2HD3A

Crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
b'MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine utilization protein eutN
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
total genus 11
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2hd3A00
2QW7A 2Z9HA 4I7AA 2HD3A 4N8X1 2RCFA 4N8FA 5L37A 4JW0A 4JVZA
chains in the Genus database with same CATH superfamily
3OHXC 1JR0D 1CM9A 1X56A 2NZHA 3S17H 4HN7A 1NJIC 1IYJB 1BCPD 3WWVA 3GTJB 3H15A 3GO5A 3D3RA 4OWXB 3MFGA 1CK1A 2ZTEA 1HHVA 5IOCA 3VR4A 3CCJA 5JEAH 1HNXL 4POFA 3GDEA 1PYWD 4QMGA 5COYA 4HJAA 1YI2A 1SJED 4JOIA 2PMZB 4N9TA 3CQZB 3CCUA 4CJ0B 5IYBH 5IYCG 4LF7L 2DY7A 4GN3B 4OX9L 1VQ6A 3IAYA 3KLSA 1LTBD 3QJYA 2IX3A 2PW7A 1EQTA 1PDQA 2RSNA 4H7BA 1TWHB 2K03A 3GP7A 2VUMG 3NSWA 4HR7B 1KLGD 3KLRA 4PQXA 4BY1B 4AYBE 1PRTC 3F8TA 1R9TH 1JMCA 4NB3A 2BH2A 3S16H 2Z0SA 1SJHD 4JI1L 1MJCA 4IFDG 4JW0A 5FKAC 4HJ9A 2I5LX 4OONA 3I91A 2ZTDA 4DNTB 3S1NB 3FMCA 1HNZL 1CKMA 3CPWA 3NK9A 1S5ED 4C1NK 1BKBA 2JP1A 4YWMA 1GHJA 4X6AH 1ENFA 2J0TD 1VMPA 1LT3D 2NWGA 4WJ4A 5M3FH 5FO9B 1QVGA 4XYOA 4JYAL 1A2UA 5KEEA 4BWGB 2AKWB 3S2DB 2ZTCA 1EWIA 4A3FB 2B63B 3OIQA 1ZEQX 2Q8TA 5FJ8G 2O2LD 1WTWA 1ZXTA 3I3CA 4IPDA 4L8JA 3TMEA 4AQYL 1VQ5A 4KKTA 1FL0A 2P5ZX 4DV6Q 2UUAL 4A3DB 2IX1A 2K4KA 3CW2C 3HKZB 5IIFA 1CZGA 4UY8C 4GZYC 1MHWC 1DOLA 4O42A 3Q22A 4UP8A 1DOKA 3ULJA 4C3JH 2OQKA 2AUKA 3S14B 3QOLA 1D8LA 3KF8B 4V0BA 5EPJA 4JBMA 1SROA 4B3MQ 2A6HC 4DN4M 4GKKQ 4A3EH 5IGBA 3MTSA 3CCEA 4PMWA 3D31A 3TQYA 3NELA 3KK7A 1NMFA 3U58A 3LX0A 1I4PA 5CV9A 1G2SA 1ESFA 4OIJA 3SVMA 5TSSA 3M4QA 4LFCQ 4BY7B 1WTVA 1VQDA 2ID0A 3KF8A 3H0GG 4FXKC 1J9OA 2JA7G 2O4XA 4A3JH 1TY2A 4IQZA 4R4OA 2N55A 2PZWA 4RCOA 1I6VC 4B3SL 3LWEA 4X65Q 2VB2X 1MGSA 5G3LF 1JWSD 4L5TA 4CGYB 3HOUH 1K8MA 2R3ZA 3GTMB 1A3UA 1A3TA 1S40A 2B2VC 4DV7L 2HCIA 1TWGH 5L37A 4DUZL 3L7ZC 4OELB 3JAMi 1XYIA 1QZHA 3A74A 5T1GA 4GKJQ 3CAMA 1CHPD 1XX8A 1HR0L 1F9SA 3HG9A 4A3LG 1SYEA 1FJGQ 2J7ZA 2UXBL 4K8JA 2XIWA 3U50C 2EYJA 5JPMC 2F0EA 4DR1L 5I6WA 1PV4A 1HNWQ 1F2YA 5EPKA 1SNPA 3SHLA 1XNQQ 3T1YL 3TRZA 2L5TA 1XMQQ 4A76A 4Y52H 1ET9A 3OPOA 2WAQB 3D4RA 2NVYH 2JQOA 2WP8J 3CHBD 1HFNA 4HCSA 3ICEA 2F0LA 1UE6A 2ZJPA 3PO2G 1ET6A 4JVZA 1M4VA 3HKSA 2B8FA 3BYTB 4JV5Q 3M4PA 3F2CA 3PIO3 1HTPA 1VQCA 4QJFA 3F1ZA 4X62Q 1WOCA 1E1OA 4LAAA 2L12A 4DR3Q 4JI0Q 1I4GA 1F9PA 4XQJA 4JC0A 1I6HH 2F1MA 3BDLA 5JEAG 1EY5A 1FR3A 3W1GA 4EX5A 4KMUC 1PH3A 1C48A 2L4NA 2EJFC 4POGA 1SMXA 3HEJA 2R7ZB 1A2TA 2MHVA 2Z8LA 4L5SA 3G48A 5IYBG 4OO1H 3ND8A 2K5QA 5C4ZA 3W5OA 5A2QE 2UUBQ 4B9XA 2JA8B 3BDOA 2Y0SB 1JJGA 3KBXA 4XT1B 3H3VC 2RHQB 1A3VA 1HZAA 1HR0W 3JAML 1LYLA 3IL8A 5IGFA 4A3GH 4DK6C 2JSOA 2WACA 3SK8A 1VQIA 1NNXA 1SAPA 4KY5A 1HRJA 5CR3A 1TQOA 4BBRH 3ULPA 3M7NA 2C35B 3A54A 1BDOA 2F0IA 3HOWB 1GVPA 1JQYD 4BBSH 1X3PA 3Q0AA 4LF8Q 3S15H 2VS1A 3D4DA 1F9RA 2K32A 4H13C 1AZPA 4QB4A 2JA6B 4LNQA 3C1EA 4A93H 4DXFA 3K8AA 5M3FG 5KYIA 1X55A 5EAYA 4RCNA 1ASZA 2NUCA 4YCWA 3V05A 4NW2A 1Z47A 4A3IB 3MFYA 3NENA 4DV6L 2A68D 4DV4Q 3D4WA 1TT2A 1EEID 1X6OA 2Q2UA 1KDAA 4PNYA 5LL6S 4KHPQ 2QEXA 3TDQA 3CCQA 5NUCA 1Y1VB 1K8AC 3DEOA 3JC66 3HOYB 3RZDB 3KDFB 1HFGA 4X3KA 3ND9A 1WD0A 4GKKL 4IUVA 2D5DA 1PH2A 4M1UB 4HIKA 2C9OA 2KCNA 4C3JG 5FO7B 4DV5Q 1VQOA 1WCMB 1IBMQ 1Q8IA 2B2YA 5GROA 1WTOA 1LTAD 3CMEA 4JBKA 2F4VQ 1WVLA 4RGNA 1S5DD 4A3EG 4WRDA 3J7AV 1I4HA 5LMUQ 3K7UC 3MXNB 4PZ7A 1RHPA 3AFQA 2YYZA 3D6CA 3DWQA 4MIUA 4LFCL 1Q86C 3RMHA 1YZ6A 3CCLA 2K01A 2GVAA 3KDFA 2NVTH 2ICIA 2QCPX 3A7AB 3FKIH 2UU9Q 2K50A 1Z9FA 2DJFC 2K5HA 1LTSD 1PFSA 3CCSA 2VQFQ 4X65L 3M4OB 4DV0Q 1HH2P 3GTOH 4RH6A 2VNUD 1M8AA 1NUCA 1DONA 1PH8A 1EYAA 4A3JG 3G71A 1SYCA 4FF3A 3NEMA 1N34Q 1PHJA 3MXNA 1YNNC 3SXHA 3W2DA 3U4VA 3NBHB 3HOUG 2PI2E 1BF4A 4GKJL 3CCVA 1MSGA 3BVZA 1E7ZA 2GA4B 2ZJQA 1FJGL 1J6QA 1EIHA 1XJVA 4R8IA 2SEBD 3S1RH 3RZOH 1E1TA 2XRQD 1Q8KA 3R3OA 1KC8C 4P75A 2A8VA 4EQOA 5C0XG 4E6IA 2VB3X 4LF4Q 1XNQL 3VYTA 1BXTA 2F3IA 2KVMA 2NYZD 1XMQL 5IWAQ 3HRZC 4X64Q 3J80L 3M85A 1YJ9A 5GQOA 5CV8A 1PFBA 2ATWA 3C2PA 3NBHA 5A2QL 2KCCA 4K6DA 4ALPA 3GTGH 4PV1C 2RDHA 4P72A 3TP6A 3K58A 4JV5L 2ZT9C 4DV2Q 3T53B 3VR5A 4X62L 1AE3A 4FNFA 2FFKB 4K5WA 4WJ3M 1Q81C 4DR3L 5CV6A 5T1IA 1EY6A 5JOBA 3R2TA 2V1CC 3TBIB 2MJ8A 4CDEC 5IYCH 5C5MA 3CCRA 4ME3A 2XWBB 2Z9HA 1JB7A 4LUVA 2I07B 2AQ1B 1A63A 3HS0C 2XNAC 4J15A 3TP8A 4OHJA 4JI5Q 2UUBL 2K5WA 2MQHA 5IGCA 1WTHA 3HFZB 1JE5A 4X3UA 2BA0A 4QQBX 4X3TA 5ISRA 3UDFA 5CYUA 1HZBA 5JJKA 2ICEC 4GOPC 2R6GA 4KTAA 4K2KA 1WFQA 4IOCA 4IFDH 3PIP3 1A6XA 2WAQE 4QY7A 3RN2A 3QWNA 1W6JA 3TP5A 5KYLA 1KABA 1TWFB 5BR8Q 2R92G 3V96A 1U4LA 2KQ3A 4LF8L 2F3WA 2XTIA 4DV3Q 2F0KA 1SMYD 4Y7NH 4IN3A 2NB0A 2NVQB 2BE5C 4BBRG 2ZJRA 5C44B 3VR2A 2WB1G 4BBSG 1GJXA 4EQPA 4FDBA 1U4PA 1J5EQ 3DWPA 2MPMA 2F0QA 5M5WB 1KRSA 2PNHA 3AYHB 2I5MX 2K04A 1IW7C 3H3VI 4DV4L 1N9WA 2VL6A 5IP7H 4A93G 4CJ2C 1VMCA 3CC7A 4A3MH 4KHPL 1KHIA 3Q8DA 2EYPA 1JCKB 2YU9B 1BBUA 4YWKA 4DK1A 5IE8A 4KY6A 3AFPA 1IBKQ 1NTGA 5ELEA 5C5LA 3DMUA 1IBML 4I65A 1XPOA 4YY3Q 1OXUA 2B2UC 1X3QA 3ERQA 1CT1D 2L1BA 3J81E 3OW2A 2RDFA 1WJJA 2QF7A 4ZCKA 2B2WC 5LMUL 2HIVA 1VQJA 4DR6Q 3J7AF 1LT5D 3H09A 4DR2Q 2EYMA 2VUMB 5LMNQ 1RTNA 4N8FA 3L2PA 1JWUD 1PXUA 4IOAA 2F0UA 1STEA 3EFXD 1HTLD 2UU9L 2XRSD 1STHA 2K75A 4FF2A 2CW0D 2TSSA 1SN8A 2VQFL 4DV0L 1L1OC 4JCVE 5J22A 2EDGA 4YHHQ 3NQTA 3FKIG 3ULLA 1UNSA 4DAYB 1N34L 2A6ED 1KNEA 4S3SA 5F2DA 4EQNA 3GTKB 3VYSA 3CQZH 2KENA 2VZAA 2EYLA 1KAAA 1W3SA 2ALYB 2NBFA 2E75C 3D0FA 1T9HA 1TVXA 1W2BA 3AB9A 3P20A 1ILPA 2A19A 4Z9CB 4DKAC 3RNUA 2G5DA 1TWHH 1A15A 2D0OA 1MI2A 4LF4L 1L2FA 1Q7YC 3J7A5 5CMDA 1FGUA 1SE4A 3OIPA 1V8QA 5FLXE 5M3MG 4DAYA 3CCMA 4X64L 2EOTA 1LTLA 1IKLA 3P75A 1BCPC 2AQ3B 5E3FA 3NHHA 4PZ8A 3RUZA 5C4XH 1SBBB 4KV6A 1KLUD 5M5XH 4DV2L 3LNNA 1VQEA 1JT8A 1CA6A 3CC4A 4IUUA 3MEHA 2KEEA 3JAMc 1S3OA 2X69A 3NE5B 2R93H 3J7YW 5J1ZA 1VQ4A 4DU9A 3A7LA 2HHHQ 1B1ZA 2F4IA 3ERSX 1T5EA 3I90A 1HUNA 4LF6Q 4A3FH 1SNCA 4UAIA 4JI5L 1B70B 2RQXA 2E2JH 3J81j 3H0GB 3MZ5A 5DEHA 1C9OA 2Z6KC 3OMCA 3SK6A 4GLVB 4C2MB 1PLFA 3SDZA 2K33A 1C0AA 3K80C 3K5MA 3D8GA 2LXKA 2DJGC 5JJIA 1X3FA 2H5XA 1D6EC 4OGQC 4HJ7A 4N8X1 2D2CC 3MA2B 4DV3L 1STBA 5ELFA 2RKSA 3TSSA 1NR4A 1Q1EA 4RA8A 1PH5A 1JE4A 3KF6B 5K5PA 1VF5C 1J5EL 1K73C 4BY7H 1CUKA 4IURA 2Q2IA 1V9PA 4AIMA 3J81L 4FF4A 3FDTA 5EBDA 1BR9A 4OWWB 2FHTA 2VQEQ 3A55A 3NPPA 1E2VA 1EQVA 1ASYA 1X9NA 2SNSA 2F0NA 3PO2B 1CZWA 1NAPA 4K5VA 1YVCA 3K6OA 3GTMH 3ZJYC 4U673 3VYRA 1CTMA 1B3QA 1K83H 2ASBA 2I46A 3JAME 4GNXC 4HIOA 3S17B 3KF6A 5IP7G 3K5NA 4MZ9A 3HP3A 2VW9A 1EY4A 4B3TL 1IBKL 1LM0A 4A3MG 2FMCA 2Q8RE 4R1JA 1KIXA 1K8OA 1IYVA 1I5FA 1V1PB 4YY3L 2EY6A 4ILWA 4DXGA 2E2DC 3GTQH 2N8NA 1Y69U 4IJHA 4JI4Q 4DR6L 1DOMA 5LMNL 2MO0A 4FF1A 1EY9A 2NZ1D 1TWAH 3TS0A 1EY7A 2HDMA 1DJRD 2CVRA 3CC2A 1JOOA 2B2VA 5DM63 3CXCA 1GKHA 2NTTA 3IRBA 5FLXL 1V1PA 1OTCA 1R9TB 1GUWA 2NN6I 4YHHL 2PI2A 1PTOC 3J80c 3F2BA 1G2TA 4RHRA 4NDXA 1HQRD 1SE8A 4ZLTF 4JG2A 3HZXA 3I4NH 3DLLA 1JORA 2SNMA 2A1AA 1EWCA 1A8VA 4A3BB 1SSOA 2KHIA 5GAGC 2JK8A 3R2IA 3A8IE 4IO9A 5EKKA 1PZID 2MFIA 5IGDA 2UXCQ 1YNJD 2BH8A 1SFOH 1SE3A 3RLFA 4KN4C 5I9OA 5M3FB 1K8GA 3M3YH 4K2LA 3HOVH 2JA8H 4PMCA 5C0XH 1NMGA 4CBVA 2HD3A 4LUOA 3PV0A 2MNAA 3BU2A 5C3EB 1YJWA 4IZ8A 4BY1G 3PCOB 4CDDC 1Y8OB 1YEZA 5M5YB 5IY0A 4KI0A 4QUCA 4ODGA 4QIWB 1U5KA 2XVSA 5LMNW 5JJZA 4B3RQ 3HOWH 1E3PA 2N49A 4NP5A 1XNRQ 4GS3A 4J1MA 3A8KE 3D6WA 5DM73 4C3JB 5EKIA 5C4XG 1SNDA 2FINB 1D1KA 2HQEA 3C3LA 4KLKA 2ES2A 3E6ZX 2HHHL 1TY0A 3SE0A 4J6HA 4DGZA 5JVH3 4LF6L 1JWMD 1CSQA 3EBEA 2MP1A 2R93G 1U0LA 2KHJA 1UEBA 2EY2A 2KEDA 4P2CB 4DF7A 3L0OA 3MXPA 1I4QA 2K52A 3STBD 1Y1WH 4A3FG 1XWEA 2B63G 3J80E 1GUSA 4R4IA 3KJPA 3OTOQ 3HOYH 5K36G 1EL0A 1HUMA 3HKZG 4G4KA 3J7ZC 2UUCQ 3P1HA 3K7AB 2Z4IA 4F87A 1EZ8A 2JN4A 5C4JB 4DK3C 2BCOA 4ULLA 2R92H 3HOUB 2F0DA 3A5ZB 1GXDC 1CKNB 2YTVA 5E4WC 3F2UA 2GVBA 5KNDA 2M9VA 1TWGB 3I73A 2K05A 3NWSA 4FXGC 3H91A 2ENBA 3FRPB 3KUPA 1STNA 1E2ZA 2A68C 2A69D 2HQLA 5C3WA 4L6TB 3I4MH 4A3KH 1ICFB 4RGOS 5LHY1 1B53A 4LF5Q 2E76C 1H9JA 4BY7G 5G3LD 2E2HH 1CKNA 1K9MC 1AN8A 4ZKBB 4TSSA 4HIMA 4MTKA 4JPBW 1SNQA 4A4IA 1SNOA 2F3VA 3RLNA 1GHKA 2WV6D 3C1FA 4TQUS 3G7LA 4ME5A 4YCUA 1M90C 4CDFC 2EXDA 1N8RC 1UUPA 3DUZA 2KHSA 4JI2Q 1JB3A 1MBYA 2HCCA 4B3ML 1T5XD 3AMUA 4O1NA 3OMGA 4JI4L 4RKLA 3CU7A 3FEWX 1K3BC 1I6HB 4DR5Q 4F8MA 3PIOA 1HQMC 2F52A 3BZDB 4WJWA 1II3A 2M00A 4HMIA 3IFDA 3TS2A 1KDCA 2NVXH 3VYUA 1VF7A 1VDZA 1RF2D 2EJMA 3PF5A 4UHVA 3AQQA 1I3QH 1ZYRC 1WYDA 2XSCA 1RDPD 3GTLH 3PUWA 4EQ5A 3I7FA 1EEFD 2D9UA 5EJWA 4DUYQ 4A3GB 2E2IH 1TU2B 3IFTA 1PA6A 3L3OC 4C3HB 4C3IH 2JA5H 3TREA 4BBRB 3GTPB 3KFUA 5CV5A 2UXCL 1LO5D 5AFWA 5ELOA 1WTPA 1QZGA 2WB1B 4BXXH 4BBSB 4K14A 2CHBD 3I4NG 1JOKA 3S15B 1SR3A 5HGQA 3M7GA 2IT1A 4RKBA 3UE0A 3S24A 2X6LA 1X3EA 4RGMA 1NBWA 4IJLA 1FNUA 2ZM6Q 2G9DA 2N3SA 1L0WA 5CORA 3NTIA 1NSNS 4GLAC 5M3MH 3S2HH 4A93B 3X3NA 1BBWA 1GD7A 1ENAA 4WORA 4YWLA 3HOVG 2JA8G 1BUVT 1HNWL 4OXPA 3SGIA 3K0XA 4GOPB 5CC4A 2Y0SG 4XIGS 3I8ZA 2EY5A 1YITA 1VQAA 2LKVA 2FJ2A 4OWTB 1EIYB 4B3RL 2KCMA 2CQAA 2MO1A 4JBWA 1XNRL 1EFID 3A8JE 1P8LA 1EU4A 1MKHA 1LLRD 3HOXH 2E74C 4FVMA 1AEXA 3DHQA 4ZK9B 1PFMA 5C44H 1F2LA 3HOWG 1QVFA 1WD1A 4V190 4GOPA 1HA6A 1J8IA 2DN8A 1XTCD 2D0PA 1PYSB 4JI8Q 1B44D 2LY7A 4JI6Q 4KKUA 4JI0L 5HGTA 3CD6A 3E0EA 2JA9A 4HEDA 2RF4A 1N36Q 1TWCH 3NXWA 1S4ZA 3S9WA 4CDCC 3NBIA 4APVA 1FNWA 1KQSA 1RKNA 2AHOB 1A0IA 2FMMA 4ZKCB 1AP0A 4A3IG 3J81c 2NVTB 1HCZA 3BDCA 3OTOL 4LFBQ 3FKIB 1VQHA 4CJ1B 2UUCL 3NUCA 4L63B 1Y1WG 2OCEA 3PO3H 3GTOB 3RR5A 4UP7A 1BOSA 1W6KA 5IGGA 1LT6D 1SMYC 1Y1VG 3F2DA 4QIWE 3HOYG 4XQQA 1HNXQ 1I50B 1G91A 1TR5A 4HTHA 2LMCB 1PH6A 1DD2A 1D5XC 1Z7TA 4N9PA 1ENCA 1R4QB 3URYA 1WCMG 3L9AX 1OO9B 1EIFA 1L0XB 3HOZH 2OT2A 2VXWA 3EIVA 3QG1A 4EVOA 3K81C 4J8QA 2VY3A 4A3CH 2QW7A 2R7FA 3E9HA 4DAMA 2B3GA 1IL8A 4LF5L 2F0GA 3V2TA 2PW5A 1H9SB 4ZUIA 3PF4A 4Q0FA 2AWOA 3KLSX 3CMAA 2C5CA 2H1EA 4FXDA 3CPFA 4R9WA 4XQNA 3I4MG 1L1OB 4A3KG 2B2UA 2K5VA 5KRUA 2HDLA 1EZ6A 1KXLA 4HJ5A 2EY1A 2IL8A 3OYYA 2A73B 2A74C 1JJCB 2IHEA 3GV6A 1GO3E 2B2WA 5ELCA 1VQPA 1TIID 3GTGB 4QF4A 5FLXc 5IODA 2AMCB 3WOFA 2JYOA 3EJIA 4JI2L 2K5DA 2K7VA 3I4OA 1EU3A 1H9SA 3N6RA 4P73A 3NTHA 2EZVA 1BCPF 1IYUA 1FD7D 2F0OA 4DV5L 2DGYA 1QVCA 1L1OA 3PUVA 4DR5L 2F0VA 2YTYA 1YHBA 3NQIA 3OSOA 1OXVA 2F4VL 3GQBA 2RCNA 2QILA 3NTKA 3CRKC 3S1QH 3VDYA 1H9MA 3QO2A 1YIJA 4AQYQ 1BCPB 4AYBG 2A6EC 4GLXA 4LW1A 1GM5A 4X3SA 1O7LA 4RG1A 2OWOA 3UDGA 5ELDA 4DUYL 4K0KQ 2XWJB 4ZUJA 2PQAB 3QOJA 2JXMB 2CWAA 2IPKD 3GTJH 1XMOQ 4P71A 1IXRA 1BO0A 1P16A 2PPBC 3PSIA 1B9NA 4KJOA 1EFWA 3T16A 3PIPA 2R7DA 4C3IG 2JA5G 3QR8A 3H94A 3R8BA 1I4XA 3MXGA 1D1IA 2ZM6L 1PRTF 4BXXG 1EIGA 3BYYB 2CQOA 1LV9A 2QA4A 2K28A 2PQAA 2Z4HA 4YIJA 2PZUA 5IT9L 3DM1A 1WTXA 2L11A 1SXTA 4BY1H 3MHBA 1TKWB 5JAVA 4DR4Q 1C4QA 1EOVA 1LUZA 1WI5A 3LWUA 4UPAA 1UE5A 3WDNA 3OWEB 1ESRA 3TEHB 5IWAL 1XXGA 3TZDA 1AFPA 1PRTB 3OOCA 1V1OA 4ID6A 1O7ZA 2PNRC 4Q5VA 4A3MB 5D3DA 1F2MA 3S1NH 1S5BD 2E8GA 1H9RA 2B2TC 4O2DA 4R4TA 3S1MB 4LWCA 2JEBI 1IZ6A 2L0CA 2L55A 3NWTA 1PVOA 2Z6KA 3E0JA 1G291 3NP8A 1VQLA 3HOXG 3RD4A 1PH7A 3P7JA 4JI6L 1IHZA 1Q82C 5C44G 2I0QA 5M9OA 2WB1E 1N36L 2D62A 1D5MC 4HCEA 4O0AA 1EYDA 1K0SA 4DR7Q 1QWYA 3I2ZA 2EYHA 4H0LC 1KNAA 1XTDA 2BDNA 5GADC 3S2DH 1Q46A 1DZ1A 1H9KA 4UDUC 3PGZA 5DLQE 2B63H 4MN3A 5IGEA 4LFBL 1PH9A 2JA7B 2ZXOA 3ITPA 2QKIC 4OO1I 5K36H 4DAVA 4A3DH 2K6AA 2AWNA 2HT1A 4GNXB 3DXJC 2KUMA 1B4OA 2EYOA 1K0RA 4FYDA 1NR2A 3S14H 3R93A 2GN5A 1I4RA 1R4PB 1F9QA 1V43A 2Q2TA 1CQFA 3PO3G 5BR8L 3EROA 2I5HA 2R61A 1D5ZC 3FHWA 2F0MA 2JE6I 4DPGA 1Y8NB 1C8CA 4C56C 4CKEA 4QGUA 1JJ2A 3X3MA 4GNXA 1PTOF 3T51B 2N88A 1TS2A 3HOZG 5HURA 4KKSA 4H02A 4A3CG 1AH9A 4JOIC 4WFN3 1VQFA 4X66Q 1PTOB 2XGTA 3IKJA 4A3BH 4XT3B 5C4XB 1YHQA 3O13A 5M5XB 1TS3A 2TMPA 1PRTD 1EQRA 5DNFA 3QIAA 4LJZC 4IPCA 1CQVA 4ZQ3A 3FPUB 2R93B 3BS1A 3DM3A 5I2XA 4GN5A 2O5JC 1X32A 3T4AC 1VQGA 4I7AA 1NY4A 3PUZA 5C3EH 3A5UA 4QCLA 1ZKOA 4K6LA 3U4ZA 1JOQA 1H95A 3E9IA 3H3VH 5FK9C 2E2JB 4DR2L 5M5YH 3H6MA 1PH4A 2X6GA 1GUNA 1UE7A 3M4YA 1YBYA 1HPCA 4QL5A 2MGSA 3N52A 2H4OA 4HSVA 3T56B 1AW7A 3I4LA 3TN2A 4K0KL 1BVSA 2OF1A 3GD7A 2IY5B 1XMOL 1V1QA 1YNJC 1VS0A 3S16B 3G6JB 2F0TA 4MTNA 2B39A 1RCVD 4HIDA 2ZXPA 4NXNQ 1RTOA 1SLJA 2PO4A 2OQ0A 1GUOA 5FOBB 3CF5A 1JC7A 1XPUA 1RD9D 2O5IC 1BQQT 2L15A 5CBEE 4PZ6A 2A6HD 1N32Q 2R7ZH 5EKLA 4FP5D 4DA2A 4IPGA 2G9HD 4DAPA 1EY8A 5HY6A 4G57A 1EUJA 4DR4L 3M9BA 1SEBD 1S5FD 1UEAB 3K7AH 1B3AA 2J4XA 3EN2A 3ONAB 1IBLQ 5C4JH 1K83B 3EQLC 3K59A 1O7YA 4P74A 5E1FA 1PTOD 1HZCA 1U4MA 3G4SA 2F0WA 4ZYSA 3RLOA 2RCFA 1CFMA 4XYQA 4IFDJ 1F77A 1LTGD 2DNCA 3PUXA 5GAEC 1MD2D 3GTQB 1PZKD 1STYA 3BZCA 3STBC 4DR7L 2JA6H 4A3EB 1VQMA 5C6AA 1BBXC 4C1NI 2MUYA 4DV1Q 1VQ9A 3LGJA 1AZQA 5IP9H 1HZ9A 5KIXA 1TWAB 3Q24A 4A3IH 3SK4A 1E22A 1L0YB 2LXJA 2Z6BA 4FO2A 4JI3Q 3U9OA 1UE1A 2CWPA 4LUZA 3BVGA 2XN9C 2KCTA 3UE1A 5JPNC 1Y1VH 1Z6HA 3HGBA 4IFDI 1XPRA 1B9MA 1DGSA 3RZDH 4A3JB 1PH1A 4A3DG 1B8AA 3FPPA 1C7YA 3I4NB 2NZOA 2QGQA 1QNKA 2A5HA 4KY7A 1WTQA 3SR1A 4KHVA 2A69C 1KTKA 2IX0A 1WCMH 1O80A 1CI3M 1VCIA 4IUTA 1SFOB 2JJQA 3M3YB 2DY8A 1ICWA 2UXDQ 1QCBD 3VA7A 3HOVB 2WKCA 3K0YA 2RDGA 4YCVA 3ER0A 3KOJA 4HJ8A 2E5LQ 4F88A 3K57A 4GN4B 1QE6A 3OWFA 5I9PA 4KK7A 5BN5A 2VQEL 4X66L 2DUDA 1PYBA 2F0SA 4M8AA 5ELNA 1U9RA 1ML0D 2WFWA 2IWHA 3M4OH 3UI2A 4C3HH 2LFNA 4OEMB 1TS4A 2QEJC 4XXEA 1FNVA 3GTPH 3I70A 2HUGA 5KNBA 3ZYYX 2NVYB 5CGKA 5FO8B 1KRTA 1SRUA 3MWYW 4A3BG 4TKOB 4KD4A 5AJ3Q 1LTRD 2PMZE 2EQSA 2RBMA 1SYGA 1FGBD 1PZJD 4G7OC 1I94Q 3KBGA 1X65A 1G6ZA 2Q2HA 2IW3A 1OXXK 4HSPA 4ZAIA 1DCZA 5BN3A 5J39A 4L5QA 2IJ0A 2EPBA 5CBAE 5KNCA 1LTID 1EWHA 2PCFB 4LF9Q 1N33Q 1G6PA 2BDOA 2SDFA 2ZXRA 4HMJA 4IALA 5C3EG 2KJXA 3SEBA 4PMBA 1Y1WB 1B50A 1O78A 1FVIA 2CH4W 4R4CA 3T13A 4QUFA 5E4XA 2QDLA 5IT9c 2OTLA 5FLMH 4RHSA 4JK1C 1HXYD 3MEFA 2CFMA 1B2TA 2WAQG 3Q6SA 3J80i 4NXMQ 2M2LA 4CKBA 4CHTB 1OXSC 1QNUA 3FP9A 3MAQA 1SDFA 1LT4D 4NXNL 1DM0B 2R92B 5C3XA 1QJOA 3DWAA 1GUGA 3W3AA 4RWSC 1S72A 1EYCA 5EBCA 4KJNA 4JI7Q 1PFNA 4R4QA 2L9HA 2F0JA 1N32L 3I72A 3E5SA 4XDXA 1CHQD 4AH6A 4BA2I 1LABA 3T1HQ 3RN5A 3I4MB 2BA1A 4A3KB 1DYQA 1JICA 1MJEA 5JEAJ 2NN6H 2R7ZG 2EJGC 2E2HB 1IBLL 3AEVA 4JBJA 2B2YC 2EIFA 3C46A 3AU7A 2LS01 4ABNA 3CKIB 1I50H 1SE2A 3HKZE 1ONLA 4R8NA 1QB5D 1S5CD 1ZYRD 1VQBA 3MXUA 1TWFH 2CKZB 1VQ7A 5A35A 4DNRB 1VQ8A 2PYKA 1MSHA 4A75A 2NVQH 4OIKA 4LFAQ 5IYDH 3E3XA 1B7YB 1YNND 4DV1L 1KAWA 3CP0A 1IL2A 4EGVA 5M5WH 2EXZA 3WOEA 4AYBB 5IT9E 4UP9A 2JA6G 4JI3L 2NVXB 2EYFA 1G51A 1CSPA 3FVQA 1X54A 5IP9G 3BG3A 1IKMA 1RL2A 1EQQA 3BJUA 3Q23A 3B6YA 1I3QB 5CV4A 2YU9H 1A62A 3GTLB 1EYGA 4U68A 1HJPA 5ELBA 2B8GA 2E2IB 2JEAI 3I56A 1NCVA 4KHZA 4MNOA 1GUTA 4C3IB 4K8IA 2OXPA 4K5XA 2JA5B 1SYBA 2HIXA 5LL6X 4KN7C 3U9SA 4MHEA 2UXDL 3G6EA 4RGTA 2VUMH 2WINB 4LF7Q 3SK5A 2F03A 3EA6A 4OX9Q 2E5LL 4H44C 3BZKA 4HAEA 5M3MB 1F2ZA 2K5NA 3S2HB 5BN4A 3MVVA 1NE3A 2CH4A 1Q3LA 4LMQD 4TVAB 4OO1G 3S1RB 3RZOB 1LTTD 2Z1CA 2RA4A 5EGTA 4BS9A 2RVLA 2KA7A 1SYDA 1G8ZD 1RODA 2K14A 4DNIA 4RMFA 5EQ0A 5C4HA 4G7ZC 4JI1Q 1DXMA 2KECA 1GOZA 3PUYA 4CKCA 4A3GG 3GTKH 5J3BA 1E24A 1SYFA 4C3HG 3HOXB 4KD3A 4TRDA 5AJ3L 1HNZQ 1VQNA 5D65A 1I94L 4NMZA 1CKOA 1EOTA 2RSOA 3MC0B 3OW7A 5I2YA 3VR6A 2EE1A 2KOLA 1M1KC 1U4RA 2K1BA 4IUNA 1AE2A 1FYCA 4B9WA 1Q12A 1OXTA 3A0JA 4LF9L 4DFAA 1N33L 5FJ8H 2AQ2B 1TWCB 2Q8IB 4JYAQ 2WKDA 2F0PA 1YNXA 3KLWA 2BE5D 1Y8PB 2PQEA 2CW0C 1K3RA 3TZUA 2WIIB 4BA1I 3BVMA 4L5RC 2KBNA 1Q1BA 5CV7A 2Y0SE 2RHSB 5EPLA 1YHAA 1PMRA 3UDXA 5JVG3 4I7ZC 3UDIA 3I55A 3S1MH 5C0XJ 5JJLA 2UUAQ 4NXML 4OL7A 1IW7D 2SOBA 4B3TQ 3K5OA 3PO3B 1QUQB 3TP7A 2DNEA 4NKLA 5I6YA 5FLMG 2F0FA 1STAA 3PQIA 4RFBA 4JI7L 3A56A 1HA5A 1RIPA 1YJNA 1STGA 1O7IA 1E2WA 1KL9A 2V4DA 4IPHA 5D3IB 3HOZB 5KGUA 1EY0A 1ILQA 3W1BA 1VQKA 2YTXA 3H0GH 4B08A 3T1HL 4Y7NB 4DK0A 3KJOA 2JA7H 2OTJA 2B2TA 3VR3A 2N78A 2AUJD 3QB3A 4RAUC 1QUQA 1UWVA 1SNMA 2YV5A 5DAUA 5C0XI 5GAHC 1TS5A 1K28A 4XTCS 5E7NA 4C2MH 1RJTA 1BNZA 2F0HA 2B29A 1X3GA 5D14A 1QILA 4ZRZA 1TXYA 2NTSA 3K5LA 1D7QA 2NN6G 2OEOA 1UAPA 4B3SQ 4IUPA 3DEPA 3CRLC 2PZTA 2LSSA 2IHFA 5H1SE 4PG3A 1QOHA 1MIUA 4A3LH 2QDBA 4DV7Q 2FXQA 4LFAL 2CCZA 1QG7A 1KD1C 5I4DA 1CA5A 4DUZQ 4LK1C 4G7HC 1LACA 1E0BA 1Q90A 4F7XA 1HR0Q 3GV3A 4JI8L 3VA5A 2UXBQ 3EVQA 1WTRA 1D2BA 5IYDG 1Y14B 2BOSA 4NPSA 4IUQA 1PTOH 4DR1Q 3S1QB 3KYHC 3PMFA 3PO2H 2EVBA 1KDBA 3J81i 3T1YQ
chains in the Genus database with same CATH topology
2QW7A 2Z9HA 4I7AA 2HD3A 4N8X1 2RCFA 4N8FA 5L37A 4JW0A 4JVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW7 A;  2Z9H A;  4I7A A;  2HD3 A;  4N8X 1;  2RCF A;  4N8F A;  5L37 A;  4JW0 A;  4JVZ A; 
#chains in the Genus database with same CATH topology
 3OHX C;  1JR0 D;  1CM9 A;  1X56 A;  2NZH A;  3S17 H;  4HN7 A;  1NJI C;  1IYJ B;  1BCP D;  3WWV A;  3GTJ B;  3H15 A;  3GO5 A;  3D3R A;  4OWX B;  3MFG A;  1CK1 A;  2ZTE A;  1HHV A;  5IOC A;  3VR4 A;  3CCJ A;  5JEA H;  1HNX L;  4POF A;  3GDE A;  1PYW D;  4QMG A;  5COY A;  4HJA A;  1YI2 A;  1SJE D;  4JOI A;  2PMZ B;  4N9T A;  3CQZ B;  3CCU A;  4CJ0 B;  5IYB H;  5IYC G;  4LF7 L;  2DY7 A;  4GN3 B;  4OX9 L;  1VQ6 A;  3IAY A;  3KLS A;  1LTB D;  3QJY A;  2IX3 A;  2PW7 A;  1EQT A;  1PDQ A;  2RSN A;  4H7B A;  1TWH B;  2K03 A;  3GP7 A;  2VUM G;  3NSW A;  4HR7 B;  1KLG D;  3KLR A;  4PQX A;  4BY1 B;  4AYB E;  1PRT C;  3F8T A;  1R9T H;  1JMC A;  4NB3 A;  2BH2 A;  3S16 H;  2Z0S A;  1SJH D;  4JI1 L;  1MJC A;  4IFD G;  4JW0 A;  5FKA C;  4HJ9 A;  2I5L X;  4OON A;  3I91 A;  2ZTD A;  4DNT B;  3S1N B;  3FMC A;  1HNZ L;  1CKM A;  3CPW A;  3NK9 A;  1S5E D;  4C1N K;  1BKB A;  2JP1 A;  4YWM A;  1GHJ A;  4X6A H;  1ENF A;  2J0T D;  1VMP A;  1LT3 D;  2NWG A;  4WJ4 A;  5M3F H;  5FO9 B;  1QVG A;  4XYO A;  4JYA L;  1A2U A;  5KEE A;  4BWG B;  2AKW B;  3S2D B;  2ZTC A;  1EWI A;  4A3F B;  2B63 B;  3OIQ A;  1ZEQ X;  2Q8T A;  5FJ8 G;  2O2L D;  1WTW A;  1ZXT A;  3I3C A;  4IPD A;  4L8J A;  3TME A;  4AQY L;  1VQ5 A;  4KKT A;  1FL0 A;  2P5Z X;  4DV6 Q;  2UUA L;  4A3D B;  2IX1 A;  2K4K A;  3CW2 C;  3HKZ B;  5IIF A;  1CZG A;  4UY8 C;  4GZY C;  1MHW C;  1DOL A;  4O42 A;  3Q22 A;  4UP8 A;  1DOK A;  3ULJ A;  4C3J H;  2OQK A;  2AUK A;  3S14 B;  3QOL A;  1D8L A;  3KF8 B;  4V0B A;  5EPJ A;  4JBM A;  1SRO A;  4B3M Q;  2A6H C;  4DN4 M;  4GKK Q;  4A3E H;  5IGB A;  3MTS A;  3CCE A;  4PMW A;  3D31 A;  3TQY A;  3NEL A;  3KK7 A;  1NMF A;  3U58 A;  3LX0 A;  1I4P A;  5CV9 A;  1G2S A;  1ESF A;  4OIJ A;  3SVM A;  5TSS A;  3M4Q A;  4LFC Q;  4BY7 B;  1WTV A;  1VQD A;  2ID0 A;  3KF8 A;  3H0G G;  4FXK C;  1J9O A;  2JA7 G;  2O4X A;  4A3J H;  1TY2 A;  4IQZ A;  4R4O A;  2N55 A;  2PZW A;  4RCO A;  1I6V C;  4B3S L;  3LWE A;  4X65 Q;  2VB2 X;  1MGS A;  5G3L F;  1JWS D;  4L5T A;  4CGY B;  3HOU H;  1K8M A;  2R3Z A;  3GTM B;  1A3U A;  1A3T A;  1S40 A;  2B2V C;  4DV7 L;  2HCI A;  1TWG H;  5L37 A;  4DUZ L;  3L7Z C;  4OEL B;  3JAM i;  1XYI A;  1QZH A;  3A74 A;  5T1G A;  4GKJ Q;  3CAM A;  1CHP D;  1XX8 A;  1HR0 L;  1F9S A;  3HG9 A;  4A3L G;  1SYE A;  1FJG Q;  2J7Z A;  2UXB L;  4K8J A;  2XIW A;  3U50 C;  2EYJ A;  5JPM C;  2F0E A;  4DR1 L;  5I6W A;  1PV4 A;  1HNW Q;  1F2Y A;  5EPK A;  1SNP A;  3SHL A;  1XNQ Q;  3T1Y L;  3TRZ A;  2L5T A;  1XMQ Q;  4A76 A;  4Y52 H;  1ET9 A;  3OPO A;  2WAQ B;  3D4R A;  2NVY H;  2JQO A;  2WP8 J;  3CHB D;  1HFN A;  4HCS A;  3ICE A;  2F0L A;  1UE6 A;  2ZJP A;  3PO2 G;  1ET6 A;  4JVZ A;  1M4V A;  3HKS A;  2B8F A;  3BYT B;  4JV5 Q;  3M4P A;  3F2C A;  3PIO 3;  1HTP A;  1VQC A;  4QJF A;  3F1Z A;  4X62 Q;  1WOC A;  1E1O A;  4LAA A;  2L12 A;  4DR3 Q;  4JI0 Q;  1I4G A;  1F9P A;  4XQJ A;  4JC0 A;  1I6H H;  2F1M A;  3BDL A;  5JEA G;  1EY5 A;  1FR3 A;  3W1G A;  4EX5 A;  4KMU C;  1PH3 A;  1C48 A;  2L4N A;  2EJF C;  4POG A;  1SMX A;  3HEJ A;  2R7Z B;  1A2T A;  2MHV A;  2Z8L A;  4L5S A;  3G48 A;  5IYB G;  4OO1 H;  3ND8 A;  2K5Q A;  5C4Z A;  3W5O A;  5A2Q E;  2UUB Q;  4B9X A;  2JA8 B;  3BDO A;  2Y0S B;  1JJG A;  3KBX A;  4XT1 B;  3H3V C;  2RHQ B;  1A3V A;  1HZA A;  1HR0 W;  3JAM L;  1LYL A;  3IL8 A;  5IGF A;  4A3G H;  4DK6 C;  2JSO A;  2WAC A;  3SK8 A;  1VQI A;  1NNX A;  1SAP A;  4KY5 A;  1HRJ A;  5CR3 A;  1TQO A;  4BBR H;  3ULP A;  3M7N A;  2C35 B;  3A54 A;  1BDO A;  2F0I A;  3HOW B;  1GVP A;  1JQY D;  4BBS H;  1X3P A;  3Q0A A;  4LF8 Q;  3S15 H;  2VS1 A;  3D4D A;  1F9R A;  2K32 A;  4H13 C;  1AZP A;  4QB4 A;  2JA6 B;  4LNQ A;  3C1E A;  4A93 H;  4DXF A;  3K8A A;  5M3F G;  5KYI A;  1X55 A;  5EAY A;  4RCN A;  1ASZ A;  2NUC A;  4YCW A;  3V05 A;  4NW2 A;  1Z47 A;  4A3I B;  3MFY A;  3NEN A;  4DV6 L;  2A68 D;  4DV4 Q;  3D4W A;  1TT2 A;  1EEI D;  1X6O A;  2Q2U A;  1KDA A;  4PNY A;  5LL6 S;  4KHP Q;  2QEX A;  3TDQ A;  3CCQ A;  5NUC A;  1Y1V B;  1K8A C;  3DEO A;  3JC6 6;  3HOY B;  3RZD B;  3KDF B;  1HFG A;  4X3K A;  3ND9 A;  1WD0 A;  4GKK L;  4IUV A;  2D5D A;  1PH2 A;  4M1U B;  4HIK A;  2C9O A;  2KCN A;  4C3J G;  5FO7 B;  4DV5 Q;  1VQO A;  1WCM B;  1IBM Q;  1Q8I A;  2B2Y A;  5GRO A;  1WTO A;  1LTA D;  3CME A;  4JBK A;  2F4V Q;  1WVL A;  4RGN A;  1S5D D;  4A3E G;  4WRD A;  3J7A V;  1I4H A;  5LMU Q;  3K7U C;  3MXN B;  4PZ7 A;  1RHP A;  3AFQ A;  2YYZ A;  3D6C A;  3DWQ A;  4MIU A;  4LFC L;  1Q86 C;  3RMH A;  1YZ6 A;  3CCL A;  2K01 A;  2GVA A;  3KDF A;  2NVT H;  2ICI A;  2QCP X;  3A7A B;  3FKI H;  2UU9 Q;  2K50 A;  1Z9F A;  2DJF C;  2K5H A;  1LTS D;  1PFS A;  3CCS A;  2VQF Q;  4X65 L;  3M4O B;  4DV0 Q;  1HH2 P;  3GTO H;  4RH6 A;  2VNU D;  1M8A A;  1NUC A;  1DON A;  1PH8 A;  1EYA A;  4A3J G;  3G71 A;  1SYC A;  4FF3 A;  3NEM A;  1N34 Q;  1PHJ A;  3MXN A;  1YNN C;  3SXH A;  3W2D A;  3U4V A;  3NBH B;  3HOU G;  2PI2 E;  1BF4 A;  4GKJ L;  3CCV A;  1MSG A;  3BVZ A;  1E7Z A;  2GA4 B;  2ZJQ A;  1FJG L;  1J6Q A;  1EIH A;  1XJV A;  4R8I A;  2SEB D;  3S1R H;  3RZO H;  1E1T A;  2XRQ D;  1Q8K A;  3R3O A;  1KC8 C;  4P75 A;  2A8V A;  4EQO A;  5C0X G;  4E6I A;  2VB3 X;  4LF4 Q;  1XNQ L;  3VYT A;  1BXT A;  2F3I A;  2KVM A;  2NYZ D;  1XMQ L;  5IWA Q;  3HRZ C;  4X64 Q;  3J80 L;  3M85 A;  1YJ9 A;  5GQO A;  5CV8 A;  1PFB A;  2ATW A;  3C2P A;  3NBH A;  5A2Q L;  2KCC A;  4K6D A;  4ALP A;  3GTG H;  4PV1 C;  2RDH A;  4P72 A;  3TP6 A;  3K58 A;  4JV5 L;  2ZT9 C;  4DV2 Q;  3T53 B;  3VR5 A;  4X62 L;  1AE3 A;  4FNF A;  2FFK B;  4K5W A;  4WJ3 M;  1Q81 C;  4DR3 L;  5CV6 A;  5T1I A;  1EY6 A;  5JOB A;  3R2T A;  2V1C C;  3TBI B;  2MJ8 A;  4CDE C;  5IYC H;  5C5M A;  3CCR A;  4ME3 A;  2XWB B;  2Z9H A;  1JB7 A;  4LUV A;  2I07 B;  2AQ1 B;  1A63 A;  3HS0 C;  2XNA C;  4J15 A;  3TP8 A;  4OHJ A;  4JI5 Q;  2UUB L;  2K5W A;  2MQH A;  5IGC A;  1WTH A;  3HFZ B;  1JE5 A;  4X3U A;  2BA0 A;  4QQB X;  4X3T A;  5ISR A;  3UDF A;  5CYU A;  1HZB A;  5JJK A;  2ICE C;  4GOP C;  2R6G A;  4KTA A;  4K2K A;  1WFQ A;  4IOC A;  4IFD H;  3PIP 3;  1A6X A;  2WAQ E;  4QY7 A;  3RN2 A;  3QWN A;  1W6J A;  3TP5 A;  5KYL A;  1KAB A;  1TWF B;  5BR8 Q;  2R92 G;  3V96 A;  1U4L A;  2KQ3 A;  4LF8 L;  2F3W A;  2XTI A;  4DV3 Q;  2F0K A;  1SMY D;  4Y7N H;  4IN3 A;  2NB0 A;  2NVQ B;  2BE5 C;  4BBR G;  2ZJR A;  5C44 B;  3VR2 A;  2WB1 G;  4BBS G;  1GJX A;  4EQP A;  4FDB A;  1U4P A;  1J5E Q;  3DWP A;  2MPM A;  2F0Q A;  5M5W B;  1KRS A;  2PNH A;  3AYH B;  2I5M X;  2K04 A;  1IW7 C;  3H3V I;  4DV4 L;  1N9W A;  2VL6 A;  5IP7 H;  4A93 G;  4CJ2 C;  1VMC A;  3CC7 A;  4A3M H;  4KHP L;  1KHI A;  3Q8D A;  2EYP A;  1JCK B;  2YU9 B;  1BBU A;  4YWK A;  4DK1 A;  5IE8 A;  4KY6 A;  3AFP A;  1IBK Q;  1NTG A;  5ELE A;  5C5L A;  3DMU A;  1IBM L;  4I65 A;  1XPO A;  4YY3 Q;  1OXU A;  2B2U C;  1X3Q A;  3ERQ A;  1CT1 D;  2L1B A;  3J81 E;  3OW2 A;  2RDF A;  1WJJ A;  2QF7 A;  4ZCK A;  2B2W C;  5LMU L;  2HIV A;  1VQJ A;  4DR6 Q;  3J7A F;  1LT5 D;  3H09 A;  4DR2 Q;  2EYM A;  2VUM B;  5LMN Q;  1RTN A;  4N8F A;  3L2P A;  1JWU D;  1PXU A;  4IOA A;  2F0U A;  1STE A;  3EFX D;  1HTL D;  2UU9 L;  2XRS D;  1STH A;  2K75 A;  4FF2 A;  2CW0 D;  2TSS A;  1SN8 A;  2VQF L;  4DV0 L;  1L1O C;  4JCV E;  5J22 A;  2EDG A;  4YHH Q;  3NQT A;  3FKI G;  3ULL A;  1UNS A;  4DAY B;  1N34 L;  2A6E D;  1KNE A;  4S3S A;  5F2D A;  4EQN A;  3GTK B;  3VYS A;  3CQZ H;  2KEN A;  2VZA A;  2EYL A;  1KAA A;  1W3S A;  2ALY B;  2NBF A;  2E75 C;  3D0F A;  1T9H A;  1TVX A;  1W2B A;  3AB9 A;  3P20 A;  1ILP A;  2A19 A;  4Z9C B;  4DKA C;  3RNU A;  2G5D A;  1TWH H;  1A15 A;  2D0O A;  1MI2 A;  4LF4 L;  1L2F A;  1Q7Y C;  3J7A 5;  5CMD A;  1FGU A;  1SE4 A;  3OIP A;  1V8Q A;  5FLX E;  5M3M G;  4DAY A;  3CCM A;  4X64 L;  2EOT A;  1LTL A;  1IKL A;  3P75 A;  1BCP C;  2AQ3 B;  5E3F A;  3NHH A;  4PZ8 A;  3RUZ A;  5C4X H;  1SBB B;  4KV6 A;  1KLU D;  5M5X H;  4DV2 L;  3LNN A;  1VQE A;  1JT8 A;  1CA6 A;  3CC4 A;  4IUU A;  3MEH A;  2KEE A;  3JAM c;  1S3O A;  2X69 A;  3NE5 B;  2R93 H;  3J7Y W;  5J1Z A;  1VQ4 A;  4DU9 A;  3A7L A;  2HHH Q;  1B1Z A;  2F4I A;  3ERS X;  1T5E A;  3I90 A;  1HUN A;  4LF6 Q;  4A3F H;  1SNC A;  4UAI A;  4JI5 L;  1B70 B;  2RQX A;  2E2J H;  3J81 j;  3H0G B;  3MZ5 A;  5DEH A;  1C9O A;  2Z6K C;  3OMC A;  3SK6 A;  4GLV B;  4C2M B;  1PLF A;  3SDZ A;  2K33 A;  1C0A A;  3K80 C;  3K5M A;  3D8G A;  2LXK A;  2DJG C;  5JJI A;  1X3F A;  2H5X A;  1D6E C;  4OGQ C;  4HJ7 A;  4N8X 1;  2D2C C;  3MA2 B;  4DV3 L;  1STB A;  5ELF A;  2RKS A;  3TSS A;  1NR4 A;  1Q1E A;  4RA8 A;  1PH5 A;  1JE4 A;  3KF6 B;  5K5P A;  1VF5 C;  1J5E L;  1K73 C;  4BY7 H;  1CUK A;  4IUR A;  2Q2I A;  1V9P A;  4AIM A;  3J81 L;  4FF4 A;  3FDT A;  5EBD A;  1BR9 A;  4OWW B;  2FHT A;  2VQE Q;  3A55 A;  3NPP A;  1E2V A;  1EQV A;  1ASY A;  1X9N A;  2SNS A;  2F0N A;  3PO2 B;  1CZW A;  1NAP A;  4K5V A;  1YVC A;  3K6O A;  3GTM H;  3ZJY C;  4U67 3;  3VYR A;  1CTM A;  1B3Q A;  1K83 H;  2ASB A;  2I46 A;  3JAM E;  4GNX C;  4HIO A;  3S17 B;  3KF6 A;  5IP7 G;  3K5N A;  4MZ9 A;  3HP3 A;  2VW9 A;  1EY4 A;  4B3T L;  1IBK L;  1LM0 A;  4A3M G;  2FMC A;  2Q8R E;  4R1J A;  1KIX A;  1K8O A;  1IYV A;  1I5F A;  1V1P B;  4YY3 L;  2EY6 A;  4ILW A;  4DXG A;  2E2D C;  3GTQ H;  2N8N A;  1Y69 U;  4IJH A;  4JI4 Q;  4DR6 L;  1DOM A;  5LMN L;  2MO0 A;  4FF1 A;  1EY9 A;  2NZ1 D;  1TWA H;  3TS0 A;  1EY7 A;  2HDM A;  1DJR D;  2CVR A;  3CC2 A;  1JOO A;  2B2V A;  5DM6 3;  3CXC A;  1GKH A;  2NTT A;  3IRB A;  5FLX L;  1V1P A;  1OTC A;  1R9T B;  1GUW A;  2NN6 I;  4YHH L;  2PI2 A;  1PTO C;  3J80 c;  3F2B A;  1G2T A;  4RHR A;  4NDX A;  1HQR D;  1SE8 A;  4ZLT F;  4JG2 A;  3HZX A;  3I4N H;  3DLL A;  1JOR A;  2SNM A;  2A1A A;  1EWC A;  1A8V A;  4A3B B;  1SSO A;  2KHI A;  5GAG C;  2JK8 A;  3R2I A;  3A8I E;  4IO9 A;  5EKK A;  1PZI D;  2MFI A;  5IGD A;  2UXC Q;  1YNJ D;  2BH8 A;  1SFO H;  1SE3 A;  3RLF A;  4KN4 C;  5I9O A;  5M3F B;  1K8G A;  3M3Y H;  4K2L A;  3HOV H;  2JA8 H;  4PMC A;  5C0X H;  1NMG A;  4CBV A;  2HD3 A;  4LUO A;  3PV0 A;  2MNA A;  3BU2 A;  5C3E B;  1YJW A;  4IZ8 A;  4BY1 G;  3PCO B;  4CDD C;  1Y8O B;  1YEZ A;  5M5Y B;  5IY0 A;  4KI0 A;  4QUC A;  4ODG A;  4QIW B;  1U5K A;  2XVS A;  5LMN W;  5JJZ A;  4B3R Q;  3HOW H;  1E3P A;  2N49 A;  4NP5 A;  1XNR Q;  4GS3 A;  4J1M A;  3A8K E;  3D6W A;  5DM7 3;  4C3J B;  5EKI A;  5C4X G;  1SND A;  2FIN B;  1D1K A;  2HQE A;  3C3L A;  4KLK A;  2ES2 A;  3E6Z X;  2HHH L;  1TY0 A;  3SE0 A;  4J6H A;  4DGZ A;  5JVH 3;  4LF6 L;  1JWM D;  1CSQ A;  3EBE A;  2MP1 A;  2R93 G;  1U0L A;  2KHJ A;  1UEB A;  2EY2 A;  2KED A;  4P2C B;  4DF7 A;  3L0O A;  3MXP A;  1I4Q A;  2K52 A;  3STB D;  1Y1W H;  4A3F G;  1XWE A;  2B63 G;  3J80 E;  1GUS A;  4R4I A;  3KJP A;  3OTO Q;  3HOY H;  5K36 G;  1EL0 A;  1HUM A;  3HKZ G;  4G4K A;  3J7Z C;  2UUC Q;  3P1H A;  3K7A B;  2Z4I A;  4F87 A;  1EZ8 A;  2JN4 A;  5C4J B;  4DK3 C;  2BCO A;  4ULL A;  2R92 H;  3HOU B;  2F0D A;  3A5Z B;  1GXD C;  1CKN B;  2YTV A;  5E4W C;  3F2U A;  2GVB A;  5KND A;  2M9V A;  1TWG B;  3I73 A;  2K05 A;  3NWS A;  4FXG C;  3H91 A;  2ENB A;  3FRP B;  3KUP A;  1STN A;  1E2Z A;  2A68 C;  2A69 D;  2HQL A;  5C3W A;  4L6T B;  3I4M H;  4A3K H;  1ICF B;  4RGO S;  5LHY 1;  1B53 A;  4LF5 Q;  2E76 C;  1H9J A;  4BY7 G;  5G3L D;  2E2H H;  1CKN A;  1K9M C;  1AN8 A;  4ZKB B;  4TSS A;  4HIM A;  4MTK A;  4JPB W;  1SNQ A;  4A4I A;  1SNO A;  2F3V A;  3RLN A;  1GHK A;  2WV6 D;  3C1F A;  4TQU S;  3G7L A;  4ME5 A;  4YCU A;  1M90 C;  4CDF C;  2EXD A;  1N8R C;  1UUP A;  3DUZ A;  2KHS A;  4JI2 Q;  1JB3 A;  1MBY A;  2HCC A;  4B3M L;  1T5X D;  3AMU A;  4O1N A;  3OMG A;  4JI4 L;  4RKL A;  3CU7 A;  3FEW X;  1K3B C;  1I6H B;  4DR5 Q;  4F8M A;  3PIO A;  1HQM C;  2F52 A;  3BZD B;  4WJW A;  1II3 A;  2M00 A;  4HMI A;  3IFD A;  3TS2 A;  1KDC A;  2NVX H;  3VYU A;  1VF7 A;  1VDZ A;  1RF2 D;  2EJM A;  3PF5 A;  4UHV A;  3AQQ A;  1I3Q H;  1ZYR C;  1WYD A;  2XSC A;  1RDP D;  3GTL H;  3PUW A;  4EQ5 A;  3I7F A;  1EEF D;  2D9U A;  5EJW A;  4DUY Q;  4A3G B;  2E2I H;  1TU2 B;  3IFT A;  1PA6 A;  3L3O C;  4C3H B;  4C3I H;  2JA5 H;  3TRE A;  4BBR B;  3GTP B;  3KFU A;  5CV5 A;  2UXC L;  1LO5 D;  5AFW A;  5ELO A;  1WTP A;  1QZG A;  2WB1 B;  4BXX H;  4BBS B;  4K14 A;  2CHB D;  3I4N G;  1JOK A;  3S15 B;  1SR3 A;  5HGQ A;  3M7G A;  2IT1 A;  4RKB A;  3UE0 A;  3S24 A;  2X6L A;  1X3E A;  4RGM A;  1NBW A;  4IJL A;  1FNU A;  2ZM6 Q;  2G9D A;  2N3S A;  1L0W A;  5COR A;  3NTI A;  1NSN S;  4GLA C;  5M3M H;  3S2H H;  4A93 B;  3X3N A;  1BBW A;  1GD7 A;  1ENA A;  4WOR A;  4YWL A;  3HOV G;  2JA8 G;  1BUV T;  1HNW L;  4OXP A;  3SGI A;  3K0X A;  4GOP B;  5CC4 A;  2Y0S G;  4XIG S;  3I8Z A;  2EY5 A;  1YIT A;  1VQA A;  2LKV A;  2FJ2 A;  4OWT B;  1EIY B;  4B3R L;  2KCM A;  2CQA A;  2MO1 A;  4JBW A;  1XNR L;  1EFI D;  3A8J E;  1P8L A;  1EU4 A;  1MKH A;  1LLR D;  3HOX H;  2E74 C;  4FVM A;  1AEX A;  3DHQ A;  4ZK9 B;  1PFM A;  5C44 H;  1F2L A;  3HOW G;  1QVF A;  1WD1 A;  4V19 0;  4GOP A;  1HA6 A;  1J8I A;  2DN8 A;  1XTC D;  2D0P A;  1PYS B;  4JI8 Q;  1B44 D;  2LY7 A;  4JI6 Q;  4KKU A;  4JI0 L;  5HGT A;  3CD6 A;  3E0E A;  2JA9 A;  4HED A;  2RF4 A;  1N36 Q;  1TWC H;  3NXW A;  1S4Z A;  3S9W A;  4CDC C;  3NBI A;  4APV A;  1FNW A;  1KQS A;  1RKN A;  2AHO B;  1A0I A;  2FMM A;  4ZKC B;  1AP0 A;  4A3I G;  3J81 c;  2NVT B;  1HCZ A;  3BDC A;  3OTO L;  4LFB Q;  3FKI B;  1VQH A;  4CJ1 B;  2UUC L;  3NUC A;  4L63 B;  1Y1W G;  2OCE A;  3PO3 H;  3GTO B;  3RR5 A;  4UP7 A;  1BOS A;  1W6K A;  5IGG A;  1LT6 D;  1SMY C;  1Y1V G;  3F2D A;  4QIW E;  3HOY G;  4XQQ A;  1HNX Q;  1I50 B;  1G91 A;  1TR5 A;  4HTH A;  2LMC B;  1PH6 A;  1DD2 A;  1D5X C;  1Z7T A;  4N9P A;  1ENC A;  1R4Q B;  3URY A;  1WCM G;  3L9A X;  1OO9 B;  1EIF A;  1L0X B;  3HOZ H;  2OT2 A;  2VXW A;  3EIV A;  3QG1 A;  4EVO A;  3K81 C;  4J8Q A;  2VY3 A;  4A3C H;  2QW7 A;  2R7F A;  3E9H A;  4DAM A;  2B3G A;  1IL8 A;  4LF5 L;  2F0G A;  3V2T A;  2PW5 A;  1H9S B;  4ZUI A;  3PF4 A;  4Q0F A;  2AWO A;  3KLS X;  3CMA A;  2C5C A;  2H1E A;  4FXD A;  3CPF A;  4R9W A;  4XQN A;  3I4M G;  1L1O B;  4A3K G;  2B2U A;  2K5V A;  5KRU A;  2HDL A;  1EZ6 A;  1KXL A;  4HJ5 A;  2EY1 A;  2IL8 A;  3OYY A;  2A73 B;  2A74 C;  1JJC B;  2IHE A;  3GV6 A;  1GO3 E;  2B2W A;  5ELC A;  1VQP A;  1TII D;  3GTG B;  4QF4 A;  5FLX c;  5IOD A;  2AMC B;  3WOF A;  2JYO A;  3EJI A;  4JI2 L;  2K5D A;  2K7V A;  3I4O A;  1EU3 A;  1H9S A;  3N6R A;  4P73 A;  3NTH A;  2EZV A;  1BCP F;  1IYU A;  1FD7 D;  2F0O A;  4DV5 L;  2DGY A;  1QVC A;  1L1O A;  3PUV A;  4DR5 L;  2F0V A;  2YTY A;  1YHB A;  3NQI A;  3OSO A;  1OXV A;  2F4V L;  3GQB A;  2RCN A;  2QIL A;  3NTK A;  3CRK C;  3S1Q H;  3VDY A;  1H9M A;  3QO2 A;  1YIJ A;  4AQY Q;  1BCP B;  4AYB G;  2A6E C;  4GLX A;  4LW1 A;  1GM5 A;  4X3S A;  1O7L A;  4RG1 A;  2OWO A;  3UDG A;  5ELD A;  4DUY L;  4K0K Q;  2XWJ B;  4ZUJ A;  2PQA B;  3QOJ A;  2JXM B;  2CWA A;  2IPK D;  3GTJ H;  1XMO Q;  4P71 A;  1IXR A;  1BO0 A;  1P16 A;  2PPB C;  3PSI A;  1B9N A;  4KJO A;  1EFW A;  3T16 A;  3PIP A;  2R7D A;  4C3I G;  2JA5 G;  3QR8 A;  3H94 A;  3R8B A;  1I4X A;  3MXG A;  1D1I A;  2ZM6 L;  1PRT F;  4BXX G;  1EIG A;  3BYY B;  2CQO A;  1LV9 A;  2QA4 A;  2K28 A;  2PQA A;  2Z4H A;  4YIJ A;  2PZU A;  5IT9 L;  3DM1 A;  1WTX A;  2L11 A;  1SXT A;  4BY1 H;  3MHB A;  1TKW B;  5JAV A;  4DR4 Q;  1C4Q A;  1EOV A;  1LUZ A;  1WI5 A;  3LWU A;  4UPA A;  1UE5 A;  3WDN A;  3OWE B;  1ESR A;  3TEH B;  5IWA L;  1XXG A;  3TZD A;  1AFP A;  1PRT B;  3OOC A;  1V1O A;  4ID6 A;  1O7Z A;  2PNR C;  4Q5V A;  4A3M B;  5D3D A;  1F2M A;  3S1N H;  1S5B D;  2E8G A;  1H9R A;  2B2T C;  4O2D A;  4R4T A;  3S1M B;  4LWC A;  2JEB I;  1IZ6 A;  2L0C A;  2L55 A;  3NWT A;  1PVO A;  2Z6K A;  3E0J A;  1G29 1;  3NP8 A;  1VQL A;  3HOX G;  3RD4 A;  1PH7 A;  3P7J A;  4JI6 L;  1IHZ A;  1Q82 C;  5C44 G;  2I0Q A;  5M9O A;  2WB1 E;  1N36 L;  2D62 A;  1D5M C;  4HCE A;  4O0A A;  1EYD A;  1K0S A;  4DR7 Q;  1QWY A;  3I2Z A;  2EYH A;  4H0L C;  1KNA A;  1XTD A;  2BDN A;  5GAD C;  3S2D H;  1Q46 A;  1DZ1 A;  1H9K A;  4UDU C;  3PGZ A;  5DLQ E;  2B63 H;  4MN3 A;  5IGE A;  4LFB L;  1PH9 A;  2JA7 B;  2ZXO A;  3ITP A;  2QKI C;  4OO1 I;  5K36 H;  4DAV A;  4A3D H;  2K6A A;  2AWN A;  2HT1 A;  4GNX B;  3DXJ C;  2KUM A;  1B4O A;  2EYO A;  1K0R A;  4FYD A;  1NR2 A;  3S14 H;  3R93 A;  2GN5 A;  1I4R A;  1R4P B;  1F9Q A;  1V43 A;  2Q2T A;  1CQF A;  3PO3 G;  5BR8 L;  3ERO A;  2I5H A;  2R61 A;  1D5Z C;  3FHW A;  2F0M A;  2JE6 I;  4DPG A;  1Y8N B;  1C8C A;  4C56 C;  4CKE A;  4QGU A;  1JJ2 A;  3X3M A;  4GNX A;  1PTO F;  3T51 B;  2N88 A;  1TS2 A;  3HOZ G;  5HUR A;  4KKS A;  4H02 A;  4A3C G;  1AH9 A;  4JOI C;  4WFN 3;  1VQF A;  4X66 Q;  1PTO B;  2XGT A;  3IKJ A;  4A3B H;  4XT3 B;  5C4X B;  1YHQ A;  3O13 A;  5M5X B;  1TS3 A;  2TMP A;  1PRT D;  1EQR A;  5DNF A;  3QIA A;  4LJZ C;  4IPC A;  1CQV A;  4ZQ3 A;  3FPU B;  2R93 B;  3BS1 A;  3DM3 A;  5I2X A;  4GN5 A;  2O5J C;  1X32 A;  3T4A C;  1VQG A;  4I7A A;  1NY4 A;  3PUZ A;  5C3E H;  3A5U A;  4QCL A;  1ZKO A;  4K6L A;  3U4Z A;  1JOQ A;  1H95 A;  3E9I A;  3H3V H;  5FK9 C;  2E2J B;  4DR2 L;  5M5Y H;  3H6M A;  1PH4 A;  2X6G A;  1GUN A;  1UE7 A;  3M4Y A;  1YBY A;  1HPC A;  4QL5 A;  2MGS A;  3N52 A;  2H4O A;  4HSV A;  3T56 B;  1AW7 A;  3I4L A;  3TN2 A;  4K0K L;  1BVS A;  2OF1 A;  3GD7 A;  2IY5 B;  1XMO L;  1V1Q A;  1YNJ C;  1VS0 A;  3S16 B;  3G6J B;  2F0T A;  4MTN A;  2B39 A;  1RCV D;  4HID A;  2ZXP A;  4NXN Q;  1RTO A;  1SLJ A;  2PO4 A;  2OQ0 A;  1GUO A;  5FOB B;  3CF5 A;  1JC7 A;  1XPU A;  1RD9 D;  2O5I C;  1BQQ T;  2L15 A;  5CBE E;  4PZ6 A;  2A6H D;  1N32 Q;  2R7Z H;  5EKL A;  4FP5 D;  4DA2 A;  4IPG A;  2G9H D;  4DAP A;  1EY8 A;  5HY6 A;  4G57 A;  1EUJ A;  4DR4 L;  3M9B A;  1SEB D;  1S5F D;  1UEA B;  3K7A H;  1B3A A;  2J4X A;  3EN2 A;  3ONA B;  1IBL Q;  5C4J H;  1K83 B;  3EQL C;  3K59 A;  1O7Y A;  4P74 A;  5E1F A;  1PTO D;  1HZC A;  1U4M A;  3G4S A;  2F0W A;  4ZYS A;  3RLO A;  2RCF A;  1CFM A;  4XYQ A;  4IFD J;  1F77 A;  1LTG D;  2DNC A;  3PUX A;  5GAE C;  1MD2 D;  3GTQ B;  1PZK D;  1STY A;  3BZC A;  3STB C;  4DR7 L;  2JA6 H;  4A3E B;  1VQM A;  5C6A A;  1BBX C;  4C1N I;  2MUY A;  4DV1 Q;  1VQ9 A;  3LGJ A;  1AZQ A;  5IP9 H;  1HZ9 A;  5KIX A;  1TWA B;  3Q24 A;  4A3I H;  3SK4 A;  1E22 A;  1L0Y B;  2LXJ A;  2Z6B A;  4FO2 A;  4JI3 Q;  3U9O A;  1UE1 A;  2CWP A;  4LUZ A;  3BVG A;  2XN9 C;  2KCT A;  3UE1 A;  5JPN C;  1Y1V H;  1Z6H A;  3HGB A;  4IFD I;  1XPR A;  1B9M A;  1DGS A;  3RZD H;  4A3J B;  1PH1 A;  4A3D G;  1B8A A;  3FPP A;  1C7Y A;  3I4N B;  2NZO A;  2QGQ A;  1QNK A;  2A5H A;  4KY7 A;  1WTQ A;  3SR1 A;  4KHV A;  2A69 C;  1KTK A;  2IX0 A;  1WCM H;  1O80 A;  1CI3 M;  1VCI A;  4IUT A;  1SFO B;  2JJQ A;  3M3Y B;  2DY8 A;  1ICW A;  2UXD Q;  1QCB D;  3VA7 A;  3HOV B;  2WKC A;  3K0Y A;  2RDG A;  4YCV A;  3ER0 A;  3KOJ A;  4HJ8 A;  2E5L Q;  4F88 A;  3K57 A;  4GN4 B;  1QE6 A;  3OWF A;  5I9P A;  4KK7 A;  5BN5 A;  2VQE L;  4X66 L;  2DUD A;  1PYB A;  2F0S A;  4M8A A;  5ELN A;  1U9R A;  1ML0 D;  2WFW A;  2IWH A;  3M4O H;  3UI2 A;  4C3H H;  2LFN A;  4OEM B;  1TS4 A;  2QEJ C;  4XXE A;  1FNV A;  3GTP H;  3I70 A;  2HUG A;  5KNB A;  3ZYY X;  2NVY B;  5CGK A;  5FO8 B;  1KRT A;  1SRU A;  3MWY W;  4A3B G;  4TKO B;  4KD4 A;  5AJ3 Q;  1LTR D;  2PMZ E;  2EQS A;  2RBM A;  1SYG A;  1FGB D;  1PZJ D;  4G7O C;  1I94 Q;  3KBG A;  1X65 A;  1G6Z A;  2Q2H A;  2IW3 A;  1OXX K;  4HSP A;  4ZAI A;  1DCZ A;  5BN3 A;  5J39 A;  4L5Q A;  2IJ0 A;  2EPB A;  5CBA E;  5KNC A;  1LTI D;  1EWH A;  2PCF B;  4LF9 Q;  1N33 Q;  1G6P A;  2BDO A;  2SDF A;  2ZXR A;  4HMJ A;  4IAL A;  5C3E G;  2KJX A;  3SEB A;  4PMB A;  1Y1W B;  1B50 A;  1O78 A;  1FVI A;  2CH4 W;  4R4C A;  3T13 A;  4QUF A;  5E4X A;  2QDL A;  5IT9 c;  2OTL A;  5FLM H;  4RHS A;  4JK1 C;  1HXY D;  3MEF A;  2CFM A;  1B2T A;  2WAQ G;  3Q6S A;  3J80 i;  4NXM Q;  2M2L A;  4CKB A;  4CHT B;  1OXS C;  1QNU A;  3FP9 A;  3MAQ A;  1SDF A;  1LT4 D;  4NXN L;  1DM0 B;  2R92 B;  5C3X A;  1QJO A;  3DWA A;  1GUG A;  3W3A A;  4RWS C;  1S72 A;  1EYC A;  5EBC A;  4KJN A;  4JI7 Q;  1PFN A;  4R4Q A;  2L9H A;  2F0J A;  1N32 L;  3I72 A;  3E5S A;  4XDX A;  1CHQ D;  4AH6 A;  4BA2 I;  1LAB A;  3T1H Q;  3RN5 A;  3I4M B;  2BA1 A;  4A3K B;  1DYQ A;  1JIC A;  1MJE A;  5JEA J;  2NN6 H;  2R7Z G;  2EJG C;  2E2H B;  1IBL L;  3AEV A;  4JBJ A;  2B2Y C;  2EIF A;  3C46 A;  3AU7 A;  2LS0 1;  4ABN A;  3CKI B;  1I50 H;  1SE2 A;  3HKZ E;  1ONL A;  4R8N A;  1QB5 D;  1S5C D;  1ZYR D;  1VQB A;  3MXU A;  1TWF H;  2CKZ B;  1VQ7 A;  5A35 A;  4DNR B;  1VQ8 A;  2PYK A;  1MSH A;  4A75 A;  2NVQ H;  4OIK A;  4LFA Q;  5IYD H;  3E3X A;  1B7Y B;  1YNN D;  4DV1 L;  1KAW A;  3CP0 A;  1IL2 A;  4EGV A;  5M5W H;  2EXZ A;  3WOE A;  4AYB B;  5IT9 E;  4UP9 A;  2JA6 G;  4JI3 L;  2NVX B;  2EYF A;  1G51 A;  1CSP A;  3FVQ A;  1X54 A;  5IP9 G;  3BG3 A;  1IKM A;  1RL2 A;  1EQQ A;  3BJU A;  3Q23 A;  3B6Y A;  1I3Q B;  5CV4 A;  2YU9 H;  1A62 A;  3GTL B;  1EYG A;  4U68 A;  1HJP A;  5ELB A;  2B8G A;  2E2I B;  2JEA I;  3I56 A;  1NCV A;  4KHZ A;  4MNO A;  1GUT A;  4C3I B;  4K8I A;  2OXP A;  4K5X A;  2JA5 B;  1SYB A;  2HIX A;  5LL6 X;  4KN7 C;  3U9S A;  4MHE A;  2UXD L;  3G6E A;  4RGT A;  2VUM H;  2WIN B;  4LF7 Q;  3SK5 A;  2F03 A;  3EA6 A;  4OX9 Q;  2E5L L;  4H44 C;  3BZK A;  4HAE A;  5M3M B;  1F2Z A;  2K5N A;  3S2H B;  5BN4 A;  3MVV A;  1NE3 A;  2CH4 A;  1Q3L A;  4LMQ D;  4TVA B;  4OO1 G;  3S1R B;  3RZO B;  1LTT D;  2Z1C A;  2RA4 A;  5EGT A;  4BS9 A;  2RVL A;  2KA7 A;  1SYD A;  1G8Z D;  1ROD A;  2K14 A;  4DNI A;  4RMF A;  5EQ0 A;  5C4H A;  4G7Z C;  4JI1 Q;  1DXM A;  2KEC A;  1GOZ A;  3PUY A;  4CKC A;  4A3G G;  3GTK H;  5J3B A;  1E24 A;  1SYF A;  4C3H G;  3HOX B;  4KD3 A;  4TRD A;  5AJ3 L;  1HNZ Q;  1VQN A;  5D65 A;  1I94 L;  4NMZ A;  1CKO A;  1EOT A;  2RSO A;  3MC0 B;  3OW7 A;  5I2Y A;  3VR6 A;  2EE1 A;  2KOL A;  1M1K C;  1U4R A;  2K1B A;  4IUN A;  1AE2 A;  1FYC A;  4B9W A;  1Q12 A;  1OXT A;  3A0J A;  4LF9 L;  4DFA A;  1N33 L;  5FJ8 H;  2AQ2 B;  1TWC B;  2Q8I B;  4JYA Q;  2WKD A;  2F0P A;  1YNX A;  3KLW A;  2BE5 D;  1Y8P B;  2PQE A;  2CW0 C;  1K3R A;  3TZU A;  2WII B;  4BA1 I;  3BVM A;  4L5R C;  2KBN A;  1Q1B A;  5CV7 A;  2Y0S E;  2RHS B;  5EPL A;  1YHA A;  1PMR A;  3UDX A;  5JVG 3;  4I7Z C;  3UDI A;  3I55 A;  3S1M H;  5C0X J;  5JJL A;  2UUA Q;  4NXM L;  4OL7 A;  1IW7 D;  2SOB A;  4B3T Q;  3K5O A;  3PO3 B;  1QUQ B;  3TP7 A;  2DNE A;  4NKL A;  5I6Y A;  5FLM G;  2F0F A;  1STA A;  3PQI A;  4RFB A;  4JI7 L;  3A56 A;  1HA5 A;  1RIP A;  1YJN A;  1STG A;  1O7I A;  1E2W A;  1KL9 A;  2V4D A;  4IPH A;  5D3I B;  3HOZ B;  5KGU A;  1EY0 A;  1ILQ A;  3W1B A;  1VQK A;  2YTX A;  3H0G H;  4B08 A;  3T1H L;  4Y7N B;  4DK0 A;  3KJO A;  2JA7 H;  2OTJ A;  2B2T A;  3VR3 A;  2N78 A;  2AUJ D;  3QB3 A;  4RAU C;  1QUQ A;  1UWV A;  1SNM A;  2YV5 A;  5DAU A;  5C0X I;  5GAH C;  1TS5 A;  1K28 A;  4XTC S;  5E7N A;  4C2M H;  1RJT A;  1BNZ A;  2F0H A;  2B29 A;  1X3G A;  5D14 A;  1QIL A;  4ZRZ A;  1TXY A;  2NTS A;  3K5L A;  1D7Q A;  2NN6 G;  2OEO A;  1UAP A;  4B3S Q;  4IUP A;  3DEP A;  3CRL C;  2PZT A;  2LSS A;  2IHF A;  5H1S E;  4PG3 A;  1QOH A;  1MIU A;  4A3L H;  2QDB A;  4DV7 Q;  2FXQ A;  4LFA L;  2CCZ A;  1QG7 A;  1KD1 C;  5I4D A;  1CA5 A;  4DUZ Q;  4LK1 C;  4G7H C;  1LAC A;  1E0B A;  1Q90 A;  4F7X A;  1HR0 Q;  3GV3 A;  4JI8 L;  3VA5 A;  2UXB Q;  3EVQ A;  1WTR A;  1D2B A;  5IYD G;  1Y14 B;  2BOS A;  4NPS A;  4IUQ A;  1PTO H;  4DR1 Q;  3S1Q B;  3KYH C;  3PMF A;  3PO2 H;  2EVB A;  1KDB A;  3J81 i;  3T1Y Q; 
#chains in the Genus database with same CATH homology
 2QW7 A;  2Z9H A;  4I7A A;  2HD3 A;  4N8X 1;  2RCF A;  4N8F A;  5L37 A;  4JW0 A;  4JVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...