B;  4FXK C;  4K2K A;  3J80 L;  3K57 A;  2F0S A;  4PV1 C;  3G6J B;  4X3K A;  1KDC A;  4BBS B;  2IX0 A;  2F0M A;  2R93 B;  4CKC A;  1Z6H A;  2JP1 A;  4FF1 A;  2QDB A;  1F2L A;  1VCI A;  5EJW A;  4KI0 A;  2L0C A;  1BCP F;  3K7A B;  1Y69 U;  3PUX A;  3D8G A;  4J6H A;  4RGN A;  1QWY A;  2RBM A;  3FVQ A;  2ENB A;  1EWH A;  4DGZ A;  1D2B A;  1H9S A;  1JWU D;  1PFB A;  3MWY W;  2R92 B;  1SMY C;  1HUM A;  3S2H B;  2EYO A;  1KAA A;  1KLG D;  2Z8L A;  1FYC A;  1TKW B;  2BA1 A;  4K6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...