4DK6C

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
87
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
total genus 14
structure length 87
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk6C00
4A3LG 4JBWA 3PIPA 3GTGH 4DV7L 1MJCA 1TXYA 2UUBQ 1WI5A 3SGIA 2I5MX 2JK8A 4H02A 3TS0A 3U58A 3KFUA 1SFOH 2K14A 1LUZA 1BVSA 3HOYH 3TREA 1Q81C 2I0QA 4LF5Q 1V43A 4DV0Q 1Q7YC 3DLLA 4UP9A 1JJ2A 3JAMi 3A0JA 1X9NA 2D0PA 2JA8H 2VL6A 5C44G 4DAMA 3NBHB 3I4OA 2L15A 4A3CH 1N34L 1PH7A 5M5YH 3GTPH 3ICEA 2GVBA 4DV7Q 3A5UA 3W5OA 4DV1L 3S1RH 3PV0A 4MNOA 1I6HH 2EIFA 2C35B 4POFA 2RHSB 2A8VA 4JI6L 3HOWG 1HNWL 3KF6A 3STBD 1XPRA 4O0AA 3PO3H 4LF4L 1K8GA 1EYGA 4IFDJ 1X3FA 4JBMA 3FP9A 3MXNB 2R92G 2R6GA 3W1BA 3G6EA 4NB3A 3CF5A 4HIKA 5IYDH 4BY1H 1TWAH 3K7UC 3F1ZA 1I5FA 3H15A 1YI2A 1XPOA 2OTLA 4LFCL 1BKBA 4DV1Q 1QZHA 2K5HA 3JAMc 2R93H 4YY3L 5M5XH 2D0OA 3TRZA 1G6PA 4GN5A 1HNWQ 4UP8A 1YIJA 3S24A 3BU2A 3H0GG 1VQOA 1FL0A 2R7FA 2YTYA 4LUZA 5M5WH 2KBNA 1KL9A 1YHAA 2A1AA 4DV6L 4DUZL 4JOIC 4BA2I 2WAQE 4B3SL 1X6OA 5ELOA 1HNXL 2EXDA 1Y1VG 2KCTA 1PH1A 4OWTB 3U4ZA 3OW2A 2BH8A 3J7ZC 2IHEA 1NJIC 3FHWA 3BJUA 3EBEA 2JEBI 1O7IA 4YCVA 5H1SE 4BY7H 1HZCA 1BBWA 2JEAI 3PF4A 1HR0W 1WYDA 3UDIA 4HIMA 2WP8J 1A0IA 4DV3L 4A3IG 4LFCQ 3PGZA 1CKNB 2GN5A 4YY3Q 2KENA 2YTVA 4YCWA 1RL2A 3VDYA 1VQ6A 2A19A 4DR4L 3EN2A 1A63A 2VNUD 4DV4L 5C4JH 2WB1G 4DV6Q 1PA6A 1HH2P 4DUZQ 1VQNA 4B3SQ 1HNXQ 1N32Q 3NEMA 3S1QH 1YITA 3HOUH 4IPCA 2Q2IA 4YWMA 3CCVA 5HGQA 2RCNA 3K0XA 5LMNW 3ULJA 4QY7A 1G51A 4A3FH 5M3MH 2WB1E 3CXCA 4A3DH 3FKIG 4GOPA 2XTIA 4P74A 4C3HH 4DV3Q 1I94L 4QIWE 3PSIA 1K8AC 3KYHC 3CCRA 4IO9A 2PQAB 2MO1A 4DNIA 3GTOH 1K3RA 4AYBG 2HT1A 1BBUA 4DR4Q 4DV4Q 2IT1A 1AE3A 3D31A 1HZ9A 1Q12A 2VUMH 1KHIA 4WJ4A 2ALYB 1E3PA 2ZTCA 1X56A 4UY8C 4C3IH 4A75A 1IZ6A 4ME3A 3RNUA 2E2JH 5IYBH 1X65A 1Y1WH 4XTCS 4APVA 4OXPA 4OWXB 4L5TA 1I94Q 3RLFA 1QUQA 4A3MG 5GROA 1KIXA 3GTKH 1K0RA 4IFDG 2F4VL 4JI1L 2UU9L 4QJFA 1VQBA 3UDGA 2B63H 4WJ3M 3CCEA 4TQUS 2Q2HA 4HJ9A 4BBRH 2BH2A 1VQAA 2F3IA 3HKSA 4R4TA 4C3JH 1I3QH 3KF8B 2KHIA 3L2PA 1NY4A 4HJ7A 1P16A 3KJOA 4UPAA 1JJGA 3HFZB 3KDFB 4DV5L 5IP9H 1IL2A 4FDBA 2JA6H 1EWIA 1SROA 4LWCA 1YHQA 1S72A 4GLXA 1Q86C 2JA5G 3PUZA 2IX1A 2YYZA 3RLOA 2I5HA 1L1OA 2K5NA 4JI1Q 2UU9Q 2AMCB 2F4VQ 3PCOB 4EX5A 4GN3B 1VQ7A 2UXCL 1B8AA 4A3JH 2LSSA 1VQLA 3I4MH 1C9OA 1L1OC 1JB7A 3S1NH 2WFWA 3NELA 1U5KA 3I56A 4P71A 4JI5L 1YVCA 3M4OH 4AH6A 3RLNA 4DV5Q 1K73C 4DUYL 4QGUA 4K0KL 5IY0A 3G71A 2ZTEA 4PZ7A 5LMUL 3M9BA 4DR2L 4JCVE 4YCUA 4LUOA 2JA8G 2NVQH 1OXXK 1PVOA 2NN6I 5C44H 3GD7A 3J80i 4A76A 3CW2C 4JYAL 5LMNL 1PH9A 3GTMH 4JI4L 1L1OB 4A3CG 3ULPA 3A5ZB 4R1JA 2UXCQ 5FLMG 4Y7NH 2VS1A 2OQKA 1FJGL 2DUDA 2UXDL 5GAHC 3PO2H 1H95A 4KI0A 3S2HH 1N32L 1X3GA 1NTGA 1VQPA 1XMOL 4JI5Q 3WWVA 1MJEA 3S1MH 4DUYQ 4K0KQ 1OXSC 1N34Q 5LMUQ 4IPDA 1GO3E 4HJAA 3CCJA 5M3FG 4DR2Q 2KHJA 4LF8L 3H3VH 4GNXA 1FVIA 2UXBL 3A74A 1KC8C 3CCQA 4GN4B 2WAQG 4OX9L 4A3BH 4BBSH 3UE1A 1EFWA 4JYAQ 5LMNQ 1D8LA 4Y52H 1QVGA 3CP0A 3ZJYC 4JI4Q 1VQDA 3AEVA 4DR7L 4JI6Q 4A3GH 3Q8DA 2ES2A 1YEZA 5IYDG 1PH4A 2UXDQ 4LF4Q 1PFSA 1QZGA 3KLWA 4LF9L 4JV5L 1CSQA 1SR3A 4JG2A 4PG3A 1XMOQ 5JEAG 2Y0SE 2HHHL 2MQHA 1L0WA 5C3EH 3HOZG 4A93G 3K80C 2R93G 5C4XG 4PZ8A 3KF6B 2Z0SA 3J80c 2BA1A 3KOJA 5FJ8H 2CQOA 4L5SA 4IJHA 4LF8Q 3HOVG 1G291 1V1QA 2UXBQ 3J81c 1B70B 4DR1L 2JA7G 3CD6A 4OX9Q 3JC66 1LTLA 5FLXc 3G4SA 2N78A 3AFPA 3UDFA 1Y1VH 1RIPA 1NE3A 1VQGA 2V1CC 5IYCH 4HJ8A 2R7ZG 1FGUA 4DR7Q 1PH2A 3M3YH 2GVAA 2NN6G 1XPUA 3T1HL 2IHFA 1IBLL 1P8LA 4UP7A 1N33L 4LF9Q 4JV5Q 2JJQA 2E5LL 4A3IH 4BA1I 4P75A 2HHHQ 1JJCB 3LGJA 4JBKA 3ULLA 1XMQL 4LF6L 1HNZL 4MTNA 2B3GA 3ER0A 3W1GA 4LFAL 4LUVA 1C0AA 4A3KG 3CCSA 2H5XA 3HKZE 3HOXG 3RZDH 4DR1Q 2D62A 3F2CA 4LFBL 1Q1EA 1UE7A 3I4NG 1YJ9A 2F52A 2EQSA 4IPHA 3HOUG 5ELNA 1M90C 2UUAL 4NXML 5IT9c 3ERSX 4GLAC 4EQ5A 4RG1A 4A3FG 3J7A5 3CCUA 2K4KA 4HIDA 3T1HQ 4X65L 1IBLQ 3HOVH 4A3DG 1N33Q 1QVFA 2E5LQ 1XNQL 4DV2L 3PUWA 4GOPC 3D0FA 1XMQQ 4LF6Q 1HNZQ 4LFAQ 1Y14B 1PYBA 1D7QA 4HIOA 4TVAB 1YJNA 2OTJA 2Q2TA 5HY6A 5JEAJ 4DK6C 5BR8L 4LFBQ 4YWLA 2MNAA 4LF7L 2PI2A 1CKOA 3DM3A 4NXMQ 1EIYB 1NBWA 2PI2E 4JI8L 1OXTA 4HJ5A 4A3EG 2OCEA 1KQSA 1W3SA 4X65Q 4GOPB 1VQ8A 4B3TL 3NENA 1VQ9A 2DGYA 2YV5A 3GTLH 4L5RC 1T9HA 1XNQQ 4DV2Q 2NVTH 4A3MH 4BXXH 1YNXA 1TWFH 1E1TA 5IP7H 2VZAA 3G48A 1VQJA 1TWCH 1VS0A 1SMXA 2LXKA 1Q82C 1IBML 3CC4A 3PUVA 4O2DA 2VW9A 4BBRG 1GVPA 3CPFA 2QGQA 3MEFA 1DGSA 4QQBX 2Z6KA 1VQFA 4LF7Q 5DLQE 2AKWB 1YJWA 1PH8A 1WCMG 1A62A 1JT8A 4JI8Q 2NZHA 2HIVA 1LYLA 2I5LX 3I2ZA 4PMWA 4GS3A 3RN5A 1XJVA 4B3TQ 2JA6G 4P73A 4GKJL 2HQLA 4A3LH 1QUQB 1WFQA 4X64L 1HR0L 1MIUA 1UE6A 1UWVA 2JA5H 3S2DH 3CAMA 4DK3C 1VQHA 4NPSA 3TQYA 4IOAA 3AYHB 1A8VA 4NXNL 1IBMQ 1K83H 3I55A 3KJPA 3HOYG 4QL5A 3CC2A 2ZM6L 4DR5L 4POGA 1TWGH 1KRSA 3I4MG 1OXUA 2CWAA 1E7ZA 3K8AA 3EIVA 3OYYA 1CSPA 3PUYA 2E2IH 4KLKA 1GD7A 2OQ0A 2AHOB 4PZ6A 1HZBA 5J3BA 3CCLA 1SE8A 2PNHA 2RF4A 3E0EA 4YWKA 3J81i 4GKJQ 1MKHA 1VQIA 2FXQA 1HR0Q 4X64Q 1IBKL 1KXLA 3CQZH 4B3ML 2ZJRA 1E1OA 4P72A 4IOCA 1WJJA 4JI0L 3GDEA 4NXNQ 1X54A 3AFQA 1IYJB 1Z47A 2ID0A 3M4PA 4R4IA 3T1YL 3HOWH 2ZM6Q 4ALPA 1VQCA 4DR5Q 5FLMH 4IFDI 4OO1G 3CMEA 3PO3G 1VQKA 3UE0A 4JI7L 3PO2G 1X3EA 1M1KC 3GO5A 1KAWA 2N8NA 2CCZA 3RZOH 2E8GA 2E2HH 4DR3L 3M4QA 2LXJA 2Y0SG 3PUXA 4JI2L 4KHPL 3U50C 2R92H 1PH3A 5GADC 1TWHH 2N49A 4BY1G 5M3FH 1FJGQ 2K52A 1IBKQ 1EUJA 1JE5A 4YHHL 5C0XJ 1LM0A 3CC7A 4B3MQ 3RR5A 4JI3L 5EAYA 1GM5A 4A3BG 4BBSG 3RN2A 4A4IA 1JMCA 4JI0Q 4GNXC 1CKNA 1EOVA 3CMAA 3T1YQ 2B29A 3M7NA 3CCMA 4A3GG 2OWOA 4JOIA 1CKMA 3H0GH 4DAYB 4JI7Q 3U4VA 4X62L 2VQFL 3M85A 1YHBA 1UE5A 4X6AH 3L7ZC 4DR3Q 1EQRA 2NVXH 1Q1BA 2MFIA 1B7YB 1UE1A 4JI2Q 5C3EG 4JBJA 3HOZH 4A93H 4KHZA 4KHPQ 2ZJPA 1Q8KA 5C4XH 1VCIA 2HIXA 5FJ8G 5IE8A 4BY7G 4B3RL 4GKKL 4GNXB 3HKZG 1Z9FA 2IX0A 2QA4A 2MO0A 4C2MH 2NVYH 4YHHQ 1N8RC 3F2DA 1X55A 1HZAA 1PYSB 1YBYA 1PH5A 4JI3Q 1S40A 2JA7H 1GKHA 2K50A 4DR6L 1WOCA 5IYCG 1ASYA 3K7AH 2R7ZH 1N9WA 4AIMA 3TS2A 3L0OA 2PQAA 1KD1C 1N36L 1E22A 2CFMA 2JA9A 4A3JG 4J15A 5C0XI 3I7FA 4X62Q 2VQFQ 2KCMA 2ASBA 2AWOA 1IXRA 1UEBA 1OTCA 1VQEA 2CWPA 4MZ9A 5GAEC 3J81j 3PF5A 2UUCL 3E9HA 4A3KH 1VQ5A 4B3RQ 1EIFA 3S14H 5M3MG 4GKKQ 3E9IA 3HOXH 2BA0A 3FKIH 3IRBA 3TEHB 2N3SA 2RHQB 2PMZE 3I4NH 4OONA 4DR6Q 3F8TA 3OTOL 1KRTA 1R9TH 4RMFA 4X66L 4R4OA 1NMFA 4R4QA 1N36Q 1E24A 1XNRL 2VY3A 4AQYL 3UDXA 2VUMG 1L2FA 1VQ4A 3AQQA 3S17H 2XGTA 1AE2A 4JC0A 4L5QA 2JE6I 2ZJQA 1SLJA 4LNQA 1J6QA 1HJPA 4DPGA 2UUAQ 2NZOA 1NMGA 2Q2UA 2UUCQ 5IYBG 1K9MC 1Y1WG 3KDFA 1Q46A 2AWNA 1AH9A 1U0LA 5E7NA 1PHJA 3B6YA 2CKZB 4LW1A 2VQEL 3S15H 3S16H 2R7DA 2ZTDA 5AJ3L 3BZKA 2JQOA 3OTOQ 1ASZA 2ATWA 4OO1I 1C7YA 4X66Q 1XTDA 1EQQA 4AYBE 3F2BA 1VQMA 5IWAL 1J5EL 2B63G 1XNRQ 5JJKA 1QVCA 2K5VA 5GAGC 4A3EH 1PV4A 4AQYQ 5K36G 5BR8Q 4OWWB 4BXXG 1SRUA 2UUBL 5C0XG 1YZ6A 5IP7G 3GTJH 1OXVA 3GTQH 3H3VI 4GLVB 2IY5B 2QEXA 1PH6A 5IP9G 3K81C 1CUKA 1W2BA 2YU9H 4DKAC 3CPWA 1S3OA 4LF5L 2K75A 4DV0L 2YTXA 5GQOA 3STBC 2VQEQ 5AJ3Q 4IPGA 3BZCA 3PIOA 2Z6KC 1I50H 1WCMH 4XIGS 1V9PA 5JJLA 5IWAQ 1J5EQ 5JJIA 4IJLA 1SN8A 4R4CA
chains in the Genus database with same CATH superfamily
3IAYA 3NHHA 2A73B 1TXYA 2UUBQ 1WI5A 1H9RA 2I5MX 2JK8A 3U58A 1Y1WB 1SNOA 2K14A 1Q81C 1BBXC 4LF5Q 1V43A 3DLLA 4RCOA 1X9NA 2PQEA 2VL6A 1B9NA 3RMHA 4ZAIA 2L15A 1WTOA 4A3MB 5JVG3 2GVBA 3OW7A 2EXZA 5JAVA 3A5UA 3D4RA 4DV1L 1B50A 1ET9A 2C35B 5EPLA 4Z9CB 1F9PA 4XXEA 4LF4L 3ITPA 1GUTA 3LWUA 2B8FA 1EYGA 2KOLA 5K5PA 3J81E 4HSPA 2CHBD 2KCNA 2R6GA 3W1BA 2JA5B 2EYFA 4FF2A 5FLXE 1EY4A 2ZXOA 1BR9A 3F1ZA 3P1HA 1XPOA 3GV3A 4WORA 3A7LA 2R93H 2D0OA 2L5TA 1HNWQ 4J8QA 3BU2A 3H0GG 4G57A 2R7FA 3HOVH 2YTYA 1U4RA 3H3VC 1KL9A 4DV6L 2F0DA 3IKJA 2WAQE 2JSOA 1X6OA 5ELOA 1HA6A 2WKCA 2IHEA 2JEBI 1AN8A 4HIMA 3DEPA 3HOWB 2F0PA 4YY3Q 1RL2A 3VDYA 2BOSA 2L0CA 4DR4L 1O7ZA 2B2WC 4OIJA 1PA6A 1NCVA 3NEMA 1TWHB 4IPCA 2Q2IA 3K57A 4YWMA 3K0XA 1GUNA 1G51A 4A3FH 3N52A 4A3DH 3FKIG 2XTIA 4P74A 4C3HH 1NUCA 3C2PA 2F3VA 1TQOA 2M2LA 1QCBD 4ILWA 4DNIA 3GTOH 4AYBG 2XSCA 4MTKA 1NR2A 2HT1A 4JW0A 3KLSA 2IT1A 1ILPA 4ME5A 1IYUA 1HZ9A 1Q12A 1STEA 4RGMA 4F88A 3K58A 2VUMH 1KTKA 5ELDA 4C2MB 5ELCA 4A75A 5IYBH 1X65A 3QJYA 2B2UA 1Y1WH 5A2QE 4XYQA 2R7ZB 1QUQA 5GROA 4PNYA 1ESRA 2HUGA 3GTKH 1BCPC 1K0RA 1EL0A 4JI1L 1V1PB 1JORA 3CCEA 2BH2A 4L8JA 3HG9A 3HKSA 4HJ7A 2MHVA 2OXPA 1JJGA 3HFZB 5AFWA 1GUOA 1BCPB 1R9TB 1I4RA 2IWHA 4LWCA 2IW3A 5FKAC 1H9KA 4DAPA 3PUZA 2IX1A 1PZID 2I5HA 3MXGA 2IJ0A 2AMCB 3S17B 1SNDA 1F9RA 2UXCL 2LSSA 1F9QA 3I4MH 1JB7A 2A6EC 2WFWA 1TS4A 3NELA 1U5KA 3ND9A 3M4OH 1NSNS 4KJNA 3RLNA 3T13A 4QGUA 3S15B 3S16B 5IY0A 5LMUL 2ZTEA 3D8GA 3M9BA 5C5MA 4JCVE 4YCUA 4LUOA 2FMMA 2NN6I 3Q22A 1C48A 4JYAL 5LMNL 1PH9A 1EY6A 4JI4L 2EJFC 4A3CG 1CK1A 5FLMG 2VS1A 2G9DA 2OQKA 2F4IA 1E2VA 3NTIA 4KI0A 3KBXA 1Z7TA 4CGYB 2K5WA 4KD4A 3WWVA 4K0KQ 1EFID 3D3RA 2K5DA 1CHPD 1DCZA 3A55A 3H3VH 4Q0FA 4GNXA 1SNQA 5FOBB 3CCQA 4BBSH 4A3BH 3EFXD 3V96A 1QVGA 3GTGB 3AEVA 3Q23A 1PH4A 1CSQA 1HRJA 4PG3A 5JEAG 3EQLC 3K80C 4PZ8A 3CQZB 3J80c 2BA1A 4LF8Q 2F0HA 1B70B 4K2KA 2FMCA 3JC66 1J9OA 5M5YB 4X3TA 5HGTA 1RIPA 1CM9A 1FGUA 2A68D 3M3YH 2GVAA 1XPUA 2E2HB 3T1HL 1VMCA 2IHFA 2F0QA 2JJQA 5E3FA 1EY8A 5M3FB 1JJCB 4JBKA 3ULLA 5TSSA 3TDQA 4OGQC 3ER0A 4LFAL 1EY9A 3OIQA 4LUVA 2SNMA 4K5VA 4DR1Q 4ZRZA 2LY7A 3F2CA 4RFBA 1MI2A 1SNPA 3I4NG 4ZUJA 1D5ZC 5IGBA 5IT9c 3ERSX 4EQ5A 3J7A5 2KVMA 1CA5A 5I2XA 3QO2A 2E5LQ 2KCCA 3PUWA 1Q90A 3D0FA 1XMQQ 1O7YA 2F0GA 5HURA 2JA7B 2DY8A 2LMCB 4TVAB 5JEAJ 3AB9A 5BR8L 1H9SB 1JC7A 2MNAA 2ENBA 2RA4A 3TN2A 2Q8RE 4NXMQ 3I4LA 4A3EG 1N32L 2OCEA 1W3SA 1SXTA 1XTCD 3OHXC 1XNQQ 4DV2Q 1YNXA 4KHVA 1PYWD 1VS0A 1Q82C 1SMXA 4M1UB 4RGNA 4CJ2C 1T5EA 1A2UA 1EZ8A 3MEFA 4QQBX 4IUUA 3OWFA 3J7YW 2Z6KA 1Y69U 1AZPA 1VQFA 5BN3A 1YJWA 2XWBB 4R8NA 1AEXA 4NMZA 1JT8A 2HIVA 4PMWA 1XJVA 1S5BD 2HQLA 2NB0A 1MIUA 1UE6A 2P5ZX 3VA7A 3I70A 1WTHA 1ZXTA 5NUCA 1JICA 4K14A 4QL5A 3CC2A 2BCOA 1D1KA 2BDOA 5ELBA 2ZM6L 3S9WA 2RDFA 1KRSA 1E7ZA 3K8AA 2E2JB 3PUYA 1CSPA 3DM1A 5KNBA 5ISRA 1GD7A 2OQ0A 4PZ6A 1HZBA 1STYA 2RF4A 2LKVA 2E74C 1VQIA 1IBKL 3CQZH 2KA7A 2XWJB 1LTRD 4XT1B 4BBRB 3Q24A 4JI0L 1Z47A 3M4PA 1VQCA 1VQKA 1ICFB 3PO2G 1H9MA 1X3EA 1KAWA 2E2HH 2Y0SG 3NQIA 2E75C 3NWSA 3DEOA 5M3FH 1AP0A 3A8IE 3QG1A 4YHHL 5C0XJ 1U4LA 2AUJD 4B3MQ 3BYYB 1JMCA 1II3A 1I4GA 1HA5A 1EOVA 5CORA 3SK6A 4IUPA 3H0GH 4JI7Q 2K04A 3M85A 1EQRA 1Q1BA 2MFIA 1B7YB 4KHPQ 4L6TB 2ZJPA 1Q8KA 1VCIA 5FJ8G 1F2YA 3S1RB 3HKZG 2IX0A 2MO0A 1N8RC 4IURA 1YBYA 2JA7H 1SYCA 2RDGA 4Y7NB 2RDHA 1F2LA 5C6AA 1JCKB 4AIMA 3VR6A 4J15A 5C0XI 3S1MB 4HAEA 4K6DA 1S4ZA 2K05A 3D4DA 1VQEA 2ICIA 4N8FA 2CWPA 4BY1B 4A3KH 2EY6A 1EIFA 3R8BA 3E9IA 2BA0A 3FKIH 3IRBA 4C3HG 2RQXA 2N3SA 5E4XA 1JB3A 2K5QA 4DR6Q 3F8TA 2F0KA 1MD2D 1B44D 4V190 1E24A 3UDXA 2VUMG 2QEJC 4JC0A 4L5QA 3VYRA 4LNQA 4DPGA 2NZOA 4UDUC 5IYBG 2Z9HA 4XYOA 5FO7B 1EIGA 3URYA 1Y1WG 2AWNA 1Y1VB 3B6YA 2EVBA 4HMJA 5ELEA 2R7DA 5AJ3L 3OTOQ 2F0IA 2ATWA 1C7YA 3TSSA 3CU7A 4DU9A 1LT4D 3O13A 4AYBE 1VQMA 1QNUA 2PMZB 4A3IB 1PV4A 4AQYQ 1SE4A 3T4AC 1F9SA 4BXXG 1YZ6A 1CUKA 3OMGA 4DV0L 2MUYA 1JOKA 1ENFA 4IPGA 1MGSA 4HN7A 5IWAQ 4IJLA 2K28A 4IUNA 1SN8A 1SNCA 2EDGA 2LS01 4NKLA 2RBMA 4H02A 1SFOH 2LFNA 1LUZA 1BVSA 3TREA 1B2TA 1M4VA 5JPMC 5E4WC 5CC4A 2K03A 5KEEA 4DAMA 3NBHB 4FYDA 4ZYSA 4A3CH 1PH7A 3AU7A 3QOLA 2SDFA 4C1NI 1TWCB 5D3DA 1HUNA 3S1RH 3OPOA 4POFA 2A8VA 3HOWG 2L1BA 3STBD 3FVQA 5C4HA 1XPRA 1Q8IA 4XT3B 3J80E 4ZQ3A 4IFDJ 4UAIA 1I6VC 3FP9A 4NB3A 3NE5B 4HIKA 1LTSD 1ZKOA 3R2IA 4BY1H 3H15A 1YI2A 1K83B 4LFCL 4DV1Q 1DONA 5JEAH 3HZXA 1Y8NB 1W6JA 5M5XH 2KQ3A 4UP8A 4DGZA 1YIJA 3TP7A 5C44B 1VQOA 1CQFA 2A1AA 3A8JE 1LT5D 4JOIC 4B3SL 1HNXL 2EXDA 2EZVA 1PH1A 1RTNA 3U4ZA 1NJIC 3BJUA 4YCVA 5H1SE 3NK9A 3PF4A 5KNDA 5IT9E 4IFDI 4DV3L 4IUTA 2GN5A 4MN3A 1HHVA 3TP5A 2G9HD 2VB2X 3K5MA 2VNUD 1FNUA 4DV6Q 2R92B 5HGQA 1PRTD 3VYSA 1RODA 3ONAB 5M3MH 2MJ8A 2WB1E 2KEDA 3CXCA 4GOPA 1I94L 2BE5C 3PSIA 1KNAA 3KYHC 3CCRA 2MO1A 1FNVA 1PTOD 2F0UA 4DR4Q 2EJGC 2CH4W 2NVXB 1AE3A 3D31A 2KUMA 2QKIC 5C4XB 2ALYB 1E3PA 4ME3A 1X3QA 4XTCS 4CKBA 2J7ZA 4OWXB 3K7AB 1LT6D 2RSOA 2F4VL 5C3XA 1VQBA 3UDGA 4TQUS 1QG7A 2RVLA 2F1MA 1EZ6A 2F3IA 4R4TA 4C3JH 2KHIA 4KN4C 5C0XH 3S14B 5CGKA 4UPAA 3HOXB 1PZJD 3MXPA 2J0TD 4GLXA 2X69A 5A35A 2PZWA 2XRSD 1EQVA 2YYZA 3RLOA 3UI2A 1TKWB 4JI1Q 4GN3B 1VQ7A 5G3LD 3J7AV 3D4WA 1B8AA 2DJFC 1L1OC 3E5SA 4QMGA 3I56A 3MTSA 1YVCA 4JI5L 3VYTA 1B9MA 4DUYL 3G71A 1TWFB 3PMFA 1BDOA 4IN3A 1AFPA 1PVOA 5C44H 2WKDA 4A76A 1Z6HA 1L1OB 3QOJA 3A5ZB 4QF4A 1MBYA 2UXCQ 5EPJA 2EYLA 1FJGL 2EYPA 5GAHC 3PO2H 4DAYA 1H95A 3S2HH 1M8AA 1XMOL 1NTGA 3QIAA 1N34Q 3JAML 1HFNA 5CYUA 5LMUQ 1GO3E 4HJAA 5M3FG 2KHJA 2QF7A 1FVIA 2UXBL 4OX9L 1I4PA 1I4XA 2NTSA 3BS1A 2CVRA 4JYAQ 5LMNQ 1D8LA 4Y52H 3CP0A 3ZJYC 4JI4Q 1VQDA 4JI6Q 2SOBA 1JWMD 4RHSA 4IQZA 2E2IB 3NSWA 1PFSA 2L9HA 3KLWA 4LF9L 4JV5L 4PQXA 1EY7A 3IL8A 4PV1C 2Y0SE 2HHHL 3TZUA 3KF6B 2JA8B 2MPMA 5FJ8H 4L5SA 4G7OC 3C1EA 3CD6A 2JA7G 5I9PA 2A6HC 3UDFA 1VQ8A 1EIHA 5DAUA 1VQGA 1NE3A 3NTKA 2NN6G 3RZOB 1JWSD 3OSOA 1IBLL 3DUZA 1P8LA 1WD1A 3CRLC 3M7GA 4IZ8A 3LGJA 1BQQT 1B1ZA 2K6AA 4RH6A 4LF6L 1C0AA 4I7AA 1VDZA 4A3KG 3HKZE 1BUVT 1YNJC 1GXDC 1UEAB 4WRDA 4LFBL 1UE7A 1F2ZA 2F52A 1EY5A 2UUAL 1CFMA 3NBIA 3T1HQ 4X65L 4K8IA 5I4DA 1GOZA 5M5WB 4LFAQ 1DOKA 1PYBA 2FJ2A 2E76C 3TP8A 2B2YA 2IPKD 5HY6A 4YWLA 1PFBA 4BY7B 1CKOA 3DM3A 1DYQA 1EOTA 1VMPA 4JI8L 1IW7C 2L4NA 4B3TL 1IKLA 2YV5A 2F0LA 2SNSA 5KYLA 4BXXH 4A3MH 3EA6A 1TWFH 2DN8A 1TVXA 3CC4A 4IFDH 3DWPA 3PUVA 4O2DA 4BBRG 1GVPA 3HOUB 1D6EC 5FO8B 2K32A 3EVQA 1PH8A 2A74C 1QJOA 1N32Q 4G4KA 4GKJL 1UWVA 1ICWA 4I65A 1C4QA 1QILA 2JA5H 1PLFA 1JE4A 1CHQD 1D5XC 1HTLD 2XVSA 3I55A 3KJPA 2CWAA 3EIVA 2E2IH 2AHOB 5J3BA 3CCLA 2O5IC 3E0EA 4YWKA 4OL7A 2B8GA 3HGBA 4N8X1 4IUVA 2O2LD 1E1OA 3CHBD 5IOCA 4XQJA 1X54A 4WJWA 5D14A 5CV9A 1I3QB 2ZM6Q 3HOWH 2CH4A 3CMEA 2MP1A 3GO5A 1M1KC 3RZOH 4C56C 2JA6B 1D2BA 4JI2L 3PUXA 2E2DC 5GADC 1TWHH 4HEDA 5E1FA 4RHRA 4BY1G 4ZKCB 1IBKQ 1LM0A 3RR5A 1GM5A 3A54A 3I8ZA 3J81L 3HOYB 1SYEA 4L63B 4JI0Q 3Q0AA 2B29A 2JYOA 5CBAE 3CCMA 3M7NA 3S1NB 3IFDA 4ZKBB 4KTAA 3VR2A 4X62L 1L0XB 1YHBA 1UE5A 1DM0B 1F2MA 1FD7D 4JBJA 3SK8A 4KHZA 2NVQB 5IE8A 5LL6X 3EJIA 2QA4A 4C2MH 1I6HB 4YHHQ 3VR4A 3F2DA 1X55A 1HZAA 2NUCA 1GKHA 3VYUA 2HCCA 1ASYA 2R7ZH 1N9WA 3PO3B 2EY2A 3L0OA 2B2WA 5CBEE 1N36L 3GV6A 2JA9A 1A3VA 4HSVA 4HCEA 2XRQD 2ASBA 4B9XA 1IXRA 1UEBA 1HXYD 2AQ2B 4H7BA 2KECA 4MZ9A 5D65A 5GAEC 2UUCL 1VQ5A 2HQEA 5M3MG 1PFMA 2RHQB 4A3GB 4CJ0B 1GUWA 1UNSA 1R9TH 4X66L 1NMFA 3VA5A 1XNRL 2EY1A 1V1PA 5D3IB 5C3EB 1LTAD 2HD3A 3SEBA 3S17H 1KABA 2XGTA 1AE2A 1XWEA 2JE6I 2VXWA 2Z4HA 3W2DA 5BN5A 5C4ZA 1HJPA 1Q46A 1U0LA 1PHJA 3S15H 2VQEL 3S16H 4YIJA 3BZKA 4PMBA 5A2QL 1EQQA 3F2BA 2F0FA 1J5EL 1YNNC 1EYDA 1PRTF 5GAGC 2EOTA 4C3JG 4C1NK 3KLSX 1SRUA 1HPCA 5CV7A 5IGFA 5C0XG 2R3ZA 1SYBA 3T51B 1OXVA 4Q5VA 5EJWA 2IY5B 2Z4IA 2FINB 1PTOF 3CPWA 1S3OA 2K75A 2YTXA 3BVGA 5GQOA 3STBC 1JOQA 3ND8A 5AJ3Q 3SE0A 4PMCA 5IGEA 2B2VC 1QOHA 4KY7A 2ZXPA 3SK5A 1S5CD 4R4CA 4POGA 5COYA 3PIPA 3SXHA 3GTGH 4X3SA 4DV7L 1MJCA 4AYBB 4CDEC 3SGIA 3KFUA 3TS0A 3HOYH 1KAAA 2I0QA 1CZGA 4DV0Q 1Q7YC 4UP9A 1JJ2A 2WV6D 4H13C 3JAMi 3A0JA 3RD4A 2B63B 5C44G 4BWGB 2FFKB 3I4OA 4UHVA 4CJ1B 3GTLB 5M5YH 2NVTB 4F7XA 2O5JC 1STGA 1HCZA 4DF7A 3ICEA 1SE3A 2C9OA 5JVH3 1BCPD 3W5OA 2WIIB 4MNOA 2AQ3B 3TMEA 2DY7A 1I6HH 3AMUA 1A2TA 3FPPA 5G3LF 3HRZC 3PO3H 1F77A 1LT3D 1EEFD 1X32A 2Z8LA 4A3JB 3MXNB 1DOMA 2R92G 3S2DB 1EWHA 3CF5A 1PRTC 3T53B 2AUKA 2OTLA 1BKBA 3E3XA 3MXUA 1TWGB 2K5HA 3TRZA 1G6PA 4N9TA 4GN5A 5IODA 3S24A 3M4YA 1PTOC 2A6ED 2NTTA 4QUCA 4LUZA 3GTMB 2KBNA 1YHAA 2I46A 4DUZL 3VR3A 1PRTB 3V05A 5I2YA 3HEJA 4OWTB 3Q6SA 2BH8A 3J7ZC 1JR0D 3C1FA 3FHWA 3EBEA 2NN6H 4KKUA 1O7IA 1HZCA 3BDCA 4LFCQ 3UDIA 2WP8J 1CKNB 1PTOB 3FPUB 2KENA 1A15A 2A19A 4DV4L 1WVLA 3I72A 1HH2P 1A3TA 4H44C 4B3SQ 4KMUC 1HNXQ 1YITA 4H0LC 1H9SA 4DK1A 1JOOA 3CCVA 3DMUA 2RCNA 5LMNW 1J8IA 3ULJA 1A3UA 4DV3Q 4QIWE 1K8AC 3HP3A 4IO9A 2PQAB 2D9UA 1ZYRD 3OMCA 2H1EA 1LTBD 1GHKA 1KHIA 3C3LA 3KLRA 2V4DA 2ZTCA 4UY8C 1DD2A 2NVYB 1IZ6A 2E2JH 5M9OA 1I94Q 4A3MG 4HMIA 2B2TC 2EYOA 3DWAA 1IHZA 2WB1B 5LL6S 4IFDG 2UU9L 2B63H 2Q2HA 4BBRH 1E0BA 1EYCA 1VQAA 1QE6A 1E2ZA 3KF8B 4CDFC 1NY4A 5FO9B 1P16A 2NZ1D 3KDFB 4DV5L 2F0NA 5IP9H 1IL2A 4FDBA 1EWIA 4OEMB 3G6JB 1S72A 1YHQA 3FMCA 2JA5G 1NAPA 3FEWX 1O80A 2DJGC 4TRDA 2F4VQ 2K5NA 2OEOA 4LMQD 1PFNA 3NQTA 3PCOB 4A3JH 3DWQA 1VQLA 5C5LA 1C9OA 1BOSA 4FXDA 3T56B 4DA2A 5KRUA 4P71A 2JN4A 4AH6A 4XQQA 1SAPA 2F0VA 4DR2L 1O78A 2JA8G 1OXXK 4A3EB 3GD7A 4KKTA 1G2TA 3GTMH 3EROA 1TR5A 3D6WA 4R1JA 2C5CA 4Y7NH 3GP7A 1BXTA 3GTJB 2UXDL 4V0BA 5J1ZA 2YU9B 1EU3A 1SEBD 1X3GA 1VQPA 4JI5Q 3R3OA 3S1MH 4DUYQ 1R4PB 2CW0D 4IPDA 3CCJA 4J1MA 1EWCA 2RKSA 3A74A 1KC8C 2RSNA 4GN4B 3UE1A 4N9PA 5BN4A 4DR7L 5EBDA 2ES2A 4KK7A 1GUSA 1U9RA 2JP1A 5IYDG 1WTVA 4LF4Q 4JPBW 4JG2A 2M00A 5DM63 1XMOQ 4K5XA 1I4HA 2Z0SA 2CQOA 4IJHA 1V1QA 2UXBQ 4OX9Q 1VF7A 2KEEA 2N78A 3G4SA 1Y1VH 2R7ZG 5C3WA 1PH2A 2NYZD 4RKLA 2HDMA 1L0YB 4UP7A 1N33L 4LF9Q 4JV5Q 1V1OA 4A3IH 4BA1I 4P75A 2HHHQ 2DNCA 1HNZL 4MTNA 3W1GA 2EY5A 2WAQB 2H5XA 2QW7A 3TP6A 2Y0SB 4E6IA 2D62A 1YJ9A 2EQSA 3HOUG 1XYIA 1OO9B 1RHPA 4RG1A 3CCUA 2K4KA 1IBLQ 3HOZB 4FF1A 4A93B 2R93B 1KDBA 1SDFA 1QVFA 3K0YA 5J39A 1CTMA 1SNMA 4LF6Q 3HOVB 3WOEA 1YJNA 1NR4A 2HDLA 4RCNA 2Q2TA 1W6KA 4DK6C 4LFBQ 4LF7L 2D5DA 2PI2A 3PIP3 1EIYB 2PI2E 4HJ5A 1KQSA 2A69D 4X65Q 1RKNA 3NENA 1VQ9A 3N6RA 2DGYA 2B2UC 5EQ0A 3NXWA 1SYFA 1VQJA 1TWCH 2LXKA 2Z6BA 1IBML 3NTHA 3K6OA 4DK0A 2VW9A 3CPFA 3ZYYX 1A6XA 1TY0A 1U4MA 4A3FB 4A3DB 2PZUA 3NBHA 4C3HB 4JI8Q 1LYLA 1ENCA 3I2ZA 2JA6G 4GS3A 2O4XA 4B3TQ 2M9VA 4P73A 1QUQB 4X64L 1HR0L 3GTOB 3QR8A 1WD0A 3R2TA 4DK3C 1VQHA 1HTPA 2QCPX 4NPSA 5EKKA 3ERQA 4NXNL 3FRPB 1K83H 2VUMB 3HOYG 1GJXA 4KN7C 4DR5L 1B53A 1STAA 3OYYA 4KLKA 2IX3A 3K5NA 1SE8A 1D1IA 2A68C 4GKJQ 1MKHA 2D2CC 3GTQB 3GTKB 1KXLA 2Q8IB 2ZJRA 4CDDC 4P72A 1WJJA 3GDEA 1SMYD 4R4IA 3T1YL 1ILQA 4OO1G 3PO3G 3UE0A 4EQNA 1I50B 1WCMB 4B9WA 4DR3L 1R4QB 2GA4B 2R92H 3X3MA 3MC0B 3J80L 1EUJA 4DAVA 1JE5A 4JI3L 4A4IA 2MGSA 4GNXC 3OIPA 3E0JA 3I4MB 2I07B 4A3GG 1FGBD 3DHQA 2OWOA 1FR3A 4JOIA 1S5ED 1CKMA 3M4OB 3U4VA 2VQFL 4KJOA 2F3WA 3L7ZC 2NVXH 1BCPF 4JI2Q 5C3EG 1UE1A 3GTPB 2F0TA 3HOZH 4A93H 1G6ZA 5C4XH 1VF5C 2K33A 2XN9C 2A5HA 1KNEA 2NBFA 4NDXA 4GNXB 4GKKL 1Z9FA 2J4XA 4KD3A 4B3RL 4KV6A 1PH5A 1PYSB 1RJTA 2K50A 5CR3A 5F2DA 1WOCA 5IYCG 5IGGA 4DXFA 3K7AH 3TS2A 2RCFA 1KD1C 1E22A 2CFMA 5IT9L 1LTTD 2WINB 3MVVA 3WDNA 4X62Q 2AWOA 1ONLA 4OIKA 1OTCA 4HTHA 4RAUC 1TWAB 3PF5A 1Y8OB 1HUMA 4BBSB 4A3BB 4ZLTF 3S14H 1SYDA 2PCFB 3HOXH 5L37A 5T1IA 3TEHB 5JPNC 2VB3X 3C46A 2QDLA 4ABNA 3WOFA 1MSHA 4RMFA 1B3QA 1KLUD 1T5XD 4R4OA 4RWSC 5CMDA 4DFAA 1N36Q 3D6CA 2PPBC 1L2FA 1ET6A 1PXUA 2EE1A 3AQQA 1VQ4A 4OELB 3BDLA 5FK9C 1SLJA 1J6QA 2UUCQ 3E6ZX 1K9MC 1XXGA 4CDCC 2ZTDA 3M3YB 2JQOA 1ASZA 4OO1I 1SYGA 2K1BA 5C4JB 4X66Q 1XTDA 1IYVA 1S5DD 3KUPA 2EPBA 4NP5A 2B63G 3DXJC 1XNRQ 3S1QB 5K36G 5BR8Q 1EYAA 4OWWB 1TIID 2UUBL 1K8OA 4CKEA 3K5LA 5IP7G 3GTQH 3T16A 4GLVB 2QEXA 5IP9G 3K81C 1W2BA 3NWTA 4LF5L 5I6YA 3L3OC 2VQEQ 1ESFA 3BZCA 3BYTB 2Z6KC 3BZDB 3PIOA 1I50H 1STHA 1WCMH 1V9PA 5JJLA 1J5EQ 5JJIA 1STBA 1LV9A 1L1OA 3I90A 4A3JG 4A3LG 4R9WA 4JBWA 2BE5D 4C3IB 3P20A 4TSSA 1LABA 2L11A 5DEHA 4LJZC 4ODGA 1EEID 2D0PA 2JA8H 1SE2A 2ZT9C 3K59A 1N34L 5EKIA 3GTPH 4DV7Q 4U68A 3PV0A 2PW5A 2EIFA 5KGUA 2RHSB 4JI6L 1HNWL 3KF6A 4O0AA 4CHTB 1DJRD 3NPPA 1K8GA 1WTXA 1X3FA 5FLXL 4JBMA 2Z1CA 3I3CA 3G6EA 3A56A 5IYDH 1TWAH 3K7UC 1I5FA 1SBBB 1K8MA 4JVZA 1QZHA 4R8IA 3JAMc 4YY3L 4RGOS 1RTOA 1ZYRC 1FL0A 5M5WH 4BA2I 3U9OA 1LO5D 1Y1VG 3BVMA 2KCTA 1STNA 3TZDA 1UUPA 3OW2A 4O42A 1CA6A 5EPKA 4BY7H 4EGVA 2JEAI 1BBWA 5DNFA 1WYDA 1HR0W 3RUZA 1A0IA 4A3IG 3PGZA 1GHJA 3FDTA 2YTVA 4YCWA 1VQ6A 1S5FD 1A63A 3EN2A 5C4JH 2WB1G 2X6LA 1AW7A 4ID6A 4DUZQ 1VQNA 2PZTA 3S1QH 3HOUH 4KY6A 2DNEA 4QY7A 4DN4M 3MFYA 3OWEB 3H0GB 5CV4A 1K3RA 1B3AA 1BBUA 4X3UA 4DV4Q 1EU4A 2EYMA 4WJ4A 4IALA 2ZXRA 1UAPA 1X56A 4C3IH 1GUGA 1HQMC 3IFTA 3RNUA 1SJED 3OOCA 5IIFA 3PQIA 3L9AX 4APVA 4OXPA 2A6HD 1LACA 4L5TA 4FXGC 3RLFA 1KIXA 1LTID 3RZDB 2FHTA 4QJFA 4WJ3M 3MFGA 4QIWB 4HJ9A 4QB4A 1I3QH 3L2PA 1TS3A 4A3KB 3BDOA 3KJOA 4LAAA 3FKIB 3U9SA 4ZK9B 1YNJD 1K3BC 4I7ZC 3BG3A 2JA6H 2CW0C 1SROA 4B08A 1Q86C 1HFGA 1TY2A 1AZQA 3NP8A 1G2SA 2UU9Q 4EX5A 2TSSA 3HS0C 3SDZA 5IGCA 3S1NH 5IGDA 1EY0A 4DV5Q 2K01A 1K73C 4K0KL 4PZ7A 5JOBA 4MIUA 4RA8A 2NVQH 1IKMA 3A7AB 3J80i 3I91A 1WTQA 3CW2C 2BDNA 1IW7D 3ULPA 2PYKA 1XX8A 1JWUD 1KLGD 4OO1H 1BO0A 1G8ZD 2WACA 2DUDA 4HCSA 2L12A 4J6HA 1MJEA 3KK7A 1OXSC 1K28A 1JQYD 4DR2Q 4LF8L 1C8CA 2PW7A 4M8AA 1O7LA 5I6WA 2WAQG 1QNKA 5KIXA 2AQ1B 1EFWA 4A3GH 3Q8DA 1YEZA 1V8QA 2UXDQ 1SFOB 2F0JA 1QZGA 1MSGA 1I4QA 1SR3A 2CQAA 2MQHA 1L0WA 5C3EH 2F0EA 3HOZG 4A93G 4ULLA 1TS2A 2R93G 1LTGD 5C4XG 2X6GA 3KOJA 3HOVG 1G291 3SR1A 3J81c 4DR1L 4WFN3 1LTLA 5FLXc 5T1GA 5JJZA 3AFPA 4HJ8A 2V1CC 5IYCH 4DR7Q 3K5OA 1PZKD 3NUCA 3W3AA 2TMPA 4FXKC 5KYIA 2A69C 1PMRA 4U673 2E5LL 5CV8A 4XDXA 2H4OA 1BNZA 1XMQL 2B3GA 3CKIB 3CCSA 1QWYA 3QWNA 3HOXG 3RZDH 2ICEC 4S3SA 4BS9A 1Q1EA 5CV6A 3P7JA 1FNWA 1RCVD 4IPHA 5ELNA 1U4PA 1ML0D 1M90C 4NXML 5LHY1 4GLAC 4A3FG 2N55A 4HIDA 1CT1D 4A3DG 1N33Q 3H09A 5M5XB 1KDCA 1Y8PB 1XNQL 4DV2L 2EJMA 4MHEA 4GOPC 1B4OA 1HNZQ 1Y14B 3MHBA 1D7QA 4HIOA 2OTJA 3PIO3 4P2CB 4FP5D 2OF1A 2EYJA 1EQTA 1NBWA 4DXGA 1OXTA 5KNCA 2XIWA 4K2LA 4GOPB 1SJHD 4GZYC 5K36H 1H9JA 3GTLH 4L5RC 1T9HA 4F87A 1WTPA 2NVTH 3H91A 1D5MC 2XNAC 1E1TA 4ZUIA 2VZAA 3G48A 5IP7H 1SSOA 4TKOB 1SMYC 4K6LA 3I4NB 2QGQA 1DGSA 1PDQA 4XQNA 2KJXA 3KBGA 2B2VA 4LF7Q 5DLQE 2AKWB 2B39A 5M3MB 3LWEA 1WCMG 1RF2D 1A62A 2NZHA 2I5LX 3RN5A 2NWGA 2N88A 2PNRC 4A3LH 2HCIA 4DNTB 4EVOA 1TT2A 1WFQA 3SVMA 3S2DH 3CAMA 1CI3M 1LLRD 3H6MA 3TQYA 4HR7B 4IOAA 4LK1C 3AYHB 1A8VA 1IBMQ 2PO4A 1NNXA 1MHWC 4FNFA 1K0SA 3A8KE 1TWGH 3G7LA 3I4MG 1OXUA 4JK1C 2OT2A 3MWYW 1CZWA 4EQPA 1DZ1A 2PNHA 4DNRB 5I9OA 2K7VA 3J81i 3MXNA 1BF4A 3BVZA 5CV5A 2FXQA 1CQVA 1WTRA 1HR0Q 4X64Q 4QCLA 4B3ML 1FYCA 2L55A 4FF4A 4IOCA 4NXNQ 1YNND 2R61A 3CRKC 3AFQA 1IYJB 1DOLA 2ID0A 4C3JB 4ALPA 4EQOA 4DR5Q 1PTOH 5FLMH 3JAME 4JI7L 4G7HC 2CCZA 2N8NA 2E8GA 2SEBD 2Q8TA 3M4QA 2LXJA 4KHPL 3U50C 4K8JA 1PH3A 2N49A 1FJGQ 2K52A 2QDBA 3CC7A 1RDPD 2G5DA 5EAYA 4A3BG 4BBSG 3RN2A 1Q3LA 4OHJA 1CKNA 4RGTA 3CMAA 3T1YQ 4KKSA 4DAYB 1X3PA 4X6AH 2EYHA 3J7AF 4K5WA 4DR3Q 1IL8A 4RKBA 3MA2B 2F0WA 2HIXA 1KDAA 4KY5A 4BY7G 1HQRD 3MEHA 3TBIB 2NVYH 4JI3Q 1S40A 3LNNA 3X3NA 2F0OA 3SK4A 4DR6L 4F8MA 2F0SA 4CKCA 3PO2B 4FO2A 2PQAA 4CBVA 3S2HB 1ZEQX 2QILA 3MZ5A 3I7FA 2VQFQ 2KCMA 3V2TA 3GQBA 5J22A 1TU2B 3I73A 3J81j 3E9HA 4X3KA 4B3RQ 4GKKQ 5EKLA 4FF3A 2JXMB 4NW2A 2PMZE 4O1NA 3I4NH 4OONA 3OTOL 1KRTA 3R93A 1G91A 1RD9D 1QB5D 4R4QA 4ZCKA 2VY3A 4AQYL 1WTWA 4QUFA 1TS5A 3LX0A 2ZJQA 3KF8A 5EGTA 4C3IG 3HKZB 2UUAQ 1NMGA 2Q2UA 3H94A 3KDFA 1AH9A 2B2TA 5E7NA 1ENAA 2CKZB 5EBCA 4LW1A 4FVMA 2F0MA 2B2YC 5DM73 4IUQA 4G7ZC 3P75A 5IWAL 5JJKA 1QVCA 2K5VA 3F2UA 4A3EH 1E2WA 2KHSA 3GTJH 3H3VI 2F03A 3VR5A 1PH6A 2YU9H 4DKAC 3QB3A 3MAQA 3SHLA 1DXMA 2IL8A 4XIGS 5ELFA
chains in the Genus database with same CATH topology
4A3LG 4JBWA 3PIPA 3GTGH 4DV7L 1MJCA 1TXYA 2UUBQ 1WI5A 3SGIA 2I5MX 2JK8A 4H02A 3TS0A 3U58A 3KFUA 1SFOH 2K14A 1LUZA 1BVSA 3HOYH 3TREA 1Q81C 2I0QA 4LF5Q 1V43A 4DV0Q 1Q7YC 3DLLA 4UP9A 1JJ2A 3JAMi 3A0JA 1X9NA 2D0PA 2JA8H 2VL6A 5C44G 4DAMA 3NBHB 3I4OA 2L15A 4A3CH 1N34L 1PH7A 5M5YH 3GTPH 3ICEA 2GVBA 4DV7Q 3A5UA 3W5OA 4DV1L 3S1RH 3PV0A 4MNOA 1I6HH 2EIFA 2C35B 4POFA 2RHSB 2A8VA 4JI6L 3HOWG 1HNWL 3KF6A 3STBD 1XPRA 4O0AA 3PO3H 4LF4L 1K8GA 1EYGA 4IFDJ 1X3FA 4JBMA 3FP9A 3MXNB 2R92G 2R6GA 3W1BA 3G6EA 4NB3A 3CF5A 4HIKA 5IYDH 4BY1H 1TWAH 3K7UC 3F1ZA 1I5FA 3H15A 1YI2A 1XPOA 2OTLA 4LFCL 1BKBA 4DV1Q 1QZHA 2K5HA 3JAMc 2R93H 4YY3L 5M5XH 2D0OA 3TRZA 1G6PA 4GN5A 1HNWQ 4UP8A 1YIJA 3S24A 3BU2A 3H0GG 1VQOA 1FL0A 2R7FA 2YTYA 4LUZA 5M5WH 2KBNA 1KL9A 1YHAA 2A1AA 4DV6L 4DUZL 4JOIC 4BA2I 2WAQE 4B3SL 1X6OA 5ELOA 1HNXL 2EXDA 1Y1VG 2KCTA 1PH1A 4OWTB 3U4ZA 3OW2A 2BH8A 3J7ZC 2IHEA 1NJIC 3FHWA 3BJUA 3EBEA 2JEBI 1O7IA 4YCVA 5H1SE 4BY7H 1HZCA 1BBWA 2JEAI 3PF4A 1HR0W 1WYDA 3UDIA 4HIMA 2WP8J 1A0IA 4DV3L 4A3IG 4LFCQ 3PGZA 1CKNB 2GN5A 4YY3Q 2KENA 2YTVA 4YCWA 1RL2A 3VDYA 1VQ6A 2A19A 4DR4L 3EN2A 1A63A 2VNUD 4DV4L 5C4JH 2WB1G 4DV6Q 1PA6A 1HH2P 4DUZQ 1VQNA 4B3SQ 1HNXQ 1N32Q 3NEMA 3S1QH 1YITA 3HOUH 4IPCA 2Q2IA 4YWMA 3CCVA 5HGQA 2RCNA 3K0XA 5LMNW 3ULJA 4QY7A 1G51A 4A3FH 5M3MH 2WB1E 3CXCA 4A3DH 3FKIG 4GOPA 2XTIA 4P74A 4C3HH 4DV3Q 1I94L 4QIWE 3PSIA 1K8AC 3KYHC 3CCRA 4IO9A 2PQAB 2MO1A 4DNIA 3GTOH 1K3RA 4AYBG 2HT1A 1BBUA 4DR4Q 4DV4Q 2IT1A 1AE3A 3D31A 1HZ9A 1Q12A 2VUMH 1KHIA 4WJ4A 2ALYB 1E3PA 2ZTCA 1X56A 4UY8C 4C3IH 4A75A 1IZ6A 4ME3A 3RNUA 2E2JH 5IYBH 1X65A 1Y1WH 4XTCS 4APVA 4OXPA 4OWXB 4L5TA 1I94Q 3RLFA 1QUQA 4A3MG 5GROA 1KIXA 3GTKH 1K0RA 4IFDG 2F4VL 4JI1L 2UU9L 4QJFA 1VQBA 3UDGA 2B63H 4WJ3M 3CCEA 4TQUS 2Q2HA 4HJ9A 4BBRH 2BH2A 1VQAA 2F3IA 3HKSA 4R4TA 4C3JH 1I3QH 3KF8B 2KHIA 3L2PA 1NY4A 4HJ7A 1P16A 3KJOA 4UPAA 1JJGA 3HFZB 3KDFB 4DV5L 5IP9H 1IL2A 4FDBA 2JA6H 1EWIA 1SROA 4LWCA 1YHQA 1S72A 4GLXA 1Q86C 2JA5G 3PUZA 2IX1A 2YYZA 3RLOA 2I5HA 1L1OA 2K5NA 4JI1Q 2UU9Q 2AMCB 2F4VQ 3PCOB 4EX5A 4GN3B 1VQ7A 2UXCL 1B8AA 4A3JH 2LSSA 1VQLA 3I4MH 1C9OA 1L1OC 1JB7A 3S1NH 2WFWA 3NELA 1U5KA 3I56A 4P71A 4JI5L 1YVCA 3M4OH 4AH6A 3RLNA 4DV5Q 1K73C 4DUYL 4QGUA 4K0KL 5IY0A 3G71A 2ZTEA 4PZ7A 5LMUL 3M9BA 4DR2L 4JCVE 4YCUA 4LUOA 2JA8G 2NVQH 1OXXK 1PVOA 2NN6I 5C44H 3GD7A 3J80i 4A76A 3CW2C 4JYAL 5LMNL 1PH9A 3GTMH 4JI4L 1L1OB 4A3CG 3ULPA 3A5ZB 4R1JA 2UXCQ 5FLMG 4Y7NH 2VS1A 2OQKA 1FJGL 2DUDA 2UXDL 5GAHC 3PO2H 1H95A 4KI0A 3S2HH 1N32L 1X3GA 1NTGA 1VQPA 1XMOL 4JI5Q 3WWVA 1MJEA 3S1MH 4DUYQ 4K0KQ 1OXSC 1N34Q 5LMUQ 4IPDA 1GO3E 4HJAA 3CCJA 5M3FG 4DR2Q 2KHJA 4LF8L 3H3VH 4GNXA 1FVIA 2UXBL 3A74A 1KC8C 3CCQA 4GN4B 2WAQG 4OX9L 4A3BH 4BBSH 3UE1A 1EFWA 4JYAQ 5LMNQ 1D8LA 4Y52H 1QVGA 3CP0A 3ZJYC 4JI4Q 1VQDA 3AEVA 4DR7L 4JI6Q 4A3GH 3Q8DA 2ES2A 1YEZA 5IYDG 1PH4A 2UXDQ 4LF4Q 1PFSA 1QZGA 3KLWA 4LF9L 4JV5L 1CSQA 1SR3A 4JG2A 4PG3A 1XMOQ 5JEAG 2Y0SE 2HHHL 2MQHA 1L0WA 5C3EH 3HOZG 4A93G 3K80C 2R93G 5C4XG 4PZ8A 3KF6B 2Z0SA 3J80c 2BA1A 3KOJA 5FJ8H 2CQOA 4L5SA 4IJHA 4LF8Q 3HOVG 1G291 1V1QA 2UXBQ 3J81c 1B70B 4DR1L 2JA7G 3CD6A 4OX9Q 3JC66 1LTLA 5FLXc 3G4SA 2N78A 3AFPA 3UDFA 1Y1VH 1RIPA 1NE3A 1VQGA 2V1CC 5IYCH 4HJ8A 2R7ZG 1FGUA 4DR7Q 1PH2A 3M3YH 2GVAA 2NN6G 1XPUA 3T1HL 2IHFA 1IBLL 1P8LA 4UP7A 1N33L 4LF9Q 4JV5Q 2JJQA 2E5LL 4A3IH 4BA1I 4P75A 2HHHQ 1JJCB 3LGJA 4JBKA 3ULLA 1XMQL 4LF6L 1HNZL 4MTNA 2B3GA 3ER0A 3W1GA 4LFAL 4LUVA 1C0AA 4A3KG 3CCSA 2H5XA 3HKZE 3HOXG 3RZDH 4DR1Q 2D62A 3F2CA 4LFBL 1Q1EA 1UE7A 3I4NG 1YJ9A 2F52A 2EQSA 4IPHA 3HOUG 5ELNA 1M90C 2UUAL 4NXML 5IT9c 3ERSX 4GLAC 4EQ5A 4RG1A 4A3FG 3J7A5 3CCUA 2K4KA 4HIDA 3T1HQ 4X65L 1IBLQ 3HOVH 4A3DG 1N33Q 1QVFA 2E5LQ 1XNQL 4DV2L 3PUWA 4GOPC 3D0FA 1XMQQ 4LF6Q 1HNZQ 4LFAQ 1Y14B 1PYBA 1D7QA 4HIOA 4TVAB 1YJNA 2OTJA 2Q2TA 5HY6A 5JEAJ 4DK6C 5BR8L 4LFBQ 4YWLA 2MNAA 4LF7L 2PI2A 1CKOA 3DM3A 4NXMQ 1EIYB 1NBWA 2PI2E 4JI8L 1OXTA 4HJ5A 4A3EG 2OCEA 1KQSA 1W3SA 4X65Q 4GOPB 1VQ8A 4B3TL 3NENA 1VQ9A 2DGYA 2YV5A 3GTLH 4L5RC 1T9HA 1XNQQ 4DV2Q 2NVTH 4A3MH 4BXXH 1YNXA 1TWFH 1E1TA 5IP7H 2VZAA 3G48A 1VQJA 1TWCH 1VS0A 1SMXA 2LXKA 1Q82C 1IBML 3CC4A 3PUVA 4O2DA 2VW9A 4BBRG 1GVPA 3CPFA 2QGQA 3MEFA 1DGSA 4QQBX 2Z6KA 1VQFA 4LF7Q 5DLQE 2AKWB 1YJWA 1PH8A 1WCMG 1A62A 1JT8A 4JI8Q 2NZHA 2HIVA 1LYLA 2I5LX 3I2ZA 4PMWA 4GS3A 3RN5A 1XJVA 4B3TQ 2JA6G 4P73A 4GKJL 2HQLA 4A3LH 1QUQB 1WFQA 4X64L 1HR0L 1MIUA 1UE6A 1UWVA 2JA5H 3S2DH 3CAMA 4DK3C 1VQHA 4NPSA 3TQYA 4IOAA 3AYHB 1A8VA 4NXNL 1IBMQ 1K83H 3I55A 3KJPA 3HOYG 4QL5A 3CC2A 2ZM6L 4DR5L 4POGA 1TWGH 1KRSA 3I4MG 1OXUA 2CWAA 1E7ZA 3K8AA 3EIVA 3OYYA 1CSPA 3PUYA 2E2IH 4KLKA 1GD7A 2OQ0A 2AHOB 4PZ6A 1HZBA 5J3BA 3CCLA 1SE8A 2PNHA 2RF4A 3E0EA 4YWKA 3J81i 4GKJQ 1MKHA 1VQIA 2FXQA 1HR0Q 4X64Q 1IBKL 1KXLA 3CQZH 4B3ML 2ZJRA 1E1OA 4P72A 4IOCA 1WJJA 4JI0L 3GDEA 4NXNQ 1X54A 3AFQA 1IYJB 1Z47A 2ID0A 3M4PA 4R4IA 3T1YL 3HOWH 2ZM6Q 4ALPA 1VQCA 4DR5Q 5FLMH 4IFDI 4OO1G 3CMEA 3PO3G 1VQKA 3UE0A 4JI7L 3PO2G 1X3EA 1M1KC 3GO5A 1KAWA 2N8NA 2CCZA 3RZOH 2E8GA 2E2HH 4DR3L 3M4QA 2LXJA 2Y0SG 3PUXA 4JI2L 4KHPL 3U50C 2R92H 1PH3A 5GADC 1TWHH 2N49A 4BY1G 5M3FH 1FJGQ 2K52A 1IBKQ 1EUJA 1JE5A 4YHHL 5C0XJ 1LM0A 3CC7A 4B3MQ 3RR5A 4JI3L 5EAYA 1GM5A 4A3BG 4BBSG 3RN2A 4A4IA 1JMCA 4JI0Q 4GNXC 1CKNA 1EOVA 3CMAA 3T1YQ 2B29A 3M7NA 3CCMA 4A3GG 2OWOA 4JOIA 1CKMA 3H0GH 4DAYB 4JI7Q 3U4VA 4X62L 2VQFL 3M85A 1YHBA 1UE5A 4X6AH 3L7ZC 4DR3Q 1EQRA 2NVXH 1Q1BA 2MFIA 1B7YB 1UE1A 4JI2Q 5C3EG 4JBJA 3HOZH 4A93H 4KHZA 4KHPQ 2ZJPA 1Q8KA 5C4XH 1VCIA 2HIXA 5FJ8G 5IE8A 4BY7G 4B3RL 4GKKL 4GNXB 3HKZG 1Z9FA 2IX0A 2QA4A 2MO0A 4C2MH 2NVYH 4YHHQ 1N8RC 3F2DA 1X55A 1HZAA 1PYSB 1YBYA 1PH5A 4JI3Q 1S40A 2JA7H 1GKHA 2K50A 4DR6L 1WOCA 5IYCG 1ASYA 3K7AH 2R7ZH 1N9WA 4AIMA 3TS2A 3L0OA 2PQAA 1KD1C 1N36L 1E22A 2CFMA 2JA9A 4A3JG 4J15A 5C0XI 3I7FA 4X62Q 2VQFQ 2KCMA 2ASBA 2AWOA 1IXRA 1UEBA 1OTCA 1VQEA 2CWPA 4MZ9A 5GAEC 3J81j 3PF5A 2UUCL 3E9HA 4A3KH 1VQ5A 4B3RQ 1EIFA 3S14H 5M3MG 4GKKQ 3E9IA 3HOXH 2BA0A 3FKIH 3IRBA 3TEHB 2N3SA 2RHQB 2PMZE 3I4NH 4OONA 4DR6Q 3F8TA 3OTOL 1KRTA 1R9TH 4RMFA 4X66L 4R4OA 1NMFA 4R4QA 1N36Q 1E24A 1XNRL 2VY3A 4AQYL 3UDXA 2VUMG 1L2FA 1VQ4A 3AQQA 3S17H 2XGTA 1AE2A 4JC0A 4L5QA 2JE6I 2ZJQA 1SLJA 4LNQA 1J6QA 1HJPA 4DPGA 2UUAQ 2NZOA 1NMGA 2Q2UA 2UUCQ 5IYBG 1K9MC 1Y1WG 3KDFA 1Q46A 2AWNA 1AH9A 1U0LA 5E7NA 1PHJA 3B6YA 2CKZB 4LW1A 2VQEL 3S15H 3S16H 2R7DA 2ZTDA 5AJ3L 3BZKA 2JQOA 3OTOQ 1ASZA 2ATWA 4OO1I 1C7YA 4X66Q 1XTDA 1EQQA 4AYBE 3F2BA 1VQMA 5IWAL 1J5EL 2B63G 1XNRQ 5JJKA 1QVCA 2K5VA 5GAGC 4A3EH 1PV4A 4AQYQ 5K36G 5BR8Q 4OWWB 4BXXG 1SRUA 2UUBL 5C0XG 1YZ6A 5IP7G 3GTJH 1OXVA 3GTQH 3H3VI 4GLVB 2IY5B 2QEXA 1PH6A 5IP9G 3K81C 1CUKA 1W2BA 2YU9H 4DKAC 3CPWA 1S3OA 4LF5L 2K75A 4DV0L 2YTXA 5GQOA 3STBC 2VQEQ 5AJ3Q 4IPGA 3BZCA 3PIOA 2Z6KC 1I50H 1WCMH 4XIGS 1V9PA 5JJLA 5IWAQ 1J5EQ 5JJIA 4IJLA 1SN8A 4R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L G;  4JBW A;  3PIP A;  3GTG H;  4DV7 L;  1MJC A;  1TXY A;  2UUB Q;  1WI5 A;  3SGI A;  2I5M X;  2JK8 A;  4H02 A;  3TS0 A;  3U58 A;  3KFU A;  1SFO H;  2K14 A;  1LUZ A;  1BVS A;  3HOY H;  3TRE A;  1Q81 C;  2I0Q A;  4LF5 Q;  1V43 A;  4DV0 Q;  1Q7Y C;  3DLL A;  4UP9 A;  1JJ2 A;  3JAM i;  3A0J A;  1X9N A;  2D0P A;  2JA8 H;  2VL6 A;  5C44 G;  4DAM A;  3NBH B;  3I4O A;  2L15 A;  4A3C H;  1N34 L;  1PH7 A;  5M5Y H;  3GTP H;  3ICE A;  2GVB A;  4DV7 Q;  3A5U A;  3W5O A;  4DV1 L;  3S1R H;  3PV0 A;  4MNO A;  1I6H H;  2EIF A;  2C35 B;  4POF A;  2RHS B;  2A8V A;  4JI6 L;  3HOW G;  1HNW L;  3KF6 A;  3STB D;  1XPR A;  4O0A A;  3PO3 H;  4LF4 L;  1K8G A;  1EYG A;  4IFD J;  1X3F A;  4JBM A;  3FP9 A;  3MXN B;  2R92 G;  2R6G A;  3W1B A;  3G6E A;  4NB3 A;  3CF5 A;  4HIK A;  5IYD H;  4BY1 H;  1TWA H;  3K7U C;  3F1Z A;  1I5F A;  3H15 A;  1YI2 A;  1XPO A;  2OTL A;  4LFC L;  1BKB A;  4DV1 Q;  1QZH A;  2K5H A;  3JAM c;  2R93 H;  4YY3 L;  5M5X H;  2D0O A;  3TRZ A;  1G6P A;  4GN5 A;  1HNW Q;  4UP8 A;  1YIJ A;  3S24 A;  3BU2 A;  3H0G G;  1VQO A;  1FL0 A;  2R7F A;  2YTY A;  4LUZ A;  5M5W H;  2KBN A;  1KL9 A;  1YHA A;  2A1A A;  4DV6 L;  4DUZ L;  4JOI C;  4BA2 I;  2WAQ E;  4B3S L;  1X6O A;  5ELO A;  1HNX L;  2EXD A;  1Y1V G;  2KCT A;  1PH1 A;  4OWT B;  3U4Z A;  3OW2 A;  2BH8 A;  3J7Z C;  2IHE A;  1NJI C;  3FHW A;  3BJU A;  3EBE A;  2JEB I;  1O7I A;  4YCV A;  5H1S E;  4BY7 H;  1HZC A;  1BBW A;  2JEA I;  3PF4 A;  1HR0 W;  1WYD A;  3UDI A;  4HIM A;  2WP8 J;  1A0I A;  4DV3 L;  4A3I G;  4LFC Q;  3PGZ A;  1CKN B;  2GN5 A;  4YY3 Q;  2KEN A;  2YTV A;  4YCW A;  1RL2 A;  3VDY A;  1VQ6 A;  2A19 A;  4DR4 L;  3EN2 A;  1A63 A;  2VNU D;  4DV4 L;  5C4J H;  2WB1 G;  4DV6 Q;  1PA6 A;  1HH2 P;  4DUZ Q;  1VQN A;  4B3S Q;  1HNX Q;  1N32 Q;  3NEM A;  3S1Q H;  1YIT A;  3HOU H;  4IPC A;  2Q2I A;  4YWM A;  3CCV A;  5HGQ A;  2RCN A;  3K0X A;  5LMN W;  3ULJ A;  4QY7 A;  1G51 A;  4A3F H;  5M3M H;  2WB1 E;  3CXC A;  4A3D H;  3FKI G;  4GOP A;  2XTI A;  4P74 A;  4C3H H;  4DV3 Q;  1I94 L;  4QIW E;  3PSI A;  1K8A C;  3KYH C;  3CCR A;  4IO9 A;  2PQA B;  2MO1 A;  4DNI A;  3GTO H;  1K3R A;  4AYB G;  2HT1 A;  1BBU A;  4DR4 Q;  4DV4 Q;  2IT1 A;  1AE3 A;  3D31 A;  1HZ9 A;  1Q12 A;  2VUM H;  1KHI A;  4WJ4 A;  2ALY B;  1E3P A;  2ZTC A;  1X56 A;  4UY8 C;  4C3I H;  4A75 A;  1IZ6 A;  4ME3 A;  3RNU A;  2E2J H;  5IYB H;  1X65 A;  1Y1W H;  4XTC S;  4APV A;  4OXP A;  4OWX B;  4L5T A;  1I94 Q;  3RLF A;  1QUQ A;  4A3M G;  5GRO A;  1KIX A;  3GTK H;  1K0R A;  4IFD G;  2F4V L;  4JI1 L;  2UU9 L;  4QJF A;  1VQB A;  3UDG A;  2B63 H;  4WJ3 M;  3CCE A;  4TQU S;  2Q2H A;  4HJ9 A;  4BBR H;  2BH2 A;  1VQA A;  2F3I A;  3HKS A;  4R4T A;  4C3J H;  1I3Q H;  3KF8 B;  2KHI A;  3L2P A;  1NY4 A;  4HJ7 A;  1P16 A;  3KJO A;  4UPA A;  1JJG A;  3HFZ B;  3KDF B;  4DV5 L;  5IP9 H;  1IL2 A;  4FDB A;  2JA6 H;  1EWI A;  1SRO A;  4LWC A;  1YHQ A;  1S72 A;  4GLX A;  1Q86 C;  2JA5 G;  3PUZ A;  2IX1 A;  2YYZ A;  3RLO A;  2I5H A;  1L1O A;  2K5N A;  4JI1 Q;  2UU9 Q;  2AMC B;  2F4V Q;  3PCO B;  4EX5 A;  4GN3 B;  1VQ7 A;  2UXC L;  1B8A A;  4A3J H;  2LSS A;  1VQL A;  3I4M H;  1C9O A;  1L1O C;  1JB7 A;  3S1N H;  2WFW A;  3NEL A;  1U5K A;  3I56 A;  4P71 A;  4JI5 L;  1YVC A;  3M4O H;  4AH6 A;  3RLN A;  4DV5 Q;  1K73 C;  4DUY L;  4QGU A;  4K0K L;  5IY0 A;  3G71 A;  2ZTE A;  4PZ7 A;  5LMU L;  3M9B A;  4DR2 L;  4JCV E;  4YCU A;  4LUO A;  2JA8 G;  2NVQ H;  1OXX K;  1PVO A;  2NN6 I;  5C44 H;  3GD7 A;  3J80 i;  4A76 A;  3CW2 C;  4JYA L;  5LMN L;  1PH9 A;  3GTM H;  4JI4 L;  1L1O B;  4A3C G;  3ULP A;  3A5Z B;  4R1J A;  2UXC Q;  5FLM G;  4Y7N H;  2VS1 A;  2OQK A;  1FJG L;  2DUD A;  2UXD L;  5GAH C;  3PO2 H;  1H95 A;  4KI0 A;  3S2H H;  1N32 L;  1X3G A;  1NTG A;  1VQP A;  1XMO L;  4JI5 Q;  3WWV A;  1MJE A;  3S1M H;  4DUY Q;  4K0K Q;  1OXS C;  1N34 Q;  5LMU Q;  4IPD A;  1GO3 E;  4HJA A;  3CCJ A;  5M3F G;  4DR2 Q;  2KHJ A;  4LF8 L;  3H3V H;  4GNX A;  1FVI A;  2UXB L;  3A74 A;  1KC8 C;  3CCQ A;  4GN4 B;  2WAQ G;  4OX9 L;  4A3B H;  4BBS H;  3UE1 A;  1EFW A;  4JYA Q;  5LMN Q;  1D8L A;  4Y52 H;  1QVG A;  3CP0 A;  3ZJY C;  4JI4 Q;  1VQD A;  3AEV A;  4DR7 L;  4JI6 Q;  4A3G H;  3Q8D A;  2ES2 A;  1YEZ A;  5IYD G;  1PH4 A;  2UXD Q;  4LF4 Q;  1PFS A;  1QZG A;  3KLW A;  4LF9 L;  4JV5 L;  1CSQ A;  1SR3 A;  4JG2 A;  4PG3 A;  1XMO Q;  5JEA G;  2Y0S E;  2HHH L;  2MQH A;  1L0W A;  5C3E H;  3HOZ G;  4A93 G;  3K80 C;  2R93 G;  5C4X G;  4PZ8 A;  3KF6 B;  2Z0S A;  3J80 c;  2BA1 A;  3KOJ A;  5FJ8 H;  2CQO A;  4L5S A;  4IJH A;  4LF8 Q;  3HOV G;  1G29 1;  1V1Q A;  2UXB Q;  3J81 c;  1B70 B;  4DR1 L;  2JA7 G;  3CD6 A;  4OX9 Q;  3JC6 6;  1LTL A;  5FLX c;  3G4S A;  2N78 A;  3AFP A;  3UDF A;  1Y1V H;  1RIP A;  1NE3 A;  1VQG A;  2V1C C;  5IYC H;  4HJ8 A;  2R7Z G;  1FGU A;  4DR7 Q;  1PH2 A;  3M3Y H;  2GVA A;  2NN6 G;  1XPU A;  3T1H L;  2IHF A;  1IBL L;  1P8L A;  4UP7 A;  1N33 L;  4LF9 Q;  4JV5 Q;  2JJQ A;  2E5L L;  4A3I H;  4BA1 I;  4P75 A;  2HHH Q;  1JJC B;  3LGJ A;  4JBK A;  3ULL A;  1XMQ L;  4LF6 L;  1HNZ L;  4MTN A;  2B3G A;  3ER0 A;  3W1G A;  4LFA L;  4LUV A;  1C0A A;  4A3K G;  3CCS A;  2H5X A;  3HKZ E;  3HOX G;  3RZD H;  4DR1 Q;  2D62 A;  3F2C A;  4LFB L;  1Q1E A;  1UE7 A;  3I4N G;  1YJ9 A;  2F52 A;  2EQS A;  4IPH A;  3HOU G;  5ELN A;  1M90 C;  2UUA L;  4NXM L;  5IT9 c;  3ERS X;  4GLA C;  4EQ5 A;  4RG1 A;  4A3F G;  3J7A 5;  3CCU A;  2K4K A;  4HID A;  3T1H Q;  4X65 L;  1IBL Q;  3HOV H;  4A3D G;  1N33 Q;  1QVF A;  2E5L Q;  1XNQ L;  4DV2 L;  3PUW A;  4GOP C;  3D0F A;  1XMQ Q;  4LF6 Q;  1HNZ Q;  4LFA Q;  1Y14 B;  1PYB A;  1D7Q A;  4HIO A;  4TVA B;  1YJN A;  2OTJ A;  2Q2T A;  5HY6 A;  5JEA J;  4DK6 C;  5BR8 L;  4LFB Q;  4YWL A;  2MNA A;  4LF7 L;  2PI2 A;  1CKO A;  3DM3 A;  4NXM Q;  1EIY B;  1NBW A;  2PI2 E;  4JI8 L;  1OXT A;  4HJ5 A;  4A3E G;  2OCE A;  1KQS A;  1W3S A;  4X65 Q;  4GOP B;  1VQ8 A;  4B3T L;  3NEN A;  1VQ9 A;  2DGY A;  2YV5 A;  3GTL H;  4L5R C;  1T9H A;  1XNQ Q;  4DV2 Q;  2NVT H;  4A3M H;  4BXX H;  1YNX A;  1TWF H;  1E1T A;  5IP7 H;  2VZA A;  3G48 A;  1VQJ A;  1TWC H;  1VS0 A;  1SMX A;  2LXK A;  1Q82 C;  1IBM L;  3CC4 A;  3PUV A;  4O2D A;  2VW9 A;  4BBR G;  1GVP A;  3CPF A;  2QGQ A;  3MEF A;  1DGS A;  4QQB X;  2Z6K A;  1VQF A;  4LF7 Q;  5DLQ E;  2AKW B;  1YJW A;  1PH8 A;  1WCM G;  1A62 A;  1JT8 A;  4JI8 Q;  2NZH A;  2HIV A;  1LYL A;  2I5L X;  3I2Z A;  4PMW A;  4GS3 A;  3RN5 A;  1XJV A;  4B3T Q;  2JA6 G;  4P73 A;  4GKJ L;  2HQL A;  4A3L H;  1QUQ B;  1WFQ A;  4X64 L;  1HR0 L;  1MIU A;  1UE6 A;  1UWV A;  2JA5 H;  3S2D H;  3CAM A;  4DK3 C;  1VQH A;  4NPS A;  3TQY A;  4IOA A;  3AYH B;  1A8V A;  4NXN L;  1IBM Q;  1K83 H;  3I55 A;  3KJP A;  3HOY G;  4QL5 A;  3CC2 A;  2ZM6 L;  4DR5 L;  4POG A;  1TWG H;  1KRS A;  3I4M G;  1OXU A;  2CWA A;  1E7Z A;  3K8A A;  3EIV A;  3OYY A;  1CSP A;  3PUY A;  2E2I H;  4KLK A;  1GD7 A;  2OQ0 A;  2AHO B;  4PZ6 A;  1HZB A;  5J3B A;  3CCL A;  1SE8 A;  2PNH A;  2RF4 A;  3E0E A;  4YWK A;  3J81 i;  4GKJ Q;  1MKH A;  1VQI A;  2FXQ A;  1HR0 Q;  4X64 Q;  1IBK L;  1KXL A;  3CQZ H;  4B3M L;  2ZJR A;  1E1O A;  4P72 A;  4IOC A;  1WJJ A;  4JI0 L;  3GDE A;  4NXN Q;  1X54 A;  3AFQ A;  1IYJ B;  1Z47 A;  2ID0 A;  3M4P A;  4R4I A;  3T1Y L;  3HOW H;  2ZM6 Q;  4ALP A;  1VQC A;  4DR5 Q;  5FLM H;  4IFD I;  4OO1 G;  3CME A;  3PO3 G;  1VQK A;  3UE0 A;  4JI7 L;  3PO2 G;  1X3E A;  1M1K C;  3GO5 A;  1KAW A;  2N8N A;  2CCZ A;  3RZO H;  2E8G A;  2E2H H;  4DR3 L;  3M4Q A;  2LXJ A;  2Y0S G;  3PUX A;  4JI2 L;  4KHP L;  3U50 C;  2R92 H;  1PH3 A;  5GAD C;  1TWH H;  2N49 A;  4BY1 G;  5M3F H;  1FJG Q;  2K52 A;  1IBK Q;  1EUJ A;  1JE5 A;  4YHH L;  5C0X J;  1LM0 A;  3CC7 A;  4B3M Q;  3RR5 A;  4JI3 L;  5EAY A;  1GM5 A;  4A3B G;  4BBS G;  3RN2 A;  4A4I A;  1JMC A;  4JI0 Q;  4GNX C;  1CKN A;  1EOV A;  3CMA A;  3T1Y Q;  2B29 A;  3M7N A;  3CCM A;  4A3G G;  2OWO A;  4JOI A;  1CKM A;  3H0G H;  4DAY B;  4JI7 Q;  3U4V A;  4X62 L;  2VQF L;  3M85 A;  1YHB A;  1UE5 A;  4X6A H;  3L7Z C;  4DR3 Q;  1EQR A;  2NVX H;  1Q1B A;  2MFI A;  1B7Y B;  1UE1 A;  4JI2 Q;  5C3E G;  4JBJ A;  3HOZ H;  4A93 H;  4KHZ A;  4KHP Q;  2ZJP A;  1Q8K A;  5C4X H;  1VCI A;  2HIX A;  5FJ8 G;  5IE8 A;  4BY7 G;  4B3R L;  4GKK L;  4GNX B;  3HKZ G;  1Z9F A;  2IX0 A;  2QA4 A;  2MO0 A;  4C2M H;  2NVY H;  4YHH Q;  1N8R C;  3F2D A;  1X55 A;  1HZA A;  1PYS B;  1YBY A;  1PH5 A;  4JI3 Q;  1S40 A;  2JA7 H;  1GKH A;  2K50 A;  4DR6 L;  1WOC A;  5IYC G;  1ASY A;  3K7A H;  2R7Z H;  1N9W A;  4AIM A;  3TS2 A;  3L0O A;  2PQA A;  1KD1 C;  1N36 L;  1E22 A;  2CFM A;  2JA9 A;  4A3J G;  4J15 A;  5C0X I;  3I7F A;  4X62 Q;  2VQF Q;  2KCM A;  2ASB A;  2AWO A;  1IXR A;  1UEB A;  1OTC A;  1VQE A;  2CWP A;  4MZ9 A;  5GAE C;  3J81 j;  3PF5 A;  2UUC L;  3E9H A;  4A3K H;  1VQ5 A;  4B3R Q;  1EIF A;  3S14 H;  5M3M G;  4GKK Q;  3E9I A;  3HOX H;  2BA0 A;  3FKI H;  3IRB A;  3TEH B;  2N3S A;  2RHQ B;  2PMZ E;  3I4N H;  4OON A;  4DR6 Q;  3F8T A;  3OTO L;  1KRT A;  1R9T H;  4RMF A;  4X66 L;  4R4O A;  1NMF A;  4R4Q A;  1N36 Q;  1E24 A;  1XNR L;  2VY3 A;  4AQY L;  3UDX A;  2VUM G;  1L2F A;  1VQ4 A;  3AQQ A;  3S17 H;  2XGT A;  1AE2 A;  4JC0 A;  4L5Q A;  2JE6 I;  2ZJQ A;  1SLJ A;  4LNQ A;  1J6Q A;  1HJP A;  4DPG A;  2UUA Q;  2NZO A;  1NMG A;  2Q2U A;  2UUC Q;  5IYB G;  1K9M C;  1Y1W G;  3KDF A;  1Q46 A;  2AWN A;  1AH9 A;  1U0L A;  5E7N A;  1PHJ A;  3B6Y A;  2CKZ B;  4LW1 A;  2VQE L;  3S15 H;  3S16 H;  2R7D A;  2ZTD A;  5AJ3 L;  3BZK A;  2JQO A;  3OTO Q;  1ASZ A;  2ATW A;  4OO1 I;  1C7Y A;  4X66 Q;  1XTD A;  1EQQ A;  4AYB E;  3F2B A;  1VQM A;  5IWA L;  1J5E L;  2B63 G;  1XNR Q;  5JJK A;  1QVC A;  2K5V A;  5GAG C;  4A3E H;  1PV4 A;  4AQY Q;  5K36 G;  5BR8 Q;  4OWW B;  4BXX G;  1SRU A;  2UUB L;  5C0X G;  1YZ6 A;  5IP7 G;  3GTJ H;  1OXV A;  3GTQ H;  3H3V I;  4GLV B;  2IY5 B;  2QEX A;  1PH6 A;  5IP9 G;  3K81 C;  1CUK A;  1W2B A;  2YU9 H;  4DKA C;  3CPW A;  1S3O A;  4LF5 L;  2K75 A;  4DV0 L;  2YTX A;  5GQO A;  3STB C;  2VQE Q;  5AJ3 Q;  4IPG A;  3BZC A;  3PIO A;  2Z6K C;  1I50 H;  1WCM H;  4XIG S;  1V9P A;  5JJL A;  5IWA Q;  1J5E Q;  5JJI A;  4IJL A;  1SN8 A;  4R4C A; 
#chains in the Genus database with same CATH topology
 3IAY A;  3NHH A;  2A73 B;  1TXY A;  2UUB Q;  1WI5 A;  1H9R A;  2I5M X;  2JK8 A;  3U58 A;  1Y1W B;  1SNO A;  2K14 A;  1Q81 C;  1BBX C;  4LF5 Q;  1V43 A;  3DLL A;  4RCO A;  1X9N A;  2PQE A;  2VL6 A;  1B9N A;  3RMH A;  4ZAI A;  2L15 A;  1WTO A;  4A3M B;  5JVG 3;  2GVB A;  3OW7 A;  2EXZ A;  5JAV A;  3A5U A;  3D4R A;  4DV1 L;  1B50 A;  1ET9 A;  2C35 B;  5EPL A;  4Z9C B;  1F9P A;  4XXE A;  4LF4 L;  3ITP A;  1GUT A;  3LWU A;  2B8F A;  1EYG A;  2KOL A;  5K5P A;  3J81 E;  4HSP A;  2CHB D;  2KCN A;  2R6G A;  3W1B A;  2JA5 B;  2EYF A;  4FF2 A;  5FLX E;  1EY4 A;  2ZXO A;  1BR9 A;  3F1Z A;  3P1H A;  1XPO A;  3GV3 A;  4WOR A;  3A7L A;  2R93 H;  2D0O A;  2L5T A;  1HNW Q;  4J8Q A;  3BU2 A;  3H0G G;  4G57 A;  2R7F A;  3HOV H;  2YTY A;  1U4R A;  3H3V C;  1KL9 A;  4DV6 L;  2F0D A;  3IKJ A;  2WAQ E;  2JSO A;  1X6O A;  5ELO A;  1HA6 A;  2WKC A;  2IHE A;  2JEB I;  1AN8 A;  4HIM A;  3DEP A;  3HOW B;  2F0P A;  4YY3 Q;  1RL2 A;  3VDY A;  2BOS A;  2L0C A;  4DR4 L;  1O7Z A;  2B2W C;  4OIJ A;  1PA6 A;  1NCV A;  3NEM A;  1TWH B;  4IPC A;  2Q2I A;  3K57 A;  4YWM A;  3K0X A;  1GUN A;  1G51 A;  4A3F H;  3N52 A;  4A3D H;  3FKI G;  2XTI A;  4P74 A;  4C3H H;  1NUC A;  3C2P A;  2F3V A;  1TQO A;  2M2L A;  1QCB D;  4ILW A;  4DNI A;  3GTO H;  4AYB G;  2XSC A;  4MTK A;  1NR2 A;  2HT1 A;  4JW0 A;  3KLS A;  2IT1 A;  1ILP A;  4ME5 A;  1IYU A;  1HZ9 A;  1Q12 A;  1STE A;  4RGM A;  4F88 A;  3K58 A;  2VUM H;  1KTK A;  5ELD A;  4C2M B;  5ELC A;  4A75 A;  5IYB H;  1X65 A;  3QJY A;  2B2U A;  1Y1W H;  5A2Q E;  4XYQ A;  2R7Z B;  1QUQ A;  5GRO A;  4PNY A;  1ESR A;  2HUG A;  3GTK H;  1BCP C;  1K0R A;  1EL0 A;  4JI1 L;  1V1P B;  1JOR A;  3CCE A;  2BH2 A;  4L8J A;  3HG9 A;  3HKS A;  4HJ7 A;  2MHV A;  2OXP A;  1JJG A;  3HFZ B;  5AFW A;  1GUO A;  1BCP B;  1R9T B;  1I4R A;  2IWH A;  4LWC A;  2IW3 A;  5FKA C;  1H9K A;  4DAP A;  3PUZ A;  2IX1 A;  1PZI D;  2I5H A;  3MXG A;  2IJ0 A;  2AMC B;  3S17 B;  1SND A;  1F9R A;  2UXC L;  2LSS A;  1F9Q A;  3I4M H;  1JB7 A;  2A6E C;  2WFW A;  1TS4 A;  3NEL A;  1U5K A;  3ND9 A;  3M4O H;  1NSN S;  4KJN A;  3RLN A;  3T13 A;  4QGU A;  3S15 B;  3S16 B;  5IY0 A;  5LMU L;  2ZTE A;  3D8G A;  3M9B A;  5C5M A;  4JCV E;  4YCU A;  4LUO A;  2FMM A;  2NN6 I;  3Q22 A;  1C48 A;  4JYA L;  5LMN L;  1PH9 A;  1EY6 A;  4JI4 L;  2EJF C;  4A3C G;  1CK1 A;  5FLM G;  2VS1 A;  2G9D A;  2OQK A;  2F4I A;  1E2V A;  3NTI A;  4KI0 A;  3KBX A;  1Z7T A;  4CGY B;  2K5W A;  4KD4 A;  3WWV A;  4K0K Q;  1EFI D;  3D3R A;  2K5D A;  1CHP D;  1DCZ A;  3A55 A;  3H3V H;  4Q0F A;  4GNX A;  1SNQ A;  5FOB B;  3CCQ A;  4BBS H;  4A3B H;  3EFX D;  3V96 A;  1QVG A;  3GTG B;  3AEV A;  3Q23 A;  1PH4 A;  1CSQ A;  1HRJ A;  4PG3 A;  5JEA G;  3EQL C;  3K80 C;  4PZ8 A;  3CQZ B;  3J80 c;  2BA1 A;  4LF8 Q;  2F0H A;  1B70 B;  4K2K A;  2FMC A;  3JC6 6;  1J9O A;  5M5Y B;  4X3T A;  5HGT A;  1RIP A;  1CM9 A;  1FGU A;  2A68 D;  3M3Y H;  2GVA A;  1XPU A;  2E2H B;  3T1H L;  1VMC A;  2IHF A;  2F0Q A;  2JJQ A;  5E3F A;  1EY8 A;  5M3F B;  1JJC B;  4JBK A;  3ULL A;  5TSS A;  3TDQ A;  4OGQ C;  3ER0 A;  4LFA L;  1EY9 A;  3OIQ A;  4LUV A;  2SNM A;  4K5V A;  4DR1 Q;  4ZRZ A;  2LY7 A;  3F2C A;  4RFB A;  1MI2 A;  1SNP A;  3I4N G;  4ZUJ A;  1D5Z C;  5IGB A;  5IT9 c;  3ERS X;  4EQ5 A;  3J7A 5;  2KVM A;  1CA5 A;  5I2X A;  3QO2 A;  2E5L Q;  2KCC A;  3PUW A;  1Q90 A;  3D0F A;  1XMQ Q;  1O7Y A;  2F0G A;  5HUR A;  2JA7 B;  2DY8 A;  2LMC B;  4TVA B;  5JEA J;  3AB9 A;  5BR8 L;  1H9S B;  1JC7 A;  2MNA A;  2ENB A;  2RA4 A;  3TN2 A;  2Q8R E;  4NXM Q;  3I4L A;  4A3E G;  1N32 L;  2OCE A;  1W3S A;  1SXT A;  1XTC D;  3OHX C;  1XNQ Q;  4DV2 Q;  1YNX A;  4KHV A;  1PYW D;  1VS0 A;  1Q82 C;  1SMX A;  4M1U B;  4RGN A;  4CJ2 C;  1T5E A;  1A2U A;  1EZ8 A;  3MEF A;  4QQB X;  4IUU A;  3OWF A;  3J7Y W;  2Z6K A;  1Y69 U;  1AZP A;  1VQF A;  5BN3 A;  1YJW A;  2XWB B;  4R8N A;  1AEX A;  4NMZ A;  1JT8 A;  2HIV A;  4PMW A;  1XJV A;  1S5B D;  2HQL A;  2NB0 A;  1MIU A;  1UE6 A;  2P5Z X;  3VA7 A;  3I70 A;  1WTH A;  1ZXT A;  5NUC A;  1JIC A;  4K14 A;  4QL5 A;  3CC2 A;  2BCO A;  1D1K A;  2BDO A;  5ELB A;  2ZM6 L;  3S9W A;  2RDF A;  1KRS A;  1E7Z A;  3K8A A;  2E2J B;  3PUY A;  1CSP A;  3DM1 A;  5KNB A;  5ISR A;  1GD7 A;  2OQ0 A;  4PZ6 A;  1HZB A;  1STY A;  2RF4 A;  2LKV A;  2E74 C;  1VQI A;  1IBK L;  3CQZ H;  2KA7 A;  2XWJ B;  1LTR D;  4XT1 B;  4BBR B;  3Q24 A;  4JI0 L;  1Z47 A;  3M4P A;  1VQC A;  1VQK A;  1ICF B;  3PO2 G;  1H9M A;  1X3E A;  1KAW A;  2E2H H;  2Y0S G;  3NQI A;  2E75 C;  3NWS A;  3DEO A;  5M3F H;  1AP0 A;  3A8I E;  3QG1 A;  4YHH L;  5C0X J;  1U4L A;  2AUJ D;  4B3M Q;  3BYY B;  1JMC A;  1II3 A;  1I4G A;  1HA5 A;  1EOV A;  5COR A;  3SK6 A;  4IUP A;  3H0G H;  4JI7 Q;  2K04 A;  3M85 A;  1EQR A;  1Q1B A;  2MFI A;  1B7Y B;  4KHP Q;  4L6T B;  2ZJP A;  1Q8K A;  1VCI A;  5FJ8 G;  1F2Y A;  3S1R B;  3HKZ G;  2IX0 A;  2MO0 A;  1N8R C;  4IUR A;  1YBY A;  2JA7 H;  1SYC A;  2RDG A;  4Y7N B;  2RDH A;  1F2L A;  5C6A A;  1JCK B;  4AIM A;  3VR6 A;  4J15 A;  5C0X I;  3S1M B;  4HAE A;  4K6D A;  1S4Z A;  2K05 A;  3D4D A;  1VQE A;  2ICI A;  4N8F A;  2CWP A;  4BY1 B;  4A3K H;  2EY6 A;  1EIF A;  3R8B A;  3E9I A;  2BA0 A;  3FKI H;  3IRB A;  4C3H G;  2RQX A;  2N3S A;  5E4X A;  1JB3 A;  2K5Q A;  4DR6 Q;  3F8T A;  2F0K A;  1MD2 D;  1B44 D;  4V19 0;  1E24 A;  3UDX A;  2VUM G;  2QEJ C;  4JC0 A;  4L5Q A;  3VYR A;  4LNQ A;  4DPG A;  2NZO A;  4UDU C;  5IYB G;  2Z9H A;  4XYO A;  5FO7 B;  1EIG A;  3URY A;  1Y1W G;  2AWN A;  1Y1V B;  3B6Y A;  2EVB A;  4HMJ A;  5ELE A;  2R7D A;  5AJ3 L;  3OTO Q;  2F0I A;  2ATW A;  1C7Y A;  3TSS A;  3CU7 A;  4DU9 A;  1LT4 D;  3O13 A;  4AYB E;  1VQM A;  1QNU A;  2PMZ B;  4A3I B;  1PV4 A;  4AQY Q;  1SE4 A;  3T4A C;  1F9S A;  4BXX G;  1YZ6 A;  1CUK A;  3OMG A;  4DV0 L;  2MUY A;  1JOK A;  1ENF A;  4IPG A;  1MGS A;  4HN7 A;  5IWA Q;  4IJL A;  2K28 A;  4IUN A;  1SN8 A;  1SNC A;  2EDG A;  2LS0 1;  4NKL A;  2RBM A;  4H02 A;  1SFO H;  2LFN A;  1LUZ A;  1BVS A;  3TRE A;  1B2T A;  1M4V A;  5JPM C;  5E4W C;  5CC4 A;  2K03 A;  5KEE A;  4DAM A;  3NBH B;  4FYD A;  4ZYS A;  4A3C H;  1PH7 A;  3AU7 A;  3QOL A;  2SDF A;  4C1N I;  1TWC B;  5D3D A;  1HUN A;  3S1R H;  3OPO A;  4POF A;  2A8V A;  3HOW G;  2L1B A;  3STB D;  3FVQ A;  5C4H A;  1XPR A;  1Q8I A;  4XT3 B;  3J80 E;  4ZQ3 A;  4IFD J;  4UAI A;  1I6V C;  3FP9 A;  4NB3 A;  3NE5 B;  4HIK A;  1LTS D;  1ZKO A;  3R2I A;  4BY1 H;  3H15 A;  1YI2 A;  1K83 B;  4LFC L;  4DV1 Q;  1DON A;  5JEA H;  3HZX A;  1Y8N B;  1W6J A;  5M5X H;  2KQ3 A;  4UP8 A;  4DGZ A;  1YIJ A;  3TP7 A;  5C44 B;  1VQO A;  1CQF A;  2A1A A;  3A8J E;  1LT5 D;  4JOI C;  4B3S L;  1HNX L;  2EXD A;  2EZV A;  1PH1 A;  1RTN A;  3U4Z A;  1NJI C;  3BJU A;  4YCV A;  5H1S E;  3NK9 A;  3PF4 A;  5KND A;  5IT9 E;  4IFD I;  4DV3 L;  4IUT A;  2GN5 A;  4MN3 A;  1HHV A;  3TP5 A;  2G9H D;  2VB2 X;  3K5M A;  2VNU D;  1FNU A;  4DV6 Q;  2R92 B;  5HGQ A;  1PRT D;  3VYS A;  1ROD A;  3ONA B;  5M3M H;  2MJ8 A;  2WB1 E;  2KED A;  3CXC A;  4GOP A;  1I94 L;  2BE5 C;  3PSI A;  1KNA A;  3KYH C;  3CCR A;  2MO1 A;  1FNV A;  1PTO D;  2F0U A;  4DR4 Q;  2EJG C;  2CH4 W;  2NVX B;  1AE3 A;  3D31 A;  2KUM A;  2QKI C;  5C4X B;  2ALY B;  1E3P A;  4ME3 A;  1X3Q A;  4XTC S;  4CKB A;  2J7Z A;  4OWX B;  3K7A B;  1LT6 D;  2RSO A;  2F4V L;  5C3X A;  1VQB A;  3UDG A;  4TQU S;  1QG7 A;  2RVL A;  2F1M A;  1EZ6 A;  2F3I A;  4R4T A;  4C3J H;  2KHI A;  4KN4 C;  5C0X H;  3S14 B;  5CGK A;  4UPA A;  3HOX B;  1PZJ D;  3MXP A;  2J0T D;  4GLX A;  2X69 A;  5A35 A;  2PZW A;  2XRS D;  1EQV A;  2YYZ A;  3RLO A;  3UI2 A;  1TKW B;  4JI1 Q;  4GN3 B;  1VQ7 A;  5G3L D;  3J7A V;  3D4W A;  1B8A A;  2DJF C;  1L1O C;  3E5S A;  4QMG A;  3I56 A;  3MTS A;  1YVC A;  4JI5 L;  3VYT A;  1B9M A;  4DUY L;  3G71 A;  1TWF B;  3PMF A;  1BDO A;  4IN3 A;  1AFP A;  1PVO A;  5C44 H;  2WKD A;  4A76 A;  1Z6H A;  1L1O B;  3QOJ A;  3A5Z B;  4QF4 A;  1MBY A;  2UXC Q;  5EPJ A;  2EYL A;  1FJG L;  2EYP A;  5GAH C;  3PO2 H;  4DAY A;  1H95 A;  3S2H H;  1M8A A;  1XMO L;  1NTG A;  3QIA A;  1N34 Q;  3JAM L;  1HFN A;  5CYU A;  5LMU Q;  1GO3 E;  4HJA A;  5M3F G;  2KHJ A;  2QF7 A;  1FVI A;  2UXB L;  4OX9 L;  1I4P A;  1I4X A;  2NTS A;  3BS1 A;  2CVR A;  4JYA Q;  5LMN Q;  1D8L A;  4Y52 H;  3CP0 A;  3ZJY C;  4JI4 Q;  1VQD A;  4JI6 Q;  2SOB A;  1JWM D;  4RHS A;  4IQZ A;  2E2I B;  3NSW A;  1PFS A;  2L9H A;  3KLW A;  4LF9 L;  4JV5 L;  4PQX A;  1EY7 A;  3IL8 A;  4PV1 C;  2Y0S E;  2HHH L;  3TZU A;  3KF6 B;  2JA8 B;  2MPM A;  5FJ8 H;  4L5S A;  4G7O C;  3C1E A;  3CD6 A;  2JA7 G;  5I9P A;  2A6H C;  3UDF A;  1VQ8 A;  1EIH A;  5DAU A;  1VQG A;  1NE3 A;  3NTK A;  2NN6 G;  3RZO B;  1JWS D;  3OSO A;  1IBL L;  3DUZ A;  1P8L A;  1WD1 A;  3CRL C;  3M7G A;  4IZ8 A;  3LGJ A;  1BQQ T;  1B1Z A;  2K6A A;  4RH6 A;  4LF6 L;  1C0A A;  4I7A A;  1VDZ A;  4A3K G;  3HKZ E;  1BUV T;  1YNJ C;  1GXD C;  1UEA B;  4WRD A;  4LFB L;  1UE7 A;  1F2Z A;  2F52 A;  1EY5 A;  2UUA L;  1CFM A;  3NBI A;  3T1H Q;  4X65 L;  4K8I A;  5I4D A;  1GOZ A;  5M5W B;  4LFA Q;  1DOK A;  1PYB A;  2FJ2 A;  2E76 C;  3TP8 A;  2B2Y A;  2IPK D;  5HY6 A;  4YWL A;  1PFB A;  4BY7 B;  1CKO A;  3DM3 A;  1DYQ A;  1EOT A;  1VMP A;  4JI8 L;  1IW7 C;  2L4N A;  4B3T L;  1IKL A;  2YV5 A;  2F0L A;  2SNS A;  5KYL A;  4BXX H;  4A3M H;  3EA6 A;  1TWF H;  2DN8 A;  1TVX A;  3CC4 A;  4IFD H;  3DWP A;  3PUV A;  4O2D A;  4BBR G;  1GVP A;  3HOU B;  1D6E C;  5FO8 B;  2K32 A;  3EVQ A;  1PH8 A;  2A74 C;  1QJO A;  1N32 Q;  4G4K A;  4GKJ L;  1UWV A;  1ICW A;  4I65 A;  1C4Q A;  1QIL A;  2JA5 H;  1PLF A;  1JE4 A;  1CHQ D;  1D5X C;  1HTL D;  2XVS A;  3I55 A;  3KJP A;  2CWA A;  3EIV A;  2E2I H;  2AHO B;  5J3B A;  3CCL A;  2O5I C;  3E0E A;  4YWK A;  4OL7 A;  2B8G A;  3HGB A;  4N8X 1;  4IUV A;  2O2L D;  1E1O A;  3CHB D;  5IOC A;  4XQJ A;  1X54 A;  4WJW A;  5D14 A;  5CV9 A;  1I3Q B;  2ZM6 Q;  3HOW H;  2CH4 A;  3CME A;  2MP1 A;  3GO5 A;  1M1K C;  3RZO H;  4C56 C;  2JA6 B;  1D2B A;  4JI2 L;  3PUX A;  2E2D C;  5GAD C;  1TWH H;  4HED A;  5E1F A;  4RHR A;  4BY1 G;  4ZKC B;  1IBK Q;  1LM0 A;  3RR5 A;  1GM5 A;  3A54 A;  3I8Z A;  3J81 L;  3HOY B;  1SYE A;  4L63 B;  4JI0 Q;  3Q0A A;  2B29 A;  2JYO A;  5CBA E;  3CCM A;  3M7N A;  3S1N B;  3IFD A;  4ZKB B;  4KTA A;  3VR2 A;  4X62 L;  1L0X B;  1YHB A;  1UE5 A;  1DM0 B;  1F2M A;  1FD7 D;  4JBJ A;  3SK8 A;  4KHZ A;  2NVQ B;  5IE8 A;  5LL6 X;  3EJI A;  2QA4 A;  4C2M H;  1I6H B;  4YHH Q;  3VR4 A;  3F2D A;  1X55 A;  1HZA A;  2NUC A;  1GKH A;  3VYU A;  2HCC A;  1ASY A;  2R7Z H;  1N9W A;  3PO3 B;  2EY2 A;  3L0O A;  2B2W A;  5CBE E;  1N36 L;  3GV6 A;  2JA9 A;  1A3V A;  4HSV A;  4HCE A;  2XRQ D;  2ASB A;  4B9X A;  1IXR A;  1UEB A;  1HXY D;  2AQ2 B;  4H7B A;  2KEC A;  4MZ9 A;  5D65 A;  5GAE C;  2UUC L;  1VQ5 A;  2HQE A;  5M3M G;  1PFM A;  2RHQ B;  4A3G B;  4CJ0 B;  1GUW A;  1UNS A;  1R9T H;  4X66 L;  1NMF A;  3VA5 A;  1XNR L;  2EY1 A;  1V1P A;  5D3I B;  5C3E B;  1LTA D;  2HD3 A;  3SEB A;  3S17 H;  1KAB A;  2XGT A;  1AE2 A;  1XWE A;  2JE6 I;  2VXW A;  2Z4H A;  3W2D A;  5BN5 A;  5C4Z A;  1HJP A;  1Q46 A;  1U0L A;  1PHJ A;  3S15 H;  2VQE L;  3S16 H;  4YIJ A;  3BZK A;  4PMB A;  5A2Q L;  1EQQ A;  3F2B A;  2F0F A;  1J5E L;  1YNN C;  1EYD A;  1PRT F;  5GAG C;  2EOT A;  4C3J G;  4C1N K;  3KLS X;  1SRU A;  1HPC A;  5CV7 A;  5IGF A;  5C0X G;  2R3Z A;  1SYB A;  3T51 B;  1OXV A;  4Q5V A;  5EJW A;  2IY5 B;  2Z4I A;  2FIN B;  1PTO F;  3CPW A;  1S3O A;  2K75 A;  2YTX A;  3BVG A;  5GQO A;  3STB C;  1JOQ A;  3ND8 A;  5AJ3 Q;  3SE0 A;  4PMC A;  5IGE A;  2B2V C;  1QOH A;  4KY7 A;  2ZXP A;  3SK5 A;  1S5C D;  4R4C A;  4POG A;  5COY A;  3PIP A;  3SXH A;  3GTG H;  4X3S A;  4DV7 L;  1MJC A;  4AYB B;  4CDE C;  3SGI A;  3KFU A;  3TS0 A;  3HOY H;  1KAA A;  2I0Q A;  1CZG A;  4DV0 Q;  1Q7Y C;  4UP9 A;  1JJ2 A;  2WV6 D;  4H13 C;  3JAM i;  3A0J A;  3RD4 A;  2B63 B;  5C44 G;  4BWG B;  2FFK B;  3I4O A;  4UHV A;  4CJ1 B;  3GTL B;  5M5Y H;  2NVT B;  4F7X A;  2O5J C;  1STG A;  1HCZ A;  4DF7 A;  3ICE A;  1SE3 A;  2C9O A;  5JVH 3;  1BCP D;  3W5O A;  2WII B;  4MNO A;  2AQ3 B;  3TME A;  2DY7 A;  1I6H H;  3AMU A;  1A2T A;  3FPP A;  5G3L F;  3HRZ C;  3PO3 H;  1F77 A;  1LT3 D;  1EEF D;  1X32 A;  2Z8L A;  4A3J B;  3MXN B;  1DOM A;  2R92 G;  3S2D B;  1EWH A;  3CF5 A;  1PRT C;  3T53 B;  2AUK A;  2OTL A;  1BKB A;  3E3X A;  3MXU A;  1TWG B;  2K5H A;  3TRZ A;  1G6P A;  4N9T A;  4GN5 A;  5IOD A;  3S24 A;  3M4Y A;  1PTO C;  2A6E D;  2NTT A;  4QUC A;  4LUZ A;  3GTM B;  2KBN A;  1YHA A;  2I46 A;  4DUZ L;  3VR3 A;  1PRT B;  3V05 A;  5I2Y A;  3HEJ A;  4OWT B;  3Q6S A;  2BH8 A;  3J7Z C;  1JR0 D;  3C1F A;  3FHW A;  3EBE A;  2NN6 H;  4KKU A;  1O7I A;  1HZC A;  3BDC A;  4LFC Q;  3UDI A;  2WP8 J;  1CKN B;  1PTO B;  3FPU B;  2KEN A;  1A15 A;  2A19 A;  4DV4 L;  1WVL A;  3I72 A;  1HH2 P;  1A3T A;  4H44 C;  4B3S Q;  4KMU C;  1HNX Q;  1YIT A;  4H0L C;  1H9S A;  4DK1 A;  1JOO A;  3CCV A;  3DMU A;  2RCN A;  5LMN W;  1J8I A;  3ULJ A;  1A3U A;  4DV3 Q;  4QIW E;  1K8A C;  3HP3 A;  4IO9 A;  2PQA B;  2D9U A;  1ZYR D;  3OMC A;  2H1E A;  1LTB D;  1GHK A;  1KHI A;  3C3L A;  3KLR A;  2V4D A;  2ZTC A;  4UY8 C;  1DD2 A;  2NVY B;  1IZ6 A;  2E2J H;  5M9O A;  1I94 Q;  4A3M G;  4HMI A;  2B2T C;  2EYO A;  3DWA A;  1IHZ A;  2WB1 B;  5LL6 S;  4IFD G;  2UU9 L;  2B63 H;  2Q2H A;  4BBR H;  1E0B A;  1EYC A;  1VQA A;  1QE6 A;  1E2Z A;  3KF8 B;  4CDF C;  1NY4 A;  5FO9 B;  1P16 A;  2NZ1 D;  3KDF B;  4DV5 L;  2F0N A;  5IP9 H;  1IL2 A;  4FDB A;  1EWI A;  4OEM B;  3G6J B;  1S72 A;  1YHQ A;  3FMC A;  2JA5 G;  1NAP A;  3FEW X;  1O80 A;  2DJG C;  4TRD A;  2F4V Q;  2K5N A;  2OEO A;  4LMQ D;  1PFN A;  3NQT A;  3PCO B;  4A3J H;  3DWQ A;  1VQL A;  5C5L A;  1C9O A;  1BOS A;  4FXD A;  3T56 B;  4DA2 A;  5KRU A;  4P71 A;  2JN4 A;  4AH6 A;  4XQQ A;  1SAP A;  2F0V A;  4DR2 L;  1O78 A;  2JA8 G;  1OXX K;  4A3E B;  3GD7 A;  4KKT A;  1G2T A;  3GTM H;  3ERO A;  1TR5 A;  3D6W A;  4R1J A;  2C5C A;  4Y7N H;  3GP7 A;  1BXT A;  3GTJ B;  2UXD L;  4V0B A;  5J1Z A;  2YU9 B;  1EU3 A;  1SEB D;  1X3G A;  1VQP A;  4JI5 Q;  3R3O A;  3S1M H;  4DUY Q;  1R4P B;  2CW0 D;  4IPD A;  3CCJ A;  4J1M A;  1EWC A;  2RKS A;  3A74 A;  1KC8 C;  2RSN A;  4GN4 B;  3UE1 A;  4N9P A;  5BN4 A;  4DR7 L;  5EBD A;  2ES2 A;  4KK7 A;  1GUS A;  1U9R A;  2JP1 A;  5IYD G;  1WTV A;  4LF4 Q;  4JPB W;  4JG2 A;  2M00 A;  5DM6 3;  1XMO Q;  4K5X A;  1I4H A;  2Z0S A;  2CQO A;  4IJH A;  1V1Q A;  2UXB Q;  4OX9 Q;  1VF7 A;  2KEE A;  2N78 A;  3G4S A;  1Y1V H;  2R7Z G;  5C3W A;  1PH2 A;  2NYZ D;  4RKL A;  2HDM A;  1L0Y B;  4UP7 A;  1N33 L;  4LF9 Q;  4JV5 Q;  1V1O A;  4A3I H;  4BA1 I;  4P75 A;  2HHH Q;  2DNC A;  1HNZ L;  4MTN A;  3W1G A;  2EY5 A;  2WAQ B;  2H5X A;  2QW7 A;  3TP6 A;  2Y0S B;  4E6I A;  2D62 A;  1YJ9 A;  2EQS A;  3HOU G;  1XYI A;  1OO9 B;  1RHP A;  4RG1 A;  3CCU A;  2K4K A;  1IBL Q;  3HOZ B;  4FF1 A;  4A93 B;  2R93 B;  1KDB A;  1SDF A;  1QVF A;  3K0Y A;  5J39 A;  1CTM A;  1SNM A;  4LF6 Q;  3HOV B;  3WOE A;  1YJN A;  1NR4 A;  2HDL A;  4RCN A;  2Q2T A;  1W6K A;  4DK6 C;  4LFB Q;  4LF7 L;  2D5D A;  2PI2 A;  3PIP 3;  1EIY B;  2PI2 E;  4HJ5 A;  1KQS A;  2A69 D;  4X65 Q;  1RKN A;  3NEN A;  1VQ9 A;  3N6R A;  2DGY A;  2B2U C;  5EQ0 A;  3NXW A;  1SYF A;  1VQJ A;  1TWC H;  2LXK A;  2Z6B A;  1IBM L;  3NTH A;  3K6O A;  4DK0 A;  2VW9 A;  3CPF A;  3ZYY X;  1A6X A;  1TY0 A;  1U4M A;  4A3F B;  4A3D B;  2PZU A;  3NBH A;  4C3H B;  4JI8 Q;  1LYL A;  1ENC A;  3I2Z A;  2JA6 G;  4GS3 A;  2O4X A;  4B3T Q;  2M9V A;  4P73 A;  1QUQ B;  4X64 L;  1HR0 L;  3GTO B;  3QR8 A;  1WD0 A;  3R2T A;  4DK3 C;  1VQH A;  1HTP A;  2QCP X;  4NPS A;  5EKK A;  3ERQ A;  4NXN L;  3FRP B;  1K83 H;  2VUM B;  3HOY G;  1GJX A;  4KN7 C;  4DR5 L;  1B53 A;  1STA A;  3OYY A;  4KLK A;  2IX3 A;  3K5N A;  1SE8 A;  1D1I A;  2A68 C;  4GKJ Q;  1MKH A;  2D2C C;  3GTQ B;  3GTK B;  1KXL A;  2Q8I B;  2ZJR A;  4CDD C;  4P72 A;  1WJJ A;  3GDE A;  1SMY D;  4R4I A;  3T1Y L;  1ILQ A;  4OO1 G;  3PO3 G;  3UE0 A;  4EQN A;  1I50 B;  1WCM B;  4B9W A;  4DR3 L;  1R4Q B;  2GA4 B;  2R92 H;  3X3M A;  3MC0 B;  3J80 L;  1EUJ A;  4DAV A;  1JE5 A;  4JI3 L;  4A4I A;  2MGS A;  4GNX C;  3OIP A;  3E0J A;  3I4M B;  2I07 B;  4A3G G;  1FGB D;  3DHQ A;  2OWO A;  1FR3 A;  4JOI A;  1S5E D;  1CKM A;  3M4O B;  3U4V A;  2VQF L;  4KJO A;  2F3W A;  3L7Z C;  2NVX H;  1BCP F;  4JI2 Q;  5C3E G;  1UE1 A;  3GTP B;  2F0T A;  3HOZ H;  4A93 H;  1G6Z A;  5C4X H;  1VF5 C;  2K33 A;  2XN9 C;  2A5H A;  1KNE A;  2NBF A;  4NDX A;  4GNX B;  4GKK L;  1Z9F A;  2J4X A;  4KD3 A;  4B3R L;  4KV6 A;  1PH5 A;  1PYS B;  1RJT A;  2K50 A;  5CR3 A;  5F2D A;  1WOC A;  5IYC G;  5IGG A;  4DXF A;  3K7A H;  3TS2 A;  2RCF A;  1KD1 C;  1E22 A;  2CFM A;  5IT9 L;  1LTT D;  2WIN B;  3MVV A;  3WDN A;  4X62 Q;  2AWO A;  1ONL A;  4OIK A;  1OTC A;  4HTH A;  4RAU C;  1TWA B;  3PF5 A;  1Y8O B;  1HUM A;  4BBS B;  4A3B B;  4ZLT F;  3S14 H;  1SYD A;  2PCF B;  3HOX H;  5L37 A;  5T1I A;  3TEH B;  5JPN C;  2VB3 X;  3C46 A;  2QDL A;  4ABN A;  3WOF A;  1MSH A;  4RMF A;  1B3Q A;  1KLU D;  1T5X D;  4R4O A;  4RWS C;  5CMD A;  4DFA A;  1N36 Q;  3D6C A;  2PPB C;  1L2F A;  1ET6 A;  1PXU A;  2EE1 A;  3AQQ A;  1VQ4 A;  4OEL B;  3BDL A;  5FK9 C;  1SLJ A;  1J6Q A;  2UUC Q;  3E6Z X;  1K9M C;  1XXG A;  4CDC C;  2ZTD A;  3M3Y B;  2JQO A;  1ASZ A;  4OO1 I;  1SYG A;  2K1B A;  5C4J B;  4X66 Q;  1XTD A;  1IYV A;  1S5D D;  3KUP A;  2EPB A;  4NP5 A;  2B63 G;  3DXJ C;  1XNR Q;  3S1Q B;  5K36 G;  5BR8 Q;  1EYA A;  4OWW B;  1TII D;  2UUB L;  1K8O A;  4CKE A;  3K5L A;  5IP7 G;  3GTQ H;  3T16 A;  4GLV B;  2QEX A;  5IP9 G;  3K81 C;  1W2B A;  3NWT A;  4LF5 L;  5I6Y A;  3L3O C;  2VQE Q;  1ESF A;  3BZC A;  3BYT B;  2Z6K C;  3BZD B;  3PIO A;  1I50 H;  1STH A;  1WCM H;  1V9P A;  5JJL A;  1J5E Q;  5JJI A;  1STB A;  1LV9 A;  1L1O A;  3I90 A;  4A3J G;  4A3L G;  4R9W A;  4JBW A;  2BE5 D;  4C3I B;  3P20 A;  4TSS A;  1LAB A;  2L11 A;  5DEH A;  4LJZ C;  4ODG A;  1EEI D;  2D0P A;  2JA8 H;  1SE2 A;  2ZT9 C;  3K59 A;  1N34 L;  5EKI A;  3GTP H;  4DV7 Q;  4U68 A;  3PV0 A;  2PW5 A;  2EIF A;  5KGU A;  2RHS B;  4JI6 L;  1HNW L;  3KF6 A;  4O0A A;  4CHT B;  1DJR D;  3NPP A;  1K8G A;  1WTX A;  1X3F A;  5FLX L;  4JBM A;  2Z1C A;  3I3C A;  3G6E A;  3A56 A;  5IYD H;  1TWA H;  3K7U C;  1I5F A;  1SBB B;  1K8M A;  4JVZ A;  1QZH A;  4R8I A;  3JAM c;  4YY3 L;  4RGO S;  1RTO A;  1ZYR C;  1FL0 A;  5M5W H;  4BA2 I;  3U9O A;  1LO5 D;  1Y1V G;  3BVM A;  2KCT A;  1STN A;  3TZD A;  1UUP A;  3OW2 A;  4O42 A;  1CA6 A;  5EPK A;  4BY7 H;  4EGV A;  2JEA I;  1BBW A;  5DNF A;  1WYD A;  1HR0 W;  3RUZ A;  1A0I A;  4A3I G;  3PGZ A;  1GHJ A;  3FDT A;  2YTV A;  4YCW A;  1VQ6 A;  1S5F D;  1A63 A;  3EN2 A;  5C4J H;  2WB1 G;  2X6L A;  1AW7 A;  4ID6 A;  4DUZ Q;  1VQN A;  2PZT A;  3S1Q H;  3HOU H;  4KY6 A;  2DNE A;  4QY7 A;  4DN4 M;  3MFY A;  3OWE B;  3H0G B;  5CV4 A;  1K3R A;  1B3A A;  1BBU A;  4X3U A;  4DV4 Q;  1EU4 A;  2EYM A;  4WJ4 A;  4IAL A;  2ZXR A;  1UAP A;  1X56 A;  4C3I H;  1GUG A;  1HQM C;  3IFT A;  3RNU A;  1SJE D;  3OOC A;  5IIF A;  3PQI A;  3L9A X;  4APV A;  4OXP A;  2A6H D;  1LAC A;  4L5T A;  4FXG C;  3RLF A;  1KIX A;  1LTI D;  3RZD B;  2FHT A;  4QJF A;  4WJ3 M;  3MFG A;  4QIW B;  4HJ9 A;  4QB4 A;  1I3Q H;  3L2P A;  1TS3 A;  4A3K B;  3BDO A;  3KJO A;  4LAA A;  3FKI B;  3U9S A;  4ZK9 B;  1YNJ D;  1K3B C;  4I7Z C;  3BG3 A;  2JA6 H;  2CW0 C;  1SRO A;  4B08 A;  1Q86 C;  1HFG A;  1TY2 A;  1AZQ A;  3NP8 A;  1G2S A;  2UU9 Q;  4EX5 A;  2TSS A;  3HS0 C;  3SDZ A;  5IGC A;  3S1N H;  5IGD A;  1EY0 A;  4DV5 Q;  2K01 A;  1K73 C;  4K0K L;  4PZ7 A;  5JOB A;  4MIU A;  4RA8 A;  2NVQ H;  1IKM A;  3A7A B;  3J80 i;  3I91 A;  1WTQ A;  3CW2 C;  2BDN A;  1IW7 D;  3ULP A;  2PYK A;  1XX8 A;  1JWU D;  1KLG D;  4OO1 H;  1BO0 A;  1G8Z D;  2WAC A;  2DUD A;  4HCS A;  2L12 A;  4J6H A;  1MJE A;  3KK7 A;  1OXS C;  1K28 A;  1JQY D;  4DR2 Q;  4LF8 L;  1C8C A;  2PW7 A;  4M8A A;  1O7L A;  5I6W A;  2WAQ G;  1QNK A;  5KIX A;  2AQ1 B;  1EFW A;  4A3G H;  3Q8D A;  1YEZ A;  1V8Q A;  2UXD Q;  1SFO B;  2F0J A;  1QZG A;  1MSG A;  1I4Q A;  1SR3 A;  2CQA A;  2MQH A;  1L0W A;  5C3E H;  2F0E A;  3HOZ G;  4A93 G;  4ULL A;  1TS2 A;  2R93 G;  1LTG D;  5C4X G;  2X6G A;  3KOJ A;  3HOV G;  1G29 1;  3SR1 A;  3J81 c;  4DR1 L;  4WFN 3;  1LTL A;  5FLX c;  5T1G A;  5JJZ A;  3AFP A;  4HJ8 A;  2V1C C;  5IYC H;  4DR7 Q;  3K5O A;  1PZK D;  3NUC A;  3W3A A;  2TMP A;  4FXK C;  5KYI A;  2A69 C;  1PMR A;  4U67 3;  2E5L L;  5CV8 A;  4XDX A;  2H4O A;  1BNZ A;  1XMQ L;  2B3G A;  3CKI B;  3CCS A;  1QWY A;  3QWN A;  3HOX G;  3RZD H;  2ICE C;  4S3S A;  4BS9 A;  1Q1E A;  5CV6 A;  3P7J A;  1FNW A;  1RCV D;  4IPH A;  5ELN A;  1U4P A;  1ML0 D;  1M90 C;  4NXM L;  5LHY 1;  4GLA C;  4A3F G;  2N55 A;  4HID A;  1CT1 D;  4A3D G;  1N33 Q;  3H09 A;  5M5X B;  1KDC A;  1Y8P B;  1XNQ L;  4DV2 L;  2EJM A;  4MHE A;  4GOP C;  1B4O A;  1HNZ Q;  1Y14 B;  3MHB A;  1D7Q A;  4HIO A;  2OTJ A;  3PIO 3;  4P2C B;  4FP5 D;  2OF1 A;  2EYJ A;  1EQT A;  1NBW A;  4DXG A;  1OXT A;  5KNC A;  2XIW A;  4K2L A;  4GOP B;  1SJH D;  4GZY C;  5K36 H;  1H9J A;  3GTL H;  4L5R C;  1T9H A;  4F87 A;  1WTP A;  2NVT H;  3H91 A;  1D5M C;  2XNA C;  1E1T A;  4ZUI A;  2VZA A;  3G48 A;  5IP7 H;  1SSO A;  4TKO B;  1SMY C;  4K6L A;  3I4N B;  2QGQ A;  1DGS A;  1PDQ A;  4XQN A;  2KJX A;  3KBG A;  2B2V A;  4LF7 Q;  5DLQ E;  2AKW B;  2B39 A;  5M3M B;  3LWE A;  1WCM G;  1RF2 D;  1A62 A;  2NZH A;  2I5L X;  3RN5 A;  2NWG A;  2N88 A;  2PNR C;  4A3L H;  2HCI A;  4DNT B;  4EVO A;  1TT2 A;  1WFQ A;  3SVM A;  3S2D H;  3CAM A;  1CI3 M;  1LLR D;  3H6M A;  3TQY A;  4HR7 B;  4IOA A;  4LK1 C;  3AYH B;  1A8V A;  1IBM Q;  2PO4 A;  1NNX A;  1MHW C;  4FNF A;  1K0S A;  3A8K E;  1TWG H;  3G7L A;  3I4M G;  1OXU A;  4JK1 C;  2OT2 A;  3MWY W;  1CZW A;  4EQP A;  1DZ1 A;  2PNH A;  4DNR B;  5I9O A;  2K7V A;  3J81 i;  3MXN A;  1BF4 A;  3BVZ A;  5CV5 A;  2FXQ A;  1CQV A;  1WTR A;  1HR0 Q;  4X64 Q;  4QCL A;  4B3M L;  1FYC A;  2L55 A;  4FF4 A;  4IOC A;  4NXN Q;  1YNN D;  2R61 A;  3CRK C;  3AFQ A;  1IYJ B;  1DOL A;  2ID0 A;  4C3J B;  4ALP A;  4EQO A;  4DR5 Q;  1PTO H;  5FLM H;  3JAM E;  4JI7 L;  4G7H C;  2CCZ A;  2N8N A;  2E8G A;  2SEB D;  2Q8T A;  3M4Q A;  2LXJ A;  4KHP L;  3U50 C;  4K8J A;  1PH3 A;  2N49 A;  1FJG Q;  2K52 A;  2QDB A;  3CC7 A;  1RDP D;  2G5D A;  5EAY A;  4A3B G;  4BBS G;  3RN2 A;  1Q3L A;  4OHJ A;  1CKN A;  4RGT A;  3CMA A;  3T1Y Q;  4KKS A;  4DAY B;  1X3P A;  4X6A H;  2EYH A;  3J7A F;  4K5W A;  4DR3 Q;  1IL8 A;  4RKB A;  3MA2 B;  2F0W A;  2HIX A;  1KDA A;  4KY5 A;  4BY7 G;  1HQR D;  3MEH A;  3TBI B;  2NVY H;  4JI3 Q;  1S40 A;  3LNN A;  3X3N A;  2F0O A;  3SK4 A;  4DR6 L;  4F8M A;  2F0S A;  4CKC A;  3PO2 B;  4FO2 A;  2PQA A;  4CBV A;  3S2H B;  1ZEQ X;  2QIL A;  3MZ5 A;  3I7F A;  2VQF Q;  2KCM A;  3V2T A;  3GQB A;  5J22 A;  1TU2 B;  3I73 A;  3J81 j;  3E9H A;  4X3K A;  4B3R Q;  4GKK Q;  5EKL A;  4FF3 A;  2JXM B;  4NW2 A;  2PMZ E;  4O1N A;  3I4N H;  4OON A;  3OTO L;  1KRT A;  3R93 A;  1G91 A;  1RD9 D;  1QB5 D;  4R4Q A;  4ZCK A;  2VY3 A;  4AQY L;  1WTW A;  4QUF A;  1TS5 A;  3LX0 A;  2ZJQ A;  3KF8 A;  5EGT A;  4C3I G;  3HKZ B;  2UUA Q;  1NMG A;  2Q2U A;  3H94 A;  3KDF A;  1AH9 A;  2B2T A;  5E7N A;  1ENA A;  2CKZ B;  5EBC A;  4LW1 A;  4FVM A;  2F0M A;  2B2Y C;  5DM7 3;  4IUQ A;  4G7Z C;  3P75 A;  5IWA L;  5JJK A;  1QVC A;  2K5V A;  3F2U A;  4A3E H;  1E2W A;  2KHS A;  3GTJ H;  3H3V I;  2F03 A;  3VR5 A;  1PH6 A;  2YU9 H;  4DKA C;  3QB3 A;  3MAQ A;  3SHL A;  1DXM A;  2IL8 A;  4XIG S;  5ELF A; 
#chains in the Genus database with same CATH homology
 4A3L G;  4JBW A;  3PIP A;  3GTG H;  4DV7 L;  1MJC A;  1TXY A;  2UUB Q;  1WI5 A;  3SGI A;  2I5M X;  2JK8 A;  4H02 A;  3TS0 A;  3U58 A;  3KFU A;  1SFO H;  2K14 A;  1LUZ A;  1BVS A;  3HOY H;  3TRE A;  1Q81 C;  2I0Q A;  4LF5 Q;  1V43 A;  4DV0 Q;  1Q7Y C;  3DLL A;  4UP9 A;  1JJ2 A;  3JAM i;  3A0J A;  1X9N A;  2D0P A;  2JA8 H;  2VL6 A;  5C44 G;  4DAM A;  3NBH B;  3I4O A;  2L15 A;  4A3C H;  1N34 L;  1PH7 A;  5M5Y H;  3GTP H;  3ICE A;  2GVB A;  4DV7 Q;  3A5U A;  3W5O A;  4DV1 L;  3S1R H;  3PV0 A;  4MNO A;  1I6H H;  2EIF A;  2C35 B;  4POF A;  2RHS B;  2A8V A;  4JI6 L;  3HOW G;  1HNW L;  3KF6 A;  3STB D;  1XPR A;  4O0A A;  3PO3 H;  4LF4 L;  1K8G A;  1EYG A;  4IFD J;  1X3F A;  4JBM A;  3FP9 A;  3MXN B;  2R92 G;  2R6G A;  3W1B A;  3G6E A;  4NB3 A;  3CF5 A;  4HIK A;  5IYD H;  4BY1 H;  1TWA H;  3K7U C;  3F1Z A;  1I5F A;  3H15 A;  1YI2 A;  1XPO A;  2OTL A;  4LFC L;  1BKB A;  4DV1 Q;  1QZH A;  2K5H A;  3JAM c;  2R93 H;  4YY3 L;  5M5X H;  2D0O A;  3TRZ A;  1G6P A;  4GN5 A;  1HNW Q;  4UP8 A;  1YIJ A;  3S24 A;  3BU2 A;  3H0G G;  1VQO A;  1FL0 A;  2R7F A;  2YTY A;  4LUZ A;  5M5W H;  2KBN A;  1KL9 A;  1YHA A;  2A1A A;  4DV6 L;  4DUZ L;  4JOI C;  4BA2 I;  2WAQ E;  4B3S L;  1X6O A;  5ELO A;  1HNX L;  2EXD A;  1Y1V G;  2KCT A;  1PH1 A;  4OWT B;  3U4Z A;  3OW2 A;  2BH8 A;  3J7Z C;  2IHE A;  1NJI C;  3FHW A;  3BJU A;  3EBE A;  2JEB I;  1O7I A;  4YCV A;  5H1S E;  4BY7 H;  1HZC A;  1BBW A;  2JEA I;  3PF4 A;  1HR0 W;  1WYD A;  3UDI A;  4HIM A;  2WP8 J;  1A0I A;  4DV3 L;  4A3I G;  4LFC Q;  3PGZ A;  1CKN B;  2GN5 A;  4YY3 Q;  2KEN A;  2YTV A;  4YCW A;  1RL2 A;  3VDY A;  1VQ6 A;  2A19 A;  4DR4 L;  3EN2 A;  1A63 A;  2VNU D;  4DV4 L;  5C4J H;  2WB1 G;  4DV6 Q;  1PA6 A;  1HH2 P;  4DUZ Q;  1VQN A;  4B3S Q;  1HNX Q;  1N32 Q;  3NEM A;  3S1Q H;  1YIT A;  3HOU H;  4IPC A;  2Q2I A;  4YWM A;  3CCV A;  5HGQ A;  2RCN A;  3K0X A;  5LMN W;  3ULJ A;  4QY7 A;  1G51 A;  4A3F H;  5M3M H;  2WB1 E;  3CXC A;  4A3D H;  3FKI G;  4GOP A;  2XTI A;  4P74 A;  4C3H H;  4DV3 Q;  1I94 L;  4QIW E;  3PSI A;  1K8A C;  3KYH C;  3CCR A;  4IO9 A;  2PQA B;  2MO1 A;  4DNI A;  3GTO H;  1K3R A;  4AYB G;  2HT1 A;  1BBU A;  4DR4 Q;  4DV4 Q;  2IT1 A;  1AE3 A;  3D31 A;  1HZ9 A;  1Q12 A;  2VUM H;  1KHI A;  4WJ4 A;  2ALY B;  1E3P A;  2ZTC A;  1X56 A;  4UY8 C;  4C3I H;  4A75 A;  1IZ6 A;  4ME3 A;  3RNU A;  2E2J H;  5IYB H;  1X65 A;  1Y1W H;  4XTC S;  4APV A;  4OXP A;  4OWX B;  4L5T A;  1I94 Q;  3RLF A;  1QUQ A;  4A3M G;  5GRO A;  1KIX A;  3GTK H;  1K0R A;  4IFD G;  2F4V L;  4JI1 L;  2UU9 L;  4QJF A;  1VQB A;  3UDG A;  2B63 H;  4WJ3 M;  3CCE A;  4TQU S;  2Q2H A;  4HJ9 A;  4BBR H;  2BH2 A;  1VQA A;  2F3I A;  3HKS A;  4R4T A;  4C3J H;  1I3Q H;  3KF8 B;  2KHI A;  3L2P A;  1NY4 A;  4HJ7 A;  1P16 A;  3KJO A;  4UPA A;  1JJG A;  3HFZ B;  3KDF B;  4DV5 L;  5IP9 H;  1IL2 A;  4FDB A;  2JA6 H;  1EWI A;  1SRO A;  4LWC A;  1YHQ A;  1S72 A;  4GLX A;  1Q86 C;  2JA5 G;  3PUZ A;  2IX1 A;  2YYZ A;  3RLO A;  2I5H A;  1L1O A;  2K5N A;  4JI1 Q;  2UU9 Q;  2AMC B;  2F4V Q;  3PCO B;  4EX5 A;  4GN3 B;  1VQ7 A;  2UXC L;  1B8A A;  4A3J H;  2LSS A;  1VQL A;  3I4M H;  1C9O A;  1L1O C;  1JB7 A;  3S1N H;  2WFW A;  3NEL A;  1U5K A;  3I56 A;  4P71 A;  4JI5 L;  1YVC A;  3M4O H;  4AH6 A;  3RLN A;  4DV5 Q;  1K73 C;  4DUY L;  4QGU A;  4K0K L;  5IY0 A;  3G71 A;  2ZTE A;  4PZ7 A;  5LMU L;  3M9B A;  4DR2 L;  4JCV E;  4YCU A;  4LUO A;  2JA8 G;  2NVQ H;  1OXX K;  1PVO A;  2NN6 I;  5C44 H;  3GD7 A;  3J80 i;  4A76 A;  3CW2 C;  4JYA L;  5LMN L;  1PH9 A;  3GTM H;  4JI4 L;  1L1O B;  4A3C G;  3ULP A;  3A5Z B;  4R1J A;  2UXC Q;  5FLM G;  4Y7N H;  2VS1 A;  2OQK A;  1FJG L;  2DUD A;  2UXD L;  5GAH C;  3PO2 H;  1H95 A;  4KI0 A;  3S2H H;  1N32 L;  1X3G A;  1NTG A;  1VQP A;  1XMO L;  4JI5 Q;  3WWV A;  1MJE A;  3S1M H;  4DUY Q;  4K0K Q;  1OXS C;  1N34 Q;  5LMU Q;  4IPD A;  1GO3 E;  4HJA A;  3CCJ A;  5M3F G;  4DR2 Q;  2KHJ A;  4LF8 L;  3H3V H;  4GNX A;  1FVI A;  2UXB L;  3A74 A;  1KC8 C;  3CCQ A;  4GN4 B;  2WAQ G;  4OX9 L;  4A3B H;  4BBS H;  3UE1 A;  1EFW A;  4JYA Q;  5LMN Q;  1D8L A;  4Y52 H;  1QVG A;  3CP0 A;  3ZJY C;  4JI4 Q;  1VQD A;  3AEV A;  4DR7 L;  4JI6 Q;  4A3G H;  3Q8D A;  2ES2 A;  1YEZ A;  5IYD G;  1PH4 A;  2UXD Q;  4LF4 Q;  1PFS A;  1QZG A;  3KLW A;  4LF9 L;  4JV5 L;  1CSQ A;  1SR3 A;  4JG2 A;  4PG3 A;  1XMO Q;  5JEA G;  2Y0S E;  2HHH L;  2MQH A;  1L0W A;  5C3E H;  3HOZ G;  4A93 G;  3K80 C;  2R93 G;  5C4X G;  4PZ8 A;  3KF6 B;  2Z0S A;  3J80 c;  2BA1 A;  3KOJ A;  5FJ8 H;  2CQO A;  4L5S A;  4IJH A;  4LF8 Q;  3HOV G;  1G29 1;  1V1Q A;  2UXB Q;  3J81 c;  1B70 B;  4DR1 L;  2JA7 G;  3CD6 A;  4OX9 Q;  3JC6 6;  1LTL A;  5FLX c;  3G4S A;  2N78 A;  3AFP A;  3UDF A;  1Y1V H;  1RIP A;  1NE3 A;  1VQG A;  2V1C C;  5IYC H;  4HJ8 A;  2R7Z G;  1FGU A;  4DR7 Q;  1PH2 A;  3M3Y H;  2GVA A;  2NN6 G;  1XPU A;  3T1H L;  2IHF A;  1IBL L;  1P8L A;  4UP7 A;  1N33 L;  4LF9 Q;  4JV5 Q;  2JJQ A;  2E5L L;  4A3I H;  4BA1 I;  4P75 A;  2HHH Q;  1JJC B;  3LGJ A;  4JBK A;  3ULL A;  1XMQ L;  4LF6 L;  1HNZ L;  4MTN A;  2B3G A;  3ER0 A;  3W1G A;  4LFA L;  4LUV A;  1C0A A;  4A3K G;  3CCS A;  2H5X A;  3HKZ E;  3HOX G;  3RZD H;  4DR1 Q;  2D62 A;  3F2C A;  4LFB L;  1Q1E A;  1UE7 A;  3I4N G;  1YJ9 A;  2F52 A;  2EQS A;  4IPH A;  3HOU G;  5ELN A;  1M90 C;  2UUA L;  4NXM L;  5IT9 c;  3ERS X;  4GLA C;  4EQ5 A;  4RG1 A;  4A3F G;  3J7A 5;  3CCU A;  2K4K A;  4HID A;  3T1H Q;  4X65 L;  1IBL Q;  3HOV H;  4A3D G;  1N33 Q;  1QVF A;  2E5L Q;  1XNQ L;  4DV2 L;  3PUW A;  4GOP C;  3D0F A;  1XMQ Q;  4LF6 Q;  1HNZ Q;  4LFA Q;  1Y14 B;  1PYB A;  1D7Q A;  4HIO A;  4TVA B;  1YJN A;  2OTJ A;  2Q2T A;  5HY6 A;  5JEA J;  4DK6 C;  5BR8 L;  4LFB Q;  4YWL A;  2MNA A;  4LF7 L;  2PI2 A;  1CKO A;  3DM3 A;  4NXM Q;  1EIY B;  1NBW A;  2PI2 E;  4JI8 L;  1OXT A;  4HJ5 A;  4A3E G;  2OCE A;  1KQS A;  1W3S A;  4X65 Q;  4GOP B;  1VQ8 A;  4B3T L;  3NEN A;  1VQ9 A;  2DGY A;  2YV5 A;  3GTL H;  4L5R C;  1T9H A;  1XNQ Q;  4DV2 Q;  2NVT H;  4A3M H;  4BXX H;  1YNX A;  1TWF H;  1E1T A;  5IP7 H;  2VZA A;  3G48 A;  1VQJ A;  1TWC H;  1VS0 A;  1SMX A;  2LXK A;  1Q82 C;  1IBM L;  3CC4 A;  3PUV A;  4O2D A;  2VW9 A;  4BBR G;  1GVP A;  3CPF A;  2QGQ A;  3MEF A;  1DGS A;  4QQB X;  2Z6K A;  1VQF A;  4LF7 Q;  5DLQ E;  2AKW B;  1YJW A;  1PH8 A;  1WCM G;  1A62 A;  1JT8 A;  4JI8 Q;  2NZH A;  2HIV A;  1LYL A;  2I5L X;  3I2Z A;  4PMW A;  4GS3 A;  3RN5 A;  1XJV A;  4B3T Q;  2JA6 G;  4P73 A;  4GKJ L;  2HQL A;  4A3L H;  1QUQ B;  1WFQ A;  4X64 L;  1HR0 L;  1MIU A;  1UE6 A;  1UWV A;  2JA5 H;  3S2D H;  3CAM A;  4DK3 C;  1VQH A;  4NPS A;  3TQY A;  4IOA A;  3AYH B;  1A8V A;  4NXN L;  1IBM Q;  1K83 H;  3I55 A;  3KJP A;  3HOY G;  4QL5 A;  3CC2 A;  2ZM6 L;  4DR5 L;  4POG A;  1TWG H;  1KRS A;  3I4M G;  1OXU A;  2CWA A;  1E7Z A;  3K8A A;  3EIV A;  3OYY A;  1CSP A;  3PUY A;  2E2I H;  4KLK A;  1GD7 A;  2OQ0 A;  2AHO B;  4PZ6 A;  1HZB A;  5J3B A;  3CCL A;  1SE8 A;  2PNH A;  2RF4 A;  3E0E A;  4YWK A;  3J81 i;  4GKJ Q;  1MKH A;  1VQI A;  2FXQ A;  1HR0 Q;  4X64 Q;  1IBK L;  1KXL A;  3CQZ H;  4B3M L;  2ZJR A;  1E1O A;  4P72 A;  4IOC A;  1WJJ A;  4JI0 L;  3GDE A;  4NXN Q;  1X54 A;  3AFQ A;  1IYJ B;  1Z47 A;  2ID0 A;  3M4P A;  4R4I A;  3T1Y L;  3HOW H;  2ZM6 Q;  4ALP A;  1VQC A;  4DR5 Q;  5FLM H;  4IFD I;  4OO1 G;  3CME A;  3PO3 G;  1VQK A;  3UE0 A;  4JI7 L;  3PO2 G;  1X3E A;  1M1K C;  3GO5 A;  1KAW A;  2N8N A;  2CCZ A;  3RZO H;  2E8G A;  2E2H H;  4DR3 L;  3M4Q A;  2LXJ A;  2Y0S G;  3PUX A;  4JI2 L;  4KHP L;  3U50 C;  2R92 H;  1PH3 A;  5GAD C;  1TWH H;  2N49 A;  4BY1 G;  5M3F H;  1FJG Q;  2K52 A;  1IBK Q;  1EUJ A;  1JE5 A;  4YHH L;  5C0X J;  1LM0 A;  3CC7 A;  4B3M Q;  3RR5 A;  4JI3 L;  5EAY A;  1GM5 A;  4A3B G;  4BBS G;  3RN2 A;  4A4I A;  1JMC A;  4JI0 Q;  4GNX C;  1CKN A;  1EOV A;  3CMA A;  3T1Y Q;  2B29 A;  3M7N A;  3CCM A;  4A3G G;  2OWO A;  4JOI A;  1CKM A;  3H0G H;  4DAY B;  4JI7 Q;  3U4V A;  4X62 L;  2VQF L;  3M85 A;  1YHB A;  1UE5 A;  4X6A H;  3L7Z C;  4DR3 Q;  1EQR A;  2NVX H;  1Q1B A;  2MFI A;  1B7Y B;  1UE1 A;  4JI2 Q;  5C3E G;  4JBJ A;  3HOZ H;  4A93 H;  4KHZ A;  4KHP Q;  2ZJP A;  1Q8K A;  5C4X H;  1VCI A;  2HIX A;  5FJ8 G;  5IE8 A;  4BY7 G;  4B3R L;  4GKK L;  4GNX B;  3HKZ G;  1Z9F A;  2IX0 A;  2QA4 A;  2MO0 A;  4C2M H;  2NVY H;  4YHH Q;  1N8R C;  3F2D A;  1X55 A;  1HZA A;  1PYS B;  1YBY A;  1PH5 A;  4JI3 Q;  1S40 A;  2JA7 H;  1GKH A;  2K50 A;  4DR6 L;  1WOC A;  5IYC G;  1ASY A;  3K7A H;  2R7Z H;  1N9W A;  4AIM A;  3TS2 A;  3L0O A;  2PQA A;  1KD1 C;  1N36 L;  1E22 A;  2CFM A;  2JA9 A;  4A3J G;  4J15 A;  5C0X I;  3I7F A;  4X62 Q;  2VQF Q;  2KCM A;  2ASB A;  2AWO A;  1IXR A;  1UEB A;  1OTC A;  1VQE A;  2CWP A;  4MZ9 A;  5GAE C;  3J81 j;  3PF5 A;  2UUC L;  3E9H A;  4A3K H;  1VQ5 A;  4B3R Q;  1EIF A;  3S14 H;  5M3M G;  4GKK Q;  3E9I A;  3HOX H;  2BA0 A;  3FKI H;  3IRB A;  3TEH B;  2N3S A;  2RHQ B;  2PMZ E;  3I4N H;  4OON A;  4DR6 Q;  3F8T A;  3OTO L;  1KRT A;  1R9T H;  4RMF A;  4X66 L;  4R4O A;  1NMF A;  4R4Q A;  1N36 Q;  1E24 A;  1XNR L;  2VY3 A;  4AQY L;  3UDX A;  2VUM G;  1L2F A;  1VQ4 A;  3AQQ A;  3S17 H;  2XGT A;  1AE2 A;  4JC0 A;  4L5Q A;  2JE6 I;  2ZJQ A;  1SLJ A;  4LNQ A;  1J6Q A;  1HJP A;  4DPG A;  2UUA Q;  2NZO A;  1NMG A;  2Q2U A;  2UUC Q;  5IYB G;  1K9M C;  1Y1W G;  3KDF A;  1Q46 A;  2AWN A;  1AH9 A;  1U0L A;  5E7N A;  1PHJ A;  3B6Y A;  2CKZ B;  4LW1 A;  2VQE L;  3S15 H;  3S16 H;  2R7D A;  2ZTD A;  5AJ3 L;  3BZK A;  2JQO A;  3OTO Q;  1ASZ A;  2ATW A;  4OO1 I;  1C7Y A;  4X66 Q;  1XTD A;  1EQQ A;  4AYB E;  3F2B A;  1VQM A;  5IWA L;  1J5E L;  2B63 G;  1XNR Q;  5JJK A;  1QVC A;  2K5V A;  5GAG C;  4A3E H;  1PV4 A;  4AQY Q;  5K36 G;  5BR8 Q;  4OWW B;  4BXX G;  1SRU A;  2UUB L;  5C0X G;  1YZ6 A;  5IP7 G;  3GTJ H;  1OXV A;  3GTQ H;  3H3V I;  4GLV B;  2IY5 B;  2QEX A;  1PH6 A;  5IP9 G;  3K81 C;  1CUK A;  1W2B A;  2YU9 H;  4DKA C;  3CPW A;  1S3O A;  4LF5 L;  2K75 A;  4DV0 L;  2YTX A;  5GQO A;  3STB C;  2VQE Q;  5AJ3 Q;  4IPG A;  3BZC A;  3PIO A;  2Z6K C;  1I50 H;  1WCM H;  4XIG S;  1V9P A;  5JJL A;  5IWA Q;  1J5E Q;  5JJI A;  4IJL A;  1SN8 A;  4R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...