4DK6C

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
87
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 14
structure length 87
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk6C00
1P8LA 1X3GA 1EUJA 3BJUA 2E2JH 3HKZG 4Y7NH 4A3IH 4B3TL 4OO1G 2UXCQ 1Y1VG 4P75A 3I56A 3U50C 4BY1G 1M90C 4JI3L 2UUCL 5HY6A 2MQHA 3GO5A 5J3BA 2PMZE 1Q8KA 4JI1Q 2GN5A 3RZDH 1XMOL 3GTKH 1YJWA 2VUMG 2WAQE 3A5ZB 1PH1A 1N34Q 1KIXA 4IPGA 1WI5A 1GVPA 4A76A 1A63A 3NEMA 4LF4L 3J7ZC 5GROA 2E8GA 1VQNA 4A3EH 2JA6G 3CC7A 3HOWG 5AJ3Q 1VQ7A 4LNQA 4R4IA 4YWKA 1S3OA 4GN4B 3UDXA 3CCLA 4KHZA 1HR0W 5IWAQ 1PH3A 4DUYL 1L1OC 5JJIA 1IBKL 2VNUD 1I94Q 5ELOA 4QIWE 4A3CH 5C3EH 4TVAB 1I5FA 3GTQH 2UUBQ 4QL5A 3OYYA 3KJPA 1VQAA 1Y1VH 4APVA 4DR1L 2E5LQ 3E9IA 2R93G 2UXBQ 4BY1H 1EIYB 4GN5A 3HOYH 2WFWA 3T1HQ 1E7ZA 1VQ8A 4C3IH 2XTIA 1UEBA 4DR7L 4JI0Q 5IT9c 3I4MH 1HZ9A 3DLLA 1V43A 1NBWA 4KI0A 2Q2IA 2ZM6L 3CCEA 1YHBA 2K4KA 1X3EA 4UP9A 4HIOA 5JJKA 2JA6H 4AIMA 5FLXc 4JBMA 4QGUA 3S14H 1XNQQ 2KBNA 4NXML 3RZOH 4R4OA 3S17H 1IYJB 4A3GG 2UXDQ 4X65L 1XPRA 1UE6A 3CF5A 4DR6L 4A3KG 1YVCA 3HOXG 2VQEQ 4HIKA 5C4JH 4GNXA 1LYLA 1N32L 4OWXB 4A3LG 2R7FA 4TQUS 2BH2A 3PO3G 2YTYA 5IYDG 1C7YA 4A3JG 1W3SA 4GKJL 5JJLA 1TWAH 2JJQA 2CQOA 2ZTEA 1Q12A 4EX5A 1HZCA 1E24A 4DR4Q 3UE0A 3A74A 3GTPH 1VS0A 2MO0A 2R7ZH 2YYZA 1PHJA 1G291 3K7UC 4BXXG 1BBWA 1HNZL 1R9TH 1Y1WG 4LF8L 3H3VH 4DNIA 1OXTA 1IZ6A 3KDFB 2RHSB 4LF9L 1VQDA 1KL9A 2L15A 2R92G 1B7YB 5LMNL 1WFQA 1L0WA 2HHHQ 4POGA 1VQBA 2UU9L 3I2ZA 3L2PA 2JEBI 4AQYL 4A3KH 2K5NA 1T9HA 2EXDA 2MFIA 1N8RC 4JI6Q 2OTJA 2JQOA 1EQRA 4A3LH 3H0GH 1UE1A 3CD6A 3HKSA 4JI2Q 3VDYA 2IHEA 5IP9H 3OTOQ 4A3JH 1NY4A 4JI7L 3S1QH 1HNWQ 2D62A 5BR8L 3I4NG 1UE5A 1VQ9A 1JMCA 4GLXA 2YU9H 1VQ4A 1W2BA 1WCMG 4DV5Q 4JV5L 4IPDA 2JK8A 1SRUA 1Q46A 1YJ9A 1YJNA 2OWOA 3SGIA 3RR5A 2F4VQ 1VQGA 4NXNL 5M3MG 4BXXH 4GS3A 1VQOA 3Q8DA 1Z47A 5DLQE 2K50A 4DV1Q 1NMFA 4DK6C 1Y1WH 3HOVG 3PUXA 4JI5L 2RHQB 2VQFL 4BBSH 3EBEA 2IHFA 3F1ZA 5LMUQ 5E7NA 4HIMA 1G51A 3GTOH 3CCQA 4JYAL 4K0KQ 3M4PA 4LUVA 3RN5A 3AFQA 4A93H 5C0XG 4DV6L 2R6GA 2Z0SA 3TS0A 1E1TA 2GVBA 4PZ8A 1S72A 5HGQA 1N33Q 4YCVA 1XMQQ 1HR0Q 1VQLA 4DR5L 4RMFA 3I4NH 1QVGA 2N49A 4IJLA 2ES2A 3TQYA 1WCMH 1K0RA 4DV4L 3E0EA 3A5UA 1G6PA 1CKNA 1UE7A 4YY3L 1Z9FA 1FJGL 5M3MH 2HQLA 2QGQA 3KFUA 2A19A 1AH9A 3U4VA 1XPUA 1O7IA 1X54A 1JJ2A 3A0JA 1N32Q 2V1CC 4A3MG 2I5HA 4GKKL 4BA1I 5FJ8G 3NELA 1JE5A 2HIXA 2I5LX 1MJCA 1QVCA 4LF6L 4UP7A 4UY8C 2JA7H 4DV0Q 3L7ZC 4X62L 4LFBL 4DUZQ 4GOPA 3KF6B 1XNRQ 3CCVA 3JAMi 1X9NA 2ZTCA 5C44H 4R4CA 4L5QA 1L1OB 1D7QA 5IYBG 3FKIG 1SROA 1YHAA 2AWOA 4XTCS 4DV2L 4IO9A 3PF4A 4OX9L 4QY7A 2PQAB 1XJVA 3KOJA 2Y0SE 3J81c 4GNXC 1QZHA 2ZJPA 1VQKA 1FL0A 1PFSA 3D0FA 3K7AH 3S1NH 3PO2G 2Z6KA 3GTMH 2VS1A 1YI2A 3BU2A 4JI4L 4A3DG 4A3MH 1NE3A 3PCOB 1K83H 3BZCA 4B3RL 1FGUA 1RIPA 1VQHA 3RNUA 5M5YH 4YHHL 1IBML 3KF8B 2WP8J 4DAMA 3D31A 2ALYB 1TWCH 1PH6A 2OQ0A 2VW9A 2NN6I 1Q86C 5IYBH 3FKIH 1BVSA 2VUMH 5M5XH 3CXCA 3RN2A 3W1BA 1IBLL 1Q1BA 3CCRA 3H15A 2JA5G 1MKHA 2QA4A 4DV7L 4LF7L 1IL2A 3NBHB 1AE2A 3HOWH 4JG2A 3G71A 4IJHA 1SN8A 1TWHH 2N8NA 2UUAQ 4DV3L 4LF5Q 3K80C 3AEVA 2ID0A 4JYAQ 3B6YA 2Q2UA 2MO1A 3PUVA 1TWFH 5K36G 4QJFA 4LFCL 1PH7A 4A3DH 1U0LA 2NVYH 3HFZB 4JOIA 5LMNW 2VL6A 1Y14B 2HIVA 4L5TA 1X6OA 2Y0SG 1HJPA 2HT1A 2R93H 3M9BA 2LSSA 1VQ5A 1JJGA 1LUZA 2KCMA 1SLJA 4DR2L 1YHQA 1ASYA 1CKOA 1MIUA 2DGYA 1A8VA 4JBWA 3TREA 3CCJA 1K9MC 4C2MH 1EQQA 4B3SL 4L5SA 3ZJYC 3K81C 4LFAQ 1Q1EA 1A62A 1J5EL 4KHPQ 2JA5H 4UP8A 1B70B 4OO1I 1N36L 4R1JA 4C3HH 1AE3A 3M7NA 4MNOA 4B3TQ 4X64L 1E3PA 4B3ML 1GKHA 1JJCB 4DKAC 3CCMA 4UPAA 4LF6Q 4A3GH 2VY3A 3KYHC 2UUCQ 4JI3Q 3HOXH 2UXCL 1GM5A 5GQOA 2D0PA 2R7DA 1HZBA 1NTGA 1XMOQ 1PV4A 4POFA 3W5OA 1PH8A 3PO3H 1KRSA 3G48A 4JI1L 5IYDH 1VQEA 1CSPA 4PMWA 4DV2Q 5JEAG 2NZOA 3T1YL 4LF4Q 3OW2A 4A3FG 4HIDA 3RLFA 4HJ7A 2D0OA 3S24A 3TS2A 5IP7G 3PSIA 4HJ8A 1QUQA 3RLNA 3AQQA 3BZKA 3GTJH 1KHIA 5AJ3L 2QEXA 4DUYQ 3NENA 4JCVE 2A8VA 1IBKQ 2PI2A 4DAYB 1L2FA 5IWAL 3UE1A 1YZ6A 1K3RA 4GOPC 3HOZG 2H5XA 4PZ7A 2R92H 4BBRG 1H95A 3CMEA 1I94L 4DR1Q 2UUBL 2E2HH 1HH2P 2F3IA 4JC0A 4GN3B 3J7A5 2E5LL 1YBYA 2UXBL 5C4XG 1BKBA 4DR7Q 1OXSC 3T1HL 1KD1C 2RCNA 3U4ZA 3AYHB 3I4OA 3H3VI 4DK3C 2ZM6Q 5GAEC 3PF5A 4JI0L 1PH5A 2F52A 2NN6G 2A1AA 2K14A 4KLKA 4A3FH 3GD7A 4JBJA 4QQBX 2B3GA 2Z6KC 4X66L 2YTXA 1J6QA 2B63G 4LUOA 4YWMA 4PZ6A 4IOCA 4NXMQ 3S2DH 4X65Q 3HOVH 3J80i 1VQ6A 1CKMA 4DR6Q 2NZHA 1XNQL 4IFDJ 3M4OH 2UXDL 1PH4A 3HOZH 2N3SA 3ER0A 1XTDA 4A4IA 2VQEL 4R4QA 5EAYA 4YCUA 4GKJQ 3FHWA 1WYDA 3CPWA 4Y52H 4GNXB 5C4XH 3AFPA 1HNXL 3MEFA 4GLVB 3UDGA 1I3QH 4P74A 5IE8A 4A3EG 1SE8A 3KDFA 1HNZQ 4DR4L 4LF8Q 1TWGH 3I7FA 1XPOA 2KHJA 1I50H 2Q2TA 1EOVA 4JI8L 4DR3L 4LF9Q 3ERSX 5ELNA 4HJAA 5FLMG 3J81i 1PH2A 5LMNQ 2B63H 4OXPA 3RLOA 4A3CG 5C3EG 3F2BA 2GVAA 4JOIC 1NJIC 1OXUA 1ASZA 2UU9Q 1WJJA 4AYBE 4AQYQ 1OTCA 2HHHL 1X56A 2Q2HA 1SFOH 4LW1A 3HOYG 2N78A 1KXLA 5FJ8H 1VQJA 4P71A 3JAMc 4A75A 2CKZB 4JI6L 1QVFA 5GAHC 4PG3A 3CC4A 4JI7Q 4BY7G 1VQFA 5BR8Q 3CMAA 2ZJRA 4JI2L 3T1YQ 3I4MG 3S1MH 3S15H 3J81j 4R4TA 3OTOL 1PA6A 1CUKA 3STBD 3ULJA 2K75A 1E1OA 2LXJA 1SMXA 3PGZA 4JV5Q 1HNWL 2RF4A 2CCZA 2BH8A 4IPCA 4NXNQ 2JEAI 4LUZA 4YCWA 4DPGA 4DV5L 2WB1G 3PUWA 2F4VL 4H02A 2ATWA 1EFWA 2AHOB 4JI5Q 2VQFQ 4DV1L 2KHIA 1QUQB 3E9HA 3WWVA 5FLMH 3G4SA 1QZGA 1I6HH 2IY5B 1JT8A 4BA2I 2AKWB 3GDEA 3UDIA 3EN2A 5C0XI 3PO2H 3EIVA 1E22A 2K5HA 5LMUL 3M3YH 1C0AA 2ZTDA 4DV6Q 4K0KL 1VQCA 4BY7H 3TEHB 2KCTA 3K8AA 1YITA 4DR5Q 3IRBA 3STBC 2C35B 3L0OA 4AYBG 2R7ZG 1LTLA 3F2DA 1N33L 1XMQL 1IXRA 2BA0A 2OCEA 3S2HH 3ULLA 4DV4Q 1HR0L 4X66Q 4IFDI 1K8GA 1Q81C 3S16H 4YY3Q 1FJGQ 3CAMA 2LXKA 3DM3A 1WOCA 1MJEA 2PI2E 1EYGA 3HOUG 2KENA 2JA8G 3CW2C 4IOAA 5IY0A 4EQ5A 3MXNB 1RL2A 5M3FG 2WAQG 1GO3E 1C9OA 3S1RH 4WJ3M 4MZ9A 1CKNB 1TXYA 4GKKQ 3KF6A 1LM0A 3PV0A 3H0GG 4X62Q 1VQPA 4A3BG 4GLAC 4LFBQ 1L1OA 4C3JH 5IP9G 3JC66 3F2CA 2OQKA 3PIOA 1OXVA 3GTGH 1HNXQ 4DV0L 2PNHA 1X65A 4DUZL 1XNRL 4XIGS 4JBKA 5H1SE 4P73A 3PIPA 3M85A 3PUZA 2PQAA 4GOPB 1YNXA 3U58A 1VQMA 1JB7A 1D8LA 2CWAA 3CPFA 2EIFA 4ALPA 4OX9Q 4JI8Q 4DR3Q 1EIFA 1N34L 3ULPA 2AMCB 2DUDA 5JEAJ 1A0IA 2B29A 2CFMA 1GD7A 2YTVA 4LWCA 1X3FA 1K8AC 1KC8C 1VQIA 3PUYA 3HOUH 4BBSG 2JA8H 3CP0A 2YV5A 4HJ5A 2ASBA 4P72A 3I55A 5M3FH 4JI4Q 4ME3A 4J15A 3CCUA 4O0AA 4B3RQ 3K0XA 1B8AA 1IBMQ 2NVQH 4YHHQ 3KJOA 1CSQA 3CCSA 4A93G 1KRTA 2NVTH 1OXXK 4A3BH 1HZAA 1EWIA 2XGTA 3CC2A 2I0QA 1PVOA 4IPHA 2EQSA 5C0XJ 4MTNA 4NB3A 1IBLQ 3HKZE 4OWTB 3M4QA 2JA9A 4DV7Q 2BA1A 1NMGA 4LF7Q 3LGJA 3TRZA 1S40A 5IYCG 3GTLH 1BBUA 1Q82C 1SR3A 5IP7H 4WJ4A 4DV3Q 2IT1A 2IX1A 1PYBA 1U5KA 4OWWB 4AH6A 1V9PA 4A3IG 1YEZA 2UUAL 4LFCQ 1VCIA 4LF5L 2JA7G 4FDBA 2K5VA 4L5RC 4HJ9A 4KHPL 4BBRH 5C44G 2MNAA 3FP9A 3ICEA 5M5WH 1K73C 2WB1E 2ZJQA 3G6EA 2VZAA 1P16A 4DR2Q 1N9WA 1KQSA 3KLWA 1PH9A 1V1QA 4B3SQ 4X6AH 3CQZH 1UWVA 1PYSB 1X55A 2AWNA 3F8TA 1FVIA 3W1GA 2I5MX 1J5EQ 1M1KC 4O2DA 1DGSA 2CWPA 4NPSA 4IFDG 4LFAL 1Q7YC 2E2IH 2NVXH 1N36Q 5GADC 4YWLA 5IYCH 2K52A 3UDFA 3J80c 5GAGC 4X64Q 2OTLA 4OONA 2IX0A 2JE6I 1KAWA 1YIJA 4B3MQ 4RG1A 2FXQA
chains in the Genus database with same CATH superfamily
1P8LA 1X3GA 3BJUA 2E2JH 1BUVT 4Y7NH 4OO1G 1Y1VG 4YIJA 4E6IA 1PZID 1HUMA 2MQHA 2R61A 3EQLC 1Q8KA 3I91A 3NK9A 2VUMG 2WAQE 1PH1A 1N34Q 1KIXA 3M4YA 4IPGA 1LTRD 3NEMA 2HQEA 1PTOC 2JA6G 3CC7A 3TSSA 1VQ7A 1PH3A 4XYQA 4XQJA 4DUYL 2H4OA 3FDTA 1FGBD 1TIID 4I65A 4BBRB 4A3CH 4TVAB 1I5FA 3GTQH 1M4VA 5M5WB 4MTKA 1LACA 2NBFA 3KJPA 4OO1H 1Y1VH 4DR1L 2UXBQ 2B8FA 2ICIA 4XDXA 2WFWA 4HMJA 3SK5A 3DLLA 3ND9A 1AW7A 2Q2IA 5KYLA 2ZM6L 1V8QA 2E2IB 4UP9A 2ZXOA 1W6KA 1F2YA 4HIOA 2JA6H 4AIMA 2L5TA 5JOBA 5K5PA 3R3OA 5DAUA 4B9WA 2KBNA 4NXML 4A3IB 3S17H 2JA7B 1UE6A 1YVCA 4HIKA 1FNWA 2X6GA 3P75A 4N9TA 4A3LG 3GTKB 1EZ8A 2WKCA 2A6HD 5JJLA 1TWAH 2CQOA 2E75C 2IJ0A 3KK7A 1HZCA 2Z8LA 1E24A 1VS0A 1PHJA 2G9HD 1Y1WG 4DNIA 1F9PA 3KDFB 2RHSB 1SEBD 2L15A 5C3EB 2ICEC 5LMNL 2UU9L 1T9HA 4QUCA 4X3TA 5C3WA 4A3LH 3H0GH 1UE1A 4CKBA 3HKSA 1QILA 3VDYA 3ERQA 4J1MA 5BR8L 4RGNA 1SE3A 2O5JC 4JV5L 1Q46A 3K5MA 1YJNA 2OWOA 3SGIA 3RR5A 1SE4A 2CH4A 4GS3A 2B2YA 3RZOB 1Y1WH 1DCZA 3PUXA 1TWFB 2VB2X 2M00A 3EBEA 2PYKA 2F0NA 1PRTD 3TBIB 1CA6A 3TS0A 4PZ8A 1LTAD 3QOJA 4OIKA 1N33Q 5CV8A 2KCCA 1VQLA 5IIFA 3WDNA 1EY9A 2RA4A 1NNXA 1H9SA 4UHVA 3TQYA 3SVMA 4UDUC 4PMCA 1RCVD 1SYBA 1O7IA 3CKIB 3A0JA 2FINB 1SSOA 4ABNA 5IGBA 4H44C 4DFAA 1QVCA 3L7ZC 4X62L 3S1QB 1RF2D 1X9NA 4R9WA 3C2PA 1SYEA 5C44H 4L5QA 1Y8NB 1D7QA 1EFID 1YHAA 1SYFA 5JAVA 3P1HA 1XJVA 2K5WA 2Y0SE 3SK8A 1QZHA 4G7OC 5T1IA 2F0FA 1E2VA 2Z6KA 1HRJA 2VS1A 1YI2A 3PIO3 1NE3A 2L11A 2NZ1D 3BZCA 4B3RL 1RIPA 3RNUA 4YHHL 3D31A 2EYHA 1TWCH 1MBYA 1STBA 5JPNC 3NTIA 3R2IA 2IWHA 3A54A 1WCMB 1SJHD 1BVSA 2G5DA 1LTID 3CXCA 3RN2A 1Q1BA 3CCRA 3H15A 2JA5G 1MKHA 2QDLA 3EJIA 4DV7L 2B2UA 1AE2A 2M9VA 1TWHH 2UUAQ 4ZAIA 3K80C 2A6EC 3MWYW 4JOIA 2B2WA 2HIVA 2CQAA 2B2TA 1EIHA 1X6OA 5KIXA 1LUZA 1SLJA 1E0BA 4DR2L 1K8OA 1MIUA 1K9MC 4L5SA 5I9OA 2JA5H 2XRQD 2EYOA 2KHSA 3SR1A 3SK4A 1OO9B 1HFGA 2OEOA 4A3MB 1AE3A 3M7NA 1GUWA 5M5YB 1F9SA 4RGMA 3UI2A 4JI3Q 2UXCL 1PV4A 1HZBA 1NTGA 1RTOA 3VR6A 2A5HA 1U4LA 3G48A 2K7VA 4ME5A 5JEAG 1DM0B 1SMYD 3RLFA 2D0OA 1GUOA 3D8GA 5IP7G 3PSIA 5AFWA 1KHIA 1ESRA 4IUUA 1IBKQ 3SE0A 1RJTA 1PTOF 3VYTA 5KGUA 1L2FA 1YZ6A 1EQTA 3FVQA 2NVYB 3CMEA 3GP7A 1I94L 2MPMA 2E2HH 2TMPA 3J7A5 3FPUB 2E5LL 1YBYA 3T51B 1LT5D 3T1HL 3U4ZA 3I4OA 3OW7A 1PMRA 3H3VI 4KD3A 3PF5A 4JI0L 5JEAH 1CTMA 2NN6G 2EYMA 4IUTA 5CC4A 1PRTB 3NXWA 4JBJA 1Q8IA 4QQBX 3VYRA 3BZDB 4C3HB 2K6AA 5EKLA 4PZ6A 1QOHA 2KEDA 3HOVH 4DR6Q 2F0KA 2BE5C 3M4OH 2KUMA 1EYAA 1EY4A 1WYDA 2Y0SB 3K5LA 1BR9A 1Q3LA 4CHTB 1MI2A 1HNXL 4FVMA 4A3EG 3KDFA 2KHJA 1I50H 1EWCA 4LF9Q 3IKJA 4HJAA 5FLMG 3J81i 3J81E 5ELEA 3F2BA 4U673 1WJJA 2L0CA 4AYBE 1OTCA 2F0HA 2HHHL 1X56A 2Q2HA 3KBXA 4ZQ3A 4XYOA 1SXTA 2IL8A 1VQJA 2DJGC 4A75A 1ESFA 2F0PA 2EY6A 2JSOA 3G7LA 3S1MH 1D1IA 1EY5A 3S15H 4P2CB 1HNWL 3ULJA 3VA7A 3GTLB 2BH8A 4HN7A 5J1ZA 2WB1G 1FYCA 5IODA 2F4VL 2ATWA 1ICWA 1EFWA 4JI5Q 2VQFQ 4DV1L 2KHIA 1GHJA 4F8MA 5FLMH 1QZGA 2RQXA 3NTKA 3EN2A 3EIVA 4H13C 5A2QL 2L1BA 4DV6Q 5C4XB 3EFXD 1I3QB 3SEBA 3STBC 1XWEA 2R7ZG 5C4ZA 1S5BD 1XMQL 1IXRA 3S2HH 3ULLA 1CZGA 5IGGA 1FJGQ 3CAMA 4R8NA 5CORA 2WV6D 3CW2C 1L0YB 1RL2A 2J0TD 3S1RH 1CKNB 1I4GA 1KNEA 4GKKQ 5CBAE 2F03A 2EDGA 1WTOA 5IP9G 3JC66 3F2CA 1YNND 1HNXQ 1X65A 3OMCA 3QOLA 4DUZL 5F2DA 3HGBA 4CDCC 4K6DA 5H1SE 4LMQD 1QG7A 3U58A 1D8LA 2WACA 4FF2A 4OX9Q 1ILQA 1EIFA 4G4KA 3HP3A 3RD4A 5JEAJ 1A0IA 3DMUA 4LWCA 1X3FA 1D5ZC 1I6HB 2A69C 1VQIA 1KC8C 3CP0A 1AZPA 3DEPA 4P72A 5CV5A 3M3YB 1SJED 1B1ZA 1IBMQ 3HOYB 1JICA 2E76C 1ET6A 1SNDA 1CZWA 3NWTA 1PZJD 2IW3A 2DNEA 2KEEA 1PVOA 1KABA 1W6JA 5FLXL 3S16B 4IPHA 5FOBB 1IBLQ 5CYUA 4OWTB 2EY1A 4RHSA 4ZYSA 4TSSA 3Q24A 1U4RA 5IYCG 1BBUA 3MVVA 4DV3Q 2IX1A 1GUGA 4NKLA 4A3IG 4C3JB 4LFCQ 2JA7G 4FDBA 2K5VA 4KJNA 1KDCA 2VXWA 4BBRH 2MNAA 3FP9A 3ICEA 5M5WH 1K73C 2WB1E 3G6EA 4X3KA 4AYBB 1FNUA 2QDBA 1UWVA 1PYSB 3W1GA 3IL8A 2PMZB 1J5EQ 4TRDA 1PTOD 4O2DA 5EPKA 3DXJC 4LFAL 2E2IH 4XQNA 1N36Q 1ENAA 5IYCH 4X64Q 1DOMA 4B3MQ 1TY0A 1KAWA 2NVQB 3D4WA 4ZUIA 4A3IH 1X3PA 2EE1A 3U50C 3H3VC 1M90C 3URYA 2UUCL 1B3QA 5J3BA 2GN5A 1XMOL 3GTKH 1ZEQX 1CQVA 4KKSA 1WI5A 1Y8OB 2PCFB 2V4DA 5EBDA 3MXPA 1VQNA 5AJ3Q 4LNQA 4R4IA 4GN4B 4ID6A 3CCLA 4KHZA 5IWAQ 2FFKB 1U9RA 3TN2A 5KNBA 5ELFA 1L1OC 5JJIA 3HS0C 5C3EH 2LKVA 1VQAA 2R93G 4APVA 3E9IA 3R2TA 2GA4B 2PNRC 4GN5A 1EIYB 1E7ZA 2FMMA 1H9JA 5DM63 3OPOA 1UEBA 4DR7L 2A73B 3NHHA 1V43A 2IX3A 4KI0A 2D2CC 1YHBA 4JVZA 3S1NB 4K5VA 2A68C 1VF5C 1LTSD 3G6JB 1TS4A 4QGUA 1QE6A 1IHZA 3RZOH 2UXDQ 3HOXG 1F2ZA 1V1OA 1MSHA 1IKLA 2BH2A 3PO3G 2YTYA 1IW7D 1W3SA 4GKJL 3T53B 2ZTEA 1Q12A 4WJWA 2I07B 4OGQC 3NWSA 3MFYA 4F87A 1EY6A 1H9MA 4BWGB 4DR4Q 3A74A 2MO0A 3FPPA 2YYZA 1G291 2EJFC 4OEMB 2F0OA 1EEID 4ZLTF 1WD1A 2EYJA 4DGZA 2ZT9C 1KL9A 2R92G 3DWQA 1B7YB 1WFQA 5CV4A 1L0WA 1VQBA 4QCLA 3L3OC 3L2PA 4IUVA 3MTSA 4IZ8A 2EXDA 1A2TA 4JI6Q 2OTJA 1PFBA 5KEEA 1RODA 5IGDA 5FKAC 5HURA 3OTOQ 4JI7L 4IUPA 3S1QH 1O80A 5I2YA 2CH4W 4DNRB 3QO2A 1WCMG 3S9WA 4IPDA 3HOWB 2WB1B 1O78A 2K1BA 4NXNL 2NWGA 3TP5A 3Q8DA 4G57A 2K50A 1EYCA 1LV9A 5I6YA 4MN3A 5ELCA 2IHFA 1G6ZA 5EJWA 1II3A 4ZRZA 1HCZA 3M4PA 3RN5A 3AFQA 5C0XG 4K5XA 2Z0SA 1IKMA 4KV6A 1SAPA 1A2UA 1S72A 1EU3A 4YCVA 2R7ZB 1HR0Q 1MHWC 3GV3A 2N49A 3Q23A 1H9KA 1R9TB 1WCMH 4DV4L 1CKNA 4YY3L 1QCBD 2WIIB 3H94A 2A19A 3QR8A 1AH9A 3J80E 1XPUA 4A3GB 1X54A 1HQRD 4A3KB 2K05A 2V1CC 4A3MG 1GUTA 2QF7A 2Q8TA 1NAPA 2I5HA 4BA1I 1STNA 1JE5A 1PTOB 4RGTA 3VYUA 4UY8C 4DV0Q 4LFBL 3KF6B 3J7YW 3D4RA 2SDFA 5C0XH 2YU9B 1HA6A 2K04A 1SROA 5BN5A 2B2UC 2K01A 4XTCS 4DV2L 1WD0A 1DYQA 1CHPD 4QY7A 1S4ZA 4RKLA 3KOJA 4F7XA 1I4QA 3J81c 4GNXC 2ZJPA 3I72A 3PMFA 3TP8A 1VQKA 5G3LF 1B9NA 4IFDH 3GTOB 3PO2G 2B2TC 1MSGA 1ENFA 4A3MH 1UAPA 1VQHA 5M5YH 3KF8B 2N88A 3NSWA 3E6ZX 2VW9A 5IT9E 2VUMH 2OF1A 1B44D 3I4LA 2HCIA 2J4XA 4LF7L 3NBHB 4JG2A 4C3HG 4KN7C 3AEVA 3B6YA 4DK1A 2NVYH 5IGEA 4FNFA 1C8CA 2VL6A 1DJRD 2Y0SG 2Z9HA 3M9BA 1AP0A 2F0IA 2KCMA 2XWBB 1G8ZD 3GQBA 1A8VA 3CCJA 4B3SL 3ZJYC 3EROA 1ILPA 4TKOB 4KHPQ 1KLUD 2PO4A 3K7AB 5D3IB 4UP8A 1B70B 1Z6HA 4OO1I 4C3HH 1B50A 4MNOA 1E3PA 3CCMA 4OHJA 2B2VC 1JWSD 2HCCA 1WTHA 3W5OA 3FKIB 4JI1L 2MJ8A 5M5XB 4DV2Q 2NZOA 2CVRA 3T1YL 1SE2A 2WINB 1RKNA 1ZKOA 4HJ8A 3AQQA 4DUYQ 1HXYD 3NENA 4L8JA 4DAYB 1K3RA 4GOPC 2H5XA 1RTNA 2BE5D 1BCPC 4DR1Q 4M1UB 2UUBL 2R93B 2F3IA 4XT3B 1TU2B 4GN3B 1A3TA 5C4XG 1BKBA 1OXSC 1KD1C 4HMIA 4RCOA 1Q90A 4C2MB 3AYHB 4DK3C 3KLRA 4XXEA 2ZM6Q 2F52A 2XVSA 4EQPA 3MXNA 3WOFA 5CR3A 1LT3D 4X66L 2YTXA 1J6QA 4NXMQ 4IN3A 1VQ6A 1CKMA 2NZHA 1XNQL 2WKDA 3HOXB 4IFDJ 1PH4A 2XRSD 1XTDA 2VQEL 4YCUA 1DD2A 1TS3A 3PO3B 3FHWA 3CPWA 4Y52H 5C6AA 1F77A 5C4XH 4DU9A 4JK1C 4KN4C 3UDGA 1I3QH 2L9HA 3IFDA 4P74A 1HQMC 1YNJD 1SE8A 1BDOA 2Q2TA 1EOVA 4DR3L 3CRLC 3ERSX 5ELNA 1PH2A 5LMNQ 1KAAA 2R92B 3D6CA 4G7HC 2UU9Q 3VR3A 4LW1A 3HOYG 2N78A 4KHVA 3JAMc 2CKZB 3PIP3 5BR8Q 4JI2L 3E0JA 3P7JA 3DM1A 3T1YQ 3I4MG 2RBMA 3DWPA 3STBD 1Z7TA 3PGZA 4A3FB 4JV5Q 1HHVA 2JEAI 1KLGD 4YCWA 4DV5L 2XSCA 5KNCA 3S2DB 1BOSA 4HAEA 1CQFA 4H02A 5CBEE 1QUQB 1I6HH 2NB0A 5C5LA 1AZQA 2BDOA 1GUNA 1JT8A 1PDQA 4C3JG 5LMUL 3M3YH 2ZTDA 4B08A 1S5CD 1B53A 4K0KL 3NQIA 2J7ZA 3TEHB 4HCEA 1YITA 3IRBA 2C35B 1VF7A 2NTSA 3L0OA 4AYBG 1LTLA 2KQ3A 2FHTA 4X66Q 4UAIA 1K8GA 1Q81C 3S16H 3DM3A 1MJEA 1EYGA 5G3LD 2B63B 3A55A 2KENA 4EQ5A 2A69D 1SNQA 1GO3E 2EY2A 1X32A 4MZ9A 1SFOB 1EEFD 3KF6A 5JJZA 4X62Q 1VQPA 4C3JH 4HSPA 2K5DA 1OXVA 3GTGH 2PNHA 3FMCA 1XNRL 4JBKA 3K5NA 3M85A 1JB7A 2E74C 3CPFA 4DR3Q 3ULPA 2AMCB 3K5OA 2DUDA 3Q0AA 2FMCA 2YTVA 1GD7A 3MHBA 3PUYA 4BBSG 4M8AA 2YV5A 4HJ5A 2ASBA 2FJ2A 3PO2B 4ME3A 4J15A 3CCUA 4V190 4B3RQ 2NVQH 4YHHQ 3KJOA 3CCSA 4F88A 4A93G 1OXXK 5I2XA 1EWIA 1LTBD 2XGTA 3CC2A 4J6HA 2EYPA 3HRZC 4IURA 1I4XA 3NBHA 4MTNA 4N8FA 3HKZE 3OWEB 4RAUC 2Q8IB 4DV7Q 1NMGA 1STYA 1Q82C 1JCKB 5IP7H 2F3VA 5FK9C 1U5KA 1CA5A 4OWWB 1V9PA 1YEZA 1XXGA 4LF5L 4L5RC 2AUJD 4V0BA 1TWAB 2CW0C 1F2LA 3OMGA 2ZJQA 2VZAA 1P16A 4DR2Q 3EVQA 1KQSA 1G2TA 1BF4A 4RCNA 1O7YA 2X6LA 3ND8A 3TP6A 4O1NA 1M1KC 2JA8B 2NN6H 2CWPA 5M3FB 3S1NH 4YWLA 5LL6S 3J80c 2OTLA 5GAGC 4OONA 1YIJA 4RG1A 3C46A 3H0GB 3VYSA 2NVTB 1EUJA 4B3TL 2Z4IA 2UXCQ 2NYZD 4P75A 4EQNA 3H91A 5HY6A 3GO5A 2PMZE 5EPJA 4ULLA 3K57A 5BN3A 4DAVA 1WTRA 3A5ZB 1CHQD 4U68A 1GVPA 4A76A 1F2MA 4LF4L 3J7ZC 5GROA 4DAYA 4A3EH 3HOWG 1ICFB 1S3OA 1WTWA 4FXKC 2VNUD 1I94Q 3BVZA 4QIWE 5ELOA 3TZUA 3VR4A 2AQ3B 1CM9A 5J39A 3OYYA 2E5LQ 2IPKD 5CV9A 3T1HQ 2LFNA 1VQ8A 2XTIA 4JI0Q 4L63B 5IT9c 1HZ9A 1AEXA 1X3EA 3C1FA 2NVXB 1JC7A 1ZYRC 1VMPA 4JBMA 2O4XA 4R4OA 1IYJB 4A3GG 5EKKA 4X65L 4HEDA 1XPRA 3CF5A 4A3KG 3MFGA 2RCFA 4BS9A 5C4JH 2Z1CA 1LYLA 1JR0D 1N32L 3RZDB 5IYDG 1U4PA 1C7YA 3DEOA 1KTKA 2JJQA 4K8JA 1J8IA 4FF3A 2DY8A 3SDZA 4EX5A 4FXGC 2R7ZH 1HPCA 1KNAA 3K7UC 4BXXG 2EJGC 1BBWA 1HNZL 2QEJC 1R9TH 4LF8L 1OXTA 3MZ5A 1IZ6A 1M8AA 2JP1A 2HHHQ 3HKZB 4NP5A 1FNVA 2JEBI 4AQYL 4A3KH 4BY1B 1TWCB 2MFIA 1N8RC 3KUPA 3RMHA 3I73A 4KD4A 1EQRA 2L4NA 1LT6D 3CD6A 4C3IB 2IHEA 1PTOH 5IP9H 3VA5A 3I4MB 1NY4A 1HNWQ 2D62A 3NP8A 3QG1A 1TQOA 1UE5A 1WTQA 2F0QA 4GLXA 1JMCA 4LK1C 2YU9H 1W2BA 2JK8A 2PW7A 1E2WA 2OT2A 3C3LA 2F4VQ 3S14B 4BXXH 5DLQE 1Z47A 2HDLA 3AU7A 4HCSA 1NMFA 2F4IA 4DK6C 4DV1Q 1I6VC 2QCPX 3F1ZA 4HIMA 5E7NA 3GTOH 3CCQA 4K2KA 4JYAL 2RVLA 5IGFA 1B9MA 4LUVA 2F0JA 3W3AA 3A7LA 4ZKCB 1E1TA 4NMZA 1DONA 5HGQA 1CI3M 1FR3A 2F0VA 5KNDA 5A2QE 2F1MA 1XMQQ 3GTPB 2BCOA 4CJ0B 4DR5L 1QVGA 3V96A 3A5UA 2SNMA 1UE7A 2HQLA 4RKBA 4DXGA 3KFUA 3U4VA 5E1FA 1JJ2A 2K28A 4MHEA 1N32Q 4WRDA 5FJ8G 3NELA 2HIXA 2I5LX 1MJCA 2JA7H 1H9RA 4A3JB 4DUZQ 4DA2A 4Q5VA 5D14A 3JAMi 2ZTCA 3JAME 1HTLD 4R4CA 1L1OB 4QIWB 5IYBG 3FKIG 4L6TB 4IO9A 3PF4A 2M2LA 1RD9D 3QJYA 2XWJB 1GHKA 4ZUJA 4BBSB 1G2SA 2F0EA 1PFSA 3K7AH 1TKWB 2RDHA 5LHY1 3BU2A 4JI4L 4A93B 2LY7A 4K14A 1I4PA 5DM73 1PH6A 3I4NB 2OQ0A 2TSSA 4DXFA 5IYBH 3FKIH 1HUNA 4CDDC 5M5XH 1U4MA 2JYOA 4DAPA 3W1BA 5M3MB 4KY5A 1LO5D 3HOVB 3Q22A 2EJMA 2EVBA 1TS5A 4RA8A 2QA4A 1IL2A 4PV1C 2RSNA 1HTPA 2O2LD 3V05A 4DF7A 3G71A 2N8NA 3LWUA 2ID0A 4JYAQ 2Q2UA 4ODGA 1TWFH 4O42A 5M9OA 5K36G 5IOCA 5EBCA 4CJ2C 4ZKBB 2R93H 1HJPA 2LS01 2LSSA 1JJGA 1YHQA 1ASYA 2DGYA 2B2YC 4JBWA 1DOKA 3TREA 2ENBA 4C2MH 2R3ZA 3K81C 1DXMA 4LFAQ 1A62A 2SOBA 4PMBA 1L0XB 1H9SB 3GTMB 1JJCB 1K83B 2DNCA 2HUGA 4UPAA 1SDFA 2VY3A 3KYHC 2UUCQ 3HOXH 5K36H 3U9OA 1D2BA 4PQXA 5GQOA 1XMOQ 2R7DA 4FXDA 4POFA 1SBBB 1UEAB 3PO3H 3R93A 1CSPA 3TZDA 3D6WA 3D3RA 3O13A 3OW2A 4HIDA 4A3FG 4HJ7A 3TS2A 2MHVA 3U9SA 3RLNA 2BOSA 3MC0B 3BZKA 2JXMB 1TVXA 3AMUA 5COYA 3UE1A 4A3DB 4N8X1 1C48A 4PZ7A 2R92H 3SXHA 1MGSA 4FO2A 1HH2P 2KJXA 2DN8A 3I3CA 2UXBL 3K59A 4DR7Q 3S2HB 3ITPA 3E3XA 2RCNA 4QB4A 5EGTA 4KMUC 4KLKA 4A3FH 2B3GA 2Z6KC 3BS1A 2L55A 2B63G 4LUOA 4LJZC 1A3VA 3S2DH 4QUFA 3J80i 4C1NK 1PXUA 3H6MA 5T1GA 4X3SA 1WTXA 5JVH3 5I9PA 3ER0A 5C4HA 4CDFC 4R4QA 5EAYA 4GKJQ 4J8QA 2KCNA 4RH6A 4GNXB 1EYDA 3AFPA 1EWHA 4GLVB 3NQTA 3BYYB 5IE8A 1D5MC 3A8IE 1K3BC 5LL6X 3GTJB 2PZUA 3RUZA 5FO9B 1XPOA 1D5XC 3TDQA 1SNMA 1GJXA 1X3QA 2B63H 3N52A 4OXPA 1CFMA 3RLOA 4A3CG 2GVAA 4JOIC 1NJIC 1PYWD 2B2WC 3X3MA 4KJOA 2F0WA 1SFOH 1WTVA 1SNPA 2A6ED 1XYIA 1R4PB 1D1KA 4P71A 5GAHC 4PG3A 3CC4A 4JI7Q 2ZJRA 5CV7A 3J81j 4R4TA 1E1OA 2LXJA 1STAA 2CCZA 3MA2B 4NXNQ 4KY7A 4DPGA 4QF4A 2SEBD 3WWVA 3G4SA 3HOZB 5FO8B 2IY5B 4KTAA 1ET9A 3M7GA 1IYUA 5JPMC 2AKWB 3UDIA 3PO2H 5C0XI 2K5HA 4KKTA 3ONAB 2MP1A 1VQCA 1RDPD 2KCTA 3K8AA 3MEHA 3T4AC 4X3UA 2X69A 3V2TA 3K58A 1TWGB 1N33L 2BA0A 4DV4Q 4IFDI 4YY3Q 1CT1D 2LXKA 2PI2E 2RDFA 2JA8G 4IOAA 5IY0A 3D4DA 2ZXPA 3LNNA 3P20A 5M3FG 1ENCA 5D3DA 1TY2A 3IAYA 2B39A 1I4RA 1JOKA 3PV0A 1JB3A 1A15A 3H0GG 1BBXC 4LFBQ 1L1OA 3BDCA 3QB3A 1BQQT 5E4XA 4P73A 3PUZA 1JOOA 4GOPB 1YNXA 3IFTA 1WTPA 4CGYB 1BCPB 4ALPA 4HR7B 1GOZA 1EY7A 3SHLA 3QIAA 1IL8A 1K8AC 3HZXA 4B9XA 2JA8H 3NTHA 4N9PA 2AUKA 3I90A 3FRPB 5M3FH 4O0AA 1EQVA 4FP5D 1KRTA 2NVTH 4BY7B 1IW7C 2CW0D 3N6RA 3J7AF 1HZAA 2KA7A 1O7ZA 2SNSA 1VMCA 1STEA 1A6XA 5C0XJ 1CK1A 2MUYA 4LF7Q 2BA1A 2F3WA 3TRZA 5CMDA 3GTLH 4CKEA 4WJ4A 1PFNA 2DJFC 2RDGA 1LT4D 2UUAL 1VCIA 1STGA 2F0UA 5EQ0A 3H09A 5C44G 5ELDA 5TSSA 1XX8A 2D9UA 3F2UA 4B3SQ 4X6AH 1X55A 2AWNA 1FVIA 5C5MA 2I5MX 3I8ZA 3HOUB 5KRUA 1DGSA 4NPSA 2NVXH 3DHQA 2WAQB 3UDFA 2IX0A 1B2TA 2L12A 4IQZA 4A3BB 4CDEC 3DWAA 3HKZG 3I56A 4BY1G 2CHBD 3CRKC 4JI3L 3NUCA 3OIQA 4JI1Q 3RZDH 2G9DA 4C3IG 1Y69U 3FEWX 2XNAC 3WOEA 1YJWA 2K5QA 3LWEA 1A63A 3VR2A 4I7AA 4S3SA 2E8GA 5EKIA 4EGVA 2PQEA 4YWKA 1ZYRD 2HDMA 3UDXA 3L9AX 1NR2A 1HR0W 5ISRA 1K8MA 1F9RA 4DN4M 5I4DA 1IBKL 2UUBQ 1NUCA 4QL5A 3MAQA 1T5EA 4BY1H 3KLSA 1JQYD 1S5ED 5E3FA 3ZYYX 3HOYH 2P5ZX 4JPBW 4C3IH 3CQZB 3I4MH 1DOLA 4G7ZC 3TMEA 1NBWA 3CCEA 1JWMD 2K4KA 5JJKA 4DNTB 5FLXc 2F0GA 4XT1B 3S14H 2MGSA 1XNQQ 2E2JB 4Y7NB 4DR6L 2VQEQ 1SYCA 4GNXA 4OWXB 2R7FA 1HA5A 3MXGA 3LX0A 1R4QB 4KKUA 4TQUS 4A3JG 3OOCA 3CU7A 5D65A 2K33A 4IALA 4NW2A 3J81L 3UE0A 3GTPH 3A56A 5ELBA 2N55A 2KVMA 3K0YA 3H3VH 5C3XA 4LF9L 1VQDA 3GTQB 4POGA 1Y1VB 3I2ZA 3KF8A 1ML0D 1NCVA 3BG3A 4FF4A 2K5NA 2O5IC 1K0SA 2JQOA 4JI2Q 2A6HC 2VUMB 4A3JH 3I4NG 1VDZA 1GXDC 1QNUA 1A3UA 1VQ9A 4EVOA 1VQ4A 2EPBA 4DV5Q 2JA6B 1SRUA 1YJ9A 4Q0FA 5IGCA 1VQGA 1PLFA 5M3MG 3CHBD 1GUSA 4OELB 1VQOA 3HOVG 3S17B 2EYLA 2XIWA 2PZWA 2EXZA 3R8BA 4JI5L 2RHQB 2VQFL 4BBSH 5LMUQ 1G51A 3W2DA 4K5WA 3A8JE 4K0KQ 1UNSA 1S5FD 4A93H 4DV6L 2R6GA 2B2VA 2GVBA 3VR5A 1QWYA 4RMFA 3I4NH 4IJLA 5L37A 2ES2A 1K0RA 1SNOA 3E0EA 1G6PA 1FJGL 1Z9FA 5M3MH 5A35A 2QGQA 2ZXRA 4OL7A 2RKSA 2K32A 2D5DA 3K6OA 4EQOA 5HGTA 4K8IA 3C1EA 4GKKL 3KBGA 4LF6L 4UP7A 1PRTC 2QW7A 4GOPA 1XNRQ 3CCVA 3SK6A 1B4OA 1JE4A 5CV6A 1S5DD 2AWOA 3A8KE 1Y1WB 4OX9L 2PQAB 2Z6BA 2A68D 1JOQA 1FL0A 3D0FA 4ZCKA 3GTMH 4KY6A 3Q6SA 4A3DG 3PCOB 1K83H 1FGUA 1IBML 5CGKA 4R8IA 1LTGD 2F0LA 4FF1A 2WP8J 4DAMA 2ALYB 2NUCA 3T13A 1BCPF 4IUQA 1BXTA 2NN6I 4I7ZC 1Q86C 1QB5D 1YNJC 1QNKA 5EPLA 3OIPA 2JN4A 1EY8A 1IBLL 2I46A 4RFBA 4RWSC 3HOWH 4IJHA 1SN8A 4LF5Q 4DV3L 2KECA 2KOLA 2MO1A 3PUVA 4ZK9B 2LMCB 4QJFA 4LFCL 1PH7A 1V1PB 1U0LA 4A3DH 3HFZB 5C44B 5LMNW 1LLRD 1Y14B 1UUPA 4H0LC 4H7BA 2K03A 4L5TA 1JORA 2HT1A 3KLSX 1VQ5A 4HTHA 1CKOA 1LABA 5BN4A 1EQQA 4Z9CB 1Q1EA 1J5EL 4DK0A 2BDNA 1EOTA 4WORA 1N36L 1TR5A 4R1JA 3JAML 4B3TQ 4X64L 4B3ML 1GKHA 4DKAC 4LF6Q 1NSNS 1WVLA 4A3GH 3QWNA 1GM5A 2NTTA 2D0PA 2HD3A 1NR4A 1PH8A 4CJ1B 1KRSA 5IYDH 1VQEA 4HSVA 4PMWA 4LF4Q 1E2ZA 1SYGA 3S24A 4OIJA 1QUQA 4KK7A 2A8VA 1TWHB 3GTJH 2QEXA 4PNYA 5AJ3L 4JCVE 2PI2A 5DEHA 5IWAL 3HOZG 1H95A 4BBRG 4K2LA 4JC0A 1FD7D 1K28A 3BVMA 1SMYC 4C56C 5GAEC 2RSOA 3BDOA 1PH5A 2A1AA 2K14A 1DZ1A 2JA5B 2DY7A 3GD7A 1KDAA 4QMGA 4YWMA 4IOCA 4X65Q 3NE5B 2UXDL 3GTGB 3HOZH 2N3SA 4A4IA 1C4QA 1F9QA 1SYDA 5JVG3 2PW5A 1MD2D 1ONLA 3MEFA 2XN9C 2QILA 4LAAA 4C1NI 3OHXC 5NUCA 5KYIA 1Y8PB 2F0MA 1JWUD 1HNZQ 4DR4L 4LF8Q 1TWGH 3I7FA 1EU4A 1PZKD 4JI8L 2C9OA 3TP7A 1LTTD 3HEJA 4ILWA 2E2DC 1ZXTA 5C3EG 5I6WA 1OXUA 1ASZA 4NDXA 4AQYQ 1I4HA 2E2HB 1O7LA 1RHPA 3BYTB 2C5CA 1KXLA 5FJ8H 1QVFA 4BY7G 4JI6L 3OWFA 2H1EA 1VQFA 1TS2A 3CMAA 2F0SA 3OTOL 1PA6A 4IUNA 1CUKA 2K75A 1SMXA 4RHRA 2RF4A 4IPCA 1XTCD 4LUZA 5FO7B 3PUWA 2Z4HA 2OXPA 2EZVA 2AHOB 5FLXE 3E9HA 3MXUA 3M4OB 4BA2I 3GDEA 1E22A 3A7AB 2AQ1B 4JW0A 1C0AA 1T5XD 1EZ6A 3AB9A 4BY7H 2A74C 1G91A 1HFNA 4DR5Q 1D6EC 3BDLA 2EYFA 3F2DA 3EA6A 3T56B 1J9OA 2OCEA 1I50B 3J80L 1HR0L 1PFMA 1WOCA 3X3NA 3HOUG 3MXNB 3NBIA 2WAQG 4XQQA 3HG9A 1C9OA 4WJ3M 1TXYA 3J7AV 1LM0A 3PQIA 1EL0A 1AN8A 4A3BG 4GLAC 1BCPD 2VB3X 2OQKA 3PIOA 3S1MB 2F0DA 3S15B 4DV0L 5DNFA 4XIGS 1IYVA 1PRTF 3PIPA 2PQAA 4A3EB 1VQMA 2CWAA 2EIFA 4MIUA 2PZTA 1BO0A 4JI8Q 1N34L 2B29A 2CFMA 3HOUH 1EIGA 5J22A 3I55A 4JI4Q 1B3AA 3DUZA 3K0XA 1B8AA 1CSQA 2EY5A 2EOTA 4A3BH 1YNNC 5IT9L 1TT2A 2Q8RE 1QJOA 4WFN3 3OSOA 2I0QA 4FYDA 2EQSA 4NB3A 3NPPA 2PPBC 3M4QA 2JA9A 5E4WC 3T16A 3LGJA 1S40A 3S1RB 1SR3A 5C4JB 1AFPA 1V1PA 2IT1A 1PYBA 1STHA 4AH6A 4CKCA 4HJ9A 1SNCA 3GV6A 2AQ2B 2QKIC 2B8GA 1EY0A 3E5SA 1N9WA 3KLWA 1PH9A 4K6LA 1V1QA 2F0TA 3CQZH 4CBVA 3F8TA 3I70A 4RGOS 4GZYC 4IFDG 1BNZA 1Q7YC 5GADC 3BVGA 2K52A 4KHPL 1KDBA 2JE6I 2FXQA
chains in the Genus database with same CATH topology
1P8LA 1X3GA 1EUJA 3BJUA 2E2JH 3HKZG 4Y7NH 4A3IH 4B3TL 4OO1G 2UXCQ 1Y1VG 4P75A 3I56A 3U50C 4BY1G 1M90C 4JI3L 2UUCL 5HY6A 2MQHA 3GO5A 5J3BA 2PMZE 1Q8KA 4JI1Q 2GN5A 3RZDH 1XMOL 3GTKH 1YJWA 2VUMG 2WAQE 3A5ZB 1PH1A 1N34Q 1KIXA 4IPGA 1WI5A 1GVPA 4A76A 1A63A 3NEMA 4LF4L 3J7ZC 5GROA 2E8GA 1VQNA 4A3EH 2JA6G 3CC7A 3HOWG 5AJ3Q 1VQ7A 4LNQA 4R4IA 4YWKA 1S3OA 4GN4B 3UDXA 3CCLA 4KHZA 1HR0W 5IWAQ 1PH3A 4DUYL 1L1OC 5JJIA 1IBKL 2VNUD 1I94Q 5ELOA 4QIWE 4A3CH 5C3EH 4TVAB 1I5FA 3GTQH 2UUBQ 4QL5A 3OYYA 3KJPA 1VQAA 1Y1VH 4APVA 4DR1L 2E5LQ 3E9IA 2R93G 2UXBQ 4BY1H 1EIYB 4GN5A 3HOYH 2WFWA 3T1HQ 1E7ZA 1VQ8A 4C3IH 2XTIA 1UEBA 4DR7L 4JI0Q 5IT9c 3I4MH 1HZ9A 3DLLA 1V43A 1NBWA 4KI0A 2Q2IA 2ZM6L 3CCEA 1YHBA 2K4KA 1X3EA 4UP9A 4HIOA 5JJKA 2JA6H 4AIMA 5FLXc 4JBMA 4QGUA 3S14H 1XNQQ 2KBNA 4NXML 3RZOH 4R4OA 3S17H 1IYJB 4A3GG 2UXDQ 4X65L 1XPRA 1UE6A 3CF5A 4DR6L 4A3KG 1YVCA 3HOXG 2VQEQ 4HIKA 5C4JH 4GNXA 1LYLA 1N32L 4OWXB 4A3LG 2R7FA 4TQUS 2BH2A 3PO3G 2YTYA 5IYDG 1C7YA 4A3JG 1W3SA 4GKJL 5JJLA 1TWAH 2JJQA 2CQOA 2ZTEA 1Q12A 4EX5A 1HZCA 1E24A 4DR4Q 3UE0A 3A74A 3GTPH 1VS0A 2MO0A 2R7ZH 2YYZA 1PHJA 1G291 3K7UC 4BXXG 1BBWA 1HNZL 1R9TH 1Y1WG 4LF8L 3H3VH 4DNIA 1OXTA 1IZ6A 3KDFB 2RHSB 4LF9L 1VQDA 1KL9A 2L15A 2R92G 1B7YB 5LMNL 1WFQA 1L0WA 2HHHQ 4POGA 1VQBA 2UU9L 3I2ZA 3L2PA 2JEBI 4AQYL 4A3KH 2K5NA 1T9HA 2EXDA 2MFIA 1N8RC 4JI6Q 2OTJA 2JQOA 1EQRA 4A3LH 3H0GH 1UE1A 3CD6A 3HKSA 4JI2Q 3VDYA 2IHEA 5IP9H 3OTOQ 4A3JH 1NY4A 4JI7L 3S1QH 1HNWQ 2D62A 5BR8L 3I4NG 1UE5A 1VQ9A 1JMCA 4GLXA 2YU9H 1VQ4A 1W2BA 1WCMG 4DV5Q 4JV5L 4IPDA 2JK8A 1SRUA 1Q46A 1YJ9A 1YJNA 2OWOA 3SGIA 3RR5A 2F4VQ 1VQGA 4NXNL 5M3MG 4BXXH 4GS3A 1VQOA 3Q8DA 1Z47A 5DLQE 2K50A 4DV1Q 1NMFA 4DK6C 1Y1WH 3HOVG 3PUXA 4JI5L 2RHQB 2VQFL 4BBSH 3EBEA 2IHFA 3F1ZA 5LMUQ 5E7NA 4HIMA 1G51A 3GTOH 3CCQA 4JYAL 4K0KQ 3M4PA 4LUVA 3RN5A 3AFQA 4A93H 5C0XG 4DV6L 2R6GA 2Z0SA 3TS0A 1E1TA 2GVBA 4PZ8A 1S72A 5HGQA 1N33Q 4YCVA 1XMQQ 1HR0Q 1VQLA 4DR5L 4RMFA 3I4NH 1QVGA 2N49A 4IJLA 2ES2A 3TQYA 1WCMH 1K0RA 4DV4L 3E0EA 3A5UA 1G6PA 1CKNA 1UE7A 4YY3L 1Z9FA 1FJGL 5M3MH 2HQLA 2QGQA 3KFUA 2A19A 1AH9A 3U4VA 1XPUA 1O7IA 1X54A 1JJ2A 3A0JA 1N32Q 2V1CC 4A3MG 2I5HA 4GKKL 4BA1I 5FJ8G 3NELA 1JE5A 2HIXA 2I5LX 1MJCA 1QVCA 4LF6L 4UP7A 4UY8C 2JA7H 4DV0Q 3L7ZC 4X62L 4LFBL 4DUZQ 4GOPA 3KF6B 1XNRQ 3CCVA 3JAMi 1X9NA 2ZTCA 5C44H 4R4CA 4L5QA 1L1OB 1D7QA 5IYBG 3FKIG 1SROA 1YHAA 2AWOA 4XTCS 4DV2L 4IO9A 3PF4A 4OX9L 4QY7A 2PQAB 1XJVA 3KOJA 2Y0SE 3J81c 4GNXC 1QZHA 2ZJPA 1VQKA 1FL0A 1PFSA 3D0FA 3K7AH 3S1NH 3PO2G 2Z6KA 3GTMH 2VS1A 1YI2A 3BU2A 4JI4L 4A3DG 4A3MH 1NE3A 3PCOB 1K83H 3BZCA 4B3RL 1FGUA 1RIPA 1VQHA 3RNUA 5M5YH 4YHHL 1IBML 3KF8B 2WP8J 4DAMA 3D31A 2ALYB 1TWCH 1PH6A 2OQ0A 2VW9A 2NN6I 1Q86C 5IYBH 3FKIH 1BVSA 2VUMH 5M5XH 3CXCA 3RN2A 3W1BA 1IBLL 1Q1BA 3CCRA 3H15A 2JA5G 1MKHA 2QA4A 4DV7L 4LF7L 1IL2A 3NBHB 1AE2A 3HOWH 4JG2A 3G71A 4IJHA 1SN8A 1TWHH 2N8NA 2UUAQ 4DV3L 4LF5Q 3K80C 3AEVA 2ID0A 4JYAQ 3B6YA 2Q2UA 2MO1A 3PUVA 1TWFH 5K36G 4QJFA 4LFCL 1PH7A 4A3DH 1U0LA 2NVYH 3HFZB 4JOIA 5LMNW 2VL6A 1Y14B 2HIVA 4L5TA 1X6OA 2Y0SG 1HJPA 2HT1A 2R93H 3M9BA 2LSSA 1VQ5A 1JJGA 1LUZA 2KCMA 1SLJA 4DR2L 1YHQA 1ASYA 1CKOA 1MIUA 2DGYA 1A8VA 4JBWA 3TREA 3CCJA 1K9MC 4C2MH 1EQQA 4B3SL 4L5SA 3ZJYC 3K81C 4LFAQ 1Q1EA 1A62A 1J5EL 4KHPQ 2JA5H 4UP8A 1B70B 4OO1I 1N36L 4R1JA 4C3HH 1AE3A 3M7NA 4MNOA 4B3TQ 4X64L 1E3PA 4B3ML 1GKHA 1JJCB 4DKAC 3CCMA 4UPAA 4LF6Q 4A3GH 2VY3A 3KYHC 2UUCQ 4JI3Q 3HOXH 2UXCL 1GM5A 5GQOA 2D0PA 2R7DA 1HZBA 1NTGA 1XMOQ 1PV4A 4POFA 3W5OA 1PH8A 3PO3H 1KRSA 3G48A 4JI1L 5IYDH 1VQEA 1CSPA 4PMWA 4DV2Q 5JEAG 2NZOA 3T1YL 4LF4Q 3OW2A 4A3FG 4HIDA 3RLFA 4HJ7A 2D0OA 3S24A 3TS2A 5IP7G 3PSIA 4HJ8A 1QUQA 3RLNA 3AQQA 3BZKA 3GTJH 1KHIA 5AJ3L 2QEXA 4DUYQ 3NENA 4JCVE 2A8VA 1IBKQ 2PI2A 4DAYB 1L2FA 5IWAL 3UE1A 1YZ6A 1K3RA 4GOPC 3HOZG 2H5XA 4PZ7A 2R92H 4BBRG 1H95A 3CMEA 1I94L 4DR1Q 2UUBL 2E2HH 1HH2P 2F3IA 4JC0A 4GN3B 3J7A5 2E5LL 1YBYA 2UXBL 5C4XG 1BKBA 4DR7Q 1OXSC 3T1HL 1KD1C 2RCNA 3U4ZA 3AYHB 3I4OA 3H3VI 4DK3C 2ZM6Q 5GAEC 3PF5A 4JI0L 1PH5A 2F52A 2NN6G 2A1AA 2K14A 4KLKA 4A3FH 3GD7A 4JBJA 4QQBX 2B3GA 2Z6KC 4X66L 2YTXA 1J6QA 2B63G 4LUOA 4YWMA 4PZ6A 4IOCA 4NXMQ 3S2DH 4X65Q 3HOVH 3J80i 1VQ6A 1CKMA 4DR6Q 2NZHA 1XNQL 4IFDJ 3M4OH 2UXDL 1PH4A 3HOZH 2N3SA 3ER0A 1XTDA 4A4IA 2VQEL 4R4QA 5EAYA 4YCUA 4GKJQ 3FHWA 1WYDA 3CPWA 4Y52H 4GNXB 5C4XH 3AFPA 1HNXL 3MEFA 4GLVB 3UDGA 1I3QH 4P74A 5IE8A 4A3EG 1SE8A 3KDFA 1HNZQ 4DR4L 4LF8Q 1TWGH 3I7FA 1XPOA 2KHJA 1I50H 2Q2TA 1EOVA 4JI8L 4DR3L 4LF9Q 3ERSX 5ELNA 4HJAA 5FLMG 3J81i 1PH2A 5LMNQ 2B63H 4OXPA 3RLOA 4A3CG 5C3EG 3F2BA 2GVAA 4JOIC 1NJIC 1OXUA 1ASZA 2UU9Q 1WJJA 4AYBE 4AQYQ 1OTCA 2HHHL 1X56A 2Q2HA 1SFOH 4LW1A 3HOYG 2N78A 1KXLA 5FJ8H 1VQJA 4P71A 3JAMc 4A75A 2CKZB 4JI6L 1QVFA 5GAHC 4PG3A 3CC4A 4JI7Q 4BY7G 1VQFA 5BR8Q 3CMAA 2ZJRA 4JI2L 3T1YQ 3I4MG 3S1MH 3S15H 3J81j 4R4TA 3OTOL 1PA6A 1CUKA 3STBD 3ULJA 2K75A 1E1OA 2LXJA 1SMXA 3PGZA 4JV5Q 1HNWL 2RF4A 2CCZA 2BH8A 4IPCA 4NXNQ 2JEAI 4LUZA 4YCWA 4DPGA 4DV5L 2WB1G 3PUWA 2F4VL 4H02A 2ATWA 1EFWA 2AHOB 4JI5Q 2VQFQ 4DV1L 2KHIA 1QUQB 3E9HA 3WWVA 5FLMH 3G4SA 1QZGA 1I6HH 2IY5B 1JT8A 4BA2I 2AKWB 3GDEA 3UDIA 3EN2A 5C0XI 3PO2H 3EIVA 1E22A 2K5HA 5LMUL 3M3YH 1C0AA 2ZTDA 4DV6Q 4K0KL 1VQCA 4BY7H 3TEHB 2KCTA 3K8AA 1YITA 4DR5Q 3IRBA 3STBC 2C35B 3L0OA 4AYBG 2R7ZG 1LTLA 3F2DA 1N33L 1XMQL 1IXRA 2BA0A 2OCEA 3S2HH 3ULLA 4DV4Q 1HR0L 4X66Q 4IFDI 1K8GA 1Q81C 3S16H 4YY3Q 1FJGQ 3CAMA 2LXKA 3DM3A 1WOCA 1MJEA 2PI2E 1EYGA 3HOUG 2KENA 2JA8G 3CW2C 4IOAA 5IY0A 4EQ5A 3MXNB 1RL2A 5M3FG 2WAQG 1GO3E 1C9OA 3S1RH 4WJ3M 4MZ9A 1CKNB 1TXYA 4GKKQ 3KF6A 1LM0A 3PV0A 3H0GG 4X62Q 1VQPA 4A3BG 4GLAC 4LFBQ 1L1OA 4C3JH 5IP9G 3JC66 3F2CA 2OQKA 3PIOA 1OXVA 3GTGH 1HNXQ 4DV0L 2PNHA 1X65A 4DUZL 1XNRL 4XIGS 4JBKA 5H1SE 4P73A 3PIPA 3M85A 3PUZA 2PQAA 4GOPB 1YNXA 3U58A 1VQMA 1JB7A 1D8LA 2CWAA 3CPFA 2EIFA 4ALPA 4OX9Q 4JI8Q 4DR3Q 1EIFA 1N34L 3ULPA 2AMCB 2DUDA 5JEAJ 1A0IA 2B29A 2CFMA 1GD7A 2YTVA 4LWCA 1X3FA 1K8AC 1KC8C 1VQIA 3PUYA 3HOUH 4BBSG 2JA8H 3CP0A 2YV5A 4HJ5A 2ASBA 4P72A 3I55A 5M3FH 4JI4Q 4ME3A 4J15A 3CCUA 4O0AA 4B3RQ 3K0XA 1B8AA 1IBMQ 2NVQH 4YHHQ 3KJOA 1CSQA 3CCSA 4A93G 1KRTA 2NVTH 1OXXK 4A3BH 1HZAA 1EWIA 2XGTA 3CC2A 2I0QA 1PVOA 4IPHA 2EQSA 5C0XJ 4MTNA 4NB3A 1IBLQ 3HKZE 4OWTB 3M4QA 2JA9A 4DV7Q 2BA1A 1NMGA 4LF7Q 3LGJA 3TRZA 1S40A 5IYCG 3GTLH 1BBUA 1Q82C 1SR3A 5IP7H 4WJ4A 4DV3Q 2IT1A 2IX1A 1PYBA 1U5KA 4OWWB 4AH6A 1V9PA 4A3IG 1YEZA 2UUAL 4LFCQ 1VCIA 4LF5L 2JA7G 4FDBA 2K5VA 4L5RC 4HJ9A 4KHPL 4BBRH 5C44G 2MNAA 3FP9A 3ICEA 5M5WH 1K73C 2WB1E 2ZJQA 3G6EA 2VZAA 1P16A 4DR2Q 1N9WA 1KQSA 3KLWA 1PH9A 1V1QA 4B3SQ 4X6AH 3CQZH 1UWVA 1PYSB 1X55A 2AWNA 3F8TA 1FVIA 3W1GA 2I5MX 1J5EQ 1M1KC 4O2DA 1DGSA 2CWPA 4NPSA 4IFDG 4LFAL 1Q7YC 2E2IH 2NVXH 1N36Q 5GADC 4YWLA 5IYCH 2K52A 3UDFA 3J80c 5GAGC 4X64Q 2OTLA 4OONA 2IX0A 2JE6I 1KAWA 1YIJA 4B3MQ 4RG1A 2FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8L A;  1X3G A;  1EUJ A;  3BJU A;  2E2J H;  3HKZ G;  4Y7N H;  4A3I H;  4B3T L;  4OO1 G;  2UXC Q;  1Y1V G;  4P75 A;  3I56 A;  3U50 C;  4BY1 G;  1M90 C;  4JI3 L;  2UUC L;  5HY6 A;  2MQH A;  3GO5 A;  5J3B A;  2PMZ E;  1Q8K A;  4JI1 Q;  2GN5 A;  3RZD H;  1XMO L;  3GTK H;  1YJW A;  2VUM G;  2WAQ E;  3A5Z B;  1PH1 A;  1N34 Q;  1KIX A;  4IPG A;  1WI5 A;  1GVP A;  4A76 A;  1A63 A;  3NEM A;  4LF4 L;  3J7Z C;  5GRO A;  2E8G A;  1VQN A;  4A3E H;  2JA6 G;  3CC7 A;  3HOW G;  5AJ3 Q;  1VQ7 A;  4LNQ A;  4R4I A;  4YWK A;  1S3O A;  4GN4 B;  3UDX A;  3CCL A;  4KHZ A;  1HR0 W;  5IWA Q;  1PH3 A;  4DUY L;  1L1O C;  5JJI A;  1IBK L;  2VNU D;  1I94 Q;  5ELO A;  4QIW E;  4A3C H;  5C3E H;  4TVA B;  1I5F A;  3GTQ H;  2UUB Q;  4QL5 A;  3OYY A;  3KJP A;  1VQA A;  1Y1V H;  4APV A;  4DR1 L;  2E5L Q;  3E9I A;  2R93 G;  2UXB Q;  4BY1 H;  1EIY B;  4GN5 A;  3HOY H;  2WFW A;  3T1H Q;  1E7Z A;  1VQ8 A;  4C3I H;  2XTI A;  1UEB A;  4DR7 L;  4JI0 Q;  5IT9 c;  3I4M H;  1HZ9 A;  3DLL A;  1V43 A;  1NBW A;  4KI0 A;  2Q2I A;  2ZM6 L;  3CCE A;  1YHB A;  2K4K A;  1X3E A;  4UP9 A;  4HIO A;  5JJK A;  2JA6 H;  4AIM A;  5FLX c;  4JBM A;  4QGU A;  3S14 H;  1XNQ Q;  2KBN A;  4NXM L;  3RZO H;  4R4O A;  3S17 H;  1IYJ B;  4A3G G;  2UXD Q;  4X65 L;  1XPR A;  1UE6 A;  3CF5 A;  4DR6 L;  4A3K G;  1YVC A;  3HOX G;  2VQE Q;  4HIK A;  5C4J H;  4GNX A;  1LYL A;  1N32 L;  4OWX B;  4A3L G;  2R7F A;  4TQU S;  2BH2 A;  3PO3 G;  2YTY A;  5IYD G;  1C7Y A;  4A3J G;  1W3S A;  4GKJ L;  5JJL A;  1TWA H;  2JJQ A;  2CQO A;  2ZTE A;  1Q12 A;  4EX5 A;  1HZC A;  1E24 A;  4DR4 Q;  3UE0 A;  3A74 A;  3GTP H;  1VS0 A;  2MO0 A;  2R7Z H;  2YYZ A;  1PHJ A;  1G29 1;  3K7U C;  4BXX G;  1BBW A;  1HNZ L;  1R9T H;  1Y1W G;  4LF8 L;  3H3V H;  4DNI A;  1OXT A;  1IZ6 A;  3KDF B;  2RHS B;  4LF9 L;  1VQD A;  1KL9 A;  2L15 A;  2R92 G;  1B7Y B;  5LMN L;  1WFQ A;  1L0W A;  2HHH Q;  4POG A;  1VQB A;  2UU9 L;  3I2Z A;  3L2P A;  2JEB I;  4AQY L;  4A3K H;  2K5N A;  1T9H A;  2EXD A;  2MFI A;  1N8R C;  4JI6 Q;  2OTJ A;  2JQO A;  1EQR A;  4A3L H;  3H0G H;  1UE1 A;  3CD6 A;  3HKS A;  4JI2 Q;  3VDY A;  2IHE A;  5IP9 H;  3OTO Q;  4A3J H;  1NY4 A;  4JI7 L;  3S1Q H;  1HNW Q;  2D62 A;  5BR8 L;  3I4N G;  1UE5 A;  1VQ9 A;  1JMC A;  4GLX A;  2YU9 H;  1VQ4 A;  1W2B A;  1WCM G;  4DV5 Q;  4JV5 L;  4IPD A;  2JK8 A;  1SRU A;  1Q46 A;  1YJ9 A;  1YJN A;  2OWO A;  3SGI A;  3RR5 A;  2F4V Q;  1VQG A;  4NXN L;  5M3M G;  4BXX H;  4GS3 A;  1VQO A;  3Q8D A;  1Z47 A;  5DLQ E;  2K50 A;  4DV1 Q;  1NMF A;  4DK6 C;  1Y1W H;  3HOV G;  3PUX A;  4JI5 L;  2RHQ B;  2VQF L;  4BBS H;  3EBE A;  2IHF A;  3F1Z A;  5LMU Q;  5E7N A;  4HIM A;  1G51 A;  3GTO H;  3CCQ A;  4JYA L;  4K0K Q;  3M4P A;  4LUV A;  3RN5 A;  3AFQ A;  4A93 H;  5C0X G;  4DV6 L;  2R6G A;  2Z0S A;  3TS0 A;  1E1T A;  2GVB A;  4PZ8 A;  1S72 A;  5HGQ A;  1N33 Q;  4YCV A;  1XMQ Q;  1HR0 Q;  1VQL A;  4DR5 L;  4RMF A;  3I4N H;  1QVG A;  2N49 A;  4IJL A;  2ES2 A;  3TQY A;  1WCM H;  1K0R A;  4DV4 L;  3E0E A;  3A5U A;  1G6P A;  1CKN A;  1UE7 A;  4YY3 L;  1Z9F A;  1FJG L;  5M3M H;  2HQL A;  2QGQ A;  3KFU A;  2A19 A;  1AH9 A;  3U4V A;  1XPU A;  1O7I A;  1X54 A;  1JJ2 A;  3A0J A;  1N32 Q;  2V1C C;  4A3M G;  2I5H A;  4GKK L;  4BA1 I;  5FJ8 G;  3NEL A;  1JE5 A;  2HIX A;  2I5L X;  1MJC A;  1QVC A;  4LF6 L;  4UP7 A;  4UY8 C;  2JA7 H;  4DV0 Q;  3L7Z C;  4X62 L;  4LFB L;  4DUZ Q;  4GOP A;  3KF6 B;  1XNR Q;  3CCV A;  3JAM i;  1X9N A;  2ZTC A;  5C44 H;  4R4C A;  4L5Q A;  1L1O B;  1D7Q A;  5IYB G;  3FKI G;  1SRO A;  1YHA A;  2AWO A;  4XTC S;  4DV2 L;  4IO9 A;  3PF4 A;  4OX9 L;  4QY7 A;  2PQA B;  1XJV A;  3KOJ A;  2Y0S E;  3J81 c;  4GNX C;  1QZH A;  2ZJP A;  1VQK A;  1FL0 A;  1PFS A;  3D0F A;  3K7A H;  3S1N H;  3PO2 G;  2Z6K A;  3GTM H;  2VS1 A;  1YI2 A;  3BU2 A;  4JI4 L;  4A3D G;  4A3M H;  1NE3 A;  3PCO B;  1K83 H;  3BZC A;  4B3R L;  1FGU A;  1RIP A;  1VQH A;  3RNU A;  5M5Y H;  4YHH L;  1IBM L;  3KF8 B;  2WP8 J;  4DAM A;  3D31 A;  2ALY B;  1TWC H;  1PH6 A;  2OQ0 A;  2VW9 A;  2NN6 I;  1Q86 C;  5IYB H;  3FKI H;  1BVS A;  2VUM H;  5M5X H;  3CXC A;  3RN2 A;  3W1B A;  1IBL L;  1Q1B A;  3CCR A;  3H15 A;  2JA5 G;  1MKH A;  2QA4 A;  4DV7 L;  4LF7 L;  1IL2 A;  3NBH B;  1AE2 A;  3HOW H;  4JG2 A;  3G71 A;  4IJH A;  1SN8 A;  1TWH H;  2N8N A;  2UUA Q;  4DV3 L;  4LF5 Q;  3K80 C;  3AEV A;  2ID0 A;  4JYA Q;  3B6Y A;  2Q2U A;  2MO1 A;  3PUV A;  1TWF H;  5K36 G;  4QJF A;  4LFC L;  1PH7 A;  4A3D H;  1U0L A;  2NVY H;  3HFZ B;  4JOI A;  5LMN W;  2VL6 A;  1Y14 B;  2HIV A;  4L5T A;  1X6O A;  2Y0S G;  1HJP A;  2HT1 A;  2R93 H;  3M9B A;  2LSS A;  1VQ5 A;  1JJG A;  1LUZ A;  2KCM A;  1SLJ A;  4DR2 L;  1YHQ A;  1ASY A;  1CKO A;  1MIU A;  2DGY A;  1A8V A;  4JBW A;  3TRE A;  3CCJ A;  1K9M C;  4C2M H;  1EQQ A;  4B3S L;  4L5S A;  3ZJY C;  3K81 C;  4LFA Q;  1Q1E A;  1A62 A;  1J5E L;  4KHP Q;  2JA5 H;  4UP8 A;  1B70 B;  4OO1 I;  1N36 L;  4R1J A;  4C3H H;  1AE3 A;  3M7N A;  4MNO A;  4B3T Q;  4X64 L;  1E3P A;  4B3M L;  1GKH A;  1JJC B;  4DKA C;  3CCM A;  4UPA A;  4LF6 Q;  4A3G H;  2VY3 A;  3KYH C;  2UUC Q;  4JI3 Q;  3HOX H;  2UXC L;  1GM5 A;  5GQO A;  2D0P A;  2R7D A;  1HZB A;  1NTG A;  1XMO Q;  1PV4 A;  4POF A;  3W5O A;  1PH8 A;  3PO3 H;  1KRS A;  3G48 A;  4JI1 L;  5IYD H;  1VQE A;  1CSP A;  4PMW A;  4DV2 Q;  5JEA G;  2NZO A;  3T1Y L;  4LF4 Q;  3OW2 A;  4A3F G;  4HID A;  3RLF A;  4HJ7 A;  2D0O A;  3S24 A;  3TS2 A;  5IP7 G;  3PSI A;  4HJ8 A;  1QUQ A;  3RLN A;  3AQQ A;  3BZK A;  3GTJ H;  1KHI A;  5AJ3 L;  2QEX A;  4DUY Q;  3NEN A;  4JCV E;  2A8V A;  1IBK Q;  2PI2 A;  4DAY B;  1L2F A;  5IWA L;  3UE1 A;  1YZ6 A;  1K3R A;  4GOP C;  3HOZ G;  2H5X A;  4PZ7 A;  2R92 H;  4BBR G;  1H95 A;  3CME A;  1I94 L;  4DR1 Q;  2UUB L;  2E2H H;  1HH2 P;  2F3I A;  4JC0 A;  4GN3 B;  3J7A 5;  2E5L L;  1YBY A;  2UXB L;  5C4X G;  1BKB A;  4DR7 Q;  1OXS C;  3T1H L;  1KD1 C;  2RCN A;  3U4Z A;  3AYH B;  3I4O A;  3H3V I;  4DK3 C;  2ZM6 Q;  5GAE C;  3PF5 A;  4JI0 L;  1PH5 A;  2F52 A;  2NN6 G;  2A1A A;  2K14 A;  4KLK A;  4A3F H;  3GD7 A;  4JBJ A;  4QQB X;  2B3G A;  2Z6K C;  4X66 L;  2YTX A;  1J6Q A;  2B63 G;  4LUO A;  4YWM A;  4PZ6 A;  4IOC A;  4NXM Q;  3S2D H;  4X65 Q;  3HOV H;  3J80 i;  1VQ6 A;  1CKM A;  4DR6 Q;  2NZH A;  1XNQ L;  4IFD J;  3M4O H;  2UXD L;  1PH4 A;  3HOZ H;  2N3S A;  3ER0 A;  1XTD A;  4A4I A;  2VQE L;  4R4Q A;  5EAY A;  4YCU A;  4GKJ Q;  3FHW A;  1WYD A;  3CPW A;  4Y52 H;  4GNX B;  5C4X H;  3AFP A;  1HNX L;  3MEF A;  4GLV B;  3UDG A;  1I3Q H;  4P74 A;  5IE8 A;  4A3E G;  1SE8 A;  3KDF A;  1HNZ Q;  4DR4 L;  4LF8 Q;  1TWG H;  3I7F A;  1XPO A;  2KHJ A;  1I50 H;  2Q2T A;  1EOV A;  4JI8 L;  4DR3 L;  4LF9 Q;  3ERS X;  5ELN A;  4HJA A;  5FLM G;  3J81 i;  1PH2 A;  5LMN Q;  2B63 H;  4OXP A;  3RLO A;  4A3C G;  5C3E G;  3F2B A;  2GVA A;  4JOI C;  1NJI C;  1OXU A;  1ASZ A;  2UU9 Q;  1WJJ A;  4AYB E;  4AQY Q;  1OTC A;  2HHH L;  1X56 A;  2Q2H A;  1SFO H;  4LW1 A;  3HOY G;  2N78 A;  1KXL A;  5FJ8 H;  1VQJ A;  4P71 A;  3JAM c;  4A75 A;  2CKZ B;  4JI6 L;  1QVF A;  5GAH C;  4PG3 A;  3CC4 A;  4JI7 Q;  4BY7 G;  1VQF A;  5BR8 Q;  3CMA A;  2ZJR A;  4JI2 L;  3T1Y Q;  3I4M G;  3S1M H;  3S15 H;  3J81 j;  4R4T A;  3OTO L;  1PA6 A;  1CUK A;  3STB D;  3ULJ A;  2K75 A;  1E1O A;  2LXJ A;  1SMX A;  3PGZ A;  4JV5 Q;  1HNW L;  2RF4 A;  2CCZ A;  2BH8 A;  4IPC A;  4NXN Q;  2JEA I;  4LUZ A;  4YCW A;  4DPG A;  4DV5 L;  2WB1 G;  3PUW A;  2F4V L;  4H02 A;  2ATW A;  1EFW A;  2AHO B;  4JI5 Q;  2VQF Q;  4DV1 L;  2KHI A;  1QUQ B;  3E9H A;  3WWV A;  5FLM H;  3G4S A;  1QZG A;  1I6H H;  2IY5 B;  1JT8 A;  4BA2 I;  2AKW B;  3GDE A;  3UDI A;  3EN2 A;  5C0X I;  3PO2 H;  3EIV A;  1E22 A;  2K5H A;  5LMU L;  3M3Y H;  1C0A A;  2ZTD A;  4DV6 Q;  4K0K L;  1VQC A;  4BY7 H;  3TEH B;  2KCT A;  3K8A A;  1YIT A;  4DR5 Q;  3IRB A;  3STB C;  2C35 B;  3L0O A;  4AYB G;  2R7Z G;  1LTL A;  3F2D A;  1N33 L;  1XMQ L;  1IXR A;  2BA0 A;  2OCE A;  3S2H H;  3ULL A;  4DV4 Q;  1HR0 L;  4X66 Q;  4IFD I;  1K8G A;  1Q81 C;  3S16 H;  4YY3 Q;  1FJG Q;  3CAM A;  2LXK A;  3DM3 A;  1WOC A;  1MJE A;  2PI2 E;  1EYG A;  3HOU G;  2KEN A;  2JA8 G;  3CW2 C;  4IOA A;  5IY0 A;  4EQ5 A;  3MXN B;  1RL2 A;  5M3F G;  2WAQ G;  1GO3 E;  1C9O A;  3S1R H;  4WJ3 M;  4MZ9 A;  1CKN B;  1TXY A;  4GKK Q;  3KF6 A;  1LM0 A;  3PV0 A;  3H0G G;  4X62 Q;  1VQP A;  4A3B G;  4GLA C;  4LFB Q;  1L1O A;  4C3J H;  5IP9 G;  3JC6 6;  3F2C A;  2OQK A;  3PIO A;  1OXV A;  3GTG H;  1HNX Q;  4DV0 L;  2PNH A;  1X65 A;  4DUZ L;  1XNR L;  4XIG S;  4JBK A;  5H1S E;  4P73 A;  3PIP A;  3M85 A;  3PUZ A;  2PQA A;  4GOP B;  1YNX A;  3U58 A;  1VQM A;  1JB7 A;  1D8L A;  2CWA A;  3CPF A;  2EIF A;  4ALP A;  4OX9 Q;  4JI8 Q;  4DR3 Q;  1EIF A;  1N34 L;  3ULP A;  2AMC B;  2DUD A;  5JEA J;  1A0I A;  2B29 A;  2CFM A;  1GD7 A;  2YTV A;  4LWC A;  1X3F A;  1K8A C;  1KC8 C;  1VQI A;  3PUY A;  3HOU H;  4BBS G;  2JA8 H;  3CP0 A;  2YV5 A;  4HJ5 A;  2ASB A;  4P72 A;  3I55 A;  5M3F H;  4JI4 Q;  4ME3 A;  4J15 A;  3CCU A;  4O0A A;  4B3R Q;  3K0X A;  1B8A A;  1IBM Q;  2NVQ H;  4YHH Q;  3KJO A;  1CSQ A;  3CCS A;  4A93 G;  1KRT A;  2NVT H;  1OXX K;  4A3B H;  1HZA A;  1EWI A;  2XGT A;  3CC2 A;  2I0Q A;  1PVO A;  4IPH A;  2EQS A;  5C0X J;  4MTN A;  4NB3 A;  1IBL Q;  3HKZ E;  4OWT B;  3M4Q A;  2JA9 A;  4DV7 Q;  2BA1 A;  1NMG A;  4LF7 Q;  3LGJ A;  3TRZ A;  1S40 A;  5IYC G;  3GTL H;  1BBU A;  1Q82 C;  1SR3 A;  5IP7 H;  4WJ4 A;  4DV3 Q;  2IT1 A;  2IX1 A;  1PYB A;  1U5K A;  4OWW B;  4AH6 A;  1V9P A;  4A3I G;  1YEZ A;  2UUA L;  4LFC Q;  1VCI A;  4LF5 L;  2JA7 G;  4FDB A;  2K5V A;  4L5R C;  4HJ9 A;  4KHP L;  4BBR H;  5C44 G;  2MNA A;  3FP9 A;  3ICE A;  5M5W H;  1K73 C;  2WB1 E;  2ZJQ A;  3G6E A;  2VZA A;  1P16 A;  4DR2 Q;  1N9W A;  1KQS A;  3KLW A;  1PH9 A;  1V1Q A;  4B3S Q;  4X6A H;  3CQZ H;  1UWV A;  1PYS B;  1X55 A;  2AWN A;  3F8T A;  1FVI A;  3W1G A;  2I5M X;  1J5E Q;  1M1K C;  4O2D A;  1DGS A;  2CWP A;  4NPS A;  4IFD G;  4LFA L;  1Q7Y C;  2E2I H;  2NVX H;  1N36 Q;  5GAD C;  4YWL A;  5IYC H;  2K52 A;  3UDF A;  3J80 c;  5GAG C;  4X64 Q;  2OTL A;  4OON A;  2IX0 A;  2JE6 I;  1KAW A;  1YIJ A;  4B3M Q;  4RG1 A;  2FXQ A; 
#chains in the Genus database with same CATH topology
 1P8L A;  1X3G A;  3BJU A;  2E2J H;  1BUV T;  4Y7N H;  4OO1 G;  1Y1V G;  4YIJ A;  4E6I A;  1PZI D;  1HUM A;  2MQH A;  2R61 A;  3EQL C;  1Q8K A;  3I91 A;  3NK9 A;  2VUM G;  2WAQ E;  1PH1 A;  1N34 Q;  1KIX A;  3M4Y A;  4IPG A;  1LTR D;  3NEM A;  2HQE A;  1PTO C;  2JA6 G;  3CC7 A;  3TSS A;  1VQ7 A;  1PH3 A;  4XYQ A;  4XQJ A;  4DUY L;  2H4O A;  3FDT A;  1FGB D;  1TII D;  4I65 A;  4BBR B;  4A3C H;  4TVA B;  1I5F A;  3GTQ H;  1M4V A;  5M5W B;  4MTK A;  1LAC A;  2NBF A;  3KJP A;  4OO1 H;  1Y1V H;  4DR1 L;  2UXB Q;  2B8F A;  2ICI A;  4XDX A;  2WFW A;  4HMJ A;  3SK5 A;  3DLL A;  3ND9 A;  1AW7 A;  2Q2I A;  5KYL A;  2ZM6 L;  1V8Q A;  2E2I B;  4UP9 A;  2ZXO A;  1W6K A;  1F2Y A;  4HIO A;  2JA6 H;  4AIM A;  2L5T A;  5JOB A;  5K5P A;  3R3O A;  5DAU A;  4B9W A;  2KBN A;  4NXM L;  4A3I B;  3S17 H;  2JA7 B;  1UE6 A;  1YVC A;  4HIK A;  1FNW A;  2X6G A;  3P75 A;  4N9T A;  4A3L G;  3GTK B;  1EZ8 A;  2WKC A;  2A6H D;  5JJL A;  1TWA H;  2CQO A;  2E75 C;  2IJ0 A;  3KK7 A;  1HZC A;  2Z8L A;  1E24 A;  1VS0 A;  1PHJ A;  2G9H D;  1Y1W G;  4DNI A;  1F9P A;  3KDF B;  2RHS B;  1SEB D;  2L15 A;  5C3E B;  2ICE C;  5LMN L;  2UU9 L;  1T9H A;  4QUC A;  4X3T A;  5C3W A;  4A3L H;  3H0G H;  1UE1 A;  4CKB A;  3HKS A;  1QIL A;  3VDY A;  3ERQ A;  4J1M A;  5BR8 L;  4RGN A;  1SE3 A;  2O5J C;  4JV5 L;  1Q46 A;  3K5M A;  1YJN A;  2OWO A;  3SGI A;  3RR5 A;  1SE4 A;  2CH4 A;  4GS3 A;  2B2Y A;  3RZO B;  1Y1W H;  1DCZ A;  3PUX A;  1TWF B;  2VB2 X;  2M00 A;  3EBE A;  2PYK A;  2F0N A;  1PRT D;  3TBI B;  1CA6 A;  3TS0 A;  4PZ8 A;  1LTA D;  3QOJ A;  4OIK A;  1N33 Q;  5CV8 A;  2KCC A;  1VQL A;  5IIF A;  3WDN A;  1EY9 A;  2RA4 A;  1NNX A;  1H9S A;  4UHV A;  3TQY A;  3SVM A;  4UDU C;  4PMC A;  1RCV D;  1SYB A;  1O7I A;  3CKI B;  3A0J A;  2FIN B;  1SSO A;  4ABN A;  5IGB A;  4H44 C;  4DFA A;  1QVC A;  3L7Z C;  4X62 L;  3S1Q B;  1RF2 D;  1X9N A;  4R9W A;  3C2P A;  1SYE A;  5C44 H;  4L5Q A;  1Y8N B;  1D7Q A;  1EFI D;  1YHA A;  1SYF A;  5JAV A;  3P1H A;  1XJV A;  2K5W A;  2Y0S E;  3SK8 A;  1QZH A;  4G7O C;  5T1I A;  2F0F A;  1E2V A;  2Z6K A;  1HRJ A;  2VS1 A;  1YI2 A;  3PIO 3;  1NE3 A;  2L11 A;  2NZ1 D;  3BZC A;  4B3R L;  1RIP A;  3RNU A;  4YHH L;  3D31 A;  2EYH A;  1TWC H;  1MBY A;  1STB A;  5JPN C;  3NTI A;  3R2I A;  2IWH A;  3A54 A;  1WCM B;  1SJH D;  1BVS A;  2G5D A;  1LTI D;  3CXC A;  3RN2 A;  1Q1B A;  3CCR A;  3H15 A;  2JA5 G;  1MKH A;  2QDL A;  3EJI A;  4DV7 L;  2B2U A;  1AE2 A;  2M9V A;  1TWH H;  2UUA Q;  4ZAI A;  3K80 C;  2A6E C;  3MWY W;  4JOI A;  2B2W A;  2HIV A;  2CQA A;  2B2T A;  1EIH A;  1X6O A;  5KIX A;  1LUZ A;  1SLJ A;  1E0B A;  4DR2 L;  1K8O A;  1MIU A;  1K9M C;  4L5S A;  5I9O A;  2JA5 H;  2XRQ D;  2EYO A;  2KHS A;  3SR1 A;  3SK4 A;  1OO9 B;  1HFG A;  2OEO A;  4A3M B;  1AE3 A;  3M7N A;  1GUW A;  5M5Y B;  1F9S A;  4RGM A;  3UI2 A;  4JI3 Q;  2UXC L;  1PV4 A;  1HZB A;  1NTG A;  1RTO A;  3VR6 A;  2A5H A;  1U4L A;  3G48 A;  2K7V A;  4ME5 A;  5JEA G;  1DM0 B;  1SMY D;  3RLF A;  2D0O A;  1GUO A;  3D8G A;  5IP7 G;  3PSI A;  5AFW A;  1KHI A;  1ESR A;  4IUU A;  1IBK Q;  3SE0 A;  1RJT A;  1PTO F;  3VYT A;  5KGU A;  1L2F A;  1YZ6 A;  1EQT A;  3FVQ A;  2NVY B;  3CME A;  3GP7 A;  1I94 L;  2MPM A;  2E2H H;  2TMP A;  3J7A 5;  3FPU B;  2E5L L;  1YBY A;  3T51 B;  1LT5 D;  3T1H L;  3U4Z A;  3I4O A;  3OW7 A;  1PMR A;  3H3V I;  4KD3 A;  3PF5 A;  4JI0 L;  5JEA H;  1CTM A;  2NN6 G;  2EYM A;  4IUT A;  5CC4 A;  1PRT B;  3NXW A;  4JBJ A;  1Q8I A;  4QQB X;  3VYR A;  3BZD B;  4C3H B;  2K6A A;  5EKL A;  4PZ6 A;  1QOH A;  2KED A;  3HOV H;  4DR6 Q;  2F0K A;  2BE5 C;  3M4O H;  2KUM A;  1EYA A;  1EY4 A;  1WYD A;  2Y0S B;  3K5L A;  1BR9 A;  1Q3L A;  4CHT B;  1MI2 A;  1HNX L;  4FVM A;  4A3E G;  3KDF A;  2KHJ A;  1I50 H;  1EWC A;  4LF9 Q;  3IKJ A;  4HJA A;  5FLM G;  3J81 i;  3J81 E;  5ELE A;  3F2B A;  4U67 3;  1WJJ A;  2L0C A;  4AYB E;  1OTC A;  2F0H A;  2HHH L;  1X56 A;  2Q2H A;  3KBX A;  4ZQ3 A;  4XYO A;  1SXT A;  2IL8 A;  1VQJ A;  2DJG C;  4A75 A;  1ESF A;  2F0P A;  2EY6 A;  2JSO A;  3G7L A;  3S1M H;  1D1I A;  1EY5 A;  3S15 H;  4P2C B;  1HNW L;  3ULJ A;  3VA7 A;  3GTL B;  2BH8 A;  4HN7 A;  5J1Z A;  2WB1 G;  1FYC A;  5IOD A;  2F4V L;  2ATW A;  1ICW A;  1EFW A;  4JI5 Q;  2VQF Q;  4DV1 L;  2KHI A;  1GHJ A;  4F8M A;  5FLM H;  1QZG A;  2RQX A;  3NTK A;  3EN2 A;  3EIV A;  4H13 C;  5A2Q L;  2L1B A;  4DV6 Q;  5C4X B;  3EFX D;  1I3Q B;  3SEB A;  3STB C;  1XWE A;  2R7Z G;  5C4Z A;  1S5B D;  1XMQ L;  1IXR A;  3S2H H;  3ULL A;  1CZG A;  5IGG A;  1FJG Q;  3CAM A;  4R8N A;  5COR A;  2WV6 D;  3CW2 C;  1L0Y B;  1RL2 A;  2J0T D;  3S1R H;  1CKN B;  1I4G A;  1KNE A;  4GKK Q;  5CBA E;  2F03 A;  2EDG A;  1WTO A;  5IP9 G;  3JC6 6;  3F2C A;  1YNN D;  1HNX Q;  1X65 A;  3OMC A;  3QOL A;  4DUZ L;  5F2D A;  3HGB A;  4CDC C;  4K6D A;  5H1S E;  4LMQ D;  1QG7 A;  3U58 A;  1D8L A;  2WAC A;  4FF2 A;  4OX9 Q;  1ILQ A;  1EIF A;  4G4K A;  3HP3 A;  3RD4 A;  5JEA J;  1A0I A;  3DMU A;  4LWC A;  1X3F A;  1D5Z C;  1I6H B;  2A69 C;  1VQI A;  1KC8 C;  3CP0 A;  1AZP A;  3DEP A;  4P72 A;  5CV5 A;  3M3Y B;  1SJE D;  1B1Z A;  1IBM Q;  3HOY B;  1JIC A;  2E76 C;  1ET6 A;  1SND A;  1CZW A;  3NWT A;  1PZJ D;  2IW3 A;  2DNE A;  2KEE A;  1PVO A;  1KAB A;  1W6J A;  5FLX L;  3S16 B;  4IPH A;  5FOB B;  1IBL Q;  5CYU A;  4OWT B;  2EY1 A;  4RHS A;  4ZYS A;  4TSS A;  3Q24 A;  1U4R A;  5IYC G;  1BBU A;  3MVV A;  4DV3 Q;  2IX1 A;  1GUG A;  4NKL A;  4A3I G;  4C3J B;  4LFC Q;  2JA7 G;  4FDB A;  2K5V A;  4KJN A;  1KDC A;  2VXW A;  4BBR H;  2MNA A;  3FP9 A;  3ICE A;  5M5W H;  1K73 C;  2WB1 E;  3G6E A;  4X3K A;  4AYB B;  1FNU A;  2QDB A;  1UWV A;  1PYS B;  3W1G A;  3IL8 A;  2PMZ B;  1J5E Q;  4TRD A;  1PTO D;  4O2D A;  5EPK A;  3DXJ C;  4LFA L;  2E2I H;  4XQN A;  1N36 Q;  1ENA A;  5IYC H;  4X64 Q;  1DOM A;  4B3M Q;  1TY0 A;  1KAW A;  2NVQ B;  3D4W A;  4ZUI A;  4A3I H;  1X3P A;  2EE1 A;  3U50 C;  3H3V C;  1M90 C;  3URY A;  2UUC L;  1B3Q A;  5J3B A;  2GN5 A;  1XMO L;  3GTK H;  1ZEQ X;  1CQV A;  4KKS A;  1WI5 A;  1Y8O B;  2PCF B;  2V4D A;  5EBD A;  3MXP A;  1VQN A;  5AJ3 Q;  4LNQ A;  4R4I A;  4GN4 B;  4ID6 A;  3CCL A;  4KHZ A;  5IWA Q;  2FFK B;  1U9R A;  3TN2 A;  5KNB A;  5ELF A;  1L1O C;  5JJI A;  3HS0 C;  5C3E H;  2LKV A;  1VQA A;  2R93 G;  4APV A;  3E9I A;  3R2T A;  2GA4 B;  2PNR C;  4GN5 A;  1EIY B;  1E7Z A;  2FMM A;  1H9J A;  5DM6 3;  3OPO A;  1UEB A;  4DR7 L;  2A73 B;  3NHH A;  1V43 A;  2IX3 A;  4KI0 A;  2D2C C;  1YHB A;  4JVZ A;  3S1N B;  4K5V A;  2A68 C;  1VF5 C;  1LTS D;  3G6J B;  1TS4 A;  4QGU A;  1QE6 A;  1IHZ A;  3RZO H;  2UXD Q;  3HOX G;  1F2Z A;  1V1O A;  1MSH A;  1IKL A;  2BH2 A;  3PO3 G;  2YTY A;  1IW7 D;  1W3S A;  4GKJ L;  3T53 B;  2ZTE A;  1Q12 A;  4WJW A;  2I07 B;  4OGQ C;  3NWS A;  3MFY A;  4F87 A;  1EY6 A;  1H9M A;  4BWG B;  4DR4 Q;  3A74 A;  2MO0 A;  3FPP A;  2YYZ A;  1G29 1;  2EJF C;  4OEM B;  2F0O A;  1EEI D;  4ZLT F;  1WD1 A;  2EYJ A;  4DGZ A;  2ZT9 C;  1KL9 A;  2R92 G;  3DWQ A;  1B7Y B;  1WFQ A;  5CV4 A;  1L0W A;  1VQB A;  4QCL A;  3L3O C;  3L2P A;  4IUV A;  3MTS A;  4IZ8 A;  2EXD A;  1A2T A;  4JI6 Q;  2OTJ A;  1PFB A;  5KEE A;  1ROD A;  5IGD A;  5FKA C;  5HUR A;  3OTO Q;  4JI7 L;  4IUP A;  3S1Q H;  1O80 A;  5I2Y A;  2CH4 W;  4DNR B;  3QO2 A;  1WCM G;  3S9W A;  4IPD A;  3HOW B;  2WB1 B;  1O78 A;  2K1B A;  4NXN L;  2NWG A;  3TP5 A;  3Q8D A;  4G57 A;  2K50 A;  1EYC A;  1LV9 A;  5I6Y A;  4MN3 A;  5ELC A;  2IHF A;  1G6Z A;  5EJW A;  1II3 A;  4ZRZ A;  1HCZ A;  3M4P A;  3RN5 A;  3AFQ A;  5C0X G;  4K5X A;  2Z0S A;  1IKM A;  4KV6 A;  1SAP A;  1A2U A;  1S72 A;  1EU3 A;  4YCV A;  2R7Z B;  1HR0 Q;  1MHW C;  3GV3 A;  2N49 A;  3Q23 A;  1H9K A;  1R9T B;  1WCM H;  4DV4 L;  1CKN A;  4YY3 L;  1QCB D;  2WII B;  3H94 A;  2A19 A;  3QR8 A;  1AH9 A;  3J80 E;  1XPU A;  4A3G B;  1X54 A;  1HQR D;  4A3K B;  2K05 A;  2V1C C;  4A3M G;  1GUT A;  2QF7 A;  2Q8T A;  1NAP A;  2I5H A;  4BA1 I;  1STN A;  1JE5 A;  1PTO B;  4RGT A;  3VYU A;  4UY8 C;  4DV0 Q;  4LFB L;  3KF6 B;  3J7Y W;  3D4R A;  2SDF A;  5C0X H;  2YU9 B;  1HA6 A;  2K04 A;  1SRO A;  5BN5 A;  2B2U C;  2K01 A;  4XTC S;  4DV2 L;  1WD0 A;  1DYQ A;  1CHP D;  4QY7 A;  1S4Z A;  4RKL A;  3KOJ A;  4F7X A;  1I4Q A;  3J81 c;  4GNX C;  2ZJP A;  3I72 A;  3PMF A;  3TP8 A;  1VQK A;  5G3L F;  1B9N A;  4IFD H;  3GTO B;  3PO2 G;  2B2T C;  1MSG A;  1ENF A;  4A3M H;  1UAP A;  1VQH A;  5M5Y H;  3KF8 B;  2N88 A;  3NSW A;  3E6Z X;  2VW9 A;  5IT9 E;  2VUM H;  2OF1 A;  1B44 D;  3I4L A;  2HCI A;  2J4X A;  4LF7 L;  3NBH B;  4JG2 A;  4C3H G;  4KN7 C;  3AEV A;  3B6Y A;  4DK1 A;  2NVY H;  5IGE A;  4FNF A;  1C8C A;  2VL6 A;  1DJR D;  2Y0S G;  2Z9H A;  3M9B A;  1AP0 A;  2F0I A;  2KCM A;  2XWB B;  1G8Z D;  3GQB A;  1A8V A;  3CCJ A;  4B3S L;  3ZJY C;  3ERO A;  1ILP A;  4TKO B;  4KHP Q;  1KLU D;  2PO4 A;  3K7A B;  5D3I B;  4UP8 A;  1B70 B;  1Z6H A;  4OO1 I;  4C3H H;  1B50 A;  4MNO A;  1E3P A;  3CCM A;  4OHJ A;  2B2V C;  1JWS D;  2HCC A;  1WTH A;  3W5O A;  3FKI B;  4JI1 L;  2MJ8 A;  5M5X B;  4DV2 Q;  2NZO A;  2CVR A;  3T1Y L;  1SE2 A;  2WIN B;  1RKN A;  1ZKO A;  4HJ8 A;  3AQQ A;  4DUY Q;  1HXY D;  3NEN A;  4L8J A;  4DAY B;  1K3R A;  4GOP C;  2H5X A;  1RTN A;  2BE5 D;  1BCP C;  4DR1 Q;  4M1U B;  2UUB L;  2R93 B;  2F3I A;  4XT3 B;  1TU2 B;  4GN3 B;  1A3T A;  5C4X G;  1BKB A;  1OXS C;  1KD1 C;  4HMI A;  4RCO A;  1Q90 A;  4C2M B;  3AYH B;  4DK3 C;  3KLR A;  4XXE A;  2ZM6 Q;  2F52 A;  2XVS A;  4EQP A;  3MXN A;  3WOF A;  5CR3 A;  1LT3 D;  4X66 L;  2YTX A;  1J6Q A;  4NXM Q;  4IN3 A;  1VQ6 A;  1CKM A;  2NZH A;  1XNQ L;  2WKD A;  3HOX B;  4IFD J;  1PH4 A;  2XRS D;  1XTD A;  2VQE L;  4YCU A;  1DD2 A;  1TS3 A;  3PO3 B;  3FHW A;  3CPW A;  4Y52 H;  5C6A A;  1F77 A;  5C4X H;  4DU9 A;  4JK1 C;  4KN4 C;  3UDG A;  1I3Q H;  2L9H A;  3IFD A;  4P74 A;  1HQM C;  1YNJ D;  1SE8 A;  1BDO A;  2Q2T A;  1EOV A;  4DR3 L;  3CRL C;  3ERS X;  5ELN A;  1PH2 A;  5LMN Q;  1KAA A;  2R92 B;  3D6C A;  4G7H C;  2UU9 Q;  3VR3 A;  4LW1 A;  3HOY G;  2N78 A;  4KHV A;  3JAM c;  2CKZ B;  3PIP 3;  5BR8 Q;  4JI2 L;  3E0J A;  3P7J A;  3DM1 A;  3T1Y Q;  3I4M G;  2RBM A;  3DWP A;  3STB D;  1Z7T A;  3PGZ A;  4A3F B;  4JV5 Q;  1HHV A;  2JEA I;  1KLG D;  4YCW A;  4DV5 L;  2XSC A;  5KNC A;  3S2D B;  1BOS A;  4HAE A;  1CQF A;  4H02 A;  5CBE E;  1QUQ B;  1I6H H;  2NB0 A;  5C5L A;  1AZQ A;  2BDO A;  1GUN A;  1JT8 A;  1PDQ A;  4C3J G;  5LMU L;  3M3Y H;  2ZTD A;  4B08 A;  1S5C D;  1B53 A;  4K0K L;  3NQI A;  2J7Z A;  3TEH B;  4HCE A;  1YIT A;  3IRB A;  2C35 B;  1VF7 A;  2NTS A;  3L0O A;  4AYB G;  1LTL A;  2KQ3 A;  2FHT A;  4X66 Q;  4UAI A;  1K8G A;  1Q81 C;  3S16 H;  3DM3 A;  1MJE A;  1EYG A;  5G3L D;  2B63 B;  3A55 A;  2KEN A;  4EQ5 A;  2A69 D;  1SNQ A;  1GO3 E;  2EY2 A;  1X32 A;  4MZ9 A;  1SFO B;  1EEF D;  3KF6 A;  5JJZ A;  4X62 Q;  1VQP A;  4C3J H;  4HSP A;  2K5D A;  1OXV A;  3GTG H;  2PNH A;  3FMC A;  1XNR L;  4JBK A;  3K5N A;  3M85 A;  1JB7 A;  2E74 C;  3CPF A;  4DR3 Q;  3ULP A;  2AMC B;  3K5O A;  2DUD A;  3Q0A A;  2FMC A;  2YTV A;  1GD7 A;  3MHB A;  3PUY A;  4BBS G;  4M8A A;  2YV5 A;  4HJ5 A;  2ASB A;  2FJ2 A;  3PO2 B;  4ME3 A;  4J15 A;  3CCU A;  4V19 0;  4B3R Q;  2NVQ H;  4YHH Q;  3KJO A;  3CCS A;  4F88 A;  4A93 G;  1OXX K;  5I2X A;  1EWI A;  1LTB D;  2XGT A;  3CC2 A;  4J6H A;  2EYP A;  3HRZ C;  4IUR A;  1I4X A;  3NBH A;  4MTN A;  4N8F A;  3HKZ E;  3OWE B;  4RAU C;  2Q8I B;  4DV7 Q;  1NMG A;  1STY A;  1Q82 C;  1JCK B;  5IP7 H;  2F3V A;  5FK9 C;  1U5K A;  1CA5 A;  4OWW B;  1V9P A;  1YEZ A;  1XXG A;  4LF5 L;  4L5R C;  2AUJ D;  4V0B A;  1TWA B;  2CW0 C;  1F2L A;  3OMG A;  2ZJQ A;  2VZA A;  1P16 A;  4DR2 Q;  3EVQ A;  1KQS A;  1G2T A;  1BF4 A;  4RCN A;  1O7Y A;  2X6L A;  3ND8 A;  3TP6 A;  4O1N A;  1M1K C;  2JA8 B;  2NN6 H;  2CWP A;  5M3F B;  3S1N H;  4YWL A;  5LL6 S;  3J80 c;  2OTL A;  5GAG C;  4OON A;  1YIJ A;  4RG1 A;  3C46 A;  3H0G B;  3VYS A;  2NVT B;  1EUJ A;  4B3T L;  2Z4I A;  2UXC Q;  2NYZ D;  4P75 A;  4EQN A;  3H91 A;  5HY6 A;  3GO5 A;  2PMZ E;  5EPJ A;  4ULL A;  3K57 A;  5BN3 A;  4DAV A;  1WTR A;  3A5Z B;  1CHQ D;  4U68 A;  1GVP A;  4A76 A;  1F2M A;  4LF4 L;  3J7Z C;  5GRO A;  4DAY A;  4A3E H;  3HOW G;  1ICF B;  1S3O A;  1WTW A;  4FXK C;  2VNU D;  1I94 Q;  3BVZ A;  4QIW E;  5ELO A;  3TZU A;  3VR4 A;  2AQ3 B;  1CM9 A;  5J39 A;  3OYY A;  2E5L Q;  2IPK D;  5CV9 A;  3T1H Q;  2LFN A;  1VQ8 A;  2XTI A;  4JI0 Q;  4L63 B;  5IT9 c;  1HZ9 A;  1AEX A;  1X3E A;  3C1F A;  2NVX B;  1JC7 A;  1ZYR C;  1VMP A;  4JBM A;  2O4X A;  4R4O A;  1IYJ B;  4A3G G;  5EKK A;  4X65 L;  4HED A;  1XPR A;  3CF5 A;  4A3K G;  3MFG A;  2RCF A;  4BS9 A;  5C4J H;  2Z1C A;  1LYL A;  1JR0 D;  1N32 L;  3RZD B;  5IYD G;  1U4P A;  1C7Y A;  3DEO A;  1KTK A;  2JJQ A;  4K8J A;  1J8I A;  4FF3 A;  2DY8 A;  3SDZ A;  4EX5 A;  4FXG C;  2R7Z H;  1HPC A;  1KNA A;  3K7U C;  4BXX G;  2EJG C;  1BBW A;  1HNZ L;  2QEJ C;  1R9T H;  4LF8 L;  1OXT A;  3MZ5 A;  1IZ6 A;  1M8A A;  2JP1 A;  2HHH Q;  3HKZ B;  4NP5 A;  1FNV A;  2JEB I;  4AQY L;  4A3K H;  4BY1 B;  1TWC B;  2MFI A;  1N8R C;  3KUP A;  3RMH A;  3I73 A;  4KD4 A;  1EQR A;  2L4N A;  1LT6 D;  3CD6 A;  4C3I B;  2IHE A;  1PTO H;  5IP9 H;  3VA5 A;  3I4M B;  1NY4 A;  1HNW Q;  2D62 A;  3NP8 A;  3QG1 A;  1TQO A;  1UE5 A;  1WTQ A;  2F0Q A;  4GLX A;  1JMC A;  4LK1 C;  2YU9 H;  1W2B A;  2JK8 A;  2PW7 A;  1E2W A;  2OT2 A;  3C3L A;  2F4V Q;  3S14 B;  4BXX H;  5DLQ E;  1Z47 A;  2HDL A;  3AU7 A;  4HCS A;  1NMF A;  2F4I A;  4DK6 C;  4DV1 Q;  1I6V C;  2QCP X;  3F1Z A;  4HIM A;  5E7N A;  3GTO H;  3CCQ A;  4K2K A;  4JYA L;  2RVL A;  5IGF A;  1B9M A;  4LUV A;  2F0J A;  3W3A A;  3A7L A;  4ZKC B;  1E1T A;  4NMZ A;  1DON A;  5HGQ A;  1CI3 M;  1FR3 A;  2F0V A;  5KND A;  5A2Q E;  2F1M A;  1XMQ Q;  3GTP B;  2BCO A;  4CJ0 B;  4DR5 L;  1QVG A;  3V96 A;  3A5U A;  2SNM A;  1UE7 A;  2HQL A;  4RKB A;  4DXG A;  3KFU A;  3U4V A;  5E1F A;  1JJ2 A;  2K28 A;  4MHE A;  1N32 Q;  4WRD A;  5FJ8 G;  3NEL A;  2HIX A;  2I5L X;  1MJC A;  2JA7 H;  1H9R A;  4A3J B;  4DUZ Q;  4DA2 A;  4Q5V A;  5D14 A;  3JAM i;  2ZTC A;  3JAM E;  1HTL D;  4R4C A;  1L1O B;  4QIW B;  5IYB G;  3FKI G;  4L6T B;  4IO9 A;  3PF4 A;  2M2L A;  1RD9 D;  3QJY A;  2XWJ B;  1GHK A;  4ZUJ A;  4BBS B;  1G2S A;  2F0E A;  1PFS A;  3K7A H;  1TKW B;  2RDH A;  5LHY 1;  3BU2 A;  4JI4 L;  4A93 B;  2LY7 A;  4K14 A;  1I4P A;  5DM7 3;  1PH6 A;  3I4N B;  2OQ0 A;  2TSS A;  4DXF A;  5IYB H;  3FKI H;  1HUN A;  4CDD C;  5M5X H;  1U4M A;  2JYO A;  4DAP A;  3W1B A;  5M3M B;  4KY5 A;  1LO5 D;  3HOV B;  3Q22 A;  2EJM A;  2EVB A;  1TS5 A;  4RA8 A;  2QA4 A;  1IL2 A;  4PV1 C;  2RSN A;  1HTP A;  2O2L D;  3V05 A;  4DF7 A;  3G71 A;  2N8N A;  3LWU A;  2ID0 A;  4JYA Q;  2Q2U A;  4ODG A;  1TWF H;  4O42 A;  5M9O A;  5K36 G;  5IOC A;  5EBC A;  4CJ2 C;  4ZKB B;  2R93 H;  1HJP A;  2LS0 1;  2LSS A;  1JJG A;  1YHQ A;  1ASY A;  2DGY A;  2B2Y C;  4JBW A;  1DOK A;  3TRE A;  2ENB A;  4C2M H;  2R3Z A;  3K81 C;  1DXM A;  4LFA Q;  1A62 A;  2SOB A;  4PMB A;  1L0X B;  1H9S B;  3GTM B;  1JJC B;  1K83 B;  2DNC A;  2HUG A;  4UPA A;  1SDF A;  2VY3 A;  3KYH C;  2UUC Q;  3HOX H;  5K36 H;  3U9O A;  1D2B A;  4PQX A;  5GQO A;  1XMO Q;  2R7D A;  4FXD A;  4POF A;  1SBB B;  1UEA B;  3PO3 H;  3R93 A;  1CSP A;  3TZD A;  3D6W A;  3D3R A;  3O13 A;  3OW2 A;  4HID A;  4A3F G;  4HJ7 A;  3TS2 A;  2MHV A;  3U9S A;  3RLN A;  2BOS A;  3MC0 B;  3BZK A;  2JXM B;  1TVX A;  3AMU A;  5COY A;  3UE1 A;  4A3D B;  4N8X 1;  1C48 A;  4PZ7 A;  2R92 H;  3SXH A;  1MGS A;  4FO2 A;  1HH2 P;  2KJX A;  2DN8 A;  3I3C A;  2UXB L;  3K59 A;  4DR7 Q;  3S2H B;  3ITP A;  3E3X A;  2RCN A;  4QB4 A;  5EGT A;  4KMU C;  4KLK A;  4A3F H;  2B3G A;  2Z6K C;  3BS1 A;  2L55 A;  2B63 G;  4LUO A;  4LJZ C;  1A3V A;  3S2D H;  4QUF A;  3J80 i;  4C1N K;  1PXU A;  3H6M A;  5T1G A;  4X3S A;  1WTX A;  5JVH 3;  5I9P A;  3ER0 A;  5C4H A;  4CDF C;  4R4Q A;  5EAY A;  4GKJ Q;  4J8Q A;  2KCN A;  4RH6 A;  4GNX B;  1EYD A;  3AFP A;  1EWH A;  4GLV B;  3NQT A;  3BYY B;  5IE8 A;  1D5M C;  3A8I E;  1K3B C;  5LL6 X;  3GTJ B;  2PZU A;  3RUZ A;  5FO9 B;  1XPO A;  1D5X C;  3TDQ A;  1SNM A;  1GJX A;  1X3Q A;  2B63 H;  3N52 A;  4OXP A;  1CFM A;  3RLO A;  4A3C G;  2GVA A;  4JOI C;  1NJI C;  1PYW D;  2B2W C;  3X3M A;  4KJO A;  2F0W A;  1SFO H;  1WTV A;  1SNP A;  2A6E D;  1XYI A;  1R4P B;  1D1K A;  4P71 A;  5GAH C;  4PG3 A;  3CC4 A;  4JI7 Q;  2ZJR A;  5CV7 A;  3J81 j;  4R4T A;  1E1O A;  2LXJ A;  1STA A;  2CCZ A;  3MA2 B;  4NXN Q;  4KY7 A;  4DPG A;  4QF4 A;  2SEB D;  3WWV A;  3G4S A;  3HOZ B;  5FO8 B;  2IY5 B;  4KTA A;  1ET9 A;  3M7G A;  1IYU A;  5JPM C;  2AKW B;  3UDI A;  3PO2 H;  5C0X I;  2K5H A;  4KKT A;  3ONA B;  2MP1 A;  1VQC A;  1RDP D;  2KCT A;  3K8A A;  3MEH A;  3T4A C;  4X3U A;  2X69 A;  3V2T A;  3K58 A;  1TWG B;  1N33 L;  2BA0 A;  4DV4 Q;  4IFD I;  4YY3 Q;  1CT1 D;  2LXK A;  2PI2 E;  2RDF A;  2JA8 G;  4IOA A;  5IY0 A;  3D4D A;  2ZXP A;  3LNN A;  3P20 A;  5M3F G;  1ENC A;  5D3D A;  1TY2 A;  3IAY A;  2B39 A;  1I4R A;  1JOK A;  3PV0 A;  1JB3 A;  1A15 A;  3H0G G;  1BBX C;  4LFB Q;  1L1O A;  3BDC A;  3QB3 A;  1BQQ T;  5E4X A;  4P73 A;  3PUZ A;  1JOO A;  4GOP B;  1YNX A;  3IFT A;  1WTP A;  4CGY B;  1BCP B;  4ALP A;  4HR7 B;  1GOZ A;  1EY7 A;  3SHL A;  3QIA A;  1IL8 A;  1K8A C;  3HZX A;  4B9X A;  2JA8 H;  3NTH A;  4N9P A;  2AUK A;  3I90 A;  3FRP B;  5M3F H;  4O0A A;  1EQV A;  4FP5 D;  1KRT A;  2NVT H;  4BY7 B;  1IW7 C;  2CW0 D;  3N6R A;  3J7A F;  1HZA A;  2KA7 A;  1O7Z A;  2SNS A;  1VMC A;  1STE A;  1A6X A;  5C0X J;  1CK1 A;  2MUY A;  4LF7 Q;  2BA1 A;  2F3W A;  3TRZ A;  5CMD A;  3GTL H;  4CKE A;  4WJ4 A;  1PFN A;  2DJF C;  2RDG A;  1LT4 D;  2UUA L;  1VCI A;  1STG A;  2F0U A;  5EQ0 A;  3H09 A;  5C44 G;  5ELD A;  5TSS A;  1XX8 A;  2D9U A;  3F2U A;  4B3S Q;  4X6A H;  1X55 A;  2AWN A;  1FVI A;  5C5M A;  2I5M X;  3I8Z A;  3HOU B;  5KRU A;  1DGS A;  4NPS A;  2NVX H;  3DHQ A;  2WAQ B;  3UDF A;  2IX0 A;  1B2T A;  2L12 A;  4IQZ A;  4A3B B;  4CDE C;  3DWA A;  3HKZ G;  3I56 A;  4BY1 G;  2CHB D;  3CRK C;  4JI3 L;  3NUC A;  3OIQ A;  4JI1 Q;  3RZD H;  2G9D A;  4C3I G;  1Y69 U;  3FEW X;  2XNA C;  3WOE A;  1YJW A;  2K5Q A;  3LWE A;  1A63 A;  3VR2 A;  4I7A A;  4S3S A;  2E8G A;  5EKI A;  4EGV A;  2PQE A;  4YWK A;  1ZYR D;  2HDM A;  3UDX A;  3L9A X;  1NR2 A;  1HR0 W;  5ISR A;  1K8M A;  1F9R A;  4DN4 M;  5I4D A;  1IBK L;  2UUB Q;  1NUC A;  4QL5 A;  3MAQ A;  1T5E A;  4BY1 H;  3KLS A;  1JQY D;  1S5E D;  5E3F A;  3ZYY X;  3HOY H;  2P5Z X;  4JPB W;  4C3I H;  3CQZ B;  3I4M H;  1DOL A;  4G7Z C;  3TME A;  1NBW A;  3CCE A;  1JWM D;  2K4K A;  5JJK A;  4DNT B;  5FLX c;  2F0G A;  4XT1 B;  3S14 H;  2MGS A;  1XNQ Q;  2E2J B;  4Y7N B;  4DR6 L;  2VQE Q;  1SYC A;  4GNX A;  4OWX B;  2R7F A;  1HA5 A;  3MXG A;  3LX0 A;  1R4Q B;  4KKU A;  4TQU S;  4A3J G;  3OOC A;  3CU7 A;  5D65 A;  2K33 A;  4IAL A;  4NW2 A;  3J81 L;  3UE0 A;  3GTP H;  3A56 A;  5ELB A;  2N55 A;  2KVM A;  3K0Y A;  3H3V H;  5C3X A;  4LF9 L;  1VQD A;  3GTQ B;  4POG A;  1Y1V B;  3I2Z A;  3KF8 A;  1ML0 D;  1NCV A;  3BG3 A;  4FF4 A;  2K5N A;  2O5I C;  1K0S A;  2JQO A;  4JI2 Q;  2A6H C;  2VUM B;  4A3J H;  3I4N G;  1VDZ A;  1GXD C;  1QNU A;  1A3U A;  1VQ9 A;  4EVO A;  1VQ4 A;  2EPB A;  4DV5 Q;  2JA6 B;  1SRU A;  1YJ9 A;  4Q0F A;  5IGC A;  1VQG A;  1PLF A;  5M3M G;  3CHB D;  1GUS A;  4OEL B;  1VQO A;  3HOV G;  3S17 B;  2EYL A;  2XIW A;  2PZW A;  2EXZ A;  3R8B A;  4JI5 L;  2RHQ B;  2VQF L;  4BBS H;  5LMU Q;  1G51 A;  3W2D A;  4K5W A;  3A8J E;  4K0K Q;  1UNS A;  1S5F D;  4A93 H;  4DV6 L;  2R6G A;  2B2V A;  2GVB A;  3VR5 A;  1QWY A;  4RMF A;  3I4N H;  4IJL A;  5L37 A;  2ES2 A;  1K0R A;  1SNO A;  3E0E A;  1G6P A;  1FJG L;  1Z9F A;  5M3M H;  5A35 A;  2QGQ A;  2ZXR A;  4OL7 A;  2RKS A;  2K32 A;  2D5D A;  3K6O A;  4EQO A;  5HGT A;  4K8I A;  3C1E A;  4GKK L;  3KBG A;  4LF6 L;  4UP7 A;  1PRT C;  2QW7 A;  4GOP A;  1XNR Q;  3CCV A;  3SK6 A;  1B4O A;  1JE4 A;  5CV6 A;  1S5D D;  2AWO A;  3A8K E;  1Y1W B;  4OX9 L;  2PQA B;  2Z6B A;  2A68 D;  1JOQ A;  1FL0 A;  3D0F A;  4ZCK A;  3GTM H;  4KY6 A;  3Q6S A;  4A3D G;  3PCO B;  1K83 H;  1FGU A;  1IBM L;  5CGK A;  4R8I A;  1LTG D;  2F0L A;  4FF1 A;  2WP8 J;  4DAM A;  2ALY B;  2NUC A;  3T13 A;  1BCP F;  4IUQ A;  1BXT A;  2NN6 I;  4I7Z C;  1Q86 C;  1QB5 D;  1YNJ C;  1QNK A;  5EPL A;  3OIP A;  2JN4 A;  1EY8 A;  1IBL L;  2I46 A;  4RFB A;  4RWS C;  3HOW H;  4IJH A;  1SN8 A;  4LF5 Q;  4DV3 L;  2KEC A;  2KOL A;  2MO1 A;  3PUV A;  4ZK9 B;  2LMC B;  4QJF A;  4LFC L;  1PH7 A;  1V1P B;  1U0L A;  4A3D H;  3HFZ B;  5C44 B;  5LMN W;  1LLR D;  1Y14 B;  1UUP A;  4H0L C;  4H7B A;  2K03 A;  4L5T A;  1JOR A;  2HT1 A;  3KLS X;  1VQ5 A;  4HTH A;  1CKO A;  1LAB A;  5BN4 A;  1EQQ A;  4Z9C B;  1Q1E A;  1J5E L;  4DK0 A;  2BDN A;  1EOT A;  4WOR A;  1N36 L;  1TR5 A;  4R1J A;  3JAM L;  4B3T Q;  4X64 L;  4B3M L;  1GKH A;  4DKA C;  4LF6 Q;  1NSN S;  1WVL A;  4A3G H;  3QWN A;  1GM5 A;  2NTT A;  2D0P A;  2HD3 A;  1NR4 A;  1PH8 A;  4CJ1 B;  1KRS A;  5IYD H;  1VQE A;  4HSV A;  4PMW A;  4LF4 Q;  1E2Z A;  1SYG A;  3S24 A;  4OIJ A;  1QUQ A;  4KK7 A;  2A8V A;  1TWH B;  3GTJ H;  2QEX A;  4PNY A;  5AJ3 L;  4JCV E;  2PI2 A;  5DEH A;  5IWA L;  3HOZ G;  1H95 A;  4BBR G;  4K2L A;  4JC0 A;  1FD7 D;  1K28 A;  3BVM A;  1SMY C;  4C56 C;  5GAE C;  2RSO A;  3BDO A;  1PH5 A;  2A1A A;  2K14 A;  1DZ1 A;  2JA5 B;  2DY7 A;  3GD7 A;  1KDA A;  4QMG A;  4YWM A;  4IOC A;  4X65 Q;  3NE5 B;  2UXD L;  3GTG B;  3HOZ H;  2N3S A;  4A4I A;  1C4Q A;  1F9Q A;  1SYD A;  5JVG 3;  2PW5 A;  1MD2 D;  1ONL A;  3MEF A;  2XN9 C;  2QIL A;  4LAA A;  4C1N I;  3OHX C;  5NUC A;  5KYI A;  1Y8P B;  2F0M A;  1JWU D;  1HNZ Q;  4DR4 L;  4LF8 Q;  1TWG H;  3I7F A;  1EU4 A;  1PZK D;  4JI8 L;  2C9O A;  3TP7 A;  1LTT D;  3HEJ A;  4ILW A;  2E2D C;  1ZXT A;  5C3E G;  5I6W A;  1OXU A;  1ASZ A;  4NDX A;  4AQY Q;  1I4H A;  2E2H B;  1O7L A;  1RHP A;  3BYT B;  2C5C A;  1KXL A;  5FJ8 H;  1QVF A;  4BY7 G;  4JI6 L;  3OWF A;  2H1E A;  1VQF A;  1TS2 A;  3CMA A;  2F0S A;  3OTO L;  1PA6 A;  4IUN A;  1CUK A;  2K75 A;  1SMX A;  4RHR A;  2RF4 A;  4IPC A;  1XTC D;  4LUZ A;  5FO7 B;  3PUW A;  2Z4H A;  2OXP A;  2EZV A;  2AHO B;  5FLX E;  3E9H A;  3MXU A;  3M4O B;  4BA2 I;  3GDE A;  1E22 A;  3A7A B;  2AQ1 B;  4JW0 A;  1C0A A;  1T5X D;  1EZ6 A;  3AB9 A;  4BY7 H;  2A74 C;  1G91 A;  1HFN A;  4DR5 Q;  1D6E C;  3BDL A;  2EYF A;  3F2D A;  3EA6 A;  3T56 B;  1J9O A;  2OCE A;  1I50 B;  3J80 L;  1HR0 L;  1PFM A;  1WOC A;  3X3N A;  3HOU G;  3MXN B;  3NBI A;  2WAQ G;  4XQQ A;  3HG9 A;  1C9O A;  4WJ3 M;  1TXY A;  3J7A V;  1LM0 A;  3PQI A;  1EL0 A;  1AN8 A;  4A3B G;  4GLA C;  1BCP D;  2VB3 X;  2OQK A;  3PIO A;  3S1M B;  2F0D A;  3S15 B;  4DV0 L;  5DNF A;  4XIG S;  1IYV A;  1PRT F;  3PIP A;  2PQA A;  4A3E B;  1VQM A;  2CWA A;  2EIF A;  4MIU A;  2PZT A;  1BO0 A;  4JI8 Q;  1N34 L;  2B29 A;  2CFM A;  3HOU H;  1EIG A;  5J22 A;  3I55 A;  4JI4 Q;  1B3A A;  3DUZ A;  3K0X A;  1B8A A;  1CSQ A;  2EY5 A;  2EOT A;  4A3B H;  1YNN C;  5IT9 L;  1TT2 A;  2Q8R E;  1QJO A;  4WFN 3;  3OSO A;  2I0Q A;  4FYD A;  2EQS A;  4NB3 A;  3NPP A;  2PPB C;  3M4Q A;  2JA9 A;  5E4W C;  3T16 A;  3LGJ A;  1S40 A;  3S1R B;  1SR3 A;  5C4J B;  1AFP A;  1V1P A;  2IT1 A;  1PYB A;  1STH A;  4AH6 A;  4CKC A;  4HJ9 A;  1SNC A;  3GV6 A;  2AQ2 B;  2QKI C;  2B8G A;  1EY0 A;  3E5S A;  1N9W A;  3KLW A;  1PH9 A;  4K6L A;  1V1Q A;  2F0T A;  3CQZ H;  4CBV A;  3F8T A;  3I70 A;  4RGO S;  4GZY C;  4IFD G;  1BNZ A;  1Q7Y C;  5GAD C;  3BVG A;  2K52 A;  4KHP L;  1KDB A;  2JE6 I;  2FXQ A; 
#chains in the Genus database with same CATH homology
 1P8L A;  1X3G A;  1EUJ A;  3BJU A;  2E2J H;  3HKZ G;  4Y7N H;  4A3I H;  4B3T L;  4OO1 G;  2UXC Q;  1Y1V G;  4P75 A;  3I56 A;  3U50 C;  4BY1 G;  1M90 C;  4JI3 L;  2UUC L;  5HY6 A;  2MQH A;  3GO5 A;  5J3B A;  2PMZ E;  1Q8K A;  4JI1 Q;  2GN5 A;  3RZD H;  1XMO L;  3GTK H;  1YJW A;  2VUM G;  2WAQ E;  3A5Z B;  1PH1 A;  1N34 Q;  1KIX A;  4IPG A;  1WI5 A;  1GVP A;  4A76 A;  1A63 A;  3NEM A;  4LF4 L;  3J7Z C;  5GRO A;  2E8G A;  1VQN A;  4A3E H;  2JA6 G;  3CC7 A;  3HOW G;  5AJ3 Q;  1VQ7 A;  4LNQ A;  4R4I A;  4YWK A;  1S3O A;  4GN4 B;  3UDX A;  3CCL A;  4KHZ A;  1HR0 W;  5IWA Q;  1PH3 A;  4DUY L;  1L1O C;  5JJI A;  1IBK L;  2VNU D;  1I94 Q;  5ELO A;  4QIW E;  4A3C H;  5C3E H;  4TVA B;  1I5F A;  3GTQ H;  2UUB Q;  4QL5 A;  3OYY A;  3KJP A;  1VQA A;  1Y1V H;  4APV A;  4DR1 L;  2E5L Q;  3E9I A;  2R93 G;  2UXB Q;  4BY1 H;  1EIY B;  4GN5 A;  3HOY H;  2WFW A;  3T1H Q;  1E7Z A;  1VQ8 A;  4C3I H;  2XTI A;  1UEB A;  4DR7 L;  4JI0 Q;  5IT9 c;  3I4M H;  1HZ9 A;  3DLL A;  1V43 A;  1NBW A;  4KI0 A;  2Q2I A;  2ZM6 L;  3CCE A;  1YHB A;  2K4K A;  1X3E A;  4UP9 A;  4HIO A;  5JJK A;  2JA6 H;  4AIM A;  5FLX c;  4JBM A;  4QGU A;  3S14 H;  1XNQ Q;  2KBN A;  4NXM L;  3RZO H;  4R4O A;  3S17 H;  1IYJ B;  4A3G G;  2UXD Q;  4X65 L;  1XPR A;  1UE6 A;  3CF5 A;  4DR6 L;  4A3K G;  1YVC A;  3HOX G;  2VQE Q;  4HIK A;  5C4J H;  4GNX A;  1LYL A;  1N32 L;  4OWX B;  4A3L G;  2R7F A;  4TQU S;  2BH2 A;  3PO3 G;  2YTY A;  5IYD G;  1C7Y A;  4A3J G;  1W3S A;  4GKJ L;  5JJL A;  1TWA H;  2JJQ A;  2CQO A;  2ZTE A;  1Q12 A;  4EX5 A;  1HZC A;  1E24 A;  4DR4 Q;  3UE0 A;  3A74 A;  3GTP H;  1VS0 A;  2MO0 A;  2R7Z H;  2YYZ A;  1PHJ A;  1G29 1;  3K7U C;  4BXX G;  1BBW A;  1HNZ L;  1R9T H;  1Y1W G;  4LF8 L;  3H3V H;  4DNI A;  1OXT A;  1IZ6 A;  3KDF B;  2RHS B;  4LF9 L;  1VQD A;  1KL9 A;  2L15 A;  2R92 G;  1B7Y B;  5LMN L;  1WFQ A;  1L0W A;  2HHH Q;  4POG A;  1VQB A;  2UU9 L;  3I2Z A;  3L2P A;  2JEB I;  4AQY L;  4A3K H;  2K5N A;  1T9H A;  2EXD A;  2MFI A;  1N8R C;  4JI6 Q;  2OTJ A;  2JQO A;  1EQR A;  4A3L H;  3H0G H;  1UE1 A;  3CD6 A;  3HKS A;  4JI2 Q;  3VDY A;  2IHE A;  5IP9 H;  3OTO Q;  4A3J H;  1NY4 A;  4JI7 L;  3S1Q H;  1HNW Q;  2D62 A;  5BR8 L;  3I4N G;  1UE5 A;  1VQ9 A;  1JMC A;  4GLX A;  2YU9 H;  1VQ4 A;  1W2B A;  1WCM G;  4DV5 Q;  4JV5 L;  4IPD A;  2JK8 A;  1SRU A;  1Q46 A;  1YJ9 A;  1YJN A;  2OWO A;  3SGI A;  3RR5 A;  2F4V Q;  1VQG A;  4NXN L;  5M3M G;  4BXX H;  4GS3 A;  1VQO A;  3Q8D A;  1Z47 A;  5DLQ E;  2K50 A;  4DV1 Q;  1NMF A;  4DK6 C;  1Y1W H;  3HOV G;  3PUX A;  4JI5 L;  2RHQ B;  2VQF L;  4BBS H;  3EBE A;  2IHF A;  3F1Z A;  5LMU Q;  5E7N A;  4HIM A;  1G51 A;  3GTO H;  3CCQ A;  4JYA L;  4K0K Q;  3M4P A;  4LUV A;  3RN5 A;  3AFQ A;  4A93 H;  5C0X G;  4DV6 L;  2R6G A;  2Z0S A;  3TS0 A;  1E1T A;  2GVB A;  4PZ8 A;  1S72 A;  5HGQ A;  1N33 Q;  4YCV A;  1XMQ Q;  1HR0 Q;  1VQL A;  4DR5 L;  4RMF A;  3I4N H;  1QVG A;  2N49 A;  4IJL A;  2ES2 A;  3TQY A;  1WCM H;  1K0R A;  4DV4 L;  3E0E A;  3A5U A;  1G6P A;  1CKN A;  1UE7 A;  4YY3 L;  1Z9F A;  1FJG L;  5M3M H;  2HQL A;  2QGQ A;  3KFU A;  2A19 A;  1AH9 A;  3U4V A;  1XPU A;  1O7I A;  1X54 A;  1JJ2 A;  3A0J A;  1N32 Q;  2V1C C;  4A3M G;  2I5H A;  4GKK L;  4BA1 I;  5FJ8 G;  3NEL A;  1JE5 A;  2HIX A;  2I5L X;  1MJC A;  1QVC A;  4LF6 L;  4UP7 A;  4UY8 C;  2JA7 H;  4DV0 Q;  3L7Z C;  4X62 L;  4LFB L;  4DUZ Q;  4GOP A;  3KF6 B;  1XNR Q;  3CCV A;  3JAM i;  1X9N A;  2ZTC A;  5C44 H;  4R4C A;  4L5Q A;  1L1O B;  1D7Q A;  5IYB G;  3FKI G;  1SRO A;  1YHA A;  2AWO A;  4XTC S;  4DV2 L;  4IO9 A;  3PF4 A;  4OX9 L;  4QY7 A;  2PQA B;  1XJV A;  3KOJ A;  2Y0S E;  3J81 c;  4GNX C;  1QZH A;  2ZJP A;  1VQK A;  1FL0 A;  1PFS A;  3D0F A;  3K7A H;  3S1N H;  3PO2 G;  2Z6K A;  3GTM H;  2VS1 A;  1YI2 A;  3BU2 A;  4JI4 L;  4A3D G;  4A3M H;  1NE3 A;  3PCO B;  1K83 H;  3BZC A;  4B3R L;  1FGU A;  1RIP A;  1VQH A;  3RNU A;  5M5Y H;  4YHH L;  1IBM L;  3KF8 B;  2WP8 J;  4DAM A;  3D31 A;  2ALY B;  1TWC H;  1PH6 A;  2OQ0 A;  2VW9 A;  2NN6 I;  1Q86 C;  5IYB H;  3FKI H;  1BVS A;  2VUM H;  5M5X H;  3CXC A;  3RN2 A;  3W1B A;  1IBL L;  1Q1B A;  3CCR A;  3H15 A;  2JA5 G;  1MKH A;  2QA4 A;  4DV7 L;  4LF7 L;  1IL2 A;  3NBH B;  1AE2 A;  3HOW H;  4JG2 A;  3G71 A;  4IJH A;  1SN8 A;  1TWH H;  2N8N A;  2UUA Q;  4DV3 L;  4LF5 Q;  3K80 C;  3AEV A;  2ID0 A;  4JYA Q;  3B6Y A;  2Q2U A;  2MO1 A;  3PUV A;  1TWF H;  5K36 G;  4QJF A;  4LFC L;  1PH7 A;  4A3D H;  1U0L A;  2NVY H;  3HFZ B;  4JOI A;  5LMN W;  2VL6 A;  1Y14 B;  2HIV A;  4L5T A;  1X6O A;  2Y0S G;  1HJP A;  2HT1 A;  2R93 H;  3M9B A;  2LSS A;  1VQ5 A;  1JJG A;  1LUZ A;  2KCM A;  1SLJ A;  4DR2 L;  1YHQ A;  1ASY A;  1CKO A;  1MIU A;  2DGY A;  1A8V A;  4JBW A;  3TRE A;  3CCJ A;  1K9M C;  4C2M H;  1EQQ A;  4B3S L;  4L5S A;  3ZJY C;  3K81 C;  4LFA Q;  1Q1E A;  1A62 A;  1J5E L;  4KHP Q;  2JA5 H;  4UP8 A;  1B70 B;  4OO1 I;  1N36 L;  4R1J A;  4C3H H;  1AE3 A;  3M7N A;  4MNO A;  4B3T Q;  4X64 L;  1E3P A;  4B3M L;  1GKH A;  1JJC B;  4DKA C;  3CCM A;  4UPA A;  4LF6 Q;  4A3G H;  2VY3 A;  3KYH C;  2UUC Q;  4JI3 Q;  3HOX H;  2UXC L;  1GM5 A;  5GQO A;  2D0P A;  2R7D A;  1HZB A;  1NTG A;  1XMO Q;  1PV4 A;  4POF A;  3W5O A;  1PH8 A;  3PO3 H;  1KRS A;  3G48 A;  4JI1 L;  5IYD H;  1VQE A;  1CSP A;  4PMW A;  4DV2 Q;  5JEA G;  2NZO A;  3T1Y L;  4LF4 Q;  3OW2 A;  4A3F G;  4HID A;  3RLF A;  4HJ7 A;  2D0O A;  3S24 A;  3TS2 A;  5IP7 G;  3PSI A;  4HJ8 A;  1QUQ A;  3RLN A;  3AQQ A;  3BZK A;  3GTJ H;  1KHI A;  5AJ3 L;  2QEX A;  4DUY Q;  3NEN A;  4JCV E;  2A8V A;  1IBK Q;  2PI2 A;  4DAY B;  1L2F A;  5IWA L;  3UE1 A;  1YZ6 A;  1K3R A;  4GOP C;  3HOZ G;  2H5X A;  4PZ7 A;  2R92 H;  4BBR G;  1H95 A;  3CME A;  1I94 L;  4DR1 Q;  2UUB L;  2E2H H;  1HH2 P;  2F3I A;  4JC0 A;  4GN3 B;  3J7A 5;  2E5L L;  1YBY A;  2UXB L;  5C4X G;  1BKB A;  4DR7 Q;  1OXS C;  3T1H L;  1KD1 C;  2RCN A;  3U4Z A;  3AYH B;  3I4O A;  3H3V I;  4DK3 C;  2ZM6 Q;  5GAE C;  3PF5 A;  4JI0 L;  1PH5 A;  2F52 A;  2NN6 G;  2A1A A;  2K14 A;  4KLK A;  4A3F H;  3GD7 A;  4JBJ A;  4QQB X;  2B3G A;  2Z6K C;  4X66 L;  2YTX A;  1J6Q A;  2B63 G;  4LUO A;  4YWM A;  4PZ6 A;  4IOC A;  4NXM Q;  3S2D H;  4X65 Q;  3HOV H;  3J80 i;  1VQ6 A;  1CKM A;  4DR6 Q;  2NZH A;  1XNQ L;  4IFD J;  3M4O H;  2UXD L;  1PH4 A;  3HOZ H;  2N3S A;  3ER0 A;  1XTD A;  4A4I A;  2VQE L;  4R4Q A;  5EAY A;  4YCU A;  4GKJ Q;  3FHW A;  1WYD A;  3CPW A;  4Y52 H;  4GNX B;  5C4X H;  3AFP A;  1HNX L;  3MEF A;  4GLV B;  3UDG A;  1I3Q H;  4P74 A;  5IE8 A;  4A3E G;  1SE8 A;  3KDF A;  1HNZ Q;  4DR4 L;  4LF8 Q;  1TWG H;  3I7F A;  1XPO A;  2KHJ A;  1I50 H;  2Q2T A;  1EOV A;  4JI8 L;  4DR3 L;  4LF9 Q;  3ERS X;  5ELN A;  4HJA A;  5FLM G;  3J81 i;  1PH2 A;  5LMN Q;  2B63 H;  4OXP A;  3RLO A;  4A3C G;  5C3E G;  3F2B A;  2GVA A;  4JOI C;  1NJI C;  1OXU A;  1ASZ A;  2UU9 Q;  1WJJ A;  4AYB E;  4AQY Q;  1OTC A;  2HHH L;  1X56 A;  2Q2H A;  1SFO H;  4LW1 A;  3HOY G;  2N78 A;  1KXL A;  5FJ8 H;  1VQJ A;  4P71 A;  3JAM c;  4A75 A;  2CKZ B;  4JI6 L;  1QVF A;  5GAH C;  4PG3 A;  3CC4 A;  4JI7 Q;  4BY7 G;  1VQF A;  5BR8 Q;  3CMA A;  2ZJR A;  4JI2 L;  3T1Y Q;  3I4M G;  3S1M H;  3S15 H;  3J81 j;  4R4T A;  3OTO L;  1PA6 A;  1CUK A;  3STB D;  3ULJ A;  2K75 A;  1E1O A;  2LXJ A;  1SMX A;  3PGZ A;  4JV5 Q;  1HNW L;  2RF4 A;  2CCZ A;  2BH8 A;  4IPC A;  4NXN Q;  2JEA I;  4LUZ A;  4YCW A;  4DPG A;  4DV5 L;  2WB1 G;  3PUW A;  2F4V L;  4H02 A;  2ATW A;  1EFW A;  2AHO B;  4JI5 Q;  2VQF Q;  4DV1 L;  2KHI A;  1QUQ B;  3E9H A;  3WWV A;  5FLM H;  3G4S A;  1QZG A;  1I6H H;  2IY5 B;  1JT8 A;  4BA2 I;  2AKW B;  3GDE A;  3UDI A;  3EN2 A;  5C0X I;  3PO2 H;  3EIV A;  1E22 A;  2K5H A;  5LMU L;  3M3Y H;  1C0A A;  2ZTD A;  4DV6 Q;  4K0K L;  1VQC A;  4BY7 H;  3TEH B;  2KCT A;  3K8A A;  1YIT A;  4DR5 Q;  3IRB A;  3STB C;  2C35 B;  3L0O A;  4AYB G;  2R7Z G;  1LTL A;  3F2D A;  1N33 L;  1XMQ L;  1IXR A;  2BA0 A;  2OCE A;  3S2H H;  3ULL A;  4DV4 Q;  1HR0 L;  4X66 Q;  4IFD I;  1K8G A;  1Q81 C;  3S16 H;  4YY3 Q;  1FJG Q;  3CAM A;  2LXK A;  3DM3 A;  1WOC A;  1MJE A;  2PI2 E;  1EYG A;  3HOU G;  2KEN A;  2JA8 G;  3CW2 C;  4IOA A;  5IY0 A;  4EQ5 A;  3MXN B;  1RL2 A;  5M3F G;  2WAQ G;  1GO3 E;  1C9O A;  3S1R H;  4WJ3 M;  4MZ9 A;  1CKN B;  1TXY A;  4GKK Q;  3KF6 A;  1LM0 A;  3PV0 A;  3H0G G;  4X62 Q;  1VQP A;  4A3B G;  4GLA C;  4LFB Q;  1L1O A;  4C3J H;  5IP9 G;  3JC6 6;  3F2C A;  2OQK A;  3PIO A;  1OXV A;  3GTG H;  1HNX Q;  4DV0 L;  2PNH A;  1X65 A;  4DUZ L;  1XNR L;  4XIG S;  4JBK A;  5H1S E;  4P73 A;  3PIP A;  3M85 A;  3PUZ A;  2PQA A;  4GOP B;  1YNX A;  3U58 A;  1VQM A;  1JB7 A;  1D8L A;  2CWA A;  3CPF A;  2EIF A;  4ALP A;  4OX9 Q;  4JI8 Q;  4DR3 Q;  1EIF A;  1N34 L;  3ULP A;  2AMC B;  2DUD A;  5JEA J;  1A0I A;  2B29 A;  2CFM A;  1GD7 A;  2YTV A;  4LWC A;  1X3F A;  1K8A C;  1KC8 C;  1VQI A;  3PUY A;  3HOU H;  4BBS G;  2JA8 H;  3CP0 A;  2YV5 A;  4HJ5 A;  2ASB A;  4P72 A;  3I55 A;  5M3F H;  4JI4 Q;  4ME3 A;  4J15 A;  3CCU A;  4O0A A;  4B3R Q;  3K0X A;  1B8A A;  1IBM Q;  2NVQ H;  4YHH Q;  3KJO A;  1CSQ A;  3CCS A;  4A93 G;  1KRT A;  2NVT H;  1OXX K;  4A3B H;  1HZA A;  1EWI A;  2XGT A;  3CC2 A;  2I0Q A;  1PVO A;  4IPH A;  2EQS A;  5C0X J;  4MTN A;  4NB3 A;  1IBL Q;  3HKZ E;  4OWT B;  3M4Q A;  2JA9 A;  4DV7 Q;  2BA1 A;  1NMG A;  4LF7 Q;  3LGJ A;  3TRZ A;  1S40 A;  5IYC G;  3GTL H;  1BBU A;  1Q82 C;  1SR3 A;  5IP7 H;  4WJ4 A;  4DV3 Q;  2IT1 A;  2IX1 A;  1PYB A;  1U5K A;  4OWW B;  4AH6 A;  1V9P A;  4A3I G;  1YEZ A;  2UUA L;  4LFC Q;  1VCI A;  4LF5 L;  2JA7 G;  4FDB A;  2K5V A;  4L5R C;  4HJ9 A;  4KHP L;  4BBR H;  5C44 G;  2MNA A;  3FP9 A;  3ICE A;  5M5W H;  1K73 C;  2WB1 E;  2ZJQ A;  3G6E A;  2VZA A;  1P16 A;  4DR2 Q;  1N9W A;  1KQS A;  3KLW A;  1PH9 A;  1V1Q A;  4B3S Q;  4X6A H;  3CQZ H;  1UWV A;  1PYS B;  1X55 A;  2AWN A;  3F8T A;  1FVI A;  3W1G A;  2I5M X;  1J5E Q;  1M1K C;  4O2D A;  1DGS A;  2CWP A;  4NPS A;  4IFD G;  4LFA L;  1Q7Y C;  2E2I H;  2NVX H;  1N36 Q;  5GAD C;  4YWL A;  5IYC H;  2K52 A;  3UDF A;  3J80 c;  5GAG C;  4X64 Q;  2OTL A;  4OON A;  2IX0 A;  2JE6 I;  1KAW A;  1YIJ A;  4B3M Q;  4RG1 A;  2FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...