2HD3A

Crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein eutN
total genus 11
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2hd3A00
2RCFA 4JVZA 2Z9HA 4N8FA 4I7AA 4JW0A 4N8X1 2HD3A 2QW7A 5L37A
chains in the Genus database with same CATH superfamily
1EYDA 1QB5D 1Y69U 4OO1H 2ZT9C 1PTOF 3A5UA 3LWEA 2J0TD 1HJPA 3P75A 2EY6A 1XMQL 1SLJA 3HOZB 1YNND 2EDGA 2LXKA 2RCNA 2N8NA 2YU9H 3ER0A 1QOHA 3HOZG 4IN3A 2Z0SA 4LF8L 1F9PA 4DKAC 1XMOQ 2M00A 4XQNA 4NW2A 3LNNA 2K03A 4CDFC 3I70A 4H02A 1CM9A 3S9WA 4BBSH 3WDNA 4HMIA 2E5LQ 1JOKA 2Q8RE 2K75A 2Z4IA 4A3GG 1PH8A 4IUQA 2DJGC 2CH4W 2RQXA 4MZ9A 3J80E 3VA5A 4YCVA 1U9RA 2VZAA 1O78A 2OT2A 5C4JB 1BCPC 1SNQA 4O2DA 1F2LA 5J1ZA 1BCPB 2UXCQ 3S1QB 3EBEA 2F0EA 5K36G 1TWGH 1VQ4A 2QCPX 1S4ZA 4H0LC 4QUFA 4IUVA 1CZGA 4IFDH 4C3JB 3HOUG 4K5WA 4GKJQ 2HUGA 5C4ZA 1EUJA 3CCVA 4A3DH 4DGZA 4OWXB 1I50H 4Q0FA 4ZAIA 2PI2E 2L0CA 4Y7NB 4B9WA 4IO9A 1B3QA 2GN5A 4KKSA 5D65A 3KLWA 1UUPA 4JBKA 1R4PB 3NTIA 3ND9A 1PLFA 4EQNA 4DV2L 2F52A 2MNAA 1NMFA 3X3MA 1TXYA 4FNFA 4AYBE 2MFIA 3DEPA 1EYGA 2V1CC 3WOFA 3KF6B 2MQHA 1RL2A 4ZUIA 2JN4A 2CFMA 4ALPA 1MGSA 4DV3Q 4X3KA 1KTKA 3STBD 4C2MH 2UUAQ 4HCEA 3PMFA 4DR2L 3KFUA 4MNOA 3E9HA 2L15A 3ERQA 5LL6S 1H9SA 1MIUA 4BA2I 4F88A 2E75C 5IYBH 2F4VL 4RAUC 4NDXA 1DYQA 3TSSA 4DR7Q 1PFSA 4YWKA 1EY6A 2PMZB 1X3EA 3QJYA 3VDYA 3ND8A 2FMCA 1HXYD 4IUPA 4JOIA 1RF2D 4NMZA 1A15A 3D4DA 4RGTA 1SNMA 4XQQA 2AWNA 3TDQA 4LF8Q 2IX1A 4A3IG 3S1RB 3KLSX 1M8AA 5F2DA 4Y7NH 1EY9A 1Z9FA 3K7UC 5T1IA 3NWTA 1BQQT 4DR6L 4EQOA 4DAYB 2GVBA 1PTOB 3S2DB 2IHEA 2QEJC 1HNXQ 3HOYB 2XTIA 5IWAL 3RZOH 1N9WA 2HCIA 4R4IA 4V190 2F3VA 3JAML 1VQ5A 1ZYRD 4WJ3M 1IKLA 4JI5Q 3FKIH 3EJIA 4KI0A 1PH4A 5C0XH 1SYDA 1SYFA 5C0XI 1MBYA 1U5KA 1Q82C 3T1HL 5FK9C 2E2HH 1QUQB 1VQGA 4IALA 4JW0A 4I65A 2NVTB 3Q0AA 1XX8A 2B2UC 3H6MA 4A4IA 4JV5Q 2ID0A 3I72A 1EY5A 2WB1B 5G3LF 3E9IA 3TP7A 1XPUA 4FF3A 1ZXTA 2C35B 3HG9A 3BZCA 5C3EB 1Y1VG 2K32A 3KBXA 3HOVG 1VQHA 2MO0A 1C0AA 3FRPB 4DV3L 2ES2A 1UWVA 1PH9A 2Q2UA 4JYAL 3NEMA 1A8VA 3CD6A 4RKLA 3NHHA 2WKDA 1N36Q 3MFYA 1PTOH 1ENFA 2Z6KA 2EE1A 5ELNA 1VDZA 3MXNB 1SYGA 1JORA 3T1YL 1GUWA 4JBWA 3S1NB 2JXMB 2NUCA 3AFPA 1SFOB 3BJUA 1OXVA 3IAYA 4WJ4A 5JVH3 5M3FH 3SE0A 3RD4A 3J7AF 4PQXA 1VQKA 3BS1A 1S5DD 1S40A 3J81j 1X3FA 5M9OA 1G6PA 4QUCA 1YHBA 2F0HA 3OSOA 2A6HC 1PYSB 4GN4B 4GNXA 1AN8A 5EJWA 1EOTA 2KCNA 3F2DA 4CJ0B 4AH6A 4L5SA 3J7A5 3SDZA 4R8NA 1J6QA 1ENAA 2AWOA 1H9RA 5AFWA 1SNDA 4UP7A 3SHLA 4CKCA 2R3ZA 2LS01 2WFWA 5JJIA 2HD3A 3K5LA 1LTRD 1NE3A 3CHBD 4OELB 1OXXK 5IWAQ 1MI2A 1IKMA 3ULJA 4LK1C 4V0BA 5EKLA 4DR3Q 2D5DA 1A6XA 1B2TA 1F2MA 2EYOA 3PUVA 3U9SA 5JEAG 1UE7A 1OTCA 1X9NA 3MVVA 1IXRA 4DV1L 1DZ1A 3GTQH 1PH2A 5CYUA 3HOWH 2O4XA 2WAQE 3F1ZA 4A3KB 2ICEC 1FR3A 1HZBA 4DR5Q 1C7YA 1O7ZA 3OWEB 3CU7A 1BDOA 2F4IA 3U4VA 1AH9A 1GVPA 3R93A 3UDFA 1QUQA 1XMQQ 5FLXL 4OO1I 1CKMA 4DK6C 4IFDG 2I5MX 1YBYA 4A3LG 1CT1D 1EQVA 2EOTA 3KJOA 1Y8PB 2J7ZA 4RHSA 1D8LA 3DUZA 2RVLA 2Y0SB 4A3DB 1HRJA 4A3CH 1BBWA 2JQOA 2ZTEA 1PTOC 4ZYSA 3I4MB 1PXUA 5DM63 2PW7A 1N34L 3O13A 5C3WA 4F87A 4KTAA 4DK3C 5M3MH 2UXBQ 1X56A 2IJ0A 4OEMB 2KHSA 2HHHL 3EIVA 3I4LA 2F1MA 1RD9D 4C3HH 2L55A 1PZKD 3FMCA 4KD4A 1HNZQ 2I0QA 5D3DA 3J80c 2XRQD 1DXMA 4KHPQ 1UNSA 3UE0A 1BBUA 2K33A 1S5ED 4JBMA 1SRUA 1GHKA 1VQFA 2A73B 3BDOA 1OO9B 3SEBA 2NN6I 3M4OB 3VYTA 1STHA 2F0OA 1E7ZA 4PV1C 2KEDA 3K58A 4JG2A 2DN8A 3NTKA 4JI6L 2K4KA 2JA7B 5IT9c 2OQKA 2IWHA 2KENA 4LAAA 4M1UB 4ODGA 3M4QA 1WD0A 4P71A 3HS0C 3F8TA 2HT1A 4A3EH 1KNEA 4BBRH 3L0OA 3DWPA 3FHWA 1NR2A 5NUCA 2BA0A 1K3RA 1ET9A 1YIJA 3VR5A 2VQFL 1SMXA 2A68C 4K8IA 1I94Q 4DR7L 4ZKBB 2OTJA 3OTOQ 1XNRQ 5FO8B 3PGZA 3V05A 2AUKA 2RDHA 3A7AB 4RGOS 1CSQA 3MEFA 3DM1A 3BVGA 1LUZA 4X66L 3HRZC 3K81C 5AJ3Q 5JJKA 1Z6HA 1HR0W 2PQAB 4NB3A 2D62A 2WKCA 1H9JA 1ESRA 2PZUA 3CKIB 2XRSD 4HIDA 3FP9A 3TP5A 5C3EG 3DLLA 3MC0B 2L5TA 2K52A 2KJXA 1QVFA 2O5IC 4QIWE 4UP8A 1VQIA 4YHHQ 2SNSA 4X62Q 4DV5L 4GKKL 2R93H 1WTOA 2PZWA 4B3TQ 1O80A 2NVXB 4UPAA 1Y1WB 3DHQA 3F2BA 4JI2Q 1VF5C 1PYWD 2F3WA 2R61A 5H1SE 4X64L 1SYEA 2KVMA 1S5FD 3OOCA 1GUGA 1PH7A 1IYJB 1QE6A 2K28A 1XPOA 4POGA 4HJ5A 2JA5H 2KOLA 1VQ6A 2WP8J 1YHAA 3G48A 3URYA 4B3RL 2K5DA 3CQZH 1LTID 1AW7A 4F7XA 1M1KC 1F9QA 1HQRD 4ULLA 1UAPA 1HUMA 2V4DA 4FDBA 3GTMH 1I4XA 2WAQG 2F0SA 4UP9A 2UU9Q 1SEBD 4K2LA 4K5XA 1JCKB 5EBDA 1KIXA 1I6VC 4DFAA 1QWYA 4LUZA 2N3SA 3BYYB 4DR1L 4A3IB 1VQ8A 3TS2A 3ZYYX 4L63B 1DM0B 4C1NK 5M3MG 2CW0D 3S24A 3L9AX 3PUYA 4Q5VA 2KCTA 3QO2A 2CQOA 5IYCH 1VMCA 1YNXA 1EWCA 1DOMA 5D14A 3NP8A 1GHJA 1OXSC 1XNRL 2HDLA 2KBNA 2JA7G 4BBSG 4KN7C 2R7ZB 1FNUA 3H09A 2JA8H 2KEEA 3C1FA 1A62A 2CCZA 3EA6A 4DUYL 2KHJA 1SDFA 2O2LD 3OW2A 4BXXG 3GTMB 1YJ9A 5IYDH 1V1OA 3R8BA 4OXPA 2B63H 3AQQA 4R1JA 4RCNA 2E2IB 3QOJA 1B3AA 3H94A 4JI1L 3KLSA 1PV4A 3A7LA 2XIWA 5HY6A 4TSSA 1BBXC 1N33L 3TRZA 2CWPA 4K6DA 4X62L 4IOCA 4DR3L 2LKVA 2JEBI 3WOEA 3S14B 2BCOA 4PZ8A 1DCZA 1KNAA 3NQIA 1GUTA 3OPOA 2MGSA 1LO5D 2RDFA 4KY7A 4HTHA 1KLGD 4JI5L 2JYOA 4FF4A 5I6YA 1WTQA 3M7GA 4K0KQ 4KY5A 5IP7G 1JOOA 2IY5B 2F0MA 2VNUD 2XGTA 2WB1E 5IP7H 4QQBX 1QVCA 1IHZA 5C6AA 1X3GA 1GUNA 3KLRA 1BVSA 5CV5A 4BY7B 1A2TA 1VCIA 1YI2A 1FGUA 2RDGA 3JAMi 2SDFA 5E7NA 2E2JH 3CP0A 1EY0A 3PO2B 4JI0L 3N52A 5JVG3 2DJFC 1KDCA 4XQJA 3MEHA 1L0YB 4MTKA 3CCLA 1ENCA 3IL8A 3PF4A 2DGYA 5IYCG 2FXQA 2JEAI 1GKHA 2ZTDA 3MAQA 1CSPA 4IUTA 1MJCA 3NUCA 4UHVA 1O7LA 1IW7C 5KYLA 1J8IA 1SE8A 3EROA 1N34Q 3H3VC 2F0GA 2A8VA 2NBFA 1H9KA 2IX3A 2Q8TA 5J3BA 3HOVH 5JEAJ 3ICEA 1X3QA 2PNRC 5IT9E 1E2ZA 4A93B 2UUBL 1PDQA 5D3IB 3HKZG 3GTQB 2NZHA 1CZWA 3BYTB 1QNKA 4FVMA 1I6HB 2R93B 2EY2A 3PO2H 2YTXA 3E6ZX 1Y8NB 1NY4A 1Q8IA 4I7ZC 3S16B 1Q81C 5DAUA 5DLQE 3TZUA 1CA6A 3KBGA 4X65L 3E0JA 2B2VA 4N8X1 5EPLA 3LWUA 4HIKA 4GS3A 4KK7A 2YV5A 5EQ0A 1KABA 1LTBD 5C0XG 1HZAA 4DV7L 1M90C 4FXDA 4JI6Q 1TWFH 3N6RA 2SOBA 5ELDA 3QOLA 2L1BA 4A3JB 1EQRA 1ONLA 3PO3G 2P5ZX 1KDBA 1IBML 4OO1G 5GAGC 3KK7A 5EAYA 2ZM6Q 4O42A 4R4QA 3H0GG 1TY0A 1K8GA 1FYCA 3UI2A 1WCMH 3T51B 5FOBB 1TWHB 2PYKA 2AQ1B 3RNUA 2A6ED 2KHIA 1I4GA 4X6AH 3GDEA 3I4MH 2BH2A 2R93G 3T56B 4BBSB 2XSCA 1B70B 3HOXH 1ZKOA 5CV7A 3V2TA 3GTPB 1CKOA 1Y1VB 1YNJC 3KF8A 3TEHB 4CKBA 1KRSA 3T4AC 1NR4A 3SK8A 3MFGA 1I5FA 2RKSA 4ABNA 1VQBA 3DMUA 3FVQA 1TWFB 5LMNQ 3VR4A 3MZ5A 3SK4A 1E3PA 4LF6L 5C4XH 3PF5A 3DWAA 4EX5A 3S2HB 4HSPA 1W2BA 3TMEA 4LFCQ 3A56A 1R9TB 1E1TA 1SNPA 2JA5B 3A8IE 2I5HA 5I9OA 1CA5A 1F9SA 1PYBA 1SMYC 1J5EQ 1TWHH 1G2TA 1IL2A 1LTTD 2K5WA 1XWEA 4MN3A 4C1NI 4Z9CB 2XVSA 3R3OA 1QJOA 4B3MQ 4B3TL 2NN6G 3U9OA 4DAMA 3CRKC 1CI3M 1WCMG 1ET6A 3SXHA 3K7AB 3TBIB 3S17B 4A3BB 1BOSA 1N32L 5ELFA 1KQSA 4R9WA 5E4WC 3S15H 4HIOA 1HQMC 1PRTB 1SYBA 4GN5A 3J81c 2FMMA 4X65Q 5BR8L 4LUOA 4CDDC 2QDLA 3K5NA 1I4PA 1PFMA 3M85A 4A3KH 3G6JB 2F0FA 1RDPD 1Y14B 4DAPA 2N49A 1MSGA 4Y52H 3K0XA 5KRUA 3OYYA 2G9HD 4IFDJ 4A3EB 4ZRZA 4JBJA 2EXDA 1ILQA 4GNXC 2B63G 1BCPD 4JI3Q 3TS0A 1NUCA 4HMJA 3U50C 2X6LA 1TWCH 3ZJYC 4IFDI 3S14H 2CKZB 1V1QA 1EWIA 2XN9C 3BZKA 1Q1BA 3VR3A 3UDIA 2VQEL 4JYAQ 2HQEA 4JK1C 1WVLA 4JI8L 4R8IA 3VYUA 5CV8A 1LT3D 2OWOA 2R92B 5JJLA 1EL0A 2DNCA 3AEVA 5C0XJ 3CCRA 2VUMG 4A3JG 2EYLA 2H5XA 2WV6D 2A19A 3CC7A 3BZDB 5C4HA 2YYZA 4LF5L 3EVQA 1JJ2A 5AJ3L 2I5LX 3HOZH 2WIIB 1LTSD 3D3RA 2RF4A 1VQPA 2ZJRA 4GKJL 1X65A 2K7VA 3GTJH 2Q2HA 4PNYA 4JI1Q 3WWVA 1SJED 1ESFA 4RFBA 2E2HB 5ELBA 5IGFA 1II3A 1VQ9A 4FF1A 4CHTB 2QA4A 2BDNA 5JJZA 4KD3A 2CH4A 3RLFA 4YY3L 1JB3A 1L1OC 1JR0D 1X55A 3Q6SA 1GUOA 4RH6A 5KYIA 4LF9L 1L1OB 4YIJA 1YJNA 3I8ZA 3E0EA 5ELOA 1IBLQ 4ZCKA 3DM3A 4A93H 2MUYA 4A3MG 4PG3A 4WORA 3A55A 1PA6A 3NPPA 3QWNA 4QB4A 4L8JA 2EJFC 1GO3E 3W5OA 4EQ5A 4CJ2C 1N8RC 3PQIA 2Z4HA 1HHVA 4C3HG 4HJ7A 5LMUQ 2BE5C 1SYCA 3J7ZC 2AKWB 4MHEA 1PH1A 4JPBW 1H9SB 3CW2C 3DWQA 5K36H 4A3FB 5C3EH 1VF7A 3TREA 4I7AA 2NZ1D 1ICWA 4HJ9A 3QR8A 3D4WA 1WTXA 1HTPA 1JMCA 2ZXRA 5KNDA 3PV0A 3FPUB 4L6TB 2OF1A 5GAHC 1FGBD 3M3YB 2JJQA 3DEOA 5E3FA 3E3XA 4JI8Q 4KY6A 3H91A 1Q3LA 3NK9A 3GTKH 5A2QE 1EEFD 5IGBA 4A75A 4X3TA 3TP8A 2HHHQ 2ASBA 1WFQA 3CCMA 2C5CA 2MO1A 4J6HA 1G291 1AE3A 2B2WA 1EY8A 3VR6A 2QW7A 3W2DA 1AP0A 4C3IG 1YNNC 2ALYB 1XJVA 3K57A 3B6YA 1JJCB 1EY7A 3MXUA 2CVRA 3UDXA 4DV4L 3I4NB 2B2TC 1Z47A 4UDUC 4IURA 1UEBA 4YWLA 3H15A 2VXWA 3IFDA 2K5VA 2BH8A 3LGJA 4OHJA 4DV0L 1PVOA 2IPKD 2N88A 4DV7Q 3HOXB 3GTPH 4FXGC 1STYA 4XYOA 3S2HH 2Q2IA 4QCLA 2NZOA 2SNMA 2KECA 1SBBB 3NWSA 4P73A 4DV2Q 2B29A 3GTOH 2MPMA 3PIO3 4YY3Q 3NBHB 2RSOA 4QJFA 1B50A 1NJIC 2HIXA 5HGTA 3AU7A 4DR4Q 4IOAA 4IJHA 4XDXA 3BG3A 4NP5A 3J81L 3CXCA 3G71A 2L11A 5JPMC 4DAVA 2EYPA 4PZ6A 1IW7D 2RHSB 1DOLA 2UUCQ 1STAA 2EYHA 3BDLA 5EPKA 1R4QB 1E24A 1NAPA 3PUWA 3T1YQ 3C46A 2F4VQ 2X6GA 3BDCA 3OTOL 4LWCA 5IIFA 2VUMB 3I4OA 2F0LA 1B1ZA 1EWHA 1RJTA 3AB9A 1UE1A 1FL0A 4G57A 4FF2A 4PZ7A 5M3MB 4A3MH 1P8LA 4JI4Q 2JA8B 2XWBB 4APVA 3ONAB 1SJHD 4ME3A 2LSSA 3S1NH 2LFNA 1B8AA 5FO7B 3GTOB 1PZJD 2DY7A 1K8OA 4A3LH 5JPNC 2H4OA 1YJWA 2NVYH 2Z9HA 3GTGB 1CFMA 5I2XA 1X6OA 3T1HQ 3HOYG 1GXDC 1XYIA 3CMEA 3H3VH 1EU4A 2VS1A 3A8JE 1ZYRC 4ZLTF 2PPBC 4RCOA 3A0JA 3I4NG 3H0GH 1F9RA 2B8GA 4QGUA 4TRDA 2L4NA 1WTWA 4ID6A 2WAQB 4DV5Q 4TVAB 4GKKQ 4R4TA 1FNVA 2VW9A 5FLXE 4JCVE 3W1GA 4A93G 4N8FA 3S1QH 1EIFA 4TKOB 4KKTA 1P16A 2K5NA 4K5VA 4C3IH 1CQVA 4GN3B 2IHFA 3CC2A 2MJ8A 2M9VA 3A74A 5BR8Q 1LM0A 1EEID 1S5CD 2E5LL 3AMUA 1DD2A 4HIMA 4B3RQ 1Q46A 3X3NA 4S3SA 1MJEA 1EZ8A 2I46A 4KLKA 1VQAA 4GLAC 1T5XD 2Q8IB 1LT4D 2J4XA 1F77A 2UU9L 1EIYB 4A3FG 4GOPB 4BXXH 1PFNA 1YZ6A 1IZ6A 1CTMA 3PO3B 1PHJA 4BY7G 1HA5A 4N9PA 5CMDA 1XTDA 3KDFB 2F0TA 3F2UA 2JA8G 4U673 1EIGA 4PMBA 4BY1B 5LL6X 2QGQA 4OIJA 4BY1G 4A3BH 3M9BA 3NSWA 5FJ8G 4B3SQ 4P72A 3K7AH 4OONA 1D5ZC 4YCUA 5IY0A 3BU2A 1V43A 2CWAA 1KD1C 1TVXA 2AUJD 1KC8C 2AHOB 1HNZL 1I4HA 4XXEA 3S2DH 3CCEA 1CQFA 5J22A 4IQZA 2B2TA 1VS0A 3GD7A 1SSOA 1A3UA 4FO2A 5IP9G 2WINB 1STGA 1XNQL 1A3TA 1IYUA 1ASYA 5EGTA 4LFBL 4IPCA 4LMQD 2CQAA 3VYRA 2WB1G 1F2YA 3S16H 4G4KA 5FJ8H 1HUNA 1PRTD 2B2WC 1D2BA 1C48A 3H3VI 4C3JG 1X54A 3NXWA 1LTAD 4J1MA 1RHPA 5KNCA 3M4OH 1SE3A 3J80i 4NXML 5CV9A 1SFOH 5C5MA 3SVMA 3A54A 1BUVT 2OQ0A 5C4JH 4LFAQ 3HOUH 3OW7A 3G4SA 4BY1H 1RIPA 1Q86C 3J80L 1S5BD 3CCSA 1OXUA 3HEJA 5LMUL 1K0SA 4HEDA 3PIP3 2NVTH 3I4NH 4GZYC 1XXGA 1D5MC 1V1PA 4RMFA 3OWFA 1TQOA 2DY8A 4CDEC 5C44H 3HZXA 4A76A 1J9OA 1I4RA 1YVCA 3PIPA 4JVZA 2K14A 4DXGA 4A3IH 2R92H 3K0YA 5FLMG 1UEAB 4U68A 2X69A 3NBHA 1LACA 2I07B 1E1OA 4OWWB 3I2ZA 2QILA 1YNJD 2VB3X 2F0DA 2PMZE 2VL6A 1FJGQ 4PMWA 1WJJA 2NVQB 1WYDA 2OEOA 3P20A 4JI7L 1RODA 2K50A 3C2PA 5I4DA 4DNRB 3MHBA 1UE5A 2UUBQ 4J8QA 1K83H 1EYCA 4KJNA 5M5YH 2R6GA 4KJOA 4DV6L 3Q8DA 4L5RC 4X64Q 2ATWA 2NTSA 3PO2G 2F0IA 1BXTA 1L0WA 1TS5A 5HURA 2JSOA 2NTTA 1SN8A 1LABA 3HKZE 5E1FA 2EVBA 5K5PA 5CV4A 2JA5G 2HCCA 1JWMD 2F0NA 4LJZC 2UXDL 4EVOA 4H13C 1N36L 2YTYA 3M4YA 5E4XA 2VQFQ 4HN7A 2TSSA 4LFBQ 2YTVA 1VQOA 1S3OA 3CF5A 1PRTF 2R7DA 1BNZA 2E2JB 1K3BC 3MWYW 3KUPA 4G7ZC 2ZM6L 5C3XA 2K6AA 4J15A 1W6JA 4N9TA 1JE5A 2AQ3B 3D0FA 5I6WA 1WI5A 1RTNA 2N78A 3SK5A 3GTGH 2ZJQA 2H1EA 2FINB 3I90A 2OCEA 1NSNS 4IPGA 1PFBA 1E22A 2HQLA 5IYBG 3RLOA 4LF7L 3R2TA 4DF7A 1H9MA 1TWAH 1TWCB 3FPPA 5IT9L 1C4QA 4X66Q 1KAAA 4BS9A 4ZKCB 3D4RA 1T9HA 1RCVD 1JWSD 4DNTB 1C8CA 4LFCL 2Z6KC 1RTOA 1JQYD 1JE4A 1Y8OB 1QNUA 4A3GB 2G5DA 1EQTA 2L9HA 4XYQA 1VQEA 1VQMA 2JP1A 4NKLA 4P75A 4DK0A 2G9DA 3MXPA 4H44C 3HKSA 4C3HB 2L12A 2KA7A 1GM5A 4JV5L 2E74C 1E0BA 2QEXA 3D31A 3I3CA 3D6WA 1TS2A 4DUZL 2JK8A 1PH3A 2PNHA 4DV6Q 3NBIA 4KN4C 4LUVA 5IYDG 4E6IA 1IYVA 1B44D 3PUZA 3ULLA 5M5XH 1EY4A 1H95A 3P1HA 2KCCA 3BVMA 4OX9Q 2TMPA 1I3QB 2M2LA 3NQTA 2B2YC 3IKJA 4ZUJA 1UE6A 3M7NA 3CRLC 2SEBD 4A3BG 1B4OA 2UXDQ 1IL8A 4P74A 1STEA 4A3GH 3RLNA 5J39A 3CMAA 4DPGA 4BWGB 3J7AV 3KF8B 4A3MB 2UXCL 5C44G 1SROA 1GOZA 3T16A 3TN2A 5CBEE 4JI3L 5M5WH 3RZDH 2B39A 3A8KE 4L5TA 3EQLC 1B9NA 3I7FA 2IW3A 1XPRA 2RSNA 4HJAA 4HCSA 3EN2A 2UUCL 1CKNB 1WTRA 4UY8C 1NTGA 4K6LA 2DUDA 3KF6A 1JB7A 1I3QH 2A1AA 2UXBL 1JOQA 1K8MA 4ME5A 4DA2A 4CJ1B 3VA7A 1G51A 3FDTA 5IGDA 1STBA 2EPBA 3LX0A 3HOWB 1TKWB 4JI4L 3RMHA 5CBAE 1V1PB 1HPCA 1LLRD 5BN3A 4DU9A 3K5MA 2B2VC 4AYBB 3S1MH 2C9OA 5C44B 2EYFA 4DR2Q 2B8FA 2ZXOA 1WTHA 5HGQA 4AYBG 3HOUB 2F0JA 4KV6A 1LV9A 4TQUS 3OMGA 1SE4A 1U4RA 3K80C 5JOBA 1BO0A 1L2FA 4C3IB 2BOSA 3V96A 4LF4L 3M4PA 2PCFB 3HP3A 1AFPA 3S17H 1STNA 5I9PA 4LF9Q 1O7IA 1IBMQ 3RR5A 4GOPC 4JI0Q 5IOCA 3STBC 2RA4A 2EIFA 2LY7A 1L1OA 5JEAH 2ENBA 4NXMQ 5IP9H 5IE8A 2JA6B 3TZDA 1WOCA 4LFAL 1WTVA 2R7ZH 1QILA 3CAMA 4PMCA 1LT6D 4AQYQ 5IGCA 2PO4A 5BN4A 1LTGD 4K2KA 2WACA 4CGYB 3C1EA 5C4XG 5JAVA 2QKIC 4DR6Q 1AZPA 4LNQA 1ICFB 1IBKQ 2B63B 3AYHB 3P7JA 1HFNA 2EJGC 2EXZA 1VQ7A 3T53B 1GJXA 1JICA 1TWGB 5BN5A 1WD1A 3E5SA 2JA7H 3JAMc 4IUUA 1ZEQX 4RA8A 1Q12A 4OWTB 1Y1VH 3NELA 4RGMA 4LF6Q 3JC66 4QL5A 5GQOA 4K14A 3IRBA 4K8JA 3VR2A 1F2ZA 1ILPA 2D2CC 4RHRA 4M8AA 2RBMA 5GROA 2DNEA 2PQEA 2BE5D 4R4OA 1TS3A 1XTCD 1CKNA 3GTJB 3TP6A 1ML0D 3CC4A 4DXFA 5C4XB 4P2CB 3GV3A 4UAIA 1QCBD 1K73C 5CGKA 4HAEA 2E2DC 2F3IA 3I73A 2NN6H 4BBRG 3CCQA 3MTSA 3UDGA 4R4CA 2D0PA 2PW5A 5TSSA 3GTLB 3D6CA 5IGGA 4CDCC 1HNWL 1HCZA 1FVIA 1XMOL 3QB3A 1EFID 1W3SA 3GQBA 2EY5A 2Y0SE 5DEHA 1HTLD 1G91A 1FNWA 5L37A 1HZCA 2EYMA 1D1KA 4NXNL 4C56C 2XNAC 3FKIG 1K8AC 1XNQQ 5FLMH 1A63A 2IX0A 3C3LA 4KHZA 3A5ZB 3D8GA 1I94L 4GNXB 4RKBA 1CK1A 1I6HH 2NVXH 3J81E 4G7OC 4DR1Q 2K01A 4IZ8A 2EQSA 3GP7A 1KHIA 4XT1B 3T13A 1VQJA 1QZGA 3I56A 2JA9A 4FXKC 5C5LA 4WFN3 5EPJA 1Q1EA 2ZTCA 3ITPA 4JOIC 4DAYA 2R7ZG 3UE1A 2Q2TA 1NNXA 2NVQH 3M3YH 1PZID 3PSIA 1QZHA 4HSVA 2R92G 1O7YA 2K1BA 1J5EL 1JC7A 4XIGS 5KIXA 2Z8LA 1DGSA 4GLXA 1PMRA 3PO3H 4LF5Q 2EZVA 2XWJB 4DUYQ 4A3EG 3HOWG 2F0PA 2PI2A 3G7LA 1CHPD 1MSHA 3GTLH 2A69C 2F0QA 3FKIB 1LT5D 5LMNL 1JJGA 4JI2L 3HOVB 2E8GA 2KCMA 2ZXPA 1M4VA 4K0KL 2UUAL 3I4MG 2VY3A 2RCFA 4KHVA 1G8ZD 1ASZA 1X3PA 3GTKB 2IT1A 4DN4M 1U4LA 4ZQ3A 1A2UA 4BBRB 5CC4A 1LYLA 1KDAA 5COYA 4C3JH 4POFA 1WCMB 3Q22A 4DR5L 2HIVA 2KQ3A 1EFWA 4HJ8A 4X3SA 1I50B 1U4MA 4O0AA 5FKAC 3EFXD 1G6ZA 5LMNW 1E2WA 4FYDA 1CHQD 5FLXc 4OX9L 2QF7A 1HR0L 2A5HA 1I4QA 3Q24A 1Y1WG 1PH6A 2BDOA 3L3OC 4A3DG 3KJPA 2E2IH 1QG7A 3U4ZA 1U0LA 1TY2A 3U58A 3IFTA 3QG1A 1SMYD 2F0VA 4XTCS 1HNXL 2FJ2A 4H7BA 1MD2D 1G2SA 4XT3B 2MHVA 1BKBA 1B53A 3CPWA 2VUMH 2YU9B 1D5XC 1CUKA 2AQ2B 4DNIA 4GOPA 2LXJA 1KAWA 1MKHA 5EKKA 3OMCA 3PUXA 1U4PA 4A3FH 3RZOB 4EQPA 4IPHA 1HA6A 1AZQA 1TR5A 1JWUD 3L7ZC 1NMGA 1VQDA 1B9MA 5CR3A 4BY7H 4KHPL 1HZ9A 1AE2A 2K5QA 3K6OA 2EJMA 3W1BA 3CQZB 2CW0C 5IGEA 4F8MA 4B3SL 3OIQA 2FFKB 1FD7D 1KLUD 3J81i 2BA1A 4DV4Q 3HFZB 1BF4A 2R7FA 4ILWA 4OIKA 4OGQC 4G7HC 1EOVA 1NCVA 3VYSA 1SNOA 3H0GB 4DV0Q 1A0IA 3MXNA 3SGIA 3SK6A 1R9TH 1KRTA 1B7YB 2JE6I 4LF4Q 1E2VA 1K0RA 1GUSA 5M5XB 2PQAA 5GAEC 1GD7A 2K05A 2CHBD 5DNFA 3S15B 4WJWA 1D7QA 1SAPA 5ELCA 1DONA 1S72A 1A3VA 3OHXC 4B9XA 3Q23A 1KXLA 2NB0A 3G6EA 1SXTA 4DUZQ 3MXGA 1BCPF 2ZJPA 3RUZA 4GLVB 5A2QL 3BVZA 3SR1A 5DM73 1HR0Q 4AQYL 1TIID 1PTOD 1W6KA 2F03A 4RG1A 5GADC 1EQQA 5LHY1 1TT2A 3NE5B 1SE2A 5CORA 3CCUA 5ELEA 4CBVA 3TQYA 1VQCA 3NENA 4BA1I 4MTNA 4EGVA 4MIUA 1IBKL 2GVAA 1Q7YC 2KUMA 2B2YA 2NWGA 5IODA 3CPFA 4YHHL 3J7YW 1SR3A 4C2MB 4IPDA 5M3FG 2MP1A 4A3JH 2Y0SG 3W3AA 5I2YA 5A35A 1TWAB 4RGNA 5M3FB 4OL7A 4WRDA 4X3UA 1TS4A 2QDBA 1EU3A 2F0WA 2K5HA 4RWSC 1PH5A 1TU2B 1BR9A 1RKNA 2N55A 3GV6A 2ICIA 2VB2X 4QIWB 3MA2B 4DV1Q 3FEWX 4A3KG 3QIAA 4AIMA 2A69D 1L0XB 3ERSX 3K8AA 5EKIA 3JAME 3L2PA 2OXPA 1FJGL 2A6HD 2F0UA 3KYHC 4YWMA 2LMCB 5FO9B 4QF4A 5KGUA 4LW1A 4QY7A 1MHWC 4KMUC 1JT8A 4HR7B 4JI7Q 1Q8KA 1Z7TA 3S1MB 2NVYB 2JA6G 5CV6A 2Z6BA 3CCJA 5KEEA 1K28A 1N32Q 1VQLA 2AMCB 1HH2P 2JA6H 4CKEA 1DJRD 1HNWQ 4DK1A 1HFGA 3I55A 4DR4L 3DXJC 5ISRA 1EYAA 1PRTC 3HOYH 1EIHA 4YCWA 1NBWA 1V9PA 1Q90A 4IJLA 4NXNQ 4B08A 4O1NA 2K04A 3GO5A 1YHQA 1D1IA 3RN5A 3KOJA 5KNBA 3PCOB 1OXTA 2EYJA 4ZK9B 2PZTA 1D6EC 4QMGA 4L5QA 2HDMA 3F2CA 2FHTA 3S1RH 1KL9A 1LTLA 3OIPA 1EZ6A 2A74C 2OTLA 3AFQA 1SNCA 1WTPA 1AEXA 1VQNA 5M5WB 3RZDB 3RN2A 3HOXG 2A6EC 2E76C 2D9UA 2VQEQ 5G3LD 2F0KA 2GA4B 4A3CG 2A68D 4NPSA 3R2IA 2IL8A 2D0OA 3KDFA 5T1GA 1YEZA 3HGBA 1YITA 4LF7Q 1VMPA 3NTHA 2O5JC 1N33Q 4KKUA 2Z1CA 3I91A 2B3GA 4B3ML 1Y1WH 4IUNA 1X32A 4FP5D 1K83B 5M5YB 1C9OA 1QVGA 1IBLL 2NYZD 3PIOA 1V8QA 2EY1A 3ULPA 1DOKA 1T5EA 2RHQB 2B2UA 5EBCA 4JC0A 1K9MC 3K5OA 3K59A 3HKZB
chains in the Genus database with same CATH topology
2RCFA 4JVZA 2Z9HA 4N8FA 4I7AA 4JW0A 4N8X1 2HD3A 2QW7A 5L37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCF A;  4JVZ A;  2Z9H A;  4N8F A;  4I7A A;  4JW0 A;  4N8X 1;  2HD3 A;  2QW7 A;  5L37 A; 
#chains in the Genus database with same CATH topology
 1EYD A;  1QB5 D;  1Y69 U;  4OO1 H;  2ZT9 C;  1PTO F;  3A5U A;  3LWE A;  2J0T D;  1HJP A;  3P75 A;  2EY6 A;  1XMQ L;  1SLJ A;  3HOZ B;  1YNN D;  2EDG A;  2LXK A;  2RCN A;  2N8N A;  2YU9 H;  3ER0 A;  1QOH A;  3HOZ G;  4IN3 A;  2Z0S A;  4LF8 L;  1F9P A;  4DKA C;  1XMO Q;  2M00 A;  4XQN A;  4NW2 A;  3LNN A;  2K03 A;  4CDF C;  3I70 A;  4H02 A;  1CM9 A;  3S9W A;  4BBS H;  3WDN A;  4HMI A;  2E5L Q;  1JOK A;  2Q8R E;  2K75 A;  2Z4I A;  4A3G G;  1PH8 A;  4IUQ A;  2DJG C;  2CH4 W;  2RQX A;  4MZ9 A;  3J80 E;  3VA5 A;  4YCV A;  1U9R A;  2VZA A;  1O78 A;  2OT2 A;  5C4J B;  1BCP C;  1SNQ A;  4O2D A;  1F2L A;  5J1Z A;  1BCP B;  2UXC Q;  3S1Q B;  3EBE A;  2F0E A;  5K36 G;  1TWG H;  1VQ4 A;  2QCP X;  1S4Z A;  4H0L C;  4QUF A;  4IUV A;  1CZG A;  4IFD H;  4C3J B;  3HOU G;  4K5W A;  4GKJ Q;  2HUG A;  5C4Z A;  1EUJ A;  3CCV A;  4A3D H;  4DGZ A;  4OWX B;  1I50 H;  4Q0F A;  4ZAI A;  2PI2 E;  2L0C A;  4Y7N B;  4B9W A;  4IO9 A;  1B3Q A;  2GN5 A;  4KKS A;  5D65 A;  3KLW A;  1UUP A;  4JBK A;  1R4P B;  3NTI A;  3ND9 A;  1PLF A;  4EQN A;  4DV2 L;  2F52 A;  2MNA A;  1NMF A;  3X3M A;  1TXY A;  4FNF A;  4AYB E;  2MFI A;  3DEP A;  1EYG A;  2V1C C;  3WOF A;  3KF6 B;  2MQH A;  1RL2 A;  4ZUI A;  2JN4 A;  2CFM A;  4ALP A;  1MGS A;  4DV3 Q;  4X3K A;  1KTK A;  3STB D;  4C2M H;  2UUA Q;  4HCE A;  3PMF A;  4DR2 L;  3KFU A;  4MNO A;  3E9H A;  2L15 A;  3ERQ A;  5LL6 S;  1H9S A;  1MIU A;  4BA2 I;  4F88 A;  2E75 C;  5IYB H;  2F4V L;  4RAU C;  4NDX A;  1DYQ A;  3TSS A;  4DR7 Q;  1PFS A;  4YWK A;  1EY6 A;  2PMZ B;  1X3E A;  3QJY A;  3VDY A;  3ND8 A;  2FMC A;  1HXY D;  4IUP A;  4JOI A;  1RF2 D;  4NMZ A;  1A15 A;  3D4D A;  4RGT A;  1SNM A;  4XQQ A;  2AWN A;  3TDQ A;  4LF8 Q;  2IX1 A;  4A3I G;  3S1R B;  3KLS X;  1M8A A;  5F2D A;  4Y7N H;  1EY9 A;  1Z9F A;  3K7U C;  5T1I A;  3NWT A;  1BQQ T;  4DR6 L;  4EQO A;  4DAY B;  2GVB A;  1PTO B;  3S2D B;  2IHE A;  2QEJ C;  1HNX Q;  3HOY B;  2XTI A;  5IWA L;  3RZO H;  1N9W A;  2HCI A;  4R4I A;  4V19 0;  2F3V A;  3JAM L;  1VQ5 A;  1ZYR D;  4WJ3 M;  1IKL A;  4JI5 Q;  3FKI H;  3EJI A;  4KI0 A;  1PH4 A;  5C0X H;  1SYD A;  1SYF A;  5C0X I;  1MBY A;  1U5K A;  1Q82 C;  3T1H L;  5FK9 C;  2E2H H;  1QUQ B;  1VQG A;  4IAL A;  4JW0 A;  4I65 A;  2NVT B;  3Q0A A;  1XX8 A;  2B2U C;  3H6M A;  4A4I A;  4JV5 Q;  2ID0 A;  3I72 A;  1EY5 A;  2WB1 B;  5G3L F;  3E9I A;  3TP7 A;  1XPU A;  4FF3 A;  1ZXT A;  2C35 B;  3HG9 A;  3BZC A;  5C3E B;  1Y1V G;  2K32 A;  3KBX A;  3HOV G;  1VQH A;  2MO0 A;  1C0A A;  3FRP B;  4DV3 L;  2ES2 A;  1UWV A;  1PH9 A;  2Q2U A;  4JYA L;  3NEM A;  1A8V A;  3CD6 A;  4RKL A;  3NHH A;  2WKD A;  1N36 Q;  3MFY A;  1PTO H;  1ENF A;  2Z6K A;  2EE1 A;  5ELN A;  1VDZ A;  3MXN B;  1SYG A;  1JOR A;  3T1Y L;  1GUW A;  4JBW A;  3S1N B;  2JXM B;  2NUC A;  3AFP A;  1SFO B;  3BJU A;  1OXV A;  3IAY A;  4WJ4 A;  5JVH 3;  5M3F H;  3SE0 A;  3RD4 A;  3J7A F;  4PQX A;  1VQK A;  3BS1 A;  1S5D D;  1S40 A;  3J81 j;  1X3F A;  5M9O A;  1G6P A;  4QUC A;  1YHB A;  2F0H A;  3OSO A;  2A6H C;  1PYS B;  4GN4 B;  4GNX A;  1AN8 A;  5EJW A;  1EOT A;  2KCN A;  3F2D A;  4CJ0 B;  4AH6 A;  4L5S A;  3J7A 5;  3SDZ A;  4R8N A;  1J6Q A;  1ENA A;  2AWO A;  1H9R A;  5AFW A;  1SND A;  4UP7 A;  3SHL A;  4CKC A;  2R3Z A;  2LS0 1;  2WFW A;  5JJI A;  2HD3 A;  3K5L A;  1LTR D;  1NE3 A;  3CHB D;  4OEL B;  1OXX K;  5IWA Q;  1MI2 A;  1IKM A;  3ULJ A;  4LK1 C;  4V0B A;  5EKL A;  4DR3 Q;  2D5D A;  1A6X A;  1B2T A;  1F2M A;  2EYO A;  3PUV A;  3U9S A;  5JEA G;  1UE7 A;  1OTC A;  1X9N A;  3MVV A;  1IXR A;  4DV1 L;  1DZ1 A;  3GTQ H;  1PH2 A;  5CYU A;  3HOW H;  2O4X A;  2WAQ E;  3F1Z A;  4A3K B;  2ICE C;  1FR3 A;  1HZB A;  4DR5 Q;  1C7Y A;  1O7Z A;  3OWE B;  3CU7 A;  1BDO A;  2F4I A;  3U4V A;  1AH9 A;  1GVP A;  3R93 A;  3UDF A;  1QUQ A;  1XMQ Q;  5FLX L;  4OO1 I;  1CKM A;  4DK6 C;  4IFD G;  2I5M X;  1YBY A;  4A3L G;  1CT1 D;  1EQV A;  2EOT A;  3KJO A;  1Y8P B;  2J7Z A;  4RHS A;  1D8L A;  3DUZ A;  2RVL A;  2Y0S B;  4A3D B;  1HRJ A;  4A3C H;  1BBW A;  2JQO A;  2ZTE A;  1PTO C;  4ZYS A;  3I4M B;  1PXU A;  5DM6 3;  2PW7 A;  1N34 L;  3O13 A;  5C3W A;  4F87 A;  4KTA A;  4DK3 C;  5M3M H;  2UXB Q;  1X56 A;  2IJ0 A;  4OEM B;  2KHS A;  2HHH L;  3EIV A;  3I4L A;  2F1M A;  1RD9 D;  4C3H H;  2L55 A;  1PZK D;  3FMC A;  4KD4 A;  1HNZ Q;  2I0Q A;  5D3D A;  3J80 c;  2XRQ D;  1DXM A;  4KHP Q;  1UNS A;  3UE0 A;  1BBU A;  2K33 A;  1S5E D;  4JBM A;  1SRU A;  1GHK A;  1VQF A;  2A73 B;  3BDO A;  1OO9 B;  3SEB A;  2NN6 I;  3M4O B;  3VYT A;  1STH A;  2F0O A;  1E7Z A;  4PV1 C;  2KED A;  3K58 A;  4JG2 A;  2DN8 A;  3NTK A;  4JI6 L;  2K4K A;  2JA7 B;  5IT9 c;  2OQK A;  2IWH A;  2KEN A;  4LAA A;  4M1U B;  4ODG A;  3M4Q A;  1WD0 A;  4P71 A;  3HS0 C;  3F8T A;  2HT1 A;  4A3E H;  1KNE A;  4BBR H;  3L0O A;  3DWP A;  3FHW A;  1NR2 A;  5NUC A;  2BA0 A;  1K3R A;  1ET9 A;  1YIJ A;  3VR5 A;  2VQF L;  1SMX A;  2A68 C;  4K8I A;  1I94 Q;  4DR7 L;  4ZKB B;  2OTJ A;  3OTO Q;  1XNR Q;  5FO8 B;  3PGZ A;  3V05 A;  2AUK A;  2RDH A;  3A7A B;  4RGO S;  1CSQ A;  3MEF A;  3DM1 A;  3BVG A;  1LUZ A;  4X66 L;  3HRZ C;  3K81 C;  5AJ3 Q;  5JJK A;  1Z6H A;  1HR0 W;  2PQA B;  4NB3 A;  2D62 A;  2WKC A;  1H9J A;  1ESR A;  2PZU A;  3CKI B;  2XRS D;  4HID A;  3FP9 A;  3TP5 A;  5C3E G;  3DLL A;  3MC0 B;  2L5T A;  2K52 A;  2KJX A;  1QVF A;  2O5I C;  4QIW E;  4UP8 A;  1VQI A;  4YHH Q;  2SNS A;  4X62 Q;  4DV5 L;  4GKK L;  2R93 H;  1WTO A;  2PZW A;  4B3T Q;  1O80 A;  2NVX B;  4UPA A;  1Y1W B;  3DHQ A;  3F2B A;  4JI2 Q;  1VF5 C;  1PYW D;  2F3W A;  2R61 A;  5H1S E;  4X64 L;  1SYE A;  2KVM A;  1S5F D;  3OOC A;  1GUG A;  1PH7 A;  1IYJ B;  1QE6 A;  2K28 A;  1XPO A;  4POG A;  4HJ5 A;  2JA5 H;  2KOL A;  1VQ6 A;  2WP8 J;  1YHA A;  3G48 A;  3URY A;  4B3R L;  2K5D A;  3CQZ H;  1LTI D;  1AW7 A;  4F7X A;  1M1K C;  1F9Q A;  1HQR D;  4ULL A;  1UAP A;  1HUM A;  2V4D A;  4FDB A;  3GTM H;  1I4X A;  2WAQ G;  2F0S A;  4UP9 A;  2UU9 Q;  1SEB D;  4K2L A;  4K5X A;  1JCK B;  5EBD A;  1KIX A;  1I6V C;  4DFA A;  1QWY A;  4LUZ A;  2N3S A;  3BYY B;  4DR1 L;  4A3I B;  1VQ8 A;  3TS2 A;  3ZYY X;  4L63 B;  1DM0 B;  4C1N K;  5M3M G;  2CW0 D;  3S24 A;  3L9A X;  3PUY A;  4Q5V A;  2KCT A;  3QO2 A;  2CQO A;  5IYC H;  1VMC A;  1YNX A;  1EWC A;  1DOM A;  5D14 A;  3NP8 A;  1GHJ A;  1OXS C;  1XNR L;  2HDL A;  2KBN A;  2JA7 G;  4BBS G;  4KN7 C;  2R7Z B;  1FNU A;  3H09 A;  2JA8 H;  2KEE A;  3C1F A;  1A62 A;  2CCZ A;  3EA6 A;  4DUY L;  2KHJ A;  1SDF A;  2O2L D;  3OW2 A;  4BXX G;  3GTM B;  1YJ9 A;  5IYD H;  1V1O A;  3R8B A;  4OXP A;  2B63 H;  3AQQ A;  4R1J A;  4RCN A;  2E2I B;  3QOJ A;  1B3A A;  3H94 A;  4JI1 L;  3KLS A;  1PV4 A;  3A7L A;  2XIW A;  5HY6 A;  4TSS A;  1BBX C;  1N33 L;  3TRZ A;  2CWP A;  4K6D A;  4X62 L;  4IOC A;  4DR3 L;  2LKV A;  2JEB I;  3WOE A;  3S14 B;  2BCO A;  4PZ8 A;  1DCZ A;  1KNA A;  3NQI A;  1GUT A;  3OPO A;  2MGS A;  1LO5 D;  2RDF A;  4KY7 A;  4HTH A;  1KLG D;  4JI5 L;  2JYO A;  4FF4 A;  5I6Y A;  1WTQ A;  3M7G A;  4K0K Q;  4KY5 A;  5IP7 G;  1JOO A;  2IY5 B;  2F0M A;  2VNU D;  2XGT A;  2WB1 E;  5IP7 H;  4QQB X;  1QVC A;  1IHZ A;  5C6A A;  1X3G A;  1GUN A;  3KLR A;  1BVS A;  5CV5 A;  4BY7 B;  1A2T A;  1VCI A;  1YI2 A;  1FGU A;  2RDG A;  3JAM i;  2SDF A;  5E7N A;  2E2J H;  3CP0 A;  1EY0 A;  3PO2 B;  4JI0 L;  3N52 A;  5JVG 3;  2DJF C;  1KDC A;  4XQJ A;  3MEH A;  1L0Y B;  4MTK A;  3CCL A;  1ENC A;  3IL8 A;  3PF4 A;  2DGY A;  5IYC G;  2FXQ A;  2JEA I;  1GKH A;  2ZTD A;  3MAQ A;  1CSP A;  4IUT A;  1MJC A;  3NUC A;  4UHV A;  1O7L A;  1IW7 C;  5KYL A;  1J8I A;  1SE8 A;  3ERO A;  1N34 Q;  3H3V C;  2F0G A;  2A8V A;  2NBF A;  1H9K A;  2IX3 A;  2Q8T A;  5J3B A;  3HOV H;  5JEA J;  3ICE A;  1X3Q A;  2PNR C;  5IT9 E;  1E2Z A;  4A93 B;  2UUB L;  1PDQ A;  5D3I B;  3HKZ G;  3GTQ B;  2NZH A;  1CZW A;  3BYT B;  1QNK A;  4FVM A;  1I6H B;  2R93 B;  2EY2 A;  3PO2 H;  2YTX A;  3E6Z X;  1Y8N B;  1NY4 A;  1Q8I A;  4I7Z C;  3S16 B;  1Q81 C;  5DAU A;  5DLQ E;  3TZU A;  1CA6 A;  3KBG A;  4X65 L;  3E0J A;  2B2V A;  4N8X 1;  5EPL A;  3LWU A;  4HIK A;  4GS3 A;  4KK7 A;  2YV5 A;  5EQ0 A;  1KAB A;  1LTB D;  5C0X G;  1HZA A;  4DV7 L;  1M90 C;  4FXD A;  4JI6 Q;  1TWF H;  3N6R A;  2SOB A;  5ELD A;  3QOL A;  2L1B A;  4A3J B;  1EQR A;  1ONL A;  3PO3 G;  2P5Z X;  1KDB A;  1IBM L;  4OO1 G;  5GAG C;  3KK7 A;  5EAY A;  2ZM6 Q;  4O42 A;  4R4Q A;  3H0G G;  1TY0 A;  1K8G A;  1FYC A;  3UI2 A;  1WCM H;  3T51 B;  5FOB B;  1TWH B;  2PYK A;  2AQ1 B;  3RNU A;  2A6E D;  2KHI A;  1I4G A;  4X6A H;  3GDE A;  3I4M H;  2BH2 A;  2R93 G;  3T56 B;  4BBS B;  2XSC A;  1B70 B;  3HOX H;  1ZKO A;  5CV7 A;  3V2T A;  3GTP B;  1CKO A;  1Y1V B;  1YNJ C;  3KF8 A;  3TEH B;  4CKB A;  1KRS A;  3T4A C;  1NR4 A;  3SK8 A;  3MFG A;  1I5F A;  2RKS A;  4ABN A;  1VQB A;  3DMU A;  3FVQ A;  1TWF B;  5LMN Q;  3VR4 A;  3MZ5 A;  3SK4 A;  1E3P A;  4LF6 L;  5C4X H;  3PF5 A;  3DWA A;  4EX5 A;  3S2H B;  4HSP A;  1W2B A;  3TME A;  4LFC Q;  3A56 A;  1R9T B;  1E1T A;  1SNP A;  2JA5 B;  3A8I E;  2I5H A;  5I9O A;  1CA5 A;  1F9S A;  1PYB A;  1SMY C;  1J5E Q;  1TWH H;  1G2T A;  1IL2 A;  1LTT D;  2K5W A;  1XWE A;  4MN3 A;  4C1N I;  4Z9C B;  2XVS A;  3R3O A;  1QJO A;  4B3M Q;  4B3T L;  2NN6 G;  3U9O A;  4DAM A;  3CRK C;  1CI3 M;  1WCM G;  1ET6 A;  3SXH A;  3K7A B;  3TBI B;  3S17 B;  4A3B B;  1BOS A;  1N32 L;  5ELF A;  1KQS A;  4R9W A;  5E4W C;  3S15 H;  4HIO A;  1HQM C;  1PRT B;  1SYB A;  4GN5 A;  3J81 c;  2FMM A;  4X65 Q;  5BR8 L;  4LUO A;  4CDD C;  2QDL A;  3K5N A;  1I4P A;  1PFM A;  3M85 A;  4A3K H;  3G6J B;  2F0F A;  1RDP D;  1Y14 B;  4DAP A;  2N49 A;  1MSG A;  4Y52 H;  3K0X A;  5KRU A;  3OYY A;  2G9H D;  4IFD J;  4A3E B;  4ZRZ A;  4JBJ A;  2EXD A;  1ILQ A;  4GNX C;  2B63 G;  1BCP D;  4JI3 Q;  3TS0 A;  1NUC A;  4HMJ A;  3U50 C;  2X6L A;  1TWC H;  3ZJY C;  4IFD I;  3S14 H;  2CKZ B;  1V1Q A;  1EWI A;  2XN9 C;  3BZK A;  1Q1B A;  3VR3 A;  3UDI A;  2VQE L;  4JYA Q;  2HQE A;  4JK1 C;  1WVL A;  4JI8 L;  4R8I A;  3VYU A;  5CV8 A;  1LT3 D;  2OWO A;  2R92 B;  5JJL A;  1EL0 A;  2DNC A;  3AEV A;  5C0X J;  3CCR A;  2VUM G;  4A3J G;  2EYL A;  2H5X A;  2WV6 D;  2A19 A;  3CC7 A;  3BZD B;  5C4H A;  2YYZ A;  4LF5 L;  3EVQ A;  1JJ2 A;  5AJ3 L;  2I5L X;  3HOZ H;  2WII B;  1LTS D;  3D3R A;  2RF4 A;  1VQP A;  2ZJR A;  4GKJ L;  1X65 A;  2K7V A;  3GTJ H;  2Q2H A;  4PNY A;  4JI1 Q;  3WWV A;  1SJE D;  1ESF A;  4RFB A;  2E2H B;  5ELB A;  5IGF A;  1II3 A;  1VQ9 A;  4FF1 A;  4CHT B;  2QA4 A;  2BDN A;  5JJZ A;  4KD3 A;  2CH4 A;  3RLF A;  4YY3 L;  1JB3 A;  1L1O C;  1JR0 D;  1X55 A;  3Q6S A;  1GUO A;  4RH6 A;  5KYI A;  4LF9 L;  1L1O B;  4YIJ A;  1YJN A;  3I8Z A;  3E0E A;  5ELO A;  1IBL Q;  4ZCK A;  3DM3 A;  4A93 H;  2MUY A;  4A3M G;  4PG3 A;  4WOR A;  3A55 A;  1PA6 A;  3NPP A;  3QWN A;  4QB4 A;  4L8J A;  2EJF C;  1GO3 E;  3W5O A;  4EQ5 A;  4CJ2 C;  1N8R C;  3PQI A;  2Z4H A;  1HHV A;  4C3H G;  4HJ7 A;  5LMU Q;  2BE5 C;  1SYC A;  3J7Z C;  2AKW B;  4MHE A;  1PH1 A;  4JPB W;  1H9S B;  3CW2 C;  3DWQ A;  5K36 H;  4A3F B;  5C3E H;  1VF7 A;  3TRE A;  4I7A A;  2NZ1 D;  1ICW A;  4HJ9 A;  3QR8 A;  3D4W A;  1WTX A;  1HTP A;  1JMC A;  2ZXR A;  5KND A;  3PV0 A;  3FPU B;  4L6T B;  2OF1 A;  5GAH C;  1FGB D;  3M3Y B;  2JJQ A;  3DEO A;  5E3F A;  3E3X A;  4JI8 Q;  4KY6 A;  3H91 A;  1Q3L A;  3NK9 A;  3GTK H;  5A2Q E;  1EEF D;  5IGB A;  4A75 A;  4X3T A;  3TP8 A;  2HHH Q;  2ASB A;  1WFQ A;  3CCM A;  2C5C A;  2MO1 A;  4J6H A;  1G29 1;  1AE3 A;  2B2W A;  1EY8 A;  3VR6 A;  2QW7 A;  3W2D A;  1AP0 A;  4C3I G;  1YNN C;  2ALY B;  1XJV A;  3K57 A;  3B6Y A;  1JJC B;  1EY7 A;  3MXU A;  2CVR A;  3UDX A;  4DV4 L;  3I4N B;  2B2T C;  1Z47 A;  4UDU C;  4IUR A;  1UEB A;  4YWL A;  3H15 A;  2VXW A;  3IFD A;  2K5V A;  2BH8 A;  3LGJ A;  4OHJ A;  4DV0 L;  1PVO A;  2IPK D;  2N88 A;  4DV7 Q;  3HOX B;  3GTP H;  4FXG C;  1STY A;  4XYO A;  3S2H H;  2Q2I A;  4QCL A;  2NZO A;  2SNM A;  2KEC A;  1SBB B;  3NWS A;  4P73 A;  4DV2 Q;  2B29 A;  3GTO H;  2MPM A;  3PIO 3;  4YY3 Q;  3NBH B;  2RSO A;  4QJF A;  1B50 A;  1NJI C;  2HIX A;  5HGT A;  3AU7 A;  4DR4 Q;  4IOA A;  4IJH A;  4XDX A;  3BG3 A;  4NP5 A;  3J81 L;  3CXC A;  3G71 A;  2L11 A;  5JPM C;  4DAV A;  2EYP A;  4PZ6 A;  1IW7 D;  2RHS B;  1DOL A;  2UUC Q;  1STA A;  2EYH A;  3BDL A;  5EPK A;  1R4Q B;  1E24 A;  1NAP A;  3PUW A;  3T1Y Q;  3C46 A;  2F4V Q;  2X6G A;  3BDC A;  3OTO L;  4LWC A;  5IIF A;  2VUM B;  3I4O A;  2F0L A;  1B1Z A;  1EWH A;  1RJT A;  3AB9 A;  1UE1 A;  1FL0 A;  4G57 A;  4FF2 A;  4PZ7 A;  5M3M B;  4A3M H;  1P8L A;  4JI4 Q;  2JA8 B;  2XWB B;  4APV A;  3ONA B;  1SJH D;  4ME3 A;  2LSS A;  3S1N H;  2LFN A;  1B8A A;  5FO7 B;  3GTO B;  1PZJ D;  2DY7 A;  1K8O A;  4A3L H;  5JPN C;  2H4O A;  1YJW A;  2NVY H;  2Z9H A;  3GTG B;  1CFM A;  5I2X A;  1X6O A;  3T1H Q;  3HOY G;  1GXD C;  1XYI A;  3CME A;  3H3V H;  1EU4 A;  2VS1 A;  3A8J E;  1ZYR C;  4ZLT F;  2PPB C;  4RCO A;  3A0J A;  3I4N G;  3H0G H;  1F9R A;  2B8G A;  4QGU A;  4TRD A;  2L4N A;  1WTW A;  4ID6 A;  2WAQ B;  4DV5 Q;  4TVA B;  4GKK Q;  4R4T A;  1FNV A;  2VW9 A;  5FLX E;  4JCV E;  3W1G A;  4A93 G;  4N8F A;  3S1Q H;  1EIF A;  4TKO B;  4KKT A;  1P16 A;  2K5N A;  4K5V A;  4C3I H;  1CQV A;  4GN3 B;  2IHF A;  3CC2 A;  2MJ8 A;  2M9V A;  3A74 A;  5BR8 Q;  1LM0 A;  1EEI D;  1S5C D;  2E5L L;  3AMU A;  1DD2 A;  4HIM A;  4B3R Q;  1Q46 A;  3X3N A;  4S3S A;  1MJE A;  1EZ8 A;  2I46 A;  4KLK A;  1VQA A;  4GLA C;  1T5X D;  2Q8I B;  1LT4 D;  2J4X A;  1F77 A;  2UU9 L;  1EIY B;  4A3F G;  4GOP B;  4BXX H;  1PFN A;  1YZ6 A;  1IZ6 A;  1CTM A;  3PO3 B;  1PHJ A;  4BY7 G;  1HA5 A;  4N9P A;  5CMD A;  1XTD A;  3KDF B;  2F0T A;  3F2U A;  2JA8 G;  4U67 3;  1EIG A;  4PMB A;  4BY1 B;  5LL6 X;  2QGQ A;  4OIJ A;  4BY1 G;  4A3B H;  3M9B A;  3NSW A;  5FJ8 G;  4B3S Q;  4P72 A;  3K7A H;  4OON A;  1D5Z C;  4YCU A;  5IY0 A;  3BU2 A;  1V43 A;  2CWA A;  1KD1 C;  1TVX A;  2AUJ D;  1KC8 C;  2AHO B;  1HNZ L;  1I4H A;  4XXE A;  3S2D H;  3CCE A;  1CQF A;  5J22 A;  4IQZ A;  2B2T A;  1VS0 A;  3GD7 A;  1SSO A;  1A3U A;  4FO2 A;  5IP9 G;  2WIN B;  1STG A;  1XNQ L;  1A3T A;  1IYU A;  1ASY A;  5EGT A;  4LFB L;  4IPC A;  4LMQ D;  2CQA A;  3VYR A;  2WB1 G;  1F2Y A;  3S16 H;  4G4K A;  5FJ8 H;  1HUN A;  1PRT D;  2B2W C;  1D2B A;  1C48 A;  3H3V I;  4C3J G;  1X54 A;  3NXW A;  1LTA D;  4J1M A;  1RHP A;  5KNC A;  3M4O H;  1SE3 A;  3J80 i;  4NXM L;  5CV9 A;  1SFO H;  5C5M A;  3SVM A;  3A54 A;  1BUV T;  2OQ0 A;  5C4J H;  4LFA Q;  3HOU H;  3OW7 A;  3G4S A;  4BY1 H;  1RIP A;  1Q86 C;  3J80 L;  1S5B D;  3CCS A;  1OXU A;  3HEJ A;  5LMU L;  1K0S A;  4HED A;  3PIP 3;  2NVT H;  3I4N H;  4GZY C;  1XXG A;  1D5M C;  1V1P A;  4RMF A;  3OWF A;  1TQO A;  2DY8 A;  4CDE C;  5C44 H;  3HZX A;  4A76 A;  1J9O A;  1I4R A;  1YVC A;  3PIP A;  4JVZ A;  2K14 A;  4DXG A;  4A3I H;  2R92 H;  3K0Y A;  5FLM G;  1UEA B;  4U68 A;  2X69 A;  3NBH A;  1LAC A;  2I07 B;  1E1O A;  4OWW B;  3I2Z A;  2QIL A;  1YNJ D;  2VB3 X;  2F0D A;  2PMZ E;  2VL6 A;  1FJG Q;  4PMW A;  1WJJ A;  2NVQ B;  1WYD A;  2OEO A;  3P20 A;  4JI7 L;  1ROD A;  2K50 A;  3C2P A;  5I4D A;  4DNR B;  3MHB A;  1UE5 A;  2UUB Q;  4J8Q A;  1K83 H;  1EYC A;  4KJN A;  5M5Y H;  2R6G A;  4KJO A;  4DV6 L;  3Q8D A;  4L5R C;  4X64 Q;  2ATW A;  2NTS A;  3PO2 G;  2F0I A;  1BXT A;  1L0W A;  1TS5 A;  5HUR A;  2JSO A;  2NTT A;  1SN8 A;  1LAB A;  3HKZ E;  5E1F A;  2EVB A;  5K5P A;  5CV4 A;  2JA5 G;  2HCC A;  1JWM D;  2F0N A;  4LJZ C;  2UXD L;  4EVO A;  4H13 C;  1N36 L;  2YTY A;  3M4Y A;  5E4X A;  2VQF Q;  4HN7 A;  2TSS A;  4LFB Q;  2YTV A;  1VQO A;  1S3O A;  3CF5 A;  1PRT F;  2R7D A;  1BNZ A;  2E2J B;  1K3B C;  3MWY W;  3KUP A;  4G7Z C;  2ZM6 L;  5C3X A;  2K6A A;  4J15 A;  1W6J A;  4N9T A;  1JE5 A;  2AQ3 B;  3D0F A;  5I6W A;  1WI5 A;  1RTN A;  2N78 A;  3SK5 A;  3GTG H;  2ZJQ A;  2H1E A;  2FIN B;  3I90 A;  2OCE A;  1NSN S;  4IPG A;  1PFB A;  1E22 A;  2HQL A;  5IYB G;  3RLO A;  4LF7 L;  3R2T A;  4DF7 A;  1H9M A;  1TWA H;  1TWC B;  3FPP A;  5IT9 L;  1C4Q A;  4X66 Q;  1KAA A;  4BS9 A;  4ZKC B;  3D4R A;  1T9H A;  1RCV D;  1JWS D;  4DNT B;  1C8C A;  4LFC L;  2Z6K C;  1RTO A;  1JQY D;  1JE4 A;  1Y8O B;  1QNU A;  4A3G B;  2G5D A;  1EQT A;  2L9H A;  4XYQ A;  1VQE A;  1VQM A;  2JP1 A;  4NKL A;  4P75 A;  4DK0 A;  2G9D A;  3MXP A;  4H44 C;  3HKS A;  4C3H B;  2L12 A;  2KA7 A;  1GM5 A;  4JV5 L;  2E74 C;  1E0B A;  2QEX A;  3D31 A;  3I3C A;  3D6W A;  1TS2 A;  4DUZ L;  2JK8 A;  1PH3 A;  2PNH A;  4DV6 Q;  3NBI A;  4KN4 C;  4LUV A;  5IYD G;  4E6I A;  1IYV A;  1B44 D;  3PUZ A;  3ULL A;  5M5X H;  1EY4 A;  1H95 A;  3P1H A;  2KCC A;  3BVM A;  4OX9 Q;  2TMP A;  1I3Q B;  2M2L A;  3NQT A;  2B2Y C;  3IKJ A;  4ZUJ A;  1UE6 A;  3M7N A;  3CRL C;  2SEB D;  4A3B G;  1B4O A;  2UXD Q;  1IL8 A;  4P74 A;  1STE A;  4A3G H;  3RLN A;  5J39 A;  3CMA A;  4DPG A;  4BWG B;  3J7A V;  3KF8 B;  4A3M B;  2UXC L;  5C44 G;  1SRO A;  1GOZ A;  3T16 A;  3TN2 A;  5CBE E;  4JI3 L;  5M5W H;  3RZD H;  2B39 A;  3A8K E;  4L5T A;  3EQL C;  1B9N A;  3I7F A;  2IW3 A;  1XPR A;  2RSN A;  4HJA A;  4HCS A;  3EN2 A;  2UUC L;  1CKN B;  1WTR A;  4UY8 C;  1NTG A;  4K6L A;  2DUD A;  3KF6 A;  1JB7 A;  1I3Q H;  2A1A A;  2UXB L;  1JOQ A;  1K8M A;  4ME5 A;  4DA2 A;  4CJ1 B;  3VA7 A;  1G51 A;  3FDT A;  5IGD A;  1STB A;  2EPB A;  3LX0 A;  3HOW B;  1TKW B;  4JI4 L;  3RMH A;  5CBA E;  1V1P B;  1HPC A;  1LLR D;  5BN3 A;  4DU9 A;  3K5M A;  2B2V C;  4AYB B;  3S1M H;  2C9O A;  5C44 B;  2EYF A;  4DR2 Q;  2B8F A;  2ZXO A;  1WTH A;  5HGQ A;  4AYB G;  3HOU B;  2F0J A;  4KV6 A;  1LV9 A;  4TQU S;  3OMG A;  1SE4 A;  1U4R A;  3K80 C;  5JOB A;  1BO0 A;  1L2F A;  4C3I B;  2BOS A;  3V96 A;  4LF4 L;  3M4P A;  2PCF B;  3HP3 A;  1AFP A;  3S17 H;  1STN A;  5I9P A;  4LF9 Q;  1O7I A;  1IBM Q;  3RR5 A;  4GOP C;  4JI0 Q;  5IOC A;  3STB C;  2RA4 A;  2EIF A;  2LY7 A;  1L1O A;  5JEA H;  2ENB A;  4NXM Q;  5IP9 H;  5IE8 A;  2JA6 B;  3TZD A;  1WOC A;  4LFA L;  1WTV A;  2R7Z H;  1QIL A;  3CAM A;  4PMC A;  1LT6 D;  4AQY Q;  5IGC A;  2PO4 A;  5BN4 A;  1LTG D;  4K2K A;  2WAC A;  4CGY B;  3C1E A;  5C4X G;  5JAV A;  2QKI C;  4DR6 Q;  1AZP A;  4LNQ A;  1ICF B;  1IBK Q;  2B63 B;  3AYH B;  3P7J A;  1HFN A;  2EJG C;  2EXZ A;  1VQ7 A;  3T53 B;  1GJX A;  1JIC A;  1TWG B;  5BN5 A;  1WD1 A;  3E5S A;  2JA7 H;  3JAM c;  4IUU A;  1ZEQ X;  4RA8 A;  1Q12 A;  4OWT B;  1Y1V H;  3NEL A;  4RGM A;  4LF6 Q;  3JC6 6;  4QL5 A;  5GQO A;  4K14 A;  3IRB A;  4K8J A;  3VR2 A;  1F2Z A;  1ILP A;  2D2C C;  4RHR A;  4M8A A;  2RBM A;  5GRO A;  2DNE A;  2PQE A;  2BE5 D;  4R4O A;  1TS3 A;  1XTC D;  1CKN A;  3GTJ B;  3TP6 A;  1ML0 D;  3CC4 A;  4DXF A;  5C4X B;  4P2C B;  3GV3 A;  4UAI A;  1QCB D;  1K73 C;  5CGK A;  4HAE A;  2E2D C;  2F3I A;  3I73 A;  2NN6 H;  4BBR G;  3CCQ A;  3MTS A;  3UDG A;  4R4C A;  2D0P A;  2PW5 A;  5TSS A;  3GTL B;  3D6C A;  5IGG A;  4CDC C;  1HNW L;  1HCZ A;  1FVI A;  1XMO L;  3QB3 A;  1EFI D;  1W3S A;  3GQB A;  2EY5 A;  2Y0S E;  5DEH A;  1HTL D;  1G91 A;  1FNW A;  5L37 A;  1HZC A;  2EYM A;  1D1K A;  4NXN L;  4C56 C;  2XNA C;  3FKI G;  1K8A C;  1XNQ Q;  5FLM H;  1A63 A;  2IX0 A;  3C3L A;  4KHZ A;  3A5Z B;  3D8G A;  1I94 L;  4GNX B;  4RKB A;  1CK1 A;  1I6H H;  2NVX H;  3J81 E;  4G7O C;  4DR1 Q;  2K01 A;  4IZ8 A;  2EQS A;  3GP7 A;  1KHI A;  4XT1 B;  3T13 A;  1VQJ A;  1QZG A;  3I56 A;  2JA9 A;  4FXK C;  5C5L A;  4WFN 3;  5EPJ A;  1Q1E A;  2ZTC A;  3ITP A;  4JOI C;  4DAY A;  2R7Z G;  3UE1 A;  2Q2T A;  1NNX A;  2NVQ H;  3M3Y H;  1PZI D;  3PSI A;  1QZH A;  4HSV A;  2R92 G;  1O7Y A;  2K1B A;  1J5E L;  1JC7 A;  4XIG S;  5KIX A;  2Z8L A;  1DGS A;  4GLX A;  1PMR A;  3PO3 H;  4LF5 Q;  2EZV A;  2XWJ B;  4DUY Q;  4A3E G;  3HOW G;  2F0P A;  2PI2 A;  3G7L A;  1CHP D;  1MSH A;  3GTL H;  2A69 C;  2F0Q A;  3FKI B;  1LT5 D;  5LMN L;  1JJG A;  4JI2 L;  3HOV B;  2E8G A;  2KCM A;  2ZXP A;  1M4V A;  4K0K L;  2UUA L;  3I4M G;  2VY3 A;  2RCF A;  4KHV A;  1G8Z D;  1ASZ A;  1X3P A;  3GTK B;  2IT1 A;  4DN4 M;  1U4L A;  4ZQ3 A;  1A2U A;  4BBR B;  5CC4 A;  1LYL A;  1KDA A;  5COY A;  4C3J H;  4POF A;  1WCM B;  3Q22 A;  4DR5 L;  2HIV A;  2KQ3 A;  1EFW A;  4HJ8 A;  4X3S A;  1I50 B;  1U4M A;  4O0A A;  5FKA C;  3EFX D;  1G6Z A;  5LMN W;  1E2W A;  4FYD A;  1CHQ D;  5FLX c;  4OX9 L;  2QF7 A;  1HR0 L;  2A5H A;  1I4Q A;  3Q24 A;  1Y1W G;  1PH6 A;  2BDO A;  3L3O C;  4A3D G;  3KJP A;  2E2I H;  1QG7 A;  3U4Z A;  1U0L A;  1TY2 A;  3U58 A;  3IFT A;  3QG1 A;  1SMY D;  2F0V A;  4XTC S;  1HNX L;  2FJ2 A;  4H7B A;  1MD2 D;  1G2S A;  4XT3 B;  2MHV A;  1BKB A;  1B53 A;  3CPW A;  2VUM H;  2YU9 B;  1D5X C;  1CUK A;  2AQ2 B;  4DNI A;  4GOP A;  2LXJ A;  1KAW A;  1MKH A;  5EKK A;  3OMC A;  3PUX A;  1U4P A;  4A3F H;  3RZO B;  4EQP A;  4IPH A;  1HA6 A;  1AZQ A;  1TR5 A;  1JWU D;  3L7Z C;  1NMG A;  1VQD A;  1B9M A;  5CR3 A;  4BY7 H;  4KHP L;  1HZ9 A;  1AE2 A;  2K5Q A;  3K6O A;  2EJM A;  3W1B A;  3CQZ B;  2CW0 C;  5IGE A;  4F8M A;  4B3S L;  3OIQ A;  2FFK B;  1FD7 D;  1KLU D;  3J81 i;  2BA1 A;  4DV4 Q;  3HFZ B;  1BF4 A;  2R7F A;  4ILW A;  4OIK A;  4OGQ C;  4G7H C;  1EOV A;  1NCV A;  3VYS A;  1SNO A;  3H0G B;  4DV0 Q;  1A0I A;  3MXN A;  3SGI A;  3SK6 A;  1R9T H;  1KRT A;  1B7Y B;  2JE6 I;  4LF4 Q;  1E2V A;  1K0R A;  1GUS A;  5M5X B;  2PQA A;  5GAE C;  1GD7 A;  2K05 A;  2CHB D;  5DNF A;  3S15 B;  4WJW A;  1D7Q A;  1SAP A;  5ELC A;  1DON A;  1S72 A;  1A3V A;  3OHX C;  4B9X A;  3Q23 A;  1KXL A;  2NB0 A;  3G6E A;  1SXT A;  4DUZ Q;  3MXG A;  1BCP F;  2ZJP A;  3RUZ A;  4GLV B;  5A2Q L;  3BVZ A;  3SR1 A;  5DM7 3;  1HR0 Q;  4AQY L;  1TII D;  1PTO D;  1W6K A;  2F03 A;  4RG1 A;  5GAD C;  1EQQ A;  5LHY 1;  1TT2 A;  3NE5 B;  1SE2 A;  5COR A;  3CCU A;  5ELE A;  4CBV A;  3TQY A;  1VQC A;  3NEN A;  4BA1 I;  4MTN A;  4EGV A;  4MIU A;  1IBK L;  2GVA A;  1Q7Y C;  2KUM A;  2B2Y A;  2NWG A;  5IOD A;  3CPF A;  4YHH L;  3J7Y W;  1SR3 A;  4C2M B;  4IPD A;  5M3F G;  2MP1 A;  4A3J H;  2Y0S G;  3W3A A;  5I2Y A;  5A35 A;  1TWA B;  4RGN A;  5M3F B;  4OL7 A;  4WRD A;  4X3U A;  1TS4 A;  2QDB A;  1EU3 A;  2F0W A;  2K5H A;  4RWS C;  1PH5 A;  1TU2 B;  1BR9 A;  1RKN A;  2N55 A;  3GV6 A;  2ICI A;  2VB2 X;  4QIW B;  3MA2 B;  4DV1 Q;  3FEW X;  4A3K G;  3QIA A;  4AIM A;  2A69 D;  1L0X B;  3ERS X;  3K8A A;  5EKI A;  3JAM E;  3L2P A;  2OXP A;  1FJG L;  2A6H D;  2F0U A;  3KYH C;  4YWM A;  2LMC B;  5FO9 B;  4QF4 A;  5KGU A;  4LW1 A;  4QY7 A;  1MHW C;  4KMU C;  1JT8 A;  4HR7 B;  4JI7 Q;  1Q8K A;  1Z7T A;  3S1M B;  2NVY B;  2JA6 G;  5CV6 A;  2Z6B A;  3CCJ A;  5KEE A;  1K28 A;  1N32 Q;  1VQL A;  2AMC B;  1HH2 P;  2JA6 H;  4CKE A;  1DJR D;  1HNW Q;  4DK1 A;  1HFG A;  3I55 A;  4DR4 L;  3DXJ C;  5ISR A;  1EYA A;  1PRT C;  3HOY H;  1EIH A;  4YCW A;  1NBW A;  1V9P A;  1Q90 A;  4IJL A;  4NXN Q;  4B08 A;  4O1N A;  2K04 A;  3GO5 A;  1YHQ A;  1D1I A;  3RN5 A;  3KOJ A;  5KNB A;  3PCO B;  1OXT A;  2EYJ A;  4ZK9 B;  2PZT A;  1D6E C;  4QMG A;  4L5Q A;  2HDM A;  3F2C A;  2FHT A;  3S1R H;  1KL9 A;  1LTL A;  3OIP A;  1EZ6 A;  2A74 C;  2OTL A;  3AFQ A;  1SNC A;  1WTP A;  1AEX A;  1VQN A;  5M5W B;  3RZD B;  3RN2 A;  3HOX G;  2A6E C;  2E76 C;  2D9U A;  2VQE Q;  5G3L D;  2F0K A;  2GA4 B;  4A3C G;  2A68 D;  4NPS A;  3R2I A;  2IL8 A;  2D0O A;  3KDF A;  5T1G A;  1YEZ A;  3HGB A;  1YIT A;  4LF7 Q;  1VMP A;  3NTH A;  2O5J C;  1N33 Q;  4KKU A;  2Z1C A;  3I91 A;  2B3G A;  4B3M L;  1Y1W H;  4IUN A;  1X32 A;  4FP5 D;  1K83 B;  5M5Y B;  1C9O A;  1QVG A;  1IBL L;  2NYZ D;  3PIO A;  1V8Q A;  2EY1 A;  3ULP A;  1DOK A;  1T5E A;  2RHQ B;  2B2U A;  5EBC A;  4JC0 A;  1K9M C;  3K5O A;  3K59 A;  3HKZ B; 
#chains in the Genus database with same CATH homology
 2RCF A;  4JVZ A;  2Z9H A;  4N8F A;  4I7A A;  4JW0 A;  4N8X 1;  2HD3 A;  2QW7 A;  5L37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...