3I91A

Crystal structure of human chromobox homolog 8 (cbx8) with h3k9 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
RVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 8
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i91A00
2K28A 1ZXTA 3MWYW 1SAPA 2BDNA 4XDXA 5JJZA 1B50A 1WVLA 4QUCA 3DEOA 4R8IA 4LMQD 4ZKCB 1DOMA 2X6LA 2RVLA 3I90A 4ZK9B 1RTNA 2N55A 1IKLA 1WTRA 3N52A 3H91A 3P7JA 2B2VA 3ONAB 1NCVA 1Q3LA 1XX8A 2Q8RE 1WD0A 1F9RA 1HA6A 1SDFA 1HFGA 2HUGA 2KECA 2RSOA 3FDTA 1EIGA 4ZKBB 2M2LA 2CVRA 2H1EA 1NR4A 5EPJA 5AFWA 2MJ8A 4HSVA 3LWEA 4ZLTF 1WTWA 1WTPA 2NZ1D 2HDLA 4X3SA 5CBAE 3I3CA 1MSGA 2IL8A 4CJ0B 4IURA 1VMCA 3GV6A 3DM1A 2K03A 3MTSA 4X3KA 1BBXC 1B2TA 1G6ZA 3Q6SA 4O42A 5DNFA 1CA6A 1O7ZA 1G2SA 1X3QA 4ZAIA 5EPKA 2KEDA 4OIJA 2B2UC 3R93A 2L1BA 1BNZA 4UAIA 1DONA 2K1BA 1X3PA 2KVMA 2HCIA 4RWSC 2EE1A 3SVMA 1XYIA 3QO2A 4X3UA 5T1IA 1HUMA 1LV9A 2KEEA 1AP0A 1PLFA 1AZQA 2B2UA 4HCSA 1F2LA 1QG7A 3D6WA 4IUUA 1J9OA 2K05A 1AZPA 1EL0A 2N88A 5T1GA 2HCCA 4CJ1B 1MGSA 2HDMA 2K01A 2K04A 2RA4A 2X6GA 3G7LA 1KNAA 2MGSA 3I8ZA 4HAEA 4IUVA 2KOLA 1E0BA 1DOKA 1DZ1A 1HUNA 1PFBA 1S4ZA 3IFDA 3KUPA 5EQ0A 2DY7A 3TN2A 1U4MA 4NW2A 4OIKA 1M8AA 3DEPA 1B4OA 1O80A 2B2TC 1CA5A 1RJTA 4R9WA 3HP3A 4CJ2C 1PDQA 1PFNA 1G2TA 2SDFA 2NYZD 5E4XA 1TVXA 1JE4A 4IUPA 4RA8A 5CMDA 1QE6A 2MP1A 1NAPA 4MN3A 1B3AA 1BO0A 1F9SA 4MHEA 1ILPA 1EIHA 2FJ2A 1WTVA 2B2TA 2RSNA 2B2WA 3I91A 2FFKB 1ML0D 2MPMA 2FHTA 4IUQA 5EJWA 1WTOA 1C8CA 1HFNA 1MSHA 5COYA 4RAUC 1ILQA 2FINB 1GUWA 2J7ZA 5CORA 1CM9A 2VXWA 2D9UA 5CBEE 4DN4M 3FPUB 2B2YC 1IL8A 5D65A 1PFMA 1KNEA 3F2UA 5D14A 1A15A 1B53A 1NR2A 1HRJA 2FMMA 2B2WC 1ESRA 1U4LA 4QUFA 1WTQA 1ICWA 2JP1A 5E4WC 1EOTA 3UI2A 2KUMA 1MI2A 2L11A 1IKMA 1X32A 5EKIA 1VMPA 2NWGA 1RODA 1BF4A 1J8IA 1O7YA 2DY8A 1JICA 1U4RA 1DOLA 2B2YA 1F9PA 2XIWA 2R3ZA 5EPLA 1WTXA 4U68A 2X69A 1HHVA 1EQTA 3KBXA 4XT1B 1WD1A 4X3TA 2EOTA 1U4PA 4HEDA 4XT3B 4IUTA 2EPBA 2L12A 1SSOA 2JYOA 1F9QA 2L4NA 1RTOA 1QNKA 2L9HA 1G91A 3TZDA 3IL8A 2B2VC 1RHPA 3GV3A 2Q8TA
chains in the Genus database with same CATH superfamily
1ZXTA 4XDXA 1K8OA 4R8IA 2KENA 4DFAA 1DOMA 1TS4A 1VQMA 1RTNA 4L6TB 1ZYRD 3VR4A 5FO9B 1Y8NB 1VS0A 1FJGQ 4BY1G 2BH8A 1HA5A 1PZKD 4NXMQ 5F2DA 4DV6Q 3HOUH 4HIDA 2F0WA 4GNXB 1GUGA 1A62A 4HCEA 2HDLA 5JEAH 4X66L 1B2TA 4QMGA 2UU9Q 1PYBA 1FNWA 4JBWA 3Q6SA 5EBCA 1CA6A 3CCQA 2E5LL 3UDIA 3HOUB 3M9BA 1AH9A 2DGYA 2G5DA 4A3JH 4LF9L 3MC0B 5IYCG 3M4QA 1IYJB 5FK9C 1Y1VH 4DUZQ 1X56A 1BR9A 1EQRA 4B3ML 4A3JB 1J9OA 2YTXA 3VYSA 3MXNA 5J22A 1TWGH 4IUNA 2PQAB 3KLSX 4HMIA 1Y1VB 3S1RH 1VQ7A 3BVGA 2R92G 2NTTA 3U50C 3TDQA 4LUZA 2BA0A 1TWGB 3HKZE 4ZQ3A 2XGTA 4RGMA 3NWSA 3S1RB 1JOOA 4YCWA 1LTLA 5CMDA 3NXWA 3VYRA 1EY7A 3X3MA 1EUJA 1UAPA 2WIIB 2IJ0A 3H3VI 2XN9C 4X65L 3OWEB 1GHKA 1PMRA 2A6EC 1KAWA 4DAYA 4N8X1 1PVOA 1HZCA 4POGA 3H09A 5M3FG 1KHIA 2WAQE 4EGVA 2LXJA 3PSIA 1K28A 4JCVE 1SR3A 2HQLA 1BXTA 3Q24A 1L2FA 4IPHA 2I5LX 3BG3A 3ZJYC 5IT9E 2EJMA 3E9IA 1DOLA 1KRSA 1K9MC 3RN5A 4YY3L 2DNCA 1XPOA 2EOTA 1T5XD 1JJ2A 3LX0A 5IIFA 2C5CA 4JI7Q 1WFQA 4L63B 2NVQB 3CCSA 5C44H 4GNXA 3IFTA 4QUCA 2PO4A 1YIJA 3R3OA 3A56A 2RVLA 1WOCA 3WDNA 1E2ZA 4OELB 1Q46A 5C44B 3CC7A 1PZJD 1VQPA 4R1JA 1Z47A 1CQVA 2EYJA 1HQRD 5I9PA 4DR2Q 3SK4A 3UE0A 1SYDA 2YYZA 1UE1A 4JI3L 4LF7L 1XMQL 2EVBA 1Y8PB 4A3BG 4QF4A 4MIUA 5E1FA 4BBRH 2RBMA 5IE8A 1V8QA 2PQAA 4TKOB 4LF8L 4CKCA 3GTPB 1EY8A 2NTSA 3PO2H 1QNUA 1YVCA 2CW0C 4B9XA 1I3QH 4BBRB 3K5NA 4L5QA 4RKBA 4ABNA 4RWSC 3DXJC 5CGKA 1SNPA 1Q90A 1XTDA 3TP6A 2CWPA 4JI2L 1XXGA 3PO3G 2Q2UA 3VA5A 2F0PA 3WOFA 2NZOA 1I3QB 4CJ1B 4KJNA 2N49A 1JORA 2CH4A 2K5NA 3QB3A 1DZ1A 1GUTA 2BH2A 1FR3A 1PFBA 3KOJA 1SNDA 2B2TC 4DUYL 4DV1L 1KAAA 2NVXB 5IGBA 2VUMG 3K7AH 2LFNA 3A55A 4A3EH 1PRTF 2NYZD 3F2CA 5E4XA 4RA8A 2NBFA 2MP1A 2KHJA 5EBDA 2Z6KA 4MHEA 1WTVA 4IO9A 4DNTB 3K7AB 3S15H 4A3EB 2EZVA 3W1GA 3PIP3 2F0NA 5C4HA 2EYMA 2F0UA 2PW7A 1YJNA 3S15B 1NE3A 1B53A 1EEID 3K6OA 1CSPA 2FMMA 3FKIG 2UXBL 1VQDA 4DPGA 3C1EA 5C0XH 1LUZA 3S1MH 2XRQD 3K5OA 2WP8J 4JI0Q 3STBD 5IWAQ 3I4NH 2Q8IB 5IOCA 3S1MB 1I4HA 3L7ZC 5C3EH 2KBNA 4Q5VA 1ICFB 1EIYB 1U4PA 5C0XI 2J0TD 5EGTA 2LXKA 1S5CD 3X3NA 3GO5A 2E76C 1SMXA 3I4NB 1V43A 2Q8TA 4IN3A 4KY5A 4B9WA 1JT8A 5CC4A 5BN5A 5C3EB 1LT5D 1QOHA 4LF4L 2N3SA 1PV4A 4NP5A 1KDAA 3GTOH 4C3IH 1Q3LA 3NTHA 2NUCA 3I73A 4QB4A 1JMCA 2B63H 3B6YA 1YNJD 1HNXQ 2H1EA 3G4SA 3VR6A 3GTOB 5ELNA 4OHJA 4C3IB 4TVAB 3HKZB 4X64Q 1BCPF 4KD4A 2QA4A 4XQNA 1PYSB 4L5RC 1VQ6A 2B63B 1PH5A 2YV5A 3SEBA 2JEBI 5BR8Q 1Y1WH 4A3IH 1SJHD 2E2IH 1STAA 1AEXA 3T56B 3AFQA 4DR4L 1NMFA 4DK0A 4PZ8A 3NBHB 3K57A 1ET6A 3T1HQ 1SYEA 1HNWL 1Y1WB 1FJGL 3QO2A 3U9SA 2E2IB 1HUMA 1LV9A 2WAQB 3K0YA 2JA7G 1N32L 2R93H 3S2DH 3DHQA 1U4MA 4DV2Q 5LMNL 1E7ZA 2K4KA 4ZRZA 2R93B 1TWCB 2BA1A 4CDEC 4IPDA 4P75A 3KYHC 1BUVT 1TKWB 4OO1H 1BQQT 4GOPC 1EIHA 4S3SA 4QJFA 1MHWC 4YWKA 1TWFH 1SNMA 1IXRA 1VF7A 4RHSA 4XQQA 1GUWA 5JPNC 2NB0A 4Q0FA 1AN8A 3FPUB 2UXCQ 3PQIA 3NHHA 2VB2X 1VQ5A 3S9WA 2I5HA 2WFWA 4K2KA 4DR6Q 3RZDB 1ASZA 2R7ZH 3HOYH 2KUMA 2OF1A 1CI3M 1EOVA 5JVG3 1L0YB 1F9PA 2JA9A 5GAEC 4KI0A 5FLXE 4N8FA 2QEXA 4J8QA 1EQTA 3HOYB 4I7AA 2F0TA 4NMZA 5KNDA 1CKOA 4RMFA 2QW7A 4X3TA 5C4XH 4XT3B 1EWCA 5LMNW 3I4OA 4CJ2C 1H9SB 1DYQA 1PH7A 4OX9Q 3CCLA 3GTJB 2MQHA 1EFID 5C4XB 4LMQD 2ZTDA 3E3XA 1SFOH 5JEAG 5CYUA 1HH2P 2KQ3A 1NSNS 4QGUA 1GOZA 3S24A 3NBHA 1R4PB 1EIGA 1SNQA 1NR4A 1SFOB 1J6QA 4JI7L 2PZWA 3GDEA 3CD6A 3K58A 4ILWA 4A3GG 3NTKA 2B29A 1Q81C 3Q8DA 4OIJA 2MNAA 2ZT9C 1UWVA 1OXSC 1CT1D 1HTPA 3FEWX 3A7LA 4KN4C 3U4VA 1M90C 2A8VA 4DR2L 3HOVB 4IUUA 2N88A 4CDDC 2NN6H 1EFWA 4B3MQ 3G7LA 3V96A 4E6IA 1QB5D 5KYLA 4A3FH 4YCVA 4BXXH 1O80A 4UHVA 1C7YA 3F1ZA 4RGTA 4HJAA 2HHHL 4K0KQ 1CZGA 2CQAA 3HP3A 2F0FA 4KLKA 3N6RA 2NN6I 2Z1CA 4A3FB 4PNYA 4A3DG 1LT4D 1B1ZA 2VW9A 1HR0L 4I65A 5HURA 1N36Q 3I91A 3S1QH 4A3LH 4DGZA 1M4VA 1O7IA 3SE0A 1EWHA 4X65Q 3EBEA 5C4JH 2OWOA 1SYBA 2CHBD 2B2YC 1IL8A 1PZID 3S1QB 3AB9A 3CU7A 2EYLA 3ER0A 4IZ8A 4BA1I 1HRJA 3CRLC 1FD7D 1WTQA 1H9SA 5FLMG 5C4JB 1X32A 4GLVB 1RODA 1IZ6A 2IHEA 2VZAA 3A8JE 2XIWA 2R3ZA 4DV5L 1GHJA 3L9AX 1X6OA 3K0XA 4R4IA 3QJYA 1TY2A 4YY3Q 2Z9HA 3CAMA 4RG1A 1SNCA 1JOQA 1XNRQ 3AU7A 4IFDH 4DR7L 1EQQA 1SAPA 2BE5D 2JK8A 1YEZA 1HR0W 2QKIC 1DJRD 4ALPA 4JI0L 2QF7A 3OMGA 5IWAL 3BDCA 1A3UA 4WORA 3D31A 4IJHA 1SDFA 1IYVA 2HT1A 2IPKD 2EJFC 2WB1E 3PO2G 3MA2B 4NDXA 4RHRA 4OWXB 4N9TA 3HG9A 2IL8A 4JBMA 4CJ0B 4JI3Q 4LF7Q 1KDBA 1QCBD 1O7ZA 4C56C 1K0SA 4K6LA 1CHPD 1XMOQ 2AQ3B 2B2UC 5KEEA 4JV5L 3K59A 3V05A 2A1AA 5KNBA 5M3MH 4LF5Q 1DD2A 4L5TA 2NVYH 3SK6A 2A69D 3PF5A 2KCNA 4P71A 4JI2Q 4A93H 2K04A 4X64L 4A3EG 2NVYB 1NBWA 3J7AV 1JWUD 3QWNA 3KF8A 4A93B 3D0FA 3ICEA 4EX5A 1I4RA 4DUYQ 4DK6C 1KXLA 5DLQE 1SN8A 1NAPA 1WCMH 2JSOA 4AYBG 3HOXH 4F7XA 3M3YH 1K3RA 2YTYA 2ZM6Q 3G71A 1WCMB 2LMCB 5LL6X 3URYA 3HOXB 1A3TA 3M3YB 3I4NG 4DV2L 2DJGC 3F2UA 1U5KA 1DGSA 1LT3D 2UXBQ 2Y0SE 4O2DA 3DLLA 4PQXA 2B39A 4MNOA 3K81C 4RCNA 1WTXA 3C2PA 4G7HC 1J5EQ 1W3SA 2KA7A 2PZUA 2WKDA 3RD4A 3TZDA 3IL8A 1RHPA 1KRTA 1CTMA 4U673 3FHWA 3SXHA 4J15A 2B63G 1D5XC 1VQNA 4DR6L 1N8RC 1NMGA 4R8NA 2RCNA 2PZTA 4LF4Q 3P7JA 2GN5A 1WD0A 1IBML 1YNNC 1F9RA 2JA5G 1EYAA 2B8FA 4A3IG 4AH6A 4JBKA 5BN3A 4QY7A 3BDLA 4X3SA 4GKJL 3RUZA 1G6ZA 3I70A 3ULLA 3I4LA 5IP9G 2Z0SA 2A19A 3RLOA 1I6HB 3ND8A 5EPKA 4Z9CB 3J81E 1KQSA 4C3JH 1K0RA 2O4XA 4BBSG 4DR4Q 3HRZC 3BDOA 2OTJA 4DAMA 4X3UA 1HNWQ 4X62L 1AZQA 2LS01 2F4IA 4HCSA 4C3JB 2AMCB 3O13A 1LYLA 2MO1A 2HCCA 4Y7NH 3CCVA 4H44C 1SE3A 1E0BA 2KOLA 3EJIA 4DV3Q 3EIVA 4DXFA 1N32Q 4MTNA 3BJUA 4M1UB 2JE6I 1STYA 4JPBW 1KDCA 3ND9A 3D4DA 4Y7NB 4HJ7A 1IYUA 5LMNQ 1YITA 1MIUA 2H5XA 4IUPA 1H9JA 3MEHA 4J1MA 1X65A 1I50H 1SXTA 3P20A 1AE2A 5IGCA 3G6EA 4JI4L 1SYGA 2R7ZG 1UE6A 1C48A 4H0LC 4FDBA 1CM9A 1I50B 2F3IA 1CK1A 3H3VH 1I4XA 4K0KL 1NUCA 3TMEA 1U9RA 1VQAA 5C4XG 2VNUD 3NBIA 1IKMA 1FVIA 3PIOA 2WB1B 3I4MG 3T4AC 5GADC 2K52A 5NUCA 4GLXA 1N36L 3RZOH 2A68C 2X69A 5IODA 2JA6H 2EIFA 5I6YA 3M85A 3DWQA 1YZ6A 2F0LA 4MTKA 3J81i 2Q2HA 2B2VC 5FOBB 4A3CH 1Q8KA 3RZOB 1UEAB 4KHPQ 1EZ8A 2JA6B 4DR5Q 3PF4A 1FYCA 1OO9B 5M9OA 1VQHA 2K33A 1HFGA 1V1QA 2DUDA 2NVQH 4V0BA 4LFBQ 1T9HA 2L15A 3NSWA 2QDBA 1LTBD 4NPSA 1XNRL 2OQ0A 2EDGA 4X3KA 5JPMC 5L37A 4QQBX 4YWLA 1QVGA 1RF2D 3VR5A 4UP9A 1YHBA 4DK3C 3KLRA 1F2YA 2EY5A 2L1BA 4XYOA 1EYGA 2A5HA 1Y69U 2NVTH 1SJED 1PRTC 1EY5A 5DM73 4FNFA 2I5MX 1S5FD 1CFMA 4HR7B 1XYIA 1I5FA 4A3KB 2XVSA 1AP0A 3HGBA 2K05A 4RH6A 3HOZH 5M5YH 2NVTB 1AW7A 2Z4HA 1SYFA 4R4QA 3A54A 4KD3A 1BVSA 3CXCA 3I8ZA 2ZXRA 2JN4A 3GTPH 1DOKA 1EZ6A 2E2DC 2XWBB 3T16A 3LWUA 3UDFA 5EQ0A 1B7YB 5ISRA 2GVAA 2Y0SB 4EVOA 1XMOL 3HOZB 4B3RL 2UXDL 5M5YB 4TSSA 4DAPA 3FPPA 1RJTA 3HOWG 1PA6A 4FXDA 5IGDA 2HHHQ 3W5OA 2JQOA 5I2XA 4LF5L 3EFXD 3HFZB 3MXPA 1VQJA 3KK7A 1B3QA 1HR0Q 5E7NA 2K5HA 4B3SQ 5IYBH 2ES2A 4APVA 4DA2A 5IP7H 3OTOL 2NVXH 1HJPA 2PW5A 1L1OC 2CCZA 3NQIA 1TWHH 2FXQA 2B2WC 1ICWA 1EOTA 1OXUA 2A6ED 4IOAA 1C9OA 5GAHC 5C4ZA 3K80C 2NWGA 1WI5A 1AE3A 1K8GA 3TS2A 1TWHB 1YHQA 2E2JH 1H9RA 4GLAC 4U68A 1JC7A 3ULPA 4BA2I 1HHVA 2RDGA 2IT1A 4IPGA 4DV5Q 1IBLL 1VQEA 3OW7A 2ZM6L 4RCOA 2RCFA 4KV6A 1SSOA 5ELFA 1BCPC 4OONA 2E2JB 4PMBA 1IBKL 3OWFA 4DKAC 3JAMc 4DR7Q 1UEBA 3J7YW 1CKMA 5KIXA 3I90A 4BY7H 2AWNA 4ZYSA 2LY7A 1IKLA 2JA8G 4G4KA 3N52A 1YJWA 1TS3A 3KJPA 2TSSA 4CHTB 3J80c 2D0PA 4QCLA 4JI8L 4BY7B 3H15A 5ELCA 2D62A 2ENBA 4BWGB 1J5EL 1NY4A 3R2TA 3DM1A 3MAQA 1BBXC 5M3MG 4J6HA 2D0OA 3TP7A 4TQUS 2PI2E 1UE5A 2O5JC 2KEDA 4JOIC 1BNZA 2A73B 4UAIA 3EQLC 3A8IE 4JV5Q 1STGA 2H4OA 5FO7B 3D6CA 4B3TL 4MZ9A 1ENFA 2NZHA 3P75A 3T51B 2C9OA 4G57A 4LJZC 1QG7A 1IW7C 2PQEA 2CW0D 2X6GA 2E74C 2F0GA 1WCMG 4GZYC 4HTHA 3ITPA 2RHSB 3DEPA 4R9WA 3VR2A 4UDUC 1VQ8A 1G2TA 3S1NH 3OPOA 1TWAB 3R2IA 2FJ2A 1SE4A 4C3HH 3DWAA 3ZYYX 1TQOA 3PUWA 1KL9A 3A7AB 5D3DA 5EJWA 1WTOA 3S1NB 4DV3L 3KF6B 4UP7A 1E22A 3J7ZC 1TWCH 4A3MH 1I4GA 4C3HB 5D65A 1A15A 3CCUA 3RMHA 2Z8LA 3C1FA 4OL7A 2L11A 3D8GA 4A3MB 1BF4A 4KKTA 4DR1Q 4DR3L 5JJLA 1OTCA 1R4QB 1B8AA 2EYFA 5A2QL 2D5DA 2ZXPA 3KDFB 4ZUIA 2L12A 4FVMA 2L9HA 1G91A 4YHHL 1N34L 3UE1A 1S3OA 4BY1H 3RZDH 3E0JA 3DUZA 4OEMB 5GQOA 1V1PB 1PH3A 1PYWD 3L0OA 1ESFA 1UE7A 5KNCA 3JAML 4JK1C 4BY1B 1EEFD 3M4OH 1ENAA 5I9OA 2XRSD 4DV0Q 2IX0A 1IBMQ 4JI1L 5JVH3 1Q8IA 5GROA 2VQEQ 3GTJH 4FF3A 3M4OB 3J80L 2NZ1D 5CBAE 3T1YQ 1PTOC 3MTSA 5IYCH 4GKJQ 4KHPL 4DR5L 5DNFA 2F0QA 2HQEA 5K36H 3WWVA 5C6AA 1TIID 4LUOA 3HOUG 1G51A 1DONA 1GD7A 3I7FA 2KVMA 2HCIA 2G9HD 2B3GA 1W2BA 1PH4A 1PRTB 1GKHA 2F4VL 5T1IA 1PH6A 1HTLD 1STEA 4LFBL 2EYHA 1EL0A 1B70B 4X62Q 4CDFC 5IGGA 2RA4A 4A3JG 2R92B 3I55A 4HAEA 1ET9A 5I4DA 2I07B 3BVMA 1LTGD 5CV5A 5C5LA 4A4IA 1IL2A 4OIKA 4IALA 1Y1VG 1RKNA 1EYDA 1HCZA 3KF6A 3EVQA 1PDQA 3HOVH 5J1ZA 3E0EA 5FJ8H 1JE4A 4HJ5A 3BS1A 4JG2A 5M3FH 2JEAI 5DAUA 5IGFA 2ZXOA 2PMZE 4JI4Q 3QOLA 3TQYA 5M3FB 2OEOA 5CORA 2JXMB 1PTOF 5BN4A 2D9UA 1H9KA 3NPPA 4KHZA 3KDFA 5EKLA 4F87A 2VQFL 1L1OB 4HMJA 5E4WC 1FNVA 1S72A 3FMCA 1A2TA 4A3CG 1V1PA 2DY8A 2SNSA 2L55A 2E2HH 4GNXC 1SMYC 4B3SL 1X3GA 4JC0A 2R6GA 2K5QA 1NTGA 5C3XA 2RQXA 4HEDA 4LUVA 4WJ4A 5JJKA 2EQSA 1HZBA 2E2HB 3MWYW 2ZTCA 3W2DA 4DNIA 3HZXA 3LNNA 2F0EA 4DNRB 1K83B 1P16A 1LTRD 1LTID 1Q12A 1LTAD 3T53B 1MBYA 5M5XH 2Z4IA 4CBVA 5C44G 1K8AC 5C3WA 2IW3A 4R4TA 2A6HC 2RKSA 4A3BB 5M5XB 5G3LD 3G6JB 2VB3X 3KJOA 3PO3H 5CV9A 3FRPB 3AQQA 2AUJD 3UDXA 3C3LA 3GTMB 3M7GA 2UUCL 2ATWA 3GP7A 1JCKB 5ELEA 3PO3B 1LO5D 4BBRG 1RIPA 2KEEA 1HPCA 3M4YA 1IHZA 1SROA 3MZ5A 1AZPA 2LSSA 5CV8A 2L5TA 5T1GA 2VUMH 1PH2A 3J80i 4UY8C 4G7ZC 4P73A 3OSOA 2IX3A 2F0KA 5KRUA 3S14H 2F52A 2CH4W 3NE5B 4NW2A 1EQVA 2Z6KC 1F2ZA 2VUMB 4OWTB 5D3IB 4B3RQ 2UXDQ 5J39A 5IYBG 1C4QA 3VA7A 3BVZA 5JEAJ 3S14B 2F3WA 4LW1A 3UDGA 1B3AA 2B2TA 1HZAA 1VQBA 1D5MC 5EAYA 2B2WA 5KGUA 2IHFA 1HXYD 3FKIH 1UNSA 2F0VA 2FHTA 1VQLA 1MSHA 4RAUC 3A5UA 4K2LA 1KTKA 1SE8A 4K5WA 4ME5A 4JBJA 4KMUC 3OTOQ 3FKIB 5D14A 1Z6HA 1S5DD 3IAYA 3PV0A 1K8MA 4DV4Q 4KK7A 4G7OC 1FGBD 1S5BD 1R9TB 1VQKA 3TP5A 5JOBA 2PYKA 3F8TA 3RR5A 3TZUA 2EYPA 5EPLA 1ZEQX 4GOPB 5DM63 4DV7L 5IT9c 5C0XG 1E2WA 1IBLQ 3GTGH 1ZYRC 1F9QA 1LLRD 1MKHA 1LABA 3OIPA 5JJZA 1B50A 1GVPA 3BZCA 4Y52H 1BOSA 1IBKQ 3GTGB 1QUQB 5C3EG 4YWMA 1D6EC 1S5ED 1GM5A 2WACA 1A8VA 1WTRA 2N78A 3K8AA 1YBYA 3KLSA 4DR1L 1GJXA 4K14A 3CW2C 2HUGA 2KECA 1G291 1V9PA 2KCMA 1X55A 3RN2A 4ULLA 4JI8Q 4HSVA 1QJOA 1TR5A 1Z7TA 3JC66 1VMCA 2OT2A 4PMWA 3CPWA 4C3IG 2IY5B 3HKZG 5KYIA 1LTSD 4DXGA 1ENCA 1XJVA 1OXXK 4ZUJA 1LTTD 4P72A 1G8ZD 2K1BA 1DXMA 1GUNA 1TU2B 1KABA 3Q23A 1NJIC 4DV0L 4EQNA 2PMZB 3ULJA 1Y1WG 4B3TQ 2AKWB 5CR3A 2VQEL 2JA7B 1B44D 3HS0C 3R8BA 3T1YL 1I6HH 1KNAA 4HSPA 1HQMC 1EU4A 1QZGA 1I6VC 2WAQG 2DY7A 2XSCA 3PUVA 1A2UA 3AYHB 5LMUQ 4EQPA 2CWAA 1XTCD 4FYDA 1W6JA 5TSSA 1TVXA 2R93G 3H0GH 1F9SA 1LT6D 4DAYB 3NQTA 3BZDB 3NP8A 2MPMA 3CQZH 3CMAA 1RCVD 2BDOA 1KD1C 2AHOB 3H0GB 1ILQA 2MO0A 3IRBA 4GOPA 4OO1G 1GXDC 4DN4M 3HEJA 2M9VA 3CQZB 4OGQC 1TXYA 1WYDA 1VMPA 4AIMA 4RKLA 4P2CB 3I2ZA 1QUQA 2KHSA 3J81j 1QVFA 5EKKA 4DR3Q 3J7AF 4AYBE 1VQCA 3TEHB 4IOCA 4TRDA 1A63A 1JOKA 3HOYG 1I94Q 2JYOA 2K5WA 2K6AA 4IQZA 3K5MA 1L0WA 3GV3A 5IT9L 1UUPA 3J7A5 4YHHQ 1N34Q 1VQIA 4C1NI 4K6DA 3OIQA 2AQ1B 4ZK9B 3TP8A 4CGYB 2N55A 3RNUA 2PNHA 2XNAC 1NCVA 3CCRA 1PH1A 4A3GH 5K36G 1HA6A 3Q22A 3FDTA 2ZJRA 1VDZA 1JJGA 2K75A 4JI1Q 5C0XJ 1TS2A 4ZLTF 1WTPA 4H02A 3CC4A 4X6AH 1KLUD 4A3GB 1T5EA 1FGUA 3DWPA 4K5VA 3S17H 1YNND 4M8AA 3CKIB 4K5XA 3OW2A 1X3QA 4K8IA 4P74A 2GVBA 3S17B 1OXVA 3NELA 5FO8B 4JVZA 4NB3A 2PCFB 2WV6D 4PMCA 1F2MA 2F4VQ 1F2LA 2LKVA 2XTIA 1TS5A 3EROA 3HOVG 1O78A 2QCPX 3K5LA 5FJ8G 1QILA 3U9OA 4A3DH 2F0DA 2ID0A 3LGJA 2F3VA 1M8AA 1EY0A 4K8JA 1B4OA 4IJLA 4JI5L 1CA5A 4XQJA 1RL2A 1CZWA 4A3KH 4A3DB 2NN6G 2EXDA 3CC2A 5H1SE 2ASBA 1AFPA 4MN3A 2QEJC 1H95A 4A3FG 2K32A 4BXXG 1GUSA 3CMEA 3SHLA 3L3OC 4RGOS 5FLMH 2FINB 1D2BA 4HIKA 3STBC 3VR3A 2VXWA 1YHAA 2G9DA 5I6WA 4ODGA 4A3LG 2VQFQ 1MI2A 3NWTA 5EKIA 1J8IA 2B2YA 4OXPA 2Q2TA 2DNEA 2UUAQ 1YJ9A 1P8LA 2AWOA 1CSQA 3V2TA 1FL0A 1SNOA 5FKAC 1RTOA 4NXNQ 5FLXc 3MXGA 3R93A 3Q0AA 2A68D 2AUKA 5E3FA 2R7FA 1JWSD 1VQFA 2L0CA 1YNJC 2X6LA 5I2YA 4DV4L 4HJ8A 1O7LA 3GD7A 4PG3A 5LHY1 4IFDG 1Q86C 1PXUA 4I7ZC 3AMUA 3PO2B 1EY6A 3EA6A 1JR0D 2M2LA 1CKNB 1XPRA 3CCEA 1JWMD 3U58A 4LFAL 3TRZA 1SBBB 4DK1A 1LM0A 4KN7C 1N33L 3D4RA 4A76A 5C5MA 1SE2A 2EJGC 1X3PA 1C0AA 2MFIA 2OCEA 2UUCQ 5IGEA 2O2LD 3C46A 2B2UA 4LF6Q 2RDFA 5GAGC 1X3FA 3NK9A 5IY0A 1MGSA 1PRTD 1KLGD 1YI2A 3TREA 1XNQL 3SK8A 4AQYL 4JYAL 4YIJA 3IFDA 1S4ZA 1KC8C 2VY3A 2A74C 4R4OA 2UUBL 2XWJB 5HGQA 4A93G 1PFNA 4H7BA 2HIXA 1STHA 4O0AA 5ELBA 2SDFA 5LL6S 4AYBB 4GKKL 3TSSA 1OXTA 2RSNA 5ELDA 1ML0D 4RFBA 4XTCS 5CV6A 4IUQA 2RDHA 2SNMA 5COYA 1PH9A 2ICEC 2J7ZA 5J3BA 2SOBA 4WJWA 3HOXG 5LMUL 1KNEA 3CCJA 3OMCA 1EYCA 2EY6A 1TWAH 1U4LA 4QUFA 1D7QA 1V1OA 5IYDH 3F2DA 2Q2IA 3NEMA 1K3BC 2F1MA 3OOCA 4CKEA 1EU3A 1O7YA 1VQ9A 1JICA 3A0JA 1TY0A 4GS3A 4GN5A 2ALYB 4UPAA 3L2PA 4DV7Q 4IUTA 2C35B 1W6KA 4QIWE 1D5ZC 3PUXA 1CKNA 3D3RA 2JA5H 3DMUA 1SYCA 4QL5A 1STNA 5FLXL 2K7VA 1WVLA 4ZCKA 1Y14B 4F8MA 2DN8A 1YNXA 2OTLA 1BCPD 5AJ3Q 3FP9A 1EY9A 3E9HA 4HN7A 3RLNA 4A3IB 2JA5B 4NXML 5IP9H 1XX8A 2Q8RE 3PUYA 1XPUA 1K73C 4DV6L 2QILA 2CVRA 1WTHA 1DCZA 1WTWA 2MJ8A 1L0XB 3MEFA 1I94L 3BYTB 4BBSH 2UU9L 1MSGA 2V1CC 4IURA 4OWWB 1NNXA 4FXKC 4PV1C 4PZ6A 4F88A 3U4ZA 2EYOA 2R7DA 4L5SA 2KCTA 1PHJA 4ZAIA 4BBSB 2CQOA 3NENA 3S2DB 1A3VA 2EXZA 4WRDA 1KIXA 4IFDJ 4FF1A 1E1OA 4DUZL 1VF5C 3K7UC 4C2MH 3SVMA 2ZJPA 5DEHA 4DU9A 3NUCA 4KJOA 2HDMA 1HZ9A 3T13A 3W1BA 4C3JG 4C2MB 1WJJA 1A6XA 2F0MA 3CCMA 4OO1I 3H0GG 1TWFB 4NKLA 1IW7D 4LFCQ 2Z6BA 2P5ZX 1VCIA 2VL6A 4UP8A 4LWCA 2IWHA 1QZHA 5A35A 1HNZQ 2R92H 1ILPA 3A8KE 2R7ZB 3P1HA 3E6ZX 3PCOB 4JI6Q 2CFMA 3QIAA 1M1KC 1BDOA 3I56A 3M4PA 2RF4A 3I4MH 3CP0A 3TS0A 3WOEA 1X9NA 5A2QE 1DM0B 4A75A 1QVCA 4KTAA 3TBIB 1RD9D 3D4WA 3PIPA 1X54A 4ID6A 3I4MB 3UI2A 1EIFA 4EQ5A 1U4RA 5K5PA 2WB1G 4LK1C 2BE5C 1Q1BA 1Q82C 2ZTEA 3JAME 3GTQH 2KJXA 3HKSA 4X66Q 2QGQA 1I4QA 2BCOA 2K5VA 4FO2A 1PH8A 2E5LQ 1STBA 1X3EA 2JA6G 4ZKCB 3J80E 1SRUA 2QDLA 2YTVA 3GTQB 3F2BA 1H9MA 2F0OA 3H91A 2EY2A 2B2VA 3PUZA 4LF9Q 5CV7A 3ONAB 2OXPA 2UUAL 4KKSA 2RSOA 3BYYB 3M7NA 4ME3A 3RLFA 5EPJA 5AFWA 3LWEA 4LAAA 4NXNL 3I3CA 4POFA 3GV6A 2K03A 1K83H 2N8NA 4O42A 2V4DA 1BCPB 4HIOA 4WFN3 1BBUA 1JQYD 1G2SA 3GTKH 2TMPA 2A69C 1N9WA 4KY7A 4BS9A 2HIVA 1PTOD 3DM3A 4YCUA 1E3PA 2EE1A 5G3LF 3MXUA 4A3BH 1ZKOA 3GTKB 3MFGA 1MJCA 4KY6A 3J81c 3PGZA 1PLFA 1S40A 4RGNA 3HOWH 4A3KG 1G6PA 3KF8B 2EY1A 2K01A 1ONLA 4IUVA 2K5DA 4GN3B 1PFSA 3ERSX 2F0JA 2K14A 2WKCA 3FVQA 2YU9H 3GTMH 3TN2A 3VYUA 3HOWB 3A5ZB 2CKZB 3QR8A 2Y0SG 3HOZG 4KHVA 3SGIA 4JI5Q 3H3VC 2YU9B 3JAMi 1QE6A 3ERQA 1B9NA 4C1NK 4JW0A 3AFPA 4B08A 4HIMA 4LF6L 1VQ4A 4QIWB 2FFKB 1EY4A 1JB3A 1C8CA 3OYYA 2DJFC 3IKJA 4XYQA 3MHBA 2F03A 5CBEE 3SR1A 1VQGA 1PFMA 1BKBA 4H13C 3KFUA 2IX1A 1ESRA 3NTIA 5ELOA 2JJQA 2FMCA 3CRKC 1D1KA 2SEBD 4FF2A 2O5IC 5IP7G 2KCCA 2ZJQA 1Z9FA 2PNRC 4IFDI 1JE5A 3GTLH 1SEBD 2AQ2B 1L1OA 3H94A 1D1IA 1JJCB 5JAVA 1Y8OB 4XT1B 1WD1A 1BBWA 1MD2D 2WINB 2JA8H 2VS1A 3GTLB 2L4NA 1XMQQ 1QNKA 1TT2A 2K28A 4CKBA 2BDNA 3PIO3 1R9TH 1SMYD 4FF4A 3VDYA 3QOJA 3DEOA 3OHXC 2PI2A 4LF8Q 4PZ7A 2JA8B 4L8JA 4DF7A 1F77A 1Q1EA 2I46A 4IPCA 3W3AA 1I4PA 1E2VA 1CUKA 1B9MA 1D8LA 1HNXL 3MVVA 1LACA 4ZKBB 4WJ3M 1U0LA 4R4CA 3SK5A 4BY7G 5M3MB 2J4XA 4LFAQ 1MJEA 2HD3A 4KKUA 5BR8L 2E8GA 3KBGA 5CV4A 2F0IA 2MUYA 2A6HD 1N33Q 3T1HL 4DV1Q 1A0IA 2M00A 2PPBC 5AJ3L 3EN2A 3KLWA 2E75C 4HJ9A 1GO3E 4V190 5HGTA 3S2HH 2K50A 1E1TA 3CHBD 4JOIA 3D6WA 4O1NA 1PTOH 2BOSA 1CQFA 1II3A 3J81L 3S16H 3VYTA 4GN4B 2MGSA 4CDCC 3S2HB 3GQBA 1HUNA 1XNQQ 3KUPA 4AQYQ 2MHVA 4JYAQ 1PTOB 1VQOA 3E5SA 2I0QA 4N9PA 3S16B 3SDZA 3AEVA 5JJIA 1SLJA 2OQKA 2UUBQ 2JA7H 3PMFA 3MXNB 3CF5A 4XXEA 1BO0A 3BZKA 5HY6A 4GKKQ 3MFYA 1HFNA 5IYDG 2KHIA 4FP5D 1Q7YC 5M5WH 2F0SA 1GUOA 3CPFA 4LNQA 2ICIA 2RHQB 3G48A 2UXCL 3BU2A 3I72A 2F0HA 4LFCL 1EWIA 2GA4B 4FXGC 4DAVA 1FNUA 1NR2A 2R61A 4C3HG 5M5WB 2JP1A 3H6MA 1HNZL 4XIGS 1CHQD 1XWEA 1JB7A 4EQOA 4A3MG 1RDPD 4JI6L 1E24A 3KBXA 1QWYA 1ASYA 2B8GA 2EPBA 3A74A 2D2CC 4OX9L 3QG1A
chains in the Genus database with same CATH topology
1ZXTA 4XDXA 1K8OA 4R8IA 4DFAA 1DOMA 1TS4A 1RTNA 4L6TB 1ZYRD 3VR4A 5FO9B 1Y8NB 1HA5A 1PZKD 5F2DA 2F0WA 1GUGA 4HCEA 2HDLA 5JEAH 1B2TA 4QMGA 1FNWA 4JBWA 3Q6SA 5EBCA 1CA6A 3HOUB 3MC0B 5FK9C 1BR9A 4A3JB 1J9OA 3VYSA 3MXNA 5J22A 4IUNA 3KLSX 4HMIA 1Y1VB 3BVGA 2NTTA 3TDQA 2BA0A 1TWGB 4ZQ3A 4RGMA 3NWSA 3S1RB 1JOOA 5CMDA 3NXWA 3VYRA 1EY7A 3X3MA 1UAPA 2WIIB 2IJ0A 2XN9C 3OWEB 1GHKA 1PMRA 2A6EC 4DAYA 3H09A 4EGVA 1BXTA 3Q24A 3BG3A 5IT9E 2EJMA 1DOLA 2DNCA 2EOTA 1T5XD 3LX0A 5IIFA 2C5CA 4L63B 2NVQB 3IFTA 4QUCA 2PO4A 3R3OA 3A56A 2RVLA 3WDNA 1E2ZA 5C44B 1PZJD 1Z47A 1CQVA 2EYJA 1HQRD 5I9PA 3SK4A 1SYDA 2YYZA 2EVBA 1Y8PB 4QF4A 4MIUA 5E1FA 2RBMA 1V8QA 4TKOB 4CKCA 3GTPB 1EY8A 2NTSA 1QNUA 2CW0C 4B9XA 4BBRB 3K5NA 4RKBA 4ABNA 4RWSC 3DXJC 5CGKA 1SNPA 1Q90A 3TP6A 1XXGA 3VA5A 2F0PA 3WOFA 1I3QB 4CJ1B 4KJNA 1JORA 3QB3A 1DZ1A 1GUTA 1FR3A 1PFBA 1SNDA 2B2TC 1KAAA 2NVXB 5IGBA 2LFNA 3A55A 1PRTF 2NYZD 5E4XA 4RA8A 2NBFA 2MP1A 5EBDA 4MHEA 1WTVA 4DNTB 3K7AB 4A3EB 2EZVA 3PIP3 2F0NA 5C4HA 2EYMA 2F0UA 2PW7A 3S15B 1B53A 1EEID 3K6OA 2FMMA 3C1EA 5C0XH 2XRQD 3K5OA 2WP8J 2Q8IB 5IOCA 3S1MB 1I4HA 3L7ZC 4Q5VA 1U4PA 5C0XI 2J0TD 5EGTA 3X3NA 1S5CD 3GO5A 2E76C 3I4NB 1V43A 2Q8TA 4IN3A 4KY5A 4B9WA 5CC4A 5BN5A 5C3EB 1LT5D 1QOHA 4NP5A 1KDAA 1Q3LA 3NTHA 2NUCA 3I73A 4QB4A 1YNJD 2H1EA 3VR6A 3GTOB 4OHJA 4C3IB 3HKZB 1BCPF 4KD4A 4XQNA 2B63B 3SEBA 2JEBI 1SJHD 3T56B 1STAA 1AEXA 4DK0A 3K57A 1ET6A 1SYEA 1Y1WB 3QO2A 3U9SA 2E2IB 1HUMA 1LV9A 2WAQB 3K0YA 3DHQA 1U4MA 4ZRZA 2R93B 1TWCB 2BA1A 1BUVT 1TKWB 4OO1H 1BQQT 1EIHA 4S3SA 1SNMA 1VF7A 4RHSA 4XQQA 1GUWA 5JPNC 2NB0A 4Q0FA 1AN8A 3FPUB 3NHHA 2VB2X 3S9WA 4K2KA 3RZDB 2KUMA 2OF1A 1CI3M 5JVG3 1L0YB 1F9PA 4KI0A 5FLXE 4J8QA 1EQTA 3HOYB 2F0TA 4NMZA 5KNDA 4X3TA 4XT3B 1EWCA 4CJ2C 1H9SB 1DYQA 3GTJB 1EFID 5C4XB 4LMQD 5JEAG 5CYUA 2KQ3A 1NSNS 1GOZA 3NBHA 1R4PB 1EIGA 1SNQA 1NR4A 1SFOB 2PZWA 3K58A 4ILWA 3NTKA 4OIJA 2ZT9C 1OXSC 1CT1D 1HTPA 3FEWX 3A7LA 4KN4C 3HOVB 4IUUA 2N88A 2NN6H 3G7LA 3V96A 4E6IA 1QB5D 5KYLA 1O80A 4RGTA 1CZGA 2CQAA 3HP3A 2F0FA 3N6RA 2NN6I 2Z1CA 4A3FB 4PNYA 1LT4D 1B1ZA 4I65A 5HURA 3I91A 4DGZA 1M4VA 3SE0A 1EWHA 1SYBA 2CHBD 2B2YC 1IL8A 1PZID 3S1QB 3AB9A 3CU7A 2EYLA 1HRJA 4IZ8A 4BA1I 3CRLC 1FD7D 1WTQA 1H9SA 5C4JB 1X32A 1RODA 3A8JE 2XIWA 2R3ZA 1GHJA 3L9AX 3QJYA 1TY2A 1SNCA 1JOQA 3AU7A 4IFDH 1SAPA 2BE5D 2QKIC 1DJRD 2QF7A 3OMGA 3BDCA 1A3UA 4WORA 3D31A 1SDFA 1IYVA 2IPKD 2EJFC 3MA2B 4NDXA 4RHRA 4N9TA 3HG9A 2IL8A 4CJ0B 1KDBA 1QCBD 1O7ZA 4C56C 4K6LA 1CHPD 2AQ3B 2B2UC 5KEEA 3K59A 3V05A 5KNBA 1DD2A 3SK6A 2A69D 2KCNA 2K04A 2NVYB 3J7AV 1JWUD 3QWNA 3KF8A 4A93B 1I4RA 1NAPA 2JSOA 4F7XA 1WCMB 2LMCB 5LL6X 3URYA 3HOXB 1A3TA 3M3YB 3F2UA 1LT3D 4PQXA 2B39A 4RCNA 1WTXA 3C2PA 4G7HC 2KA7A 2PZUA 2WKDA 3RD4A 3TZDA 3IL8A 1RHPA 1CTMA 4U673 3SXHA 1D5XC 4R8NA 2PZTA 3P7JA 1WD0A 1YNNC 1F9RA 1EYAA 2B8FA 5BN3A 3BDLA 4X3SA 3RUZA 1G6ZA 3I70A 3I4LA 1I6HB 3ND8A 5EPKA 4Z9CB 3J81E 2O4XA 3HRZC 3BDOA 4X3UA 1AZQA 2LS01 2F4IA 4HCSA 4C3JB 3O13A 2HCCA 4H44C 1SE3A 1E0BA 2KOLA 3EJIA 4DXFA 4M1UB 2JE6I 1STYA 1KDCA 3ND9A 3D4DA 4Y7NB 1IYUA 4IUPA 1H9JA 3MEHA 4J1MA 1SXTA 3P20A 5IGCA 1SYGA 1C48A 4H0LC 1CM9A 1I50B 1CK1A 1I4XA 1NUCA 3TMEA 1U9RA 2VNUD 3NBIA 1IKMA 2WB1B 3T4AC 5NUCA 2A68C 2X69A 5IODA 5I6YA 3M85A 3DWQA 2F0LA 2B2VC 5FOBB 3RZOB 1UEAB 1EZ8A 2JA6B 1FYCA 1OO9B 5M9OA 2K33A 1HFGA 4V0BA 3NSWA 2QDBA 1LTBD 2EDGA 4X3KA 5JPMC 1RF2D 3VR5A 3KLRA 1F2YA 2EY5A 2L1BA 4XYOA 2A5HA 1Y69U 1SJED 1PRTC 1EY5A 5DM73 4FNFA 1S5FD 1CFMA 4HR7B 1XYIA 4A3KB 2XVSA 1AP0A 3HGBA 2K05A 4RH6A 2NVTB 1AW7A 2Z4HA 1SYFA 3A54A 4KD3A 3I8ZA 2ZXRA 1DOKA 1EZ6A 2E2DC 2XWBB 3T16A 3LWUA 5EQ0A 5ISRA 2Y0SB 4EVOA 3HOZB 5M5YB 4TSSA 4DAPA 3FPPA 1RJTA 4FXDA 5IGDA 5I2XA 3EFXD 3MXPA 3KK7A 4DA2A 2PW5A 3NQIA 2B2WC 1ICWA 1EOTA 1OXUA 2A6ED 5C4ZA 2NWGA 1TWHB 1H9RA 4U68A 4BA2I 1JC7A 1HHVA 2RDGA 2IT1A 3OW7A 4RCOA 4KV6A 1SSOA 5ELFA 1BCPC 2E2JB 4PMBA 3OWFA 3J7YW 5KIXA 3I90A 2AWNA 4ZYSA 2LY7A 1IKLA 4G4KA 3N52A 1TS3A 2TSSA 4CHTB 4QCLA 4BY7B 5ELCA 2D62A 2ENBA 4BWGB 3R2TA 3DM1A 3MAQA 1BBXC 4J6HA 3TP7A 4TQUS 2O5JC 2KEDA 1BNZA 2A73B 4UAIA 3EQLC 3A8IE 1STGA 2H4OA 5FO7B 3D6CA 1ENFA 3P75A 3T51B 2C9OA 4G57A 4LJZC 1QG7A 1IW7C 2PQEA 2CW0D 2X6GA 2E74C 2F0GA 4GZYC 4HTHA 3ITPA 3DEPA 4R9WA 3VR2A 4UDUC 1G2TA 3OPOA 1TWAB 3R2IA 2FJ2A 1SE4A 3DWAA 3ZYYX 1TQOA 3PUWA 3A7AB 5D3DA 5EJWA 1WTOA 3S1NB 1I4GA 4C3HB 5D65A 1A15A 3RMHA 2Z8LA 3C1FA 4OL7A 2L11A 3D8GA 4A3MB 1BF4A 4KKTA 1R4QB 5A2QL 2EYFA 2D5DA 2ZXPA 4ZUIA 2L12A 4FVMA 2L9HA 1G91A 3E0JA 3DUZA 1V1PB 1PYWD 1ESFA 5KNCA 3JAML 4JK1C 4BY1B 1EEFD 1ENAA 5I9OA 2XRSD 2IX0A 5JVH3 1Q8IA 4FF3A 3M4OB 3J80L 2NZ1D 5CBAE 1PTOC 3MTSA 5DNFA 2F0QA 2HQEA 5K36H 5C6AA 1TIID 1DONA 2KVMA 2HCIA 2G9HD 1PRTB 5T1IA 1HTLD 1STEA 2EYHA 1EL0A 5IGGA 2RA4A 2R92B 4HAEA 1ET9A 5I4DA 2I07B 3BVMA 1LTGD 5CV5A 5C5LA 4OIKA 4IALA 1RKNA 1EYDA 1HCZA 3EVQA 1PDQA 5J1ZA 1JE4A 3BS1A 2JEAI 5DAUA 5IGFA 2ZXOA 3QOLA 5M3FB 2OEOA 5CORA 2JXMB 1PTOF 5BN4A 2D9UA 1H9KA 3NPPA 4KHZA 5EKLA 4F87A 4HMJA 5E4WC 1FNVA 3FMCA 1A2TA 1V1PA 2DY8A 2SNSA 2L55A 1SMYC 2R6GA 2K5QA 5C3XA 2RQXA 4HEDA 2E2HB 3MWYW 3W2DA 3HZXA 3LNNA 2F0EA 4DNRB 1K83B 1LTRD 1LTID 1Q12A 1LTAD 3T53B 1MBYA 2Z4IA 4CBVA 5C3WA 2IW3A 2A6HC 2RKSA 4A3BB 5M5XB 5G3LD 3G6JB 2VB3X 5CV9A 3FRPB 2AUJD 3C3LA 3GTMB 3M7GA 3GP7A 1JCKB 5ELEA 3PO3B 1LO5D 2KEEA 1HPCA 3M4YA 1IHZA 3MZ5A 1AZPA 5CV8A 2L5TA 5T1GA 4G7ZC 3OSOA 2IX3A 2F0KA 5KRUA 4NW2A 3NE5B 1EQVA 1F2ZA 2VUMB 5D3IB 5J39A 1C4QA 3VA7A 3BVZA 5JEAJ 3S14B 2F3WA 1B3AA 2B2TA 1D5MC 5KGUA 2B2WA 1HXYD 1UNSA 2F0VA 2FHTA 1MSHA 4RAUC 4K2LA 1KTKA 4KMUC 4K5WA 4ME5A 3FKIB 5D14A 1Z6HA 1S5DD 3IAYA 3PV0A 1K8MA 4KK7A 4G7OC 1FGBD 1S5BD 1R9TB 3TP5A 5JOBA 2PYKA 3TZUA 2EYPA 5EPLA 1ZEQX 5DM63 5C0XG 1E2WA 1ZYRC 1F9QA 1LLRD 1LABA 3OIPA 5JJZA 1B50A 1BOSA 3GTGB 1D6EC 1S5ED 2WACA 1WTRA 3KLSA 1GJXA 4K14A 2HUGA 2KECA 1G291 4ULLA 4HSVA 1QJOA 1TR5A 1Z7TA 1VMCA 2OT2A 4PMWA 4C3IG 5KYIA 1LTSD 4DXGA 1ENCA 1OXXK 4ZUJA 1LTTD 1G8ZD 2K1BA 1DXMA 1GUNA 1TU2B 1KABA 3Q23A 4EQNA 2PMZB 5CR3A 2JA7B 1B44D 3HS0C 3R8BA 1KNAA 4HSPA 1HQMC 1EU4A 1I6VC 2DY7A 2XSCA 3PUVA 1A2UA 4EQPA 1XTCD 4FYDA 1W6JA 5TSSA 1TVXA 1F9SA 1LT6D 3NQTA 3BZDB 3NP8A 2MPMA 1RCVD 2BDOA 3H0GB 1ILQA 4OO1G 1GXDC 4DN4M 3HEJA 2M9VA 3CQZB 4OGQC 1VMPA 4RKLA 4P2CB 2KHSA 5EKKA 3J7AF 4TRDA 1JOKA 2JYOA 2K5WA 2K6AA 4IQZA 3K5MA 3GV3A 5IT9L 1UUPA 4C1NI 4K6DA 3OIQA 2AQ1B 4ZK9B 3TP8A 4CGYB 2N55A 2XNAC 1NCVA 5K36G 1HA6A 3Q22A 3FDTA 1VDZA 5C0XJ 1TS2A 4ZLTF 1WTPA 1KLUD 4A3GB 1T5EA 3DWPA 4K5VA 1YNND 4M8AA 3CKIB 4K5XA 1X3QA 4K8IA 3S17B 1OXVA 5FO8B 2PCFB 2WV6D 4PMCA 1F2MA 1F2LA 2LKVA 1TS5A 3EROA 1O78A 2QCPX 3K5LA 1QILA 3U9OA 2F0DA 2ID0A 2F3VA 1M8AA 1EY0A 4K8JA 1B4OA 1CA5A 4XQJA 1CZWA 4A3DB 2NN6G 1AFPA 4MN3A 2QEJC 2K32A 1GUSA 3SHLA 3L3OC 4RGOS 2FINB 1D2BA 3VR3A 2VXWA 2G9DA 5I6WA 4ODGA 1MI2A 3NWTA 5EKIA 1J8IA 2B2YA 2DNEA 2AWOA 3V2TA 1SNOA 5FKAC 1RTOA 3R93A 3MXGA 3Q0AA 2A68D 2AUKA 5E3FA 1JWSD 2L0CA 1YNJC 2X6LA 5I2YA 1O7LA 3GD7A 5LHY1 4IFDG 1PXUA 4I7ZC 3AMUA 3PO2B 1EY6A 3EA6A 1JR0D 2M2LA 1JWMD 1SBBB 4DK1A 4KN7C 3D4RA 5C5MA 1SE2A 2EJGC 1X3PA 5IGEA 2O2LD 3C46A 2B2UA 2RDFA 3NK9A 1MGSA 1PRTD 1KLGD 3SK8A 4YIJA 3IFDA 1S4ZA 2A74C 2XWJB 1PFNA 4H7BA 5ELBA 1STHA 2SDFA 5LL6S 4AYBB 3TSSA 1OXTA 2RSNA 5ELDA 1ML0D 4RFBA 4XTCS 5CV6A 4IUQA 2RDHA 2SNMA 5COYA 2ICEC 2J7ZA 2SOBA 4WJWA 1KNEA 3OMCA 1EYCA 2EY6A 1U4LA 4QUFA 1V1OA 2F1MA 3OOCA 4CKEA 1EU3A 1O7YA 1JICA 1TY0A 4IUTA 1W6KA 1D5ZC 3PUXA 3D3RA 3DMUA 1SYCA 1STNA 5FLXL 2K7VA 1WVLA 4F8MA 2DN8A 1BCPD 1EY9A 4HN7A 2JA5B 4A3IB 1XX8A 2Q8RE 3PUYA 2QILA 2CVRA 1DCZA 1WTWA 2MJ8A 1L0XB 3BYTB 1MSGA 4IURA 4FXKC 4PV1C 4F88A 2EYOA 4ZAIA 4BBSB 3S2DB 1A3VA 2EXZA 4WRDA 4IFDJ 4FF1A 1VF5C 3SVMA 5DEHA 4DU9A 3NUCA 4KJOA 2HDMA 3T13A 4C3JG 4C2MB 1A6XA 2F0MA 4OO1I 1TWFB 4NKLA 1IW7D 1VCIA 2IWHA 5A35A 1ILPA 3A8KE 2R7ZB 3P1HA 3E6ZX 3QIAA 1BDOA 3WOEA 5A2QE 1DM0B 3TBIB 4KTAA 1RD9D 3D4WA 4ID6A 3I4MB 3UI2A 1U4RA 5K5PA 4LK1C 2BE5C 1Q1BA 3JAME 2KJXA 1I4QA 2BCOA 4FO2A 1STBA 4ZKCB 3J80E 3GTQB 1H9MA 2F0OA 3H91A 2EY2A 2B2VA 3PUZA 5CV7A 3ONAB 2OXPA 4KKSA 2RSOA 3BYYB 3M7NA 3RLFA 5EPJA 5AFWA 3LWEA 4LAAA 3I3CA 3GV6A 2K03A 4O42A 2V4DA 1BCPB 4WFN3 1JQYD 1G2SA 2TMPA 2A69C 4KY7A 4BS9A 1PTOD 2EE1A 5G3LF 3MXUA 1ZKOA 3GTKB 3MFGA 4KY6A 1PLFA 4RGNA 2EY1A 2K01A 1ONLA 4IUVA 2K5DA 2F0JA 2WKCA 3FVQA 3TN2A 3VYUA 3HOWB 4KHVA 3H3VC 2YU9B 1QE6A 3ERQA 1B9NA 4C1NK 4B08A 4QIWB 2FFKB 1EY4A 1JB3A 1C8CA 3IKJA 4XYQA 3MHBA 2F03A 5CBEE 3SR1A 1PFMA 4H13C 2IX1A 1ESRA 3NTIA 2FMCA 3CRKC 1D1KA 2SEBD 4FF2A 2O5IC 2KCCA 2PNRC 4IFDI 1SEBD 2AQ2B 3H94A 1D1IA 5JAVA 1Y8OB 4XT1B 1WD1A 1MD2D 2WINB 3GTLB 2L4NA 1QNKA 1TT2A 2K28A 4CKBA 2BDNA 3PIO3 1SMYD 4FF4A 3QOJA 3DEOA 3OHXC 2JA8B 4L8JA 4DF7A 1F77A 1Q1EA 2I46A 3W3AA 1I4PA 1E2VA 1B9MA 3MVVA 1LACA 4ZKBB 3SK5A 5M3MB 2J4XA 4KKUA 3KBGA 5CV4A 2F0IA 2MUYA 2A6HD 2M00A 2PPBC 2E75C 4V190 5HGTA 3CHBD 4O1NA 3D6WA 1PTOH 2BOSA 1CQFA 1II3A 3J81L 3VYTA 2MGSA 3S2HB 3GQBA 1HUNA 3KUPA 2MHVA 1PTOB 3E5SA 4N9PA 3S16B 3SDZA 3PMFA 4XXEA 1BO0A 3MFYA 1HFNA 4FP5D 2F0SA 1GUOA 2ICIA 2F0HA 3I72A 4DAVA 2GA4B 4FXGC 1FNUA 1NR2A 2R61A 4C3HG 5M5WB 2JP1A 3H6MA 4XIGS 1CHQD 1XWEA 4EQOA 1RDPD 3KBXA 1QWYA 2B8GA 2EPBA 2D2CC 3QG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K28 A;  1ZXT A;  3MWY W;  1SAP A;  2BDN A;  4XDX A;  5JJZ A;  1B50 A;  1WVL A;  4QUC A;  3DEO A;  4R8I A;  4LMQ D;  4ZKC B;  1DOM A;  2X6L A;  2RVL A;  3I90 A;  4ZK9 B;  1RTN A;  2N55 A;  1IKL A;  1WTR A;  3N52 A;  3H91 A;  3P7J A;  2B2V A;  3ONA B;  1NCV A;  1Q3L A;  1XX8 A;  2Q8R E;  1WD0 A;  1F9R A;  1HA6 A;  1SDF A;  1HFG A;  2HUG A;  2KEC A;  2RSO A;  3FDT A;  1EIG A;  4ZKB B;  2M2L A;  2CVR A;  2H1E A;  1NR4 A;  5EPJ A;  5AFW A;  2MJ8 A;  4HSV A;  3LWE A;  4ZLT F;  1WTW A;  1WTP A;  2NZ1 D;  2HDL A;  4X3S A;  5CBA E;  3I3C A;  1MSG A;  2IL8 A;  4CJ0 B;  4IUR A;  1VMC A;  3GV6 A;  3DM1 A;  2K03 A;  3MTS A;  4X3K A;  1BBX C;  1B2T A;  1G6Z A;  3Q6S A;  4O42 A;  5DNF A;  1CA6 A;  1O7Z A;  1G2S A;  1X3Q A;  4ZAI A;  5EPK A;  2KED A;  4OIJ A;  2B2U C;  3R93 A;  2L1B A;  1BNZ A;  4UAI A;  1DON A;  2K1B A;  1X3P A;  2KVM A;  2HCI A;  4RWS C;  2EE1 A;  3SVM A;  1XYI A;  3QO2 A;  4X3U A;  5T1I A;  1HUM A;  1LV9 A;  2KEE A;  1AP0 A;  1PLF A;  1AZQ A;  2B2U A;  4HCS A;  1F2L A;  1QG7 A;  3D6W A;  4IUU A;  1J9O A;  2K05 A;  1AZP A;  1EL0 A;  2N88 A;  5T1G A;  2HCC A;  4CJ1 B;  1MGS A;  2HDM A;  2K01 A;  2K04 A;  2RA4 A;  2X6G A;  3G7L A;  1KNA A;  2MGS A;  3I8Z A;  4HAE A;  4IUV A;  2KOL A;  1E0B A;  1DOK A;  1DZ1 A;  1HUN A;  1PFB A;  1S4Z A;  3IFD A;  3KUP A;  5EQ0 A;  2DY7 A;  3TN2 A;  1U4M A;  4NW2 A;  4OIK A;  1M8A A;  3DEP A;  1B4O A;  1O80 A;  2B2T C;  1CA5 A;  1RJT A;  4R9W A;  3HP3 A;  4CJ2 C;  1PDQ A;  1PFN A;  1G2T A;  2SDF A;  2NYZ D;  5E4X A;  1TVX A;  1JE4 A;  4IUP A;  4RA8 A;  5CMD A;  1QE6 A;  2MP1 A;  1NAP A;  4MN3 A;  1B3A A;  1BO0 A;  1F9S A;  4MHE A;  1ILP A;  1EIH A;  2FJ2 A;  1WTV A;  2B2T A;  2RSN A;  2B2W A;  3I91 A;  2FFK B;  1ML0 D;  2MPM A;  2FHT A;  4IUQ A;  5EJW A;  1WTO A;  1C8C A;  1HFN A;  1MSH A;  5COY A;  4RAU C;  1ILQ A;  2FIN B;  1GUW A;  2J7Z A;  5COR A;  1CM9 A;  2VXW A;  2D9U A;  5CBE E;  4DN4 M;  3FPU B;  2B2Y C;  1IL8 A;  5D65 A;  1PFM A;  1KNE A;  3F2U A;  5D14 A;  1A15 A;  1B53 A;  1NR2 A;  1HRJ A;  2FMM A;  2B2W C;  1ESR A;  1U4L A;  4QUF A;  1WTQ A;  1ICW A;  2JP1 A;  5E4W C;  1EOT A;  3UI2 A;  2KUM A;  1MI2 A;  2L11 A;  1IKM A;  1X32 A;  5EKI A;  1VMP A;  2NWG A;  1ROD A;  1BF4 A;  1J8I A;  1O7Y A;  2DY8 A;  1JIC A;  1U4R A;  1DOL A;  2B2Y A;  1F9P A;  2XIW A;  2R3Z A;  5EPL A;  1WTX A;  4U68 A;  2X69 A;  1HHV A;  1EQT A;  3KBX A;  4XT1 B;  1WD1 A;  4X3T A;  2EOT A;  1U4P A;  4HED A;  4XT3 B;  4IUT A;  2EPB A;  2L12 A;  1SSO A;  2JYO A;  1F9Q A;  2L4N A;  1RTO A;  1QNK A;  2L9H A;  1G91 A;  3TZD A;  3IL8 A;  2B2V C;  1RHP A;  3GV3 A;  2Q8T A; 
#chains in the Genus database with same CATH topology
 1ZXT A;  4XDX A;  1K8O A;  4R8I A;  2KEN A;  4DFA A;  1DOM A;  1TS4 A;  1VQM A;  1RTN A;  4L6T B;  1ZYR D;  3VR4 A;  5FO9 B;  1Y8N B;  1VS0 A;  1FJG Q;  4BY1 G;  2BH8 A;  1HA5 A;  1PZK D;  4NXM Q;  5F2D A;  4DV6 Q;  3HOU H;  4HID A;  2F0W A;  4GNX B;  1GUG A;  1A62 A;  4HCE A;  2HDL A;  5JEA H;  4X66 L;  1B2T A;  4QMG A;  2UU9 Q;  1PYB A;  1FNW A;  4JBW A;  3Q6S A;  5EBC A;  1CA6 A;  3CCQ A;  2E5L L;  3UDI A;  3HOU B;  3M9B A;  1AH9 A;  2DGY A;  2G5D A;  4A3J H;  4LF9 L;  3MC0 B;  5IYC G;  3M4Q A;  1IYJ B;  5FK9 C;  1Y1V H;  4DUZ Q;  1X56 A;  1BR9 A;  1EQR A;  4B3M L;  4A3J B;  1J9O A;  2YTX A;  3VYS A;  3MXN A;  5J22 A;  1TWG H;  4IUN A;  2PQA B;  3KLS X;  4HMI A;  1Y1V B;  3S1R H;  1VQ7 A;  3BVG A;  2R92 G;  2NTT A;  3U50 C;  3TDQ A;  4LUZ A;  2BA0 A;  1TWG B;  3HKZ E;  4ZQ3 A;  2XGT A;  4RGM A;  3NWS A;  3S1R B;  1JOO A;  4YCW A;  1LTL A;  5CMD A;  3NXW A;  3VYR A;  1EY7 A;  3X3M A;  1EUJ A;  1UAP A;  2WII B;  2IJ0 A;  3H3V I;  2XN9 C;  4X65 L;  3OWE B;  1GHK A;  1PMR A;  2A6E C;  1KAW A;  4DAY A;  4N8X 1;  1PVO A;  1HZC A;  4POG A;  3H09 A;  5M3F G;  1KHI A;  2WAQ E;  4EGV A;  2LXJ A;  3PSI A;  1K28 A;  4JCV E;  1SR3 A;  2HQL A;  1BXT A;  3Q24 A;  1L2F A;  4IPH A;  2I5L X;  3BG3 A;  3ZJY C;  5IT9 E;  2EJM A;  3E9I A;  1DOL A;  1KRS A;  1K9M C;  3RN5 A;  4YY3 L;  2DNC A;  1XPO A;  2EOT A;  1T5X D;  1JJ2 A;  3LX0 A;  5IIF A;  2C5C A;  4JI7 Q;  1WFQ A;  4L63 B;  2NVQ B;  3CCS A;  5C44 H;  4GNX A;  3IFT A;  4QUC A;  2PO4 A;  1YIJ A;  3R3O A;  3A56 A;  2RVL A;  1WOC A;  3WDN A;  1E2Z A;  4OEL B;  1Q46 A;  5C44 B;  3CC7 A;  1PZJ D;  1VQP A;  4R1J A;  1Z47 A;  1CQV A;  2EYJ A;  1HQR D;  5I9P A;  4DR2 Q;  3SK4 A;  3UE0 A;  1SYD A;  2YYZ A;  1UE1 A;  4JI3 L;  4LF7 L;  1XMQ L;  2EVB A;  1Y8P B;  4A3B G;  4QF4 A;  4MIU A;  5E1F A;  4BBR H;  2RBM A;  5IE8 A;  1V8Q A;  2PQA A;  4TKO B;  4LF8 L;  4CKC A;  3GTP B;  1EY8 A;  2NTS A;  3PO2 H;  1QNU A;  1YVC A;  2CW0 C;  4B9X A;  1I3Q H;  4BBR B;  3K5N A;  4L5Q A;  4RKB A;  4ABN A;  4RWS C;  3DXJ C;  5CGK A;  1SNP A;  1Q90 A;  1XTD A;  3TP6 A;  2CWP A;  4JI2 L;  1XXG A;  3PO3 G;  2Q2U A;  3VA5 A;  2F0P A;  3WOF A;  2NZO A;  1I3Q B;  4CJ1 B;  4KJN A;  2N49 A;  1JOR A;  2CH4 A;  2K5N A;  3QB3 A;  1DZ1 A;  1GUT A;  2BH2 A;  1FR3 A;  1PFB A;  3KOJ A;  1SND A;  2B2T C;  4DUY L;  4DV1 L;  1KAA A;  2NVX B;  5IGB A;  2VUM G;  3K7A H;  2LFN A;  3A55 A;  4A3E H;  1PRT F;  2NYZ D;  3F2C A;  5E4X A;  4RA8 A;  2NBF A;  2MP1 A;  2KHJ A;  5EBD A;  2Z6K A;  4MHE A;  1WTV A;  4IO9 A;  4DNT B;  3K7A B;  3S15 H;  4A3E B;  2EZV A;  3W1G A;  3PIP 3;  2F0N A;  5C4H A;  2EYM A;  2F0U A;  2PW7 A;  1YJN A;  3S15 B;  1NE3 A;  1B53 A;  1EEI D;  3K6O A;  1CSP A;  2FMM A;  3FKI G;  2UXB L;  1VQD A;  4DPG A;  3C1E A;  5C0X H;  1LUZ A;  3S1M H;  2XRQ D;  3K5O A;  2WP8 J;  4JI0 Q;  3STB D;  5IWA Q;  3I4N H;  2Q8I B;  5IOC A;  3S1M B;  1I4H A;  3L7Z C;  5C3E H;  2KBN A;  4Q5V A;  1ICF B;  1EIY B;  1U4P A;  5C0X I;  2J0T D;  5EGT A;  2LXK A;  1S5C D;  3X3N A;  3GO5 A;  2E76 C;  1SMX A;  3I4N B;  1V43 A;  2Q8T A;  4IN3 A;  4KY5 A;  4B9W A;  1JT8 A;  5CC4 A;  5BN5 A;  5C3E B;  1LT5 D;  1QOH A;  4LF4 L;  2N3S A;  1PV4 A;  4NP5 A;  1KDA A;  3GTO H;  4C3I H;  1Q3L A;  3NTH A;  2NUC A;  3I73 A;  4QB4 A;  1JMC A;  2B63 H;  3B6Y A;  1YNJ D;  1HNX Q;  2H1E A;  3G4S A;  3VR6 A;  3GTO B;  5ELN A;  4OHJ A;  4C3I B;  4TVA B;  3HKZ B;  4X64 Q;  1BCP F;  4KD4 A;  2QA4 A;  4XQN A;  1PYS B;  4L5R C;  1VQ6 A;  2B63 B;  1PH5 A;  2YV5 A;  3SEB A;  2JEB I;  5BR8 Q;  1Y1W H;  4A3I H;  1SJH D;  2E2I H;  1STA A;  1AEX A;  3T56 B;  3AFQ A;  4DR4 L;  1NMF A;  4DK0 A;  4PZ8 A;  3NBH B;  3K57 A;  1ET6 A;  3T1H Q;  1SYE A;  1HNW L;  1Y1W B;  1FJG L;  3QO2 A;  3U9S A;  2E2I B;  1HUM A;  1LV9 A;  2WAQ B;  3K0Y A;  2JA7 G;  1N32 L;  2R93 H;  3S2D H;  3DHQ A;  1U4M A;  4DV2 Q;  5LMN L;  1E7Z A;  2K4K A;  4ZRZ A;  2R93 B;  1TWC B;  2BA1 A;  4CDE C;  4IPD A;  4P75 A;  3KYH C;  1BUV T;  1TKW B;  4OO1 H;  1BQQ T;  4GOP C;  1EIH A;  4S3S A;  4QJF A;  1MHW C;  4YWK A;  1TWF H;  1SNM A;  1IXR A;  1VF7 A;  4RHS A;  4XQQ A;  1GUW A;  5JPN C;  2NB0 A;  4Q0F A;  1AN8 A;  3FPU B;  2UXC Q;  3PQI A;  3NHH A;  2VB2 X;  1VQ5 A;  3S9W A;  2I5H A;  2WFW A;  4K2K A;  4DR6 Q;  3RZD B;  1ASZ A;  2R7Z H;  3HOY H;  2KUM A;  2OF1 A;  1CI3 M;  1EOV A;  5JVG 3;  1L0Y B;  1F9P A;  2JA9 A;  5GAE C;  4KI0 A;  5FLX E;  4N8F A;  2QEX A;  4J8Q A;  1EQT A;  3HOY B;  4I7A A;  2F0T A;  4NMZ A;  5KND A;  1CKO A;  4RMF A;  2QW7 A;  4X3T A;  5C4X H;  4XT3 B;  1EWC A;  5LMN W;  3I4O A;  4CJ2 C;  1H9S B;  1DYQ A;  1PH7 A;  4OX9 Q;  3CCL A;  3GTJ B;  2MQH A;  1EFI D;  5C4X B;  4LMQ D;  2ZTD A;  3E3X A;  1SFO H;  5JEA G;  5CYU A;  1HH2 P;  2KQ3 A;  1NSN S;  4QGU A;  1GOZ A;  3S24 A;  3NBH A;  1R4P B;  1EIG A;  1SNQ A;  1NR4 A;  1SFO B;  1J6Q A;  4JI7 L;  2PZW A;  3GDE A;  3CD6 A;  3K58 A;  4ILW A;  4A3G G;  3NTK A;  2B29 A;  1Q81 C;  3Q8D A;  4OIJ A;  2MNA A;  2ZT9 C;  1UWV A;  1OXS C;  1CT1 D;  1HTP A;  3FEW X;  3A7L A;  4KN4 C;  3U4V A;  1M90 C;  2A8V A;  4DR2 L;  3HOV B;  4IUU A;  2N88 A;  4CDD C;  2NN6 H;  1EFW A;  4B3M Q;  3G7L A;  3V96 A;  4E6I A;  1QB5 D;  5KYL A;  4A3F H;  4YCV A;  4BXX H;  1O80 A;  4UHV A;  1C7Y A;  3F1Z A;  4RGT A;  4HJA A;  2HHH L;  4K0K Q;  1CZG A;  2CQA A;  3HP3 A;  2F0F A;  4KLK A;  3N6R A;  2NN6 I;  2Z1C A;  4A3F B;  4PNY A;  4A3D G;  1LT4 D;  1B1Z A;  2VW9 A;  1HR0 L;  4I65 A;  5HUR A;  1N36 Q;  3I91 A;  3S1Q H;  4A3L H;  4DGZ A;  1M4V A;  1O7I A;  3SE0 A;  1EWH A;  4X65 Q;  3EBE A;  5C4J H;  2OWO A;  1SYB A;  2CHB D;  2B2Y C;  1IL8 A;  1PZI D;  3S1Q B;  3AB9 A;  3CU7 A;  2EYL A;  3ER0 A;  4IZ8 A;  4BA1 I;  1HRJ A;  3CRL C;  1FD7 D;  1WTQ A;  1H9S A;  5FLM G;  5C4J B;  1X32 A;  4GLV B;  1ROD A;  1IZ6 A;  2IHE A;  2VZA A;  3A8J E;  2XIW A;  2R3Z A;  4DV5 L;  1GHJ A;  3L9A X;  1X6O A;  3K0X A;  4R4I A;  3QJY A;  1TY2 A;  4YY3 Q;  2Z9H A;  3CAM A;  4RG1 A;  1SNC A;  1JOQ A;  1XNR Q;  3AU7 A;  4IFD H;  4DR7 L;  1EQQ A;  1SAP A;  2BE5 D;  2JK8 A;  1YEZ A;  1HR0 W;  2QKI C;  1DJR D;  4ALP A;  4JI0 L;  2QF7 A;  3OMG A;  5IWA L;  3BDC A;  1A3U A;  4WOR A;  3D31 A;  4IJH A;  1SDF A;  1IYV A;  2HT1 A;  2IPK D;  2EJF C;  2WB1 E;  3PO2 G;  3MA2 B;  4NDX A;  4RHR A;  4OWX B;  4N9T A;  3HG9 A;  2IL8 A;  4JBM A;  4CJ0 B;  4JI3 Q;  4LF7 Q;  1KDB A;  1QCB D;  1O7Z A;  4C56 C;  1K0S A;  4K6L A;  1CHP D;  1XMO Q;  2AQ3 B;  2B2U C;  5KEE A;  4JV5 L;  3K59 A;  3V05 A;  2A1A A;  5KNB A;  5M3M H;  4LF5 Q;  1DD2 A;  4L5T A;  2NVY H;  3SK6 A;  2A69 D;  3PF5 A;  2KCN A;  4P71 A;  4JI2 Q;  4A93 H;  2K04 A;  4X64 L;  4A3E G;  2NVY B;  1NBW A;  3J7A V;  1JWU D;  3QWN A;  3KF8 A;  4A93 B;  3D0F A;  3ICE A;  4EX5 A;  1I4R A;  4DUY Q;  4DK6 C;  1KXL A;  5DLQ E;  1SN8 A;  1NAP A;  1WCM H;  2JSO A;  4AYB G;  3HOX H;  4F7X A;  3M3Y H;  1K3R A;  2YTY A;  2ZM6 Q;  3G71 A;  1WCM B;  2LMC B;  5LL6 X;  3URY A;  3HOX B;  1A3T A;  3M3Y B;  3I4N G;  4DV2 L;  2DJG C;  3F2U A;  1U5K A;  1DGS A;  1LT3 D;  2UXB Q;  2Y0S E;  4O2D A;  3DLL A;  4PQX A;  2B39 A;  4MNO A;  3K81 C;  4RCN A;  1WTX A;  3C2P A;  4G7H C;  1J5E Q;  1W3S A;  2KA7 A;  2PZU A;  2WKD A;  3RD4 A;  3TZD A;  3IL8 A;  1RHP A;  1KRT A;  1CTM A;  4U67 3;  3FHW A;  3SXH A;  4J15 A;  2B63 G;  1D5X C;  1VQN A;  4DR6 L;  1N8R C;  1NMG A;  4R8N A;  2RCN A;  2PZT A;  4LF4 Q;  3P7J A;  2GN5 A;  1WD0 A;  1IBM L;  1YNN C;  1F9R A;  2JA5 G;  1EYA A;  2B8F A;  4A3I G;  4AH6 A;  4JBK A;  5BN3 A;  4QY7 A;  3BDL A;  4X3S A;  4GKJ L;  3RUZ A;  1G6Z A;  3I70 A;  3ULL A;  3I4L A;  5IP9 G;  2Z0S A;  2A19 A;  3RLO A;  1I6H B;  3ND8 A;  5EPK A;  4Z9C B;  3J81 E;  1KQS A;  4C3J H;  1K0R A;  2O4X A;  4BBS G;  4DR4 Q;  3HRZ C;  3BDO A;  2OTJ A;  4DAM A;  4X3U A;  1HNW Q;  4X62 L;  1AZQ A;  2LS0 1;  2F4I A;  4HCS A;  4C3J B;  2AMC B;  3O13 A;  1LYL A;  2MO1 A;  2HCC A;  4Y7N H;  3CCV A;  4H44 C;  1SE3 A;  1E0B A;  2KOL A;  3EJI A;  4DV3 Q;  3EIV A;  4DXF A;  1N32 Q;  4MTN A;  3BJU A;  4M1U B;  2JE6 I;  1STY A;  4JPB W;  1KDC A;  3ND9 A;  3D4D A;  4Y7N B;  4HJ7 A;  1IYU A;  5LMN Q;  1YIT A;  1MIU A;  2H5X A;  4IUP A;  1H9J A;  3MEH A;  4J1M A;  1X65 A;  1I50 H;  1SXT A;  3P20 A;  1AE2 A;  5IGC A;  3G6E A;  4JI4 L;  1SYG A;  2R7Z G;  1UE6 A;  1C48 A;  4H0L C;  4FDB A;  1CM9 A;  1I50 B;  2F3I A;  1CK1 A;  3H3V H;  1I4X A;  4K0K L;  1NUC A;  3TME A;  1U9R A;  1VQA A;  5C4X G;  2VNU D;  3NBI A;  1IKM A;  1FVI A;  3PIO A;  2WB1 B;  3I4M G;  3T4A C;  5GAD C;  2K52 A;  5NUC A;  4GLX A;  1N36 L;  3RZO H;  2A68 C;  2X69 A;  5IOD A;  2JA6 H;  2EIF A;  5I6Y A;  3M85 A;  3DWQ A;  1YZ6 A;  2F0L A;  4MTK A;  3J81 i;  2Q2H A;  2B2V C;  5FOB B;  4A3C H;  1Q8K A;  3RZO B;  1UEA B;  4KHP Q;  1EZ8 A;  2JA6 B;  4DR5 Q;  3PF4 A;  1FYC A;  1OO9 B;  5M9O A;  1VQH A;  2K33 A;  1HFG A;  1V1Q A;  2DUD A;  2NVQ H;  4V0B A;  4LFB Q;  1T9H A;  2L15 A;  3NSW A;  2QDB A;  1LTB D;  4NPS A;  1XNR L;  2OQ0 A;  2EDG A;  4X3K A;  5JPM C;  5L37 A;  4QQB X;  4YWL A;  1QVG A;  1RF2 D;  3VR5 A;  4UP9 A;  1YHB A;  4DK3 C;  3KLR A;  1F2Y A;  2EY5 A;  2L1B A;  4XYO A;  1EYG A;  2A5H A;  1Y69 U;  2NVT H;  1SJE D;  1PRT C;  1EY5 A;  5DM7 3;  4FNF A;  2I5M X;  1S5F D;  1CFM A;  4HR7 B;  1XYI A;  1I5F A;  4A3K B;  2XVS A;  1AP0 A;  3HGB A;  2K05 A;  4RH6 A;  3HOZ H;  5M5Y H;  2NVT B;  1AW7 A;  2Z4H A;  1SYF A;  4R4Q A;  3A54 A;  4KD3 A;  1BVS A;  3CXC A;  3I8Z A;  2ZXR A;  2JN4 A;  3GTP H;  1DOK A;  1EZ6 A;  2E2D C;  2XWB B;  3T16 A;  3LWU A;  3UDF A;  5EQ0 A;  1B7Y B;  5ISR A;  2GVA A;  2Y0S B;  4EVO A;  1XMO L;  3HOZ B;  4B3R L;  2UXD L;  5M5Y B;  4TSS A;  4DAP A;  3FPP A;  1RJT A;  3HOW G;  1PA6 A;  4FXD A;  5IGD A;  2HHH Q;  3W5O A;  2JQO A;  5I2X A;  4LF5 L;  3EFX D;  3HFZ B;  3MXP A;  1VQJ A;  3KK7 A;  1B3Q A;  1HR0 Q;  5E7N A;  2K5H A;  4B3S Q;  5IYB H;  2ES2 A;  4APV A;  4DA2 A;  5IP7 H;  3OTO L;  2NVX H;  1HJP A;  2PW5 A;  1L1O C;  2CCZ A;  3NQI A;  1TWH H;  2FXQ A;  2B2W C;  1ICW A;  1EOT A;  1OXU A;  2A6E D;  4IOA A;  1C9O A;  5GAH C;  5C4Z A;  3K80 C;  2NWG A;  1WI5 A;  1AE3 A;  1K8G A;  3TS2 A;  1TWH B;  1YHQ A;  2E2J H;  1H9R A;  4GLA C;  4U68 A;  1JC7 A;  3ULP A;  4BA2 I;  1HHV A;  2RDG A;  2IT1 A;  4IPG A;  4DV5 Q;  1IBL L;  1VQE A;  3OW7 A;  2ZM6 L;  4RCO A;  2RCF A;  4KV6 A;  1SSO A;  5ELF A;  1BCP C;  4OON A;  2E2J B;  4PMB A;  1IBK L;  3OWF A;  4DKA C;  3JAM c;  4DR7 Q;  1UEB A;  3J7Y W;  1CKM A;  5KIX A;  3I90 A;  4BY7 H;  2AWN A;  4ZYS A;  2LY7 A;  1IKL A;  2JA8 G;  4G4K A;  3N52 A;  1YJW A;  1TS3 A;  3KJP A;  2TSS A;  4CHT B;  3J80 c;  2D0P A;  4QCL A;  4JI8 L;  4BY7 B;  3H15 A;  5ELC A;  2D62 A;  2ENB A;  4BWG B;  1J5E L;  1NY4 A;  3R2T A;  3DM1 A;  3MAQ A;  1BBX C;  5M3M G;  4J6H A;  2D0O A;  3TP7 A;  4TQU S;  2PI2 E;  1UE5 A;  2O5J C;  2KED A;  4JOI C;  1BNZ A;  2A73 B;  4UAI A;  3EQL C;  3A8I E;  4JV5 Q;  1STG A;  2H4O A;  5FO7 B;  3D6C A;  4B3T L;  4MZ9 A;  1ENF A;  2NZH A;  3P75 A;  3T51 B;  2C9O A;  4G57 A;  4LJZ C;  1QG7 A;  1IW7 C;  2PQE A;  2CW0 D;  2X6G A;  2E74 C;  2F0G A;  1WCM G;  4GZY C;  4HTH A;  3ITP A;  2RHS B;  3DEP A;  4R9W A;  3VR2 A;  4UDU C;  1VQ8 A;  1G2T A;  3S1N H;  3OPO A;  1TWA B;  3R2I A;  2FJ2 A;  1SE4 A;  4C3H H;  3DWA A;  3ZYY X;  1TQO A;  3PUW A;  1KL9 A;  3A7A B;  5D3D A;  5EJW A;  1WTO A;  3S1N B;  4DV3 L;  3KF6 B;  4UP7 A;  1E22 A;  3J7Z C;  1TWC H;  4A3M H;  1I4G A;  4C3H B;  5D65 A;  1A15 A;  3CCU A;  3RMH A;  2Z8L A;  3C1F A;  4OL7 A;  2L11 A;  3D8G A;  4A3M B;  1BF4 A;  4KKT A;  4DR1 Q;  4DR3 L;  5JJL A;  1OTC A;  1R4Q B;  1B8A A;  2EYF A;  5A2Q L;  2D5D A;  2ZXP A;  3KDF B;  4ZUI A;  2L12 A;  4FVM A;  2L9H A;  1G91 A;  4YHH L;  1N34 L;  3UE1 A;  1S3O A;  4BY1 H;  3RZD H;  3E0J A;  3DUZ A;  4OEM B;  5GQO A;  1V1P B;  1PH3 A;  1PYW D;  3L0O A;  1ESF A;  1UE7 A;  5KNC A;  3JAM L;  4JK1 C;  4BY1 B;  1EEF D;  3M4O H;  1ENA A;  5I9O A;  2XRS D;  4DV0 Q;  2IX0 A;  1IBM Q;  4JI1 L;  5JVH 3;  1Q8I A;  5GRO A;  2VQE Q;  3GTJ H;  4FF3 A;  3M4O B;  3J80 L;  2NZ1 D;  5CBA E;  3T1Y Q;  1PTO C;  3MTS A;  5IYC H;  4GKJ Q;  4KHP L;  4DR5 L;  5DNF A;  2F0Q A;  2HQE A;  5K36 H;  3WWV A;  5C6A A;  1TII D;  4LUO A;  3HOU G;  1G51 A;  1DON A;  1GD7 A;  3I7F A;  2KVM A;  2HCI A;  2G9H D;  2B3G A;  1W2B A;  1PH4 A;  1PRT B;  1GKH A;  2F4V L;  5T1I A;  1PH6 A;  1HTL D;  1STE A;  4LFB L;  2EYH A;  1EL0 A;  1B70 B;  4X62 Q;  4CDF C;  5IGG A;  2RA4 A;  4A3J G;  2R92 B;  3I55 A;  4HAE A;  1ET9 A;  5I4D A;  2I07 B;  3BVM A;  1LTG D;  5CV5 A;  5C5L A;  4A4I A;  1IL2 A;  4OIK A;  4IAL A;  1Y1V G;  1RKN A;  1EYD A;  1HCZ A;  3KF6 A;  3EVQ A;  1PDQ A;  3HOV H;  5J1Z A;  3E0E A;  5FJ8 H;  1JE4 A;  4HJ5 A;  3BS1 A;  4JG2 A;  5M3F H;  2JEA I;  5DAU A;  5IGF A;  2ZXO A;  2PMZ E;  4JI4 Q;  3QOL A;  3TQY A;  5M3F B;  2OEO A;  5COR A;  2JXM B;  1PTO F;  5BN4 A;  2D9U A;  1H9K A;  3NPP A;  4KHZ A;  3KDF A;  5EKL A;  4F87 A;  2VQF L;  1L1O B;  4HMJ A;  5E4W C;  1FNV A;  1S72 A;  3FMC A;  1A2T A;  4A3C G;  1V1P A;  2DY8 A;  2SNS A;  2L55 A;  2E2H H;  4GNX C;  1SMY C;  4B3S L;  1X3G A;  4JC0 A;  2R6G A;  2K5Q A;  1NTG A;  5C3X A;  2RQX A;  4HED A;  4LUV A;  4WJ4 A;  5JJK A;  2EQS A;  1HZB A;  2E2H B;  3MWY W;  2ZTC A;  3W2D A;  4DNI A;  3HZX A;  3LNN A;  2F0E A;  4DNR B;  1K83 B;  1P16 A;  1LTR D;  1LTI D;  1Q12 A;  1LTA D;  3T53 B;  1MBY A;  5M5X H;  2Z4I A;  4CBV A;  5C44 G;  1K8A C;  5C3W A;  2IW3 A;  4R4T A;  2A6H C;  2RKS A;  4A3B B;  5M5X B;  5G3L D;  3G6J B;  2VB3 X;  3KJO A;  3PO3 H;  5CV9 A;  3FRP B;  3AQQ A;  2AUJ D;  3UDX A;  3C3L A;  3GTM B;  3M7G A;  2UUC L;  2ATW A;  3GP7 A;  1JCK B;  5ELE A;  3PO3 B;  1LO5 D;  4BBR G;  1RIP A;  2KEE A;  1HPC A;  3M4Y A;  1IHZ A;  1SRO A;  3MZ5 A;  1AZP A;  2LSS A;  5CV8 A;  2L5T A;  5T1G A;  2VUM H;  1PH2 A;  3J80 i;  4UY8 C;  4G7Z C;  4P73 A;  3OSO A;  2IX3 A;  2F0K A;  5KRU A;  3S14 H;  2F52 A;  2CH4 W;  3NE5 B;  4NW2 A;  1EQV A;  2Z6K C;  1F2Z A;  2VUM B;  4OWT B;  5D3I B;  4B3R Q;  2UXD Q;  5J39 A;  5IYB G;  1C4Q A;  3VA7 A;  3BVZ A;  5JEA J;  3S14 B;  2F3W A;  4LW1 A;  3UDG A;  1B3A A;  2B2T A;  1HZA A;  1VQB A;  1D5M C;  5EAY A;  2B2W A;  5KGU A;  2IHF A;  1HXY D;  3FKI H;  1UNS A;  2F0V A;  2FHT A;  1VQL A;  1MSH A;  4RAU C;  3A5U A;  4K2L A;  1KTK A;  1SE8 A;  4K5W A;  4ME5 A;  4JBJ A;  4KMU C;  3OTO Q;  3FKI B;  5D14 A;  1Z6H A;  1S5D D;  3IAY A;  3PV0 A;  1K8M A;  4DV4 Q;  4KK7 A;  4G7O C;  1FGB D;  1S5B D;  1R9T B;  1VQK A;  3TP5 A;  5JOB A;  2PYK A;  3F8T A;  3RR5 A;  3TZU A;  2EYP A;  5EPL A;  1ZEQ X;  4GOP B;  5DM6 3;  4DV7 L;  5IT9 c;  5C0X G;  1E2W A;  1IBL Q;  3GTG H;  1ZYR C;  1F9Q A;  1LLR D;  1MKH A;  1LAB A;  3OIP A;  5JJZ A;  1B50 A;  1GVP A;  3BZC A;  4Y52 H;  1BOS A;  1IBK Q;  3GTG B;  1QUQ B;  5C3E G;  4YWM A;  1D6E C;  1S5E D;  1GM5 A;  2WAC A;  1A8V A;  1WTR A;  2N78 A;  3K8A A;  1YBY A;  3KLS A;  4DR1 L;  1GJX A;  4K14 A;  3CW2 C;  2HUG A;  2KEC A;  1G29 1;  1V9P A;  2KCM A;  1X55 A;  3RN2 A;  4ULL A;  4JI8 Q;  4HSV A;  1QJO A;  1TR5 A;  1Z7T A;  3JC6 6;  1VMC A;  2OT2 A;  4PMW A;  3CPW A;  4C3I G;  2IY5 B;  3HKZ G;  5KYI A;  1LTS D;  4DXG A;  1ENC A;  1XJV A;  1OXX K;  4ZUJ A;  1LTT D;  4P72 A;  1G8Z D;  2K1B A;  1DXM A;  1GUN A;  1TU2 B;  1KAB A;  3Q23 A;  1NJI C;  4DV0 L;  4EQN A;  2PMZ B;  3ULJ A;  1Y1W G;  4B3T Q;  2AKW B;  5CR3 A;  2VQE L;  2JA7 B;  1B44 D;  3HS0 C;  3R8B A;  3T1Y L;  1I6H H;  1KNA A;  4HSP A;  1HQM C;  1EU4 A;  1QZG A;  1I6V C;  2WAQ G;  2DY7 A;  2XSC A;  3PUV A;  1A2U A;  3AYH B;  5LMU Q;  4EQP A;  2CWA A;  1XTC D;  4FYD A;  1W6J A;  5TSS A;  1TVX A;  2R93 G;  3H0G H;  1F9S A;  1LT6 D;  4DAY B;  3NQT A;  3BZD B;  3NP8 A;  2MPM A;  3CQZ H;  3CMA A;  1RCV D;  2BDO A;  1KD1 C;  2AHO B;  3H0G B;  1ILQ A;  2MO0 A;  3IRB A;  4GOP A;  4OO1 G;  1GXD C;  4DN4 M;  3HEJ A;  2M9V A;  3CQZ B;  4OGQ C;  1TXY A;  1WYD A;  1VMP A;  4AIM A;  4RKL A;  4P2C B;  3I2Z A;  1QUQ A;  2KHS A;  3J81 j;  1QVF A;  5EKK A;  4DR3 Q;  3J7A F;  4AYB E;  1VQC A;  3TEH B;  4IOC A;  4TRD A;  1A63 A;  1JOK A;  3HOY G;  1I94 Q;  2JYO A;  2K5W A;  2K6A A;  4IQZ A;  3K5M A;  1L0W A;  3GV3 A;  5IT9 L;  1UUP A;  3J7A 5;  4YHH Q;  1N34 Q;  1VQI A;  4C1N I;  4K6D A;  3OIQ A;  2AQ1 B;  4ZK9 B;  3TP8 A;  4CGY B;  2N55 A;  3RNU A;  2PNH A;  2XNA C;  1NCV A;  3CCR A;  1PH1 A;  4A3G H;  5K36 G;  1HA6 A;  3Q22 A;  3FDT A;  2ZJR A;  1VDZ A;  1JJG A;  2K75 A;  4JI1 Q;  5C0X J;  1TS2 A;  4ZLT F;  1WTP A;  4H02 A;  3CC4 A;  4X6A H;  1KLU D;  4A3G B;  1T5E A;  1FGU A;  3DWP A;  4K5V A;  3S17 H;  1YNN D;  4M8A A;  3CKI B;  4K5X A;  3OW2 A;  1X3Q A;  4K8I A;  4P74 A;  2GVB A;  3S17 B;  1OXV A;  3NEL A;  5FO8 B;  4JVZ A;  4NB3 A;  2PCF B;  2WV6 D;  4PMC A;  1F2M A;  2F4V Q;  1F2L A;  2LKV A;  2XTI A;  1TS5 A;  3ERO A;  3HOV G;  1O78 A;  2QCP X;  3K5L A;  5FJ8 G;  1QIL A;  3U9O A;  4A3D H;  2F0D A;  2ID0 A;  3LGJ A;  2F3V A;  1M8A A;  1EY0 A;  4K8J A;  1B4O A;  4IJL A;  4JI5 L;  1CA5 A;  4XQJ A;  1RL2 A;  1CZW A;  4A3K H;  4A3D B;  2NN6 G;  2EXD A;  3CC2 A;  5H1S E;  2ASB A;  1AFP A;  4MN3 A;  2QEJ C;  1H95 A;  4A3F G;  2K32 A;  4BXX G;  1GUS A;  3CME A;  3SHL A;  3L3O C;  4RGO S;  5FLM H;  2FIN B;  1D2B A;  4HIK A;  3STB C;  3VR3 A;  2VXW A;  1YHA A;  2G9D A;  5I6W A;  4ODG A;  4A3L G;  2VQF Q;  1MI2 A;  3NWT A;  5EKI A;  1J8I A;  2B2Y A;  4OXP A;  2Q2T A;  2DNE A;  2UUA Q;  1YJ9 A;  1P8L A;  2AWO A;  1CSQ A;  3V2T A;  1FL0 A;  1SNO A;  5FKA C;  1RTO A;  4NXN Q;  5FLX c;  3MXG A;  3R93 A;  3Q0A A;  2A68 D;  2AUK A;  5E3F A;  2R7F A;  1JWS D;  1VQF A;  2L0C A;  1YNJ C;  2X6L A;  5I2Y A;  4DV4 L;  4HJ8 A;  1O7L A;  3GD7 A;  4PG3 A;  5LHY 1;  4IFD G;  1Q86 C;  1PXU A;  4I7Z C;  3AMU A;  3PO2 B;  1EY6 A;  3EA6 A;  1JR0 D;  2M2L A;  1CKN B;  1XPR A;  3CCE A;  1JWM D;  3U58 A;  4LFA L;  3TRZ A;  1SBB B;  4DK1 A;  1LM0 A;  4KN7 C;  1N33 L;  3D4R A;  4A76 A;  5C5M A;  1SE2 A;  2EJG C;  1X3P A;  1C0A A;  2MFI A;  2OCE A;  2UUC Q;  5IGE A;  2O2L D;  3C46 A;  2B2U A;  4LF6 Q;  2RDF A;  5GAG C;  1X3F A;  3NK9 A;  5IY0 A;  1MGS A;  1PRT D;  1KLG D;  1YI2 A;  3TRE A;  1XNQ L;  3SK8 A;  4AQY L;  4JYA L;  4YIJ A;  3IFD A;  1S4Z A;  1KC8 C;  2VY3 A;  2A74 C;  4R4O A;  2UUB L;  2XWJ B;  5HGQ A;  4A93 G;  1PFN A;  4H7B A;  2HIX A;  1STH A;  4O0A A;  5ELB A;  2SDF A;  5LL6 S;  4AYB B;  4GKK L;  3TSS A;  1OXT A;  2RSN A;  5ELD A;  1ML0 D;  4RFB A;  4XTC S;  5CV6 A;  4IUQ A;  2RDH A;  2SNM A;  5COY A;  1PH9 A;  2ICE C;  2J7Z A;  5J3B A;  2SOB A;  4WJW A;  3HOX G;  5LMU L;  1KNE A;  3CCJ A;  3OMC A;  1EYC A;  2EY6 A;  1TWA H;  1U4L A;  4QUF A;  1D7Q A;  1V1O A;  5IYD H;  3F2D A;  2Q2I A;  3NEM A;  1K3B C;  2F1M A;  3OOC A;  4CKE A;  1EU3 A;  1O7Y A;  1VQ9 A;  1JIC A;  3A0J A;  1TY0 A;  4GS3 A;  4GN5 A;  2ALY B;  4UPA A;  3L2P A;  4DV7 Q;  4IUT A;  2C35 B;  1W6K A;  4QIW E;  1D5Z C;  3PUX A;  1CKN A;  3D3R A;  2JA5 H;  3DMU A;  1SYC A;  4QL5 A;  1STN A;  5FLX L;  2K7V A;  1WVL A;  4ZCK A;  1Y14 B;  4F8M A;  2DN8 A;  1YNX A;  2OTL A;  1BCP D;  5AJ3 Q;  3FP9 A;  1EY9 A;  3E9H A;  4HN7 A;  3RLN A;  4A3I B;  2JA5 B;  4NXM L;  5IP9 H;  1XX8 A;  2Q8R E;  3PUY A;  1XPU A;  1K73 C;  4DV6 L;  2QIL A;  2CVR A;  1WTH A;  1DCZ A;  1WTW A;  2MJ8 A;  1L0X B;  3MEF A;  1I94 L;  3BYT B;  4BBS H;  2UU9 L;  1MSG A;  2V1C C;  4IUR A;  4OWW B;  1NNX A;  4FXK C;  4PV1 C;  4PZ6 A;  4F88 A;  3U4Z A;  2EYO A;  2R7D A;  4L5S A;  2KCT A;  1PHJ A;  4ZAI A;  4BBS B;  2CQO A;  3NEN A;  3S2D B;  1A3V A;  2EXZ A;  4WRD A;  1KIX A;  4IFD J;  4FF1 A;  1E1O A;  4DUZ L;  1VF5 C;  3K7U C;  4C2M H;  3SVM A;  2ZJP A;  5DEH A;  4DU9 A;  3NUC A;  4KJO A;  2HDM A;  1HZ9 A;  3T13 A;  3W1B A;  4C3J G;  4C2M B;  1WJJ A;  1A6X A;  2F0M A;  3CCM A;  4OO1 I;  3H0G G;  1TWF B;  4NKL A;  1IW7 D;  4LFC Q;  2Z6B A;  2P5Z X;  1VCI A;  2VL6 A;  4UP8 A;  4LWC A;  2IWH A;  1QZH A;  5A35 A;  1HNZ Q;  2R92 H;  1ILP A;  3A8K E;  2R7Z B;  3P1H A;  3E6Z X;  3PCO B;  4JI6 Q;  2CFM A;  3QIA A;  1M1K C;  1BDO A;  3I56 A;  3M4P A;  2RF4 A;  3I4M H;  3CP0 A;  3TS0 A;  3WOE A;  1X9N A;  5A2Q E;  1DM0 B;  4A75 A;  1QVC A;  4KTA A;  3TBI B;  1RD9 D;  3D4W A;  3PIP A;  1X54 A;  4ID6 A;  3I4M B;  3UI2 A;  1EIF A;  4EQ5 A;  1U4R A;  5K5P A;  2WB1 G;  4LK1 C;  2BE5 C;  1Q1B A;  1Q82 C;  2ZTE A;  3JAM E;  3GTQ H;  2KJX A;  3HKS A;  4X66 Q;  2QGQ A;  1I4Q A;  2BCO A;  2K5V A;  4FO2 A;  1PH8 A;  2E5L Q;  1STB A;  1X3E A;  2JA6 G;  4ZKC B;  3J80 E;  1SRU A;  2QDL A;  2YTV A;  3GTQ B;  3F2B A;  1H9M A;  2F0O A;  3H91 A;  2EY2 A;  2B2V A;  3PUZ A;  4LF9 Q;  5CV7 A;  3ONA B;  2OXP A;  2UUA L;  4KKS A;  2RSO A;  3BYY B;  3M7N A;  4ME3 A;  3RLF A;  5EPJ A;  5AFW A;  3LWE A;  4LAA A;  4NXN L;  3I3C A;  4POF A;  3GV6 A;  2K03 A;  1K83 H;  2N8N A;  4O42 A;  2V4D A;  1BCP B;  4HIO A;  4WFN 3;  1BBU A;  1JQY D;  1G2S A;  3GTK H;  2TMP A;  2A69 C;  1N9W A;  4KY7 A;  4BS9 A;  2HIV A;  1PTO D;  3DM3 A;  4YCU A;  1E3P A;  2EE1 A;  5G3L F;  3MXU A;  4A3B H;  1ZKO A;  3GTK B;  3MFG A;  1MJC A;  4KY6 A;  3J81 c;  3PGZ A;  1PLF A;  1S40 A;  4RGN A;  3HOW H;  4A3K G;  1G6P A;  3KF8 B;  2EY1 A;  2K01 A;  1ONL A;  4IUV A;  2K5D A;  4GN3 B;  1PFS A;  3ERS X;  2F0J A;  2K14 A;  2WKC A;  3FVQ A;  2YU9 H;  3GTM H;  3TN2 A;  3VYU A;  3HOW B;  3A5Z B;  2CKZ B;  3QR8 A;  2Y0S G;  3HOZ G;  4KHV A;  3SGI A;  4JI5 Q;  3H3V C;  2YU9 B;  3JAM i;  1QE6 A;  3ERQ A;  1B9N A;  4C1N K;  4JW0 A;  3AFP A;  4B08 A;  4HIM A;  4LF6 L;  1VQ4 A;  4QIW B;  2FFK B;  1EY4 A;  1JB3 A;  1C8C A;  3OYY A;  2DJF C;  3IKJ A;  4XYQ A;  3MHB A;  2F03 A;  5CBE E;  3SR1 A;  1VQG A;  1PFM A;  1BKB A;  4H13 C;  3KFU A;  2IX1 A;  1ESR A;  3NTI A;  5ELO A;  2JJQ A;  2FMC A;  3CRK C;  1D1K A;  2SEB D;  4FF2 A;  2O5I C;  5IP7 G;  2KCC A;  2ZJQ A;  1Z9F A;  2PNR C;  4IFD I;  1JE5 A;  3GTL H;  1SEB D;  2AQ2 B;  1L1O A;  3H94 A;  1D1I A;  1JJC B;  5JAV A;  1Y8O B;  4XT1 B;  1WD1 A;  1BBW A;  1MD2 D;  2WIN B;  2JA8 H;  2VS1 A;  3GTL B;  2L4N A;  1XMQ Q;  1QNK A;  1TT2 A;  2K28 A;  4CKB A;  2BDN A;  3PIO 3;  1R9T H;  1SMY D;  4FF4 A;  3VDY A;  3QOJ A;  3DEO A;  3OHX C;  2PI2 A;  4LF8 Q;  4PZ7 A;  2JA8 B;  4L8J A;  4DF7 A;  1F77 A;  1Q1E A;  2I46 A;  4IPC A;  3W3A A;  1I4P A;  1E2V A;  1CUK A;  1B9M A;  1D8L A;  1HNX L;  3MVV A;  1LAC A;  4ZKB B;  4WJ3 M;  1U0L A;  4R4C A;  3SK5 A;  4BY7 G;  5M3M B;  2J4X A;  4LFA Q;  1MJE A;  2HD3 A;  4KKU A;  5BR8 L;  2E8G A;  3KBG A;  5CV4 A;  2F0I A;  2MUY A;  2A6H D;  1N33 Q;  3T1H L;  4DV1 Q;  1A0I A;  2M00 A;  2PPB C;  5AJ3 L;  3EN2 A;  3KLW A;  2E75 C;  4HJ9 A;  1GO3 E;  4V19 0;  5HGT A;  3S2H H;  2K50 A;  1E1T A;  3CHB D;  4JOI A;  3D6W A;  4O1N A;  1PTO H;  2BOS A;  1CQF A;  1II3 A;  3J81 L;  3S16 H;  3VYT A;  4GN4 B;  2MGS A;  4CDC C;  3S2H B;  3GQB A;  1HUN A;  1XNQ Q;  3KUP A;  4AQY Q;  2MHV A;  4JYA Q;  1PTO B;  1VQO A;  3E5S A;  2I0Q A;  4N9P A;  3S16 B;  3SDZ A;  3AEV A;  5JJI A;  1SLJ A;  2OQK A;  2UUB Q;  2JA7 H;  3PMF A;  3MXN B;  3CF5 A;  4XXE A;  1BO0 A;  3BZK A;  5HY6 A;  4GKK Q;  3MFY A;  1HFN A;  5IYD G;  2KHI A;  4FP5 D;  1Q7Y C;  5M5W H;  2F0S A;  1GUO A;  3CPF A;  4LNQ A;  2ICI A;  2RHQ B;  3G48 A;  2UXC L;  3BU2 A;  3I72 A;  2F0H A;  4LFC L;  1EWI A;  2GA4 B;  4FXG C;  4DAV A;  1FNU A;  1NR2 A;  2R61 A;  4C3H G;  5M5W B;  2JP1 A;  3H6M A;  1HNZ L;  4XIG S;  1CHQ D;  1XWE A;  1JB7 A;  4EQO A;  4A3M G;  1RDP D;  4JI6 L;  1E24 A;  3KBX A;  1QWY A;  1ASY A;  2B8G A;  2EPB A;  3A74 A;  2D2C C;  4OX9 L;  3QG1 A; 
#chains in the Genus database with same CATH homology
 1ZXT A;  4XDX A;  1K8O A;  4R8I A;  4DFA A;  1DOM A;  1TS4 A;  1RTN A;  4L6T B;  1ZYR D;  3VR4 A;  5FO9 B;  1Y8N B;  1HA5 A;  1PZK D;  5F2D A;  2F0W A;  1GUG A;  4HCE A;  2HDL A;  5JEA H;  1B2T A;  4QMG A;  1FNW A;  4JBW A;  3Q6S A;  5EBC A;  1CA6 A;  3HOU B;  3MC0 B;  5FK9 C;  1BR9 A;  4A3J B;  1J9O A;  3VYS A;  3MXN A;  5J22 A;  4IUN A;  3KLS X;  4HMI A;  1Y1V B;  3BVG A;  2NTT A;  3TDQ A;  2BA0 A;  1TWG B;  4ZQ3 A;  4RGM A;  3NWS A;  3S1R B;  1JOO A;  5CMD A;  3NXW A;  3VYR A;  1EY7 A;  3X3M A;  1UAP A;  2WII B;  2IJ0 A;  2XN9 C;  3OWE B;  1GHK A;  1PMR A;  2A6E C;  4DAY A;  3H09 A;  4EGV A;  1BXT A;  3Q24 A;  3BG3 A;  5IT9 E;  2EJM A;  1DOL A;  2DNC A;  2EOT A;  1T5X D;  3LX0 A;  5IIF A;  2C5C A;  4L63 B;  2NVQ B;  3IFT A;  4QUC A;  2PO4 A;  3R3O A;  3A56 A;  2RVL A;  3WDN A;  1E2Z A;  5C44 B;  1PZJ D;  1Z47 A;  1CQV A;  2EYJ A;  1HQR D;  5I9P A;  3SK4 A;  1SYD A;  2YYZ A;  2EVB A;  1Y8P B;  4QF4 A;  4MIU A;  5E1F A;  2RBM A;  1V8Q A;  4TKO B;  4CKC A;  3GTP B;  1EY8 A;  2NTS A;  1QNU A;  2CW0 C;  4B9X A;  4BBR B;  3K5N A;  4RKB A;  4ABN A;  4RWS C;  3DXJ C;  5CGK A;  1SNP A;  1Q90 A;  3TP6 A;  1XXG A;  3VA5 A;  2F0P A;  3WOF A;  1I3Q B;  4CJ1 B;  4KJN A;  1JOR A;  3QB3 A;  1DZ1 A;  1GUT A;  1FR3 A;  1PFB A;  1SND A;  2B2T C;  1KAA A;  2NVX B;  5IGB A;  2LFN A;  3A55 A;  1PRT F;  2NYZ D;  5E4X A;  4RA8 A;  2NBF A;  2MP1 A;  5EBD A;  4MHE A;  1WTV A;  4DNT B;  3K7A B;  4A3E B;  2EZV A;  3PIP 3;  2F0N A;  5C4H A;  2EYM A;  2F0U A;  2PW7 A;  3S15 B;  1B53 A;  1EEI D;  3K6O A;  2FMM A;  3C1E A;  5C0X H;  2XRQ D;  3K5O A;  2WP8 J;  2Q8I B;  5IOC A;  3S1M B;  1I4H A;  3L7Z C;  4Q5V A;  1U4P A;  5C0X I;  2J0T D;  5EGT A;  3X3N A;  1S5C D;  3GO5 A;  2E76 C;  3I4N B;  1V43 A;  2Q8T A;  4IN3 A;  4KY5 A;  4B9W A;  5CC4 A;  5BN5 A;  5C3E B;  1LT5 D;  1QOH A;  4NP5 A;  1KDA A;  1Q3L A;  3NTH A;  2NUC A;  3I73 A;  4QB4 A;  1YNJ D;  2H1E A;  3VR6 A;  3GTO B;  4OHJ A;  4C3I B;  3HKZ B;  1BCP F;  4KD4 A;  4XQN A;  2B63 B;  3SEB A;  2JEB I;  1SJH D;  3T56 B;  1STA A;  1AEX A;  4DK0 A;  3K57 A;  1ET6 A;  1SYE A;  1Y1W B;  3QO2 A;  3U9S A;  2E2I B;  1HUM A;  1LV9 A;  2WAQ B;  3K0Y A;  3DHQ A;  1U4M A;  4ZRZ A;  2R93 B;  1TWC B;  2BA1 A;  1BUV T;  1TKW B;  4OO1 H;  1BQQ T;  1EIH A;  4S3S A;  1SNM A;  1VF7 A;  4RHS A;  4XQQ A;  1GUW A;  5JPN C;  2NB0 A;  4Q0F A;  1AN8 A;  3FPU B;  3NHH A;  2VB2 X;  3S9W A;  4K2K A;  3RZD B;  2KUM A;  2OF1 A;  1CI3 M;  5JVG 3;  1L0Y B;  1F9P A;  4KI0 A;  5FLX E;  4J8Q A;  1EQT A;  3HOY B;  2F0T A;  4NMZ A;  5KND A;  4X3T A;  4XT3 B;  1EWC A;  4CJ2 C;  1H9S B;  1DYQ A;  3GTJ B;  1EFI D;  5C4X B;  4LMQ D;  5JEA G;  5CYU A;  2KQ3 A;  1NSN S;  1GOZ A;  3NBH A;  1R4P B;  1EIG A;  1SNQ A;  1NR4 A;  1SFO B;  2PZW A;  3K58 A;  4ILW A;  3NTK A;  4OIJ A;  2ZT9 C;  1OXS C;  1CT1 D;  1HTP A;  3FEW X;  3A7L A;  4KN4 C;  3HOV B;  4IUU A;  2N88 A;  2NN6 H;  3G7L A;  3V96 A;  4E6I A;  1QB5 D;  5KYL A;  1O80 A;  4RGT A;  1CZG A;  2CQA A;  3HP3 A;  2F0F A;  3N6R A;  2NN6 I;  2Z1C A;  4A3F B;  4PNY A;  1LT4 D;  1B1Z A;  4I65 A;  5HUR A;  3I91 A;  4DGZ A;  1M4V A;  3SE0 A;  1EWH A;  1SYB A;  2CHB D;  2B2Y C;  1IL8 A;  1PZI D;  3S1Q B;  3AB9 A;  3CU7 A;  2EYL A;  1HRJ A;  4IZ8 A;  4BA1 I;  3CRL C;  1FD7 D;  1WTQ A;  1H9S A;  5C4J B;  1X32 A;  1ROD A;  3A8J E;  2XIW A;  2R3Z A;  1GHJ A;  3L9A X;  3QJY A;  1TY2 A;  1SNC A;  1JOQ A;  3AU7 A;  4IFD H;  1SAP A;  2BE5 D;  2QKI C;  1DJR D;  2QF7 A;  3OMG A;  3BDC A;  1A3U A;  4WOR A;  3D31 A;  1SDF A;  1IYV A;  2IPK D;  2EJF C;  3MA2 B;  4NDX A;  4RHR A;  4N9T A;  3HG9 A;  2IL8 A;  4CJ0 B;  1KDB A;  1QCB D;  1O7Z A;  4C56 C;  4K6L A;  1CHP D;  2AQ3 B;  2B2U C;  5KEE A;  3K59 A;  3V05 A;  5KNB A;  1DD2 A;  3SK6 A;  2A69 D;  2KCN A;  2K04 A;  2NVY B;  3J7A V;  1JWU D;  3QWN A;  3KF8 A;  4A93 B;  1I4R A;  1NAP A;  2JSO A;  4F7X A;  1WCM B;  2LMC B;  5LL6 X;  3URY A;  3HOX B;  1A3T A;  3M3Y B;  3F2U A;  1LT3 D;  4PQX A;  2B39 A;  4RCN A;  1WTX A;  3C2P A;  4G7H C;  2KA7 A;  2PZU A;  2WKD A;  3RD4 A;  3TZD A;  3IL8 A;  1RHP A;  1CTM A;  4U67 3;  3SXH A;  1D5X C;  4R8N A;  2PZT A;  3P7J A;  1WD0 A;  1YNN C;  1F9R A;  1EYA A;  2B8F A;  5BN3 A;  3BDL A;  4X3S A;  3RUZ A;  1G6Z A;  3I70 A;  3I4L A;  1I6H B;  3ND8 A;  5EPK A;  4Z9C B;  3J81 E;  2O4X A;  3HRZ C;  3BDO A;  4X3U A;  1AZQ A;  2LS0 1;  2F4I A;  4HCS A;  4C3J B;  3O13 A;  2HCC A;  4H44 C;  1SE3 A;  1E0B A;  2KOL A;  3EJI A;  4DXF A;  4M1U B;  2JE6 I;  1STY A;  1KDC A;  3ND9 A;  3D4D A;  4Y7N B;  1IYU A;  4IUP A;  1H9J A;  3MEH A;  4J1M A;  1SXT A;  3P20 A;  5IGC A;  1SYG A;  1C48 A;  4H0L C;  1CM9 A;  1I50 B;  1CK1 A;  1I4X A;  1NUC A;  3TME A;  1U9R A;  2VNU D;  3NBI A;  1IKM A;  2WB1 B;  3T4A C;  5NUC A;  2A68 C;  2X69 A;  5IOD A;  5I6Y A;  3M85 A;  3DWQ A;  2F0L A;  2B2V C;  5FOB B;  3RZO B;  1UEA B;  1EZ8 A;  2JA6 B;  1FYC A;  1OO9 B;  5M9O A;  2K33 A;  1HFG A;  4V0B A;  3NSW A;  2QDB A;  1LTB D;  2EDG A;  4X3K A;  5JPM C;  1RF2 D;  3VR5 A;  3KLR A;  1F2Y A;  2EY5 A;  2L1B A;  4XYO A;  2A5H A;  1Y69 U;  1SJE D;  1PRT C;  1EY5 A;  5DM7 3;  4FNF A;  1S5F D;  1CFM A;  4HR7 B;  1XYI A;  4A3K B;  2XVS A;  1AP0 A;  3HGB A;  2K05 A;  4RH6 A;  2NVT B;  1AW7 A;  2Z4H A;  1SYF A;  3A54 A;  4KD3 A;  3I8Z A;  2ZXR A;  1DOK A;  1EZ6 A;  2E2D C;  2XWB B;  3T16 A;  3LWU A;  5EQ0 A;  5ISR A;  2Y0S B;  4EVO A;  3HOZ B;  5M5Y B;  4TSS A;  4DAP A;  3FPP A;  1RJT A;  4FXD A;  5IGD A;  5I2X A;  3EFX D;  3MXP A;  3KK7 A;  4DA2 A;  2PW5 A;  3NQI A;  2B2W C;  1ICW A;  1EOT A;  1OXU A;  2A6E D;  5C4Z A;  2NWG A;  1TWH B;  1H9R A;  4U68 A;  4BA2 I;  1JC7 A;  1HHV A;  2RDG A;  2IT1 A;  3OW7 A;  4RCO A;  4KV6 A;  1SSO A;  5ELF A;  1BCP C;  2E2J B;  4PMB A;  3OWF A;  3J7Y W;  5KIX A;  3I90 A;  2AWN A;  4ZYS A;  2LY7 A;  1IKL A;  4G4K A;  3N52 A;  1TS3 A;  2TSS A;  4CHT B;  4QCL A;  4BY7 B;  5ELC A;  2D62 A;  2ENB A;  4BWG B;  3R2T A;  3DM1 A;  3MAQ A;  1BBX C;  4J6H A;  3TP7 A;  4TQU S;  2O5J C;  2KED A;  1BNZ A;  2A73 B;  4UAI A;  3EQL C;  3A8I E;  1STG A;  2H4O A;  5FO7 B;  3D6C A;  1ENF A;  3P75 A;  3T51 B;  2C9O A;  4G57 A;  4LJZ C;  1QG7 A;  1IW7 C;  2PQE A;  2CW0 D;  2X6G A;  2E74 C;  2F0G A;  4GZY C;  4HTH A;  3ITP A;  3DEP A;  4R9W A;  3VR2 A;  4UDU C;  1G2T A;  3OPO A;  1TWA B;  3R2I A;  2FJ2 A;  1SE4 A;  3DWA A;  3ZYY X;  1TQO A;  3PUW A;  3A7A B;  5D3D A;  5EJW A;  1WTO A;  3S1N B;  1I4G A;  4C3H B;  5D65 A;  1A15 A;  3RMH A;  2Z8L A;  3C1F A;  4OL7 A;  2L11 A;  3D8G A;  4A3M B;  1BF4 A;  4KKT A;  1R4Q B;  5A2Q L;  2EYF A;  2D5D A;  2ZXP A;  4ZUI A;  2L12 A;  4FVM A;  2L9H A;  1G91 A;  3E0J A;  3DUZ A;  1V1P B;  1PYW D;  1ESF A;  5KNC A;  3JAM L;  4JK1 C;  4BY1 B;  1EEF D;  1ENA A;  5I9O A;  2XRS D;  2IX0 A;  5JVH 3;  1Q8I A;  4FF3 A;  3M4O B;  3J80 L;  2NZ1 D;  5CBA E;  1PTO C;  3MTS A;  5DNF A;  2F0Q A;  2HQE A;  5K36 H;  5C6A A;  1TII D;  1DON A;  2KVM A;  2HCI A;  2G9H D;  1PRT B;  5T1I A;  1HTL D;  1STE A;  2EYH A;  1EL0 A;  5IGG A;  2RA4 A;  2R92 B;  4HAE A;  1ET9 A;  5I4D A;  2I07 B;  3BVM A;  1LTG D;  5CV5 A;  5C5L A;  4OIK A;  4IAL A;  1RKN A;  1EYD A;  1HCZ A;  3EVQ A;  1PDQ A;  5J1Z A;  1JE4 A;  3BS1 A;  2JEA I;  5DAU A;  5IGF A;  2ZXO A;  3QOL A;  5M3F B;  2OEO A;  5COR A;  2JXM B;  1PTO F;  5BN4 A;  2D9U A;  1H9K A;  3NPP A;  4KHZ A;  5EKL A;  4F87 A;  4HMJ A;  5E4W C;  1FNV A;  3FMC A;  1A2T A;  1V1P A;  2DY8 A;  2SNS A;  2L55 A;  1SMY C;  2R6G A;  2K5Q A;  5C3X A;  2RQX A;  4HED A;  2E2H B;  3MWY W;  3W2D A;  3HZX A;  3LNN A;  2F0E A;  4DNR B;  1K83 B;  1LTR D;  1LTI D;  1Q12 A;  1LTA D;  3T53 B;  1MBY A;  2Z4I A;  4CBV A;  5C3W A;  2IW3 A;  2A6H C;  2RKS A;  4A3B B;  5M5X B;  5G3L D;  3G6J B;  2VB3 X;  5CV9 A;  3FRP B;  2AUJ D;  3C3L A;  3GTM B;  3M7G A;  3GP7 A;  1JCK B;  5ELE A;  3PO3 B;  1LO5 D;  2KEE A;  1HPC A;  3M4Y A;  1IHZ A;  3MZ5 A;  1AZP A;  5CV8 A;  2L5T A;  5T1G A;  4G7Z C;  3OSO A;  2IX3 A;  2F0K A;  5KRU A;  4NW2 A;  3NE5 B;  1EQV A;  1F2Z A;  2VUM B;  5D3I B;  5J39 A;  1C4Q A;  3VA7 A;  3BVZ A;  5JEA J;  3S14 B;  2F3W A;  1B3A A;  2B2T A;  1D5M C;  5KGU A;  2B2W A;  1HXY D;  1UNS A;  2F0V A;  2FHT A;  1MSH A;  4RAU C;  4K2L A;  1KTK A;  4KMU C;  4K5W A;  4ME5 A;  3FKI B;  5D14 A;  1Z6H A;  1S5D D;  3IAY A;  3PV0 A;  1K8M A;  4KK7 A;  4G7O C;  1FGB D;  1S5B D;  1R9T B;  3TP5 A;  5JOB A;  2PYK A;  3TZU A;  2EYP A;  5EPL A;  1ZEQ X;  5DM6 3;  5C0X G;  1E2W A;  1ZYR C;  1F9Q A;  1LLR D;  1LAB A;  3OIP A;  5JJZ A;  1B50 A;  1BOS A;  3GTG B;  1D6E C;  1S5E D;  2WAC A;  1WTR A;  3KLS A;  1GJX A;  4K14 A;  2HUG A;  2KEC A;  1G29 1;  4ULL A;  4HSV A;  1QJO A;  1TR5 A;  1Z7T A;  1VMC A;  2OT2 A;  4PMW A;  4C3I G;  5KYI A;  1LTS D;  4DXG A;  1ENC A;  1OXX K;  4ZUJ A;  1LTT D;  1G8Z D;  2K1B A;  1DXM A;  1GUN A;  1TU2 B;  1KAB A;  3Q23 A;  4EQN A;  2PMZ B;  5CR3 A;  2JA7 B;  1B44 D;  3HS0 C;  3R8B A;  1KNA A;  4HSP A;  1HQM C;  1EU4 A;  1I6V C;  2DY7 A;  2XSC A;  3PUV A;  1A2U A;  4EQP A;  1XTC D;  4FYD A;  1W6J A;  5TSS A;  1TVX A;  1F9S A;  1LT6 D;  3NQT A;  3BZD B;  3NP8 A;  2MPM A;  1RCV D;  2BDO A;  3H0G B;  1ILQ A;  4OO1 G;  1GXD C;  4DN4 M;  3HEJ A;  2M9V A;  3CQZ B;  4OGQ C;  1VMP A;  4RKL A;  4P2C B;  2KHS A;  5EKK A;  3J7A F;  4TRD A;  1JOK A;  2JYO A;  2K5W A;  2K6A A;  4IQZ A;  3K5M A;  3GV3 A;  5IT9 L;  1UUP A;  4C1N I;  4K6D A;  3OIQ A;  2AQ1 B;  4ZK9 B;  3TP8 A;  4CGY B;  2N55 A;  2XNA C;  1NCV A;  5K36 G;  1HA6 A;  3Q22 A;  3FDT A;  1VDZ A;  5C0X J;  1TS2 A;  4ZLT F;  1WTP A;  1KLU D;  4A3G B;  1T5E A;  3DWP A;  4K5V A;  1YNN D;  4M8A A;  3CKI B;  4K5X A;  1X3Q A;  4K8I A;  3S17 B;  1OXV A;  5FO8 B;  2PCF B;  2WV6 D;  4PMC A;  1F2M A;  1F2L A;  2LKV A;  1TS5 A;  3ERO A;  1O78 A;  2QCP X;  3K5L A;  1QIL A;  3U9O A;  2F0D A;  2ID0 A;  2F3V A;  1M8A A;  1EY0 A;  4K8J A;  1B4O A;  1CA5 A;  4XQJ A;  1CZW A;  4A3D B;  2NN6 G;  1AFP A;  4MN3 A;  2QEJ C;  2K32 A;  1GUS A;  3SHL A;  3L3O C;  4RGO S;  2FIN B;  1D2B A;  3VR3 A;  2VXW A;  2G9D A;  5I6W A;  4ODG A;  1MI2 A;  3NWT A;  5EKI A;  1J8I A;  2B2Y A;  2DNE A;  2AWO A;  3V2T A;  1SNO A;  5FKA C;  1RTO A;  3R93 A;  3MXG A;  3Q0A A;  2A68 D;  2AUK A;  5E3F A;  1JWS D;  2L0C A;  1YNJ C;  2X6L A;  5I2Y A;  1O7L A;  3GD7 A;  5LHY 1;  4IFD G;  1PXU A;  4I7Z C;  3AMU A;  3PO2 B;  1EY6 A;  3EA6 A;  1JR0 D;  2M2L A;  1JWM D;  1SBB B;  4DK1 A;  4KN7 C;  3D4R A;  5C5M A;  1SE2 A;  2EJG C;  1X3P A;  5IGE A;  2O2L D;  3C46 A;  2B2U A;  2RDF A;  3NK9 A;  1MGS A;  1PRT D;  1KLG D;  3SK8 A;  4YIJ A;  3IFD A;  1S4Z A;  2A74 C;  2XWJ B;  1PFN A;  4H7B A;  5ELB A;  1STH A;  2SDF A;  5LL6 S;  4AYB B;  3TSS A;  1OXT A;  2RSN A;  5ELD A;  1ML0 D;  4RFB A;  4XTC S;  5CV6 A;  4IUQ A;  2RDH A;  2SNM A;  5COY A;  2ICE C;  2J7Z A;  2SOB A;  4WJW A;  1KNE A;  3OMC A;  1EYC A;  2EY6 A;  1U4L A;  4QUF A;  1V1O A;  2F1M A;  3OOC A;  4CKE A;  1EU3 A;  1O7Y A;  1JIC A;  1TY0 A;  4IUT A;  1W6K A;  1D5Z C;  3PUX A;  3D3R A;  3DMU A;  1SYC A;  1STN A;  5FLX L;  2K7V A;  1WVL A;  4F8M A;  2DN8 A;  1BCP D;  1EY9 A;  4HN7 A;  2JA5 B;  4A3I B;  1XX8 A;  2Q8R E;  3PUY A;  2QIL A;  2CVR A;  1DCZ A;  1WTW A;  2MJ8 A;  1L0X B;  3BYT B;  1MSG A;  4IUR A;  4FXK C;  4PV1 C;  4F88 A;  2EYO A;  4ZAI A;  4BBS B;  3S2D B;  1A3V A;  2EXZ A;  4WRD A;  4IFD J;  4FF1 A;  1VF5 C;  3SVM A;  5DEH A;  4DU9 A;  3NUC A;  4KJO A;  2HDM A;  3T13 A;  4C3J G;  4C2M B;  1A6X A;  2F0M A;  4OO1 I;  1TWF B;  4NKL A;  1IW7 D;  1VCI A;  2IWH A;  5A35 A;  1ILP A;  3A8K E;  2R7Z B;  3P1H A;  3E6Z X;  3QIA A;  1BDO A;  3WOE A;  5A2Q E;  1DM0 B;  3TBI B;  4KTA A;  1RD9 D;  3D4W A;  4ID6 A;  3I4M B;  3UI2 A;  1U4R A;  5K5P A;  4LK1 C;  2BE5 C;  1Q1B A;  3JAM E;  2KJX A;  1I4Q A;  2BCO A;  4FO2 A;  1STB A;  4ZKC B;  3J80 E;  3GTQ B;  1H9M A;  2F0O A;  3H91 A;  2EY2 A;  2B2V A;  3PUZ A;  5CV7 A;  3ONA B;  2OXP A;  4KKS A;  2RSO A;  3BYY B;  3M7N A;  3RLF A;  5EPJ A;  5AFW A;  3LWE A;  4LAA A;  3I3C A;  3GV6 A;  2K03 A;  4O42 A;  2V4D A;  1BCP B;  4WFN 3;  1JQY D;  1G2S A;  2TMP A;  2A69 C;  4KY7 A;  4BS9 A;  1PTO D;  2EE1 A;  5G3L F;  3MXU A;  1ZKO A;  3GTK B;  3MFG A;  4KY6 A;  1PLF A;  4RGN A;  2EY1 A;  2K01 A;  1ONL A;  4IUV A;  2K5D A;  2F0J A;  2WKC A;  3FVQ A;  3TN2 A;  3VYU A;  3HOW B;  4KHV A;  3H3V C;  2YU9 B;  1QE6 A;  3ERQ A;  1B9N A;  4C1N K;  4B08 A;  4QIW B;  2FFK B;  1EY4 A;  1JB3 A;  1C8C A;  3IKJ A;  4XYQ A;  3MHB A;  2F03 A;  5CBE E;  3SR1 A;  1PFM A;  4H13 C;  2IX1 A;  1ESR A;  3NTI A;  2FMC A;  3CRK C;  1D1K A;  2SEB D;  4FF2 A;  2O5I C;  2KCC A;  2PNR C;  4IFD I;  1SEB D;  2AQ2 B;  3H94 A;  1D1I A;  5JAV A;  1Y8O B;  4XT1 B;  1WD1 A;  1MD2 D;  2WIN B;  3GTL B;  2L4N A;  1QNK A;  1TT2 A;  2K28 A;  4CKB A;  2BDN A;  3PIO 3;  1SMY D;  4FF4 A;  3QOJ A;  3DEO A;  3OHX C;  2JA8 B;  4L8J A;  4DF7 A;  1F77 A;  1Q1E A;  2I46 A;  3W3A A;  1I4P A;  1E2V A;  1B9M A;  3MVV A;  1LAC A;  4ZKB B;  3SK5 A;  5M3M B;  2J4X A;  4KKU A;  3KBG A;  5CV4 A;  2F0I A;  2MUY A;  2A6H D;  2M00 A;  2PPB C;  2E75 C;  4V19 0;  5HGT A;  3CHB D;  4O1N A;  3D6W A;  1PTO H;  2BOS A;  1CQF A;  1II3 A;  3J81 L;  3VYT A;  2MGS A;  3S2H B;  3GQB A;  1HUN A;  3KUP A;  2MHV A;  1PTO B;  3E5S A;  4N9P A;  3S16 B;  3SDZ A;  3PMF A;  4XXE A;  1BO0 A;  3MFY A;  1HFN A;  4FP5 D;  2F0S A;  1GUO A;  2ICI A;  2F0H A;  3I72 A;  4DAV A;  2GA4 B;  4FXG C;  1FNU A;  1NR2 A;  2R61 A;  4C3H G;  5M5W B;  2JP1 A;  3H6M A;  4XIG S;  1CHQ D;  1XWE A;  4EQO A;  1RDP D;  3KBX A;  1QWY A;  2B8G A;  2EPB A;  2D2C C;  3QG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...