2HD3A

Crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
molecule keywords Ethanolamine utilization protein eutN
total genus 11
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2hd3A00
4I7AA 2RCFA 2QW7A 4N8X1 2HD3A 2Z9HA 4JW0A 4N8FA 5L37A 4JVZA
chains in the Genus database with same CATH superfamily
3GO5A 5EPKA 1N32Q 3A7AB 3PO2H 4IOAA 1KIXA 1IBMQ 2EYPA 2VXWA 4AQYQ 2F3IA 2WAQG 1JC7A 1PH9A 1K0RA 1BDOA 1LTLA 4L63B 3VDYA 4I65A 1NR2A 3Q8DA 3T53B 1K3RA 5EKKA 4BXXH 3VR6A 1BUVT 1VQAA 2I5LX 1Q81C 3FPUB 1CZWA 1U0LA 1JCKB 2TSSA 1A2TA 1B1ZA 1B8AA 3RZDH 4JI4L 1R4PB 3ZYYX 3I4MG 2YTYA 5ELDA 3TEHB 1E24A 1LV9A 5G3LD 3KDFA 5JJKA 3Q6SA 3TDQA 1E0BA 4K5WA 4IJHA 2Q2UA 1N33Q 3HEJA 3RLNA 2F0NA 2A6HD 3CP0A 3LWUA 4ZUJA 4JOIA 1PTOH 2B63G 2F0TA 2I5HA 4DU9A 2ZTCA 3E6ZX 3NSWA 2PZWA 4ZYSA 1VQ4A 3CCEA 2Z6KC 2F0JA 4PQXA 5IIFA 2IHEA 3GTGH 3TP7A 5C4XB 5IP9G 2NVYB 3IL8A 4C3JH 4DUZQ 3FPPA 3ERSX 5IOCA 2F0DA 1WD0A 3P1HA 4JI1Q 1I4GA 1KRTA 2A68C 3K8AA 1FNVA 3GP7A 3T13A 4F8MA 1VF5C 4F87A 2DUDA 4JI8Q 3TS0A 1QWYA 4KKTA 3CMEA 1EY9A 4CDEC 1H9SB 4KKSA 4YHHQ 1SYCA 1ZYRD 5EJWA 4A3MH 3UDXA 4LF8Q 3GTOB 3S15B 3I91A 1EY5A 1F2YA 4NW2A 5F2DA 1N8RC 1X9NA 1YHAA 2XWBB 3C2PA 1LTRD 3GTLH 3HOXB 2PI2A 1VQPA 2R92G 3SK6A 4LF4L 1TWCH 4KD4A 2QF7A 1YZ6A 4HIMA 1BKBA 1I50H 2ZM6L 5CC4A 3FKIG 5IY0A 2I46A 5IGGA 1XYIA 3J80i 3D6CA 1C48A 4DV2Q 1LABA 3MWYW 1G91A 1YHBA 1X54A 2RQXA 3ERQA 1WTPA 1J6QA 2F1MA 3WDNA 2BH2A 1DOLA 1LM0A 2A5HA 2Q8RE 1KABA 2E5LQ 2EY1A 4V190 4B08A 4HJ7A 1ESRA 2A6HC 3SXHA 4CDCC 5IYDH 1SSOA 3JAME 1L0XB 2B8GA 5FJ8G 3S1MH 3CHBD 3DLLA 3RZDB 3I70A 2F0FA 2L9HA 4A3IB 2B2YC 4HJ9A 3I4OA 4B3ML 1PVOA 1QJOA 4U673 4NXMQ 2JA7G 1FJGL 4IJLA 1RL2A 2VQEQ 5ELEA 1JT8A 2IHFA 5IGDA 3URYA 4DXGA 4DR5Q 5LL6X 4LF9Q 4LUOA 2X6GA 5GAEC 4BY7H 5FLXE 3CC7A 1B9MA 4F88A 3CCSA 2IL8A 1SE3A 1CHQD 3OIPA 2VUMB 3MHBA 2HDLA 2K5WA 4KN7C 4UDUC 3UI2A 1DD2A 3GD7A 1NR4A 3E3XA 4A3EH 1U4MA 2ENBA 3QO2A 4NMZA 3D8GA 2WKCA 4HIOA 2WIIB 3FDTA 4R1JA 4AH6A 1STEA 3MEHA 5C4XG 3J7A5 3PUWA 1GKHA 1EZ8A 1LACA 1HR0W 4JBKA 4XYQA 3D6WA 1D8LA 4C3IG 1HTPA 4IN3A 3KLSX 4AYBB 1UUPA 3MFGA 1JJ2A 2QDLA 5DLQE 4GOPA 3DWAA 3TREA 4R4IA 2PI2E 1S72A 1GUTA 3IRBA 4CBVA 4G7OC 4DV1L 4KHPL 1STBA 1PLFA 4NKLA 3A8IE 3N6RA 1SN8A 4YY3L 1LTAD 2KCTA 2PW7A 1JJCB 3S14H 4MTKA 3STBD 1SR3A 5ISRA 5BN4A 4YCWA 2EXDA 5LMNQ 1F2LA 1Y1VG 1PH7A 1SNOA 1OXTA 1L1OB 4EQNA 4DAYA 5FK9C 2K7VA 1V43A 2R7ZB 4IPHA 4KJNA 2WFWA 2JA8B 2OTLA 4IPGA 4A3GG 3KF6A 1PFBA 4DNRB 2N55A 1N36L 1V1PA 4K8JA 2I5MX 2WAQE 2QDBA 1EU4A 1F2ZA 2Z4HA 2AQ3B 2OQ0A 1TU2B 3I7FA 1EL0A 2R3ZA 1QNUA 1VQCA 3RUZA 1JE4A 4ZCKA 5LMUQ 1BBUA 4JW0A 1Q1BA 1T5EA 1U9RA 3KLRA 2D0OA 3FHWA 2YYZA 4UAIA 3CCUA 2K14A 5IWAQ 4FF4A 1XPUA 1UNSA 5FLMH 1SNPA 3VYTA 5DEHA 1RTNA 3A55A 1I3QH 1I4QA 1X3GA 1SFOB 5A2QL 4GOPC 4A3IG 4A3DH 4P73A 3EROA 4G57A 5J3BA 4LFAQ 2B2YA 1JWMD 1WCMG 4YWMA 4IURA 1SNMA 1I6HB 3OTOL 1JOQA 5KYIA 2YTVA 2ATWA 2RF4A 2IX0A 1SJED 5C3EH 1EFWA 1N34L 1JMCA 2QA4A 4Q5VA 1S40A 1KLGD 2OXPA 4X6AH 2F0GA 2XTIA 3PUYA 4RGMA 5JOBA 1L0YB 2F0IA 1HHVA 3BJUA 1HRJA 4R4OA 3R2TA 2H4OA 3W5OA 4JI5L 1I4RA 3HOZG 1A6XA 2VY3A 1PHJA 1GUWA 1ENFA 1IYJB 3MXGA 1R4QB 2UUCL 2C9OA 3EIVA 1A3TA 1LT5D 2RVLA 4QGUA 5E4WC 2HHHL 1Y1WH 3KF8B 4DV0Q 2DNEA 1CA5A 4QF4A 1II3A 4CJ0B 5IGCA 1ZEQX 1EWHA 4OXPA 3EJIA 5G3LF 2I07B 3KOJA 4LF6L 2HD3A 4DN4M 5JPMC 3S9WA 1XPOA 5IYBG 2Q8TA 5M5YH 2KQ3A 4POFA 4JYAL 1Q8IA 5DAUA 1QVCA 4PZ6A 2Z6BA 5DM73 2X6LA 1PRTD 4I7AA 4LF7Q 3HFZB 2FHTA 3HOWG 3GTMB 3M85A 5K5PA 3QOLA 1WFQA 3PO3G 1PXUA 5JPNC 1TT2A 1WD1A 4DV3Q 3TMEA 3GTLB 3T1HQ 4X65L 3X3NA 4DV3L 2XNAC 2HIVA 4A3FB 3PUZA 2PW5A 2D0PA 3PV0A 1HNWQ 1ASYA 4X66Q 3C46A 1RTOA 2CWPA 2LKVA 2OT2A 1WTWA 1VF7A 4B3RQ 2KOLA 4Y7NB 4A93B 1VQHA 1HA6A 2B3GA 1PZJD 1ZXTA 2L5TA 4HMIA 4BA2I 1TKWB 1I4HA 4OX9Q 3CCQA 1S5BD 4YCVA 4A3FH 5CGKA 3R8BA 4JYAQ 1PDQA 1SXTA 3U4ZA 2R6GA 2EJGC 1C4QA 2CW0C 1I94L 2F3VA 4LF6Q 3S1QB 3GTPH 3JAML 4KN4C 4A3JB 1KTKA 4A93H 1J5EL 1B53A 4HEDA 4K2LA 4DV0L 4DR4L 2PQAA 2HHHQ 5BN5A 1SAPA 1QUQB 1OXXK 2QILA 1QVFA 1UE6A 4A3CG 1EUJA 1WCMB 1EQVA 4OL7A 1CKOA 2DGYA 1TWGH 4WJ3M 4DR6Q 1TWHH 4WJ4A 4K5VA 2NZHA 2ZJQA 2F0EA 1FGUA 1D7QA 2CH4A 4NP5A 2K5VA 4IZ8A 1XXGA 2D5DA 2O4XA 4ALPA 4GLXA 3K5OA 2SNSA 1V1PB 2K5HA 2NB0A 5C0XJ 1CK1A 1CQVA 1N34Q 1S5CD 1RJTA 4JI6L 3J81j 4H44C 3H0GG 2NN6H 2RDHA 4JC0A 4UP9A 4FXGC 5C44G 1ENAA 1KNEA 2A68D 3M4OB 2B63B 2NZ1D 5IODA 2L4NA 1QE6A 4HCSA 1JICA 4OIJA 2K05A 3J80L 4LFAL 1KLUD 1WOCA 3A74A 3GTJH 4A3KH 3LWEA 4OHJA 4RKLA 1ILPA 2A73B 3TSSA 1AZQA 3L0OA 1ET9A 1RIPA 4FXDA 3G71A 1RDPD 1A3UA 1VQOA 4MNOA 2PZTA 3IAYA 4ZKCB 5C0XI 3HG9A 3I3CA 1SMYD 1HPCA 1AH9A 3CQZB 4HJ8A 2PNRC 2UXDL 1EWCA 4XT1B 4EGVA 4DR6L 3HOVG 4P75A 3T56B 1KAWA 2EXZA 4OGQC 1IBKQ 2UU9Q 2MFIA 2F4VQ 3BZKA 3L7ZC 5CV7A 3KF6B 3H3VC 3H94A 4DR4Q 5EGTA 3HOXG 3LGJA 1MSGA 4UP8A 5AFWA 3A8KE 3FP9A 3NBHB 4RA8A 4IFDI 1B2TA 4QCLA 2QGQA 2Z9HA 1F9PA 5KNBA 3CPFA 2ZXOA 3BYYB 4JOIC 1E22A 1U4RA 3HKZB 4KHPQ 2AWNA 2G5DA 2RSNA 2BOSA 3NE5B 3HOUH 5JEAG 3TQYA 3FRPB 4B3RL 5EAYA 2KCCA 4DR1Q 4X66L 4O2DA 2RHSB 1HR0Q 2PPBC 1TWGB 3K59A 1IYUA 3CCVA 1DJRD 4X65Q 3S24A 4KK7A 5FLXc 4RAUC 2XRSD 1IKMA 1Q12A 3J7YW 3OIQA 3I4LA 5IP7G 2GN5A 1EY4A 3AFQA 4HMJA 1H9MA 1DONA 3X3MA 1SBBB 1SEBD 2UUBQ 2BA0A 1I4PA 3NEMA 4YIJA 1EIHA 1A0IA 4DV4Q 5ELFA 2H5XA 5FOBB 1TY2A 1NNXA 1NY4A 1HZBA 1SROA 3CPWA 2Z4IA 4DR5L 1EIYB 1A2UA 1GM5A 5JVH3 2N3SA 2VQEL 4POGA 3BDOA 2VUMG 3S1RB 5IGBA 4NXML 4IFDH 4NPSA 5D3IB 3U50C 2RCFA 5CV9A 3D31A 2UUCQ 1TWFB 2KVMA 2R92H 1IHZA 1CFMA 1D5XC 3A56A 4GN4B 2JA6B 2EY2A 1LYLA 5KNDA 5CV8A 5CMDA 1VQKA 3AMUA 4UPAA 2KEEA 4R4TA 4O1NA 1AEXA 3J7AF 4LF5L 5A35A 2DN8A 4A3BB 2D9UA 1G6PA 4C1NI 4K5XA 2B39A 3BYTB 1CQFA 3I90A 2GA4B 5EKLA 4LF4Q 1AW7A 2LXJA 1Y1VB 5IT9E 1SYEA 3I4NB 1VMCA 5JVG3 3TZDA 1X3EA 4BY7B 1M1KC 1Q8KA 4BBRG 2Z8LA 2I0QA 1DYQA 2JA8G 3FVQA 2DJFC 4KLKA 4DV6L 1BCPF 3HOXH 5GAGC 2EOTA 4LFBL 1CM9A 2PMZE 2KHIA 1E2WA 1IW7D 2K4KA 4IFDJ 1LT4D 3OYYA 2EIFA 5IT9c 4A3GH 4DNIA 3BDLA 3K80C 4X3KA 2R93H 1LTID 4LW1A 4JI8L 4GOPB 1TR5A 2QKIC 3PUVA 3V2TA 2Z6KA 1PZID 2G9HD 4J15A 5M3MH 4RKBA 3PO2G 4B9WA 5I4DA 1FD7D 4DKAC 2NVTH 2ICEC 1GUSA 1IW7C 4L5SA 2AUKA 2EYJA 2J7ZA 3FKIH 3O13A 3T1YL 1MHWC 5JJZA 1K8MA 4A3GB 1RODA 3EBEA 2P5ZX 4C2MB 1DCZA 1JOOA 1D5MC 3FEWX 5C0XG 1B9NA 4QB4A 3IKJA 3QG1A 1ZYRC 5C5LA 2NVQH 4DA2A 5FLMG 1VQFA 3AYHB 5CV4A 5LMNL 2F0LA 5E3FA 5JAVA 2WV6D 1D5ZC 5I6WA 2DJGC 3I73A 2JA5G 5BR8Q 2L55A 2WACA 1CI3M 1C8CA 4DV1Q 1E2ZA 2AUJD 3SEBA 1CHPD 1Z7TA 4CDDC 3M4PA 2E8GA 4A3JH 2K50A 3Q23A 3NBHA 1BOSA 2PMZB 2VUMH 4IPDA 1XMOQ 3NTIA 1KDCA 2B63H 1OXVA 1EOVA 4JBMA 1HJPA 1M4VA 3MA2B 3NTKA 5LMNW 4FNFA 3DHQA 1YNND 3MEFA 2XWJB 4P71A 2NVXH 1W3SA 2JA6G 3NELA 1WTXA 4KHZA 3NP8A 1SFOH 4LNQA 1E1TA 3K5LA 2AQ1B 3QR8A 2IWHA 4LF9L 3GTGB 3D4DA 1UAPA 2K1BA 1VQ6A 1CSPA 2EPBA 3A5UA 4Y52H 4NDXA 1WYDA 4CHTB 3PIPA 1LTTD 1UE7A 3J7ZC 2MP1A 5IYCH 3AEVA 1QB5D 1FJGQ 5L37A 4GKKQ 1DXMA 3M9BA 1LO5D 2O2LD 4B3MQ 5EPJA 1CA6A 1BCPB 3PO3B 1K8GA 3G6JB 2A69C 3E0EA 2N78A 4LFCQ 4DXFA 3STBC 3ND8A 1W2BA 1QZHA 4RHRA 3OPOA 1PH5A 2E5LL 1EY8A 2R7ZH 1NMFA 1TXYA 1Z47A 2EVBA 1JE5A 4FP5D 3C3LA 3EN2A 2K28A 2J0TD 2EY5A 1PRTC 4DV2L 1BNZA 1VQLA 1OXUA 2JE6I 2K01A 2K6AA 1XTDA 1GUOA 3MZ5A 4DF7A 3AFPA 4HIKA 3HOZH 5D14A 2VL6A 5CR3A 1S5ED 3SR1A 1EU3A 1UE5A 3A7LA 3QB3A 4A3FG 2F0OA 1HNZL 4L8JA 4BBSH 1H9RA 2KA7A 1EEID 2V4DA 4DK0A 3GV6A 1RCVD 3OMGA 3Q0AA 1MI2A 4A75A 4A93G 4LF8L 1TWHB 4YHHL 4ID6A 4WFN3 3PGZA 4PMCA 4A3IH 3TP8A 3G7LA 2F4IA 3KLSA 5A2QE 2L11A 1EIGA 4A3JG 5KEEA 1YVCA 1YI2A 1HUMA 2N8NA 1ILQA 2WB1B 2PNHA 3GQBA 1HFNA 3RNUA 3SDZA 4IO9A 2ID0A 5C44B 3H09A 3RZOB 1U4PA 3DM3A 5M9OA 4C3HG 1YEZA 4KI0A 2A69D 1STGA 1O7LA 1ET6A 3Q22A 1T5XD 1STHA 4J6HA 2NTSA 5FO9B 4JG2A 3W1BA 5M5XH 1IL8A 1SYGA 1QG7A 4BY1B 1BXTA 2KCMA 3TP6A 4XQJA 2QCPX 4UP7A 3S2HB 5KIXA 3SHLA 1R9TB 2TMPA 5C4JH 1SMXA 1SE8A 2VS1A 2ZXPA 1HNZQ 3VYSA 1A63A 2YU9B 4LJZC 3TZUA 4EQ5A 1O7IA 1GOZA 3PIOA 2E2DC 1AN8A 5I9OA 1BO0A 1BCPC 2ZTEA 2IW3A 4X3TA 1LTBD 4Q0FA 5IE8A 2JA9A 2WB1E 4OELB 2K04A 1GHKA 1XPRA 4LF5Q 5EKIA 1HTLD 1N9WA 1SDFA 3C1FA 1XJVA 5C6AA 3M3YH 1K0SA 2CQOA 1NTGA 3HKSA 2VB3X 1NSNS 1HH2P 5KNCA 3S17B 3J81L 4BY1H 1XWEA 2JA7H 1QILA 4LFCL 2B2WA 5CORA 3H0GH 3HOVB 4KKUA 5C4JB 3I72A 4KJOA 2JP1A 4DR2Q 2E74C 1I5FA 3M3YB 2ICIA 1M90C 4A4IA 3AB9A 4GKKL 1HUNA 4BBSG 1L0WA 1PTOB 2CHBD 4X3SA 4A3LH 4GN5A 2Z0SA 3UE1A 2GVBA 2HT1A 1ENCA 1QCBD 4B9XA 5LHY1 3SK8A 4DAPA 3MAQA 2UUBL 3OOCA 3CKIB 2B2TA 4AIMA 4QQBX 1SE2A 3J81E 3BG3A 1A15A 4QJFA 2L15A 1VQMA 5JJLA 3HGBA 2LMCB 2PYKA 2HCIA 4OO1I 3QJYA 4YWLA 1EOTA 1SYFA 2IX1A 2G9DA 3VR3A 1EY0A 1XMOL 3CF5A 2RKSA 1C9OA 1XNRL 1HR0L 3KYHC 3V96A 4DR1L 1KDAA 1TWFH 1EYDA 1MGSA 1RD9D 1PRTB 4FF1A 3H91A 1R9TH 3GTQH 4IFDG 4F7XA 4Z9CB 5BR8L 5AJ3L 1KNAA 5I2XA 2R7FA 1PYSB 1X65A 3S2DH 2VW9A 3D0FA 3GDEA 2E76C 5IGEA 2RCNA 1BF4A 4RMFA 4WRDA 4XYOA 2K33A 2N88A 2NZOA 3I8ZA 1TY0A 3KJOA 2NVYH 4A3BG 1Q1EA 3MFYA 3HOYH 1GD7A 2E2IB 2UU9L 2F4VL 1F9SA 1PYWD 4OWXB 3T1YQ 3OMCA 3ITPA 4RG1A 4GKJL 4ZRZA 2PCFB 1OO9B 4GNXC 1D6EC 2R61A 2A6ED 1GO3E 1YITA 3OWFA 2HCCA 4LWCA 5CV5A 1IKLA 2HQLA 3R3OA 1DGSA 2JA7B 3NENA 3A5ZB 3H15A 3OHXC 3G6EA 3NWSA 5C3EB 2XVSA 1WTVA 2X69A 2JYOA 3KBXA 3M7NA 4LFBQ 3F2DA 1B4OA 1HCZA 1X55A 4DV6Q 4MTNA 1PH4A 1PFSA 4JBJA 1L2FA 4FVMA 1HZAA 1VMPA 2M2LA 5HURA 1FR3A 4P2CB 4RHSA 1S5FD 4DK3C 2ALYB 3ONAB 4N9PA 2DY8A 1B70B 2XIWA 2DY7A 1Y69U 4BBSB 1H95A 4JI6Q 4C3JG 2F0KA 4HSPA 3F2CA 4H7BA 2KEDA 3HRZC 1G2SA 1A8VA 1D1IA 4AYBG 3U58A 4ULLA 1K73C 4H02A 1HZCA 4JBWA 2F0WA 4RCNA 1LUZA 1HXYD 1S5DD 4LK1C 5FJ8H 3G4SA 3MC0B 4GLAC 2KCNA 1Y8PB 2BCOA 2MO1A 3PO2B 3IFTA 4DAYB 4JI3Q 1B3QA 4OEMB 4DR7L 3KK7A 1KHIA 3C1EA 1YJNA 4K2KA 3KFUA 3KBGA 3P20A 5EBDA 4DV7L 1P16A 4MZ9A 3S1NH 3NHHA 3ZJYC 2KJXA 3EQLC 1I94Q 1JB3A 2AQ2B 2AHOB 1CZGA 4DV4L 4FO2A 4EVOA 1V9PA 1EY6A 1ZKOA 1B7YB 3ICEA 1KRSA 1EIFA 4ABNA 4WJWA 1PMRA 1K3BC 2A1AA 1MIUA 1TS3A 3P7JA 3HOUB 2GVAA 4KD3A 1L1OA 1F77A 1PA6A 2CCZA 1TQOA 1TWCB 5CBAE 3GTPB 1HNWL 1DZ1A 2R7DA 5IP9H 2KUMA 2UXBL 2RDGA 1A3VA 3EA6A 3T1HL 1WTHA 5IYDG 5FLXL 4C56C 5C4ZA 4OWTB 3GV3A 1F9QA 4QIWE 4B3TL 3MXUA 1VQJA 2PO4A 5ELNA 4A3DB 2VB2X 3CCRA 5TSSA 1XX8A 5M5YB 1VQ5A 4LMQD 3RN5A 1Y1WG 3CQZH 5C5MA 1NAPA 1I6HH 1GXDC 2QEJC 2AWOA 3BVGA 3WWVA 3I55A 2BA1A 1EQRA 1Y8OB 4IUTA 4X3UA 1KC8C 1KD1C 4B3SQ 2K75A 2UUAL 1ONLA 2EYLA 2IJ0A 1JWSD 4OO1G 1WTQA 2HIXA 2SDFA 4IUQA 1J8IA 4LUZA 1PH2A 2IX3A 3AQQA 3UDFA 5EBCA 5FO7B 4FXKC 4JI7L 5M3FH 1NUCA 1LT6D 4A3EG 1IBKL 1G2TA 1Q86C 1Q90A 1EYCA 1RHPA 5C3WA 4L6TB 3BS1A 2EZVA 4ZAIA 4EQPA 3FMCA 4JI5Q 4QUCA 4R8NA 4CKEA 2LSSA 3CC4A 2UXDQ 3D3RA 2VQFL 5EQ0A 1PTOC 1UEBA 5I9PA 2JA6H 3BZCA 1PH3A 3R93A 1Q46A 2BDNA 2ASBA 4XT3B 4JI2Q 3OW7A 4U68A 4M8AA 2NVQB 3KJPA 1VQEA 2F3WA 1HNXL 4OWWB 3BDCA 3MXNA 4UY8C 2E2HB 4C2MH 4E6IA 2IY5B 4KMUC 1KDBA 2MPMA 5T1IA 1BCPD 4NB3A 1NMGA 1EEFD 4NXNL 3F2BA 3S1NB 4OIKA 1CKMA 4PNYA 3VYUA 1WVLA 2K03A 5GAHC 3CXCA 2EDGA 1WCMH 2QW7A 2MUYA 3E9HA 4LAAA 1GHJA 1SYBA 1U4LA 2JJQA 4YWKA 1FNWA 2ZTDA 2JN4A 3QOJA 1AE3A 1JB7A 3OSOA 2F0VA 1VQNA 4PV1C 1UE1A 1PFMA 2OF1A 1PYBA 1FGBD 3PSIA 3RZOH 2B2UC 3OWEB 4DR3Q 4QIWB 3MTSA 3VR2A 4QY7A 2BDOA 3QWNA 1UWVA 3GTOH 1O7YA 3S15H 2XSCA 3SK5A 2PQEA 4JV5L 5IT9L 3GTQB 3K57A 4RFBA 2HDMA 4HJAA 1Y8NB 3AU7A 5LMUL 1E2VA 3KF8A 4HCEA 1K8AC 2MHVA 2Q2HA 1JJGA 4TVAB 4IUUA 3JC66 4KTAA 5IGFA 2WB1G 1O78A 1XNQL 1TWAH 2F0UA 1QUQA 2LFNA 2B2VA 3E5SA 1N36Q 1I50B 3HP3A 1MJEA 1PTOF 1EYGA 1SNDA 2WP8J 3CCMA 4K0KL 1K9MC 3W1GA 2RBMA 2Q8IB 1NJIC 1J5EQ 4A3DG 4CJ1B 4C3HB 3JAMc 4GLVB 3UDIA 4A3KG 3RMHA 1WTOA 4WORA 1Y1WB 1I3QB 1UEAB 2A74C 2K32A 1CTMA 3I2ZA 5C3XA 4ME3A 1DM0B 4OX9L 1HQMC 3HOWH 2OCEA 3MXPA 1SNCA 2B8FA 2ES2A 2OQKA 1Y1VH 3GTMH 1SJHD 4K6LA 3ND9A 3DMUA 1C0AA 2MGSA 1GVPA 1CKNB 4RCOA 1VCIA 2MO0A 4PMBA 3PIO3 3CC2A 4RWSC 3DM1A 3LNNA 5HY6A 3H6MA 4FF3A 4H0LC 1YNNC 1YNJC 5FKAC 3S14B 2V1CC 3H0GB 2RHQB 3HOVH 3HOWB 2NN6I 4KHVA 2ZT9C 4XXEA 2SEBD 4DAMA 4FF2A 4N8FA 3BVZA 3S2DB 2BE5C 1LT3D 4Y7NH 2MNAA 1VQ7A 4C3HH 1QOHA 4LF7L 1ML0D 4IPCA 4XQQA 3EFXD 5J22A 2CFMA 2A8VA 4KY5A 1RKNA 2K5DA 2F0HA 1X56A 3I56A 3NWTA 4XQNA 1YHQA 2YU9H 4R8IA 1CT1D 1ICWA 2O5IC 1I4XA 2HQEA 1A62A 2EE1A 2K52A 1FYCA 1MD2D 3EVQA 5C4HA 2F0QA 4A3CH 1VQGA 4HR7B 3E0JA 4L5QA 5ELOA 1JORA 4ZUIA 3L3OC 2XGTA 3M7GA 5C4XH 1AP0A 1E1OA 4DK6C 3NTHA 1FL0A 3DXJC 3RLOA 2EQSA 3CCJA 2AKWB 1JOKA 1BVSA 1E3PA 2JQOA 4GZYC 1K83H 4CKBA 4A3MB 2Z1CA 1EZ6A 3VYRA 4KY6A 3S16H 1ICFB 1AFPA 4JI7Q 4MIUA 4RGTA 1AZPA 3K0XA 5JJIA 3I4MH 5JEAJ 1Q7YC 4M1UB 2JA8H 1S4ZA 2SOBA 4J8QA 3HKZG 1TVXA 2ZM6Q 4KY7A 2Y0SB 2B29A 2KECA 3OTOQ 1GUGA 4C1NK 1MKHA 2L12A 3K81C 3VA7A 4S3SA 3J80c 1EFID 3TS2A 3BU2A 1WTRA 2ZJPA 1G291 3K5MA 4V0BA 3M4OH 1DOMA 5I6YA 2F52A 3N52A 4A3KB 3K5NA 3GTJB 5M3MG 2Y0SE 5IYBH 4B3TQ 5IWAL 4N8X1 4L5TA 3MVVA 2KHJA 4HAEA 1F2MA 3J80E 2F03A 3DWPA 4QMGA 2IT1A 4G7ZC 2UXBQ 1PRTF 3HS0C 1EQQA 3Q24A 3I4MB 4ILWA 2XRQD 1FNUA 1VQBA 3DEPA 4PMWA 2NUCA 2F0SA 2KHSA 1H9KA 2DNCA 3SVMA 5J39A 1PV4A 3DWQA 2XN9C 2JA5H 2K5QA 3JAMi 4LUVA 1JWUD 1KAAA 3GTKH 2NYZD 4DPGA 3HZXA 1LTGD 3SK4A 3T51B 1L1OC 5GADC 2CVRA 3A8JE 3K6OA 5DM63 4QUFA 1PFNA 5HGQA 4K0KQ 4N9TA 4IUPA 1BR9A 3F2UA 4YY3Q 2R93B 1JR0D 5C3EG 1YNXA 3LX0A 4CDFC 5JEAH 4HSVA 2C35B 4PZ8A 1XNQQ 3RN2A 4JK1C 4DR7Q 2NVTB 1OXSC 4GNXA 3TN2A 2H1EA 3F8TA 4PZ7A 2ZXRA 1NBWA 3WOFA 3A0JA 1MSHA 3T4AC 4JI4Q 1KXLA 5E7NA 4FYDA 2EJMA 2RSOA 1K8OA 5IP7H 4JV5Q 4A3LG 1B50A 4ME5A 3J81i 3SE0A 1H9JA 4DK1A 3S16B 4KV6A 1CSQA 2NTTA 4HN7A 2RDFA 1VQ8A 4DR3L 4O0AA 2JEAI 1NCVA 4C3JB 5C0XH 4AQYL 1NE3A 2A6EC 4A3MG 3CD6A 3U4VA 2JEBI 2Q2TA 2E2JH 3E9IA 1W6KA 1XTCD 2YV5A 3RR5A 3L9AX 1N32L 4ODGA 4JPBW 3J7AV 3S1MB 4TKOB 4X64Q 3J81c 4NXNQ 4DV5Q 2NN6G 5C44H 1O80A 3WOEA 3U9SA 2B2UA 5M5WB 1GUNA 4PG3A 2Y0SG 3B6YA 1KQSA 1DOKA 1LTSD 1X3PA 1X3QA 1HNXQ 3CRLC 4QL5A 3HOUG 1O7ZA 5DNFA 4JI2L 3NQIA 1HZ9A 1QNKA 1QZGA 2NWGA 3CU7A 2E2HH 2VQFQ 4L5RC 1PH6A 1SLJA 4BA1I 4K6DA 2FINB 4CKCA 2FJ2A 3HKZE 5KRUA 2VZAA 4GKJQ 2D2CC 4HJ5A 2VNUD 2OEOA 4GN3B 4TRDA 4C3IH 2JA5B 1WI5A 3CRKC 3HOYG 1YJ9A 1IL2A 3GTKB 4CJ2C 1STYA 2EJFC 2NBFA 2O5JC 1YBYA 4X62L 1TWAB 4YCUA 5KGUA 4IOCA 2UUAQ 1VDZA 1SNQA 5AJ3Q 4B3SL 2D62A 1CUKA 1ESFA 5GROA 3TP5A 4MN3A 3KLWA 2FXQA 4IQZA 1YJWA 2B2VC 3L2PA 2JSOA 4OO1H 4OONA 2C5CA 3I4NG 3K7UC 1TS2A 4BY7G 4RGOS 1Q3LA 4BBRB 2R93G 3NPPA 5M3FG 2M9VA 3CW2C 4C3IB 3NXWA 2N49A 2EYMA 3R2IA 1I6VC 2JXMB 5M5XB 4JI1L 1X6OA 3S2HH 4FDBA 4DUZL 3BZDB 3ULJA 2KBNA 3W2DA 4A3EB 1IBLQ 1V1QA 1WJJA 3PUXA 3S1QH 2FMMA 2AMCB 3NUCA 1AE2A 3K7AB 3T16A 2E2JB 2YTXA 1V1OA 2B2TC 4JVZA 1G6ZA 5H1SE 5CV6A 1B3AA 2EYHA 2FFKB 1N33L 5LL6S 1TIID 4DV7Q 5HGTA 4G7HC 2UXCL 4R9WA 2L0CA 4CGYB 3CCLA 1VS0A 1STNA 1SYDA 5K36G 4JI3L 3ULPA 4DUYL 2FMCA 2CKZB 3PCOB 4X64L 2CQAA 3RLFA 1JQYD 1K28A 3H3VH 2HUGA 5CYUA 5D65A 5ELBA 1PH1A 4JI0Q 1QVGA 1H9SA 2WKDA 3PF4A 3NK9A 4EX5A 3W3AA 2E75C 3TRZA 4XIGS 5EPLA 4P74A 2R7ZG 4GS3A 3S1RH 4GNXB 2NVXB 1VQ9A 5E1FA 3QIAA 3KDFB 1K83B 4XTCS 1IZ6A 3NQTA 1Z6HA 2F0MA 5GQOA 1BQQT 1LLRD 1EYAA 4TQUS 1IBML 1S3OA 2MJ8A 1D1KA 1J9OA 1W6JA 1ASZA 4JCVE 4P72A 4HIDA 2EYOA 3SGIA 4JI0L 2E2IH 3HOYB 2LS01 3F1ZA 3OW2A 2IPKD 1STAA 4AYBE 1OTCA 1B44D 4K14A 1BBXC 1HA5A 4DUYQ 2K5NA 2WINB 2Q2IA 3VR5A 2CH4W 4A76A 4G4KA 2UXCQ 4APVA 1PH8A 1EWIA 5FO8B 2RA4A 1EY7A 4BBRH 3DEOA 4K8IA 2WAQB 3PMFA 3K58A 3U9OA 1FVIA 4EQOA 4J1MA 3PO3H 3VR4A 2CWAA 1SMYC 1IXRA 3I4NH 4BXXG 2A19A 1T9HA 3CMAA 2J4XA 5COYA 4ZQ3A 2PQAB 3MXNB 1IBLL 4H13C 5M3FB 4TSSA 2OWOA 1BBWA 1X3FA 4HTHA 1U5KA 1EQTA 1VQIA 2L1BA 2PZUA 1X32A 4O42A 5BN3A 3PF5A 3KUPA 5I2YA 1F9RA 1G51A 3G48A 3PQIA 3K7AH 3BVMA 1Z9FA 2CW0D 5D3DA 4BY1G 1HQRD 5CBEE 3UE0A 4R4QA 3TBIB 1YNJD 1PTOD 4DGZA 2QEXA 1XMQQ 2F0PA 1M8AA 3HOZB 2MQHA 3IFDA 5ELCA 3RD4A 1CKNA 4ZLTF 2SNMA 1KL9A 2LY7A 2B2WC 3DUZA 5T1GA 5E4XA 1TS5A 2M00A 2OTJA 4ZKBB 4DFAA 1XNRQ 3K0YA 3H3VI 1XMQL 1IYVA 3PIP3 4A3BH 1V8QA 1GJXA 3A54A 3NBIA 3M4QA 5KYLA 4R4CA 4IUNA 3CAMA 4X62Q 3M4YA 2KENA 1G8ZD 1PZKD 5K36H 4MHEA 2LXKA 4BS9A 1HFGA 4BWGB 4ZK9B 5M5WH 4DAVA 5J1ZA 3S17H 1TS4A 5NUCA 1MJCA 1D2BA 1P8LA 3ER0A 1MBYA 1Q82C 4XDXA 3UDGA 4UHVA 1E7ZA 2JK8A 3ULLA 4DNTB 2EY6A 1VQDA 3P75A 2EYFA 3V05A 4RH6A 4IUVA 1SE4A 4RGNA 2ZJRA 3D4WA 1C7YA 2BE5D 1RF2D 3VA5A 2BH8A 5M3MB 4DR2L 1Y14B 2R92B 1SRUA 4I7ZC 1YIJA 3FKIB 5IYCG 4IALA 4DV5L 3D4RA
chains in the Genus database with same CATH topology
4I7AA 2RCFA 2QW7A 4N8X1 2HD3A 2Z9HA 4JW0A 4N8FA 5L37A 4JVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7A A;  2RCF A;  2QW7 A;  4N8X 1;  2HD3 A;  2Z9H A;  4JW0 A;  4N8F A;  5L37 A;  4JVZ A; 
#chains in the Genus database with same CATH topology
 3GO5 A;  5EPK A;  1N32 Q;  3A7A B;  3PO2 H;  4IOA A;  1KIX A;  1IBM Q;  2EYP A;  2VXW A;  4AQY Q;  2F3I A;  2WAQ G;  1JC7 A;  1PH9 A;  1K0R A;  1BDO A;  1LTL A;  4L63 B;  3VDY A;  4I65 A;  1NR2 A;  3Q8D A;  3T53 B;  1K3R A;  5EKK A;  4BXX H;  3VR6 A;  1BUV T;  1VQA A;  2I5L X;  1Q81 C;  3FPU B;  1CZW A;  1U0L A;  1JCK B;  2TSS A;  1A2T A;  1B1Z A;  1B8A A;  3RZD H;  4JI4 L;  1R4P B;  3ZYY X;  3I4M G;  2YTY A;  5ELD A;  3TEH B;  1E24 A;  1LV9 A;  5G3L D;  3KDF A;  5JJK A;  3Q6S A;  3TDQ A;  1E0B A;  4K5W A;  4IJH A;  2Q2U A;  1N33 Q;  3HEJ A;  3RLN A;  2F0N A;  2A6H D;  3CP0 A;  3LWU A;  4ZUJ A;  4JOI A;  1PTO H;  2B63 G;  2F0T A;  2I5H A;  4DU9 A;  2ZTC A;  3E6Z X;  3NSW A;  2PZW A;  4ZYS A;  1VQ4 A;  3CCE A;  2Z6K C;  2F0J A;  4PQX A;  5IIF A;  2IHE A;  3GTG H;  3TP7 A;  5C4X B;  5IP9 G;  2NVY B;  3IL8 A;  4C3J H;  4DUZ Q;  3FPP A;  3ERS X;  5IOC A;  2F0D A;  1WD0 A;  3P1H A;  4JI1 Q;  1I4G A;  1KRT A;  2A68 C;  3K8A A;  1FNV A;  3GP7 A;  3T13 A;  4F8M A;  1VF5 C;  4F87 A;  2DUD A;  4JI8 Q;  3TS0 A;  1QWY A;  4KKT A;  3CME A;  1EY9 A;  4CDE C;  1H9S B;  4KKS A;  4YHH Q;  1SYC A;  1ZYR D;  5EJW A;  4A3M H;  3UDX A;  4LF8 Q;  3GTO B;  3S15 B;  3I91 A;  1EY5 A;  1F2Y A;  4NW2 A;  5F2D A;  1N8R C;  1X9N A;  1YHA A;  2XWB B;  3C2P A;  1LTR D;  3GTL H;  3HOX B;  2PI2 A;  1VQP A;  2R92 G;  3SK6 A;  4LF4 L;  1TWC H;  4KD4 A;  2QF7 A;  1YZ6 A;  4HIM A;  1BKB A;  1I50 H;  2ZM6 L;  5CC4 A;  3FKI G;  5IY0 A;  2I46 A;  5IGG A;  1XYI A;  3J80 i;  3D6C A;  1C48 A;  4DV2 Q;  1LAB A;  3MWY W;  1G91 A;  1YHB A;  1X54 A;  2RQX A;  3ERQ A;  1WTP A;  1J6Q A;  2F1M A;  3WDN A;  2BH2 A;  1DOL A;  1LM0 A;  2A5H A;  2Q8R E;  1KAB A;  2E5L Q;  2EY1 A;  4V19 0;  4B08 A;  4HJ7 A;  1ESR A;  2A6H C;  3SXH A;  4CDC C;  5IYD H;  1SSO A;  3JAM E;  1L0X B;  2B8G A;  5FJ8 G;  3S1M H;  3CHB D;  3DLL A;  3RZD B;  3I70 A;  2F0F A;  2L9H A;  4A3I B;  2B2Y C;  4HJ9 A;  3I4O A;  4B3M L;  1PVO A;  1QJO A;  4U67 3;  4NXM Q;  2JA7 G;  1FJG L;  4IJL A;  1RL2 A;  2VQE Q;  5ELE A;  1JT8 A;  2IHF A;  5IGD A;  3URY A;  4DXG A;  4DR5 Q;  5LL6 X;  4LF9 Q;  4LUO A;  2X6G A;  5GAE C;  4BY7 H;  5FLX E;  3CC7 A;  1B9M A;  4F88 A;  3CCS A;  2IL8 A;  1SE3 A;  1CHQ D;  3OIP A;  2VUM B;  3MHB A;  2HDL A;  2K5W A;  4KN7 C;  4UDU C;  3UI2 A;  1DD2 A;  3GD7 A;  1NR4 A;  3E3X A;  4A3E H;  1U4M A;  2ENB A;  3QO2 A;  4NMZ A;  3D8G A;  2WKC A;  4HIO A;  2WII B;  3FDT A;  4R1J A;  4AH6 A;  1STE A;  3MEH A;  5C4X G;  3J7A 5;  3PUW A;  1GKH A;  1EZ8 A;  1LAC A;  1HR0 W;  4JBK A;  4XYQ A;  3D6W A;  1D8L A;  4C3I G;  1HTP A;  4IN3 A;  3KLS X;  4AYB B;  1UUP A;  3MFG A;  1JJ2 A;  2QDL A;  5DLQ E;  4GOP A;  3DWA A;  3TRE A;  4R4I A;  2PI2 E;  1S72 A;  1GUT A;  3IRB A;  4CBV A;  4G7O C;  4DV1 L;  4KHP L;  1STB A;  1PLF A;  4NKL A;  3A8I E;  3N6R A;  1SN8 A;  4YY3 L;  1LTA D;  2KCT A;  2PW7 A;  1JJC B;  3S14 H;  4MTK A;  3STB D;  1SR3 A;  5ISR A;  5BN4 A;  4YCW A;  2EXD A;  5LMN Q;  1F2L A;  1Y1V G;  1PH7 A;  1SNO A;  1OXT A;  1L1O B;  4EQN A;  4DAY A;  5FK9 C;  2K7V A;  1V43 A;  2R7Z B;  4IPH A;  4KJN A;  2WFW A;  2JA8 B;  2OTL A;  4IPG A;  4A3G G;  3KF6 A;  1PFB A;  4DNR B;  2N55 A;  1N36 L;  1V1P A;  4K8J A;  2I5M X;  2WAQ E;  2QDB A;  1EU4 A;  1F2Z A;  2Z4H A;  2AQ3 B;  2OQ0 A;  1TU2 B;  3I7F A;  1EL0 A;  2R3Z A;  1QNU A;  1VQC A;  3RUZ A;  1JE4 A;  4ZCK A;  5LMU Q;  1BBU A;  4JW0 A;  1Q1B A;  1T5E A;  1U9R A;  3KLR A;  2D0O A;  3FHW A;  2YYZ A;  4UAI A;  3CCU A;  2K14 A;  5IWA Q;  4FF4 A;  1XPU A;  1UNS A;  5FLM H;  1SNP A;  3VYT A;  5DEH A;  1RTN A;  3A55 A;  1I3Q H;  1I4Q A;  1X3G A;  1SFO B;  5A2Q L;  4GOP C;  4A3I G;  4A3D H;  4P73 A;  3ERO A;  4G57 A;  5J3B A;  4LFA Q;  2B2Y A;  1JWM D;  1WCM G;  4YWM A;  4IUR A;  1SNM A;  1I6H B;  3OTO L;  1JOQ A;  5KYI A;  2YTV A;  2ATW A;  2RF4 A;  2IX0 A;  1SJE D;  5C3E H;  1EFW A;  1N34 L;  1JMC A;  2QA4 A;  4Q5V A;  1S40 A;  1KLG D;  2OXP A;  4X6A H;  2F0G A;  2XTI A;  3PUY A;  4RGM A;  5JOB A;  1L0Y B;  2F0I A;  1HHV A;  3BJU A;  1HRJ A;  4R4O A;  3R2T A;  2H4O A;  3W5O A;  4JI5 L;  1I4R A;  3HOZ G;  1A6X A;  2VY3 A;  1PHJ A;  1GUW A;  1ENF A;  1IYJ B;  3MXG A;  1R4Q B;  2UUC L;  2C9O A;  3EIV A;  1A3T A;  1LT5 D;  2RVL A;  4QGU A;  5E4W C;  2HHH L;  1Y1W H;  3KF8 B;  4DV0 Q;  2DNE A;  1CA5 A;  4QF4 A;  1II3 A;  4CJ0 B;  5IGC A;  1ZEQ X;  1EWH A;  4OXP A;  3EJI A;  5G3L F;  2I07 B;  3KOJ A;  4LF6 L;  2HD3 A;  4DN4 M;  5JPM C;  3S9W A;  1XPO A;  5IYB G;  2Q8T A;  5M5Y H;  2KQ3 A;  4POF A;  4JYA L;  1Q8I A;  5DAU A;  1QVC A;  4PZ6 A;  2Z6B A;  5DM7 3;  2X6L A;  1PRT D;  4I7A A;  4LF7 Q;  3HFZ B;  2FHT A;  3HOW G;  3GTM B;  3M85 A;  5K5P A;  3QOL A;  1WFQ A;  3PO3 G;  1PXU A;  5JPN C;  1TT2 A;  1WD1 A;  4DV3 Q;  3TME A;  3GTL B;  3T1H Q;  4X65 L;  3X3N A;  4DV3 L;  2XNA C;  2HIV A;  4A3F B;  3PUZ A;  2PW5 A;  2D0P A;  3PV0 A;  1HNW Q;  1ASY A;  4X66 Q;  3C46 A;  1RTO A;  2CWP A;  2LKV A;  2OT2 A;  1WTW A;  1VF7 A;  4B3R Q;  2KOL A;  4Y7N B;  4A93 B;  1VQH A;  1HA6 A;  2B3G A;  1PZJ D;  1ZXT A;  2L5T A;  4HMI A;  4BA2 I;  1TKW B;  1I4H A;  4OX9 Q;  3CCQ A;  1S5B D;  4YCV A;  4A3F H;  5CGK A;  3R8B A;  4JYA Q;  1PDQ A;  1SXT A;  3U4Z A;  2R6G A;  2EJG C;  1C4Q A;  2CW0 C;  1I94 L;  2F3V A;  4LF6 Q;  3S1Q B;  3GTP H;  3JAM L;  4KN4 C;  4A3J B;  1KTK A;  4A93 H;  1J5E L;  1B53 A;  4HED A;  4K2L A;  4DV0 L;  4DR4 L;  2PQA A;  2HHH Q;  5BN5 A;  1SAP A;  1QUQ B;  1OXX K;  2QIL A;  1QVF A;  1UE6 A;  4A3C G;  1EUJ A;  1WCM B;  1EQV A;  4OL7 A;  1CKO A;  2DGY A;  1TWG H;  4WJ3 M;  4DR6 Q;  1TWH H;  4WJ4 A;  4K5V A;  2NZH A;  2ZJQ A;  2F0E A;  1FGU A;  1D7Q A;  2CH4 A;  4NP5 A;  2K5V A;  4IZ8 A;  1XXG A;  2D5D A;  2O4X A;  4ALP A;  4GLX A;  3K5O A;  2SNS A;  1V1P B;  2K5H A;  2NB0 A;  5C0X J;  1CK1 A;  1CQV A;  1N34 Q;  1S5C D;  1RJT A;  4JI6 L;  3J81 j;  4H44 C;  3H0G G;  2NN6 H;  2RDH A;  4JC0 A;  4UP9 A;  4FXG C;  5C44 G;  1ENA A;  1KNE A;  2A68 D;  3M4O B;  2B63 B;  2NZ1 D;  5IOD A;  2L4N A;  1QE6 A;  4HCS A;  1JIC A;  4OIJ A;  2K05 A;  3J80 L;  4LFA L;  1KLU D;  1WOC A;  3A74 A;  3GTJ H;  4A3K H;  3LWE A;  4OHJ A;  4RKL A;  1ILP A;  2A73 B;  3TSS A;  1AZQ A;  3L0O A;  1ET9 A;  1RIP A;  4FXD A;  3G71 A;  1RDP D;  1A3U A;  1VQO A;  4MNO A;  2PZT A;  3IAY A;  4ZKC B;  5C0X I;  3HG9 A;  3I3C A;  1SMY D;  1HPC A;  1AH9 A;  3CQZ B;  4HJ8 A;  2PNR C;  2UXD L;  1EWC A;  4XT1 B;  4EGV A;  4DR6 L;  3HOV G;  4P75 A;  3T56 B;  1KAW A;  2EXZ A;  4OGQ C;  1IBK Q;  2UU9 Q;  2MFI A;  2F4V Q;  3BZK A;  3L7Z C;  5CV7 A;  3KF6 B;  3H3V C;  3H94 A;  4DR4 Q;  5EGT A;  3HOX G;  3LGJ A;  1MSG A;  4UP8 A;  5AFW A;  3A8K E;  3FP9 A;  3NBH B;  4RA8 A;  4IFD I;  1B2T A;  4QCL A;  2QGQ A;  2Z9H A;  1F9P A;  5KNB A;  3CPF A;  2ZXO A;  3BYY B;  4JOI C;  1E22 A;  1U4R A;  3HKZ B;  4KHP Q;  2AWN A;  2G5D A;  2RSN A;  2BOS A;  3NE5 B;  3HOU H;  5JEA G;  3TQY A;  3FRP B;  4B3R L;  5EAY A;  2KCC A;  4DR1 Q;  4X66 L;  4O2D A;  2RHS B;  1HR0 Q;  2PPB C;  1TWG B;  3K59 A;  1IYU A;  3CCV A;  1DJR D;  4X65 Q;  3S24 A;  4KK7 A;  5FLX c;  4RAU C;  2XRS D;  1IKM A;  1Q12 A;  3J7Y W;  3OIQ A;  3I4L A;  5IP7 G;  2GN5 A;  1EY4 A;  3AFQ A;  4HMJ A;  1H9M A;  1DON A;  3X3M A;  1SBB B;  1SEB D;  2UUB Q;  2BA0 A;  1I4P A;  3NEM A;  4YIJ A;  1EIH A;  1A0I A;  4DV4 Q;  5ELF A;  2H5X A;  5FOB B;  1TY2 A;  1NNX A;  1NY4 A;  1HZB A;  1SRO A;  3CPW A;  2Z4I A;  4DR5 L;  1EIY B;  1A2U A;  1GM5 A;  5JVH 3;  2N3S A;  2VQE L;  4POG A;  3BDO A;  2VUM G;  3S1R B;  5IGB A;  4NXM L;  4IFD H;  4NPS A;  5D3I B;  3U50 C;  2RCF A;  5CV9 A;  3D31 A;  2UUC Q;  1TWF B;  2KVM A;  2R92 H;  1IHZ A;  1CFM A;  1D5X C;  3A56 A;  4GN4 B;  2JA6 B;  2EY2 A;  1LYL A;  5KND A;  5CV8 A;  5CMD A;  1VQK A;  3AMU A;  4UPA A;  2KEE A;  4R4T A;  4O1N A;  1AEX A;  3J7A F;  4LF5 L;  5A35 A;  2DN8 A;  4A3B B;  2D9U A;  1G6P A;  4C1N I;  4K5X A;  2B39 A;  3BYT B;  1CQF A;  3I90 A;  2GA4 B;  5EKL A;  4LF4 Q;  1AW7 A;  2LXJ A;  1Y1V B;  5IT9 E;  1SYE A;  3I4N B;  1VMC A;  5JVG 3;  3TZD A;  1X3E A;  4BY7 B;  1M1K C;  1Q8K A;  4BBR G;  2Z8L A;  2I0Q A;  1DYQ A;  2JA8 G;  3FVQ A;  2DJF C;  4KLK A;  4DV6 L;  1BCP F;  3HOX H;  5GAG C;  2EOT A;  4LFB L;  1CM9 A;  2PMZ E;  2KHI A;  1E2W A;  1IW7 D;  2K4K A;  4IFD J;  1LT4 D;  3OYY A;  2EIF A;  5IT9 c;  4A3G H;  4DNI A;  3BDL A;  3K80 C;  4X3K A;  2R93 H;  1LTI D;  4LW1 A;  4JI8 L;  4GOP B;  1TR5 A;  2QKI C;  3PUV A;  3V2T A;  2Z6K A;  1PZI D;  2G9H D;  4J15 A;  5M3M H;  4RKB A;  3PO2 G;  4B9W A;  5I4D A;  1FD7 D;  4DKA C;  2NVT H;  2ICE C;  1GUS A;  1IW7 C;  4L5S A;  2AUK A;  2EYJ A;  2J7Z A;  3FKI H;  3O13 A;  3T1Y L;  1MHW C;  5JJZ A;  1K8M A;  4A3G B;  1ROD A;  3EBE A;  2P5Z X;  4C2M B;  1DCZ A;  1JOO A;  1D5M C;  3FEW X;  5C0X G;  1B9N A;  4QB4 A;  3IKJ A;  3QG1 A;  1ZYR C;  5C5L A;  2NVQ H;  4DA2 A;  5FLM G;  1VQF A;  3AYH B;  5CV4 A;  5LMN L;  2F0L A;  5E3F A;  5JAV A;  2WV6 D;  1D5Z C;  5I6W A;  2DJG C;  3I73 A;  2JA5 G;  5BR8 Q;  2L55 A;  2WAC A;  1CI3 M;  1C8C A;  4DV1 Q;  1E2Z A;  2AUJ D;  3SEB A;  1CHP D;  1Z7T A;  4CDD C;  3M4P A;  2E8G A;  4A3J H;  2K50 A;  3Q23 A;  3NBH A;  1BOS A;  2PMZ B;  2VUM H;  4IPD A;  1XMO Q;  3NTI A;  1KDC A;  2B63 H;  1OXV A;  1EOV A;  4JBM A;  1HJP A;  1M4V A;  3MA2 B;  3NTK A;  5LMN W;  4FNF A;  3DHQ A;  1YNN D;  3MEF A;  2XWJ B;  4P71 A;  2NVX H;  1W3S A;  2JA6 G;  3NEL A;  1WTX A;  4KHZ A;  3NP8 A;  1SFO H;  4LNQ A;  1E1T A;  3K5L A;  2AQ1 B;  3QR8 A;  2IWH A;  4LF9 L;  3GTG B;  3D4D A;  1UAP A;  2K1B A;  1VQ6 A;  1CSP A;  2EPB A;  3A5U A;  4Y52 H;  4NDX A;  1WYD A;  4CHT B;  3PIP A;  1LTT D;  1UE7 A;  3J7Z C;  2MP1 A;  5IYC H;  3AEV A;  1QB5 D;  1FJG Q;  5L37 A;  4GKK Q;  1DXM A;  3M9B A;  1LO5 D;  2O2L D;  4B3M Q;  5EPJ A;  1CA6 A;  1BCP B;  3PO3 B;  1K8G A;  3G6J B;  2A69 C;  3E0E A;  2N78 A;  4LFC Q;  4DXF A;  3STB C;  3ND8 A;  1W2B A;  1QZH A;  4RHR A;  3OPO A;  1PH5 A;  2E5L L;  1EY8 A;  2R7Z H;  1NMF A;  1TXY A;  1Z47 A;  2EVB A;  1JE5 A;  4FP5 D;  3C3L A;  3EN2 A;  2K28 A;  2J0T D;  2EY5 A;  1PRT C;  4DV2 L;  1BNZ A;  1VQL A;  1OXU A;  2JE6 I;  2K01 A;  2K6A A;  1XTD A;  1GUO A;  3MZ5 A;  4DF7 A;  3AFP A;  4HIK A;  3HOZ H;  5D14 A;  2VL6 A;  5CR3 A;  1S5E D;  3SR1 A;  1EU3 A;  1UE5 A;  3A7L A;  3QB3 A;  4A3F G;  2F0O A;  1HNZ L;  4L8J A;  4BBS H;  1H9R A;  2KA7 A;  1EEI D;  2V4D A;  4DK0 A;  3GV6 A;  1RCV D;  3OMG A;  3Q0A A;  1MI2 A;  4A75 A;  4A93 G;  4LF8 L;  1TWH B;  4YHH L;  4ID6 A;  4WFN 3;  3PGZ A;  4PMC A;  4A3I H;  3TP8 A;  3G7L A;  2F4I A;  3KLS A;  5A2Q E;  2L11 A;  1EIG A;  4A3J G;  5KEE A;  1YVC A;  1YI2 A;  1HUM A;  2N8N A;  1ILQ A;  2WB1 B;  2PNH A;  3GQB A;  1HFN A;  3RNU A;  3SDZ A;  4IO9 A;  2ID0 A;  5C44 B;  3H09 A;  3RZO B;  1U4P A;  3DM3 A;  5M9O A;  4C3H G;  1YEZ A;  4KI0 A;  2A69 D;  1STG A;  1O7L A;  1ET6 A;  3Q22 A;  1T5X D;  1STH A;  4J6H A;  2NTS A;  5FO9 B;  4JG2 A;  3W1B A;  5M5X H;  1IL8 A;  1SYG A;  1QG7 A;  4BY1 B;  1BXT A;  2KCM A;  3TP6 A;  4XQJ A;  2QCP X;  4UP7 A;  3S2H B;  5KIX A;  3SHL A;  1R9T B;  2TMP A;  5C4J H;  1SMX A;  1SE8 A;  2VS1 A;  2ZXP A;  1HNZ Q;  3VYS A;  1A63 A;  2YU9 B;  4LJZ C;  3TZU A;  4EQ5 A;  1O7I A;  1GOZ A;  3PIO A;  2E2D C;  1AN8 A;  5I9O A;  1BO0 A;  1BCP C;  2ZTE A;  2IW3 A;  4X3T A;  1LTB D;  4Q0F A;  5IE8 A;  2JA9 A;  2WB1 E;  4OEL B;  2K04 A;  1GHK A;  1XPR A;  4LF5 Q;  5EKI A;  1HTL D;  1N9W A;  1SDF A;  3C1F A;  1XJV A;  5C6A A;  3M3Y H;  1K0S A;  2CQO A;  1NTG A;  3HKS A;  2VB3 X;  1NSN S;  1HH2 P;  5KNC A;  3S17 B;  3J81 L;  4BY1 H;  1XWE A;  2JA7 H;  1QIL A;  4LFC L;  2B2W A;  5COR A;  3H0G H;  3HOV B;  4KKU A;  5C4J B;  3I72 A;  4KJO A;  2JP1 A;  4DR2 Q;  2E74 C;  1I5F A;  3M3Y B;  2ICI A;  1M90 C;  4A4I A;  3AB9 A;  4GKK L;  1HUN A;  4BBS G;  1L0W A;  1PTO B;  2CHB D;  4X3S A;  4A3L H;  4GN5 A;  2Z0S A;  3UE1 A;  2GVB A;  2HT1 A;  1ENC A;  1QCB D;  4B9X A;  5LHY 1;  3SK8 A;  4DAP A;  3MAQ A;  2UUB L;  3OOC A;  3CKI B;  2B2T A;  4AIM A;  4QQB X;  1SE2 A;  3J81 E;  3BG3 A;  1A15 A;  4QJF A;  2L15 A;  1VQM A;  5JJL A;  3HGB A;  2LMC B;  2PYK A;  2HCI A;  4OO1 I;  3QJY A;  4YWL A;  1EOT A;  1SYF A;  2IX1 A;  2G9D A;  3VR3 A;  1EY0 A;  1XMO L;  3CF5 A;  2RKS A;  1C9O A;  1XNR L;  1HR0 L;  3KYH C;  3V96 A;  4DR1 L;  1KDA A;  1TWF H;  1EYD A;  1MGS A;  1RD9 D;  1PRT B;  4FF1 A;  3H91 A;  1R9T H;  3GTQ H;  4IFD G;  4F7X A;  4Z9C B;  5BR8 L;  5AJ3 L;  1KNA A;  5I2X A;  2R7F A;  1PYS B;  1X65 A;  3S2D H;  2VW9 A;  3D0F A;  3GDE A;  2E76 C;  5IGE A;  2RCN A;  1BF4 A;  4RMF A;  4WRD A;  4XYO A;  2K33 A;  2N88 A;  2NZO A;  3I8Z A;  1TY0 A;  3KJO A;  2NVY H;  4A3B G;  1Q1E A;  3MFY A;  3HOY H;  1GD7 A;  2E2I B;  2UU9 L;  2F4V L;  1F9S A;  1PYW D;  4OWX B;  3T1Y Q;  3OMC A;  3ITP A;  4RG1 A;  4GKJ L;  4ZRZ A;  2PCF B;  1OO9 B;  4GNX C;  1D6E C;  2R61 A;  2A6E D;  1GO3 E;  1YIT A;  3OWF A;  2HCC A;  4LWC A;  5CV5 A;  1IKL A;  2HQL A;  3R3O A;  1DGS A;  2JA7 B;  3NEN A;  3A5Z B;  3H15 A;  3OHX C;  3G6E A;  3NWS A;  5C3E B;  2XVS A;  1WTV A;  2X69 A;  2JYO A;  3KBX A;  3M7N A;  4LFB Q;  3F2D A;  1B4O A;  1HCZ A;  1X55 A;  4DV6 Q;  4MTN A;  1PH4 A;  1PFS A;  4JBJ A;  1L2F A;  4FVM A;  1HZA A;  1VMP A;  2M2L A;  5HUR A;  1FR3 A;  4P2C B;  4RHS A;  1S5F D;  4DK3 C;  2ALY B;  3ONA B;  4N9P A;  2DY8 A;  1B70 B;  2XIW A;  2DY7 A;  1Y69 U;  4BBS B;  1H95 A;  4JI6 Q;  4C3J G;  2F0K A;  4HSP A;  3F2C A;  4H7B A;  2KED A;  3HRZ C;  1G2S A;  1A8V A;  1D1I A;  4AYB G;  3U58 A;  4ULL A;  1K73 C;  4H02 A;  1HZC A;  4JBW A;  2F0W A;  4RCN A;  1LUZ A;  1HXY D;  1S5D D;  4LK1 C;  5FJ8 H;  3G4S A;  3MC0 B;  4GLA C;  2KCN A;  1Y8P B;  2BCO A;  2MO1 A;  3PO2 B;  3IFT A;  4DAY B;  4JI3 Q;  1B3Q A;  4OEM B;  4DR7 L;  3KK7 A;  1KHI A;  3C1E A;  1YJN A;  4K2K A;  3KFU A;  3KBG A;  3P20 A;  5EBD A;  4DV7 L;  1P16 A;  4MZ9 A;  3S1N H;  3NHH A;  3ZJY C;  2KJX A;  3EQL C;  1I94 Q;  1JB3 A;  2AQ2 B;  2AHO B;  1CZG A;  4DV4 L;  4FO2 A;  4EVO A;  1V9P A;  1EY6 A;  1ZKO A;  1B7Y B;  3ICE A;  1KRS A;  1EIF A;  4ABN A;  4WJW A;  1PMR A;  1K3B C;  2A1A A;  1MIU A;  1TS3 A;  3P7J A;  3HOU B;  2GVA A;  4KD3 A;  1L1O A;  1F77 A;  1PA6 A;  2CCZ A;  1TQO A;  1TWC B;  5CBA E;  3GTP B;  1HNW L;  1DZ1 A;  2R7D A;  5IP9 H;  2KUM A;  2UXB L;  2RDG A;  1A3V A;  3EA6 A;  3T1H L;  1WTH A;  5IYD G;  5FLX L;  4C56 C;  5C4Z A;  4OWT B;  3GV3 A;  1F9Q A;  4QIW E;  4B3T L;  3MXU A;  1VQJ A;  2PO4 A;  5ELN A;  4A3D B;  2VB2 X;  3CCR A;  5TSS A;  1XX8 A;  5M5Y B;  1VQ5 A;  4LMQ D;  3RN5 A;  1Y1W G;  3CQZ H;  5C5M A;  1NAP A;  1I6H H;  1GXD C;  2QEJ C;  2AWO A;  3BVG A;  3WWV A;  3I55 A;  2BA1 A;  1EQR A;  1Y8O B;  4IUT A;  4X3U A;  1KC8 C;  1KD1 C;  4B3S Q;  2K75 A;  2UUA L;  1ONL A;  2EYL A;  2IJ0 A;  1JWS D;  4OO1 G;  1WTQ A;  2HIX A;  2SDF A;  4IUQ A;  1J8I A;  4LUZ A;  1PH2 A;  2IX3 A;  3AQQ A;  3UDF A;  5EBC A;  5FO7 B;  4FXK C;  4JI7 L;  5M3F H;  1NUC A;  1LT6 D;  4A3E G;  1IBK L;  1G2T A;  1Q86 C;  1Q90 A;  1EYC A;  1RHP A;  5C3W A;  4L6T B;  3BS1 A;  2EZV A;  4ZAI A;  4EQP A;  3FMC A;  4JI5 Q;  4QUC A;  4R8N A;  4CKE A;  2LSS A;  3CC4 A;  2UXD Q;  3D3R A;  2VQF L;  5EQ0 A;  1PTO C;  1UEB A;  5I9P A;  2JA6 H;  3BZC A;  1PH3 A;  3R93 A;  1Q46 A;  2BDN A;  2ASB A;  4XT3 B;  4JI2 Q;  3OW7 A;  4U68 A;  4M8A A;  2NVQ B;  3KJP A;  1VQE A;  2F3W A;  1HNX L;  4OWW B;  3BDC A;  3MXN A;  4UY8 C;  2E2H B;  4C2M H;  4E6I A;  2IY5 B;  4KMU C;  1KDB A;  2MPM A;  5T1I A;  1BCP D;  4NB3 A;  1NMG A;  1EEF D;  4NXN L;  3F2B A;  3S1N B;  4OIK A;  1CKM A;  4PNY A;  3VYU A;  1WVL A;  2K03 A;  5GAH C;  3CXC A;  2EDG A;  1WCM H;  2QW7 A;  2MUY A;  3E9H A;  4LAA A;  1GHJ A;  1SYB A;  1U4L A;  2JJQ A;  4YWK A;  1FNW A;  2ZTD A;  2JN4 A;  3QOJ A;  1AE3 A;  1JB7 A;  3OSO A;  2F0V A;  1VQN A;  4PV1 C;  1UE1 A;  1PFM A;  2OF1 A;  1PYB A;  1FGB D;  3PSI A;  3RZO H;  2B2U C;  3OWE B;  4DR3 Q;  4QIW B;  3MTS A;  3VR2 A;  4QY7 A;  2BDO A;  3QWN A;  1UWV A;  3GTO H;  1O7Y A;  3S15 H;  2XSC A;  3SK5 A;  2PQE A;  4JV5 L;  5IT9 L;  3GTQ B;  3K57 A;  4RFB A;  2HDM A;  4HJA A;  1Y8N B;  3AU7 A;  5LMU L;  1E2V A;  3KF8 A;  4HCE A;  1K8A C;  2MHV A;  2Q2H A;  1JJG A;  4TVA B;  4IUU A;  3JC6 6;  4KTA A;  5IGF A;  2WB1 G;  1O78 A;  1XNQ L;  1TWA H;  2F0U A;  1QUQ A;  2LFN A;  2B2V A;  3E5S A;  1N36 Q;  1I50 B;  3HP3 A;  1MJE A;  1PTO F;  1EYG A;  1SND A;  2WP8 J;  3CCM A;  4K0K L;  1K9M C;  3W1G A;  2RBM A;  2Q8I B;  1NJI C;  1J5E Q;  4A3D G;  4CJ1 B;  4C3H B;  3JAM c;  4GLV B;  3UDI A;  4A3K G;  3RMH A;  1WTO A;  4WOR A;  1Y1W B;  1I3Q B;  1UEA B;  2A74 C;  2K32 A;  1CTM A;  3I2Z A;  5C3X A;  4ME3 A;  1DM0 B;  4OX9 L;  1HQM C;  3HOW H;  2OCE A;  3MXP A;  1SNC A;  2B8F A;  2ES2 A;  2OQK A;  1Y1V H;  3GTM H;  1SJH D;  4K6L A;  3ND9 A;  3DMU A;  1C0A A;  2MGS A;  1GVP A;  1CKN B;  4RCO A;  1VCI A;  2MO0 A;  4PMB A;  3PIO 3;  3CC2 A;  4RWS C;  3DM1 A;  3LNN A;  5HY6 A;  3H6M A;  4FF3 A;  4H0L C;  1YNN C;  1YNJ C;  5FKA C;  3S14 B;  2V1C C;  3H0G B;  2RHQ B;  3HOV H;  3HOW B;  2NN6 I;  4KHV A;  2ZT9 C;  4XXE A;  2SEB D;  4DAM A;  4FF2 A;  4N8F A;  3BVZ A;  3S2D B;  2BE5 C;  1LT3 D;  4Y7N H;  2MNA A;  1VQ7 A;  4C3H H;  1QOH A;  4LF7 L;  1ML0 D;  4IPC A;  4XQQ A;  3EFX D;  5J22 A;  2CFM A;  2A8V A;  4KY5 A;  1RKN A;  2K5D A;  2F0H A;  1X56 A;  3I56 A;  3NWT A;  4XQN A;  1YHQ A;  2YU9 H;  4R8I A;  1CT1 D;  1ICW A;  2O5I C;  1I4X A;  2HQE A;  1A62 A;  2EE1 A;  2K52 A;  1FYC A;  1MD2 D;  3EVQ A;  5C4H A;  2F0Q A;  4A3C H;  1VQG A;  4HR7 B;  3E0J A;  4L5Q A;  5ELO A;  1JOR A;  4ZUI A;  3L3O C;  2XGT A;  3M7G A;  5C4X H;  1AP0 A;  1E1O A;  4DK6 C;  3NTH A;  1FL0 A;  3DXJ C;  3RLO A;  2EQS A;  3CCJ A;  2AKW B;  1JOK A;  1BVS A;  1E3P A;  2JQO A;  4GZY C;  1K83 H;  4CKB A;  4A3M B;  2Z1C A;  1EZ6 A;  3VYR A;  4KY6 A;  3S16 H;  1ICF B;  1AFP A;  4JI7 Q;  4MIU A;  4RGT A;  1AZP A;  3K0X A;  5JJI A;  3I4M H;  5JEA J;  1Q7Y C;  4M1U B;  2JA8 H;  1S4Z A;  2SOB A;  4J8Q A;  3HKZ G;  1TVX A;  2ZM6 Q;  4KY7 A;  2Y0S B;  2B29 A;  2KEC A;  3OTO Q;  1GUG A;  4C1N K;  1MKH A;  2L12 A;  3K81 C;  3VA7 A;  4S3S A;  3J80 c;  1EFI D;  3TS2 A;  3BU2 A;  1WTR A;  2ZJP A;  1G29 1;  3K5M A;  4V0B A;  3M4O H;  1DOM A;  5I6Y A;  2F52 A;  3N52 A;  4A3K B;  3K5N A;  3GTJ B;  5M3M G;  2Y0S E;  5IYB H;  4B3T Q;  5IWA L;  4N8X 1;  4L5T A;  3MVV A;  2KHJ A;  4HAE A;  1F2M A;  3J80 E;  2F03 A;  3DWP A;  4QMG A;  2IT1 A;  4G7Z C;  2UXB Q;  1PRT F;  3HS0 C;  1EQQ A;  3Q24 A;  3I4M B;  4ILW A;  2XRQ D;  1FNU A;  1VQB A;  3DEP A;  4PMW A;  2NUC A;  2F0S A;  2KHS A;  1H9K A;  2DNC A;  3SVM A;  5J39 A;  1PV4 A;  3DWQ A;  2XN9 C;  2JA5 H;  2K5Q A;  3JAM i;  4LUV A;  1JWU D;  1KAA A;  3GTK H;  2NYZ D;  4DPG A;  3HZX A;  1LTG D;  3SK4 A;  3T51 B;  1L1O C;  5GAD C;  2CVR A;  3A8J E;  3K6O A;  5DM6 3;  4QUF A;  1PFN A;  5HGQ A;  4K0K Q;  4N9T A;  4IUP A;  1BR9 A;  3F2U A;  4YY3 Q;  2R93 B;  1JR0 D;  5C3E G;  1YNX A;  3LX0 A;  4CDF C;  5JEA H;  4HSV A;  2C35 B;  4PZ8 A;  1XNQ Q;  3RN2 A;  4JK1 C;  4DR7 Q;  2NVT B;  1OXS C;  4GNX A;  3TN2 A;  2H1E A;  3F8T A;  4PZ7 A;  2ZXR A;  1NBW A;  3WOF A;  3A0J A;  1MSH A;  3T4A C;  4JI4 Q;  1KXL A;  5E7N A;  4FYD A;  2EJM A;  2RSO A;  1K8O A;  5IP7 H;  4JV5 Q;  4A3L G;  1B50 A;  4ME5 A;  3J81 i;  3SE0 A;  1H9J A;  4DK1 A;  3S16 B;  4KV6 A;  1CSQ A;  2NTT A;  4HN7 A;  2RDF A;  1VQ8 A;  4DR3 L;  4O0A A;  2JEA I;  1NCV A;  4C3J B;  5C0X H;  4AQY L;  1NE3 A;  2A6E C;  4A3M G;  3CD6 A;  3U4V A;  2JEB I;  2Q2T A;  2E2J H;  3E9I A;  1W6K A;  1XTC D;  2YV5 A;  3RR5 A;  3L9A X;  1N32 L;  4ODG A;  4JPB W;  3J7A V;  3S1M B;  4TKO B;  4X64 Q;  3J81 c;  4NXN Q;  4DV5 Q;  2NN6 G;  5C44 H;  1O80 A;  3WOE A;  3U9S A;  2B2U A;  5M5W B;  1GUN A;  4PG3 A;  2Y0S G;  3B6Y A;  1KQS A;  1DOK A;  1LTS D;  1X3P A;  1X3Q A;  1HNX Q;  3CRL C;  4QL5 A;  3HOU G;  1O7Z A;  5DNF A;  4JI2 L;  3NQI A;  1HZ9 A;  1QNK A;  1QZG A;  2NWG A;  3CU7 A;  2E2H H;  2VQF Q;  4L5R C;  1PH6 A;  1SLJ A;  4BA1 I;  4K6D A;  2FIN B;  4CKC A;  2FJ2 A;  3HKZ E;  5KRU A;  2VZA A;  4GKJ Q;  2D2C C;  4HJ5 A;  2VNU D;  2OEO A;  4GN3 B;  4TRD A;  4C3I H;  2JA5 B;  1WI5 A;  3CRK C;  3HOY G;  1YJ9 A;  1IL2 A;  3GTK B;  4CJ2 C;  1STY A;  2EJF C;  2NBF A;  2O5J C;  1YBY A;  4X62 L;  1TWA B;  4YCU A;  5KGU A;  4IOC A;  2UUA Q;  1VDZ A;  1SNQ A;  5AJ3 Q;  4B3S L;  2D62 A;  1CUK A;  1ESF A;  5GRO A;  3TP5 A;  4MN3 A;  3KLW A;  2FXQ A;  4IQZ A;  1YJW A;  2B2V C;  3L2P A;  2JSO A;  4OO1 H;  4OON A;  2C5C A;  3I4N G;  3K7U C;  1TS2 A;  4BY7 G;  4RGO S;  1Q3L A;  4BBR B;  2R93 G;  3NPP A;  5M3F G;  2M9V A;  3CW2 C;  4C3I B;  3NXW A;  2N49 A;  2EYM A;  3R2I A;  1I6V C;  2JXM B;  5M5X B;  4JI1 L;  1X6O A;  3S2H H;  4FDB A;  4DUZ L;  3BZD B;  3ULJ A;  2KBN A;  3W2D A;  4A3E B;  1IBL Q;  1V1Q A;  1WJJ A;  3PUX A;  3S1Q H;  2FMM A;  2AMC B;  3NUC A;  1AE2 A;  3K7A B;  3T16 A;  2E2J B;  2YTX A;  1V1O A;  2B2T C;  4JVZ A;  1G6Z A;  5H1S E;  5CV6 A;  1B3A A;  2EYH A;  2FFK B;  1N33 L;  5LL6 S;  1TII D;  4DV7 Q;  5HGT A;  4G7H C;  2UXC L;  4R9W A;  2L0C A;  4CGY B;  3CCL A;  1VS0 A;  1STN A;  1SYD A;  5K36 G;  4JI3 L;  3ULP A;  4DUY L;  2FMC A;  2CKZ B;  3PCO B;  4X64 L;  2CQA A;  3RLF A;  1JQY D;  1K28 A;  3H3V H;  2HUG A;  5CYU A;  5D65 A;  5ELB A;  1PH1 A;  4JI0 Q;  1QVG A;  1H9S A;  2WKD A;  3PF4 A;  3NK9 A;  4EX5 A;  3W3A A;  2E75 C;  3TRZ A;  4XIG S;  5EPL A;  4P74 A;  2R7Z G;  4GS3 A;  3S1R H;  4GNX B;  2NVX B;  1VQ9 A;  5E1F A;  3QIA A;  3KDF B;  1K83 B;  4XTC S;  1IZ6 A;  3NQT A;  1Z6H A;  2F0M A;  5GQO A;  1BQQ T;  1LLR D;  1EYA A;  4TQU S;  1IBM L;  1S3O A;  2MJ8 A;  1D1K A;  1J9O A;  1W6J A;  1ASZ A;  4JCV E;  4P72 A;  4HID A;  2EYO A;  3SGI A;  4JI0 L;  2E2I H;  3HOY B;  2LS0 1;  3F1Z A;  3OW2 A;  2IPK D;  1STA A;  4AYB E;  1OTC A;  1B44 D;  4K14 A;  1BBX C;  1HA5 A;  4DUY Q;  2K5N A;  2WIN B;  2Q2I A;  3VR5 A;  2CH4 W;  4A76 A;  4G4K A;  2UXC Q;  4APV A;  1PH8 A;  1EWI A;  5FO8 B;  2RA4 A;  1EY7 A;  4BBR H;  3DEO A;  4K8I A;  2WAQ B;  3PMF A;  3K58 A;  3U9O A;  1FVI A;  4EQO A;  4J1M A;  3PO3 H;  3VR4 A;  2CWA A;  1SMY C;  1IXR A;  3I4N H;  4BXX G;  2A19 A;  1T9H A;  3CMA A;  2J4X A;  5COY A;  4ZQ3 A;  2PQA B;  3MXN B;  1IBL L;  4H13 C;  5M3F B;  4TSS A;  2OWO A;  1BBW A;  1X3F A;  4HTH A;  1U5K A;  1EQT A;  1VQI A;  2L1B A;  2PZU A;  1X32 A;  4O42 A;  5BN3 A;  3PF5 A;  3KUP A;  5I2Y A;  1F9R A;  1G51 A;  3G48 A;  3PQI A;  3K7A H;  3BVM A;  1Z9F A;  2CW0 D;  5D3D A;  4BY1 G;  1HQR D;  5CBE E;  3UE0 A;  4R4Q A;  3TBI B;  1YNJ D;  1PTO D;  4DGZ A;  2QEX A;  1XMQ Q;  2F0P A;  1M8A A;  3HOZ B;  2MQH A;  3IFD A;  5ELC A;  3RD4 A;  1CKN A;  4ZLT F;  2SNM A;  1KL9 A;  2LY7 A;  2B2W C;  3DUZ A;  5T1G A;  5E4X A;  1TS5 A;  2M00 A;  2OTJ A;  4ZKB B;  4DFA A;  1XNR Q;  3K0Y A;  3H3V I;  1XMQ L;  1IYV A;  3PIP 3;  4A3B H;  1V8Q A;  1GJX A;  3A54 A;  3NBI A;  3M4Q A;  5KYL A;  4R4C A;  4IUN A;  3CAM A;  4X62 Q;  3M4Y A;  2KEN A;  1G8Z D;  1PZK D;  5K36 H;  4MHE A;  2LXK A;  4BS9 A;  1HFG A;  4BWG B;  4ZK9 B;  5M5W H;  4DAV A;  5J1Z A;  3S17 H;  1TS4 A;  5NUC A;  1MJC A;  1D2B A;  1P8L A;  3ER0 A;  1MBY A;  1Q82 C;  4XDX A;  3UDG A;  4UHV A;  1E7Z A;  2JK8 A;  3ULL A;  4DNT B;  2EY6 A;  1VQD A;  3P75 A;  2EYF A;  3V05 A;  4RH6 A;  4IUV A;  1SE4 A;  4RGN A;  2ZJR A;  3D4W A;  1C7Y A;  2BE5 D;  1RF2 D;  3VA5 A;  2BH8 A;  5M3M B;  4DR2 L;  1Y14 B;  2R92 B;  1SRU A;  4I7Z C;  1YIJ A;  3FKI B;  5IYC G;  4IAL A;  4DV5 L;  3D4R A; 
#chains in the Genus database with same CATH homology
 4I7A A;  2RCF A;  2QW7 A;  4N8X 1;  2HD3 A;  2Z9H A;  4JW0 A;  4N8F A;  5L37 A;  4JVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...