3T13A

Crystal structure of staphylococcal nuclease variant delta+phs a69g at cryogenic temperature
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENGKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A69G at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 40
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t13A00
1SYGA 2F0JA 3OWFA 3D8GA 3SR1A 4ME5A 5CV7A 3ERQA 4WORA 1STYA 1RKNA 3OSOA 5IOCA 1EQVA 2EYJA 3OMCA 4K8JA 1SYEA 1SYFA 2RKSA 3SXHA 3TP7A 3HZXA 1STBA 5CV9A 4N9TA 4J6HA 3S9WA 1SNOA 5I6YA 5E1FA 4IUNA 1EZ6A 5IIFA 2EYFA 3D4DA 4LAAA 2F0UA 3D4WA 1TQOA 4IZ8A 3EJIA 4K8IA 2LKVA 1SYCA 4K14A 4N9PA 2EY2A 1EY7A 2EY6A 1SYBA 4RKBA 1AEXA 5EKLA 5HGTA 4DFAA 3DHQA 4KD3A 1EZ8A 1STGA 2PYKA 3HEJA 1STAA 1STHA 5IGBA 5KYIA 4K2KA 5C5LA 4PMBA 5IGFA 2F0PA 1U9RA 5C6AA 4HMJA 5KEEA 4KJOA 5KIXA 2F0QA 2PZWA 2F0MA 4J1MA 2RBMA 3MVVA 3PMFA 1TR5A 3T13A 2O4XA 2EXZA 4HTHA 2PW5A 5E3FA 1KDBA 3BDLA 4I65A 2OEOA 1SNDA 5CR3A 4E6IA 5I9OA 5IGEA 2F0LA 1EY8A 1II3A 3NK9A 3NXWA 1SNCA 4H7BA 4KHVA 1A3TA 2M00A 2PQEA 1SNQA 1TT2A 4ZUIA 3MXPA 2F0DA 4EQNA 1NUCA 4TRDA 5IGGA 5KYLA 2F0GA 2EYMA 1EY6A 2F0TA 4YIJA 3VA5A 2SOBA 2NUCA 3SHLA 1IHZA 1JOQA 3TP5A 1EY4A 2EY5A 4ID6A 4OL7A 2F0VA 4NDXA 4K6DA 5EKKA 5IGCA 3NQTA 4NP5A 3TP6A 5C5MA 4B9XA 4F8MA 1SNMA 2ENBA 2F0FA 1ENCA 2EYLA 4KY6A 4WRDA 4IALA 4RKLA 4DU9A 3P1HA 5IGDA 1ENAA 2F0OA 1F2YA 5KGUA 2F0EA 4B9WA 5J1ZA 4MIUA 4K2LA 3SK8A 2F0WA 4G57A 4QB4A 5NUCA 4F7XA 1A2TA 5JOBA 4DF7A 5I6WA 4NKLA 5C4ZA 1A3VA 4KD4A 5HURA 5F2DA 4KV6A 1F2MA 2SNSA 3R3OA 2F3WA 4QF4A 5IODA 2EYPA 1JOKA 5C3WA 2EY1A 3NHHA 3EVQA 5CV5A 1EYAA 3SK4A 4EQPA 4EQOA 1A3UA 3QOJA 3QOLA 5CC4A 3T16A 5CGKA 1SYDA 4R8NA 5C3XA 1KABA 2F3VA 1STNA 2F0NA 1F2ZA 1EYCA 3OMGA 3MEHA 1EY5A 1NSNS 2F0SA 5J39A 4PNYA 4QMGA 4NMZA 2F0IA 3P75A 4ODGA 3MZ5A 3EROA 4ZQ3A 3TP8A 5I9PA 4DGZA 5ISRA 2PZUA 5CV6A 5DEHA 1KAAA 3RUZA 2QDBA 4K5XA 2EYOA 2F0HA 1EYDA 2HQEA 3TMEA 1KDCA 2OF1A 5K5PA 4K5WA 3E5SA 2WACA 4K5VA 3NUCA 2KQ3A 3C1FA 5EGTA 5JAVA 2OXPA 4ZUJA 1KDAA 3BDCA 4EVOA 5M9OA 2F0KA 3H6MA 3U9OA 5CV8A 2PZTA 2SNMA 3ITPA 3MHBA 3D6CA 3NP8A 1JORA 3LX0A 4KY7A 5KRUA 4KJNA 5CV4A 3DMUA 3SK5A 5DAUA 1SNPA 3V2TA 4PMCA 2EYHA 4S3SA 5J22A 2RDFA 1JOOA 1EY0A 2KHSA 4HMIA 3C1EA 3QB3A 5C4HA 1EY9A 2PW7A 4KY5A 1A2UA 3SK6A 4KTAA
chains in the Genus database with same CATH superfamily
4RG1A 1B8AA 1KLUD 4JOIC 4YY3L 1T5XD 4A3MH 3CQZB 2K52A 4N9TA 1YITA 4HEDA 4DV3L 4O2DA 1PFBA 5IIFA 1F9PA 3L3OC 4LAAA 2F0UA 4OX9L 3MXUA 3R93A 2GA4B 4DV4Q 1JCKB 3NBIA 1CKNA 1U4PA 1Y1WH 3OPOA 1UEAB 3DWQA 1UNSA 3MVVA 3PO3G 2I0QA 4BXXH 1TY0A 2OQKA 2Z6BA 4HTHA 1PH4A 1ZEQX 1SFOB 1SNDA 5CR3A 3BYTB 1D5MC 4DR5L 2IX0A 1PMRA 2B29A 1S5FD 3GTQB 3KBXA 1QNUA 5C4XB 1LLRD 2EYMA 5EPJA 4C2MB 1VQHA 3PF4A 4A76A 3FKIG 4YCVA 3TS0A 4F88A 2E5LQ 4HJ5A 4G7HC 3HKZE 4JBKA 2B3GA 4H44C 1Y8NB 2F0OA 4OO1G 3OOCA 3M4PA 4OHJA 5HURA 2O2LD 5IP7G 1K0RA 1V8QA 5K36G 3VR4A 1SE3A 2B2YC 5JPMC 2LMCB 3E9HA 3W5OA 4KHPQ 2NN6H 1EUJA 1STNA 1AFPA 2NVXB 2QEXA 1EY5A 1ONLA 4JI8Q 4A75A 3DWPA 1TWHB 4QMGA 1ESRA 5AFWA 3A8IE 1FL0A 3GTPB 1F77A 1KAAA 1TY2A 3MAQA 4K5XA 3F2UA 1CFMA 4PZ7A 1BBWA 3RD4A 2VQFL 3NUCA 4P71A 1A0IA 2J7ZA 4ZUJA 3ZJYC 1KAWA 1ASZA 4JVZA 2JA7H 3EBEA 1ZXTA 3PO2H 1WFQA 1X9NA 3AFPA 1IL2A 1S40A 4PMCA 5BR8L 4P2CB 3E9IA 5LMNL 2B2VA 4UP8A 3C1EA 3I4OA 2I5HA 1U4MA 1BUVT 4XQQA 2R6GA 4CJ1B 5FLMG 2LSSA 1X3QA 1SLJA 2BE5C 4JYAQ 3TS2A 4DV2L 3BVGA 3U9SA 3HOYG 1Y1VG 2Z4IA 3AFQA 3D4DA 2QEJC 2G9DA 3EJIA 1E2WA 1DXMA 1TWCH 3RN2A 5FJ8H 2BDNA 2Q2UA 4KJOA 3HGBA 1I4GA 1UE5A 3T13A 1DOKA 1TR5A 2O4XA 1JJ2A 1GUOA 1KDBA 3T4AC 3H3VC 1LT5D 3B6YA 3VYTA 4KHVA 3K6OA 4KHZA 1HRJA 4QGUA 1TT2A 2PQAA 1PFNA 1SE4A 5BN4A 3BG3A 4A93G 1HQMC 2PNHA 1ZYRC 3KJOA 3PUYA 2CKZB 4C3HG 1ILQA 2WFWA 4JI3Q 4NP5A 4IJHA 1TIID 2UUAQ 3MXGA 4KY6A 2IJ0A 4JI5L 2F0EA 2NN6I 2RVLA 1DD2A 1EYGA 2F0WA 2R3ZA 1A2TA 1EU4A 1KD1C 4A3KB 3HOWG 2YV5A 2CW0D 2EY1A 3N52A 3S1QB 3NENA 5LHY1 2JXMB 4IURA 4HIOA 3RN5A 3S1NH 3BZCA 4HIDA 1EEFD 1NSNS 4Z9CB 4JBWA 4OWTB 2K05A 3A8KE 2R7DA 3A5ZB 3RUZA 2TMPA 1BCPC 4B3TL 3G6EA 2WKCA 3CKIB 3TQYA 4DUZQ 2O5IC 1YJ9A 3GD7A 2WIIB 2X6LA 4HJ7A 3GTMH 4YCWA 1JOOA 1EY0A 3G4SA 2ZTDA 1Q82C 1WTPA 1G6ZA 5COYA 2F4VL 4OWXB 4HJAA 1H95A 2KBNA 3NWSA 3D8GA 4ME5A 1FR3A 3ERQA 4UP9A 1M1KC 5DLQE 4Q0FA 4OXPA 1IKMA 2NVTB 1E0BA 1TVXA 2EDGA 3M85A 1DONA 1GHKA 5IYCG 1RODA 2DJFC 3NE5B 1S72A 4JI6Q 4DV4L 1EOTA 1SYBA 1N36Q 4ZCKA 3DHQA 4KD3A 4N8FA 4A3IG 1JC7A 1VMPA 3H91A 2TSSA 4MN3A 1AE2A 1KQSA 2F0QA 3U4VA 1PZID 4GNXB 2A19A 3H0GB 2L11A 3NK9A 4H7BA 2KJXA 2KEEA 4OIKA 2BH2A 2FFKB 4GN4B 2KCNA 1N33L 2WINB 1LTSD 4LK1C 3D0FA 2ZJRA 2R93H 1K73C 5GQOA 3AU7A 5IGCA 5IP7H 5M5WB 2E5LL 1X3PA 1YNXA 3S1MB 1E7ZA 4HR7B 1Y1WB 5C0XJ 4CDDC 3MXNA 1DOLA 4RAUC 3AYHB 1LTBD 1QJOA 4OELB 1JJGA 3I55A 3AB9A 5ELCA 2Z0SA 3FVQA 2CQAA 3J81L 3EN2A 1R4QB 2NB0A 1CA6A 4DR6Q 4MNOA 4RHSA 1JB7A 2K5DA 4JI8L 4RA8A 4Q5VA 1L0YB 2NZOA 2MQHA 4NMZA 4DGZA 1OTCA 4NXMQ 4ZYSA 1F9RA 1EYDA 1KDCA 1WTXA 3E5SA 1L1OA 1K8AC 1HR0Q 4DV0Q 1GKHA 1S3OA 2G9HD 4RGOS 4CHTB 2JJQA 5E4XA 2BDOA 2ASBA 1LTGD 2K04A 1AW7A 1YHBA 1ZKOA 2Z8LA 2HIVA 3JC66 5BN5A 3I4NH 3ULJA 4A3BH 1Y8PB 2A68D 1CKOA 1W6JA 5C3EG 3KK7A 5LL6X 1TKWB 1PH7A 4JYAL 2HHHQ 3A7LA 2LXKA 1F9QA 4IUTA 4J6HA 3NWTA 1A62A 4B3MQ 4IZ8A 3EQLC 4CDCC 3PO2B 4DFAA 2QCPX 4FF4A 2E2IB 4K2KA 5C5LA 4LF5L 1L2FA 3PCOB 4LMQD 1LTID 4RMFA 1I50H 1UEBA 3VR2A 1D1KA 4IUQA 4I65A 4GOPC 3X3MA 4UDUC 4XIGS 4A3FG 5TSSA 1NNXA 1QVFA 2VB2X 4HJ9A 3S15H 1SRUA 3RR5A 3FPUB 3T51B 4HIKA 2AQ3B 1YNND 4JI3L 1X6OA 1O80A 5IE8A 2UUAL 5C5MA 4B9XA 5GADC 4A3MG 1VQNA 4BBSB 2EVBA 2C9OA 3HKZB 2NBFA 1AH9A 1I4QA 3P7JA 4YWKA 4F7XA 3JAME 4NKLA 1YZ6A 1AZQA 4RWSC 1HA5A 2K6AA 1G291 5IODA 1K0SA 1X56A 5M5XH 1Y1WG 1SE2A 1D1IA 4BXXG 4EQOA 1NMFA 1PH8A 5CGKA 4POGA 1XNQL 4QIWB 1HZ9A 4CGYB 4DNRB 4O0AA 1HZAA 2IX3A 4ILWA 3PUZA 2H1EA 2SDFA 3MZ5A 4RCNA 4DA2A 2WP8J 1U4RA 1B2TA 1MJCA 4DUZL 2WACA 4L8JA 4LFCL 2JSOA 5KNBA 2KUMA 2K4KA 4J15A 2ZXRA 1GUNA 2R92B 3WDNA 5C0XI 3CCUA 2RHSB 2QILA 4A3JH 2XIWA 4CDFC 2A6HC 1SYGA 3CC7A 3ULPA 3STBC 5IOCA 4A3IH 4JOIA 2VW9A 3SXHA 3CD6A 1WCMH 2JK8A 4R4QA 2JA5G 3PGZA 1HTPA 2NN6G 2X6GA 1SAPA 3I70A 2CFMA 4JI6L 1E1OA 3U58A 2MFIA 1AEXA 1EWIA 3T1YQ 1DJRD 2B63H 4HMJA 1I4HA 3NPPA 5BR8Q 5LMNQ 2EJGC 4PZ6A 4FF1A 3OHXC 5EAYA 5LMNW 1QUQB 5JJLA 2EXZA 3CHBD 1AZPA 2JA7G 1J8IA 1PRTC 3LGJA 3DM3A 1CHPD 3G7LA 1V1QA 4HIMA 3PO3B 5IYBG 2F0TA 4G7ZC 3GTOH 1E2VA 1FGBD 1SBBB 1V43A 4X65Q 1WTVA 1WVLA 3E6ZX 4NDXA 3NTKA 2NVYH 4IUUA 1PLFA 4AH6A 1HPCA 4XYQA 3P1HA 1K83B 2FINB 2LFNA 3CXCA 4KD4A 3TSSA 4F87A 3GTKH 5FJ8G 1MSHA 3G71A 3M7NA 2A6EC 2B2YA 4GKJL 3QWNA 1QB5D 2HCCA 4IUVA 3VR3A 4NXNQ 1IW7C 3QOLA 4P75A 1VQGA 4O42A 3T16A 1CK1A 3MFYA 1W3SA 3RZDH 2RCFA 4FF3A 2JA8G 5FLXL 2Z6KC 1D6EC 4ODGA 4NXML 4AYBB 1WTWA 1HNZQ 2RCNA 1RCVD 1YJWA 3HOUH 3NBHB 2PMZB 4K5VA 1AP0A 2B2UC 1HR0L 3HKSA 2NYZD 3GQBA 1ET6A 1BDOA 2NZHA 2PZTA 3I72A 1C0AA 1YNJD 1L0WA 2JQOA 4XTCS 1Q46A 1SNPA 2HDLA 3HOXH 3BVMA 2OQ0A 3KDFA 3KF8A 1WTOA 5EPLA 1A2UA 3SK6A 3ERSX 3UDXA 1VQMA 1STYA 3S2DH 4JI2Q 3FPPA 1EQVA 3A7AB 2HHHL 3S24A 5HY6A 1SYFA 1PA6A 3BU2A 3HZXA 4B3TQ 3S9WA 2FXQA 4B3ML 3KLSX 1BKBA 3FMCA 5HGTA 1NJIC 2QF7A 3CCMA 4A3FH 2XRQD 2RSNA 3HEJA 3VDYA 1Z6HA 1KL9A 1I6VC 3HOYB 1TWFH 1Y1VB 3AQQA 4J1MA 3F1ZA 2F4VQ 4C56C 3HFZB 1UWVA 4YWMA 1X3FA 4LUZA 1VQEA 1H9KA 1QZGA 4LF8Q 3VYSA 1IL8A 2BOSA 1GHJA 1IBLQ 3K80C 1QVGA 1VQDA 3NSWA 1LUZA 2E74C 3GDEA 2OTLA 4P74A 2CVRA 1FYCA 3UI2A 4L5TA 2Q2HA 1VQIA 2MGSA 1V1PA 3S14H 2EIFA 1RJTA 2G5DA 4PV1C 2BA1A 3CPFA 4F8MA 4A93B 5IGDA 1KRTA 4IALA 1I6HH 1I50B 3GTLB 4AQYQ 1A8VA 2H5XA 1UUPA 3WOFA 2QKIC 3KF6A 4FXGC 5DNFA 4C3HB 3K5OA 3GV3A 4G4KA 1B9NA 1B44D 2B8GA 3S17H 2JYOA 5CBAE 3PIOA 3A54A 1N33Q 5GAGC 2BA0A 3KUPA 1KABA 5D3IB 5KNDA 2CWAA 2AMCB 2VQEL 3HOWB 3MEHA 4LW1A 2EXDA 4GLXA 1HFNA 2ZM6Q 1B50A 1Q7YC 3TP8A 4CKCA 1M8AA 3DM1A 3J80L 1GXDC 1TU2B 5K5PA 1I94L 4BY7H 2R93G 1XMQQ 2AUJD 1XYIA 5DM63 4GKKL 1PDQA 2OXPA 5M9OA 3NQIA 5ELDA 5HGQA 5M5XB 3I56A 3CF5A 3NP8A 4HSPA 1YI2A 3T56B 3M3YB 4AYBG 3K7AH 4LFAL 2L1BA 2JA5H 2EJMA 1HH2P 4QIWE 3TZUA 3EFXD 5C44H 1MI2A 3PUXA 3J81c 3CRKC 1HZBA 4X3UA 4OONA 3J81i 4MZ9A 1K8GA 2I46A 2NVQB 2RKSA 1HQRD 5IP9H 1G2SA 1QILA 4C3IH 2X69A 1I4PA 3CCRA 2MP1A 4LUVA 4LF9Q 2PNRC 5I6YA 4XQJA 3PF5A 3M4OH 2EY2A 2K01A 3T1YL 4WFN3 4DV1L 1EZ8A 3SE0A 1N8RC 4IO9A 2YU9H 2ATWA 5IYBH 1N34L 5M3MH 3H3VI 3RZOH 4E6IA 5IGEA 4DAPA 4Y7NH 4A3IB 3CAMA 3HP3A 1SNCA 1A3TA 2KEDA 4ME3A 4UP7A 1NMGA 1LABA 5IGGA 2BH8A 1VQ9A 1OO9B 1NE3A 1EY6A 4ZAIA 5CORA 1X32A 3I4NG 4A3BG 1I4XA 4X65L 1LACA 3PIO3 4K6DA 2B2WA 1XTDA 2L4NA 2DN8A 2B63B 4WJWA 5EPKA 4LF5Q 4DU9A 4RKLA 5CBEE 4X3TA 1F2YA 5C0XG 3K57A 3SK8A 4QB4A 1EIFA 3S16H 2KHIA 2Y0SG 3HOZH 4LF7Q 1E24A 5F2DA 2SNSA 2JA8H 1KTKA 4GNXC 1Q1EA 3D3RA 4LF4Q 3GTJH 4NXNL 4HCEA 2B39A 2QW7A 3IKJA 1HZCA 3MA2B 1SE8A 5IWAL 1PTOD 2Q2TA 1TS2A 2PI2A 1JJCB 5ISRA 3Q8DA 1HNZL 5DEHA 4JI0Q 1PFSA 3RLFA 3URYA 4DK6C 1VCIA 4H13C 4WJ3M 1JB3A 2E2HH 4Y52H 2VUMH 5JEAJ 3ITPA 3D6CA 4JG2A 5FKAC 1U4LA 3SK5A 4K6LA 3K5MA 2CQOA 5J22A 3Q22A 1PHJA 1HNWQ 3Q0AA 1P16A 2XTIA 3RZDB 1XNQQ 1VS0A 3ONAB 2E75C 5A35A 2PW7A 3HRZC 1D5ZC 4AYBE 1G91A 4JI2L 1PH1A 2VY3A 3OSOA 4IJLA 4BBRH 3R8BA 4DNTB 1R9TH 2PMZE 3KLWA 2QA4A 2PPBC 3D6WA 4QL5A 4LFCQ 1U5KA 3FP9A 1B7YB 1TQOA 1JORA 5C3EB 3CCLA 1PTOF 4DUYL 3K59A 1SMXA 1BBXC 2IX1A 5L37A 1P8LA 3S1RB 1STHA 1JE5A 1PZKD 3HOXB 1LO5D 3G48A 5C6AA 1RD9D 3S2HH 4OGQC 1G51A 1PVOA 2FHTA 2IY5B 3HOVH 1IBMQ 2PW5A 3ULLA 4GOPA 4A3GH 3VYUA 4MTNA 3I8ZA 1Q1BA 1X3EA 5T1GA 4LF8L 4G7OC 1BOSA 4I7ZC 1ET9A 1IBLL 1KLGD 2K50A 2XRSD 4FP5D 5E4WC 5I4DA 4A3JG 4EQ5A 5C4JH 4IPGA 1PTOH 1IHZA 1VQJA 4KN7C 4ID6A 4P72A 4A3FB 2L12A 1YVCA 4X3SA 4DR7L 4DXFA 2JN4A 1WCMG 1PYWD 1SNMA 1EQQA 4X3KA 2R7ZH 4AQYL 2UXBL 5JEAH 4TQUS 1ENAA 4MIUA 2XNAC 4NW2A 4G57A 3KLSA 2F3WA 1DYQA 4A3MB 2B63G 1BO0A 3K0XA 4NB3A 1MJEA 1B53A 2Y0SE 3E0JA 2JA6H 2AUKA 3K5LA 4IPCA 1UE6A 1F2ZA 3S14B 2ZM6L 4XQNA 3VA7A 1QNKA 2J4XA 3HS0C 1I6HB 1KNEA 3OWEB 4FXKC 1RIPA 2EPBA 1XMQL 1SMYD 1YEZA 1H9SA 1GVPA 4IPHA 2F0KA 1TWGH 1CKNB 4GLVB 4RGMA 1QVCA 2N49A 4KY7A 4GKJQ 3DMUA 4M1UB 2MNAA 1QOHA 4HJ8A 1RF2D 1ASYA 2AHOB 2D9UA 4DAYA 5JJIA 4N8X1 4KLKA 1EY9A 1EIHA 1MHWC 3SVMA 3NEMA 5AJ3Q 3K0YA 4X64L 4B08A 3J7ZC 1A6XA 3OMCA 4ABNA 5FLXc 1T5EA 5ELBA 4CKEA 3OW2A 4LF9L 5D3DA 4AIMA 1KC8C 1S5DD 2I07B 3QO2A 1GO3E 1FJGL 4WJ4A 4IUNA 1HR0W 4K8IA 3DEOA 2D5DA 3KOJA 3K7AB 1WTHA 3K58A 3M9BA 1AN8A 2JA5B 4GN3B 1E1TA 3HOUG 1L0XB 3OW7A 2N78A 1A63A 4JI1L 3CPWA 1VQCA 4XYOA 2D0PA 3NXWA 5FOBB 3MXPA 1WD1A 3HOXG 1K8MA 5C0XH 4YIJA 2AKWB 2NUCA 2JA7B 1C8CA 1JOQA 4DPGA 4PMWA 2D62A 4JK1C 5EKKA 3TDQA 1YBYA 3PUWA 2V4DA 1ENCA 4WRDA 3RMHA 2XWJB 1CSQA 2CHBD 5GAEC 5KNCA 3OTOQ 4LF7L 5C4ZA 3CQZH 3NTIA 2L15A 4GLAC 4ZKCB 4KV6A 2A69D 1DZ1A 4LF4L 1LV9A 2ALYB 1JOKA 2ID0A 3NHHA 3EVQA 1VF7A 1O7IA 3RNUA 4JPBW 1K8OA 4R8NA 2AQ2B 2UU9Q 5LL6S 1SDFA 1J5EL 1TWCB 3U4ZA 1Y14B 4CJ0B 4OWWB 1R4PB 1WJJA 5JJZA 1CTMA 2Z6KA 1SFOH 4JI0L 5CV6A 4XT3B 3GTQH 3IFDA 1KNAA 2B8FA 2B2UA 1GM5A 2JA8B 1I3QH 1ICWA 4DK1A 2CW0C 1BR9A 1E2ZA 1CM9A 2WB1G 3LX0A 3H15A 5A2QE 1A15A 1HNWL 2EYHA 3NELA 4DR1L 3C3LA 1ML0D 2VQEQ 2PQAB 4C3JG 3ZYYX 1F2LA 1SYEA 2XSCA 2IWHA 2F03A 5J3BA 1W6KA 1I94Q 2ICIA 2QGQA 1OXVA 3E0EA 1HHVA 3F8TA 3J80c 4GKKQ 2VUMB 3J80i 4YHHQ 2N55A 5EKLA 3BZKA 2LXJA 2NVXH 2YTVA 4LFAQ 4BY7G 2F0PA 2Z9HA 4KKTA 3S1NB 5M3FG 1IYJB 3LWUA 2SEBD 1IBML 1VQBA 1FGUA 1HXYD 2Q8IB 1Q3LA 1HCZA 1S5ED 3A56A 1IXRA 2PQEA 2M00A 2R61A 1I4RA 5KYLA 5C44G 1PH2A 1JR0D 1LT6D 1JWSD 2E2JH 1B70B 1DOMA 5M5YH 2F0VA 1T9HA 3GTMB 1XPUA 4CDEC 3V96A 4DV1Q 3J80E 1B1ZA 4DK3C 5IP9G 4A3CH 3I4MG 1HNXQ 4KKSA 3OYYA 4C3IG 4H02A 4HCSA 3C46A 1N34Q 1D2BA 2KCTA 1Q8KA 2N88A 3IL8A 4K2LA 3CCEA 4DR2Q 1VQ5A 1XNRQ 1AE3A 1Q81C 4X6AH 2HT1A 2K03A 1C4QA 4LUOA 1F2MA 3R3OA 2DGYA 1BBUA 4POFA 1VQKA 5C3WA 1V9PA 1SXTA 2HD3A 2A5HA 3SK4A 1UE7A 4GZYC 4EQPA 1PTOB 5M3MG 2A73B 5BN3A 4K0KL 4DR4Q 1RL2A 3R2TA 1KXLA 2JP1A 5CYUA 4FYDA 2UXCQ 5I9PA 4HAEA 4J8QA 4DV6Q 3KBGA 5IY0A 1YHAA 1SN8A 2EYOA 2BE5D 2KHJA 4DXGA 4IUPA 4KMUC 2VZAA 3CRLC 4QUCA 1Q12A 1BNZA 3PIPA 2ZT9C 1NCVA 2YTXA 2RDGA 1CKMA 3H6MA 1CA5A 4ULLA 5EBCA 1RTNA 5KRUA 2RDHA 4U673 2R93B 3V2TA 4DN4M 3W1BA 5FO7B 5GROA 3HOZG 3QR8A 5ELNA 5IWAQ 2WB1E 2PZUA 4KY5A 5H1SE 1OXSC 2CH4A 2F0JA 4HSVA 3RLOA 3UE1A 5AJ3L 5LMUQ 5CV7A 2IPKD 4WORA 1EIGA 1RKNA 4C1NK 1GJXA 1DGSA 4IOCA 3BS1A 4A3KH 2DY7A 1EU3A 1NR2A 2HIXA 4ZK9B 1M4VA 1EEID 2OWOA 1ZYRD 4N9PA 1HJPA 1EY7A 3U50C 4RKBA 3MXNB 2HQLA 3M4YA 1EWCA 4PMBA 4QCLA 5KEEA 1VQ8A 1H9SB 1LTAD 2IT1A 1B3QA 4A3EG 1PYBA 2KECA 2VUMG 1MD2D 2A68C 2Z1CA 1II3A 3IFTA 1V1OA 1JWUD 2BCOA 4CJ2C 3CW2C 1NUCA 4TRDA 4IFDJ 1ICFB 3D4RA 4U68A 2KENA 3SHLA 3TP5A 3KFUA 3DXJC 1YHQA 4EX5A 4DUYQ 4BBRG 3NQTA 2R7FA 3TP6A 2IW3A 2RA4A 3AMUA 2ES2A 3ICEA 3I4NB 4A3BB 1L1OB 2KCCA 1BCPD 5ELFA 1OXTA 3OTOL 1GUGA 1X3GA 1A3VA 1W2BA 1HUMA 5EKIA 4GNXA 4ALPA 4UY8C 1IYVA 4L5RC 1PYSB 1EFID 3JAML 2O5JC 1EYAA 2A1AA 3HOVG 3PIP3 2UU9L 2Y0SB 3H3VH 4ZLTF 3UDFA 4A3GG 1YNNC 1LYLA 2F0NA 3K81C 3I90A 4DR7Q 4A3DG 2EZVA 2F0IA 1QWYA 3A55A 2UXBQ 3H0GH 5DM73 2QDBA 2HCIA 2HQEA 4JW0A 1QE6A 5JPNC 2YYZA 1IZ6A 5CMDA 1S4ZA 3DWAA 4XXEA 3BDCA 2P5ZX 4C3JH 3U9OA 1B3AA 3S15B 1QCBD 4MHEA 4X62Q 4I7AA 2R7ZG 5JEAG 2E76C 5M5WH 2WAQB 3S1MH 3IRBA 5C4HA 4R9WA 1IBKL 1BCPF 4FF2A 4IFDH 1O78A 4DV7Q 3E3XA 1KIXA 1CZGA 1FVIA 1STBA 2JA6G 4XDXA 5M3FH 4GS3A 2DY8A 1TS5A 4B3SL 1I3QB 1NY4A 2EYFA 3CU7A 2F4IA 4YHHL 2XGTA 1E22A 3D4WA 3ND9A 1K28A 3CMAA 4DF7A 2VNUD 3PV0A 1EQTA 1WTQA 5KIXA 1LTTD 2RBMA 2LY7A 5D14A 3J7AV 1D7QA 2K14A 2HUGA 3I4LA 1JWMD 1Y8OB 1MGSA 2F0LA 1VQLA 1XXGA 2XN9C 1GUTA 3K5NA 4GN5A 2L55A 4X64Q 4ZUIA 3I4MH 2K5NA 4R8IA 3RLNA 4JBMA 2SOBA 1FJGQ 2Q8TA 2PI2E 3MEFA 3FEWX 1H9RA 2B2TC 2IHEA 1K3BC 3Q24A 2VXWA 4EGVA 1HNXL 3CC2A 3GV6A 4A3JB 3C2PA 1GOZA 2NTTA 3LWEA 4FO2A 1EFWA 1OXXK 5J1ZA 4DR2L 1XNRL 4JI1Q 2F3IA 1TS3A 2ZXOA 1XPRA 3J81E 1WCMB 2K5VA 5GAHC 2F52A 5CV5A 1XX8A 2E2JB 3QOJA 2E2IH 3L0OA 4DR4L 2YTYA 1DCZA 5M5YB 2WV6D 2F3VA 4A3LH 2UXDQ 5E7NA 2F0SA 1G6PA 4BWGB 2UXCL 2PCFB 4DV6L 3EROA 4FDBA 3F2CA 3I2ZA 3DLLA 4BA2I 3K8AA 4RFBA 2F0HA 4YCUA 2ZJQA 4IFDI 5EQ0A 2RF4A 4RGTA 5JAVA 4HN7A 2XVSA 1J9OA 3L2PA 5CV8A 2SNMA 2MPMA 4DV5Q 3GTOB 2A74C 2RDFA 1H9JA 4JI7L 2KHSA 1KRSA 2J0TD 4BBSH 4X66L 4JI4Q 2NVYB 5IT9L 1J5EQ 4IOAA 2Q2IA 3C1FA 2KQ3A 5LMUL 3H94A 1X54A 4DR3Q 5EBDA 2UUCL 5IYDH 2JEAI 4K8JA 3TP7A 1CUKA 2GVAA 1SROA 2WAQG 4O1NA 3CP0A 4PG3A 4A3EH 3GTKB 4APVA 1LTRD 1CI3M 3LNNA 2LKVA 1SYCA 2XWBB 4L6TB 2EY6A 2KOLA 1YNJC 4P73A 3TEHB 2L9HA 1RHPA 5IGBA 1FD7D 1VQAA 5IGFA 1K9MC 1EQRA 4DR1Q 1JT8A 3T1HL 5C4XG 4B3RQ 4FVMA 3W3AA 5E3FA 3CCSA 2DNEA 1MBYA 1K3RA 2EQSA 2E8GA 1FNWA 3HOUB 4TSSA 3J81j 2F0DA 1PH6A 3MTSA 1TWAH 2QDLA 3I91A 2F0GA 2MO0A 2RQXA 2FJ2A 2K32A 2MUYA 2R92H 1XWEA 2WKDA 3Q23A 2EY5A 3WOEA 3FRPB 4LF6L 3MC0B 1IKLA 1X55A 1Z9FA 1I5FA 1QG7A 4B9WA 4BY1H 2EOTA 5JOBA 3S2DB 1QUQA 1LT4D 1EIYB 1D8LA 3OIQA 4A3DH 2ZTEA 2EYPA 1N32Q 2KCMA 3I3CA 3BDOA 2FMMA 3KDFB 3KF8B 1ENFA 5C3XA 4KN4C 4H0LC 1SJHD 1EOVA 1EYCA 5J39A 4PNYA 1STEA 2A6HD 1TWFB 1E3PA 3STBD 2N3SA 1VDZA 2VS1A 1C48A 2OTJA 4C1NI 3BJUA 3PO3H 3D31A 1VQFA 4EVOA 4A3CG 1O7YA 1VF5C 4MTKA 4X62L 3MHBA 2V1CC 5DAUA 1BQQT 1PXUA 2B2VC 4K0KQ 1XPOA 4KKUA 1B4OA 4DV7L 4JV5Q 2VL6A 3FKIH 1K83H 1X65A 2WB1B 2NWGA 1PRTD 3A74A 4R1JA 1EL0A 1XMOQ 5FK9C 1CSPA 3T53B 1SNOA 1XTCD 2UUBQ 4C3JB 1V1PB 1EZ6A 3S17B 2C35B 3NBHA 4K14A 1GD7A 4OO1H 2B2WC 1DM0B 2WAQE 5EJWA 4A4IA 2DUDA 2D2CC 1U9RA 5K36H 3KF6B 2PZWA 3PMFA 3GP7A 3VR5A 3I73A 3BDLA 3MFGA 1JQYD 1ILPA 1IYUA 1GUWA 1VMCA 3CCJA 3EIVA 4BY7B 3W2DA 4DAMA 4EQNA 1MSGA 5M3FB 4OEMB 2A6ED 3TZDA 1YIJA 4LFBQ 2ICEC 2K33A 5D65A 1S5BD 1IW7D 4JC0A 4KHPL 3N6RA 1EY4A 2C5CA 4OL7A 1SSOA 4L63B 4QQBX 4A3KG 1BCPB 5C44B 1PRTF 3KYHC 2F0FA 2I5MX 3TN2A 3BVZA 1D5XC 3GTGH 1SEBD 2JA9A 2N8NA 1JE4A 3I4MB 2DNCA 1NR4A 1FNVA 3F2DA 1S5CD 4C3IB 4IQZA 2PO4A 3A5UA 3UDGA 5FLMH 3M4OB 5FLXE 3GO5A 1SYDA 4IPDA 4DK0A 2UXDL 4R4OA 3HOYH 3OMGA 1Y1VH 2KVMA 4L5QA 2YU9B 2MJ8A 2EJFC 2F1MA 3P75A 1M90C 3UE0A 1B9MA 4QJFA 5M3MB 3RZOB 2OF1A 4Y7NB 1QZHA 3BYYB 3KJPA 4BS9A 1J6QA 1O7LA 3W1GA 4DV5L 1Q8IA 4QUFA 4KJNA 3SDZA 3Q6SA 3WWVA 1Q86C 1Q90A 4S3SA 3J7YW 3JAMc 4JI4L 3TBIB 2AWOA 4R4CA 3JAMi 4A93H 1PTOC 4TKOB 3GTLH 4OO1I 2GVBA 4RCOA 2L0CA 2ZXPA 4KTAA 4XT1B 4DR3L 1WI5A 3SR1A 1CT1D 2M2LA 4C3HH 2LS01 3K7UC 3V05A 3QJYA 5I2YA 3CC4A 3S16B 1HA6A 5CV9A 4BA1I 4YY3Q 1CQFA 1WOCA 3HOZB 4DNIA 5C4XH 2K1BA 3J7AF 1O7ZA 4C2MH 3TRZA 1CHQD 4DV3Q 2AWNA 4R4TA 3GTJB 4CBVA 5JJKA 3A8JE 4OX9Q 3IAYA 4KK7A 1STGA 5KYIA 3H0GG 3HOWH 1H9MA 4DKAC 2OT2A 4B3RL 2KA7A 4M8AA 2Q8RE 2RSOA 3X3NA 2F0MA 3TREA 1IBKQ 3DEPA 1C9OA 5I9OA 3EA6A 1PFMA 1PH9A 3FHWA 2GN5A 1EY8A 2CH4W 4DR5Q 2FMCA 1SNQA 1BF4A 2RHQB 4QY7A 4A3EB 1HTLD 2ZJPA 3M3YH 3HG9A 2E2HB 4B3SQ 1VQ6A 4IFDG 4UHVA 3FDTA 5G3LD 1UAPA 5I2XA 1VQ7A 1VQOA 3P20A 3CMEA 1TWHH 4ZKBB 1PH5A 1JMCA 3GTPH 3KLRA 3M7GA 2CCZA 2HDMA 2NVQH 1BXTA 5NUCA 1LM0A 4BBRB 1R9TB 3VR6A 4QF4A 1N32L 1TWAB 3PSIA 3SEBA 4NPSA 1CQVA 3M4QA 1MIUA 1LTLA 2K5HA 4UAIA 2A8VA 3O13A 1Z47A 5IYCH 1CZWA 3AEVA 3BZDB 1YJNA 3S2HB 3G6JB 1UE1A 3HOVB 4BY1B 4RGNA 3TMEA 5ELEA 2L5TA 4A3GB 1XJVA 1MKHA 1PV4A 1G8ZD 1L1OC 5EGTA 2OCEA 2VQFQ 4A3DB 4OIJA 1NTGA 1KDAA 2K28A 5G3LF 3ER0A 1N36L 5C4JB 3QIAA 4YWLA 4IN3A 1F9SA 4PQXA 1FNUA 1SR3A 1HFGA 4GOPB 4HMIA 3QB3A 1WTRA 4JV5L 1WYDA 4KI0A 2R7ZB 3OWFA 1SJED 4LJZC 1XMOL 4LWCA 3PO2G 2M9VA 5FO8B 2Z4HA 3MWYW 2EYJA 1SMYC 4FNFA 3F2BA 2UUBL 4UPAA 4A3LG 4DV2Q 5E1FA 2K75A 2DJGC 3H09A 1RDPD 1GUSA 1VQPA 2PYKA 1STAA 2JA6B 3I7FA 1RTOA 2I5LX 4ZRZA 4JI7Q 4X66Q 4JBJA 3FKIB 1PH3A 2OEOA 3A0JA 2K7VA 3UDIA 5IT9c 1OXUA 1NAPA 2UUCQ 2E2DC 4RH6A 4LFBL 4V0BA 4BBSG 3PQIA 3S1QH 3VA5A 1TWGB 3ND8A 3HKZG 1BVSA 1C7YA 2D0OA 4DR6L 5FO9B 1N9WA 2B2TA 1Z7TA 3PUVA 2ZTCA 5IYDG 4V190 3J7A5 3CCQA 2ENBA 2EYLA 5KGUA 4R4IA 3T1HQ 2H4OA 4RHRA 1PZJD 1TXYA 4JI5Q 1ESFA 5I6WA 2MHVA 3R2IA 2EE1A 1G2TA 4DV0L 4FXDA 5JVH3 5C3EH 1NBWA 4DAYB 5IT9E 1A3UA 2K5QA 3NTHA 5CC4A 3S1RH 1TS4A 1EWHA 2JEBI 4JCVE 4LF6Q 2AQ1B 2MO1A 2IHFA 2IL8A 2VB3X 2CWPA 4ZQ3A 5ELOA 1WD0A 2NVTH 3GTGB 2R92G 4K5WA 2NTSA 3CCVA 1JICA 1LT3D 2A69C 2K5WA 4TVAB 3OIPA 1Y69U 4DAVA 4L5SA 3L9AX 5T1IA 5CV4A 4LNQA 1VQ4A 4BY1G 5JVG3 3L7ZC 1KHIA 4CKBA 3SGIA 1HUNA 1U0LA 2JE6I 1PRTB 2NZ1D 5A2QL 3DUZA 3VYRA 3QG1A 4PZ8A
chains in the Genus database with same CATH topology
1KLUD 1T5XD 3CQZB 4N9TA 4HEDA 1PFBA 5IIFA 1F9PA 3L3OC 4LAAA 2F0UA 3MXUA 3R93A 2GA4B 1JCKB 3NBIA 1U4PA 3OPOA 1UEAB 3DWQA 1UNSA 3MVVA 1TY0A 4HTHA 1ZEQX 1SFOB 1SNDA 5CR3A 3BYTB 1D5MC 2IX0A 1PMRA 1S5FD 3GTQB 3KBXA 1QNUA 5C4XB 1LLRD 2EYMA 5EPJA 4C2MB 4F88A 4G7HC 4H44C 1Y8NB 2F0OA 4OO1G 3OOCA 4OHJA 5HURA 2O2LD 1V8QA 5K36G 3VR4A 1SE3A 2B2YC 5JPMC 2LMCB 2NN6H 1STNA 1AFPA 2NVXB 1EY5A 1ONLA 3DWPA 1TWHB 4QMGA 1ESRA 5AFWA 3A8IE 3GTPB 1F77A 1KAAA 1TY2A 3MAQA 4K5XA 3F2UA 1CFMA 3RD4A 3NUCA 2J7ZA 4ZUJA 1ZXTA 4PMCA 4P2CB 2B2VA 3C1EA 1U4MA 1BUVT 4XQQA 2R6GA 4CJ1B 1X3QA 2BE5C 3BVGA 3U9SA 2Z4IA 3D4DA 2QEJC 2G9DA 3EJIA 1E2WA 1DXMA 2BDNA 4KJOA 3HGBA 1I4GA 3T13A 1DOKA 1TR5A 2O4XA 1GUOA 1KDBA 3T4AC 3H3VC 1LT5D 3VYTA 4KHVA 3K6OA 4KHZA 1HRJA 1TT2A 1PFNA 1SE4A 5BN4A 3BG3A 1HQMC 1ZYRC 3PUYA 4C3HG 1ILQA 4NP5A 1TIID 3MXGA 4KY6A 2IJ0A 2F0EA 2NN6I 2RVLA 1DD2A 2F0WA 2R3ZA 1A2TA 1EU4A 4A3KB 2CW0D 2EY1A 3N52A 3S1QB 5LHY1 2JXMB 4IURA 1EEFD 1NSNS 4Z9CB 4JBWA 2K05A 3A8KE 3RUZA 2TMPA 1BCPC 2WKCA 3CKIB 2O5IC 3GD7A 2WIIB 2X6LA 1JOOA 1EY0A 1WTPA 1G6ZA 5COYA 3NWSA 3D8GA 4ME5A 1FR3A 3ERQA 4Q0FA 1IKMA 2NVTB 1E0BA 1TVXA 2EDGA 3M85A 1DONA 1GHKA 1RODA 3NE5B 1EOTA 1SYBA 3DHQA 4KD3A 1JC7A 1VMPA 3H91A 2TSSA 4MN3A 2F0QA 1PZID 3H0GB 3NK9A 2L11A 4H7BA 2KJXA 2KEEA 4OIKA 2FFKB 2KCNA 2WINB 1LTSD 4LK1C 3AU7A 5IGCA 5M5WB 1X3PA 3S1MB 4HR7B 1Y1WB 5C0XJ 3MXNA 1DOLA 4RAUC 1LTBD 1QJOA 3AB9A 5ELCA 3FVQA 2CQAA 3J81L 1R4QB 2NB0A 1CA6A 4RHSA 2K5DA 4RA8A 4Q5VA 1L0YB 4NMZA 4DGZA 4ZYSA 1F9RA 1EYDA 1KDCA 1WTXA 3E5SA 2G9HD 4RGOS 4CHTB 5E4XA 2BDOA 1LTGD 2K04A 1AW7A 1ZKOA 2Z8LA 5BN5A 1Y8PB 2A68D 1W6JA 3KK7A 5LL6X 1TKWB 3A7LA 1F9QA 4IUTA 4J6HA 3NWTA 4IZ8A 3EQLC 3PO2B 4DFAA 2QCPX 4FF4A 2E2IB 4K2KA 5C5LA 4LMQD 1LTID 3VR2A 1D1KA 4IUQA 4I65A 3X3MA 4UDUC 4XIGS 5TSSA 2VB2X 3FPUB 3T51B 2AQ3B 1YNND 1O80A 5C5MA 4B9XA 4BBSB 2EVBA 2C9OA 3HKZB 2NBFA 1I4QA 3P7JA 4F7XA 3JAME 4NKLA 1AZQA 4RWSC 1HA5A 2K6AA 1G291 5IODA 1SE2A 1D1IA 4EQOA 5CGKA 4QIWB 4CGYB 4DNRB 2IX3A 4ILWA 3PUZA 2H1EA 2SDFA 3MZ5A 4RCNA 4DA2A 2WP8J 1U4RA 1B2TA 2WACA 4L8JA 2JSOA 5KNBA 2KUMA 2ZXRA 1GUNA 2R92B 3WDNA 5C0XI 2QILA 2XIWA 2A6HC 1SYGA 5IOCA 3SXHA 1HTPA 2NN6G 2X6GA 1SAPA 3I70A 1AEXA 1DJRD 4HMJA 1I4HA 3NPPA 2EJGC 4FF1A 3OHXC 2EXZA 3CHBD 1AZPA 1J8IA 1PRTC 1CHPD 3G7LA 3PO3B 4G7ZC 2F0TA 1E2VA 1FGBD 1SBBB 1V43A 1WTVA 1WVLA 3E6ZX 4NDXA 3NTKA 4IUUA 1PLFA 1HPCA 4XYQA 3P1HA 1K83B 2FINB 2LFNA 4KD4A 3TSSA 4F87A 1MSHA 3M7NA 2A6EC 2B2YA 3QWNA 1QB5D 2HCCA 4IUVA 3VR3A 1IW7C 3QOLA 4O42A 3T16A 1CK1A 3MFYA 4FF3A 5FLXL 4ODGA 1D6EC 4AYBB 1WTWA 1RCVD 2PMZB 4K5VA 1AP0A 2B2UC 2NYZD 3GQBA 1ET6A 1BDOA 2PZTA 3I72A 1YNJD 4XTCS 1SNPA 2HDLA 3BVMA 3KF8A 1WTOA 5EPLA 1A2UA 3SK6A 1STYA 3FPPA 1EQVA 3A7AB 1SYFA 3HZXA 3S9WA 3KLSX 3FMCA 5HGTA 2QF7A 2XRQD 2RSNA 3HEJA 1Z6HA 1I6VC 3HOYB 1Y1VB 4J1MA 4C56C 1H9KA 3VYSA 1IL8A 2BOSA 1GHJA 3NSWA 2E74C 2CVRA 1FYCA 3UI2A 2MGSA 1V1PA 1RJTA 4PV1C 2BA1A 4F8MA 4A93B 5IGDA 4IALA 1I50B 3GTLB 1UUPA 3WOFA 2QKIC 4FXGC 5DNFA 4C3HB 3K5OA 3GV3A 4G4KA 1B9NA 1B44D 2B8GA 2JYOA 5CBAE 3A54A 2BA0A 3KUPA 1KABA 5D3IB 5KNDA 3HOWB 3MEHA 1HFNA 1B50A 3TP8A 4CKCA 1M8AA 3DM1A 3J80L 1GXDC 1TU2B 5K5PA 2AUJD 1XYIA 5DM63 1PDQA 2OXPA 5M9OA 3NQIA 5ELDA 5M5XB 3NP8A 4HSPA 3T56B 3M3YB 2L1BA 2EJMA 3TZUA 3EFXD 1MI2A 3PUXA 3CRKC 4X3UA 2I46A 2NVQB 2RKSA 1HQRD 1G2SA 1QILA 2X69A 1I4PA 2MP1A 2PNRC 5I6YA 4XQJA 2EY2A 2K01A 4WFN3 1EZ8A 3SE0A 4E6IA 5IGEA 4DAPA 4A3IB 3HP3A 1SNCA 1A3TA 2KEDA 1LABA 5IGGA 1OO9B 1EY6A 4ZAIA 5CORA 1X32A 1I4XA 1LACA 3PIO3 4K6DA 2B2WA 2L4NA 2DN8A 2B63B 4WJWA 5EPKA 4DU9A 4RKLA 5CBEE 4X3TA 1F2YA 5C0XG 3K57A 3SK8A 4QB4A 5F2DA 2SNSA 1KTKA 1Q1EA 3D3RA 4HCEA 2B39A 3IKJA 3MA2B 1PTOD 1TS2A 5ISRA 5DEHA 3RLFA 3URYA 1VCIA 4H13C 1JB3A 5JEAJ 3ITPA 3D6CA 5FKAC 1U4LA 3SK5A 4K6LA 3K5MA 5J22A 3Q22A 3Q0AA 3RZDB 3ONAB 2E75C 5A35A 2PW7A 3HRZC 1D5ZC 1G91A 3OSOA 3R8BA 4DNTB 2PPBC 3D6WA 1TQOA 1JORA 5C3EB 1PTOF 3K59A 1BBXC 2IX1A 3S1RB 1STHA 1PZKD 3HOXB 1LO5D 5C6AA 1RD9D 4OGQC 2FHTA 2PW5A 3VYUA 3I8ZA 1Q1BA 4G7OC 5T1GA 1BOSA 4I7ZC 1ET9A 1KLGD 2XRSD 4FP5D 5E4WC 5I4DA 1PTOH 1IHZA 4KN7C 4ID6A 4A3FB 2L12A 4X3SA 4DXFA 1PYWD 1SNMA 4X3KA 5JEAH 4TQUS 1ENAA 4MIUA 2XNAC 4NW2A 4G57A 3KLSA 2F3WA 1DYQA 4A3MB 1BO0A 1B53A 3E0JA 2AUKA 3K5LA 1F2ZA 3S14B 4XQNA 3VA7A 1QNKA 2J4XA 3HS0C 1I6HB 1KNEA 3OWEB 4FXKC 2EPBA 1SMYD 1H9SA 2F0KA 4RGMA 4KY7A 3DMUA 4M1UB 1QOHA 1RF2D 2D9UA 4DAYA 1EY9A 1EIHA 3SVMA 3K0YA 4B08A 1A6XA 3OMCA 4ABNA 1T5EA 5ELBA 4CKEA 5D3DA 1S5DD 2I07B 3QO2A 4IUNA 4K8IA 3DEOA 2D5DA 3K7AB 3K58A 1AN8A 2JA5B 1L0XB 3OW7A 4XYOA 3NXWA 5FOBB 3MXPA 1WD1A 1K8MA 5C0XH 4YIJA 2NUCA 2JA7B 1C8CA 1JOQA 4PMWA 2D62A 4JK1C 5EKKA 3TDQA 3PUWA 2V4DA 1ENCA 4WRDA 3RMHA 2XWJB 2CHBD 5KNCA 5C4ZA 3NTIA 4ZKCB 4KV6A 2A69D 1DZ1A 1LV9A 1JOKA 2ID0A 3NHHA 3EVQA 1VF7A 1K8OA 4R8NA 2AQ2B 5LL6S 1SDFA 1TWCB 4CJ0B 1R4PB 5JJZA 1CTMA 5CV6A 4XT3B 3IFDA 1KNAA 2B8FA 2B2UA 2JA8B 1ICWA 4DK1A 2CW0C 1BR9A 1E2ZA 1CM9A 3LX0A 5A2QE 1A15A 2EYHA 3C3LA 1ML0D 4C3JG 3ZYYX 1F2LA 1SYEA 2XSCA 2IWHA 2F03A 1W6KA 2ICIA 1OXVA 1HHVA 2VUMB 2N55A 5EKLA 2F0PA 4KKTA 3S1NB 3LWUA 2SEBD 1HXYD 2Q8IB 1Q3LA 1HCZA 1S5ED 3A56A 2PQEA 2M00A 2R61A 1I4RA 5KYLA 1JR0D 1LT6D 1JWSD 1DOMA 2F0VA 3GTMB 3V96A 3J80E 1B1ZA 4KKSA 4C3IG 4HCSA 3C46A 1D2BA 2N88A 3IL8A 4K2LA 2K03A 1C4QA 1F2MA 3R3OA 5C3WA 1SXTA 2A5HA 3SK4A 4GZYC 4EQPA 1PTOB 2A73B 5BN3A 3R2TA 2JP1A 5CYUA 4FYDA 5I9PA 4HAEA 4J8QA 3KBGA 2EYOA 2BE5D 4DXGA 4IUPA 4KMUC 3CRLC 4QUCA 1Q12A 1BNZA 2ZT9C 1NCVA 2RDGA 3H6MA 1CA5A 4ULLA 5EBCA 1RTNA 5KRUA 2RDHA 4U673 2R93B 3V2TA 4DN4M 5FO7B 4KY5A 2PZUA 1OXSC 2F0JA 4HSVA 5CV7A 2IPKD 4WORA 1EIGA 1RKNA 4C1NK 1GJXA 3BS1A 2DY7A 1EU3A 1NR2A 4ZK9B 1M4VA 1EEID 1ZYRD 4N9PA 1EY7A 4RKBA 3M4YA 1EWCA 4PMBA 4QCLA 5KEEA 1H9SB 1LTAD 2IT1A 2KECA 1MD2D 2A68C 2Z1CA 1II3A 3IFTA 1V1OA 1JWUD 2BCOA 4CJ2C 1NUCA 4TRDA 4IFDJ 3D4RA 4U68A 3SHLA 3TP5A 3DXJC 3NQTA 3TP6A 2IW3A 2RA4A 3AMUA 3I4NB 4A3BB 2KCCA 1BCPD 5ELFA 1OXTA 1GUGA 1A3VA 1HUMA 5EKIA 1IYVA 1EFID 3JAML 2O5JC 1EYAA 3PIP3 2Y0SB 4ZLTF 1YNNC 2F0NA 3I90A 2EZVA 2F0IA 1QWYA 3A55A 5DM73 2QDBA 2HCIA 2HQEA 1QE6A 5JPNC 2YYZA 5CMDA 1S4ZA 3DWAA 4XXEA 3BDCA 3U9OA 1B3AA 3S15B 1QCBD 4MHEA 5JEAG 2E76C 2WAQB 5C4HA 4R9WA 4FF2A 1BCPF 4IFDH 1O78A 1CZGA 1STBA 4XDXA 2DY8A 1TS5A 1I3QB 2EYFA 3CU7A 2F4IA 3D4WA 3ND9A 4DF7A 2VNUD 3PV0A 1EQTA 1WTQA 5KIXA 1LTTD 2RBMA 2LY7A 5D14A 3J7AV 2HUGA 3I4LA 1JWMD 1Y8OB 1MGSA 2F0LA 1XXGA 2XN9C 1GUTA 3K5NA 2L55A 4ZUIA 4R8IA 2SOBA 2Q8TA 3FEWX 1H9RA 2B2TC 3Q24A 2VXWA 4EGVA 3GV6A 4A3JB 3C2PA 1GOZA 2NTTA 3LWEA 4FO2A 1OXXK 5J1ZA 1TS3A 2ZXOA 3J81E 1WCMB 5CV5A 1XX8A 2E2JB 3QOJA 1DCZA 5M5YB 2WV6D 2F3VA 2F0SA 4BWGB 2PCFB 3EROA 4BA2I 4RFBA 2F0HA 4IFDI 5EQ0A 4RGTA 5JAVA 4HN7A 2XVSA 1J9OA 5CV8A 2SNMA 2MPMA 3GTOB 2A74C 2RDFA 1H9JA 2KHSA 2J0TD 2NVYB 5IT9L 3C1FA 2KQ3A 3H94A 5EBDA 2JEAI 4K8JA 3TP7A 4O1NA 3GTKB 1LTRD 1CI3M 3LNNA 2LKVA 1SYCA 2XWBB 4L6TB 2EY6A 2KOLA 1YNJC 2L9HA 1RHPA 5IGBA 1FD7D 5IGFA 4FVMA 3W3AA 5E3FA 2DNEA 1MBYA 3HOUB 1FNWA 4TSSA 2F0DA 3MTSA 3I91A 2F0GA 2RQXA 2FJ2A 2K32A 2MUYA 1XWEA 2WKDA 3Q23A 2EY5A 3WOEA 3FRPB 3MC0B 1IKLA 1QG7A 4B9WA 2EOTA 5JOBA 3S2DB 1LT4D 3OIQA 2EYPA 3I3CA 3BDOA 2FMMA 1ENFA 5C3XA 4KN4C 4H0LC 1SJHD 1EYCA 5J39A 4PNYA 1STEA 2A6HD 1TWFB 1VDZA 1C48A 4C1NI 3D31A 4EVOA 1O7YA 1VF5C 3MHBA 5DAUA 1BQQT 1PXUA 2B2VC 4KKUA 1B4OA 2WB1B 2NWGA 1PRTD 1EL0A 5FK9C 3T53B 1SNOA 1XTCD 4C3JB 1V1PB 1EZ6A 3S17B 3NBHA 4K14A 4OO1H 2B2WC 1DM0B 5EJWA 2D2CC 1U9RA 5K36H 2PZWA 3PMFA 3GP7A 3VR5A 3I73A 3BDLA 3MFGA 1JQYD 1ILPA 1IYUA 1GUWA 1VMCA 4BY7B 3W2DA 4EQNA 1MSGA 5M3FB 2A6ED 3TZDA 2ICEC 2K33A 5D65A 1S5BD 1IW7D 3N6RA 1EY4A 2C5CA 4OL7A 1SSOA 4L63B 1BCPB 5C44B 1PRTF 2F0FA 3TN2A 3BVZA 1D5XC 1SEBD 1JE4A 3I4MB 2DNCA 1NR4A 1FNVA 1S5CD 4C3IB 4IQZA 2PO4A 3M4OB 5FLXE 3GO5A 1SYDA 4DK0A 3OMGA 2KVMA 2YU9B 2MJ8A 2EJFC 2F1MA 3P75A 1B9MA 5M3MB 3RZOB 2OF1A 4Y7NB 3BYYB 4BS9A 1O7LA 1Q8IA 4QUFA 4KJNA 3SDZA 3Q6SA 1Q90A 4S3SA 3J7YW 3TBIB 2AWOA 1PTOC 4TKOB 4OO1I 4RCOA 2L0CA 2ZXPA 4KTAA 4XT1B 3SR1A 1CT1D 2M2LA 2LS01 3V05A 3QJYA 5I2YA 3S16B 1HA6A 5CV9A 4BA1I 1CQFA 3HOZB 2K1BA 3J7AF 1O7ZA 1CHQD 2AWNA 3GTJB 4CBVA 3A8JE 3IAYA 4KK7A 1STGA 5KYIA 1H9MA 2OT2A 2KA7A 4M8AA 2Q8RE 2RSOA 3X3NA 2F0MA 3DEPA 5I9OA 3EA6A 1PFMA 1EY8A 2FMCA 1SNQA 1BF4A 4A3EB 1HTLD 3HG9A 2E2HB 4IFDG 3FDTA 5G3LD 1UAPA 5I2XA 3P20A 4ZKBB 3KLRA 3M7GA 2HDMA 1BXTA 5NUCA 4BBRB 1R9TB 3VR6A 4QF4A 1TWAB 3SEBA 1CQVA 4UAIA 3O13A 1Z47A 1CZWA 3BZDB 3S2HB 3G6JB 3HOVB 4BY1B 4RGNA 3TMEA 5ELEA 2L5TA 4A3GB 1G8ZD 5EGTA 4A3DB 4OIJA 1KDAA 2K28A 5G3LF 5C4JB 3QIAA 4IN3A 1F9SA 4PQXA 1FNUA 1HFGA 4HMIA 3QB3A 1WTRA 4KI0A 2R7ZB 3OWFA 1SJED 4LJZC 2M9VA 5FO8B 2Z4HA 3MWYW 2EYJA 1SMYC 4FNFA 5E1FA 3H09A 1RDPD 1GUSA 2PYKA 1STAA 2JA6B 1RTOA 4ZRZA 3FKIB 2OEOA 2K7VA 1OXUA 1NAPA 2E2DC 4RH6A 4V0BA 3VA5A 1TWGB 3ND8A 5FO9B 2B2TA 1Z7TA 3PUVA 4V190 2ENBA 2EYLA 5KGUA 2H4OA 4RHRA 1PZJD 1ESFA 5I6WA 2MHVA 3R2IA 2EE1A 1G2TA 4FXDA 5JVH3 5IT9E 1A3UA 2K5QA 3NTHA 5CC4A 1TS4A 1EWHA 2JEBI 2AQ1B 2IL8A 2VB3X 4ZQ3A 1WD0A 3GTGB 4K5WA 2NTSA 1JICA 1LT3D 2A69C 2K5WA 3OIPA 1Y69U 4DAVA 3L9AX 5T1IA 5CV4A 5JVG3 3L7ZC 4CKBA 1HUNA 2JE6I 1PRTB 2NZ1D 5A2QL 3DUZA 3VYRA 3QG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYG A;  2F0J A;  3OWF A;  3D8G A;  3SR1 A;  4ME5 A;  5CV7 A;  3ERQ A;  4WOR A;  1STY A;  1RKN A;  3OSO A;  5IOC A;  1EQV A;  2EYJ A;  3OMC A;  4K8J A;  1SYE A;  1SYF A;  2RKS A;  3SXH A;  3TP7 A;  3HZX A;  1STB A;  5CV9 A;  4N9T A;  4J6H A;  3S9W A;  1SNO A;  5I6Y A;  5E1F A;  4IUN A;  1EZ6 A;  5IIF A;  2EYF A;  3D4D A;  4LAA A;  2F0U A;  3D4W A;  1TQO A;  4IZ8 A;  3EJI A;  4K8I A;  2LKV A;  1SYC A;  4K14 A;  4N9P A;  2EY2 A;  1EY7 A;  2EY6 A;  1SYB A;  4RKB A;  1AEX A;  5EKL A;  5HGT A;  4DFA A;  3DHQ A;  4KD3 A;  1EZ8 A;  1STG A;  2PYK A;  3HEJ A;  1STA A;  1STH A;  5IGB A;  5KYI A;  4K2K A;  5C5L A;  4PMB A;  5IGF A;  2F0P A;  1U9R A;  5C6A A;  4HMJ A;  5KEE A;  4KJO A;  5KIX A;  2F0Q A;  2PZW A;  2F0M A;  4J1M A;  2RBM A;  3MVV A;  3PMF A;  1TR5 A;  3T13 A;  2O4X A;  2EXZ A;  4HTH A;  2PW5 A;  5E3F A;  1KDB A;  3BDL A;  4I65 A;  2OEO A;  1SND A;  5CR3 A;  4E6I A;  5I9O A;  5IGE A;  2F0L A;  1EY8 A;  1II3 A;  3NK9 A;  3NXW A;  1SNC A;  4H7B A;  4KHV A;  1A3T A;  2M00 A;  2PQE A;  1SNQ A;  1TT2 A;  4ZUI A;  3MXP A;  2F0D A;  4EQN A;  1NUC A;  4TRD A;  5IGG A;  5KYL A;  2F0G A;  2EYM A;  1EY6 A;  2F0T A;  4YIJ A;  3VA5 A;  2SOB A;  2NUC A;  3SHL A;  1IHZ A;  1JOQ A;  3TP5 A;  1EY4 A;  2EY5 A;  4ID6 A;  4OL7 A;  2F0V A;  4NDX A;  4K6D A;  5EKK A;  5IGC A;  3NQT A;  4NP5 A;  3TP6 A;  5C5M A;  4B9X A;  4F8M A;  1SNM A;  2ENB A;  2F0F A;  1ENC A;  2EYL A;  4KY6 A;  4WRD A;  4IAL A;  4RKL A;  4DU9 A;  3P1H A;  5IGD A;  1ENA A;  2F0O A;  1F2Y A;  5KGU A;  2F0E A;  4B9W A;  5J1Z A;  4MIU A;  4K2L A;  3SK8 A;  2F0W A;  4G57 A;  4QB4 A;  5NUC A;  4F7X A;  1A2T A;  5JOB A;  4DF7 A;  5I6W A;  4NKL A;  5C4Z A;  1A3V A;  4KD4 A;  5HUR A;  5F2D A;  4KV6 A;  1F2M A;  2SNS A;  3R3O A;  2F3W A;  4QF4 A;  5IOD A;  2EYP A;  1JOK A;  5C3W A;  2EY1 A;  3NHH A;  3EVQ A;  5CV5 A;  1EYA A;  3SK4 A;  4EQP A;  4EQO A;  1A3U A;  3QOJ A;  3QOL A;  5CC4 A;  3T16 A;  5CGK A;  1SYD A;  4R8N A;  5C3X A;  1KAB A;  2F3V A;  1STN A;  2F0N A;  1F2Z A;  1EYC A;  3OMG A;  3MEH A;  1EY5 A;  1NSN S;  2F0S A;  5J39 A;  4PNY A;  4QMG A;  4NMZ A;  2F0I A;  3P75 A;  4ODG A;  3MZ5 A;  3ERO A;  4ZQ3 A;  3TP8 A;  5I9P A;  4DGZ A;  5ISR A;  2PZU A;  5CV6 A;  5DEH A;  1KAA A;  3RUZ A;  2QDB A;  4K5X A;  2EYO A;  2F0H A;  1EYD A;  2HQE A;  3TME A;  1KDC A;  2OF1 A;  5K5P A;  4K5W A;  3E5S A;  2WAC A;  4K5V A;  3NUC A;  2KQ3 A;  3C1F A;  5EGT A;  5JAV A;  2OXP A;  4ZUJ A;  1KDA A;  3BDC A;  4EVO A;  5M9O A;  2F0K A;  3H6M A;  3U9O A;  5CV8 A;  2PZT A;  2SNM A;  3ITP A;  3MHB A;  3D6C A;  3NP8 A;  1JOR A;  3LX0 A;  4KY7 A;  5KRU A;  4KJN A;  5CV4 A;  3DMU A;  3SK5 A;  5DAU A;  1SNP A;  3V2T A;  4PMC A;  2EYH A;  4S3S A;  5J22 A;  2RDF A;  1JOO A;  1EY0 A;  2KHS A;  4HMI A;  3C1E A;  3QB3 A;  5C4H A;  1EY9 A;  2PW7 A;  4KY5 A;  1A2U A;  3SK6 A;  4KTA A; 
#chains in the Genus database with same CATH topology
 4RG1 A;  1B8A A;  1KLU D;  4JOI C;  4YY3 L;  1T5X D;  4A3M H;  3CQZ B;  2K52 A;  4N9T A;  1YIT A;  4HED A;  4DV3 L;  4O2D A;  1PFB A;  5IIF A;  1F9P A;  3L3O C;  4LAA A;  2F0U A;  4OX9 L;  3MXU A;  3R93 A;  2GA4 B;  4DV4 Q;  1JCK B;  3NBI A;  1CKN A;  1U4P A;  1Y1W H;  3OPO A;  1UEA B;  3DWQ A;  1UNS A;  3MVV A;  3PO3 G;  2I0Q A;  4BXX H;  1TY0 A;  2OQK A;  2Z6B A;  4HTH A;  1PH4 A;  1ZEQ X;  1SFO B;  1SND A;  5CR3 A;  3BYT B;  1D5M C;  4DR5 L;  2IX0 A;  1PMR A;  2B29 A;  1S5F D;  3GTQ B;  3KBX A;  1QNU A;  5C4X B;  1LLR D;  2EYM A;  5EPJ A;  4C2M B;  1VQH A;  3PF4 A;  4A76 A;  3FKI G;  4YCV A;  3TS0 A;  4F88 A;  2E5L Q;  4HJ5 A;  4G7H C;  3HKZ E;  4JBK A;  2B3G A;  4H44 C;  1Y8N B;  2F0O A;  4OO1 G;  3OOC A;  3M4P A;  4OHJ A;  5HUR A;  2O2L D;  5IP7 G;  1K0R A;  1V8Q A;  5K36 G;  3VR4 A;  1SE3 A;  2B2Y C;  5JPM C;  2LMC B;  3E9H A;  3W5O A;  4KHP Q;  2NN6 H;  1EUJ A;  1STN A;  1AFP A;  2NVX B;  2QEX A;  1EY5 A;  1ONL A;  4JI8 Q;  4A75 A;  3DWP A;  1TWH B;  4QMG A;  1ESR A;  5AFW A;  3A8I E;  1FL0 A;  3GTP B;  1F77 A;  1KAA A;  1TY2 A;  3MAQ A;  4K5X A;  3F2U A;  1CFM A;  4PZ7 A;  1BBW A;  3RD4 A;  2VQF L;  3NUC A;  4P71 A;  1A0I A;  2J7Z A;  4ZUJ A;  3ZJY C;  1KAW A;  1ASZ A;  4JVZ A;  2JA7 H;  3EBE A;  1ZXT A;  3PO2 H;  1WFQ A;  1X9N A;  3AFP A;  1IL2 A;  1S40 A;  4PMC A;  5BR8 L;  4P2C B;  3E9I A;  5LMN L;  2B2V A;  4UP8 A;  3C1E A;  3I4O A;  2I5H A;  1U4M A;  1BUV T;  4XQQ A;  2R6G A;  4CJ1 B;  5FLM G;  2LSS A;  1X3Q A;  1SLJ A;  2BE5 C;  4JYA Q;  3TS2 A;  4DV2 L;  3BVG A;  3U9S A;  3HOY G;  1Y1V G;  2Z4I A;  3AFQ A;  3D4D A;  2QEJ C;  2G9D A;  3EJI A;  1E2W A;  1DXM A;  1TWC H;  3RN2 A;  5FJ8 H;  2BDN A;  2Q2U A;  4KJO A;  3HGB A;  1I4G A;  1UE5 A;  3T13 A;  1DOK A;  1TR5 A;  2O4X A;  1JJ2 A;  1GUO A;  1KDB A;  3T4A C;  3H3V C;  1LT5 D;  3B6Y A;  3VYT A;  4KHV A;  3K6O A;  4KHZ A;  1HRJ A;  4QGU A;  1TT2 A;  2PQA A;  1PFN A;  1SE4 A;  5BN4 A;  3BG3 A;  4A93 G;  1HQM C;  2PNH A;  1ZYR C;  3KJO A;  3PUY A;  2CKZ B;  4C3H G;  1ILQ A;  2WFW A;  4JI3 Q;  4NP5 A;  4IJH A;  1TII D;  2UUA Q;  3MXG A;  4KY6 A;  2IJ0 A;  4JI5 L;  2F0E A;  2NN6 I;  2RVL A;  1DD2 A;  1EYG A;  2F0W A;  2R3Z A;  1A2T A;  1EU4 A;  1KD1 C;  4A3K B;  3HOW G;  2YV5 A;  2CW0 D;  2EY1 A;  3N52 A;  3S1Q B;  3NEN A;  5LHY 1;  2JXM B;  4IUR A;  4HIO A;  3RN5 A;  3S1N H;  3BZC A;  4HID A;  1EEF D;  1NSN S;  4Z9C B;  4JBW A;  4OWT B;  2K05 A;  3A8K E;  2R7D A;  3A5Z B;  3RUZ A;  2TMP A;  1BCP C;  4B3T L;  3G6E A;  2WKC A;  3CKI B;  3TQY A;  4DUZ Q;  2O5I C;  1YJ9 A;  3GD7 A;  2WII B;  2X6L A;  4HJ7 A;  3GTM H;  4YCW A;  1JOO A;  1EY0 A;  3G4S A;  2ZTD A;  1Q82 C;  1WTP A;  1G6Z A;  5COY A;  2F4V L;  4OWX B;  4HJA A;  1H95 A;  2KBN A;  3NWS A;  3D8G A;  4ME5 A;  1FR3 A;  3ERQ A;  4UP9 A;  1M1K C;  5DLQ E;  4Q0F A;  4OXP A;  1IKM A;  2NVT B;  1E0B A;  1TVX A;  2EDG A;  3M85 A;  1DON A;  1GHK A;  5IYC G;  1ROD A;  2DJF C;  3NE5 B;  1S72 A;  4JI6 Q;  4DV4 L;  1EOT A;  1SYB A;  1N36 Q;  4ZCK A;  3DHQ A;  4KD3 A;  4N8F A;  4A3I G;  1JC7 A;  1VMP A;  3H91 A;  2TSS A;  4MN3 A;  1AE2 A;  1KQS A;  2F0Q A;  3U4V A;  1PZI D;  4GNX B;  2A19 A;  3H0G B;  2L11 A;  3NK9 A;  4H7B A;  2KJX A;  2KEE A;  4OIK A;  2BH2 A;  2FFK B;  4GN4 B;  2KCN A;  1N33 L;  2WIN B;  1LTS D;  4LK1 C;  3D0F A;  2ZJR A;  2R93 H;  1K73 C;  5GQO A;  3AU7 A;  5IGC A;  5IP7 H;  5M5W B;  2E5L L;  1X3P A;  1YNX A;  3S1M B;  1E7Z A;  4HR7 B;  1Y1W B;  5C0X J;  4CDD C;  3MXN A;  1DOL A;  4RAU C;  3AYH B;  1LTB D;  1QJO A;  4OEL B;  1JJG A;  3I55 A;  3AB9 A;  5ELC A;  2Z0S A;  3FVQ A;  2CQA A;  3J81 L;  3EN2 A;  1R4Q B;  2NB0 A;  1CA6 A;  4DR6 Q;  4MNO A;  4RHS A;  1JB7 A;  2K5D A;  4JI8 L;  4RA8 A;  4Q5V A;  1L0Y B;  2NZO A;  2MQH A;  4NMZ A;  4DGZ A;  1OTC A;  4NXM Q;  4ZYS A;  1F9R A;  1EYD A;  1KDC A;  1WTX A;  3E5S A;  1L1O A;  1K8A C;  1HR0 Q;  4DV0 Q;  1GKH A;  1S3O A;  2G9H D;  4RGO S;  4CHT B;  2JJQ A;  5E4X A;  2BDO A;  2ASB A;  1LTG D;  2K04 A;  1AW7 A;  1YHB A;  1ZKO A;  2Z8L A;  2HIV A;  3JC6 6;  5BN5 A;  3I4N H;  3ULJ A;  4A3B H;  1Y8P B;  2A68 D;  1CKO A;  1W6J A;  5C3E G;  3KK7 A;  5LL6 X;  1TKW B;  1PH7 A;  4JYA L;  2HHH Q;  3A7L A;  2LXK A;  1F9Q A;  4IUT A;  4J6H A;  3NWT A;  1A62 A;  4B3M Q;  4IZ8 A;  3EQL C;  4CDC C;  3PO2 B;  4DFA A;  2QCP X;  4FF4 A;  2E2I B;  4K2K A;  5C5L A;  4LF5 L;  1L2F A;  3PCO B;  4LMQ D;  1LTI D;  4RMF A;  1I50 H;  1UEB A;  3VR2 A;  1D1K A;  4IUQ A;  4I65 A;  4GOP C;  3X3M A;  4UDU C;  4XIG S;  4A3F G;  5TSS A;  1NNX A;  1QVF A;  2VB2 X;  4HJ9 A;  3S15 H;  1SRU A;  3RR5 A;  3FPU B;  3T51 B;  4HIK A;  2AQ3 B;  1YNN D;  4JI3 L;  1X6O A;  1O80 A;  5IE8 A;  2UUA L;  5C5M A;  4B9X A;  5GAD C;  4A3M G;  1VQN A;  4BBS B;  2EVB A;  2C9O A;  3HKZ B;  2NBF A;  1AH9 A;  1I4Q A;  3P7J A;  4YWK A;  4F7X A;  3JAM E;  4NKL A;  1YZ6 A;  1AZQ A;  4RWS C;  1HA5 A;  2K6A A;  1G29 1;  5IOD A;  1K0S A;  1X56 A;  5M5X H;  1Y1W G;  1SE2 A;  1D1I A;  4BXX G;  4EQO A;  1NMF A;  1PH8 A;  5CGK A;  4POG A;  1XNQ L;  4QIW B;  1HZ9 A;  4CGY B;  4DNR B;  4O0A A;  1HZA A;  2IX3 A;  4ILW A;  3PUZ A;  2H1E A;  2SDF A;  3MZ5 A;  4RCN A;  4DA2 A;  2WP8 J;  1U4R A;  1B2T A;  1MJC A;  4DUZ L;  2WAC A;  4L8J A;  4LFC L;  2JSO A;  5KNB A;  2KUM A;  2K4K A;  4J15 A;  2ZXR A;  1GUN A;  2R92 B;  3WDN A;  5C0X I;  3CCU A;  2RHS B;  2QIL A;  4A3J H;  2XIW A;  4CDF C;  2A6H C;  1SYG A;  3CC7 A;  3ULP A;  3STB C;  5IOC A;  4A3I H;  4JOI A;  2VW9 A;  3SXH A;  3CD6 A;  1WCM H;  2JK8 A;  4R4Q A;  2JA5 G;  3PGZ A;  1HTP A;  2NN6 G;  2X6G A;  1SAP A;  3I70 A;  2CFM A;  4JI6 L;  1E1O A;  3U58 A;  2MFI A;  1AEX A;  1EWI A;  3T1Y Q;  1DJR D;  2B63 H;  4HMJ A;  1I4H A;  3NPP A;  5BR8 Q;  5LMN Q;  2EJG C;  4PZ6 A;  4FF1 A;  3OHX C;  5EAY A;  5LMN W;  1QUQ B;  5JJL A;  2EXZ A;  3CHB D;  1AZP A;  2JA7 G;  1J8I A;  1PRT C;  3LGJ A;  3DM3 A;  1CHP D;  3G7L A;  1V1Q A;  4HIM A;  3PO3 B;  5IYB G;  2F0T A;  4G7Z C;  3GTO H;  1E2V A;  1FGB D;  1SBB B;  1V43 A;  4X65 Q;  1WTV A;  1WVL A;  3E6Z X;  4NDX A;  3NTK A;  2NVY H;  4IUU A;  1PLF A;  4AH6 A;  1HPC A;  4XYQ A;  3P1H A;  1K83 B;  2FIN B;  2LFN A;  3CXC A;  4KD4 A;  3TSS A;  4F87 A;  3GTK H;  5FJ8 G;  1MSH A;  3G71 A;  3M7N A;  2A6E C;  2B2Y A;  4GKJ L;  3QWN A;  1QB5 D;  2HCC A;  4IUV A;  3VR3 A;  4NXN Q;  1IW7 C;  3QOL A;  4P75 A;  1VQG A;  4O42 A;  3T16 A;  1CK1 A;  3MFY A;  1W3S A;  3RZD H;  2RCF A;  4FF3 A;  2JA8 G;  5FLX L;  2Z6K C;  1D6E C;  4ODG A;  4NXM L;  4AYB B;  1WTW A;  1HNZ Q;  2RCN A;  1RCV D;  1YJW A;  3HOU H;  3NBH B;  2PMZ B;  4K5V A;  1AP0 A;  2B2U C;  1HR0 L;  3HKS A;  2NYZ D;  3GQB A;  1ET6 A;  1BDO A;  2NZH A;  2PZT A;  3I72 A;  1C0A A;  1YNJ D;  1L0W A;  2JQO A;  4XTC S;  1Q46 A;  1SNP A;  2HDL A;  3HOX H;  3BVM A;  2OQ0 A;  3KDF A;  3KF8 A;  1WTO A;  5EPL A;  1A2U A;  3SK6 A;  3ERS X;  3UDX A;  1VQM A;  1STY A;  3S2D H;  4JI2 Q;  3FPP A;  1EQV A;  3A7A B;  2HHH L;  3S24 A;  5HY6 A;  1SYF A;  1PA6 A;  3BU2 A;  3HZX A;  4B3T Q;  3S9W A;  2FXQ A;  4B3M L;  3KLS X;  1BKB A;  3FMC A;  5HGT A;  1NJI C;  2QF7 A;  3CCM A;  4A3F H;  2XRQ D;  2RSN A;  3HEJ A;  3VDY A;  1Z6H A;  1KL9 A;  1I6V C;  3HOY B;  1TWF H;  1Y1V B;  3AQQ A;  4J1M A;  3F1Z A;  2F4V Q;  4C56 C;  3HFZ B;  1UWV A;  4YWM A;  1X3F A;  4LUZ A;  1VQE A;  1H9K A;  1QZG A;  4LF8 Q;  3VYS A;  1IL8 A;  2BOS A;  1GHJ A;  1IBL Q;  3K80 C;  1QVG A;  1VQD A;  3NSW A;  1LUZ A;  2E74 C;  3GDE A;  2OTL A;  4P74 A;  2CVR A;  1FYC A;  3UI2 A;  4L5T A;  2Q2H A;  1VQI A;  2MGS A;  1V1P A;  3S14 H;  2EIF A;  1RJT A;  2G5D A;  4PV1 C;  2BA1 A;  3CPF A;  4F8M A;  4A93 B;  5IGD A;  1KRT A;  4IAL A;  1I6H H;  1I50 B;  3GTL B;  4AQY Q;  1A8V A;  2H5X A;  1UUP A;  3WOF A;  2QKI C;  3KF6 A;  4FXG C;  5DNF A;  4C3H B;  3K5O A;  3GV3 A;  4G4K A;  1B9N A;  1B44 D;  2B8G A;  3S17 H;  2JYO A;  5CBA E;  3PIO A;  3A54 A;  1N33 Q;  5GAG C;  2BA0 A;  3KUP A;  1KAB A;  5D3I B;  5KND A;  2CWA A;  2AMC B;  2VQE L;  3HOW B;  3MEH A;  4LW1 A;  2EXD A;  4GLX A;  1HFN A;  2ZM6 Q;  1B50 A;  1Q7Y C;  3TP8 A;  4CKC A;  1M8A A;  3DM1 A;  3J80 L;  1GXD C;  1TU2 B;  5K5P A;  1I94 L;  4BY7 H;  2R93 G;  1XMQ Q;  2AUJ D;  1XYI A;  5DM6 3;  4GKK L;  1PDQ A;  2OXP A;  5M9O A;  3NQI A;  5ELD A;  5HGQ A;  5M5X B;  3I56 A;  3CF5 A;  3NP8 A;  4HSP A;  1YI2 A;  3T56 B;  3M3Y B;  4AYB G;  3K7A H;  4LFA L;  2L1B A;  2JA5 H;  2EJM A;  1HH2 P;  4QIW E;  3TZU A;  3EFX D;  5C44 H;  1MI2 A;  3PUX A;  3J81 c;  3CRK C;  1HZB A;  4X3U A;  4OON A;  3J81 i;  4MZ9 A;  1K8G A;  2I46 A;  2NVQ B;  2RKS A;  1HQR D;  5IP9 H;  1G2S A;  1QIL A;  4C3I H;  2X69 A;  1I4P A;  3CCR A;  2MP1 A;  4LUV A;  4LF9 Q;  2PNR C;  5I6Y A;  4XQJ A;  3PF5 A;  3M4O H;  2EY2 A;  2K01 A;  3T1Y L;  4WFN 3;  4DV1 L;  1EZ8 A;  3SE0 A;  1N8R C;  4IO9 A;  2YU9 H;  2ATW A;  5IYB H;  1N34 L;  5M3M H;  3H3V I;  3RZO H;  4E6I A;  5IGE A;  4DAP A;  4Y7N H;  4A3I B;  3CAM A;  3HP3 A;  1SNC A;  1A3T A;  2KED A;  4ME3 A;  4UP7 A;  1NMG A;  1LAB A;  5IGG A;  2BH8 A;  1VQ9 A;  1OO9 B;  1NE3 A;  1EY6 A;  4ZAI A;  5COR A;  1X32 A;  3I4N G;  4A3B G;  1I4X A;  4X65 L;  1LAC A;  3PIO 3;  4K6D A;  2B2W A;  1XTD A;  2L4N A;  2DN8 A;  2B63 B;  4WJW A;  5EPK A;  4LF5 Q;  4DU9 A;  4RKL A;  5CBE E;  4X3T A;  1F2Y A;  5C0X G;  3K57 A;  3SK8 A;  4QB4 A;  1EIF A;  3S16 H;  2KHI A;  2Y0S G;  3HOZ H;  4LF7 Q;  1E24 A;  5F2D A;  2SNS A;  2JA8 H;  1KTK A;  4GNX C;  1Q1E A;  3D3R A;  4LF4 Q;  3GTJ H;  4NXN L;  4HCE A;  2B39 A;  2QW7 A;  3IKJ A;  1HZC A;  3MA2 B;  1SE8 A;  5IWA L;  1PTO D;  2Q2T A;  1TS2 A;  2PI2 A;  1JJC B;  5ISR A;  3Q8D A;  1HNZ L;  5DEH A;  4JI0 Q;  1PFS A;  3RLF A;  3URY A;  4DK6 C;  1VCI A;  4H13 C;  4WJ3 M;  1JB3 A;  2E2H H;  4Y52 H;  2VUM H;  5JEA J;  3ITP A;  3D6C A;  4JG2 A;  5FKA C;  1U4L A;  3SK5 A;  4K6L A;  3K5M A;  2CQO A;  5J22 A;  3Q22 A;  1PHJ A;  1HNW Q;  3Q0A A;  1P16 A;  2XTI A;  3RZD B;  1XNQ Q;  1VS0 A;  3ONA B;  2E75 C;  5A35 A;  2PW7 A;  3HRZ C;  1D5Z C;  4AYB E;  1G91 A;  4JI2 L;  1PH1 A;  2VY3 A;  3OSO A;  4IJL A;  4BBR H;  3R8B A;  4DNT B;  1R9T H;  2PMZ E;  3KLW A;  2QA4 A;  2PPB C;  3D6W A;  4QL5 A;  4LFC Q;  1U5K A;  3FP9 A;  1B7Y B;  1TQO A;  1JOR A;  5C3E B;  3CCL A;  1PTO F;  4DUY L;  3K59 A;  1SMX A;  1BBX C;  2IX1 A;  5L37 A;  1P8L A;  3S1R B;  1STH A;  1JE5 A;  1PZK D;  3HOX B;  1LO5 D;  3G48 A;  5C6A A;  1RD9 D;  3S2H H;  4OGQ C;  1G51 A;  1PVO A;  2FHT A;  2IY5 B;  3HOV H;  1IBM Q;  2PW5 A;  3ULL A;  4GOP A;  4A3G H;  3VYU A;  4MTN A;  3I8Z A;  1Q1B A;  1X3E A;  5T1G A;  4LF8 L;  4G7O C;  1BOS A;  4I7Z C;  1ET9 A;  1IBL L;  1KLG D;  2K50 A;  2XRS D;  4FP5 D;  5E4W C;  5I4D A;  4A3J G;  4EQ5 A;  5C4J H;  4IPG A;  1PTO H;  1IHZ A;  1VQJ A;  4KN7 C;  4ID6 A;  4P72 A;  4A3F B;  2L12 A;  1YVC A;  4X3S A;  4DR7 L;  4DXF A;  2JN4 A;  1WCM G;  1PYW D;  1SNM A;  1EQQ A;  4X3K A;  2R7Z H;  4AQY L;  2UXB L;  5JEA H;  4TQU S;  1ENA A;  4MIU A;  2XNA C;  4NW2 A;  4G57 A;  3KLS A;  2F3W A;  1DYQ A;  4A3M B;  2B63 G;  1BO0 A;  3K0X A;  4NB3 A;  1MJE A;  1B53 A;  2Y0S E;  3E0J A;  2JA6 H;  2AUK A;  3K5L A;  4IPC A;  1UE6 A;  1F2Z A;  3S14 B;  2ZM6 L;  4XQN A;  3VA7 A;  1QNK A;  2J4X A;  3HS0 C;  1I6H B;  1KNE A;  3OWE B;  4FXK C;  1RIP A;  2EPB A;  1XMQ L;  1SMY D;  1YEZ A;  1H9S A;  1GVP A;  4IPH A;  2F0K A;  1TWG H;  1CKN B;  4GLV B;  4RGM A;  1QVC A;  2N49 A;  4KY7 A;  4GKJ Q;  3DMU A;  4M1U B;  2MNA A;  1QOH A;  4HJ8 A;  1RF2 D;  1ASY A;  2AHO B;  2D9U A;  4DAY A;  5JJI A;  4N8X 1;  4KLK A;  1EY9 A;  1EIH A;  1MHW C;  3SVM A;  3NEM A;  5AJ3 Q;  3K0Y A;  4X64 L;  4B08 A;  3J7Z C;  1A6X A;  3OMC A;  4ABN A;  5FLX c;  1T5E A;  5ELB A;  4CKE A;  3OW2 A;  4LF9 L;  5D3D A;  4AIM A;  1KC8 C;  1S5D D;  2I07 B;  3QO2 A;  1GO3 E;  1FJG L;  4WJ4 A;  4IUN A;  1HR0 W;  4K8I A;  3DEO A;  2D5D A;  3KOJ A;  3K7A B;  1WTH A;  3K58 A;  3M9B A;  1AN8 A;  2JA5 B;  4GN3 B;  1E1T A;  3HOU G;  1L0X B;  3OW7 A;  2N78 A;  1A63 A;  4JI1 L;  3CPW A;  1VQC A;  4XYO A;  2D0P A;  3NXW A;  5FOB B;  3MXP A;  1WD1 A;  3HOX G;  1K8M A;  5C0X H;  4YIJ A;  2AKW B;  2NUC A;  2JA7 B;  1C8C A;  1JOQ A;  4DPG A;  4PMW A;  2D62 A;  4JK1 C;  5EKK A;  3TDQ A;  1YBY A;  3PUW A;  2V4D A;  1ENC A;  4WRD A;  3RMH A;  2XWJ B;  1CSQ A;  2CHB D;  5GAE C;  5KNC A;  3OTO Q;  4LF7 L;  5C4Z A;  3CQZ H;  3NTI A;  2L15 A;  4GLA C;  4ZKC B;  4KV6 A;  2A69 D;  1DZ1 A;  4LF4 L;  1LV9 A;  2ALY B;  1JOK A;  2ID0 A;  3NHH A;  3EVQ A;  1VF7 A;  1O7I A;  3RNU A;  4JPB W;  1K8O A;  4R8N A;  2AQ2 B;  2UU9 Q;  5LL6 S;  1SDF A;  1J5E L;  1TWC B;  3U4Z A;  1Y14 B;  4CJ0 B;  4OWW B;  1R4P B;  1WJJ A;  5JJZ A;  1CTM A;  2Z6K A;  1SFO H;  4JI0 L;  5CV6 A;  4XT3 B;  3GTQ H;  3IFD A;  1KNA A;  2B8F A;  2B2U A;  1GM5 A;  2JA8 B;  1I3Q H;  1ICW A;  4DK1 A;  2CW0 C;  1BR9 A;  1E2Z A;  1CM9 A;  2WB1 G;  3LX0 A;  3H15 A;  5A2Q E;  1A15 A;  1HNW L;  2EYH A;  3NEL A;  4DR1 L;  3C3L A;  1ML0 D;  2VQE Q;  2PQA B;  4C3J G;  3ZYY X;  1F2L A;  1SYE A;  2XSC A;  2IWH A;  2F03 A;  5J3B A;  1W6K A;  1I94 Q;  2ICI A;  2QGQ A;  1OXV A;  3E0E A;  1HHV A;  3F8T A;  3J80 c;  4GKK Q;  2VUM B;  3J80 i;  4YHH Q;  2N55 A;  5EKL A;  3BZK A;  2LXJ A;  2NVX H;  2YTV A;  4LFA Q;  4BY7 G;  2F0P A;  2Z9H A;  4KKT A;  3S1N B;  5M3F G;  1IYJ B;  3LWU A;  2SEB D;  1IBM L;  1VQB A;  1FGU A;  1HXY D;  2Q8I B;  1Q3L A;  1HCZ A;  1S5E D;  3A56 A;  1IXR A;  2PQE A;  2M00 A;  2R61 A;  1I4R A;  5KYL A;  5C44 G;  1PH2 A;  1JR0 D;  1LT6 D;  1JWS D;  2E2J H;  1B70 B;  1DOM A;  5M5Y H;  2F0V A;  1T9H A;  3GTM B;  1XPU A;  4CDE C;  3V96 A;  4DV1 Q;  3J80 E;  1B1Z A;  4DK3 C;  5IP9 G;  4A3C H;  3I4M G;  1HNX Q;  4KKS A;  3OYY A;  4C3I G;  4H02 A;  4HCS A;  3C46 A;  1N34 Q;  1D2B A;  2KCT A;  1Q8K A;  2N88 A;  3IL8 A;  4K2L A;  3CCE A;  4DR2 Q;  1VQ5 A;  1XNR Q;  1AE3 A;  1Q81 C;  4X6A H;  2HT1 A;  2K03 A;  1C4Q A;  4LUO A;  1F2M A;  3R3O A;  2DGY A;  1BBU A;  4POF A;  1VQK A;  5C3W A;  1V9P A;  1SXT A;  2HD3 A;  2A5H A;  3SK4 A;  1UE7 A;  4GZY C;  4EQP A;  1PTO B;  5M3M G;  2A73 B;  5BN3 A;  4K0K L;  4DR4 Q;  1RL2 A;  3R2T A;  1KXL A;  2JP1 A;  5CYU A;  4FYD A;  2UXC Q;  5I9P A;  4HAE A;  4J8Q A;  4DV6 Q;  3KBG A;  5IY0 A;  1YHA A;  1SN8 A;  2EYO A;  2BE5 D;  2KHJ A;  4DXG A;  4IUP A;  4KMU C;  2VZA A;  3CRL C;  4QUC A;  1Q12 A;  1BNZ A;  3PIP A;  2ZT9 C;  1NCV A;  2YTX A;  2RDG A;  1CKM A;  3H6M A;  1CA5 A;  4ULL A;  5EBC A;  1RTN A;  5KRU A;  2RDH A;  4U67 3;  2R93 B;  3V2T A;  4DN4 M;  3W1B A;  5FO7 B;  5GRO A;  3HOZ G;  3QR8 A;  5ELN A;  5IWA Q;  2WB1 E;  2PZU A;  4KY5 A;  5H1S E;  1OXS C;  2CH4 A;  2F0J A;  4HSV A;  3RLO A;  3UE1 A;  5AJ3 L;  5LMU Q;  5CV7 A;  2IPK D;  4WOR A;  1EIG A;  1RKN A;  4C1N K;  1GJX A;  1DGS A;  4IOC A;  3BS1 A;  4A3K H;  2DY7 A;  1EU3 A;  1NR2 A;  2HIX A;  4ZK9 B;  1M4V A;  1EEI D;  2OWO A;  1ZYR D;  4N9P A;  1HJP A;  1EY7 A;  3U50 C;  4RKB A;  3MXN B;  2HQL A;  3M4Y A;  1EWC A;  4PMB A;  4QCL A;  5KEE A;  1VQ8 A;  1H9S B;  1LTA D;  2IT1 A;  1B3Q A;  4A3E G;  1PYB A;  2KEC A;  2VUM G;  1MD2 D;  2A68 C;  2Z1C A;  1II3 A;  3IFT A;  1V1O A;  1JWU D;  2BCO A;  4CJ2 C;  3CW2 C;  1NUC A;  4TRD A;  4IFD J;  1ICF B;  3D4R A;  4U68 A;  2KEN A;  3SHL A;  3TP5 A;  3KFU A;  3DXJ C;  1YHQ A;  4EX5 A;  4DUY Q;  4BBR G;  3NQT A;  2R7F A;  3TP6 A;  2IW3 A;  2RA4 A;  3AMU A;  2ES2 A;  3ICE A;  3I4N B;  4A3B B;  1L1O B;  2KCC A;  1BCP D;  5ELF A;  1OXT A;  3OTO L;  1GUG A;  1X3G A;  1A3V A;  1W2B A;  1HUM A;  5EKI A;  4GNX A;  4ALP A;  4UY8 C;  1IYV A;  4L5R C;  1PYS B;  1EFI D;  3JAM L;  2O5J C;  1EYA A;  2A1A A;  3HOV G;  3PIP 3;  2UU9 L;  2Y0S B;  3H3V H;  4ZLT F;  3UDF A;  4A3G G;  1YNN C;  1LYL A;  2F0N A;  3K81 C;  3I90 A;  4DR7 Q;  4A3D G;  2EZV A;  2F0I A;  1QWY A;  3A55 A;  2UXB Q;  3H0G H;  5DM7 3;  2QDB A;  2HCI A;  2HQE A;  4JW0 A;  1QE6 A;  5JPN C;  2YYZ A;  1IZ6 A;  5CMD A;  1S4Z A;  3DWA A;  4XXE A;  3BDC A;  2P5Z X;  4C3J H;  3U9O A;  1B3A A;  3S15 B;  1QCB D;  4MHE A;  4X62 Q;  4I7A A;  2R7Z G;  5JEA G;  2E76 C;  5M5W H;  2WAQ B;  3S1M H;  3IRB A;  5C4H A;  4R9W A;  1IBK L;  1BCP F;  4FF2 A;  4IFD H;  1O78 A;  4DV7 Q;  3E3X A;  1KIX A;  1CZG A;  1FVI A;  1STB A;  2JA6 G;  4XDX A;  5M3F H;  4GS3 A;  2DY8 A;  1TS5 A;  4B3S L;  1I3Q B;  1NY4 A;  2EYF A;  3CU7 A;  2F4I A;  4YHH L;  2XGT A;  1E22 A;  3D4W A;  3ND9 A;  1K28 A;  3CMA A;  4DF7 A;  2VNU D;  3PV0 A;  1EQT A;  1WTQ A;  5KIX A;  1LTT D;  2RBM A;  2LY7 A;  5D14 A;  3J7A V;  1D7Q A;  2K14 A;  2HUG A;  3I4L A;  1JWM D;  1Y8O B;  1MGS A;  2F0L A;  1VQL A;  1XXG A;  2XN9 C;  1GUT A;  3K5N A;  4GN5 A;  2L55 A;  4X64 Q;  4ZUI A;  3I4M H;  2K5N A;  4R8I A;  3RLN A;  4JBM A;  2SOB A;  1FJG Q;  2Q8T A;  2PI2 E;  3MEF A;  3FEW X;  1H9R A;  2B2T C;  2IHE A;  1K3B C;  3Q24 A;  2VXW A;  4EGV A;  1HNX L;  3CC2 A;  3GV6 A;  4A3J B;  3C2P A;  1GOZ A;  2NTT A;  3LWE A;  4FO2 A;  1EFW A;  1OXX K;  5J1Z A;  4DR2 L;  1XNR L;  4JI1 Q;  2F3I A;  1TS3 A;  2ZXO A;  1XPR A;  3J81 E;  1WCM B;  2K5V A;  5GAH C;  2F52 A;  5CV5 A;  1XX8 A;  2E2J B;  3QOJ A;  2E2I H;  3L0O A;  4DR4 L;  2YTY A;  1DCZ A;  5M5Y B;  2WV6 D;  2F3V A;  4A3L H;  2UXD Q;  5E7N A;  2F0S A;  1G6P A;  4BWG B;  2UXC L;  2PCF B;  4DV6 L;  3ERO A;  4FDB A;  3F2C A;  3I2Z A;  3DLL A;  4BA2 I;  3K8A A;  4RFB A;  2F0H A;  4YCU A;  2ZJQ A;  4IFD I;  5EQ0 A;  2RF4 A;  4RGT A;  5JAV A;  4HN7 A;  2XVS A;  1J9O A;  3L2P A;  5CV8 A;  2SNM A;  2MPM A;  4DV5 Q;  3GTO B;  2A74 C;  2RDF A;  1H9J A;  4JI7 L;  2KHS A;  1KRS A;  2J0T D;  4BBS H;  4X66 L;  4JI4 Q;  2NVY B;  5IT9 L;  1J5E Q;  4IOA A;  2Q2I A;  3C1F A;  2KQ3 A;  5LMU L;  3H94 A;  1X54 A;  4DR3 Q;  5EBD A;  2UUC L;  5IYD H;  2JEA I;  4K8J A;  3TP7 A;  1CUK A;  2GVA A;  1SRO A;  2WAQ G;  4O1N A;  3CP0 A;  4PG3 A;  4A3E H;  3GTK B;  4APV A;  1LTR D;  1CI3 M;  3LNN A;  2LKV A;  1SYC A;  2XWB B;  4L6T B;  2EY6 A;  2KOL A;  1YNJ C;  4P73 A;  3TEH B;  2L9H A;  1RHP A;  5IGB A;  1FD7 D;  1VQA A;  5IGF A;  1K9M C;  1EQR A;  4DR1 Q;  1JT8 A;  3T1H L;  5C4X G;  4B3R Q;  4FVM A;  3W3A A;  5E3F A;  3CCS A;  2DNE A;  1MBY A;  1K3R A;  2EQS A;  2E8G A;  1FNW A;  3HOU B;  4TSS A;  3J81 j;  2F0D A;  1PH6 A;  3MTS A;  1TWA H;  2QDL A;  3I91 A;  2F0G A;  2MO0 A;  2RQX A;  2FJ2 A;  2K32 A;  2MUY A;  2R92 H;  1XWE A;  2WKD A;  3Q23 A;  2EY5 A;  3WOE A;  3FRP B;  4LF6 L;  3MC0 B;  1IKL A;  1X55 A;  1Z9F A;  1I5F A;  1QG7 A;  4B9W A;  4BY1 H;  2EOT A;  5JOB A;  3S2D B;  1QUQ A;  1LT4 D;  1EIY B;  1D8L A;  3OIQ A;  4A3D H;  2ZTE A;  2EYP A;  1N32 Q;  2KCM A;  3I3C A;  3BDO A;  2FMM A;  3KDF B;  3KF8 B;  1ENF A;  5C3X A;  4KN4 C;  4H0L C;  1SJH D;  1EOV A;  1EYC A;  5J39 A;  4PNY A;  1STE A;  2A6H D;  1TWF B;  1E3P A;  3STB D;  2N3S A;  1VDZ A;  2VS1 A;  1C48 A;  2OTJ A;  4C1N I;  3BJU A;  3PO3 H;  3D31 A;  1VQF A;  4EVO A;  4A3C G;  1O7Y A;  1VF5 C;  4MTK A;  4X62 L;  3MHB A;  2V1C C;  5DAU A;  1BQQ T;  1PXU A;  2B2V C;  4K0K Q;  1XPO A;  4KKU A;  1B4O A;  4DV7 L;  4JV5 Q;  2VL6 A;  3FKI H;  1K83 H;  1X65 A;  2WB1 B;  2NWG A;  1PRT D;  3A74 A;  4R1J A;  1EL0 A;  1XMO Q;  5FK9 C;  1CSP A;  3T53 B;  1SNO A;  1XTC D;  2UUB Q;  4C3J B;  1V1P B;  1EZ6 A;  3S17 B;  2C35 B;  3NBH A;  4K14 A;  1GD7 A;  4OO1 H;  2B2W C;  1DM0 B;  2WAQ E;  5EJW A;  4A4I A;  2DUD A;  2D2C C;  1U9R A;  5K36 H;  3KF6 B;  2PZW A;  3PMF A;  3GP7 A;  3VR5 A;  3I73 A;  3BDL A;  3MFG A;  1JQY D;  1ILP A;  1IYU A;  1GUW A;  1VMC A;  3CCJ A;  3EIV A;  4BY7 B;  3W2D A;  4DAM A;  4EQN A;  1MSG A;  5M3F B;  4OEM B;  2A6E D;  3TZD A;  1YIJ A;  4LFB Q;  2ICE C;  2K33 A;  5D65 A;  1S5B D;  1IW7 D;  4JC0 A;  4KHP L;  3N6R A;  1EY4 A;  2C5C A;  4OL7 A;  1SSO A;  4L63 B;  4QQB X;  4A3K G;  1BCP B;  5C44 B;  1PRT F;  3KYH C;  2F0F A;  2I5M X;  3TN2 A;  3BVZ A;  1D5X C;  3GTG H;  1SEB D;  2JA9 A;  2N8N A;  1JE4 A;  3I4M B;  2DNC A;  1NR4 A;  1FNV A;  3F2D A;  1S5C D;  4C3I B;  4IQZ A;  2PO4 A;  3A5U A;  3UDG A;  5FLM H;  3M4O B;  5FLX E;  3GO5 A;  1SYD A;  4IPD A;  4DK0 A;  2UXD L;  4R4O A;  3HOY H;  3OMG A;  1Y1V H;  2KVM A;  4L5Q A;  2YU9 B;  2MJ8 A;  2EJF C;  2F1M A;  3P75 A;  1M90 C;  3UE0 A;  1B9M A;  4QJF A;  5M3M B;  3RZO B;  2OF1 A;  4Y7N B;  1QZH A;  3BYY B;  3KJP A;  4BS9 A;  1J6Q A;  1O7L A;  3W1G A;  4DV5 L;  1Q8I A;  4QUF A;  4KJN A;  3SDZ A;  3Q6S A;  3WWV A;  1Q86 C;  1Q90 A;  4S3S A;  3J7Y W;  3JAM c;  4JI4 L;  3TBI B;  2AWO A;  4R4C A;  3JAM i;  4A93 H;  1PTO C;  4TKO B;  3GTL H;  4OO1 I;  2GVB A;  4RCO A;  2L0C A;  2ZXP A;  4KTA A;  4XT1 B;  4DR3 L;  1WI5 A;  3SR1 A;  1CT1 D;  2M2L A;  4C3H H;  2LS0 1;  3K7U C;  3V05 A;  3QJY A;  5I2Y A;  3CC4 A;  3S16 B;  1HA6 A;  5CV9 A;  4BA1 I;  4YY3 Q;  1CQF A;  1WOC A;  3HOZ B;  4DNI A;  5C4X H;  2K1B A;  3J7A F;  1O7Z A;  4C2M H;  3TRZ A;  1CHQ D;  4DV3 Q;  2AWN A;  4R4T A;  3GTJ B;  4CBV A;  5JJK A;  3A8J E;  4OX9 Q;  3IAY A;  4KK7 A;  1STG A;  5KYI A;  3H0G G;  3HOW H;  1H9M A;  4DKA C;  2OT2 A;  4B3R L;  2KA7 A;  4M8A A;  2Q8R E;  2RSO A;  3X3N A;  2F0M A;  3TRE A;  1IBK Q;  3DEP A;  1C9O A;  5I9O A;  3EA6 A;  1PFM A;  1PH9 A;  3FHW A;  2GN5 A;  1EY8 A;  2CH4 W;  4DR5 Q;  2FMC A;  1SNQ A;  1BF4 A;  2RHQ B;  4QY7 A;  4A3E B;  1HTL D;  2ZJP A;  3M3Y H;  3HG9 A;  2E2H B;  4B3S Q;  1VQ6 A;  4IFD G;  4UHV A;  3FDT A;  5G3L D;  1UAP A;  5I2X A;  1VQ7 A;  1VQO A;  3P20 A;  3CME A;  1TWH H;  4ZKB B;  1PH5 A;  1JMC A;  3GTP H;  3KLR A;  3M7G A;  2CCZ A;  2HDM A;  2NVQ H;  1BXT A;  5NUC A;  1LM0 A;  4BBR B;  1R9T B;  3VR6 A;  4QF4 A;  1N32 L;  1TWA B;  3PSI A;  3SEB A;  4NPS A;  1CQV A;  3M4Q A;  1MIU A;  1LTL A;  2K5H A;  4UAI A;  2A8V A;  3O13 A;  1Z47 A;  5IYC H;  1CZW A;  3AEV A;  3BZD B;  1YJN A;  3S2H B;  3G6J B;  1UE1 A;  3HOV B;  4BY1 B;  4RGN A;  3TME A;  5ELE A;  2L5T A;  4A3G B;  1XJV A;  1MKH A;  1PV4 A;  1G8Z D;  1L1O C;  5EGT A;  2OCE A;  2VQF Q;  4A3D B;  4OIJ A;  1NTG A;  1KDA A;  2K28 A;  5G3L F;  3ER0 A;  1N36 L;  5C4J B;  3QIA A;  4YWL A;  4IN3 A;  1F9S A;  4PQX A;  1FNU A;  1SR3 A;  1HFG A;  4GOP B;  4HMI A;  3QB3 A;  1WTR A;  4JV5 L;  1WYD A;  4KI0 A;  2R7Z B;  3OWF A;  1SJE D;  4LJZ C;  1XMO L;  4LWC A;  3PO2 G;  2M9V A;  5FO8 B;  2Z4H A;  3MWY W;  2EYJ A;  1SMY C;  4FNF A;  3F2B A;  2UUB L;  4UPA A;  4A3L G;  4DV2 Q;  5E1F A;  2K75 A;  2DJG C;  3H09 A;  1RDP D;  1GUS A;  1VQP A;  2PYK A;  1STA A;  2JA6 B;  3I7F A;  1RTO A;  2I5L X;  4ZRZ A;  4JI7 Q;  4X66 Q;  4JBJ A;  3FKI B;  1PH3 A;  2OEO A;  3A0J A;  2K7V A;  3UDI A;  5IT9 c;  1OXU A;  1NAP A;  2UUC Q;  2E2D C;  4RH6 A;  4LFB L;  4V0B A;  4BBS G;  3PQI A;  3S1Q H;  3VA5 A;  1TWG B;  3ND8 A;  3HKZ G;  1BVS A;  1C7Y A;  2D0O A;  4DR6 L;  5FO9 B;  1N9W A;  2B2T A;  1Z7T A;  3PUV A;  2ZTC A;  5IYD G;  4V19 0;  3J7A 5;  3CCQ A;  2ENB A;  2EYL A;  5KGU A;  4R4I A;  3T1H Q;  2H4O A;  4RHR A;  1PZJ D;  1TXY A;  4JI5 Q;  1ESF A;  5I6W A;  2MHV A;  3R2I A;  2EE1 A;  1G2T A;  4DV0 L;  4FXD A;  5JVH 3;  5C3E H;  1NBW A;  4DAY B;  5IT9 E;  1A3U A;  2K5Q A;  3NTH A;  5CC4 A;  3S1R H;  1TS4 A;  1EWH A;  2JEB I;  4JCV E;  4LF6 Q;  2AQ1 B;  2MO1 A;  2IHF A;  2IL8 A;  2VB3 X;  2CWP A;  4ZQ3 A;  5ELO A;  1WD0 A;  2NVT H;  3GTG B;  2R92 G;  4K5W A;  2NTS A;  3CCV A;  1JIC A;  1LT3 D;  2A69 C;  2K5W A;  4TVA B;  3OIP A;  1Y69 U;  4DAV A;  4L5S A;  3L9A X;  5T1I A;  5CV4 A;  4LNQ A;  1VQ4 A;  4BY1 G;  5JVG 3;  3L7Z C;  1KHI A;  4CKB A;  3SGI A;  1HUN A;  1U0L A;  2JE6 I;  1PRT B;  2NZ1 D;  5A2Q L;  3DUZ A;  3VYR A;  3QG1 A;  4PZ8 A; 
#chains in the Genus database with same CATH homology
 1KLU D;  1T5X D;  3CQZ B;  4N9T A;  4HED A;  1PFB A;  5IIF A;  1F9P A;  3L3O C;  4LAA A;  2F0U A;  3MXU A;  3R93 A;  2GA4 B;  1JCK B;  3NBI A;  1U4P A;  3OPO A;  1UEA B;  3DWQ A;  1UNS A;  3MVV A;  1TY0 A;  4HTH A;  1ZEQ X;  1SFO B;  1SND A;  5CR3 A;  3BYT B;  1D5M C;  2IX0 A;  1PMR A;  1S5F D;  3GTQ B;  3KBX A;  1QNU A;  5C4X B;  1LLR D;  2EYM A;  5EPJ A;  4C2M B;  4F88 A;  4G7H C;  4H44 C;  1Y8N B;  2F0O A;  4OO1 G;  3OOC A;  4OHJ A;  5HUR A;  2O2L D;  1V8Q A;  5K36 G;  3VR4 A;  1SE3 A;  2B2Y C;  5JPM C;  2LMC B;  2NN6 H;  1STN A;  1AFP A;  2NVX B;  1EY5 A;  1ONL A;  3DWP A;  1TWH B;  4QMG A;  1ESR A;  5AFW A;  3A8I E;  3GTP B;  1F77 A;  1KAA A;  1TY2 A;  3MAQ A;  4K5X A;  3F2U A;  1CFM A;  3RD4 A;  3NUC A;  2J7Z A;  4ZUJ A;  1ZXT A;  4PMC A;  4P2C B;  2B2V A;  3C1E A;  1U4M A;  1BUV T;  4XQQ A;  2R6G A;  4CJ1 B;  1X3Q A;  2BE5 C;  3BVG A;  3U9S A;  2Z4I A;  3D4D A;  2QEJ C;  2G9D A;  3EJI A;  1E2W A;  1DXM A;  2BDN A;  4KJO A;  3HGB A;  1I4G A;  3T13 A;  1DOK A;  1TR5 A;  2O4X A;  1GUO A;  1KDB A;  3T4A C;  3H3V C;  1LT5 D;  3VYT A;  4KHV A;  3K6O A;  4KHZ A;  1HRJ A;  1TT2 A;  1PFN A;  1SE4 A;  5BN4 A;  3BG3 A;  1HQM C;  1ZYR C;  3PUY A;  4C3H G;  1ILQ A;  4NP5 A;  1TII D;  3MXG A;  4KY6 A;  2IJ0 A;  2F0E A;  2NN6 I;  2RVL A;  1DD2 A;  2F0W A;  2R3Z A;  1A2T A;  1EU4 A;  4A3K B;  2CW0 D;  2EY1 A;  3N52 A;  3S1Q B;  5LHY 1;  2JXM B;  4IUR A;  1EEF D;  1NSN S;  4Z9C B;  4JBW A;  2K05 A;  3A8K E;  3RUZ A;  2TMP A;  1BCP C;  2WKC A;  3CKI B;  2O5I C;  3GD7 A;  2WII B;  2X6L A;  1JOO A;  1EY0 A;  1WTP A;  1G6Z A;  5COY A;  3NWS A;  3D8G A;  4ME5 A;  1FR3 A;  3ERQ A;  4Q0F A;  1IKM A;  2NVT B;  1E0B A;  1TVX A;  2EDG A;  3M85 A;  1DON A;  1GHK A;  1ROD A;  3NE5 B;  1EOT A;  1SYB A;  3DHQ A;  4KD3 A;  1JC7 A;  1VMP A;  3H91 A;  2TSS A;  4MN3 A;  2F0Q A;  1PZI D;  3H0G B;  3NK9 A;  2L11 A;  4H7B A;  2KJX A;  2KEE A;  4OIK A;  2FFK B;  2KCN A;  2WIN B;  1LTS D;  4LK1 C;  3AU7 A;  5IGC A;  5M5W B;  1X3P A;  3S1M B;  4HR7 B;  1Y1W B;  5C0X J;  3MXN A;  1DOL A;  4RAU C;  1LTB D;  1QJO A;  3AB9 A;  5ELC A;  3FVQ A;  2CQA A;  3J81 L;  1R4Q B;  2NB0 A;  1CA6 A;  4RHS A;  2K5D A;  4RA8 A;  4Q5V A;  1L0Y B;  4NMZ A;  4DGZ A;  4ZYS A;  1F9R A;  1EYD A;  1KDC A;  1WTX A;  3E5S A;  2G9H D;  4RGO S;  4CHT B;  5E4X A;  2BDO A;  1LTG D;  2K04 A;  1AW7 A;  1ZKO A;  2Z8L A;  5BN5 A;  1Y8P B;  2A68 D;  1W6J A;  3KK7 A;  5LL6 X;  1TKW B;  3A7L A;  1F9Q A;  4IUT A;  4J6H A;  3NWT A;  4IZ8 A;  3EQL C;  3PO2 B;  4DFA A;  2QCP X;  4FF4 A;  2E2I B;  4K2K A;  5C5L A;  4LMQ D;  1LTI D;  3VR2 A;  1D1K A;  4IUQ A;  4I65 A;  3X3M A;  4UDU C;  4XIG S;  5TSS A;  2VB2 X;  3FPU B;  3T51 B;  2AQ3 B;  1YNN D;  1O80 A;  5C5M A;  4B9X A;  4BBS B;  2EVB A;  2C9O A;  3HKZ B;  2NBF A;  1I4Q A;  3P7J A;  4F7X A;  3JAM E;  4NKL A;  1AZQ A;  4RWS C;  1HA5 A;  2K6A A;  1G29 1;  5IOD A;  1SE2 A;  1D1I A;  4EQO A;  5CGK A;  4QIW B;  4CGY B;  4DNR B;  2IX3 A;  4ILW A;  3PUZ A;  2H1E A;  2SDF A;  3MZ5 A;  4RCN A;  4DA2 A;  2WP8 J;  1U4R A;  1B2T A;  2WAC A;  4L8J A;  2JSO A;  5KNB A;  2KUM A;  2ZXR A;  1GUN A;  2R92 B;  3WDN A;  5C0X I;  2QIL A;  2XIW A;  2A6H C;  1SYG A;  5IOC A;  3SXH A;  1HTP A;  2NN6 G;  2X6G A;  1SAP A;  3I70 A;  1AEX A;  1DJR D;  4HMJ A;  1I4H A;  3NPP A;  2EJG C;  4FF1 A;  3OHX C;  2EXZ A;  3CHB D;  1AZP A;  1J8I A;  1PRT C;  1CHP D;  3G7L A;  3PO3 B;  4G7Z C;  2F0T A;  1E2V A;  1FGB D;  1SBB B;  1V43 A;  1WTV A;  1WVL A;  3E6Z X;  4NDX A;  3NTK A;  4IUU A;  1PLF A;  1HPC A;  4XYQ A;  3P1H A;  1K83 B;  2FIN B;  2LFN A;  4KD4 A;  3TSS A;  4F87 A;  1MSH A;  3M7N A;  2A6E C;  2B2Y A;  3QWN A;  1QB5 D;  2HCC A;  4IUV A;  3VR3 A;  1IW7 C;  3QOL A;  4O42 A;  3T16 A;  1CK1 A;  3MFY A;  4FF3 A;  5FLX L;  4ODG A;  1D6E C;  4AYB B;  1WTW A;  1RCV D;  2PMZ B;  4K5V A;  1AP0 A;  2B2U C;  2NYZ D;  3GQB A;  1ET6 A;  1BDO A;  2PZT A;  3I72 A;  1YNJ D;  4XTC S;  1SNP A;  2HDL A;  3BVM A;  3KF8 A;  1WTO A;  5EPL A;  1A2U A;  3SK6 A;  1STY A;  3FPP A;  1EQV A;  3A7A B;  1SYF A;  3HZX A;  3S9W A;  3KLS X;  3FMC A;  5HGT A;  2QF7 A;  2XRQ D;  2RSN A;  3HEJ A;  1Z6H A;  1I6V C;  3HOY B;  1Y1V B;  4J1M A;  4C56 C;  1H9K A;  3VYS A;  1IL8 A;  2BOS A;  1GHJ A;  3NSW A;  2E74 C;  2CVR A;  1FYC A;  3UI2 A;  2MGS A;  1V1P A;  1RJT A;  4PV1 C;  2BA1 A;  4F8M A;  4A93 B;  5IGD A;  4IAL A;  1I50 B;  3GTL B;  1UUP A;  3WOF A;  2QKI C;  4FXG C;  5DNF A;  4C3H B;  3K5O A;  3GV3 A;  4G4K A;  1B9N A;  1B44 D;  2B8G A;  2JYO A;  5CBA E;  3A54 A;  2BA0 A;  3KUP A;  1KAB A;  5D3I B;  5KND A;  3HOW B;  3MEH A;  1HFN A;  1B50 A;  3TP8 A;  4CKC A;  1M8A A;  3DM1 A;  3J80 L;  1GXD C;  1TU2 B;  5K5P A;  2AUJ D;  1XYI A;  5DM6 3;  1PDQ A;  2OXP A;  5M9O A;  3NQI A;  5ELD A;  5M5X B;  3NP8 A;  4HSP A;  3T56 B;  3M3Y B;  2L1B A;  2EJM A;  3TZU A;  3EFX D;  1MI2 A;  3PUX A;  3CRK C;  4X3U A;  2I46 A;  2NVQ B;  2RKS A;  1HQR D;  1G2S A;  1QIL A;  2X69 A;  1I4P A;  2MP1 A;  2PNR C;  5I6Y A;  4XQJ A;  2EY2 A;  2K01 A;  4WFN 3;  1EZ8 A;  3SE0 A;  4E6I A;  5IGE A;  4DAP A;  4A3I B;  3HP3 A;  1SNC A;  1A3T A;  2KED A;  1LAB A;  5IGG A;  1OO9 B;  1EY6 A;  4ZAI A;  5COR A;  1X32 A;  1I4X A;  1LAC A;  3PIO 3;  4K6D A;  2B2W A;  2L4N A;  2DN8 A;  2B63 B;  4WJW A;  5EPK A;  4DU9 A;  4RKL A;  5CBE E;  4X3T A;  1F2Y A;  5C0X G;  3K57 A;  3SK8 A;  4QB4 A;  5F2D A;  2SNS A;  1KTK A;  1Q1E A;  3D3R A;  4HCE A;  2B39 A;  3IKJ A;  3MA2 B;  1PTO D;  1TS2 A;  5ISR A;  5DEH A;  3RLF A;  3URY A;  1VCI A;  4H13 C;  1JB3 A;  5JEA J;  3ITP A;  3D6C A;  5FKA C;  1U4L A;  3SK5 A;  4K6L A;  3K5M A;  5J22 A;  3Q22 A;  3Q0A A;  3RZD B;  3ONA B;  2E75 C;  5A35 A;  2PW7 A;  3HRZ C;  1D5Z C;  1G91 A;  3OSO A;  3R8B A;  4DNT B;  2PPB C;  3D6W A;  1TQO A;  1JOR A;  5C3E B;  1PTO F;  3K59 A;  1BBX C;  2IX1 A;  3S1R B;  1STH A;  1PZK D;  3HOX B;  1LO5 D;  5C6A A;  1RD9 D;  4OGQ C;  2FHT A;  2PW5 A;  3VYU A;  3I8Z A;  1Q1B A;  4G7O C;  5T1G A;  1BOS A;  4I7Z C;  1ET9 A;  1KLG D;  2XRS D;  4FP5 D;  5E4W C;  5I4D A;  1PTO H;  1IHZ A;  4KN7 C;  4ID6 A;  4A3F B;  2L12 A;  4X3S A;  4DXF A;  1PYW D;  1SNM A;  4X3K A;  5JEA H;  4TQU S;  1ENA A;  4MIU A;  2XNA C;  4NW2 A;  4G57 A;  3KLS A;  2F3W A;  1DYQ A;  4A3M B;  1BO0 A;  1B53 A;  3E0J A;  2AUK A;  3K5L A;  1F2Z A;  3S14 B;  4XQN A;  3VA7 A;  1QNK A;  2J4X A;  3HS0 C;  1I6H B;  1KNE A;  3OWE B;  4FXK C;  2EPB A;  1SMY D;  1H9S A;  2F0K A;  4RGM A;  4KY7 A;  3DMU A;  4M1U B;  1QOH A;  1RF2 D;  2D9U A;  4DAY A;  1EY9 A;  1EIH A;  3SVM A;  3K0Y A;  4B08 A;  1A6X A;  3OMC A;  4ABN A;  1T5E A;  5ELB A;  4CKE A;  5D3D A;  1S5D D;  2I07 B;  3QO2 A;  4IUN A;  4K8I A;  3DEO A;  2D5D A;  3K7A B;  3K58 A;  1AN8 A;  2JA5 B;  1L0X B;  3OW7 A;  4XYO A;  3NXW A;  5FOB B;  3MXP A;  1WD1 A;  1K8M A;  5C0X H;  4YIJ A;  2NUC A;  2JA7 B;  1C8C A;  1JOQ A;  4PMW A;  2D62 A;  4JK1 C;  5EKK A;  3TDQ A;  3PUW A;  2V4D A;  1ENC A;  4WRD A;  3RMH A;  2XWJ B;  2CHB D;  5KNC A;  5C4Z A;  3NTI A;  4ZKC B;  4KV6 A;  2A69 D;  1DZ1 A;  1LV9 A;  1JOK A;  2ID0 A;  3NHH A;  3EVQ A;  1VF7 A;  1K8O A;  4R8N A;  2AQ2 B;  5LL6 S;  1SDF A;  1TWC B;  4CJ0 B;  1R4P B;  5JJZ A;  1CTM A;  5CV6 A;  4XT3 B;  3IFD A;  1KNA A;  2B8F A;  2B2U A;  2JA8 B;  1ICW A;  4DK1 A;  2CW0 C;  1BR9 A;  1E2Z A;  1CM9 A;  3LX0 A;  5A2Q E;  1A15 A;  2EYH A;  3C3L A;  1ML0 D;  4C3J G;  3ZYY X;  1F2L A;  1SYE A;  2XSC A;  2IWH A;  2F03 A;  1W6K A;  2ICI A;  1OXV A;  1HHV A;  2VUM B;  2N55 A;  5EKL A;  2F0P A;  4KKT A;  3S1N B;  3LWU A;  2SEB D;  1HXY D;  2Q8I B;  1Q3L A;  1HCZ A;  1S5E D;  3A56 A;  2PQE A;  2M00 A;  2R61 A;  1I4R A;  5KYL A;  1JR0 D;  1LT6 D;  1JWS D;  1DOM A;  2F0V A;  3GTM B;  3V96 A;  3J80 E;  1B1Z A;  4KKS A;  4C3I G;  4HCS A;  3C46 A;  1D2B A;  2N88 A;  3IL8 A;  4K2L A;  2K03 A;  1C4Q A;  1F2M A;  3R3O A;  5C3W A;  1SXT A;  2A5H A;  3SK4 A;  4GZY C;  4EQP A;  1PTO B;  2A73 B;  5BN3 A;  3R2T A;  2JP1 A;  5CYU A;  4FYD A;  5I9P A;  4HAE A;  4J8Q A;  3KBG A;  2EYO A;  2BE5 D;  4DXG A;  4IUP A;  4KMU C;  3CRL C;  4QUC A;  1Q12 A;  1BNZ A;  2ZT9 C;  1NCV A;  2RDG A;  3H6M A;  1CA5 A;  4ULL A;  5EBC A;  1RTN A;  5KRU A;  2RDH A;  4U67 3;  2R93 B;  3V2T A;  4DN4 M;  5FO7 B;  4KY5 A;  2PZU A;  1OXS C;  2F0J A;  4HSV A;  5CV7 A;  2IPK D;  4WOR A;  1EIG A;  1RKN A;  4C1N K;  1GJX A;  3BS1 A;  2DY7 A;  1EU3 A;  1NR2 A;  4ZK9 B;  1M4V A;  1EEI D;  1ZYR D;  4N9P A;  1EY7 A;  4RKB A;  3M4Y A;  1EWC A;  4PMB A;  4QCL A;  5KEE A;  1H9S B;  1LTA D;  2IT1 A;  2KEC A;  1MD2 D;  2A68 C;  2Z1C A;  1II3 A;  3IFT A;  1V1O A;  1JWU D;  2BCO A;  4CJ2 C;  1NUC A;  4TRD A;  4IFD J;  3D4R A;  4U68 A;  3SHL A;  3TP5 A;  3DXJ C;  3NQT A;  3TP6 A;  2IW3 A;  2RA4 A;  3AMU A;  3I4N B;  4A3B B;  2KCC A;  1BCP D;  5ELF A;  1OXT A;  1GUG A;  1A3V A;  1HUM A;  5EKI A;  1IYV A;  1EFI D;  3JAM L;  2O5J C;  1EYA A;  3PIP 3;  2Y0S B;  4ZLT F;  1YNN C;  2F0N A;  3I90 A;  2EZV A;  2F0I A;  1QWY A;  3A55 A;  5DM7 3;  2QDB A;  2HCI A;  2HQE A;  1QE6 A;  5JPN C;  2YYZ A;  5CMD A;  1S4Z A;  3DWA A;  4XXE A;  3BDC A;  3U9O A;  1B3A A;  3S15 B;  1QCB D;  4MHE A;  5JEA G;  2E76 C;  2WAQ B;  5C4H A;  4R9W A;  4FF2 A;  1BCP F;  4IFD H;  1O78 A;  1CZG A;  1STB A;  4XDX A;  2DY8 A;  1TS5 A;  1I3Q B;  2EYF A;  3CU7 A;  2F4I A;  3D4W A;  3ND9 A;  4DF7 A;  2VNU D;  3PV0 A;  1EQT A;  1WTQ A;  5KIX A;  1LTT D;  2RBM A;  2LY7 A;  5D14 A;  3J7A V;  2HUG A;  3I4L A;  1JWM D;  1Y8O B;  1MGS A;  2F0L A;  1XXG A;  2XN9 C;  1GUT A;  3K5N A;  2L55 A;  4ZUI A;  4R8I A;  2SOB A;  2Q8T A;  3FEW X;  1H9R A;  2B2T C;  3Q24 A;  2VXW A;  4EGV A;  3GV6 A;  4A3J B;  3C2P A;  1GOZ A;  2NTT A;  3LWE A;  4FO2 A;  1OXX K;  5J1Z A;  1TS3 A;  2ZXO A;  3J81 E;  1WCM B;  5CV5 A;  1XX8 A;  2E2J B;  3QOJ A;  1DCZ A;  5M5Y B;  2WV6 D;  2F3V A;  2F0S A;  4BWG B;  2PCF B;  3ERO A;  4BA2 I;  4RFB A;  2F0H A;  4IFD I;  5EQ0 A;  4RGT A;  5JAV A;  4HN7 A;  2XVS A;  1J9O A;  5CV8 A;  2SNM A;  2MPM A;  3GTO B;  2A74 C;  2RDF A;  1H9J A;  2KHS A;  2J0T D;  2NVY B;  5IT9 L;  3C1F A;  2KQ3 A;  3H94 A;  5EBD A;  2JEA I;  4K8J A;  3TP7 A;  4O1N A;  3GTK B;  1LTR D;  1CI3 M;  3LNN A;  2LKV A;  1SYC A;  2XWB B;  4L6T B;  2EY6 A;  2KOL A;  1YNJ C;  2L9H A;  1RHP A;  5IGB A;  1FD7 D;  5IGF A;  4FVM A;  3W3A A;  5E3F A;  2DNE A;  1MBY A;  3HOU B;  1FNW A;  4TSS A;  2F0D A;  3MTS A;  3I91 A;  2F0G A;  2RQX A;  2FJ2 A;  2K32 A;  2MUY A;  1XWE A;  2WKD A;  3Q23 A;  2EY5 A;  3WOE A;  3FRP B;  3MC0 B;  1IKL A;  1QG7 A;  4B9W A;  2EOT A;  5JOB A;  3S2D B;  1LT4 D;  3OIQ A;  2EYP A;  3I3C A;  3BDO A;  2FMM A;  1ENF A;  5C3X A;  4KN4 C;  4H0L C;  1SJH D;  1EYC A;  5J39 A;  4PNY A;  1STE A;  2A6H D;  1TWF B;  1VDZ A;  1C48 A;  4C1N I;  3D31 A;  4EVO A;  1O7Y A;  1VF5 C;  3MHB A;  5DAU A;  1BQQ T;  1PXU A;  2B2V C;  4KKU A;  1B4O A;  2WB1 B;  2NWG A;  1PRT D;  1EL0 A;  5FK9 C;  3T53 B;  1SNO A;  1XTC D;  4C3J B;  1V1P B;  1EZ6 A;  3S17 B;  3NBH A;  4K14 A;  4OO1 H;  2B2W C;  1DM0 B;  5EJW A;  2D2C C;  1U9R A;  5K36 H;  2PZW A;  3PMF A;  3GP7 A;  3VR5 A;  3I73 A;  3BDL A;  3MFG A;  1JQY D;  1ILP A;  1IYU A;  1GUW A;  1VMC A;  4BY7 B;  3W2D A;  4EQN A;  1MSG A;  5M3F B;  2A6E D;  3TZD A;  2ICE C;  2K33 A;  5D65 A;  1S5B D;  1IW7 D;  3N6R A;  1EY4 A;  2C5C A;  4OL7 A;  1SSO A;  4L63 B;  1BCP B;  5C44 B;  1PRT F;  2F0F A;  3TN2 A;  3BVZ A;  1D5X C;  1SEB D;  1JE4 A;  3I4M B;  2DNC A;  1NR4 A;  1FNV A;  1S5C D;  4C3I B;  4IQZ A;  2PO4 A;  3M4O B;  5FLX E;  3GO5 A;  1SYD A;  4DK0 A;  3OMG A;  2KVM A;  2YU9 B;  2MJ8 A;  2EJF C;  2F1M A;  3P75 A;  1B9M A;  5M3M B;  3RZO B;  2OF1 A;  4Y7N B;  3BYY B;  4BS9 A;  1O7L A;  1Q8I A;  4QUF A;  4KJN A;  3SDZ A;  3Q6S A;  1Q90 A;  4S3S A;  3J7Y W;  3TBI B;  2AWO A;  1PTO C;  4TKO B;  4OO1 I;  4RCO A;  2L0C A;  2ZXP A;  4KTA A;  4XT1 B;  3SR1 A;  1CT1 D;  2M2L A;  2LS0 1;  3V05 A;  3QJY A;  5I2Y A;  3S16 B;  1HA6 A;  5CV9 A;  4BA1 I;  1CQF A;  3HOZ B;  2K1B A;  3J7A F;  1O7Z A;  1CHQ D;  2AWN A;  3GTJ B;  4CBV A;  3A8J E;  3IAY A;  4KK7 A;  1STG A;  5KYI A;  1H9M A;  2OT2 A;  2KA7 A;  4M8A A;  2Q8R E;  2RSO A;  3X3N A;  2F0M A;  3DEP A;  5I9O A;  3EA6 A;  1PFM A;  1EY8 A;  2FMC A;  1SNQ A;  1BF4 A;  4A3E B;  1HTL D;  3HG9 A;  2E2H B;  4IFD G;  3FDT A;  5G3L D;  1UAP A;  5I2X A;  3P20 A;  4ZKB B;  3KLR A;  3M7G A;  2HDM A;  1BXT A;  5NUC A;  4BBR B;  1R9T B;  3VR6 A;  4QF4 A;  1TWA B;  3SEB A;  1CQV A;  4UAI A;  3O13 A;  1Z47 A;  1CZW A;  3BZD B;  3S2H B;  3G6J B;  3HOV B;  4BY1 B;  4RGN A;  3TME A;  5ELE A;  2L5T A;  4A3G B;  1G8Z D;  5EGT A;  4A3D B;  4OIJ A;  1KDA A;  2K28 A;  5G3L F;  5C4J B;  3QIA A;  4IN3 A;  1F9S A;  4PQX A;  1FNU A;  1HFG A;  4HMI A;  3QB3 A;  1WTR A;  4KI0 A;  2R7Z B;  3OWF A;  1SJE D;  4LJZ C;  2M9V A;  5FO8 B;  2Z4H A;  3MWY W;  2EYJ A;  1SMY C;  4FNF A;  5E1F A;  3H09 A;  1RDP D;  1GUS A;  2PYK A;  1STA A;  2JA6 B;  1RTO A;  4ZRZ A;  3FKI B;  2OEO A;  2K7V A;  1OXU A;  1NAP A;  2E2D C;  4RH6 A;  4V0B A;  3VA5 A;  1TWG B;  3ND8 A;  5FO9 B;  2B2T A;  1Z7T A;  3PUV A;  4V19 0;  2ENB A;  2EYL A;  5KGU A;  2H4O A;  4RHR A;  1PZJ D;  1ESF A;  5I6W A;  2MHV A;  3R2I A;  2EE1 A;  1G2T A;  4FXD A;  5JVH 3;  5IT9 E;  1A3U A;  2K5Q A;  3NTH A;  5CC4 A;  1TS4 A;  1EWH A;  2JEB I;  2AQ1 B;  2IL8 A;  2VB3 X;  4ZQ3 A;  1WD0 A;  3GTG B;  4K5W A;  2NTS A;  1JIC A;  1LT3 D;  2A69 C;  2K5W A;  3OIP A;  1Y69 U;  4DAV A;  3L9A X;  5T1I A;  5CV4 A;  5JVG 3;  3L7Z C;  4CKB A;  1HUN A;  2JE6 I;  1PRT B;  2NZ1 D;  5A2Q L;  3DUZ A;  3VYR A;  3QG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...