4DK6C

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
87
Chain Sequence
b'SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPLGYVKVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 14
structure length 87
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk6C00
1YZ6A 5IP7G 2D62A 3CQZH 1TWCH 3KOJA 1NJIC 1N36Q 3CW2C 4DAMA 4DUZQ 2JK8A 3H0GH 1BBUA 4DR5L 3I4NH 3HOZH 5M5YH 2UU9Q 3M4PA 4OWXB 1GM5A 4JI6L 1A63A 1WFQA 5ELNA 4MNOA 4BA1I 4JI7L 3ICEA 3J7A5 1XNRL 4UP7A 2K5VA 4DR7L 2BH2A 4JOIA 1AH9A 4KHZA 4A3IH 1X54A 4X62Q 4DV1Q 1JB7A 1VQDA 4Y7NH 5GAGC 4IOCA 1PH9A 4AYBG 2XTIA 3PSIA 3EN2A 2HT1A 4UPAA 5AJ3L 3GTGH 3J81c 1PH7A 2A8VA 4GN4B 1Y1WG 5FLMH 1K9MC 4JBMA 1YHAA 2Z0SA 3PUYA 3KF6A 4B3SL 4JBWA 2UUCQ 1HNXL 4BXXG 4JCVE 1GKHA 1C0AA 4DK6C 1SN8A 1TWFH 1WYDA 4QQBX 1VQLA 4LFBQ 1UWVA 2UXBL 4DR4Q 3UDGA 2UUAL 1K8AC 4JC0A 3PUXA 1S72A 3FP9A 2NZOA 1HNZQ 1UEBA 1QVFA 1PYBA 1K3RA 3SGIA 3NBHB 1HZCA 1SE8A 2Z6KC 3JAMi 3RN2A 1Q7YC 2E5LL 1N32L 1DGSA 4BY1G 1YJNA 3CAMA 4BBRG 4C2MH 4C3JH 3F1ZA 1PH6A 2KHIA 3AFQA 3KF6B 1PHJA 4DR2Q 4H02A 5M3FG 4DV0Q 3RLFA 4LF9Q 3MXNB 5J3BA 5C0XJ 3NELA 4A3MG 1OXSC 3S14H 4DR6Q 5FLXc 1EQRA 1SROA 2F52A 3CF5A 1QUQA 2VQEL 4RG1A 5LMNL 4LF7Q 3AFPA 5IYCG 2UXCL 4DR1Q 1EOVA 4PMWA 4LF6Q 4DV3L 4A3FG 2VL6A 3PIOA 1J5EL 1C7YA 1VQ9A 2OTJA 1G6PA 3A5ZB 4LUVA 5IYBG 4JBKA 2ATWA 1PH5A 4DNIA 3S1MH 4JI5L 5M3MH 1CKMA 3I55A 2OWOA 3E9HA 4YCVA 1HR0L 3HOXH 3E9IA 2VUMG 3ERSX 2AHOB 1N34L 1Y1VG 2UUBQ 1VQGA 4A93H 2IT1A 1YVCA 4OONA 2E8GA 3UDXA 1LYLA 3BU2A 5IWAQ 1AE3A 4P72A 3HOZG 1VQKA 3CPFA 5C0XI 3L7ZC 2ZTEA 3GD7A 4QIWE 1WI5A 3UE1A 3KJPA 1NMFA 4YCWA 1QZHA 2AMCB 3S15H 1LM0A 4IPHA 3TS0A 1FJGQ 4A3IG 4KHPL 1I5FA 3PCOB 4JI1Q 2VQFQ 4TVAB 1KL9A 3F8TA 3OYYA 3S1NH 1Q8KA 4K0KQ 3STBC 4P74A 4BBSH 2B29A 1X55A 5FLMG 5BR8Q 2KENA 1KHIA 5C44G 4Y52H 2Z6KA 1JE5A 4O0AA 2F4VQ 1P16A 2B3GA 4LF4L 1RIPA 2LSSA 1YITA 4GKJQ 3L2PA 1Q81C 3GTJH 3U58A 1N8RC 3RNUA 3PUVA 4B3TQ 2MO1A 4IPCA 5C4JH 2JA9A 1EWIA 5EAYA 1Z9FA 2JQOA 3GTKH 4DV6Q 1T9HA 2A1AA 1VQBA 3F2BA 1KC8C 4DV5Q 2K4KA 4PZ8A 1UE6A 1UE5A 3G48A 5JJIA 1FVIA 1XNQL 1Q82C 4A3BG 4FDBA 4R4TA 1M90C 1VQ7A 1NY4A 4LUOA 5LMNW 3T1HQ 1XMQQ 4A76A 4X64Q 2JEAI 3GTPH 4YHHL 3T1YQ 1PA6A 1CUKA 2GVAA 4LF8Q 1PH3A 3DM3A 5C3EG 2I5MX 4YWMA 3RLOA 3Q8DA 4L5TA 5C4XH 4DPGA 5IYDG 4B3ML 4HIKA 4GN5A 3A0JA 4OXPA 4A75A 4EQ5A 5M5XH 4O2DA 1ASZA 3I4OA 3FHWA 2WB1E 2CWAA 3MEFA 2Q2UA 1VQNA 4B3RL 1I50H 2ID0A 1N33L 4IFDG 1E7ZA 1X3FA 3J80c 3HOVH 4DR3Q 1JJ2A 3JC66 3HOXG 4GOPB 1VQOA 2FXQA 4GNXB 4DR4L 4NXML 3U50C 4DUYQ 5IP9H 2OQ0A 3TEHB 4TQUS 4X65L 4A4IA 3HOUG 2UXDQ 1CKNB 4DV7Q 4OX9L 2Q2IA 1AE2A 4DV4Q 1PH8A 4L5RC 4KI0A 4WJ4A 3W5OA 1X6OA 4AQYL 3H15A 2JA5H 4YWKA 2JEBI 3I2ZA 4XIGS 4DKAC 1YJ9A 2JA7H 4A3EH 4JI8L 4X66Q 3DLLA 4JI0Q 2OTLA 2R92H 2JJQA 1VQ4A 5GROA 1LUZA 3M4QA 3RLNA 1PFSA 2ZM6Q 1IBLL 1VQ5A 3S1RH 1VQJA 3NEMA 4L5QA 1Q86C 3M9BA 4BBSG 2DGYA 3CMEA 4LF7L 2ALYB 3OTOL 4YY3L 3CCVA 1U5KA 4DK3C 4LF5Q 2YTVA 2KBNA 1IBML 2CKZB 4A3GG 3F2CA 1CSPA 1IXRA 4LW1A 3UDIA 2HIXA 1XMOQ 4NXNQ 4LFCL 1R9TH 4MZ9A 2ZJPA 1GD7A 5IT9c 1D7QA 5LMUQ 1HNWL 1PH2A 2IX1A 4X6AH 1O7IA 1XTDA 2HIVA 1OXUA 2YYZA 1EQQA 1FL0A 4A3LH 4DR5Q 2JA6H 3I4MH 2ZTCA 4PZ7A 1KRTA 1YJWA 3CCLA 2AWNA 3CC4A 3RZDH 2RF4A 2EQSA 2WAQG 1MJCA 1BKBA 3PO3H 4JI6Q 2B63H 5IWAL 4HIOA 4JI7Q 5FJ8G 4QL5A 3CCSA 1XNRQ 4DR7Q 1K73C 5GADC 3UE0A 3ER0A 2PNHA 3OW2A 4JV5L 1IYJB 1K83H 3KYHC 1HZBA 4RMFA 4GOPC 4BY7G 4R4QA 2BA0A 2EXDA 4GNXC 1MJEA 4JI4Q 4A3KG 5AJ3Q 3UDFA 1L0WA 2Q2HA 2Y0SE 3LGJA 4LFAL 1QZGA 4A3DH 3FKIH 1OTCA 1EUJA 3PV0A 2I5LX 4B3SQ 3HKZG 4A3JH 1HNXQ 2R7ZH 1E24A 1V1QA 1SR3A 2KHJA 2UXBQ 1RL2A 4GKKL 5GQOA 3PO2H 2QEXA 1PVOA 2UUAQ 5JJKA 3PUWA 3H0GG 3STBD 4JYAL 2MNAA 1YIJA 1YEZA 3AEVA 1NTGA 1Z47A 3I4NG 1JT8A 5GAHC 1V9PA 4EX5A 1I94L 3RR5A 4R4IA 5IP9G 5IP7H 1N32Q 2E5LQ 2H5XA 4WJ3M 4JI3L 2RHSB 2JA8G 4DV2L 2MFIA 2NN6I 3A5UA 2I5HA 2YTXA 4AYBE 2F3IA 4APVA 1VQ6A 4OWTB 1WCMH 4JBJA 2JA7G 1VQFA 4JG2A 2PQAB 4YWLA 3EIVA 2AWOA 1IL2A 3S1QH 4A3EG 1JMCA 2EIFA 1VQHA 3G4SA 1KRSA 3CP0A 3J81i 3KDFB 3L0OA 1LTLA 2LXJA 3TREA 2QGQA 2VQEQ 4JI2L 5LMNQ 3EBEA 3S2DH 3GTMH 1SMXA 2UXCQ 1IBKL 4DV3Q 1J5EQ 4C3IH 2VS1A 5JEAJ 1QVCA 1Y14B 1Y1WH 1KIXA 1YBYA 3GO5A 3ULLA 1KAWA 2RHQB 4JI5Q 3KF8B 1PV4A 1NE3A 1GVPA 2CQOA 1TWHH 2VW9A 4BXXH 1EIFA 1Q1BA 3PF5A 1WJJA 1GO3E 3D31A 2NVQH 1HR0Q 4BA2I 2HQLA 1N36L 1PH4A 3CCMA 1N34Q 4DUZL 3S17H 3RZOH 2UU9L 2R7FA 3JAMc 4GOPA 2YU9H 2E2HH 4GNXA 2JA6G 3GTQH 1CKOA 5HGQA 2ES2A 1V43A 3AQQA 1CKNA 3H3VI 1VQ8A 3IRBA 3PO3G 4BY1H 2R93H 2K52A 4X62L 4DV1L 4BBRH 2B63G 4P73A 4QJFA 2R6GA 1VS0A 1VQEA 1WOCA 1L1OB 4KHPQ 1BBWA 3TQYA 3U4VA 3KLWA 5M3FH 3H3VH 1UE7A 1Q46A 4JI0L 1B8AA 2D0PA 4A3MH 2K5NA 5M3MG 3GDEA 1SFOH 1EFWA 2D0OA 1XJVA 2UUCL 2OQKA 2ZJQA 3CC2A 3HOYH 4MTNA 4LFBL 2R7ZG 4A3FH 4LF4Q 2IX0A 4P75A 4A93G 4LF5L 3K0XA 3KFUA 1SRUA 1HNZL 1KQSA 5E7NA 3PO2G 1H95A 1X3GA 1MIUA 1VCIA 3CCQA 2CCZA 3D0FA 1JJCB 2DUDA 1I3QH 4GN3B 1Q1EA 5DLQE 4IJLA 1XPOA 2CFMA 1E1TA 4YCUA 2VY3A 3U4ZA 2VUMH 1CSQA 1Y1VH 1E3PA 1TWGH 3I56A 3CPWA 1XNQQ 4OO1I 2IY5B 2HHHQ 1KXLA 4DAYB 3G71A 4PZ6A 4DR2L 4HJAA 4YHHQ 5C0XG 4A3CH 2BA1A 1UE1A 4DV0L 1WCMG 2JE6I 4GLXA 1YI2A 4LF9L 4QGUA 4DR6L 2E2JH 3B6YA 2KCMA 5HY6A 1P8LA 1HH2P 2RCNA 3I7FA 5K36G 2N78A 2NN6G 4DR1L 1Q12A 4LF6L 1X65A 4UP8A 4B3MQ 4HJ7A 3CC7A 4L5SA 3CCRA 3GTLH 1G51A 4IJHA 1E22A 1K8GA 3E0EA 3F2DA 4JI4L 4LNQA 2WFWA 2YV5A 3PIPA 4AIMA 2OCEA 1S3OA 5C44H 4IOAA 3RN5A 1OXXK 2NZHA 3CCUA 3M85A 4B3RQ 1N33Q 1I6HH 1XPUA 1PH1A 2UUBL 3ZJYC 4IFDJ 1L1OC 1HZ9A 3K7AH 3S24A 4POGA 4NXMQ 4OWWB 2PI2A 4R4OA 4X65Q 2IHEA 3HFZB 2Q2TA 4IPDA 4KLKA 4OX9Q 5ELOA 1NBWA 1OXTA 3W1GA 4AQYQ 2N49A 4A3BH 3M4OH 2NVTH 1FGUA 1VQMA 1SLJA 4P71A 1FJGL 2R93G 3TS2A 4UP9A 5C4XG 5M5WH 3GTOH 2GN5A 3J81j 4JI1L 2VQFL 4JI8Q 4AH6A 4POFA 5IE8A 2PQAA 4GLAC 4K0KL 5JJLA 2QA4A 5C3EH 3PGZA 1IBLQ 5GAEC 5BR8L 2PMZE 4HJ5A 2MO0A 3KDFA 2F4VL 3HOWH 4LWCA 5IYDH 2GVBA 1W3SA 1VQPA 3OTOQ 4IFDI 4YY3Q 4GKJL 1ASYA 3HOVG 4HIMA 3HOYG 1YNXA 2MQHA 5JEAG 1IBMQ 2JA8H 2CWPA 1A8VA 4B3TL 1TWAH 1YHBA 3J80i 4GS3A 4LFCQ 3A74A 1QVGA 2WB1G 3BZCA 4DV6L 1HNWQ 1NMGA 4DV5L 3HKSA 1JJGA 4UY8C 4HIDA 1K0RA 2JA5G 1D8LA 2K50A 3T1HL 1XMQL 4X64L 2VZAA 4C3HH 4ALPA 1L2FA 3T1YL 2K14A 3HOUH 3VDYA 1C9OA 1X9NA 2R92G 4LF8L 2ZTDA 2E2IH 3S2HH 4J15A 2AKWB 3W1BA 3AYHB 2V1CC 2N3SA 1QUQB 4A3CG 1A0IA 4LUZA 3BJUA 3ULJA 3NENA 2IHFA 4IO9A 2YTYA 2BH8A 3S16H 4IPGA 4JV5Q 4OO1G 3CD6A 1TXYA 1L1OA 3PUZA 4R1JA 1HZAA 3ULPA 1XPRA 1PYSB 4LFAQ 4NB3A 3J7ZC 1X3EA 4JOIC 4GLVB 1VQIA 1B7YB 1HJPA 1VQCA 4XTCS 2C35B 4ME3A 5H1SE 2I0QA 4DR3L 1MKHA 4A3GH 3K81C 4QY7A 4GKKQ 4A3LG 2WP8J 1VQAA 3I4MG 4DUYL 4NPSA 4JYAQ 4PG3A 3M3YH 2WAQE 2UXDL 1X56A 2KCTA 4DV7L 2ASBA 4R4CA 1J6QA 1I94Q 4DV4L 2PI2E 4JI3Q 5IY0A 4DV2Q 1N9WA 3CCJA 3K7UC 1BVSA 3K80C 2L15A 1EYGA 4X66L 2HHHL 3TRZA 2R7DA 3G6EA 3CCEA 2ZM6L 3WWVA 4HJ8A 3CMAA 1B70B 5FJ8H 1YHQA 3FKIG 3M7NA 2K5HA 4A3DG 2VNUD 5IYCH 1E1OA 2A19A 3HKZE 1EIYB 1OXVA 2N8NA 2ZJRA 4A3JG 3KJOA 1G291 2XGTA 1S40A 4JI2Q 2LXKA 2K75A 5IYBH 4BY7H 2NVYH 1W2BA 1M1KC 1IBKQ 4HJ9A 4A3KH 3HOWG 1KD1C 2NVXH 4NXNL 1IZ6A 2Y0SG 3BZKA 1XMOL 3K8AA 1HR0W 3PF4A 3CXCA 5LMUL 1U0LA 1A62A
chains in the Genus database with same CATH superfamily
2NVTB 1F2YA 1X3PA 1AP0A 1QNKA 1S5ED 2I46A 4G57A 3DWAA 3FKIB 3HOZH 1LTTD 3QR8A 1SAPA 5ELNA 4JI7L 3BZDB 5FOBB 2BH2A 3J7AF 1X54A 5DNFA 1VQDA 3VYUA 4IOCA 1EIGA 3SE0A 2ICIA 2QDBA 1SNMA 1STHA 1B3QA 1Y1WG 2DJFC 5FLMH 1B3AA 1YHAA 3PUYA 1KDAA 4JBWA 3MA2B 1K0SA 4K6DA 4JCVE 4QB4A 2L4NA 4U68A 1TWFH 4QQBX 4WJWA 1UWVA 2UUAL 4IN3A 4JC0A 4M8AA 2G5DA 2NZOA 1ZYRC 3S2DB 3DUZA 1WTXA 1SE8A 1N32L 3MAQA 1EQTA 4K5WA 4C3IB 2VXWA 4ODGA 1BR9A 1EZ6A 2K01A 4NMZA 3W2DA 3KF6B 1PHJA 4DR2Q 3RLFA 4LF9Q 4ME5A 3S14H 1BBXC 2B2WC 3CF5A 1QUQA 4OHJA 3RZOB 2FMMA 3AFPA 1EOVA 4DV3L 1T5XD 1C7YA 2VL6A 3PIOA 2OTJA 3A5ZB 2ATWA 3BS1A 1PH5A 4DNIA 1DM0B 1E0BA 1EY9A 4JI5L 4XYOA 3C1FA 2K6AA 3QO2A 1EYCA 1SNDA 1Y1VG 1VQGA 2DY7A 4A3MB 1HHVA 3OPOA 3BU2A 2ICEC 1X3QA 2RDGA 3K59A 5CBEE 4G7ZC 2ZXOA 5C0XI 4A3FB 3GD7A 3UE1A 4YCWA 2AMCB 4IPHA 4KHPL 3PCOB 2ENBA 1H9KA 4O1NA 4S3SA 3OYYA 2OXPA 4K0KQ 1NR2A 4BBSH 2B29A 1LLRD 3PMFA 2Q8RE 5A2QE 4MN3A 2B3GA 1RIPA 1YITA 3DHQA 1AZPA 3L2PA 3GTJH 5KNDA 1N8RC 3LWUA 5FO7B 4FF4A 2Q8IB 1Z9FA 2JQOA 2J7ZA 2A1AA 4A3IB 1SEBD 1LV9A 3SK8A 2K4KA 4DV5Q 4GZYC 4PZ8A 4Y7NB 4IUQA 1D5MC 1XNQL 1DJRD 3MC0B 1I4HA 2L5TA 3T1HQ 1XMQQ 3GTPH 2JEAI 4EQNA 3K0YA 4OELB 4YHHL 1KDCA 4FF1A 1V1PB 2RSOA 1ENCA 1I6HB 1DD2A 4L5TA 2G9HD 1E2WA 2PYKA 4B3ML 4HIKA 4QF4A 4GN5A 2RSNA 1F77A 3S9WA 4KD3A 4EQ5A 2MPMA 2WB1E 2D2CC 3MEFA 3QOLA 3M4OB 4A3BB 2XWBB 3MHBA 2B2UA 2E76C 3ZYYX 5M5WB 4IFDG 1H9JA 1X3FA 2R61A 3J80c 1DYQA 2ZT9C 1XWEA 1UUPA 3LNNA 1VQOA 2OF1A 4C3HG 1Y8OB 4X65L 2UXDQ 1CKNB 2F0QA 2Q2IA 3X3NA 4DV4Q 1PH8A 3W5OA 4AQYL 5FK9C 4L6TB 3D8GA 2JEBI 3H09A 4XIGS 3U9OA 4DKAC 1YJ9A 2NYZD 2EYPA 1ZYRD 2OTLA 3S1MB 1VQ4A 5GROA 3M4QA 1WTVA 3RLNA 1IBLL 1KNEA 4C56C 2EDGA 3NEMA 3HOUB 4DK3C 4IUVA 1GJXA 3NXWA 2JXMB 5ELCA 2HIXA 2A6HD 4MZ9A 1GD7A 5LMUQ 1ILQA 3TP7A 2A6EC 1EU3A 2IX1A 3K5OA 2B39A 1TVXA 2L55A 3EQLC 1DOKA 1PTOF 2AWNA 4N8FA 2RF4A 3RZDH 1MJCA 1II3A 3A54A 3R2IA 5FJ8G 3CCSA 3BYYB 4NKLA 3OIQA 1AEXA 1K73C 1XX8A 5E3FA 1HZBA 4RMFA 3A8IE 3EROA 3EJIA 2JYOA 3WDNA 1SYGA 2B2YC 5J1ZA 2I5LX 1EFID 2R7ZH 5CV7A 1L0YB 4RGMA 2WAQB 2FHTA 2RDHA 1PVOA 4ULLA 2F03A 3U9SA 1U4PA 3RR5A 5IP9G 2E5LQ 2NVYB 2RHSB 4DV2L 2YTXA 1ZXTA 3NHHA 5M5XB 1VQFA 2PQAB 1JMCA 3G4SA 3T4AC 3TREA 2QGQA 3T16A 2VQEQ 4JI2L 3GTMH 4CBVA 1G91A 4KHVA 1IBKL 5DAUA 2VS1A 1Y1WH 3R93A 1YBYA 1O78A 1GVPA 2CQOA 1WJJA 2JA7B 1HR0Q 4J8QA 2HQLA 4A3EB 1PH4A 5E4WC 3URYA 4GOPA 1EZ8A 1MHWC 1HCZA 5JPNC 1CKOA 1EEFD 2WKCA 5COYA 3S1RB 2ES2A 1CZWA 3PO3G 1FNVA 5JVH3 2F0FA 1S5DD 1VQEA 1JR0D 1BBWA 3KLWA 2K28A 4QUFA 3H3VH 1Q46A 5BN4A 3GDEA 1XJVA 4PQXA 3HOYH 4MTNA 4LFBL 2KA7A 1TY0A 1YNNC 3S14B 3PO2G 3T56B 1EY6A 2Z4IA 4GN3B 1I3QH 2F0LA 1PXUA 3J7AV 5DLQE 4IJLA 1ET9A 1ICWA 1XPOA 3S15H 2VY3A 1Y1VH 2IY5B 4OO1I 1CA5A 1KXLA 2B2VC 5EPLA 5C0XG 2A6ED 1NR4A 1PLFA 3VR5A 4DV0L 5BN5A 4GLXA 1YI2A 5CMDA 5K36G 5T1IA 4LF6L 1GHKA 4UP8A 3GTLH 3CCRA 2MHVA 4FP5D 4DGZA 4RKLA 3E0EA 5G3LD 2WFWA 2YV5A 4AIMA 3GP7A 3K6OA 1EU4A 2B2TA 2OCEA 4L63B 5KEEA 3E5SA 1EYDA 2NZHA 3RD4A 1N33Q 1GUGA 3KLSX 2XWJB 2UUBL 1WCMB 1PZID 4R9WA 3K7AH 3X3MA 1ICFB 3OWEB 1Q8IA 3A7AB 1DOLA 4IPDA 4OX9Q 2L1BA 5C4ZA 3GTJB 1KNAA 4LMQD 2NVTH 1FGUA 1VQMA 1SLJA 5C4XG 3J81j 4JI1L 1NAPA 2F1MA 4AH6A 5EKIA 1PZKD 4POFA 1FNUA 1K3BC 1TWHB 5L37A 5I2YA 5GAEC 4FVMA 5BR8L 2PZTA 2KJXA 2MO0A 3KDFA 2F4VL 4LWCA 3GTPB 3SDZA 1W3SA 4FF2A 3S17B 1QE6A 3J81L 3HOVG 1YNXA 3OSOA 1TU2B 2CWPA 4B3TL 1BCPF 5FLXE 4DU9A 4LFCQ 2WB1G 1KLGD 1JQYD 1LT5D 4IFDH 3HKSA 5D65A 5CV4A 1WD0A 2JA5G 2IL8A 3NWSA 4X64L 2VZAA 4C3HH 4DAPA 4ALPA 3KUPA 1L2FA 4RGNA 4K8JA 2ZTDA 2NWGA 4J15A 3W1BA 2N3SA 1BUVT 1QUQB 1A0IA 1SNOA 2SNMA 4IO9A 2YTYA 4CDFC 3S16H 3CD6A 1L1OA 1HZAA 2H4OA 1PYSB 4LFAQ 4NB3A 1JORA 1X3EA 4GLVB 2RVLA 1VQIA 5J22A 2HCCA 1PFBA 3KBGA 2M00A 4GKKQ 1BQQT 3I4MG 3FPPA 4NPSA 4PG3A 3E6ZX 1X56A 2KCTA 1AZQA 1A2TA 2IX3A 2OT2A 1PDQA 1KAAA 1M4VA 4HCSA 5IY0A 1N9WA 1YNND 3K7UC 3I73A 1EYAA 3CCJA 2EJGC 4Q0FA 1EYGA 4CKCA 2ZM6L 3QG1A 5FJ8H 1YHQA 4A3DG 1E1OA 2A19A 2L9HA 3HKZE 2NB0A 1G291 3RMHA 2K75A 1BO0A 3RZDB 1S5FD 2Z9HA 1W2BA 1M1KC 4IQZA 3HOWG 1TIID 3L9AX 4FXGC 3BZKA 3K8AA 3PF4A 5DM73 2JA8G 1GM5A 1YZ6A 4I7AA 2D62A 3HP3A 1F9PA 1CQVA 1NJIC 1N36Q 4CDCC 4DAMA 4DUZQ 4DR5L 2JK8A 2C5CA 3H6MA 4OWXB 1BDOA 4JI6L 1B2TA 2DNEA 2K5WA 1WFQA 4MNOA 2CH4A 1XNRL 4UP7A 4DR7L 1JJGA 1FNWA 4JOIA 4A3IH 4DV1Q 3P7JA 4Y7NH 2EE1A 1NSNS 3MZ5A 1PTOH 3EN2A 4RCOA 5FKAC 3BDOA 2HT1A 2K32A 3JAML 3GTGH 2A8VA 2LKVA 2Z0SA 3Q23A 2UUCQ 1GKHA 1C0AA 1B50A 1VQLA 3R3OA 1BNZA 3FP9A 4K8IA 1HNZQ 2E2IB 1PYBA 4MIUA 1STNA 3JAMi 2NBFA 1Q7YC 4BY1G 3CAMA 1Y1WB 2EY2A 3N6RA 1PH6A 3GV3A 5IT9E 1E2ZA 3D4DA 1U4LA 4H02A 5M3FG 4KTAA 3NELA 1OXSC 1EQRA 1GUNA 2PQEA 4LF7Q 5LMNL 5IYCG 2UXCL 4DR1Q 1J5EL 1G6PA 4V0BA 1Z6HA 3CHBD 3S1MH 2PW7A 3E9HA 2IW3A 2RQXA 4K6LA 2TSSA 1BOSA 1TS3A 2AHOB 1YVCA 4IUUA 5G3LF 2E8GA 5IWAQ 1AE3A 3NE5B 4P72A 2AQ3B 1VQKA 2EVBA 2ZTEA 1LTRD 4QIWE 1IW7C 4ZCKA 3KJPA 1Y69U 2WIIB 3BYTB 4B9WA 1QZHA 1JICA 1LM0A 3TS0A 2NVXB 5KGUA 1TS4A 2VQFQ 1I3QB 5C0XH 3IAYA 1Q8KA 3K58A 4P74A 3BVMA 4DA2A 5KNBA 3S15B 1X55A 1Y1VB 5E4XA 5K36H 1HTPA 1P16A 4RH6A 4GKJQ 5M5YB 2AUKA 4Z9CB 2F0IA 1Q90A 1STBA 1DCZA 2CVRA 1EWIA 5EAYA 3GTKH 1PZJD 4ABNA 4DV6Q 1KC8C 3GTLB 2B2WA 3OMGA 1MD2D 3CU7A 1M90C 1NY4A 4C3JG 3P20A 3NWTA 3T1YQ 5KNCA 1PA6A 2GVAA 4LF8Q 3UI2A 3DM3A 3Q8DA 3K7AB 5C4XH 4N9PA 2CHBD 3SXHA 3A0JA 3W3AA 2QW7A 5M5XH 2KQ3A 2Q2UA 1VQNA 2F0EA 1E7ZA 2E74C 4DR3Q 3HOVH 3C2PA 3HOXG 4GOPB 2FXQA 1I4RA 4NXML 4A4IA 1JOKA 3BVZA 3H15A 2JA5H 2JA7H 2VB2X 4A3EH 1PRTC 1TKWB 1CHPD 1Y8PB 3D3RA 4X66Q 1ONLA 2JJQA 1LUZA 1U4MA 1VQ5A 3S1RH 2O2LD 2QF7A 3MXNA 1SE2A 4C3HB 4N9TA 4LF7L 1SYBA 1UAPA 4YY3L 1IBML 3VA5A 4LW1A 2X6GA 4KJNA 5CV6A 1JCKB 5A35A 3K57A 4DNTB 1W6KA 3S16B 1O7IA 1EQQA 1OXUA 3IKJA 2K33A 4KJOA 3I4MH 2ZTCA 1KRTA 1YJWA 3CCLA 1NCVA 2EQSA 1BKBA 5IWAL 4HIOA 4QL5A 4UAIA 5I9OA 2JSOA 4DN4M 5DEHA 3UE0A 1K8MA 3ER0A 3OW2A 1K83H 3KYHC 1C8CA 4BY7G 4R4QA 2BA0A 4GNXC 4JI4Q 4A3KG 5AJ3Q 3UDFA 2Y0SE 3TBIB 1QZGA 4A3DH 1IW7D 1H9RA 3PV0A 3TP8A 4B3SQ 3HKZG 1HNXQ 1A3UA 1CI3M 1V1QA 2UXBQ 3PUWA 5ISRA 1Z47A 1ET6A 3R8BA 3I70A 4PMCA 4WJ3M 2MFIA 4WRDA 4AYBE 1AN8A 5EJWA 1WCMH 5D14A 1IL2A 2HDLA 3EIVA 3S1QH 4JVZA 2BDOA 2EIFA 3SR1A 1YNJC 1KRSA 3ERQA 3DM1A 1RKNA 1CT1D 3KDFB 2LXJA 1GUOA 4C1NI 2QCPX 1RHPA 3EBEA 4R8IA 3VYSA 5JEAJ 3Q6SA 3TZDA 3GO5A 3VR6A 1TQOA 1NE3A 3MEHA 2VW9A 1TWHH 1Q1BA 4LK1C 3GV6A 1PTOB 3D6WA 3D31A 2NVQH 3GTGB 1N34Q 3S17H 2R7FA 3I90A 2E2HH 2H1EA 2JA6G 3GTQH 5HGQA 3TP6A 2B2YA 3TSSA 1VQ8A 3IRBA 4BY1H 1EOTA 2RDFA 1EWCA 2B63G 1HA5A 4RCNA 1VS0A 1TS5A 1XYIA 5I6WA 1L1OB 2D5DA 2BCOA 5JPMC 5M3FH 2F0KA 2SOBA 4HSVA 5M3MG 3ITPA 2C9OA 1PRTD 2O5IC 1JOQA 4LF4Q 4RWSC 1PMRA 4P75A 4EQPA 5IODA 3PO3B 4RA8A 5E7NA 1KQSA 1X3GA 1ZEQX 1VCIA 3D0FA 2CQAA 4HN7A 1CTMA 4H7BA 3SK5A 2CFMA 3U4ZA 1E3PA 3I56A 2HHHQ 2PNRC 3G71A 3IL8A 4DR2L 4HJAA 2BA1A 2PZWA 4QMGA 2IJ0A 2JE6I 3PIP3 4LF9L 5HY6A 4OO1H 3T13A 2RCNA 3HG9A 2QEJC 2N78A 3PO2B 1X65A 1H9SA 1G51A 4IJHA 1K8GA 4JI4L 4LNQA 5E1FA 1S3OA 5LHY1 1DOMA 3M85A 4B3RQ 1B9MA 2XRSD 1XPUA 4DF7A 1HZ9A 1RJTA 4POGA 1J8IA 1KLUD 2XRQD 1HQMC 2Q2TA 1K8OA 5I2XA 2PO4A 1OXTA 2FFKB 2R93G 4DFAA 3GTOH 3AU7A 4HSPA 1WTPA 4JI8Q 4XYQA 3GTKB 3PIO3 1A2UA 5IE8A 4K0KL 3ND9A 2QA4A 4E6IA 2AQ1B 2X6LA 3PGZA 2PMZE 2MP1A 2NTSA 2KCCA 3OTOQ 4ZUJA 1ASYA 1JOOA 3MXUA 5JEAG 1UEAB 1CHQD 2B2VA 3J80i 5IGEA 4U673 3A74A 4CGYB 5C4XB 4CJ0B 4NW2A 3KF8A 5JOBA 1HNWQ 1NMGA 4DV5L 3DWQA 3NSWA 4X3KA 5KIXA 4HIDA 4TSSA 4KD4A 2K50A 3T1HL 1XMQL 4OIKA 2QDLA 2F3WA 1SE3A 1E2VA 3VDYA 1C9OA 4ZUIA 2R92G 1SFOB 5KRUA 2E2IH 3S2HH 2AKWB 2V4DA 3AYHB 2V1CC 3HOVB 4A3CG 2B2UC 1PYWD 4JV5Q 4IPGA 2K05A 2WB1B 2EOTA 4R1JA 1XPRA 4KKUA 5FLXL 2JA5B 4F8MA 3DMUA 1EEID 5LL6X 2KHSA 2EY1A 3A55A 4QY7A 4A3LG 2WP8J 2L12A 4JYAQ 3OOCA 2NUCA 5EPJA 2UXDL 4QCLA 2ASBA 4R4CA 1I94Q 4DV4L 4JI3Q 1I4GA 4FNFA 1FD7D 1BVSA 2HHHL 3TZUA 2R7DA 2I07B 3H94A 3CCEA 3QWNA 3WWVA 2MUYA 3CMAA 1OXVA 4A3JG 1I4XA 3L3OC 2J0TD 3I4MB 1BCPB 2E75C 4BY7H 4A3KH 2NVXH 2IPKD 3H3VC 1HXYD 4CJ2C 1IZ6A 2Y0SG 3FMCA 1VDZA 3CXCA 5LMUL 1H95A 3HRZC 1U0LA 1A62A 1K83B 2PPBC 1GUWA 2MGSA 3TMEA 1RTNA 1TWCH 4A3DB 1BBUA 5M5YH 2UU9Q 3M4PA 4TRDA 2KEDA 1KDBA 2M2LA 1QJOA 1A63A 3V2TA 4BA1I 1D2BA 2EXZA 3J80E 1AH9A 4X62Q 5DM63 1CM9A 5GAGC 4AYBG 2JA8B 5ELDA 4HR7B 4UPAA 3J81c 1TWAB 2DNCA 3KF6A 3T53B 4BXXG 4DK6C 1SN8A 1S5BD 4CKBA 1WYDA 1D5ZC 3S1QB 2LMCB 4DR4Q 1QILA 4PV1C 1O7LA 1K8AC 3A8JE 3G7LA 1QVFA 1UEBA 1GHJA 3SGIA 3GQBA 1D6EC 2Z6KC 3RN2A 2E5LL 1DZ1A 1YJNA 1NUCA 4BBRG 1GUSA 3F1ZA 1I4QA 5I9PA 2NZ1D 4LJZC 2NVQB 3MXNB 5J3BA 4DR6Q 3M4YA 4IUTA 2F52A 2Z4HA 2VQEL 1DXMA 4B9XA 5CBAE 2E2HB 4PMWA 2A68C 4J6HA 3GTQB 1V1OA 1VQ9A 4X3TA 1T5EA 5IYBG 1XTCD 3PQIA 4BY1B 1Z7TA 5M3MH 5T1GA 5ELEA 4YCVA 3FRPB 5EQ0A 1HR0L 2ZXRA 3E9IA 2VUMG 5J39A 5M3FB 1F2MA 4I7ZC 4OONA 1IYUA 5IT9L 5AFWA 1IHZA 3HOZG 2EJMA 3R2TA 4XQNA 1SJED 1NMFA 2RKSA 2SDFA 3F2UA 1FJGQ 4K5VA 4TVAB 3F8TA 3S1NH 1HTLD 3O13A 5FLMG 2Q8TA 3CQZB 5C44G 1KHIA 1SNCA 4Y52H 1JE5A 4O0AA 1IYVA 3AMUA 5EBCA 1Q81C 1KTKA 3U58A 3RNUA 2PW5A 2JA9A 1VQBA 1UE5A 3G48A 1FVIA 2O5JC 1CK1A 1Y8NB 4A76A 1MSHA 1CUKA 1PH3A 3KK7A 5C3EG 2I5MX 2HUGA 2F0WA 3J7YW 4ZKBB 1Q3LA 5IYDG 2EY5A 4JW0A 4A75A 1J9OA 3N52A 3IFTA 3OWFA 3I4OA 2RA4A 3FHWA 3P1HA 5FO8B 4C2MB 1N33L 4DK0A 4C3JB 4WFN3 3GTOB 4FYDA 2RBMA 1QWYA 2RCFA 2XN9C 4IZ8A 2HDMA 1JJ2A 4DR4L 2D9UA 3U50C 5IP9H 4DUYQ 2FINB 1LACA 1BXTA 1EY0A 4DV7Q 2M9VA 4OX9L 1AE2A 3NBHA 4L5RC 4F87A 4KI0A 4WJ4A 1ILPA 4OGQC 4KKSA 1MBYA 3I91A 3EVQA 4JI0Q 2R92H 4CDEC 2K5DA 4DNRB 3K5NA 4DXGA 1VQJA 4L5QA 3HOXB 2XIWA 1Q86C 4BBSG 3CMEA 3RUZA 2ALYB 1U5KA 4LF5Q 4A3GG 2KBNA 2CKZB 3F2CA 1IXRA 1SJHD 1W6JA 3UDIA 1XMOQ 4NXNQ 3S2HB 4LFCL 2K03A 4OL7A 1D7QA 1JWSD 5D3DA 4X6AH 2A68D 1F2ZA 1VMCA 3NK9A 1F2LA 2F0NA 4A3LH 1TY2A 4ZLTF 4PZ7A 3SHLA 1ESFA 3PO3H 3VYTA 2KUMA 4JI7Q 4I65A 1WTRA 4KV6A 3K5LA 5JAVA 5GADC 1IYJB 5IGBA 1H9SB 2R3ZA 1MJEA 1B4OA 3EA6A 4ZK9B 3LGJA 4LFAL 1OTCA 1S5CD 2EJFC 4A3JH 2K1BA 2O4XA 1LTSD 1RL2A 4OEMB 5GQOA 3PO2H 2QEXA 4GKKL 2UUAQ 1HFNA 3H0GG 5CV5A 3I4NG 1YIJA 1YEZA 1NTGA 5IOCA 1JT8A 1HA6A 5EPKA 4R4IA 4XQQA 1N32Q 4BY7B 3A56A 3C3LA 4A3KB 1G2SA 3ND8A 1JWMD 2F3IA 2F0PA 5KYLA 4XDXA 4JBJA 3HKZB 2AWOA 2SNSA 2L11A 1HPCA 1TWCB 3CP0A 3L0OA 1LTLA 4HMJA 4TKOB 4DV3Q 4ZYSA 5CV9A 1KAWA 2RHQB 4JI5Q 3KF8B 1PV4A 5CV8A 4Q5VA 4BXXH 1EIFA 3PF5A 4HAEA 4BA2I 1A15A 1N36L 3CCMA 4DUZL 1FR3A 1B53A 2YU9H 4GNXA 1MSGA 2DJGC 3AQQA 4CDDC 2BOSA 1SE4A 5A2QL 2K52A 3BDLA 4DV1L 4BBRH 1QCBD 1O80A 1X32A 4P73A 4FXDA 1ML0D 2R6GA 5BN3A 5ELFA 1WOCA 4KHPQ 5JVG3 1CA6A 3FEWX 5FO9B 4JI0L 1B8AA 2D0PA 1S4ZA 2K5NA 1SFOH 2UUCL 2ZJQA 2D0OA 2Z1CA 2A74C 3CC2A 1I4PA 1SYDA 2JA6B 2R7ZG 3C46A 1ESRA 2IWHA 1V8QA 1F9RA 4A93G 4LF5L 1SRUA 1HNZL 1LTAD 2B63B 4CKEA 1MIUA 2CCZA 1JJCB 1U9RA 2EYJA 2NTTA 5EKLA 2TMPA 2VUMH 1CSQA 1XNQQ 1TWGH 5M3MB 4YHHQ 2JP1A 1D1IA 4QGUA 3B6YA 1HH2P 2K7VA 2NN6G 4DR1L 4B3MQ 4HJ7A 3CC7A 2F0DA 1TR5A 1E22A 3PIPA 5C44H 3RN5A 1KABA 3NBIA 1OXXK 4RKBA 4H44C 4IFDJ 1PH1A 1LABA 3ZJYC 3S1NB 4QIWB 4OWWB 4R4OA 3NTKA 1FYCA 4X65Q 3HFZB 1F9QA 3QIAA 1HQRD 3NTHA 2OEOA 5C3XA 5ELOA 1NBWA 4AQYQ 3P75A 1BCPC 4P71A 4JPBW 4UP9A 1NNXA 2GN5A 2VQFL 2E2DC 4R8NA 5JJLA 3V96A 2HQEA 5C3EH 1IBLQ 1SBBB 4V190 3HOWH 2A6HC 5IYDH 4GKJL 3KLRA 4HIMA 3HOYG 2JA8H 1A8VA 1TT2A 1TWAH 1YHBA 4GS3A 1SYCA 3BZCA 4BWGB 4DV6L 2R93B 1SSOA 3CRKC 4UY8C 2WACA 3MTSA 2F0HA 4FO2A 1C48A 4H13C 4ZKCB 3T1YL 1X9NA 4LF8L 2X69A 4IUPA 2F0OA 2G9DA 1R4PB 3ULJA 3BJUA 1GOZA 2IHFA 4C1NK 1QNUA 4HCEA 1TXYA 3WOEA 2F0JA 2N55A 3PUZA 3TN2A 4ID6A 2PZUA 4DXFA 3J7ZC 1RF2D 2K5QA 3QOJA 1VQCA 2C35B 4ME3A 5H1SE 2I0QA 4DR3L 1O7ZA 4NP5A 5IGGA 4A3GH 3K81C 2R92B 3ONAB 2N88A 4DAVA 4MHEA 3V05A 3M3YH 2WAQE 3I72A 2E2JB 1J6QA 1UNSA 2PI2E 3OMCA 4DV2Q 3M7GA 4RGTA 2DY8A 4X66L 4M1UB 4DAYA 5HURA 3TRZA 1SYFA 3KLSA 2AQ2B 4K14A 3QJYA 3FKIG 2VNUD 5IYCH 5IGDA 2XGTA 1S40A 4JI2Q 4LAAA 2LXKA 5TSSA 5NUCA 1RTOA 1IBKQ 4XQJA 3LWEA 1HR0W 4XT3B 4HJ8A 3OW7A 5IP7G 2F0GA 3CQZH 1AFPA 5CORA 3KOJA 4HEDA 3CW2C 5CGKA 5C4HA 3H0GH 3VR3A 3I4NH 5CYUA 1STGA 4A3JB 3FDTA 3MXPA 1IKLA 3J7A5 3ICEA 3NQTA 1D5XC 1SMYC 2FJ2A 2K5VA 2HCIA 4KHZA 3BG3A 1JB7A 2Y0SB 4K5XA 1WTQA 1PH9A 2XTIA 3PSIA 1OO9B 5AJ3L 1PH7A 4C3IG 4GN4B 1K9MC 4JBMA 4B3SL 1HNXL 1BCPD 3QB3A 4LFBQ 2UXBL 1AW7A 1LTID 4DK1A 3UDGA 3PUXA 1S72A 1A6XA 1ENFA 1QOHA 1K3RA 5C6AA 3NBHB 1HZCA 4AYBB 2SEBD 3EFXD 1DGSA 3J80L 1PFNA 4C2MH 1SDFA 1LT6D 4C3JH 1WTHA 2KHIA 3AFQA 1EIHA 1WVLA 2MJ8A 4G4KA 4DV0Q 1JWUD 5C0XJ 4A3MG 5FLXc 1SROA 5IGFA 4RG1A 4EGVA 4ZQ3A 2YU9B 4KY6A 4LF6Q 1HRJA 1YNJD 4RGOS 4A3FG 4RHRA 1R4QB 4LUVA 1U4RA 2EYMA 3SVMA 1HUMA 4JBKA 5IGCA 1D1KA 4BBRB 3NPPA 1CKMA 3I55A 4IALA 2OWOA 3HOXH 1BF4A 3ERSX 1N34L 3DXJC 2UUBQ 2KEEA 1JC7A 4A93H 2IT1A 3UDXA 1LYLA 4CJ1B 2CW0C 1LTGD 2Z8LA 3CPFA 3L7ZC 1SXTA 3MWYW 1QB5D 1WI5A 5M9OA 3CRLC 4A3IG 4XT1B 1I5FA 1RCVD 4JI1Q 1G2TA 1KL9A 3STBC 2VUMB 4KN7C 1TWGB 5BR8Q 2KENA 2Z6KA 1GXDC 2NN6H 2F4VQ 4KN4C 4UDUC 4LF4L 2LSSA 3HOZB 1PRTB 2BDNA 3E0JA 3PUVA 4B3TQ 2MO1A 4IPCA 1WTOA 5C4JH 1CZGA 1T9HA 3F2BA 1UE6A 3NP8A 5JJIA 1Q82C 4A3BG 3FVQA 4FDBA 4R4TA 1VQ7A 4LUOA 5LMNW 1G8ZD 4X64Q 5C44B 2EYLA 3VR4A 3OHXC 4YWMA 5I4DA 1STEA 3RLOA 1TWFB 4DPGA 1ENAA 2A5HA 2VB3X 4OXPA 2JN4A 4O2DA 1ASZA 1SMYD 4KK7A 2CWAA 2F4IA 1EY7A 3K5MA 1I6VC 4J1MA 3SK6A 4EVOA 4B3RL 1I50H 2ID0A 4EQOA 1B9NA 3I3CA 1PFMA 2FMCA 3JC66 5C3EB 4GNXB 4ZAIA 4L8JA 2OQ0A 3TEHB 4TQUS 2K04A 4FF3A 3HOUG 3HOWB 3G6JB 2EYOA 2F0SA 1X6OA 4YWKA 3I2ZA 4F7XA 3TDQA 4JI8L 2L0CA 3DLLA 2PMZB 1LTBD 5D3IB 1PFSA 2ZM6Q 3FPUB 3CKIB 5JJZA 4YIJA 5F2DA 1XXGA 1LT3D 3M9BA 3VYRA 2DGYA 2ZXPA 2B8FA 4ZRZA 3SK4A 1A3VA 3OTOL 1A3TA 4ILWA 3CCVA 4CHTB 2EYHA 2YTVA 3NTIA 1CSPA 1R9TH 2WV6D 2CH4W 2ZJPA 5IT9c 1PRTF 4G7HC 2HD3A 1DONA 1HNWL 1EWHA 1PH2A 1XTDA 1VF5C 4F88A 2HIVA 2YYZA 1JE4A 1FL0A 4DR5Q 2JA6H 3BDCA 1L0XB 3CC4A 4QUCA 2WAQG 4BBSB 4JI6Q 2EYFA 2B63H 3A8KE 4A3GB 1XNRQ 4DR7Q 5C5MA 2PNHA 4JV5L 3M3YB 4GOPC 2EXDA 2CW0D 4KKTA 2Q2HA 2Z6BA 1L0WA 2F0VA 2KECA 3FKIH 1EUJA 1MGSA 1E24A 2PCFB 3I4LA 4H0LC 1SR3A 2KHJA 1LT4D 3Q24A 5JJKA 3STBD 4JYAL 2LS01 2MNAA 3AEVA 5GAHC 1V9PA 4EX5A 1I94L 5IP7H 5HGTA 2H5XA 4PMBA 1H9MA 4JI3L 2NN6I 3HGBA 2I5HA 3A5UA 4APVA 1RD9D 1VQ6A 4OWTB 2JA7G 4JG2A 4YWLA 4A3EG 1G6ZA 5ELBA 1VQHA 1V1PA 3HEJA 3J81i 4B08A 1STYA 3H0GB 3S2DH 5LMNQ 3I4NB 2B8GA 1HFGA 1SMXA 2UXCQ 2XSCA 3KBXA 1J5EQ 4C3IH 1QVCA 1Y14B 1KIXA 3ULLA 4OIJA 1GO3E 3NQIA 4IUNA 2EY6A 2BE5C 2UU9L 3RZOH 3JAMc 3H91A 1F9SA 2B2TC 5C5LA 2KOLA 1V43A 1CKNA 3H3VI 4NDXA 2R93H 4X62L 3E3XA 4QJFA 3AB9A 5CR3A 3Q0AA 3HS0C 3MXGA 3TQYA 3U4VA 1UE7A 1WD1A 4A3MH 1SNPA 1EFWA 2OQKA 4WORA 4N8X1 1B1ZA 5JEAH 1HUNA 1WTWA 4A3FH 2IX0A 2J4XA 2KVMA 3K0XA 3KFUA 2P5ZX 3CCQA 2DUDA 2EZVA 1K28A 1Q1EA 1VMPA 2F0UA 1E1TA 4YCUA 2A69C 4RHSA 3VR2A 2A73B 3CPWA 5EGTA 1GUTA 4RAUC 4DAYB 5I6YA 1C4QA 4PZ6A 4RFBA 5IIFA 4A3CH 1UE1A 1B44D 1STAA 1WCMG 2KCNA 4DR6L 4P2CB 2E2JH 2KCMA 2QILA 1P8LA 4FXKC 2R7ZB 1PTOC 3I7FA 4A93B 3MFYA 1O7YA 1FGBD 1Q12A 4L5SA 1M8AA 4X3UA 3WOFA 5KYIA 4KMUC 3F2DA 3DEPA 4IOAA 1JB3A 3CCUA 5EKKA 3J81E 4KY5A 3TP5A 1I6HH 3D6CA 1L1OC 2LFNA 3S24A 1EQVA 3C1EA 2DN8A 4NXMQ 4IURA 2PI2A 3A7LA 1EY4A 2F0MA 2IHEA 4O42A 5C3WA 4KLKA 2WINB 5K5PA 4K2LA 3MVVA 3GTMB 3W1GA 2N49A 4A3BH 3M4OH 1FJGL 4PNYA 4G7OC 2LY7A 3TS2A 1SNQA 5M5WH 5C4JB 3BVGA 1CFMA 2PQAA 4GLAC 5EBDA 2AUJD 3DWPA 4MTKA 4HJ5A 2GVBA 1VQPA 4IFDI 4YY3Q 2MQHA 3HZXA 1IBMQ 4X3SA 4HTHA 5LL6S 4JK1C 1CQFA 1EY5A 1QVGA 2WKDA 1TS2A 3LX0A 3MFGA 1ZKOA 1K0RA 1D8LA 3D4RA 1RODA 2K14A 3VA7A 3HOUH 1QG7A 3D4WA 1I50B 1MI2A 1EL0A 2EPBA 3T51B 3HOYB 1IL8A 4LUZA 1LO5D 3NENA 3Q22A 2BE5D 2BH8A 4OO1G 3ULPA 4HMIA 4JOIC 4BS9A 1B7YB 1HJPA 4XTCS 1RDPD 1MKHA 3I8ZA 1VQAA 2F0TA 2F3VA 1IKMA 4DUYL 4DV7L 3DEOA 4K2KA 1SYEA 2GA4B 1R9TB 1EY8A 4XXEA 2XNAC 2L15A 3K80C 3SEBA 1VF7A 4KY7A 3G6EA 5CC4A 1B70B 3OIPA 3M7NA 2K5HA 2A69D 1EIYB 2QKIC 2N8NA 2ZJRA 3IFDA 3KJOA 3NUCA 5IYBH 2NVYH 3JAME 4HJ9A 1KD1C 4NXNL 4UHVA 2XVSA 1XMOL 1PTOD
chains in the Genus database with same CATH topology
1YZ6A 5IP7G 2D62A 3CQZH 1TWCH 3KOJA 1NJIC 1N36Q 3CW2C 4DAMA 4DUZQ 2JK8A 3H0GH 1BBUA 4DR5L 3I4NH 3HOZH 5M5YH 2UU9Q 3M4PA 4OWXB 1GM5A 4JI6L 1A63A 1WFQA 5ELNA 4MNOA 4BA1I 4JI7L 3ICEA 3J7A5 1XNRL 4UP7A 2K5VA 4DR7L 2BH2A 4JOIA 1AH9A 4KHZA 4A3IH 1X54A 4X62Q 4DV1Q 1JB7A 1VQDA 4Y7NH 5GAGC 4IOCA 1PH9A 4AYBG 2XTIA 3PSIA 3EN2A 2HT1A 4UPAA 5AJ3L 3GTGH 3J81c 1PH7A 2A8VA 4GN4B 1Y1WG 5FLMH 1K9MC 4JBMA 1YHAA 2Z0SA 3PUYA 3KF6A 4B3SL 4JBWA 2UUCQ 1HNXL 4BXXG 4JCVE 1GKHA 1C0AA 4DK6C 1SN8A 1TWFH 1WYDA 4QQBX 1VQLA 4LFBQ 1UWVA 2UXBL 4DR4Q 3UDGA 2UUAL 1K8AC 4JC0A 3PUXA 1S72A 3FP9A 2NZOA 1HNZQ 1UEBA 1QVFA 1PYBA 1K3RA 3SGIA 3NBHB 1HZCA 1SE8A 2Z6KC 3JAMi 3RN2A 1Q7YC 2E5LL 1N32L 1DGSA 4BY1G 1YJNA 3CAMA 4BBRG 4C2MH 4C3JH 3F1ZA 1PH6A 2KHIA 3AFQA 3KF6B 1PHJA 4DR2Q 4H02A 5M3FG 4DV0Q 3RLFA 4LF9Q 3MXNB 5J3BA 5C0XJ 3NELA 4A3MG 1OXSC 3S14H 4DR6Q 5FLXc 1EQRA 1SROA 2F52A 3CF5A 1QUQA 2VQEL 4RG1A 5LMNL 4LF7Q 3AFPA 5IYCG 2UXCL 4DR1Q 1EOVA 4PMWA 4LF6Q 4DV3L 4A3FG 2VL6A 3PIOA 1J5EL 1C7YA 1VQ9A 2OTJA 1G6PA 3A5ZB 4LUVA 5IYBG 4JBKA 2ATWA 1PH5A 4DNIA 3S1MH 4JI5L 5M3MH 1CKMA 3I55A 2OWOA 3E9HA 4YCVA 1HR0L 3HOXH 3E9IA 2VUMG 3ERSX 2AHOB 1N34L 1Y1VG 2UUBQ 1VQGA 4A93H 2IT1A 1YVCA 4OONA 2E8GA 3UDXA 1LYLA 3BU2A 5IWAQ 1AE3A 4P72A 3HOZG 1VQKA 3CPFA 5C0XI 3L7ZC 2ZTEA 3GD7A 4QIWE 1WI5A 3UE1A 3KJPA 1NMFA 4YCWA 1QZHA 2AMCB 3S15H 1LM0A 4IPHA 3TS0A 1FJGQ 4A3IG 4KHPL 1I5FA 3PCOB 4JI1Q 2VQFQ 4TVAB 1KL9A 3F8TA 3OYYA 3S1NH 1Q8KA 4K0KQ 3STBC 4P74A 4BBSH 2B29A 1X55A 5FLMG 5BR8Q 2KENA 1KHIA 5C44G 4Y52H 2Z6KA 1JE5A 4O0AA 2F4VQ 1P16A 2B3GA 4LF4L 1RIPA 2LSSA 1YITA 4GKJQ 3L2PA 1Q81C 3GTJH 3U58A 1N8RC 3RNUA 3PUVA 4B3TQ 2MO1A 4IPCA 5C4JH 2JA9A 1EWIA 5EAYA 1Z9FA 2JQOA 3GTKH 4DV6Q 1T9HA 2A1AA 1VQBA 3F2BA 1KC8C 4DV5Q 2K4KA 4PZ8A 1UE6A 1UE5A 3G48A 5JJIA 1FVIA 1XNQL 1Q82C 4A3BG 4FDBA 4R4TA 1M90C 1VQ7A 1NY4A 4LUOA 5LMNW 3T1HQ 1XMQQ 4A76A 4X64Q 2JEAI 3GTPH 4YHHL 3T1YQ 1PA6A 1CUKA 2GVAA 4LF8Q 1PH3A 3DM3A 5C3EG 2I5MX 4YWMA 3RLOA 3Q8DA 4L5TA 5C4XH 4DPGA 5IYDG 4B3ML 4HIKA 4GN5A 3A0JA 4OXPA 4A75A 4EQ5A 5M5XH 4O2DA 1ASZA 3I4OA 3FHWA 2WB1E 2CWAA 3MEFA 2Q2UA 1VQNA 4B3RL 1I50H 2ID0A 1N33L 4IFDG 1E7ZA 1X3FA 3J80c 3HOVH 4DR3Q 1JJ2A 3JC66 3HOXG 4GOPB 1VQOA 2FXQA 4GNXB 4DR4L 4NXML 3U50C 4DUYQ 5IP9H 2OQ0A 3TEHB 4TQUS 4X65L 4A4IA 3HOUG 2UXDQ 1CKNB 4DV7Q 4OX9L 2Q2IA 1AE2A 4DV4Q 1PH8A 4L5RC 4KI0A 4WJ4A 3W5OA 1X6OA 4AQYL 3H15A 2JA5H 4YWKA 2JEBI 3I2ZA 4XIGS 4DKAC 1YJ9A 2JA7H 4A3EH 4JI8L 4X66Q 3DLLA 4JI0Q 2OTLA 2R92H 2JJQA 1VQ4A 5GROA 1LUZA 3M4QA 3RLNA 1PFSA 2ZM6Q 1IBLL 1VQ5A 3S1RH 1VQJA 3NEMA 4L5QA 1Q86C 3M9BA 4BBSG 2DGYA 3CMEA 4LF7L 2ALYB 3OTOL 4YY3L 3CCVA 1U5KA 4DK3C 4LF5Q 2YTVA 2KBNA 1IBML 2CKZB 4A3GG 3F2CA 1CSPA 1IXRA 4LW1A 3UDIA 2HIXA 1XMOQ 4NXNQ 4LFCL 1R9TH 4MZ9A 2ZJPA 1GD7A 5IT9c 1D7QA 5LMUQ 1HNWL 1PH2A 2IX1A 4X6AH 1O7IA 1XTDA 2HIVA 1OXUA 2YYZA 1EQQA 1FL0A 4A3LH 4DR5Q 2JA6H 3I4MH 2ZTCA 4PZ7A 1KRTA 1YJWA 3CCLA 2AWNA 3CC4A 3RZDH 2RF4A 2EQSA 2WAQG 1MJCA 1BKBA 3PO3H 4JI6Q 2B63H 5IWAL 4HIOA 4JI7Q 5FJ8G 4QL5A 3CCSA 1XNRQ 4DR7Q 1K73C 5GADC 3UE0A 3ER0A 2PNHA 3OW2A 4JV5L 1IYJB 1K83H 3KYHC 1HZBA 4RMFA 4GOPC 4BY7G 4R4QA 2BA0A 2EXDA 4GNXC 1MJEA 4JI4Q 4A3KG 5AJ3Q 3UDFA 1L0WA 2Q2HA 2Y0SE 3LGJA 4LFAL 1QZGA 4A3DH 3FKIH 1OTCA 1EUJA 3PV0A 2I5LX 4B3SQ 3HKZG 4A3JH 1HNXQ 2R7ZH 1E24A 1V1QA 1SR3A 2KHJA 2UXBQ 1RL2A 4GKKL 5GQOA 3PO2H 2QEXA 1PVOA 2UUAQ 5JJKA 3PUWA 3H0GG 3STBD 4JYAL 2MNAA 1YIJA 1YEZA 3AEVA 1NTGA 1Z47A 3I4NG 1JT8A 5GAHC 1V9PA 4EX5A 1I94L 3RR5A 4R4IA 5IP9G 5IP7H 1N32Q 2E5LQ 2H5XA 4WJ3M 4JI3L 2RHSB 2JA8G 4DV2L 2MFIA 2NN6I 3A5UA 2I5HA 2YTXA 4AYBE 2F3IA 4APVA 1VQ6A 4OWTB 1WCMH 4JBJA 2JA7G 1VQFA 4JG2A 2PQAB 4YWLA 3EIVA 2AWOA 1IL2A 3S1QH 4A3EG 1JMCA 2EIFA 1VQHA 3G4SA 1KRSA 3CP0A 3J81i 3KDFB 3L0OA 1LTLA 2LXJA 3TREA 2QGQA 2VQEQ 4JI2L 5LMNQ 3EBEA 3S2DH 3GTMH 1SMXA 2UXCQ 1IBKL 4DV3Q 1J5EQ 4C3IH 2VS1A 5JEAJ 1QVCA 1Y14B 1Y1WH 1KIXA 1YBYA 3GO5A 3ULLA 1KAWA 2RHQB 4JI5Q 3KF8B 1PV4A 1NE3A 1GVPA 2CQOA 1TWHH 2VW9A 4BXXH 1EIFA 1Q1BA 3PF5A 1WJJA 1GO3E 3D31A 2NVQH 1HR0Q 4BA2I 2HQLA 1N36L 1PH4A 3CCMA 1N34Q 4DUZL 3S17H 3RZOH 2UU9L 2R7FA 3JAMc 4GOPA 2YU9H 2E2HH 4GNXA 2JA6G 3GTQH 1CKOA 5HGQA 2ES2A 1V43A 3AQQA 1CKNA 3H3VI 1VQ8A 3IRBA 3PO3G 4BY1H 2R93H 2K52A 4X62L 4DV1L 4BBRH 2B63G 4P73A 4QJFA 2R6GA 1VS0A 1VQEA 1WOCA 1L1OB 4KHPQ 1BBWA 3TQYA 3U4VA 3KLWA 5M3FH 3H3VH 1UE7A 1Q46A 4JI0L 1B8AA 2D0PA 4A3MH 2K5NA 5M3MG 3GDEA 1SFOH 1EFWA 2D0OA 1XJVA 2UUCL 2OQKA 2ZJQA 3CC2A 3HOYH 4MTNA 4LFBL 2R7ZG 4A3FH 4LF4Q 2IX0A 4P75A 4A93G 4LF5L 3K0XA 3KFUA 1SRUA 1HNZL 1KQSA 5E7NA 3PO2G 1H95A 1X3GA 1MIUA 1VCIA 3CCQA 2CCZA 3D0FA 1JJCB 2DUDA 1I3QH 4GN3B 1Q1EA 5DLQE 4IJLA 1XPOA 2CFMA 1E1TA 4YCUA 2VY3A 3U4ZA 2VUMH 1CSQA 1Y1VH 1E3PA 1TWGH 3I56A 3CPWA 1XNQQ 4OO1I 2IY5B 2HHHQ 1KXLA 4DAYB 3G71A 4PZ6A 4DR2L 4HJAA 4YHHQ 5C0XG 4A3CH 2BA1A 1UE1A 4DV0L 1WCMG 2JE6I 4GLXA 1YI2A 4LF9L 4QGUA 4DR6L 2E2JH 3B6YA 2KCMA 5HY6A 1P8LA 1HH2P 2RCNA 3I7FA 5K36G 2N78A 2NN6G 4DR1L 1Q12A 4LF6L 1X65A 4UP8A 4B3MQ 4HJ7A 3CC7A 4L5SA 3CCRA 3GTLH 1G51A 4IJHA 1E22A 1K8GA 3E0EA 3F2DA 4JI4L 4LNQA 2WFWA 2YV5A 3PIPA 4AIMA 2OCEA 1S3OA 5C44H 4IOAA 3RN5A 1OXXK 2NZHA 3CCUA 3M85A 4B3RQ 1N33Q 1I6HH 1XPUA 1PH1A 2UUBL 3ZJYC 4IFDJ 1L1OC 1HZ9A 3K7AH 3S24A 4POGA 4NXMQ 4OWWB 2PI2A 4R4OA 4X65Q 2IHEA 3HFZB 2Q2TA 4IPDA 4KLKA 4OX9Q 5ELOA 1NBWA 1OXTA 3W1GA 4AQYQ 2N49A 4A3BH 3M4OH 2NVTH 1FGUA 1VQMA 1SLJA 4P71A 1FJGL 2R93G 3TS2A 4UP9A 5C4XG 5M5WH 3GTOH 2GN5A 3J81j 4JI1L 2VQFL 4JI8Q 4AH6A 4POFA 5IE8A 2PQAA 4GLAC 4K0KL 5JJLA 2QA4A 5C3EH 3PGZA 1IBLQ 5GAEC 5BR8L 2PMZE 4HJ5A 2MO0A 3KDFA 2F4VL 3HOWH 4LWCA 5IYDH 2GVBA 1W3SA 1VQPA 3OTOQ 4IFDI 4YY3Q 4GKJL 1ASYA 3HOVG 4HIMA 3HOYG 1YNXA 2MQHA 5JEAG 1IBMQ 2JA8H 2CWPA 1A8VA 4B3TL 1TWAH 1YHBA 3J80i 4GS3A 4LFCQ 3A74A 1QVGA 2WB1G 3BZCA 4DV6L 1HNWQ 1NMGA 4DV5L 3HKSA 1JJGA 4UY8C 4HIDA 1K0RA 2JA5G 1D8LA 2K50A 3T1HL 1XMQL 4X64L 2VZAA 4C3HH 4ALPA 1L2FA 3T1YL 2K14A 3HOUH 3VDYA 1C9OA 1X9NA 2R92G 4LF8L 2ZTDA 2E2IH 3S2HH 4J15A 2AKWB 3W1BA 3AYHB 2V1CC 2N3SA 1QUQB 4A3CG 1A0IA 4LUZA 3BJUA 3ULJA 3NENA 2IHFA 4IO9A 2YTYA 2BH8A 3S16H 4IPGA 4JV5Q 4OO1G 3CD6A 1TXYA 1L1OA 3PUZA 4R1JA 1HZAA 3ULPA 1XPRA 1PYSB 4LFAQ 4NB3A 3J7ZC 1X3EA 4JOIC 4GLVB 1VQIA 1B7YB 1HJPA 1VQCA 4XTCS 2C35B 4ME3A 5H1SE 2I0QA 4DR3L 1MKHA 4A3GH 3K81C 4QY7A 4GKKQ 4A3LG 2WP8J 1VQAA 3I4MG 4DUYL 4NPSA 4JYAQ 4PG3A 3M3YH 2WAQE 2UXDL 1X56A 2KCTA 4DV7L 2ASBA 4R4CA 1J6QA 1I94Q 4DV4L 2PI2E 4JI3Q 5IY0A 4DV2Q 1N9WA 3CCJA 3K7UC 1BVSA 3K80C 2L15A 1EYGA 4X66L 2HHHL 3TRZA 2R7DA 3G6EA 3CCEA 2ZM6L 3WWVA 4HJ8A 3CMAA 1B70B 5FJ8H 1YHQA 3FKIG 3M7NA 2K5HA 4A3DG 2VNUD 5IYCH 1E1OA 2A19A 3HKZE 1EIYB 1OXVA 2N8NA 2ZJRA 4A3JG 3KJOA 1G291 2XGTA 1S40A 4JI2Q 2LXKA 2K75A 5IYBH 4BY7H 2NVYH 1W2BA 1M1KC 1IBKQ 4HJ9A 4A3KH 3HOWG 1KD1C 2NVXH 4NXNL 1IZ6A 2Y0SG 3BZKA 1XMOL 3K8AA 1HR0W 3PF4A 3CXCA 5LMUL 1U0LA 1A62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ6 A;  5IP7 G;  2D62 A;  3CQZ H;  1TWC H;  3KOJ A;  1NJI C;  1N36 Q;  3CW2 C;  4DAM A;  4DUZ Q;  2JK8 A;  3H0G H;  1BBU A;  4DR5 L;  3I4N H;  3HOZ H;  5M5Y H;  2UU9 Q;  3M4P A;  4OWX B;  1GM5 A;  4JI6 L;  1A63 A;  1WFQ A;  5ELN A;  4MNO A;  4BA1 I;  4JI7 L;  3ICE A;  3J7A 5;  1XNR L;  4UP7 A;  2K5V A;  4DR7 L;  2BH2 A;  4JOI A;  1AH9 A;  4KHZ A;  4A3I H;  1X54 A;  4X62 Q;  4DV1 Q;  1JB7 A;  1VQD A;  4Y7N H;  5GAG C;  4IOC A;  1PH9 A;  4AYB G;  2XTI A;  3PSI A;  3EN2 A;  2HT1 A;  4UPA A;  5AJ3 L;  3GTG H;  3J81 c;  1PH7 A;  2A8V A;  4GN4 B;  1Y1W G;  5FLM H;  1K9M C;  4JBM A;  1YHA A;  2Z0S A;  3PUY A;  3KF6 A;  4B3S L;  4JBW A;  2UUC Q;  1HNX L;  4BXX G;  4JCV E;  1GKH A;  1C0A A;  4DK6 C;  1SN8 A;  1TWF H;  1WYD A;  4QQB X;  1VQL A;  4LFB Q;  1UWV A;  2UXB L;  4DR4 Q;  3UDG A;  2UUA L;  1K8A C;  4JC0 A;  3PUX A;  1S72 A;  3FP9 A;  2NZO A;  1HNZ Q;  1UEB A;  1QVF A;  1PYB A;  1K3R A;  3SGI A;  3NBH B;  1HZC A;  1SE8 A;  2Z6K C;  3JAM i;  3RN2 A;  1Q7Y C;  2E5L L;  1N32 L;  1DGS A;  4BY1 G;  1YJN A;  3CAM A;  4BBR G;  4C2M H;  4C3J H;  3F1Z A;  1PH6 A;  2KHI A;  3AFQ A;  3KF6 B;  1PHJ A;  4DR2 Q;  4H02 A;  5M3F G;  4DV0 Q;  3RLF A;  4LF9 Q;  3MXN B;  5J3B A;  5C0X J;  3NEL A;  4A3M G;  1OXS C;  3S14 H;  4DR6 Q;  5FLX c;  1EQR A;  1SRO A;  2F52 A;  3CF5 A;  1QUQ A;  2VQE L;  4RG1 A;  5LMN L;  4LF7 Q;  3AFP A;  5IYC G;  2UXC L;  4DR1 Q;  1EOV A;  4PMW A;  4LF6 Q;  4DV3 L;  4A3F G;  2VL6 A;  3PIO A;  1J5E L;  1C7Y A;  1VQ9 A;  2OTJ A;  1G6P A;  3A5Z B;  4LUV A;  5IYB G;  4JBK A;  2ATW A;  1PH5 A;  4DNI A;  3S1M H;  4JI5 L;  5M3M H;  1CKM A;  3I55 A;  2OWO A;  3E9H A;  4YCV A;  1HR0 L;  3HOX H;  3E9I A;  2VUM G;  3ERS X;  2AHO B;  1N34 L;  1Y1V G;  2UUB Q;  1VQG A;  4A93 H;  2IT1 A;  1YVC A;  4OON A;  2E8G A;  3UDX A;  1LYL A;  3BU2 A;  5IWA Q;  1AE3 A;  4P72 A;  3HOZ G;  1VQK A;  3CPF A;  5C0X I;  3L7Z C;  2ZTE A;  3GD7 A;  4QIW E;  1WI5 A;  3UE1 A;  3KJP A;  1NMF A;  4YCW A;  1QZH A;  2AMC B;  3S15 H;  1LM0 A;  4IPH A;  3TS0 A;  1FJG Q;  4A3I G;  4KHP L;  1I5F A;  3PCO B;  4JI1 Q;  2VQF Q;  4TVA B;  1KL9 A;  3F8T A;  3OYY A;  3S1N H;  1Q8K A;  4K0K Q;  3STB C;  4P74 A;  4BBS H;  2B29 A;  1X55 A;  5FLM G;  5BR8 Q;  2KEN A;  1KHI A;  5C44 G;  4Y52 H;  2Z6K A;  1JE5 A;  4O0A A;  2F4V Q;  1P16 A;  2B3G A;  4LF4 L;  1RIP A;  2LSS A;  1YIT A;  4GKJ Q;  3L2P A;  1Q81 C;  3GTJ H;  3U58 A;  1N8R C;  3RNU A;  3PUV A;  4B3T Q;  2MO1 A;  4IPC A;  5C4J H;  2JA9 A;  1EWI A;  5EAY A;  1Z9F A;  2JQO A;  3GTK H;  4DV6 Q;  1T9H A;  2A1A A;  1VQB A;  3F2B A;  1KC8 C;  4DV5 Q;  2K4K A;  4PZ8 A;  1UE6 A;  1UE5 A;  3G48 A;  5JJI A;  1FVI A;  1XNQ L;  1Q82 C;  4A3B G;  4FDB A;  4R4T A;  1M90 C;  1VQ7 A;  1NY4 A;  4LUO A;  5LMN W;  3T1H Q;  1XMQ Q;  4A76 A;  4X64 Q;  2JEA I;  3GTP H;  4YHH L;  3T1Y Q;  1PA6 A;  1CUK A;  2GVA A;  4LF8 Q;  1PH3 A;  3DM3 A;  5C3E G;  2I5M X;  4YWM A;  3RLO A;  3Q8D A;  4L5T A;  5C4X H;  4DPG A;  5IYD G;  4B3M L;  4HIK A;  4GN5 A;  3A0J A;  4OXP A;  4A75 A;  4EQ5 A;  5M5X H;  4O2D A;  1ASZ A;  3I4O A;  3FHW A;  2WB1 E;  2CWA A;  3MEF A;  2Q2U A;  1VQN A;  4B3R L;  1I50 H;  2ID0 A;  1N33 L;  4IFD G;  1E7Z A;  1X3F A;  3J80 c;  3HOV H;  4DR3 Q;  1JJ2 A;  3JC6 6;  3HOX G;  4GOP B;  1VQO A;  2FXQ A;  4GNX B;  4DR4 L;  4NXM L;  3U50 C;  4DUY Q;  5IP9 H;  2OQ0 A;  3TEH B;  4TQU S;  4X65 L;  4A4I A;  3HOU G;  2UXD Q;  1CKN B;  4DV7 Q;  4OX9 L;  2Q2I A;  1AE2 A;  4DV4 Q;  1PH8 A;  4L5R C;  4KI0 A;  4WJ4 A;  3W5O A;  1X6O A;  4AQY L;  3H15 A;  2JA5 H;  4YWK A;  2JEB I;  3I2Z A;  4XIG S;  4DKA C;  1YJ9 A;  2JA7 H;  4A3E H;  4JI8 L;  4X66 Q;  3DLL A;  4JI0 Q;  2OTL A;  2R92 H;  2JJQ A;  1VQ4 A;  5GRO A;  1LUZ A;  3M4Q A;  3RLN A;  1PFS A;  2ZM6 Q;  1IBL L;  1VQ5 A;  3S1R H;  1VQJ A;  3NEM A;  4L5Q A;  1Q86 C;  3M9B A;  4BBS G;  2DGY A;  3CME A;  4LF7 L;  2ALY B;  3OTO L;  4YY3 L;  3CCV A;  1U5K A;  4DK3 C;  4LF5 Q;  2YTV A;  2KBN A;  1IBM L;  2CKZ B;  4A3G G;  3F2C A;  1CSP A;  1IXR A;  4LW1 A;  3UDI A;  2HIX A;  1XMO Q;  4NXN Q;  4LFC L;  1R9T H;  4MZ9 A;  2ZJP A;  1GD7 A;  5IT9 c;  1D7Q A;  5LMU Q;  1HNW L;  1PH2 A;  2IX1 A;  4X6A H;  1O7I A;  1XTD A;  2HIV A;  1OXU A;  2YYZ A;  1EQQ A;  1FL0 A;  4A3L H;  4DR5 Q;  2JA6 H;  3I4M H;  2ZTC A;  4PZ7 A;  1KRT A;  1YJW A;  3CCL A;  2AWN A;  3CC4 A;  3RZD H;  2RF4 A;  2EQS A;  2WAQ G;  1MJC A;  1BKB A;  3PO3 H;  4JI6 Q;  2B63 H;  5IWA L;  4HIO A;  4JI7 Q;  5FJ8 G;  4QL5 A;  3CCS A;  1XNR Q;  4DR7 Q;  1K73 C;  5GAD C;  3UE0 A;  3ER0 A;  2PNH A;  3OW2 A;  4JV5 L;  1IYJ B;  1K83 H;  3KYH C;  1HZB A;  4RMF A;  4GOP C;  4BY7 G;  4R4Q A;  2BA0 A;  2EXD A;  4GNX C;  1MJE A;  4JI4 Q;  4A3K G;  5AJ3 Q;  3UDF A;  1L0W A;  2Q2H A;  2Y0S E;  3LGJ A;  4LFA L;  1QZG A;  4A3D H;  3FKI H;  1OTC A;  1EUJ A;  3PV0 A;  2I5L X;  4B3S Q;  3HKZ G;  4A3J H;  1HNX Q;  2R7Z H;  1E24 A;  1V1Q A;  1SR3 A;  2KHJ A;  2UXB Q;  1RL2 A;  4GKK L;  5GQO A;  3PO2 H;  2QEX A;  1PVO A;  2UUA Q;  5JJK A;  3PUW A;  3H0G G;  3STB D;  4JYA L;  2MNA A;  1YIJ A;  1YEZ A;  3AEV A;  1NTG A;  1Z47 A;  3I4N G;  1JT8 A;  5GAH C;  1V9P A;  4EX5 A;  1I94 L;  3RR5 A;  4R4I A;  5IP9 G;  5IP7 H;  1N32 Q;  2E5L Q;  2H5X A;  4WJ3 M;  4JI3 L;  2RHS B;  2JA8 G;  4DV2 L;  2MFI A;  2NN6 I;  3A5U A;  2I5H A;  2YTX A;  4AYB E;  2F3I A;  4APV A;  1VQ6 A;  4OWT B;  1WCM H;  4JBJ A;  2JA7 G;  1VQF A;  4JG2 A;  2PQA B;  4YWL A;  3EIV A;  2AWO A;  1IL2 A;  3S1Q H;  4A3E G;  1JMC A;  2EIF A;  1VQH A;  3G4S A;  1KRS A;  3CP0 A;  3J81 i;  3KDF B;  3L0O A;  1LTL A;  2LXJ A;  3TRE A;  2QGQ A;  2VQE Q;  4JI2 L;  5LMN Q;  3EBE A;  3S2D H;  3GTM H;  1SMX A;  2UXC Q;  1IBK L;  4DV3 Q;  1J5E Q;  4C3I H;  2VS1 A;  5JEA J;  1QVC A;  1Y14 B;  1Y1W H;  1KIX A;  1YBY A;  3GO5 A;  3ULL A;  1KAW A;  2RHQ B;  4JI5 Q;  3KF8 B;  1PV4 A;  1NE3 A;  1GVP A;  2CQO A;  1TWH H;  2VW9 A;  4BXX H;  1EIF A;  1Q1B A;  3PF5 A;  1WJJ A;  1GO3 E;  3D31 A;  2NVQ H;  1HR0 Q;  4BA2 I;  2HQL A;  1N36 L;  1PH4 A;  3CCM A;  1N34 Q;  4DUZ L;  3S17 H;  3RZO H;  2UU9 L;  2R7F A;  3JAM c;  4GOP A;  2YU9 H;  2E2H H;  4GNX A;  2JA6 G;  3GTQ H;  1CKO A;  5HGQ A;  2ES2 A;  1V43 A;  3AQQ A;  1CKN A;  3H3V I;  1VQ8 A;  3IRB A;  3PO3 G;  4BY1 H;  2R93 H;  2K52 A;  4X62 L;  4DV1 L;  4BBR H;  2B63 G;  4P73 A;  4QJF A;  2R6G A;  1VS0 A;  1VQE A;  1WOC A;  1L1O B;  4KHP Q;  1BBW A;  3TQY A;  3U4V A;  3KLW A;  5M3F H;  3H3V H;  1UE7 A;  1Q46 A;  4JI0 L;  1B8A A;  2D0P A;  4A3M H;  2K5N A;  5M3M G;  3GDE A;  1SFO H;  1EFW A;  2D0O A;  1XJV A;  2UUC L;  2OQK A;  2ZJQ A;  3CC2 A;  3HOY H;  4MTN A;  4LFB L;  2R7Z G;  4A3F H;  4LF4 Q;  2IX0 A;  4P75 A;  4A93 G;  4LF5 L;  3K0X A;  3KFU A;  1SRU A;  1HNZ L;  1KQS A;  5E7N A;  3PO2 G;  1H95 A;  1X3G A;  1MIU A;  1VCI A;  3CCQ A;  2CCZ A;  3D0F A;  1JJC B;  2DUD A;  1I3Q H;  4GN3 B;  1Q1E A;  5DLQ E;  4IJL A;  1XPO A;  2CFM A;  1E1T A;  4YCU A;  2VY3 A;  3U4Z A;  2VUM H;  1CSQ A;  1Y1V H;  1E3P A;  1TWG H;  3I56 A;  3CPW A;  1XNQ Q;  4OO1 I;  2IY5 B;  2HHH Q;  1KXL A;  4DAY B;  3G71 A;  4PZ6 A;  4DR2 L;  4HJA A;  4YHH Q;  5C0X G;  4A3C H;  2BA1 A;  1UE1 A;  4DV0 L;  1WCM G;  2JE6 I;  4GLX A;  1YI2 A;  4LF9 L;  4QGU A;  4DR6 L;  2E2J H;  3B6Y A;  2KCM A;  5HY6 A;  1P8L A;  1HH2 P;  2RCN A;  3I7F A;  5K36 G;  2N78 A;  2NN6 G;  4DR1 L;  1Q12 A;  4LF6 L;  1X65 A;  4UP8 A;  4B3M Q;  4HJ7 A;  3CC7 A;  4L5S A;  3CCR A;  3GTL H;  1G51 A;  4IJH A;  1E22 A;  1K8G A;  3E0E A;  3F2D A;  4JI4 L;  4LNQ A;  2WFW A;  2YV5 A;  3PIP A;  4AIM A;  2OCE A;  1S3O A;  5C44 H;  4IOA A;  3RN5 A;  1OXX K;  2NZH A;  3CCU A;  3M85 A;  4B3R Q;  1N33 Q;  1I6H H;  1XPU A;  1PH1 A;  2UUB L;  3ZJY C;  4IFD J;  1L1O C;  1HZ9 A;  3K7A H;  3S24 A;  4POG A;  4NXM Q;  4OWW B;  2PI2 A;  4R4O A;  4X65 Q;  2IHE A;  3HFZ B;  2Q2T A;  4IPD A;  4KLK A;  4OX9 Q;  5ELO A;  1NBW A;  1OXT A;  3W1G A;  4AQY Q;  2N49 A;  4A3B H;  3M4O H;  2NVT H;  1FGU A;  1VQM A;  1SLJ A;  4P71 A;  1FJG L;  2R93 G;  3TS2 A;  4UP9 A;  5C4X G;  5M5W H;  3GTO H;  2GN5 A;  3J81 j;  4JI1 L;  2VQF L;  4JI8 Q;  4AH6 A;  4POF A;  5IE8 A;  2PQA A;  4GLA C;  4K0K L;  5JJL A;  2QA4 A;  5C3E H;  3PGZ A;  1IBL Q;  5GAE C;  5BR8 L;  2PMZ E;  4HJ5 A;  2MO0 A;  3KDF A;  2F4V L;  3HOW H;  4LWC A;  5IYD H;  2GVB A;  1W3S A;  1VQP A;  3OTO Q;  4IFD I;  4YY3 Q;  4GKJ L;  1ASY A;  3HOV G;  4HIM A;  3HOY G;  1YNX A;  2MQH A;  5JEA G;  1IBM Q;  2JA8 H;  2CWP A;  1A8V A;  4B3T L;  1TWA H;  1YHB A;  3J80 i;  4GS3 A;  4LFC Q;  3A74 A;  1QVG A;  2WB1 G;  3BZC A;  4DV6 L;  1HNW Q;  1NMG A;  4DV5 L;  3HKS A;  1JJG A;  4UY8 C;  4HID A;  1K0R A;  2JA5 G;  1D8L A;  2K50 A;  3T1H L;  1XMQ L;  4X64 L;  2VZA A;  4C3H H;  4ALP A;  1L2F A;  3T1Y L;  2K14 A;  3HOU H;  3VDY A;  1C9O A;  1X9N A;  2R92 G;  4LF8 L;  2ZTD A;  2E2I H;  3S2H H;  4J15 A;  2AKW B;  3W1B A;  3AYH B;  2V1C C;  2N3S A;  1QUQ B;  4A3C G;  1A0I A;  4LUZ A;  3BJU A;  3ULJ A;  3NEN A;  2IHF A;  4IO9 A;  2YTY A;  2BH8 A;  3S16 H;  4IPG A;  4JV5 Q;  4OO1 G;  3CD6 A;  1TXY A;  1L1O A;  3PUZ A;  4R1J A;  1HZA A;  3ULP A;  1XPR A;  1PYS B;  4LFA Q;  4NB3 A;  3J7Z C;  1X3E A;  4JOI C;  4GLV B;  1VQI A;  1B7Y B;  1HJP A;  1VQC A;  4XTC S;  2C35 B;  4ME3 A;  5H1S E;  2I0Q A;  4DR3 L;  1MKH A;  4A3G H;  3K81 C;  4QY7 A;  4GKK Q;  4A3L G;  2WP8 J;  1VQA A;  3I4M G;  4DUY L;  4NPS A;  4JYA Q;  4PG3 A;  3M3Y H;  2WAQ E;  2UXD L;  1X56 A;  2KCT A;  4DV7 L;  2ASB A;  4R4C A;  1J6Q A;  1I94 Q;  4DV4 L;  2PI2 E;  4JI3 Q;  5IY0 A;  4DV2 Q;  1N9W A;  3CCJ A;  3K7U C;  1BVS A;  3K80 C;  2L15 A;  1EYG A;  4X66 L;  2HHH L;  3TRZ A;  2R7D A;  3G6E A;  3CCE A;  2ZM6 L;  3WWV A;  4HJ8 A;  3CMA A;  1B70 B;  5FJ8 H;  1YHQ A;  3FKI G;  3M7N A;  2K5H A;  4A3D G;  2VNU D;  5IYC H;  1E1O A;  2A19 A;  3HKZ E;  1EIY B;  1OXV A;  2N8N A;  2ZJR A;  4A3J G;  3KJO A;  1G29 1;  2XGT A;  1S40 A;  4JI2 Q;  2LXK A;  2K75 A;  5IYB H;  4BY7 H;  2NVY H;  1W2B A;  1M1K C;  1IBK Q;  4HJ9 A;  4A3K H;  3HOW G;  1KD1 C;  2NVX H;  4NXN L;  1IZ6 A;  2Y0S G;  3BZK A;  1XMO L;  3K8A A;  1HR0 W;  3PF4 A;  3CXC A;  5LMU L;  1U0L A;  1A62 A; 
#chains in the Genus database with same CATH topology
 2NVT B;  1F2Y A;  1X3P A;  1AP0 A;  1QNK A;  1S5E D;  2I46 A;  4G57 A;  3DWA A;  3FKI B;  3HOZ H;  1LTT D;  3QR8 A;  1SAP A;  5ELN A;  4JI7 L;  3BZD B;  5FOB B;  2BH2 A;  3J7A F;  1X54 A;  5DNF A;  1VQD A;  3VYU A;  4IOC A;  1EIG A;  3SE0 A;  2ICI A;  2QDB A;  1SNM A;  1STH A;  1B3Q A;  1Y1W G;  2DJF C;  5FLM H;  1B3A A;  1YHA A;  3PUY A;  1KDA A;  4JBW A;  3MA2 B;  1K0S A;  4K6D A;  4JCV E;  4QB4 A;  2L4N A;  4U68 A;  1TWF H;  4QQB X;  4WJW A;  1UWV A;  2UUA L;  4IN3 A;  4JC0 A;  4M8A A;  2G5D A;  2NZO A;  1ZYR C;  3S2D B;  3DUZ A;  1WTX A;  1SE8 A;  1N32 L;  3MAQ A;  1EQT A;  4K5W A;  4C3I B;  2VXW A;  4ODG A;  1BR9 A;  1EZ6 A;  2K01 A;  4NMZ A;  3W2D A;  3KF6 B;  1PHJ A;  4DR2 Q;  3RLF A;  4LF9 Q;  4ME5 A;  3S14 H;  1BBX C;  2B2W C;  3CF5 A;  1QUQ A;  4OHJ A;  3RZO B;  2FMM A;  3AFP A;  1EOV A;  4DV3 L;  1T5X D;  1C7Y A;  2VL6 A;  3PIO A;  2OTJ A;  3A5Z B;  2ATW A;  3BS1 A;  1PH5 A;  4DNI A;  1DM0 B;  1E0B A;  1EY9 A;  4JI5 L;  4XYO A;  3C1F A;  2K6A A;  3QO2 A;  1EYC A;  1SND A;  1Y1V G;  1VQG A;  2DY7 A;  4A3M B;  1HHV A;  3OPO A;  3BU2 A;  2ICE C;  1X3Q A;  2RDG A;  3K59 A;  5CBE E;  4G7Z C;  2ZXO A;  5C0X I;  4A3F B;  3GD7 A;  3UE1 A;  4YCW A;  2AMC B;  4IPH A;  4KHP L;  3PCO B;  2ENB A;  1H9K A;  4O1N A;  4S3S A;  3OYY A;  2OXP A;  4K0K Q;  1NR2 A;  4BBS H;  2B29 A;  1LLR D;  3PMF A;  2Q8R E;  5A2Q E;  4MN3 A;  2B3G A;  1RIP A;  1YIT A;  3DHQ A;  1AZP A;  3L2P A;  3GTJ H;  5KND A;  1N8R C;  3LWU A;  5FO7 B;  4FF4 A;  2Q8I B;  1Z9F A;  2JQO A;  2J7Z A;  2A1A A;  4A3I B;  1SEB D;  1LV9 A;  3SK8 A;  2K4K A;  4DV5 Q;  4GZY C;  4PZ8 A;  4Y7N B;  4IUQ A;  1D5M C;  1XNQ L;  1DJR D;  3MC0 B;  1I4H A;  2L5T A;  3T1H Q;  1XMQ Q;  3GTP H;  2JEA I;  4EQN A;  3K0Y A;  4OEL B;  4YHH L;  1KDC A;  4FF1 A;  1V1P B;  2RSO A;  1ENC A;  1I6H B;  1DD2 A;  4L5T A;  2G9H D;  1E2W A;  2PYK A;  4B3M L;  4HIK A;  4QF4 A;  4GN5 A;  2RSN A;  1F77 A;  3S9W A;  4KD3 A;  4EQ5 A;  2MPM A;  2WB1 E;  2D2C C;  3MEF A;  3QOL A;  3M4O B;  4A3B B;  2XWB B;  3MHB A;  2B2U A;  2E76 C;  3ZYY X;  5M5W B;  4IFD G;  1H9J A;  1X3F A;  2R61 A;  3J80 c;  1DYQ A;  2ZT9 C;  1XWE A;  1UUP A;  3LNN A;  1VQO A;  2OF1 A;  4C3H G;  1Y8O B;  4X65 L;  2UXD Q;  1CKN B;  2F0Q A;  2Q2I A;  3X3N A;  4DV4 Q;  1PH8 A;  3W5O A;  4AQY L;  5FK9 C;  4L6T B;  3D8G A;  2JEB I;  3H09 A;  4XIG S;  3U9O A;  4DKA C;  1YJ9 A;  2NYZ D;  2EYP A;  1ZYR D;  2OTL A;  3S1M B;  1VQ4 A;  5GRO A;  3M4Q A;  1WTV A;  3RLN A;  1IBL L;  1KNE A;  4C56 C;  2EDG A;  3NEM A;  3HOU B;  4DK3 C;  4IUV A;  1GJX A;  3NXW A;  2JXM B;  5ELC A;  2HIX A;  2A6H D;  4MZ9 A;  1GD7 A;  5LMU Q;  1ILQ A;  3TP7 A;  2A6E C;  1EU3 A;  2IX1 A;  3K5O A;  2B39 A;  1TVX A;  2L55 A;  3EQL C;  1DOK A;  1PTO F;  2AWN A;  4N8F A;  2RF4 A;  3RZD H;  1MJC A;  1II3 A;  3A54 A;  3R2I A;  5FJ8 G;  3CCS A;  3BYY B;  4NKL A;  3OIQ A;  1AEX A;  1K73 C;  1XX8 A;  5E3F A;  1HZB A;  4RMF A;  3A8I E;  3ERO A;  3EJI A;  2JYO A;  3WDN A;  1SYG A;  2B2Y C;  5J1Z A;  2I5L X;  1EFI D;  2R7Z H;  5CV7 A;  1L0Y B;  4RGM A;  2WAQ B;  2FHT A;  2RDH A;  1PVO A;  4ULL A;  2F03 A;  3U9S A;  1U4P A;  3RR5 A;  5IP9 G;  2E5L Q;  2NVY B;  2RHS B;  4DV2 L;  2YTX A;  1ZXT A;  3NHH A;  5M5X B;  1VQF A;  2PQA B;  1JMC A;  3G4S A;  3T4A C;  3TRE A;  2QGQ A;  3T16 A;  2VQE Q;  4JI2 L;  3GTM H;  4CBV A;  1G91 A;  4KHV A;  1IBK L;  5DAU A;  2VS1 A;  1Y1W H;  3R93 A;  1YBY A;  1O78 A;  1GVP A;  2CQO A;  1WJJ A;  2JA7 B;  1HR0 Q;  4J8Q A;  2HQL A;  4A3E B;  1PH4 A;  5E4W C;  3URY A;  4GOP A;  1EZ8 A;  1MHW C;  1HCZ A;  5JPN C;  1CKO A;  1EEF D;  2WKC A;  5COY A;  3S1R B;  2ES2 A;  1CZW A;  3PO3 G;  1FNV A;  5JVH 3;  2F0F A;  1S5D D;  1VQE A;  1JR0 D;  1BBW A;  3KLW A;  2K28 A;  4QUF A;  3H3V H;  1Q46 A;  5BN4 A;  3GDE A;  1XJV A;  4PQX A;  3HOY H;  4MTN A;  4LFB L;  2KA7 A;  1TY0 A;  1YNN C;  3S14 B;  3PO2 G;  3T56 B;  1EY6 A;  2Z4I A;  4GN3 B;  1I3Q H;  2F0L A;  1PXU A;  3J7A V;  5DLQ E;  4IJL A;  1ET9 A;  1ICW A;  1XPO A;  3S15 H;  2VY3 A;  1Y1V H;  2IY5 B;  4OO1 I;  1CA5 A;  1KXL A;  2B2V C;  5EPL A;  5C0X G;  2A6E D;  1NR4 A;  1PLF A;  3VR5 A;  4DV0 L;  5BN5 A;  4GLX A;  1YI2 A;  5CMD A;  5K36 G;  5T1I A;  4LF6 L;  1GHK A;  4UP8 A;  3GTL H;  3CCR A;  2MHV A;  4FP5 D;  4DGZ A;  4RKL A;  3E0E A;  5G3L D;  2WFW A;  2YV5 A;  4AIM A;  3GP7 A;  3K6O A;  1EU4 A;  2B2T A;  2OCE A;  4L63 B;  5KEE A;  3E5S A;  1EYD A;  2NZH A;  3RD4 A;  1N33 Q;  1GUG A;  3KLS X;  2XWJ B;  2UUB L;  1WCM B;  1PZI D;  4R9W A;  3K7A H;  3X3M A;  1ICF B;  3OWE B;  1Q8I A;  3A7A B;  1DOL A;  4IPD A;  4OX9 Q;  2L1B A;  5C4Z A;  3GTJ B;  1KNA A;  4LMQ D;  2NVT H;  1FGU A;  1VQM A;  1SLJ A;  5C4X G;  3J81 j;  4JI1 L;  1NAP A;  2F1M A;  4AH6 A;  5EKI A;  1PZK D;  4POF A;  1FNU A;  1K3B C;  1TWH B;  5L37 A;  5I2Y A;  5GAE C;  4FVM A;  5BR8 L;  2PZT A;  2KJX A;  2MO0 A;  3KDF A;  2F4V L;  4LWC A;  3GTP B;  3SDZ A;  1W3S A;  4FF2 A;  3S17 B;  1QE6 A;  3J81 L;  3HOV G;  1YNX A;  3OSO A;  1TU2 B;  2CWP A;  4B3T L;  1BCP F;  5FLX E;  4DU9 A;  4LFC Q;  2WB1 G;  1KLG D;  1JQY D;  1LT5 D;  4IFD H;  3HKS A;  5D65 A;  5CV4 A;  1WD0 A;  2JA5 G;  2IL8 A;  3NWS A;  4X64 L;  2VZA A;  4C3H H;  4DAP A;  4ALP A;  3KUP A;  1L2F A;  4RGN A;  4K8J A;  2ZTD A;  2NWG A;  4J15 A;  3W1B A;  2N3S A;  1BUV T;  1QUQ B;  1A0I A;  1SNO A;  2SNM A;  4IO9 A;  2YTY A;  4CDF C;  3S16 H;  3CD6 A;  1L1O A;  1HZA A;  2H4O A;  1PYS B;  4LFA Q;  4NB3 A;  1JOR A;  1X3E A;  4GLV B;  2RVL A;  1VQI A;  5J22 A;  2HCC A;  1PFB A;  3KBG A;  2M00 A;  4GKK Q;  1BQQ T;  3I4M G;  3FPP A;  4NPS A;  4PG3 A;  3E6Z X;  1X56 A;  2KCT A;  1AZQ A;  1A2T A;  2IX3 A;  2OT2 A;  1PDQ A;  1KAA A;  1M4V A;  4HCS A;  5IY0 A;  1N9W A;  1YNN D;  3K7U C;  3I73 A;  1EYA A;  3CCJ A;  2EJG C;  4Q0F A;  1EYG A;  4CKC A;  2ZM6 L;  3QG1 A;  5FJ8 H;  1YHQ A;  4A3D G;  1E1O A;  2A19 A;  2L9H A;  3HKZ E;  2NB0 A;  1G29 1;  3RMH A;  2K75 A;  1BO0 A;  3RZD B;  1S5F D;  2Z9H A;  1W2B A;  1M1K C;  4IQZ A;  3HOW G;  1TII D;  3L9A X;  4FXG C;  3BZK A;  3K8A A;  3PF4 A;  5DM7 3;  2JA8 G;  1GM5 A;  1YZ6 A;  4I7A A;  2D62 A;  3HP3 A;  1F9P A;  1CQV A;  1NJI C;  1N36 Q;  4CDC C;  4DAM A;  4DUZ Q;  4DR5 L;  2JK8 A;  2C5C A;  3H6M A;  4OWX B;  1BDO A;  4JI6 L;  1B2T A;  2DNE A;  2K5W A;  1WFQ A;  4MNO A;  2CH4 A;  1XNR L;  4UP7 A;  4DR7 L;  1JJG A;  1FNW A;  4JOI A;  4A3I H;  4DV1 Q;  3P7J A;  4Y7N H;  2EE1 A;  1NSN S;  3MZ5 A;  1PTO H;  3EN2 A;  4RCO A;  5FKA C;  3BDO A;  2HT1 A;  2K32 A;  3JAM L;  3GTG H;  2A8V A;  2LKV A;  2Z0S A;  3Q23 A;  2UUC Q;  1GKH A;  1C0A A;  1B50 A;  1VQL A;  3R3O A;  1BNZ A;  3FP9 A;  4K8I A;  1HNZ Q;  2E2I B;  1PYB A;  4MIU A;  1STN A;  3JAM i;  2NBF A;  1Q7Y C;  4BY1 G;  3CAM A;  1Y1W B;  2EY2 A;  3N6R A;  1PH6 A;  3GV3 A;  5IT9 E;  1E2Z A;  3D4D A;  1U4L A;  4H02 A;  5M3F G;  4KTA A;  3NEL A;  1OXS C;  1EQR A;  1GUN A;  2PQE A;  4LF7 Q;  5LMN L;  5IYC G;  2UXC L;  4DR1 Q;  1J5E L;  1G6P A;  4V0B A;  1Z6H A;  3CHB D;  3S1M H;  2PW7 A;  3E9H A;  2IW3 A;  2RQX A;  4K6L A;  2TSS A;  1BOS A;  1TS3 A;  2AHO B;  1YVC A;  4IUU A;  5G3L F;  2E8G A;  5IWA Q;  1AE3 A;  3NE5 B;  4P72 A;  2AQ3 B;  1VQK A;  2EVB A;  2ZTE A;  1LTR D;  4QIW E;  1IW7 C;  4ZCK A;  3KJP A;  1Y69 U;  2WII B;  3BYT B;  4B9W A;  1QZH A;  1JIC A;  1LM0 A;  3TS0 A;  2NVX B;  5KGU A;  1TS4 A;  2VQF Q;  1I3Q B;  5C0X H;  3IAY A;  1Q8K A;  3K58 A;  4P74 A;  3BVM A;  4DA2 A;  5KNB A;  3S15 B;  1X55 A;  1Y1V B;  5E4X A;  5K36 H;  1HTP A;  1P16 A;  4RH6 A;  4GKJ Q;  5M5Y B;  2AUK A;  4Z9C B;  2F0I A;  1Q90 A;  1STB A;  1DCZ A;  2CVR A;  1EWI A;  5EAY A;  3GTK H;  1PZJ D;  4ABN A;  4DV6 Q;  1KC8 C;  3GTL B;  2B2W A;  3OMG A;  1MD2 D;  3CU7 A;  1M90 C;  1NY4 A;  4C3J G;  3P20 A;  3NWT A;  3T1Y Q;  5KNC A;  1PA6 A;  2GVA A;  4LF8 Q;  3UI2 A;  3DM3 A;  3Q8D A;  3K7A B;  5C4X H;  4N9P A;  2CHB D;  3SXH A;  3A0J A;  3W3A A;  2QW7 A;  5M5X H;  2KQ3 A;  2Q2U A;  1VQN A;  2F0E A;  1E7Z A;  2E74 C;  4DR3 Q;  3HOV H;  3C2P A;  3HOX G;  4GOP B;  2FXQ A;  1I4R A;  4NXM L;  4A4I A;  1JOK A;  3BVZ A;  3H15 A;  2JA5 H;  2JA7 H;  2VB2 X;  4A3E H;  1PRT C;  1TKW B;  1CHP D;  1Y8P B;  3D3R A;  4X66 Q;  1ONL A;  2JJQ A;  1LUZ A;  1U4M A;  1VQ5 A;  3S1R H;  2O2L D;  2QF7 A;  3MXN A;  1SE2 A;  4C3H B;  4N9T A;  4LF7 L;  1SYB A;  1UAP A;  4YY3 L;  1IBM L;  3VA5 A;  4LW1 A;  2X6G A;  4KJN A;  5CV6 A;  1JCK B;  5A35 A;  3K57 A;  4DNT B;  1W6K A;  3S16 B;  1O7I A;  1EQQ A;  1OXU A;  3IKJ A;  2K33 A;  4KJO A;  3I4M H;  2ZTC A;  1KRT A;  1YJW A;  3CCL A;  1NCV A;  2EQS A;  1BKB A;  5IWA L;  4HIO A;  4QL5 A;  4UAI A;  5I9O A;  2JSO A;  4DN4 M;  5DEH A;  3UE0 A;  1K8M A;  3ER0 A;  3OW2 A;  1K83 H;  3KYH C;  1C8C A;  4BY7 G;  4R4Q A;  2BA0 A;  4GNX C;  4JI4 Q;  4A3K G;  5AJ3 Q;  3UDF A;  2Y0S E;  3TBI B;  1QZG A;  4A3D H;  1IW7 D;  1H9R A;  3PV0 A;  3TP8 A;  4B3S Q;  3HKZ G;  1HNX Q;  1A3U A;  1CI3 M;  1V1Q A;  2UXB Q;  3PUW A;  5ISR A;  1Z47 A;  1ET6 A;  3R8B A;  3I70 A;  4PMC A;  4WJ3 M;  2MFI A;  4WRD A;  4AYB E;  1AN8 A;  5EJW A;  1WCM H;  5D14 A;  1IL2 A;  2HDL A;  3EIV A;  3S1Q H;  4JVZ A;  2BDO A;  2EIF A;  3SR1 A;  1YNJ C;  1KRS A;  3ERQ A;  3DM1 A;  1RKN A;  1CT1 D;  3KDF B;  2LXJ A;  1GUO A;  4C1N I;  2QCP X;  1RHP A;  3EBE A;  4R8I A;  3VYS A;  5JEA J;  3Q6S A;  3TZD A;  3GO5 A;  3VR6 A;  1TQO A;  1NE3 A;  3MEH A;  2VW9 A;  1TWH H;  1Q1B A;  4LK1 C;  3GV6 A;  1PTO B;  3D6W A;  3D31 A;  2NVQ H;  3GTG B;  1N34 Q;  3S17 H;  2R7F A;  3I90 A;  2E2H H;  2H1E A;  2JA6 G;  3GTQ H;  5HGQ A;  3TP6 A;  2B2Y A;  3TSS A;  1VQ8 A;  3IRB A;  4BY1 H;  1EOT A;  2RDF A;  1EWC A;  2B63 G;  1HA5 A;  4RCN A;  1VS0 A;  1TS5 A;  1XYI A;  5I6W A;  1L1O B;  2D5D A;  2BCO A;  5JPM C;  5M3F H;  2F0K A;  2SOB A;  4HSV A;  5M3M G;  3ITP A;  2C9O A;  1PRT D;  2O5I C;  1JOQ A;  4LF4 Q;  4RWS C;  1PMR A;  4P75 A;  4EQP A;  5IOD A;  3PO3 B;  4RA8 A;  5E7N A;  1KQS A;  1X3G A;  1ZEQ X;  1VCI A;  3D0F A;  2CQA A;  4HN7 A;  1CTM A;  4H7B A;  3SK5 A;  2CFM A;  3U4Z A;  1E3P A;  3I56 A;  2HHH Q;  2PNR C;  3G71 A;  3IL8 A;  4DR2 L;  4HJA A;  2BA1 A;  2PZW A;  4QMG A;  2IJ0 A;  2JE6 I;  3PIP 3;  4LF9 L;  5HY6 A;  4OO1 H;  3T13 A;  2RCN A;  3HG9 A;  2QEJ C;  2N78 A;  3PO2 B;  1X65 A;  1H9S A;  1G51 A;  4IJH A;  1K8G A;  4JI4 L;  4LNQ A;  5E1F A;  1S3O A;  5LHY 1;  1DOM A;  3M85 A;  4B3R Q;  1B9M A;  2XRS D;  1XPU A;  4DF7 A;  1HZ9 A;  1RJT A;  4POG A;  1J8I A;  1KLU D;  2XRQ D;  1HQM C;  2Q2T A;  1K8O A;  5I2X A;  2PO4 A;  1OXT A;  2FFK B;  2R93 G;  4DFA A;  3GTO H;  3AU7 A;  4HSP A;  1WTP A;  4JI8 Q;  4XYQ A;  3GTK B;  3PIO 3;  1A2U A;  5IE8 A;  4K0K L;  3ND9 A;  2QA4 A;  4E6I A;  2AQ1 B;  2X6L A;  3PGZ A;  2PMZ E;  2MP1 A;  2NTS A;  2KCC A;  3OTO Q;  4ZUJ A;  1ASY A;  1JOO A;  3MXU A;  5JEA G;  1UEA B;  1CHQ D;  2B2V A;  3J80 i;  5IGE A;  4U67 3;  3A74 A;  4CGY B;  5C4X B;  4CJ0 B;  4NW2 A;  3KF8 A;  5JOB A;  1HNW Q;  1NMG A;  4DV5 L;  3DWQ A;  3NSW A;  4X3K A;  5KIX A;  4HID A;  4TSS A;  4KD4 A;  2K50 A;  3T1H L;  1XMQ L;  4OIK A;  2QDL A;  2F3W A;  1SE3 A;  1E2V A;  3VDY A;  1C9O A;  4ZUI A;  2R92 G;  1SFO B;  5KRU A;  2E2I H;  3S2H H;  2AKW B;  2V4D A;  3AYH B;  2V1C C;  3HOV B;  4A3C G;  2B2U C;  1PYW D;  4JV5 Q;  4IPG A;  2K05 A;  2WB1 B;  2EOT A;  4R1J A;  1XPR A;  4KKU A;  5FLX L;  2JA5 B;  4F8M A;  3DMU A;  1EEI D;  5LL6 X;  2KHS A;  2EY1 A;  3A55 A;  4QY7 A;  4A3L G;  2WP8 J;  2L12 A;  4JYA Q;  3OOC A;  2NUC A;  5EPJ A;  2UXD L;  4QCL A;  2ASB A;  4R4C A;  1I94 Q;  4DV4 L;  4JI3 Q;  1I4G A;  4FNF A;  1FD7 D;  1BVS A;  2HHH L;  3TZU A;  2R7D A;  2I07 B;  3H94 A;  3CCE A;  3QWN A;  3WWV A;  2MUY A;  3CMA A;  1OXV A;  4A3J G;  1I4X A;  3L3O C;  2J0T D;  3I4M B;  1BCP B;  2E75 C;  4BY7 H;  4A3K H;  2NVX H;  2IPK D;  3H3V C;  1HXY D;  4CJ2 C;  1IZ6 A;  2Y0S G;  3FMC A;  1VDZ A;  3CXC A;  5LMU L;  1H95 A;  3HRZ C;  1U0L A;  1A62 A;  1K83 B;  2PPB C;  1GUW A;  2MGS A;  3TME A;  1RTN A;  1TWC H;  4A3D B;  1BBU A;  5M5Y H;  2UU9 Q;  3M4P A;  4TRD A;  2KED A;  1KDB A;  2M2L A;  1QJO A;  1A63 A;  3V2T A;  4BA1 I;  1D2B A;  2EXZ A;  3J80 E;  1AH9 A;  4X62 Q;  5DM6 3;  1CM9 A;  5GAG C;  4AYB G;  2JA8 B;  5ELD A;  4HR7 B;  4UPA A;  3J81 c;  1TWA B;  2DNC A;  3KF6 A;  3T53 B;  4BXX G;  4DK6 C;  1SN8 A;  1S5B D;  4CKB A;  1WYD A;  1D5Z C;  3S1Q B;  2LMC B;  4DR4 Q;  1QIL A;  4PV1 C;  1O7L A;  1K8A C;  3A8J E;  3G7L A;  1QVF A;  1UEB A;  1GHJ A;  3SGI A;  3GQB A;  1D6E C;  2Z6K C;  3RN2 A;  2E5L L;  1DZ1 A;  1YJN A;  1NUC A;  4BBR G;  1GUS A;  3F1Z A;  1I4Q A;  5I9P A;  2NZ1 D;  4LJZ C;  2NVQ B;  3MXN B;  5J3B A;  4DR6 Q;  3M4Y A;  4IUT A;  2F52 A;  2Z4H A;  2VQE L;  1DXM A;  4B9X A;  5CBA E;  2E2H B;  4PMW A;  2A68 C;  4J6H A;  3GTQ B;  1V1O A;  1VQ9 A;  4X3T A;  1T5E A;  5IYB G;  1XTC D;  3PQI A;  4BY1 B;  1Z7T A;  5M3M H;  5T1G A;  5ELE A;  4YCV A;  3FRP B;  5EQ0 A;  1HR0 L;  2ZXR A;  3E9I A;  2VUM G;  5J39 A;  5M3F B;  1F2M A;  4I7Z C;  4OON A;  1IYU A;  5IT9 L;  5AFW A;  1IHZ A;  3HOZ G;  2EJM A;  3R2T A;  4XQN A;  1SJE D;  1NMF A;  2RKS A;  2SDF A;  3F2U A;  1FJG Q;  4K5V A;  4TVA B;  3F8T A;  3S1N H;  1HTL D;  3O13 A;  5FLM G;  2Q8T A;  3CQZ B;  5C44 G;  1KHI A;  1SNC A;  4Y52 H;  1JE5 A;  4O0A A;  1IYV A;  3AMU A;  5EBC A;  1Q81 C;  1KTK A;  3U58 A;  3RNU A;  2PW5 A;  2JA9 A;  1VQB A;  1UE5 A;  3G48 A;  1FVI A;  2O5J C;  1CK1 A;  1Y8N B;  4A76 A;  1MSH A;  1CUK A;  1PH3 A;  3KK7 A;  5C3E G;  2I5M X;  2HUG A;  2F0W A;  3J7Y W;  4ZKB B;  1Q3L A;  5IYD G;  2EY5 A;  4JW0 A;  4A75 A;  1J9O A;  3N52 A;  3IFT A;  3OWF A;  3I4O A;  2RA4 A;  3FHW A;  3P1H A;  5FO8 B;  4C2M B;  1N33 L;  4DK0 A;  4C3J B;  4WFN 3;  3GTO B;  4FYD A;  2RBM A;  1QWY A;  2RCF A;  2XN9 C;  4IZ8 A;  2HDM A;  1JJ2 A;  4DR4 L;  2D9U A;  3U50 C;  5IP9 H;  4DUY Q;  2FIN B;  1LAC A;  1BXT A;  1EY0 A;  4DV7 Q;  2M9V A;  4OX9 L;  1AE2 A;  3NBH A;  4L5R C;  4F87 A;  4KI0 A;  4WJ4 A;  1ILP A;  4OGQ C;  4KKS A;  1MBY A;  3I91 A;  3EVQ A;  4JI0 Q;  2R92 H;  4CDE C;  2K5D A;  4DNR B;  3K5N A;  4DXG A;  1VQJ A;  4L5Q A;  3HOX B;  2XIW A;  1Q86 C;  4BBS G;  3CME A;  3RUZ A;  2ALY B;  1U5K A;  4LF5 Q;  4A3G G;  2KBN A;  2CKZ B;  3F2C A;  1IXR A;  1SJH D;  1W6J A;  3UDI A;  1XMO Q;  4NXN Q;  3S2H B;  4LFC L;  2K03 A;  4OL7 A;  1D7Q A;  1JWS D;  5D3D A;  4X6A H;  2A68 D;  1F2Z A;  1VMC A;  3NK9 A;  1F2L A;  2F0N A;  4A3L H;  1TY2 A;  4ZLT F;  4PZ7 A;  3SHL A;  1ESF A;  3PO3 H;  3VYT A;  2KUM A;  4JI7 Q;  4I65 A;  1WTR A;  4KV6 A;  3K5L A;  5JAV A;  5GAD C;  1IYJ B;  5IGB A;  1H9S B;  2R3Z A;  1MJE A;  1B4O A;  3EA6 A;  4ZK9 B;  3LGJ A;  4LFA L;  1OTC A;  1S5C D;  2EJF C;  4A3J H;  2K1B A;  2O4X A;  1LTS D;  1RL2 A;  4OEM B;  5GQO A;  3PO2 H;  2QEX A;  4GKK L;  2UUA Q;  1HFN A;  3H0G G;  5CV5 A;  3I4N G;  1YIJ A;  1YEZ A;  1NTG A;  5IOC A;  1JT8 A;  1HA6 A;  5EPK A;  4R4I A;  4XQQ A;  1N32 Q;  4BY7 B;  3A56 A;  3C3L A;  4A3K B;  1G2S A;  3ND8 A;  1JWM D;  2F3I A;  2F0P A;  5KYL A;  4XDX A;  4JBJ A;  3HKZ B;  2AWO A;  2SNS A;  2L11 A;  1HPC A;  1TWC B;  3CP0 A;  3L0O A;  1LTL A;  4HMJ A;  4TKO B;  4DV3 Q;  4ZYS A;  5CV9 A;  1KAW A;  2RHQ B;  4JI5 Q;  3KF8 B;  1PV4 A;  5CV8 A;  4Q5V A;  4BXX H;  1EIF A;  3PF5 A;  4HAE A;  4BA2 I;  1A15 A;  1N36 L;  3CCM A;  4DUZ L;  1FR3 A;  1B53 A;  2YU9 H;  4GNX A;  1MSG A;  2DJG C;  3AQQ A;  4CDD C;  2BOS A;  1SE4 A;  5A2Q L;  2K52 A;  3BDL A;  4DV1 L;  4BBR H;  1QCB D;  1O80 A;  1X32 A;  4P73 A;  4FXD A;  1ML0 D;  2R6G A;  5BN3 A;  5ELF A;  1WOC A;  4KHP Q;  5JVG 3;  1CA6 A;  3FEW X;  5FO9 B;  4JI0 L;  1B8A A;  2D0P A;  1S4Z A;  2K5N A;  1SFO H;  2UUC L;  2ZJQ A;  2D0O A;  2Z1C A;  2A74 C;  3CC2 A;  1I4P A;  1SYD A;  2JA6 B;  2R7Z G;  3C46 A;  1ESR A;  2IWH A;  1V8Q A;  1F9R A;  4A93 G;  4LF5 L;  1SRU A;  1HNZ L;  1LTA D;  2B63 B;  4CKE A;  1MIU A;  2CCZ A;  1JJC B;  1U9R A;  2EYJ A;  2NTT A;  5EKL A;  2TMP A;  2VUM H;  1CSQ A;  1XNQ Q;  1TWG H;  5M3M B;  4YHH Q;  2JP1 A;  1D1I A;  4QGU A;  3B6Y A;  1HH2 P;  2K7V A;  2NN6 G;  4DR1 L;  4B3M Q;  4HJ7 A;  3CC7 A;  2F0D A;  1TR5 A;  1E22 A;  3PIP A;  5C44 H;  3RN5 A;  1KAB A;  3NBI A;  1OXX K;  4RKB A;  4H44 C;  4IFD J;  1PH1 A;  1LAB A;  3ZJY C;  3S1N B;  4QIW B;  4OWW B;  4R4O A;  3NTK A;  1FYC A;  4X65 Q;  3HFZ B;  1F9Q A;  3QIA A;  1HQR D;  3NTH A;  2OEO A;  5C3X A;  5ELO A;  1NBW A;  4AQY Q;  3P75 A;  1BCP C;  4P71 A;  4JPB W;  4UP9 A;  1NNX A;  2GN5 A;  2VQF L;  2E2D C;  4R8N A;  5JJL A;  3V96 A;  2HQE A;  5C3E H;  1IBL Q;  1SBB B;  4V19 0;  3HOW H;  2A6H C;  5IYD H;  4GKJ L;  3KLR A;  4HIM A;  3HOY G;  2JA8 H;  1A8V A;  1TT2 A;  1TWA H;  1YHB A;  4GS3 A;  1SYC A;  3BZC A;  4BWG B;  4DV6 L;  2R93 B;  1SSO A;  3CRK C;  4UY8 C;  2WAC A;  3MTS A;  2F0H A;  4FO2 A;  1C48 A;  4H13 C;  4ZKC B;  3T1Y L;  1X9N A;  4LF8 L;  2X69 A;  4IUP A;  2F0O A;  2G9D A;  1R4P B;  3ULJ A;  3BJU A;  1GOZ A;  2IHF A;  4C1N K;  1QNU A;  4HCE A;  1TXY A;  3WOE A;  2F0J A;  2N55 A;  3PUZ A;  3TN2 A;  4ID6 A;  2PZU A;  4DXF A;  3J7Z C;  1RF2 D;  2K5Q A;  3QOJ A;  1VQC A;  2C35 B;  4ME3 A;  5H1S E;  2I0Q A;  4DR3 L;  1O7Z A;  4NP5 A;  5IGG A;  4A3G H;  3K81 C;  2R92 B;  3ONA B;  2N88 A;  4DAV A;  4MHE A;  3V05 A;  3M3Y H;  2WAQ E;  3I72 A;  2E2J B;  1J6Q A;  1UNS A;  2PI2 E;  3OMC A;  4DV2 Q;  3M7G A;  4RGT A;  2DY8 A;  4X66 L;  4M1U B;  4DAY A;  5HUR A;  3TRZ A;  1SYF A;  3KLS A;  2AQ2 B;  4K14 A;  3QJY A;  3FKI G;  2VNU D;  5IYC H;  5IGD A;  2XGT A;  1S40 A;  4JI2 Q;  4LAA A;  2LXK A;  5TSS A;  5NUC A;  1RTO A;  1IBK Q;  4XQJ A;  3LWE A;  1HR0 W;  4XT3 B;  4HJ8 A;  3OW7 A;  5IP7 G;  2F0G A;  3CQZ H;  1AFP A;  5COR A;  3KOJ A;  4HED A;  3CW2 C;  5CGK A;  5C4H A;  3H0G H;  3VR3 A;  3I4N H;  5CYU A;  1STG A;  4A3J B;  3FDT A;  3MXP A;  1IKL A;  3J7A 5;  3ICE A;  3NQT A;  1D5X C;  1SMY C;  2FJ2 A;  2K5V A;  2HCI A;  4KHZ A;  3BG3 A;  1JB7 A;  2Y0S B;  4K5X A;  1WTQ A;  1PH9 A;  2XTI A;  3PSI A;  1OO9 B;  5AJ3 L;  1PH7 A;  4C3I G;  4GN4 B;  1K9M C;  4JBM A;  4B3S L;  1HNX L;  1BCP D;  3QB3 A;  4LFB Q;  2UXB L;  1AW7 A;  1LTI D;  4DK1 A;  3UDG A;  3PUX A;  1S72 A;  1A6X A;  1ENF A;  1QOH A;  1K3R A;  5C6A A;  3NBH B;  1HZC A;  4AYB B;  2SEB D;  3EFX D;  1DGS A;  3J80 L;  1PFN A;  4C2M H;  1SDF A;  1LT6 D;  4C3J H;  1WTH A;  2KHI A;  3AFQ A;  1EIH A;  1WVL A;  2MJ8 A;  4G4K A;  4DV0 Q;  1JWU D;  5C0X J;  4A3M G;  5FLX c;  1SRO A;  5IGF A;  4RG1 A;  4EGV A;  4ZQ3 A;  2YU9 B;  4KY6 A;  4LF6 Q;  1HRJ A;  1YNJ D;  4RGO S;  4A3F G;  4RHR A;  1R4Q B;  4LUV A;  1U4R A;  2EYM A;  3SVM A;  1HUM A;  4JBK A;  5IGC A;  1D1K A;  4BBR B;  3NPP A;  1CKM A;  3I55 A;  4IAL A;  2OWO A;  3HOX H;  1BF4 A;  3ERS X;  1N34 L;  3DXJ C;  2UUB Q;  2KEE A;  1JC7 A;  4A93 H;  2IT1 A;  3UDX A;  1LYL A;  4CJ1 B;  2CW0 C;  1LTG D;  2Z8L A;  3CPF A;  3L7Z C;  1SXT A;  3MWY W;  1QB5 D;  1WI5 A;  5M9O A;  3CRL C;  4A3I G;  4XT1 B;  1I5F A;  1RCV D;  4JI1 Q;  1G2T A;  1KL9 A;  3STB C;  2VUM B;  4KN7 C;  1TWG B;  5BR8 Q;  2KEN A;  2Z6K A;  1GXD C;  2NN6 H;  2F4V Q;  4KN4 C;  4UDU C;  4LF4 L;  2LSS A;  3HOZ B;  1PRT B;  2BDN A;  3E0J A;  3PUV A;  4B3T Q;  2MO1 A;  4IPC A;  1WTO A;  5C4J H;  1CZG A;  1T9H A;  3F2B A;  1UE6 A;  3NP8 A;  5JJI A;  1Q82 C;  4A3B G;  3FVQ A;  4FDB A;  4R4T A;  1VQ7 A;  4LUO A;  5LMN W;  1G8Z D;  4X64 Q;  5C44 B;  2EYL A;  3VR4 A;  3OHX C;  4YWM A;  5I4D A;  1STE A;  3RLO A;  1TWF B;  4DPG A;  1ENA A;  2A5H A;  2VB3 X;  4OXP A;  2JN4 A;  4O2D A;  1ASZ A;  1SMY D;  4KK7 A;  2CWA A;  2F4I A;  1EY7 A;  3K5M A;  1I6V C;  4J1M A;  3SK6 A;  4EVO A;  4B3R L;  1I50 H;  2ID0 A;  4EQO A;  1B9N A;  3I3C A;  1PFM A;  2FMC A;  3JC6 6;  5C3E B;  4GNX B;  4ZAI A;  4L8J A;  2OQ0 A;  3TEH B;  4TQU S;  2K04 A;  4FF3 A;  3HOU G;  3HOW B;  3G6J B;  2EYO A;  2F0S A;  1X6O A;  4YWK A;  3I2Z A;  4F7X A;  3TDQ A;  4JI8 L;  2L0C A;  3DLL A;  2PMZ B;  1LTB D;  5D3I B;  1PFS A;  2ZM6 Q;  3FPU B;  3CKI B;  5JJZ A;  4YIJ A;  5F2D A;  1XXG A;  1LT3 D;  3M9B A;  3VYR A;  2DGY A;  2ZXP A;  2B8F A;  4ZRZ A;  3SK4 A;  1A3V A;  3OTO L;  1A3T A;  4ILW A;  3CCV A;  4CHT B;  2EYH A;  2YTV A;  3NTI A;  1CSP A;  1R9T H;  2WV6 D;  2CH4 W;  2ZJP A;  5IT9 c;  1PRT F;  4G7H C;  2HD3 A;  1DON A;  1HNW L;  1EWH A;  1PH2 A;  1XTD A;  1VF5 C;  4F88 A;  2HIV A;  2YYZ A;  1JE4 A;  1FL0 A;  4DR5 Q;  2JA6 H;  3BDC A;  1L0X B;  3CC4 A;  4QUC A;  2WAQ G;  4BBS B;  4JI6 Q;  2EYF A;  2B63 H;  3A8K E;  4A3G B;  1XNR Q;  4DR7 Q;  5C5M A;  2PNH A;  4JV5 L;  3M3Y B;  4GOP C;  2EXD A;  2CW0 D;  4KKT A;  2Q2H A;  2Z6B A;  1L0W A;  2F0V A;  2KEC A;  3FKI H;  1EUJ A;  1MGS A;  1E24 A;  2PCF B;  3I4L A;  4H0L C;  1SR3 A;  2KHJ A;  1LT4 D;  3Q24 A;  5JJK A;  3STB D;  4JYA L;  2LS0 1;  2MNA A;  3AEV A;  5GAH C;  1V9P A;  4EX5 A;  1I94 L;  5IP7 H;  5HGT A;  2H5X A;  4PMB A;  1H9M A;  4JI3 L;  2NN6 I;  3HGB A;  2I5H A;  3A5U A;  4APV A;  1RD9 D;  1VQ6 A;  4OWT B;  2JA7 G;  4JG2 A;  4YWL A;  4A3E G;  1G6Z A;  5ELB A;  1VQH A;  1V1P A;  3HEJ A;  3J81 i;  4B08 A;  1STY A;  3H0G B;  3S2D H;  5LMN Q;  3I4N B;  2B8G A;  1HFG A;  1SMX A;  2UXC Q;  2XSC A;  3KBX A;  1J5E Q;  4C3I H;  1QVC A;  1Y14 B;  1KIX A;  3ULL A;  4OIJ A;  1GO3 E;  3NQI A;  4IUN A;  2EY6 A;  2BE5 C;  2UU9 L;  3RZO H;  3JAM c;  3H91 A;  1F9S A;  2B2T C;  5C5L A;  2KOL A;  1V43 A;  1CKN A;  3H3V I;  4NDX A;  2R93 H;  4X62 L;  3E3X A;  4QJF A;  3AB9 A;  5CR3 A;  3Q0A A;  3HS0 C;  3MXG A;  3TQY A;  3U4V A;  1UE7 A;  1WD1 A;  4A3M H;  1SNP A;  1EFW A;  2OQK A;  4WOR A;  4N8X 1;  1B1Z A;  5JEA H;  1HUN A;  1WTW A;  4A3F H;  2IX0 A;  2J4X A;  2KVM A;  3K0X A;  3KFU A;  2P5Z X;  3CCQ A;  2DUD A;  2EZV A;  1K28 A;  1Q1E A;  1VMP A;  2F0U A;  1E1T A;  4YCU A;  2A69 C;  4RHS A;  3VR2 A;  2A73 B;  3CPW A;  5EGT A;  1GUT A;  4RAU C;  4DAY B;  5I6Y A;  1C4Q A;  4PZ6 A;  4RFB A;  5IIF A;  4A3C H;  1UE1 A;  1B44 D;  1STA A;  1WCM G;  2KCN A;  4DR6 L;  4P2C B;  2E2J H;  2KCM A;  2QIL A;  1P8L A;  4FXK C;  2R7Z B;  1PTO C;  3I7F A;  4A93 B;  3MFY A;  1O7Y A;  1FGB D;  1Q12 A;  4L5S A;  1M8A A;  4X3U A;  3WOF A;  5KYI A;  4KMU C;  3F2D A;  3DEP A;  4IOA A;  1JB3 A;  3CCU A;  5EKK A;  3J81 E;  4KY5 A;  3TP5 A;  1I6H H;  3D6C A;  1L1O C;  2LFN A;  3S24 A;  1EQV A;  3C1E A;  2DN8 A;  4NXM Q;  4IUR A;  2PI2 A;  3A7L A;  1EY4 A;  2F0M A;  2IHE A;  4O42 A;  5C3W A;  4KLK A;  2WIN B;  5K5P A;  4K2L A;  3MVV A;  3GTM B;  3W1G A;  2N49 A;  4A3B H;  3M4O H;  1FJG L;  4PNY A;  4G7O C;  2LY7 A;  3TS2 A;  1SNQ A;  5M5W H;  5C4J B;  3BVG A;  1CFM A;  2PQA A;  4GLA C;  5EBD A;  2AUJ D;  3DWP A;  4MTK A;  4HJ5 A;  2GVB A;  1VQP A;  4IFD I;  4YY3 Q;  2MQH A;  3HZX A;  1IBM Q;  4X3S A;  4HTH A;  5LL6 S;  4JK1 C;  1CQF A;  1EY5 A;  1QVG A;  2WKD A;  1TS2 A;  3LX0 A;  3MFG A;  1ZKO A;  1K0R A;  1D8L A;  3D4R A;  1ROD A;  2K14 A;  3VA7 A;  3HOU H;  1QG7 A;  3D4W A;  1I50 B;  1MI2 A;  1EL0 A;  2EPB A;  3T51 B;  3HOY B;  1IL8 A;  4LUZ A;  1LO5 D;  3NEN A;  3Q22 A;  2BE5 D;  2BH8 A;  4OO1 G;  3ULP A;  4HMI A;  4JOI C;  4BS9 A;  1B7Y B;  1HJP A;  4XTC S;  1RDP D;  1MKH A;  3I8Z A;  1VQA A;  2F0T A;  2F3V A;  1IKM A;  4DUY L;  4DV7 L;  3DEO A;  4K2K A;  1SYE A;  2GA4 B;  1R9T B;  1EY8 A;  4XXE A;  2XNA C;  2L15 A;  3K80 C;  3SEB A;  1VF7 A;  4KY7 A;  3G6E A;  5CC4 A;  1B70 B;  3OIP A;  3M7N A;  2K5H A;  2A69 D;  1EIY B;  2QKI C;  2N8N A;  2ZJR A;  3IFD A;  3KJO A;  3NUC A;  5IYB H;  2NVY H;  3JAM E;  4HJ9 A;  1KD1 C;  4NXN L;  4UHV A;  2XVS A;  1XMO L;  1PTO D; 
#chains in the Genus database with same CATH homology
 1YZ6 A;  5IP7 G;  2D62 A;  3CQZ H;  1TWC H;  3KOJ A;  1NJI C;  1N36 Q;  3CW2 C;  4DAM A;  4DUZ Q;  2JK8 A;  3H0G H;  1BBU A;  4DR5 L;  3I4N H;  3HOZ H;  5M5Y H;  2UU9 Q;  3M4P A;  4OWX B;  1GM5 A;  4JI6 L;  1A63 A;  1WFQ A;  5ELN A;  4MNO A;  4BA1 I;  4JI7 L;  3ICE A;  3J7A 5;  1XNR L;  4UP7 A;  2K5V A;  4DR7 L;  2BH2 A;  4JOI A;  1AH9 A;  4KHZ A;  4A3I H;  1X54 A;  4X62 Q;  4DV1 Q;  1JB7 A;  1VQD A;  4Y7N H;  5GAG C;  4IOC A;  1PH9 A;  4AYB G;  2XTI A;  3PSI A;  3EN2 A;  2HT1 A;  4UPA A;  5AJ3 L;  3GTG H;  3J81 c;  1PH7 A;  2A8V A;  4GN4 B;  1Y1W G;  5FLM H;  1K9M C;  4JBM A;  1YHA A;  2Z0S A;  3PUY A;  3KF6 A;  4B3S L;  4JBW A;  2UUC Q;  1HNX L;  4BXX G;  4JCV E;  1GKH A;  1C0A A;  4DK6 C;  1SN8 A;  1TWF H;  1WYD A;  4QQB X;  1VQL A;  4LFB Q;  1UWV A;  2UXB L;  4DR4 Q;  3UDG A;  2UUA L;  1K8A C;  4JC0 A;  3PUX A;  1S72 A;  3FP9 A;  2NZO A;  1HNZ Q;  1UEB A;  1QVF A;  1PYB A;  1K3R A;  3SGI A;  3NBH B;  1HZC A;  1SE8 A;  2Z6K C;  3JAM i;  3RN2 A;  1Q7Y C;  2E5L L;  1N32 L;  1DGS A;  4BY1 G;  1YJN A;  3CAM A;  4BBR G;  4C2M H;  4C3J H;  3F1Z A;  1PH6 A;  2KHI A;  3AFQ A;  3KF6 B;  1PHJ A;  4DR2 Q;  4H02 A;  5M3F G;  4DV0 Q;  3RLF A;  4LF9 Q;  3MXN B;  5J3B A;  5C0X J;  3NEL A;  4A3M G;  1OXS C;  3S14 H;  4DR6 Q;  5FLX c;  1EQR A;  1SRO A;  2F52 A;  3CF5 A;  1QUQ A;  2VQE L;  4RG1 A;  5LMN L;  4LF7 Q;  3AFP A;  5IYC G;  2UXC L;  4DR1 Q;  1EOV A;  4PMW A;  4LF6 Q;  4DV3 L;  4A3F G;  2VL6 A;  3PIO A;  1J5E L;  1C7Y A;  1VQ9 A;  2OTJ A;  1G6P A;  3A5Z B;  4LUV A;  5IYB G;  4JBK A;  2ATW A;  1PH5 A;  4DNI A;  3S1M H;  4JI5 L;  5M3M H;  1CKM A;  3I55 A;  2OWO A;  3E9H A;  4YCV A;  1HR0 L;  3HOX H;  3E9I A;  2VUM G;  3ERS X;  2AHO B;  1N34 L;  1Y1V G;  2UUB Q;  1VQG A;  4A93 H;  2IT1 A;  1YVC A;  4OON A;  2E8G A;  3UDX A;  1LYL A;  3BU2 A;  5IWA Q;  1AE3 A;  4P72 A;  3HOZ G;  1VQK A;  3CPF A;  5C0X I;  3L7Z C;  2ZTE A;  3GD7 A;  4QIW E;  1WI5 A;  3UE1 A;  3KJP A;  1NMF A;  4YCW A;  1QZH A;  2AMC B;  3S15 H;  1LM0 A;  4IPH A;  3TS0 A;  1FJG Q;  4A3I G;  4KHP L;  1I5F A;  3PCO B;  4JI1 Q;  2VQF Q;  4TVA B;  1KL9 A;  3F8T A;  3OYY A;  3S1N H;  1Q8K A;  4K0K Q;  3STB C;  4P74 A;  4BBS H;  2B29 A;  1X55 A;  5FLM G;  5BR8 Q;  2KEN A;  1KHI A;  5C44 G;  4Y52 H;  2Z6K A;  1JE5 A;  4O0A A;  2F4V Q;  1P16 A;  2B3G A;  4LF4 L;  1RIP A;  2LSS A;  1YIT A;  4GKJ Q;  3L2P A;  1Q81 C;  3GTJ H;  3U58 A;  1N8R C;  3RNU A;  3PUV A;  4B3T Q;  2MO1 A;  4IPC A;  5C4J H;  2JA9 A;  1EWI A;  5EAY A;  1Z9F A;  2JQO A;  3GTK H;  4DV6 Q;  1T9H A;  2A1A A;  1VQB A;  3F2B A;  1KC8 C;  4DV5 Q;  2K4K A;  4PZ8 A;  1UE6 A;  1UE5 A;  3G48 A;  5JJI A;  1FVI A;  1XNQ L;  1Q82 C;  4A3B G;  4FDB A;  4R4T A;  1M90 C;  1VQ7 A;  1NY4 A;  4LUO A;  5LMN W;  3T1H Q;  1XMQ Q;  4A76 A;  4X64 Q;  2JEA I;  3GTP H;  4YHH L;  3T1Y Q;  1PA6 A;  1CUK A;  2GVA A;  4LF8 Q;  1PH3 A;  3DM3 A;  5C3E G;  2I5M X;  4YWM A;  3RLO A;  3Q8D A;  4L5T A;  5C4X H;  4DPG A;  5IYD G;  4B3M L;  4HIK A;  4GN5 A;  3A0J A;  4OXP A;  4A75 A;  4EQ5 A;  5M5X H;  4O2D A;  1ASZ A;  3I4O A;  3FHW A;  2WB1 E;  2CWA A;  3MEF A;  2Q2U A;  1VQN A;  4B3R L;  1I50 H;  2ID0 A;  1N33 L;  4IFD G;  1E7Z A;  1X3F A;  3J80 c;  3HOV H;  4DR3 Q;  1JJ2 A;  3JC6 6;  3HOX G;  4GOP B;  1VQO A;  2FXQ A;  4GNX B;  4DR4 L;  4NXM L;  3U50 C;  4DUY Q;  5IP9 H;  2OQ0 A;  3TEH B;  4TQU S;  4X65 L;  4A4I A;  3HOU G;  2UXD Q;  1CKN B;  4DV7 Q;  4OX9 L;  2Q2I A;  1AE2 A;  4DV4 Q;  1PH8 A;  4L5R C;  4KI0 A;  4WJ4 A;  3W5O A;  1X6O A;  4AQY L;  3H15 A;  2JA5 H;  4YWK A;  2JEB I;  3I2Z A;  4XIG S;  4DKA C;  1YJ9 A;  2JA7 H;  4A3E H;  4JI8 L;  4X66 Q;  3DLL A;  4JI0 Q;  2OTL A;  2R92 H;  2JJQ A;  1VQ4 A;  5GRO A;  1LUZ A;  3M4Q A;  3RLN A;  1PFS A;  2ZM6 Q;  1IBL L;  1VQ5 A;  3S1R H;  1VQJ A;  3NEM A;  4L5Q A;  1Q86 C;  3M9B A;  4BBS G;  2DGY A;  3CME A;  4LF7 L;  2ALY B;  3OTO L;  4YY3 L;  3CCV A;  1U5K A;  4DK3 C;  4LF5 Q;  2YTV A;  2KBN A;  1IBM L;  2CKZ B;  4A3G G;  3F2C A;  1CSP A;  1IXR A;  4LW1 A;  3UDI A;  2HIX A;  1XMO Q;  4NXN Q;  4LFC L;  1R9T H;  4MZ9 A;  2ZJP A;  1GD7 A;  5IT9 c;  1D7Q A;  5LMU Q;  1HNW L;  1PH2 A;  2IX1 A;  4X6A H;  1O7I A;  1XTD A;  2HIV A;  1OXU A;  2YYZ A;  1EQQ A;  1FL0 A;  4A3L H;  4DR5 Q;  2JA6 H;  3I4M H;  2ZTC A;  4PZ7 A;  1KRT A;  1YJW A;  3CCL A;  2AWN A;  3CC4 A;  3RZD H;  2RF4 A;  2EQS A;  2WAQ G;  1MJC A;  1BKB A;  3PO3 H;  4JI6 Q;  2B63 H;  5IWA L;  4HIO A;  4JI7 Q;  5FJ8 G;  4QL5 A;  3CCS A;  1XNR Q;  4DR7 Q;  1K73 C;  5GAD C;  3UE0 A;  3ER0 A;  2PNH A;  3OW2 A;  4JV5 L;  1IYJ B;  1K83 H;  3KYH C;  1HZB A;  4RMF A;  4GOP C;  4BY7 G;  4R4Q A;  2BA0 A;  2EXD A;  4GNX C;  1MJE A;  4JI4 Q;  4A3K G;  5AJ3 Q;  3UDF A;  1L0W A;  2Q2H A;  2Y0S E;  3LGJ A;  4LFA L;  1QZG A;  4A3D H;  3FKI H;  1OTC A;  1EUJ A;  3PV0 A;  2I5L X;  4B3S Q;  3HKZ G;  4A3J H;  1HNX Q;  2R7Z H;  1E24 A;  1V1Q A;  1SR3 A;  2KHJ A;  2UXB Q;  1RL2 A;  4GKK L;  5GQO A;  3PO2 H;  2QEX A;  1PVO A;  2UUA Q;  5JJK A;  3PUW A;  3H0G G;  3STB D;  4JYA L;  2MNA A;  1YIJ A;  1YEZ A;  3AEV A;  1NTG A;  1Z47 A;  3I4N G;  1JT8 A;  5GAH C;  1V9P A;  4EX5 A;  1I94 L;  3RR5 A;  4R4I A;  5IP9 G;  5IP7 H;  1N32 Q;  2E5L Q;  2H5X A;  4WJ3 M;  4JI3 L;  2RHS B;  2JA8 G;  4DV2 L;  2MFI A;  2NN6 I;  3A5U A;  2I5H A;  2YTX A;  4AYB E;  2F3I A;  4APV A;  1VQ6 A;  4OWT B;  1WCM H;  4JBJ A;  2JA7 G;  1VQF A;  4JG2 A;  2PQA B;  4YWL A;  3EIV A;  2AWO A;  1IL2 A;  3S1Q H;  4A3E G;  1JMC A;  2EIF A;  1VQH A;  3G4S A;  1KRS A;  3CP0 A;  3J81 i;  3KDF B;  3L0O A;  1LTL A;  2LXJ A;  3TRE A;  2QGQ A;  2VQE Q;  4JI2 L;  5LMN Q;  3EBE A;  3S2D H;  3GTM H;  1SMX A;  2UXC Q;  1IBK L;  4DV3 Q;  1J5E Q;  4C3I H;  2VS1 A;  5JEA J;  1QVC A;  1Y14 B;  1Y1W H;  1KIX A;  1YBY A;  3GO5 A;  3ULL A;  1KAW A;  2RHQ B;  4JI5 Q;  3KF8 B;  1PV4 A;  1NE3 A;  1GVP A;  2CQO A;  1TWH H;  2VW9 A;  4BXX H;  1EIF A;  1Q1B A;  3PF5 A;  1WJJ A;  1GO3 E;  3D31 A;  2NVQ H;  1HR0 Q;  4BA2 I;  2HQL A;  1N36 L;  1PH4 A;  3CCM A;  1N34 Q;  4DUZ L;  3S17 H;  3RZO H;  2UU9 L;  2R7F A;  3JAM c;  4GOP A;  2YU9 H;  2E2H H;  4GNX A;  2JA6 G;  3GTQ H;  1CKO A;  5HGQ A;  2ES2 A;  1V43 A;  3AQQ A;  1CKN A;  3H3V I;  1VQ8 A;  3IRB A;  3PO3 G;  4BY1 H;  2R93 H;  2K52 A;  4X62 L;  4DV1 L;  4BBR H;  2B63 G;  4P73 A;  4QJF A;  2R6G A;  1VS0 A;  1VQE A;  1WOC A;  1L1O B;  4KHP Q;  1BBW A;  3TQY A;  3U4V A;  3KLW A;  5M3F H;  3H3V H;  1UE7 A;  1Q46 A;  4JI0 L;  1B8A A;  2D0P A;  4A3M H;  2K5N A;  5M3M G;  3GDE A;  1SFO H;  1EFW A;  2D0O A;  1XJV A;  2UUC L;  2OQK A;  2ZJQ A;  3CC2 A;  3HOY H;  4MTN A;  4LFB L;  2R7Z G;  4A3F H;  4LF4 Q;  2IX0 A;  4P75 A;  4A93 G;  4LF5 L;  3K0X A;  3KFU A;  1SRU A;  1HNZ L;  1KQS A;  5E7N A;  3PO2 G;  1H95 A;  1X3G A;  1MIU A;  1VCI A;  3CCQ A;  2CCZ A;  3D0F A;  1JJC B;  2DUD A;  1I3Q H;  4GN3 B;  1Q1E A;  5DLQ E;  4IJL A;  1XPO A;  2CFM A;  1E1T A;  4YCU A;  2VY3 A;  3U4Z A;  2VUM H;  1CSQ A;  1Y1V H;  1E3P A;  1TWG H;  3I56 A;  3CPW A;  1XNQ Q;  4OO1 I;  2IY5 B;  2HHH Q;  1KXL A;  4DAY B;  3G71 A;  4PZ6 A;  4DR2 L;  4HJA A;  4YHH Q;  5C0X G;  4A3C H;  2BA1 A;  1UE1 A;  4DV0 L;  1WCM G;  2JE6 I;  4GLX A;  1YI2 A;  4LF9 L;  4QGU A;  4DR6 L;  2E2J H;  3B6Y A;  2KCM A;  5HY6 A;  1P8L A;  1HH2 P;  2RCN A;  3I7F A;  5K36 G;  2N78 A;  2NN6 G;  4DR1 L;  1Q12 A;  4LF6 L;  1X65 A;  4UP8 A;  4B3M Q;  4HJ7 A;  3CC7 A;  4L5S A;  3CCR A;  3GTL H;  1G51 A;  4IJH A;  1E22 A;  1K8G A;  3E0E A;  3F2D A;  4JI4 L;  4LNQ A;  2WFW A;  2YV5 A;  3PIP A;  4AIM A;  2OCE A;  1S3O A;  5C44 H;  4IOA A;  3RN5 A;  1OXX K;  2NZH A;  3CCU A;  3M85 A;  4B3R Q;  1N33 Q;  1I6H H;  1XPU A;  1PH1 A;  2UUB L;  3ZJY C;  4IFD J;  1L1O C;  1HZ9 A;  3K7A H;  3S24 A;  4POG A;  4NXM Q;  4OWW B;  2PI2 A;  4R4O A;  4X65 Q;  2IHE A;  3HFZ B;  2Q2T A;  4IPD A;  4KLK A;  4OX9 Q;  5ELO A;  1NBW A;  1OXT A;  3W1G A;  4AQY Q;  2N49 A;  4A3B H;  3M4O H;  2NVT H;  1FGU A;  1VQM A;  1SLJ A;  4P71 A;  1FJG L;  2R93 G;  3TS2 A;  4UP9 A;  5C4X G;  5M5W H;  3GTO H;  2GN5 A;  3J81 j;  4JI1 L;  2VQF L;  4JI8 Q;  4AH6 A;  4POF A;  5IE8 A;  2PQA A;  4GLA C;  4K0K L;  5JJL A;  2QA4 A;  5C3E H;  3PGZ A;  1IBL Q;  5GAE C;  5BR8 L;  2PMZ E;  4HJ5 A;  2MO0 A;  3KDF A;  2F4V L;  3HOW H;  4LWC A;  5IYD H;  2GVB A;  1W3S A;  1VQP A;  3OTO Q;  4IFD I;  4YY3 Q;  4GKJ L;  1ASY A;  3HOV G;  4HIM A;  3HOY G;  1YNX A;  2MQH A;  5JEA G;  1IBM Q;  2JA8 H;  2CWP A;  1A8V A;  4B3T L;  1TWA H;  1YHB A;  3J80 i;  4GS3 A;  4LFC Q;  3A74 A;  1QVG A;  2WB1 G;  3BZC A;  4DV6 L;  1HNW Q;  1NMG A;  4DV5 L;  3HKS A;  1JJG A;  4UY8 C;  4HID A;  1K0R A;  2JA5 G;  1D8L A;  2K50 A;  3T1H L;  1XMQ L;  4X64 L;  2VZA A;  4C3H H;  4ALP A;  1L2F A;  3T1Y L;  2K14 A;  3HOU H;  3VDY A;  1C9O A;  1X9N A;  2R92 G;  4LF8 L;  2ZTD A;  2E2I H;  3S2H H;  4J15 A;  2AKW B;  3W1B A;  3AYH B;  2V1C C;  2N3S A;  1QUQ B;  4A3C G;  1A0I A;  4LUZ A;  3BJU A;  3ULJ A;  3NEN A;  2IHF A;  4IO9 A;  2YTY A;  2BH8 A;  3S16 H;  4IPG A;  4JV5 Q;  4OO1 G;  3CD6 A;  1TXY A;  1L1O A;  3PUZ A;  4R1J A;  1HZA A;  3ULP A;  1XPR A;  1PYS B;  4LFA Q;  4NB3 A;  3J7Z C;  1X3E A;  4JOI C;  4GLV B;  1VQI A;  1B7Y B;  1HJP A;  1VQC A;  4XTC S;  2C35 B;  4ME3 A;  5H1S E;  2I0Q A;  4DR3 L;  1MKH A;  4A3G H;  3K81 C;  4QY7 A;  4GKK Q;  4A3L G;  2WP8 J;  1VQA A;  3I4M G;  4DUY L;  4NPS A;  4JYA Q;  4PG3 A;  3M3Y H;  2WAQ E;  2UXD L;  1X56 A;  2KCT A;  4DV7 L;  2ASB A;  4R4C A;  1J6Q A;  1I94 Q;  4DV4 L;  2PI2 E;  4JI3 Q;  5IY0 A;  4DV2 Q;  1N9W A;  3CCJ A;  3K7U C;  1BVS A;  3K80 C;  2L15 A;  1EYG A;  4X66 L;  2HHH L;  3TRZ A;  2R7D A;  3G6E A;  3CCE A;  2ZM6 L;  3WWV A;  4HJ8 A;  3CMA A;  1B70 B;  5FJ8 H;  1YHQ A;  3FKI G;  3M7N A;  2K5H A;  4A3D G;  2VNU D;  5IYC H;  1E1O A;  2A19 A;  3HKZ E;  1EIY B;  1OXV A;  2N8N A;  2ZJR A;  4A3J G;  3KJO A;  1G29 1;  2XGT A;  1S40 A;  4JI2 Q;  2LXK A;  2K75 A;  5IYB H;  4BY7 H;  2NVY H;  1W2B A;  1M1K C;  1IBK Q;  4HJ9 A;  4A3K H;  3HOW G;  1KD1 C;  2NVX H;  4NXN L;  1IZ6 A;  2Y0S G;  3BZK A;  1XMO L;  3K8A A;  1HR0 W;  3PF4 A;  3CXC A;  5LMU L;  1U0L A;  1A62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...