2HD3A

Crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein eutN
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Escherichia coli
total genus 11
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2hd3A00
2Z9HA 4N8X1 2RCFA 4N8FA 4JVZA 5L37A 2HD3A 4JW0A 4I7AA 2QW7A
chains in the Genus database with same CATH superfamily
2EY1A 2ALYB 2NVTB 3NQTA 1Q1EA 5C5LA 2L12A 2ZJQA 2KQ3A 4GKJL 1Y14B 3HOZB 2OCEA 3BZKA 2AKWB 2KECA 1YI2A 2UU9Q 3PUWA 3GP7A 1VQ7A 5C4HA 1AEXA 4IUUA 2RDFA 1YNJC 3OTOL 1TWFH 1HR0L 1QCBD 1SJED 4IUQA 4JYAL 1FNWA 2ZXOA 3DMUA 3S2HH 3AFPA 4JI1Q 1X32A 2JP1A 5ELCA 2F0FA 4LUZA 3E9IA 1SJHD 3S1MH 1UNSA 1D5XC 4IPDA 4IJLA 4R4TA 1EUJA 2F0VA 3K7AB 2RF4A 5C3EB 3CCLA 2NZHA 1XNQL 4BWGB 4K14A 5GAGC 2BA1A 3A8IE 4RA8A 4AH6A 2CH4A 5IYBH 2R93G 3UE0A 5LL6X 2ES2A 1EEFD 3PO2H 1I4HA 1Q86C 2X69A 4KN7C 4MIUA 1STGA 3HOZG 1EWCA 1T5XD 2D5DA 1HA5A 4RWSC 1E0BA 4R1JA 3CMEA 4JV5Q 4LFAQ 1AZQA 5M5WH 5IGBA 2YU9B 3H3VI 4IPGA 1ZEQX 1HFNA 2ICEC 5EPJA 4PMBA 2NVTH 4JOIA 4DK6C 3BS1A 1F9PA 1WYDA 2GN5A 2L9HA 4CGYB 4LF7Q 2KUMA 5FK9C 1FGUA 1CKNB 1V8QA 4GLVB 4BA2I 1ENCA 5FOBB 3RZDB 4QCLA 4A3FB 1BDOA 2F4VL 1Y8PB 1IBKQ 1STBA 2CQAA 3T16A 1DXMA 4CKBA 5C3EG 4XQQA 2OWOA 4FNFA 1S72A 3F8TA 5K5PA 3GTJH 4B3TQ 1MD2D 1SE3A 3M4QA 3SVMA 1JWUD 5DAUA 5EJWA 2A6HC 2WV6D 1NMGA 2WINB 2XIWA 1SMXA 3DHQA 4QL5A 3I8ZA 2HDMA 4RGOS 3EFXD 1HUMA 5CBEE 3E5SA 4RH6A 4GNXA 4BY7H 2HUGA 3VA7A 3K7AH 2RCFA 1CT1D 2FHTA 4ALPA 5IYCH 4ZKCB 3K5LA 3K0XA 4RGNA 3AB9A 1ESFA 2KENA 1E2ZA 1Y1VB 1ZXTA 5CV8A 1TS5A 2A6ED 1GUOA 2JQOA 3I55A 3NTIA 2CWPA 1HZAA 2TSSA 4X62L 4A3FG 3S17B 3I90A 1N9WA 4ZYSA 3K81C 2YU9H 4B3SL 3NENA 2EY6A 3KLSX 2R7DA 3CCMA 1SMYD 1Y1WB 3IFDA 5G3LF 2JA5G 1JMCA 4DU9A 3KJOA 2IHEA 2VXWA 4IPCA 3VYSA 2YTVA 2K5WA 1I3QB 1AE2A 2KEDA 4YWLA 3JAML 2B2WC 1VQ8A 3J81c 1A2UA 2R61A 5D65A 4OWXB 4CDCC 1SE8A 3NP8A 3GTKH 4A3EB 2VQEL 1OTCA 2G9DA 4LNQA 1X3FA 2PNRC 2E5LQ 1IL8A 1Y1VG 1NMFA 2QEXA 1EYCA 1EIFA 3N52A 1VQOA 1I4QA 3FEWX 4N9PA 4LJZC 4LFCL 3S1QH 4IZ8A 4JVZA 1GUGA 2R7FA 2L1BA 1JC7A 4B9XA 2F0EA 3PGZA 4UP7A 1SNMA 4J6HA 1WTHA 1BCPB 3VYRA 1Y1WG 1CI3M 3TZDA 1F9SA 1XPRA 1WD1A 4IQZA 5E4XA 3J7AV 1D5MC 1SDFA 3SK5A 4IUTA 2JA6B 2L5TA 1F9QA 4OGQC 2NN6G 3GD7A 2CVRA 4K6DA 2C35B 3MWYW 5COYA 3RLNA 4AIMA 5IGCA 3K80C 4G7ZC 3S17H 3F2UA 3S1NH 1G91A 4A3MH 4CKEA 4GLAC 2EXDA 1PTOB 2E74C 4V0BA 4QJFA 1CSPA 1XJVA 4KMUC 5IP9H 2Y0SE 1GHJA 4HR7B 4GN4B 2N49A 2IT1A 3DXJC 2NN6H 4C1NK 2DJFC 4DK1A 1IBMQ 4JI3L 1B9NA 3TS0A 1V1PA 2CQOA 3T51B 1XMOL 4A3EH 2Q2UA 1PH7A 5EAYA 2PI2A 5JPMC 5JEAG 2VL6A 3KJPA 4BBSB 1NE3A 4A3CG 3T1HQ 3URYA 1Z9FA 3NBHA 1EWHA 3C1FA 2KCTA 2JA6G 2JJQA 1E1OA 2XTIA 3HKSA 1FJGQ 4BS9A 1G2TA 3S15B 1DZ1A 3A5UA 3X3NA 3C1EA 3HZXA 3HRZC 1ZYRD 3AQQA 3SK6A 1OXVA 1JJCB 1WFQA 3J7A5 1RKNA 3KLSA 4GZYC 1XPOA 4A3CH 2JA7B 1E22A 3DUZA 2ICIA 1EZ8A 1OXXK 2NZ1D 1Q8KA 4B9WA 3T56B 4JBJA 2NVXB 3PV0A 5GQOA 2RSOA 4HIMA 5ELNA 4L6TB 3A8JE 4K5WA 5C0XG 3T13A 4NKLA 2RHQB 5H1SE 1KDBA 3M4OB 3U50C 4J15A 1E3PA 1PTOH 2PCFB 4L5QA 1WOCA 2LFNA 5FJ8G 1S5BD 2UXDL 4LF8Q 4A3BG 3BDCA 2JEBI 3X3MA 3JC66 1L1OC 4JI5L 5BR8L 4JG2A 4CJ2C 3RUZA 2KCMA 4DR1L 1RJTA 1IBLL 1CKMA 3W2DA 4DR3L 4OO1G 4YHHQ 3ND8A 4PMWA 3VR6A 5C4ZA 5NUCA 2HQEA 4DUZQ 1MSGA 4NP5A 3TMEA 4QIWE 2K50A 4ZLTF 4DFAA 2EQSA 1ET9A 2VUMH 4BBSH 3PCOB 1QVFA 2AWNA 3BJUA 1DOLA 2HCIA 5FLXc 5GROA 4XIGS 2NUCA 1GM5A 1E1TA 1GUSA 2PYKA 1PFSA 1UEBA 2YTYA 5C3WA 5KYLA 5I6WA 1P16A 5HURA 3CKIB 4IFDJ 1U9RA 3S15H 3IFTA 4NW2A 4X3KA 3QG1A 4KD4A 1XMOQ 1N32L 2OQ0A 3LWEA 2NB0A 5JAVA 2VY3A 2XWBB 3ICEA 2LXJA 3KYHC 1A15A 2JA7H 4A3JB 1LTTD 1KDCA 1KHIA 1QUQA 4K0KQ 4OIKA 1U4LA 3KDFA 1JWSD 4RKLA 3QOLA 3EROA 1B50A 1SN8A 1B8AA 2I5MX 3I2ZA 4HSPA 2CCZA 1ONLA 2PW7A 5CORA 5M3FH 3M4OH 2UXCQ 3AFQA 1QE6A 2AUJD 1EQRA 1TWCB 4KKSA 4APVA 4UPAA 2PI2E 4OIJA 1SNCA 2UXBQ 4A4IA 1B44D 4R8IA 1IYUA 2F3WA 2WKCA 1PZID 1CTMA 1U4PA 3GTMH 3MC0B 1I5FA 4OONA 4GKKL 1CQVA 5LMUL 4JI0Q 4QY7A 1WTOA 1PXUA 2Y0SB 3UE1A 4A3LG 2VB2X 1U0LA 4MN3A 3WOEA 3ULJA 3I91A 4HJ5A 2OT2A 1JICA 4A3JG 1WTVA 5BR8Q 2EIFA 5C4JB 2HIXA 2ASBA 3I4LA 3VYUA 2LKVA 3PQIA 2GA4B 4DR3Q 3RN5A 1QILA 2RBMA 4GNXB 3OOCA 1ESRA 1VMCA 1AP0A 4RHSA 1AN8A 4K8JA 1JOOA 1EEID 5EKKA 3OHXC 2FINB 1ENAA 1P8LA 3MXPA 4DN4M 5IP7H 2ZJPA 1VQ6A 3OYYA 1WJJA 5M5XH 3TS2A 1SNQA 2IHFA 2LS01 3STBC 4FP5D 2R7ZH 5CBAE 1HNXQ 1JB7A 5T1GA 2ZT9C 1EY9A 1STAA 1MJCA 2Q8TA 1YNJD 2ENBA 4NXNL 5BN4A 1X3EA 2E8GA 4X65Q 1SNOA 4JBMA 4JI4L 2Y0SG 5E1FA 1KQSA 3L2PA 3RZOB 5EPLA 1OO9B 4X64L 2VQFQ 1GD7A 3UDXA 3TRZA 3O13A 1BBWA 4RCOA 1G8ZD 3CC4A 4UAIA 3P1HA 3FMCA 4KI0A 4LUOA 2LSSA 2F0WA 1SYCA 2NVYB 4HIDA 3I3CA 3HOUG 3DWPA 3SE0A 5LMNL 2L4NA 3WOFA 1JWMD 4DA2A 4PQXA 3I70A 4KN4C 2DY7A 4DV2Q 3M85A 4HSVA 3HOYB 5J39A 1VCIA 3F2CA 4KTAA 2ZJRA 3A54A 5ELOA 1K8OA 4RHRA 4TKOB 5ELFA 4QIWB 1BXTA 1LYLA 1SYEA 2MHVA 2EYPA 3VA5A 3B6YA 2KCNA 1CK1A 2H4OA 4O2DA 4YY3Q 4UP8A 2WP8J 4A3DH 1Y8NB 2UU9L 3GTPB 5GADC 3OW2A 1PYBA 1JJ2A 5JVH3 1GO3E 1K8AC 4IPHA 1UE1A 5JJZA 3I56A 2MP1A 4RFBA 4JI1L 4U673 2EOTA 1K9MC 1PHJA 5ELBA 3K5MA 1SE4A 3N6RA 5EGTA 3VR4A 3J81j 2HIVA 2BDOA 3A74A 1N36Q 1VQMA 1DONA 4QMGA 2A6HD 3FRPB 1N33Q 4LAAA 3HOYG 2DNEA 2M00A 3NE5B 4DR4Q 3NELA 1VF7A 4DXFA 3EIVA 1V1PB 3E3XA 4O0AA 3S1MB 2RQXA 3E9HA 4IOCA 3ZYYX 3DWAA 3W3AA 5M3MG 1G2SA 3MFYA 5ELDA 3J7YW 4JV5L 4LFAL 1E2VA 2QEJC 2HT1A 1LTSD 1EY6A 3NBHB 3GTGH 2B2YC 2K4KA 3TP6A 2DGYA 1RTOA 4MTKA 2I07B 2KHIA 1VQCA 2R6GA 3OMGA 4LF7L 4ZAIA 1EY0A 1O7LA 4DV6Q 1SRUA 1GJXA 3D6CA 1AZPA 2F0UA 1EWIA 1IBKL 4POFA 1WTWA 4ILWA 3CU7A 4P72A 4DR2Q 3J80L 5CV5A 4B3TL 1B3QA 2H5XA 1JE5A 4E6IA 1TWGB 4H13C 1JJGA 2B2UC 2EYFA 3SXHA 1NAPA 1I6VC 3BYTB 3M4YA 2CW0C 2GVBA 3I72A 4EGVA 5L37A 4QF4A 2F0TA 4JPBW 1SYGA 1Y8OB 4XDXA 1IKMA 3DEOA 5A35A 3A56A 3GTJB 5AJ3Q 3H0GH 1KC8C 5HGQA 4PZ8A 2K01A 5IYBG 1YBYA 4EX5A 4X6AH 1TWHH 4IALA 3PO2G 3NHHA 3BVZA 1A3VA 4B3MQ 2AQ1B 3OIPA 4BY7B 1WVLA 2KCCA 2XRSD 1FYCA 4JI2Q 4DV3Q 3M3YB 4R4IA 1M4VA 1NNXA 1JR0D 1T9HA 2QDLA 3TP7A 1W6KA 4EQOA 4R4OA 4GS3A 3RN2A 1SSOA 1BNZA 5D3DA 2EJFC 1XYIA 2MO1A 5JEAJ 2A19A 3FHWA 2Z4HA 4KY7A 1U4RA 4CDEC 1O7YA 4R4CA 5HGTA 5ISRA 3G6EA 3TDQA 4J8QA 5KEEA 2PW5A 1JQYD 1CA6A 1QUQB 2B2TC 4JI7Q 3A5ZB 1HQMC 1EQVA 3KDFB 3TP5A 3OWEB 3GTQH 3M4PA 2K03A 4LWCA 5IOCA 2NBFA 1LTID 3CCEA 3BYYB 1TWGH 3V2TA 4JK1C 2E5LL 2YTXA 1L0YB 2IL8A 2L0CA 4DV1Q 3NUCA 2X6LA 4BY7G 2B29A 1GUNA 1K0SA 4I7AA 3H91A 1GVPA 2I0QA 5KYIA 5CR3A 4H0LC 3K8AA 5IYCG 3K5NA 4GOPA 3GTKB 5J22A 5IYDH 2EZVA 3UDFA 2A69C 5C0XJ 4TSSA 3ULPA 2OTJA 1II3A 4JI6Q 3I4MB 1HTLD 4DV7Q 3VYTA 2D62A 1N8RC 3KFUA 1H95A 2EE1A 1PH3A 5CGKA 4HEDA 5EBDA 3S1QB 2K5QA 4K5XA 5K36H 5F2DA 2QA4A 3M3YH 4TVAB 1Q90A 2F52A 4IUVA 2K33A 1F2YA 1A3UA 2FMMA 3J80E 3AEVA 4PZ6A 4DAPA 5E3FA 5D3IB 2D2CC 4FF2A 1X9NA 5FO9B 1K3RA 2WAQB 3H09A 2EYOA 4ZKBB 1NUCA 4N9TA 4G57A 2B8FA 2AMCB 2K5DA 4IJHA 4GN5A 4RGTA 3VR3A 4C3HH 1IBML 2JK8A 5IGDA 1CFMA 1ENFA 2K5HA 3S1NB 2Z6KC 4A3MB 3J81E 1I6HB 3CAMA 2MUYA 3S9WA 2WACA 1KDAA 2F4IA 3H3VH 4ZQ3A 4OX9Q 3I4MG 1H9SB 3PIPA 1Q8IA 1C4QA 4XYQA 3T1HL 1M8AA 1WTXA 2RSNA 4K2LA 2JEAI 3TREA 5JPNC 4A3IB 2VW9A 1FJGL 1VQ9A 3KF8B 1H9KA 4R9WA 3TP8A 1FGBD 3CHBD 4BY1H 1OXUA 2IWHA 2KA7A 1UEAB 1TS2A 2A68C 1HPCA 4NMZA 2DNCA 3I4MH 2WB1E 2BE5C 1LT4D 2NVQH 3LGJA 3HOVB 1PH6A 1X6OA 5FO8B 2A74C 2B2VA 2F0LA 2G9HD 2EVBA 1EU3A 1GUTA 1TR5A 4DNTB 2D0PA 5DM63 3ITPA 2OXPA 1G6ZA 4BBRB 2AHOB 4MZ9A 1PV4A 2GVAA 1C7YA 4A3MG 3SGIA 2ATWA 1R4QB 2FXQA 3OSOA 2MO0A 1U4MA 1Q82C 5IP9G 1OXTA 2MQHA 4YCVA 4AQYQ 4LF8L 3I4NB 1Z7TA 1EIYB 1L0XB 1SYDA 3Q6SA 5D14A 1QVGA 5M5YB 3V96A 2XN9C 4A3IG 2NTSA 2YV5A 1VQJA 4YHHL 3TZUA 4DUZL 1I6HH 4A3EG 2E2JB 2KHSA 3DM3A 3MHBA 4JOIC 1D1KA 4JI8Q 2KOLA 5CMDA 1S5DD 2MPMA 3BU2A 1VQBA 1NBWA 4A76A 1IZ6A 3D3RA 1S3OA 4DV0Q 2A73B 4BXXH 1D7QA 4QUFA 4P75A 1EL0A 1KABA 1CZGA 2QGQA 4A3IH 1TS3A 5BN3A 5GAHC 3K6OA 2R92B 2C9OA 3S14H 3PF5A 3PUYA 1X56A 3A0JA 2N55A 1DYQA 4K6LA 3HEJA 4LMQD 2VUMB 1LM0A 1XMQQ 3U4VA 1H9RA 3QO2A 3HOVH 1S5FD 3EA6A 3T1YQ 1RHPA 1W6JA 5C0XI 4DNRB 3K58A 1EFID 3PSIA 2BH2A 2PO4A 4K0KL 4GNXC 3PUVA 1PLFA 1LT6D 4CHTB 3PIOA 4BBRH 1VQNA 5IT9E 1EYAA 3UDGA 1HJPA 3STBD 4OEMB 3G4SA 2UXCL 3CXCA 2K1BA 5KRUA 2QW7A 1L2FA 1YJNA 1RODA 3I4NH 1KLUD 1BVSA 2EY5A 4PMCA 2EJMA 4DUYQ 4R8NA 4GLXA 2UXBL 3RLFA 5M5YH 3M7NA 2VNUD 1EOVA 2F0HA 3NPPA 3D0FA 3A7AB 5LHY1 2BA0A 5M3FB 4JC0A 3P7JA 4JI0L 2E2JH 2HHHQ 3K57A 2WKDA 2VUMG 4BBSG 3QWNA 3UDIA 1DOMA 1PFNA 1XPUA 4ODGA 3QJYA 5DNFA 5IGEA 1PFMA 2K5VA 1J5EQ 1AE3A 4XQJA 2B63B 1K8GA 1MHWC 1NSNS 3GTMB 3CC7A 2R92H 3A8KE 2F03A 4G7HC 1HH2P 3G6JB 1JB3A 4KY6A 1PH2A 2LXKA 2EXZA 1AFPA 1WCMB 4RKBA 3J80i 2JA7G 3SEBA 3JAMc 3HP3A 5KNCA 1IXRA 4P71A 4PG3A 1CSQA 4C1NI 4TQUS 3U58A 3NK9A 2XSCA 1KAAA 4C3JH 1HNXL 2WB1B 4FO2A 2PMZE 2O4XA 5M3FG 3R2TA 3I4OA 4LF5Q 4X65L 1NY4A 2L11A 3J81i 4OWWB 2VB3X 1XWEA 2PQEA 3DWQA 1G51A 2E2IB 4H7BA 1DOKA 5M5XB 3Q0AA 1SAPA 1SXTA 2VQFL 2QILA 2AQ2B 3PO3B 2R7ZB 2B63G 1QZGA 1HR0W 5DM73 2FMCA 2XVSA 3CW2C 1K3BC 4AYBE 3S2DH 4JBKA 3L9AX 2Z1CA 2B3GA 3W1GA 2HD3A 3SK8A 1WCMG 4WJWA 1MKHA 2YYZA 1PZJD 4C2MB 4DV2L 5C44H 3G7LA 1PRTD 4FF4A 1PH5A 1QG7A 1J6QA 2QF7A 1KD1C 2UUCQ 2B63H 2NTTA 3AU7A 3BZDB 4A93H 2UUBQ 2WB1G 2PPBC 4GOPB 1SBBB 2K28A 4K5VA 5KNDA 2R3ZA 4YY3L 5CV7A 1SLJA 5I9PA 1WCMH 2K75A 1KL9A 2CH4W 5IIFA 1YVCA 1M90C 5IP7G 3HOWB 4CJ0B 3KBXA 1V43A 3Q23A 1C8CA 1ILQA 1BF4A 4KK7A 2R7ZG 3L7ZC 1CQFA 2IX3A 1ZKOA 1EQQA 4DR7Q 1KRSA 2N78A 1HCZA 2DN8A 4FXKC 4KHPQ 2JA9A 4A3DB 4IURA 2F0NA 1LT3D 1F9RA 2I5LX 5IWAQ 1HNZQ 1QJOA 2E2IH 1TQOA 1N36L 1VQEA 4L8JA 4C3IB 1FNUA 3W1BA 3D8GA 1N33L 2CW0D 3GTOB 1DJRD 5J3BA 3BVMA 2OTLA 4DR4L 3PO3H 3CCUA 4RAUC 5T1IA 1H9SA 3OIQA 4Z9CB 1PRTF 3PUZA 2NZOA 3CCQA 1B4OA 2ZM6Q 2SOBA 4O42A 2EPBA 3KF8A 3CP0A 2N8NA 3KLRA 1KNEA 3FKIH 1B7YB 4C2MH 1O78A 1B1ZA 4G4KA 3MZ5A 1D2BA 3J7ZC 1VQ5A 1LTBD 2L15A 4DR6Q 4OHJA 1VQIA 1VF5C 1CKOA 3C2PA 3DLLA 3K5OA 3T4AC 2ID0A 4KD3A 1I50B 1HUNA 1TT2A 4ZCKA 4A3DG 2K32A 3HOXB 1IKLA 1KIXA 4DV6L 1EIHA 3HOWH 4EQNA 2XGTA 3GTGB 1L1OB 3ULLA 4X66L 3AMUA 4DR2L 1U5KA 1EY8A 3Q22A 1DCZA 1CA5A 4P2CB 4Y7NB 2F0KA 1SROA 4L5RC 4A3KH 3F1ZA 4IFDI 3QR8A 1KXLA 1ICWA 2G5DA 1A8VA 4JW0A 5JJKA 1BUVT 1B9MA 1BOSA 2I46A 5HY6A 4F88A 4B3RQ 2LY7A 2MJ8A 4C3IH 1QNUA 1T5EA 3K0YA 2PMZB 3GTOH 1K83B 1OXSC 5AJ3L 1UUPA 1HQRD 1X3PA 1JORA 1F2MA 4J1MA 1BQQT 3IRBA 1EIGA 1F2LA 2K52A 4B3ML 4FYDA 1YNNC 2V4DA 4FXGC 1TY2A 1J9OA 3U9OA 4LF6Q 3EN2A 3RR5A 3HOXG 4JI2L 4DV3L 3SR1A 4LF9Q 4A3GB 2ZTCA 4ABNA 1Q1BA 3H0GB 4AYBB 4HJ9A 4QQBX 3UI2A 3OWFA 1O80A 1TWHB 4OELB 4DNIA 3V05A 2F0MA 2N88A 1I50H 1XX8A 5IGFA 3ER0A 4L63B 3HOXH 2O2LD 3BDLA 1A3TA 2WAQE 4DF7A 2IJ0A 2JA8B 4YCUA 4DR5Q 3PIP3 1I4PA 5EKLA 4JI7L 4QGUA 3CCSA 1SFOH 4DPGA 1EYDA 2K14A 4Y7NH 1NR4A 3KOJA 1WTRA 4DV1L 1JOKA 1FR3A 1IW7C 2F0JA 1HZBA 4UHVA 2XWJB 5KIXA 4IFDH 3MXGA 3H15A 1STEA 4R4QA 1BKBA 4X66Q 2I5HA 3H0GG 4M1UB 1K83H 3GTQB 3TN2A 4DV5Q 5C3XA 5I9OA 4JI6L 1V9PA 4KJOA 4DV7L 2QCPX 2A68D 2K5NA 4X3UA 3RLOA 1NJIC 1W3SA 2EYLA 2D9UA 2FJ2A 3U9SA 2BE5D 4XYOA 5C4XB 1WI5A 1ML0D 1LTRD 1JOQA 4A3GH 2Z6BA 4UP9A 2A8VA 2J7ZA 1XNRQ 3J81L 2R93B 2A1AA 4GN3B 2K6AA 2ZTEA 2IX0A 4DKAC 1BBUA 4LUVA 1AH9A 1N34Q 3TSSA 3MEHA 1H9MA 5EQ0A 4N8X1 4LFBQ 4WJ4A 4HMIA 3EBEA 2B2WA 3BG3A 4QB4A 1JE4A 4DV4Q 2JSOA 1FL0A 4NXMQ 2JA8H 3KF6B 1VQHA 3TBIB 1XXGA 1J8IA 2PNHA 1BCPC 5A2QE 2M9VA 3NXWA 1HXYD 1D8LA 1I94Q 4FVMA 4RMFA 4OX9L 4KLKA 2PQAA 2XNAC 1L0WA 3PMFA 1TWAB 2RDHA 2O5IC 3PUXA 4C3HB 5C4XG 3FPUB 4KV6A 5E4WC 4OXPA 1RTNA 2D0OA 1K73C 2F0OA 1PTOC 2JYOA 4DK0A 2HCCA 5IYDG 4L5SA 2UUAQ 4LF4Q 4V190 5JJLA 4ME3A 3CRLC 2OQKA 3NSWA 4F7XA 2E2HB 3U4ZA 2Q2HA 3PIO3 1UE7A 1VQGA 1TIID 4M8AA 3CC2A 1EYGA 5C4XH 5K36G 3IKJA 2F3VA 2MFIA 4KJNA 4BY1B 3FPPA 1PH1A 1HFGA 3CMAA 3G48A 2R93H 1V1QA 4L5TA 1BO0A 1KTKA 4YIJA 2NVQB 3P75A 1LTAD 3HOZH 4AQYL 1C48A 1A63A 1FNVA 2AWOA 4IOAA 2SDFA 1PH8A 5G3LD 1HNWQ 4C3HG 4Y52H 3I7FA 1R4PB 3FDTA 4MTNA 4IUNA 3OW7A 4CBVA 4P74A 2JA5B 3HFZB 5TSSA 1IL2A 4GKJQ 1PYWD 1VQAA 1WD0A 2N3SA 3ERSX 4JI8L 5FO7B 1C0AA 3FP9A 1JCKB 3R3OA 4NDXA 1PYSB 4O1NA 3PF4A 4DV0L 1PRTB 1TWAH 1UE6A 4KKUA 2B39A 1YJ9A 3R2IA 3S1RB 5C3EH 3OTOQ 5IT9L 1A6XA 1VQFA 4BY1G 1HR0Q 1EQTA 4IUPA 4JYAQ 4PV1C 1LT5D 2WIIB 1EY5A 1XMQL 2ZTDA 3HGBA 1CM9A 2E2HH 4LK1C 3T1YL 1QZHA 4UY8C 1Q81C 1HZ9A 1STHA 1YITA 4OWTB 1XNQQ 3J80c 3GTLB 5EBCA 3S14B 5J1ZA 5IODA 2EYHA 4FF3A 4DAYB 4MHEA 2Z9HA 2NN6I 4CJ1B 3GDEA 5GAEC 1QVCA 4ZK9B 1EZ6A 2NWGA 1L1OA 5FLXL 5IE8A 1B3AA 3F2BA 2WAQG 3CF5A 5CV4A 3RZDH 4KKTA 3KBGA 4DUYL 2EY2A 1VQKA 4A3FH 4XT1B 3A55A 4PNYA 3IL8A 3R93A 3G71A 1F77A 3E0JA 1YJWA 2JA5H 1MSHA 2HHHL 2CKZB 2MGSA 1PH9A 3SDZA 3EQLC 2IY5B 4ME5A 3OPOA 3CD6A 3MTSA 4QUCA 1RCVD 4DAMA 1GXDC 1J5EL 4BXXG 1EFWA 2F4VQ 4ZUIA 2J4XA 3S1RH 3M7GA 4KHVA 2Q2TA 3MEFA 1D5ZC 4RCNA 5FKAC 3QOJA 4CKCA 1BBXC 1O7ZA 1X3GA 3D6WA 4XT3B 3CRKC 2KVMA 1Y1VH 3HOVG 5DEHA 5LMNW 2LMCB 4IO9A 3LX0A 2TMPA 4WRDA 5CYUA 3C3LA 3RMHA 1IYVA 1MI2A 1X3QA 1W2BA 3GTLH 1SYBA 4BBRG 1M1KC 2KJXA 1YEZA 4GOPC 1Y1WH 4LF5L 4Q0FA 2OEOA 2B8GA 2PZWA 2L55A 1STNA 1X55A 1Z6HA 3I4NG 1I3QH 1EU4A 1IYJB 1AW7A 4X62Q 2JN4A 3SHLA 3EJIA 4C3JB 1A62A 3E6ZX 1Z47A 5M9OA 4B3SQ 3NWSA 1DM0B 5JVG3 2PZTA 4HAEA 4IN3A 4HJ8A 1PA6A 2JA8G 2KEEA 5JOBA 3BDOA 5KNBA 1Q7YC 1RDPD 1XTDA 5ELEA 1CHQD 1WTQA 1C9OA 4A3BB 1TKWB 2RVLA 1DD2A 1FD7D 4OO1I 3S16B 1F2ZA 2CFMA 4HCEA 1I4RA 3VR5A 4DAVA 2KHJA 2X6GA 4JBWA 3WWVA 3MFGA 1HHVA 2Q8IB 3TEHB 1H9JA 3SK4A 2UUCL 2R92G 1NTGA 2VQEQ 1S4ZA 3L3OC 4F87A 3I73A 4Q5VA 3S2DB 4K2KA 5JEAH 3KLWA 1PH4A 1YNXA 2UUBL 3MXNB 4ULLA 1G6PA 2P5ZX 2VS1A 4FF1A 3GV6A 3TQYA 2RCNA 1KNAA 2SNMA 5I2XA 2A5HA 4RG1A 1MGSA 5FLXE 5C44B 2JA6H 2SEBD 5AFWA 4DXGA 2QDBA 4DGZA 5IT9c 4LFCQ 3JAME 5I2YA 1TY0A 4C3JG 4EVOA 4A93B 2J0TD 1S40A 3ZJYC 2A6EC 1SYFA 1VQDA 5CV6A 1E24A 3CCJA 1KRTA 1PFBA 2HDLA 4DR7L 3FVQA 4KHPL 1ICFB 1LTLA 5IWAL 1EY7A 3KK7A 2B2VC 3KF6A 5IGGA 1HNZL 1MJEA 2NYZD 5CC4A 2VZAA 1SMYC 2ZXRA 2E76C 1I4XA 1E7ZA 1PZKD 5C0XH 3HKZE 4I65A 2O5JC 2K04A 5BN5A 1Q46A 5FLMG 2IPKD 1NCVA 2DY8A 3RD4A 2E2DC 2Q2IA 4HTHA 5FJ8H 1UAPA 2ZM6L 1LABA 4A3BH 5JJIA 1TU2B 3S16H 1VMPA 1QOHA 2PQAB 2Z4IA 2BCOA 4EQ5A 5C44G 2E75C 4JI3Q 1CZWA 1YNND 3K7UC 4HIKA 4OO1H 1CHPD 1WTPA 1G291 4DR6L 3CPFA 4HMJA 2SNSA 1ASYA 4A93G 3NEMA 1SNDA 2F0IA 3J7AF 4UDUC 5FLMH 3NTKA 1S5ED 2AUKA 4WJ3M 2IX1A 3FKIB 3GO5A 3F2DA 3BZCA 4HN7A 1V1OA 2EYMA 3NWTA 4G7OC 1Q12A 1VDZA 3M9BA 2NVXH 5DLQE 3DEPA 3CPWA 2RDGA 1KLGD 3CQZB 1D1IA 1CKNA 2JE6I 3WDNA 5I4DA 2FFKB 4A75A 1YIJA 4WFN3 1QB5D 1KAWA 1VQPA 4MNOA 1A0IA 1K0RA 4FXDA 2ZXPA 2JXMB 4B3RL 4LW1A 3HS0C 3MAQA 1IW7D 3C46A 3QB3A 3HG9A 4KHZA 2F1MA 3PO3G 2WFWA 4C56C 1QWYA 1YHQA 4A3KB 4XXEA 3NTHA 2UXDQ 3S24A 4LF6L 2F3IA 4CDFC 1TS4A 4JI5Q 3FKIG 3RNUA 1MIUA 4LF9L 2B2YA 4KY5A 4DR1Q 1IBLQ 4OL7A 3MXUA 2BDNA 1XTCD 1LTGD 3KUPA 1RIPA 1ET6A 3D4RA 4H44C 1FVIA 1A2TA 3HOUB 1HTPA 4A3LH 1JT8A 3P20A 3CCRA 3R8BA 3NQIA 4A3JH 1YHAA 4BA1I 1PMRA 2Z8LA 4RGMA 4XTCS 1LO5D 1ZYRC 5EPKA 3MVVA 3ONAB 3HOWG 1B2TA 2MNAA 3L0OA 2RKSA 4DAYA 4DR5L 3Q8DA 1EOTA 1E2WA 4H02A 1K8MA 1N32Q 2V1CC 3CQZH 5C6AA 2B2UA 1I4GA 3GQBA 4ID6A 1S5CD 1LV9A 2BH8A 1BCPD 1BR9A 4A3KG 2RHSB 4CDDC 4DK3C 4YCWA 4N8FA 2EYJA 1GKHA 1TWCH 5LL6S 4HJAA 5C5MA 3D4DA 3VR2A 1Q3LA 3AYHB 3E0EA 4C3IG 1RF2D 3BVGA 4EQPA 2BOSA 1HRJA 1CUKA 1SFOB 3T53B 3H94A 3VDYA 5IY0A 1YZ6A 1X65A 4YWMA 2F0QA 4DV5L 4POGA 4F8MA 1PTOD 1LLRD 2RA4A 1B70B 1R9TB 4WORA 2K05A 1PDQA 1VS0A 2F0PA 4I7ZC 1HZCA 2HQLA 5C4JH 1PVOA 5EKIA 4HIOA 3HKZB 3MA2B 4S3SA 1SEBD 1XNRL 3K59A 5A2QL 3H3VC 4GKKQ 1GUWA 1MBYA 5LMUQ 1UE5A 3JAMi 3QIAA 4K8IA 1YHBA 2CWAA 3ERQA 1N34L 3HOUH 2Q8RE 1HA6A 1STYA 1DGSA 1GOZA 2A69D 1QNKA 1ILPA 2EJGC 4LFBL 1B53A 5M3MB 3CCVA 4P73A 2OF1A 1O7IA 4DV4L 3LWUA 1BCPF 2C5CA 2B2TA 4X3TA 4NXML 4XQNA 1IHZA 2H1EA 4ZRZA 1SE2A 3Q24A 2XRQD 1I94L 2F0DA 1EY4A 1UWVA 1SNPA 3DM1A 1SR3A 4NPSA 5E7NA 2AQ3B 4JCVE 3RZOH 2CHBD 2F0SA 4TRDA 2QKIC 1PTOF 1RL2A 1TWFB 3GV3A 4IFDG 3ND9A 1D6EC 3HKZG 4ZUJA 2DJGC 3S2HB 3IAYA 4FDBA 2UUAL 4LF4L 1LACA 4NXNQ 4B08A 2NVYH 4JI4Q 5I6YA 1TVXA 2EDGA 1PRTC 3EVQA 3OMCA 2F0GA 4PZ7A 1VQLA 1R9TH 2Z0SA 4HCSA 2KBNA 4X64Q 3HOYH 1K28A 1LUZA 4A3GG 3A7LA 3NBIA 4YWKA 3MXNA 2IW3A 4NB3A 5CV9A 1NR2A 3D4WA 4AYBG 1RD9D 3PO2B 2K7VA 2M2LA 2PZUA 5KGUA 1TXYA 5LMNQ 4U68A 1Y69U 4HJ7A 3GTPH 1X54A 3H6MA 3LNNA 5M3MH 1GHKA 5M5WB 4X3SA 2DUDA 1ASZA 3W5OA 2Z6KA 1HNWL 1VQ4A 3D31A
chains in the Genus database with same CATH topology
2Z9HA 4N8X1 2RCFA 4N8FA 4JVZA 5L37A 2HD3A 4JW0A 4I7AA 2QW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9H A;  4N8X 1;  2RCF A;  4N8F A;  4JVZ A;  5L37 A;  2HD3 A;  4JW0 A;  4I7A A;  2QW7 A; 
#chains in the Genus database with same CATH topology
 2EY1 A;  2ALY B;  2NVT B;  3NQT A;  1Q1E A;  5C5L A;  2L12 A;  2ZJQ A;  2KQ3 A;  4GKJ L;  1Y14 B;  3HOZ B;  2OCE A;  3BZK A;  2AKW B;  2KEC A;  1YI2 A;  2UU9 Q;  3PUW A;  3GP7 A;  1VQ7 A;  5C4H A;  1AEX A;  4IUU A;  2RDF A;  1YNJ C;  3OTO L;  1TWF H;  1HR0 L;  1QCB D;  1SJE D;  4IUQ A;  4JYA L;  1FNW A;  2ZXO A;  3DMU A;  3S2H H;  3AFP A;  4JI1 Q;  1X32 A;  2JP1 A;  5ELC A;  2F0F A;  4LUZ A;  3E9I A;  1SJH D;  3S1M H;  1UNS A;  1D5X C;  4IPD A;  4IJL A;  4R4T A;  1EUJ A;  2F0V A;  3K7A B;  2RF4 A;  5C3E B;  3CCL A;  2NZH A;  1XNQ L;  4BWG B;  4K14 A;  5GAG C;  2BA1 A;  3A8I E;  4RA8 A;  4AH6 A;  2CH4 A;  5IYB H;  2R93 G;  3UE0 A;  5LL6 X;  2ES2 A;  1EEF D;  3PO2 H;  1I4H A;  1Q86 C;  2X69 A;  4KN7 C;  4MIU A;  1STG A;  3HOZ G;  1EWC A;  1T5X D;  2D5D A;  1HA5 A;  4RWS C;  1E0B A;  4R1J A;  3CME A;  4JV5 Q;  4LFA Q;  1AZQ A;  5M5W H;  5IGB A;  2YU9 B;  3H3V I;  4IPG A;  1ZEQ X;  1HFN A;  2ICE C;  5EPJ A;  4PMB A;  2NVT H;  4JOI A;  4DK6 C;  3BS1 A;  1F9P A;  1WYD A;  2GN5 A;  2L9H A;  4CGY B;  4LF7 Q;  2KUM A;  5FK9 C;  1FGU A;  1CKN B;  1V8Q A;  4GLV B;  4BA2 I;  1ENC A;  5FOB B;  3RZD B;  4QCL A;  4A3F B;  1BDO A;  2F4V L;  1Y8P B;  1IBK Q;  1STB A;  2CQA A;  3T16 A;  1DXM A;  4CKB A;  5C3E G;  4XQQ A;  2OWO A;  4FNF A;  1S72 A;  3F8T A;  5K5P A;  3GTJ H;  4B3T Q;  1MD2 D;  1SE3 A;  3M4Q A;  3SVM A;  1JWU D;  5DAU A;  5EJW A;  2A6H C;  2WV6 D;  1NMG A;  2WIN B;  2XIW A;  1SMX A;  3DHQ A;  4QL5 A;  3I8Z A;  2HDM A;  4RGO S;  3EFX D;  1HUM A;  5CBE E;  3E5S A;  4RH6 A;  4GNX A;  4BY7 H;  2HUG A;  3VA7 A;  3K7A H;  2RCF A;  1CT1 D;  2FHT A;  4ALP A;  5IYC H;  4ZKC B;  3K5L A;  3K0X A;  4RGN A;  3AB9 A;  1ESF A;  2KEN A;  1E2Z A;  1Y1V B;  1ZXT A;  5CV8 A;  1TS5 A;  2A6E D;  1GUO A;  2JQO A;  3I55 A;  3NTI A;  2CWP A;  1HZA A;  2TSS A;  4X62 L;  4A3F G;  3S17 B;  3I90 A;  1N9W A;  4ZYS A;  3K81 C;  2YU9 H;  4B3S L;  3NEN A;  2EY6 A;  3KLS X;  2R7D A;  3CCM A;  1SMY D;  1Y1W B;  3IFD A;  5G3L F;  2JA5 G;  1JMC A;  4DU9 A;  3KJO A;  2IHE A;  2VXW A;  4IPC A;  3VYS A;  2YTV A;  2K5W A;  1I3Q B;  1AE2 A;  2KED A;  4YWL A;  3JAM L;  2B2W C;  1VQ8 A;  3J81 c;  1A2U A;  2R61 A;  5D65 A;  4OWX B;  4CDC C;  1SE8 A;  3NP8 A;  3GTK H;  4A3E B;  2VQE L;  1OTC A;  2G9D A;  4LNQ A;  1X3F A;  2PNR C;  2E5L Q;  1IL8 A;  1Y1V G;  1NMF A;  2QEX A;  1EYC A;  1EIF A;  3N52 A;  1VQO A;  1I4Q A;  3FEW X;  4N9P A;  4LJZ C;  4LFC L;  3S1Q H;  4IZ8 A;  4JVZ A;  1GUG A;  2R7F A;  2L1B A;  1JC7 A;  4B9X A;  2F0E A;  3PGZ A;  4UP7 A;  1SNM A;  4J6H A;  1WTH A;  1BCP B;  3VYR A;  1Y1W G;  1CI3 M;  3TZD A;  1F9S A;  1XPR A;  1WD1 A;  4IQZ A;  5E4X A;  3J7A V;  1D5M C;  1SDF A;  3SK5 A;  4IUT A;  2JA6 B;  2L5T A;  1F9Q A;  4OGQ C;  2NN6 G;  3GD7 A;  2CVR A;  4K6D A;  2C35 B;  3MWY W;  5COY A;  3RLN A;  4AIM A;  5IGC A;  3K80 C;  4G7Z C;  3S17 H;  3F2U A;  3S1N H;  1G91 A;  4A3M H;  4CKE A;  4GLA C;  2EXD A;  1PTO B;  2E74 C;  4V0B A;  4QJF A;  1CSP A;  1XJV A;  4KMU C;  5IP9 H;  2Y0S E;  1GHJ A;  4HR7 B;  4GN4 B;  2N49 A;  2IT1 A;  3DXJ C;  2NN6 H;  4C1N K;  2DJF C;  4DK1 A;  1IBM Q;  4JI3 L;  1B9N A;  3TS0 A;  1V1P A;  2CQO A;  3T51 B;  1XMO L;  4A3E H;  2Q2U A;  1PH7 A;  5EAY A;  2PI2 A;  5JPM C;  5JEA G;  2VL6 A;  3KJP A;  4BBS B;  1NE3 A;  4A3C G;  3T1H Q;  3URY A;  1Z9F A;  3NBH A;  1EWH A;  3C1F A;  2KCT A;  2JA6 G;  2JJQ A;  1E1O A;  2XTI A;  3HKS A;  1FJG Q;  4BS9 A;  1G2T A;  3S15 B;  1DZ1 A;  3A5U A;  3X3N A;  3C1E A;  3HZX A;  3HRZ C;  1ZYR D;  3AQQ A;  3SK6 A;  1OXV A;  1JJC B;  1WFQ A;  3J7A 5;  1RKN A;  3KLS A;  4GZY C;  1XPO A;  4A3C H;  2JA7 B;  1E22 A;  3DUZ A;  2ICI A;  1EZ8 A;  1OXX K;  2NZ1 D;  1Q8K A;  4B9W A;  3T56 B;  4JBJ A;  2NVX B;  3PV0 A;  5GQO A;  2RSO A;  4HIM A;  5ELN A;  4L6T B;  3A8J E;  4K5W A;  5C0X G;  3T13 A;  4NKL A;  2RHQ B;  5H1S E;  1KDB A;  3M4O B;  3U50 C;  4J15 A;  1E3P A;  1PTO H;  2PCF B;  4L5Q A;  1WOC A;  2LFN A;  5FJ8 G;  1S5B D;  2UXD L;  4LF8 Q;  4A3B G;  3BDC A;  2JEB I;  3X3M A;  3JC6 6;  1L1O C;  4JI5 L;  5BR8 L;  4JG2 A;  4CJ2 C;  3RUZ A;  2KCM A;  4DR1 L;  1RJT A;  1IBL L;  1CKM A;  3W2D A;  4DR3 L;  4OO1 G;  4YHH Q;  3ND8 A;  4PMW A;  3VR6 A;  5C4Z A;  5NUC A;  2HQE A;  4DUZ Q;  1MSG A;  4NP5 A;  3TME A;  4QIW E;  2K50 A;  4ZLT F;  4DFA A;  2EQS A;  1ET9 A;  2VUM H;  4BBS H;  3PCO B;  1QVF A;  2AWN A;  3BJU A;  1DOL A;  2HCI A;  5FLX c;  5GRO A;  4XIG S;  2NUC A;  1GM5 A;  1E1T A;  1GUS A;  2PYK A;  1PFS A;  1UEB A;  2YTY A;  5C3W A;  5KYL A;  5I6W A;  1P16 A;  5HUR A;  3CKI B;  4IFD J;  1U9R A;  3S15 H;  3IFT A;  4NW2 A;  4X3K A;  3QG1 A;  4KD4 A;  1XMO Q;  1N32 L;  2OQ0 A;  3LWE A;  2NB0 A;  5JAV A;  2VY3 A;  2XWB B;  3ICE A;  2LXJ A;  3KYH C;  1A15 A;  2JA7 H;  4A3J B;  1LTT D;  1KDC A;  1KHI A;  1QUQ A;  4K0K Q;  4OIK A;  1U4L A;  3KDF A;  1JWS D;  4RKL A;  3QOL A;  3ERO A;  1B50 A;  1SN8 A;  1B8A A;  2I5M X;  3I2Z A;  4HSP A;  2CCZ A;  1ONL A;  2PW7 A;  5COR A;  5M3F H;  3M4O H;  2UXC Q;  3AFQ A;  1QE6 A;  2AUJ D;  1EQR A;  1TWC B;  4KKS A;  4APV A;  4UPA A;  2PI2 E;  4OIJ A;  1SNC A;  2UXB Q;  4A4I A;  1B44 D;  4R8I A;  1IYU A;  2F3W A;  2WKC A;  1PZI D;  1CTM A;  1U4P A;  3GTM H;  3MC0 B;  1I5F A;  4OON A;  4GKK L;  1CQV A;  5LMU L;  4JI0 Q;  4QY7 A;  1WTO A;  1PXU A;  2Y0S B;  3UE1 A;  4A3L G;  2VB2 X;  1U0L A;  4MN3 A;  3WOE A;  3ULJ A;  3I91 A;  4HJ5 A;  2OT2 A;  1JIC A;  4A3J G;  1WTV A;  5BR8 Q;  2EIF A;  5C4J B;  2HIX A;  2ASB A;  3I4L A;  3VYU A;  2LKV A;  3PQI A;  2GA4 B;  4DR3 Q;  3RN5 A;  1QIL A;  2RBM A;  4GNX B;  3OOC A;  1ESR A;  1VMC A;  1AP0 A;  4RHS A;  1AN8 A;  4K8J A;  1JOO A;  1EEI D;  5EKK A;  3OHX C;  2FIN B;  1ENA A;  1P8L A;  3MXP A;  4DN4 M;  5IP7 H;  2ZJP A;  1VQ6 A;  3OYY A;  1WJJ A;  5M5X H;  3TS2 A;  1SNQ A;  2IHF A;  2LS0 1;  3STB C;  4FP5 D;  2R7Z H;  5CBA E;  1HNX Q;  1JB7 A;  5T1G A;  2ZT9 C;  1EY9 A;  1STA A;  1MJC A;  2Q8T A;  1YNJ D;  2ENB A;  4NXN L;  5BN4 A;  1X3E A;  2E8G A;  4X65 Q;  1SNO A;  4JBM A;  4JI4 L;  2Y0S G;  5E1F A;  1KQS A;  3L2P A;  3RZO B;  5EPL A;  1OO9 B;  4X64 L;  2VQF Q;  1GD7 A;  3UDX A;  3TRZ A;  3O13 A;  1BBW A;  4RCO A;  1G8Z D;  3CC4 A;  4UAI A;  3P1H A;  3FMC A;  4KI0 A;  4LUO A;  2LSS A;  2F0W A;  1SYC A;  2NVY B;  4HID A;  3I3C A;  3HOU G;  3DWP A;  3SE0 A;  5LMN L;  2L4N A;  3WOF A;  1JWM D;  4DA2 A;  4PQX A;  3I70 A;  4KN4 C;  2DY7 A;  4DV2 Q;  3M85 A;  4HSV A;  3HOY B;  5J39 A;  1VCI A;  3F2C A;  4KTA A;  2ZJR A;  3A54 A;  5ELO A;  1K8O A;  4RHR A;  4TKO B;  5ELF A;  4QIW B;  1BXT A;  1LYL A;  1SYE A;  2MHV A;  2EYP A;  3VA5 A;  3B6Y A;  2KCN A;  1CK1 A;  2H4O A;  4O2D A;  4YY3 Q;  4UP8 A;  2WP8 J;  4A3D H;  1Y8N B;  2UU9 L;  3GTP B;  5GAD C;  3OW2 A;  1PYB A;  1JJ2 A;  5JVH 3;  1GO3 E;  1K8A C;  4IPH A;  1UE1 A;  5JJZ A;  3I56 A;  2MP1 A;  4RFB A;  4JI1 L;  4U67 3;  2EOT A;  1K9M C;  1PHJ A;  5ELB A;  3K5M A;  1SE4 A;  3N6R A;  5EGT A;  3VR4 A;  3J81 j;  2HIV A;  2BDO A;  3A74 A;  1N36 Q;  1VQM A;  1DON A;  4QMG A;  2A6H D;  3FRP B;  1N33 Q;  4LAA A;  3HOY G;  2DNE A;  2M00 A;  3NE5 B;  4DR4 Q;  3NEL A;  1VF7 A;  4DXF A;  3EIV A;  1V1P B;  3E3X A;  4O0A A;  3S1M B;  2RQX A;  3E9H A;  4IOC A;  3ZYY X;  3DWA A;  3W3A A;  5M3M G;  1G2S A;  3MFY A;  5ELD A;  3J7Y W;  4JV5 L;  4LFA L;  1E2V A;  2QEJ C;  2HT1 A;  1LTS D;  1EY6 A;  3NBH B;  3GTG H;  2B2Y C;  2K4K A;  3TP6 A;  2DGY A;  1RTO A;  4MTK A;  2I07 B;  2KHI A;  1VQC A;  2R6G A;  3OMG A;  4LF7 L;  4ZAI A;  1EY0 A;  1O7L A;  4DV6 Q;  1SRU A;  1GJX A;  3D6C A;  1AZP A;  2F0U A;  1EWI A;  1IBK L;  4POF A;  1WTW A;  4ILW A;  3CU7 A;  4P72 A;  4DR2 Q;  3J80 L;  5CV5 A;  4B3T L;  1B3Q A;  2H5X A;  1JE5 A;  4E6I A;  1TWG B;  4H13 C;  1JJG A;  2B2U C;  2EYF A;  3SXH A;  1NAP A;  1I6V C;  3BYT B;  3M4Y A;  2CW0 C;  2GVB A;  3I72 A;  4EGV A;  5L37 A;  4QF4 A;  2F0T A;  4JPB W;  1SYG A;  1Y8O B;  4XDX A;  1IKM A;  3DEO A;  5A35 A;  3A56 A;  3GTJ B;  5AJ3 Q;  3H0G H;  1KC8 C;  5HGQ A;  4PZ8 A;  2K01 A;  5IYB G;  1YBY A;  4EX5 A;  4X6A H;  1TWH H;  4IAL A;  3PO2 G;  3NHH A;  3BVZ A;  1A3V A;  4B3M Q;  2AQ1 B;  3OIP A;  4BY7 B;  1WVL A;  2KCC A;  2XRS D;  1FYC A;  4JI2 Q;  4DV3 Q;  3M3Y B;  4R4I A;  1M4V A;  1NNX A;  1JR0 D;  1T9H A;  2QDL A;  3TP7 A;  1W6K A;  4EQO A;  4R4O A;  4GS3 A;  3RN2 A;  1SSO A;  1BNZ A;  5D3D A;  2EJF C;  1XYI A;  2MO1 A;  5JEA J;  2A19 A;  3FHW A;  2Z4H A;  4KY7 A;  1U4R A;  4CDE C;  1O7Y A;  4R4C A;  5HGT A;  5ISR A;  3G6E A;  3TDQ A;  4J8Q A;  5KEE A;  2PW5 A;  1JQY D;  1CA6 A;  1QUQ B;  2B2T C;  4JI7 Q;  3A5Z B;  1HQM C;  1EQV A;  3KDF B;  3TP5 A;  3OWE B;  3GTQ H;  3M4P A;  2K03 A;  4LWC A;  5IOC A;  2NBF A;  1LTI D;  3CCE A;  3BYY B;  1TWG H;  3V2T A;  4JK1 C;  2E5L L;  2YTX A;  1L0Y B;  2IL8 A;  2L0C A;  4DV1 Q;  3NUC A;  2X6L A;  4BY7 G;  2B29 A;  1GUN A;  1K0S A;  4I7A A;  3H91 A;  1GVP A;  2I0Q A;  5KYI A;  5CR3 A;  4H0L C;  3K8A A;  5IYC G;  3K5N A;  4GOP A;  3GTK B;  5J22 A;  5IYD H;  2EZV A;  3UDF A;  2A69 C;  5C0X J;  4TSS A;  3ULP A;  2OTJ A;  1II3 A;  4JI6 Q;  3I4M B;  1HTL D;  4DV7 Q;  3VYT A;  2D62 A;  1N8R C;  3KFU A;  1H95 A;  2EE1 A;  1PH3 A;  5CGK A;  4HED A;  5EBD A;  3S1Q B;  2K5Q A;  4K5X A;  5K36 H;  5F2D A;  2QA4 A;  3M3Y H;  4TVA B;  1Q90 A;  2F52 A;  4IUV A;  2K33 A;  1F2Y A;  1A3U A;  2FMM A;  3J80 E;  3AEV A;  4PZ6 A;  4DAP A;  5E3F A;  5D3I B;  2D2C C;  4FF2 A;  1X9N A;  5FO9 B;  1K3R A;  2WAQ B;  3H09 A;  2EYO A;  4ZKB B;  1NUC A;  4N9T A;  4G57 A;  2B8F A;  2AMC B;  2K5D A;  4IJH A;  4GN5 A;  4RGT A;  3VR3 A;  4C3H H;  1IBM L;  2JK8 A;  5IGD A;  1CFM A;  1ENF A;  2K5H A;  3S1N B;  2Z6K C;  4A3M B;  3J81 E;  1I6H B;  3CAM A;  2MUY A;  3S9W A;  2WAC A;  1KDA A;  2F4I A;  3H3V H;  4ZQ3 A;  4OX9 Q;  3I4M G;  1H9S B;  3PIP A;  1Q8I A;  1C4Q A;  4XYQ A;  3T1H L;  1M8A A;  1WTX A;  2RSN A;  4K2L A;  2JEA I;  3TRE A;  5JPN C;  4A3I B;  2VW9 A;  1FJG L;  1VQ9 A;  3KF8 B;  1H9K A;  4R9W A;  3TP8 A;  1FGB D;  3CHB D;  4BY1 H;  1OXU A;  2IWH A;  2KA7 A;  1UEA B;  1TS2 A;  2A68 C;  1HPC A;  4NMZ A;  2DNC A;  3I4M H;  2WB1 E;  2BE5 C;  1LT4 D;  2NVQ H;  3LGJ A;  3HOV B;  1PH6 A;  1X6O A;  5FO8 B;  2A74 C;  2B2V A;  2F0L A;  2G9H D;  2EVB A;  1EU3 A;  1GUT A;  1TR5 A;  4DNT B;  2D0P A;  5DM6 3;  3ITP A;  2OXP A;  1G6Z A;  4BBR B;  2AHO B;  4MZ9 A;  1PV4 A;  2GVA A;  1C7Y A;  4A3M G;  3SGI A;  2ATW A;  1R4Q B;  2FXQ A;  3OSO A;  2MO0 A;  1U4M A;  1Q82 C;  5IP9 G;  1OXT A;  2MQH A;  4YCV A;  4AQY Q;  4LF8 L;  3I4N B;  1Z7T A;  1EIY B;  1L0X B;  1SYD A;  3Q6S A;  5D14 A;  1QVG A;  5M5Y B;  3V96 A;  2XN9 C;  4A3I G;  2NTS A;  2YV5 A;  1VQJ A;  4YHH L;  3TZU A;  4DUZ L;  1I6H H;  4A3E G;  2E2J B;  2KHS A;  3DM3 A;  3MHB A;  4JOI C;  1D1K A;  4JI8 Q;  2KOL A;  5CMD A;  1S5D D;  2MPM A;  3BU2 A;  1VQB A;  1NBW A;  4A76 A;  1IZ6 A;  3D3R A;  1S3O A;  4DV0 Q;  2A73 B;  4BXX H;  1D7Q A;  4QUF A;  4P75 A;  1EL0 A;  1KAB A;  1CZG A;  2QGQ A;  4A3I H;  1TS3 A;  5BN3 A;  5GAH C;  3K6O A;  2R92 B;  2C9O A;  3S14 H;  3PF5 A;  3PUY A;  1X56 A;  3A0J A;  2N55 A;  1DYQ A;  4K6L A;  3HEJ A;  4LMQ D;  2VUM B;  1LM0 A;  1XMQ Q;  3U4V A;  1H9R A;  3QO2 A;  3HOV H;  1S5F D;  3EA6 A;  3T1Y Q;  1RHP A;  1W6J A;  5C0X I;  4DNR B;  3K58 A;  1EFI D;  3PSI A;  2BH2 A;  2PO4 A;  4K0K L;  4GNX C;  3PUV A;  1PLF A;  1LT6 D;  4CHT B;  3PIO A;  4BBR H;  1VQN A;  5IT9 E;  1EYA A;  3UDG A;  1HJP A;  3STB D;  4OEM B;  3G4S A;  2UXC L;  3CXC A;  2K1B A;  5KRU A;  2QW7 A;  1L2F A;  1YJN A;  1ROD A;  3I4N H;  1KLU D;  1BVS A;  2EY5 A;  4PMC A;  2EJM A;  4DUY Q;  4R8N A;  4GLX A;  2UXB L;  3RLF A;  5M5Y H;  3M7N A;  2VNU D;  1EOV A;  2F0H A;  3NPP A;  3D0F A;  3A7A B;  5LHY 1;  2BA0 A;  5M3F B;  4JC0 A;  3P7J A;  4JI0 L;  2E2J H;  2HHH Q;  3K57 A;  2WKD A;  2VUM G;  4BBS G;  3QWN A;  3UDI A;  1DOM A;  1PFN A;  1XPU A;  4ODG A;  3QJY A;  5DNF A;  5IGE A;  1PFM A;  2K5V A;  1J5E Q;  1AE3 A;  4XQJ A;  2B63 B;  1K8G A;  1MHW C;  1NSN S;  3GTM B;  3CC7 A;  2R92 H;  3A8K E;  2F03 A;  4G7H C;  1HH2 P;  3G6J B;  1JB3 A;  4KY6 A;  1PH2 A;  2LXK A;  2EXZ A;  1AFP A;  1WCM B;  4RKB A;  3J80 i;  2JA7 G;  3SEB A;  3JAM c;  3HP3 A;  5KNC A;  1IXR A;  4P71 A;  4PG3 A;  1CSQ A;  4C1N I;  4TQU S;  3U58 A;  3NK9 A;  2XSC A;  1KAA A;  4C3J H;  1HNX L;  2WB1 B;  4FO2 A;  2PMZ E;  2O4X A;  5M3F G;  3R2T A;  3I4O A;  4LF5 Q;  4X65 L;  1NY4 A;  2L11 A;  3J81 i;  4OWW B;  2VB3 X;  1XWE A;  2PQE A;  3DWQ A;  1G51 A;  2E2I B;  4H7B A;  1DOK A;  5M5X B;  3Q0A A;  1SAP A;  1SXT A;  2VQF L;  2QIL A;  2AQ2 B;  3PO3 B;  2R7Z B;  2B63 G;  1QZG A;  1HR0 W;  5DM7 3;  2FMC A;  2XVS A;  3CW2 C;  1K3B C;  4AYB E;  3S2D H;  4JBK A;  3L9A X;  2Z1C A;  2B3G A;  3W1G A;  2HD3 A;  3SK8 A;  1WCM G;  4WJW A;  1MKH A;  2YYZ A;  1PZJ D;  4C2M B;  4DV2 L;  5C44 H;  3G7L A;  1PRT D;  4FF4 A;  1PH5 A;  1QG7 A;  1J6Q A;  2QF7 A;  1KD1 C;  2UUC Q;  2B63 H;  2NTT A;  3AU7 A;  3BZD B;  4A93 H;  2UUB Q;  2WB1 G;  2PPB C;  4GOP B;  1SBB B;  2K28 A;  4K5V A;  5KND A;  2R3Z A;  4YY3 L;  5CV7 A;  1SLJ A;  5I9P A;  1WCM H;  2K75 A;  1KL9 A;  2CH4 W;  5IIF A;  1YVC A;  1M90 C;  5IP7 G;  3HOW B;  4CJ0 B;  3KBX A;  1V43 A;  3Q23 A;  1C8C A;  1ILQ A;  1BF4 A;  4KK7 A;  2R7Z G;  3L7Z C;  1CQF A;  2IX3 A;  1ZKO A;  1EQQ A;  4DR7 Q;  1KRS A;  2N78 A;  1HCZ A;  2DN8 A;  4FXK C;  4KHP Q;  2JA9 A;  4A3D B;  4IUR A;  2F0N A;  1LT3 D;  1F9R A;  2I5L X;  5IWA Q;  1HNZ Q;  1QJO A;  2E2I H;  1TQO A;  1N36 L;  1VQE A;  4L8J A;  4C3I B;  1FNU A;  3W1B A;  3D8G A;  1N33 L;  2CW0 D;  3GTO B;  1DJR D;  5J3B A;  3BVM A;  2OTL A;  4DR4 L;  3PO3 H;  3CCU A;  4RAU C;  5T1I A;  1H9S A;  3OIQ A;  4Z9C B;  1PRT F;  3PUZ A;  2NZO A;  3CCQ A;  1B4O A;  2ZM6 Q;  2SOB A;  4O42 A;  2EPB A;  3KF8 A;  3CP0 A;  2N8N A;  3KLR A;  1KNE A;  3FKI H;  1B7Y B;  4C2M H;  1O78 A;  1B1Z A;  4G4K A;  3MZ5 A;  1D2B A;  3J7Z C;  1VQ5 A;  1LTB D;  2L15 A;  4DR6 Q;  4OHJ A;  1VQI A;  1VF5 C;  1CKO A;  3C2P A;  3DLL A;  3K5O A;  3T4A C;  2ID0 A;  4KD3 A;  1I50 B;  1HUN A;  1TT2 A;  4ZCK A;  4A3D G;  2K32 A;  3HOX B;  1IKL A;  1KIX A;  4DV6 L;  1EIH A;  3HOW H;  4EQN A;  2XGT A;  3GTG B;  1L1O B;  3ULL A;  4X66 L;  3AMU A;  4DR2 L;  1U5K A;  1EY8 A;  3Q22 A;  1DCZ A;  1CA5 A;  4P2C B;  4Y7N B;  2F0K A;  1SRO A;  4L5R C;  4A3K H;  3F1Z A;  4IFD I;  3QR8 A;  1KXL A;  1ICW A;  2G5D A;  1A8V A;  4JW0 A;  5JJK A;  1BUV T;  1B9M A;  1BOS A;  2I46 A;  5HY6 A;  4F88 A;  4B3R Q;  2LY7 A;  2MJ8 A;  4C3I H;  1QNU A;  1T5E A;  3K0Y A;  2PMZ B;  3GTO H;  1K83 B;  1OXS C;  5AJ3 L;  1UUP A;  1HQR D;  1X3P A;  1JOR A;  1F2M A;  4J1M A;  1BQQ T;  3IRB A;  1EIG A;  1F2L A;  2K52 A;  4B3M L;  4FYD A;  1YNN C;  2V4D A;  4FXG C;  1TY2 A;  1J9O A;  3U9O A;  4LF6 Q;  3EN2 A;  3RR5 A;  3HOX G;  4JI2 L;  4DV3 L;  3SR1 A;  4LF9 Q;  4A3G B;  2ZTC A;  4ABN A;  1Q1B A;  3H0G B;  4AYB B;  4HJ9 A;  4QQB X;  3UI2 A;  3OWF A;  1O80 A;  1TWH B;  4OEL B;  4DNI A;  3V05 A;  2F0M A;  2N88 A;  1I50 H;  1XX8 A;  5IGF A;  3ER0 A;  4L63 B;  3HOX H;  2O2L D;  3BDL A;  1A3T A;  2WAQ E;  4DF7 A;  2IJ0 A;  2JA8 B;  4YCU A;  4DR5 Q;  3PIP 3;  1I4P A;  5EKL A;  4JI7 L;  4QGU A;  3CCS A;  1SFO H;  4DPG A;  1EYD A;  2K14 A;  4Y7N H;  1NR4 A;  3KOJ A;  1WTR A;  4DV1 L;  1JOK A;  1FR3 A;  1IW7 C;  2F0J A;  1HZB A;  4UHV A;  2XWJ B;  5KIX A;  4IFD H;  3MXG A;  3H15 A;  1STE A;  4R4Q A;  1BKB A;  4X66 Q;  2I5H A;  3H0G G;  4M1U B;  1K83 H;  3GTQ B;  3TN2 A;  4DV5 Q;  5C3X A;  5I9O A;  4JI6 L;  1V9P A;  4KJO A;  4DV7 L;  2QCP X;  2A68 D;  2K5N A;  4X3U A;  3RLO A;  1NJI C;  1W3S A;  2EYL A;  2D9U A;  2FJ2 A;  3U9S A;  2BE5 D;  4XYO A;  5C4X B;  1WI5 A;  1ML0 D;  1LTR D;  1JOQ A;  4A3G H;  2Z6B A;  4UP9 A;  2A8V A;  2J7Z A;  1XNR Q;  3J81 L;  2R93 B;  2A1A A;  4GN3 B;  2K6A A;  2ZTE A;  2IX0 A;  4DKA C;  1BBU A;  4LUV A;  1AH9 A;  1N34 Q;  3TSS A;  3MEH A;  1H9M A;  5EQ0 A;  4N8X 1;  4LFB Q;  4WJ4 A;  4HMI A;  3EBE A;  2B2W A;  3BG3 A;  4QB4 A;  1JE4 A;  4DV4 Q;  2JSO A;  1FL0 A;  4NXM Q;  2JA8 H;  3KF6 B;  1VQH A;  3TBI B;  1XXG A;  1J8I A;  2PNH A;  1BCP C;  5A2Q E;  2M9V A;  3NXW A;  1HXY D;  1D8L A;  1I94 Q;  4FVM A;  4RMF A;  4OX9 L;  4KLK A;  2PQA A;  2XNA C;  1L0W A;  3PMF A;  1TWA B;  2RDH A;  2O5I C;  3PUX A;  4C3H B;  5C4X G;  3FPU B;  4KV6 A;  5E4W C;  4OXP A;  1RTN A;  2D0O A;  1K73 C;  2F0O A;  1PTO C;  2JYO A;  4DK0 A;  2HCC A;  5IYD G;  4L5S A;  2UUA Q;  4LF4 Q;  4V19 0;  5JJL A;  4ME3 A;  3CRL C;  2OQK A;  3NSW A;  4F7X A;  2E2H B;  3U4Z A;  2Q2H A;  3PIO 3;  1UE7 A;  1VQG A;  1TII D;  4M8A A;  3CC2 A;  1EYG A;  5C4X H;  5K36 G;  3IKJ A;  2F3V A;  2MFI A;  4KJN A;  4BY1 B;  3FPP A;  1PH1 A;  1HFG A;  3CMA A;  3G48 A;  2R93 H;  1V1Q A;  4L5T A;  1BO0 A;  1KTK A;  4YIJ A;  2NVQ B;  3P75 A;  1LTA D;  3HOZ H;  4AQY L;  1C48 A;  1A63 A;  1FNV A;  2AWO A;  4IOA A;  2SDF A;  1PH8 A;  5G3L D;  1HNW Q;  4C3H G;  4Y52 H;  3I7F A;  1R4P B;  3FDT A;  4MTN A;  4IUN A;  3OW7 A;  4CBV A;  4P74 A;  2JA5 B;  3HFZ B;  5TSS A;  1IL2 A;  4GKJ Q;  1PYW D;  1VQA A;  1WD0 A;  2N3S A;  3ERS X;  4JI8 L;  5FO7 B;  1C0A A;  3FP9 A;  1JCK B;  3R3O A;  4NDX A;  1PYS B;  4O1N A;  3PF4 A;  4DV0 L;  1PRT B;  1TWA H;  1UE6 A;  4KKU A;  2B39 A;  1YJ9 A;  3R2I A;  3S1R B;  5C3E H;  3OTO Q;  5IT9 L;  1A6X A;  1VQF A;  4BY1 G;  1HR0 Q;  1EQT A;  4IUP A;  4JYA Q;  4PV1 C;  1LT5 D;  2WII B;  1EY5 A;  1XMQ L;  2ZTD A;  3HGB A;  1CM9 A;  2E2H H;  4LK1 C;  3T1Y L;  1QZH A;  4UY8 C;  1Q81 C;  1HZ9 A;  1STH A;  1YIT A;  4OWT B;  1XNQ Q;  3J80 c;  3GTL B;  5EBC A;  3S14 B;  5J1Z A;  5IOD A;  2EYH A;  4FF3 A;  4DAY B;  4MHE A;  2Z9H A;  2NN6 I;  4CJ1 B;  3GDE A;  5GAE C;  1QVC A;  4ZK9 B;  1EZ6 A;  2NWG A;  1L1O A;  5FLX L;  5IE8 A;  1B3A A;  3F2B A;  2WAQ G;  3CF5 A;  5CV4 A;  3RZD H;  4KKT A;  3KBG A;  4DUY L;  2EY2 A;  1VQK A;  4A3F H;  4XT1 B;  3A55 A;  4PNY A;  3IL8 A;  3R93 A;  3G71 A;  1F77 A;  3E0J A;  1YJW A;  2JA5 H;  1MSH A;  2HHH L;  2CKZ B;  2MGS A;  1PH9 A;  3SDZ A;  3EQL C;  2IY5 B;  4ME5 A;  3OPO A;  3CD6 A;  3MTS A;  4QUC A;  1RCV D;  4DAM A;  1GXD C;  1J5E L;  4BXX G;  1EFW A;  2F4V Q;  4ZUI A;  2J4X A;  3S1R H;  3M7G A;  4KHV A;  2Q2T A;  3MEF A;  1D5Z C;  4RCN A;  5FKA C;  3QOJ A;  4CKC A;  1BBX C;  1O7Z A;  1X3G A;  3D6W A;  4XT3 B;  3CRK C;  2KVM A;  1Y1V H;  3HOV G;  5DEH A;  5LMN W;  2LMC B;  4IO9 A;  3LX0 A;  2TMP A;  4WRD A;  5CYU A;  3C3L A;  3RMH A;  1IYV A;  1MI2 A;  1X3Q A;  1W2B A;  3GTL H;  1SYB A;  4BBR G;  1M1K C;  2KJX A;  1YEZ A;  4GOP C;  1Y1W H;  4LF5 L;  4Q0F A;  2OEO A;  2B8G A;  2PZW A;  2L55 A;  1STN A;  1X55 A;  1Z6H A;  3I4N G;  1I3Q H;  1EU4 A;  1IYJ B;  1AW7 A;  4X62 Q;  2JN4 A;  3SHL A;  3EJI A;  4C3J B;  1A62 A;  3E6Z X;  1Z47 A;  5M9O A;  4B3S Q;  3NWS A;  1DM0 B;  5JVG 3;  2PZT A;  4HAE A;  4IN3 A;  4HJ8 A;  1PA6 A;  2JA8 G;  2KEE A;  5JOB A;  3BDO A;  5KNB A;  1Q7Y C;  1RDP D;  1XTD A;  5ELE A;  1CHQ D;  1WTQ A;  1C9O A;  4A3B B;  1TKW B;  2RVL A;  1DD2 A;  1FD7 D;  4OO1 I;  3S16 B;  1F2Z A;  2CFM A;  4HCE A;  1I4R A;  3VR5 A;  4DAV A;  2KHJ A;  2X6G A;  4JBW A;  3WWV A;  3MFG A;  1HHV A;  2Q8I B;  3TEH B;  1H9J A;  3SK4 A;  2UUC L;  2R92 G;  1NTG A;  2VQE Q;  1S4Z A;  3L3O C;  4F87 A;  3I73 A;  4Q5V A;  3S2D B;  4K2K A;  5JEA H;  3KLW A;  1PH4 A;  1YNX A;  2UUB L;  3MXN B;  4ULL A;  1G6P A;  2P5Z X;  2VS1 A;  4FF1 A;  3GV6 A;  3TQY A;  2RCN A;  1KNA A;  2SNM A;  5I2X A;  2A5H A;  4RG1 A;  1MGS A;  5FLX E;  5C44 B;  2JA6 H;  2SEB D;  5AFW A;  4DXG A;  2QDB A;  4DGZ A;  5IT9 c;  4LFC Q;  3JAM E;  5I2Y A;  1TY0 A;  4C3J G;  4EVO A;  4A93 B;  2J0T D;  1S40 A;  3ZJY C;  2A6E C;  1SYF A;  1VQD A;  5CV6 A;  1E24 A;  3CCJ A;  1KRT A;  1PFB A;  2HDL A;  4DR7 L;  3FVQ A;  4KHP L;  1ICF B;  1LTL A;  5IWA L;  1EY7 A;  3KK7 A;  2B2V C;  3KF6 A;  5IGG A;  1HNZ L;  1MJE A;  2NYZ D;  5CC4 A;  2VZA A;  1SMY C;  2ZXR A;  2E76 C;  1I4X A;  1E7Z A;  1PZK D;  5C0X H;  3HKZ E;  4I65 A;  2O5J C;  2K04 A;  5BN5 A;  1Q46 A;  5FLM G;  2IPK D;  1NCV A;  2DY8 A;  3RD4 A;  2E2D C;  2Q2I A;  4HTH A;  5FJ8 H;  1UAP A;  2ZM6 L;  1LAB A;  4A3B H;  5JJI A;  1TU2 B;  3S16 H;  1VMP A;  1QOH A;  2PQA B;  2Z4I A;  2BCO A;  4EQ5 A;  5C44 G;  2E75 C;  4JI3 Q;  1CZW A;  1YNN D;  3K7U C;  4HIK A;  4OO1 H;  1CHP D;  1WTP A;  1G29 1;  4DR6 L;  3CPF A;  4HMJ A;  2SNS A;  1ASY A;  4A93 G;  3NEM A;  1SND A;  2F0I A;  3J7A F;  4UDU C;  5FLM H;  3NTK A;  1S5E D;  2AUK A;  4WJ3 M;  2IX1 A;  3FKI B;  3GO5 A;  3F2D A;  3BZC A;  4HN7 A;  1V1O A;  2EYM A;  3NWT A;  4G7O C;  1Q12 A;  1VDZ A;  3M9B A;  2NVX H;  5DLQ E;  3DEP A;  3CPW A;  2RDG A;  1KLG D;  3CQZ B;  1D1I A;  1CKN A;  2JE6 I;  3WDN A;  5I4D A;  2FFK B;  4A75 A;  1YIJ A;  4WFN 3;  1QB5 D;  1KAW A;  1VQP A;  4MNO A;  1A0I A;  1K0R A;  4FXD A;  2ZXP A;  2JXM B;  4B3R L;  4LW1 A;  3HS0 C;  3MAQ A;  1IW7 D;  3C46 A;  3QB3 A;  3HG9 A;  4KHZ A;  2F1M A;  3PO3 G;  2WFW A;  4C56 C;  1QWY A;  1YHQ A;  4A3K B;  4XXE A;  3NTH A;  2UXD Q;  3S24 A;  4LF6 L;  2F3I A;  4CDF C;  1TS4 A;  4JI5 Q;  3FKI G;  3RNU A;  1MIU A;  4LF9 L;  2B2Y A;  4KY5 A;  4DR1 Q;  1IBL Q;  4OL7 A;  3MXU A;  2BDN A;  1XTC D;  1LTG D;  3KUP A;  1RIP A;  1ET6 A;  3D4R A;  4H44 C;  1FVI A;  1A2T A;  3HOU B;  1HTP A;  4A3L H;  1JT8 A;  3P20 A;  3CCR A;  3R8B A;  3NQI A;  4A3J H;  1YHA A;  4BA1 I;  1PMR A;  2Z8L A;  4RGM A;  4XTC S;  1LO5 D;  1ZYR C;  5EPK A;  3MVV A;  3ONA B;  3HOW G;  1B2T A;  2MNA A;  3L0O A;  2RKS A;  4DAY A;  4DR5 L;  3Q8D A;  1EOT A;  1E2W A;  4H02 A;  1K8M A;  1N32 Q;  2V1C C;  3CQZ H;  5C6A A;  2B2U A;  1I4G A;  3GQB A;  4ID6 A;  1S5C D;  1LV9 A;  2BH8 A;  1BCP D;  1BR9 A;  4A3K G;  2RHS B;  4CDD C;  4DK3 C;  4YCW A;  4N8F A;  2EYJ A;  1GKH A;  1TWC H;  5LL6 S;  4HJA A;  5C5M A;  3D4D A;  3VR2 A;  1Q3L A;  3AYH B;  3E0E A;  4C3I G;  1RF2 D;  3BVG A;  4EQP A;  2BOS A;  1HRJ A;  1CUK A;  1SFO B;  3T53 B;  3H94 A;  3VDY A;  5IY0 A;  1YZ6 A;  1X65 A;  4YWM A;  2F0Q A;  4DV5 L;  4POG A;  4F8M A;  1PTO D;  1LLR D;  2RA4 A;  1B70 B;  1R9T B;  4WOR A;  2K05 A;  1PDQ A;  1VS0 A;  2F0P A;  4I7Z C;  1HZC A;  2HQL A;  5C4J H;  1PVO A;  5EKI A;  4HIO A;  3HKZ B;  3MA2 B;  4S3S A;  1SEB D;  1XNR L;  3K59 A;  5A2Q L;  3H3V C;  4GKK Q;  1GUW A;  1MBY A;  5LMU Q;  1UE5 A;  3JAM i;  3QIA A;  4K8I A;  1YHB A;  2CWA A;  3ERQ A;  1N34 L;  3HOU H;  2Q8R E;  1HA6 A;  1STY A;  1DGS A;  1GOZ A;  2A69 D;  1QNK A;  1ILP A;  2EJG C;  4LFB L;  1B53 A;  5M3M B;  3CCV A;  4P73 A;  2OF1 A;  1O7I A;  4DV4 L;  3LWU A;  1BCP F;  2C5C A;  2B2T A;  4X3T A;  4NXM L;  4XQN A;  1IHZ A;  2H1E A;  4ZRZ A;  1SE2 A;  3Q24 A;  2XRQ D;  1I94 L;  2F0D A;  1EY4 A;  1UWV A;  1SNP A;  3DM1 A;  1SR3 A;  4NPS A;  5E7N A;  2AQ3 B;  4JCV E;  3RZO H;  2CHB D;  2F0S A;  4TRD A;  2QKI C;  1PTO F;  1RL2 A;  1TWF B;  3GV3 A;  4IFD G;  3ND9 A;  1D6E C;  3HKZ G;  4ZUJ A;  2DJG C;  3S2H B;  3IAY A;  4FDB A;  2UUA L;  4LF4 L;  1LAC A;  4NXN Q;  4B08 A;  2NVY H;  4JI4 Q;  5I6Y A;  1TVX A;  2EDG A;  1PRT C;  3EVQ A;  3OMC A;  2F0G A;  4PZ7 A;  1VQL A;  1R9T H;  2Z0S A;  4HCS A;  2KBN A;  4X64 Q;  3HOY H;  1K28 A;  1LUZ A;  4A3G G;  3A7L A;  3NBI A;  4YWK A;  3MXN A;  2IW3 A;  4NB3 A;  5CV9 A;  1NR2 A;  3D4W A;  4AYB G;  1RD9 D;  3PO2 B;  2K7V A;  2M2L A;  2PZU A;  5KGU A;  1TXY A;  5LMN Q;  4U68 A;  1Y69 U;  4HJ7 A;  3GTP H;  1X54 A;  3H6M A;  3LNN A;  5M3M H;  1GHK A;  5M5W B;  4X3S A;  2DUD A;  1ASZ A;  3W5O A;  2Z6K A;  1HNW L;  1VQ4 A;  3D31 A; 
#chains in the Genus database with same CATH homology
 2Z9H A;  4N8X 1;  2RCF A;  4N8F A;  4JVZ A;  5L37 A;  2HD3 A;  4JW0 A;  4I7A A;  2QW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...