3I91A

Crystal structure of human chromobox homolog 8 (cbx8) with h3k9 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
RVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 8
total genus 11
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i91A00
2L9HA 1KNEA 2D9UA 4ZAIA 2KOLA 2B2VC 2CVRA 1ESRA 1DOKA 2J7ZA 2MP1A 2Q8RE 4IUPA 4ZKBB 2MJ8A 3ONAB 4CJ2C 1NCVA 4RAUC 3G7LA 1G91A 1VMPA 1JICA 1X3QA 2L12A 2NYZD 1EOTA 2B2VA 2FINB 3H91A 1U4PA 1F9QA 4O42A 4X3TA 4R9WA 2N55A 2JP1A 1AZPA 3GV6A 1XX8A 3D6WA 3P7JA 1RTNA 3TN2A 2B2YC 2RSNA 4RWSC 1XYIA 1MSGA 1WD0A 2R3ZA 1BNZA 1CA6A 4HAEA 5COYA 1AP0A 5EPLA 1RTOA 1NR4A 1B53A 4CJ1B 4MHEA 2HUGA 1C8CA 1G2TA 3Q6SA 5DNFA 1WTPA 3FPUB 1IKLA 1QNKA 1HUNA 1B3AA 1E0BA 3QO2A 4HEDA 4ZK9B 5CMDA 1WVLA 5CORA 1TVXA 2DY7A 2K28A 1VMCA 1U4MA 2L4NA 1BBXC 1HA6A 2B2WA 5AFWA 1NR2A 1WTOA 1ML0D 4X3KA 2KEDA 4CJ0B 1PFNA 1HFGA 2FFKB 2K1BA 4QUCA 1WTVA 1SDFA 2EOTA 5JJZA 1MI2A 4LMQD 1WTWA 5EPJA 5T1IA 1ILPA 1B2TA 4NW2A 1EL0A 5D65A 1ILQA 1DOMA 1X3PA 2B2UC 3I90A 4XT1B 1WTRA 1ZXTA 3DM1A 4OIJA 1BO0A 2B2WC 3I8ZA 1WD1A 1EIHA 4MN3A 2X69A 2RA4A 1G2SA 1U4RA 4IURA 3FDTA 1DOLA 4QUFA 3MWYW 5EPKA 1G6ZA 1HRJA 4RA8A 1DZ1A 2N88A 1WTQA 1X32A 2JYOA 5T1GA 2B2TA 2KUMA 2L11A 1MSHA 3IL8A 1HUMA 5EQ0A 5CBEE 3KBXA 1GUWA 5E4WC 3I91A 2KECA 2NWGA 4HCSA 1O7ZA 4IUTA 2RVLA 3HP3A 1NAPA 2IL8A 2B2UA 4IUQA 1PFMA 5EJWA 2H1EA 3IFDA 2Q8TA 3TZDA 1U4LA 1ICWA 3MTSA 1RODA 2NZ1D 1RJTA 1J8IA 4R8IA 2MGSA 2HCIA 1HHVA 2B2YA 2L1BA 1PDQA 4X3UA 1HFNA 3KUPA 1J9OA 1DONA 1SSOA 2DY8A 1F9SA 2B2TC 2HDMA 3LWEA 2K05A 2FHTA 1BF4A 1B50A 1O7YA 2EPBA 2MPMA 2X6LA 2X6GA 4OIKA 5CBAE 1Q3LA 1PLFA 2FJ2A 1CM9A 4X3SA 1IKMA 2KEEA 2XIWA 3UI2A 2SDFA 2M2LA 1S4ZA 2VXWA 5D14A 1O80A 2K03A 1JE4A 2HCCA 5E4XA 4IUUA 1SAPA 1QG7A 1RHPA 1F9PA 4DN4M 2K04A 1F2LA 4UAIA 2EE1A 1MGSA 2FMMA 3F2UA 4ZLTF 3DEPA 1M8AA 3GV3A 2K01A 1B4OA 2KVMA 1WTXA 2HDLA 3N52A 4HSVA 2RSOA 1PFBA 4XDXA 4IUVA 3I3CA 1QE6A 1LV9A 4XT3B 1KNAA 1A15A 3R93A 1F9RA 5EKIA 1AZQA 3DEOA 1EQTA 4ZKCB 3SVMA 1CA5A 2BDNA 1IL8A 1EIGA 4U68A
chains in the Genus database with same CATH superfamily
2E2IH 2K6AA 4ZKBB 2MP1A 1E24A 3QB3A 1EY9A 3PF5A 4PQXA 4X6AH 3J81c 2AUKA 4QIWB 2B2VA 2ICIA 4DU9A 2R92B 1SRUA 1N32L 4LF6Q 5HURA 2QF7A 4MZ9A 3A8KE 1IYJB 4I7ZC 4JOIC 3ULPA 2CH4W 1HXYD 5C3EG 2GVAA 1B3AA 4H44C 2I5LX 2VB2X 1YNND 4A3KG 3IFTA 3G6JB 2WACA 3EVQA 1BBUA 1MKHA 5C6AA 5DM63 4HJ9A 2UXBQ 3OYYA 3S1NH 2EYJA 1YZ6A 4DV5Q 4LW1A 4UP8A 4A3KH 1I4QA 5T1IA 1ZXTA 3DM1A 3K57A 1EIHA 1TXYA 3I4MB 2E2JH 1TU2B 1K0SA 4P74A 2QKIC 1OXTA 3TRZA 1BXTA 3CCVA 4FVMA 1EUJA 4ME3A 1A3VA 3PCOB 3KJPA 1BCPB 2NVQB 1U4LA 1NY4A 3W5OA 4DA2A 1HHVA 2E74C 5M5YH 1CI3M 1ENAA 3BU2A 3D4DA 3SE0A 1TS5A 4H13C 4C2MB 4OEMB 5C3EB 4WJ4A 5CBAE 4RHSA 4C3JH 2N49A 3NELA 1I6HB 2IX3A 1F2MA 2DNCA 4I7AA 1YHQA 2HT1A 1HNZQ 2M2LA 2YU9B 4G7ZC 4DR6L 3GTMH 4I65A 2VUMB 3D31A 4LFBL 1XWEA 2EE1A 4KK7A 1LTTD 5C3WA 2UUCL 1A2UA 4JBKA 1K3BC 3A55A 4JI5L 4A3EB 2DJFC 2QCPX 4DV2Q 1ONLA 2NZHA 3SVMA 4YWMA 4A3FG 5LMUL 3G6EA 2NN6G 1QZGA 3I4MG 2N78A 3L3OC 3J81j 1Q46A 1HNXQ 3ITPA 3M3YB 4C1NK 4JI4Q 4ZRZA 5HGQA 4JI3L 1C4QA 4X3TA 5I6YA 4JI4L 3VYSA 2K5VA 1BNZA 3SK6A 4A3BH 1LTRD 4FP5D 4R1JA 1G2TA 4Y7NB 4PMCA 3W1GA 3ICEA 1E0BA 1MD2D 5ELOA 1I3QH 1X54A 3HOVG 4IPDA 4JVZA 3H3VI 1ZYRD 1H9MA 1SR3A 4XQQA 1F2YA 5CC4A 1Y1VG 2OQ0A 1J6QA 1VDZA 2HD3A 1MI2A 2I46A 4BBRG 1HA5A 3GQBA 5G3LD 3CD6A 1B2TA 2B2UC 5GQOA 5IGGA 1N8RC 4FXKC 3BDCA 4LF6L 1IL2A 3S1MH 4BBSB 2G9HD 1G2SA 3S15H 4B3SQ 1ICFB 1A8VA 2XVSA 3AEVA 4DV1L 2PZTA 2Z6BA 3VDYA 4IFDH 5C0XG 5IP9G 1QUQA 3RLFA 1NAPA 2IL8A 1SE8A 1WCMB 2LXJA 3U4ZA 2D0OA 5IY0A 2VY3A 2ENBA 4A3DH 2HCIA 2R61A 5ISRA 1PDQA 4X3UA 4JI7L 2AWOA 1BDOA 1HQMC 1PZKD 1SSOA 3S2HB 1AW7A 2EJMA 5BN5A 1F9SA 1A0IA 2HDMA 5KNDA 4AIMA 4WJ3M 1O7YA 2X6GA 3ER0A 3S2DH 5CV5A 4KKUA 5AJ3L 1Q3LA 1EY0A 3UE0A 1R4QB 2SEBD 1FVIA 5C3XA 4FO2A 2K03A 3CF5A 1QG7A 1IHZA 3U9OA 5JEAH 3DEPA 4POGA 4OWWB 1STEA 2LFNA 5KYIA 2KVMA 3N52A 4A3FB 3GTQB 5LMNL 1EZ8A 1KNAA 1YI2A 5EKIA 4AH6A 4JI6Q 2L9HA 1MBYA 4EQOA 5D3IB 5C0XI 4G7OC 5M5XH 2PNHA 3C3LA 3K5NA 1M90C 3V05A 2ZJPA 3OIQA 3BDLA 2PNRC 1HTPA 2VL6A 3Q24A 2VQFQ 2BCOA 4HR7B 4GNXB 2NVTB 1L1OA 3NSWA 2E76C 4IFDI 1LLRD 4KKSA 1JWMD 4NXMQ 1WTPA 1SNQA 1Z9FA 3NTHA 3C2PA 1TWGB 4JI5Q 4A3IG 1NSNS 2WV6D 1KLGD 3AU7A 5E3FA 3MXUA 4LFAQ 4A3LH 2KA7A 1D5XC 5IODA 4GLXA 4C2MH 2MQHA 5NUCA 1XNRQ 4HIKA 3E5SA 5C5LA 4J1MA 1IBLL 1EL0A 4RGTA 3I4NB 3I8ZA 3OMCA 1BUVT 3FDTA 3T51B 3I7FA 1EFID 1TWAH 5J3BA 3TREA 3T4AC 1H9RA 4GOPA 4GLAC 1EZ6A 1J5EQ 1FGUA 4H02A 1GUGA 2EYOA 4K2KA 1EY6A 3HP3A 1M4VA 4RKLA 2JEAI 2Q8TA 3KLSA 3MTSA 1LTGD 3CXCA 4RHRA 4A3JB 4QY7A 3HOVB 2NN6H 2Z4IA 4C1NI 2RKSA 5GAHC 2HIVA 3LWEA 1Z47A 3TMEA 2K05A 4A3BB 1SFOB 5K36H 5KRUA 2F0LA 4DV7Q 2RCFA 3Q23A 1B7YB 4X64L 2HHHL 4LJZC 4LFCQ 4DN4M 4BA2I 5DAUA 3H0GG 1ENFA 2A6EC 4WJWA 1BCPD 4X65L 4DR2L 1UE5A 2L55A 1XMOL 2CH4A 1A15A 2F0JA 5CYUA 3R93A 1F9RA 1LM0A 2WB1E 1KABA 4TSSA 2Y0SE 4A93B 3MXGA 4JBWA 1EWIA 2D9UA 3UDFA 4ZAIA 1PRTC 1SYCA 1I4RA 4ZUJA 1XJVA 2EDGA 2QGQA 4LF5L 1D5MC 1X3FA 2R7ZG 1FR3A 3A8IE 2F0EA 1VQ4A 4DV0L 3D6WA 3HOZG 2RSNA 4IPGA 1CA6A 3TS2A 5COYA 3CAMA 4GKJL 3KDFA 2AHOB 1AFPA 1FNUA 5DNFA 2WAQE 3CC2A 3BG3A 2JA9A 2A6ED 3JAMc 2UU9Q 1HA6A 1S40A 4EVOA 4B3MQ 1ML0D 2CWAA 3BVGA 1PYBA 1KRSA 1PFNA 4ME5A 4LWCA 1KQSA 2UUAQ 1HJPA 3GTLH 2F3WA 4YIJA 4N8X1 5I2YA 2JN4A 1N33Q 3MXNB 3I4MH 5BN3A 1ILQA 1QWYA 3PGZA 1N33L 4DNRB 1WD1A 2VQFL 3KBGA 2IX0A 4IURA 3J80E 4AYBB 3URYA 5M3MH 1WTQA 2BH8A 5D3DA 2PO4A 1O7LA 1Y69U 1QB5D 5EBCA 2ZJQA 2Q8IB 1NMGA 2KECA 4A3LG 5L37A 2NWGA 1YJWA 2B2UA 2JXMB 2NVXH 1BVSA 2K75A 3CPFA 4JC0A 1E3PA 3MHBA 4B3RL 3PIPA 1N34L 3TP7A 2QW7A 3HOVH 4PNYA 1KAWA 1HPCA 2EPBA 2MPMA 2UXDL 1CQFA 3KOJA 5KIXA 3X3MA 4GZYC 3I73A 5IGEA 4EGVA 3K81C 1W6JA 3OOCA 3SK8A 1PHJA 2R92G 5BN4A 1RHPA 3J80L 2K04A 4ZLTF 3R2IA 4CKBA 1I50B 4GNXC 4L5TA 2RHQB 1HH2P 4DR1L 3T16A 3L7ZC 1S72A 1Y1WB 4IOAA 3SK4A 4IJHA 1G91A 1GJXA 2E8GA 1U9RA 2K5HA 3HFZB 1QVGA 2LKVA 3ULLA 1SYGA 4RAUC 1ASYA 4HN7A 3RUZA 3TP8A 2FINB 3X3NA 1LYLA 4RKBA 3EFXD 5C4JB 3IKJA 4R4QA 2JSOA 1L0WA 5LL6X 5J1ZA 1NR4A 4CJ1B 1R9TH 1H9SA 4P72A 1L0YB 2PMZB 1XMQL 4A3KB 5CMDA 1TS4A 4XQJA 1HZ9A 4N8FA 1MJEA 1SMYD 3HOWB 5EKKA 1L1OC 1EQVA 2P5ZX 3F8TA 1S5FD 2VNUD 1Z7TA 4IZ8A 1SN8A 4A3GB 4FXDA 3R3OA 1R9TB 1DOMA 4XT1B 1CFMA 5IP7H 3I90A 1KD1C 4AYBG 4MN3A 3U4VA 2R7ZB 3J7ZC 2A73B 1MIUA 1S5BD 1PTOF 1II3A 3M9BA 1JR0D 1EWCA 1RF2D 2OWOA 3VR6A 1VQKA 1GUWA 1VQJA 3DWAA 1AEXA 3LWUA 1ILPA 4OGQC 5EJWA 2XN9C 4C3IH 4KI0A 3MXPA 2NZ1D 1TWAB 3T13A 4DXGA 1OXXK 4AQYQ 4OX9Q 2UXCQ 4DV3Q 3OHXC 1CHPD 1V8QA 2RF4A 2HQEA 1B8AA 3NHHA 1M1KC 1E2WA 3PUZA 3DHQA 1CM9A 2IW3A 1N9WA 2DGYA 3KYHC 2JA7H 5ELNA 5JEAJ 2QEXA 3H3VC 2OT2A 4H0LC 5I9PA 4TRDA 1S4ZA 4GNXA 3AMUA 2ALYB 4A3CG 1MHWC 4DK3C 4X65Q 4OO1H 3F2UA 1HNXL 3G4SA 3S15B 2JE6I 3NTKA 4IALA 2B8FA 2GN5A 2JA7G 2F0GA 2EIFA 2YTXA 1KL9A 1TT2A 2EYFA 1C0AA 1TQOA 3C46A 2NVYH 2CW0D 3WWVA 5A35A 3M4YA 4ILWA 4ZKCB 4DFAA 1WJJA 3CPWA 1XTDA 2BDNA 2D2CC 3D0FA 1XMQQ 2A8VA 1E1TA 3FRPB 2YTYA 2IX1A 2RCNA 3K80C 4MNOA 1Y1VH 1GXDC 3H94A 4KLKA 2JP1A 1ET6A 2E75C 5JVH3 1XYIA 3PUXA 1MSGA 3ERQA 4DAVA 2VQEL 1RTOA 2K5NA 4HTHA 3I55A 3DM3A 4DR7Q 2GA4B 2NVXB 1BBWA 4YHHL 3MFGA 1TVXA 2WP8J 3OIPA 3S2DB 1VQFA 3K6OA 3K59A 1XNRL 1VQ9A 3OTOL 5FJ8H 4NDXA 2CHBD 4LMQD 3PO3G 4Y52H 1I5FA 1STNA 2AQ3B 4WRDA 5D65A 1DD2A 1B50A 2ZTEA 3ND9A 4IJLA 4JI7Q 3EQLC 1GOZA 3GTMB 1G6ZA 3ULJA 1EOVA 4WORA 1VQEA 4Q0FA 3LNNA 3MA2B 1YNNC 3F1ZA 2EY6A 3I91A 2RVLA 4QUFA 4YCUA 1B70B 1U5KA 3DWQA 3PUVA 3GTPH 1TWGH 2XSCA 4C3JB 1VQMA 3HGBA 4DR3Q 3B6YA 2ZM6Q 3JC66 4KY7A 2ZTCA 1GUOA 2NN6I 1EYAA 4FDBA 2QDBA 3TP6A 2JA8B 3S16H 4QMGA 1XTCD 1PLFA 4EQ5A 3K58A 1ENCA 4FYDA 5F2DA 2KEEA 1FL0A 2SDFA 3VR4A 1JE4A 2JA8G 1AH9A 2F0PA 1PA6A 4JI0L 1QILA 4JI1Q 4HMJA 1HZBA 1SNCA 4DPGA 2Q2UA 3QOLA 2J4XA 5ELEA 1A62A 4NP5A 5KNCA 1PH2A 2RSOA 3MZ5A 5GAEC 1VQBA 1LT4D 4BA1I 1Q8IA 1HR0L 3HOUH 1G51A 2LY7A 3BZKA 4CKEA 5KEEA 3JAME 1FJGQ 2UXBL 2KOLA 4QJFA 4IUPA 5JVG3 2K5DA 3STBD 4UP7A 3K5OA 1L1OB 4APVA 3CU7A 4R9WA 1FD7D 3MXNA 3S1RB 2PQAB 4LF7L 3KFUA 1RTNA 2B2YC 2VB3X 2R3ZA 2A5HA 1AP0A 4A4IA 3RLNA 4M8AA 1PH4A 2QILA 2R93H 3Q6SA 3FPUB 4QQBX 1HUNA 1GKHA 1EEID 4DF7A 2TMPA 1DM0B 1CSQA 5IWAQ 3MAQA 3HKZB 1ZYRC 4JK1C 4JYAQ 1VQOA 2E2DC 1PYWD 3P20A 2K32A 5M5WH 1AE3A 3ZYYX 2OCEA 4J6HA 1YJNA 5IGFA 1DXMA 5ELDA 2NB0A 2CQOA 2NUCA 5I6WA 4K8IA 2B2WC 1Y14B 3QIAA 3NQIA 4KHPQ 4JV5L 3QOJA 3DUZA 1CK1A 5T1GA 4L5SA 5EQ0A 2A6HC 1JORA 3KBXA 3TQYA 4HCSA 4DV7L 2F1MA 2R7ZH 4DR5Q 1K73C 1N34Q 4NPSA 4BBRH 1EQQA 1N36Q 2B2YA 4BY7G 3NENA 4Z9CB 3FVQA 4IN3A 1N36L 2O4XA 3PV0A 5LL6S 1W2BA 1PH7A 4DR4L 2F52A 4TVAB 1VQHA 3GTJH 2BE5D 4LUOA 1LTLA 1Q81C 5IYCH 2WFWA 1LUZA 3CCQA 1I94Q 2FMCA 3UI2A 1O80A 3L2PA 3GD7A 3HOUB 3W3AA 4IO9A 3S17H 2H5XA 3P75A 4N9TA 2OTJA 2B39A 4DUZQ 1MJCA 1QOHA 2I5MX 1M8AA 3E0EA 1Q7YC 5C4XB 3AFQA 1Y8PB 2A69C 2WIIB 1VQGA 3BS1A 4FF3A 3SEBA 1LV9A 4C3IG 3HOXB 2WAQB 1EQTA 1HNZL 2PMZE 3J81i 1IL8A 3E9IA 3OWFA 2AWNA 2IJ0A 1HR0Q 2YU9H 4UDUC 3WOFA 2MHVA 1JICA 1YNJC 4X64Q 1YEZA 1EOTA 1E2VA 2F0MA 3K7UC 1NTGA 2F3VA 3I4NH 3S2HH 5EAYA 4NXML 3I4LA 2VW9A 2OEOA 4RMFA 4DV6L 3QG1A 4L5RC 1F77A 3TZUA 2K28A 3PUWA 4RCNA 1VMCA 4YCWA 4UP9A 1PZJD 3AYHB 1KLUD 2E5LL 3BJUA 1HFGA 3A5ZB 2KCMA 5IWAL 2BDOA 5C44B 3NTIA 1D1KA 3EN2A 1XNQL 2XRSD 2D62A 3BZCA 3PF4A 4K6DA 2XWJB 5FLMH 1EIFA 3PQIA 2R93G 4IUNA 3PO3B 4QL5A 5LMNW 4BY1H 4FNFA 2B2TA 1MSHA 4LUZA 2F0WA 5C0XH 4JI2L 1NNXA 3U9SA 1EYCA 2PI2A 1PH8A 4A3MB 3PO2G 3U58A 1SYEA 4HSPA 2KHIA 1J9OA 4DR5L 2DY8A 1H9SB 1VQNA 5EBDA 1BF4A 4HIMA 3OMGA 4AYBE 1I4GA 4CKCA 4JG2A 3GTKH 1SNPA 4CDFC 2I07B 3NP8A 4LF8Q 1D7QA 1IYUA 2KCCA 4JI0Q 4XQNA 4RH6A 1XPOA 1JC7A 5IT9L 5GAGC 4NXNQ 2UUBQ 1TWFB 1LTBD 2JA8H 1W6KA 2WINB 3S16B 3GO5A 4ZQ3A 1F2LA 5EKLA 1MGSA 5ELFA 1JCKB 2EYLA 2K01A 4JI3Q 1B4OA 2JEBI 3NBIA 1K8AC 4P2CB 1QUQB 3D8GA 1STAA 3DEOA 1B3QA 1SMXA 4KY6A 4ZYSA 1UWVA 2B63H 5M5WB 5IOCA 3FKIG 1TS3A 3G7LA 4DV4Q 2WB1G 1VMPA 1Y8OB 1AE2A 1X3QA 1JJGA 4O42A 1B9MA 4K5WA 2E5LQ 2JA6H 4B9WA 3UDXA 2EY5A 2F0QA 3TN2A 2PZUA 5FO7B 5M5YB 3HKZG 4PG3A 5EPLA 1A2TA 1HNWQ 2ZJRA 1IBML 1SE4A 4OO1I 1RIPA 4A3GH 3AQQA 3CHBD 1Q90A 2EYMA 1NE3A 3Q0AA 1QCBD 3EJIA 3M4QA 4DV5L 5IP9H 2YYZA 3P1HA 2KEDA 3NBHA 3OTOQ 2FFKB 3S1QB 2F0VA 4QUCA 4QGUA 4BY1G 5CV7A 2K14A 1TWHH 2EYPA 2ZTDA 3R8BA 1X3PA 2PCFB 4K5VA 2NBFA 4MIUA 1NBWA 4DAPA 1JWUD 2X69A 3CCMA 2AQ2B 3S1NB 4F7XA 1HZAA 2F0KA 4EX5A 4DAMA 4RA8A 3FMCA 3CRLC 1UE6A 5HY6A 4KD4A 2JYOA 4JOIA 4OWTB 1GUSA 3EIVA 3K7AH 3S24A 5M3FB 2EZVA 4LUVA 1CTMA 3CC7A 3D3RA 1PYSB 1X65A 1X6OA 5LHY1 3KF6A 1EY4A 4DR3L 1OO9B 3FHWA 1XNQQ 1OXUA 1U0LA 3M4OB 3T1YL 3HOYB 4OELB 4ODGA 5IT9c 1S5ED 1IW7C 4DR6Q 4X3SA 2KHSA 1FNVA 1SBBB 1FNWA 1ZEQX 2Z8LA 2ZXOA 1PH9A 4JI6L 4K6LA 2R93B 5C3EH 1EFWA 1SEBD 2SNMA 2FMMA 5HGTA 1SYDA 1VQ8A 4C3HB 4IFDG 4DV2L 4A3JG 1EU4A 4HSVA 2A74C 4XDXA 4AQYL 1JJ2A 2K5WA 5FOBB 2H4OA 3S9WA 1X55A 2MUYA 2R7DA 5CV9A 5FK9C 1QVCA 2Q8RE 4RG1A 3JAMi 2UUAL 3M85A 2QDLA 4LF9Q 4BS9A 4RGNA 3PO3H 1WI5A 2LSSA 1SE2A 2Y0SG 1DCZA 1LT3D 1VQAA 2V4DA 2IWHA 4YWKA 3CQZB 5C4HA 3KLSX 1EWHA 4U673 1QNKA 1ZKOA 3M3YH 2A6HD 2JA5G 3MEHA 4A3MG 1JB3A 3K5MA 5AFWA 1Q8KA 4X3KA 1E2ZA 4CJ0B 4IPHA 1CZWA 4GOPB 3NWSA 1SDFA 3RLOA 4LF4Q 5C4XG 4N9PA 1SYBA 2B63G 3J7AF 4NW2A 5FLXL 2BE5C 2KCNA 2F3IA 1BR9A 4DUYL 3AB9A 1U4RA 1GVPA 4B08A 1DOLA 4G57A 1GHJA 1PTOB 3BVMA 2L11A 1K9MC 1I4PA 2EY1A 1A3UA 3HOYH 1H9JA 2H1EA 1EQRA 4BBSH 3K0XA 3S1MB 3H0GH 1E7ZA 2BA0A 1JB7A 3QR8A 1UAPA 5AJ3Q 4YY3L 2NVTH 3RN5A 5JOBA 1SNDA 4DR4Q 1RD9D 2PI2E 4DR2Q 3S1RH 1A3TA 1PZID 4K14A 4KJNA 2MO1A 1H9KA 3OW2A 3K0YA 3HG9A 1LTAD 3AFPA 5FLMG 5M3FH 4ZCKA 2VXWA 4B3TL 3E9HA 5JAVA 1F9PA 4TKOB 4UY8C 4P71A 2XRQD 1RL2A 1V1OA 3TEHB 4LF7Q 4IUVA 3I3CA 2MFIA 4DNIA 3SHLA 1I6VC 5M9OA 1KNEA 4WFN3 4C3HG 2J7ZA 1UNSA 1UE1A 4KY5A 2B29A 3HZXA 4IQZA 2A19A 4OO1G 1VQPA 4QCLA 2N55A 1HNWL 4K0KQ 2NVYB 3DWPA 5FO8B 4O0AA 2Q2TA 2AMCB 3M4PA 4C3HH 4DKAC 3A7AB 5TSSA 4A3JH 2RHSB 1TWCH 4DV1Q 2EJFC 2KHJA 3G71A 4HEDA 4ZK9B 3GTPB 1WVLA 1Z6HA 3RNUA 2DN8A 2B2WA 1PH1A 4KHPL 4JCVE 3LX0A 3C1EA 3HKSA 4FF4A 2G9DA 5C4ZA 5I2XA 1S5DD 2WKDA 1I6HH 4YWLA 1STGA 2JA6G 4A3IH 1Y1WH 1TWCB 1WOCA 2KJXA 1N32Q 4R4CA 4GN3B 1SJHD 3W1BA 3VYRA 2I5HA 3HRZC 1JOOA 4JW0A 4HJ8A 1T9HA 1J5EL 3FPPA 4CDEC 2N88A 3ERSX 2SNSA 3O13A 3A5UA 1UEBA 3K7AB 1EY5A 4C3IB 1EY7A 2BOSA 2CQAA 4JPBW 2SOBA 3MC0B 3T1HQ 1IYVA 4XYQA 1PFMA 1R4PB 3TZDA 1ICWA 3IRBA 4PZ7A 4CGYB 1RODA 1SJED 3D6CA 2MGSA 2Z6KA 4A75A 4IOCA 3NQTA 4V190 1K8MA 2RDFA 1CKNA 2DJGC 2RQXA 3KUPA 4LFBQ 1DONA 5CR3A 3PIP3 3HS0C 1ET9A 3RZOB 2IT1A 2F4IA 4OIKA 2EXZA 3GTGB 4DAYB 2RDHA 4CDCC 4JBMA 2XGTA 1T5EA 2L0CA 4LFCL 4GS3A 3BYTB 3GTGH 1P16A 4LF8L 5LMUQ 5D14A 5C0XJ 3JAML 3CCJA 5E4XA 1VQ7A 4A3CH 4DV3L 2NTSA 1LO5D 2PW5A 1D2BA 2ICEC 1CKMA 3BZDB 1SYFA 5JJKA 1ASZA 1KDCA 1XPRA 2ZT9C 4EQNA 1AN8A 1O7IA 4OL7A 1NJIC 4XT3B 1DJRD 4OXPA 3KK7A 3H0GB 2OXPA 2CCZA 4RFBA 1CA5A 2NTTA 4BWGB 4U68A 4LF9L 1A6XA 1S5CD 3F2CA 2Z1CA 3G48A 4L8JA 3V2TA 5IE8A 2L15A 1QVFA 1B1ZA 1NCVA 1V1PA 2A1AA 3OW7A 1BOSA 5IYDG 1YIJA 4F87A 2B63B 4QIWE 1PRTD 4LF5Q 3GV6A 2BA1A 5BR8Q 3J7AV 1K0RA 1YNJD 1Q82C 4A3BG 1CSPA 1Q12A 4KHVA 1B53A 4S3SA 3HOYG 2HUGA 4MTNA 3CCRA 1PTOC 3KDFB 1KTKA 1BBXC 1U4MA 2L4NA 1WTOA 2A68D 1H95A 5KYLA 1C7YA 3GTKB 1HZCA 3OWEB 1Q1BA 1WFQA 3T1HL 3M7NA 2LMCB 2RDGA 2F0FA 1SNOA 1JE5A 4PV1C 4DR7L 3ZJYC 4PMBA 5C5MA 1YITA 1E22A 2RA4A 3Q8DA 1TWHB 4A93G 3TS0A 2EQSA 1IW7D 5EPKA 3CMAA 1Y1VB 3A56A 2ZXRA 1UUPA 3J80i 3S17B 2B3GA 2KUMA 1HUMA 1IBKL 4BY1B 3WOEA 1K3RA 4OONA 1EEFD 1IBKQ 4H7BA 3GTJB 2XTIA 1J8IA 2ZM6L 2XNAC 2O5IC 4G4KA 4YY3Q 2B8GA 4J15A 3NPPA 3SR1A 2ATWA 4POFA 2ZXPA 1L0XB 3HEJA 3OSOA 5C44H 1CQVA 2JA6B 1GD7A 5I4DA 2F0SA 1STYA 5LMNQ 2IY5B 2KBNA 3I56A 3R2TA 1VQ6A 1K8OA 2XIWA 5K5PA 5CV8A 3FP9A 2HCCA 1SE3A 2RBMA 4ULLA 3RZDB 4UAIA 4LK1C 3EROA 1KRTA 5JJLA 3GV3A 4A3EG 2QEJC 1V1PB 3TSSA 2PQAA 5M3FG 1WTXA 1GUTA 4CDDC 5BR8L 3MVVA 1JJCB 4FXGC 4ALPA 1SXTA 4KN4C 2C35B 2CKZB 4P75A 4OWXB 3VA5A 3VR3A 2JA7B 3J81L 1DYQA 2F0UA 1LACA 2ID0A 3J81E 2KCTA 5IGCA 4CJ2C 4J8QA 1NUCA 2PQEA 3CKIB 4K0KL 5E7NA 1VS0A 3U50C 3V96A 3H91A 5ELBA 3J7YW 4K2LA 2Z0SA 5JJIA 1K83H 3VYTA 3FEWX 1HQRD 5J39A 3C1FA 3HOXH 3IAYA 3HKZE 4HAEA 1KAAA 4HCEA 3STBC 4DAYA 2JA5B 5K36G 3NEMA 5I9OA 5JPMC 2DY7A 4BY7H 4A3MH 1Q1EA 2TSSA 1CHQD 5M5XB 4PZ8A 4PZ6A 4NB3A 1OXVA 1X3GA 1Y8NB 3PMFA 3K8AA 1CUKA 3KF8A 2R7FA 5GROA 4A3DG 5ELCA 3VA7A 2K52A 1YHAA 4NMZA 1BO0A 4LAAA 4DXFA 2VQEQ 1KXLA 4B9XA 4XIGS 4C3JG 3HOWH 4DUYQ 1QJOA 4GLVB 2LS01 1SNMA 4IFDJ 1QNUA 1VF7A 3PSIA 5IP7G 5E4WC 3VYUA 1X3EA 2M9VA 4QB4A 4OX9L 2UXCL 4PMWA 3HOWG 4RCOA 5JEAG 1IXRA 1JOKA 2E2HB 3A54A 1K83B 3TDQA 2FHTA 1PRTF 2XWBB 3SGIA 1C9OA 3I2ZA 1K8GA 1XPUA 1QZHA 5A2QE 1PH6A 1CZGA 1TWFH 2CWPA 1PRTB 2BH2A 3J80c 4L6TB 5DEHA 2G5DA 3GP7A 4R4TA 2PZWA 4A93H 1PXUA 2O5JC 3I4OA 1RDPD 3I4NG 1V1QA 4M1UB 4A76A 3FKIH 2PPBC 3A0JA 4X62Q 2F4VQ 2K33A 4DV0Q 1I94L 1OTCA 3KLWA 2F4VL 1GHKA 2JJQA 3T1YQ 3KJOA 2PW7A 1RKNA 1SROA 4KJOA 1DOKA 5FKAC 2K7VA 4UHVA 3GTOB 3SXHA 1T5XD 1C48A 3GTQH 3HOUG 1F2ZA 3T53B 5IYCG 4JYAL 1AZPA 3CMEA 3S14H 3MEFA 1WD0A 4P73A 3S14B 3KF8B 1VCIA 1W3SA 3PUYA 3Q22A 3E0JA 5C44G 1D1IA 1C8CA 4GKKL 3F2DA 4OHJA 4CHTB 4E6IA 1XMOQ 3S1QH 4GKJQ 2QA4A 4HMIA 3UDGA 4R4IA 5IYBG 1GM5A 3NE5B 3GTOH 1NR2A 4DGZA 4BY7B 4JV5Q 2Z9HA 1PVOA 3VR5A 1BQQT 1A63A 3I70A 1PH5A 4DK6C 1BCPC 2K1BA 1LTSD 2YV5A 4BXXH 2PYKA 3H09A 3VR2A 1VQLA 5FLXE 4G7HC 4RGOS 1LT6D 1TKWB 3RMHA 3T56B 1WTRA 5IYDH 3W2DA 3CCEA 1P8LA 2D0PA 3GDEA 1D8LA 5IGBA 1SMYC 1KDAA 1DZ1A 2EYHA 1UE7A 3DXJC 1WCMH 4NXNL 3UDIA 3DLLA 4KKTA 2UXDQ 3MFYA 1YBYA 4FF2A 2OQKA 3IFDA 2C5CA 2JQOA 1PFSA 1RJTA 2VUMG 2YTVA 2F03A 1HFNA 3M4OH 2CW0C 4EQPA 1GO3E 2F0IA 1RCVD 3NK9A 4B3SL 4CBVA 1VQ5A 1CKOA 4B3RQ 2B2TC 2Z6KC 3QJYA 3CCUA 2E2HH 1YJ9A 3RD4A 1FGBD 2VZAA 2X6LA 1KC8C 2UUBL 5KNBA 4JI1L 1E1OA 5CV6A 4IUUA 1EY8A 4Y7NH 3CQZH 2L5TA 2AUJD 2EJGC 1V43A 4GN4B 4F88A 1SFOH 4XTCS 3OPOA 4NKLA 5CGKA 1HTLD 1LABA 3I72A 3UE1A 4YHHQ 2F0NA 4R4OA 4DR1Q 3CP0A 4K5XA 1EIGA 4OIJA 2Z4HA 1STHA 4DK1A 1ESRA 2CFMA 1G8ZD 1FJGL 2L12A 2DNEA 4HJ7A 4A3GG 1U4PA 1F9QA 2F0OA 3PO2H 1Y1WG 3M7GA 1I4XA 4V0BA 3P7JA 2JA5H 4RWSC 4L5QA 2GVBA 3E3XA 1GUNA 4HJAA 4DK0A 2R92H 1TY2A 1VQCA 1LT5D 4X62L 3SK5A 1NMFA 4XYOA 5GADC 4A3IB 2NZOA 1IKLA 1YVCA 5JPNC 1D5ZC 5CORA 2I0QA 3HOZH 4GKKQ 3H3VH 5IIFA 5EGTA 2MO0A 2JK8A 1HCZA 4KMUC 1BCPF 4LF4L 3H6MA 2E2IB 3HOZB 1STBA 3N6RA 4JI2Q 4B3ML 2K50A 1PTOH 1DGSA 1JMCA 2D5DA 5JJZA 1O78A 5J22A 5EPJA 3CC4A 1EU3A 1I50H 2M00A 5KGUA 2NVQH 2EY2A 3A74A 1VF5C 3MWYW 3DMUA 2A68C 4DNTB 3PO2B 3A7LA 3RZDH 3HOXG 1X32A 1PH3A 1I4HA 4X66L 1KDBA 2ASBA 2HHHQ 1TY0A 4HJ5A 4O2DA 2J0TD 3IL8A 1WYDA 5E1FA 3D4WA 4GN5A 4MTKA 1KHIA 4ZUIA 1EYDA 1IBLQ 2E2JB 4R8IA 3ND8A 5FJ8G 2L1BA 2V1CC 4KTAA 1VQDA 3NBHB 4JI8L 1G291 4Q5VA 3CW2C 3L9AX 4KHZA 1CT1D 4HIOA 3NXWA 4F8MA 1ESFA 3LGJA 2KENA 3NUCA 2EXDA 4TQUS 2FJ2A 4ID6A 3F2BA 4R8NA 5IT9E 4UPAA 1K28A 2F0DA 2KQ3A 4DUZL 3RR5A 2LXKA 3QWNA 1KIXA 2OTLA 3CRKC 2A69D 3J7A5 5M3MB 1JOQA 3H15A 4A3FH 4XXEA 3BDOA 1CKNB 2O2LD 5FO9B 1D6EC 1B44D 2R6GA 4BBRB 3WDNA 1PFBA 1QE6A 1UEAB 3SDZA 5C4JH 2Q2HA 1AZQA 2N3SA 2UU9L 2FXQA 3GTLB 2VS1A 5M3MG 2VUMH 2B2VC 2CVRA 5CV4A 2MJ8A 3ONAB 3KLRA 3K5LA 3BYYB 2HIXA 2NYZD 3PIO3 3BVZA 4DV6Q 1TS2A 2MNAA 1OXSC 2N8NA 2WAQG 5IGDA 1XX8A 4LNQA 1JWSD 4FF1A 5G3LF 4MHEA 1SLJA 1EYGA 3QO2A 4JBJA 1XXGA 2F0HA 1JT8A 4C56C 1PMRA 1I3QB 2Q2IA 4LFAL 1VQIA 2AKWB 1WTVA 3NWTA 3PIOA 5H1SE 2WKCA 2EOTA 1BKBA 1JQYD 3D4RA 5C4XH 5IYBH 1WTWA 3CCLA 3EBEA 1LTID 2AQ1B 2DUDA 2IPKD 2OF1A 4ABNA 4KV6A 1YHBA 4YCVA 1G6PA 2WB1B 3TBIB 4BBSG 1HRJA 1X56A 1IBMQ 1HR0W 1V9PA 3A8JE 5CBEE 4IUTA 4IUQA 1O7ZA 1EIYB 3RZOH 3KF6B 5DM73 4GOPC 1Q86C 4A3EH 4QF4A 3TP5A 2F0TA 1B9NA 5DLQE 2C9OA 4IPCA 4HIDA 2IHEA 1PV4A 1X9NA 2HQLA 4BXXG 4RGMA 3EA6A 2K4KA 1IKMA 4B3TQ 4X66Q 1FYCA 2IHFA 2ES2A 3L0OA 5A2QL 1SAPA 1YNXA 2UUCQ 3CCSA 1TIID 3E6ZX 4KN7C 1L2FA 4K8JA 5FLXc 3RN2A 3FKIB 1WCMG 1WTHA 1IZ6A 2EVBA 4O1NA 1PTOD 2K5QA 2HDLA 4JI8Q 4A3DB 2Y0SB 4KD3A 4L63B 1TR5A 1S3OA 4DV4L
chains in the Genus database with same CATH topology
2K6AA 4ZKBB 2MP1A 3QB3A 1EY9A 4PQXA 2AUKA 4QIWB 2B2VA 2ICIA 4DU9A 2R92B 5HURA 2QF7A 3A8KE 4I7ZC 1HXYD 1B3AA 4H44C 2VB2X 1YNND 3IFTA 3G6JB 2WACA 3EVQA 5DM63 5C6AA 2EYJA 1I4QA 5T1IA 1ZXTA 3DM1A 3K57A 1EIHA 3I4MB 1TU2B 2QKIC 1OXTA 1BXTA 4FVMA 1A3VA 1BCPB 2NVQB 1U4LA 4DA2A 1HHVA 2E74C 1CI3M 1ENAA 3D4DA 3SE0A 1TS5A 4H13C 4C2MB 5C3EB 5CBAE 4RHSA 1I6HB 2IX3A 1F2MA 2DNCA 2M2LA 2YU9B 4G7ZC 4I65A 2VUMB 3D31A 1XWEA 2EE1A 4KK7A 1LTTD 5C3WA 1A2UA 3A55A 4A3EB 2QCPX 1ONLA 3SVMA 2NN6G 3L3OC 3ITPA 3M3YB 4C1NK 4ZRZA 1C4QA 4X3TA 5I6YA 3VYSA 1BNZA 3SK6A 1LTRD 4FP5D 1G2TA 4Y7NB 4PMCA 1E0BA 1MD2D 1ZYRD 1H9MA 4XQQA 1F2YA 5CC4A 1VDZA 2I46A 1MI2A 1HA5A 3GQBA 5G3LD 1B2TA 2B2UC 5IGGA 4FXKC 3BDCA 4BBSB 2G9HD 1G2SA 2XVSA 2PZTA 4IFDH 5C0XG 3RLFA 1NAPA 2IL8A 1WCMB 2ENBA 2HCIA 2R61A 5ISRA 1PDQA 4X3UA 2AWOA 1BDOA 1HQMC 1PZKD 1SSOA 3S2HB 1AW7A 2EJMA 5BN5A 1F9SA 2HDMA 5KNDA 1O7YA 2X6GA 5CV5A 4KKUA 1Q3LA 1EY0A 1R4QB 2SEBD 5C3XA 4FO2A 2K03A 1QG7A 1IHZA 3U9OA 5JEAH 3DEPA 1STEA 2LFNA 5KYIA 2KVMA 3N52A 4A3FB 3GTQB 1EZ8A 1KNAA 5EKIA 2L9HA 1MBYA 4EQOA 5D3IB 5C0XI 4G7OC 3C3LA 3K5NA 3V05A 3OIQA 3BDLA 2PNRC 1HTPA 3Q24A 2BCOA 4HR7B 2NVTB 3NSWA 2E76C 4IFDI 1LLRD 4KKSA 1JWMD 1WTPA 1SNQA 3NTHA 3C2PA 1TWGB 1NSNS 2WV6D 1KLGD 3AU7A 5E3FA 3MXUA 2KA7A 1D5XC 5IODA 5NUCA 3E5SA 5C5LA 4J1MA 1EL0A 4RGTA 3I4NB 3I8ZA 3OMCA 1BUVT 3FDTA 3T51B 1EFID 3T4AC 1H9RA 1EZ6A 1GUGA 2EYOA 4K2KA 1EY6A 3HP3A 1M4VA 4RKLA 2JEAI 2Q8TA 3KLSA 3MTSA 1LTGD 4A3JB 4RHRA 3HOVB 2NN6H 2Z4IA 4C1NI 2RKSA 3LWEA 1Z47A 3TMEA 2K05A 4A3BB 1SFOB 5K36H 5KRUA 2F0LA 3Q23A 4LJZC 4DN4M 4BA2I 5DAUA 1ENFA 2A6EC 4WJWA 1BCPD 2L55A 1A15A 2F0JA 5CYUA 3R93A 1F9RA 1KABA 4TSSA 4A93B 3MXGA 4JBWA 2D9UA 4ZAIA 1PRTC 1SYCA 4ZUJA 1I4RA 2EDGA 1D5MC 1FR3A 3A8IE 2F0EA 3D6WA 2RSNA 1CA6A 5COYA 1AFPA 1FNUA 5DNFA 3BG3A 2A6ED 1HA6A 4EVOA 1ML0D 3BVGA 1PFNA 4ME5A 2F3WA 4YIJA 5I2YA 5BN3A 1ILQA 1QWYA 4DNRB 1WD1A 3KBGA 2IX0A 4IURA 3J80E 4AYBB 3URYA 1WTQA 5D3DA 2PO4A 1O7LA 1Y69U 1QB5D 5EBCA 2Q8IB 2KECA 2NWGA 2B2UA 2JXMB 3MHBA 3TP7A 4PNYA 1HPCA 2EPBA 2MPMA 1CQFA 5KIXA 3X3MA 4GZYC 3I73A 5IGEA 4EGVA 1W6JA 3OOCA 3SK8A 5BN4A 1RHPA 3J80L 2K04A 4ZLTF 3R2IA 4CKBA 1I50B 3T16A 3L7ZC 1Y1WB 3SK4A 1G91A 1GJXA 1U9RA 2LKVA 1SYGA 4RAUC 4HN7A 3RUZA 3TP8A 2FINB 3X3NA 4RKBA 3EFXD 5C4JB 3IKJA 2JSOA 5LL6X 5J1ZA 1NR4A 4CJ1B 1H9SA 1L0YB 2PMZB 4A3KB 5CMDA 1TS4A 4XQJA 1SMYD 3HOWB 5EKKA 1EQVA 2VNUD 1S5FD 1Z7TA 4IZ8A 4A3GB 4FXDA 3R3OA 1R9TB 1DOMA 4XT1B 1CFMA 3I90A 4MN3A 2R7ZB 2A73B 1S5BD 1PTOF 1II3A 1JR0D 1EWCA 1RF2D 3VR6A 1GUWA 3DWAA 1AEXA 3LWUA 1ILPA 4OGQC 5EJWA 2XN9C 4KI0A 3MXPA 2NZ1D 1TWAB 3T13A 4DXGA 1OXXK 3OHXC 1CHPD 1V8QA 2HQEA 3NHHA 1E2WA 3PUZA 3DHQA 1CM9A 2IW3A 3H3VC 5JEAJ 2OT2A 4H0LC 5I9PA 4TRDA 1S4ZA 3AMUA 4OO1H 3F2UA 3S15B 2JE6I 3NTKA 4IALA 2B8FA 2F0GA 1TT2A 2EYFA 1TQOA 3C46A 2CW0D 5A35A 3M4YA 4ILWA 4ZKCB 4DFAA 2BDNA 2D2CC 3FRPB 2IX1A 1GXDC 3H94A 2JP1A 1ET6A 2E75C 5JVH3 1XYIA 3PUXA 1MSGA 3ERQA 4DAVA 1RTOA 4HTHA 2GA4B 2NVXB 3MFGA 1TVXA 2WP8J 3OIPA 3S2DB 3K6OA 3K59A 2CHBD 4LMQD 4NDXA 1STNA 2AQ3B 4WRDA 5D65A 1DD2A 1B50A 3ND9A 3EQLC 1GOZA 3GTMB 1G6ZA 4WORA 4Q0FA 3LNNA 3MA2B 1YNNC 2EY6A 3I91A 2RVLA 4QUFA 3DWQA 3PUVA 2XSCA 4C3JB 3HGBA 4KY7A 1GUOA 2NN6I 1EYAA 2QDBA 3TP6A 2JA8B 4QMGA 1XTCD 1PLFA 3K58A 1ENCA 4FYDA 5F2DA 2KEEA 2SDFA 3VR4A 1JE4A 2F0PA 1QILA 4HMJA 1SNCA 3QOLA 2J4XA 5ELEA 4NP5A 5KNCA 2RSOA 3MZ5A 1LT4D 4BA1I 1Q8IA 2LY7A 4CKEA 5KEEA 3JAME 2KOLA 4IUPA 5JVG3 2K5DA 3K5OA 3CU7A 4R9WA 1FD7D 3MXNA 3S1RB 1RTNA 2B2YC 2VB3X 2R3ZA 2A5HA 1AP0A 4M8AA 2QILA 3Q6SA 3FPUB 1HUNA 1EEID 4DF7A 2TMPA 1DM0B 3MAQA 3HKZB 1ZYRC 4JK1C 2E2DC 1PYWD 3P20A 2K32A 3ZYYX 4J6HA 5IGFA 1DXMA 5ELDA 2NB0A 2NUCA 5I6WA 4K8IA 2B2WC 3QIAA 3NQIA 3QOJA 3DUZA 1CK1A 5T1GA 5EQ0A 2A6HC 1JORA 3KBXA 4HCSA 2F1MA 2B2YA 4Z9CB 3FVQA 4IN3A 2O4XA 3PV0A 5LL6S 2BE5D 2FMCA 3UI2A 1O80A 3GD7A 3HOUB 3W3AA 3P75A 4N9TA 2B39A 1QOHA 1M8AA 5C4XB 1Y8PB 2A69C 2WIIB 3BS1A 4FF3A 3SEBA 1LV9A 4C3IG 3HOXB 2WAQB 1EQTA 1IL8A 3OWFA 2AWNA 2IJ0A 4UDUC 3WOFA 2MHVA 1JICA 1YNJC 1EOTA 1E2VA 2F0MA 2F3VA 3I4LA 2OEOA 3QG1A 1F77A 3TZUA 2K28A 3PUWA 4RCNA 1VMCA 1PZJD 1KLUD 1HFGA 2BDOA 5C44B 3NTIA 1D1KA 2XRSD 2D62A 4K6DA 2XWJB 4IUNA 3PO3B 4FNFA 2B2TA 1MSHA 2F0WA 5C0XH 3U9SA 1EYCA 4A3MB 1SYEA 4HSPA 1J9OA 2DY8A 1H9SB 5EBDA 1BF4A 3OMGA 1I4GA 4CKCA 1SNPA 2I07B 3NP8A 1IYUA 2KCCA 4XQNA 4RH6A 1JC7A 5IT9L 1TWFB 1LTBD 3S16B 1W6KA 2WINB 3GO5A 4ZQ3A 1F2LA 5EKLA 1MGSA 5ELFA 1JCKB 2EYLA 2K01A 1B4OA 2JEBI 3NBIA 4P2CB 3D8GA 1STAA 3DEOA 4KY6A 4ZYSA 5M5WB 5IOCA 1TS3A 3G7LA 1VMPA 1Y8OB 1X3QA 4O42A 1B9MA 4K5WA 4B9WA 2EY5A 2F0QA 3TN2A 2PZUA 5FO7B 5M5YB 5EPLA 1A2TA 1SE4A 4OO1I 3CHBD 1Q90A 2EYMA 3Q0AA 1QCBD 3EJIA 2YYZA 3P1HA 2KEDA 3NBHA 2FFKB 3S1QB 2F0VA 4QUCA 5CV7A 2EYPA 3R8BA 1X3PA 2PCFB 4K5VA 2NBFA 4MIUA 4DAPA 1JWUD 2X69A 2AQ2B 3S1NB 4F7XA 2F0KA 4RA8A 3FMCA 3CRLC 4KD4A 2JYOA 1GUSA 5M3FB 2EZVA 1CTMA 3D3RA 5LHY1 1EY4A 1OO9B 1OXUA 3M4OB 3HOYB 4ODGA 1S5ED 1IW7C 4X3SA 2KHSA 1FNVA 1SBBB 1FNWA 1ZEQX 2Z8LA 2ZXOA 4K6LA 2R93B 1SEBD 2SNMA 2FMMA 5HGTA 1SYDA 4C3HB 4IFDG 1EU4A 4HSVA 2A74C 4XDXA 2K5WA 5FOBB 2H4OA 3S9WA 2MUYA 5CV9A 5FK9C 2Q8RE 3M85A 4BS9A 4RGNA 1SE2A 1DCZA 1LT3D 2V4DA 2IWHA 3CQZB 5C4HA 3KLSX 1EWHA 4U673 1QNKA 1ZKOA 2A6HD 3MEHA 1JB3A 3K5MA 5AFWA 4X3KA 1E2ZA 4CJ0B 1CZWA 3NWSA 1SDFA 4N9PA 1SYBA 3J7AF 4NW2A 5FLXL 2BE5C 2KCNA 1BR9A 3AB9A 1U4RA 4B08A 1DOLA 4G57A 1GHJA 1PTOB 3BVMA 2L11A 1I4PA 2EY1A 1A3UA 1H9JA 2H1EA 3S1MB 2BA0A 1UAPA 5JOBA 1SNDA 1RD9D 1A3TA 1PZID 4K14A 4KJNA 1H9KA 3K0YA 3HG9A 1LTAD 2VXWA 5JAVA 1F9PA 4TKOB 2XRQD 1V1OA 4IUVA 3I3CA 3SHLA 1I6VC 5M9OA 1KNEA 4WFN3 4C3HG 2J7ZA 1UNSA 4KY5A 3HZXA 4IQZA 4OO1G 4QCLA 2N55A 2NVYB 3DWPA 5FO8B 3A7AB 5TSSA 2EJFC 4HEDA 4ZK9B 3GTPB 1WVLA 1Z6HA 2DN8A 2B2WA 3LX0A 3C1EA 4FF4A 2G9DA 5C4ZA 5I2XA 1S5DD 2WKDA 1STGA 1TWCB 2KJXA 1SJHD 3VYRA 3HRZC 1JOOA 3FPPA 2N88A 2SNSA 3O13A 4C3IB 3K7AB 1EY5A 1EY7A 2BOSA 2CQAA 2SOBA 3MC0B 1IYVA 4XYQA 1PFMA 1R4PB 3TZDA 1ICWA 4CGYB 1RODA 1SJED 3D6CA 2MGSA 3NQTA 4V190 1K8MA 2RDFA 2RQXA 3KUPA 1DONA 5CR3A 3PIP3 3HS0C 1ET9A 3RZOB 2IT1A 2F4IA 4OIKA 2EXZA 3GTGB 2RDHA 1T5EA 2L0CA 3BYTB 5D14A 5C0XJ 3JAML 5E4XA 2NTSA 1LO5D 2PW5A 1D2BA 2ICEC 3BZDB 1SYFA 1KDCA 2ZT9C 4EQNA 1AN8A 4OL7A 4XT3B 1DJRD 3KK7A 3H0GB 2OXPA 4RFBA 1CA5A 2NTTA 4BWGB 4U68A 1A6XA 1S5CD 2Z1CA 4L8JA 3V2TA 1B1ZA 1NCVA 1V1PA 3OW7A 1BOSA 4F87A 2B63B 1PRTD 3GV6A 2BA1A 3J7AV 1YNJD 1Q12A 4KHVA 1B53A 4S3SA 2HUGA 1PTOC 1KTKA 1BBXC 1U4MA 2L4NA 1WTOA 2A68D 5KYLA 3GTKB 3OWEB 1Q1BA 3M7NA 2LMCB 2RDGA 2F0FA 1SNOA 4PV1C 4PMBA 5C5MA 2RA4A 1TWHB 1IW7D 5EPKA 1Y1VB 3A56A 2ZXRA 1UUPA 3S17B 2KUMA 1HUMA 4BY1B 3WOEA 1EEFD 4H7BA 3GTJB 1J8IA 2XNAC 2O5IC 4G4KA 2B8GA 3SR1A 3NPPA 2ZXPA 1L0XB 3HEJA 3OSOA 1CQVA 2JA6B 5I4DA 2F0SA 1STYA 3R2TA 1K8OA 2XIWA 5K5PA 5CV8A 2HCCA 1SE3A 2RBMA 4ULLA 3RZDB 4UAIA 4LK1C 3EROA 3GV3A 2QEJC 1V1PB 3TSSA 1WTXA 1GUTA 3MVVA 4FXGC 1SXTA 4KN4C 3VA5A 3VR3A 2JA7B 3J81L 1DYQA 2F0UA 1LACA 2ID0A 3J81E 5IGCA 4CJ2C 4J8QA 1NUCA 2PQEA 3CKIB 3V96A 3H91A 5ELBA 3J7YW 4K2LA 3VYTA 3FEWX 1HQRD 5J39A 3C1FA 3IAYA 4HAEA 1KAAA 4HCEA 4DAYA 2JA5B 5K36G 5I9OA 5JPMC 2DY7A 1Q1EA 2TSSA 1CHQD 5M5XB 1OXVA 1Y8NB 3PMFA 3KF8A 5ELCA 3VA7A 4NMZA 1BO0A 4LAAA 4DXFA 4B9XA 4XIGS 4C3JG 1QJOA 2LS01 1SNMA 4IFDJ 1QNUA 1VF7A 5E4WC 3VYUA 2M9VA 4QB4A 4PMWA 4RCOA 5JEAG 1JOKA 2E2HB 3A54A 1K83B 3TDQA 2FHTA 1PRTF 2XWBB 5A2QE 1CZGA 1PRTB 4L6TB 5DEHA 3GP7A 2PZWA 1PXUA 2O5JC 1RDPD 4M1UB 2PPBC 2K33A 1GHKA 2PW7A 1RKNA 4KJOA 1DOKA 5FKAC 2K7VA 3GTOB 3SXHA 1T5XD 1C48A 1F2ZA 3T53B 1AZPA 1WD0A 3S14B 3PUYA 1VCIA 3Q22A 3E0JA 1D1IA 1C8CA 4OHJA 4CHTB 4E6IA 4HMIA 3NE5B 1NR2A 4DGZA 4BY7B 3VR5A 1BQQT 3I70A 1BCPC 2K1BA 1LTSD 2PYKA 3H09A 3VR2A 5FLXE 4G7HC 4RGOS 1LT6D 1TKWB 3RMHA 3T56B 1WTRA 3W2DA 5IGBA 1SMYC 1KDAA 1DZ1A 2EYHA 3DXJC 4KKTA 3MFYA 4FF2A 3IFDA 2C5CA 1RJTA 2F03A 1HFNA 2CW0C 4EQPA 3NK9A 2F0IA 1RCVD 4CBVA 2B2TC 3QJYA 3RD4A 1FGBD 2X6LA 5KNBA 5CV6A 4IUUA 1EY8A 2L5TA 2AUJD 2EJGC 1V43A 4F88A 4XTCS 3OPOA 4NKLA 5CGKA 1HTLD 1LABA 3I72A 2F0NA 4K5XA 1EIGA 4OIJA 2Z4HA 1STHA 4DK1A 1ESRA 1G8ZD 2L12A 2DNEA 1U4PA 1F9QA 2F0OA 3M7GA 1I4XA 4V0BA 3P7JA 4RWSC 1GUNA 4DK0A 1TY2A 1LT5D 3SK5A 4XYOA 4A3IB 1IKLA 5JPNC 1D5ZC 5CORA 5IIFA 5EGTA 1HCZA 4KMUC 1BCPF 3H6MA 2E2IB 3HOZB 1STBA 3N6RA 1PTOH 2D5DA 5JJZA 1O78A 5J22A 5EPJA 1EU3A 2M00A 5KGUA 2EY2A 1VF5C 3MWYW 3DMUA 2A68C 4DNTB 3PO2B 3A7LA 1X32A 1I4HA 1KDBA 1TY0A 3IL8A 2J0TD 5E1FA 3D4WA 4ZUIA 1EYDA 2E2JB 4R8IA 3ND8A 2L1BA 4KTAA 1G291 4Q5VA 3L9AX 4KHZA 1CT1D 3NXWA 4F8MA 1ESFA 3NUCA 4TQUS 2FJ2A 4ID6A 4R8NA 5IT9E 2F0DA 2KQ3A 3QWNA 3CRKC 2A69D 1JOQA 5M3MB 4XXEA 3BDOA 2O2LD 5FO9B 1D6EC 1B44D 2R6GA 4BBRB 3WDNA 1PFBA 1QE6A 1UEAB 3SDZA 1AZQA 3GTLB 2B2VC 2CVRA 5CV4A 2MJ8A 3ONAB 3KLRA 3K5LA 3BYYB 3PIO3 2NYZD 3BVZA 1TS2A 1OXSC 5IGDA 1XX8A 1JWSD 4FF1A 5G3LF 4MHEA 3QO2A 1XXGA 2F0HA 4C56C 1PMRA 1I3QB 1WTVA 3NWTA 2WKCA 2EOTA 1JQYD 3D4RA 1WTWA 1LTID 2AQ1B 2IPKD 2OF1A 4ABNA 4KV6A 2WB1B 3TBIB 1HRJA 3A8JE 5CBEE 4IUTA 4IUQA 1O7ZA 5DM73 4QF4A 3TP5A 2F0TA 1B9NA 2C9OA 4RGMA 3EA6A 1IKMA 1FYCA 5A2QL 1SAPA 1TIID 3E6ZX 4KN7C 4K8JA 3FKIB 4O1NA 2EVBA 1PTOD 2K5QA 2HDLA 4A3DB 2Y0SB 4KD3A 4L63B 1TR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9H A;  1KNE A;  2D9U A;  4ZAI A;  2KOL A;  2B2V C;  2CVR A;  1ESR A;  1DOK A;  2J7Z A;  2MP1 A;  2Q8R E;  4IUP A;  4ZKB B;  2MJ8 A;  3ONA B;  4CJ2 C;  1NCV A;  4RAU C;  3G7L A;  1G91 A;  1VMP A;  1JIC A;  1X3Q A;  2L12 A;  2NYZ D;  1EOT A;  2B2V A;  2FIN B;  3H91 A;  1U4P A;  1F9Q A;  4O42 A;  4X3T A;  4R9W A;  2N55 A;  2JP1 A;  1AZP A;  3GV6 A;  1XX8 A;  3D6W A;  3P7J A;  1RTN A;  3TN2 A;  2B2Y C;  2RSN A;  4RWS C;  1XYI A;  1MSG A;  1WD0 A;  2R3Z A;  1BNZ A;  1CA6 A;  4HAE A;  5COY A;  1AP0 A;  5EPL A;  1RTO A;  1NR4 A;  1B53 A;  4CJ1 B;  4MHE A;  2HUG A;  1C8C A;  1G2T A;  3Q6S A;  5DNF A;  1WTP A;  3FPU B;  1IKL A;  1QNK A;  1HUN A;  1B3A A;  1E0B A;  3QO2 A;  4HED A;  4ZK9 B;  5CMD A;  1WVL A;  5COR A;  1TVX A;  2DY7 A;  2K28 A;  1VMC A;  1U4M A;  2L4N A;  1BBX C;  1HA6 A;  2B2W A;  5AFW A;  1NR2 A;  1WTO A;  1ML0 D;  4X3K A;  2KED A;  4CJ0 B;  1PFN A;  1HFG A;  2FFK B;  2K1B A;  4QUC A;  1WTV A;  1SDF A;  2EOT A;  5JJZ A;  1MI2 A;  4LMQ D;  1WTW A;  5EPJ A;  5T1I A;  1ILP A;  1B2T A;  4NW2 A;  1EL0 A;  5D65 A;  1ILQ A;  1DOM A;  1X3P A;  2B2U C;  3I90 A;  4XT1 B;  1WTR A;  1ZXT A;  3DM1 A;  4OIJ A;  1BO0 A;  2B2W C;  3I8Z A;  1WD1 A;  1EIH A;  4MN3 A;  2X69 A;  2RA4 A;  1G2S A;  1U4R A;  4IUR A;  3FDT A;  1DOL A;  4QUF A;  3MWY W;  5EPK A;  1G6Z A;  1HRJ A;  4RA8 A;  1DZ1 A;  2N88 A;  1WTQ A;  1X32 A;  2JYO A;  5T1G A;  2B2T A;  2KUM A;  2L11 A;  1MSH A;  3IL8 A;  1HUM A;  5EQ0 A;  5CBE E;  3KBX A;  1GUW A;  5E4W C;  3I91 A;  2KEC A;  2NWG A;  4HCS A;  1O7Z A;  4IUT A;  2RVL A;  3HP3 A;  1NAP A;  2IL8 A;  2B2U A;  4IUQ A;  1PFM A;  5EJW A;  2H1E A;  3IFD A;  2Q8T A;  3TZD A;  1U4L A;  1ICW A;  3MTS A;  1ROD A;  2NZ1 D;  1RJT A;  1J8I A;  4R8I A;  2MGS A;  2HCI A;  1HHV A;  2B2Y A;  2L1B A;  1PDQ A;  4X3U A;  1HFN A;  3KUP A;  1J9O A;  1DON A;  1SSO A;  2DY8 A;  1F9S A;  2B2T C;  2HDM A;  3LWE A;  2K05 A;  2FHT A;  1BF4 A;  1B50 A;  1O7Y A;  2EPB A;  2MPM A;  2X6L A;  2X6G A;  4OIK A;  5CBA E;  1Q3L A;  1PLF A;  2FJ2 A;  1CM9 A;  4X3S A;  1IKM A;  2KEE A;  2XIW A;  3UI2 A;  2SDF A;  2M2L A;  1S4Z A;  2VXW A;  5D14 A;  1O80 A;  2K03 A;  1JE4 A;  2HCC A;  5E4X A;  4IUU A;  1SAP A;  1QG7 A;  1RHP A;  1F9P A;  4DN4 M;  2K04 A;  1F2L A;  4UAI A;  2EE1 A;  1MGS A;  2FMM A;  3F2U A;  4ZLT F;  3DEP A;  1M8A A;  3GV3 A;  2K01 A;  1B4O A;  2KVM A;  1WTX A;  2HDL A;  3N52 A;  4HSV A;  2RSO A;  1PFB A;  4XDX A;  4IUV A;  3I3C A;  1QE6 A;  1LV9 A;  4XT3 B;  1KNA A;  1A15 A;  3R93 A;  1F9R A;  5EKI A;  1AZQ A;  3DEO A;  1EQT A;  4ZKC B;  3SVM A;  1CA5 A;  2BDN A;  1IL8 A;  1EIG A;  4U68 A; 
#chains in the Genus database with same CATH topology
 2E2I H;  2K6A A;  4ZKB B;  2MP1 A;  1E24 A;  3QB3 A;  1EY9 A;  3PF5 A;  4PQX A;  4X6A H;  3J81 c;  2AUK A;  4QIW B;  2B2V A;  2ICI A;  4DU9 A;  2R92 B;  1SRU A;  1N32 L;  4LF6 Q;  5HUR A;  2QF7 A;  4MZ9 A;  3A8K E;  1IYJ B;  4I7Z C;  4JOI C;  3ULP A;  2CH4 W;  1HXY D;  5C3E G;  2GVA A;  1B3A A;  4H44 C;  2I5L X;  2VB2 X;  1YNN D;  4A3K G;  3IFT A;  3G6J B;  2WAC A;  3EVQ A;  1BBU A;  1MKH A;  5C6A A;  5DM6 3;  4HJ9 A;  2UXB Q;  3OYY A;  3S1N H;  2EYJ A;  1YZ6 A;  4DV5 Q;  4LW1 A;  4UP8 A;  4A3K H;  1I4Q A;  5T1I A;  1ZXT A;  3DM1 A;  3K57 A;  1EIH A;  1TXY A;  3I4M B;  2E2J H;  1TU2 B;  1K0S A;  4P74 A;  2QKI C;  1OXT A;  3TRZ A;  1BXT A;  3CCV A;  4FVM A;  1EUJ A;  4ME3 A;  1A3V A;  3PCO B;  3KJP A;  1BCP B;  2NVQ B;  1U4L A;  1NY4 A;  3W5O A;  4DA2 A;  1HHV A;  2E74 C;  5M5Y H;  1CI3 M;  1ENA A;  3BU2 A;  3D4D A;  3SE0 A;  1TS5 A;  4H13 C;  4C2M B;  4OEM B;  5C3E B;  4WJ4 A;  5CBA E;  4RHS A;  4C3J H;  2N49 A;  3NEL A;  1I6H B;  2IX3 A;  1F2M A;  2DNC A;  4I7A A;  1YHQ A;  2HT1 A;  1HNZ Q;  2M2L A;  2YU9 B;  4G7Z C;  4DR6 L;  3GTM H;  4I65 A;  2VUM B;  3D31 A;  4LFB L;  1XWE A;  2EE1 A;  4KK7 A;  1LTT D;  5C3W A;  2UUC L;  1A2U A;  4JBK A;  1K3B C;  3A55 A;  4JI5 L;  4A3E B;  2DJF C;  2QCP X;  4DV2 Q;  1ONL A;  2NZH A;  3SVM A;  4YWM A;  4A3F G;  5LMU L;  3G6E A;  2NN6 G;  1QZG A;  3I4M G;  2N78 A;  3L3O C;  3J81 j;  1Q46 A;  1HNX Q;  3ITP A;  3M3Y B;  4C1N K;  4JI4 Q;  4ZRZ A;  5HGQ A;  4JI3 L;  1C4Q A;  4X3T A;  5I6Y A;  4JI4 L;  3VYS A;  2K5V A;  1BNZ A;  3SK6 A;  4A3B H;  1LTR D;  4FP5 D;  4R1J A;  1G2T A;  4Y7N B;  4PMC A;  3W1G A;  3ICE A;  1E0B A;  1MD2 D;  5ELO A;  1I3Q H;  1X54 A;  3HOV G;  4IPD A;  4JVZ A;  3H3V I;  1ZYR D;  1H9M A;  1SR3 A;  4XQQ A;  1F2Y A;  5CC4 A;  1Y1V G;  2OQ0 A;  1J6Q A;  1VDZ A;  2HD3 A;  1MI2 A;  2I46 A;  4BBR G;  1HA5 A;  3GQB A;  5G3L D;  3CD6 A;  1B2T A;  2B2U C;  5GQO A;  5IGG A;  1N8R C;  4FXK C;  3BDC A;  4LF6 L;  1IL2 A;  3S1M H;  4BBS B;  2G9H D;  1G2S A;  3S15 H;  4B3S Q;  1ICF B;  1A8V A;  2XVS A;  3AEV A;  4DV1 L;  2PZT A;  2Z6B A;  3VDY A;  4IFD H;  5C0X G;  5IP9 G;  1QUQ A;  3RLF A;  1NAP A;  2IL8 A;  1SE8 A;  1WCM B;  2LXJ A;  3U4Z A;  2D0O A;  5IY0 A;  2VY3 A;  2ENB A;  4A3D H;  2HCI A;  2R61 A;  5ISR A;  1PDQ A;  4X3U A;  4JI7 L;  2AWO A;  1BDO A;  1HQM C;  1PZK D;  1SSO A;  3S2H B;  1AW7 A;  2EJM A;  5BN5 A;  1F9S A;  1A0I A;  2HDM A;  5KND A;  4AIM A;  4WJ3 M;  1O7Y A;  2X6G A;  3ER0 A;  3S2D H;  5CV5 A;  4KKU A;  5AJ3 L;  1Q3L A;  1EY0 A;  3UE0 A;  1R4Q B;  2SEB D;  1FVI A;  5C3X A;  4FO2 A;  2K03 A;  3CF5 A;  1QG7 A;  1IHZ A;  3U9O A;  5JEA H;  3DEP A;  4POG A;  4OWW B;  1STE A;  2LFN A;  5KYI A;  2KVM A;  3N52 A;  4A3F B;  3GTQ B;  5LMN L;  1EZ8 A;  1KNA A;  1YI2 A;  5EKI A;  4AH6 A;  4JI6 Q;  2L9H A;  1MBY A;  4EQO A;  5D3I B;  5C0X I;  4G7O C;  5M5X H;  2PNH A;  3C3L A;  3K5N A;  1M90 C;  3V05 A;  2ZJP A;  3OIQ A;  3BDL A;  2PNR C;  1HTP A;  2VL6 A;  3Q24 A;  2VQF Q;  2BCO A;  4HR7 B;  4GNX B;  2NVT B;  1L1O A;  3NSW A;  2E76 C;  4IFD I;  1LLR D;  4KKS A;  1JWM D;  4NXM Q;  1WTP A;  1SNQ A;  1Z9F A;  3NTH A;  3C2P A;  1TWG B;  4JI5 Q;  4A3I G;  1NSN S;  2WV6 D;  1KLG D;  3AU7 A;  5E3F A;  3MXU A;  4LFA Q;  4A3L H;  2KA7 A;  1D5X C;  5IOD A;  4GLX A;  4C2M H;  2MQH A;  5NUC A;  1XNR Q;  4HIK A;  3E5S A;  5C5L A;  4J1M A;  1IBL L;  1EL0 A;  4RGT A;  3I4N B;  3I8Z A;  3OMC A;  1BUV T;  3FDT A;  3T51 B;  3I7F A;  1EFI D;  1TWA H;  5J3B A;  3TRE A;  3T4A C;  1H9R A;  4GOP A;  4GLA C;  1EZ6 A;  1J5E Q;  1FGU A;  4H02 A;  1GUG A;  2EYO A;  4K2K A;  1EY6 A;  3HP3 A;  1M4V A;  4RKL A;  2JEA I;  2Q8T A;  3KLS A;  3MTS A;  1LTG D;  3CXC A;  4RHR A;  4A3J B;  4QY7 A;  3HOV B;  2NN6 H;  2Z4I A;  4C1N I;  2RKS A;  5GAH C;  2HIV A;  3LWE A;  1Z47 A;  3TME A;  2K05 A;  4A3B B;  1SFO B;  5K36 H;  5KRU A;  2F0L A;  4DV7 Q;  2RCF A;  3Q23 A;  1B7Y B;  4X64 L;  2HHH L;  4LJZ C;  4LFC Q;  4DN4 M;  4BA2 I;  5DAU A;  3H0G G;  1ENF A;  2A6E C;  4WJW A;  1BCP D;  4X65 L;  4DR2 L;  1UE5 A;  2L55 A;  1XMO L;  2CH4 A;  1A15 A;  2F0J A;  5CYU A;  3R93 A;  1F9R A;  1LM0 A;  2WB1 E;  1KAB A;  4TSS A;  2Y0S E;  4A93 B;  3MXG A;  4JBW A;  1EWI A;  2D9U A;  3UDF A;  4ZAI A;  1PRT C;  1SYC A;  1I4R A;  4ZUJ A;  1XJV A;  2EDG A;  2QGQ A;  4LF5 L;  1D5M C;  1X3F A;  2R7Z G;  1FR3 A;  3A8I E;  2F0E A;  1VQ4 A;  4DV0 L;  3D6W A;  3HOZ G;  2RSN A;  4IPG A;  1CA6 A;  3TS2 A;  5COY A;  3CAM A;  4GKJ L;  3KDF A;  2AHO B;  1AFP A;  1FNU A;  5DNF A;  2WAQ E;  3CC2 A;  3BG3 A;  2JA9 A;  2A6E D;  3JAM c;  2UU9 Q;  1HA6 A;  1S40 A;  4EVO A;  4B3M Q;  1ML0 D;  2CWA A;  3BVG A;  1PYB A;  1KRS A;  1PFN A;  4ME5 A;  4LWC A;  1KQS A;  2UUA Q;  1HJP A;  3GTL H;  2F3W A;  4YIJ A;  4N8X 1;  5I2Y A;  2JN4 A;  1N33 Q;  3MXN B;  3I4M H;  5BN3 A;  1ILQ A;  1QWY A;  3PGZ A;  1N33 L;  4DNR B;  1WD1 A;  2VQF L;  3KBG A;  2IX0 A;  4IUR A;  3J80 E;  4AYB B;  3URY A;  5M3M H;  1WTQ A;  2BH8 A;  5D3D A;  2PO4 A;  1O7L A;  1Y69 U;  1QB5 D;  5EBC A;  2ZJQ A;  2Q8I B;  1NMG A;  2KEC A;  4A3L G;  5L37 A;  2NWG A;  1YJW A;  2B2U A;  2JXM B;  2NVX H;  1BVS A;  2K75 A;  3CPF A;  4JC0 A;  1E3P A;  3MHB A;  4B3R L;  3PIP A;  1N34 L;  3TP7 A;  2QW7 A;  3HOV H;  4PNY A;  1KAW A;  1HPC A;  2EPB A;  2MPM A;  2UXD L;  1CQF A;  3KOJ A;  5KIX A;  3X3M A;  4GZY C;  3I73 A;  5IGE A;  4EGV A;  3K81 C;  1W6J A;  3OOC A;  3SK8 A;  1PHJ A;  2R92 G;  5BN4 A;  1RHP A;  3J80 L;  2K04 A;  4ZLT F;  3R2I A;  4CKB A;  1I50 B;  4GNX C;  4L5T A;  2RHQ B;  1HH2 P;  4DR1 L;  3T16 A;  3L7Z C;  1S72 A;  1Y1W B;  4IOA A;  3SK4 A;  4IJH A;  1G91 A;  1GJX A;  2E8G A;  1U9R A;  2K5H A;  3HFZ B;  1QVG A;  2LKV A;  3ULL A;  1SYG A;  4RAU C;  1ASY A;  4HN7 A;  3RUZ A;  3TP8 A;  2FIN B;  3X3N A;  1LYL A;  4RKB A;  3EFX D;  5C4J B;  3IKJ A;  4R4Q A;  2JSO A;  1L0W A;  5LL6 X;  5J1Z A;  1NR4 A;  4CJ1 B;  1R9T H;  1H9S A;  4P72 A;  1L0Y B;  2PMZ B;  1XMQ L;  4A3K B;  5CMD A;  1TS4 A;  4XQJ A;  1HZ9 A;  4N8F A;  1MJE A;  1SMY D;  3HOW B;  5EKK A;  1L1O C;  1EQV A;  2P5Z X;  3F8T A;  1S5F D;  2VNU D;  1Z7T A;  4IZ8 A;  1SN8 A;  4A3G B;  4FXD A;  3R3O A;  1R9T B;  1DOM A;  4XT1 B;  1CFM A;  5IP7 H;  3I90 A;  1KD1 C;  4AYB G;  4MN3 A;  3U4V A;  2R7Z B;  3J7Z C;  2A73 B;  1MIU A;  1S5B D;  1PTO F;  1II3 A;  3M9B A;  1JR0 D;  1EWC A;  1RF2 D;  2OWO A;  3VR6 A;  1VQK A;  1GUW A;  1VQJ A;  3DWA A;  1AEX A;  3LWU A;  1ILP A;  4OGQ C;  5EJW A;  2XN9 C;  4C3I H;  4KI0 A;  3MXP A;  2NZ1 D;  1TWA B;  3T13 A;  4DXG A;  1OXX K;  4AQY Q;  4OX9 Q;  2UXC Q;  4DV3 Q;  3OHX C;  1CHP D;  1V8Q A;  2RF4 A;  2HQE A;  1B8A A;  3NHH A;  1M1K C;  1E2W A;  3PUZ A;  3DHQ A;  1CM9 A;  2IW3 A;  1N9W A;  2DGY A;  3KYH C;  2JA7 H;  5ELN A;  5JEA J;  2QEX A;  3H3V C;  2OT2 A;  4H0L C;  5I9P A;  4TRD A;  1S4Z A;  4GNX A;  3AMU A;  2ALY B;  4A3C G;  1MHW C;  4DK3 C;  4X65 Q;  4OO1 H;  3F2U A;  1HNX L;  3G4S A;  3S15 B;  2JE6 I;  3NTK A;  4IAL A;  2B8F A;  2GN5 A;  2JA7 G;  2F0G A;  2EIF A;  2YTX A;  1KL9 A;  1TT2 A;  2EYF A;  1C0A A;  1TQO A;  3C46 A;  2NVY H;  2CW0 D;  3WWV A;  5A35 A;  3M4Y A;  4ILW A;  4ZKC B;  4DFA A;  1WJJ A;  3CPW A;  1XTD A;  2BDN A;  2D2C C;  3D0F A;  1XMQ Q;  2A8V A;  1E1T A;  3FRP B;  2YTY A;  2IX1 A;  2RCN A;  3K80 C;  4MNO A;  1Y1V H;  1GXD C;  3H94 A;  4KLK A;  2JP1 A;  1ET6 A;  2E75 C;  5JVH 3;  1XYI A;  3PUX A;  1MSG A;  3ERQ A;  4DAV A;  2VQE L;  1RTO A;  2K5N A;  4HTH A;  3I55 A;  3DM3 A;  4DR7 Q;  2GA4 B;  2NVX B;  1BBW A;  4YHH L;  3MFG A;  1TVX A;  2WP8 J;  3OIP A;  3S2D B;  1VQF A;  3K6O A;  3K59 A;  1XNR L;  1VQ9 A;  3OTO L;  5FJ8 H;  4NDX A;  2CHB D;  4LMQ D;  3PO3 G;  4Y52 H;  1I5F A;  1STN A;  2AQ3 B;  4WRD A;  5D65 A;  1DD2 A;  1B50 A;  2ZTE A;  3ND9 A;  4IJL A;  4JI7 Q;  3EQL C;  1GOZ A;  3GTM B;  1G6Z A;  3ULJ A;  1EOV A;  4WOR A;  1VQE A;  4Q0F A;  3LNN A;  3MA2 B;  1YNN C;  3F1Z A;  2EY6 A;  3I91 A;  2RVL A;  4QUF A;  4YCU A;  1B70 B;  1U5K A;  3DWQ A;  3PUV A;  3GTP H;  1TWG H;  2XSC A;  4C3J B;  1VQM A;  3HGB A;  4DR3 Q;  3B6Y A;  2ZM6 Q;  3JC6 6;  4KY7 A;  2ZTC A;  1GUO A;  2NN6 I;  1EYA A;  4FDB A;  2QDB A;  3TP6 A;  2JA8 B;  3S16 H;  4QMG A;  1XTC D;  1PLF A;  4EQ5 A;  3K58 A;  1ENC A;  4FYD A;  5F2D A;  2KEE A;  1FL0 A;  2SDF A;  3VR4 A;  1JE4 A;  2JA8 G;  1AH9 A;  2F0P A;  1PA6 A;  4JI0 L;  1QIL A;  4JI1 Q;  4HMJ A;  1HZB A;  1SNC A;  4DPG A;  2Q2U A;  3QOL A;  2J4X A;  5ELE A;  1A62 A;  4NP5 A;  5KNC A;  1PH2 A;  2RSO A;  3MZ5 A;  5GAE C;  1VQB A;  1LT4 D;  4BA1 I;  1Q8I A;  1HR0 L;  3HOU H;  1G51 A;  2LY7 A;  3BZK A;  4CKE A;  5KEE A;  3JAM E;  1FJG Q;  2UXB L;  2KOL A;  4QJF A;  4IUP A;  5JVG 3;  2K5D A;  3STB D;  4UP7 A;  3K5O A;  1L1O B;  4APV A;  3CU7 A;  4R9W A;  1FD7 D;  3MXN A;  3S1R B;  2PQA B;  4LF7 L;  3KFU A;  1RTN A;  2B2Y C;  2VB3 X;  2R3Z A;  2A5H A;  1AP0 A;  4A4I A;  3RLN A;  4M8A A;  1PH4 A;  2QIL A;  2R93 H;  3Q6S A;  3FPU B;  4QQB X;  1HUN A;  1GKH A;  1EEI D;  4DF7 A;  2TMP A;  1DM0 B;  1CSQ A;  5IWA Q;  3MAQ A;  3HKZ B;  1ZYR C;  4JK1 C;  4JYA Q;  1VQO A;  2E2D C;  1PYW D;  3P20 A;  2K32 A;  5M5W H;  1AE3 A;  3ZYY X;  2OCE A;  4J6H A;  1YJN A;  5IGF A;  1DXM A;  5ELD A;  2NB0 A;  2CQO A;  2NUC A;  5I6W A;  4K8I A;  2B2W C;  1Y14 B;  3QIA A;  3NQI A;  4KHP Q;  4JV5 L;  3QOJ A;  3DUZ A;  1CK1 A;  5T1G A;  4L5S A;  5EQ0 A;  2A6H C;  1JOR A;  3KBX A;  3TQY A;  4HCS A;  4DV7 L;  2F1M A;  2R7Z H;  4DR5 Q;  1K73 C;  1N34 Q;  4NPS A;  4BBR H;  1EQQ A;  1N36 Q;  2B2Y A;  4BY7 G;  3NEN A;  4Z9C B;  3FVQ A;  4IN3 A;  1N36 L;  2O4X A;  3PV0 A;  5LL6 S;  1W2B A;  1PH7 A;  4DR4 L;  2F52 A;  4TVA B;  1VQH A;  3GTJ H;  2BE5 D;  4LUO A;  1LTL A;  1Q81 C;  5IYC H;  2WFW A;  1LUZ A;  3CCQ A;  1I94 Q;  2FMC A;  3UI2 A;  1O80 A;  3L2P A;  3GD7 A;  3HOU B;  3W3A A;  4IO9 A;  3S17 H;  2H5X A;  3P75 A;  4N9T A;  2OTJ A;  2B39 A;  4DUZ Q;  1MJC A;  1QOH A;  2I5M X;  1M8A A;  3E0E A;  1Q7Y C;  5C4X B;  3AFQ A;  1Y8P B;  2A69 C;  2WII B;  1VQG A;  3BS1 A;  4FF3 A;  3SEB A;  1LV9 A;  4C3I G;  3HOX B;  2WAQ B;  1EQT A;  1HNZ L;  2PMZ E;  3J81 i;  1IL8 A;  3E9I A;  3OWF A;  2AWN A;  2IJ0 A;  1HR0 Q;  2YU9 H;  4UDU C;  3WOF A;  2MHV A;  1JIC A;  1YNJ C;  4X64 Q;  1YEZ A;  1EOT A;  1E2V A;  2F0M A;  3K7U C;  1NTG A;  2F3V A;  3I4N H;  3S2H H;  5EAY A;  4NXM L;  3I4L A;  2VW9 A;  2OEO A;  4RMF A;  4DV6 L;  3QG1 A;  4L5R C;  1F77 A;  3TZU A;  2K28 A;  3PUW A;  4RCN A;  1VMC A;  4YCW A;  4UP9 A;  1PZJ D;  3AYH B;  1KLU D;  2E5L L;  3BJU A;  1HFG A;  3A5Z B;  2KCM A;  5IWA L;  2BDO A;  5C44 B;  3NTI A;  1D1K A;  3EN2 A;  1XNQ L;  2XRS D;  2D62 A;  3BZC A;  3PF4 A;  4K6D A;  2XWJ B;  5FLM H;  1EIF A;  3PQI A;  2R93 G;  4IUN A;  3PO3 B;  4QL5 A;  5LMN W;  4BY1 H;  4FNF A;  2B2T A;  1MSH A;  4LUZ A;  2F0W A;  5C0X H;  4JI2 L;  1NNX A;  3U9S A;  1EYC A;  2PI2 A;  1PH8 A;  4A3M B;  3PO2 G;  3U58 A;  1SYE A;  4HSP A;  2KHI A;  1J9O A;  4DR5 L;  2DY8 A;  1H9S B;  1VQN A;  5EBD A;  1BF4 A;  4HIM A;  3OMG A;  4AYB E;  1I4G A;  4CKC A;  4JG2 A;  3GTK H;  1SNP A;  4CDF C;  2I07 B;  3NP8 A;  4LF8 Q;  1D7Q A;  1IYU A;  2KCC A;  4JI0 Q;  4XQN A;  4RH6 A;  1XPO A;  1JC7 A;  5IT9 L;  5GAG C;  4NXN Q;  2UUB Q;  1TWF B;  1LTB D;  2JA8 H;  1W6K A;  2WIN B;  3S16 B;  3GO5 A;  4ZQ3 A;  1F2L A;  5EKL A;  1MGS A;  5ELF A;  1JCK B;  2EYL A;  2K01 A;  4JI3 Q;  1B4O A;  2JEB I;  3NBI A;  1K8A C;  4P2C B;  1QUQ B;  3D8G A;  1STA A;  3DEO A;  1B3Q A;  1SMX A;  4KY6 A;  4ZYS A;  1UWV A;  2B63 H;  5M5W B;  5IOC A;  3FKI G;  1TS3 A;  3G7L A;  4DV4 Q;  2WB1 G;  1VMP A;  1Y8O B;  1AE2 A;  1X3Q A;  1JJG A;  4O42 A;  1B9M A;  4K5W A;  2E5L Q;  2JA6 H;  4B9W A;  3UDX A;  2EY5 A;  2F0Q A;  3TN2 A;  2PZU A;  5FO7 B;  5M5Y B;  3HKZ G;  4PG3 A;  5EPL A;  1A2T A;  1HNW Q;  2ZJR A;  1IBM L;  1SE4 A;  4OO1 I;  1RIP A;  4A3G H;  3AQQ A;  3CHB D;  1Q90 A;  2EYM A;  1NE3 A;  3Q0A A;  1QCB D;  3EJI A;  3M4Q A;  4DV5 L;  5IP9 H;  2YYZ A;  3P1H A;  2KED A;  3NBH A;  3OTO Q;  2FFK B;  3S1Q B;  2F0V A;  4QUC A;  4QGU A;  4BY1 G;  5CV7 A;  2K14 A;  1TWH H;  2EYP A;  2ZTD A;  3R8B A;  1X3P A;  2PCF B;  4K5V A;  2NBF A;  4MIU A;  1NBW A;  4DAP A;  1JWU D;  2X69 A;  3CCM A;  2AQ2 B;  3S1N B;  4F7X A;  1HZA A;  2F0K A;  4EX5 A;  4DAM A;  4RA8 A;  3FMC A;  3CRL C;  1UE6 A;  5HY6 A;  4KD4 A;  2JYO A;  4JOI A;  4OWT B;  1GUS A;  3EIV A;  3K7A H;  3S24 A;  5M3F B;  2EZV A;  4LUV A;  1CTM A;  3CC7 A;  3D3R A;  1PYS B;  1X65 A;  1X6O A;  5LHY 1;  3KF6 A;  1EY4 A;  4DR3 L;  1OO9 B;  3FHW A;  1XNQ Q;  1OXU A;  1U0L A;  3M4O B;  3T1Y L;  3HOY B;  4OEL B;  4ODG A;  5IT9 c;  1S5E D;  1IW7 C;  4DR6 Q;  4X3S A;  2KHS A;  1FNV A;  1SBB B;  1FNW A;  1ZEQ X;  2Z8L A;  2ZXO A;  1PH9 A;  4JI6 L;  4K6L A;  2R93 B;  5C3E H;  1EFW A;  1SEB D;  2SNM A;  2FMM A;  5HGT A;  1SYD A;  1VQ8 A;  4C3H B;  4IFD G;  4DV2 L;  4A3J G;  1EU4 A;  4HSV A;  2A74 C;  4XDX A;  4AQY L;  1JJ2 A;  2K5W A;  5FOB B;  2H4O A;  3S9W A;  1X55 A;  2MUY A;  2R7D A;  5CV9 A;  5FK9 C;  1QVC A;  2Q8R E;  4RG1 A;  3JAM i;  2UUA L;  3M85 A;  2QDL A;  4LF9 Q;  4BS9 A;  4RGN A;  3PO3 H;  1WI5 A;  2LSS A;  1SE2 A;  2Y0S G;  1DCZ A;  1LT3 D;  1VQA A;  2V4D A;  2IWH A;  4YWK A;  3CQZ B;  5C4H A;  3KLS X;  1EWH A;  4U67 3;  1QNK A;  1ZKO A;  3M3Y H;  2A6H D;  2JA5 G;  3MEH A;  4A3M G;  1JB3 A;  3K5M A;  5AFW A;  1Q8K A;  4X3K A;  1E2Z A;  4CJ0 B;  4IPH A;  1CZW A;  4GOP B;  3NWS A;  1SDF A;  3RLO A;  4LF4 Q;  5C4X G;  4N9P A;  1SYB A;  2B63 G;  3J7A F;  4NW2 A;  5FLX L;  2BE5 C;  2KCN A;  2F3I A;  1BR9 A;  4DUY L;  3AB9 A;  1U4R A;  1GVP A;  4B08 A;  1DOL A;  4G57 A;  1GHJ A;  1PTO B;  3BVM A;  2L11 A;  1K9M C;  1I4P A;  2EY1 A;  1A3U A;  3HOY H;  1H9J A;  2H1E A;  1EQR A;  4BBS H;  3K0X A;  3S1M B;  3H0G H;  1E7Z A;  2BA0 A;  1JB7 A;  3QR8 A;  1UAP A;  5AJ3 Q;  4YY3 L;  2NVT H;  3RN5 A;  5JOB A;  1SND A;  4DR4 Q;  1RD9 D;  2PI2 E;  4DR2 Q;  3S1R H;  1A3T A;  1PZI D;  4K14 A;  4KJN A;  2MO1 A;  1H9K A;  3OW2 A;  3K0Y A;  3HG9 A;  1LTA D;  3AFP A;  5FLM G;  5M3F H;  4ZCK A;  2VXW A;  4B3T L;  3E9H A;  5JAV A;  1F9P A;  4TKO B;  4UY8 C;  4P71 A;  2XRQ D;  1RL2 A;  1V1O A;  3TEH B;  4LF7 Q;  4IUV A;  3I3C A;  2MFI A;  4DNI A;  3SHL A;  1I6V C;  5M9O A;  1KNE A;  4WFN 3;  4C3H G;  2J7Z A;  1UNS A;  1UE1 A;  4KY5 A;  2B29 A;  3HZX A;  4IQZ A;  2A19 A;  4OO1 G;  1VQP A;  4QCL A;  2N55 A;  1HNW L;  4K0K Q;  2NVY B;  3DWP A;  5FO8 B;  4O0A A;  2Q2T A;  2AMC B;  3M4P A;  4C3H H;  4DKA C;  3A7A B;  5TSS A;  4A3J H;  2RHS B;  1TWC H;  4DV1 Q;  2EJF C;  2KHJ A;  3G71 A;  4HED A;  4ZK9 B;  3GTP B;  1WVL A;  1Z6H A;  3RNU A;  2DN8 A;  2B2W A;  1PH1 A;  4KHP L;  4JCV E;  3LX0 A;  3C1E A;  3HKS A;  4FF4 A;  2G9D A;  5C4Z A;  5I2X A;  1S5D D;  2WKD A;  1I6H H;  4YWL A;  1STG A;  2JA6 G;  4A3I H;  1Y1W H;  1TWC B;  1WOC A;  2KJX A;  1N32 Q;  4R4C A;  4GN3 B;  1SJH D;  3W1B A;  3VYR A;  2I5H A;  3HRZ C;  1JOO A;  4JW0 A;  4HJ8 A;  1T9H A;  1J5E L;  3FPP A;  4CDE C;  2N88 A;  3ERS X;  2SNS A;  3O13 A;  3A5U A;  1UEB A;  3K7A B;  1EY5 A;  4C3I B;  1EY7 A;  2BOS A;  2CQA A;  4JPB W;  2SOB A;  3MC0 B;  3T1H Q;  1IYV A;  4XYQ A;  1PFM A;  1R4P B;  3TZD A;  1ICW A;  3IRB A;  4PZ7 A;  4CGY B;  1ROD A;  1SJE D;  3D6C A;  2MGS A;  2Z6K A;  4A75 A;  4IOC A;  3NQT A;  4V19 0;  1K8M A;  2RDF A;  1CKN A;  2DJG C;  2RQX A;  3KUP A;  4LFB Q;  1DON A;  5CR3 A;  3PIP 3;  3HS0 C;  1ET9 A;  3RZO B;  2IT1 A;  2F4I A;  4OIK A;  2EXZ A;  3GTG B;  4DAY B;  2RDH A;  4CDC C;  4JBM A;  2XGT A;  1T5E A;  2L0C A;  4LFC L;  4GS3 A;  3BYT B;  3GTG H;  1P16 A;  4LF8 L;  5LMU Q;  5D14 A;  5C0X J;  3JAM L;  3CCJ A;  5E4X A;  1VQ7 A;  4A3C H;  4DV3 L;  2NTS A;  1LO5 D;  2PW5 A;  1D2B A;  2ICE C;  1CKM A;  3BZD B;  1SYF A;  5JJK A;  1ASZ A;  1KDC A;  1XPR A;  2ZT9 C;  4EQN A;  1AN8 A;  1O7I A;  4OL7 A;  1NJI C;  4XT3 B;  1DJR D;  4OXP A;  3KK7 A;  3H0G B;  2OXP A;  2CCZ A;  4RFB A;  1CA5 A;  2NTT A;  4BWG B;  4U68 A;  4LF9 L;  1A6X A;  1S5C D;  3F2C A;  2Z1C A;  3G48 A;  4L8J A;  3V2T A;  5IE8 A;  2L15 A;  1QVF A;  1B1Z A;  1NCV A;  1V1P A;  2A1A A;  3OW7 A;  1BOS A;  5IYD G;  1YIJ A;  4F87 A;  2B63 B;  4QIW E;  1PRT D;  4LF5 Q;  3GV6 A;  2BA1 A;  5BR8 Q;  3J7A V;  1K0R A;  1YNJ D;  1Q82 C;  4A3B G;  1CSP A;  1Q12 A;  4KHV A;  1B53 A;  4S3S A;  3HOY G;  2HUG A;  4MTN A;  3CCR A;  1PTO C;  3KDF B;  1KTK A;  1BBX C;  1U4M A;  2L4N A;  1WTO A;  2A68 D;  1H95 A;  5KYL A;  1C7Y A;  3GTK B;  1HZC A;  3OWE B;  1Q1B A;  1WFQ A;  3T1H L;  3M7N A;  2LMC B;  2RDG A;  2F0F A;  1SNO A;  1JE5 A;  4PV1 C;  4DR7 L;  3ZJY C;  4PMB A;  5C5M A;  1YIT A;  1E22 A;  2RA4 A;  3Q8D A;  1TWH B;  4A93 G;  3TS0 A;  2EQS A;  1IW7 D;  5EPK A;  3CMA A;  1Y1V B;  3A56 A;  2ZXR A;  1UUP A;  3J80 i;  3S17 B;  2B3G A;  2KUM A;  1HUM A;  1IBK L;  4BY1 B;  3WOE A;  1K3R A;  4OON A;  1EEF D;  1IBK Q;  4H7B A;  3GTJ B;  2XTI A;  1J8I A;  2ZM6 L;  2XNA C;  2O5I C;  4G4K A;  4YY3 Q;  2B8G A;  4J15 A;  3NPP A;  3SR1 A;  2ATW A;  4POF A;  2ZXP A;  1L0X B;  3HEJ A;  3OSO A;  5C44 H;  1CQV A;  2JA6 B;  1GD7 A;  5I4D A;  2F0S A;  1STY A;  5LMN Q;  2IY5 B;  2KBN A;  3I56 A;  3R2T A;  1VQ6 A;  1K8O A;  2XIW A;  5K5P A;  5CV8 A;  3FP9 A;  2HCC A;  1SE3 A;  2RBM A;  4ULL A;  3RZD B;  4UAI A;  4LK1 C;  3ERO A;  1KRT A;  5JJL A;  3GV3 A;  4A3E G;  2QEJ C;  1V1P B;  3TSS A;  2PQA A;  5M3F G;  1WTX A;  1GUT A;  4CDD C;  5BR8 L;  3MVV A;  1JJC B;  4FXG C;  4ALP A;  1SXT A;  4KN4 C;  2C35 B;  2CKZ B;  4P75 A;  4OWX B;  3VA5 A;  3VR3 A;  2JA7 B;  3J81 L;  1DYQ A;  2F0U A;  1LAC A;  2ID0 A;  3J81 E;  2KCT A;  5IGC A;  4CJ2 C;  4J8Q A;  1NUC A;  2PQE A;  3CKI B;  4K0K L;  5E7N A;  1VS0 A;  3U50 C;  3V96 A;  3H91 A;  5ELB A;  3J7Y W;  4K2L A;  2Z0S A;  5JJI A;  1K83 H;  3VYT A;  3FEW X;  1HQR D;  5J39 A;  3C1F A;  3HOX H;  3IAY A;  3HKZ E;  4HAE A;  1KAA A;  4HCE A;  3STB C;  4DAY A;  2JA5 B;  5K36 G;  3NEM A;  5I9O A;  5JPM C;  2DY7 A;  4BY7 H;  4A3M H;  1Q1E A;  2TSS A;  1CHQ D;  5M5X B;  4PZ8 A;  4PZ6 A;  4NB3 A;  1OXV A;  1X3G A;  1Y8N B;  3PMF A;  3K8A A;  1CUK A;  3KF8 A;  2R7F A;  5GRO A;  4A3D G;  5ELC A;  3VA7 A;  2K52 A;  1YHA A;  4NMZ A;  1BO0 A;  4LAA A;  4DXF A;  2VQE Q;  1KXL A;  4B9X A;  4XIG S;  4C3J G;  3HOW H;  4DUY Q;  1QJO A;  4GLV B;  2LS0 1;  1SNM A;  4IFD J;  1QNU A;  1VF7 A;  3PSI A;  5IP7 G;  5E4W C;  3VYU A;  1X3E A;  2M9V A;  4QB4 A;  4OX9 L;  2UXC L;  4PMW A;  3HOW G;  4RCO A;  5JEA G;  1IXR A;  1JOK A;  2E2H B;  3A54 A;  1K83 B;  3TDQ A;  2FHT A;  1PRT F;  2XWB B;  3SGI A;  1C9O A;  3I2Z A;  1K8G A;  1XPU A;  1QZH A;  5A2Q E;  1PH6 A;  1CZG A;  1TWF H;  2CWP A;  1PRT B;  2BH2 A;  3J80 c;  4L6T B;  5DEH A;  2G5D A;  3GP7 A;  4R4T A;  2PZW A;  4A93 H;  1PXU A;  2O5J C;  3I4O A;  1RDP D;  3I4N G;  1V1Q A;  4M1U B;  4A76 A;  3FKI H;  2PPB C;  3A0J A;  4X62 Q;  2F4V Q;  2K33 A;  4DV0 Q;  1I94 L;  1OTC A;  3KLW A;  2F4V L;  1GHK A;  2JJQ A;  3T1Y Q;  3KJO A;  2PW7 A;  1RKN A;  1SRO A;  4KJO A;  1DOK A;  5FKA C;  2K7V A;  4UHV A;  3GTO B;  3SXH A;  1T5X D;  1C48 A;  3GTQ H;  3HOU G;  1F2Z A;  3T53 B;  5IYC G;  4JYA L;  1AZP A;  3CME A;  3S14 H;  3MEF A;  1WD0 A;  4P73 A;  3S14 B;  3KF8 B;  1VCI A;  1W3S A;  3PUY A;  3Q22 A;  3E0J A;  5C44 G;  1D1I A;  1C8C A;  4GKK L;  3F2D A;  4OHJ A;  4CHT B;  4E6I A;  1XMO Q;  3S1Q H;  4GKJ Q;  2QA4 A;  4HMI A;  3UDG A;  4R4I A;  5IYB G;  1GM5 A;  3NE5 B;  3GTO H;  1NR2 A;  4DGZ A;  4BY7 B;  4JV5 Q;  2Z9H A;  1PVO A;  3VR5 A;  1BQQ T;  1A63 A;  3I70 A;  1PH5 A;  4DK6 C;  1BCP C;  2K1B A;  1LTS D;  2YV5 A;  4BXX H;  2PYK A;  3H09 A;  3VR2 A;  1VQL A;  5FLX E;  4G7H C;  4RGO S;  1LT6 D;  1TKW B;  3RMH A;  3T56 B;  1WTR A;  5IYD H;  3W2D A;  3CCE A;  1P8L A;  2D0P A;  3GDE A;  1D8L A;  5IGB A;  1SMY C;  1KDA A;  1DZ1 A;  2EYH A;  1UE7 A;  3DXJ C;  1WCM H;  4NXN L;  3UDI A;  3DLL A;  4KKT A;  2UXD Q;  3MFY A;  1YBY A;  4FF2 A;  2OQK A;  3IFD A;  2C5C A;  2JQO A;  1PFS A;  1RJT A;  2VUM G;  2YTV A;  2F03 A;  1HFN A;  3M4O H;  2CW0 C;  4EQP A;  1GO3 E;  2F0I A;  1RCV D;  3NK9 A;  4B3S L;  4CBV A;  1VQ5 A;  1CKO A;  4B3R Q;  2B2T C;  2Z6K C;  3QJY A;  3CCU A;  2E2H H;  1YJ9 A;  3RD4 A;  1FGB D;  2VZA A;  2X6L A;  1KC8 C;  2UUB L;  5KNB A;  4JI1 L;  1E1O A;  5CV6 A;  4IUU A;  1EY8 A;  4Y7N H;  3CQZ H;  2L5T A;  2AUJ D;  2EJG C;  1V43 A;  4GN4 B;  4F88 A;  1SFO H;  4XTC S;  3OPO A;  4NKL A;  5CGK A;  1HTL D;  1LAB A;  3I72 A;  3UE1 A;  4YHH Q;  2F0N A;  4R4O A;  4DR1 Q;  3CP0 A;  4K5X A;  1EIG A;  4OIJ A;  2Z4H A;  1STH A;  4DK1 A;  1ESR A;  2CFM A;  1G8Z D;  1FJG L;  2L12 A;  2DNE A;  4HJ7 A;  4A3G G;  1U4P A;  1F9Q A;  2F0O A;  3PO2 H;  1Y1W G;  3M7G A;  1I4X A;  4V0B A;  3P7J A;  2JA5 H;  4RWS C;  4L5Q A;  2GVB A;  3E3X A;  1GUN A;  4HJA A;  4DK0 A;  2R92 H;  1TY2 A;  1VQC A;  1LT5 D;  4X62 L;  3SK5 A;  1NMF A;  4XYO A;  5GAD C;  4A3I B;  2NZO A;  1IKL A;  1YVC A;  5JPN C;  1D5Z C;  5COR A;  2I0Q A;  3HOZ H;  4GKK Q;  3H3V H;  5IIF A;  5EGT A;  2MO0 A;  2JK8 A;  1HCZ A;  4KMU C;  1BCP F;  4LF4 L;  3H6M A;  2E2I B;  3HOZ B;  1STB A;  3N6R A;  4JI2 Q;  4B3M L;  2K50 A;  1PTO H;  1DGS A;  1JMC A;  2D5D A;  5JJZ A;  1O78 A;  5J22 A;  5EPJ A;  3CC4 A;  1EU3 A;  1I50 H;  2M00 A;  5KGU A;  2NVQ H;  2EY2 A;  3A74 A;  1VF5 C;  3MWY W;  3DMU A;  2A68 C;  4DNT B;  3PO2 B;  3A7L A;  3RZD H;  3HOX G;  1X32 A;  1PH3 A;  1I4H A;  4X66 L;  1KDB A;  2ASB A;  2HHH Q;  1TY0 A;  4HJ5 A;  4O2D A;  2J0T D;  3IL8 A;  1WYD A;  5E1F A;  3D4W A;  4GN5 A;  4MTK A;  1KHI A;  4ZUI A;  1EYD A;  1IBL Q;  2E2J B;  4R8I A;  3ND8 A;  5FJ8 G;  2L1B A;  2V1C C;  4KTA A;  1VQD A;  3NBH B;  4JI8 L;  1G29 1;  4Q5V A;  3CW2 C;  3L9A X;  4KHZ A;  1CT1 D;  4HIO A;  3NXW A;  4F8M A;  1ESF A;  3LGJ A;  2KEN A;  3NUC A;  2EXD A;  4TQU S;  2FJ2 A;  4ID6 A;  3F2B A;  4R8N A;  5IT9 E;  4UPA A;  1K28 A;  2F0D A;  2KQ3 A;  4DUZ L;  3RR5 A;  2LXK A;  3QWN A;  1KIX A;  2OTL A;  3CRK C;  2A69 D;  3J7A 5;  5M3M B;  1JOQ A;  3H15 A;  4A3F H;  4XXE A;  3BDO A;  1CKN B;  2O2L D;  5FO9 B;  1D6E C;  1B44 D;  2R6G A;  4BBR B;  3WDN A;  1PFB A;  1QE6 A;  1UEA B;  3SDZ A;  5C4J H;  2Q2H A;  1AZQ A;  2N3S A;  2UU9 L;  2FXQ A;  3GTL B;  2VS1 A;  5M3M G;  2VUM H;  2B2V C;  2CVR A;  5CV4 A;  2MJ8 A;  3ONA B;  3KLR A;  3K5L A;  3BYY B;  2HIX A;  2NYZ D;  3PIO 3;  3BVZ A;  4DV6 Q;  1TS2 A;  2MNA A;  1OXS C;  2N8N A;  2WAQ G;  5IGD A;  1XX8 A;  4LNQ A;  1JWS D;  4FF1 A;  5G3L F;  4MHE A;  1SLJ A;  1EYG A;  3QO2 A;  4JBJ A;  1XXG A;  2F0H A;  1JT8 A;  4C56 C;  1PMR A;  1I3Q B;  2Q2I A;  4LFA L;  1VQI A;  2AKW B;  1WTV A;  3NWT A;  3PIO A;  5H1S E;  2WKC A;  2EOT A;  1BKB A;  1JQY D;  3D4R A;  5C4X H;  5IYB H;  1WTW A;  3CCL A;  3EBE A;  1LTI D;  2AQ1 B;  2DUD A;  2IPK D;  2OF1 A;  4ABN A;  4KV6 A;  1YHB A;  4YCV A;  1G6P A;  2WB1 B;  3TBI B;  4BBS G;  1HRJ A;  1X56 A;  1IBM Q;  1HR0 W;  1V9P A;  3A8J E;  5CBE E;  4IUT A;  4IUQ A;  1O7Z A;  1EIY B;  3RZO H;  3KF6 B;  5DM7 3;  4GOP C;  1Q86 C;  4A3E H;  4QF4 A;  3TP5 A;  2F0T A;  1B9N A;  5DLQ E;  2C9O A;  4IPC A;  4HID A;  2IHE A;  1PV4 A;  1X9N A;  2HQL A;  4BXX G;  4RGM A;  3EA6 A;  2K4K A;  1IKM A;  4B3T Q;  4X66 Q;  1FYC A;  2IHF A;  2ES2 A;  3L0O A;  5A2Q L;  1SAP A;  1YNX A;  2UUC Q;  3CCS A;  1TII D;  3E6Z X;  4KN7 C;  1L2F A;  4K8J A;  5FLX c;  3RN2 A;  3FKI B;  1WCM G;  1WTH A;  1IZ6 A;  2EVB A;  4O1N A;  1PTO D;  2K5Q A;  2HDL A;  4JI8 Q;  4A3D B;  2Y0S B;  4KD3 A;  4L63 B;  1TR5 A;  1S3O A;  4DV4 L; 
#chains in the Genus database with same CATH homology
 2K6A A;  4ZKB B;  2MP1 A;  3QB3 A;  1EY9 A;  4PQX A;  2AUK A;  4QIW B;  2B2V A;  2ICI A;  4DU9 A;  2R92 B;  5HUR A;  2QF7 A;  3A8K E;  4I7Z C;  1HXY D;  1B3A A;  4H44 C;  2VB2 X;  1YNN D;  3IFT A;  3G6J B;  2WAC A;  3EVQ A;  5DM6 3;  5C6A A;  2EYJ A;  1I4Q A;  5T1I A;  1ZXT A;  3DM1 A;  3K57 A;  1EIH A;  3I4M B;  1TU2 B;  2QKI C;  1OXT A;  1BXT A;  4FVM A;  1A3V A;  1BCP B;  2NVQ B;  1U4L A;  4DA2 A;  1HHV A;  2E74 C;  1CI3 M;  1ENA A;  3D4D A;  3SE0 A;  1TS5 A;  4H13 C;  4C2M B;  5C3E B;  5CBA E;  4RHS A;  1I6H B;  2IX3 A;  1F2M A;  2DNC A;  2M2L A;  2YU9 B;  4G7Z C;  4I65 A;  2VUM B;  3D31 A;  1XWE A;  2EE1 A;  4KK7 A;  1LTT D;  5C3W A;  1A2U A;  3A55 A;  4A3E B;  2QCP X;  1ONL A;  3SVM A;  2NN6 G;  3L3O C;  3ITP A;  3M3Y B;  4C1N K;  4ZRZ A;  1C4Q A;  4X3T A;  5I6Y A;  3VYS A;  1BNZ A;  3SK6 A;  1LTR D;  4FP5 D;  1G2T A;  4Y7N B;  4PMC A;  1E0B A;  1MD2 D;  1ZYR D;  1H9M A;  4XQQ A;  1F2Y A;  5CC4 A;  1VDZ A;  2I46 A;  1MI2 A;  1HA5 A;  3GQB A;  5G3L D;  1B2T A;  2B2U C;  5IGG A;  4FXK C;  3BDC A;  4BBS B;  2G9H D;  1G2S A;  2XVS A;  2PZT A;  4IFD H;  5C0X G;  3RLF A;  1NAP A;  2IL8 A;  1WCM B;  2ENB A;  2HCI A;  2R61 A;  5ISR A;  1PDQ A;  4X3U A;  2AWO A;  1BDO A;  1HQM C;  1PZK D;  1SSO A;  3S2H B;  1AW7 A;  2EJM A;  5BN5 A;  1F9S A;  2HDM A;  5KND A;  1O7Y A;  2X6G A;  5CV5 A;  4KKU A;  1Q3L A;  1EY0 A;  1R4Q B;  2SEB D;  5C3X A;  4FO2 A;  2K03 A;  1QG7 A;  1IHZ A;  3U9O A;  5JEA H;  3DEP A;  1STE A;  2LFN A;  5KYI A;  2KVM A;  3N52 A;  4A3F B;  3GTQ B;  1EZ8 A;  1KNA A;  5EKI A;  2L9H A;  1MBY A;  4EQO A;  5D3I B;  5C0X I;  4G7O C;  3C3L A;  3K5N A;  3V05 A;  3OIQ A;  3BDL A;  2PNR C;  1HTP A;  3Q24 A;  2BCO A;  4HR7 B;  2NVT B;  3NSW A;  2E76 C;  4IFD I;  1LLR D;  4KKS A;  1JWM D;  1WTP A;  1SNQ A;  3NTH A;  3C2P A;  1TWG B;  1NSN S;  2WV6 D;  1KLG D;  3AU7 A;  5E3F A;  3MXU A;  2KA7 A;  1D5X C;  5IOD A;  5NUC A;  3E5S A;  5C5L A;  4J1M A;  1EL0 A;  4RGT A;  3I4N B;  3I8Z A;  3OMC A;  1BUV T;  3FDT A;  3T51 B;  1EFI D;  3T4A C;  1H9R A;  1EZ6 A;  1GUG A;  2EYO A;  4K2K A;  1EY6 A;  3HP3 A;  1M4V A;  4RKL A;  2JEA I;  2Q8T A;  3KLS A;  3MTS A;  1LTG D;  4A3J B;  4RHR A;  3HOV B;  2NN6 H;  2Z4I A;  4C1N I;  2RKS A;  3LWE A;  1Z47 A;  3TME A;  2K05 A;  4A3B B;  1SFO B;  5K36 H;  5KRU A;  2F0L A;  3Q23 A;  4LJZ C;  4DN4 M;  4BA2 I;  5DAU A;  1ENF A;  2A6E C;  4WJW A;  1BCP D;  2L55 A;  1A15 A;  2F0J A;  5CYU A;  3R93 A;  1F9R A;  1KAB A;  4TSS A;  4A93 B;  3MXG A;  4JBW A;  2D9U A;  4ZAI A;  1PRT C;  1SYC A;  4ZUJ A;  1I4R A;  2EDG A;  1D5M C;  1FR3 A;  3A8I E;  2F0E A;  3D6W A;  2RSN A;  1CA6 A;  5COY A;  1AFP A;  1FNU A;  5DNF A;  3BG3 A;  2A6E D;  1HA6 A;  4EVO A;  1ML0 D;  3BVG A;  1PFN A;  4ME5 A;  2F3W A;  4YIJ A;  5I2Y A;  5BN3 A;  1ILQ A;  1QWY A;  4DNR B;  1WD1 A;  3KBG A;  2IX0 A;  4IUR A;  3J80 E;  4AYB B;  3URY A;  1WTQ A;  5D3D A;  2PO4 A;  1O7L A;  1Y69 U;  1QB5 D;  5EBC A;  2Q8I B;  2KEC A;  2NWG A;  2B2U A;  2JXM B;  3MHB A;  3TP7 A;  4PNY A;  1HPC A;  2EPB A;  2MPM A;  1CQF A;  5KIX A;  3X3M A;  4GZY C;  3I73 A;  5IGE A;  4EGV A;  1W6J A;  3OOC A;  3SK8 A;  5BN4 A;  1RHP A;  3J80 L;  2K04 A;  4ZLT F;  3R2I A;  4CKB A;  1I50 B;  3T16 A;  3L7Z C;  1Y1W B;  3SK4 A;  1G91 A;  1GJX A;  1U9R A;  2LKV A;  1SYG A;  4RAU C;  4HN7 A;  3RUZ A;  3TP8 A;  2FIN B;  3X3N A;  4RKB A;  3EFX D;  5C4J B;  3IKJ A;  2JSO A;  5LL6 X;  5J1Z A;  1NR4 A;  4CJ1 B;  1H9S A;  1L0Y B;  2PMZ B;  4A3K B;  5CMD A;  1TS4 A;  4XQJ A;  1SMY D;  3HOW B;  5EKK A;  1EQV A;  2VNU D;  1S5F D;  1Z7T A;  4IZ8 A;  4A3G B;  4FXD A;  3R3O A;  1R9T B;  1DOM A;  4XT1 B;  1CFM A;  3I90 A;  4MN3 A;  2R7Z B;  2A73 B;  1S5B D;  1PTO F;  1II3 A;  1JR0 D;  1EWC A;  1RF2 D;  3VR6 A;  1GUW A;  3DWA A;  1AEX A;  3LWU A;  1ILP A;  4OGQ C;  5EJW A;  2XN9 C;  4KI0 A;  3MXP A;  2NZ1 D;  1TWA B;  3T13 A;  4DXG A;  1OXX K;  3OHX C;  1CHP D;  1V8Q A;  2HQE A;  3NHH A;  1E2W A;  3PUZ A;  3DHQ A;  1CM9 A;  2IW3 A;  3H3V C;  5JEA J;  2OT2 A;  4H0L C;  5I9P A;  4TRD A;  1S4Z A;  3AMU A;  4OO1 H;  3F2U A;  3S15 B;  2JE6 I;  3NTK A;  4IAL A;  2B8F A;  2F0G A;  1TT2 A;  2EYF A;  1TQO A;  3C46 A;  2CW0 D;  5A35 A;  3M4Y A;  4ILW A;  4ZKC B;  4DFA A;  2BDN A;  2D2C C;  3FRP B;  2IX1 A;  1GXD C;  3H94 A;  2JP1 A;  1ET6 A;  2E75 C;  5JVH 3;  1XYI A;  3PUX A;  1MSG A;  3ERQ A;  4DAV A;  1RTO A;  4HTH A;  2GA4 B;  2NVX B;  3MFG A;  1TVX A;  2WP8 J;  3OIP A;  3S2D B;  3K6O A;  3K59 A;  2CHB D;  4LMQ D;  4NDX A;  1STN A;  2AQ3 B;  4WRD A;  5D65 A;  1DD2 A;  1B50 A;  3ND9 A;  3EQL C;  1GOZ A;  3GTM B;  1G6Z A;  4WOR A;  4Q0F A;  3LNN A;  3MA2 B;  1YNN C;  2EY6 A;  3I91 A;  2RVL A;  4QUF A;  3DWQ A;  3PUV A;  2XSC A;  4C3J B;  3HGB A;  4KY7 A;  1GUO A;  2NN6 I;  1EYA A;  2QDB A;  3TP6 A;  2JA8 B;  4QMG A;  1XTC D;  1PLF A;  3K58 A;  1ENC A;  4FYD A;  5F2D A;  2KEE A;  2SDF A;  3VR4 A;  1JE4 A;  2F0P A;  1QIL A;  4HMJ A;  1SNC A;  3QOL A;  2J4X A;  5ELE A;  4NP5 A;  5KNC A;  2RSO A;  3MZ5 A;  1LT4 D;  4BA1 I;  1Q8I A;  2LY7 A;  4CKE A;  5KEE A;  3JAM E;  2KOL A;  4IUP A;  5JVG 3;  2K5D A;  3K5O A;  3CU7 A;  4R9W A;  1FD7 D;  3MXN A;  3S1R B;  1RTN A;  2B2Y C;  2VB3 X;  2R3Z A;  2A5H A;  1AP0 A;  4M8A A;  2QIL A;  3Q6S A;  3FPU B;  1HUN A;  1EEI D;  4DF7 A;  2TMP A;  1DM0 B;  3MAQ A;  3HKZ B;  1ZYR C;  4JK1 C;  2E2D C;  1PYW D;  3P20 A;  2K32 A;  3ZYY X;  4J6H A;  5IGF A;  1DXM A;  5ELD A;  2NB0 A;  2NUC A;  5I6W A;  4K8I A;  2B2W C;  3QIA A;  3NQI A;  3QOJ A;  3DUZ A;  1CK1 A;  5T1G A;  5EQ0 A;  2A6H C;  1JOR A;  3KBX A;  4HCS A;  2F1M A;  2B2Y A;  4Z9C B;  3FVQ A;  4IN3 A;  2O4X A;  3PV0 A;  5LL6 S;  2BE5 D;  2FMC A;  3UI2 A;  1O80 A;  3GD7 A;  3HOU B;  3W3A A;  3P75 A;  4N9T A;  2B39 A;  1QOH A;  1M8A A;  5C4X B;  1Y8P B;  2A69 C;  2WII B;  3BS1 A;  4FF3 A;  3SEB A;  1LV9 A;  4C3I G;  3HOX B;  2WAQ B;  1EQT A;  1IL8 A;  3OWF A;  2AWN A;  2IJ0 A;  4UDU C;  3WOF A;  2MHV A;  1JIC A;  1YNJ C;  1EOT A;  1E2V A;  2F0M A;  2F3V A;  3I4L A;  2OEO A;  3QG1 A;  1F77 A;  3TZU A;  2K28 A;  3PUW A;  4RCN A;  1VMC A;  1PZJ D;  1KLU D;  1HFG A;  2BDO A;  5C44 B;  3NTI A;  1D1K A;  2XRS D;  2D62 A;  4K6D A;  2XWJ B;  4IUN A;  3PO3 B;  4FNF A;  2B2T A;  1MSH A;  2F0W A;  5C0X H;  3U9S A;  1EYC A;  4A3M B;  1SYE A;  4HSP A;  1J9O A;  2DY8 A;  1H9S B;  5EBD A;  1BF4 A;  3OMG A;  1I4G A;  4CKC A;  1SNP A;  2I07 B;  3NP8 A;  1IYU A;  2KCC A;  4XQN A;  4RH6 A;  1JC7 A;  5IT9 L;  1TWF B;  1LTB D;  3S16 B;  1W6K A;  2WIN B;  3GO5 A;  4ZQ3 A;  1F2L A;  5EKL A;  1MGS A;  5ELF A;  1JCK B;  2EYL A;  2K01 A;  1B4O A;  2JEB I;  3NBI A;  4P2C B;  3D8G A;  1STA A;  3DEO A;  4KY6 A;  4ZYS A;  5M5W B;  5IOC A;  1TS3 A;  3G7L A;  1VMP A;  1Y8O B;  1X3Q A;  4O42 A;  1B9M A;  4K5W A;  4B9W A;  2EY5 A;  2F0Q A;  3TN2 A;  2PZU A;  5FO7 B;  5M5Y B;  5EPL A;  1A2T A;  1SE4 A;  4OO1 I;  3CHB D;  1Q90 A;  2EYM A;  3Q0A A;  1QCB D;  3EJI A;  2YYZ A;  3P1H A;  2KED A;  3NBH A;  2FFK B;  3S1Q B;  2F0V A;  4QUC A;  5CV7 A;  2EYP A;  3R8B A;  1X3P A;  2PCF B;  4K5V A;  2NBF A;  4MIU A;  4DAP A;  1JWU D;  2X69 A;  2AQ2 B;  3S1N B;  4F7X A;  2F0K A;  4RA8 A;  3FMC A;  3CRL C;  4KD4 A;  2JYO A;  1GUS A;  5M3F B;  2EZV A;  1CTM A;  3D3R A;  5LHY 1;  1EY4 A;  1OO9 B;  1OXU A;  3M4O B;  3HOY B;  4ODG A;  1S5E D;  1IW7 C;  4X3S A;  2KHS A;  1FNV A;  1SBB B;  1FNW A;  1ZEQ X;  2Z8L A;  2ZXO A;  4K6L A;  2R93 B;  1SEB D;  2SNM A;  2FMM A;  5HGT A;  1SYD A;  4C3H B;  4IFD G;  1EU4 A;  4HSV A;  2A74 C;  4XDX A;  2K5W A;  5FOB B;  2H4O A;  3S9W A;  2MUY A;  5CV9 A;  5FK9 C;  2Q8R E;  3M85 A;  4BS9 A;  4RGN A;  1SE2 A;  1DCZ A;  1LT3 D;  2V4D A;  2IWH A;  3CQZ B;  5C4H A;  3KLS X;  1EWH A;  4U67 3;  1QNK A;  1ZKO A;  2A6H D;  3MEH A;  1JB3 A;  3K5M A;  5AFW A;  4X3K A;  1E2Z A;  4CJ0 B;  1CZW A;  3NWS A;  1SDF A;  4N9P A;  1SYB A;  3J7A F;  4NW2 A;  5FLX L;  2BE5 C;  2KCN A;  1BR9 A;  3AB9 A;  1U4R A;  4B08 A;  1DOL A;  4G57 A;  1GHJ A;  1PTO B;  3BVM A;  2L11 A;  1I4P A;  2EY1 A;  1A3U A;  1H9J A;  2H1E A;  3S1M B;  2BA0 A;  1UAP A;  5JOB A;  1SND A;  1RD9 D;  1A3T A;  1PZI D;  4K14 A;  4KJN A;  1H9K A;  3K0Y A;  3HG9 A;  1LTA D;  2VXW A;  5JAV A;  1F9P A;  4TKO B;  2XRQ D;  1V1O A;  4IUV A;  3I3C A;  3SHL A;  1I6V C;  5M9O A;  1KNE A;  4WFN 3;  4C3H G;  2J7Z A;  1UNS A;  4KY5 A;  3HZX A;  4IQZ A;  4OO1 G;  4QCL A;  2N55 A;  2NVY B;  3DWP A;  5FO8 B;  3A7A B;  5TSS A;  2EJF C;  4HED A;  4ZK9 B;  3GTP B;  1WVL A;  1Z6H A;  2DN8 A;  2B2W A;  3LX0 A;  3C1E A;  4FF4 A;  2G9D A;  5C4Z A;  5I2X A;  1S5D D;  2WKD A;  1STG A;  1TWC B;  2KJX A;  1SJH D;  3VYR A;  3HRZ C;  1JOO A;  3FPP A;  2N88 A;  2SNS A;  3O13 A;  4C3I B;  3K7A B;  1EY5 A;  1EY7 A;  2BOS A;  2CQA A;  2SOB A;  3MC0 B;  1IYV A;  4XYQ A;  1PFM A;  1R4P B;  3TZD A;  1ICW A;  4CGY B;  1ROD A;  1SJE D;  3D6C A;  2MGS A;  3NQT A;  4V19 0;  1K8M A;  2RDF A;  2RQX A;  3KUP A;  1DON A;  5CR3 A;  3PIP 3;  3HS0 C;  1ET9 A;  3RZO B;  2IT1 A;  2F4I A;  4OIK A;  2EXZ A;  3GTG B;  2RDH A;  1T5E A;  2L0C A;  3BYT B;  5D14 A;  5C0X J;  3JAM L;  5E4X A;  2NTS A;  1LO5 D;  2PW5 A;  1D2B A;  2ICE C;  3BZD B;  1SYF A;  1KDC A;  2ZT9 C;  4EQN A;  1AN8 A;  4OL7 A;  4XT3 B;  1DJR D;  3KK7 A;  3H0G B;  2OXP A;  4RFB A;  1CA5 A;  2NTT A;  4BWG B;  4U68 A;  1A6X A;  1S5C D;  2Z1C A;  4L8J A;  3V2T A;  1B1Z A;  1NCV A;  1V1P A;  3OW7 A;  1BOS A;  4F87 A;  2B63 B;  1PRT D;  3GV6 A;  2BA1 A;  3J7A V;  1YNJ D;  1Q12 A;  4KHV A;  1B53 A;  4S3S A;  2HUG A;  1PTO C;  1KTK A;  1BBX C;  1U4M A;  2L4N A;  1WTO A;  2A68 D;  5KYL A;  3GTK B;  3OWE B;  1Q1B A;  3M7N A;  2LMC B;  2RDG A;  2F0F A;  1SNO A;  4PV1 C;  4PMB A;  5C5M A;  2RA4 A;  1TWH B;  1IW7 D;  5EPK A;  1Y1V B;  3A56 A;  2ZXR A;  1UUP A;  3S17 B;  2KUM A;  1HUM A;  4BY1 B;  3WOE A;  1EEF D;  4H7B A;  3GTJ B;  1J8I A;  2XNA C;  2O5I C;  4G4K A;  2B8G A;  3SR1 A;  3NPP A;  2ZXP A;  1L0X B;  3HEJ A;  3OSO A;  1CQV A;  2JA6 B;  5I4D A;  2F0S A;  1STY A;  3R2T A;  1K8O A;  2XIW A;  5K5P A;  5CV8 A;  2HCC A;  1SE3 A;  2RBM A;  4ULL A;  3RZD B;  4UAI A;  4LK1 C;  3ERO A;  3GV3 A;  2QEJ C;  1V1P B;  3TSS A;  1WTX A;  1GUT A;  3MVV A;  4FXG C;  1SXT A;  4KN4 C;  3VA5 A;  3VR3 A;  2JA7 B;  3J81 L;  1DYQ A;  2F0U A;  1LAC A;  2ID0 A;  3J81 E;  5IGC A;  4CJ2 C;  4J8Q A;  1NUC A;  2PQE A;  3CKI B;  3V96 A;  3H91 A;  5ELB A;  3J7Y W;  4K2L A;  3VYT A;  3FEW X;  1HQR D;  5J39 A;  3C1F A;  3IAY A;  4HAE A;  1KAA A;  4HCE A;  4DAY A;  2JA5 B;  5K36 G;  5I9O A;  5JPM C;  2DY7 A;  1Q1E A;  2TSS A;  1CHQ D;  5M5X B;  1OXV A;  1Y8N B;  3PMF A;  3KF8 A;  5ELC A;  3VA7 A;  4NMZ A;  1BO0 A;  4LAA A;  4DXF A;  4B9X A;  4XIG S;  4C3J G;  1QJO A;  2LS0 1;  1SNM A;  4IFD J;  1QNU A;  1VF7 A;  5E4W C;  3VYU A;  2M9V A;  4QB4 A;  4PMW A;  4RCO A;  5JEA G;  1JOK A;  2E2H B;  3A54 A;  1K83 B;  3TDQ A;  2FHT A;  1PRT F;  2XWB B;  5A2Q E;  1CZG A;  1PRT B;  4L6T B;  5DEH A;  3GP7 A;  2PZW A;  1PXU A;  2O5J C;  1RDP D;  4M1U B;  2PPB C;  2K33 A;  1GHK A;  2PW7 A;  1RKN A;  4KJO A;  1DOK A;  5FKA C;  2K7V A;  3GTO B;  3SXH A;  1T5X D;  1C48 A;  1F2Z A;  3T53 B;  1AZP A;  1WD0 A;  3S14 B;  3PUY A;  1VCI A;  3Q22 A;  3E0J A;  1D1I A;  1C8C A;  4OHJ A;  4CHT B;  4E6I A;  4HMI A;  3NE5 B;  1NR2 A;  4DGZ A;  4BY7 B;  3VR5 A;  1BQQ T;  3I70 A;  1BCP C;  2K1B A;  1LTS D;  2PYK A;  3H09 A;  3VR2 A;  5FLX E;  4G7H C;  4RGO S;  1LT6 D;  1TKW B;  3RMH A;  3T56 B;  1WTR A;  3W2D A;  5IGB A;  1SMY C;  1KDA A;  1DZ1 A;  2EYH A;  3DXJ C;  4KKT A;  3MFY A;  4FF2 A;  3IFD A;  2C5C A;  1RJT A;  2F03 A;  1HFN A;  2CW0 C;  4EQP A;  3NK9 A;  2F0I A;  1RCV D;  4CBV A;  2B2T C;  3QJY A;  3RD4 A;  1FGB D;  2X6L A;  5KNB A;  5CV6 A;  4IUU A;  1EY8 A;  2L5T A;  2AUJ D;  2EJG C;  1V43 A;  4F88 A;  4XTC S;  3OPO A;  4NKL A;  5CGK A;  1HTL D;  1LAB A;  3I72 A;  2F0N A;  4K5X A;  1EIG A;  4OIJ A;  2Z4H A;  1STH A;  4DK1 A;  1ESR A;  1G8Z D;  2L12 A;  2DNE A;  1U4P A;  1F9Q A;  2F0O A;  3M7G A;  1I4X A;  4V0B A;  3P7J A;  4RWS C;  1GUN A;  4DK0 A;  1TY2 A;  1LT5 D;  3SK5 A;  4XYO A;  4A3I B;  1IKL A;  5JPN C;  1D5Z C;  5COR A;  5IIF A;  5EGT A;  1HCZ A;  4KMU C;  1BCP F;  3H6M A;  2E2I B;  3HOZ B;  1STB A;  3N6R A;  1PTO H;  2D5D A;  5JJZ A;  1O78 A;  5J22 A;  5EPJ A;  1EU3 A;  2M00 A;  5KGU A;  2EY2 A;  1VF5 C;  3MWY W;  3DMU A;  2A68 C;  4DNT B;  3PO2 B;  3A7L A;  1X32 A;  1I4H A;  1KDB A;  1TY0 A;  3IL8 A;  2J0T D;  5E1F A;  3D4W A;  4ZUI A;  1EYD A;  2E2J B;  4R8I A;  3ND8 A;  2L1B A;  4KTA A;  1G29 1;  4Q5V A;  3L9A X;  4KHZ A;  1CT1 D;  3NXW A;  4F8M A;  1ESF A;  3NUC A;  4TQU S;  2FJ2 A;  4ID6 A;  4R8N A;  5IT9 E;  2F0D A;  2KQ3 A;  3QWN A;  3CRK C;  2A69 D;  1JOQ A;  5M3M B;  4XXE A;  3BDO A;  2O2L D;  5FO9 B;  1D6E C;  1B44 D;  2R6G A;  4BBR B;  3WDN A;  1PFB A;  1QE6 A;  1UEA B;  3SDZ A;  1AZQ A;  3GTL B;  2B2V C;  2CVR A;  5CV4 A;  2MJ8 A;  3ONA B;  3KLR A;  3K5L A;  3BYY B;  3PIO 3;  2NYZ D;  3BVZ A;  1TS2 A;  1OXS C;  5IGD A;  1XX8 A;  1JWS D;  4FF1 A;  5G3L F;  4MHE A;  3QO2 A;  1XXG A;  2F0H A;  4C56 C;  1PMR A;  1I3Q B;  1WTV A;  3NWT A;  2WKC A;  2EOT A;  1JQY D;  3D4R A;  1WTW A;  1LTI D;  2AQ1 B;  2IPK D;  2OF1 A;  4ABN A;  4KV6 A;  2WB1 B;  3TBI B;  1HRJ A;  3A8J E;  5CBE E;  4IUT A;  4IUQ A;  1O7Z A;  5DM7 3;  4QF4 A;  3TP5 A;  2F0T A;  1B9N A;  2C9O A;  4RGM A;  3EA6 A;  1IKM A;  1FYC A;  5A2Q L;  1SAP A;  1TII D;  3E6Z X;  4KN7 C;  4K8J A;  3FKI B;  4O1N A;  2EVB A;  1PTO D;  2K5Q A;  2HDL A;  4A3D B;  2Y0S B;  4KD3 A;  4L63 B;  1TR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...