3DWAA

Crystal structure of the b-subunit of the ab5 toxin from e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
EWTGDARDGMFSGVVITQFHTGQIDNKPYFCIEGKQSAGSSISACSMKNSSVWGASFSTLYNQALYFYTTGQPVRIYYEPGVWTYPPFVKALTSNALVGLSTCTTSTECFGPDRKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Subtilase cytotoxin, subunit B
publication title Incorporation of a non-human glycan mediates human susceptibility to a bacterial toxin
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 118
sequence length 118
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dwaA00
5FK9C 1D5XC 1PTOD 1D5MC 1KTKA 1SE4A 1CT1D 1I4RA 1HXYD 1PTOF 1LT3D 1FNWA 1V1PA 1SJHD 2IPKD 1B44D 1BXTA 1LT6D 5ELCA 5TSSA 4DXGA 2XRSD 1PZJD 1PRTD 1SEBD 4Z9CB 1SJED 4ZYSA 1PRTF 1EU3A 1HTLD 3EA6A 1LTGD 1PTOC 4OHJA 3V05A 1RD9D 3BVZA 1SBBB 2SEBD 2RDGA 1JWSD 1EWCA 4BWGB 1ESFA 3TSSA 1CHPD 1F77A 1RCVD 1EFID 1V1PB 4RHRA 1LTID 1PTOH 1PRTC 1FGBD 1RDPD 2NTSA 1CQVA 3GP7A 1ENFA 1DJRD 3URYA 1LTBD 1GOZA 1I4GA 3OWEB 5FKAC 1I4QA 2XNAC 1AN8A 3CHBD 3DWAA 1DYQA 1BCPC 1KLGD 3EFXD 1JWUD 4RHSA 4RFBA 2WV6D 3BYTB 3DWQA 4C56C 3O13A 1UNSA 5ELDA 1TY2A 1S5FD 1I4XA 1LT4D 3BZDB 1EEFD 3R2IA 5ELEA 1BCPD 3DWPA 1KLUD 1BCPF 3SEBA 1T5XD 4RH6A 3BYYB 1CK1A 2ICIA 1STEA 1JQYD 3R8BA 1V1OA 1B1ZA 1FNUA 1LLRD 1HA5A 1PTOB 1JR0D 2TSSA 2AQ1B 4RGTA 1MD2D 1TY0A 4RCOA 2QILA 1L0XB 1XXGA 1JWMD 2RDHA 1TS5A 1EU4A 2XRQD 1G8ZD 4RGNA 2R61A 1S5DD 1S5ED 1PZKD 1CHQD 1RF2D 1M4VA 4L6TB 1PRTB 4TSSA 2AQ2B 1LO5D 1LTSD 1AW7A 2CHBD 1LTTD 3R2TA 1L0YB 1S5CD 1S5BD 1LTAD 1BCPB 1FNVA 1SXTA 2O2LD 3W2DA 4DXFA 1PYWD 3BVGA 5ELBA 2AQ3B 4L63B 1TS4A 3KLSX 4UDUC 2XN9C 1I4HA 1ET9A 1D6EC 1XTCD 1LTRD 2Z8LA 1SE2A 5ELFA 2IJ0A 4RGOS 1FD7D 1SE3A 1TS3A 4O1NA 3BVMA 1I4PA 1QILA 3MC0B 1UUPA 4RGMA 5D3DA 3MFGA 1EEID 2NTTA 2QEJC 1TS2A 1LT5D 2G9HD 4K6LA 5I4DA 2J4XA 1HQRD 1ET6A 1D5ZC 1PZID 1JCKB 5D3IB
chains in the Genus database with same CATH superfamily
4G4KA 3SK4A 1SE4A 4RAUC 1HNXQ 1GJXA 4TQUS 4CKEA 3PIP3 1PV4A 1YBYA 1LT3D 3UDXA 1FNWA 3X3MA 2CQOA 3U58A 1EZ6A 4A3IG 1I50H 3I3CA 3PV0A 2B2WA 2KCTA 4C3JB 3JAML 3EA6A 5EKLA 1JC7A 3BVZA 2OQ0A 1B8AA 1A0IA 2EY5A 3V2TA 5IGDA 1WI5A 2R92H 1J9OA 1HUMA 4LUZA 2F0KA 1VF7A 2M9VA 5FKAC 1KRSA 1JWUD 5J1ZA 3HOYG 4DV1L 3KDFA 3PO3G 2KHJA 3H3VC 3GO5A 1P16A 4KD3A 1VQMA 4LF9Q 1IXRA 1S5FD 2JA7B 1NJIC 1PXUA 4HAEA 2O4XA 4CDEC 4X6AH 4KJNA 2ZXPA 4UP9A 3A7LA 2LKVA 4YCVA 1Y14B 2EQSA 1CK1A 2DUDA 1JJCB 1C9OA 4UP8A 3PQIA 5IYBH 1LLRD 3HOZH 4IFDG 2EYLA 2DY8A 4YHHL 4AIMA 1L0XB 5JVG3 4BBRB 4IN3A 4XQJA 3S14H 1Y1VH 2ZJRA 1J8IA 5E4XA 1LTSD 5D14A 1NMGA 4HIDA 2FJ2A 4LFAQ 3NPPA 1UE1A 1LACA 3GTKH 4ME3A 3NTIA 5KNCA 5EGTA 2AQ3B 4DNRB 1G2TA 5IIFA 4DR7Q 2XN9C 4QL5A 2FINB 2UXDQ 1SYFA 2R7ZG 4B3MQ 3AU7A 1TT2A 4EQOA 4DUZQ 2PI2E 4HTHA 4ZKBB 4BY1H 1CTMA 1EL0A 3NXWA 1RKNA 3K0XA 4B3SQ 2NTTA 1CFMA 1VQ4A 5I4DA 3PIPA 2IL8A 3B6YA 3H6MA 3I4MG 2F03A 1IBLQ 1GXDC 4JVZA 1PTOD 3IFDA 3AEVA 4HN7A 5C3EH 1QWYA 1VQ5A 3P75A 5I9OA 1WTOA 3K5OA 1F2MA 1JT8A 1Q8IA 1RIPA 4XT3B 3ND9A 1JORA 1UWVA 2JA9A 2R93H 5KGUA 2I5MX 1SJED 5DNFA 2NVXB 3PUXA 3VYRA 3QWNA 2QF7A 3QJYA 1R4PB 1F2YA 5BN3A 3KLWA 3T53B 5C4XB 3D8GA 1WOCA 1KXLA 1JWSD 5C0XI 4IO9A 2I0QA 3OW7A 1SYDA 1SFOB 2O5IC 4EQ5A 4JI1L 4A93B 3T51B 2ZM6L 5CR3A 3MXNB 5ELOA 3BS1A 5JJLA 2XTIA 2SOBA 2X6LA 4A3KH 4BBSG 5M3FH 2E2JH 3DWQA 1TQOA 2DN8A 4DKAC 3UE1A 2WINB 5BN4A 1Q82C 4X3SA 2J7ZA 2MQHA 2E2HB 2JP1A 1EIHA 3PGZA 3J80E 2BOSA 3DWPA 4DV7Q 1IKLA 3SEBA 3D31A 5FJ8G 2KHIA 2ICIA 1FL0A 3L9AX 3EJIA 3J81E 3J81j 4DV2L 3R8BA 1STBA 1XMOQ 2I07B 5AJ3Q 4LF5Q 3SK5A 2FFKB 2EYHA 4CKCA 1BO0A 1TS5A 1EU4A 1KAAA 1IKMA 1VMCA 4DV4Q 3H0GG 1X3PA 1H9MA 1VQPA 1HFGA 1QZHA 5J39A 4BA2I 3NP8A 1KQSA 4JOIC 1FVIA 3DLLA 2F0TA 4KTAA 1BBUA 1HTPA 4DV3L 3GTGB 1EIGA 1E0BA 2KJXA 2NVQB 1XPOA 3MHBA 1Y1WB 3CC7A 3K7AH 4WRDA 1RL2A 3VR2A 5KIXA 4OL7A 5IE8A 2B2WC 3DM1A 4LWCA 1E24A 1CKOA 2B63H 1DOLA 4DV5Q 4JV5L 3A56A 4CKBA 1AZQA 4R8IA 2ZTCA 1JCKB 4XTCS 4GKKQ 2JA7G 4PZ7A 1WJJA 1QVFA 1EY8A 1EOTA 4NB3A 1NUCA 3OMGA 3K0YA 1R9TB 2ZXOA 3A7AB 4DV6Q 3TP5A 1HTLD 1HR0W 3OIQA 4A76A 1JOQA 1L2FA 5M5XH 4LF9L 2QEXA 5BR8Q 1ESFA 1CHPD 3J80c 4KD4A 4RCNA 1VQIA 3CQZB 3NENA 2YU9H 1FR3A 1CQVA 1WYDA 3E6ZX 3MAQA 4OO1I 1AN8A 3HFZB 4AYBB 4DAVA 3CAMA 2NN6I 3SGIA 1L1OB 4KHPQ 1JB3A 4DR5Q 1KL9A 1CSQA 3M4OH 3HOXB 5GAEC 1EOVA 4B9XA 1YHBA 2XIWA 1T5XD 3OYYA 4EGVA 4OELB 1HQMC 5CBEE 4KKUA 4LFAL 1HNWQ 5COYA 1PTOB 2RHQB 3N52A 4Q5VA 2AQ1B 2E76C 5AFWA 1G6PA 5DEHA 1KC8C 1QUQA 2KHSA 3RN2A 2NVYH 4NXNL 4B3ML 3RLOA 1N34Q 4JBKA 2VS1A 3FDTA 3F2CA 4DUZL 3KFUA 2NBFA 2V4DA 4JI4Q 4DR4Q 3K59A 5FO9B 1A3VA 4B3SL 4APVA 1SR3A 2FMMA 2VUMH 2K01A 1ILQA 4MIUA 4RKLA 1JB7A 1KRTA 3KDFB 3M4YA 5C4XG 3FEWX 4NDXA 1IBLL 4X64Q 1GVPA 2K4KA 1G6ZA 3N6RA 2UXCQ 2KCMA 2OXPA 3SHLA 5M3MG 2QDBA 4L5QA 3CRKC 3TREA 4LF8Q 4X3TA 3VR3A 2E5LQ 1TS2A 5ELNA 2J4XA 2VQFQ 1ET6A 4A3JB 4YWMA 1XNRQ 2OTLA 2BE5D 3A5UA 5C4JB 2PQEA 1E3PA 4U673 4HJAA 5EPLA 3F8TA 2B3GA 2MP1A 3J7A5 5C6AA 2GA4B 4KI0A 5JJKA 1I6HB 5E7NA 1PZJD 4JG2A 2SNMA 4Z9CB 1YITA 2M2LA 3TBIB 1QVGA 3RZDH 1TXYA 3KF8B 2EIFA 3PUYA 4WJ4A 1TWFH 2BDOA 1A3TA 4A3IH 4R4CA 4HIOA 1LTLA 3OMCA 2NVTB 2VXWA 1W6JA 4ZAIA 3EIVA 4DV7L 1J6QA 4KHZA 4A75A 4FF1A 1ML0D 1WD0A 4QUCA 2JYOA 2WAQB 3OWEB 4X66Q 2JQOA 3IL8A 3DWAA 1EQQA 2PI2A 1PDQA 1SYEA 4RHSA 1XMOL 1YJWA 5AJ3L 3CF5A 4LF5L 3TS2A 1K83H 3L7ZC 3T4AC 2X69A 1TY2A 3DHQA 1TWGB 4O2DA 4IPCA 2IW3A 1Y1WG 2N88A 3WWVA 3CC4A 3PO3H 1GHKA 4I65A 1BCPF 3A8JE 4HR7B 4DAYA 1Q86C 4FYDA 1I3QH 2XSCA 1BF4A 1CZGA 3R93A 3CCEA 5IOCA 1C4QA 2FHTA 3QOLA 4RCOA 3C3LA 1XXGA 5EKKA 3F1ZA 1S5ED 5JPMC 1XYIA 1STHA 1ZEQX 1M4VA 2K5QA 2A5HA 4IFDH 1VQ6A 1B3QA 2AQ2B 2B29A 5IGFA 1YHAA 4DV5L 5CC4A 3S15H 3ERQA 4K8JA 1PYWD 3BVGA 5G3LF 1S72A 3I70A 2B2YA 4H0LC 3NHHA 4HIKA 3NWSA 4GKKL 4GKJL 3PCOB 4C3HB 1A3UA 1FD7D 5IYDH 4OIJA 3CC2A 2BE5C 4FXGC 4OXPA 4TRDA 3D6CA 3T1HQ 2JE6I 2KA7A 3EROA 2NB0A 1STYA 1BUVT 1HUNA 5HGQA 4DV6L 1HA6A 4AYBG 1VDZA 5D65A 5D3DA 5C4ZA 2R7ZH 1Z9FA 1LT5D 2AMCB 1V8QA 1E2VA 1PH5A 1EQRA 1AE2A 4FVMA 1BDOA 2E2IB 1B4OA 5KYIA 4KV6A 1O78A 2CQAA 3R3OA 4X3KA 3HOXG 1N8RC 1YNXA 2EXZA 4DR1Q 2F0DA 5C0XG 1U4RA 4KLKA 1X9NA 3I4MH 1ILPA 2RQXA 1AFPA 1PRTD 4JI8Q 4GS3A 4I7ZC 3DEPA 2Z6KC 5T1GA 1E2ZA 2KQ3A 3UDIA 4KHPL 1E2WA 4G57A 1V43A 4DR5L 3TRZA 4K5WA 1RJTA 1E1OA 2KVMA 3CMEA 2HQLA 3M7GA 2FMCA 3D0FA 2OT2A 1XNQQ 3KBXA 2XNAC 4ZLTF 4A3CG 1HNWL 5IGCA 3J81i 4IUTA 2Z6BA 5IP9G 4DFAA 1I4XA 2OCEA 1FYCA 1SRUA 3VA7A 1BBWA 1N34L 1VS0A 3S2HH 1GUTA 1MSHA 4BBSH 4C3IB 1C7YA 1KIXA 4DR4L 5A2QE 2CH4W 1F9PA 3M3YH 4A3JG 5IY0A 2ATWA 4BXXG 2NUCA 5FJ8H 1KDAA 1JWMD 3MEHA 2LS01 4OGQC 1I94Q 1EWIA 3U50C 2R61A 2NYZD 5M5WH 2RBMA 1H95A 2C9OA 1YVCA 2UXCL 3S1QH 3S1RB 1NMFA 1A15A 1GUSA 3ERSX 3VR4A 1IL2A 1KNAA 3H0GH 3W2DA 2VQFL 3I73A 5EAYA 1Y8OB 1GO3E 1XNRL 1TWCB 2WACA 3A8KE 2K33A 2VW9A 1ESRA 1TWHB 1N9WA 2YTXA 2GVAA 3P1HA 1WVLA 2BA1A 2WAQG 1K0SA 1CM9A 1XTDA 3TN2A 3OTOQ 2ES2A 1STGA 2F0HA 2IX3A 2UXBQ 4UAIA 3GTJB 3GV3A 3FPUB 1I4RA 3OPOA 3G48A 4R1JA 4HSVA 3K8AA 2JA7H 3KUPA 1PH6A 1WTVA 1SYBA 3IFTA 2A74C 2CW0D 2CFMA 1IBKQ 3J81L 3ITPA 3NE5B 3V05A 3KLSA 1DGSA 4N9PA 1SMXA 4OO1G 4UHVA 4UY8C 1VQ9A 4DUYQ 2N8NA 2NN6G 3FKIB 2LMCB 5KNDA 2NTSA 2F3WA 1I4GA 4JI2Q 1E1TA 3I8ZA 4K0KL 3ONAB 5IYCG 1SNMA 4IURA 1DM0B 1EQTA 4N8X1 3I91A 3BDLA 3NQIA 1VQCA 4K2KA 2D62A 1M1KC 5EQ0A 5LMNQ 4ALPA 4C3HG 4IUQA 2IWHA 4NPSA 4J1MA 4R9WA 2EXDA 2L11A 5GADC 1PFSA 3FVQA 3SDZA 4GNXA 1M90C 4X62Q 4B3TQ 3WDNA 4IUNA 3GTPB 2B2YC 1FNUA 3C1FA 3W1GA 1VQFA 2K03A 4ULLA 3M9BA 1VQ8A 2JK8A 2XGTA 4RA8A 5DLQE 5M9OA 4IUUA 2IX0A 4LF7Q 2Z9HA 4R4OA 1PLFA 1PRTB 3T1HL 1B50A 3OOCA 2DGYA 1U0LA 1D8LA 3K58A 3W5OA 2HHHL 2PW7A 3J7AF 3H3VH 1BCPB 4KY5A 4A3GB 2Q2IA 4MHEA 2VB3X 1T9HA 4R4IA 1Q1BA 3ULJA 4DR3Q 5CMDA 2Q8TA 2NVXH 4CDFC 1D1KA 1SE2A 1ZYRC 1V1QA 2IJ0A 1Q3LA 4J15A 2YV5A 3STBD 3LX0A 1PHJA 3VDYA 2QCPX 1G91A 1SE8A 3A54A 1U4LA 5C4XH 1NR2A 4KN7C 4FO2A 3FMCA 4DAYB 2G5DA 3KF8A 3T56B 3P20A 1PZID 2MNAA 1IW7D 5M3MH 2CW0C 4PMWA 4C1NI 2RVLA 4CDDC 3WOEA 2EJGC 3KBGA 1K8MA 4DXGA 4C3IG 4CBVA 1IHZA 2XRSD 1XNQL 1KDBA 2IHFA 3EN2A 4A3BB 2E2HH 1O7LA 2F1MA 3FP9A 3CXCA 4F87A 1SNOA 3E5SA 2ZTEA 2L15A 1DD2A 3RZOB 4RMFA 4DR6Q 1JJ2A 4LNQA 4IPGA 4RHRA 1N33Q 1JOKA 3GP7A 3HKZB 2K5WA 1HH2P 3CCQA 3URYA 1I4QA 5E3FA 2B2VC 3BG3A 3BYTB 2D0OA 2EOTA 3GTMB 1AH9A 1I94L 4NP5A 2AUJD 3HGBA 4AQYQ 2L9HA 1K3RA 1A63A 1KLUD 3C1EA 3GTGH 2NVQH 1MJCA 2N55A 5FLXc 1R4QB 1Y1WH 2UUCL 4JYAL 2HT1A 2E2DC 3DXJC 5I9PA 4K2LA 2DJFC 3LGJA 3J7ZC 3GTQB 3W3AA 3HKSA 1AEXA 2AHOB 1J5EL 3QG1A 3HKZE 3S9WA 2A6HD 3EBEA 3I4NB 5DM73 1Y1VB 3E0EA 4H02A 2R3ZA 1QZGA 3PUZA 3X3NA 3JC66 2EYJA 1XJVA 4PMCA 3OTOL 1Y69U 2WB1E 4R8NA 1R9TH 4M1UB 2UXBL 4L63B 1I6VC 4K14A 4A4IA 4B3RQ 1ET9A 2A69D 5DAUA 3FKIG 2F0LA 2ZJPA 1IW7C 4DK1A 1K9MC 1CQFA 5C5MA 4IFDJ 1F9SA 1O80A 4AH6A 5E1FA 1HZ9A 1PH7A 1O7IA 1IBKL 2LY7A 3CQZH 1WTPA 2D5DA 2MO1A 1EQVA 1RHPA 2UUBQ 2HCIA 2A73B 4KHVA 1L1OC 2CKZB 4C3JG 2K5DA 4MN3A 4DUYL 4DU9A 2EY1A 4F8MA 2C35B 2GN5A 4JI5L 1VQNA 4UPAA 4XIGS 1EY0A 1IBMQ 3TDQA 2MFIA 3RD4A 1PH4A 1HNXL 3GD7A 4JI2L 1TR5A 3S24A 1VCIA 1SEBD 2F4VQ 4A3MH 1PTOC 3ND8A 3HOXH 1DZ1A 1K8GA 4PZ8A 5C0XH 1YI2A 3G7LA 5LMNL 2L5TA 1ASYA 5ISRA 5JJIA 2HD3A 5GAGC 1PTOH 1RDPD 3Q6SA 4C2MH 3E0JA 3QO2A 4ODGA 1GOZA 4B3TL 2Y0SE 4A3GG 2X6GA 3K80C 2UUAQ 4A3DB 1B70B 3F2BA 4V0BA 4LF7L 4A3KB 1MGSA 1TWAB 1VQGA 3HOWB 4A3CH 4QB4A 3HOUB 4R4TA 1IZ6A 4BBRG 4LUOA 1MHWC 1LYLA 5IT9c 1GUNA 5IP9H 1UE6A 3TP7A 1WCMB 2Q8IB 3Q22A 2CWPA 5I6WA 2A6HC 4LF4Q 2JJQA 3MWYW 2RCNA 3LNNA 2MGSA 1ASZA 4DR3L 3D4RA 2H4OA 1WTWA 1NCVA 3SE0A 4DNIA 4PMBA 4KY7A 3NQTA 4TSSA 1Z47A 4A3JH 1PH2A 2PMZE 2A69C 3KF6A 5C4HA 4BXXH 3MXUA 1EUJA 2CVRA 2PZUA 3E3XA 5C4JH 3Q24A 4A3BG 3OWFA 5C5LA 2EVBA 1QVCA 2VL6A 2O2LD 2R7DA 2K5VA 1I6HH 2H5XA 4KJOA 1X54A 4Y7NH 1VQJA 1EY5A 1Y8PB 3HKZG 5I2YA 4DR7L 1QOHA 3RR5A 2K32A 4IPDA 2F0EA 3A74A 3J7AV 2Z4IA 4IJHA 2UXDL 3V96A 3K7AB 3A0JA 2RSNA 3SVMA 1PVOA 2EY6A 1WFQA 1EEID 4GNXB 1EY4A 2YTVA 2B63B 1HQRD 1UE7A 4QCLA 1KTKA 1PFMA 2ZTDA 3JAMc 1HXYD 1WTXA 1OXVA 1N33L 3CKIB 1II3A 1A8VA 1D7QA 1CZWA 1TWGH 5IP7G 4A93G 5A2QL 1W6KA 1OXUA 1MIUA 4OHJA 4H13C 3S17B 5K36G 2SEBD 3VR6A 3PIO3 4LK1C 3TSSA 1B9MA 2QKIC 2UU9Q 4AQYL 2K5NA 3I4NG 4OO1H 1A6XA 2OWOA 3GDEA 1F9RA 2YU9B 2OTJA 3K5LA 2NN6H 3AFPA 2F0MA 3A5ZB 3VYSA 2WV6D 4YIJA 3NBHB 1DONA 3KJPA 5ELDA 3FPPA 4JI3Q 4IALA 5IYCH 2PQAA 4A3EB 3K5MA 4GZYC 2AWNA 4TVAB 3U9SA 5DM63 5M5YH 2I5HA 4C3HH 2JA8B 4ZK9B 1SN8A 4MTNA 2YYZA 5KNBA 4LFCQ 2AWOA 3L2PA 1MD2D 2EPBA 3DMUA 1CI3M 4B3RL 4RGNA 5EJWA 1G291 1S5DD 5JJZA 1FGUA 1S40A 2NVYB 2PO4A 5EPKA 3PF5A 1LV9A 1C48A 1MJEA 1AW7A 4DV4L 2E2IH 1PFNA 3HOYH 2K04A 1S5CD 1VQHA 3EQLC 1YNJD 5CV7A 3I2ZA 2UUBL 4NXMQ 1Q12A 1DXMA 3MXPA 1XTCD 1LTRD 1I5FA 3IKJA 2NZOA 3OW2A 2F0OA 1D2BA 4LUVA 2IT1A 1LUZA 4POGA 3ZYYX 4J8QA 4LMQD 4OWWB 1OXXK 1IBML 4DR2Q 3GTOH 1QILA 3DUZA 2F4VL 4BY7B 1VQLA 2K75A 4YWLA 4A3DG 2EJMA 3TP6A 2A8VA 5CV6A 1HNZQ 3NUCA 3TEHB 3HOWG 1O7ZA 3HOUG 1QNKA 1BXTA 1U9RA 3L0OA 5JAVA 2K28A 1ENCA 1WCMG 1E22A 3PIOA 3CCLA 3BDOA 3CCJA 4YCWA 3I56A 4C3IH 3RZDB 2RDGA 2D9UA 1IYVA 3KJOA 1K28A 1EFID 2ALYB 4BA1I 5JOBA 4G7HC 4EQNA 4JW0A 3I90A 5BR8L 5CBAE 3GTLB 3AYHB 3NTHA 3RNUA 2L1BA 4ILWA 1GKHA 1ICFB 4J6HA 4LF4L 1DYQA 3HOVB 1NTGA 5EBCA 2JA5B 3S1RH 2EE1A 5A35A 3M4PA 2RA4A 2CWAA 1U4PA 2ZJQA 3O13A 1ZXTA 2WKCA 3BZDB 3NSWA 2HQEA 1BCPD 2ENBA 1SROA 2VZAA 1BVSA 2HCCA 3PO3B 1TWHH 1JQYD 2WKDA 4LAAA 2QW7A 1B1ZA 1PYBA 3J80i 2TSSA 3VYTA 4H7BA 3M7NA 2LXKA 1UEBA 1YNJC 2A6ED 3I4OA 3MFYA 4L6TB 4JI7Q 3NEMA 4ZUIA 5I2XA 2F0QA 2Q8RE 1UAPA 2BH2A 1BQQT 4CGYB 2PCFB 3M85A 1LTAD 1FNVA 5G3LD 4RKBA 2MO0A 1SYCA 1VQBA 2OQKA 3G71A 4JI4L 2EZVA 5ELBA 4V190 3PMFA 3CP0A 3G6JB 1TS4A 2D0PA 4FF3A 2Z8LA 3K6OA 3D3RA 1BR9A 2HUGA 3AB9A 2N78A 4LW1A 2Z1CA 4X64L 1HPCA 3FRPB 2G9DA 3A8IE 3S16B 2E8GA 3FKIH 1D1IA 2PPBC 3S1MB 4MZ9A 2JEAI 1KAWA 2QEJC 3H09A 5CV9A 1YHQA 1CKNA 3MXGA 3BZKA 5BN5A 2PZTA 4LF8L 4G7OC 1D5ZC 2L4NA 2E5LL 3S2DB 1D5MC 3I72A 3QIAA 4A3EG 5HURA 1RTOA 1NY4A 1JJGA 3C46A 3IRBA 2NWGA 1SJHD 1A62A 5TSSA 4PV1C 4C3JH 2BCOA 2L0CA 2JA8G 3KF6B 1GUOA 2RSOA 2F0WA 4QMGA 3RN5A 4N9TA 1RD9D 2RF4A 3UE0A 3U4VA 3TP8A 3P7JA 4JI3L 2A68D 2KCCA 2F0NA 3GTPH 1V1PB 1PRTC 2DNEA 1AZPA 1N36Q 5C3WA 5C44B 1DJRD 2HIXA 4NKLA 1HCZA 3AFQA 1H9KA 2RDFA 4DNTB 4XXEA 1BCPC 3J80L 1P8LA 4LFCL 1G2SA 4RFBA 4GOPA 4X66L 1HZAA 1XMQQ 2J0TD 4C56C 5C0XJ 3BZCA 4A3GH 4A3FB 1TU2B 4IPHA 3U4ZA 2MUYA 1IL8A 2A6EC 4RH6A 3BYYB 3CRLC 4BY7G 1S4ZA 4XQNA 4HMJA 1JOOA 1NNXA 1QCBD 4BBRH 3G6EA 4NXML 5GAHC 1X3GA 2QILA 5L37A 3K5NA 1G51A 3SK8A 1SLJA 4ZCKA 1Z6HA 2L55A 2MJ8A 4DA2A 4DR2L 1X3FA 4K6DA 3CW2C 1HHVA 4DV3Q 4DAPA 4OWTB 4JC0A 1GHJA 1OXSC 4G7ZC 4IOCA 2JA6B 1C8CA 1X32A 3H0GB 2OF1A 1HNZL 4CJ2C 3HS0C 4A3BH 5ELFA 5E4WC 2ASBA 1SNQA 3MA2B 1TS3A 1DCZA 2PQAB 3CCVA 3RZOH 4JV5Q 5JEAG 1VQKA 3MC0B 4FNFA 4L8JA 3HOVG 1TVXA 2JA5G 1TIID 1U5KA 4DF7A 4HJ7A 4FDBA 1IYUA 5FLXE 3ULPA 1PYSB 3IAYA 2I5LX 1PTOF 3S1NB 4QIWE 3TZUA 1LT6D 3PO2B 3GTMH 2XWBB 2A68C 1DOKA 2BA0A 4IJLA 4YCUA 1VMPA 1K0RA 2PW5A 4B08A 4ZYSA 2LFNA 1EZ8A 4CDCC 4DR1L 1B9NA 1T5EA 1UE5A 1SBBB 4P73A 2N3SA 4JI8L 4PZ6A 1SFOH 3NBHA 4BWGB 5IP7H 4A93H 3G4SA 5LMUQ 1F77A 4GLXA 3T13A 2ZXRA 1FGBD 5FLMG 2B2UA 4LJZC 5K36H 1HJPA 3GTQH 2A19A 2KEEA 3NELA 3CHBD 1X6OA 2MPMA 4GN5A 3CCRA 2Q2UA 3NWTA 4RG1A 3I4NH 4POFA 5IWAQ 4QJFA 4K8IA 1PH1A 4JPBW 1HFNA 1I50B 1LT4D 1QE6A 3KLRA 4QF4A 3KK7A 3M4QA 5ELEA 4JI7L 1GM5A 1PMRA 2F0SA 5CV4A 1A2TA 2PYKA 5IYDG 4WORA 2VQEQ 1BBXC 4LFBQ 1B2TA 1YJNA 3MVVA 1KABA 4XYQA 2R92B 2PNRC 4NXNQ 4PQXA 4R4QA 1HR0Q 3HP3A 1G8ZD 5LL6S 2WB1B 1CHQD 1XWEA 3H91A 2DJGC 4ID6A 2SNSA 1MSGA 1X3QA 4PNYA 4DV0Q 3DM3A 4I7AA 4NMZA 3UDGA 1F2ZA 5KEEA 3HEJA 4K5XA 3VA5A 4MNOA 2KUMA 2H1EA 4O0AA 3WOFA 1MKHA 2BH8A 3CPFA 3PSIA 5K5PA 1EY9A 4OEMB 5C44G 3HOZB 2K05A 2QA4A 1CA5A 3BVMA 4GN4B 1BNZA 4RGMA 3CPWA 4X3UA 3MFGA 5JEAJ 4DGZA 2K5HA 3S14B 2G9HD 5JPNC 2VNUD 5LMNW 2B39A 5IT9E 1NSNS 4OX9Q 3STBC 4FXKC 4KMUC 1EY7A 2YTYA 4A3FG 5CV8A 2Z4HA 2DY7A 3L3OC 5M3MB 3AMUA 4L5RC 2R6GA 4A3DH 1N36L 4H44C 2IPKD 1B44D 5ELCA 3GTKB 1PH9A 1HRJA 2F0VA 1TWAH 3HOWH 3VYUA 4HEDA 4GOPC 3HOUH 2F3IA 4ABNA 1ONLA 2I46A 4XT1B 1XMQL 1K3BC 3E9IA 4HJ5A 4HCSA 1WCMH 4IQZA 2EYOA 2Y0SB 4BY1B 1JE4A 3H94A 1EYCA 1RCVD 3ER0A 3ZJYC 4A3LG 5KRUA 4DK3C 2N49A 3T1YQ 1VQAA 1K73C 2ICEC 3CU7A 3OHXC 1VQ7A 3TZDA 3RLFA 5C3EB 5C3XA 4ZQ3A 2ID0A 2JA6G 1XX8A 1H9SA 1CKNB 2VB2X 1UNSA 4IUPA 1PH3A 2R93B 4YY3Q 3HG9A 3FHWA 2CCZA 1NAPA 4P71A 4XYOA 1OXTA 5EPJA 1STEA 1MI2A 1YZ6A 2RHSB 3JAME 4NW2A 4GNXC 1A2UA 1HA5A 2AKWB 1JICA 2PMZB 4X62L 4X65Q 1XPRA 1SAPA 1KDCA 3W1BA 2KOLA 1RF2D 4JK1C 3PO2G 1X65A 5M3FB 2E2JB 2CHBD 3H15A 1OTCA 1JMCA 3I55A 4IZ8A 1LABA 3BDCA 4JBMA 4CHTB 1HZBA 4HJ9A 4JBWA 4GKJQ 4KKTA 1RTNA 5FO7B 4DK0A 1FJGQ 4GLVB 1I4HA 4GOPB 4ZRZA 2EYPA 3S17H 1O7YA 1RODA 2K14A 1PFBA 5IGEA 3VR5A 3RLNA 2F0JA 1I4PA 3TQYA 3E9HA 4F88A 3Q23A 1QJOA 4K6LA 1L0WA 1YNND 3LWEA 4EX5A 1NBWA 5FK9C 2M00A 3CCUA 4HJ8A 5LL6X 5LMUL 1CT1D 2B2UC 3J81c 1QNUA 1VQOA 1V1PA 2JN4A 1SMYD 1STAA 5GQOA 2F0GA 3U9OA 1H9RA 2Z6KA 1X56A 1K8OA 4KN4C 4A3EH 2R92G 1LTGD 2KENA 3PUWA 5IODA 4DN4M 1V9PA 1KD1C 5IWAL 3F2DA 2NVTH 4A3MB 2P5ZX 4O42A 4JI6Q 2WB1G 1EWCA 2JA8H 4P2CB 1EY6A 2XVSA 2QDLA 1ENAA 1LTID 4DR6L 4Y52H 4HCEA 3KYHC 4N8FA 1EIFA 2KBNA 1WD1A 3J7YW 1LTBD 3K81C 2VQEL 4LFBL 5HY6A 4C2MB 1KLGD 1CSPA 2DNCA 3K7UC 2PNHA 2R7FA 1H9JA 3RUZA 3I7FA 1HR0L 1KNEA 1X3EA 5FOBB 1PH8A 5IYBG 4AYBE 3HOZG 4TKOB 2E75C 1KHIA 5M5XB 4DV0L 4MTKA 1ZKOA 2B8GA 4FXDA 1F2LA 3BU2A 1QB5D 2EDGA 1Y1VG 1EYAA 1QG7A 1V1OA 2B8FA 4EVOA 1JR0D 3EVQA 4CJ0B 2IY5B 4BY7H 1JE5A 3PUVA 2IX1A 1SNPA 1MBYA 4CJ1B 4XDXA 2LSSA 1Y8NB 5T1IA 1LO5D 4WFN3 4JI0Q 1GUWA 4IFDI 1YJ9A 1S5BD 4HSPA 5IGGA 3M4OB 2OEOA 3CD6A 2K7VA 4OONA 2WIIB 1B7YB 1LM0A 3SK6A 2SDFA 4OX9L 1N32Q 2Y0SG 4BY1G 1EWHA 1EYDA 4ME5A 2NZ1D 3C2PA 1YNNC 2F0UA 1SE3A 4M8AA 3ICEA 4Y7NB 2HDMA 4ZKCB 1UUPA 4IOAA 3HZXA 4HIMA 4S3SA 5C3EG 1SMYC 1HZCA 3KOJA 3GTLH 4HMIA 2WFWA 5JEAH 3SXHA 1XPUA 1Q46A 1D5XC 2R93G 4LF6Q 1SDFA 2GVBA 3HOVH 2JA5H 2VUMB 4ZUJA 3T1YL 2RKSA 4B9WA 1PRTF 1EU3A 1Q90A 4EQPA 4GLAC 2B2TA 4QQBX 1BOSA 1YIJA 5IGBA 2BDNA 4Q0FA 3BJUA 4QGUA 2F4IA 4YY3L 5F2DA 1SNDA 3GQBA 3TMEA 4K0KQ 4A3KG 3D4DA 2F0FA 5M3FG 1GUGA 4JBJA 1B3AA 3MTSA 5CORA 2V1CC 1OO9B 3MEFA 5CGKA 5FLMH 2F0IA 4WJ3M 2JXMB 4X65L 2PZWA 1SYGA 1BKBA 2Z0SA 3PF4A 1SNCA 2KEDA 2WAQE 4F7XA 5NUCA 2UUAL 3R2IA 2EJFC 3AQQA 3UDFA 4OIKA 1TWFB 3A55A 1K8AC 2JEBI 4A3IB 3RMHA 4OWXB 5M5YB 1Q1EA 4DV1Q 2EYFA 4BS9A 3D4WA 4RGTA 1TY0A 3OSOA 1FJGL 3S16H 1F9QA 2RDHA 1NE3A 1IYJB 3CMAA 2CH4A 1PA6A 3S1MH 3CCSA 1PZKD 2KECA 5FLXL 1U4MA 4U68A 2FXQA 2L12A 1Q81C 2HHHQ 1K83B 2F3VA 3S2DH 1LTTD 1STNA 2E74C 2C5CA 3NTKA 1AP0A 3LWUA 1SXTA 3HOYB 2D2CC 1TWCH 5EKIA 4FF4A 2RCFA 4YHHQ 4A3MG 4XQQA 2ZT9C 4UDUC 5HGTA 1M8AA 2VY3A 3HRZC 4RWSC 1EYGA 2B63G 1I3QB 1H9SB 4RGOS 5CYUA 4KY6A 1E7ZA 2IHEA 4O1NA 4P74A 1SSOA 4FF2A 3MXNA 2Q2TA 2LXJA 1C0AA 5KYLA 3I4LA 4L5SA 3GTOB 4UP7A 5C44H 3GTJH 3QOJA 4GN3B 3Q0AA 1WTHA 1VF5C 3F2UA 5D3IB 2A1AA 2F52A 4JI6L 1NR4A 3UI2A 1EIYB 1B53A 2WP8J 3S15B 5J22A 1AE3A 1ICWA 5FO8B 3T16A 3QB3A 4QUFA 4K5VA 4A3FH 4DK6C 4DPGA 1Z7TA 2JSOA 3NK9A 1W2BA 2HDLA 3Q8DA 1Q7YC 4P72A 3CCMA 1VQDA 4E6IA 2Q2HA 3QR8A 2R7ZB 4KK7A 4L5TA 4KKSA 1Q8KA 1ENFA 2UU9L 1VQEA 4WJWA 5I6YA 4YWKA 2B2VA 4C1NK 1CUKA 3EFXD 4A3LH 3OIPA 2EYMA 3JAMi 2EY2A 1CA6A 3I4MB 1EEFD 5J3BA 5CV5A 5GROA 4JI1Q 2JA6H 2ZM6Q 2UUCQ 1WTQA 5LHY1 4JI0L 4JYAQ 3TS0A 2K1BA 1S3OA 4DAMA 1UEAB 1J5EQ 2O5JC 2HIVA 5IT9L 5JVH3 1N32L 2TMPA 2XRQD 1WTRA 1DOMA 2QGQA 2VUMG 1W3SA 3SR1A 4JCVE 1ZYRD 3R2TA 1L0YB 3GV6A 3NBIA 2K52A 3DEOA 3S1NH 4DV2Q 2F0PA 4FP5D 5EBDA 1GD7A 4DXFA 3PO2H 1QUQB 3H3VI 3MZ5A 3S2HB 2AUKA 2KCNA 4BBSB 1X55A 3KLSX 4LF6L 1D6EC 3ULLA 3K57A 4PG3A 3M3YB 2K6AA 1EFWA 4P75A 2MHVA 3D6WA 1TKWB 2NZHA 1CKMA 2B2TC 5H1SE 1YEZA 4QIWB 4QY7A 2XWJB 5M5WB 1L1OA 4IUVA 3S1QB 4JI5Q 4JOIA 2K50A
chains in the Genus database with same CATH topology
4G4KA 3SK4A 1SE4A 4RAUC 1GJXA 4TQUS 4CKEA 3PIP3 1LT3D 1FNWA 3X3MA 1EZ6A 3I3CA 3PV0A 2B2WA 4C3JB 3JAML 3EA6A 5EKLA 1JC7A 3BVZA 2EY5A 3V2TA 5IGDA 1J9OA 1HUMA 2F0KA 1VF7A 2M9VA 5FKAC 1JWUD 5J1ZA 3H3VC 3GO5A 4KD3A 1S5FD 2JA7B 1PXUA 4HAEA 2O4XA 4KJNA 2ZXPA 3A7LA 2LKVA 1CK1A 1LLRD 4IFDG 2EYLA 2DY8A 1L0XB 5JVG3 4BBRB 4IN3A 4XQJA 1J8IA 5E4XA 1LTSD 5D14A 2FJ2A 3NPPA 1LACA 3NTIA 5KNCA 5EGTA 2AQ3B 4DNRB 1G2TA 5IIFA 2XN9C 2FINB 1SYFA 3AU7A 1TT2A 4EQOA 4HTHA 4ZKBB 1CTMA 1EL0A 3NXWA 1RKNA 2NTTA 1CFMA 5I4DA 2IL8A 3H6MA 2F03A 1GXDC 1PTOD 3IFDA 4HN7A 1QWYA 3P75A 5I9OA 1WTOA 3K5OA 1F2MA 1Q8IA 4XT3B 3ND9A 1JORA 5KGUA 1SJED 5DNFA 2NVXB 3PUXA 3VYRA 3QWNA 2QF7A 3QJYA 1R4PB 1F2YA 5BN3A 3T53B 5C4XB 3D8GA 1JWSD 5C0XI 3OW7A 1SYDA 1SFOB 2O5IC 4A93B 3T51B 5CR3A 3BS1A 2SOBA 2X6LA 3DWQA 1TQOA 2DN8A 2WINB 5BN4A 4X3SA 2J7ZA 2E2HB 2JP1A 1EIHA 3J80E 2BOSA 3DWPA 1IKLA 3SEBA 3D31A 2ICIA 3L9AX 3EJIA 3J81E 3R8BA 1STBA 2I07B 3SK5A 2FFKB 2EYHA 4CKCA 1BO0A 1TS5A 1EU4A 1KAAA 1IKMA 1VMCA 1X3PA 1H9MA 1HFGA 5J39A 4BA2I 3NP8A 2F0TA 4KTAA 1HTPA 3GTGB 1EIGA 1E0BA 2KJXA 2NVQB 3MHBA 1Y1WB 4WRDA 5KIXA 3VR2A 4OL7A 2B2WC 3DM1A 1DOLA 3A56A 4CKBA 1AZQA 4R8IA 1JCKB 4XTCS 1EY8A 1EOTA 1NUCA 3OMGA 3K0YA 1R9TB 2ZXOA 3A7AB 3TP5A 1HTLD 3OIQA 1JOQA 1ESFA 1CHPD 4KD4A 4RCNA 3CQZB 1FR3A 1CQVA 3E6ZX 3MAQA 4OO1I 1AN8A 4AYBB 4DAVA 2NN6I 1JB3A 3HOXB 4B9XA 2XIWA 1T5XD 4EGVA 1HQMC 5CBEE 4KKUA 5COYA 1PTOB 3N52A 4Q5VA 2AQ1B 2E76C 5AFWA 5DEHA 2KHSA 3FDTA 2NBFA 2V4DA 3K59A 5FO9B 1A3VA 2FMMA 2K01A 1ILQA 4MIUA 4RKLA 3M4YA 3FEWX 4NDXA 1G6ZA 3N6RA 2OXPA 3SHLA 2QDBA 3CRKC 4X3TA 3VR3A 1TS2A 2J4XA 1ET6A 4A3JB 2BE5D 5C4JB 2PQEA 4U673 5EPLA 2MP1A 5C6AA 2GA4B 4KI0A 1I6HB 1PZJD 2SNMA 4Z9CB 2M2LA 3TBIB 3PUYA 2BDOA 1A3TA 3OMCA 2NVTB 2VXWA 1W6JA 4ZAIA 4KHZA 4FF1A 1ML0D 1WD0A 4QUCA 2JYOA 2WAQB 3OWEB 3IL8A 3DWAA 1PDQA 1SYEA 4RHSA 3L7ZC 3T4AC 2X69A 1TY2A 3DHQA 1TWGB 2IW3A 2N88A 1GHKA 4I65A 1BCPF 3A8JE 4HR7B 4DAYA 4FYDA 2XSCA 1BF4A 1CZGA 3R93A 5IOCA 1C4QA 2FHTA 3QOLA 4RCOA 3C3LA 1XXGA 5EKKA 1S5ED 5JPMC 1XYIA 1STHA 1ZEQX 1M4VA 2K5QA 2A5HA 4IFDH 2AQ2B 5IGFA 5CC4A 3ERQA 4K8JA 1PYWD 3BVGA 5G3LF 3I70A 2B2YA 4H0LC 3NHHA 3NWSA 4C3HB 1A3UA 1FD7D 4OIJA 2BE5C 4FXGC 4TRDA 3D6CA 2JE6I 2KA7A 3EROA 2NB0A 1STYA 1BUVT 1HUNA 1HA6A 1VDZA 5C4ZA 5D3DA 5D65A 1LT5D 1V8QA 1E2VA 4FVMA 1BDOA 2E2IB 1B4OA 5KYIA 4KV6A 1O78A 2CQAA 3R3OA 4X3KA 2EXZA 2F0DA 5C0XG 1U4RA 1AFPA 1ILPA 2RQXA 1PRTD 4I7ZC 3DEPA 5T1GA 1E2ZA 2KQ3A 1E2WA 4G57A 1V43A 4K5WA 1RJTA 2KVMA 3M7GA 2FMCA 2OT2A 3KBXA 2XNAC 4ZLTF 5IGCA 4IUTA 4DFAA 1I4XA 1FYCA 3VA7A 1GUTA 1MSHA 4C3IB 5A2QE 1F9PA 2NUCA 1KDAA 1JWMD 3MEHA 2LS01 4OGQC 2R61A 2NYZD 2RBMA 2C9OA 3S1RB 1A15A 1GUSA 3VR4A 1KNAA 3W2DA 3I73A 1Y8OB 1TWCB 2WACA 3A8KE 2K33A 1ESRA 1TWHB 3P1HA 1WVLA 2BA1A 1CM9A 3TN2A 1STGA 2F0HA 2IX3A 4UAIA 3GTJB 3GV3A 3FPUB 1I4RA 3OPOA 4HSVA 3KUPA 1WTVA 1SYBA 3IFTA 2A74C 2CW0D 3J81L 3V05A 3ITPA 3NE5B 3KLSA 4N9PA 4OO1G 2NN6G 3FKIB 2LMCB 5KNDA 2NTSA 2F3WA 1I4GA 3I8ZA 3ONAB 1SNMA 4IURA 1DM0B 1EQTA 3I91A 3BDLA 3NQIA 4K2KA 2D62A 5EQ0A 4C3HG 4IUQA 2IWHA 4J1MA 4R9WA 2L11A 3FVQA 3SDZA 3WDNA 4IUNA 3GTPB 2B2YC 1FNUA 3C1FA 2K03A 4ULLA 4RA8A 5M9OA 4IUUA 2IX0A 1PLFA 1PRTB 1B50A 3OOCA 3K58A 2PW7A 3J7AF 4A3GB 1BCPB 4KY5A 4MHEA 2VB3X 1Q1BA 5CMDA 2Q8TA 1D1KA 1SE2A 1ZYRC 2IJ0A 1Q3LA 3LX0A 2QCPX 1G91A 3A54A 1U4LA 1NR2A 4KN7C 4FO2A 3FMCA 3KF8A 3T56B 3P20A 1PZID 1IW7D 2CW0C 4PMWA 4C1NI 2RVLA 3WOEA 2EJGC 3KBGA 1K8MA 4DXGA 4C3IG 4CBVA 1IHZA 2XRSD 1KDBA 4A3BB 1O7LA 2F1MA 4F87A 1SNOA 3E5SA 1DD2A 3RZOB 4RHRA 1JOKA 3GP7A 3HKZB 2K5WA 3URYA 1I4QA 5E3FA 2B2VC 3BG3A 3BYTB 2EOTA 3GTMB 4NP5A 2AUJD 3HGBA 2L9HA 1KLUD 3C1EA 2N55A 1R4QB 2E2DC 3DXJC 5I9PA 4K2LA 3GTQB 3W3AA 1AEXA 3QG1A 3S9WA 2A6HD 3I4NB 5DM73 1Y1VB 2R3ZA 3PUZA 3X3NA 2EYJA 4PMCA 1Y69U 4R8NA 4M1UB 4L63B 1I6VC 4K14A 1ET9A 2A69D 5DAUA 2F0LA 1IW7C 4DK1A 1CQFA 5C5MA 4IFDJ 1F9SA 1O80A 5E1FA 2LY7A 1WTPA 2D5DA 1EQVA 1RHPA 2HCIA 2A73B 4KHVA 4C3JG 2K5DA 4MN3A 4DU9A 2EY1A 4F8MA 4XIGS 1EY0A 3TDQA 3RD4A 3GD7A 1TR5A 1VCIA 1SEBD 1PTOC 3ND8A 1DZ1A 5C0XH 3G7LA 2L5TA 5ISRA 1PTOH 1RDPD 3Q6SA 3E0JA 3QO2A 4ODGA 1GOZA 2X6GA 4A3DB 4V0BA 4A3KB 1MGSA 1TWAB 3HOWB 4QB4A 3HOUB 1GUNA 3TP7A 1WCMB 2Q8IB 3Q22A 5I6WA 2A6HC 3MWYW 3LNNA 2MGSA 3D4RA 2H4OA 1WTWA 1NCVA 3SE0A 4PMBA 4KY7A 3NQTA 4TSSA 1Z47A 5C4HA 2A69C 3MXUA 2CVRA 2PZUA 3Q24A 3OWFA 5C5LA 2EVBA 2O2LD 4KJOA 1EY5A 1Y8PB 5I2YA 1QOHA 2K32A 2F0EA 3J7AV 2Z4IA 3V96A 3K7AB 2RSNA 3SVMA 2EY6A 1EEID 1EY4A 2B63B 1HQRD 4QCLA 1KTKA 1PFMA 1HXYD 1WTXA 1OXVA 3CKIB 1II3A 1CZWA 5A2QL 1W6KA 1OXUA 4OHJA 4H13C 3S17B 5K36G 2SEBD 3VR6A 3PIO3 4LK1C 3TSSA 1B9MA 2QKIC 4OO1H 1A6XA 2YU9B 1F9RA 3K5LA 2NN6H 2F0MA 3VYSA 2WV6D 4YIJA 1DONA 5ELDA 3FPPA 4IALA 4A3EB 3K5MA 4GZYC 2AWNA 3U9SA 5DM63 2JA8B 4ZK9B 2YYZA 5KNBA 2AWOA 1MD2D 2EPBA 3DMUA 1CI3M 4RGNA 5EJWA 1G291 1S5DD 5JJZA 2NVYB 2PO4A 5EPKA 1LV9A 1C48A 1AW7A 1PFNA 2K04A 1S5CD 3EQLC 1YNJD 5CV7A 1Q12A 1DXMA 3MXPA 1XTCD 1LTRD 3IKJA 1D2BA 2F0OA 2IT1A 3ZYYX 4J8QA 4LMQD 1OXXK 1QILA 3DUZA 4BY7B 2EJMA 3TP6A 5CV6A 3NUCA 1O7ZA 1QNKA 1BXTA 1U9RA 5JAVA 2K28A 1ENCA 3BDOA 3RZDB 2RDGA 2D9UA 1IYVA 1EFID 4BA1I 5JOBA 4G7HC 4EQNA 3I90A 3GTLB 5CBAE 3NTHA 2L1BA 4ILWA 4J6HA 1DYQA 3HOVB 5EBCA 2JA5B 2EE1A 5A35A 2RA4A 1U4PA 3O13A 1ZXTA 2WKCA 3BZDB 3NSWA 2HQEA 1BCPD 2ENBA 2HCCA 3PO3B 1JQYD 2WKDA 4LAAA 1B1ZA 2TSSA 3VYTA 4H7BA 3M7NA 1YNJC 2A6ED 3MFYA 4L6TB 4ZUIA 5I2XA 2F0QA 2Q8RE 1UAPA 1BQQT 4CGYB 2PCFB 3M85A 1LTAD 1FNVA 5G3LD 4RKBA 1SYCA 2EZVA 5ELBA 4V190 3PMFA 3G6JB 1TS4A 4FF3A 2Z8LA 3K6OA 3D3RA 1BR9A 2HUGA 3AB9A 2Z1CA 1HPCA 3FRPB 2G9DA 3A8IE 3S16B 2PPBC 1D1IA 3S1MB 2JEAI 2QEJC 5CV9A 3H09A 3MXGA 5BN5A 2PZTA 4G7OC 1D5ZC 2L4NA 3S2DB 1D5MC 3I72A 3QIAA 5HURA 1RTOA 3C46A 2NWGA 1SJHD 5TSSA 4PV1C 2BCOA 2L0CA 1GUOA 2RSOA 2F0WA 4QMGA 4N9TA 1RD9D 3TP8A 3P7JA 2A68D 2KCCA 2F0NA 1V1PB 1PRTC 2DNEA 1AZPA 5C3WA 5C44B 1DJRD 4NKLA 1HCZA 1H9KA 2RDFA 4DNTB 4XXEA 1BCPC 3J80L 1G2SA 4RFBA 2J0TD 4C56C 5C0XJ 4A3FB 1TU2B 2MUYA 1IL8A 2A6EC 4RH6A 3BYYB 3CRLC 1S4ZA 4XQNA 4HMJA 1JOOA 1QCBD 2QILA 3K5NA 3SK8A 1Z6HA 2L55A 2MJ8A 4DA2A 4K6DA 1HHVA 4DAPA 1GHJA 1OXSC 4G7ZC 2JA6B 1C8CA 1X32A 3H0GB 2OF1A 4CJ2C 3HS0C 5ELFA 5E4WC 1SNQA 3MA2B 1TS3A 1DCZA 5JEAG 3MC0B 4FNFA 4L8JA 1TVXA 1TIID 4DF7A 1IYUA 5FLXE 3IAYA 1PTOF 3S1NB 3TZUA 1LT6D 3PO2B 2XWBB 2A68C 1DOKA 2BA0A 1VMPA 2PW5A 4B08A 4ZYSA 2LFNA 1EZ8A 1B9NA 1T5EA 1SBBB 3NBHA 4BWGB 1F77A 3T13A 2ZXRA 1FGBD 2B2UA 4LJZC 5K36H 2KEEA 3CHBD 2MPMA 3NWTA 4K8IA 1HFNA 1I50B 1LT4D 1QE6A 3KLRA 4QF4A 3KK7A 5ELEA 1PMRA 2F0SA 5CV4A 1A2TA 2PYKA 4WORA 1B2TA 1BBXC 3MVVA 1KABA 4XYQA 2R92B 2PNRC 4PQXA 3HP3A 1G8ZD 5LL6S 2WB1B 1CHQD 1XWEA 3H91A 4ID6A 2SNSA 1MSGA 1X3QA 4PNYA 4NMZA 5KEEA 1F2ZA 3HEJA 4K5XA 3VA5A 2KUMA 2H1EA 3WOFA 5K5PA 1EY9A 3HOZB 2K05A 1CA5A 3BVMA 1BNZA 4RGMA 4X3UA 3MFGA 5JEAJ 4DGZA 3S14B 2G9HD 5JPNC 2VNUD 2B39A 5IT9E 1NSNS 4FXKC 4KMUC 1EY7A 5CV8A 2Z4HA 2DY7A 3L3OC 5M3MB 3AMUA 2R6GA 4H44C 2IPKD 1B44D 5ELCA 3GTKB 1HRJA 2F0VA 3VYUA 4HEDA 4ABNA 1ONLA 2I46A 4XT1B 4HCSA 4IQZA 2EYOA 2Y0SB 4BY1B 1JE4A 3H94A 1EYCA 1RCVD 5KRUA 2ICEC 3CU7A 3OHXC 3TZDA 3RLFA 5C3EB 5C3XA 4ZQ3A 2ID0A 1XX8A 1H9SA 2VB2X 1UNSA 4IUPA 2R93B 3HG9A 1NAPA 4XYOA 1OXTA 5EPJA 1STEA 1MI2A 3JAME 4NW2A 1A2UA 1HA5A 1JICA 2PMZB 1SAPA 1KDCA 2KOLA 1RF2D 4JK1C 5M3FB 2E2JB 2CHBD 4IZ8A 1LABA 3BDCA 4CHTB 4JBWA 4KKTA 1RTNA 5FO7B 4DK0A 1I4HA 4ZRZA 2EYPA 1O7YA 1RODA 5IGEA 1PFBA 3VR5A 2F0JA 1I4PA 4F88A 3Q23A 1QJOA 4K6LA 1YNND 3LWEA 5FK9C 2M00A 5LL6X 1CT1D 2B2UC 1QNUA 1V1PA 1SMYD 1STAA 2F0GA 3U9OA 1H9RA 1K8OA 4KN4C 1LTGD 3PUWA 5IODA 4DN4M 4A3MB 4O42A 1EWCA 4P2CB 1EY6A 2XVSA 1ENAA 1LTID 4HCEA 1WD1A 3J7YW 1LTBD 4C2MB 1KLGD 2DNCA 1H9JA 3RUZA 1KNEA 5FOBB 4TKOB 2E75C 5M5XB 1ZKOA 2B8GA 4FXDA 1F2LA 1QB5D 2EDGA 1QG7A 1EYAA 1V1OA 2B8FA 4EVOA 1JR0D 3EVQA 4CJ0B 3PUVA 2IX1A 1SNPA 1MBYA 4CJ1B 4XDXA 1Y8NB 5T1IA 1LO5D 4WFN3 1GUWA 4IFDI 1S5BD 4HSPA 5IGGA 3M4OB 2OEOA 2K7VA 2WIIB 3SK6A 2SDFA 1EWHA 1EYDA 4ME5A 2NZ1D 3C2PA 1YNNC 2F0UA 1SE3A 4M8AA 4Y7NB 2HDMA 4ZKCB 1UUPA 3HZXA 4S3SA 1SMYC 4HMIA 5JEAH 3SXHA 1D5XC 1SDFA 2VUMB 4ZUJA 2RKSA 4B9WA 1PRTF 1EU3A 1Q90A 4EQPA 2B2TA 1BOSA 5IGBA 2BDNA 4Q0FA 2F4IA 5F2DA 1SNDA 3GQBA 3TMEA 3D4DA 2F0FA 1GUGA 1B3AA 3MTSA 5CORA 1OO9B 5CGKA 2F0IA 2JXMB 2PZWA 1SYGA 1SNCA 2KEDA 4F7XA 5NUCA 3R2IA 2EJFC 4OIKA 1TWFB 3A55A 2JEBI 4A3IB 3RMHA 5M5YB 1Q1EA 2EYFA 4BS9A 3D4WA 4RGTA 1TY0A 3OSOA 1F9QA 2RDHA 1PZKD 2KECA 5FLXL 1U4MA 4U68A 2L12A 1K83B 2F3VA 1LTTD 1STNA 2E74C 2C5CA 3NTKA 1AP0A 3LWUA 1SXTA 3HOYB 2D2CC 5EKIA 4FF4A 4XQQA 2ZT9C 4UDUC 5HGTA 1M8AA 3HRZC 4RWSC 1I3QB 1H9SB 4RGOS 5CYUA 4KY6A 4O1NA 4FF2A 1SSOA 3MXNA 5KYLA 3I4LA 3GTOB 3Q0AA 3QOJA 1VF5C 3F2UA 5D3IB 1NR4A 3UI2A 1B53A 2WP8J 3S15B 5J22A 1ICWA 5FO8B 3T16A 3QB3A 4QUFA 4K5VA 1Z7TA 2JSOA 3NK9A 2HDLA 4E6IA 2R7ZB 4KK7A 4KKSA 1ENFA 4WJWA 5I6YA 2B2VA 4C1NK 3EFXD 3OIPA 2EYMA 2EY2A 1CA6A 3I4MB 1EEFD 5CV5A 1WTQA 5LHY1 2K1BA 1UEAB 2O5JC 5IT9L 5JVH3 2TMPA 2XRQD 1WTRA 1DOMA 3SR1A 1ZYRD 3R2TA 1L0YB 3GV6A 3NBIA 3DEOA 2F0PA 4FP5D 4DXFA 5EBDA 3S2HB 3MZ5A 2AUKA 2KCNA 4BBSB 3KLSX 1D6EC 3K57A 3M3YB 2K6AA 2MHVA 3D6WA 1TKWB 2B2TC 4QIWB 2XWJB 5M5WB 4IUVA 3S1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FK9 C;  1D5X C;  1PTO D;  1D5M C;  1KTK A;  1SE4 A;  1CT1 D;  1I4R A;  1HXY D;  1PTO F;  1LT3 D;  1FNW A;  1V1P A;  1SJH D;  2IPK D;  1B44 D;  1BXT A;  1LT6 D;  5ELC A;  5TSS A;  4DXG A;  2XRS D;  1PZJ D;  1PRT D;  1SEB D;  4Z9C B;  1SJE D;  4ZYS A;  1PRT F;  1EU3 A;  1HTL D;  3EA6 A;  1LTG D;  1PTO C;  4OHJ A;  3V05 A;  1RD9 D;  3BVZ A;  1SBB B;  2SEB D;  2RDG A;  1JWS D;  1EWC A;  4BWG B;  1ESF A;  3TSS A;  1CHP D;  1F77 A;  1RCV D;  1EFI D;  1V1P B;  4RHR A;  1LTI D;  1PTO H;  1PRT C;  1FGB D;  1RDP D;  2NTS A;  1CQV A;  3GP7 A;  1ENF A;  1DJR D;  3URY A;  1LTB D;  1GOZ A;  1I4G A;  3OWE B;  5FKA C;  1I4Q A;  2XNA C;  1AN8 A;  3CHB D;  3DWA A;  1DYQ A;  1BCP C;  1KLG D;  3EFX D;  1JWU D;  4RHS A;  4RFB A;  2WV6 D;  3BYT B;  3DWQ A;  4C56 C;  3O13 A;  1UNS A;  5ELD A;  1TY2 A;  1S5F D;  1I4X A;  1LT4 D;  3BZD B;  1EEF D;  3R2I A;  5ELE A;  1BCP D;  3DWP A;  1KLU D;  1BCP F;  3SEB A;  1T5X D;  4RH6 A;  3BYY B;  1CK1 A;  2ICI A;  1STE A;  1JQY D;  3R8B A;  1V1O A;  1B1Z A;  1FNU A;  1LLR D;  1HA5 A;  1PTO B;  1JR0 D;  2TSS A;  2AQ1 B;  4RGT A;  1MD2 D;  1TY0 A;  4RCO A;  2QIL A;  1L0X B;  1XXG A;  1JWM D;  2RDH A;  1TS5 A;  1EU4 A;  2XRQ D;  1G8Z D;  4RGN A;  2R61 A;  1S5D D;  1S5E D;  1PZK D;  1CHQ D;  1RF2 D;  1M4V A;  4L6T B;  1PRT B;  4TSS A;  2AQ2 B;  1LO5 D;  1LTS D;  1AW7 A;  2CHB D;  1LTT D;  3R2T A;  1L0Y B;  1S5C D;  1S5B D;  1LTA D;  1BCP B;  1FNV A;  1SXT A;  2O2L D;  3W2D A;  4DXF A;  1PYW D;  3BVG A;  5ELB A;  2AQ3 B;  4L63 B;  1TS4 A;  3KLS X;  4UDU C;  2XN9 C;  1I4H A;  1ET9 A;  1D6E C;  1XTC D;  1LTR D;  2Z8L A;  1SE2 A;  5ELF A;  2IJ0 A;  4RGO S;  1FD7 D;  1SE3 A;  1TS3 A;  4O1N A;  3BVM A;  1I4P A;  1QIL A;  3MC0 B;  1UUP A;  4RGM A;  5D3D A;  3MFG A;  1EEI D;  2NTT A;  2QEJ C;  1TS2 A;  1LT5 D;  2G9H D;  4K6L A;  5I4D A;  2J4X A;  1HQR D;  1ET6 A;  1D5Z C;  1PZI D;  1JCK B;  5D3I B; 
#chains in the Genus database with same CATH topology
 4G4K A;  3SK4 A;  1SE4 A;  4RAU C;  1HNX Q;  1GJX A;  4TQU S;  4CKE A;  3PIP 3;  1PV4 A;  1YBY A;  1LT3 D;  3UDX A;  1FNW A;  3X3M A;  2CQO A;  3U58 A;  1EZ6 A;  4A3I G;  1I50 H;  3I3C A;  3PV0 A;  2B2W A;  2KCT A;  4C3J B;  3JAM L;  3EA6 A;  5EKL A;  1JC7 A;  3BVZ A;  2OQ0 A;  1B8A A;  1A0I A;  2EY5 A;  3V2T A;  5IGD A;  1WI5 A;  2R92 H;  1J9O A;  1HUM A;  4LUZ A;  2F0K A;  1VF7 A;  2M9V A;  5FKA C;  1KRS A;  1JWU D;  5J1Z A;  3HOY G;  4DV1 L;  3KDF A;  3PO3 G;  2KHJ A;  3H3V C;  3GO5 A;  1P16 A;  4KD3 A;  1VQM A;  4LF9 Q;  1IXR A;  1S5F D;  2JA7 B;  1NJI C;  1PXU A;  4HAE A;  2O4X A;  4CDE C;  4X6A H;  4KJN A;  2ZXP A;  4UP9 A;  3A7L A;  2LKV A;  4YCV A;  1Y14 B;  2EQS A;  1CK1 A;  2DUD A;  1JJC B;  1C9O A;  4UP8 A;  3PQI A;  5IYB H;  1LLR D;  3HOZ H;  4IFD G;  2EYL A;  2DY8 A;  4YHH L;  4AIM A;  1L0X B;  5JVG 3;  4BBR B;  4IN3 A;  4XQJ A;  3S14 H;  1Y1V H;  2ZJR A;  1J8I A;  5E4X A;  1LTS D;  5D14 A;  1NMG A;  4HID A;  2FJ2 A;  4LFA Q;  3NPP A;  1UE1 A;  1LAC A;  3GTK H;  4ME3 A;  3NTI A;  5KNC A;  5EGT A;  2AQ3 B;  4DNR B;  1G2T A;  5IIF A;  4DR7 Q;  2XN9 C;  4QL5 A;  2FIN B;  2UXD Q;  1SYF A;  2R7Z G;  4B3M Q;  3AU7 A;  1TT2 A;  4EQO A;  4DUZ Q;  2PI2 E;  4HTH A;  4ZKB B;  4BY1 H;  1CTM A;  1EL0 A;  3NXW A;  1RKN A;  3K0X A;  4B3S Q;  2NTT A;  1CFM A;  1VQ4 A;  5I4D A;  3PIP A;  2IL8 A;  3B6Y A;  3H6M A;  3I4M G;  2F03 A;  1IBL Q;  1GXD C;  4JVZ A;  1PTO D;  3IFD A;  3AEV A;  4HN7 A;  5C3E H;  1QWY A;  1VQ5 A;  3P75 A;  5I9O A;  1WTO A;  3K5O A;  1F2M A;  1JT8 A;  1Q8I A;  1RIP A;  4XT3 B;  3ND9 A;  1JOR A;  1UWV A;  2JA9 A;  2R93 H;  5KGU A;  2I5M X;  1SJE D;  5DNF A;  2NVX B;  3PUX A;  3VYR A;  3QWN A;  2QF7 A;  3QJY A;  1R4P B;  1F2Y A;  5BN3 A;  3KLW A;  3T53 B;  5C4X B;  3D8G A;  1WOC A;  1KXL A;  1JWS D;  5C0X I;  4IO9 A;  2I0Q A;  3OW7 A;  1SYD A;  1SFO B;  2O5I C;  4EQ5 A;  4JI1 L;  4A93 B;  3T51 B;  2ZM6 L;  5CR3 A;  3MXN B;  5ELO A;  3BS1 A;  5JJL A;  2XTI A;  2SOB A;  2X6L A;  4A3K H;  4BBS G;  5M3F H;  2E2J H;  3DWQ A;  1TQO A;  2DN8 A;  4DKA C;  3UE1 A;  2WIN B;  5BN4 A;  1Q82 C;  4X3S A;  2J7Z A;  2MQH A;  2E2H B;  2JP1 A;  1EIH A;  3PGZ A;  3J80 E;  2BOS A;  3DWP A;  4DV7 Q;  1IKL A;  3SEB A;  3D31 A;  5FJ8 G;  2KHI A;  2ICI A;  1FL0 A;  3L9A X;  3EJI A;  3J81 E;  3J81 j;  4DV2 L;  3R8B A;  1STB A;  1XMO Q;  2I07 B;  5AJ3 Q;  4LF5 Q;  3SK5 A;  2FFK B;  2EYH A;  4CKC A;  1BO0 A;  1TS5 A;  1EU4 A;  1KAA A;  1IKM A;  1VMC A;  4DV4 Q;  3H0G G;  1X3P A;  1H9M A;  1VQP A;  1HFG A;  1QZH A;  5J39 A;  4BA2 I;  3NP8 A;  1KQS A;  4JOI C;  1FVI A;  3DLL A;  2F0T A;  4KTA A;  1BBU A;  1HTP A;  4DV3 L;  3GTG B;  1EIG A;  1E0B A;  2KJX A;  2NVQ B;  1XPO A;  3MHB A;  1Y1W B;  3CC7 A;  3K7A H;  4WRD A;  1RL2 A;  3VR2 A;  5KIX A;  4OL7 A;  5IE8 A;  2B2W C;  3DM1 A;  4LWC A;  1E24 A;  1CKO A;  2B63 H;  1DOL A;  4DV5 Q;  4JV5 L;  3A56 A;  4CKB A;  1AZQ A;  4R8I A;  2ZTC A;  1JCK B;  4XTC S;  4GKK Q;  2JA7 G;  4PZ7 A;  1WJJ A;  1QVF A;  1EY8 A;  1EOT A;  4NB3 A;  1NUC A;  3OMG A;  3K0Y A;  1R9T B;  2ZXO A;  3A7A B;  4DV6 Q;  3TP5 A;  1HTL D;  1HR0 W;  3OIQ A;  4A76 A;  1JOQ A;  1L2F A;  5M5X H;  4LF9 L;  2QEX A;  5BR8 Q;  1ESF A;  1CHP D;  3J80 c;  4KD4 A;  4RCN A;  1VQI A;  3CQZ B;  3NEN A;  2YU9 H;  1FR3 A;  1CQV A;  1WYD A;  3E6Z X;  3MAQ A;  4OO1 I;  1AN8 A;  3HFZ B;  4AYB B;  4DAV A;  3CAM A;  2NN6 I;  3SGI A;  1L1O B;  4KHP Q;  1JB3 A;  4DR5 Q;  1KL9 A;  1CSQ A;  3M4O H;  3HOX B;  5GAE C;  1EOV A;  4B9X A;  1YHB A;  2XIW A;  1T5X D;  3OYY A;  4EGV A;  4OEL B;  1HQM C;  5CBE E;  4KKU A;  4LFA L;  1HNW Q;  5COY A;  1PTO B;  2RHQ B;  3N52 A;  4Q5V A;  2AQ1 B;  2E76 C;  5AFW A;  1G6P A;  5DEH A;  1KC8 C;  1QUQ A;  2KHS A;  3RN2 A;  2NVY H;  4NXN L;  4B3M L;  3RLO A;  1N34 Q;  4JBK A;  2VS1 A;  3FDT A;  3F2C A;  4DUZ L;  3KFU A;  2NBF A;  2V4D A;  4JI4 Q;  4DR4 Q;  3K59 A;  5FO9 B;  1A3V A;  4B3S L;  4APV A;  1SR3 A;  2FMM A;  2VUM H;  2K01 A;  1ILQ A;  4MIU A;  4RKL A;  1JB7 A;  1KRT A;  3KDF B;  3M4Y A;  5C4X G;  3FEW X;  4NDX A;  1IBL L;  4X64 Q;  1GVP A;  2K4K A;  1G6Z A;  3N6R A;  2UXC Q;  2KCM A;  2OXP A;  3SHL A;  5M3M G;  2QDB A;  4L5Q A;  3CRK C;  3TRE A;  4LF8 Q;  4X3T A;  3VR3 A;  2E5L Q;  1TS2 A;  5ELN A;  2J4X A;  2VQF Q;  1ET6 A;  4A3J B;  4YWM A;  1XNR Q;  2OTL A;  2BE5 D;  3A5U A;  5C4J B;  2PQE A;  1E3P A;  4U67 3;  4HJA A;  5EPL A;  3F8T A;  2B3G A;  2MP1 A;  3J7A 5;  5C6A A;  2GA4 B;  4KI0 A;  5JJK A;  1I6H B;  5E7N A;  1PZJ D;  4JG2 A;  2SNM A;  4Z9C B;  1YIT A;  2M2L A;  3TBI B;  1QVG A;  3RZD H;  1TXY A;  3KF8 B;  2EIF A;  3PUY A;  4WJ4 A;  1TWF H;  2BDO A;  1A3T A;  4A3I H;  4R4C A;  4HIO A;  1LTL A;  3OMC A;  2NVT B;  2VXW A;  1W6J A;  4ZAI A;  3EIV A;  4DV7 L;  1J6Q A;  4KHZ A;  4A75 A;  4FF1 A;  1ML0 D;  1WD0 A;  4QUC A;  2JYO A;  2WAQ B;  3OWE B;  4X66 Q;  2JQO A;  3IL8 A;  3DWA A;  1EQQ A;  2PI2 A;  1PDQ A;  1SYE A;  4RHS A;  1XMO L;  1YJW A;  5AJ3 L;  3CF5 A;  4LF5 L;  3TS2 A;  1K83 H;  3L7Z C;  3T4A C;  2X69 A;  1TY2 A;  3DHQ A;  1TWG B;  4O2D A;  4IPC A;  2IW3 A;  1Y1W G;  2N88 A;  3WWV A;  3CC4 A;  3PO3 H;  1GHK A;  4I65 A;  1BCP F;  3A8J E;  4HR7 B;  4DAY A;  1Q86 C;  4FYD A;  1I3Q H;  2XSC A;  1BF4 A;  1CZG A;  3R93 A;  3CCE A;  5IOC A;  1C4Q A;  2FHT A;  3QOL A;  4RCO A;  3C3L A;  1XXG A;  5EKK A;  3F1Z A;  1S5E D;  5JPM C;  1XYI A;  1STH A;  1ZEQ X;  1M4V A;  2K5Q A;  2A5H A;  4IFD H;  1VQ6 A;  1B3Q A;  2AQ2 B;  2B29 A;  5IGF A;  1YHA A;  4DV5 L;  5CC4 A;  3S15 H;  3ERQ A;  4K8J A;  1PYW D;  3BVG A;  5G3L F;  1S72 A;  3I70 A;  2B2Y A;  4H0L C;  3NHH A;  4HIK A;  3NWS A;  4GKK L;  4GKJ L;  3PCO B;  4C3H B;  1A3U A;  1FD7 D;  5IYD H;  4OIJ A;  3CC2 A;  2BE5 C;  4FXG C;  4OXP A;  4TRD A;  3D6C A;  3T1H Q;  2JE6 I;  2KA7 A;  3ERO A;  2NB0 A;  1STY A;  1BUV T;  1HUN A;  5HGQ A;  4DV6 L;  1HA6 A;  4AYB G;  1VDZ A;  5D65 A;  5D3D A;  5C4Z A;  2R7Z H;  1Z9F A;  1LT5 D;  2AMC B;  1V8Q A;  1E2V A;  1PH5 A;  1EQR A;  1AE2 A;  4FVM A;  1BDO A;  2E2I B;  1B4O A;  5KYI A;  4KV6 A;  1O78 A;  2CQA A;  3R3O A;  4X3K A;  3HOX G;  1N8R C;  1YNX A;  2EXZ A;  4DR1 Q;  2F0D A;  5C0X G;  1U4R A;  4KLK A;  1X9N A;  3I4M H;  1ILP A;  2RQX A;  1AFP A;  1PRT D;  4JI8 Q;  4GS3 A;  4I7Z C;  3DEP A;  2Z6K C;  5T1G A;  1E2Z A;  2KQ3 A;  3UDI A;  4KHP L;  1E2W A;  4G57 A;  1V43 A;  4DR5 L;  3TRZ A;  4K5W A;  1RJT A;  1E1O A;  2KVM A;  3CME A;  2HQL A;  3M7G A;  2FMC A;  3D0F A;  2OT2 A;  1XNQ Q;  3KBX A;  2XNA C;  4ZLT F;  4A3C G;  1HNW L;  5IGC A;  3J81 i;  4IUT A;  2Z6B A;  5IP9 G;  4DFA A;  1I4X A;  2OCE A;  1FYC A;  1SRU A;  3VA7 A;  1BBW A;  1N34 L;  1VS0 A;  3S2H H;  1GUT A;  1MSH A;  4BBS H;  4C3I B;  1C7Y A;  1KIX A;  4DR4 L;  5A2Q E;  2CH4 W;  1F9P A;  3M3Y H;  4A3J G;  5IY0 A;  2ATW A;  4BXX G;  2NUC A;  5FJ8 H;  1KDA A;  1JWM D;  3MEH A;  2LS0 1;  4OGQ C;  1I94 Q;  1EWI A;  3U50 C;  2R61 A;  2NYZ D;  5M5W H;  2RBM A;  1H95 A;  2C9O A;  1YVC A;  2UXC L;  3S1Q H;  3S1R B;  1NMF A;  1A15 A;  1GUS A;  3ERS X;  3VR4 A;  1IL2 A;  1KNA A;  3H0G H;  3W2D A;  2VQF L;  3I73 A;  5EAY A;  1Y8O B;  1GO3 E;  1XNR L;  1TWC B;  2WAC A;  3A8K E;  2K33 A;  2VW9 A;  1ESR A;  1TWH B;  1N9W A;  2YTX A;  2GVA A;  3P1H A;  1WVL A;  2BA1 A;  2WAQ G;  1K0S A;  1CM9 A;  1XTD A;  3TN2 A;  3OTO Q;  2ES2 A;  1STG A;  2F0H A;  2IX3 A;  2UXB Q;  4UAI A;  3GTJ B;  3GV3 A;  3FPU B;  1I4R A;  3OPO A;  3G48 A;  4R1J A;  4HSV A;  3K8A A;  2JA7 H;  3KUP A;  1PH6 A;  1WTV A;  1SYB A;  3IFT A;  2A74 C;  2CW0 D;  2CFM A;  1IBK Q;  3J81 L;  3ITP A;  3NE5 B;  3V05 A;  3KLS A;  1DGS A;  4N9P A;  1SMX A;  4OO1 G;  4UHV A;  4UY8 C;  1VQ9 A;  4DUY Q;  2N8N A;  2NN6 G;  3FKI B;  2LMC B;  5KND A;  2NTS A;  2F3W A;  1I4G A;  4JI2 Q;  1E1T A;  3I8Z A;  4K0K L;  3ONA B;  5IYC G;  1SNM A;  4IUR A;  1DM0 B;  1EQT A;  4N8X 1;  3I91 A;  3BDL A;  3NQI A;  1VQC A;  4K2K A;  2D62 A;  1M1K C;  5EQ0 A;  5LMN Q;  4ALP A;  4C3H G;  4IUQ A;  2IWH A;  4NPS A;  4J1M A;  4R9W A;  2EXD A;  2L11 A;  5GAD C;  1PFS A;  3FVQ A;  3SDZ A;  4GNX A;  1M90 C;  4X62 Q;  4B3T Q;  3WDN A;  4IUN A;  3GTP B;  2B2Y C;  1FNU A;  3C1F A;  3W1G A;  1VQF A;  2K03 A;  4ULL A;  3M9B A;  1VQ8 A;  2JK8 A;  2XGT A;  4RA8 A;  5DLQ E;  5M9O A;  4IUU A;  2IX0 A;  4LF7 Q;  2Z9H A;  4R4O A;  1PLF A;  1PRT B;  3T1H L;  1B50 A;  3OOC A;  2DGY A;  1U0L A;  1D8L A;  3K58 A;  3W5O A;  2HHH L;  2PW7 A;  3J7A F;  3H3V H;  1BCP B;  4KY5 A;  4A3G B;  2Q2I A;  4MHE A;  2VB3 X;  1T9H A;  4R4I A;  1Q1B A;  3ULJ A;  4DR3 Q;  5CMD A;  2Q8T A;  2NVX H;  4CDF C;  1D1K A;  1SE2 A;  1ZYR C;  1V1Q A;  2IJ0 A;  1Q3L A;  4J15 A;  2YV5 A;  3STB D;  3LX0 A;  1PHJ A;  3VDY A;  2QCP X;  1G91 A;  1SE8 A;  3A54 A;  1U4L A;  5C4X H;  1NR2 A;  4KN7 C;  4FO2 A;  3FMC A;  4DAY B;  2G5D A;  3KF8 A;  3T56 B;  3P20 A;  1PZI D;  2MNA A;  1IW7 D;  5M3M H;  2CW0 C;  4PMW A;  4C1N I;  2RVL A;  4CDD C;  3WOE A;  2EJG C;  3KBG A;  1K8M A;  4DXG A;  4C3I G;  4CBV A;  1IHZ A;  2XRS D;  1XNQ L;  1KDB A;  2IHF A;  3EN2 A;  4A3B B;  2E2H H;  1O7L A;  2F1M A;  3FP9 A;  3CXC A;  4F87 A;  1SNO A;  3E5S A;  2ZTE A;  2L15 A;  1DD2 A;  3RZO B;  4RMF A;  4DR6 Q;  1JJ2 A;  4LNQ A;  4IPG A;  4RHR A;  1N33 Q;  1JOK A;  3GP7 A;  3HKZ B;  2K5W A;  1HH2 P;  3CCQ A;  3URY A;  1I4Q A;  5E3F A;  2B2V C;  3BG3 A;  3BYT B;  2D0O A;  2EOT A;  3GTM B;  1AH9 A;  1I94 L;  4NP5 A;  2AUJ D;  3HGB A;  4AQY Q;  2L9H A;  1K3R A;  1A63 A;  1KLU D;  3C1E A;  3GTG H;  2NVQ H;  1MJC A;  2N55 A;  5FLX c;  1R4Q B;  1Y1W H;  2UUC L;  4JYA L;  2HT1 A;  2E2D C;  3DXJ C;  5I9P A;  4K2L A;  2DJF C;  3LGJ A;  3J7Z C;  3GTQ B;  3W3A A;  3HKS A;  1AEX A;  2AHO B;  1J5E L;  3QG1 A;  3HKZ E;  3S9W A;  2A6H D;  3EBE A;  3I4N B;  5DM7 3;  1Y1V B;  3E0E A;  4H02 A;  2R3Z A;  1QZG A;  3PUZ A;  3X3N A;  3JC6 6;  2EYJ A;  1XJV A;  4PMC A;  3OTO L;  1Y69 U;  2WB1 E;  4R8N A;  1R9T H;  4M1U B;  2UXB L;  4L63 B;  1I6V C;  4K14 A;  4A4I A;  4B3R Q;  1ET9 A;  2A69 D;  5DAU A;  3FKI G;  2F0L A;  2ZJP A;  1IW7 C;  4DK1 A;  1K9M C;  1CQF A;  5C5M A;  4IFD J;  1F9S A;  1O80 A;  4AH6 A;  5E1F A;  1HZ9 A;  1PH7 A;  1O7I A;  1IBK L;  2LY7 A;  3CQZ H;  1WTP A;  2D5D A;  2MO1 A;  1EQV A;  1RHP A;  2UUB Q;  2HCI A;  2A73 B;  4KHV A;  1L1O C;  2CKZ B;  4C3J G;  2K5D A;  4MN3 A;  4DUY L;  4DU9 A;  2EY1 A;  4F8M A;  2C35 B;  2GN5 A;  4JI5 L;  1VQN A;  4UPA A;  4XIG S;  1EY0 A;  1IBM Q;  3TDQ A;  2MFI A;  3RD4 A;  1PH4 A;  1HNX L;  3GD7 A;  4JI2 L;  1TR5 A;  3S24 A;  1VCI A;  1SEB D;  2F4V Q;  4A3M H;  1PTO C;  3ND8 A;  3HOX H;  1DZ1 A;  1K8G A;  4PZ8 A;  5C0X H;  1YI2 A;  3G7L A;  5LMN L;  2L5T A;  1ASY A;  5ISR A;  5JJI A;  2HD3 A;  5GAG C;  1PTO H;  1RDP D;  3Q6S A;  4C2M H;  3E0J A;  3QO2 A;  4ODG A;  1GOZ A;  4B3T L;  2Y0S E;  4A3G G;  2X6G A;  3K80 C;  2UUA Q;  4A3D B;  1B70 B;  3F2B A;  4V0B A;  4LF7 L;  4A3K B;  1MGS A;  1TWA B;  1VQG A;  3HOW B;  4A3C H;  4QB4 A;  3HOU B;  4R4T A;  1IZ6 A;  4BBR G;  4LUO A;  1MHW C;  1LYL A;  5IT9 c;  1GUN A;  5IP9 H;  1UE6 A;  3TP7 A;  1WCM B;  2Q8I B;  3Q22 A;  2CWP A;  5I6W A;  2A6H C;  4LF4 Q;  2JJQ A;  3MWY W;  2RCN A;  3LNN A;  2MGS A;  1ASZ A;  4DR3 L;  3D4R A;  2H4O A;  1WTW A;  1NCV A;  3SE0 A;  4DNI A;  4PMB A;  4KY7 A;  3NQT A;  4TSS A;  1Z47 A;  4A3J H;  1PH2 A;  2PMZ E;  2A69 C;  3KF6 A;  5C4H A;  4BXX H;  3MXU A;  1EUJ A;  2CVR A;  2PZU A;  3E3X A;  5C4J H;  3Q24 A;  4A3B G;  3OWF A;  5C5L A;  2EVB A;  1QVC A;  2VL6 A;  2O2L D;  2R7D A;  2K5V A;  1I6H H;  2H5X A;  4KJO A;  1X54 A;  4Y7N H;  1VQJ A;  1EY5 A;  1Y8P B;  3HKZ G;  5I2Y A;  4DR7 L;  1QOH A;  3RR5 A;  2K32 A;  4IPD A;  2F0E A;  3A74 A;  3J7A V;  2Z4I A;  4IJH A;  2UXD L;  3V96 A;  3K7A B;  3A0J A;  2RSN A;  3SVM A;  1PVO A;  2EY6 A;  1WFQ A;  1EEI D;  4GNX B;  1EY4 A;  2YTV A;  2B63 B;  1HQR D;  1UE7 A;  4QCL A;  1KTK A;  1PFM A;  2ZTD A;  3JAM c;  1HXY D;  1WTX A;  1OXV A;  1N33 L;  3CKI B;  1II3 A;  1A8V A;  1D7Q A;  1CZW A;  1TWG H;  5IP7 G;  4A93 G;  5A2Q L;  1W6K A;  1OXU A;  1MIU A;  4OHJ A;  4H13 C;  3S17 B;  5K36 G;  2SEB D;  3VR6 A;  3PIO 3;  4LK1 C;  3TSS A;  1B9M A;  2QKI C;  2UU9 Q;  4AQY L;  2K5N A;  3I4N G;  4OO1 H;  1A6X A;  2OWO A;  3GDE A;  1F9R A;  2YU9 B;  2OTJ A;  3K5L A;  2NN6 H;  3AFP A;  2F0M A;  3A5Z B;  3VYS A;  2WV6 D;  4YIJ A;  3NBH B;  1DON A;  3KJP A;  5ELD A;  3FPP A;  4JI3 Q;  4IAL A;  5IYC H;  2PQA A;  4A3E B;  3K5M A;  4GZY C;  2AWN A;  4TVA B;  3U9S A;  5DM6 3;  5M5Y H;  2I5H A;  4C3H H;  2JA8 B;  4ZK9 B;  1SN8 A;  4MTN A;  2YYZ A;  5KNB A;  4LFC Q;  2AWO A;  3L2P A;  1MD2 D;  2EPB A;  3DMU A;  1CI3 M;  4B3R L;  4RGN A;  5EJW A;  1G29 1;  1S5D D;  5JJZ A;  1FGU A;  1S40 A;  2NVY B;  2PO4 A;  5EPK A;  3PF5 A;  1LV9 A;  1C48 A;  1MJE A;  1AW7 A;  4DV4 L;  2E2I H;  1PFN A;  3HOY H;  2K04 A;  1S5C D;  1VQH A;  3EQL C;  1YNJ D;  5CV7 A;  3I2Z A;  2UUB L;  4NXM Q;  1Q12 A;  1DXM A;  3MXP A;  1XTC D;  1LTR D;  1I5F A;  3IKJ A;  2NZO A;  3OW2 A;  2F0O A;  1D2B A;  4LUV A;  2IT1 A;  1LUZ A;  4POG A;  3ZYY X;  4J8Q A;  4LMQ D;  4OWW B;  1OXX K;  1IBM L;  4DR2 Q;  3GTO H;  1QIL A;  3DUZ A;  2F4V L;  4BY7 B;  1VQL A;  2K75 A;  4YWL A;  4A3D G;  2EJM A;  3TP6 A;  2A8V A;  5CV6 A;  1HNZ Q;  3NUC A;  3TEH B;  3HOW G;  1O7Z A;  3HOU G;  1QNK A;  1BXT A;  1U9R A;  3L0O A;  5JAV A;  2K28 A;  1ENC A;  1WCM G;  1E22 A;  3PIO A;  3CCL A;  3BDO A;  3CCJ A;  4YCW A;  3I56 A;  4C3I H;  3RZD B;  2RDG A;  2D9U A;  1IYV A;  3KJO A;  1K28 A;  1EFI D;  2ALY B;  4BA1 I;  5JOB A;  4G7H C;  4EQN A;  4JW0 A;  3I90 A;  5BR8 L;  5CBA E;  3GTL B;  3AYH B;  3NTH A;  3RNU A;  2L1B A;  4ILW A;  1GKH A;  1ICF B;  4J6H A;  4LF4 L;  1DYQ A;  3HOV B;  1NTG A;  5EBC A;  2JA5 B;  3S1R H;  2EE1 A;  5A35 A;  3M4P A;  2RA4 A;  2CWA A;  1U4P A;  2ZJQ A;  3O13 A;  1ZXT A;  2WKC A;  3BZD B;  3NSW A;  2HQE A;  1BCP D;  2ENB A;  1SRO A;  2VZA A;  1BVS A;  2HCC A;  3PO3 B;  1TWH H;  1JQY D;  2WKD A;  4LAA A;  2QW7 A;  1B1Z A;  1PYB A;  3J80 i;  2TSS A;  3VYT A;  4H7B A;  3M7N A;  2LXK A;  1UEB A;  1YNJ C;  2A6E D;  3I4O A;  3MFY A;  4L6T B;  4JI7 Q;  3NEM A;  4ZUI A;  5I2X A;  2F0Q A;  2Q8R E;  1UAP A;  2BH2 A;  1BQQ T;  4CGY B;  2PCF B;  3M85 A;  1LTA D;  1FNV A;  5G3L D;  4RKB A;  2MO0 A;  1SYC A;  1VQB A;  2OQK A;  3G71 A;  4JI4 L;  2EZV A;  5ELB A;  4V19 0;  3PMF A;  3CP0 A;  3G6J B;  1TS4 A;  2D0P A;  4FF3 A;  2Z8L A;  3K6O A;  3D3R A;  1BR9 A;  2HUG A;  3AB9 A;  2N78 A;  4LW1 A;  2Z1C A;  4X64 L;  1HPC A;  3FRP B;  2G9D A;  3A8I E;  3S16 B;  2E8G A;  3FKI H;  1D1I A;  2PPB C;  3S1M B;  4MZ9 A;  2JEA I;  1KAW A;  2QEJ C;  3H09 A;  5CV9 A;  1YHQ A;  1CKN A;  3MXG A;  3BZK A;  5BN5 A;  2PZT A;  4LF8 L;  4G7O C;  1D5Z C;  2L4N A;  2E5L L;  3S2D B;  1D5M C;  3I72 A;  3QIA A;  4A3E G;  5HUR A;  1RTO A;  1NY4 A;  1JJG A;  3C46 A;  3IRB A;  2NWG A;  1SJH D;  1A62 A;  5TSS A;  4PV1 C;  4C3J H;  2BCO A;  2L0C A;  2JA8 G;  3KF6 B;  1GUO A;  2RSO A;  2F0W A;  4QMG A;  3RN5 A;  4N9T A;  1RD9 D;  2RF4 A;  3UE0 A;  3U4V A;  3TP8 A;  3P7J A;  4JI3 L;  2A68 D;  2KCC A;  2F0N A;  3GTP H;  1V1P B;  1PRT C;  2DNE A;  1AZP A;  1N36 Q;  5C3W A;  5C44 B;  1DJR D;  2HIX A;  4NKL A;  1HCZ A;  3AFQ A;  1H9K A;  2RDF A;  4DNT B;  4XXE A;  1BCP C;  3J80 L;  1P8L A;  4LFC L;  1G2S A;  4RFB A;  4GOP A;  4X66 L;  1HZA A;  1XMQ Q;  2J0T D;  4C56 C;  5C0X J;  3BZC A;  4A3G H;  4A3F B;  1TU2 B;  4IPH A;  3U4Z A;  2MUY A;  1IL8 A;  2A6E C;  4RH6 A;  3BYY B;  3CRL C;  4BY7 G;  1S4Z A;  4XQN A;  4HMJ A;  1JOO A;  1NNX A;  1QCB D;  4BBR H;  3G6E A;  4NXM L;  5GAH C;  1X3G A;  2QIL A;  5L37 A;  3K5N A;  1G51 A;  3SK8 A;  1SLJ A;  4ZCK A;  1Z6H A;  2L55 A;  2MJ8 A;  4DA2 A;  4DR2 L;  1X3F A;  4K6D A;  3CW2 C;  1HHV A;  4DV3 Q;  4DAP A;  4OWT B;  4JC0 A;  1GHJ A;  1OXS C;  4G7Z C;  4IOC A;  2JA6 B;  1C8C A;  1X32 A;  3H0G B;  2OF1 A;  1HNZ L;  4CJ2 C;  3HS0 C;  4A3B H;  5ELF A;  5E4W C;  2ASB A;  1SNQ A;  3MA2 B;  1TS3 A;  1DCZ A;  2PQA B;  3CCV A;  3RZO H;  4JV5 Q;  5JEA G;  1VQK A;  3MC0 B;  4FNF A;  4L8J A;  3HOV G;  1TVX A;  2JA5 G;  1TII D;  1U5K A;  4DF7 A;  4HJ7 A;  4FDB A;  1IYU A;  5FLX E;  3ULP A;  1PYS B;  3IAY A;  2I5L X;  1PTO F;  3S1N B;  4QIW E;  3TZU A;  1LT6 D;  3PO2 B;  3GTM H;  2XWB B;  2A68 C;  1DOK A;  2BA0 A;  4IJL A;  4YCU A;  1VMP A;  1K0R A;  2PW5 A;  4B08 A;  4ZYS A;  2LFN A;  1EZ8 A;  4CDC C;  4DR1 L;  1B9N A;  1T5E A;  1UE5 A;  1SBB B;  4P73 A;  2N3S A;  4JI8 L;  4PZ6 A;  1SFO H;  3NBH A;  4BWG B;  5IP7 H;  4A93 H;  3G4S A;  5LMU Q;  1F77 A;  4GLX A;  3T13 A;  2ZXR A;  1FGB D;  5FLM G;  2B2U A;  4LJZ C;  5K36 H;  1HJP A;  3GTQ H;  2A19 A;  2KEE A;  3NEL A;  3CHB D;  1X6O A;  2MPM A;  4GN5 A;  3CCR A;  2Q2U A;  3NWT A;  4RG1 A;  3I4N H;  4POF A;  5IWA Q;  4QJF A;  4K8I A;  1PH1 A;  4JPB W;  1HFN A;  1I50 B;  1LT4 D;  1QE6 A;  3KLR A;  4QF4 A;  3KK7 A;  3M4Q A;  5ELE A;  4JI7 L;  1GM5 A;  1PMR A;  2F0S A;  5CV4 A;  1A2T A;  2PYK A;  5IYD G;  4WOR A;  2VQE Q;  1BBX C;  4LFB Q;  1B2T A;  1YJN A;  3MVV A;  1KAB A;  4XYQ A;  2R92 B;  2PNR C;  4NXN Q;  4PQX A;  4R4Q A;  1HR0 Q;  3HP3 A;  1G8Z D;  5LL6 S;  2WB1 B;  1CHQ D;  1XWE A;  3H91 A;  2DJG C;  4ID6 A;  2SNS A;  1MSG A;  1X3Q A;  4PNY A;  4DV0 Q;  3DM3 A;  4I7A A;  4NMZ A;  3UDG A;  1F2Z A;  5KEE A;  3HEJ A;  4K5X A;  3VA5 A;  4MNO A;  2KUM A;  2H1E A;  4O0A A;  3WOF A;  1MKH A;  2BH8 A;  3CPF A;  3PSI A;  5K5P A;  1EY9 A;  4OEM B;  5C44 G;  3HOZ B;  2K05 A;  2QA4 A;  1CA5 A;  3BVM A;  4GN4 B;  1BNZ A;  4RGM A;  3CPW A;  4X3U A;  3MFG A;  5JEA J;  4DGZ A;  2K5H A;  3S14 B;  2G9H D;  5JPN C;  2VNU D;  5LMN W;  2B39 A;  5IT9 E;  1NSN S;  4OX9 Q;  3STB C;  4FXK C;  4KMU C;  1EY7 A;  2YTY A;  4A3F G;  5CV8 A;  2Z4H A;  2DY7 A;  3L3O C;  5M3M B;  3AMU A;  4L5R C;  2R6G A;  4A3D H;  1N36 L;  4H44 C;  2IPK D;  1B44 D;  5ELC A;  3GTK B;  1PH9 A;  1HRJ A;  2F0V A;  1TWA H;  3HOW H;  3VYU A;  4HED A;  4GOP C;  3HOU H;  2F3I A;  4ABN A;  1ONL A;  2I46 A;  4XT1 B;  1XMQ L;  1K3B C;  3E9I A;  4HJ5 A;  4HCS A;  1WCM H;  4IQZ A;  2EYO A;  2Y0S B;  4BY1 B;  1JE4 A;  3H94 A;  1EYC A;  1RCV D;  3ER0 A;  3ZJY C;  4A3L G;  5KRU A;  4DK3 C;  2N49 A;  3T1Y Q;  1VQA A;  1K73 C;  2ICE C;  3CU7 A;  3OHX C;  1VQ7 A;  3TZD A;  3RLF A;  5C3E B;  5C3X A;  4ZQ3 A;  2ID0 A;  2JA6 G;  1XX8 A;  1H9S A;  1CKN B;  2VB2 X;  1UNS A;  4IUP A;  1PH3 A;  2R93 B;  4YY3 Q;  3HG9 A;  3FHW A;  2CCZ A;  1NAP A;  4P71 A;  4XYO A;  1OXT A;  5EPJ A;  1STE A;  1MI2 A;  1YZ6 A;  2RHS B;  3JAM E;  4NW2 A;  4GNX C;  1A2U A;  1HA5 A;  2AKW B;  1JIC A;  2PMZ B;  4X62 L;  4X65 Q;  1XPR A;  1SAP A;  1KDC A;  3W1B A;  2KOL A;  1RF2 D;  4JK1 C;  3PO2 G;  1X65 A;  5M3F B;  2E2J B;  2CHB D;  3H15 A;  1OTC A;  1JMC A;  3I55 A;  4IZ8 A;  1LAB A;  3BDC A;  4JBM A;  4CHT B;  1HZB A;  4HJ9 A;  4JBW A;  4GKJ Q;  4KKT A;  1RTN A;  5FO7 B;  4DK0 A;  1FJG Q;  4GLV B;  1I4H A;  4GOP B;  4ZRZ A;  2EYP A;  3S17 H;  1O7Y A;  1ROD A;  2K14 A;  1PFB A;  5IGE A;  3VR5 A;  3RLN A;  2F0J A;  1I4P A;  3TQY A;  3E9H A;  4F88 A;  3Q23 A;  1QJO A;  4K6L A;  1L0W A;  1YNN D;  3LWE A;  4EX5 A;  1NBW A;  5FK9 C;  2M00 A;  3CCU A;  4HJ8 A;  5LL6 X;  5LMU L;  1CT1 D;  2B2U C;  3J81 c;  1QNU A;  1VQO A;  1V1P A;  2JN4 A;  1SMY D;  1STA A;  5GQO A;  2F0G A;  3U9O A;  1H9R A;  2Z6K A;  1X56 A;  1K8O A;  4KN4 C;  4A3E H;  2R92 G;  1LTG D;  2KEN A;  3PUW A;  5IOD A;  4DN4 M;  1V9P A;  1KD1 C;  5IWA L;  3F2D A;  2NVT H;  4A3M B;  2P5Z X;  4O42 A;  4JI6 Q;  2WB1 G;  1EWC A;  2JA8 H;  4P2C B;  1EY6 A;  2XVS A;  2QDL A;  1ENA A;  1LTI D;  4DR6 L;  4Y52 H;  4HCE A;  3KYH C;  4N8F A;  1EIF A;  2KBN A;  1WD1 A;  3J7Y W;  1LTB D;  3K81 C;  2VQE L;  4LFB L;  5HY6 A;  4C2M B;  1KLG D;  1CSP A;  2DNC A;  3K7U C;  2PNH A;  2R7F A;  1H9J A;  3RUZ A;  3I7F A;  1HR0 L;  1KNE A;  1X3E A;  5FOB B;  1PH8 A;  5IYB G;  4AYB E;  3HOZ G;  4TKO B;  2E75 C;  1KHI A;  5M5X B;  4DV0 L;  4MTK A;  1ZKO A;  2B8G A;  4FXD A;  1F2L A;  3BU2 A;  1QB5 D;  2EDG A;  1Y1V G;  1EYA A;  1QG7 A;  1V1O A;  2B8F A;  4EVO A;  1JR0 D;  3EVQ A;  4CJ0 B;  2IY5 B;  4BY7 H;  1JE5 A;  3PUV A;  2IX1 A;  1SNP A;  1MBY A;  4CJ1 B;  4XDX A;  2LSS A;  1Y8N B;  5T1I A;  1LO5 D;  4WFN 3;  4JI0 Q;  1GUW A;  4IFD I;  1YJ9 A;  1S5B D;  4HSP A;  5IGG A;  3M4O B;  2OEO A;  3CD6 A;  2K7V A;  4OON A;  2WII B;  1B7Y B;  1LM0 A;  3SK6 A;  2SDF A;  4OX9 L;  1N32 Q;  2Y0S G;  4BY1 G;  1EWH A;  1EYD A;  4ME5 A;  2NZ1 D;  3C2P A;  1YNN C;  2F0U A;  1SE3 A;  4M8A A;  3ICE A;  4Y7N B;  2HDM A;  4ZKC B;  1UUP A;  4IOA A;  3HZX A;  4HIM A;  4S3S A;  5C3E G;  1SMY C;  1HZC A;  3KOJ A;  3GTL H;  4HMI A;  2WFW A;  5JEA H;  3SXH A;  1XPU A;  1Q46 A;  1D5X C;  2R93 G;  4LF6 Q;  1SDF A;  2GVB A;  3HOV H;  2JA5 H;  2VUM B;  4ZUJ A;  3T1Y L;  2RKS A;  4B9W A;  1PRT F;  1EU3 A;  1Q90 A;  4EQP A;  4GLA C;  2B2T A;  4QQB X;  1BOS A;  1YIJ A;  5IGB A;  2BDN A;  4Q0F A;  3BJU A;  4QGU A;  2F4I A;  4YY3 L;  5F2D A;  1SND A;  3GQB A;  3TME A;  4K0K Q;  4A3K G;  3D4D A;  2F0F A;  5M3F G;  1GUG A;  4JBJ A;  1B3A A;  3MTS A;  5COR A;  2V1C C;  1OO9 B;  3MEF A;  5CGK A;  5FLM H;  2F0I A;  4WJ3 M;  2JXM B;  4X65 L;  2PZW A;  1SYG A;  1BKB A;  2Z0S A;  3PF4 A;  1SNC A;  2KED A;  2WAQ E;  4F7X A;  5NUC A;  2UUA L;  3R2I A;  2EJF C;  3AQQ A;  3UDF A;  4OIK A;  1TWF B;  3A55 A;  1K8A C;  2JEB I;  4A3I B;  3RMH A;  4OWX B;  5M5Y B;  1Q1E A;  4DV1 Q;  2EYF A;  4BS9 A;  3D4W A;  4RGT A;  1TY0 A;  3OSO A;  1FJG L;  3S16 H;  1F9Q A;  2RDH A;  1NE3 A;  1IYJ B;  3CMA A;  2CH4 A;  1PA6 A;  3S1M H;  3CCS A;  1PZK D;  2KEC A;  5FLX L;  1U4M A;  4U68 A;  2FXQ A;  2L12 A;  1Q81 C;  2HHH Q;  1K83 B;  2F3V A;  3S2D H;  1LTT D;  1STN A;  2E74 C;  2C5C A;  3NTK A;  1AP0 A;  3LWU A;  1SXT A;  3HOY B;  2D2C C;  1TWC H;  5EKI A;  4FF4 A;  2RCF A;  4YHH Q;  4A3M G;  4XQQ A;  2ZT9 C;  4UDU C;  5HGT A;  1M8A A;  2VY3 A;  3HRZ C;  4RWS C;  1EYG A;  2B63 G;  1I3Q B;  1H9S B;  4RGO S;  5CYU A;  4KY6 A;  1E7Z A;  2IHE A;  4O1N A;  4P74 A;  1SSO A;  4FF2 A;  3MXN A;  2Q2T A;  2LXJ A;  1C0A A;  5KYL A;  3I4L A;  4L5S A;  3GTO B;  4UP7 A;  5C44 H;  3GTJ H;  3QOJ A;  4GN3 B;  3Q0A A;  1WTH A;  1VF5 C;  3F2U A;  5D3I B;  2A1A A;  2F52 A;  4JI6 L;  1NR4 A;  3UI2 A;  1EIY B;  1B53 A;  2WP8 J;  3S15 B;  5J22 A;  1AE3 A;  1ICW A;  5FO8 B;  3T16 A;  3QB3 A;  4QUF A;  4K5V A;  4A3F H;  4DK6 C;  4DPG A;  1Z7T A;  2JSO A;  3NK9 A;  1W2B A;  2HDL A;  3Q8D A;  1Q7Y C;  4P72 A;  3CCM A;  1VQD A;  4E6I A;  2Q2H A;  3QR8 A;  2R7Z B;  4KK7 A;  4L5T A;  4KKS A;  1Q8K A;  1ENF A;  2UU9 L;  1VQE A;  4WJW A;  5I6Y A;  4YWK A;  2B2V A;  4C1N K;  1CUK A;  3EFX D;  4A3L H;  3OIP A;  2EYM A;  3JAM i;  2EY2 A;  1CA6 A;  3I4M B;  1EEF D;  5J3B A;  5CV5 A;  5GRO A;  4JI1 Q;  2JA6 H;  2ZM6 Q;  2UUC Q;  1WTQ A;  5LHY 1;  4JI0 L;  4JYA Q;  3TS0 A;  2K1B A;  1S3O A;  4DAM A;  1UEA B;  1J5E Q;  2O5J C;  2HIV A;  5IT9 L;  5JVH 3;  1N32 L;  2TMP A;  2XRQ D;  1WTR A;  1DOM A;  2QGQ A;  2VUM G;  1W3S A;  3SR1 A;  4JCV E;  1ZYR D;  3R2T A;  1L0Y B;  3GV6 A;  3NBI A;  2K52 A;  3DEO A;  3S1N H;  4DV2 Q;  2F0P A;  4FP5 D;  5EBD A;  1GD7 A;  4DXF A;  3PO2 H;  1QUQ B;  3H3V I;  3MZ5 A;  3S2H B;  2AUK A;  2KCN A;  4BBS B;  1X55 A;  3KLS X;  4LF6 L;  1D6E C;  3ULL A;  3K57 A;  4PG3 A;  3M3Y B;  2K6A A;  1EFW A;  4P75 A;  2MHV A;  3D6W A;  1TKW B;  2NZH A;  1CKM A;  2B2T C;  5H1S E;  1YEZ A;  4QIW B;  4QY7 A;  2XWJ B;  5M5W B;  1L1O A;  4IUV A;  3S1Q B;  4JI5 Q;  4JOI A;  2K50 A; 
#chains in the Genus database with same CATH homology
 4G4K A;  3SK4 A;  1SE4 A;  4RAU C;  1GJX A;  4TQU S;  4CKE A;  3PIP 3;  1LT3 D;  1FNW A;  3X3M A;  1EZ6 A;  3I3C A;  3PV0 A;  2B2W A;  4C3J B;  3JAM L;  3EA6 A;  5EKL A;  1JC7 A;  3BVZ A;  2EY5 A;  3V2T A;  5IGD A;  1J9O A;  1HUM A;  2F0K A;  1VF7 A;  2M9V A;  5FKA C;  1JWU D;  5J1Z A;  3H3V C;  3GO5 A;  4KD3 A;  1S5F D;  2JA7 B;  1PXU A;  4HAE A;  2O4X A;  4KJN A;  2ZXP A;  3A7L A;  2LKV A;  1CK1 A;  1LLR D;  4IFD G;  2EYL A;  2DY8 A;  1L0X B;  5JVG 3;  4BBR B;  4IN3 A;  4XQJ A;  1J8I A;  5E4X A;  1LTS D;  5D14 A;  2FJ2 A;  3NPP A;  1LAC A;  3NTI A;  5KNC A;  5EGT A;  2AQ3 B;  4DNR B;  1G2T A;  5IIF A;  2XN9 C;  2FIN B;  1SYF A;  3AU7 A;  1TT2 A;  4EQO A;  4HTH A;  4ZKB B;  1CTM A;  1EL0 A;  3NXW A;  1RKN A;  2NTT A;  1CFM A;  5I4D A;  2IL8 A;  3H6M A;  2F03 A;  1GXD C;  1PTO D;  3IFD A;  4HN7 A;  1QWY A;  3P75 A;  5I9O A;  1WTO A;  3K5O A;  1F2M A;  1Q8I A;  4XT3 B;  3ND9 A;  1JOR A;  5KGU A;  1SJE D;  5DNF A;  2NVX B;  3PUX A;  3VYR A;  3QWN A;  2QF7 A;  3QJY A;  1R4P B;  1F2Y A;  5BN3 A;  3T53 B;  5C4X B;  3D8G A;  1JWS D;  5C0X I;  3OW7 A;  1SYD A;  1SFO B;  2O5I C;  4A93 B;  3T51 B;  5CR3 A;  3BS1 A;  2SOB A;  2X6L A;  3DWQ A;  1TQO A;  2DN8 A;  2WIN B;  5BN4 A;  4X3S A;  2J7Z A;  2E2H B;  2JP1 A;  1EIH A;  3J80 E;  2BOS A;  3DWP A;  1IKL A;  3SEB A;  3D31 A;  2ICI A;  3L9A X;  3EJI A;  3J81 E;  3R8B A;  1STB A;  2I07 B;  3SK5 A;  2FFK B;  2EYH A;  4CKC A;  1BO0 A;  1TS5 A;  1EU4 A;  1KAA A;  1IKM A;  1VMC A;  1X3P A;  1H9M A;  1HFG A;  5J39 A;  4BA2 I;  3NP8 A;  2F0T A;  4KTA A;  1HTP A;  3GTG B;  1EIG A;  1E0B A;  2KJX A;  2NVQ B;  3MHB A;  1Y1W B;  4WRD A;  5KIX A;  3VR2 A;  4OL7 A;  2B2W C;  3DM1 A;  1DOL A;  3A56 A;  4CKB A;  1AZQ A;  4R8I A;  1JCK B;  4XTC S;  1EY8 A;  1EOT A;  1NUC A;  3OMG A;  3K0Y A;  1R9T B;  2ZXO A;  3A7A B;  3TP5 A;  1HTL D;  3OIQ A;  1JOQ A;  1ESF A;  1CHP D;  4KD4 A;  4RCN A;  3CQZ B;  1FR3 A;  1CQV A;  3E6Z X;  3MAQ A;  4OO1 I;  1AN8 A;  4AYB B;  4DAV A;  2NN6 I;  1JB3 A;  3HOX B;  4B9X A;  2XIW A;  1T5X D;  4EGV A;  1HQM C;  5CBE E;  4KKU A;  5COY A;  1PTO B;  3N52 A;  4Q5V A;  2AQ1 B;  2E76 C;  5AFW A;  5DEH A;  2KHS A;  3FDT A;  2NBF A;  2V4D A;  3K59 A;  5FO9 B;  1A3V A;  2FMM A;  2K01 A;  1ILQ A;  4MIU A;  4RKL A;  3M4Y A;  3FEW X;  4NDX A;  1G6Z A;  3N6R A;  2OXP A;  3SHL A;  2QDB A;  3CRK C;  4X3T A;  3VR3 A;  1TS2 A;  2J4X A;  1ET6 A;  4A3J B;  2BE5 D;  5C4J B;  2PQE A;  4U67 3;  5EPL A;  2MP1 A;  5C6A A;  2GA4 B;  4KI0 A;  1I6H B;  1PZJ D;  2SNM A;  4Z9C B;  2M2L A;  3TBI B;  3PUY A;  2BDO A;  1A3T A;  3OMC A;  2NVT B;  2VXW A;  1W6J A;  4ZAI A;  4KHZ A;  4FF1 A;  1ML0 D;  1WD0 A;  4QUC A;  2JYO A;  2WAQ B;  3OWE B;  3IL8 A;  3DWA A;  1PDQ A;  1SYE A;  4RHS A;  3L7Z C;  3T4A C;  2X69 A;  1TY2 A;  3DHQ A;  1TWG B;  2IW3 A;  2N88 A;  1GHK A;  4I65 A;  1BCP F;  3A8J E;  4HR7 B;  4DAY A;  4FYD A;  2XSC A;  1BF4 A;  1CZG A;  3R93 A;  5IOC A;  1C4Q A;  2FHT A;  3QOL A;  4RCO A;  3C3L A;  1XXG A;  5EKK A;  1S5E D;  5JPM C;  1XYI A;  1STH A;  1ZEQ X;  1M4V A;  2K5Q A;  2A5H A;  4IFD H;  2AQ2 B;  5IGF A;  5CC4 A;  3ERQ A;  4K8J A;  1PYW D;  3BVG A;  5G3L F;  3I70 A;  2B2Y A;  4H0L C;  3NHH A;  3NWS A;  4C3H B;  1A3U A;  1FD7 D;  4OIJ A;  2BE5 C;  4FXG C;  4TRD A;  3D6C A;  2JE6 I;  2KA7 A;  3ERO A;  2NB0 A;  1STY A;  1BUV T;  1HUN A;  1HA6 A;  1VDZ A;  5C4Z A;  5D3D A;  5D65 A;  1LT5 D;  1V8Q A;  1E2V A;  4FVM A;  1BDO A;  2E2I B;  1B4O A;  5KYI A;  4KV6 A;  1O78 A;  2CQA A;  3R3O A;  4X3K A;  2EXZ A;  2F0D A;  5C0X G;  1U4R A;  1AFP A;  1ILP A;  2RQX A;  1PRT D;  4I7Z C;  3DEP A;  5T1G A;  1E2Z A;  2KQ3 A;  1E2W A;  4G57 A;  1V43 A;  4K5W A;  1RJT A;  2KVM A;  3M7G A;  2FMC A;  2OT2 A;  3KBX A;  2XNA C;  4ZLT F;  5IGC A;  4IUT A;  4DFA A;  1I4X A;  1FYC A;  3VA7 A;  1GUT A;  1MSH A;  4C3I B;  5A2Q E;  1F9P A;  2NUC A;  1KDA A;  1JWM D;  3MEH A;  2LS0 1;  4OGQ C;  2R61 A;  2NYZ D;  2RBM A;  2C9O A;  3S1R B;  1A15 A;  1GUS A;  3VR4 A;  1KNA A;  3W2D A;  3I73 A;  1Y8O B;  1TWC B;  2WAC A;  3A8K E;  2K33 A;  1ESR A;  1TWH B;  3P1H A;  1WVL A;  2BA1 A;  1CM9 A;  3TN2 A;  1STG A;  2F0H A;  2IX3 A;  4UAI A;  3GTJ B;  3GV3 A;  3FPU B;  1I4R A;  3OPO A;  4HSV A;  3KUP A;  1WTV A;  1SYB A;  3IFT A;  2A74 C;  2CW0 D;  3J81 L;  3V05 A;  3ITP A;  3NE5 B;  3KLS A;  4N9P A;  4OO1 G;  2NN6 G;  3FKI B;  2LMC B;  5KND A;  2NTS A;  2F3W A;  1I4G A;  3I8Z A;  3ONA B;  1SNM A;  4IUR A;  1DM0 B;  1EQT A;  3I91 A;  3BDL A;  3NQI A;  4K2K A;  2D62 A;  5EQ0 A;  4C3H G;  4IUQ A;  2IWH A;  4J1M A;  4R9W A;  2L11 A;  3FVQ A;  3SDZ A;  3WDN A;  4IUN A;  3GTP B;  2B2Y C;  1FNU A;  3C1F A;  2K03 A;  4ULL A;  4RA8 A;  5M9O A;  4IUU A;  2IX0 A;  1PLF A;  1PRT B;  1B50 A;  3OOC A;  3K58 A;  2PW7 A;  3J7A F;  4A3G B;  1BCP B;  4KY5 A;  4MHE A;  2VB3 X;  1Q1B A;  5CMD A;  2Q8T A;  1D1K A;  1SE2 A;  1ZYR C;  2IJ0 A;  1Q3L A;  3LX0 A;  2QCP X;  1G91 A;  3A54 A;  1U4L A;  1NR2 A;  4KN7 C;  4FO2 A;  3FMC A;  3KF8 A;  3T56 B;  3P20 A;  1PZI D;  1IW7 D;  2CW0 C;  4PMW A;  4C1N I;  2RVL A;  3WOE A;  2EJG C;  3KBG A;  1K8M A;  4DXG A;  4C3I G;  4CBV A;  1IHZ A;  2XRS D;  1KDB A;  4A3B B;  1O7L A;  2F1M A;  4F87 A;  1SNO A;  3E5S A;  1DD2 A;  3RZO B;  4RHR A;  1JOK A;  3GP7 A;  3HKZ B;  2K5W A;  3URY A;  1I4Q A;  5E3F A;  2B2V C;  3BG3 A;  3BYT B;  2EOT A;  3GTM B;  4NP5 A;  2AUJ D;  3HGB A;  2L9H A;  1KLU D;  3C1E A;  2N55 A;  1R4Q B;  2E2D C;  3DXJ C;  5I9P A;  4K2L A;  3GTQ B;  3W3A A;  1AEX A;  3QG1 A;  3S9W A;  2A6H D;  3I4N B;  5DM7 3;  1Y1V B;  2R3Z A;  3PUZ A;  3X3N A;  2EYJ A;  4PMC A;  1Y69 U;  4R8N A;  4M1U B;  4L63 B;  1I6V C;  4K14 A;  1ET9 A;  2A69 D;  5DAU A;  2F0L A;  1IW7 C;  4DK1 A;  1CQF A;  5C5M A;  4IFD J;  1F9S A;  1O80 A;  5E1F A;  2LY7 A;  1WTP A;  2D5D A;  1EQV A;  1RHP A;  2HCI A;  2A73 B;  4KHV A;  4C3J G;  2K5D A;  4MN3 A;  4DU9 A;  2EY1 A;  4F8M A;  4XIG S;  1EY0 A;  3TDQ A;  3RD4 A;  3GD7 A;  1TR5 A;  1VCI A;  1SEB D;  1PTO C;  3ND8 A;  1DZ1 A;  5C0X H;  3G7L A;  2L5T A;  5ISR A;  1PTO H;  1RDP D;  3Q6S A;  3E0J A;  3QO2 A;  4ODG A;  1GOZ A;  2X6G A;  4A3D B;  4V0B A;  4A3K B;  1MGS A;  1TWA B;  3HOW B;  4QB4 A;  3HOU B;  1GUN A;  3TP7 A;  1WCM B;  2Q8I B;  3Q22 A;  5I6W A;  2A6H C;  3MWY W;  3LNN A;  2MGS A;  3D4R A;  2H4O A;  1WTW A;  1NCV A;  3SE0 A;  4PMB A;  4KY7 A;  3NQT A;  4TSS A;  1Z47 A;  5C4H A;  2A69 C;  3MXU A;  2CVR A;  2PZU A;  3Q24 A;  3OWF A;  5C5L A;  2EVB A;  2O2L D;  4KJO A;  1EY5 A;  1Y8P B;  5I2Y A;  1QOH A;  2K32 A;  2F0E A;  3J7A V;  2Z4I A;  3V96 A;  3K7A B;  2RSN A;  3SVM A;  2EY6 A;  1EEI D;  1EY4 A;  2B63 B;  1HQR D;  4QCL A;  1KTK A;  1PFM A;  1HXY D;  1WTX A;  1OXV A;  3CKI B;  1II3 A;  1CZW A;  5A2Q L;  1W6K A;  1OXU A;  4OHJ A;  4H13 C;  3S17 B;  5K36 G;  2SEB D;  3VR6 A;  3PIO 3;  4LK1 C;  3TSS A;  1B9M A;  2QKI C;  4OO1 H;  1A6X A;  2YU9 B;  1F9R A;  3K5L A;  2NN6 H;  2F0M A;  3VYS A;  2WV6 D;  4YIJ A;  1DON A;  5ELD A;  3FPP A;  4IAL A;  4A3E B;  3K5M A;  4GZY C;  2AWN A;  3U9S A;  5DM6 3;  2JA8 B;  4ZK9 B;  2YYZ A;  5KNB A;  2AWO A;  1MD2 D;  2EPB A;  3DMU A;  1CI3 M;  4RGN A;  5EJW A;  1G29 1;  1S5D D;  5JJZ A;  2NVY B;  2PO4 A;  5EPK A;  1LV9 A;  1C48 A;  1AW7 A;  1PFN A;  2K04 A;  1S5C D;  3EQL C;  1YNJ D;  5CV7 A;  1Q12 A;  1DXM A;  3MXP A;  1XTC D;  1LTR D;  3IKJ A;  1D2B A;  2F0O A;  2IT1 A;  3ZYY X;  4J8Q A;  4LMQ D;  1OXX K;  1QIL A;  3DUZ A;  4BY7 B;  2EJM A;  3TP6 A;  5CV6 A;  3NUC A;  1O7Z A;  1QNK A;  1BXT A;  1U9R A;  5JAV A;  2K28 A;  1ENC A;  3BDO A;  3RZD B;  2RDG A;  2D9U A;  1IYV A;  1EFI D;  4BA1 I;  5JOB A;  4G7H C;  4EQN A;  3I90 A;  3GTL B;  5CBA E;  3NTH A;  2L1B A;  4ILW A;  4J6H A;  1DYQ A;  3HOV B;  5EBC A;  2JA5 B;  2EE1 A;  5A35 A;  2RA4 A;  1U4P A;  3O13 A;  1ZXT A;  2WKC A;  3BZD B;  3NSW A;  2HQE A;  1BCP D;  2ENB A;  2HCC A;  3PO3 B;  1JQY D;  2WKD A;  4LAA A;  1B1Z A;  2TSS A;  3VYT A;  4H7B A;  3M7N A;  1YNJ C;  2A6E D;  3MFY A;  4L6T B;  4ZUI A;  5I2X A;  2F0Q A;  2Q8R E;  1UAP A;  1BQQ T;  4CGY B;  2PCF B;  3M85 A;  1LTA D;  1FNV A;  5G3L D;  4RKB A;  1SYC A;  2EZV A;  5ELB A;  4V19 0;  3PMF A;  3G6J B;  1TS4 A;  4FF3 A;  2Z8L A;  3K6O A;  3D3R A;  1BR9 A;  2HUG A;  3AB9 A;  2Z1C A;  1HPC A;  3FRP B;  2G9D A;  3A8I E;  3S16 B;  2PPB C;  1D1I A;  3S1M B;  2JEA I;  2QEJ C;  5CV9 A;  3H09 A;  3MXG A;  5BN5 A;  2PZT A;  4G7O C;  1D5Z C;  2L4N A;  3S2D B;  1D5M C;  3I72 A;  3QIA A;  5HUR A;  1RTO A;  3C46 A;  2NWG A;  1SJH D;  5TSS A;  4PV1 C;  2BCO A;  2L0C A;  1GUO A;  2RSO A;  2F0W A;  4QMG A;  4N9T A;  1RD9 D;  3TP8 A;  3P7J A;  2A68 D;  2KCC A;  2F0N A;  1V1P B;  1PRT C;  2DNE A;  1AZP A;  5C3W A;  5C44 B;  1DJR D;  4NKL A;  1HCZ A;  1H9K A;  2RDF A;  4DNT B;  4XXE A;  1BCP C;  3J80 L;  1G2S A;  4RFB A;  2J0T D;  4C56 C;  5C0X J;  4A3F B;  1TU2 B;  2MUY A;  1IL8 A;  2A6E C;  4RH6 A;  3BYY B;  3CRL C;  1S4Z A;  4XQN A;  4HMJ A;  1JOO A;  1QCB D;  2QIL A;  3K5N A;  3SK8 A;  1Z6H A;  2L55 A;  2MJ8 A;  4DA2 A;  4K6D A;  1HHV A;  4DAP A;  1GHJ A;  1OXS C;  4G7Z C;  2JA6 B;  1C8C A;  1X32 A;  3H0G B;  2OF1 A;  4CJ2 C;  3HS0 C;  5ELF A;  5E4W C;  1SNQ A;  3MA2 B;  1TS3 A;  1DCZ A;  5JEA G;  3MC0 B;  4FNF A;  4L8J A;  1TVX A;  1TII D;  4DF7 A;  1IYU A;  5FLX E;  3IAY A;  1PTO F;  3S1N B;  3TZU A;  1LT6 D;  3PO2 B;  2XWB B;  2A68 C;  1DOK A;  2BA0 A;  1VMP A;  2PW5 A;  4B08 A;  4ZYS A;  2LFN A;  1EZ8 A;  1B9N A;  1T5E A;  1SBB B;  3NBH A;  4BWG B;  1F77 A;  3T13 A;  2ZXR A;  1FGB D;  2B2U A;  4LJZ C;  5K36 H;  2KEE A;  3CHB D;  2MPM A;  3NWT A;  4K8I A;  1HFN A;  1I50 B;  1LT4 D;  1QE6 A;  3KLR A;  4QF4 A;  3KK7 A;  5ELE A;  1PMR A;  2F0S A;  5CV4 A;  1A2T A;  2PYK A;  4WOR A;  1B2T A;  1BBX C;  3MVV A;  1KAB A;  4XYQ A;  2R92 B;  2PNR C;  4PQX A;  3HP3 A;  1G8Z D;  5LL6 S;  2WB1 B;  1CHQ D;  1XWE A;  3H91 A;  4ID6 A;  2SNS A;  1MSG A;  1X3Q A;  4PNY A;  4NMZ A;  5KEE A;  1F2Z A;  3HEJ A;  4K5X A;  3VA5 A;  2KUM A;  2H1E A;  3WOF A;  5K5P A;  1EY9 A;  3HOZ B;  2K05 A;  1CA5 A;  3BVM A;  1BNZ A;  4RGM A;  4X3U A;  3MFG A;  5JEA J;  4DGZ A;  3S14 B;  2G9H D;  5JPN C;  2VNU D;  2B39 A;  5IT9 E;  1NSN S;  4FXK C;  4KMU C;  1EY7 A;  5CV8 A;  2Z4H A;  2DY7 A;  3L3O C;  5M3M B;  3AMU A;  2R6G A;  4H44 C;  2IPK D;  1B44 D;  5ELC A;  3GTK B;  1HRJ A;  2F0V A;  3VYU A;  4HED A;  4ABN A;  1ONL A;  2I46 A;  4XT1 B;  4HCS A;  4IQZ A;  2EYO A;  2Y0S B;  4BY1 B;  1JE4 A;  3H94 A;  1EYC A;  1RCV D;  5KRU A;  2ICE C;  3CU7 A;  3OHX C;  3TZD A;  3RLF A;  5C3E B;  5C3X A;  4ZQ3 A;  2ID0 A;  1XX8 A;  1H9S A;  2VB2 X;  1UNS A;  4IUP A;  2R93 B;  3HG9 A;  1NAP A;  4XYO A;  1OXT A;  5EPJ A;  1STE A;  1MI2 A;  3JAM E;  4NW2 A;  1A2U A;  1HA5 A;  1JIC A;  2PMZ B;  1SAP A;  1KDC A;  2KOL A;  1RF2 D;  4JK1 C;  5M3F B;  2E2J B;  2CHB D;  4IZ8 A;  1LAB A;  3BDC A;  4CHT B;  4JBW A;  4KKT A;  1RTN A;  5FO7 B;  4DK0 A;  1I4H A;  4ZRZ A;  2EYP A;  1O7Y A;  1ROD A;  5IGE A;  1PFB A;  3VR5 A;  2F0J A;  1I4P A;  4F88 A;  3Q23 A;  1QJO A;  4K6L A;  1YNN D;  3LWE A;  5FK9 C;  2M00 A;  5LL6 X;  1CT1 D;  2B2U C;  1QNU A;  1V1P A;  1SMY D;  1STA A;  2F0G A;  3U9O A;  1H9R A;  1K8O A;  4KN4 C;  1LTG D;  3PUW A;  5IOD A;  4DN4 M;  4A3M B;  4O42 A;  1EWC A;  4P2C B;  1EY6 A;  2XVS A;  1ENA A;  1LTI D;  4HCE A;  1WD1 A;  3J7Y W;  1LTB D;  4C2M B;  1KLG D;  2DNC A;  1H9J A;  3RUZ A;  1KNE A;  5FOB B;  4TKO B;  2E75 C;  5M5X B;  1ZKO A;  2B8G A;  4FXD A;  1F2L A;  1QB5 D;  2EDG A;  1QG7 A;  1EYA A;  1V1O A;  2B8F A;  4EVO A;  1JR0 D;  3EVQ A;  4CJ0 B;  3PUV A;  2IX1 A;  1SNP A;  1MBY A;  4CJ1 B;  4XDX A;  1Y8N B;  5T1I A;  1LO5 D;  4WFN 3;  1GUW A;  4IFD I;  1S5B D;  4HSP A;  5IGG A;  3M4O B;  2OEO A;  2K7V A;  2WII B;  3SK6 A;  2SDF A;  1EWH A;  1EYD A;  4ME5 A;  2NZ1 D;  3C2P A;  1YNN C;  2F0U A;  1SE3 A;  4M8A A;  4Y7N B;  2HDM A;  4ZKC B;  1UUP A;  3HZX A;  4S3S A;  1SMY C;  4HMI A;  5JEA H;  3SXH A;  1D5X C;  1SDF A;  2VUM B;  4ZUJ A;  2RKS A;  4B9W A;  1PRT F;  1EU3 A;  1Q90 A;  4EQP A;  2B2T A;  1BOS A;  5IGB A;  2BDN A;  4Q0F A;  2F4I A;  5F2D A;  1SND A;  3GQB A;  3TME A;  3D4D A;  2F0F A;  1GUG A;  1B3A A;  3MTS A;  5COR A;  1OO9 B;  5CGK A;  2F0I A;  2JXM B;  2PZW A;  1SYG A;  1SNC A;  2KED A;  4F7X A;  5NUC A;  3R2I A;  2EJF C;  4OIK A;  1TWF B;  3A55 A;  2JEB I;  4A3I B;  3RMH A;  5M5Y B;  1Q1E A;  2EYF A;  4BS9 A;  3D4W A;  4RGT A;  1TY0 A;  3OSO A;  1F9Q A;  2RDH A;  1PZK D;  2KEC A;  5FLX L;  1U4M A;  4U68 A;  2L12 A;  1K83 B;  2F3V A;  1LTT D;  1STN A;  2E74 C;  2C5C A;  3NTK A;  1AP0 A;  3LWU A;  1SXT A;  3HOY B;  2D2C C;  5EKI A;  4FF4 A;  4XQQ A;  2ZT9 C;  4UDU C;  5HGT A;  1M8A A;  3HRZ C;  4RWS C;  1I3Q B;  1H9S B;  4RGO S;  5CYU A;  4KY6 A;  4O1N A;  4FF2 A;  1SSO A;  3MXN A;  5KYL A;  3I4L A;  3GTO B;  3Q0A A;  3QOJ A;  1VF5 C;  3F2U A;  5D3I B;  1NR4 A;  3UI2 A;  1B53 A;  2WP8 J;  3S15 B;  5J22 A;  1ICW A;  5FO8 B;  3T16 A;  3QB3 A;  4QUF A;  4K5V A;  1Z7T A;  2JSO A;  3NK9 A;  2HDL A;  4E6I A;  2R7Z B;  4KK7 A;  4KKS A;  1ENF A;  4WJW A;  5I6Y A;  2B2V A;  4C1N K;  3EFX D;  3OIP A;  2EYM A;  2EY2 A;  1CA6 A;  3I4M B;  1EEF D;  5CV5 A;  1WTQ A;  5LHY 1;  2K1B A;  1UEA B;  2O5J C;  5IT9 L;  5JVH 3;  2TMP A;  2XRQ D;  1WTR A;  1DOM A;  3SR1 A;  1ZYR D;  3R2T A;  1L0Y B;  3GV6 A;  3NBI A;  3DEO A;  2F0P A;  4FP5 D;  4DXF A;  5EBD A;  3S2H B;  3MZ5 A;  2AUK A;  2KCN A;  4BBS B;  3KLS X;  1D6E C;  3K57 A;  3M3Y B;  2K6A A;  2MHV A;  3D6W A;  1TKW B;  2B2T C;  4QIW B;  2XWJ B;  5M5W B;  4IUV A;  3S1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...