4DK6C

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
87
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 14
structure length 87
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk6C00
2VL6A 4A3DG 4LFBL 4FDBA 2PI2E 1GKHA 3W5OA 5M5XH 2R6GA 3DLLA 2KHJA 4GNXA 2UU9L 3S14H 1EQQA 4JV5Q 1I6HH 4LFAQ 2OQ0A 5IP7G 1EIFA 4X66Q 3GO5A 4JI5L 1PYSB 1YIJA 4PZ6A 3G6EA 4B3MQ 4HIDA 2A1AA 4YCUA 3UDGA 4QJFA 1EWIA 3B6YA 4BY1G 1WCMH 4PG3A 1Q7YC 1X9NA 2ZJPA 4ALPA 4AH6A 2JA5G 3KF8B 2JA7G 2OTJA 5GADC 3CD6A 3S1QH 1YHAA 3I4OA 4LF7Q 3KF6A 1N36L 2QA4A 3L7ZC 3HOWG 5IYDH 3A0JA 1ASYA 1IZ6A 1UWVA 4KLKA 4NXMQ 4RG1A 4HJ5A 4IFDJ 2F4VL 3BJUA 1J6QA 5BR8L 2Z6KA 4DR1L 3UDIA 1MJCA 1N9WA 1SFOH 2Y0SE 3HOXH 1VQ7A 2UUCQ 3MEFA 1C0AA 4IO9A 4JI8Q 4A3EG 2YU9H 1N33L 1JT8A 1XPUA 4C3HH 5AJ3Q 3F2BA 2EXDA 4JOIA 4X65L 2PQAB 1W2BA 1PHJA 1IXRA 1R9TH 1B7YB 4A3CG 3KOJA 1S40A 2WB1G 2WAQG 3MXNB 1HR0W 1K0RA 1VQPA 4A3JH 1VQKA 4LF4Q 4A3FH 1OXTA 3F2CA 5LMNL 1Y1VG 2MFIA 2C35B 2N49A 4JI0L 5FLXc 2E5LQ 5FJ8H 2RHSB 1G291 4UY8C 1EIYB 1XJVA 2VQEQ 4IPDA 2HHHL 4A3GG 4DAMA 4A3MH 1T9HA 4DR4Q 1TWHH 1Y1WG 1WOCA 4K0KL 3IRBA 1CKNB 5IWAQ 1CKOA 1MJEA 3H3VI 5IP9H 4DV2Q 3FKIH 4HJ8A 1L0WA 1HNWQ 1JJ2A 5IYBG 1K9MC 3UE1A 1BBUA 2Z0SA 1Q12A 1M1KC 3K80C 3FHWA 4B3ML 3K81C 1IBML 2MQHA 3AFQA 4NXNL 1VQ6A 2VZAA 2YYZA 4IJHA 4P71A 2F52A 4X62Q 4POGA 1NY4A 4JI1L 2K52A 2GVBA 5IY0A 4DV5Q 4IPHA 3TS0A 2KBNA 5M3FG 1MKHA 3OW2A 1X3FA 3SGIA 2R92G 4JBMA 1FJGQ 1P8LA 5H1SE 4KHZA 1VQOA 4LFCQ 3CC4A 3UE0A 4C2MH 2NZOA 4LF6Q 2JA8G 1HZBA 1Q82C 1N8RC 4JI3Q 2ASBA 1SMXA 1XNQQ 3CCQA 2VUMG 1E22A 3OYYA 4QGUA 3BZKA 2YV5A 1FGUA 3L2PA 5LMUL 2HIVA 3AYHB 1PH1A 1NE3A 3I4NH 4IFDI 1VQDA 2N78A 1YJ9A 3EN2A 4XTCS 3KDFA 1X56A 1YBYA 1A8VA 2DGYA 3HFZB 4Y52H 2D0OA 2XGTA 1VQLA 1QVGA 3BU2A 2VNUD 4EQ5A 1SR3A 3PUYA 3BZCA 3UDXA 1OXXK 1KD1C 2UUAQ 5IE8A 3KJPA 2N8NA 3S24A 1HZ9A 5M3MH 2R93G 3DM3A 4HIMA 3ULPA 4LUVA 3J80i 2ZTDA 4JI7Q 1L1OA 1H95A 4J15A 4DR6L 3A5UA 5HY6A 4LUOA 4HJAA 3S1MH 4AQYL 1HNXQ 3PO3H 1X3EA 1VQ4A 4IFDG 4A3KH 2VQEL 2GVAA 1XNRQ 2Y0SG 2WFWA 3CCRA 3U4ZA 2XTIA 1HR0Q 4DK6C 3T1HL 5GAGC 3I4MH 2A19A 2AKWB 4GOPB 2CKZB 4QL5A 3H15A 4UP7A 4GNXB 2Q2HA 1LUZA 3E0EA 3UDFA 5C3EH 4P74A 3I55A 3S1NH 1N34Q 4PZ7A 1B8AA 4GOPC 2ES2A 2UUBQ 2CCZA 2YTXA 4GNXC 1M90C 4OWXB 1UE1A 1K8GA 3PUWA 3CXCA 4DV4Q 4JYAL 2LXJA 1AH9A 4YCVA 4X64Q 2ZJQA 2YTVA 4X62L 2ZM6L 1YHBA 1PVOA 4DV5L 4R4OA 2ZTCA 3PV0A 4R4CA 4UPAA 1C7YA 2N3SA 1LM0A 4UP8A 1D8LA 2JEBI 2MO0A 3D31A 1FJGL 3U58A 1GM5A 4YWKA 4DR2L 4IPGA 4TQUS 1DGSA 5GROA 3J80c 3G4SA 5IYDG 3GTGH 3RLNA 3M9BA 4DKAC 1KC8C 1I94L 4DR3L 1EUJA 2EQSA 3AQQA 1X65A 2R7ZH 1IBLL 2NN6I 4DUZQ 2MO1A 1UE5A 2HIXA 4DV1Q 1X54A 3S2HH 4IOCA 4IPCA 3ULJA 4JI6Q 2UXDQ 2CWPA 2UXBL 3T1YL 2IHEA 3E9IA 5GAEC 4DV3Q 2I5MX 1XMOQ 3GTOH 4L5QA 1YVCA 1HZCA 4L5RC 2NVYH 1IL2A 4BY7H 1VCIA 3HOYG 4B3TQ 1GO3E 3HKZE 2L15A 3K0XA 1KL9A 4JI2L 1FL0A 2R7FA 1EQRA 3TRZA 2IX0A 3GDEA 4A3JG 1IBKL 3M4OH 4A75A 4A3FG 1S72A 1A63A 1U5KA 5C4XH 4AYBE 3JC66 5IT9c 4YY3Q 2K4KA 2JJQA 5FJ8G 1Z9FA 3RLFA 2VQFQ 4A93G 3TEHB 1UE6A 4UP9A 4DV0Q 2ZJRA 1YI2A 1JJGA 4A3MG 1HNZQ 2OQKA 2CWAA 5C0XJ 2V1CC 1KQSA 3S15H 1XTDA 1QUQA 3OTOQ 5FLMH 1X55A 5C4JH 5IP9G 1CSPA 3FKIG 1B70B 4MTNA 4C3IH 4B3RL 1E3PA 4BY1H 1VQ8A 1FVIA 3S16H 4A3LG 3U4VA 2UXCQ 4ME3A 3ICEA 4QY7A 4P73A 4JI4Q 3RNUA 4LF8L 1AE3A 4C3JH 4GN3B 4YHHQ 4LF9Q 2JA6H 1YZ6A 2ATWA 1VQJA 4O2DA 3CAMA 4DR7Q 3HKSA 3J7A5 3STBC 4KHPQ 2IY5B 1YNXA 2IT1A 1OXUA 4DV4L 1YJWA 2OWOA 2B63G 3I56A 2K50A 1VQ5A 3HOUH 4JV5L 4DUYQ 4LFAL 1E1OA 2JEAI 2HT1A 3S1RH 2K5NA 4X66L 1WFQA 1U0LA 3GTJH 1E7ZA 2IX1A 3VDYA 1RL2A 5LMNW 1GD7A 4LF5Q 4A3BH 4DR5Q 2D0PA 4YWLA 1WI5A 3I4NG 3FP9A 1G51A 5JJIA 2PQAA 4GLVB 4JC0A 3J7ZC 3PUXA 1JB7A 2PMZE 3GTLH 1HH2P 1PH8A 2K5VA 1EFWA 1VQBA 4A3CH 4PMWA 1KAWA 3KDFB 4YCWA 3W1GA 1MIUA 2VS1A 1CUKA 2BH2A 4OX9Q 4GKJQ 4LF7L 3ZJYC 4PZ8A 5GAHC 5C44H 1Y1VH 1N32Q 1PH5A 4GKKQ 2KCMA 2IHFA 3JAMi 4LWCA 5M3MG 3J81i 4NXML 2PNHA 3KLWA 4A3GH 3CPWA 2E8GA 3H0GG 4LFBQ 5M5YH 3F8TA 3CCSA 4POFA 2UU9Q 4A3IH 2UUCL 5IYCH 1VQAA 1HZAA 1VQNA 4NB3A 4JI8L 1J5EQ 2VQFL 3STBD 3PO3G 4A3KG 5C0XI 3K8AA 1CSQA 5AJ3L 2PI2A 4OXPA 4DV0L 1W3SA 1HNZL 3CQZH 1PH9A 1X3GA 3CF5A 3G48A 3I4MG 3L0OA 4IOAA 1OTCA 3PO2H 4HJ7A 1V1QA 4LF4L 5JJLA 2BA1A 5ELOA 4A4IA 3HKZG 3HOVH 2K75A 1I50H 4HJ9A 4WJ4A 1C9OA 4BBSH 2UXCL 2E5LL 5M3FH 2B29A 2R92H 2AWNA 2D62A 2A8VA 3TQYA 3CMEA 4DV6Q 1N36Q 4AYBG 2H5XA 4DR4L 1V43A 3Q8DA 4OWTB 2F3IA 2NVTH 5GQOA 2RCNA 1SRUA 1NTGA 4L5TA 4XIGS 5IWAL 2F4VQ 2I5HA 4DV2L 1KRSA 1NBWA 4O0AA 3JAMc 4H02A 2I0QA 1P16A 2Q2TA 1A62A 3U50C 4R1JA 5C0XG 3HOZH 4QQBX 1HNWL 5M5WH 1N33Q 3PGZA 1QZGA 1WCMG 2ZTEA 2NVXH 3M3YH 4R4QA 4DR5L 4X65Q 1QVFA 3KFUA 3RN5A 1WYDA 1VQ9A 1GVPA 4LFCL 1NJIC 4JBWA 5LMNQ 1JMCA 3M4PA 1TXYA 1VQHA 5JEAJ 4BBRH 3CMAA 4JI0Q 2LSSA 4LF6L 4JI3L 4GKJL 2ALYB 3PUVA 2BH8A 1HJPA 2FXQA 3KF6B 1XNQL 3AEVA 3RR5A 2YTYA 1NMFA 4GN4B 2OTLA 2ID0A 2KENA 4BA1I 3HOXG 4K0KQ 3WWVA 5C4XG 4GOPA 1YJNA 1JJCB 1PH3A 3GTPH 3S17H 1G6PA 4L5SA 1TWCH 2BA0A 4MNOA 2Z6KC 4BXXH 4TVAB 1J5EL 1VQFA 1K8AC 3ERSX 4DV7Q 1VS0A 3G71A 2AMCB 5FLMG 1IBMQ 2UUAL 3GTQH 4NXNQ 1VQMA 1QUQB 3PF5A 4JI1Q 4GLXA 4JOIC 4JI7L 3NBHB 1Q8KA 2VW9A 1Q46A 4A3DH 3CC7A 4OWWB 1LTLA 2K5HA 1V9PA 3KYHC 4QIWE 3CCVA 5IP7H 1BVSA 3J81j 1HNXL 2I5LX 4A76A 3GTMH 2JA6G 1BBWA 2NN6G 3I7FA 3K7UC 1XNRL 3TS2A 1E1TA 3NENA 1HR0L 4DV6L 1PH2A 1PH4A 4BA2I 1NMGA 1K83H 5LMUQ 2LXKA 3HOUG 2RF4A 1KIXA 1EYGA 1D7QA 4B3SQ 4DNIA 3CP0A 3EBEA 2JA5H 1EOVA 2JA9A 2JA7H 2VY3A 3CC2A 1N34L 3I2ZA 2UUBL 2NZHA 4JG2A 4A3BG 4R4IA 3CCJA 3NEMA 3GD7A 1JE5A 3CCUA 3A5ZB 4GN5A 1Y14B 4LW1A 1RIPA 3HOWH 2EIFA 3E9HA 4X64L 3CCEA 3HOYH 1I5FA 1PA6A 2GN5A 1OXVA 1XMQQ 1TWFH 5JJKA 4EX5A 4DR6Q 1E24A 1PV4A 5C44G 4A3EH 3A74A 5K36G 2Q2IA 4AQYQ 2E2IH 1O7IA 3W1BA 2QEXA 4A93H 2AHOB 4MZ9A 3PF4A 1X6OA 3CW2C 4DUZL 4DV1L 3T1HQ 4A3IG 5IYCG 1VQCA 1VQGA 2K14A 4R4TA 3F2DA 1A0IA 4HIKA 4JI6L 2UXDL 3M85A 1VQIA 2B3GA 3PUZA 3PIOA 4DV3L 1XMOL 4NPSA 4JBJA 4A3LH 3KJOA 5HGQA 4B3TL 4P72A 1Q86C 1BKBA 5EAYA 4P75A 3RN2A 4DV7L 3PO2G 4JYAQ 1CKNA 1AE2A 1WJJA 3RLOA 2OCEA 1PYBA 1TWGH 3ULLA 4Y7NH 1Y1WH 2ZM6Q 1QVCA 1L1OB 3LGJA 5JEAG 4OO1I 4BBSG 3F1ZA 3PSIA 4YY3L 2B63H 1SROA 1TWAH 2R7DA 3NELA 5ELNA 4JI5Q 1L1OC 3M7NA 4DR2Q 3ER0A 5IYBH 5J3BA 4YWMA 1UE7A 3OTOL 3CCLA 1QZHA 2DUDA 1I94Q 4DR3Q 2NVQH 2MNAA 1Q1BA 5C3EG 1IBLQ 1XPOA 1I3QH 1YEZA 3HOZG 4B3SL 1OXSC 2HQLA 3D0FA 3AFPA 2UXBQ 3T1YQ 4RMFA 1S3OA 2CFMA 4JI4L 5DLQE 2WB1E 2WAQE 3PIPA 2JA8H 1SN8A 1L2FA 1SE8A 4YHHL 4AIMA 4LF9L 3S2DH 4HIOA 1PH6A 4DAYB 4GLAC 4JCVE 4APVA 2VUMH 4DR7L 4JI2Q 1LYLA 4KHPL 4OO1G 5BR8Q 1ASZA 4DR1Q 3CPFA 3H3VH 1K73C 1IBKQ 4LNQA 4DUYL 2QGQA 3J81c 1YHQA 2AWOA 3CCMA 1VQEA 1XMQL 2WP8J 2CQOA 4OONA 2JK8A 3H0GH 4BBRG 4GS3A 2Q2UA 3RZOH 4JBKA 3EIVA 1Q81C 4LF5L 2R7ZG 1Q1EA 4DK3C 4KI0A 1K3RA 3TREA 1KHIA 2JQOA 2KHIA 2RHQB 1SLJA 1Z47A 2JE6I 4LUZA 1YITA 3PCOB 2E2JH 3HOVG 2R93H 1IYJB 2KCTA 1PH7A 5E7NA 4B3RQ 4BY7G 4IJLA 4WJ3M 3GTKH 4BXXG 4OX9L 3M4QA 3RZDH 1XPRA 1KRTA 2HHHQ 1N32L 1PFSA 4DPGA 2E2HH 4LF8Q 4GKKL 4X6AH 1UEBA 1KXLA 3K7AH 1CKMA
chains in the Genus database with same CATH superfamily
4NW2A 2XWBB 2VL6A 4HCSA 4U673 4G57A 1HFGA 1UEAB 5M5XH 1I6HH 2KHJA 4JV5Q 1VMCA 3OSOA 2OQ0A 2KJXA 2EYPA 4X66Q 2K33A 1WTHA 3GO5A 3D4RA 1PYSB 1YIJA 1MSHA 4C3HB 2A1AA 4QUFA 4QJFA 1EWIA 1WCMH 4FO2A 4C1NK 4AH6A 1Z7TA 1X32A 2OTJA 3S1QH 1JOOA 4LF7Q 4HCEA 2E2IB 4KY7A 1AZPA 3HOWG 5IYDH 3J7AV 1TS3A 3A0JA 5CR3A 2GA4B 4A3MB 1UWVA 2C9OA 2B2WA 2A69C 3HOXH 1C0AA 1JT8A 4KY6A 1A2UA 1ICFB 1SNPA 5AJ3Q 1S5FD 2F0JA 3VYRA 3F2BA 4JOIA 2A6HC 3TN2A 5FLXE 4J6HA 1IXRA 4A3CG 1TWGB 3KOJA 4KMUC 5T1IA 4A3JH 2J7ZA 1D5MC 2B63B 4ILWA 4MHEA 5LMNL 2C35B 2G9DA 4EVOA 4JK1C 4PMCA 2E5LQ 3G7LA 4ZAIA 4RGTA 2VQEQ 3BYTB 3LWEA 1T9HA 4M1UB 1TWHH 3I4NB 2F0SA 4K0KL 1CKOA 1MHWC 1EIHA 4HJ8A 3FKIH 3NHHA 3NSWA 1SYBA 1L0WA 3D4DA 4DAVA 3K58A 5JVH3 3D4WA 5A2QE 1JJ2A 5IYBG 5IT9L 3UE1A 2Z0SA 1KABA 1K9MC 1M1KC 2Z8LA 1IBML 2MQHA 2VZAA 2YYZA 4P71A 4POGA 4PV1C 1NY4A 3ITPA 4NDXA 4IPHA 3OIQA 5M3FG 1MKHA 3SGIA 2XWJB 1P8LA 1VQOA 2Z6BA 2JA8G 3Q6SA 2K28A 1HZBA 1FYCA 2HCIA 1CHPD 2VUMG 3OYYA 4A3KB 3BZKA 5IGBA 4K6LA 1AZQA 3P75A 1PH1A 5CBAE 3T4AC 3KLSA 3EN2A 4XTCS 1X56A 1A8VA 1I4RA 1ESRA 1VF7A 1EY7A 1S5ED 2VNUD 1CA5A 4XYQA 3FMCA 1OXXK 1AN8A 1KD1C 1CM9A 2UUAQ 2WINB 5IE8A 3S24A 5M3MH 2R93G 1AFPA 4IUUA 3OIPA 3KBXA 3J80i 3SK5A 1L1OA 1H95A 4IN3A 1U4PA 3A5UA 4R8IA 1X3EA 1VQ4A 3A8JE 1BXTA 3QOLA 2Y0SG 1ICWA 2XTIA 5IGEA 3I4MH 2A19A 2CKZB 2MHVA 4E6IA 2Q2HA 3S2HB 3UDFA 1F9QA 3S1NH 1B8AA 2UUBQ 2CCZA 1M90C 3CXCA 2EY1A 4YCVA 2ZJQA 2EYMA 5K5PA 4DV5L 4R4OA 4R4CA 5KRUA 4UPAA 2JEBI 3U58A 5C0XH 4ME5A 4TQUS 3EJIA 1F77A 2R3ZA 5I9OA 4LAAA 1KC8C 2RBMA 2MO1A 2K5DA 2UXBL 5E3FA 2IHEA 3MZ5A 1XMOQ 5FO7B 3JAML 4BY7H 3J81L 2E74C 1MBYA 4ZQ3A 4L6TB 1DYQA 2JA6B 1EQRA 1GUTA 1U4MA 4HEDA 1S72A 4A3FG 3HOUB 1U5KA 1SMYC 1W6JA 2DY7A 5DNFA 1AEXA 1ML0D 2H1EA 1UE6A 1JJGA 2Q8IB 4LMQD 4RCNA 5EPLA 1STAA 3S15H 3IFTA 1UAPA 1F9PA 3TSSA 3S16H 4A3LG 1SE4A 3F2UA 2FFKB 2PQEA 3CU7A 2JP1A 4P73A 3RNUA 3KLSX 4JVZA 3DM1A 4LF9Q 1YZ6A 2G9HD 4DR7Q 1SYEA 5IGCA 1OXUA 4DV4L 1DCZA 1IYVA 2I07B 4LFAL 1F2LA 2HQEA 3LWUA 5LMNW 4A3BH 5F2DA 4DR5Q 2B39A 4JC0A 1B50A 1JB7A 1B2TA 3PO2B 3MXNA 4A3CH 2A6HD 3KDFB 2F0MA 1MIUA 1CUKA 5EKKA 2AQ2B 3OOCA 3ZJYC 3H09A 4PZ8A 5GAHC 5K36H 2QDBA 3EFXD 4DXFA 3KLWA 3CPWA 2X69A 3H0GG 5M5YH 1XX8A 4A3IH 2UUCL 1VQNA 4RGOS 4JI8L 2VQFL 1F9RA 5ELEA 1I4XA 3DHQA 3K8AA 2D5DA 4DV0L 3AB9A 5CV9A 1HNZL 2NVXB 2EJMA 4IOAA 1OTCA 2BA1A 5ELOA 4A4IA 1EYDA 4BBSH 2UXCL 5M3FH 3GTGB 1PZJD 1PFMA 2AWNA 2D62A 3OW7A 4FVMA 4K5WA 3CMEA 4L63B 4JPBW 2R7ZB 1JORA 1IHZA 3A8IE 1V43A 4XIGS 2I5HA 4DV2L 1OO9B 1NBWA 1D1IA 5LL6X 3S17B 2Q2TA 3U50C 2VB2X 1ONLA 1HQMC 2ZTEA 1EWCA 3VA7A 3M3YH 4RKBA 4CKEA 4HMJA 3RN5A 5LL6S 3N52A 5LMNQ 1JMCA 1BCPB 1VQHA 3K5MA 1B9MA 2BH8A 2FXQA 2PMZB 2YTYA 1BCPC 2OTLA 1BCPF 4ZK9B 4BA1I 4K0KQ 3WWVA 5JOBA 1PH3A 1S5BD 1G6PA 1NR4A 2AUJD 4L5SA 2JA7B 4MNOA 1K8AC 3CRLC 4OIJA 4DV7Q 1GUWA 1IBMQ 2D9UA 1II3A 2RVLA 2MJ8A 1QUQB 3PF5A 3CRKC 4A3DH 1Q46A 3MAQA 1TWFB 3ERQA 3PQIA 4KJOA 2BDNA 3TP7A 2F0DA 2WV6D 3GTMH 1VF5C 2FHTA 1SYGA 2RKSA 3K7UC 4BA2I 1K83H 5C5LA 1HTPA 3FDTA 2RF4A 3DXJC 3GTLB 4B3SQ 2EYHA 1PRTB 3EBEA 2JA5H 2WAQB 1NCVA 3C46A 1FNWA 3NTHA 3I2ZA 5COYA 4JG2A 3EQLC 1Y1VB 1PRTC 1PRTF 3CCUA 3A5ZB 1E2VA 4MTKA 4A3GB 2EIFA 4X64L 1I5FA 1BR9A 1RDPD 1OXVA 3GQBA 1XMQQ 1TS4A 1SJHD 4EX5A 1IW7D 1QJOA 1TWAB 4FXGC 4RCOA 1O7IA 1SMYD 1XTCD 3AU7A 3CQZB 3W1BA 2K5QA 4YIJA 1X6OA 3U9SA 3HOVB 1L0YB 3TP8A 1JWMD 3HRZC 1I50B 1VQCA 3F2DA 2UXDL 3M85A 1VQIA 3PIOA 3AMUA 4QB4A 4NPSA 5DM63 4A3LH 3KJOA 2RCFA 4QCLA 4ZUIA 5EAYA 3S2DB 3HS0C 3QO2A 4O1NA 2A6EC 3RLOA 2OCEA 1H9SA 1PYBA 3BVGA 4Y7NH 1Y1WH 2G5DA 4OO1I 4CDEC 5ELNA 3M7NA 2EYOA 2E76C 4MN3A 5FLXL 4S3SA 5J3BA 2EOTA 1IKMA 1Y8NB 1V8QA 2B2YA 5IOCA 1YEZA 4J8QA 1OXSC 2HQLA 3GTKB 2UXBQ 5CV6A 3URYA 3J81E 2WAQE 1L2FA 2WIIB 4AIMA 1SEBD 4GLAC 4JCVE 4KHPL 3K5LA 1ASZA 3I73A 3GTPB 3RUZA 5M5XB 5G3LF 1VQEA 3H0GH 1TWCB 5CV4A 4F88A 2Q2UA 3RZOH 1I4QA 4JBKA 5BN4A 1Q81C 4RAUC 4XT1B 4DK3C 1K3RA 1SYDA 2RHQB 3SDZA 2K01A 5C6AA 4LUZA 3PCOB 2E2JH 3A56A 2KCTA 2CVRA 1PH7A 5C3XA 4KY5A 4XXEA 4RFBA 4RHSA 1KRTA 1H9KA 1N32L 2KQ3A 4DPGA 1U4RA 2E2HH 1W6KA 1K8OA 3K7AH 3A7AB 2WACA 3NWTA 1J9OA 4FDBA 2PI2E 3DLLA 4GNXA 2UU9L 1EQQA 5EGTA 4LFAQ 1ZYRD 4N8X1 1EIFA 4CJ1B 2O5IC 5I2XA 4JI5L 4PZ6A 5JAVA 4YCUA 3UDGA 3HOYB 4FXKC 4C3IG 5DEHA 1X9NA 3KF8B 4A3JB 4X3UA 1YHAA 3HGBA 1LABA 1QNUA 3MTSA 3A8KE 4G4KA 3L7ZC 4PQXA 3NUCA 2MGSA 1TWHB 3BJUA 2ZXPA 5BR8L 4DR1L 1BCPD 3T53B 2K1BA 3FKIB 4OGQC 2UUCQ 4JI8Q 4A3EG 2YU9H 1KDCA 4QMGA 2EY5A 3IAYA 2PQAB 1W2BA 1O7ZA 1R9TH 4FF3A 2M00A 1S40A 3LX0A 2WKDA 2WB1G 5NUCA 1K0RA 1VQPA 3NBHA 1OXTA 3F2CA 3FPUB 4FNFA 2B2TA 5FJ8H 1G291 2Z4HA 2Z1CA 4UY8C 1EIYB 4IPDA 2NB0A 5CMDA 2AQ3B 4DNRB 3IRBA 3D3RA 2NUCA 4DU9A 1R4QB 4DV2Q 1GUOA 4KV6A 3D6WA 1RCVD 4K2LA 4N8FA 2QKIC 5ELDA 4KKUA 2X6LA 5I4DA 5J39A 4B3ML 1NNXA 3NE5B 1VQ6A 3H94A 4XT3B 4IJHA 2F52A 1D5ZC 2K52A 5M3MB 2K04A 2KBNA 1SNOA 1SNMA 5L37A 1X3FA 3NK9A 2M2LA 1FJGQ 5H1SE 3CC4A 2NZOA 1Q82C 2ASBA 1SMXA 1E22A 2YV5A 3L2PA 2IPKD 5LMUL 2HIVA 1NE3A 1VQDA 1F2MA 4G7ZC 3I4MB 1YBYA 3BVZA 1K28A 1TY0A 2L0CA 3HKZB 1CQFA 5DM73 1QVGA 1G8ZD 2NZ1D 2NTTA 3PUYA 3UDXA 3KJPA 2N8NA 1HZ9A 1CQVA 3ULPA 1MI2A 3DWPA 4B9XA 4J15A 4DR6L 4KHVA 4HR7B 4IUVA 5HY6A 4LUOA 2DNEA 3S1MH 3PO3H 1JR0D 1O7YA 3CCRA 3U4ZA 5BN5A 5CGKA 1KNEA 3S9WA 4QL5A 2DNCA 2LFNA 3E0EA 3I55A 3T51B 1KTKA 4PZ7A 2ES2A 1K8MA 2JN4A 3TP6A 3C1EA 2AQ1B 1Q3LA 5EQ0A 4JYAL 1V1PB 2LXJA 4X64Q 1CT1D 4X62L 1DXMA 3PV0A 5TSSA 2MO0A 1GM5A 5G3LD 2ZXRA 2TMPA 3J80c 4V0BA 2RSNA 3RMHA 3G4SA 2NTSA 1I94L 4DR3L 2EQSA 1LTRD 1WTXA 1IBLL 3VR2A 1UE5A 1U9RA 4IOCA 4IPCA 5IGFA 2UXDQ 4WRDA 3T13A 2PPBC 3E9IA 5CORA 3GTOH 1YVCA 2B2WC 4C3HG 4L5RC 1VCIA 1JOKA 1EY4A 3BYYB 3HKZE 5EKLA 2BOSA 1KL9A 4ZUJA 1FL0A 2L9HA 1E2WA 2R7FA 2PO4A 4PMBA 4B08A 1A63A 4A75A 4UHVA 3MXPA 5C4XH 1F2YA 2OXPA 2KUMA 1YI2A 4A3MG 2CWAA 4KKSA 2V1CC 3Q22A 4A3BB 1XTDA 2LS01 1WTRA 5FLMH 1LO5D 1X55A 4ZKBB 5C4JH 5IP9G 1B70B 2EXZA 4C3IH 1LACA 4P2CB 3U4VA 4QY7A 2DJFC 3GV6A 1NUCA 1VQJA 4O2DA 3HKSA 4KHPQ 2PZWA 1YNXA 2IT1A 2PYKA 3WOEA 2KVMA 1GUSA 2B63G 2K50A 2B2VC 5M5YB 3BVMA 1E1OA 2CH4W 2HT1A 4DNTB 4A3IB 3S1RH 4K5VA 3DWQA 1HPCA 2IX1A 5JPMC 3VDYA 4R9WA 1GD7A 3T16A 2VB3X 4YWLA 1WI5A 3I4NG 3MFGA 3J7ZC 2XN9C 1PH8A 1YNJD 4PMWA 1FGBD 1KAWA 2QILA 3NTIA 4GKJQ 4BBSB 5C44H 1N32Q 2KCMA 3JAMi 4LWCA 3J81i 4Z9CB 3CCSA 2UU9Q 1B1ZA 5IYCH 5C3EB 1Y8OB 1J5EQ 1HA5A 2IX3A 4A3KG 1CSQA 1QE6A 4OXPA 2K5WA 5JJZA 2CH4A 4CGYB 3L0OA 4EQOA 2Q8TA 4HJ7A 1V1QA 1PFNA 4WJ4A 1C9OA 1STNA 4CBVA 1SJED 1RTNA 3D8GA 2A8VA 1PZKD 3TQYA 4DV6Q 4DR4L 5CV7A 3Q8DA 2NVTH 1SYCA 2RCNA 4L5TA 1WTPA 3R3OA 1DOMA 4H02A 1P16A 4ZLTF 3PIP3 4J1MA 4NMZA 5M5WH 2NVYB 3PGZA 4ZKCB 1QZGA 4QUCA 3VR5A 1H9RA 3M4OB 4OO1H 4A3DB 3D6CA 5D65A 4HMIA 2HD3A 2LY7A 5JEAJ 4BBRH 4JI3L 2ALYB 3AEVA 3KF6B 1A15A 3RR5A 2OT2A 3K59A 5J1ZA 3ONAB 1C8CA 4BY1B 4DF7A 1YJNA 1JJCB 3BDCA 1CK1A 5AFWA 3IKJA 2JA5B 2CW0C 2Z6KC 2SOBA 4BXXH 4C3JB 1ENFA 1VS0A 4TRDA 1IW7C 1VQMA 2BE5C 1JOQA 5IGGA 4JI7L 1Q8KA 4H0LC 2VW9A 5IGDA 1KNAA 1STBA 4UDUC 1LTLA 2K5HA 1G2TA 4RKLA 1B4OA 2I5LX 1EU4A 4QF4A 1BBWA 2JA6G 3TS2A 2RDHA 1XNRL 1E1TA 1HR0L 1PH2A 4GZYC 5BN3A 5LMUQ 1CA6A 3HOUG 1KIXA 1KDAA 1EOVA 3UI2A 2VY3A 3HP3A 2NBFA 1JC7A 2OEOA 3GD7A 1D1KA 1JE5A 3WDNA 4GN5A 4CHTB 1RTOA 4LW1A 3HOWH 3M4YA 1LLRD 1EEID 5CV5A 4EQNA 2GN5A 4DGZA 3BDOA 1ET9A 4Y7NB 1Y1WB 4U68A 3OHXC 5EJWA 4DR6Q 1E24A 2EY6A 1TIID 4DA2A 3A74A 2Q2IA 5D3IB 2E2IH 2B2UC 2KA7A 3Q24A 5D3DA 2AHOB 4HN7A 4RA8A 4DV1L 1VQGA 3EVQA 4R4TA 4HIKA 4JI6L 2B3GA 3BDLA 1EYCA 2R92B 1WTWA 1BKBA 3A54A 2KEDA 3PO2G 4JYAQ 1CKNA 1WJJA 1TWGH 3ULLA 1BDOA 3LGJA 4I7ZC 5JEAG 3J7YW 3F1ZA 3PSIA 4YY3L 3HOZB 2B63H 3L3OC 1EQTA 4LJZC 5EBCA 5IYBH 2JYOA 2PNRC 2EY2A 2HDMA 3CCLA 1QZHA 2DUDA 1I94Q 4DR3Q 3K57A 2F0QA 5I9PA 2MNAA 1Q1BA 1IBLQ 2E2JB 4Q0FA 3HOZG 1HHVA 3I90A 2TSSA 5KYIA 1GOZA 1S5CD 4RMFA 1S3OA 2CFMA 2JA8H 4YHHL 1ZYRC 1PH6A 4APVA 2VUMH 3SHLA 1K73C 4DUYL 2QGQA 2AWOA 1GUGA 2WP8J 2CQOA 4B9WA 3LNNA 3EIVA 5ELFA 1E2ZA 4LF5L 2R7ZG 2F1MA 3L9AX 4KI0A 5KNBA 1KHIA 2JQOA 1SLJA 1T5EA 4O42A 1EOTA 3MA2B 2R93H 1QILA 3HG9A 5E7NA 4WJ3M 4I65A 3M4QA 1XPRA 5FO8B 1DOLA 3C2PA 4GKKL 1UEBA 1ET6A 2F0VA 4LFBL 1CFMA 1LV9A 3S14H 3W5OA 3IFDA 3A7LA 5IP7G 1TY2A 2YU9B 3VYTA 1DZ1A 2EVBA 3G6EA 3TZUA 2Z9HA 4HIDA 2L1BA 1Q7YC 4ALPA 2JA7G 2IWHA 5A35A 2A68C 3I4OA 3NP8A 5EPKA 4A93B 4TKOB 5FK9C 1IZ6A 4JW0A 4RG1A 4IFDJ 2F4VL 1J6QA 3MC0B 1QB5D 1MJCA 1N9WA 1SFOH 1VQ7A 2R61A 3U9OA 1N33L 2DN8A 3HZXA 1EWHA 2EXDA 4UAIA 2CW0D 1PHJA 1B7YB 2WAQG 1HR0W 1CZGA 1WTOA 4A3FH 1LTAD 1Y1VG 2BE5D 2MFIA 4JI0L 2RHSB 1JICA 2HHHL 4A3GG 2C5CA 3V05A 3DEOA 1QNKA 2MPMA 2NVQB 1UNSA 4DR4Q 2XVSA 1WOCA 2DY8A 1H9SB 1MJEA 3CKIB 3H3VI 2EYLA 2RDFA 3O13A 3I72A 1BBUA 1Q12A 3K80C 2RQXA 3K81C 2VXWA 3AFQA 4NXNL 2H4OA 2KEEA 3HOVG 1FNVA 3PMFA 2GVBA 4DV5Q 1RODA 1HCZA 3OW2A 2KCNA 4ID6A 4JBMA 5I6YA 3FEWX 3UE0A 4C2MH 3QG1A 1N8RC 4JI3Q 1NR2A 3S1MB 3CCQA 3PO3B 4QGUA 1A3TA 1C48A 3SR1A 4KJNA 1FGUA 4C1NI 1NSNS 2N78A 5E1FA 2F0TA 3P7JA 2EJFC 2D0OA 3TP5A 4OEMB 4N9PA 3VR4A 5IIFA 2B8GA 1VQLA 1EY8A 1A6XA 3BU2A 3BZCA 5EPJA 4AYBB 2KHSA 1I6HB 4HIMA 4LUVA 4RGMA 2ZTDA 4JI7Q 5KNDA 4KD3A 5JEAH 2F03A 4HJAA 4AQYL 4IFDG 2VQEL 2GVAA 1XNRQ 3FRPB 2WFWA 1WCMB 1HR0Q 2QF7A 4M8AA 5GAGC 1KAAA 2AKWB 2K7VA 5E4WC 4GOPB 3DWAA 4GNXB 1TS2A 4UP7A 3S1QB 1C4QA 3V2TA 1G91A 4GOPC 3GTOB 4GNXC 1UE1A 3PUWA 4DV4Q 1AH9A 1X3PA 2O2LD 2YTVA 1PVOA 1YHBA 2ZTCA 3HOXB 5C4XB 4G7HC 4UP8A 1D8LA 1PFBA 3D31A 1Q90A 4RGNA 5GROA 3GTGH 1DGSA 5IYDG 4L8JA 1ILPA 2EYJA 3M9BA 4IZ8A 2R7ZH 1EUJA 1I4GA 4DK1A 2NN6I 1M8AA 5C4JB 4DV1Q 2HIXA 3FVQA 3SK4A 4JI6Q 2ENBA 3T1YL 5GAEC 1BF4A 4L5QA 1HZCA 1IL2A 3HOYG 1J8IA 2HDLA 2L15A 2PZTA 3TRZA 2IX0A 4A3JG 1IBKL 3Q23A 1STGA 4AYBE 5IT9c 4YY3Q 2F0EA 2JJQA 2K4KA 2VQFQ 3S1RB 5CYUA 4DV0Q 2ZJRA 2P5ZX 1YNJC 1HNZQ 2OQKA 5C0XJ 1KQSA 2F0OA 2B2TC 4BWGB 1HUMA 3NPPA 3MXGA 3FKIG 4MTNA 2HCCA 4B3RL 1VQ8A 1FVIA 4IURA 3KF8A 2UXCQ 4TSSA 2JSOA 4LF8L 2L55A 5C44B 1QOHA 4YHHQ 4GN3B 2SNMA 3VA5A 2A68D 2ICEC 2ATWA 3CAMA 5HGTA 1WTVA 1YJWA 2OWOA 4DUYQ 3VR6A 3QJYA 1PZID 1WFQA 1U0LA 3GTJH 3R8BA 1EY0A 3P20A 5FKAC 4KK7A 4LF5Q 2D0PA 5E4XA 3FP9A 1G51A 2PQAA 4GLVB 2XNAC 3PUXA 3C3LA 3GTLH 2K5VA 1VQBA 5CV8A 4YCWA 3EA6A 3BG3A 3W1GA 4FF1A 2BH2A 3OMCA 1PTOH 5C3WA 1Y1VH 4GKKQ 4K5XA 5M3MG 4NXML 4A3GH 1I4HA 1EIGA 4LFBQ 2NVTB 1WTQA 2WKCA 1SAPA 1VQAA 1HZAA 3S1NB 4NB3A 1LT6D 1TR5A 5M5WB 3STBD 2FMCA 2PW7A 4HSVA 2BDOA 5ELBA 1W3SA 3CQZH 1TU2B 5LHY1 1PH9A 1X3GA 3I4MG 1SDFA 1HXYD 2N55A 3G48A 4V190 3J7AF 3R93A 2F0NA 3I8ZA 4LF4L 3HOVH 4H7BA 3HKZG 1G6ZA 2K75A 1I50H 2OF1A 1SNDA 5ISRA 1JQYD 2H5XA 4OWTB 1F9SA 5IWAL 1SRUA 1NTGA 4K14A 2F4VQ 1DONA 1IKLA 1KRSA 4O0AA 3JAMc 4QQBX 5C0XG 1HNWL 2X6GA 4BY7B 3KLRA 1N33Q 4HAEA 1LT5D 4DAYA 1KLUD 1ESFA 4DR5L 1QVFA 3KFUA 1IL8A 1QWYA 1SXTA 1WYDA 1VQ9A 1PDQA 5I6WA 4LFCL 4JBWA 3M4PA 1RJTA 1TXYA 4JI0Q 4LF6L 3PUVA 1HJPA 1XNQL 4KN7C 3S15B 5FO9B 1NMFA 2RDGA 2ID0A 3S16B 2LMCB 3OMGA 3GTPH 3NQIA 1TWCH 2BA0A 4I7AA 4F7XA 2IL8A 4XQJA 1SNCA 3KUPA 3C1FA 2EDGA 4RH6A 1FNUA 2AMCB 3GTQH 1MD2D 4NXNQ 1ENAA 3HEJA 3HOWB 1V1PA 3H6MA 2D2CC 4JOIC 2RSOA 3KYHC 3CCVA 4RWSC 1HNXL 1BVSA 4CKCA 4NKLA 4A76A 2NN6G 3I7FA 1XYIA 2AUKA 4X3KA 3NBIA 1HUNA 1PH4A 1NMGA 1SE3A 1EYGA 1D7QA 3NTKA 5T1GA 4NP5A 1N34L 2NZHA 3K5OA 4A3BG 3V96A 3BS1A 1Y14B 1RIPA 1O78A 1VMPA 3CCEA 3HOYH 3DMUA 2KCCA 5JJKA 1LTBD 3R2TA 5EBDA 4K8IA 1PV4A 4HSPA 2SDFA 4A3EH 5K36G 1L0XB 4AQYQ 3IL8A 2XRQD 4MZ9A 3PF4A 4DUZL 2IW3A 1EY6A 4F8MA 4A3IG 2K03A 1SE2A 1A0IA 4DV3L 5M3FB 3QWNA 4JBJA 1PXUA 2N88A 4B3TL 1ENCA 4K8JA 1Q86C 1EZ8A 2JA8B 1UUPA 2B2VA 3MEHA 4DV7L 1RD9D 2VUMB 1AE2A 3NQTA 1L1OB 4MIUA 4BBSG 1SROA 2R7DA 4JI5Q 1L1OC 3ER0A 3M3YB 4FF2A 4CJ2C 1G2SA 1UE7A 1EQVA 3OTOL 1A3UA 2KECA 4DXGA 5C3EG 2R93B 1HQRD 1I3QH 4XQNA 4B3SL 3D0FA 3AFPA 3T1YQ 4JI4L 3TDQA 3PIPA 2F4IA 1SN8A 2E2DC 3DUZA 2F0KA 1LYLA 2QDLA 2PW5A 5BR8Q 3H3VH 2Y0SB 4DR1Q 1IBKQ 4LNQA 3VYSA 3S14B 3CCMA 1XMQL 4OONA 1S4ZA 1B3QA 2JK8A 4EGVA 4IUTA 5ELCA 4BS9A 2B8FA 3MVVA 5D14A 2KHIA 1CI3M 3I4LA 3M7GA 1Z47A 2JE6I 4OELB 1IYJB 1DJRD 4B3RQ 1SSOA 1IYUA 4LK1C 4RHRA 4OX9L 3OWFA 3E6ZX 3GTMB 3RZDH 1BBXC 1PFSA 3K5NA 4LF8Q 3E5SA 1KXLA 1CKMA 1K83B 3P1HA 4EQPA 4A3DG 2A74C 1GKHA 1LT4D 2R6GA 3K0YA 4ODGA 3SEBA 1SFOB 4K6DA 3GP7A 3MHBA 2Q8RE 1LTTD 1GHJA 4B3MQ 4IUNA 1YNND 1B9NA 3B6YA 4BY1G 4PG3A 5M9OA 1BUVT 2ZJPA 4CDDC 2JA5G 5GADC 2MUYA 3CD6A 3NWSA 1BO0A 4A3FB 4C3JG 3KF6A 1N36L 2F0WA 4KKTA 2QA4A 1ASYA 4KLKA 4NXMQ 4HJ5A 2Z6KA 2PZUA 3UDIA 2Y0SE 3MEFA 1V1OA 4IO9A 1XPUA 1A3VA 4C3HH 4X65L 1EU3A 3J80L 4X3TA 3MXNB 1VQKA 4LF4Q 2N49A 4OHJA 5FLXc 1AW7A 4C2MB 1SYFA 1XJVA 1DOKA 2QW7A 1EY9A 4DAMA 4A3MH 3VYUA 4OL7A 1Y1WG 2NN6H 1CKNB 5IWAQ 3ND9A 2NYZD 5IP9H 1HNWQ 2A73B 1B53A 1F2ZA 1EL0A 2A69D 3FHWA 3SVMA 4X62Q 2EE1A 4ZCKA 4JI1L 2LKVA 3QOJA 5IY0A 2J4XA 3SE0A 3TS0A 3H0GB 2R92G 2CQAA 3RZOB 1LTGD 4KHZA 4LFCQ 2B2UA 4FP5D 4LF6Q 1KDBA 3MXUA 1XNQQ 2O4XA 2F3WA 4IQZA 1TVXA 1XWEA 3I4NH 3AYHB 4IFDI 3GV3A 2F0GA 1K3BC 3I70A 3H91A 1YJ9A 3KDFA 2DGYA 3HFZB 4DK0A 4Y52H 1HRJA 1GJXA 2XGTA 2F0UA 1ZXTA 1GXDC 1TQOA 1Y8PB 2E2HB 4EQ5A 1CHQD 1SR3A 3K7AB 2E75C 5JVG3 1U4LA 4F87A 1Y69U 2JXMB 1MSGA 3DM3A 4ZYSA 1D2BA 3KBGA 4WORA 1WD0A 1HNXQ 4A3KH 1GUNA 4DK6C 4R8NA 3T1HL 4CKBA 2M9VA 3I91A 3H15A 3WOFA 1LUZA 5C3EH 5C4ZA 4P74A 1N34Q 2YTXA 5HURA 4OWXB 3QR8A 1K8GA 4CJ0B 4KN4C 1H9MA 4CDCC 2ZM6L 4XYOA 3I3CA 1C7YA 1LM0A 2N3SA 3Q0AA 2F0LA 1FJGL 4YWKA 1KLGD 3ZYYX 4DR2L 4IPGA 3SK6A 1XXGA 3CHBD 3ND8A 3RLNA 4HTHA 3TZDA 4DKAC 1R9TB 3AQQA 1X65A 2F0PA 4DUZQ 1X54A 3S2HH 3ULJA 4IUPA 1STEA 1EZ6A 4ULLA 2CWPA 1WVLA 4DV3Q 2I5MX 2RA4A 2NVYH 3TBIB 2NWGA 5IT9E 1GO3E 2DJGC 4B3TQ 3K0XA 1AP0A 4JI2L 3GDEA 3M4OH 3E3XA 3JC66 5EKIA 5FJ8G 1Z9FA 2F0FA 4XDXA 3RLFA 3VR3A 3GTJB 3TEHB 2J0TD 4UP9A 2CHBD 4A93G 1I6VC 1BOSA 4FF4A 1QUQA 3OTOQ 1CSPA 1QCBD 5IODA 1E3PA 4BY1H 2KOLA 1A2TA 4ME3A 2L12A 3ICEA 3R2IA 3EROA 4JI4Q 1AE3A 5CC4A 1PTOB 1JWSD 2EYFA 3DEPA 4C3JH 2JA6H 2IY5B 3J7A5 3STBC 2BCOA 1PTOC 1VDZA 3I56A 1VQ5A 3HOUH 1PTOF 4JV5L 1EEFD 3E0JA 2JEAI 1B3AA 2K5NA 4X66L 1CZWA 4ABNA 1E7ZA 4X3SA 1RL2A 5JJIA 1M4VA 3MWYW 2PMZE 1HH2P 2A5HA 1EFWA 1PLFA 2IJ0A 4KD4A 2VS1A 2V4DA 2B2YC 4OX9Q 4LF7L 1D5XC 1JCKB 5KEEA 2Z4IA 1HFNA 1PH5A 2IHFA 2PNHA 2XSCA 1MGSA 2EZVA 2E8GA 3F8TA 4POFA 3PIO3 4G7OC 4CDFC 1PYWD 3KK7A 1BNZA 1JE4A 3PO3G 1O80A 1HTLD 5C0XI 5AJ3L 2PI2A 2HUGA 1GHKA 3CF5A 2L5TA 3PO2H 4WFN3 5JJLA 4QIWB 4HJ9A 1NAPA 2E5LL 2B29A 2R92H 3JAME 5I2YA 5KGUA 1T5XD 1N36Q 1E0BA 4AYBG 4IUQA 2F3IA 3MFYA 5GQOA 3X3NA 3FPPA 1LTID 1STYA 4WJWA 4FYDA 2I0QA 1A62A 4R1JA 3HOZH 5KYLA 5A2QL 2QEJC 1WCMG 2NVXH 1O7LA 1JB3A 4DAPA 4R4QA 3J80E 4X65Q 3GTQB 5JPNC 1GVPA 1NJIC 3CMAA 1EY5A 2LSSA 4GKJL 1TT2A 4PNYA 3N6RA 4GN4B 1LT3D 2F0HA 2KENA 3HOXG 4C3IB 5C4XG 1I4PA 4DN4M 5KNCA 4GOPA 3S17H 1DD2A 1BQQT 1K0SA 1RF2D 4TVAB 1J5EL 1VQFA 2XIWA 3ERSX 2XRSD 1DM0B 2EJGC 3G71A 1EYAA 4H13C 5FLMG 2UUAL 1SBBB 4JI1Q 1ZKOA 4GLXA 3NBHB 3CC7A 4OWWB 1V9PA 4QIWE 5IP7H 3J81j 1B44D 1Q8IA 4A3EB 5C4HA 4KTAA 3NENA 2ZXOA 4DV6L 1TKWB 2LXKA 4OIKA 4DNIA 1X3QA 3CP0A 2WB1B 2JA9A 2JA7H 5DAUA 3CC2A 4H44C 5KIXA 2UUBL 3NXWA 4R4IA 3CCJA 3NEMA 2EPBA 3QIAA 3E9HA 1JWUD 1PA6A 2K05A 3W2DA 1TWFH 3OWEB 2F0IA 3RD4A 1EFID 5C44G 1ILQA 4K2KA 4XQQA 2QCPX 4FXDA 4N9TA 2QEXA 3T56B 1TS5A 4A93H 1FR3A 1LTSD 3SXHA 1ZEQX 3CW2C 3T1HQ 2F3VA 5IYCG 2K14A 2SNSA 1I3QB 1Z6HA 2I46A 3PUZA 1XMOL 2PCFB 5C5MA 5FOBB 5HGQA 4P72A 1WD1A 3RN2A 4P75A 5J22A 2K6AA 2ZM6Q 1QVCA 1PRTD 1PMRA 3NELA 1TWAH 4C56C 1PTOD 3H3VC 4DR2Q 2SEBD 4YWMA 1QG7A 4ZRZA 2NVQH 1XPOA 1SNQA 3A55A 1STHA 2FINB 4BBRB 2FMMA 1FD7D 4Q5VA 2MP1A 3RZDB 5DLQE 2WB1E 3S2DH 1SE8A 4LF9L 1RKNA 4HIOA 4DAYB 4DR7L 4JI2Q 1R4PB 1RHPA 4OO1G 3CPFA 4DFAA 3J81c 3OPOA 1YHQA 1YNNC 2L4NA 4BBRG 3X3MA 4GS3A 2A6ED 1Q1EA 3TREA 2FJ2A 1H9JA 3BZDB 2O5JC 3G6JB 4IALA 3W3AA 1YITA 2ICIA 3K6OA 3SK8A 4BY7G 4IJLA 1HA6A 1CTMA 2ZT9C 3GTKH 4BXXG 2L11A 3TMEA 2HHHQ 3QB3A 1D6EC 4X6AH 5CBEE 1S5DD 2K32A 4IFDH
chains in the Genus database with same CATH topology
2VL6A 4A3DG 4LFBL 4FDBA 2PI2E 1GKHA 3W5OA 5M5XH 2R6GA 3DLLA 2KHJA 4GNXA 2UU9L 3S14H 1EQQA 4JV5Q 1I6HH 4LFAQ 2OQ0A 5IP7G 1EIFA 4X66Q 3GO5A 4JI5L 1PYSB 1YIJA 4PZ6A 3G6EA 4B3MQ 4HIDA 2A1AA 4YCUA 3UDGA 4QJFA 1EWIA 3B6YA 4BY1G 1WCMH 4PG3A 1Q7YC 1X9NA 2ZJPA 4ALPA 4AH6A 2JA5G 3KF8B 2JA7G 2OTJA 5GADC 3CD6A 3S1QH 1YHAA 3I4OA 4LF7Q 3KF6A 1N36L 2QA4A 3L7ZC 3HOWG 5IYDH 3A0JA 1ASYA 1IZ6A 1UWVA 4KLKA 4NXMQ 4RG1A 4HJ5A 4IFDJ 2F4VL 3BJUA 1J6QA 5BR8L 2Z6KA 4DR1L 3UDIA 1MJCA 1N9WA 1SFOH 2Y0SE 3HOXH 1VQ7A 2UUCQ 3MEFA 1C0AA 4IO9A 4JI8Q 4A3EG 2YU9H 1N33L 1JT8A 1XPUA 4C3HH 5AJ3Q 3F2BA 2EXDA 4JOIA 4X65L 2PQAB 1W2BA 1PHJA 1IXRA 1R9TH 1B7YB 4A3CG 3KOJA 1S40A 2WB1G 2WAQG 3MXNB 1HR0W 1K0RA 1VQPA 4A3JH 1VQKA 4LF4Q 4A3FH 1OXTA 3F2CA 5LMNL 1Y1VG 2MFIA 2C35B 2N49A 4JI0L 5FLXc 2E5LQ 5FJ8H 2RHSB 1G291 4UY8C 1EIYB 1XJVA 2VQEQ 4IPDA 2HHHL 4A3GG 4DAMA 4A3MH 1T9HA 4DR4Q 1TWHH 1Y1WG 1WOCA 4K0KL 3IRBA 1CKNB 5IWAQ 1CKOA 1MJEA 3H3VI 5IP9H 4DV2Q 3FKIH 4HJ8A 1L0WA 1HNWQ 1JJ2A 5IYBG 1K9MC 3UE1A 1BBUA 2Z0SA 1Q12A 1M1KC 3K80C 3FHWA 4B3ML 3K81C 1IBML 2MQHA 3AFQA 4NXNL 1VQ6A 2VZAA 2YYZA 4IJHA 4P71A 2F52A 4X62Q 4POGA 1NY4A 4JI1L 2K52A 2GVBA 5IY0A 4DV5Q 4IPHA 3TS0A 2KBNA 5M3FG 1MKHA 3OW2A 1X3FA 3SGIA 2R92G 4JBMA 1FJGQ 1P8LA 5H1SE 4KHZA 1VQOA 4LFCQ 3CC4A 3UE0A 4C2MH 2NZOA 4LF6Q 2JA8G 1HZBA 1Q82C 1N8RC 4JI3Q 2ASBA 1SMXA 1XNQQ 3CCQA 2VUMG 1E22A 3OYYA 4QGUA 3BZKA 2YV5A 1FGUA 3L2PA 5LMUL 2HIVA 3AYHB 1PH1A 1NE3A 3I4NH 4IFDI 1VQDA 2N78A 1YJ9A 3EN2A 4XTCS 3KDFA 1X56A 1YBYA 1A8VA 2DGYA 3HFZB 4Y52H 2D0OA 2XGTA 1VQLA 1QVGA 3BU2A 2VNUD 4EQ5A 1SR3A 3PUYA 3BZCA 3UDXA 1OXXK 1KD1C 2UUAQ 5IE8A 3KJPA 2N8NA 3S24A 1HZ9A 5M3MH 2R93G 3DM3A 4HIMA 3ULPA 4LUVA 3J80i 2ZTDA 4JI7Q 1L1OA 1H95A 4J15A 4DR6L 3A5UA 5HY6A 4LUOA 4HJAA 3S1MH 4AQYL 1HNXQ 3PO3H 1X3EA 1VQ4A 4IFDG 4A3KH 2VQEL 2GVAA 1XNRQ 2Y0SG 2WFWA 3CCRA 3U4ZA 2XTIA 1HR0Q 4DK6C 3T1HL 5GAGC 3I4MH 2A19A 2AKWB 4GOPB 2CKZB 4QL5A 3H15A 4UP7A 4GNXB 2Q2HA 1LUZA 3E0EA 3UDFA 5C3EH 4P74A 3I55A 3S1NH 1N34Q 4PZ7A 1B8AA 4GOPC 2ES2A 2UUBQ 2CCZA 2YTXA 4GNXC 1M90C 4OWXB 1UE1A 1K8GA 3PUWA 3CXCA 4DV4Q 4JYAL 2LXJA 1AH9A 4YCVA 4X64Q 2ZJQA 2YTVA 4X62L 2ZM6L 1YHBA 1PVOA 4DV5L 4R4OA 2ZTCA 3PV0A 4R4CA 4UPAA 1C7YA 2N3SA 1LM0A 4UP8A 1D8LA 2JEBI 2MO0A 3D31A 1FJGL 3U58A 1GM5A 4YWKA 4DR2L 4IPGA 4TQUS 1DGSA 5GROA 3J80c 3G4SA 5IYDG 3GTGH 3RLNA 3M9BA 4DKAC 1KC8C 1I94L 4DR3L 1EUJA 2EQSA 3AQQA 1X65A 2R7ZH 1IBLL 2NN6I 4DUZQ 2MO1A 1UE5A 2HIXA 4DV1Q 1X54A 3S2HH 4IOCA 4IPCA 3ULJA 4JI6Q 2UXDQ 2CWPA 2UXBL 3T1YL 2IHEA 3E9IA 5GAEC 4DV3Q 2I5MX 1XMOQ 3GTOH 4L5QA 1YVCA 1HZCA 4L5RC 2NVYH 1IL2A 4BY7H 1VCIA 3HOYG 4B3TQ 1GO3E 3HKZE 2L15A 3K0XA 1KL9A 4JI2L 1FL0A 2R7FA 1EQRA 3TRZA 2IX0A 3GDEA 4A3JG 1IBKL 3M4OH 4A75A 4A3FG 1S72A 1A63A 1U5KA 5C4XH 4AYBE 3JC66 5IT9c 4YY3Q 2K4KA 2JJQA 5FJ8G 1Z9FA 3RLFA 2VQFQ 4A93G 3TEHB 1UE6A 4UP9A 4DV0Q 2ZJRA 1YI2A 1JJGA 4A3MG 1HNZQ 2OQKA 2CWAA 5C0XJ 2V1CC 1KQSA 3S15H 1XTDA 1QUQA 3OTOQ 5FLMH 1X55A 5C4JH 5IP9G 1CSPA 3FKIG 1B70B 4MTNA 4C3IH 4B3RL 1E3PA 4BY1H 1VQ8A 1FVIA 3S16H 4A3LG 3U4VA 2UXCQ 4ME3A 3ICEA 4QY7A 4P73A 4JI4Q 3RNUA 4LF8L 1AE3A 4C3JH 4GN3B 4YHHQ 4LF9Q 2JA6H 1YZ6A 2ATWA 1VQJA 4O2DA 3CAMA 4DR7Q 3HKSA 3J7A5 3STBC 4KHPQ 2IY5B 1YNXA 2IT1A 1OXUA 4DV4L 1YJWA 2OWOA 2B63G 3I56A 2K50A 1VQ5A 3HOUH 4JV5L 4DUYQ 4LFAL 1E1OA 2JEAI 2HT1A 3S1RH 2K5NA 4X66L 1WFQA 1U0LA 3GTJH 1E7ZA 2IX1A 3VDYA 1RL2A 5LMNW 1GD7A 4LF5Q 4A3BH 4DR5Q 2D0PA 4YWLA 1WI5A 3I4NG 3FP9A 1G51A 5JJIA 2PQAA 4GLVB 4JC0A 3J7ZC 3PUXA 1JB7A 2PMZE 3GTLH 1HH2P 1PH8A 2K5VA 1EFWA 1VQBA 4A3CH 4PMWA 1KAWA 3KDFB 4YCWA 3W1GA 1MIUA 2VS1A 1CUKA 2BH2A 4OX9Q 4GKJQ 4LF7L 3ZJYC 4PZ8A 5GAHC 5C44H 1Y1VH 1N32Q 1PH5A 4GKKQ 2KCMA 2IHFA 3JAMi 4LWCA 5M3MG 3J81i 4NXML 2PNHA 3KLWA 4A3GH 3CPWA 2E8GA 3H0GG 4LFBQ 5M5YH 3F8TA 3CCSA 4POFA 2UU9Q 4A3IH 2UUCL 5IYCH 1VQAA 1HZAA 1VQNA 4NB3A 4JI8L 1J5EQ 2VQFL 3STBD 3PO3G 4A3KG 5C0XI 3K8AA 1CSQA 5AJ3L 2PI2A 4OXPA 4DV0L 1W3SA 1HNZL 3CQZH 1PH9A 1X3GA 3CF5A 3G48A 3I4MG 3L0OA 4IOAA 1OTCA 3PO2H 4HJ7A 1V1QA 4LF4L 5JJLA 2BA1A 5ELOA 4A4IA 3HKZG 3HOVH 2K75A 1I50H 4HJ9A 4WJ4A 1C9OA 4BBSH 2UXCL 2E5LL 5M3FH 2B29A 2R92H 2AWNA 2D62A 2A8VA 3TQYA 3CMEA 4DV6Q 1N36Q 4AYBG 2H5XA 4DR4L 1V43A 3Q8DA 4OWTB 2F3IA 2NVTH 5GQOA 2RCNA 1SRUA 1NTGA 4L5TA 4XIGS 5IWAL 2F4VQ 2I5HA 4DV2L 1KRSA 1NBWA 4O0AA 3JAMc 4H02A 2I0QA 1P16A 2Q2TA 1A62A 3U50C 4R1JA 5C0XG 3HOZH 4QQBX 1HNWL 5M5WH 1N33Q 3PGZA 1QZGA 1WCMG 2ZTEA 2NVXH 3M3YH 4R4QA 4DR5L 4X65Q 1QVFA 3KFUA 3RN5A 1WYDA 1VQ9A 1GVPA 4LFCL 1NJIC 4JBWA 5LMNQ 1JMCA 3M4PA 1TXYA 1VQHA 5JEAJ 4BBRH 3CMAA 4JI0Q 2LSSA 4LF6L 4JI3L 4GKJL 2ALYB 3PUVA 2BH8A 1HJPA 2FXQA 3KF6B 1XNQL 3AEVA 3RR5A 2YTYA 1NMFA 4GN4B 2OTLA 2ID0A 2KENA 4BA1I 3HOXG 4K0KQ 3WWVA 5C4XG 4GOPA 1YJNA 1JJCB 1PH3A 3GTPH 3S17H 1G6PA 4L5SA 1TWCH 2BA0A 4MNOA 2Z6KC 4BXXH 4TVAB 1J5EL 1VQFA 1K8AC 3ERSX 4DV7Q 1VS0A 3G71A 2AMCB 5FLMG 1IBMQ 2UUAL 3GTQH 4NXNQ 1VQMA 1QUQB 3PF5A 4JI1Q 4GLXA 4JOIC 4JI7L 3NBHB 1Q8KA 2VW9A 1Q46A 4A3DH 3CC7A 4OWWB 1LTLA 2K5HA 1V9PA 3KYHC 4QIWE 3CCVA 5IP7H 1BVSA 3J81j 1HNXL 2I5LX 4A76A 3GTMH 2JA6G 1BBWA 2NN6G 3I7FA 3K7UC 1XNRL 3TS2A 1E1TA 3NENA 1HR0L 4DV6L 1PH2A 1PH4A 4BA2I 1NMGA 1K83H 5LMUQ 2LXKA 3HOUG 2RF4A 1KIXA 1EYGA 1D7QA 4B3SQ 4DNIA 3CP0A 3EBEA 2JA5H 1EOVA 2JA9A 2JA7H 2VY3A 3CC2A 1N34L 3I2ZA 2UUBL 2NZHA 4JG2A 4A3BG 4R4IA 3CCJA 3NEMA 3GD7A 1JE5A 3CCUA 3A5ZB 4GN5A 1Y14B 4LW1A 1RIPA 3HOWH 2EIFA 3E9HA 4X64L 3CCEA 3HOYH 1I5FA 1PA6A 2GN5A 1OXVA 1XMQQ 1TWFH 5JJKA 4EX5A 4DR6Q 1E24A 1PV4A 5C44G 4A3EH 3A74A 5K36G 2Q2IA 4AQYQ 2E2IH 1O7IA 3W1BA 2QEXA 4A93H 2AHOB 4MZ9A 3PF4A 1X6OA 3CW2C 4DUZL 4DV1L 3T1HQ 4A3IG 5IYCG 1VQCA 1VQGA 2K14A 4R4TA 3F2DA 1A0IA 4HIKA 4JI6L 2UXDL 3M85A 1VQIA 2B3GA 3PUZA 3PIOA 4DV3L 1XMOL 4NPSA 4JBJA 4A3LH 3KJOA 5HGQA 4B3TL 4P72A 1Q86C 1BKBA 5EAYA 4P75A 3RN2A 4DV7L 3PO2G 4JYAQ 1CKNA 1AE2A 1WJJA 3RLOA 2OCEA 1PYBA 1TWGH 3ULLA 4Y7NH 1Y1WH 2ZM6Q 1QVCA 1L1OB 3LGJA 5JEAG 4OO1I 4BBSG 3F1ZA 3PSIA 4YY3L 2B63H 1SROA 1TWAH 2R7DA 3NELA 5ELNA 4JI5Q 1L1OC 3M7NA 4DR2Q 3ER0A 5IYBH 5J3BA 4YWMA 1UE7A 3OTOL 3CCLA 1QZHA 2DUDA 1I94Q 4DR3Q 2NVQH 2MNAA 1Q1BA 5C3EG 1IBLQ 1XPOA 1I3QH 1YEZA 3HOZG 4B3SL 1OXSC 2HQLA 3D0FA 3AFPA 2UXBQ 3T1YQ 4RMFA 1S3OA 2CFMA 4JI4L 5DLQE 2WB1E 2WAQE 3PIPA 2JA8H 1SN8A 1L2FA 1SE8A 4YHHL 4AIMA 4LF9L 3S2DH 4HIOA 1PH6A 4DAYB 4GLAC 4JCVE 4APVA 2VUMH 4DR7L 4JI2Q 1LYLA 4KHPL 4OO1G 5BR8Q 1ASZA 4DR1Q 3CPFA 3H3VH 1K73C 1IBKQ 4LNQA 4DUYL 2QGQA 3J81c 1YHQA 2AWOA 3CCMA 1VQEA 1XMQL 2WP8J 2CQOA 4OONA 2JK8A 3H0GH 4BBRG 4GS3A 2Q2UA 3RZOH 4JBKA 3EIVA 1Q81C 4LF5L 2R7ZG 1Q1EA 4DK3C 4KI0A 1K3RA 3TREA 1KHIA 2JQOA 2KHIA 2RHQB 1SLJA 1Z47A 2JE6I 4LUZA 1YITA 3PCOB 2E2JH 3HOVG 2R93H 1IYJB 2KCTA 1PH7A 5E7NA 4B3RQ 4BY7G 4IJLA 4WJ3M 3GTKH 4BXXG 4OX9L 3M4QA 3RZDH 1XPRA 1KRTA 2HHHQ 1N32L 1PFSA 4DPGA 2E2HH 4LF8Q 4GKKL 4X6AH 1UEBA 1KXLA 3K7AH 1CKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL6 A;  4A3D G;  4LFB L;  4FDB A;  2PI2 E;  1GKH A;  3W5O A;  5M5X H;  2R6G A;  3DLL A;  2KHJ A;  4GNX A;  2UU9 L;  3S14 H;  1EQQ A;  4JV5 Q;  1I6H H;  4LFA Q;  2OQ0 A;  5IP7 G;  1EIF A;  4X66 Q;  3GO5 A;  4JI5 L;  1PYS B;  1YIJ A;  4PZ6 A;  3G6E A;  4B3M Q;  4HID A;  2A1A A;  4YCU A;  3UDG A;  4QJF A;  1EWI A;  3B6Y A;  4BY1 G;  1WCM H;  4PG3 A;  1Q7Y C;  1X9N A;  2ZJP A;  4ALP A;  4AH6 A;  2JA5 G;  3KF8 B;  2JA7 G;  2OTJ A;  5GAD C;  3CD6 A;  3S1Q H;  1YHA A;  3I4O A;  4LF7 Q;  3KF6 A;  1N36 L;  2QA4 A;  3L7Z C;  3HOW G;  5IYD H;  3A0J A;  1ASY A;  1IZ6 A;  1UWV A;  4KLK A;  4NXM Q;  4RG1 A;  4HJ5 A;  4IFD J;  2F4V L;  3BJU A;  1J6Q A;  5BR8 L;  2Z6K A;  4DR1 L;  3UDI A;  1MJC A;  1N9W A;  1SFO H;  2Y0S E;  3HOX H;  1VQ7 A;  2UUC Q;  3MEF A;  1C0A A;  4IO9 A;  4JI8 Q;  4A3E G;  2YU9 H;  1N33 L;  1JT8 A;  1XPU A;  4C3H H;  5AJ3 Q;  3F2B A;  2EXD A;  4JOI A;  4X65 L;  2PQA B;  1W2B A;  1PHJ A;  1IXR A;  1R9T H;  1B7Y B;  4A3C G;  3KOJ A;  1S40 A;  2WB1 G;  2WAQ G;  3MXN B;  1HR0 W;  1K0R A;  1VQP A;  4A3J H;  1VQK A;  4LF4 Q;  4A3F H;  1OXT A;  3F2C A;  5LMN L;  1Y1V G;  2MFI A;  2C35 B;  2N49 A;  4JI0 L;  5FLX c;  2E5L Q;  5FJ8 H;  2RHS B;  1G29 1;  4UY8 C;  1EIY B;  1XJV A;  2VQE Q;  4IPD A;  2HHH L;  4A3G G;  4DAM A;  4A3M H;  1T9H A;  4DR4 Q;  1TWH H;  1Y1W G;  1WOC A;  4K0K L;  3IRB A;  1CKN B;  5IWA Q;  1CKO A;  1MJE A;  3H3V I;  5IP9 H;  4DV2 Q;  3FKI H;  4HJ8 A;  1L0W A;  1HNW Q;  1JJ2 A;  5IYB G;  1K9M C;  3UE1 A;  1BBU A;  2Z0S A;  1Q12 A;  1M1K C;  3K80 C;  3FHW A;  4B3M L;  3K81 C;  1IBM L;  2MQH A;  3AFQ A;  4NXN L;  1VQ6 A;  2VZA A;  2YYZ A;  4IJH A;  4P71 A;  2F52 A;  4X62 Q;  4POG A;  1NY4 A;  4JI1 L;  2K52 A;  2GVB A;  5IY0 A;  4DV5 Q;  4IPH A;  3TS0 A;  2KBN A;  5M3F G;  1MKH A;  3OW2 A;  1X3F A;  3SGI A;  2R92 G;  4JBM A;  1FJG Q;  1P8L A;  5H1S E;  4KHZ A;  1VQO A;  4LFC Q;  3CC4 A;  3UE0 A;  4C2M H;  2NZO A;  4LF6 Q;  2JA8 G;  1HZB A;  1Q82 C;  1N8R C;  4JI3 Q;  2ASB A;  1SMX A;  1XNQ Q;  3CCQ A;  2VUM G;  1E22 A;  3OYY A;  4QGU A;  3BZK A;  2YV5 A;  1FGU A;  3L2P A;  5LMU L;  2HIV A;  3AYH B;  1PH1 A;  1NE3 A;  3I4N H;  4IFD I;  1VQD A;  2N78 A;  1YJ9 A;  3EN2 A;  4XTC S;  3KDF A;  1X56 A;  1YBY A;  1A8V A;  2DGY A;  3HFZ B;  4Y52 H;  2D0O A;  2XGT A;  1VQL A;  1QVG A;  3BU2 A;  2VNU D;  4EQ5 A;  1SR3 A;  3PUY A;  3BZC A;  3UDX A;  1OXX K;  1KD1 C;  2UUA Q;  5IE8 A;  3KJP A;  2N8N A;  3S24 A;  1HZ9 A;  5M3M H;  2R93 G;  3DM3 A;  4HIM A;  3ULP A;  4LUV A;  3J80 i;  2ZTD A;  4JI7 Q;  1L1O A;  1H95 A;  4J15 A;  4DR6 L;  3A5U A;  5HY6 A;  4LUO A;  4HJA A;  3S1M H;  4AQY L;  1HNX Q;  3PO3 H;  1X3E A;  1VQ4 A;  4IFD G;  4A3K H;  2VQE L;  2GVA A;  1XNR Q;  2Y0S G;  2WFW A;  3CCR A;  3U4Z A;  2XTI A;  1HR0 Q;  4DK6 C;  3T1H L;  5GAG C;  3I4M H;  2A19 A;  2AKW B;  4GOP B;  2CKZ B;  4QL5 A;  3H15 A;  4UP7 A;  4GNX B;  2Q2H A;  1LUZ A;  3E0E A;  3UDF A;  5C3E H;  4P74 A;  3I55 A;  3S1N H;  1N34 Q;  4PZ7 A;  1B8A A;  4GOP C;  2ES2 A;  2UUB Q;  2CCZ A;  2YTX A;  4GNX C;  1M90 C;  4OWX B;  1UE1 A;  1K8G A;  3PUW A;  3CXC A;  4DV4 Q;  4JYA L;  2LXJ A;  1AH9 A;  4YCV A;  4X64 Q;  2ZJQ A;  2YTV A;  4X62 L;  2ZM6 L;  1YHB A;  1PVO A;  4DV5 L;  4R4O A;  2ZTC A;  3PV0 A;  4R4C A;  4UPA A;  1C7Y A;  2N3S A;  1LM0 A;  4UP8 A;  1D8L A;  2JEB I;  2MO0 A;  3D31 A;  1FJG L;  3U58 A;  1GM5 A;  4YWK A;  4DR2 L;  4IPG A;  4TQU S;  1DGS A;  5GRO A;  3J80 c;  3G4S A;  5IYD G;  3GTG H;  3RLN A;  3M9B A;  4DKA C;  1KC8 C;  1I94 L;  4DR3 L;  1EUJ A;  2EQS A;  3AQQ A;  1X65 A;  2R7Z H;  1IBL L;  2NN6 I;  4DUZ Q;  2MO1 A;  1UE5 A;  2HIX A;  4DV1 Q;  1X54 A;  3S2H H;  4IOC A;  4IPC A;  3ULJ A;  4JI6 Q;  2UXD Q;  2CWP A;  2UXB L;  3T1Y L;  2IHE A;  3E9I A;  5GAE C;  4DV3 Q;  2I5M X;  1XMO Q;  3GTO H;  4L5Q A;  1YVC A;  1HZC A;  4L5R C;  2NVY H;  1IL2 A;  4BY7 H;  1VCI A;  3HOY G;  4B3T Q;  1GO3 E;  3HKZ E;  2L15 A;  3K0X A;  1KL9 A;  4JI2 L;  1FL0 A;  2R7F A;  1EQR A;  3TRZ A;  2IX0 A;  3GDE A;  4A3J G;  1IBK L;  3M4O H;  4A75 A;  4A3F G;  1S72 A;  1A63 A;  1U5K A;  5C4X H;  4AYB E;  3JC6 6;  5IT9 c;  4YY3 Q;  2K4K A;  2JJQ A;  5FJ8 G;  1Z9F A;  3RLF A;  2VQF Q;  4A93 G;  3TEH B;  1UE6 A;  4UP9 A;  4DV0 Q;  2ZJR A;  1YI2 A;  1JJG A;  4A3M G;  1HNZ Q;  2OQK A;  2CWA A;  5C0X J;  2V1C C;  1KQS A;  3S15 H;  1XTD A;  1QUQ A;  3OTO Q;  5FLM H;  1X55 A;  5C4J H;  5IP9 G;  1CSP A;  3FKI G;  1B70 B;  4MTN A;  4C3I H;  4B3R L;  1E3P A;  4BY1 H;  1VQ8 A;  1FVI A;  3S16 H;  4A3L G;  3U4V A;  2UXC Q;  4ME3 A;  3ICE A;  4QY7 A;  4P73 A;  4JI4 Q;  3RNU A;  4LF8 L;  1AE3 A;  4C3J H;  4GN3 B;  4YHH Q;  4LF9 Q;  2JA6 H;  1YZ6 A;  2ATW A;  1VQJ A;  4O2D A;  3CAM A;  4DR7 Q;  3HKS A;  3J7A 5;  3STB C;  4KHP Q;  2IY5 B;  1YNX A;  2IT1 A;  1OXU A;  4DV4 L;  1YJW A;  2OWO A;  2B63 G;  3I56 A;  2K50 A;  1VQ5 A;  3HOU H;  4JV5 L;  4DUY Q;  4LFA L;  1E1O A;  2JEA I;  2HT1 A;  3S1R H;  2K5N A;  4X66 L;  1WFQ A;  1U0L A;  3GTJ H;  1E7Z A;  2IX1 A;  3VDY A;  1RL2 A;  5LMN W;  1GD7 A;  4LF5 Q;  4A3B H;  4DR5 Q;  2D0P A;  4YWL A;  1WI5 A;  3I4N G;  3FP9 A;  1G51 A;  5JJI A;  2PQA A;  4GLV B;  4JC0 A;  3J7Z C;  3PUX A;  1JB7 A;  2PMZ E;  3GTL H;  1HH2 P;  1PH8 A;  2K5V A;  1EFW A;  1VQB A;  4A3C H;  4PMW A;  1KAW A;  3KDF B;  4YCW A;  3W1G A;  1MIU A;  2VS1 A;  1CUK A;  2BH2 A;  4OX9 Q;  4GKJ Q;  4LF7 L;  3ZJY C;  4PZ8 A;  5GAH C;  5C44 H;  1Y1V H;  1N32 Q;  1PH5 A;  4GKK Q;  2KCM A;  2IHF A;  3JAM i;  4LWC A;  5M3M G;  3J81 i;  4NXM L;  2PNH A;  3KLW A;  4A3G H;  3CPW A;  2E8G A;  3H0G G;  4LFB Q;  5M5Y H;  3F8T A;  3CCS A;  4POF A;  2UU9 Q;  4A3I H;  2UUC L;  5IYC H;  1VQA A;  1HZA A;  1VQN A;  4NB3 A;  4JI8 L;  1J5E Q;  2VQF L;  3STB D;  3PO3 G;  4A3K G;  5C0X I;  3K8A A;  1CSQ A;  5AJ3 L;  2PI2 A;  4OXP A;  4DV0 L;  1W3S A;  1HNZ L;  3CQZ H;  1PH9 A;  1X3G A;  3CF5 A;  3G48 A;  3I4M G;  3L0O A;  4IOA A;  1OTC A;  3PO2 H;  4HJ7 A;  1V1Q A;  4LF4 L;  5JJL A;  2BA1 A;  5ELO A;  4A4I A;  3HKZ G;  3HOV H;  2K75 A;  1I50 H;  4HJ9 A;  4WJ4 A;  1C9O A;  4BBS H;  2UXC L;  2E5L L;  5M3F H;  2B29 A;  2R92 H;  2AWN A;  2D62 A;  2A8V A;  3TQY A;  3CME A;  4DV6 Q;  1N36 Q;  4AYB G;  2H5X A;  4DR4 L;  1V43 A;  3Q8D A;  4OWT B;  2F3I A;  2NVT H;  5GQO A;  2RCN A;  1SRU A;  1NTG A;  4L5T A;  4XIG S;  5IWA L;  2F4V Q;  2I5H A;  4DV2 L;  1KRS A;  1NBW A;  4O0A A;  3JAM c;  4H02 A;  2I0Q A;  1P16 A;  2Q2T A;  1A62 A;  3U50 C;  4R1J A;  5C0X G;  3HOZ H;  4QQB X;  1HNW L;  5M5W H;  1N33 Q;  3PGZ A;  1QZG A;  1WCM G;  2ZTE A;  2NVX H;  3M3Y H;  4R4Q A;  4DR5 L;  4X65 Q;  1QVF A;  3KFU A;  3RN5 A;  1WYD A;  1VQ9 A;  1GVP A;  4LFC L;  1NJI C;  4JBW A;  5LMN Q;  1JMC A;  3M4P A;  1TXY A;  1VQH A;  5JEA J;  4BBR H;  3CMA A;  4JI0 Q;  2LSS A;  4LF6 L;  4JI3 L;  4GKJ L;  2ALY B;  3PUV A;  2BH8 A;  1HJP A;  2FXQ A;  3KF6 B;  1XNQ L;  3AEV A;  3RR5 A;  2YTY A;  1NMF A;  4GN4 B;  2OTL A;  2ID0 A;  2KEN A;  4BA1 I;  3HOX G;  4K0K Q;  3WWV A;  5C4X G;  4GOP A;  1YJN A;  1JJC B;  1PH3 A;  3GTP H;  3S17 H;  1G6P A;  4L5S A;  1TWC H;  2BA0 A;  4MNO A;  2Z6K C;  4BXX H;  4TVA B;  1J5E L;  1VQF A;  1K8A C;  3ERS X;  4DV7 Q;  1VS0 A;  3G71 A;  2AMC B;  5FLM G;  1IBM Q;  2UUA L;  3GTQ H;  4NXN Q;  1VQM A;  1QUQ B;  3PF5 A;  4JI1 Q;  4GLX A;  4JOI C;  4JI7 L;  3NBH B;  1Q8K A;  2VW9 A;  1Q46 A;  4A3D H;  3CC7 A;  4OWW B;  1LTL A;  2K5H A;  1V9P A;  3KYH C;  4QIW E;  3CCV A;  5IP7 H;  1BVS A;  3J81 j;  1HNX L;  2I5L X;  4A76 A;  3GTM H;  2JA6 G;  1BBW A;  2NN6 G;  3I7F A;  3K7U C;  1XNR L;  3TS2 A;  1E1T A;  3NEN A;  1HR0 L;  4DV6 L;  1PH2 A;  1PH4 A;  4BA2 I;  1NMG A;  1K83 H;  5LMU Q;  2LXK A;  3HOU G;  2RF4 A;  1KIX A;  1EYG A;  1D7Q A;  4B3S Q;  4DNI A;  3CP0 A;  3EBE A;  2JA5 H;  1EOV A;  2JA9 A;  2JA7 H;  2VY3 A;  3CC2 A;  1N34 L;  3I2Z A;  2UUB L;  2NZH A;  4JG2 A;  4A3B G;  4R4I A;  3CCJ A;  3NEM A;  3GD7 A;  1JE5 A;  3CCU A;  3A5Z B;  4GN5 A;  1Y14 B;  4LW1 A;  1RIP A;  3HOW H;  2EIF A;  3E9H A;  4X64 L;  3CCE A;  3HOY H;  1I5F A;  1PA6 A;  2GN5 A;  1OXV A;  1XMQ Q;  1TWF H;  5JJK A;  4EX5 A;  4DR6 Q;  1E24 A;  1PV4 A;  5C44 G;  4A3E H;  3A74 A;  5K36 G;  2Q2I A;  4AQY Q;  2E2I H;  1O7I A;  3W1B A;  2QEX A;  4A93 H;  2AHO B;  4MZ9 A;  3PF4 A;  1X6O A;  3CW2 C;  4DUZ L;  4DV1 L;  3T1H Q;  4A3I G;  5IYC G;  1VQC A;  1VQG A;  2K14 A;  4R4T A;  3F2D A;  1A0I A;  4HIK A;  4JI6 L;  2UXD L;  3M85 A;  1VQI A;  2B3G A;  3PUZ A;  3PIO A;  4DV3 L;  1XMO L;  4NPS A;  4JBJ A;  4A3L H;  3KJO A;  5HGQ A;  4B3T L;  4P72 A;  1Q86 C;  1BKB A;  5EAY A;  4P75 A;  3RN2 A;  4DV7 L;  3PO2 G;  4JYA Q;  1CKN A;  1AE2 A;  1WJJ A;  3RLO A;  2OCE A;  1PYB A;  1TWG H;  3ULL A;  4Y7N H;  1Y1W H;  2ZM6 Q;  1QVC A;  1L1O B;  3LGJ A;  5JEA G;  4OO1 I;  4BBS G;  3F1Z A;  3PSI A;  4YY3 L;  2B63 H;  1SRO A;  1TWA H;  2R7D A;  3NEL A;  5ELN A;  4JI5 Q;  1L1O C;  3M7N A;  4DR2 Q;  3ER0 A;  5IYB H;  5J3B A;  4YWM A;  1UE7 A;  3OTO L;  3CCL A;  1QZH A;  2DUD A;  1I94 Q;  4DR3 Q;  2NVQ H;  2MNA A;  1Q1B A;  5C3E G;  1IBL Q;  1XPO A;  1I3Q H;  1YEZ A;  3HOZ G;  4B3S L;  1OXS C;  2HQL A;  3D0F A;  3AFP A;  2UXB Q;  3T1Y Q;  4RMF A;  1S3O A;  2CFM A;  4JI4 L;  5DLQ E;  2WB1 E;  2WAQ E;  3PIP A;  2JA8 H;  1SN8 A;  1L2F A;  1SE8 A;  4YHH L;  4AIM A;  4LF9 L;  3S2D H;  4HIO A;  1PH6 A;  4DAY B;  4GLA C;  4JCV E;  4APV A;  2VUM H;  4DR7 L;  4JI2 Q;  1LYL A;  4KHP L;  4OO1 G;  5BR8 Q;  1ASZ A;  4DR1 Q;  3CPF A;  3H3V H;  1K73 C;  1IBK Q;  4LNQ A;  4DUY L;  2QGQ A;  3J81 c;  1YHQ A;  2AWO A;  3CCM A;  1VQE A;  1XMQ L;  2WP8 J;  2CQO A;  4OON A;  2JK8 A;  3H0G H;  4BBR G;  4GS3 A;  2Q2U A;  3RZO H;  4JBK A;  3EIV A;  1Q81 C;  4LF5 L;  2R7Z G;  1Q1E A;  4DK3 C;  4KI0 A;  1K3R A;  3TRE A;  1KHI A;  2JQO A;  2KHI A;  2RHQ B;  1SLJ A;  1Z47 A;  2JE6 I;  4LUZ A;  1YIT A;  3PCO B;  2E2J H;  3HOV G;  2R93 H;  1IYJ B;  2KCT A;  1PH7 A;  5E7N A;  4B3R Q;  4BY7 G;  4IJL A;  4WJ3 M;  3GTK H;  4BXX G;  4OX9 L;  3M4Q A;  3RZD H;  1XPR A;  1KRT A;  2HHH Q;  1N32 L;  1PFS A;  4DPG A;  2E2H H;  4LF8 Q;  4GKK L;  4X6A H;  1UEB A;  1KXL A;  3K7A H;  1CKM A; 
#chains in the Genus database with same CATH topology
 4NW2 A;  2XWB B;  2VL6 A;  4HCS A;  4U67 3;  4G57 A;  1HFG A;  1UEA B;  5M5X H;  1I6H H;  2KHJ A;  4JV5 Q;  1VMC A;  3OSO A;  2OQ0 A;  2KJX A;  2EYP A;  4X66 Q;  2K33 A;  1WTH A;  3GO5 A;  3D4R A;  1PYS B;  1YIJ A;  1MSH A;  4C3H B;  2A1A A;  4QUF A;  4QJF A;  1EWI A;  1WCM H;  4FO2 A;  4C1N K;  4AH6 A;  1Z7T A;  1X32 A;  2OTJ A;  3S1Q H;  1JOO A;  4LF7 Q;  4HCE A;  2E2I B;  4KY7 A;  1AZP A;  3HOW G;  5IYD H;  3J7A V;  1TS3 A;  3A0J A;  5CR3 A;  2GA4 B;  4A3M B;  1UWV A;  2C9O A;  2B2W A;  2A69 C;  3HOX H;  1C0A A;  1JT8 A;  4KY6 A;  1A2U A;  1ICF B;  1SNP A;  5AJ3 Q;  1S5F D;  2F0J A;  3VYR A;  3F2B A;  4JOI A;  2A6H C;  3TN2 A;  5FLX E;  4J6H A;  1IXR A;  4A3C G;  1TWG B;  3KOJ A;  4KMU C;  5T1I A;  4A3J H;  2J7Z A;  1D5M C;  2B63 B;  4ILW A;  4MHE A;  5LMN L;  2C35 B;  2G9D A;  4EVO A;  4JK1 C;  4PMC A;  2E5L Q;  3G7L A;  4ZAI A;  4RGT A;  2VQE Q;  3BYT B;  3LWE A;  1T9H A;  4M1U B;  1TWH H;  3I4N B;  2F0S A;  4K0K L;  1CKO A;  1MHW C;  1EIH A;  4HJ8 A;  3FKI H;  3NHH A;  3NSW A;  1SYB A;  1L0W A;  3D4D A;  4DAV A;  3K58 A;  5JVH 3;  3D4W A;  5A2Q E;  1JJ2 A;  5IYB G;  5IT9 L;  3UE1 A;  2Z0S A;  1KAB A;  1K9M C;  1M1K C;  2Z8L A;  1IBM L;  2MQH A;  2VZA A;  2YYZ A;  4P71 A;  4POG A;  4PV1 C;  1NY4 A;  3ITP A;  4NDX A;  4IPH A;  3OIQ A;  5M3F G;  1MKH A;  3SGI A;  2XWJ B;  1P8L A;  1VQO A;  2Z6B A;  2JA8 G;  3Q6S A;  2K28 A;  1HZB A;  1FYC A;  2HCI A;  1CHP D;  2VUM G;  3OYY A;  4A3K B;  3BZK A;  5IGB A;  4K6L A;  1AZQ A;  3P75 A;  1PH1 A;  5CBA E;  3T4A C;  3KLS A;  3EN2 A;  4XTC S;  1X56 A;  1A8V A;  1I4R A;  1ESR A;  1VF7 A;  1EY7 A;  1S5E D;  2VNU D;  1CA5 A;  4XYQ A;  3FMC A;  1OXX K;  1AN8 A;  1KD1 C;  1CM9 A;  2UUA Q;  2WIN B;  5IE8 A;  3S24 A;  5M3M H;  2R93 G;  1AFP A;  4IUU A;  3OIP A;  3KBX A;  3J80 i;  3SK5 A;  1L1O A;  1H95 A;  4IN3 A;  1U4P A;  3A5U A;  4R8I A;  1X3E A;  1VQ4 A;  3A8J E;  1BXT A;  3QOL A;  2Y0S G;  1ICW A;  2XTI A;  5IGE A;  3I4M H;  2A19 A;  2CKZ B;  2MHV A;  4E6I A;  2Q2H A;  3S2H B;  3UDF A;  1F9Q A;  3S1N H;  1B8A A;  2UUB Q;  2CCZ A;  1M90 C;  3CXC A;  2EY1 A;  4YCV A;  2ZJQ A;  2EYM A;  5K5P A;  4DV5 L;  4R4O A;  4R4C A;  5KRU A;  4UPA A;  2JEB I;  3U58 A;  5C0X H;  4ME5 A;  4TQU S;  3EJI A;  1F77 A;  2R3Z A;  5I9O A;  4LAA A;  1KC8 C;  2RBM A;  2MO1 A;  2K5D A;  2UXB L;  5E3F A;  2IHE A;  3MZ5 A;  1XMO Q;  5FO7 B;  3JAM L;  4BY7 H;  3J81 L;  2E74 C;  1MBY A;  4ZQ3 A;  4L6T B;  1DYQ A;  2JA6 B;  1EQR A;  1GUT A;  1U4M A;  4HED A;  1S72 A;  4A3F G;  3HOU B;  1U5K A;  1SMY C;  1W6J A;  2DY7 A;  5DNF A;  1AEX A;  1ML0 D;  2H1E A;  1UE6 A;  1JJG A;  2Q8I B;  4LMQ D;  4RCN A;  5EPL A;  1STA A;  3S15 H;  3IFT A;  1UAP A;  1F9P A;  3TSS A;  3S16 H;  4A3L G;  1SE4 A;  3F2U A;  2FFK B;  2PQE A;  3CU7 A;  2JP1 A;  4P73 A;  3RNU A;  3KLS X;  4JVZ A;  3DM1 A;  4LF9 Q;  1YZ6 A;  2G9H D;  4DR7 Q;  1SYE A;  5IGC A;  1OXU A;  4DV4 L;  1DCZ A;  1IYV A;  2I07 B;  4LFA L;  1F2L A;  2HQE A;  3LWU A;  5LMN W;  4A3B H;  5F2D A;  4DR5 Q;  2B39 A;  4JC0 A;  1B50 A;  1JB7 A;  1B2T A;  3PO2 B;  3MXN A;  4A3C H;  2A6H D;  3KDF B;  2F0M A;  1MIU A;  1CUK A;  5EKK A;  2AQ2 B;  3OOC A;  3ZJY C;  3H09 A;  4PZ8 A;  5GAH C;  5K36 H;  2QDB A;  3EFX D;  4DXF A;  3KLW A;  3CPW A;  2X69 A;  3H0G G;  5M5Y H;  1XX8 A;  4A3I H;  2UUC L;  1VQN A;  4RGO S;  4JI8 L;  2VQF L;  1F9R A;  5ELE A;  1I4X A;  3DHQ A;  3K8A A;  2D5D A;  4DV0 L;  3AB9 A;  5CV9 A;  1HNZ L;  2NVX B;  2EJM A;  4IOA A;  1OTC A;  2BA1 A;  5ELO A;  4A4I A;  1EYD A;  4BBS H;  2UXC L;  5M3F H;  3GTG B;  1PZJ D;  1PFM A;  2AWN A;  2D62 A;  3OW7 A;  4FVM A;  4K5W A;  3CME A;  4L63 B;  4JPB W;  2R7Z B;  1JOR A;  1IHZ A;  3A8I E;  1V43 A;  4XIG S;  2I5H A;  4DV2 L;  1OO9 B;  1NBW A;  1D1I A;  5LL6 X;  3S17 B;  2Q2T A;  3U50 C;  2VB2 X;  1ONL A;  1HQM C;  2ZTE A;  1EWC A;  3VA7 A;  3M3Y H;  4RKB A;  4CKE A;  4HMJ A;  3RN5 A;  5LL6 S;  3N52 A;  5LMN Q;  1JMC A;  1BCP B;  1VQH A;  3K5M A;  1B9M A;  2BH8 A;  2FXQ A;  2PMZ B;  2YTY A;  1BCP C;  2OTL A;  1BCP F;  4ZK9 B;  4BA1 I;  4K0K Q;  3WWV A;  5JOB A;  1PH3 A;  1S5B D;  1G6P A;  1NR4 A;  2AUJ D;  4L5S A;  2JA7 B;  4MNO A;  1K8A C;  3CRL C;  4OIJ A;  4DV7 Q;  1GUW A;  1IBM Q;  2D9U A;  1II3 A;  2RVL A;  2MJ8 A;  1QUQ B;  3PF5 A;  3CRK C;  4A3D H;  1Q46 A;  3MAQ A;  1TWF B;  3ERQ A;  3PQI A;  4KJO A;  2BDN A;  3TP7 A;  2F0D A;  2WV6 D;  3GTM H;  1VF5 C;  2FHT A;  1SYG A;  2RKS A;  3K7U C;  4BA2 I;  1K83 H;  5C5L A;  1HTP A;  3FDT A;  2RF4 A;  3DXJ C;  3GTL B;  4B3S Q;  2EYH A;  1PRT B;  3EBE A;  2JA5 H;  2WAQ B;  1NCV A;  3C46 A;  1FNW A;  3NTH A;  3I2Z A;  5COY A;  4JG2 A;  3EQL C;  1Y1V B;  1PRT C;  1PRT F;  3CCU A;  3A5Z B;  1E2V A;  4MTK A;  4A3G B;  2EIF A;  4X64 L;  1I5F A;  1BR9 A;  1RDP D;  1OXV A;  3GQB A;  1XMQ Q;  1TS4 A;  1SJH D;  4EX5 A;  1IW7 D;  1QJO A;  1TWA B;  4FXG C;  4RCO A;  1O7I A;  1SMY D;  1XTC D;  3AU7 A;  3CQZ B;  3W1B A;  2K5Q A;  4YIJ A;  1X6O A;  3U9S A;  3HOV B;  1L0Y B;  3TP8 A;  1JWM D;  3HRZ C;  1I50 B;  1VQC A;  3F2D A;  2UXD L;  3M85 A;  1VQI A;  3PIO A;  3AMU A;  4QB4 A;  4NPS A;  5DM6 3;  4A3L H;  3KJO A;  2RCF A;  4QCL A;  4ZUI A;  5EAY A;  3S2D B;  3HS0 C;  3QO2 A;  4O1N A;  2A6E C;  3RLO A;  2OCE A;  1H9S A;  1PYB A;  3BVG A;  4Y7N H;  1Y1W H;  2G5D A;  4OO1 I;  4CDE C;  5ELN A;  3M7N A;  2EYO A;  2E76 C;  4MN3 A;  5FLX L;  4S3S A;  5J3B A;  2EOT A;  1IKM A;  1Y8N B;  1V8Q A;  2B2Y A;  5IOC A;  1YEZ A;  4J8Q A;  1OXS C;  2HQL A;  3GTK B;  2UXB Q;  5CV6 A;  3URY A;  3J81 E;  2WAQ E;  1L2F A;  2WII B;  4AIM A;  1SEB D;  4GLA C;  4JCV E;  4KHP L;  3K5L A;  1ASZ A;  3I73 A;  3GTP B;  3RUZ A;  5M5X B;  5G3L F;  1VQE A;  3H0G H;  1TWC B;  5CV4 A;  4F88 A;  2Q2U A;  3RZO H;  1I4Q A;  4JBK A;  5BN4 A;  1Q81 C;  4RAU C;  4XT1 B;  4DK3 C;  1K3R A;  1SYD A;  2RHQ B;  3SDZ A;  2K01 A;  5C6A A;  4LUZ A;  3PCO B;  2E2J H;  3A56 A;  2KCT A;  2CVR A;  1PH7 A;  5C3X A;  4KY5 A;  4XXE A;  4RFB A;  4RHS A;  1KRT A;  1H9K A;  1N32 L;  2KQ3 A;  4DPG A;  1U4R A;  2E2H H;  1W6K A;  1K8O A;  3K7A H;  3A7A B;  2WAC A;  3NWT A;  1J9O A;  4FDB A;  2PI2 E;  3DLL A;  4GNX A;  2UU9 L;  1EQQ A;  5EGT A;  4LFA Q;  1ZYR D;  4N8X 1;  1EIF A;  4CJ1 B;  2O5I C;  5I2X A;  4JI5 L;  4PZ6 A;  5JAV A;  4YCU A;  3UDG A;  3HOY B;  4FXK C;  4C3I G;  5DEH A;  1X9N A;  3KF8 B;  4A3J B;  4X3U A;  1YHA A;  3HGB A;  1LAB A;  1QNU A;  3MTS A;  3A8K E;  4G4K A;  3L7Z C;  4PQX A;  3NUC A;  2MGS A;  1TWH B;  3BJU A;  2ZXP A;  5BR8 L;  4DR1 L;  1BCP D;  3T53 B;  2K1B A;  3FKI B;  4OGQ C;  2UUC Q;  4JI8 Q;  4A3E G;  2YU9 H;  1KDC A;  4QMG A;  2EY5 A;  3IAY A;  2PQA B;  1W2B A;  1O7Z A;  1R9T H;  4FF3 A;  2M00 A;  1S40 A;  3LX0 A;  2WKD A;  2WB1 G;  5NUC A;  1K0R A;  1VQP A;  3NBH A;  1OXT A;  3F2C A;  3FPU B;  4FNF A;  2B2T A;  5FJ8 H;  1G29 1;  2Z4H A;  2Z1C A;  4UY8 C;  1EIY B;  4IPD A;  2NB0 A;  5CMD A;  2AQ3 B;  4DNR B;  3IRB A;  3D3R A;  2NUC A;  4DU9 A;  1R4Q B;  4DV2 Q;  1GUO A;  4KV6 A;  3D6W A;  1RCV D;  4K2L A;  4N8F A;  2QKI C;  5ELD A;  4KKU A;  2X6L A;  5I4D A;  5J39 A;  4B3M L;  1NNX A;  3NE5 B;  1VQ6 A;  3H94 A;  4XT3 B;  4IJH A;  2F52 A;  1D5Z C;  2K52 A;  5M3M B;  2K04 A;  2KBN A;  1SNO A;  1SNM A;  5L37 A;  1X3F A;  3NK9 A;  2M2L A;  1FJG Q;  5H1S E;  3CC4 A;  2NZO A;  1Q82 C;  2ASB A;  1SMX A;  1E22 A;  2YV5 A;  3L2P A;  2IPK D;  5LMU L;  2HIV A;  1NE3 A;  1VQD A;  1F2M A;  4G7Z C;  3I4M B;  1YBY A;  3BVZ A;  1K28 A;  1TY0 A;  2L0C A;  3HKZ B;  1CQF A;  5DM7 3;  1QVG A;  1G8Z D;  2NZ1 D;  2NTT A;  3PUY A;  3UDX A;  3KJP A;  2N8N A;  1HZ9 A;  1CQV A;  3ULP A;  1MI2 A;  3DWP A;  4B9X A;  4J15 A;  4DR6 L;  4KHV A;  4HR7 B;  4IUV A;  5HY6 A;  4LUO A;  2DNE A;  3S1M H;  3PO3 H;  1JR0 D;  1O7Y A;  3CCR A;  3U4Z A;  5BN5 A;  5CGK A;  1KNE A;  3S9W A;  4QL5 A;  2DNC A;  2LFN A;  3E0E A;  3I55 A;  3T51 B;  1KTK A;  4PZ7 A;  2ES2 A;  1K8M A;  2JN4 A;  3TP6 A;  3C1E A;  2AQ1 B;  1Q3L A;  5EQ0 A;  4JYA L;  1V1P B;  2LXJ A;  4X64 Q;  1CT1 D;  4X62 L;  1DXM A;  3PV0 A;  5TSS A;  2MO0 A;  1GM5 A;  5G3L D;  2ZXR A;  2TMP A;  3J80 c;  4V0B A;  2RSN A;  3RMH A;  3G4S A;  2NTS A;  1I94 L;  4DR3 L;  2EQS A;  1LTR D;  1WTX A;  1IBL L;  3VR2 A;  1UE5 A;  1U9R A;  4IOC A;  4IPC A;  5IGF A;  2UXD Q;  4WRD A;  3T13 A;  2PPB C;  3E9I A;  5COR A;  3GTO H;  1YVC A;  2B2W C;  4C3H G;  4L5R C;  1VCI A;  1JOK A;  1EY4 A;  3BYY B;  3HKZ E;  5EKL A;  2BOS A;  1KL9 A;  4ZUJ A;  1FL0 A;  2L9H A;  1E2W A;  2R7F A;  2PO4 A;  4PMB A;  4B08 A;  1A63 A;  4A75 A;  4UHV A;  3MXP A;  5C4X H;  1F2Y A;  2OXP A;  2KUM A;  1YI2 A;  4A3M G;  2CWA A;  4KKS A;  2V1C C;  3Q22 A;  4A3B B;  1XTD A;  2LS0 1;  1WTR A;  5FLM H;  1LO5 D;  1X55 A;  4ZKB B;  5C4J H;  5IP9 G;  1B70 B;  2EXZ A;  4C3I H;  1LAC A;  4P2C B;  3U4V A;  4QY7 A;  2DJF C;  3GV6 A;  1NUC A;  1VQJ A;  4O2D A;  3HKS A;  4KHP Q;  2PZW A;  1YNX A;  2IT1 A;  2PYK A;  3WOE A;  2KVM A;  1GUS A;  2B63 G;  2K50 A;  2B2V C;  5M5Y B;  3BVM A;  1E1O A;  2CH4 W;  2HT1 A;  4DNT B;  4A3I B;  3S1R H;  4K5V A;  3DWQ A;  1HPC A;  2IX1 A;  5JPM C;  3VDY A;  4R9W A;  1GD7 A;  3T16 A;  2VB3 X;  4YWL A;  1WI5 A;  3I4N G;  3MFG A;  3J7Z C;  2XN9 C;  1PH8 A;  1YNJ D;  4PMW A;  1FGB D;  1KAW A;  2QIL A;  3NTI A;  4GKJ Q;  4BBS B;  5C44 H;  1N32 Q;  2KCM A;  3JAM i;  4LWC A;  3J81 i;  4Z9C B;  3CCS A;  2UU9 Q;  1B1Z A;  5IYC H;  5C3E B;  1Y8O B;  1J5E Q;  1HA5 A;  2IX3 A;  4A3K G;  1CSQ A;  1QE6 A;  4OXP A;  2K5W A;  5JJZ A;  2CH4 A;  4CGY B;  3L0O A;  4EQO A;  2Q8T A;  4HJ7 A;  1V1Q A;  1PFN A;  4WJ4 A;  1C9O A;  1STN A;  4CBV A;  1SJE D;  1RTN A;  3D8G A;  2A8V A;  1PZK D;  3TQY A;  4DV6 Q;  4DR4 L;  5CV7 A;  3Q8D A;  2NVT H;  1SYC A;  2RCN A;  4L5T A;  1WTP A;  3R3O A;  1DOM A;  4H02 A;  1P16 A;  4ZLT F;  3PIP 3;  4J1M A;  4NMZ A;  5M5W H;  2NVY B;  3PGZ A;  4ZKC B;  1QZG A;  4QUC A;  3VR5 A;  1H9R A;  3M4O B;  4OO1 H;  4A3D B;  3D6C A;  5D65 A;  4HMI A;  2HD3 A;  2LY7 A;  5JEA J;  4BBR H;  4JI3 L;  2ALY B;  3AEV A;  3KF6 B;  1A15 A;  3RR5 A;  2OT2 A;  3K59 A;  5J1Z A;  3ONA B;  1C8C A;  4BY1 B;  4DF7 A;  1YJN A;  1JJC B;  3BDC A;  1CK1 A;  5AFW A;  3IKJ A;  2JA5 B;  2CW0 C;  2Z6K C;  2SOB A;  4BXX H;  4C3J B;  1ENF A;  1VS0 A;  4TRD A;  1IW7 C;  1VQM A;  2BE5 C;  1JOQ A;  5IGG A;  4JI7 L;  1Q8K A;  4H0L C;  2VW9 A;  5IGD A;  1KNA A;  1STB A;  4UDU C;  1LTL A;  2K5H A;  1G2T A;  4RKL A;  1B4O A;  2I5L X;  1EU4 A;  4QF4 A;  1BBW A;  2JA6 G;  3TS2 A;  2RDH A;  1XNR L;  1E1T A;  1HR0 L;  1PH2 A;  4GZY C;  5BN3 A;  5LMU Q;  1CA6 A;  3HOU G;  1KIX A;  1KDA A;  1EOV A;  3UI2 A;  2VY3 A;  3HP3 A;  2NBF A;  1JC7 A;  2OEO A;  3GD7 A;  1D1K A;  1JE5 A;  3WDN A;  4GN5 A;  4CHT B;  1RTO A;  4LW1 A;  3HOW H;  3M4Y A;  1LLR D;  1EEI D;  5CV5 A;  4EQN A;  2GN5 A;  4DGZ A;  3BDO A;  1ET9 A;  4Y7N B;  1Y1W B;  4U68 A;  3OHX C;  5EJW A;  4DR6 Q;  1E24 A;  2EY6 A;  1TII D;  4DA2 A;  3A74 A;  2Q2I A;  5D3I B;  2E2I H;  2B2U C;  2KA7 A;  3Q24 A;  5D3D A;  2AHO B;  4HN7 A;  4RA8 A;  4DV1 L;  1VQG A;  3EVQ A;  4R4T A;  4HIK A;  4JI6 L;  2B3G A;  3BDL A;  1EYC A;  2R92 B;  1WTW A;  1BKB A;  3A54 A;  2KED A;  3PO2 G;  4JYA Q;  1CKN A;  1WJJ A;  1TWG H;  3ULL A;  1BDO A;  3LGJ A;  4I7Z C;  5JEA G;  3J7Y W;  3F1Z A;  3PSI A;  4YY3 L;  3HOZ B;  2B63 H;  3L3O C;  1EQT A;  4LJZ C;  5EBC A;  5IYB H;  2JYO A;  2PNR C;  2EY2 A;  2HDM A;  3CCL A;  1QZH A;  2DUD A;  1I94 Q;  4DR3 Q;  3K57 A;  2F0Q A;  5I9P A;  2MNA A;  1Q1B A;  1IBL Q;  2E2J B;  4Q0F A;  3HOZ G;  1HHV A;  3I90 A;  2TSS A;  5KYI A;  1GOZ A;  1S5C D;  4RMF A;  1S3O A;  2CFM A;  2JA8 H;  4YHH L;  1ZYR C;  1PH6 A;  4APV A;  2VUM H;  3SHL A;  1K73 C;  4DUY L;  2QGQ A;  2AWO A;  1GUG A;  2WP8 J;  2CQO A;  4B9W A;  3LNN A;  3EIV A;  5ELF A;  1E2Z A;  4LF5 L;  2R7Z G;  2F1M A;  3L9A X;  4KI0 A;  5KNB A;  1KHI A;  2JQO A;  1SLJ A;  1T5E A;  4O42 A;  1EOT A;  3MA2 B;  2R93 H;  1QIL A;  3HG9 A;  5E7N A;  4WJ3 M;  4I65 A;  3M4Q A;  1XPR A;  5FO8 B;  1DOL A;  3C2P A;  4GKK L;  1UEB A;  1ET6 A;  2F0V A;  4LFB L;  1CFM A;  1LV9 A;  3S14 H;  3W5O A;  3IFD A;  3A7L A;  5IP7 G;  1TY2 A;  2YU9 B;  3VYT A;  1DZ1 A;  2EVB A;  3G6E A;  3TZU A;  2Z9H A;  4HID A;  2L1B A;  1Q7Y C;  4ALP A;  2JA7 G;  2IWH A;  5A35 A;  2A68 C;  3I4O A;  3NP8 A;  5EPK A;  4A93 B;  4TKO B;  5FK9 C;  1IZ6 A;  4JW0 A;  4RG1 A;  4IFD J;  2F4V L;  1J6Q A;  3MC0 B;  1QB5 D;  1MJC A;  1N9W A;  1SFO H;  1VQ7 A;  2R61 A;  3U9O A;  1N33 L;  2DN8 A;  3HZX A;  1EWH A;  2EXD A;  4UAI A;  2CW0 D;  1PHJ A;  1B7Y B;  2WAQ G;  1HR0 W;  1CZG A;  1WTO A;  4A3F H;  1LTA D;  1Y1V G;  2BE5 D;  2MFI A;  4JI0 L;  2RHS B;  1JIC A;  2HHH L;  4A3G G;  2C5C A;  3V05 A;  3DEO A;  1QNK A;  2MPM A;  2NVQ B;  1UNS A;  4DR4 Q;  2XVS A;  1WOC A;  2DY8 A;  1H9S B;  1MJE A;  3CKI B;  3H3V I;  2EYL A;  2RDF A;  3O13 A;  3I72 A;  1BBU A;  1Q12 A;  3K80 C;  2RQX A;  3K81 C;  2VXW A;  3AFQ A;  4NXN L;  2H4O A;  2KEE A;  3HOV G;  1FNV A;  3PMF A;  2GVB A;  4DV5 Q;  1ROD A;  1HCZ A;  3OW2 A;  2KCN A;  4ID6 A;  4JBM A;  5I6Y A;  3FEW X;  3UE0 A;  4C2M H;  3QG1 A;  1N8R C;  4JI3 Q;  1NR2 A;  3S1M B;  3CCQ A;  3PO3 B;  4QGU A;  1A3T A;  1C48 A;  3SR1 A;  4KJN A;  1FGU A;  4C1N I;  1NSN S;  2N78 A;  5E1F A;  2F0T A;  3P7J A;  2EJF C;  2D0O A;  3TP5 A;  4OEM B;  4N9P A;  3VR4 A;  5IIF A;  2B8G A;  1VQL A;  1EY8 A;  1A6X A;  3BU2 A;  3BZC A;  5EPJ A;  4AYB B;  2KHS A;  1I6H B;  4HIM A;  4LUV A;  4RGM A;  2ZTD A;  4JI7 Q;  5KND A;  4KD3 A;  5JEA H;  2F03 A;  4HJA A;  4AQY L;  4IFD G;  2VQE L;  2GVA A;  1XNR Q;  3FRP B;  2WFW A;  1WCM B;  1HR0 Q;  2QF7 A;  4M8A A;  5GAG C;  1KAA A;  2AKW B;  2K7V A;  5E4W C;  4GOP B;  3DWA A;  4GNX B;  1TS2 A;  4UP7 A;  3S1Q B;  1C4Q A;  3V2T A;  1G91 A;  4GOP C;  3GTO B;  4GNX C;  1UE1 A;  3PUW A;  4DV4 Q;  1AH9 A;  1X3P A;  2O2L D;  2YTV A;  1PVO A;  1YHB A;  2ZTC A;  3HOX B;  5C4X B;  4G7H C;  4UP8 A;  1D8L A;  1PFB A;  3D31 A;  1Q90 A;  4RGN A;  5GRO A;  3GTG H;  1DGS A;  5IYD G;  4L8J A;  1ILP A;  2EYJ A;  3M9B A;  4IZ8 A;  2R7Z H;  1EUJ A;  1I4G A;  4DK1 A;  2NN6 I;  1M8A A;  5C4J B;  4DV1 Q;  2HIX A;  3FVQ A;  3SK4 A;  4JI6 Q;  2ENB A;  3T1Y L;  5GAE C;  1BF4 A;  4L5Q A;  1HZC A;  1IL2 A;  3HOY G;  1J8I A;  2HDL A;  2L15 A;  2PZT A;  3TRZ A;  2IX0 A;  4A3J G;  1IBK L;  3Q23 A;  1STG A;  4AYB E;  5IT9 c;  4YY3 Q;  2F0E A;  2JJQ A;  2K4K A;  2VQF Q;  3S1R B;  5CYU A;  4DV0 Q;  2ZJR A;  2P5Z X;  1YNJ C;  1HNZ Q;  2OQK A;  5C0X J;  1KQS A;  2F0O A;  2B2T C;  4BWG B;  1HUM A;  3NPP A;  3MXG A;  3FKI G;  4MTN A;  2HCC A;  4B3R L;  1VQ8 A;  1FVI A;  4IUR A;  3KF8 A;  2UXC Q;  4TSS A;  2JSO A;  4LF8 L;  2L55 A;  5C44 B;  1QOH A;  4YHH Q;  4GN3 B;  2SNM A;  3VA5 A;  2A68 D;  2ICE C;  2ATW A;  3CAM A;  5HGT A;  1WTV A;  1YJW A;  2OWO A;  4DUY Q;  3VR6 A;  3QJY A;  1PZI D;  1WFQ A;  1U0L A;  3GTJ H;  3R8B A;  1EY0 A;  3P20 A;  5FKA C;  4KK7 A;  4LF5 Q;  2D0P A;  5E4X A;  3FP9 A;  1G51 A;  2PQA A;  4GLV B;  2XNA C;  3PUX A;  3C3L A;  3GTL H;  2K5V A;  1VQB A;  5CV8 A;  4YCW A;  3EA6 A;  3BG3 A;  3W1G A;  4FF1 A;  2BH2 A;  3OMC A;  1PTO H;  5C3W A;  1Y1V H;  4GKK Q;  4K5X A;  5M3M G;  4NXM L;  4A3G H;  1I4H A;  1EIG A;  4LFB Q;  2NVT B;  1WTQ A;  2WKC A;  1SAP A;  1VQA A;  1HZA A;  3S1N B;  4NB3 A;  1LT6 D;  1TR5 A;  5M5W B;  3STB D;  2FMC A;  2PW7 A;  4HSV A;  2BDO A;  5ELB A;  1W3S A;  3CQZ H;  1TU2 B;  5LHY 1;  1PH9 A;  1X3G A;  3I4M G;  1SDF A;  1HXY D;  2N55 A;  3G48 A;  4V19 0;  3J7A F;  3R93 A;  2F0N A;  3I8Z A;  4LF4 L;  3HOV H;  4H7B A;  3HKZ G;  1G6Z A;  2K75 A;  1I50 H;  2OF1 A;  1SND A;  5ISR A;  1JQY D;  2H5X A;  4OWT B;  1F9S A;  5IWA L;  1SRU A;  1NTG A;  4K14 A;  2F4V Q;  1DON A;  1IKL A;  1KRS A;  4O0A A;  3JAM c;  4QQB X;  5C0X G;  1HNW L;  2X6G A;  4BY7 B;  3KLR A;  1N33 Q;  4HAE A;  1LT5 D;  4DAY A;  1KLU D;  1ESF A;  4DR5 L;  1QVF A;  3KFU A;  1IL8 A;  1QWY A;  1SXT A;  1WYD A;  1VQ9 A;  1PDQ A;  5I6W A;  4LFC L;  4JBW A;  3M4P A;  1RJT A;  1TXY A;  4JI0 Q;  4LF6 L;  3PUV A;  1HJP A;  1XNQ L;  4KN7 C;  3S15 B;  5FO9 B;  1NMF A;  2RDG A;  2ID0 A;  3S16 B;  2LMC B;  3OMG A;  3GTP H;  3NQI A;  1TWC H;  2BA0 A;  4I7A A;  4F7X A;  2IL8 A;  4XQJ A;  1SNC A;  3KUP A;  3C1F A;  2EDG A;  4RH6 A;  1FNU A;  2AMC B;  3GTQ H;  1MD2 D;  4NXN Q;  1ENA A;  3HEJ A;  3HOW B;  1V1P A;  3H6M A;  2D2C C;  4JOI C;  2RSO A;  3KYH C;  3CCV A;  4RWS C;  1HNX L;  1BVS A;  4CKC A;  4NKL A;  4A76 A;  2NN6 G;  3I7F A;  1XYI A;  2AUK A;  4X3K A;  3NBI A;  1HUN A;  1PH4 A;  1NMG A;  1SE3 A;  1EYG A;  1D7Q A;  3NTK A;  5T1G A;  4NP5 A;  1N34 L;  2NZH A;  3K5O A;  4A3B G;  3V96 A;  3BS1 A;  1Y14 B;  1RIP A;  1O78 A;  1VMP A;  3CCE A;  3HOY H;  3DMU A;  2KCC A;  5JJK A;  1LTB D;  3R2T A;  5EBD A;  4K8I A;  1PV4 A;  4HSP A;  2SDF A;  4A3E H;  5K36 G;  1L0X B;  4AQY Q;  3IL8 A;  2XRQ D;  4MZ9 A;  3PF4 A;  4DUZ L;  2IW3 A;  1EY6 A;  4F8M A;  4A3I G;  2K03 A;  1SE2 A;  1A0I A;  4DV3 L;  5M3F B;  3QWN A;  4JBJ A;  1PXU A;  2N88 A;  4B3T L;  1ENC A;  4K8J A;  1Q86 C;  1EZ8 A;  2JA8 B;  1UUP A;  2B2V A;  3MEH A;  4DV7 L;  1RD9 D;  2VUM B;  1AE2 A;  3NQT A;  1L1O B;  4MIU A;  4BBS G;  1SRO A;  2R7D A;  4JI5 Q;  1L1O C;  3ER0 A;  3M3Y B;  4FF2 A;  4CJ2 C;  1G2S A;  1UE7 A;  1EQV A;  3OTO L;  1A3U A;  2KEC A;  4DXG A;  5C3E G;  2R93 B;  1HQR D;  1I3Q H;  4XQN A;  4B3S L;  3D0F A;  3AFP A;  3T1Y Q;  4JI4 L;  3TDQ A;  3PIP A;  2F4I A;  1SN8 A;  2E2D C;  3DUZ A;  2F0K A;  1LYL A;  2QDL A;  2PW5 A;  5BR8 Q;  3H3V H;  2Y0S B;  4DR1 Q;  1IBK Q;  4LNQ A;  3VYS A;  3S14 B;  3CCM A;  1XMQ L;  4OON A;  1S4Z A;  1B3Q A;  2JK8 A;  4EGV A;  4IUT A;  5ELC A;  4BS9 A;  2B8F A;  3MVV A;  5D14 A;  2KHI A;  1CI3 M;  3I4L A;  3M7G A;  1Z47 A;  2JE6 I;  4OEL B;  1IYJ B;  1DJR D;  4B3R Q;  1SSO A;  1IYU A;  4LK1 C;  4RHR A;  4OX9 L;  3OWF A;  3E6Z X;  3GTM B;  3RZD H;  1BBX C;  1PFS A;  3K5N A;  4LF8 Q;  3E5S A;  1KXL A;  1CKM A;  1K83 B;  3P1H A;  4EQP A;  4A3D G;  2A74 C;  1GKH A;  1LT4 D;  2R6G A;  3K0Y A;  4ODG A;  3SEB A;  1SFO B;  4K6D A;  3GP7 A;  3MHB A;  2Q8R E;  1LTT D;  1GHJ A;  4B3M Q;  4IUN A;  1YNN D;  1B9N A;  3B6Y A;  4BY1 G;  4PG3 A;  5M9O A;  1BUV T;  2ZJP A;  4CDD C;  2JA5 G;  5GAD C;  2MUY A;  3CD6 A;  3NWS A;  1BO0 A;  4A3F B;  4C3J G;  3KF6 A;  1N36 L;  2F0W A;  4KKT A;  2QA4 A;  1ASY A;  4KLK A;  4NXM Q;  4HJ5 A;  2Z6K A;  2PZU A;  3UDI A;  2Y0S E;  3MEF A;  1V1O A;  4IO9 A;  1XPU A;  1A3V A;  4C3H H;  4X65 L;  1EU3 A;  3J80 L;  4X3T A;  3MXN B;  1VQK A;  4LF4 Q;  2N49 A;  4OHJ A;  5FLX c;  1AW7 A;  4C2M B;  1SYF A;  1XJV A;  1DOK A;  2QW7 A;  1EY9 A;  4DAM A;  4A3M H;  3VYU A;  4OL7 A;  1Y1W G;  2NN6 H;  1CKN B;  5IWA Q;  3ND9 A;  2NYZ D;  5IP9 H;  1HNW Q;  2A73 B;  1B53 A;  1F2Z A;  1EL0 A;  2A69 D;  3FHW A;  3SVM A;  4X62 Q;  2EE1 A;  4ZCK A;  4JI1 L;  2LKV A;  3QOJ A;  5IY0 A;  2J4X A;  3SE0 A;  3TS0 A;  3H0G B;  2R92 G;  2CQA A;  3RZO B;  1LTG D;  4KHZ A;  4LFC Q;  2B2U A;  4FP5 D;  4LF6 Q;  1KDB A;  3MXU A;  1XNQ Q;  2O4X A;  2F3W A;  4IQZ A;  1TVX A;  1XWE A;  3I4N H;  3AYH B;  4IFD I;  3GV3 A;  2F0G A;  1K3B C;  3I70 A;  3H91 A;  1YJ9 A;  3KDF A;  2DGY A;  3HFZ B;  4DK0 A;  4Y52 H;  1HRJ A;  1GJX A;  2XGT A;  2F0U A;  1ZXT A;  1GXD C;  1TQO A;  1Y8P B;  2E2H B;  4EQ5 A;  1CHQ D;  1SR3 A;  3K7A B;  2E75 C;  5JVG 3;  1U4L A;  4F87 A;  1Y69 U;  2JXM B;  1MSG A;  3DM3 A;  4ZYS A;  1D2B A;  3KBG A;  4WOR A;  1WD0 A;  1HNX Q;  4A3K H;  1GUN A;  4DK6 C;  4R8N A;  3T1H L;  4CKB A;  2M9V A;  3I91 A;  3H15 A;  3WOF A;  1LUZ A;  5C3E H;  5C4Z A;  4P74 A;  1N34 Q;  2YTX A;  5HUR A;  4OWX B;  3QR8 A;  1K8G A;  4CJ0 B;  4KN4 C;  1H9M A;  4CDC C;  2ZM6 L;  4XYO A;  3I3C A;  1C7Y A;  1LM0 A;  2N3S A;  3Q0A A;  2F0L A;  1FJG L;  4YWK A;  1KLG D;  3ZYY X;  4DR2 L;  4IPG A;  3SK6 A;  1XXG A;  3CHB D;  3ND8 A;  3RLN A;  4HTH A;  3TZD A;  4DKA C;  1R9T B;  3AQQ A;  1X65 A;  2F0P A;  4DUZ Q;  1X54 A;  3S2H H;  3ULJ A;  4IUP A;  1STE A;  1EZ6 A;  4ULL A;  2CWP A;  1WVL A;  4DV3 Q;  2I5M X;  2RA4 A;  2NVY H;  3TBI B;  2NWG A;  5IT9 E;  1GO3 E;  2DJG C;  4B3T Q;  3K0X A;  1AP0 A;  4JI2 L;  3GDE A;  3M4O H;  3E3X A;  3JC6 6;  5EKI A;  5FJ8 G;  1Z9F A;  2F0F A;  4XDX A;  3RLF A;  3VR3 A;  3GTJ B;  3TEH B;  2J0T D;  4UP9 A;  2CHB D;  4A93 G;  1I6V C;  1BOS A;  4FF4 A;  1QUQ A;  3OTO Q;  1CSP A;  1QCB D;  5IOD A;  1E3P A;  4BY1 H;  2KOL A;  1A2T A;  4ME3 A;  2L12 A;  3ICE A;  3R2I A;  3ERO A;  4JI4 Q;  1AE3 A;  5CC4 A;  1PTO B;  1JWS D;  2EYF A;  3DEP A;  4C3J H;  2JA6 H;  2IY5 B;  3J7A 5;  3STB C;  2BCO A;  1PTO C;  1VDZ A;  3I56 A;  1VQ5 A;  3HOU H;  1PTO F;  4JV5 L;  1EEF D;  3E0J A;  2JEA I;  1B3A A;  2K5N A;  4X66 L;  1CZW A;  4ABN A;  1E7Z A;  4X3S A;  1RL2 A;  5JJI A;  1M4V A;  3MWY W;  2PMZ E;  1HH2 P;  2A5H A;  1EFW A;  1PLF A;  2IJ0 A;  4KD4 A;  2VS1 A;  2V4D A;  2B2Y C;  4OX9 Q;  4LF7 L;  1D5X C;  1JCK B;  5KEE A;  2Z4I A;  1HFN A;  1PH5 A;  2IHF A;  2PNH A;  2XSC A;  1MGS A;  2EZV A;  2E8G A;  3F8T A;  4POF A;  3PIO 3;  4G7O C;  4CDF C;  1PYW D;  3KK7 A;  1BNZ A;  1JE4 A;  3PO3 G;  1O80 A;  1HTL D;  5C0X I;  5AJ3 L;  2PI2 A;  2HUG A;  1GHK A;  3CF5 A;  2L5T A;  3PO2 H;  4WFN 3;  5JJL A;  4QIW B;  4HJ9 A;  1NAP A;  2E5L L;  2B29 A;  2R92 H;  3JAM E;  5I2Y A;  5KGU A;  1T5X D;  1N36 Q;  1E0B A;  4AYB G;  4IUQ A;  2F3I A;  3MFY A;  5GQO A;  3X3N A;  3FPP A;  1LTI D;  1STY A;  4WJW A;  4FYD A;  2I0Q A;  1A62 A;  4R1J A;  3HOZ H;  5KYL A;  5A2Q L;  2QEJ C;  1WCM G;  2NVX H;  1O7L A;  1JB3 A;  4DAP A;  4R4Q A;  3J80 E;  4X65 Q;  3GTQ B;  5JPN C;  1GVP A;  1NJI C;  3CMA A;  1EY5 A;  2LSS A;  4GKJ L;  1TT2 A;  4PNY A;  3N6R A;  4GN4 B;  1LT3 D;  2F0H A;  2KEN A;  3HOX G;  4C3I B;  5C4X G;  1I4P A;  4DN4 M;  5KNC A;  4GOP A;  3S17 H;  1DD2 A;  1BQQ T;  1K0S A;  1RF2 D;  4TVA B;  1J5E L;  1VQF A;  2XIW A;  3ERS X;  2XRS D;  1DM0 B;  2EJG C;  3G71 A;  1EYA A;  4H13 C;  5FLM G;  2UUA L;  1SBB B;  4JI1 Q;  1ZKO A;  4GLX A;  3NBH B;  3CC7 A;  4OWW B;  1V9P A;  4QIW E;  5IP7 H;  3J81 j;  1B44 D;  1Q8I A;  4A3E B;  5C4H A;  4KTA A;  3NEN A;  2ZXO A;  4DV6 L;  1TKW B;  2LXK A;  4OIK A;  4DNI A;  1X3Q A;  3CP0 A;  2WB1 B;  2JA9 A;  2JA7 H;  5DAU A;  3CC2 A;  4H44 C;  5KIX A;  2UUB L;  3NXW A;  4R4I A;  3CCJ A;  3NEM A;  2EPB A;  3QIA A;  3E9H A;  1JWU D;  1PA6 A;  2K05 A;  3W2D A;  1TWF H;  3OWE B;  2F0I A;  3RD4 A;  1EFI D;  5C44 G;  1ILQ A;  4K2K A;  4XQQ A;  2QCP X;  4FXD A;  4N9T A;  2QEX A;  3T56 B;  1TS5 A;  4A93 H;  1FR3 A;  1LTS D;  3SXH A;  1ZEQ X;  3CW2 C;  3T1H Q;  2F3V A;  5IYC G;  2K14 A;  2SNS A;  1I3Q B;  1Z6H A;  2I46 A;  3PUZ A;  1XMO L;  2PCF B;  5C5M A;  5FOB B;  5HGQ A;  4P72 A;  1WD1 A;  3RN2 A;  4P75 A;  5J22 A;  2K6A A;  2ZM6 Q;  1QVC A;  1PRT D;  1PMR A;  3NEL A;  1TWA H;  4C56 C;  1PTO D;  3H3V C;  4DR2 Q;  2SEB D;  4YWM A;  1QG7 A;  4ZRZ A;  2NVQ H;  1XPO A;  1SNQ A;  3A55 A;  1STH A;  2FIN B;  4BBR B;  2FMM A;  1FD7 D;  4Q5V A;  2MP1 A;  3RZD B;  5DLQ E;  2WB1 E;  3S2D H;  1SE8 A;  4LF9 L;  1RKN A;  4HIO A;  4DAY B;  4DR7 L;  4JI2 Q;  1R4P B;  1RHP A;  4OO1 G;  3CPF A;  4DFA A;  3J81 c;  3OPO A;  1YHQ A;  1YNN C;  2L4N A;  4BBR G;  3X3M A;  4GS3 A;  2A6E D;  1Q1E A;  3TRE A;  2FJ2 A;  1H9J A;  3BZD B;  2O5J C;  3G6J B;  4IAL A;  3W3A A;  1YIT A;  2ICI A;  3K6O A;  3SK8 A;  4BY7 G;  4IJL A;  1HA6 A;  1CTM A;  2ZT9 C;  3GTK H;  4BXX G;  2L11 A;  3TME A;  2HHH Q;  3QB3 A;  1D6E C;  4X6A H;  5CBE E;  1S5D D;  2K32 A;  4IFD H; 
#chains in the Genus database with same CATH homology
 2VL6 A;  4A3D G;  4LFB L;  4FDB A;  2PI2 E;  1GKH A;  3W5O A;  5M5X H;  2R6G A;  3DLL A;  2KHJ A;  4GNX A;  2UU9 L;  3S14 H;  1EQQ A;  4JV5 Q;  1I6H H;  4LFA Q;  2OQ0 A;  5IP7 G;  1EIF A;  4X66 Q;  3GO5 A;  4JI5 L;  1PYS B;  1YIJ A;  4PZ6 A;  3G6E A;  4B3M Q;  4HID A;  2A1A A;  4YCU A;  3UDG A;  4QJF A;  1EWI A;  3B6Y A;  4BY1 G;  1WCM H;  4PG3 A;  1Q7Y C;  1X9N A;  2ZJP A;  4ALP A;  4AH6 A;  2JA5 G;  3KF8 B;  2JA7 G;  2OTJ A;  5GAD C;  3CD6 A;  3S1Q H;  1YHA A;  3I4O A;  4LF7 Q;  3KF6 A;  1N36 L;  2QA4 A;  3L7Z C;  3HOW G;  5IYD H;  3A0J A;  1ASY A;  1IZ6 A;  1UWV A;  4KLK A;  4NXM Q;  4RG1 A;  4HJ5 A;  4IFD J;  2F4V L;  3BJU A;  1J6Q A;  5BR8 L;  2Z6K A;  4DR1 L;  3UDI A;  1MJC A;  1N9W A;  1SFO H;  2Y0S E;  3HOX H;  1VQ7 A;  2UUC Q;  3MEF A;  1C0A A;  4IO9 A;  4JI8 Q;  4A3E G;  2YU9 H;  1N33 L;  1JT8 A;  1XPU A;  4C3H H;  5AJ3 Q;  3F2B A;  2EXD A;  4JOI A;  4X65 L;  2PQA B;  1W2B A;  1PHJ A;  1IXR A;  1R9T H;  1B7Y B;  4A3C G;  3KOJ A;  1S40 A;  2WB1 G;  2WAQ G;  3MXN B;  1HR0 W;  1K0R A;  1VQP A;  4A3J H;  1VQK A;  4LF4 Q;  4A3F H;  1OXT A;  3F2C A;  5LMN L;  1Y1V G;  2MFI A;  2C35 B;  2N49 A;  4JI0 L;  5FLX c;  2E5L Q;  5FJ8 H;  2RHS B;  1G29 1;  4UY8 C;  1EIY B;  1XJV A;  2VQE Q;  4IPD A;  2HHH L;  4A3G G;  4DAM A;  4A3M H;  1T9H A;  4DR4 Q;  1TWH H;  1Y1W G;  1WOC A;  4K0K L;  3IRB A;  1CKN B;  5IWA Q;  1CKO A;  1MJE A;  3H3V I;  5IP9 H;  4DV2 Q;  3FKI H;  4HJ8 A;  1L0W A;  1HNW Q;  1JJ2 A;  5IYB G;  1K9M C;  3UE1 A;  1BBU A;  2Z0S A;  1Q12 A;  1M1K C;  3K80 C;  3FHW A;  4B3M L;  3K81 C;  1IBM L;  2MQH A;  3AFQ A;  4NXN L;  1VQ6 A;  2VZA A;  2YYZ A;  4IJH A;  4P71 A;  2F52 A;  4X62 Q;  4POG A;  1NY4 A;  4JI1 L;  2K52 A;  2GVB A;  5IY0 A;  4DV5 Q;  4IPH A;  3TS0 A;  2KBN A;  5M3F G;  1MKH A;  3OW2 A;  1X3F A;  3SGI A;  2R92 G;  4JBM A;  1FJG Q;  1P8L A;  5H1S E;  4KHZ A;  1VQO A;  4LFC Q;  3CC4 A;  3UE0 A;  4C2M H;  2NZO A;  4LF6 Q;  2JA8 G;  1HZB A;  1Q82 C;  1N8R C;  4JI3 Q;  2ASB A;  1SMX A;  1XNQ Q;  3CCQ A;  2VUM G;  1E22 A;  3OYY A;  4QGU A;  3BZK A;  2YV5 A;  1FGU A;  3L2P A;  5LMU L;  2HIV A;  3AYH B;  1PH1 A;  1NE3 A;  3I4N H;  4IFD I;  1VQD A;  2N78 A;  1YJ9 A;  3EN2 A;  4XTC S;  3KDF A;  1X56 A;  1YBY A;  1A8V A;  2DGY A;  3HFZ B;  4Y52 H;  2D0O A;  2XGT A;  1VQL A;  1QVG A;  3BU2 A;  2VNU D;  4EQ5 A;  1SR3 A;  3PUY A;  3BZC A;  3UDX A;  1OXX K;  1KD1 C;  2UUA Q;  5IE8 A;  3KJP A;  2N8N A;  3S24 A;  1HZ9 A;  5M3M H;  2R93 G;  3DM3 A;  4HIM A;  3ULP A;  4LUV A;  3J80 i;  2ZTD A;  4JI7 Q;  1L1O A;  1H95 A;  4J15 A;  4DR6 L;  3A5U A;  5HY6 A;  4LUO A;  4HJA A;  3S1M H;  4AQY L;  1HNX Q;  3PO3 H;  1X3E A;  1VQ4 A;  4IFD G;  4A3K H;  2VQE L;  2GVA A;  1XNR Q;  2Y0S G;  2WFW A;  3CCR A;  3U4Z A;  2XTI A;  1HR0 Q;  4DK6 C;  3T1H L;  5GAG C;  3I4M H;  2A19 A;  2AKW B;  4GOP B;  2CKZ B;  4QL5 A;  3H15 A;  4UP7 A;  4GNX B;  2Q2H A;  1LUZ A;  3E0E A;  3UDF A;  5C3E H;  4P74 A;  3I55 A;  3S1N H;  1N34 Q;  4PZ7 A;  1B8A A;  4GOP C;  2ES2 A;  2UUB Q;  2CCZ A;  2YTX A;  4GNX C;  1M90 C;  4OWX B;  1UE1 A;  1K8G A;  3PUW A;  3CXC A;  4DV4 Q;  4JYA L;  2LXJ A;  1AH9 A;  4YCV A;  4X64 Q;  2ZJQ A;  2YTV A;  4X62 L;  2ZM6 L;  1YHB A;  1PVO A;  4DV5 L;  4R4O A;  2ZTC A;  3PV0 A;  4R4C A;  4UPA A;  1C7Y A;  2N3S A;  1LM0 A;  4UP8 A;  1D8L A;  2JEB I;  2MO0 A;  3D31 A;  1FJG L;  3U58 A;  1GM5 A;  4YWK A;  4DR2 L;  4IPG A;  4TQU S;  1DGS A;  5GRO A;  3J80 c;  3G4S A;  5IYD G;  3GTG H;  3RLN A;  3M9B A;  4DKA C;  1KC8 C;  1I94 L;  4DR3 L;  1EUJ A;  2EQS A;  3AQQ A;  1X65 A;  2R7Z H;  1IBL L;  2NN6 I;  4DUZ Q;  2MO1 A;  1UE5 A;  2HIX A;  4DV1 Q;  1X54 A;  3S2H H;  4IOC A;  4IPC A;  3ULJ A;  4JI6 Q;  2UXD Q;  2CWP A;  2UXB L;  3T1Y L;  2IHE A;  3E9I A;  5GAE C;  4DV3 Q;  2I5M X;  1XMO Q;  3GTO H;  4L5Q A;  1YVC A;  1HZC A;  4L5R C;  2NVY H;  1IL2 A;  4BY7 H;  1VCI A;  3HOY G;  4B3T Q;  1GO3 E;  3HKZ E;  2L15 A;  3K0X A;  1KL9 A;  4JI2 L;  1FL0 A;  2R7F A;  1EQR A;  3TRZ A;  2IX0 A;  3GDE A;  4A3J G;  1IBK L;  3M4O H;  4A75 A;  4A3F G;  1S72 A;  1A63 A;  1U5K A;  5C4X H;  4AYB E;  3JC6 6;  5IT9 c;  4YY3 Q;  2K4K A;  2JJQ A;  5FJ8 G;  1Z9F A;  3RLF A;  2VQF Q;  4A93 G;  3TEH B;  1UE6 A;  4UP9 A;  4DV0 Q;  2ZJR A;  1YI2 A;  1JJG A;  4A3M G;  1HNZ Q;  2OQK A;  2CWA A;  5C0X J;  2V1C C;  1KQS A;  3S15 H;  1XTD A;  1QUQ A;  3OTO Q;  5FLM H;  1X55 A;  5C4J H;  5IP9 G;  1CSP A;  3FKI G;  1B70 B;  4MTN A;  4C3I H;  4B3R L;  1E3P A;  4BY1 H;  1VQ8 A;  1FVI A;  3S16 H;  4A3L G;  3U4V A;  2UXC Q;  4ME3 A;  3ICE A;  4QY7 A;  4P73 A;  4JI4 Q;  3RNU A;  4LF8 L;  1AE3 A;  4C3J H;  4GN3 B;  4YHH Q;  4LF9 Q;  2JA6 H;  1YZ6 A;  2ATW A;  1VQJ A;  4O2D A;  3CAM A;  4DR7 Q;  3HKS A;  3J7A 5;  3STB C;  4KHP Q;  2IY5 B;  1YNX A;  2IT1 A;  1OXU A;  4DV4 L;  1YJW A;  2OWO A;  2B63 G;  3I56 A;  2K50 A;  1VQ5 A;  3HOU H;  4JV5 L;  4DUY Q;  4LFA L;  1E1O A;  2JEA I;  2HT1 A;  3S1R H;  2K5N A;  4X66 L;  1WFQ A;  1U0L A;  3GTJ H;  1E7Z A;  2IX1 A;  3VDY A;  1RL2 A;  5LMN W;  1GD7 A;  4LF5 Q;  4A3B H;  4DR5 Q;  2D0P A;  4YWL A;  1WI5 A;  3I4N G;  3FP9 A;  1G51 A;  5JJI A;  2PQA A;  4GLV B;  4JC0 A;  3J7Z C;  3PUX A;  1JB7 A;  2PMZ E;  3GTL H;  1HH2 P;  1PH8 A;  2K5V A;  1EFW A;  1VQB A;  4A3C H;  4PMW A;  1KAW A;  3KDF B;  4YCW A;  3W1G A;  1MIU A;  2VS1 A;  1CUK A;  2BH2 A;  4OX9 Q;  4GKJ Q;  4LF7 L;  3ZJY C;  4PZ8 A;  5GAH C;  5C44 H;  1Y1V H;  1N32 Q;  1PH5 A;  4GKK Q;  2KCM A;  2IHF A;  3JAM i;  4LWC A;  5M3M G;  3J81 i;  4NXM L;  2PNH A;  3KLW A;  4A3G H;  3CPW A;  2E8G A;  3H0G G;  4LFB Q;  5M5Y H;  3F8T A;  3CCS A;  4POF A;  2UU9 Q;  4A3I H;  2UUC L;  5IYC H;  1VQA A;  1HZA A;  1VQN A;  4NB3 A;  4JI8 L;  1J5E Q;  2VQF L;  3STB D;  3PO3 G;  4A3K G;  5C0X I;  3K8A A;  1CSQ A;  5AJ3 L;  2PI2 A;  4OXP A;  4DV0 L;  1W3S A;  1HNZ L;  3CQZ H;  1PH9 A;  1X3G A;  3CF5 A;  3G48 A;  3I4M G;  3L0O A;  4IOA A;  1OTC A;  3PO2 H;  4HJ7 A;  1V1Q A;  4LF4 L;  5JJL A;  2BA1 A;  5ELO A;  4A4I A;  3HKZ G;  3HOV H;  2K75 A;  1I50 H;  4HJ9 A;  4WJ4 A;  1C9O A;  4BBS H;  2UXC L;  2E5L L;  5M3F H;  2B29 A;  2R92 H;  2AWN A;  2D62 A;  2A8V A;  3TQY A;  3CME A;  4DV6 Q;  1N36 Q;  4AYB G;  2H5X A;  4DR4 L;  1V43 A;  3Q8D A;  4OWT B;  2F3I A;  2NVT H;  5GQO A;  2RCN A;  1SRU A;  1NTG A;  4L5T A;  4XIG S;  5IWA L;  2F4V Q;  2I5H A;  4DV2 L;  1KRS A;  1NBW A;  4O0A A;  3JAM c;  4H02 A;  2I0Q A;  1P16 A;  2Q2T A;  1A62 A;  3U50 C;  4R1J A;  5C0X G;  3HOZ H;  4QQB X;  1HNW L;  5M5W H;  1N33 Q;  3PGZ A;  1QZG A;  1WCM G;  2ZTE A;  2NVX H;  3M3Y H;  4R4Q A;  4DR5 L;  4X65 Q;  1QVF A;  3KFU A;  3RN5 A;  1WYD A;  1VQ9 A;  1GVP A;  4LFC L;  1NJI C;  4JBW A;  5LMN Q;  1JMC A;  3M4P A;  1TXY A;  1VQH A;  5JEA J;  4BBR H;  3CMA A;  4JI0 Q;  2LSS A;  4LF6 L;  4JI3 L;  4GKJ L;  2ALY B;  3PUV A;  2BH8 A;  1HJP A;  2FXQ A;  3KF6 B;  1XNQ L;  3AEV A;  3RR5 A;  2YTY A;  1NMF A;  4GN4 B;  2OTL A;  2ID0 A;  2KEN A;  4BA1 I;  3HOX G;  4K0K Q;  3WWV A;  5C4X G;  4GOP A;  1YJN A;  1JJC B;  1PH3 A;  3GTP H;  3S17 H;  1G6P A;  4L5S A;  1TWC H;  2BA0 A;  4MNO A;  2Z6K C;  4BXX H;  4TVA B;  1J5E L;  1VQF A;  1K8A C;  3ERS X;  4DV7 Q;  1VS0 A;  3G71 A;  2AMC B;  5FLM G;  1IBM Q;  2UUA L;  3GTQ H;  4NXN Q;  1VQM A;  1QUQ B;  3PF5 A;  4JI1 Q;  4GLX A;  4JOI C;  4JI7 L;  3NBH B;  1Q8K A;  2VW9 A;  1Q46 A;  4A3D H;  3CC7 A;  4OWW B;  1LTL A;  2K5H A;  1V9P A;  3KYH C;  4QIW E;  3CCV A;  5IP7 H;  1BVS A;  3J81 j;  1HNX L;  2I5L X;  4A76 A;  3GTM H;  2JA6 G;  1BBW A;  2NN6 G;  3I7F A;  3K7U C;  1XNR L;  3TS2 A;  1E1T A;  3NEN A;  1HR0 L;  4DV6 L;  1PH2 A;  1PH4 A;  4BA2 I;  1NMG A;  1K83 H;  5LMU Q;  2LXK A;  3HOU G;  2RF4 A;  1KIX A;  1EYG A;  1D7Q A;  4B3S Q;  4DNI A;  3CP0 A;  3EBE A;  2JA5 H;  1EOV A;  2JA9 A;  2JA7 H;  2VY3 A;  3CC2 A;  1N34 L;  3I2Z A;  2UUB L;  2NZH A;  4JG2 A;  4A3B G;  4R4I A;  3CCJ A;  3NEM A;  3GD7 A;  1JE5 A;  3CCU A;  3A5Z B;  4GN5 A;  1Y14 B;  4LW1 A;  1RIP A;  3HOW H;  2EIF A;  3E9H A;  4X64 L;  3CCE A;  3HOY H;  1I5F A;  1PA6 A;  2GN5 A;  1OXV A;  1XMQ Q;  1TWF H;  5JJK A;  4EX5 A;  4DR6 Q;  1E24 A;  1PV4 A;  5C44 G;  4A3E H;  3A74 A;  5K36 G;  2Q2I A;  4AQY Q;  2E2I H;  1O7I A;  3W1B A;  2QEX A;  4A93 H;  2AHO B;  4MZ9 A;  3PF4 A;  1X6O A;  3CW2 C;  4DUZ L;  4DV1 L;  3T1H Q;  4A3I G;  5IYC G;  1VQC A;  1VQG A;  2K14 A;  4R4T A;  3F2D A;  1A0I A;  4HIK A;  4JI6 L;  2UXD L;  3M85 A;  1VQI A;  2B3G A;  3PUZ A;  3PIO A;  4DV3 L;  1XMO L;  4NPS A;  4JBJ A;  4A3L H;  3KJO A;  5HGQ A;  4B3T L;  4P72 A;  1Q86 C;  1BKB A;  5EAY A;  4P75 A;  3RN2 A;  4DV7 L;  3PO2 G;  4JYA Q;  1CKN A;  1AE2 A;  1WJJ A;  3RLO A;  2OCE A;  1PYB A;  1TWG H;  3ULL A;  4Y7N H;  1Y1W H;  2ZM6 Q;  1QVC A;  1L1O B;  3LGJ A;  5JEA G;  4OO1 I;  4BBS G;  3F1Z A;  3PSI A;  4YY3 L;  2B63 H;  1SRO A;  1TWA H;  2R7D A;  3NEL A;  5ELN A;  4JI5 Q;  1L1O C;  3M7N A;  4DR2 Q;  3ER0 A;  5IYB H;  5J3B A;  4YWM A;  1UE7 A;  3OTO L;  3CCL A;  1QZH A;  2DUD A;  1I94 Q;  4DR3 Q;  2NVQ H;  2MNA A;  1Q1B A;  5C3E G;  1IBL Q;  1XPO A;  1I3Q H;  1YEZ A;  3HOZ G;  4B3S L;  1OXS C;  2HQL A;  3D0F A;  3AFP A;  2UXB Q;  3T1Y Q;  4RMF A;  1S3O A;  2CFM A;  4JI4 L;  5DLQ E;  2WB1 E;  2WAQ E;  3PIP A;  2JA8 H;  1SN8 A;  1L2F A;  1SE8 A;  4YHH L;  4AIM A;  4LF9 L;  3S2D H;  4HIO A;  1PH6 A;  4DAY B;  4GLA C;  4JCV E;  4APV A;  2VUM H;  4DR7 L;  4JI2 Q;  1LYL A;  4KHP L;  4OO1 G;  5BR8 Q;  1ASZ A;  4DR1 Q;  3CPF A;  3H3V H;  1K73 C;  1IBK Q;  4LNQ A;  4DUY L;  2QGQ A;  3J81 c;  1YHQ A;  2AWO A;  3CCM A;  1VQE A;  1XMQ L;  2WP8 J;  2CQO A;  4OON A;  2JK8 A;  3H0G H;  4BBR G;  4GS3 A;  2Q2U A;  3RZO H;  4JBK A;  3EIV A;  1Q81 C;  4LF5 L;  2R7Z G;  1Q1E A;  4DK3 C;  4KI0 A;  1K3R A;  3TRE A;  1KHI A;  2JQO A;  2KHI A;  2RHQ B;  1SLJ A;  1Z47 A;  2JE6 I;  4LUZ A;  1YIT A;  3PCO B;  2E2J H;  3HOV G;  2R93 H;  1IYJ B;  2KCT A;  1PH7 A;  5E7N A;  4B3R Q;  4BY7 G;  4IJL A;  4WJ3 M;  3GTK H;  4BXX G;  4OX9 L;  3M4Q A;  3RZD H;  1XPR A;  1KRT A;  2HHH Q;  1N32 L;  1PFS A;  4DPG A;  2E2H H;  4LF8 Q;  4GKK L;  4X6A H;  1UEB A;  1KXL A;  3K7A H;  1CKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...