4DK6C

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
87
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVPLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
total genus 14
structure length 87
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dk6C00
2AMCB 2F52A 3EN2A 4LFAL 4B3MQ 1XJVA 1XNRQ 4POGA 1SE8A 2QGQA 1U5KA 2Y0SE 1BVSA 5C0XG 4PG3A 2JQOA 2QEXA 1M90C 2JA6G 3TRZA 5IT9c 3ICEA 3FP9A 1SROA 1I94L 3AFQA 1NY4A 2K5HA 4A3FG 2JA5G 3J7A5 3CXCA 1J6QA 3H3VH 2PNHA 4HJ7A 3SGIA 4YY3L 1TWHH 5GADC 2KCMA 2OTLA 4JI7L 2NVQH 4QQBX 3PF5A 1IL2A 4DK6C 1Y1WH 4TVAB 1UEBA 2JE6I 2ZJPA 1GM5A 5IY0A 1PH1A 1EOVA 1LM0A 1YHAA 2CWPA 2PQAA 4A3DG 4OO1G 1C0AA 4IPHA 4GN5A 1NMGA 2VY3A 2HHHQ 4B3SL 4JI4Q 4NXMQ 1I94Q 4WJ4A 2FXQA 4DV0Q 3HKSA 3RLOA 1B70B 3K0XA 3CMAA 1U0LA 3MEFA 4BY7G 1K73C 3BZKA 3J80i 3HKZG 1IBKL 1E1OA 3D0FA 4IJLA 2CCZA 4QL5A 4JC0A 1PYSB 1NTGA 2JA6H 4AH6A 2ID0A 1K0RA 2JK8A 4IOCA 2H5XA 1VQOA 2ES2A 2HIXA 4DUYQ 4UP8A 4APVA 4HIDA 1NBWA 1RL2A 3AEVA 2AWNA 4A4IA 4GNXA 1HJPA 4DV0L 2PQAB 2OWOA 2VUMG 4DKAC 1FVIA 1UE7A 2N78A 3M4PA 3CCUA 1VQKA 2AKWB 1N8RC 4J15A 4OWWB 2UXBQ 4DV7L 4KHPL 2KHJA 2JEAI 4DNIA 3L2PA 5GROA 4UPAA 1G291 2IT1A 2XTIA 1VQ4A 1XMQQ 2R92G 3HOZG 4A3BH 3S1NH 3OYYA 4HIMA 2CWAA 4LFAQ 4JI7Q 5IWAQ 4QGUA 1OXUA 2PI2E 4QY7A 4YHHL 2VQEL 1S40A 2IX1A 3S2HH 3B6YA 1I6HH 2WB1E 1X54A 1D8LA 1YBYA 3NEMA 4RMFA 4B3TQ 4X6AH 3S15H 2R7FA 5M5YH 2PMZE 4DV5Q 1E1TA 4YCVA 4A3EG 3S1RH 5IYDH 1YHBA 3TEHB 3KFUA 1I3QH 1MIUA 1T9HA 4L5QA 1GD7A 4PMWA 2F4VL 4A3JH 1SR3A 1VQGA 3FHWA 1GO3E 1TWFH 1EQQA 1Q12A 1WYDA 4GS3A 1VQBA 5K36G 2YTXA 1G51A 1Y14B 2JA7G 4ALPA 1L1OB 3OTOQ 3S2DH 2IX0A 2NN6I 5C4JH 3GDEA 1YIJA 2HHHL 2NVTH 3BU2A 4LF4L 2VNUD 1QVGA 2JA8H 1XTDA 2K75A 1WJJA 2A1AA 3KDFA 1EIFA 1PH6A 2F4VQ 3STBC 3K80C 1MJEA 1KQSA 3M3YH 5IYDG 5LMUQ 4JI1L 2XGTA 4UP7A 1HZBA 3E9HA 2Z0SA 1VQ6A 4IFDI 2R7DA 3RN5A 4BY1H 3UDGA 4JI8Q 2K52A 3G71A 5IP9H 2JEBI 1EIYB 1CSQA 3CW2C 1OXSC 5ELNA 1PH8A 5ELOA 3CCRA 1PFSA 4XTCS 2V1CC 3GO5A 4AYBG 1VQLA 1L1OC 5IWAL 1JJGA 5FJ8G 5GAEC 3UDIA 3GTQH 1B7YB 3NELA 5BR8L 2K4KA 4BBRG 3PUWA 1Q81C 4KLKA 1QUQB 1VS0A 4JV5L 2HQLA 3KJPA 3A5ZB 4K0KQ 1QVCA 4GKKQ 5IYBH 4JI8L 3UDXA 1HNZL 3CD6A 1PH7A 2WFWA 1TXYA 2VS1A 4FDBA 4JBKA 4A3DH 5EAYA 4LNQA 1VQEA 1SRUA 1SN8A 4GLVB 2Q2IA 1CKNB 2B29A 2K5VA 4R4OA 1PHJA 3D31A 4B3ML 1KRTA 2JJQA 4GOPC 3I7FA 2GVBA 2KHIA 1K8GA 3I4MG 3PF4A 4BY7H 1UE6A 5IE8A 1PH4A 1TWCH 1IBLQ 2OQKA 3PUYA 4LF9Q 2JA5H 1X55A 1V9PA 3S14H 5LMNW 4JOIA 1PA6A 1PH3A 1VQHA 1AE2A 1X56A 2L15A 4GKKL 4A3CH 2R93G 1E24A 1KD1C 2VZAA 4OWXB 4C3JH 1HNXQ 2YTYA 4UP9A 3ULJA 5LMNQ 1QVFA 3CMEA 1G6PA 3ULPA 5GQOA 4JI5Q 4X62L 4BBRH 3A0JA 4YCWA 3CQZH 3CPWA 4O0AA 4L5RC 1M1KC 1YNXA 4JBJA 1CKNA 3RZOH 4P71A 1CKMA 3AYHB 3TREA 2RHQB 2MO0A 3GD7A 4JBMA 2WAQG 5BR8Q 2ATWA 1X3GA 1KIXA 1ASYA 4HIKA 1HNXL 2IY5B 5C44H 4A3GG 1X6OA 1IBKQ 3GTLH 3GTPH 3PSIA 1PH5A 3CCJA 4BA1I 1OTCA 4DV6L 4GLAC 1MJCA 3HOVG 3OW2A 3L7ZC 4OO1I 2NN6G 4Y52H 3CAMA 1PVOA 4OXPA 5IYCG 4GLXA 2MFIA 1DGSA 2HT1A 2HIVA 4JBWA 4A93H 3G48A 1BBWA 2Q2TA 2D0OA 3MXNB 1PH9A 3Q8DA 3E9IA 4DR4L 2Q2UA 4X65Q 4JI6Q 2KBNA 2ZTCA 5H1SE 1YITA 1IYJB 5J3BA 2EQSA 2QA4A 1XMQL 3RLNA 3PUZA 4LWCA 2BH2A 1KHIA 4JI3L 1O7IA 2UU9L 1MKHA 2R6GA 3M9BA 4YHHQ 3F8TA 2K14A 4X66Q 1HZAA 1FGUA 2VQFQ 4JI0L 3PO2H 4HJAA 1YJNA 4B3TL 4R1JA 3CP0A 3PGZA 2UUBQ 4DR6Q 3I4NG 1HNWL 3KF8B 2WB1G 4GN4B 4A3KH 1YVCA 4A3MG 2UXDL 1X3EA 2LSSA 2E8GA 4PZ7A 1PH2A 2D0PA 3K8AA 2JA8G 2IHFA 3HOXH 1VCIA 4TQUS 2BA1A 2K50A 4JI5L 1EWIA 4JG2A 4KHZA 2JA7H 3RR5A 1K9MC 4X66L 3HOVH 2CFMA 4DK3C 1OXXK 4LF5Q 4OX9Q 5C3EH 4EX5A 4C3HH 1V43A 2E2IH 4BXXG 3J81i 4DAYB 1EUJA 1UE5A 4DV4L 4YWKA 2MQHA 5M5XH 5HGQA 5JEAJ 2AWOA 1E3PA 1QUQA 2EXDA 4LUOA 3G6EA 1N9WA 2UXCL 2UXDQ 4JI1Q 2N3SA 1KC8C 3RNUA 1HH2P 4A76A 1Q7YC 2ASBA 2R92H 1K8AC 5JJKA 3S1QH 5IP7G 4L5TA 2OTJA 1IZ6A 4P73A 4POFA 4DV6Q 4DR4Q 3U4VA 1YEZA 4QIWE 2RCNA 3CC2A 1EQRA 1S72A 3IRBA 4GOPA 1KRSA 4P75A 2E2JH 3EIVA 1I5FA 5HY6A 4JI3Q 1Z47A 3GTOH 4DR7Q 1LTLA 2MNAA 2UXCQ 4MTNA 4IFDG 3FKIH 4HJ5A 5FLMG 2YTVA 1IXRA 5FLXc 1SMXA 3I55A 1VQJA 3PCOB 4A3EH 1Y1VH 2VUMH 2BA0A 4LFBQ 3TS0A 4GKJL 3AQQA 3F1ZA 1HNZQ 3GTGH 1EYGA 2E2HH 3PV0A 2DUDA 1HZCA 1YJ9A 1Q8KA 1K3RA 1WCMG 4DV1L 1QZGA 4DR5Q 1VQ7A 3U4ZA 1VQFA 3J81j 4OWTB 1Y1VG 3S1MH 4GN3B 2CQOA 3M4OH 3ER0A 3HOZH 4DPGA 3JAMc 1S3OA 2VL6A 5DLQE 5FLMH 4DR6L 4MNOA 4DR7L 5AJ3Q 5C0XJ 1FL0A 4OX9L 4R4IA 1N34L 4IPGA 3T1YQ 3CCEA 1IBLL 3KF6A 1L0WA 4LF9L 1FJGQ 4BXXH 3CCMA 3GTJH 4DAMA 1Q46A 1Y1WG 3GTMH 4IJHA 1XMOL 4DR1Q 2Y0SG 2EIFA 4JOIC 2LXJA 1D7QA 3CCQA 4DV1Q 3F2CA 1Q86C 2AHOB 4IO9A 2NVXH 5LMNL 2R93H 2B63H 2OQ0A 2I5HA 3LGJA 4H02A 3TQYA 4P72A 4LF5L 4X62Q 1SFOH 3M7NA 4A3MH 4BBSG 2UUAL 5E7NA 1VQDA 2UUCQ 3CPFA 2D62A 3EBEA 3RLFA 3T1YL 1FJGL 1A62A 1ASZA 1Q1EA 1VQAA 1XPUA 5M3FH 5IP7H 3HOWH 1JJCB 2C35B 3PO2G 2WP8J 4QJFA 4DR1L 4AIMA 4B3RL 4GNXB 1BKBA 3KF6B 1B8AA 3JC66 4RG1A 4YWLA 4X64L 1CSPA 1W3SA 4GKJQ 5IYBG 2GVAA 3H0GH 1GKHA 1LYLA 4DR3Q 3HOWG 3F2DA 1YHQA 1QZHA 3GTKH 4DUZQ 4JCVE 3ZJYC 4DR5L 2YYZA 4A3KG 3A5UA 2UUAQ 4NB3A 2BH8A 3UDFA 1C7YA 4JI2Q 1JT8A 2DGYA 1YI2A 1XNQL 4LW1A 3NBHB 4DR2L 5JJLA 3RZDH 3PIPA 1NMFA 1CUKA 3F2BA 4HIOA 4DV2L 3UE0A 2RHSB 1N34Q 1VQNA 1AH9A 3JAMi 4LF7Q 4X65L 3DLLA 4JI6L 4O2DA 1KAWA 1TWAH 3STBD 4JYAL 1GVPA 4Y7NH 5M3FG 4DR3L 3I4NH 2NVYH 5C4XG 5C0XI 1J5EQ 1UWVA 3NENA 5GAGC 2UU9Q 4EQ5A 2I5MX 2VQFL 1V1QA 1P16A 4JI0Q 4LFCL 3CCLA 3W1GA 5FJ8H 3HOXG 1R9TH 2UUBL 2B63G 4R4QA 1NE3A 2KCTA 3T1HQ 2R7ZH 1HNWQ 1WCMH 2PI2A 4DV2Q 2UUCL 3VDYA 2WAQE 1WI5A 3HOYH 3AFPA 2CKZB 3ULLA 3K7AH 4JI4L 1VQCA 1IBMQ 4A3LG 3W5OA 4A93G 4BY1G 4DV3L 1HR0L 3J80c 4UY8C 1E7ZA 1E22A 1JB7A 3KLWA 3ERSX 2N8NA 1W2BA 1LUZA 4WJ3M 4HJ9A 3J7ZC 1N33L 4DV4Q 3I4MH 1VQ8A 1OXVA 4XIGS 1VQPA 3PO3G 3A74A 3K81C 1XPRA 4LF6Q 4C2MH 3KOJA 3U50C 4DV3Q 4A3BG 3DM3A 4R4CA 2ZJRA 4A3IG 3I56A 1XPOA 3H0GG 1HR0Q 1CKOA 1UE1A 4AQYQ 3FKIG 4DUZL 5GAHC 4JYAQ 3H15A 4LF6L 4A3CG 2MO1A 2YV5A 2Z6KA 4A3IH 3W1BA 3TS2A 1JE5A 4JI2L 3HFZB 2ZJQA 3KDFB 4ME3A 4DR2Q 3CC4A 1N33Q 1X65A 3PIOA 4LF8Q 3PO3H 4L5SA 2VQEQ 2OCEA 3I4OA 3T1HL 1AE3A 4KI0A 1HR0W 4OONA 4AYBE 2YU9H 4LF7L 2ZM6Q 3E0EA 4IPCA 2A8VA 4LFBL 5M5WH 3KJOA 1N32L 2F3IA 4C3IH 4DV5L 1H95A 1WOCA 3M85A 2GN5A 1J5EL 3K7UC 1X9NA 1PYBA 3J81c 2KENA 1OXTA 2N49A 5C3EG 5JJIA 4NPSA 2E5LL 3M4QA 4LFCQ 1VQIA 1YZ6A 2LXKA 3BZCA 3S24A 2I0QA 4LF8L 2A19A 2IHEA 3PUXA 3CCVA 3HOYG 5AJ3L 3H3VI 5M3MG 4YWMA 2B3GA 3UE1A 1A8VA 3OTOL 2R7ZG 1Q1BA 4PZ6A 1N36Q 4LF4Q 1N32Q 3PUVA 2ZM6L 1IBML 1KXLA 3KYHC 4A3LH 1XMOQ 4B3SQ 4NXML 3S16H 2ALYB 1WFQA 4PZ8A 1X3FA 4YY3Q 4P74A 3CCSA 3RN2A 3G4SA 5LMUL 4IPDA 4MZ9A 4GNXC 1I50H 1A63A 3HOUH 4NXNQ 3WWVA 2E5LQ 4AQYL 1P8LA 2RF4A 3HKZE 2VW9A 4A3JG 5M3MH 1SLJA 2Z6KC 4A75A 1Z9FA 1VQ5A 4LUVA 1L2FA 3L0OA 5IP9G 1TWGH 1EFWA 2ZTEA 5JEAG 4R4TA 4BA2I 1N36L 3HOUG 4IOAA 1L1OA 5C44G 4A3GH 1BBUA 4HJ8A 1K83H 2ZTDA 1XNRL 4IFDJ 3S17H 2NZOA 2JA9A 1JJ2A 1KL9A 4BBSH 4B3RQ 1PV4A 1C9OA 1Q82C 1HZ9A 2K5NA 4X64Q 3CC7A 3I2ZA 1VQMA 4NXNL 4JV5Q 5IYCH 4LUZA 1A0IA 4K0KL 2Q2HA 4A3FH 4YCUA 1YJWA 2NZHA 1JMCA 4DV7Q 4GOPB 4KHPQ 1NJIC 2I5LX 2UXBL 3CF5A 3U58A 3BJUA 1XNQQ 4DUYL 1RIPA 5C4XH 1VQ9A
chains in the Genus database with same CATH superfamily
5M5YB 3WDNA 3VYSA 1O7ZA 4B3MQ 1XNRQ 5D3DA 1U5KA 3FVQA 2B2WC 2JQOA 3TRZA 1RTOA 1WTHA 4IURA 1I94L 3ICEA 1NY4A 4A3FG 3CXCA 4ZYSA 3E5SA 3H3VH 1E0BA 1TWHH 3J80L 4JI7L 3OW7A 4TVAB 2RSOA 1GM5A 1DCZA 1YHAA 2CWPA 1EY6A 4UHVA 4TKOB 4C1NI 2HHHQ 4JI4Q 4KJOA 1I94Q 1RF2D 3HKSA 3RLOA 2F3VA 4F7XA 4BY7G 3EA6A 1K73C 3GTMB 3BZKA 1CQVA 4JC0A 2JA6H 4AH6A 2ID0A 1K0RA 2ES2A 3GV3A 2FMCA 3MFGA 5CV7A 4DUYQ 4WRDA 1DM0B 1NBWA 4G7HC 2M00A 1HJPA 1V1PB 4DKAC 1FVIA 4B9WA 3CCUA 2N78A 4XT1B 1VQKA 4HR7B 1N8RC 4OWWB 4KHPL 3VR4A 3QIAA 3K5LA 4DNIA 1G291 2R92G 2B2VC 2XTIA 3HOZG 1KDCA 3S1QB 4HIMA 1VMPA 1I4PA 1OXUA 4QY7A 2VQEL 3S2HH 5C4ZA 2WB1E 3S14B 2KECA 3CKIB 3S1RH 1YHBA 1T9HA 5BN4A 4A3JH 5CBEE 5I9PA 1GO3E 5K36G 1VQBA 4LMQD 2F0SA 4Y7NB 3S2DB 1ZYRD 2YTXA 1G51A 1SSOA 3VA7A 1BBXC 2NVTB 3MXGA 2JA7G 1L1OB 2B2WA 5KNDA 3S2DH 1IYVA 2OT2A 3GDEA 2NVTH 4IN3A 4CGYB 4XQNA 2IJ0A 4BY1H 4JI8Q 2K52A 4DNTB 2L9HA 1E2ZA 3KLRA 1TT2A 1RCVD 1NAPA 5ELOA 3CCRA 1HA6A 3GO5A 4AYBG 1Q90A 2E76C 5FLXL 5GAEC 1B7YB 3A7AB 4Q0FA 1ET6A 3EFXD 4G57A 2K05A 4JI8L 3UDXA 2WFWA 4FDBA 2N55A 3RMHA 1SRUA 1SN8A 1CKNB 2QDBA 1PHJA 2XRSD 3DEOA 3PF4A 5IE8A 1PH4A 1IBLQ 1TWCH 2OQKA 5K36H 1V9PA 4DFAA 2BDNA 3P75A 1K0SA 2L15A 2EYOA 2KA7A 2VZAA 3ULPA 4HEDA 4YCWA 4EGVA 1V1OA 2XRQD 3NXWA 4L5RC 1M1KC 1YNXA 3ND8A 5CV6A 4CJ1B 2R92B 3RZOH 1CKMA 2F0LA 3TREA 2FMMA 5BR8Q 3TP6A 1X3GA 1ASYA 4XDXA 1I4HA 4KMUC 4A3GG 2WB1B 1PH5A 4F8MA 1OTCA 3C2PA 1MJCA 3T4AC 3AU7A 3EQLC 1GUNA 4GLXA 1D5XC 3HKZB 2HT1A 4A93H 3G48A 2VXWA 3E9IA 2XWBB 2Q2UA 4JI6Q 5IGDA 3A55A 1YITA 1IYJB 5EPJA 2EQSA 1SNDA 5J3BA 2QA4A 1KHIA 1O7IA 4YHHQ 1YJNA 1RKNA 3PGZA 4HAEA 5IGCA 2WB1G 5KYLA 4A3KH 1YVCA 3OSOA 4A3MG 2UXDL 5ELBA 1MSHA 4H13C 2JA8G 1B9NA 2JA6B 3IKJA 2K50A 1EWIA 2XWJB 3QR8A 1K9MC 2H4OA 4DK3C 1GJXA 4EX5A 4I7ZC 1JORA 1V43A 2L0CA 4BXXG 4K5XA 2MQHA 4YWKA 5IOCA 2UXDQ 4CDCC 2KOLA 4JI1Q 1KNEA 4QUCA 2ASBA 5D14A 3S1QH 4L5TA 4P73A 4DV6Q 3C1EA 3RD4A 3CC2A 1JE4A 3SK5A 4I65A 1JCKB 1JR0D 1KRSA 1I5FA 3GTOH 4DR7Q 5JEAH 1IW7D 1SMYD 4KY5A 1LTGD 4A3JB 4HJ5A 1TWAB 2C9OA 5CYUA 2F0KA 3DM1A 1Y1VH 3TS0A 2XIWA 3AQQA 3F1ZA 4ZRZA 1W6KA 3PV0A 1YJ9A 3VR6A 1K3RA 4DR5Q 3U4ZA 1QG7A 4KN4C 1EY5A 1R9TB 3LWUA 1Y1VG 1HXYD 3KK7A 4DK0A 3KF8A 4DPGA 4DR7L 4DGZA 3MEHA 4KKUA 1F2ZA 4OIJA 3CCEA 1LTSD 1EU3A 1Q46A 3T16A 4IJHA 4DR1Q 2B2YA 3L3OC 2LXJA 4RHSA 1D7QA 5DM73 3CCQA 2NVXH 1B4OA 3LGJA 4P72A 2NVXB 3SXHA 3M7NA 2K5DA 1IHZA 2JXMB 2UUAL 1L0XB 3CPFA 2D62A 1A62A 1ASZA 3HOWH 1JJCB 4CJ2C 3CRKC 2WP8J 3HOWB 4QJFA 4DR1L 1PZJD 1QCBD 3CRLC 3NQTA 4F87A 4B3RL 2QW7A 1H9KA 4ZLTF 3HOWG 4DR3Q 1FGBD 3NK9A 4IUVA 1RJTA 4JCVE 2YYZA 2L12A 4A3KG 2UUAQ 4NB3A 5E4WC 2BH8A 3UDFA 4JI2Q 1TWCB 5C6AA 4KD4A 4LW1A 3A8JE 3E0JA 3I70A 1WTOA 1NMFA 1TS2A 5ISRA 3UE0A 2NN6H 1AH9A 1R4QB 4LF7Q 4X65L 4O2DA 3D4WA 3I72A 1JQYD 3I4NH 3ZYYX 4DR3L 1AEXA 1UWVA 5GAGC 5C4JB 4JI0Q 2JA8B 3OMCA 3W1GA 1DZ1A 2KCTA 1HNWQ 1PRTB 2PI2A 2WAQE 1WI5A 2CKZB 3ULLA 1EFID 3PMFA 4JI4L 1IBMQ 4HSVA 1BXTA 3J80c 4K5WA 5JPNC 2AQ1B 3MXPA 2EZVA 1ESRA 2R93B 4LK1C 3GTQB 1TWFB 1N33L 4U68A 1GUWA 3I4MH 1OXVA 4XIGS 1CK1A 2MHVA 3I4MB 3U50C 1O80A 4R4CA 2ZJRA 1CKOA 1UE1A 3FKIG 1FR3A 2MO1A 2NBFA 2RKSA 2YV5A 3W1BA 2Z1CA 1D5MC 4ME3A 3CC4A 1N33Q 1X65A 2D5DA 2QILA 2VQEQ 1ENAA 1EU4A 2OCEA 3T1HL 3E0EA 2K5QA 4ZAIA 5M5WH 3KJOA 4CDDC 1LO5D 4C3IH 2M9VA 3M85A 1Y1WB 2ICIA 2PPBC 3J81c 3N52A 2E5LL 4U673 2I0QA 3S24A 2HDMA 4RGMA 1T5XD 3CCVA 1SNQA 3H3VI 4G7OC 4YWMA 1BR9A 1LTAD 1Q8IA 2NTSA 5CC4A 1XMOQ 4FXDA 4NXML 2ALYB 1WFQA 4YY3Q 4IUTA 1KLUD 4MZ9A 2XVSA 3SDZA 1A63A 5LHY1 4NXNQ 1NNXA 2E5LQ 4AQYL 5G3LD 2RF4A 1EY8A 3HKZE 5M3MH 4Z9CB 1SNPA 4E6IA 4K8JA 1L2FA 4IUQA 5IP9G 4KV6A 3NWTA 1RDPD 3N6RA 1VDZA 2F4IA 2IX3A 1L1OA 4WFN3 5C3EB 2RVLA 3S17H 2NZOA 4BBSH 4CKBA 2EY5A 2L5TA 1EIHA 4TSSA 4BBSB 4RHRA 4NXNL 4LUZA 2QF7A 1II3A 1S5FD 1C8CA 1YJWA 1NJIC 4QCLA 3CF5A 2H1EA 3U58A 1HUNA 4MTKA 4LFAL 2OXPA 1SE8A 1IYUA 4CBVA 3QJYA 2QEXA 2O2LD 3I90A 1KNAA 5IT9c 1SROA 3AFQA 2JA5G 1XX8A 1QNKA 4HJ7A 1PYWD 1B3QA 5GADC 4DF7A 4CKCA 2CW0D 1IL2A 2G5DA 1UEBA 2EYFA 5IY0A 2PQAA 1HQRD 4RGTA 1C0AA 3S1MB 2VY3A 4DV0Q 1GOZA 1B70B 2VB3X 1U0LA 2EY1A 5FLXE 3J80i 1HA5A 3NSWA 4KHVA 5LL6S 1I50B 1NUCA 3MXNA 4UAIA 3TP5A 2JK8A 4IOCA 2XN9C 5I2YA 5ELEA 4V190 2B8FA 3K5MA 2VUMB 1S5BD 1U4MA 2JYOA 4A4IA 4FYDA 4DV0L 2DNEA 2B2TC 2PQAB 2AUKA 3M4PA 5HURA 2AKWB 5ELFA 4DV7L 5JAVA 3S1NB 4HMJA 1ENCA 4UPAA 3J7AV 3VYTA 3DWAA 4A3BH 3S1NH 1J9OA 4JI7Q 5IWAQ 1PTOC 2PI2E 4BY7B 4YHHL 2IX1A 1X54A 1D8LA 2Q8RE 3Q6SA 3NEMA 4RMFA 4N9TA 2R7FA 5M5YH 2K28A 1FNUA 1E1TA 4K8IA 1X3QA 1PMRA 1I3QH 4L5QA 4ID6A 4PMWA 2F4VL 1G6ZA 4F88A 1Z7TA 4ABNA 2CH4W 3TDQA 1TWFH 1Q12A 4GS3A 2PCFB 1Y14B 2V4DA 1G8ZD 1TWHB 4QMGA 4ALPA 3BU2A 1XTDA 1AW7A 2K75A 4IZ8A 1RTNA 1EIFA 3P20A 2F4VQ 1MJEA 1KQSA 5IYDG 4JI1L 2F0TA 4UP7A 2Z4HA 2EJMA 1HZBA 4KKTA 1VQ6A 2PO4A 4IFDI 2R7DA 5KYIA 2EOTA 3UI2A 2BDOA 4JVZA 2JEBI 1EIYB 2SDFA 1PH8A 5ELNA 4XTCS 4L6TB 1JJGA 1AZQA 1EIGA 4FF3A 4KK7A 1DONA 3R2TA 1SDFA 1QUQB 3T13A 4JV5L 2HQLA 2ZXRA 2VS1A 4A3DH 1F77A 2HCIA 1ICFB 1U4PA 1KRTA 2JJQA 4GOPC 2FJ2A 3I7FA 2GVBA 2KHIA 1K8GA 5C5MA 3I4MG 3PUYA 3S14H 4XQQA 1DXMA 5M3MB 1PA6A 3Q23A 4A3CH 4RKLA 1KD1C 4OWXB 4C3JH 1QVFA 1DOMA 3ULJA 1STBA 5C3WA 1TVXA 4K5VA 4BBRH 3CQZH 4O0AA 3DXJC 3MTSA 3P1HA 4JBJA 3U9SA 4OL7A 2RHQB 4JBMA 3C3LA 1B9MA 4ME5A 1NR2A 4HIKA 1Z6HA 4NMZA 3GTLH 5EPKA 1ILPA 3PSIA 1PZID 3CCJA 3HOVG 3OW2A 2SNSA 1CFMA 4OO1I 2NN6G 3C1FA 4JW0A 1K8MA 4OXPA 1PVOA 1K8OA 1TS5A 2F0UA 5I4DA 1A2TA 2MFIA 3G6JB 2HIVA 4JBWA 1QWYA 2K04A 2Q2TA 3MXNB 3Q8DA 3TZUA 4DR4L 1XTCD 3EVQA 5CV4A 4X65Q 5H1SE 5D3IB 1XMQL 3RLNA 3A56A 2WIIB 4JI3L 2RDHA 2R6GA 5FO8B 4JI0L 2PZTA 2X69A 3PO2H 4B3TL 3CP0A 1JB3A 4DR6Q 1GXDC 1HNWL 2NYZD 2KEEA 1BO0A 1STNA 3GV6A 1EZ6A 1GHJA 2IHFA 3P7JA 4JI5L 3PIP3 2JA7H 3RR5A 1JOKA 2F0GA 3HOVH 2CFMA 4LF5Q 1DYQA 3DWQA 4C3HH 3I91A 1EUJA 2EJFC 1HHVA 1VMCA 5CV5A 4C3HB 4BS9A 5HGQA 1A2UA 5JEAJ 3G6EA 2UXCL 3QB3A 3SVMA 1HH2P 1Q7YC 2R92H 5IP7G 4IUUA 1UEAB 5HGTA 1U9RA 1IKMA 3W2DA 3VR3A 2F0WA 3GP7A 1PFNA 4RAUC 2UXCQ 4MTNA 4IFDG 1PFBA 1IXRA 4K2KA 2F0JA 3DHQA 3K58A 1J8IA 4GKJL 1JWMD 1Y69U 3GTGH 2DUDA 1HZCA 3NP8A 4QB4A 4OWTB 1SNMA 4GN3B 3JAMc 1S3OA 5FLMH 4A3FB 4MNOA 3HOYB 5C0XJ 4IPGA 1E2WA 1FJGQ 4QIWB 2LKVA 4DAMA 3TP8A 1Y1WG 3GTMH 4KKSA 1WTRA 1XMOL 3HS0C 4JOIC 2EIFA 2F03A 3S15B 4HCEA 3F2CA 4X3UA 2PYKA 3TZDA 4X62Q 1SFOH 3EROA 4A3MH 3A54A 2UUCQ 3HG9A 1FJGL 1CI3M 2ZT9C 3WOFA 4A3DB 1BKBA 1O7YA 2A73B 2M2LA 1B8AA 3JC66 4ZUIA 2QCPX 3S9WA 1STGA 3F2DA 4DUZQ 5KIXA 4DR5L 1H9JA 2ICEC 2DGYA 1YI2A 4X3SA 3NBHB 4DR2L 3PIPA 4IALA 3GTOB 3LWEA 1TWAH 4JYAL 4M8AA 2E74C 3I8ZA 4Y7NH 1A15A 4BBRB 5IGFA 5C0XI 4LJZC 1J5EQ 1C4QA 3TBIB 2UU9Q 4EQ5A 1PTOB 3I3CA 1R9TH 1PTOH 2R3ZA 1WCMH 2J7ZA 2MUYA 2IW3A 3AFPA 1VQCA 4EQOA 4A3LG 5I6WA 4BY1G 2MPMA 1YNNC 1KABA 2EYMA 1CZWA 3J7AF 1JB7A 2F0HA 4WJ3M 1LUZA 4HJ9A 1JWUD 3I4LA 5EKLA 1STAA 3J7ZC 1WTQA 1H9RA 4DV4Q 1TY0A 1VQ8A 1G2SA 3PO3G 2XSCA 5JJZA 4LF6Q 1ET9A 4A3BG 1ML0D 3D6WA 5DNFA 1XPOA 1CZGA 3M7GA 5GAHC 4A3CG 1O7LA 3PO2B 2A6EC 3R3OA 3GTPB 1D5ZC 1S5ED 1LT4D 1IW7C 2SNMA 2IL8A 2D2CC 4OIKA 4RH6A 2F0NA 3C46A 1RODA 4LFBL 2KCCA 2RBMA 1H95A 1B44D 2GN5A 4IQZA 3KBXA 1WD1A 2WKDA 1SNOA 4NPSA 4FF1A 4LFCQ 3I4NB 1YZ6A 2LXKA 3BZCA 2FHTA 2IPKD 4ZQ3A 5E3FA 5K5PA 5IGEA 2Q8TA 4QUFA 5AJ3L 1A8VA 3R2IA 3QG1A 1Q1BA 4PZ6A 1N36Q 3PUVA 5CR3A 1SYCA 3KYHC 4A3LH 3K6OA 2EPBA 2PW5A 3S16H 4PZ8A 4TRDA 4P74A 3G4SA 4XYOA 2AQ3B 1GUOA 3WWVA 5IT9E 2FINB 4FVMA 3J81L 1SLJA 2KEDA 2WACA 3H6MA 1Z9FA 4A3JG 1LLRD 3L0OA 4V0BA 4A93B 1N36L 5C44G 5BN3A 3ERQA 4HJ8A 3GTGB 1SYBA 2ZTDA 1S5CD 1HRJA 5EBCA 2QKIC 3H3VC 4B08A 1C9OA 1Q82C 1HZ9A 3AB9A 2XNAC 3IFTA 3CC7A 1VQMA 4JV5Q 4PMBA 5KEEA 2SEBD 4A3FH 4YCUA 4KHPQ 2I5LX 5CORA 1CTMA 1WTXA 2RDFA 2EDGA 1EOTA 4OHJA 1VQ9A 3EN2A 2F52A 1T5EA 1F9RA 5C0XG 5CBAE 1BVSA 2B39A 2JA6G 5TSSA 3D4RA 3FP9A 2LS01 5FO7B 1J6QA 4A3MB 3D6CA 4YY3L 4J1MA 5E4XA 2KCMA 2NVQH 4ZK9B 3PF5A 1I6VC 2E2HB 4DK6C 1Y1WH 2JE6I 2ZJPA 2NVQB 1PH1A 4A3DG 1IL8A 2HUGA 2B2YC 1EYDA 2Z9HA 1NMGA 1KLGD 2BOSA 4B3SL 4DA2A 4WJ4A 3O13A 1CT1D 3K0XA 1B50A 1B53A 3MEFA 1DOLA 4N9PA 3Q24A 5JOBA 3HKZG 1E1OA 2CCZA 4QL5A 5JPMC 1NTGA 2B63B 2DJGC 2H5XA 3ONAB 5EGTA 2A6ED 4IFDH 2HIXA 4UP8A 1SJHD 4HIDA 4DXFA 4GNXA 2VUMG 1PXUA 2EYPA 1JOQA 2UXBQ 2JEAI 4PMCA 1HUMA 4FXGC 4IUPA 5GROA 1ENFA 2NZ1D 1AN8A 1XMQQ 1BNZA 1WCMB 3G7LA 4R9WA 2CWAA 1RHPA 4QGUA 1S40A 1K28A 1I6HH 1YBYA 4B3TQ 4X6AH 1PRTF 1AZPA 3OOCA 3TEHB 1MIUA 3BS1A 1YNJC 1VQGA 4A3EB 3FHWA 2LFNA 1EQQA 2F0EA 2F0FA 2F0PA 3R93A 4DN4M 3IL8A 1TY2A 2BE5C 2F3WA 3OTOQ 2NN6I 2HHHL 5EKKA 2VNUD 4H44C 1HTPA 1QVGA 3NQIA 3M4OB 1WJJA 3SR1A 1ICWA 2A1AA 3KDFA 1PH6A 3STBC 3K80C 1LACA 2O5IC 5LMUQ 3E9HA 4EQNA 5C3XA 3GTJB 3RN5A 3MHBA 3UDGA 3G71A 3K0YA 4NDXA 1CSQA 3CW2C 4B9XA 1PFSA 1L1OC 1QILA 5IWAL 2EYJA 3UDIA 2L1BA 2X6LA 3NELA 1PDQA 2K4KA 2MJ8A 4BBRG 1Q81C 3OIQA 4ZUJA 4X3TA 3KJPA 3BDLA 4FF4A 2Z6BA 1TXYA 5IGBA 4JBKA 4ULLA 1VQEA 4GLVB 2Q2IA 5JVG3 4KY7A 4A3IB 1DD2A 4R4OA 1BCPF 3D31A 4A3BB 2RA4A 1SJED 4BY7H 3V2TA 2JA5H 4JOIA 1PH3A 1VQHA 1AE2A 1X56A 2D9UA 3H09A 1E24A 3K5OA 1I3QB 1HNXQ 2YTYA 4UP9A 3CMEA 1SYEA 5GQOA 4X62L 2NVYB 3CPWA 5JVH3 4P71A 3AYHB 2JSOA 2MO0A 4WJWA 1KIXA 1HNXL 4C56C 3K7AB 1GUGA 1IBKQ 1GHKA 1UUPA 3HZXA 4BA1I 4DV6L 4NP5A 4PQXA 5DAUA 3HOUB 1QB5D 3SHLA 3FKIB 2PQEA 3H91A 1MBYA 3FMCA 1DGSA 1ZEQX 3V05A 1BBWA 3QWNA 2D0OA 4DAPA 1BCPD 3LNNA 4NW2A 2ZTCA 4X3KA 1CA6A 1KTKA 1STYA 3PUZA 4LWCA 2BH2A 1OO9B 1GUSA 3NUCA 5J22A 1YNJD 2UU9L 1MKHA 3M9BA 4YIJA 2I07B 3F8TA 2K14A 1HZAA 4FP5D 1STHA 4NKLA 2K01A 4R1JA 1HCZA 4R8NA 4GN4B 4K14A 1EY7A 3HOXB 2D0PA 3K8AA 2YU9B 3HOXH 4TQUS 4FNFA 4N8X1 2EY6A 1EL0A 1Y8PB 5M3FB 1A6XA 4OX9Q 4C3JB 5C3EH 1RD9D 3J7YW 2E2IH 5C4HA 4DAYB 1UE5A 1W6JA 3X3NA 4DV4L 2CVRA 3CQZB 4LUOA 2EXDA 2R61A 1R4PB 2CQAA 1KC8C 3RNUA 3X3MA 3PQIA 1CHPD 5JJKA 2EYHA 5LL6X 4POFA 4DR4Q 5AFWA 4IUNA 1EQRA 4GOPA 4P75A 2ENBA 2E2JH 3EIVA 4JI3Q 1Z47A 2MNAA 1SBBB 2K03A 5EJWA 5FLXc 1SMXA 3I55A 3K5NA 1VQJA 4RA8A 4A3EH 4LFBQ 2NWGA 5L37A 1K83B 4DK1A 1HNZQ 5A2QE 4DV1L 1QZGA 1VQFA 2MP1A 3J81j 1SYFA 3S1MH 2R7ZB 3M4OH 4G7ZC 5AJ3Q 1FL0A 1F2MA 4R4IA 1N34L 2PZUA 4LF9L 2NTTA 3CCMA 3S2HB 3GTJH 1KAAA 5C4XB 2ZXPA 1VF7A 2WAQB 4DV1Q 1Q86C 4ZKCB 5T1GA 5LMNL 3I73A 1JOOA 3TQYA 1NSNS 2EYLA 4BBSG 5E7NA 1VQDA 2F0DA 1PTOD 1HPCA 1XPUA 1VQAA 4J8QA 5IP7H 4CKEA 3PO2G 4JK1C 3SK6A 1YNND 4GNXB 4YWLA 3GTKB 1W3SA 5KRUA 4GKJQ 1GKHA 1LYLA 3K57A 2G9DA 3GTKH 3PO3B 4OEMB 4OELB 1Q3LA 2KHSA 1S4ZA 1MHWC 4OGQC 3TP7A 3A5UA 1C7YA 1JT8A 2C5CA 2JA5B 3OMGA 3JAME 3T53B 3RZDH 5JJLA 4LAAA 4M1UB 2K32A 4HIOA 4DV2L 1EY0A 3J80E 3RZDB 1VQNA 1CA5A 3JAMi 3DLLA 4O1NA 5M3FG 1BDOA 2NVYH 5C4XG 2WKCA 1PRTD 4RCOA 2VQFL 2AQ2B 1FYCA 1MI2A 3CCLA 2BCOA 5FJ8H 3HOXG 2UUBL 3VR2A 2B63G 2HQEA 1S5DD 2RCFA 4DV2Q 2UUCL 3A8IE 5D65A 3J81E 1SE4A 5IGGA 3HOYH 4FO2A 3BVZA 3K7AH 4RWSC 1WVLA 2TSSA 3CU7A 1PTOF 4DV3L 3KLSX 4QF4A 4UY8C 1D6EC 1EY9A 3BVMA 3D8GA 1DOKA 4C3IG 3KLWA 1AFPA 3ERSX 3R8BA 1W2BA 3E6ZX 1SFOB 3A74A 3BDOA 3HP3A 1WD0A 3K81C 1LV9A 2A68D 4DV3Q 3T56B 3H0GG 3RZOB 4JYAQ 2Z6KA 3NBHA 3TS2A 2EVBA 4JI2L 3HFZB 2ZJQA 1ONLA 5FK9C 1QNUA 4LF8Q 2K33A 1TU2B 2Z8LA 4MIUA 1AE3A 4KI0A 1HR0W 2YU9H 4AYBE 1D1KA 1ZKOA 4LF7L 4IPCA 2A8VA 1VF5C 4HN7A 2F3IA 2Y0SB 1KDBA 3K7UC 2ZXOA 1X9NA 1LABA 1OXTA 4BWGB 4LF8L 3HOYG 3NTKA 3NTHA 1CHQD 3ND9A 1EEID 2B3GA 1EQTA 3OTOL 1AP0A 1PZKD 3VYRA 5FO9B 1TS4A 1IBML 2SOBA 1KXLA 3BYTB 4RGOS 3GTLB 4K2LA 3CCSA 4LF6L 3RN2A 3Q22A 5LMUL 4IPDA 5C5LA 2E2JB 1P8LA 4RCNA 2VW9A 4A75A 2KVMA 2O4XA 2QDLA 1EFWA 1G2TA 4BA2I 3HOUG 4IOAA 4A3GH 1K83H 4R8IA 4IFDJ 1JJ2A 1V8QA 1KL9A 4A3GB 1DJRD 2E2DC 4CJ0B 1PV4A 1BOSA 2K5NA 5EPLA 4HCSA 4X64Q 3I2ZA 2N88A 5IYCH 1BQQT 4K6DA 2DNCA 3A8KE 2OF1A 3SK4A 3IFDA 4WORA 4DV7Q 4J6HA 4GOPB 4HMIA 1XNQQ 3BJUA 2RDGA 4DUYL 2VB2X 5C4XH 3LX0A 2B2UA 2AMCB 3NHHA 1SE3A 4ZCKA 1XJVA 4N8FA 2QGQA 4P2CB 2Y0SE 4POGA 4PG3A 3GQBA 1M90C 2A69C 2K5HA 2X6GA 3J7A5 4RKBA 1EY4A 2JA7B 2PNHA 1Y1VB 2O5JC 1PLFA 3SGIA 2J0TD 1O78A 2OTLA 4QQBX 5CGKA 1LT5D 1FNVA 1F9PA 4XQJA 1EOVA 1LM0A 4OO1G 1BF4A 4IPHA 4GN5A 2K1BA 5BN5A 5IIFA 1LTID 4NXMQ 3AMUA 2FXQA 3FPPA 3HEJA 3CMAA 2RQXA 3FPUB 2DJFC 3MVVA 1FD7D 3S16B 1IBKL 3D0FA 4IJLA 1Y8NB 4AYBB 1PYSB 1VQOA 3DMUA 1H9SA 4APVA 1MD2D 1RL2A 5CV9A 2AWNA 3AEVA 3SEBA 2OWOA 1UE7A 1JICA 4C3JG 1EWHA 1D2BA 5M5XB 4J15A 5A2QL 2G9HD 2KHJA 1CM9A 2MGSA 2FFKB 3HRZC 3L2PA 2K5WA 2IT1A 1VQ4A 1SE2A 3OYYA 4G4KA 4LFAQ 3JAML 3B6YA 1SXTA 1H9SB 1TKWB 3S15H 3U9OA 5IYDH 2PMZE 4DV5Q 4YCVA 5NUCA 4A3EG 2B2VA 3KFUA 1GD7A 3FEWX 1WTVA 2E75C 1SR3A 4DAYA 2I46A 1WYDA 2OEOA 2IX0A 5C4JH 1YIJA 4LF4L 2JA8H 3HOZB 3KBGA 3VYUA 2F0MA 4ZKBB 3M3YH 5C0XH 4Q5VA 4DNRB 2XGTA 2Z0SA 4XYQA 5IP9H 1EEFD 1OXSC 2F0QA 4PNYA 1TIID 2V1CC 1VQLA 3IAYA 3WOEA 5FJ8G 2L4NA 5IT9L 2F0IA 1SMYC 2WV6D 3GTQH 5BR8L 3PUWA 3FDTA 5I6YA 1LT3D 4KLKA 1VS0A 2PZWA 3BVGA 3A5ZB 4K0KQ 1QVCA 4GKKQ 5IYBH 1HNZL 3CD6A 1PH7A 5DM63 5EAYA 2A6HC 4LNQA 5COYA 2B29A 3H0GB 2LY7A 2K5VA 4EVOA 1HTLD 1ZXTA 4B3ML 4A3KB 2NUCA 4HTHA 1UE6A 1STEA 3BG3A 4LF9Q 2HD3A 1X55A 5LMNW 4C1NK 4GKKL 2R93G 3MXUA 1XWEA 3Q0AA 2PMZB 3MAQA 5LMNQ 3HGBA 1XXGA 4C3HG 1G6PA 3MWYW 4JI5Q 1HQMC 2Z4IA 3A0JA 4DU9A 1HFGA 2F0VA 5KGUA 2TMPA 3MA2B 1CKNA 1KDAA 5E1FA 2LMCB 3GD7A 2ATWA 2WAQG 1C48A 1I4RA 2IY5B 1LTRD 3DWPA 5C44H 1X6OA 3GTPH 2NB0A 1M4VA 3D3RA 4GLAC 2Q8IB 4CDFC 4RFBA 3L7ZC 1E2VA 3OIPA 3CHBD 4Y52H 4MHEA 2EE1A 3CAMA 1XYIA 1B3AA 1UAPA 2GA4B 5IYCG 1F2YA 1A3UA 4KY6A 1EWCA 1MGSA 3L9AX 2PW7A 1EZ8A 1PH9A 1GUTA 3S17B 2KBNA 1B2TA 1WTPA 5IODA 1BCPB 2A6HD 3BZDB 4C2MB 3OPOA 5A35A 5CV8A 5FOBB 4X66Q 2VQFQ 1FGUA 4PV1C 4HJAA 4O42A 2UUBQ 2L11A 3I4NG 3KF8B 2CHBD 2DY7A 1X3EA 2J4XA 2LSSA 2E8GA 3M4YA 3TSSA 4PZ7A 5M9OA 1PH2A 3BYYB 1VCIA 3ITPA 4KTAA 2BA1A 2CW0C 4JG2A 4KHZA 4X66L 4CDEC 5CMDA 1OXXK 2EY2A 2A68C 3J81i 3FRPB 2PNRC 5M5XH 2AWOA 1E3PA 1QUQA 1N9WA 3NWSA 3NPPA 1FNWA 1G91A 2N3SA 4A76A 1K8AC 4L63B 2OTJA 1IZ6A 1NR4A 3U4VA 1PRTC 1YEZA 4QIWE 3QOLA 2RCNA 4H7BA 1S72A 1QJOA 3IRBA 1LT6D 5HY6A 1LTLA 3FKIH 1V1PA 5J39A 5FLMG 2YTVA 1PFMA 3PCOB 2B2UC 2VUMH 2BA0A 1I4GA 3NBIA 1EYGA 2E2HH 1TQOA 3D4DA 1Q8KA 1VQ7A 1WCMG 2JN4A 1TR5A 1A3TA 2A74C 3H94A 2B8GA 3OWEB 5F2DA 2CQOA 3HOZH 3ER0A 2VL6A 2KJXA 5DLQE 4DR6L 1L0YB 3W3AA 3M3YB 4OX9L 3T1YQ 1IBLL 3KF6A 1L0WA 4BXXH 1EYCA 1SAPA 4ILWA 2Y0SG 4UDUC 2AHOB 4IO9A 4CHTB 2R93H 2B63H 2OQ0A 2I5HA 4H02A 4KD3A 4LF5L 2B2TA 2KCNA 4L8JA 3EBEA 3T1YL 3RLFA 2AUJD 1Q1EA 5M3FH 1U4RA 2C35B 2P5ZX 3DUZA 3VR5A 1NCVA 2E2IB 3T51B 3MC0B 4AIMA 3QO2A 3KF6B 2F1MA 4RG1A 4X64L 1CSPA 2CH4A 5IYBG 2GVAA 3H0GH 1YHQA 1QZHA 4JPBW 5ELDA 3ZJYC 1I6HB 2KQ3A 2HDLA 1D1IA 3OHXC 1XNQL 2A69D 5M5WB 4C3IB 4RGNA 1CUKA 3F2BA 1X3PA 1I4XA 1EQVA 2RHSB 1N34Q 5KNCA 1X32A 1LTBD 4JI6L 3VA5A 1KAWA 3STBD 1ESFA 1GVPA 2DN8A 4XT3B 3OWFA 3NENA 4FF2A 1EYAA 1JC7A 2I5MX 1V1QA 1P16A 2RSNA 4LFCL 5T1IA 2BE5D 4R4QA 1NE3A 3T1HQ 2R7ZH 4S3SA 2WINB 3VDYA 2HCCA 5C44B 1TS3A 3W5OA 3V96A 4A93G 4GZYC 1SEBD 1HR0L 3DEPA 1U4LA 3S1RB 1E7ZA 4KN7C 1E22A 3MZ5A 5FKAC 3URYA 2N8NA 2F0OA 2A5HA 1VQPA 1B1ZA 3TMEA 5G3LF 4MN3A 2IWHA 1XPRA 1I4QA 4C2MH 3KOJA 3E3XA 3DM3A 5ELCA 4A3IG 3I56A 1HR0Q 3F2UA 4AQYQ 5DEHA 4DUZL 3SE0A 3TN2A 3H15A 4I7AA 4A3IH 1JE5A 3MFYA 3KDFB 3A7LA 4DR2Q 4BY1B 3SK8A 3PIOA 1Y8OB 3PO3H 4XXEA 3NTIA 4L5SA 1UNSA 1F9QA 2DY8A 3I4OA 4ODGA 1BUVT 4OONA 5J1ZA 1N32L 2ZM6Q 2JP1A 4DV5L 1WOCA 2EXZA 1SYGA 1J5EL 1PYBA 5EBDA 2KENA 2N49A 5EQ0A 3QOJA 2K6AA 5C3EG 4K6LA 2K7VA 3M4QA 5JJIA 1VQIA 2A19A 1F2LA 1SNCA 2IHEA 1MSGA 3PUXA 5M3MG 3UE1A 4H0LC 1JWSD 4DAVA 1K3BC 2R7ZG 4OO1H 4LF4Q 1N32Q 1CQFA 2ZM6L 3RUZA 3K59A 4DXGA 4B3SQ 3EJIA 1X3FA 1BCPC 1M8AA 1QE6A 4GNXC 1I50H 1H9MA 1ZYRC 2QEJC 5EKIA 3PIO3 3HOUH 1QOHA 5KNBA 2Z6KC 2EJGC 1VQ5A 4LUVA 1HFNA 1TWGH 3NE5B 2ZTEA 5JEAG 4R4TA 1TWGB 3BDCA 1BBUA 4FXKC 3HOVB 4KJNA 1XNRL 1WTWA 1IKLA 4HSPA 3KLSA 2JA9A 5I2XA 4B3RQ 1SYDA 3KUPA 1ILQA 2KUMA 2L55A 1A0IA 4K0KL 2Q2HA 1A3VA 2NZHA 1JMCA 2UXBL 1LTTD 1F9SA 4EQPA 5I9OA 1RIPA
chains in the Genus database with same CATH topology
2AMCB 2F52A 3EN2A 4LFAL 4B3MQ 1XJVA 1XNRQ 4POGA 1SE8A 2QGQA 1U5KA 2Y0SE 1BVSA 5C0XG 4PG3A 2JQOA 2QEXA 1M90C 2JA6G 3TRZA 5IT9c 3ICEA 3FP9A 1SROA 1I94L 3AFQA 1NY4A 2K5HA 4A3FG 2JA5G 3J7A5 3CXCA 1J6QA 3H3VH 2PNHA 4HJ7A 3SGIA 4YY3L 1TWHH 5GADC 2KCMA 2OTLA 4JI7L 2NVQH 4QQBX 3PF5A 1IL2A 4DK6C 1Y1WH 4TVAB 1UEBA 2JE6I 2ZJPA 1GM5A 5IY0A 1PH1A 1EOVA 1LM0A 1YHAA 2CWPA 2PQAA 4A3DG 4OO1G 1C0AA 4IPHA 4GN5A 1NMGA 2VY3A 2HHHQ 4B3SL 4JI4Q 4NXMQ 1I94Q 4WJ4A 2FXQA 4DV0Q 3HKSA 3RLOA 1B70B 3K0XA 3CMAA 1U0LA 3MEFA 4BY7G 1K73C 3BZKA 3J80i 3HKZG 1IBKL 1E1OA 3D0FA 4IJLA 2CCZA 4QL5A 4JC0A 1PYSB 1NTGA 2JA6H 4AH6A 2ID0A 1K0RA 2JK8A 4IOCA 2H5XA 1VQOA 2ES2A 2HIXA 4DUYQ 4UP8A 4APVA 4HIDA 1NBWA 1RL2A 3AEVA 2AWNA 4A4IA 4GNXA 1HJPA 4DV0L 2PQAB 2OWOA 2VUMG 4DKAC 1FVIA 1UE7A 2N78A 3M4PA 3CCUA 1VQKA 2AKWB 1N8RC 4J15A 4OWWB 2UXBQ 4DV7L 4KHPL 2KHJA 2JEAI 4DNIA 3L2PA 5GROA 4UPAA 1G291 2IT1A 2XTIA 1VQ4A 1XMQQ 2R92G 3HOZG 4A3BH 3S1NH 3OYYA 4HIMA 2CWAA 4LFAQ 4JI7Q 5IWAQ 4QGUA 1OXUA 2PI2E 4QY7A 4YHHL 2VQEL 1S40A 2IX1A 3S2HH 3B6YA 1I6HH 2WB1E 1X54A 1D8LA 1YBYA 3NEMA 4RMFA 4B3TQ 4X6AH 3S15H 2R7FA 5M5YH 2PMZE 4DV5Q 1E1TA 4YCVA 4A3EG 3S1RH 5IYDH 1YHBA 3TEHB 3KFUA 1I3QH 1MIUA 1T9HA 4L5QA 1GD7A 4PMWA 2F4VL 4A3JH 1SR3A 1VQGA 3FHWA 1GO3E 1TWFH 1EQQA 1Q12A 1WYDA 4GS3A 1VQBA 5K36G 2YTXA 1G51A 1Y14B 2JA7G 4ALPA 1L1OB 3OTOQ 3S2DH 2IX0A 2NN6I 5C4JH 3GDEA 1YIJA 2HHHL 2NVTH 3BU2A 4LF4L 2VNUD 1QVGA 2JA8H 1XTDA 2K75A 1WJJA 2A1AA 3KDFA 1EIFA 1PH6A 2F4VQ 3STBC 3K80C 1MJEA 1KQSA 3M3YH 5IYDG 5LMUQ 4JI1L 2XGTA 4UP7A 1HZBA 3E9HA 2Z0SA 1VQ6A 4IFDI 2R7DA 3RN5A 4BY1H 3UDGA 4JI8Q 2K52A 3G71A 5IP9H 2JEBI 1EIYB 1CSQA 3CW2C 1OXSC 5ELNA 1PH8A 5ELOA 3CCRA 1PFSA 4XTCS 2V1CC 3GO5A 4AYBG 1VQLA 1L1OC 5IWAL 1JJGA 5FJ8G 5GAEC 3UDIA 3GTQH 1B7YB 3NELA 5BR8L 2K4KA 4BBRG 3PUWA 1Q81C 4KLKA 1QUQB 1VS0A 4JV5L 2HQLA 3KJPA 3A5ZB 4K0KQ 1QVCA 4GKKQ 5IYBH 4JI8L 3UDXA 1HNZL 3CD6A 1PH7A 2WFWA 1TXYA 2VS1A 4FDBA 4JBKA 4A3DH 5EAYA 4LNQA 1VQEA 1SRUA 1SN8A 4GLVB 2Q2IA 1CKNB 2B29A 2K5VA 4R4OA 1PHJA 3D31A 4B3ML 1KRTA 2JJQA 4GOPC 3I7FA 2GVBA 2KHIA 1K8GA 3I4MG 3PF4A 4BY7H 1UE6A 5IE8A 1PH4A 1TWCH 1IBLQ 2OQKA 3PUYA 4LF9Q 2JA5H 1X55A 1V9PA 3S14H 5LMNW 4JOIA 1PA6A 1PH3A 1VQHA 1AE2A 1X56A 2L15A 4GKKL 4A3CH 2R93G 1E24A 1KD1C 2VZAA 4OWXB 4C3JH 1HNXQ 2YTYA 4UP9A 3ULJA 5LMNQ 1QVFA 3CMEA 1G6PA 3ULPA 5GQOA 4JI5Q 4X62L 4BBRH 3A0JA 4YCWA 3CQZH 3CPWA 4O0AA 4L5RC 1M1KC 1YNXA 4JBJA 1CKNA 3RZOH 4P71A 1CKMA 3AYHB 3TREA 2RHQB 2MO0A 3GD7A 4JBMA 2WAQG 5BR8Q 2ATWA 1X3GA 1KIXA 1ASYA 4HIKA 1HNXL 2IY5B 5C44H 4A3GG 1X6OA 1IBKQ 3GTLH 3GTPH 3PSIA 1PH5A 3CCJA 4BA1I 1OTCA 4DV6L 4GLAC 1MJCA 3HOVG 3OW2A 3L7ZC 4OO1I 2NN6G 4Y52H 3CAMA 1PVOA 4OXPA 5IYCG 4GLXA 2MFIA 1DGSA 2HT1A 2HIVA 4JBWA 4A93H 3G48A 1BBWA 2Q2TA 2D0OA 3MXNB 1PH9A 3Q8DA 3E9IA 4DR4L 2Q2UA 4X65Q 4JI6Q 2KBNA 2ZTCA 5H1SE 1YITA 1IYJB 5J3BA 2EQSA 2QA4A 1XMQL 3RLNA 3PUZA 4LWCA 2BH2A 1KHIA 4JI3L 1O7IA 2UU9L 1MKHA 2R6GA 3M9BA 4YHHQ 3F8TA 2K14A 4X66Q 1HZAA 1FGUA 2VQFQ 4JI0L 3PO2H 4HJAA 1YJNA 4B3TL 4R1JA 3CP0A 3PGZA 2UUBQ 4DR6Q 3I4NG 1HNWL 3KF8B 2WB1G 4GN4B 4A3KH 1YVCA 4A3MG 2UXDL 1X3EA 2LSSA 2E8GA 4PZ7A 1PH2A 2D0PA 3K8AA 2JA8G 2IHFA 3HOXH 1VCIA 4TQUS 2BA1A 2K50A 4JI5L 1EWIA 4JG2A 4KHZA 2JA7H 3RR5A 1K9MC 4X66L 3HOVH 2CFMA 4DK3C 1OXXK 4LF5Q 4OX9Q 5C3EH 4EX5A 4C3HH 1V43A 2E2IH 4BXXG 3J81i 4DAYB 1EUJA 1UE5A 4DV4L 4YWKA 2MQHA 5M5XH 5HGQA 5JEAJ 2AWOA 1E3PA 1QUQA 2EXDA 4LUOA 3G6EA 1N9WA 2UXCL 2UXDQ 4JI1Q 2N3SA 1KC8C 3RNUA 1HH2P 4A76A 1Q7YC 2ASBA 2R92H 1K8AC 5JJKA 3S1QH 5IP7G 4L5TA 2OTJA 1IZ6A 4P73A 4POFA 4DV6Q 4DR4Q 3U4VA 1YEZA 4QIWE 2RCNA 3CC2A 1EQRA 1S72A 3IRBA 4GOPA 1KRSA 4P75A 2E2JH 3EIVA 1I5FA 5HY6A 4JI3Q 1Z47A 3GTOH 4DR7Q 1LTLA 2MNAA 2UXCQ 4MTNA 4IFDG 3FKIH 4HJ5A 5FLMG 2YTVA 1IXRA 5FLXc 1SMXA 3I55A 1VQJA 3PCOB 4A3EH 1Y1VH 2VUMH 2BA0A 4LFBQ 3TS0A 4GKJL 3AQQA 3F1ZA 1HNZQ 3GTGH 1EYGA 2E2HH 3PV0A 2DUDA 1HZCA 1YJ9A 1Q8KA 1K3RA 1WCMG 4DV1L 1QZGA 4DR5Q 1VQ7A 3U4ZA 1VQFA 3J81j 4OWTB 1Y1VG 3S1MH 4GN3B 2CQOA 3M4OH 3ER0A 3HOZH 4DPGA 3JAMc 1S3OA 2VL6A 5DLQE 5FLMH 4DR6L 4MNOA 4DR7L 5AJ3Q 5C0XJ 1FL0A 4OX9L 4R4IA 1N34L 4IPGA 3T1YQ 3CCEA 1IBLL 3KF6A 1L0WA 4LF9L 1FJGQ 4BXXH 3CCMA 3GTJH 4DAMA 1Q46A 1Y1WG 3GTMH 4IJHA 1XMOL 4DR1Q 2Y0SG 2EIFA 4JOIC 2LXJA 1D7QA 3CCQA 4DV1Q 3F2CA 1Q86C 2AHOB 4IO9A 2NVXH 5LMNL 2R93H 2B63H 2OQ0A 2I5HA 3LGJA 4H02A 3TQYA 4P72A 4LF5L 4X62Q 1SFOH 3M7NA 4A3MH 4BBSG 2UUAL 5E7NA 1VQDA 2UUCQ 3CPFA 2D62A 3EBEA 3RLFA 3T1YL 1FJGL 1A62A 1ASZA 1Q1EA 1VQAA 1XPUA 5M3FH 5IP7H 3HOWH 1JJCB 2C35B 3PO2G 2WP8J 4QJFA 4DR1L 4AIMA 4B3RL 4GNXB 1BKBA 3KF6B 1B8AA 3JC66 4RG1A 4YWLA 4X64L 1CSPA 1W3SA 4GKJQ 5IYBG 2GVAA 3H0GH 1GKHA 1LYLA 4DR3Q 3HOWG 3F2DA 1YHQA 1QZHA 3GTKH 4DUZQ 4JCVE 3ZJYC 4DR5L 2YYZA 4A3KG 3A5UA 2UUAQ 4NB3A 2BH8A 3UDFA 1C7YA 4JI2Q 1JT8A 2DGYA 1YI2A 1XNQL 4LW1A 3NBHB 4DR2L 5JJLA 3RZDH 3PIPA 1NMFA 1CUKA 3F2BA 4HIOA 4DV2L 3UE0A 2RHSB 1N34Q 1VQNA 1AH9A 3JAMi 4LF7Q 4X65L 3DLLA 4JI6L 4O2DA 1KAWA 1TWAH 3STBD 4JYAL 1GVPA 4Y7NH 5M3FG 4DR3L 3I4NH 2NVYH 5C4XG 5C0XI 1J5EQ 1UWVA 3NENA 5GAGC 2UU9Q 4EQ5A 2I5MX 2VQFL 1V1QA 1P16A 4JI0Q 4LFCL 3CCLA 3W1GA 5FJ8H 3HOXG 1R9TH 2UUBL 2B63G 4R4QA 1NE3A 2KCTA 3T1HQ 2R7ZH 1HNWQ 1WCMH 2PI2A 4DV2Q 2UUCL 3VDYA 2WAQE 1WI5A 3HOYH 3AFPA 2CKZB 3ULLA 3K7AH 4JI4L 1VQCA 1IBMQ 4A3LG 3W5OA 4A93G 4BY1G 4DV3L 1HR0L 3J80c 4UY8C 1E7ZA 1E22A 1JB7A 3KLWA 3ERSX 2N8NA 1W2BA 1LUZA 4WJ3M 4HJ9A 3J7ZC 1N33L 4DV4Q 3I4MH 1VQ8A 1OXVA 4XIGS 1VQPA 3PO3G 3A74A 3K81C 1XPRA 4LF6Q 4C2MH 3KOJA 3U50C 4DV3Q 4A3BG 3DM3A 4R4CA 2ZJRA 4A3IG 3I56A 1XPOA 3H0GG 1HR0Q 1CKOA 1UE1A 4AQYQ 3FKIG 4DUZL 5GAHC 4JYAQ 3H15A 4LF6L 4A3CG 2MO1A 2YV5A 2Z6KA 4A3IH 3W1BA 3TS2A 1JE5A 4JI2L 3HFZB 2ZJQA 3KDFB 4ME3A 4DR2Q 3CC4A 1N33Q 1X65A 3PIOA 4LF8Q 3PO3H 4L5SA 2VQEQ 2OCEA 3I4OA 3T1HL 1AE3A 4KI0A 1HR0W 4OONA 4AYBE 2YU9H 4LF7L 2ZM6Q 3E0EA 4IPCA 2A8VA 4LFBL 5M5WH 3KJOA 1N32L 2F3IA 4C3IH 4DV5L 1H95A 1WOCA 3M85A 2GN5A 1J5EL 3K7UC 1X9NA 1PYBA 3J81c 2KENA 1OXTA 2N49A 5C3EG 5JJIA 4NPSA 2E5LL 3M4QA 4LFCQ 1VQIA 1YZ6A 2LXKA 3BZCA 3S24A 2I0QA 4LF8L 2A19A 2IHEA 3PUXA 3CCVA 3HOYG 5AJ3L 3H3VI 5M3MG 4YWMA 2B3GA 3UE1A 1A8VA 3OTOL 2R7ZG 1Q1BA 4PZ6A 1N36Q 4LF4Q 1N32Q 3PUVA 2ZM6L 1IBML 1KXLA 3KYHC 4A3LH 1XMOQ 4B3SQ 4NXML 3S16H 2ALYB 1WFQA 4PZ8A 1X3FA 4YY3Q 4P74A 3CCSA 3RN2A 3G4SA 5LMUL 4IPDA 4MZ9A 4GNXC 1I50H 1A63A 3HOUH 4NXNQ 3WWVA 2E5LQ 4AQYL 1P8LA 2RF4A 3HKZE 2VW9A 4A3JG 5M3MH 1SLJA 2Z6KC 4A75A 1Z9FA 1VQ5A 4LUVA 1L2FA 3L0OA 5IP9G 1TWGH 1EFWA 2ZTEA 5JEAG 4R4TA 4BA2I 1N36L 3HOUG 4IOAA 1L1OA 5C44G 4A3GH 1BBUA 4HJ8A 1K83H 2ZTDA 1XNRL 4IFDJ 3S17H 2NZOA 2JA9A 1JJ2A 1KL9A 4BBSH 4B3RQ 1PV4A 1C9OA 1Q82C 1HZ9A 2K5NA 4X64Q 3CC7A 3I2ZA 1VQMA 4NXNL 4JV5Q 5IYCH 4LUZA 1A0IA 4K0KL 2Q2HA 4A3FH 4YCUA 1YJWA 2NZHA 1JMCA 4DV7Q 4GOPB 4KHPQ 1NJIC 2I5LX 2UXBL 3CF5A 3U58A 3BJUA 1XNQQ 4DUYL 1RIPA 5C4XH 1VQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMC B;  2F52 A;  3EN2 A;  4LFA L;  4B3M Q;  1XJV A;  1XNR Q;  4POG A;  1SE8 A;  2QGQ A;  1U5K A;  2Y0S E;  1BVS A;  5C0X G;  4PG3 A;  2JQO A;  2QEX A;  1M90 C;  2JA6 G;  3TRZ A;  5IT9 c;  3ICE A;  3FP9 A;  1SRO A;  1I94 L;  3AFQ A;  1NY4 A;  2K5H A;  4A3F G;  2JA5 G;  3J7A 5;  3CXC A;  1J6Q A;  3H3V H;  2PNH A;  4HJ7 A;  3SGI A;  4YY3 L;  1TWH H;  5GAD C;  2KCM A;  2OTL A;  4JI7 L;  2NVQ H;  4QQB X;  3PF5 A;  1IL2 A;  4DK6 C;  1Y1W H;  4TVA B;  1UEB A;  2JE6 I;  2ZJP A;  1GM5 A;  5IY0 A;  1PH1 A;  1EOV A;  1LM0 A;  1YHA A;  2CWP A;  2PQA A;  4A3D G;  4OO1 G;  1C0A A;  4IPH A;  4GN5 A;  1NMG A;  2VY3 A;  2HHH Q;  4B3S L;  4JI4 Q;  4NXM Q;  1I94 Q;  4WJ4 A;  2FXQ A;  4DV0 Q;  3HKS A;  3RLO A;  1B70 B;  3K0X A;  3CMA A;  1U0L A;  3MEF A;  4BY7 G;  1K73 C;  3BZK A;  3J80 i;  3HKZ G;  1IBK L;  1E1O A;  3D0F A;  4IJL A;  2CCZ A;  4QL5 A;  4JC0 A;  1PYS B;  1NTG A;  2JA6 H;  4AH6 A;  2ID0 A;  1K0R A;  2JK8 A;  4IOC A;  2H5X A;  1VQO A;  2ES2 A;  2HIX A;  4DUY Q;  4UP8 A;  4APV A;  4HID A;  1NBW A;  1RL2 A;  3AEV A;  2AWN A;  4A4I A;  4GNX A;  1HJP A;  4DV0 L;  2PQA B;  2OWO A;  2VUM G;  4DKA C;  1FVI A;  1UE7 A;  2N78 A;  3M4P A;  3CCU A;  1VQK A;  2AKW B;  1N8R C;  4J15 A;  4OWW B;  2UXB Q;  4DV7 L;  4KHP L;  2KHJ A;  2JEA I;  4DNI A;  3L2P A;  5GRO A;  4UPA A;  1G29 1;  2IT1 A;  2XTI A;  1VQ4 A;  1XMQ Q;  2R92 G;  3HOZ G;  4A3B H;  3S1N H;  3OYY A;  4HIM A;  2CWA A;  4LFA Q;  4JI7 Q;  5IWA Q;  4QGU A;  1OXU A;  2PI2 E;  4QY7 A;  4YHH L;  2VQE L;  1S40 A;  2IX1 A;  3S2H H;  3B6Y A;  1I6H H;  2WB1 E;  1X54 A;  1D8L A;  1YBY A;  3NEM A;  4RMF A;  4B3T Q;  4X6A H;  3S15 H;  2R7F A;  5M5Y H;  2PMZ E;  4DV5 Q;  1E1T A;  4YCV A;  4A3E G;  3S1R H;  5IYD H;  1YHB A;  3TEH B;  3KFU A;  1I3Q H;  1MIU A;  1T9H A;  4L5Q A;  1GD7 A;  4PMW A;  2F4V L;  4A3J H;  1SR3 A;  1VQG A;  3FHW A;  1GO3 E;  1TWF H;  1EQQ A;  1Q12 A;  1WYD A;  4GS3 A;  1VQB A;  5K36 G;  2YTX A;  1G51 A;  1Y14 B;  2JA7 G;  4ALP A;  1L1O B;  3OTO Q;  3S2D H;  2IX0 A;  2NN6 I;  5C4J H;  3GDE A;  1YIJ A;  2HHH L;  2NVT H;  3BU2 A;  4LF4 L;  2VNU D;  1QVG A;  2JA8 H;  1XTD A;  2K75 A;  1WJJ A;  2A1A A;  3KDF A;  1EIF A;  1PH6 A;  2F4V Q;  3STB C;  3K80 C;  1MJE A;  1KQS A;  3M3Y H;  5IYD G;  5LMU Q;  4JI1 L;  2XGT A;  4UP7 A;  1HZB A;  3E9H A;  2Z0S A;  1VQ6 A;  4IFD I;  2R7D A;  3RN5 A;  4BY1 H;  3UDG A;  4JI8 Q;  2K52 A;  3G71 A;  5IP9 H;  2JEB I;  1EIY B;  1CSQ A;  3CW2 C;  1OXS C;  5ELN A;  1PH8 A;  5ELO A;  3CCR A;  1PFS A;  4XTC S;  2V1C C;  3GO5 A;  4AYB G;  1VQL A;  1L1O C;  5IWA L;  1JJG A;  5FJ8 G;  5GAE C;  3UDI A;  3GTQ H;  1B7Y B;  3NEL A;  5BR8 L;  2K4K A;  4BBR G;  3PUW A;  1Q81 C;  4KLK A;  1QUQ B;  1VS0 A;  4JV5 L;  2HQL A;  3KJP A;  3A5Z B;  4K0K Q;  1QVC A;  4GKK Q;  5IYB H;  4JI8 L;  3UDX A;  1HNZ L;  3CD6 A;  1PH7 A;  2WFW A;  1TXY A;  2VS1 A;  4FDB A;  4JBK A;  4A3D H;  5EAY A;  4LNQ A;  1VQE A;  1SRU A;  1SN8 A;  4GLV B;  2Q2I A;  1CKN B;  2B29 A;  2K5V A;  4R4O A;  1PHJ A;  3D31 A;  4B3M L;  1KRT A;  2JJQ A;  4GOP C;  3I7F A;  2GVB A;  2KHI A;  1K8G A;  3I4M G;  3PF4 A;  4BY7 H;  1UE6 A;  5IE8 A;  1PH4 A;  1TWC H;  1IBL Q;  2OQK A;  3PUY A;  4LF9 Q;  2JA5 H;  1X55 A;  1V9P A;  3S14 H;  5LMN W;  4JOI A;  1PA6 A;  1PH3 A;  1VQH A;  1AE2 A;  1X56 A;  2L15 A;  4GKK L;  4A3C H;  2R93 G;  1E24 A;  1KD1 C;  2VZA A;  4OWX B;  4C3J H;  1HNX Q;  2YTY A;  4UP9 A;  3ULJ A;  5LMN Q;  1QVF A;  3CME A;  1G6P A;  3ULP A;  5GQO A;  4JI5 Q;  4X62 L;  4BBR H;  3A0J A;  4YCW A;  3CQZ H;  3CPW A;  4O0A A;  4L5R C;  1M1K C;  1YNX A;  4JBJ A;  1CKN A;  3RZO H;  4P71 A;  1CKM A;  3AYH B;  3TRE A;  2RHQ B;  2MO0 A;  3GD7 A;  4JBM A;  2WAQ G;  5BR8 Q;  2ATW A;  1X3G A;  1KIX A;  1ASY A;  4HIK A;  1HNX L;  2IY5 B;  5C44 H;  4A3G G;  1X6O A;  1IBK Q;  3GTL H;  3GTP H;  3PSI A;  1PH5 A;  3CCJ A;  4BA1 I;  1OTC A;  4DV6 L;  4GLA C;  1MJC A;  3HOV G;  3OW2 A;  3L7Z C;  4OO1 I;  2NN6 G;  4Y52 H;  3CAM A;  1PVO A;  4OXP A;  5IYC G;  4GLX A;  2MFI A;  1DGS A;  2HT1 A;  2HIV A;  4JBW A;  4A93 H;  3G48 A;  1BBW A;  2Q2T A;  2D0O A;  3MXN B;  1PH9 A;  3Q8D A;  3E9I A;  4DR4 L;  2Q2U A;  4X65 Q;  4JI6 Q;  2KBN A;  2ZTC A;  5H1S E;  1YIT A;  1IYJ B;  5J3B A;  2EQS A;  2QA4 A;  1XMQ L;  3RLN A;  3PUZ A;  4LWC A;  2BH2 A;  1KHI A;  4JI3 L;  1O7I A;  2UU9 L;  1MKH A;  2R6G A;  3M9B A;  4YHH Q;  3F8T A;  2K14 A;  4X66 Q;  1HZA A;  1FGU A;  2VQF Q;  4JI0 L;  3PO2 H;  4HJA A;  1YJN A;  4B3T L;  4R1J A;  3CP0 A;  3PGZ A;  2UUB Q;  4DR6 Q;  3I4N G;  1HNW L;  3KF8 B;  2WB1 G;  4GN4 B;  4A3K H;  1YVC A;  4A3M G;  2UXD L;  1X3E A;  2LSS A;  2E8G A;  4PZ7 A;  1PH2 A;  2D0P A;  3K8A A;  2JA8 G;  2IHF A;  3HOX H;  1VCI A;  4TQU S;  2BA1 A;  2K50 A;  4JI5 L;  1EWI A;  4JG2 A;  4KHZ A;  2JA7 H;  3RR5 A;  1K9M C;  4X66 L;  3HOV H;  2CFM A;  4DK3 C;  1OXX K;  4LF5 Q;  4OX9 Q;  5C3E H;  4EX5 A;  4C3H H;  1V43 A;  2E2I H;  4BXX G;  3J81 i;  4DAY B;  1EUJ A;  1UE5 A;  4DV4 L;  4YWK A;  2MQH A;  5M5X H;  5HGQ A;  5JEA J;  2AWO A;  1E3P A;  1QUQ A;  2EXD A;  4LUO A;  3G6E A;  1N9W A;  2UXC L;  2UXD Q;  4JI1 Q;  2N3S A;  1KC8 C;  3RNU A;  1HH2 P;  4A76 A;  1Q7Y C;  2ASB A;  2R92 H;  1K8A C;  5JJK A;  3S1Q H;  5IP7 G;  4L5T A;  2OTJ A;  1IZ6 A;  4P73 A;  4POF A;  4DV6 Q;  4DR4 Q;  3U4V A;  1YEZ A;  4QIW E;  2RCN A;  3CC2 A;  1EQR A;  1S72 A;  3IRB A;  4GOP A;  1KRS A;  4P75 A;  2E2J H;  3EIV A;  1I5F A;  5HY6 A;  4JI3 Q;  1Z47 A;  3GTO H;  4DR7 Q;  1LTL A;  2MNA A;  2UXC Q;  4MTN A;  4IFD G;  3FKI H;  4HJ5 A;  5FLM G;  2YTV A;  1IXR A;  5FLX c;  1SMX A;  3I55 A;  1VQJ A;  3PCO B;  4A3E H;  1Y1V H;  2VUM H;  2BA0 A;  4LFB Q;  3TS0 A;  4GKJ L;  3AQQ A;  3F1Z A;  1HNZ Q;  3GTG H;  1EYG A;  2E2H H;  3PV0 A;  2DUD A;  1HZC A;  1YJ9 A;  1Q8K A;  1K3R A;  1WCM G;  4DV1 L;  1QZG A;  4DR5 Q;  1VQ7 A;  3U4Z A;  1VQF A;  3J81 j;  4OWT B;  1Y1V G;  3S1M H;  4GN3 B;  2CQO A;  3M4O H;  3ER0 A;  3HOZ H;  4DPG A;  3JAM c;  1S3O A;  2VL6 A;  5DLQ E;  5FLM H;  4DR6 L;  4MNO A;  4DR7 L;  5AJ3 Q;  5C0X J;  1FL0 A;  4OX9 L;  4R4I A;  1N34 L;  4IPG A;  3T1Y Q;  3CCE A;  1IBL L;  3KF6 A;  1L0W A;  4LF9 L;  1FJG Q;  4BXX H;  3CCM A;  3GTJ H;  4DAM A;  1Q46 A;  1Y1W G;  3GTM H;  4IJH A;  1XMO L;  4DR1 Q;  2Y0S G;  2EIF A;  4JOI C;  2LXJ A;  1D7Q A;  3CCQ A;  4DV1 Q;  3F2C A;  1Q86 C;  2AHO B;  4IO9 A;  2NVX H;  5LMN L;  2R93 H;  2B63 H;  2OQ0 A;  2I5H A;  3LGJ A;  4H02 A;  3TQY A;  4P72 A;  4LF5 L;  4X62 Q;  1SFO H;  3M7N A;  4A3M H;  4BBS G;  2UUA L;  5E7N A;  1VQD A;  2UUC Q;  3CPF A;  2D62 A;  3EBE A;  3RLF A;  3T1Y L;  1FJG L;  1A62 A;  1ASZ A;  1Q1E A;  1VQA A;  1XPU A;  5M3F H;  5IP7 H;  3HOW H;  1JJC B;  2C35 B;  3PO2 G;  2WP8 J;  4QJF A;  4DR1 L;  4AIM A;  4B3R L;  4GNX B;  1BKB A;  3KF6 B;  1B8A A;  3JC6 6;  4RG1 A;  4YWL A;  4X64 L;  1CSP A;  1W3S A;  4GKJ Q;  5IYB G;  2GVA A;  3H0G H;  1GKH A;  1LYL A;  4DR3 Q;  3HOW G;  3F2D A;  1YHQ A;  1QZH A;  3GTK H;  4DUZ Q;  4JCV E;  3ZJY C;  4DR5 L;  2YYZ A;  4A3K G;  3A5U A;  2UUA Q;  4NB3 A;  2BH8 A;  3UDF A;  1C7Y A;  4JI2 Q;  1JT8 A;  2DGY A;  1YI2 A;  1XNQ L;  4LW1 A;  3NBH B;  4DR2 L;  5JJL A;  3RZD H;  3PIP A;  1NMF A;  1CUK A;  3F2B A;  4HIO A;  4DV2 L;  3UE0 A;  2RHS B;  1N34 Q;  1VQN A;  1AH9 A;  3JAM i;  4LF7 Q;  4X65 L;  3DLL A;  4JI6 L;  4O2D A;  1KAW A;  1TWA H;  3STB D;  4JYA L;  1GVP A;  4Y7N H;  5M3F G;  4DR3 L;  3I4N H;  2NVY H;  5C4X G;  5C0X I;  1J5E Q;  1UWV A;  3NEN A;  5GAG C;  2UU9 Q;  4EQ5 A;  2I5M X;  2VQF L;  1V1Q A;  1P16 A;  4JI0 Q;  4LFC L;  3CCL A;  3W1G A;  5FJ8 H;  3HOX G;  1R9T H;  2UUB L;  2B63 G;  4R4Q A;  1NE3 A;  2KCT A;  3T1H Q;  2R7Z H;  1HNW Q;  1WCM H;  2PI2 A;  4DV2 Q;  2UUC L;  3VDY A;  2WAQ E;  1WI5 A;  3HOY H;  3AFP A;  2CKZ B;  3ULL A;  3K7A H;  4JI4 L;  1VQC A;  1IBM Q;  4A3L G;  3W5O A;  4A93 G;  4BY1 G;  4DV3 L;  1HR0 L;  3J80 c;  4UY8 C;  1E7Z A;  1E22 A;  1JB7 A;  3KLW A;  3ERS X;  2N8N A;  1W2B A;  1LUZ A;  4WJ3 M;  4HJ9 A;  3J7Z C;  1N33 L;  4DV4 Q;  3I4M H;  1VQ8 A;  1OXV A;  4XIG S;  1VQP A;  3PO3 G;  3A74 A;  3K81 C;  1XPR A;  4LF6 Q;  4C2M H;  3KOJ A;  3U50 C;  4DV3 Q;  4A3B G;  3DM3 A;  4R4C A;  2ZJR A;  4A3I G;  3I56 A;  1XPO A;  3H0G G;  1HR0 Q;  1CKO A;  1UE1 A;  4AQY Q;  3FKI G;  4DUZ L;  5GAH C;  4JYA Q;  3H15 A;  4LF6 L;  4A3C G;  2MO1 A;  2YV5 A;  2Z6K A;  4A3I H;  3W1B A;  3TS2 A;  1JE5 A;  4JI2 L;  3HFZ B;  2ZJQ A;  3KDF B;  4ME3 A;  4DR2 Q;  3CC4 A;  1N33 Q;  1X65 A;  3PIO A;  4LF8 Q;  3PO3 H;  4L5S A;  2VQE Q;  2OCE A;  3I4O A;  3T1H L;  1AE3 A;  4KI0 A;  1HR0 W;  4OON A;  4AYB E;  2YU9 H;  4LF7 L;  2ZM6 Q;  3E0E A;  4IPC A;  2A8V A;  4LFB L;  5M5W H;  3KJO A;  1N32 L;  2F3I A;  4C3I H;  4DV5 L;  1H95 A;  1WOC A;  3M85 A;  2GN5 A;  1J5E L;  3K7U C;  1X9N A;  1PYB A;  3J81 c;  2KEN A;  1OXT A;  2N49 A;  5C3E G;  5JJI A;  4NPS A;  2E5L L;  3M4Q A;  4LFC Q;  1VQI A;  1YZ6 A;  2LXK A;  3BZC A;  3S24 A;  2I0Q A;  4LF8 L;  2A19 A;  2IHE A;  3PUX A;  3CCV A;  3HOY G;  5AJ3 L;  3H3V I;  5M3M G;  4YWM A;  2B3G A;  3UE1 A;  1A8V A;  3OTO L;  2R7Z G;  1Q1B A;  4PZ6 A;  1N36 Q;  4LF4 Q;  1N32 Q;  3PUV A;  2ZM6 L;  1IBM L;  1KXL A;  3KYH C;  4A3L H;  1XMO Q;  4B3S Q;  4NXM L;  3S16 H;  2ALY B;  1WFQ A;  4PZ8 A;  1X3F A;  4YY3 Q;  4P74 A;  3CCS A;  3RN2 A;  3G4S A;  5LMU L;  4IPD A;  4MZ9 A;  4GNX C;  1I50 H;  1A63 A;  3HOU H;  4NXN Q;  3WWV A;  2E5L Q;  4AQY L;  1P8L A;  2RF4 A;  3HKZ E;  2VW9 A;  4A3J G;  5M3M H;  1SLJ A;  2Z6K C;  4A75 A;  1Z9F A;  1VQ5 A;  4LUV A;  1L2F A;  3L0O A;  5IP9 G;  1TWG H;  1EFW A;  2ZTE A;  5JEA G;  4R4T A;  4BA2 I;  1N36 L;  3HOU G;  4IOA A;  1L1O A;  5C44 G;  4A3G H;  1BBU A;  4HJ8 A;  1K83 H;  2ZTD A;  1XNR L;  4IFD J;  3S17 H;  2NZO A;  2JA9 A;  1JJ2 A;  1KL9 A;  4BBS H;  4B3R Q;  1PV4 A;  1C9O A;  1Q82 C;  1HZ9 A;  2K5N A;  4X64 Q;  3CC7 A;  3I2Z A;  1VQM A;  4NXN L;  4JV5 Q;  5IYC H;  4LUZ A;  1A0I A;  4K0K L;  2Q2H A;  4A3F H;  4YCU A;  1YJW A;  2NZH A;  1JMC A;  4DV7 Q;  4GOP B;  4KHP Q;  1NJI C;  2I5L X;  2UXB L;  3CF5 A;  3U58 A;  3BJU A;  1XNQ Q;  4DUY L;  1RIP A;  5C4X H;  1VQ9 A; 
#chains in the Genus database with same CATH topology
 5M5Y B;  3WDN A;  3VYS A;  1O7Z A;  4B3M Q;  1XNR Q;  5D3D A;  1U5K A;  3FVQ A;  2B2W C;  2JQO A;  3TRZ A;  1RTO A;  1WTH A;  4IUR A;  1I94 L;  3ICE A;  1NY4 A;  4A3F G;  3CXC A;  4ZYS A;  3E5S A;  3H3V H;  1E0B A;  1TWH H;  3J80 L;  4JI7 L;  3OW7 A;  4TVA B;  2RSO A;  1GM5 A;  1DCZ A;  1YHA A;  2CWP A;  1EY6 A;  4UHV A;  4TKO B;  4C1N I;  2HHH Q;  4JI4 Q;  4KJO A;  1I94 Q;  1RF2 D;  3HKS A;  3RLO A;  2F3V A;  4F7X A;  4BY7 G;  3EA6 A;  1K73 C;  3GTM B;  3BZK A;  1CQV A;  4JC0 A;  2JA6 H;  4AH6 A;  2ID0 A;  1K0R A;  2ES2 A;  3GV3 A;  2FMC A;  3MFG A;  5CV7 A;  4DUY Q;  4WRD A;  1DM0 B;  1NBW A;  4G7H C;  2M00 A;  1HJP A;  1V1P B;  4DKA C;  1FVI A;  4B9W A;  3CCU A;  2N78 A;  4XT1 B;  1VQK A;  4HR7 B;  1N8R C;  4OWW B;  4KHP L;  3VR4 A;  3QIA A;  3K5L A;  4DNI A;  1G29 1;  2R92 G;  2B2V C;  2XTI A;  3HOZ G;  1KDC A;  3S1Q B;  4HIM A;  1VMP A;  1I4P A;  1OXU A;  4QY7 A;  2VQE L;  3S2H H;  5C4Z A;  2WB1 E;  3S14 B;  2KEC A;  3CKI B;  3S1R H;  1YHB A;  1T9H A;  5BN4 A;  4A3J H;  5CBE E;  5I9P A;  1GO3 E;  5K36 G;  1VQB A;  4LMQ D;  2F0S A;  4Y7N B;  3S2D B;  1ZYR D;  2YTX A;  1G51 A;  1SSO A;  3VA7 A;  1BBX C;  2NVT B;  3MXG A;  2JA7 G;  1L1O B;  2B2W A;  5KND A;  3S2D H;  1IYV A;  2OT2 A;  3GDE A;  2NVT H;  4IN3 A;  4CGY B;  4XQN A;  2IJ0 A;  4BY1 H;  4JI8 Q;  2K52 A;  4DNT B;  2L9H A;  1E2Z A;  3KLR A;  1TT2 A;  1RCV D;  1NAP A;  5ELO A;  3CCR A;  1HA6 A;  3GO5 A;  4AYB G;  1Q90 A;  2E76 C;  5FLX L;  5GAE C;  1B7Y B;  3A7A B;  4Q0F A;  1ET6 A;  3EFX D;  4G57 A;  2K05 A;  4JI8 L;  3UDX A;  2WFW A;  4FDB A;  2N55 A;  3RMH A;  1SRU A;  1SN8 A;  1CKN B;  2QDB A;  1PHJ A;  2XRS D;  3DEO A;  3PF4 A;  5IE8 A;  1PH4 A;  1IBL Q;  1TWC H;  2OQK A;  5K36 H;  1V9P A;  4DFA A;  2BDN A;  3P75 A;  1K0S A;  2L15 A;  2EYO A;  2KA7 A;  2VZA A;  3ULP A;  4HED A;  4YCW A;  4EGV A;  1V1O A;  2XRQ D;  3NXW A;  4L5R C;  1M1K C;  1YNX A;  3ND8 A;  5CV6 A;  4CJ1 B;  2R92 B;  3RZO H;  1CKM A;  2F0L A;  3TRE A;  2FMM A;  5BR8 Q;  3TP6 A;  1X3G A;  1ASY A;  4XDX A;  1I4H A;  4KMU C;  4A3G G;  2WB1 B;  1PH5 A;  4F8M A;  1OTC A;  3C2P A;  1MJC A;  3T4A C;  3AU7 A;  3EQL C;  1GUN A;  4GLX A;  1D5X C;  3HKZ B;  2HT1 A;  4A93 H;  3G48 A;  2VXW A;  3E9I A;  2XWB B;  2Q2U A;  4JI6 Q;  5IGD A;  3A55 A;  1YIT A;  1IYJ B;  5EPJ A;  2EQS A;  1SND A;  5J3B A;  2QA4 A;  1KHI A;  1O7I A;  4YHH Q;  1YJN A;  1RKN A;  3PGZ A;  4HAE A;  5IGC A;  2WB1 G;  5KYL A;  4A3K H;  1YVC A;  3OSO A;  4A3M G;  2UXD L;  5ELB A;  1MSH A;  4H13 C;  2JA8 G;  1B9N A;  2JA6 B;  3IKJ A;  2K50 A;  1EWI A;  2XWJ B;  3QR8 A;  1K9M C;  2H4O A;  4DK3 C;  1GJX A;  4EX5 A;  4I7Z C;  1JOR A;  1V43 A;  2L0C A;  4BXX G;  4K5X A;  2MQH A;  4YWK A;  5IOC A;  2UXD Q;  4CDC C;  2KOL A;  4JI1 Q;  1KNE A;  4QUC A;  2ASB A;  5D14 A;  3S1Q H;  4L5T A;  4P73 A;  4DV6 Q;  3C1E A;  3RD4 A;  3CC2 A;  1JE4 A;  3SK5 A;  4I65 A;  1JCK B;  1JR0 D;  1KRS A;  1I5F A;  3GTO H;  4DR7 Q;  5JEA H;  1IW7 D;  1SMY D;  4KY5 A;  1LTG D;  4A3J B;  4HJ5 A;  1TWA B;  2C9O A;  5CYU A;  2F0K A;  3DM1 A;  1Y1V H;  3TS0 A;  2XIW A;  3AQQ A;  3F1Z A;  4ZRZ A;  1W6K A;  3PV0 A;  1YJ9 A;  3VR6 A;  1K3R A;  4DR5 Q;  3U4Z A;  1QG7 A;  4KN4 C;  1EY5 A;  1R9T B;  3LWU A;  1Y1V G;  1HXY D;  3KK7 A;  4DK0 A;  3KF8 A;  4DPG A;  4DR7 L;  4DGZ A;  3MEH A;  4KKU A;  1F2Z A;  4OIJ A;  3CCE A;  1LTS D;  1EU3 A;  1Q46 A;  3T16 A;  4IJH A;  4DR1 Q;  2B2Y A;  3L3O C;  2LXJ A;  4RHS A;  1D7Q A;  5DM7 3;  3CCQ A;  2NVX H;  1B4O A;  3LGJ A;  4P72 A;  2NVX B;  3SXH A;  3M7N A;  2K5D A;  1IHZ A;  2JXM B;  2UUA L;  1L0X B;  3CPF A;  2D62 A;  1A62 A;  1ASZ A;  3HOW H;  1JJC B;  4CJ2 C;  3CRK C;  2WP8 J;  3HOW B;  4QJF A;  4DR1 L;  1PZJ D;  1QCB D;  3CRL C;  3NQT A;  4F87 A;  4B3R L;  2QW7 A;  1H9K A;  4ZLT F;  3HOW G;  4DR3 Q;  1FGB D;  3NK9 A;  4IUV A;  1RJT A;  4JCV E;  2YYZ A;  2L12 A;  4A3K G;  2UUA Q;  4NB3 A;  5E4W C;  2BH8 A;  3UDF A;  4JI2 Q;  1TWC B;  5C6A A;  4KD4 A;  4LW1 A;  3A8J E;  3E0J A;  3I70 A;  1WTO A;  1NMF A;  1TS2 A;  5ISR A;  3UE0 A;  2NN6 H;  1AH9 A;  1R4Q B;  4LF7 Q;  4X65 L;  4O2D A;  3D4W A;  3I72 A;  1JQY D;  3I4N H;  3ZYY X;  4DR3 L;  1AEX A;  1UWV A;  5GAG C;  5C4J B;  4JI0 Q;  2JA8 B;  3OMC A;  3W1G A;  1DZ1 A;  2KCT A;  1HNW Q;  1PRT B;  2PI2 A;  2WAQ E;  1WI5 A;  2CKZ B;  3ULL A;  1EFI D;  3PMF A;  4JI4 L;  1IBM Q;  4HSV A;  1BXT A;  3J80 c;  4K5W A;  5JPN C;  2AQ1 B;  3MXP A;  2EZV A;  1ESR A;  2R93 B;  4LK1 C;  3GTQ B;  1TWF B;  1N33 L;  4U68 A;  1GUW A;  3I4M H;  1OXV A;  4XIG S;  1CK1 A;  2MHV A;  3I4M B;  3U50 C;  1O80 A;  4R4C A;  2ZJR A;  1CKO A;  1UE1 A;  3FKI G;  1FR3 A;  2MO1 A;  2NBF A;  2RKS A;  2YV5 A;  3W1B A;  2Z1C A;  1D5M C;  4ME3 A;  3CC4 A;  1N33 Q;  1X65 A;  2D5D A;  2QIL A;  2VQE Q;  1ENA A;  1EU4 A;  2OCE A;  3T1H L;  3E0E A;  2K5Q A;  4ZAI A;  5M5W H;  3KJO A;  4CDD C;  1LO5 D;  4C3I H;  2M9V A;  3M85 A;  1Y1W B;  2ICI A;  2PPB C;  3J81 c;  3N52 A;  2E5L L;  4U67 3;  2I0Q A;  3S24 A;  2HDM A;  4RGM A;  1T5X D;  3CCV A;  1SNQ A;  3H3V I;  4G7O C;  4YWM A;  1BR9 A;  1LTA D;  1Q8I A;  2NTS A;  5CC4 A;  1XMO Q;  4FXD A;  4NXM L;  2ALY B;  1WFQ A;  4YY3 Q;  4IUT A;  1KLU D;  4MZ9 A;  2XVS A;  3SDZ A;  1A63 A;  5LHY 1;  4NXN Q;  1NNX A;  2E5L Q;  4AQY L;  5G3L D;  2RF4 A;  1EY8 A;  3HKZ E;  5M3M H;  4Z9C B;  1SNP A;  4E6I A;  4K8J A;  1L2F A;  4IUQ A;  5IP9 G;  4KV6 A;  3NWT A;  1RDP D;  3N6R A;  1VDZ A;  2F4I A;  2IX3 A;  1L1O A;  4WFN 3;  5C3E B;  2RVL A;  3S17 H;  2NZO A;  4BBS H;  4CKB A;  2EY5 A;  2L5T A;  1EIH A;  4TSS A;  4BBS B;  4RHR A;  4NXN L;  4LUZ A;  2QF7 A;  1II3 A;  1S5F D;  1C8C A;  1YJW A;  1NJI C;  4QCL A;  3CF5 A;  2H1E A;  3U58 A;  1HUN A;  4MTK A;  4LFA L;  2OXP A;  1SE8 A;  1IYU A;  4CBV A;  3QJY A;  2QEX A;  2O2L D;  3I90 A;  1KNA A;  5IT9 c;  1SRO A;  3AFQ A;  2JA5 G;  1XX8 A;  1QNK A;  4HJ7 A;  1PYW D;  1B3Q A;  5GAD C;  4DF7 A;  4CKC A;  2CW0 D;  1IL2 A;  2G5D A;  1UEB A;  2EYF A;  5IY0 A;  2PQA A;  1HQR D;  4RGT A;  1C0A A;  3S1M B;  2VY3 A;  4DV0 Q;  1GOZ A;  1B70 B;  2VB3 X;  1U0L A;  2EY1 A;  5FLX E;  3J80 i;  1HA5 A;  3NSW A;  4KHV A;  5LL6 S;  1I50 B;  1NUC A;  3MXN A;  4UAI A;  3TP5 A;  2JK8 A;  4IOC A;  2XN9 C;  5I2Y A;  5ELE A;  4V19 0;  2B8F A;  3K5M A;  2VUM B;  1S5B D;  1U4M A;  2JYO A;  4A4I A;  4FYD A;  4DV0 L;  2DNE A;  2B2T C;  2PQA B;  2AUK A;  3M4P A;  5HUR A;  2AKW B;  5ELF A;  4DV7 L;  5JAV A;  3S1N B;  4HMJ A;  1ENC A;  4UPA A;  3J7A V;  3VYT A;  3DWA A;  4A3B H;  3S1N H;  1J9O A;  4JI7 Q;  5IWA Q;  1PTO C;  2PI2 E;  4BY7 B;  4YHH L;  2IX1 A;  1X54 A;  1D8L A;  2Q8R E;  3Q6S A;  3NEM A;  4RMF A;  4N9T A;  2R7F A;  5M5Y H;  2K28 A;  1FNU A;  1E1T A;  4K8I A;  1X3Q A;  1PMR A;  1I3Q H;  4L5Q A;  4ID6 A;  4PMW A;  2F4V L;  1G6Z A;  4F88 A;  1Z7T A;  4ABN A;  2CH4 W;  3TDQ A;  1TWF H;  1Q12 A;  4GS3 A;  2PCF B;  1Y14 B;  2V4D A;  1G8Z D;  1TWH B;  4QMG A;  4ALP A;  3BU2 A;  1XTD A;  1AW7 A;  2K75 A;  4IZ8 A;  1RTN A;  1EIF A;  3P20 A;  2F4V Q;  1MJE A;  1KQS A;  5IYD G;  4JI1 L;  2F0T A;  4UP7 A;  2Z4H A;  2EJM A;  1HZB A;  4KKT A;  1VQ6 A;  2PO4 A;  4IFD I;  2R7D A;  5KYI A;  2EOT A;  3UI2 A;  2BDO A;  4JVZ A;  2JEB I;  1EIY B;  2SDF A;  1PH8 A;  5ELN A;  4XTC S;  4L6T B;  1JJG A;  1AZQ A;  1EIG A;  4FF3 A;  4KK7 A;  1DON A;  3R2T A;  1SDF A;  1QUQ B;  3T13 A;  4JV5 L;  2HQL A;  2ZXR A;  2VS1 A;  4A3D H;  1F77 A;  2HCI A;  1ICF B;  1U4P A;  1KRT A;  2JJQ A;  4GOP C;  2FJ2 A;  3I7F A;  2GVB A;  2KHI A;  1K8G A;  5C5M A;  3I4M G;  3PUY A;  3S14 H;  4XQQ A;  1DXM A;  5M3M B;  1PA6 A;  3Q23 A;  4A3C H;  4RKL A;  1KD1 C;  4OWX B;  4C3J H;  1QVF A;  1DOM A;  3ULJ A;  1STB A;  5C3W A;  1TVX A;  4K5V A;  4BBR H;  3CQZ H;  4O0A A;  3DXJ C;  3MTS A;  3P1H A;  4JBJ A;  3U9S A;  4OL7 A;  2RHQ B;  4JBM A;  3C3L A;  1B9M A;  4ME5 A;  1NR2 A;  4HIK A;  1Z6H A;  4NMZ A;  3GTL H;  5EPK A;  1ILP A;  3PSI A;  1PZI D;  3CCJ A;  3HOV G;  3OW2 A;  2SNS A;  1CFM A;  4OO1 I;  2NN6 G;  3C1F A;  4JW0 A;  1K8M A;  4OXP A;  1PVO A;  1K8O A;  1TS5 A;  2F0U A;  5I4D A;  1A2T A;  2MFI A;  3G6J B;  2HIV A;  4JBW A;  1QWY A;  2K04 A;  2Q2T A;  3MXN B;  3Q8D A;  3TZU A;  4DR4 L;  1XTC D;  3EVQ A;  5CV4 A;  4X65 Q;  5H1S E;  5D3I B;  1XMQ L;  3RLN A;  3A56 A;  2WII B;  4JI3 L;  2RDH A;  2R6G A;  5FO8 B;  4JI0 L;  2PZT A;  2X69 A;  3PO2 H;  4B3T L;  3CP0 A;  1JB3 A;  4DR6 Q;  1GXD C;  1HNW L;  2NYZ D;  2KEE A;  1BO0 A;  1STN A;  3GV6 A;  1EZ6 A;  1GHJ A;  2IHF A;  3P7J A;  4JI5 L;  3PIP 3;  2JA7 H;  3RR5 A;  1JOK A;  2F0G A;  3HOV H;  2CFM A;  4LF5 Q;  1DYQ A;  3DWQ A;  4C3H H;  3I91 A;  1EUJ A;  2EJF C;  1HHV A;  1VMC A;  5CV5 A;  4C3H B;  4BS9 A;  5HGQ A;  1A2U A;  5JEA J;  3G6E A;  2UXC L;  3QB3 A;  3SVM A;  1HH2 P;  1Q7Y C;  2R92 H;  5IP7 G;  4IUU A;  1UEA B;  5HGT A;  1U9R A;  1IKM A;  3W2D A;  3VR3 A;  2F0W A;  3GP7 A;  1PFN A;  4RAU C;  2UXC Q;  4MTN A;  4IFD G;  1PFB A;  1IXR A;  4K2K A;  2F0J A;  3DHQ A;  3K58 A;  1J8I A;  4GKJ L;  1JWM D;  1Y69 U;  3GTG H;  2DUD A;  1HZC A;  3NP8 A;  4QB4 A;  4OWT B;  1SNM A;  4GN3 B;  3JAM c;  1S3O A;  5FLM H;  4A3F B;  4MNO A;  3HOY B;  5C0X J;  4IPG A;  1E2W A;  1FJG Q;  4QIW B;  2LKV A;  4DAM A;  3TP8 A;  1Y1W G;  3GTM H;  4KKS A;  1WTR A;  1XMO L;  3HS0 C;  4JOI C;  2EIF A;  2F03 A;  3S15 B;  4HCE A;  3F2C A;  4X3U A;  2PYK A;  3TZD A;  4X62 Q;  1SFO H;  3ERO A;  4A3M H;  3A54 A;  2UUC Q;  3HG9 A;  1FJG L;  1CI3 M;  2ZT9 C;  3WOF A;  4A3D B;  1BKB A;  1O7Y A;  2A73 B;  2M2L A;  1B8A A;  3JC6 6;  4ZUI A;  2QCP X;  3S9W A;  1STG A;  3F2D A;  4DUZ Q;  5KIX A;  4DR5 L;  1H9J A;  2ICE C;  2DGY A;  1YI2 A;  4X3S A;  3NBH B;  4DR2 L;  3PIP A;  4IAL A;  3GTO B;  3LWE A;  1TWA H;  4JYA L;  4M8A A;  2E74 C;  3I8Z A;  4Y7N H;  1A15 A;  4BBR B;  5IGF A;  5C0X I;  4LJZ C;  1J5E Q;  1C4Q A;  3TBI B;  2UU9 Q;  4EQ5 A;  1PTO B;  3I3C A;  1R9T H;  1PTO H;  2R3Z A;  1WCM H;  2J7Z A;  2MUY A;  2IW3 A;  3AFP A;  1VQC A;  4EQO A;  4A3L G;  5I6W A;  4BY1 G;  2MPM A;  1YNN C;  1KAB A;  2EYM A;  1CZW A;  3J7A F;  1JB7 A;  2F0H A;  4WJ3 M;  1LUZ A;  4HJ9 A;  1JWU D;  3I4L A;  5EKL A;  1STA A;  3J7Z C;  1WTQ A;  1H9R A;  4DV4 Q;  1TY0 A;  1VQ8 A;  1G2S A;  3PO3 G;  2XSC A;  5JJZ A;  4LF6 Q;  1ET9 A;  4A3B G;  1ML0 D;  3D6W A;  5DNF A;  1XPO A;  1CZG A;  3M7G A;  5GAH C;  4A3C G;  1O7L A;  3PO2 B;  2A6E C;  3R3O A;  3GTP B;  1D5Z C;  1S5E D;  1LT4 D;  1IW7 C;  2SNM A;  2IL8 A;  2D2C C;  4OIK A;  4RH6 A;  2F0N A;  3C46 A;  1ROD A;  4LFB L;  2KCC A;  2RBM A;  1H95 A;  1B44 D;  2GN5 A;  4IQZ A;  3KBX A;  1WD1 A;  2WKD A;  1SNO A;  4NPS A;  4FF1 A;  4LFC Q;  3I4N B;  1YZ6 A;  2LXK A;  3BZC A;  2FHT A;  2IPK D;  4ZQ3 A;  5E3F A;  5K5P A;  5IGE A;  2Q8T A;  4QUF A;  5AJ3 L;  1A8V A;  3R2I A;  3QG1 A;  1Q1B A;  4PZ6 A;  1N36 Q;  3PUV A;  5CR3 A;  1SYC A;  3KYH C;  4A3L H;  3K6O A;  2EPB A;  2PW5 A;  3S16 H;  4PZ8 A;  4TRD A;  4P74 A;  3G4S A;  4XYO A;  2AQ3 B;  1GUO A;  3WWV A;  5IT9 E;  2FIN B;  4FVM A;  3J81 L;  1SLJ A;  2KED A;  2WAC A;  3H6M A;  1Z9F A;  4A3J G;  1LLR D;  3L0O A;  4V0B A;  4A93 B;  1N36 L;  5C44 G;  5BN3 A;  3ERQ A;  4HJ8 A;  3GTG B;  1SYB A;  2ZTD A;  1S5C D;  1HRJ A;  5EBC A;  2QKI C;  3H3V C;  4B08 A;  1C9O A;  1Q82 C;  1HZ9 A;  3AB9 A;  2XNA C;  3IFT A;  3CC7 A;  1VQM A;  4JV5 Q;  4PMB A;  5KEE A;  2SEB D;  4A3F H;  4YCU A;  4KHP Q;  2I5L X;  5COR A;  1CTM A;  1WTX A;  2RDF A;  2EDG A;  1EOT A;  4OHJ A;  1VQ9 A;  3EN2 A;  2F52 A;  1T5E A;  1F9R A;  5C0X G;  5CBA E;  1BVS A;  2B39 A;  2JA6 G;  5TSS A;  3D4R A;  3FP9 A;  2LS0 1;  5FO7 B;  1J6Q A;  4A3M B;  3D6C A;  4YY3 L;  4J1M A;  5E4X A;  2KCM A;  2NVQ H;  4ZK9 B;  3PF5 A;  1I6V C;  2E2H B;  4DK6 C;  1Y1W H;  2JE6 I;  2ZJP A;  2NVQ B;  1PH1 A;  4A3D G;  1IL8 A;  2HUG A;  2B2Y C;  1EYD A;  2Z9H A;  1NMG A;  1KLG D;  2BOS A;  4B3S L;  4DA2 A;  4WJ4 A;  3O13 A;  1CT1 D;  3K0X A;  1B50 A;  1B53 A;  3MEF A;  1DOL A;  4N9P A;  3Q24 A;  5JOB A;  3HKZ G;  1E1O A;  2CCZ A;  4QL5 A;  5JPM C;  1NTG A;  2B63 B;  2DJG C;  2H5X A;  3ONA B;  5EGT A;  2A6E D;  4IFD H;  2HIX A;  4UP8 A;  1SJH D;  4HID A;  4DXF A;  4GNX A;  2VUM G;  1PXU A;  2EYP A;  1JOQ A;  2UXB Q;  2JEA I;  4PMC A;  1HUM A;  4FXG C;  4IUP A;  5GRO A;  1ENF A;  2NZ1 D;  1AN8 A;  1XMQ Q;  1BNZ A;  1WCM B;  3G7L A;  4R9W A;  2CWA A;  1RHP A;  4QGU A;  1S40 A;  1K28 A;  1I6H H;  1YBY A;  4B3T Q;  4X6A H;  1PRT F;  1AZP A;  3OOC A;  3TEH B;  1MIU A;  3BS1 A;  1YNJ C;  1VQG A;  4A3E B;  3FHW A;  2LFN A;  1EQQ A;  2F0E A;  2F0F A;  2F0P A;  3R93 A;  4DN4 M;  3IL8 A;  1TY2 A;  2BE5 C;  2F3W A;  3OTO Q;  2NN6 I;  2HHH L;  5EKK A;  2VNU D;  4H44 C;  1HTP A;  1QVG A;  3NQI A;  3M4O B;  1WJJ A;  3SR1 A;  1ICW A;  2A1A A;  3KDF A;  1PH6 A;  3STB C;  3K80 C;  1LAC A;  2O5I C;  5LMU Q;  3E9H A;  4EQN A;  5C3X A;  3GTJ B;  3RN5 A;  3MHB A;  3UDG A;  3G71 A;  3K0Y A;  4NDX A;  1CSQ A;  3CW2 C;  4B9X A;  1PFS A;  1L1O C;  1QIL A;  5IWA L;  2EYJ A;  3UDI A;  2L1B A;  2X6L A;  3NEL A;  1PDQ A;  2K4K A;  2MJ8 A;  4BBR G;  1Q81 C;  3OIQ A;  4ZUJ A;  4X3T A;  3KJP A;  3BDL A;  4FF4 A;  2Z6B A;  1TXY A;  5IGB A;  4JBK A;  4ULL A;  1VQE A;  4GLV B;  2Q2I A;  5JVG 3;  4KY7 A;  4A3I B;  1DD2 A;  4R4O A;  1BCP F;  3D31 A;  4A3B B;  2RA4 A;  1SJE D;  4BY7 H;  3V2T A;  2JA5 H;  4JOI A;  1PH3 A;  1VQH A;  1AE2 A;  1X56 A;  2D9U A;  3H09 A;  1E24 A;  3K5O A;  1I3Q B;  1HNX Q;  2YTY A;  4UP9 A;  3CME A;  1SYE A;  5GQO A;  4X62 L;  2NVY B;  3CPW A;  5JVH 3;  4P71 A;  3AYH B;  2JSO A;  2MO0 A;  4WJW A;  1KIX A;  1HNX L;  4C56 C;  3K7A B;  1GUG A;  1IBK Q;  1GHK A;  1UUP A;  3HZX A;  4BA1 I;  4DV6 L;  4NP5 A;  4PQX A;  5DAU A;  3HOU B;  1QB5 D;  3SHL A;  3FKI B;  2PQE A;  3H91 A;  1MBY A;  3FMC A;  1DGS A;  1ZEQ X;  3V05 A;  1BBW A;  3QWN A;  2D0O A;  4DAP A;  1BCP D;  3LNN A;  4NW2 A;  2ZTC A;  4X3K A;  1CA6 A;  1KTK A;  1STY A;  3PUZ A;  4LWC A;  2BH2 A;  1OO9 B;  1GUS A;  3NUC A;  5J22 A;  1YNJ D;  2UU9 L;  1MKH A;  3M9B A;  4YIJ A;  2I07 B;  3F8T A;  2K14 A;  1HZA A;  4FP5 D;  1STH A;  4NKL A;  2K01 A;  4R1J A;  1HCZ A;  4R8N A;  4GN4 B;  4K14 A;  1EY7 A;  3HOX B;  2D0P A;  3K8A A;  2YU9 B;  3HOX H;  4TQU S;  4FNF A;  4N8X 1;  2EY6 A;  1EL0 A;  1Y8P B;  5M3F B;  1A6X A;  4OX9 Q;  4C3J B;  5C3E H;  1RD9 D;  3J7Y W;  2E2I H;  5C4H A;  4DAY B;  1UE5 A;  1W6J A;  3X3N A;  4DV4 L;  2CVR A;  3CQZ B;  4LUO A;  2EXD A;  2R61 A;  1R4P B;  2CQA A;  1KC8 C;  3RNU A;  3X3M A;  3PQI A;  1CHP D;  5JJK A;  2EYH A;  5LL6 X;  4POF A;  4DR4 Q;  5AFW A;  4IUN A;  1EQR A;  4GOP A;  4P75 A;  2ENB A;  2E2J H;  3EIV A;  4JI3 Q;  1Z47 A;  2MNA A;  1SBB B;  2K03 A;  5EJW A;  5FLX c;  1SMX A;  3I55 A;  3K5N A;  1VQJ A;  4RA8 A;  4A3E H;  4LFB Q;  2NWG A;  5L37 A;  1K83 B;  4DK1 A;  1HNZ Q;  5A2Q E;  4DV1 L;  1QZG A;  1VQF A;  2MP1 A;  3J81 j;  1SYF A;  3S1M H;  2R7Z B;  3M4O H;  4G7Z C;  5AJ3 Q;  1FL0 A;  1F2M A;  4R4I A;  1N34 L;  2PZU A;  4LF9 L;  2NTT A;  3CCM A;  3S2H B;  3GTJ H;  1KAA A;  5C4X B;  2ZXP A;  1VF7 A;  2WAQ B;  4DV1 Q;  1Q86 C;  4ZKC B;  5T1G A;  5LMN L;  3I73 A;  1JOO A;  3TQY A;  1NSN S;  2EYL A;  4BBS G;  5E7N A;  1VQD A;  2F0D A;  1PTO D;  1HPC A;  1XPU A;  1VQA A;  4J8Q A;  5IP7 H;  4CKE A;  3PO2 G;  4JK1 C;  3SK6 A;  1YNN D;  4GNX B;  4YWL A;  3GTK B;  1W3S A;  5KRU A;  4GKJ Q;  1GKH A;  1LYL A;  3K57 A;  2G9D A;  3GTK H;  3PO3 B;  4OEM B;  4OEL B;  1Q3L A;  2KHS A;  1S4Z A;  1MHW C;  4OGQ C;  3TP7 A;  3A5U A;  1C7Y A;  1JT8 A;  2C5C A;  2JA5 B;  3OMG A;  3JAM E;  3T53 B;  3RZD H;  5JJL A;  4LAA A;  4M1U B;  2K32 A;  4HIO A;  4DV2 L;  1EY0 A;  3J80 E;  3RZD B;  1VQN A;  1CA5 A;  3JAM i;  3DLL A;  4O1N A;  5M3F G;  1BDO A;  2NVY H;  5C4X G;  2WKC A;  1PRT D;  4RCO A;  2VQF L;  2AQ2 B;  1FYC A;  1MI2 A;  3CCL A;  2BCO A;  5FJ8 H;  3HOX G;  2UUB L;  3VR2 A;  2B63 G;  2HQE A;  1S5D D;  2RCF A;  4DV2 Q;  2UUC L;  3A8I E;  5D65 A;  3J81 E;  1SE4 A;  5IGG A;  3HOY H;  4FO2 A;  3BVZ A;  3K7A H;  4RWS C;  1WVL A;  2TSS A;  3CU7 A;  1PTO F;  4DV3 L;  3KLS X;  4QF4 A;  4UY8 C;  1D6E C;  1EY9 A;  3BVM A;  3D8G A;  1DOK A;  4C3I G;  3KLW A;  1AFP A;  3ERS X;  3R8B A;  1W2B A;  3E6Z X;  1SFO B;  3A74 A;  3BDO A;  3HP3 A;  1WD0 A;  3K81 C;  1LV9 A;  2A68 D;  4DV3 Q;  3T56 B;  3H0G G;  3RZO B;  4JYA Q;  2Z6K A;  3NBH A;  3TS2 A;  2EVB A;  4JI2 L;  3HFZ B;  2ZJQ A;  1ONL A;  5FK9 C;  1QNU A;  4LF8 Q;  2K33 A;  1TU2 B;  2Z8L A;  4MIU A;  1AE3 A;  4KI0 A;  1HR0 W;  2YU9 H;  4AYB E;  1D1K A;  1ZKO A;  4LF7 L;  4IPC A;  2A8V A;  1VF5 C;  4HN7 A;  2F3I A;  2Y0S B;  1KDB A;  3K7U C;  2ZXO A;  1X9N A;  1LAB A;  1OXT A;  4BWG B;  4LF8 L;  3HOY G;  3NTK A;  3NTH A;  1CHQ D;  3ND9 A;  1EEI D;  2B3G A;  1EQT A;  3OTO L;  1AP0 A;  1PZK D;  3VYR A;  5FO9 B;  1TS4 A;  1IBM L;  2SOB A;  1KXL A;  3BYT B;  4RGO S;  3GTL B;  4K2L A;  3CCS A;  4LF6 L;  3RN2 A;  3Q22 A;  5LMU L;  4IPD A;  5C5L A;  2E2J B;  1P8L A;  4RCN A;  2VW9 A;  4A75 A;  2KVM A;  2O4X A;  2QDL A;  1EFW A;  1G2T A;  4BA2 I;  3HOU G;  4IOA A;  4A3G H;  1K83 H;  4R8I A;  4IFD J;  1JJ2 A;  1V8Q A;  1KL9 A;  4A3G B;  1DJR D;  2E2D C;  4CJ0 B;  1PV4 A;  1BOS A;  2K5N A;  5EPL A;  4HCS A;  4X64 Q;  3I2Z A;  2N88 A;  5IYC H;  1BQQ T;  4K6D A;  2DNC A;  3A8K E;  2OF1 A;  3SK4 A;  3IFD A;  4WOR A;  4DV7 Q;  4J6H A;  4GOP B;  4HMI A;  1XNQ Q;  3BJU A;  2RDG A;  4DUY L;  2VB2 X;  5C4X H;  3LX0 A;  2B2U A;  2AMC B;  3NHH A;  1SE3 A;  4ZCK A;  1XJV A;  4N8F A;  2QGQ A;  4P2C B;  2Y0S E;  4POG A;  4PG3 A;  3GQB A;  1M90 C;  2A69 C;  2K5H A;  2X6G A;  3J7A 5;  4RKB A;  1EY4 A;  2JA7 B;  2PNH A;  1Y1V B;  2O5J C;  1PLF A;  3SGI A;  2J0T D;  1O78 A;  2OTL A;  4QQB X;  5CGK A;  1LT5 D;  1FNV A;  1F9P A;  4XQJ A;  1EOV A;  1LM0 A;  4OO1 G;  1BF4 A;  4IPH A;  4GN5 A;  2K1B A;  5BN5 A;  5IIF A;  1LTI D;  4NXM Q;  3AMU A;  2FXQ A;  3FPP A;  3HEJ A;  3CMA A;  2RQX A;  3FPU B;  2DJF C;  3MVV A;  1FD7 D;  3S16 B;  1IBK L;  3D0F A;  4IJL A;  1Y8N B;  4AYB B;  1PYS B;  1VQO A;  3DMU A;  1H9S A;  4APV A;  1MD2 D;  1RL2 A;  5CV9 A;  2AWN A;  3AEV A;  3SEB A;  2OWO A;  1UE7 A;  1JIC A;  4C3J G;  1EWH A;  1D2B A;  5M5X B;  4J15 A;  5A2Q L;  2G9H D;  2KHJ A;  1CM9 A;  2MGS A;  2FFK B;  3HRZ C;  3L2P A;  2K5W A;  2IT1 A;  1VQ4 A;  1SE2 A;  3OYY A;  4G4K A;  4LFA Q;  3JAM L;  3B6Y A;  1SXT A;  1H9S B;  1TKW B;  3S15 H;  3U9O A;  5IYD H;  2PMZ E;  4DV5 Q;  4YCV A;  5NUC A;  4A3E G;  2B2V A;  3KFU A;  1GD7 A;  3FEW X;  1WTV A;  2E75 C;  1SR3 A;  4DAY A;  2I46 A;  1WYD A;  2OEO A;  2IX0 A;  5C4J H;  1YIJ A;  4LF4 L;  2JA8 H;  3HOZ B;  3KBG A;  3VYU A;  2F0M A;  4ZKB B;  3M3Y H;  5C0X H;  4Q5V A;  4DNR B;  2XGT A;  2Z0S A;  4XYQ A;  5IP9 H;  1EEF D;  1OXS C;  2F0Q A;  4PNY A;  1TII D;  2V1C C;  1VQL A;  3IAY A;  3WOE A;  5FJ8 G;  2L4N A;  5IT9 L;  2F0I A;  1SMY C;  2WV6 D;  3GTQ H;  5BR8 L;  3PUW A;  3FDT A;  5I6Y A;  1LT3 D;  4KLK A;  1VS0 A;  2PZW A;  3BVG A;  3A5Z B;  4K0K Q;  1QVC A;  4GKK Q;  5IYB H;  1HNZ L;  3CD6 A;  1PH7 A;  5DM6 3;  5EAY A;  2A6H C;  4LNQ A;  5COY A;  2B29 A;  3H0G B;  2LY7 A;  2K5V A;  4EVO A;  1HTL D;  1ZXT A;  4B3M L;  4A3K B;  2NUC A;  4HTH A;  1UE6 A;  1STE A;  3BG3 A;  4LF9 Q;  2HD3 A;  1X55 A;  5LMN W;  4C1N K;  4GKK L;  2R93 G;  3MXU A;  1XWE A;  3Q0A A;  2PMZ B;  3MAQ A;  5LMN Q;  3HGB A;  1XXG A;  4C3H G;  1G6P A;  3MWY W;  4JI5 Q;  1HQM C;  2Z4I A;  3A0J A;  4DU9 A;  1HFG A;  2F0V A;  5KGU A;  2TMP A;  3MA2 B;  1CKN A;  1KDA A;  5E1F A;  2LMC B;  3GD7 A;  2ATW A;  2WAQ G;  1C48 A;  1I4R A;  2IY5 B;  1LTR D;  3DWP A;  5C44 H;  1X6O A;  3GTP H;  2NB0 A;  1M4V A;  3D3R A;  4GLA C;  2Q8I B;  4CDF C;  4RFB A;  3L7Z C;  1E2V A;  3OIP A;  3CHB D;  4Y52 H;  4MHE A;  2EE1 A;  3CAM A;  1XYI A;  1B3A A;  1UAP A;  2GA4 B;  5IYC G;  1F2Y A;  1A3U A;  4KY6 A;  1EWC A;  1MGS A;  3L9A X;  2PW7 A;  1EZ8 A;  1PH9 A;  1GUT A;  3S17 B;  2KBN A;  1B2T A;  1WTP A;  5IOD A;  1BCP B;  2A6H D;  3BZD B;  4C2M B;  3OPO A;  5A35 A;  5CV8 A;  5FOB B;  4X66 Q;  2VQF Q;  1FGU A;  4PV1 C;  4HJA A;  4O42 A;  2UUB Q;  2L11 A;  3I4N G;  3KF8 B;  2CHB D;  2DY7 A;  1X3E A;  2J4X A;  2LSS A;  2E8G A;  3M4Y A;  3TSS A;  4PZ7 A;  5M9O A;  1PH2 A;  3BYY B;  1VCI A;  3ITP A;  4KTA A;  2BA1 A;  2CW0 C;  4JG2 A;  4KHZ A;  4X66 L;  4CDE C;  5CMD A;  1OXX K;  2EY2 A;  2A68 C;  3J81 i;  3FRP B;  2PNR C;  5M5X H;  2AWO A;  1E3P A;  1QUQ A;  1N9W A;  3NWS A;  3NPP A;  1FNW A;  1G91 A;  2N3S A;  4A76 A;  1K8A C;  4L63 B;  2OTJ A;  1IZ6 A;  1NR4 A;  3U4V A;  1PRT C;  1YEZ A;  4QIW E;  3QOL A;  2RCN A;  4H7B A;  1S72 A;  1QJO A;  3IRB A;  1LT6 D;  5HY6 A;  1LTL A;  3FKI H;  1V1P A;  5J39 A;  5FLM G;  2YTV A;  1PFM A;  3PCO B;  2B2U C;  2VUM H;  2BA0 A;  1I4G A;  3NBI A;  1EYG A;  2E2H H;  1TQO A;  3D4D A;  1Q8K A;  1VQ7 A;  1WCM G;  2JN4 A;  1TR5 A;  1A3T A;  2A74 C;  3H94 A;  2B8G A;  3OWE B;  5F2D A;  2CQO A;  3HOZ H;  3ER0 A;  2VL6 A;  2KJX A;  5DLQ E;  4DR6 L;  1L0Y B;  3W3A A;  3M3Y B;  4OX9 L;  3T1Y Q;  1IBL L;  3KF6 A;  1L0W A;  4BXX H;  1EYC A;  1SAP A;  4ILW A;  2Y0S G;  4UDU C;  2AHO B;  4IO9 A;  4CHT B;  2R93 H;  2B63 H;  2OQ0 A;  2I5H A;  4H02 A;  4KD3 A;  4LF5 L;  2B2T A;  2KCN A;  4L8J A;  3EBE A;  3T1Y L;  3RLF A;  2AUJ D;  1Q1E A;  5M3F H;  1U4R A;  2C35 B;  2P5Z X;  3DUZ A;  3VR5 A;  1NCV A;  2E2I B;  3T51 B;  3MC0 B;  4AIM A;  3QO2 A;  3KF6 B;  2F1M A;  4RG1 A;  4X64 L;  1CSP A;  2CH4 A;  5IYB G;  2GVA A;  3H0G H;  1YHQ A;  1QZH A;  4JPB W;  5ELD A;  3ZJY C;  1I6H B;  2KQ3 A;  2HDL A;  1D1I A;  3OHX C;  1XNQ L;  2A69 D;  5M5W B;  4C3I B;  4RGN A;  1CUK A;  3F2B A;  1X3P A;  1I4X A;  1EQV A;  2RHS B;  1N34 Q;  5KNC A;  1X32 A;  1LTB D;  4JI6 L;  3VA5 A;  1KAW A;  3STB D;  1ESF A;  1GVP A;  2DN8 A;  4XT3 B;  3OWF A;  3NEN A;  4FF2 A;  1EYA A;  1JC7 A;  2I5M X;  1V1Q A;  1P16 A;  2RSN A;  4LFC L;  5T1I A;  2BE5 D;  4R4Q A;  1NE3 A;  3T1H Q;  2R7Z H;  4S3S A;  2WIN B;  3VDY A;  2HCC A;  5C44 B;  1TS3 A;  3W5O A;  3V96 A;  4A93 G;  4GZY C;  1SEB D;  1HR0 L;  3DEP A;  1U4L A;  3S1R B;  1E7Z A;  4KN7 C;  1E22 A;  3MZ5 A;  5FKA C;  3URY A;  2N8N A;  2F0O A;  2A5H A;  1VQP A;  1B1Z A;  3TME A;  5G3L F;  4MN3 A;  2IWH A;  1XPR A;  1I4Q A;  4C2M H;  3KOJ A;  3E3X A;  3DM3 A;  5ELC A;  4A3I G;  3I56 A;  1HR0 Q;  3F2U A;  4AQY Q;  5DEH A;  4DUZ L;  3SE0 A;  3TN2 A;  3H15 A;  4I7A A;  4A3I H;  1JE5 A;  3MFY A;  3KDF B;  3A7L A;  4DR2 Q;  4BY1 B;  3SK8 A;  3PIO A;  1Y8O B;  3PO3 H;  4XXE A;  3NTI A;  4L5S A;  1UNS A;  1F9Q A;  2DY8 A;  3I4O A;  4ODG A;  1BUV T;  4OON A;  5J1Z A;  1N32 L;  2ZM6 Q;  2JP1 A;  4DV5 L;  1WOC A;  2EXZ A;  1SYG A;  1J5E L;  1PYB A;  5EBD A;  2KEN A;  2N49 A;  5EQ0 A;  3QOJ A;  2K6A A;  5C3E G;  4K6L A;  2K7V A;  3M4Q A;  5JJI A;  1VQI A;  2A19 A;  1F2L A;  1SNC A;  2IHE A;  1MSG A;  3PUX A;  5M3M G;  3UE1 A;  4H0L C;  1JWS D;  4DAV A;  1K3B C;  2R7Z G;  4OO1 H;  4LF4 Q;  1N32 Q;  1CQF A;  2ZM6 L;  3RUZ A;  3K59 A;  4DXG A;  4B3S Q;  3EJI A;  1X3F A;  1BCP C;  1M8A A;  1QE6 A;  4GNX C;  1I50 H;  1H9M A;  1ZYR C;  2QEJ C;  5EKI A;  3PIO 3;  3HOU H;  1QOH A;  5KNB A;  2Z6K C;  2EJG C;  1VQ5 A;  4LUV A;  1HFN A;  1TWG H;  3NE5 B;  2ZTE A;  5JEA G;  4R4T A;  1TWG B;  3BDC A;  1BBU A;  4FXK C;  3HOV B;  4KJN A;  1XNR L;  1WTW A;  1IKL A;  4HSP A;  3KLS A;  2JA9 A;  5I2X A;  4B3R Q;  1SYD A;  3KUP A;  1ILQ A;  2KUM A;  2L55 A;  1A0I A;  4K0K L;  2Q2H A;  1A3V A;  2NZH A;  1JMC A;  2UXB L;  1LTT D;  1F9S A;  4EQP A;  5I9O A;  1RIP A; 
#chains in the Genus database with same CATH homology
 2AMC B;  2F52 A;  3EN2 A;  4LFA L;  4B3M Q;  1XJV A;  1XNR Q;  4POG A;  1SE8 A;  2QGQ A;  1U5K A;  2Y0S E;  1BVS A;  5C0X G;  4PG3 A;  2JQO A;  2QEX A;  1M90 C;  2JA6 G;  3TRZ A;  5IT9 c;  3ICE A;  3FP9 A;  1SRO A;  1I94 L;  3AFQ A;  1NY4 A;  2K5H A;  4A3F G;  2JA5 G;  3J7A 5;  3CXC A;  1J6Q A;  3H3V H;  2PNH A;  4HJ7 A;  3SGI A;  4YY3 L;  1TWH H;  5GAD C;  2KCM A;  2OTL A;  4JI7 L;  2NVQ H;  4QQB X;  3PF5 A;  1IL2 A;  4DK6 C;  1Y1W H;  4TVA B;  1UEB A;  2JE6 I;  2ZJP A;  1GM5 A;  5IY0 A;  1PH1 A;  1EOV A;  1LM0 A;  1YHA A;  2CWP A;  2PQA A;  4A3D G;  4OO1 G;  1C0A A;  4IPH A;  4GN5 A;  1NMG A;  2VY3 A;  2HHH Q;  4B3S L;  4JI4 Q;  4NXM Q;  1I94 Q;  4WJ4 A;  2FXQ A;  4DV0 Q;  3HKS A;  3RLO A;  1B70 B;  3K0X A;  3CMA A;  1U0L A;  3MEF A;  4BY7 G;  1K73 C;  3BZK A;  3J80 i;  3HKZ G;  1IBK L;  1E1O A;  3D0F A;  4IJL A;  2CCZ A;  4QL5 A;  4JC0 A;  1PYS B;  1NTG A;  2JA6 H;  4AH6 A;  2ID0 A;  1K0R A;  2JK8 A;  4IOC A;  2H5X A;  1VQO A;  2ES2 A;  2HIX A;  4DUY Q;  4UP8 A;  4APV A;  4HID A;  1NBW A;  1RL2 A;  3AEV A;  2AWN A;  4A4I A;  4GNX A;  1HJP A;  4DV0 L;  2PQA B;  2OWO A;  2VUM G;  4DKA C;  1FVI A;  1UE7 A;  2N78 A;  3M4P A;  3CCU A;  1VQK A;  2AKW B;  1N8R C;  4J15 A;  4OWW B;  2UXB Q;  4DV7 L;  4KHP L;  2KHJ A;  2JEA I;  4DNI A;  3L2P A;  5GRO A;  4UPA A;  1G29 1;  2IT1 A;  2XTI A;  1VQ4 A;  1XMQ Q;  2R92 G;  3HOZ G;  4A3B H;  3S1N H;  3OYY A;  4HIM A;  2CWA A;  4LFA Q;  4JI7 Q;  5IWA Q;  4QGU A;  1OXU A;  2PI2 E;  4QY7 A;  4YHH L;  2VQE L;  1S40 A;  2IX1 A;  3S2H H;  3B6Y A;  1I6H H;  2WB1 E;  1X54 A;  1D8L A;  1YBY A;  3NEM A;  4RMF A;  4B3T Q;  4X6A H;  3S15 H;  2R7F A;  5M5Y H;  2PMZ E;  4DV5 Q;  1E1T A;  4YCV A;  4A3E G;  3S1R H;  5IYD H;  1YHB A;  3TEH B;  3KFU A;  1I3Q H;  1MIU A;  1T9H A;  4L5Q A;  1GD7 A;  4PMW A;  2F4V L;  4A3J H;  1SR3 A;  1VQG A;  3FHW A;  1GO3 E;  1TWF H;  1EQQ A;  1Q12 A;  1WYD A;  4GS3 A;  1VQB A;  5K36 G;  2YTX A;  1G51 A;  1Y14 B;  2JA7 G;  4ALP A;  1L1O B;  3OTO Q;  3S2D H;  2IX0 A;  2NN6 I;  5C4J H;  3GDE A;  1YIJ A;  2HHH L;  2NVT H;  3BU2 A;  4LF4 L;  2VNU D;  1QVG A;  2JA8 H;  1XTD A;  2K75 A;  1WJJ A;  2A1A A;  3KDF A;  1EIF A;  1PH6 A;  2F4V Q;  3STB C;  3K80 C;  1MJE A;  1KQS A;  3M3Y H;  5IYD G;  5LMU Q;  4JI1 L;  2XGT A;  4UP7 A;  1HZB A;  3E9H A;  2Z0S A;  1VQ6 A;  4IFD I;  2R7D A;  3RN5 A;  4BY1 H;  3UDG A;  4JI8 Q;  2K52 A;  3G71 A;  5IP9 H;  2JEB I;  1EIY B;  1CSQ A;  3CW2 C;  1OXS C;  5ELN A;  1PH8 A;  5ELO A;  3CCR A;  1PFS A;  4XTC S;  2V1C C;  3GO5 A;  4AYB G;  1VQL A;  1L1O C;  5IWA L;  1JJG A;  5FJ8 G;  5GAE C;  3UDI A;  3GTQ H;  1B7Y B;  3NEL A;  5BR8 L;  2K4K A;  4BBR G;  3PUW A;  1Q81 C;  4KLK A;  1QUQ B;  1VS0 A;  4JV5 L;  2HQL A;  3KJP A;  3A5Z B;  4K0K Q;  1QVC A;  4GKK Q;  5IYB H;  4JI8 L;  3UDX A;  1HNZ L;  3CD6 A;  1PH7 A;  2WFW A;  1TXY A;  2VS1 A;  4FDB A;  4JBK A;  4A3D H;  5EAY A;  4LNQ A;  1VQE A;  1SRU A;  1SN8 A;  4GLV B;  2Q2I A;  1CKN B;  2B29 A;  2K5V A;  4R4O A;  1PHJ A;  3D31 A;  4B3M L;  1KRT A;  2JJQ A;  4GOP C;  3I7F A;  2GVB A;  2KHI A;  1K8G A;  3I4M G;  3PF4 A;  4BY7 H;  1UE6 A;  5IE8 A;  1PH4 A;  1TWC H;  1IBL Q;  2OQK A;  3PUY A;  4LF9 Q;  2JA5 H;  1X55 A;  1V9P A;  3S14 H;  5LMN W;  4JOI A;  1PA6 A;  1PH3 A;  1VQH A;  1AE2 A;  1X56 A;  2L15 A;  4GKK L;  4A3C H;  2R93 G;  1E24 A;  1KD1 C;  2VZA A;  4OWX B;  4C3J H;  1HNX Q;  2YTY A;  4UP9 A;  3ULJ A;  5LMN Q;  1QVF A;  3CME A;  1G6P A;  3ULP A;  5GQO A;  4JI5 Q;  4X62 L;  4BBR H;  3A0J A;  4YCW A;  3CQZ H;  3CPW A;  4O0A A;  4L5R C;  1M1K C;  1YNX A;  4JBJ A;  1CKN A;  3RZO H;  4P71 A;  1CKM A;  3AYH B;  3TRE A;  2RHQ B;  2MO0 A;  3GD7 A;  4JBM A;  2WAQ G;  5BR8 Q;  2ATW A;  1X3G A;  1KIX A;  1ASY A;  4HIK A;  1HNX L;  2IY5 B;  5C44 H;  4A3G G;  1X6O A;  1IBK Q;  3GTL H;  3GTP H;  3PSI A;  1PH5 A;  3CCJ A;  4BA1 I;  1OTC A;  4DV6 L;  4GLA C;  1MJC A;  3HOV G;  3OW2 A;  3L7Z C;  4OO1 I;  2NN6 G;  4Y52 H;  3CAM A;  1PVO A;  4OXP A;  5IYC G;  4GLX A;  2MFI A;  1DGS A;  2HT1 A;  2HIV A;  4JBW A;  4A93 H;  3G48 A;  1BBW A;  2Q2T A;  2D0O A;  3MXN B;  1PH9 A;  3Q8D A;  3E9I A;  4DR4 L;  2Q2U A;  4X65 Q;  4JI6 Q;  2KBN A;  2ZTC A;  5H1S E;  1YIT A;  1IYJ B;  5J3B A;  2EQS A;  2QA4 A;  1XMQ L;  3RLN A;  3PUZ A;  4LWC A;  2BH2 A;  1KHI A;  4JI3 L;  1O7I A;  2UU9 L;  1MKH A;  2R6G A;  3M9B A;  4YHH Q;  3F8T A;  2K14 A;  4X66 Q;  1HZA A;  1FGU A;  2VQF Q;  4JI0 L;  3PO2 H;  4HJA A;  1YJN A;  4B3T L;  4R1J A;  3CP0 A;  3PGZ A;  2UUB Q;  4DR6 Q;  3I4N G;  1HNW L;  3KF8 B;  2WB1 G;  4GN4 B;  4A3K H;  1YVC A;  4A3M G;  2UXD L;  1X3E A;  2LSS A;  2E8G A;  4PZ7 A;  1PH2 A;  2D0P A;  3K8A A;  2JA8 G;  2IHF A;  3HOX H;  1VCI A;  4TQU S;  2BA1 A;  2K50 A;  4JI5 L;  1EWI A;  4JG2 A;  4KHZ A;  2JA7 H;  3RR5 A;  1K9M C;  4X66 L;  3HOV H;  2CFM A;  4DK3 C;  1OXX K;  4LF5 Q;  4OX9 Q;  5C3E H;  4EX5 A;  4C3H H;  1V43 A;  2E2I H;  4BXX G;  3J81 i;  4DAY B;  1EUJ A;  1UE5 A;  4DV4 L;  4YWK A;  2MQH A;  5M5X H;  5HGQ A;  5JEA J;  2AWO A;  1E3P A;  1QUQ A;  2EXD A;  4LUO A;  3G6E A;  1N9W A;  2UXC L;  2UXD Q;  4JI1 Q;  2N3S A;  1KC8 C;  3RNU A;  1HH2 P;  4A76 A;  1Q7Y C;  2ASB A;  2R92 H;  1K8A C;  5JJK A;  3S1Q H;  5IP7 G;  4L5T A;  2OTJ A;  1IZ6 A;  4P73 A;  4POF A;  4DV6 Q;  4DR4 Q;  3U4V A;  1YEZ A;  4QIW E;  2RCN A;  3CC2 A;  1EQR A;  1S72 A;  3IRB A;  4GOP A;  1KRS A;  4P75 A;  2E2J H;  3EIV A;  1I5F A;  5HY6 A;  4JI3 Q;  1Z47 A;  3GTO H;  4DR7 Q;  1LTL A;  2MNA A;  2UXC Q;  4MTN A;  4IFD G;  3FKI H;  4HJ5 A;  5FLM G;  2YTV A;  1IXR A;  5FLX c;  1SMX A;  3I55 A;  1VQJ A;  3PCO B;  4A3E H;  1Y1V H;  2VUM H;  2BA0 A;  4LFB Q;  3TS0 A;  4GKJ L;  3AQQ A;  3F1Z A;  1HNZ Q;  3GTG H;  1EYG A;  2E2H H;  3PV0 A;  2DUD A;  1HZC A;  1YJ9 A;  1Q8K A;  1K3R A;  1WCM G;  4DV1 L;  1QZG A;  4DR5 Q;  1VQ7 A;  3U4Z A;  1VQF A;  3J81 j;  4OWT B;  1Y1V G;  3S1M H;  4GN3 B;  2CQO A;  3M4O H;  3ER0 A;  3HOZ H;  4DPG A;  3JAM c;  1S3O A;  2VL6 A;  5DLQ E;  5FLM H;  4DR6 L;  4MNO A;  4DR7 L;  5AJ3 Q;  5C0X J;  1FL0 A;  4OX9 L;  4R4I A;  1N34 L;  4IPG A;  3T1Y Q;  3CCE A;  1IBL L;  3KF6 A;  1L0W A;  4LF9 L;  1FJG Q;  4BXX H;  3CCM A;  3GTJ H;  4DAM A;  1Q46 A;  1Y1W G;  3GTM H;  4IJH A;  1XMO L;  4DR1 Q;  2Y0S G;  2EIF A;  4JOI C;  2LXJ A;  1D7Q A;  3CCQ A;  4DV1 Q;  3F2C A;  1Q86 C;  2AHO B;  4IO9 A;  2NVX H;  5LMN L;  2R93 H;  2B63 H;  2OQ0 A;  2I5H A;  3LGJ A;  4H02 A;  3TQY A;  4P72 A;  4LF5 L;  4X62 Q;  1SFO H;  3M7N A;  4A3M H;  4BBS G;  2UUA L;  5E7N A;  1VQD A;  2UUC Q;  3CPF A;  2D62 A;  3EBE A;  3RLF A;  3T1Y L;  1FJG L;  1A62 A;  1ASZ A;  1Q1E A;  1VQA A;  1XPU A;  5M3F H;  5IP7 H;  3HOW H;  1JJC B;  2C35 B;  3PO2 G;  2WP8 J;  4QJF A;  4DR1 L;  4AIM A;  4B3R L;  4GNX B;  1BKB A;  3KF6 B;  1B8A A;  3JC6 6;  4RG1 A;  4YWL A;  4X64 L;  1CSP A;  1W3S A;  4GKJ Q;  5IYB G;  2GVA A;  3H0G H;  1GKH A;  1LYL A;  4DR3 Q;  3HOW G;  3F2D A;  1YHQ A;  1QZH A;  3GTK H;  4DUZ Q;  4JCV E;  3ZJY C;  4DR5 L;  2YYZ A;  4A3K G;  3A5U A;  2UUA Q;  4NB3 A;  2BH8 A;  3UDF A;  1C7Y A;  4JI2 Q;  1JT8 A;  2DGY A;  1YI2 A;  1XNQ L;  4LW1 A;  3NBH B;  4DR2 L;  5JJL A;  3RZD H;  3PIP A;  1NMF A;  1CUK A;  3F2B A;  4HIO A;  4DV2 L;  3UE0 A;  2RHS B;  1N34 Q;  1VQN A;  1AH9 A;  3JAM i;  4LF7 Q;  4X65 L;  3DLL A;  4JI6 L;  4O2D A;  1KAW A;  1TWA H;  3STB D;  4JYA L;  1GVP A;  4Y7N H;  5M3F G;  4DR3 L;  3I4N H;  2NVY H;  5C4X G;  5C0X I;  1J5E Q;  1UWV A;  3NEN A;  5GAG C;  2UU9 Q;  4EQ5 A;  2I5M X;  2VQF L;  1V1Q A;  1P16 A;  4JI0 Q;  4LFC L;  3CCL A;  3W1G A;  5FJ8 H;  3HOX G;  1R9T H;  2UUB L;  2B63 G;  4R4Q A;  1NE3 A;  2KCT A;  3T1H Q;  2R7Z H;  1HNW Q;  1WCM H;  2PI2 A;  4DV2 Q;  2UUC L;  3VDY A;  2WAQ E;  1WI5 A;  3HOY H;  3AFP A;  2CKZ B;  3ULL A;  3K7A H;  4JI4 L;  1VQC A;  1IBM Q;  4A3L G;  3W5O A;  4A93 G;  4BY1 G;  4DV3 L;  1HR0 L;  3J80 c;  4UY8 C;  1E7Z A;  1E22 A;  1JB7 A;  3KLW A;  3ERS X;  2N8N A;  1W2B A;  1LUZ A;  4WJ3 M;  4HJ9 A;  3J7Z C;  1N33 L;  4DV4 Q;  3I4M H;  1VQ8 A;  1OXV A;  4XIG S;  1VQP A;  3PO3 G;  3A74 A;  3K81 C;  1XPR A;  4LF6 Q;  4C2M H;  3KOJ A;  3U50 C;  4DV3 Q;  4A3B G;  3DM3 A;  4R4C A;  2ZJR A;  4A3I G;  3I56 A;  1XPO A;  3H0G G;  1HR0 Q;  1CKO A;  1UE1 A;  4AQY Q;  3FKI G;  4DUZ L;  5GAH C;  4JYA Q;  3H15 A;  4LF6 L;  4A3C G;  2MO1 A;  2YV5 A;  2Z6K A;  4A3I H;  3W1B A;  3TS2 A;  1JE5 A;  4JI2 L;  3HFZ B;  2ZJQ A;  3KDF B;  4ME3 A;  4DR2 Q;  3CC4 A;  1N33 Q;  1X65 A;  3PIO A;  4LF8 Q;  3PO3 H;  4L5S A;  2VQE Q;  2OCE A;  3I4O A;  3T1H L;  1AE3 A;  4KI0 A;  1HR0 W;  4OON A;  4AYB E;  2YU9 H;  4LF7 L;  2ZM6 Q;  3E0E A;  4IPC A;  2A8V A;  4LFB L;  5M5W H;  3KJO A;  1N32 L;  2F3I A;  4C3I H;  4DV5 L;  1H95 A;  1WOC A;  3M85 A;  2GN5 A;  1J5E L;  3K7U C;  1X9N A;  1PYB A;  3J81 c;  2KEN A;  1OXT A;  2N49 A;  5C3E G;  5JJI A;  4NPS A;  2E5L L;  3M4Q A;  4LFC Q;  1VQI A;  1YZ6 A;  2LXK A;  3BZC A;  3S24 A;  2I0Q A;  4LF8 L;  2A19 A;  2IHE A;  3PUX A;  3CCV A;  3HOY G;  5AJ3 L;  3H3V I;  5M3M G;  4YWM A;  2B3G A;  3UE1 A;  1A8V A;  3OTO L;  2R7Z G;  1Q1B A;  4PZ6 A;  1N36 Q;  4LF4 Q;  1N32 Q;  3PUV A;  2ZM6 L;  1IBM L;  1KXL A;  3KYH C;  4A3L H;  1XMO Q;  4B3S Q;  4NXM L;  3S16 H;  2ALY B;  1WFQ A;  4PZ8 A;  1X3F A;  4YY3 Q;  4P74 A;  3CCS A;  3RN2 A;  3G4S A;  5LMU L;  4IPD A;  4MZ9 A;  4GNX C;  1I50 H;  1A63 A;  3HOU H;  4NXN Q;  3WWV A;  2E5L Q;  4AQY L;  1P8L A;  2RF4 A;  3HKZ E;  2VW9 A;  4A3J G;  5M3M H;  1SLJ A;  2Z6K C;  4A75 A;  1Z9F A;  1VQ5 A;  4LUV A;  1L2F A;  3L0O A;  5IP9 G;  1TWG H;  1EFW A;  2ZTE A;  5JEA G;  4R4T A;  4BA2 I;  1N36 L;  3HOU G;  4IOA A;  1L1O A;  5C44 G;  4A3G H;  1BBU A;  4HJ8 A;  1K83 H;  2ZTD A;  1XNR L;  4IFD J;  3S17 H;  2NZO A;  2JA9 A;  1JJ2 A;  1KL9 A;  4BBS H;  4B3R Q;  1PV4 A;  1C9O A;  1Q82 C;  1HZ9 A;  2K5N A;  4X64 Q;  3CC7 A;  3I2Z A;  1VQM A;  4NXN L;  4JV5 Q;  5IYC H;  4LUZ A;  1A0I A;  4K0K L;  2Q2H A;  4A3F H;  4YCU A;  1YJW A;  2NZH A;  1JMC A;  4DV7 Q;  4GOP B;  4KHP Q;  1NJI C;  2I5L X;  2UXB L;  3CF5 A;  3U58 A;  3BJU A;  1XNQ Q;  4DUY L;  1RIP A;  5C4X H;  1VQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...