3I91A

Crystal structure of human chromobox homolog 8 (cbx8) with h3k9 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
RVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 8
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i91A00
2HCCA 4X3KA 2X6GA 3G7LA 1O7ZA 3I90A 1EIHA 2Q8TA 4LMQD 1CA5A 1RTOA 1X32A 1HUNA 5D14A 1U4MA 4HCSA 5E4WC 3UI2A 1QNKA 1SDFA 1SSOA 4OIKA 4ZK9B 1HHVA 2H1EA 3IFDA 4ZKCB 2EPBA 5CBAE 1CA6A 2B2WA 2CVRA 4IUVA 2RSOA 1JICA 1NR2A 3FDTA 2RA4A 1TVXA 4RWSC 1HA6A 2MGSA 2K1BA 4IUUA 1AZPA 2X6LA 1J8IA 1G91A 3MWYW 5AFWA 2FJ2A 1WTOA 1DOLA 1VMPA 1XX8A 2DY8A 1SAPA 3HP3A 1WD1A 2EE1A 3N52A 1QG7A 1DONA 3SVMA 3GV6A 2B2YC 2FFKB 1VMCA 2NWGA 2BDNA 1F9SA 2K28A 2KVMA 1RHPA 2RVLA 4IUQA 3TZDA 2B2UA 2SDFA 2HDMA 3I91A 2FHTA 2B2VC 3I8ZA 1A15A 2D9UA 5JJZA 1BBXC 4OIJA 1G2TA 1WVLA 1WTQA 1C8CA 4CJ0B 2HDLA 2JP1A 3R93A 4CJ2C 4UAIA 1U4LA 1NR4A 1QE6A 2L4NA 1IKMA 1AZQA 1WTPA 1J9OA 2RSNA 2B2TA 3H91A 4U68A 1F9QA 3QO2A 2B2WC 2N88A 3KUPA 5DNFA 4IURA 4HAEA 2X69A 2MJ8A 1DOMA 1HFGA 3D6WA 1BF4A 1ILPA 3DEPA 2FMMA 5COYA 1NAPA 4QUFA 1ZXTA 3I3CA 4QUCA 1X3PA 1B50A 1RJTA 1Q3LA 4MHEA 4X3TA 2JYOA 2R3ZA 3ONAB 1RODA 1EL0A 2HUGA 1PFNA 1G2SA 1MSHA 2K03A 1O80A 2KOLA 2VXWA 5EQ0A 5T1IA 5CMDA 1WTXA 1B53A 1CM9A 5EKIA 5T1GA 1WTRA 3MTSA 3FPUB 1F2LA 2L9HA 3IL8A 1JE4A 4HSVA 1BNZA 1PLFA 4NW2A 2NYZD 1BO0A 4XDXA 2L11A 1MI2A 3GV3A 4X3SA 4R8IA 2N55A 1DOKA 1ESRA 4IUTA 4O42A 5CBEE 2B2YA 5D65A 1WD0A 2KECA 4R9WA 4DN4M 1G6ZA 1IL8A 5EJWA 1XYIA 1B3AA 1KNEA 3F2UA 2B2VA 1LV9A 1M8AA 1KNAA 2FINB 3Q6SA 4CJ1B 2Q8RE 1ICWA 1B4OA 1E0BA 2KUMA 2L12A 1HFNA 4IUPA 1HUMA 2MP1A 3LWEA 1MGSA 2NZ1D 4HEDA 4RAUC 3TN2A 1EIGA 1EQTA 1PFBA 2KEEA 3KBXA 5CORA 5E4XA 1NCVA 4ZLTF 1B2TA 2K05A 4XT3B 1X3QA 1S4ZA 1ILQA 2XIWA 2M2LA 1HRJA 3DEOA 1F9PA 3DM1A 2IL8A 2K01A 1GUWA 4MN3A 2B2UC 1ML0D 4RA8A 2HCIA 4X3UA 1IKLA 1F9RA 1O7YA 2J7ZA 5EPKA 1AP0A 1U4RA 2K04A 2MPMA 1U4PA 3P7JA 1MSGA 2DY7A 4XT1B 5EPLA 4ZAIA 4ZKBB 1DZ1A 2KEDA 5EPJA 1PDQA 2L1BA 1EOTA 2B2TC 1WTWA 2EOTA 1PFMA 1WTVA 1RTNA
chains in the Genus database with same CATH superfamily
4AYBG 2EYMA 3DLLA 2EYOA 1XMQQ 4LFBQ 5I6WA 1LTAD 4HIOA 1STHA 4LAAA 2RSOA 4HIKA 4POGA 1K28A 4NXNL 1NSNS 4DR7Q 2IX0A 1ZEQX 1WTOA 1SNMA 1HZAA 3GQBA 3M4PA 4EQOA 2IX3A 1SAPA 5M5XB 1KTKA 5C6AA 3PIOA 1F9SA 1EYAA 1FGUA 4OONA 4JI0Q 4LUVA 4KMUC 2HDLA 1VQNA 5JJIA 3VYRA 4KHPQ 1EY8A 1V1PB 2VQFQ 4UHVA 4TQUS 3QO2A 4OX9L 4K2KA 4LWCA 3RR5A 1TWCB 4KJNA 2X69A 3D6WA 4C2MB 1OTCA 1A63A 4QUCA 3HKZE 2Z0SA 2AWNA 4X64Q 4JI7L 1B50A 2JA5G 2GN5A 2RQXA 2UXCL 4GOPB 3A8JE 3NBHA 3CCSA 3RZOB 1IYVA 2DN8A 3G48A 2L9HA 3HOUG 1AE3A 5C5LA 1K9MC 1DOKA 4O42A 1VQ5A 4HSPA 1LTLA 5IT9L 3HOXH 1TU2B 2EYLA 2NVTH 4R9WA 4O1NA 4IFDH 4KHZA 3K6OA 5M3MG 1X9NA 1QB5D 4U673 1HFNA 4HCEA 4B3RQ 1ZKOA 5JVH3 1PTOF 2AHOB 1PTOB 4JI8Q 2EXZA 3DUZA 1NCVA 5KGUA 3BZDB 2IL8A 1HR0W 4MN3A 1TWHH 3MXNA 2CFMA 3QWNA 3T1YL 1I4HA 1O7YA 2J7ZA 4L8JA 1X65A 4P73A 3K0YA 4ZAIA 1JB7A 2C9OA 1ASZA 1ET6A 2HCCA 3U4VA 1JCKB 1BCPD 1HNZQ 1EYGA 3BVMA 4HCSA 2F4IA 1HHVA 3IFDA 2KA7A 2J4XA 4IUVA 2ASBA 1CHPD 5DM73 2A19A 3J7AF 3HOYB 2O2LD 4X6AH 1AZPA 1STGA 1O7LA 1M1KC 3TS2A 1S5ED 2SEBD 1D5MC 1LACA 1EWCA 3HP3A 3TZUA 4L63B 1JORA 2IW3A 2JA5H 4EX5A 1RDPD 1A2TA 1RHPA 1I4GA 2M00A 1LTBD 2FHTA 3K7UC 3LX0A 3FKIG 1ET9A 3HOUH 3PUWA 1EY7A 1K0SA 2PCFB 4XQJA 1LTID 1CFMA 4H13C 4GLAC 1IKMA 2MUYA 4FDBA 4O0AA 4A3EB 2IPKD 4IURA 4PNYA 4G7HC 5M3MH 4DUZL 4LF5Q 2N78A 3M4YA 1PYBA 1U0LA 2EZVA 1AN8A 1EZ6A 3VDYA 1X3PA 3S1QB 3ONAB 3PUYA 1K8AC 2L5TA 4CDCC 4IOCA 2KOLA 1II3A 4K6LA 2PNHA 4A3KG 2G5DA 3GTPB 1YEZA 2K5NA 1HNXQ 1E1OA 4DR2Q 1XNRL 2XGTA 4LW1A 1A2UA 1DJRD 2XSCA 4MTKA 4NPSA 4BY7G 4DV1Q 3SE0A 1ZYRD 1KNAA 3Q6SA 1FJGQ 4HMIA 1N32L 3C1FA 1WOCA 4Q0FA 3E3XA 1XMQL 1MGSA 2F0LA 4XT3B 2XIWA 3E9IA 5FO7B 3DEOA 4C1NK 4CGYB 1LTRD 5NUCA 5M5YB 4A75A 2G9HD 3O13A 3OTOL 2JA7G 2B63G 1AP0A 3A5UA 2Z9HA 4P74A 4DR7L 3HKZB 5CC4A 4A3JG 3DM3A 1D1IA 2HQLA 2PW5A 3SEBA 4ZKCB 1K73C 1EEID 1CKNB 3S15B 2WAQB 1RKNA 1IXRA 4DR4Q 1TS5A 3NWTA 4YIJA 3FKIH 2PPBC 1Q1EA 1HUNA 5KIXA 1SSOA 1SYBA 3IFTA 1EY0A 4DV7L 4DNIA 5CGKA 2IT1A 5CBAE 2L55A 5BN5A 1AEXA 3GTLB 2RA4A 4IUUA 1Q82C 1EEFD 2VQFL 2UUAL 3C1EA 1OXXK 2I5MX 1Y8PB 1W3SA 3KK7A 5AJ3Q 2BOSA 2KQ3A 3GV6A 3OPOA 4FF1A 3M4OH 2RVLA 4GN4B 4OO1I 5ELOA 1PHJA 1QVCA 2B39A 1SMYC 4GNXC 1GOZA 1TQOA 1IBKQ 4LF8Q 2F52A 1D6EC 2JK8A 5C4HA 1JJ2A 4BY7H 1RL2A 4HN7A 4LF6L 1E3PA 1DM0B 1KDAA 2PI2E 1BF4A 3BS1A 1I6VC 5D3DA 1C7YA 3CCUA 4FF3A 1ZXTA 3IKJA 3A56A 2EIFA 1Q8IA 4X3TA 2R3ZA 2PQAA 3J81i 1EY6A 1EY9A 4B3RL 3J80i 3HOVB 2LXKA 2JQOA 4XIGS 4K5WA 1TWAH 2VXWA 3PUVA 3MTSA 4ZUIA 2EJMA 1HH2P 1GM5A 1N36Q 2VY3A 5FLXL 2UUCQ 2B63H 4PMCA 4B3SQ 1TS4A 3T1HQ 1JWSD 4S3SA 3NHHA 3U9SA 4A3JH 2E5LQ 3S16H 1D7QA 1NJIC 3KLSA 1E7ZA 3J81L 2EJGC 3J80L 1GJXA 1VS0A 3I55A 3LWEA 2WFWA 5KEEA 1OXSC 5IODA 2IHEA 3DM1A 1VF7A 4KY6A 4PMWA 4R4IA 4UP8A 1IKLA 1I6HH 4JVZA 4N8X1 1UEBA 1KXLA 3CU7A 1P16A 1EYDA 1X6OA 5M5XH 4IFDJ 4DK6C 3GO5A 1QJOA 1PFMA 2N8NA 5IGGA 3X3NA 1PRTD 5ELNA 1RIPA 1FNUA 2VQEL 4LUOA 1N34Q 4FP5D 4X65L 1F2YA 1SRUA 4O2DA 4BA2I 1VQJA 3SGIA 2CKZB 1C48A 3A74A 1N8RC 1JICA 1SE8A 3J7AV 1HA6A 2K50A 3JAMi 2OQKA 3TDQA 4DV6Q 3NTHA 1XPUA 3R2TA 4RGNA 1TWCH 2NVQB 2JE6I 3CRKC 4C2MH 5CR3A 4XYOA 4QIWE 4CHTB 3CCVA 5IP9G 4LF5L 3H0GB 2K14A 1Q8KA 3FVQA 3SK6A 4H02A 1G51A 1NY4A 3C46A 3SXHA 4EQNA 3RZOH 1YJWA 1V1PA 1PTOC 3K5OA 1GUTA 3JAML 1HNXL 4N9TA 1S40A 4LF9Q 4QL5A 5LL6X 4FXGC 5K36G 1EU3A 4A3EG 1VQEA 1AE2A 1MIUA 5ELEA 3TSSA 2IJ0A 2O5JC 4YY3Q 4A3DB 3D3RA 5A2QL 2QW7A 3CRLC 3CD6A 3MXUA 3TRZA 2K03A 4IJHA 1PTOH 4RMFA 5T1GA 3A8KE 5FKAC 3Q8DA 1KAAA 2A69D 3PO2H 2NYZD 4PZ6A 2L11A 1LTGD 2EQSA 1SXTA 4LF4L 4IUTA 3ICEA 5CBEE 3PUZA 4DAYB 1HR0L 1VQ7A 1IBLL 1HZBA 2F0WA 4POFA 4JV5L 2PW7A 5EJWA 1B9NA 2CW0C 4MNOA 1OXTA 1M8AA 4HJ9A 2FINB 2NVYH 3KDFA 4K0KL 1V43A 2L12A 3R3OA 1SNCA 4X62L 1XTDA 1VQDA 3I4NG 2NN6G 1T5EA 1NBWA 3M9BA 3UE1A 2WB1E 2GVAA 3F8TA 2I5HA 3GTJB 1MHWC 3PIP3 4OX9Q 3S2DB 5IP9H 1CKOA 1DZ1A 3HKZG 2NTSA 3BJUA 3W1BA 2IHFA 1WTVA 3E0JA 1EIHA 2AUJD 3GTKB 4JI7Q 4AH6A 2UXCQ 1VQMA 3S1MB 1U4MA 4OWTB 1HTLD 2PMZE 3VR2A 4GZYC 1TWGB 1IBKL 4WORA 5I9OA 1TVXA 4A3EH 4PZ7A 2X6LA 3K80C 1Z47A 2A6EC 1M90C 5ELBA 1I3QB 3MHBA 2QEXA 1BCPF 1SNOA 5TSSA 1BCPB 4ULLA 2K5QA 2A1AA 5FO9B 3I73A 2QGQA 3S17B 3KF8A 1IW7C 2R93G 4OO1H 2ZJRA 3S1NB 2V4DA 2E74C 5C4XB 2V1CC 1V1QA 1YJNA 1QUQA 4CKBA 4K6DA 1NR4A 3A5ZB 5HURA 5C0XG 1JJGA 1PH9A 3T1YQ 4U68A 1FL0A 2L0CA 2ATWA 1I4XA 2RF4A 3DEPA 4JBMA 4A3IG 2FMMA 5COYA 3VR4A 4ME3A 2RDHA 3CF5A 1RJTA 4DUYL 2WP8J 3NELA 2NN6H 3W2DA 3I4NH 4TKOB 1G2SA 1Q90A 3ERQA 3U9OA 3HOVG 4C56C 5EKIA 5M5WB 2EXDA 3G6EA 2LY7A 5M5YH 2A74C 3MFGA 1BO0A 1B44D 4QIWB 5C4ZA 1KIXA 2EY1A 2IWHA 3DWAA 2K6AA 2VUMB 1ENAA 4IO9A 4IUPA 2WACA 1EIYB 2D0PA 3TP5A 2R7ZG 1P8LA 3H09A 5F2DA 4RAUC 4DV5Q 1A0IA 1EIGA 1EQTA 1N34L 3CMEA 2AWOA 3OYYA 5KRUA 1X3QA 5EKKA 4FXKC 2KHIA 3HOWB 2EY2A 4FNFA 1UEAB 1WTHA 3BDOA 1A3UA 2DY7A 4XT1B 4QCLA 2OT2A 2OTLA 4K8IA 5CV8A 1XMOL 4K5VA 4DA2A 1HTPA 3D4WA 2R93H 2X6GA 1PH7A 4R4OA 2OF1A 1LT5D 3BG3A 4ZK9B 1QCBD 1CA6A 5C0XH 2Q2TA 1WCMB 5LMNL 2BE5C 2MGSA 4HR7B 1XNRQ 2JEAI 1EUJA 1BQQT 3KLRA 2NZHA 2JA6B 1A3VA 4A3IH 1VMPA 3I4LA 1YBYA 2E2JB 1QG7A 2HHHL 4YY3L 1L2FA 3H0GG 5JOBA 1N32Q 1Y1WB 3HOVH 1LLRD 2WB1B 1VQ4A 1TT2A 4H44C 4V190 3M4QA 1HNWL 2VB3X 1S5DD 1EFID 1J9OA 3MXPA 5C44B 3OTOQ 1QVFA 2A6HC 3H15A 3K7AB 5FO8B 1U5KA 4A3FB 4L5RC 1D2BA 2UUBL 4A3DG 2R7ZH 2F1MA 1HZ9A 2PMZB 5C5MA 2E2HH 3S2HB 3PIO3 1Y8OB 3F2DA 2F3WA 5C3EG 4DV7Q 2KHSA 4MZ9A 4NW2A 3PO3B 2Z8LA 3TBIB 2PYKA 4X3SA 4JYAL 1B3QA 1LUZA 4Y7NB 2UUAQ 5C4JH 1IL8A 4IPCA 1L0XB 1YITA 3D0FA 3WWVA 4IZ8A 4A3LG 1BOSA 3FPPA 3GTQB 2JA9A 1FVIA 1PFSA 4LK1C 2NUCA 2MP1A 1CI3M 3GTGB 3JC66 2WAQE 4DV4L 5HY6A 1Z9FA 1GD7A 1JOOA 2ZTCA 5IE8A 2RDFA 1GUWA 4C1NI 1VQIA 5GQOA 1ML0D 2ZTDA 3OW2A 4ALPA 4LF6Q 2K4KA 1HCZA 2QDLA 2LXJA 5EPJA 5ELFA 3H0GH 3C2PA 3CMAA 4IPDA 4G7ZC 3MAQA 4JW0A 1KHIA 1Y69U 2OEOA 4KI0A 2D5DA 2EY5A 2CVRA 4QJFA 1LM0A 3S1RB 3QIAA 4KTAA 3SK8A 4YHHQ 1CQVA 2LFNA 3MXGA 3NBIA 5IGDA 3EBEA 3AB9A 5DM63 4FYDA 4ID6A 4G7OC 4R4QA 3VR5A 4A3DH 1DONA 1CHQD 1JOQA 1C4QA 1IL2A 2MO1A 5C3EH 4HMJA 4KKTA 2AUKA 1A15A 1SEBD 3HZXA 4RG1A 3T53B 1Q86C 1EOVA 5C4XG 3R93A 4G57A 2R61A 1QE6A 1V1OA 2RSNA 2BH8A 1EU4A 1Y8NB 4A3LH 1SJHD 2EYPA 1V9PA 5IT9E 2ZXOA 2VB2X 3M7NA 4IJLA 1HQRD 3NENA 1QVGA 3KBGA 2VQEQ 1EL0A 1VQLA 1G291 4X65Q 1S5FD 4DV5L 1CSQA 1K3RA 1GUGA 3A7AB 3K81C 3CCJA 4YWMA 1FR3A 1STAA 3GTJH 2N55A 3S2DH 3E9HA 1CTMA 4QY7A 3TQYA 5DLQE 1ICFB 3UDXA 1YHQA 4XYQA 2DGYA 1B3AA 3DWPA 3F2UA 1EY4A 3GTKH 3KJOA 2KCNA 1LT4D 3S1MH 1RF2D 1NTGA 2CHBD 2KEEA 3KBXA 1Y1VB 1K8GA 3GP7A 3RD4A 1B2TA 1TWGH 4A3BB 2SOBA 2ICEC 4MIUA 4C3JB 3BZKA 2UXBL 2ICIA 2EYHA 1QWYA 3HOWG 3HKSA 2HCIA 2XWJB 3A8IE 3CPFA 2NZOA 1I3QH 4QB4A 4L6TB 4WFN3 3BZCA 1K0RA 3I4OA 1K83H 4R1JA 4YCWA 5KNDA 3S17H 3AMUA 4BBRB 1RTOA 3AFPA 4ZCKA 3K0XA 3UE0A 4DPGA 5C4XH 2H1EA 3SK5A 1BDOA 1HXYD 3GTMB 3J7YW 1X55A 2RHQB 3NP8A 1WCMG 4LF4Q 2MQHA 1ENCA 1HR0Q 1IBLQ 2K33A 4JV5Q 1J5EL 1DOLA 2JA6G 1QZGA 1H9JA 4I65A 4RGOS 1VDZA 4K0KQ 2K7VA 3PF5A 1CZWA 1NUCA 4C3HB 1XXGA 4X62Q 5BR8L 4QMGA 1Y1WG 3I8ZA 2MO0A 2WB1G 4K8JA 1SMYD 2F0HA 5M5WH 1YNXA 2J0TD 3T13A 4XQQA 3I72A 1W6JA 1YNJC 4R4CA 1VQ6A 5C0XJ 3K57A 1WTPA 1Y14B 4OELB 4RHSA 1AW7A 3CPWA 1F9QA 1KABA 5C44G 3BYYB 2MNAA 1F2ZA 2F0GA 1FGBD 4UP7A 3L7ZC 1ZYRC 1B9MA 4PZ8A 2A8VA 2AMCB 3TMEA 2GVBA 4A3FG 3BDCA 1A8VA 4YCVA 4I7AA 2R92B 4LFAL 3NEMA 1X3GA 4KY5A 3TS0A 1PFNA 1PH6A 1RCVD 2Z4IA 4A3KH 5LMNW 4GKJL 1HA5A 3HOWH 1X54A 3M85A 2UU9L 3PO3G 4ABNA 2O4XA 3S24A 1QOHA 2QF7A 1LTSD 2BCOA 3NXWA 1BBUA 3MA2B 2E2IB 4QGUA 4A4IA 2KCCA 2KJXA 3RMHA 1B4OA 1H9SA 1GO3E 2UXDL 2TMPA 1NNXA 4DAMA 1PA6A 4JI2L 2NN6I 5J1ZA 4DFAA 3CCLA 2F0NA 3N6RA 1WCMH 3OWFA 1WFQA 4KN7C 2JA7H 3EN2A 3ND8A 1F9RA 1BXTA 2K52A 4YHHL 3S14H 5C3XA 3T16A 3FEWX 4DV2L 4F88A 2LS01 4KV6A 4GNXA 1O7ZA 2EY6A 2HD3A 1Y1WH 4DUYQ 4PMBA 2PO4A 3DXJC 2JSOA 1PH3A 2KBNA 3BVGA 4LJZC 1SDFA 3E5SA 5ELCA 1GUOA 1YHAA 4PQXA 1L0YB 1QNUA 3X3MA 1SNDA 1DYQA 4IUNA 4RWSC 4RCNA 5C44H 1ESFA 2ENBA 2DJGC 3F1ZA 2IY5B 3PMFA 5CYUA 1AH9A 3K7AH 1W6KA 2FJ2A 2Z1CA 3ER0A 5GAGC 2DY8A 4GN3B 4A3FH 3N52A 1TS3A 3NSWA 1VMCA 1N9WA 3S2HH 4B08A 4IPGA 2KCMA 3EJIA 1I50B 3LGJA 4GOPC 3P75A 4B3TQ 3NBHB 3PO3H 1SMXA 4KHVA 2F0VA 3URYA 3WOEA 5C0XI 3AU7A 3PQIA 5FOBB 2A68D 2I0QA 2LSSA 4ZYSA 3HOYG 2EVBA 2B2WC 1S5CD 1SBBB 3CC4A 3W3AA 4YCUA 4ZUJA 1XMOQ 3FMCA 3GTQH 3HOZB 3CCEA 2F0QA 1TIID 2A5HA 4MHEA 4IALA 4EQ5A 4R4TA 4OHJA 4MTNA 2HUGA 3GTGH 3KOJA 1EYCA 5E7NA 2CCZA 1H9KA 4CKCA 2SNMA 1O80A 1NMGA 1Z6HA 4UDUC 1L1OB 3RLNA 3J81E 5I4DA 1PH8A 2IX1A 3FPUB 2B8GA 3KF6B 1STEA 3IL8A 3QG1A 5LMNQ 4DK1A 1O7IA 1G6PA 4HJ5A 3HOXB 4LF7L 4RHRA 2G9DA 4FO2A 5J39A 1M4VA 3A54A 3E0EA 3MXNB 2F0UA 2CW0D 4JG2A 1YHBA 2K32A 3L9AX 4GOPA 2HHHQ 1ENFA 1C0AA 1ICWA 1E0BA 2AKWB 2XNAC 3RLFA 1N33L 1VQOA 2VNUD 5GAEC 5KYIA 4YWKA 4J1MA 5KYLA 1XNQQ 3S9WA 3K8AA 2OTJA 1HNWQ 1GUNA 3CKIB 1Y1VG 2ZT9C 2RCFA 1TWHB 4A3BG 3KLSX 4C3JG 2MHVA 2K5DA 4CKEA 1CK1A 4ME5A 2Q8IB 1NE3A 1TWFB 3UDGA 4LFCL 2UUBQ 4M1UB 2Z6KC 3VYUA 1K8MA 1X32A 2C5CA 1X56A 4BBRG 3WOFA 1UUPA 2O5IC 2JA8B 3HOYH 1OXUA 4DR6L 4WJ3M 1YNND 2A6ED 5K5PA 3JAME 3EVQA 4IOAA 4H0LC 3PF4A 4JYAQ 1KAWA 1VQ9A 4JCVE 1VCIA 1XX8A 5EBCA 3D4DA 1SN8A 2ZXPA 4DR1L 2JA5B 4Q5VA 4JBKA 4JI5L 2F0PA 1MKHA 1IW7D 1T9HA 2H4OA 2WINB 1SYDA 4C3HG 2WAQG 3I91A 4NKLA 4L5SA 1WJJA 3A0JA 3ND9A 2CQOA 4DV4Q 2A69C 1CKMA 5M3FB 2XN9C 4B3ML 5L37A 1K3BC 5K36H 2Y0SE 2LMCB 2Z6KA 5DNFA 2MJ8A 3U50C 3CCMA 2KHJA 1ILPA 2Q2HA 4OEMB 3STBC 4BBSB 1CUKA 1E22A 1YI2A 1UE6A 4TVAB 4JOIC 3QB3A 3S1QH 4FVMA 4XQNA 1MSHA 1Y1VH 4A3CG 2XTIA 1STBA 4A3BH 1F2LA 3D4RA 4C3JH 4X66L 1FYCA 1PLFA 3GTPH 2NTTA 4DAVA 4BXXG 2VZAA 5I2XA 3CQZB 2OQ0A 3V05A 4KLKA 1B1ZA 1EIFA 3GTOB 3MFYA 1H9RA 4GKKL 3NPPA 1E2WA 4P71A 1HPCA 2JXMB 4BBRH 3M7GA 2ZJPA 3CC2A 3KLWA 3MC0B 3DMUA 2D62A 4F8MA 4ZLTF 3CXCA 1O78A 3D6CA 3OWEB 3RZDB 1KLGD 3HRZC 1UWVA 1U4RA 1Q46A 2MPMA 4JOIA 5JEAG 3MEFA 3HFZB 5EPLA 1GHJA 4J15A 3W1GA 1E1TA 2Z4HA 1RTNA 1ASYA 1BVSA 4PG3A 4C3HH 2YYZA 3S15H 2RBMA 4NDXA 5IGEA 3EIVA 4BY1B 1NMFA 2F0DA 5E4WC 1QZHA 3K5MA 1YIJA 2I5LX 3NK9A 4V0BA 2EPBA 2DJFC 4Z9CB 1I94L 3H3VC 4B3TL 3KJPA 2BE5D 2F0EA 3GTLH 4OWWB 4KKUA 1KQSA 3GD7A 5IYDG 1A3TA 5JJLA 1QILA 1CKNA 3M3YB 4BA1I 1SFOB 5GADC 4ZRZA 1JC7A 1SLJA 3M4OB 4A3MB 2KVMA 1DD2A 1PYWD 3TZDA 3K59A 2SDFA 2HDMA 4A3CH 4RCOA 4HTHA 5LMUL 3QR8A 3H3VH 2E8GA 2PQAB 2EYFA 2RCNA 2UXBQ 2L4NA 4BXXH 3T51B 2HIXA 1AZQA 2VS1A 3MEHA 5CV7A 3Q22A 3F2CA 1IYJB 1L0WA 1KL9A 1R4PB 1JE5A 1STYA 2A6HD 2BH2A 1DOMA 2E2IH 2EYJA 1ONLA 1SE2A 2QA4A 2D0OA 1Q3LA 3HOZG 3ULPA 2BDOA 3IAYA 3AYHB 3UDIA 1VF5C 3BYTB 1SE3A 1TWAB 5CMDA 5T1IA 1XNQL 2NBFA 1UAPA 1JE4A 2PZWA 3RUZA 5G3LD 1D5XC 4NMZA 3I56A 4AQYL 2YTVA 3PGZA 1R9TB 1FNWA 5JEAH 1DCZA 1WD0A 3TP8A 3VA5A 4DXGA 1J5EQ 1KNEA 4IFDG 1BBWA 3U4ZA 1S72A 3FHWA 5BR8Q 5A35A 2K5VA 1IBMQ 2K5HA 1WI5A 4EGVA 4N9PA 1PZJD 2Y0SB 4JI3L 2PNRC 4ODGA 4NP5A 5IYDH 4JPBW 1I6HB 4WJ4A 5IWAL 1DGSA 4GLVB 3L0OA 1VQ8A 1VQFA 1RD9D 3I4MB 2EOTA 1PH4A 1EWIA 4NXML 3G7LA 4RGMA 2Q8TA 3VR3A 5IOCA 1Q1BA 4LFAQ 3SR1A 4DU9A 3W5OA 1I50H 1QNKA 4OIKA 2BA1A 1L1OC 4GKJQ 3NUCA 2JEBI 2E2DC 2F0IA 2CQAA 2UU9Q 2JA8G 5FK9C 2ZM6L 1I4QA 1EZ8A 1G91A 3CCRA 2F3VA 2NVQH 3G6JB 2JJQA 4A3GB 1JQYD 4DV3L 3HOZH 3SVMA 1BKBA 2FXQA 3BDLA 2AQ2B 2UXDQ 4JI2Q 1JB3A 1C8CA 2JP1A 4CJ2C 4JI1L 4UAIA 1F77A 2MFIA 2F4VL 4IQZA 4IN3A 4K14A 5M3FG 3HS0C 1EQQA 4DV0Q 1KRTA 3QOLA 5JVG3 5ISRA 2H5XA 4DV2Q 4FF4A 2M9VA 3KFUA 1SNQA 1PRTF 4BBSG 1GKHA 1PRTB 1L1OA 2WKCA 2XWBB 3KF6A 3QJYA 4BWGB 4WJWA 5DEHA 3KDFB 1IZ6A 1WTXA 4JI6L 2YV5A 1UE7A 4HSVA 3PO2B 3OIQA 1LT3D 4XDXA 2QEJC 4ILWA 2F0JA 5D65A 2QILA 3SDZA 2F0MA 5GAHC 1GUSA 1S5BD 4DNTB 1LV9A 5EGTA 1TWFH 5LHY1 4K5XA 2NVYB 1PMRA 2F03A 4WRDA 2KUMA 1UE1A 4QQBX 5IP7G 4UPAA 4DK3C 1SR3A 3DHQA 1PH2A 2DNCA 2F0SA 2NVXB 4DAYA 2JA8H 3I2ZA 2PZUA 4OGQC 3BU2A 1TXYA 2B8FA 1D5ZC 4C3IB 3OSOA 3EA6A 4JI4L 4DAPA 2KEDA 2R7FA 1PDQA 1GXDC 2B2TC 1WTWA 2N3SA 2VUMG 3I90A 1BCPC 5IT9c 3OMCA 3EFXD 4LMQD 1CA5A 1V8QA 4A93B 3UI2A 4DR3Q 4F7XA 4BY1G 3UDFA 2DUDA 2JN4A 2PI2A 3KF8B 4DF7A 5M3FH 5IGBA 1GHKA 1IYUA 4BS9A 1QUQB 3OOCA 1J8IA 4LF7Q 2ALYB 3EQLC 4L5TA 4BBSH 3NTIA 3OMGA 3CP0A 4LUZA 5GROA 2B2YC 2NWGA 4HIMA 1N33Q 4A3MG 1PZKD 4G4KA 3EROA 3S1NH 2B2VC 2A73B 3Q24A 3PUXA 2F0FA 1BBXC 3IRBA 4TRDA 3PCOB 1WTQA 1E2VA 3R8BA 1YNJD 3Q0AA 2F0OA 2B2TA 4DR5L 2YTYA 3CQZH 1U9RA 2N88A 3KUPA 3OIPA 3VYSA 5KNCA 1XTCD 2AQ3B 5CV4A 4APVA 2EJFC 4YWLA 3RN5A 5IP7H 3I3CA 1YZ6A 5CV5A 1XJVA 3GTOH 3ULJA 3LWUA 2RHSB 4LFCQ 1RODA 3I4NB 4LFBL 2DNEA 4AYBE 4RH6A 3V96A 1IBML 3RLOA 3RZDH 1SROA 3ZJYC 4CDDC 4DR6Q 1ESRA 5IYBG 4B9WA 2B2YA 3SK4A 2ZXRA 4DN4M 3VR6A 1G6ZA 1JWMD 3WDNA 3U58A 2B2VA 1Q81C 2VUMH 4DR1Q 2Z6BA 2Q8RE 4JI5Q 2GA4B 1PH1A 4BY1H 3P20A 2Q2IA 2YU9B 2NZ1D 4JI0L 5E4XA 2QCPX 1PFBA 4CDEC 1W2BA 1XWEA 2K05A 1ILQA 2M2LA 1HRJA 3NQIA 2B2UC 4KHPL 4B3MQ 2Y0SG 3FRPB 5EKLA 4XTCS 5EPKA 1X3FA 3BVZA 5JEAJ 2K04A 3J81j 3A7LA 1MSGA 4ZKBB 3M3YH 1X3EA 1S3OA 1KDBA 5FLMG 1VQGA 1SFOH 5JPNC 2L1BA 3I4MG 2R93B 4A3MH 3R2IA 4X64L 3V2TA 3AQQA 1SYFA 4A76A 1J6QA 3I7FA 3QOJA 1T5XD 1C9OA 4JC0A 1VQAA 1XPOA 5J3BA 4X66Q 5H1SE 2KCTA 5IYCG 4DK0A 1R4QB 4DV0L 1HJPA 4A3IB 1JJCB 1E24A 2JA6H 4RKBA 1VQBA 2EE1A 2YTXA 4A3GG 5HGTA 2E2JH 3HEJA 1KC8C 2FFKB 2CH4W 4GKKQ 1EWHA 2B2UA 4JBJA 4P75A 3K5NA 1KRSA 2D9UA 5JJKA 4JI8L 4UP9A 1CSPA 3LNNA 1TY0A 3VYTA 5HGQA 3PV0A 5FJ8G 5IYBH 2NB0A 1R9TH 4DKAC 3MVVA 2EDGA 4HAEA 1EQRA 2PQEA 4LNQA 3F2BA 3VA7A 3C3LA 1EQVA 4JK1C 4QUFA 2OWOA 3ULLA 4JBWA 1DXMA 1MJCA 2D2CC 1HNZL 2R7ZB 2E2HB 3T4AC 4KD3A 5E1FA 5C3WA 4HIDA 3HG9A 2VL6A 3RN2A 2RKSA 4DNRB 1WTRA 1CM9A 3FP9A 4QF4A 1FNVA 1PTOD 3H3VI 1I94Q 1BNZA 1LT6D 1G8ZD 3PO2G 3GV3A 5FLXE 5C4JB 4Y7NH 5FLMH 2F0KA 3OHXC 3I4MH 2ZTEA 2B29A 1KD1C 1PZID 5ELDA 4J6HA 3E6ZX 5IGCA 2RDGA 4HEDA 5LMUQ 4RFBA 5CORA 2F0TA 4DR3L 5G3LF 5E3FA 4RGTA 4F87A 3J80E 1JWUD 4CDFC 2K01A 5IYCH 4N8FA 2E75C 5I2YA 1YJ9A 1MBYA 1SNPA 1SYEA 3TEHB 2P5ZX 4DXFA 1GVPA 2NVTB 4P2CB 4KD4A 1HZCA 1Q12A 1U4PA 1HQMC 3L3OC 3P7JA 5FLXc 4A3GH 1LO5D 4C3IG 5CV6A 1CQFA 4RA8A 5D3IB 1JMCA 4AYBB 2K75A 4X3KA 1PRTC 2I07B 5JAVA 1OXVA 1I4RA 1TY2A 3NQTA 5D14A 3D8GA 1A62A 1OO9B 4A93G 1XPRA 1PH5A 5FJ8H 2B2WA 1BUVT 2HIVA 4DR2L 3J81c 1NR2A 3J80c 3TREA 2A68C 2K1BA 3S1RH 1TS2A 4AQYQ 1LTTD 1IHZA 3OW7A 3TP7A 5M9OA 2R6GA 2AQ1B 1VQHA 4DV1L 3CC7A 1WD1A 3T56B 1FJGL 4GN5A 2LKVA 4DGZA 3TP6A 5C3EB 4OO1G 4KK7A 4OIJA 2XRQD 4R8NA 2SNSA 1LABA 3DWQA 1U4LA 4JI3Q 2N49A 2FMCA 1KDCA 4HJ8A 1JT8A 3H91A 2B3GA 4NXNQ 5IWAQ 4NB3A 4P72A 1PV4A 1HFGA 3STBD 5IIFA 1NAPA 3Q23A 4K2LA 3AEVA 4NXMQ 3SHLA 4DR4L 2JYOA 4H7BA 4PV1C 5I6YA 5EQ0A 1D1KA 2WIIB 3I70A 5A2QE 1B53A 4HJ7A 5EAYA 1MJEA 3HOUB 2NVXH 3J7ZC 2OXPA 3PIPA 2Q2UA 1MI2A 5IGFA 5JPMC 2ZM6Q 1AFPA 1PVOA 2CWPA 4C3IH 2PZTA 1XYIA 5M3MB 3JAMc 4IFDI 5AJ3L 2ES2A 4DV3Q 4CJ1B 2BA0A 4I7ZC 3B6YA 3ZYYX 1D8LA 2HT1A 3PSIA 4A93H 5J22A 4E6IA 2R92G 3TN2A 2QKIC 4HJAA 5IY0A 1BR9A 1S4ZA 4KN4C 2WKDA 4JI1Q 1LYLA 4LF8L 2F4VQ 1YNNC 2K5WA 3H94A 4X3UA 3J7A5 1I5FA 3NTKA 3A55A 1I4PA 4RKLA 3K5LA 1YVCA 2I46A 1EOTA 5I9PA 1K83B 4XXEA 1TR5A 1F2MA 2ID0A 3NE5B 5BN4A 4TSSA 1FD7D 1H95A 4OWXB 4JI6Q 4IPHA 1PYSB 2QDBA 1N36L 3D31A 3GTMH 2UUCL 3FDTA 3NWSA 1B70B 4KJOA 4B3SL 3T1HL 1VQKA 3G71A 3ERSX 3KYHC 3MWYW 5AFWA 2E5LL 1TKWB 4FF2A 1SYGA 4B9XA 3HGBA 4GS3A 2E76C 3CW2C 2BDNA 2K28A 3AFQA 4IUQA 3FKIB 5JJZA 1EY5A 1G2TA 1VQCA 1WVLA 3RNUA 1A6XA 4OXPA 4CJ0B 1UNSA 1Z7TA 4AIMA 4L5QA 4KKSA 5DAUA 2TSSA 1K8OA 4JI4Q 1SYCA 4OL7A 3L2PA 1B8AA 3CCQA 2CH4A 4EQPA 2F3IA 3H6MA 1CT1D 2R92H 2YU9H 1H9SB 1UE5A 4A3KB 2CWAA 4GLXA 1WYDA 2ZJQA 1STNA 4DV6L 4R8IA 2VW9A 1H9MA 3MZ5A 4BY7B 5EBDA 1VQPA 2KECA 3CHBD 4DUZQ 2XVSA 3CAMA 5LL6S 3ITPA 1JR0D 5KNBA 1B7YB 3GDEA 3K58A 4Y52H 3G4SA 1HUMA 2OCEA 1MD2D 4ZQ3A 1Q7YC 4GNXB 1CZGA 4J8QA 4M8AA 4EVOA 5CV9A 4UY8C 1F9PA 4FXDA 1EFWA 3P1HA 1PXUA 5BN3A 2JA7B 2B63B 1E2ZA 4LF9L 2C35B 4KY7A 4DR5Q 3S14B 2WV6D 4CBVA 2R7DA 3HOXG 4A3JB 2HQEA 3S16B 2XRSD 1JOKA 2KENA 1KLUD 2L15A 1SJED 1SE4A
chains in the Genus database with same CATH topology
2EYMA 2EYOA 5I6WA 1LTAD 1STHA 4LAAA 2RSOA 1NSNS 2IX0A 1ZEQX 1WTOA 1SNMA 3GQBA 4EQOA 2IX3A 1SAPA 5M5XB 1KTKA 5C6AA 1F9SA 1EYAA 4KMUC 2HDLA 3VYRA 1EY8A 1V1PB 4TQUS 3QO2A 4K2KA 1TWCB 4KJNA 2X69A 3D6WA 4C2MB 4QUCA 1B50A 2AWNA 2RQXA 3A8JE 3NBHA 3RZOB 1IYVA 2DN8A 2L9HA 5C5LA 1DOKA 4O42A 4HSPA 5IT9L 1TU2B 2EYLA 4R9WA 4O1NA 4IFDH 4KHZA 3K6OA 1QB5D 4U673 1HFNA 4HCEA 1ZKOA 5JVH3 1PTOF 1PTOB 2EXZA 3DUZA 1NCVA 5KGUA 3BZDB 2IL8A 4MN3A 3MXNA 3QWNA 1I4HA 1O7YA 2J7ZA 4L8JA 3K0YA 4ZAIA 2C9OA 1ET6A 2HCCA 1JCKB 1BCPD 3BVMA 4HCSA 2F4IA 1HHVA 3IFDA 2KA7A 2J4XA 4IUVA 1CHPD 5DM73 3J7AF 3HOYB 2O2LD 1AZPA 1STGA 1O7LA 1S5ED 2SEBD 1D5MC 1LACA 1EWCA 3HP3A 3TZUA 4L63B 1JORA 2IW3A 1RDPD 1A2TA 1RHPA 1I4GA 2M00A 1LTBD 2FHTA 3LX0A 1ET9A 3PUWA 1EY7A 2PCFB 4XQJA 1LTID 1CFMA 4H13C 1IKMA 2MUYA 4A3EB 2IPKD 4IURA 4PNYA 4G7HC 3M4YA 2EZVA 1AN8A 1EZ6A 1X3PA 3S1QB 3ONAB 3PUYA 2L5TA 2KOLA 1II3A 4K6LA 3GTPB 1A2UA 1DJRD 2XSCA 3SE0A 1ZYRD 1KNAA 3Q6SA 4HMIA 3C1FA 4Q0FA 1MGSA 2F0LA 4XT3B 2XIWA 5FO7B 3DEOA 4C1NK 4CGYB 1LTRD 5NUCA 5M5YB 2G9HD 3O13A 1AP0A 3HKZB 5CC4A 1D1IA 2PW5A 3SEBA 4ZKCB 1EEID 3S15B 2WAQB 1RKNA 1TS5A 3NWTA 4YIJA 2PPBC 1Q1EA 1HUNA 5KIXA 1SSOA 1SYBA 3IFTA 1EY0A 5CGKA 2IT1A 5CBAE 2L55A 5BN5A 1AEXA 3GTLB 2RA4A 4IUUA 1EEFD 3C1EA 1OXXK 1Y8PB 3KK7A 2BOSA 2KQ3A 3GV6A 3OPOA 4FF1A 2RVLA 4OO1I 2B39A 1SMYC 1GOZA 1TQOA 1D6EC 5C4HA 4HN7A 1DM0B 1KDAA 1BF4A 3BS1A 1I6VC 5D3DA 4FF3A 1ZXTA 3IKJA 3A56A 1Q8IA 4X3TA 2R3ZA 1EY6A 1EY9A 3HOVB 4XIGS 4K5WA 2VXWA 3PUVA 3MTSA 4ZUIA 2EJMA 5FLXL 4PMCA 1TS4A 1JWSD 4S3SA 3NHHA 3U9SA 3KLSA 3J81L 2EJGC 3J80L 1GJXA 3LWEA 5KEEA 1OXSC 5IODA 3DM1A 1VF7A 4KY6A 4PMWA 1IKLA 3CU7A 1EYDA 4IFDJ 3GO5A 1QJOA 1PFMA 5IGGA 3X3NA 1PRTD 1FNUA 4FP5D 1F2YA 4BA2I 1C48A 1JICA 3J7AV 1HA6A 3TDQA 3NTHA 3R2TA 4RGNA 2NVQB 2JE6I 3CRKC 5CR3A 4XYOA 4CHTB 3H0GB 3FVQA 3SK6A 3C46A 3SXHA 4EQNA 1V1PA 1PTOC 3K5OA 1GUTA 3JAML 4N9TA 5LL6X 4FXGC 5K36G 1EU3A 5ELEA 3TSSA 2IJ0A 2O5JC 4A3DB 3D3RA 5A2QL 3CRLC 3MXUA 2K03A 1PTOH 5T1GA 3A8KE 5FKAC 1KAAA 2A69D 2NYZD 2L11A 1LTGD 1SXTA 4IUTA 5CBEE 3PUZA 2F0WA 2PW7A 5EJWA 1B9NA 2CW0C 1OXTA 1M8AA 2FINB 1V43A 2L12A 3R3OA 1SNCA 2NN6G 1T5EA 3GTJB 3PIP3 3S2DB 1DZ1A 2NTSA 1WTVA 3E0JA 1EIHA 2AUJD 3GTKB 3S1MB 1U4MA 1HTLD 3VR2A 4GZYC 1TWGB 4WORA 5I9OA 1TVXA 2X6LA 1Z47A 2A6EC 5ELBA 1I3QB 3MHBA 1BCPF 1SNOA 5TSSA 1BCPB 4ULLA 2K5QA 5FO9B 3I73A 3S17B 3KF8A 1IW7C 4OO1H 3S1NB 2V4DA 2E74C 5C4XB 4CKBA 4K6DA 1NR4A 5HURA 5C0XG 4U68A 2L0CA 1I4XA 3DEPA 2FMMA 5COYA 3VR4A 2RDHA 1RJTA 2WP8J 2NN6H 3W2DA 4TKOB 1G2SA 1Q90A 3ERQA 3U9OA 4C56C 5EKIA 5M5WB 2LY7A 2A74C 3MFGA 1BO0A 1B44D 4QIWB 5C4ZA 2EY1A 2IWHA 3DWAA 2K6AA 2VUMB 1ENAA 4IUPA 2WACA 3TP5A 3H09A 5F2DA 4RAUC 1EIGA 1EQTA 2AWOA 5KRUA 1X3QA 5EKKA 4FXKC 3HOWB 2EY2A 4FNFA 1UEAB 3BDOA 1A3UA 2DY7A 4XT1B 4QCLA 2OT2A 4K8IA 5CV8A 4K5VA 4DA2A 1HTPA 3D4WA 2X6GA 2OF1A 1LT5D 3BG3A 4ZK9B 1QCBD 1CA6A 5C0XH 1WCMB 2BE5C 2MGSA 4HR7B 2JEAI 1BQQT 3KLRA 2JA6B 1A3VA 1VMPA 3I4LA 2E2JB 1QG7A 5JOBA 1Y1WB 1LLRD 2WB1B 1TT2A 4H44C 4V190 2VB3X 1S5DD 1EFID 1J9OA 3MXPA 5C44B 2A6HC 3K7AB 5FO8B 4A3FB 1D2BA 2F1MA 5C5MA 2PMZB 3S2HB 3PIO3 1Y8OB 2F3WA 2KHSA 4NW2A 3PO3B 2Z8LA 3TBIB 2PYKA 4X3SA 4Y7NB 1IL8A 1L0XB 4IZ8A 1BOSA 3FPPA 3GTQB 4LK1C 2NUCA 2MP1A 1CI3M 3GTGB 1JOOA 2RDFA 1GUWA 4C1NI 1ML0D 1HCZA 5EPJA 5ELFA 3C2PA 4G7ZC 3MAQA 1Y69U 2OEOA 4KI0A 2D5DA 2EY5A 2CVRA 3S1RB 3QIAA 4KTAA 3SK8A 1CQVA 2LFNA 3MXGA 3NBIA 5IGDA 3AB9A 5DM63 4FYDA 4ID6A 4G7OC 3VR5A 1DONA 1CHQD 1JOQA 1C4QA 4HMJA 4KKTA 2AUKA 1A15A 1SEBD 3HZXA 3T53B 3R93A 4G57A 2R61A 1QE6A 1V1OA 2RSNA 1EU4A 1Y8NB 1SJHD 2EYPA 5IT9E 2ZXOA 2VB2X 3M7NA 1HQRD 3KBGA 1EL0A 1G291 1S5FD 1GUGA 3A7AB 1FR3A 1STAA 2N55A 1CTMA 4XYQA 1B3AA 3DWPA 3F2UA 1EY4A 2KCNA 1LT4D 1RF2D 2CHBD 2KEEA 3KBXA 1Y1VB 3GP7A 3RD4A 1B2TA 4A3BB 2SOBA 2ICEC 4MIUA 4C3JB 2ICIA 2EYHA 1QWYA 2HCIA 2XWJB 3A8IE 4QB4A 4L6TB 4WFN3 5KNDA 3AMUA 4BBRB 1RTOA 2H1EA 3SK5A 1BDOA 1HXYD 3GTMB 3J7YW 3NP8A 1ENCA 2K33A 1DOLA 1H9JA 4I65A 4RGOS 1VDZA 2K7VA 1CZWA 1NUCA 4C3HB 1XXGA 4QMGA 3I8ZA 4K8JA 1SMYD 2F0HA 2J0TD 3T13A 4XQQA 3I72A 1W6JA 1YNJC 5C0XJ 3K57A 1WTPA 4RHSA 1AW7A 1F9QA 1KABA 3BYYB 1F2ZA 2F0GA 1FGBD 3L7ZC 1ZYRC 1B9MA 3TMEA 3BDCA 2R92B 4KY5A 1PFNA 1RCVD 2Z4IA 1HA5A 3M85A 4ABNA 2O4XA 1QOHA 2QF7A 1LTSD 2BCOA 3NXWA 3MA2B 2E2IB 2KCCA 2KJXA 3RMHA 1B4OA 1H9SA 2TMPA 2NN6I 5J1ZA 4DFAA 2F0NA 3N6RA 3OWFA 4KN7C 3ND8A 1F9RA 1BXTA 5C3XA 3T16A 3FEWX 4F88A 2LS01 4KV6A 1O7ZA 2EY6A 4PMBA 2PO4A 3DXJC 2JSOA 3BVGA 4LJZC 1SDFA 3E5SA 5ELCA 1GUOA 4PQXA 1L0YB 1QNUA 3X3MA 1SNDA 1DYQA 4IUNA 4RWSC 4RCNA 1ESFA 2ENBA 3PMFA 5CYUA 1W6KA 2FJ2A 2Z1CA 2DY8A 3N52A 1TS3A 3NSWA 1VMCA 4B08A 3EJIA 1I50B 3P75A 4KHVA 2F0VA 3URYA 3WOEA 5C0XI 3AU7A 5FOBB 2A68D 4ZYSA 2EVBA 2B2WC 1S5CD 1SBBB 3W3AA 4ZUJA 3FMCA 3HOZB 2F0QA 1TIID 2A5HA 4MHEA 4IALA 4OHJA 2HUGA 1EYCA 1H9KA 4CKCA 2SNMA 1O80A 1Z6HA 4UDUC 2IX1A 3J81E 5I4DA 3FPUB 2B8GA 1STEA 3IL8A 3QG1A 4DK1A 3HOXB 4RHRA 2G9DA 4FO2A 5J39A 1M4VA 3A54A 2F0UA 2CW0D 2K32A 3L9AX 1ENFA 1ICWA 1E0BA 3RLFA 2XNAC 2VNUD 5KYIA 4J1MA 5KYLA 3S9WA 1GUNA 3CKIB 2ZT9C 1TWHB 3KLSX 4C3JG 2MHVA 2K5DA 4CKEA 1CK1A 4ME5A 2Q8IB 1TWFB 4M1UB 3VYUA 1K8MA 1X32A 2C5CA 3WOFA 1UUPA 2O5IC 2JA8B 1OXUA 1YNND 2A6ED 5K5PA 3JAME 3EVQA 4H0LC 1VCIA 1XX8A 5EBCA 3D4DA 2ZXPA 2JA5B 4Q5VA 2F0PA 1IW7D 2H4OA 2WINB 1SYDA 4C3HG 3I91A 4NKLA 3ND9A 2A69C 5M3FB 2XN9C 5K36H 2LMCB 5DNFA 2MJ8A 1ILPA 4BBSB 3QB3A 4FVMA 4XQNA 1MSHA 1STBA 1F2LA 3D4RA 1FYCA 1PLFA 2NTTA 4DAVA 5I2XA 3CQZB 3V05A 1B1ZA 3GTOB 3MFYA 1H9RA 3NPPA 1E2WA 1HPCA 2JXMB 3M7GA 3MC0B 3DMUA 2D62A 4F8MA 4ZLTF 1O78A 3D6CA 3OWEB 3RZDB 1KLGD 3HRZC 1U4RA 5JEAG 2MPMA 5EPLA 1GHJA 2Z4HA 1RTNA 2YYZA 2RBMA 4NDXA 5IGEA 4BY1B 2F0DA 5E4WC 3K5MA 3NK9A 4V0BA 2EPBA 4Z9CB 3H3VC 2BE5D 2F0EA 4KKUA 3GD7A 1A3TA 1QILA 3M3YB 4BA1I 1SFOB 4ZRZA 1JC7A 3M4OB 4A3MB 2KVMA 1DD2A 1PYWD 3TZDA 3K59A 2SDFA 2HDMA 4RCOA 4HTHA 2EYFA 2L4NA 3T51B 1AZQA 3MEHA 5CV7A 3Q22A 1STYA 1R4PB 2A6HD 1DOMA 2EYJA 1ONLA 1SE2A 1Q3LA 2BDOA 3IAYA 1VF5C 3BYTB 1SE3A 5CMDA 1TWAB 5T1IA 2NBFA 1UAPA 1JE4A 2PZWA 3RUZA 5G3LD 1D5XC 4NMZA 1R9TB 1FNWA 5JEAH 1DCZA 1WD0A 3TP8A 3VA5A 4DXGA 1KNEA 4IFDG 5A35A 4EGVA 4N9PA 1PZJD 2Y0SB 2PNRC 4ODGA 4NP5A 1I6HB 1RD9D 3I4MB 2EOTA 3G7LA 4RGMA 2Q8TA 3VR3A 5IOCA 1Q1BA 3SR1A 4DU9A 1QNKA 4OIKA 2BA1A 2JEBI 3NUCA 2E2DC 2F0IA 2CQAA 5FK9C 1I4QA 1EZ8A 1G91A 2F3VA 3G6JB 4A3GB 1JQYD 3SVMA 3BDLA 2AQ2B 1JB3A 1C8CA 4CJ2C 2JP1A 4UAIA 1F77A 4IQZA 4IN3A 4K14A 3HS0C 3QOLA 5JVG3 5ISRA 4FF4A 2M9VA 1SNQA 1PRTF 1PRTB 2WKCA 2XWBB 3QJYA 4BWGB 4WJWA 5DEHA 1WTXA 4HSVA 3PO2B 3OIQA 1LT3D 4XDXA 2QEJC 4ILWA 2F0JA 5D65A 2QILA 3SDZA 2F0MA 1GUSA 1S5BD 4DNTB 1LV9A 5EGTA 5LHY1 4K5XA 2NVYB 1PMRA 2F03A 4WRDA 2KUMA 3DHQA 2DNCA 2F0SA 2NVXB 4DAYA 2PZUA 4OGQC 2B8FA 1D5ZC 4C3IB 3OSOA 3EA6A 4DAPA 2KEDA 1PDQA 1GXDC 2B2TC 1WTWA 3I90A 1BCPC 3OMCA 3EFXD 4LMQD 1CA5A 1V8QA 4A93B 3UI2A 4F7XA 4DF7A 5IGBA 1GHKA 1IYUA 4BS9A 3OOCA 1J8IA 3EQLC 3NTIA 3OMGA 2B2YC 2NWGA 1PZKD 4G4KA 3EROA 2B2VC 2A73B 3Q24A 3PUXA 2F0FA 1BBXC 4TRDA 1WTQA 1E2VA 3R8BA 1YNJD 3Q0AA 2F0OA 2B2TA 1U9RA 2N88A 3KUPA 3OIPA 5KNCA 3VYSA 1XTCD 2AQ3B 5CV4A 2EJFC 3I3CA 5CV5A 3LWUA 1RODA 3I4NB 2DNEA 4RH6A 3V96A 1ESRA 4B9WA 2B2YA 3SK4A 2ZXRA 4DN4M 3VR6A 1G6ZA 1JWMD 3WDNA 2B2VA 2Q8RE 2GA4B 3P20A 2YU9B 2NZ1D 5E4XA 2QCPX 1PFBA 1XWEA 2K05A 1ILQA 2M2LA 1HRJA 3NQIA 2B2UC 3FRPB 5EKLA 4XTCS 5EPKA 3BVZA 5JEAJ 2K04A 3A7LA 1MSGA 4ZKBB 1KDBA 5JPNC 2L1BA 2R93B 3R2IA 3V2TA 1SYFA 3QOJA 1T5XD 4DK0A 1R4QB 4A3IB 4RKBA 2EE1A 5HGTA 3HEJA 2FFKB 1EWHA 2B2UA 3K5NA 2D9UA 3LNNA 1TY0A 3VYTA 3PV0A 2NB0A 3MVVA 2EDGA 4HAEA 2PQEA 3VA7A 3C3LA 1EQVA 4JK1C 4QUFA 4JBWA 1DXMA 2D2CC 2R7ZB 2E2HB 3T4AC 4KD3A 5E1FA 5C3WA 3HG9A 2RKSA 4DNRB 1WTRA 1CM9A 4QF4A 1FNVA 1PTOD 1BNZA 1LT6D 1G8ZD 3GV3A 5FLXE 5C4JB 2F0KA 3OHXC 1PZID 5ELDA 4J6HA 3E6ZX 5IGCA 2RDGA 4HEDA 4RFBA 5CORA 2F0TA 5G3LF 5E3FA 4RGTA 4F87A 3J80E 1JWUD 2K01A 2E75C 5I2YA 1MBYA 1SNPA 1SYEA 4DXFA 2NVTB 4P2CB 4KD4A 1Q12A 1U4PA 1HQMC 3L3OC 3P7JA 1LO5D 4C3IG 5CV6A 1CQFA 4RA8A 5D3IB 4AYBB 4X3KA 1PRTC 2I07B 5JAVA 1OXVA 1I4RA 1TY2A 3NQTA 5D14A 3D8GA 1OO9B 2B2WA 1BUVT 1NR2A 2A68C 2K1BA 1TS2A 1LTTD 1IHZA 3OW7A 3TP7A 5M9OA 2R6GA 2AQ1B 1WD1A 3T56B 2LKVA 4DGZA 3TP6A 5C3EB 4OO1G 4KK7A 4OIJA 2XRQD 4R8NA 2SNSA 1LABA 3DWQA 1U4LA 2FMCA 1KDCA 3H91A 1HFGA 5IIFA 1NAPA 3Q23A 4K2LA 3SHLA 2JYOA 4H7BA 4PV1C 5I6YA 5EQ0A 1D1KA 2WIIB 3I70A 5A2QE 1B53A 3HOUB 2OXPA 1MI2A 5IGFA 5JPMC 1AFPA 2PZTA 1XYIA 5M3MB 4IFDI 4CJ1B 2BA0A 4I7ZC 3ZYYX 5J22A 4E6IA 3TN2A 2QKIC 1BR9A 1S4ZA 4KN4C 2WKDA 1YNNC 2K5WA 3H94A 4X3UA 3NTKA 3A55A 1I4PA 4RKLA 3K5LA 2I46A 1EOTA 5I9PA 1K83B 4XXEA 1TR5A 1F2MA 2ID0A 3NE5B 5BN4A 4TSSA 1FD7D 2QDBA 3D31A 3FDTA 3NWSA 4KJOA 3MWYW 5AFWA 1TKWB 4FF2A 1SYGA 4B9XA 3HGBA 2E76C 2BDNA 2K28A 4IUQA 3FKIB 5JJZA 1EY5A 1G2TA 1A6XA 1WVLA 4CJ0B 1UNSA 1Z7TA 4KKSA 5DAUA 2TSSA 1K8OA 1SYCA 4OL7A 4EQPA 3H6MA 1CT1D 1H9SB 4A3KB 1STNA 4R8IA 1H9MA 3MZ5A 4BY7B 5EBDA 2KECA 3CHBD 2XVSA 5LL6S 3ITPA 1JR0D 5KNBA 3K58A 1HUMA 1MD2D 4ZQ3A 1CZGA 4J8QA 4M8AA 4EVOA 5CV9A 1F9PA 4FXDA 3P1HA 1PXUA 5BN3A 2JA7B 2B63B 1E2ZA 4KY7A 3S14B 2WV6D 4CBVA 4A3JB 2HQEA 3S16B 2XRSD 1JOKA 1KLUD 1SJED 1SE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HCC A;  4X3K A;  2X6G A;  3G7L A;  1O7Z A;  3I90 A;  1EIH A;  2Q8T A;  4LMQ D;  1CA5 A;  1RTO A;  1X32 A;  1HUN A;  5D14 A;  1U4M A;  4HCS A;  5E4W C;  3UI2 A;  1QNK A;  1SDF A;  1SSO A;  4OIK A;  4ZK9 B;  1HHV A;  2H1E A;  3IFD A;  4ZKC B;  2EPB A;  5CBA E;  1CA6 A;  2B2W A;  2CVR A;  4IUV A;  2RSO A;  1JIC A;  1NR2 A;  3FDT A;  2RA4 A;  1TVX A;  4RWS C;  1HA6 A;  2MGS A;  2K1B A;  4IUU A;  1AZP A;  2X6L A;  1J8I A;  1G91 A;  3MWY W;  5AFW A;  2FJ2 A;  1WTO A;  1DOL A;  1VMP A;  1XX8 A;  2DY8 A;  1SAP A;  3HP3 A;  1WD1 A;  2EE1 A;  3N52 A;  1QG7 A;  1DON A;  3SVM A;  3GV6 A;  2B2Y C;  2FFK B;  1VMC A;  2NWG A;  2BDN A;  1F9S A;  2K28 A;  2KVM A;  1RHP A;  2RVL A;  4IUQ A;  3TZD A;  2B2U A;  2SDF A;  2HDM A;  3I91 A;  2FHT A;  2B2V C;  3I8Z A;  1A15 A;  2D9U A;  5JJZ A;  1BBX C;  4OIJ A;  1G2T A;  1WVL A;  1WTQ A;  1C8C A;  4CJ0 B;  2HDL A;  2JP1 A;  3R93 A;  4CJ2 C;  4UAI A;  1U4L A;  1NR4 A;  1QE6 A;  2L4N A;  1IKM A;  1AZQ A;  1WTP A;  1J9O A;  2RSN A;  2B2T A;  3H91 A;  4U68 A;  1F9Q A;  3QO2 A;  2B2W C;  2N88 A;  3KUP A;  5DNF A;  4IUR A;  4HAE A;  2X69 A;  2MJ8 A;  1DOM A;  1HFG A;  3D6W A;  1BF4 A;  1ILP A;  3DEP A;  2FMM A;  5COY A;  1NAP A;  4QUF A;  1ZXT A;  3I3C A;  4QUC A;  1X3P A;  1B50 A;  1RJT A;  1Q3L A;  4MHE A;  4X3T A;  2JYO A;  2R3Z A;  3ONA B;  1ROD A;  1EL0 A;  2HUG A;  1PFN A;  1G2S A;  1MSH A;  2K03 A;  1O80 A;  2KOL A;  2VXW A;  5EQ0 A;  5T1I A;  5CMD A;  1WTX A;  1B53 A;  1CM9 A;  5EKI A;  5T1G A;  1WTR A;  3MTS A;  3FPU B;  1F2L A;  2L9H A;  3IL8 A;  1JE4 A;  4HSV A;  1BNZ A;  1PLF A;  4NW2 A;  2NYZ D;  1BO0 A;  4XDX A;  2L11 A;  1MI2 A;  3GV3 A;  4X3S A;  4R8I A;  2N55 A;  1DOK A;  1ESR A;  4IUT A;  4O42 A;  5CBE E;  2B2Y A;  5D65 A;  1WD0 A;  2KEC A;  4R9W A;  4DN4 M;  1G6Z A;  1IL8 A;  5EJW A;  1XYI A;  1B3A A;  1KNE A;  3F2U A;  2B2V A;  1LV9 A;  1M8A A;  1KNA A;  2FIN B;  3Q6S A;  4CJ1 B;  2Q8R E;  1ICW A;  1B4O A;  1E0B A;  2KUM A;  2L12 A;  1HFN A;  4IUP A;  1HUM A;  2MP1 A;  3LWE A;  1MGS A;  2NZ1 D;  4HED A;  4RAU C;  3TN2 A;  1EIG A;  1EQT A;  1PFB A;  2KEE A;  3KBX A;  5COR A;  5E4X A;  1NCV A;  4ZLT F;  1B2T A;  2K05 A;  4XT3 B;  1X3Q A;  1S4Z A;  1ILQ A;  2XIW A;  2M2L A;  1HRJ A;  3DEO A;  1F9P A;  3DM1 A;  2IL8 A;  2K01 A;  1GUW A;  4MN3 A;  2B2U C;  1ML0 D;  4RA8 A;  2HCI A;  4X3U A;  1IKL A;  1F9R A;  1O7Y A;  2J7Z A;  5EPK A;  1AP0 A;  1U4R A;  2K04 A;  2MPM A;  1U4P A;  3P7J A;  1MSG A;  2DY7 A;  4XT1 B;  5EPL A;  4ZAI A;  4ZKB B;  1DZ1 A;  2KED A;  5EPJ A;  1PDQ A;  2L1B A;  1EOT A;  2B2T C;  1WTW A;  2EOT A;  1PFM A;  1WTV A;  1RTN A; 
#chains in the Genus database with same CATH topology
 4AYB G;  2EYM A;  3DLL A;  2EYO A;  1XMQ Q;  4LFB Q;  5I6W A;  1LTA D;  4HIO A;  1STH A;  4LAA A;  2RSO A;  4HIK A;  4POG A;  1K28 A;  4NXN L;  1NSN S;  4DR7 Q;  2IX0 A;  1ZEQ X;  1WTO A;  1SNM A;  1HZA A;  3GQB A;  3M4P A;  4EQO A;  2IX3 A;  1SAP A;  5M5X B;  1KTK A;  5C6A A;  3PIO A;  1F9S A;  1EYA A;  1FGU A;  4OON A;  4JI0 Q;  4LUV A;  4KMU C;  2HDL A;  1VQN A;  5JJI A;  3VYR A;  4KHP Q;  1EY8 A;  1V1P B;  2VQF Q;  4UHV A;  4TQU S;  3QO2 A;  4OX9 L;  4K2K A;  4LWC A;  3RR5 A;  1TWC B;  4KJN A;  2X69 A;  3D6W A;  4C2M B;  1OTC A;  1A63 A;  4QUC A;  3HKZ E;  2Z0S A;  2AWN A;  4X64 Q;  4JI7 L;  1B50 A;  2JA5 G;  2GN5 A;  2RQX A;  2UXC L;  4GOP B;  3A8J E;  3NBH A;  3CCS A;  3RZO B;  1IYV A;  2DN8 A;  3G48 A;  2L9H A;  3HOU G;  1AE3 A;  5C5L A;  1K9M C;  1DOK A;  4O42 A;  1VQ5 A;  4HSP A;  1LTL A;  5IT9 L;  3HOX H;  1TU2 B;  2EYL A;  2NVT H;  4R9W A;  4O1N A;  4IFD H;  4KHZ A;  3K6O A;  5M3M G;  1X9N A;  1QB5 D;  4U67 3;  1HFN A;  4HCE A;  4B3R Q;  1ZKO A;  5JVH 3;  1PTO F;  2AHO B;  1PTO B;  4JI8 Q;  2EXZ A;  3DUZ A;  1NCV A;  5KGU A;  3BZD B;  2IL8 A;  1HR0 W;  4MN3 A;  1TWH H;  3MXN A;  2CFM A;  3QWN A;  3T1Y L;  1I4H A;  1O7Y A;  2J7Z A;  4L8J A;  1X65 A;  4P73 A;  3K0Y A;  4ZAI A;  1JB7 A;  2C9O A;  1ASZ A;  1ET6 A;  2HCC A;  3U4V A;  1JCK B;  1BCP D;  1HNZ Q;  1EYG A;  3BVM A;  4HCS A;  2F4I A;  1HHV A;  3IFD A;  2KA7 A;  2J4X A;  4IUV A;  2ASB A;  1CHP D;  5DM7 3;  2A19 A;  3J7A F;  3HOY B;  2O2L D;  4X6A H;  1AZP A;  1STG A;  1O7L A;  1M1K C;  3TS2 A;  1S5E D;  2SEB D;  1D5M C;  1LAC A;  1EWC A;  3HP3 A;  3TZU A;  4L63 B;  1JOR A;  2IW3 A;  2JA5 H;  4EX5 A;  1RDP D;  1A2T A;  1RHP A;  1I4G A;  2M00 A;  1LTB D;  2FHT A;  3K7U C;  3LX0 A;  3FKI G;  1ET9 A;  3HOU H;  3PUW A;  1EY7 A;  1K0S A;  2PCF B;  4XQJ A;  1LTI D;  1CFM A;  4H13 C;  4GLA C;  1IKM A;  2MUY A;  4FDB A;  4O0A A;  4A3E B;  2IPK D;  4IUR A;  4PNY A;  4G7H C;  5M3M H;  4DUZ L;  4LF5 Q;  2N78 A;  3M4Y A;  1PYB A;  1U0L A;  2EZV A;  1AN8 A;  1EZ6 A;  3VDY A;  1X3P A;  3S1Q B;  3ONA B;  3PUY A;  1K8A C;  2L5T A;  4CDC C;  4IOC A;  2KOL A;  1II3 A;  4K6L A;  2PNH A;  4A3K G;  2G5D A;  3GTP B;  1YEZ A;  2K5N A;  1HNX Q;  1E1O A;  4DR2 Q;  1XNR L;  2XGT A;  4LW1 A;  1A2U A;  1DJR D;  2XSC A;  4MTK A;  4NPS A;  4BY7 G;  4DV1 Q;  3SE0 A;  1ZYR D;  1KNA A;  3Q6S A;  1FJG Q;  4HMI A;  1N32 L;  3C1F A;  1WOC A;  4Q0F A;  3E3X A;  1XMQ L;  1MGS A;  2F0L A;  4XT3 B;  2XIW A;  3E9I A;  5FO7 B;  3DEO A;  4C1N K;  4CGY B;  1LTR D;  5NUC A;  5M5Y B;  4A75 A;  2G9H D;  3O13 A;  3OTO L;  2JA7 G;  2B63 G;  1AP0 A;  3A5U A;  2Z9H A;  4P74 A;  4DR7 L;  3HKZ B;  5CC4 A;  4A3J G;  3DM3 A;  1D1I A;  2HQL A;  2PW5 A;  3SEB A;  4ZKC B;  1K73 C;  1EEI D;  1CKN B;  3S15 B;  2WAQ B;  1RKN A;  1IXR A;  4DR4 Q;  1TS5 A;  3NWT A;  4YIJ A;  3FKI H;  2PPB C;  1Q1E A;  1HUN A;  5KIX A;  1SSO A;  1SYB A;  3IFT A;  1EY0 A;  4DV7 L;  4DNI A;  5CGK A;  2IT1 A;  5CBA E;  2L55 A;  5BN5 A;  1AEX A;  3GTL B;  2RA4 A;  4IUU A;  1Q82 C;  1EEF D;  2VQF L;  2UUA L;  3C1E A;  1OXX K;  2I5M X;  1Y8P B;  1W3S A;  3KK7 A;  5AJ3 Q;  2BOS A;  2KQ3 A;  3GV6 A;  3OPO A;  4FF1 A;  3M4O H;  2RVL A;  4GN4 B;  4OO1 I;  5ELO A;  1PHJ A;  1QVC A;  2B39 A;  1SMY C;  4GNX C;  1GOZ A;  1TQO A;  1IBK Q;  4LF8 Q;  2F52 A;  1D6E C;  2JK8 A;  5C4H A;  1JJ2 A;  4BY7 H;  1RL2 A;  4HN7 A;  4LF6 L;  1E3P A;  1DM0 B;  1KDA A;  2PI2 E;  1BF4 A;  3BS1 A;  1I6V C;  5D3D A;  1C7Y A;  3CCU A;  4FF3 A;  1ZXT A;  3IKJ A;  3A56 A;  2EIF A;  1Q8I A;  4X3T A;  2R3Z A;  2PQA A;  3J81 i;  1EY6 A;  1EY9 A;  4B3R L;  3J80 i;  3HOV B;  2LXK A;  2JQO A;  4XIG S;  4K5W A;  1TWA H;  2VXW A;  3PUV A;  3MTS A;  4ZUI A;  2EJM A;  1HH2 P;  1GM5 A;  1N36 Q;  2VY3 A;  5FLX L;  2UUC Q;  2B63 H;  4PMC A;  4B3S Q;  1TS4 A;  3T1H Q;  1JWS D;  4S3S A;  3NHH A;  3U9S A;  4A3J H;  2E5L Q;  3S16 H;  1D7Q A;  1NJI C;  3KLS A;  1E7Z A;  3J81 L;  2EJG C;  3J80 L;  1GJX A;  1VS0 A;  3I55 A;  3LWE A;  2WFW A;  5KEE A;  1OXS C;  5IOD A;  2IHE A;  3DM1 A;  1VF7 A;  4KY6 A;  4PMW A;  4R4I A;  4UP8 A;  1IKL A;  1I6H H;  4JVZ A;  4N8X 1;  1UEB A;  1KXL A;  3CU7 A;  1P16 A;  1EYD A;  1X6O A;  5M5X H;  4IFD J;  4DK6 C;  3GO5 A;  1QJO A;  1PFM A;  2N8N A;  5IGG A;  3X3N A;  1PRT D;  5ELN A;  1RIP A;  1FNU A;  2VQE L;  4LUO A;  1N34 Q;  4FP5 D;  4X65 L;  1F2Y A;  1SRU A;  4O2D A;  4BA2 I;  1VQJ A;  3SGI A;  2CKZ B;  1C48 A;  3A74 A;  1N8R C;  1JIC A;  1SE8 A;  3J7A V;  1HA6 A;  2K50 A;  3JAM i;  2OQK A;  3TDQ A;  4DV6 Q;  3NTH A;  1XPU A;  3R2T A;  4RGN A;  1TWC H;  2NVQ B;  2JE6 I;  3CRK C;  4C2M H;  5CR3 A;  4XYO A;  4QIW E;  4CHT B;  3CCV A;  5IP9 G;  4LF5 L;  3H0G B;  2K14 A;  1Q8K A;  3FVQ A;  3SK6 A;  4H02 A;  1G51 A;  1NY4 A;  3C46 A;  3SXH A;  4EQN A;  3RZO H;  1YJW A;  1V1P A;  1PTO C;  3K5O A;  1GUT A;  3JAM L;  1HNX L;  4N9T A;  1S40 A;  4LF9 Q;  4QL5 A;  5LL6 X;  4FXG C;  5K36 G;  1EU3 A;  4A3E G;  1VQE A;  1AE2 A;  1MIU A;  5ELE A;  3TSS A;  2IJ0 A;  2O5J C;  4YY3 Q;  4A3D B;  3D3R A;  5A2Q L;  2QW7 A;  3CRL C;  3CD6 A;  3MXU A;  3TRZ A;  2K03 A;  4IJH A;  1PTO H;  4RMF A;  5T1G A;  3A8K E;  5FKA C;  3Q8D A;  1KAA A;  2A69 D;  3PO2 H;  2NYZ D;  4PZ6 A;  2L11 A;  1LTG D;  2EQS A;  1SXT A;  4LF4 L;  4IUT A;  3ICE A;  5CBE E;  3PUZ A;  4DAY B;  1HR0 L;  1VQ7 A;  1IBL L;  1HZB A;  2F0W A;  4POF A;  4JV5 L;  2PW7 A;  5EJW A;  1B9N A;  2CW0 C;  4MNO A;  1OXT A;  1M8A A;  4HJ9 A;  2FIN B;  2NVY H;  3KDF A;  4K0K L;  1V43 A;  2L12 A;  3R3O A;  1SNC A;  4X62 L;  1XTD A;  1VQD A;  3I4N G;  2NN6 G;  1T5E A;  1NBW A;  3M9B A;  3UE1 A;  2WB1 E;  2GVA A;  3F8T A;  2I5H A;  3GTJ B;  1MHW C;  3PIP 3;  4OX9 Q;  3S2D B;  5IP9 H;  1CKO A;  1DZ1 A;  3HKZ G;  2NTS A;  3BJU A;  3W1B A;  2IHF A;  1WTV A;  3E0J A;  1EIH A;  2AUJ D;  3GTK B;  4JI7 Q;  4AH6 A;  2UXC Q;  1VQM A;  3S1M B;  1U4M A;  4OWT B;  1HTL D;  2PMZ E;  3VR2 A;  4GZY C;  1TWG B;  1IBK L;  4WOR A;  5I9O A;  1TVX A;  4A3E H;  4PZ7 A;  2X6L A;  3K80 C;  1Z47 A;  2A6E C;  1M90 C;  5ELB A;  1I3Q B;  3MHB A;  2QEX A;  1BCP F;  1SNO A;  5TSS A;  1BCP B;  4ULL A;  2K5Q A;  2A1A A;  5FO9 B;  3I73 A;  2QGQ A;  3S17 B;  3KF8 A;  1IW7 C;  2R93 G;  4OO1 H;  2ZJR A;  3S1N B;  2V4D A;  2E74 C;  5C4X B;  2V1C C;  1V1Q A;  1YJN A;  1QUQ A;  4CKB A;  4K6D A;  1NR4 A;  3A5Z B;  5HUR A;  5C0X G;  1JJG A;  1PH9 A;  3T1Y Q;  4U68 A;  1FL0 A;  2L0C A;  2ATW A;  1I4X A;  2RF4 A;  3DEP A;  4JBM A;  4A3I G;  2FMM A;  5COY A;  3VR4 A;  4ME3 A;  2RDH A;  3CF5 A;  1RJT A;  4DUY L;  2WP8 J;  3NEL A;  2NN6 H;  3W2D A;  3I4N H;  4TKO B;  1G2S A;  1Q90 A;  3ERQ A;  3U9O A;  3HOV G;  4C56 C;  5EKI A;  5M5W B;  2EXD A;  3G6E A;  2LY7 A;  5M5Y H;  2A74 C;  3MFG A;  1BO0 A;  1B44 D;  4QIW B;  5C4Z A;  1KIX A;  2EY1 A;  2IWH A;  3DWA A;  2K6A A;  2VUM B;  1ENA A;  4IO9 A;  4IUP A;  2WAC A;  1EIY B;  2D0P A;  3TP5 A;  2R7Z G;  1P8L A;  3H09 A;  5F2D A;  4RAU C;  4DV5 Q;  1A0I A;  1EIG A;  1EQT A;  1N34 L;  3CME A;  2AWO A;  3OYY A;  5KRU A;  1X3Q A;  5EKK A;  4FXK C;  2KHI A;  3HOW B;  2EY2 A;  4FNF A;  1UEA B;  1WTH A;  3BDO A;  1A3U A;  2DY7 A;  4XT1 B;  4QCL A;  2OT2 A;  2OTL A;  4K8I A;  5CV8 A;  1XMO L;  4K5V A;  4DA2 A;  1HTP A;  3D4W A;  2R93 H;  2X6G A;  1PH7 A;  4R4O A;  2OF1 A;  1LT5 D;  3BG3 A;  4ZK9 B;  1QCB D;  1CA6 A;  5C0X H;  2Q2T A;  1WCM B;  5LMN L;  2BE5 C;  2MGS A;  4HR7 B;  1XNR Q;  2JEA I;  1EUJ A;  1BQQ T;  3KLR A;  2NZH A;  2JA6 B;  1A3V A;  4A3I H;  1VMP A;  3I4L A;  1YBY A;  2E2J B;  1QG7 A;  2HHH L;  4YY3 L;  1L2F A;  3H0G G;  5JOB A;  1N32 Q;  1Y1W B;  3HOV H;  1LLR D;  2WB1 B;  1VQ4 A;  1TT2 A;  4H44 C;  4V19 0;  3M4Q A;  1HNW L;  2VB3 X;  1S5D D;  1EFI D;  1J9O A;  3MXP A;  5C44 B;  3OTO Q;  1QVF A;  2A6H C;  3H15 A;  3K7A B;  5FO8 B;  1U5K A;  4A3F B;  4L5R C;  1D2B A;  2UUB L;  4A3D G;  2R7Z H;  2F1M A;  1HZ9 A;  2PMZ B;  5C5M A;  2E2H H;  3S2H B;  3PIO 3;  1Y8O B;  3F2D A;  2F3W A;  5C3E G;  4DV7 Q;  2KHS A;  4MZ9 A;  4NW2 A;  3PO3 B;  2Z8L A;  3TBI B;  2PYK A;  4X3S A;  4JYA L;  1B3Q A;  1LUZ A;  4Y7N B;  2UUA Q;  5C4J H;  1IL8 A;  4IPC A;  1L0X B;  1YIT A;  3D0F A;  3WWV A;  4IZ8 A;  4A3L G;  1BOS A;  3FPP A;  3GTQ B;  2JA9 A;  1FVI A;  1PFS A;  4LK1 C;  2NUC A;  2MP1 A;  1CI3 M;  3GTG B;  3JC6 6;  2WAQ E;  4DV4 L;  5HY6 A;  1Z9F A;  1GD7 A;  1JOO A;  2ZTC A;  5IE8 A;  2RDF A;  1GUW A;  4C1N I;  1VQI A;  5GQO A;  1ML0 D;  2ZTD A;  3OW2 A;  4ALP A;  4LF6 Q;  2K4K A;  1HCZ A;  2QDL A;  2LXJ A;  5EPJ A;  5ELF A;  3H0G H;  3C2P A;  3CMA A;  4IPD A;  4G7Z C;  3MAQ A;  4JW0 A;  1KHI A;  1Y69 U;  2OEO A;  4KI0 A;  2D5D A;  2EY5 A;  2CVR A;  4QJF A;  1LM0 A;  3S1R B;  3QIA A;  4KTA A;  3SK8 A;  4YHH Q;  1CQV A;  2LFN A;  3MXG A;  3NBI A;  5IGD A;  3EBE A;  3AB9 A;  5DM6 3;  4FYD A;  4ID6 A;  4G7O C;  4R4Q A;  3VR5 A;  4A3D H;  1DON A;  1CHQ D;  1JOQ A;  1C4Q A;  1IL2 A;  2MO1 A;  5C3E H;  4HMJ A;  4KKT A;  2AUK A;  1A15 A;  1SEB D;  3HZX A;  4RG1 A;  3T53 B;  1Q86 C;  1EOV A;  5C4X G;  3R93 A;  4G57 A;  2R61 A;  1QE6 A;  1V1O A;  2RSN A;  2BH8 A;  1EU4 A;  1Y8N B;  4A3L H;  1SJH D;  2EYP A;  1V9P A;  5IT9 E;  2ZXO A;  2VB2 X;  3M7N A;  4IJL A;  1HQR D;  3NEN A;  1QVG A;  3KBG A;  2VQE Q;  1EL0 A;  1VQL A;  1G29 1;  4X65 Q;  1S5F D;  4DV5 L;  1CSQ A;  1K3R A;  1GUG A;  3A7A B;  3K81 C;  3CCJ A;  4YWM A;  1FR3 A;  1STA A;  3GTJ H;  2N55 A;  3S2D H;  3E9H A;  1CTM A;  4QY7 A;  3TQY A;  5DLQ E;  1ICF B;  3UDX A;  1YHQ A;  4XYQ A;  2DGY A;  1B3A A;  3DWP A;  3F2U A;  1EY4 A;  3GTK H;  3KJO A;  2KCN A;  1LT4 D;  3S1M H;  1RF2 D;  1NTG A;  2CHB D;  2KEE A;  3KBX A;  1Y1V B;  1K8G A;  3GP7 A;  3RD4 A;  1B2T A;  1TWG H;  4A3B B;  2SOB A;  2ICE C;  4MIU A;  4C3J B;  3BZK A;  2UXB L;  2ICI A;  2EYH A;  1QWY A;  3HOW G;  3HKS A;  2HCI A;  2XWJ B;  3A8I E;  3CPF A;  2NZO A;  1I3Q H;  4QB4 A;  4L6T B;  4WFN 3;  3BZC A;  1K0R A;  3I4O A;  1K83 H;  4R1J A;  4YCW A;  5KND A;  3S17 H;  3AMU A;  4BBR B;  1RTO A;  3AFP A;  4ZCK A;  3K0X A;  3UE0 A;  4DPG A;  5C4X H;  2H1E A;  3SK5 A;  1BDO A;  1HXY D;  3GTM B;  3J7Y W;  1X55 A;  2RHQ B;  3NP8 A;  1WCM G;  4LF4 Q;  2MQH A;  1ENC A;  1HR0 Q;  1IBL Q;  2K33 A;  4JV5 Q;  1J5E L;  1DOL A;  2JA6 G;  1QZG A;  1H9J A;  4I65 A;  4RGO S;  1VDZ A;  4K0K Q;  2K7V A;  3PF5 A;  1CZW A;  1NUC A;  4C3H B;  1XXG A;  4X62 Q;  5BR8 L;  4QMG A;  1Y1W G;  3I8Z A;  2MO0 A;  2WB1 G;  4K8J A;  1SMY D;  2F0H A;  5M5W H;  1YNX A;  2J0T D;  3T13 A;  4XQQ A;  3I72 A;  1W6J A;  1YNJ C;  4R4C A;  1VQ6 A;  5C0X J;  3K57 A;  1WTP A;  1Y14 B;  4OEL B;  4RHS A;  1AW7 A;  3CPW A;  1F9Q A;  1KAB A;  5C44 G;  3BYY B;  2MNA A;  1F2Z A;  2F0G A;  1FGB D;  4UP7 A;  3L7Z C;  1ZYR C;  1B9M A;  4PZ8 A;  2A8V A;  2AMC B;  3TME A;  2GVB A;  4A3F G;  3BDC A;  1A8V A;  4YCV A;  4I7A A;  2R92 B;  4LFA L;  3NEM A;  1X3G A;  4KY5 A;  3TS0 A;  1PFN A;  1PH6 A;  1RCV D;  2Z4I A;  4A3K H;  5LMN W;  4GKJ L;  1HA5 A;  3HOW H;  1X54 A;  3M85 A;  2UU9 L;  3PO3 G;  4ABN A;  2O4X A;  3S24 A;  1QOH A;  2QF7 A;  1LTS D;  2BCO A;  3NXW A;  1BBU A;  3MA2 B;  2E2I B;  4QGU A;  4A4I A;  2KCC A;  2KJX A;  3RMH A;  1B4O A;  1H9S A;  1GO3 E;  2UXD L;  2TMP A;  1NNX A;  4DAM A;  1PA6 A;  4JI2 L;  2NN6 I;  5J1Z A;  4DFA A;  3CCL A;  2F0N A;  3N6R A;  1WCM H;  3OWF A;  1WFQ A;  4KN7 C;  2JA7 H;  3EN2 A;  3ND8 A;  1F9R A;  1BXT A;  2K52 A;  4YHH L;  3S14 H;  5C3X A;  3T16 A;  3FEW X;  4DV2 L;  4F88 A;  2LS0 1;  4KV6 A;  4GNX A;  1O7Z A;  2EY6 A;  2HD3 A;  1Y1W H;  4DUY Q;  4PMB A;  2PO4 A;  3DXJ C;  2JSO A;  1PH3 A;  2KBN A;  3BVG A;  4LJZ C;  1SDF A;  3E5S A;  5ELC A;  1GUO A;  1YHA A;  4PQX A;  1L0Y B;  1QNU A;  3X3M A;  1SND A;  1DYQ A;  4IUN A;  4RWS C;  4RCN A;  5C44 H;  1ESF A;  2ENB A;  2DJG C;  3F1Z A;  2IY5 B;  3PMF A;  5CYU A;  1AH9 A;  3K7A H;  1W6K A;  2FJ2 A;  2Z1C A;  3ER0 A;  5GAG C;  2DY8 A;  4GN3 B;  4A3F H;  3N52 A;  1TS3 A;  3NSW A;  1VMC A;  1N9W A;  3S2H H;  4B08 A;  4IPG A;  2KCM A;  3EJI A;  1I50 B;  3LGJ A;  4GOP C;  3P75 A;  4B3T Q;  3NBH B;  3PO3 H;  1SMX A;  4KHV A;  2F0V A;  3URY A;  3WOE A;  5C0X I;  3AU7 A;  3PQI A;  5FOB B;  2A68 D;  2I0Q A;  2LSS A;  4ZYS A;  3HOY G;  2EVB A;  2B2W C;  1S5C D;  1SBB B;  3CC4 A;  3W3A A;  4YCU A;  4ZUJ A;  1XMO Q;  3FMC A;  3GTQ H;  3HOZ B;  3CCE A;  2F0Q A;  1TII D;  2A5H A;  4MHE A;  4IAL A;  4EQ5 A;  4R4T A;  4OHJ A;  4MTN A;  2HUG A;  3GTG H;  3KOJ A;  1EYC A;  5E7N A;  2CCZ A;  1H9K A;  4CKC A;  2SNM A;  1O80 A;  1NMG A;  1Z6H A;  4UDU C;  1L1O B;  3RLN A;  3J81 E;  5I4D A;  1PH8 A;  2IX1 A;  3FPU B;  2B8G A;  3KF6 B;  1STE A;  3IL8 A;  3QG1 A;  5LMN Q;  4DK1 A;  1O7I A;  1G6P A;  4HJ5 A;  3HOX B;  4LF7 L;  4RHR A;  2G9D A;  4FO2 A;  5J39 A;  1M4V A;  3A54 A;  3E0E A;  3MXN B;  2F0U A;  2CW0 D;  4JG2 A;  1YHB A;  2K32 A;  3L9A X;  4GOP A;  2HHH Q;  1ENF A;  1C0A A;  1ICW A;  1E0B A;  2AKW B;  2XNA C;  3RLF A;  1N33 L;  1VQO A;  2VNU D;  5GAE C;  5KYI A;  4YWK A;  4J1M A;  5KYL A;  1XNQ Q;  3S9W A;  3K8A A;  2OTJ A;  1HNW Q;  1GUN A;  3CKI B;  1Y1V G;  2ZT9 C;  2RCF A;  1TWH B;  4A3B G;  3KLS X;  4C3J G;  2MHV A;  2K5D A;  4CKE A;  1CK1 A;  4ME5 A;  2Q8I B;  1NE3 A;  1TWF B;  3UDG A;  4LFC L;  2UUB Q;  4M1U B;  2Z6K C;  3VYU A;  1K8M A;  1X32 A;  2C5C A;  1X56 A;  4BBR G;  3WOF A;  1UUP A;  2O5I C;  2JA8 B;  3HOY H;  1OXU A;  4DR6 L;  4WJ3 M;  1YNN D;  2A6E D;  5K5P A;  3JAM E;  3EVQ A;  4IOA A;  4H0L C;  3PF4 A;  4JYA Q;  1KAW A;  1VQ9 A;  4JCV E;  1VCI A;  1XX8 A;  5EBC A;  3D4D A;  1SN8 A;  2ZXP A;  4DR1 L;  2JA5 B;  4Q5V A;  4JBK A;  4JI5 L;  2F0P A;  1MKH A;  1IW7 D;  1T9H A;  2H4O A;  2WIN B;  1SYD A;  4C3H G;  2WAQ G;  3I91 A;  4NKL A;  4L5S A;  1WJJ A;  3A0J A;  3ND9 A;  2CQO A;  4DV4 Q;  2A69 C;  1CKM A;  5M3F B;  2XN9 C;  4B3M L;  5L37 A;  1K3B C;  5K36 H;  2Y0S E;  2LMC B;  2Z6K A;  5DNF A;  2MJ8 A;  3U50 C;  3CCM A;  2KHJ A;  1ILP A;  2Q2H A;  4OEM B;  3STB C;  4BBS B;  1CUK A;  1E22 A;  1YI2 A;  1UE6 A;  4TVA B;  4JOI C;  3QB3 A;  3S1Q H;  4FVM A;  4XQN A;  1MSH A;  1Y1V H;  4A3C G;  2XTI A;  1STB A;  4A3B H;  1F2L A;  3D4R A;  4C3J H;  4X66 L;  1FYC A;  1PLF A;  3GTP H;  2NTT A;  4DAV A;  4BXX G;  2VZA A;  5I2X A;  3CQZ B;  2OQ0 A;  3V05 A;  4KLK A;  1B1Z A;  1EIF A;  3GTO B;  3MFY A;  1H9R A;  4GKK L;  3NPP A;  1E2W A;  4P71 A;  1HPC A;  2JXM B;  4BBR H;  3M7G A;  2ZJP A;  3CC2 A;  3KLW A;  3MC0 B;  3DMU A;  2D62 A;  4F8M A;  4ZLT F;  3CXC A;  1O78 A;  3D6C A;  3OWE B;  3RZD B;  1KLG D;  3HRZ C;  1UWV A;  1U4R A;  1Q46 A;  2MPM A;  4JOI A;  5JEA G;  3MEF A;  3HFZ B;  5EPL A;  1GHJ A;  4J15 A;  3W1G A;  1E1T A;  2Z4H A;  1RTN A;  1ASY A;  1BVS A;  4PG3 A;  4C3H H;  2YYZ A;  3S15 H;  2RBM A;  4NDX A;  5IGE A;  3EIV A;  4BY1 B;  1NMF A;  2F0D A;  5E4W C;  1QZH A;  3K5M A;  1YIJ A;  2I5L X;  3NK9 A;  4V0B A;  2EPB A;  2DJF C;  4Z9C B;  1I94 L;  3H3V C;  4B3T L;  3KJP A;  2BE5 D;  2F0E A;  3GTL H;  4OWW B;  4KKU A;  1KQS A;  3GD7 A;  5IYD G;  1A3T A;  5JJL A;  1QIL A;  1CKN A;  3M3Y B;  4BA1 I;  1SFO B;  5GAD C;  4ZRZ A;  1JC7 A;  1SLJ A;  3M4O B;  4A3M B;  2KVM A;  1DD2 A;  1PYW D;  3TZD A;  3K59 A;  2SDF A;  2HDM A;  4A3C H;  4RCO A;  4HTH A;  5LMU L;  3QR8 A;  3H3V H;  2E8G A;  2PQA B;  2EYF A;  2RCN A;  2UXB Q;  2L4N A;  4BXX H;  3T51 B;  2HIX A;  1AZQ A;  2VS1 A;  3MEH A;  5CV7 A;  3Q22 A;  3F2C A;  1IYJ B;  1L0W A;  1KL9 A;  1R4P B;  1JE5 A;  1STY A;  2A6H D;  2BH2 A;  1DOM A;  2E2I H;  2EYJ A;  1ONL A;  1SE2 A;  2QA4 A;  2D0O A;  1Q3L A;  3HOZ G;  3ULP A;  2BDO A;  3IAY A;  3AYH B;  3UDI A;  1VF5 C;  3BYT B;  1SE3 A;  1TWA B;  5CMD A;  5T1I A;  1XNQ L;  2NBF A;  1UAP A;  1JE4 A;  2PZW A;  3RUZ A;  5G3L D;  1D5X C;  4NMZ A;  3I56 A;  4AQY L;  2YTV A;  3PGZ A;  1R9T B;  1FNW A;  5JEA H;  1DCZ A;  1WD0 A;  3TP8 A;  3VA5 A;  4DXG A;  1J5E Q;  1KNE A;  4IFD G;  1BBW A;  3U4Z A;  1S72 A;  3FHW A;  5BR8 Q;  5A35 A;  2K5V A;  1IBM Q;  2K5H A;  1WI5 A;  4EGV A;  4N9P A;  1PZJ D;  2Y0S B;  4JI3 L;  2PNR C;  4ODG A;  4NP5 A;  5IYD H;  4JPB W;  1I6H B;  4WJ4 A;  5IWA L;  1DGS A;  4GLV B;  3L0O A;  1VQ8 A;  1VQF A;  1RD9 D;  3I4M B;  2EOT A;  1PH4 A;  1EWI A;  4NXM L;  3G7L A;  4RGM A;  2Q8T A;  3VR3 A;  5IOC A;  1Q1B A;  4LFA Q;  3SR1 A;  4DU9 A;  3W5O A;  1I50 H;  1QNK A;  4OIK A;  2BA1 A;  1L1O C;  4GKJ Q;  3NUC A;  2JEB I;  2E2D C;  2F0I A;  2CQA A;  2UU9 Q;  2JA8 G;  5FK9 C;  2ZM6 L;  1I4Q A;  1EZ8 A;  1G91 A;  3CCR A;  2F3V A;  2NVQ H;  3G6J B;  2JJQ A;  4A3G B;  1JQY D;  4DV3 L;  3HOZ H;  3SVM A;  1BKB A;  2FXQ A;  3BDL A;  2AQ2 B;  2UXD Q;  4JI2 Q;  1JB3 A;  1C8C A;  2JP1 A;  4CJ2 C;  4JI1 L;  4UAI A;  1F77 A;  2MFI A;  2F4V L;  4IQZ A;  4IN3 A;  4K14 A;  5M3F G;  3HS0 C;  1EQQ A;  4DV0 Q;  1KRT A;  3QOL A;  5JVG 3;  5ISR A;  2H5X A;  4DV2 Q;  4FF4 A;  2M9V A;  3KFU A;  1SNQ A;  1PRT F;  4BBS G;  1GKH A;  1PRT B;  1L1O A;  2WKC A;  2XWB B;  3KF6 A;  3QJY A;  4BWG B;  4WJW A;  5DEH A;  3KDF B;  1IZ6 A;  1WTX A;  4JI6 L;  2YV5 A;  1UE7 A;  4HSV A;  3PO2 B;  3OIQ A;  1LT3 D;  4XDX A;  2QEJ C;  4ILW A;  2F0J A;  5D65 A;  2QIL A;  3SDZ A;  2F0M A;  5GAH C;  1GUS A;  1S5B D;  4DNT B;  1LV9 A;  5EGT A;  1TWF H;  5LHY 1;  4K5X A;  2NVY B;  1PMR A;  2F03 A;  4WRD A;  2KUM A;  1UE1 A;  4QQB X;  5IP7 G;  4UPA A;  4DK3 C;  1SR3 A;  3DHQ A;  1PH2 A;  2DNC A;  2F0S A;  2NVX B;  4DAY A;  2JA8 H;  3I2Z A;  2PZU A;  4OGQ C;  3BU2 A;  1TXY A;  2B8F A;  1D5Z C;  4C3I B;  3OSO A;  3EA6 A;  4JI4 L;  4DAP A;  2KED A;  2R7F A;  1PDQ A;  1GXD C;  2B2T C;  1WTW A;  2N3S A;  2VUM G;  3I90 A;  1BCP C;  5IT9 c;  3OMC A;  3EFX D;  4LMQ D;  1CA5 A;  1V8Q A;  4A93 B;  3UI2 A;  4DR3 Q;  4F7X A;  4BY1 G;  3UDF A;  2DUD A;  2JN4 A;  2PI2 A;  3KF8 B;  4DF7 A;  5M3F H;  5IGB A;  1GHK A;  1IYU A;  4BS9 A;  1QUQ B;  3OOC A;  1J8I A;  4LF7 Q;  2ALY B;  3EQL C;  4L5T A;  4BBS H;  3NTI A;  3OMG A;  3CP0 A;  4LUZ A;  5GRO A;  2B2Y C;  2NWG A;  4HIM A;  1N33 Q;  4A3M G;  1PZK D;  4G4K A;  3ERO A;  3S1N H;  2B2V C;  2A73 B;  3Q24 A;  3PUX A;  2F0F A;  1BBX C;  3IRB A;  4TRD A;  3PCO B;  1WTQ A;  1E2V A;  3R8B A;  1YNJ D;  3Q0A A;  2F0O A;  2B2T A;  4DR5 L;  2YTY A;  3CQZ H;  1U9R A;  2N88 A;  3KUP A;  3OIP A;  3VYS A;  5KNC A;  1XTC D;  2AQ3 B;  5CV4 A;  4APV A;  2EJF C;  4YWL A;  3RN5 A;  5IP7 H;  3I3C A;  1YZ6 A;  5CV5 A;  1XJV A;  3GTO H;  3ULJ A;  3LWU A;  2RHS B;  4LFC Q;  1ROD A;  3I4N B;  4LFB L;  2DNE A;  4AYB E;  4RH6 A;  3V96 A;  1IBM L;  3RLO A;  3RZD H;  1SRO A;  3ZJY C;  4CDD C;  4DR6 Q;  1ESR A;  5IYB G;  4B9W A;  2B2Y A;  3SK4 A;  2ZXR A;  4DN4 M;  3VR6 A;  1G6Z A;  1JWM D;  3WDN A;  3U58 A;  2B2V A;  1Q81 C;  2VUM H;  4DR1 Q;  2Z6B A;  2Q8R E;  4JI5 Q;  2GA4 B;  1PH1 A;  4BY1 H;  3P20 A;  2Q2I A;  2YU9 B;  2NZ1 D;  4JI0 L;  5E4X A;  2QCP X;  1PFB A;  4CDE C;  1W2B A;  1XWE A;  2K05 A;  1ILQ A;  2M2L A;  1HRJ A;  3NQI A;  2B2U C;  4KHP L;  4B3M Q;  2Y0S G;  3FRP B;  5EKL A;  4XTC S;  5EPK A;  1X3F A;  3BVZ A;  5JEA J;  2K04 A;  3J81 j;  3A7L A;  1MSG A;  4ZKB B;  3M3Y H;  1X3E A;  1S3O A;  1KDB A;  5FLM G;  1VQG A;  1SFO H;  5JPN C;  2L1B A;  3I4M G;  2R93 B;  4A3M H;  3R2I A;  4X64 L;  3V2T A;  3AQQ A;  1SYF A;  4A76 A;  1J6Q A;  3I7F A;  3QOJ A;  1T5X D;  1C9O A;  4JC0 A;  1VQA A;  1XPO A;  5J3B A;  4X66 Q;  5H1S E;  2KCT A;  5IYC G;  4DK0 A;  1R4Q B;  4DV0 L;  1HJP A;  4A3I B;  1JJC B;  1E24 A;  2JA6 H;  4RKB A;  1VQB A;  2EE1 A;  2YTX A;  4A3G G;  5HGT A;  2E2J H;  3HEJ A;  1KC8 C;  2FFK B;  2CH4 W;  4GKK Q;  1EWH A;  2B2U A;  4JBJ A;  4P75 A;  3K5N A;  1KRS A;  2D9U A;  5JJK A;  4JI8 L;  4UP9 A;  1CSP A;  3LNN A;  1TY0 A;  3VYT A;  5HGQ A;  3PV0 A;  5FJ8 G;  5IYB H;  2NB0 A;  1R9T H;  4DKA C;  3MVV A;  2EDG A;  4HAE A;  1EQR A;  2PQE A;  4LNQ A;  3F2B A;  3VA7 A;  3C3L A;  1EQV A;  4JK1 C;  4QUF A;  2OWO A;  3ULL A;  4JBW A;  1DXM A;  1MJC A;  2D2C C;  1HNZ L;  2R7Z B;  2E2H B;  3T4A C;  4KD3 A;  5E1F A;  5C3W A;  4HID A;  3HG9 A;  2VL6 A;  3RN2 A;  2RKS A;  4DNR B;  1WTR A;  1CM9 A;  3FP9 A;  4QF4 A;  1FNV A;  1PTO D;  3H3V I;  1I94 Q;  1BNZ A;  1LT6 D;  1G8Z D;  3PO2 G;  3GV3 A;  5FLX E;  5C4J B;  4Y7N H;  5FLM H;  2F0K A;  3OHX C;  3I4M H;  2ZTE A;  2B29 A;  1KD1 C;  1PZI D;  5ELD A;  4J6H A;  3E6Z X;  5IGC A;  2RDG A;  4HED A;  5LMU Q;  4RFB A;  5COR A;  2F0T A;  4DR3 L;  5G3L F;  5E3F A;  4RGT A;  4F87 A;  3J80 E;  1JWU D;  4CDF C;  2K01 A;  5IYC H;  4N8F A;  2E75 C;  5I2Y A;  1YJ9 A;  1MBY A;  1SNP A;  1SYE A;  3TEH B;  2P5Z X;  4DXF A;  1GVP A;  2NVT B;  4P2C B;  4KD4 A;  1HZC A;  1Q12 A;  1U4P A;  1HQM C;  3L3O C;  3P7J A;  5FLX c;  4A3G H;  1LO5 D;  4C3I G;  5CV6 A;  1CQF A;  4RA8 A;  5D3I B;  1JMC A;  4AYB B;  2K75 A;  4X3K A;  1PRT C;  2I07 B;  5JAV A;  1OXV A;  1I4R A;  1TY2 A;  3NQT A;  5D14 A;  3D8G A;  1A62 A;  1OO9 B;  4A93 G;  1XPR A;  1PH5 A;  5FJ8 H;  2B2W A;  1BUV T;  2HIV A;  4DR2 L;  3J81 c;  1NR2 A;  3J80 c;  3TRE A;  2A68 C;  2K1B A;  3S1R H;  1TS2 A;  4AQY Q;  1LTT D;  1IHZ A;  3OW7 A;  3TP7 A;  5M9O A;  2R6G A;  2AQ1 B;  1VQH A;  4DV1 L;  3CC7 A;  1WD1 A;  3T56 B;  1FJG L;  4GN5 A;  2LKV A;  4DGZ A;  3TP6 A;  5C3E B;  4OO1 G;  4KK7 A;  4OIJ A;  2XRQ D;  4R8N A;  2SNS A;  1LAB A;  3DWQ A;  1U4L A;  4JI3 Q;  2N49 A;  2FMC A;  1KDC A;  4HJ8 A;  1JT8 A;  3H91 A;  2B3G A;  4NXN Q;  5IWA Q;  4NB3 A;  4P72 A;  1PV4 A;  1HFG A;  3STB D;  5IIF A;  1NAP A;  3Q23 A;  4K2L A;  3AEV A;  4NXM Q;  3SHL A;  4DR4 L;  2JYO A;  4H7B A;  4PV1 C;  5I6Y A;  5EQ0 A;  1D1K A;  2WII B;  3I70 A;  5A2Q E;  1B53 A;  4HJ7 A;  5EAY A;  1MJE A;  3HOU B;  2NVX H;  3J7Z C;  2OXP A;  3PIP A;  2Q2U A;  1MI2 A;  5IGF A;  5JPM C;  2ZM6 Q;  1AFP A;  1PVO A;  2CWP A;  4C3I H;  2PZT A;  1XYI A;  5M3M B;  3JAM c;  4IFD I;  5AJ3 L;  2ES2 A;  4DV3 Q;  4CJ1 B;  2BA0 A;  4I7Z C;  3B6Y A;  3ZYY X;  1D8L A;  2HT1 A;  3PSI A;  4A93 H;  5J22 A;  4E6I A;  2R92 G;  3TN2 A;  2QKI C;  4HJA A;  5IY0 A;  1BR9 A;  1S4Z A;  4KN4 C;  2WKD A;  4JI1 Q;  1LYL A;  4LF8 L;  2F4V Q;  1YNN C;  2K5W A;  3H94 A;  4X3U A;  3J7A 5;  1I5F A;  3NTK A;  3A55 A;  1I4P A;  4RKL A;  3K5L A;  1YVC A;  2I46 A;  1EOT A;  5I9P A;  1K83 B;  4XXE A;  1TR5 A;  1F2M A;  2ID0 A;  3NE5 B;  5BN4 A;  4TSS A;  1FD7 D;  1H95 A;  4OWX B;  4JI6 Q;  4IPH A;  1PYS B;  2QDB A;  1N36 L;  3D31 A;  3GTM H;  2UUC L;  3FDT A;  3NWS A;  1B70 B;  4KJO A;  4B3S L;  3T1H L;  1VQK A;  3G71 A;  3ERS X;  3KYH C;  3MWY W;  5AFW A;  2E5L L;  1TKW B;  4FF2 A;  1SYG A;  4B9X A;  3HGB A;  4GS3 A;  2E76 C;  3CW2 C;  2BDN A;  2K28 A;  3AFQ A;  4IUQ A;  3FKI B;  5JJZ A;  1EY5 A;  1G2T A;  1VQC A;  1WVL A;  3RNU A;  1A6X A;  4OXP A;  4CJ0 B;  1UNS A;  1Z7T A;  4AIM A;  4L5Q A;  4KKS A;  5DAU A;  2TSS A;  1K8O A;  4JI4 Q;  1SYC A;  4OL7 A;  3L2P A;  1B8A A;  3CCQ A;  2CH4 A;  4EQP A;  2F3I A;  3H6M A;  1CT1 D;  2R92 H;  2YU9 H;  1H9S B;  1UE5 A;  4A3K B;  2CWA A;  4GLX A;  1WYD A;  2ZJQ A;  1STN A;  4DV6 L;  4R8I A;  2VW9 A;  1H9M A;  3MZ5 A;  4BY7 B;  5EBD A;  1VQP A;  2KEC A;  3CHB D;  4DUZ Q;  2XVS A;  3CAM A;  5LL6 S;  3ITP A;  1JR0 D;  5KNB A;  1B7Y B;  3GDE A;  3K58 A;  4Y52 H;  3G4S A;  1HUM A;  2OCE A;  1MD2 D;  4ZQ3 A;  1Q7Y C;  4GNX B;  1CZG A;  4J8Q A;  4M8A A;  4EVO A;  5CV9 A;  4UY8 C;  1F9P A;  4FXD A;  1EFW A;  3P1H A;  1PXU A;  5BN3 A;  2JA7 B;  2B63 B;  1E2Z A;  4LF9 L;  2C35 B;  4KY7 A;  4DR5 Q;  3S14 B;  2WV6 D;  4CBV A;  2R7D A;  3HOX G;  4A3J B;  2HQE A;  3S16 B;  2XRS D;  1JOK A;  2KEN A;  1KLU D;  2L15 A;  1SJE D;  1SE4 A; 
#chains in the Genus database with same CATH homology
 2EYM A;  2EYO A;  5I6W A;  1LTA D;  1STH A;  4LAA A;  2RSO A;  1NSN S;  2IX0 A;  1ZEQ X;  1WTO A;  1SNM A;  3GQB A;  4EQO A;  2IX3 A;  1SAP A;  5M5X B;  1KTK A;  5C6A A;  1F9S A;  1EYA A;  4KMU C;  2HDL A;  3VYR A;  1EY8 A;  1V1P B;  4TQU S;  3QO2 A;  4K2K A;  1TWC B;  4KJN A;  2X69 A;  3D6W A;  4C2M B;  4QUC A;  1B50 A;  2AWN A;  2RQX A;  3A8J E;  3NBH A;  3RZO B;  1IYV A;  2DN8 A;  2L9H A;  5C5L A;  1DOK A;  4O42 A;  4HSP A;  5IT9 L;  1TU2 B;  2EYL A;  4R9W A;  4O1N A;  4IFD H;  4KHZ A;  3K6O A;  1QB5 D;  4U67 3;  1HFN A;  4HCE A;  1ZKO A;  5JVH 3;  1PTO F;  1PTO B;  2EXZ A;  3DUZ A;  1NCV A;  5KGU A;  3BZD B;  2IL8 A;  4MN3 A;  3MXN A;  3QWN A;  1I4H A;  1O7Y A;  2J7Z A;  4L8J A;  3K0Y A;  4ZAI A;  2C9O A;  1ET6 A;  2HCC A;  1JCK B;  1BCP D;  3BVM A;  4HCS A;  2F4I A;  1HHV A;  3IFD A;  2KA7 A;  2J4X A;  4IUV A;  1CHP D;  5DM7 3;  3J7A F;  3HOY B;  2O2L D;  1AZP A;  1STG A;  1O7L A;  1S5E D;  2SEB D;  1D5M C;  1LAC A;  1EWC A;  3HP3 A;  3TZU A;  4L63 B;  1JOR A;  2IW3 A;  1RDP D;  1A2T A;  1RHP A;  1I4G A;  2M00 A;  1LTB D;  2FHT A;  3LX0 A;  1ET9 A;  3PUW A;  1EY7 A;  2PCF B;  4XQJ A;  1LTI D;  1CFM A;  4H13 C;  1IKM A;  2MUY A;  4A3E B;  2IPK D;  4IUR A;  4PNY A;  4G7H C;  3M4Y A;  2EZV A;  1AN8 A;  1EZ6 A;  1X3P A;  3S1Q B;  3ONA B;  3PUY A;  2L5T A;  2KOL A;  1II3 A;  4K6L A;  3GTP B;  1A2U A;  1DJR D;  2XSC A;  3SE0 A;  1ZYR D;  1KNA A;  3Q6S A;  4HMI A;  3C1F A;  4Q0F A;  1MGS A;  2F0L A;  4XT3 B;  2XIW A;  5FO7 B;  3DEO A;  4C1N K;  4CGY B;  1LTR D;  5NUC A;  5M5Y B;  2G9H D;  3O13 A;  1AP0 A;  3HKZ B;  5CC4 A;  1D1I A;  2PW5 A;  3SEB A;  4ZKC B;  1EEI D;  3S15 B;  2WAQ B;  1RKN A;  1TS5 A;  3NWT A;  4YIJ A;  2PPB C;  1Q1E A;  1HUN A;  5KIX A;  1SSO A;  1SYB A;  3IFT A;  1EY0 A;  5CGK A;  2IT1 A;  5CBA E;  2L55 A;  5BN5 A;  1AEX A;  3GTL B;  2RA4 A;  4IUU A;  1EEF D;  3C1E A;  1OXX K;  1Y8P B;  3KK7 A;  2BOS A;  2KQ3 A;  3GV6 A;  3OPO A;  4FF1 A;  2RVL A;  4OO1 I;  2B39 A;  1SMY C;  1GOZ A;  1TQO A;  1D6E C;  5C4H A;  4HN7 A;  1DM0 B;  1KDA A;  1BF4 A;  3BS1 A;  1I6V C;  5D3D A;  4FF3 A;  1ZXT A;  3IKJ A;  3A56 A;  1Q8I A;  4X3T A;  2R3Z A;  1EY6 A;  1EY9 A;  3HOV B;  4XIG S;  4K5W A;  2VXW A;  3PUV A;  3MTS A;  4ZUI A;  2EJM A;  5FLX L;  4PMC A;  1TS4 A;  1JWS D;  4S3S A;  3NHH A;  3U9S A;  3KLS A;  3J81 L;  2EJG C;  3J80 L;  1GJX A;  3LWE A;  5KEE A;  1OXS C;  5IOD A;  3DM1 A;  1VF7 A;  4KY6 A;  4PMW A;  1IKL A;  3CU7 A;  1EYD A;  4IFD J;  3GO5 A;  1QJO A;  1PFM A;  5IGG A;  3X3N A;  1PRT D;  1FNU A;  4FP5 D;  1F2Y A;  4BA2 I;  1C48 A;  1JIC A;  3J7A V;  1HA6 A;  3TDQ A;  3NTH A;  3R2T A;  4RGN A;  2NVQ B;  2JE6 I;  3CRK C;  5CR3 A;  4XYO A;  4CHT B;  3H0G B;  3FVQ A;  3SK6 A;  3C46 A;  3SXH A;  4EQN A;  1V1P A;  1PTO C;  3K5O A;  1GUT A;  3JAM L;  4N9T A;  5LL6 X;  4FXG C;  5K36 G;  1EU3 A;  5ELE A;  3TSS A;  2IJ0 A;  2O5J C;  4A3D B;  3D3R A;  5A2Q L;  3CRL C;  3MXU A;  2K03 A;  1PTO H;  5T1G A;  3A8K E;  5FKA C;  1KAA A;  2A69 D;  2NYZ D;  2L11 A;  1LTG D;  1SXT A;  4IUT A;  5CBE E;  3PUZ A;  2F0W A;  2PW7 A;  5EJW A;  1B9N A;  2CW0 C;  1OXT A;  1M8A A;  2FIN B;  1V43 A;  2L12 A;  3R3O A;  1SNC A;  2NN6 G;  1T5E A;  3GTJ B;  3PIP 3;  3S2D B;  1DZ1 A;  2NTS A;  1WTV A;  3E0J A;  1EIH A;  2AUJ D;  3GTK B;  3S1M B;  1U4M A;  1HTL D;  3VR2 A;  4GZY C;  1TWG B;  4WOR A;  5I9O A;  1TVX A;  2X6L A;  1Z47 A;  2A6E C;  5ELB A;  1I3Q B;  3MHB A;  1BCP F;  1SNO A;  5TSS A;  1BCP B;  4ULL A;  2K5Q A;  5FO9 B;  3I73 A;  3S17 B;  3KF8 A;  1IW7 C;  4OO1 H;  3S1N B;  2V4D A;  2E74 C;  5C4X B;  4CKB A;  4K6D A;  1NR4 A;  5HUR A;  5C0X G;  4U68 A;  2L0C A;  1I4X A;  3DEP A;  2FMM A;  5COY A;  3VR4 A;  2RDH A;  1RJT A;  2WP8 J;  2NN6 H;  3W2D A;  4TKO B;  1G2S A;  1Q90 A;  3ERQ A;  3U9O A;  4C56 C;  5EKI A;  5M5W B;  2LY7 A;  2A74 C;  3MFG A;  1BO0 A;  1B44 D;  4QIW B;  5C4Z A;  2EY1 A;  2IWH A;  3DWA A;  2K6A A;  2VUM B;  1ENA A;  4IUP A;  2WAC A;  3TP5 A;  3H09 A;  5F2D A;  4RAU C;  1EIG A;  1EQT A;  2AWO A;  5KRU A;  1X3Q A;  5EKK A;  4FXK C;  3HOW B;  2EY2 A;  4FNF A;  1UEA B;  3BDO A;  1A3U A;  2DY7 A;  4XT1 B;  4QCL A;  2OT2 A;  4K8I A;  5CV8 A;  4K5V A;  4DA2 A;  1HTP A;  3D4W A;  2X6G A;  2OF1 A;  1LT5 D;  3BG3 A;  4ZK9 B;  1QCB D;  1CA6 A;  5C0X H;  1WCM B;  2BE5 C;  2MGS A;  4HR7 B;  2JEA I;  1BQQ T;  3KLR A;  2JA6 B;  1A3V A;  1VMP A;  3I4L A;  2E2J B;  1QG7 A;  5JOB A;  1Y1W B;  1LLR D;  2WB1 B;  1TT2 A;  4H44 C;  4V19 0;  2VB3 X;  1S5D D;  1EFI D;  1J9O A;  3MXP A;  5C44 B;  2A6H C;  3K7A B;  5FO8 B;  4A3F B;  1D2B A;  2F1M A;  5C5M A;  2PMZ B;  3S2H B;  3PIO 3;  1Y8O B;  2F3W A;  2KHS A;  4NW2 A;  3PO3 B;  2Z8L A;  3TBI B;  2PYK A;  4X3S A;  4Y7N B;  1IL8 A;  1L0X B;  4IZ8 A;  1BOS A;  3FPP A;  3GTQ B;  4LK1 C;  2NUC A;  2MP1 A;  1CI3 M;  3GTG B;  1JOO A;  2RDF A;  1GUW A;  4C1N I;  1ML0 D;  1HCZ A;  5EPJ A;  5ELF A;  3C2P A;  4G7Z C;  3MAQ A;  1Y69 U;  2OEO A;  4KI0 A;  2D5D A;  2EY5 A;  2CVR A;  3S1R B;  3QIA A;  4KTA A;  3SK8 A;  1CQV A;  2LFN A;  3MXG A;  3NBI A;  5IGD A;  3AB9 A;  5DM6 3;  4FYD A;  4ID6 A;  4G7O C;  3VR5 A;  1DON A;  1CHQ D;  1JOQ A;  1C4Q A;  4HMJ A;  4KKT A;  2AUK A;  1A15 A;  1SEB D;  3HZX A;  3T53 B;  3R93 A;  4G57 A;  2R61 A;  1QE6 A;  1V1O A;  2RSN A;  1EU4 A;  1Y8N B;  1SJH D;  2EYP A;  5IT9 E;  2ZXO A;  2VB2 X;  3M7N A;  1HQR D;  3KBG A;  1EL0 A;  1G29 1;  1S5F D;  1GUG A;  3A7A B;  1FR3 A;  1STA A;  2N55 A;  1CTM A;  4XYQ A;  1B3A A;  3DWP A;  3F2U A;  1EY4 A;  2KCN A;  1LT4 D;  1RF2 D;  2CHB D;  2KEE A;  3KBX A;  1Y1V B;  3GP7 A;  3RD4 A;  1B2T A;  4A3B B;  2SOB A;  2ICE C;  4MIU A;  4C3J B;  2ICI A;  2EYH A;  1QWY A;  2HCI A;  2XWJ B;  3A8I E;  4QB4 A;  4L6T B;  4WFN 3;  5KND A;  3AMU A;  4BBR B;  1RTO A;  2H1E A;  3SK5 A;  1BDO A;  1HXY D;  3GTM B;  3J7Y W;  3NP8 A;  1ENC A;  2K33 A;  1DOL A;  1H9J A;  4I65 A;  4RGO S;  1VDZ A;  2K7V A;  1CZW A;  1NUC A;  4C3H B;  1XXG A;  4QMG A;  3I8Z A;  4K8J A;  1SMY D;  2F0H A;  2J0T D;  3T13 A;  4XQQ A;  3I72 A;  1W6J A;  1YNJ C;  5C0X J;  3K57 A;  1WTP A;  4RHS A;  1AW7 A;  1F9Q A;  1KAB A;  3BYY B;  1F2Z A;  2F0G A;  1FGB D;  3L7Z C;  1ZYR C;  1B9M A;  3TME A;  3BDC A;  2R92 B;  4KY5 A;  1PFN A;  1RCV D;  2Z4I A;  1HA5 A;  3M85 A;  4ABN A;  2O4X A;  1QOH A;  2QF7 A;  1LTS D;  2BCO A;  3NXW A;  3MA2 B;  2E2I B;  2KCC A;  2KJX A;  3RMH A;  1B4O A;  1H9S A;  2TMP A;  2NN6 I;  5J1Z A;  4DFA A;  2F0N A;  3N6R A;  3OWF A;  4KN7 C;  3ND8 A;  1F9R A;  1BXT A;  5C3X A;  3T16 A;  3FEW X;  4F88 A;  2LS0 1;  4KV6 A;  1O7Z A;  2EY6 A;  4PMB A;  2PO4 A;  3DXJ C;  2JSO A;  3BVG A;  4LJZ C;  1SDF A;  3E5S A;  5ELC A;  1GUO A;  4PQX A;  1L0Y B;  1QNU A;  3X3M A;  1SND A;  1DYQ A;  4IUN A;  4RWS C;  4RCN A;  1ESF A;  2ENB A;  3PMF A;  5CYU A;  1W6K A;  2FJ2 A;  2Z1C A;  2DY8 A;  3N52 A;  1TS3 A;  3NSW A;  1VMC A;  4B08 A;  3EJI A;  1I50 B;  3P75 A;  4KHV A;  2F0V A;  3URY A;  3WOE A;  5C0X I;  3AU7 A;  5FOB B;  2A68 D;  4ZYS A;  2EVB A;  2B2W C;  1S5C D;  1SBB B;  3W3A A;  4ZUJ A;  3FMC A;  3HOZ B;  2F0Q A;  1TII D;  2A5H A;  4MHE A;  4IAL A;  4OHJ A;  2HUG A;  1EYC A;  1H9K A;  4CKC A;  2SNM A;  1O80 A;  1Z6H A;  4UDU C;  2IX1 A;  3J81 E;  5I4D A;  3FPU B;  2B8G A;  1STE A;  3IL8 A;  3QG1 A;  4DK1 A;  3HOX B;  4RHR A;  2G9D A;  4FO2 A;  5J39 A;  1M4V A;  3A54 A;  2F0U A;  2CW0 D;  2K32 A;  3L9A X;  1ENF A;  1ICW A;  1E0B A;  3RLF A;  2XNA C;  2VNU D;  5KYI A;  4J1M A;  5KYL A;  3S9W A;  1GUN A;  3CKI B;  2ZT9 C;  1TWH B;  3KLS X;  4C3J G;  2MHV A;  2K5D A;  4CKE A;  1CK1 A;  4ME5 A;  2Q8I B;  1TWF B;  4M1U B;  3VYU A;  1K8M A;  1X32 A;  2C5C A;  3WOF A;  1UUP A;  2O5I C;  2JA8 B;  1OXU A;  1YNN D;  2A6E D;  5K5P A;  3JAM E;  3EVQ A;  4H0L C;  1VCI A;  1XX8 A;  5EBC A;  3D4D A;  2ZXP A;  2JA5 B;  4Q5V A;  2F0P A;  1IW7 D;  2H4O A;  2WIN B;  1SYD A;  4C3H G;  3I91 A;  4NKL A;  3ND9 A;  2A69 C;  5M3F B;  2XN9 C;  5K36 H;  2LMC B;  5DNF A;  2MJ8 A;  1ILP A;  4BBS B;  3QB3 A;  4FVM A;  4XQN A;  1MSH A;  1STB A;  1F2L A;  3D4R A;  1FYC A;  1PLF A;  2NTT A;  4DAV A;  5I2X A;  3CQZ B;  3V05 A;  1B1Z A;  3GTO B;  3MFY A;  1H9R A;  3NPP A;  1E2W A;  1HPC A;  2JXM B;  3M7G A;  3MC0 B;  3DMU A;  2D62 A;  4F8M A;  4ZLT F;  1O78 A;  3D6C A;  3OWE B;  3RZD B;  1KLG D;  3HRZ C;  1U4R A;  5JEA G;  2MPM A;  5EPL A;  1GHJ A;  2Z4H A;  1RTN A;  2YYZ A;  2RBM A;  4NDX A;  5IGE A;  4BY1 B;  2F0D A;  5E4W C;  3K5M A;  3NK9 A;  4V0B A;  2EPB A;  4Z9C B;  3H3V C;  2BE5 D;  2F0E A;  4KKU A;  3GD7 A;  1A3T A;  1QIL A;  3M3Y B;  4BA1 I;  1SFO B;  4ZRZ A;  1JC7 A;  3M4O B;  4A3M B;  2KVM A;  1DD2 A;  1PYW D;  3TZD A;  3K59 A;  2SDF A;  2HDM A;  4RCO A;  4HTH A;  2EYF A;  2L4N A;  3T51 B;  1AZQ A;  3MEH A;  5CV7 A;  3Q22 A;  1STY A;  1R4P B;  2A6H D;  1DOM A;  2EYJ A;  1ONL A;  1SE2 A;  1Q3L A;  2BDO A;  3IAY A;  1VF5 C;  3BYT B;  1SE3 A;  5CMD A;  1TWA B;  5T1I A;  2NBF A;  1UAP A;  1JE4 A;  2PZW A;  3RUZ A;  5G3L D;  1D5X C;  4NMZ A;  1R9T B;  1FNW A;  5JEA H;  1DCZ A;  1WD0 A;  3TP8 A;  3VA5 A;  4DXG A;  1KNE A;  4IFD G;  5A35 A;  4EGV A;  4N9P A;  1PZJ D;  2Y0S B;  2PNR C;  4ODG A;  4NP5 A;  1I6H B;  1RD9 D;  3I4M B;  2EOT A;  3G7L A;  4RGM A;  2Q8T A;  3VR3 A;  5IOC A;  1Q1B A;  3SR1 A;  4DU9 A;  1QNK A;  4OIK A;  2BA1 A;  2JEB I;  3NUC A;  2E2D C;  2F0I A;  2CQA A;  5FK9 C;  1I4Q A;  1EZ8 A;  1G91 A;  2F3V A;  3G6J B;  4A3G B;  1JQY D;  3SVM A;  3BDL A;  2AQ2 B;  1JB3 A;  1C8C A;  4CJ2 C;  2JP1 A;  4UAI A;  1F77 A;  4IQZ A;  4IN3 A;  4K14 A;  3HS0 C;  3QOL A;  5JVG 3;  5ISR A;  4FF4 A;  2M9V A;  1SNQ A;  1PRT F;  1PRT B;  2WKC A;  2XWB B;  3QJY A;  4BWG B;  4WJW A;  5DEH A;  1WTX A;  4HSV A;  3PO2 B;  3OIQ A;  1LT3 D;  4XDX A;  2QEJ C;  4ILW A;  2F0J A;  5D65 A;  2QIL A;  3SDZ A;  2F0M A;  1GUS A;  1S5B D;  4DNT B;  1LV9 A;  5EGT A;  5LHY 1;  4K5X A;  2NVY B;  1PMR A;  2F03 A;  4WRD A;  2KUM A;  3DHQ A;  2DNC A;  2F0S A;  2NVX B;  4DAY A;  2PZU A;  4OGQ C;  2B8F A;  1D5Z C;  4C3I B;  3OSO A;  3EA6 A;  4DAP A;  2KED A;  1PDQ A;  1GXD C;  2B2T C;  1WTW A;  3I90 A;  1BCP C;  3OMC A;  3EFX D;  4LMQ D;  1CA5 A;  1V8Q A;  4A93 B;  3UI2 A;  4F7X A;  4DF7 A;  5IGB A;  1GHK A;  1IYU A;  4BS9 A;  3OOC A;  1J8I A;  3EQL C;  3NTI A;  3OMG A;  2B2Y C;  2NWG A;  1PZK D;  4G4K A;  3ERO A;  2B2V C;  2A73 B;  3Q24 A;  3PUX A;  2F0F A;  1BBX C;  4TRD A;  1WTQ A;  1E2V A;  3R8B A;  1YNJ D;  3Q0A A;  2F0O A;  2B2T A;  1U9R A;  2N88 A;  3KUP A;  3OIP A;  5KNC A;  3VYS A;  1XTC D;  2AQ3 B;  5CV4 A;  2EJF C;  3I3C A;  5CV5 A;  3LWU A;  1ROD A;  3I4N B;  2DNE A;  4RH6 A;  3V96 A;  1ESR A;  4B9W A;  2B2Y A;  3SK4 A;  2ZXR A;  4DN4 M;  3VR6 A;  1G6Z A;  1JWM D;  3WDN A;  2B2V A;  2Q8R E;  2GA4 B;  3P20 A;  2YU9 B;  2NZ1 D;  5E4X A;  2QCP X;  1PFB A;  1XWE A;  2K05 A;  1ILQ A;  2M2L A;  1HRJ A;  3NQI A;  2B2U C;  3FRP B;  5EKL A;  4XTC S;  5EPK A;  3BVZ A;  5JEA J;  2K04 A;  3A7L A;  1MSG A;  4ZKB B;  1KDB A;  5JPN C;  2L1B A;  2R93 B;  3R2I A;  3V2T A;  1SYF A;  3QOJ A;  1T5X D;  4DK0 A;  1R4Q B;  4A3I B;  4RKB A;  2EE1 A;  5HGT A;  3HEJ A;  2FFK B;  1EWH A;  2B2U A;  3K5N A;  2D9U A;  3LNN A;  1TY0 A;  3VYT A;  3PV0 A;  2NB0 A;  3MVV A;  2EDG A;  4HAE A;  2PQE A;  3VA7 A;  3C3L A;  1EQV A;  4JK1 C;  4QUF A;  4JBW A;  1DXM A;  2D2C C;  2R7Z B;  2E2H B;  3T4A C;  4KD3 A;  5E1F A;  5C3W A;  3HG9 A;  2RKS A;  4DNR B;  1WTR A;  1CM9 A;  4QF4 A;  1FNV A;  1PTO D;  1BNZ A;  1LT6 D;  1G8Z D;  3GV3 A;  5FLX E;  5C4J B;  2F0K A;  3OHX C;  1PZI D;  5ELD A;  4J6H A;  3E6Z X;  5IGC A;  2RDG A;  4HED A;  4RFB A;  5COR A;  2F0T A;  5G3L F;  5E3F A;  4RGT A;  4F87 A;  3J80 E;  1JWU D;  2K01 A;  2E75 C;  5I2Y A;  1MBY A;  1SNP A;  1SYE A;  4DXF A;  2NVT B;  4P2C B;  4KD4 A;  1Q12 A;  1U4P A;  1HQM C;  3L3O C;  3P7J A;  1LO5 D;  4C3I G;  5CV6 A;  1CQF A;  4RA8 A;  5D3I B;  4AYB B;  4X3K A;  1PRT C;  2I07 B;  5JAV A;  1OXV A;  1I4R A;  1TY2 A;  3NQT A;  5D14 A;  3D8G A;  1OO9 B;  2B2W A;  1BUV T;  1NR2 A;  2A68 C;  2K1B A;  1TS2 A;  1LTT D;  1IHZ A;  3OW7 A;  3TP7 A;  5M9O A;  2R6G A;  2AQ1 B;  1WD1 A;  3T56 B;  2LKV A;  4DGZ A;  3TP6 A;  5C3E B;  4OO1 G;  4KK7 A;  4OIJ A;  2XRQ D;  4R8N A;  2SNS A;  1LAB A;  3DWQ A;  1U4L A;  2FMC A;  1KDC A;  3H91 A;  1HFG A;  5IIF A;  1NAP A;  3Q23 A;  4K2L A;  3SHL A;  2JYO A;  4H7B A;  4PV1 C;  5I6Y A;  5EQ0 A;  1D1K A;  2WII B;  3I70 A;  5A2Q E;  1B53 A;  3HOU B;  2OXP A;  1MI2 A;  5IGF A;  5JPM C;  1AFP A;  2PZT A;  1XYI A;  5M3M B;  4IFD I;  4CJ1 B;  2BA0 A;  4I7Z C;  3ZYY X;  5J22 A;  4E6I A;  3TN2 A;  2QKI C;  1BR9 A;  1S4Z A;  4KN4 C;  2WKD A;  1YNN C;  2K5W A;  3H94 A;  4X3U A;  3NTK A;  3A55 A;  1I4P A;  4RKL A;  3K5L A;  2I46 A;  1EOT A;  5I9P A;  1K83 B;  4XXE A;  1TR5 A;  1F2M A;  2ID0 A;  3NE5 B;  5BN4 A;  4TSS A;  1FD7 D;  2QDB A;  3D31 A;  3FDT A;  3NWS A;  4KJO A;  3MWY W;  5AFW A;  1TKW B;  4FF2 A;  1SYG A;  4B9X A;  3HGB A;  2E76 C;  2BDN A;  2K28 A;  4IUQ A;  3FKI B;  5JJZ A;  1EY5 A;  1G2T A;  1A6X A;  1WVL A;  4CJ0 B;  1UNS A;  1Z7T A;  4KKS A;  5DAU A;  2TSS A;  1K8O A;  1SYC A;  4OL7 A;  4EQP A;  3H6M A;  1CT1 D;  1H9S B;  4A3K B;  1STN A;  4R8I A;  1H9M A;  3MZ5 A;  4BY7 B;  5EBD A;  2KEC A;  3CHB D;  2XVS A;  5LL6 S;  3ITP A;  1JR0 D;  5KNB A;  3K58 A;  1HUM A;  1MD2 D;  4ZQ3 A;  1CZG A;  4J8Q A;  4M8A A;  4EVO A;  5CV9 A;  1F9P A;  4FXD A;  3P1H A;  1PXU A;  5BN3 A;  2JA7 B;  2B63 B;  1E2Z A;  4KY7 A;  3S14 B;  2WV6 D;  4CBV A;  4A3J B;  2HQE A;  3S16 B;  2XRS D;  1JOK A;  1KLU D;  1SJE D;  1SE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...