3P1HA

Crystal structure of staphylococcal nuclease variant delta+phs v23k/i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTKKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thermonuclease
publication title Pressure unfolding effects of artificial cavities in proteins.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3p1hA00
2LKVA 3P75A 2RBMA 1EYCA 3PMFA 4DU9A 4J1MA 2F3WA 2SOBA 4KTAA 3SK6A 1SNCA 4ZUJA 3SK5A 2F0OA 3P1HA 3TP6A 5KYIA 1ENAA 5F2DA 4K5VA 4KY5A 4QB4A 5C5LA 4F7XA 5ISRA 4KY6A 4KD4A 4K8JA 5EKKA 5CR3A 2F0VA 2F0LA 3C1FA 4ID6A 4KD3A 4MIUA 4YIJA 4B9WA 3QB3A 4K14A 1EY7A 5E3FA 4EVOA 2EY1A 4NDXA 1EZ8A 1AEXA 3LX0A 1EY0A 1NUCA 3MZ5A 3SXHA 5KGUA 1STGA 2KHSA 4J6HA 3SR1A 4DF7A 2F0MA 1SNQA 4TRDA 5IGCA 3SK8A 1JORA 4F8MA 4K2LA 1SNDA 3ERQA 3MVVA 4B9XA 4KJOA 2F0GA 4QF4A 5C3XA 1SNPA 4HTHA 5IOCA 4I65A 5CV8A 2OF1A 1TQOA 5IGEA 5CV6A 5JOBA 1JOOA 1SNMA 1STAA 2F0FA 3ITPA 4WORA 2F0JA 5IGGA 3EROA 4K8IA 3HZXA 2EY5A 1JOQA 5EKLA 1A2TA 4QMGA 1STBA 1F2ZA 5K5PA 4EQOA 4IZ8A 1KAAA 3E5SA 2M00A 5CV9A 5HGTA 5IGDA 5C5MA 4ZUIA 3RUZA 1TR5A 3NK9A 1EYAA 2PZWA 4NP5A 4N9PA 4KY7A 3QOLA 1A3UA 1II3A 3T13A 5KIXA 3MEHA 2PW7A 3TP7A 4NMZA 2F0NA 2OEOA 3R3OA 5JAVA 2F0UA 3QOJA 1EQVA 1SYFA 2SNMA 2RDFA 3D4DA 2EYPA 5CC4A 2F0WA 5I9PA 1A3VA 2EYJA 3NUCA 4K6DA 4ZQ3A 5EGTA 4E6IA 3OMCA 5I6WA 3NP8A 1KDAA 4NKLA 5C6AA 2F3VA 2PW5A 3D6CA 5E1FA 1JOKA 5IIFA 3C1EA 5J39A 5CV5A 3TP5A 2EYFA 5NUCA 1EYDA 2F0TA 2EY6A 1U9RA 5C4ZA 2EYOA 4ME5A 1SYCA 1SNOA 3D4WA 3MHBA 1STHA 2F0IA 2QDBA 1ENCA 3SK4A 2ENBA 4K2KA 3T16A 4ODGA 1IHZA 1KDCA 3NXWA 5CV4A 2EY2A 3S9WA 1EY8A 4RKLA 5IODA 4EQPA 2KQ3A 3OWFA 2EYMA 1SYDA 2EXZA 4OL7A 1EY4A 3TMEA 2PQEA 2F0EA 3MXPA 4S3SA 5KYLA 5J1ZA 3EVQA 5CGKA 4PMBA 1EY5A 1EZ6A 3TP8A 1F2MA 1SYGA 3HEJA 2F0DA 2O4XA 3NHHA 5HURA 5I6YA 3SHLA 2EYHA 4WRDA 4PMCA 2F0PA 3D8GA 3DHQA 1NSNS 4KHVA 3DMUA 5C3WA 5J22A 2F0HA 4IALA 4K5WA 3EJIA 3BDLA 5IGBA 1RKNA 1KDBA 5DEHA 2PZTA 4PNYA 1KABA 4DFAA 1F2YA 4KV6A 4R8NA 4N9TA 5CV7A 4EQNA 2HQEA 1A2UA 2OXPA 3V2TA 2F0QA 2F0KA 1EY6A 2F0SA 3NQTA 4K5XA 3VA5A 3BDCA 3OSOA 4RKBA 5KEEA 3U9OA 3H6MA 5C4HA 5DAUA 5KRUA 2PYKA 4DGZA 1STYA 4LAAA 1SYEA 2SNSA 2EYLA 2PZUA 1TT2A 4H7BA 4KJNA 2WACA 3OMGA 5M9OA 2RKSA 1A3TA 4HMJA 1SYBA 4G57A 1EY9A 5IGFA 4IUNA 2NUCA 1STNA 4HMIA 5I9OA
chains in the Genus database with same CATH superfamily
1PTOF 1GKHA 4LF9Q 2JN4A 2F3WA 3GTQB 2OTLA 1NR4A 1JE5A 4ZUJA 5M5XH 4DR4L 3TDQA 4AYBB 1PRTD 2K5WA 4P72A 3J7AV 2LY7A 3QB3A 1XPUA 2IX1A 3EN2A 1VF5C 5ELBA 4A93G 3TRZA 4A93B 1PYBA 3RN5A 2Z6KC 1CKOA 2R6GA 3A8JE 2CWAA 4K2LA 4OXPA 1L1OB 4DV7Q 4UY8C 2R92H 1IYUA 3MA2B 4EQ5A 3L7ZC 3GV3A 4LUVA 4BXXG 4LF6Q 1VS0A 1L1OA 4A3GH 3R2TA 2QILA 1QCBD 4EQOA 4DR5Q 3AU7A 1GJXA 2WKCA 4I7ZC 1G8ZD 1KHIA 2ICIA 1II3A 2MGSA 4A3KH 1F2LA 3PUVA 2ZM6L 3DWAA 2B8FA 1EYGA 4JI1L 2EYPA 1VQHA 4HCEA 3NUCA 1J9OA 3OMCA 4DUZL 1JCKB 4HSVA 4OHJA 4B3SQ 1SDFA 4FDBA 4GNXC 4A3FG 1BQQT 2ICEC 5C44G 4RGNA 5C44B 3GTOH 1PDQA 4DNIA 4UHVA 3QG1A 4X62L 4ODGA 2YV5A 5CV4A 2EY2A 4CDFC 3PGZA 2D0OA 1VQAA 1EY5A 2P5ZX 1YHAA 1TKWB 4WRDA 2F0PA 5IYCH 4OONA 1TS4A 3DEPA 1S5CD 4KHVA 5C4XB 2F0HA 4LWCA 2A69C 3VDYA 4YHHL 2WFWA 5GQOA 1TS5A 1A2UA 3GTQH 1LV9A 2XIWA 2F0KA 1EY6A 1FR3A 5G3LD 4M8AA 3Q6SA 1JE4A 2F4IA 1KD1C 4R4QA 1FNUA 2SNSA 5IP7H 2JA6G 2JA6B 1UE1A 4DKAC 1QVCA 2A1AA 2DN8A 3OPOA 3CAMA 2VXWA 4A93H 1LUZA 2NTSA 4DV2L 3V96A 3ICEA 1JB3A 4YY3Q 2E5LQ 1STNA 2RBMA 2CW0C 1XMOL 4B3TL 2OCEA 1VQLA 1HPCA 2ZXRA 4FVMA 5F2DA 4KY5A 1LT4D 4BXXH 3NSWA 3CC2A 3TN2A 1C9OA 4JYAQ 4K14A 1M90C 1HUNA 3I91A 3U4ZA 2F52A 2F4VQ 4P2CB 4I65A 1TQOA 5IYDG 2Q8IB 2BDOA 2JQOA 4HCSA 3KBGA 4N8FA 4A3DG 3EROA 1RJTA 1VQ8A 4A3DB 1CKNB 1WTXA 3G4SA 4R1JA 5L37A 1JWMD 1SFOH 4P74A 3HKZG 4A3FH 1I3QB 3HKZB 1X56A 1PTOH 2WB1B 5C44H 3U58A 2I5HA 2E2HB 3K81C 3TQYA 1GHKA 1N33Q 5LL6X 3H91A 2VQEL 1CKNA 1HA5A 4A3LG 5C4JB 1LTTD 3TP7A 4BY1G 2FJ2A 2LFNA 1SYFA 2Y0SG 1XXGA 4BY1B 2Y0SB 5I9PA 4GN4B 2UU9Q 4JI8Q 5JEAJ 1I50H 3BG3A 2VQFQ 3GTJH 3BU2A 4FNFA 4DAPA 1AE3A 3GV6A 4FO2A 5CMDA 1GM5A 3DM1A 3NEMA 2HCCA 4A3EG 3NXWA 1I4PA 1OO9B 4EQPA 1H9MA 2HT1A 4HIKA 1K8AC 3R8BA 2C35B 1EIGA 1JJ2A 1EZ6A 4L6TB 2H1EA 2JA6H 4PMCA 1VQNA 4IUTA 4R9WA 3LNNA 4L8JA 4JI0L 4X3TA 3L9AX 1Z6HA 4YCWA 3AQQA 3CKIB 3NELA 1GVPA 3Q23A 3T56B 4BS9A 2PZTA 2OXPA 2HCIA 4K5XA 3UE1A 4K0KQ 2RHSB 5IT9L 4LF4Q 4J15A 4DGZA 3S24A 3G71A 3MEFA 3AMUA 2ZJRA 2XTIA 3J80i 2B63B 1YJ9A 4RH6A 1PYSB 2V4DA 2RCFA 2UUBQ 1V43A 3P75A 4BBSH 5FLXL 3U9SA 3KOJA 2SOBA 1K3BC 3WOEA 2F0OA 3TZDA 5IYDH 1ZYRC 5C5LA 1W3SA 3OIPA 3HKZE 5ISRA 2A68C 4KY6A 3STBC 3J7AF 4A3DH 5M5WH 4ID6A 5JJKA 4JOIA 1EY7A 1EWCA 1PFSA 1ILPA 3A8KE 4PZ7A 1M8AA 2BH2A 2Y0SE 1SNDA 5IOCA 2E2HH 1EQRA 3VR3A 2N55A 4ILWA 5JOBA 4A3LH 1BCPB 2H5XA 4FF2A 2JA7G 4KHPQ 4BY1H 2JA7B 5KNBA 5JJIA 1HZ9A 3ER0A 4PZ8A 2N78A 2X6GA 3F2BA 4QMGA 5GROA 1AP0A 1E24A 2K05A 3NE5B 1PMRA 2B2UA 3BZCA 1KQSA 3S15H 1SMXA 3H0GG 3PO3G 5FLMG 3QOLA 1PVOA 3PO3B 5KIXA 2R7DA 1WVLA 4IJLA 1E2ZA 4A3EH 4CGYB 3QOJA 5DM63 2XGTA 2A6EC 4E6IA 4ZQ3A 2XWJB 3CCRA 1SSOA 5C6AA 3ERSX 1RIPA 1FNVA 3H3VI 4X6AH 3LWUA 5J39A 2IX0A 3HOXB 2KUMA 2Z4HA 1U9RA 4IOCA 3J7A5 2B3GA 3M85A 1B9NA 4IPGA 4OWTB 1AW7A 1UWVA 2NVTB 4BBRG 2ZJQA 2C9OA 4BBRB 2EDGA 1B3QA 2EXZA 3A7LA 1EY4A 1IL8A 4JI6Q 5EBDA 5FO8B 3S2DB 1E3PA 4JW0A 2KJXA 2V1CC 3URYA 1EQTA 2RDGA 4DUYL 1NSNS 3TS2A 5J22A 1IZ6A 1LT3D 3M7GA 4JI1Q 5LMNW 5IWAL 4F88A 1GD7A 3I4NG 4YWLA 2F0QA 5ELFA 1Y8NB 2L15A 2DJGC 2DUDA 2A69D 2B2YC 3A5ZB 1VQ5A 5AFWA 3X3NA 4X62Q 1N36Q 1CSPA 1E22A 2CWPA 1CK1A 4GS3A 4TSSA 1Q8KA 1TY2A 4QY7A 1E2WA 4O0AA 2G5DA 4FXKC 5EBCA 3I4MG 3MWYW 3I4MB 3SEBA 5A2QL 1O80A 3AB9A 3KFUA 2HUGA 3I55A 4YHHQ 2EY1A 2E74C 1EFID 5KGUA 1STGA 4R4TA 3ERQA 2OQKA 3OOCA 2NVQH 3KUPA 2BA1A 3H0GH 5FLMH 1C8CA 1AE2A 1STAA 2ZJPA 3RZOB 1ET6A 4RMFA 1U5KA 3J81L 5K5PA 1STBA 4DPGA 3RZDB 3SVMA 1YNNC 4MN3A 1KAAA 1SLJA 3GTPB 1XMOQ 4B3TQ 4UP8A 3S1RB 1N32L 1KTKA 1PV4A 4JI2L 2AQ1B 4LFCL 3FVQA 1BCPD 1H9JA 4GLXA 4BA2I 2PW7A 4QGUA 2VL6A 4HAEA 3VR4A 3D4DA 3CXCA 1TWHH 5EGTA 3FEWX 3CC7A 1JOKA 4YCUA 2Q2IA 4C3IH 5T1GA 3KLRA 2KVMA 3PF4A 2QDBA 3MXNB 5COYA 2OTJA 3S1NB 1LTLA 1VQPA 5DM73 2EYMA 3I4NH 1IKMA 1XWEA 1IL2A 1PRTF 1W2BA 5CGKA 1RTNA 1F2MA 4FYDA 2DGYA 2R7ZH 5I6YA 3MXNA 4IN3A 4KN7C 2UXDL 5IYBG 2QGQA 2QKIC 2K5VA 1LT6D 5C3EG 1BF4A 5C3EB 4DFAA 4C3HG 4GN5A 1AZQA 4C3HB 5KEEA 3VYUA 2JP1A 3I4MH 4XYQA 1SJHD 2NZOA 2ALYB 1A3TA 3KF6B 4OWXB 3M3YH 2FHTA 1H9RA 1F9RA 1UUPA 3D3RA 1Y1VH 5JEAG 3VR5A 4LMQD 3KF6A 3NTIA 3RZOH 4XT3B 2E76C 4JI0Q 3RZDH 2KECA 1S5ED 1VQEA 4DF7A 3E0JA 1STEA 3HS0C 4B9XA 3OW7A 1EOVA 1E7ZA 4DR1Q 4XQJA 3K5NA 3GTGB 3J81E 2F0FA 1WI5A 4AQYL 3EA6A 3CPWA 3HZXA 1A0IA 4H44C 1F77A 3CQZH 1VQOA 3H94A 5EKLA 1O7YA 2NTTA 2YU9B 4IZ8A 1Q86C 2M00A 1H95A 4QCLA 1PH4A 4C1NI 4DV4L 2D62A 3GO5A 3SDZA 2UXBL 2G9HD 2ATWA 3HOWG 2A73B 4C2MH 5G3LF 3HOWB 4DV0L 1O78A 1UE6A 3F2UA 3OYYA 1PH6A 3BZKA 5CC4A 3CF5A 2F0WA 3K80C 4O2DA 1LT5D 2R7FA 5GAGC 3F1ZA 3M4PA 1S3OA 3BVZA 5NUCA 1EYDA 5IYBH 3HOVH 4ME5A 3MHBA 4IUQA 4K2KA 1KDCA 3S9WA 1GUOA 3K7AH 1NMFA 4FXGC 4C3HH 1SYDA 1GUSA 5KYLA 4K6LA 3J7ZC 4GKKL 1EU4A 4QUCA 3T53B 1I94L 1HZBA 2F0DA 1RD9D 3N52A 3UDGA 3HG9A 2EYHA 5FK9C 4CKCA 4L63B 2B2VA 4HIMA 1KLGD 4JPBW 3HOZG 1WTHA 4JC0A 1A62A 4KKSA 4LF8L 4OEMB 5JEAH 2F0SA 5ELDA 2KENA 3BDCA 2M9VA 2TSSA 1I6HB 5KNCA 3CCUA 1STYA 2HIXA 2EYLA 3FP9A 3OMGA 1S5DD 2N3SA 4XIGS 4HEDA 3D6WA 2UXCL 2KEEA 4CDEC 1PH8A 3QO2A 1HNWL 1BNZA 1PTOC 2O2LD 1KNEA 1TWFB 3QIAA 5ELEA 4K8JA 2Q8RE 2IHFA 1PZID 1HR0L 4HN7A 2F03A 3K5OA 4KD3A 3NWTA 4J8QA 5IE8A 2HDMA 5IWAQ 2YU9H 2AQ3B 4CHTB 4LF5L 3G7LA 1HJPA 2Z9HA 1Z7TA 5HY6A 3FKIG 3GTLB 3FKIB 2E2JB 4DR2L 4QUFA 4JG2A 5IGGA 3HOWH 2UUCL 2EY5A 3CC4A 1QWYA 4AYBG 2GA4B 1X6OA 1ML0D 4HJ7A 5HGTA 4ZRZA 3C3LA 2L5TA 1SMYC 2NYZD 1YNXA 1YNJC 3DWPA 1EYAA 2PZWA 2PMZB 4N9PA 4ZCKA 1A3UA 3W1GA 4CDCC 2G9DA 2F0NA 2OEOA 2EE1A 1DZ1A 2Z0SA 4GOPB 1U4PA 3F2CA 4NKLA 3MAQA 2WP8J 1EQQA 2EYFA 3I56A 1BBXC 2OWOA 4H0LC 3JAME 1LYLA 3S1MH 2EYOA 1TWGH 3ZYYX 4GOPA 3HOZH 1QUQB 3QWNA 3PUZA 2CQOA 2KQ3A 3PSIA 4OO1I 1XNQL 1UEAB 3GTMH 4CJ2C 1V1OA 3PUYA 1IBML 1KL9A 1I6HH 1N32Q 1HFNA 1MIUA 2K04A 1IYJB 3SHLA 1QUQA 3QR8A 1V8QA 2NN6I 1RCVD 2B39A 5C3WA 3TEHB 1S5BD 3VA7A 2HQEA 1S40A 1MJEA 1V1PB 4HIOA 1HZCA 1CT1D 4WJWA 3KDFB 1J5EQ 1IBLL 2ZTDA 3I2ZA 4RGMA 1SYBA 2L1BA 5EPKA 3PQIA 5JJZA 2JA8G 3K57A 2JA8B 2PO4A 4QJFA 4DV5L 5I9OA 3VR2A 5C4XG 1DOKA 3GTLH 3KDFA 3FKIH 4XTCS 4AYBE 2C5CA 2LMCB 4X64L 1L2FA 2AWOA 5CR3A 4OWWB 1X3FA 2E2DC 2N8NA 1OTCA 3FHWA 3MZ5A 2TMPA 2FXQA 3UE0A 4APVA 1Y1WB 2AHOB 3GQBA 1MHWC 3CCSA 3KLSA 2RF4A 4CBVA 1Q7YC 3HOYB 1X3GA 5E7NA 3BZDB 2A6HC 1SJED 1ESRA 1VQJA 5H1SE 2RHQB 1ZEQX 3S2HB 4NW2A 3HGBA 1V9PA 2NVYB 2JJQA 1YHQA 1TWAB 4JI3L 1A3VA 1LTBD 3M4QA 4X3UA 4DK3C 4JOIC 4CJ0B 5I6WA 2F3VA 4DAYB 4LF7L 3I4OA 4Y7NB 1LTRD 2JE6I 2UUAL 2O5IC 2B8GA 4LFBL 1I4XA 4AQYQ 1MJCA 1N9WA 4KK7A 2WB1G 4KI0A 1Y69U 4RKLA 4DAYA 3NBHB 3OIQA 1V1QA 1K8GA 3EVQA 3TP8A 1LTID 3VYTA 2B2UC 5HURA 4DV4Q 1WTRA 2JYOA 5AJ3L 1B3AA 3D8GA 3I70A 4POFA 2UXBQ 4V0BA 3DMUA 3NBHA 4B3ML 4GNXB 4B3RL 5I4DA 1RTOA 3AFPA 2JA8H 4R4IA 1FYCA 1BUVT 1HQRD 5C4XH 1I4QA 3K8AA 3NWSA 3IRBA 1QVGA 5FO7B 4HIDA 1G91A 1TWCB 4OELB 1TT2A 2YTYA 2OT2A 2WACA 4GLAC 1LTSD 1R4PB 2EQSA 4G57A 1CHQD 2RVLA 4JI5L 1MD2D 1BCPF 1HTLD 4HMIA 3G48A 4GKKQ 4KKUA 3HKSA 1HFGA 1PHJA 1I94Q 2O5JC 1GO3E 3M7NA 1XNRQ 2M2LA 4GKJL 1CKMA 1JMCA 1HTPA 1PXUA 4QIWB 4EVOA 1HH2P 1LTGD 3GTKB 2K50A 5BR8Q 4RG1A 1VQIA 3SK8A 4F8MA 5FOBB 2B63G 2F3IA 4XQQA 2YYZA 3M4OB 5FJ8G 3MTSA 1TXYA 1VMPA 2DNEA 4K8IA 5EJWA 2UXCQ 3A8IE 2K14A 1C48A 4RCNA 1ILQA 1PH3A 2WB1E 5EKIA 3I73A 1G51A 4ZUIA 1HNWQ 1B44D 1P16A 3PIPA 1RODA 2KBNA 2RA4A 3UDFA 4AH6A 5LMUL 5BN3A 4DR6L 3J80L 1HR0Q 2Z1CA 1PH9A 1I3QH 3DEOA 3T1YL 1QNUA 4IFDI 3U4VA 4OO1G 1PZKD 1MBYA 1Q8IA 3CCVA 4K6DA 5LMNL 1YNJD 4DV3L 1KDAA 1KNAA 4LF5Q 5C4JH 4DK6C 3ND9A 5IIFA 1QZHA 1YBYA 1Q1EA 3NQIA 1QILA 1XPOA 4DR2Q 1STHA 4DV6Q 2FMCA 1VMCA 3WOFA 1H9SB 4Q5VA 1ASYA 4DA2A 4DR4Q 1CHPD 3IAYA 4ZAIA 2WINB 4MTNA 3H09A 4DK1A 5M5YB 1RDPD 1O7LA 1GUWA 3IL8A 2ZTEA 1H9SA 2ZXOA 1U4RA 5K36G 4JV5L 3K58A 4XT1B 2IWHA 1CA5A 3HOXG 3PUWA 5DEHA 5M3MG 4LFAL 4R8NA 1FGUA 4N9TA 4QIWE 5M3MB 4IJHA 1HQMC 1ICFB 1B1ZA 2EPBA 2GN5A 3U9OA 2FMMA 1RHPA 3DXJC 4IPHA 2Q2UA 2PZUA 3R2IA 3NENA 5C0XI 1RL2A 2MUYA 3GTKH 1VCIA 3T1HL 2EVBA 2I07B 2K5QA 1XNQQ 3L0OA 4IPCA 3FDTA 1CQVA 2B63H 1IBMQ 3AYHB 4DU9A 2ZM6Q 3MFGA 1NE3A 1WTQA 1LABA 3M4OH 2N49A 1XX8A 1LTAD 2RSNA 1QE6A 2EJGC 5IT9E 1VQ7A 1UE7A 4NXML 4DUZQ 1Q90A 2Q8TA 5E3FA 1JJGA 1SXTA 4PZ6A 2HIVA 1DGSA 1PZJD 1JC7A 2JXMB 1BR9A 1VQFA 1K8OA 3A56A 4QF4A 2RSOA 2R61A 2J0TD 2IW3A 5FLXE 5IGEA 1EIHA 3BYTB 2I5MX 1WJJA 3B6YA 4XYOA 2AUKA 4UP9A 4UPAA 4WORA 4ZLTF 1IBLQ 3E9HA 4NXNL 5EAYA 1NR2A 1I4GA 2D0PA 2X69A 1YJWA 1UEBA 3BVGA 1OXTA 2KA7A 4DV5Q 2VY3A 4C3JB 1LACA 1F9SA 1Y8PB 2JA7H 4GZYC 2D2CC 3J80E 3K5MA 3A5UA 1BOSA 4P71A 4A3MB 2CW0D 2AWNA 4JK1C 2CQAA 1EEID 2YTXA 2RQXA 5GAHC 3AEVA 2A6HD 3R3OA 4I7AA 4XQNA 3PO3H 1TVXA 4X65L 1AZPA 1HNZL 5IP9G 3C2PA 4JBMA 2PI2A 1EUJA 4DV2Q 3RNUA 1K9MC 3D4WA 1JJCB 2F0IA 1B50A 3SK4A 1WOCA 3HOXH 2EIFA 4TVAB 1ZXTA 3DLLA 1QJOA 2NVXB 4ULLA 3TMEA 2PQEA 2VUMG 2VUMB 5JVH3 2EJFC 4LF6L 1PRTC 2K75A 2NZ1D 2NVTH 3JC66 4A3CG 4QQBX 3UI2A 4BBRH 3NHHA 1B53A 4R8IA 3KF8B 3M4YA 2CH4A 1XJVA 3S2DH 3DM3A 2B2WA 3T4AC 2VB2X 4UDUC 4IURA 1S72A 3A74A 5LHY1 3J81c 4DR3L 1PA6A 3KF8A 1CSQA 2DY8A 2BCOA 1Y14B 2K4KA 2KEDA 4FXDA 2NB0A 2LS01 4LAAA 4DR7L 1NY4A 2BE5C 1K8MA 4LFBQ 4H7BA 4R4CA 5M9OA 4B3SL 1EL0A 4HMJA 3WDNA 2L55A 2B2TA 2EJMA 4WFN3 5CYUA 5J3BA 1SBBB 2VQEQ 4RAUC 4PMWA 1SNCA 2KCMA 2L12A 5KYIA 2AQ2B 4F7XA 3K5LA 1UE5A 1KRSA 4N8X1 1D7QA 1PYWD 2F0VA 3C1FA 4B3RQ 3SE0A 1EZ8A 3HOUG 1D5ZC 1F9PA 3E6ZX 2GVBA 3HOUB 3SR1A 4TQUS 4RFBA 1SNQA 4TRDA 2KCNA 3NTKA 1SNPA 1N34L 3RR5A 4POGA 4IFDG 1TS2A 3Q8DA 5A2QE 4JI5Q 5M3FG 4DXGA 5M3FB 4MZ9A 1Y8OB 3E0EA 5IP9H 3CMAA 1PFNA 2E5LL 4HJ5A 5D3DA 1G2TA 4GKJQ 3GTPH 3MEHA 1ZYRD 3S1RH 1Q81C 2A68D 2EZVA 4LNQA 3STBD 1A6XA 2EYJA 2Z4IA 1SE3A 1TIID 2J7ZA 4A4IA 3E9IA 3KLSX 4OIKA 2ID0A 1ESFA 1SE8A 1E1OA 1SNOA 2PCFB 1OXSC 2VNUD 1Q12A 2F4VL 3CW2C 2F1MA 3J7YW 2AKWB 3G6EA 1CM9A 1NTGA 4O1NA 4OL7A 4QL5A 3S16B 1M4VA 3DWQA 4X66L 3S1NH 2SEBD 1WCMB 2CCZA 2IY5B 4Y52H 3CCEA 4DR6Q 4KN4C 4KMUC 5C0XG 3S14B 3DHQA 3T1YQ 5D3IB 4HSPA 1XMQL 1OXXK 1I5FA 1CZWA 2IJ0A 4HJ9A 4KV6A 3MXGA 2A6ED 3NQTA 3JAMi 3OSOA 5KNDA 4CDDC 3H6MA 5C3EH 5E4XA 1SAPA 1DOMA 1L1OC 3HOUH 3EBEA 2WAQB 5IGFA 4GOPC 5M5XB 4F87A 1VQ6A 4IUNA 1C4QA 4JBWA 4KTAA 1O7IA 3CD6A 4P75A 3PUXA 4ZK9B 5BN5A 3A55A 3TREA 1G291 4KD4A 1ZKOA 2K5NA 5D14A 5EKKA 4JV5Q 3RLFA 3LGJA 1VQ4A 1HA6A 2LSSA 3JAMc 2R92B 4IUVA 4C1NK 5GADC 1MSGA 1DCZA 4LFAQ 4TKOB 1K83B 2BDNA 1JORA 1MSHA 5C3XA 3UDXA 2Z8LA 3I8ZA 4MTKA 3FPPA 4GN3B 1TS3A 2QCPX 2VS1A 1JOOA 4A3GB 1VQCA 4K0KL 1BKBA 2A19A 3I90A 1VQMA 3K7UC 3PV0A 3T1HQ 1OXVA 3GTGH 2KCTA 4JI7L 4A3KG 4DUYQ 5C5MA 4A3KB 3M9BA 5FKAC 3CCMA 1NNXA 3PCOB 1IKLA 4KY7A 4NXMQ 3H3VH 1WTVA 2YTVA 1EQVA 3GTOB 5HGQA 4RHRA 4Z9CB 3K59A 5CV5A 3TP5A 3L2PA 3ULLA 2CVRA 5ELOA 1N8RC 3L3OC 4JI4L 3D31A 2ENBA 4NXNQ 3BJUA 4BY7G 5IODA 1LM0A 2QEXA 4BY7B 1XTCD 2LXKA 1QNKA 2AMCB 1WFQA 1ET9A 1F9QA 4P73A 1YNND 2WIIB 4LUZA 1QZGA 4RGTA 1M1KC 3KLWA 1L0YB 2VW9A 2Q2TA 4A3JG 4IUUA 4K5WA 4A3JB 1E1TA 1KAWA 3PIP3 1DOLA 3ULPA 5IP7G 1E0BA 3FMCA 4X65Q 1TY0A 1EIFA 1FGBD 2B29A 1HNZQ 1R9TB 1GXDC 1R4QB 2L11A 2DJFC 4G4KA 1CA6A 2NBFA 2RKSA 5EPLA 3IFDA 1T5XD 2MHVA 1EY9A 2IT1A 3PIOA 1CFMA 4JI2Q 1K83H 2CFMA 3KJPA 4DAMA 1EIYB 4LFCQ 1IW7C 4PG3A 3CCLA 1JWSD 3J81j 3PMFA 1E2VA 2BE5D 3HRZC 3NTHA 4AIMA 4K5VA 1KRTA 2R3ZA 4JBJA 4JI6L 1X32A 4MHEA 1KC8C 1HR0W 1AEXA 1EY0A 1TWFH 2KHSA 4J6HA 4DR3Q 2F0MA 2K03A 3W1BA 1U4MA 1HRJA 4ZKBB 3MVVA 2F0GA 4DXFA 2K6AA 1DYQA 4DR7Q 1V1PA 1SNMA 1SFOB 4ZYSA 2X6LA 3KK7A 1G6PA 2XN9C 4A3FB 3I7FA 3BYYB 3S17B 1PTOB 2MNAA 2K32A 2E2JH 3RD4A 2RCNA 1JQYD 4YWMA 2UXDQ 2A5HA 4A76A 1N36L 3A7AB 5DLQE 1B8AA 4FF1A 2DNCA 1WTWA 2PQAB 1XYIA 2PMZE 1KIXA 3RLOA 2CKZB 2RDHA 1I50B 2HQLA 4DV1L 4NMZA 3GTJB 4BY7H 1A63A 4A3BG 1D1KA 3UDIA 2IX3A 2XRSD 4A3BB 3BVMA 1Y1WG 1ASZA 5IY0A 3NP8A 2PQAA 3VYSA 4IQZA 3D6CA 5T1IA 1FNWA 3C1EA 4OX9L 3W2DA 1MGSA 1N34Q 2F0TA 1UNSA 3HOYG 1SYCA 2VZAA 4A3JH 1CTMA 2HHHL 3D4RA 2K28A 1FJGL 3OTOL 3MXPA 2GVAA 4H02A 3N6RA 1R9TH 4L5QA 1WYDA 5D65A 4JCVE 1SYGA 2O4XA 1NBWA 1SRUA 2E8GA 2I0QA 1I6VC 1DD2A 3EFXD 2H4OA 4R4OA 2Z6KA 1I4RA 4U673 2K7VA 1H9KA 5JVG3 2KCCA 3U50C 2KHJA 5CORA 4G7OC 2K33A 1SE4A 2HD3A 2QW7A 5C4HA 2PYKA 3EIVA 4BBSG 4BBSB 2XSCA 1C0AA 1QOHA 2WV6D 3S1QB 5ELCA 4RA8A 3CP0A 3KJOA 4WJ3M 1K0SA 1CZGA 3LWEA 4IFDJ 2FINB 4NPSA 1BCPC 4J1MA 5E4WC 5M5WB 4X66Q 3P1HA 4DV0Q 1ENAA 1PH1A 4QB4A 1D1IA 4LW1A 5EPJA 3S17H 1P8LA 1XMQQ 4B9WA 1EWIA 4GNXA 3CRKC 2XNAC 1G6ZA 2JSOA 5CV8A 1JWUD 5BN4A 1WD0A 1BBWA 2K01A 4A3BH 4PQXA 3S15B 2R93G 1ONLA 1Y1WH 2R93B 3TZUA 1F2ZA 3OHXC 1J8IA 5IGDA 4MNOA 2OQ0A 4A3EB 2MJ8A 2MQHA 3HOYH 4O42A 1VQKA 1GHJA 1D5XC 1D6EC 1PTOD 4LF8Q 4XDXA 1GUNA 3S2HH 3GD7A 3Q22A 5C0XJ 1WTOA 1S5FD 1RF2D 3I72A 2K1BA 4DK0A 1Q82C 2NVYH 2PW5A 3NPPA 1PH2A 4JBKA 3VR6A 1HZAA 1TWAH 2EY6A 3W3AA 3WWVA 2IL8A 4Y7NH 4DR1L 1U0LA 1EOTA 5TSSA 4M1UB 1QB5D 1HHVA 3OWFA 1VQ9A 4H13C 5IT9c 3FPUB 4JI7Q 2F0EA 4X3KA 1YVCA 1D8LA 1QVFA 4HJ8A 2IHEA 3EQLC 1IYVA 1SMYD 1YEZA 4XXEA 1EFWA 3S1QH 1LLRD 3EJIA 1RKNA 3A54A 1Q3LA 2I46A 3O13A 1S4ZA 5FLXc 1PFBA 3H15A 2DY7A 1F2YA 4EQNA 1JICA 2NN6G 2MO1A 2N88A 4C56C 2UUCQ 3P7JA 5DAUA 4GLVB 2QEJC 2JA5G 4ME3A 4JI4Q 3TBIB 3J80c 2JA5B 3RLNA 1VF7A 1I4HA 1MKHA 1TWCH 4U68A 1EYCA 5LL6S 4HR7B 3TP6A 1HNXL 3K6OA 1SN8A 5I2YA 1BBUA 4OIJA 2XWBB 1B70B 2MP1A 2F0LA 1GOZA 4YIJA 1IW7D 3I4LA 2NZHA 2A8VA 2R93H 2NVQB 1Z47A 1FVIA 1SEBD 1NUCA 2B2WC 4LUOA 3H0GB 1VQDA 4PV1C 3C46A 3PO2G 3PO2B 2ZT9C 4DNTB 4HTHA 1IBKL 3HP3A 1X3EA 4LK1C 1YHBA 2MO0A 3F8TA 5EQ0A 5FJ8H 1CI3M 2B2TC 3F2DA 1K73C 5CV9A 3ND8A 1HCZA 4WJ4A 1BO0A 3D0FA 1SE2A 2Z6BA 1TWHB 2IPKD 1C7YA 1U4LA 3QJYA 2L4NA 4C3IG 4KKTA 1KLUD 5JAVA 4C3IB 3CU7A 1WTPA 1QG7A 2EXDA 3TSSA 1D5MC 2LXJA 4OO1H 2I5LX 3TS0A 1GUTA 4ABNA 3ZJYC 2VB3X 3I4NB 2EOTA 1T5EA 3BDOA 3IKJA 4C3JG 1NAPA 4KLKA 4CKBA 1IHZA 4IO9A 2R7ZG 5DNFA 4A3MG 2R7ZB 2PNRC 1Q1BA 1BDOA 2NN6H 1EU3A 4EGVA 4OGQC 4X64Q 4LF9L 4PMBA 4DN4M 1DM0B 1WD1A 4IPDA 2JA5H 1OXUA 4A3IG 2ES2A 4DV1Q 4A3IB 1FL0A 2D5DA 5M5YH 2L9HA 4PNYA 3J81i 3ULJA 2K52A 3V2TA 5K36H 4DV7L 4OX9Q 1YIJA 3M3YB 3MC0B 2JEBI 5M3MH 4V190 4ZKCB 1T9HA 2A74C 2E75C 2HHHQ 1Y1VG 1Y1VB 3DUZA 2NWGA 4FF3A 4L5SA 1FJGQ 1B7YB 1VQBA 3P20A 4RWSC 3OTOQ 1EWHA 3PO2H 2LKVA 4DR5L 1D2BA 1X54A 2JA9A 1B9MA 3SK6A 2MFIA 1A8VA 4X3SA 4JI3Q 5FO9B 1DJRD 2CHBD 1X55A 3H3VC 4LF7Q 2L0CA 3T51B 5CBAE 5JPMC 4NDXA 4B08A 2UUAQ 5IGCA 4RHSA 4KJOA 1EEFD 1MI2A 4Q0FA 2PPBC 4NB3A 3CQZB 2OF1A 5CV6A 1NCVA 3ITPA 3PF5A 1JOQA 4FF4A 1O7ZA 1UAPA 1A2TA 1J5EL 4LJZC 5AJ3Q 1K28A 4B3MQ 2SDFA 4C2MB 3RUZA 1TR5A 3NK9A 2B2VC 2MPMA 1HUMA 1W6JA 3PIO3 1LO5D 4C3JH 2PI2E 2CH4W 4A3MH 2SNMA 1HXYD 3KBXA 1AFPA 1JR0D 4UAIA 4DNRB 2HDLA 3HOVG 3I3CA 2BOSA 2E2IB 3HOVB 3K0YA 4CKEA 2XRQD 5E1FA 5GAEC 1TU2B 2B2YA 3A0JA 3FRPB 3CRLC 3G6JB 3W5OA 3K7AB 1DONA 4A3IH 4KHZA 5ELNA 1BVSA 1ENCA 2WKDA 1X9NA 1EY8A 4YY3L 5JJLA 3CMEA 2XVSA 5J1ZA 3MXUA 4JVZA 2ASBA 2QA4A 4A75A 1CUKA 2NVXH 4HJAA 3GP7A 3IFTA 2VUMH 1PLFA 1XPRA 4JYAL 4A3CH 5IGBA 1KDBA 3E3XA 1KABA 4FP5D 3MFYA 1VDZA 4RKBA 2JK8A 2AUJD 1SYEA 1Q46A 2KHIA 1VQGA 3Q0AA 1PRTB 1AH9A 1WCMG 1GUGA 3CCJA 3KYHC 5LMUQ 4YWKA 3SK5A 5CBEE 1N33L 1X3QA 5LMNQ 1X3PA 4DV3Q 1ENFA 4CJ1B 1NMGA 2BH8A 1G2SA 1PH5A 4MIUA 3ONAB 4YCVA 3LX0A 3SXHA 4G7ZC 2UU9L 1Z9FA 4JI8L 3OW2A 2VQFL 3NBIA 2KOLA 2J4XA 4IUPA 5I2XA 1PH7A 3CHBD 1BXTA 2WAQG 3X3MA 1DXMA 3CCQA 2F0JA 4UP7A 4G7HC 3VYRA 3Q24A 1YI2A 2PNHA 3K0XA 2E2IH 1W6KA 3E5SA 1K0RA 3JAML 4IFDH 1A15A 2R92G 1HNXQ 2ZXPA 2QDLA 1L0WA 4NP5A 5JPNC 5M3FH 3CPFA 4RGOS 3T13A 1SR3A 4ALPA 4EX5A 3V05A 1XTDA 2F0UA 1XNRL 2D9UA 2RDFA 2BA0A 3S1MB 4A3GG 1B4OA 1TWGB 4IOAA 3OWEB 4L5RC 3HOZB 1IBKQ 1K3RA 5BR8L 4LF4L 4RCOA 5C4ZA 2JEAI 1FD7D 3GTMB 1PFMA 3RMHA 3SGIA 1YZ6A 1CQFA 2K5DA 2ZTCA 4L5TA 3T16A 1YJNA 1SROA 2UUBL 1B2TA 2FFKB 1AN8A 4S3SA 3BS1A 1JT8A 2QF7A 3GDEA 2K5HA 3HEJA 2Q2HA 1YITA 3S16H 4BWGB 1JB7A 1J6QA 4IALA 3RN2A 1ICWA 1WCMH 3BDLA 1NJIC 4DAVA 3AFQA 1IXRA 5CV7A 3S14H 5C0XH 1X65A 3VA5A 5KRUA 4BA1I 5A35A 4KJNA 5IYCG 3R93A 1KXLA 1L0XB 4KHPL 2WAQE 2NUCA 4DV6L 3HFZB
chains in the Genus database with same CATH topology
1PTOF 2F3WA 3GTQB 1NR4A 4ZUJA 3TDQA 4AYBB 1PRTD 2K5WA 3J7AV 2LY7A 3QB3A 2IX1A 1VF5C 5ELBA 4A93B 2R6GA 3A8JE 4K2LA 1IYUA 3MA2B 3L7ZC 3GV3A 3R2TA 2QILA 1QCBD 4EQOA 3AU7A 1GJXA 2WKCA 4I7ZC 1G8ZD 2ICIA 1II3A 2MGSA 1F2LA 3PUVA 3DWAA 2B8FA 2EYPA 4HCEA 3NUCA 1J9OA 3OMCA 1JCKB 4HSVA 4OHJA 1SDFA 1BQQT 2ICEC 4RGNA 5C44B 1PDQA 3QG1A 4ODGA 5CV4A 2EY2A 1EY5A 1TKWB 4WRDA 2F0PA 1TS4A 3DEPA 1S5CD 4KHVA 5C4XB 2F0HA 2A69C 1TS5A 1A2UA 1LV9A 2XIWA 2F0KA 1EY6A 1FR3A 5G3LD 4M8AA 3Q6SA 1JE4A 2F4IA 1FNUA 2SNSA 2JA6B 2DN8A 3OPOA 2VXWA 2NTSA 3V96A 1JB3A 1STNA 2RBMA 2CW0C 1HPCA 2ZXRA 4FVMA 5F2DA 4KY5A 1LT4D 3NSWA 3TN2A 4K14A 1HUNA 3I91A 4P2CB 4I65A 1TQOA 2Q8IB 2BDOA 4HCSA 3KBGA 3EROA 1RJTA 4A3DB 1WTXA 1JWMD 1I3QB 3HKZB 1PTOH 2WB1B 2E2HB 1GHKA 5LL6X 3H91A 1HA5A 5C4JB 1LTTD 3TP7A 2FJ2A 2LFNA 1SYFA 4BY1B 1XXGA 2Y0SB 5I9PA 5JEAJ 3BG3A 4FNFA 4DAPA 3GV6A 4FO2A 5CMDA 3DM1A 2HCCA 3NXWA 1I4PA 1OO9B 4EQPA 1H9MA 3R8BA 1EIGA 1EZ6A 4L6TB 2H1EA 4PMCA 4IUTA 4R9WA 3LNNA 4L8JA 4X3TA 3L9AX 1Z6HA 3CKIB 3Q23A 3T56B 4BS9A 2PZTA 2OXPA 2HCIA 4K5XA 5IT9L 4DGZA 3AMUA 2B63B 4RH6A 2V4DA 1V43A 3P75A 5FLXL 3U9SA 2SOBA 3WOEA 2F0OA 3TZDA 1ZYRC 5C5LA 3OIPA 5ISRA 2A68C 4KY6A 3J7AF 4ID6A 1EY7A 1EWCA 1ILPA 3A8KE 1M8AA 1SNDA 5IOCA 3VR3A 2N55A 4ILWA 5JOBA 1BCPB 4FF2A 2JA7B 5KNBA 2X6GA 4QMGA 1AP0A 2K05A 1PMRA 2B2UA 3NE5B 3QOLA 3PO3B 5KIXA 1WVLA 1E2ZA 4CGYB 3QOJA 5DM63 2A6EC 4E6IA 4ZQ3A 2XWJB 1SSOA 5C6AA 1FNVA 3LWUA 5J39A 2IX0A 3HOXB 2KUMA 2Z4HA 1U9RA 3M85A 1B9NA 1AW7A 2NVTB 2C9OA 4BBRB 2EDGA 2EXZA 3A7LA 1EY4A 1IL8A 5EBDA 5FO8B 3S2DB 2KJXA 3URYA 1EQTA 2RDGA 1NSNS 5J22A 1LT3D 3M7GA 4F88A 2F0QA 5ELFA 1Y8NB 2A69D 2B2YC 5AFWA 3X3NA 1CK1A 4TSSA 1TY2A 1E2WA 4FXKC 5EBCA 3MWYW 3I4MB 3SEBA 5A2QL 1O80A 3AB9A 2HUGA 2EY1A 2E74C 1EFID 5KGUA 1STGA 3ERQA 3OOCA 3KUPA 2BA1A 1C8CA 1STAA 3RZOB 1ET6A 3J81L 5K5PA 1STBA 3RZDB 3SVMA 1YNNC 4MN3A 1KAAA 3GTPB 3S1RB 1KTKA 2AQ1B 3FVQA 1BCPD 1H9JA 4BA2I 2PW7A 4HAEA 3VR4A 3D4DA 5EGTA 3FEWX 1JOKA 5T1GA 3KLRA 2KVMA 2QDBA 5COYA 3S1NB 5DM73 2EYMA 1IKMA 1XWEA 1PRTF 5CGKA 1RTNA 1F2MA 4FYDA 5I6YA 3MXNA 4IN3A 4KN7C 2QKIC 1LT6D 1BF4A 5C3EB 4DFAA 4C3HG 1AZQA 4C3HB 5KEEA 3VYUA 2JP1A 4XYQA 1SJHD 1A3TA 2FHTA 1H9RA 1F9RA 1UUPA 3D3RA 5JEAG 3VR5A 4LMQD 3NTIA 4XT3B 2E76C 2KECA 1S5ED 4DF7A 3E0JA 1STEA 3HS0C 4B9XA 3OW7A 4XQJA 3K5NA 3GTGB 3J81E 2F0FA 3EA6A 3HZXA 4H44C 1F77A 3H94A 5EKLA 1O7YA 2NTTA 2YU9B 4IZ8A 2M00A 4QCLA 4C1NI 2D62A 3GO5A 3SDZA 2G9HD 2A73B 5G3LF 3HOWB 1O78A 3F2UA 5CC4A 2F0WA 1LT5D 3BVZA 5NUCA 1EYDA 4ME5A 3MHBA 4IUQA 4K2KA 1KDCA 3S9WA 1GUOA 4FXGC 1SYDA 1GUSA 5KYLA 4K6LA 1EU4A 4QUCA 3T53B 2F0DA 1RD9D 3N52A 3HG9A 2EYHA 5FK9C 4CKCA 4L63B 2B2VA 1KLGD 4KKSA 5JEAH 2F0SA 5ELDA 3BDCA 2M9VA 2TSSA 1I6HB 5KNCA 1STYA 2EYLA 3OMGA 1S5DD 4XIGS 4HEDA 3D6WA 2KEEA 3QO2A 1BNZA 1PTOC 2O2LD 1KNEA 1TWFB 3QIAA 5ELEA 4K8JA 2Q8RE 1PZID 4HN7A 2F03A 3K5OA 4KD3A 3NWTA 4J8QA 2HDMA 2AQ3B 4CHTB 3G7LA 1Z7TA 3GTLB 3FKIB 2E2JB 4QUFA 5IGGA 2EY5A 1QWYA 2GA4B 1ML0D 5HGTA 4ZRZA 3C3LA 2L5TA 1SMYC 2NYZD 1YNJC 3DWPA 1EYAA 2PZWA 2PMZB 4N9PA 1A3UA 2G9DA 2F0NA 2OEOA 2EE1A 1DZ1A 1U4PA 4NKLA 3MAQA 2WP8J 2EYFA 1BBXC 4H0LC 3JAME 2EYOA 3ZYYX 3QWNA 3PUZA 2KQ3A 4OO1I 1UEAB 4CJ2C 1V1OA 3PUYA 1HFNA 2K04A 3SHLA 1V8QA 5C3WA 2NN6I 1RCVD 2B39A 1S5BD 3VA7A 2HQEA 1V1PB 1CT1D 4WJWA 4RGMA 1SYBA 2L1BA 5EPKA 5JJZA 3K57A 2JA8B 2PO4A 5I9OA 3VR2A 1DOKA 4XTCS 2C5CA 2LMCB 2AWOA 5CR3A 2E2DC 3MZ5A 2TMPA 1Y1WB 3GQBA 3KLSA 4CBVA 3HOYB 3BZDB 2A6HC 1SJED 1ESRA 1ZEQX 3S2HB 4NW2A 3HGBA 2NVYB 1TWAB 1A3VA 1LTBD 4X3UA 4CJ0B 5I6WA 2F3VA 4Y7NB 1LTRD 2JE6I 2O5IC 2B8GA 1I4XA 4KK7A 4KI0A 1Y69U 4RKLA 4DAYA 3OIQA 3EVQA 3TP8A 1LTID 3VYTA 2B2UC 5HURA 1WTRA 2JYOA 1B3AA 3D8GA 3I70A 4V0BA 3DMUA 3NBHA 5I4DA 1RTOA 1FYCA 1BUVT 1HQRD 1I4QA 3NWSA 5FO7B 1G91A 1TWCB 1TT2A 2OT2A 2WACA 1LTSD 1R4PB 4G57A 1CHQD 2RVLA 1MD2D 1BCPF 1HTLD 4HMIA 4KKUA 1HFGA 2O5JC 3M7NA 2M2LA 1HTPA 1PXUA 4QIWB 4EVOA 1LTGD 3GTKB 3SK8A 4F8MA 5FOBB 4XQQA 2YYZA 3M4OB 3MTSA 1VMPA 2DNEA 4K8IA 5EJWA 3A8IE 4RCNA 1C48A 1ILQA 5EKIA 3I73A 4ZUIA 1B44D 1RODA 2RA4A 5BN3A 3J80L 2Z1CA 3DEOA 1QNUA 4IFDI 4OO1G 1PZKD 1MBYA 1Q8IA 4K6DA 1YNJD 1KDAA 1KNAA 3ND9A 5IIFA 1Q1EA 3NQIA 1QILA 1STHA 2FMCA 1VMCA 3WOFA 1H9SB 4Q5VA 4DA2A 1CHPD 3IAYA 4ZAIA 2WINB 3H09A 4DK1A 5M5YB 1RDPD 1O7LA 1GUWA 3IL8A 1H9SA 2ZXOA 1U4RA 5K36G 3K58A 4XT1B 2IWHA 1CA5A 3PUWA 5DEHA 4R8NA 4N9TA 5M3MB 1HQMC 1B1ZA 2EPBA 3U9OA 2FMMA 1RHPA 3DXJC 2PZUA 3R2IA 5C0XI 2MUYA 1VCIA 2EVBA 2I07B 2K5QA 3FDTA 1CQVA 4DU9A 3MFGA 1WTQA 1LABA 1XX8A 1LTAD 2RSNA 1QE6A 2EJGC 5IT9E 1Q90A 2Q8TA 5E3FA 1SXTA 1PZJD 1JC7A 2JXMB 1BR9A 1K8OA 3A56A 4QF4A 2RSOA 2R61A 2J0TD 2IW3A 5FLXE 5IGEA 1EIHA 3BYTB 4XYOA 2AUKA 4WORA 4ZLTF 1NR2A 1I4GA 2X69A 3BVGA 1OXTA 2KA7A 4C3JB 1LACA 1F9SA 1Y8PB 4GZYC 2D2CC 3J80E 3K5MA 1BOSA 4A3MB 2CW0D 2AWNA 4JK1C 2CQAA 1EEID 2RQXA 2A6HD 3R3OA 4XQNA 1TVXA 1AZPA 3C2PA 3D4WA 2F0IA 1B50A 3SK4A 1ZXTA 1QJOA 2NVXB 4ULLA 3TMEA 2PQEA 2VUMB 5JVH3 2EJFC 1PRTC 2NZ1D 3UI2A 3NHHA 1B53A 4R8IA 3M4YA 2B2WA 3T4AC 2VB2X 4UDUC 4IURA 5LHY1 3KF8A 2DY8A 2BCOA 2KEDA 4FXDA 2NB0A 2LS01 4LAAA 2BE5C 1K8MA 4H7BA 5M9OA 1EL0A 4HMJA 3WDNA 2L55A 2B2TA 2EJMA 4WFN3 5CYUA 1SBBB 4RAUC 4PMWA 1SNCA 2L12A 5KYIA 2AQ2B 4F7XA 3K5LA 1PYWD 2F0VA 3C1FA 3SE0A 1EZ8A 1D5ZC 1F9PA 3E6ZX 3HOUB 3SR1A 4TQUS 4RFBA 1SNQA 4TRDA 2KCNA 3NTKA 1SNPA 4IFDG 1TS2A 5A2QE 4DXGA 5M3FB 1Y8OB 1PFNA 5D3DA 1G2TA 3MEHA 1ZYRD 2A68D 2EZVA 1A6XA 2EYJA 2Z4IA 1SE3A 1TIID 2J7ZA 3KLSX 4OIKA 2ID0A 1ESFA 1SNOA 2PCFB 1OXSC 2VNUD 1Q12A 2F1MA 3J7YW 1CM9A 4OL7A 4O1NA 3S16B 1M4VA 3DWQA 2SEBD 1WCMB 4KN4C 4KMUC 5C0XG 3S14B 3DHQA 5D3IB 4HSPA 1OXXK 1CZWA 2IJ0A 4KV6A 3MXGA 2A6ED 3NQTA 3OSOA 5KNDA 3H6MA 5E4XA 1SAPA 1DOMA 2WAQB 5IGFA 5M5XB 4F87A 4IUNA 1C4QA 4JBWA 4KTAA 3PUXA 4ZK9B 5BN5A 3A55A 1G291 4KD4A 1ZKOA 5D14A 5EKKA 3RLFA 1HA6A 2R92B 4IUVA 4C1NK 1MSGA 1DCZA 4TKOB 1K83B 2BDNA 1JORA 1MSHA 5C3XA 2Z8LA 3I8ZA 3FPPA 1TS3A 2QCPX 1JOOA 4A3GB 3I90A 3PV0A 1OXVA 5C5MA 4A3KB 5FKAC 1IKLA 4KY7A 1WTVA 1EQVA 3GTOB 4RHRA 4Z9CB 3K59A 5CV5A 3TP5A 2CVRA 3L3OC 3D31A 2ENBA 5IODA 4BY7B 1XTCD 1QNKA 1ET9A 1F9QA 1YNND 2WIIB 4RGTA 1L0YB 4IUUA 4K5WA 4A3JB 3PIP3 1DOLA 1E0BA 3FMCA 1TY0A 1FGBD 1R9TB 1GXDC 1R4QB 2L11A 4G4KA 1CA6A 2NBFA 2RKSA 5EPLA 3IFDA 1T5XD 2MHVA 1EY9A 2IT1A 1CFMA 1IW7C 1JWSD 3PMFA 1E2VA 2BE5D 3HRZC 3NTHA 4K5VA 2R3ZA 1X32A 4MHEA 1AEXA 1EY0A 2KHSA 4J6HA 2F0MA 2K03A 1U4MA 1HRJA 4ZKBB 3MVVA 2F0GA 4DXFA 2K6AA 1DYQA 1V1PA 1SNMA 1SFOB 4ZYSA 2X6LA 3KK7A 2XN9C 4A3FB 3BYYB 3S17B 1PTOB 2K32A 3RD4A 1JQYD 2A5HA 3A7AB 4FF1A 2DNCA 1WTWA 1XYIA 2RDHA 1I50B 4NMZA 3GTJB 1D1KA 2IX3A 2XRSD 4A3BB 3BVMA 3NP8A 3VYSA 4IQZA 3D6CA 5T1IA 1FNWA 3C1EA 3W2DA 1MGSA 2F0TA 1UNSA 1SYCA 1CTMA 3D4RA 2K28A 3MXPA 3N6RA 5D65A 1SYGA 2O4XA 1I6VC 1DD2A 3EFXD 2H4OA 1I4RA 4U673 2K7VA 1H9KA 5JVG3 2KCCA 5CORA 4G7OC 2K33A 1SE4A 5C4HA 2PYKA 4BBSB 2XSCA 1QOHA 2WV6D 3S1QB 5ELCA 4RA8A 1CZGA 3LWEA 4IFDJ 2FINB 1BCPC 4J1MA 5E4WC 5M5WB 3P1HA 1ENAA 4QB4A 1D1IA 5EPJA 4B9WA 3CRKC 2XNAC 1G6ZA 2JSOA 5CV8A 1JWUD 5BN4A 1WD0A 2K01A 4PQXA 3S15B 1ONLA 2R93B 3TZUA 1F2ZA 3OHXC 1J8IA 5IGDA 4A3EB 2MJ8A 4O42A 1GHJA 1D5XC 1D6EC 1PTOD 4XDXA 1GUNA 3GD7A 3Q22A 5C0XJ 1WTOA 1S5FD 1RF2D 3I72A 2K1BA 4DK0A 2PW5A 3NPPA 3VR6A 2EY6A 3W3AA 2IL8A 1EOTA 5TSSA 4M1UB 1QB5D 1HHVA 3OWFA 4H13C 3FPUB 2F0EA 4X3KA 3EQLC 1IYVA 1SMYD 4XXEA 1LLRD 3EJIA 1RKNA 3A54A 1Q3LA 2I46A 3O13A 1S4ZA 1PFBA 2DY7A 1F2YA 4EQNA 1JICA 2NN6G 4C56C 2N88A 3P7JA 5DAUA 2QEJC 2JA5B 3TBIB 1VF7A 1I4HA 4U68A 1EYCA 5LL6S 4HR7B 3TP6A 3K6OA 5I2YA 4OIJA 2XWBB 2MP1A 2F0LA 1GOZA 4YIJA 1IW7D 3I4LA 2NVQB 1Z47A 1SEBD 2B2WC 1NUCA 4PV1C 3H0GB 3C46A 3PO2B 2ZT9C 4DNTB 4HTHA 3HP3A 4LK1C 5EQ0A 1CI3M 2B2TC 5CV9A 3ND8A 1HCZA 1BO0A 1SE2A 1TWHB 2IPKD 1U4LA 3QJYA 2L4NA 4C3IG 4KKTA 1KLUD 5JAVA 4C3IB 3CU7A 1WTPA 1QG7A 3TSSA 1D5MC 4OO1H 1GUTA 4ABNA 2VB3X 3I4NB 2EOTA 1T5EA 3BDOA 3IKJA 4C3JG 1NAPA 4CKBA 1IHZA 5DNFA 2R7ZB 2PNRC 1Q1BA 1BDOA 2NN6H 1EU3A 4EGVA 4OGQC 4PMBA 4DN4M 1DM0B 1WD1A 1OXUA 4A3IB 2D5DA 2L9HA 4PNYA 3V2TA 5K36H 3M3YB 3MC0B 2JEBI 4V190 4ZKCB 2A74C 2E75C 1Y1VB 3DUZA 2NWGA 4FF3A 3P20A 4RWSC 1EWHA 2LKVA 1D2BA 1B9MA 3SK6A 4X3SA 5FO9B 1DJRD 2CHBD 3H3VC 2L0CA 3T51B 5CBAE 5JPMC 4NDXA 4B08A 5IGCA 4RHSA 4KJOA 1EEFD 1MI2A 4Q0FA 2PPBC 3CQZB 2OF1A 5CV6A 1NCVA 3ITPA 1JOQA 4FF4A 1O7ZA 1UAPA 1A2TA 4LJZC 2SDFA 4C2MB 3RUZA 1TR5A 3NK9A 2B2VC 2MPMA 1HUMA 1W6JA 3PIO3 1LO5D 2SNMA 1HXYD 3KBXA 1AFPA 1JR0D 4UAIA 4DNRB 2HDLA 3I3CA 2BOSA 2E2IB 3HOVB 3K0YA 4CKEA 2XRQD 5E1FA 1TU2B 2B2YA 3FRPB 3CRLC 3G6JB 3K7AB 1DONA 4KHZA 1ENCA 2WKDA 1EY8A 2XVSA 5J1ZA 3MXUA 3GP7A 3IFTA 1PLFA 5IGBA 1KDBA 1KABA 4FP5D 3MFYA 1VDZA 4RKBA 2AUJD 1SYEA 3Q0AA 1PRTB 1GUGA 3SK5A 5CBEE 1X3QA 1X3PA 1ENFA 4CJ1B 1G2SA 4MIUA 3ONAB 3LX0A 3SXHA 4G7ZC 3NBIA 2KOLA 2J4XA 4IUPA 5I2XA 3CHBD 1BXTA 3X3MA 1DXMA 2F0JA 4G7HC 3VYRA 3Q24A 1W6KA 3E5SA 3JAML 4IFDH 1A15A 2ZXPA 4NP5A 5JPNC 4RGOS 3T13A 3V05A 2F0UA 2D9UA 2RDFA 2BA0A 3S1MB 1B4OA 1TWGB 3OWEB 3HOZB 2JEAI 4RCOA 5C4ZA 1FD7D 3GTMB 1PFMA 3RMHA 3T16A 1CQFA 2K5DA 1B2TA 2FFKB 1AN8A 4S3SA 3BS1A 2QF7A 3HEJA 4BWGB 4IALA 1ICWA 3BDLA 4DAVA 5CV7A 5C0XH 3VA5A 5KRUA 4BA1I 5A35A 4KJNA 3R93A 1L0XB 2NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKV A;  3P75 A;  2RBM A;  1EYC A;  3PMF A;  4DU9 A;  4J1M A;  2F3W A;  2SOB A;  4KTA A;  3SK6 A;  1SNC A;  4ZUJ A;  3SK5 A;  2F0O A;  3P1H A;  3TP6 A;  5KYI A;  1ENA A;  5F2D A;  4K5V A;  4KY5 A;  4QB4 A;  5C5L A;  4F7X A;  5ISR A;  4KY6 A;  4KD4 A;  4K8J A;  5EKK A;  5CR3 A;  2F0V A;  2F0L A;  3C1F A;  4ID6 A;  4KD3 A;  4MIU A;  4YIJ A;  4B9W A;  3QB3 A;  4K14 A;  1EY7 A;  5E3F A;  4EVO A;  2EY1 A;  4NDX A;  1EZ8 A;  1AEX A;  3LX0 A;  1EY0 A;  1NUC A;  3MZ5 A;  3SXH A;  5KGU A;  1STG A;  2KHS A;  4J6H A;  3SR1 A;  4DF7 A;  2F0M A;  1SNQ A;  4TRD A;  5IGC A;  3SK8 A;  1JOR A;  4F8M A;  4K2L A;  1SND A;  3ERQ A;  3MVV A;  4B9X A;  4KJO A;  2F0G A;  4QF4 A;  5C3X A;  1SNP A;  4HTH A;  5IOC A;  4I65 A;  5CV8 A;  2OF1 A;  1TQO A;  5IGE A;  5CV6 A;  5JOB A;  1JOO A;  1SNM A;  1STA A;  2F0F A;  3ITP A;  4WOR A;  2F0J A;  5IGG A;  3ERO A;  4K8I A;  3HZX A;  2EY5 A;  1JOQ A;  5EKL A;  1A2T A;  4QMG A;  1STB A;  1F2Z A;  5K5P A;  4EQO A;  4IZ8 A;  1KAA A;  3E5S A;  2M00 A;  5CV9 A;  5HGT A;  5IGD A;  5C5M A;  4ZUI A;  3RUZ A;  1TR5 A;  3NK9 A;  1EYA A;  2PZW A;  4NP5 A;  4N9P A;  4KY7 A;  3QOL A;  1A3U A;  1II3 A;  3T13 A;  5KIX A;  3MEH A;  2PW7 A;  3TP7 A;  4NMZ A;  2F0N A;  2OEO A;  3R3O A;  5JAV A;  2F0U A;  3QOJ A;  1EQV A;  1SYF A;  2SNM A;  2RDF A;  3D4D A;  2EYP A;  5CC4 A;  2F0W A;  5I9P A;  1A3V A;  2EYJ A;  3NUC A;  4K6D A;  4ZQ3 A;  5EGT A;  4E6I A;  3OMC A;  5I6W A;  3NP8 A;  1KDA A;  4NKL A;  5C6A A;  2F3V A;  2PW5 A;  3D6C A;  5E1F A;  1JOK A;  5IIF A;  3C1E A;  5J39 A;  5CV5 A;  3TP5 A;  2EYF A;  5NUC A;  1EYD A;  2F0T A;  2EY6 A;  1U9R A;  5C4Z A;  2EYO A;  4ME5 A;  1SYC A;  1SNO A;  3D4W A;  3MHB A;  1STH A;  2F0I A;  2QDB A;  1ENC A;  3SK4 A;  2ENB A;  4K2K A;  3T16 A;  4ODG A;  1IHZ A;  1KDC A;  3NXW A;  5CV4 A;  2EY2 A;  3S9W A;  1EY8 A;  4RKL A;  5IOD A;  4EQP A;  2KQ3 A;  3OWF A;  2EYM A;  1SYD A;  2EXZ A;  4OL7 A;  1EY4 A;  3TME A;  2PQE A;  2F0E A;  3MXP A;  4S3S A;  5KYL A;  5J1Z A;  3EVQ A;  5CGK A;  4PMB A;  1EY5 A;  1EZ6 A;  3TP8 A;  1F2M A;  1SYG A;  3HEJ A;  2F0D A;  2O4X A;  3NHH A;  5HUR A;  5I6Y A;  3SHL A;  2EYH A;  4WRD A;  4PMC A;  2F0P A;  3D8G A;  3DHQ A;  1NSN S;  4KHV A;  3DMU A;  5C3W A;  5J22 A;  2F0H A;  4IAL A;  4K5W A;  3EJI A;  3BDL A;  5IGB A;  1RKN A;  1KDB A;  5DEH A;  2PZT A;  4PNY A;  1KAB A;  4DFA A;  1F2Y A;  4KV6 A;  4R8N A;  4N9T A;  5CV7 A;  4EQN A;  2HQE A;  1A2U A;  2OXP A;  3V2T A;  2F0Q A;  2F0K A;  1EY6 A;  2F0S A;  3NQT A;  4K5X A;  3VA5 A;  3BDC A;  3OSO A;  4RKB A;  5KEE A;  3U9O A;  3H6M A;  5C4H A;  5DAU A;  5KRU A;  2PYK A;  4DGZ A;  1STY A;  4LAA A;  1SYE A;  2SNS A;  2EYL A;  2PZU A;  1TT2 A;  4H7B A;  4KJN A;  2WAC A;  3OMG A;  5M9O A;  2RKS A;  1A3T A;  4HMJ A;  1SYB A;  4G57 A;  1EY9 A;  5IGF A;  4IUN A;  2NUC A;  1STN A;  4HMI A;  5I9O A; 
#chains in the Genus database with same CATH topology
 1PTO F;  1GKH A;  4LF9 Q;  2JN4 A;  2F3W A;  3GTQ B;  2OTL A;  1NR4 A;  1JE5 A;  4ZUJ A;  5M5X H;  4DR4 L;  3TDQ A;  4AYB B;  1PRT D;  2K5W A;  4P72 A;  3J7A V;  2LY7 A;  3QB3 A;  1XPU A;  2IX1 A;  3EN2 A;  1VF5 C;  5ELB A;  4A93 G;  3TRZ A;  4A93 B;  1PYB A;  3RN5 A;  2Z6K C;  1CKO A;  2R6G A;  3A8J E;  2CWA A;  4K2L A;  4OXP A;  1L1O B;  4DV7 Q;  4UY8 C;  2R92 H;  1IYU A;  3MA2 B;  4EQ5 A;  3L7Z C;  3GV3 A;  4LUV A;  4BXX G;  4LF6 Q;  1VS0 A;  1L1O A;  4A3G H;  3R2T A;  2QIL A;  1QCB D;  4EQO A;  4DR5 Q;  3AU7 A;  1GJX A;  2WKC A;  4I7Z C;  1G8Z D;  1KHI A;  2ICI A;  1II3 A;  2MGS A;  4A3K H;  1F2L A;  3PUV A;  2ZM6 L;  3DWA A;  2B8F A;  1EYG A;  4JI1 L;  2EYP A;  1VQH A;  4HCE A;  3NUC A;  1J9O A;  3OMC A;  4DUZ L;  1JCK B;  4HSV A;  4OHJ A;  4B3S Q;  1SDF A;  4FDB A;  4GNX C;  4A3F G;  1BQQ T;  2ICE C;  5C44 G;  4RGN A;  5C44 B;  3GTO H;  1PDQ A;  4DNI A;  4UHV A;  3QG1 A;  4X62 L;  4ODG A;  2YV5 A;  5CV4 A;  2EY2 A;  4CDF C;  3PGZ A;  2D0O A;  1VQA A;  1EY5 A;  2P5Z X;  1YHA A;  1TKW B;  4WRD A;  2F0P A;  5IYC H;  4OON A;  1TS4 A;  3DEP A;  1S5C D;  4KHV A;  5C4X B;  2F0H A;  4LWC A;  2A69 C;  3VDY A;  4YHH L;  2WFW A;  5GQO A;  1TS5 A;  1A2U A;  3GTQ H;  1LV9 A;  2XIW A;  2F0K A;  1EY6 A;  1FR3 A;  5G3L D;  4M8A A;  3Q6S A;  1JE4 A;  2F4I A;  1KD1 C;  4R4Q A;  1FNU A;  2SNS A;  5IP7 H;  2JA6 G;  2JA6 B;  1UE1 A;  4DKA C;  1QVC A;  2A1A A;  2DN8 A;  3OPO A;  3CAM A;  2VXW A;  4A93 H;  1LUZ A;  2NTS A;  4DV2 L;  3V96 A;  3ICE A;  1JB3 A;  4YY3 Q;  2E5L Q;  1STN A;  2RBM A;  2CW0 C;  1XMO L;  4B3T L;  2OCE A;  1VQL A;  1HPC A;  2ZXR A;  4FVM A;  5F2D A;  4KY5 A;  1LT4 D;  4BXX H;  3NSW A;  3CC2 A;  3TN2 A;  1C9O A;  4JYA Q;  4K14 A;  1M90 C;  1HUN A;  3I91 A;  3U4Z A;  2F52 A;  2F4V Q;  4P2C B;  4I65 A;  1TQO A;  5IYD G;  2Q8I B;  2BDO A;  2JQO A;  4HCS A;  3KBG A;  4N8F A;  4A3D G;  3ERO A;  1RJT A;  1VQ8 A;  4A3D B;  1CKN B;  1WTX A;  3G4S A;  4R1J A;  5L37 A;  1JWM D;  1SFO H;  4P74 A;  3HKZ G;  4A3F H;  1I3Q B;  3HKZ B;  1X56 A;  1PTO H;  2WB1 B;  5C44 H;  3U58 A;  2I5H A;  2E2H B;  3K81 C;  3TQY A;  1GHK A;  1N33 Q;  5LL6 X;  3H91 A;  2VQE L;  1CKN A;  1HA5 A;  4A3L G;  5C4J B;  1LTT D;  3TP7 A;  4BY1 G;  2FJ2 A;  2LFN A;  1SYF A;  2Y0S G;  1XXG A;  4BY1 B;  2Y0S B;  5I9P A;  4GN4 B;  2UU9 Q;  4JI8 Q;  5JEA J;  1I50 H;  3BG3 A;  2VQF Q;  3GTJ H;  3BU2 A;  4FNF A;  4DAP A;  1AE3 A;  3GV6 A;  4FO2 A;  5CMD A;  1GM5 A;  3DM1 A;  3NEM A;  2HCC A;  4A3E G;  3NXW A;  1I4P A;  1OO9 B;  4EQP A;  1H9M A;  2HT1 A;  4HIK A;  1K8A C;  3R8B A;  2C35 B;  1EIG A;  1JJ2 A;  1EZ6 A;  4L6T B;  2H1E A;  2JA6 H;  4PMC A;  1VQN A;  4IUT A;  4R9W A;  3LNN A;  4L8J A;  4JI0 L;  4X3T A;  3L9A X;  1Z6H A;  4YCW A;  3AQQ A;  3CKI B;  3NEL A;  1GVP A;  3Q23 A;  3T56 B;  4BS9 A;  2PZT A;  2OXP A;  2HCI A;  4K5X A;  3UE1 A;  4K0K Q;  2RHS B;  5IT9 L;  4LF4 Q;  4J15 A;  4DGZ A;  3S24 A;  3G71 A;  3MEF A;  3AMU A;  2ZJR A;  2XTI A;  3J80 i;  2B63 B;  1YJ9 A;  4RH6 A;  1PYS B;  2V4D A;  2RCF A;  2UUB Q;  1V43 A;  3P75 A;  4BBS H;  5FLX L;  3U9S A;  3KOJ A;  2SOB A;  1K3B C;  3WOE A;  2F0O A;  3TZD A;  5IYD H;  1ZYR C;  5C5L A;  1W3S A;  3OIP A;  3HKZ E;  5ISR A;  2A68 C;  4KY6 A;  3STB C;  3J7A F;  4A3D H;  5M5W H;  4ID6 A;  5JJK A;  4JOI A;  1EY7 A;  1EWC A;  1PFS A;  1ILP A;  3A8K E;  4PZ7 A;  1M8A A;  2BH2 A;  2Y0S E;  1SND A;  5IOC A;  2E2H H;  1EQR A;  3VR3 A;  2N55 A;  4ILW A;  5JOB A;  4A3L H;  1BCP B;  2H5X A;  4FF2 A;  2JA7 G;  4KHP Q;  4BY1 H;  2JA7 B;  5KNB A;  5JJI A;  1HZ9 A;  3ER0 A;  4PZ8 A;  2N78 A;  2X6G A;  3F2B A;  4QMG A;  5GRO A;  1AP0 A;  1E24 A;  2K05 A;  3NE5 B;  1PMR A;  2B2U A;  3BZC A;  1KQS A;  3S15 H;  1SMX A;  3H0G G;  3PO3 G;  5FLM G;  3QOL A;  1PVO A;  3PO3 B;  5KIX A;  2R7D A;  1WVL A;  4IJL A;  1E2Z A;  4A3E H;  4CGY B;  3QOJ A;  5DM6 3;  2XGT A;  2A6E C;  4E6I A;  4ZQ3 A;  2XWJ B;  3CCR A;  1SSO A;  5C6A A;  3ERS X;  1RIP A;  1FNV A;  3H3V I;  4X6A H;  3LWU A;  5J39 A;  2IX0 A;  3HOX B;  2KUM A;  2Z4H A;  1U9R A;  4IOC A;  3J7A 5;  2B3G A;  3M85 A;  1B9N A;  4IPG A;  4OWT B;  1AW7 A;  1UWV A;  2NVT B;  4BBR G;  2ZJQ A;  2C9O A;  4BBR B;  2EDG A;  1B3Q A;  2EXZ A;  3A7L A;  1EY4 A;  1IL8 A;  4JI6 Q;  5EBD A;  5FO8 B;  3S2D B;  1E3P A;  4JW0 A;  2KJX A;  2V1C C;  3URY A;  1EQT A;  2RDG A;  4DUY L;  1NSN S;  3TS2 A;  5J22 A;  1IZ6 A;  1LT3 D;  3M7G A;  4JI1 Q;  5LMN W;  5IWA L;  4F88 A;  1GD7 A;  3I4N G;  4YWL A;  2F0Q A;  5ELF A;  1Y8N B;  2L15 A;  2DJG C;  2DUD A;  2A69 D;  2B2Y C;  3A5Z B;  1VQ5 A;  5AFW A;  3X3N A;  4X62 Q;  1N36 Q;  1CSP A;  1E22 A;  2CWP A;  1CK1 A;  4GS3 A;  4TSS A;  1Q8K A;  1TY2 A;  4QY7 A;  1E2W A;  4O0A A;  2G5D A;  4FXK C;  5EBC A;  3I4M G;  3MWY W;  3I4M B;  3SEB A;  5A2Q L;  1O80 A;  3AB9 A;  3KFU A;  2HUG A;  3I55 A;  4YHH Q;  2EY1 A;  2E74 C;  1EFI D;  5KGU A;  1STG A;  4R4T A;  3ERQ A;  2OQK A;  3OOC A;  2NVQ H;  3KUP A;  2BA1 A;  3H0G H;  5FLM H;  1C8C A;  1AE2 A;  1STA A;  2ZJP A;  3RZO B;  1ET6 A;  4RMF A;  1U5K A;  3J81 L;  5K5P A;  1STB A;  4DPG A;  3RZD B;  3SVM A;  1YNN C;  4MN3 A;  1KAA A;  1SLJ A;  3GTP B;  1XMO Q;  4B3T Q;  4UP8 A;  3S1R B;  1N32 L;  1KTK A;  1PV4 A;  4JI2 L;  2AQ1 B;  4LFC L;  3FVQ A;  1BCP D;  1H9J A;  4GLX A;  4BA2 I;  2PW7 A;  4QGU A;  2VL6 A;  4HAE A;  3VR4 A;  3D4D A;  3CXC A;  1TWH H;  5EGT A;  3FEW X;  3CC7 A;  1JOK A;  4YCU A;  2Q2I A;  4C3I H;  5T1G A;  3KLR A;  2KVM A;  3PF4 A;  2QDB A;  3MXN B;  5COY A;  2OTJ A;  3S1N B;  1LTL A;  1VQP A;  5DM7 3;  2EYM A;  3I4N H;  1IKM A;  1XWE A;  1IL2 A;  1PRT F;  1W2B A;  5CGK A;  1RTN A;  1F2M A;  4FYD A;  2DGY A;  2R7Z H;  5I6Y A;  3MXN A;  4IN3 A;  4KN7 C;  2UXD L;  5IYB G;  2QGQ A;  2QKI C;  2K5V A;  1LT6 D;  5C3E G;  1BF4 A;  5C3E B;  4DFA A;  4C3H G;  4GN5 A;  1AZQ A;  4C3H B;  5KEE A;  3VYU A;  2JP1 A;  3I4M H;  4XYQ A;  1SJH D;  2NZO A;  2ALY B;  1A3T A;  3KF6 B;  4OWX B;  3M3Y H;  2FHT A;  1H9R A;  1F9R A;  1UUP A;  3D3R A;  1Y1V H;  5JEA G;  3VR5 A;  4LMQ D;  3KF6 A;  3NTI A;  3RZO H;  4XT3 B;  2E76 C;  4JI0 Q;  3RZD H;  2KEC A;  1S5E D;  1VQE A;  4DF7 A;  3E0J A;  1STE A;  3HS0 C;  4B9X A;  3OW7 A;  1EOV A;  1E7Z A;  4DR1 Q;  4XQJ A;  3K5N A;  3GTG B;  3J81 E;  2F0F A;  1WI5 A;  4AQY L;  3EA6 A;  3CPW A;  3HZX A;  1A0I A;  4H44 C;  1F77 A;  3CQZ H;  1VQO A;  3H94 A;  5EKL A;  1O7Y A;  2NTT A;  2YU9 B;  4IZ8 A;  1Q86 C;  2M00 A;  1H95 A;  4QCL A;  1PH4 A;  4C1N I;  4DV4 L;  2D62 A;  3GO5 A;  3SDZ A;  2UXB L;  2G9H D;  2ATW A;  3HOW G;  2A73 B;  4C2M H;  5G3L F;  3HOW B;  4DV0 L;  1O78 A;  1UE6 A;  3F2U A;  3OYY A;  1PH6 A;  3BZK A;  5CC4 A;  3CF5 A;  2F0W A;  3K80 C;  4O2D A;  1LT5 D;  2R7F A;  5GAG C;  3F1Z A;  3M4P A;  1S3O A;  3BVZ A;  5NUC A;  1EYD A;  5IYB H;  3HOV H;  4ME5 A;  3MHB A;  4IUQ A;  4K2K A;  1KDC A;  3S9W A;  1GUO A;  3K7A H;  1NMF A;  4FXG C;  4C3H H;  1SYD A;  1GUS A;  5KYL A;  4K6L A;  3J7Z C;  4GKK L;  1EU4 A;  4QUC A;  3T53 B;  1I94 L;  1HZB A;  2F0D A;  1RD9 D;  3N52 A;  3UDG A;  3HG9 A;  2EYH A;  5FK9 C;  4CKC A;  4L63 B;  2B2V A;  4HIM A;  1KLG D;  4JPB W;  3HOZ G;  1WTH A;  4JC0 A;  1A62 A;  4KKS A;  4LF8 L;  4OEM B;  5JEA H;  2F0S A;  5ELD A;  2KEN A;  3BDC A;  2M9V A;  2TSS A;  1I6H B;  5KNC A;  3CCU A;  1STY A;  2HIX A;  2EYL A;  3FP9 A;  3OMG A;  1S5D D;  2N3S A;  4XIG S;  4HED A;  3D6W A;  2UXC L;  2KEE A;  4CDE C;  1PH8 A;  3QO2 A;  1HNW L;  1BNZ A;  1PTO C;  2O2L D;  1KNE A;  1TWF B;  3QIA A;  5ELE A;  4K8J A;  2Q8R E;  2IHF A;  1PZI D;  1HR0 L;  4HN7 A;  2F03 A;  3K5O A;  4KD3 A;  3NWT A;  4J8Q A;  5IE8 A;  2HDM A;  5IWA Q;  2YU9 H;  2AQ3 B;  4CHT B;  4LF5 L;  3G7L A;  1HJP A;  2Z9H A;  1Z7T A;  5HY6 A;  3FKI G;  3GTL B;  3FKI B;  2E2J B;  4DR2 L;  4QUF A;  4JG2 A;  5IGG A;  3HOW H;  2UUC L;  2EY5 A;  3CC4 A;  1QWY A;  4AYB G;  2GA4 B;  1X6O A;  1ML0 D;  4HJ7 A;  5HGT A;  4ZRZ A;  3C3L A;  2L5T A;  1SMY C;  2NYZ D;  1YNX A;  1YNJ C;  3DWP A;  1EYA A;  2PZW A;  2PMZ B;  4N9P A;  4ZCK A;  1A3U A;  3W1G A;  4CDC C;  2G9D A;  2F0N A;  2OEO A;  2EE1 A;  1DZ1 A;  2Z0S A;  4GOP B;  1U4P A;  3F2C A;  4NKL A;  3MAQ A;  2WP8 J;  1EQQ A;  2EYF A;  3I56 A;  1BBX C;  2OWO A;  4H0L C;  3JAM E;  1LYL A;  3S1M H;  2EYO A;  1TWG H;  3ZYY X;  4GOP A;  3HOZ H;  1QUQ B;  3QWN A;  3PUZ A;  2CQO A;  2KQ3 A;  3PSI A;  4OO1 I;  1XNQ L;  1UEA B;  3GTM H;  4CJ2 C;  1V1O A;  3PUY A;  1IBM L;  1KL9 A;  1I6H H;  1N32 Q;  1HFN A;  1MIU A;  2K04 A;  1IYJ B;  3SHL A;  1QUQ A;  3QR8 A;  1V8Q A;  2NN6 I;  1RCV D;  2B39 A;  5C3W A;  3TEH B;  1S5B D;  3VA7 A;  2HQE A;  1S40 A;  1MJE A;  1V1P B;  4HIO A;  1HZC A;  1CT1 D;  4WJW A;  3KDF B;  1J5E Q;  1IBL L;  2ZTD A;  3I2Z A;  4RGM A;  1SYB A;  2L1B A;  5EPK A;  3PQI A;  5JJZ A;  2JA8 G;  3K57 A;  2JA8 B;  2PO4 A;  4QJF A;  4DV5 L;  5I9O A;  3VR2 A;  5C4X G;  1DOK A;  3GTL H;  3KDF A;  3FKI H;  4XTC S;  4AYB E;  2C5C A;  2LMC B;  4X64 L;  1L2F A;  2AWO A;  5CR3 A;  4OWW B;  1X3F A;  2E2D C;  2N8N A;  1OTC A;  3FHW A;  3MZ5 A;  2TMP A;  2FXQ A;  3UE0 A;  4APV A;  1Y1W B;  2AHO B;  3GQB A;  1MHW C;  3CCS A;  3KLS A;  2RF4 A;  4CBV A;  1Q7Y C;  3HOY B;  1X3G A;  5E7N A;  3BZD B;  2A6H C;  1SJE D;  1ESR A;  1VQJ A;  5H1S E;  2RHQ B;  1ZEQ X;  3S2H B;  4NW2 A;  3HGB A;  1V9P A;  2NVY B;  2JJQ A;  1YHQ A;  1TWA B;  4JI3 L;  1A3V A;  1LTB D;  3M4Q A;  4X3U A;  4DK3 C;  4JOI C;  4CJ0 B;  5I6W A;  2F3V A;  4DAY B;  4LF7 L;  3I4O A;  4Y7N B;  1LTR D;  2JE6 I;  2UUA L;  2O5I C;  2B8G A;  4LFB L;  1I4X A;  4AQY Q;  1MJC A;  1N9W A;  4KK7 A;  2WB1 G;  4KI0 A;  1Y69 U;  4RKL A;  4DAY A;  3NBH B;  3OIQ A;  1V1Q A;  1K8G A;  3EVQ A;  3TP8 A;  1LTI D;  3VYT A;  2B2U C;  5HUR A;  4DV4 Q;  1WTR A;  2JYO A;  5AJ3 L;  1B3A A;  3D8G A;  3I70 A;  4POF A;  2UXB Q;  4V0B A;  3DMU A;  3NBH A;  4B3M L;  4GNX B;  4B3R L;  5I4D A;  1RTO A;  3AFP A;  2JA8 H;  4R4I A;  1FYC A;  1BUV T;  1HQR D;  5C4X H;  1I4Q A;  3K8A A;  3NWS A;  3IRB A;  1QVG A;  5FO7 B;  4HID A;  1G91 A;  1TWC B;  4OEL B;  1TT2 A;  2YTY A;  2OT2 A;  2WAC A;  4GLA C;  1LTS D;  1R4P B;  2EQS A;  4G57 A;  1CHQ D;  2RVL A;  4JI5 L;  1MD2 D;  1BCP F;  1HTL D;  4HMI A;  3G48 A;  4GKK Q;  4KKU A;  3HKS A;  1HFG A;  1PHJ A;  1I94 Q;  2O5J C;  1GO3 E;  3M7N A;  1XNR Q;  2M2L A;  4GKJ L;  1CKM A;  1JMC A;  1HTP A;  1PXU A;  4QIW B;  4EVO A;  1HH2 P;  1LTG D;  3GTK B;  2K50 A;  5BR8 Q;  4RG1 A;  1VQI A;  3SK8 A;  4F8M A;  5FOB B;  2B63 G;  2F3I A;  4XQQ A;  2YYZ A;  3M4O B;  5FJ8 G;  3MTS A;  1TXY A;  1VMP A;  2DNE A;  4K8I A;  5EJW A;  2UXC Q;  3A8I E;  2K14 A;  1C48 A;  4RCN A;  1ILQ A;  1PH3 A;  2WB1 E;  5EKI A;  3I73 A;  1G51 A;  4ZUI A;  1HNW Q;  1B44 D;  1P16 A;  3PIP A;  1ROD A;  2KBN A;  2RA4 A;  3UDF A;  4AH6 A;  5LMU L;  5BN3 A;  4DR6 L;  3J80 L;  1HR0 Q;  2Z1C A;  1PH9 A;  1I3Q H;  3DEO A;  3T1Y L;  1QNU A;  4IFD I;  3U4V A;  4OO1 G;  1PZK D;  1MBY A;  1Q8I A;  3CCV A;  4K6D A;  5LMN L;  1YNJ D;  4DV3 L;  1KDA A;  1KNA A;  4LF5 Q;  5C4J H;  4DK6 C;  3ND9 A;  5IIF A;  1QZH A;  1YBY A;  1Q1E A;  3NQI A;  1QIL A;  1XPO A;  4DR2 Q;  1STH A;  4DV6 Q;  2FMC A;  1VMC A;  3WOF A;  1H9S B;  4Q5V A;  1ASY A;  4DA2 A;  4DR4 Q;  1CHP D;  3IAY A;  4ZAI A;  2WIN B;  4MTN A;  3H09 A;  4DK1 A;  5M5Y B;  1RDP D;  1O7L A;  1GUW A;  3IL8 A;  2ZTE A;  1H9S A;  2ZXO A;  1U4R A;  5K36 G;  4JV5 L;  3K58 A;  4XT1 B;  2IWH A;  1CA5 A;  3HOX G;  3PUW A;  5DEH A;  5M3M G;  4LFA L;  4R8N A;  1FGU A;  4N9T A;  4QIW E;  5M3M B;  4IJH A;  1HQM C;  1ICF B;  1B1Z A;  2EPB A;  2GN5 A;  3U9O A;  2FMM A;  1RHP A;  3DXJ C;  4IPH A;  2Q2U A;  2PZU A;  3R2I A;  3NEN A;  5C0X I;  1RL2 A;  2MUY A;  3GTK H;  1VCI A;  3T1H L;  2EVB A;  2I07 B;  2K5Q A;  1XNQ Q;  3L0O A;  4IPC A;  3FDT A;  1CQV A;  2B63 H;  1IBM Q;  3AYH B;  4DU9 A;  2ZM6 Q;  3MFG A;  1NE3 A;  1WTQ A;  1LAB A;  3M4O H;  2N49 A;  1XX8 A;  1LTA D;  2RSN A;  1QE6 A;  2EJG C;  5IT9 E;  1VQ7 A;  1UE7 A;  4NXM L;  4DUZ Q;  1Q90 A;  2Q8T A;  5E3F A;  1JJG A;  1SXT A;  4PZ6 A;  2HIV A;  1DGS A;  1PZJ D;  1JC7 A;  2JXM B;  1BR9 A;  1VQF A;  1K8O A;  3A56 A;  4QF4 A;  2RSO A;  2R61 A;  2J0T D;  2IW3 A;  5FLX E;  5IGE A;  1EIH A;  3BYT B;  2I5M X;  1WJJ A;  3B6Y A;  4XYO A;  2AUK A;  4UP9 A;  4UPA A;  4WOR A;  4ZLT F;  1IBL Q;  3E9H A;  4NXN L;  5EAY A;  1NR2 A;  1I4G A;  2D0P A;  2X69 A;  1YJW A;  1UEB A;  3BVG A;  1OXT A;  2KA7 A;  4DV5 Q;  2VY3 A;  4C3J B;  1LAC A;  1F9S A;  1Y8P B;  2JA7 H;  4GZY C;  2D2C C;  3J80 E;  3K5M A;  3A5U A;  1BOS A;  4P71 A;  4A3M B;  2CW0 D;  2AWN A;  4JK1 C;  2CQA A;  1EEI D;  2YTX A;  2RQX A;  5GAH C;  3AEV A;  2A6H D;  3R3O A;  4I7A A;  4XQN A;  3PO3 H;  1TVX A;  4X65 L;  1AZP A;  1HNZ L;  5IP9 G;  3C2P A;  4JBM A;  2PI2 A;  1EUJ A;  4DV2 Q;  3RNU A;  1K9M C;  3D4W A;  1JJC B;  2F0I A;  1B50 A;  3SK4 A;  1WOC A;  3HOX H;  2EIF A;  4TVA B;  1ZXT A;  3DLL A;  1QJO A;  2NVX B;  4ULL A;  3TME A;  2PQE A;  2VUM G;  2VUM B;  5JVH 3;  2EJF C;  4LF6 L;  1PRT C;  2K75 A;  2NZ1 D;  2NVT H;  3JC6 6;  4A3C G;  4QQB X;  3UI2 A;  4BBR H;  3NHH A;  1B53 A;  4R8I A;  3KF8 B;  3M4Y A;  2CH4 A;  1XJV A;  3S2D H;  3DM3 A;  2B2W A;  3T4A C;  2VB2 X;  4UDU C;  4IUR A;  1S72 A;  3A74 A;  5LHY 1;  3J81 c;  4DR3 L;  1PA6 A;  3KF8 A;  1CSQ A;  2DY8 A;  2BCO A;  1Y14 B;  2K4K A;  2KED A;  4FXD A;  2NB0 A;  2LS0 1;  4LAA A;  4DR7 L;  1NY4 A;  2BE5 C;  1K8M A;  4LFB Q;  4H7B A;  4R4C A;  5M9O A;  4B3S L;  1EL0 A;  4HMJ A;  3WDN A;  2L55 A;  2B2T A;  2EJM A;  4WFN 3;  5CYU A;  5J3B A;  1SBB B;  2VQE Q;  4RAU C;  4PMW A;  1SNC A;  2KCM A;  2L12 A;  5KYI A;  2AQ2 B;  4F7X A;  3K5L A;  1UE5 A;  1KRS A;  4N8X 1;  1D7Q A;  1PYW D;  2F0V A;  3C1F A;  4B3R Q;  3SE0 A;  1EZ8 A;  3HOU G;  1D5Z C;  1F9P A;  3E6Z X;  2GVB A;  3HOU B;  3SR1 A;  4TQU S;  4RFB A;  1SNQ A;  4TRD A;  2KCN A;  3NTK A;  1SNP A;  1N34 L;  3RR5 A;  4POG A;  4IFD G;  1TS2 A;  3Q8D A;  5A2Q E;  4JI5 Q;  5M3F G;  4DXG A;  5M3F B;  4MZ9 A;  1Y8O B;  3E0E A;  5IP9 H;  3CMA A;  1PFN A;  2E5L L;  4HJ5 A;  5D3D A;  1G2T A;  4GKJ Q;  3GTP H;  3MEH A;  1ZYR D;  3S1R H;  1Q81 C;  2A68 D;  2EZV A;  4LNQ A;  3STB D;  1A6X A;  2EYJ A;  2Z4I A;  1SE3 A;  1TII D;  2J7Z A;  4A4I A;  3E9I A;  3KLS X;  4OIK A;  2ID0 A;  1ESF A;  1SE8 A;  1E1O A;  1SNO A;  2PCF B;  1OXS C;  2VNU D;  1Q12 A;  2F4V L;  3CW2 C;  2F1M A;  3J7Y W;  2AKW B;  3G6E A;  1CM9 A;  1NTG A;  4O1N A;  4OL7 A;  4QL5 A;  3S16 B;  1M4V A;  3DWQ A;  4X66 L;  3S1N H;  2SEB D;  1WCM B;  2CCZ A;  2IY5 B;  4Y52 H;  3CCE A;  4DR6 Q;  4KN4 C;  4KMU C;  5C0X G;  3S14 B;  3DHQ A;  3T1Y Q;  5D3I B;  4HSP A;  1XMQ L;  1OXX K;  1I5F A;  1CZW A;  2IJ0 A;  4HJ9 A;  4KV6 A;  3MXG A;  2A6E D;  3NQT A;  3JAM i;  3OSO A;  5KND A;  4CDD C;  3H6M A;  5C3E H;  5E4X A;  1SAP A;  1DOM A;  1L1O C;  3HOU H;  3EBE A;  2WAQ B;  5IGF A;  4GOP C;  5M5X B;  4F87 A;  1VQ6 A;  4IUN A;  1C4Q A;  4JBW A;  4KTA A;  1O7I A;  3CD6 A;  4P75 A;  3PUX A;  4ZK9 B;  5BN5 A;  3A55 A;  3TRE A;  1G29 1;  4KD4 A;  1ZKO A;  2K5N A;  5D14 A;  5EKK A;  4JV5 Q;  3RLF A;  3LGJ A;  1VQ4 A;  1HA6 A;  2LSS A;  3JAM c;  2R92 B;  4IUV A;  4C1N K;  5GAD C;  1MSG A;  1DCZ A;  4LFA Q;  4TKO B;  1K83 B;  2BDN A;  1JOR A;  1MSH A;  5C3X A;  3UDX A;  2Z8L A;  3I8Z A;  4MTK A;  3FPP A;  4GN3 B;  1TS3 A;  2QCP X;  2VS1 A;  1JOO A;  4A3G B;  1VQC A;  4K0K L;  1BKB A;  2A19 A;  3I90 A;  1VQM A;  3K7U C;  3PV0 A;  3T1H Q;  1OXV A;  3GTG H;  2KCT A;  4JI7 L;  4A3K G;  4DUY Q;  5C5M A;  4A3K B;  3M9B A;  5FKA C;  3CCM A;  1NNX A;  3PCO B;  1IKL A;  4KY7 A;  4NXM Q;  3H3V H;  1WTV A;  2YTV A;  1EQV A;  3GTO B;  5HGQ A;  4RHR A;  4Z9C B;  3K59 A;  5CV5 A;  3TP5 A;  3L2P A;  3ULL A;  2CVR A;  5ELO A;  1N8R C;  3L3O C;  4JI4 L;  3D31 A;  2ENB A;  4NXN Q;  3BJU A;  4BY7 G;  5IOD A;  1LM0 A;  2QEX A;  4BY7 B;  1XTC D;  2LXK A;  1QNK A;  2AMC B;  1WFQ A;  1ET9 A;  1F9Q A;  4P73 A;  1YNN D;  2WII B;  4LUZ A;  1QZG A;  4RGT A;  1M1K C;  3KLW A;  1L0Y B;  2VW9 A;  2Q2T A;  4A3J G;  4IUU A;  4K5W A;  4A3J B;  1E1T A;  1KAW A;  3PIP 3;  1DOL A;  3ULP A;  5IP7 G;  1E0B A;  3FMC A;  4X65 Q;  1TY0 A;  1EIF A;  1FGB D;  2B29 A;  1HNZ Q;  1R9T B;  1GXD C;  1R4Q B;  2L11 A;  2DJF C;  4G4K A;  1CA6 A;  2NBF A;  2RKS A;  5EPL A;  3IFD A;  1T5X D;  2MHV A;  1EY9 A;  2IT1 A;  3PIO A;  1CFM A;  4JI2 Q;  1K83 H;  2CFM A;  3KJP A;  4DAM A;  1EIY B;  4LFC Q;  1IW7 C;  4PG3 A;  3CCL A;  1JWS D;  3J81 j;  3PMF A;  1E2V A;  2BE5 D;  3HRZ C;  3NTH A;  4AIM A;  4K5V A;  1KRT A;  2R3Z A;  4JBJ A;  4JI6 L;  1X32 A;  4MHE A;  1KC8 C;  1HR0 W;  1AEX A;  1EY0 A;  1TWF H;  2KHS A;  4J6H A;  4DR3 Q;  2F0M A;  2K03 A;  3W1B A;  1U4M A;  1HRJ A;  4ZKB B;  3MVV A;  2F0G A;  4DXF A;  2K6A A;  1DYQ A;  4DR7 Q;  1V1P A;  1SNM A;  1SFO B;  4ZYS A;  2X6L A;  3KK7 A;  1G6P A;  2XN9 C;  4A3F B;  3I7F A;  3BYY B;  3S17 B;  1PTO B;  2MNA A;  2K32 A;  2E2J H;  3RD4 A;  2RCN A;  1JQY D;  4YWM A;  2UXD Q;  2A5H A;  4A76 A;  1N36 L;  3A7A B;  5DLQ E;  1B8A A;  4FF1 A;  2DNC A;  1WTW A;  2PQA B;  1XYI A;  2PMZ E;  1KIX A;  3RLO A;  2CKZ B;  2RDH A;  1I50 B;  2HQL A;  4DV1 L;  4NMZ A;  3GTJ B;  4BY7 H;  1A63 A;  4A3B G;  1D1K A;  3UDI A;  2IX3 A;  2XRS D;  4A3B B;  3BVM A;  1Y1W G;  1ASZ A;  5IY0 A;  3NP8 A;  2PQA A;  3VYS A;  4IQZ A;  3D6C A;  5T1I A;  1FNW A;  3C1E A;  4OX9 L;  3W2D A;  1MGS A;  1N34 Q;  2F0T A;  1UNS A;  3HOY G;  1SYC A;  2VZA A;  4A3J H;  1CTM A;  2HHH L;  3D4R A;  2K28 A;  1FJG L;  3OTO L;  3MXP A;  2GVA A;  4H02 A;  3N6R A;  1R9T H;  4L5Q A;  1WYD A;  5D65 A;  4JCV E;  1SYG A;  2O4X A;  1NBW A;  1SRU A;  2E8G A;  2I0Q A;  1I6V C;  1DD2 A;  3EFX D;  2H4O A;  4R4O A;  2Z6K A;  1I4R A;  4U67 3;  2K7V A;  1H9K A;  5JVG 3;  2KCC A;  3U50 C;  2KHJ A;  5COR A;  4G7O C;  2K33 A;  1SE4 A;  2HD3 A;  2QW7 A;  5C4H A;  2PYK A;  3EIV A;  4BBS G;  4BBS B;  2XSC A;  1C0A A;  1QOH A;  2WV6 D;  3S1Q B;  5ELC A;  4RA8 A;  3CP0 A;  3KJO A;  4WJ3 M;  1K0S A;  1CZG A;  3LWE A;  4IFD J;  2FIN B;  4NPS A;  1BCP C;  4J1M A;  5E4W C;  5M5W B;  4X66 Q;  3P1H A;  4DV0 Q;  1ENA A;  1PH1 A;  4QB4 A;  1D1I A;  4LW1 A;  5EPJ A;  3S17 H;  1P8L A;  1XMQ Q;  4B9W A;  1EWI A;  4GNX A;  3CRK C;  2XNA C;  1G6Z A;  2JSO A;  5CV8 A;  1JWU D;  5BN4 A;  1WD0 A;  1BBW A;  2K01 A;  4A3B H;  4PQX A;  3S15 B;  2R93 G;  1ONL A;  1Y1W H;  2R93 B;  3TZU A;  1F2Z A;  3OHX C;  1J8I A;  5IGD A;  4MNO A;  2OQ0 A;  4A3E B;  2MJ8 A;  2MQH A;  3HOY H;  4O42 A;  1VQK A;  1GHJ A;  1D5X C;  1D6E C;  1PTO D;  4LF8 Q;  4XDX A;  1GUN A;  3S2H H;  3GD7 A;  3Q22 A;  5C0X J;  1WTO A;  1S5F D;  1RF2 D;  3I72 A;  2K1B A;  4DK0 A;  1Q82 C;  2NVY H;  2PW5 A;  3NPP A;  1PH2 A;  4JBK A;  3VR6 A;  1HZA A;  1TWA H;  2EY6 A;  3W3A A;  3WWV A;  2IL8 A;  4Y7N H;  4DR1 L;  1U0L A;  1EOT A;  5TSS A;  4M1U B;  1QB5 D;  1HHV A;  3OWF A;  1VQ9 A;  4H13 C;  5IT9 c;  3FPU B;  4JI7 Q;  2F0E A;  4X3K A;  1YVC A;  1D8L A;  1QVF A;  4HJ8 A;  2IHE A;  3EQL C;  1IYV A;  1SMY D;  1YEZ A;  4XXE A;  1EFW A;  3S1Q H;  1LLR D;  3EJI A;  1RKN A;  3A54 A;  1Q3L A;  2I46 A;  3O13 A;  1S4Z A;  5FLX c;  1PFB A;  3H15 A;  2DY7 A;  1F2Y A;  4EQN A;  1JIC A;  2NN6 G;  2MO1 A;  2N88 A;  4C56 C;  2UUC Q;  3P7J A;  5DAU A;  4GLV B;  2QEJ C;  2JA5 G;  4ME3 A;  4JI4 Q;  3TBI B;  3J80 c;  2JA5 B;  3RLN A;  1VF7 A;  1I4H A;  1MKH A;  1TWC H;  4U68 A;  1EYC A;  5LL6 S;  4HR7 B;  3TP6 A;  1HNX L;  3K6O A;  1SN8 A;  5I2Y A;  1BBU A;  4OIJ A;  2XWB B;  1B70 B;  2MP1 A;  2F0L A;  1GOZ A;  4YIJ A;  1IW7 D;  3I4L A;  2NZH A;  2A8V A;  2R93 H;  2NVQ B;  1Z47 A;  1FVI A;  1SEB D;  1NUC A;  2B2W C;  4LUO A;  3H0G B;  1VQD A;  4PV1 C;  3C46 A;  3PO2 G;  3PO2 B;  2ZT9 C;  4DNT B;  4HTH A;  1IBK L;  3HP3 A;  1X3E A;  4LK1 C;  1YHB A;  2MO0 A;  3F8T A;  5EQ0 A;  5FJ8 H;  1CI3 M;  2B2T C;  3F2D A;  1K73 C;  5CV9 A;  3ND8 A;  1HCZ A;  4WJ4 A;  1BO0 A;  3D0F A;  1SE2 A;  2Z6B A;  1TWH B;  2IPK D;  1C7Y A;  1U4L A;  3QJY A;  2L4N A;  4C3I G;  4KKT A;  1KLU D;  5JAV A;  4C3I B;  3CU7 A;  1WTP A;  1QG7 A;  2EXD A;  3TSS A;  1D5M C;  2LXJ A;  4OO1 H;  2I5L X;  3TS0 A;  1GUT A;  4ABN A;  3ZJY C;  2VB3 X;  3I4N B;  2EOT A;  1T5E A;  3BDO A;  3IKJ A;  4C3J G;  1NAP A;  4KLK A;  4CKB A;  1IHZ A;  4IO9 A;  2R7Z G;  5DNF A;  4A3M G;  2R7Z B;  2PNR C;  1Q1B A;  1BDO A;  2NN6 H;  1EU3 A;  4EGV A;  4OGQ C;  4X64 Q;  4LF9 L;  4PMB A;  4DN4 M;  1DM0 B;  1WD1 A;  4IPD A;  2JA5 H;  1OXU A;  4A3I G;  2ES2 A;  4DV1 Q;  4A3I B;  1FL0 A;  2D5D A;  5M5Y H;  2L9H A;  4PNY A;  3J81 i;  3ULJ A;  2K52 A;  3V2T A;  5K36 H;  4DV7 L;  4OX9 Q;  1YIJ A;  3M3Y B;  3MC0 B;  2JEB I;  5M3M H;  4V19 0;  4ZKC B;  1T9H A;  2A74 C;  2E75 C;  2HHH Q;  1Y1V G;  1Y1V B;  3DUZ A;  2NWG A;  4FF3 A;  4L5S A;  1FJG Q;  1B7Y B;  1VQB A;  3P20 A;  4RWS C;  3OTO Q;  1EWH A;  3PO2 H;  2LKV A;  4DR5 L;  1D2B A;  1X54 A;  2JA9 A;  1B9M A;  3SK6 A;  2MFI A;  1A8V A;  4X3S A;  4JI3 Q;  5FO9 B;  1DJR D;  2CHB D;  1X55 A;  3H3V C;  4LF7 Q;  2L0C A;  3T51 B;  5CBA E;  5JPM C;  4NDX A;  4B08 A;  2UUA Q;  5IGC A;  4RHS A;  4KJO A;  1EEF D;  1MI2 A;  4Q0F A;  2PPB C;  4NB3 A;  3CQZ B;  2OF1 A;  5CV6 A;  1NCV A;  3ITP A;  3PF5 A;  1JOQ A;  4FF4 A;  1O7Z A;  1UAP A;  1A2T A;  1J5E L;  4LJZ C;  5AJ3 Q;  1K28 A;  4B3M Q;  2SDF A;  4C2M B;  3RUZ A;  1TR5 A;  3NK9 A;  2B2V C;  2MPM A;  1HUM A;  1W6J A;  3PIO 3;  1LO5 D;  4C3J H;  2PI2 E;  2CH4 W;  4A3M H;  2SNM A;  1HXY D;  3KBX A;  1AFP A;  1JR0 D;  4UAI A;  4DNR B;  2HDL A;  3HOV G;  3I3C A;  2BOS A;  2E2I B;  3HOV B;  3K0Y A;  4CKE A;  2XRQ D;  5E1F A;  5GAE C;  1TU2 B;  2B2Y A;  3A0J A;  3FRP B;  3CRL C;  3G6J B;  3W5O A;  3K7A B;  1DON A;  4A3I H;  4KHZ A;  5ELN A;  1BVS A;  1ENC A;  2WKD A;  1X9N A;  1EY8 A;  4YY3 L;  5JJL A;  3CME A;  2XVS A;  5J1Z A;  3MXU A;  4JVZ A;  2ASB A;  2QA4 A;  4A75 A;  1CUK A;  2NVX H;  4HJA A;  3GP7 A;  3IFT A;  2VUM H;  1PLF A;  1XPR A;  4JYA L;  4A3C H;  5IGB A;  1KDB A;  3E3X A;  1KAB A;  4FP5 D;  3MFY A;  1VDZ A;  4RKB A;  2JK8 A;  2AUJ D;  1SYE A;  1Q46 A;  2KHI A;  1VQG A;  3Q0A A;  1PRT B;  1AH9 A;  1WCM G;  1GUG A;  3CCJ A;  3KYH C;  5LMU Q;  4YWK A;  3SK5 A;  5CBE E;  1N33 L;  1X3Q A;  5LMN Q;  1X3P A;  4DV3 Q;  1ENF A;  4CJ1 B;  1NMG A;  2BH8 A;  1G2S A;  1PH5 A;  4MIU A;  3ONA B;  4YCV A;  3LX0 A;  3SXH A;  4G7Z C;  2UU9 L;  1Z9F A;  4JI8 L;  3OW2 A;  2VQF L;  3NBI A;  2KOL A;  2J4X A;  4IUP A;  5I2X A;  1PH7 A;  3CHB D;  1BXT A;  2WAQ G;  3X3M A;  1DXM A;  3CCQ A;  2F0J A;  4UP7 A;  4G7H C;  3VYR A;  3Q24 A;  1YI2 A;  2PNH A;  3K0X A;  2E2I H;  1W6K A;  3E5S A;  1K0R A;  3JAM L;  4IFD H;  1A15 A;  2R92 G;  1HNX Q;  2ZXP A;  2QDL A;  1L0W A;  4NP5 A;  5JPN C;  5M3F H;  3CPF A;  4RGO S;  3T13 A;  1SR3 A;  4ALP A;  4EX5 A;  3V05 A;  1XTD A;  2F0U A;  1XNR L;  2D9U A;  2RDF A;  2BA0 A;  3S1M B;  4A3G G;  1B4O A;  1TWG B;  4IOA A;  3OWE B;  4L5R C;  3HOZ B;  1IBK Q;  1K3R A;  5BR8 L;  4LF4 L;  4RCO A;  5C4Z A;  2JEA I;  1FD7 D;  3GTM B;  1PFM A;  3RMH A;  3SGI A;  1YZ6 A;  1CQF A;  2K5D A;  2ZTC A;  4L5T A;  3T16 A;  1YJN A;  1SRO A;  2UUB L;  1B2T A;  2FFK B;  1AN8 A;  4S3S A;  3BS1 A;  1JT8 A;  2QF7 A;  3GDE A;  2K5H A;  3HEJ A;  2Q2H A;  1YIT A;  3S16 H;  4BWG B;  1JB7 A;  1J6Q A;  4IAL A;  3RN2 A;  1ICW A;  1WCM H;  3BDL A;  1NJI C;  4DAV A;  3AFQ A;  1IXR A;  5CV7 A;  3S14 H;  5C0X H;  1X65 A;  3VA5 A;  5KRU A;  4BA1 I;  5A35 A;  4KJN A;  5IYC G;  3R93 A;  1KXL A;  1L0X B;  4KHP L;  2WAQ E;  2NUC A;  4DV6 L;  3HFZ B; 
#chains in the Genus database with same CATH homology
 1PTO F;  2F3W A;  3GTQ B;  1NR4 A;  4ZUJ A;  3TDQ A;  4AYB B;  1PRT D;  2K5W A;  3J7A V;  2LY7 A;  3QB3 A;  2IX1 A;  1VF5 C;  5ELB A;  4A93 B;  2R6G A;  3A8J E;  4K2L A;  1IYU A;  3MA2 B;  3L7Z C;  3GV3 A;  3R2T A;  2QIL A;  1QCB D;  4EQO A;  3AU7 A;  1GJX A;  2WKC A;  4I7Z C;  1G8Z D;  2ICI A;  1II3 A;  2MGS A;  1F2L A;  3PUV A;  3DWA A;  2B8F A;  2EYP A;  4HCE A;  3NUC A;  1J9O A;  3OMC A;  1JCK B;  4HSV A;  4OHJ A;  1SDF A;  1BQQ T;  2ICE C;  4RGN A;  5C44 B;  1PDQ A;  3QG1 A;  4ODG A;  5CV4 A;  2EY2 A;  1EY5 A;  1TKW B;  4WRD A;  2F0P A;  1TS4 A;  3DEP A;  1S5C D;  4KHV A;  5C4X B;  2F0H A;  2A69 C;  1TS5 A;  1A2U A;  1LV9 A;  2XIW A;  2F0K A;  1EY6 A;  1FR3 A;  5G3L D;  4M8A A;  3Q6S A;  1JE4 A;  2F4I A;  1FNU A;  2SNS A;  2JA6 B;  2DN8 A;  3OPO A;  2VXW A;  2NTS A;  3V96 A;  1JB3 A;  1STN A;  2RBM A;  2CW0 C;  1HPC A;  2ZXR A;  4FVM A;  5F2D A;  4KY5 A;  1LT4 D;  3NSW A;  3TN2 A;  4K14 A;  1HUN A;  3I91 A;  4P2C B;  4I65 A;  1TQO A;  2Q8I B;  2BDO A;  4HCS A;  3KBG A;  3ERO A;  1RJT A;  4A3D B;  1WTX A;  1JWM D;  1I3Q B;  3HKZ B;  1PTO H;  2WB1 B;  2E2H B;  1GHK A;  5LL6 X;  3H91 A;  1HA5 A;  5C4J B;  1LTT D;  3TP7 A;  2FJ2 A;  2LFN A;  1SYF A;  4BY1 B;  1XXG A;  2Y0S B;  5I9P A;  5JEA J;  3BG3 A;  4FNF A;  4DAP A;  3GV6 A;  4FO2 A;  5CMD A;  3DM1 A;  2HCC A;  3NXW A;  1I4P A;  1OO9 B;  4EQP A;  1H9M A;  3R8B A;  1EIG A;  1EZ6 A;  4L6T B;  2H1E A;  4PMC A;  4IUT A;  4R9W A;  3LNN A;  4L8J A;  4X3T A;  3L9A X;  1Z6H A;  3CKI B;  3Q23 A;  3T56 B;  4BS9 A;  2PZT A;  2OXP A;  2HCI A;  4K5X A;  5IT9 L;  4DGZ A;  3AMU A;  2B63 B;  4RH6 A;  2V4D A;  1V43 A;  3P75 A;  5FLX L;  3U9S A;  2SOB A;  3WOE A;  2F0O A;  3TZD A;  1ZYR C;  5C5L A;  3OIP A;  5ISR A;  2A68 C;  4KY6 A;  3J7A F;  4ID6 A;  1EY7 A;  1EWC A;  1ILP A;  3A8K E;  1M8A A;  1SND A;  5IOC A;  3VR3 A;  2N55 A;  4ILW A;  5JOB A;  1BCP B;  4FF2 A;  2JA7 B;  5KNB A;  2X6G A;  4QMG A;  1AP0 A;  2K05 A;  1PMR A;  2B2U A;  3NE5 B;  3QOL A;  3PO3 B;  5KIX A;  1WVL A;  1E2Z A;  4CGY B;  3QOJ A;  5DM6 3;  2A6E C;  4E6I A;  4ZQ3 A;  2XWJ B;  1SSO A;  5C6A A;  1FNV A;  3LWU A;  5J39 A;  2IX0 A;  3HOX B;  2KUM A;  2Z4H A;  1U9R A;  3M85 A;  1B9N A;  1AW7 A;  2NVT B;  2C9O A;  4BBR B;  2EDG A;  2EXZ A;  3A7L A;  1EY4 A;  1IL8 A;  5EBD A;  5FO8 B;  3S2D B;  2KJX A;  3URY A;  1EQT A;  2RDG A;  1NSN S;  5J22 A;  1LT3 D;  3M7G A;  4F88 A;  2F0Q A;  5ELF A;  1Y8N B;  2A69 D;  2B2Y C;  5AFW A;  3X3N A;  1CK1 A;  4TSS A;  1TY2 A;  1E2W A;  4FXK C;  5EBC A;  3MWY W;  3I4M B;  3SEB A;  5A2Q L;  1O80 A;  3AB9 A;  2HUG A;  2EY1 A;  2E74 C;  1EFI D;  5KGU A;  1STG A;  3ERQ A;  3OOC A;  3KUP A;  2BA1 A;  1C8C A;  1STA A;  3RZO B;  1ET6 A;  3J81 L;  5K5P A;  1STB A;  3RZD B;  3SVM A;  1YNN C;  4MN3 A;  1KAA A;  3GTP B;  3S1R B;  1KTK A;  2AQ1 B;  3FVQ A;  1BCP D;  1H9J A;  4BA2 I;  2PW7 A;  4HAE A;  3VR4 A;  3D4D A;  5EGT A;  3FEW X;  1JOK A;  5T1G A;  3KLR A;  2KVM A;  2QDB A;  5COY A;  3S1N B;  5DM7 3;  2EYM A;  1IKM A;  1XWE A;  1PRT F;  5CGK A;  1RTN A;  1F2M A;  4FYD A;  5I6Y A;  3MXN A;  4IN3 A;  4KN7 C;  2QKI C;  1LT6 D;  1BF4 A;  5C3E B;  4DFA A;  4C3H G;  1AZQ A;  4C3H B;  5KEE A;  3VYU A;  2JP1 A;  4XYQ A;  1SJH D;  1A3T A;  2FHT A;  1H9R A;  1F9R A;  1UUP A;  3D3R A;  5JEA G;  3VR5 A;  4LMQ D;  3NTI A;  4XT3 B;  2E76 C;  2KEC A;  1S5E D;  4DF7 A;  3E0J A;  1STE A;  3HS0 C;  4B9X A;  3OW7 A;  4XQJ A;  3K5N A;  3GTG B;  3J81 E;  2F0F A;  3EA6 A;  3HZX A;  4H44 C;  1F77 A;  3H94 A;  5EKL A;  1O7Y A;  2NTT A;  2YU9 B;  4IZ8 A;  2M00 A;  4QCL A;  4C1N I;  2D62 A;  3GO5 A;  3SDZ A;  2G9H D;  2A73 B;  5G3L F;  3HOW B;  1O78 A;  3F2U A;  5CC4 A;  2F0W A;  1LT5 D;  3BVZ A;  5NUC A;  1EYD A;  4ME5 A;  3MHB A;  4IUQ A;  4K2K A;  1KDC A;  3S9W A;  1GUO A;  4FXG C;  1SYD A;  1GUS A;  5KYL A;  4K6L A;  1EU4 A;  4QUC A;  3T53 B;  2F0D A;  1RD9 D;  3N52 A;  3HG9 A;  2EYH A;  5FK9 C;  4CKC A;  4L63 B;  2B2V A;  1KLG D;  4KKS A;  5JEA H;  2F0S A;  5ELD A;  3BDC A;  2M9V A;  2TSS A;  1I6H B;  5KNC A;  1STY A;  2EYL A;  3OMG A;  1S5D D;  4XIG S;  4HED A;  3D6W A;  2KEE A;  3QO2 A;  1BNZ A;  1PTO C;  2O2L D;  1KNE A;  1TWF B;  3QIA A;  5ELE A;  4K8J A;  2Q8R E;  1PZI D;  4HN7 A;  2F03 A;  3K5O A;  4KD3 A;  3NWT A;  4J8Q A;  2HDM A;  2AQ3 B;  4CHT B;  3G7L A;  1Z7T A;  3GTL B;  3FKI B;  2E2J B;  4QUF A;  5IGG A;  2EY5 A;  1QWY A;  2GA4 B;  1ML0 D;  5HGT A;  4ZRZ A;  3C3L A;  2L5T A;  1SMY C;  2NYZ D;  1YNJ C;  3DWP A;  1EYA A;  2PZW A;  2PMZ B;  4N9P A;  1A3U A;  2G9D A;  2F0N A;  2OEO A;  2EE1 A;  1DZ1 A;  1U4P A;  4NKL A;  3MAQ A;  2WP8 J;  2EYF A;  1BBX C;  4H0L C;  3JAM E;  2EYO A;  3ZYY X;  3QWN A;  3PUZ A;  2KQ3 A;  4OO1 I;  1UEA B;  4CJ2 C;  1V1O A;  3PUY A;  1HFN A;  2K04 A;  3SHL A;  1V8Q A;  5C3W A;  2NN6 I;  1RCV D;  2B39 A;  1S5B D;  3VA7 A;  2HQE A;  1V1P B;  1CT1 D;  4WJW A;  4RGM A;  1SYB A;  2L1B A;  5EPK A;  5JJZ A;  3K57 A;  2JA8 B;  2PO4 A;  5I9O A;  3VR2 A;  1DOK A;  4XTC S;  2C5C A;  2LMC B;  2AWO A;  5CR3 A;  2E2D C;  3MZ5 A;  2TMP A;  1Y1W B;  3GQB A;  3KLS A;  4CBV A;  3HOY B;  3BZD B;  2A6H C;  1SJE D;  1ESR A;  1ZEQ X;  3S2H B;  4NW2 A;  3HGB A;  2NVY B;  1TWA B;  1A3V A;  1LTB D;  4X3U A;  4CJ0 B;  5I6W A;  2F3V A;  4Y7N B;  1LTR D;  2JE6 I;  2O5I C;  2B8G A;  1I4X A;  4KK7 A;  4KI0 A;  1Y69 U;  4RKL A;  4DAY A;  3OIQ A;  3EVQ A;  3TP8 A;  1LTI D;  3VYT A;  2B2U C;  5HUR A;  1WTR A;  2JYO A;  1B3A A;  3D8G A;  3I70 A;  4V0B A;  3DMU A;  3NBH A;  5I4D A;  1RTO A;  1FYC A;  1BUV T;  1HQR D;  1I4Q A;  3NWS A;  5FO7 B;  1G91 A;  1TWC B;  1TT2 A;  2OT2 A;  2WAC A;  1LTS D;  1R4P B;  4G57 A;  1CHQ D;  2RVL A;  1MD2 D;  1BCP F;  1HTL D;  4HMI A;  4KKU A;  1HFG A;  2O5J C;  3M7N A;  2M2L A;  1HTP A;  1PXU A;  4QIW B;  4EVO A;  1LTG D;  3GTK B;  3SK8 A;  4F8M A;  5FOB B;  4XQQ A;  2YYZ A;  3M4O B;  3MTS A;  1VMP A;  2DNE A;  4K8I A;  5EJW A;  3A8I E;  4RCN A;  1C48 A;  1ILQ A;  5EKI A;  3I73 A;  4ZUI A;  1B44 D;  1ROD A;  2RA4 A;  5BN3 A;  3J80 L;  2Z1C A;  3DEO A;  1QNU A;  4IFD I;  4OO1 G;  1PZK D;  1MBY A;  1Q8I A;  4K6D A;  1YNJ D;  1KDA A;  1KNA A;  3ND9 A;  5IIF A;  1Q1E A;  3NQI A;  1QIL A;  1STH A;  2FMC A;  1VMC A;  3WOF A;  1H9S B;  4Q5V A;  4DA2 A;  1CHP D;  3IAY A;  4ZAI A;  2WIN B;  3H09 A;  4DK1 A;  5M5Y B;  1RDP D;  1O7L A;  1GUW A;  3IL8 A;  1H9S A;  2ZXO A;  1U4R A;  5K36 G;  3K58 A;  4XT1 B;  2IWH A;  1CA5 A;  3PUW A;  5DEH A;  4R8N A;  4N9T A;  5M3M B;  1HQM C;  1B1Z A;  2EPB A;  3U9O A;  2FMM A;  1RHP A;  3DXJ C;  2PZU A;  3R2I A;  5C0X I;  2MUY A;  1VCI A;  2EVB A;  2I07 B;  2K5Q A;  3FDT A;  1CQV A;  4DU9 A;  3MFG A;  1WTQ A;  1LAB A;  1XX8 A;  1LTA D;  2RSN A;  1QE6 A;  2EJG C;  5IT9 E;  1Q90 A;  2Q8T A;  5E3F A;  1SXT A;  1PZJ D;  1JC7 A;  2JXM B;  1BR9 A;  1K8O A;  3A56 A;  4QF4 A;  2RSO A;  2R61 A;  2J0T D;  2IW3 A;  5FLX E;  5IGE A;  1EIH A;  3BYT B;  4XYO A;  2AUK A;  4WOR A;  4ZLT F;  1NR2 A;  1I4G A;  2X69 A;  3BVG A;  1OXT A;  2KA7 A;  4C3J B;  1LAC A;  1F9S A;  1Y8P B;  4GZY C;  2D2C C;  3J80 E;  3K5M A;  1BOS A;  4A3M B;  2CW0 D;  2AWN A;  4JK1 C;  2CQA A;  1EEI D;  2RQX A;  2A6H D;  3R3O A;  4XQN A;  1TVX A;  1AZP A;  3C2P A;  3D4W A;  2F0I A;  1B50 A;  3SK4 A;  1ZXT A;  1QJO A;  2NVX B;  4ULL A;  3TME A;  2PQE A;  2VUM B;  5JVH 3;  2EJF C;  1PRT C;  2NZ1 D;  3UI2 A;  3NHH A;  1B53 A;  4R8I A;  3M4Y A;  2B2W A;  3T4A C;  2VB2 X;  4UDU C;  4IUR A;  5LHY 1;  3KF8 A;  2DY8 A;  2BCO A;  2KED A;  4FXD A;  2NB0 A;  2LS0 1;  4LAA A;  2BE5 C;  1K8M A;  4H7B A;  5M9O A;  1EL0 A;  4HMJ A;  3WDN A;  2L55 A;  2B2T A;  2EJM A;  4WFN 3;  5CYU A;  1SBB B;  4RAU C;  4PMW A;  1SNC A;  2L12 A;  5KYI A;  2AQ2 B;  4F7X A;  3K5L A;  1PYW D;  2F0V A;  3C1F A;  3SE0 A;  1EZ8 A;  1D5Z C;  1F9P A;  3E6Z X;  3HOU B;  3SR1 A;  4TQU S;  4RFB A;  1SNQ A;  4TRD A;  2KCN A;  3NTK A;  1SNP A;  4IFD G;  1TS2 A;  5A2Q E;  4DXG A;  5M3F B;  1Y8O B;  1PFN A;  5D3D A;  1G2T A;  3MEH A;  1ZYR D;  2A68 D;  2EZV A;  1A6X A;  2EYJ A;  2Z4I A;  1SE3 A;  1TII D;  2J7Z A;  3KLS X;  4OIK A;  2ID0 A;  1ESF A;  1SNO A;  2PCF B;  1OXS C;  2VNU D;  1Q12 A;  2F1M A;  3J7Y W;  1CM9 A;  4OL7 A;  4O1N A;  3S16 B;  1M4V A;  3DWQ A;  2SEB D;  1WCM B;  4KN4 C;  4KMU C;  5C0X G;  3S14 B;  3DHQ A;  5D3I B;  4HSP A;  1OXX K;  1CZW A;  2IJ0 A;  4KV6 A;  3MXG A;  2A6E D;  3NQT A;  3OSO A;  5KND A;  3H6M A;  5E4X A;  1SAP A;  1DOM A;  2WAQ B;  5IGF A;  5M5X B;  4F87 A;  4IUN A;  1C4Q A;  4JBW A;  4KTA A;  3PUX A;  4ZK9 B;  5BN5 A;  3A55 A;  1G29 1;  4KD4 A;  1ZKO A;  5D14 A;  5EKK A;  3RLF A;  1HA6 A;  2R92 B;  4IUV A;  4C1N K;  1MSG A;  1DCZ A;  4TKO B;  1K83 B;  2BDN A;  1JOR A;  1MSH A;  5C3X A;  2Z8L A;  3I8Z A;  3FPP A;  1TS3 A;  2QCP X;  1JOO A;  4A3G B;  3I90 A;  3PV0 A;  1OXV A;  5C5M A;  4A3K B;  5FKA C;  1IKL A;  4KY7 A;  1WTV A;  1EQV A;  3GTO B;  4RHR A;  4Z9C B;  3K59 A;  5CV5 A;  3TP5 A;  2CVR A;  3L3O C;  3D31 A;  2ENB A;  5IOD A;  4BY7 B;  1XTC D;  1QNK A;  1ET9 A;  1F9Q A;  1YNN D;  2WII B;  4RGT A;  1L0Y B;  4IUU A;  4K5W A;  4A3J B;  3PIP 3;  1DOL A;  1E0B A;  3FMC A;  1TY0 A;  1FGB D;  1R9T B;  1GXD C;  1R4Q B;  2L11 A;  4G4K A;  1CA6 A;  2NBF A;  2RKS A;  5EPL A;  3IFD A;  1T5X D;  2MHV A;  1EY9 A;  2IT1 A;  1CFM A;  1IW7 C;  1JWS D;  3PMF A;  1E2V A;  2BE5 D;  3HRZ C;  3NTH A;  4K5V A;  2R3Z A;  1X32 A;  4MHE A;  1AEX A;  1EY0 A;  2KHS A;  4J6H A;  2F0M A;  2K03 A;  1U4M A;  1HRJ A;  4ZKB B;  3MVV A;  2F0G A;  4DXF A;  2K6A A;  1DYQ A;  1V1P A;  1SNM A;  1SFO B;  4ZYS A;  2X6L A;  3KK7 A;  2XN9 C;  4A3F B;  3BYY B;  3S17 B;  1PTO B;  2K32 A;  3RD4 A;  1JQY D;  2A5H A;  3A7A B;  4FF1 A;  2DNC A;  1WTW A;  1XYI A;  2RDH A;  1I50 B;  4NMZ A;  3GTJ B;  1D1K A;  2IX3 A;  2XRS D;  4A3B B;  3BVM A;  3NP8 A;  3VYS A;  4IQZ A;  3D6C A;  5T1I A;  1FNW A;  3C1E A;  3W2D A;  1MGS A;  2F0T A;  1UNS A;  1SYC A;  1CTM A;  3D4R A;  2K28 A;  3MXP A;  3N6R A;  5D65 A;  1SYG A;  2O4X A;  1I6V C;  1DD2 A;  3EFX D;  2H4O A;  1I4R A;  4U67 3;  2K7V A;  1H9K A;  5JVG 3;  2KCC A;  5COR A;  4G7O C;  2K33 A;  1SE4 A;  5C4H A;  2PYK A;  4BBS B;  2XSC A;  1QOH A;  2WV6 D;  3S1Q B;  5ELC A;  4RA8 A;  1CZG A;  3LWE A;  4IFD J;  2FIN B;  1BCP C;  4J1M A;  5E4W C;  5M5W B;  3P1H A;  1ENA A;  4QB4 A;  1D1I A;  5EPJ A;  4B9W A;  3CRK C;  2XNA C;  1G6Z A;  2JSO A;  5CV8 A;  1JWU D;  5BN4 A;  1WD0 A;  2K01 A;  4PQX A;  3S15 B;  1ONL A;  2R93 B;  3TZU A;  1F2Z A;  3OHX C;  1J8I A;  5IGD A;  4A3E B;  2MJ8 A;  4O42 A;  1GHJ A;  1D5X C;  1D6E C;  1PTO D;  4XDX A;  1GUN A;  3GD7 A;  3Q22 A;  5C0X J;  1WTO A;  1S5F D;  1RF2 D;  3I72 A;  2K1B A;  4DK0 A;  2PW5 A;  3NPP A;  3VR6 A;  2EY6 A;  3W3A A;  2IL8 A;  1EOT A;  5TSS A;  4M1U B;  1QB5 D;  1HHV A;  3OWF A;  4H13 C;  3FPU B;  2F0E A;  4X3K A;  3EQL C;  1IYV A;  1SMY D;  4XXE A;  1LLR D;  3EJI A;  1RKN A;  3A54 A;  1Q3L A;  2I46 A;  3O13 A;  1S4Z A;  1PFB A;  2DY7 A;  1F2Y A;  4EQN A;  1JIC A;  2NN6 G;  4C56 C;  2N88 A;  3P7J A;  5DAU A;  2QEJ C;  2JA5 B;  3TBI B;  1VF7 A;  1I4H A;  4U68 A;  1EYC A;  5LL6 S;  4HR7 B;  3TP6 A;  3K6O A;  5I2Y A;  4OIJ A;  2XWB B;  2MP1 A;  2F0L A;  1GOZ A;  4YIJ A;  1IW7 D;  3I4L A;  2NVQ B;  1Z47 A;  1SEB D;  2B2W C;  1NUC A;  4PV1 C;  3H0G B;  3C46 A;  3PO2 B;  2ZT9 C;  4DNT B;  4HTH A;  3HP3 A;  4LK1 C;  5EQ0 A;  1CI3 M;  2B2T C;  5CV9 A;  3ND8 A;  1HCZ A;  1BO0 A;  1SE2 A;  1TWH B;  2IPK D;  1U4L A;  3QJY A;  2L4N A;  4C3I G;  4KKT A;  1KLU D;  5JAV A;  4C3I B;  3CU7 A;  1WTP A;  1QG7 A;  3TSS A;  1D5M C;  4OO1 H;  1GUT A;  4ABN A;  2VB3 X;  3I4N B;  2EOT A;  1T5E A;  3BDO A;  3IKJ A;  4C3J G;  1NAP A;  4CKB A;  1IHZ A;  5DNF A;  2R7Z B;  2PNR C;  1Q1B A;  1BDO A;  2NN6 H;  1EU3 A;  4EGV A;  4OGQ C;  4PMB A;  4DN4 M;  1DM0 B;  1WD1 A;  1OXU A;  4A3I B;  2D5D A;  2L9H A;  4PNY A;  3V2T A;  5K36 H;  3M3Y B;  3MC0 B;  2JEB I;  4V19 0;  4ZKC B;  2A74 C;  2E75 C;  1Y1V B;  3DUZ A;  2NWG A;  4FF3 A;  3P20 A;  4RWS C;  1EWH A;  2LKV A;  1D2B A;  1B9M A;  3SK6 A;  4X3S A;  5FO9 B;  1DJR D;  2CHB D;  3H3V C;  2L0C A;  3T51 B;  5CBA E;  5JPM C;  4NDX A;  4B08 A;  5IGC A;  4RHS A;  4KJO A;  1EEF D;  1MI2 A;  4Q0F A;  2PPB C;  3CQZ B;  2OF1 A;  5CV6 A;  1NCV A;  3ITP A;  1JOQ A;  4FF4 A;  1O7Z A;  1UAP A;  1A2T A;  4LJZ C;  2SDF A;  4C2M B;  3RUZ A;  1TR5 A;  3NK9 A;  2B2V C;  2MPM A;  1HUM A;  1W6J A;  3PIO 3;  1LO5 D;  2SNM A;  1HXY D;  3KBX A;  1AFP A;  1JR0 D;  4UAI A;  4DNR B;  2HDL A;  3I3C A;  2BOS A;  2E2I B;  3HOV B;  3K0Y A;  4CKE A;  2XRQ D;  5E1F A;  1TU2 B;  2B2Y A;  3FRP B;  3CRL C;  3G6J B;  3K7A B;  1DON A;  4KHZ A;  1ENC A;  2WKD A;  1EY8 A;  2XVS A;  5J1Z A;  3MXU A;  3GP7 A;  3IFT A;  1PLF A;  5IGB A;  1KDB A;  1KAB A;  4FP5 D;  3MFY A;  1VDZ A;  4RKB A;  2AUJ D;  1SYE A;  3Q0A A;  1PRT B;  1GUG A;  3SK5 A;  5CBE E;  1X3Q A;  1X3P A;  1ENF A;  4CJ1 B;  1G2S A;  4MIU A;  3ONA B;  3LX0 A;  3SXH A;  4G7Z C;  3NBI A;  2KOL A;  2J4X A;  4IUP A;  5I2X A;  3CHB D;  1BXT A;  3X3M A;  1DXM A;  2F0J A;  4G7H C;  3VYR A;  3Q24 A;  1W6K A;  3E5S A;  3JAM L;  4IFD H;  1A15 A;  2ZXP A;  4NP5 A;  5JPN C;  4RGO S;  3T13 A;  3V05 A;  2F0U A;  2D9U A;  2RDF A;  2BA0 A;  3S1M B;  1B4O A;  1TWG B;  3OWE B;  3HOZ B;  2JEA I;  4RCO A;  5C4Z A;  1FD7 D;  3GTM B;  1PFM A;  3RMH A;  3T16 A;  1CQF A;  2K5D A;  1B2T A;  2FFK B;  1AN8 A;  4S3S A;  3BS1 A;  2QF7 A;  3HEJ A;  4BWG B;  4IAL A;  1ICW A;  3BDL A;  4DAV A;  5CV7 A;  5C0X H;  3VA5 A;  5KRU A;  4BA1 I;  5A35 A;  4KJN A;  3R93 A;  1L0X B;  2NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...