2HD3A

Crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine utilization protein eutN
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
total genus 11
structure length 96
sequence length 96
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 2hd3A00
2Z9HA 4JVZA 2RCFA 5L37A 4I7AA 2QW7A 2HD3A 4N8X1 4JW0A 4N8FA
chains in the Genus database with same CATH superfamily
3H0GH 1I3QB 2OXPA 3S15B 4JI1L 2JA7H 5M5XB 3DWQA 5CC4A 3ND9A 3STBD 3I4MG 1SYGA 1WTPA 5C5LA 2CHBD 4EQNA 2E2JH 2EYFA 3R2TA 2KEDA 5EPKA 4FYDA 5M5WH 1KDAA 4DF7A 5LMUL 1YNJC 1II3A 1CA6A 1Y1VH 4R4IA 3EROA 1TU2B 1KD1C 1I50B 1K8GA 1I94Q 5ELOA 4JI7Q 3OW7A 1H9SA 2R3ZA 4KHVA 2IHEA 1I4QA 2EE1A 5EKLA 2EYJA 3HKSA 2LFNA 5BN4A 2L0CA 4C2MB 1LT6D 1OXTA 2VB2X 3GTQB 5ELDA 4ILWA 2MO1A 2JYOA 1YNXA 1L1OC 1Q1BA 1QWYA 1VQ5A 1Y69U 1Z7TA 3H3VI 4KV6A 1U9RA 1WVLA 1TWHB 1RKNA 2RQXA 3I55A 1QJOA 4JI5L 1FL0A 2K75A 2JA6G 2NB0A 1V1QA 4R4QA 4A3KH 4BS9A 3J7YW 1SMYC 1HR0L 3W2DA 3ITPA 1LLRD 3I4NG 1G2TA 1BVSA 4HJ9A 4DV5L 4A76A 3G48A 1PLFA 4R4TA 1HJPA 1PH2A 1F2MA 3BU2A 1S40A 2HQEA 5EKIA 1UEBA 3HOUB 2UUAQ 3K58A 1GHJA 2WINB 5A2QE 1VQLA 1WTHA 2F3IA 1RD9D 1IYJB 4NW2A 3SGIA 4BXXH 2EZVA 1GUTA 1VQKA 2F0PA 3MVVA 4EX5A 3GTGB 4KI0A 3VYUA 3HKZB 1A15A 1KABA 1B53A 3NUCA 1PFSA 1YNNC 3RZOH 1ENCA 5JEAJ 2FXQA 4K6LA 1HZAA 1SE8A 5J39A 3GP7A 4RH6A 3MAQA 3KJOA 3PUXA 1PH6A 2IW3A 3J7AV 1O7LA 1KQSA 3KF6B 4FDBA 1CZWA 2A19A 3HGBA 4P74A 1E3PA 4DV1Q 1BNZA 1FGBD 5KIXA 4A3LG 3S1QB 2A74C 2JA8H 1AP0A 4MTKA 5BR8Q 4DV2Q 2DN8A 3T53B 2EDGA 4LWCA 3T1HL 3PUZA 5IP7H 4XTCS 3AB9A 1HZCA 4A3BH 2NVYB 1X3EA 5FLMH 1YJNA 3HOZB 1KNEA 1L2FA 3TQYA 4BY7G 1Z9FA 3RZDB 2H1EA 1CT1D 2QW7A 3VDYA 2PQAA 3CC4A 4A93B 1A62A 4QL5A 4J15A 3ND8A 1NE3A 3CPWA 2WB1E 1SNMA 4R4OA 3C2PA 5LMNQ 4CJ2C 1F2LA 4B3RQ 4IPGA 1A63A 4ZAIA 2R93G 5G3LF 1JJGA 5TSSA 1D1KA 5I6WA 2JK8A 1DJRD 1DGSA 2TMPA 3BVZA 1TWGH 3MXNB 3NEMA 4GKJL 2B3GA 1EYCA 4X3SA 1EY6A 1X54A 1NY4A 1AEXA 1WTWA 2XWJB 4N9TA 2E75C 5NUCA 5IYBH 2EY5A 2ZJRA 4K2KA 2XSCA 4RG1A 4IPDA 2UU9Q 3M9BA 4OONA 2F0NA 1SNQA 2B2WA 3P1HA 3PF5A 2I5LX 3J80E 4LFCL 4DR4Q 3S16H 1JCKB 3K7UC 4A3GH 1M90C 3FKIB 4C3HG 3U9OA 4X65L 2D5DA 1ZYRD 4S3SA 3IKJA 1JT8A 2WAQG 4FF4A 5C44B 3S14H 1BCPD 2NVXH 2RCFA 4OIJA 3W5OA 3HOXB 1TQOA 5C0XJ 4IFDI 2I5MX 3CCMA 1WTQA 1W3SA 1FVIA 1EUJA 3WOFA 2QDBA 1BBUA 1L0XB 3L2PA 3EVQA 4A3DB 1EYAA 3S1RB 4GKKL 1XPOA 1YEZA 1Z6HA 2N49A 1STBA 4LAAA 3L0OA 2GA4B 5CR3A 1CTMA 2CCZA 2EPBA 4LJZC 3MC0B 3C1EA 4DXFA 3E9IA 2X69A 3VA7A 1IBLL 1XNRL 2VY3A 4F87A 2B2WC 1CQVA 1SYBA 4POFA 4JI0Q 5EBDA 4LMQD 4GNXB 4A3MH 5M3FH 4PMWA 4AYBB 3I70A 1SYEA 3SK5A 3ZJYC 4UAIA 3MFGA 2XWBB 1C9OA 4ZRZA 3K0XA 1BOSA 2K5NA 2Y0SE 3NWSA 4JI8L 1TS4A 3AFPA 3BYTB 4DV0Q 1K8MA 3GTLH 1W2BA 4H44C 1K83B 2L9HA 1EWIA 2JE6I 1AE2A 1QVFA 1TT2A 4GOPA 3S17H 2JP1A 4XQJA 3IFTA 4OEMB 1TS2A 3G7LA 1HPCA 2EXDA 1SROA 2EXZA 4H7BA 1X3FA 1AFPA 1S5CD 4LNQA 3X3NA 2QKIC 1EY9A 2GVAA 4DR2Q 4LF5L 1QG7A 4IN3A 4DR1Q 4DAYB 1I3QH 3S15H 4IO9A 2PMZE 3DEPA 2EJMA 1LTLA 1RL2A 4G7ZC 1IYVA 1CHQD 1JR0D 1XTDA 3MXPA 5IT9E 3T1YQ 2M2LA 4A3EG 1PRTF 4A3IG 3E0EA 3NP8A 2MP1A 3UDXA 4ZLTF 3QWNA 2XN9C 5EBCA 1XPRA 1E1OA 3M4YA 3F2BA 2YV5A 1I50H 1YHAA 1BDOA 4DU9A 1LT5D 4IUPA 2G9DA 2AWOA 1D7QA 4L5QA 3CC7A 5GADC 3T13A 4R1JA 4BA2I 1WCMG 2CVRA 4O2DA 1K3RA 1QB5D 5JOBA 4OX9Q 3TP6A 2D2CC 1SBBB 1KHIA 2KCMA 4GOPC 2WKDA 5M3MG 4C2MH 4JBJA 3TN2A 2VQFQ 2IPKD 3FMCA 2VQEQ 3GTQH 4L5TA 1H95A 1PRTC 3I91A 3T1HQ 4GN4B 3QB3A 4IPHA 1O7ZA 3I4MB 1P8LA 4APVA 3TBIB 1TWHH 3STBC 5T1IA 1MI2A 2B2YA 2HD3A 4U673 5I6YA 1KNAA 3D4RA 1B1ZA 2N55A 2O5IC 2ZTEA 1TWFB 1Q82C 1V43A 4ZYSA 3T4AC 4EQOA 1HTPA 4DR7L 1EY5A 1ICFB 3MEFA 1LT4D 1H9MA 4MIUA 4RCNA 2GN5A 2IHFA 3HG9A 1ZKOA 3HOUH 4WFN3 1ENFA 4UDUC 2RHQB 2RSNA 4LF6Q 1V8QA 1D8LA 1EY0A 3TDQA 5GROA 3I56A 3HRZC 2KQ3A 3HOYG 2KCCA 2JA5H 1SFOB 4IFDH 2PI2A 3A54A 1DXMA 3NBHB 3GTGH 1PFMA 2N78A 5C4XH 2KA7A 1Q86C 3G6JB 3U4ZA 2DNEA 4TVAB 3QR8A 1HR0W 2VZAA 2LXKA 5FO7B 4FXKC 3NQIA 4JI4L 2DY8A 3HOVG 3A8IE 4QY7A 4OHJA 1JB7A 2B2YC 3VR2A 2NVTB 2OTJA 3R3OA 1GUNA 1WTRA 1N33L 2PCFB 2XIWA 1OXXK 1A8VA 3I4NB 3S1QH 1X3QA 2VB3X 1XXGA 1GD7A 3LWUA 3Q24A 4OWTB 3TSSA 1U4LA 3L3OC 2RVLA 4XT3B 2XRQD 3RN2A 1VQ6A 1S5ED 5CMDA 4R9WA 2NVYH 3OWFA 2Q8TA 3HOZH 2JEAI 2O5JC 4XYOA 2B39A 1JWSD 3KJPA 1TIID 3D6CA 2NVQB 1YVCA 3SE0A 3RZDH 1J9OA 1Q1EA 2VUMG 1QUQA 1UUPA 4G4KA 1SXTA 4A93H 3CHBD 4HJ5A 1CUKA 1PTOB 4Q0FA 1R4QB 2F0GA 4A3JH 3A7LA 5HGQA 2R7ZG 1VF5C 4X3TA 4DNIA 1IBLQ 1XNRQ 4QCLA 2QILA 4O42A 5KRUA 2Z6KA 1Q90A 4Q5VA 4RWSC 2KOLA 3PO2H 1PFNA 4CDCC 4PMCA 1XYIA 1HA6A 1X55A 2K7VA 3S2DB 2NZOA 3OIQA 2ENBA 1HZ9A 5HGTA 3S1NB 4ME5A 1RHPA 1HUMA 1B3AA 4JI8Q 5FO8B 4DR6Q 1TKWB 2QGQA 1UE5A 3CQZB 4YCVA 1YJWA 1EY4A 2B2VA 5GAHC 3K5LA 3DLLA 4BY7B 2EOTA 3DUZA 4IOCA 2F4IA 5JJLA 4BY1G 4B9XA 3RNUA 1X65A 3FKIH 4FF2A 2RCNA 4JW0A 3SK6A 4M1UB 1D2BA 1BO0A 4OWXB 3PO3G 1A2UA 3CXCA 2UUCQ 1LT3D 5C44H 5E7NA 2R93B 1STAA 1B7YB 1RTNA 3JAMi 3HOXH 1CKNA 1UE6A 4KHZA 1PH9A 2MGSA 2F0IA 2PZTA 1NMFA 5EKKA 4ZUJA 4DAVA 4JI6Q 2Z6KC 1E0BA 2EYOA 1EIGA 2HCCA 4XT1B 4A3DH 1LABA 3S1RH 2VW9A 5JVG3 4IUUA 5AFWA 4HCEA 1EU3A 2PZWA 2O2LD 1ZEQX 4RGMA 3H3VC 3F2DA 3M3YH 2A68C 2N88A 2KHSA 5C4JB 3ULPA 2KEEA 3M4QA 4PQXA 4H0LC 2KCNA 4BBRG 5C3EG 4YCWA 1AZQA 2QDLA 2E8GA 1PFBA 1N34L 1YHBA 3MTSA 5IYCH 3MA2B 4P2CB 4ID6A 1GUWA 2HT1A 2HIVA 5E3FA 3GTMB 2RDHA 3EBEA 4WJWA 1IKLA 4DUZQ 2J7ZA 4DV6L 2JA7G 1VQFA 2K6AA 4QGUA 4HJAA 5M5YB 3EJIA 3OPOA 3I4LA 3NBIA 1S5DD 3S9WA 1VDZA 3EQLC 4GZYC 1K83H 1A6XA 4K0KQ 2AKWB 4B3MQ 2ZXRA 1S3OA 3K7AB 2ID0A 2BA0A 5DNFA 1QVGA 1JQYD 1C4QA 2ALYB 4UPAA 1K3BC 1L1OA 5ELBA 4DR7Q 3KF8A 1TWAB 3OOCA 1U4RA 1A3VA 4UP9A 2WB1G 3MXUA 1NR2A 4NP5A 4GLAC 2K33A 4Z9CB 3M4OB 2DNCA 1E22A 1HNZL 1BF4A 1D5MC 3ICEA 3QIAA 1SE3A 4XDXA 4DAMA 1M1KC 3U4VA 1A3UA 1QCBD 4IALA 3E6ZX 4DR3L 1B50A 4X3UA 5D3DA 2CW0C 1N32Q 3V05A 5FJ8G 1HRJA 1IW7C 2E2DC 3TS0A 2MQHA 3BDCA 3HS0C 3MZ5A 1DM0B 3VYSA 3SVMA 5IYDG 1N33Q 5COYA 3CD6A 1J8IA 3RLNA 1HNXL 2EYHA 3J81L 3TEHB 1EU4A 1KRSA 2G9HD 1OXVA 2RKSA 4YY3Q 4GN5A 2IX1A 3I4MH 3OMCA 3F8TA 1VQ7A 4A3IB 4JC0A 1OXSC 2V1CC 1FNVA 4KHPL 1GM5A 2OF1A 4DUYL 3KF6A 2FFKB 1SRUA 3DMUA 2UUBL 1J6QA 1TWFH 1I4XA 4PZ6A 2I46A 1RJTA 5LL6X 2K01A 4PMBA 1PH7A 1CSQA 3BS1A 2CWPA 4X64L 1J5EL 4KKSA 4YWLA 1T5XD 5DM73 4DGZA 2I07B 1V1OA 1X32A 2RF4A 4LW1A 5FLXL 3F1ZA 1QNUA 1H9KA 1O80A 2JEBI 2A6HD 5M3MB 1TWCB 3ZYYX 2JA8G 3E5SA 2YTYA 1H9SB 3A74A 4P71A 3UDGA 4OWWB 2EJFC 1UWVA 1SFOH 1EFID 3HP3A 1SNPA 4CJ1B 5ELNA 1IHZA 1PTOD 2J0TD 1OTCA 2BH2A 1NJIC 4IUQA 1G291 3URYA 4F7XA 1EQQA 1SYCA 3OTOL 4FP5D 4DV3L 4U68A 3QO2A 1KL9A 4PV1C 3VR4A 1IL8A 2SNMA 1DOLA 2MJ8A 2NN6I 4DR5Q 2NVTH 3LX0A 5AJ3Q 3K5MA 4DV7L 3NK9A 4LF9L 3I4NH 1UE1A 4Y52H 1N9WA 3PUYA 1STNA 1YZ6A 1K28A 2EYMA 2BE5D 1HNWL 4L6TB 2AUKA 2D0OA 1KAWA 4JVZA 3NWTA 1MBYA 5KGUA 2E2IB 1EQVA 2K1BA 4MTNA 4B08A 1TS3A 4HTHA 1MHWC 4UHVA 1G91A 1VF7A 2NVQH 2HHHQ 2A69D 3HOYB 3KYHC 1PHJA 1UNSA 3O13A 2RSOA 2JXMB 1YBYA 3TP8A 1AW7A 4CHTB 1PTOH 3PUWA 5I4DA 4ALPA 1A3TA 4EQ5A 3DEOA 4P73A 3HOVB 4IPCA 1WD1A 3ULLA 2EQSA 4IFDJ 4MZ9A 2L5TA 1UE7A 3I7FA 3ONAB 1SE2A 1O7YA 4A3LH 3EIVA 3S2DH 3QG1A 4A3FG 1IBKQ 1F9PA 3JAME 1VS0A 2QEXA 2K4KA 2B63G 5JJIA 1DCZA 2LS01 3S1NH 1B3QA 3A7AB 3SK4A 1DZ1A 1QE6A 1QNKA 4JI2L 3BVGA 3CQZH 5L37A 5KNCA 1JJCB 1I4PA 2K28A 5J3BA 1L0WA 4GLXA 1XMOL 3QOLA 3PMFA 2K14A 5KEEA 4BY7H 1EOTA 1WTVA 2Q2IA 1OXUA 2A6ED 3N52A 4K5XA 3SEBA 2VUMB 1B4OA 4JBKA 2BOSA 3CU7A 2YTVA 4RGTA 1SN8A 1G2SA 3GQBA 3J81c 2F0TA 2XGTA 4JI1Q 3KDFA 2CFMA 2BDNA 3S1MB 2R93H 4KMUC 3A5ZB 5M3FG 4F8MA 1VCIA 2PQAB 2AMCB 1G8ZD 2X6LA 5LMUQ 3WDNA 1L0YB 4QQBX 5E4XA 4LF4L 3TRZA 2G5DA 1VQNA 1VQDA 4NXML 2R92G 3ER0A 4HN7A 4DFAA 1NAPA 4E6IA 1DOMA 3SDZA 4K5WA 3W1BA 5C4JH 4P75A 2Z4HA 4JV5L 1K8AC 1EL0A 5LL6S 1PH5A 3OSOA 4RA8A 4WRDA 1Y1WG 3OW2A 3X3MA 2PNHA 4BY1B 5CV7A 4LFAL 4CBVA 5FLXc 2F0OA 5A2QL 4OO1I 4UP7A 3PO3B 2JN4A 2KENA 2R61A 4DN4M 1GOZA 4A3CH 2SNSA 5M5YH 5H1SE 1LO5D 1KLGD 3P20A 3PSIA 3G71A 4JI5Q 3V2TA 1MIUA 1YNJD 3PV0A 1VQ8A 2E5LL 2F0LA 1RDPD 4KK7A 5D14A 4C3IG 1S5BD 1HR0Q 4ZCKA 1XJVA 1STYA 5GAGC 4WJ4A 2ZM6L 1VQPA 4DV5Q 1U4MA 4DK6C 2I5HA 1IYUA 5D65A 3IRBA 1VQCA 2QA4A 2TSSA 4LUOA 2YTXA 1LV9A 5M5XH 4BBRB 1EZ8A 2R7FA 4JK1C 4AQYL 2NN6H 5CV4A 2DGYA 1IKMA 2ES2A 5JEAG 4NXNL 1KXLA 2D0PA 1Y8PB 3JC66 2F0EA 3M4OH 4G57A 1VMCA 2JA7B 3VYTA 5CV9A 4ZKCB 3SR1A 2F52A 4KN7C 2CH4A 5T1GA 3CCQA 1I6VC 3L7ZC 3KLSA 4GLVB 4H13C 4XQNA 1WYDA 2XRSD 1RTOA 1AH9A 1SMYD 2RDGA 2KVMA 1FGUA 3I72A 1V9PA 2GVBA 2C35B 2F0HA 1SDFA 2F3WA 4B9WA 1TY2A 2F0VA 1SYDA 4DV7Q 4LF9Q 3K0YA 3I73A 2FMMA 1EZ6A 4YCUA 1JWUD 4I7AA 4R8IA 1XMQL 1XTCD 1Y8OB 3FRPB 3BZDB 4GOPB 2F0DA 3BZCA 2KUMA 1ESFA 2BH8A 1PRTB 4Y7NB 3J80L 4AH6A 2JA5G 4X62L 4IFDG 4A3IH 2LXJA 1AE3A 1YNND 5C4XG 3QJYA 5IGEA 2ZXOA 1DYQA 1HA5A 4I7ZC 4KN4C 4QJFA 4X6AH 5KYLA 3VR5A 2K5VA 3K8AA 1E7ZA 3TZUA 1IBML 1K73C 3BG3A 2ZXPA 1AZPA 4GKJQ 1VQHA 1HTLD 1QZGA 4LF7L 2Z0SA 2A1AA 5M3MH 1BQQT 1TWCH 1F9SA 3NSWA 1X9NA 2CQAA 2IT1A 1FNUA 4K5VA 4RKLA 4CDFC 5CV5A 3CC2A 1SAPA 2CWAA 2LMCB 1ZXTA 2B2TA 1E2ZA 2KCTA 3NTKA 3WOEA 3GTJB 3ERSX 4JI3L 1NNXA 2SEBD 5A35A 1XMOQ 2JA6B 3DWAA 4LFCQ 2WACA 5C0XG 2IL8A 1HZBA 1CZGA 2M00A 1I5FA 2BDOA 4X65Q 1Y14B 2OQKA 1PZID 2FJ2A 4IUVA 2FHTA 4A93G 2OQ0A 2DUDA 5IIFA 3BZKA 5IP9H 4A3JG 1I94L 1BXTA 5F2DA 4JI7L 3ERQA 2AQ3B 3TMEA 2CQOA 2PW5A 1E2VA 1O78A 1NSNS 2OEOA 4YHHL 4JCVE 4X3KA 2ZJQA 3TS2A 2VS1A 3RMHA 3E0JA 3M7GA 4OO1H 1R4PB 2QCPX 3PO2G 3VR3A 4JOIA 2E2IH 4K6DA 3IAYA 4GKKQ 1VQ4A 4B3SL 1N36L 1EEFD 4LF4Q 3HOYH 2R6GA 4B3TL 4NXMQ 5JJZA 3UI2A 4QF4A 1G51A 3GTKB 4BBSG 4IUTA 2L55A 1PYBA 2B2TC 4DV4L 1ASZA 5G3LD 3H6MA 1Q8IA 3GD7A 3IFDA 1W6KA 5DM63 1WOCA 4MNOA 2B8FA 2K50A 1RF2D 1B44D 5E4WC 1T9HA 2B8GA 4O0AA 4KJNA 1SEBD 2NZ1D 4L5RC 3K57A 5IT9L 3TP5A 5C44G 1XPUA 4KD3A 5K36H 4HEDA 4RAUC 1F9QA 2PZUA 1BR9A 2WV6D 3PF4A 2JJQA 2UUAL 4IQZA 2BE5C 1H9RA 2VL6A 4HJ7A 5IGCA 3BDOA 4A3DG 2WFWA 2PO4A 1JICA 3SHLA 4DAPA 1VQ9A 4JOIC 1EIHA 3I2ZA 4RFBA 4BWGB 3MEHA 3BYYB 2VUMH 3LNNA 2NBFA 3SXHA 4HIOA 2YU9B 2EJGC 3BDLA 4TKOB 4LF5Q 1HHVA 4RMFA 4C3JG 3A5UA 4IJHA 4C1NK 3CAMA 1GKHA 4AQYQ 1V1PA 4V0BA 3VYRA 1GJXA 3S1MH 2E2HB 1YHQA 4NXNQ 2IY5B 3PQIA 1QUQB 3CW2C 1I6HB 3HOWG 2F4VL 3HKZE 4O1NA 3J80c 4A3FB 1EQRA 1BCPF 2B63B 2F0SA 4GS3A 4DV2L 5IGGA 4FXDA 2JQOA 4J1MA 2F0WA 3GTOB 1KC8C 1YITA 4KKUA 1X56A 1F2ZA 3A8KE 2A5HA 2Z4IA 3KOJA 4FF3A 3SK8A 1FD7D 1GO3E 4C3HB 1WJJA 1I4RA 4LF8L 3V96A 3D6WA 2MNAA 2AHOB 1ZYRC 2WAQB 3H0GG 2PPBC 3PO3H 3CKIB 5LMNL 4IURA 4QIWB 4B3RL 3J7ZC 1XMQQ 1BCPC 3VR6A 3CCSA 2UXCL 3NTIA 1TR5A 2PQEA 3A8JE 5M3FB 2M9VA 4J6HA 1Q7YC 4P72A 3KK7A 3BVMA 1PZJD 1RIPA 1Y1VG 2IX3A 5JAVA 2LKVA 3CRKC 2WP8J 2R92B 2LSSA 4KY6A 1PXUA 1X6OA 4QMGA 2Q2UA 2Z6BA 2UU9L 1NTGA 1CKNB 4TSSA 5FK9C 3K59A 2PYKA 3A0JA 5EPLA 4EQPA 4DR4L 1IBMQ 1Y1WB 4N8X1 4BBRH 4HIMA 1SSOA 4RKBA 4LF7Q 1LACA 2F0UA 1PRTD 4PZ7A 1SNOA 4PZ8A 2JSOA 3S24A 5JVH3 1C8CA 3P7JA 1YI2A 3J7AF 3Q23A 4JI3Q 5ELFA 4JI4Q 3AU7A 1CFMA 4DA2A 3P75A 4A3KG 2C9OA 1ICWA 4C3IB 1HH2P 3MFYA 1G6ZA 1U0LA 4QB4A 3KLSX 3AQQA 1KAAA 5DLQE 4UP8A 1PA6A 1ET6A 5ELEA 1UEAB 1B70B 5IT9c 1ML0D 4YHHQ 1MJCA 1OO9B 1VQAA 4N8FA 5JPNC 1X3GA 4JI0L 1STEA 1SE4A 2ZTDA 3Q6SA 1BUVT 1KDCA 2KJXA 1KRTA 4BXXG 2HUGA 2Q2TA 3KFUA 3TREA 3I90A 4A3EB 2MPMA 1L1OB 3I8ZA 3OIPA 4B3SQ 2F0FA 2YYZA 1N36Q 2H4OA 4Y7NH 2D9UA 3KF8B 3D4WA 4B3TQ 2EYLA 5CV6A 4IJLA 4MHEA 2Z9HA 1NUCA 1X3PA 2K5HA 2RA4A 4DV0L 5K5PA 2AUJD 2EY2A 2HDLA 2QEJC 1LTGD 4FVMA 1M8AA 4DV4Q 1CHPD 5FJ8H 3D4DA 4DKAC 4AYBE 1VQJA 1WCMB 3K80C 1SR3A 1TVXA 4KY7A 2AQ1B 2I0QA 1D5ZC 1WTOA 3GTPB 5IYDH 2K5QA 4HMJA 3CF5A 1STHA 4PG3A 5HURA 1D5XC 5IP7G 1F2YA 1PVOA 3UDFA 4DR2L 2UXBL 3FVQA 4DR1L 5BN3A 4IZ8A 4A3BG 4KTAA 5FLMG 3NENA 4IOAA 2Y0SG 1H9JA 3GTJH 3MHBA 1JOOA 3TP7A 5C5MA 2V4DA 3PIOA 2JA6H 3M7NA 2CH4W 1DD2A 2WKCA 4NMZA 2CKZB 3T1YL 4AIMA 4DK1A 4DNRB 2JA5B 2SOBA 4KLKA 1D1IA 4A4IA 1VQMA 1NMGA 3C46A 1JJ2A 3MXNA 4JBWA 5C4XB 4HIDA 3OWEB 4L8JA 5HY6A 1A0IA 4V190 4BA1I 3FPPA 2DJGC 2RBMA 3D8GA 1SMXA 3UE0A 3NXWA 3WWVA 1LTAD 4NKLA 1LTRD 3RLOA 1PH4A 1UAPA 2OTLA 4HMIA 4X66L 4H02A 1G6PA 5IE8A 5EQ0A 4OX9L 3RN5A 1HUNA 1K0SA 3LGJA 2F4VQ 2ZT9C 4NPSA 2VQFL 1DOKA 2VQEL 4K14A 2QF7A 1KDBA 5IYBG 1YIJA 1CK1A 4YWMA 3Q0AA 1MD2D 4HJ8A 2K32A 4ZK9B 5IOCA 1W6JA 2RDFA 3PIPA 3GTKH 3E9HA 3OYYA 3PIO3 3CCEA 1GHKA 1JWMD 4OELB 2L11A 4A3GG 1N34Q 4HSPA 2Q8RE 2RHSB 2X6GA 4RCOA 4CDDC 4LF8Q 1JB3A 2UXDL 3CMAA 1I4GA 2ATWA 4JYAL 3CCVA 4GN3B 3PUVA 1FNWA 4A3JB 4DV6Q 4R8NA 3A55A 4RHRA 3OMGA 4I65A 3W3AA 5IODA 3HEJA 2UXCQ 3MWYW 3F2UA 3E3XA 1HXYD 4MN3A 4C1NI 3PO2B 3FEWX 1FJGL 4LF6L 4C56C 1B9NA 2F3VA 3AFQA 3EN2A 3FDTA 5FO9B 4GNXA 5LHY1 2F03A 3K6OA 1NBWA 1M4VA 4LUVA 2N3SA 3C1FA 4L63B 1ESRA 2A68D 3D31A 3U9SA 1LTBD 3CCRA 1QVCA 2Z1CA 3AYHB 3PIP3 2R7ZB 3KBXA 1EIYB 3GO5A 2R7DA 2YU9H 4BBSB 3FHWA 4OL7A 2MHVA 1MSGA 4A3MG 3DXJC 3U50C 1JMCA 4LFBL 4DK0A 1N8RC 2EVBA 5EAYA 3HFZB 2E2HH 4XIGS 1K9MC 3CMEA 1STGA 1SNDA 1I6HH 2ICEC 2AQ2B 3LWEA 1HNZQ 4A3FH 2IX0A 3KBGA 4NDXA 3J81i 4A3CG 3GDEA 2B63H 2J4XA 4DR3Q 3HZXA 2ZTCA 4WJ3M 1KLUD 1MKHA 2BA1A 5IGFA 3GTOH 4QUCA 2F1MA 3OHXC 4DAYA 3ULJA 5IY0A 2K52A 2F0KA 1U5KA 1R9TB 4HCSA 3T51B 1B9MA 3I3CA 3H3VH 3PGZA 4C3HH 4CDEC 4GNXC 3M3YB 4NB3A 3GTMH 1S5FD 1HNXQ 3KLWA 5DAUA 3W1GA 1YJ9A 2A73B 2L15A 4C3JB 3AMUA 1P16A 2NN6G 4JPBW 1C7YA 1VQGA 5CV8A 2XTIA 1TS5A 4OXPA 1EFWA 2L4NA 1AN8A 1HCZA 1EEID 3UDIA 3DM1A 2E74C 5C3XA 3HOWB 4TRDA 1CSPA 2Q2HA 5EJWA 1T5EA 3K7AH 4KHPQ 4DUYQ 2HIXA 3CCUA 2UUBQ 1WI5A 5BN5A 2FINB 2CW0D 3KDFB 1RODA 5C0XI 5IGBA 1B2TA 4DR6L 2R92H 4IUNA 3CCJA 3Q22A 1PMRA 1IW7D 4RGOS 5I9OA 3DM3A 4KKTA 1VQOA 5M9OA 1RCVD 1TWAH 3PCOB 4FNFA 3T16A 4X64Q 1PH8A 5C3EB 1J5EQ 1SJHD 2PI2E 3D3RA 1E1TA 1QZHA 2B2UA 1Y1WH 3H94A 3S2HB 5LMNW 2F0JA 1SLJA 4ABNA 4N9PA 5C4HA 1K8OA 2EIFA 1PH3A 1HQRD 2Q8IB 1K0RA 1EYDA 1JOQA 4CKBA 3H0GB 3T56B 4ZKBB 3NTHA 2UUCL 3RR5A 2UXBQ 1EY8A 1IL2A 1KTKA 1U4PA 4G7OC 1EWHA 1VMPA 3DHQA 5IWAL 4CGYB 1JE4A 2H5XA 1F9RA 2NYZD 3IL8A 1CA5A 5CBEE 4POGA 2E2JB 4ULLA 1XNQL 4JI6L 5M5WB 2EYPA 1ASYA 3OTOQ 4DV3Q 1BBWA 1Y1VB 4JBMA 4C3IH 2BCOA 4JG2A 4EGVA 5KYIA 2FMCA 4DK3C 2Z8LA 3MXGA 1LTTD 4K8JA 4YWKA 1ONLA 3DWPA 5CYUA 3L9AX 5FOBB 2MFIA 5FKAC 1PYSB 5J1ZA 1CM9A 1QILA 2EY6A 3NBHA 4HIKA 1HNWQ 1O7IA 2WB1B 3JAML 5CORA 3HOUG 3FP9A 4YIJA 4X66Q 2VNUD 1BKBA 1GUOA 1VQEA 4DPGA 1MSHA 4FO2A 5I2XA 5JEAH 1GUSA 2HQLA 2NTTA 2ZJPA 2B2UC 2NWGA 4A3EH 4DUZL 2MO0A 1TY0A 5CGKA 3HKZG 1NCVA 3NQTA 4PNYA 3G4SA 1GXDC 3GV6A 2IWHA 4L5SA 2DY7A 2N8NA 4A3KB 3H15A 1EQTA 4K0KL 4B3ML 4FXGC 1WCMH 2IJ0A 3NELA 2WAQE 2UXDQ 1C48A 2SDFA 4JYAQ 3GTPH 4QIWE 5IP9G 3VA5A 1IZ6A 2NUCA 3A56A 1S4ZA 2OCEA 3EFXD 4HR7B 5KNBA 4CKEA 1CKMA 5I9PA 1C0AA 1CQFA 2K5WA 4OO1G 4F88A 3M85A 3UE1A 1JOKA 4JI2Q 4UY8C 3HOZG 1SYFA 1VQIA 3U58A 1FJGQ 3G6EA 1JE5A 2NTSA 2OT2A 4ODGA 4CKCA 1ILPA 1Q8KA 3R2IA 5ELCA 2HDMA 2KHJA 1TXYA 3I4OA 3FPUB 4HSVA 3RZOB 3RD4A 3BJUA 1PTOF 2PW7A 4ZQ3A 1MGSA 5CBAE 1N32L 3NE5B 2A8VA 1HFGA 4LFBQ 1PZKD 4ZUIA 2B29A 4FF1A 1PYWD 1CI3M 2JA8B 3KUPA 4K2LA 2A6HC 5K36G 3B6YA 1PV4A 1JC7A 1Q46A 1E2WA 4K8IA 4TQUS 3J81j 3N6RA 2K04A 3KLRA 1WD0A 5GAEC 4A3BB 3CRLC 1EYGA 4KJOA 4YY3L 3D0FA 2Y0SB 4JV5Q 4WORA 1PTOC 1DONA 4OGQC 3HOVH 5C0XH 5I2YA 3FKIG 2C5CA 4LFAQ 4RHSA 2ICIA 2OWOA 4J8QA 1D6EC 1A2TA 3K5OA 2E76C 1QOHA 4XQQA 3K5NA 4LUZA 1HFNA 1Q12A 3HOXG 1E24A 2L1BA 3F2CA 5C3WA 2D62A 1TWGB 1VQBA 1FR3A 2AWNA 2XVSA 3TZDA 2PMZB 2E5LQ 3J81E 4OIKA 5C4ZA 1SJED 3RLFA 1NR4A 2A69C 2ASBA 2ZM6Q 1HQMC 1LTSD 5ISRA 2EY1A 2K5DA 3CPFA 2KHIA 2MUYA 4M8AA 1KIXA 2R7ZH 3M4PA 1EY7A 4QUFA 3S16B 4BBSH 2XNAC 1I4HA 3H91A 3JAMc 5IYCG 4A3GB 1XX8A 1JORA 4XYQA 1EWCA 1EIFA 2L12A 1GUGA 3Q8DA 4AYBG 4DV1L 4DR5L 5AJ3L 5KNDA 2O4XA 3S14B 2NVXB 5BR8L 1ET9A 2KECA 1F77A 5FLXE 5IWAQ 1CKOA 3CP0A 4CJ0B 4EVOA 3NHHA 3QOJA 3AEVA 3R93A 1XNQQ 4A75A 1WTXA 4RGNA 1FYCA 2HHHL 4G7HC 1R9TH 3J80i 4BY1H 2VXWA 2A6EC 1ILQA 3H09A 4KD4A 5JPMC 1BBXC 1B8AA 2DJFC 2LY7A 3CCLA 1PDQA 4C3JH 1WFQA 5EGTA 4LK1C 1LM0A 2B2VC 4A3MB 2F0MA 4ME3A 1LUZA 3J7A5 5E1FA 1ENAA 3R8BA 5C6AA 4X62Q 3GV3A 4HAEA 1PH1A 3HOWH 1S72A 1GVPA 3EA6A 1IBKL 1BCPB 1Y8NB 1MJEA 1LTID 1EOVA 2P5ZX 2JA9A 2K05A 5D3IB 5JJKA 2F0QA 3GTLB 2KBNA 4KY5A 1V1PB 4DNTB 1LYLA 5EPJA 2PNRC 4XXEA 5J22A 3K81C 3C3LA 2K03A 3S17B 3RUZA 2WIIB 2HCIA 5C3EH 5IGDA 4R4CA 1Q81C 5DEHA 1Q3LA 5GQOA 3NPPA 2NZHA 3S2HH 1SNCA 1XWEA 1IXRA 4DXGA 1Z47A
chains in the Genus database with same CATH topology
2Z9HA 4JVZA 2RCFA 5L37A 4I7AA 2QW7A 2HD3A 4N8X1 4JW0A 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9H A;  4JVZ A;  2RCF A;  5L37 A;  4I7A A;  2QW7 A;  2HD3 A;  4N8X 1;  4JW0 A;  4N8F A; 
#chains in the Genus database with same CATH topology
 3H0G H;  1I3Q B;  2OXP A;  3S15 B;  4JI1 L;  2JA7 H;  5M5X B;  3DWQ A;  5CC4 A;  3ND9 A;  3STB D;  3I4M G;  1SYG A;  1WTP A;  5C5L A;  2CHB D;  4EQN A;  2E2J H;  2EYF A;  3R2T A;  2KED A;  5EPK A;  4FYD A;  5M5W H;  1KDA A;  4DF7 A;  5LMU L;  1YNJ C;  1II3 A;  1CA6 A;  1Y1V H;  4R4I A;  3ERO A;  1TU2 B;  1KD1 C;  1I50 B;  1K8G A;  1I94 Q;  5ELO A;  4JI7 Q;  3OW7 A;  1H9S A;  2R3Z A;  4KHV A;  2IHE A;  1I4Q A;  2EE1 A;  5EKL A;  2EYJ A;  3HKS A;  2LFN A;  5BN4 A;  2L0C A;  4C2M B;  1LT6 D;  1OXT A;  2VB2 X;  3GTQ B;  5ELD A;  4ILW A;  2MO1 A;  2JYO A;  1YNX A;  1L1O C;  1Q1B A;  1QWY A;  1VQ5 A;  1Y69 U;  1Z7T A;  3H3V I;  4KV6 A;  1U9R A;  1WVL A;  1TWH B;  1RKN A;  2RQX A;  3I55 A;  1QJO A;  4JI5 L;  1FL0 A;  2K75 A;  2JA6 G;  2NB0 A;  1V1Q A;  4R4Q A;  4A3K H;  4BS9 A;  3J7Y W;  1SMY C;  1HR0 L;  3W2D A;  3ITP A;  1LLR D;  3I4N G;  1G2T A;  1BVS A;  4HJ9 A;  4DV5 L;  4A76 A;  3G48 A;  1PLF A;  4R4T A;  1HJP A;  1PH2 A;  1F2M A;  3BU2 A;  1S40 A;  2HQE A;  5EKI A;  1UEB A;  3HOU B;  2UUA Q;  3K58 A;  1GHJ A;  2WIN B;  5A2Q E;  1VQL A;  1WTH A;  2F3I A;  1RD9 D;  1IYJ B;  4NW2 A;  3SGI A;  4BXX H;  2EZV A;  1GUT A;  1VQK A;  2F0P A;  3MVV A;  4EX5 A;  3GTG B;  4KI0 A;  3VYU A;  3HKZ B;  1A15 A;  1KAB A;  1B53 A;  3NUC A;  1PFS A;  1YNN C;  3RZO H;  1ENC A;  5JEA J;  2FXQ A;  4K6L A;  1HZA A;  1SE8 A;  5J39 A;  3GP7 A;  4RH6 A;  3MAQ A;  3KJO A;  3PUX A;  1PH6 A;  2IW3 A;  3J7A V;  1O7L A;  1KQS A;  3KF6 B;  4FDB A;  1CZW A;  2A19 A;  3HGB A;  4P74 A;  1E3P A;  4DV1 Q;  1BNZ A;  1FGB D;  5KIX A;  4A3L G;  3S1Q B;  2A74 C;  2JA8 H;  1AP0 A;  4MTK A;  5BR8 Q;  4DV2 Q;  2DN8 A;  3T53 B;  2EDG A;  4LWC A;  3T1H L;  3PUZ A;  5IP7 H;  4XTC S;  3AB9 A;  1HZC A;  4A3B H;  2NVY B;  1X3E A;  5FLM H;  1YJN A;  3HOZ B;  1KNE A;  1L2F A;  3TQY A;  4BY7 G;  1Z9F A;  3RZD B;  2H1E A;  1CT1 D;  2QW7 A;  3VDY A;  2PQA A;  3CC4 A;  4A93 B;  1A62 A;  4QL5 A;  4J15 A;  3ND8 A;  1NE3 A;  3CPW A;  2WB1 E;  1SNM A;  4R4O A;  3C2P A;  5LMN Q;  4CJ2 C;  1F2L A;  4B3R Q;  4IPG A;  1A63 A;  4ZAI A;  2R93 G;  5G3L F;  1JJG A;  5TSS A;  1D1K A;  5I6W A;  2JK8 A;  1DJR D;  1DGS A;  2TMP A;  3BVZ A;  1TWG H;  3MXN B;  3NEM A;  4GKJ L;  2B3G A;  1EYC A;  4X3S A;  1EY6 A;  1X54 A;  1NY4 A;  1AEX A;  1WTW A;  2XWJ B;  4N9T A;  2E75 C;  5NUC A;  5IYB H;  2EY5 A;  2ZJR A;  4K2K A;  2XSC A;  4RG1 A;  4IPD A;  2UU9 Q;  3M9B A;  4OON A;  2F0N A;  1SNQ A;  2B2W A;  3P1H A;  3PF5 A;  2I5L X;  3J80 E;  4LFC L;  4DR4 Q;  3S16 H;  1JCK B;  3K7U C;  4A3G H;  1M90 C;  3FKI B;  4C3H G;  3U9O A;  4X65 L;  2D5D A;  1ZYR D;  4S3S A;  3IKJ A;  1JT8 A;  2WAQ G;  4FF4 A;  5C44 B;  3S14 H;  1BCP D;  2NVX H;  2RCF A;  4OIJ A;  3W5O A;  3HOX B;  1TQO A;  5C0X J;  4IFD I;  2I5M X;  3CCM A;  1WTQ A;  1W3S A;  1FVI A;  1EUJ A;  3WOF A;  2QDB A;  1BBU A;  1L0X B;  3L2P A;  3EVQ A;  4A3D B;  1EYA A;  3S1R B;  4GKK L;  1XPO A;  1YEZ A;  1Z6H A;  2N49 A;  1STB A;  4LAA A;  3L0O A;  2GA4 B;  5CR3 A;  1CTM A;  2CCZ A;  2EPB A;  4LJZ C;  3MC0 B;  3C1E A;  4DXF A;  3E9I A;  2X69 A;  3VA7 A;  1IBL L;  1XNR L;  2VY3 A;  4F87 A;  2B2W C;  1CQV A;  1SYB A;  4POF A;  4JI0 Q;  5EBD A;  4LMQ D;  4GNX B;  4A3M H;  5M3F H;  4PMW A;  4AYB B;  3I70 A;  1SYE A;  3SK5 A;  3ZJY C;  4UAI A;  3MFG A;  2XWB B;  1C9O A;  4ZRZ A;  3K0X A;  1BOS A;  2K5N A;  2Y0S E;  3NWS A;  4JI8 L;  1TS4 A;  3AFP A;  3BYT B;  4DV0 Q;  1K8M A;  3GTL H;  1W2B A;  4H44 C;  1K83 B;  2L9H A;  1EWI A;  2JE6 I;  1AE2 A;  1QVF A;  1TT2 A;  4GOP A;  3S17 H;  2JP1 A;  4XQJ A;  3IFT A;  4OEM B;  1TS2 A;  3G7L A;  1HPC A;  2EXD A;  1SRO A;  2EXZ A;  4H7B A;  1X3F A;  1AFP A;  1S5C D;  4LNQ A;  3X3N A;  2QKI C;  1EY9 A;  2GVA A;  4DR2 Q;  4LF5 L;  1QG7 A;  4IN3 A;  4DR1 Q;  4DAY B;  1I3Q H;  3S15 H;  4IO9 A;  2PMZ E;  3DEP A;  2EJM A;  1LTL A;  1RL2 A;  4G7Z C;  1IYV A;  1CHQ D;  1JR0 D;  1XTD A;  3MXP A;  5IT9 E;  3T1Y Q;  2M2L A;  4A3E G;  1PRT F;  4A3I G;  3E0E A;  3NP8 A;  2MP1 A;  3UDX A;  4ZLT F;  3QWN A;  2XN9 C;  5EBC A;  1XPR A;  1E1O A;  3M4Y A;  3F2B A;  2YV5 A;  1I50 H;  1YHA A;  1BDO A;  4DU9 A;  1LT5 D;  4IUP A;  2G9D A;  2AWO A;  1D7Q A;  4L5Q A;  3CC7 A;  5GAD C;  3T13 A;  4R1J A;  4BA2 I;  1WCM G;  2CVR A;  4O2D A;  1K3R A;  1QB5 D;  5JOB A;  4OX9 Q;  3TP6 A;  2D2C C;  1SBB B;  1KHI A;  2KCM A;  4GOP C;  2WKD A;  5M3M G;  4C2M H;  4JBJ A;  3TN2 A;  2VQF Q;  2IPK D;  3FMC A;  2VQE Q;  3GTQ H;  4L5T A;  1H95 A;  1PRT C;  3I91 A;  3T1H Q;  4GN4 B;  3QB3 A;  4IPH A;  1O7Z A;  3I4M B;  1P8L A;  4APV A;  3TBI B;  1TWH H;  3STB C;  5T1I A;  1MI2 A;  2B2Y A;  2HD3 A;  4U67 3;  5I6Y A;  1KNA A;  3D4R A;  1B1Z A;  2N55 A;  2O5I C;  2ZTE A;  1TWF B;  1Q82 C;  1V43 A;  4ZYS A;  3T4A C;  4EQO A;  1HTP A;  4DR7 L;  1EY5 A;  1ICF B;  3MEF A;  1LT4 D;  1H9M A;  4MIU A;  4RCN A;  2GN5 A;  2IHF A;  3HG9 A;  1ZKO A;  3HOU H;  4WFN 3;  1ENF A;  4UDU C;  2RHQ B;  2RSN A;  4LF6 Q;  1V8Q A;  1D8L A;  1EY0 A;  3TDQ A;  5GRO A;  3I56 A;  3HRZ C;  2KQ3 A;  3HOY G;  2KCC A;  2JA5 H;  1SFO B;  4IFD H;  2PI2 A;  3A54 A;  1DXM A;  3NBH B;  3GTG H;  1PFM A;  2N78 A;  5C4X H;  2KA7 A;  1Q86 C;  3G6J B;  3U4Z A;  2DNE A;  4TVA B;  3QR8 A;  1HR0 W;  2VZA A;  2LXK A;  5FO7 B;  4FXK C;  3NQI A;  4JI4 L;  2DY8 A;  3HOV G;  3A8I E;  4QY7 A;  4OHJ A;  1JB7 A;  2B2Y C;  3VR2 A;  2NVT B;  2OTJ A;  3R3O A;  1GUN A;  1WTR A;  1N33 L;  2PCF B;  2XIW A;  1OXX K;  1A8V A;  3I4N B;  3S1Q H;  1X3Q A;  2VB3 X;  1XXG A;  1GD7 A;  3LWU A;  3Q24 A;  4OWT B;  3TSS A;  1U4L A;  3L3O C;  2RVL A;  4XT3 B;  2XRQ D;  3RN2 A;  1VQ6 A;  1S5E D;  5CMD A;  4R9W A;  2NVY H;  3OWF A;  2Q8T A;  3HOZ H;  2JEA I;  2O5J C;  4XYO A;  2B39 A;  1JWS D;  3KJP A;  1TII D;  3D6C A;  2NVQ B;  1YVC A;  3SE0 A;  3RZD H;  1J9O A;  1Q1E A;  2VUM G;  1QUQ A;  1UUP A;  4G4K A;  1SXT A;  4A93 H;  3CHB D;  4HJ5 A;  1CUK A;  1PTO B;  4Q0F A;  1R4Q B;  2F0G A;  4A3J H;  3A7L A;  5HGQ A;  2R7Z G;  1VF5 C;  4X3T A;  4DNI A;  1IBL Q;  1XNR Q;  4QCL A;  2QIL A;  4O42 A;  5KRU A;  2Z6K A;  1Q90 A;  4Q5V A;  4RWS C;  2KOL A;  3PO2 H;  1PFN A;  4CDC C;  4PMC A;  1XYI A;  1HA6 A;  1X55 A;  2K7V A;  3S2D B;  2NZO A;  3OIQ A;  2ENB A;  1HZ9 A;  5HGT A;  3S1N B;  4ME5 A;  1RHP A;  1HUM A;  1B3A A;  4JI8 Q;  5FO8 B;  4DR6 Q;  1TKW B;  2QGQ A;  1UE5 A;  3CQZ B;  4YCV A;  1YJW A;  1EY4 A;  2B2V A;  5GAH C;  3K5L A;  3DLL A;  4BY7 B;  2EOT A;  3DUZ A;  4IOC A;  2F4I A;  5JJL A;  4BY1 G;  4B9X A;  3RNU A;  1X65 A;  3FKI H;  4FF2 A;  2RCN A;  4JW0 A;  3SK6 A;  4M1U B;  1D2B A;  1BO0 A;  4OWX B;  3PO3 G;  1A2U A;  3CXC A;  2UUC Q;  1LT3 D;  5C44 H;  5E7N A;  2R93 B;  1STA A;  1B7Y B;  1RTN A;  3JAM i;  3HOX H;  1CKN A;  1UE6 A;  4KHZ A;  1PH9 A;  2MGS A;  2F0I A;  2PZT A;  1NMF A;  5EKK A;  4ZUJ A;  4DAV A;  4JI6 Q;  2Z6K C;  1E0B A;  2EYO A;  1EIG A;  2HCC A;  4XT1 B;  4A3D H;  1LAB A;  3S1R H;  2VW9 A;  5JVG 3;  4IUU A;  5AFW A;  4HCE A;  1EU3 A;  2PZW A;  2O2L D;  1ZEQ X;  4RGM A;  3H3V C;  3F2D A;  3M3Y H;  2A68 C;  2N88 A;  2KHS A;  5C4J B;  3ULP A;  2KEE A;  3M4Q A;  4PQX A;  4H0L C;  2KCN A;  4BBR G;  5C3E G;  4YCW A;  1AZQ A;  2QDL A;  2E8G A;  1PFB A;  1N34 L;  1YHB A;  3MTS A;  5IYC H;  3MA2 B;  4P2C B;  4ID6 A;  1GUW A;  2HT1 A;  2HIV A;  5E3F A;  3GTM B;  2RDH A;  3EBE A;  4WJW A;  1IKL A;  4DUZ Q;  2J7Z A;  4DV6 L;  2JA7 G;  1VQF A;  2K6A A;  4QGU A;  4HJA A;  5M5Y B;  3EJI A;  3OPO A;  3I4L A;  3NBI A;  1S5D D;  3S9W A;  1VDZ A;  3EQL C;  4GZY C;  1K83 H;  1A6X A;  4K0K Q;  2AKW B;  4B3M Q;  2ZXR A;  1S3O A;  3K7A B;  2ID0 A;  2BA0 A;  5DNF A;  1QVG A;  1JQY D;  1C4Q A;  2ALY B;  4UPA A;  1K3B C;  1L1O A;  5ELB A;  4DR7 Q;  3KF8 A;  1TWA B;  3OOC A;  1U4R A;  1A3V A;  4UP9 A;  2WB1 G;  3MXU A;  1NR2 A;  4NP5 A;  4GLA C;  2K33 A;  4Z9C B;  3M4O B;  2DNC A;  1E22 A;  1HNZ L;  1BF4 A;  1D5M C;  3ICE A;  3QIA A;  1SE3 A;  4XDX A;  4DAM A;  1M1K C;  3U4V A;  1A3U A;  1QCB D;  4IAL A;  3E6Z X;  4DR3 L;  1B50 A;  4X3U A;  5D3D A;  2CW0 C;  1N32 Q;  3V05 A;  5FJ8 G;  1HRJ A;  1IW7 C;  2E2D C;  3TS0 A;  2MQH A;  3BDC A;  3HS0 C;  3MZ5 A;  1DM0 B;  3VYS A;  3SVM A;  5IYD G;  1N33 Q;  5COY A;  3CD6 A;  1J8I A;  3RLN A;  1HNX L;  2EYH A;  3J81 L;  3TEH B;  1EU4 A;  1KRS A;  2G9H D;  1OXV A;  2RKS A;  4YY3 Q;  4GN5 A;  2IX1 A;  3I4M H;  3OMC A;  3F8T A;  1VQ7 A;  4A3I B;  4JC0 A;  1OXS C;  2V1C C;  1FNV A;  4KHP L;  1GM5 A;  2OF1 A;  4DUY L;  3KF6 A;  2FFK B;  1SRU A;  3DMU A;  2UUB L;  1J6Q A;  1TWF H;  1I4X A;  4PZ6 A;  2I46 A;  1RJT A;  5LL6 X;  2K01 A;  4PMB A;  1PH7 A;  1CSQ A;  3BS1 A;  2CWP A;  4X64 L;  1J5E L;  4KKS A;  4YWL A;  1T5X D;  5DM7 3;  4DGZ A;  2I07 B;  1V1O A;  1X32 A;  2RF4 A;  4LW1 A;  5FLX L;  3F1Z A;  1QNU A;  1H9K A;  1O80 A;  2JEB I;  2A6H D;  5M3M B;  1TWC B;  3ZYY X;  2JA8 G;  3E5S A;  2YTY A;  1H9S B;  3A74 A;  4P71 A;  3UDG A;  4OWW B;  2EJF C;  1UWV A;  1SFO H;  1EFI D;  3HP3 A;  1SNP A;  4CJ1 B;  5ELN A;  1IHZ A;  1PTO D;  2J0T D;  1OTC A;  2BH2 A;  1NJI C;  4IUQ A;  1G29 1;  3URY A;  4F7X A;  1EQQ A;  1SYC A;  3OTO L;  4FP5 D;  4DV3 L;  4U68 A;  3QO2 A;  1KL9 A;  4PV1 C;  3VR4 A;  1IL8 A;  2SNM A;  1DOL A;  2MJ8 A;  2NN6 I;  4DR5 Q;  2NVT H;  3LX0 A;  5AJ3 Q;  3K5M A;  4DV7 L;  3NK9 A;  4LF9 L;  3I4N H;  1UE1 A;  4Y52 H;  1N9W A;  3PUY A;  1STN A;  1YZ6 A;  1K28 A;  2EYM A;  2BE5 D;  1HNW L;  4L6T B;  2AUK A;  2D0O A;  1KAW A;  4JVZ A;  3NWT A;  1MBY A;  5KGU A;  2E2I B;  1EQV A;  2K1B A;  4MTN A;  4B08 A;  1TS3 A;  4HTH A;  1MHW C;  4UHV A;  1G91 A;  1VF7 A;  2NVQ H;  2HHH Q;  2A69 D;  3HOY B;  3KYH C;  1PHJ A;  1UNS A;  3O13 A;  2RSO A;  2JXM B;  1YBY A;  3TP8 A;  1AW7 A;  4CHT B;  1PTO H;  3PUW A;  5I4D A;  4ALP A;  1A3T A;  4EQ5 A;  3DEO A;  4P73 A;  3HOV B;  4IPC A;  1WD1 A;  3ULL A;  2EQS A;  4IFD J;  4MZ9 A;  2L5T A;  1UE7 A;  3I7F A;  3ONA B;  1SE2 A;  1O7Y A;  4A3L H;  3EIV A;  3S2D H;  3QG1 A;  4A3F G;  1IBK Q;  1F9P A;  3JAM E;  1VS0 A;  2QEX A;  2K4K A;  2B63 G;  5JJI A;  1DCZ A;  2LS0 1;  3S1N H;  1B3Q A;  3A7A B;  3SK4 A;  1DZ1 A;  1QE6 A;  1QNK A;  4JI2 L;  3BVG A;  3CQZ H;  5L37 A;  5KNC A;  1JJC B;  1I4P A;  2K28 A;  5J3B A;  1L0W A;  4GLX A;  1XMO L;  3QOL A;  3PMF A;  2K14 A;  5KEE A;  4BY7 H;  1EOT A;  1WTV A;  2Q2I A;  1OXU A;  2A6E D;  3N52 A;  4K5X A;  3SEB A;  2VUM B;  1B4O A;  4JBK A;  2BOS A;  3CU7 A;  2YTV A;  4RGT A;  1SN8 A;  1G2S A;  3GQB A;  3J81 c;  2F0T A;  2XGT A;  4JI1 Q;  3KDF A;  2CFM A;  2BDN A;  3S1M B;  2R93 H;  4KMU C;  3A5Z B;  5M3F G;  4F8M A;  1VCI A;  2PQA B;  2AMC B;  1G8Z D;  2X6L A;  5LMU Q;  3WDN A;  1L0Y B;  4QQB X;  5E4X A;  4LF4 L;  3TRZ A;  2G5D A;  1VQN A;  1VQD A;  4NXM L;  2R92 G;  3ER0 A;  4HN7 A;  4DFA A;  1NAP A;  4E6I A;  1DOM A;  3SDZ A;  4K5W A;  3W1B A;  5C4J H;  4P75 A;  2Z4H A;  4JV5 L;  1K8A C;  1EL0 A;  5LL6 S;  1PH5 A;  3OSO A;  4RA8 A;  4WRD A;  1Y1W G;  3OW2 A;  3X3M A;  2PNH A;  4BY1 B;  5CV7 A;  4LFA L;  4CBV A;  5FLX c;  2F0O A;  5A2Q L;  4OO1 I;  4UP7 A;  3PO3 B;  2JN4 A;  2KEN A;  2R61 A;  4DN4 M;  1GOZ A;  4A3C H;  2SNS A;  5M5Y H;  5H1S E;  1LO5 D;  1KLG D;  3P20 A;  3PSI A;  3G71 A;  4JI5 Q;  3V2T A;  1MIU A;  1YNJ D;  3PV0 A;  1VQ8 A;  2E5L L;  2F0L A;  1RDP D;  4KK7 A;  5D14 A;  4C3I G;  1S5B D;  1HR0 Q;  4ZCK A;  1XJV A;  1STY A;  5GAG C;  4WJ4 A;  2ZM6 L;  1VQP A;  4DV5 Q;  1U4M A;  4DK6 C;  2I5H A;  1IYU A;  5D65 A;  3IRB A;  1VQC A;  2QA4 A;  2TSS A;  4LUO A;  2YTX A;  1LV9 A;  5M5X H;  4BBR B;  1EZ8 A;  2R7F A;  4JK1 C;  4AQY L;  2NN6 H;  5CV4 A;  2DGY A;  1IKM A;  2ES2 A;  5JEA G;  4NXN L;  1KXL A;  2D0P A;  1Y8P B;  3JC6 6;  2F0E A;  3M4O H;  4G57 A;  1VMC A;  2JA7 B;  3VYT A;  5CV9 A;  4ZKC B;  3SR1 A;  2F52 A;  4KN7 C;  2CH4 A;  5T1G A;  3CCQ A;  1I6V C;  3L7Z C;  3KLS A;  4GLV B;  4H13 C;  4XQN A;  1WYD A;  2XRS D;  1RTO A;  1AH9 A;  1SMY D;  2RDG A;  2KVM A;  1FGU A;  3I72 A;  1V9P A;  2GVB A;  2C35 B;  2F0H A;  1SDF A;  2F3W A;  4B9W A;  1TY2 A;  2F0V A;  1SYD A;  4DV7 Q;  4LF9 Q;  3K0Y A;  3I73 A;  2FMM A;  1EZ6 A;  4YCU A;  1JWU D;  4I7A A;  4R8I A;  1XMQ L;  1XTC D;  1Y8O B;  3FRP B;  3BZD B;  4GOP B;  2F0D A;  3BZC A;  2KUM A;  1ESF A;  2BH8 A;  1PRT B;  4Y7N B;  3J80 L;  4AH6 A;  2JA5 G;  4X62 L;  4IFD G;  4A3I H;  2LXJ A;  1AE3 A;  1YNN D;  5C4X G;  3QJY A;  5IGE A;  2ZXO A;  1DYQ A;  1HA5 A;  4I7Z C;  4KN4 C;  4QJF A;  4X6A H;  5KYL A;  3VR5 A;  2K5V A;  3K8A A;  1E7Z A;  3TZU A;  1IBM L;  1K73 C;  3BG3 A;  2ZXP A;  1AZP A;  4GKJ Q;  1VQH A;  1HTL D;  1QZG A;  4LF7 L;  2Z0S A;  2A1A A;  5M3M H;  1BQQ T;  1TWC H;  1F9S A;  3NSW A;  1X9N A;  2CQA A;  2IT1 A;  1FNU A;  4K5V A;  4RKL A;  4CDF C;  5CV5 A;  3CC2 A;  1SAP A;  2CWA A;  2LMC B;  1ZXT A;  2B2T A;  1E2Z A;  2KCT A;  3NTK A;  3WOE A;  3GTJ B;  3ERS X;  4JI3 L;  1NNX A;  2SEB D;  5A35 A;  1XMO Q;  2JA6 B;  3DWA A;  4LFC Q;  2WAC A;  5C0X G;  2IL8 A;  1HZB A;  1CZG A;  2M00 A;  1I5F A;  2BDO A;  4X65 Q;  1Y14 B;  2OQK A;  1PZI D;  2FJ2 A;  4IUV A;  2FHT A;  4A93 G;  2OQ0 A;  2DUD A;  5IIF A;  3BZK A;  5IP9 H;  4A3J G;  1I94 L;  1BXT A;  5F2D A;  4JI7 L;  3ERQ A;  2AQ3 B;  3TME A;  2CQO A;  2PW5 A;  1E2V A;  1O78 A;  1NSN S;  2OEO A;  4YHH L;  4JCV E;  4X3K A;  2ZJQ A;  3TS2 A;  2VS1 A;  3RMH A;  3E0J A;  3M7G A;  4OO1 H;  1R4P B;  2QCP X;  3PO2 G;  3VR3 A;  4JOI A;  2E2I H;  4K6D A;  3IAY A;  4GKK Q;  1VQ4 A;  4B3S L;  1N36 L;  1EEF D;  4LF4 Q;  3HOY H;  2R6G A;  4B3T L;  4NXM Q;  5JJZ A;  3UI2 A;  4QF4 A;  1G51 A;  3GTK B;  4BBS G;  4IUT A;  2L55 A;  1PYB A;  2B2T C;  4DV4 L;  1ASZ A;  5G3L D;  3H6M A;  1Q8I A;  3GD7 A;  3IFD A;  1W6K A;  5DM6 3;  1WOC A;  4MNO A;  2B8F A;  2K50 A;  1RF2 D;  1B44 D;  5E4W C;  1T9H A;  2B8G A;  4O0A A;  4KJN A;  1SEB D;  2NZ1 D;  4L5R C;  3K57 A;  5IT9 L;  3TP5 A;  5C44 G;  1XPU A;  4KD3 A;  5K36 H;  4HED A;  4RAU C;  1F9Q A;  2PZU A;  1BR9 A;  2WV6 D;  3PF4 A;  2JJQ A;  2UUA L;  4IQZ A;  2BE5 C;  1H9R A;  2VL6 A;  4HJ7 A;  5IGC A;  3BDO A;  4A3D G;  2WFW A;  2PO4 A;  1JIC A;  3SHL A;  4DAP A;  1VQ9 A;  4JOI C;  1EIH A;  3I2Z A;  4RFB A;  4BWG B;  3MEH A;  3BYY B;  2VUM H;  3LNN A;  2NBF A;  3SXH A;  4HIO A;  2YU9 B;  2EJG C;  3BDL A;  4TKO B;  4LF5 Q;  1HHV A;  4RMF A;  4C3J G;  3A5U A;  4IJH A;  4C1N K;  3CAM A;  1GKH A;  4AQY Q;  1V1P A;  4V0B A;  3VYR A;  1GJX A;  3S1M H;  2E2H B;  1YHQ A;  4NXN Q;  2IY5 B;  3PQI A;  1QUQ B;  3CW2 C;  1I6H B;  3HOW G;  2F4V L;  3HKZ E;  4O1N A;  3J80 c;  4A3F B;  1EQR A;  1BCP F;  2B63 B;  2F0S A;  4GS3 A;  4DV2 L;  5IGG A;  4FXD A;  2JQO A;  4J1M A;  2F0W A;  3GTO B;  1KC8 C;  1YIT A;  4KKU A;  1X56 A;  1F2Z A;  3A8K E;  2A5H A;  2Z4I A;  3KOJ A;  4FF3 A;  3SK8 A;  1FD7 D;  1GO3 E;  4C3H B;  1WJJ A;  1I4R A;  4LF8 L;  3V96 A;  3D6W A;  2MNA A;  2AHO B;  1ZYR C;  2WAQ B;  3H0G G;  2PPB C;  3PO3 H;  3CKI B;  5LMN L;  4IUR A;  4QIW B;  4B3R L;  3J7Z C;  1XMQ Q;  1BCP C;  3VR6 A;  3CCS A;  2UXC L;  3NTI A;  1TR5 A;  2PQE A;  3A8J E;  5M3F B;  2M9V A;  4J6H A;  1Q7Y C;  4P72 A;  3KK7 A;  3BVM A;  1PZJ D;  1RIP A;  1Y1V G;  2IX3 A;  5JAV A;  2LKV A;  3CRK C;  2WP8 J;  2R92 B;  2LSS A;  4KY6 A;  1PXU A;  1X6O A;  4QMG A;  2Q2U A;  2Z6B A;  2UU9 L;  1NTG A;  1CKN B;  4TSS A;  5FK9 C;  3K59 A;  2PYK A;  3A0J A;  5EPL A;  4EQP A;  4DR4 L;  1IBM Q;  1Y1W B;  4N8X 1;  4BBR H;  4HIM A;  1SSO A;  4RKB A;  4LF7 Q;  1LAC A;  2F0U A;  1PRT D;  4PZ7 A;  1SNO A;  4PZ8 A;  2JSO A;  3S24 A;  5JVH 3;  1C8C A;  3P7J A;  1YI2 A;  3J7A F;  3Q23 A;  4JI3 Q;  5ELF A;  4JI4 Q;  3AU7 A;  1CFM A;  4DA2 A;  3P75 A;  4A3K G;  2C9O A;  1ICW A;  4C3I B;  1HH2 P;  3MFY A;  1G6Z A;  1U0L A;  4QB4 A;  3KLS X;  3AQQ A;  1KAA A;  5DLQ E;  4UP8 A;  1PA6 A;  1ET6 A;  5ELE A;  1UEA B;  1B70 B;  5IT9 c;  1ML0 D;  4YHH Q;  1MJC A;  1OO9 B;  1VQA A;  4N8F A;  5JPN C;  1X3G A;  4JI0 L;  1STE A;  1SE4 A;  2ZTD A;  3Q6S A;  1BUV T;  1KDC A;  2KJX A;  1KRT A;  4BXX G;  2HUG A;  2Q2T A;  3KFU A;  3TRE A;  3I90 A;  4A3E B;  2MPM A;  1L1O B;  3I8Z A;  3OIP A;  4B3S Q;  2F0F A;  2YYZ A;  1N36 Q;  2H4O A;  4Y7N H;  2D9U A;  3KF8 B;  3D4W A;  4B3T Q;  2EYL A;  5CV6 A;  4IJL A;  4MHE A;  2Z9H A;  1NUC A;  1X3P A;  2K5H A;  2RA4 A;  4DV0 L;  5K5P A;  2AUJ D;  2EY2 A;  2HDL A;  2QEJ C;  1LTG D;  4FVM A;  1M8A A;  4DV4 Q;  1CHP D;  5FJ8 H;  3D4D A;  4DKA C;  4AYB E;  1VQJ A;  1WCM B;  3K80 C;  1SR3 A;  1TVX A;  4KY7 A;  2AQ1 B;  2I0Q A;  1D5Z C;  1WTO A;  3GTP B;  5IYD H;  2K5Q A;  4HMJ A;  3CF5 A;  1STH A;  4PG3 A;  5HUR A;  1D5X C;  5IP7 G;  1F2Y A;  1PVO A;  3UDF A;  4DR2 L;  2UXB L;  3FVQ A;  4DR1 L;  5BN3 A;  4IZ8 A;  4A3B G;  4KTA A;  5FLM G;  3NEN A;  4IOA A;  2Y0S G;  1H9J A;  3GTJ H;  3MHB A;  1JOO A;  3TP7 A;  5C5M A;  2V4D A;  3PIO A;  2JA6 H;  3M7N A;  2CH4 W;  1DD2 A;  2WKC A;  4NMZ A;  2CKZ B;  3T1Y L;  4AIM A;  4DK1 A;  4DNR B;  2JA5 B;  2SOB A;  4KLK A;  1D1I A;  4A4I A;  1VQM A;  1NMG A;  3C46 A;  1JJ2 A;  3MXN A;  4JBW A;  5C4X B;  4HID A;  3OWE B;  4L8J A;  5HY6 A;  1A0I A;  4V19 0;  4BA1 I;  3FPP A;  2DJG C;  2RBM A;  3D8G A;  1SMX A;  3UE0 A;  3NXW A;  3WWV A;  1LTA D;  4NKL A;  1LTR D;  3RLO A;  1PH4 A;  1UAP A;  2OTL A;  4HMI A;  4X66 L;  4H02 A;  1G6P A;  5IE8 A;  5EQ0 A;  4OX9 L;  3RN5 A;  1HUN A;  1K0S A;  3LGJ A;  2F4V Q;  2ZT9 C;  4NPS A;  2VQF L;  1DOK A;  2VQE L;  4K14 A;  2QF7 A;  1KDB A;  5IYB G;  1YIJ A;  1CK1 A;  4YWM A;  3Q0A A;  1MD2 D;  4HJ8 A;  2K32 A;  4ZK9 B;  5IOC A;  1W6J A;  2RDF A;  3PIP A;  3GTK H;  3E9H A;  3OYY A;  3PIO 3;  3CCE A;  1GHK A;  1JWM D;  4OEL B;  2L11 A;  4A3G G;  1N34 Q;  4HSP A;  2Q8R E;  2RHS B;  2X6G A;  4RCO A;  4CDD C;  4LF8 Q;  1JB3 A;  2UXD L;  3CMA A;  1I4G A;  2ATW A;  4JYA L;  3CCV A;  4GN3 B;  3PUV A;  1FNW A;  4A3J B;  4DV6 Q;  4R8N A;  3A55 A;  4RHR A;  3OMG A;  4I65 A;  3W3A A;  5IOD A;  3HEJ A;  2UXC Q;  3MWY W;  3F2U A;  3E3X A;  1HXY D;  4MN3 A;  4C1N I;  3PO2 B;  3FEW X;  1FJG L;  4LF6 L;  4C56 C;  1B9N A;  2F3V A;  3AFQ A;  3EN2 A;  3FDT A;  5FO9 B;  4GNX A;  5LHY 1;  2F03 A;  3K6O A;  1NBW A;  1M4V A;  4LUV A;  2N3S A;  3C1F A;  4L63 B;  1ESR A;  2A68 D;  3D31 A;  3U9S A;  1LTB D;  3CCR A;  1QVC A;  2Z1C A;  3AYH B;  3PIP 3;  2R7Z B;  3KBX A;  1EIY B;  3GO5 A;  2R7D A;  2YU9 H;  4BBS B;  3FHW A;  4OL7 A;  2MHV A;  1MSG A;  4A3M G;  3DXJ C;  3U50 C;  1JMC A;  4LFB L;  4DK0 A;  1N8R C;  2EVB A;  5EAY A;  3HFZ B;  2E2H H;  4XIG S;  1K9M C;  3CME A;  1STG A;  1SND A;  1I6H H;  2ICE C;  2AQ2 B;  3LWE A;  1HNZ Q;  4A3F H;  2IX0 A;  3KBG A;  4NDX A;  3J81 i;  4A3C G;  3GDE A;  2B63 H;  2J4X A;  4DR3 Q;  3HZX A;  2ZTC A;  4WJ3 M;  1KLU D;  1MKH A;  2BA1 A;  5IGF A;  3GTO H;  4QUC A;  2F1M A;  3OHX C;  4DAY A;  3ULJ A;  5IY0 A;  2K52 A;  2F0K A;  1U5K A;  1R9T B;  4HCS A;  3T51 B;  1B9M A;  3I3C A;  3H3V H;  3PGZ A;  4C3H H;  4CDE C;  4GNX C;  3M3Y B;  4NB3 A;  3GTM H;  1S5F D;  1HNX Q;  3KLW A;  5DAU A;  3W1G A;  1YJ9 A;  2A73 B;  2L15 A;  4C3J B;  3AMU A;  1P16 A;  2NN6 G;  4JPB W;  1C7Y A;  1VQG A;  5CV8 A;  2XTI A;  1TS5 A;  4OXP A;  1EFW A;  2L4N A;  1AN8 A;  1HCZ A;  1EEI D;  3UDI A;  3DM1 A;  2E74 C;  5C3X A;  3HOW B;  4TRD A;  1CSP A;  2Q2H A;  5EJW A;  1T5E A;  3K7A H;  4KHP Q;  4DUY Q;  2HIX A;  3CCU A;  2UUB Q;  1WI5 A;  5BN5 A;  2FIN B;  2CW0 D;  3KDF B;  1ROD A;  5C0X I;  5IGB A;  1B2T A;  4DR6 L;  2R92 H;  4IUN A;  3CCJ A;  3Q22 A;  1PMR A;  1IW7 D;  4RGO S;  5I9O A;  3DM3 A;  4KKT A;  1VQO A;  5M9O A;  1RCV D;  1TWA H;  3PCO B;  4FNF A;  3T16 A;  4X64 Q;  1PH8 A;  5C3E B;  1J5E Q;  1SJH D;  2PI2 E;  3D3R A;  1E1T A;  1QZH A;  2B2U A;  1Y1W H;  3H94 A;  3S2H B;  5LMN W;  2F0J A;  1SLJ A;  4ABN A;  4N9P A;  5C4H A;  1K8O A;  2EIF A;  1PH3 A;  1HQR D;  2Q8I B;  1K0R A;  1EYD A;  1JOQ A;  4CKB A;  3H0G B;  3T56 B;  4ZKB B;  3NTH A;  2UUC L;  3RR5 A;  2UXB Q;  1EY8 A;  1IL2 A;  1KTK A;  1U4P A;  4G7O C;  1EWH A;  1VMP A;  3DHQ A;  5IWA L;  4CGY B;  1JE4 A;  2H5X A;  1F9R A;  2NYZ D;  3IL8 A;  1CA5 A;  5CBE E;  4POG A;  2E2J B;  4ULL A;  1XNQ L;  4JI6 L;  5M5W B;  2EYP A;  1ASY A;  3OTO Q;  4DV3 Q;  1BBW A;  1Y1V B;  4JBM A;  4C3I H;  2BCO A;  4JG2 A;  4EGV A;  5KYI A;  2FMC A;  4DK3 C;  2Z8L A;  3MXG A;  1LTT D;  4K8J A;  4YWK A;  1ONL A;  3DWP A;  5CYU A;  3L9A X;  5FOB B;  2MFI A;  5FKA C;  1PYS B;  5J1Z A;  1CM9 A;  1QIL A;  2EY6 A;  3NBH A;  4HIK A;  1HNW Q;  1O7I A;  2WB1 B;  3JAM L;  5COR A;  3HOU G;  3FP9 A;  4YIJ A;  4X66 Q;  2VNU D;  1BKB A;  1GUO A;  1VQE A;  4DPG A;  1MSH A;  4FO2 A;  5I2X A;  5JEA H;  1GUS A;  2HQL A;  2NTT A;  2ZJP A;  2B2U C;  2NWG A;  4A3E H;  4DUZ L;  2MO0 A;  1TY0 A;  5CGK A;  3HKZ G;  1NCV A;  3NQT A;  4PNY A;  3G4S A;  1GXD C;  3GV6 A;  2IWH A;  4L5S A;  2DY7 A;  2N8N A;  4A3K B;  3H15 A;  1EQT A;  4K0K L;  4B3M L;  4FXG C;  1WCM H;  2IJ0 A;  3NEL A;  2WAQ E;  2UXD Q;  1C48 A;  2SDF A;  4JYA Q;  3GTP H;  4QIW E;  5IP9 G;  3VA5 A;  1IZ6 A;  2NUC A;  3A56 A;  1S4Z A;  2OCE A;  3EFX D;  4HR7 B;  5KNB A;  4CKE A;  1CKM A;  5I9P A;  1C0A A;  1CQF A;  2K5W A;  4OO1 G;  4F88 A;  3M85 A;  3UE1 A;  1JOK A;  4JI2 Q;  4UY8 C;  3HOZ G;  1SYF A;  1VQI A;  3U58 A;  1FJG Q;  3G6E A;  1JE5 A;  2NTS A;  2OT2 A;  4ODG A;  4CKC A;  1ILP A;  1Q8K A;  3R2I A;  5ELC A;  2HDM A;  2KHJ A;  1TXY A;  3I4O A;  3FPU B;  4HSV A;  3RZO B;  3RD4 A;  3BJU A;  1PTO F;  2PW7 A;  4ZQ3 A;  1MGS A;  5CBA E;  1N32 L;  3NE5 B;  2A8V A;  1HFG A;  4LFB Q;  1PZK D;  4ZUI A;  2B29 A;  4FF1 A;  1PYW D;  1CI3 M;  2JA8 B;  3KUP A;  4K2L A;  2A6H C;  5K36 G;  3B6Y A;  1PV4 A;  1JC7 A;  1Q46 A;  1E2W A;  4K8I A;  4TQU S;  3J81 j;  3N6R A;  2K04 A;  3KLR A;  1WD0 A;  5GAE C;  4A3B B;  3CRL C;  1EYG A;  4KJO A;  4YY3 L;  3D0F A;  2Y0S B;  4JV5 Q;  4WOR A;  1PTO C;  1DON A;  4OGQ C;  3HOV H;  5C0X H;  5I2Y A;  3FKI G;  2C5C A;  4LFA Q;  4RHS A;  2ICI A;  2OWO A;  4J8Q A;  1D6E C;  1A2T A;  3K5O A;  2E76 C;  1QOH A;  4XQQ A;  3K5N A;  4LUZ A;  1HFN A;  1Q12 A;  3HOX G;  1E24 A;  2L1B A;  3F2C A;  5C3W A;  2D62 A;  1TWG B;  1VQB A;  1FR3 A;  2AWN A;  2XVS A;  3TZD A;  2PMZ B;  2E5L Q;  3J81 E;  4OIK A;  5C4Z A;  1SJE D;  3RLF A;  1NR4 A;  2A69 C;  2ASB A;  2ZM6 Q;  1HQM C;  1LTS D;  5ISR A;  2EY1 A;  2K5D A;  3CPF A;  2KHI A;  2MUY A;  4M8A A;  1KIX A;  2R7Z H;  3M4P A;  1EY7 A;  4QUF A;  3S16 B;  4BBS H;  2XNA C;  1I4H A;  3H91 A;  3JAM c;  5IYC G;  4A3G B;  1XX8 A;  1JOR A;  4XYQ A;  1EWC A;  1EIF A;  2L12 A;  1GUG A;  3Q8D A;  4AYB G;  4DV1 L;  4DR5 L;  5AJ3 L;  5KND A;  2O4X A;  3S14 B;  2NVX B;  5BR8 L;  1ET9 A;  2KEC A;  1F77 A;  5FLX E;  5IWA Q;  1CKO A;  3CP0 A;  4CJ0 B;  4EVO A;  3NHH A;  3QOJ A;  3AEV A;  3R93 A;  1XNQ Q;  4A75 A;  1WTX A;  4RGN A;  1FYC A;  2HHH L;  4G7H C;  1R9T H;  3J80 i;  4BY1 H;  2VXW A;  2A6E C;  1ILQ A;  3H09 A;  4KD4 A;  5JPM C;  1BBX C;  1B8A A;  2DJF C;  2LY7 A;  3CCL A;  1PDQ A;  4C3J H;  1WFQ A;  5EGT A;  4LK1 C;  1LM0 A;  2B2V C;  4A3M B;  2F0M A;  4ME3 A;  1LUZ A;  3J7A 5;  5E1F A;  1ENA A;  3R8B A;  5C6A A;  4X62 Q;  3GV3 A;  4HAE A;  1PH1 A;  3HOW H;  1S72 A;  1GVP A;  3EA6 A;  1IBK L;  1BCP B;  1Y8N B;  1MJE A;  1LTI D;  1EOV A;  2P5Z X;  2JA9 A;  2K05 A;  5D3I B;  5JJK A;  2F0Q A;  3GTL B;  2KBN A;  4KY5 A;  1V1P B;  4DNT B;  1LYL A;  5EPJ A;  2PNR C;  4XXE A;  5J22 A;  3K81 C;  3C3L A;  2K03 A;  3S17 B;  3RUZ A;  2WII B;  2HCI A;  5C3E H;  5IGD A;  4R4C A;  1Q81 C;  5DEH A;  1Q3L A;  5GQO A;  3NPP A;  2NZH A;  3S2H H;  1SNC A;  1XWE A;  1IXR A;  4DXG A;  1Z47 A; 
#chains in the Genus database with same CATH homology
 2Z9H A;  4JVZ A;  2RCF A;  5L37 A;  4I7A A;  2QW7 A;  2HD3 A;  4N8X 1;  4JW0 A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...