3T13A

Crystal structure of staphylococcal nuclease variant delta+phs a69g at cryogenic temperature
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENGKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A69G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 40
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t13A00
4ZUJA 1ENAA 4PMCA 5KEEA 1JORA 1SYEA 4KY6A 1STNA 2OXPA 2F0KA 3DMUA 4WRDA 3LX0A 5KIXA 4KJNA 4IALA 4K5WA 4B9XA 5KRUA 1STAA 2EYOA 1F2MA 3ERQA 5IGDA 2EYPA 2PYKA 3DHQA 3RUZA 1A3UA 4IZ8A 5E3FA 3HEJA 2PZWA 4PNYA 5J22A 2LKVA 5DAUA 4J1MA 2PW5A 5IODA 1SYCA 5J1ZA 4LAAA 3MVVA 3SXHA 1EY9A 3OWFA 2F0OA 1EY7A 1SYFA 1TQOA 2EY2A 1AEXA 2EYHA 2F0HA 5CV9A 1IHZA 2OF1A 3SK5A 4H7BA 2PQEA 5C4HA 5CGKA 5KGUA 1NSNS 1SYGA 2F0FA 4PMBA 3QB3A 1SNMA 2EYMA 2F0NA 4QB4A 4R8NA 4F7XA 1TR5A 5C6AA 5C5LA 5CC4A 1EY6A 5KYIA 4G57A 5K5PA 2EYLA 2SNSA 2F0GA 1SNPA 2PZUA 4K2KA 2M00A 1STBA 3NHHA 4EQNA 3R3OA 4KV6A 2KQ3A 3QOJA 4N9PA 3VA5A 2HQEA 3TP7A 2RBMA 3NQTA 3S9WA 3D6CA 1EY8A 1KDCA 1KAAA 2F0IA 4K6DA 1STYA 5ISRA 3D4WA 5C5MA 5I6YA 5IOCA 3NUCA 2SOBA 3QOLA 2EXZA 3OMGA 3HZXA 2F0EA 3PMFA 5JOBA 4E6IA 5J39A 1SNCA 4F8MA 3TP5A 1STGA 4ME5A 5C3WA 1STHA 1EY5A 2F0PA 4HTHA 3T13A 5I9OA 4KD4A 3C1FA 2F0TA 2F0LA 1KABA 4MIUA 1A3VA 4WORA 1EYDA 2F3VA 4TRDA 4NKLA 2EY6A 4K14A 3EVQA 4J6HA 4NDXA 4ZUIA 1SNOA 4QMGA 1SNDA 3SK4A 1U9RA 5IGCA 2ENBA 3MEHA 4RKLA 5NUCA 3SHLA 1SYDA 4K8IA 3NP8A 2WACA 4OL7A 1EY4A 1JOKA 3TP6A 4K2LA 5CV7A 1SNQA 1A2UA 1A2TA 3C1EA 4N9TA 3SK6A 4KD3A 3V2TA 4EQOA 5IGEA 5I6WA 5I9PA 5DEHA 5HURA 3T16A 3OSOA 4S3SA 1JOQA 5CR3A 5C4ZA 4ODGA 1JOOA 5CV8A 2KHSA 3P1HA 1EYAA 1F2ZA 2SNMA 2F0JA 2QDBA 4IUNA 2EY5A 2F0SA 2F3WA 1EZ6A 5HGTA 3EJIA 4HMJA 1EYCA 3SR1A 4ZQ3A 5E1FA 4K8JA 4NMZA 4K5XA 5EGTA 4EQPA 2EYJA 3MZ5A 4DFAA 4DF7A 4ID6A 3TP8A 4KHVA 4RKBA 1II3A 2F0DA 1F2YA 5IGBA 2F0MA 3NK9A 4KJOA 4HMIA 4I65A 5CV5A 1A3TA 2F0VA 3H6MA 5IGFA 3SK8A 4B9WA 3MXPA 4YIJA 1TT2A 4QF4A 4DGZA 4KY7A 2RDFA 4KY5A 2O4XA 3P75A 2PZTA 2OEOA 1EY0A 4NP5A 5KYLA 3TMEA 1KDAA 1KDBA 2F0UA 3D4DA 3NXWA 5IGGA 1ENCA 2EYFA 2NUCA 3D8GA 5CV4A 5EKKA 3U9OA 5C3XA 5M9OA 3ITPA 1RKNA 3BDCA 4KTAA 4DU9A 4EVOA 3EROA 3E5SA 5CV6A 4K5VA 5EKLA 2F0WA 1NUCA 2RKSA 2F0QA 1EZ8A 3OMCA 5F2DA 5IIFA 3BDLA 2PW7A 3MHBA 1SYBA 1EQVA 2EY1A 5JAVA
chains in the Genus database with same CATH superfamily
2IW3A 3NPPA 3RLNA 2NN6G 4WRDA 5CBAE 3H3VH 1TIID 4K5WA 1G51A 1LTBD 3IFTA 1JJCB 3MEFA 1TKWB 2LFNA 2K01A 4YWKA 2K03A 4Q5VA 2KEDA 3UDIA 1VQIA 4BBRG 4A3IG 2F52A 5IODA 2NZHA 1MSHA 3ER0A 1SYCA 4IO9A 4JYAQ 1Q81C 3RZOB 1SLJA 4KN7C 2BA0A 3T51B 4JYAL 2NBFA 3T13A 2ZJRA 3KFUA 3O13A 4L5SA 2DGYA 3MFGA 4O1NA 4DR3Q 2Z9HA 1SE4A 4IUQA 5EBCA 3MXUA 1EEFD 4DR3L 3OW2A 2M00A 1VQHA 4ZYSA 3KF8A 4N9PA 2XGTA 3R93A 1PYSB 3K6OA 4P71A 4YY3Q 4YY3L 4UP7A 4R4QA 4OXPA 1FYCA 2NTTA 5FLXE 1L0YB 1FJGQ 2K14A 2VS1A 4A3LH 5IGCA 1KTKA 2HCIA 1GUNA 1FJGL 2K52A 1I4PA 2DNCA 5CV7A 2GN5A 1KNEA 3T16A 2Y0SG 3JAME 1LTGD 1MJCA 2EPBA 2FJ2A 1F2ZA 3VYUA 2F3WA 2NVQH 1PH1A 1V1PA 1EYCA 2LXKA 2K1BA 1RODA 4L5RC 1TU2B 1Y1VB 3I90A 4QUCA 4HSPA 4R4CA 2D9UA 4KJOA 4KI0A 4HJ9A 1SMYC 4I65A 4F88A 5M5XH 4HIKA 1QG7A 4DGZA 5IYBG 2G5DA 1EQRA 3CD6A 3TMEA 1KDAA 4P72A 2ALYB 1JR0D 4KN4C 1L0WA 2E75C 2EZVA 1EOVA 3CC4A 3J81E 1BR9A 4JBWA 1AN8A 4GN4B 2G9DA 1Y14B 4JC0A 3MHBA 2JA7G 5BN4A 4ZUJA 2HIVA 3BZDB 1VQAA 1WCMH 1LUZA 3CC7A 3RN2A 2R92H 1A3UA 3HG9A 2EDGA 5JEAJ 1X55A 1XTCD 4KKUA 4JI1Q 1YJ9A 3K8AA 1CQFA 3MVVA 1PA6A 1X3PA 1YHAA 4JI1L 2R7ZB 3P7JA 2VQEQ 1WTVA 2GVAA 2VW9A 1IBLQ 4B3MQ 3M7NA 2NB0A 1SMYD 3GTKB 3FMCA 1HQMC 4A3DB 2VQEL 1IBLL 4B3ML 5CC4A 1HNZQ 2C5CA 2LY7A 4H02A 4R4IA 4G57A 4TQUS 3NENA 1HNZL 3EA6A 2B2UC 3D4WA 1EQQA 3CRLC 4C3IB 3BJUA 4HIOA 2ID0A 2B2TA 2R61A 4DK6C 1DONA 4B08A 2R6GA 1UEBA 1ZXTA 1U5KA 5IWAQ 1VF5C 3S14H 1N8RC 2E76C 5IWAL 2XWJB 4LUOA 2A6HD 2A5HA 3ULJA 3NWTA 3V2TA 4HR7B 4KMUC 3QR8A 2LSSA 4DV6Q 2Q2UA 3TREA 4IQZA 3MXNB 4CDEC 5LHY1 4C1NK 4DV6L 2Q2TA 4A3FH 3HOXB 3SR1A 3TS0A 1DOMA 1N32Q 4A3LG 3KBXA 1S4ZA 1N32L 1Y1WB 5M3MB 3BU2A 4ME3A 1Q3LA 3K57A 3DWPA 3S2HB 4IPDA 2OEOA 3RLFA 5KYLA 2Z1CA 5CV4A 2WAQG 2E5LQ 3VDYA 1V43A 3BDCA 1X54A 4QJFA 1PMRA 1Z47A 5H1SE 1EIYB 4MTKA 2E5LL 1X32A 1M8AA 1CQVA 2L4NA 3S1MH 4FF1A 2F0QA 1PLFA 1KLUD 2CCZA 1TWGB 3I56A 4LNQA 1VQEA 4G7OC 1XPRA 2QCPX 1AZQA 3LX0A 5LMUQ 3I8ZA 1I4RA 4A3GG 2EYOA 1TWHB 3MFYA 1U4MA 1YEZA 5LMUL 3VR5A 1KIXA 2HHHQ 5BN5A 4DAVA 2AHOB 2DY7A 2HHHL 4POGA 2JA6H 1L0XB 4CDFC 2F0OA 2RSNA 1OXSC 5CV9A 2I5LX 2RVLA 1WCMG 3CCJA 4HCSA 2L9HA 3L0OA 1F77A 1NNXA 2F4IA 3GTJH 3GV3A 2A1AA 2A74C 2EXDA 2KCTA 2D0OA 3NTIA 2V4DA 3AFQA 1K83B 1KC8C 3RZOH 4HJ7A 2B3GA 4G7ZC 2B2WA 3K0YA 1PRTC 4JI8Q 5ISRA 1DD2A 5IOCA 2AUJD 4LFBQ 2BH2A 2PMZE 3QOLA 3Q6SA 3PUZA 4O0AA 4JI8L 1PH7A 3I4MG 1E2WA 3C46A 4LFBL 4RHSA 1L2FA 1KD1C 4FO2A 4Z9CB 2F0LA 2GA4B 3IL8A 3BS1A 1G8ZD 1VS0A 3HOUB 3EVQA 1VQ5A 1Y69U 2NVTH 3MEHA 4RKLA 2RSOA 3I72A 1OO9B 1UE5A 2WACA 4CBVA 3CQZB 3FPUB 2DN8A 3N52A 1TWFH 1Y8PB 1SNQA 1A2UA 3S1RH 4Q0FA 4GN5A 1HZBA 2FFKB 2AQ1B 1HTPA 3NSWA 2SEBD 1GXDC 2WB1E 3OW7A 5T1IA 3M4OB 2NZ1D 3PO2H 2HT1A 4EQPA 1ET9A 4DF7A 4YCWA 3H3VC 1IBKQ 3F2DA 2QGQA 4A3MB 1F2YA 2XVSA 1IBKL 1NR4A 1MSGA 4DV2Q 5FO7B 1SJHD 4XT3B 2I5MX 1KXLA 4DV2L 1VQBA 2A68C 2I07B 3PIPA 3BYYB 3BVGA 2B39A 1ESFA 4RA8A 4FYDA 2HCCA 4A3FG 1I6VC 1VQ7A 4KTAA 3I4NB 2RKSA 3TS2A 1OTCA 2E8GA 4QMGA 2AUKA 4HN7A 3S1QB 2XTIA 3DMUA 3EFXD 4QIWE 5C0XI 1XWEA 1Q90A 1EYGA 2EYPA 4QGUA 1I5FA 1NMGA 4AIMA 1WJJA 5E4XA 5C3EB 5GAEC 2E2JH 4LAAA 3S1NB 4NPSA 1K8AC 2F1MA 3PUYA 5LL6S 1ENFA 1SYGA 1TR5A 2B2TC 2A68D 2NZOA 4IFDI 1STBA 4H0LC 1ONLA 4C56C 2JA6G 1BXTA 1FD7D 1SROA 4IUVA 4BY7B 3FRPB 1BDOA 3D0FA 3KDFB 1KAAA 3P20A 4XT1B 4CGYB 3KF6B 1STYA 2R7ZH 5A35A 3RNUA 4A3KH 1CKOA 3ND8A 1SE2A 1SNCA 3KJOA 3GTKH 1LTID 1FNWA 4LF5Q 1VQKA 1FL0A 2CWPA 2XSCA 4LF5L 4OHJA 1ILPA 1J9OA 3SHLA 1SBBB 3C3LA 4KHPQ 3PGZA 1HZAA 3CXCA 3SK6A 5I9PA 5DEHA 1KAWA 4KHPL 4ODGA 1GOZA 4PZ7A 4IUNA 1EYAA 5C0XH 3Q23A 2XIWA 1IKMA 2RDHA 1YNXA 4JCVE 2V1CC 1D5MC 2IY5B 1PVOA 4Y7NB 1NAPA 5FLMH 5CV5A 4MZ9A 1WOCA 2YTVA 3Q0AA 1Q8KA 1BCPF 2ZJQA 4JV5Q 5EPKA 1TWAH 2XNAC 3A55A 3PO2G 4X3UA 5GAGC 1YHQA 1F2LA 2C9OA 4DXGA 3GTMB 4JV5L 2KCCA 2VXWA 3U4VA 2L12A 4IFDH 5ELOA 1E2ZA 2K05A 2EIFA 4ZAIA 4OO1I 1EU4A 5KEEA 1S3OA 1JE5A 5AFWA 5CMDA 1LT4D 1HRJA 1IYVA 3K80C 2I5HA 4BA1I 2D62A 2PI2E 4X3KA 1H9SA 1WTWA 4OX9Q 2PYKA 3FEWX 1CHQD 4P75A 4OX9L 3FDTA 1PFMA 4HJ8A 3T4AC 4R9WA 3K7UC 1I94Q 1I94L 4IOAA 2PQEA 2B2WC 2JEBI 3SE0A 5C4JB 5JJLA 3A56A 1B53A 4A3EB 4QB4A 1LTLA 4A3BH 4L5TA 4K6LA 1CT1D 4V0BA 5COYA 1VQOA 5M3FG 2SDFA 2KQ3A 2MP1A 2UUBQ 1GHJA 1JWSD 1C7YA 4N8X1 1O80A 4DK1A 1ASYA 2UUBL 3FP9A 1ZYRC 1X56A 1WTHA 1D6EC 1U4PA 1Y8NB 2YTYA 3PMFA 2KVMA 3TP5A 1BKBA 2NYZD 5I9OA 4EQOA 1VQGA 4BY1B 1G6PA 3GV6A 5FO8B 4CDCC 5M5WB 3OTOQ 3CPWA 3VYTA 3TP6A 4RG1A 4DV4Q 3OTOL 1Y8OB 2B63G 1K83H 4OO1H 2K50A 3LGJA 1HQRD 2R7ZG 4DV4L 1UWVA 4A3KG 1FR3A 2MO1A 2JSOA 3KLSX 5ELEA 3IAYA 2E2IB 2K5NA 3QO2A 1LTRD 4DV3Q 1YBYA 4GLAC 4DV1Q 4RKBA 4DN4M 4DV3L 2GVBA 3HKZE 4DV1L 4A4IA 1IL8A 3OIQA 5I4DA 1B9MA 2MNAA 3CF5A 3OPOA 3CQZH 2E2HB 3BG3A 1OXTA 2DJGC 1K8OA 1B70B 3ZYYX 2ES2A 1BCPD 5C0XG 2MQHA 1HNWQ 1VDZA 1XX8A 2F0UA 1ZYRD 4JOIA 5CYUA 1HNWL 3NEMA 2Q2HA 2A19A 1EEID 1BCPB 1WTRA 2CFMA 2JA8B 3TQYA 5FLMG 2CVRA 1Q8IA 1IYJB 3R8BA 4GNXA 2CKZB 2K7VA 1ILQA 1I50B 4PMCA 2B8FA 4NXMQ 2F0KA 3CCMA 5JVH3 5C4XB 1SAPA 4XTCS 2VY3A 4A3JB 4NXML 3HOWB 3N6RA 4OWXB 1X3FA 2F4VQ 1BO0A 5GADC 3DXJC 1M90C 1P8LA 2K6AA 4BBSB 2F4VL 3I7FA 4LFCQ 5ELBA 4IFDG 3I4NH 2JA5B 1EY9A 4LFCL 2JK8A 1TS2A 1EIFA 1C48A 3J80c 1PTOF 2NVYB 3S24A 2Q2IA 1Z6HA 4R8NA 1PFBA 4LF6Q 1HR0W 4DK0A 4LF6L 1ESRA 3H0GH 3R3OA 2A69C 2K4KA 5JJKA 2ZXOA 5C3EH 2D2CC 2UUAQ 3K7AH 2F0IA 1DGSA 1V1QA 3S1NH 2UUAL 1LACA 2WB1G 5I6YA 4QCLA 1MIUA 5FOBB 2SOBA 1L1OA 2BH8A 3CMEA 4A3BG 2MGSA 3M3YB 5DAUA 2F0TA 4TRDA 1VCIA 2R93H 2OT2A 4FVMA 2KECA 1GO3E 5NUCA 4A3CH 2PQAB 2ZXPA 3OSOA 1CKNB 3KOJA 1WFQA 1ET6A 4C3JB 1D5XC 1VMCA 1ASZA 3GTLH 1N36Q 2EJMA 2QF7A 1VQ9A 4IPHA 3EBEA 4IURA 4O42A 4P2CB 5AJ3Q 1N36L 2QKIC 2MUYA 4AYBB 3PO3G 5DM63 1QZHA 1PTOC 5AJ3L 1B7YB 2F0VA 1XJVA 4OO1G 4DNIA 4QF4A 4PV1C 4WJ4A 3FVQA 1JE4A 1BNZA 4KK7A 2C35B 1ICWA 5IGGA 4N8FA 3G6EA 3ERSX 1XPUA 3G6JB 3VR2A 1C0AA 4JI3Q 3LNNA 5FJ8H 2N8NA 4RAUC 1FNVA 3HOVG 4JI3L 2KEEA 2K33A 4DAYB 1SFOH 4CJ0B 5JAVA 1E0BA 2J7ZA 3D6WA 5IT9L 3H09A 1KHIA 1B8AA 1EOTA 4QY7A 2DNEA 1I4QA 3HS0C 4C3HB 3A54A 2JYOA 4X6AH 1VQDA 3CPFA 1EUJA 1T9HA 2LKVA 1KNAA 4NXNQ 2PW5A 3IKJA 4NXNL 4C2MB 2VB2X 1NJIC 4LWCA 1TQOA 3HOZH 2B2YA 2OF1A 1PTOD 1STEA 4UY8C 2LMCB 3BDOA 3PQIA 4HAEA 1I3QH 5C6AA 5C5LA 4QUFA 5KYIA 3Q22A 4IJHA 1PH6A 1EU3A 4HIMA 1HZCA 2RQXA 1EL0A 3QG1A 1W6KA 3RD4A 4HIDA 1MD2D 4ZRZA 2MO0A 2VUMB 4U673 1WTXA 1KDCA 4LF7Q 1QVFA 1PH8A 1PV4A 4AYBE 1J5EQ 4LF7L 5J39A 5C4JH 4UDUC 1CA5A 1J6QA 1ZKOA 3LWEA 1U4LA 4HTHA 4CDDC 1J5EL 1EYDA 3H0GG 4ZK9B 4LF4Q 1QUQA 3MC0B 1WTOA 2N78A 2PNHA 1OXXK 4LF4L 4X65Q 3C1EA 3D4RA 3MXGA 1Q7YC 4X65L 1EWHA 2OTLA 1S40A 5CV8A 1QB5D 1TWCB 2FHTA 3S17B 2Z8LA 1S5DD 1JWMD 4XQQA 2EY5A 1EZ6A 2JXMB 4JOIC 3E9HA 1J8IA 2R93G 3MZ5A 1KQSA 2F3IA 4BY1H 4A3CG 5M5WH 3ONAB 4GNXC 4GZYC 1S72A 4B9WA 1RL2A 3MXPA 1D1KA 1TXYA 4YIJA 4H13C 2PZTA 4PZ6A 2NWGA 4A93B 4XYOA 5C3XA 4U68A 3ITPA 4M8AA 4GOPC 3AFPA 3EROA 2B2VA 4WJ3M 4K5VA 4UAIA 5JPNC 4DR2Q 2KHIA 4B3TQ 2WINB 2HDMA 2X69A 1VQ6A 2BOSA 2KBNA 2KHJA 4DR2L 4UP9A 3VR6A 4B3TL 4DAPA 1STNA 2RCFA 4Y52H 2HDLA 5EAYA 1JC7A 4L6TB 2KUMA 4K0KQ 1VQCA 1WI5A 1CSPA 5IGDA 3X3MA 1E1OA 2IL8A 3S15B 3RUZA 1CUKA 4K0KL 5FO9B 2YU9B 3HOYB 1PRTF 3A7AB 2WKDA 4A76A 3A5UA 4DR5Q 1IKLA 2PO4A 4OGQC 4DR5L 2L0CA 1X3GA 2JA8H 1AEXA 4ABNA 1HR0Q 1NSNS 1I50H 2JQOA 1HR0L 1L1OC 2CHBD 1K0SA 2EYLA 1G91A 1FNUA 3U58A 4UP8A 1AW7A 1HJPA 1XXGA 1H95A 1TY2A 1Z9FA 3D6CA 1PFNA 4CJ1B 3HOZG 4LFAQ 3GTQB 3ND9A 4KKTA 1U0LA 3I3CA 1SSOA 3K5OA 1V1OA 4BBRB 1RHPA 4A3IB 4LFAL 1F9PA 2DUDA 2NVYH 4MTNA 5JOBA 4FXDA 3CCVA 4MN3A 5K36H 1EY5A 5GROA 3W1GA 1A0IA 1B9NA 2HUGA 4WFN3 3HKZG 1SNOA 1OXVA 1SNDA 2R92G 2ICIA 3G71A 4IUTA 2Q8TA 1EY4A 3I70A 1PHJA 5LMNW 4KD3A 2OTJA 1AE3A 3RMHA 2K75A 1JOOA 2JJQA 3KBGA 1VQPA 4EX5A 5C0XJ 2KENA 4HMJA 1VQFA 2J0TD 4LJZC 4R4TA 5J3BA 4RGOS 3M3YH 4UPAA 2FMCA 5T1GA 3TP8A 3C2PA 1A8VA 5D14A 1GUGA 3A8KE 5I2YA 3AQQA 3D31A 2PNRC 2KCNA 2EOTA 4RGNA 4RWSC 3G48A 5IY0A 3BZKA 4B3RQ 1G291 5IE8A 1EY0A 4NP5A 3D4DA 3TSSA 3CW2C 1TS5A 4HJ5A 4B3RL 1UNSA 4RHRA 1LTAD 1ICFB 1MBYA 5EKLA 2Y0SB 2N49A 3WDNA 1NTGA 4F87A 2Q8RE 1H9KA 3BDLA 3KF8B 5KNDA 4IFDJ 1SYBA 2A6EC 1HPCA 2ZTDA 2B2YC 1JJ2A 4CKCA 4I7ZC 3J80L 3J80i 1HFNA 1HUMA 1TVXA 2FMMA 2WFWA 4MNOA 1F9RA 4ZCKA 4DA2A 3HEJA 4RGTA 1PRTD 2FXQA 3A5ZB 3NBHA 3SXHA 2ZM6Q 1E2VA 1E1TA 3KYHC 2ZM6L 1IHZA 1XMOQ 4ZLTF 1Y1VH 5KGUA 2PPBC 2L15A 1XMOL 3GTOB 2JA7B 3RZDB 1V1PB 1G2TA 1WTPA 3K81C 1DJRD 4YWMA 3PIOA 2IX3A 2JA8G 3UDGA 3WOEA 4C2MH 1R9TB 1FGBD 4IOCA 5IT9c 4QL5A 3W5OA 4OELB 5CBEE 2UUCQ 1Z7TA 1GUWA 4KD4A 1DOKA 1BF4A 2UUCL 4K14A 1W3SA 3J7A5 1X65A 4JG2A 2AWOA 2X6LA 3U4ZA 3H91A 4OL7A 4IPCA 2Y0SE 3VYSA 4S3SA 3J7ZC 1S5BD 5HGTA 2OWOA 5K36G 2O5JC 2P5ZX 3DUZA 3FPPA 2VZAA 4ID6A 3S2DB 2B2VC 2NTSA 1WVLA 4A3DH 1I6HB 3NK9A 2XRSD 3K59A 1LT5D 3KLRA 1KL9A 3SK8A 5EKIA 5FLXL 4IUUA 1DYQA 2D5DA 5IYDH 4DV5Q 4OIKA 1LTTD 2RCNA 3PV0A 4DV5L 5EKKA 3S17H 3BYTB 3BZCA 4FXGC 1R4PB 4C3IH 4FNFA 2ZTCA 3HKSA 3CP0A 3PUWA 5L37A 2MPMA 4JI0Q 4EQ5A 1UAPA 2HD3A 5KIXA 4JI0L 2A8VA 3J7AV 1RDPD 3CKIB 3CCSA 1MGSA 3E0EA 4LMQD 1Q1EA 3DHQA 2QA4A 1RTOA 1HXYD 4J1MA 2EJGC 1F9QA 3S16B 1S5CD 2NVQB 2N55A 2WAQB 2EYHA 2F0HA 3HOXH 4DR7Q 1CI3M 4GKKQ 4DR7L 4LF8Q 4GKKL 1Y1WH 4KLKA 5M3MH 3CCEA 3GO5A 3EIVA 4JPBW 4LF8L 1NY4A 4MHEA 5K5PA 5M5XB 3IRBA 3VR3A 2F0GA 2K32A 1VQ4A 1BOSA 3S15H 3S2HH 2YV5A 3HOYH 4A3GB 4RCNA 3S9WA 2WIIB 5C44B 1Y1VG 5HGQA 3MAQA 1S5ED 1YZ6A 1KLGD 2ATWA 4F8MA 1N34Q 1TWGH 5KNBA 1H9MA 1O78A 4X3SA 1N34L 5KNCA 2EY6A 1WCMB 3CCLA 3SK4A 4POFA 1IL2A 5LMNQ 1N9WA 2DJFC 5JJIA 1TWHH 2WP8J 3I4OA 3UE0A 3T56B 5LMNL 2J4XA 4N9TA 2RDGA 1JOQA 1C4QA 2H4OA 3GTQH 1YNNC 3P1HA 3CAMA 2K5VA 2CWAA 5G3LF 1VQNA 3AU7A 4FF4A 1UUPA 1GUTA 4O2DA 2F03A 2JEAI 3NBIA 1D7QA 4OIJA 3I4MB 1HCZA 1LTSD 3J7AF 1CKMA 1BBUA 5IYCH 3QJYA 3KLWA 1I4XA 2AQ3B 2QW7A 5A2QL 1AE2A 2UU9Q 1D8LA 4KY7A 1GJXA 2E74C 2UU9L 2CQAA 1PZKD 5CORA 2O5IC 3CCUA 2R7DA 3ULPA 1U4RA 2EVBA 4A3DG 4RGMA 3H15A 3OMCA 2Q8IB 1EQVA 2EY1A 1NMFA 5D3DA 2K5DA 4BWGB 3HOUH 3S14B 4KY6A 1XMQQ 2Z4IA 3MXNA 2CW0C 1NCVA 1LYLA 3HP3A 4KJNA 1MJEA 1LV9A 4RMFA 1PZJD 5KRUA 1XMQL 1PZID 2PCFB 3DWAA 1EFWA 1OXUA 2IWHA 4DNTB 4EGVA 2ZJPA 1YNND 4JK1C 1YIJA 1SR3A 1SN8A 5J22A 4GLVB 4C3IG 3CC2A 1FGUA 3OWFA 4A3FB 1V9PA 3M4OH 1E24A 5C4HA 1EFID 4PMBA 3QB3A 2Z6KA 4A3MH 1EY6A 3M85A 1DM0B 1SNPA 2PZUA 3KUPA 4AQYQ 4EQNA 3PIO3 4GOPA 3VA5A 4AQYL 5IYBH 2HQEA 3PSIA 2RBMA 4OWWB 1EY8A 3HOXG 1VF7A 3OMGA 4OEMB 3S1MB 1Y1WG 4JI5Q 5M3MG 4E6IA 3ICEA 2ICEC 3J80E 1XPOA 4RH6A 3W1BA 4JI5L 3SEBA 1KABA 1A3VA 2EQSA 4QQBX 3S1QH 4FP5D 2K5WA 3RZDH 2ENBA 3NELA 3PUVA 3UDFA 1VMPA 1A2TA 5D3IB 1QCBD 1X3QA 4GKJQ 2QDLA 3KJPA 1VQLA 2KHSA 2JA6B 2RA4A 3UDXA 3E0JA 5IP9H 1HZ9A 5G3LD 5FK9C 4NMZA 3Q8DA 1SRUA 1G2SA 1IW7C 5GQOA 1ML0D 3L3OC 2F0MA 3GTJB 3CU7A 1CA6A 5IGFA 3CMAA 1TT2A 3AYHB 4KY5A 1G6ZA 3KK7A 4PZ8A 1R4QB 3Q24A 1CTMA 4BY7H 3U9OA 4XIGS 1RKNA 3AMUA 5CV6A 3ULLA 3U9SA 2QEXA 5F2DA 5IIFA 3GTPB 5IYCG 2PW7A 3S2DH 1I6HH 1O7ZA 3OYYA 4X3TA 2YYZA 2LS01 2AQ2B 1SYEA 2NVTB 4CJ2C 2A69D 3ERQA 1TWFB 3S1RB 4IZ8A 4X66Q 1WD0A 1XTDA 1BUVT 3K0XA 1UE6A 3UE1A 4X66L 1RIPA 1EIHA 3QIAA 1PXUA 3PO2B 1IW7D 1RJTA 3FKIB 3J7YW 1QJOA 3HOUG 3B6YA 2F0FA 4Y7NH 5FLXc 4JVZA 4TKOB 1Q46A 2OQKA 3DWQA 3GP7A 3SGIA 5GAHC 4KV6A 4P73A 4DNRB 3J81j 3RLOA 3TZUA 5M5YB 1KRTA 2CH4A 3JAMc 3GTMH 3S16H 4NB3A 1WYDA 3JC66 1QWYA 4LW1A 4A3MG 2F0EA 4PMWA 1X6OA 4XQJA 3C1FA 2L55A 4FXKC 3OHXC 3I91A 2VB3X 5EQ0A 3K58A 4ILWA 4ZKBB 1PTOB 2HQLA 2AWNA 1RD9D 1HNXQ 4A3GH 3K5LA 4XYQA 5BN3A 3I4NG 5HURA 5M3FB 5CR3A 1HNXL 2E2JB 5C44H 3J81c 1H9SB 3MA2B 2X6GA 5EGTA 1IXRA 2EYJA 2BA1A 5DM73 4LF9Q 2PI2A 4A3EH 1B2TA 3T1YQ 1HUNA 3DLLA 3KDFA 4LF9L 4HMIA 3KF6A 1PYWD 3T1YL 3RR5A 1DCZA 3NQIA 4RCOA 3GDEA 3BVMA 4APVA 5EPJA 4LK1C 5C3EG 1HA5A 5DNFA 1YI2A 2I0QA 3TEHB 2A6HC 5IP9G 5M9OA 1QVCA 2B63B 2H1EA 4GS3A 4IJLA 3R2IA 2K5QA 2JA9A 1HHVA 4A3KB 2KA7A 1B44D 1D2BA 3GQBA 3I4MH 3TN2A 1H9RA 2TMPA 1X3EA 2OXPA 1SEBD 4M1UB 3TZDA 4IALA 1RCVD 1TS3A 1JWUD 2Z6KC 1STAA 1HTLD 3RN5A 1F2MA 4BY7G 1LT3D 5BR8Q 3CHBD 3DEPA 4P74A 1JB7A 1JB3A 5BR8L 1EIGA 1MKHA 1H9JA 5J1ZA 4X62Q 4I7AA 1QOHA 1TY0A 2E2IH 3WOFA 4X62L 2EY2A 3A8IE 4TSSA 2KOLA 4DUZQ 1PH4A 1AP0A 3A74A 5A2QE 4DUZL 2M9VA 1O7IA 1AZPA 1P16A 3AB9A 3DEOA 4X64Q 2E2HH 4K2KA 1HA6A 1K8GA 1ZEQX 2BE5C 1SE8A 4X64L 1TWAB 2IPKD 1GD7A 3NQTA 1LM0A 4JI6Q 4WJWA 1Q1BA 5FJ8G 3CRKC 4JI6L 1CM9A 2RHQB 4NW2A 1STGA 4CKEA 1K8MA 2F0PA 1C9OA 2PMZB 4WORA 4DR6Q 3FHWA 1GKHA 1XNRQ 1GVPA 3A0JA 4J6HA 5C4XH 3HRZC 4DR6L 1JT8A 1XNRL 5TSSA 4A3JH 1GUSA 1SYDA 4K8IA 2O2LD 3HOWH 4IUPA 1F9SA 4GNXB 3PUXA 4K2LA 3W2DA 1K0RA 1E7ZA 4BBSH 2ZXRA 1NE3A 1YJNA 2VNUD 4XXEA 1GHKA 2L11A 2F0JA 2JA5H 2F0SA 3EJIA 1NBWA 1QILA 5D65A 4ZQ3A 5E1FA 4GOPB 2NVXB 1CZWA 2WB1B 3A7LA 4A3BB 1C8CA 1A6XA 2BE5D 1UE1A 3H6MA 2E2DC 3PCOB 4R4OA 2KJXA 1SDFA 5C44G 1A63A 4B3SQ 4BXXH 2UXCQ 3LWUA 4B3SL 2UXCL 3E5SA 2B29A 3A8JE 4A3EG 2IHFA 4XQNA 1V8QA 3NHHA 4IPGA 1IBMQ 4JBKA 1LT6D 3X3NA 4FF3A 3PF4A 1IBML 4L5QA 3PO3B 3F8TA 1L1OB 3H94A 1TS4A 4QIWB 5EJWA 2JN4A 5JEAH 3TDQA 2PZWA 5ELNA 4C3JH 3E6ZX 1KRSA 2IX0A 4KHZA 2IHEA 2JE6I 4OWTB 3GTPH 4H7BA 4BY1G 5I2XA 3GTGB 4DV7Q 1WTQA 1QVGA 1UEAB 2WKCA 3DM1A 4DV7L 3OOCA 4G4KA 3HOVB 1B4OA 1Q86C 5EPLA 3HGBA 2XRQD 3V05A 1UE7A 2R7FA 2BDNA 1VQ8A 2N88A 3I4LA 2MHVA 4FF2A 1LLRD 1YJWA 5C5MA 3NUCA 4HSVA 3FKIH 1PYBA 1BBXC 1CFMA 1WD1A 3NWSA 1VQMA 5C3WA 1PRTB 1STHA 4LUVA 4MIUA 3U50C 1A62A 4NKLA 1SMXA 4NDXA 4ZUIA 1U9RA 1GUOA 1SE3A 1RF2D 1GM5A 1JOKA 3E9IA 4HEDA 4C3HH 5M5YH 4DPGA 1NR2A 5I6WA 4V190 2BCOA 2QEJC 5C4ZA 2SNMA 2QDBA 3M4YA 5IT9E 2ASBA 2A6ED 5JJZA 1PFSA 3STBC 5C4XG 3URYA 4A3JG 2F0DA 3HOWG 3W3AA 3AEVA 2HIXA 4ULLA 1PTOH 4BBSG 2YTXA 3H0GB 4L63B 1DOLA 1QNUA 3VA7A 2JA5G 2MFIA 3NXWA 5M3FH 1K9MC 4JI2Q 2VUMH 4OONA 3K7AB 2EJFC 3M4PA 1O7YA 3K5MA 3K5NA 4JI2L 4LUZA 4DK3C 4YWLA 3BVZA 1EZ8A 2PQAA 1HFGA 1JMCA 2EE1A 2UXDQ 1JORA 1CKNA 2R93B 1VQJA 3TBIB 2UXDL 4B9XA 4DAMA 2BDOA 4HJAA 4BXXG 4FDBA 4DR1Q 4XDXA 2Z6BA 4PNYA 4DR1L 2OCEA 3I2ZA 1JCKB 2K04A 2R3ZA 2B63H 1TWCH 4GLXA 1BVSA 1QUQB 3HFZB 1QE6A 3STBD 1EY7A 1PH2A 1N33Q 3GTLB 2NN6I 3OIPA 2XWBB 3JAML 5HY6A 3JAMi 1N33L 1JJGA 1SNMA 1T5XD 2EYMA 1FVIA 1BQQT 4YHHQ 5JEAG 2A73B 2DY8A 3T53B 4YHHL 1EQTA 2TSSA 4J8QA 1Q82C 4C3JG 2K5HA 4A75A 4DAYA 5EBDA 4A93H 5IP7H 4K6DA 2L1BA 1E22A 4YCVA 2Z4HA 3EN2A 1SXTA 1CHPD 5FKAC 4AYBG 2OQ0A 4JBMA 1CSQA 1T5EA 1B3QA 1SFOB 5JPMC 3J81L 4BA2I 3R2TA 3J81i 3KLSA 1B50A 2QILA 5ELDA 4H44C 3E3XA 5ELCA 3ZJYC 2H5XA 4BS9A 4JI4Q 4RFBA 2ZTEA 3L9AX 3VR4A 3M4QA 2YU9H 3OWEB 2JP1A 3I73A 3TRZA 4JI4L 5IGEA 2K28A 3FKIG 1D5ZC 1BBWA 5JVG3 1QZGA 3PF5A 4ZKCB 3HOZB 4K8JA 2CQOA 4DFAA 3NTHA 2D0PA 4KHVA 1PH5A 1IYUA 1I3QB 5IGBA 2IJ0A 1A3TA 2WV6D 4C3HG 1YNJC 2FINB 3HKZB 2NN6H 3EQLC 3P75A 3I55A 4GN3B 2R92B 1XNQQ 1PDQA 3F2BA 4PG3A 3SDZA 4AH6A 4DXFA 1XNQL 4DU9A 2G9HD 1YVCA 4BBRH 1I4HA 2F0WA 1NUCA 3T1HQ 4A3IH 1K3BC 3M7GA 3G4SA 2NVXH 1DZ1A 3T1HL 2NUCA 3CCQA 1ENAA 2B8GA 3F1ZA 3IFDA 2VQFQ 1B1ZA 1RTNA 2ZT9C 5LL6X 2VL6A 2VUMG 1PH9A 1K3RA 1LO5D 2VQFL 4KKSA 5E3FA 4YCUA 1W6JA 1BCPC 4TVAB 2WAQE 1IZ6A 4G7HC 3F2CA 1D1IA 1W2BA 1MHWC 1SYFA 3SK5A 1K73C 5CGKA 1Q12A 4JI7Q 2Z0SA 2AMCB 1DXMA 1SJED 2F0NA 4F7XA 1YNJD 1M4VA 4JW0A 4JI7L 3NTKA 3DM3A 3V96A 1S5FD 2CH4W 3PO3H 5IYDG 2SNSA 4DUYQ 1EWCA 2I46A 2N3SA 4DUYL 2L5TA 3QOJA 4HCEA 3QWNA 1CK1A 3TP7A 3H3VI 3MTSA 3SVMA 1MI2A 4R1JA 2EXZA 3HZXA 3GTGH 2UXBQ 5E4WC 3VYRA 1LABA 4ME5A 3NE5B 4DR4Q 4IN3A 2UXBL 2F3VA 3CCRA 1AH9A 3HOVH 2B2UA 4DR4L 3NP8A 4DKAC 3PIP3 4A93G 1JICA 5IP7G 4ALPA 2RF4A 3D3RA 3G7LA 4J15A 2KCMA 1YHBA 2MJ8A 4JBJA 1X9NA 3L7ZC 1JQYD 4CHTB 3UI2A 2IT1A 2XN9C 2M2LA 4DV0Q 4K5XA 5ELFA 4DV0L 5E7NA 2CW0D 1II3A 5DLQE 3NBHB 1A15A 1HH2P 1K28A 3GD7A 1PH3A 3GTOH 2JA7H 4C1NI 3HOYG 2LXJA 2RDFA 2O4XA 4UHVA 1QNKA 3M9BA 1E3PA 4R8IA 1YITA 1M1KC 1I4GA 1KDBA 1ENCA 1EWIA 2EYFA 3D8GA 4PQXA 4EVOA 1O7LA 2RHSB 3L2PA 1R9TH 2IX1A 4GKJL 3MWYW 4CKBA 1AFPA 2AKWB 4L8JA 3F2UA 1XYIA 3WWVA 1B3AA 1CZGA
chains in the Genus database with same CATH topology
2IW3A 3NPPA 2NN6G 4WRDA 5CBAE 1TIID 4K5WA 1LTBD 3IFTA 1TKWB 2LFNA 2K01A 2K03A 4Q5VA 2KEDA 3RZOB 5IODA 1MSHA 1SYCA 4KN7C 2BA0A 3T51B 2NBFA 3T13A 3O13A 3MFGA 4O1NA 1SE4A 4IUQA 5EBCA 3MXUA 1EEFD 2M00A 4ZYSA 3KF8A 4N9PA 3R93A 3K6OA 1FYCA 2NTTA 5FLXE 1L0YB 5IGCA 1KTKA 2HCIA 1GUNA 1I4PA 2DNCA 5CV7A 1KNEA 3T16A 3JAME 1LTGD 2EPBA 2FJ2A 1F2ZA 3VYUA 2F3WA 1V1PA 1EYCA 2K1BA 1RODA 1TU2B 1Y1VB 3I90A 4QUCA 4HSPA 2D9UA 4KJOA 4KI0A 1SMYC 4I65A 4F88A 1QG7A 4DGZA 3TMEA 1KDAA 1JR0D 4KN4C 2E75C 2EZVA 3J81E 1BR9A 4JBWA 1AN8A 2G9DA 3MHBA 5BN4A 4ZUJA 3BZDB 1A3UA 3HG9A 2EDGA 5JEAJ 1XTCD 4KKUA 1CQFA 3MVVA 1X3PA 2R7ZB 3P7JA 1WTVA 3M7NA 2NB0A 1SMYD 3GTKB 3FMCA 1HQMC 4A3DB 5CC4A 2C5CA 2LY7A 4G57A 4TQUS 3EA6A 2B2UC 3D4WA 3CRLC 4C3IB 2ID0A 2B2TA 2R61A 1DONA 4B08A 2R6GA 1ZXTA 1VF5C 2E76C 2XWJB 2A6HD 2A5HA 3NWTA 3V2TA 4HR7B 4KMUC 4IQZA 5LHY1 4C1NK 3HOXB 3SR1A 1DOMA 3KBXA 1S4ZA 1Y1WB 5M3MB 1Q3LA 3K57A 3DWPA 3S2HB 2OEOA 3RLFA 5KYLA 2Z1CA 5CV4A 1V43A 3BDCA 1PMRA 1Z47A 1X32A 1M8AA 1CQVA 2L4NA 4FF1A 2F0QA 1PLFA 1KLUD 1TWGB 4G7OC 2QCPX 1AZQA 3LX0A 3I8ZA 1I4RA 2EYOA 1TWHB 3MFYA 1U4MA 3VR5A 5BN5A 4DAVA 2DY7A 1L0XB 2F0OA 2RSNA 1OXSC 5CV9A 2RVLA 4HCSA 2L9HA 1F77A 2F4IA 3GV3A 2A74C 3NTIA 2V4DA 1K83B 4G7ZC 2B2WA 3K0YA 1PRTC 5ISRA 1DD2A 5IOCA 2AUJD 3QOLA 3Q6SA 3PUZA 1E2WA 3C46A 4RHSA 4FO2A 4Z9CB 2F0LA 2GA4B 3IL8A 3BS1A 1G8ZD 3HOUB 3EVQA 1Y69U 3MEHA 4RKLA 2RSOA 3I72A 1OO9B 2WACA 4CBVA 3CQZB 3FPUB 2DN8A 3N52A 1Y8PB 1SNQA 1A2UA 4Q0FA 2FFKB 2AQ1B 1HTPA 3NSWA 2SEBD 1GXDC 3OW7A 5T1IA 3M4OB 2NZ1D 4EQPA 1ET9A 4DF7A 3H3VC 4A3MB 1F2YA 2XVSA 1NR4A 1MSGA 5FO7B 1SJHD 4XT3B 2A68C 2I07B 3BYYB 3BVGA 2B39A 1ESFA 4RA8A 4FYDA 2HCCA 1I6VC 4KTAA 3I4NB 2RKSA 4QMGA 2AUKA 4HN7A 3S1QB 3DMUA 3EFXD 5C0XI 1XWEA 1Q90A 2EYPA 5E4XA 5C3EB 4LAAA 3S1NB 2F1MA 3PUYA 5LL6S 1ENFA 1SYGA 1TR5A 2B2TC 2A68D 4IFDI 1STBA 4H0LC 1ONLA 4C56C 1BXTA 1FD7D 4IUVA 4BY7B 3FRPB 1BDOA 3P20A 4XT1B 1KAAA 4CGYB 1STYA 5A35A 3ND8A 1SE2A 1SNCA 1LTID 1FNWA 2XSCA 4OHJA 1ILPA 1J9OA 3SHLA 1SBBB 3C3LA 3SK6A 5I9PA 5DEHA 4ODGA 1GOZA 4IUNA 1EYAA 5C0XH 3Q23A 2XIWA 1IKMA 2RDHA 1D5MC 4Y7NB 1NAPA 5CV5A 3Q0AA 1BCPF 5EPKA 2XNAC 3A55A 4X3UA 3GTMB 1F2LA 2C9OA 4DXGA 2KCCA 2VXWA 2L12A 4IFDH 1E2ZA 2K05A 4ZAIA 4OO1I 1EU4A 5KEEA 1HRJA 5AFWA 5CMDA 1LT4D 1IYVA 4BA1I 2D62A 4X3KA 1WTWA 1H9SA 2PYKA 3FEWX 1CHQD 3FDTA 1PFMA 3T4AC 4R9WA 2PQEA 2B2WC 2JEBI 3SE0A 5C4JB 3A56A 1B53A 4A3EB 4QB4A 4K6LA 1CT1D 4V0BA 5COYA 2SDFA 2KQ3A 2MP1A 1GHJA 1JWSD 1O80A 4DK1A 1ZYRC 1D6EC 1U4PA 1Y8NB 3PMFA 2KVMA 3TP5A 2NYZD 5I9OA 4EQOA 4BY1B 3GV6A 5FO8B 5M5WB 3VYTA 3TP6A 1Y8OB 4OO1H 1HQRD 1FR3A 2JSOA 3KLSX 5ELEA 3IAYA 2E2IB 3QO2A 1LTRD 4RKBA 4DN4M 1IL8A 3OIQA 5I4DA 1B9MA 3OPOA 2E2HB 3BG3A 1OXTA 1K8OA 3ZYYX 1BCPD 5C0XG 1VDZA 1XX8A 2F0UA 1ZYRD 5CYUA 1EEID 1BCPB 1WTRA 2JA8B 2CVRA 1Q8IA 3R8BA 2K7VA 1ILQA 1I50B 4PMCA 2B8FA 2F0KA 5JVH3 5C4XB 1SAPA 4XTCS 4A3JB 3HOWB 3N6RA 1BO0A 3DXJC 2K6AA 4BBSB 5ELBA 4IFDG 2JA5B 1EY9A 1TS2A 1C48A 1PTOF 2NVYB 1Z6HA 4R8NA 1PFBA 4DK0A 1ESRA 3R3OA 2A69C 2ZXOA 2D2CC 2F0IA 1LACA 5I6YA 4QCLA 5FOBB 2SOBA 2MGSA 3M3YB 5DAUA 2F0TA 4TRDA 1VCIA 2OT2A 4FVMA 2KECA 5NUCA 2ZXPA 3OSOA 1ET6A 4C3JB 1D5XC 1VMCA 2EJMA 2QF7A 4IURA 4O42A 4P2CB 2QKIC 2MUYA 4AYBB 5DM63 1PTOC 2F0VA 4OO1G 4QF4A 4PV1C 3FVQA 1JE4A 1BNZA 4KK7A 1ICWA 5IGGA 3G6JB 3VR2A 3LNNA 4RAUC 1FNVA 2KEEA 2K33A 4CJ0B 5JAVA 1E0BA 2J7ZA 3D6WA 5IT9L 3H09A 1EOTA 2DNEA 1I4QA 3HS0C 4C3HB 3A54A 2JYOA 2LKVA 1KNAA 2PW5A 3IKJA 4C2MB 2VB2X 1TQOA 2B2YA 2OF1A 1PTOD 1STEA 2LMCB 3BDOA 4HAEA 5C6AA 5C5LA 4QUFA 5KYIA 3Q22A 1EU3A 2RQXA 1EL0A 3QG1A 1W6KA 3RD4A 1MD2D 4ZRZA 2VUMB 4U673 1WTXA 1KDCA 5J39A 4UDUC 1CA5A 1ZKOA 3LWEA 1U4LA 4HTHA 1EYDA 4ZK9B 3MC0B 1WTOA 1OXXK 3C1EA 3D4RA 3MXGA 1EWHA 5CV8A 1QB5D 1TWCB 2FHTA 3S17B 2Z8LA 1S5DD 1JWMD 4XQQA 2EY5A 1EZ6A 2JXMB 1J8IA 3MZ5A 3ONAB 4GZYC 4B9WA 3MXPA 4YIJA 1D1KA 4H13C 2PZTA 2NWGA 4A93B 4XYOA 5C3XA 4U68A 3ITPA 4M8AA 3EROA 2B2VA 4K5VA 4UAIA 5JPNC 2WINB 2HDMA 2X69A 2BOSA 3VR6A 4DAPA 1STNA 2HDLA 1JC7A 4L6TB 2KUMA 5IGDA 3X3MA 2IL8A 3S15B 3RUZA 5FO9B 2YU9B 3HOYB 1PRTF 3A7AB 2WKDA 1IKLA 2PO4A 4OGQC 2L0CA 1AEXA 4ABNA 1NSNS 2CHBD 2EYLA 1G91A 1FNUA 1AW7A 1XXGA 1TY2A 3D6CA 1PFNA 4CJ1B 3GTQB 3ND9A 4KKTA 4BBRB 1V1OA 1SSOA 3I3CA 3K5OA 4A3IB 1RHPA 1F9PA 5JOBA 4FXDA 4MN3A 5K36H 1EY5A 1B9NA 2HUGA 4WFN3 1SNOA 1OXVA 1SNDA 2ICIA 4IUTA 2Q8TA 1EY4A 3I70A 4KD3A 3RMHA 1JOOA 3KBGA 5C0XJ 4HMJA 4LJZC 2J0TD 4RGOS 2FMCA 5T1GA 3TP8A 3C2PA 5D14A 1GUGA 3A8KE 5I2YA 3D31A 2PNRC 2KCNA 2EOTA 4RGNA 4RWSC 1G291 1EY0A 4NP5A 3D4DA 3TSSA 1TS5A 1UNSA 4RHRA 1LTAD 1MBYA 5EKLA 2Y0SB 3WDNA 4F87A 2Q8RE 1H9KA 3BDLA 5KNDA 4IFDJ 1SYBA 2A6EC 1HPCA 2B2YC 4CKCA 4I7ZC 3J80L 1HFNA 1HUMA 1TVXA 2FMMA 1F9RA 4DA2A 3HEJA 4RGTA 1PRTD 3NBHA 3SXHA 1E2VA 1IHZA 4ZLTF 5KGUA 2PPBC 3GTOB 2JA7B 3RZDB 1V1PB 1G2TA 1WTPA 1DJRD 2IX3A 3WOEA 1R9TB 1FGBD 5CBEE 1Z7TA 1GUWA 4KD4A 1DOKA 1BF4A 4K14A 2AWOA 2X6LA 3H91A 4OL7A 3VYSA 4S3SA 1S5BD 5HGTA 5K36G 2O5JC 3DUZA 3FPPA 4ID6A 3S2DB 2B2VC 2NTSA 1WVLA 1I6HB 3NK9A 2XRSD 3K59A 1LT5D 3KLRA 3SK8A 5EKIA 5FLXL 4IUUA 1DYQA 2D5DA 4OIKA 1LTTD 3PV0A 5EKKA 3BYTB 4FXGC 1R4PB 4FNFA 3PUWA 2MPMA 1UAPA 5KIXA 3J7AV 1RDPD 3CKIB 1MGSA 4LMQD 1Q1EA 3DHQA 1RTOA 1HXYD 4J1MA 2EJGC 1F9QA 3S16B 1S5CD 2NVQB 2N55A 2WAQB 2EYHA 2F0HA 1CI3M 3GO5A 4MHEA 5M5XB 5K5PA 3VR3A 2F0GA 2K32A 1BOSA 4A3GB 4RCNA 3S9WA 2WIIB 5C44B 3MAQA 1S5ED 1KLGD 4F8MA 5KNBA 1H9MA 1O78A 4X3SA 5KNCA 2EY6A 1WCMB 3SK4A 2WP8J 3T56B 2J4XA 4N9TA 2RDGA 1JOQA 1C4QA 2H4OA 1YNNC 3P1HA 5G3LF 3AU7A 4FF4A 1UUPA 1GUTA 2F03A 2JEAI 3NBIA 4OIJA 3I4MB 1HCZA 1LTSD 3J7AF 3QJYA 1I4XA 2AQ3B 5A2QL 4KY7A 1GJXA 2E74C 2CQAA 1PZKD 5CORA 2O5IC 1U4RA 2EVBA 4RGMA 3OMCA 2Q8IB 1EQVA 2EY1A 5D3DA 2K5DA 4BWGB 3S14B 4KY6A 2Z4IA 2CW0C 3MXNA 1NCVA 3HP3A 4KJNA 1LV9A 1PZJD 5KRUA 1PZID 2PCFB 3DWAA 1OXUA 2IWHA 4DNTB 4EGVA 1YNND 4JK1C 5J22A 4C3IG 3OWFA 4A3FB 5C4HA 1EFID 4PMBA 3QB3A 1EY6A 3M85A 1DM0B 1SNPA 2PZUA 3KUPA 4EQNA 3PIO3 3VA5A 2HQEA 2RBMA 1EY8A 1VF7A 3OMGA 3S1MB 4E6IA 2ICEC 3J80E 4RH6A 3SEBA 1KABA 1A3VA 4FP5D 2K5WA 2ENBA 3PUVA 1VMPA 1A2TA 5D3IB 1QCBD 1X3QA 2KHSA 2JA6B 2RA4A 3E0JA 5G3LD 5FK9C 4NMZA 1G2SA 1IW7C 1ML0D 3L3OC 2F0MA 3GTJB 3CU7A 1CA6A 5IGFA 1TT2A 4KY5A 1G6ZA 3KK7A 1R4QB 3Q24A 1CTMA 3U9OA 4XIGS 1RKNA 3AMUA 5CV6A 3U9SA 5F2DA 5IIFA 3GTPB 2PW7A 1O7ZA 4X3TA 2YYZA 2LS01 2AQ2B 1SYEA 2NVTB 4CJ2C 2A69D 3ERQA 1TWFB 3S1RB 4IZ8A 1WD0A 1BUVT 1EIHA 3QIAA 1PXUA 3PO2B 1IW7D 1RJTA 3FKIB 3J7YW 1QJOA 2F0FA 4TKOB 3DWQA 3GP7A 4KV6A 4DNRB 3TZUA 5M5YB 1QWYA 2F0EA 4PMWA 4XQJA 3C1FA 2L55A 4FXKC 3OHXC 3I91A 2VB3X 5EQ0A 3K58A 4ILWA 4ZKBB 1PTOB 2AWNA 1RD9D 3K5LA 4XYQA 5BN3A 5HURA 5M3FB 5CR3A 2E2JB 1H9SB 3MA2B 2X6GA 5EGTA 2EYJA 2BA1A 5DM73 1B2TA 1HUNA 4HMIA 1PYWD 1DCZA 3NQIA 4RCOA 3BVMA 5EPJA 4LK1C 1HA5A 5DNFA 2A6HC 5M9OA 2B63B 2H1EA 3R2IA 2K5QA 1HHVA 4A3KB 2KA7A 1B44D 1D2BA 3GQBA 3TN2A 1H9RA 2TMPA 2OXPA 1SEBD 4M1UB 3TZDA 4IALA 1RCVD 1TS3A 1JWUD 1STAA 1HTLD 1F2MA 1LT3D 3CHBD 3DEPA 1JB3A 1EIGA 1H9JA 5J1ZA 1QOHA 1TY0A 3WOFA 2EY2A 3A8IE 4TSSA 2KOLA 1AP0A 5A2QE 2M9VA 1AZPA 3AB9A 3DEOA 4K2KA 1HA6A 1ZEQX 2BE5C 1TWAB 2IPKD 3NQTA 4WJWA 1Q1BA 3CRKC 1CM9A 4NW2A 1STGA 4CKEA 1K8MA 2F0PA 2PMZB 4WORA 4J6HA 3HRZC 5TSSA 1GUSA 1SYDA 4K8IA 2O2LD 4IUPA 1F9SA 3PUXA 4K2LA 3W2DA 2ZXRA 2VNUD 4XXEA 1GHKA 2L11A 2F0JA 2F0SA 3EJIA 1QILA 5D65A 4ZQ3A 5E1FA 2NVXB 1CZWA 2WB1B 3A7LA 4A3BB 1C8CA 1A6XA 2BE5D 3H6MA 2E2DC 2KJXA 1SDFA 3LWUA 3E5SA 3A8JE 4XQNA 1V8QA 3NHHA 1LT6D 3X3NA 4FF3A 3PO3B 3H94A 1TS4A 4QIWB 5EJWA 5JEAH 3TDQA 2PZWA 3E6ZX 2IX0A 4KHZA 2JE6I 4H7BA 5I2XA 3GTGB 1WTQA 1UEAB 2WKCA 3DM1A 3OOCA 4G4KA 3HOVB 1B4OA 5EPLA 3HGBA 2XRQD 3V05A 2BDNA 2N88A 3I4LA 2MHVA 4FF2A 1LLRD 5C5MA 3NUCA 4HSVA 1BBXC 1CFMA 1WD1A 3NWSA 5C3WA 1PRTB 1STHA 4MIUA 4NKLA 4NDXA 4ZUIA 1U9RA 1GUOA 1SE3A 1RF2D 1JOKA 4HEDA 1NR2A 5I6WA 4V190 2BCOA 2QEJC 5C4ZA 2SNMA 2QDBA 3M4YA 5IT9E 2A6ED 5JJZA 3URYA 2F0DA 3W3AA 4ULLA 1PTOH 3H0GB 4L63B 1DOLA 1QNUA 3VA7A 3NXWA 3K7AB 2EJFC 3K5MA 1O7YA 3K5NA 3BVZA 1EZ8A 1HFGA 2EE1A 1JORA 2R93B 3TBIB 4B9XA 2BDOA 4XDXA 4PNYA 1JCKB 2K04A 2R3ZA 1QE6A 1EY7A 3GTLB 2NN6I 3OIPA 2XWBB 3JAML 1SNMA 1T5XD 2EYMA 1BQQT 5JEAG 2A73B 2DY8A 3T53B 1EQTA 2TSSA 4J8QA 4C3JG 4DAYA 5EBDA 4K6DA 2L1BA 2Z4HA 1SXTA 1CHPD 5FKAC 1T5EA 1SFOB 5JPMC 3J81L 4BA2I 3R2TA 3KLSA 1B50A 2QILA 5ELDA 4H44C 5ELCA 4BS9A 4RFBA 3VR4A 3L9AX 3OWEB 2JP1A 3I73A 5IGEA 2K28A 1D5ZC 5JVG3 4ZKCB 3HOZB 4K8JA 4DFAA 3NTHA 4KHVA 1IYUA 1I3QB 5IGBA 2IJ0A 1A3TA 2WV6D 4C3HG 1YNJC 2FINB 3HKZB 2NN6H 3EQLC 3P75A 2R92B 1PDQA 3SDZA 4DXFA 4DU9A 2G9HD 1I4HA 2F0WA 1NUCA 3M7GA 1DZ1A 2NUCA 1ENAA 2B8GA 3IFDA 1B1ZA 1RTNA 2ZT9C 5LL6X 1LO5D 4KKSA 5E3FA 1W6JA 1BCPC 4G7HC 1D1IA 1SYFA 3SK5A 5CGKA 1Q12A 1DXMA 1SJED 2F0NA 4F7XA 1YNJD 1M4VA 3NTKA 3V96A 1S5FD 2SNSA 1EWCA 2I46A 2L5TA 3QOJA 4HCEA 3QWNA 1CK1A 3TP7A 3MTSA 3SVMA 1MI2A 2EXZA 3HZXA 5E4WC 3VYRA 1LABA 4ME5A 3NE5B 4IN3A 2F3VA 2B2UA 3NP8A 3PIP3 1JICA 3D3RA 3G7LA 2MJ8A 3L7ZC 1JQYD 4CHTB 3UI2A 2IT1A 2XN9C 2M2LA 4K5XA 5ELFA 2CW0D 1II3A 1A15A 3GD7A 4C1NI 2RDFA 2O4XA 1QNKA 4R8IA 1I4GA 1KDBA 1ENCA 2EYFA 3D8GA 4PQXA 4EVOA 1O7LA 2IX1A 3MWYW 4CKBA 1AFPA 4L8JA 3F2UA 1XYIA 1B3AA 1CZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUJ A;  1ENA A;  4PMC A;  5KEE A;  1JOR A;  1SYE A;  4KY6 A;  1STN A;  2OXP A;  2F0K A;  3DMU A;  4WRD A;  3LX0 A;  5KIX A;  4KJN A;  4IAL A;  4K5W A;  4B9X A;  5KRU A;  1STA A;  2EYO A;  1F2M A;  3ERQ A;  5IGD A;  2EYP A;  2PYK A;  3DHQ A;  3RUZ A;  1A3U A;  4IZ8 A;  5E3F A;  3HEJ A;  2PZW A;  4PNY A;  5J22 A;  2LKV A;  5DAU A;  4J1M A;  2PW5 A;  5IOD A;  1SYC A;  5J1Z A;  4LAA A;  3MVV A;  3SXH A;  1EY9 A;  3OWF A;  2F0O A;  1EY7 A;  1SYF A;  1TQO A;  2EY2 A;  1AEX A;  2EYH A;  2F0H A;  5CV9 A;  1IHZ A;  2OF1 A;  3SK5 A;  4H7B A;  2PQE A;  5C4H A;  5CGK A;  5KGU A;  1NSN S;  1SYG A;  2F0F A;  4PMB A;  3QB3 A;  1SNM A;  2EYM A;  2F0N A;  4QB4 A;  4R8N A;  4F7X A;  1TR5 A;  5C6A A;  5C5L A;  5CC4 A;  1EY6 A;  5KYI A;  4G57 A;  5K5P A;  2EYL A;  2SNS A;  2F0G A;  1SNP A;  2PZU A;  4K2K A;  2M00 A;  1STB A;  3NHH A;  4EQN A;  3R3O A;  4KV6 A;  2KQ3 A;  3QOJ A;  4N9P A;  3VA5 A;  2HQE A;  3TP7 A;  2RBM A;  3NQT A;  3S9W A;  3D6C A;  1EY8 A;  1KDC A;  1KAA A;  2F0I A;  4K6D A;  1STY A;  5ISR A;  3D4W A;  5C5M A;  5I6Y A;  5IOC A;  3NUC A;  2SOB A;  3QOL A;  2EXZ A;  3OMG A;  3HZX A;  2F0E A;  3PMF A;  5JOB A;  4E6I A;  5J39 A;  1SNC A;  4F8M A;  3TP5 A;  1STG A;  4ME5 A;  5C3W A;  1STH A;  1EY5 A;  2F0P A;  4HTH A;  3T13 A;  5I9O A;  4KD4 A;  3C1F A;  2F0T A;  2F0L A;  1KAB A;  4MIU A;  1A3V A;  4WOR A;  1EYD A;  2F3V A;  4TRD A;  4NKL A;  2EY6 A;  4K14 A;  3EVQ A;  4J6H A;  4NDX A;  4ZUI A;  1SNO A;  4QMG A;  1SND A;  3SK4 A;  1U9R A;  5IGC A;  2ENB A;  3MEH A;  4RKL A;  5NUC A;  3SHL A;  1SYD A;  4K8I A;  3NP8 A;  2WAC A;  4OL7 A;  1EY4 A;  1JOK A;  3TP6 A;  4K2L A;  5CV7 A;  1SNQ A;  1A2U A;  1A2T A;  3C1E A;  4N9T A;  3SK6 A;  4KD3 A;  3V2T A;  4EQO A;  5IGE A;  5I6W A;  5I9P A;  5DEH A;  5HUR A;  3T16 A;  3OSO A;  4S3S A;  1JOQ A;  5CR3 A;  5C4Z A;  4ODG A;  1JOO A;  5CV8 A;  2KHS A;  3P1H A;  1EYA A;  1F2Z A;  2SNM A;  2F0J A;  2QDB A;  4IUN A;  2EY5 A;  2F0S A;  2F3W A;  1EZ6 A;  5HGT A;  3EJI A;  4HMJ A;  1EYC A;  3SR1 A;  4ZQ3 A;  5E1F A;  4K8J A;  4NMZ A;  4K5X A;  5EGT A;  4EQP A;  2EYJ A;  3MZ5 A;  4DFA A;  4DF7 A;  4ID6 A;  3TP8 A;  4KHV A;  4RKB A;  1II3 A;  2F0D A;  1F2Y A;  5IGB A;  2F0M A;  3NK9 A;  4KJO A;  4HMI A;  4I65 A;  5CV5 A;  1A3T A;  2F0V A;  3H6M A;  5IGF A;  3SK8 A;  4B9W A;  3MXP A;  4YIJ A;  1TT2 A;  4QF4 A;  4DGZ A;  4KY7 A;  2RDF A;  4KY5 A;  2O4X A;  3P75 A;  2PZT A;  2OEO A;  1EY0 A;  4NP5 A;  5KYL A;  3TME A;  1KDA A;  1KDB A;  2F0U A;  3D4D A;  3NXW A;  5IGG A;  1ENC A;  2EYF A;  2NUC A;  3D8G A;  5CV4 A;  5EKK A;  3U9O A;  5C3X A;  5M9O A;  3ITP A;  1RKN A;  3BDC A;  4KTA A;  4DU9 A;  4EVO A;  3ERO A;  3E5S A;  5CV6 A;  4K5V A;  5EKL A;  2F0W A;  1NUC A;  2RKS A;  2F0Q A;  1EZ8 A;  3OMC A;  5F2D A;  5IIF A;  3BDL A;  2PW7 A;  3MHB A;  1SYB A;  1EQV A;  2EY1 A;  5JAV A; 
#chains in the Genus database with same CATH topology
 2IW3 A;  3NPP A;  3RLN A;  2NN6 G;  4WRD A;  5CBA E;  3H3V H;  1TII D;  4K5W A;  1G51 A;  1LTB D;  3IFT A;  1JJC B;  3MEF A;  1TKW B;  2LFN A;  2K01 A;  4YWK A;  2K03 A;  4Q5V A;  2KED A;  3UDI A;  1VQI A;  4BBR G;  4A3I G;  2F52 A;  5IOD A;  2NZH A;  1MSH A;  3ER0 A;  1SYC A;  4IO9 A;  4JYA Q;  1Q81 C;  3RZO B;  1SLJ A;  4KN7 C;  2BA0 A;  3T51 B;  4JYA L;  2NBF A;  3T13 A;  2ZJR A;  3KFU A;  3O13 A;  4L5S A;  2DGY A;  3MFG A;  4O1N A;  4DR3 Q;  2Z9H A;  1SE4 A;  4IUQ A;  5EBC A;  3MXU A;  1EEF D;  4DR3 L;  3OW2 A;  2M00 A;  1VQH A;  4ZYS A;  3KF8 A;  4N9P A;  2XGT A;  3R93 A;  1PYS B;  3K6O A;  4P71 A;  4YY3 Q;  4YY3 L;  4UP7 A;  4R4Q A;  4OXP A;  1FYC A;  2NTT A;  5FLX E;  1L0Y B;  1FJG Q;  2K14 A;  2VS1 A;  4A3L H;  5IGC A;  1KTK A;  2HCI A;  1GUN A;  1FJG L;  2K52 A;  1I4P A;  2DNC A;  5CV7 A;  2GN5 A;  1KNE A;  3T16 A;  2Y0S G;  3JAM E;  1LTG D;  1MJC A;  2EPB A;  2FJ2 A;  1F2Z A;  3VYU A;  2F3W A;  2NVQ H;  1PH1 A;  1V1P A;  1EYC A;  2LXK A;  2K1B A;  1ROD A;  4L5R C;  1TU2 B;  1Y1V B;  3I90 A;  4QUC A;  4HSP A;  4R4C A;  2D9U A;  4KJO A;  4KI0 A;  4HJ9 A;  1SMY C;  4I65 A;  4F88 A;  5M5X H;  4HIK A;  1QG7 A;  4DGZ A;  5IYB G;  2G5D A;  1EQR A;  3CD6 A;  3TME A;  1KDA A;  4P72 A;  2ALY B;  1JR0 D;  4KN4 C;  1L0W A;  2E75 C;  2EZV A;  1EOV A;  3CC4 A;  3J81 E;  1BR9 A;  4JBW A;  1AN8 A;  4GN4 B;  2G9D A;  1Y14 B;  4JC0 A;  3MHB A;  2JA7 G;  5BN4 A;  4ZUJ A;  2HIV A;  3BZD B;  1VQA A;  1WCM H;  1LUZ A;  3CC7 A;  3RN2 A;  2R92 H;  1A3U A;  3HG9 A;  2EDG A;  5JEA J;  1X55 A;  1XTC D;  4KKU A;  4JI1 Q;  1YJ9 A;  3K8A A;  1CQF A;  3MVV A;  1PA6 A;  1X3P A;  1YHA A;  4JI1 L;  2R7Z B;  3P7J A;  2VQE Q;  1WTV A;  2GVA A;  2VW9 A;  1IBL Q;  4B3M Q;  3M7N A;  2NB0 A;  1SMY D;  3GTK B;  3FMC A;  1HQM C;  4A3D B;  2VQE L;  1IBL L;  4B3M L;  5CC4 A;  1HNZ Q;  2C5C A;  2LY7 A;  4H02 A;  4R4I A;  4G57 A;  4TQU S;  3NEN A;  1HNZ L;  3EA6 A;  2B2U C;  3D4W A;  1EQQ A;  3CRL C;  4C3I B;  3BJU A;  4HIO A;  2ID0 A;  2B2T A;  2R61 A;  4DK6 C;  1DON A;  4B08 A;  2R6G A;  1UEB A;  1ZXT A;  1U5K A;  5IWA Q;  1VF5 C;  3S14 H;  1N8R C;  2E76 C;  5IWA L;  2XWJ B;  4LUO A;  2A6H D;  2A5H A;  3ULJ A;  3NWT A;  3V2T A;  4HR7 B;  4KMU C;  3QR8 A;  2LSS A;  4DV6 Q;  2Q2U A;  3TRE A;  4IQZ A;  3MXN B;  4CDE C;  5LHY 1;  4C1N K;  4DV6 L;  2Q2T A;  4A3F H;  3HOX B;  3SR1 A;  3TS0 A;  1DOM A;  1N32 Q;  4A3L G;  3KBX A;  1S4Z A;  1N32 L;  1Y1W B;  5M3M B;  3BU2 A;  4ME3 A;  1Q3L A;  3K57 A;  3DWP A;  3S2H B;  4IPD A;  2OEO A;  3RLF A;  5KYL A;  2Z1C A;  5CV4 A;  2WAQ G;  2E5L Q;  3VDY A;  1V43 A;  3BDC A;  1X54 A;  4QJF A;  1PMR A;  1Z47 A;  5H1S E;  1EIY B;  4MTK A;  2E5L L;  1X32 A;  1M8A A;  1CQV A;  2L4N A;  3S1M H;  4FF1 A;  2F0Q A;  1PLF A;  1KLU D;  2CCZ A;  1TWG B;  3I56 A;  4LNQ A;  1VQE A;  4G7O C;  1XPR A;  2QCP X;  1AZQ A;  3LX0 A;  5LMU Q;  3I8Z A;  1I4R A;  4A3G G;  2EYO A;  1TWH B;  3MFY A;  1U4M A;  1YEZ A;  5LMU L;  3VR5 A;  1KIX A;  2HHH Q;  5BN5 A;  4DAV A;  2AHO B;  2DY7 A;  2HHH L;  4POG A;  2JA6 H;  1L0X B;  4CDF C;  2F0O A;  2RSN A;  1OXS C;  5CV9 A;  2I5L X;  2RVL A;  1WCM G;  3CCJ A;  4HCS A;  2L9H A;  3L0O A;  1F77 A;  1NNX A;  2F4I A;  3GTJ H;  3GV3 A;  2A1A A;  2A74 C;  2EXD A;  2KCT A;  2D0O A;  3NTI A;  2V4D A;  3AFQ A;  1K83 B;  1KC8 C;  3RZO H;  4HJ7 A;  2B3G A;  4G7Z C;  2B2W A;  3K0Y A;  1PRT C;  4JI8 Q;  5ISR A;  1DD2 A;  5IOC A;  2AUJ D;  4LFB Q;  2BH2 A;  2PMZ E;  3QOL A;  3Q6S A;  3PUZ A;  4O0A A;  4JI8 L;  1PH7 A;  3I4M G;  1E2W A;  3C46 A;  4LFB L;  4RHS A;  1L2F A;  1KD1 C;  4FO2 A;  4Z9C B;  2F0L A;  2GA4 B;  3IL8 A;  3BS1 A;  1G8Z D;  1VS0 A;  3HOU B;  3EVQ A;  1VQ5 A;  1Y69 U;  2NVT H;  3MEH A;  4RKL A;  2RSO A;  3I72 A;  1OO9 B;  1UE5 A;  2WAC A;  4CBV A;  3CQZ B;  3FPU B;  2DN8 A;  3N52 A;  1TWF H;  1Y8P B;  1SNQ A;  1A2U A;  3S1R H;  4Q0F A;  4GN5 A;  1HZB A;  2FFK B;  2AQ1 B;  1HTP A;  3NSW A;  2SEB D;  1GXD C;  2WB1 E;  3OW7 A;  5T1I A;  3M4O B;  2NZ1 D;  3PO2 H;  2HT1 A;  4EQP A;  1ET9 A;  4DF7 A;  4YCW A;  3H3V C;  1IBK Q;  3F2D A;  2QGQ A;  4A3M B;  1F2Y A;  2XVS A;  1IBK L;  1NR4 A;  1MSG A;  4DV2 Q;  5FO7 B;  1SJH D;  4XT3 B;  2I5M X;  1KXL A;  4DV2 L;  1VQB A;  2A68 C;  2I07 B;  3PIP A;  3BYY B;  3BVG A;  2B39 A;  1ESF A;  4RA8 A;  4FYD A;  2HCC A;  4A3F G;  1I6V C;  1VQ7 A;  4KTA A;  3I4N B;  2RKS A;  3TS2 A;  1OTC A;  2E8G A;  4QMG A;  2AUK A;  4HN7 A;  3S1Q B;  2XTI A;  3DMU A;  3EFX D;  4QIW E;  5C0X I;  1XWE A;  1Q90 A;  1EYG A;  2EYP A;  4QGU A;  1I5F A;  1NMG A;  4AIM A;  1WJJ A;  5E4X A;  5C3E B;  5GAE C;  2E2J H;  4LAA A;  3S1N B;  4NPS A;  1K8A C;  2F1M A;  3PUY A;  5LL6 S;  1ENF A;  1SYG A;  1TR5 A;  2B2T C;  2A68 D;  2NZO A;  4IFD I;  1STB A;  4H0L C;  1ONL A;  4C56 C;  2JA6 G;  1BXT A;  1FD7 D;  1SRO A;  4IUV A;  4BY7 B;  3FRP B;  1BDO A;  3D0F A;  3KDF B;  1KAA A;  3P20 A;  4XT1 B;  4CGY B;  3KF6 B;  1STY A;  2R7Z H;  5A35 A;  3RNU A;  4A3K H;  1CKO A;  3ND8 A;  1SE2 A;  1SNC A;  3KJO A;  3GTK H;  1LTI D;  1FNW A;  4LF5 Q;  1VQK A;  1FL0 A;  2CWP A;  2XSC A;  4LF5 L;  4OHJ A;  1ILP A;  1J9O A;  3SHL A;  1SBB B;  3C3L A;  4KHP Q;  3PGZ A;  1HZA A;  3CXC A;  3SK6 A;  5I9P A;  5DEH A;  1KAW A;  4KHP L;  4ODG A;  1GOZ A;  4PZ7 A;  4IUN A;  1EYA A;  5C0X H;  3Q23 A;  2XIW A;  1IKM A;  2RDH A;  1YNX A;  4JCV E;  2V1C C;  1D5M C;  2IY5 B;  1PVO A;  4Y7N B;  1NAP A;  5FLM H;  5CV5 A;  4MZ9 A;  1WOC A;  2YTV A;  3Q0A A;  1Q8K A;  1BCP F;  2ZJQ A;  4JV5 Q;  5EPK A;  1TWA H;  2XNA C;  3A55 A;  3PO2 G;  4X3U A;  5GAG C;  1YHQ A;  1F2L A;  2C9O A;  4DXG A;  3GTM B;  4JV5 L;  2KCC A;  2VXW A;  3U4V A;  2L12 A;  4IFD H;  5ELO A;  1E2Z A;  2K05 A;  2EIF A;  4ZAI A;  4OO1 I;  1EU4 A;  5KEE A;  1S3O A;  1JE5 A;  5AFW A;  5CMD A;  1LT4 D;  1HRJ A;  1IYV A;  3K80 C;  2I5H A;  4BA1 I;  2D62 A;  2PI2 E;  4X3K A;  1H9S A;  1WTW A;  4OX9 Q;  2PYK A;  3FEW X;  1CHQ D;  4P75 A;  4OX9 L;  3FDT A;  1PFM A;  4HJ8 A;  3T4A C;  4R9W A;  3K7U C;  1I94 Q;  1I94 L;  4IOA A;  2PQE A;  2B2W C;  2JEB I;  3SE0 A;  5C4J B;  5JJL A;  3A56 A;  1B53 A;  4A3E B;  4QB4 A;  1LTL A;  4A3B H;  4L5T A;  4K6L A;  1CT1 D;  4V0B A;  5COY A;  1VQO A;  5M3F G;  2SDF A;  2KQ3 A;  2MP1 A;  2UUB Q;  1GHJ A;  1JWS D;  1C7Y A;  4N8X 1;  1O80 A;  4DK1 A;  1ASY A;  2UUB L;  3FP9 A;  1ZYR C;  1X56 A;  1WTH A;  1D6E C;  1U4P A;  1Y8N B;  2YTY A;  3PMF A;  2KVM A;  3TP5 A;  1BKB A;  2NYZ D;  5I9O A;  4EQO A;  1VQG A;  4BY1 B;  1G6P A;  3GV6 A;  5FO8 B;  4CDC C;  5M5W B;  3OTO Q;  3CPW A;  3VYT A;  3TP6 A;  4RG1 A;  4DV4 Q;  3OTO L;  1Y8O B;  2B63 G;  1K83 H;  4OO1 H;  2K50 A;  3LGJ A;  1HQR D;  2R7Z G;  4DV4 L;  1UWV A;  4A3K G;  1FR3 A;  2MO1 A;  2JSO A;  3KLS X;  5ELE A;  3IAY A;  2E2I B;  2K5N A;  3QO2 A;  1LTR D;  4DV3 Q;  1YBY A;  4GLA C;  4DV1 Q;  4RKB A;  4DN4 M;  4DV3 L;  2GVB A;  3HKZ E;  4DV1 L;  4A4I A;  1IL8 A;  3OIQ A;  5I4D A;  1B9M A;  2MNA A;  3CF5 A;  3OPO A;  3CQZ H;  2E2H B;  3BG3 A;  1OXT A;  2DJG C;  1K8O A;  1B70 B;  3ZYY X;  2ES2 A;  1BCP D;  5C0X G;  2MQH A;  1HNW Q;  1VDZ A;  1XX8 A;  2F0U A;  1ZYR D;  4JOI A;  5CYU A;  1HNW L;  3NEM A;  2Q2H A;  2A19 A;  1EEI D;  1BCP B;  1WTR A;  2CFM A;  2JA8 B;  3TQY A;  5FLM G;  2CVR A;  1Q8I A;  1IYJ B;  3R8B A;  4GNX A;  2CKZ B;  2K7V A;  1ILQ A;  1I50 B;  4PMC A;  2B8F A;  4NXM Q;  2F0K A;  3CCM A;  5JVH 3;  5C4X B;  1SAP A;  4XTC S;  2VY3 A;  4A3J B;  4NXM L;  3HOW B;  3N6R A;  4OWX B;  1X3F A;  2F4V Q;  1BO0 A;  5GAD C;  3DXJ C;  1M90 C;  1P8L A;  2K6A A;  4BBS B;  2F4V L;  3I7F A;  4LFC Q;  5ELB A;  4IFD G;  3I4N H;  2JA5 B;  1EY9 A;  4LFC L;  2JK8 A;  1TS2 A;  1EIF A;  1C48 A;  3J80 c;  1PTO F;  2NVY B;  3S24 A;  2Q2I A;  1Z6H A;  4R8N A;  1PFB A;  4LF6 Q;  1HR0 W;  4DK0 A;  4LF6 L;  1ESR A;  3H0G H;  3R3O A;  2A69 C;  2K4K A;  5JJK A;  2ZXO A;  5C3E H;  2D2C C;  2UUA Q;  3K7A H;  2F0I A;  1DGS A;  1V1Q A;  3S1N H;  2UUA L;  1LAC A;  2WB1 G;  5I6Y A;  4QCL A;  1MIU A;  5FOB B;  2SOB A;  1L1O A;  2BH8 A;  3CME A;  4A3B G;  2MGS A;  3M3Y B;  5DAU A;  2F0T A;  4TRD A;  1VCI A;  2R93 H;  2OT2 A;  4FVM A;  2KEC A;  1GO3 E;  5NUC A;  4A3C H;  2PQA B;  2ZXP A;  3OSO A;  1CKN B;  3KOJ A;  1WFQ A;  1ET6 A;  4C3J B;  1D5X C;  1VMC A;  1ASZ A;  3GTL H;  1N36 Q;  2EJM A;  2QF7 A;  1VQ9 A;  4IPH A;  3EBE A;  4IUR A;  4O42 A;  4P2C B;  5AJ3 Q;  1N36 L;  2QKI C;  2MUY A;  4AYB B;  3PO3 G;  5DM6 3;  1QZH A;  1PTO C;  5AJ3 L;  1B7Y B;  2F0V A;  1XJV A;  4OO1 G;  4DNI A;  4QF4 A;  4PV1 C;  4WJ4 A;  3FVQ A;  1JE4 A;  1BNZ A;  4KK7 A;  2C35 B;  1ICW A;  5IGG A;  4N8F A;  3G6E A;  3ERS X;  1XPU A;  3G6J B;  3VR2 A;  1C0A A;  4JI3 Q;  3LNN A;  5FJ8 H;  2N8N A;  4RAU C;  1FNV A;  3HOV G;  4JI3 L;  2KEE A;  2K33 A;  4DAY B;  1SFO H;  4CJ0 B;  5JAV A;  1E0B A;  2J7Z A;  3D6W A;  5IT9 L;  3H09 A;  1KHI A;  1B8A A;  1EOT A;  4QY7 A;  2DNE A;  1I4Q A;  3HS0 C;  4C3H B;  3A54 A;  2JYO A;  4X6A H;  1VQD A;  3CPF A;  1EUJ A;  1T9H A;  2LKV A;  1KNA A;  4NXN Q;  2PW5 A;  3IKJ A;  4NXN L;  4C2M B;  2VB2 X;  1NJI C;  4LWC A;  1TQO A;  3HOZ H;  2B2Y A;  2OF1 A;  1PTO D;  1STE A;  4UY8 C;  2LMC B;  3BDO A;  3PQI A;  4HAE A;  1I3Q H;  5C6A A;  5C5L A;  4QUF A;  5KYI A;  3Q22 A;  4IJH A;  1PH6 A;  1EU3 A;  4HIM A;  1HZC A;  2RQX A;  1EL0 A;  3QG1 A;  1W6K A;  3RD4 A;  4HID A;  1MD2 D;  4ZRZ A;  2MO0 A;  2VUM B;  4U67 3;  1WTX A;  1KDC A;  4LF7 Q;  1QVF A;  1PH8 A;  1PV4 A;  4AYB E;  1J5E Q;  4LF7 L;  5J39 A;  5C4J H;  4UDU C;  1CA5 A;  1J6Q A;  1ZKO A;  3LWE A;  1U4L A;  4HTH A;  4CDD C;  1J5E L;  1EYD A;  3H0G G;  4ZK9 B;  4LF4 Q;  1QUQ A;  3MC0 B;  1WTO A;  2N78 A;  2PNH A;  1OXX K;  4LF4 L;  4X65 Q;  3C1E A;  3D4R A;  3MXG A;  1Q7Y C;  4X65 L;  1EWH A;  2OTL A;  1S40 A;  5CV8 A;  1QB5 D;  1TWC B;  2FHT A;  3S17 B;  2Z8L A;  1S5D D;  1JWM D;  4XQQ A;  2EY5 A;  1EZ6 A;  2JXM B;  4JOI C;  3E9H A;  1J8I A;  2R93 G;  3MZ5 A;  1KQS A;  2F3I A;  4BY1 H;  4A3C G;  5M5W H;  3ONA B;  4GNX C;  4GZY C;  1S72 A;  4B9W A;  1RL2 A;  3MXP A;  1D1K A;  1TXY A;  4YIJ A;  4H13 C;  2PZT A;  4PZ6 A;  2NWG A;  4A93 B;  4XYO A;  5C3X A;  4U68 A;  3ITP A;  4M8A A;  4GOP C;  3AFP A;  3ERO A;  2B2V A;  4WJ3 M;  4K5V A;  4UAI A;  5JPN C;  4DR2 Q;  2KHI A;  4B3T Q;  2WIN B;  2HDM A;  2X69 A;  1VQ6 A;  2BOS A;  2KBN A;  2KHJ A;  4DR2 L;  4UP9 A;  3VR6 A;  4B3T L;  4DAP A;  1STN A;  2RCF A;  4Y52 H;  2HDL A;  5EAY A;  1JC7 A;  4L6T B;  2KUM A;  4K0K Q;  1VQC A;  1WI5 A;  1CSP A;  5IGD A;  3X3M A;  1E1O A;  2IL8 A;  3S15 B;  3RUZ A;  1CUK A;  4K0K L;  5FO9 B;  2YU9 B;  3HOY B;  1PRT F;  3A7A B;  2WKD A;  4A76 A;  3A5U A;  4DR5 Q;  1IKL A;  2PO4 A;  4OGQ C;  4DR5 L;  2L0C A;  1X3G A;  2JA8 H;  1AEX A;  4ABN A;  1HR0 Q;  1NSN S;  1I50 H;  2JQO A;  1HR0 L;  1L1O C;  2CHB D;  1K0S A;  2EYL A;  1G91 A;  1FNU A;  3U58 A;  4UP8 A;  1AW7 A;  1HJP A;  1XXG A;  1H95 A;  1TY2 A;  1Z9F A;  3D6C A;  1PFN A;  4CJ1 B;  3HOZ G;  4LFA Q;  3GTQ B;  3ND9 A;  4KKT A;  1U0L A;  3I3C A;  1SSO A;  3K5O A;  1V1O A;  4BBR B;  1RHP A;  4A3I B;  4LFA L;  1F9P A;  2DUD A;  2NVY H;  4MTN A;  5JOB A;  4FXD A;  3CCV A;  4MN3 A;  5K36 H;  1EY5 A;  5GRO A;  3W1G A;  1A0I A;  1B9N A;  2HUG A;  4WFN 3;  3HKZ G;  1SNO A;  1OXV A;  1SND A;  2R92 G;  2ICI A;  3G71 A;  4IUT A;  2Q8T A;  1EY4 A;  3I70 A;  1PHJ A;  5LMN W;  4KD3 A;  2OTJ A;  1AE3 A;  3RMH A;  2K75 A;  1JOO A;  2JJQ A;  3KBG A;  1VQP A;  4EX5 A;  5C0X J;  2KEN A;  4HMJ A;  1VQF A;  2J0T D;  4LJZ C;  4R4T A;  5J3B A;  4RGO S;  3M3Y H;  4UPA A;  2FMC A;  5T1G A;  3TP8 A;  3C2P A;  1A8V A;  5D14 A;  1GUG A;  3A8K E;  5I2Y A;  3AQQ A;  3D31 A;  2PNR C;  2KCN A;  2EOT A;  4RGN A;  4RWS C;  3G48 A;  5IY0 A;  3BZK A;  4B3R Q;  1G29 1;  5IE8 A;  1EY0 A;  4NP5 A;  3D4D A;  3TSS A;  3CW2 C;  1TS5 A;  4HJ5 A;  4B3R L;  1UNS A;  4RHR A;  1LTA D;  1ICF B;  1MBY A;  5EKL A;  2Y0S B;  2N49 A;  3WDN A;  1NTG A;  4F87 A;  2Q8R E;  1H9K A;  3BDL A;  3KF8 B;  5KND A;  4IFD J;  1SYB A;  2A6E C;  1HPC A;  2ZTD A;  2B2Y C;  1JJ2 A;  4CKC A;  4I7Z C;  3J80 L;  3J80 i;  1HFN A;  1HUM A;  1TVX A;  2FMM A;  2WFW A;  4MNO A;  1F9R A;  4ZCK A;  4DA2 A;  3HEJ A;  4RGT A;  1PRT D;  2FXQ A;  3A5Z B;  3NBH A;  3SXH A;  2ZM6 Q;  1E2V A;  1E1T A;  3KYH C;  2ZM6 L;  1IHZ A;  1XMO Q;  4ZLT F;  1Y1V H;  5KGU A;  2PPB C;  2L15 A;  1XMO L;  3GTO B;  2JA7 B;  3RZD B;  1V1P B;  1G2T A;  1WTP A;  3K81 C;  1DJR D;  4YWM A;  3PIO A;  2IX3 A;  2JA8 G;  3UDG A;  3WOE A;  4C2M H;  1R9T B;  1FGB D;  4IOC A;  5IT9 c;  4QL5 A;  3W5O A;  4OEL B;  5CBE E;  2UUC Q;  1Z7T A;  1GUW A;  4KD4 A;  1DOK A;  1BF4 A;  2UUC L;  4K14 A;  1W3S A;  3J7A 5;  1X65 A;  4JG2 A;  2AWO A;  2X6L A;  3U4Z A;  3H91 A;  4OL7 A;  4IPC A;  2Y0S E;  3VYS A;  4S3S A;  3J7Z C;  1S5B D;  5HGT A;  2OWO A;  5K36 G;  2O5J C;  2P5Z X;  3DUZ A;  3FPP A;  2VZA A;  4ID6 A;  3S2D B;  2B2V C;  2NTS A;  1WVL A;  4A3D H;  1I6H B;  3NK9 A;  2XRS D;  3K59 A;  1LT5 D;  3KLR A;  1KL9 A;  3SK8 A;  5EKI A;  5FLX L;  4IUU A;  1DYQ A;  2D5D A;  5IYD H;  4DV5 Q;  4OIK A;  1LTT D;  2RCN A;  3PV0 A;  4DV5 L;  5EKK A;  3S17 H;  3BYT B;  3BZC A;  4FXG C;  1R4P B;  4C3I H;  4FNF A;  2ZTC A;  3HKS A;  3CP0 A;  3PUW A;  5L37 A;  2MPM A;  4JI0 Q;  4EQ5 A;  1UAP A;  2HD3 A;  5KIX A;  4JI0 L;  2A8V A;  3J7A V;  1RDP D;  3CKI B;  3CCS A;  1MGS A;  3E0E A;  4LMQ D;  1Q1E A;  3DHQ A;  2QA4 A;  1RTO A;  1HXY D;  4J1M A;  2EJG C;  1F9Q A;  3S16 B;  1S5C D;  2NVQ B;  2N55 A;  2WAQ B;  2EYH A;  2F0H A;  3HOX H;  4DR7 Q;  1CI3 M;  4GKK Q;  4DR7 L;  4LF8 Q;  4GKK L;  1Y1W H;  4KLK A;  5M3M H;  3CCE A;  3GO5 A;  3EIV A;  4JPB W;  4LF8 L;  1NY4 A;  4MHE A;  5K5P A;  5M5X B;  3IRB A;  3VR3 A;  2F0G A;  2K32 A;  1VQ4 A;  1BOS A;  3S15 H;  3S2H H;  2YV5 A;  3HOY H;  4A3G B;  4RCN A;  3S9W A;  2WII B;  5C44 B;  1Y1V G;  5HGQ A;  3MAQ A;  1S5E D;  1YZ6 A;  1KLG D;  2ATW A;  4F8M A;  1N34 Q;  1TWG H;  5KNB A;  1H9M A;  1O78 A;  4X3S A;  1N34 L;  5KNC A;  2EY6 A;  1WCM B;  3CCL A;  3SK4 A;  4POF A;  1IL2 A;  5LMN Q;  1N9W A;  2DJF C;  5JJI A;  1TWH H;  2WP8 J;  3I4O A;  3UE0 A;  3T56 B;  5LMN L;  2J4X A;  4N9T A;  2RDG A;  1JOQ A;  1C4Q A;  2H4O A;  3GTQ H;  1YNN C;  3P1H A;  3CAM A;  2K5V A;  2CWA A;  5G3L F;  1VQN A;  3AU7 A;  4FF4 A;  1UUP A;  1GUT A;  4O2D A;  2F03 A;  2JEA I;  3NBI A;  1D7Q A;  4OIJ A;  3I4M B;  1HCZ A;  1LTS D;  3J7A F;  1CKM A;  1BBU A;  5IYC H;  3QJY A;  3KLW A;  1I4X A;  2AQ3 B;  2QW7 A;  5A2Q L;  1AE2 A;  2UU9 Q;  1D8L A;  4KY7 A;  1GJX A;  2E74 C;  2UU9 L;  2CQA A;  1PZK D;  5COR A;  2O5I C;  3CCU A;  2R7D A;  3ULP A;  1U4R A;  2EVB A;  4A3D G;  4RGM A;  3H15 A;  3OMC A;  2Q8I B;  1EQV A;  2EY1 A;  1NMF A;  5D3D A;  2K5D A;  4BWG B;  3HOU H;  3S14 B;  4KY6 A;  1XMQ Q;  2Z4I A;  3MXN A;  2CW0 C;  1NCV A;  1LYL A;  3HP3 A;  4KJN A;  1MJE A;  1LV9 A;  4RMF A;  1PZJ D;  5KRU A;  1XMQ L;  1PZI D;  2PCF B;  3DWA A;  1EFW A;  1OXU A;  2IWH A;  4DNT B;  4EGV A;  2ZJP A;  1YNN D;  4JK1 C;  1YIJ A;  1SR3 A;  1SN8 A;  5J22 A;  4GLV B;  4C3I G;  3CC2 A;  1FGU A;  3OWF A;  4A3F B;  1V9P A;  3M4O H;  1E24 A;  5C4H A;  1EFI D;  4PMB A;  3QB3 A;  2Z6K A;  4A3M H;  1EY6 A;  3M85 A;  1DM0 B;  1SNP A;  2PZU A;  3KUP A;  4AQY Q;  4EQN A;  3PIO 3;  4GOP A;  3VA5 A;  4AQY L;  5IYB H;  2HQE A;  3PSI A;  2RBM A;  4OWW B;  1EY8 A;  3HOX G;  1VF7 A;  3OMG A;  4OEM B;  3S1M B;  1Y1W G;  4JI5 Q;  5M3M G;  4E6I A;  3ICE A;  2ICE C;  3J80 E;  1XPO A;  4RH6 A;  3W1B A;  4JI5 L;  3SEB A;  1KAB A;  1A3V A;  2EQS A;  4QQB X;  3S1Q H;  4FP5 D;  2K5W A;  3RZD H;  2ENB A;  3NEL A;  3PUV A;  3UDF A;  1VMP A;  1A2T A;  5D3I B;  1QCB D;  1X3Q A;  4GKJ Q;  2QDL A;  3KJP A;  1VQL A;  2KHS A;  2JA6 B;  2RA4 A;  3UDX A;  3E0J A;  5IP9 H;  1HZ9 A;  5G3L D;  5FK9 C;  4NMZ A;  3Q8D A;  1SRU A;  1G2S A;  1IW7 C;  5GQO A;  1ML0 D;  3L3O C;  2F0M A;  3GTJ B;  3CU7 A;  1CA6 A;  5IGF A;  3CMA A;  1TT2 A;  3AYH B;  4KY5 A;  1G6Z A;  3KK7 A;  4PZ8 A;  1R4Q B;  3Q24 A;  1CTM A;  4BY7 H;  3U9O A;  4XIG S;  1RKN A;  3AMU A;  5CV6 A;  3ULL A;  3U9S A;  2QEX A;  5F2D A;  5IIF A;  3GTP B;  5IYC G;  2PW7 A;  3S2D H;  1I6H H;  1O7Z A;  3OYY A;  4X3T A;  2YYZ A;  2LS0 1;  2AQ2 B;  1SYE A;  2NVT B;  4CJ2 C;  2A69 D;  3ERQ A;  1TWF B;  3S1R B;  4IZ8 A;  4X66 Q;  1WD0 A;  1XTD A;  1BUV T;  3K0X A;  1UE6 A;  3UE1 A;  4X66 L;  1RIP A;  1EIH A;  3QIA A;  1PXU A;  3PO2 B;  1IW7 D;  1RJT A;  3FKI B;  3J7Y W;  1QJO A;  3HOU G;  3B6Y A;  2F0F A;  4Y7N H;  5FLX c;  4JVZ A;  4TKO B;  1Q46 A;  2OQK A;  3DWQ A;  3GP7 A;  3SGI A;  5GAH C;  4KV6 A;  4P73 A;  4DNR B;  3J81 j;  3RLO A;  3TZU A;  5M5Y B;  1KRT A;  2CH4 A;  3JAM c;  3GTM H;  3S16 H;  4NB3 A;  1WYD A;  3JC6 6;  1QWY A;  4LW1 A;  4A3M G;  2F0E A;  4PMW A;  1X6O A;  4XQJ A;  3C1F A;  2L55 A;  4FXK C;  3OHX C;  3I91 A;  2VB3 X;  5EQ0 A;  3K58 A;  4ILW A;  4ZKB B;  1PTO B;  2HQL A;  2AWN A;  1RD9 D;  1HNX Q;  4A3G H;  3K5L A;  4XYQ A;  5BN3 A;  3I4N G;  5HUR A;  5M3F B;  5CR3 A;  1HNX L;  2E2J B;  5C44 H;  3J81 c;  1H9S B;  3MA2 B;  2X6G A;  5EGT A;  1IXR A;  2EYJ A;  2BA1 A;  5DM7 3;  4LF9 Q;  2PI2 A;  4A3E H;  1B2T A;  3T1Y Q;  1HUN A;  3DLL A;  3KDF A;  4LF9 L;  4HMI A;  3KF6 A;  1PYW D;  3T1Y L;  3RR5 A;  1DCZ A;  3NQI A;  4RCO A;  3GDE A;  3BVM A;  4APV A;  5EPJ A;  4LK1 C;  5C3E G;  1HA5 A;  5DNF A;  1YI2 A;  2I0Q A;  3TEH B;  2A6H C;  5IP9 G;  5M9O A;  1QVC A;  2B63 B;  2H1E A;  4GS3 A;  4IJL A;  3R2I A;  2K5Q A;  2JA9 A;  1HHV A;  4A3K B;  2KA7 A;  1B44 D;  1D2B A;  3GQB A;  3I4M H;  3TN2 A;  1H9R A;  2TMP A;  1X3E A;  2OXP A;  1SEB D;  4M1U B;  3TZD A;  4IAL A;  1RCV D;  1TS3 A;  1JWU D;  2Z6K C;  1STA A;  1HTL D;  3RN5 A;  1F2M A;  4BY7 G;  1LT3 D;  5BR8 Q;  3CHB D;  3DEP A;  4P74 A;  1JB7 A;  1JB3 A;  5BR8 L;  1EIG A;  1MKH A;  1H9J A;  5J1Z A;  4X62 Q;  4I7A A;  1QOH A;  1TY0 A;  2E2I H;  3WOF A;  4X62 L;  2EY2 A;  3A8I E;  4TSS A;  2KOL A;  4DUZ Q;  1PH4 A;  1AP0 A;  3A74 A;  5A2Q E;  4DUZ L;  2M9V A;  1O7I A;  1AZP A;  1P16 A;  3AB9 A;  3DEO A;  4X64 Q;  2E2H H;  4K2K A;  1HA6 A;  1K8G A;  1ZEQ X;  2BE5 C;  1SE8 A;  4X64 L;  1TWA B;  2IPK D;  1GD7 A;  3NQT A;  1LM0 A;  4JI6 Q;  4WJW A;  1Q1B A;  5FJ8 G;  3CRK C;  4JI6 L;  1CM9 A;  2RHQ B;  4NW2 A;  1STG A;  4CKE A;  1K8M A;  2F0P A;  1C9O A;  2PMZ B;  4WOR A;  4DR6 Q;  3FHW A;  1GKH A;  1XNR Q;  1GVP A;  3A0J A;  4J6H A;  5C4X H;  3HRZ C;  4DR6 L;  1JT8 A;  1XNR L;  5TSS A;  4A3J H;  1GUS A;  1SYD A;  4K8I A;  2O2L D;  3HOW H;  4IUP A;  1F9S A;  4GNX B;  3PUX A;  4K2L A;  3W2D A;  1K0R A;  1E7Z A;  4BBS H;  2ZXR A;  1NE3 A;  1YJN A;  2VNU D;  4XXE A;  1GHK A;  2L11 A;  2F0J A;  2JA5 H;  2F0S A;  3EJI A;  1NBW A;  1QIL A;  5D65 A;  4ZQ3 A;  5E1F A;  4GOP B;  2NVX B;  1CZW A;  2WB1 B;  3A7L A;  4A3B B;  1C8C A;  1A6X A;  2BE5 D;  1UE1 A;  3H6M A;  2E2D C;  3PCO B;  4R4O A;  2KJX A;  1SDF A;  5C44 G;  1A63 A;  4B3S Q;  4BXX H;  2UXC Q;  3LWU A;  4B3S L;  2UXC L;  3E5S A;  2B29 A;  3A8J E;  4A3E G;  2IHF A;  4XQN A;  1V8Q A;  3NHH A;  4IPG A;  1IBM Q;  4JBK A;  1LT6 D;  3X3N A;  4FF3 A;  3PF4 A;  1IBM L;  4L5Q A;  3PO3 B;  3F8T A;  1L1O B;  3H94 A;  1TS4 A;  4QIW B;  5EJW A;  2JN4 A;  5JEA H;  3TDQ A;  2PZW A;  5ELN A;  4C3J H;  3E6Z X;  1KRS A;  2IX0 A;  4KHZ A;  2IHE A;  2JE6 I;  4OWT B;  3GTP H;  4H7B A;  4BY1 G;  5I2X A;  3GTG B;  4DV7 Q;  1WTQ A;  1QVG A;  1UEA B;  2WKC A;  3DM1 A;  4DV7 L;  3OOC A;  4G4K A;  3HOV B;  1B4O A;  1Q86 C;  5EPL A;  3HGB A;  2XRQ D;  3V05 A;  1UE7 A;  2R7F A;  2BDN A;  1VQ8 A;  2N88 A;  3I4L A;  2MHV A;  4FF2 A;  1LLR D;  1YJW A;  5C5M A;  3NUC A;  4HSV A;  3FKI H;  1PYB A;  1BBX C;  1CFM A;  1WD1 A;  3NWS A;  1VQM A;  5C3W A;  1PRT B;  1STH A;  4LUV A;  4MIU A;  3U50 C;  1A62 A;  4NKL A;  1SMX A;  4NDX A;  4ZUI A;  1U9R A;  1GUO A;  1SE3 A;  1RF2 D;  1GM5 A;  1JOK A;  3E9I A;  4HED A;  4C3H H;  5M5Y H;  4DPG A;  1NR2 A;  5I6W A;  4V19 0;  2BCO A;  2QEJ C;  5C4Z A;  2SNM A;  2QDB A;  3M4Y A;  5IT9 E;  2ASB A;  2A6E D;  5JJZ A;  1PFS A;  3STB C;  5C4X G;  3URY A;  4A3J G;  2F0D A;  3HOW G;  3W3A A;  3AEV A;  2HIX A;  4ULL A;  1PTO H;  4BBS G;  2YTX A;  3H0G B;  4L63 B;  1DOL A;  1QNU A;  3VA7 A;  2JA5 G;  2MFI A;  3NXW A;  5M3F H;  1K9M C;  4JI2 Q;  2VUM H;  4OON A;  3K7A B;  2EJF C;  3M4P A;  1O7Y A;  3K5M A;  3K5N A;  4JI2 L;  4LUZ A;  4DK3 C;  4YWL A;  3BVZ A;  1EZ8 A;  2PQA A;  1HFG A;  1JMC A;  2EE1 A;  2UXD Q;  1JOR A;  1CKN A;  2R93 B;  1VQJ A;  3TBI B;  2UXD L;  4B9X A;  4DAM A;  2BDO A;  4HJA A;  4BXX G;  4FDB A;  4DR1 Q;  4XDX A;  2Z6B A;  4PNY A;  4DR1 L;  2OCE A;  3I2Z A;  1JCK B;  2K04 A;  2R3Z A;  2B63 H;  1TWC H;  4GLX A;  1BVS A;  1QUQ B;  3HFZ B;  1QE6 A;  3STB D;  1EY7 A;  1PH2 A;  1N33 Q;  3GTL B;  2NN6 I;  3OIP A;  2XWB B;  3JAM L;  5HY6 A;  3JAM i;  1N33 L;  1JJG A;  1SNM A;  1T5X D;  2EYM A;  1FVI A;  1BQQ T;  4YHH Q;  5JEA G;  2A73 B;  2DY8 A;  3T53 B;  4YHH L;  1EQT A;  2TSS A;  4J8Q A;  1Q82 C;  4C3J G;  2K5H A;  4A75 A;  4DAY A;  5EBD A;  4A93 H;  5IP7 H;  4K6D A;  2L1B A;  1E22 A;  4YCV A;  2Z4H A;  3EN2 A;  1SXT A;  1CHP D;  5FKA C;  4AYB G;  2OQ0 A;  4JBM A;  1CSQ A;  1T5E A;  1B3Q A;  1SFO B;  5JPM C;  3J81 L;  4BA2 I;  3R2T A;  3J81 i;  3KLS A;  1B50 A;  2QIL A;  5ELD A;  4H44 C;  3E3X A;  5ELC A;  3ZJY C;  2H5X A;  4BS9 A;  4JI4 Q;  4RFB A;  2ZTE A;  3L9A X;  3VR4 A;  3M4Q A;  2YU9 H;  3OWE B;  2JP1 A;  3I73 A;  3TRZ A;  4JI4 L;  5IGE A;  2K28 A;  3FKI G;  1D5Z C;  1BBW A;  5JVG 3;  1QZG A;  3PF5 A;  4ZKC B;  3HOZ B;  4K8J A;  2CQO A;  4DFA A;  3NTH A;  2D0P A;  4KHV A;  1PH5 A;  1IYU A;  1I3Q B;  5IGB A;  2IJ0 A;  1A3T A;  2WV6 D;  4C3H G;  1YNJ C;  2FIN B;  3HKZ B;  2NN6 H;  3EQL C;  3P75 A;  3I55 A;  4GN3 B;  2R92 B;  1XNQ Q;  1PDQ A;  3F2B A;  4PG3 A;  3SDZ A;  4AH6 A;  4DXF A;  1XNQ L;  4DU9 A;  2G9H D;  1YVC A;  4BBR H;  1I4H A;  2F0W A;  1NUC A;  3T1H Q;  4A3I H;  1K3B C;  3M7G A;  3G4S A;  2NVX H;  1DZ1 A;  3T1H L;  2NUC A;  3CCQ A;  1ENA A;  2B8G A;  3F1Z A;  3IFD A;  2VQF Q;  1B1Z A;  1RTN A;  2ZT9 C;  5LL6 X;  2VL6 A;  2VUM G;  1PH9 A;  1K3R A;  1LO5 D;  2VQF L;  4KKS A;  5E3F A;  4YCU A;  1W6J A;  1BCP C;  4TVA B;  2WAQ E;  1IZ6 A;  4G7H C;  3F2C A;  1D1I A;  1W2B A;  1MHW C;  1SYF A;  3SK5 A;  1K73 C;  5CGK A;  1Q12 A;  4JI7 Q;  2Z0S A;  2AMC B;  1DXM A;  1SJE D;  2F0N A;  4F7X A;  1YNJ D;  1M4V A;  4JW0 A;  4JI7 L;  3NTK A;  3DM3 A;  3V96 A;  1S5F D;  2CH4 W;  3PO3 H;  5IYD G;  2SNS A;  4DUY Q;  1EWC A;  2I46 A;  2N3S A;  4DUY L;  2L5T A;  3QOJ A;  4HCE A;  3QWN A;  1CK1 A;  3TP7 A;  3H3V I;  3MTS A;  3SVM A;  1MI2 A;  4R1J A;  2EXZ A;  3HZX A;  3GTG H;  2UXB Q;  5E4W C;  3VYR A;  1LAB A;  4ME5 A;  3NE5 B;  4DR4 Q;  4IN3 A;  2UXB L;  2F3V A;  3CCR A;  1AH9 A;  3HOV H;  2B2U A;  4DR4 L;  3NP8 A;  4DKA C;  3PIP 3;  4A93 G;  1JIC A;  5IP7 G;  4ALP A;  2RF4 A;  3D3R A;  3G7L A;  4J15 A;  2KCM A;  1YHB A;  2MJ8 A;  4JBJ A;  1X9N A;  3L7Z C;  1JQY D;  4CHT B;  3UI2 A;  2IT1 A;  2XN9 C;  2M2L A;  4DV0 Q;  4K5X A;  5ELF A;  4DV0 L;  5E7N A;  2CW0 D;  1II3 A;  5DLQ E;  3NBH B;  1A15 A;  1HH2 P;  1K28 A;  3GD7 A;  1PH3 A;  3GTO H;  2JA7 H;  4C1N I;  3HOY G;  2LXJ A;  2RDF A;  2O4X A;  4UHV A;  1QNK A;  3M9B A;  1E3P A;  4R8I A;  1YIT A;  1M1K C;  1I4G A;  1KDB A;  1ENC A;  1EWI A;  2EYF A;  3D8G A;  4PQX A;  4EVO A;  1O7L A;  2RHS B;  3L2P A;  1R9T H;  2IX1 A;  4GKJ L;  3MWY W;  4CKB A;  1AFP A;  2AKW B;  4L8J A;  3F2U A;  1XYI A;  3WWV A;  1B3A A;  1CZG A; 
#chains in the Genus database with same CATH homology
 2IW3 A;  3NPP A;  2NN6 G;  4WRD A;  5CBA E;  1TII D;  4K5W A;  1LTB D;  3IFT A;  1TKW B;  2LFN A;  2K01 A;  2K03 A;  4Q5V A;  2KED A;  3RZO B;  5IOD A;  1MSH A;  1SYC A;  4KN7 C;  2BA0 A;  3T51 B;  2NBF A;  3T13 A;  3O13 A;  3MFG A;  4O1N A;  1SE4 A;  4IUQ A;  5EBC A;  3MXU A;  1EEF D;  2M00 A;  4ZYS A;  3KF8 A;  4N9P A;  3R93 A;  3K6O A;  1FYC A;  2NTT A;  5FLX E;  1L0Y B;  5IGC A;  1KTK A;  2HCI A;  1GUN A;  1I4P A;  2DNC A;  5CV7 A;  1KNE A;  3T16 A;  3JAM E;  1LTG D;  2EPB A;  2FJ2 A;  1F2Z A;  3VYU A;  2F3W A;  1V1P A;  1EYC A;  2K1B A;  1ROD A;  1TU2 B;  1Y1V B;  3I90 A;  4QUC A;  4HSP A;  2D9U A;  4KJO A;  4KI0 A;  1SMY C;  4I65 A;  4F88 A;  1QG7 A;  4DGZ A;  3TME A;  1KDA A;  1JR0 D;  4KN4 C;  2E75 C;  2EZV A;  3J81 E;  1BR9 A;  4JBW A;  1AN8 A;  2G9D A;  3MHB A;  5BN4 A;  4ZUJ A;  3BZD B;  1A3U A;  3HG9 A;  2EDG A;  5JEA J;  1XTC D;  4KKU A;  1CQF A;  3MVV A;  1X3P A;  2R7Z B;  3P7J A;  1WTV A;  3M7N A;  2NB0 A;  1SMY D;  3GTK B;  3FMC A;  1HQM C;  4A3D B;  5CC4 A;  2C5C A;  2LY7 A;  4G57 A;  4TQU S;  3EA6 A;  2B2U C;  3D4W A;  3CRL C;  4C3I B;  2ID0 A;  2B2T A;  2R61 A;  1DON A;  4B08 A;  2R6G A;  1ZXT A;  1VF5 C;  2E76 C;  2XWJ B;  2A6H D;  2A5H A;  3NWT A;  3V2T A;  4HR7 B;  4KMU C;  4IQZ A;  5LHY 1;  4C1N K;  3HOX B;  3SR1 A;  1DOM A;  3KBX A;  1S4Z A;  1Y1W B;  5M3M B;  1Q3L A;  3K57 A;  3DWP A;  3S2H B;  2OEO A;  3RLF A;  5KYL A;  2Z1C A;  5CV4 A;  1V43 A;  3BDC A;  1PMR A;  1Z47 A;  1X32 A;  1M8A A;  1CQV A;  2L4N A;  4FF1 A;  2F0Q A;  1PLF A;  1KLU D;  1TWG B;  4G7O C;  2QCP X;  1AZQ A;  3LX0 A;  3I8Z A;  1I4R A;  2EYO A;  1TWH B;  3MFY A;  1U4M A;  3VR5 A;  5BN5 A;  4DAV A;  2DY7 A;  1L0X B;  2F0O A;  2RSN A;  1OXS C;  5CV9 A;  2RVL A;  4HCS A;  2L9H A;  1F77 A;  2F4I A;  3GV3 A;  2A74 C;  3NTI A;  2V4D A;  1K83 B;  4G7Z C;  2B2W A;  3K0Y A;  1PRT C;  5ISR A;  1DD2 A;  5IOC A;  2AUJ D;  3QOL A;  3Q6S A;  3PUZ A;  1E2W A;  3C46 A;  4RHS A;  4FO2 A;  4Z9C B;  2F0L A;  2GA4 B;  3IL8 A;  3BS1 A;  1G8Z D;  3HOU B;  3EVQ A;  1Y69 U;  3MEH A;  4RKL A;  2RSO A;  3I72 A;  1OO9 B;  2WAC A;  4CBV A;  3CQZ B;  3FPU B;  2DN8 A;  3N52 A;  1Y8P B;  1SNQ A;  1A2U A;  4Q0F A;  2FFK B;  2AQ1 B;  1HTP A;  3NSW A;  2SEB D;  1GXD C;  3OW7 A;  5T1I A;  3M4O B;  2NZ1 D;  4EQP A;  1ET9 A;  4DF7 A;  3H3V C;  4A3M B;  1F2Y A;  2XVS A;  1NR4 A;  1MSG A;  5FO7 B;  1SJH D;  4XT3 B;  2A68 C;  2I07 B;  3BYY B;  3BVG A;  2B39 A;  1ESF A;  4RA8 A;  4FYD A;  2HCC A;  1I6V C;  4KTA A;  3I4N B;  2RKS A;  4QMG A;  2AUK A;  4HN7 A;  3S1Q B;  3DMU A;  3EFX D;  5C0X I;  1XWE A;  1Q90 A;  2EYP A;  5E4X A;  5C3E B;  4LAA A;  3S1N B;  2F1M A;  3PUY A;  5LL6 S;  1ENF A;  1SYG A;  1TR5 A;  2B2T C;  2A68 D;  4IFD I;  1STB A;  4H0L C;  1ONL A;  4C56 C;  1BXT A;  1FD7 D;  4IUV A;  4BY7 B;  3FRP B;  1BDO A;  3P20 A;  4XT1 B;  1KAA A;  4CGY B;  1STY A;  5A35 A;  3ND8 A;  1SE2 A;  1SNC A;  1LTI D;  1FNW A;  2XSC A;  4OHJ A;  1ILP A;  1J9O A;  3SHL A;  1SBB B;  3C3L A;  3SK6 A;  5I9P A;  5DEH A;  4ODG A;  1GOZ A;  4IUN A;  1EYA A;  5C0X H;  3Q23 A;  2XIW A;  1IKM A;  2RDH A;  1D5M C;  4Y7N B;  1NAP A;  5CV5 A;  3Q0A A;  1BCP F;  5EPK A;  2XNA C;  3A55 A;  4X3U A;  3GTM B;  1F2L A;  2C9O A;  4DXG A;  2KCC A;  2VXW A;  2L12 A;  4IFD H;  1E2Z A;  2K05 A;  4ZAI A;  4OO1 I;  1EU4 A;  5KEE A;  1HRJ A;  5AFW A;  5CMD A;  1LT4 D;  1IYV A;  4BA1 I;  2D62 A;  4X3K A;  1WTW A;  1H9S A;  2PYK A;  3FEW X;  1CHQ D;  3FDT A;  1PFM A;  3T4A C;  4R9W A;  2PQE A;  2B2W C;  2JEB I;  3SE0 A;  5C4J B;  3A56 A;  1B53 A;  4A3E B;  4QB4 A;  4K6L A;  1CT1 D;  4V0B A;  5COY A;  2SDF A;  2KQ3 A;  2MP1 A;  1GHJ A;  1JWS D;  1O80 A;  4DK1 A;  1ZYR C;  1D6E C;  1U4P A;  1Y8N B;  3PMF A;  2KVM A;  3TP5 A;  2NYZ D;  5I9O A;  4EQO A;  4BY1 B;  3GV6 A;  5FO8 B;  5M5W B;  3VYT A;  3TP6 A;  1Y8O B;  4OO1 H;  1HQR D;  1FR3 A;  2JSO A;  3KLS X;  5ELE A;  3IAY A;  2E2I B;  3QO2 A;  1LTR D;  4RKB A;  4DN4 M;  1IL8 A;  3OIQ A;  5I4D A;  1B9M A;  3OPO A;  2E2H B;  3BG3 A;  1OXT A;  1K8O A;  3ZYY X;  1BCP D;  5C0X G;  1VDZ A;  1XX8 A;  2F0U A;  1ZYR D;  5CYU A;  1EEI D;  1BCP B;  1WTR A;  2JA8 B;  2CVR A;  1Q8I A;  3R8B A;  2K7V A;  1ILQ A;  1I50 B;  4PMC A;  2B8F A;  2F0K A;  5JVH 3;  5C4X B;  1SAP A;  4XTC S;  4A3J B;  3HOW B;  3N6R A;  1BO0 A;  3DXJ C;  2K6A A;  4BBS B;  5ELB A;  4IFD G;  2JA5 B;  1EY9 A;  1TS2 A;  1C48 A;  1PTO F;  2NVY B;  1Z6H A;  4R8N A;  1PFB A;  4DK0 A;  1ESR A;  3R3O A;  2A69 C;  2ZXO A;  2D2C C;  2F0I A;  1LAC A;  5I6Y A;  4QCL A;  5FOB B;  2SOB A;  2MGS A;  3M3Y B;  5DAU A;  2F0T A;  4TRD A;  1VCI A;  2OT2 A;  4FVM A;  2KEC A;  5NUC A;  2ZXP A;  3OSO A;  1ET6 A;  4C3J B;  1D5X C;  1VMC A;  2EJM A;  2QF7 A;  4IUR A;  4O42 A;  4P2C B;  2QKI C;  2MUY A;  4AYB B;  5DM6 3;  1PTO C;  2F0V A;  4OO1 G;  4QF4 A;  4PV1 C;  3FVQ A;  1JE4 A;  1BNZ A;  4KK7 A;  1ICW A;  5IGG A;  3G6J B;  3VR2 A;  3LNN A;  4RAU C;  1FNV A;  2KEE A;  2K33 A;  4CJ0 B;  5JAV A;  1E0B A;  2J7Z A;  3D6W A;  5IT9 L;  3H09 A;  1EOT A;  2DNE A;  1I4Q A;  3HS0 C;  4C3H B;  3A54 A;  2JYO A;  2LKV A;  1KNA A;  2PW5 A;  3IKJ A;  4C2M B;  2VB2 X;  1TQO A;  2B2Y A;  2OF1 A;  1PTO D;  1STE A;  2LMC B;  3BDO A;  4HAE A;  5C6A A;  5C5L A;  4QUF A;  5KYI A;  3Q22 A;  1EU3 A;  2RQX A;  1EL0 A;  3QG1 A;  1W6K A;  3RD4 A;  1MD2 D;  4ZRZ A;  2VUM B;  4U67 3;  1WTX A;  1KDC A;  5J39 A;  4UDU C;  1CA5 A;  1ZKO A;  3LWE A;  1U4L A;  4HTH A;  1EYD A;  4ZK9 B;  3MC0 B;  1WTO A;  1OXX K;  3C1E A;  3D4R A;  3MXG A;  1EWH A;  5CV8 A;  1QB5 D;  1TWC B;  2FHT A;  3S17 B;  2Z8L A;  1S5D D;  1JWM D;  4XQQ A;  2EY5 A;  1EZ6 A;  2JXM B;  1J8I A;  3MZ5 A;  3ONA B;  4GZY C;  4B9W A;  3MXP A;  4YIJ A;  1D1K A;  4H13 C;  2PZT A;  2NWG A;  4A93 B;  4XYO A;  5C3X A;  4U68 A;  3ITP A;  4M8A A;  3ERO A;  2B2V A;  4K5V A;  4UAI A;  5JPN C;  2WIN B;  2HDM A;  2X69 A;  2BOS A;  3VR6 A;  4DAP A;  1STN A;  2HDL A;  1JC7 A;  4L6T B;  2KUM A;  5IGD A;  3X3M A;  2IL8 A;  3S15 B;  3RUZ A;  5FO9 B;  2YU9 B;  3HOY B;  1PRT F;  3A7A B;  2WKD A;  1IKL A;  2PO4 A;  4OGQ C;  2L0C A;  1AEX A;  4ABN A;  1NSN S;  2CHB D;  2EYL A;  1G91 A;  1FNU A;  1AW7 A;  1XXG A;  1TY2 A;  3D6C A;  1PFN A;  4CJ1 B;  3GTQ B;  3ND9 A;  4KKT A;  4BBR B;  1V1O A;  1SSO A;  3I3C A;  3K5O A;  4A3I B;  1RHP A;  1F9P A;  5JOB A;  4FXD A;  4MN3 A;  5K36 H;  1EY5 A;  1B9N A;  2HUG A;  4WFN 3;  1SNO A;  1OXV A;  1SND A;  2ICI A;  4IUT A;  2Q8T A;  1EY4 A;  3I70 A;  4KD3 A;  3RMH A;  1JOO A;  3KBG A;  5C0X J;  4HMJ A;  4LJZ C;  2J0T D;  4RGO S;  2FMC A;  5T1G A;  3TP8 A;  3C2P A;  5D14 A;  1GUG A;  3A8K E;  5I2Y A;  3D31 A;  2PNR C;  2KCN A;  2EOT A;  4RGN A;  4RWS C;  1G29 1;  1EY0 A;  4NP5 A;  3D4D A;  3TSS A;  1TS5 A;  1UNS A;  4RHR A;  1LTA D;  1MBY A;  5EKL A;  2Y0S B;  3WDN A;  4F87 A;  2Q8R E;  1H9K A;  3BDL A;  5KND A;  4IFD J;  1SYB A;  2A6E C;  1HPC A;  2B2Y C;  4CKC A;  4I7Z C;  3J80 L;  1HFN A;  1HUM A;  1TVX A;  2FMM A;  1F9R A;  4DA2 A;  3HEJ A;  4RGT A;  1PRT D;  3NBH A;  3SXH A;  1E2V A;  1IHZ A;  4ZLT F;  5KGU A;  2PPB C;  3GTO B;  2JA7 B;  3RZD B;  1V1P B;  1G2T A;  1WTP A;  1DJR D;  2IX3 A;  3WOE A;  1R9T B;  1FGB D;  5CBE E;  1Z7T A;  1GUW A;  4KD4 A;  1DOK A;  1BF4 A;  4K14 A;  2AWO A;  2X6L A;  3H91 A;  4OL7 A;  3VYS A;  4S3S A;  1S5B D;  5HGT A;  5K36 G;  2O5J C;  3DUZ A;  3FPP A;  4ID6 A;  3S2D B;  2B2V C;  2NTS A;  1WVL A;  1I6H B;  3NK9 A;  2XRS D;  3K59 A;  1LT5 D;  3KLR A;  3SK8 A;  5EKI A;  5FLX L;  4IUU A;  1DYQ A;  2D5D A;  4OIK A;  1LTT D;  3PV0 A;  5EKK A;  3BYT B;  4FXG C;  1R4P B;  4FNF A;  3PUW A;  2MPM A;  1UAP A;  5KIX A;  3J7A V;  1RDP D;  3CKI B;  1MGS A;  4LMQ D;  1Q1E A;  3DHQ A;  1RTO A;  1HXY D;  4J1M A;  2EJG C;  1F9Q A;  3S16 B;  1S5C D;  2NVQ B;  2N55 A;  2WAQ B;  2EYH A;  2F0H A;  1CI3 M;  3GO5 A;  4MHE A;  5M5X B;  5K5P A;  3VR3 A;  2F0G A;  2K32 A;  1BOS A;  4A3G B;  4RCN A;  3S9W A;  2WII B;  5C44 B;  3MAQ A;  1S5E D;  1KLG D;  4F8M A;  5KNB A;  1H9M A;  1O78 A;  4X3S A;  5KNC A;  2EY6 A;  1WCM B;  3SK4 A;  2WP8 J;  3T56 B;  2J4X A;  4N9T A;  2RDG A;  1JOQ A;  1C4Q A;  2H4O A;  1YNN C;  3P1H A;  5G3L F;  3AU7 A;  4FF4 A;  1UUP A;  1GUT A;  2F03 A;  2JEA I;  3NBI A;  4OIJ A;  3I4M B;  1HCZ A;  1LTS D;  3J7A F;  3QJY A;  1I4X A;  2AQ3 B;  5A2Q L;  4KY7 A;  1GJX A;  2E74 C;  2CQA A;  1PZK D;  5COR A;  2O5I C;  1U4R A;  2EVB A;  4RGM A;  3OMC A;  2Q8I B;  1EQV A;  2EY1 A;  5D3D A;  2K5D A;  4BWG B;  3S14 B;  4KY6 A;  2Z4I A;  2CW0 C;  3MXN A;  1NCV A;  3HP3 A;  4KJN A;  1LV9 A;  1PZJ D;  5KRU A;  1PZI D;  2PCF B;  3DWA A;  1OXU A;  2IWH A;  4DNT B;  4EGV A;  1YNN D;  4JK1 C;  5J22 A;  4C3I G;  3OWF A;  4A3F B;  5C4H A;  1EFI D;  4PMB A;  3QB3 A;  1EY6 A;  3M85 A;  1DM0 B;  1SNP A;  2PZU A;  3KUP A;  4EQN A;  3PIO 3;  3VA5 A;  2HQE A;  2RBM A;  1EY8 A;  1VF7 A;  3OMG A;  3S1M B;  4E6I A;  2ICE C;  3J80 E;  4RH6 A;  3SEB A;  1KAB A;  1A3V A;  4FP5 D;  2K5W A;  2ENB A;  3PUV A;  1VMP A;  1A2T A;  5D3I B;  1QCB D;  1X3Q A;  2KHS A;  2JA6 B;  2RA4 A;  3E0J A;  5G3L D;  5FK9 C;  4NMZ A;  1G2S A;  1IW7 C;  1ML0 D;  3L3O C;  2F0M A;  3GTJ B;  3CU7 A;  1CA6 A;  5IGF A;  1TT2 A;  4KY5 A;  1G6Z A;  3KK7 A;  1R4Q B;  3Q24 A;  1CTM A;  3U9O A;  4XIG S;  1RKN A;  3AMU A;  5CV6 A;  3U9S A;  5F2D A;  5IIF A;  3GTP B;  2PW7 A;  1O7Z A;  4X3T A;  2YYZ A;  2LS0 1;  2AQ2 B;  1SYE A;  2NVT B;  4CJ2 C;  2A69 D;  3ERQ A;  1TWF B;  3S1R B;  4IZ8 A;  1WD0 A;  1BUV T;  1EIH A;  3QIA A;  1PXU A;  3PO2 B;  1IW7 D;  1RJT A;  3FKI B;  3J7Y W;  1QJO A;  2F0F A;  4TKO B;  3DWQ A;  3GP7 A;  4KV6 A;  4DNR B;  3TZU A;  5M5Y B;  1QWY A;  2F0E A;  4PMW A;  4XQJ A;  3C1F A;  2L55 A;  4FXK C;  3OHX C;  3I91 A;  2VB3 X;  5EQ0 A;  3K58 A;  4ILW A;  4ZKB B;  1PTO B;  2AWN A;  1RD9 D;  3K5L A;  4XYQ A;  5BN3 A;  5HUR A;  5M3F B;  5CR3 A;  2E2J B;  1H9S B;  3MA2 B;  2X6G A;  5EGT A;  2EYJ A;  2BA1 A;  5DM7 3;  1B2T A;  1HUN A;  4HMI A;  1PYW D;  1DCZ A;  3NQI A;  4RCO A;  3BVM A;  5EPJ A;  4LK1 C;  1HA5 A;  5DNF A;  2A6H C;  5M9O A;  2B63 B;  2H1E A;  3R2I A;  2K5Q A;  1HHV A;  4A3K B;  2KA7 A;  1B44 D;  1D2B A;  3GQB A;  3TN2 A;  1H9R A;  2TMP A;  2OXP A;  1SEB D;  4M1U B;  3TZD A;  4IAL A;  1RCV D;  1TS3 A;  1JWU D;  1STA A;  1HTL D;  1F2M A;  1LT3 D;  3CHB D;  3DEP A;  1JB3 A;  1EIG A;  1H9J A;  5J1Z A;  1QOH A;  1TY0 A;  3WOF A;  2EY2 A;  3A8I E;  4TSS A;  2KOL A;  1AP0 A;  5A2Q E;  2M9V A;  1AZP A;  3AB9 A;  3DEO A;  4K2K A;  1HA6 A;  1ZEQ X;  2BE5 C;  1TWA B;  2IPK D;  3NQT A;  4WJW A;  1Q1B A;  3CRK C;  1CM9 A;  4NW2 A;  1STG A;  4CKE A;  1K8M A;  2F0P A;  2PMZ B;  4WOR A;  4J6H A;  3HRZ C;  5TSS A;  1GUS A;  1SYD A;  4K8I A;  2O2L D;  4IUP A;  1F9S A;  3PUX A;  4K2L A;  3W2D A;  2ZXR A;  2VNU D;  4XXE A;  1GHK A;  2L11 A;  2F0J A;  2F0S A;  3EJI A;  1QIL A;  5D65 A;  4ZQ3 A;  5E1F A;  2NVX B;  1CZW A;  2WB1 B;  3A7L A;  4A3B B;  1C8C A;  1A6X A;  2BE5 D;  3H6M A;  2E2D C;  2KJX A;  1SDF A;  3LWU A;  3E5S A;  3A8J E;  4XQN A;  1V8Q A;  3NHH A;  1LT6 D;  3X3N A;  4FF3 A;  3PO3 B;  3H94 A;  1TS4 A;  4QIW B;  5EJW A;  5JEA H;  3TDQ A;  2PZW A;  3E6Z X;  2IX0 A;  4KHZ A;  2JE6 I;  4H7B A;  5I2X A;  3GTG B;  1WTQ A;  1UEA B;  2WKC A;  3DM1 A;  3OOC A;  4G4K A;  3HOV B;  1B4O A;  5EPL A;  3HGB A;  2XRQ D;  3V05 A;  2BDN A;  2N88 A;  3I4L A;  2MHV A;  4FF2 A;  1LLR D;  5C5M A;  3NUC A;  4HSV A;  1BBX C;  1CFM A;  1WD1 A;  3NWS A;  5C3W A;  1PRT B;  1STH A;  4MIU A;  4NKL A;  4NDX A;  4ZUI A;  1U9R A;  1GUO A;  1SE3 A;  1RF2 D;  1JOK A;  4HED A;  1NR2 A;  5I6W A;  4V19 0;  2BCO A;  2QEJ C;  5C4Z A;  2SNM A;  2QDB A;  3M4Y A;  5IT9 E;  2A6E D;  5JJZ A;  3URY A;  2F0D A;  3W3A A;  4ULL A;  1PTO H;  3H0G B;  4L63 B;  1DOL A;  1QNU A;  3VA7 A;  3NXW A;  3K7A B;  2EJF C;  3K5M A;  1O7Y A;  3K5N A;  3BVZ A;  1EZ8 A;  1HFG A;  2EE1 A;  1JOR A;  2R93 B;  3TBI B;  4B9X A;  2BDO A;  4XDX A;  4PNY A;  1JCK B;  2K04 A;  2R3Z A;  1QE6 A;  1EY7 A;  3GTL B;  2NN6 I;  3OIP A;  2XWB B;  3JAM L;  1SNM A;  1T5X D;  2EYM A;  1BQQ T;  5JEA G;  2A73 B;  2DY8 A;  3T53 B;  1EQT A;  2TSS A;  4J8Q A;  4C3J G;  4DAY A;  5EBD A;  4K6D A;  2L1B A;  2Z4H A;  1SXT A;  1CHP D;  5FKA C;  1T5E A;  1SFO B;  5JPM C;  3J81 L;  4BA2 I;  3R2T A;  3KLS A;  1B50 A;  2QIL A;  5ELD A;  4H44 C;  5ELC A;  4BS9 A;  4RFB A;  3VR4 A;  3L9A X;  3OWE B;  2JP1 A;  3I73 A;  5IGE A;  2K28 A;  1D5Z C;  5JVG 3;  4ZKC B;  3HOZ B;  4K8J A;  4DFA A;  3NTH A;  4KHV A;  1IYU A;  1I3Q B;  5IGB A;  2IJ0 A;  1A3T A;  2WV6 D;  4C3H G;  1YNJ C;  2FIN B;  3HKZ B;  2NN6 H;  3EQL C;  3P75 A;  2R92 B;  1PDQ A;  3SDZ A;  4DXF A;  4DU9 A;  2G9H D;  1I4H A;  2F0W A;  1NUC A;  3M7G A;  1DZ1 A;  2NUC A;  1ENA A;  2B8G A;  3IFD A;  1B1Z A;  1RTN A;  2ZT9 C;  5LL6 X;  1LO5 D;  4KKS A;  5E3F A;  1W6J A;  1BCP C;  4G7H C;  1D1I A;  1SYF A;  3SK5 A;  5CGK A;  1Q12 A;  1DXM A;  1SJE D;  2F0N A;  4F7X A;  1YNJ D;  1M4V A;  3NTK A;  3V96 A;  1S5F D;  2SNS A;  1EWC A;  2I46 A;  2L5T A;  3QOJ A;  4HCE A;  3QWN A;  1CK1 A;  3TP7 A;  3MTS A;  3SVM A;  1MI2 A;  2EXZ A;  3HZX A;  5E4W C;  3VYR A;  1LAB A;  4ME5 A;  3NE5 B;  4IN3 A;  2F3V A;  2B2U A;  3NP8 A;  3PIP 3;  1JIC A;  3D3R A;  3G7L A;  2MJ8 A;  3L7Z C;  1JQY D;  4CHT B;  3UI2 A;  2IT1 A;  2XN9 C;  2M2L A;  4K5X A;  5ELF A;  2CW0 D;  1II3 A;  1A15 A;  3GD7 A;  4C1N I;  2RDF A;  2O4X A;  1QNK A;  4R8I A;  1I4G A;  1KDB A;  1ENC A;  2EYF A;  3D8G A;  4PQX A;  4EVO A;  1O7L A;  2IX1 A;  3MWY W;  4CKB A;  1AFP A;  4L8J A;  3F2U A;  1XYI A;  1B3A A;  1CZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...