3I91A

Crystal structure of human chromobox homolog 8 (cbx8) with h3k9 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
b'RVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 8
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i91A00
2KVMA 2N55A 4X3KA 1WTXA 4MHEA 1CA5A 1QG7A 2B2VA 4OIKA 4ZK9B 4ZLTF 1B3AA 3ONAB 1HRJA 2EPBA 5EPKA 1J8IA 3GV3A 2MP1A 1F9PA 1WD0A 4R9WA 5E4XA 2N88A 1HFGA 1NAPA 1PFNA 1B4OA 1KNAA 2K05A 2KUMA 2MGSA 3DEOA 3I3CA 4U68A 4IUTA 2MPMA 3KBXA 1Q3LA 1TVXA 1ILQA 1HFNA 5DNFA 1U4LA 5CBAE 4IURA 1WTQA 3R93A 2NYZD 1MGSA 4HSVA 1DONA 4HCSA 5JJZA 3MTSA 3FPUB 2NZ1D 1F2LA 1NR2A 2MJ8A 4RA8A 2BDNA 2RSNA 5EPJA 1EIHA 1BO0A 1DOMA 4IUVA 1BBXC 1WVLA 5EPLA 2RVLA 1RHPA 1X32A 5EKIA 1C8CA 4MN3A 1A15A 1F9SA 3HP3A 2DY8A 3N52A 4X3UA 5EJWA 1WTRA 1B2TA 2X6LA 4X3SA 2RA4A 1PFMA 5E4WC 1QNKA 2D9UA 1ESRA 3DM1A 1RJTA 1ZXTA 2K04A 3I8ZA 3D6WA 2H1EA 1RTNA 4R8IA 1U4RA 2KEDA 2B2TC 4HAEA 4IUQA 4DN4M 1XYIA 1AZPA 1O7ZA 4LMQD 3G7LA 1BF4A 2KOLA 3LWEA 3IFDA 4ZKBB 1EQTA 3TZDA 4RWSC 1B53A 3P7JA 1HUMA 1S4ZA 1DZ1A 2DY7A 2HDMA 1O7YA 1HA6A 1RTOA 2CVRA 4X3TA 2JP1A 1PLFA 3DEPA 1VMPA 1IKLA 1DOKA 1NR4A 2K01A 2HDLA 2FHTA 4QUCA 2B2WC 2HCCA 5D14A 2L1BA 3SVMA 1M8AA 2EE1A 4HEDA 1X3PA 2K03A 2HCIA 3H91A 1SAPA 3Q6SA 1PFBA 4CJ1B 1WTPA 1ILPA 1G2TA 4XT1B 1PDQA 1J9OA 1JICA 1MSHA 3IL8A 1F9QA 3MWYW 5D65A 1IL8A 1MSGA 2K1BA 1G6ZA 1SDFA 2HUGA 2XIWA 3KUPA 1HUNA 1QE6A 3UI2A 3TN2A 1X3QA 1ML0D 1EL0A 2FJ2A 1XX8A 2FFKB 1WTOA 1WTWA 3QO2A 2Q8RE 1EOTA 1WD1A 2J7ZA 4OIJA 4CJ2C 3I90A 2IL8A 5COYA 2B2TA 1IKMA 1BNZA 1E0BA 1JE4A 4IUUA 2NWGA 2L11A 1G91A 4ZKCB 2SDFA 2X6GA 1CM9A 3F2UA 4IUPA 4QUFA 4CJ0B 1O80A 1VMCA 4RAUC 1DOLA 1NCVA 4ZAIA 2K28A 2L9HA 1U4MA 2B2UC 1U4PA 4XDXA 1F9RA 5T1IA 2EOTA 1WTVA 4O42A 5AFWA 2JYOA 2B2YC 4XT3B 2X69A 5CORA 1ICWA 3GV6A 2B2WA 2KECA 2M2LA 2L12A 1EIGA 2R3ZA 5CBEE 2B2UA 2VXWA 2KEEA 5CMDA 1AP0A 1GUWA 1KNEA 5T1GA 2Q8TA 1AZQA 1CA6A 1B50A 1SSOA 2B2VC 1HHVA 4UAIA 3I91A 1MI2A 1LV9A 2B2YA 2L4NA 2FMMA 2RSOA 5EQ0A 4NW2A 1G2SA 2FINB 1RODA 3FDTA
chains in the Genus database with same CATH superfamily
4IALA 1EU3A 5IGFA 5BN3A 4B3SQ 3CPWA 4ZLTF 2NN6H 1HNXQ 3S2HH 3CCUA 1PMRA 4R4TA 1YHQA 1JQYD 2UUBL 3FMCA 4Q5VA 4OO1H 4DV6L 4V190 5I2YA 4JPBW 1SE8A 5JOBA 2ID0A 1K3RA 3UDXA 5I6WA 1NMFA 3MFYA 1YNND 1YI2A 5AJ3L 4A3CG 1B7YB 4QY7A 4UP8A 1SJHD 1UUPA 5JJZA 4DV1L 1NR2A 4C3JB 1EIHA 1MJCA 4JI3L 3F8TA 4LK1C 2UU9L 3HP3A 3KK7A 4B3MQ 1N9WA 1TKWB 2VW9A 1CFMA 1VQ4A 1WI5A 1KLUD 1VQHA 4JBKA 4P2CB 1O7ZA 3J7ZC 2Z4IA 4WJ3M 3FEWX 1STEA 3RMHA 5FO8B 4QCLA 3KFUA 1S4ZA 1DZ1A 1O7YA 2NVQH 3K7AB 1P8LA 2VUMG 2UUCQ 3ERQA 4B9WA 1QB5D 3HOUB 1Q8KA 1GUOA 3JAME 1NSNS 4DNTB 5D14A 2F0NA 2L1BA 3T1YQ 4B3SL 3W5OA 4JV5Q 4LUZA 3J80E 2K4KA 1X54A 1J9OA 3IL8A 1M90C 3I4MG 2XIWA 5A2QL 1DCZA 1I94Q 3CC2A 4HCEA 3ULJA 3CW2C 1EY0A 1ZKOA 2FJ2A 1G291 4AYBE 4NXMQ 2J7ZA 3KF8A 1DYQA 4NXNQ 1EWIA 5CV5A 1PZJD 2PW5A 5J39A 2NVXH 3CCLA 1A6XA 5L37A 2EYOA 3J7YW 1NE3A 1TT2A 2EJGC 1CZWA 1PYSB 3F2CA 1CUKA 3TDQA 2F0KA 3M7GA 4WJ4A 1CTMA 1ICWA 2LXKA 4DA2A 2M2LA 1MHWC 1GUWA 1HHVA 4C3HH 3I91A 3JAMc 1MI2A 3EQLC 2KHIA 3HOYH 1RODA 2FMCA 3ND8A 1SMYC 1WTXA 4DUYQ 3AB9A 4ZK9B 1CQFA 3MXPA 3HKZG 3TSSA 5J22A 1VQDA 4R4CA 1HFGA 1V1QA 3NTIA 2R7ZB 1B1ZA 4FF3A 1EYDA 1TVXA 1HFNA 4LAAA 5CBAE 4A3CH 3NWTA 2NYZD 5IY0A 4KTAA 3CCEA 3GQBA 3T1HQ 4N8FA 1WJJA 4NP5A 1VQBA 5IYCG 3HOZB 1EYGA 1WVLA 1XPUA 2PCFB 1H9SA 1NNXA 2CW0D 5HY6A 4EVOA 1VQLA 3GTGB 4C1NI 2E75C 4IUNA 4X3SA 1UAPA 5E4WC 1QNKA 1TWHB 3J7A5 5DM73 1I6VC 4A3MB 2A1AA 3ULLA 1TS3A 4APVA 1BOSA 1Q1EA 4EGVA 4KV6A 4QL5A 1B9NA 2NVTB 2DY7A 4OWWB 3BVMA 2WAQB 3NELA 1A62A 1LM0A 1G51A 3KJPA 4PNYA 4DV0L 4LF4L 4A3KH 4JOIA 2EQSA 1C0AA 1X3PA 2EZVA 2QGQA 1PH8A 3I4MH 4PZ7A 3STBC 1G2TA 5FO9B 4DV4L 5C5MA 1IBKQ 1SNOA 4EQPA 4AQYL 3J81L 1XMQQ 3TS2A 2YU9B 1XX8A 4Z9CB 1FYCA 4ULLA 1B9MA 3S2DB 1B70B 1STBA 3R3OA 4X62Q 4G7HC 1KRTA 4JG2A 1DOLA 3DUZA 2L9HA 4DUZL 2AMCB 1HZCA 4A3FB 4LF7L 1F77A 4A3BB 1SMXA 2R7DA 3M4OH 2JEAI 1RF2D 5I6YA 4LJZC 1SNPA 3CPFA 4UP7A 3VYTA 3WOFA 1EIGA 4F7XA 4JBWA 4BXXG 2KEEA 2OEOA 2QCPX 3GTMB 4A3DG 3TEHB 3IRBA 1E1OA 2SOBA 1V43A 3PIPA 4NW2A 4DV7Q 2A8VA 2XGTA 5FO7B 1GVPA 2WB1B 1XNRL 1SYEA 2DJGC 2D2CC 2F0OA 1I5FA 4JI2L 1H9KA 2WB1E 3S24A 1WFQA 1I3QB 4U68A 1R9TH 3KBXA 1SRUA 2F0QA 1D5ZC 4IURA 1Q82C 1VF5C 4KY5A 3MXUA 1GUTA 5EGTA 2C35B 4GLXA 5I9PA 3H0GG 4EQ5A 5IYCH 5HGQA 3H3VI 1DOMA 2LS01 4CDCC 4YCVA 2O4XA 1LACA 1HPCA 3VYUA 5C44G 5M5XB 5EAYA 1HZBA 2VB3X 3PSIA 5CGKA 3DM1A 3K58A 3CCJA 2B63G 2UUAQ 5J3BA 4DV2L 4R8IA 3PV0A 2HHHQ 3I4NB 3GTLH 5C4XH 3CQZB 3TZDA 5BR8Q 3HKSA 3DHQA 1PRTB 5IGCA 3I4OA 1RTOA 4HJ9A 3RN5A 1HNWQ 2A68D 4R4QA 3OMGA 2RCFA 2EYHA 5EBCA 3J81c 3NBIA 2IWHA 4OXPA 1LYLA 3M4QA 3KDFB 2E2DC 4O0AA 2K03A 4K6DA 5CV7A 5I9OA 2JA7B 3G48A 3TS0A 1U5KA 4GLVB 2NB0A 1F9QA 4KHZA 1H95A 1UE5A 1JOKA 4IJLA 3L0OA 1KXLA 2FFKB 1HR0Q 3S15B 4FF4A 3K7UC 4PMWA 3I55A 4DR3L 4GKKL 1HQRD 3EVQA 1F2MA 1JE4A 3I73A 1B3QA 1KDCA 4H44C 3HOXG 5LMUQ 1EY5A 2K28A 2KHJA 4J1MA 4DAYB 3CMEA 1HTPA 3HEJA 4LFBQ 1JT8A 1U9RA 1JOQA 2B2YC 1ENAA 4DR5L 2HHHL 2WV6D 1VQFA 4A3DH 3U9OA 3U50C 2F1MA 5CMDA 1IBLL 2IX0A 3GTPB 3RZOH 5JJKA 4H02A 3HGBA 1X3EA 4LF9L 4K2KA 1CSPA 1VQMA 3ONAB 2F0UA 1TXYA 1WD0A 2UXCQ 3TQYA 4R9WA 1HH2P 1GKHA 5JJIA 3FHWA 1FD7D 2NVYH 3VR4A 4IUTA 4V0BA 1PH5A 2A19A 3C2PA 4K8JA 1XTDA 1WTQA 4LF6Q 2WIIB 4GS3A 5LMNQ 2ALYB 3BDOA 4DR6L 1HR0L 2Q8IB 4HCSA 2F0LA 5C0XJ 2Y0SG 1TWCH 4IUVA 3RD4A 4JBJA 1N32L 5ELBA 3WDNA 1TS4A 5M3FH 4P71A 1FNVA 3K5LA 1K8OA 3NBHB 2E2JB 2K04A 3ERSX 4LFCQ 1NMGA 1SNQA 4LWCA 4IUQA 1Q7YC 4A3LH 3D8GA 5FLXL 4TVAB 1I50H 5JEAJ 1EQTA 1D5MC 2E5LQ 1LUZA 3A5UA 2D0OA 2BA1A 4IO9A 3CRLC 1JORA 2V4DA 3CU7A 1BKBA 1PLFA 1EY8A 2OTJA 4YHHL 5G3LF 1SYFA 4BBRB 1KQSA 5E7NA 1PZKD 3BZKA 4IFDI 1ILPA 4CJ1B 1WTPA 1S72A 3OWFA 5LL6S 4UPAA 4I65A 3RLOA 1IL8A 5FKAC 5BN4A 1GO3E 2AUKA 3TMEA 4YY3L 4JI6Q 3HOVG 1KAWA 1OXVA 4WRDA 4G7OC 4XYQA 4ME5A 4Q0FA 4BY1B 4QQBX 1D8LA 1HCZA 2RDFA 2A6EC 1G91A 2NWGA 1FNUA 1O80A 2ZT9C 1XPOA 5FK9C 3P75A 1U4MA 4KHPL 4FP5D 2F0FA 4FYDA 1XMOQ 5NUCA 4G7ZC 1LTID 2AQ3B 2ZJPA 1STYA 3S16H 2ICIA 4IPGA 2B2WA 1FGBD 1FGUA 2A73B 1LT4D 2PMZB 4CKBA 2CWAA 2E5LL 4HMJA 2Q8TA 3SE0A 3M4YA 1YEZA 2OT2A 1MBYA 4MNOA 1F2YA 4CBVA 4JYAL 2BH2A 1AE2A 1W6KA 2JA5G 1MD2D 4A3IG 1IBMQ 3DMUA 3QG1A 4OEMB 4QJFA 5IT9L 4HJ7A 2QILA 1U4LA 2Z0SA 4KKTA 5C4JH 5C3EG 5IP7H 1Q12A 2F0MA 1KL9A 4GOPA 2JA6G 1UEBA 3PO3G 4FVMA 2JA9A 4HSPA 4RGMA 2A69D 5EPLA 4R4IA 1XWEA 1ONLA 4OONA 5EJWA 3Q22A 1K8MA 3G6EA 2VUMB 2E74C 5EKKA 1PTOB 1PFMA 1SYCA 2PQAA 1J5EQ 2BE5C 5HGTA 3CRKC 4RHSA 1LO5D 1BF4A 3MXNB 4KJNA 3IFDA 4L5RC 4FNFA 3CC7A 4A3BH 4PQXA 2JK8A 4HR7B 5IE8A 1HXYD 5LMNW 3HOWB 3L7ZC 3K59A 4Y7NH 1QVCA 1IBML 2E2IB 3H91A 1PFBA 5C3WA 1MSHA 4IPCA 3HOVH 2K1BA 3HG9A 1TWAB 2PNRC 3HRZC 4DXGA 4GN4B 4DR4L 1WTWA 4H7BA 4ALPA 1SMYD 3U58A 4CKEA 1A2TA 2EYMA 2CH4W 4A3EG 4ZKCB 2QEJC 1HNZL 2OQKA 2O5IC 3W3AA 4ZAIA 3UDFA 2VB2X 4A93B 1EFID 1J5EL 4F87A 3GTOH 4JVZA 1CKMA 4K5VA 5CBEE 2M00A 4P72A 1QVGA 1AP0A 1VF7A 2K5WA 2WFWA 1Y8PB 2L4NA 5IT9c 3HKZE 4DPGA 2OQ0A 1CSQA 2NZOA 1FVIA 2JA5H 1GJXA 1I4PA 3UDIA 5GADC 4A3IH 1OTCA 4DR1Q 1E7ZA 2UXBL 2K7VA 3SK8A 4JI7Q 3RZDH 5C5LA 4GNXB 4EX5A 1T5EA 4OX9L 5M3MG 3E6ZX 5C3EH 1OO9B 3PO3H 2JA7H 2HQLA 2IPKD 3H3VC 1V8QA 1W6JA 5JAVA 1K9MC 4HIDA 4M8AA 1YJ9A 3GTJB 4C3HG 4JK1C 3KF6A 2K5DA 1BR9A 4BY7B 4C3IB 2YV5A 3D6CA 1C8CA 4YCWA 3F2BA 1NBWA 3CCVA 2R93H 3HOYG 2JEBI 3CAMA 2WKDA 4IFDJ 4MZ9A 3SEBA 3JAML 3FKIB 2JQOA 2PZWA 2L0CA 2Z1CA 4DAVA 3J80L 4K8IA 4TRDA 3MEFA 3CKIB 1JJ2A 3CC4A 4A3JG 2HDMA 2EJMA 2R92B 3DWQA 2XSCA 2MNAA 2QDBA 4JI0L 1VQGA 4X65L 1AFPA 4C2MH 3MA2B 1VQEA 2VQEL 4A3GG 4K0KQ 3K5MA 4LF5Q 4P75A 4S3SA 4CDFC 4OGQC 1K83B 4QGUA 1FJGQ 1PYWD 4JI4Q 2F3WA 1NY4A 1WCMB 3TN2A 1ML0D 4KMUC 2EYJA 1ESFA 1H9RA 2I46A 5FJ8G 5I2XA 2XRSD 4A3EH 2K6AA 2IL8A 3I70A 2B2TA 4TQUS 1E2ZA 3LNNA 2X6GA 4CJ0B 1Y1WG 3BZDB 3OIPA 1HNXL 1QNUA 2JE6I 4A3KG 2GVAA 1PH3A 2V1CC 3U4VA 1ZYRC 2H4OA 2C5CA 3DWPA 4AYBB 1V1PB 2JJQA 2B2UA 1I4RA 3ICEA 1KNEA 5IGDA 5DM63 4QF4A 3S17B 2FMMA 4NB3A 1G2SA 1ET9A 3EN2A 2KVMA 2R7FA 1PRTF 3H0GB 5M5WB 1IW7C 2K52A 2N8NA 2Z6KC 2J4XA 2WACA 4LF5L 1SXTA 3CCRA 1PHJA 3M3YB 4B3ML 2ENBA 3K0XA 5M3MH 2CWPA 1PFNA 3ZYYX 1KLGD 5ELDA 3P1HA 1LTRD 3S1RH 5KYIA 2B63B 2RQXA 1A3VA 3M7NA 2XN9C 3AMUA 3MXGA 3PO2B 1B44D 1LTGD 1YNJC 3LWUA 4LF8Q 1EIFA 3S1NH 3CCMA 1VS0A 3JAMi 1JWUD 2UUCL 1LTTD 5KNCA 3J80c 1GUSA 2AQ1B 1EY7A 1F9SA 3A8KE 3T1YL 1JWSD 2GVBA 4JV5L 1ESRA 2CQOA 2WINB 3T16A 2F4VQ 5GAHC 5M5YH 2HIXA 5I4DA 4A3JH 1I94L 5GAEC 2MHVA 1TU2B 3Q23A 1B53A 1HUMA 1YJNA 1QWYA 4MTNA 4X3TA 4NXML 1X55A 4NXNL 2EYPA 1QUQA 2LMCB 2AWOA 4A3GH 1PV4A 4DGZA 1Q8IA 3MVVA 4HEDA 3CMAA 2KJXA 5CV9A 3OWEB 1SAPA 4KY6A 4K5XA 3SGIA 4DK3C 1VQ5A 4QMGA 1JMCA 5CR3A 5D65A 4JCVE 3S9WA 4MTKA 3KUPA 5IYDH 2Q2TA 2DN8A 1YBYA 3A7AB 5FJ8H 4F8MA 1UE1A 3SXHA 1VQPA 3OPOA 5C4XG 3SHLA 4OIJA 4P73A 1H9MA 3S14H 1Y1WH 1EOVA 1C9OA 1E2WA 3A8IE 3A8JE 1KDAA 3NP8A 5IGBA 4DUYL 3U9SA 5C0XG 1U4PA 1F9RA 3NUCA 3GTKB 2XVSA 3T53B 5LL6X 2JA8B 4I7AA 3UE1A 2ZXRA 1Y1VG 3PF5A 1YHBA 5EBDA 2GA4B 4KKSA 4DK1A 3E0EA 2L5TA 3T1HL 2EY6A 1PRTC 4ZCKA 2YTYA 2KCTA 2EPBA 1J8IA 4RGOS 1FL0A 3OTOQ 4UP9A 3FRPB 2WKCA 4LW1A 4DNIA 1NAPA 1TIID 1SEBD 3DEOA 4N9PA 3K8AA 2Y0SE 4C3JG 2G9HD 4KD3A 1TY2A 4FDBA 1A0IA 2I0QA 1LTLA 3OHXC 3C3LA 5GROA 1C4QA 1TWFH 3WWVA 4DV3Q 5CV4A 2HIVA 3S1QH 1RHPA 5GQOA 3SK5A 4MN3A 1AEXA 1A15A 2OF1A 1PH6A 1VQIA 1Z47A 5JJLA 2DUDA 2H1EA 4CHTB 4R4OA 2RDHA 4NPSA 4LMQD 2KOLA 1IBKL 4PMBA 3BDLA 3HOUG 2A6ED 2PZTA 1KDBA 1XMQL 4A93H 4OWTB 3EBEA 1R4QB 1GHKA 1QJOA 4L6TB 3G4SA 2HDLA 1LT6D 2KCMA 1YVCA 4X62L 4IN3A 1KRSA 2B29A 1PH4A 3OTOL 3IAYA 1TWGB 3GTQB 4KJOA 1I6HB 2PZUA 1JICA 5M3FG 4YWKA 3PF4A 1BBUA 1HQMC 2MQHA 1K28A 1NJIC 2F0HA 4WORA 3VR2A 4A3LG 2KBNA 1SJED 2H5XA 2KCNA 2Q8RE 3V96A 4L5QA 1BCPF 4TSSA 3EA6A 1IKMA 1IHZA 3AFQA 4B3RQ 1BNZA 2RHQB 4DV7L 5C0XH 3F2UA 4QUFA 2NZHA 3PIP3 1DJRD 3FP9A 3T4AC 2I07B 3J81i 3UDGA 1Y1VH 1SR3A 3SK4A 1EFWA 1PTOF 1SFOH 4BY7H 3L2PA 2MUYA 1YNXA 3KDFA 1JCKB 4FXDA 5JEAH 1YZ6A 3CF5A 3NK9A 5EQ0A 3N6RA 2EXZA 2MO0A 2N3SA 5D3DA 2BE5D 4DR7Q 1BQQT 2F0PA 1D5XC 4A75A 4JI1Q 4C3JH 3D4RA 2UUAL 1S5FD 1RIPA 3HZXA 3S2HB 3ULPA 1Y8OB 3HOZG 5BR8L 4DAYA 2F0VA 4HSVA 1K83H 1F2LA 5EPJA 4UHVA 4CKCA 1HNWL 2RF4A 4FF1A 5KYLA 5EKIA 2NTSA 4BS9A 5A35A 1N36Q 4A3MG 4X3UA 2PQEA 4K14A 4O1NA 4KI0A 1JB3A 3K7AH 5E3FA 3HFZB 3MC0B 1AZPA 1D7QA 4NDXA 2WAQG 1CK1A 3HOUH 2IT1A 3RN2A 1Q90A 3BZCA 4MIUA 1EY9A 2CHBD 2F0IA 5IP7G 2JP1A 3OMCA 3K80C 1DOKA 1IZ6A 3KLSX 4G57A 1NUCA 2B2WC 3E9HA 3SVMA 5LMUL 2TSSA 2NVQB 4LFBL 1CKNB 4JI1L 1J6QA 1PVOA 3TRZA 1YJWA 2XTIA 3ZJYC 4RMFA 4RG1A 3AU7A 2F3IA 2E76C 3F1ZA 1XTCD 4EQOA 1PXUA 3K6OA 2I5HA 3QO2A 2ES2A 1BCPC 1EOTA 2VNUD 2MFIA 3K0YA 5COYA 4A3BG 3OW2A 1N36L 4B3TQ 2VQFQ 1XNQQ 3V05A 2UXCL 2EOTA 4RCOA 4RKBA 1PTOC 2NVXB 4K6LA 2IW3A 2KECA 2EYFA 2R3ZA 2L12A 4RFBA 1C7YA 1EY6A 3AYHB 4LF6L 1CA6A 2B2VC 4BBSB 5LMNL 4BA2I 2B2YA 5IWAQ 1EEFD 2ZM6Q 4K5WA 1SE3A 3GDEA 2R7ZH 1EZ6A 2VZAA 4C3HB 1QVFA 3ND9A 5IOCA 2UXDQ 4GN5A 4PZ8A 4OWXB 5BN5A 2N88A 1XXGA 2KUMA 1ZEQX 3HOYB 4TKOB 2RCNA 4LFCL 1EQVA 3HOZH 1AW7A 3R93A 3L9AX 2VS1A 3A55A 3GTGH 1MGSA 3QJYA 1TWHH 1JB7A 3PGZA 1I4GA 1JWMD 5ELEA 5CV6A 1BO0A 3CCQA 4LUVA 1BBXC 4A3MH 4G4KA 1S5BD 2IX1A 3GO5A 5FLXE 3I4NG 2NVTH 2K50A 1L1OC 1Z6HA 4BA1I 1PFSA 2L15A 1LT5D 3I72A 1PH2A 1G6PA 3J7AF 1LTSD 3OSOA 1PH1A 2DNCA 1OXXK 2ZTEA 4IQZA 1BCPB 1Z7TA 1SROA 4DXFA 3P7JA 5IGGA 4JI6L 1F2ZA 1A63A 2LSSA 4RGTA 3S1MB 1E22A 2RKSA 2B3GA 3W2DA 1JC7A 2K5HA 4PV1C 2JA7G 4FO2A 4ZUIA 1X56A 3V2TA 1NR4A 2A68C 2HCCA 4LFAQ 1STGA 1Y14B 1EWHA 1ZYRD 3SR1A 2Z9HA 2YU9H 2KENA 1RD9D 4OL7A 5KEEA 3I4LA 1VQ9A 2R93G 2VL6A 3MWYW 3PCOB 1MSGA 1XMOL 1QILA 2HUGA 3S2DH 5JPNC 1EUJA 4XIGS 4GNXC 4A3KB 3UI2A 3E9IA 4KY7A 3I4MB 1KHIA 2PQAB 4RCNA 5GAGC 4A3FH 2QW7A 1WD1A 1IW7D 4JI5Q 1X9NA 2NN6I 4IZ8A 1E0BA 3M4PA 3TBIB 1CM9A 1STNA 1B8AA 2XWJB 2SEBD 1HTLD 2NUCA 1L0XB 3H6MA 2PI2A 2OCEA 3GTMH 4OO1I 2QKIC 4JI8Q 2JXMB 4IFDH 2CCZA 4KD4A 3R2TA 4PZ6A 2VXWA 4HJ8A 1B50A 1TY0A 2SNMA 1UWVA 3G71A 1K8GA 3M4OB 2F0GA 4RGNA 2PYKA 2RSOA 4ME3A 1I3QH 1O7IA 4OIKA 2A5HA 1L1OB 1CHQD 3F2DA 2MP1A 4X66Q 1Y69U 2ASBA 1M1KC 2G9DA 2R61A 2ZTDA 1Y8NB 3PIOA 3HKZB 5FLMH 1KIXA 4NMZA 1CI3M 5M5XH 2JSOA 1QZHA 2QEXA 5CYUA 1CZGA 1LTBD 1WYDA 4IPHA 1S5DD 4RA8A 2CKZB 1R9TB 3AQQA 3M85A 1N34Q 3M9BA 1BBWA 2CQAA 1W2BA 3I4NH 3B6YA 1JJGA 3CQZH 1GUGA 1TR5A 2D9UA 1RJTA 5JPMC 3K57A 2UUBQ 3DLLA 1RTNA 4DV6Q 3TP7A 2ZXOA 3OIQA 2B2TC 3FVQA 4HAEA 1JR0D 4JW0A 2B8FA 4JC0A 2QF7A 4RWSC 1GXDC 4DV1Q 4UDUC 4H0LC 3VA7A 4BBRG 2I5LX 1S5CD 3D4DA 1VQOA 4JI3Q 1HZ9A 3QWNA 3GTLB 2PW7A 1G8ZD 1KD1C 5C4XB 1C48A 1S3OA 2KQ3A 1D2BA 3STBD 1S5ED 2E8GA 3TP5A 2ZJRA 1XJVA 3S15H 2OWOA 1PDQA 5KIXA 1GUNA 5IGEA 1LABA 4HIOA 3NTHA 4HIMA 3K5OA 3PIO3 4C56C 2F3VA 1PRTD 5K36H 4DFAA 3I90A 3KBGA 3J81j 2BA0A 5D3IB 1N34L 5CV8A 4YIJA 1EIYB 3LX0A 4DR1L 3NWSA 1ENFA 5ELNA 4PG3A 2E2HB 2EY1A 4XDXA 3GD7A 4JI7L 3GTPH 2K14A 2F4IA 3NE5B 4L5TA 4R1JA 1QOHA 3GV6A 1S40A 1JJCB 2Z8LA 2A74C 3CD6A 1AZQA 3PUYA 5IYDG 4XQNA 2HD3A 3IKJA 1DM0B 1VQ7A 4POGA 1V9PA 2B39A 2RDGA 1L2FA 3JC66 3D3RA 3GP7A 5K5PA 4A3DB 4PMCA 2K33A 3G6JB 1MIUA 3A54A 1VQJA 3A5ZB 1NTGA 3RZOB 1VQ6A 1KNAA 1EQRA 2K05A 2MGSA 5DAUA 3C46A 4EQNA 3TP8A 3BDCA 4HJ5A 3NHHA 2NZ1D 2NVYB 2E2JH 3NXWA 4XQJA 1V1PA 2D62A 2A69C 4CDDC 4GKJQ 3HS0C 1WTRA 1IYUA 1Q1BA 4E6IA 2WP8J 1WTHA 4K0KL 2CFMA 3KF8B 5C44B 1TWCB 3D6WA 1AH9A 1XYIA 1JOOA 1FJGL 5KGUA 1Q86C 4JI4L 1BVSA 4ZKBB 5M3FB 3EJIA 5ISRA 4BBRH 4JOIC 3HOWG 4XXEA 5JVG3 3TZUA 4ZUJA 1K0RA 4RH6A 3VR3A 2RBMA 4L63B 3H09A 4KN4C 2O5JC 1I50B 2K01A 1VQNA 1ASZA 1M8AA 3J80i 4BBSH 1H9JA 3Q6SA 3D4WA 5CC4A 4XT1B 1TQOA 4BY1H 2R6GA 4KHVA 2ZJQA 1QE6A 3URYA 3NEMA 3QOJA 3H15A 1MJEA 3PUZA 4A93G 4DV0Q 4LF4Q 1EYCA 3J7AV 4GKJL 4C1NK 2L55A 5A2QE 2AHOB 3C1EA 3NSWA 5T1IA 1CT1D 1IYJB 5ELFA 4DV4Q 1QUQB 4XT3B 3HOXB 1H9SB 2XRQD 4AQYQ 3SK6A 2Q2UA 1YHAA 3NTKA 1SSOA 3PQIA 1LV9A 3QIAA 1RKNA 1GHJA 2F52A 3T51B 4QIWB 3S16B 4LF8L 3E0JA 2FINB 4OHJA 4RKLA 5F2DA 4X3KA 2SNSA 4DUZQ 4LF7Q 3P20A 4QB4A 5EPKA 4QIWE 3AEVA 1A3TA 3RLFA 2D5DA 3S1MH 2BCOA 3EROA 3VR6A 2Z6KA 2F4VL 3KLSA 1VDZA 2A6HC 5EKLA 2VUMH 4BY7G 4C3IG 1DONA 1PTOH 5C0XI 2MJ8A 2PNHA 1TS5A 1XNRQ 5JEAG 4HIKA 2AKWB 5IIFA 4ZRZA 4DK0A 3FKIG 3UE0A 3SDZA 5C4JB 2WAQE 3N52A 1JE5A 4JI2Q 2Y0SB 1OXUA 3Q8DA 4H13C 3VYSA 2F0JA 2LY7A 2Z4HA 3EIVA 3DWAA 1OXTA 5FOBB 1QZGA 1SBBB 3IFTA 1TS2A 2R92G 3HOWH 1BCPD 2EVBA 3MFGA 3RLNA 2K75A 2E2IH 2AUJD 3CHBD 1YNNC 4R8NA 4O2DA 3A0JA 1K73C 1L0YB 1A3UA 3T13A 4WFN3 1TWAH 4L5SA 1EQQA 3EFXD 5LHY1 1ASYA 2IX3A 1PTOD 3RR5A 3BG3A 1WCMG 4DV2Q 2B8GA 4ID6A 1R4PB 1SDFA 4AH6A 3D31A 4Y7NB 4N9TA 3BS1A 4N8X1 4L8JA 1RDPD 5C3XA 1GM5A 3HOVB 2EDGA 4X6AH 1HJPA 2KHSA 1SYDA 4IUPA 1BUVT 4HMIA 4RAUC 1NCVA 3WOEA 4AYBG 2K5QA 2EXDA 2Q2HA 2XWBB 4ODGA 1KC8C 1A2UA 3FPPA 2JYOA 4YCUA 3VR5A 3J81E 2OTLA 4UY8C 1A8VA 3H94A 1PA6A 4GLAC 4DR3Q 4GKKQ 3K5NA 3RNUA 2LXJA 3GTOB 1YITA 1CQVA 4DV3L 3K81C 2N55A 1CA5A 1EYAA 4DU9A 3A7LA 2JA5B 3QOLA 3GTJH 3I3CA 3VDYA 1ICFB 3PO2G 2KCCA 4DR5Q 4A3IB 1Q3LA 1KTKA 4C3IH 1IBLQ 1VQ8A 5HURA 4FXGC 4IPDA 3RZDB 3MTSA 1E3PA 3FKIH 5IODA 4LF9Q 5C3EB 1X32A 2XNAC 2JA6B 2F03A 3PO3B 3TP6A 4FXKC 1B2TA 3MZ5A 2X6LA 2R7ZG 2RA4A 1PYBA 4GZYC 3I8ZA 3KOJA 2R92H 1O78A 1U4RA 2J0TD 3U4ZA 1UEAB 3MHBA 1Q46A 4CDEC 2R93B 3DXJC 4DR6Q 4J15A 4KN7C 2IY5B 5IP9G 1SYBA 2E2HH 3PUXA 3A56A 5G3LD 2BH8A 1V1OA 2NTTA 1RL2A 1N32Q 1K0SA 4B3RL 4A4IA 4QUCA 1L0WA 1WCMH 1SNCA 3RUZA 2CW0C 5IYBG 1IYVA 2OXPA 3Q24A 2N78A 3BJUA 4F88A 4BXXH 4B9XA 4BWGB 4DR2Q 1N33Q 4C2MB 1X3QA 2JN4A 3TREA 3C1FA 1LLRD 3KJOA 2BDOA 3BVZA 1SLJA 1I4XA 4YHHQ 2SDFA 2ZXPA 1VQCA 3R2IA 5KRUA 2FXQA 3CCSA 4AIMA 2JA8G 1ET6A 4ABNA 4Y52H 4DV5Q 4CGYB 3H3VH 3OOCA 4XTCS 4DR7L 4A3EB 3VA5A 1K3BC 2I5MX 4O42A 5AFWA 3S17H 1EU4A 2X69A 1X65A 5CORA 4YY3Q 1BXTA 2Z6BA 3H0GH 5M5WH 1Q81C 1E2VA 2MO1A 4UAIA 1UE6A 3M3YH 3NENA 1CKNA 5C44H 3NBHA 4A3FG 4MHEA 1HZAA 1QG7A 1GD7A 1STHA 3KYHC 1K8AC 2B63H 1B3AA 1ENCA 3GV3A 4KHPQ 1F9PA 2HT1A 3PO2H 1DD2A 4GOPC 1SE2A 1UE7A 4WJWA 1SYGA 2EYLA 1DGSA 5ELOA 4HJAA 5DNFA 4DR2L 1N33L 3W1GA 2IHEA 4IFDG 2ATWA 4JBMA 4NKLA 3D0FA 4JYAQ 2WB1G 5M3MB 3FPUB 3X3NA 3CXCA 4GN3B 1IL2A 1LT3D 3S1RB 2F0EA 4DV5L 3S1NB 3X3MA 2EIFA 4K2LA 1LTAD 5IP9H 3NPPA 3ITPA 3E5SA 1E1TA 4POFA 5FLMG 1QCBD 2PPBC 2F0TA 4P74A 2RHSB 1HA6A 1O7LA 1X3FA 3I7FA 2YYZA 2CVRA 3KLWA 2DJFC 2K5NA 3DEPA 5M9OA 1FNWA 3HOXH 1XPRA 5M5YB 4IOAA 4A3JB 5E1FA 2G5DA 5IYBH 2EE1A 1CHPD 2VQFL 4B3TL 2F0DA 1XNQL 1PH9A 2HCIA 2IHFA 1EY4A 4RHRA 3MAQA 4A3GB 4KKUA 4A76A 4IJHA 1HUNA 4FF2A 4I7ZC 2QA4A 2YTXA 2NBFA 1P16A 3BYYB 1EL0A 1VQAA 4CJ2C 1HR0W 5IWAL 3GTKH 1SE4A 2DGYA 2EJFC 2PMZE 1PH7A 2K32A 3O13A 2ZM6L 2JA8H 3I2ZA 4XYOA 1VMCA 1D1IA 4DNRB 4GOPB 2UXDL 3CP0A 3S14B 1UNSA 1Y1WB 3PMFA 3OW7A 2ICEC 3L3OC 2LFNA 1W3SA 3AFPA 4DR4Q 1PZID 3QB3A 1DXMA 5T1GA 2BOSA 1M4VA 5KNDA 2CH4A 2N49A 2VY3A 2DNEA 1I4QA 4XQQA 1D1KA 3MEHA 3T56B 5FLXc 2EY5A 1VCIA 3FDTA 1HNZQ 1EWCA 3NQTA 5K36G 2D0PA 2Q2IA 2B2VA 1AE3A 3MXNA 2M9VA 3PUVA 1EZ8A 1HRJA 2QDLA 4DF7A 2AWNA 2NN6G 5E4XA 5JVH3 1B4OA 1AN8A 3DM3A 3A74A 2MPMA 1ILQA 3OYYA 2YTVA 4J8QA 2KA7A 1X3GA 4OO1G 1OXSC 1YNJD 1YIJA 5C4ZA 4LUOA 2BDNA 1Z9FA 2RSNA 4DAPA 5H1SE 4X64Q 1E24A 2RVLA 2PI2E 5IT9E 1I4HA 2UXBQ 5J1ZA 2DY8A 2O2LD 4LFAL 4OELB 5DLQE 1TWFB 1ZXTA 4OX9Q 2K5VA 4DKAC 3QR8A 2PO4A 4DN4M 2KEDA 4DAMA 1T5XD 3S1QB 1FR3A 2F0WA 3G7LA 2HQEA 3LWEA 1IXRA 1L1OA 2ZTCA 1X6OA 1KAAA 1CKOA 3BVGA 5DEHA 1TWGH 1VQKA 3GTQH 3PUWA 5TSSA 3ER0A 1I6HH 4KK7A 4JI5L 3E3XA 1VMPA 1IKLA 1U0LA 1RCVD 2FHTA 1SNDA 3BYTB 2F0SA 3VYRA 4ZYSA 2C9OA 5C4HA 2P5ZX 2TMPA 1G6ZA 1KABA 3LGJA 4JI8L 2GN5A 1EEID 1II3A 2AQ2B 1T9HA 3Q0AA 1BDOA 1SN8A 5AJ3Q 1N8RC 1WTOA 4ILWA 4IOCA 4LNQA 4JI0Q 2LKVA 4X64L 4GNXA 4X65Q 4HTHA 4IUUA 2L11A 4KLKA 4ZQ3A 5ELCA 1D6EC 2UU9Q 1STAA 2VQEQ 4B08A 4DK6C 4U673 2B2UC 3R8BA 3NQIA 4X66L 1WTVA 1WOCA 3KF6B 1GOZA 2A6HD 4BBSG 4J6HA 3KLRA 3W1BA 1SNMA 2JA6H 4BY1G 1MKHA 2EY2A 4M1UB 4HN7A 3BU2A 1HA5A 3I56A 1Y1VB 2IJ0A 4YWLA 4YWMA 5KNBA 1SFOB 5C6AA
chains in the Genus database with same CATH topology
4IALA 1EU3A 5IGFA 5BN3A 4ZLTF 2NN6H 1PMRA 1JQYD 3FMCA 4Q5VA 4OO1H 4V190 5I2YA 5JOBA 2ID0A 5I6WA 3MFYA 1YNND 1SJHD 1UUPA 5JJZA 1NR2A 4C3JB 1EIHA 4LK1C 3HP3A 3KK7A 1TKWB 1CFMA 1KLUD 4P2CB 1O7ZA 2Z4IA 3FEWX 1STEA 3RMHA 5FO8B 4QCLA 1DZ1A 1S4ZA 1O7YA 3K7AB 3ERQA 4B9WA 1QB5D 3HOUB 1GUOA 3JAME 1NSNS 4DNTB 5D14A 2F0NA 2L1BA 3J80E 1J9OA 3IL8A 2XIWA 5A2QL 1DCZA 4HCEA 1EY0A 1ZKOA 2FJ2A 1G291 2J7ZA 3KF8A 1DYQA 5CV5A 1PZJD 2PW5A 5J39A 1A6XA 2EYOA 3J7YW 1TT2A 2EJGC 1CZWA 3TDQA 2F0KA 3M7GA 1CTMA 1ICWA 4DA2A 2M2LA 1GUWA 1HHVA 3I91A 1MI2A 3EQLC 1RODA 2FMCA 3ND8A 1SMYC 1WTXA 3AB9A 4ZK9B 1CQFA 3MXPA 3TSSA 5J22A 1HFGA 3NTIA 2R7ZB 1B1ZA 4FF3A 1EYDA 1TVXA 1HFNA 4LAAA 5CBAE 3NWTA 2NYZD 4KTAA 3GQBA 4NP5A 3HOZB 1WVLA 2PCFB 1H9SA 2CW0D 4EVOA 3GTGB 4C1NI 2E75C 4IUNA 4X3SA 1UAPA 5E4WC 1QNKA 1TWHB 5DM73 1I6VC 4A3MB 1TS3A 1BOSA 1Q1EA 4EGVA 4KV6A 2NVTB 1B9NA 2DY7A 3BVMA 2WAQB 4PNYA 1X3PA 2EZVA 1G2TA 5FO9B 5C5MA 1SNOA 4EQPA 3J81L 2YU9B 1XX8A 4Z9CB 1FYCA 4ULLA 1B9MA 3S2DB 1STBA 3R3OA 4G7HC 1DOLA 3DUZA 2L9HA 4A3FB 1F77A 4A3BB 2JEAI 1RF2D 5I6YA 4LJZC 1SNPA 3VYTA 3WOFA 1EIGA 4F7XA 4JBWA 2KEEA 2OEOA 2QCPX 3GTMB 2SOBA 1V43A 4NW2A 5FO7B 2WB1B 1SYEA 2D2CC 2F0OA 1H9KA 1I3QB 4U68A 3KBXA 2F0QA 1D5ZC 4IURA 1VF5C 4KY5A 3MXUA 1GUTA 5EGTA 5I9PA 1DOMA 2LS01 2O4XA 1LACA 1HPCA 3VYUA 5M5XB 2VB3X 5CGKA 3DM1A 3K58A 4R8IA 3PV0A 3I4NB 3CQZB 3TZDA 3DHQA 1PRTB 5IGCA 1RTOA 2A68D 3OMGA 2EYHA 5EBCA 3NBIA 2IWHA 2E2DC 2K03A 4K6DA 5CV7A 5I9OA 2JA7B 2NB0A 1F9QA 4KHZA 1JOKA 2FFKB 3S15B 4FF4A 4PMWA 1HQRD 3EVQA 1F2MA 1JE4A 3I73A 1KDCA 4H44C 1EY5A 2K28A 4J1MA 1HTPA 3HEJA 1U9RA 1JOQA 2B2YC 1ENAA 2WV6D 3U9OA 2F1MA 5CMDA 2IX0A 3GTPB 3HGBA 4K2KA 3ONAB 2F0UA 1WD0A 4R9WA 1FD7D 3VR4A 4IUTA 4V0BA 3C2PA 4K8JA 1WTQA 2WIIB 3BDOA 2Q8IB 4HCSA 2F0LA 5C0XJ 4IUVA 3RD4A 5ELBA 3WDNA 1TS4A 1FNVA 3K5LA 1K8OA 2E2JB 2K04A 1SNQA 4IUQA 3D8GA 5FLXL 5JEAJ 1EQTA 1D5MC 2BA1A 3CRLC 1JORA 2V4DA 3CU7A 1PLFA 1EY8A 5G3LF 1SYFA 4BBRB 1PZKD 4IFDI 1ILPA 4CJ1B 1WTPA 3OWFA 5LL6S 4I65A 1IL8A 5FKAC 5BN4A 2AUKA 3TMEA 1OXVA 4WRDA 4G7OC 4XYQA 4ME5A 4Q0FA 4BY1B 1HCZA 2RDFA 2A6EC 1G91A 2NWGA 1FNUA 1O80A 2ZT9C 5FK9C 3P75A 1U4MA 4FP5D 2F0FA 4FYDA 5NUCA 4G7ZC 1LTID 2AQ3B 1STYA 2ICIA 2B2WA 1FGBD 2A73B 1LT4D 2PMZB 4CKBA 4HMJA 2Q8TA 3SE0A 3M4YA 1MBYA 2OT2A 1F2YA 4CBVA 1W6KA 1MD2D 3DMUA 3QG1A 5IT9L 2QILA 1U4LA 4KKTA 1Q12A 2F0MA 4FVMA 4HSPA 4RGMA 2A69D 5EPLA 1XWEA 1ONLA 5EJWA 3Q22A 2VUMB 1K8MA 2E74C 5EKKA 1PTOB 1PFMA 1SYCA 2BE5C 5HGTA 3CRKC 4RHSA 1LO5D 1BF4A 4KJNA 3IFDA 4FNFA 4PQXA 4HR7B 1HXYD 3HOWB 3L7ZC 3K59A 2E2IB 3H91A 1PFBA 5C3WA 1MSHA 2K1BA 3HG9A 1TWAB 2PNRC 3HRZC 4DXGA 1WTWA 4H7BA 1SMYD 4CKEA 1A2TA 2EYMA 4ZKCB 2QEJC 2O5IC 3W3AA 4ZAIA 2VB2X 4A93B 1EFID 4F87A 4K5VA 5CBEE 2M00A 1AP0A 1VF7A 2K5WA 1Y8PB 2L4NA 1GJXA 1I4PA 2K7VA 3SK8A 5C5LA 1T5EA 3E6ZX 1OO9B 2IPKD 3H3VC 1V8QA 1W6JA 5JAVA 3GTJB 4M8AA 4C3HG 4JK1C 2K5DA 1BR9A 4BY7B 4C3IB 3D6CA 1C8CA 2JEBI 2WKDA 4IFDJ 3SEBA 3JAML 3FKIB 2PZWA 2L0CA 2Z1CA 4DAVA 3J80L 4K8IA 4TRDA 3CKIB 2HDMA 2EJMA 2R92B 3DWQA 2XSCA 2QDBA 1AFPA 3MA2B 3K5MA 4S3SA 4OGQC 1K83B 1PYWD 2F3WA 1WCMB 3TN2A 1ML0D 4KMUC 2EYJA 1ESFA 1H9RA 2I46A 5I2XA 2XRSD 2K6AA 2IL8A 3I70A 2B2TA 4TQUS 1E2ZA 3LNNA 2X6GA 4CJ0B 3BZDB 3OIPA 1QNUA 2JE6I 1ZYRC 2H4OA 4AYBB 2C5CA 3DWPA 1V1PB 2B2UA 1I4RA 1KNEA 5IGDA 5DM63 4QF4A 3S17B 2FMMA 1G2SA 1ET9A 2KVMA 3H0GB 1PRTF 5M5WB 1IW7C 2J4XA 2WACA 1SXTA 3M3YB 2ENBA 1PFNA 3ZYYX 1KLGD 5ELDA 3P1HA 1LTRD 5KYIA 2B63B 2RQXA 1A3VA 3M7NA 2XN9C 3AMUA 3MXGA 3PO2B 1B44D 1LTGD 1YNJC 3LWUA 1JWUD 1LTTD 5KNCA 1GUSA 2AQ1B 1EY7A 1F9SA 3A8KE 1JWSD 1ESRA 2WINB 3T16A 5I4DA 2MHVA 1TU2B 3Q23A 1B53A 1HUMA 1QWYA 4X3TA 2EYPA 2LMCB 2AWOA 4DGZA 1Q8IA 3MVVA 4HEDA 2KJXA 5CV9A 3OWEB 1SAPA 4KY6A 4K5XA 4QMGA 5CR3A 5D65A 3S9WA 3KUPA 2DN8A 3A7AB 4F8MA 3SXHA 3OPOA 3SHLA 4OIJA 1H9MA 1E2WA 3A8IE 3A8JE 1KDAA 3NP8A 5IGBA 3U9SA 5C0XG 1U4PA 1F9RA 3NUCA 3GTKB 2XVSA 3T53B 5LL6X 2JA8B 2ZXRA 5EBDA 2GA4B 4KKSA 4DK1A 2L5TA 2EY6A 1PRTC 2EPBA 1J8IA 4RGOS 3FRPB 2WKCA 1NAPA 1TIID 1SEBD 3DEOA 4N9PA 4C3JG 2G9HD 4KD3A 1TY2A 3OHXC 3C3LA 1C4QA 5CV4A 1RHPA 3SK5A 4MN3A 1AEXA 1A15A 2OF1A 1Z47A 2H1EA 4CHTB 2RDHA 4LMQD 2KOLA 4PMBA 3BDLA 2A6ED 2PZTA 1KDBA 1R4QB 1GHKA 1QJOA 4L6TB 2HDLA 1LT6D 4IN3A 3IAYA 1TWGB 3GTQB 4KJOA 1I6HB 2PZUA 1JICA 1HQMC 2F0HA 4WORA 3VR2A 1SJED 2KCNA 2Q8RE 3V96A 1BCPF 4TSSA 3EA6A 1IKMA 1IHZA 1BNZA 5C0XH 3F2UA 4QUFA 3PIP3 1DJRD 3T4AC 2I07B 3SK4A 1PTOF 2MUYA 1JCKB 4FXDA 5JEAH 3NK9A 5EQ0A 3N6RA 2EXZA 5D3DA 2BE5D 1BQQT 2F0PA 1D5XC 3D4RA 1S5FD 3HZXA 3S2HB 1Y8OB 4DAYA 2F0VA 4HSVA 1F2LA 5EPJA 4CKCA 4FF1A 5KYLA 5EKIA 2NTSA 4BS9A 5A35A 4X3UA 2PQEA 4K14A 4O1NA 4KI0A 1JB3A 5E3FA 3MC0B 1AZPA 4NDXA 1CK1A 2IT1A 1Q90A 4MIUA 1EY9A 2CHBD 2F0IA 2JP1A 3OMCA 1DOKA 3KLSX 4G57A 1NUCA 2B2WC 3SVMA 2TSSA 2NVQB 3AU7A 2E76C 1XTCD 4EQOA 1PXUA 3K6OA 3QO2A 1BCPC 1EOTA 2VNUD 3K0YA 5COYA 3V05A 2EOTA 4RCOA 4RKBA 1PTOC 2NVXB 4K6LA 2IW3A 2KECA 2EYFA 2R3ZA 2L12A 4RFBA 1EY6A 1CA6A 2B2VC 4BBSB 4BA2I 2B2YA 1EEFD 4K5WA 1SE3A 1EZ6A 4C3HB 3ND9A 5IOCA 5BN5A 2N88A 1XXGA 2KUMA 1ZEQX 3HOYB 4TKOB 1EQVA 1AW7A 3R93A 3L9AX 3A55A 1MGSA 3QJYA 1I4GA 1JWMD 5ELEA 5CV6A 1BO0A 1BBXC 4G4KA 1S5BD 2IX1A 3GO5A 5FLXE 1Z6HA 4BA1I 1LT5D 3I72A 3J7AF 1LTSD 3OSOA 2DNCA 1OXXK 4IQZA 5IGGA 1BCPB 1Z7TA 4DXFA 3P7JA 1F2ZA 4RGTA 3S1MB 2RKSA 3W2DA 1JC7A 4PV1C 4FO2A 4ZUIA 3V2TA 1NR4A 2A68C 2HCCA 1STGA 1EWHA 1ZYRD 3SR1A 4OL7A 1RD9D 5KEEA 3I4LA 3MWYW 1MSGA 1QILA 2HUGA 5JPNC 4XIGS 4A3KB 3UI2A 4KY7A 3I4MB 4RCNA 1WD1A 1IW7D 2NN6I 4IZ8A 1E0BA 3TBIB 1CM9A 1STNA 2XWJB 2SEBD 1HTLD 2NUCA 1L0XB 3H6MA 4OO1I 2QKIC 2JXMB 4IFDH 4KD4A 3R2TA 2VXWA 1B50A 1TY0A 2SNMA 3M4OB 2F0GA 4RGNA 2PYKA 2RSOA 4OIKA 2A5HA 1CHQD 2MP1A 1Y69U 2G9DA 2R61A 1Y8NB 3HKZB 4NMZA 1CI3M 2JSOA 5CYUA 1CZGA 1LTBD 1S5DD 4RA8A 1R9TB 3M85A 2CQAA 1GUGA 1TR5A 2D9UA 1RJTA 5JPMC 3K57A 1RTNA 3TP7A 2ZXOA 3OIQA 2B2TC 3FVQA 4HAEA 1JR0D 2B8FA 2QF7A 4RWSC 1GXDC 4UDUC 4H0LC 3VA7A 1S5CD 3D4DA 3QWNA 3GTLB 2PW7A 1G8ZD 5C4XB 1C48A 2KQ3A 1D2BA 1S5ED 3TP5A 1PDQA 5KIXA 1GUNA 5IGEA 1LABA 3NTHA 3K5OA 3PIO3 4C56C 2F3VA 1PRTD 5K36H 4DFAA 3I90A 3KBGA 2BA0A 5D3IB 5CV8A 4YIJA 3LX0A 3NWSA 1ENFA 2E2HB 2EY1A 4XDXA 3GD7A 2F4IA 3NE5B 1QOHA 3GV6A 2Z8LA 2A74C 1AZQA 3PUYA 4XQNA 3IKJA 1DM0B 2B39A 2RDGA 3D3RA 3GP7A 5K5PA 4A3DB 4PMCA 2K33A 3G6JB 3A54A 3RZOB 1KNAA 2K05A 2MGSA 5DAUA 3C46A 4EQNA 3TP8A 3BDCA 3NHHA 2NZ1D 2NVYB 3NXWA 4XQJA 1V1PA 2D62A 2A69C 3HS0C 1WTRA 1IYUA 1Q1BA 4E6IA 2WP8J 5C44B 1TWCB 3D6WA 1XYIA 1JOOA 5KGUA 4ZKBB 5M3FB 3EJIA 5ISRA 4XXEA 5JVG3 3TZUA 4ZUJA 4RH6A 3VR3A 2RBMA 4L63B 3H09A 4KN4C 2O5JC 1I50B 2K01A 1M8AA 1H9JA 3Q6SA 3D4WA 5CC4A 4XT1B 1TQOA 2R6GA 4KHVA 1QE6A 3URYA 3QOJA 3PUZA 1EYCA 3J7AV 4C1NK 2L55A 5A2QE 3C1EA 3NSWA 5T1IA 1CT1D 5ELFA 4XT3B 3HOXB 1H9SB 2XRQD 3SK6A 3NTKA 1SSOA 1LV9A 3QIAA 1RKNA 1GHJA 3T51B 4QIWB 3S16B 3E0JA 2FINB 4OHJA 4RKLA 5F2DA 4X3KA 2SNSA 3P20A 4QB4A 5EPKA 1A3TA 3RLFA 2D5DA 2BCOA 3EROA 3VR6A 3KLSA 1VDZA 2A6HC 5EKLA 4C3IG 1DONA 1PTOH 5C0XI 2MJ8A 1TS5A 5JEAG 5IIFA 4ZRZA 4DK0A 3SDZA 5C4JB 3N52A 2Y0SB 1OXUA 4H13C 3VYSA 2F0JA 2LY7A 2Z4HA 3DWAA 1OXTA 5FOBB 1SBBB 3IFTA 1TS2A 1BCPD 2EVBA 3MFGA 2AUJD 3CHBD 1YNNC 4R8NA 1L0YB 1A3UA 3T13A 4WFN3 3EFXD 5LHY1 2IX3A 1PTOD 3BG3A 2B8GA 4ID6A 1R4PB 1SDFA 3D31A 4Y7NB 4N9TA 3BS1A 4L8JA 1RDPD 5C3XA 3HOVB 2EDGA 2KHSA 1SYDA 4IUPA 1BUVT 4HMIA 4RAUC 1NCVA 3WOEA 2K5QA 4ODGA 2XWBB 1A2UA 3FPPA 2JYOA 3VR5A 3J81E 3H94A 3K5NA 3GTOB 1CQVA 2N55A 1CA5A 1EYAA 4DU9A 3A7LA 2JA5B 3QOLA 3I3CA 2KCCA 4A3IB 1Q3LA 1KTKA 5HURA 4FXGC 3RZDB 3MTSA 5IODA 5C3EB 1X32A 2XNAC 2JA6B 2F03A 3PO3B 3TP6A 4FXKC 1B2TA 3MZ5A 2X6LA 2RA4A 4GZYC 3I8ZA 1O78A 1U4RA 2J0TD 1UEAB 3MHBA 2R93B 3DXJC 4KN7C 1SYBA 3PUXA 3A56A 5G3LD 1V1OA 2NTTA 4QUCA 1SNCA 3RUZA 2CW0C 1IYVA 2OXPA 3Q24A 4F88A 4B9XA 4BWGB 4C2MB 1X3QA 3C1FA 1LLRD 2BDOA 3BVZA 1I4XA 2SDFA 2ZXPA 3R2IA 5KRUA 1ET6A 4ABNA 4CGYB 3OOCA 4XTCS 4A3EB 3VA5A 4O42A 5AFWA 1EU4A 2X69A 5CORA 1BXTA 1E2VA 4UAIA 3NBHA 4MHEA 1QG7A 1STHA 1B3AA 1ENCA 3GV3A 1F9PA 1DD2A 1SE2A 4WJWA 1SYGA 2EYLA 5DNFA 4IFDG 4NKLA 5M3MB 3FPUB 3X3NA 1LT3D 3S1RB 2F0EA 3S1NB 3X3MA 4K2LA 1LTAD 3NPPA 3ITPA 3E5SA 1QCBD 2PPBC 2F0TA 1HA6A 1O7LA 2YYZA 2CVRA 5M9OA 3DEPA 5M5YB 1FNWA 4A3JB 5E1FA 2EE1A 1CHPD 2F0DA 2HCIA 1EY4A 4RHRA 3MAQA 4A3GB 4KKUA 1HUNA 4FF2A 4I7ZC 2NBFA 3BYYB 1EL0A 4CJ2C 1SE4A 2EJFC 2K32A 3O13A 4XYOA 1VMCA 1D1IA 4DNRB 3S14B 1UNSA 1Y1WB 3PMFA 3OW7A 2ICEC 3L3OC 2LFNA 1PZID 3QB3A 1DXMA 5T1GA 2BOSA 1M4VA 5KNDA 2DNEA 1I4QA 4XQQA 1D1KA 3MEHA 3T56B 2EY5A 1VCIA 3FDTA 1EWCA 3NQTA 5K36G 2B2VA 3MXNA 2M9VA 3PUVA 1EZ8A 1HRJA 4DF7A 2AWNA 2NN6G 5E4XA 5JVH3 1B4OA 1AN8A 2MPMA 1ILQA 4J8QA 2KA7A 4OO1G 1OXSC 1YNJD 5C4ZA 2BDNA 2RSNA 4DAPA 2RVLA 5IT9E 1I4HA 5J1ZA 2DY8A 2O2LD 1TWFB 1ZXTA 2PO4A 4DN4M 2KEDA 3S1QB 1T5XD 1FR3A 2F0WA 3G7LA 2HQEA 3LWEA 1KAAA 3BVGA 5DEHA 3PUWA 5TSSA 4KK7A 1VMPA 1IKLA 1RCVD 2FHTA 1SNDA 3BYTB 2F0SA 3VYRA 4ZYSA 2C9OA 5C4HA 2TMPA 1G6ZA 1KABA 1EEID 1II3A 2AQ2B 3Q0AA 1BDOA 1WTOA 4ILWA 2LKVA 4HTHA 4IUUA 2L11A 4ZQ3A 5ELCA 1D6EC 1STAA 4B08A 4U673 2B2UC 3R8BA 3NQIA 1WTVA 1GOZA 2A6HD 4J6HA 3KLRA 1SNMA 4M1UB 2EY2A 4HN7A 1HA5A 1Y1VB 2IJ0A 5KNBA 1SFOB 5C6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVM A;  2N55 A;  4X3K A;  1WTX A;  4MHE A;  1CA5 A;  1QG7 A;  2B2V A;  4OIK A;  4ZK9 B;  4ZLT F;  1B3A A;  3ONA B;  1HRJ A;  2EPB A;  5EPK A;  1J8I A;  3GV3 A;  2MP1 A;  1F9P A;  1WD0 A;  4R9W A;  5E4X A;  2N88 A;  1HFG A;  1NAP A;  1PFN A;  1B4O A;  1KNA A;  2K05 A;  2KUM A;  2MGS A;  3DEO A;  3I3C A;  4U68 A;  4IUT A;  2MPM A;  3KBX A;  1Q3L A;  1TVX A;  1ILQ A;  1HFN A;  5DNF A;  1U4L A;  5CBA E;  4IUR A;  1WTQ A;  3R93 A;  2NYZ D;  1MGS A;  4HSV A;  1DON A;  4HCS A;  5JJZ A;  3MTS A;  3FPU B;  2NZ1 D;  1F2L A;  1NR2 A;  2MJ8 A;  4RA8 A;  2BDN A;  2RSN A;  5EPJ A;  1EIH A;  1BO0 A;  1DOM A;  4IUV A;  1BBX C;  1WVL A;  5EPL A;  2RVL A;  1RHP A;  1X32 A;  5EKI A;  1C8C A;  4MN3 A;  1A15 A;  1F9S A;  3HP3 A;  2DY8 A;  3N52 A;  4X3U A;  5EJW A;  1WTR A;  1B2T A;  2X6L A;  4X3S A;  2RA4 A;  1PFM A;  5E4W C;  1QNK A;  2D9U A;  1ESR A;  3DM1 A;  1RJT A;  1ZXT A;  2K04 A;  3I8Z A;  3D6W A;  2H1E A;  1RTN A;  4R8I A;  1U4R A;  2KED A;  2B2T C;  4HAE A;  4IUQ A;  4DN4 M;  1XYI A;  1AZP A;  1O7Z A;  4LMQ D;  3G7L A;  1BF4 A;  2KOL A;  3LWE A;  3IFD A;  4ZKB B;  1EQT A;  3TZD A;  4RWS C;  1B53 A;  3P7J A;  1HUM A;  1S4Z A;  1DZ1 A;  2DY7 A;  2HDM A;  1O7Y A;  1HA6 A;  1RTO A;  2CVR A;  4X3T A;  2JP1 A;  1PLF A;  3DEP A;  1VMP A;  1IKL A;  1DOK A;  1NR4 A;  2K01 A;  2HDL A;  2FHT A;  4QUC A;  2B2W C;  2HCC A;  5D14 A;  2L1B A;  3SVM A;  1M8A A;  2EE1 A;  4HED A;  1X3P A;  2K03 A;  2HCI A;  3H91 A;  1SAP A;  3Q6S A;  1PFB A;  4CJ1 B;  1WTP A;  1ILP A;  1G2T A;  4XT1 B;  1PDQ A;  1J9O A;  1JIC A;  1MSH A;  3IL8 A;  1F9Q A;  3MWY W;  5D65 A;  1IL8 A;  1MSG A;  2K1B A;  1G6Z A;  1SDF A;  2HUG A;  2XIW A;  3KUP A;  1HUN A;  1QE6 A;  3UI2 A;  3TN2 A;  1X3Q A;  1ML0 D;  1EL0 A;  2FJ2 A;  1XX8 A;  2FFK B;  1WTO A;  1WTW A;  3QO2 A;  2Q8R E;  1EOT A;  1WD1 A;  2J7Z A;  4OIJ A;  4CJ2 C;  3I90 A;  2IL8 A;  5COY A;  2B2T A;  1IKM A;  1BNZ A;  1E0B A;  1JE4 A;  4IUU A;  2NWG A;  2L11 A;  1G91 A;  4ZKC B;  2SDF A;  2X6G A;  1CM9 A;  3F2U A;  4IUP A;  4QUF A;  4CJ0 B;  1O80 A;  1VMC A;  4RAU C;  1DOL A;  1NCV A;  4ZAI A;  2K28 A;  2L9H A;  1U4M A;  2B2U C;  1U4P A;  4XDX A;  1F9R A;  5T1I A;  2EOT A;  1WTV A;  4O42 A;  5AFW A;  2JYO A;  2B2Y C;  4XT3 B;  2X69 A;  5COR A;  1ICW A;  3GV6 A;  2B2W A;  2KEC A;  2M2L A;  2L12 A;  1EIG A;  2R3Z A;  5CBE E;  2B2U A;  2VXW A;  2KEE A;  5CMD A;  1AP0 A;  1GUW A;  1KNE A;  5T1G A;  2Q8T A;  1AZQ A;  1CA6 A;  1B50 A;  1SSO A;  2B2V C;  1HHV A;  4UAI A;  3I91 A;  1MI2 A;  1LV9 A;  2B2Y A;  2L4N A;  2FMM A;  2RSO A;  5EQ0 A;  4NW2 A;  1G2S A;  2FIN B;  1ROD A;  3FDT A; 
#chains in the Genus database with same CATH topology
 4IAL A;  1EU3 A;  5IGF A;  5BN3 A;  4B3S Q;  3CPW A;  4ZLT F;  2NN6 H;  1HNX Q;  3S2H H;  3CCU A;  1PMR A;  4R4T A;  1YHQ A;  1JQY D;  2UUB L;  3FMC A;  4Q5V A;  4OO1 H;  4DV6 L;  4V19 0;  5I2Y A;  4JPB W;  1SE8 A;  5JOB A;  2ID0 A;  1K3R A;  3UDX A;  5I6W A;  1NMF A;  3MFY A;  1YNN D;  1YI2 A;  5AJ3 L;  4A3C G;  1B7Y B;  4QY7 A;  4UP8 A;  1SJH D;  1UUP A;  5JJZ A;  4DV1 L;  1NR2 A;  4C3J B;  1EIH A;  1MJC A;  4JI3 L;  3F8T A;  4LK1 C;  2UU9 L;  3HP3 A;  3KK7 A;  4B3M Q;  1N9W A;  1TKW B;  2VW9 A;  1CFM A;  1VQ4 A;  1WI5 A;  1KLU D;  1VQH A;  4JBK A;  4P2C B;  1O7Z A;  3J7Z C;  2Z4I A;  4WJ3 M;  3FEW X;  1STE A;  3RMH A;  5FO8 B;  4QCL A;  3KFU A;  1S4Z A;  1DZ1 A;  1O7Y A;  2NVQ H;  3K7A B;  1P8L A;  2VUM G;  2UUC Q;  3ERQ A;  4B9W A;  1QB5 D;  3HOU B;  1Q8K A;  1GUO A;  3JAM E;  1NSN S;  4DNT B;  5D14 A;  2F0N A;  2L1B A;  3T1Y Q;  4B3S L;  3W5O A;  4JV5 Q;  4LUZ A;  3J80 E;  2K4K A;  1X54 A;  1J9O A;  3IL8 A;  1M90 C;  3I4M G;  2XIW A;  5A2Q L;  1DCZ A;  1I94 Q;  3CC2 A;  4HCE A;  3ULJ A;  3CW2 C;  1EY0 A;  1ZKO A;  2FJ2 A;  1G29 1;  4AYB E;  4NXM Q;  2J7Z A;  3KF8 A;  1DYQ A;  4NXN Q;  1EWI A;  5CV5 A;  1PZJ D;  2PW5 A;  5J39 A;  2NVX H;  3CCL A;  1A6X A;  5L37 A;  2EYO A;  3J7Y W;  1NE3 A;  1TT2 A;  2EJG C;  1CZW A;  1PYS B;  3F2C A;  1CUK A;  3TDQ A;  2F0K A;  3M7G A;  4WJ4 A;  1CTM A;  1ICW A;  2LXK A;  4DA2 A;  2M2L A;  1MHW C;  1GUW A;  1HHV A;  4C3H H;  3I91 A;  3JAM c;  1MI2 A;  3EQL C;  2KHI A;  3HOY H;  1ROD A;  2FMC A;  3ND8 A;  1SMY C;  1WTX A;  4DUY Q;  3AB9 A;  4ZK9 B;  1CQF A;  3MXP A;  3HKZ G;  3TSS A;  5J22 A;  1VQD A;  4R4C A;  1HFG A;  1V1Q A;  3NTI A;  2R7Z B;  1B1Z A;  4FF3 A;  1EYD A;  1TVX A;  1HFN A;  4LAA A;  5CBA E;  4A3C H;  3NWT A;  2NYZ D;  5IY0 A;  4KTA A;  3CCE A;  3GQB A;  3T1H Q;  4N8F A;  1WJJ A;  4NP5 A;  1VQB A;  5IYC G;  3HOZ B;  1EYG A;  1WVL A;  1XPU A;  2PCF B;  1H9S A;  1NNX A;  2CW0 D;  5HY6 A;  4EVO A;  1VQL A;  3GTG B;  4C1N I;  2E75 C;  4IUN A;  4X3S A;  1UAP A;  5E4W C;  1QNK A;  1TWH B;  3J7A 5;  5DM7 3;  1I6V C;  4A3M B;  2A1A A;  3ULL A;  1TS3 A;  4APV A;  1BOS A;  1Q1E A;  4EGV A;  4KV6 A;  4QL5 A;  1B9N A;  2NVT B;  2DY7 A;  4OWW B;  3BVM A;  2WAQ B;  3NEL A;  1A62 A;  1LM0 A;  1G51 A;  3KJP A;  4PNY A;  4DV0 L;  4LF4 L;  4A3K H;  4JOI A;  2EQS A;  1C0A A;  1X3P A;  2EZV A;  2QGQ A;  1PH8 A;  3I4M H;  4PZ7 A;  3STB C;  1G2T A;  5FO9 B;  4DV4 L;  5C5M A;  1IBK Q;  1SNO A;  4EQP A;  4AQY L;  3J81 L;  1XMQ Q;  3TS2 A;  2YU9 B;  1XX8 A;  4Z9C B;  1FYC A;  4ULL A;  1B9M A;  3S2D B;  1B70 B;  1STB A;  3R3O A;  4X62 Q;  4G7H C;  1KRT A;  4JG2 A;  1DOL A;  3DUZ A;  2L9H A;  4DUZ L;  2AMC B;  1HZC A;  4A3F B;  4LF7 L;  1F77 A;  4A3B B;  1SMX A;  2R7D A;  3M4O H;  2JEA I;  1RF2 D;  5I6Y A;  4LJZ C;  1SNP A;  3CPF A;  4UP7 A;  3VYT A;  3WOF A;  1EIG A;  4F7X A;  4JBW A;  4BXX G;  2KEE A;  2OEO A;  2QCP X;  3GTM B;  4A3D G;  3TEH B;  3IRB A;  1E1O A;  2SOB A;  1V43 A;  3PIP A;  4NW2 A;  4DV7 Q;  2A8V A;  2XGT A;  5FO7 B;  1GVP A;  2WB1 B;  1XNR L;  1SYE A;  2DJG C;  2D2C C;  2F0O A;  1I5F A;  4JI2 L;  1H9K A;  2WB1 E;  3S24 A;  1WFQ A;  1I3Q B;  4U68 A;  1R9T H;  3KBX A;  1SRU A;  2F0Q A;  1D5Z C;  4IUR A;  1Q82 C;  1VF5 C;  4KY5 A;  3MXU A;  1GUT A;  5EGT A;  2C35 B;  4GLX A;  5I9P A;  3H0G G;  4EQ5 A;  5IYC H;  5HGQ A;  3H3V I;  1DOM A;  2LS0 1;  4CDC C;  4YCV A;  2O4X A;  1LAC A;  1HPC A;  3VYU A;  5C44 G;  5M5X B;  5EAY A;  1HZB A;  2VB3 X;  3PSI A;  5CGK A;  3DM1 A;  3K58 A;  3CCJ A;  2B63 G;  2UUA Q;  5J3B A;  4DV2 L;  4R8I A;  3PV0 A;  2HHH Q;  3I4N B;  3GTL H;  5C4X H;  3CQZ B;  3TZD A;  5BR8 Q;  3HKS A;  3DHQ A;  1PRT B;  5IGC A;  3I4O A;  1RTO A;  4HJ9 A;  3RN5 A;  1HNW Q;  2A68 D;  4R4Q A;  3OMG A;  2RCF A;  2EYH A;  5EBC A;  3J81 c;  3NBI A;  2IWH A;  4OXP A;  1LYL A;  3M4Q A;  3KDF B;  2E2D C;  4O0A A;  2K03 A;  4K6D A;  5CV7 A;  5I9O A;  2JA7 B;  3G48 A;  3TS0 A;  1U5K A;  4GLV B;  2NB0 A;  1F9Q A;  4KHZ A;  1H95 A;  1UE5 A;  1JOK A;  4IJL A;  3L0O A;  1KXL A;  2FFK B;  1HR0 Q;  3S15 B;  4FF4 A;  3K7U C;  4PMW A;  3I55 A;  4DR3 L;  4GKK L;  1HQR D;  3EVQ A;  1F2M A;  1JE4 A;  3I73 A;  1B3Q A;  1KDC A;  4H44 C;  3HOX G;  5LMU Q;  1EY5 A;  2K28 A;  2KHJ A;  4J1M A;  4DAY B;  3CME A;  1HTP A;  3HEJ A;  4LFB Q;  1JT8 A;  1U9R A;  1JOQ A;  2B2Y C;  1ENA A;  4DR5 L;  2HHH L;  2WV6 D;  1VQF A;  4A3D H;  3U9O A;  3U50 C;  2F1M A;  5CMD A;  1IBL L;  2IX0 A;  3GTP B;  3RZO H;  5JJK A;  4H02 A;  3HGB A;  1X3E A;  4LF9 L;  4K2K A;  1CSP A;  1VQM A;  3ONA B;  2F0U A;  1TXY A;  1WD0 A;  2UXC Q;  3TQY A;  4R9W A;  1HH2 P;  1GKH A;  5JJI A;  3FHW A;  1FD7 D;  2NVY H;  3VR4 A;  4IUT A;  4V0B A;  1PH5 A;  2A19 A;  3C2P A;  4K8J A;  1XTD A;  1WTQ A;  4LF6 Q;  2WII B;  4GS3 A;  5LMN Q;  2ALY B;  3BDO A;  4DR6 L;  1HR0 L;  2Q8I B;  4HCS A;  2F0L A;  5C0X J;  2Y0S G;  1TWC H;  4IUV A;  3RD4 A;  4JBJ A;  1N32 L;  5ELB A;  3WDN A;  1TS4 A;  5M3F H;  4P71 A;  1FNV A;  3K5L A;  1K8O A;  3NBH B;  2E2J B;  2K04 A;  3ERS X;  4LFC Q;  1NMG A;  1SNQ A;  4LWC A;  4IUQ A;  1Q7Y C;  4A3L H;  3D8G A;  5FLX L;  4TVA B;  1I50 H;  5JEA J;  1EQT A;  1D5M C;  2E5L Q;  1LUZ A;  3A5U A;  2D0O A;  2BA1 A;  4IO9 A;  3CRL C;  1JOR A;  2V4D A;  3CU7 A;  1BKB A;  1PLF A;  1EY8 A;  2OTJ A;  4YHH L;  5G3L F;  1SYF A;  4BBR B;  1KQS A;  5E7N A;  1PZK D;  3BZK A;  4IFD I;  1ILP A;  4CJ1 B;  1WTP A;  1S72 A;  3OWF A;  5LL6 S;  4UPA A;  4I65 A;  3RLO A;  1IL8 A;  5FKA C;  5BN4 A;  1GO3 E;  2AUK A;  3TME A;  4YY3 L;  4JI6 Q;  3HOV G;  1KAW A;  1OXV A;  4WRD A;  4G7O C;  4XYQ A;  4ME5 A;  4Q0F A;  4BY1 B;  4QQB X;  1D8L A;  1HCZ A;  2RDF A;  2A6E C;  1G91 A;  2NWG A;  1FNU A;  1O80 A;  2ZT9 C;  1XPO A;  5FK9 C;  3P75 A;  1U4M A;  4KHP L;  4FP5 D;  2F0F A;  4FYD A;  1XMO Q;  5NUC A;  4G7Z C;  1LTI D;  2AQ3 B;  2ZJP A;  1STY A;  3S16 H;  2ICI A;  4IPG A;  2B2W A;  1FGB D;  1FGU A;  2A73 B;  1LT4 D;  2PMZ B;  4CKB A;  2CWA A;  2E5L L;  4HMJ A;  2Q8T A;  3SE0 A;  3M4Y A;  1YEZ A;  2OT2 A;  1MBY A;  4MNO A;  1F2Y A;  4CBV A;  4JYA L;  2BH2 A;  1AE2 A;  1W6K A;  2JA5 G;  1MD2 D;  4A3I G;  1IBM Q;  3DMU A;  3QG1 A;  4OEM B;  4QJF A;  5IT9 L;  4HJ7 A;  2QIL A;  1U4L A;  2Z0S A;  4KKT A;  5C4J H;  5C3E G;  5IP7 H;  1Q12 A;  2F0M A;  1KL9 A;  4GOP A;  2JA6 G;  1UEB A;  3PO3 G;  4FVM A;  2JA9 A;  4HSP A;  4RGM A;  2A69 D;  5EPL A;  4R4I A;  1XWE A;  1ONL A;  4OON A;  5EJW A;  3Q22 A;  1K8M A;  3G6E A;  2VUM B;  2E74 C;  5EKK A;  1PTO B;  1PFM A;  1SYC A;  2PQA A;  1J5E Q;  2BE5 C;  5HGT A;  3CRK C;  4RHS A;  1LO5 D;  1BF4 A;  3MXN B;  4KJN A;  3IFD A;  4L5R C;  4FNF A;  3CC7 A;  4A3B H;  4PQX A;  2JK8 A;  4HR7 B;  5IE8 A;  1HXY D;  5LMN W;  3HOW B;  3L7Z C;  3K59 A;  4Y7N H;  1QVC A;  1IBM L;  2E2I B;  3H91 A;  1PFB A;  5C3W A;  1MSH A;  4IPC A;  3HOV H;  2K1B A;  3HG9 A;  1TWA B;  2PNR C;  3HRZ C;  4DXG A;  4GN4 B;  4DR4 L;  1WTW A;  4H7B A;  4ALP A;  1SMY D;  3U58 A;  4CKE A;  1A2T A;  2EYM A;  2CH4 W;  4A3E G;  4ZKC B;  2QEJ C;  1HNZ L;  2OQK A;  2O5I C;  3W3A A;  4ZAI A;  3UDF A;  2VB2 X;  4A93 B;  1EFI D;  1J5E L;  4F87 A;  3GTO H;  4JVZ A;  1CKM A;  4K5V A;  5CBE E;  2M00 A;  4P72 A;  1QVG A;  1AP0 A;  1VF7 A;  2K5W A;  2WFW A;  1Y8P B;  2L4N A;  5IT9 c;  3HKZ E;  4DPG A;  2OQ0 A;  1CSQ A;  2NZO A;  1FVI A;  2JA5 H;  1GJX A;  1I4P A;  3UDI A;  5GAD C;  4A3I H;  1OTC A;  4DR1 Q;  1E7Z A;  2UXB L;  2K7V A;  3SK8 A;  4JI7 Q;  3RZD H;  5C5L A;  4GNX B;  4EX5 A;  1T5E A;  4OX9 L;  5M3M G;  3E6Z X;  5C3E H;  1OO9 B;  3PO3 H;  2JA7 H;  2HQL A;  2IPK D;  3H3V C;  1V8Q A;  1W6J A;  5JAV A;  1K9M C;  4HID A;  4M8A A;  1YJ9 A;  3GTJ B;  4C3H G;  4JK1 C;  3KF6 A;  2K5D A;  1BR9 A;  4BY7 B;  4C3I B;  2YV5 A;  3D6C A;  1C8C A;  4YCW A;  3F2B A;  1NBW A;  3CCV A;  2R93 H;  3HOY G;  2JEB I;  3CAM A;  2WKD A;  4IFD J;  4MZ9 A;  3SEB A;  3JAM L;  3FKI B;  2JQO A;  2PZW A;  2L0C A;  2Z1C A;  4DAV A;  3J80 L;  4K8I A;  4TRD A;  3MEF A;  3CKI B;  1JJ2 A;  3CC4 A;  4A3J G;  2HDM A;  2EJM A;  2R92 B;  3DWQ A;  2XSC A;  2MNA A;  2QDB A;  4JI0 L;  1VQG A;  4X65 L;  1AFP A;  4C2M H;  3MA2 B;  1VQE A;  2VQE L;  4A3G G;  4K0K Q;  3K5M A;  4LF5 Q;  4P75 A;  4S3S A;  4CDF C;  4OGQ C;  1K83 B;  4QGU A;  1FJG Q;  1PYW D;  4JI4 Q;  2F3W A;  1NY4 A;  1WCM B;  3TN2 A;  1ML0 D;  4KMU C;  2EYJ A;  1ESF A;  1H9R A;  2I46 A;  5FJ8 G;  5I2X A;  2XRS D;  4A3E H;  2K6A A;  2IL8 A;  3I70 A;  2B2T A;  4TQU S;  1E2Z A;  3LNN A;  2X6G A;  4CJ0 B;  1Y1W G;  3BZD B;  3OIP A;  1HNX L;  1QNU A;  2JE6 I;  4A3K G;  2GVA A;  1PH3 A;  2V1C C;  3U4V A;  1ZYR C;  2H4O A;  2C5C A;  3DWP A;  4AYB B;  1V1P B;  2JJQ A;  2B2U A;  1I4R A;  3ICE A;  1KNE A;  5IGD A;  5DM6 3;  4QF4 A;  3S17 B;  2FMM A;  4NB3 A;  1G2S A;  1ET9 A;  3EN2 A;  2KVM A;  2R7F A;  1PRT F;  3H0G B;  5M5W B;  1IW7 C;  2K52 A;  2N8N A;  2Z6K C;  2J4X A;  2WAC A;  4LF5 L;  1SXT A;  3CCR A;  1PHJ A;  3M3Y B;  4B3M L;  2ENB A;  3K0X A;  5M3M H;  2CWP A;  1PFN A;  3ZYY X;  1KLG D;  5ELD A;  3P1H A;  1LTR D;  3S1R H;  5KYI A;  2B63 B;  2RQX A;  1A3V A;  3M7N A;  2XN9 C;  3AMU A;  3MXG A;  3PO2 B;  1B44 D;  1LTG D;  1YNJ C;  3LWU A;  4LF8 Q;  1EIF A;  3S1N H;  3CCM A;  1VS0 A;  3JAM i;  1JWU D;  2UUC L;  1LTT D;  5KNC A;  3J80 c;  1GUS A;  2AQ1 B;  1EY7 A;  1F9S A;  3A8K E;  3T1Y L;  1JWS D;  2GVB A;  4JV5 L;  1ESR A;  2CQO A;  2WIN B;  3T16 A;  2F4V Q;  5GAH C;  5M5Y H;  2HIX A;  5I4D A;  4A3J H;  1I94 L;  5GAE C;  2MHV A;  1TU2 B;  3Q23 A;  1B53 A;  1HUM A;  1YJN A;  1QWY A;  4MTN A;  4X3T A;  4NXM L;  1X55 A;  4NXN L;  2EYP A;  1QUQ A;  2LMC B;  2AWO A;  4A3G H;  1PV4 A;  4DGZ A;  1Q8I A;  3MVV A;  4HED A;  3CMA A;  2KJX A;  5CV9 A;  3OWE B;  1SAP A;  4KY6 A;  4K5X A;  3SGI A;  4DK3 C;  1VQ5 A;  4QMG A;  1JMC A;  5CR3 A;  5D65 A;  4JCV E;  3S9W A;  4MTK A;  3KUP A;  5IYD H;  2Q2T A;  2DN8 A;  1YBY A;  3A7A B;  5FJ8 H;  4F8M A;  1UE1 A;  3SXH A;  1VQP A;  3OPO A;  5C4X G;  3SHL A;  4OIJ A;  4P73 A;  1H9M A;  3S14 H;  1Y1W H;  1EOV A;  1C9O A;  1E2W A;  3A8I E;  3A8J E;  1KDA A;  3NP8 A;  5IGB A;  4DUY L;  3U9S A;  5C0X G;  1U4P A;  1F9R A;  3NUC A;  3GTK B;  2XVS A;  3T53 B;  5LL6 X;  2JA8 B;  4I7A A;  3UE1 A;  2ZXR A;  1Y1V G;  3PF5 A;  1YHB A;  5EBD A;  2GA4 B;  4KKS A;  4DK1 A;  3E0E A;  2L5T A;  3T1H L;  2EY6 A;  1PRT C;  4ZCK A;  2YTY A;  2KCT A;  2EPB A;  1J8I A;  4RGO S;  1FL0 A;  3OTO Q;  4UP9 A;  3FRP B;  2WKC A;  4LW1 A;  4DNI A;  1NAP A;  1TII D;  1SEB D;  3DEO A;  4N9P A;  3K8A A;  2Y0S E;  4C3J G;  2G9H D;  4KD3 A;  1TY2 A;  4FDB A;  1A0I A;  2I0Q A;  1LTL A;  3OHX C;  3C3L A;  5GRO A;  1C4Q A;  1TWF H;  3WWV A;  4DV3 Q;  5CV4 A;  2HIV A;  3S1Q H;  1RHP A;  5GQO A;  3SK5 A;  4MN3 A;  1AEX A;  1A15 A;  2OF1 A;  1PH6 A;  1VQI A;  1Z47 A;  5JJL A;  2DUD A;  2H1E A;  4CHT B;  4R4O A;  2RDH A;  4NPS A;  4LMQ D;  2KOL A;  1IBK L;  4PMB A;  3BDL A;  3HOU G;  2A6E D;  2PZT A;  1KDB A;  1XMQ L;  4A93 H;  4OWT B;  3EBE A;  1R4Q B;  1GHK A;  1QJO A;  4L6T B;  3G4S A;  2HDL A;  1LT6 D;  2KCM A;  1YVC A;  4X62 L;  4IN3 A;  1KRS A;  2B29 A;  1PH4 A;  3OTO L;  3IAY A;  1TWG B;  3GTQ B;  4KJO A;  1I6H B;  2PZU A;  1JIC A;  5M3F G;  4YWK A;  3PF4 A;  1BBU A;  1HQM C;  2MQH A;  1K28 A;  1NJI C;  2F0H A;  4WOR A;  3VR2 A;  4A3L G;  2KBN A;  1SJE D;  2H5X A;  2KCN A;  2Q8R E;  3V96 A;  4L5Q A;  1BCP F;  4TSS A;  3EA6 A;  1IKM A;  1IHZ A;  3AFQ A;  4B3R Q;  1BNZ A;  2RHQ B;  4DV7 L;  5C0X H;  3F2U A;  4QUF A;  2NZH A;  3PIP 3;  1DJR D;  3FP9 A;  3T4A C;  2I07 B;  3J81 i;  3UDG A;  1Y1V H;  1SR3 A;  3SK4 A;  1EFW A;  1PTO F;  1SFO H;  4BY7 H;  3L2P A;  2MUY A;  1YNX A;  3KDF A;  1JCK B;  4FXD A;  5JEA H;  1YZ6 A;  3CF5 A;  3NK9 A;  5EQ0 A;  3N6R A;  2EXZ A;  2MO0 A;  2N3S A;  5D3D A;  2BE5 D;  4DR7 Q;  1BQQ T;  2F0P A;  1D5X C;  4A75 A;  4JI1 Q;  4C3J H;  3D4R A;  2UUA L;  1S5F D;  1RIP A;  3HZX A;  3S2H B;  3ULP A;  1Y8O B;  3HOZ G;  5BR8 L;  4DAY A;  2F0V A;  4HSV A;  1K83 H;  1F2L A;  5EPJ A;  4UHV A;  4CKC A;  1HNW L;  2RF4 A;  4FF1 A;  5KYL A;  5EKI A;  2NTS A;  4BS9 A;  5A35 A;  1N36 Q;  4A3M G;  4X3U A;  2PQE A;  4K14 A;  4O1N A;  4KI0 A;  1JB3 A;  3K7A H;  5E3F A;  3HFZ B;  3MC0 B;  1AZP A;  1D7Q A;  4NDX A;  2WAQ G;  1CK1 A;  3HOU H;  2IT1 A;  3RN2 A;  1Q90 A;  3BZC A;  4MIU A;  1EY9 A;  2CHB D;  2F0I A;  5IP7 G;  2JP1 A;  3OMC A;  3K80 C;  1DOK A;  1IZ6 A;  3KLS X;  4G57 A;  1NUC A;  2B2W C;  3E9H A;  3SVM A;  5LMU L;  2TSS A;  2NVQ B;  4LFB L;  1CKN B;  4JI1 L;  1J6Q A;  1PVO A;  3TRZ A;  1YJW A;  2XTI A;  3ZJY C;  4RMF A;  4RG1 A;  3AU7 A;  2F3I A;  2E76 C;  3F1Z A;  1XTC D;  4EQO A;  1PXU A;  3K6O A;  2I5H A;  3QO2 A;  2ES2 A;  1BCP C;  1EOT A;  2VNU D;  2MFI A;  3K0Y A;  5COY A;  4A3B G;  3OW2 A;  1N36 L;  4B3T Q;  2VQF Q;  1XNQ Q;  3V05 A;  2UXC L;  2EOT A;  4RCO A;  4RKB A;  1PTO C;  2NVX B;  4K6L A;  2IW3 A;  2KEC A;  2EYF A;  2R3Z A;  2L12 A;  4RFB A;  1C7Y A;  1EY6 A;  3AYH B;  4LF6 L;  1CA6 A;  2B2V C;  4BBS B;  5LMN L;  4BA2 I;  2B2Y A;  5IWA Q;  1EEF D;  2ZM6 Q;  4K5W A;  1SE3 A;  3GDE A;  2R7Z H;  1EZ6 A;  2VZA A;  4C3H B;  1QVF A;  3ND9 A;  5IOC A;  2UXD Q;  4GN5 A;  4PZ8 A;  4OWX B;  5BN5 A;  2N88 A;  1XXG A;  2KUM A;  1ZEQ X;  3HOY B;  4TKO B;  2RCN A;  4LFC L;  1EQV A;  3HOZ H;  1AW7 A;  3R93 A;  3L9A X;  2VS1 A;  3A55 A;  3GTG H;  1MGS A;  3QJY A;  1TWH H;  1JB7 A;  3PGZ A;  1I4G A;  1JWM D;  5ELE A;  5CV6 A;  1BO0 A;  3CCQ A;  4LUV A;  1BBX C;  4A3M H;  4G4K A;  1S5B D;  2IX1 A;  3GO5 A;  5FLX E;  3I4N G;  2NVT H;  2K50 A;  1L1O C;  1Z6H A;  4BA1 I;  1PFS A;  2L15 A;  1LT5 D;  3I72 A;  1PH2 A;  1G6P A;  3J7A F;  1LTS D;  3OSO A;  1PH1 A;  2DNC A;  1OXX K;  2ZTE A;  4IQZ A;  1BCP B;  1Z7T A;  1SRO A;  4DXF A;  3P7J A;  5IGG A;  4JI6 L;  1F2Z A;  1A63 A;  2LSS A;  4RGT A;  3S1M B;  1E22 A;  2RKS A;  2B3G A;  3W2D A;  1JC7 A;  2K5H A;  4PV1 C;  2JA7 G;  4FO2 A;  4ZUI A;  1X56 A;  3V2T A;  1NR4 A;  2A68 C;  2HCC A;  4LFA Q;  1STG A;  1Y14 B;  1EWH A;  1ZYR D;  3SR1 A;  2Z9H A;  2YU9 H;  2KEN A;  1RD9 D;  4OL7 A;  5KEE A;  3I4L A;  1VQ9 A;  2R93 G;  2VL6 A;  3MWY W;  3PCO B;  1MSG A;  1XMO L;  1QIL A;  2HUG A;  3S2D H;  5JPN C;  1EUJ A;  4XIG S;  4GNX C;  4A3K B;  3UI2 A;  3E9I A;  4KY7 A;  3I4M B;  1KHI A;  2PQA B;  4RCN A;  5GAG C;  4A3F H;  2QW7 A;  1WD1 A;  1IW7 D;  4JI5 Q;  1X9N A;  2NN6 I;  4IZ8 A;  1E0B A;  3M4P A;  3TBI B;  1CM9 A;  1STN A;  1B8A A;  2XWJ B;  2SEB D;  1HTL D;  2NUC A;  1L0X B;  3H6M A;  2PI2 A;  2OCE A;  3GTM H;  4OO1 I;  2QKI C;  4JI8 Q;  2JXM B;  4IFD H;  2CCZ A;  4KD4 A;  3R2T A;  4PZ6 A;  2VXW A;  4HJ8 A;  1B50 A;  1TY0 A;  2SNM A;  1UWV A;  3G71 A;  1K8G A;  3M4O B;  2F0G A;  4RGN A;  2PYK A;  2RSO A;  4ME3 A;  1I3Q H;  1O7I A;  4OIK A;  2A5H A;  1L1O B;  1CHQ D;  3F2D A;  2MP1 A;  4X66 Q;  1Y69 U;  2ASB A;  1M1K C;  2G9D A;  2R61 A;  2ZTD A;  1Y8N B;  3PIO A;  3HKZ B;  5FLM H;  1KIX A;  4NMZ A;  1CI3 M;  5M5X H;  2JSO A;  1QZH A;  2QEX A;  5CYU A;  1CZG A;  1LTB D;  1WYD A;  4IPH A;  1S5D D;  4RA8 A;  2CKZ B;  1R9T B;  3AQQ A;  3M85 A;  1N34 Q;  3M9B A;  1BBW A;  2CQA A;  1W2B A;  3I4N H;  3B6Y A;  1JJG A;  3CQZ H;  1GUG A;  1TR5 A;  2D9U A;  1RJT A;  5JPM C;  3K57 A;  2UUB Q;  3DLL A;  1RTN A;  4DV6 Q;  3TP7 A;  2ZXO A;  3OIQ A;  2B2T C;  3FVQ A;  4HAE A;  1JR0 D;  4JW0 A;  2B8F A;  4JC0 A;  2QF7 A;  4RWS C;  1GXD C;  4DV1 Q;  4UDU C;  4H0L C;  3VA7 A;  4BBR G;  2I5L X;  1S5C D;  3D4D A;  1VQO A;  4JI3 Q;  1HZ9 A;  3QWN A;  3GTL B;  2PW7 A;  1G8Z D;  1KD1 C;  5C4X B;  1C48 A;  1S3O A;  2KQ3 A;  1D2B A;  3STB D;  1S5E D;  2E8G A;  3TP5 A;  2ZJR A;  1XJV A;  3S15 H;  2OWO A;  1PDQ A;  5KIX A;  1GUN A;  5IGE A;  1LAB A;  4HIO A;  3NTH A;  4HIM A;  3K5O A;  3PIO 3;  4C56 C;  2F3V A;  1PRT D;  5K36 H;  4DFA A;  3I90 A;  3KBG A;  3J81 j;  2BA0 A;  5D3I B;  1N34 L;  5CV8 A;  4YIJ A;  1EIY B;  3LX0 A;  4DR1 L;  3NWS A;  1ENF A;  5ELN A;  4PG3 A;  2E2H B;  2EY1 A;  4XDX A;  3GD7 A;  4JI7 L;  3GTP H;  2K14 A;  2F4I A;  3NE5 B;  4L5T A;  4R1J A;  1QOH A;  3GV6 A;  1S40 A;  1JJC B;  2Z8L A;  2A74 C;  3CD6 A;  1AZQ A;  3PUY A;  5IYD G;  4XQN A;  2HD3 A;  3IKJ A;  1DM0 B;  1VQ7 A;  4POG A;  1V9P A;  2B39 A;  2RDG A;  1L2F A;  3JC6 6;  3D3R A;  3GP7 A;  5K5P A;  4A3D B;  4PMC A;  2K33 A;  3G6J B;  1MIU A;  3A54 A;  1VQJ A;  3A5Z B;  1NTG A;  3RZO B;  1VQ6 A;  1KNA A;  1EQR A;  2K05 A;  2MGS A;  5DAU A;  3C46 A;  4EQN A;  3TP8 A;  3BDC A;  4HJ5 A;  3NHH A;  2NZ1 D;  2NVY B;  2E2J H;  3NXW A;  4XQJ A;  1V1P A;  2D62 A;  2A69 C;  4CDD C;  4GKJ Q;  3HS0 C;  1WTR A;  1IYU A;  1Q1B A;  4E6I A;  2WP8 J;  1WTH A;  4K0K L;  2CFM A;  3KF8 B;  5C44 B;  1TWC B;  3D6W A;  1AH9 A;  1XYI A;  1JOO A;  1FJG L;  5KGU A;  1Q86 C;  4JI4 L;  1BVS A;  4ZKB B;  5M3F B;  3EJI A;  5ISR A;  4BBR H;  4JOI C;  3HOW G;  4XXE A;  5JVG 3;  3TZU A;  4ZUJ A;  1K0R A;  4RH6 A;  3VR3 A;  2RBM A;  4L63 B;  3H09 A;  4KN4 C;  2O5J C;  1I50 B;  2K01 A;  1VQN A;  1ASZ A;  1M8A A;  3J80 i;  4BBS H;  1H9J A;  3Q6S A;  3D4W A;  5CC4 A;  4XT1 B;  1TQO A;  4BY1 H;  2R6G A;  4KHV A;  2ZJQ A;  1QE6 A;  3URY A;  3NEM A;  3QOJ A;  3H15 A;  1MJE A;  3PUZ A;  4A93 G;  4DV0 Q;  4LF4 Q;  1EYC A;  3J7A V;  4GKJ L;  4C1N K;  2L55 A;  5A2Q E;  2AHO B;  3C1E A;  3NSW A;  5T1I A;  1CT1 D;  1IYJ B;  5ELF A;  4DV4 Q;  1QUQ B;  4XT3 B;  3HOX B;  1H9S B;  2XRQ D;  4AQY Q;  3SK6 A;  2Q2U A;  1YHA A;  3NTK A;  1SSO A;  3PQI A;  1LV9 A;  3QIA A;  1RKN A;  1GHJ A;  2F52 A;  3T51 B;  4QIW B;  3S16 B;  4LF8 L;  3E0J A;  2FIN B;  4OHJ A;  4RKL A;  5F2D A;  4X3K A;  2SNS A;  4DUZ Q;  4LF7 Q;  3P20 A;  4QB4 A;  5EPK A;  4QIW E;  3AEV A;  1A3T A;  3RLF A;  2D5D A;  3S1M H;  2BCO A;  3ERO A;  3VR6 A;  2Z6K A;  2F4V L;  3KLS A;  1VDZ A;  2A6H C;  5EKL A;  2VUM H;  4BY7 G;  4C3I G;  1DON A;  1PTO H;  5C0X I;  2MJ8 A;  2PNH A;  1TS5 A;  1XNR Q;  5JEA G;  4HIK A;  2AKW B;  5IIF A;  4ZRZ A;  4DK0 A;  3FKI G;  3UE0 A;  3SDZ A;  5C4J B;  2WAQ E;  3N52 A;  1JE5 A;  4JI2 Q;  2Y0S B;  1OXU A;  3Q8D A;  4H13 C;  3VYS A;  2F0J A;  2LY7 A;  2Z4H A;  3EIV A;  3DWA A;  1OXT A;  5FOB B;  1QZG A;  1SBB B;  3IFT A;  1TS2 A;  2R92 G;  3HOW H;  1BCP D;  2EVB A;  3MFG A;  3RLN A;  2K75 A;  2E2I H;  2AUJ D;  3CHB D;  1YNN C;  4R8N A;  4O2D A;  3A0J A;  1K73 C;  1L0Y B;  1A3U A;  3T13 A;  4WFN 3;  1TWA H;  4L5S A;  1EQQ A;  3EFX D;  5LHY 1;  1ASY A;  2IX3 A;  1PTO D;  3RR5 A;  3BG3 A;  1WCM G;  4DV2 Q;  2B8G A;  4ID6 A;  1R4P B;  1SDF A;  4AH6 A;  3D31 A;  4Y7N B;  4N9T A;  3BS1 A;  4N8X 1;  4L8J A;  1RDP D;  5C3X A;  1GM5 A;  3HOV B;  2EDG A;  4X6A H;  1HJP A;  2KHS A;  1SYD A;  4IUP A;  1BUV T;  4HMI A;  4RAU C;  1NCV A;  3WOE A;  4AYB G;  2K5Q A;  2EXD A;  2Q2H A;  2XWB B;  4ODG A;  1KC8 C;  1A2U A;  3FPP A;  2JYO A;  4YCU A;  3VR5 A;  3J81 E;  2OTL A;  4UY8 C;  1A8V A;  3H94 A;  1PA6 A;  4GLA C;  4DR3 Q;  4GKK Q;  3K5N A;  3RNU A;  2LXJ A;  3GTO B;  1YIT A;  1CQV A;  4DV3 L;  3K81 C;  2N55 A;  1CA5 A;  1EYA A;  4DU9 A;  3A7L A;  2JA5 B;  3QOL A;  3GTJ H;  3I3C A;  3VDY A;  1ICF B;  3PO2 G;  2KCC A;  4DR5 Q;  4A3I B;  1Q3L A;  1KTK A;  4C3I H;  1IBL Q;  1VQ8 A;  5HUR A;  4FXG C;  4IPD A;  3RZD B;  3MTS A;  1E3P A;  3FKI H;  5IOD A;  4LF9 Q;  5C3E B;  1X32 A;  2XNA C;  2JA6 B;  2F03 A;  3PO3 B;  3TP6 A;  4FXK C;  1B2T A;  3MZ5 A;  2X6L A;  2R7Z G;  2RA4 A;  1PYB A;  4GZY C;  3I8Z A;  3KOJ A;  2R92 H;  1O78 A;  1U4R A;  2J0T D;  3U4Z A;  1UEA B;  3MHB A;  1Q46 A;  4CDE C;  2R93 B;  3DXJ C;  4DR6 Q;  4J15 A;  4KN7 C;  2IY5 B;  5IP9 G;  1SYB A;  2E2H H;  3PUX A;  3A56 A;  5G3L D;  2BH8 A;  1V1O A;  2NTT A;  1RL2 A;  1N32 Q;  1K0S A;  4B3R L;  4A4I A;  4QUC A;  1L0W A;  1WCM H;  1SNC A;  3RUZ A;  2CW0 C;  5IYB G;  1IYV A;  2OXP A;  3Q24 A;  2N78 A;  3BJU A;  4F88 A;  4BXX H;  4B9X A;  4BWG B;  4DR2 Q;  1N33 Q;  4C2M B;  1X3Q A;  2JN4 A;  3TRE A;  3C1F A;  1LLR D;  3KJO A;  2BDO A;  3BVZ A;  1SLJ A;  1I4X A;  4YHH Q;  2SDF A;  2ZXP A;  1VQC A;  3R2I A;  5KRU A;  2FXQ A;  3CCS A;  4AIM A;  2JA8 G;  1ET6 A;  4ABN A;  4Y52 H;  4DV5 Q;  4CGY B;  3H3V H;  3OOC A;  4XTC S;  4DR7 L;  4A3E B;  3VA5 A;  1K3B C;  2I5M X;  4O42 A;  5AFW A;  3S17 H;  1EU4 A;  2X69 A;  1X65 A;  5COR A;  4YY3 Q;  1BXT A;  2Z6B A;  3H0G H;  5M5W H;  1Q81 C;  1E2V A;  2MO1 A;  4UAI A;  1UE6 A;  3M3Y H;  3NEN A;  1CKN A;  5C44 H;  3NBH A;  4A3F G;  4MHE A;  1HZA A;  1QG7 A;  1GD7 A;  1STH A;  3KYH C;  1K8A C;  2B63 H;  1B3A A;  1ENC A;  3GV3 A;  4KHP Q;  1F9P A;  2HT1 A;  3PO2 H;  1DD2 A;  4GOP C;  1SE2 A;  1UE7 A;  4WJW A;  1SYG A;  2EYL A;  1DGS A;  5ELO A;  4HJA A;  5DNF A;  4DR2 L;  1N33 L;  3W1G A;  2IHE A;  4IFD G;  2ATW A;  4JBM A;  4NKL A;  3D0F A;  4JYA Q;  2WB1 G;  5M3M B;  3FPU B;  3X3N A;  3CXC A;  4GN3 B;  1IL2 A;  1LT3 D;  3S1R B;  2F0E A;  4DV5 L;  3S1N B;  3X3M A;  2EIF A;  4K2L A;  1LTA D;  5IP9 H;  3NPP A;  3ITP A;  3E5S A;  1E1T A;  4POF A;  5FLM G;  1QCB D;  2PPB C;  2F0T A;  4P74 A;  2RHS B;  1HA6 A;  1O7L A;  1X3F A;  3I7F A;  2YYZ A;  2CVR A;  3KLW A;  2DJF C;  2K5N A;  3DEP A;  5M9O A;  1FNW A;  3HOX H;  1XPR A;  5M5Y B;  4IOA A;  4A3J B;  5E1F A;  2G5D A;  5IYB H;  2EE1 A;  1CHP D;  2VQF L;  4B3T L;  2F0D A;  1XNQ L;  1PH9 A;  2HCI A;  2IHF A;  1EY4 A;  4RHR A;  3MAQ A;  4A3G B;  4KKU A;  4A76 A;  4IJH A;  1HUN A;  4FF2 A;  4I7Z C;  2QA4 A;  2YTX A;  2NBF A;  1P16 A;  3BYY B;  1EL0 A;  1VQA A;  4CJ2 C;  1HR0 W;  5IWA L;  3GTK H;  1SE4 A;  2DGY A;  2EJF C;  2PMZ E;  1PH7 A;  2K32 A;  3O13 A;  2ZM6 L;  2JA8 H;  3I2Z A;  4XYO A;  1VMC A;  1D1I A;  4DNR B;  4GOP B;  2UXD L;  3CP0 A;  3S14 B;  1UNS A;  1Y1W B;  3PMF A;  3OW7 A;  2ICE C;  3L3O C;  2LFN A;  1W3S A;  3AFP A;  4DR4 Q;  1PZI D;  3QB3 A;  1DXM A;  5T1G A;  2BOS A;  1M4V A;  5KND A;  2CH4 A;  2N49 A;  2VY3 A;  2DNE A;  1I4Q A;  4XQQ A;  1D1K A;  3MEH A;  3T56 B;  5FLX c;  2EY5 A;  1VCI A;  3FDT A;  1HNZ Q;  1EWC A;  3NQT A;  5K36 G;  2D0P A;  2Q2I A;  2B2V A;  1AE3 A;  3MXN A;  2M9V A;  3PUV A;  1EZ8 A;  1HRJ A;  2QDL A;  4DF7 A;  2AWN A;  2NN6 G;  5E4X A;  5JVH 3;  1B4O A;  1AN8 A;  3DM3 A;  3A74 A;  2MPM A;  1ILQ A;  3OYY A;  2YTV A;  4J8Q A;  2KA7 A;  1X3G A;  4OO1 G;  1OXS C;  1YNJ D;  1YIJ A;  5C4Z A;  4LUO A;  2BDN A;  1Z9F A;  2RSN A;  4DAP A;  5H1S E;  4X64 Q;  1E24 A;  2RVL A;  2PI2 E;  5IT9 E;  1I4H A;  2UXB Q;  5J1Z A;  2DY8 A;  2O2L D;  4LFA L;  4OEL B;  5DLQ E;  1TWF B;  1ZXT A;  4OX9 Q;  2K5V A;  4DKA C;  3QR8 A;  2PO4 A;  4DN4 M;  2KED A;  4DAM A;  1T5X D;  3S1Q B;  1FR3 A;  2F0W A;  3G7L A;  2HQE A;  3LWE A;  1IXR A;  1L1O A;  2ZTC A;  1X6O A;  1KAA A;  1CKO A;  3BVG A;  5DEH A;  1TWG H;  1VQK A;  3GTQ H;  3PUW A;  5TSS A;  3ER0 A;  1I6H H;  4KK7 A;  4JI5 L;  3E3X A;  1VMP A;  1IKL A;  1U0L A;  1RCV D;  2FHT A;  1SND A;  3BYT B;  2F0S A;  3VYR A;  4ZYS A;  2C9O A;  5C4H A;  2P5Z X;  2TMP A;  1G6Z A;  1KAB A;  3LGJ A;  4JI8 L;  2GN5 A;  1EEI D;  1II3 A;  2AQ2 B;  1T9H A;  3Q0A A;  1BDO A;  1SN8 A;  5AJ3 Q;  1N8R C;  1WTO A;  4ILW A;  4IOC A;  4LNQ A;  4JI0 Q;  2LKV A;  4X64 L;  4GNX A;  4X65 Q;  4HTH A;  4IUU A;  2L11 A;  4KLK A;  4ZQ3 A;  5ELC A;  1D6E C;  2UU9 Q;  1STA A;  2VQE Q;  4B08 A;  4DK6 C;  4U67 3;  2B2U C;  3R8B A;  3NQI A;  4X66 L;  1WTV A;  1WOC A;  3KF6 B;  1GOZ A;  2A6H D;  4BBS G;  4J6H A;  3KLR A;  3W1B A;  1SNM A;  2JA6 H;  4BY1 G;  1MKH A;  2EY2 A;  4M1U B;  4HN7 A;  3BU2 A;  1HA5 A;  3I56 A;  1Y1V B;  2IJ0 A;  4YWL A;  4YWM A;  5KNB A;  1SFO B;  5C6A A; 
#chains in the Genus database with same CATH homology
 4IAL A;  1EU3 A;  5IGF A;  5BN3 A;  4ZLT F;  2NN6 H;  1PMR A;  1JQY D;  3FMC A;  4Q5V A;  4OO1 H;  4V19 0;  5I2Y A;  5JOB A;  2ID0 A;  5I6W A;  3MFY A;  1YNN D;  1SJH D;  1UUP A;  5JJZ A;  1NR2 A;  4C3J B;  1EIH A;  4LK1 C;  3HP3 A;  3KK7 A;  1TKW B;  1CFM A;  1KLU D;  4P2C B;  1O7Z A;  2Z4I A;  3FEW X;  1STE A;  3RMH A;  5FO8 B;  4QCL A;  1DZ1 A;  1S4Z A;  1O7Y A;  3K7A B;  3ERQ A;  4B9W A;  1QB5 D;  3HOU B;  1GUO A;  3JAM E;  1NSN S;  4DNT B;  5D14 A;  2F0N A;  2L1B A;  3J80 E;  1J9O A;  3IL8 A;  2XIW A;  5A2Q L;  1DCZ A;  4HCE A;  1EY0 A;  1ZKO A;  2FJ2 A;  1G29 1;  2J7Z A;  3KF8 A;  1DYQ A;  5CV5 A;  1PZJ D;  2PW5 A;  5J39 A;  1A6X A;  2EYO A;  3J7Y W;  1TT2 A;  2EJG C;  1CZW A;  3TDQ A;  2F0K A;  3M7G A;  1CTM A;  1ICW A;  4DA2 A;  2M2L A;  1GUW A;  1HHV A;  3I91 A;  1MI2 A;  3EQL C;  1ROD A;  2FMC A;  3ND8 A;  1SMY C;  1WTX A;  3AB9 A;  4ZK9 B;  1CQF A;  3MXP A;  3TSS A;  5J22 A;  1HFG A;  3NTI A;  2R7Z B;  1B1Z A;  4FF3 A;  1EYD A;  1TVX A;  1HFN A;  4LAA A;  5CBA E;  3NWT A;  2NYZ D;  4KTA A;  3GQB A;  4NP5 A;  3HOZ B;  1WVL A;  2PCF B;  1H9S A;  2CW0 D;  4EVO A;  3GTG B;  4C1N I;  2E75 C;  4IUN A;  4X3S A;  1UAP A;  5E4W C;  1QNK A;  1TWH B;  5DM7 3;  1I6V C;  4A3M B;  1TS3 A;  1BOS A;  1Q1E A;  4EGV A;  4KV6 A;  2NVT B;  1B9N A;  2DY7 A;  3BVM A;  2WAQ B;  4PNY A;  1X3P A;  2EZV A;  1G2T A;  5FO9 B;  5C5M A;  1SNO A;  4EQP A;  3J81 L;  2YU9 B;  1XX8 A;  4Z9C B;  1FYC A;  4ULL A;  1B9M A;  3S2D B;  1STB A;  3R3O A;  4G7H C;  1DOL A;  3DUZ A;  2L9H A;  4A3F B;  1F77 A;  4A3B B;  2JEA I;  1RF2 D;  5I6Y A;  4LJZ C;  1SNP A;  3VYT A;  3WOF A;  1EIG A;  4F7X A;  4JBW A;  2KEE A;  2OEO A;  2QCP X;  3GTM B;  2SOB A;  1V43 A;  4NW2 A;  5FO7 B;  2WB1 B;  1SYE A;  2D2C C;  2F0O A;  1H9K A;  1I3Q B;  4U68 A;  3KBX A;  2F0Q A;  1D5Z C;  4IUR A;  1VF5 C;  4KY5 A;  3MXU A;  1GUT A;  5EGT A;  5I9P A;  1DOM A;  2LS0 1;  2O4X A;  1LAC A;  1HPC A;  3VYU A;  5M5X B;  2VB3 X;  5CGK A;  3DM1 A;  3K58 A;  4R8I A;  3PV0 A;  3I4N B;  3CQZ B;  3TZD A;  3DHQ A;  1PRT B;  5IGC A;  1RTO A;  2A68 D;  3OMG A;  2EYH A;  5EBC A;  3NBI A;  2IWH A;  2E2D C;  2K03 A;  4K6D A;  5CV7 A;  5I9O A;  2JA7 B;  2NB0 A;  1F9Q A;  4KHZ A;  1JOK A;  2FFK B;  3S15 B;  4FF4 A;  4PMW A;  1HQR D;  3EVQ A;  1F2M A;  1JE4 A;  3I73 A;  1KDC A;  4H44 C;  1EY5 A;  2K28 A;  4J1M A;  1HTP A;  3HEJ A;  1U9R A;  1JOQ A;  2B2Y C;  1ENA A;  2WV6 D;  3U9O A;  2F1M A;  5CMD A;  2IX0 A;  3GTP B;  3HGB A;  4K2K A;  3ONA B;  2F0U A;  1WD0 A;  4R9W A;  1FD7 D;  3VR4 A;  4IUT A;  4V0B A;  3C2P A;  4K8J A;  1WTQ A;  2WII B;  3BDO A;  2Q8I B;  4HCS A;  2F0L A;  5C0X J;  4IUV A;  3RD4 A;  5ELB A;  3WDN A;  1TS4 A;  1FNV A;  3K5L A;  1K8O A;  2E2J B;  2K04 A;  1SNQ A;  4IUQ A;  3D8G A;  5FLX L;  5JEA J;  1EQT A;  1D5M C;  2BA1 A;  3CRL C;  1JOR A;  2V4D A;  3CU7 A;  1PLF A;  1EY8 A;  5G3L F;  1SYF A;  4BBR B;  1PZK D;  4IFD I;  1ILP A;  4CJ1 B;  1WTP A;  3OWF A;  5LL6 S;  4I65 A;  1IL8 A;  5FKA C;  5BN4 A;  2AUK A;  3TME A;  1OXV A;  4WRD A;  4G7O C;  4XYQ A;  4ME5 A;  4Q0F A;  4BY1 B;  1HCZ A;  2RDF A;  2A6E C;  1G91 A;  2NWG A;  1FNU A;  1O80 A;  2ZT9 C;  5FK9 C;  3P75 A;  1U4M A;  4FP5 D;  2F0F A;  4FYD A;  5NUC A;  4G7Z C;  1LTI D;  2AQ3 B;  1STY A;  2ICI A;  2B2W A;  1FGB D;  2A73 B;  1LT4 D;  2PMZ B;  4CKB A;  4HMJ A;  2Q8T A;  3SE0 A;  3M4Y A;  1MBY A;  2OT2 A;  1F2Y A;  4CBV A;  1W6K A;  1MD2 D;  3DMU A;  3QG1 A;  5IT9 L;  2QIL A;  1U4L A;  4KKT A;  1Q12 A;  2F0M A;  4FVM A;  4HSP A;  4RGM A;  2A69 D;  5EPL A;  1XWE A;  1ONL A;  5EJW A;  3Q22 A;  2VUM B;  1K8M A;  2E74 C;  5EKK A;  1PTO B;  1PFM A;  1SYC A;  2BE5 C;  5HGT A;  3CRK C;  4RHS A;  1LO5 D;  1BF4 A;  4KJN A;  3IFD A;  4FNF A;  4PQX A;  4HR7 B;  1HXY D;  3HOW B;  3L7Z C;  3K59 A;  2E2I B;  3H91 A;  1PFB A;  5C3W A;  1MSH A;  2K1B A;  3HG9 A;  1TWA B;  2PNR C;  3HRZ C;  4DXG A;  1WTW A;  4H7B A;  1SMY D;  4CKE A;  1A2T A;  2EYM A;  4ZKC B;  2QEJ C;  2O5I C;  3W3A A;  4ZAI A;  2VB2 X;  4A93 B;  1EFI D;  4F87 A;  4K5V A;  5CBE E;  2M00 A;  1AP0 A;  1VF7 A;  2K5W A;  1Y8P B;  2L4N A;  1GJX A;  1I4P A;  2K7V A;  3SK8 A;  5C5L A;  1T5E A;  3E6Z X;  1OO9 B;  2IPK D;  3H3V C;  1V8Q A;  1W6J A;  5JAV A;  3GTJ B;  4M8A A;  4C3H G;  4JK1 C;  2K5D A;  1BR9 A;  4BY7 B;  4C3I B;  3D6C A;  1C8C A;  2JEB I;  2WKD A;  4IFD J;  3SEB A;  3JAM L;  3FKI B;  2PZW A;  2L0C A;  2Z1C A;  4DAV A;  3J80 L;  4K8I A;  4TRD A;  3CKI B;  2HDM A;  2EJM A;  2R92 B;  3DWQ A;  2XSC A;  2QDB A;  1AFP A;  3MA2 B;  3K5M A;  4S3S A;  4OGQ C;  1K83 B;  1PYW D;  2F3W A;  1WCM B;  3TN2 A;  1ML0 D;  4KMU C;  2EYJ A;  1ESF A;  1H9R A;  2I46 A;  5I2X A;  2XRS D;  2K6A A;  2IL8 A;  3I70 A;  2B2T A;  4TQU S;  1E2Z A;  3LNN A;  2X6G A;  4CJ0 B;  3BZD B;  3OIP A;  1QNU A;  2JE6 I;  1ZYR C;  2H4O A;  4AYB B;  2C5C A;  3DWP A;  1V1P B;  2B2U A;  1I4R A;  1KNE A;  5IGD A;  5DM6 3;  4QF4 A;  3S17 B;  2FMM A;  1G2S A;  1ET9 A;  2KVM A;  3H0G B;  1PRT F;  5M5W B;  1IW7 C;  2J4X A;  2WAC A;  1SXT A;  3M3Y B;  2ENB A;  1PFN A;  3ZYY X;  1KLG D;  5ELD A;  3P1H A;  1LTR D;  5KYI A;  2B63 B;  2RQX A;  1A3V A;  3M7N A;  2XN9 C;  3AMU A;  3MXG A;  3PO2 B;  1B44 D;  1LTG D;  1YNJ C;  3LWU A;  1JWU D;  1LTT D;  5KNC A;  1GUS A;  2AQ1 B;  1EY7 A;  1F9S A;  3A8K E;  1JWS D;  1ESR A;  2WIN B;  3T16 A;  5I4D A;  2MHV A;  1TU2 B;  3Q23 A;  1B53 A;  1HUM A;  1QWY A;  4X3T A;  2EYP A;  2LMC B;  2AWO A;  4DGZ A;  1Q8I A;  3MVV A;  4HED A;  2KJX A;  5CV9 A;  3OWE B;  1SAP A;  4KY6 A;  4K5X A;  4QMG A;  5CR3 A;  5D65 A;  3S9W A;  3KUP A;  2DN8 A;  3A7A B;  4F8M A;  3SXH A;  3OPO A;  3SHL A;  4OIJ A;  1H9M A;  1E2W A;  3A8I E;  3A8J E;  1KDA A;  3NP8 A;  5IGB A;  3U9S A;  5C0X G;  1U4P A;  1F9R A;  3NUC A;  3GTK B;  2XVS A;  3T53 B;  5LL6 X;  2JA8 B;  2ZXR A;  5EBD A;  2GA4 B;  4KKS A;  4DK1 A;  2L5T A;  2EY6 A;  1PRT C;  2EPB A;  1J8I A;  4RGO S;  3FRP B;  2WKC A;  1NAP A;  1TII D;  1SEB D;  3DEO A;  4N9P A;  4C3J G;  2G9H D;  4KD3 A;  1TY2 A;  3OHX C;  3C3L A;  1C4Q A;  5CV4 A;  1RHP A;  3SK5 A;  4MN3 A;  1AEX A;  1A15 A;  2OF1 A;  1Z47 A;  2H1E A;  4CHT B;  2RDH A;  4LMQ D;  2KOL A;  4PMB A;  3BDL A;  2A6E D;  2PZT A;  1KDB A;  1R4Q B;  1GHK A;  1QJO A;  4L6T B;  2HDL A;  1LT6 D;  4IN3 A;  3IAY A;  1TWG B;  3GTQ B;  4KJO A;  1I6H B;  2PZU A;  1JIC A;  1HQM C;  2F0H A;  4WOR A;  3VR2 A;  1SJE D;  2KCN A;  2Q8R E;  3V96 A;  1BCP F;  4TSS A;  3EA6 A;  1IKM A;  1IHZ A;  1BNZ A;  5C0X H;  3F2U A;  4QUF A;  3PIP 3;  1DJR D;  3T4A C;  2I07 B;  3SK4 A;  1PTO F;  2MUY A;  1JCK B;  4FXD A;  5JEA H;  3NK9 A;  5EQ0 A;  3N6R A;  2EXZ A;  5D3D A;  2BE5 D;  1BQQ T;  2F0P A;  1D5X C;  3D4R A;  1S5F D;  3HZX A;  3S2H B;  1Y8O B;  4DAY A;  2F0V A;  4HSV A;  1F2L A;  5EPJ A;  4CKC A;  4FF1 A;  5KYL A;  5EKI A;  2NTS A;  4BS9 A;  5A35 A;  4X3U A;  2PQE A;  4K14 A;  4O1N A;  4KI0 A;  1JB3 A;  5E3F A;  3MC0 B;  1AZP A;  4NDX A;  1CK1 A;  2IT1 A;  1Q90 A;  4MIU A;  1EY9 A;  2CHB D;  2F0I A;  2JP1 A;  3OMC A;  1DOK A;  3KLS X;  4G57 A;  1NUC A;  2B2W C;  3SVM A;  2TSS A;  2NVQ B;  3AU7 A;  2E76 C;  1XTC D;  4EQO A;  1PXU A;  3K6O A;  3QO2 A;  1BCP C;  1EOT A;  2VNU D;  3K0Y A;  5COY A;  3V05 A;  2EOT A;  4RCO A;  4RKB A;  1PTO C;  2NVX B;  4K6L A;  2IW3 A;  2KEC A;  2EYF A;  2R3Z A;  2L12 A;  4RFB A;  1EY6 A;  1CA6 A;  2B2V C;  4BBS B;  4BA2 I;  2B2Y A;  1EEF D;  4K5W A;  1SE3 A;  1EZ6 A;  4C3H B;  3ND9 A;  5IOC A;  5BN5 A;  2N88 A;  1XXG A;  2KUM A;  1ZEQ X;  3HOY B;  4TKO B;  1EQV A;  1AW7 A;  3R93 A;  3L9A X;  3A55 A;  1MGS A;  3QJY A;  1I4G A;  1JWM D;  5ELE A;  5CV6 A;  1BO0 A;  1BBX C;  4G4K A;  1S5B D;  2IX1 A;  3GO5 A;  5FLX E;  1Z6H A;  4BA1 I;  1LT5 D;  3I72 A;  3J7A F;  1LTS D;  3OSO A;  2DNC A;  1OXX K;  4IQZ A;  5IGG A;  1BCP B;  1Z7T A;  4DXF A;  3P7J A;  1F2Z A;  4RGT A;  3S1M B;  2RKS A;  3W2D A;  1JC7 A;  4PV1 C;  4FO2 A;  4ZUI A;  3V2T A;  1NR4 A;  2A68 C;  2HCC A;  1STG A;  1EWH A;  1ZYR D;  3SR1 A;  4OL7 A;  1RD9 D;  5KEE A;  3I4L A;  3MWY W;  1MSG A;  1QIL A;  2HUG A;  5JPN C;  4XIG S;  4A3K B;  3UI2 A;  4KY7 A;  3I4M B;  4RCN A;  1WD1 A;  1IW7 D;  2NN6 I;  4IZ8 A;  1E0B A;  3TBI B;  1CM9 A;  1STN A;  2XWJ B;  2SEB D;  1HTL D;  2NUC A;  1L0X B;  3H6M A;  4OO1 I;  2QKI C;  2JXM B;  4IFD H;  4KD4 A;  3R2T A;  2VXW A;  1B50 A;  1TY0 A;  2SNM A;  3M4O B;  2F0G A;  4RGN A;  2PYK A;  2RSO A;  4OIK A;  2A5H A;  1CHQ D;  2MP1 A;  1Y69 U;  2G9D A;  2R61 A;  1Y8N B;  3HKZ B;  4NMZ A;  1CI3 M;  2JSO A;  5CYU A;  1CZG A;  1LTB D;  1S5D D;  4RA8 A;  1R9T B;  3M85 A;  2CQA A;  1GUG A;  1TR5 A;  2D9U A;  1RJT A;  5JPM C;  3K57 A;  1RTN A;  3TP7 A;  2ZXO A;  3OIQ A;  2B2T C;  3FVQ A;  4HAE A;  1JR0 D;  2B8F A;  2QF7 A;  4RWS C;  1GXD C;  4UDU C;  4H0L C;  3VA7 A;  1S5C D;  3D4D A;  3QWN A;  3GTL B;  2PW7 A;  1G8Z D;  5C4X B;  1C48 A;  2KQ3 A;  1D2B A;  1S5E D;  3TP5 A;  1PDQ A;  5KIX A;  1GUN A;  5IGE A;  1LAB A;  3NTH A;  3K5O A;  3PIO 3;  4C56 C;  2F3V A;  1PRT D;  5K36 H;  4DFA A;  3I90 A;  3KBG A;  2BA0 A;  5D3I B;  5CV8 A;  4YIJ A;  3LX0 A;  3NWS A;  1ENF A;  2E2H B;  2EY1 A;  4XDX A;  3GD7 A;  2F4I A;  3NE5 B;  1QOH A;  3GV6 A;  2Z8L A;  2A74 C;  1AZQ A;  3PUY A;  4XQN A;  3IKJ A;  1DM0 B;  2B39 A;  2RDG A;  3D3R A;  3GP7 A;  5K5P A;  4A3D B;  4PMC A;  2K33 A;  3G6J B;  3A54 A;  3RZO B;  1KNA A;  2K05 A;  2MGS A;  5DAU A;  3C46 A;  4EQN A;  3TP8 A;  3BDC A;  3NHH A;  2NZ1 D;  2NVY B;  3NXW A;  4XQJ A;  1V1P A;  2D62 A;  2A69 C;  3HS0 C;  1WTR A;  1IYU A;  1Q1B A;  4E6I A;  2WP8 J;  5C44 B;  1TWC B;  3D6W A;  1XYI A;  1JOO A;  5KGU A;  4ZKB B;  5M3F B;  3EJI A;  5ISR A;  4XXE A;  5JVG 3;  3TZU A;  4ZUJ A;  4RH6 A;  3VR3 A;  2RBM A;  4L63 B;  3H09 A;  4KN4 C;  2O5J C;  1I50 B;  2K01 A;  1M8A A;  1H9J A;  3Q6S A;  3D4W A;  5CC4 A;  4XT1 B;  1TQO A;  2R6G A;  4KHV A;  1QE6 A;  3URY A;  3QOJ A;  3PUZ A;  1EYC A;  3J7A V;  4C1N K;  2L55 A;  5A2Q E;  3C1E A;  3NSW A;  5T1I A;  1CT1 D;  5ELF A;  4XT3 B;  3HOX B;  1H9S B;  2XRQ D;  3SK6 A;  3NTK A;  1SSO A;  1LV9 A;  3QIA A;  1RKN A;  1GHJ A;  3T51 B;  4QIW B;  3S16 B;  3E0J A;  2FIN B;  4OHJ A;  4RKL A;  5F2D A;  4X3K A;  2SNS A;  3P20 A;  4QB4 A;  5EPK A;  1A3T A;  3RLF A;  2D5D A;  2BCO A;  3ERO A;  3VR6 A;  3KLS A;  1VDZ A;  2A6H C;  5EKL A;  4C3I G;  1DON A;  1PTO H;  5C0X I;  2MJ8 A;  1TS5 A;  5JEA G;  5IIF A;  4ZRZ A;  4DK0 A;  3SDZ A;  5C4J B;  3N52 A;  2Y0S B;  1OXU A;  4H13 C;  3VYS A;  2F0J A;  2LY7 A;  2Z4H A;  3DWA A;  1OXT A;  5FOB B;  1SBB B;  3IFT A;  1TS2 A;  1BCP D;  2EVB A;  3MFG A;  2AUJ D;  3CHB D;  1YNN C;  4R8N A;  1L0Y B;  1A3U A;  3T13 A;  4WFN 3;  3EFX D;  5LHY 1;  2IX3 A;  1PTO D;  3BG3 A;  2B8G A;  4ID6 A;  1R4P B;  1SDF A;  3D31 A;  4Y7N B;  4N9T A;  3BS1 A;  4L8J A;  1RDP D;  5C3X A;  3HOV B;  2EDG A;  2KHS A;  1SYD A;  4IUP A;  1BUV T;  4HMI A;  4RAU C;  1NCV A;  3WOE A;  2K5Q A;  4ODG A;  2XWB B;  1A2U A;  3FPP A;  2JYO A;  3VR5 A;  3J81 E;  3H94 A;  3K5N A;  3GTO B;  1CQV A;  2N55 A;  1CA5 A;  1EYA A;  4DU9 A;  3A7L A;  2JA5 B;  3QOL A;  3I3C A;  2KCC A;  4A3I B;  1Q3L A;  1KTK A;  5HUR A;  4FXG C;  3RZD B;  3MTS A;  5IOD A;  5C3E B;  1X32 A;  2XNA C;  2JA6 B;  2F03 A;  3PO3 B;  3TP6 A;  4FXK C;  1B2T A;  3MZ5 A;  2X6L A;  2RA4 A;  4GZY C;  3I8Z A;  1O78 A;  1U4R A;  2J0T D;  1UEA B;  3MHB A;  2R93 B;  3DXJ C;  4KN7 C;  1SYB A;  3PUX A;  3A56 A;  5G3L D;  1V1O A;  2NTT A;  4QUC A;  1SNC A;  3RUZ A;  2CW0 C;  1IYV A;  2OXP A;  3Q24 A;  4F88 A;  4B9X A;  4BWG B;  4C2M B;  1X3Q A;  3C1F A;  1LLR D;  2BDO A;  3BVZ A;  1I4X A;  2SDF A;  2ZXP A;  3R2I A;  5KRU A;  1ET6 A;  4ABN A;  4CGY B;  3OOC A;  4XTC S;  4A3E B;  3VA5 A;  4O42 A;  5AFW A;  1EU4 A;  2X69 A;  5COR A;  1BXT A;  1E2V A;  4UAI A;  3NBH A;  4MHE A;  1QG7 A;  1STH A;  1B3A A;  1ENC A;  3GV3 A;  1F9P A;  1DD2 A;  1SE2 A;  4WJW A;  1SYG A;  2EYL A;  5DNF A;  4IFD G;  4NKL A;  5M3M B;  3FPU B;  3X3N A;  1LT3 D;  3S1R B;  2F0E A;  3S1N B;  3X3M A;  4K2L A;  1LTA D;  3NPP A;  3ITP A;  3E5S A;  1QCB D;  2PPB C;  2F0T A;  1HA6 A;  1O7L A;  2YYZ A;  2CVR A;  5M9O A;  3DEP A;  5M5Y B;  1FNW A;  4A3J B;  5E1F A;  2EE1 A;  1CHP D;  2F0D A;  2HCI A;  1EY4 A;  4RHR A;  3MAQ A;  4A3G B;  4KKU A;  1HUN A;  4FF2 A;  4I7Z C;  2NBF A;  3BYY B;  1EL0 A;  4CJ2 C;  1SE4 A;  2EJF C;  2K32 A;  3O13 A;  4XYO A;  1VMC A;  1D1I A;  4DNR B;  3S14 B;  1UNS A;  1Y1W B;  3PMF A;  3OW7 A;  2ICE C;  3L3O C;  2LFN A;  1PZI D;  3QB3 A;  1DXM A;  5T1G A;  2BOS A;  1M4V A;  5KND A;  2DNE A;  1I4Q A;  4XQQ A;  1D1K A;  3MEH A;  3T56 B;  2EY5 A;  1VCI A;  3FDT A;  1EWC A;  3NQT A;  5K36 G;  2B2V A;  3MXN A;  2M9V A;  3PUV A;  1EZ8 A;  1HRJ A;  4DF7 A;  2AWN A;  2NN6 G;  5E4X A;  5JVH 3;  1B4O A;  1AN8 A;  2MPM A;  1ILQ A;  4J8Q A;  2KA7 A;  4OO1 G;  1OXS C;  1YNJ D;  5C4Z A;  2BDN A;  2RSN A;  4DAP A;  2RVL A;  5IT9 E;  1I4H A;  5J1Z A;  2DY8 A;  2O2L D;  1TWF B;  1ZXT A;  2PO4 A;  4DN4 M;  2KED A;  3S1Q B;  1T5X D;  1FR3 A;  2F0W A;  3G7L A;  2HQE A;  3LWE A;  1KAA A;  3BVG A;  5DEH A;  3PUW A;  5TSS A;  4KK7 A;  1VMP A;  1IKL A;  1RCV D;  2FHT A;  1SND A;  3BYT B;  2F0S A;  3VYR A;  4ZYS A;  2C9O A;  5C4H A;  2TMP A;  1G6Z A;  1KAB A;  1EEI D;  1II3 A;  2AQ2 B;  3Q0A A;  1BDO A;  1WTO A;  4ILW A;  2LKV A;  4HTH A;  4IUU A;  2L11 A;  4ZQ3 A;  5ELC A;  1D6E C;  1STA A;  4B08 A;  4U67 3;  2B2U C;  3R8B A;  3NQI A;  1WTV A;  1GOZ A;  2A6H D;  4J6H A;  3KLR A;  1SNM A;  4M1U B;  2EY2 A;  4HN7 A;  1HA5 A;  1Y1V B;  2IJ0 A;  5KNB A;  1SFO B;  5C6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...