4DK6C

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
87
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
total genus 14
structure length 87
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk6C00
1E3PA 3T1YL 3S2DH 4IFDI 3HOVG 3FKIG 3U50C 4DR1L 1R9TH 3GTOH 3HOUH 3I55A 4A3KG 4WJ3M 1NBWA 1J5EL 4L5RC 2JA8G 1TWGH 4ME3A 1VQLA 3OTOQ 3I4OA 1GKHA 2E5LL 4GN3B 1Q12A 1GVPA 4BBRH 2R6GA 3PUZA 3TRZA 4JI3Q 3PO2G 5LMNL 4TQUS 3H0GH 3NBHB 1TWAH 1WOCA 1UWVA 3CCUA 3HOYH 2R7DA 4B3TL 1KL9A 1IBMQ 3UE1A 1X54A 4KHPQ 4IFDJ 4GLXA 1MKHA 3K81C 3HKZG 4P73A 5LMUL 1Q1BA 2MO0A 3S17H 4A3LH 3RN5A 2IX1A 3ER0A 5FJ8H 1VQ8A 1YZ6A 2AWOA 2E8GA 1X56A 3AYHB 2Q2UA 2UU9Q 5IYBG 3E9HA 1AE2A 5IP7G 1PH6A 3HOVH 3CC2A 4GLVB 4Y7NH 1P8LA 3HOUG 4LF8L 1WI5A 4GKKQ 2KCMA 4HIMA 2R7ZG 1EIFA 1KD1C 4A3DG 4JCVE 2BA0A 3CCMA 1NMGA 4DV6Q 4DR5Q 3KJOA 2WB1E 1IL2A 1N32Q 1SR3A 4UP8A 4A3FG 1VQAA 1XMOL 2DGYA 1A62A 3K7UC 4P72A 4YWMA 2E2IH 3H0GG 1CUKA 5J3BA 4K0KQ 2MFIA 3U58A 4A3JH 3PF4A 4IO9A 2PMZE 4GOPA 3W5OA 4AYBE 3T1HQ 2RF4A 1XMQQ 1QZGA 2V1CC 3GTMH 2ID0A 3PIOA 3CCJA 4BY1G 3J7ZC 1K3RA 1PH3A 4LFAL 1SE8A 2OQ0A 2JA7G 3I4MG 5FJ8G 2NVQH 2UUCL 2PQAB 1VQEA 2QEXA 3PUYA 2B29A 3KYHC 3GTJH 3E0EA 2VUMG 4DR7Q 3KOJA 4R4IA 3ULLA 3CQZH 4H02A 1K73C 4B3SL 4HIKA 2R92G 3CAMA 1PVOA 2YYZA 4JI0Q 4JYAQ 5AJ3Q 1CSQA 5GAHC 1K83H 3RR5A 1E24A 1Y1VG 1YVCA 1UE7A 2VS1A 2UXBQ 1VQ5A 3RNUA 4LFBL 2B3GA 1WCMG 2XTIA 3PUWA 2K52A 1EFWA 1FJGQ 4A3GH 3AQQA 1VQGA 2K5NA 4XTCS 4BY1H 1XNQQ 3RZOH 3MEFA 4X65L 4A93G 4DV2L 5LMNQ 4GNXB 4P71A 2IT1A 5M3FG 1PH5A 4LF4L 1N33Q 3IRBA 2CWAA 4JOIA 2VQEQ 3CCRA 1TWHH 4NPSA 5GADC 2N3SA 3RLNA 3ZJYC 4R1JA 1YITA 3PO3G 4HIDA 5K36G 4GKJL 3WWVA 1CKOA 1XJVA 1CKMA 4GLAC 4RG1A 3S1MH 1VQNA 2XGTA 1PA6A 4O2DA 3M4PA 2LSSA 2AHOB 2UXDQ 2JQOA 4DK3C 1E7ZA 1LTLA 2LXKA 2IX0A 2UU9L 1KRSA 5M3MG 2RCNA 1IBKL 3JAMc 3A5ZB 4MZ9A 3CF5A 1PV4A 4BY7G 5GQOA 1G51A 1LM0A 1OXUA 4OX9L 2HT1A 1WCMH 4LFCQ 1T9HA 5IT9c 3CCLA 1PH8A 3NENA 4DV6L 4B3RL 1KQSA 1TXYA 1YEZA 2R93G 2IY5B 1EOVA 3PUVA 2YTVA 3EN2A 1HH2P 1VQKA 1N34L 5C0XJ 3TS0A 1D8LA 2RHQB 3KF6A 1HJPA 1VQCA 4MNOA 3STBC 1G291 4X64Q 2OCEA 1B70B 2KENA 4YHHQ 4YCVA 3HOXH 4JV5L 2KHJA 5JJLA 1E1OA 3KF8B 3AFPA 1I94Q 4JI7Q 4UY8C 3PO3H 1K9MC 3HOWG 1AH9A 4LF9Q 4QGUA 3PCOB 4KI0A 3D31A 3E9IA 1MIUA 2FXQA 4AIMA 2OTLA 2N78A 1HR0Q 3S1QH 4B3MQ 5C3EG 4HJAA 3FP9A 1A63A 5IWAL 4HJ9A 2JK8A 2BA1A 4NXNL 4DV5L 1PYBA 4GN4B 1CKNA 4LNQA 4EX5A 3I56A 3CXCA 3CMAA 4JI4Q 1L0WA 1BKBA 4GOPC 4X66L 3PIPA 3K80C 4BA1I 1OXTA 4YCUA 4P75A 1EQQA 3G71A 3FHWA 4JI1L 1JJ2A 4JI2L 3S14H 3OTOL 1GM5A 4NXMQ 1J6QA 3J81c 5BR8L 2D0PA 1FVIA 4LF5L 3ULJA 4APVA 1RL2A 3M85A 3CMEA 3RN2A 1N36L 2VQFL 4DR2L 4RMFA 4BBSG 2A1AA 3JAMi 2VNUD 3HOWH 2KHIA 3I4NH 4MTNA 3DLLA 1PH7A 2JA5H 4DR4Q 2ZM6Q 3G48A 2Z6KC 4DV2Q 5LMUQ 2N49A 1D7QA 1VQ4A 1WJJA 4LF4Q 1FGUA 4XIGS 1N33L 1WYDA 2I5HA 1UE6A 4PZ8A 3W1GA 4DV0Q 3S15H 1C0AA 4UP7A 1QVGA 4A3EG 5ELOA 3TREA 3RLFA 2UUBL 3PV0A 1QVFA 4JBKA 4C3HH 2K50A 1TWFH 3A5UA 4BBRG 3M4QA 5IYCG 2Z6KA 4BXXG 2KCTA 2EIFA 2D0OA 3UE0A 3CCQA 1OXSC 1PFSA 3DM3A 3M9BA 4HJ5A 4A3CG 4YWLA 2B63H 2AKWB 4POGA 1W3SA 2UUAQ 2WAQE 1PH2A 1X9NA 2LXJA 1A8VA 2NN6I 3OYYA 4BBSH 2YTYA 2ZTCA 2F4VQ 5IYDG 1PH1A 4IPDA 4JI8L 5IYBH 5IP7H 2E2HH 1YJWA 3RLOA 3K8AA 3S24A 4AQYQ 1N34Q 1OTCA 3OW2A 3UDIA 1NE3A 4LFAQ 4LWCA 2ATWA 4LUOA 2N8NA 1K8AC 4A3DH 1XMOQ 4IFDG 3A74A 4LF6L 5FLMH 1H95A 2Y0SG 1HZCA 1P16A 3TEHB 1VQFA 4DV7Q 4A3EH 1XTDA 4DNIA 2K5VA 4A3FH 1Q7YC 1JB7A 3CCEA 1UE1A 4HJ7A 1CKNB 1VQDA 1LYLA 1GD7A 3HKZE 4P74A 5IYCH 1HZBA 5C44H 3STBD 4B3SQ 1N8RC 1U0LA 1J5EQ 1KAWA 1I50H 4DUZL 2CFMA 4JYAL 5JJIA 5IWAQ 1YIJA 1IBLQ 3HOZH 4DR6L 2JJQA 2JEAI 1EYGA 2B63G 1Y1WH 4X62L 2IHEA 1I5FA 4GOPB 3UDGA 4YY3L 4NB3A 4HIOA 2PI2A 2PNHA 4R4TA 4GKKL 2UXBL 1X55A 4DUYQ 3MXNB 4LF7L 2JEBI 2NVYH 1VQIA 3GD7A 2AWNA 2WB1G 4L5TA 4OWXB 4JI3L 5IY0A 2A19A 3I2ZA 5M5XH 4X66Q 5C0XI 3KFUA 4JI1Q 3GTLH 1HZ9A 4NXML 1VCIA 3KDFA 4KHPL 3JC66 3AFQA 5C4XG 1XNQL 4A3MG 1JJCB 1YHAA 4X65Q 4EQ5A 4DV4L 2Z0SA 3CC7A 3I7FA 3M3YH 2Q2IA 4DV3L 1VS0A 1IXRA 5JEAJ 1WFQA 5IP9G 1XPUA 4BA2I 3CD6A 3BJUA 5HGQA 1KC8C 2ZTEA 3J80c 1MJEA 1N9WA 3L7ZC 5C44G 4JI5Q 4OWWB 1QVCA 3J80i 3PGZA 4QY7A 4UP9A 3CCVA 3ULPA 3GTGH 4A76A 3HOZG 1I6HH 4DR5L 1YI2A 3CPFA 3W1BA 1BBWA 1Y1WG 1N32L 3EBEA 2I0QA 3B6YA 4PZ7A 1S72A 4OX9Q 3L2PA 2ZJRA 4A93H 1OXVA 2I5MX 1JT8A 4JI6Q 1BBUA 4LUVA 4QIWE 1Q82C 4LF8Q 1JE5A 3K7AH 1PHJA 3U4ZA 3S16H 3NELA 3BZKA 4A75A 3T1HL 1XMQL 5C4XH 4A3MH 5E7NA 2HQLA 4HJ8A 2UUAL 4Y52H 5LMNW 2L15A 4JG2A 4OXPA 1V1QA 4DV1Q 1SLJA 5JEAG 4IPGA 4YHHL 1Z47A 1VQOA 4R4OA 1SN8A 1XNRQ 4A3KH 1PYSB 4YWKA 4LFCL 4R4CA 3A0JA 4IPCA 1NTGA 4AQYL 3M7NA 1Z9FA 4K0KL 3AEVA 3T1YQ 2JA8H 1E22A 3ICEA 1U5KA 2E2JH 4GS3A 1Y14B 2NZHA 1DGSA 4TVAB 1PH9A 4LW1A 2NVXH 1B7YB 2K14A 4J15A 4LF6Q 1YJ9A 1TWCH 3CCSA 2HHHL 4JI7L 5IE8A 2ZJPA 4WJ4A 4OO1I 4LF9L 3J81j 3KLWA 4DR7L 3J7A5 2PQAA 5HY6A 4DR1Q 3ERSX 3RZDH 4A3LG 3H15A 1HR0L 4O0AA 3PF5A 2A8VA 4X62Q 1YJNA 2GVBA 3S1RH 2H5XA 5AJ3L 1SMXA 1UEBA 2ALYB 4IPHA 3F2DA 2OTJA 5IYDH 5H1SE 4QJFA 2E5LQ 1O7IA 2UXCQ 2AMCB 1X3GA 2VL6A 4DR3L 4LFBQ 2DUDA 2VZAA 3S1NH 1A0IA 2R7ZH 3L0OA 1HNZQ 2NVTH 1VQHA 1L1OC 4C3IH 1EUJA 2JE6I 5C4JH 5BR8Q 4C2MH 1IBML 5JJKA 2EQSA 3KF6B 4JC0A 1HR0W 4DV0L 1EWIA 1SRUA 1HNXQ 3CP0A 4R4QA 2VQFQ 4DR2Q 1K8GA 3CW2C 4QL5A 1NMFA 4A3JG 4LUZA 3TS2A 5C0XG 3G4SA 2QA4A 1B8AA 2CKZB 1L1OB 2F3IA 2K4KA 4IJLA 4IJHA 4AH6A 3I4NG 2JA7H 1KRTA 3I4MH 4DAMA 2HIXA 4POFA 2JA5G 1NY4A 4JBWA 4C3JH 1BVSA 2OWOA 1VQBA 1IBKQ 1G6PA 4A3IG 2VUMH 2F4VL 2UUCQ 3H3VI 3BU2A 4JI8Q 3U4VA 1LUZA 2MO1A 1M90C 1VQ7A 2R92H 1K0RA 1Q1EA 1VQMA 4ALPA 1I3QH 3F1ZA 1X3EA 2RHSB 4BXXH 1SFOH 2Q2HA 3EIVA 1M1KC 2BH8A 1Y1VH 4B3ML 3GDEA 1SROA 4X64L 2Q2TA 1X6OA 1VQPA 4IOAA 2PI2E 4A3CH 1JJGA 1RIPA 2CQOA 1MJCA 4QQBX 1PH4A 4A4IA 1IYJB 1UE5A 2HIVA 2JA6H 4A3GG 1V43A 4IOCA 2ZTDA 2MNAA 2CWPA 2ES2A 3F2CA 4UPAA 2I5LX 2NZOA 3NEMA 4JBJA 5M5WH 1C9OA 5M3FH 1QUQB 3SGIA 4DV7L 4YY3Q 4JI0L 4A3IH 3K0XA 5GAEC 2MQHA 2GN5A 2YV5A 4LF7Q 1N36Q 3CC4A 2K5HA 2BH2A 1X65A 5FLMG 1QUQA 2QGQA 2VQEL 2R7FA 5GROA 4JI4L 2WAQG 3UDFA 4DUZQ 1KIXA 1S40A 1FJGL 3BZCA 4AYBG 3HFZB 3CPWA 3GTPH 4JI2Q 2ZM6L 4DR4L 4L5SA 4DR6Q 5M3MH 3GTQH 4B3TQ 4BY7H 2ASBA 1XPOA 1GO3E 2UXCL 1EQRA 5EAYA 2F52A 4DUYL 2UXDL 1L1OA 4DR3Q 4OONA 4A3BG 1S3OA 2ZJQA 5GAGC 1HNZL 1FL0A 2UUBQ 4OO1G 2R93H 3GO5A 2YTXA 2JA6G 1HNWQ 2Y0SE 1Q86C 4GKJQ 3TQYA 2YU9H 2WFWA 2KBNA 1HNXL 1JMCA 3F8TA 4DV4Q 4KHZA 4PZ6A 1OXXK 4DAYB 5M5YH 1QZHA 3HOXG 4DV3Q 1YBYA 1ASYA 2EXDA 2WP8J 1L2FA 1EIYB 4JI6L 2VY3A 3HKSA 1AE3A 4JI5L 4DK6C 3H3VH 3FKIH 5DLQE 5FLXc 3F2BA 3PUXA 4GN5A 1NJIC 1Q46A 2GVAA 4KLKA 5IP9H 1I94L 1E1TA 5C3EH 4JOIC 5ELNA 1KHIA 4B3RQ 2D62A 2IHFA 3LGJA 3GTKH 1W2BA 1IZ6A 1YHBA 3G6EA 2C35B 4DV1L 4GNXC 1KXLA 1XNRL 4YCWA 4A3BH 4L5QA 2OQKA 4PG3A 2CCZA 1CSPA 3D0FA 1YNXA 3PO2H 1HZAA 1XPRA 1C7YA 4DV5Q 3Q8DA 4PMWA 4NXNQ 4JV5Q 4FDBA 1ASZA 2K75A 1HNWL 1VQJA 3KDFB 2NN6G 3PSIA 1YHQA 1Q81C 1Q8KA 1VQ6A 4JBMA 3HOYG 3UDXA 3KJPA 4GNXA 1V9PA 1IBLL 4DKAC 3J81i 2VW9A 3VDYA 2HHHQ 3S2HH 4OWTB 1X3FA 4X6AH 2JA9A 4LF5Q 4DPGA 1VQ9A 3M4OH
chains in the Genus database with same CATH superfamily
1E3PA 1EY0A 2RVLA 4IFDI 5M3FB 3GTOH 3HOUH 5F2DA 3I55A 1CQVA 1O7YA 1TWGH 1VQLA 2PMZB 5I2YA 2L1BA 3I4OA 1WD0A 4XT1B 2E5LL 1Q12A 3PO2B 3GTLB 3H0GH 1UWVA 3HOYH 5J39A 3UE1A 2XRQD 2JA8B 3FRPB 2K5QA 3PMFA 1DONA 3S17H 2MO0A 4A3LH 1Q90A 2G9HD 3RN5A 1MSGA 2IX1A 3ER0A 1YZ6A 3E9HA 5IP7G 1PH6A 1GUSA 1P8LA 3HOUG 4LF8L 2Q8IB 1KD1C 2BA0A 4C3IG 2AQ3B 2L12A 1STEA 2JN4A 3K7UC 4P72A 4HCSA 3H0GG 2A5HA 4K0KQ 3U58A 4A3JH 3MZ5A 1B1ZA 2GA4B 3W5OA 5D3DA 2K01A 4A3FB 1QZGA 3GTMH 2KVMA 3PIOA 1KLGD 3NSWA 4BY1G 2J0TD 1SE8A 4FF1A 2M2LA 1U9RA 3PUYA 2B29A 4NMZA 5IGFA 1UNSA 5K36H 3HKZB 3E0EA 4DR7Q 2RSNA 3CQZH 1EEID 3T51B 1V8QA 4H13C 5IIFA 3VR6A 3CU7A 3TP6A 1CSQA 2X6LA 1K83H 1BQQT 1HUNA 1YVCA 1UE7A 1WCMG 3V05A 2K52A 5M3MB 5I6WA 4ZK9B 1EQTA 5IGGA 4BY1H 2EYPA 3MEFA 4A93G 4NP5A 2B2UC 5LMNQ 2FHTA 1DM0B 2B2YA 2KCNA 4JOIA 3RLNA 3PO3G 5K36G 4HIDA 2JSOA 1FNWA 5JPNC 5C4XB 3DHQA 2C9OA 5EKKA 3S1MH 4K6LA 2WB1B 1ONLA 2UXDQ 2JQOA 4NDXA 4DK3C 1E7ZA 2F0MA 4RCNA 3JAMc 1H9MA 2F0VA 3OW7A 1LM0A 1I6VC 1WCMH 1T9HA 1PH8A 4OO1H 1ICWA 1G6ZA 3BVGA 3PUVA 3A8IE 3MHBA 3N6RA 1SBBB 1D8LA 1QG7A 1SYFA 5ELBA 3TS0A 3GTPB 2EYLA 3H6MA 1PZID 2OCEA 2VUMB 4OHJA 1B70B 2KHJA 3PO3H 4P2CB 1F9QA 4QGUA 4KI0A 3D31A 5KYLA 4DN4M 4ZYSA 3C46A 1QILA 2N78A 1HR0Q 3MFYA 2IX3A 2BA1A 4HTHA 4NXNL 1TWCB 2JA6B 5E4WC 4EX5A 2F0JA 1Y8OB 3I56A 4JI4Q 4ZUJA 3PIPA 1OXTA 4YCUA 1KABA 4P75A 4JI1L 4NXMQ 1J6QA 4XXEA 1DOKA 5BR8L 1FVIA 4BY1B 2K5WA 2JXMB 3IFTA 4DR2L 1ENCA 1TY2A 2EXZA 3PQIA 3G48A 2Z6KC 4DV2Q 1FGUA 4XIGS 3W1GA 1TY0A 4UP7A 2XSCA 2UUBL 4C3HH 2K50A 4TSSA 1B50A 2SEBD 1D6EC 3R93A 3M4QA 1G91A 3L9AX 3EROA 2B39A 1I6HB 2EIFA 2D0OA 1SYEA 3VR3A 4FF2A 4A3CG 4YWLA 3P20A 1STGA 4RKLA 4DNRB 2UUAQ 2WAQE 1PH2A 1A6XA 3X3MA 1FR3A 2ZXRA 3C1EA 3OYYA 2ZTCA 2LS01 1G8ZD 1RJTA 4JI8L 5IYBH 2E2HH 1YJWA 4IUTA 4AQYQ 3K5OA 2RBMA 3H0GB 3KK7A 2A6EC 4LUOA 1STYA 4LK1C 3A74A 1CFMA 4K5XA 4DNIA 1JB7A 1K28A 1Q7YC 5BN4A 3CCEA 3ITPA 1K8MA 3VA7A 1CKNB 1MD2D 1GD7A 3STBD 1U0LA 1AW7A 1LTSD 2NVQB 1KAWA 1I50H 2CFMA 2L4NA 4OIKA 4FP5D 5IWAQ 1IBLQ 5JJIA 2JJQA 5NUCA 5M5WB 1YNJD 4YY3L 2PNHA 5KYIA 1VQ9A 4OWXB 3M4YA 4X66Q 3I2ZA 2MHVA 3GTLH 5CV5A 1HZ9A 4ULLA 4KHPL 2A6HC 4QF4A 1GUGA 1T5XD 5DAUA 5JEAH 4DV3L 5IP9G 1I4GA 3CD6A 5HGQA 1MJEA 1N9WA 3DEPA 3L7ZC 2B63B 1DCZA 3K5MA 4KKSA 3J80i 5CMDA 3DEOA 4WORA 3GTGH 2JA5B 1I6HH 1YI2A 3UI2A 1N32L 1ENAA 1BXTA 3EBEA 4U68A 1ILPA 3NXWA 2I5MX 2Y0SB 4ILWA 3S16H 3NELA 1TKWB 1STAA 5IGBA 3T1HL 5T1GA 1EU3A 5C44B 3X3NA 4DV1Q 5JEAG 1SN8A 1PYSB 4YWKA 4IPCA 1NTGA 3M7NA 1U4RA 3MWYW 2JA8H 3AEVA 2RSOA 1E22A 1U5KA 5K5PA 2F0DA 2IPKD 1Y14B 5ISRA 2E2JH 1DGSA 4TVAB 4LF6Q 3SXHA 3CCSA 4WJ4A 4LF9L 3J81j 2KCCA 1BCPB 2RDFA 2PQAA 4DR1Q 3ERSX 3RZDH 2A8VA 5AJ3L 3U9SA 3F2DA 2OTJA 4QJFA 5EPKA 5JAVA 1HFNA 1EU4A 2UXCQ 4A3KB 4PQXA 1HNZQ 4HSVA 1L1OC 5C4JH 3DWQA 3WOFA 1IBML 2L5TA 4JC0A 3MXPA 4R8IA 2K6AA 4RKBA 1DOMA 3PIP3 1K8GA 3CW2C 2J4XA 1K3BC 5C0XG 1B8AA 1L1OB 3AB9A 2K4KA 2JA7H 4RGTA 5CR3A 4POFA 1NY4A 1EZ8A 4C3JH 1VQBA 4CJ2C 1OO9B 4KY5A 3OWEB 4O1NA 3VR2A 2VUMH 2EYHA 3LNNA 3BU2A 4JI8Q 3U4VA 2UUCQ 3H3VI 1EYCA 2MO1A 1M90C 3I72A 3HOYB 2X6GA 5C5MA 1Q1EA 3O13A 1I3QH 3F1ZA 2NYZD 4B3ML 4X64L 1BR9A 1ZKOA 3M4OB 1VQPA 4IOAA 2D5DA 1RIPA 2CQOA 2IW3A 4HAEA 3ND8A 3T56B 2FFKB 2NBFA 4IOCA 2MNAA 2ES2A 4CJ0B 2PPBC 5M5WH 3SGIA 4YY3Q 2MQHA 4IUQA 4XDXA 1X65A 1QUQA 2G9DA 2R7FA 2WAQG 4DUZQ 1KIXA 3CPWA 4JI2Q 1SJHD 3GTMB 1MBYA 2XVSA 4BS9A 4J8QA 3GTQH 4BY7H 3I70A 2L11A 4DUYL 3SHLA 1DD2A 1S3OA 2ZJQA 1FL0A 3GO5A 2YTXA 2V4DA 1ILQA 2F0HA 2K1BA 4DAYB 1QZHA 5M5YH 1IYVA 1R4PB 2EXDA 3QJYA 1KNAA 2F0KA 1AE3A 3H3VH 2CHBD 5DLQE 1NJIC 4KLKA 4OGQC 2D2CC 2F0OA 4DAVA 1BDOA 1BUVT 5ELNA 3SVMA 4IALA 1TWAB 1VF5C 1IZ6A 5EQ0A 1HTPA 2C35B 4NW2A 4DV1L 3IAYA 1PXUA 4KJOA 3S14B 2CCZA 2A74C 2XN9C 4JV5Q 4FDBA 4BY7B 1YHQA 2NN6G 2LY7A 3MFGA 4BWGB 1RODA 4GNXA 2QEJC 3NWTA 3D6CA 1U4PA 1I50B 2VW9A 1QJOA 3VYSA 2DY8A 1HHVA 2KQ3A 3S2DH 2EPBA 4DR1L 2NVYB 1IYUA 2RKSA 1LO5D 2TMPA 4L5RC 5C3EB 3VYTA 1Z6HA 2PYKA 1GKHA 2ZXPA 4GN3B 4KN4C 1S5ED 4K14A 1D1KA 5LMNL 4TQUS 4JI3Q 3NBHB 1TWAH 3Q24A 3CCUA 2NN6H 5ELCA 1IBMQ 3J7AV 3Q23A 4FVMA 1RTOA 5LMUL 1JWUD 3OSOA 5FJ8H 1VQ8A 2E8GA 1X56A 4CDFC 5FO9B 4FF3A 3HRZC 1JICA 4CJ1B 1IL8A 4HIMA 1NSNS 3ERQA 4KD4A 4A3DG 3NBHA 2NVTB 1O78A 3KJOA 4A3FG 1B3AA 3HOZB 2Z9HA 1XMOL 3NHHA 4YWMA 1HPCA 4Y7NB 3M7GA 5CV8A 3PF4A 4GOPA 4AYBE 1PH3A 2EVBA 3S1MB 3I4MG 5FJ8G 1VQEA 2K03A 2WIIB 5IT9L 1BCPD 1JE4A 1K73C 4H02A 1PVOA 1SNOA 4B08A 2R93B 5GAHC 3RR5A 5M9OA 2VS1A 3RNUA 3FPUB 4A3GH 3AQQA 5IODA 2K5NA 4XTCS 1CQFA 1EYAA 1IHZA 1LT5D 3I4LA 4DV2L 4A3EB 4UAIA 1PH5A 2VQEQ 4NPSA 5GADC 2N3SA 1YITA 3HOVB 1XJVA 3J80E 4JPBW 1EOTA 2F0FA 3M4PA 5CV4A 2AHOB 4ODGA 3KLRA 1T5EA 2UU9L 5M3MG 1IBKL 1ET6A 5GQOA 3A7AB 1G51A 3K59A 3KBGA 5IT9c 4O42A 4DV6L 1YEZA 1G2TA 3KF6A 1HJPA 3H3VC 1STNA 3M3YB 1G291 2KENA 3HOXH 4YCVA 4JV5L 2KJXA 5JJLA 1CT1D 4V0BA 1E1OA 3AFPA 1I94Q 4JI7Q 4UY8C 1FD7D 4K8JA 1F2YA 3FEWX 3PCOB 3E9IA 3S2HB 5C3EG 5CBAE 1A63A 5IWAL 5D3IB 4ID6A 2JK8A 3LX0A 4DV5L 1PYBA 4FXKC 4GN4B 4DK1A 1QWYA 4PMBA 3CXCA 2HUGA 4GOPC 4X66L 1O7ZA 1F2MA 5I6YA 3G71A 4KN7C 3J81c 1STBA 2D0PA 5C3XA 3HG9A 2HDLA 1RL2A 3CMEA 4E6IA 4RFBA 2A1AA 5EBCA 2VNUD 3I4NH 2JA5H 2ZM6Q 3T53B 4C56C 4QUFA 5LMUQ 1F77A 4XQNA 1WYDA 4PZ8A 4RGOS 1SNCA 1RTNA 4A3EG 1FGBD 1EY5A 1UEAB 3TREA 4K5WA 3A5UA 4BBRG 3C2PA 4BXXG 2Z6KA 1B2TA 1EWCA 3CCQA 3A55A 1RCVD 1PFSA 3M9BA 4HJ5A 1W3SA 1WTRA 2QDBA 3U9OA 3SK6A 1X9NA 2EYJA 3D4WA 5LHY1 4DK0A 1PH1A 1IKMA 1V1OA 1MI2A 2O5IC 3RLOA 1N34Q 1PZKD 2F0EA 3P75A 3R3OA 1DYQA 4LWCA 2MUYA 2N8NA 2VB2X 1LT4D 4LF6L 5FLMH 4A3EH 4DV7Q 3BG3A 3BVMA 3CQZB 3TN2A 1SMYC 4KKUA 1EY8A 2QF7A 3GP7A 1EFID 2ICEC 2K28A 5C4ZA 1HQMC 1YIJA 4DR6L 1Y1WH 1Q8IA 2PI2A 4R4TA 4GKKL 1X55A 3N52A 2JEBI 4L5TA 5IY0A 4F8MA 3C3LA 1KAAA 4CKEA 3FDTA 5C4XG 4A3MG 1JJCB 1YHAA 4DV4L 1AZPA 3M3YH 2ENBA 2KUMA 2Q2IA 3S17B 1WFQA 1KC8C 4HMIA 3VYUA 4OWWB 2BE5C 4I7AA 3CCVA 2Z4IA 3ULPA 4A76A 3CPFA 1Y1WG 3OOCA 3QOJA 3L2PA 2CW0D 4OIJA 1JT8A 1BBUA 4LUVA 3TSSA 1JCKB 3K7AH 1PHJA 5FLXE 5LL6S 3BZKA 1WTWA 5C4XH 4A3MH 4HJ8A 2SNMA 4Y52H 5LMNW 3D3RA 2SDFA 1SLJA 1F9SA 3DMUA 1UAPA 1BNZA 4OL7A 3A0JA 4K2LA 3T1YQ 1ENFA 4PMCA 2NZHA 2K14A 3K5LA 1YJ9A 4KKTA 1TWCH 4JVZA 2HHHL 3S16B 2XNAC 4FXGC 3OPOA 4OO1I 3KLWA 5ELFA 2CH4W 4A3LG 4N9TA 1HR0L 3OIQA 3PF5A 4X62Q 1YJNA 4MN3A 3I91A 1EL0A 1UEBA 5H1SE 3D4RA 4LFBQ 2DUDA 3QB3A 1GUNA 3L0OA 2NTSA 2DN8A 1VQHA 2F0NA 4C3IH 2JE6I 5BR8Q 1LT3D 2F0GA 1HR0W 1U4LA 1SRUA 2SOBA 3JAME 4DR2Q 1TWHB 2F0LA 4QL5A 4A3JG 4LUZA 1WTPA 2A69D 1D5MC 4IJLA 2PNRC 1S5BD 4AH6A 1JORA 1EYDA 4JBWA 2OWOA 1G6PA 4XYQA 2WINB 2J7ZA 3S9WA 1VQMA 1QOHA 4C1NI 5D65A 1VF7A 2E74C 2BH8A 3CRKC 1X6OA 1GXDC 1TQOA 5EGTA 1MJCA 2WV6D 1IYJB 2JA6H 1ET9A 4HMJA 1TWGB 3F2UA 1GJXA 3GTJB 3S1QB 2NZOA 1R9TB 2XIWA 4JI0L 5DEHA 3A8JE 5GAEC 1KDBA 5CBEE 1DZ1A 1CM9A 1S40A 2Q8RE 1AZQA 3LWUA 2ASBA 1Y1VB 1GO3E 2PZWA 4DR3Q 1IW7C 1JB3A 2UUBQ 1XX8A 4OO1G 2JA6G 1Q86C 3C1FA 3TQYA 5BN3A 1PLFA 1HNXL 3F8TA 4DAYA 4ZRZA 2FMCA 4DV3Q 4NKLA 1L2FA 4EQOA 2VY3A 2WKDA 3HKSA 5EPLA 3AU7A 3PUXA 2GVAA 1ML0D 3EA6A 5E3FA 3OWFA 2D9UA 2P5ZX 3DWPA 3MXGA 2PZTA 2KECA 2JYOA 3P7JA 3GTGB 1KXLA 4GNXC 4YCWA 2OQKA 3EVQA 1ZYRC 5EKLA 3NQIA 4KY7A 3Q8DA 3PSIA 4DNTB 1VQ6A 1SMYD 3G6JB 1LABA 1FYCA 4HR7B 1H9RA 1GHJA 2F0WA 1V9PA 1IBLL 3J81i 1XWEA 2F3VA 3VDYA 2HHHQ 2MGSA 4OWTB 4QCLA 4LF5Q 4DPGA 3MEHA 2B8FA 2JP1A 2K5DA 5E1FA 3BS1A 2I07B 3HOVG 1X3QA 2NVXB 1R9TH 3HP3A 4A3KG 1NBWA 1J5EL 1SE3A 4ZKBB 1AN8A 5JOBA 2R6GA 4WFN3 5HURA 1W6JA 1SNQA 1WOCA 2JA7B 2MPMA 1KL9A 3NTKA 1X54A 4IFDJ 2VXWA 1LTGD 4EQNA 2OF1A 2AWOA 3AYHB 2UU9Q 5IYBG 3QO2A 2TSSA 1V1PB 3HOVH 3CC2A 3SEBA 3J81L 5M5YB 4XYOA 4KK7A 2R7ZG 4JCVE 2HD3A 3MTSA 1NMGA 1ZXTA 1QCBD 1PRTF 4DV6Q 4DR5Q 1WD1A 2WB1E 2F0PA 1IL2A 2NUCA 3W2DA 2EY6A 1PFNA 2IWHA 2DGYA 2E2IH 1CUKA 5C4JB 2A73B 5J3BA 1DXMA 2MFIA 5HGTA 4IO9A 2PMZE 1MGSA 2PW7A 3SE0A 3TMEA 1XMQQ 2V1CC 2ID0A 4J1MA 4CDEC 4I65A 3Q6SA 4H7BA 2NVQH 2UUCL 2PQAB 2EYFA 3HEJA 1AFPA 1EIGA 3KYHC 4IZ8A 3GTJH 4QMGA 4CKBA 3KOJA 3ULLA 2YU9B 2R92G 4ZQ3A 4JI0Q 4JYAQ 2MJ8A 5AJ3Q 1NR4A 3VR4A 3SDZA 1EQVA 2KA7A 1KLUD 4RAUC 3V2TA 1Y1VG 3E5SA 2MP1A 2UXBQ 2VB3X 1WCMB 2B3GA 3QIAA 1EFWA 3GTQB 1TR5A 4G7OC 2H1EA 2RQXA 5D14A 1SYBA 1XNQQ 3RZOH 4X65L 1B3QA 4GNXB 3K57A 1SNMA 4P71A 2IT1A 1S5DD 5M3FG 2CWAA 1L0YB 3CCRA 1TWHH 3ZJYC 4R1JA 1CA6A 1HA5A 1CKMA 1II3A 4GLAC 4RG1A 3A54A 2XGTA 1PA6A 1E2ZA 3OHXC 4O2DA 4TKOB 1V1PA 3ONAB 2LXKA 1HRJA 3BDCA 5JPMC 5LL6X 3A5ZB 1PV4A 3CF5A 4XQQA 4JK1C 1OXUA 4CDCC 1ICFB 4FXDA 2HT1A 3BYYB 4LFCQ 2R93G 3NENA 4CKCA 5KGUA 2IY5B 1EOVA 3EN2A 1QNKA 1VQKA 1N34L 5C0XJ 2RHQB 1VQCA 4MNOA 5KNBA 4X64Q 1XYIA 1NAPA 5E4XA 4UDUC 1A3VA 3D4DA 1H9SB 3KF8B 3L3OC 3HOWB 1K9MC 2AUKA 1TS4A 1AH9A 3SK8A 1CTMA 5IGDA 1SYGA 1MIUA 3KUPA 4AIMA 2OTLA 3S1NB 3S1QH 2QDLA 2OEOA 3FP9A 4K5VA 2BCOA 4HJ9A 2N55A 5CGKA 1CKNA 1JQYD 2EJFC 1Z7TA 2XRSD 1JOQA 1L0WA 4OEMB 1PTOC 5G3LD 1JJ2A 3S14H 4JI2L 3FHWA 1I4HA 1A3TA 2PO4A 3ULJA 4APVA 2NB0A 3TP8A 1N36L 4F88A 2VQFL 3IFDA 4RMFA 3ZYYX 5EBDA 1I4XA 4MTNA 1PH7A 1CZWA 5C4HA 2XWJB 4DR4Q 4WRDA 4X3TA 3OIPA 1D7QA 1VQ4A 1WJJA 4LF4Q 1N33L 4G57A 5CV7A 2O2LD 4DV0Q 2I5HA 3GV6A 3S15H 1H9SA 1MSHA 1QVGA 1CHQD 5ELOA 1R4QB 2DJFC 3PV0A 4PV1C 1SE2A 5CYUA 1TWFH 4MTKA 2B2VA 2E2HB 3D6WA 1SFOB 1LACA 3UE0A 1OXSC 2HDMA 2B2WA 2B63H 2AKWB 5EJWA 2FJ2A 4HN7A 4RGMA 3FKIB 1X32A 2LXJA 1A8VA 2NN6I 2KHSA 4IUVA 2F4VQ 3T16A 5IYDG 4IPDA 2LFNA 5IP7H 3K8AA 1OTCA 2R61A 3A7LA 3OW2A 1EY4A 3UDIA 1K8AC 2LMCB 1XMOQ 3HGBA 1ESFA 2Y0SG 1HZCA 1P16A 2IL8A 2RDGA 4RWSC 3TEHB 1XTDA 3J80L 2K5VA 1JC7A 1LV9A 1UE1A 4HJ7A 1VQDA 4KD3A 5C44H 3HKZE 1PYWD 3PIO3 1N8RC 1VMCA 1A15A 3J7AF 4JYAL 2B2VC 3HOZH 1A2TA 2JEAI 2B63G 5TSSA 4X62L 1WTXA 1I5FA 3UDGA 4NB3A 4HIOA 4RHSA 2OT2A 5FKAC 2UXBL 4XT3B 1Y8NB 3F2BA 1VQIA 4JI3L 2WB1G 5IYDH 5C0XI 2A19A 3D8GA 2F0QA 3KDFA 1PRTD 3JC66 3AFQA 1XNQL 4X65Q 3I7FA 5J22A 4UHVA 1VS0A 1IXRA 4N9PA 4V190 4DF7A 3BJUA 2ZTEA 4ZAIA 1Y8PB 5IT9E 4JI5Q 1D1IA 5C44G 1QVCA 3PGZA 4UP9A 3HOZG 4A3MB 3K5NA 1K8OA 3NWSA 3B6YA 2ZJRA 4A93H 2F4IA 1OXVA 3IKJA 3NP8A 4F7XA 1Q82C 4LF8Q 1JE5A 1QE6A 2CQAA 1DOLA 5E7NA 4DGZA 1S4ZA 4JG2A 1Z47A 2F0UA 4R4CA 2ZT9C 3LWEA 4K0KL 3V96A 4N8X1 2EZVA 3ICEA 4GS3A 4QUCA 1PH9A 1B7YB 1F9RA 4C1NK 3E6ZX 5JVH3 4JI7L 5IE8A 2OXPA 5IGCA 1Y69U 4B9WA 4DR7L 3J7A5 4RH6A 3H15A 3HZXA 5JJZA 4KMUC 4ZLTF 3MC0B 3MXUA 3HOXB 1SMXA 1K83B 2E2IB 4IPHA 1E2VA 1O7IA 1GHKA 2E76C 2F03A 1PTOH 1X3GA 4K8IA 4DR3L 2VZAA 1A0IA 2B2TA 5L37A 1EUJA 4MIUA 5JJKA 4DV0L 4L6TB 1EWIA 1HNXQ 3CP0A 2K05A 2F0IA 2Z8LA 4QIWB 2QW7A 3TS2A 2WAQB 3SK5A 3G4SA 2QA4A 4FF4A 2R7ZB 1EZ6A 3H94A 3BDLA 1FNVA 4K6DA 4IN3A 1I4RA 2K33A 4IJHA 1U4MA 3NTHA 2F0TA 4EVOA 1KRTA 3I4MH 3EQLC 2KOLA 5J1ZA 2EYMA 4C3HB 3BYTB 3WOEA 1C48A 4A3IG 2EYOA 3BDOA 5A35A 2F4VL 1TT2A 2CVRA 1WVLA 1TS2A 1K0RA 4C3HG 5AFWA 4ALPA 3FPPA 2RHSB 3EIVA 1BOSA 4G4KA 2CW0C 2RDHA 1M1KC 1JWMD 1PRTB 3GDEA 4OELB 1UUPA 1O7LA 1H9JA 4A3CH 1JJGA 2SNSA 4H0LC 3TP5A 4A3GG 2HIVA 3F2CA 3BZDB 2I5LX 1S5FD 5KRUA 3Q0AA 4DV7L 1HTLD 4A3IH 4ZUIA 3K0XA 1I4PA 4C3IB 2ZXOA 3CC4A 2BH2A 1RKNA 3RZOB 5GROA 4JI4L 4HEDA 1YNND 1FJGL 5DM63 3BZCA 4AYBG 3HFZB 2NTTA 2EDGA 4IURA 2ZM6L 4DR6Q 2EJGC 5M3MH 3K58A 1XXGA 1XPOA 1EQRA 5EAYA 2UXDL 3R2TA 5CC4A 3GTKB 5GAGC 1HNWQ 2X69A 3TDQA 2Y0SE 2PZUA 3OMCA 2A6HD 5ELEA 4GKJQ 1WTVA 2YU9H 1BBXC 5FLXL 2KBNA 3A56A 5A2QE 4DV4Q 4PZ6A 3HOXG 1ASYA 2WP8J 2DNCA 1I3QB 3K7AB 1EIYB 2BDOA 4DK6C 1WTHA 1CA5A 3FKIH 4M1UB 1ESRA 1WTQA 4GN5A 5IP9H 1KDCA 4ME5A 1EWHA 3TBIB 5FO8B 1E1TA 5C3EH 4JOIC 5KNCA 1GUOA 1KHIA 3LGJA 2D62A 2IHFA 1YNJC 4B3RQ 3MVVA 5COYA 1SNDA 2Z1CA 2F3WA 4PG3A 1CSPA 3D0FA 1YNXA 3PO2H 1C7YA 4NXNQ 4PMWA 1ASZA 2K32A 2K75A 1VQJA 1L0XB 1J8IA 4F87A 4M8AA 1Q8KA 3J7YW 1Q81C 4JBMA 2N88A 2PQEA 3UDXA 3KJPA 5I9OA 1F2LA 4DKAC 1DJRD 4A3JB 1X3FA 3AMUA 4GKKQ 2AQ1B 4A3IB 5I4DA 3T1YL 3FKIG 4GZYC 3U50C 3OMGA 4L8JA 4WJ3M 1PDQA 2Q8TA 1C8CA 2JA8G 4I7ZC 4FO2A 1SXTA 4ME3A 4KV6A 1MHWC 3KLSA 3OTOQ 1SAPA 4FYDA 2PCFB 1F2ZA 1GVPA 4BBRH 3PUZA 3TRZA 3PO2G 2E2JB 3GQBA 2B8GA 1LLRD 2R92B 2R7DA 4B3TL 4KHPQ 3FVQA 4A3DB 4GLXA 1MKHA 3K81C 3HKZG 4P73A 1Q1BA 1F9PA 1RD9D 2Q2UA 1I4QA 1AE2A 3NBIA 4GLVB 4Y7NH 1WI5A 3BVZA 3I4MB 4R9WA 2KCMA 1PTOD 4N8FA 1EIFA 3JAML 3CCMA 1SNPA 1N32Q 1SR3A 4UP8A 3GTOB 4X3SA 3HOUB 4R8NA 1VQAA 5KEEA 4A3BB 1A62A 5BN5A 5FO7B 1AEXA 4BBSB 1BO0A 3E3XA 5C0XH 3T1HQ 2RF4A 5C3WA 3EJIA 2IJ0A 3CCJA 3J7ZC 1K3RA 4LFAL 2OQ0A 2JA7G 5FK9C 4C3JG 1W6KA 2QEXA 2VUMG 1TVXA 4R4IA 2EOTA 4B3SL 4HIKA 1IW7D 3CAMA 2AUJD 2WKCA 2YYZA 1VDZA 4PNYA 5C6AA 1PFMA 3TP7A 3I73A 3NQTA 2HCIA 1K0SA 1E24A 4S3SA 3SK4A 1LTID 1BCPC 2A6ED 2K7VA 4DXGA 1VQ5A 4LFBL 1IKLA 2XTIA 3PUWA 1FJGQ 3MA2B 1VQGA 3T4AC 3KLSX 2ICIA 4LF4L 1N33Q 1CHPD 3IRBA 1HNWL 1QB5D 4GKJL 3WWVA 1CKOA 1EIHA 1VQNA 1E2WA 3NUCA 2B2TC 2LSSA 2H4OA 1LTLA 1J9OA 2IX0A 1KRSA 1RHPA 2A68C 2RCNA 4MZ9A 1D5XC 1TU2B 4BY7G 2L9HA 4OX9L 4KHVA 2PW5A 3CCLA 4B3RL 2R3ZA 1TXYA 1KQSA 2YTVA 1EEFD 1HH2P 2DNEA 3DM1A 3KBXA 1HQRD 1SYCA 1JOOA 3STBC 2QILA 1BCPF 5CV9A 4YHHQ 1B53A 2M00A 4BBRB 3HOWG 4LF9Q 2RA4A 1S5CD 1H9KA 2FXQA 2HQEA 4B3MQ 1SYDA 4HJAA 1B4OA 1KTKA 2XWBB 1NNXA 4LNQA 1PMRA 3RUZA 1Q3LA 4L63B 3CMAA 2Z6BA 1BKBA 3QR8A 3K80C 4BA1I 1EQQA 1TS5A 2I46A 3K6OA 1VMPA 3OTOL 1SJED 1GM5A 4DXFA 4LF5L 4KJNA 1HFGA 2Z4HA 3M85A 3RN2A 3P1HA 4BBSG 3JAMi 3HOWH 2KHIA 3VR5A 3DLLA 3H91A 3CKIB 2N49A 3R2IA 1C0AA 1UE6A 4DFAA 4IFDH 3DXJC 3RLFA 1QVFA 4JBKA 2EY1A 3G7LA 1WTOA 5IYCG 2E2DC 2KCTA 1GOZA 3S1RB 3DM3A 2E75C 3CHBD 4RGNA 4POGA 4G7ZC 4EQPA 1M4VA 4BBSH 2YTYA 3I4NB 2F1MA 3S24A 4JW0A 4YIJA 3SR1A 4C2MB 2EY2A 1NE3A 4LFAQ 2EY5A 2ATWA 1CK1A 4MHEA 4A3DH 4IFDG 1H95A 4ZKCB 2BOSA 1SSOA 4FNFA 1VQFA 1O80A 5I2XA 1JR0D 4A3FH 3H09A 1G2SA 1LYLA 4KTAA 4P74A 5IYCH 1HZBA 4B3SQ 1J5EQ 2CH4A 3NPPA 4DUZL 3R8BA 2L55A 2O5JC 3K0YA 1LTRD 2NZ1D 1EYGA 1GUWA 2IHEA 1M8AA 2BDNA 5KIXA 4GOPB 3RZDB 2F0SA 1PTOB 5FOBB 4DUYQ 3MXNB 2NWGA 2NVYH 3GD7A 4LF7L 2QCPX 2AWNA 5M5XH 1SDFA 4K2KA 3IL8A 1NR2A 3KFUA 4LJZC 4JI1Q 4NXML 4X3KA 1VCIA 1LT6D 4EGVA 4EQ5A 4RHRA 2Z0SA 3CC7A 4Q5VA 5JVG3 4G7HC 1NUCA 2B2YC 1EY7A 1PZJD 5JEAJ 4A93B 1XPUA 4BA2I 1HA6A 3J80c 3NK9A 3NE5B 4QY7A 4LAAA 1STHA 3ND9A 4DR5L 3W1BA 1BBWA 5ELDA 3VYRA 2FINB 4B9XA 2I0QA 4PZ7A 2A68D 1S72A 4OX9Q 1TIID 4JI6Q 4QIWE 3U4ZA 2BE5D 1KNEA 1YNNC 4DAPA 4A75A 1XMQL 3DWAA 2C5CA 2RCFA 2FMMA 3DUZA 2HQLA 4TRDA 2UUAL 5M5XB 2L15A 4OXPA 1V1QA 4YHHL 4IPGA 1XNRQ 1VQOA 4R4OA 4XQJA 4A3KH 4LFCL 4AQYL 1Z9FA 4LW1A 2WACA 2NVXH 1A3UA 4J15A 4IUNA 5EPJA 3TZDA 4U673 5A2QL 2ZJPA 1PFBA 2EJMA 3RMHA 4H44C 5HY6A 2L0CA 3MXNA 1B9NA 4O0AA 2GVBA 3S1RH 2H5XA 4ABNA 3CRLC 2ALYB 4CBVA 2E5LQ 2AMCB 4RCOA 3Q22A 2VL6A 5KNDA 4HCEA 3S1NH 4IUPA 2R7ZH 5I9PA 2NVTH 1JWSD 2A69C 4IUUA 4C2MH 2EQSA 3KF6B 3QWNA 1LTTD 1HCZA 3E0JA 4KY6A 2DJGC 2QKIC 3I3CA 1A2UA 2VQFQ 4R4QA 2EE1A 1TWFB 4IQZA 1NMFA 1RDPD 4X3UA 1PRTC 2K04A 1C4QA 4LMQD 2CKZB 4WJWA 2F3IA 1HXYD 3I4NG 4DAMA 2HIXA 2JA5G 5CORA 1BF4A 1BVSA 3MAQA 2B2WC 1IBKQ 3QG1A 1LUZA 1VQ7A 2R92H 1B44D 3S15B 1QNUA 1X3EA 4BXXH 1SFOH 2B2UA 2KEEA 2Q2HA 4C3JB 1Y1VH 1SROA 2Q2TA 1NCVA 1AP0A 2PI2E 3TZUA 4QQBX 1ZEQX 3HS0C 4A4IA 1UE5A 3QOLA 1SE4A 1PH4A 1V43A 1LTBD 1HUMA 2ZTDA 4CDDC 2CWPA 3EFXD 3A8KE 5DM73 4UPAA 1LTAD 3KF8A 1E0BA 3NEMA 4JBJA 1D2BA 1C9OA 5T1IA 1D5ZC 5M3FH 1FNUA 1QUQB 3FMCA 1XTCD 5IGEA 5EKIA 2GN5A 2YV5A 4LF7Q 1N36Q 1B9MA 2K5HA 5FLMG 3WDNA 2QGQA 2VQEL 1EY6A 4DA2A 3UDFA 4ZCKA 1Y1WB 2O4XA 3VA5A 4AYBB 3GTPH 4DR4L 3I8ZA 4L5SA 3S2DB 4B3TQ 4CHTB 3J81E 2UXCL 2F52A 3I90A 1L1OA 1X3PA 4OONA 4A3BG 2HCCA 1HNZL 2R93H 3T13A 1EY9A 2LKVA 2WFWA 1JMCA 4J6HA 4Q0FA 4DU9A 2M9VA 1JOKA 4KHZA 4A3GB 1OXXK 4HSPA 3RD4A 1KDAA 3PO3B 2G5DA 1YBYA 4Z9CB 2DY7A 1RF2D 4JI6L 4JI5L 5FLXc 2KEDA 1Q46A 3W3AA 1I94L 5G3LF 3NTIA 3GTKH 1W2BA 1YHBA 3G6EA 1XNRL 4A3BH 4L5QA 4QB4A 5DNFA 1CI3M 5CV6A 2AQ2B 1HZAA 5C5LA 1XPRA 4DV5Q 4CGYB 3KDFB 1GUTA 3HOYG 3URYA 1SEBD 1TS3A 5IOCA 3GV3A 3S2HH 1CZGA 1ZYRD 4X6AH 2JA9A 1PTOF 4RA8A 3M4OH
chains in the Genus database with same CATH topology
1E3PA 3T1YL 3S2DH 4IFDI 3HOVG 3FKIG 3U50C 4DR1L 1R9TH 3GTOH 3HOUH 3I55A 4A3KG 4WJ3M 1NBWA 1J5EL 4L5RC 2JA8G 1TWGH 4ME3A 1VQLA 3OTOQ 3I4OA 1GKHA 2E5LL 4GN3B 1Q12A 1GVPA 4BBRH 2R6GA 3PUZA 3TRZA 4JI3Q 3PO2G 5LMNL 4TQUS 3H0GH 3NBHB 1TWAH 1WOCA 1UWVA 3CCUA 3HOYH 2R7DA 4B3TL 1KL9A 1IBMQ 3UE1A 1X54A 4KHPQ 4IFDJ 4GLXA 1MKHA 3K81C 3HKZG 4P73A 5LMUL 1Q1BA 2MO0A 3S17H 4A3LH 3RN5A 2IX1A 3ER0A 5FJ8H 1VQ8A 1YZ6A 2AWOA 2E8GA 1X56A 3AYHB 2Q2UA 2UU9Q 5IYBG 3E9HA 1AE2A 5IP7G 1PH6A 3HOVH 3CC2A 4GLVB 4Y7NH 1P8LA 3HOUG 4LF8L 1WI5A 4GKKQ 2KCMA 4HIMA 2R7ZG 1EIFA 1KD1C 4A3DG 4JCVE 2BA0A 3CCMA 1NMGA 4DV6Q 4DR5Q 3KJOA 2WB1E 1IL2A 1N32Q 1SR3A 4UP8A 4A3FG 1VQAA 1XMOL 2DGYA 1A62A 3K7UC 4P72A 4YWMA 2E2IH 3H0GG 1CUKA 5J3BA 4K0KQ 2MFIA 3U58A 4A3JH 3PF4A 4IO9A 2PMZE 4GOPA 3W5OA 4AYBE 3T1HQ 2RF4A 1XMQQ 1QZGA 2V1CC 3GTMH 2ID0A 3PIOA 3CCJA 4BY1G 3J7ZC 1K3RA 1PH3A 4LFAL 1SE8A 2OQ0A 2JA7G 3I4MG 5FJ8G 2NVQH 2UUCL 2PQAB 1VQEA 2QEXA 3PUYA 2B29A 3KYHC 3GTJH 3E0EA 2VUMG 4DR7Q 3KOJA 4R4IA 3ULLA 3CQZH 4H02A 1K73C 4B3SL 4HIKA 2R92G 3CAMA 1PVOA 2YYZA 4JI0Q 4JYAQ 5AJ3Q 1CSQA 5GAHC 1K83H 3RR5A 1E24A 1Y1VG 1YVCA 1UE7A 2VS1A 2UXBQ 1VQ5A 3RNUA 4LFBL 2B3GA 1WCMG 2XTIA 3PUWA 2K52A 1EFWA 1FJGQ 4A3GH 3AQQA 1VQGA 2K5NA 4XTCS 4BY1H 1XNQQ 3RZOH 3MEFA 4X65L 4A93G 4DV2L 5LMNQ 4GNXB 4P71A 2IT1A 5M3FG 1PH5A 4LF4L 1N33Q 3IRBA 2CWAA 4JOIA 2VQEQ 3CCRA 1TWHH 4NPSA 5GADC 2N3SA 3RLNA 3ZJYC 4R1JA 1YITA 3PO3G 4HIDA 5K36G 4GKJL 3WWVA 1CKOA 1XJVA 1CKMA 4GLAC 4RG1A 3S1MH 1VQNA 2XGTA 1PA6A 4O2DA 3M4PA 2LSSA 2AHOB 2UXDQ 2JQOA 4DK3C 1E7ZA 1LTLA 2LXKA 2IX0A 2UU9L 1KRSA 5M3MG 2RCNA 1IBKL 3JAMc 3A5ZB 4MZ9A 3CF5A 1PV4A 4BY7G 5GQOA 1G51A 1LM0A 1OXUA 4OX9L 2HT1A 1WCMH 4LFCQ 1T9HA 5IT9c 3CCLA 1PH8A 3NENA 4DV6L 4B3RL 1KQSA 1TXYA 1YEZA 2R93G 2IY5B 1EOVA 3PUVA 2YTVA 3EN2A 1HH2P 1VQKA 1N34L 5C0XJ 3TS0A 1D8LA 2RHQB 3KF6A 1HJPA 1VQCA 4MNOA 3STBC 1G291 4X64Q 2OCEA 1B70B 2KENA 4YHHQ 4YCVA 3HOXH 4JV5L 2KHJA 5JJLA 1E1OA 3KF8B 3AFPA 1I94Q 4JI7Q 4UY8C 3PO3H 1K9MC 3HOWG 1AH9A 4LF9Q 4QGUA 3PCOB 4KI0A 3D31A 3E9IA 1MIUA 2FXQA 4AIMA 2OTLA 2N78A 1HR0Q 3S1QH 4B3MQ 5C3EG 4HJAA 3FP9A 1A63A 5IWAL 4HJ9A 2JK8A 2BA1A 4NXNL 4DV5L 1PYBA 4GN4B 1CKNA 4LNQA 4EX5A 3I56A 3CXCA 3CMAA 4JI4Q 1L0WA 1BKBA 4GOPC 4X66L 3PIPA 3K80C 4BA1I 1OXTA 4YCUA 4P75A 1EQQA 3G71A 3FHWA 4JI1L 1JJ2A 4JI2L 3S14H 3OTOL 1GM5A 4NXMQ 1J6QA 3J81c 5BR8L 2D0PA 1FVIA 4LF5L 3ULJA 4APVA 1RL2A 3M85A 3CMEA 3RN2A 1N36L 2VQFL 4DR2L 4RMFA 4BBSG 2A1AA 3JAMi 2VNUD 3HOWH 2KHIA 3I4NH 4MTNA 3DLLA 1PH7A 2JA5H 4DR4Q 2ZM6Q 3G48A 2Z6KC 4DV2Q 5LMUQ 2N49A 1D7QA 1VQ4A 1WJJA 4LF4Q 1FGUA 4XIGS 1N33L 1WYDA 2I5HA 1UE6A 4PZ8A 3W1GA 4DV0Q 3S15H 1C0AA 4UP7A 1QVGA 4A3EG 5ELOA 3TREA 3RLFA 2UUBL 3PV0A 1QVFA 4JBKA 4C3HH 2K50A 1TWFH 3A5UA 4BBRG 3M4QA 5IYCG 2Z6KA 4BXXG 2KCTA 2EIFA 2D0OA 3UE0A 3CCQA 1OXSC 1PFSA 3DM3A 3M9BA 4HJ5A 4A3CG 4YWLA 2B63H 2AKWB 4POGA 1W3SA 2UUAQ 2WAQE 1PH2A 1X9NA 2LXJA 1A8VA 2NN6I 3OYYA 4BBSH 2YTYA 2ZTCA 2F4VQ 5IYDG 1PH1A 4IPDA 4JI8L 5IYBH 5IP7H 2E2HH 1YJWA 3RLOA 3K8AA 3S24A 4AQYQ 1N34Q 1OTCA 3OW2A 3UDIA 1NE3A 4LFAQ 4LWCA 2ATWA 4LUOA 2N8NA 1K8AC 4A3DH 1XMOQ 4IFDG 3A74A 4LF6L 5FLMH 1H95A 2Y0SG 1HZCA 1P16A 3TEHB 1VQFA 4DV7Q 4A3EH 1XTDA 4DNIA 2K5VA 4A3FH 1Q7YC 1JB7A 3CCEA 1UE1A 4HJ7A 1CKNB 1VQDA 1LYLA 1GD7A 3HKZE 4P74A 5IYCH 1HZBA 5C44H 3STBD 4B3SQ 1N8RC 1U0LA 1J5EQ 1KAWA 1I50H 4DUZL 2CFMA 4JYAL 5JJIA 5IWAQ 1YIJA 1IBLQ 3HOZH 4DR6L 2JJQA 2JEAI 1EYGA 2B63G 1Y1WH 4X62L 2IHEA 1I5FA 4GOPB 3UDGA 4YY3L 4NB3A 4HIOA 2PI2A 2PNHA 4R4TA 4GKKL 2UXBL 1X55A 4DUYQ 3MXNB 4LF7L 2JEBI 2NVYH 1VQIA 3GD7A 2AWNA 2WB1G 4L5TA 4OWXB 4JI3L 5IY0A 2A19A 3I2ZA 5M5XH 4X66Q 5C0XI 3KFUA 4JI1Q 3GTLH 1HZ9A 4NXML 1VCIA 3KDFA 4KHPL 3JC66 3AFQA 5C4XG 1XNQL 4A3MG 1JJCB 1YHAA 4X65Q 4EQ5A 4DV4L 2Z0SA 3CC7A 3I7FA 3M3YH 2Q2IA 4DV3L 1VS0A 1IXRA 5JEAJ 1WFQA 5IP9G 1XPUA 4BA2I 3CD6A 3BJUA 5HGQA 1KC8C 2ZTEA 3J80c 1MJEA 1N9WA 3L7ZC 5C44G 4JI5Q 4OWWB 1QVCA 3J80i 3PGZA 4QY7A 4UP9A 3CCVA 3ULPA 3GTGH 4A76A 3HOZG 1I6HH 4DR5L 1YI2A 3CPFA 3W1BA 1BBWA 1Y1WG 1N32L 3EBEA 2I0QA 3B6YA 4PZ7A 1S72A 4OX9Q 3L2PA 2ZJRA 4A93H 1OXVA 2I5MX 1JT8A 4JI6Q 1BBUA 4LUVA 4QIWE 1Q82C 4LF8Q 1JE5A 3K7AH 1PHJA 3U4ZA 3S16H 3NELA 3BZKA 4A75A 3T1HL 1XMQL 5C4XH 4A3MH 5E7NA 2HQLA 4HJ8A 2UUAL 4Y52H 5LMNW 2L15A 4JG2A 4OXPA 1V1QA 4DV1Q 1SLJA 5JEAG 4IPGA 4YHHL 1Z47A 1VQOA 4R4OA 1SN8A 1XNRQ 4A3KH 1PYSB 4YWKA 4LFCL 4R4CA 3A0JA 4IPCA 1NTGA 4AQYL 3M7NA 1Z9FA 4K0KL 3AEVA 3T1YQ 2JA8H 1E22A 3ICEA 1U5KA 2E2JH 4GS3A 1Y14B 2NZHA 1DGSA 4TVAB 1PH9A 4LW1A 2NVXH 1B7YB 2K14A 4J15A 4LF6Q 1YJ9A 1TWCH 3CCSA 2HHHL 4JI7L 5IE8A 2ZJPA 4WJ4A 4OO1I 4LF9L 3J81j 3KLWA 4DR7L 3J7A5 2PQAA 5HY6A 4DR1Q 3ERSX 3RZDH 4A3LG 3H15A 1HR0L 4O0AA 3PF5A 2A8VA 4X62Q 1YJNA 2GVBA 3S1RH 2H5XA 5AJ3L 1SMXA 1UEBA 2ALYB 4IPHA 3F2DA 2OTJA 5IYDH 5H1SE 4QJFA 2E5LQ 1O7IA 2UXCQ 2AMCB 1X3GA 2VL6A 4DR3L 4LFBQ 2DUDA 2VZAA 3S1NH 1A0IA 2R7ZH 3L0OA 1HNZQ 2NVTH 1VQHA 1L1OC 4C3IH 1EUJA 2JE6I 5C4JH 5BR8Q 4C2MH 1IBML 5JJKA 2EQSA 3KF6B 4JC0A 1HR0W 4DV0L 1EWIA 1SRUA 1HNXQ 3CP0A 4R4QA 2VQFQ 4DR2Q 1K8GA 3CW2C 4QL5A 1NMFA 4A3JG 4LUZA 3TS2A 5C0XG 3G4SA 2QA4A 1B8AA 2CKZB 1L1OB 2F3IA 2K4KA 4IJLA 4IJHA 4AH6A 3I4NG 2JA7H 1KRTA 3I4MH 4DAMA 2HIXA 4POFA 2JA5G 1NY4A 4JBWA 4C3JH 1BVSA 2OWOA 1VQBA 1IBKQ 1G6PA 4A3IG 2VUMH 2F4VL 2UUCQ 3H3VI 3BU2A 4JI8Q 3U4VA 1LUZA 2MO1A 1M90C 1VQ7A 2R92H 1K0RA 1Q1EA 1VQMA 4ALPA 1I3QH 3F1ZA 1X3EA 2RHSB 4BXXH 1SFOH 2Q2HA 3EIVA 1M1KC 2BH8A 1Y1VH 4B3ML 3GDEA 1SROA 4X64L 2Q2TA 1X6OA 1VQPA 4IOAA 2PI2E 4A3CH 1JJGA 1RIPA 2CQOA 1MJCA 4QQBX 1PH4A 4A4IA 1IYJB 1UE5A 2HIVA 2JA6H 4A3GG 1V43A 4IOCA 2ZTDA 2MNAA 2CWPA 2ES2A 3F2CA 4UPAA 2I5LX 2NZOA 3NEMA 4JBJA 5M5WH 1C9OA 5M3FH 1QUQB 3SGIA 4DV7L 4YY3Q 4JI0L 4A3IH 3K0XA 5GAEC 2MQHA 2GN5A 2YV5A 4LF7Q 1N36Q 3CC4A 2K5HA 2BH2A 1X65A 5FLMG 1QUQA 2QGQA 2VQEL 2R7FA 5GROA 4JI4L 2WAQG 3UDFA 4DUZQ 1KIXA 1S40A 1FJGL 3BZCA 4AYBG 3HFZB 3CPWA 3GTPH 4JI2Q 2ZM6L 4DR4L 4L5SA 4DR6Q 5M3MH 3GTQH 4B3TQ 4BY7H 2ASBA 1XPOA 1GO3E 2UXCL 1EQRA 5EAYA 2F52A 4DUYL 2UXDL 1L1OA 4DR3Q 4OONA 4A3BG 1S3OA 2ZJQA 5GAGC 1HNZL 1FL0A 2UUBQ 4OO1G 2R93H 3GO5A 2YTXA 2JA6G 1HNWQ 2Y0SE 1Q86C 4GKJQ 3TQYA 2YU9H 2WFWA 2KBNA 1HNXL 1JMCA 3F8TA 4DV4Q 4KHZA 4PZ6A 1OXXK 4DAYB 5M5YH 1QZHA 3HOXG 4DV3Q 1YBYA 1ASYA 2EXDA 2WP8J 1L2FA 1EIYB 4JI6L 2VY3A 3HKSA 1AE3A 4JI5L 4DK6C 3H3VH 3FKIH 5DLQE 5FLXc 3F2BA 3PUXA 4GN5A 1NJIC 1Q46A 2GVAA 4KLKA 5IP9H 1I94L 1E1TA 5C3EH 4JOIC 5ELNA 1KHIA 4B3RQ 2D62A 2IHFA 3LGJA 3GTKH 1W2BA 1IZ6A 1YHBA 3G6EA 2C35B 4DV1L 4GNXC 1KXLA 1XNRL 4YCWA 4A3BH 4L5QA 2OQKA 4PG3A 2CCZA 1CSPA 3D0FA 1YNXA 3PO2H 1HZAA 1XPRA 1C7YA 4DV5Q 3Q8DA 4PMWA 4NXNQ 4JV5Q 4FDBA 1ASZA 2K75A 1HNWL 1VQJA 3KDFB 2NN6G 3PSIA 1YHQA 1Q81C 1Q8KA 1VQ6A 4JBMA 3HOYG 3UDXA 3KJPA 4GNXA 1V9PA 1IBLL 4DKAC 3J81i 2VW9A 3VDYA 2HHHQ 3S2HH 4OWTB 1X3FA 4X6AH 2JA9A 4LF5Q 4DPGA 1VQ9A 3M4OH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  3T1Y L;  3S2D H;  4IFD I;  3HOV G;  3FKI G;  3U50 C;  4DR1 L;  1R9T H;  3GTO H;  3HOU H;  3I55 A;  4A3K G;  4WJ3 M;  1NBW A;  1J5E L;  4L5R C;  2JA8 G;  1TWG H;  4ME3 A;  1VQL A;  3OTO Q;  3I4O A;  1GKH A;  2E5L L;  4GN3 B;  1Q12 A;  1GVP A;  4BBR H;  2R6G A;  3PUZ A;  3TRZ A;  4JI3 Q;  3PO2 G;  5LMN L;  4TQU S;  3H0G H;  3NBH B;  1TWA H;  1WOC A;  1UWV A;  3CCU A;  3HOY H;  2R7D A;  4B3T L;  1KL9 A;  1IBM Q;  3UE1 A;  1X54 A;  4KHP Q;  4IFD J;  4GLX A;  1MKH A;  3K81 C;  3HKZ G;  4P73 A;  5LMU L;  1Q1B A;  2MO0 A;  3S17 H;  4A3L H;  3RN5 A;  2IX1 A;  3ER0 A;  5FJ8 H;  1VQ8 A;  1YZ6 A;  2AWO A;  2E8G A;  1X56 A;  3AYH B;  2Q2U A;  2UU9 Q;  5IYB G;  3E9H A;  1AE2 A;  5IP7 G;  1PH6 A;  3HOV H;  3CC2 A;  4GLV B;  4Y7N H;  1P8L A;  3HOU G;  4LF8 L;  1WI5 A;  4GKK Q;  2KCM A;  4HIM A;  2R7Z G;  1EIF A;  1KD1 C;  4A3D G;  4JCV E;  2BA0 A;  3CCM A;  1NMG A;  4DV6 Q;  4DR5 Q;  3KJO A;  2WB1 E;  1IL2 A;  1N32 Q;  1SR3 A;  4UP8 A;  4A3F G;  1VQA A;  1XMO L;  2DGY A;  1A62 A;  3K7U C;  4P72 A;  4YWM A;  2E2I H;  3H0G G;  1CUK A;  5J3B A;  4K0K Q;  2MFI A;  3U58 A;  4A3J H;  3PF4 A;  4IO9 A;  2PMZ E;  4GOP A;  3W5O A;  4AYB E;  3T1H Q;  2RF4 A;  1XMQ Q;  1QZG A;  2V1C C;  3GTM H;  2ID0 A;  3PIO A;  3CCJ A;  4BY1 G;  3J7Z C;  1K3R A;  1PH3 A;  4LFA L;  1SE8 A;  2OQ0 A;  2JA7 G;  3I4M G;  5FJ8 G;  2NVQ H;  2UUC L;  2PQA B;  1VQE A;  2QEX A;  3PUY A;  2B29 A;  3KYH C;  3GTJ H;  3E0E A;  2VUM G;  4DR7 Q;  3KOJ A;  4R4I A;  3ULL A;  3CQZ H;  4H02 A;  1K73 C;  4B3S L;  4HIK A;  2R92 G;  3CAM A;  1PVO A;  2YYZ A;  4JI0 Q;  4JYA Q;  5AJ3 Q;  1CSQ A;  5GAH C;  1K83 H;  3RR5 A;  1E24 A;  1Y1V G;  1YVC A;  1UE7 A;  2VS1 A;  2UXB Q;  1VQ5 A;  3RNU A;  4LFB L;  2B3G A;  1WCM G;  2XTI A;  3PUW A;  2K52 A;  1EFW A;  1FJG Q;  4A3G H;  3AQQ A;  1VQG A;  2K5N A;  4XTC S;  4BY1 H;  1XNQ Q;  3RZO H;  3MEF A;  4X65 L;  4A93 G;  4DV2 L;  5LMN Q;  4GNX B;  4P71 A;  2IT1 A;  5M3F G;  1PH5 A;  4LF4 L;  1N33 Q;  3IRB A;  2CWA A;  4JOI A;  2VQE Q;  3CCR A;  1TWH H;  4NPS A;  5GAD C;  2N3S A;  3RLN A;  3ZJY C;  4R1J A;  1YIT A;  3PO3 G;  4HID A;  5K36 G;  4GKJ L;  3WWV A;  1CKO A;  1XJV A;  1CKM A;  4GLA C;  4RG1 A;  3S1M H;  1VQN A;  2XGT A;  1PA6 A;  4O2D A;  3M4P A;  2LSS A;  2AHO B;  2UXD Q;  2JQO A;  4DK3 C;  1E7Z A;  1LTL A;  2LXK A;  2IX0 A;  2UU9 L;  1KRS A;  5M3M G;  2RCN A;  1IBK L;  3JAM c;  3A5Z B;  4MZ9 A;  3CF5 A;  1PV4 A;  4BY7 G;  5GQO A;  1G51 A;  1LM0 A;  1OXU A;  4OX9 L;  2HT1 A;  1WCM H;  4LFC Q;  1T9H A;  5IT9 c;  3CCL A;  1PH8 A;  3NEN A;  4DV6 L;  4B3R L;  1KQS A;  1TXY A;  1YEZ A;  2R93 G;  2IY5 B;  1EOV A;  3PUV A;  2YTV A;  3EN2 A;  1HH2 P;  1VQK A;  1N34 L;  5C0X J;  3TS0 A;  1D8L A;  2RHQ B;  3KF6 A;  1HJP A;  1VQC A;  4MNO A;  3STB C;  1G29 1;  4X64 Q;  2OCE A;  1B70 B;  2KEN A;  4YHH Q;  4YCV A;  3HOX H;  4JV5 L;  2KHJ A;  5JJL A;  1E1O A;  3KF8 B;  3AFP A;  1I94 Q;  4JI7 Q;  4UY8 C;  3PO3 H;  1K9M C;  3HOW G;  1AH9 A;  4LF9 Q;  4QGU A;  3PCO B;  4KI0 A;  3D31 A;  3E9I A;  1MIU A;  2FXQ A;  4AIM A;  2OTL A;  2N78 A;  1HR0 Q;  3S1Q H;  4B3M Q;  5C3E G;  4HJA A;  3FP9 A;  1A63 A;  5IWA L;  4HJ9 A;  2JK8 A;  2BA1 A;  4NXN L;  4DV5 L;  1PYB A;  4GN4 B;  1CKN A;  4LNQ A;  4EX5 A;  3I56 A;  3CXC A;  3CMA A;  4JI4 Q;  1L0W A;  1BKB A;  4GOP C;  4X66 L;  3PIP A;  3K80 C;  4BA1 I;  1OXT A;  4YCU A;  4P75 A;  1EQQ A;  3G71 A;  3FHW A;  4JI1 L;  1JJ2 A;  4JI2 L;  3S14 H;  3OTO L;  1GM5 A;  4NXM Q;  1J6Q A;  3J81 c;  5BR8 L;  2D0P A;  1FVI A;  4LF5 L;  3ULJ A;  4APV A;  1RL2 A;  3M85 A;  3CME A;  3RN2 A;  1N36 L;  2VQF L;  4DR2 L;  4RMF A;  4BBS G;  2A1A A;  3JAM i;  2VNU D;  3HOW H;  2KHI A;  3I4N H;  4MTN A;  3DLL A;  1PH7 A;  2JA5 H;  4DR4 Q;  2ZM6 Q;  3G48 A;  2Z6K C;  4DV2 Q;  5LMU Q;  2N49 A;  1D7Q A;  1VQ4 A;  1WJJ A;  4LF4 Q;  1FGU A;  4XIG S;  1N33 L;  1WYD A;  2I5H A;  1UE6 A;  4PZ8 A;  3W1G A;  4DV0 Q;  3S15 H;  1C0A A;  4UP7 A;  1QVG A;  4A3E G;  5ELO A;  3TRE A;  3RLF A;  2UUB L;  3PV0 A;  1QVF A;  4JBK A;  4C3H H;  2K50 A;  1TWF H;  3A5U A;  4BBR G;  3M4Q A;  5IYC G;  2Z6K A;  4BXX G;  2KCT A;  2EIF A;  2D0O A;  3UE0 A;  3CCQ A;  1OXS C;  1PFS A;  3DM3 A;  3M9B A;  4HJ5 A;  4A3C G;  4YWL A;  2B63 H;  2AKW B;  4POG A;  1W3S A;  2UUA Q;  2WAQ E;  1PH2 A;  1X9N A;  2LXJ A;  1A8V A;  2NN6 I;  3OYY A;  4BBS H;  2YTY A;  2ZTC A;  2F4V Q;  5IYD G;  1PH1 A;  4IPD A;  4JI8 L;  5IYB H;  5IP7 H;  2E2H H;  1YJW A;  3RLO A;  3K8A A;  3S24 A;  4AQY Q;  1N34 Q;  1OTC A;  3OW2 A;  3UDI A;  1NE3 A;  4LFA Q;  4LWC A;  2ATW A;  4LUO A;  2N8N A;  1K8A C;  4A3D H;  1XMO Q;  4IFD G;  3A74 A;  4LF6 L;  5FLM H;  1H95 A;  2Y0S G;  1HZC A;  1P16 A;  3TEH B;  1VQF A;  4DV7 Q;  4A3E H;  1XTD A;  4DNI A;  2K5V A;  4A3F H;  1Q7Y C;  1JB7 A;  3CCE A;  1UE1 A;  4HJ7 A;  1CKN B;  1VQD A;  1LYL A;  1GD7 A;  3HKZ E;  4P74 A;  5IYC H;  1HZB A;  5C44 H;  3STB D;  4B3S Q;  1N8R C;  1U0L A;  1J5E Q;  1KAW A;  1I50 H;  4DUZ L;  2CFM A;  4JYA L;  5JJI A;  5IWA Q;  1YIJ A;  1IBL Q;  3HOZ H;  4DR6 L;  2JJQ A;  2JEA I;  1EYG A;  2B63 G;  1Y1W H;  4X62 L;  2IHE A;  1I5F A;  4GOP B;  3UDG A;  4YY3 L;  4NB3 A;  4HIO A;  2PI2 A;  2PNH A;  4R4T A;  4GKK L;  2UXB L;  1X55 A;  4DUY Q;  3MXN B;  4LF7 L;  2JEB I;  2NVY H;  1VQI A;  3GD7 A;  2AWN A;  2WB1 G;  4L5T A;  4OWX B;  4JI3 L;  5IY0 A;  2A19 A;  3I2Z A;  5M5X H;  4X66 Q;  5C0X I;  3KFU A;  4JI1 Q;  3GTL H;  1HZ9 A;  4NXM L;  1VCI A;  3KDF A;  4KHP L;  3JC6 6;  3AFQ A;  5C4X G;  1XNQ L;  4A3M G;  1JJC B;  1YHA A;  4X65 Q;  4EQ5 A;  4DV4 L;  2Z0S A;  3CC7 A;  3I7F A;  3M3Y H;  2Q2I A;  4DV3 L;  1VS0 A;  1IXR A;  5JEA J;  1WFQ A;  5IP9 G;  1XPU A;  4BA2 I;  3CD6 A;  3BJU A;  5HGQ A;  1KC8 C;  2ZTE A;  3J80 c;  1MJE A;  1N9W A;  3L7Z C;  5C44 G;  4JI5 Q;  4OWW B;  1QVC A;  3J80 i;  3PGZ A;  4QY7 A;  4UP9 A;  3CCV A;  3ULP A;  3GTG H;  4A76 A;  3HOZ G;  1I6H H;  4DR5 L;  1YI2 A;  3CPF A;  3W1B A;  1BBW A;  1Y1W G;  1N32 L;  3EBE A;  2I0Q A;  3B6Y A;  4PZ7 A;  1S72 A;  4OX9 Q;  3L2P A;  2ZJR A;  4A93 H;  1OXV A;  2I5M X;  1JT8 A;  4JI6 Q;  1BBU A;  4LUV A;  4QIW E;  1Q82 C;  4LF8 Q;  1JE5 A;  3K7A H;  1PHJ A;  3U4Z A;  3S16 H;  3NEL A;  3BZK A;  4A75 A;  3T1H L;  1XMQ L;  5C4X H;  4A3M H;  5E7N A;  2HQL A;  4HJ8 A;  2UUA L;  4Y52 H;  5LMN W;  2L15 A;  4JG2 A;  4OXP A;  1V1Q A;  4DV1 Q;  1SLJ A;  5JEA G;  4IPG A;  4YHH L;  1Z47 A;  1VQO A;  4R4O A;  1SN8 A;  1XNR Q;  4A3K H;  1PYS B;  4YWK A;  4LFC L;  4R4C A;  3A0J A;  4IPC A;  1NTG A;  4AQY L;  3M7N A;  1Z9F A;  4K0K L;  3AEV A;  3T1Y Q;  2JA8 H;  1E22 A;  3ICE A;  1U5K A;  2E2J H;  4GS3 A;  1Y14 B;  2NZH A;  1DGS A;  4TVA B;  1PH9 A;  4LW1 A;  2NVX H;  1B7Y B;  2K14 A;  4J15 A;  4LF6 Q;  1YJ9 A;  1TWC H;  3CCS A;  2HHH L;  4JI7 L;  5IE8 A;  2ZJP A;  4WJ4 A;  4OO1 I;  4LF9 L;  3J81 j;  3KLW A;  4DR7 L;  3J7A 5;  2PQA A;  5HY6 A;  4DR1 Q;  3ERS X;  3RZD H;  4A3L G;  3H15 A;  1HR0 L;  4O0A A;  3PF5 A;  2A8V A;  4X62 Q;  1YJN A;  2GVB A;  3S1R H;  2H5X A;  5AJ3 L;  1SMX A;  1UEB A;  2ALY B;  4IPH A;  3F2D A;  2OTJ A;  5IYD H;  5H1S E;  4QJF A;  2E5L Q;  1O7I A;  2UXC Q;  2AMC B;  1X3G A;  2VL6 A;  4DR3 L;  4LFB Q;  2DUD A;  2VZA A;  3S1N H;  1A0I A;  2R7Z H;  3L0O A;  1HNZ Q;  2NVT H;  1VQH A;  1L1O C;  4C3I H;  1EUJ A;  2JE6 I;  5C4J H;  5BR8 Q;  4C2M H;  1IBM L;  5JJK A;  2EQS A;  3KF6 B;  4JC0 A;  1HR0 W;  4DV0 L;  1EWI A;  1SRU A;  1HNX Q;  3CP0 A;  4R4Q A;  2VQF Q;  4DR2 Q;  1K8G A;  3CW2 C;  4QL5 A;  1NMF A;  4A3J G;  4LUZ A;  3TS2 A;  5C0X G;  3G4S A;  2QA4 A;  1B8A A;  2CKZ B;  1L1O B;  2F3I A;  2K4K A;  4IJL A;  4IJH A;  4AH6 A;  3I4N G;  2JA7 H;  1KRT A;  3I4M H;  4DAM A;  2HIX A;  4POF A;  2JA5 G;  1NY4 A;  4JBW A;  4C3J H;  1BVS A;  2OWO A;  1VQB A;  1IBK Q;  1G6P A;  4A3I G;  2VUM H;  2F4V L;  2UUC Q;  3H3V I;  3BU2 A;  4JI8 Q;  3U4V A;  1LUZ A;  2MO1 A;  1M90 C;  1VQ7 A;  2R92 H;  1K0R A;  1Q1E A;  1VQM A;  4ALP A;  1I3Q H;  3F1Z A;  1X3E A;  2RHS B;  4BXX H;  1SFO H;  2Q2H A;  3EIV A;  1M1K C;  2BH8 A;  1Y1V H;  4B3M L;  3GDE A;  1SRO A;  4X64 L;  2Q2T A;  1X6O A;  1VQP A;  4IOA A;  2PI2 E;  4A3C H;  1JJG A;  1RIP A;  2CQO A;  1MJC A;  4QQB X;  1PH4 A;  4A4I A;  1IYJ B;  1UE5 A;  2HIV A;  2JA6 H;  4A3G G;  1V43 A;  4IOC A;  2ZTD A;  2MNA A;  2CWP A;  2ES2 A;  3F2C A;  4UPA A;  2I5L X;  2NZO A;  3NEM A;  4JBJ A;  5M5W H;  1C9O A;  5M3F H;  1QUQ B;  3SGI A;  4DV7 L;  4YY3 Q;  4JI0 L;  4A3I H;  3K0X A;  5GAE C;  2MQH A;  2GN5 A;  2YV5 A;  4LF7 Q;  1N36 Q;  3CC4 A;  2K5H A;  2BH2 A;  1X65 A;  5FLM G;  1QUQ A;  2QGQ A;  2VQE L;  2R7F A;  5GRO A;  4JI4 L;  2WAQ G;  3UDF A;  4DUZ Q;  1KIX A;  1S40 A;  1FJG L;  3BZC A;  4AYB G;  3HFZ B;  3CPW A;  3GTP H;  4JI2 Q;  2ZM6 L;  4DR4 L;  4L5S A;  4DR6 Q;  5M3M H;  3GTQ H;  4B3T Q;  4BY7 H;  2ASB A;  1XPO A;  1GO3 E;  2UXC L;  1EQR A;  5EAY A;  2F52 A;  4DUY L;  2UXD L;  1L1O A;  4DR3 Q;  4OON A;  4A3B G;  1S3O A;  2ZJQ A;  5GAG C;  1HNZ L;  1FL0 A;  2UUB Q;  4OO1 G;  2R93 H;  3GO5 A;  2YTX A;  2JA6 G;  1HNW Q;  2Y0S E;  1Q86 C;  4GKJ Q;  3TQY A;  2YU9 H;  2WFW A;  2KBN A;  1HNX L;  1JMC A;  3F8T A;  4DV4 Q;  4KHZ A;  4PZ6 A;  1OXX K;  4DAY B;  5M5Y H;  1QZH A;  3HOX G;  4DV3 Q;  1YBY A;  1ASY A;  2EXD A;  2WP8 J;  1L2F A;  1EIY B;  4JI6 L;  2VY3 A;  3HKS A;  1AE3 A;  4JI5 L;  4DK6 C;  3H3V H;  3FKI H;  5DLQ E;  5FLX c;  3F2B A;  3PUX A;  4GN5 A;  1NJI C;  1Q46 A;  2GVA A;  4KLK A;  5IP9 H;  1I94 L;  1E1T A;  5C3E H;  4JOI C;  5ELN A;  1KHI A;  4B3R Q;  2D62 A;  2IHF A;  3LGJ A;  3GTK H;  1W2B A;  1IZ6 A;  1YHB A;  3G6E A;  2C35 B;  4DV1 L;  4GNX C;  1KXL A;  1XNR L;  4YCW A;  4A3B H;  4L5Q A;  2OQK A;  4PG3 A;  2CCZ A;  1CSP A;  3D0F A;  1YNX A;  3PO2 H;  1HZA A;  1XPR A;  1C7Y A;  4DV5 Q;  3Q8D A;  4PMW A;  4NXN Q;  4JV5 Q;  4FDB A;  1ASZ A;  2K75 A;  1HNW L;  1VQJ A;  3KDF B;  2NN6 G;  3PSI A;  1YHQ A;  1Q81 C;  1Q8K A;  1VQ6 A;  4JBM A;  3HOY G;  3UDX A;  3KJP A;  4GNX A;  1V9P A;  1IBL L;  4DKA C;  3J81 i;  2VW9 A;  3VDY A;  2HHH Q;  3S2H H;  4OWT B;  1X3F A;  4X6A H;  2JA9 A;  4LF5 Q;  4DPG A;  1VQ9 A;  3M4O H; 
#chains in the Genus database with same CATH topology
 1E3P A;  1EY0 A;  2RVL A;  4IFD I;  5M3F B;  3GTO H;  3HOU H;  5F2D A;  3I55 A;  1CQV A;  1O7Y A;  1TWG H;  1VQL A;  2PMZ B;  5I2Y A;  2L1B A;  3I4O A;  1WD0 A;  4XT1 B;  2E5L L;  1Q12 A;  3PO2 B;  3GTL B;  3H0G H;  1UWV A;  3HOY H;  5J39 A;  3UE1 A;  2XRQ D;  2JA8 B;  3FRP B;  2K5Q A;  3PMF A;  1DON A;  3S17 H;  2MO0 A;  4A3L H;  1Q90 A;  2G9H D;  3RN5 A;  1MSG A;  2IX1 A;  3ER0 A;  1YZ6 A;  3E9H A;  5IP7 G;  1PH6 A;  1GUS A;  1P8L A;  3HOU G;  4LF8 L;  2Q8I B;  1KD1 C;  2BA0 A;  4C3I G;  2AQ3 B;  2L12 A;  1STE A;  2JN4 A;  3K7U C;  4P72 A;  4HCS A;  3H0G G;  2A5H A;  4K0K Q;  3U58 A;  4A3J H;  3MZ5 A;  1B1Z A;  2GA4 B;  3W5O A;  5D3D A;  2K01 A;  4A3F B;  1QZG A;  3GTM H;  2KVM A;  3PIO A;  1KLG D;  3NSW A;  4BY1 G;  2J0T D;  1SE8 A;  4FF1 A;  2M2L A;  1U9R A;  3PUY A;  2B29 A;  4NMZ A;  5IGF A;  1UNS A;  5K36 H;  3HKZ B;  3E0E A;  4DR7 Q;  2RSN A;  3CQZ H;  1EEI D;  3T51 B;  1V8Q A;  4H13 C;  5IIF A;  3VR6 A;  3CU7 A;  3TP6 A;  1CSQ A;  2X6L A;  1K83 H;  1BQQ T;  1HUN A;  1YVC A;  1UE7 A;  1WCM G;  3V05 A;  2K52 A;  5M3M B;  5I6W A;  4ZK9 B;  1EQT A;  5IGG A;  4BY1 H;  2EYP A;  3MEF A;  4A93 G;  4NP5 A;  2B2U C;  5LMN Q;  2FHT A;  1DM0 B;  2B2Y A;  2KCN A;  4JOI A;  3RLN A;  3PO3 G;  5K36 G;  4HID A;  2JSO A;  1FNW A;  5JPN C;  5C4X B;  3DHQ A;  2C9O A;  5EKK A;  3S1M H;  4K6L A;  2WB1 B;  1ONL A;  2UXD Q;  2JQO A;  4NDX A;  4DK3 C;  1E7Z A;  2F0M A;  4RCN A;  3JAM c;  1H9M A;  2F0V A;  3OW7 A;  1LM0 A;  1I6V C;  1WCM H;  1T9H A;  1PH8 A;  4OO1 H;  1ICW A;  1G6Z A;  3BVG A;  3PUV A;  3A8I E;  3MHB A;  3N6R A;  1SBB B;  1D8L A;  1QG7 A;  1SYF A;  5ELB A;  3TS0 A;  3GTP B;  2EYL A;  3H6M A;  1PZI D;  2OCE A;  2VUM B;  4OHJ A;  1B70 B;  2KHJ A;  3PO3 H;  4P2C B;  1F9Q A;  4QGU A;  4KI0 A;  3D31 A;  5KYL A;  4DN4 M;  4ZYS A;  3C46 A;  1QIL A;  2N78 A;  1HR0 Q;  3MFY A;  2IX3 A;  2BA1 A;  4HTH A;  4NXN L;  1TWC B;  2JA6 B;  5E4W C;  4EX5 A;  2F0J A;  1Y8O B;  3I56 A;  4JI4 Q;  4ZUJ A;  3PIP A;  1OXT A;  4YCU A;  1KAB A;  4P75 A;  4JI1 L;  4NXM Q;  1J6Q A;  4XXE A;  1DOK A;  5BR8 L;  1FVI A;  4BY1 B;  2K5W A;  2JXM B;  3IFT A;  4DR2 L;  1ENC A;  1TY2 A;  2EXZ A;  3PQI A;  3G48 A;  2Z6K C;  4DV2 Q;  1FGU A;  4XIG S;  3W1G A;  1TY0 A;  4UP7 A;  2XSC A;  2UUB L;  4C3H H;  2K50 A;  4TSS A;  1B50 A;  2SEB D;  1D6E C;  3R93 A;  3M4Q A;  1G91 A;  3L9A X;  3ERO A;  2B39 A;  1I6H B;  2EIF A;  2D0O A;  1SYE A;  3VR3 A;  4FF2 A;  4A3C G;  4YWL A;  3P20 A;  1STG A;  4RKL A;  4DNR B;  2UUA Q;  2WAQ E;  1PH2 A;  1A6X A;  3X3M A;  1FR3 A;  2ZXR A;  3C1E A;  3OYY A;  2ZTC A;  2LS0 1;  1G8Z D;  1RJT A;  4JI8 L;  5IYB H;  2E2H H;  1YJW A;  4IUT A;  4AQY Q;  3K5O A;  2RBM A;  3H0G B;  3KK7 A;  2A6E C;  4LUO A;  1STY A;  4LK1 C;  3A74 A;  1CFM A;  4K5X A;  4DNI A;  1JB7 A;  1K28 A;  1Q7Y C;  5BN4 A;  3CCE A;  3ITP A;  1K8M A;  3VA7 A;  1CKN B;  1MD2 D;  1GD7 A;  3STB D;  1U0L A;  1AW7 A;  1LTS D;  2NVQ B;  1KAW A;  1I50 H;  2CFM A;  2L4N A;  4OIK A;  4FP5 D;  5IWA Q;  1IBL Q;  5JJI A;  2JJQ A;  5NUC A;  5M5W B;  1YNJ D;  4YY3 L;  2PNH A;  5KYI A;  1VQ9 A;  4OWX B;  3M4Y A;  4X66 Q;  3I2Z A;  2MHV A;  3GTL H;  5CV5 A;  1HZ9 A;  4ULL A;  4KHP L;  2A6H C;  4QF4 A;  1GUG A;  1T5X D;  5DAU A;  5JEA H;  4DV3 L;  5IP9 G;  1I4G A;  3CD6 A;  5HGQ A;  1MJE A;  1N9W A;  3DEP A;  3L7Z C;  2B63 B;  1DCZ A;  3K5M A;  4KKS A;  3J80 i;  5CMD A;  3DEO A;  4WOR A;  3GTG H;  2JA5 B;  1I6H H;  1YI2 A;  3UI2 A;  1N32 L;  1ENA A;  1BXT A;  3EBE A;  4U68 A;  1ILP A;  3NXW A;  2I5M X;  2Y0S B;  4ILW A;  3S16 H;  3NEL A;  1TKW B;  1STA A;  5IGB A;  3T1H L;  5T1G A;  1EU3 A;  5C44 B;  3X3N A;  4DV1 Q;  5JEA G;  1SN8 A;  1PYS B;  4YWK A;  4IPC A;  1NTG A;  3M7N A;  1U4R A;  3MWY W;  2JA8 H;  3AEV A;  2RSO A;  1E22 A;  1U5K A;  5K5P A;  2F0D A;  2IPK D;  1Y14 B;  5ISR A;  2E2J H;  1DGS A;  4TVA B;  4LF6 Q;  3SXH A;  3CCS A;  4WJ4 A;  4LF9 L;  3J81 j;  2KCC A;  1BCP B;  2RDF A;  2PQA A;  4DR1 Q;  3ERS X;  3RZD H;  2A8V A;  5AJ3 L;  3U9S A;  3F2D A;  2OTJ A;  4QJF A;  5EPK A;  5JAV A;  1HFN A;  1EU4 A;  2UXC Q;  4A3K B;  4PQX A;  1HNZ Q;  4HSV A;  1L1O C;  5C4J H;  3DWQ A;  3WOF A;  1IBM L;  2L5T A;  4JC0 A;  3MXP A;  4R8I A;  2K6A A;  4RKB A;  1DOM A;  3PIP 3;  1K8G A;  3CW2 C;  2J4X A;  1K3B C;  5C0X G;  1B8A A;  1L1O B;  3AB9 A;  2K4K A;  2JA7 H;  4RGT A;  5CR3 A;  4POF A;  1NY4 A;  1EZ8 A;  4C3J H;  1VQB A;  4CJ2 C;  1OO9 B;  4KY5 A;  3OWE B;  4O1N A;  3VR2 A;  2VUM H;  2EYH A;  3LNN A;  3BU2 A;  4JI8 Q;  3U4V A;  2UUC Q;  3H3V I;  1EYC A;  2MO1 A;  1M90 C;  3I72 A;  3HOY B;  2X6G A;  5C5M A;  1Q1E A;  3O13 A;  1I3Q H;  3F1Z A;  2NYZ D;  4B3M L;  4X64 L;  1BR9 A;  1ZKO A;  3M4O B;  1VQP A;  4IOA A;  2D5D A;  1RIP A;  2CQO A;  2IW3 A;  4HAE A;  3ND8 A;  3T56 B;  2FFK B;  2NBF A;  4IOC A;  2MNA A;  2ES2 A;  4CJ0 B;  2PPB C;  5M5W H;  3SGI A;  4YY3 Q;  2MQH A;  4IUQ A;  4XDX A;  1X65 A;  1QUQ A;  2G9D A;  2R7F A;  2WAQ G;  4DUZ Q;  1KIX A;  3CPW A;  4JI2 Q;  1SJH D;  3GTM B;  1MBY A;  2XVS A;  4BS9 A;  4J8Q A;  3GTQ H;  4BY7 H;  3I70 A;  2L11 A;  4DUY L;  3SHL A;  1DD2 A;  1S3O A;  2ZJQ A;  1FL0 A;  3GO5 A;  2YTX A;  2V4D A;  1ILQ A;  2F0H A;  2K1B A;  4DAY B;  1QZH A;  5M5Y H;  1IYV A;  1R4P B;  2EXD A;  3QJY A;  1KNA A;  2F0K A;  1AE3 A;  3H3V H;  2CHB D;  5DLQ E;  1NJI C;  4KLK A;  4OGQ C;  2D2C C;  2F0O A;  4DAV A;  1BDO A;  1BUV T;  5ELN A;  3SVM A;  4IAL A;  1TWA B;  1VF5 C;  1IZ6 A;  5EQ0 A;  1HTP A;  2C35 B;  4NW2 A;  4DV1 L;  3IAY A;  1PXU A;  4KJO A;  3S14 B;  2CCZ A;  2A74 C;  2XN9 C;  4JV5 Q;  4FDB A;  4BY7 B;  1YHQ A;  2NN6 G;  2LY7 A;  3MFG A;  4BWG B;  1ROD A;  4GNX A;  2QEJ C;  3NWT A;  3D6C A;  1U4P A;  1I50 B;  2VW9 A;  1QJO A;  3VYS A;  2DY8 A;  1HHV A;  2KQ3 A;  3S2D H;  2EPB A;  4DR1 L;  2NVY B;  1IYU A;  2RKS A;  1LO5 D;  2TMP A;  4L5R C;  5C3E B;  3VYT A;  1Z6H A;  2PYK A;  1GKH A;  2ZXP A;  4GN3 B;  4KN4 C;  1S5E D;  4K14 A;  1D1K A;  5LMN L;  4TQU S;  4JI3 Q;  3NBH B;  1TWA H;  3Q24 A;  3CCU A;  2NN6 H;  5ELC A;  1IBM Q;  3J7A V;  3Q23 A;  4FVM A;  1RTO A;  5LMU L;  1JWU D;  3OSO A;  5FJ8 H;  1VQ8 A;  2E8G A;  1X56 A;  4CDF C;  5FO9 B;  4FF3 A;  3HRZ C;  1JIC A;  4CJ1 B;  1IL8 A;  4HIM A;  1NSN S;  3ERQ A;  4KD4 A;  4A3D G;  3NBH A;  2NVT B;  1O78 A;  3KJO A;  4A3F G;  1B3A A;  3HOZ B;  2Z9H A;  1XMO L;  3NHH A;  4YWM A;  1HPC A;  4Y7N B;  3M7G A;  5CV8 A;  3PF4 A;  4GOP A;  4AYB E;  1PH3 A;  2EVB A;  3S1M B;  3I4M G;  5FJ8 G;  1VQE A;  2K03 A;  2WII B;  5IT9 L;  1BCP D;  1JE4 A;  1K73 C;  4H02 A;  1PVO A;  1SNO A;  4B08 A;  2R93 B;  5GAH C;  3RR5 A;  5M9O A;  2VS1 A;  3RNU A;  3FPU B;  4A3G H;  3AQQ A;  5IOD A;  2K5N A;  4XTC S;  1CQF A;  1EYA A;  1IHZ A;  1LT5 D;  3I4L A;  4DV2 L;  4A3E B;  4UAI A;  1PH5 A;  2VQE Q;  4NPS A;  5GAD C;  2N3S A;  1YIT A;  3HOV B;  1XJV A;  3J80 E;  4JPB W;  1EOT A;  2F0F A;  3M4P A;  5CV4 A;  2AHO B;  4ODG A;  3KLR A;  1T5E A;  2UU9 L;  5M3M G;  1IBK L;  1ET6 A;  5GQO A;  3A7A B;  1G51 A;  3K59 A;  3KBG A;  5IT9 c;  4O42 A;  4DV6 L;  1YEZ A;  1G2T A;  3KF6 A;  1HJP A;  3H3V C;  1STN A;  3M3Y B;  1G29 1;  2KEN A;  3HOX H;  4YCV A;  4JV5 L;  2KJX A;  5JJL A;  1CT1 D;  4V0B A;  1E1O A;  3AFP A;  1I94 Q;  4JI7 Q;  4UY8 C;  1FD7 D;  4K8J A;  1F2Y A;  3FEW X;  3PCO B;  3E9I A;  3S2H B;  5C3E G;  5CBA E;  1A63 A;  5IWA L;  5D3I B;  4ID6 A;  2JK8 A;  3LX0 A;  4DV5 L;  1PYB A;  4FXK C;  4GN4 B;  4DK1 A;  1QWY A;  4PMB A;  3CXC A;  2HUG A;  4GOP C;  4X66 L;  1O7Z A;  1F2M A;  5I6Y A;  3G71 A;  4KN7 C;  3J81 c;  1STB A;  2D0P A;  5C3X A;  3HG9 A;  2HDL A;  1RL2 A;  3CME A;  4E6I A;  4RFB A;  2A1A A;  5EBC A;  2VNU D;  3I4N H;  2JA5 H;  2ZM6 Q;  3T53 B;  4C56 C;  4QUF A;  5LMU Q;  1F77 A;  4XQN A;  1WYD A;  4PZ8 A;  4RGO S;  1SNC A;  1RTN A;  4A3E G;  1FGB D;  1EY5 A;  1UEA B;  3TRE A;  4K5W A;  3A5U A;  4BBR G;  3C2P A;  4BXX G;  2Z6K A;  1B2T A;  1EWC A;  3CCQ A;  3A55 A;  1RCV D;  1PFS A;  3M9B A;  4HJ5 A;  1W3S A;  1WTR A;  2QDB A;  3U9O A;  3SK6 A;  1X9N A;  2EYJ A;  3D4W A;  5LHY 1;  4DK0 A;  1PH1 A;  1IKM A;  1V1O A;  1MI2 A;  2O5I C;  3RLO A;  1N34 Q;  1PZK D;  2F0E A;  3P75 A;  3R3O A;  1DYQ A;  4LWC A;  2MUY A;  2N8N A;  2VB2 X;  1LT4 D;  4LF6 L;  5FLM H;  4A3E H;  4DV7 Q;  3BG3 A;  3BVM A;  3CQZ B;  3TN2 A;  1SMY C;  4KKU A;  1EY8 A;  2QF7 A;  3GP7 A;  1EFI D;  2ICE C;  2K28 A;  5C4Z A;  1HQM C;  1YIJ A;  4DR6 L;  1Y1W H;  1Q8I A;  2PI2 A;  4R4T A;  4GKK L;  1X55 A;  3N52 A;  2JEB I;  4L5T A;  5IY0 A;  4F8M A;  3C3L A;  1KAA A;  4CKE A;  3FDT A;  5C4X G;  4A3M G;  1JJC B;  1YHA A;  4DV4 L;  1AZP A;  3M3Y H;  2ENB A;  2KUM A;  2Q2I A;  3S17 B;  1WFQ A;  1KC8 C;  4HMI A;  3VYU A;  4OWW B;  2BE5 C;  4I7A A;  3CCV A;  2Z4I A;  3ULP A;  4A76 A;  3CPF A;  1Y1W G;  3OOC A;  3QOJ A;  3L2P A;  2CW0 D;  4OIJ A;  1JT8 A;  1BBU A;  4LUV A;  3TSS A;  1JCK B;  3K7A H;  1PHJ A;  5FLX E;  5LL6 S;  3BZK A;  1WTW A;  5C4X H;  4A3M H;  4HJ8 A;  2SNM A;  4Y52 H;  5LMN W;  3D3R A;  2SDF A;  1SLJ A;  1F9S A;  3DMU A;  1UAP A;  1BNZ A;  4OL7 A;  3A0J A;  4K2L A;  3T1Y Q;  1ENF A;  4PMC A;  2NZH A;  2K14 A;  3K5L A;  1YJ9 A;  4KKT A;  1TWC H;  4JVZ A;  2HHH L;  3S16 B;  2XNA C;  4FXG C;  3OPO A;  4OO1 I;  3KLW A;  5ELF A;  2CH4 W;  4A3L G;  4N9T A;  1HR0 L;  3OIQ A;  3PF5 A;  4X62 Q;  1YJN A;  4MN3 A;  3I91 A;  1EL0 A;  1UEB A;  5H1S E;  3D4R A;  4LFB Q;  2DUD A;  3QB3 A;  1GUN A;  3L0O A;  2NTS A;  2DN8 A;  1VQH A;  2F0N A;  4C3I H;  2JE6 I;  5BR8 Q;  1LT3 D;  2F0G A;  1HR0 W;  1U4L A;  1SRU A;  2SOB A;  3JAM E;  4DR2 Q;  1TWH B;  2F0L A;  4QL5 A;  4A3J G;  4LUZ A;  1WTP A;  2A69 D;  1D5M C;  4IJL A;  2PNR C;  1S5B D;  4AH6 A;  1JOR A;  1EYD A;  4JBW A;  2OWO A;  1G6P A;  4XYQ A;  2WIN B;  2J7Z A;  3S9W A;  1VQM A;  1QOH A;  4C1N I;  5D65 A;  1VF7 A;  2E74 C;  2BH8 A;  3CRK C;  1X6O A;  1GXD C;  1TQO A;  5EGT A;  1MJC A;  2WV6 D;  1IYJ B;  2JA6 H;  1ET9 A;  4HMJ A;  1TWG B;  3F2U A;  1GJX A;  3GTJ B;  3S1Q B;  2NZO A;  1R9T B;  2XIW A;  4JI0 L;  5DEH A;  3A8J E;  5GAE C;  1KDB A;  5CBE E;  1DZ1 A;  1CM9 A;  1S40 A;  2Q8R E;  1AZQ A;  3LWU A;  2ASB A;  1Y1V B;  1GO3 E;  2PZW A;  4DR3 Q;  1IW7 C;  1JB3 A;  2UUB Q;  1XX8 A;  4OO1 G;  2JA6 G;  1Q86 C;  3C1F A;  3TQY A;  5BN3 A;  1PLF A;  1HNX L;  3F8T A;  4DAY A;  4ZRZ A;  2FMC A;  4DV3 Q;  4NKL A;  1L2F A;  4EQO A;  2VY3 A;  2WKD A;  3HKS A;  5EPL A;  3AU7 A;  3PUX A;  2GVA A;  1ML0 D;  3EA6 A;  5E3F A;  3OWF A;  2D9U A;  2P5Z X;  3DWP A;  3MXG A;  2PZT A;  2KEC A;  2JYO A;  3P7J A;  3GTG B;  1KXL A;  4GNX C;  4YCW A;  2OQK A;  3EVQ A;  1ZYR C;  5EKL A;  3NQI A;  4KY7 A;  3Q8D A;  3PSI A;  4DNT B;  1VQ6 A;  1SMY D;  3G6J B;  1LAB A;  1FYC A;  4HR7 B;  1H9R A;  1GHJ A;  2F0W A;  1V9P A;  1IBL L;  3J81 i;  1XWE A;  2F3V A;  3VDY A;  2HHH Q;  2MGS A;  4OWT B;  4QCL A;  4LF5 Q;  4DPG A;  3MEH A;  2B8F A;  2JP1 A;  2K5D A;  5E1F A;  3BS1 A;  2I07 B;  3HOV G;  1X3Q A;  2NVX B;  1R9T H;  3HP3 A;  4A3K G;  1NBW A;  1J5E L;  1SE3 A;  4ZKB B;  1AN8 A;  5JOB A;  2R6G A;  4WFN 3;  5HUR A;  1W6J A;  1SNQ A;  1WOC A;  2JA7 B;  2MPM A;  1KL9 A;  3NTK A;  1X54 A;  4IFD J;  2VXW A;  1LTG D;  4EQN A;  2OF1 A;  2AWO A;  3AYH B;  2UU9 Q;  5IYB G;  3QO2 A;  2TSS A;  1V1P B;  3HOV H;  3CC2 A;  3SEB A;  3J81 L;  5M5Y B;  4XYO A;  4KK7 A;  2R7Z G;  4JCV E;  2HD3 A;  3MTS A;  1NMG A;  1ZXT A;  1QCB D;  1PRT F;  4DV6 Q;  4DR5 Q;  1WD1 A;  2WB1 E;  2F0P A;  1IL2 A;  2NUC A;  3W2D A;  2EY6 A;  1PFN A;  2IWH A;  2DGY A;  2E2I H;  1CUK A;  5C4J B;  2A73 B;  5J3B A;  1DXM A;  2MFI A;  5HGT A;  4IO9 A;  2PMZ E;  1MGS A;  2PW7 A;  3SE0 A;  3TME A;  1XMQ Q;  2V1C C;  2ID0 A;  4J1M A;  4CDE C;  4I65 A;  3Q6S A;  4H7B A;  2NVQ H;  2UUC L;  2PQA B;  2EYF A;  3HEJ A;  1AFP A;  1EIG A;  3KYH C;  4IZ8 A;  3GTJ H;  4QMG A;  4CKB A;  3KOJ A;  3ULL A;  2YU9 B;  2R92 G;  4ZQ3 A;  4JI0 Q;  4JYA Q;  2MJ8 A;  5AJ3 Q;  1NR4 A;  3VR4 A;  3SDZ A;  1EQV A;  2KA7 A;  1KLU D;  4RAU C;  3V2T A;  1Y1V G;  3E5S A;  2MP1 A;  2UXB Q;  2VB3 X;  1WCM B;  2B3G A;  3QIA A;  1EFW A;  3GTQ B;  1TR5 A;  4G7O C;  2H1E A;  2RQX A;  5D14 A;  1SYB A;  1XNQ Q;  3RZO H;  4X65 L;  1B3Q A;  4GNX B;  3K57 A;  1SNM A;  4P71 A;  2IT1 A;  1S5D D;  5M3F G;  2CWA A;  1L0Y B;  3CCR A;  1TWH H;  3ZJY C;  4R1J A;  1CA6 A;  1HA5 A;  1CKM A;  1II3 A;  4GLA C;  4RG1 A;  3A54 A;  2XGT A;  1PA6 A;  1E2Z A;  3OHX C;  4O2D A;  4TKO B;  1V1P A;  3ONA B;  2LXK A;  1HRJ A;  3BDC A;  5JPM C;  5LL6 X;  3A5Z B;  1PV4 A;  3CF5 A;  4XQQ A;  4JK1 C;  1OXU A;  4CDC C;  1ICF B;  4FXD A;  2HT1 A;  3BYY B;  4LFC Q;  2R93 G;  3NEN A;  4CKC A;  5KGU A;  2IY5 B;  1EOV A;  3EN2 A;  1QNK A;  1VQK A;  1N34 L;  5C0X J;  2RHQ B;  1VQC A;  4MNO A;  5KNB A;  4X64 Q;  1XYI A;  1NAP A;  5E4X A;  4UDU C;  1A3V A;  3D4D A;  1H9S B;  3KF8 B;  3L3O C;  3HOW B;  1K9M C;  2AUK A;  1TS4 A;  1AH9 A;  3SK8 A;  1CTM A;  5IGD A;  1SYG A;  1MIU A;  3KUP A;  4AIM A;  2OTL A;  3S1N B;  3S1Q H;  2QDL A;  2OEO A;  3FP9 A;  4K5V A;  2BCO A;  4HJ9 A;  2N55 A;  5CGK A;  1CKN A;  1JQY D;  2EJF C;  1Z7T A;  2XRS D;  1JOQ A;  1L0W A;  4OEM B;  1PTO C;  5G3L D;  1JJ2 A;  3S14 H;  4JI2 L;  3FHW A;  1I4H A;  1A3T A;  2PO4 A;  3ULJ A;  4APV A;  2NB0 A;  3TP8 A;  1N36 L;  4F88 A;  2VQF L;  3IFD A;  4RMF A;  3ZYY X;  5EBD A;  1I4X A;  4MTN A;  1PH7 A;  1CZW A;  5C4H A;  2XWJ B;  4DR4 Q;  4WRD A;  4X3T A;  3OIP A;  1D7Q A;  1VQ4 A;  1WJJ A;  4LF4 Q;  1N33 L;  4G57 A;  5CV7 A;  2O2L D;  4DV0 Q;  2I5H A;  3GV6 A;  3S15 H;  1H9S A;  1MSH A;  1QVG A;  1CHQ D;  5ELO A;  1R4Q B;  2DJF C;  3PV0 A;  4PV1 C;  1SE2 A;  5CYU A;  1TWF H;  4MTK A;  2B2V A;  2E2H B;  3D6W A;  1SFO B;  1LAC A;  3UE0 A;  1OXS C;  2HDM A;  2B2W A;  2B63 H;  2AKW B;  5EJW A;  2FJ2 A;  4HN7 A;  4RGM A;  3FKI B;  1X32 A;  2LXJ A;  1A8V A;  2NN6 I;  2KHS A;  4IUV A;  2F4V Q;  3T16 A;  5IYD G;  4IPD A;  2LFN A;  5IP7 H;  3K8A A;  1OTC A;  2R61 A;  3A7L A;  3OW2 A;  1EY4 A;  3UDI A;  1K8A C;  2LMC B;  1XMO Q;  3HGB A;  1ESF A;  2Y0S G;  1HZC A;  1P16 A;  2IL8 A;  2RDG A;  4RWS C;  3TEH B;  1XTD A;  3J80 L;  2K5V A;  1JC7 A;  1LV9 A;  1UE1 A;  4HJ7 A;  1VQD A;  4KD3 A;  5C44 H;  3HKZ E;  1PYW D;  3PIO 3;  1N8R C;  1VMC A;  1A15 A;  3J7A F;  4JYA L;  2B2V C;  3HOZ H;  1A2T A;  2JEA I;  2B63 G;  5TSS A;  4X62 L;  1WTX A;  1I5F A;  3UDG A;  4NB3 A;  4HIO A;  4RHS A;  2OT2 A;  5FKA C;  2UXB L;  4XT3 B;  1Y8N B;  3F2B A;  1VQI A;  4JI3 L;  2WB1 G;  5IYD H;  5C0X I;  2A19 A;  3D8G A;  2F0Q A;  3KDF A;  1PRT D;  3JC6 6;  3AFQ A;  1XNQ L;  4X65 Q;  3I7F A;  5J22 A;  4UHV A;  1VS0 A;  1IXR A;  4N9P A;  4V19 0;  4DF7 A;  3BJU A;  2ZTE A;  4ZAI A;  1Y8P B;  5IT9 E;  4JI5 Q;  1D1I A;  5C44 G;  1QVC A;  3PGZ A;  4UP9 A;  3HOZ G;  4A3M B;  3K5N A;  1K8O A;  3NWS A;  3B6Y A;  2ZJR A;  4A93 H;  2F4I A;  1OXV A;  3IKJ A;  3NP8 A;  4F7X A;  1Q82 C;  4LF8 Q;  1JE5 A;  1QE6 A;  2CQA A;  1DOL A;  5E7N A;  4DGZ A;  1S4Z A;  4JG2 A;  1Z47 A;  2F0U A;  4R4C A;  2ZT9 C;  3LWE A;  4K0K L;  3V96 A;  4N8X 1;  2EZV A;  3ICE A;  4GS3 A;  4QUC A;  1PH9 A;  1B7Y B;  1F9R A;  4C1N K;  3E6Z X;  5JVH 3;  4JI7 L;  5IE8 A;  2OXP A;  5IGC A;  1Y69 U;  4B9W A;  4DR7 L;  3J7A 5;  4RH6 A;  3H15 A;  3HZX A;  5JJZ A;  4KMU C;  4ZLT F;  3MC0 B;  3MXU A;  3HOX B;  1SMX A;  1K83 B;  2E2I B;  4IPH A;  1E2V A;  1O7I A;  1GHK A;  2E76 C;  2F03 A;  1PTO H;  1X3G A;  4K8I A;  4DR3 L;  2VZA A;  1A0I A;  2B2T A;  5L37 A;  1EUJ A;  4MIU A;  5JJK A;  4DV0 L;  4L6T B;  1EWI A;  1HNX Q;  3CP0 A;  2K05 A;  2F0I A;  2Z8L A;  4QIW B;  2QW7 A;  3TS2 A;  2WAQ B;  3SK5 A;  3G4S A;  2QA4 A;  4FF4 A;  2R7Z B;  1EZ6 A;  3H94 A;  3BDL A;  1FNV A;  4K6D A;  4IN3 A;  1I4R A;  2K33 A;  4IJH A;  1U4M A;  3NTH A;  2F0T A;  4EVO A;  1KRT A;  3I4M H;  3EQL C;  2KOL A;  5J1Z A;  2EYM A;  4C3H B;  3BYT B;  3WOE A;  1C48 A;  4A3I G;  2EYO A;  3BDO A;  5A35 A;  2F4V L;  1TT2 A;  2CVR A;  1WVL A;  1TS2 A;  1K0R A;  4C3H G;  5AFW A;  4ALP A;  3FPP A;  2RHS B;  3EIV A;  1BOS A;  4G4K A;  2CW0 C;  2RDH A;  1M1K C;  1JWM D;  1PRT B;  3GDE A;  4OEL B;  1UUP A;  1O7L A;  1H9J A;  4A3C H;  1JJG A;  2SNS A;  4H0L C;  3TP5 A;  4A3G G;  2HIV A;  3F2C A;  3BZD B;  2I5L X;  1S5F D;  5KRU A;  3Q0A A;  4DV7 L;  1HTL D;  4A3I H;  4ZUI A;  3K0X A;  1I4P A;  4C3I B;  2ZXO A;  3CC4 A;  2BH2 A;  1RKN A;  3RZO B;  5GRO A;  4JI4 L;  4HED A;  1YNN D;  1FJG L;  5DM6 3;  3BZC A;  4AYB G;  3HFZ B;  2NTT A;  2EDG A;  4IUR A;  2ZM6 L;  4DR6 Q;  2EJG C;  5M3M H;  3K58 A;  1XXG A;  1XPO A;  1EQR A;  5EAY A;  2UXD L;  3R2T A;  5CC4 A;  3GTK B;  5GAG C;  1HNW Q;  2X69 A;  3TDQ A;  2Y0S E;  2PZU A;  3OMC A;  2A6H D;  5ELE A;  4GKJ Q;  1WTV A;  2YU9 H;  1BBX C;  5FLX L;  2KBN A;  3A56 A;  5A2Q E;  4DV4 Q;  4PZ6 A;  3HOX G;  1ASY A;  2WP8 J;  2DNC A;  1I3Q B;  3K7A B;  1EIY B;  2BDO A;  4DK6 C;  1WTH A;  1CA5 A;  3FKI H;  4M1U B;  1ESR A;  1WTQ A;  4GN5 A;  5IP9 H;  1KDC A;  4ME5 A;  1EWH A;  3TBI B;  5FO8 B;  1E1T A;  5C3E H;  4JOI C;  5KNC A;  1GUO A;  1KHI A;  3LGJ A;  2D62 A;  2IHF A;  1YNJ C;  4B3R Q;  3MVV A;  5COY A;  1SND A;  2Z1C A;  2F3W A;  4PG3 A;  1CSP A;  3D0F A;  1YNX A;  3PO2 H;  1C7Y A;  4NXN Q;  4PMW A;  1ASZ A;  2K32 A;  2K75 A;  1VQJ A;  1L0X B;  1J8I A;  4F87 A;  4M8A A;  1Q8K A;  3J7Y W;  1Q81 C;  4JBM A;  2N88 A;  2PQE A;  3UDX A;  3KJP A;  5I9O A;  1F2L A;  4DKA C;  1DJR D;  4A3J B;  1X3F A;  3AMU A;  4GKK Q;  2AQ1 B;  4A3I B;  5I4D A;  3T1Y L;  3FKI G;  4GZY C;  3U50 C;  3OMG A;  4L8J A;  4WJ3 M;  1PDQ A;  2Q8T A;  1C8C A;  2JA8 G;  4I7Z C;  4FO2 A;  1SXT A;  4ME3 A;  4KV6 A;  1MHW C;  3KLS A;  3OTO Q;  1SAP A;  4FYD A;  2PCF B;  1F2Z A;  1GVP A;  4BBR H;  3PUZ A;  3TRZ A;  3PO2 G;  2E2J B;  3GQB A;  2B8G A;  1LLR D;  2R92 B;  2R7D A;  4B3T L;  4KHP Q;  3FVQ A;  4A3D B;  4GLX A;  1MKH A;  3K81 C;  3HKZ G;  4P73 A;  1Q1B A;  1F9P A;  1RD9 D;  2Q2U A;  1I4Q A;  1AE2 A;  3NBI A;  4GLV B;  4Y7N H;  1WI5 A;  3BVZ A;  3I4M B;  4R9W A;  2KCM A;  1PTO D;  4N8F A;  1EIF A;  3JAM L;  3CCM A;  1SNP A;  1N32 Q;  1SR3 A;  4UP8 A;  3GTO B;  4X3S A;  3HOU B;  4R8N A;  1VQA A;  5KEE A;  4A3B B;  1A62 A;  5BN5 A;  5FO7 B;  1AEX A;  4BBS B;  1BO0 A;  3E3X A;  5C0X H;  3T1H Q;  2RF4 A;  5C3W A;  3EJI A;  2IJ0 A;  3CCJ A;  3J7Z C;  1K3R A;  4LFA L;  2OQ0 A;  2JA7 G;  5FK9 C;  4C3J G;  1W6K A;  2QEX A;  2VUM G;  1TVX A;  4R4I A;  2EOT A;  4B3S L;  4HIK A;  1IW7 D;  3CAM A;  2AUJ D;  2WKC A;  2YYZ A;  1VDZ A;  4PNY A;  5C6A A;  1PFM A;  3TP7 A;  3I73 A;  3NQT A;  2HCI A;  1K0S A;  1E24 A;  4S3S A;  3SK4 A;  1LTI D;  1BCP C;  2A6E D;  2K7V A;  4DXG A;  1VQ5 A;  4LFB L;  1IKL A;  2XTI A;  3PUW A;  1FJG Q;  3MA2 B;  1VQG A;  3T4A C;  3KLS X;  2ICI A;  4LF4 L;  1N33 Q;  1CHP D;  3IRB A;  1HNW L;  1QB5 D;  4GKJ L;  3WWV A;  1CKO A;  1EIH A;  1VQN A;  1E2W A;  3NUC A;  2B2T C;  2LSS A;  2H4O A;  1LTL A;  1J9O A;  2IX0 A;  1KRS A;  1RHP A;  2A68 C;  2RCN A;  4MZ9 A;  1D5X C;  1TU2 B;  4BY7 G;  2L9H A;  4OX9 L;  4KHV A;  2PW5 A;  3CCL A;  4B3R L;  2R3Z A;  1TXY A;  1KQS A;  2YTV A;  1EEF D;  1HH2 P;  2DNE A;  3DM1 A;  3KBX A;  1HQR D;  1SYC A;  1JOO A;  3STB C;  2QIL A;  1BCP F;  5CV9 A;  4YHH Q;  1B53 A;  2M00 A;  4BBR B;  3HOW G;  4LF9 Q;  2RA4 A;  1S5C D;  1H9K A;  2FXQ A;  2HQE A;  4B3M Q;  1SYD A;  4HJA A;  1B4O A;  1KTK A;  2XWB B;  1NNX A;  4LNQ A;  1PMR A;  3RUZ A;  1Q3L A;  4L63 B;  3CMA A;  2Z6B A;  1BKB A;  3QR8 A;  3K80 C;  4BA1 I;  1EQQ A;  1TS5 A;  2I46 A;  3K6O A;  1VMP A;  3OTO L;  1SJE D;  1GM5 A;  4DXF A;  4LF5 L;  4KJN A;  1HFG A;  2Z4H A;  3M85 A;  3RN2 A;  3P1H A;  4BBS G;  3JAM i;  3HOW H;  2KHI A;  3VR5 A;  3DLL A;  3H91 A;  3CKI B;  2N49 A;  3R2I A;  1C0A A;  1UE6 A;  4DFA A;  4IFD H;  3DXJ C;  3RLF A;  1QVF A;  4JBK A;  2EY1 A;  3G7L A;  1WTO A;  5IYC G;  2E2D C;  2KCT A;  1GOZ A;  3S1R B;  3DM3 A;  2E75 C;  3CHB D;  4RGN A;  4POG A;  4G7Z C;  4EQP A;  1M4V A;  4BBS H;  2YTY A;  3I4N B;  2F1M A;  3S24 A;  4JW0 A;  4YIJ A;  3SR1 A;  4C2M B;  2EY2 A;  1NE3 A;  4LFA Q;  2EY5 A;  2ATW A;  1CK1 A;  4MHE A;  4A3D H;  4IFD G;  1H95 A;  4ZKC B;  2BOS A;  1SSO A;  4FNF A;  1VQF A;  1O80 A;  5I2X A;  1JR0 D;  4A3F H;  3H09 A;  1G2S A;  1LYL A;  4KTA A;  4P74 A;  5IYC H;  1HZB A;  4B3S Q;  1J5E Q;  2CH4 A;  3NPP A;  4DUZ L;  3R8B A;  2L55 A;  2O5J C;  3K0Y A;  1LTR D;  2NZ1 D;  1EYG A;  1GUW A;  2IHE A;  1M8A A;  2BDN A;  5KIX A;  4GOP B;  3RZD B;  2F0S A;  1PTO B;  5FOB B;  4DUY Q;  3MXN B;  2NWG A;  2NVY H;  3GD7 A;  4LF7 L;  2QCP X;  2AWN A;  5M5X H;  1SDF A;  4K2K A;  3IL8 A;  1NR2 A;  3KFU A;  4LJZ C;  4JI1 Q;  4NXM L;  4X3K A;  1VCI A;  1LT6 D;  4EGV A;  4EQ5 A;  4RHR A;  2Z0S A;  3CC7 A;  4Q5V A;  5JVG 3;  4G7H C;  1NUC A;  2B2Y C;  1EY7 A;  1PZJ D;  5JEA J;  4A93 B;  1XPU A;  4BA2 I;  1HA6 A;  3J80 c;  3NK9 A;  3NE5 B;  4QY7 A;  4LAA A;  1STH A;  3ND9 A;  4DR5 L;  3W1B A;  1BBW A;  5ELD A;  3VYR A;  2FIN B;  4B9X A;  2I0Q A;  4PZ7 A;  2A68 D;  1S72 A;  4OX9 Q;  1TII D;  4JI6 Q;  4QIW E;  3U4Z A;  2BE5 D;  1KNE A;  1YNN C;  4DAP A;  4A75 A;  1XMQ L;  3DWA A;  2C5C A;  2RCF A;  2FMM A;  3DUZ A;  2HQL A;  4TRD A;  2UUA L;  5M5X B;  2L15 A;  4OXP A;  1V1Q A;  4YHH L;  4IPG A;  1XNR Q;  1VQO A;  4R4O A;  4XQJ A;  4A3K H;  4LFC L;  4AQY L;  1Z9F A;  4LW1 A;  2WAC A;  2NVX H;  1A3U A;  4J15 A;  4IUN A;  5EPJ A;  3TZD A;  4U67 3;  5A2Q L;  2ZJP A;  1PFB A;  2EJM A;  3RMH A;  4H44 C;  5HY6 A;  2L0C A;  3MXN A;  1B9N A;  4O0A A;  2GVB A;  3S1R H;  2H5X A;  4ABN A;  3CRL C;  2ALY B;  4CBV A;  2E5L Q;  2AMC B;  4RCO A;  3Q22 A;  2VL6 A;  5KND A;  4HCE A;  3S1N H;  4IUP A;  2R7Z H;  5I9P A;  2NVT H;  1JWS D;  2A69 C;  4IUU A;  4C2M H;  2EQS A;  3KF6 B;  3QWN A;  1LTT D;  1HCZ A;  3E0J A;  4KY6 A;  2DJG C;  2QKI C;  3I3C A;  1A2U A;  2VQF Q;  4R4Q A;  2EE1 A;  1TWF B;  4IQZ A;  1NMF A;  1RDP D;  4X3U A;  1PRT C;  2K04 A;  1C4Q A;  4LMQ D;  2CKZ B;  4WJW A;  2F3I A;  1HXY D;  3I4N G;  4DAM A;  2HIX A;  2JA5 G;  5COR A;  1BF4 A;  1BVS A;  3MAQ A;  2B2W C;  1IBK Q;  3QG1 A;  1LUZ A;  1VQ7 A;  2R92 H;  1B44 D;  3S15 B;  1QNU A;  1X3E A;  4BXX H;  1SFO H;  2B2U A;  2KEE A;  2Q2H A;  4C3J B;  1Y1V H;  1SRO A;  2Q2T A;  1NCV A;  1AP0 A;  2PI2 E;  3TZU A;  4QQB X;  1ZEQ X;  3HS0 C;  4A4I A;  1UE5 A;  3QOL A;  1SE4 A;  1PH4 A;  1V43 A;  1LTB D;  1HUM A;  2ZTD A;  4CDD C;  2CWP A;  3EFX D;  3A8K E;  5DM7 3;  4UPA A;  1LTA D;  3KF8 A;  1E0B A;  3NEM A;  4JBJ A;  1D2B A;  1C9O A;  5T1I A;  1D5Z C;  5M3F H;  1FNU A;  1QUQ B;  3FMC A;  1XTC D;  5IGE A;  5EKI A;  2GN5 A;  2YV5 A;  4LF7 Q;  1N36 Q;  1B9M A;  2K5H A;  5FLM G;  3WDN A;  2QGQ A;  2VQE L;  1EY6 A;  4DA2 A;  3UDF A;  4ZCK A;  1Y1W B;  2O4X A;  3VA5 A;  4AYB B;  3GTP H;  4DR4 L;  3I8Z A;  4L5S A;  3S2D B;  4B3T Q;  4CHT B;  3J81 E;  2UXC L;  2F52 A;  3I90 A;  1L1O A;  1X3P A;  4OON A;  4A3B G;  2HCC A;  1HNZ L;  2R93 H;  3T13 A;  1EY9 A;  2LKV A;  2WFW A;  1JMC A;  4J6H A;  4Q0F A;  4DU9 A;  2M9V A;  1JOK A;  4KHZ A;  4A3G B;  1OXX K;  4HSP A;  3RD4 A;  1KDA A;  3PO3 B;  2G5D A;  1YBY A;  4Z9C B;  2DY7 A;  1RF2 D;  4JI6 L;  4JI5 L;  5FLX c;  2KED A;  1Q46 A;  3W3A A;  1I94 L;  5G3L F;  3NTI A;  3GTK H;  1W2B A;  1YHB A;  3G6E A;  1XNR L;  4A3B H;  4L5Q A;  4QB4 A;  5DNF A;  1CI3 M;  5CV6 A;  2AQ2 B;  1HZA A;  5C5L A;  1XPR A;  4DV5 Q;  4CGY B;  3KDF B;  1GUT A;  3HOY G;  3URY A;  1SEB D;  1TS3 A;  5IOC A;  3GV3 A;  3S2H H;  1CZG A;  1ZYR D;  4X6A H;  2JA9 A;  1PTO F;  4RA8 A;  3M4O H; 
#chains in the Genus database with same CATH homology
 1E3P A;  3T1Y L;  3S2D H;  4IFD I;  3HOV G;  3FKI G;  3U50 C;  4DR1 L;  1R9T H;  3GTO H;  3HOU H;  3I55 A;  4A3K G;  4WJ3 M;  1NBW A;  1J5E L;  4L5R C;  2JA8 G;  1TWG H;  4ME3 A;  1VQL A;  3OTO Q;  3I4O A;  1GKH A;  2E5L L;  4GN3 B;  1Q12 A;  1GVP A;  4BBR H;  2R6G A;  3PUZ A;  3TRZ A;  4JI3 Q;  3PO2 G;  5LMN L;  4TQU S;  3H0G H;  3NBH B;  1TWA H;  1WOC A;  1UWV A;  3CCU A;  3HOY H;  2R7D A;  4B3T L;  1KL9 A;  1IBM Q;  3UE1 A;  1X54 A;  4KHP Q;  4IFD J;  4GLX A;  1MKH A;  3K81 C;  3HKZ G;  4P73 A;  5LMU L;  1Q1B A;  2MO0 A;  3S17 H;  4A3L H;  3RN5 A;  2IX1 A;  3ER0 A;  5FJ8 H;  1VQ8 A;  1YZ6 A;  2AWO A;  2E8G A;  1X56 A;  3AYH B;  2Q2U A;  2UU9 Q;  5IYB G;  3E9H A;  1AE2 A;  5IP7 G;  1PH6 A;  3HOV H;  3CC2 A;  4GLV B;  4Y7N H;  1P8L A;  3HOU G;  4LF8 L;  1WI5 A;  4GKK Q;  2KCM A;  4HIM A;  2R7Z G;  1EIF A;  1KD1 C;  4A3D G;  4JCV E;  2BA0 A;  3CCM A;  1NMG A;  4DV6 Q;  4DR5 Q;  3KJO A;  2WB1 E;  1IL2 A;  1N32 Q;  1SR3 A;  4UP8 A;  4A3F G;  1VQA A;  1XMO L;  2DGY A;  1A62 A;  3K7U C;  4P72 A;  4YWM A;  2E2I H;  3H0G G;  1CUK A;  5J3B A;  4K0K Q;  2MFI A;  3U58 A;  4A3J H;  3PF4 A;  4IO9 A;  2PMZ E;  4GOP A;  3W5O A;  4AYB E;  3T1H Q;  2RF4 A;  1XMQ Q;  1QZG A;  2V1C C;  3GTM H;  2ID0 A;  3PIO A;  3CCJ A;  4BY1 G;  3J7Z C;  1K3R A;  1PH3 A;  4LFA L;  1SE8 A;  2OQ0 A;  2JA7 G;  3I4M G;  5FJ8 G;  2NVQ H;  2UUC L;  2PQA B;  1VQE A;  2QEX A;  3PUY A;  2B29 A;  3KYH C;  3GTJ H;  3E0E A;  2VUM G;  4DR7 Q;  3KOJ A;  4R4I A;  3ULL A;  3CQZ H;  4H02 A;  1K73 C;  4B3S L;  4HIK A;  2R92 G;  3CAM A;  1PVO A;  2YYZ A;  4JI0 Q;  4JYA Q;  5AJ3 Q;  1CSQ A;  5GAH C;  1K83 H;  3RR5 A;  1E24 A;  1Y1V G;  1YVC A;  1UE7 A;  2VS1 A;  2UXB Q;  1VQ5 A;  3RNU A;  4LFB L;  2B3G A;  1WCM G;  2XTI A;  3PUW A;  2K52 A;  1EFW A;  1FJG Q;  4A3G H;  3AQQ A;  1VQG A;  2K5N A;  4XTC S;  4BY1 H;  1XNQ Q;  3RZO H;  3MEF A;  4X65 L;  4A93 G;  4DV2 L;  5LMN Q;  4GNX B;  4P71 A;  2IT1 A;  5M3F G;  1PH5 A;  4LF4 L;  1N33 Q;  3IRB A;  2CWA A;  4JOI A;  2VQE Q;  3CCR A;  1TWH H;  4NPS A;  5GAD C;  2N3S A;  3RLN A;  3ZJY C;  4R1J A;  1YIT A;  3PO3 G;  4HID A;  5K36 G;  4GKJ L;  3WWV A;  1CKO A;  1XJV A;  1CKM A;  4GLA C;  4RG1 A;  3S1M H;  1VQN A;  2XGT A;  1PA6 A;  4O2D A;  3M4P A;  2LSS A;  2AHO B;  2UXD Q;  2JQO A;  4DK3 C;  1E7Z A;  1LTL A;  2LXK A;  2IX0 A;  2UU9 L;  1KRS A;  5M3M G;  2RCN A;  1IBK L;  3JAM c;  3A5Z B;  4MZ9 A;  3CF5 A;  1PV4 A;  4BY7 G;  5GQO A;  1G51 A;  1LM0 A;  1OXU A;  4OX9 L;  2HT1 A;  1WCM H;  4LFC Q;  1T9H A;  5IT9 c;  3CCL A;  1PH8 A;  3NEN A;  4DV6 L;  4B3R L;  1KQS A;  1TXY A;  1YEZ A;  2R93 G;  2IY5 B;  1EOV A;  3PUV A;  2YTV A;  3EN2 A;  1HH2 P;  1VQK A;  1N34 L;  5C0X J;  3TS0 A;  1D8L A;  2RHQ B;  3KF6 A;  1HJP A;  1VQC A;  4MNO A;  3STB C;  1G29 1;  4X64 Q;  2OCE A;  1B70 B;  2KEN A;  4YHH Q;  4YCV A;  3HOX H;  4JV5 L;  2KHJ A;  5JJL A;  1E1O A;  3KF8 B;  3AFP A;  1I94 Q;  4JI7 Q;  4UY8 C;  3PO3 H;  1K9M C;  3HOW G;  1AH9 A;  4LF9 Q;  4QGU A;  3PCO B;  4KI0 A;  3D31 A;  3E9I A;  1MIU A;  2FXQ A;  4AIM A;  2OTL A;  2N78 A;  1HR0 Q;  3S1Q H;  4B3M Q;  5C3E G;  4HJA A;  3FP9 A;  1A63 A;  5IWA L;  4HJ9 A;  2JK8 A;  2BA1 A;  4NXN L;  4DV5 L;  1PYB A;  4GN4 B;  1CKN A;  4LNQ A;  4EX5 A;  3I56 A;  3CXC A;  3CMA A;  4JI4 Q;  1L0W A;  1BKB A;  4GOP C;  4X66 L;  3PIP A;  3K80 C;  4BA1 I;  1OXT A;  4YCU A;  4P75 A;  1EQQ A;  3G71 A;  3FHW A;  4JI1 L;  1JJ2 A;  4JI2 L;  3S14 H;  3OTO L;  1GM5 A;  4NXM Q;  1J6Q A;  3J81 c;  5BR8 L;  2D0P A;  1FVI A;  4LF5 L;  3ULJ A;  4APV A;  1RL2 A;  3M85 A;  3CME A;  3RN2 A;  1N36 L;  2VQF L;  4DR2 L;  4RMF A;  4BBS G;  2A1A A;  3JAM i;  2VNU D;  3HOW H;  2KHI A;  3I4N H;  4MTN A;  3DLL A;  1PH7 A;  2JA5 H;  4DR4 Q;  2ZM6 Q;  3G48 A;  2Z6K C;  4DV2 Q;  5LMU Q;  2N49 A;  1D7Q A;  1VQ4 A;  1WJJ A;  4LF4 Q;  1FGU A;  4XIG S;  1N33 L;  1WYD A;  2I5H A;  1UE6 A;  4PZ8 A;  3W1G A;  4DV0 Q;  3S15 H;  1C0A A;  4UP7 A;  1QVG A;  4A3E G;  5ELO A;  3TRE A;  3RLF A;  2UUB L;  3PV0 A;  1QVF A;  4JBK A;  4C3H H;  2K50 A;  1TWF H;  3A5U A;  4BBR G;  3M4Q A;  5IYC G;  2Z6K A;  4BXX G;  2KCT A;  2EIF A;  2D0O A;  3UE0 A;  3CCQ A;  1OXS C;  1PFS A;  3DM3 A;  3M9B A;  4HJ5 A;  4A3C G;  4YWL A;  2B63 H;  2AKW B;  4POG A;  1W3S A;  2UUA Q;  2WAQ E;  1PH2 A;  1X9N A;  2LXJ A;  1A8V A;  2NN6 I;  3OYY A;  4BBS H;  2YTY A;  2ZTC A;  2F4V Q;  5IYD G;  1PH1 A;  4IPD A;  4JI8 L;  5IYB H;  5IP7 H;  2E2H H;  1YJW A;  3RLO A;  3K8A A;  3S24 A;  4AQY Q;  1N34 Q;  1OTC A;  3OW2 A;  3UDI A;  1NE3 A;  4LFA Q;  4LWC A;  2ATW A;  4LUO A;  2N8N A;  1K8A C;  4A3D H;  1XMO Q;  4IFD G;  3A74 A;  4LF6 L;  5FLM H;  1H95 A;  2Y0S G;  1HZC A;  1P16 A;  3TEH B;  1VQF A;  4DV7 Q;  4A3E H;  1XTD A;  4DNI A;  2K5V A;  4A3F H;  1Q7Y C;  1JB7 A;  3CCE A;  1UE1 A;  4HJ7 A;  1CKN B;  1VQD A;  1LYL A;  1GD7 A;  3HKZ E;  4P74 A;  5IYC H;  1HZB A;  5C44 H;  3STB D;  4B3S Q;  1N8R C;  1U0L A;  1J5E Q;  1KAW A;  1I50 H;  4DUZ L;  2CFM A;  4JYA L;  5JJI A;  5IWA Q;  1YIJ A;  1IBL Q;  3HOZ H;  4DR6 L;  2JJQ A;  2JEA I;  1EYG A;  2B63 G;  1Y1W H;  4X62 L;  2IHE A;  1I5F A;  4GOP B;  3UDG A;  4YY3 L;  4NB3 A;  4HIO A;  2PI2 A;  2PNH A;  4R4T A;  4GKK L;  2UXB L;  1X55 A;  4DUY Q;  3MXN B;  4LF7 L;  2JEB I;  2NVY H;  1VQI A;  3GD7 A;  2AWN A;  2WB1 G;  4L5T A;  4OWX B;  4JI3 L;  5IY0 A;  2A19 A;  3I2Z A;  5M5X H;  4X66 Q;  5C0X I;  3KFU A;  4JI1 Q;  3GTL H;  1HZ9 A;  4NXM L;  1VCI A;  3KDF A;  4KHP L;  3JC6 6;  3AFQ A;  5C4X G;  1XNQ L;  4A3M G;  1JJC B;  1YHA A;  4X65 Q;  4EQ5 A;  4DV4 L;  2Z0S A;  3CC7 A;  3I7F A;  3M3Y H;  2Q2I A;  4DV3 L;  1VS0 A;  1IXR A;  5JEA J;  1WFQ A;  5IP9 G;  1XPU A;  4BA2 I;  3CD6 A;  3BJU A;  5HGQ A;  1KC8 C;  2ZTE A;  3J80 c;  1MJE A;  1N9W A;  3L7Z C;  5C44 G;  4JI5 Q;  4OWW B;  1QVC A;  3J80 i;  3PGZ A;  4QY7 A;  4UP9 A;  3CCV A;  3ULP A;  3GTG H;  4A76 A;  3HOZ G;  1I6H H;  4DR5 L;  1YI2 A;  3CPF A;  3W1B A;  1BBW A;  1Y1W G;  1N32 L;  3EBE A;  2I0Q A;  3B6Y A;  4PZ7 A;  1S72 A;  4OX9 Q;  3L2P A;  2ZJR A;  4A93 H;  1OXV A;  2I5M X;  1JT8 A;  4JI6 Q;  1BBU A;  4LUV A;  4QIW E;  1Q82 C;  4LF8 Q;  1JE5 A;  3K7A H;  1PHJ A;  3U4Z A;  3S16 H;  3NEL A;  3BZK A;  4A75 A;  3T1H L;  1XMQ L;  5C4X H;  4A3M H;  5E7N A;  2HQL A;  4HJ8 A;  2UUA L;  4Y52 H;  5LMN W;  2L15 A;  4JG2 A;  4OXP A;  1V1Q A;  4DV1 Q;  1SLJ A;  5JEA G;  4IPG A;  4YHH L;  1Z47 A;  1VQO A;  4R4O A;  1SN8 A;  1XNR Q;  4A3K H;  1PYS B;  4YWK A;  4LFC L;  4R4C A;  3A0J A;  4IPC A;  1NTG A;  4AQY L;  3M7N A;  1Z9F A;  4K0K L;  3AEV A;  3T1Y Q;  2JA8 H;  1E22 A;  3ICE A;  1U5K A;  2E2J H;  4GS3 A;  1Y14 B;  2NZH A;  1DGS A;  4TVA B;  1PH9 A;  4LW1 A;  2NVX H;  1B7Y B;  2K14 A;  4J15 A;  4LF6 Q;  1YJ9 A;  1TWC H;  3CCS A;  2HHH L;  4JI7 L;  5IE8 A;  2ZJP A;  4WJ4 A;  4OO1 I;  4LF9 L;  3J81 j;  3KLW A;  4DR7 L;  3J7A 5;  2PQA A;  5HY6 A;  4DR1 Q;  3ERS X;  3RZD H;  4A3L G;  3H15 A;  1HR0 L;  4O0A A;  3PF5 A;  2A8V A;  4X62 Q;  1YJN A;  2GVB A;  3S1R H;  2H5X A;  5AJ3 L;  1SMX A;  1UEB A;  2ALY B;  4IPH A;  3F2D A;  2OTJ A;  5IYD H;  5H1S E;  4QJF A;  2E5L Q;  1O7I A;  2UXC Q;  2AMC B;  1X3G A;  2VL6 A;  4DR3 L;  4LFB Q;  2DUD A;  2VZA A;  3S1N H;  1A0I A;  2R7Z H;  3L0O A;  1HNZ Q;  2NVT H;  1VQH A;  1L1O C;  4C3I H;  1EUJ A;  2JE6 I;  5C4J H;  5BR8 Q;  4C2M H;  1IBM L;  5JJK A;  2EQS A;  3KF6 B;  4JC0 A;  1HR0 W;  4DV0 L;  1EWI A;  1SRU A;  1HNX Q;  3CP0 A;  4R4Q A;  2VQF Q;  4DR2 Q;  1K8G A;  3CW2 C;  4QL5 A;  1NMF A;  4A3J G;  4LUZ A;  3TS2 A;  5C0X G;  3G4S A;  2QA4 A;  1B8A A;  2CKZ B;  1L1O B;  2F3I A;  2K4K A;  4IJL A;  4IJH A;  4AH6 A;  3I4N G;  2JA7 H;  1KRT A;  3I4M H;  4DAM A;  2HIX A;  4POF A;  2JA5 G;  1NY4 A;  4JBW A;  4C3J H;  1BVS A;  2OWO A;  1VQB A;  1IBK Q;  1G6P A;  4A3I G;  2VUM H;  2F4V L;  2UUC Q;  3H3V I;  3BU2 A;  4JI8 Q;  3U4V A;  1LUZ A;  2MO1 A;  1M90 C;  1VQ7 A;  2R92 H;  1K0R A;  1Q1E A;  1VQM A;  4ALP A;  1I3Q H;  3F1Z A;  1X3E A;  2RHS B;  4BXX H;  1SFO H;  2Q2H A;  3EIV A;  1M1K C;  2BH8 A;  1Y1V H;  4B3M L;  3GDE A;  1SRO A;  4X64 L;  2Q2T A;  1X6O A;  1VQP A;  4IOA A;  2PI2 E;  4A3C H;  1JJG A;  1RIP A;  2CQO A;  1MJC A;  4QQB X;  1PH4 A;  4A4I A;  1IYJ B;  1UE5 A;  2HIV A;  2JA6 H;  4A3G G;  1V43 A;  4IOC A;  2ZTD A;  2MNA A;  2CWP A;  2ES2 A;  3F2C A;  4UPA A;  2I5L X;  2NZO A;  3NEM A;  4JBJ A;  5M5W H;  1C9O A;  5M3F H;  1QUQ B;  3SGI A;  4DV7 L;  4YY3 Q;  4JI0 L;  4A3I H;  3K0X A;  5GAE C;  2MQH A;  2GN5 A;  2YV5 A;  4LF7 Q;  1N36 Q;  3CC4 A;  2K5H A;  2BH2 A;  1X65 A;  5FLM G;  1QUQ A;  2QGQ A;  2VQE L;  2R7F A;  5GRO A;  4JI4 L;  2WAQ G;  3UDF A;  4DUZ Q;  1KIX A;  1S40 A;  1FJG L;  3BZC A;  4AYB G;  3HFZ B;  3CPW A;  3GTP H;  4JI2 Q;  2ZM6 L;  4DR4 L;  4L5S A;  4DR6 Q;  5M3M H;  3GTQ H;  4B3T Q;  4BY7 H;  2ASB A;  1XPO A;  1GO3 E;  2UXC L;  1EQR A;  5EAY A;  2F52 A;  4DUY L;  2UXD L;  1L1O A;  4DR3 Q;  4OON A;  4A3B G;  1S3O A;  2ZJQ A;  5GAG C;  1HNZ L;  1FL0 A;  2UUB Q;  4OO1 G;  2R93 H;  3GO5 A;  2YTX A;  2JA6 G;  1HNW Q;  2Y0S E;  1Q86 C;  4GKJ Q;  3TQY A;  2YU9 H;  2WFW A;  2KBN A;  1HNX L;  1JMC A;  3F8T A;  4DV4 Q;  4KHZ A;  4PZ6 A;  1OXX K;  4DAY B;  5M5Y H;  1QZH A;  3HOX G;  4DV3 Q;  1YBY A;  1ASY A;  2EXD A;  2WP8 J;  1L2F A;  1EIY B;  4JI6 L;  2VY3 A;  3HKS A;  1AE3 A;  4JI5 L;  4DK6 C;  3H3V H;  3FKI H;  5DLQ E;  5FLX c;  3F2B A;  3PUX A;  4GN5 A;  1NJI C;  1Q46 A;  2GVA A;  4KLK A;  5IP9 H;  1I94 L;  1E1T A;  5C3E H;  4JOI C;  5ELN A;  1KHI A;  4B3R Q;  2D62 A;  2IHF A;  3LGJ A;  3GTK H;  1W2B A;  1IZ6 A;  1YHB A;  3G6E A;  2C35 B;  4DV1 L;  4GNX C;  1KXL A;  1XNR L;  4YCW A;  4A3B H;  4L5Q A;  2OQK A;  4PG3 A;  2CCZ A;  1CSP A;  3D0F A;  1YNX A;  3PO2 H;  1HZA A;  1XPR A;  1C7Y A;  4DV5 Q;  3Q8D A;  4PMW A;  4NXN Q;  4JV5 Q;  4FDB A;  1ASZ A;  2K75 A;  1HNW L;  1VQJ A;  3KDF B;  2NN6 G;  3PSI A;  1YHQ A;  1Q81 C;  1Q8K A;  1VQ6 A;  4JBM A;  3HOY G;  3UDX A;  3KJP A;  4GNX A;  1V9P A;  1IBL L;  4DKA C;  3J81 i;  2VW9 A;  3VDY A;  2HHH Q;  3S2H H;  4OWT B;  1X3F A;  4X6A H;  2JA9 A;  4LF5 Q;  4DPG A;  1VQ9 A;  3M4O H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...